3W6VA

Crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
SDPLAEVVAWALEHLHEQFDVETLAARAYMSRRTFDRRFRSLTGSAPLQWLITQRVLQAQRLLETSDYSVDEVAGRCGFRSPVALRGHFRRQLGSSPAAYRAAYRARRPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AdpA
publication title Complex Structure of the DNA-binding Domain of AdpA, the Global Transcription Factor in Streptomyces griseus, and a Target Duplex DNA Reveals the Structural Basis of Its Tolerant DNA Sequence Specificity
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Transcription activator/dna
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3w6vA00
3BTIA 2G0EA 1ETXA 4L5EA 3GTJJ 4D7MA 3S2DJ 2YS9A 4BKXA 3S1RJ 2DMNA 2GM4A 3W6VA 1TWAJ 2ID3A 2HXIA 2JWTA 1TWGJ 1JKOC 5C4JJ 2E2HJ 3S1NJ 2E2JJ 4FE4A 3H0GJ 4M3EA 1WGXA 1JKRC 3BTCA 4MIMA 2OF7A 3SFIA 2H8RA 4BBSJ 1BA5A 3HOXJ 3F0CA 3M3YJ 1I50J 3MN2A 2JK3A 3GTOJ 3JRBA 4A3JJ 3OOUA 5IOZA 1MBHA 1IC8A 2YU9J 2MSYA 3HGGA 1ENHA 1GT0C 5EGOB 1U8BA 3HM5A 1ZQ3P 1JTXA 4AYBN 2ECCA 3Q0UA 1VNDA 2CUEA 1BL0A 1IDYA 3GBGA 2HOSA 3LNQA 1JT6A 4CYCA 1RESA 4A3BJ 3TW6A 3FK6A 2X9DA 3D1NI 1A6IA 3I4NJ 2M9HA 3JRIA 4A69C 5EZHA 1ETKA 1F43A 3ZQHA 3S16J 4M3BA 2LD5A 3O8GA 2L7FP 2ECBA 3S1QJ 2EZKA 4AUXA 1GUUA 2L0KA 4UUSB 5E3MA 1MBEA 2DA4A 5J3LA 4FTHA 1CQTA 1SANA 2LK2A 2FX0A 2LKXA 2FQ4A 2X6OA 1IGNA 4BXXJ 2K40A 3A01A 3FK7A 4BBRJ 1TWFJ 2EBIA 5K7HA 5FKNA 2DJNA 3ZQLA 1PUFB 3MKLA 4MO7A 2R5YB 2LLKA 4EEFG 1TWHJ 2LR8A 1MH3A 3Q0VA 1E3OC 3HKZN 2ZB9A 3BG3A 3OSGA 4JX4A 1VI0A 4XK4A 1YRNA 5EDNA 5M5YJ 2JN6A 2KDZA 5K7FA 1X2MA 2MGQA 3JRDA 4C2MJ 2H1KA 1D5YA 2Y9ZA 3S1MJ 1IJWC 1IRZA 2DTZA 1Y1VJ 3BT9A 1Q1VA 5GPCA 1JTYA 5EZGA 3ZOBA 2R92J 5FKKA 1H89C 1FIPA 2Y9YA 1MH4A 2LVSA 1WCMJ 2CJJA 3IH2A 1MNMC 1JKPC 4JX6A 1UG2A 1WH7A 5F1JA 2R5ZB 4JX5A 1P7JA 4A3CJ 2DMPA 1NK2P 4W1UA 2I10A 4FISA 1OCPA 2Y31A 2MW8A 2DA3A 5IYDJ 1RETA 4BY7J 3HEFA 1JJ8C 1WH5A 4Y7NJ 1ZR4A 1B72B 1XC5A 1ZGWA 1JT0A 5BNGA 1W0UA 3LSGA 2DA5A 4G12A 5IYBJ 1FTTA 4RDUA 2M34A 3BR2A 3LSRA 2DMUA 2XRLA 4DYRA 4MFEA 2ME6A 4B3AA 1APLC 2LY9A 4IHVA 2K9SA 3PO2J 1JUMA 5M3FJ 1ZR2A 4HNVA 2XB0X 3TP3A 4JYKA 1XG1A 2X48A 3OIOA 4NDLA 2CU7A 2EZLA 5C3EJ 4D5FA 2R7ZJ 2M8GX 3FKIJ 5FKOA 3A02A 1ETWA 5F04A 3RQIA 1BW6A 2JA7J 1FIAA 2E1OA 3O8HA 3NARA 2N8GA 3JREA 3RZOJ 4QSHA 1LE8B 4D7NA 1TWCJ 1UHSA 3OSFA 4XRSG 5M5WJ 2LP0A 3BG5A 3QPSA 2Y0SN 4J19A 1G2HA 2XGCA 1U78A 1R9TJ 2AO9A 4IHYA 5FJ8J 2QCOA 2WV1A 4B1RA 2M0CA 3K2AA 5EGOA 5C4XJ 1RPWA 2XPVA 1NK3P 1MBFA 1LFBA 3NAUA 5FLVA 4B4CA 3PM1A 2E19A 4QTRA 5J1UA 2CQXA 2FJ1A 4ABZA 1JJ6C 2DN0A 1QPIA 3CMYA 3FISA 4GFBA 1ZTRA 4S0HB 3DCFA 5GP9A 3Q0WA 2JMWA 5J1RA 2DA2A 4XRMA 3SJMA 4V2GA 4W97A 4IHXA 4D5CA 1B8IB 3GTKJ 2R0QC 3HGYA 2JA5J 2CUFA 1H88C 1H8AC 1Z0XA 1OFCX 1QRYA 1F36A 3G1OA 2GLOA 4Y52J 5JLXA 5IP7J 1GV2A 5JLWA 5EEAA 2CQQA 4UUSA 3IH4A 3GTGJ 4M3DA 1JUPA 2B63J 1ORKA 2VPRA 3A03A 3L1PA 2YUSA 5IYCJ 4A3DJ 4IHWA 3TW7A 1GV5A 2ELKA 5FKLA 3IV5A 3B6CA 3BR6A 2NVQJ 5EYRA 1PUFA 5IPAA 2R5YA 5E3OA 1GDTA 1MBKA 2NVTJ 5M3MJ 2HDDA 2LTPA 1DU0A 1ETQA 3RKQA 2ME0A 1HLVA 4X1EA 2TRTA 4A93J 2K9NA 2VKVA 1K83J 1XS9A 2EZIA 1HDPA 4A3GJ 1AHDP 3E7LA 1NTCA 3FIWA 2LFBA 1RR7A 2XPUA 1JUSA 3GTPJ 1QVUA 3Q3SA 3B6AA 2VUMJ 3HBLA 3BR0A 5FLMJ 4MLOA 1ETOA 2OPTA 5IP9J 3JR9A 4RBOA 2R5ZA 2AHQA 1MSEC 5E3NA 5K7ZA 2TCTA 1WI3A 2NS8A 1BW5A 1DU6A 5EF6A 1JKQC 4IEJA 2D5VA 5DTDA 4C3JJ 4M3GA 2JJ7A 4A3FJ 3H3VK 3BR1A 2O7OA 1POGA 4I76A 4QIWN 1B72A 4A3KJ 1SFOJ 5F08A 5F27A 3CDLA 5M5XJ 4I6ZA 5F0FA 2IAIA 2HOAA 2DMTA 5E3LA 3WHCA 4V2FA 3SDGA 3S17J 1ZKGA 1BJZA 1IG7A 2EZHA 4AC0A 3QPLA 3JRCA 2R93J 4XICA 4A3EJ 5EG0B 1MBJA 1HOMA 3HOYJ 2JA6J 4C3IJ 3TP0A 1X58A 3RZDJ 3K7AJ 3JRGA 1FTZA 1W0TA 3HDDA 2MG4A 3QQAA 5IOYA 3G1LA 4DYQA 1AKHB 2JA8J 1UMQA 1ZK8A 4M3FA 3S14J 2NS7A 5EG0A 1TC3C 4X6AJ 1Y1WJ 3S2HJ 4XIDA 2NVXJ 4JP0A 3VPRA 3S15J 4BY1J 2XPWA 1X2NA 2VI6A 1AKHA 1LE8A 1GVDA 1ETVA 2HI3A 2FD5A 2WAQN 2DA6A 1VF9A 4XRSA 1T33A 2KT0A 4CYCB 3HOUJ 1MSFC 2EQRA 1I3QJ 1OCTC 4M6VA 3JRFA 3UKGA 4A3IJ 3BR5A 3HB9A 1HDDC 2E2IJ 1IDZA 3ZQGA 3IH3A 3PO3J 2L7ZA 2Y30A 3BTLA 1T56A 1A5JA 1OJLA 2PMZN 3G1MA 1LFUP 1IUFA 3BG9A 3LSPA 2L7MP 1RKTA 1ITYA 3C2BA 1I6HJ 2IEKA 3HOVJ 3M4OJ 1FEXA 4LOCA 1B8IA 3A01B 3BTJA 5GPAA 2HXOA 2RAEA 2O9LA 2XGDA 2GBYA 2HYJA 3LSJA 2K9QA 2WB1N 1IV6A 3BQZA 2W48A 3ZQFA 4MFDA 3HOWJ 4A3MJ 2Y2ZA 2DA7A 1YRNB 4C3HJ 1S7EA 3GTMJ 3LOCA 2VKEA 1WPKA 5HODA 2L9RA 3WHBA 2COBA 2XGEA 2M2EA 3MVPA 2NVYJ 1FJLA 5IP6A 5C44J 3ZQIA 2O8KA 3I4MJ 1O4XA 2HQ5A 2XB5A 1VFCA 1U9NA 2IBDA 1QVTA 2DMQA 5F0HA 5J1YA 3ZQCA 4DZJA 4A3LJ 4DYCA 2P81A 5F0CA 1ETYA 4DZPA 1MBGA 1HCRA 3BR3A 1JGGA 2ID6A 4FE7A 2XSDC 1Z77A 4DW6A 2DA1A 1U9OA 9ANTA 2NOGA 2QF7A 3HOZJ 1EF4A 2HOTA 3DEWA 1K61A 1HF0A 2EH3A 2CRGA 5FKMA 3GTQJ 5DS9A 3BQYA 3CCYA 1P7IA 3JRAA 4FCYA 1AU7A 3JRHA 4UUTA 1RKWA 3TEDA 3GTLJ 3CQZJ
chains in the Genus database with same CATH superfamily
3BTIA 3I56I 4XL9A 3K69A 2FEZA 3GTJJ 3S2DJ 3S1RJ 3L9FA 2FMYA 3IHUA 2CV1A 2DMNA 1ON2A 4CHUA 1R7JA 1ONVA 4HX8A 3FM5A 4NC8A 5HDNA 1B9NA 5E79C 2Q1ZB 2IA1A 3DXJF 1TWGJ 3ZQQA 3NEUA 3S1NJ 3CUOA 1Z7UA 5HS9A 3O2PE 4ZZLA 4ZYDA 4DGWB 2KJCA 1BR2A 2UUZA 3V8LA 2XAJA 4ZYEA 4MIMA 1FPQA 4YELA 1X4PA 3ZP5A 3DQVC 3SFIA 3CCLI 1BA5A 3K70C 3TL4X 2XAFA 4M72A 3DWLE 3OYKA 3OL4A 3ZXSA 1E17A 2JK3A 4Y13A 3FF5A 3OOUA 5ILUA 3IKVA 1RUNA 3HGGA 3ABUA 3QP5A 3I64A 1OPCA 2VOPA 2RKHA 3H5AA 4H0EA 1NH3A 4ZTJA 2Y75A 2PQ8A 2CUEA 3RSNA 5FO5A 1I39A 2NAZA 3LNQA 2DI3A 2RN7A 2XUBA 1Z6TA 3L7WA 1HQCA 4CYCA 4O6JA 4OIQF 2HZDA 2WAQA 3OYGA 1O3RA 1ETKA 3CUQB 3QU6A 1QQIA 2DU9A 1F4KA 2P6SA 3S3NA 4BHCA 4IRGA 2LD5A 4Q48A 1TTYA 2X1EA 2ECBA 2EZKA 2YX4A 1R5GA 4AUXA 1NG7A 4E70A 3EUHA 3PSIA 2DA4A 1XTAA 4I2OA 1CQTA 4AM3A 3E1SA 4AVZA 4BEHB 2STTA 3TKYA 4BXXJ 2K40A 4G8XA 4LK0F 3A01A 3FK7A 1OYIA 2K4JA 5FKNA 3OS2A 1T98A 3K0LA 5E1WA 4XM3A 1MH3A 4HRIA 1TLHB 3OIQA 5B66C 2FNPA 1PVEA 1USSA 4HG2A 5K7FA 1X2MA 2VB6A 1R5HA 1T2KA 4CA0A 2RV8A 4KIFA 2H1KA 3JSOA 3OL3A 4MQ9F 4YFXF 1VTNC 3G71I 3N05A 1Q1VA 1JTYA 4MGRA 1WCMJ 2K02A 2WWYA 1JKPC 4JX6A 1WH7A 4G94A 3H9JA 2R5ZB 3BCAA 3NRVA 2PJRB 5J4YA 1NK2P 2VQLA 3OR1C 2K4BA 4LJZF 4RA2A 2BVMA 2W00A 2EWNA 5IYDJ 4PJNA 4PJJA 4XLHA 3HEFA 3G73A 1J0RA 4A0XA 3SZTA 3F6OA 1YW8A 2M34A 1XDUA 1QO0D 1GXQA 3LSRA 1RI7A 2XRLA 1APLC 2FBKA 5EJCA 4AU7A 3TO6A 2OCEA 3K70D 1R23A 3J80Z 2CV2A 3PO2J 1YYVA 4XLEA 5M3FJ 1G3YA 5L3EA 4UUVA 2XB0X 3GW2A 3WTYC 3DPTA 4ETSA 1PUEE 2QVOA 2X48A 1P6RA 4EJOA 2CU7A 3EYIA 1DPRA 4MEXF 3GMEA 1S8NA 2XGXA 4X0GA 5FKOA 3VSKA 5DYMA 2QSHX 3B02A 1P4AA 4HEA2 3WGIA 1HSJA 1O3SA 1R4NB 5IY5H 1FIAA 1FZPB 4MEYF 3ZMVA 2E1OA 1G6NA 2N8GA 2KZGA 2V1NA 1FSHA 1LE8B 2M1BA 2ICWG 5HVQC 3DTKA 4NHJA 1UHSA 2HTJA 4IRHA 4A6DA 2ISYA 2BY3A 4E7KA 3C3WA 4KT6A 2LP0A 5K1YA 1TZLA 2XGCA 1KYZA 3KEYA 3OV8A 5CVRA 2VJ4A 4F3QA 3GYHX 2A5WA 1D0ZA 5IT3A 1YHQI 4OWRB 3IWFA 1TQIA 4B4CA 3PM1A 3VWBA 2E19A 3IUOA 4PK4A 4BDZA 2F2EA 1J9IA 2O03A 3BG7A 4M74A 5LHHA 3HRSA 1IAWA 3TO9A 5ED4A 4GYGA 1P92A 1T0FA 1HKTA 4O5VA 3FMQA 5H2FC 1J09A 3CZ6A 2WBMA 3FXUA 3H0DA 1H88C 4Y3OA 2OTLI 4XSZF 5LBQA 3OYHA 5IP7J 1FBSA 4M3DA 4AWXB 1G3WA 3DPLC 3TGNA 3A2KA 4XR6A 1J7KA 1LDKB 3L1PA 2YUSA 4WXCA 3PIPF 2IT0A 5IYCJ 3LSMA 1QHGA 4A3DJ 2A5YB 5J47A 3ROUA 1G8XA 2R7UA 2QBYA 5LFAA 2K3PA 3BR6A 3LSHA 2IVMA 4U0YA 3H92A 2DTRA 4XLPF 3EUAA 1GDTA 1WJEA 5J4VA 2KRCA 2L4AA 1LQ1A 3R0AA 5J40A 3J7AY 2NXNB 1YX3A 4A5MA 4CCMA 3KYLA 2K9NA 3V8KA 3ZMSA 3OYBA 1BC8C 1UJ8A 3K1NA 3F8NA 1SFEA 1B6AA 2IP2A 2R7FA 1V54H 2F4MB 2H27A 2P5VA 4IF4A 4MQVA 1MKMA 1ZYRF 3OYEA 2A68F 2MFZA 5J8FA 3PFYA 3S3OA 1VQ6I 2XAHA 2VKHA 2RVCA 3I9V2 5D8LB 5LRRA 2VUMJ 1O7LA 5K5OA 1USTA 2X1CA 1ETOA 5B5EC 2YR2A 3A0HC 3VDXA 3S3MA 4BE0A 2ZFUA 2TCTA 2NS8A 1BW5A 1Z67A 2F4IA 5GADJ 4A3FJ 2JJ7A 3K4CA 3H3VK 4R79A 3H9QA 2DYSH 1AOYA 2BW3B 4KA4A 3J81Z 1U0JA 3BDDA 5F08A 1T0FC 2CFXA 4IQ4A 5F27A 2VJJA 2HDCA 1W1WE 4HA8A 4BUPA 4BE1A 2GIVA 4V2FA 3H9GA 2KMUA 4F55A 1KU3A 1DGWY 1I1SA 1SFXA 1MNDA 3F8MA 3PNVA 3QPLA 4KUMA 5EG0B 1MBJA 2F5DA 3TP0A 2L9SA 4KICA 3K7AJ 2Z9OA 1W0TA 2EFPA 3QQAA 1OISA 5FGMA 3OYCA 3CTAA 5DCMA 1XMXA 2ZJPF 3CCJI 1TC3C 3R61A 1Y1WJ 4WF2A 3KP7A 4UHTA 2Q2EB 4A2UA 2DXIA 4BY1J 2E34A 2NOJB 2PEXA 4LGWA 3RPUD 2V9VA 2YPRA 3HSEA 1CF7A 4XRSA 1XGMA 1T33A 2KT0A 4ZJZA 4CCOA 4I99C 3TO7A 3FXJA 5CVUA 3U1KA 4BNCA 5KNLA 2E2IJ 3CJQB 4YIFA 3LSTA 2X6WA 5DEQA 4IZZA 1LDJA 3GX4X 1SVLA 3QPHA 4N0BA 4UV9A 4EM0B 2L7ZA 2M30A 2XAQA 4XLAA 2Y30A 3BTLA 4PGGA 2PMZN 4MHGA 3PJRA 2F48A 3AKZA 1WRJA 1RKTA 2KQRA 2CQNA 2X4HA 2HEOA 2IEKA 2OQGA 3M4OJ 1BJAA 1IW7F 3T0YA 2HXOA 3FMRA 3CJNA 3BROA 3LWFA 2O9LA 1K4SA 1U5TB 2EK5A 1XCVA 2IS6A 2CYYA 5LGUA 3LSJA 3HZJA 1F9NA 3RTRA 2VT3A 2I8DA 3ZMZA 2X6YA 4C9YA 1XD7A 4UVCA 4C3HJ 1YX5A 1Z3XA 5BPDA 3GTMJ 1OCCH 4FHTA 1O57A 3F21A 1YJNI 2K7LA 3WHBA 5IT9Z 3MVPA 2NVYJ 5KK1A 2DT6A 3M8FA 1VQ8I 3JAMZ 1SMYF 3GZNB 3P9IA 2XB5A 2FSWA 3P9CA 3JW4A 3K4LA 3S32A 4XBFA 3ZMDA 3OYJA 3CO7C 1QVTA 1D1BA 4RLFA 5LGNA 3CC4I 1JI8A 3V7RA 1ZGJA 3WODF 5D4SA 3E5UA 1V5EA 3AL0B 2ISZA 5DV5A 1BR4A 5JHUA 2JUGA 1MBGA 4ENNA 3V8JA 1JGGA 2ID6A 2DA1A 4WK8F 2NOGA 2PLYA 4UNOA 1OYYA 4B8XA 4HLXA 3PIOF 2H8WA 3FX3A 4M9ZA 4Y4RA 4ZDLA 4UY8I 3GTQJ 1Y8RB 3CCYA 1HW1A 3RPQA 3J7ZI 1X1DA 1WFXA 3F8BA 3CQZJ 4JQFA 2V7FA 2EFWA 2D1HA 1ETXA 2O0YA 4XONA 1UZCA 2YS9A 3ASNH 3MZYA 4UB6C 2TDXA 1S5LC 1SVOA 3W6VA 1TWAJ 1E2XA 1I27A 2DFHA 2LH9A 2ID3A 4D1QA 2JWTA 1QPMA 5C4JJ 2E2HJ 2HWVA 2DAOA 4FE4A 3CF2A 2MABA 5CVJA 2JUCA 1G4DA 4ITVA 4PZJA 3JSPA 2R7TA 3LQRA 3R0JA 1JKRC 1KQ0A 2PFBA 1XCBA 2R7SA 1QZYA 2H8RA 2R7XA 4XKWA 2Z5UA 1JHFA 1UHMA 4J01A 3F0CA 4EM1A 2CMPA 3M3YJ 3HIFA 3HRTA 1OR7A 4PDKA 4NQWA 2FA5A 3JRBA 1FBUA 1IC8A 3R4KA 2NNYA 3LAJA 5E8IA 5EGOB 1VQNI 3HTSB 3KP3A 1J2XA 1SD5A 4AYBN 2CFOA 3Q0UA 3WTWC 1VNDA 1W7PA 2PG4A 1Y8QB 5BMZA 2ZXIA 1BOBA 3F72A 2LBFB 1T08B 2IA2A 4IVNA 1BL0A 2HVRA 3GBGA 1JT6A 3PQJA 1L0OC 2KPMA 1A6QA 3HUGB 1YJ9I 1RESA 1R00A 4KITB 2Y69H 1ZLJA 4KISA 3I4NJ 3BY6A 3JRIA 3SDBA 3S16J 4F92B 5L3GA 3PQKA 5E8GA 3CCSI 2HPMA 4IKFA 2MA3A 4U87A 1GUUA 3ZMTA 4UUSB 1S9HA 1B59A 5J3LA 1E3PA 1XMAA 3WTUC 4CCJA 4ENKA 4XLCA 2LK2A 1WHUA 2LKXA 2FQ4A 2X6OA 3W6JB 2E71A 3I54A 5CPRB 4HV6A 2W25A 2ESHA 1BN5A 5AIPA 2LYCA 3LSIA 5BS6A 5J8CA 2A3SA 2EBIA 5GAEJ 1S6LA 3IAM2 2DFIA 3MKLA 2R7OA 4MO7A 3O3KA 4ZYAA 2LLKA 2R5YB 1TWHJ 2MD5A 2X1DA 1FMWA 3Q0VA 2CWEA 1U8RA 2ZB9A 5D5XB 3OSGA 2KIMA 4I09A 2OZ6A 3Q9VA 4LITA 1VI0A 4M6XA 1VQ4I 4HX4A 1YRNA 5M5YJ 2JN6A 2ZKZA 3E3VA 1H9TA 2CQKA 1RUOA 1ZG1A 2GOXB 5DDGA 1JGSA 3HPHA 3K9TA 2YSRA 2A69F 2E1MC 2Y9ZA 3KP4A 2HR3A 5A2QZ 1JXSA 2V79A 4HF2A 2HGCA 1D5VA 2ELJA 2LSOA 1OR7C 4QWQA 3F6VA 2FNAA 4ESJA 4IHSA 5KVRA 1H89C 4LG3A 4RGUA 1IN5A 3F8FA 4IQJA 3LL7A 1HW2A 2GA2A 4FASD 3ABTA 3E6DA 4LG0A 1UG2A 2E35A 1K78A 5F1JA 4F93B 1SD4A 2FRHA 2VBZA 1YS7A 1UB9A 3GXOA 1P7JA 2LF7A 3VEPA 2DMPA 1LFPA 2EV0A 5D6EA 2PMUA 3UNGC 4BAYA 4FISA 4LFUA 4IRIA 2W57A 2MW8A 3R6SA 5ICGA 5HLHA 2DA3A 1D0XA 2AXLA 4BY7J 1JJ8C 1WH5A 1ZR4A 2F4OB 2ZMEC 1JT0A 4AIDA 1YQAA 4G12A 1FTTA 4IOCF 1OQYA 3HHGA 3OOPA 4DYRA 4MFEA 4IHVA 2LY9A 3MD2A 3KZYA 4XLNF 2BBYA 2OD5A 4HNVA 1K7AA 3SQNA 3T1BA 4QPQA 3TP3A 2BEOA 4I98B 2OBPA 4JYKA 1XG1A 4ZDOA 2F5EA 5EEGA 1YI2I 2EZLA 1L3LA 3QODA 4NUBA 5CKTA 5C3EJ 2EFQA 1PP8F 3JTHA 2R7ZJ 5K5QA 3KZZA 3G4SI 5F04A 2IW5A 1MIJA 1YG2A 1P4XA 2KKOA 1BW6A 4RB0A 3OYMA 2L9NA 5CQGA 3K4JA 1FWZA 3OMYA 3NARA 5BOXA 2R7DA 4L9JA 3CF5F 2F6CA 4M9XA 2YX7A 5TRDA 3OSFA 5TGTA 1P9QC 2F5VA 1LVKA 3WTZA 4XRSG 1IXCA 2QQAA 2Y0SN 3GZ5A 1R9TJ 1FP2A 5LRSA 3L2UA 3E6CC 3NWTA 5FJ8J 1TL8A 1N75A 1GLNA 3G3ZA 3K2AA 3ZN1A 1SAXA 2XPVA 1MBFA 1LFBA 3QP6A 4XSXF 4FQGA 2E7XA 3CD6I 2OU2A 4ABZA 4KDPA 2VE8A 2QM3A 4II2A 4GFBA 1ZTRA 2R7VA 3KP5A 4AYBA 3MKWB 1DP7P 1OKRA 4XQFA 1MJAA 3ZRGA 2O6GE 4W97A 4IHXA 1X4OA 3IRRA 4D5CA 3GTKJ 3RJPA 1Z7LA 4IPAA 1V5GA 3M8JA 4M73A 4OINF 4YEJA 2BVLA 2UWMA 1Z0XA 1F36A 4CGZA 5JLXA 1GV2A 5EEAA 2CQQA 4RGXA 2FBHA 1JUPA 2ELHA 3CP8A 4AD9A 3E6MA 1FBQA 3WTXC 2UZKA 3CCMI 3BJOA 3CCUI 1X3WB 2RGVA 4LB5A 1OYWA 1R36A 4KFCA 3OY9A 3FDYA 2P0WA 2HKOA 1BBYA 1TT0A 1S7AA 3QYBA 4L5IA 1PUFA 4E7ZA 4BU2A 2VC1A 5E3OA 3HC7A 5M3MJ 1V5FA 3K4NA 2HFHA 5E17F 3KYDB 3H5RA 2VKVA 1K83J 1X1BA 2XHKA 4A3GJ 2ZJQF 1MNEA 2BXZA 2E1CA 1XGNA 3EDPA 1RRJA 2RQPA 5DUKA 2VLAA 1TW2A 4ENJA 2LC2A 1YW7A 4PFPA 4Y33A 1FX7A 1D1AA 1PDNC 3J7AO 1ZH5A 3DP7A 1A04A 3EQLF 3W2AA 2EV6A 4A0ZA 1QVUA 1W5TA 1YITI 3FKJA 3E5XA 5FLXZ 2ZBKA 1X1CA 3B6AA 2IS1A 2EIKH 2FF4A 2KIUA 4DNCA 3WU1B 1IZ1A 2PMHA 3K4BA 4WX9A 2KRHA 5K7ZA 2HOEA 1WI9A 3I59B 3L2RA 1FC3A 2XVCA 5H20A 1RIOH 2XV4S 3LMMA 2W82A 4C3JJ 1A31A 4M3GA 4BHPA 1O3QA 2CW8A 2ZC2A 1POGA 5BQTA 1B72A 1QU3A 1H0MA 4BHBA 3EUHC 5M5XJ 4I6ZA 2DBBA 2IAIA 2V9KA 1D8JA 3KFWX 3FBNB 3FHNA 2W85A 3WHCA 4E7IA 1R49A 2LRDA 3K6GA 4P55A 4D9JA 3S17J 3ZMUA 3LFKA 1FOYA 2XRNA 2RNJA 3LSKA 1IG7A 2L2OA 2M3AA 2VN2A 1C0WA 3ZPLA 4A3EJ 1HOMA 2LNBA 5LEKA 4C3IJ 1X58A 3RZDJ 2QSFX 3JRGA 3H3ZA 4OMYA 1MMSA 4RMNA 3K4MA 3H1CA 1NG6A 2Z3YA 2EIJH 4M3FA 2NS7A 5EG0A 1T6SA 4RAFA 4BGDA 2IJLA 3S2HJ 4XIDA 4P96A 2I5UA 1JE8A 4ZZDA 1N78A 2L54A 1A35A 2BYVE 2IGOA 1W5SA 3MQ0A 3W6KB 1VQ7I 2XPWA 5DD8A 2FMLA 1UAAA 1K6OA 1ETVA 1GVDA 5ERIA 2Z99A 5EEHA 3T8RA 1F1ZA 2DA6A 2HS5A 1R58A 4CYCB 3HOUJ 1MSFC 4LD5A 2EQRA 1I3QJ 4B3XA 1OCTC 2DW4A 3JRFA 5D6FA 2UXNA 1TQMA 3UKGA 3BR5A 4E6KG 3HB9A 5KHDA 4XLFA 5CYVA 4E4HA 3RI4A 1IDZA 4NC6A 1X3ZB 2M5WA 3ERED 3IH3A 2Y0SA 3RYRA 4CSWA 1DDNA 3PO3J 2NNNA 3GLXA 2KL4A 2AS5F 2KJBA 3BJ6A 1Y0NA 2X85A 3G1MA 3J81K 2EILH 2L7MP 2WC2A 1TQPA 2Q0OA 4BACA 3SEQA 1Z05A 4HLYA 1I6HJ 1KYWA 3HOVJ 4LOCA 1B8IA 5CQEA 1RNLA 3I53A 3A01B 1IUYA 3ZCOA 3M9AA 5GPAA 4IX7A 1S29A 1IRGA 1TBXA 2VT2A 4XRFA 2KDOA 4KN7X 2V1UA 1T39A 4N9HA 4JOMA 3S2WA 4EM2A 1K4TA 3WTTC 2WB1N 1IV6A 1OLTA 3DU6A 4RS8A 3KEQA 2QENA 5DD4A 1U2WA 2K9MA 2KFDA 1U5TA 5FB2A 2COBA 2V6EA 2EINH 3EUKL 4HX7A 2M2EA 3BZCA 5IP6A 5C44J 2LDUA 4LIUA 4AIJA 3MWMA 1V4RA 1VQKI 1TNSA 2H6CA 1IV8A 2DMQA 2MYSA 3ZQCA 3AFHA 6PAXA 4DZJA 2E7WA 1MMNA 1SD7A 2ZJ2A 4XKVA 4BQOA 4A3LJ 2BV6A 3I4PA 4Z6YA 2P81A 4CZCA 1HCRA 3BR3A 1YOVB 2XF5A 4DBQA 1Z77A 4DIQA 2XSDC 1IN8A 2E5NA 1U6GA 4MTDA 2QF7A 1EF4A 3OIPA 3QPTA 2BXYA 2HOTA 4YFNF 3ABKH 3DEWA 1HF0A 4A0YA 4EATA 2FXAA 3BQYA 2RC4A 4S04A 2IGNA 1BIAA 2EA4A 5ICFA 4HZFA 2WY7Q 3GO5A 1MMGA 3GTLJ 4G6TB 2EB7A 3HSFA 1BI0A 4BKXA 4GCVA 4CCLA 2STWA 3HHHA 2MLKA 4HSRA 1RC9A 1A36A 1J5YA 2VXZA 3IC7A 1D8KA 1ODDA 4A6EA 2HXIA 2Y48A 1JKOC 3IAS2 4I0AA 3KZIC 2UXXA 1SEUA 5TISC 4HSTA 1BI1A 5FD5A 5IT9K 4KT5C 3G2BA 4OIPF 4M3EA 3BTCA 3AG3H 3KCCA 2OF7A 4Q4ZF 3H35A 3KP6A 1FSEA 1YJWI 1Z91A 4BBSJ 4I02A 3E0JB 3HOXJ 1QBJA 4Y17A 1YTYA 1I50J 4HQMA 4ESFA 3MN2A 2B0LA 3LFUA 3R60A 3ERMA 3K1PA 5IOZA 2DO7A 1MBHA 2YU9J 2ZO4A 1IXRC 1ENHA 3KIOA 1GT0C 3BC8A 1U8BA 3HM5A 4KIGA 5LLQA 1ZQ3P 1JTXA 3D5RC 2ECCA 4N4NB 1ZN2A 2DODA 2LY2A 2HOSA 1XGSA 3ELKA 1HA8A 3GLLA 3AAFA 5DM7F 3PFIA 3TW6A 4KYWA 1ON1A 3D1NI 3BZKA 1IF1A 2LF8A 2M9HA 3RKYA 2C6YA 4ZDPA 2ZXJA 3WGHA 2V6CA 4R8HA 2WTEA 4UVBA 4BXUA 1E0EA 2Q8KA 1NHAA 3DFGA 3CO6C 1R1UA 3O8GA 4DOZA 1Z21A 1TNTA 1WJDA 4XNFA 4P1WA 1WWXA 2DOEA 5E3MA 1IRXA 5ICEA 1EV7A 4PUSA 4FTHA 3KYCB 1G3TA 2FX0A 3IKTA 3OR2C 3BWGA 4I7HA 5FFZA 1MDMA 4LK1F 1IGNA 2M4GA 3P5JA 4EJTA 5LHGA 2IGMA 3DV8A 1B1BA 1M1EB 1Q1HA 2OAZA 2FBIA 4XORA 1EKEA 2HKXA 4N4OB 2R4GA 4BJ5C 4EEFG 4CO8A 2L9VA 2LR8A 1I6XA 5J6XA 2HVQA 5HDKA 3F3XA 3HKZN 4JX4A 1JHHA 3A1YA 3RIRA 2DDAA 4XK4A 5EDNA 2KDZA 2VBWA 2OA4A 3ML6A 4IJAA 4HQEA 4KIBA 2WB1A 1YE9A 2DPDA 4HW0A 4IXAA 5GTHC 1D5YA 4RB2C 3DBLB 4RAGA 3E6BA 1IJWC 3MKZA 1DUXC 3BT9A 2ZSIB 5GPCA 3U2RA 5EZGA 3DBRB 2R92J 2YU3A 1FIPA 2Y9YA 1B9MA 3ZGKA 4OOIA 2CJJA 3IH2A 1OMIA 1MNMC 2PJPA 2B7EA 1BM9A 4EGZA 2Z1DA 4EQQA 4KNYA 3A4CA 4JX5A 5HLIA 3AG2H 2I10A 4U7BA 1OCPA 3H3UA 2GZWA 2Y31A 3WGGA 4BQQA 2HTSA 2HQRA 2FUG2 1F5TA 4Y7NJ 1XC5A 2DOAA 5L3DA 3DBHB 1ZGWA 5BNGA 2A6EF 5JI6A 1W0UA 3LSGA 2D1VA 2JPCA 5IYBJ 1EH8A 3CJRB 5L3FA 3OYFA 3FHZA 1XSDA 3BR2A 2CV0A 1YFHA 2ZNZA 5JHFA 1FYMA 2O5RA 3NQOA 1ZLKA 1KONA 2GXGA 4BJTA 1Z9CA 3NWSA 3JCUC 1ZR2A 1LEBA 4B48A 1T8IA 1J75A 2XSJC 5H6QA 2QQ9A 3L2WA 3REOA 2RREA 4NDLA 1OCOH 2LREA 3LA3A 2Z33A 2OC6A 4ZYHA 3SXYA 1LEAA 2VJIA 1MMDA 4D5FA 3HPGA 2M8GX 3SZPA 3FKIJ 4XN0A 3A02A 1ETWA 5DCMB 3FZVA 3MMYB 4HDUA 3GWZA 5A2QK 3V7CA 4G6QA 3JREA 3RZOJ 3V42A 4BQAA 4BH9A 4E7LA 1SD6A 3RDIA 4L0ZB 4QPOA 3VYSB 4EJWA 2HYFA 4JBAA 4D7NA 2NVUB 1CF7B 2COMA 2WAEA 2XF7A 1LJ9A 1IN7A 3CESA 2JRTA 3EPZA 3QPSA 1G2HA 2AO9A 4WCGA 3L00A 4IHYA 3QOPA 5C4XJ 1RPWA 1GHCA 2W1OA 3NAUA 4PJMA 2HZTA 3WE3A 4QTRA 5J1UA 2L02A 2CQXA 3CC2I 2FJ1A 1HKQA 4OIRF 4JK1X 3I0TA 1QPIA 3CMYA 3FISA 4S0HB 2L01A 4NC7A 5GP9A 1BIBA 1OCRH 2JMWA 5J1RA 2DA2A 4XRMA 3SJMA 4F52A 4E7SA 3I3LA 3TDUC 3CUQA 4P9FA 1V55H 4AIHA 2PMZA 2BZTA 3GVAA 2JA5J 2CUFA 1H8AC 2CUZA 2KIFA 1QRYA 2GLOA 2BY1A 3IRQA 4GO1A 5JLWA 1ZRDA 1LDDA 1SFUA 1DPUA 2OJED 3P9KA 3IH4A 4BXFA 3MZHA 2B63J 2MH2A 3GTGJ 5DM6F 3CCVI 1BR1A 5LHIA 2XROA 1EJ9A 2P5LC 2VPRA 3CJTB 3F8CA 3A03A 4LB6B 5D5WB 3WTSC 4BEHA 1YIJI 4FETA 3VB2A 2XAGA 3FXKA 4U0WA 2X6XA 2DDBA 2ELKA 2MD0A 5FKLA 1MMAA 3IV5A 3OWTA 2NVQJ 5EYRA 3PUFA 2LMDA 2JSPA 2PBIA 3BG6A 4G7OF 1LVAA 4CXFA 4RAYA 1H9GA 4PJ0C 2HDDA 1X19A 2LTPA 1DU0A 3ECHA 2WADA 2ME0A 1P4WA 1HLVA 2MLGA 4L5JA 3RKWA 2R7RA 1XS9A 1KU2A 2EZIA 1HDPA 4KMUX 1W36C 1AHDP 2HVSA 3E7LA 3L2VA 1XGOA 2K27A 3GFIA 2QQBA 1R22A 1CGPA 3FIWA 5D5VB 1RR7A 1ZRCA 2A6HF 2XPUA 2CW7A 3Q3SA 1KQ8A 2KZVA 4WXHA 3HBLA 3BR0A 4MLOA 4ZTFA 2OPTA 3JR9A 4AVPA 2R5ZA 2AHQA 2K9LA 4E7HA 1Y39A 1MSEC 2PJRA 1FOKA 1DU6A 5ILSA 2XF6A 3BZ6A 5EF6A 1IRFA 1R6RA 5DTDA 3DKXA 5HS7A 3PUBA 4RB1A 3M8EA 4QIWN 1DGRM 4A3KJ 1SFOJ 3PSFA 3I55I 5F0FA 2W4SA 2HOAA 2AXTC 5E3LA 3V4GA 4HYEA 1EA3A 3KETA 1W5CC 1ZKGA 1PJRA 3GZ6A 3ONQA 4LLGF 4AC0A 5L3BA 4LLLA 3JRCA 2R93J 1Z6RA 5DUIA 4RLQA 2JA6J 3HOYJ 3RYPA 2X51A 2R3SA 4NB5A 2R7QA 3CLOA 1YLFA 3C1DA 3QYFA 2P7VB 2XAUA 4II3A 2E1MB 2FU4A 1FOXA 5IOYA 2FOKA 2CQ7A 2XDVA 4C2TA 3ECOA 3VOEA 1RR8C 1AKHB 2JA8J 1ZGAA 3U21A 2DOFA 1D1CA 2JSCA 4NQWB 2MBFA 2HU9A 2KHMA 5HOOA 4JP0A 1ZHFA 2MC4A 3KLNA 1X3UA 2VI6A 5CVVA 1LE8A 2HI3A 2ZFWA 1T95A 1W7PB 3FXLA 1YO5C 2FD5A 2JQ7A 3L2CA 2CSOA 2M4KA 5FLXK 2EA2A 4P9UA 3OYDA 5HS8A 3WU0A 4IO9F 3FXQA 3F23A 1B4AA 2XKOA 2JVHA 4MTEA 4M6VA 4DBRA 1EH7A 4A3IJ 3K4KA 4PSXA 1HDDC 2ZMEB 4CDGA 4Q5SF 1YS6A 2VONA 4B43A 2DQRA 3J80K 3HOSA 1T56A 1A5JA 1OJLA 3OYLA 2PX9A 1LFUP 3E97A 1VQ5I 3LSPA 3MFKA 2E5ZA 2BY0A 4HNUA 1BI2A 2DFEA 1UFMA 3AG1H 2HNHA 3FXRA 2P4WA 2R7WA 4OAYA 3DEEA 1PP7U 5JVGF 4L0YB 2OTJI 2HQAA 3BTJA 2VPLA 1WVRA 4U88A 3KPHA 2RAEA 2WV0A 3QOEA 1WJBA 3HRUA 1W36D 2EFOA 2WY8Q 1HBXG 3X2QH 2W48A 3ZR8X 1S7OA 3DKYA 4MFDA 4F91B 3HOWJ 4ON0A 1W7PD 3W2WA 1YRNB 3SFZA 3W3CA 3LOCA 2VKEA 1WPKA 2K3FA 3BCBA 2BY2A 2CUJA 2XASA 4DQ2A 1ZRFA 1S72I 1N25A 1FJLA 2OV7A 3VODA 2O8KA 1R4MB 3MAJA 4YIIA 1SVMA 2HQ5A 3FXMA 1VFCA 1UG0A 1MW7A 1U9NA 4TV7A 2IBDA 2VE9A 3F9KA 3N97A 2DFFA 3CLQA 1ACIA 4I0BA 3W2VA 4LG0B 4RB3C 1K78B 2EIMH 3ULQB 2O3FA 3PNTA 4DW6A 3VYUB 1U9OA 9ANTA 4YRVA 2V26A 3HOZJ 3DEUA 3ZQ7A 2DCEA 4XN3A 1K61A 4G7HF 2CRGA 4ZH4F 1FT9A 3DTEA 2QKLB 1P7IA 4FCYA 1D3YA 5F64A 2V1DA 1DQUA 3GF2A 2V4JC 2VJ5A 1RKWA 4KN4X 4MNUA 3GUDA 2XIGA 3TEDA 2GXBA 3S8PA 3RPUA 2G0EA 3P7NA 3OS1A 1LKXA 4L5EA 4D7MA 1I1GA 5KAFC 1GXPA 2BW3A 4EGYA 2GM4A 2JT1A 2J5OA 1LB2A 2G9WA 4HOBA 2ADUA 4LMYA 1ERDA 3BJAA 1QHHD 3RCOA 2LY1A 4I01A 1V3FA 3EYYA 5B3SH 2E2JJ 4G6DA 2V1XA 3H0GJ 2CW0F 4BQNA 1R71A 1WGXA 2V9PA 2KRFA 3OS0A 3TMOA 3MKYB 2QZ8A 3GEZA 3K1MA 1T38A 2IS4A 3KP2A 4M9SA 5LD2C 3FBIB 2L3DA 1ZG5A 2A05A 2GQQA 4N9IA 3FWEA 2L4MA 4L9VA 3GTOJ 3SEZA 1FOWA 2JTVA 4A3JJ 3TOBA 3IP4B 1WKMA 1X1AA 2VOOA 2DK5A 4BDYA 2CO5A 2Q2EA 2JA2A 2MSYA 3T5XA 5TJJA 5ILVA 2BHYA 5CJ9A 4B09A 4ENMA 2JPBA 4PCQA 1IDYA 4UXNA 3FM3A 5AONA 5B1AH 4HDVA 1P2FA 1R5ID 1MGTA 2DPUA 4A3BJ 3FK6A 2X9DA 3V7SA 1A6IA 3F22A 2L7KA 2Z2SB 4A69C 3CCQI 5EZHA 4PSWA 1F43A 3ZQHA 1FYKA 1HKSA 3SHFA 4EV0A 4OAZA 5KAIC 4YIRX 4HV5A 4M3BA 2EPFA 2VIXA 3OYAA 2F5FA 2L7FP 3CMMA 3WG9A 1AWCA 3S1QJ 4DJAA 1VQLI 2VASA 2L0KA 3C2HA 3TBIA 2OUMA 1MBEA 2J5PA 1SANA 2ZXWH 3K10A 4HF0A 3HTUA 2LOOA 3PNYA 2DJIA 3DTIA 4EJUA 2MH9A 3TQNA 4BBRJ 3ESWB 1TWFJ 2DYRH 3U9GA 2CS3A 4ANJA 5K7HA 2DJNA 3ZQLA 1PUFB 2P8TA 2VC0A 2W24A 2FE3A 1E3OC 4WWCA 3BG3A 5H6RA 5FD6A 4IL6C 2GIZA 4XMYA 3DPUA 1LPQA 1XX5A 5LGTA 3GCMA 2MGQA 3JRDA 2B9SA 1BC7C 2GAUA 3S93A 4C2MJ 2G7UA 2DLLA 3H5NA 3S1MJ 4OMZA 4UB8C 1G3SA 4U0VA 2BGCA 4QLCU 2GXAA 1XN7A 3PL8A 1I3AA 2VQGA 3AG4H 1XPXA 3HXLA 1IRZA 1FNNA 2DQLA 2DTZA 1IN6A 4L9TA 1Y1VJ 2XC7A 3Q5FA 3ZOBA 5FKKA 3FXOA 1MH4A 2LVSA 2Y0MA 5KCMA 2CG4A 2A6TA 2W7NA 4EMSA 4OU0A 5E18F 3E5QA 5E20A 1ZG3A 1FMVA 1X1PA 4A3CJ 3GFLA 1ULYA 3KX2A 2H09A 4W1UA 1FLIA 1VQMI 2O61A 4UV8A 1ZARA 3WU2C 2JVGA 1RETA 4KJZA 1TT5B 1B72B 4IHTA 1LNWA 2VODA 3C7JA 3VYRB 2DA5A 2VQCA 4XKBA 4GXOA 2H1LA 3A0BC 4RDUA 2EV5A 2ZCWA 2DMUA 2ME6A 4B3AA 2K9SA 4BYYA 1DP3A 2IPQX 1JUMA 2AQFA 2ZSHB 4ESBA 5F6FA 4BL0B 4Z2YA 3QAHA 3HRMA 4EJVA 3OIOA 4XKCA 3RQ4A 5E1ZB 3CMAI 5FFXA 3BPVA 2NS0A 4GGGA 3JAMK 3VSLA 1R1TA 3VFZA 2FOWA 2FQ3A 3D5SC 1G59A 1U5TC 3BPXA 2DT7B 3SZGA 3RQIA 4KMFA 2OCCH 2JA7J 3M7GA 1WJ5A 2QSGX 2RNGA 1FY7A 3DLAA 2P6TA 3O8HA 1LUJB 2P5KA 3TOAA 4CCNA 3UR3C 4QSHA 2LKPA 2M7AA 3LAPA 2A07F 1WJCA 2M87A 3QRFF 1TWCJ 3B73A 1HC8A 1HXDA 1SFKA 3ABLH 3LQQA 4PFOA 3T8TA 4CUGA 1IXSB 5M5WJ 3BG5A 4J19A 1IN4A 3JTGA 1SC7A 1U78A 2QWWA 3KE2A 4C2UA 4RGRA 4GRIA 2QCOA 2WV1A 4B1RA 2M0CA 5EGOA 1WJAA 4HF1A 2UV1A 1QGPA 1UELB 2W84A 2Z16A 5JFRA 1NK3P 2E60A 1VQ9I 5FLVA 3D0SA 3AL0C 2LBFA 4IOAF 4C30A 2E1NA 1JJ6C 2DN0A 3IL2A 3DLLF 3HUGA 1XDSA 3SYTA 3U1DA 2GWRA 1WJFA 3LA7A 5JVTA 3DCFA 2HPIA 4U7DA 2WA0A 3Q0WA 4M71A 2JZYA 1QZZA 1WQ2A 3DKWA 1YIOA 4A5NA 3EETA 4V2GA 1QZEA 1B8IB 5K5RA 2QKMB 2R0QC 3CDIA 5CLSA 3QU3A 2K86A 3HGYA 4XOTA 4CCKA 3LA2A 5AIQA 1S3JA 3G1OA 1OFCX 4M6YA 2QBYB 4Y52J 2QGUA 2EFNA 3K2ZA 4UUSA 4O3MA 4E7JA 1PYVA 2VBXA 1ORKA 3L2QA 1ZREA 4GDFA 3I5UA 1XSVA 2ZNYA 4LIVA 1OCZH 4FT8A 3I71A 4IHWA 4FX0A 3TW7A 1GV5A 1BI3A 2EJRA 3ISPA 1K79A 3B6CA 4G7ZF 2BHZA 1WZ2A 2K85A 4K2EA 2GOMA 5IPAA 3N4MA 2R5YA 1ZAOA 4RM3A 2NVTJ 1MBKA 1W4MA 2ZXHA 5FRNA 4ASNA 1ETQA 3H36A 3RKQA 3MEXA 4X1EA 2TRTA 1FP1D 4A93J 1WSUA 2LKSA 2QLZA 5HLTA 2M7BA 2A61A 1J59A 1I5ZA 3M1EA 1AA7A 1NTCA 4A12A 2GA1A 3IWZA 5HDGA 2LFBA 2HDWA 3ZN0A 1JUSA 4WXDA 3GTPJ 1HW5A 4HBLA 5FROA 3D5LA 5GAGJ 3L09A 5B1BH 3CCRI 3CMEI 2MC3A 5JR3A 5FLMJ 1IO2A 5IP9J 5CVIA 4RBOA 1R1VA 1VQOI 4UVAA 5E3NA 2H94A 1U3EM 1WI3A 1KQ9A 3BLYA 3WE2A 1JKQC 4IEJA 2HQNA 2D5VA 1VZ0A 1MZBA 3I58A 4CICA 3BR1A 1K6YA 1KU9A 4J00A 2O7OA 4I76A 1O3TA 2XKPA 4P5OA 2DT5A 3CDLA 3ABMH 3O6BB 2DMTA 1VQPI 3G6EI 4B44A 3SDGA 4F7ZA 2BE5F 2KP6A 3HOTA 4BJ6C 1BJZA 1XSXA 4HPQA 4RGSA 2QEXI 1BOAA 2EZHA 2QA4I 4L9NA 2ZJRF 2KISA 3CC7I 4XICA 2ESNA 3J7YJ 2QUFA 2E36A 1FTZA 3KEOA 3HDDA 3FMSA 4AIKA 2MG4A 3HL2A 1UCRA 3G1LA 1MD0A 4DYQA 1Y56A 5HNHA 1UMQA 3CDHA 2D45A 1ZK8A 1KA8A 1XB4A 3S14J 4X6AJ 2IGKA 4S05A 2OZUA 2M8EA 2NVXJ 2WAFA 2KLOA 2VQHA 4YG2F 3VPRA 3S15J 4Y15A 1X2NA 2QQ8A 3RKXA 1AKHA 1GVJA 2IS2A 1O7FA 2IXSA 3MCZA 4D0PA 3CCEI 2WAQN 3KLOA 1KU7A 1VF9A 2VBYA 4V19K 3BP8A 1QNTA 2PN6A 3VYTB 4LLNA 3HG9A 2P7CB 2M45A 5D4RA 2VKDA 4CH7A 4EVIA 2OQRA 3ZQGA 3QWLA 2O8XA 2ETHA 2D2WA 5L3CA 1E3HA 2IRFG 5HNFA 4Q47A 2ACJA 2H6BA 3M1CA 3WG7H 1IUFA 3BG9A 2QYOA 3TDZC 3QYEA 2LG4A 2ZMEA 5LEJA 3DF8A 4FX4A 4NBQA 5ICCA 2BOLA 1ITYA 3C2BA 4B47A 5GTIC 1MDMB 1FEXA 1HSTA 2K5CA 3MZ8A 2RDPA 1Y6IA 3ASOH 4BE2A 1D0YA 2X0LA 5E1XA 1QA6A 2KIQA 2XGDA 2GBYA 2PI0A 1N77A 2HYJA 1SMTA 2K9QA 5D8KB 3BQZA 2NYXA 2JRMA 1ZELA 2DK8A 3WTVC 3ZQFA 4A3MJ 2Y2ZA 2DA7A 4H4KC 3DU5A 3OYIA 4L18B 1S7EA 1MJBA 4CZZA 1FYLA 5DCFA 5HODA 2L9RA 3C18A 3C2GA 4YFKF 2XGEA 2CGPA 4NNJA 2RQQA 4PJLA 3ZQIA 3I4MJ 1YW9A 1O4XA 3CP2A 1TW3A 3HKZA 5FRMA 4PGHA 1REPC 4OIOF 4HNTA 4ZYGA 2G7HA 5F0HA 5J1YA 1EH6A 1KGSA 4ZC3A 2AQEA 4DYCA 5F0CA 1ETYA 4R1HA 4DZPA 1STZA 3HSRA 1Z1DA 5BPIA 1RZ4A 1Y0UA 1KZHA 4FE7A 3GFJA 3GFMA 4G9YA 3HJEA 1MJ9A 2NRAC 3OYNA 2IA0A 1Z3YA 5D5UB 5F1RA 2M0MA 2L5QA 3M07A 2EH3A 5HLGA 1SAUA 5FKMA 2VXDA 1UHWA 2CH0A 3Q9SA 5DS9A 4XOPA 3BOQA 3JRAA 4RAZA 3COAC 5GAHJ 1AU7A 1TP4A 1XMKA 3HYIA 4RM2A 2F5CA 4GYIA 4BS9A 3I59A 4UUTA 3JRHA 3CUQC 2HYGD 4CYDA 2VL8A 4HAMA
chains in the Genus database with same CATH topology
3BTIA 2G0EA 1ETXA 4L5EA 3GTJJ 4D7MA 3S2DJ 2YS9A 4BKXA 3S1RJ 2DMNA 2GM4A 3W6VA 1TWAJ 2ID3A 2HXIA 2JWTA 1TWGJ 1JKOC 5C4JJ 2E2HJ 3S1NJ 2E2JJ 4FE4A 3H0GJ 4M3EA 1WGXA 1JKRC 3BTCA 4MIMA 2OF7A 3SFIA 2H8RA 4BBSJ 1BA5A 3HOXJ 3F0CA 3M3YJ 1I50J 3MN2A 2JK3A 3GTOJ 3JRBA 4A3JJ 3OOUA 5IOZA 1MBHA 1IC8A 2YU9J 2MSYA 3HGGA 1ENHA 1GT0C 5EGOB 1U8BA 3HM5A 1ZQ3P 1JTXA 4AYBN 2ECCA 3Q0UA 1VNDA 2CUEA 1BL0A 1IDYA 3GBGA 2HOSA 3LNQA 1JT6A 4CYCA 1RESA 4A3BJ 3TW6A 3FK6A 2X9DA 3D1NI 1A6IA 3I4NJ 2M9HA 3JRIA 4A69C 5EZHA 1ETKA 1F43A 3ZQHA 3S16J 4M3BA 2LD5A 3O8GA 2L7FP 2ECBA 3S1QJ 2EZKA 4AUXA 1GUUA 2L0KA 4UUSB 5E3MA 1MBEA 2DA4A 5J3LA 4FTHA 1CQTA 1SANA 2LK2A 2FX0A 2LKXA 2FQ4A 2X6OA 1IGNA 4BXXJ 2K40A 3A01A 3FK7A 4BBRJ 1TWFJ 2EBIA 5K7HA 5FKNA 2DJNA 3ZQLA 1PUFB 3MKLA 4MO7A 2R5YB 2LLKA 4EEFG 1TWHJ 2LR8A 1MH3A 3Q0VA 1E3OC 3HKZN 2ZB9A 3BG3A 3OSGA 4JX4A 1VI0A 4XK4A 1YRNA 5EDNA 5M5YJ 2JN6A 2KDZA 5K7FA 1X2MA 2MGQA 3JRDA 4C2MJ 2H1KA 1D5YA 2Y9ZA 3S1MJ 1IJWC 1IRZA 2DTZA 1Y1VJ 3BT9A 1Q1VA 5GPCA 1JTYA 5EZGA 3ZOBA 2R92J 5FKKA 1H89C 1FIPA 2Y9YA 1MH4A 2LVSA 1WCMJ 2CJJA 3IH2A 1MNMC 1JKPC 4JX6A 1UG2A 1WH7A 5F1JA 2R5ZB 4JX5A 1P7JA 4A3CJ 2DMPA 1NK2P 4W1UA 2I10A 4FISA 1OCPA 2Y31A 2MW8A 2DA3A 5IYDJ 1RETA 4BY7J 3HEFA 1JJ8C 1WH5A 4Y7NJ 1ZR4A 1B72B 1XC5A 1ZGWA 1JT0A 5BNGA 1W0UA 3LSGA 2DA5A 4G12A 5IYBJ 1FTTA 4RDUA 2M34A 3BR2A 3LSRA 2DMUA 2XRLA 4DYRA 4MFEA 2ME6A 4B3AA 1APLC 2LY9A 4IHVA 2K9SA 3PO2J 1JUMA 5M3FJ 1ZR2A 4HNVA 2XB0X 3TP3A 4JYKA 1XG1A 2X48A 3OIOA 4NDLA 2CU7A 2EZLA 5C3EJ 4D5FA 2R7ZJ 2M8GX 3FKIJ 5FKOA 3A02A 1ETWA 5F04A 3RQIA 1BW6A 2JA7J 1FIAA 2E1OA 3O8HA 3NARA 2N8GA 3JREA 3RZOJ 4QSHA 1LE8B 4D7NA 1TWCJ 1UHSA 3OSFA 4XRSG 5M5WJ 2LP0A 3BG5A 3QPSA 2Y0SN 4J19A 1G2HA 2XGCA 1U78A 1R9TJ 2AO9A 4IHYA 5FJ8J 2QCOA 2WV1A 4B1RA 2M0CA 3K2AA 5EGOA 5C4XJ 1RPWA 2XPVA 1NK3P 1MBFA 1LFBA 3NAUA 5FLVA 4B4CA 3PM1A 2E19A 4QTRA 5J1UA 2CQXA 2FJ1A 4ABZA 1JJ6C 2DN0A 1QPIA 3CMYA 3FISA 4GFBA 1ZTRA 4S0HB 3DCFA 5GP9A 3Q0WA 2JMWA 5J1RA 2DA2A 4XRMA 3SJMA 4V2GA 4W97A 4IHXA 4D5CA 1B8IB 3GTKJ 2R0QC 3HGYA 2JA5J 2CUFA 1H88C 1H8AC 1Z0XA 1OFCX 1QRYA 1F36A 3G1OA 2GLOA 4Y52J 5JLXA 5IP7J 1GV2A 5JLWA 5EEAA 2CQQA 4UUSA 3IH4A 3GTGJ 4M3DA 1JUPA 2B63J 1ORKA 2VPRA 3A03A 3L1PA 2YUSA 5IYCJ 4A3DJ 4IHWA 3TW7A 1GV5A 2ELKA 5FKLA 3IV5A 3B6CA 3BR6A 2NVQJ 5EYRA 1PUFA 5IPAA 2R5YA 5E3OA 1GDTA 1MBKA 2NVTJ 5M3MJ 2HDDA 2LTPA 1DU0A 1ETQA 3RKQA 2ME0A 1HLVA 4X1EA 2TRTA 4A93J 2K9NA 2VKVA 1K83J 1XS9A 2EZIA 1HDPA 4A3GJ 1AHDP 3E7LA 1NTCA 3FIWA 2LFBA 1RR7A 2XPUA 1JUSA 3GTPJ 1QVUA 3Q3SA 3B6AA 2VUMJ 3HBLA 3BR0A 5FLMJ 4MLOA 1ETOA 2OPTA 5IP9J 3JR9A 4RBOA 2R5ZA 2AHQA 1MSEC 5E3NA 5K7ZA 2TCTA 1WI3A 2NS8A 1BW5A 1DU6A 5EF6A 1JKQC 4IEJA 2D5VA 5DTDA 4C3JJ 4M3GA 2JJ7A 4A3FJ 3H3VK 3BR1A 2O7OA 1POGA 4I76A 4QIWN 1B72A 4A3KJ 1SFOJ 5F08A 5F27A 3CDLA 5M5XJ 4I6ZA 5F0FA 2IAIA 2HOAA 2DMTA 5E3LA 3WHCA 4V2FA 3SDGA 3S17J 1ZKGA 1BJZA 1IG7A 2EZHA 4AC0A 3QPLA 3JRCA 2R93J 4XICA 4A3EJ 5EG0B 1MBJA 1HOMA 3HOYJ 2JA6J 4C3IJ 3TP0A 1X58A 3RZDJ 3K7AJ 3JRGA 1FTZA 1W0TA 3HDDA 2MG4A 3QQAA 5IOYA 3G1LA 4DYQA 1AKHB 2JA8J 1UMQA 1ZK8A 4M3FA 3S14J 2NS7A 5EG0A 1TC3C 4X6AJ 1Y1WJ 3S2HJ 4XIDA 2NVXJ 4JP0A 3VPRA 3S15J 4BY1J 2XPWA 1X2NA 2VI6A 1AKHA 1LE8A 1GVDA 1ETVA 2HI3A 2FD5A 2WAQN 2DA6A 1VF9A 4XRSA 1T33A 2KT0A 4CYCB 3HOUJ 1MSFC 2EQRA 1I3QJ 1OCTC 4M6VA 3JRFA 3UKGA 4A3IJ 3BR5A 3HB9A 1HDDC 2E2IJ 1IDZA 3ZQGA 3IH3A 3PO3J 2L7ZA 2Y30A 3BTLA 1T56A 1A5JA 1OJLA 2PMZN 3G1MA 1LFUP 1IUFA 3BG9A 3LSPA 2L7MP 1RKTA 1ITYA 3C2BA 1I6HJ 2IEKA 3HOVJ 3M4OJ 1FEXA 4LOCA 1B8IA 3A01B 3BTJA 5GPAA 2HXOA 2RAEA 2O9LA 2XGDA 2GBYA 2HYJA 3LSJA 2K9QA 2WB1N 1IV6A 3BQZA 2W48A 3ZQFA 4MFDA 3HOWJ 4A3MJ 2Y2ZA 2DA7A 1YRNB 4C3HJ 1S7EA 3GTMJ 3LOCA 2VKEA 1WPKA 5HODA 2L9RA 3WHBA 2COBA 2XGEA 2M2EA 3MVPA 2NVYJ 1FJLA 5IP6A 5C44J 3ZQIA 2O8KA 3I4MJ 1O4XA 2HQ5A 2XB5A 1VFCA 1U9NA 2IBDA 1QVTA 2DMQA 5F0HA 5J1YA 3ZQCA 4DZJA 4A3LJ 4DYCA 2P81A 5F0CA 1ETYA 4DZPA 1MBGA 1HCRA 3BR3A 1JGGA 2ID6A 4FE7A 2XSDC 1Z77A 4DW6A 2DA1A 1U9OA 9ANTA 2NOGA 2QF7A 3HOZJ 1EF4A 2HOTA 3DEWA 1K61A 1HF0A 2EH3A 2CRGA 5FKMA 3GTQJ 5DS9A 3BQYA 3CCYA 1P7IA 3JRAA 4FCYA 1AU7A 3JRHA 4UUTA 1RKWA 3TEDA 3GTLJ 3CQZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTI A;  2G0E A;  1ETX A;  4L5E A;  3GTJ J;  4D7M A;  3S2D J;  2YS9 A;  4BKX A;  3S1R J;  2DMN A;  2GM4 A;  3W6V A;  1TWA J;  2ID3 A;  2HXI A;  2JWT A;  1TWG J;  1JKO C;  5C4J J;  2E2H J;  3S1N J;  2E2J J;  4FE4 A;  3H0G J;  4M3E A;  1WGX A;  1JKR C;  3BTC A;  4MIM A;  2OF7 A;  3SFI A;  2H8R A;  4BBS J;  1BA5 A;  3HOX J;  3F0C A;  3M3Y J;  1I50 J;  3MN2 A;  2JK3 A;  3GTO J;  3JRB A;  4A3J J;  3OOU A;  5IOZ A;  1MBH A;  1IC8 A;  2YU9 J;  2MSY A;  3HGG A;  1ENH A;  1GT0 C;  5EGO B;  1U8B A;  3HM5 A;  1ZQ3 P;  1JTX A;  4AYB N;  2ECC A;  3Q0U A;  1VND A;  2CUE A;  1BL0 A;  1IDY A;  3GBG A;  2HOS A;  3LNQ A;  1JT6 A;  4CYC A;  1RES A;  4A3B J;  3TW6 A;  3FK6 A;  2X9D A;  3D1N I;  1A6I A;  3I4N J;  2M9H A;  3JRI A;  4A69 C;  5EZH A;  1ETK A;  1F43 A;  3ZQH A;  3S16 J;  4M3B A;  2LD5 A;  3O8G A;  2L7F P;  2ECB A;  3S1Q J;  2EZK A;  4AUX A;  1GUU A;  2L0K A;  4UUS B;  5E3M A;  1MBE A;  2DA4 A;  5J3L A;  4FTH A;  1CQT A;  1SAN A;  2LK2 A;  2FX0 A;  2LKX A;  2FQ4 A;  2X6O A;  1IGN A;  4BXX J;  2K40 A;  3A01 A;  3FK7 A;  4BBR J;  1TWF J;  2EBI A;  5K7H A;  5FKN A;  2DJN A;  3ZQL A;  1PUF B;  3MKL A;  4MO7 A;  2R5Y B;  2LLK A;  4EEF G;  1TWH J;  2LR8 A;  1MH3 A;  3Q0V A;  1E3O C;  3HKZ N;  2ZB9 A;  3BG3 A;  3OSG A;  4JX4 A;  1VI0 A;  4XK4 A;  1YRN A;  5EDN A;  5M5Y J;  2JN6 A;  2KDZ A;  5K7F A;  1X2M A;  2MGQ A;  3JRD A;  4C2M J;  2H1K A;  1D5Y A;  2Y9Z A;  3S1M J;  1IJW C;  1IRZ A;  2DTZ A;  1Y1V J;  3BT9 A;  1Q1V A;  5GPC A;  1JTY A;  5EZG A;  3ZOB A;  2R92 J;  5FKK A;  1H89 C;  1FIP A;  2Y9Y A;  1MH4 A;  2LVS A;  1WCM J;  2CJJ A;  3IH2 A;  1MNM C;  1JKP C;  4JX6 A;  1UG2 A;  1WH7 A;  5F1J A;  2R5Z B;  4JX5 A;  1P7J A;  4A3C J;  2DMP A;  1NK2 P;  4W1U A;  2I10 A;  4FIS A;  1OCP A;  2Y31 A;  2MW8 A;  2DA3 A;  5IYD J;  1RET A;  4BY7 J;  3HEF A;  1JJ8 C;  1WH5 A;  4Y7N J;  1ZR4 A;  1B72 B;  1XC5 A;  1ZGW A;  1JT0 A;  5BNG A;  1W0U A;  3LSG A;  2DA5 A;  4G12 A;  5IYB J;  1FTT A;  4RDU A;  2M34 A;  3BR2 A;  3LSR A;  2DMU A;  2XRL A;  4DYR A;  4MFE A;  2ME6 A;  4B3A A;  1APL C;  2LY9 A;  4IHV A;  2K9S A;  3PO2 J;  1JUM A;  5M3F J;  1ZR2 A;  4HNV A;  2XB0 X;  3TP3 A;  4JYK A;  1XG1 A;  2X48 A;  3OIO A;  4NDL A;  2CU7 A;  2EZL A;  5C3E J;  4D5F A;  2R7Z J;  2M8G X;  3FKI J;  5FKO A;  3A02 A;  1ETW A;  5F04 A;  3RQI A;  1BW6 A;  2JA7 J;  1FIA A;  2E1O A;  3O8H A;  3NAR A;  2N8G A;  3JRE A;  3RZO J;  4QSH A;  1LE8 B;  4D7N A;  1TWC J;  1UHS A;  3OSF A;  4XRS G;  5M5W J;  2LP0 A;  3BG5 A;  3QPS A;  2Y0S N;  4J19 A;  1G2H A;  2XGC A;  1U78 A;  1R9T J;  2AO9 A;  4IHY A;  5FJ8 J;  2QCO A;  2WV1 A;  4B1R A;  2M0C A;  3K2A A;  5EGO A;  5C4X J;  1RPW A;  2XPV A;  1NK3 P;  1MBF A;  1LFB A;  3NAU A;  5FLV A;  4B4C A;  3PM1 A;  2E19 A;  4QTR A;  5J1U A;  2CQX A;  2FJ1 A;  4ABZ A;  1JJ6 C;  2DN0 A;  1QPI A;  3CMY A;  3FIS A;  4GFB A;  1ZTR A;  4S0H B;  3DCF A;  5GP9 A;  3Q0W A;  2JMW A;  5J1R A;  2DA2 A;  4XRM A;  3SJM A;  4V2G A;  4W97 A;  4IHX A;  4D5C A;  1B8I B;  3GTK J;  2R0Q C;  3HGY A;  2JA5 J;  2CUF A;  1H88 C;  1H8A C;  1Z0X A;  1OFC X;  1QRY A;  1F36 A;  3G1O A;  2GLO A;  4Y52 J;  5JLX A;  5IP7 J;  1GV2 A;  5JLW A;  5EEA A;  2CQQ A;  4UUS A;  3IH4 A;  3GTG J;  4M3D A;  1JUP A;  2B63 J;  1ORK A;  2VPR A;  3A03 A;  3L1P A;  2YUS A;  5IYC J;  4A3D J;  4IHW A;  3TW7 A;  1GV5 A;  2ELK A;  5FKL A;  3IV5 A;  3B6C A;  3BR6 A;  2NVQ J;  5EYR A;  1PUF A;  5IPA A;  2R5Y A;  5E3O A;  1GDT A;  1MBK A;  2NVT J;  5M3M J;  2HDD A;  2LTP A;  1DU0 A;  1ETQ A;  3RKQ A;  2ME0 A;  1HLV A;  4X1E A;  2TRT A;  4A93 J;  2K9N A;  2VKV A;  1K83 J;  1XS9 A;  2EZI A;  1HDP A;  4A3G J;  1AHD P;  3E7L A;  1NTC A;  3FIW A;  2LFB A;  1RR7 A;  2XPU A;  1JUS A;  3GTP J;  1QVU A;  3Q3S A;  3B6A A;  2VUM J;  3HBL A;  3BR0 A;  5FLM J;  4MLO A;  1ETO A;  2OPT A;  5IP9 J;  3JR9 A;  4RBO A;  2R5Z A;  2AHQ A;  1MSE C;  5E3N A;  5K7Z A;  2TCT A;  1WI3 A;  2NS8 A;  1BW5 A;  1DU6 A;  5EF6 A;  1JKQ C;  4IEJ A;  2D5V A;  5DTD A;  4C3J J;  4M3G A;  2JJ7 A;  4A3F J;  3H3V K;  3BR1 A;  2O7O A;  1POG A;  4I76 A;  4QIW N;  1B72 A;  4A3K J;  1SFO J;  5F08 A;  5F27 A;  3CDL A;  5M5X J;  4I6Z A;  5F0F A;  2IAI A;  2HOA A;  2DMT A;  5E3L A;  3WHC A;  4V2F A;  3SDG A;  3S17 J;  1ZKG A;  1BJZ A;  1IG7 A;  2EZH A;  4AC0 A;  3QPL A;  3JRC A;  2R93 J;  4XIC A;  4A3E J;  5EG0 B;  1MBJ A;  1HOM A;  3HOY J;  2JA6 J;  4C3I J;  3TP0 A;  1X58 A;  3RZD J;  3K7A J;  3JRG A;  1FTZ A;  1W0T A;  3HDD A;  2MG4 A;  3QQA A;  5IOY A;  3G1L A;  4DYQ A;  1AKH B;  2JA8 J;  1UMQ A;  1ZK8 A;  4M3F A;  3S14 J;  2NS7 A;  5EG0 A;  1TC3 C;  4X6A J;  1Y1W J;  3S2H J;  4XID A;  2NVX J;  4JP0 A;  3VPR A;  3S15 J;  4BY1 J;  2XPW A;  1X2N A;  2VI6 A;  1AKH A;  1LE8 A;  1GVD A;  1ETV A;  2HI3 A;  2FD5 A;  2WAQ N;  2DA6 A;  1VF9 A;  4XRS A;  1T33 A;  2KT0 A;  4CYC B;  3HOU J;  1MSF C;  2EQR A;  1I3Q J;  1OCT C;  4M6V A;  3JRF A;  3UKG A;  4A3I J;  3BR5 A;  3HB9 A;  1HDD C;  2E2I J;  1IDZ A;  3ZQG A;  3IH3 A;  3PO3 J;  2L7Z A;  2Y30 A;  3BTL A;  1T56 A;  1A5J A;  1OJL A;  2PMZ N;  3G1M A;  1LFU P;  1IUF A;  3BG9 A;  3LSP A;  2L7M P;  1RKT A;  1ITY A;  3C2B A;  1I6H J;  2IEK A;  3HOV J;  3M4O J;  1FEX A;  4LOC A;  1B8I A;  3A01 B;  3BTJ A;  5GPA A;  2HXO A;  2RAE A;  2O9L A;  2XGD A;  2GBY A;  2HYJ A;  3LSJ A;  2K9Q A;  2WB1 N;  1IV6 A;  3BQZ A;  2W48 A;  3ZQF A;  4MFD A;  3HOW J;  4A3M J;  2Y2Z A;  2DA7 A;  1YRN B;  4C3H J;  1S7E A;  3GTM J;  3LOC A;  2VKE A;  1WPK A;  5HOD A;  2L9R A;  3WHB A;  2COB A;  2XGE A;  2M2E A;  3MVP A;  2NVY J;  1FJL A;  5IP6 A;  5C44 J;  3ZQI A;  2O8K A;  3I4M J;  1O4X A;  2HQ5 A;  2XB5 A;  1VFC A;  1U9N A;  2IBD A;  1QVT A;  2DMQ A;  5F0H A;  5J1Y A;  3ZQC A;  4DZJ A;  4A3L J;  4DYC A;  2P81 A;  5F0C A;  1ETY A;  4DZP A;  1MBG A;  1HCR A;  3BR3 A;  1JGG A;  2ID6 A;  4FE7 A;  2XSD C;  1Z77 A;  4DW6 A;  2DA1 A;  1U9O A;  9ANT A;  2NOG A;  2QF7 A;  3HOZ J;  1EF4 A;  2HOT A;  3DEW A;  1K61 A;  1HF0 A;  2EH3 A;  2CRG A;  5FKM A;  3GTQ J;  5DS9 A;  3BQY A;  3CCY A;  1P7I A;  3JRA A;  4FCY A;  1AU7 A;  3JRH A;  4UUT A;  1RKW A;  3TED A;  3GTL J;  3CQZ J; 
#chains in the Genus database with same CATH topology
 3BTI A;  3I56 I;  4XL9 A;  3K69 A;  2FEZ A;  3GTJ J;  3S2D J;  3S1R J;  3L9F A;  2FMY A;  3IHU A;  2CV1 A;  2DMN A;  1ON2 A;  4CHU A;  1R7J A;  1ONV A;  4HX8 A;  3FM5 A;  4NC8 A;  5HDN A;  1B9N A;  5E79 C;  2Q1Z B;  2IA1 A;  3DXJ F;  1TWG J;  3ZQQ A;  3NEU A;  3S1N J;  3CUO A;  1Z7U A;  5HS9 A;  3O2P E;  4ZZL A;  4ZYD A;  4DGW B;  2KJC A;  1BR2 A;  2UUZ A;  3V8L A;  2XAJ A;  4ZYE A;  4MIM A;  1FPQ A;  4YEL A;  1X4P A;  3ZP5 A;  3DQV C;  3SFI A;  3CCL I;  1BA5 A;  3K70 C;  3TL4 X;  2XAF A;  4M72 A;  3DWL E;  3OYK A;  3OL4 A;  3ZXS A;  1E17 A;  2JK3 A;  4Y13 A;  3FF5 A;  3OOU A;  5ILU A;  3IKV A;  1RUN A;  3HGG A;  3ABU A;  3QP5 A;  3I64 A;  1OPC A;  2VOP A;  2RKH A;  3H5A A;  4H0E A;  1NH3 A;  4ZTJ A;  2Y75 A;  2PQ8 A;  2CUE A;  3RSN A;  5FO5 A;  1I39 A;  2NAZ A;  3LNQ A;  2DI3 A;  2RN7 A;  2XUB A;  1Z6T A;  3L7W A;  1HQC A;  4CYC A;  4O6J A;  4OIQ F;  2HZD A;  2WAQ A;  3OYG A;  1O3R A;  1ETK A;  3CUQ B;  3QU6 A;  1QQI A;  2DU9 A;  1F4K A;  2P6S A;  3S3N A;  4BHC A;  4IRG A;  2LD5 A;  4Q48 A;  1TTY A;  2X1E A;  2ECB A;  2EZK A;  2YX4 A;  1R5G A;  4AUX A;  1NG7 A;  4E70 A;  3EUH A;  3PSI A;  2DA4 A;  1XTA A;  4I2O A;  1CQT A;  4AM3 A;  3E1S A;  4AVZ A;  4BEH B;  2STT A;  3TKY A;  4BXX J;  2K40 A;  4G8X A;  4LK0 F;  3A01 A;  3FK7 A;  1OYI A;  2K4J A;  5FKN A;  3OS2 A;  1T98 A;  3K0L A;  5E1W A;  4XM3 A;  1MH3 A;  4HRI A;  1TLH B;  3OIQ A;  5B66 C;  2FNP A;  1PVE A;  1USS A;  4HG2 A;  5K7F A;  1X2M A;  2VB6 A;  1R5H A;  1T2K A;  4CA0 A;  2RV8 A;  4KIF A;  2H1K A;  3JSO A;  3OL3 A;  4MQ9 F;  4YFX F;  1VTN C;  3G71 I;  3N05 A;  1Q1V A;  1JTY A;  4MGR A;  1WCM J;  2K02 A;  2WWY A;  1JKP C;  4JX6 A;  1WH7 A;  4G94 A;  3H9J A;  2R5Z B;  3BCA A;  3NRV A;  2PJR B;  5J4Y A;  1NK2 P;  2VQL A;  3OR1 C;  2K4B A;  4LJZ F;  4RA2 A;  2BVM A;  2W00 A;  2EWN A;  5IYD J;  4PJN A;  4PJJ A;  4XLH A;  3HEF A;  3G73 A;  1J0R A;  4A0X A;  3SZT A;  3F6O A;  1YW8 A;  2M34 A;  1XDU A;  1QO0 D;  1GXQ A;  3LSR A;  1RI7 A;  2XRL A;  1APL C;  2FBK A;  5EJC A;  4AU7 A;  3TO6 A;  2OCE A;  3K70 D;  1R23 A;  3J80 Z;  2CV2 A;  3PO2 J;  1YYV A;  4XLE A;  5M3F J;  1G3Y A;  5L3E A;  4UUV A;  2XB0 X;  3GW2 A;  3WTY C;  3DPT A;  4ETS A;  1PUE E;  2QVO A;  2X48 A;  1P6R A;  4EJO A;  2CU7 A;  3EYI A;  1DPR A;  4MEX F;  3GME A;  1S8N A;  2XGX A;  4X0G A;  5FKO A;  3VSK A;  5DYM A;  2QSH X;  3B02 A;  1P4A A;  4HEA 2;  3WGI A;  1HSJ A;  1O3S A;  1R4N B;  5IY5 H;  1FIA A;  1FZP B;  4MEY F;  3ZMV A;  2E1O A;  1G6N A;  2N8G A;  2KZG A;  2V1N A;  1FSH A;  1LE8 B;  2M1B A;  2ICW G;  5HVQ C;  3DTK A;  4NHJ A;  1UHS A;  2HTJ A;  4IRH A;  4A6D A;  2ISY A;  2BY3 A;  4E7K A;  3C3W A;  4KT6 A;  2LP0 A;  5K1Y A;  1TZL A;  2XGC A;  1KYZ A;  3KEY A;  3OV8 A;  5CVR A;  2VJ4 A;  4F3Q A;  3GYH X;  2A5W A;  1D0Z A;  5IT3 A;  1YHQ I;  4OWR B;  3IWF A;  1TQI A;  4B4C A;  3PM1 A;  3VWB A;  2E19 A;  3IUO A;  4PK4 A;  4BDZ A;  2F2E A;  1J9I A;  2O03 A;  3BG7 A;  4M74 A;  5LHH A;  3HRS A;  1IAW A;  3TO9 A;  5ED4 A;  4GYG A;  1P92 A;  1T0F A;  1HKT A;  4O5V A;  3FMQ A;  5H2F C;  1J09 A;  3CZ6 A;  2WBM A;  3FXU A;  3H0D A;  1H88 C;  4Y3O A;  2OTL I;  4XSZ F;  5LBQ A;  3OYH A;  5IP7 J;  1FBS A;  4M3D A;  4AWX B;  1G3W A;  3DPL C;  3TGN A;  3A2K A;  4XR6 A;  1J7K A;  1LDK B;  3L1P A;  2YUS A;  4WXC A;  3PIP F;  2IT0 A;  5IYC J;  3LSM A;  1QHG A;  4A3D J;  2A5Y B;  5J47 A;  3ROU A;  1G8X A;  2R7U A;  2QBY A;  5LFA A;  2K3P A;  3BR6 A;  3LSH A;  2IVM A;  4U0Y A;  3H92 A;  2DTR A;  4XLP F;  3EUA A;  1GDT A;  1WJE A;  5J4V A;  2KRC A;  2L4A A;  1LQ1 A;  3R0A A;  5J40 A;  3J7A Y;  2NXN B;  1YX3 A;  4A5M A;  4CCM A;  3KYL A;  2K9N A;  3V8K A;  3ZMS A;  3OYB A;  1BC8 C;  1UJ8 A;  3K1N A;  3F8N A;  1SFE A;  1B6A A;  2IP2 A;  2R7F A;  1V54 H;  2F4M B;  2H27 A;  2P5V A;  4IF4 A;  4MQV A;  1MKM A;  1ZYR F;  3OYE A;  2A68 F;  2MFZ A;  5J8F A;  3PFY A;  3S3O A;  1VQ6 I;  2XAH A;  2VKH A;  2RVC A;  3I9V 2;  5D8L B;  5LRR A;  2VUM J;  1O7L A;  5K5O A;  1UST A;  2X1C A;  1ETO A;  5B5E C;  2YR2 A;  3A0H C;  3VDX A;  3S3M A;  4BE0 A;  2ZFU A;  2TCT A;  2NS8 A;  1BW5 A;  1Z67 A;  2F4I A;  5GAD J;  4A3F J;  2JJ7 A;  3K4C A;  3H3V K;  4R79 A;  3H9Q A;  2DYS H;  1AOY A;  2BW3 B;  4KA4 A;  3J81 Z;  1U0J A;  3BDD A;  5F08 A;  1T0F C;  2CFX A;  4IQ4 A;  5F27 A;  2VJJ A;  2HDC A;  1W1W E;  4HA8 A;  4BUP A;  4BE1 A;  2GIV A;  4V2F A;  3H9G A;  2KMU A;  4F55 A;  1KU3 A;  1DGW Y;  1I1S A;  1SFX A;  1MND A;  3F8M A;  3PNV A;  3QPL A;  4KUM A;  5EG0 B;  1MBJ A;  2F5D A;  3TP0 A;  2L9S A;  4KIC A;  3K7A J;  2Z9O A;  1W0T A;  2EFP A;  3QQA A;  1OIS A;  5FGM A;  3OYC A;  3CTA A;  5DCM A;  1XMX A;  2ZJP F;  3CCJ I;  1TC3 C;  3R61 A;  1Y1W J;  4WF2 A;  3KP7 A;  4UHT A;  2Q2E B;  4A2U A;  2DXI A;  4BY1 J;  2E34 A;  2NOJ B;  2PEX A;  4LGW A;  3RPU D;  2V9V A;  2YPR A;  3HSE A;  1CF7 A;  4XRS A;  1XGM A;  1T33 A;  2KT0 A;  4ZJZ A;  4CCO A;  4I99 C;  3TO7 A;  3FXJ A;  5CVU A;  3U1K A;  4BNC A;  5KNL A;  2E2I J;  3CJQ B;  4YIF A;  3LST A;  2X6W A;  5DEQ A;  4IZZ A;  1LDJ A;  3GX4 X;  1SVL A;  3QPH A;  4N0B A;  4UV9 A;  4EM0 B;  2L7Z A;  2M30 A;  2XAQ A;  4XLA A;  2Y30 A;  3BTL A;  4PGG A;  2PMZ N;  4MHG A;  3PJR A;  2F48 A;  3AKZ A;  1WRJ A;  1RKT A;  2KQR A;  2CQN A;  2X4H A;  2HEO A;  2IEK A;  2OQG A;  3M4O J;  1BJA A;  1IW7 F;  3T0Y A;  2HXO A;  3FMR A;  3CJN A;  3BRO A;  3LWF A;  2O9L A;  1K4S A;  1U5T B;  2EK5 A;  1XCV A;  2IS6 A;  2CYY A;  5LGU A;  3LSJ A;  3HZJ A;  1F9N A;  3RTR A;  2VT3 A;  2I8D A;  3ZMZ A;  2X6Y A;  4C9Y A;  1XD7 A;  4UVC A;  4C3H J;  1YX5 A;  1Z3X A;  5BPD A;  3GTM J;  1OCC H;  4FHT A;  1O57 A;  3F21 A;  1YJN I;  2K7L A;  3WHB A;  5IT9 Z;  3MVP A;  2NVY J;  5KK1 A;  2DT6 A;  3M8F A;  1VQ8 I;  3JAM Z;  1SMY F;  3GZN B;  3P9I A;  2XB5 A;  2FSW A;  3P9C A;  3JW4 A;  3K4L A;  3S32 A;  4XBF A;  3ZMD A;  3OYJ A;  3CO7 C;  1QVT A;  1D1B A;  4RLF A;  5LGN A;  3CC4 I;  1JI8 A;  3V7R A;  1ZGJ A;  3WOD F;  5D4S A;  3E5U A;  1V5E A;  3AL0 B;  2ISZ A;  5DV5 A;  1BR4 A;  5JHU A;  2JUG A;  1MBG A;  4ENN A;  3V8J A;  1JGG A;  2ID6 A;  2DA1 A;  4WK8 F;  2NOG A;  2PLY A;  4UNO A;  1OYY A;  4B8X A;  4HLX A;  3PIO F;  2H8W A;  3FX3 A;  4M9Z A;  4Y4R A;  4ZDL A;  4UY8 I;  3GTQ J;  1Y8R B;  3CCY A;  1HW1 A;  3RPQ A;  3J7Z I;  1X1D A;  1WFX A;  3F8B A;  3CQZ J;  4JQF A;  2V7F A;  2EFW A;  2D1H A;  1ETX A;  2O0Y A;  4XON A;  1UZC A;  2YS9 A;  3ASN H;  3MZY A;  4UB6 C;  2TDX A;  1S5L C;  1SVO A;  3W6V A;  1TWA J;  1E2X A;  1I27 A;  2DFH A;  2LH9 A;  2ID3 A;  4D1Q A;  2JWT A;  1QPM A;  5C4J J;  2E2H J;  2HWV A;  2DAO A;  4FE4 A;  3CF2 A;  2MAB A;  5CVJ A;  2JUC A;  1G4D A;  4ITV A;  4PZJ A;  3JSP A;  2R7T A;  3LQR A;  3R0J A;  1JKR C;  1KQ0 A;  2PFB A;  1XCB A;  2R7S A;  1QZY A;  2H8R A;  2R7X A;  4XKW A;  2Z5U A;  1JHF A;  1UHM A;  4J01 A;  3F0C A;  4EM1 A;  2CMP A;  3M3Y J;  3HIF A;  3HRT A;  1OR7 A;  4PDK A;  4NQW A;  2FA5 A;  3JRB A;  1FBU A;  1IC8 A;  3R4K A;  2NNY A;  3LAJ A;  5E8I A;  5EGO B;  1VQN I;  3HTS B;  3KP3 A;  1J2X A;  1SD5 A;  4AYB N;  2CFO A;  3Q0U A;  3WTW C;  1VND A;  1W7P A;  2PG4 A;  1Y8Q B;  5BMZ A;  2ZXI A;  1BOB A;  3F72 A;  2LBF B;  1T08 B;  2IA2 A;  4IVN A;  1BL0 A;  2HVR A;  3GBG A;  1JT6 A;  3PQJ A;  1L0O C;  2KPM A;  1A6Q A;  3HUG B;  1YJ9 I;  1RES A;  1R00 A;  4KIT B;  2Y69 H;  1ZLJ A;  4KIS A;  3I4N J;  3BY6 A;  3JRI A;  3SDB A;  3S16 J;  4F92 B;  5L3G A;  3PQK A;  5E8G A;  3CCS I;  2HPM A;  4IKF A;  2MA3 A;  4U87 A;  1GUU A;  3ZMT A;  4UUS B;  1S9H A;  1B59 A;  5J3L A;  1E3P A;  1XMA A;  3WTU C;  4CCJ A;  4ENK A;  4XLC A;  2LK2 A;  1WHU A;  2LKX A;  2FQ4 A;  2X6O A;  3W6J B;  2E71 A;  3I54 A;  5CPR B;  4HV6 A;  2W25 A;  2ESH A;  1BN5 A;  5AIP A;  2LYC A;  3LSI A;  5BS6 A;  5J8C A;  2A3S A;  2EBI A;  5GAE J;  1S6L A;  3IAM 2;  2DFI A;  3MKL A;  2R7O A;  4MO7 A;  3O3K A;  4ZYA A;  2LLK A;  2R5Y B;  1TWH J;  2MD5 A;  2X1D A;  1FMW A;  3Q0V A;  2CWE A;  1U8R A;  2ZB9 A;  5D5X B;  3OSG A;  2KIM A;  4I09 A;  2OZ6 A;  3Q9V A;  4LIT A;  1VI0 A;  4M6X A;  1VQ4 I;  4HX4 A;  1YRN A;  5M5Y J;  2JN6 A;  2ZKZ A;  3E3V A;  1H9T A;  2CQK A;  1RUO A;  1ZG1 A;  2GOX B;  5DDG A;  1JGS A;  3HPH A;  3K9T A;  2YSR A;  2A69 F;  2E1M C;  2Y9Z A;  3KP4 A;  2HR3 A;  5A2Q Z;  1JXS A;  2V79 A;  4HF2 A;  2HGC A;  1D5V A;  2ELJ A;  2LSO A;  1OR7 C;  4QWQ A;  3F6V A;  2FNA A;  4ESJ A;  4IHS A;  5KVR A;  1H89 C;  4LG3 A;  4RGU A;  1IN5 A;  3F8F A;  4IQJ A;  3LL7 A;  1HW2 A;  2GA2 A;  4FAS D;  3ABT A;  3E6D A;  4LG0 A;  1UG2 A;  2E35 A;  1K78 A;  5F1J A;  4F93 B;  1SD4 A;  2FRH A;  2VBZ A;  1YS7 A;  1UB9 A;  3GXO A;  1P7J A;  2LF7 A;  3VEP A;  2DMP A;  1LFP A;  2EV0 A;  5D6E A;  2PMU A;  3UNG C;  4BAY A;  4FIS A;  4LFU A;  4IRI A;  2W57 A;  2MW8 A;  3R6S A;  5ICG A;  5HLH A;  2DA3 A;  1D0X A;  2AXL A;  4BY7 J;  1JJ8 C;  1WH5 A;  1ZR4 A;  2F4O B;  2ZME C;  1JT0 A;  4AID A;  1YQA A;  4G12 A;  1FTT A;  4IOC F;  1OQY A;  3HHG A;  3OOP A;  4DYR A;  4MFE A;  4IHV A;  2LY9 A;  3MD2 A;  3KZY A;  4XLN F;  2BBY A;  2OD5 A;  4HNV A;  1K7A A;  3SQN A;  3T1B A;  4QPQ A;  3TP3 A;  2BEO A;  4I98 B;  2OBP A;  4JYK A;  1XG1 A;  4ZDO A;  2F5E A;  5EEG A;  1YI2 I;  2EZL A;  1L3L A;  3QOD A;  4NUB A;  5CKT A;  5C3E J;  2EFQ A;  1PP8 F;  3JTH A;  2R7Z J;  5K5Q A;  3KZZ A;  3G4S I;  5F04 A;  2IW5 A;  1MIJ A;  1YG2 A;  1P4X A;  2KKO A;  1BW6 A;  4RB0 A;  3OYM A;  2L9N A;  5CQG A;  3K4J A;  1FWZ A;  3OMY A;  3NAR A;  5BOX A;  2R7D A;  4L9J A;  3CF5 F;  2F6C A;  4M9X A;  2YX7 A;  5TRD A;  3OSF A;  5TGT A;  1P9Q C;  2F5V A;  1LVK A;  3WTZ A;  4XRS G;  1IXC A;  2QQA A;  2Y0S N;  3GZ5 A;  1R9T J;  1FP2 A;  5LRS A;  3L2U A;  3E6C C;  3NWT A;  5FJ8 J;  1TL8 A;  1N75 A;  1GLN A;  3G3Z A;  3K2A A;  3ZN1 A;  1SAX A;  2XPV A;  1MBF A;  1LFB A;  3QP6 A;  4XSX F;  4FQG A;  2E7X A;  3CD6 I;  2OU2 A;  4ABZ A;  4KDP A;  2VE8 A;  2QM3 A;  4II2 A;  4GFB A;  1ZTR A;  2R7V A;  3KP5 A;  4AYB A;  3MKW B;  1DP7 P;  1OKR A;  4XQF A;  1MJA A;  3ZRG A;  2O6G E;  4W97 A;  4IHX A;  1X4O A;  3IRR A;  4D5C A;  3GTK J;  3RJP A;  1Z7L A;  4IPA A;  1V5G A;  3M8J A;  4M73 A;  4OIN F;  4YEJ A;  2BVL A;  2UWM A;  1Z0X A;  1F36 A;  4CGZ A;  5JLX A;  1GV2 A;  5EEA A;  2CQQ A;  4RGX A;  2FBH A;  1JUP A;  2ELH A;  3CP8 A;  4AD9 A;  3E6M A;  1FBQ A;  3WTX C;  2UZK A;  3CCM I;  3BJO A;  3CCU I;  1X3W B;  2RGV A;  4LB5 A;  1OYW A;  1R36 A;  4KFC A;  3OY9 A;  3FDY A;  2P0W A;  2HKO A;  1BBY A;  1TT0 A;  1S7A A;  3QYB A;  4L5I A;  1PUF A;  4E7Z A;  4BU2 A;  2VC1 A;  5E3O A;  3HC7 A;  5M3M J;  1V5F A;  3K4N A;  2HFH A;  5E17 F;  3KYD B;  3H5R A;  2VKV A;  1K83 J;  1X1B A;  2XHK A;  4A3G J;  2ZJQ F;  1MNE A;  2BXZ A;  2E1C A;  1XGN A;  3EDP A;  1RRJ A;  2RQP A;  5DUK A;  2VLA A;  1TW2 A;  4ENJ A;  2LC2 A;  1YW7 A;  4PFP A;  4Y33 A;  1FX7 A;  1D1A A;  1PDN C;  3J7A O;  1ZH5 A;  3DP7 A;  1A04 A;  3EQL F;  3W2A A;  2EV6 A;  4A0Z A;  1QVU A;  1W5T A;  1YIT I;  3FKJ A;  3E5X A;  5FLX Z;  2ZBK A;  1X1C A;  3B6A A;  2IS1 A;  2EIK H;  2FF4 A;  2KIU A;  4DNC A;  3WU1 B;  1IZ1 A;  2PMH A;  3K4B A;  4WX9 A;  2KRH A;  5K7Z A;  2HOE A;  1WI9 A;  3I59 B;  3L2R A;  1FC3 A;  2XVC A;  5H20 A;  1RIO H;  2XV4 S;  3LMM A;  2W82 A;  4C3J J;  1A31 A;  4M3G A;  4BHP A;  1O3Q A;  2CW8 A;  2ZC2 A;  1POG A;  5BQT A;  1B72 A;  1QU3 A;  1H0M A;  4BHB A;  3EUH C;  5M5X J;  4I6Z A;  2DBB A;  2IAI A;  2V9K A;  1D8J A;  3KFW X;  3FBN B;  3FHN A;  2W85 A;  3WHC A;  4E7I A;  1R49 A;  2LRD A;  3K6G A;  4P55 A;  4D9J A;  3S17 J;  3ZMU A;  3LFK A;  1FOY A;  2XRN A;  2RNJ A;  3LSK A;  1IG7 A;  2L2O A;  2M3A A;  2VN2 A;  1C0W A;  3ZPL A;  4A3E J;  1HOM A;  2LNB A;  5LEK A;  4C3I J;  1X58 A;  3RZD J;  2QSF X;  3JRG A;  3H3Z A;  4OMY A;  1MMS A;  4RMN A;  3K4M A;  3H1C A;  1NG6 A;  2Z3Y A;  2EIJ H;  4M3F A;  2NS7 A;  5EG0 A;  1T6S A;  4RAF A;  4BGD A;  2IJL A;  3S2H J;  4XID A;  4P96 A;  2I5U A;  1JE8 A;  4ZZD A;  1N78 A;  2L54 A;  1A35 A;  2BYV E;  2IGO A;  1W5S A;  3MQ0 A;  3W6K B;  1VQ7 I;  2XPW A;  5DD8 A;  2FML A;  1UAA A;  1K6O A;  1ETV A;  1GVD A;  5ERI A;  2Z99 A;  5EEH A;  3T8R A;  1F1Z A;  2DA6 A;  2HS5 A;  1R58 A;  4CYC B;  3HOU J;  1MSF C;  4LD5 A;  2EQR A;  1I3Q J;  4B3X A;  1OCT C;  2DW4 A;  3JRF A;  5D6F A;  2UXN A;  1TQM A;  3UKG A;  3BR5 A;  4E6K G;  3HB9 A;  5KHD A;  4XLF A;  5CYV A;  4E4H A;  3RI4 A;  1IDZ A;  4NC6 A;  1X3Z B;  2M5W A;  3ERE D;  3IH3 A;  2Y0S A;  3RYR A;  4CSW A;  1DDN A;  3PO3 J;  2NNN A;  3GLX A;  2KL4 A;  2AS5 F;  2KJB A;  3BJ6 A;  1Y0N A;  2X85 A;  3G1M A;  3J81 K;  2EIL H;  2L7M P;  2WC2 A;  1TQP A;  2Q0O A;  4BAC A;  3SEQ A;  1Z05 A;  4HLY A;  1I6H J;  1KYW A;  3HOV J;  4LOC A;  1B8I A;  5CQE A;  1RNL A;  3I53 A;  3A01 B;  1IUY A;  3ZCO A;  3M9A A;  5GPA A;  4IX7 A;  1S29 A;  1IRG A;  1TBX A;  2VT2 A;  4XRF A;  2KDO A;  4KN7 X;  2V1U A;  1T39 A;  4N9H A;  4JOM A;  3S2W A;  4EM2 A;  1K4T A;  3WTT C;  2WB1 N;  1IV6 A;  1OLT A;  3DU6 A;  4RS8 A;  3KEQ A;  2QEN A;  5DD4 A;  1U2W A;  2K9M A;  2KFD A;  1U5T A;  5FB2 A;  2COB A;  2V6E A;  2EIN H;  3EUK L;  4HX7 A;  2M2E A;  3BZC A;  5IP6 A;  5C44 J;  2LDU A;  4LIU A;  4AIJ A;  3MWM A;  1V4R A;  1VQK I;  1TNS A;  2H6C A;  1IV8 A;  2DMQ A;  2MYS A;  3ZQC A;  3AFH A;  6PAX A;  4DZJ A;  2E7W A;  1MMN A;  1SD7 A;  2ZJ2 A;  4XKV A;  4BQO A;  4A3L J;  2BV6 A;  3I4P A;  4Z6Y A;  2P81 A;  4CZC A;  1HCR A;  3BR3 A;  1YOV B;  2XF5 A;  4DBQ A;  1Z77 A;  4DIQ A;  2XSD C;  1IN8 A;  2E5N A;  1U6G A;  4MTD A;  2QF7 A;  1EF4 A;  3OIP A;  3QPT A;  2BXY A;  2HOT A;  4YFN F;  3ABK H;  3DEW A;  1HF0 A;  4A0Y A;  4EAT A;  2FXA A;  3BQY A;  2RC4 A;  4S04 A;  2IGN A;  1BIA A;  2EA4 A;  5ICF A;  4HZF A;  2WY7 Q;  3GO5 A;  1MMG A;  3GTL J;  4G6T B;  2EB7 A;  3HSF A;  1BI0 A;  4BKX A;  4GCV A;  4CCL A;  2STW A;  3HHH A;  2MLK A;  4HSR A;  1RC9 A;  1A36 A;  1J5Y A;  2VXZ A;  3IC7 A;  1D8K A;  1ODD A;  4A6E A;  2HXI A;  2Y48 A;  1JKO C;  3IAS 2;  4I0A A;  3KZI C;  2UXX A;  1SEU A;  5TIS C;  4HST A;  1BI1 A;  5FD5 A;  5IT9 K;  4KT5 C;  3G2B A;  4OIP F;  4M3E A;  3BTC A;  3AG3 H;  3KCC A;  2OF7 A;  4Q4Z F;  3H35 A;  3KP6 A;  1FSE A;  1YJW I;  1Z91 A;  4BBS J;  4I02 A;  3E0J B;  3HOX J;  1QBJ A;  4Y17 A;  1YTY A;  1I50 J;  4HQM A;  4ESF A;  3MN2 A;  2B0L A;  3LFU A;  3R60 A;  3ERM A;  3K1P A;  5IOZ A;  2DO7 A;  1MBH A;  2YU9 J;  2ZO4 A;  1IXR C;  1ENH A;  3KIO A;  1GT0 C;  3BC8 A;  1U8B A;  3HM5 A;  4KIG A;  5LLQ A;  1ZQ3 P;  1JTX A;  3D5R C;  2ECC A;  4N4N B;  1ZN2 A;  2DOD A;  2LY2 A;  2HOS A;  1XGS A;  3ELK A;  1HA8 A;  3GLL A;  3AAF A;  5DM7 F;  3PFI A;  3TW6 A;  4KYW A;  1ON1 A;  3D1N I;  3BZK A;  1IF1 A;  2LF8 A;  2M9H A;  3RKY A;  2C6Y A;  4ZDP A;  2ZXJ A;  3WGH A;  2V6C A;  4R8H A;  2WTE A;  4UVB A;  4BXU A;  1E0E A;  2Q8K A;  1NHA A;  3DFG A;  3CO6 C;  1R1U A;  3O8G A;  4DOZ A;  1Z21 A;  1TNT A;  1WJD A;  4XNF A;  4P1W A;  1WWX A;  2DOE A;  5E3M A;  1IRX A;  5ICE A;  1EV7 A;  4PUS A;  4FTH A;  3KYC B;  1G3T A;  2FX0 A;  3IKT A;  3OR2 C;  3BWG A;  4I7H A;  5FFZ A;  1MDM A;  4LK1 F;  1IGN A;  2M4G A;  3P5J A;  4EJT A;  5LHG A;  2IGM A;  3DV8 A;  1B1B A;  1M1E B;  1Q1H A;  2OAZ A;  2FBI A;  4XOR A;  1EKE A;  2HKX A;  4N4O B;  2R4G A;  4BJ5 C;  4EEF G;  4CO8 A;  2L9V A;  2LR8 A;  1I6X A;  5J6X A;  2HVQ A;  5HDK A;  3F3X A;  3HKZ N;  4JX4 A;  1JHH A;  3A1Y A;  3RIR A;  2DDA A;  4XK4 A;  5EDN A;  2KDZ A;  2VBW A;  2OA4 A;  3ML6 A;  4IJA A;  4HQE A;  4KIB A;  2WB1 A;  1YE9 A;  2DPD A;  4HW0 A;  4IXA A;  5GTH C;  1D5Y A;  4RB2 C;  3DBL B;  4RAG A;  3E6B A;  1IJW C;  3MKZ A;  1DUX C;  3BT9 A;  2ZSI B;  5GPC A;  3U2R A;  5EZG A;  3DBR B;  2R92 J;  2YU3 A;  1FIP A;  2Y9Y A;  1B9M A;  3ZGK A;  4OOI A;  2CJJ A;  3IH2 A;  1OMI A;  1MNM C;  2PJP A;  2B7E A;  1BM9 A;  4EGZ A;  2Z1D A;  4EQQ A;  4KNY A;  3A4C A;  4JX5 A;  5HLI A;  3AG2 H;  2I10 A;  4U7B A;  1OCP A;  3H3U A;  2GZW A;  2Y31 A;  3WGG A;  4BQQ A;  2HTS A;  2HQR A;  2FUG 2;  1F5T A;  4Y7N J;  1XC5 A;  2DOA A;  5L3D A;  3DBH B;  1ZGW A;  5BNG A;  2A6E F;  5JI6 A;  1W0U A;  3LSG A;  2D1V A;  2JPC A;  5IYB J;  1EH8 A;  3CJR B;  5L3F A;  3OYF A;  3FHZ A;  1XSD A;  3BR2 A;  2CV0 A;  1YFH A;  2ZNZ A;  5JHF A;  1FYM A;  2O5R A;  3NQO A;  1ZLK A;  1KON A;  2GXG A;  4BJT A;  1Z9C A;  3NWS A;  3JCU C;  1ZR2 A;  1LEB A;  4B48 A;  1T8I A;  1J75 A;  2XSJ C;  5H6Q A;  2QQ9 A;  3L2W A;  3REO A;  2RRE A;  4NDL A;  1OCO H;  2LRE A;  3LA3 A;  2Z33 A;  2OC6 A;  4ZYH A;  3SXY A;  1LEA A;  2VJI A;  1MMD A;  4D5F A;  3HPG A;  2M8G X;  3SZP A;  3FKI J;  4XN0 A;  3A02 A;  1ETW A;  5DCM B;  3FZV A;  3MMY B;  4HDU A;  3GWZ A;  5A2Q K;  3V7C A;  4G6Q A;  3JRE A;  3RZO J;  3V42 A;  4BQA A;  4BH9 A;  4E7L A;  1SD6 A;  3RDI A;  4L0Z B;  4QPO A;  3VYS B;  4EJW A;  2HYF A;  4JBA A;  4D7N A;  2NVU B;  1CF7 B;  2COM A;  2WAE A;  2XF7 A;  1LJ9 A;  1IN7 A;  3CES A;  2JRT A;  3EPZ A;  3QPS A;  1G2H A;  2AO9 A;  4WCG A;  3L00 A;  4IHY A;  3QOP A;  5C4X J;  1RPW A;  1GHC A;  2W1O A;  3NAU A;  4PJM A;  2HZT A;  3WE3 A;  4QTR A;  5J1U A;  2L02 A;  2CQX A;  3CC2 I;  2FJ1 A;  1HKQ A;  4OIR F;  4JK1 X;  3I0T A;  1QPI A;  3CMY A;  3FIS A;  4S0H B;  2L01 A;  4NC7 A;  5GP9 A;  1BIB A;  1OCR H;  2JMW A;  5J1R A;  2DA2 A;  4XRM A;  3SJM A;  4F52 A;  4E7S A;  3I3L A;  3TDU C;  3CUQ A;  4P9F A;  1V55 H;  4AIH A;  2PMZ A;  2BZT A;  3GVA A;  2JA5 J;  2CUF A;  1H8A C;  2CUZ A;  2KIF A;  1QRY A;  2GLO A;  2BY1 A;  3IRQ A;  4GO1 A;  5JLW A;  1ZRD A;  1LDD A;  1SFU A;  1DPU A;  2OJE D;  3P9K A;  3IH4 A;  4BXF A;  3MZH A;  2B63 J;  2MH2 A;  3GTG J;  5DM6 F;  3CCV I;  1BR1 A;  5LHI A;  2XRO A;  1EJ9 A;  2P5L C;  2VPR A;  3CJT B;  3F8C A;  3A03 A;  4LB6 B;  5D5W B;  3WTS C;  4BEH A;  1YIJ I;  4FET A;  3VB2 A;  2XAG A;  3FXK A;  4U0W A;  2X6X A;  2DDB A;  2ELK A;  2MD0 A;  5FKL A;  1MMA A;  3IV5 A;  3OWT A;  2NVQ J;  5EYR A;  3PUF A;  2LMD A;  2JSP A;  2PBI A;  3BG6 A;  4G7O F;  1LVA A;  4CXF A;  4RAY A;  1H9G A;  4PJ0 C;  2HDD A;  1X19 A;  2LTP A;  1DU0 A;  3ECH A;  2WAD A;  2ME0 A;  1P4W A;  1HLV A;  2MLG A;  4L5J A;  3RKW A;  2R7R A;  1XS9 A;  1KU2 A;  2EZI A;  1HDP A;  4KMU X;  1W36 C;  1AHD P;  2HVS A;  3E7L A;  3L2V A;  1XGO A;  2K27 A;  3GFI A;  2QQB A;  1R22 A;  1CGP A;  3FIW A;  5D5V B;  1RR7 A;  1ZRC A;  2A6H F;  2XPU A;  2CW7 A;  3Q3S A;  1KQ8 A;  2KZV A;  4WXH A;  3HBL A;  3BR0 A;  4MLO A;  4ZTF A;  2OPT A;  3JR9 A;  4AVP A;  2R5Z A;  2AHQ A;  2K9L A;  4E7H A;  1Y39 A;  1MSE C;  2PJR A;  1FOK A;  1DU6 A;  5ILS A;  2XF6 A;  3BZ6 A;  5EF6 A;  1IRF A;  1R6R A;  5DTD A;  3DKX A;  5HS7 A;  3PUB A;  4RB1 A;  3M8E A;  4QIW N;  1DGR M;  4A3K J;  1SFO J;  3PSF A;  3I55 I;  5F0F A;  2W4S A;  2HOA A;  2AXT C;  5E3L A;  3V4G A;  4HYE A;  1EA3 A;  3KET A;  1W5C C;  1ZKG A;  1PJR A;  3GZ6 A;  3ONQ A;  4LLG F;  4AC0 A;  5L3B A;  4LLL A;  3JRC A;  2R93 J;  1Z6R A;  5DUI A;  4RLQ A;  2JA6 J;  3HOY J;  3RYP A;  2X51 A;  2R3S A;  4NB5 A;  2R7Q A;  3CLO A;  1YLF A;  3C1D A;  3QYF A;  2P7V B;  2XAU A;  4II3 A;  2E1M B;  2FU4 A;  1FOX A;  5IOY A;  2FOK A;  2CQ7 A;  2XDV A;  4C2T A;  3ECO A;  3VOE A;  1RR8 C;  1AKH B;  2JA8 J;  1ZGA A;  3U21 A;  2DOF A;  1D1C A;  2JSC A;  4NQW B;  2MBF A;  2HU9 A;  2KHM A;  5HOO A;  4JP0 A;  1ZHF A;  2MC4 A;  3KLN A;  1X3U A;  2VI6 A;  5CVV A;  1LE8 A;  2HI3 A;  2ZFW A;  1T95 A;  1W7P B;  3FXL A;  1YO5 C;  2FD5 A;  2JQ7 A;  3L2C A;  2CSO A;  2M4K A;  5FLX K;  2EA2 A;  4P9U A;  3OYD A;  5HS8 A;  3WU0 A;  4IO9 F;  3FXQ A;  3F23 A;  1B4A A;  2XKO A;  2JVH A;  4MTE A;  4M6V A;  4DBR A;  1EH7 A;  4A3I J;  3K4K A;  4PSX A;  1HDD C;  2ZME B;  4CDG A;  4Q5S F;  1YS6 A;  2VON A;  4B43 A;  2DQR A;  3J80 K;  3HOS A;  1T56 A;  1A5J A;  1OJL A;  3OYL A;  2PX9 A;  1LFU P;  3E97 A;  1VQ5 I;  3LSP A;  3MFK A;  2E5Z A;  2BY0 A;  4HNU A;  1BI2 A;  2DFE A;  1UFM A;  3AG1 H;  2HNH A;  3FXR A;  2P4W A;  2R7W A;  4OAY A;  3DEE A;  1PP7 U;  5JVG F;  4L0Y B;  2OTJ I;  2HQA A;  3BTJ A;  2VPL A;  1WVR A;  4U88 A;  3KPH A;  2RAE A;  2WV0 A;  3QOE A;  1WJB A;  3HRU A;  1W36 D;  2EFO A;  2WY8 Q;  1HBX G;  3X2Q H;  2W48 A;  3ZR8 X;  1S7O A;  3DKY A;  4MFD A;  4F91 B;  3HOW J;  4ON0 A;  1W7P D;  3W2W A;  1YRN B;  3SFZ A;  3W3C A;  3LOC A;  2VKE A;  1WPK A;  2K3F A;  3BCB A;  2BY2 A;  2CUJ A;  2XAS A;  4DQ2 A;  1ZRF A;  1S72 I;  1N25 A;  1FJL A;  2OV7 A;  3VOD A;  2O8K A;  1R4M B;  3MAJ A;  4YII A;  1SVM A;  2HQ5 A;  3FXM A;  1VFC A;  1UG0 A;  1MW7 A;  1U9N A;  4TV7 A;  2IBD A;  2VE9 A;  3F9K A;  3N97 A;  2DFF A;  3CLQ A;  1ACI A;  4I0B A;  3W2V A;  4LG0 B;  4RB3 C;  1K78 B;  2EIM H;  3ULQ B;  2O3F A;  3PNT A;  4DW6 A;  3VYU B;  1U9O A;  9ANT A;  4YRV A;  2V26 A;  3HOZ J;  3DEU A;  3ZQ7 A;  2DCE A;  4XN3 A;  1K61 A;  4G7H F;  2CRG A;  4ZH4 F;  1FT9 A;  3DTE A;  2QKL B;  1P7I A;  4FCY A;  1D3Y A;  5F64 A;  2V1D A;  1DQU A;  3GF2 A;  2V4J C;  2VJ5 A;  1RKW A;  4KN4 X;  4MNU A;  3GUD A;  2XIG A;  3TED A;  2GXB A;  3S8P A;  3RPU A;  2G0E A;  3P7N A;  3OS1 A;  1LKX A;  4L5E A;  4D7M A;  1I1G A;  5KAF C;  1GXP A;  2BW3 A;  4EGY A;  2GM4 A;  2JT1 A;  2J5O A;  1LB2 A;  2G9W A;  4HOB A;  2ADU A;  4LMY A;  1ERD A;  3BJA A;  1QHH D;  3RCO A;  2LY1 A;  4I01 A;  1V3F A;  3EYY A;  5B3S H;  2E2J J;  4G6D A;  2V1X A;  3H0G J;  2CW0 F;  4BQN A;  1R71 A;  1WGX A;  2V9P A;  2KRF A;  3OS0 A;  3TMO A;  3MKY B;  2QZ8 A;  3GEZ A;  3K1M A;  1T38 A;  2IS4 A;  3KP2 A;  4M9S A;  5LD2 C;  3FBI B;  2L3D A;  1ZG5 A;  2A05 A;  2GQQ A;  4N9I A;  3FWE A;  2L4M A;  4L9V A;  3GTO J;  3SEZ A;  1FOW A;  2JTV A;  4A3J J;  3TOB A;  3IP4 B;  1WKM A;  1X1A A;  2VOO A;  2DK5 A;  4BDY A;  2CO5 A;  2Q2E A;  2JA2 A;  2MSY A;  3T5X A;  5TJJ A;  5ILV A;  2BHY A;  5CJ9 A;  4B09 A;  4ENM A;  2JPB A;  4PCQ A;  1IDY A;  4UXN A;  3FM3 A;  5AON A;  5B1A H;  4HDV A;  1P2F A;  1R5I D;  1MGT A;  2DPU A;  4A3B J;  3FK6 A;  2X9D A;  3V7S A;  1A6I A;  3F22 A;  2L7K A;  2Z2S B;  4A69 C;  3CCQ I;  5EZH A;  4PSW A;  1F43 A;  3ZQH A;  1FYK A;  1HKS A;  3SHF A;  4EV0 A;  4OAZ A;  5KAI C;  4YIR X;  4HV5 A;  4M3B A;  2EPF A;  2VIX A;  3OYA A;  2F5F A;  2L7F P;  3CMM A;  3WG9 A;  1AWC A;  3S1Q J;  4DJA A;  1VQL I;  2VAS A;  2L0K A;  3C2H A;  3TBI A;  2OUM A;  1MBE A;  2J5P A;  1SAN A;  2ZXW H;  3K10 A;  4HF0 A;  3HTU A;  2LOO A;  3PNY A;  2DJI A;  3DTI A;  4EJU A;  2MH9 A;  3TQN A;  4BBR J;  3ESW B;  1TWF J;  2DYR H;  3U9G A;  2CS3 A;  4ANJ A;  5K7H A;  2DJN A;  3ZQL A;  1PUF B;  2P8T A;  2VC0 A;  2W24 A;  2FE3 A;  1E3O C;  4WWC A;  3BG3 A;  5H6R A;  5FD6 A;  4IL6 C;  2GIZ A;  4XMY A;  3DPU A;  1LPQ A;  1XX5 A;  5LGT A;  3GCM A;  2MGQ A;  3JRD A;  2B9S A;  1BC7 C;  2GAU A;  3S93 A;  4C2M J;  2G7U A;  2DLL A;  3H5N A;  3S1M J;  4OMZ A;  4UB8 C;  1G3S A;  4U0V A;  2BGC A;  4QLC U;  2GXA A;  1XN7 A;  3PL8 A;  1I3A A;  2VQG A;  3AG4 H;  1XPX A;  3HXL A;  1IRZ A;  1FNN A;  2DQL A;  2DTZ A;  1IN6 A;  4L9T A;  1Y1V J;  2XC7 A;  3Q5F A;  3ZOB A;  5FKK A;  3FXO A;  1MH4 A;  2LVS A;  2Y0M A;  5KCM A;  2CG4 A;  2A6T A;  2W7N A;  4EMS A;  4OU0 A;  5E18 F;  3E5Q A;  5E20 A;  1ZG3 A;  1FMV A;  1X1P A;  4A3C J;  3GFL A;  1ULY A;  3KX2 A;  2H09 A;  4W1U A;  1FLI A;  1VQM I;  2O61 A;  4UV8 A;  1ZAR A;  3WU2 C;  2JVG A;  1RET A;  4KJZ A;  1TT5 B;  1B72 B;  4IHT A;  1LNW A;  2VOD A;  3C7J A;  3VYR B;  2DA5 A;  2VQC A;  4XKB A;  4GXO A;  2H1L A;  3A0B C;  4RDU A;  2EV5 A;  2ZCW A;  2DMU A;  2ME6 A;  4B3A A;  2K9S A;  4BYY A;  1DP3 A;  2IPQ X;  1JUM A;  2AQF A;  2ZSH B;  4ESB A;  5F6F A;  4BL0 B;  4Z2Y A;  3QAH A;  3HRM A;  4EJV A;  3OIO A;  4XKC A;  3RQ4 A;  5E1Z B;  3CMA I;  5FFX A;  3BPV A;  2NS0 A;  4GGG A;  3JAM K;  3VSL A;  1R1T A;  3VFZ A;  2FOW A;  2FQ3 A;  3D5S C;  1G59 A;  1U5T C;  3BPX A;  2DT7 B;  3SZG A;  3RQI A;  4KMF A;  2OCC H;  2JA7 J;  3M7G A;  1WJ5 A;  2QSG X;  2RNG A;  1FY7 A;  3DLA A;  2P6T A;  3O8H A;  1LUJ B;  2P5K A;  3TOA A;  4CCN A;  3UR3 C;  4QSH A;  2LKP A;  2M7A A;  3LAP A;  2A07 F;  1WJC A;  2M87 A;  3QRF F;  1TWC J;  3B73 A;  1HC8 A;  1HXD A;  1SFK A;  3ABL H;  3LQQ A;  4PFO A;  3T8T A;  4CUG A;  1IXS B;  5M5W J;  3BG5 A;  4J19 A;  1IN4 A;  3JTG A;  1SC7 A;  1U78 A;  2QWW A;  3KE2 A;  4C2U A;  4RGR A;  4GRI A;  2QCO A;  2WV1 A;  4B1R A;  2M0C A;  5EGO A;  1WJA A;  4HF1 A;  2UV1 A;  1QGP A;  1UEL B;  2W84 A;  2Z16 A;  5JFR A;  1NK3 P;  2E60 A;  1VQ9 I;  5FLV A;  3D0S A;  3AL0 C;  2LBF A;  4IOA F;  4C30 A;  2E1N A;  1JJ6 C;  2DN0 A;  3IL2 A;  3DLL F;  3HUG A;  1XDS A;  3SYT A;  3U1D A;  2GWR A;  1WJF A;  3LA7 A;  5JVT A;  3DCF A;  2HPI A;  4U7D A;  2WA0 A;  3Q0W A;  4M71 A;  2JZY A;  1QZZ A;  1WQ2 A;  3DKW A;  1YIO A;  4A5N A;  3EET A;  4V2G A;  1QZE A;  1B8I B;  5K5R A;  2QKM B;  2R0Q C;  3CDI A;  5CLS A;  3QU3 A;  2K86 A;  3HGY A;  4XOT A;  4CCK A;  3LA2 A;  5AIQ A;  1S3J A;  3G1O A;  1OFC X;  4M6Y A;  2QBY B;  4Y52 J;  2QGU A;  2EFN A;  3K2Z A;  4UUS A;  4O3M A;  4E7J A;  1PYV A;  2VBX A;  1ORK A;  3L2Q A;  1ZRE A;  4GDF A;  3I5U A;  1XSV A;  2ZNY A;  4LIV A;  1OCZ H;  4FT8 A;  3I71 A;  4IHW A;  4FX0 A;  3TW7 A;  1GV5 A;  1BI3 A;  2EJR A;  3ISP A;  1K79 A;  3B6C A;  4G7Z F;  2BHZ A;  1WZ2 A;  2K85 A;  4K2E A;  2GOM A;  5IPA A;  3N4M A;  2R5Y A;  1ZAO A;  4RM3 A;  2NVT J;  1MBK A;  1W4M A;  2ZXH A;  5FRN A;  4ASN A;  1ETQ A;  3H36 A;  3RKQ A;  3MEX A;  4X1E A;  2TRT A;  1FP1 D;  4A93 J;  1WSU A;  2LKS A;  2QLZ A;  5HLT A;  2M7B A;  2A61 A;  1J59 A;  1I5Z A;  3M1E A;  1AA7 A;  1NTC A;  4A12 A;  2GA1 A;  3IWZ A;  5HDG A;  2LFB A;  2HDW A;  3ZN0 A;  1JUS A;  4WXD A;  3GTP J;  1HW5 A;  4HBL A;  5FRO A;  3D5L A;  5GAG J;  3L09 A;  5B1B H;  3CCR I;  3CME I;  2MC3 A;  5JR3 A;  5FLM J;  1IO2 A;  5IP9 J;  5CVI A;  4RBO A;  1R1V A;  1VQO I;  4UVA A;  5E3N A;  2H94 A;  1U3E M;  1WI3 A;  1KQ9 A;  3BLY A;  3WE2 A;  1JKQ C;  4IEJ A;  2HQN A;  2D5V A;  1VZ0 A;  1MZB A;  3I58 A;  4CIC A;  3BR1 A;  1K6Y A;  1KU9 A;  4J00 A;  2O7O A;  4I76 A;  1O3T A;  2XKP A;  4P5O A;  2DT5 A;  3CDL A;  3ABM H;  3O6B B;  2DMT A;  1VQP I;  3G6E I;  4B44 A;  3SDG A;  4F7Z A;  2BE5 F;  2KP6 A;  3HOT A;  4BJ6 C;  1BJZ A;  1XSX A;  4HPQ A;  4RGS A;  2QEX I;  1BOA A;  2EZH A;  2QA4 I;  4L9N A;  2ZJR F;  2KIS A;  3CC7 I;  4XIC A;  2ESN A;  3J7Y J;  2QUF A;  2E36 A;  1FTZ A;  3KEO A;  3HDD A;  3FMS A;  4AIK A;  2MG4 A;  3HL2 A;  1UCR A;  3G1L A;  1MD0 A;  4DYQ A;  1Y56 A;  5HNH A;  1UMQ A;  3CDH A;  2D45 A;  1ZK8 A;  1KA8 A;  1XB4 A;  3S14 J;  4X6A J;  2IGK A;  4S05 A;  2OZU A;  2M8E A;  2NVX J;  2WAF A;  2KLO A;  2VQH A;  4YG2 F;  3VPR A;  3S15 J;  4Y15 A;  1X2N A;  2QQ8 A;  3RKX A;  1AKH A;  1GVJ A;  2IS2 A;  1O7F A;  2IXS A;  3MCZ A;  4D0P A;  3CCE I;  2WAQ N;  3KLO A;  1KU7 A;  1VF9 A;  2VBY A;  4V19 K;  3BP8 A;  1QNT A;  2PN6 A;  3VYT B;  4LLN A;  3HG9 A;  2P7C B;  2M45 A;  5D4R A;  2VKD A;  4CH7 A;  4EVI A;  2OQR A;  3ZQG A;  3QWL A;  2O8X A;  2ETH A;  2D2W A;  5L3C A;  1E3H A;  2IRF G;  5HNF A;  4Q47 A;  2ACJ A;  2H6B A;  3M1C A;  3WG7 H;  1IUF A;  3BG9 A;  2QYO A;  3TDZ C;  3QYE A;  2LG4 A;  2ZME A;  5LEJ A;  3DF8 A;  4FX4 A;  4NBQ A;  5ICC A;  2BOL A;  1ITY A;  3C2B A;  4B47 A;  5GTI C;  1MDM B;  1FEX A;  1HST A;  2K5C A;  3MZ8 A;  2RDP A;  1Y6I A;  3ASO H;  4BE2 A;  1D0Y A;  2X0L A;  5E1X A;  1QA6 A;  2KIQ A;  2XGD A;  2GBY A;  2PI0 A;  1N77 A;  2HYJ A;  1SMT A;  2K9Q A;  5D8K B;  3BQZ A;  2NYX A;  2JRM A;  1ZEL A;  2DK8 A;  3WTV C;  3ZQF A;  4A3M J;  2Y2Z A;  2DA7 A;  4H4K C;  3DU5 A;  3OYI A;  4L18 B;  1S7E A;  1MJB A;  4CZZ A;  1FYL A;  5DCF A;  5HOD A;  2L9R A;  3C18 A;  3C2G A;  4YFK F;  2XGE A;  2CGP A;  4NNJ A;  2RQQ A;  4PJL A;  3ZQI A;  3I4M J;  1YW9 A;  1O4X A;  3CP2 A;  1TW3 A;  3HKZ A;  5FRM A;  4PGH A;  1REP C;  4OIO F;  4HNT A;  4ZYG A;  2G7H A;  5F0H A;  5J1Y A;  1EH6 A;  1KGS A;  4ZC3 A;  2AQE A;  4DYC A;  5F0C A;  1ETY A;  4R1H A;  4DZP A;  1STZ A;  3HSR A;  1Z1D A;  5BPI A;  1RZ4 A;  1Y0U A;  1KZH A;  4FE7 A;  3GFJ A;  3GFM A;  4G9Y A;  3HJE A;  1MJ9 A;  2NRA C;  3OYN A;  2IA0 A;  1Z3Y A;  5D5U B;  5F1R A;  2M0M A;  2L5Q A;  3M07 A;  2EH3 A;  5HLG A;  1SAU A;  5FKM A;  2VXD A;  1UHW A;  2CH0 A;  3Q9S A;  5DS9 A;  4XOP A;  3BOQ A;  3JRA A;  4RAZ A;  3COA C;  5GAH J;  1AU7 A;  1TP4 A;  1XMK A;  3HYI A;  4RM2 A;  2F5C A;  4GYI A;  4BS9 A;  3I59 A;  4UUT A;  3JRH A;  3CUQ C;  2HYG D;  4CYD A;  2VL8 A;  4HAM A; 
#chains in the Genus database with same CATH homology
 3BTI A;  2G0E A;  1ETX A;  4L5E A;  3GTJ J;  4D7M A;  3S2D J;  2YS9 A;  4BKX A;  3S1R J;  2DMN A;  2GM4 A;  3W6V A;  1TWA J;  2ID3 A;  2HXI A;  2JWT A;  1TWG J;  1JKO C;  5C4J J;  2E2H J;  3S1N J;  2E2J J;  4FE4 A;  3H0G J;  4M3E A;  1WGX A;  1JKR C;  3BTC A;  4MIM A;  2OF7 A;  3SFI A;  2H8R A;  4BBS J;  1BA5 A;  3HOX J;  3F0C A;  3M3Y J;  1I50 J;  3MN2 A;  2JK3 A;  3GTO J;  3JRB A;  4A3J J;  3OOU A;  5IOZ A;  1MBH A;  1IC8 A;  2YU9 J;  2MSY A;  3HGG A;  1ENH A;  1GT0 C;  5EGO B;  1U8B A;  3HM5 A;  1ZQ3 P;  1JTX A;  4AYB N;  2ECC A;  3Q0U A;  1VND A;  2CUE A;  1BL0 A;  1IDY A;  3GBG A;  2HOS A;  3LNQ A;  1JT6 A;  4CYC A;  1RES A;  4A3B J;  3TW6 A;  3FK6 A;  2X9D A;  3D1N I;  1A6I A;  3I4N J;  2M9H A;  3JRI A;  4A69 C;  5EZH A;  1ETK A;  1F43 A;  3ZQH A;  3S16 J;  4M3B A;  2LD5 A;  3O8G A;  2L7F P;  2ECB A;  3S1Q J;  2EZK A;  4AUX A;  1GUU A;  2L0K A;  4UUS B;  5E3M A;  1MBE A;  2DA4 A;  5J3L A;  4FTH A;  1CQT A;  1SAN A;  2LK2 A;  2FX0 A;  2LKX A;  2FQ4 A;  2X6O A;  1IGN A;  4BXX J;  2K40 A;  3A01 A;  3FK7 A;  4BBR J;  1TWF J;  2EBI A;  5K7H A;  5FKN A;  2DJN A;  3ZQL A;  1PUF B;  3MKL A;  4MO7 A;  2R5Y B;  2LLK A;  4EEF G;  1TWH J;  2LR8 A;  1MH3 A;  3Q0V A;  1E3O C;  3HKZ N;  2ZB9 A;  3BG3 A;  3OSG A;  4JX4 A;  1VI0 A;  4XK4 A;  1YRN A;  5EDN A;  5M5Y J;  2JN6 A;  2KDZ A;  5K7F A;  1X2M A;  2MGQ A;  3JRD A;  4C2M J;  2H1K A;  1D5Y A;  2Y9Z A;  3S1M J;  1IJW C;  1IRZ A;  2DTZ A;  1Y1V J;  3BT9 A;  1Q1V A;  5GPC A;  1JTY A;  5EZG A;  3ZOB A;  2R92 J;  5FKK A;  1H89 C;  1FIP A;  2Y9Y A;  1MH4 A;  2LVS A;  1WCM J;  2CJJ A;  3IH2 A;  1MNM C;  1JKP C;  4JX6 A;  1UG2 A;  1WH7 A;  5F1J A;  2R5Z B;  4JX5 A;  1P7J A;  4A3C J;  2DMP A;  1NK2 P;  4W1U A;  2I10 A;  4FIS A;  1OCP A;  2Y31 A;  2MW8 A;  2DA3 A;  5IYD J;  1RET A;  4BY7 J;  3HEF A;  1JJ8 C;  1WH5 A;  4Y7N J;  1ZR4 A;  1B72 B;  1XC5 A;  1ZGW A;  1JT0 A;  5BNG A;  1W0U A;  3LSG A;  2DA5 A;  4G12 A;  5IYB J;  1FTT A;  4RDU A;  2M34 A;  3BR2 A;  3LSR A;  2DMU A;  2XRL A;  4DYR A;  4MFE A;  2ME6 A;  4B3A A;  1APL C;  2LY9 A;  4IHV A;  2K9S A;  3PO2 J;  1JUM A;  5M3F J;  1ZR2 A;  4HNV A;  2XB0 X;  3TP3 A;  4JYK A;  1XG1 A;  2X48 A;  3OIO A;  4NDL A;  2CU7 A;  2EZL A;  5C3E J;  4D5F A;  2R7Z J;  2M8G X;  3FKI J;  5FKO A;  3A02 A;  1ETW A;  5F04 A;  3RQI A;  1BW6 A;  2JA7 J;  1FIA A;  2E1O A;  3O8H A;  3NAR A;  2N8G A;  3JRE A;  3RZO J;  4QSH A;  1LE8 B;  4D7N A;  1TWC J;  1UHS A;  3OSF A;  4XRS G;  5M5W J;  2LP0 A;  3BG5 A;  3QPS A;  2Y0S N;  4J19 A;  1G2H A;  2XGC A;  1U78 A;  1R9T J;  2AO9 A;  4IHY A;  5FJ8 J;  2QCO A;  2WV1 A;  4B1R A;  2M0C A;  3K2A A;  5EGO A;  5C4X J;  1RPW A;  2XPV A;  1NK3 P;  1MBF A;  1LFB A;  3NAU A;  5FLV A;  4B4C A;  3PM1 A;  2E19 A;  4QTR A;  5J1U A;  2CQX A;  2FJ1 A;  4ABZ A;  1JJ6 C;  2DN0 A;  1QPI A;  3CMY A;  3FIS A;  4GFB A;  1ZTR A;  4S0H B;  3DCF A;  5GP9 A;  3Q0W A;  2JMW A;  5J1R A;  2DA2 A;  4XRM A;  3SJM A;  4V2G A;  4W97 A;  4IHX A;  4D5C A;  1B8I B;  3GTK J;  2R0Q C;  3HGY A;  2JA5 J;  2CUF A;  1H88 C;  1H8A C;  1Z0X A;  1OFC X;  1QRY A;  1F36 A;  3G1O A;  2GLO A;  4Y52 J;  5JLX A;  5IP7 J;  1GV2 A;  5JLW A;  5EEA A;  2CQQ A;  4UUS A;  3IH4 A;  3GTG J;  4M3D A;  1JUP A;  2B63 J;  1ORK A;  2VPR A;  3A03 A;  3L1P A;  2YUS A;  5IYC J;  4A3D J;  4IHW A;  3TW7 A;  1GV5 A;  2ELK A;  5FKL A;  3IV5 A;  3B6C A;  3BR6 A;  2NVQ J;  5EYR A;  1PUF A;  5IPA A;  2R5Y A;  5E3O A;  1GDT A;  1MBK A;  2NVT J;  5M3M J;  2HDD A;  2LTP A;  1DU0 A;  1ETQ A;  3RKQ A;  2ME0 A;  1HLV A;  4X1E A;  2TRT A;  4A93 J;  2K9N A;  2VKV A;  1K83 J;  1XS9 A;  2EZI A;  1HDP A;  4A3G J;  1AHD P;  3E7L A;  1NTC A;  3FIW A;  2LFB A;  1RR7 A;  2XPU A;  1JUS A;  3GTP J;  1QVU A;  3Q3S A;  3B6A A;  2VUM J;  3HBL A;  3BR0 A;  5FLM J;  4MLO A;  1ETO A;  2OPT A;  5IP9 J;  3JR9 A;  4RBO A;  2R5Z A;  2AHQ A;  1MSE C;  5E3N A;  5K7Z A;  2TCT A;  1WI3 A;  2NS8 A;  1BW5 A;  1DU6 A;  5EF6 A;  1JKQ C;  4IEJ A;  2D5V A;  5DTD A;  4C3J J;  4M3G A;  2JJ7 A;  4A3F J;  3H3V K;  3BR1 A;  2O7O A;  1POG A;  4I76 A;  4QIW N;  1B72 A;  4A3K J;  1SFO J;  5F08 A;  5F27 A;  3CDL A;  5M5X J;  4I6Z A;  5F0F A;  2IAI A;  2HOA A;  2DMT A;  5E3L A;  3WHC A;  4V2F A;  3SDG A;  3S17 J;  1ZKG A;  1BJZ A;  1IG7 A;  2EZH A;  4AC0 A;  3QPL A;  3JRC A;  2R93 J;  4XIC A;  4A3E J;  5EG0 B;  1MBJ A;  1HOM A;  3HOY J;  2JA6 J;  4C3I J;  3TP0 A;  1X58 A;  3RZD J;  3K7A J;  3JRG A;  1FTZ A;  1W0T A;  3HDD A;  2MG4 A;  3QQA A;  5IOY A;  3G1L A;  4DYQ A;  1AKH B;  2JA8 J;  1UMQ A;  1ZK8 A;  4M3F A;  3S14 J;  2NS7 A;  5EG0 A;  1TC3 C;  4X6A J;  1Y1W J;  3S2H J;  4XID A;  2NVX J;  4JP0 A;  3VPR A;  3S15 J;  4BY1 J;  2XPW A;  1X2N A;  2VI6 A;  1AKH A;  1LE8 A;  1GVD A;  1ETV A;  2HI3 A;  2FD5 A;  2WAQ N;  2DA6 A;  1VF9 A;  4XRS A;  1T33 A;  2KT0 A;  4CYC B;  3HOU J;  1MSF C;  2EQR A;  1I3Q J;  1OCT C;  4M6V A;  3JRF A;  3UKG A;  4A3I J;  3BR5 A;  3HB9 A;  1HDD C;  2E2I J;  1IDZ A;  3ZQG A;  3IH3 A;  3PO3 J;  2L7Z A;  2Y30 A;  3BTL A;  1T56 A;  1A5J A;  1OJL A;  2PMZ N;  3G1M A;  1LFU P;  1IUF A;  3BG9 A;  3LSP A;  2L7M P;  1RKT A;  1ITY A;  3C2B A;  1I6H J;  2IEK A;  3HOV J;  3M4O J;  1FEX A;  4LOC A;  1B8I A;  3A01 B;  3BTJ A;  5GPA A;  2HXO A;  2RAE A;  2O9L A;  2XGD A;  2GBY A;  2HYJ A;  3LSJ A;  2K9Q A;  2WB1 N;  1IV6 A;  3BQZ A;  2W48 A;  3ZQF A;  4MFD A;  3HOW J;  4A3M J;  2Y2Z A;  2DA7 A;  1YRN B;  4C3H J;  1S7E A;  3GTM J;  3LOC A;  2VKE A;  1WPK A;  5HOD A;  2L9R A;  3WHB A;  2COB A;  2XGE A;  2M2E A;  3MVP A;  2NVY J;  1FJL A;  5IP6 A;  5C44 J;  3ZQI A;  2O8K A;  3I4M J;  1O4X A;  2HQ5 A;  2XB5 A;  1VFC A;  1U9N A;  2IBD A;  1QVT A;  2DMQ A;  5F0H A;  5J1Y A;  3ZQC A;  4DZJ A;  4A3L J;  4DYC A;  2P81 A;  5F0C A;  1ETY A;  4DZP A;  1MBG A;  1HCR A;  3BR3 A;  1JGG A;  2ID6 A;  4FE7 A;  2XSD C;  1Z77 A;  4DW6 A;  2DA1 A;  1U9O A;  9ANT A;  2NOG A;  2QF7 A;  3HOZ J;  1EF4 A;  2HOT A;  3DEW A;  1K61 A;  1HF0 A;  2EH3 A;  2CRG A;  5FKM A;  3GTQ J;  5DS9 A;  3BQY A;  3CCY A;  1P7I A;  3JRA A;  4FCY A;  1AU7 A;  3JRH A;  4UUT A;  1RKW A;  3TED A;  3GTL J;  3CQZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...