3W6VA

Crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
b'SDPLAEVVAWALEHLHEQFDVETLAARAYMSRRTFDRRFRSLTGSAPLQWLITQRVLQAQRLLETSDYSVDEVAGRCGFRSPVALRGHFRRQLGSSPAAYRAAYRARRPQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AdpA
publication title Complex Structure of the DNA-binding Domain of AdpA, the Global Transcription Factor in Streptomyces griseus, and a Target Duplex DNA Reveals the Structural Basis of Its Tolerant DNA Sequence Specificity
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Transcription activator/dna
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3w6vA00
3WHCA 9ANTA 1FIAA 1HDPA 4X6AJ 2QF7A 1B72B 3FIWA 1MBJA 3BG3A 2EZKA 3JRDA 1RPWA 3BR3A 1K61A 1OCTC 1TWHJ 5FKLA 1ZKGA 1U9NA 4GFBA 3FK7A 2R7ZJ 1VF9A 1T33A 4HNVA 4M3DA 1POGA 1O4XA 1XC5A 3ZQCA 2DA5A 2E1OA 4A3JJ 5IP7J 2JN6A 3BG5A 2E2JJ 4Y52J 3HOVJ 1Q1VA 4C3JJ 5FLVA 1ZR4A 2O8KA 1UMQA 1ETVA 5FLMJ 3GTQJ 4X1EA 3Q0UA 5EGOB 1ZR2A 5FKNA 2MSYA 3BR1A 1FJLA 5F0CA 4B3AA 4B1RA 3HDDA 4MLOA 1LE8B 2PMZN 4S0HB 2NVXJ 3K2AA 2R5YB 2CUFA 1QRYA 2LR8A 2DA4A 4JX4A 1OJLA 1I3QJ 3HOZJ 3MKLA 3JREA 2H1KA 1JT6A 1SANA 4BY1J 5F04A 4A3IJ 2JA8J 3HOUJ 2IBDA 1BA5A 3ZQIA 1JGGA 2M2EA 3CCYA 1ENHA 2HOAA 3HKZN 3TW6A 2R93J 4QIWN 2ME0A 5FKOA 2E2IJ 4A3LJ 5E3MA 2Y9YA 3BR0A 3NAUA 1H89C 1B8IB 4EEFG 2HDDA 2L0KA 1JUPA 3O8GA 1SFOJ 3BTJA 2R5ZB 5C4JJ 2GLOA 4C2MJ 1X58A 3HGGA 1T56A 3CMYA 1MBHA 2XB5A 2XGEA 1U78A 2MG4A 3GTPJ 2NVTJ 4UUSA 2R0QC 3ZQHA 1PUFB 2O7OA 4XRSA 2NS7A 4MFDA 1LFUP 3QPLA 1AKHB 1H8AC 2OF7A 4BKXA 2ELKA 3S1MJ 3OOUA 2LD5A 1HLVA 2RAEA 2GBYA 5EYRA 1D5YA 1CQTA 4BBRJ 2HXIA 2XSDC 3OSGA 2CQQA 1RETA 4D7MA 3S17J 4AUXA 5EF6A 4A3CJ 4FTHA 5IOYA 1F36A 2EZHA 4XICA 5F0FA 3LOCA 1VFCA 1IDZA 5E3LA 1OFCX 1I6HJ 1ZK8A 4JX6A 4FISA 1WH5A 3OIOA 3ZQLA 5IYDJ 1UHSA 5F1JA 4D5FA 4RBOA 1FTZA 3S2HJ 2ID6A 2K9QA 1RR7A 2M8GX 1BJZA 1EF4A 2WAQN 2E2HJ 4A3MJ 3A03A 4Y7NJ 2JJ7A 3S1NJ 1ETKA 2CRGA 4DYCA 2IEKA 5C44J 3LSPA 1JJ8C 1ETYA 1A6IA 2D5VA 4A3GJ 3HB9A 2DJNA 3BTLA 3VPRA 3PO2J 5IYCJ 1QPIA 2P81A 2K40A 5JLWA 5F0HA 2R92J 4CYCA 1BW5A 3ZQFA 2NVQJ 2XGCA 3JRBA 3M4OJ 1Z0XA 1GT0C 1IC8A 1P7JA 1ZQ3P 1BW6A 1MH3A 2X48A 3GTOJ 1JKPC 1RKWA 2OPTA 3HOYJ 1H88C 2HXOA 1IUFA 2L7MP 4ABZA 2Y2ZA 3TW7A 1WI3A 2YUSA 2L7ZA 3JRIA 1RKTA 5K7ZA 4IHVA 4IHWA 3RKQA 3UKGA 5FJ8J 3JRFA 2VUMJ 1A5JA 3JRCA 3CQZJ 3B6AA 1YRNB 1FTTA 1MBKA 3BQYA 4A3KJ 3S1QJ 1IV6A 2LY9A 2DA7A 3I4MJ 2FX0A 3RQIA 1DU6A 1TWAJ 2K9NA 3L1PA 2JA5J 4M3FA 3LSRA 2AHQA 4W97A 1B72A 3HOWJ 4L5EA 1ZTRA 2VPRA 2IAIA 2WB1N 3TEDA 5JLXA 1IG7A 3PO3J 1IGNA 2O9LA 2KT0A 1JTYA 1IRZA 1GV2A 2LLKA 2VKVA 5M3MJ 1HF0A 2EBIA 1MBEA 3ZOBA 3SFIA 3BG9A 3GBGA 4C3IJ 1JKQC 2EZIA 3K7AJ 5DTDA 1TWCJ 2CU7A 1LFBA 2Y31A 4XRMA 2FQ4A 4IHYA 3A01B 3BQZA 1WGXA 1LE8A 4MFEA 5EG0B 1U9OA 2DMPA 4A69C 1R9TJ 2CQXA 2K9SA 4XIDA 2R5YA 1ITYA 2KDZA 2JA7J 5E3OA 3HM5A 1HOMA 1QVTA 4BY7J 3G1OA 3BTIA 2TCTA 4AYBN 2ECCA 2NOGA 4W1UA 2JMWA 2ECBA 1MH4A 2W48A 2XPVA 3QQAA 3BR6A 5J1YA 5J1UA 3JR9A 2NVYJ 5M3FJ 1WH7A 5F08A 5M5WJ 1DU0A 3G1LA 2LP0A 3JRHA 2DA1A 3Q0VA 4G12A 2TRTA 1ETQA 1XG1A 3HEFA 4A3FJ 5EEAA 1GVDA 3GTJJ 3RZDJ 5IP6A 1GUUA 2YS9A 3H3VK 4IEJA 1Y1VJ 2Y0SN 2R5ZA 1APLC 1TWFJ 4V2FA 4A3DJ 4XK4A 2MW8A 2DMTA 3RZOJ 4QTRA 5GPCA 4LOCA 1VI0A 1PUFA 1I50J 3W6VA 1AKHA 2DMNA 1X2MA 4XRSG 2DA2A 3HBLA 3MVPA 2HOSA 5BNGA 5GPAA 1U8BA 3FK6A 2HOTA 3PM1A 1MSFC 3M3YJ 3FKIJ 5HODA 4NDLA 2QCOA 1P7IA 1MBFA 2L9RA 4DZJA 5IPAA 1ORKA 2XPUA 2DTZA 3IV5A 4DZPA 5FKKA 3JRGA 2Y30A 3A02A 2LK2A 3DEWA 4J19A 3SJMA 1WPKA 1NK3P 1TC3C 2HI3A 4I6ZA 1GV5A 5GP9A 1HCRA 2CJJA 5E3NA 4BBSJ 2B63J 1IJWC 2DA6A 3GTGJ 5EZHA 1QVUA 1UG2A 2FD5A 2I10A 3GTLJ 3S16J 3S2DJ 3FISA 4IHXA 2DMQA 5C4XJ 2AO9A 2ZB9A 5IP9J 4JYKA 4DYRA 3IH4A 1WCMJ 1JTXA 4C3HJ 4FE4A 1JKRC 1JKOC 2XRLA 1G2HA 4DYQA 3LSJA 5M5YJ 5EDNA 4UUSB 3JRAA 2WV1A 2MGQA 2JWTA 1AHDP 4MO7A 2EH3A 2X9DA 1OCPA 2LFBA 3H0GJ 1ETXA 4M6VA 5FKMA 2EQRA 3F0CA 2LTPA 1JJ6C 1NTCA 3SDGA 1MNMC 3B6CA 1F43A 2Y9ZA 2FJ1A 3DCFA 3MN2A 5IOZA 4D7NA 1BL0A 4UUTA 4I76A 5EGOA 3WHBA 3CDLA 3E7LA 1W0TA 1E3OC 2N8GA 3BT9A 2COBA 4M3BA 5K7HA 4QSHA 2GM4A 2E19A 3BR5A 3LSGA 1XS9A 3D1NI 2NS8A 4AC0A 2DMUA 1MBGA 2LKXA 2HQ5A 3S1RJ 1ETWA 2DN0A 1JT0A 5IYBJ 1IDYA 2XPWA 3NARA 1YRNA 1HDDC 2M34A 5M5XJ 3LNQA 1S7EA 4BXXJ 1W0UA 4B4CA 1JUMA 1FEXA 4M3EA 2VI6A 2G0EA 1JUSA 3OSFA 4JX5A 2CUEA 3HGYA 1AU7A 3BTCA 5DS9A 4A93J 2ID3A 1ZGWA 3QPSA 5C3EJ 2H8RA 5EZGA 4CYCB 3G1MA 3BR2A 1B8IA 3GTKJ 3C2BA 3IH2A 4M3GA 5K7FA 4A3BJ 3HOXJ 2YU9J 2JK3A 3ZQGA 3S14J 3GTMJ 1RESA 3TP3A 4DW6A 4FCYA 1FIPA 2X6OA 4FE7A 3Q3SA 2DA3A 5J3LA 2L7FP 4V2GA 3Q0WA 2EZLA 3TP0A 3A01A 1VNDA 1GDTA 5EG0A 4D5CA 2M9HA 5F27A 2LVSA 2XB0X 3IH3A 5J1RA 1MSEC 1TWGJ 1NK2P 1Y1WJ 4JP0A 2VKEA 4MIMA 4RDUA 4A3EJ 1K83J 2HYJA 1X2NA 2ME6A 3I4NJ 3S15J 3O8HA 2XGDA 1Z77A 2JA6J 1ETOA 2M0CA
chains in the Genus database with same CATH superfamily
3WTTC 3I0TA 3FXUA 1BR4A 4ZZDA 2X1DA 2QQ9A 3GXOA 3K9TA 3CUQB 3L7WA 3OYLA 3CCUI 1MBJA 1IXSB 1YIOA 4HV6A 1FSHA 4CGZA 1K61A 1OCTC 1WWXA 1ZKGA 1SAUA 1U9NA 2ZKZA 1V54H 5D4SA 1L3LA 3WGHA 4AD9A 4M3DA 1POGA 1G3TA 1TNSA 3DBHB 3PL8A 1A35A 2E1OA 3EPZA 4A3JJ 2HOEA 3BG5A 4ZDOA 1T0FA 3HOVJ 1SVOA 1Y0UA 3RKXA 1Z05A 3ZQQA 4MGRA 2PJPA 4KICA 1FJLA 5JHUA 2W1OA 5F0CA 4FASD 4RGSA 5DD8A 4D0PA 5H20A 1KQ8A 4S05A 4BHBA 2DQRA 3LSIA 4QPOA 4BYYA 1FP2A 3I53A 5GAEJ 3EUKL 3ASOH 1AA7A 3OYNA 2FNPA 2LR8A 4GGGA 2DA4A 1EJ9A 4A0XA 1SD5A 3HOZJ 2LOOA 3MKLA 4A5NA 5DCMB 4ZH4F 4XONA 1MGTA 4PGHA 1TT5B 3BJ6A 1IRFA 1OCOH 1VQLI 1W5TA 4EJWA 2JA8J 4HNTA 2IBDA 1ONVA 3HOUJ 1JGGA 2UZKA 1WZ2A 1VQ9I 4Y13A 1D8JA 2BV6A 1XMAA 3OYDA 3L2WA 2Z1DA 5E20A 1ENHA 4PFPA 1GLNA 2X4HA 1TZLA 2M7BA 5CLSA 1G4DA 3ZN0A 4LG0A 2Y9YA 1IXRC 4PJ0C 3CUQC 3ESWB 4MNUA 1X1AA 1B8IB 3CJRB 4NB5A 4EEFG 5J6XA 1JUPA 3O8GA 2LBFA 4XR6A 2R5ZB 3O6BB 3Q9SA 1T56A 3CMYA 3CC7I 4CSWA 1MBHA 3OWTA 2CUJA 3TDZC 1U78A 5IT9K 4BGDA 2DQLA 3W2WA 4EGZA 3ZQHA 2NS0A 2O3FA 2O7OA 3IWZA 4HF1A 5HS8A 2NS7A 2VE8A 3QPLA 2IGOA 1QZYA 2R7OA 3F8MA 3S1MJ 1ZGJA 2KIUA 3QPTA 4GDFA 4ZYHA 4BEHB 2LD5A 2GAUA 4RAZA 1NH3A 4OOIA 1Z7UA 2XSDC 3OSGA 1RETA 5HLTA 4YIFA 2WWYA 4RAGA 1ZLJA 5IOYA 2EZHA 4XICA 5F0FA 1J9IA 5KCMA 3LOCA 4WXHA 2VOOA 5E3LA 1I6HJ 4B47A 2E35A 2W82A 3SEZA 3K4CA 2B0LA 2YR2A 2KIMA 4JX6A 3W6KB 3MZ8A 1WH5A 3HJEA 1O7FA 3OIOA 2KISA 2MD0A 2VC0A 1UHSA 4RBOA 4HX4A 3WGGA 3S2HJ 2JVGA 2X1EA 3GZ6A 2EINH 1RRJA 3ZGKA 2X6YA 2E2HJ 2OCEA 4R1HA 3QYBA 3CC4I 3ZP5A 1X1PA 3BWGA 4B48A 2IEKA 4OIOF 1FOKA 5HVQC 2D5VA 2XDVA 3VPRA 2RN7A 5JLWA 1MMGA 2R92J 3AG4H 2HVRA 1QPMA 1T6SA 1MIJA 3TO7A 1HW5A 1GT0C 3IC7A 1ZQ3P 5B3SH 2A3SA 2F4MB 1AOYA 3I55I 1OCCH 1RKWA 3M1CA 2F4IA 3U1KA 1S5LC 3KP6A 1TW2A 1W7PD 3H5NA 3TO6A 1H88C 1IUFA 5HNHA 1MNEA 3WGIA 4LK0F 1SD4A 1OMIA 2PEXA 1SVLA 1I3AA 4XL9A 1IRXA 4ASNA 4IHVA 5HDNA 3KLNA 3JRFA 4P55A 3C2HA 3WTYC 3ISPA 4LLLA 2Y0MA 3JRCA 3AG3H 1QBJA 3FKJA 4XBFA 1BIBA 1ZELA 2I8DA 3BQYA 3BROA 1R6RA 4PSWA 4U87A 2KQRA 2LY9A 3H9GA 4UB6C 5J4VA 2DA7A 3OYJA 2GXAA 2VOPA 1MJAA 4Q4ZF 2DJIA 1WRJA 1HBXG 1R71A 2Y48A 3LSRA 3HOWJ 2YU3A 2UXNA 1ZTRA 2VPRA 3EDPA 3JCUC 2L7KA 4WXCA 2NOJB 2HKOA 1IGNA 3KE2A 1JTYA 5CVVA 4ON0A 5M3MJ 2E7WA 3GX4X 1V55H 2B7EA 2OU2A 3F8FA 1ON2A 4BNCA 2QQAA 2XF7A 5J8CA 2ACJA 2GXBA 2KJBA 1KU2A 3CLQA 2R3SA 3ZMUA 5DTDA 1I27A 3R6SA 3TL4X 1IW7F 1LFBA 4MTDA 4XRMA 2FQ4A 2XV4S 2WAFA 3OYKA 2L54A 1OQYA 4A69C 3FF5A 1T2KA 2K9MA 1ACIA 5TJJA 4EJVA 2R5YA 3R4KA 4KUMA 1R22A 3G2BA 2RGVA 4NC8A 1LEAA 2DW4A 1QZZA 2A68F 4BY7J 3G1OA 4M9ZA 1I39A 2B9SA 2JMWA 3Q5FA 2WY8Q 4CDGA 3WTWC 4CUGA 1H9GA 3QQAA 3R60A 1XMKA 2HDCA 2ISYA 2VLAA 3ABUA 4IZZA 3F3XA 4UVAA 3TKYA 3VSLA 1WH7A 1R4MB 2DA1A 1QQIA 5CVUA 1XTAA 4P9FA 4IRIA 2Q8KA 1T8IA 1ETQA 1FOWA 3HEFA 2V1DA 2HU9A 3S93A 4A3FJ 1GVDA 3V42A 2QBYB 1XGMA 4XKWA 1Y1VJ 4IEJA 3TBIA 3CO6C 1APLC 1K79A 4KJZA 4A3DJ 4GO1A 4IHTA 2DMTA 3FXQA 2M3AA 1E0EA 2NXNB 1PUFA 2V9KA 4A0ZA 3FXLA 1I50J 1ZG1A 4NNJA 4O3MA 2E1MB 4Y4RA 2XROA 3RKWA 1DPUA 2GWRA 2DA2A 3HBLA 3OYHA 1XDUA 5GPAA 3WODF 4ETSA 3EQLF 3FK6A 3PNVA 4IKFA 4E7KA 1MSFC 3VB2A 2E7XA 3M3YJ 4Y33A 1WI9A 2XVCA 1ZLKA 4B3XA 2E71A 2L9RA 4DZJA 1FT9A 4ENMA 1RR8C 3BJAA 4H4KC 2OTLI 2DFHA 3FWEA 4JK1X 2R7XA 4HZFA 3JAMK 1XSXA 2ZXIA 2HYFA 3N97A 2GQQA 2FF4A 5F1RA 3E6DA 4BU2A 3ABKH 1TC3C 1WJAA 2M0MA 5GP9A 2IS2A 1TW3A 4WX9A 3BPXA 4A6EA 3JTHA 2ELHA 4XM3A 5D5VB 3BZ6A 1IAWA 1B1BA 1TT0A 3DQVC 5HS7A 1QVUA 1RI7A 5B66C 4I98B 2H94A 3S2DJ 4IHXA 3GZ5A 4BXUA 2XAUA 1T08B 2RKHA 2R7QA 1JTXA 2GOXB 4P5OA 4L0YB 4KITB 1CGPA 4HNUA 3T5XA 5KHDA 3TMOA 2M7AA 4NQWB 4XLNF 3MKZA 3L2QA 3H9QA 2L2OA 1L0OC 3JRAA 2VQGA 2QKMB 2JWTA 3TQNA 1Z3XA 4MO7A 1E2XA 2EB7A 2ZMEA 1DP7P 3H0GJ 1ETXA 2WC2A 5CKTA 3I58A 2E1MC 3I54A 4MTEA 5IT9Z 4OIQF 2MH2A 1XGNA 3SDGA 2ICWG 4U0VA 3B6CA 1X1DA 2H6CA 3DCFA 2WA0A 3P9CA 5FFXA 2XAHA 1T38A 2IJLA 4D7NA 1BL0A 5EGOA 2ZXHA 2P6TA 3WHBA 3F6VA 1G3SA 2COBA 1FBQA 2VJIA 2GM4A 3V7CA 3M7GA 1XS9A 5ILSA 2FSWA 3BOQA 1FWZA 2BXZA 1MBGA 3K4JA 4LLNA 2HVSA 1IDYA 2ZNZA 2XPWA 1S7OA 3CMEI 1YRNA 4KA4A 2VPLA 1ZG5A 5K5QA 3SFZA 2CO5A 2P4WA 3U21A 4DBQA 4KMFA 3LNQA 2P7VB 3RPUA 3PSIA 1WQ2A 1LB2A 1FYKA 3S3NA 3GW2A 4MEXF 2FE3A 5DD4A 2M4GA 4M3EA 3HXLA 3W2VA 4YFNF 2L3DA 1JUSA 4JX5A 2XAFA 2HPIA 1HQCA 3RTRA 3BTCA 4A93J 4HSTA 3DU6A 1IV8A 1ZGWA 5FROA 3WG9A 5C3EJ 4DBRA 5EZGA 3HZJA 2QSGX 5H2FC 4BDYA 3JW4A 1O3TA 3ZMSA 1QU3A 1KYZA 1USTA 4XRFA 2EWNA 1XGOA 1DDNA 3R0JA 3DLAA 3F9KA 1VQ4I 4LLGF 1KQ0A 2GOMA 3GTMJ 1E17A 2V6EA 1SVMA 4DW6A 4PDKA 1JHFA 2DDAA 3VSKA 1V5EA 5J3LA 1SC7A 2P5VA 4V2GA 4IJAA 3E6CC 3TP0A 5LHGA 2HZTA 3A01A 1BI3A 3SYTA 1Y56A 5EG0A 5D6FA 4D5CA 4I7HA 5F27A 2QENA 2LVSA 3LAJA 2XB0X 2PMUA 2VONA 1NK2P 1U5TB 3E3VA 1B9NA 5E18F 3DTKA 4EATA 2VJ5A 1FLIA 3IP4B 3I4NJ 3S15J 2IS4A 1Z77A 3KCCA 4HG2A 4N0BA 3C3WA 3ABLH 3WHCA 3BZCA 5KK1A 4D9JA 1R00A 1DGWY 4LITA 4X6AJ 3SHFA 4QPQA 3KZIC 2CQNA 1B72B 2VXDA 4XN0A 4A5MA 2EZKA 3JRDA 1IF1A 1KU3A 4BQOA 1YX3A 1T33A 3TO9A 2DA5A 3J7YJ 5E1WA 4Y52J 1ZR4A 2F5CA 1UMQA 1ETVA 5FLMJ 2ZJ2A 4CCKA 3BZKA 3GTQJ 5K5RA 2NNNA 5FKNA 1FBUA 5BPDA 1YFHA 1LNWA 3A0HC 5LGNA 2A5WA 4N9HA 2FBHA 1VQMI 2HTSA 4B1RA 4AIJA 2DLLA 4IPAA 5KVRA 1RUOA 4V19K 4FQGA 4MLOA 4PFOA 4UNOA 5CVRA 2PMZN 4RB1A 2NVXJ 2CUFA 3DKWA 1QRYA 2JTVA 2CW0F 3ASNH 3JREA 4UUVA 1JT6A 1SANA 3HUGA 2MA3A 4R79A 2P0WA 1U5TC 1OKRA 5F04A 1K78A 4A3IJ 2STTA 3ZQIA 3HHHA 1LUJB 3K0LA 2NYXA 4RGXA 3FBNB 3KEQA 3HKZN 1P4XA 2F6CA 3WE3A 2COMA 4QIWN 2ME0A 4ZC3A 3CCRI 5FKOA 4G7OF 2PFBA 3LA3A 2E2IJ 2M45A 2QSFX 4HX8A 5CVJA 2BYVE 3D5RC 1B59A 3H1CA 5E3MA 2Z33A 1R49A 4I2OA 4IL6C 4MEYF 1H89C 4CH7A 2HDDA 2L4MA 3H0DA 2GLOA 1LFPA 2BY0A 1STZA 4Z2YA 1VQ8I 5K1YA 3DU5A 4YFKF 4UUSA 1S8NA 1W7PA 5DUIA 2J5PA 5ERIA 4KIGA 3CO7C 2IPQX 4MFDA 3S8PA 1H8AC 5D8LB 4XQFA 2LC2A 4Y3OA 3IRQA 3N05A 4G6TB 4F7ZA 2C6YA 1HA8A 3OOUA 1IRGA 3RI4A 2GBYA 2LY2A 1D5YA 1CQTA 4BBRJ 3A4CA 2MLGA 1I5ZA 3L2CA 1YG2A 5EF6A 2HKXA 1V5GA 4A3CJ 3V7RA 2OQRA 4KN7X 3WTVC 3BLYA 4Q5SF 2O61A 3F21A 2OTJI 2VIXA 2XUBA 5AIPA 5A2QK 1O3RA 1R1VA 5F64A 1ZK8A 3C1DA 2YX7A 5FGMA 2DDBA 4HYEA 2MC3A 3BC8A 5LLQA 1WJFA 2QKLB 2Z99A 2MC4A 4XKBA 3DP7A 3JAMZ 1KONA 1JGSA 2F5VA 1ZAOA 4HF2A 1EF4A 2WAQN 2X1CA 2V1NA 2PI0A 3HRUA 5FO5A 2A6HF 3OR2C 2Q2EB 5C44J 3FXRA 2VT3A 1XDSA 5GTIC 4F92B 3ZPLA 1JJ8C 2AQFA 4E7HA 4A3GJ 2VQLA 2ZC2A 3HB9A 2ZFWA 3EUHC 2V1XA 2MD5A 5F0HA 4CYCA 3CCEI 1BW5A 4F3QA 2RQQA 2W00A 3DLLF 3JRBA 2FUG2 3Q9VA 2LG4A 1IC8A 1HKTA 4LB5A 1P7JA 2X48A 4RB3C 3GTOJ 2L01A 1Z1DA 1VQ7I 2P8TA 1GHCA 2F48A 2K9LA 4OIPF 2E34A 3MCZA 4LIVA 2JRTA 3HOYJ 1ODDA 4DNCA 2WY7Q 4M6YA 2Y2ZA 3IUOA 1WJCA 3BCBA 4ZYEA 3IAS2 3CESA 3TW7A 2OC6A 2X0LA 2YUSA 3JRIA 4HRIA 1DP3A 3D5SC 2DBBA 3LSMA 3UKGA 1MMAA 2VUMJ 4ESJA 1KU7A 3QP6A 1FX7A 4BE0A 2XSJC 3DEEA 3IRRA 1IN7A 3PSFA 4XOPA 1LPQA 3KYCB 3RYPA 1FTTA 3QOPA 4XKCA 1WHUA 5LBQA 4CA0A 3DWLE 4XLHA 2V7FA 1S9HA 1T0FC 1PJRA 2AXTC 2IVMA 1FYLA 3X2QH 5CQGA 4Z6YA 4O5VA 4XSZF 2VJJA 4XOTA 1TP4A 2WB1N 4UXNA 3TEDA 1G8XA 1MDMB 2QWWA 5D5UB 2QM3A 3HIFA 3FX3A 1MBEA 5E1XA 2RC4A 2WTEA 1DQUA 4GCVA 2LF7A 1TWCJ 1LDJA 4WK8F 1YS6A 2P7CB 4AYBA 2KDOA 1WGXA 1E3HA 4LB6B 2CQXA 2K9SA 3K1PA 3U1DA 3K69A 4L5IA 1EH6A 1ITYA 3QRFF 2X85A 3J7AY 2UWMA 3CCLI 2JA7J 1PP7U 5DCMA 4PJNA 3OIPA 2HYGD 2L9NA 2XAQA 4KDPA 5J4YA 1OR7A 2ECCA 2NOGA 1FSEA 4UB8C 3UNGC 2ECBA 3A0BC 3E5QA 4DIQA 4NHJA 2XPVA 4U7DA 3BR6A 5CVIA 5J1UA 1R5HA 1UCRA 1X19A 2HWVA 5M5WJ 3G1LA 4B09A 2LP0A 2O0YA 3JRHA 1UFMA 1O57A 1UHWA 2VJ4A 3ABTA 2DO7A 3FHNA 1OYWA 1R23A 3J80K 4B44A 2KL4A 3CCVI 2W24A 2DOFA 5IP6A 1SD6A 2YS9A 1YW7A 3H3VK 1MJ9A 2Y0SN 2R5ZA 5HDKA 1BJAA 4V2FA 1W4MA 2JSPA 5DEQA 4XK4A 3OOPA 4PJJA 3ONQA 5GPCA 5CPRB 4LOCA 1VI0A 2P5KA 2W84A 3ZMTA 4E6KG 2Q1ZB 1MMDA 3BPVA 2DOAA 4IRHA 4CHUA 1TQIA 2DMNA 1RIOH 2KPMA 2KP6A 1SFXA 1USSA 3ELKA 5J47A 3KYDB 2XRNA 5BNGA 2BZTA 3GF2A 5FD5A 1U8BA 1ZGAA 3CMMA 4PSXA 3R61A 2HOTA 2DU9A 2Q0OA 4UV9A 4A0YA 3FKIJ 3N4MA 2RVCA 4NDLA 2QCOA 1P7IA 5IPAA 5KAFC 1XCBA 2OBPA 4NBQA 3B02A 5ICCA 5DDGA 2XPUA 2TDXA 3T1BA 2Y30A 2V9PA 2HFHA 3WU0A 3A02A 1R36A 1Z91A 2LK2A 3DEWA 1WPKA 5LFAA 4M71A 5IT3A 4I6ZA 2JQ7A 3LQQA 5E3NA 3RJPA 2GA2A 2V79A 2B63J 3LFUA 1H0MA 1KQ9A 1G3WA 3GFMA 3P9KA 5EZHA 2FD5A 3H3ZA 3GTLJ 3S16J 3FISA 1ZN2A 3CDHA 2AO9A 3I9V2 1X1CA 2H27A 2AS5F 1UG0A 3CP8A 4C3HJ 2CV2A 3C18A 2QSHX 1MJBA 3I71A 2UUZA 2XRLA 3SZGA 4X0GA 4DYQA 2A6TA 1FMWA 4MHGA 4RMNA 5EDNA 5LD2C 3S2WA 1SFEA 2HNHA 4P96A 2Z2SB 1IZ1A 2VT2A 2X9DA 4GYIA 3OS0A 1OCPA 2LFBA 5FKMA 4XLFA 1YJWI 4U7BA 1X1BA 4ZZLA 4BL0B 1GVJA 1HW2A 5D5XB 1F5TA 2KIQA 4LJZF 1MNMC 2ZSHB 2L4AA 4NC7A 4BE2A 3VYTB 2MFZA 1J0RA 5H6RA 1U6GA 3MN2A 2JA2A 2PLYA 5IOZA 3KYLA 3H3UA 3WU2C 2W7NA 4I76A 3CDLA 3HSRA 3U2RA 1TNTA 4XMYA 5K7HA 2PMHA 2JRMA 3H5AA 2CW8A 1XD7A 3GZNB 3D1NI 2NS8A 4AC0A 1WJEA 2EFNA 2LKXA 2HQ5A 1X3UA 3MMYB 5A2QZ 1YYVA 3S1RJ 1JT0A 3NARA 2BXYA 3NRVA 1Y6IA 3TGNA 4HV5A 4XN3A 4EJUA 2EA2A 2LSOA 5D5WB 2V26A 4M9SA 4BXXJ 3P5JA 1W0UA 4ENJA 5DM6F 3CC2I 1JUMA 1W1WE 3C7JA 4EJTA 1IXCA 2DYSH 4PK4A 3VOEA 3OSFA 4G7HF 2NAZA 2BW3B 1AU7A 5DS9A 2IA2A 3RPQA 4BXFA 2W25A 4MQ9F 4CO8A 5B5EC 3SXYA 3F22A 1O3QA 2H8RA 3BR2A 4RLQA 3GTKJ 2BY1A 3C2BA 2KZVA 1X4PA 3QU6A 4IHSA 2YU9J 2JK3A 4M72A 3L9FA 3DBLB 2M8EA 3CMAI 3DKYA 3TP3A 1XB4A 1IUYA 2E5ZA 3SQNA 2X6OA 1YJNI 2ZBKA 1OYIA 2WAQA 4YIIA 3VWBA 2DPDA 1VNDA 2K4JA 4G94A 2G7HA 3M8EA 4ZTJA 2M9HA 1ZREA 5JVTA 1BI2A 1YLFA 1XPXA 1WKMA 1VQPI 4EJOA 3COAC 1TWGJ 4DQ2A 1MSEC 1Y1WJ 2QEXI 4RDUA 2IS6A 4A3EJ 1RZ4A 1SMYF 2UV1A 3H35A 2EK5A 3K1NA 2ME6A 4OWRB 2XGDA 1G59A 4YIRX 2DFIA 2MBFA 3MD2A 3HTSB 1FIAA 1HDPA 1D1CA 3H5RA 4BQAA 2RDPA 4C2TA 2EPFA 2ZMEB 2CWEA 3FIWA 3VDXA 4M74A 3BR3A 1TWHJ 2OZ6A 4OU0A 4GFBA 2R7ZJ 3FK7A 4AM3A 2E60A 2XAJA 2QBYA 1VZ0A 4E7IA 2E36A 4UVBA 5IP7J 2ZSIB 1Q1VA 4Q47A 4C3JJ 3CUOA 1YS7A 5IY5H 3I3LA 2FMYA 2JSCA 4XLCA 4IO9F 4X1EA 5EGOB 1O3SA 2MSYA 3BR1A 3ZRGA 3HDDA 1QNTA 2QQBA 1LE8B 1BOBA 4S0HB 2R7FA 3K2AA 2CUZA 3VYSB 1TLHB 3K4MA 3F8BA 4U0WA 2D1HA 1XSDA 2H8WA 4ZYAA 2WB1A 4BY1J 4WWCA 1BA5A 2FBKA 1JE8A 4BQQA 5ICGA 4HSRA 5GADJ 2QYOA 1P4WA 1GXQA 1O7LA 2EFQA 2FU4A 2M2EA 3EETA 1OCRH 2EIJH 3TW6A 2W4SA 3HRMA 4BHPA 4A3LJ 5B1AH 4IOAF 3FDYA 4XSXF 3JSOA 2IW5A 1FP1D 3NAUA 2ZMEC 1KGSA 1BC7C 3FMRA 5FLXK 2K27A 3I4PA 3BTJA 5C4JJ 5L3BA 1X58A 1HXDA 1Z67A 3BCAA 5GTHC 2BEOA 3W3CA 4FHTA 2MG4A 3HRSA 4BQNA 3WTZA 3J80Z 4HDVA 2NVTJ 4AIDA 2CYYA 3PUFA 3OIQA 1LFUP 1XGSA 1AKHB 3DF8A 4JBAA 4C2UA 4FX0A 1BI1A 2CFXA 2IS1A 3DPTA 1J7KA 2JPBA 2JUCA 3RYRA 2RAEA 2F4OB 5EYRA 2RV8A 1R1TA 5LRSA 2CQQA 1XN7A 4D7MA 3S17J 5LGUA 1T98A 5FB2A 2RREA 1HKQA 4MQVA 1B6AA 4U0YA 4D1QA 4RAYA 5L3EA 4UY8I 4IRGA 1F36A 5LGTA 4M9XA 3ZXSA 1Y39A 2Y0SA 5TISC 3KLOA 1Y8QB 2CV1A 2OUMA 4GRIA 4KN4X 4RGUA 2NRAC 3ZQLA 1TL8A 1QGPA 3DPUA 4P1WA 2DT6A 4ITVA 4D5FA 3PFYA 2A5YB 1FTZA 1FNNA 3LA2A 3GFJA 2ID6A 2O5RA 1U8RA 2LYCA 2M8GX 3KP4A 4EGYA 1JI8A 2KMUA 3GFLA 4A3MJ 3A03A 5J8FA 5E8IA 4Y7NJ 1UB9A 2DK5A 4M73A 5HS9A 2JJ7A 3S1NJ 4WXDA 4E70A 4YG2F 3M1EA 4BAYA 3L2UA 1X3WB 4H0EA 2DODA 4N4NB 3KETA 3LAPA 2V9VA 5TRDA 1ETYA 1A6IA 5AONA 3U9GA 1TBXA 3GEZA 2M5WA 1MNDA 2DJNA 3ZQ7A 3BTLA 3PO2J 3QAHA 1BOAA 5IYCJ 2P81A 2K40A 1D8KA 2VN2A 5BQTA 2DFFA 3T0YA 3ZQFA 2NVQJ 2VBWA 1Z0XA 3HUGB 3ULQB 1BW6A 3AL0C 2RNJA 3RSNA 4RA2A 5BOXA 2LH9A 3P9IA 1CF7B 4I99C 4OIRF 1W5CC 2RQPA 1V5FA 3DKXA 4QLCU 1YE9A 4ABZA 3I56I 1H9TA 3PNYA 4I0AA 1J75A 5FRMA 3BP8A 2FBIA 1WI3A 4RGRA 4CCLA 3QODA 3H92A 4IVNA 5FJ8J 3CLOA 2IGNA 2KZGA 3E6BA 2L5QA 3CQZJ 2EFWA 3V8KA 4JOMA 2LF8A 2PN6A 3BJOA 4NUBA 2K4BA 4A12A 4KT6A 2VODA 5E17F 2K7LA 2R7DA 1MBKA 4L9NA 4A3KJ 3TOAA 3E6MA 1I1GA 3DBRB 4WF2A 2F5FA 1U2WA 3I4MJ 2F5EA 2DCEA 4LIUA 4S04A 2FA5A 2K02A 4BHCA 1TWAJ 3L1PA 3C2GA 2JA5J 4M3FA 3G71I 2AHQA 2CQ7A 1B72A 2LMDA 4L5EA 1MZBA 1I1SA 1NG7A 3I59B 5LEKA 1OLTA 4HLXA 1IG7A 3PO3J 2O9LA 3PIPF 2Z9OA 1IRZA 4AVPA 2EBIA 3M9AA 2K85A 1J5YA 1OPCA 1D1BA 3MQ0A 1MMNA 3RCOA 3VYUB 2DK8A 1G6NA 4B43A 2CW7A 5HLGA 3SFIA 3FMQA 3OR1C 3BG9A 3GBGA 4C3IJ 4XKVA 2OCCH 3MKYB 4YEJA 3O3KA 2CU7A 2VQCA 1RNLA 4KIFA 2Y31A 4MFEA 5JI6A 1R9TJ 1F1ZA 1N77A 2ZCWA 3QP5A 2VBXA 3T8TA 3HG9A 3KX2A 1Z6RA 3HM5A 5E3OA 2VB6A 1QVTA 4GYGA 1K6YA 3BTIA 1XCVA 3K6GA 4K2EA 2HDWA 3GUDA 4W1UA 3L2VA 4LK1F 1MH4A 1KU9A 3S32A 2OAZA 2PJRB 3G6EI 4BE1A 5J1YA 5M3FJ 1YO5C 5F08A 1TTYA 4II3A 1DU0A 2A07F 1Z3YA 3Q0VA 1YX5A 2TRTA 2KIFA 1VTNC 2XF6A 1XG1A 3O2PE 3GTJJ 4RM3A 4O6JA 3EYIA 3RZDJ 4HQEA 1GUUA 3HTUA 4Y17A 5BS6A 1TWFJ 2ESNA 4KYWA 2KHMA 3E5UA 3ZR8X 3DTIA 3GLLA 3IHUA 2K86A 3KZYA 4DOZA 4QTRA 4KFCA 3RZOJ 3CCSI 4G8XA 3EUHA 2HQNA 4RB0A 2KRFA 2LKSA 1IN5A 1YHQI 2O6GE 2IXSA 1X2MA 4ENKA 3DTEA 3GCMA 4XRSG 3FM3A 1U3EM 3QWLA 4BS9A 5JHFA 3OV8A 5JR3A 5DUKA 3ZCOA 4E7SA 1MBFA 2VL8A 1LJ9A 3IV5A 2DTZA 1ZRCA 4DZPA 3F72A 1RC9A 1X3ZB 2O03A 2ZNYA 1IN4A 1NK3P 4L18B 2DTRA 2FQ3A 2EV0A 3M8JA 1GV5A 4HQMA 2CJJA 3HSEA 3T8RA 3V4GA 2FRHA 3OYMA 1IJWC 4AWXB 3OYFA 3HOSA 4CZZA 3CCQI 4LG0B 3KIOA 1A04A 2FOKA 1ON1A 5CJ9A 1WJ5A 3B73A 2VBZA 2ELJA 2ZB9A 5IP9J 4DYRA 3PJRA 1QHGA 1WCMJ 3OYCA 3G73A 3RDIA 4FE4A 5L3CA 1SEUA 1JKRC 5L3GA 2LBFB 3RPUD 4OMYA 1N75A 1G2HA 1LKXA 4CCJA 2Q2EA 1YI2I 2ZJPF 5M5YJ 3F8CA 3NWSA 4E7LA 4PJMA 1LVKA 5FLXZ 1Z21A 2K5CA 3CUQA 1K4SA 2E1CA 1HKSA 2EQRA 3S3OA 5E1ZB 2V6CA 3VODA 2WAEA 1UHMA 1HW1A 2FJ1A 5KNLA 4PUSA 1Z6TA 1IO2A 2LY1A 1WVRA 4UUTA 3E7LA 3M07A 2XC7A 2MABA 1E3OC 2N8GA 3M8FA 4DGWB 5L3FA 1LEBA 1P92A 3IKTA 4HBLA 2EV5A 2Z5UA 3IWFA 2VKHA 3PFIA 2GIZA 3LSGA 2HGCA 1P4AA 4ZYDA 1R5ID 5L3DA 2DMUA 3HPHA 5E79C 2DN0A 2FOWA 1VQNI 2CQKA 5H6QA 1HDDC 1SD7A 3H9JA 5M5XJ 3ABMH 1S7EA 1BI0A 2DT7B 2QGUA 4BJTA 3FHZA 4B4CA 1Q1HA 1WJDA 3SZTA 3ZMVA 2CV0A 2VI6A 2G0EA 3K70C 3E5XA 2CUEA 1MDMA 4L9TA 3ERMA 2BGCA 3E0JB 3HYIA 1KZHA 3CD6I 2HR3A 1YOVB 2PX9A 4IQ4A 2IRFG 2GIVA 1S3JA 1B8IA 3IH2A 4M3GA 1UZCA 1RUNA 5ICFA 5K7FA 4YFXF 1A36A 4A3BJ 3HOXJ 3NQOA 3PIOF 2XF5A 2XHKA 2MYSA 2UXXA 3BG7A 4OINF 3QU3A 1RESA 3A1YA 4I0BA 4FCYA 2YPRA 1OR7C 1QA6A 4FE7A 2DA3A 4II2A 2L7FP 4RS8A 2EZLA 2EILH 4HLYA 5DV5A 2Z16A 5CQEA 4L9VA 1D1AA 3OY9A 5JVGF 2V4JC 1REPC 5CYVA 4BEHA 1K7AA 3QYEA 2D45A 2OA4A 3GMEA 3IH3A 5J1RA 1SFKA 4JP0A 2VKEA 3FZVA 4HW0A 4ZDPA 2DYRH 2HS5A 1XMXA 1K83J 3PQJA 4RB2C 3HC7A 1X2NA 4KT5C 3L09A 3E1SA 2ZJQF 3RQ4A 1ETOA 4DJAA 3CZ6A 3HRTA 1C0WA 5GAGJ 5B1BH 9ANTA 1YJ9I 2JVHA 2GXGA 2XIGA 4EV0A 4HA8A 2QQ8A 4F93B 2QF7A 6PAXA 3KZZA 3CCMI 3BG3A 2HQRA 1RPWA 4EMSA 3KP3A 2OV7A 5FKLA 2PG4A 2BHYA 3DFGA 4WCGA 3REOA 1VF9A 4OAYA 5GAHJ 4HNVA 1N25A 1K4TA 2QLZA 1O4XA 1XC5A 2M1BA 4HPQA 4OAZA 3ZQCA 2JN6A 3HSFA 1VQ5I 3FXOA 2E2JJ 3OYAA 5FLVA 4N9IA 5ILVA 3TDUC 4FETA 2O8KA 3K4LA 2PMZA 3Q0UA 4AU7A 1ZR2A 3FXMA 1DPRA 3KPHA 3D5LA 4ZYGA 5FD6A 2X6XA 3KP5A 3ROUA 2EIMH 2K3FA 3MWMA 4B3AA 2R7TA 4G7ZF 2LKPA 1HC8A 2L9SA 1B4AA 4GXOA 2R5YB 1G3YA 2JPCA 1D0ZA 2X6WA 2Y69H 4JX4A 2CMPA 1OJLA 2VASA 1I3QJ 4M6XA 4N4OB 3K4NA 1F4KA 2H1KA 3FXKA 3HKZA 4RLFA 4XLPF 4I01A 4LGWA 2R7VA 3E97A 4CCMA 1DUXC 2IA0A 3EUAA 1I6XA 1U0JA 1F9NA 1R4NB 2ZXWH 3DEUA 2QUFA 2XGXA 1FBSA 2D2WA 4BACA 2WV0A 3OS1A 1KA8A 3CCYA 2HOAA 2QZ8A 1W36C 2ADUA 2RNGA 2R93J 1WSUA 3HPGA 1SFUA 1UELB 3BR0A 2HTJA 2A6EF 5DM7F 2BVMA 4HOBA 1Y0NA 2DFEA 2L0KA 3PNTA 5LHIA 1SFOJ 3AG2H 1WFXA 2ZFUA 1LVAA 4C2MJ 5ILUA 3HGGA 2PBIA 1R58A 2IP2A 5BMZA 4EVIA 2XB5A 4KNYA 2XGEA 3GTPJ 3HOTA 2R0QC 2KLOA 1PUFB 1P9QC 3OL3A 2XKOA 3DV8A 4IX7A 5E8GA 4XRSA 1SMTA 2OD5A 2R7RA 3OMYA 4LFUA 2BY2A 1J2XA 4CICA 3J7AO 2OF7A 4BKXA 2ELKA 1D0YA 4BH9A 1QZEA 1M1EB 2OQGA 1HLVA 4KIBA 3ERED 2BE5F 1AWCA 2HQAA 4I09A 2X51A 2XAGA 1LQ1A 2HXIA 4IQJA 3OS2A 3LSKA 4R8HA 4AUXA 1BM9A 1EKEA 4FT8A 4FTHA 2IGKA 4G6QA 4ZJZA 1T95A 3VYRB 2MH9A 4BUPA 1VFCA 4L9JA 2R7SA 2VXZA 2CSOA 3UR3C 1IDZA 1X4OA 1OFCX 5DCFA 3OYIA 1VQ6I 3SDBA 4FISA 1GXPA 2EV6A 4UV8A 5IYDJ 1A6QA 5F1JA 4PGGA 4AIKA 2ZO4A 4BDZA 4HEA2 4LMYA 3CP2A 3GWZA 5EJCA 1OYYA 1W5SA 2K9QA 3K4BA 1RR7A 1BJZA 1HSTA 2D1VA 2O8XA 5ED4A 3J81K 1ZYRF 3AFHA 2P6SA 4L0ZB 3IKVA 1SAXA 4ESBA 3R0AA 1ETKA 2CRGA 4DYCA 2HEOA 3LSPA 3GVAA 3CF5F 4CCNA 4JQFA 1KYWA 2BW3A 2LNBA 1JHHA 3LSHA 2BOLA 1QPIA 3JTGA 2CS3A 5HLHA 4P9UA 4IXAA 1Z9CA 3F8NA 3LA7A 1YIJI 2XGCA 3M4OJ 2Z3YA 4CCOA 3ML6A 4PCQA 3DPLC 1MH3A 1ZRDA 4IOCF 1YITI 1JKPC 1FOXA 3K70D 2K3PA 3L00A 5K5OA 4AIHA 2E5NA 2OPTA 2W57A 1BIAA 2V1UA 5LHHA 1FC3A 2FNAA 2Y75A 2HXOA 2GZWA 4UVCA 2L7MP 4G9YA 3WU1B 1MD0A 5KAIC 2L7ZA 1RKTA 5K7ZA 4IHWA 3RKQA 1FMVA 3V8JA 4C9YA 2NVUB 1A5JA 4J01A 4HF0A 3ZMZA 2AQEA 2LREA 3S3MA 4Q48A 3WTXC 3B6AA 1VQOI 1YRNB 2CGPA 4EQQA 3FM5A 3QYFA 2YX4A 2ESHA 3LMMA 3S1QJ 1IV6A 4BJ5C 4YELA 2FX0A 4EM2A 2A69F 4Y15A 3RQIA 2H1LA 1DU6A 2K9NA 2EFOA 4RM2A 5EEGA 2R7UA 1VQKI 4W97A 3OYGA 2IAIA 1V4RA 3JSPA 2G9WA 5JLXA 5LEJA 2KRHA 3WTSC 2KT0A 2DOEA 1GV2A 2LLKA 1FPQA 2VKVA 1HF0A 5ICEA 4F55A 2M30A 1WJBA 2NNYA 5HDGA 2HPMA 4LD5A 1V3FA 2R4GA 1JXSA 2VC1A 1R7JA 3QOEA 3ZOBA 1PDNC 1TQPA 4NQWA 1JKQC 2EZIA 2EA4A 3K7AJ 1D0XA 3GYHX 4J00A 3L2RA 4EM0B 3V8LA 4IHYA 3A01B 3BQZA 3OYBA 1DGRM 1LE8A 2LRDA 1U9OA 2DMPA 5EG0B 4XIDA 3MFKA 2XKPA 1FY7A 5DYMA 2KDZA 3AL0B 4HX7A 1YQAA 1HOMA 2TCTA 4AYBN 1ZARA 2W48A 2CH0A 3GFIA 1PP8F 1ULYA 4QWQA 1R5GA 2BBYA 3JR9A 2NVYJ 3SEQA 2L02A 3K4KA 2OJED 2KFDA 2G7UA 5D8KB 1Z7LA 2DI3A 1MMSA 4G12A 4HDUA 3KEYA 2CFOA 5HOOA 5EEAA 5LRRA 1P2FA 4AVZA 4ZDLA 4ANJA 4TV7A 3LFKA 5D4RA 1ZG3A 1R1UA 4ESFA 1YW9A 2HZDA 1W36D 1K6OA 3WE2A 2MW8A 2BY3A 4EM1A 5HNFA 1EH8A 4KISA 1LDKB 2ETHA 4LG3A 3W6VA 3FXJA 1J09A 1XSVA 1AKHA 1A31A 3HL2A 4OMZA 1N78A 3VFZA 2ZXJA 2A05A 4F52A 3MVPA 2VE9A 2STWA 3I5UA 2HOSA 2M87A 3LWFA 3RIRA 4CZCA 3WG7H 3CF2A 3PM1A 3HHGA 3TOBA 4RAFA 3WTUC 3KP2A 5HODA 2QVOA 3LL7A 2PQ8A 3CTAA 1UJ8A 3BDDA 4XNFA 3RKYA 1ORKA 4PZJA 3KFWX 3G3ZA 1K78B 5TGTA 2JUGA 5FKKA 3JRGA 2DAOA 3CCJI 3W6JB 3FBIB 4E4HA 3MEXA 4J19A 2VKDA 3NEUA 3SJMA 2HI3A 1T39A 1HCRA 2E1NA 4BBSJ 1FOYA 2EFPA 5AIQA 1S7AA 3BG6A 2DA6A 1FYMA 3GTGJ 1UG2A 2I10A 3QPHA 4NC6A 2VQHA 5BPIA 2DMQA 1ZRFA 2DXIA 5C4XJ 1U5TA 4JYKA 3MKWB 3IH4A 2H6BA 1S29A 3F23A 2LDUA 2H09A 1JKOC 1ZH5A 2EJRA 1OCZH 3AG1H 1FZPB 4E7JA 3A2KA 2W85A 3V7SA 4U88A 3LSJA 1E3PA 2R7WA 4UUSB 2M4KA 1UAAA 1W7PB 2WV1A 5D6EA 2MGQA 1J59A 3J7ZI 1BN5A 1AHDP 3ECHA 4A6DA 2EH3A 5FFZA 2ZJRF 1NG6A 1QO0D 3G4SI 4M6VA 2XASA 4ZTFA 3F0CA 4C30A 3D0SA 2F5DA 2LTPA 1JJ6C 3GO5A 3CDIA 1BR2A 1NTCA 5EEHA 3KEOA 1F43A 2JT1A 4YRVA 4L5JA 2QA4I 2Y9ZA 2BHZA 1EV7A 2JZYA 4XLEA 4HAMA 3NWTA 2DPUA 1CF7A 4XLAA 1B9MA 3VEPA 1W0TA 3BY6A 3I64A 3BT9A 1S6LA 2J5OA 2WADA 2P5LC 2FEZA 2I5UA 4M3BA 4QSHA 2A61A 2E19A 2CG4A 3F6OA 3BR5A 3K1MA 3OYEA 4KMUX 1EA3A 1NHAA 2KKOA 1YTYA 1ETWA 5IYBJ 1D5VA 3K2ZA 3ZN1A 3CJNA 3AKZA 2MLKA 2FXAA 3IAM2 5J40A 4I02A 2M34A 3ECOA 1ZHFA 4IF4A 1ERDA 2EIKH 1EH7A 5JFRA 5FRNA 1YW8A 2L9VA 4A2UA 3CJQB 3W2AA 1FEXA 2ISZA 2WBMA 3J81Z 3SZPA 3H36A 3AAFA 1P6RA 3I59A 3KP7A 2VBYA 3DXJF 2GA1A 3PQKA 1QHHD 2F2EA 2IGMA 3HGYA 4G6DA 2ID3A 1BR1A 2AXLA 3QPSA 2FMLA 3K10A 4B8XA 4CYCB 1HSJA 3G1MA 1MW7A 4PJLA 2YSRA 3LQRA 4CXFA 4XORA 4ENNA 1PVEA 4BJ6C 3ZQGA 2HVQA 3S14J 3FMSA 4UHTA 3ZMDA 3IL2A 1FIPA 1TQMA 1XX5A 3Q3SA 2DT5A 3Q0WA 3EYYA 3MZHA 5F6FA 1GDTA 2IT0A 3MAJA 1PYVA 1IN6A 3OL4A 4E7ZA 1BC8C 1PUEE 3CJTB 4F91B 3P7NA 1IN8A 1Y8RB 4CYDA 1S72I 1OISA 3LSTA 1D3YA 4FX4A 4MIMA 2OZUA 3MZYA 2BVLA 2KJCA 2HYJA 5HLIA 3GLXA 3O8HA 2KRCA 1MKMA 2JA6J 1LDDA 1BBYA 2PJRA 2M0CA 2IA1A 3PUBA
chains in the Genus database with same CATH topology
3WHCA 9ANTA 1FIAA 1HDPA 4X6AJ 2QF7A 1B72B 3FIWA 1MBJA 3BG3A 2EZKA 3JRDA 1RPWA 3BR3A 1K61A 1OCTC 1TWHJ 5FKLA 1ZKGA 1U9NA 4GFBA 3FK7A 2R7ZJ 1VF9A 1T33A 4HNVA 4M3DA 1POGA 1O4XA 1XC5A 3ZQCA 2DA5A 2E1OA 4A3JJ 5IP7J 2JN6A 3BG5A 2E2JJ 4Y52J 3HOVJ 1Q1VA 4C3JJ 5FLVA 1ZR4A 2O8KA 1UMQA 1ETVA 5FLMJ 3GTQJ 4X1EA 3Q0UA 5EGOB 1ZR2A 5FKNA 2MSYA 3BR1A 1FJLA 5F0CA 4B3AA 4B1RA 3HDDA 4MLOA 1LE8B 2PMZN 4S0HB 2NVXJ 3K2AA 2R5YB 2CUFA 1QRYA 2LR8A 2DA4A 4JX4A 1OJLA 1I3QJ 3HOZJ 3MKLA 3JREA 2H1KA 1JT6A 1SANA 4BY1J 5F04A 4A3IJ 2JA8J 3HOUJ 2IBDA 1BA5A 3ZQIA 1JGGA 2M2EA 3CCYA 1ENHA 2HOAA 3HKZN 3TW6A 2R93J 4QIWN 2ME0A 5FKOA 2E2IJ 4A3LJ 5E3MA 2Y9YA 3BR0A 3NAUA 1H89C 1B8IB 4EEFG 2HDDA 2L0KA 1JUPA 3O8GA 1SFOJ 3BTJA 2R5ZB 5C4JJ 2GLOA 4C2MJ 1X58A 3HGGA 1T56A 3CMYA 1MBHA 2XB5A 2XGEA 1U78A 2MG4A 3GTPJ 2NVTJ 4UUSA 2R0QC 3ZQHA 1PUFB 2O7OA 4XRSA 2NS7A 4MFDA 1LFUP 3QPLA 1AKHB 1H8AC 2OF7A 4BKXA 2ELKA 3S1MJ 3OOUA 2LD5A 1HLVA 2RAEA 2GBYA 5EYRA 1D5YA 1CQTA 4BBRJ 2HXIA 2XSDC 3OSGA 2CQQA 1RETA 4D7MA 3S17J 4AUXA 5EF6A 4A3CJ 4FTHA 5IOYA 1F36A 2EZHA 4XICA 5F0FA 3LOCA 1VFCA 1IDZA 5E3LA 1OFCX 1I6HJ 1ZK8A 4JX6A 4FISA 1WH5A 3OIOA 3ZQLA 5IYDJ 1UHSA 5F1JA 4D5FA 4RBOA 1FTZA 3S2HJ 2ID6A 2K9QA 1RR7A 2M8GX 1BJZA 1EF4A 2WAQN 2E2HJ 4A3MJ 3A03A 4Y7NJ 2JJ7A 3S1NJ 1ETKA 2CRGA 4DYCA 2IEKA 5C44J 3LSPA 1JJ8C 1ETYA 1A6IA 2D5VA 4A3GJ 3HB9A 2DJNA 3BTLA 3VPRA 3PO2J 5IYCJ 1QPIA 2P81A 2K40A 5JLWA 5F0HA 2R92J 4CYCA 1BW5A 3ZQFA 2NVQJ 2XGCA 3JRBA 3M4OJ 1Z0XA 1GT0C 1IC8A 1P7JA 1ZQ3P 1BW6A 1MH3A 2X48A 3GTOJ 1JKPC 1RKWA 2OPTA 3HOYJ 1H88C 2HXOA 1IUFA 2L7MP 4ABZA 2Y2ZA 3TW7A 1WI3A 2YUSA 2L7ZA 3JRIA 1RKTA 5K7ZA 4IHVA 4IHWA 3RKQA 3UKGA 5FJ8J 3JRFA 2VUMJ 1A5JA 3JRCA 3CQZJ 3B6AA 1YRNB 1FTTA 1MBKA 3BQYA 4A3KJ 3S1QJ 1IV6A 2LY9A 2DA7A 3I4MJ 2FX0A 3RQIA 1DU6A 1TWAJ 2K9NA 3L1PA 2JA5J 4M3FA 3LSRA 2AHQA 4W97A 1B72A 3HOWJ 4L5EA 1ZTRA 2VPRA 2IAIA 2WB1N 3TEDA 5JLXA 1IG7A 3PO3J 1IGNA 2O9LA 2KT0A 1JTYA 1IRZA 1GV2A 2LLKA 2VKVA 5M3MJ 1HF0A 2EBIA 1MBEA 3ZOBA 3SFIA 3BG9A 3GBGA 4C3IJ 1JKQC 2EZIA 3K7AJ 5DTDA 1TWCJ 2CU7A 1LFBA 2Y31A 4XRMA 2FQ4A 4IHYA 3A01B 3BQZA 1WGXA 1LE8A 4MFEA 5EG0B 1U9OA 2DMPA 4A69C 1R9TJ 2CQXA 2K9SA 4XIDA 2R5YA 1ITYA 2KDZA 2JA7J 5E3OA 3HM5A 1HOMA 1QVTA 4BY7J 3G1OA 3BTIA 2TCTA 4AYBN 2ECCA 2NOGA 4W1UA 2JMWA 2ECBA 1MH4A 2W48A 2XPVA 3QQAA 3BR6A 5J1YA 5J1UA 3JR9A 2NVYJ 5M3FJ 1WH7A 5F08A 5M5WJ 1DU0A 3G1LA 2LP0A 3JRHA 2DA1A 3Q0VA 4G12A 2TRTA 1ETQA 1XG1A 3HEFA 4A3FJ 5EEAA 1GVDA 3GTJJ 3RZDJ 5IP6A 1GUUA 2YS9A 3H3VK 4IEJA 1Y1VJ 2Y0SN 2R5ZA 1APLC 1TWFJ 4V2FA 4A3DJ 4XK4A 2MW8A 2DMTA 3RZOJ 4QTRA 5GPCA 4LOCA 1VI0A 1PUFA 1I50J 3W6VA 1AKHA 2DMNA 1X2MA 4XRSG 2DA2A 3HBLA 3MVPA 2HOSA 5BNGA 5GPAA 1U8BA 3FK6A 2HOTA 3PM1A 1MSFC 3M3YJ 3FKIJ 5HODA 4NDLA 2QCOA 1P7IA 1MBFA 2L9RA 4DZJA 5IPAA 1ORKA 2XPUA 2DTZA 3IV5A 4DZPA 5FKKA 3JRGA 2Y30A 3A02A 2LK2A 3DEWA 4J19A 3SJMA 1WPKA 1NK3P 1TC3C 2HI3A 4I6ZA 1GV5A 5GP9A 1HCRA 2CJJA 5E3NA 4BBSJ 2B63J 1IJWC 2DA6A 3GTGJ 5EZHA 1QVUA 1UG2A 2FD5A 2I10A 3GTLJ 3S16J 3S2DJ 3FISA 4IHXA 2DMQA 5C4XJ 2AO9A 2ZB9A 5IP9J 4JYKA 4DYRA 3IH4A 1WCMJ 1JTXA 4C3HJ 4FE4A 1JKRC 1JKOC 2XRLA 1G2HA 4DYQA 3LSJA 5M5YJ 5EDNA 4UUSB 3JRAA 2WV1A 2MGQA 2JWTA 1AHDP 4MO7A 2EH3A 2X9DA 1OCPA 2LFBA 3H0GJ 1ETXA 4M6VA 5FKMA 2EQRA 3F0CA 2LTPA 1JJ6C 1NTCA 3SDGA 1MNMC 3B6CA 1F43A 2Y9ZA 2FJ1A 3DCFA 3MN2A 5IOZA 4D7NA 1BL0A 4UUTA 4I76A 5EGOA 3WHBA 3CDLA 3E7LA 1W0TA 1E3OC 2N8GA 3BT9A 2COBA 4M3BA 5K7HA 4QSHA 2GM4A 2E19A 3BR5A 3LSGA 1XS9A 3D1NI 2NS8A 4AC0A 2DMUA 1MBGA 2LKXA 2HQ5A 3S1RJ 1ETWA 2DN0A 1JT0A 5IYBJ 1IDYA 2XPWA 3NARA 1YRNA 1HDDC 2M34A 5M5XJ 3LNQA 1S7EA 4BXXJ 1W0UA 4B4CA 1JUMA 1FEXA 4M3EA 2VI6A 2G0EA 1JUSA 3OSFA 4JX5A 2CUEA 3HGYA 1AU7A 3BTCA 5DS9A 4A93J 2ID3A 1ZGWA 3QPSA 5C3EJ 2H8RA 5EZGA 4CYCB 3G1MA 3BR2A 1B8IA 3GTKJ 3C2BA 3IH2A 4M3GA 5K7FA 4A3BJ 3HOXJ 2YU9J 2JK3A 3ZQGA 3S14J 3GTMJ 1RESA 3TP3A 4DW6A 4FCYA 1FIPA 2X6OA 4FE7A 3Q3SA 2DA3A 5J3LA 2L7FP 4V2GA 3Q0WA 2EZLA 3TP0A 3A01A 1VNDA 1GDTA 5EG0A 4D5CA 2M9HA 5F27A 2LVSA 2XB0X 3IH3A 5J1RA 1MSEC 1TWGJ 1NK2P 1Y1WJ 4JP0A 2VKEA 4MIMA 4RDUA 4A3EJ 1K83J 2HYJA 1X2NA 2ME6A 3I4NJ 3S15J 3O8HA 2XGDA 1Z77A 2JA6J 1ETOA 2M0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHC A;  9ANT A;  1FIA A;  1HDP A;  4X6A J;  2QF7 A;  1B72 B;  3FIW A;  1MBJ A;  3BG3 A;  2EZK A;  3JRD A;  1RPW A;  3BR3 A;  1K61 A;  1OCT C;  1TWH J;  5FKL A;  1ZKG A;  1U9N A;  4GFB A;  3FK7 A;  2R7Z J;  1VF9 A;  1T33 A;  4HNV A;  4M3D A;  1POG A;  1O4X A;  1XC5 A;  3ZQC A;  2DA5 A;  2E1O A;  4A3J J;  5IP7 J;  2JN6 A;  3BG5 A;  2E2J J;  4Y52 J;  3HOV J;  1Q1V A;  4C3J J;  5FLV A;  1ZR4 A;  2O8K A;  1UMQ A;  1ETV A;  5FLM J;  3GTQ J;  4X1E A;  3Q0U A;  5EGO B;  1ZR2 A;  5FKN A;  2MSY A;  3BR1 A;  1FJL A;  5F0C A;  4B3A A;  4B1R A;  3HDD A;  4MLO A;  1LE8 B;  2PMZ N;  4S0H B;  2NVX J;  3K2A A;  2R5Y B;  2CUF A;  1QRY A;  2LR8 A;  2DA4 A;  4JX4 A;  1OJL A;  1I3Q J;  3HOZ J;  3MKL A;  3JRE A;  2H1K A;  1JT6 A;  1SAN A;  4BY1 J;  5F04 A;  4A3I J;  2JA8 J;  3HOU J;  2IBD A;  1BA5 A;  3ZQI A;  1JGG A;  2M2E A;  3CCY A;  1ENH A;  2HOA A;  3HKZ N;  3TW6 A;  2R93 J;  4QIW N;  2ME0 A;  5FKO A;  2E2I J;  4A3L J;  5E3M A;  2Y9Y A;  3BR0 A;  3NAU A;  1H89 C;  1B8I B;  4EEF G;  2HDD A;  2L0K A;  1JUP A;  3O8G A;  1SFO J;  3BTJ A;  2R5Z B;  5C4J J;  2GLO A;  4C2M J;  1X58 A;  3HGG A;  1T56 A;  3CMY A;  1MBH A;  2XB5 A;  2XGE A;  1U78 A;  2MG4 A;  3GTP J;  2NVT J;  4UUS A;  2R0Q C;  3ZQH A;  1PUF B;  2O7O A;  4XRS A;  2NS7 A;  4MFD A;  1LFU P;  3QPL A;  1AKH B;  1H8A C;  2OF7 A;  4BKX A;  2ELK A;  3S1M J;  3OOU A;  2LD5 A;  1HLV A;  2RAE A;  2GBY A;  5EYR A;  1D5Y A;  1CQT A;  4BBR J;  2HXI A;  2XSD C;  3OSG A;  2CQQ A;  1RET A;  4D7M A;  3S17 J;  4AUX A;  5EF6 A;  4A3C J;  4FTH A;  5IOY A;  1F36 A;  2EZH A;  4XIC A;  5F0F A;  3LOC A;  1VFC A;  1IDZ A;  5E3L A;  1OFC X;  1I6H J;  1ZK8 A;  4JX6 A;  4FIS A;  1WH5 A;  3OIO A;  3ZQL A;  5IYD J;  1UHS A;  5F1J A;  4D5F A;  4RBO A;  1FTZ A;  3S2H J;  2ID6 A;  2K9Q A;  1RR7 A;  2M8G X;  1BJZ A;  1EF4 A;  2WAQ N;  2E2H J;  4A3M J;  3A03 A;  4Y7N J;  2JJ7 A;  3S1N J;  1ETK A;  2CRG A;  4DYC A;  2IEK A;  5C44 J;  3LSP A;  1JJ8 C;  1ETY A;  1A6I A;  2D5V A;  4A3G J;  3HB9 A;  2DJN A;  3BTL A;  3VPR A;  3PO2 J;  5IYC J;  1QPI A;  2P81 A;  2K40 A;  5JLW A;  5F0H A;  2R92 J;  4CYC A;  1BW5 A;  3ZQF A;  2NVQ J;  2XGC A;  3JRB A;  3M4O J;  1Z0X A;  1GT0 C;  1IC8 A;  1P7J A;  1ZQ3 P;  1BW6 A;  1MH3 A;  2X48 A;  3GTO J;  1JKP C;  1RKW A;  2OPT A;  3HOY J;  1H88 C;  2HXO A;  1IUF A;  2L7M P;  4ABZ A;  2Y2Z A;  3TW7 A;  1WI3 A;  2YUS A;  2L7Z A;  3JRI A;  1RKT A;  5K7Z A;  4IHV A;  4IHW A;  3RKQ A;  3UKG A;  5FJ8 J;  3JRF A;  2VUM J;  1A5J A;  3JRC A;  3CQZ J;  3B6A A;  1YRN B;  1FTT A;  1MBK A;  3BQY A;  4A3K J;  3S1Q J;  1IV6 A;  2LY9 A;  2DA7 A;  3I4M J;  2FX0 A;  3RQI A;  1DU6 A;  1TWA J;  2K9N A;  3L1P A;  2JA5 J;  4M3F A;  3LSR A;  2AHQ A;  4W97 A;  1B72 A;  3HOW J;  4L5E A;  1ZTR A;  2VPR A;  2IAI A;  2WB1 N;  3TED A;  5JLX A;  1IG7 A;  3PO3 J;  1IGN A;  2O9L A;  2KT0 A;  1JTY A;  1IRZ A;  1GV2 A;  2LLK A;  2VKV A;  5M3M J;  1HF0 A;  2EBI A;  1MBE A;  3ZOB A;  3SFI A;  3BG9 A;  3GBG A;  4C3I J;  1JKQ C;  2EZI A;  3K7A J;  5DTD A;  1TWC J;  2CU7 A;  1LFB A;  2Y31 A;  4XRM A;  2FQ4 A;  4IHY A;  3A01 B;  3BQZ A;  1WGX A;  1LE8 A;  4MFE A;  5EG0 B;  1U9O A;  2DMP A;  4A69 C;  1R9T J;  2CQX A;  2K9S A;  4XID A;  2R5Y A;  1ITY A;  2KDZ A;  2JA7 J;  5E3O A;  3HM5 A;  1HOM A;  1QVT A;  4BY7 J;  3G1O A;  3BTI A;  2TCT A;  4AYB N;  2ECC A;  2NOG A;  4W1U A;  2JMW A;  2ECB A;  1MH4 A;  2W48 A;  2XPV A;  3QQA A;  3BR6 A;  5J1Y A;  5J1U A;  3JR9 A;  2NVY J;  5M3F J;  1WH7 A;  5F08 A;  5M5W J;  1DU0 A;  3G1L A;  2LP0 A;  3JRH A;  2DA1 A;  3Q0V A;  4G12 A;  2TRT A;  1ETQ A;  1XG1 A;  3HEF A;  4A3F J;  5EEA A;  1GVD A;  3GTJ J;  3RZD J;  5IP6 A;  1GUU A;  2YS9 A;  3H3V K;  4IEJ A;  1Y1V J;  2Y0S N;  2R5Z A;  1APL C;  1TWF J;  4V2F A;  4A3D J;  4XK4 A;  2MW8 A;  2DMT A;  3RZO J;  4QTR A;  5GPC A;  4LOC A;  1VI0 A;  1PUF A;  1I50 J;  3W6V A;  1AKH A;  2DMN A;  1X2M A;  4XRS G;  2DA2 A;  3HBL A;  3MVP A;  2HOS A;  5BNG A;  5GPA A;  1U8B A;  3FK6 A;  2HOT A;  3PM1 A;  1MSF C;  3M3Y J;  3FKI J;  5HOD A;  4NDL A;  2QCO A;  1P7I A;  1MBF A;  2L9R A;  4DZJ A;  5IPA A;  1ORK A;  2XPU A;  2DTZ A;  3IV5 A;  4DZP A;  5FKK A;  3JRG A;  2Y30 A;  3A02 A;  2LK2 A;  3DEW A;  4J19 A;  3SJM A;  1WPK A;  1NK3 P;  1TC3 C;  2HI3 A;  4I6Z A;  1GV5 A;  5GP9 A;  1HCR A;  2CJJ A;  5E3N A;  4BBS J;  2B63 J;  1IJW C;  2DA6 A;  3GTG J;  5EZH A;  1QVU A;  1UG2 A;  2FD5 A;  2I10 A;  3GTL J;  3S16 J;  3S2D J;  3FIS A;  4IHX A;  2DMQ A;  5C4X J;  2AO9 A;  2ZB9 A;  5IP9 J;  4JYK A;  4DYR A;  3IH4 A;  1WCM J;  1JTX A;  4C3H J;  4FE4 A;  1JKR C;  1JKO C;  2XRL A;  1G2H A;  4DYQ A;  3LSJ A;  5M5Y J;  5EDN A;  4UUS B;  3JRA A;  2WV1 A;  2MGQ A;  2JWT A;  1AHD P;  4MO7 A;  2EH3 A;  2X9D A;  1OCP A;  2LFB A;  3H0G J;  1ETX A;  4M6V A;  5FKM A;  2EQR A;  3F0C A;  2LTP A;  1JJ6 C;  1NTC A;  3SDG A;  1MNM C;  3B6C A;  1F43 A;  2Y9Z A;  2FJ1 A;  3DCF A;  3MN2 A;  5IOZ A;  4D7N A;  1BL0 A;  4UUT A;  4I76 A;  5EGO A;  3WHB A;  3CDL A;  3E7L A;  1W0T A;  1E3O C;  2N8G A;  3BT9 A;  2COB A;  4M3B A;  5K7H A;  4QSH A;  2GM4 A;  2E19 A;  3BR5 A;  3LSG A;  1XS9 A;  3D1N I;  2NS8 A;  4AC0 A;  2DMU A;  1MBG A;  2LKX A;  2HQ5 A;  3S1R J;  1ETW A;  2DN0 A;  1JT0 A;  5IYB J;  1IDY A;  2XPW A;  3NAR A;  1YRN A;  1HDD C;  2M34 A;  5M5X J;  3LNQ A;  1S7E A;  4BXX J;  1W0U A;  4B4C A;  1JUM A;  1FEX A;  4M3E A;  2VI6 A;  2G0E A;  1JUS A;  3OSF A;  4JX5 A;  2CUE A;  3HGY A;  1AU7 A;  3BTC A;  5DS9 A;  4A93 J;  2ID3 A;  1ZGW A;  3QPS A;  5C3E J;  2H8R A;  5EZG A;  4CYC B;  3G1M A;  3BR2 A;  1B8I A;  3GTK J;  3C2B A;  3IH2 A;  4M3G A;  5K7F A;  4A3B J;  3HOX J;  2YU9 J;  2JK3 A;  3ZQG A;  3S14 J;  3GTM J;  1RES A;  3TP3 A;  4DW6 A;  4FCY A;  1FIP A;  2X6O A;  4FE7 A;  3Q3S A;  2DA3 A;  5J3L A;  2L7F P;  4V2G A;  3Q0W A;  2EZL A;  3TP0 A;  3A01 A;  1VND A;  1GDT A;  5EG0 A;  4D5C A;  2M9H A;  5F27 A;  2LVS A;  2XB0 X;  3IH3 A;  5J1R A;  1MSE C;  1TWG J;  1NK2 P;  1Y1W J;  4JP0 A;  2VKE A;  4MIM A;  4RDU A;  4A3E J;  1K83 J;  2HYJ A;  1X2N A;  2ME6 A;  3I4N J;  3S15 J;  3O8H A;  2XGD A;  1Z77 A;  2JA6 J;  1ETO A;  2M0C A; 
#chains in the Genus database with same CATH topology
 3WTT C;  3I0T A;  3FXU A;  1BR4 A;  4ZZD A;  2X1D A;  2QQ9 A;  3GXO A;  3K9T A;  3CUQ B;  3L7W A;  3OYL A;  3CCU I;  1MBJ A;  1IXS B;  1YIO A;  4HV6 A;  1FSH A;  4CGZ A;  1K61 A;  1OCT C;  1WWX A;  1ZKG A;  1SAU A;  1U9N A;  2ZKZ A;  1V54 H;  5D4S A;  1L3L A;  3WGH A;  4AD9 A;  4M3D A;  1POG A;  1G3T A;  1TNS A;  3DBH B;  3PL8 A;  1A35 A;  2E1O A;  3EPZ A;  4A3J J;  2HOE A;  3BG5 A;  4ZDO A;  1T0F A;  3HOV J;  1SVO A;  1Y0U A;  3RKX A;  1Z05 A;  3ZQQ A;  4MGR A;  2PJP A;  4KIC A;  1FJL A;  5JHU A;  2W1O A;  5F0C A;  4FAS D;  4RGS A;  5DD8 A;  4D0P A;  5H20 A;  1KQ8 A;  4S05 A;  4BHB A;  2DQR A;  3LSI A;  4QPO A;  4BYY A;  1FP2 A;  3I53 A;  5GAE J;  3EUK L;  3ASO H;  1AA7 A;  3OYN A;  2FNP A;  2LR8 A;  4GGG A;  2DA4 A;  1EJ9 A;  4A0X A;  1SD5 A;  3HOZ J;  2LOO A;  3MKL A;  4A5N A;  5DCM B;  4ZH4 F;  4XON A;  1MGT A;  4PGH A;  1TT5 B;  3BJ6 A;  1IRF A;  1OCO H;  1VQL I;  1W5T A;  4EJW A;  2JA8 J;  4HNT A;  2IBD A;  1ONV A;  3HOU J;  1JGG A;  2UZK A;  1WZ2 A;  1VQ9 I;  4Y13 A;  1D8J A;  2BV6 A;  1XMA A;  3OYD A;  3L2W A;  2Z1D A;  5E20 A;  1ENH A;  4PFP A;  1GLN A;  2X4H A;  1TZL A;  2M7B A;  5CLS A;  1G4D A;  3ZN0 A;  4LG0 A;  2Y9Y A;  1IXR C;  4PJ0 C;  3CUQ C;  3ESW B;  4MNU A;  1X1A A;  1B8I B;  3CJR B;  4NB5 A;  4EEF G;  5J6X A;  1JUP A;  3O8G A;  2LBF A;  4XR6 A;  2R5Z B;  3O6B B;  3Q9S A;  1T56 A;  3CMY A;  3CC7 I;  4CSW A;  1MBH A;  3OWT A;  2CUJ A;  3TDZ C;  1U78 A;  5IT9 K;  4BGD A;  2DQL A;  3W2W A;  4EGZ A;  3ZQH A;  2NS0 A;  2O3F A;  2O7O A;  3IWZ A;  4HF1 A;  5HS8 A;  2NS7 A;  2VE8 A;  3QPL A;  2IGO A;  1QZY A;  2R7O A;  3F8M A;  3S1M J;  1ZGJ A;  2KIU A;  3QPT A;  4GDF A;  4ZYH A;  4BEH B;  2LD5 A;  2GAU A;  4RAZ A;  1NH3 A;  4OOI A;  1Z7U A;  2XSD C;  3OSG A;  1RET A;  5HLT A;  4YIF A;  2WWY A;  4RAG A;  1ZLJ A;  5IOY A;  2EZH A;  4XIC A;  5F0F A;  1J9I A;  5KCM A;  3LOC A;  4WXH A;  2VOO A;  5E3L A;  1I6H J;  4B47 A;  2E35 A;  2W82 A;  3SEZ A;  3K4C A;  2B0L A;  2YR2 A;  2KIM A;  4JX6 A;  3W6K B;  3MZ8 A;  1WH5 A;  3HJE A;  1O7F A;  3OIO A;  2KIS A;  2MD0 A;  2VC0 A;  1UHS A;  4RBO A;  4HX4 A;  3WGG A;  3S2H J;  2JVG A;  2X1E A;  3GZ6 A;  2EIN H;  1RRJ A;  3ZGK A;  2X6Y A;  2E2H J;  2OCE A;  4R1H A;  3QYB A;  3CC4 I;  3ZP5 A;  1X1P A;  3BWG A;  4B48 A;  2IEK A;  4OIO F;  1FOK A;  5HVQ C;  2D5V A;  2XDV A;  3VPR A;  2RN7 A;  5JLW A;  1MMG A;  2R92 J;  3AG4 H;  2HVR A;  1QPM A;  1T6S A;  1MIJ A;  3TO7 A;  1HW5 A;  1GT0 C;  3IC7 A;  1ZQ3 P;  5B3S H;  2A3S A;  2F4M B;  1AOY A;  3I55 I;  1OCC H;  1RKW A;  3M1C A;  2F4I A;  3U1K A;  1S5L C;  3KP6 A;  1TW2 A;  1W7P D;  3H5N A;  3TO6 A;  1H88 C;  1IUF A;  5HNH A;  1MNE A;  3WGI A;  4LK0 F;  1SD4 A;  1OMI A;  2PEX A;  1SVL A;  1I3A A;  4XL9 A;  1IRX A;  4ASN A;  4IHV A;  5HDN A;  3KLN A;  3JRF A;  4P55 A;  3C2H A;  3WTY C;  3ISP A;  4LLL A;  2Y0M A;  3JRC A;  3AG3 H;  1QBJ A;  3FKJ A;  4XBF A;  1BIB A;  1ZEL A;  2I8D A;  3BQY A;  3BRO A;  1R6R A;  4PSW A;  4U87 A;  2KQR A;  2LY9 A;  3H9G A;  4UB6 C;  5J4V A;  2DA7 A;  3OYJ A;  2GXA A;  2VOP A;  1MJA A;  4Q4Z F;  2DJI A;  1WRJ A;  1HBX G;  1R71 A;  2Y48 A;  3LSR A;  3HOW J;  2YU3 A;  2UXN A;  1ZTR A;  2VPR A;  3EDP A;  3JCU C;  2L7K A;  4WXC A;  2NOJ B;  2HKO A;  1IGN A;  3KE2 A;  1JTY A;  5CVV A;  4ON0 A;  5M3M J;  2E7W A;  3GX4 X;  1V55 H;  2B7E A;  2OU2 A;  3F8F A;  1ON2 A;  4BNC A;  2QQA A;  2XF7 A;  5J8C A;  2ACJ A;  2GXB A;  2KJB A;  1KU2 A;  3CLQ A;  2R3S A;  3ZMU A;  5DTD A;  1I27 A;  3R6S A;  3TL4 X;  1IW7 F;  1LFB A;  4MTD A;  4XRM A;  2FQ4 A;  2XV4 S;  2WAF A;  3OYK A;  2L54 A;  1OQY A;  4A69 C;  3FF5 A;  1T2K A;  2K9M A;  1ACI A;  5TJJ A;  4EJV A;  2R5Y A;  3R4K A;  4KUM A;  1R22 A;  3G2B A;  2RGV A;  4NC8 A;  1LEA A;  2DW4 A;  1QZZ A;  2A68 F;  4BY7 J;  3G1O A;  4M9Z A;  1I39 A;  2B9S A;  2JMW A;  3Q5F A;  2WY8 Q;  4CDG A;  3WTW C;  4CUG A;  1H9G A;  3QQA A;  3R60 A;  1XMK A;  2HDC A;  2ISY A;  2VLA A;  3ABU A;  4IZZ A;  3F3X A;  4UVA A;  3TKY A;  3VSL A;  1WH7 A;  1R4M B;  2DA1 A;  1QQI A;  5CVU A;  1XTA A;  4P9F A;  4IRI A;  2Q8K A;  1T8I A;  1ETQ A;  1FOW A;  3HEF A;  2V1D A;  2HU9 A;  3S93 A;  4A3F J;  1GVD A;  3V42 A;  2QBY B;  1XGM A;  4XKW A;  1Y1V J;  4IEJ A;  3TBI A;  3CO6 C;  1APL C;  1K79 A;  4KJZ A;  4A3D J;  4GO1 A;  4IHT A;  2DMT A;  3FXQ A;  2M3A A;  1E0E A;  2NXN B;  1PUF A;  2V9K A;  4A0Z A;  3FXL A;  1I50 J;  1ZG1 A;  4NNJ A;  4O3M A;  2E1M B;  4Y4R A;  2XRO A;  3RKW A;  1DPU A;  2GWR A;  2DA2 A;  3HBL A;  3OYH A;  1XDU A;  5GPA A;  3WOD F;  4ETS A;  3EQL F;  3FK6 A;  3PNV A;  4IKF A;  4E7K A;  1MSF C;  3VB2 A;  2E7X A;  3M3Y J;  4Y33 A;  1WI9 A;  2XVC A;  1ZLK A;  4B3X A;  2E71 A;  2L9R A;  4DZJ A;  1FT9 A;  4ENM A;  1RR8 C;  3BJA A;  4H4K C;  2OTL I;  2DFH A;  3FWE A;  4JK1 X;  2R7X A;  4HZF A;  3JAM K;  1XSX A;  2ZXI A;  2HYF A;  3N97 A;  2GQQ A;  2FF4 A;  5F1R A;  3E6D A;  4BU2 A;  3ABK H;  1TC3 C;  1WJA A;  2M0M A;  5GP9 A;  2IS2 A;  1TW3 A;  4WX9 A;  3BPX A;  4A6E A;  3JTH A;  2ELH A;  4XM3 A;  5D5V B;  3BZ6 A;  1IAW A;  1B1B A;  1TT0 A;  3DQV C;  5HS7 A;  1QVU A;  1RI7 A;  5B66 C;  4I98 B;  2H94 A;  3S2D J;  4IHX A;  3GZ5 A;  4BXU A;  2XAU A;  1T08 B;  2RKH A;  2R7Q A;  1JTX A;  2GOX B;  4P5O A;  4L0Y B;  4KIT B;  1CGP A;  4HNU A;  3T5X A;  5KHD A;  3TMO A;  2M7A A;  4NQW B;  4XLN F;  3MKZ A;  3L2Q A;  3H9Q A;  2L2O A;  1L0O C;  3JRA A;  2VQG A;  2QKM B;  2JWT A;  3TQN A;  1Z3X A;  4MO7 A;  1E2X A;  2EB7 A;  2ZME A;  1DP7 P;  3H0G J;  1ETX A;  2WC2 A;  5CKT A;  3I58 A;  2E1M C;  3I54 A;  4MTE A;  5IT9 Z;  4OIQ F;  2MH2 A;  1XGN A;  3SDG A;  2ICW G;  4U0V A;  3B6C A;  1X1D A;  2H6C A;  3DCF A;  2WA0 A;  3P9C A;  5FFX A;  2XAH A;  1T38 A;  2IJL A;  4D7N A;  1BL0 A;  5EGO A;  2ZXH A;  2P6T A;  3WHB A;  3F6V A;  1G3S A;  2COB A;  1FBQ A;  2VJI A;  2GM4 A;  3V7C A;  3M7G A;  1XS9 A;  5ILS A;  2FSW A;  3BOQ A;  1FWZ A;  2BXZ A;  1MBG A;  3K4J A;  4LLN A;  2HVS A;  1IDY A;  2ZNZ A;  2XPW A;  1S7O A;  3CME I;  1YRN A;  4KA4 A;  2VPL A;  1ZG5 A;  5K5Q A;  3SFZ A;  2CO5 A;  2P4W A;  3U21 A;  4DBQ A;  4KMF A;  3LNQ A;  2P7V B;  3RPU A;  3PSI A;  1WQ2 A;  1LB2 A;  1FYK A;  3S3N A;  3GW2 A;  4MEX F;  2FE3 A;  5DD4 A;  2M4G A;  4M3E A;  3HXL A;  3W2V A;  4YFN F;  2L3D A;  1JUS A;  4JX5 A;  2XAF A;  2HPI A;  1HQC A;  3RTR A;  3BTC A;  4A93 J;  4HST A;  3DU6 A;  1IV8 A;  1ZGW A;  5FRO A;  3WG9 A;  5C3E J;  4DBR A;  5EZG A;  3HZJ A;  2QSG X;  5H2F C;  4BDY A;  3JW4 A;  1O3T A;  3ZMS A;  1QU3 A;  1KYZ A;  1UST A;  4XRF A;  2EWN A;  1XGO A;  1DDN A;  3R0J A;  3DLA A;  3F9K A;  1VQ4 I;  4LLG F;  1KQ0 A;  2GOM A;  3GTM J;  1E17 A;  2V6E A;  1SVM A;  4DW6 A;  4PDK A;  1JHF A;  2DDA A;  3VSK A;  1V5E A;  5J3L A;  1SC7 A;  2P5V A;  4V2G A;  4IJA A;  3E6C C;  3TP0 A;  5LHG A;  2HZT A;  3A01 A;  1BI3 A;  3SYT A;  1Y56 A;  5EG0 A;  5D6F A;  4D5C A;  4I7H A;  5F27 A;  2QEN A;  2LVS A;  3LAJ A;  2XB0 X;  2PMU A;  2VON A;  1NK2 P;  1U5T B;  3E3V A;  1B9N A;  5E18 F;  3DTK A;  4EAT A;  2VJ5 A;  1FLI A;  3IP4 B;  3I4N J;  3S15 J;  2IS4 A;  1Z77 A;  3KCC A;  4HG2 A;  4N0B A;  3C3W A;  3ABL H;  3WHC A;  3BZC A;  5KK1 A;  4D9J A;  1R00 A;  1DGW Y;  4LIT A;  4X6A J;  3SHF A;  4QPQ A;  3KZI C;  2CQN A;  1B72 B;  2VXD A;  4XN0 A;  4A5M A;  2EZK A;  3JRD A;  1IF1 A;  1KU3 A;  4BQO A;  1YX3 A;  1T33 A;  3TO9 A;  2DA5 A;  3J7Y J;  5E1W A;  4Y52 J;  1ZR4 A;  2F5C A;  1UMQ A;  1ETV A;  5FLM J;  2ZJ2 A;  4CCK A;  3BZK A;  3GTQ J;  5K5R A;  2NNN A;  5FKN A;  1FBU A;  5BPD A;  1YFH A;  1LNW A;  3A0H C;  5LGN A;  2A5W A;  4N9H A;  2FBH A;  1VQM I;  2HTS A;  4B1R A;  4AIJ A;  2DLL A;  4IPA A;  5KVR A;  1RUO A;  4V19 K;  4FQG A;  4MLO A;  4PFO A;  4UNO A;  5CVR A;  2PMZ N;  4RB1 A;  2NVX J;  2CUF A;  3DKW A;  1QRY A;  2JTV A;  2CW0 F;  3ASN H;  3JRE A;  4UUV A;  1JT6 A;  1SAN A;  3HUG A;  2MA3 A;  4R79 A;  2P0W A;  1U5T C;  1OKR A;  5F04 A;  1K78 A;  4A3I J;  2STT A;  3ZQI A;  3HHH A;  1LUJ B;  3K0L A;  2NYX A;  4RGX A;  3FBN B;  3KEQ A;  3HKZ N;  1P4X A;  2F6C A;  3WE3 A;  2COM A;  4QIW N;  2ME0 A;  4ZC3 A;  3CCR I;  5FKO A;  4G7O F;  2PFB A;  3LA3 A;  2E2I J;  2M45 A;  2QSF X;  4HX8 A;  5CVJ A;  2BYV E;  3D5R C;  1B59 A;  3H1C A;  5E3M A;  2Z33 A;  1R49 A;  4I2O A;  4IL6 C;  4MEY F;  1H89 C;  4CH7 A;  2HDD A;  2L4M A;  3H0D A;  2GLO A;  1LFP A;  2BY0 A;  1STZ A;  4Z2Y A;  1VQ8 I;  5K1Y A;  3DU5 A;  4YFK F;  4UUS A;  1S8N A;  1W7P A;  5DUI A;  2J5P A;  5ERI A;  4KIG A;  3CO7 C;  2IPQ X;  4MFD A;  3S8P A;  1H8A C;  5D8L B;  4XQF A;  2LC2 A;  4Y3O A;  3IRQ A;  3N05 A;  4G6T B;  4F7Z A;  2C6Y A;  1HA8 A;  3OOU A;  1IRG A;  3RI4 A;  2GBY A;  2LY2 A;  1D5Y A;  1CQT A;  4BBR J;  3A4C A;  2MLG A;  1I5Z A;  3L2C A;  1YG2 A;  5EF6 A;  2HKX A;  1V5G A;  4A3C J;  3V7R A;  2OQR A;  4KN7 X;  3WTV C;  3BLY A;  4Q5S F;  2O61 A;  3F21 A;  2OTJ I;  2VIX A;  2XUB A;  5AIP A;  5A2Q K;  1O3R A;  1R1V A;  5F64 A;  1ZK8 A;  3C1D A;  2YX7 A;  5FGM A;  2DDB A;  4HYE A;  2MC3 A;  3BC8 A;  5LLQ A;  1WJF A;  2QKL B;  2Z99 A;  2MC4 A;  4XKB A;  3DP7 A;  3JAM Z;  1KON A;  1JGS A;  2F5V A;  1ZAO A;  4HF2 A;  1EF4 A;  2WAQ N;  2X1C A;  2V1N A;  2PI0 A;  3HRU A;  5FO5 A;  2A6H F;  3OR2 C;  2Q2E B;  5C44 J;  3FXR A;  2VT3 A;  1XDS A;  5GTI C;  4F92 B;  3ZPL A;  1JJ8 C;  2AQF A;  4E7H A;  4A3G J;  2VQL A;  2ZC2 A;  3HB9 A;  2ZFW A;  3EUH C;  2V1X A;  2MD5 A;  5F0H A;  4CYC A;  3CCE I;  1BW5 A;  4F3Q A;  2RQQ A;  2W00 A;  3DLL F;  3JRB A;  2FUG 2;  3Q9V A;  2LG4 A;  1IC8 A;  1HKT A;  4LB5 A;  1P7J A;  2X48 A;  4RB3 C;  3GTO J;  2L01 A;  1Z1D A;  1VQ7 I;  2P8T A;  1GHC A;  2F48 A;  2K9L A;  4OIP F;  2E34 A;  3MCZ A;  4LIV A;  2JRT A;  3HOY J;  1ODD A;  4DNC A;  2WY7 Q;  4M6Y A;  2Y2Z A;  3IUO A;  1WJC A;  3BCB A;  4ZYE A;  3IAS 2;  3CES A;  3TW7 A;  2OC6 A;  2X0L A;  2YUS A;  3JRI A;  4HRI A;  1DP3 A;  3D5S C;  2DBB A;  3LSM A;  3UKG A;  1MMA A;  2VUM J;  4ESJ A;  1KU7 A;  3QP6 A;  1FX7 A;  4BE0 A;  2XSJ C;  3DEE A;  3IRR A;  1IN7 A;  3PSF A;  4XOP A;  1LPQ A;  3KYC B;  3RYP A;  1FTT A;  3QOP A;  4XKC A;  1WHU A;  5LBQ A;  4CA0 A;  3DWL E;  4XLH A;  2V7F A;  1S9H A;  1T0F C;  1PJR A;  2AXT C;  2IVM A;  1FYL A;  3X2Q H;  5CQG A;  4Z6Y A;  4O5V A;  4XSZ F;  2VJJ A;  4XOT A;  1TP4 A;  2WB1 N;  4UXN A;  3TED A;  1G8X A;  1MDM B;  2QWW A;  5D5U B;  2QM3 A;  3HIF A;  3FX3 A;  1MBE A;  5E1X A;  2RC4 A;  2WTE A;  1DQU A;  4GCV A;  2LF7 A;  1TWC J;  1LDJ A;  4WK8 F;  1YS6 A;  2P7C B;  4AYB A;  2KDO A;  1WGX A;  1E3H A;  4LB6 B;  2CQX A;  2K9S A;  3K1P A;  3U1D A;  3K69 A;  4L5I A;  1EH6 A;  1ITY A;  3QRF F;  2X85 A;  3J7A Y;  2UWM A;  3CCL I;  2JA7 J;  1PP7 U;  5DCM A;  4PJN A;  3OIP A;  2HYG D;  2L9N A;  2XAQ A;  4KDP A;  5J4Y A;  1OR7 A;  2ECC A;  2NOG A;  1FSE A;  4UB8 C;  3UNG C;  2ECB A;  3A0B C;  3E5Q A;  4DIQ A;  4NHJ A;  2XPV A;  4U7D A;  3BR6 A;  5CVI A;  5J1U A;  1R5H A;  1UCR A;  1X19 A;  2HWV A;  5M5W J;  3G1L A;  4B09 A;  2LP0 A;  2O0Y A;  3JRH A;  1UFM A;  1O57 A;  1UHW A;  2VJ4 A;  3ABT A;  2DO7 A;  3FHN A;  1OYW A;  1R23 A;  3J80 K;  4B44 A;  2KL4 A;  3CCV I;  2W24 A;  2DOF A;  5IP6 A;  1SD6 A;  2YS9 A;  1YW7 A;  3H3V K;  1MJ9 A;  2Y0S N;  2R5Z A;  5HDK A;  1BJA A;  4V2F A;  1W4M A;  2JSP A;  5DEQ A;  4XK4 A;  3OOP A;  4PJJ A;  3ONQ A;  5GPC A;  5CPR B;  4LOC A;  1VI0 A;  2P5K A;  2W84 A;  3ZMT A;  4E6K G;  2Q1Z B;  1MMD A;  3BPV A;  2DOA A;  4IRH A;  4CHU A;  1TQI A;  2DMN A;  1RIO H;  2KPM A;  2KP6 A;  1SFX A;  1USS A;  3ELK A;  5J47 A;  3KYD B;  2XRN A;  5BNG A;  2BZT A;  3GF2 A;  5FD5 A;  1U8B A;  1ZGA A;  3CMM A;  4PSX A;  3R61 A;  2HOT A;  2DU9 A;  2Q0O A;  4UV9 A;  4A0Y A;  3FKI J;  3N4M A;  2RVC A;  4NDL A;  2QCO A;  1P7I A;  5IPA A;  5KAF C;  1XCB A;  2OBP A;  4NBQ A;  3B02 A;  5ICC A;  5DDG A;  2XPU A;  2TDX A;  3T1B A;  2Y30 A;  2V9P A;  2HFH A;  3WU0 A;  3A02 A;  1R36 A;  1Z91 A;  2LK2 A;  3DEW A;  1WPK A;  5LFA A;  4M71 A;  5IT3 A;  4I6Z A;  2JQ7 A;  3LQQ A;  5E3N A;  3RJP A;  2GA2 A;  2V79 A;  2B63 J;  3LFU A;  1H0M A;  1KQ9 A;  1G3W A;  3GFM A;  3P9K A;  5EZH A;  2FD5 A;  3H3Z A;  3GTL J;  3S16 J;  3FIS A;  1ZN2 A;  3CDH A;  2AO9 A;  3I9V 2;  1X1C A;  2H27 A;  2AS5 F;  1UG0 A;  3CP8 A;  4C3H J;  2CV2 A;  3C18 A;  2QSH X;  1MJB A;  3I71 A;  2UUZ A;  2XRL A;  3SZG A;  4X0G A;  4DYQ A;  2A6T A;  1FMW A;  4MHG A;  4RMN A;  5EDN A;  5LD2 C;  3S2W A;  1SFE A;  2HNH A;  4P96 A;  2Z2S B;  1IZ1 A;  2VT2 A;  2X9D A;  4GYI A;  3OS0 A;  1OCP A;  2LFB A;  5FKM A;  4XLF A;  1YJW I;  4U7B A;  1X1B A;  4ZZL A;  4BL0 B;  1GVJ A;  1HW2 A;  5D5X B;  1F5T A;  2KIQ A;  4LJZ F;  1MNM C;  2ZSH B;  2L4A A;  4NC7 A;  4BE2 A;  3VYT B;  2MFZ A;  1J0R A;  5H6R A;  1U6G A;  3MN2 A;  2JA2 A;  2PLY A;  5IOZ A;  3KYL A;  3H3U A;  3WU2 C;  2W7N A;  4I76 A;  3CDL A;  3HSR A;  3U2R A;  1TNT A;  4XMY A;  5K7H A;  2PMH A;  2JRM A;  3H5A A;  2CW8 A;  1XD7 A;  3GZN B;  3D1N I;  2NS8 A;  4AC0 A;  1WJE A;  2EFN A;  2LKX A;  2HQ5 A;  1X3U A;  3MMY B;  5A2Q Z;  1YYV A;  3S1R J;  1JT0 A;  3NAR A;  2BXY A;  3NRV A;  1Y6I A;  3TGN A;  4HV5 A;  4XN3 A;  4EJU A;  2EA2 A;  2LSO A;  5D5W B;  2V26 A;  4M9S A;  4BXX J;  3P5J A;  1W0U A;  4ENJ A;  5DM6 F;  3CC2 I;  1JUM A;  1W1W E;  3C7J A;  4EJT A;  1IXC A;  2DYS H;  4PK4 A;  3VOE A;  3OSF A;  4G7H F;  2NAZ A;  2BW3 B;  1AU7 A;  5DS9 A;  2IA2 A;  3RPQ A;  4BXF A;  2W25 A;  4MQ9 F;  4CO8 A;  5B5E C;  3SXY A;  3F22 A;  1O3Q A;  2H8R A;  3BR2 A;  4RLQ A;  3GTK J;  2BY1 A;  3C2B A;  2KZV A;  1X4P A;  3QU6 A;  4IHS A;  2YU9 J;  2JK3 A;  4M72 A;  3L9F A;  3DBL B;  2M8E A;  3CMA I;  3DKY A;  3TP3 A;  1XB4 A;  1IUY A;  2E5Z A;  3SQN A;  2X6O A;  1YJN I;  2ZBK A;  1OYI A;  2WAQ A;  4YII A;  3VWB A;  2DPD A;  1VND A;  2K4J A;  4G94 A;  2G7H A;  3M8E A;  4ZTJ A;  2M9H A;  1ZRE A;  5JVT A;  1BI2 A;  1YLF A;  1XPX A;  1WKM A;  1VQP I;  4EJO A;  3COA C;  1TWG J;  4DQ2 A;  1MSE C;  1Y1W J;  2QEX I;  4RDU A;  2IS6 A;  4A3E J;  1RZ4 A;  1SMY F;  2UV1 A;  3H35 A;  2EK5 A;  3K1N A;  2ME6 A;  4OWR B;  2XGD A;  1G59 A;  4YIR X;  2DFI A;  2MBF A;  3MD2 A;  3HTS B;  1FIA A;  1HDP A;  1D1C A;  3H5R A;  4BQA A;  2RDP A;  4C2T A;  2EPF A;  2ZME B;  2CWE A;  3FIW A;  3VDX A;  4M74 A;  3BR3 A;  1TWH J;  2OZ6 A;  4OU0 A;  4GFB A;  2R7Z J;  3FK7 A;  4AM3 A;  2E60 A;  2XAJ A;  2QBY A;  1VZ0 A;  4E7I A;  2E36 A;  4UVB A;  5IP7 J;  2ZSI B;  1Q1V A;  4Q47 A;  4C3J J;  3CUO A;  1YS7 A;  5IY5 H;  3I3L A;  2FMY A;  2JSC A;  4XLC A;  4IO9 F;  4X1E A;  5EGO B;  1O3S A;  2MSY A;  3BR1 A;  3ZRG A;  3HDD A;  1QNT A;  2QQB A;  1LE8 B;  1BOB A;  4S0H B;  2R7F A;  3K2A A;  2CUZ A;  3VYS B;  1TLH B;  3K4M A;  3F8B A;  4U0W A;  2D1H A;  1XSD A;  2H8W A;  4ZYA A;  2WB1 A;  4BY1 J;  4WWC A;  1BA5 A;  2FBK A;  1JE8 A;  4BQQ A;  5ICG A;  4HSR A;  5GAD J;  2QYO A;  1P4W A;  1GXQ A;  1O7L A;  2EFQ A;  2FU4 A;  2M2E A;  3EET A;  1OCR H;  2EIJ H;  3TW6 A;  2W4S A;  3HRM A;  4BHP A;  4A3L J;  5B1A H;  4IOA F;  3FDY A;  4XSX F;  3JSO A;  2IW5 A;  1FP1 D;  3NAU A;  2ZME C;  1KGS A;  1BC7 C;  3FMR A;  5FLX K;  2K27 A;  3I4P A;  3BTJ A;  5C4J J;  5L3B A;  1X58 A;  1HXD A;  1Z67 A;  3BCA A;  5GTH C;  2BEO A;  3W3C A;  4FHT A;  2MG4 A;  3HRS A;  4BQN A;  3WTZ A;  3J80 Z;  4HDV A;  2NVT J;  4AID A;  2CYY A;  3PUF A;  3OIQ A;  1LFU P;  1XGS A;  1AKH B;  3DF8 A;  4JBA A;  4C2U A;  4FX0 A;  1BI1 A;  2CFX A;  2IS1 A;  3DPT A;  1J7K A;  2JPB A;  2JUC A;  3RYR A;  2RAE A;  2F4O B;  5EYR A;  2RV8 A;  1R1T A;  5LRS A;  2CQQ A;  1XN7 A;  4D7M A;  3S17 J;  5LGU A;  1T98 A;  5FB2 A;  2RRE A;  1HKQ A;  4MQV A;  1B6A A;  4U0Y A;  4D1Q A;  4RAY A;  5L3E A;  4UY8 I;  4IRG A;  1F36 A;  5LGT A;  4M9X A;  3ZXS A;  1Y39 A;  2Y0S A;  5TIS C;  3KLO A;  1Y8Q B;  2CV1 A;  2OUM A;  4GRI A;  4KN4 X;  4RGU A;  2NRA C;  3ZQL A;  1TL8 A;  1QGP A;  3DPU A;  4P1W A;  2DT6 A;  4ITV A;  4D5F A;  3PFY A;  2A5Y B;  1FTZ A;  1FNN A;  3LA2 A;  3GFJ A;  2ID6 A;  2O5R A;  1U8R A;  2LYC A;  2M8G X;  3KP4 A;  4EGY A;  1JI8 A;  2KMU A;  3GFL A;  4A3M J;  3A03 A;  5J8F A;  5E8I A;  4Y7N J;  1UB9 A;  2DK5 A;  4M73 A;  5HS9 A;  2JJ7 A;  3S1N J;  4WXD A;  4E70 A;  4YG2 F;  3M1E A;  4BAY A;  3L2U A;  1X3W B;  4H0E A;  2DOD A;  4N4N B;  3KET A;  3LAP A;  2V9V A;  5TRD A;  1ETY A;  1A6I A;  5AON A;  3U9G A;  1TBX A;  3GEZ A;  2M5W A;  1MND A;  2DJN A;  3ZQ7 A;  3BTL A;  3PO2 J;  3QAH A;  1BOA A;  5IYC J;  2P81 A;  2K40 A;  1D8K A;  2VN2 A;  5BQT A;  2DFF A;  3T0Y A;  3ZQF A;  2NVQ J;  2VBW A;  1Z0X A;  3HUG B;  3ULQ B;  1BW6 A;  3AL0 C;  2RNJ A;  3RSN A;  4RA2 A;  5BOX A;  2LH9 A;  3P9I A;  1CF7 B;  4I99 C;  4OIR F;  1W5C C;  2RQP A;  1V5F A;  3DKX A;  4QLC U;  1YE9 A;  4ABZ A;  3I56 I;  1H9T A;  3PNY A;  4I0A A;  1J75 A;  5FRM A;  3BP8 A;  2FBI A;  1WI3 A;  4RGR A;  4CCL A;  3QOD A;  3H92 A;  4IVN A;  5FJ8 J;  3CLO A;  2IGN A;  2KZG A;  3E6B A;  2L5Q A;  3CQZ J;  2EFW A;  3V8K A;  4JOM A;  2LF8 A;  2PN6 A;  3BJO A;  4NUB A;  2K4B A;  4A12 A;  4KT6 A;  2VOD A;  5E17 F;  2K7L A;  2R7D A;  1MBK A;  4L9N A;  4A3K J;  3TOA A;  3E6M A;  1I1G A;  3DBR B;  4WF2 A;  2F5F A;  1U2W A;  3I4M J;  2F5E A;  2DCE A;  4LIU A;  4S04 A;  2FA5 A;  2K02 A;  4BHC A;  1TWA J;  3L1P A;  3C2G A;  2JA5 J;  4M3F A;  3G71 I;  2AHQ A;  2CQ7 A;  1B72 A;  2LMD A;  4L5E A;  1MZB A;  1I1S A;  1NG7 A;  3I59 B;  5LEK A;  1OLT A;  4HLX A;  1IG7 A;  3PO3 J;  2O9L A;  3PIP F;  2Z9O A;  1IRZ A;  4AVP A;  2EBI A;  3M9A A;  2K85 A;  1J5Y A;  1OPC A;  1D1B A;  3MQ0 A;  1MMN A;  3RCO A;  3VYU B;  2DK8 A;  1G6N A;  4B43 A;  2CW7 A;  5HLG A;  3SFI A;  3FMQ A;  3OR1 C;  3BG9 A;  3GBG A;  4C3I J;  4XKV A;  2OCC H;  3MKY B;  4YEJ A;  3O3K A;  2CU7 A;  2VQC A;  1RNL A;  4KIF A;  2Y31 A;  4MFE A;  5JI6 A;  1R9T J;  1F1Z A;  1N77 A;  2ZCW A;  3QP5 A;  2VBX A;  3T8T A;  3HG9 A;  3KX2 A;  1Z6R A;  3HM5 A;  5E3O A;  2VB6 A;  1QVT A;  4GYG A;  1K6Y A;  3BTI A;  1XCV A;  3K6G A;  4K2E A;  2HDW A;  3GUD A;  4W1U A;  3L2V A;  4LK1 F;  1MH4 A;  1KU9 A;  3S32 A;  2OAZ A;  2PJR B;  3G6E I;  4BE1 A;  5J1Y A;  5M3F J;  1YO5 C;  5F08 A;  1TTY A;  4II3 A;  1DU0 A;  2A07 F;  1Z3Y A;  3Q0V A;  1YX5 A;  2TRT A;  2KIF A;  1VTN C;  2XF6 A;  1XG1 A;  3O2P E;  3GTJ J;  4RM3 A;  4O6J A;  3EYI A;  3RZD J;  4HQE A;  1GUU A;  3HTU A;  4Y17 A;  5BS6 A;  1TWF J;  2ESN A;  4KYW A;  2KHM A;  3E5U A;  3ZR8 X;  3DTI A;  3GLL A;  3IHU A;  2K86 A;  3KZY A;  4DOZ A;  4QTR A;  4KFC A;  3RZO J;  3CCS I;  4G8X A;  3EUH A;  2HQN A;  4RB0 A;  2KRF A;  2LKS A;  1IN5 A;  1YHQ I;  2O6G E;  2IXS A;  1X2M A;  4ENK A;  3DTE A;  3GCM A;  4XRS G;  3FM3 A;  1U3E M;  3QWL A;  4BS9 A;  5JHF A;  3OV8 A;  5JR3 A;  5DUK A;  3ZCO A;  4E7S A;  1MBF A;  2VL8 A;  1LJ9 A;  3IV5 A;  2DTZ A;  1ZRC A;  4DZP A;  3F72 A;  1RC9 A;  1X3Z B;  2O03 A;  2ZNY A;  1IN4 A;  1NK3 P;  4L18 B;  2DTR A;  2FQ3 A;  2EV0 A;  3M8J A;  1GV5 A;  4HQM A;  2CJJ A;  3HSE A;  3T8R A;  3V4G A;  2FRH A;  3OYM A;  1IJW C;  4AWX B;  3OYF A;  3HOS A;  4CZZ A;  3CCQ I;  4LG0 B;  3KIO A;  1A04 A;  2FOK A;  1ON1 A;  5CJ9 A;  1WJ5 A;  3B73 A;  2VBZ A;  2ELJ A;  2ZB9 A;  5IP9 J;  4DYR A;  3PJR A;  1QHG A;  1WCM J;  3OYC A;  3G73 A;  3RDI A;  4FE4 A;  5L3C A;  1SEU A;  1JKR C;  5L3G A;  2LBF B;  3RPU D;  4OMY A;  1N75 A;  1G2H A;  1LKX A;  4CCJ A;  2Q2E A;  1YI2 I;  2ZJP F;  5M5Y J;  3F8C A;  3NWS A;  4E7L A;  4PJM A;  1LVK A;  5FLX Z;  1Z21 A;  2K5C A;  3CUQ A;  1K4S A;  2E1C A;  1HKS A;  2EQR A;  3S3O A;  5E1Z B;  2V6C A;  3VOD A;  2WAE A;  1UHM A;  1HW1 A;  2FJ1 A;  5KNL A;  4PUS A;  1Z6T A;  1IO2 A;  2LY1 A;  1WVR A;  4UUT A;  3E7L A;  3M07 A;  2XC7 A;  2MAB A;  1E3O C;  2N8G A;  3M8F A;  4DGW B;  5L3F A;  1LEB A;  1P92 A;  3IKT A;  4HBL A;  2EV5 A;  2Z5U A;  3IWF A;  2VKH A;  3PFI A;  2GIZ A;  3LSG A;  2HGC A;  1P4A A;  4ZYD A;  1R5I D;  5L3D A;  2DMU A;  3HPH A;  5E79 C;  2DN0 A;  2FOW A;  1VQN I;  2CQK A;  5H6Q A;  1HDD C;  1SD7 A;  3H9J A;  5M5X J;  3ABM H;  1S7E A;  1BI0 A;  2DT7 B;  2QGU A;  4BJT A;  3FHZ A;  4B4C A;  1Q1H A;  1WJD A;  3SZT A;  3ZMV A;  2CV0 A;  2VI6 A;  2G0E A;  3K70 C;  3E5X A;  2CUE A;  1MDM A;  4L9T A;  3ERM A;  2BGC A;  3E0J B;  3HYI A;  1KZH A;  3CD6 I;  2HR3 A;  1YOV B;  2PX9 A;  4IQ4 A;  2IRF G;  2GIV A;  1S3J A;  1B8I A;  3IH2 A;  4M3G A;  1UZC A;  1RUN A;  5ICF A;  5K7F A;  4YFX F;  1A36 A;  4A3B J;  3HOX J;  3NQO A;  3PIO F;  2XF5 A;  2XHK A;  2MYS A;  2UXX A;  3BG7 A;  4OIN F;  3QU3 A;  1RES A;  3A1Y A;  4I0B A;  4FCY A;  2YPR A;  1OR7 C;  1QA6 A;  4FE7 A;  2DA3 A;  4II2 A;  2L7F P;  4RS8 A;  2EZL A;  2EIL H;  4HLY A;  5DV5 A;  2Z16 A;  5CQE A;  4L9V A;  1D1A A;  3OY9 A;  5JVG F;  2V4J C;  1REP C;  5CYV A;  4BEH A;  1K7A A;  3QYE A;  2D45 A;  2OA4 A;  3GME A;  3IH3 A;  5J1R A;  1SFK A;  4JP0 A;  2VKE A;  3FZV A;  4HW0 A;  4ZDP A;  2DYR H;  2HS5 A;  1XMX A;  1K83 J;  3PQJ A;  4RB2 C;  3HC7 A;  1X2N A;  4KT5 C;  3L09 A;  3E1S A;  2ZJQ F;  3RQ4 A;  1ETO A;  4DJA A;  3CZ6 A;  3HRT A;  1C0W A;  5GAG J;  5B1B H;  9ANT A;  1YJ9 I;  2JVH A;  2GXG A;  2XIG A;  4EV0 A;  4HA8 A;  2QQ8 A;  4F93 B;  2QF7 A;  6PAX A;  3KZZ A;  3CCM I;  3BG3 A;  2HQR A;  1RPW A;  4EMS A;  3KP3 A;  2OV7 A;  5FKL A;  2PG4 A;  2BHY A;  3DFG A;  4WCG A;  3REO A;  1VF9 A;  4OAY A;  5GAH J;  4HNV A;  1N25 A;  1K4T A;  2QLZ A;  1O4X A;  1XC5 A;  2M1B A;  4HPQ A;  4OAZ A;  3ZQC A;  2JN6 A;  3HSF A;  1VQ5 I;  3FXO A;  2E2J J;  3OYA A;  5FLV A;  4N9I A;  5ILV A;  3TDU C;  4FET A;  2O8K A;  3K4L A;  2PMZ A;  3Q0U A;  4AU7 A;  1ZR2 A;  3FXM A;  1DPR A;  3KPH A;  3D5L A;  4ZYG A;  5FD6 A;  2X6X A;  3KP5 A;  3ROU A;  2EIM H;  2K3F A;  3MWM A;  4B3A A;  2R7T A;  4G7Z F;  2LKP A;  1HC8 A;  2L9S A;  1B4A A;  4GXO A;  2R5Y B;  1G3Y A;  2JPC A;  1D0Z A;  2X6W A;  2Y69 H;  4JX4 A;  2CMP A;  1OJL A;  2VAS A;  1I3Q J;  4M6X A;  4N4O B;  3K4N A;  1F4K A;  2H1K A;  3FXK A;  3HKZ A;  4RLF A;  4XLP F;  4I01 A;  4LGW A;  2R7V A;  3E97 A;  4CCM A;  1DUX C;  2IA0 A;  3EUA A;  1I6X A;  1U0J A;  1F9N A;  1R4N B;  2ZXW H;  3DEU A;  2QUF A;  2XGX A;  1FBS A;  2D2W A;  4BAC A;  2WV0 A;  3OS1 A;  1KA8 A;  3CCY A;  2HOA A;  2QZ8 A;  1W36 C;  2ADU A;  2RNG A;  2R93 J;  1WSU A;  3HPG A;  1SFU A;  1UEL B;  3BR0 A;  2HTJ A;  2A6E F;  5DM7 F;  2BVM A;  4HOB A;  1Y0N A;  2DFE A;  2L0K A;  3PNT A;  5LHI A;  1SFO J;  3AG2 H;  1WFX A;  2ZFU A;  1LVA A;  4C2M J;  5ILU A;  3HGG A;  2PBI A;  1R58 A;  2IP2 A;  5BMZ A;  4EVI A;  2XB5 A;  4KNY A;  2XGE A;  3GTP J;  3HOT A;  2R0Q C;  2KLO A;  1PUF B;  1P9Q C;  3OL3 A;  2XKO A;  3DV8 A;  4IX7 A;  5E8G A;  4XRS A;  1SMT A;  2OD5 A;  2R7R A;  3OMY A;  4LFU A;  2BY2 A;  1J2X A;  4CIC A;  3J7A O;  2OF7 A;  4BKX A;  2ELK A;  1D0Y A;  4BH9 A;  1QZE A;  1M1E B;  2OQG A;  1HLV A;  4KIB A;  3ERE D;  2BE5 F;  1AWC A;  2HQA A;  4I09 A;  2X51 A;  2XAG A;  1LQ1 A;  2HXI A;  4IQJ A;  3OS2 A;  3LSK A;  4R8H A;  4AUX A;  1BM9 A;  1EKE A;  4FT8 A;  4FTH A;  2IGK A;  4G6Q A;  4ZJZ A;  1T95 A;  3VYR B;  2MH9 A;  4BUP A;  1VFC A;  4L9J A;  2R7S A;  2VXZ A;  2CSO A;  3UR3 C;  1IDZ A;  1X4O A;  1OFC X;  5DCF A;  3OYI A;  1VQ6 I;  3SDB A;  4FIS A;  1GXP A;  2EV6 A;  4UV8 A;  5IYD J;  1A6Q A;  5F1J A;  4PGG A;  4AIK A;  2ZO4 A;  4BDZ A;  4HEA 2;  4LMY A;  3CP2 A;  3GWZ A;  5EJC A;  1OYY A;  1W5S A;  2K9Q A;  3K4B A;  1RR7 A;  1BJZ A;  1HST A;  2D1V A;  2O8X A;  5ED4 A;  3J81 K;  1ZYR F;  3AFH A;  2P6S A;  4L0Z B;  3IKV A;  1SAX A;  4ESB A;  3R0A A;  1ETK A;  2CRG A;  4DYC A;  2HEO A;  3LSP A;  3GVA A;  3CF5 F;  4CCN A;  4JQF A;  1KYW A;  2BW3 A;  2LNB A;  1JHH A;  3LSH A;  2BOL A;  1QPI A;  3JTG A;  2CS3 A;  5HLH A;  4P9U A;  4IXA A;  1Z9C A;  3F8N A;  3LA7 A;  1YIJ I;  2XGC A;  3M4O J;  2Z3Y A;  4CCO A;  3ML6 A;  4PCQ A;  3DPL C;  1MH3 A;  1ZRD A;  4IOC F;  1YIT I;  1JKP C;  1FOX A;  3K70 D;  2K3P A;  3L00 A;  5K5O A;  4AIH A;  2E5N A;  2OPT A;  2W57 A;  1BIA A;  2V1U A;  5LHH A;  1FC3 A;  2FNA A;  2Y75 A;  2HXO A;  2GZW A;  4UVC A;  2L7M P;  4G9Y A;  3WU1 B;  1MD0 A;  5KAI C;  2L7Z A;  1RKT A;  5K7Z A;  4IHW A;  3RKQ A;  1FMV A;  3V8J A;  4C9Y A;  2NVU B;  1A5J A;  4J01 A;  4HF0 A;  3ZMZ A;  2AQE A;  2LRE A;  3S3M A;  4Q48 A;  3WTX C;  3B6A A;  1VQO I;  1YRN B;  2CGP A;  4EQQ A;  3FM5 A;  3QYF A;  2YX4 A;  2ESH A;  3LMM A;  3S1Q J;  1IV6 A;  4BJ5 C;  4YEL A;  2FX0 A;  4EM2 A;  2A69 F;  4Y15 A;  3RQI A;  2H1L A;  1DU6 A;  2K9N A;  2EFO A;  4RM2 A;  5EEG A;  2R7U A;  1VQK I;  4W97 A;  3OYG A;  2IAI A;  1V4R A;  3JSP A;  2G9W A;  5JLX A;  5LEJ A;  2KRH A;  3WTS C;  2KT0 A;  2DOE A;  1GV2 A;  2LLK A;  1FPQ A;  2VKV A;  1HF0 A;  5ICE A;  4F55 A;  2M30 A;  1WJB A;  2NNY A;  5HDG A;  2HPM A;  4LD5 A;  1V3F A;  2R4G A;  1JXS A;  2VC1 A;  1R7J A;  3QOE A;  3ZOB A;  1PDN C;  1TQP A;  4NQW A;  1JKQ C;  2EZI A;  2EA4 A;  3K7A J;  1D0X A;  3GYH X;  4J00 A;  3L2R A;  4EM0 B;  3V8L A;  4IHY A;  3A01 B;  3BQZ A;  3OYB A;  1DGR M;  1LE8 A;  2LRD A;  1U9O A;  2DMP A;  5EG0 B;  4XID A;  3MFK A;  2XKP A;  1FY7 A;  5DYM A;  2KDZ A;  3AL0 B;  4HX7 A;  1YQA A;  1HOM A;  2TCT A;  4AYB N;  1ZAR A;  2W48 A;  2CH0 A;  3GFI A;  1PP8 F;  1ULY A;  4QWQ A;  1R5G A;  2BBY A;  3JR9 A;  2NVY J;  3SEQ A;  2L02 A;  3K4K A;  2OJE D;  2KFD A;  2G7U A;  5D8K B;  1Z7L A;  2DI3 A;  1MMS A;  4G12 A;  4HDU A;  3KEY A;  2CFO A;  5HOO A;  5EEA A;  5LRR A;  1P2F A;  4AVZ A;  4ZDL A;  4ANJ A;  4TV7 A;  3LFK A;  5D4R A;  1ZG3 A;  1R1U A;  4ESF A;  1YW9 A;  2HZD A;  1W36 D;  1K6O A;  3WE2 A;  2MW8 A;  2BY3 A;  4EM1 A;  5HNF A;  1EH8 A;  4KIS A;  1LDK B;  2ETH A;  4LG3 A;  3W6V A;  3FXJ A;  1J09 A;  1XSV A;  1AKH A;  1A31 A;  3HL2 A;  4OMZ A;  1N78 A;  3VFZ A;  2ZXJ A;  2A05 A;  4F52 A;  3MVP A;  2VE9 A;  2STW A;  3I5U A;  2HOS A;  2M87 A;  3LWF A;  3RIR A;  4CZC A;  3WG7 H;  3CF2 A;  3PM1 A;  3HHG A;  3TOB A;  4RAF A;  3WTU C;  3KP2 A;  5HOD A;  2QVO A;  3LL7 A;  2PQ8 A;  3CTA A;  1UJ8 A;  3BDD A;  4XNF A;  3RKY A;  1ORK A;  4PZJ A;  3KFW X;  3G3Z A;  1K78 B;  5TGT A;  2JUG A;  5FKK A;  3JRG A;  2DAO A;  3CCJ I;  3W6J B;  3FBI B;  4E4H A;  3MEX A;  4J19 A;  2VKD A;  3NEU A;  3SJM A;  2HI3 A;  1T39 A;  1HCR A;  2E1N A;  4BBS J;  1FOY A;  2EFP A;  5AIQ A;  1S7A A;  3BG6 A;  2DA6 A;  1FYM A;  3GTG J;  1UG2 A;  2I10 A;  3QPH A;  4NC6 A;  2VQH A;  5BPI A;  2DMQ A;  1ZRF A;  2DXI A;  5C4X J;  1U5T A;  4JYK A;  3MKW B;  3IH4 A;  2H6B A;  1S29 A;  3F23 A;  2LDU A;  2H09 A;  1JKO C;  1ZH5 A;  2EJR A;  1OCZ H;  3AG1 H;  1FZP B;  4E7J A;  3A2K A;  2W85 A;  3V7S A;  4U88 A;  3LSJ A;  1E3P A;  2R7W A;  4UUS B;  2M4K A;  1UAA A;  1W7P B;  2WV1 A;  5D6E A;  2MGQ A;  1J59 A;  3J7Z I;  1BN5 A;  1AHD P;  3ECH A;  4A6D A;  2EH3 A;  5FFZ A;  2ZJR F;  1NG6 A;  1QO0 D;  3G4S I;  4M6V A;  2XAS A;  4ZTF A;  3F0C A;  4C30 A;  3D0S A;  2F5D A;  2LTP A;  1JJ6 C;  3GO5 A;  3CDI A;  1BR2 A;  1NTC A;  5EEH A;  3KEO A;  1F43 A;  2JT1 A;  4YRV A;  4L5J A;  2QA4 I;  2Y9Z A;  2BHZ A;  1EV7 A;  2JZY A;  4XLE A;  4HAM A;  3NWT A;  2DPU A;  1CF7 A;  4XLA A;  1B9M A;  3VEP A;  1W0T A;  3BY6 A;  3I64 A;  3BT9 A;  1S6L A;  2J5O A;  2WAD A;  2P5L C;  2FEZ A;  2I5U A;  4M3B A;  4QSH A;  2A61 A;  2E19 A;  2CG4 A;  3F6O A;  3BR5 A;  3K1M A;  3OYE A;  4KMU X;  1EA3 A;  1NHA A;  2KKO A;  1YTY A;  1ETW A;  5IYB J;  1D5V A;  3K2Z A;  3ZN1 A;  3CJN A;  3AKZ A;  2MLK A;  2FXA A;  3IAM 2;  5J40 A;  4I02 A;  2M34 A;  3ECO A;  1ZHF A;  4IF4 A;  1ERD A;  2EIK H;  1EH7 A;  5JFR A;  5FRN A;  1YW8 A;  2L9V A;  4A2U A;  3CJQ B;  3W2A A;  1FEX A;  2ISZ A;  2WBM A;  3J81 Z;  3SZP A;  3H36 A;  3AAF A;  1P6R A;  3I59 A;  3KP7 A;  2VBY A;  3DXJ F;  2GA1 A;  3PQK A;  1QHH D;  2F2E A;  2IGM A;  3HGY A;  4G6D A;  2ID3 A;  1BR1 A;  2AXL A;  3QPS A;  2FML A;  3K10 A;  4B8X A;  4CYC B;  1HSJ A;  3G1M A;  1MW7 A;  4PJL A;  2YSR A;  3LQR A;  4CXF A;  4XOR A;  4ENN A;  1PVE A;  4BJ6 C;  3ZQG A;  2HVQ A;  3S14 J;  3FMS A;  4UHT A;  3ZMD A;  3IL2 A;  1FIP A;  1TQM A;  1XX5 A;  3Q3S A;  2DT5 A;  3Q0W A;  3EYY A;  3MZH A;  5F6F A;  1GDT A;  2IT0 A;  3MAJ A;  1PYV A;  1IN6 A;  3OL4 A;  4E7Z A;  1BC8 C;  1PUE E;  3CJT B;  4F91 B;  3P7N A;  1IN8 A;  1Y8R B;  4CYD A;  1S72 I;  1OIS A;  3LST A;  1D3Y A;  4FX4 A;  4MIM A;  2OZU A;  3MZY A;  2BVL A;  2KJC A;  2HYJ A;  5HLI A;  3GLX A;  3O8H A;  2KRC A;  1MKM A;  2JA6 J;  1LDD A;  1BBY A;  2PJR A;  2M0C A;  2IA1 A;  3PUB A; 
#chains in the Genus database with same CATH homology
 3WHC A;  9ANT A;  1FIA A;  1HDP A;  4X6A J;  2QF7 A;  1B72 B;  3FIW A;  1MBJ A;  3BG3 A;  2EZK A;  3JRD A;  1RPW A;  3BR3 A;  1K61 A;  1OCT C;  1TWH J;  5FKL A;  1ZKG A;  1U9N A;  4GFB A;  3FK7 A;  2R7Z J;  1VF9 A;  1T33 A;  4HNV A;  4M3D A;  1POG A;  1O4X A;  1XC5 A;  3ZQC A;  2DA5 A;  2E1O A;  4A3J J;  5IP7 J;  2JN6 A;  3BG5 A;  2E2J J;  4Y52 J;  3HOV J;  1Q1V A;  4C3J J;  5FLV A;  1ZR4 A;  2O8K A;  1UMQ A;  1ETV A;  5FLM J;  3GTQ J;  4X1E A;  3Q0U A;  5EGO B;  1ZR2 A;  5FKN A;  2MSY A;  3BR1 A;  1FJL A;  5F0C A;  4B3A A;  4B1R A;  3HDD A;  4MLO A;  1LE8 B;  2PMZ N;  4S0H B;  2NVX J;  3K2A A;  2R5Y B;  2CUF A;  1QRY A;  2LR8 A;  2DA4 A;  4JX4 A;  1OJL A;  1I3Q J;  3HOZ J;  3MKL A;  3JRE A;  2H1K A;  1JT6 A;  1SAN A;  4BY1 J;  5F04 A;  4A3I J;  2JA8 J;  3HOU J;  2IBD A;  1BA5 A;  3ZQI A;  1JGG A;  2M2E A;  3CCY A;  1ENH A;  2HOA A;  3HKZ N;  3TW6 A;  2R93 J;  4QIW N;  2ME0 A;  5FKO A;  2E2I J;  4A3L J;  5E3M A;  2Y9Y A;  3BR0 A;  3NAU A;  1H89 C;  1B8I B;  4EEF G;  2HDD A;  2L0K A;  1JUP A;  3O8G A;  1SFO J;  3BTJ A;  2R5Z B;  5C4J J;  2GLO A;  4C2M J;  1X58 A;  3HGG A;  1T56 A;  3CMY A;  1MBH A;  2XB5 A;  2XGE A;  1U78 A;  2MG4 A;  3GTP J;  2NVT J;  4UUS A;  2R0Q C;  3ZQH A;  1PUF B;  2O7O A;  4XRS A;  2NS7 A;  4MFD A;  1LFU P;  3QPL A;  1AKH B;  1H8A C;  2OF7 A;  4BKX A;  2ELK A;  3S1M J;  3OOU A;  2LD5 A;  1HLV A;  2RAE A;  2GBY A;  5EYR A;  1D5Y A;  1CQT A;  4BBR J;  2HXI A;  2XSD C;  3OSG A;  2CQQ A;  1RET A;  4D7M A;  3S17 J;  4AUX A;  5EF6 A;  4A3C J;  4FTH A;  5IOY A;  1F36 A;  2EZH A;  4XIC A;  5F0F A;  3LOC A;  1VFC A;  1IDZ A;  5E3L A;  1OFC X;  1I6H J;  1ZK8 A;  4JX6 A;  4FIS A;  1WH5 A;  3OIO A;  3ZQL A;  5IYD J;  1UHS A;  5F1J A;  4D5F A;  4RBO A;  1FTZ A;  3S2H J;  2ID6 A;  2K9Q A;  1RR7 A;  2M8G X;  1BJZ A;  1EF4 A;  2WAQ N;  2E2H J;  4A3M J;  3A03 A;  4Y7N J;  2JJ7 A;  3S1N J;  1ETK A;  2CRG A;  4DYC A;  2IEK A;  5C44 J;  3LSP A;  1JJ8 C;  1ETY A;  1A6I A;  2D5V A;  4A3G J;  3HB9 A;  2DJN A;  3BTL A;  3VPR A;  3PO2 J;  5IYC J;  1QPI A;  2P81 A;  2K40 A;  5JLW A;  5F0H A;  2R92 J;  4CYC A;  1BW5 A;  3ZQF A;  2NVQ J;  2XGC A;  3JRB A;  3M4O J;  1Z0X A;  1GT0 C;  1IC8 A;  1P7J A;  1ZQ3 P;  1BW6 A;  1MH3 A;  2X48 A;  3GTO J;  1JKP C;  1RKW A;  2OPT A;  3HOY J;  1H88 C;  2HXO A;  1IUF A;  2L7M P;  4ABZ A;  2Y2Z A;  3TW7 A;  1WI3 A;  2YUS A;  2L7Z A;  3JRI A;  1RKT A;  5K7Z A;  4IHV A;  4IHW A;  3RKQ A;  3UKG A;  5FJ8 J;  3JRF A;  2VUM J;  1A5J A;  3JRC A;  3CQZ J;  3B6A A;  1YRN B;  1FTT A;  1MBK A;  3BQY A;  4A3K J;  3S1Q J;  1IV6 A;  2LY9 A;  2DA7 A;  3I4M J;  2FX0 A;  3RQI A;  1DU6 A;  1TWA J;  2K9N A;  3L1P A;  2JA5 J;  4M3F A;  3LSR A;  2AHQ A;  4W97 A;  1B72 A;  3HOW J;  4L5E A;  1ZTR A;  2VPR A;  2IAI A;  2WB1 N;  3TED A;  5JLX A;  1IG7 A;  3PO3 J;  1IGN A;  2O9L A;  2KT0 A;  1JTY A;  1IRZ A;  1GV2 A;  2LLK A;  2VKV A;  5M3M J;  1HF0 A;  2EBI A;  1MBE A;  3ZOB A;  3SFI A;  3BG9 A;  3GBG A;  4C3I J;  1JKQ C;  2EZI A;  3K7A J;  5DTD A;  1TWC J;  2CU7 A;  1LFB A;  2Y31 A;  4XRM A;  2FQ4 A;  4IHY A;  3A01 B;  3BQZ A;  1WGX A;  1LE8 A;  4MFE A;  5EG0 B;  1U9O A;  2DMP A;  4A69 C;  1R9T J;  2CQX A;  2K9S A;  4XID A;  2R5Y A;  1ITY A;  2KDZ A;  2JA7 J;  5E3O A;  3HM5 A;  1HOM A;  1QVT A;  4BY7 J;  3G1O A;  3BTI A;  2TCT A;  4AYB N;  2ECC A;  2NOG A;  4W1U A;  2JMW A;  2ECB A;  1MH4 A;  2W48 A;  2XPV A;  3QQA A;  3BR6 A;  5J1Y A;  5J1U A;  3JR9 A;  2NVY J;  5M3F J;  1WH7 A;  5F08 A;  5M5W J;  1DU0 A;  3G1L A;  2LP0 A;  3JRH A;  2DA1 A;  3Q0V A;  4G12 A;  2TRT A;  1ETQ A;  1XG1 A;  3HEF A;  4A3F J;  5EEA A;  1GVD A;  3GTJ J;  3RZD J;  5IP6 A;  1GUU A;  2YS9 A;  3H3V K;  4IEJ A;  1Y1V J;  2Y0S N;  2R5Z A;  1APL C;  1TWF J;  4V2F A;  4A3D J;  4XK4 A;  2MW8 A;  2DMT A;  3RZO J;  4QTR A;  5GPC A;  4LOC A;  1VI0 A;  1PUF A;  1I50 J;  3W6V A;  1AKH A;  2DMN A;  1X2M A;  4XRS G;  2DA2 A;  3HBL A;  3MVP A;  2HOS A;  5BNG A;  5GPA A;  1U8B A;  3FK6 A;  2HOT A;  3PM1 A;  1MSF C;  3M3Y J;  3FKI J;  5HOD A;  4NDL A;  2QCO A;  1P7I A;  1MBF A;  2L9R A;  4DZJ A;  5IPA A;  1ORK A;  2XPU A;  2DTZ A;  3IV5 A;  4DZP A;  5FKK A;  3JRG A;  2Y30 A;  3A02 A;  2LK2 A;  3DEW A;  4J19 A;  3SJM A;  1WPK A;  1NK3 P;  1TC3 C;  2HI3 A;  4I6Z A;  1GV5 A;  5GP9 A;  1HCR A;  2CJJ A;  5E3N A;  4BBS J;  2B63 J;  1IJW C;  2DA6 A;  3GTG J;  5EZH A;  1QVU A;  1UG2 A;  2FD5 A;  2I10 A;  3GTL J;  3S16 J;  3S2D J;  3FIS A;  4IHX A;  2DMQ A;  5C4X J;  2AO9 A;  2ZB9 A;  5IP9 J;  4JYK A;  4DYR A;  3IH4 A;  1WCM J;  1JTX A;  4C3H J;  4FE4 A;  1JKR C;  1JKO C;  2XRL A;  1G2H A;  4DYQ A;  3LSJ A;  5M5Y J;  5EDN A;  4UUS B;  3JRA A;  2WV1 A;  2MGQ A;  2JWT A;  1AHD P;  4MO7 A;  2EH3 A;  2X9D A;  1OCP A;  2LFB A;  3H0G J;  1ETX A;  4M6V A;  5FKM A;  2EQR A;  3F0C A;  2LTP A;  1JJ6 C;  1NTC A;  3SDG A;  1MNM C;  3B6C A;  1F43 A;  2Y9Z A;  2FJ1 A;  3DCF A;  3MN2 A;  5IOZ A;  4D7N A;  1BL0 A;  4UUT A;  4I76 A;  5EGO A;  3WHB A;  3CDL A;  3E7L A;  1W0T A;  1E3O C;  2N8G A;  3BT9 A;  2COB A;  4M3B A;  5K7H A;  4QSH A;  2GM4 A;  2E19 A;  3BR5 A;  3LSG A;  1XS9 A;  3D1N I;  2NS8 A;  4AC0 A;  2DMU A;  1MBG A;  2LKX A;  2HQ5 A;  3S1R J;  1ETW A;  2DN0 A;  1JT0 A;  5IYB J;  1IDY A;  2XPW A;  3NAR A;  1YRN A;  1HDD C;  2M34 A;  5M5X J;  3LNQ A;  1S7E A;  4BXX J;  1W0U A;  4B4C A;  1JUM A;  1FEX A;  4M3E A;  2VI6 A;  2G0E A;  1JUS A;  3OSF A;  4JX5 A;  2CUE A;  3HGY A;  1AU7 A;  3BTC A;  5DS9 A;  4A93 J;  2ID3 A;  1ZGW A;  3QPS A;  5C3E J;  2H8R A;  5EZG A;  4CYC B;  3G1M A;  3BR2 A;  1B8I A;  3GTK J;  3C2B A;  3IH2 A;  4M3G A;  5K7F A;  4A3B J;  3HOX J;  2YU9 J;  2JK3 A;  3ZQG A;  3S14 J;  3GTM J;  1RES A;  3TP3 A;  4DW6 A;  4FCY A;  1FIP A;  2X6O A;  4FE7 A;  3Q3S A;  2DA3 A;  5J3L A;  2L7F P;  4V2G A;  3Q0W A;  2EZL A;  3TP0 A;  3A01 A;  1VND A;  1GDT A;  5EG0 A;  4D5C A;  2M9H A;  5F27 A;  2LVS A;  2XB0 X;  3IH3 A;  5J1R A;  1MSE C;  1TWG J;  1NK2 P;  1Y1W J;  4JP0 A;  2VKE A;  4MIM A;  4RDU A;  4A3E J;  1K83 J;  2HYJ A;  1X2N A;  2ME6 A;  3I4N J;  3S15 J;  3O8H A;  2XGD A;  1Z77 A;  2JA6 J;  1ETO A;  2M0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...