3W6VA

Crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
SDPLAEVVAWALEHLHEQFDVETLAARAYMSRRTFDRRFRSLTGSAPLQWLITQRVLQAQRLLETSDYSVDEVAGRCGFRSPVALRGHFRRQLGSSPAAYRAAYRARRPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription activator/dna
molecule keywords AdpA
publication title Complex Structure of the DNA-binding Domain of AdpA, the Global Transcription Factor in Streptomyces griseus, and a Target Duplex DNA Reveals the Structural Basis of Its Tolerant DNA Sequence Specificity
pubmed doi rcsb
source organism Streptomyces griseus
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3w6vA00
2AO9A 3BTIA 3GTPJ 3LSGA 3JRDA 5HODA 2EQRA 4RBOA 2ME0A 5C4XJ 1IDZA 2DA7A 4MLOA 3LSJA 2EZIA 2HXOA 4QTRA 5C44J 4B1RA 1I50J 3HEFA 1JKRC 5EGOB 5EG0A 1I6HJ 4XRSG 2R92J 3HOZJ 2COBA 2YU9J 2LKXA 1UG2A 4HNVA 5GPAA 3WHBA 2LLKA 5IP9J 4AYBN 3A03A 5FKLA 4D7MA 2Y0SN 5EEAA 2XGCA 5EGOA 1NK2P 1ENHA 3TP0A 2CUEA 2HOSA 3LNQA 1HCRA 2L0KA 2E19A 2OF7A 2XGDA 1GVDA 4A3CJ 4QSHA 5J1YA 1B8IB 1XS9A 3BQYA 1SFOJ 4JX4A 2ZB9A 3F0CA 2JA6J 2K9NA 2EZKA 5M5XJ 1B8IA 5K7ZA 2HOAA 3E7LA 2FX0A 3UKGA 1UHSA 3SJMA 2X6OA 5EF6A 5GP9A 1D5YA 2MG4A 3BT9A 1F36A 1U9NA 5JLXA 5J1RA 1FIPA 1ZGWA 2MW8A 1IRZA 2R5ZB 2H1KA 2JN6A 1ETQA 2JA8J 5K7FA 2LFBA 4I6ZA 5FKMA 2AHQA 1IUFA 2GLOA 2JA7J 2X9DA 4BY7J 3BR6A 3FK7A 1XC5A 3JRFA 4A3LJ 1X2NA 2R5ZA 4A3KJ 2O7OA 1OJLA 5JLWA 1ETKA 2R93J 5K7HA 2ID6A 1JJ8C 2NS7A 5FKKA 1RKWA 4B4CA 2DMQA 3LSPA 1MBJA 3C2BA 2XB5A 4AC0A 3S17J 2EZHA 4X1EA 1GV2A 2DTZA 1GUUA 2HYJA 3QPSA 3S1NJ 3S16J 3JRCA 2TRTA 5F27A 3CCYA 2CJJA 3ZQGA 4A3BJ 2VKEA 1BJZA 5IOZA 3BTJA 4FE7A 1Z0XA 5IYDJ 1OCPA 3B6CA 5M3MJ 2IAIA 3QQAA 3O8HA 4C3HJ 3BG9A 4D5CA 4A3MJ 3BTCA 2N8GA 2XGEA 4DYQA 1MSEC 1IJWC 1NTCA 2WV1A 5J3LA 2NS8A 3TP3A 4JP0A 1BA5A 3S2DJ 1DU6A 3IV5A 3A01B 4IEJA 3HBLA 1TC3C 3S14J 1ETWA 2GM4A 2LK2A 1MBKA 2ME6A 1H89C 3SFIA 2W48A 3A01A 3GTKJ 2HXIA 1IDYA 5BNGA 3PO3J 3LSRA 1HLVA 1WH5A 1JJ6C 2CQXA 1WGXA 4JX5A 4M3BA 3MN2A 4I76A 2MSYA 4A3EJ 1MBGA 1APLC 4DZJA 4LOCA 3CDLA 1Y1WJ 3GTLJ 4V2FA 1CQTA 1SANA 2M9HA 1WH7A 4FE4A 2E2JJ 2NVTJ 2VPRA 2EH3A 2VUMJ 4BBSJ 3DCFA 2DA2A 3B6AA 4S0HB 1RR7A 1K61A 1NK3P 1PUFB 2JWTA 2CU7A 3HOYJ 2XB0X 2NVQJ 2Y30A 4FTHA 2JK3A 4FISA 4C3IJ 4W97A 1ZR4A 1TWGJ 2DMNA 4CYCB 1PUFA 1ZR2A 2IBDA 1S7EA 3ZQCA 3S1QJ 3H0GJ 3SDGA 4M3GA 3OIOA 1MH4A 4IHXA 2ELKA 2LD5A 1VI0A 1WCMJ 2G0EA 5E3NA 1VF9A 4W1UA 1OFCX 3RQIA 4DZPA 3NARA 5F04A 5FKNA 1Q1VA 1FTZA 3BQZA 2K40A 4MFDA 5C3EJ 5IYCJ 3S2HJ 3HB9A 1DU0A 2JMWA 3D1NI 4M6VA 3Q0UA 2XSDC 4XRSA 5J1UA 4MO7A 2D5VA 2M0CA 3HOUJ 1JTYA 1MBFA 1K83J 1U78A 5FKOA 2Y2ZA 4J19A 3I4NJ 1ZK8A 1H88C 1POGA 1JUPA 3JRIA 2L9RA 4A93J 2P81A 5E3LA 2R7ZJ 3JRBA 2B63J 2R5YB 3M4OJ 2E2HJ 4NDLA 3WHCA 4A3GJ 3FK6A 4IHYA 3RKQA 5DTDA 2L7MP 3BG5A 1GV5A 3IH2A 1LE8B 3K7AJ 3Q3SA 4XK4A 2DA3A 2MGQA 1GT0C 3HGGA 3ZQLA 3M3YJ 2R5YA 5EYRA 2LY9A 3W6VA 1W0UA 1MBHA 1ZTRA 4RDUA 1WPKA 1ETYA 4DYRA 1LE8A 1JTXA 5F1JA 2HOTA 2LP0A 3TW6A 3JRHA 4A69C 2L7ZA 1MNMC 2M8GX 3PO2J 5IPAA 1X2MA 1U9OA 3GTQJ 2FQ4A 3IH3A 1VNDA 2DN0A 4BY1J 2CRGA 3A02A 3FKIJ 1HF0A 2KT0A 3MKLA 2FJ1A 2YS9A 3G1OA 1H8AC 1OCTC 3HM5A 3JR9A 4X6AJ 2ECBA 1TWHJ 1YRNB 2L7FP 4BXXJ 1LFBA 5EZGA 1IGNA 1JT6A 2E2IJ 1JUMA 4IHWA 3K2AA 2NOGA 4FCYA 3RZOJ 2DA1A 1YRNA 2Y9YA 2VI6A 3G1LA 2M2EA 3H3VK 3TW7A 3HKZN 3IH4A 2ECCA 3BG3A 2K9QA 2FD5A 3NAUA 4XICA 1RESA 1JKOC 5GPCA 1U8BA 3L1PA 2Y31A 3CQZJ 5IOYA 2O8KA 4UUSB 5F0FA 2PMZN 1FTTA 3LOCA 4DW6A 4M3DA 1Y1VJ 1VFCA 5DS9A 4MIMA 5C4JJ 3GTOJ 1BW6A 2YUSA 3HOVJ 1JGGA 3S1MJ 4UUSA 1RKTA 3HOWJ 4A3JJ 1QRYA 1JT0A 1G2HA 3JREA 1ZQ3P 2GBYA 4UUTA 3JRAA 1B72B 1ETVA 1QVUA 4A3FJ 1R9TJ 3GBGA 5F0CA 2DMPA 2Y9ZA 3O8GA 1Z77A 3ZQFA 1LFUP 3ZQHA 5M3FJ 4A3DJ 1AU7A 1P7JA 4CYCA 3Q0WA 1B72A 1RPWA 5F0HA 1FIAA 2K9SA 5FLVA 3BR3A 4BKXA 3GTGJ 2ID3A 2DA6A 4D5FA 1ORKA 1T33A 4C3JJ 2DA5A 3GTJJ 2HI3A 2EBIA 2M34A 1WI3A 2WB1N 3CMYA 2XRLA 4XIDA 3MVPA 2NVXJ 1MH3A 3ZOBA 2DA4A 2I10A 3FIWA 4ABZA 2WAQN 5IYBJ 1I3QJ 5M5YJ 2DMTA 4L5EA 4XRMA 5FJ8J 1JKPC 1AKHB 2HQ5A 1FEXA 4JX6A 3OSGA 4M3FA 3BR0A 4GFBA 2RAEA 2VKVA 3FISA 4D7NA 4QIWN 1BL0A 3S15J 2DMUA 4DYCA 3TEDA 2XPUA 1AHDP 2HDDA 3GTMJ 1ZKGA 5M5WJ 2JJ7A 1AKHA 2R0QC 5FLMJ 5EDNA 1IC8A 1EF4A 1HOMA 1A6IA 2XPVA 3VPRA 5IP6A 2OPTA 2H8RA 2NVYJ 1IV6A 1ETOA 1ETXA 1XG1A 1MSFC 1TWFJ 2QCOA 5E3MA 2E1OA 3BR5A 4EEFG 1W0TA 1ITYA 2O9LA 2XPWA 1X58A 2CUFA 2KDZA 1E3OC 3JRGA 4A3IJ 4M3EA 3BR1A 3HGYA 1QVTA 1RETA 4BBRJ 5E3OA 2CQQA 3ZQIA 1JUSA 2X48A 3BTLA 4MFEA 3G1MA 2TCTA 4G12A 2IEKA 3OOUA 3QPLA 1GDTA 3S1RJ 1HDPA 1O4XA 3OSFA 3HOXJ 4IHVA 3BR2A 3PM1A 3I4MJ 1IG7A 1UMQA 3RZDJ 1A5JA 5EZHA 1P7IA 5IP7J 2JA5J 1F43A 1MBEA 1HDDC 1TWCJ 4Y52J 4C2MJ 1FJLA 4JYKA 1T56A 2LVSA 2DJNA 2LR8A 5F08A 3HDDA 4B3AA 4Y7NJ 9ANTA 1JKQC 3Q0VA 4AUXA 4V2GA 2QF7A 5EG0B 3DEWA 1BW5A 2LTPA 2EZLA 1TWAJ 1QPIA
chains in the Genus database with same CATH superfamily
4LJZF 4S05A 1QO0D 2ZMEA 4E7IA 2MFZA 4AD9A 2ME0A 3I9V2 1TQMA 2VOPA 2F5CA 3DF8A 4I98B 3KP6A 2EA2A 1K4TA 4QTRA 2HXOA 5C44J 1ZG1A 1JKRC 3HEFA 2GXGA 5EGOB 4HEA2 3FHZA 3NWTA 1P4WA 4KUMA 2KLOA 2R92J 4PCQA 3HOZJ 4GXOA 4LITA 2OCEA 3FKJA 5GPAA 1A6QA 3OS0A 3DKYA 1D0XA 1V5FA 2Q0OA 1R7JA 2KZGA 1FMVA 2VBYA 5FKLA 1PP8F 2KP6A 2WAEA 2Y0SN 4XL9A 2E7WA 1NK2P 1KONA 2CUEA 2AXLA 3FM3A 3K4BA 3LNQA 3H5RA 2OF7A 1GXPA 1BR4A 1GVDA 4A3CJ 1O3RA 5KAFC 1HKQA 2FF4A 2VJIA 1J09A 1ON1A 2QSFX 4NC7A 3AKZA 2A3SA 1SFOJ 1BOBA 4CCMA 3KP2A 4E7LA 3OYJA 5ED4A 4JX4A 3QYEA 1SD6A 4AYBA 2R7RA 4J00A 4RMNA 2K9NA 1W36C 1UHSA 2KPMA 4MQ9F 1U8RA 1YS6A 1WJBA 1U9NA 4EJUA 5JLXA 3F8NA 3WTWC 1IXRC 5H2FC 2HFHA 2XSJC 1DDNA 4RAFA 2HEOA 4XM3A 2VJJA 4CA0A 1XPXA 1S7OA 3HC7A 1IUFA 1O7FA 4CCLA 2GLOA 4XLCA 5H6RA 1XC5A 5FGMA 2O7OA 1OJLA 3S93A 2LNBA 2FSWA 3KP3A 4KT5C 5HLHA 2H6CA 4B09A 2VIXA 3H0DA 2ESHA 2OBPA 3I53A 4BUPA 4B4CA 1WJ5A 2XB5A 2KJBA 3KLOA 4ITVA 4AC0A 2EZHA 2DTZA 3CCRI 3J7ZI 1XGOA 1G6NA 5FLXK 3QPSA 3S1NJ 1W7PB 4G9YA 2TRTA 5F27A 1MKMA 1XMAA 5JI6A 1I39A 2JUCA 2QBYA 4YFXF 1Z3XA 2D45A 4LB6B 1D1BA 1OKRA 1R6RA 3ZN0A 1OCPA 3B6CA 5M3MJ 2FMYA 2GA1A 2QKMB 1O3SA 2WV1A 3A1YA 2V7FA 4G7OF 1Y56A 2DK8A 1RR8C 2VOOA 4JP0A 2M3AA 4IRIA 2XUBA 3EUHA 5TISC 4CXFA 1XDSA 3PL8A 2KIUA 4FX0A 3FF5A 3L2VA 2P7CB 3SEQA 1QHHD 4WK8F 5HVQC 3NRVA 3E3VA 4KITB 3E0JB 2W48A 3A01A 2CW8A 3CJNA 5BNGA 3PO3J 4R79A 1WGXA 2X6YA 5GAGJ 4ZYAA 1K6OA 2DT5A 3HHGA 5J6XA 3Q9VA 1JGSA 3MN2A 2Q2EB 4I76A 2OQRA 4G7HF 2UXNA 4YG2F 3L2WA 1OYWA 3CCMI 5D8LB 2X51A 3IRQA 2MH9A 5GADJ 3PIPF 2M5WA 3UR3C 3K70C 1YIJI 4IHSA 4HW0A 4FHTA 2HKXA 1XCVA 3JTHA 4V2FA 1FSEA 1WH7A 4FE4A 2NVTJ 3A2KA 2QVOA 2EIKH 3CMAI 4BBSJ 5ICGA 4HV6A 3DCFA 2DA2A 3VYTB 1R36A 3HRUA 3R61A 3DBHB 3FXRA 3HOYJ 4RGUA 2EINH 3BOQA 1SVMA 1R1TA 3GUDA 1SAXA 5D5WB 1QZZA 1A31A 1TWGJ 1OR7A 1IN5A 2QEXI 1J0RA 1X1AA 1I5ZA 1X3UA 3CCVI 2PEXA 3HSRA 4A0XA 3RYPA 3ZQCA 4II3A 3RKWA 4M3GA 3WU2C 2ZFWA 3OIOA 2JA2A 4Y33A 5HLGA 1T2KA 4IHXA 3CTAA 3OIQA 2ELKA 3PSFA 1ZYRF 4E7HA 2EA4A 1KU9A 1OFCX 4XLFA 1U3EM 2A68F 1T6SA 1Y0UA 3V8LA 1I1SA 2FXAA 3EUKL 3ROUA 5FKNA 3R0AA 5LGTA 3OY9A 4M74A 2K40A 4U7DA 5C3EJ 2W25A 3OYEA 5DUKA 3PFYA 3IAM2 3Q0UA 3TO7A 4ZYGA 4L5IA 4F92B 3D1NI 2XF7A 2M0CA 3WTVC 1JTYA 1MBFA 3H1CA 3I4NJ 3IWZA 1POGA 5E3LA 1KU3A 4ZZDA 2PJRA 2R7ZJ 2H1LA 2QYOA 2CV1A 1X1PA 2KIQA 2E2HJ 4NDLA 3BPXA 2R7OA 2IPQX 2A6EF 2JPBA 4LB5A 3J7YJ 5DTDA 5LHIA 4XQFA 3ML6A 5CKTA 1Z1DA 3Q3SA 2WAQA 3HGGA 3ONQA 3N05A 3WU0A 4YFNF 1FBSA 1F1ZA 2K86A 3OYNA 2VB6A 2EFOA 2GXAA 1FWZA 3OYGA 4AWXB 2LY9A 2P7VB 4G7ZF 1IXSB 1MBHA 1RIOH 2L7KA 1JTXA 4M9ZA 3JRHA 4A69C 3M07A 1MNMC 2UWMA 1U9OA 2EFNA 3GTQJ 4J01A 4PJ0C 1SEUA 2V9KA 4BY1J 4XKBA 3A02A 3VYUB 4OMZA 1GLNA 2KT0A 3ECHA 2FJ1A 4I7HA 4B43A 1VQ5I 4X6AJ 1TWHJ 3SZPA 4A5MA 1LQ1A 1MD0A 1YRNB 4RLQA 3KEOA 4PDKA 3LSHA 4HX8A 1MDMB 2DFFA 3KX2A 2NAZA 3F3XA 4QLCU 3ISPA 1JUMA 3PQKA 4AVPA 4BE2A 3MQ0A 2K9MA 3DP7A 3BLYA 2DTRA 2K02A 3F6VA 2R7WA 2B7EA 1ZELA 3TW7A 3IH4A 2ECCA 3E5XA 3I54A 2FD5A 3ABTA 3KFWX 3NAUA 3OIPA 3A0HC 2XV4S 4DGWB 4LIUA 5GPCA 3MFKA 4FT8A 1U8BA 5KK1A 3L1PA 5DCMB 3CQZJ 1KU7A 4HPQA 2LY1A 1FBQA 4DW6A 4M3DA 2D1HA 5F1RA 2ISYA 3GTOJ 3D5SC 3DU6A 3HOVJ 2BHYA 1LEAA 1KQ9A 4UUSA 1RKTA 3WTZA 3OOPA 1QRYA 1G2HA 1ZARA 2DFEA 4N0BA 3BG7A 4CCNA 1YQAA 3R0JA 4UV9A 1R9TJ 5LEJA 2X1DA 2PMZA 4EGZA 4U88A 5DM6F 2YU3A 4N9IA 2ZC2A 3F8CA 1MNEA 3FMRA 3ZQHA 4P9UA 1HBXG 1AU7A 3CCEI 4IQ4A 4CYCA 3Q0WA 1B72A 1RPWA 2YSRA 3K10A 5CVRA 5F0HA 4UUVA 1CGPA 3S3OA 2EB7A 2BXZA 2ESNA 3LA2A 3AL0C 1MJAA 2M30A 3OYAA 3E6CC 2ID3A 4OWRB 4ZC3A 3WTXC 1T33A 3GTJJ 2EBIA 2Z5UA 3BC8A 3C2GA 2HGCA 2LMDA 3LA7A 2Y0SA 1S3JA 4UB6C 3H35A 1Y8RB 2LBFB 2XF5A 3MVPA 4B48A 3L2RA 4IHTA 3EYIA 2KRFA 4ABZA 1QU3A 5CQGA 5J8FA 2DMTA 4L5EA 3D5LA 1R71A 5ICFA 3IAS2 1R23A 5FJ8J 1JKPC 1K79A 3H9QA 4Q4ZF 2PI0A 4A5NA 2ZFUA 4Y3OA 4XR6A 3MZHA 2UZKA 4GFBA 2K85A 3FISA 2VKVA 1RRJA 2K5CA 4QIWN 3O3KA 3RSNA 2MC4A 2PFBA 4NUBA 3S15J 2DMUA 2I8DA 2DOAA 2HDDA 4U0WA 4E7KA 1D1CA 1AKHA 1FX7A 5EDNA 1HOMA 1A6IA 3OR1C 5DYMA 2RVCA 1IZ1A 1IN4A 1ETOA 1XG1A 3I55I 1MSFC 3J7AO 2R7FA 3CP2A 1J2XA 4HAMA 3DPTA 3W2WA 4HG2A 1NH3A 1VTNC 1X58A 1YYVA 5FB2A 3LQRA 1JI8A 2F5FA 1LKXA 4EV0A 5HOOA 3K4KA 4YFKF 3A0BC 2XKOA 3JW4A 4YELA 3DXJF 3CO7C 3AG4H 2DPDA 5ERIA 1KGSA 2X48A 2ZXIA 4CYDA 1FSHA 3ZMUA 1ERDA 1BI3A 3TMOA 3OOUA 4I02A 1HDPA 4IHVA 1Y6IA 4M9SA 3PM1A 3QWLA 2JSCA 3I4MJ 3ESWB 2XIGA 2FOKA 1A5JA 2BOLA 1YJWI 1HDDC 2WWYA 3JTGA 4M9XA 4ZH4F 3B02A 3ZCOA 2LVSA 4L0ZB 5E8GA 4RM2A 1ZH5A 4PFPA 1ZAOA 2XHKA 2BVMA 3J80Z 3OYIA 2WY7Q 4IRHA 5B1BH 3ASNH 2HPMA 4EJOA 1JKQC 2QF7A 1U5TB 2DK5A 2EZLA 4HF2A 4B3XA 4F55A 5HDGA 5HODA 4RBOA 4LMYA 3G73A 1IDZA 4KIGA 3KETA 3QRFF 2W84A 4UVAA 2ICWG 2EZIA 2VJ4A 1I6HJ 4B1RA 5EG0A 3GMEA 4C2UA 5CVIA 2DYRH 1X1CA 4F3QA 2PX9A 1XN7A 3QAHA 2IGNA 2CQNA 1YLFA 3A4CA 2W1OA 4Q5SF 4D7MA 1N78A 5EGOA 4RM3A 2KQRA 4XN3A 3PNVA 4E4HA 5DM7F 4IJAA 3DV8A 4ZDLA 2F5DA 2FOWA 3TP0A 2OU2A 2HOSA 2V79A 2YX4A 3I0TA 1S6LA 1EKEA 2XGDA 4CCJA 3WGHA 1B8IB 4RAZA 5JVTA 3BQYA 1FP2A 4WXCA 4HOBA 1W1WE 3K4CA 1S29A 2HVRA 2F4MB 3F0CA 1GXQA 1Z6RA 5K7ZA 3K4LA 4HYEA 2QLZA 3R6SA 2UV1A 1O3TA 5CLSA 1ZRCA 1BBYA 5EF6A 1EH7A 4PSXA 2MG4A 3BT9A 2BBYA 1F36A 2DOFA 4ZTJA 2DT6A 3K4JA 4KICA 1VQKI 3CF5F 1FIPA 1C0WA 1FMWA 1IRZA 3KP5A 3VB2A 2CYYA 1FYMA 2H1KA 1SVOA 2HWVA 1ETQA 3K1MA 2LFBA 5K7FA 3V7SA 2DT7B 2JA7J 1MNDA 4BY7J 3E5UA 3GW2A 1NG6A 3FK7A 3HSEA 3WU1B 5GAEJ 1HKSA 1XCBA 5LEKA 4HF1A 1IN8A 2L9SA 2D1VA 1WWXA 1JJ8C 2EPFA 3CCSI 2GOXB 2DMQA 3OYKA 4L9VA 1MBJA 1B9MA 3LWFA 3QOPA 1UJ8A 2VT2A 1HQCA 1P2FA 1GUUA 3KIOA 3KZYA 3OYCA 3Q9SA 1N75A 1WJCA 1E0EA 3BCAA 4DIQA 2IGMA 3CCYA 3B73A 2CJJA 2Z33A 1X4OA 3C18A 2Z2SB 1X4PA 1KZHA 1G3TA 4LGWA 1BJZA 4RB0A 4R1HA 1W7PA 2DQRA 3EQLF 1E3PA 3BTJA 3CC2I 3WTYC 1Z0XA 4PJMA 5LRRA 1T8IA 4G6DA 1QGPA 3TO6A 3EYYA 3QQAA 3O8HA 4C3HJ 3BTCA 3HPGA 2XGEA 1IJWC 1OISA 1NTCA 2GWRA 2XAJA 2WC2A 3QPHA 2Y75A 3IV5A 1P9QC 4BL0B 4XLPF 2FBIA 5ILUA 2F4OB 2LH9A 4NHJA 2PMHA 3S14J 4ZZLA 1ETWA 2LK2A 1NG7A 5L3CA 1TTYA 1UZCA 1P4XA 4G6QA 3WE3A 3HOTA 4XMYA 1WH5A 3OR2C 1JJ6C 4DBQA 2V1XA 3DBRB 4BEHB 3QODA 1MMDA 3RPQA 1V54H 3TBIA 3F8MA 2EWNA 2IGOA 5D6FA 4BU2A 2XAQA 1R49A 5J4YA 1MW7A 4A3EJ 1IXCA 3RTRA 1APLC 3WG7H 4DZJA 4LOCA 3BY6A 5B1AH 3DWLE 1H9TA 2Q2EA 2V4JC 1CQTA 1SANA 2RC4A 2E2JJ 2MABA 2X6XA 1XB4A 4FETA 4GCVA 3B6AA 2RREA 1RR7A 1XGSA 1K61A 2PJPA 1S8NA 3SQNA 1PUFB 2JWTA 5CYVA 1V5EA 2CU7A 3CD6I 2XB0X 2Y30A 2EK5A 5J8CA 1HC8A 1OCRH 4P96A 3V7RA 2K4BA 2DU9A 1LUJB 3RDIA 1XGNA 2JRTA 4HLXA 3VFZA 2L4AA 5D5UB 2JQ7A 4BDYA 4XLHA 1Z7LA 3H0GJ 1U2WA 1A35A 3MKYB 4OIQF 2M7AA 3KYCB 1YX5A 2W85A 4IRGA 4LD5A 1R58A 3M7GA 3MD2A 4L9JA 2CG4A 4L9NA 2G0EA 4Q47A 1J9IA 5E3NA 1WVRA 4W1UA 1B4AA 3OS2A 1HW1A 1Z3YA 3FM5A 1V3FA 4MTDA 3HPHA 4IXAA 3X2QH 5J47A 4QPOA 1FT9A 2WADA 1HSJA 3NARA 2G7HA 1KQ0A 1XSXA 1X3WB 1Q1VA 2MLKA 2L54A 3RJPA 2ZO4A 1FTZA 2HQNA 4YRVA 3BQZA 3ASOH 1LNWA 2XC7A 5IYCJ 3OYMA 3F9KA 3CCLI 4M6VA 4XRSA 2AXTC 4AIDA 5F6FA 1U78A 2ELJA 1FOYA 1FY7A 2W57A 3SYTA 2EV0A 1SAUA 2W82A 1EH8A 2L9RA 4XOTA 1FYLA 4I2OA 2BXYA 4OMYA 3F72A 2G7UA 3JRBA 1RZ4A 2PLYA 3FXKA 3FX3A 3HRSA 2DDBA 1JE8A 3RKQA 1HSTA 3FXOA 3K7AJ 3DLAA 2DA3A 4AIKA 2JTVA 2NNYA 3K6GA 2DCEA 5EYRA 3W6VA 2P4WA 3ABMH 1VQOI 2E34A 1W0UA 4RDUA 1OPCA 4DYRA 1D3YA 2HOTA 3BROA 1X1DA 4HQEA 3TW6A 1TNSA 1DGRM 2L7ZA 2M8GX 3PO2J 2IP2A 4N9HA 2M4GA 3HUGB 2Y0MA 4WXHA 3UNGC 2FQ4A 3BJ6A 3FMQA 3IH3A 3QU3A 5AIQA 1VNDA 2DN0A 3ELKA 4LG3A 3MKLA 4FX4A 3MKZA 1UCRA 1Q1HA 4GGGA 2RQPA 1H8AC 3MCZA 5DCFA 5IY5H 5E17F 4HNTA 1DP7P 1MMNA 1PUEE 1BR1A 3CUOA 4QWQA 2LKPA 1JT6A 4KISA 2OQGA 2MA3A 3LSKA 3RQ4A 2ZXHA 1R5HA 1YW7A 1YRNA 2H94A 3I4PA 2RDPA 4HRIA 1DPRA 3WTSC 3HKZN 3LSIA 1MDMA 3BG3A 2K9QA 1NHAA 5DEQA 2MD0A 1Z9CA 3FXMA 1RESA 3HJEA 1JKOC 1USSA 2R4GA 3H3UA 2O8KA 1Y0NA 4IPAA 1KYWA 2VBZA 1TZLA 4BHCA 3ZMSA 3ERED 1FTTA 4BH9A 4Y4RA 3LOCA 2QQBA 4PSWA 3ECOA 4MIMA 3FBIB 2EFWA 5JVGF 1BW6A 5DCMA 4IX7A 4A12A 3KCCA 2BZTA 1F5TA 3M8EA 2CS3A 2A61A 2PMUA 2HDCA 4CGZA 3HOWJ 4A3JJ 1S5LC 2M0MA 2KJCA 2DDAA 2P5VA 1ZQ3P 1K7AA 5HLTA 4UUTA 1YG2A 1QVUA 2VJ5A 2HQRA 3GBGA 3DU5A 3J80K 4NNJA 2Y9ZA 5D4RA 1FPQA 3BCBA 4D9JA 2E5ZA 5LGNA 2VONA 3F22A 3ZMDA 5M3FJ 3LA3A 1P7JA 4PFOA 3JAMZ 1ZHFA 3RYRA 2LG4A 3U21A 3L2UA 3GZ6A 3MKWB 4XBFA 2K9SA 5BQTA 3BR3A 3CP8A 1HA8A 4BKXA 5A2QZ 3GTGJ 4G6TB 3DPUA 4E70A 5B5EC 1CF7B 4D5FA 2P5KA 1ORKA 2UUZA 5D5XB 5L3DA 4XSZF 2QM3A 1WI3A 2WB1N 3CC7I 3HG9A 1X1BA 3ZOBA 2BW3B 3LFUA 3FIWA 3OS1A 3FDYA 3FXQA 2F2EA 1TW3A 5IYBJ 1J75A 5M5YJ 4BE1A 2FMLA 2XKPA 4XRMA 3QYBA 2HQ5A 2LBFA 3OSGA 4M3FA 5FRNA 4OIOF 4MEYF 2RAEA 5FFXA 4D7NA 1U5TC 2EIMH 3TEDA 4RGRA 3GTMJ 2KZVA 4KMUX 5CQEA 2KKOA 3F8FA 5CVJA 3WODF 3CC4I 4PJNA 2HKOA 3VPRA 2H8RA 2NVUB 3BJAA 1O3QA 3E97A 2EJRA 2MBFA 4F93B 4EMSA 1L0OC 1YIOA 2HTJA 4OU0A 3BR5A 4EEFG 1W0TA 1G59A 1OYYA 2DYSH 1S9HA 2E60A 1OCOH 2HVSA 2XPWA 5FRMA 1FZPB 1S7AA 2QBYB 5L3FA 3CUQB 2QWWA 3RKXA 3OMYA 3BPVA 2BY0A 4IOAF 1TLHB 4RB1A 2CFXA 3MAJA 4HF0A 1BR2A 4UV8A 2A69F 2PQ8A 5J40A 2WV0A 1LB2A 3S1RJ 2KDOA 3I64A 1KU2A 4BGDA 3OSFA 3HOXJ 5ICEA 1TP4A 1E3HA 1Z91A 3RI4A 1P92A 1IRXA 2M4KA 2HYGD 3RZDJ 1IW7F 3CESA 1D5VA 4X0GA 1XD7A 3VWBA 1F43A 2FRHA 2F5VA 1MBEA 2VL8A 4Y52J 4C2MJ 1T56A 3K4MA 3I58A 1K6YA 2DJNA 2VT3A 1FLIA 2FE3A 2LR8A 4F52A 3HDDA 1B1BA 3OL3A 4NB5A 4YIIA 4GDFA 4AUXA 1ON2A 3L2QA 2AQEA 2DFIA 4V2GA 3VDXA 2ZXJA 2OZ6A 5LBQA 3KZZA 2WY8Q 2IBDA 3WGIA 4LG0B 1MIJA 2AO9A 3BTIA 2OC6A 3LSGA 3JRDA 1J59A 3PNYA 2QGUA 1B6AA 5C4XJ 3DTKA 2R7UA 3LSJA 1YW9A 2FEZA 1I50J 1U5TA 2CUZA 4XRSG 3GVAA 2EIJH 3K69A 2COBA 2EV5A 1WHUA 1UG2A 3WHBA 2LLKA 3SZTA 3NQOA 4HBLA 1QZEA 4BQQA 4AYBN 4ESFA 2HZTA 1LJ9A 3A03A 3FXLA 4L9TA 4CCKA 3V42A 5EEHA 3H92A 2XGCA 3PUFA 2LF7A 3S8PA 2CGPA 3OYDA 4HV5A 3CLQA 3BP8A 1HCRA 2L0KA 2E19A 1T38A 3C3WA 4Y17A 3JSOA 4U7BA 4BACA 4EJVA 3MZ8A 1A04A 5J1YA 1XS9A 3FMSA 3ULQB 2ELHA 1AWCA 2ZB9A 1HW5A 2NOJB 3ZQ7A 3OYHA 2JA6J 1WFXA 1XMKA 1B8IA 4V19K 3C1DA 2FX0A 3UKGA 3MEXA 3L9FA 1Z21A 1D5YA 3PFIA 4EQQA 1R00A 1G3SA 4GYGA 5J1RA 5K5RA 5GTIC 5JHUA 2R5ZB 2XAHA 1D0ZA 5D6EA 2OTJI 3CZ6A 2JA8J 4JOMA 4I6ZA 3F6OA 5GTHC 2AHQA 2HDWA 2L5QA 3MWMA 3U2RA 2NRAC 1WZ2A 2KMUA 3WE2A 2MD5A 3DPLC 3BR6A 4A3LJ 1X2NA 2HZDA 1JHHA 2M1BA 4C30A 5ILVA 4F7ZA 1ZLJA 3G71I 3H5NA 5HNFA 2R93J 2VPLA 1SD4A 3ERMA 4KA4A 2DW4A 5FKKA 2E5NA 5H20A 5FROA 3LSPA 3C2BA 3TOAA 4U0VA 4D1QA 3L2CA 3S17J 2EILH 5BS6A 4M73A 4X1EA 5DUIA 1GV2A 1YTYA 1T98A 5EEGA 2HYJA 3S16J 3G4SI 2DQLA 2YPRA 2QKLB 4L0YB 1SFXA 1PYVA 1YFHA 3CCQI 1G8XA 1I1GA 3DKXA 3ZQGA 2ZCWA 4WWCA 2HNHA 3FHNA 2A6TA 2C6YA 4A3BJ 2VKEA 4WCGA 4AVZA 1SVLA 3VOEA 5IOZA 3REOA 2XAFA 5IYDJ 1W4MA 3F21A 2IAIA 4BJTA 4D5CA 3BG9A 4A3MJ 4DYQA 4KMFA 2UXXA 1QA6A 3CLOA 5HDKA 4BQOA 1Z67A 1VQNI 3S2DJ 3U9GA 4IEJA 3HBLA 3M1EA 4CSWA 1BI1A 1TC3C 2GM4A 2GXBA 2ME6A 2WAFA 4P9FA 1H89C 4B47A 2B9SA 3J81Z 1WJDA 5CPRB 2HVQA 4P5OA 2J5OA 4XKVA 3GTKJ 2HXIA 2OA4A 2F6CA 4E7SA 4JQFA 1HLVA 4NBQA 3DTEA 1UELB 5HNHA 4U87A 1VQ7I 2A05A 2VBXA 3IUOA 5TGTA 2O5RA 4M3BA 1FOKA 3HXLA 2V1DA 2XASA 4XKCA 3M1CA 3W3CA 3GFMA 3PSIA 4PGHA 2DJIA 3CCUI 5JR3A 3M8FA 2MSYA 5LD2C 3KP7A 3I71A 3IL2A 1QQIA 4II2A 1YS7A 4BEHA 1MBGA 1Y1WJ 2Z99A 3GTLJ 1ZGAA 4HSTA 3I56I 2VPRA 4GO1A 1IAWA 2EH3A 2VQLA 1S72I 2NYXA 2L01A 4N4NB 5GAHJ 3E1SA 3HKZA 2O0YA 2JK3A 4FISA 3I5UA 3CMEI 2B0LA 2OJED 1ZR4A 3QP6A 5LLQA 2VE8A 4CYCB 4IL6C 3RPUD 2H27A 4FASD 2DAOA 1XSDA 2CW7A 4C2TA 1PUFA 4ESBA 2Y48A 1UHMA 2X4HA 4PJJA 2IJLA 1OCZH 2YR2A 4WF2A 3IRRA 1ZREA 2VXZA 4XSXF 4XLAA 3S1QJ 4JK1X 3QP5A 1R1UA 1QPMA 2Q8KA 1VI0A 3FXUA 3S32A 1RUNA 2IS2A 1O7LA 4OAYA 2D2WA 1YO5C 4NC8A 3HZJA 2RGVA 3LSTA 3ABUA 4HZFA 2RV8A 2LC2A 1PP7U 4PK4A 5L3GA 1VQ4I 1ULYA 4BAYA 4G8XA 2CUJA 3JCUC 5E20A 3WTTC 2FNAA 2QENA 4MFDA 4XN0A 3CF2A 3GCMA 5KNLA 3ZP5A 3HHHA 2XSDC 1YI2I 4Z6YA 2VODA 5J1UA 4KFCA 2D5VA 1O57A 3HOUJ 2BGCA 4I0BA 2XAGA 1K83J 5DDGA 2Y2ZA 1IF1A 3DKWA 4ENKA 1ZK8A 2GAUA 1H88C 2L9VA 3IKVA 1D0YA 3JAMK 3HIFA 4H4KC 3JRIA 4P1WA 4A93J 2P81A 1DGWY 2EFQA 3H5AA 2B63J 4UVBA 2R5YB 1V55H 2V1NA 5A2QK 4A3GJ 1DPUA 4YIRX 2HTSA 3SEZA 3IH2A 3BG5A 1GV5A 5D4SA 1YHQI 1LE8B 2STWA 1KA8A 5FO5A 4XK4A 2F4IA 4BQNA 2MGQA 2JRMA 4CCOA 1P6RA 2P0WA 2QA4I 5BPIA 4O6JA 4ZJZA 1U6GA 1ZTRA 1YE9A 3V8JA 1OYIA 1ETYA 1WPKA 2NS0A 5F1JA 4CO8A 3CCJI 5CVVA 1PJRA 4BXFA 3CMMA 3WGGA 5IPAA 1X2MA 2BY3A 2E71A 3KEYA 2CFOA 2KRCA 1QZYA 2CRGA 3FKIJ 4ANJA 5E8IA 3G1OA 4I0AA 4JBAA 4NQWB 1OCTC 2Y69H 3HUGA 3K1PA 3HM5A 3GFLA 4A6EA 3ZGKA 2KL4A 2L7FP 4BXXJ 1LFBA 1MMAA 3BDDA 4UHTA 5EZGA 1J5YA 2ACJA 5LRSA 1W5TA 4AIJA 3PQJA 4BJ5C 1K78B 1LVKA 2L9NA 3K2AA 2CW0F 3O6BB 5KCMA 4IHWA 3FBNB 4EM0B 3P9CA 4PUSA 2R7DA 2DA1A 1VQ9I 3RZOJ 2Y9YA 2VI6A 1WSUA 2MC3A 4ZYHA 2M2EA 4RB2C 3I59B 4F91B 1ZG3A 1ODDA 2Z16A 4L5JA 5F64A 3AAFA 4XICA 2XVCA 1SFKA 2STTA 4B44A 2Y31A 5TRDA 2JT1A 2DLLA 5F0FA 2PMZN 3DLLF 1UB9A 2COMA 4ZYDA 5FFZA 1Y1VJ 1VFCA 5DS9A 1USTA 5IT9Z 2EFPA 4BDZA 3EUAA 3NWSA 4B8XA 2KRHA 2HU9A 2P8TA 2IA1A 1JT0A 4BE0A 1SFUA 3JREA 2GBYA 2HPIA 4DQ2A 1ETVA 4A3FJ 1TBXA 3CUQC 4E7JA 1G3YA 4AM3A 3HL2A 2DMPA 1I27A 2LSOA 4KIFA 2E36A 4KIBA 1J7KA 3W2AA 4Z2YA 2K7LA 3KLNA 4A3DJ 3LFKA 2WA0A 3DQVC 4AIHA 4S04A 4U0YA 2IT0A 5FLVA 1BIAA 2ISZA 3DFGA 3HTSB 2L4MA 3FZVA 2MH2A 3QOEA 3EUHC 3G2BA 1T08B 4C3JJ 5HLIA 2HOEA 2CMPA 1T39A 1P4AA 4BS9A 1B9NA 2XRLA 4XIDA 2NVXJ 1MH3A 1R4NB 2DA4A 4RAYA 4HLYA 1CF7A 4RA2A 3TOBA 5E79C 3L7WA 2JZYA 5ILSA 1FEXA 1EV7A 1W36D 2LKSA 4JX6A 5KHDA 1IO2A 5L3EA 3TKYA 3BR0A 4A2UA 2BW3A 3P9KA 1VQ6I 1YJ9I 4DYCA 2XPUA 1AHDP 5M5WJ 2BY2A 2QQ9A 3T0YA 2JJ7A 2R0QC 3I3LA 4M71A 1IC8A 2J5PA 1MMSA 1EF4A 5IP6A 1IN6A 1JXSA 2NVYJ 4ENMA 4XLEA 2IA0A 3TL4X 3W6JB 5IT3A 3R4KA 1ETXA 3OV8A 5LHGA 4IQJA 2KIFA 2V1UA 3H9GA 1TWFJ 4EM2A 1SD7A 5E3MA 4EGYA 4M6YA 2E1OA 5E1XA 1ITYA 3OYBA 2O9LA 2CUFA 2KDZA 1E2XA 3F23A 4KDPA 3G3ZA 3COAC 4A3IJ 6PAXA 2VKDA 4M3EA 4CICA 4ZDPA 2RNJA 4IF4A 2X0LA 1ZGJA 1RETA 4LIVA 2CQQA 3V4GA 2DBBA 1OR7C 2O8XA 4ETSA 4MFEA 2CSOA 3W6KB 2X85A 1VZ0A 3CUQA 3QPLA 2A5YB 2BHZA 1GDTA 2BYVE 4K2EA 2DFHA 1PDNC 2FU4A 4UXNA 3BR2A 1BC7C 1RNLA 3P7NA 1IG7A 2LF8A 1FYKA 2IVMA 3MMYB 1P7IA 5IP7J 2JA5J 1OMIA 1TWCJ 2K9LA 4DNCA 2OTLI 1RUOA 2QSGX 4ESJA 1OCCH 4JYKA 3PIOF 1Z7UA 2P6SA 3BWGA 2IW5A 3KE2A 4ZTFA 2R7TA 2PBIA 3KYDB 2ZMEB 3QU6A 4EATA 4B3AA 4Y7NJ 4CZCA 9ANTA 2H09A 2RNGA 1TW2A 3H3ZA 4MQVA 3EETA 1I6XA 2RKHA 1T95A 1Z6TA 3EDPA 2CWEA 2BY1A 2YX7A 2LTPA 1BL0A 2R7SA 1L3LA 2CH0A 3TQNA 1QPIA 5ICCA 3GTPJ 3VYSB 2EQRA 2DA7A 4MLOA 1SFEA 1OLTA 4HQMA 5BMZA 1JHFA 1R1VA 3BG6A 2CV0A 5AIPA 4LG0A 2LRDA 3GZ5A 5BPDA 2L2OA 1TT5B 4PZJA 1I3AA 5K5QA 2JUGA 2YU9J 2GOMA 3HSFA 5AONA 4HDUA 1WJFA 2LKXA 4HNVA 4M6XA 2VN2A 3V8KA 5IP9J 3GXOA 3AG2H 5EEAA 3ZMZA 3SXYA 1ENHA 2E7XA 2DPUA 3J81K 5LHHA 1BIBA 4I99C 3N97A 2CV2A 4QSHA 1ONVA 3K70D 3AG1H 1A36A 4KJZA 3HTUA 3MZYA 3ZR8X 3LAPA 2O03A 2OUMA 2E1MB 2ZNZA 5JHFA 3GYHX 4CH7A 3P5JA 4DJAA 4LK0F 4IVNA 1ZG5A 2ZJ2A 2EZKA 4BYYA 5M5XJ 1RI7A 4OAZA 2GQQA 2HOAA 4LLNA 3E7LA 2CO5A 3KEQA 3SJMA 2AS5F 2X6OA 3E5QA 1R5GA 1EA3A 5GP9A 4KNYA 2LREA 2M8EA 1PVEA 1WKMA 1MJ9A 4OIPF 3HYIA 2MW8A 1FC3A 2QQAA 2VQHA 3C2HA 1ZGWA 5E18F 2K3FA 2JN6A 4H0EA 1D8KA 3M9AA 5FKMA 3O2PE 1GVJA 4I01A 2IGKA 1M1EB 4BNCA 2X9DA 4HNUA 3KZIC 4OINF 3JRFA 1D8JA 2R5ZA 4A3KJ 2QUFA 2XGXA 5JLWA 1IN7A 1ETKA 2CQ7A 3ZMVA 5K7HA 1T0FC 2ID6A 2LY2A 3ABKH 3NEUA 1RC9A 5TJJA 2NS7A 4EJTA 1RKWA 4XLNF 2ZJRF 4RAGA 1TNTA 3GLLA 4IOCF 1FOWA 2FBKA 5J4VA 4N4OB 3DEUA 3KYLA 4HX4A 3JRCA 3ZN1A 3VYRB 1TT0A 2O6GE 5HDNA 2DODA 4ENJA 2KIMA 2BVLA 5HS7A 2ZSHB 4BJ6C 4RB3C 2O61A 2RN7A 2XRNA 5E1ZB 2KFDA 5FD5A 5LFAA 3ZXSA 2ZJPF 1OQYA 4FE7A 3F8BA 2V9PA 2Z1DA 1SC7A 1XDUA 2W00A 1QHGA 2QZ8A 4E6KG 1HW2A 4G94A 2N8GA 2X1EA 3TO9A 2R3SA 1MSEC 1BOAA 3LAJA 5J3LA 2NS8A 3TP3A 1BA5A 1DU6A 4NC6A 5FD6A 4P55A 5B3SH 3A01B 2ETHA 4RGSA 2HR3A 4OIRF 1MBKA 3T1BA 2BEOA 5JFRA 2L3DA 1YJNI 3SFIA 4TV7A 3S2WA 2VE9A 4UVCA 3ABLH 2XDVA 1G4DA 1IDYA 3LSRA 5K5OA 2CQXA 3SDBA 3IP4B 1XTAA 3DEEA 4XKWA 1E17A 3KP4A 3GO5A 4JX5A 1ZLKA 4ZDOA 2VLAA 3R60A 2TDXA 2LDUA 2XF6A 5B66C 3GFJA 1AA7A 3LQQA 3HRMA 1Y8QB 4GYIA 2OZUA 3PJRA 3HRTA 1ZRDA 2FUG2 3E6DA 3CDLA 2V9VA 1IRFA 4IZZA 5DD8A 1T0FA 3TGNA 2M9HA 1IRGA 2HQAA 4IKFA 3M8JA 3CO6C 2VUMJ 4XRFA 2BE5F 3GZNB 1QBJA 4S0HB 1NK3P 3K9TA 4BXUA 2NVQJ 4O5VA 1YW8A 4FTHA 1STZA 2HYFA 4C3IJ 4W97A 3U1DA 2M87A 2DI3A 3AG3H 1GHCA 2R7XA 2OAZA 2DMNA 3DBLB 1EJ9A 4OOIA 3CJRB 4DBRA 1YOVB 1WJAA 4EJWA 1ZR2A 1F9NA 3GEZA 4KN4X 3GLXA 2H8WA 1S7EA 1LEBA 2IA2A 3SDGA 2DO7A 1DP3A 3D5RC 1MH4A 2VQGA 1U0JA 3V7CA 1ZN2A 4R8HA 3ZMTA 2LD5A 1WCMJ 4ZYEA 5FLXZ 2A5WA 2JSPA 1VF9A 1KYZA 5IT9K 2W4SA 3RQIA 1G3WA 2I5UA 1Y39A 3S3MA 4DZPA 3WTUC 4EM1A 3ZPLA 4MNUA 5F04A 1LPQA 1V5GA 2FBHA 5KVRA 2V26A 2V6EA 3S2HJ 1BI2A 3HB9A 2JMWA 1DU0A 2PJRB 2H6BA 2E1CA 4L18B 4MO7A 2K4JA 3S3NA 4M72A 3TDUC 3LSMA 5FKOA 4J19A 1N25A 2IS1A 1LDJA 5CJ9A 3IWFA 1WJEA 2KISA 2Z3YA 1JUPA 4BHBA 1Z05A 2W7NA 1DUXC 1VQ8I 3M4OJ 2IRFG 3WHCA 2OD5A 2VC1A 3FK6A 1WQ2A 3K0LA 3VSLA 1SMTA 4IHYA 1XMXA 2L7MP 2XAUA 4UNOA 3VSKA 2G9WA 2VKHA 3HOSA 4MHGA 1REPC 1GT0C 5HS8A 3Q5FA 3ZQLA 3M3YJ 2R5YA 3CDHA 4MEXF 2XROA 1LDDA 1R5ID 1LE8A 1IV8A 2OCCH 2F48A 3VODA 2LP0A 1TQIA 3ZRGA 3QYFA 2P5LC 1H0MA 3G6EI 4KT6A 2MYSA 2X1CA 3OL4A 3OYLA 1QNTA 2M7BA 2CQKA 2GZWA 2VXDA 4GRIA 4LLLA 2FQ3A 3T8TA 3L00A 4Y13A 5D8KB 1HF0A 3K2ZA 3BZKA 2GIVA 2YS9A 3OWTA 4MGRA 4HDVA 2ZKZA 2ZNYA 3U1KA 4Q48A 3WG9A 2ECBA 3C7JA 3JR9A 2JVGA 2LYCA 1BM9A 3SFZA 4ENNA 1MMGA 2R7QA 3TDZC 1VQMI 1IGNA 3E6BA 2E2IJ 1TQPA 2P6TA 3VEPA 4NQWA 2ADUA 2DOEA 2NOGA 3SZGA 4E7ZA 4FCYA 5BOXA 3CDIA 1EH6A 5L3BA 2VASA 2V6CA 2ZJQF 3G1LA 4HA8A 2MLGA 1H9GA 3KPHA 3H3VK 1BC8C 3L09A 5H6QA 4YIFA 1K78A 1K4SA 2IS6A 5DD4A 2IXSA 4HSRA 1ACIA 5IOYA 2M45A 3SHFA 4UUSB 2ZBKA 3K1NA 1DQUA 3I59A 1F4KA 3LMMA 4WX9A 1IUYA 1UG0A 4LFUA 2OV7A 1MGTA 3K4NA 5C4JJ 2YUSA 1SMYF 2EV6A 4AU7A 3BZCA 1JGGA 2QSHX 3S1MJ 1HKTA 2K27A 2NNNA 1X19A 1LDKB 3JRAA 2VBWA 2LOOA 3FWEA 1B72B 2WBMA 4D0PA 3PNTA 5F0CA 3O8GA 1Z77A 4XNFA 5LGUA 1MZBA 3CJQB 3ZQFA 5K1YA 1LFUP 3H9JA 2E35A 4C9YA 1ZRFA 4RLFA 1UAAA 4LK1F 1FIAA 2AQFA 4PGGA 5E1WA 4CHUA 1FOXA 2X6WA 1YX3A 2E1NA 4YEJA 1N77A 1W7PD 2DA6A 3D0SA 2DA5A 2HI3A 4EVIA 2W24A 2M34A 2FA5A 1SD5A 3CMYA 3BZ6A 1X3ZB 2JPCA 3GX4X 3JSPA 2I10A 4IO9F 4ON0A 4A0ZA 3GWZA 2A07F 2F5EA 4RS8A 2WAQN 3AFHA 1YITI 1I3QJ 3RKYA 3FXJA 2R7VA 1AKHB 1R4MB 2ZMEC 1MJBA 1LFPA 4I09A 2WTEA 4CUGA 1KQ8A 2Q1ZB 3N4MA 4ASNA 2IS4A 3ZQQA 2WB1A 1ZKGA 4RGXA 2VC0A 5FLMJ 1VQLI 2XPVA 3CJTB 4A6DA 2OPTA 4CDGA 1LVAA 4QPQA 3RCOA 4UY8I 3DTIA 4PJLA 1IV6A 4CZZA 2NXNB 2HS5A 1WRJA 4XONA 3GFIA 2QCOA 4FQGA 2PG4A 4UB8C 3RPUA 4O3MA 4KN7X 2VQCA 2JVHA 1E3OC 4BQAA 3QPTA 4Y15A 3JRGA 5HS9A 1WI9A 1XGMA 4XORA 1XSVA 2ZXWH 3BR1A 3HGYA 5CVUA 1QVTA 4BBRJ 3H36A 5E3OA 4DOZA 2FNPA 4MTEA 1HXDA 1JUSA 5KAIC 3ZQIA 3BTLA 3RIRA 3G1MA 1AOYA 2TCTA 4G12A 1W5SA 2IEKA 2RQQA 1V4RA 3T5XA 1W5CC 4BHPA 5EJCA 3AL0B 1O4XA 2GA2A 3LL7A 4LLGF 1TL8A 2PN6A 1UHWA 2E1MC 1D1AA 3P9IA 3IHUA 4HX7A 3T8RA 2K3PA 3E6MA 4XOPA 2A6HF 1FNNA 1UMQA 2BV6A 3EPZA 4KYWA 5EZHA 1BN5A 3IC7A 1FP1D 2QQ8A 4WXDA 1BJAA 4A0YA 1BI0A 1FJLA 5DV5A 2GIZA 2KHMA 3GF2A 1XX5A 2L02A 3OYFA 1R22A 2O3FA 5F08A 3BJOA 3PUBA 2DXIA 1UFMA 5D5VB 1B59A 3IKTA 2Z9OA 2ZSIB 3Q0VA 1VQPI 5EG0B 1FBUA 3J7AY 3W2VA 3DEWA 1BW5A 1TWAJ
chains in the Genus database with same CATH topology
2AO9A 3BTIA 3GTPJ 3LSGA 3JRDA 5HODA 2EQRA 4RBOA 2ME0A 5C4XJ 1IDZA 2DA7A 4MLOA 3LSJA 2EZIA 2HXOA 4QTRA 5C44J 4B1RA 1I50J 3HEFA 1JKRC 5EGOB 5EG0A 1I6HJ 4XRSG 2R92J 3HOZJ 2COBA 2YU9J 2LKXA 1UG2A 4HNVA 5GPAA 3WHBA 2LLKA 5IP9J 4AYBN 3A03A 5FKLA 4D7MA 2Y0SN 5EEAA 2XGCA 5EGOA 1NK2P 1ENHA 3TP0A 2CUEA 2HOSA 3LNQA 1HCRA 2L0KA 2E19A 2OF7A 2XGDA 1GVDA 4A3CJ 4QSHA 5J1YA 1B8IB 1XS9A 3BQYA 1SFOJ 4JX4A 2ZB9A 3F0CA 2JA6J 2K9NA 2EZKA 5M5XJ 1B8IA 5K7ZA 2HOAA 3E7LA 2FX0A 3UKGA 1UHSA 3SJMA 2X6OA 5EF6A 5GP9A 1D5YA 2MG4A 3BT9A 1F36A 1U9NA 5JLXA 5J1RA 1FIPA 1ZGWA 2MW8A 1IRZA 2R5ZB 2H1KA 2JN6A 1ETQA 2JA8J 5K7FA 2LFBA 4I6ZA 5FKMA 2AHQA 1IUFA 2GLOA 2JA7J 2X9DA 4BY7J 3BR6A 3FK7A 1XC5A 3JRFA 4A3LJ 1X2NA 2R5ZA 4A3KJ 2O7OA 1OJLA 5JLWA 1ETKA 2R93J 5K7HA 2ID6A 1JJ8C 2NS7A 5FKKA 1RKWA 4B4CA 2DMQA 3LSPA 1MBJA 3C2BA 2XB5A 4AC0A 3S17J 2EZHA 4X1EA 1GV2A 2DTZA 1GUUA 2HYJA 3QPSA 3S1NJ 3S16J 3JRCA 2TRTA 5F27A 3CCYA 2CJJA 3ZQGA 4A3BJ 2VKEA 1BJZA 5IOZA 3BTJA 4FE7A 1Z0XA 5IYDJ 1OCPA 3B6CA 5M3MJ 2IAIA 3QQAA 3O8HA 4C3HJ 3BG9A 4D5CA 4A3MJ 3BTCA 2N8GA 2XGEA 4DYQA 1MSEC 1IJWC 1NTCA 2WV1A 5J3LA 2NS8A 3TP3A 4JP0A 1BA5A 3S2DJ 1DU6A 3IV5A 3A01B 4IEJA 3HBLA 1TC3C 3S14J 1ETWA 2GM4A 2LK2A 1MBKA 2ME6A 1H89C 3SFIA 2W48A 3A01A 3GTKJ 2HXIA 1IDYA 5BNGA 3PO3J 3LSRA 1HLVA 1WH5A 1JJ6C 2CQXA 1WGXA 4JX5A 4M3BA 3MN2A 4I76A 2MSYA 4A3EJ 1MBGA 1APLC 4DZJA 4LOCA 3CDLA 1Y1WJ 3GTLJ 4V2FA 1CQTA 1SANA 2M9HA 1WH7A 4FE4A 2E2JJ 2NVTJ 2VPRA 2EH3A 2VUMJ 4BBSJ 3DCFA 2DA2A 3B6AA 4S0HB 1RR7A 1K61A 1NK3P 1PUFB 2JWTA 2CU7A 3HOYJ 2XB0X 2NVQJ 2Y30A 4FTHA 2JK3A 4FISA 4C3IJ 4W97A 1ZR4A 1TWGJ 2DMNA 4CYCB 1PUFA 1ZR2A 2IBDA 1S7EA 3ZQCA 3S1QJ 3H0GJ 3SDGA 4M3GA 3OIOA 1MH4A 4IHXA 2ELKA 2LD5A 1VI0A 1WCMJ 2G0EA 5E3NA 1VF9A 4W1UA 1OFCX 3RQIA 4DZPA 3NARA 5F04A 5FKNA 1Q1VA 1FTZA 3BQZA 2K40A 4MFDA 5C3EJ 5IYCJ 3S2HJ 3HB9A 1DU0A 2JMWA 3D1NI 4M6VA 3Q0UA 2XSDC 4XRSA 5J1UA 4MO7A 2D5VA 2M0CA 3HOUJ 1JTYA 1MBFA 1K83J 1U78A 5FKOA 2Y2ZA 4J19A 3I4NJ 1ZK8A 1H88C 1POGA 1JUPA 3JRIA 2L9RA 4A93J 2P81A 5E3LA 2R7ZJ 3JRBA 2B63J 2R5YB 3M4OJ 2E2HJ 4NDLA 3WHCA 4A3GJ 3FK6A 4IHYA 3RKQA 5DTDA 2L7MP 3BG5A 1GV5A 3IH2A 1LE8B 3K7AJ 3Q3SA 4XK4A 2DA3A 2MGQA 1GT0C 3HGGA 3ZQLA 3M3YJ 2R5YA 5EYRA 2LY9A 3W6VA 1W0UA 1MBHA 1ZTRA 4RDUA 1WPKA 1ETYA 4DYRA 1LE8A 1JTXA 5F1JA 2HOTA 2LP0A 3TW6A 3JRHA 4A69C 2L7ZA 1MNMC 2M8GX 3PO2J 5IPAA 1X2MA 1U9OA 3GTQJ 2FQ4A 3IH3A 1VNDA 2DN0A 4BY1J 2CRGA 3A02A 3FKIJ 1HF0A 2KT0A 3MKLA 2FJ1A 2YS9A 3G1OA 1H8AC 1OCTC 3HM5A 3JR9A 4X6AJ 2ECBA 1TWHJ 1YRNB 2L7FP 4BXXJ 1LFBA 5EZGA 1IGNA 1JT6A 2E2IJ 1JUMA 4IHWA 3K2AA 2NOGA 4FCYA 3RZOJ 2DA1A 1YRNA 2Y9YA 2VI6A 3G1LA 2M2EA 3H3VK 3TW7A 3HKZN 3IH4A 2ECCA 3BG3A 2K9QA 2FD5A 3NAUA 4XICA 1RESA 1JKOC 5GPCA 1U8BA 3L1PA 2Y31A 3CQZJ 5IOYA 2O8KA 4UUSB 5F0FA 2PMZN 1FTTA 3LOCA 4DW6A 4M3DA 1Y1VJ 1VFCA 5DS9A 4MIMA 5C4JJ 3GTOJ 1BW6A 2YUSA 3HOVJ 1JGGA 3S1MJ 4UUSA 1RKTA 3HOWJ 4A3JJ 1QRYA 1JT0A 1G2HA 3JREA 1ZQ3P 2GBYA 4UUTA 3JRAA 1B72B 1ETVA 1QVUA 4A3FJ 1R9TJ 3GBGA 5F0CA 2DMPA 2Y9ZA 3O8GA 1Z77A 3ZQFA 1LFUP 3ZQHA 5M3FJ 4A3DJ 1AU7A 1P7JA 4CYCA 3Q0WA 1B72A 1RPWA 5F0HA 1FIAA 2K9SA 5FLVA 3BR3A 4BKXA 3GTGJ 2ID3A 2DA6A 4D5FA 1ORKA 1T33A 4C3JJ 2DA5A 3GTJJ 2HI3A 2EBIA 2M34A 1WI3A 2WB1N 3CMYA 2XRLA 4XIDA 3MVPA 2NVXJ 1MH3A 3ZOBA 2DA4A 2I10A 3FIWA 4ABZA 2WAQN 5IYBJ 1I3QJ 5M5YJ 2DMTA 4L5EA 4XRMA 5FJ8J 1JKPC 1AKHB 2HQ5A 1FEXA 4JX6A 3OSGA 4M3FA 3BR0A 4GFBA 2RAEA 2VKVA 3FISA 4D7NA 4QIWN 1BL0A 3S15J 2DMUA 4DYCA 3TEDA 2XPUA 1AHDP 2HDDA 3GTMJ 1ZKGA 5M5WJ 2JJ7A 1AKHA 2R0QC 5FLMJ 5EDNA 1IC8A 1EF4A 1HOMA 1A6IA 2XPVA 3VPRA 5IP6A 2OPTA 2H8RA 2NVYJ 1IV6A 1ETOA 1ETXA 1XG1A 1MSFC 1TWFJ 2QCOA 5E3MA 2E1OA 3BR5A 4EEFG 1W0TA 1ITYA 2O9LA 2XPWA 1X58A 2CUFA 2KDZA 1E3OC 3JRGA 4A3IJ 4M3EA 3BR1A 3HGYA 1QVTA 1RETA 4BBRJ 5E3OA 2CQQA 3ZQIA 1JUSA 2X48A 3BTLA 4MFEA 3G1MA 2TCTA 4G12A 2IEKA 3OOUA 3QPLA 1GDTA 3S1RJ 1HDPA 1O4XA 3OSFA 3HOXJ 4IHVA 3BR2A 3PM1A 3I4MJ 1IG7A 1UMQA 3RZDJ 1A5JA 5EZHA 1P7IA 5IP7J 2JA5J 1F43A 1MBEA 1HDDC 1TWCJ 4Y52J 4C2MJ 1FJLA 4JYKA 1T56A 2LVSA 2DJNA 2LR8A 5F08A 3HDDA 4B3AA 4Y7NJ 9ANTA 1JKQC 3Q0VA 4AUXA 4V2GA 2QF7A 5EG0B 3DEWA 1BW5A 2LTPA 2EZLA 1TWAJ 1QPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AO9 A;  3BTI A;  3GTP J;  3LSG A;  3JRD A;  5HOD A;  2EQR A;  4RBO A;  2ME0 A;  5C4X J;  1IDZ A;  2DA7 A;  4MLO A;  3LSJ A;  2EZI A;  2HXO A;  4QTR A;  5C44 J;  4B1R A;  1I50 J;  3HEF A;  1JKR C;  5EGO B;  5EG0 A;  1I6H J;  4XRS G;  2R92 J;  3HOZ J;  2COB A;  2YU9 J;  2LKX A;  1UG2 A;  4HNV A;  5GPA A;  3WHB A;  2LLK A;  5IP9 J;  4AYB N;  3A03 A;  5FKL A;  4D7M A;  2Y0S N;  5EEA A;  2XGC A;  5EGO A;  1NK2 P;  1ENH A;  3TP0 A;  2CUE A;  2HOS A;  3LNQ A;  1HCR A;  2L0K A;  2E19 A;  2OF7 A;  2XGD A;  1GVD A;  4A3C J;  4QSH A;  5J1Y A;  1B8I B;  1XS9 A;  3BQY A;  1SFO J;  4JX4 A;  2ZB9 A;  3F0C A;  2JA6 J;  2K9N A;  2EZK A;  5M5X J;  1B8I A;  5K7Z A;  2HOA A;  3E7L A;  2FX0 A;  3UKG A;  1UHS A;  3SJM A;  2X6O A;  5EF6 A;  5GP9 A;  1D5Y A;  2MG4 A;  3BT9 A;  1F36 A;  1U9N A;  5JLX A;  5J1R A;  1FIP A;  1ZGW A;  2MW8 A;  1IRZ A;  2R5Z B;  2H1K A;  2JN6 A;  1ETQ A;  2JA8 J;  5K7F A;  2LFB A;  4I6Z A;  5FKM A;  2AHQ A;  1IUF A;  2GLO A;  2JA7 J;  2X9D A;  4BY7 J;  3BR6 A;  3FK7 A;  1XC5 A;  3JRF A;  4A3L J;  1X2N A;  2R5Z A;  4A3K J;  2O7O A;  1OJL A;  5JLW A;  1ETK A;  2R93 J;  5K7H A;  2ID6 A;  1JJ8 C;  2NS7 A;  5FKK A;  1RKW A;  4B4C A;  2DMQ A;  3LSP A;  1MBJ A;  3C2B A;  2XB5 A;  4AC0 A;  3S17 J;  2EZH A;  4X1E A;  1GV2 A;  2DTZ A;  1GUU A;  2HYJ A;  3QPS A;  3S1N J;  3S16 J;  3JRC A;  2TRT A;  5F27 A;  3CCY A;  2CJJ A;  3ZQG A;  4A3B J;  2VKE A;  1BJZ A;  5IOZ A;  3BTJ A;  4FE7 A;  1Z0X A;  5IYD J;  1OCP A;  3B6C A;  5M3M J;  2IAI A;  3QQA A;  3O8H A;  4C3H J;  3BG9 A;  4D5C A;  4A3M J;  3BTC A;  2N8G A;  2XGE A;  4DYQ A;  1MSE C;  1IJW C;  1NTC A;  2WV1 A;  5J3L A;  2NS8 A;  3TP3 A;  4JP0 A;  1BA5 A;  3S2D J;  1DU6 A;  3IV5 A;  3A01 B;  4IEJ A;  3HBL A;  1TC3 C;  3S14 J;  1ETW A;  2GM4 A;  2LK2 A;  1MBK A;  2ME6 A;  1H89 C;  3SFI A;  2W48 A;  3A01 A;  3GTK J;  2HXI A;  1IDY A;  5BNG A;  3PO3 J;  3LSR A;  1HLV A;  1WH5 A;  1JJ6 C;  2CQX A;  1WGX A;  4JX5 A;  4M3B A;  3MN2 A;  4I76 A;  2MSY A;  4A3E J;  1MBG A;  1APL C;  4DZJ A;  4LOC A;  3CDL A;  1Y1W J;  3GTL J;  4V2F A;  1CQT A;  1SAN A;  2M9H A;  1WH7 A;  4FE4 A;  2E2J J;  2NVT J;  2VPR A;  2EH3 A;  2VUM J;  4BBS J;  3DCF A;  2DA2 A;  3B6A A;  4S0H B;  1RR7 A;  1K61 A;  1NK3 P;  1PUF B;  2JWT A;  2CU7 A;  3HOY J;  2XB0 X;  2NVQ J;  2Y30 A;  4FTH A;  2JK3 A;  4FIS A;  4C3I J;  4W97 A;  1ZR4 A;  1TWG J;  2DMN A;  4CYC B;  1PUF A;  1ZR2 A;  2IBD A;  1S7E A;  3ZQC A;  3S1Q J;  3H0G J;  3SDG A;  4M3G A;  3OIO A;  1MH4 A;  4IHX A;  2ELK A;  2LD5 A;  1VI0 A;  1WCM J;  2G0E A;  5E3N A;  1VF9 A;  4W1U A;  1OFC X;  3RQI A;  4DZP A;  3NAR A;  5F04 A;  5FKN A;  1Q1V A;  1FTZ A;  3BQZ A;  2K40 A;  4MFD A;  5C3E J;  5IYC J;  3S2H J;  3HB9 A;  1DU0 A;  2JMW A;  3D1N I;  4M6V A;  3Q0U A;  2XSD C;  4XRS A;  5J1U A;  4MO7 A;  2D5V A;  2M0C A;  3HOU J;  1JTY A;  1MBF A;  1K83 J;  1U78 A;  5FKO A;  2Y2Z A;  4J19 A;  3I4N J;  1ZK8 A;  1H88 C;  1POG A;  1JUP A;  3JRI A;  2L9R A;  4A93 J;  2P81 A;  5E3L A;  2R7Z J;  3JRB A;  2B63 J;  2R5Y B;  3M4O J;  2E2H J;  4NDL A;  3WHC A;  4A3G J;  3FK6 A;  4IHY A;  3RKQ A;  5DTD A;  2L7M P;  3BG5 A;  1GV5 A;  3IH2 A;  1LE8 B;  3K7A J;  3Q3S A;  4XK4 A;  2DA3 A;  2MGQ A;  1GT0 C;  3HGG A;  3ZQL A;  3M3Y J;  2R5Y A;  5EYR A;  2LY9 A;  3W6V A;  1W0U A;  1MBH A;  1ZTR A;  4RDU A;  1WPK A;  1ETY A;  4DYR A;  1LE8 A;  1JTX A;  5F1J A;  2HOT A;  2LP0 A;  3TW6 A;  3JRH A;  4A69 C;  2L7Z A;  1MNM C;  2M8G X;  3PO2 J;  5IPA A;  1X2M A;  1U9O A;  3GTQ J;  2FQ4 A;  3IH3 A;  1VND A;  2DN0 A;  4BY1 J;  2CRG A;  3A02 A;  3FKI J;  1HF0 A;  2KT0 A;  3MKL A;  2FJ1 A;  2YS9 A;  3G1O A;  1H8A C;  1OCT C;  3HM5 A;  3JR9 A;  4X6A J;  2ECB A;  1TWH J;  1YRN B;  2L7F P;  4BXX J;  1LFB A;  5EZG A;  1IGN A;  1JT6 A;  2E2I J;  1JUM A;  4IHW A;  3K2A A;  2NOG A;  4FCY A;  3RZO J;  2DA1 A;  1YRN A;  2Y9Y A;  2VI6 A;  3G1L A;  2M2E A;  3H3V K;  3TW7 A;  3HKZ N;  3IH4 A;  2ECC A;  3BG3 A;  2K9Q A;  2FD5 A;  3NAU A;  4XIC A;  1RES A;  1JKO C;  5GPC A;  1U8B A;  3L1P A;  2Y31 A;  3CQZ J;  5IOY A;  2O8K A;  4UUS B;  5F0F A;  2PMZ N;  1FTT A;  3LOC A;  4DW6 A;  4M3D A;  1Y1V J;  1VFC A;  5DS9 A;  4MIM A;  5C4J J;  3GTO J;  1BW6 A;  2YUS A;  3HOV J;  1JGG A;  3S1M J;  4UUS A;  1RKT A;  3HOW J;  4A3J J;  1QRY A;  1JT0 A;  1G2H A;  3JRE A;  1ZQ3 P;  2GBY A;  4UUT A;  3JRA A;  1B72 B;  1ETV A;  1QVU A;  4A3F J;  1R9T J;  3GBG A;  5F0C A;  2DMP A;  2Y9Z A;  3O8G A;  1Z77 A;  3ZQF A;  1LFU P;  3ZQH A;  5M3F J;  4A3D J;  1AU7 A;  1P7J A;  4CYC A;  3Q0W A;  1B72 A;  1RPW A;  5F0H A;  1FIA A;  2K9S A;  5FLV A;  3BR3 A;  4BKX A;  3GTG J;  2ID3 A;  2DA6 A;  4D5F A;  1ORK A;  1T33 A;  4C3J J;  2DA5 A;  3GTJ J;  2HI3 A;  2EBI A;  2M34 A;  1WI3 A;  2WB1 N;  3CMY A;  2XRL A;  4XID A;  3MVP A;  2NVX J;  1MH3 A;  3ZOB A;  2DA4 A;  2I10 A;  3FIW A;  4ABZ A;  2WAQ N;  5IYB J;  1I3Q J;  5M5Y J;  2DMT A;  4L5E A;  4XRM A;  5FJ8 J;  1JKP C;  1AKH B;  2HQ5 A;  1FEX A;  4JX6 A;  3OSG A;  4M3F A;  3BR0 A;  4GFB A;  2RAE A;  2VKV A;  3FIS A;  4D7N A;  4QIW N;  1BL0 A;  3S15 J;  2DMU A;  4DYC A;  3TED A;  2XPU A;  1AHD P;  2HDD A;  3GTM J;  1ZKG A;  5M5W J;  2JJ7 A;  1AKH A;  2R0Q C;  5FLM J;  5EDN A;  1IC8 A;  1EF4 A;  1HOM A;  1A6I A;  2XPV A;  3VPR A;  5IP6 A;  2OPT A;  2H8R A;  2NVY J;  1IV6 A;  1ETO A;  1ETX A;  1XG1 A;  1MSF C;  1TWF J;  2QCO A;  5E3M A;  2E1O A;  3BR5 A;  4EEF G;  1W0T A;  1ITY A;  2O9L A;  2XPW A;  1X58 A;  2CUF A;  2KDZ A;  1E3O C;  3JRG A;  4A3I J;  4M3E A;  3BR1 A;  3HGY A;  1QVT A;  1RET A;  4BBR J;  5E3O A;  2CQQ A;  3ZQI A;  1JUS A;  2X48 A;  3BTL A;  4MFE A;  3G1M A;  2TCT A;  4G12 A;  2IEK A;  3OOU A;  3QPL A;  1GDT A;  3S1R J;  1HDP A;  1O4X A;  3OSF A;  3HOX J;  4IHV A;  3BR2 A;  3PM1 A;  3I4M J;  1IG7 A;  1UMQ A;  3RZD J;  1A5J A;  5EZH A;  1P7I A;  5IP7 J;  2JA5 J;  1F43 A;  1MBE A;  1HDD C;  1TWC J;  4Y52 J;  4C2M J;  1FJL A;  4JYK A;  1T56 A;  2LVS A;  2DJN A;  2LR8 A;  5F08 A;  3HDD A;  4B3A A;  4Y7N J;  9ANT A;  1JKQ C;  3Q0V A;  4AUX A;  4V2G A;  2QF7 A;  5EG0 B;  3DEW A;  1BW5 A;  2LTP A;  2EZL A;  1TWA J;  1QPI A; 
#chains in the Genus database with same CATH topology
 4LJZ F;  4S05 A;  1QO0 D;  2ZME A;  4E7I A;  2MFZ A;  4AD9 A;  2ME0 A;  3I9V 2;  1TQM A;  2VOP A;  2F5C A;  3DF8 A;  4I98 B;  3KP6 A;  2EA2 A;  1K4T A;  4QTR A;  2HXO A;  5C44 J;  1ZG1 A;  1JKR C;  3HEF A;  2GXG A;  5EGO B;  4HEA 2;  3FHZ A;  3NWT A;  1P4W A;  4KUM A;  2KLO A;  2R92 J;  4PCQ A;  3HOZ J;  4GXO A;  4LIT A;  2OCE A;  3FKJ A;  5GPA A;  1A6Q A;  3OS0 A;  3DKY A;  1D0X A;  1V5F A;  2Q0O A;  1R7J A;  2KZG A;  1FMV A;  2VBY A;  5FKL A;  1PP8 F;  2KP6 A;  2WAE A;  2Y0S N;  4XL9 A;  2E7W A;  1NK2 P;  1KON A;  2CUE A;  2AXL A;  3FM3 A;  3K4B A;  3LNQ A;  3H5R A;  2OF7 A;  1GXP A;  1BR4 A;  1GVD A;  4A3C J;  1O3R A;  5KAF C;  1HKQ A;  2FF4 A;  2VJI A;  1J09 A;  1ON1 A;  2QSF X;  4NC7 A;  3AKZ A;  2A3S A;  1SFO J;  1BOB A;  4CCM A;  3KP2 A;  4E7L A;  3OYJ A;  5ED4 A;  4JX4 A;  3QYE A;  1SD6 A;  4AYB A;  2R7R A;  4J00 A;  4RMN A;  2K9N A;  1W36 C;  1UHS A;  2KPM A;  4MQ9 F;  1U8R A;  1YS6 A;  1WJB A;  1U9N A;  4EJU A;  5JLX A;  3F8N A;  3WTW C;  1IXR C;  5H2F C;  2HFH A;  2XSJ C;  1DDN A;  4RAF A;  2HEO A;  4XM3 A;  2VJJ A;  4CA0 A;  1XPX A;  1S7O A;  3HC7 A;  1IUF A;  1O7F A;  4CCL A;  2GLO A;  4XLC A;  5H6R A;  1XC5 A;  5FGM A;  2O7O A;  1OJL A;  3S93 A;  2LNB A;  2FSW A;  3KP3 A;  4KT5 C;  5HLH A;  2H6C A;  4B09 A;  2VIX A;  3H0D A;  2ESH A;  2OBP A;  3I53 A;  4BUP A;  4B4C A;  1WJ5 A;  2XB5 A;  2KJB A;  3KLO A;  4ITV A;  4AC0 A;  2EZH A;  2DTZ A;  3CCR I;  3J7Z I;  1XGO A;  1G6N A;  5FLX K;  3QPS A;  3S1N J;  1W7P B;  4G9Y A;  2TRT A;  5F27 A;  1MKM A;  1XMA A;  5JI6 A;  1I39 A;  2JUC A;  2QBY A;  4YFX F;  1Z3X A;  2D45 A;  4LB6 B;  1D1B A;  1OKR A;  1R6R A;  3ZN0 A;  1OCP A;  3B6C A;  5M3M J;  2FMY A;  2GA1 A;  2QKM B;  1O3S A;  2WV1 A;  3A1Y A;  2V7F A;  4G7O F;  1Y56 A;  2DK8 A;  1RR8 C;  2VOO A;  4JP0 A;  2M3A A;  4IRI A;  2XUB A;  3EUH A;  5TIS C;  4CXF A;  1XDS A;  3PL8 A;  2KIU A;  4FX0 A;  3FF5 A;  3L2V A;  2P7C B;  3SEQ A;  1QHH D;  4WK8 F;  5HVQ C;  3NRV A;  3E3V A;  4KIT B;  3E0J B;  2W48 A;  3A01 A;  2CW8 A;  3CJN A;  5BNG A;  3PO3 J;  4R79 A;  1WGX A;  2X6Y A;  5GAG J;  4ZYA A;  1K6O A;  2DT5 A;  3HHG A;  5J6X A;  3Q9V A;  1JGS A;  3MN2 A;  2Q2E B;  4I76 A;  2OQR A;  4G7H F;  2UXN A;  4YG2 F;  3L2W A;  1OYW A;  3CCM I;  5D8L B;  2X51 A;  3IRQ A;  2MH9 A;  5GAD J;  3PIP F;  2M5W A;  3UR3 C;  3K70 C;  1YIJ I;  4IHS A;  4HW0 A;  4FHT A;  2HKX A;  1XCV A;  3JTH A;  4V2F A;  1FSE A;  1WH7 A;  4FE4 A;  2NVT J;  3A2K A;  2QVO A;  2EIK H;  3CMA I;  4BBS J;  5ICG A;  4HV6 A;  3DCF A;  2DA2 A;  3VYT B;  1R36 A;  3HRU A;  3R61 A;  3DBH B;  3FXR A;  3HOY J;  4RGU A;  2EIN H;  3BOQ A;  1SVM A;  1R1T A;  3GUD A;  1SAX A;  5D5W B;  1QZZ A;  1A31 A;  1TWG J;  1OR7 A;  1IN5 A;  2QEX I;  1J0R A;  1X1A A;  1I5Z A;  1X3U A;  3CCV I;  2PEX A;  3HSR A;  4A0X A;  3RYP A;  3ZQC A;  4II3 A;  3RKW A;  4M3G A;  3WU2 C;  2ZFW A;  3OIO A;  2JA2 A;  4Y33 A;  5HLG A;  1T2K A;  4IHX A;  3CTA A;  3OIQ A;  2ELK A;  3PSF A;  1ZYR F;  4E7H A;  2EA4 A;  1KU9 A;  1OFC X;  4XLF A;  1U3E M;  2A68 F;  1T6S A;  1Y0U A;  3V8L A;  1I1S A;  2FXA A;  3EUK L;  3ROU A;  5FKN A;  3R0A A;  5LGT A;  3OY9 A;  4M74 A;  2K40 A;  4U7D A;  5C3E J;  2W25 A;  3OYE A;  5DUK A;  3PFY A;  3IAM 2;  3Q0U A;  3TO7 A;  4ZYG A;  4L5I A;  4F92 B;  3D1N I;  2XF7 A;  2M0C A;  3WTV C;  1JTY A;  1MBF A;  3H1C A;  3I4N J;  3IWZ A;  1POG A;  5E3L A;  1KU3 A;  4ZZD A;  2PJR A;  2R7Z J;  2H1L A;  2QYO A;  2CV1 A;  1X1P A;  2KIQ A;  2E2H J;  4NDL A;  3BPX A;  2R7O A;  2IPQ X;  2A6E F;  2JPB A;  4LB5 A;  3J7Y J;  5DTD A;  5LHI A;  4XQF A;  3ML6 A;  5CKT A;  1Z1D A;  3Q3S A;  2WAQ A;  3HGG A;  3ONQ A;  3N05 A;  3WU0 A;  4YFN F;  1FBS A;  1F1Z A;  2K86 A;  3OYN A;  2VB6 A;  2EFO A;  2GXA A;  1FWZ A;  3OYG A;  4AWX B;  2LY9 A;  2P7V B;  4G7Z F;  1IXS B;  1MBH A;  1RIO H;  2L7K A;  1JTX A;  4M9Z A;  3JRH A;  4A69 C;  3M07 A;  1MNM C;  2UWM A;  1U9O A;  2EFN A;  3GTQ J;  4J01 A;  4PJ0 C;  1SEU A;  2V9K A;  4BY1 J;  4XKB A;  3A02 A;  3VYU B;  4OMZ A;  1GLN A;  2KT0 A;  3ECH A;  2FJ1 A;  4I7H A;  4B43 A;  1VQ5 I;  4X6A J;  1TWH J;  3SZP A;  4A5M A;  1LQ1 A;  1MD0 A;  1YRN B;  4RLQ A;  3KEO A;  4PDK A;  3LSH A;  4HX8 A;  1MDM B;  2DFF A;  3KX2 A;  2NAZ A;  3F3X A;  4QLC U;  3ISP A;  1JUM A;  3PQK A;  4AVP A;  4BE2 A;  3MQ0 A;  2K9M A;  3DP7 A;  3BLY A;  2DTR A;  2K02 A;  3F6V A;  2R7W A;  2B7E A;  1ZEL A;  3TW7 A;  3IH4 A;  2ECC A;  3E5X A;  3I54 A;  2FD5 A;  3ABT A;  3KFW X;  3NAU A;  3OIP A;  3A0H C;  2XV4 S;  4DGW B;  4LIU A;  5GPC A;  3MFK A;  4FT8 A;  1U8B A;  5KK1 A;  3L1P A;  5DCM B;  3CQZ J;  1KU7 A;  4HPQ A;  2LY1 A;  1FBQ A;  4DW6 A;  4M3D A;  2D1H A;  5F1R A;  2ISY A;  3GTO J;  3D5S C;  3DU6 A;  3HOV J;  2BHY A;  1LEA A;  1KQ9 A;  4UUS A;  1RKT A;  3WTZ A;  3OOP A;  1QRY A;  1G2H A;  1ZAR A;  2DFE A;  4N0B A;  3BG7 A;  4CCN A;  1YQA A;  3R0J A;  4UV9 A;  1R9T J;  5LEJ A;  2X1D A;  2PMZ A;  4EGZ A;  4U88 A;  5DM6 F;  2YU3 A;  4N9I A;  2ZC2 A;  3F8C A;  1MNE A;  3FMR A;  3ZQH A;  4P9U A;  1HBX G;  1AU7 A;  3CCE I;  4IQ4 A;  4CYC A;  3Q0W A;  1B72 A;  1RPW A;  2YSR A;  3K10 A;  5CVR A;  5F0H A;  4UUV A;  1CGP A;  3S3O A;  2EB7 A;  2BXZ A;  2ESN A;  3LA2 A;  3AL0 C;  1MJA A;  2M30 A;  3OYA A;  3E6C C;  2ID3 A;  4OWR B;  4ZC3 A;  3WTX C;  1T33 A;  3GTJ J;  2EBI A;  2Z5U A;  3BC8 A;  3C2G A;  2HGC A;  2LMD A;  3LA7 A;  2Y0S A;  1S3J A;  4UB6 C;  3H35 A;  1Y8R B;  2LBF B;  2XF5 A;  3MVP A;  4B48 A;  3L2R A;  4IHT A;  3EYI A;  2KRF A;  4ABZ A;  1QU3 A;  5CQG A;  5J8F A;  2DMT A;  4L5E A;  3D5L A;  1R71 A;  5ICF A;  3IAS 2;  1R23 A;  5FJ8 J;  1JKP C;  1K79 A;  3H9Q A;  4Q4Z F;  2PI0 A;  4A5N A;  2ZFU A;  4Y3O A;  4XR6 A;  3MZH A;  2UZK A;  4GFB A;  2K85 A;  3FIS A;  2VKV A;  1RRJ A;  2K5C A;  4QIW N;  3O3K A;  3RSN A;  2MC4 A;  2PFB A;  4NUB A;  3S15 J;  2DMU A;  2I8D A;  2DOA A;  2HDD A;  4U0W A;  4E7K A;  1D1C A;  1AKH A;  1FX7 A;  5EDN A;  1HOM A;  1A6I A;  3OR1 C;  5DYM A;  2RVC A;  1IZ1 A;  1IN4 A;  1ETO A;  1XG1 A;  3I55 I;  1MSF C;  3J7A O;  2R7F A;  3CP2 A;  1J2X A;  4HAM A;  3DPT A;  3W2W A;  4HG2 A;  1NH3 A;  1VTN C;  1X58 A;  1YYV A;  5FB2 A;  3LQR A;  1JI8 A;  2F5F A;  1LKX A;  4EV0 A;  5HOO A;  3K4K A;  4YFK F;  3A0B C;  2XKO A;  3JW4 A;  4YEL A;  3DXJ F;  3CO7 C;  3AG4 H;  2DPD A;  5ERI A;  1KGS A;  2X48 A;  2ZXI A;  4CYD A;  1FSH A;  3ZMU A;  1ERD A;  1BI3 A;  3TMO A;  3OOU A;  4I02 A;  1HDP A;  4IHV A;  1Y6I A;  4M9S A;  3PM1 A;  3QWL A;  2JSC A;  3I4M J;  3ESW B;  2XIG A;  2FOK A;  1A5J A;  2BOL A;  1YJW I;  1HDD C;  2WWY A;  3JTG A;  4M9X A;  4ZH4 F;  3B02 A;  3ZCO A;  2LVS A;  4L0Z B;  5E8G A;  4RM2 A;  1ZH5 A;  4PFP A;  1ZAO A;  2XHK A;  2BVM A;  3J80 Z;  3OYI A;  2WY7 Q;  4IRH A;  5B1B H;  3ASN H;  2HPM A;  4EJO A;  1JKQ C;  2QF7 A;  1U5T B;  2DK5 A;  2EZL A;  4HF2 A;  4B3X A;  4F55 A;  5HDG A;  5HOD A;  4RBO A;  4LMY A;  3G73 A;  1IDZ A;  4KIG A;  3KET A;  3QRF F;  2W84 A;  4UVA A;  2ICW G;  2EZI A;  2VJ4 A;  1I6H J;  4B1R A;  5EG0 A;  3GME A;  4C2U A;  5CVI A;  2DYR H;  1X1C A;  4F3Q A;  2PX9 A;  1XN7 A;  3QAH A;  2IGN A;  2CQN A;  1YLF A;  3A4C A;  2W1O A;  4Q5S F;  4D7M A;  1N78 A;  5EGO A;  4RM3 A;  2KQR A;  4XN3 A;  3PNV A;  4E4H A;  5DM7 F;  4IJA A;  3DV8 A;  4ZDL A;  2F5D A;  2FOW A;  3TP0 A;  2OU2 A;  2HOS A;  2V79 A;  2YX4 A;  3I0T A;  1S6L A;  1EKE A;  2XGD A;  4CCJ A;  3WGH A;  1B8I B;  4RAZ A;  5JVT A;  3BQY A;  1FP2 A;  4WXC A;  4HOB A;  1W1W E;  3K4C A;  1S29 A;  2HVR A;  2F4M B;  3F0C A;  1GXQ A;  1Z6R A;  5K7Z A;  3K4L A;  4HYE A;  2QLZ A;  3R6S A;  2UV1 A;  1O3T A;  5CLS A;  1ZRC A;  1BBY A;  5EF6 A;  1EH7 A;  4PSX A;  2MG4 A;  3BT9 A;  2BBY A;  1F36 A;  2DOF A;  4ZTJ A;  2DT6 A;  3K4J A;  4KIC A;  1VQK I;  3CF5 F;  1FIP A;  1C0W A;  1FMW A;  1IRZ A;  3KP5 A;  3VB2 A;  2CYY A;  1FYM A;  2H1K A;  1SVO A;  2HWV A;  1ETQ A;  3K1M A;  2LFB A;  5K7F A;  3V7S A;  2DT7 B;  2JA7 J;  1MND A;  4BY7 J;  3E5U A;  3GW2 A;  1NG6 A;  3FK7 A;  3HSE A;  3WU1 B;  5GAE J;  1HKS A;  1XCB A;  5LEK A;  4HF1 A;  1IN8 A;  2L9S A;  2D1V A;  1WWX A;  1JJ8 C;  2EPF A;  3CCS I;  2GOX B;  2DMQ A;  3OYK A;  4L9V A;  1MBJ A;  1B9M A;  3LWF A;  3QOP A;  1UJ8 A;  2VT2 A;  1HQC A;  1P2F A;  1GUU A;  3KIO A;  3KZY A;  3OYC A;  3Q9S A;  1N75 A;  1WJC A;  1E0E A;  3BCA A;  4DIQ A;  2IGM A;  3CCY A;  3B73 A;  2CJJ A;  2Z33 A;  1X4O A;  3C18 A;  2Z2S B;  1X4P A;  1KZH A;  1G3T A;  4LGW A;  1BJZ A;  4RB0 A;  4R1H A;  1W7P A;  2DQR A;  3EQL F;  1E3P A;  3BTJ A;  3CC2 I;  3WTY C;  1Z0X A;  4PJM A;  5LRR A;  1T8I A;  4G6D A;  1QGP A;  3TO6 A;  3EYY A;  3QQA A;  3O8H A;  4C3H J;  3BTC A;  3HPG A;  2XGE A;  1IJW C;  1OIS A;  1NTC A;  2GWR A;  2XAJ A;  2WC2 A;  3QPH A;  2Y75 A;  3IV5 A;  1P9Q C;  4BL0 B;  4XLP F;  2FBI A;  5ILU A;  2F4O B;  2LH9 A;  4NHJ A;  2PMH A;  3S14 J;  4ZZL A;  1ETW A;  2LK2 A;  1NG7 A;  5L3C A;  1TTY A;  1UZC A;  1P4X A;  4G6Q A;  3WE3 A;  3HOT A;  4XMY A;  1WH5 A;  3OR2 C;  1JJ6 C;  4DBQ A;  2V1X A;  3DBR B;  4BEH B;  3QOD A;  1MMD A;  3RPQ A;  1V54 H;  3TBI A;  3F8M A;  2EWN A;  2IGO A;  5D6F A;  4BU2 A;  2XAQ A;  1R49 A;  5J4Y A;  1MW7 A;  4A3E J;  1IXC A;  3RTR A;  1APL C;  3WG7 H;  4DZJ A;  4LOC A;  3BY6 A;  5B1A H;  3DWL E;  1H9T A;  2Q2E A;  2V4J C;  1CQT A;  1SAN A;  2RC4 A;  2E2J J;  2MAB A;  2X6X A;  1XB4 A;  4FET A;  4GCV A;  3B6A A;  2RRE A;  1RR7 A;  1XGS A;  1K61 A;  2PJP A;  1S8N A;  3SQN A;  1PUF B;  2JWT A;  5CYV A;  1V5E A;  2CU7 A;  3CD6 I;  2XB0 X;  2Y30 A;  2EK5 A;  5J8C A;  1HC8 A;  1OCR H;  4P96 A;  3V7R A;  2K4B A;  2DU9 A;  1LUJ B;  3RDI A;  1XGN A;  2JRT A;  4HLX A;  3VFZ A;  2L4A A;  5D5U B;  2JQ7 A;  4BDY A;  4XLH A;  1Z7L A;  3H0G J;  1U2W A;  1A35 A;  3MKY B;  4OIQ F;  2M7A A;  3KYC B;  1YX5 A;  2W85 A;  4IRG A;  4LD5 A;  1R58 A;  3M7G A;  3MD2 A;  4L9J A;  2CG4 A;  4L9N A;  2G0E A;  4Q47 A;  1J9I A;  5E3N A;  1WVR A;  4W1U A;  1B4A A;  3OS2 A;  1HW1 A;  1Z3Y A;  3FM5 A;  1V3F A;  4MTD A;  3HPH A;  4IXA A;  3X2Q H;  5J47 A;  4QPO A;  1FT9 A;  2WAD A;  1HSJ A;  3NAR A;  2G7H A;  1KQ0 A;  1XSX A;  1X3W B;  1Q1V A;  2MLK A;  2L54 A;  3RJP A;  2ZO4 A;  1FTZ A;  2HQN A;  4YRV A;  3BQZ A;  3ASO H;  1LNW A;  2XC7 A;  5IYC J;  3OYM A;  3F9K A;  3CCL I;  4M6V A;  4XRS A;  2AXT C;  4AID A;  5F6F A;  1U78 A;  2ELJ A;  1FOY A;  1FY7 A;  2W57 A;  3SYT A;  2EV0 A;  1SAU A;  2W82 A;  1EH8 A;  2L9R A;  4XOT A;  1FYL A;  4I2O A;  2BXY A;  4OMY A;  3F72 A;  2G7U A;  3JRB A;  1RZ4 A;  2PLY A;  3FXK A;  3FX3 A;  3HRS A;  2DDB A;  1JE8 A;  3RKQ A;  1HST A;  3FXO A;  3K7A J;  3DLA A;  2DA3 A;  4AIK A;  2JTV A;  2NNY A;  3K6G A;  2DCE A;  5EYR A;  3W6V A;  2P4W A;  3ABM H;  1VQO I;  2E34 A;  1W0U A;  4RDU A;  1OPC A;  4DYR A;  1D3Y A;  2HOT A;  3BRO A;  1X1D A;  4HQE A;  3TW6 A;  1TNS A;  1DGR M;  2L7Z A;  2M8G X;  3PO2 J;  2IP2 A;  4N9H A;  2M4G A;  3HUG B;  2Y0M A;  4WXH A;  3UNG C;  2FQ4 A;  3BJ6 A;  3FMQ A;  3IH3 A;  3QU3 A;  5AIQ A;  1VND A;  2DN0 A;  3ELK A;  4LG3 A;  3MKL A;  4FX4 A;  3MKZ A;  1UCR A;  1Q1H A;  4GGG A;  2RQP A;  1H8A C;  3MCZ A;  5DCF A;  5IY5 H;  5E17 F;  4HNT A;  1DP7 P;  1MMN A;  1PUE E;  1BR1 A;  3CUO A;  4QWQ A;  2LKP A;  1JT6 A;  4KIS A;  2OQG A;  2MA3 A;  3LSK A;  3RQ4 A;  2ZXH A;  1R5H A;  1YW7 A;  1YRN A;  2H94 A;  3I4P A;  2RDP A;  4HRI A;  1DPR A;  3WTS C;  3HKZ N;  3LSI A;  1MDM A;  3BG3 A;  2K9Q A;  1NHA A;  5DEQ A;  2MD0 A;  1Z9C A;  3FXM A;  1RES A;  3HJE A;  1JKO C;  1USS A;  2R4G A;  3H3U A;  2O8K A;  1Y0N A;  4IPA A;  1KYW A;  2VBZ A;  1TZL A;  4BHC A;  3ZMS A;  3ERE D;  1FTT A;  4BH9 A;  4Y4R A;  3LOC A;  2QQB A;  4PSW A;  3ECO A;  4MIM A;  3FBI B;  2EFW A;  5JVG F;  1BW6 A;  5DCM A;  4IX7 A;  4A12 A;  3KCC A;  2BZT A;  1F5T A;  3M8E A;  2CS3 A;  2A61 A;  2PMU A;  2HDC A;  4CGZ A;  3HOW J;  4A3J J;  1S5L C;  2M0M A;  2KJC A;  2DDA A;  2P5V A;  1ZQ3 P;  1K7A A;  5HLT A;  4UUT A;  1YG2 A;  1QVU A;  2VJ5 A;  2HQR A;  3GBG A;  3DU5 A;  3J80 K;  4NNJ A;  2Y9Z A;  5D4R A;  1FPQ A;  3BCB A;  4D9J A;  2E5Z A;  5LGN A;  2VON A;  3F22 A;  3ZMD A;  5M3F J;  3LA3 A;  1P7J A;  4PFO A;  3JAM Z;  1ZHF A;  3RYR A;  2LG4 A;  3U21 A;  3L2U A;  3GZ6 A;  3MKW B;  4XBF A;  2K9S A;  5BQT A;  3BR3 A;  3CP8 A;  1HA8 A;  4BKX A;  5A2Q Z;  3GTG J;  4G6T B;  3DPU A;  4E70 A;  5B5E C;  1CF7 B;  4D5F A;  2P5K A;  1ORK A;  2UUZ A;  5D5X B;  5L3D A;  4XSZ F;  2QM3 A;  1WI3 A;  2WB1 N;  3CC7 I;  3HG9 A;  1X1B A;  3ZOB A;  2BW3 B;  3LFU A;  3FIW A;  3OS1 A;  3FDY A;  3FXQ A;  2F2E A;  1TW3 A;  5IYB J;  1J75 A;  5M5Y J;  4BE1 A;  2FML A;  2XKP A;  4XRM A;  3QYB A;  2HQ5 A;  2LBF A;  3OSG A;  4M3F A;  5FRN A;  4OIO F;  4MEY F;  2RAE A;  5FFX A;  4D7N A;  1U5T C;  2EIM H;  3TED A;  4RGR A;  3GTM J;  2KZV A;  4KMU X;  5CQE A;  2KKO A;  3F8F A;  5CVJ A;  3WOD F;  3CC4 I;  4PJN A;  2HKO A;  3VPR A;  2H8R A;  2NVU B;  3BJA A;  1O3Q A;  3E97 A;  2EJR A;  2MBF A;  4F93 B;  4EMS A;  1L0O C;  1YIO A;  2HTJ A;  4OU0 A;  3BR5 A;  4EEF G;  1W0T A;  1G59 A;  1OYY A;  2DYS H;  1S9H A;  2E60 A;  1OCO H;  2HVS A;  2XPW A;  5FRM A;  1FZP B;  1S7A A;  2QBY B;  5L3F A;  3CUQ B;  2QWW A;  3RKX A;  3OMY A;  3BPV A;  2BY0 A;  4IOA F;  1TLH B;  4RB1 A;  2CFX A;  3MAJ A;  4HF0 A;  1BR2 A;  4UV8 A;  2A69 F;  2PQ8 A;  5J40 A;  2WV0 A;  1LB2 A;  3S1R J;  2KDO A;  3I64 A;  1KU2 A;  4BGD A;  3OSF A;  3HOX J;  5ICE A;  1TP4 A;  1E3H A;  1Z91 A;  3RI4 A;  1P92 A;  1IRX A;  2M4K A;  2HYG D;  3RZD J;  1IW7 F;  3CES A;  1D5V A;  4X0G A;  1XD7 A;  3VWB A;  1F43 A;  2FRH A;  2F5V A;  1MBE A;  2VL8 A;  4Y52 J;  4C2M J;  1T56 A;  3K4M A;  3I58 A;  1K6Y A;  2DJN A;  2VT3 A;  1FLI A;  2FE3 A;  2LR8 A;  4F52 A;  3HDD A;  1B1B A;  3OL3 A;  4NB5 A;  4YII A;  4GDF A;  4AUX A;  1ON2 A;  3L2Q A;  2AQE A;  2DFI A;  4V2G A;  3VDX A;  2ZXJ A;  2OZ6 A;  5LBQ A;  3KZZ A;  2WY8 Q;  2IBD A;  3WGI A;  4LG0 B;  1MIJ A;  2AO9 A;  3BTI A;  2OC6 A;  3LSG A;  3JRD A;  1J59 A;  3PNY A;  2QGU A;  1B6A A;  5C4X J;  3DTK A;  2R7U A;  3LSJ A;  1YW9 A;  2FEZ A;  1I50 J;  1U5T A;  2CUZ A;  4XRS G;  3GVA A;  2EIJ H;  3K69 A;  2COB A;  2EV5 A;  1WHU A;  1UG2 A;  3WHB A;  2LLK A;  3SZT A;  3NQO A;  4HBL A;  1QZE A;  4BQQ A;  4AYB N;  4ESF A;  2HZT A;  1LJ9 A;  3A03 A;  3FXL A;  4L9T A;  4CCK A;  3V42 A;  5EEH A;  3H92 A;  2XGC A;  3PUF A;  2LF7 A;  3S8P A;  2CGP A;  3OYD A;  4HV5 A;  3CLQ A;  3BP8 A;  1HCR A;  2L0K A;  2E19 A;  1T38 A;  3C3W A;  4Y17 A;  3JSO A;  4U7B A;  4BAC A;  4EJV A;  3MZ8 A;  1A04 A;  5J1Y A;  1XS9 A;  3FMS A;  3ULQ B;  2ELH A;  1AWC A;  2ZB9 A;  1HW5 A;  2NOJ B;  3ZQ7 A;  3OYH A;  2JA6 J;  1WFX A;  1XMK A;  1B8I A;  4V19 K;  3C1D A;  2FX0 A;  3UKG A;  3MEX A;  3L9F A;  1Z21 A;  1D5Y A;  3PFI A;  4EQQ A;  1R00 A;  1G3S A;  4GYG A;  5J1R A;  5K5R A;  5GTI C;  5JHU A;  2R5Z B;  2XAH A;  1D0Z A;  5D6E A;  2OTJ I;  3CZ6 A;  2JA8 J;  4JOM A;  4I6Z A;  3F6O A;  5GTH C;  2AHQ A;  2HDW A;  2L5Q A;  3MWM A;  3U2R A;  2NRA C;  1WZ2 A;  2KMU A;  3WE2 A;  2MD5 A;  3DPL C;  3BR6 A;  4A3L J;  1X2N A;  2HZD A;  1JHH A;  2M1B A;  4C30 A;  5ILV A;  4F7Z A;  1ZLJ A;  3G71 I;  3H5N A;  5HNF A;  2R93 J;  2VPL A;  1SD4 A;  3ERM A;  4KA4 A;  2DW4 A;  5FKK A;  2E5N A;  5H20 A;  5FRO A;  3LSP A;  3C2B A;  3TOA A;  4U0V A;  4D1Q A;  3L2C A;  3S17 J;  2EIL H;  5BS6 A;  4M73 A;  4X1E A;  5DUI A;  1GV2 A;  1YTY A;  1T98 A;  5EEG A;  2HYJ A;  3S16 J;  3G4S I;  2DQL A;  2YPR A;  2QKL B;  4L0Y B;  1SFX A;  1PYV A;  1YFH A;  3CCQ I;  1G8X A;  1I1G A;  3DKX A;  3ZQG A;  2ZCW A;  4WWC A;  2HNH A;  3FHN A;  2A6T A;  2C6Y A;  4A3B J;  2VKE A;  4WCG A;  4AVZ A;  1SVL A;  3VOE A;  5IOZ A;  3REO A;  2XAF A;  5IYD J;  1W4M A;  3F21 A;  2IAI A;  4BJT A;  4D5C A;  3BG9 A;  4A3M J;  4DYQ A;  4KMF A;  2UXX A;  1QA6 A;  3CLO A;  5HDK A;  4BQO A;  1Z67 A;  1VQN I;  3S2D J;  3U9G A;  4IEJ A;  3HBL A;  3M1E A;  4CSW A;  1BI1 A;  1TC3 C;  2GM4 A;  2GXB A;  2ME6 A;  2WAF A;  4P9F A;  1H89 C;  4B47 A;  2B9S A;  3J81 Z;  1WJD A;  5CPR B;  2HVQ A;  4P5O A;  2J5O A;  4XKV A;  3GTK J;  2HXI A;  2OA4 A;  2F6C A;  4E7S A;  4JQF A;  1HLV A;  4NBQ A;  3DTE A;  1UEL B;  5HNH A;  4U87 A;  1VQ7 I;  2A05 A;  2VBX A;  3IUO A;  5TGT A;  2O5R A;  4M3B A;  1FOK A;  3HXL A;  2V1D A;  2XAS A;  4XKC A;  3M1C A;  3W3C A;  3GFM A;  3PSI A;  4PGH A;  2DJI A;  3CCU I;  5JR3 A;  3M8F A;  2MSY A;  5LD2 C;  3KP7 A;  3I71 A;  3IL2 A;  1QQI A;  4II2 A;  1YS7 A;  4BEH A;  1MBG A;  1Y1W J;  2Z99 A;  3GTL J;  1ZGA A;  4HST A;  3I56 I;  2VPR A;  4GO1 A;  1IAW A;  2EH3 A;  2VQL A;  1S72 I;  2NYX A;  2L01 A;  4N4N B;  5GAH J;  3E1S A;  3HKZ A;  2O0Y A;  2JK3 A;  4FIS A;  3I5U A;  3CME I;  2B0L A;  2OJE D;  1ZR4 A;  3QP6 A;  5LLQ A;  2VE8 A;  4CYC B;  4IL6 C;  3RPU D;  2H27 A;  4FAS D;  2DAO A;  1XSD A;  2CW7 A;  4C2T A;  1PUF A;  4ESB A;  2Y48 A;  1UHM A;  2X4H A;  4PJJ A;  2IJL A;  1OCZ H;  2YR2 A;  4WF2 A;  3IRR A;  1ZRE A;  2VXZ A;  4XSX F;  4XLA A;  3S1Q J;  4JK1 X;  3QP5 A;  1R1U A;  1QPM A;  2Q8K A;  1VI0 A;  3FXU A;  3S32 A;  1RUN A;  2IS2 A;  1O7L A;  4OAY A;  2D2W A;  1YO5 C;  4NC8 A;  3HZJ A;  2RGV A;  3LST A;  3ABU A;  4HZF A;  2RV8 A;  2LC2 A;  1PP7 U;  4PK4 A;  5L3G A;  1VQ4 I;  1ULY A;  4BAY A;  4G8X A;  2CUJ A;  3JCU C;  5E20 A;  3WTT C;  2FNA A;  2QEN A;  4MFD A;  4XN0 A;  3CF2 A;  3GCM A;  5KNL A;  3ZP5 A;  3HHH A;  2XSD C;  1YI2 I;  4Z6Y A;  2VOD A;  5J1U A;  4KFC A;  2D5V A;  1O57 A;  3HOU J;  2BGC A;  4I0B A;  2XAG A;  1K83 J;  5DDG A;  2Y2Z A;  1IF1 A;  3DKW A;  4ENK A;  1ZK8 A;  2GAU A;  1H88 C;  2L9V A;  3IKV A;  1D0Y A;  3JAM K;  3HIF A;  4H4K C;  3JRI A;  4P1W A;  4A93 J;  2P81 A;  1DGW Y;  2EFQ A;  3H5A A;  2B63 J;  4UVB A;  2R5Y B;  1V55 H;  2V1N A;  5A2Q K;  4A3G J;  1DPU A;  4YIR X;  2HTS A;  3SEZ A;  3IH2 A;  3BG5 A;  1GV5 A;  5D4S A;  1YHQ I;  1LE8 B;  2STW A;  1KA8 A;  5FO5 A;  4XK4 A;  2F4I A;  4BQN A;  2MGQ A;  2JRM A;  4CCO A;  1P6R A;  2P0W A;  2QA4 I;  5BPI A;  4O6J A;  4ZJZ A;  1U6G A;  1ZTR A;  1YE9 A;  3V8J A;  1OYI A;  1ETY A;  1WPK A;  2NS0 A;  5F1J A;  4CO8 A;  3CCJ I;  5CVV A;  1PJR A;  4BXF A;  3CMM A;  3WGG A;  5IPA A;  1X2M A;  2BY3 A;  2E71 A;  3KEY A;  2CFO A;  2KRC A;  1QZY A;  2CRG A;  3FKI J;  4ANJ A;  5E8I A;  3G1O A;  4I0A A;  4JBA A;  4NQW B;  1OCT C;  2Y69 H;  3HUG A;  3K1P A;  3HM5 A;  3GFL A;  4A6E A;  3ZGK A;  2KL4 A;  2L7F P;  4BXX J;  1LFB A;  1MMA A;  3BDD A;  4UHT A;  5EZG A;  1J5Y A;  2ACJ A;  5LRS A;  1W5T A;  4AIJ A;  3PQJ A;  4BJ5 C;  1K78 B;  1LVK A;  2L9N A;  3K2A A;  2CW0 F;  3O6B B;  5KCM A;  4IHW A;  3FBN B;  4EM0 B;  3P9C A;  4PUS A;  2R7D A;  2DA1 A;  1VQ9 I;  3RZO J;  2Y9Y A;  2VI6 A;  1WSU A;  2MC3 A;  4ZYH A;  2M2E A;  4RB2 C;  3I59 B;  4F91 B;  1ZG3 A;  1ODD A;  2Z16 A;  4L5J A;  5F64 A;  3AAF A;  4XIC A;  2XVC A;  1SFK A;  2STT A;  4B44 A;  2Y31 A;  5TRD A;  2JT1 A;  2DLL A;  5F0F A;  2PMZ N;  3DLL F;  1UB9 A;  2COM A;  4ZYD A;  5FFZ A;  1Y1V J;  1VFC A;  5DS9 A;  1UST A;  5IT9 Z;  2EFP A;  4BDZ A;  3EUA A;  3NWS A;  4B8X A;  2KRH A;  2HU9 A;  2P8T A;  2IA1 A;  1JT0 A;  4BE0 A;  1SFU A;  3JRE A;  2GBY A;  2HPI A;  4DQ2 A;  1ETV A;  4A3F J;  1TBX A;  3CUQ C;  4E7J A;  1G3Y A;  4AM3 A;  3HL2 A;  2DMP A;  1I27 A;  2LSO A;  4KIF A;  2E36 A;  4KIB A;  1J7K A;  3W2A A;  4Z2Y A;  2K7L A;  3KLN A;  4A3D J;  3LFK A;  2WA0 A;  3DQV C;  4AIH A;  4S04 A;  4U0Y A;  2IT0 A;  5FLV A;  1BIA A;  2ISZ A;  3DFG A;  3HTS B;  2L4M A;  3FZV A;  2MH2 A;  3QOE A;  3EUH C;  3G2B A;  1T08 B;  4C3J J;  5HLI A;  2HOE A;  2CMP A;  1T39 A;  1P4A A;  4BS9 A;  1B9N A;  2XRL A;  4XID A;  2NVX J;  1MH3 A;  1R4N B;  2DA4 A;  4RAY A;  4HLY A;  1CF7 A;  4RA2 A;  3TOB A;  5E79 C;  3L7W A;  2JZY A;  5ILS A;  1FEX A;  1EV7 A;  1W36 D;  2LKS A;  4JX6 A;  5KHD A;  1IO2 A;  5L3E A;  3TKY A;  3BR0 A;  4A2U A;  2BW3 A;  3P9K A;  1VQ6 I;  1YJ9 I;  4DYC A;  2XPU A;  1AHD P;  5M5W J;  2BY2 A;  2QQ9 A;  3T0Y A;  2JJ7 A;  2R0Q C;  3I3L A;  4M71 A;  1IC8 A;  2J5P A;  1MMS A;  1EF4 A;  5IP6 A;  1IN6 A;  1JXS A;  2NVY J;  4ENM A;  4XLE A;  2IA0 A;  3TL4 X;  3W6J B;  5IT3 A;  3R4K A;  1ETX A;  3OV8 A;  5LHG A;  4IQJ A;  2KIF A;  2V1U A;  3H9G A;  1TWF J;  4EM2 A;  1SD7 A;  5E3M A;  4EGY A;  4M6Y A;  2E1O A;  5E1X A;  1ITY A;  3OYB A;  2O9L A;  2CUF A;  2KDZ A;  1E2X A;  3F23 A;  4KDP A;  3G3Z A;  3COA C;  4A3I J;  6PAX A;  2VKD A;  4M3E A;  4CIC A;  4ZDP A;  2RNJ A;  4IF4 A;  2X0L A;  1ZGJ A;  1RET A;  4LIV A;  2CQQ A;  3V4G A;  2DBB A;  1OR7 C;  2O8X A;  4ETS A;  4MFE A;  2CSO A;  3W6K B;  2X85 A;  1VZ0 A;  3CUQ A;  3QPL A;  2A5Y B;  2BHZ A;  1GDT A;  2BYV E;  4K2E A;  2DFH A;  1PDN C;  2FU4 A;  4UXN A;  3BR2 A;  1BC7 C;  1RNL A;  3P7N A;  1IG7 A;  2LF8 A;  1FYK A;  2IVM A;  3MMY B;  1P7I A;  5IP7 J;  2JA5 J;  1OMI A;  1TWC J;  2K9L A;  4DNC A;  2OTL I;  1RUO A;  2QSG X;  4ESJ A;  1OCC H;  4JYK A;  3PIO F;  1Z7U A;  2P6S A;  3BWG A;  2IW5 A;  3KE2 A;  4ZTF A;  2R7T A;  2PBI A;  3KYD B;  2ZME B;  3QU6 A;  4EAT A;  4B3A A;  4Y7N J;  4CZC A;  9ANT A;  2H09 A;  2RNG A;  1TW2 A;  3H3Z A;  4MQV A;  3EET A;  1I6X A;  2RKH A;  1T95 A;  1Z6T A;  3EDP A;  2CWE A;  2BY1 A;  2YX7 A;  2LTP A;  1BL0 A;  2R7S A;  1L3L A;  2CH0 A;  3TQN A;  1QPI A;  5ICC A;  3GTP J;  3VYS B;  2EQR A;  2DA7 A;  4MLO A;  1SFE A;  1OLT A;  4HQM A;  5BMZ A;  1JHF A;  1R1V A;  3BG6 A;  2CV0 A;  5AIP A;  4LG0 A;  2LRD A;  3GZ5 A;  5BPD A;  2L2O A;  1TT5 B;  4PZJ A;  1I3A A;  5K5Q A;  2JUG A;  2YU9 J;  2GOM A;  3HSF A;  5AON A;  4HDU A;  1WJF A;  2LKX A;  4HNV A;  4M6X A;  2VN2 A;  3V8K A;  5IP9 J;  3GXO A;  3AG2 H;  5EEA A;  3ZMZ A;  3SXY A;  1ENH A;  2E7X A;  2DPU A;  3J81 K;  5LHH A;  1BIB A;  4I99 C;  3N97 A;  2CV2 A;  4QSH A;  1ONV A;  3K70 D;  3AG1 H;  1A36 A;  4KJZ A;  3HTU A;  3MZY A;  3ZR8 X;  3LAP A;  2O03 A;  2OUM A;  2E1M B;  2ZNZ A;  5JHF A;  3GYH X;  4CH7 A;  3P5J A;  4DJA A;  4LK0 F;  4IVN A;  1ZG5 A;  2ZJ2 A;  2EZK A;  4BYY A;  5M5X J;  1RI7 A;  4OAZ A;  2GQQ A;  2HOA A;  4LLN A;  3E7L A;  2CO5 A;  3KEQ A;  3SJM A;  2AS5 F;  2X6O A;  3E5Q A;  1R5G A;  1EA3 A;  5GP9 A;  4KNY A;  2LRE A;  2M8E A;  1PVE A;  1WKM A;  1MJ9 A;  4OIP F;  3HYI A;  2MW8 A;  1FC3 A;  2QQA A;  2VQH A;  3C2H A;  1ZGW A;  5E18 F;  2K3F A;  2JN6 A;  4H0E A;  1D8K A;  3M9A A;  5FKM A;  3O2P E;  1GVJ A;  4I01 A;  2IGK A;  1M1E B;  4BNC A;  2X9D A;  4HNU A;  3KZI C;  4OIN F;  3JRF A;  1D8J A;  2R5Z A;  4A3K J;  2QUF A;  2XGX A;  5JLW A;  1IN7 A;  1ETK A;  2CQ7 A;  3ZMV A;  5K7H A;  1T0F C;  2ID6 A;  2LY2 A;  3ABK H;  3NEU A;  1RC9 A;  5TJJ A;  2NS7 A;  4EJT A;  1RKW A;  4XLN F;  2ZJR F;  4RAG A;  1TNT A;  3GLL A;  4IOC F;  1FOW A;  2FBK A;  5J4V A;  4N4O B;  3DEU A;  3KYL A;  4HX4 A;  3JRC A;  3ZN1 A;  3VYR B;  1TT0 A;  2O6G E;  5HDN A;  2DOD A;  4ENJ A;  2KIM A;  2BVL A;  5HS7 A;  2ZSH B;  4BJ6 C;  4RB3 C;  2O61 A;  2RN7 A;  2XRN A;  5E1Z B;  2KFD A;  5FD5 A;  5LFA A;  3ZXS A;  2ZJP F;  1OQY A;  4FE7 A;  3F8B A;  2V9P A;  2Z1D A;  1SC7 A;  1XDU A;  2W00 A;  1QHG A;  2QZ8 A;  4E6K G;  1HW2 A;  4G94 A;  2N8G A;  2X1E A;  3TO9 A;  2R3S A;  1MSE C;  1BOA A;  3LAJ A;  5J3L A;  2NS8 A;  3TP3 A;  1BA5 A;  1DU6 A;  4NC6 A;  5FD6 A;  4P55 A;  5B3S H;  3A01 B;  2ETH A;  4RGS A;  2HR3 A;  4OIR F;  1MBK A;  3T1B A;  2BEO A;  5JFR A;  2L3D A;  1YJN I;  3SFI A;  4TV7 A;  3S2W A;  2VE9 A;  4UVC A;  3ABL H;  2XDV A;  1G4D A;  1IDY A;  3LSR A;  5K5O A;  2CQX A;  3SDB A;  3IP4 B;  1XTA A;  3DEE A;  4XKW A;  1E17 A;  3KP4 A;  3GO5 A;  4JX5 A;  1ZLK A;  4ZDO A;  2VLA A;  3R60 A;  2TDX A;  2LDU A;  2XF6 A;  5B66 C;  3GFJ A;  1AA7 A;  3LQQ A;  3HRM A;  1Y8Q B;  4GYI A;  2OZU A;  3PJR A;  3HRT A;  1ZRD A;  2FUG 2;  3E6D A;  3CDL A;  2V9V A;  1IRF A;  4IZZ A;  5DD8 A;  1T0F A;  3TGN A;  2M9H A;  1IRG A;  2HQA A;  4IKF A;  3M8J A;  3CO6 C;  2VUM J;  4XRF A;  2BE5 F;  3GZN B;  1QBJ A;  4S0H B;  1NK3 P;  3K9T A;  4BXU A;  2NVQ J;  4O5V A;  1YW8 A;  4FTH A;  1STZ A;  2HYF A;  4C3I J;  4W97 A;  3U1D A;  2M87 A;  2DI3 A;  3AG3 H;  1GHC A;  2R7X A;  2OAZ A;  2DMN A;  3DBL B;  1EJ9 A;  4OOI A;  3CJR B;  4DBR A;  1YOV B;  1WJA A;  4EJW A;  1ZR2 A;  1F9N A;  3GEZ A;  4KN4 X;  3GLX A;  2H8W A;  1S7E A;  1LEB A;  2IA2 A;  3SDG A;  2DO7 A;  1DP3 A;  3D5R C;  1MH4 A;  2VQG A;  1U0J A;  3V7C A;  1ZN2 A;  4R8H A;  3ZMT A;  2LD5 A;  1WCM J;  4ZYE A;  5FLX Z;  2A5W A;  2JSP A;  1VF9 A;  1KYZ A;  5IT9 K;  2W4S A;  3RQI A;  1G3W A;  2I5U A;  1Y39 A;  3S3M A;  4DZP A;  3WTU C;  4EM1 A;  3ZPL A;  4MNU A;  5F04 A;  1LPQ A;  1V5G A;  2FBH A;  5KVR A;  2V26 A;  2V6E A;  3S2H J;  1BI2 A;  3HB9 A;  2JMW A;  1DU0 A;  2PJR B;  2H6B A;  2E1C A;  4L18 B;  4MO7 A;  2K4J A;  3S3N A;  4M72 A;  3TDU C;  3LSM A;  5FKO A;  4J19 A;  1N25 A;  2IS1 A;  1LDJ A;  5CJ9 A;  3IWF A;  1WJE A;  2KIS A;  2Z3Y A;  1JUP A;  4BHB A;  1Z05 A;  2W7N A;  1DUX C;  1VQ8 I;  3M4O J;  2IRF G;  3WHC A;  2OD5 A;  2VC1 A;  3FK6 A;  1WQ2 A;  3K0L A;  3VSL A;  1SMT A;  4IHY A;  1XMX A;  2L7M P;  2XAU A;  4UNO A;  3VSK A;  2G9W A;  2VKH A;  3HOS A;  4MHG A;  1REP C;  1GT0 C;  5HS8 A;  3Q5F A;  3ZQL A;  3M3Y J;  2R5Y A;  3CDH A;  4MEX F;  2XRO A;  1LDD A;  1R5I D;  1LE8 A;  1IV8 A;  2OCC H;  2F48 A;  3VOD A;  2LP0 A;  1TQI A;  3ZRG A;  3QYF A;  2P5L C;  1H0M A;  3G6E I;  4KT6 A;  2MYS A;  2X1C A;  3OL4 A;  3OYL A;  1QNT A;  2M7B A;  2CQK A;  2GZW A;  2VXD A;  4GRI A;  4LLL A;  2FQ3 A;  3T8T A;  3L00 A;  4Y13 A;  5D8K B;  1HF0 A;  3K2Z A;  3BZK A;  2GIV A;  2YS9 A;  3OWT A;  4MGR A;  4HDV A;  2ZKZ A;  2ZNY A;  3U1K A;  4Q48 A;  3WG9 A;  2ECB A;  3C7J A;  3JR9 A;  2JVG A;  2LYC A;  1BM9 A;  3SFZ A;  4ENN A;  1MMG A;  2R7Q A;  3TDZ C;  1VQM I;  1IGN A;  3E6B A;  2E2I J;  1TQP A;  2P6T A;  3VEP A;  4NQW A;  2ADU A;  2DOE A;  2NOG A;  3SZG A;  4E7Z A;  4FCY A;  5BOX A;  3CDI A;  1EH6 A;  5L3B A;  2VAS A;  2V6C A;  2ZJQ F;  3G1L A;  4HA8 A;  2MLG A;  1H9G A;  3KPH A;  3H3V K;  1BC8 C;  3L09 A;  5H6Q A;  4YIF A;  1K78 A;  1K4S A;  2IS6 A;  5DD4 A;  2IXS A;  4HSR A;  1ACI A;  5IOY A;  2M45 A;  3SHF A;  4UUS B;  2ZBK A;  3K1N A;  1DQU A;  3I59 A;  1F4K A;  3LMM A;  4WX9 A;  1IUY A;  1UG0 A;  4LFU A;  2OV7 A;  1MGT A;  3K4N A;  5C4J J;  2YUS A;  1SMY F;  2EV6 A;  4AU7 A;  3BZC A;  1JGG A;  2QSH X;  3S1M J;  1HKT A;  2K27 A;  2NNN A;  1X19 A;  1LDK B;  3JRA A;  2VBW A;  2LOO A;  3FWE A;  1B72 B;  2WBM A;  4D0P A;  3PNT A;  5F0C A;  3O8G A;  1Z77 A;  4XNF A;  5LGU A;  1MZB A;  3CJQ B;  3ZQF A;  5K1Y A;  1LFU P;  3H9J A;  2E35 A;  4C9Y A;  1ZRF A;  4RLF A;  1UAA A;  4LK1 F;  1FIA A;  2AQF A;  4PGG A;  5E1W A;  4CHU A;  1FOX A;  2X6W A;  1YX3 A;  2E1N A;  4YEJ A;  1N77 A;  1W7P D;  2DA6 A;  3D0S A;  2DA5 A;  2HI3 A;  4EVI A;  2W24 A;  2M34 A;  2FA5 A;  1SD5 A;  3CMY A;  3BZ6 A;  1X3Z B;  2JPC A;  3GX4 X;  3JSP A;  2I10 A;  4IO9 F;  4ON0 A;  4A0Z A;  3GWZ A;  2A07 F;  2F5E A;  4RS8 A;  2WAQ N;  3AFH A;  1YIT I;  1I3Q J;  3RKY A;  3FXJ A;  2R7V A;  1AKH B;  1R4M B;  2ZME C;  1MJB A;  1LFP A;  4I09 A;  2WTE A;  4CUG A;  1KQ8 A;  2Q1Z B;  3N4M A;  4ASN A;  2IS4 A;  3ZQQ A;  2WB1 A;  1ZKG A;  4RGX A;  2VC0 A;  5FLM J;  1VQL I;  2XPV A;  3CJT B;  4A6D A;  2OPT A;  4CDG A;  1LVA A;  4QPQ A;  3RCO A;  4UY8 I;  3DTI A;  4PJL A;  1IV6 A;  4CZZ A;  2NXN B;  2HS5 A;  1WRJ A;  4XON A;  3GFI A;  2QCO A;  4FQG A;  2PG4 A;  4UB8 C;  3RPU A;  4O3M A;  4KN7 X;  2VQC A;  2JVH A;  1E3O C;  4BQA A;  3QPT A;  4Y15 A;  3JRG A;  5HS9 A;  1WI9 A;  1XGM A;  4XOR A;  1XSV A;  2ZXW H;  3BR1 A;  3HGY A;  5CVU A;  1QVT A;  4BBR J;  3H36 A;  5E3O A;  4DOZ A;  2FNP A;  4MTE A;  1HXD A;  1JUS A;  5KAI C;  3ZQI A;  3BTL A;  3RIR A;  3G1M A;  1AOY A;  2TCT A;  4G12 A;  1W5S A;  2IEK A;  2RQQ A;  1V4R A;  3T5X A;  1W5C C;  4BHP A;  5EJC A;  3AL0 B;  1O4X A;  2GA2 A;  3LL7 A;  4LLG F;  1TL8 A;  2PN6 A;  1UHW A;  2E1M C;  1D1A A;  3P9I A;  3IHU A;  4HX7 A;  3T8R A;  2K3P A;  3E6M A;  4XOP A;  2A6H F;  1FNN A;  1UMQ A;  2BV6 A;  3EPZ A;  4KYW A;  5EZH A;  1BN5 A;  3IC7 A;  1FP1 D;  2QQ8 A;  4WXD A;  1BJA A;  4A0Y A;  1BI0 A;  1FJL A;  5DV5 A;  2GIZ A;  2KHM A;  3GF2 A;  1XX5 A;  2L02 A;  3OYF A;  1R22 A;  2O3F A;  5F08 A;  3BJO A;  3PUB A;  2DXI A;  1UFM A;  5D5V B;  1B59 A;  3IKT A;  2Z9O A;  2ZSI B;  3Q0V A;  1VQP I;  5EG0 B;  1FBU A;  3J7A Y;  3W2V A;  3DEW A;  1BW5 A;  1TWA J; 
#chains in the Genus database with same CATH homology
 2AO9 A;  3BTI A;  3GTP J;  3LSG A;  3JRD A;  5HOD A;  2EQR A;  4RBO A;  2ME0 A;  5C4X J;  1IDZ A;  2DA7 A;  4MLO A;  3LSJ A;  2EZI A;  2HXO A;  4QTR A;  5C44 J;  4B1R A;  1I50 J;  3HEF A;  1JKR C;  5EGO B;  5EG0 A;  1I6H J;  4XRS G;  2R92 J;  3HOZ J;  2COB A;  2YU9 J;  2LKX A;  1UG2 A;  4HNV A;  5GPA A;  3WHB A;  2LLK A;  5IP9 J;  4AYB N;  3A03 A;  5FKL A;  4D7M A;  2Y0S N;  5EEA A;  2XGC A;  5EGO A;  1NK2 P;  1ENH A;  3TP0 A;  2CUE A;  2HOS A;  3LNQ A;  1HCR A;  2L0K A;  2E19 A;  2OF7 A;  2XGD A;  1GVD A;  4A3C J;  4QSH A;  5J1Y A;  1B8I B;  1XS9 A;  3BQY A;  1SFO J;  4JX4 A;  2ZB9 A;  3F0C A;  2JA6 J;  2K9N A;  2EZK A;  5M5X J;  1B8I A;  5K7Z A;  2HOA A;  3E7L A;  2FX0 A;  3UKG A;  1UHS A;  3SJM A;  2X6O A;  5EF6 A;  5GP9 A;  1D5Y A;  2MG4 A;  3BT9 A;  1F36 A;  1U9N A;  5JLX A;  5J1R A;  1FIP A;  1ZGW A;  2MW8 A;  1IRZ A;  2R5Z B;  2H1K A;  2JN6 A;  1ETQ A;  2JA8 J;  5K7F A;  2LFB A;  4I6Z A;  5FKM A;  2AHQ A;  1IUF A;  2GLO A;  2JA7 J;  2X9D A;  4BY7 J;  3BR6 A;  3FK7 A;  1XC5 A;  3JRF A;  4A3L J;  1X2N A;  2R5Z A;  4A3K J;  2O7O A;  1OJL A;  5JLW A;  1ETK A;  2R93 J;  5K7H A;  2ID6 A;  1JJ8 C;  2NS7 A;  5FKK A;  1RKW A;  4B4C A;  2DMQ A;  3LSP A;  1MBJ A;  3C2B A;  2XB5 A;  4AC0 A;  3S17 J;  2EZH A;  4X1E A;  1GV2 A;  2DTZ A;  1GUU A;  2HYJ A;  3QPS A;  3S1N J;  3S16 J;  3JRC A;  2TRT A;  5F27 A;  3CCY A;  2CJJ A;  3ZQG A;  4A3B J;  2VKE A;  1BJZ A;  5IOZ A;  3BTJ A;  4FE7 A;  1Z0X A;  5IYD J;  1OCP A;  3B6C A;  5M3M J;  2IAI A;  3QQA A;  3O8H A;  4C3H J;  3BG9 A;  4D5C A;  4A3M J;  3BTC A;  2N8G A;  2XGE A;  4DYQ A;  1MSE C;  1IJW C;  1NTC A;  2WV1 A;  5J3L A;  2NS8 A;  3TP3 A;  4JP0 A;  1BA5 A;  3S2D J;  1DU6 A;  3IV5 A;  3A01 B;  4IEJ A;  3HBL A;  1TC3 C;  3S14 J;  1ETW A;  2GM4 A;  2LK2 A;  1MBK A;  2ME6 A;  1H89 C;  3SFI A;  2W48 A;  3A01 A;  3GTK J;  2HXI A;  1IDY A;  5BNG A;  3PO3 J;  3LSR A;  1HLV A;  1WH5 A;  1JJ6 C;  2CQX A;  1WGX A;  4JX5 A;  4M3B A;  3MN2 A;  4I76 A;  2MSY A;  4A3E J;  1MBG A;  1APL C;  4DZJ A;  4LOC A;  3CDL A;  1Y1W J;  3GTL J;  4V2F A;  1CQT A;  1SAN A;  2M9H A;  1WH7 A;  4FE4 A;  2E2J J;  2NVT J;  2VPR A;  2EH3 A;  2VUM J;  4BBS J;  3DCF A;  2DA2 A;  3B6A A;  4S0H B;  1RR7 A;  1K61 A;  1NK3 P;  1PUF B;  2JWT A;  2CU7 A;  3HOY J;  2XB0 X;  2NVQ J;  2Y30 A;  4FTH A;  2JK3 A;  4FIS A;  4C3I J;  4W97 A;  1ZR4 A;  1TWG J;  2DMN A;  4CYC B;  1PUF A;  1ZR2 A;  2IBD A;  1S7E A;  3ZQC A;  3S1Q J;  3H0G J;  3SDG A;  4M3G A;  3OIO A;  1MH4 A;  4IHX A;  2ELK A;  2LD5 A;  1VI0 A;  1WCM J;  2G0E A;  5E3N A;  1VF9 A;  4W1U A;  1OFC X;  3RQI A;  4DZP A;  3NAR A;  5F04 A;  5FKN A;  1Q1V A;  1FTZ A;  3BQZ A;  2K40 A;  4MFD A;  5C3E J;  5IYC J;  3S2H J;  3HB9 A;  1DU0 A;  2JMW A;  3D1N I;  4M6V A;  3Q0U A;  2XSD C;  4XRS A;  5J1U A;  4MO7 A;  2D5V A;  2M0C A;  3HOU J;  1JTY A;  1MBF A;  1K83 J;  1U78 A;  5FKO A;  2Y2Z A;  4J19 A;  3I4N J;  1ZK8 A;  1H88 C;  1POG A;  1JUP A;  3JRI A;  2L9R A;  4A93 J;  2P81 A;  5E3L A;  2R7Z J;  3JRB A;  2B63 J;  2R5Y B;  3M4O J;  2E2H J;  4NDL A;  3WHC A;  4A3G J;  3FK6 A;  4IHY A;  3RKQ A;  5DTD A;  2L7M P;  3BG5 A;  1GV5 A;  3IH2 A;  1LE8 B;  3K7A J;  3Q3S A;  4XK4 A;  2DA3 A;  2MGQ A;  1GT0 C;  3HGG A;  3ZQL A;  3M3Y J;  2R5Y A;  5EYR A;  2LY9 A;  3W6V A;  1W0U A;  1MBH A;  1ZTR A;  4RDU A;  1WPK A;  1ETY A;  4DYR A;  1LE8 A;  1JTX A;  5F1J A;  2HOT A;  2LP0 A;  3TW6 A;  3JRH A;  4A69 C;  2L7Z A;  1MNM C;  2M8G X;  3PO2 J;  5IPA A;  1X2M A;  1U9O A;  3GTQ J;  2FQ4 A;  3IH3 A;  1VND A;  2DN0 A;  4BY1 J;  2CRG A;  3A02 A;  3FKI J;  1HF0 A;  2KT0 A;  3MKL A;  2FJ1 A;  2YS9 A;  3G1O A;  1H8A C;  1OCT C;  3HM5 A;  3JR9 A;  4X6A J;  2ECB A;  1TWH J;  1YRN B;  2L7F P;  4BXX J;  1LFB A;  5EZG A;  1IGN A;  1JT6 A;  2E2I J;  1JUM A;  4IHW A;  3K2A A;  2NOG A;  4FCY A;  3RZO J;  2DA1 A;  1YRN A;  2Y9Y A;  2VI6 A;  3G1L A;  2M2E A;  3H3V K;  3TW7 A;  3HKZ N;  3IH4 A;  2ECC A;  3BG3 A;  2K9Q A;  2FD5 A;  3NAU A;  4XIC A;  1RES A;  1JKO C;  5GPC A;  1U8B A;  3L1P A;  2Y31 A;  3CQZ J;  5IOY A;  2O8K A;  4UUS B;  5F0F A;  2PMZ N;  1FTT A;  3LOC A;  4DW6 A;  4M3D A;  1Y1V J;  1VFC A;  5DS9 A;  4MIM A;  5C4J J;  3GTO J;  1BW6 A;  2YUS A;  3HOV J;  1JGG A;  3S1M J;  4UUS A;  1RKT A;  3HOW J;  4A3J J;  1QRY A;  1JT0 A;  1G2H A;  3JRE A;  1ZQ3 P;  2GBY A;  4UUT A;  3JRA A;  1B72 B;  1ETV A;  1QVU A;  4A3F J;  1R9T J;  3GBG A;  5F0C A;  2DMP A;  2Y9Z A;  3O8G A;  1Z77 A;  3ZQF A;  1LFU P;  3ZQH A;  5M3F J;  4A3D J;  1AU7 A;  1P7J A;  4CYC A;  3Q0W A;  1B72 A;  1RPW A;  5F0H A;  1FIA A;  2K9S A;  5FLV A;  3BR3 A;  4BKX A;  3GTG J;  2ID3 A;  2DA6 A;  4D5F A;  1ORK A;  1T33 A;  4C3J J;  2DA5 A;  3GTJ J;  2HI3 A;  2EBI A;  2M34 A;  1WI3 A;  2WB1 N;  3CMY A;  2XRL A;  4XID A;  3MVP A;  2NVX J;  1MH3 A;  3ZOB A;  2DA4 A;  2I10 A;  3FIW A;  4ABZ A;  2WAQ N;  5IYB J;  1I3Q J;  5M5Y J;  2DMT A;  4L5E A;  4XRM A;  5FJ8 J;  1JKP C;  1AKH B;  2HQ5 A;  1FEX A;  4JX6 A;  3OSG A;  4M3F A;  3BR0 A;  4GFB A;  2RAE A;  2VKV A;  3FIS A;  4D7N A;  4QIW N;  1BL0 A;  3S15 J;  2DMU A;  4DYC A;  3TED A;  2XPU A;  1AHD P;  2HDD A;  3GTM J;  1ZKG A;  5M5W J;  2JJ7 A;  1AKH A;  2R0Q C;  5FLM J;  5EDN A;  1IC8 A;  1EF4 A;  1HOM A;  1A6I A;  2XPV A;  3VPR A;  5IP6 A;  2OPT A;  2H8R A;  2NVY J;  1IV6 A;  1ETO A;  1ETX A;  1XG1 A;  1MSF C;  1TWF J;  2QCO A;  5E3M A;  2E1O A;  3BR5 A;  4EEF G;  1W0T A;  1ITY A;  2O9L A;  2XPW A;  1X58 A;  2CUF A;  2KDZ A;  1E3O C;  3JRG A;  4A3I J;  4M3E A;  3BR1 A;  3HGY A;  1QVT A;  1RET A;  4BBR J;  5E3O A;  2CQQ A;  3ZQI A;  1JUS A;  2X48 A;  3BTL A;  4MFE A;  3G1M A;  2TCT A;  4G12 A;  2IEK A;  3OOU A;  3QPL A;  1GDT A;  3S1R J;  1HDP A;  1O4X A;  3OSF A;  3HOX J;  4IHV A;  3BR2 A;  3PM1 A;  3I4M J;  1IG7 A;  1UMQ A;  3RZD J;  1A5J A;  5EZH A;  1P7I A;  5IP7 J;  2JA5 J;  1F43 A;  1MBE A;  1HDD C;  1TWC J;  4Y52 J;  4C2M J;  1FJL A;  4JYK A;  1T56 A;  2LVS A;  2DJN A;  2LR8 A;  5F08 A;  3HDD A;  4B3A A;  4Y7N J;  9ANT A;  1JKQ C;  3Q0V A;  4AUX A;  4V2G A;  2QF7 A;  5EG0 B;  3DEW A;  1BW5 A;  2LTP A;  2EZL A;  1TWA J;  1QPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...