2L54A

Solution structure of the zalpha domain mutant of adar1 (n43a,y47a)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
YQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEIARVLASLAKKGKLQKEAGTPPLWKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title Alternate rRNA secondary structures as regulators of translation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 63
sequence length 63
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l54A00
3DP7A 1KA8A 3BDDA 2CO5A 2VE9A 4EV0A 4LMYA 2EWNA 4DNCA 1KYWA 1O3TA 5E20A 4ESBA 2OBPA 4A6EA 1HW2A 5DCMB 3JAMZ 3CLOA 2COMA 3RYPA 1KQ8A 1BC7C 3LSTA 1IUYA 2WWYA 2W57A 1U5TA 2EB7A 3E5XA 3T8RA 2Q2EA 3F6VA 2LF7A 3QU3A 2ESNA 3QOPA 2LF8A 2XV4S 4LB5A 2V1DA 3TDZC 2V1UA 3EQLF 3F8NA 4ETSA 3K69A 4MGRA 1J75A 2QBYA 1SD5A 4A2UA 4HLXA 1Z6RA 4ZYEA 2DLLA 3F21A 5KVRA 2F2EA 2KRFA 3ZMDA 4A5MA 3HUGA 4HX8A 1DUXC 2MH2A 3EETA 4LG0A 1AWCA 1U8RA 2PJPA 1ON2A 3WTWC 1TQIA 3I64A 1WKMA 3KEOA 1U78A 5D4SA 1K79A 2VN2A 4A6DA 3FHZA 4M71A 5BPIA 3HRSA 1W7PD 5JI6A 2JPCA 5FLXK 5EEHA 4Q5SF 3GZ5A 1EH8A 3TO7A 4WXDA 3C7JA 5L3GA 2STTA 1ZHFA 2PQ8A 3QPTA 1J0RA 1ZLJA 3V7CA 2XAHA 3O3KA 2ZCWA 2Z3YA 2OAZA 1ZRCA 4M9XA 3F23A 3RI4A 2LNBA 1D8JA 1G6NA 4GGGA 5DUKA 5DDGA 4RS8A 1XGNA 2A61A 2P4WA 4GYIA 2PI0A 1BC8C 4BNCA 3EDPA 2QM3A 1JXSA 3RKXA 5J6XA 3KP6A 5TJJA 1U3EM 1R7JA 1T6SA 4BXUA 2F5EA 5D5XB 2QYOA 3J7AO 3GZ6A 3FM3A 2IA2A 2VXZA 1EV7A 3CUOA 4N0BA 3ABTA 3MFKA 3I53A 3ZMZA 3JW4A 3J81K 1S7OA 2HTJA 1B59A 2E7XA 2NRAC 4L0ZB 2FF4A 1I27A 1QQIA 2M30A 1B6AA 1LVAA 2DFIA 3GYHX 4HW0A 3LA7A 2FNAA 1YS7A 5HLGA 1O3RA 1IN4A 3V8KA 2FA5A 5D8KB 1CGPA 4Q47A 2IRFG 3FXRA 2FNPA 1TTYA 5DCFA 4CDGA 4RGSA 1XSXA 3R60A 3WE2A 1S3JA 4G7ZF 2HQRA 3ZN1A 5F1RA 4ZZDA 3F8CA 4KN7X 5ED4A 1K78B 2HGCA 1DPUA 1B4AA 1YO5C 2VC0A 1BJAA 2H09A 2XGXA 4HBLA 1G3YA 3L00A 1HKQA 2RGVA 2GZWA 3WGIA 2QZ8A 1TLHB 1HW1A 2UXNA 3N97A 2YX7A 2V6CA 4EQQA 5L3DA 2PG4A 4IPAA 5FB2A 1E2XA 2DPDA 1YG2A 1ZAOA 5FFZA 2PMHA 5HDNA 1R36A 4ZYHA 3BZ6A 5E1WA 4ENJA 2IJLA 2DT5A 1RIOH 4GYGA 3WTXC 2XKOA 1SMYF 3OOPA 5DD8A 2XKPA 2QUFA 5ILVA 5E8IA 1BN5A 3NRVA 3J80K 1YLFA 2XIGA 5LEJA 2VBWA 1IW7F 2CW0F 1VTNC 3GFIA 3E5QA 1MDMB 4M73A 4FHTA 3HTUA 5E1ZB 3U2RA 4L9JA 4A0ZA 1W5TA 5CVIA 3KLNA 4HX4A 1P2FA 3N4MA 4ENNA 2O6GE 1EH7A 2VOPA 2DAOA 4OIRF 4KN4X 1IRFA 2D1HA 3LFKA 2W25A 4LJZF 1FBSA 1ZG1A 2WTEA 2EV6A 2P6SA 1Z91A 2K7LA 5HS7A 3MQ0A 4L5IA 1HQCA 2DK8A 3BPXA 1Z9CA 2IA1A 1G3SA 2Z33A 3FMQA 5K5RA 2FRHA 1S29A 4G6QA 5LHGA 3M9AA 3WU1B 2RKHA 5D4RA 1P92A 3E6BA 3H3ZA 5DCMA 4P96A 3FXQA 1IXCA 4Y17A 5LEKA 4IVNA 5AIPA 2XAFA 2ZJ2A 2P5VA 1T39A 3NEUA 4BHCA 4OMZA 5H6QA 2L4MA 1FSEA 4M74A 2XUBA 2GXGA 4PGHA 4KUMA 3QU6A 1V3FA 4P55A 1S6LA 1RUOA 2K02A 3CUQB 2HKOA 2XAQA 3VEPA 3HTSB 5FLXZ 3ZN0A 2FOKA 3TOBA 3CDHA 2DO7A 5HLIA 3PQJA 3SHFA 4OIQF 2PFBA 5L3CA 4ESJA 4BH9A 2XHKA 1SD6A 2XVCA 1YTYA 1DPRA 2NNNA 3B73A 3KFWX 1K7AA 1SMTA 3L09A 3O6BB 4KT5C 1C0WA 1FBQA 1PP7U 4MQVA 1KU2A 2L01A 4HQMA 4F7ZA 4HAMA 4I0AA 2ESHA 3CJNA 3K9TA 1BI1A 3FXUA 4I98B 1XGOA 1TQPA 1D5VA 2P5KA 2P5LC 4EGZA 1USTA 1R1VA 4EM1A 3J81Z 4RAYA 1IN8A 4ENKA 5H20A 3LA3A 3QP5A 4RB0A 3AAFA 1LEBA 2DBBA 2PN6A 2IW5A 1UFMA 2G7HA 4G9YA 1WWXA 2EA2A 2JTVA 3WTUC 2B0LA 3U1DA 1YW7A 3SZPA 1RI7A 3I4PA 5LRSA 2D45A 1J2XA 3RYRA 4UXNA 1DDNA 1OYWA 3HRUA 2C6YA 3I0TA 1R22A 4P9FA 1XDUA 3KP4A 1I1SA 1R1TA 1G3WA 3F8FA 4L18B 4G7HF 2RN7A 3ZMTA 2XRNA 2O03A 4ZH4F 4HOBA 3QAHA 3P9CA 5FD6A 3M8FA 1ZRFA 1KGSA 3WGGA 1SAXA 4N9HA 2GQQA 3HSEA 1YW9A 4KMFA 2FEZA 3WE3A 1QPMA 2K27A 2L4AA 4UV9A 4OIPF 4BHBA 3HOSA 4R8HA 2GIVA 1ZRDA 1J9IA 2ZBKA 2L02A 5ILSA 4U0YA 3TO6A 4MTEA 1GVJA 2G9WA 2A69F 2H27A 1B9NA 3QP6A 1NHAA 4JBAA 3RIRA 4ESFA 3ISPA 4BHPA 2EFOA 2A5YB 3ML6A 2Q8KA 1BI3A 4UHTA 4WXCA 1K78A 3J80Z 4A0XA 1QNTA 4RB3C 5CLSA 1ZG5A 2O0YA 3P9KA 2STWA 1YFHA 2HTSA 4LK1F 4LK0F 3KP3A 4YIIA 2OU2A 5E1XA 5BQTA 4RGXA 2MLGA 2D2WA 5K5OA 4MQ9F 1UHWA 3NQOA 4QLCU 2CWEA 4BQAA 3KCCA 2OQGA 1UHMA 3DFGA 4Q4ZF 3I5UA 3WTVC 5E18F 2FBKA 4KA4A 4EJVA 2MD5A 3COAC 4PDKA 4HLYA 3RKYA 1SD7A 3ZMSA 4YFXF 3HOTA 3R0AA 4FX0A 4OMYA 1O3QA 1MDMA 3RTRA 1HKTA 2KJBA 2ZNZA 4UVBA 1TW2A 2ZFWA 4L5JA 1ON1A 1R58A 5J8FA 4RGRA 1XD7A 3CUQC 1W4MA 1XGMA 3DPLC 1LB2A 1D3YA 2EA4A 3Q9SA 3T5XA 1T98A 4IRIA 1XCVA 3F22A 2H6CA 3F8MA 3MWMA 4KYWA 4NB5A 4HF0A 3IRQA 5LGTA 4OU0A 4I0BA 2MLKA 3LQRA 1XMAA 1FY7A 3LAPA 4G7OF 2HYGD 5CYVA 2YU3A 3G3ZA 3QPHA 3BJ6A 4TV7A 4UVAA 1OYYA 1H0MA 3F72A 3FX3A 1FNNA 4IRGA 2Y75A 5FD5A 1TQMA 3DPTA 3TGNA 3REOA 2NAZA 4LLGF 4IHSA 2K4JA 3K1PA 1PDNC 4EVIA 1YQAA 4MEXF 4I01A 4I2OA 3DKWA 2RNJA 3RKWA 3CUQA 5TRDA 4I09A 4UUVA 4R79A 4MEYF 4P5OA 4U0WA 1R23A 2M1BA 4BAYA 4ZYGA 1ZG3A 5FO5A 2ADUA 4AIJA 4I7HA 1ODDA 3GLXA 3IWFA 3B02A 1FOKA 1R1UA 1UB9A 2EV5A 5HS9A 5D5UB 4OOIA 3SXYA 3ROUA 5H6RA 5DEQA 3LA2A 2CSOA 3V7RA 1G4DA 3FMSA 3P9IA 2FBHA 4G6DA 2FQ3A 2GA1A 5LHHA 1USSA 4RB1A 4WWCA 1Z6TA 1MJBA 1L0OC 4M6YA 3R6SA 2JT1A 2YX4A 1IN6A 2AXLA 2J5OA 3IKVA 1J59A 2QENA 2XAJA 4UNOA 2V79A 1ULYA 4HF1A 4JK1X 3GVAA 5JR3A 3C1DA 1E17A 1W7PB 1SFEA 2QLZA 4XBFA 2DQLA 3BROA 3KE2A 3EUHA 3TO9A 1GHCA 3ZP5A 2A3SA 3D0SA 5E17F 4HYEA 3IHUA 3FF5A 1RUNA 1KYZA 1F5TA 2H6BA 4GXOA 4KIGA 1Z7UA 2X0LA 4XSXF 3IRRA 4L9NA 1P4XA 2EFWA 1IN7A 4K2EA 1F1ZA 3WG9A 4IXAA 4XLPF 3RDIA 4H0EA 3W6KB 2BEOA 2L3DA 1I5ZA 5LRRA 3GW2A 1H9GA 1KU3A 2IA0A 4AIKA 2CGPA 3QRFF 4ZYDA 4UVCA 3WU0A 4KDPA 5CJ9A 3BJAA 1LQ1A 1XSDA 1R00A 1SD4A 3W6JB 1ZGJA 1LDDA 3LAJA 1HXDA 1G3TA 1MKMA 1JE8A 5BMZA 2D1VA 5CVVA 2VONA 2VC1A 3M7GA 3I59A 2R7DA 2Z5UA 3E3VA 1Q1HA 2KIFA 3T1BA 1MZBA 4XLNF 4UV8A 2ZKZA 3I71A 3ZMUA 1FPQA 2VOOA 4KIFA 3ERED 4YIFA 1FYKA 5L3FA 3TDUC 2VODA 5JVTA 1YIOA 3DQVC 2QQBA 2WV0A 2VE8A 4QWQA 1LJ9A 5IT3A 4IHTA 4G94A 2DTRA 4MTDA 4LGWA 4U7DA 2M8EA 1K6OA 4AVPA 2Y48A 2XASA 3EYIA 4YFKF 2EJRA 4M72A 1TW3A 1HBXG 2FXAA 5FFXA 2RC4A 4CYDA 2NNYA 2YSRA 3KLOA 3ULQB 2F5DA 4M9SA 4KFCA 5CVJA 3GFMA 3KZYA 1CF7B 5J8CA 2A6HF 1T38A 3GFJA 4RGUA 1FZPB 1U5TC 4G8XA 5K1YA 4S05A 3G73A 4LLLA 4MNUA 3GXOA 4OINF 2Z9OA 1U2WA 1STZA 3D5LA 5ERIA 4EJUA 2GA2A 2MBFA 2PEXA 1SFXA 4I02A 2RV8A 1L3LA 1KU7A 3C18A 2Q0OA 1AOYA 2ETHA 4L9TA 1IN5A 5F64A 3DEUA 3LWFA 4D0PA 1RNLA 2UWMA 2GXBA 1GXQA 5LBQA 1QBJA 3OV8A 3BJOA 2E1NA 2W84A 2LKPA 1X3UA 4HX7A 3KP7A 1XN7A 3RJPA 3ABUA 3I54A 4U7BA 1HW5A 4EJTA 1ZN2A 3MAJA 4EJWA 1TNSA 2OZ6A 1XDSA 3MEXA 4FT8A 4HV6A 3I58A 2KJCA 4HA8A 1BIAA 2BBYA 1BM9A 5JHUA 4YFNF 3FZVA 1IXSB 5A2QK 3ECOA 4KIBA 3WTTC 3R4KA 1O57A 1O3SA 3I59B 1BOAA 3KP2A 3SFZA 1WSUA 4B8XA 2LDUA 3T8TA 4M9ZA 2IP2A 5D6EA 2L54A 1BBYA 4LFUA 3PFIA 4DQ2A 4N9IA 4YG2F 1J7KA 1YW8A 3WTYC 3ELKA 2KKOA 4AIHA 5BPDA 1O7FA 3V8JA 4XSZF 1FYLA 2ZXJA 4EJOA 4HDUA 1V4RA 3R0JA 1W5SA 2LSOA 5LLQA 5L3EA 1JGSA 1I1GA 2BV6A 3GFLA 4NHJA 3Q5FA 2G7UA 3K2ZA 1D8KA 3H92A 2BYVE 4A5NA 5DUIA 1P4AA 2FU4A 2MH9A 4JQFA 3V8LA 4EMSA 3HRMA 3TQNA 2EFQA 4AWXB 1OMIA 4ENMA 2HR3A 5HDGA 1LDKB 4HQEA 3CTAA 1SFUA 4HV5A 3F6OA 2CFXA 3E6DA 3BWGA 1S8NA 1IF1A 1YS6A 2DI3A 2X4HA 1W7PA 5D5WB 1QO0D 1DP7P 3BY6A 2HS5A 1F9NA 4LB6B 2ELHA 4E70A 1JHHA 1BI2A 4A0YA 1A04A 5LHIA 2EFPA 5JFRA 2IT0A 1H9TA 2ISZA 1ZLKA 4EM2A 2AS5F 2GAUA 1U6GA 3Q9VA 1Y0UA 3PQKA 1ONVA 4IRHA 3HYIA 4RB2C 4U0VA 3ZMVA 3L7WA 3JTGA 5BOXA 1TBXA 1IXRC 1XSVA 2JRTA 2HWVA 3GEZA 3RPQA 4WXHA 1BI0A 5ICEA 6PAXA 2VBYA 1IAWA 5L3BA 2A68F 2IVMA 1B9MA 2JPBA 4WF2A 2PBIA 5IT9K 2YR2A 1UCRA 1PP8F 2BGCA 3SQNA 3T0YA 3GUDA 3M1EA 1FC3A 3CO6C 2FMYA 2K4BA 2OA4A 3EYYA 4WCGA 2HDCA 2J5PA 3IL2A 1U5TB 1MD0A 1IZ1A 3HHGA 2JZYA 3CO7C 3RPUA 1OPCA 3IC7A 4IJAA 2HKXA 1Z05A 1YYVA 1OR7A 3ECHA 3E6MA 1FP2A 2QBYB 2PMUA 1QGPA 2UZKA 4EGYA 3GF2A 1B1BA 2CYYA 3KZZA 1P4WA 4O3MA 2ISYA 3WTZA 1WI9A 1R5GA 3HSFA 2EFNA 3JAMK 4LG0B 3O2PE 3F3XA 3BPVA 4AD9A 2MA3A 2M5WA 1BIBA 4GO1A 1T2KA 1XMKA 4B09A 4IF4A 3DXJF 4U88A 1GXPA 3FM5A 2H94A 4R1HA 2F5FA 1LDJA 2OQRA 3C3WA 2HEOA 4NQWA 3SZTA 5LGNA 1FLIA 2FMLA 2V1XA 2HOEA 2A6EF 2GWRA 4GCVA 1OKRA 3K0LA 3JSOA 2DU9A 4MHGA 3E6CC 4O5VA 4ON0A 4PCQA 5DD4A 2E7WA 3WTSC 2DK5A 5D5VB 5ICFA 2ZNYA 1FWZA 2VT3A 3R61A 1CF7A 2P8TA 2ZO4A 1FP1D 3E5UA 3TKYA 2V9VA 2HZTA 2R3SA 1MGTA 3L2CA 2QVOA 2K86A 1ZREA 5ICGA 3DV8A 3JSPA 2EV0A 2OZUA 2IPQX 2ZMEA 2M87A 5E8GA 4Q48A 3HRTA 2RVCA 2YPRA 2XROA 3L9FA 2RDPA 2QQ9A 4PGGA 3MZHA 1ZGAA 2O8XA 2PLYA 1FX7A 3WODF 5A2QZ 5HDKA 5FGMA 2VBZA 3GX4X 4M6XA 3MZYA 3V7SA 5ICCA 2W24A 3P7NA 1KQ9A 2W85A 3HSRA 1PUEE 1OYIA 1Z1DA 2TDXA 2DQRA 5AONA 1I6XA 1KQ0A 4CZZA 5DYMA 2E1CA 2Y0MA 3IKTA 3K1NA 4LD5A 1ZYRF 2FE3A 3M8EA 2DPUA 4A12A 2CQKA 1HKSA 2KIUA 1FYMA 3U9GA 3ZQ7A 2HFHA 4HF2A 2BE5F 4HZFA 2Z99A 1ZH5A 5F6FA 4BYYA 1XB4A 3S2WA 4KICA 3DF8A 3GWZA 5DV5A 4CGZA 4LLNA 2XAGA 5HS8A 3IWZA 2VT2A 1O7LA 3FMRA 1EH6A 3VODA 4S04A 4EM0B 1XCBA 2OD5A 4ASNA 5D8LB 5LGUA 5HVQC 3BOQA 4CXFA 4CHUA 2EK5A 1XGSA 2FBIA 4WK8F 3KETA 1ZARA 4L9VA 5CVUA 2QQAA 4ZZLA 4KNYA 3VFZA 4CO8A 3GO5A 4Y15A 4HDVA 2HYFA 2ACJA 3LQQA 2KIMA 5D6FA 3ZPLA 3K1MA 2O3FA 4WX9A 1IRGA 1HSTA 2R7FA 5HOOA 1J5YA 2WC2A 1QZZA 1REPC 1LEAA 2P6TA 3TOAA 1F4KA 4CICA 4Z2YA 3VB2A 2P7VB 3MCZA 4P9UA 1FT9A 2UXXA 1WRJA 5HLHA 2NYXA 1KU9A 2M45A 1S7AA 1FBUA 2JSCA 5CVRA 2FSWA 2P7CB 4XRFA 2HQNA 4O6JA 2NS0A 1MJ9A 1R5HA 4PZJA 3KP5A 4L0YB 1JHFA 4KMUX 2ZMEB 5K5QA 3KEQA 2A07F 1RZ4A 4OIOF 3F8BA 3VOEA 3WGHA 4Y13A 1MJAA 1T0FA 1TNTA 5IT9Z 3BP8A 1HSJA 1P6RA 2RQPA 1LNWA 3H3UA 4FX4A 2DW4A 3FWEA 2CG4A 3V4GA 4RAZA 5BS6A 3HHHA 1QZYA 3JTHA 3HIFA 2VBXA 2O61A 3E97A 2QWWA 5AIQA 1WQ2A 5KK1A 1FSHA 2MC3A 5ILUA 2F5CA 5EEGA
chains in the Genus database with same CATH superfamily
3DP7A 1A6QA 3DLLF 1KA8A 3BDDA 2CO5A 4BKXA 4A3MJ 1PYVA 2VE9A 3S3NA 2CUJA 4Y52J 1X1PA 4EV0A 4LMYA 2V6EA 2EWNA 4DNCA 4E7KA 1KYWA 1O3TA 2VPLA 1D0YA 5E20A 4ZDLA 3VYSB 4ESBA 2O9LA 2OBPA 4A6EA 4FQGA 2AQFA 2X51A 5IOYA 1NG7A 2CJJA 1HW2A 1HCRA 3S3MA 5DCMB 4A3IJ 1MBJA 4G6TB 2CFOA 1FJLA 3JAMZ 3CLOA 2KMUA 2COMA 1MMGA 1QVUA 3RYPA 4BXFA 1O4XA 2Y30A 1KQ8A 4RAGA 1DU0A 3VDXA 1BC7C 2VPRA 2E5NA 3IH2A 1JKOC 3LSTA 1IUYA 2WWYA 2HU9A 2R5ZA 5EG0B 2W57A 1U5TA 4GRIA 2CQXA 3JRBA 3CCQI 2EB7A 3E5XA 1EKEA 3T8RA 2Q2EA 3F6VA 2M3AA 2LF7A 3QU3A 2ESNA 3QOPA 2ECBA 4XOPA 2LF8A 2ZJPF 2CUFA 2XV4S 4LB5A 2V1DA 3TDZC 2V1UA 2WA0A 1MBHA 3EQLF 3F8NA 3G2BA 4S0HB 4ETSA 3K69A 1S72I 2HVSA 1QVTA 4MGRA 1J75A 2QBYA 1T08B 2VKHA 2EINH 5B1BH 1SD5A 4A2UA 4HLXA 3CCLI 1Z6RA 3WHCA 4ZYEA 3AG2H 2LKXA 2DLLA 3F21A 5KVRA 2F2EA 2HDWA 3M3YJ 1LKXA 2KRFA 2DMPA 1LPQA 1XX5A 3G1MA 3ZMDA 4A5MA 3HUGA 4HX8A 3BR5A 2GOMA 3U1KA 1DUXC 2YU9J 1H8AC 3S1NJ 2MH2A 3EETA 4XOTA 5FROA 2F6CA 4LG0A 2RQQA 2TRTA 2E2HJ 5F27A 1AHDP 3W2WA 1AWCA 2OUMA 1U8RA 4P1WA 3A0HC 1ON2A 3WTWC 2PJPA 3OR1C 1TQIA 3CCVI 3I64A 1WKMA 3KEOA 5TISC 1U78A 5EZHA 3WU2C 2CRGA 5D4SA 1K79A 2VN2A 3C2GA 4A6DA 5J47A 3CP8A 3FHZA 2XDVA 4A3GJ 3BTLA 4JYKA 4M71A 3HRSA 2ID6A 5BPIA 3CC7I 1W7PD 5JI6A 4LIVA 2IS4A 1VQ6I 2WADA 4N4NB 1R49A 2JPCA 2CW7A 4B43A 3S15J 1OCCH 1WJDA 3GTMJ 2HNHA 2DA3A 5FLXK 5EEHA 2HYJA 4Q5SF 4XLCA 1MMSA 5J1YA 3GZ5A 1EH8A 3FXOA 3TO7A 4A3EJ 4WXDA 3C7JA 5L3GA 2STTA 1ZHFA 2PQ8A 3ESWB 3QPTA 4JX6A 1J0RA 1ZLJA 2VXDA 3V7CA 2XAHA 3O3KA 2ZCWA 2WAQA 3LSHA 2CV1A 2Z3YA 2OAZA 4E7JA 1SVLA 1ZRCA 1B72B 4M9XA 3F23A 3RI4A 2XF6A 4BQNA 2GLOA 2LNBA 4XN0A 3DEEA 2W7NA 3OSFA 3A02A 1G6NA 1D8JA 4GGGA 5DUKA 5DDGA 1SEUA 3AL0B 2E60A 3QPLA 4RS8A 1XGNA 2A61A 1WZ2A 2P4WA 2XF7A 4GYIA 4IHVA 2PI0A 1JT6A 3H9JA 3ONQA 2JJ7A 2HPIA 4ZDOA 1BC8C 4BNCA 3L2UA 3EDPA 2QM3A 3LSPA 1JXSA 2L2OA 5CQEA 3RKXA 4X6AJ 5J6XA 3KP6A 2BZTA 1RETA 2OJED 3EUKL 5TJJA 2R7QA 4C3HJ 4BL0B 1U3EM 1R7JA 1T6SA 3ZQFA 3QWLA 4BXUA 2F5EA 5D5XB 4BGDA 2DMTA 2PJRB 3LMMA 2QYOA 3J7AO 3CCYA 3GZ6A 5M5WJ 3FM3A 2IA2A 1ZTRA 2VXZA 1EV7A 3CUOA 4N0BA 1FEXA 3ABTA 3MFKA 2VQLA 3I53A 1HOMA 1G59A 3KPHA 3ZMZA 3JW4A 3J81K 1S7OA 5GADJ 1G2HA 2HTJA 1B59A 2E7XA 2NRAC 4L0ZB 1ZGWA 3PIPF 3HG9A 2FF4A 1I27A 3O8HA 1QQIA 2M30A 4PK4A 1B6AA 1LVAA 1FOWA 2DFIA 3GYHX 3SFIA 4BJTA 4HW0A 3LA7A 5BNGA 2FNAA 1YS7A 5HLGA 1O3RA 1IN4A 3V8KA 2FA5A 4CCLA 3K6GA 3DU6A 5D8KB 1CGPA 2V7FA 2HDDA 4Q47A 2IRFG 3FXRA 3PNTA 3PM1A 1JGGA 2LY9A 2DJIA 2FNPA 2OTJI 1D0ZA 2M2EA 1IDYA 1TTYA 2OF7A 3HZJA 5DCFA 4CDGA 4RGSA 4DZPA 2KRCA 2HOSA 1D5YA 1XSXA 1A36A 3R60A 2JN6A 2KLOA 2X1EA 3WE2A 1S3JA 2ZB9A 4G7ZF 1ZELA 2HQRA 1E0EA 3ZN1A 5F1RA 2F48A 3FDYA 1MSEC 4ZZDA 3F8CA 4KN7X 5ED4A 1V54H 3OS0A 1K78B 1WJ5A 3W3CA 2BW3B 2HGCA 1DPUA 2DXIA 1B4AA 3PSIA 1YO5C 2VC0A 2VQCA 2QCOA 1BJAA 2H09A 2H1LA 2X6WA 2XGXA 4HBLA 1G3YA 4IHXA 3EUHC 2BY2A 3L00A 4LG3A 2WB1A 1HKQA 3GCMA 2RGVA 2K9NA 2GZWA 3WGIA 4AM3A 4FISA 2QZ8A 1WFXA 3OYDA 4XLEA 1X2NA 2EZIA 1LUJB 5F0FA 2NVTJ 1TLHB 1HW1A 1I3AA 2UXNA 2MYSA 3N97A 2YX7A 3VSKA 2V6CA 4EQQA 5M3FJ 5L3DA 2PG4A 4IPAA 5FB2A 1E2XA 2CU7A 2HXIA 2MC4A 1FIPA 2DPDA 2A6TA 1YG2A 1ZAOA 5FFZA 5C44J 2PMHA 5HDNA 1TL8A 5KCMA 1R36A 1WHUA 4ZYHA 3BZ6A 5FJ8J 5GTIC 5E1WA 4ENJA 2IJLA 1GUUA 2DT5A 3ZGKA 4D7MA 4E7HA 1RIOH 4GYGA 5J40A 3WTXC 3TW6A 2OTLI 2XKOA 3D1NI 3OYCA 1OQYA 1SMYF 3OOPA 5DD8A 2XKPA 2QUFA 5ILVA 2VJIA 1QPIA 2R7VA 5E8IA 1BN5A 1MMNA 3NRVA 3C2HA 4AC0A 3J80K 2WV1A 1BL0A 1YLFA 2XIGA 2L7KA 2UV1A 5LEJA 1YJ9I 2VBWA 1IW7F 3CJTB 2CW0F 1VTNC 3GFIA 3E5QA 3NAUA 1M1EB 1YRNA 3BCBA 1R6RA 3JCUC 4NDLA 3N05A 1MDMB 1WJBA 4M73A 1YITI 1Y0NA 4FHTA 3HKZA 2DDBA 3HTUA 3L2WA 5E1ZB 1SC7A 2KZVA 3QYEA 3U2RA 4L9JA 4A0ZA 3GTJJ 1W5TA 3TL4X 5CVIA 4DW6A 3CF2A 3KLNA 4HX4A 3HPHA 1P2FA 1VNDA 2BXZA 3N4MA 4ENNA 3H5AA 1RKTA 2O6GE 2F4IA 1EH7A 2EBIA 2KZGA 4XMYA 2VOPA 2DAOA 2X85A 4OIRF 4KN4X 5JLWA 2JA8J 1IRFA 3HEFA 2D1HA 3LFKA 2W25A 4DIQA 2OPTA 1NG6A 4LJZF 3SEQA 1FBSA 1ZG1A 2WTEA 2M4KA 2EV6A 1OISA 2P6SA 3BR2A 1Z0XA 1Z91A 4RAFA 4BXXJ 2K7LA 5HS7A 4D5FA 2V1NA 2ZJRF 3GLLA 3IUOA 2ZSIB 3MQ0A 2DOFA 2MGQA 2Q1ZB 4L5IA 1SFOJ 3CCMI 2M7AA 3ZQQA 1HQCA 2DK8A 3BPXA 2LY2A 1Z9CA 3HGYA 2IA1A 1G3SA 3JRGA 2Z33A 4IHWA 3NWTA 2HOAA 2LOOA 1S5LC 3FMQA 3DTEA 5K5RA 2FRHA 2W00A 1S29A 3OYMA 4G6QA 5LHGA 3M9AA 3WU1B 2RKHA 2HPMA 4DZJA 5D4RA 2AQEA 1P92A 3E6BA 3H3ZA 3PSFA 4P96A 5DCMA 3FXQA 4CCKA 1FMVA 1IXCA 3ZQHA 4Y17A 5LEKA 4IVNA 5AIPA 2LY1A 2WAQN 3JR9A 2XAFA 2ZJ2A 2P5VA 1T39A 4BE2A 3NEUA 5DM6F 4BHCA 2L4MA 4OMZA 5H6QA 5B3SH 1FSEA 1Z3YA 2M0CA 4PFPA 4M74A 5EG0A 2XUBA 1WJEA 2GXGA 1TP4A 2BVLA 4PGHA 1W5CC 4KUMA 4X0GA 4C2TA 2X1CA 3QU6A 1V3FA 2QSFX 1EA3A 3QODA 4MO7A 1MH4A 4IOAF 3PNYA 3OYGA 4P55A 1S6LA 1OCRH 2XPVA 5F0HA 1RUOA 2K02A 3CUQB 1NK3P 2HKOA 2XAQA 3D5SC 3VEPA 4A69C 5J4VA 2OCEA 3HTSB 5FLXZ 1ENHA 3ZN0A 3LL7A 3OYKA 2FOKA 2EH3A 3TOBA 1GDTA 3CDHA 2DO7A 5HLIA 3PQJA 3BLYA 4II2A 3SHFA 4OIQF 5EGOB 1ETOA 2PFBA 2K9MA 2Y0SA 5L3CA 4W97A 4ESJA 4BH9A 2XHKA 4NC8A 1SD6A 4D9JA 3GTGJ 1YHQI 1MNDA 1W1WE 2XVCA 3JRFA 1MSFC 4C2UA 5JHFA 1YTYA 4HNTA 1SVMA 1WJCA 1DPRA 2NNNA 2Z16A 3B73A 3KFWX 4RBOA 3L2VA 1K7AA 4XM3A 1SMTA 3HOVJ 1NTCA 2R4GA 3L09A 1ETKA 4A3CJ 4BUPA 3O6BB 4KT5C 1TWCJ 1C0WA 3MKYB 1YJWI 3AG4H 1FBQA 4IKFA 1PP7U 4MQVA 1KU2A 2L01A 4HQMA 4F7ZA 2R7RA 3I4MJ 4HAMA 2IS2A 4Y3OA 4I0AA 4AYBA 1IRZA 4D1QA 2ESHA 3CJNA 3K9TA 5K7HA 1BI1A 1IV8A 3FXUA 3OL4A 4I98B 5J1RA 1B8IB 1XGOA 1TQPA 1D5VA 2XRLA 1WH5A 2P5KA 4QSHA 2K3FA 4HG2A 2P5LC 4EGZA 1USTA 1R1VA 4EM1A 1FIAA 3B6AA 2JA6J 2VLAA 3J81Z 1YRNB 4RAYA 1IN8A 4ENKA 5H20A 3LA3A 3F0CA 4I99C 3QP5A 4RB0A 5JLXA 3AAFA 3OYBA 4PFOA 4LIUA 2KDZA 5CQGA 1LEBA 2AHQA 2Y9YA 2DBBA 2PN6A 3A03A 4PSWA 1VQKI 2IW5A 1UFMA 2G7HA 2X1DA 4G9YA 1WWXA 2EA2A 2JTVA 2NVQJ 3WTUC 1GLNA 2B0LA 3FKJA 3KEYA 3U1DA 4AU7A 2LREA 3O8GA 1YW7A 3SZPA 1RI7A 3I4PA 5LRSA 2DA2A 2D45A 3K70D 1J2XA 3RYRA 4UXNA 1YI2I 2FQ4A 1DDNA 1OYWA 2WY7Q 4QPQA 3HRUA 2C6YA 3I0TA 1R22A 1Y6IA 4DYRA 2DMNA 2LRDA 2PJRA 4P9FA 1XDUA 3KP4A 3KZIC 1I1SA 1R1TA 3CDIA 1G3WA 1BJZA 3F8FA 4L18B 4BU2A 4G7HF 2KFDA 2B9SA 2LMDA 2LFBA 2RN7A 3ZMTA 2XRNA 2O03A 4ZH4F 2VL8A 4HOBA 3QAHA 2MFZA 2GM4A 3P9CA 2R7TA 5FD6A 3M8FA 1ZRFA 3Q3SA 1KGSA 3WGGA 2E36A 1SAXA 4N9HA 2GQQA 5HNHA 2CH0A 1RESA 3HSEA 4C3IJ 1WI3A 1YW9A 1TT0A 1P9QC 2E5ZA 4KMFA 2FEZA 3WE3A 1QPMA 2K27A 3BR1A 2JWTA 2L4AA 3JREA 1T8IA 3S17J 4BEHA 2RREA 4UV9A 4Z6YA 3M4OJ 4OIPF 1X58A 4BHBA 1JUSA 3HOSA 4R8HA 2GIVA 1ZRDA 1J9IA 2E19A 2ZBKA 1QA6A 2L02A 3HKZN 3QPSA 5ILSA 2VI6A 2Z1DA 3K4BA 4U0YA 3DCFA 4XICA 3H36A 3V42A 3ASOH 3TO6A 4MTEA 1XPXA 1GVJA 2G9WA 2A69F 2H27A 1B9NA 4UB8C 2I8DA 3MKWB 4IHYA 3QP6A 3RCOA 3BG5A 2P81A 1NHAA 4JBAA 2WAFA 5FLVA 3DTKA 3RIRA 2EPFA 4ESFA 3ISPA 3CCSI 4JP0A 4BHPA 3IV5A 1LFUP 3OR2C 2EFOA 2A5YB 3K10A 3GTOJ 2ZXWH 4CUGA 3ML6A 1HLVA 2Q8KA 1BI3A 4UHTA 5FRMA 4WXCA 1S9HA 2DFEA 1K78A 1ZKGA 4J01A 5FKNA 2BW3A 3J80Z 1WJAA 3FBIB 3AKZA 4A0XA 3S2HJ 1QNTA 4RB3C 4NBQA 5FKKA 3G1OA 5CLSA 5F08A 1ZG5A 3HOZJ 2O0YA 2F4OB 3P9KA 2EIKH 2STWA 2NOGA 1YFHA 2HTSA 4LK1F 3HOUJ 1LVKA 4LK0F 3ZOBA 3C2BA 4NC7A 3I3LA 3KP3A 4YIIA 2OU2A 5E1XA 5BQTA 4HNVA 4RGXA 2MLGA 2D2WA 3FBNB 5K5OA 4MQ9F 1UHWA 3RZDJ 2VKVA 2HI3A 3NQOA 4QLCU 2CWEA 3FXKA 4BQAA 1MBEA 2PMZA 3KCCA 3SEZA 2OQGA 1UHMA 3DFGA 4Q4ZF 3I5UA 3WTVC 3MVPA 1K83J 3CESA 5E18F 1OCOH 2P0WA 4M3FA 3FISA 1XMXA 2FBKA 4KA4A 4EJVA 2MD5A 3K7AJ 4PDKA 3COAC 2GBYA 3BC8A 2K40A 4HLYA 4CCJA 3RKYA 2E1MC 2BHYA 3S2DJ 1SD7A 2MW8A 4BJ5C 3S93A 2M7BA 3CCEI 3ZMSA 4YFXF 1TWFJ 4PJLA 4M3BA 1IRXA 4B3AA 4HRIA 3KYDB 2QSHX 3HOTA 1IUFA 2JRMA 2W1OA 3R0AA 4FX0A 4OMYA 2KL4A 5GAEJ 2K3PA 1O3QA 1MDMA 4XN3A 3RTRA 1HKTA 2XC7A 2E71A 4A3LJ 2KJBA 2ZNZA 3A0BC 3W6VA 1N78A 3CCUI 2X9DA 3QYFA 4UVBA 3HB9A 4F52A 2B7EA 1TW2A 1A6IA 4OAZA 2ZFWA 4L5JA 1WJFA 1ON1A 2Y0SN 1IJWC 1R58A 3BR3A 4XK4A 1NK2P 2BHZA 4RGRA 5J8FA 1XD7A 1ACIA 5IYDJ 2F4MB 3M07A 3OWTA 3CUQC 2OCCH 1W4MA 1LFBA 1XGMA 3DPLC 1LB2A 1D1AA 1D3YA 3IH3A 1X1CA 4II3A 1Y1WJ 2EA4A 3Q9SA 3T5XA 2JA5J 1OR7C 1T98A 4IRIA 4RM2A 1XCVA 3CF5F 3F22A 4FASD 2JA2A 4F91B 2H6CA 2HQ5A 2XB0X 3TP3A 1BR2A 2XSJC 3CJQB 3OYJA 3X2QH 2DMUA 1OFCX 3F8MA 3MWMA 4KYWA 4NB5A 4HF0A 3I9V2 4AYBN 3JRCA 3IRQA 5LGTA 4OU0A 2K9QA 4I0BA 1IC8A 2MLKA 1TC3C 4IQJA 2KDOA 5KHDA 1X3ZB 2ZXHA 3CZ6A 4E7IA 3RZOJ 2VKDA 3LQRA 1XMAA 1FY7A 2R5YB 1U8BA 3HL2A 2L7FP 1K6YA 3LAPA 2QF7A 4G7OF 5F04A 2HYGD 5CYVA 3SZGA 2YU3A 3RPUD 3G3ZA 3QPHA 3BJ6A 4BEHB 4TV7A 3CDLA 3BZKA 2G0EA 1JTXA 4UVAA 1OYYA 1H0MA 2ICWG 4HNUA 3F72A 3FX3A 1FNNA 1TWGJ 2LG4A 4IRGA 1N77A 3HOWJ 3LOCA 4KISA 2Y75A 2QA4I 3JRDA 3K4MA 5FD5A 2VJ5A 1TQMA 3DPTA 2COBA 3TGNA 2W4SA 2ELJA 3REOA 4C2MJ 4YRVA 3BTJA 4PSXA 3CLQA 3VSLA 2NAZA 4LLGF 4IHSA 2K4JA 3K1PA 2K85A 1MMAA 4Y4RA 2EIMH 1H89C 1P7JA 4XONA 1AKHB 1PVEA 1PDNC 5C4XJ 4EVIA 1YQAA 4MEXF 4NNJA 1ITYA 4I01A 4I2OA 3DKWA 5LFAA 4B4CA 3E0JB 2RNJA 3RKWA 4B48A 3PUBA 3CUQA 2OV7A 5TRDA 3W2AA 3EPZA 4I09A 5HNFA 4XKBA 2IAIA 2HVQA 4UUVA 4R79A 4KJZA 4MEYF 4P5OA 4U0WA 1FTTA 2JA7J 3WG7H 1R23A 2M1BA 4BAYA 4ZYGA 2EZLA 5EGOA 1ZG3A 2M4GA 5FO5A 2DOEA 4RMNA 3VYRB 2ADUA 2Z2SB 4AIJA 3VPRA 4DBRA 4I7HA 1ODDA 1ETYA 3GLXA 3IWFA 3B02A 3UKGA 1FOKA 1R1UA 3HBLA 1UB9A 2EV5A 3LSMA 5IYBJ 4F3QA 5HS9A 5D5UB 4OOIA 4ZTFA 3SXYA 3HM5A 3ROUA 5H6RA 2JVGA 1WGXA 2M0MA 3EUAA 5DEQA 3LA2A 2CSOA 5IP9J 2DFHA 3V7RA 3DLAA 3FXMA 2X48A 1W0TA 3BR6A 4M3EA 1VQ5I 5GAHJ 2R7ZJ 4J19A 2HZDA 2FX0A 1G4DA 1OCTC 3FMSA 3P9IA 2CV2A 1EF4A 3H3VK 2FBHA 5E3LA 2K5CA 4G6DA 4LOCA 2FQ3A 2GA1A 1B8IA 2DODA 3PO3J 1RC9A 2L7MP 5LHHA 1USSA 4RB1A 4EATA 4WWCA 1Z6TA 3G4SI 1MJBA 3DKXA 1L0OC 1VQ8I 4M6YA 3R6SA 4E7ZA 2JT1A 2R92J 2LR8A 2YX4A 3K2AA 2VB6A 1D0XA 2L7ZA 1IN6A 2AXLA 2J5OA 2XF5A 3IKVA 1Z77A 2KT0A 1J59A 2QENA 2XAJA 4UNOA 2V79A 1ULYA 4HF1A 4JK1X 2DT7B 2Y31A 5FKOA 3GVAA 3CMMA 2JVHA 5JR3A 3C1DA 3MZ8A 1E17A 1WVRA 1W7PB 4E7SA 3GTLJ 1SFEA 2HVRA 2QLZA 1UZCA 4XBFA 3ABKH 2DQLA 3BROA 1K61A 3KE2A 4RM3A 3EUHA 3TO9A 2DT6A 2CUEA 4GDFA 1MBGA 3BZCA 1GHCA 3BG9A 3ZP5A 2R7SA 4MIMA 2A3SA 3D0SA 1W36D 2WBMA 5E17F 4HYEA 3A01B 2NVYJ 5E3MA 3CC4I 3IHUA 3FF5A 2DOAA 1YX5A 2RNGA 3K4NA 1RUNA 1KYZA 1UJ8A 2IBDA 2ZC2A 1F5TA 5EZGA 4XL9A 2H6BA 4GXOA 5GP9A 4KIGA 1Z7UA 2X0LA 3FIWA 4XSXF 3GBGA 1JUMA 4I76A 4L9NA 1P4XA 3IRRA 2EFWA 1IN7A 3LSIA 4K2EA 1F1ZA 2VQGA 3WG9A 4IXAA 4CH7A 2MG4A 2BY0A 1FOXA 1X19A 4XLPF 2E1MB 1RR8C 1V55H 3K4LA 3RDIA 4H0EA 3W6KB 2BEOA 2L3DA 2OC6A 2DTZA 3H5RA 2GIZA 4C30A 1I5ZA 5LRRA 1JI8A 3RKQA 3GW2A 5EDNA 2DJNA 1H9GA 1KU3A 2IA0A 4AIKA 4XKVA 2CGPA 3QRFF 4ZYDA 4UVCA 2AO9A 3WU0A 1TWHJ 1X2MA 3OL3A 4HEA2 5GPAA 5IYCJ 3OYLA 3OYIA 1HF0A 2JQ7A 4KDPA 2R7UA 5CJ9A 3BJAA 3L1PA 1GV5A 2KISA 3L2RA 5E3NA 1LQ1A 1XSDA 1R00A 1H88C 1SD4A 3W6JB 2Y9ZA 1ZGJA 1LDDA 2CUZA 2ME6A 1MNEA 1SFKA 3LAJA 3OS1A 3CQZJ 2QKLB 1HXDA 3OIPA 2DMQA 4QTRA 1G3TA 1MKMA 1JE8A 2CQNA 5BMZA 3LSGA 2D1VA 1FTZA 5CVVA 2L0KA 2VONA 2VC1A 1YOVB 3M7GA 1ZR2A 2ZFUA 5EEAA 3B6CA 3I59A 1POGA 2LTPA 5FKMA 2R7DA 4BDYA 2BY1A 4F93B 2Z5UA 1KZHA 3E3VA 1Q1HA 2KIFA 4XRSG 3T1BA 4EEFG 1MZBA 4XLNF 3DPUA 4UV8A 2ZKZA 3I71A 5IOZA 4OAYA 4PUSA 3ZMUA 5EYRA 4BQQA 1FPQA 2VOOA 2M8GX 4KIFA 1RPWA 4M3GA 3QQAA 4BJ6C 3ERED 1PUFB 2ELKA 4YIFA 1FYKA 5L3FA 1E3PA 3TDUC 2VODA 4ANJA 5JVTA 1E3HA 1YIOA 4F92B 3DQVC 2QQBA 2WV0A 4W1UA 2D5VA 5J4YA 1ZQ3P 2BVMA 2LYCA 3DEWA 4CYCB 2VE8A 3S16J 2IEKA 3K4JA 4QWQA 4BQOA 1LJ9A 5IT3A 5C4JJ 3OS2A 4XLAA 4IHTA 2A5WA 2DA5A 4G94A 5FKLA 2DTRA 4MTDA 3S1MJ 4LGWA 4U7DA 1MBKA 2M8EA 1K6OA 4AVPA 1YX3A 1QHHD 2Y48A 2XASA 3EYIA 4NQWB 4UB6C 2PX9A 3IP4B 2EJRA 2O5RA 4M72A 4YFKF 1XC5A 1AU7A 1TW3A 1HBXG 3K70C 2FOWA 1BA5A 3BTCA 2FXAA 5FFXA 2RC4A 4CYDA 4NUBA 2NNYA 4GFBA 1UHSA 3KX2A 2GOXB 2KPMA 2YSRA 3KLOA 3OSGA 2GXAA 3HOXJ 1Z21A 2R0QC 3OOUA 2I10A 3ULQB 4CZCA 2VASA 2L9RA 2F5DA 3S1QJ 3E1SA 1MNMC 1X1AA 4M9SA 2LBFB 4KFCA 2FUG2 2XPWA 3GFMA 3KZYA 5CVJA 1CF7B 5J8CA 2A6HF 2K9SA 1T38A 5DM7F 2FD5A 3GFJA 4I6ZA 3BG6A 2YS9A 2WB1N 4RGUA 3HOYJ 3ZXSA 1FZPB 2QSGX 1EJ9A 1U5TC 4MLOA 4V2GA 1GVDA 4G8XA 5K1YA 2XSDC 4ZTJA 4KT6A 4S05A 4DBQA 2R7XA 3G73A 1MH3A 2DA1A 4LLLA 4MNUA 3CP2A 3GXOA 4OINF 4X1EA 4FCYA 1F43A 2Z9OA 5DS9A 1U2WA 2Y2ZA 3RQIA 1STZA 1JTYA 3D5LA 5ERIA 4EJUA 4JX5A 4AVZA 2LD5A 2GA2A 3LFUA 2WAEA 1I6HJ 1UG0A 2MBFA 1WPKA 2PEXA 1SFXA 4I02A 2NXNB 2LK2A 2M9HA 4M6VA 1JJ8C 2RV8A 1L3LA 1KU7A 1R4MB 3C18A 4C3JJ 2Q0OA 2LH9A 1AOYA 2ETHA 4L9TA 1IN5A 2LVSA 5F64A 3DEUA 3VYUB 3LWFA 4D0PA 1RNLA 3TP0A 5F1JA 5F0CA 2UWMA 2QKMB 2R5YA 3HC7A 1UMQA 3AG3H 4B1RA 3OYAA 2GXBA 1GXQA 1QU3A 5LBQA 1P7IA 4IEJA 1QBJA 3OV8A 5B1AH 2X6OA 3BJOA 1SANA 4D7NA 1VQOI 2E1NA 1VZ0A 3TMOA 2W84A 5TGTA 2LKPA 1X3UA 2R7WA 4E4HA 2L5QA 4HX7A 2CQQA 3KP7A 2ZSHB 1XN7A 2ID3A 3RJPA 3ABUA 4XRMA 3I54A 1I3QJ 4U7BA 5M3MJ 1HW5A 2IGOA 4EJTA 1ZN2A 3MAJA 4EJWA 1TNSA 2OZ6A 2CS3A 1XDSA 3MEXA 4FT8A 4HV6A 3I58A 2KRHA 3FK6A 2KJCA 4E7LA 4HA8A 1BIAA 4ABZA 1AKHA 1BW6A 2BBYA 1BM9A 5JHUA 4YFNF 1VQNI 3FZVA 4OWRB 1LE8B 1IXSB 5A2QK 3ZR8X 2WY8Q 3ECOA 4KIBA 3WTTC 3R4KA 1O57A 1O3SA 3I59B 1BOAA 3KP2A 3SFZA 3CMEI 1VFCA 4B8XA 5K7FA 2LDUA 2VJ4A 2DN0A 3Q0UA 1WSUA 3T8TA 1WCMJ 4M9ZA 2IP2A 2E2IJ 2X6YA 5D6EA 1VQMI 2L54A 4A3FJ 1MW7A 4XIDA 4ITVA 1BBYA 2A05A 4LFUA 4UY8I 4AUXA 3PFIA 2LLKA 4N9IA 4DQ2A 4YG2F 2BXYA 1J7KA 1YW8A 3DBRB 3LSJA 2E34A 3WTYC 3ELKA 3ASNH 3DWLE 2KKOA 4HSTA 3BG3A 4AIHA 4V2FA 5BPDA 1O7FA 3AFHA 2DDAA 1A5JA 1D1CA 3V8JA 3S3OA 4XSZF 1FYLA 2ZXJA 1DQUA 4EJOA 4HDUA 1V4RA 4XLHA 1D1BA 5E3OA 2V9KA 3R0JA 3CD6I 1W5SA 2LSOA 4JOMA 1WH7A 2CMPA 5IPAA 4Y33A 5LLQA 5L3EA 1BW5A 1X4PA 1OJLA 1JGSA 4PJNA 2DCEA 1ZR4A 1T56A 1I1GA 2BV6A 3GFLA 3H9QA 4NHJA 1IO2A 2L9NA 4RA2A 3Q5FA 2G7UA 2H1KA 3K2ZA 9ANTA 1D8KA 3H92A 1HC8A 2BYVE 4N4OB 5C3EJ 3JRIA 4A5NA 1UAAA 5DUIA 1P4AA 2FU4A 3KYLA 2MH9A 4JQFA 3PO2J 3V8LA 1QRYA 1V5GA 2L9SA 4KITB 4EMSA 3FKIJ 3ERMA 2F5VA 1VQ9I 3HRMA 5FRNA 3S8PA 4XKWA 4CSWA 2R7OA 3TQNA 2EFQA 4AWXB 1OMIA 5J1UA 4FTHA 2HR3A 4ENMA 5HDGA 1LDKB 4HQEA 3CTAA 1SFUA 2NOJB 5B66C 4HV5A 3F6OA 3BTIA 2CFXA 2JK3A 3KIOA 4XQFA 3E6DA 3SDBA 4CCOA 3CMYA 3I4NJ 3BWGA 1LFPA 3FK7A 1S8NA 3TW7A 1IF1A 3ZQLA 3GMEA 1YS6A 1OCPA 1OCZH 2DI3A 3F9KA 2X4HA 1W7PA 4BE1A 5D5WB 1OLTA 1QO0D 5LD2C 1DP7P 3UNGC 3BY6A 2HS5A 2AXTC 4ZDPA 1F9NA 1U9NA 4LB6B 2ELHA 4E70A 1JHHA 1BI2A 4A0YA 1A04A 5LHIA 2EFPA 1APLC 3OY9A 4ZC3A 2KHMA 5JFRA 3ZRGA 2IT0A 1Y8RB 1H9TA 2ISZA 3E7LA 1K4TA 3NARA 3U21A 3JRHA 1ZLKA 2MSYA 4EM2A 2AS5F 3A01A 2GAUA 2BOLA 4UUSB 1PJRA 1U6GA 3Q9VA 1Y0UA 1X1BA 5B5EC 3PQKA 2Y69H 3FXJA 2LKSA 1ONVA 4IRHA 1DGWY 3LSRA 2R93J 3QOEA 3HYIA 3HJEA 4RLQA 3PUFA 3H1CA 1QZEA 3ZQIA 4RB2C 4U0VA 1K4SA 1JT0A 3ZMVA 2QQ8A 4ZJZA 2W82A 3L7WA 3KYCB 2KP6A 5KAFC 4BY7J 3JTGA 5BOXA 2IGMA 2E35A 1TBXA 1IXRC 2M34A 1XSVA 1E3OC 1HA8A 2ZXIA 1MIJA 5CKTA 3I55I 2JRTA 2LP0A 2HWVA 3GEZA 4NC6A 1GV2A 2B63J 3RPQA 4A3JJ 1ETXA 2UUZA 5KNLA 3RSNA 4WXHA 1AA7A 3DTIA 1Z67A 1BI0A 1Z7LA 5ICEA 3FHNA 6PAXA 2VBYA 2XGEA 1IAWA 5L3BA 2LC2A 2A68F 2IVMA 3ABLH 1B9MA 1KONA 2JPBA 2K9LA 2PBIA 4WF2A 2IS1A 4YELA 5IT9K 2YR2A 4YEJA 1UCRA 1PP8F 2BGCA 3SQNA 3HXLA 3T0YA 3GUDA 3M1EA 1FC3A 2NVUB 1I50J 3W2VA 2FMYA 3CO6C 2K4BA 1A31A 2OA4A 2R5ZB 3H9GA 3EYYA 4WCGA 2HDCA 2J5PA 3IL2A 1U5TB 1DP3A 2N8GA 3HGGA 1MD0A 1IZ1A 1N75A 3HHGA 4PJJA 2Q2EB 2JZYA 3CO7C 1FOYA 1BOBA 4ZYAA 3RPUA 1OPCA 3IC7A 3SDGA 1TT5B 2EZHA 2BY3A 1IV6A 2NS8A 4IJAA 2HKXA 1Z05A 3ZQGA 1YYVA 1OR7A 3ECHA 1JJ6C 3E6MA 1FP2A 2JUCA 1UG2A 1Z3XA 2QBYB 2VJJA 2PMUA 5KAIC 4FE4A 1RRJA 3IAS2 1QGPA 2UZKA 4EGYA 5CPRB 5FLMJ 2ECCA 2ZMEC 3GF2A 1B1BA 2CYYA 3KZZA 1P4WA 4XR6A 5GTHC 1PUFA 4O3MA 5H2FC 2ISYA 4M3DA 4G12A 3HUGB 4B3XA 3PIOF 3WTZA 1WI9A 1R5GA 3HSFA 2EFNA 3JAMK 4LG0B 3O2PE 1NH3A 3F3XA 2HQAA 2O7OA 3BPVA 4AD9A 2MA3A 2M5WA 1BIBA 4GO1A 1T2KA 1XMKA 4YIRX 4CYCA 4B09A 4IF4A 3DXJF 4U88A 1GXPA 3DBHB 3FM5A 3OIOA 1CQTA 3OYHA 5J3LA 2H94A 3GZNB 1IG7A 1YE9A 1F36A 4R1HA 1GT0C 2ZJQF 2F5FA 1LDJA 2OQRA 1DGRM 1YIJI 3C3WA 3MD2A 2HEOA 2XB5A 4NQWA 3SZTA 5LGNA 4A3DJ 2FMLA 1FLIA 1S7EA 2V1XA 2HOEA 3DU5A 3TBIA 2A6EF 2GWRA 4GCVA 1OKRA 3LSKA 2CV0A 3K0LA 4AIDA 4DOZA 3JSOA 2DU9A 3BR0A 4MHGA 1VI0A 2O8KA 3E6CC 1W36C 3OYFA 4O5VA 5M5XJ 4Y7NJ 3DBLB 4ON0A 4PCQA 4BACA 1ETVA 2V9PA 2DFFA 4DYCA 1JKRC 3A4CA 2VQHA 5DD4A 2E7WA 3WTSC 2DK5A 1N25A 2LBFA 5D5VB 5ICFA 3A1YA 2H8WA 2ZNYA 1Y1VJ 3P5JA 1FWZA 2VT3A 3R61A 1CF7A 1G8XA 3OMYA 4FETA 5M5YJ 3G1LA 2EQRA 5EF6A 2H8RA 2NVXJ 2P8TA 2ZO4A 4H4KC 1FP1D 3E5UA 3TKYA 1SAUA 2CW8A 2KIQA 2V9VA 4MFEA 4J00A 2HZTA 3M1CA 1FMWA 1MGTA 2R3SA 5GPCA 3L2CA 3A2KA 2DYSH 2DA6A 2K86A 2QVOA 1ZREA 2DA7A 5ICGA 3DV8A 3JSPA 1VQ7I 2EV0A 2OZUA 3MKLA 2IPQX 3K4CA 2ZMEA 2M87A 1X3WB 5E8GA 3CCRI 2VKEA 3HRTA 4Q48A 3BQZA 3H0DA 4V19K 2RVCA 2YPRA 2XROA 3BT9A 3L9FA 5HLTA 2RDPA 2QQ9A 4PGGA 3MZHA 1HDDC 3MKZA 3H5NA 2PMZN 3GTQJ 1ZGAA 3S1RJ 4XORA 3MN2A 2O8XA 4CA0A 2PLYA 3Q0VA 1FX7A 1VQPI 1JKQC 2HXOA 2MABA 4A3BJ 2JUGA 3PL8A 3WODF 5A2QZ 5HODA 2E1OA 4MFDA 5HDKA 3WHBA 5FGMA 2V4JC 2VBZA 3GX4X 2E2JJ 1BR4A 4M6XA 5GAGJ 3J7ZI 3MZYA 4IOCF 3V7SA 2QGUA 1R9TJ 5ICCA 3K4KA 3J7AY 2W48A 2W24A 4IO9F 5JVGF 3P7NA 3IAM2 1KQ9A 2I5UA 3BCAA 2W85A 3CC2I 3HSRA 4B44A 1XG1A 4XNFA 3RQ4A 3G6EI 1PUEE 1OYIA 4IQ4A 4C9YA 1Z1DA 2VUMJ 2TDXA 2DQRA 5AONA 3OYNA 1I6XA 1KQ0A 4CZZA 3DKYA 4E6KG 5DYMA 2E1CA 2IGNA 1ERDA 4BY1J 2Y0MA 4XKCA 3IKTA 2XPUA 3JRAA 3PNVA 1HDPA 3K1NA 4LD5A 1DU6A 1T33A 3ZCOA 1ZYRF 3ZQCA 3AG1H 2FE3A 3D5RC 3M8EA 2DPUA 4A12A 2CQKA 1IDZA 4PJMA 1HKSA 2KIUA 1T95A 1FYMA 3MMYB 3U9GA 1VQ4I 3ZQ7A 2HFHA 4FE7A 4UUTA 3BQYA 2V26A 4HF2A 2IS6A 2BE5F 4QPOA 1LE8A 4HZFA 2Z99A 2X6XA 5F6FA 1ZH5A 4BYYA 1ZK8A 2XAUA 1XB4A 2L9VA 3S2WA 3HPGA 4KICA 3DF8A 3GWZA 5DV5A 4CGZA 4LLNA 1TWAJ 3I56I 2XAGA 5HS8A 3IWZA 3H0GJ 4DGWB 2VT2A 1O7LA 1MBFA 4B47A 2XGCA 3H35A 2EZKA 3SYTA 5K7ZA 3FMRA 1EH6A 1XTAA 3VODA 2YUSA 4IZZA 3AL0C 3OYEA 4S04A 4DJAA 3LNQA 1Y8QB 4EM0B 1TZLA 2KQRA 2DA4A 1VF9A 1XCBA 4HSRA 4XRSA 2OD5A 4ASNA 5D8LB 5LGUA 3HDDA 5HVQC 4BE0A 5EJCA 1T0FC 2VIXA 3BOQA 3BG7A 4QIWN 4CXFA 4CHUA 2EK5A 3S32A 3SJMA 1XGSA 3NWSA 2FBIA 4WK8F 1Q1VA 5IY5H 3KETA 2FJ1A 1ZARA 4A93J 3Q0WA 4L9VA 5CVUA 1BR1A 2EILH 4XLFA 4IX7A 2QQAA 4BDZA 4ZZLA 1Y56A 1V5EA 5IP6A 1R4NB 4KNYA 3VFZA 1MMDA 2ME0A 4CCMA 4CO8A 3GO5A 4Y15A 4HDVA 2HYFA 2ACJA 3IH4A 2TCTA 1R71A 2IXSA 4PJ0C 4RDUA 3GTKJ 3LQQA 2KIMA 4BBSJ 1RR7A 5D6FA 3TEDA 3ZPLA 3K1MA 2O3FA 4WX9A 4RLFA 1IRGA 1HSTA 2R7FA 1XS9A 5HOOA 3J7YJ 1JKPC 1J5YA 1U0JA 3CJRB 2WC2A 1A35A 3PFYA 1QZZA 4BBRJ 1REPC 4U87A 1LEAA 1R5ID 4D5CA 2MD0A 2P6TA 3TOAA 1F4KA 1J09A 4CICA 2QEXI 4Z2YA 3CCJI 5E79C 1X4OA 3VB2A 3CMAI 1ORKA 2P7VB 3MCZA 4P9UA 1FT9A 3ABMH 2UXXA 1V5FA 1WRJA 5HLHA 3VYTB 2NYXA 1KU9A 2M45A 3OIQA 1S7AA 1ETQA 2CQ7A 4HPQA 1FBUA 2JSCA 5CVRA 4IL6C 1W0UA 2FSWA 5DTDA 2EIJH 2P7CB 3FXLA 4XRFA 1B72A 4A3KJ 4BS9A 2HQNA 3M8JA 4F55A 4O6JA 2NS0A 3UR3C 3GTPJ 1MJ9A 1ETWA 1QHGA 1R5HA 4PZJA 4DYQA 3KP5A 4L0YB 1JHFA 4KMUX 2ZMEB 3PJRA 5K5QA 3KEQA 2A07F 4LITA 1RZ4A 2RAEA 4CCNA 3G71I 1IGNA 4OIOF 3F8BA 3VOEA 1U9OA 3WGHA 4Y13A 1MJAA 1T0FA 4UUSA 1TNTA 2JSPA 1I39A 5IT9Z 1JUPA 3BP8A 1HSJA 1P6RA 2HOTA 2RQPA 3VWBA 1LNWA 1UELB 2NS7A 3H3UA 4FX4A 2IGKA 1X1DA 2DW4A 5IP7J 3FWEA 4JX4A 2CG4A 3S14J 1SVOA 3V4GA 4RAZA 2DYRH 1VQLI 5BS6A 3HHHA 1QZYA 3JTHA 3HIFA 3L2QA 2VBXA 1YJNI 3E97A 1Y39A 2O61A 2QWWA 5AIQA 1WQ2A 3QYBA 5KK1A 4L5EA 1FSHA 2MC3A 5ILUA 2JMWA 1RKWA 2F5CA 2XGDA 5EEGA
chains in the Genus database with same CATH topology
3DP7A 1KA8A 3BDDA 2CO5A 2VE9A 4EV0A 4LMYA 2EWNA 4DNCA 1KYWA 1O3TA 5E20A 4ESBA 2OBPA 4A6EA 1HW2A 5DCMB 3JAMZ 3CLOA 2COMA 3RYPA 1KQ8A 1BC7C 3LSTA 1IUYA 2WWYA 2W57A 1U5TA 2EB7A 3E5XA 3T8RA 2Q2EA 3F6VA 2LF7A 3QU3A 2ESNA 3QOPA 2LF8A 2XV4S 4LB5A 2V1DA 3TDZC 2V1UA 3EQLF 3F8NA 4ETSA 3K69A 4MGRA 1J75A 2QBYA 1SD5A 4A2UA 4HLXA 1Z6RA 4ZYEA 2DLLA 3F21A 5KVRA 2F2EA 2KRFA 3ZMDA 4A5MA 3HUGA 4HX8A 1DUXC 2MH2A 3EETA 4LG0A 1AWCA 1U8RA 2PJPA 1ON2A 3WTWC 1TQIA 3I64A 1WKMA 3KEOA 1U78A 5D4SA 1K79A 2VN2A 4A6DA 3FHZA 4M71A 5BPIA 3HRSA 1W7PD 5JI6A 2JPCA 5FLXK 5EEHA 4Q5SF 3GZ5A 1EH8A 3TO7A 4WXDA 3C7JA 5L3GA 2STTA 1ZHFA 2PQ8A 3QPTA 1J0RA 1ZLJA 3V7CA 2XAHA 3O3KA 2ZCWA 2Z3YA 2OAZA 1ZRCA 4M9XA 3F23A 3RI4A 2LNBA 1D8JA 1G6NA 4GGGA 5DUKA 5DDGA 4RS8A 1XGNA 2A61A 2P4WA 4GYIA 2PI0A 1BC8C 4BNCA 3EDPA 2QM3A 1JXSA 3RKXA 5J6XA 3KP6A 5TJJA 1U3EM 1R7JA 1T6SA 4BXUA 2F5EA 5D5XB 2QYOA 3J7AO 3GZ6A 3FM3A 2IA2A 2VXZA 1EV7A 3CUOA 4N0BA 3ABTA 3MFKA 3I53A 3ZMZA 3JW4A 3J81K 1S7OA 2HTJA 1B59A 2E7XA 2NRAC 4L0ZB 2FF4A 1I27A 1QQIA 2M30A 1B6AA 1LVAA 2DFIA 3GYHX 4HW0A 3LA7A 2FNAA 1YS7A 5HLGA 1O3RA 1IN4A 3V8KA 2FA5A 5D8KB 1CGPA 4Q47A 2IRFG 3FXRA 2FNPA 1TTYA 5DCFA 4CDGA 4RGSA 1XSXA 3R60A 3WE2A 1S3JA 4G7ZF 2HQRA 3ZN1A 5F1RA 4ZZDA 3F8CA 4KN7X 5ED4A 1K78B 2HGCA 1DPUA 1B4AA 1YO5C 2VC0A 1BJAA 2H09A 2XGXA 4HBLA 1G3YA 3L00A 1HKQA 2RGVA 2GZWA 3WGIA 2QZ8A 1TLHB 1HW1A 2UXNA 3N97A 2YX7A 2V6CA 4EQQA 5L3DA 2PG4A 4IPAA 5FB2A 1E2XA 2DPDA 1YG2A 1ZAOA 5FFZA 2PMHA 5HDNA 1R36A 4ZYHA 3BZ6A 5E1WA 4ENJA 2IJLA 2DT5A 1RIOH 4GYGA 3WTXC 2XKOA 1SMYF 3OOPA 5DD8A 2XKPA 2QUFA 5ILVA 5E8IA 1BN5A 3NRVA 3J80K 1YLFA 2XIGA 5LEJA 2VBWA 1IW7F 2CW0F 1VTNC 3GFIA 3E5QA 1MDMB 4M73A 4FHTA 3HTUA 5E1ZB 3U2RA 4L9JA 4A0ZA 1W5TA 5CVIA 3KLNA 4HX4A 1P2FA 3N4MA 4ENNA 2O6GE 1EH7A 2VOPA 2DAOA 4OIRF 4KN4X 1IRFA 2D1HA 3LFKA 2W25A 4LJZF 1FBSA 1ZG1A 2WTEA 2EV6A 2P6SA 1Z91A 2K7LA 5HS7A 3MQ0A 4L5IA 1HQCA 2DK8A 3BPXA 1Z9CA 2IA1A 1G3SA 2Z33A 3FMQA 5K5RA 2FRHA 1S29A 4G6QA 5LHGA 3M9AA 3WU1B 2RKHA 5D4RA 1P92A 3E6BA 3H3ZA 5DCMA 4P96A 3FXQA 1IXCA 4Y17A 5LEKA 4IVNA 5AIPA 2XAFA 2ZJ2A 2P5VA 1T39A 3NEUA 4BHCA 4OMZA 5H6QA 2L4MA 1FSEA 4M74A 2XUBA 2GXGA 4PGHA 4KUMA 3QU6A 1V3FA 4P55A 1S6LA 1RUOA 2K02A 3CUQB 2HKOA 2XAQA 3VEPA 3HTSB 5FLXZ 3ZN0A 2FOKA 3TOBA 3CDHA 2DO7A 5HLIA 3PQJA 3SHFA 4OIQF 2PFBA 5L3CA 4ESJA 4BH9A 2XHKA 1SD6A 2XVCA 1YTYA 1DPRA 2NNNA 3B73A 3KFWX 1K7AA 1SMTA 3L09A 3O6BB 4KT5C 1C0WA 1FBQA 1PP7U 4MQVA 1KU2A 2L01A 4HQMA 4F7ZA 4HAMA 4I0AA 2ESHA 3CJNA 3K9TA 1BI1A 3FXUA 4I98B 1XGOA 1TQPA 1D5VA 2P5KA 2P5LC 4EGZA 1USTA 1R1VA 4EM1A 3J81Z 4RAYA 1IN8A 4ENKA 5H20A 3LA3A 3QP5A 4RB0A 3AAFA 1LEBA 2DBBA 2PN6A 2IW5A 1UFMA 2G7HA 4G9YA 1WWXA 2EA2A 2JTVA 3WTUC 2B0LA 3U1DA 1YW7A 3SZPA 1RI7A 3I4PA 5LRSA 2D45A 1J2XA 3RYRA 4UXNA 1DDNA 1OYWA 3HRUA 2C6YA 3I0TA 1R22A 4P9FA 1XDUA 3KP4A 1I1SA 1R1TA 1G3WA 3F8FA 4L18B 4G7HF 2RN7A 3ZMTA 2XRNA 2O03A 4ZH4F 4HOBA 3QAHA 3P9CA 5FD6A 3M8FA 1ZRFA 1KGSA 3WGGA 1SAXA 4N9HA 2GQQA 3HSEA 1YW9A 4KMFA 2FEZA 3WE3A 1QPMA 2K27A 2L4AA 4UV9A 4OIPF 4BHBA 3HOSA 4R8HA 2GIVA 1ZRDA 1J9IA 2ZBKA 2L02A 5ILSA 4U0YA 3TO6A 4MTEA 1GVJA 2G9WA 2A69F 2H27A 1B9NA 3QP6A 1NHAA 4JBAA 3RIRA 4ESFA 3ISPA 4BHPA 2EFOA 2A5YB 3ML6A 2Q8KA 1BI3A 4UHTA 4WXCA 1K78A 3J80Z 4A0XA 1QNTA 4RB3C 5CLSA 1ZG5A 2O0YA 3P9KA 2STWA 1YFHA 2HTSA 4LK1F 4LK0F 3KP3A 4YIIA 2OU2A 5E1XA 5BQTA 4RGXA 2MLGA 2D2WA 5K5OA 4MQ9F 1UHWA 3NQOA 4QLCU 2CWEA 4BQAA 3KCCA 2OQGA 1UHMA 3DFGA 4Q4ZF 3I5UA 3WTVC 5E18F 2FBKA 4KA4A 4EJVA 2MD5A 3COAC 4PDKA 4HLYA 3RKYA 1SD7A 3ZMSA 4YFXF 3HOTA 3R0AA 4FX0A 4OMYA 1O3QA 1MDMA 3RTRA 1HKTA 2KJBA 2ZNZA 4UVBA 1TW2A 2ZFWA 4L5JA 1ON1A 1R58A 5J8FA 4RGRA 1XD7A 3CUQC 1W4MA 1XGMA 3DPLC 1LB2A 1D3YA 2EA4A 3Q9SA 3T5XA 1T98A 4IRIA 1XCVA 3F22A 2H6CA 3F8MA 3MWMA 4KYWA 4NB5A 4HF0A 3IRQA 5LGTA 4OU0A 4I0BA 2MLKA 3LQRA 1XMAA 1FY7A 3LAPA 4G7OF 2HYGD 5CYVA 2YU3A 3G3ZA 3QPHA 3BJ6A 4TV7A 4UVAA 1OYYA 1H0MA 3F72A 3FX3A 1FNNA 4IRGA 2Y75A 5FD5A 1TQMA 3DPTA 3TGNA 3REOA 2NAZA 4LLGF 4IHSA 2K4JA 3K1PA 1PDNC 4EVIA 1YQAA 4MEXF 4I01A 4I2OA 3DKWA 2RNJA 3RKWA 3CUQA 5TRDA 4I09A 4UUVA 4R79A 4MEYF 4P5OA 4U0WA 1R23A 2M1BA 4BAYA 4ZYGA 1ZG3A 5FO5A 2ADUA 4AIJA 4I7HA 1ODDA 3GLXA 3IWFA 3B02A 1FOKA 1R1UA 1UB9A 2EV5A 5HS9A 5D5UB 4OOIA 3SXYA 3ROUA 5H6RA 5DEQA 3LA2A 2CSOA 3V7RA 1G4DA 3FMSA 3P9IA 2FBHA 4G6DA 2FQ3A 2GA1A 5LHHA 1USSA 4RB1A 4WWCA 1Z6TA 1MJBA 1L0OC 4M6YA 3R6SA 2JT1A 2YX4A 1IN6A 2AXLA 2J5OA 3IKVA 1J59A 2QENA 2XAJA 4UNOA 2V79A 1ULYA 4HF1A 4JK1X 3GVAA 5JR3A 3C1DA 1E17A 1W7PB 1SFEA 2QLZA 4XBFA 2DQLA 3BROA 3KE2A 3EUHA 3TO9A 1GHCA 3ZP5A 2A3SA 3D0SA 5E17F 4HYEA 3IHUA 3FF5A 1RUNA 1KYZA 1F5TA 2H6BA 4GXOA 4KIGA 1Z7UA 2X0LA 4XSXF 3IRRA 4L9NA 1P4XA 2EFWA 1IN7A 4K2EA 1F1ZA 3WG9A 4IXAA 4XLPF 3RDIA 4H0EA 3W6KB 2BEOA 2L3DA 1I5ZA 5LRRA 3GW2A 1H9GA 1KU3A 2IA0A 4AIKA 2CGPA 3QRFF 4ZYDA 4UVCA 3WU0A 4KDPA 5CJ9A 3BJAA 1LQ1A 1XSDA 1R00A 1SD4A 3W6JB 1ZGJA 1LDDA 3LAJA 1HXDA 1G3TA 1MKMA 1JE8A 5BMZA 2D1VA 5CVVA 2VONA 2VC1A 3M7GA 3I59A 2R7DA 2Z5UA 3E3VA 1Q1HA 2KIFA 3T1BA 1MZBA 4XLNF 4UV8A 2ZKZA 3I71A 3ZMUA 1FPQA 2VOOA 4KIFA 3ERED 4YIFA 1FYKA 5L3FA 3TDUC 2VODA 5JVTA 1YIOA 3DQVC 2QQBA 2WV0A 2VE8A 4QWQA 1LJ9A 5IT3A 4IHTA 4G94A 2DTRA 4MTDA 4LGWA 4U7DA 2M8EA 1K6OA 4AVPA 2Y48A 2XASA 3EYIA 4YFKF 2EJRA 4M72A 1TW3A 1HBXG 2FXAA 5FFXA 2RC4A 4CYDA 2NNYA 2YSRA 3KLOA 3ULQB 2F5DA 4M9SA 4KFCA 5CVJA 3GFMA 3KZYA 1CF7B 5J8CA 2A6HF 1T38A 3GFJA 4RGUA 1FZPB 1U5TC 4G8XA 5K1YA 4S05A 3G73A 4LLLA 4MNUA 3GXOA 4OINF 2Z9OA 1U2WA 1STZA 3D5LA 5ERIA 4EJUA 2GA2A 2MBFA 2PEXA 1SFXA 4I02A 2RV8A 1L3LA 1KU7A 3C18A 2Q0OA 1AOYA 2ETHA 4L9TA 1IN5A 5F64A 3DEUA 3LWFA 4D0PA 1RNLA 2UWMA 2GXBA 1GXQA 5LBQA 1QBJA 3OV8A 3BJOA 2E1NA 2W84A 2LKPA 1X3UA 4HX7A 3KP7A 1XN7A 3RJPA 3ABUA 3I54A 4U7BA 1HW5A 4EJTA 1ZN2A 3MAJA 4EJWA 1TNSA 2OZ6A 1XDSA 3MEXA 4FT8A 4HV6A 3I58A 2KJCA 4HA8A 1BIAA 2BBYA 1BM9A 5JHUA 4YFNF 3FZVA 1IXSB 5A2QK 3ECOA 4KIBA 3WTTC 3R4KA 1O57A 1O3SA 3I59B 1BOAA 3KP2A 3SFZA 1WSUA 4B8XA 2LDUA 3T8TA 4M9ZA 2IP2A 5D6EA 2L54A 1BBYA 4LFUA 3PFIA 4DQ2A 4N9IA 4YG2F 1J7KA 1YW8A 3WTYC 3ELKA 2KKOA 4AIHA 5BPDA 1O7FA 3V8JA 4XSZF 1FYLA 2ZXJA 4EJOA 4HDUA 1V4RA 3R0JA 1W5SA 2LSOA 5LLQA 5L3EA 1JGSA 1I1GA 2BV6A 3GFLA 4NHJA 3Q5FA 2G7UA 3K2ZA 1D8KA 3H92A 2BYVE 4A5NA 5DUIA 1P4AA 2FU4A 2MH9A 4JQFA 3V8LA 4EMSA 3HRMA 3TQNA 2EFQA 4AWXB 1OMIA 4ENMA 2HR3A 5HDGA 1LDKB 4HQEA 3CTAA 1SFUA 4HV5A 3F6OA 2CFXA 3E6DA 3BWGA 1S8NA 1IF1A 1YS6A 2DI3A 2X4HA 1W7PA 5D5WB 1QO0D 1DP7P 3BY6A 2HS5A 1F9NA 4LB6B 2ELHA 4E70A 1JHHA 1BI2A 4A0YA 1A04A 5LHIA 2EFPA 5JFRA 2IT0A 1H9TA 2ISZA 1ZLKA 4EM2A 2AS5F 2GAUA 1U6GA 3Q9VA 1Y0UA 3PQKA 1ONVA 4IRHA 3HYIA 4RB2C 4U0VA 3ZMVA 3L7WA 3JTGA 5BOXA 1TBXA 1IXRC 1XSVA 2JRTA 2HWVA 3GEZA 3RPQA 4WXHA 1BI0A 5ICEA 6PAXA 2VBYA 1IAWA 5L3BA 2A68F 2IVMA 1B9MA 2JPBA 4WF2A 2PBIA 5IT9K 2YR2A 1UCRA 1PP8F 2BGCA 3SQNA 3T0YA 3GUDA 3M1EA 1FC3A 3CO6C 2FMYA 2K4BA 2OA4A 3EYYA 4WCGA 2HDCA 2J5PA 3IL2A 1U5TB 1MD0A 1IZ1A 3HHGA 2JZYA 3CO7C 3RPUA 1OPCA 3IC7A 4IJAA 2HKXA 1Z05A 1YYVA 1OR7A 3ECHA 3E6MA 1FP2A 2QBYB 2PMUA 1QGPA 2UZKA 4EGYA 3GF2A 1B1BA 2CYYA 3KZZA 1P4WA 4O3MA 2ISYA 3WTZA 1WI9A 1R5GA 3HSFA 2EFNA 3JAMK 4LG0B 3O2PE 3F3XA 3BPVA 4AD9A 2MA3A 2M5WA 1BIBA 4GO1A 1T2KA 1XMKA 4B09A 4IF4A 3DXJF 4U88A 1GXPA 3FM5A 2H94A 4R1HA 2F5FA 1LDJA 2OQRA 3C3WA 2HEOA 4NQWA 3SZTA 5LGNA 1FLIA 2FMLA 2V1XA 2HOEA 2A6EF 2GWRA 4GCVA 1OKRA 3K0LA 3JSOA 2DU9A 4MHGA 3E6CC 4O5VA 4ON0A 4PCQA 5DD4A 2E7WA 3WTSC 2DK5A 5D5VB 5ICFA 2ZNYA 1FWZA 2VT3A 3R61A 1CF7A 2P8TA 2ZO4A 1FP1D 3E5UA 3TKYA 2V9VA 2HZTA 2R3SA 1MGTA 3L2CA 2QVOA 2K86A 1ZREA 5ICGA 3DV8A 3JSPA 2EV0A 2OZUA 2IPQX 2ZMEA 2M87A 5E8GA 4Q48A 3HRTA 2RVCA 2YPRA 2XROA 3L9FA 2RDPA 2QQ9A 4PGGA 3MZHA 1ZGAA 2O8XA 2PLYA 1FX7A 3WODF 5A2QZ 5HDKA 5FGMA 2VBZA 3GX4X 4M6XA 3MZYA 3V7SA 5ICCA 2W24A 3P7NA 1KQ9A 2W85A 3HSRA 1PUEE 1OYIA 1Z1DA 2TDXA 2DQRA 5AONA 1I6XA 1KQ0A 4CZZA 5DYMA 2E1CA 2Y0MA 3IKTA 3K1NA 4LD5A 1ZYRF 2FE3A 3M8EA 2DPUA 4A12A 2CQKA 1HKSA 2KIUA 1FYMA 3U9GA 3ZQ7A 2HFHA 4HF2A 2BE5F 4HZFA 2Z99A 1ZH5A 5F6FA 4BYYA 1XB4A 3S2WA 4KICA 3DF8A 3GWZA 5DV5A 4CGZA 4LLNA 2XAGA 5HS8A 3IWZA 2VT2A 1O7LA 3FMRA 1EH6A 3VODA 4S04A 4EM0B 1XCBA 2OD5A 4ASNA 5D8LB 5LGUA 5HVQC 3BOQA 4CXFA 4CHUA 2EK5A 1XGSA 2FBIA 4WK8F 3KETA 1ZARA 4L9VA 5CVUA 2QQAA 4ZZLA 4KNYA 3VFZA 4CO8A 3GO5A 4Y15A 4HDVA 2HYFA 2ACJA 3LQQA 2KIMA 5D6FA 3ZPLA 3K1MA 2O3FA 4WX9A 1IRGA 1HSTA 2R7FA 5HOOA 1J5YA 2WC2A 1QZZA 1REPC 1LEAA 2P6TA 3TOAA 1F4KA 4CICA 4Z2YA 3VB2A 2P7VB 3MCZA 4P9UA 1FT9A 2UXXA 1WRJA 5HLHA 2NYXA 1KU9A 2M45A 1S7AA 1FBUA 2JSCA 5CVRA 2FSWA 2P7CB 4XRFA 2HQNA 4O6JA 2NS0A 1MJ9A 1R5HA 4PZJA 3KP5A 4L0YB 1JHFA 4KMUX 2ZMEB 5K5QA 3KEQA 2A07F 1RZ4A 4OIOF 3F8BA 3VOEA 3WGHA 4Y13A 1MJAA 1T0FA 1TNTA 5IT9Z 3BP8A 1HSJA 1P6RA 2RQPA 1LNWA 3H3UA 4FX4A 2DW4A 3FWEA 2CG4A 3V4GA 4RAZA 5BS6A 3HHHA 1QZYA 3JTHA 3HIFA 2VBXA 2O61A 3E97A 2QWWA 5AIQA 1WQ2A 5KK1A 1FSHA 2MC3A 5ILUA 2F5CA 5EEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP7 A;  1KA8 A;  3BDD A;  2CO5 A;  2VE9 A;  4EV0 A;  4LMY A;  2EWN A;  4DNC A;  1KYW A;  1O3T A;  5E20 A;  4ESB A;  2OBP A;  4A6E A;  1HW2 A;  5DCM B;  3JAM Z;  3CLO A;  2COM A;  3RYP A;  1KQ8 A;  1BC7 C;  3LST A;  1IUY A;  2WWY A;  2W57 A;  1U5T A;  2EB7 A;  3E5X A;  3T8R A;  2Q2E A;  3F6V A;  2LF7 A;  3QU3 A;  2ESN A;  3QOP A;  2LF8 A;  2XV4 S;  4LB5 A;  2V1D A;  3TDZ C;  2V1U A;  3EQL F;  3F8N A;  4ETS A;  3K69 A;  4MGR A;  1J75 A;  2QBY A;  1SD5 A;  4A2U A;  4HLX A;  1Z6R A;  4ZYE A;  2DLL A;  3F21 A;  5KVR A;  2F2E A;  2KRF A;  3ZMD A;  4A5M A;  3HUG A;  4HX8 A;  1DUX C;  2MH2 A;  3EET A;  4LG0 A;  1AWC A;  1U8R A;  2PJP A;  1ON2 A;  3WTW C;  1TQI A;  3I64 A;  1WKM A;  3KEO A;  1U78 A;  5D4S A;  1K79 A;  2VN2 A;  4A6D A;  3FHZ A;  4M71 A;  5BPI A;  3HRS A;  1W7P D;  5JI6 A;  2JPC A;  5FLX K;  5EEH A;  4Q5S F;  3GZ5 A;  1EH8 A;  3TO7 A;  4WXD A;  3C7J A;  5L3G A;  2STT A;  1ZHF A;  2PQ8 A;  3QPT A;  1J0R A;  1ZLJ A;  3V7C A;  2XAH A;  3O3K A;  2ZCW A;  2Z3Y A;  2OAZ A;  1ZRC A;  4M9X A;  3F23 A;  3RI4 A;  2LNB A;  1D8J A;  1G6N A;  4GGG A;  5DUK A;  5DDG A;  4RS8 A;  1XGN A;  2A61 A;  2P4W A;  4GYI A;  2PI0 A;  1BC8 C;  4BNC A;  3EDP A;  2QM3 A;  1JXS A;  3RKX A;  5J6X A;  3KP6 A;  5TJJ A;  1U3E M;  1R7J A;  1T6S A;  4BXU A;  2F5E A;  5D5X B;  2QYO A;  3J7A O;  3GZ6 A;  3FM3 A;  2IA2 A;  2VXZ A;  1EV7 A;  3CUO A;  4N0B A;  3ABT A;  3MFK A;  3I53 A;  3ZMZ A;  3JW4 A;  3J81 K;  1S7O A;  2HTJ A;  1B59 A;  2E7X A;  2NRA C;  4L0Z B;  2FF4 A;  1I27 A;  1QQI A;  2M30 A;  1B6A A;  1LVA A;  2DFI A;  3GYH X;  4HW0 A;  3LA7 A;  2FNA A;  1YS7 A;  5HLG A;  1O3R A;  1IN4 A;  3V8K A;  2FA5 A;  5D8K B;  1CGP A;  4Q47 A;  2IRF G;  3FXR A;  2FNP A;  1TTY A;  5DCF A;  4CDG A;  4RGS A;  1XSX A;  3R60 A;  3WE2 A;  1S3J A;  4G7Z F;  2HQR A;  3ZN1 A;  5F1R A;  4ZZD A;  3F8C A;  4KN7 X;  5ED4 A;  1K78 B;  2HGC A;  1DPU A;  1B4A A;  1YO5 C;  2VC0 A;  1BJA A;  2H09 A;  2XGX A;  4HBL A;  1G3Y A;  3L00 A;  1HKQ A;  2RGV A;  2GZW A;  3WGI A;  2QZ8 A;  1TLH B;  1HW1 A;  2UXN A;  3N97 A;  2YX7 A;  2V6C A;  4EQQ A;  5L3D A;  2PG4 A;  4IPA A;  5FB2 A;  1E2X A;  2DPD A;  1YG2 A;  1ZAO A;  5FFZ A;  2PMH A;  5HDN A;  1R36 A;  4ZYH A;  3BZ6 A;  5E1W A;  4ENJ A;  2IJL A;  2DT5 A;  1RIO H;  4GYG A;  3WTX C;  2XKO A;  1SMY F;  3OOP A;  5DD8 A;  2XKP A;  2QUF A;  5ILV A;  5E8I A;  1BN5 A;  3NRV A;  3J80 K;  1YLF A;  2XIG A;  5LEJ A;  2VBW A;  1IW7 F;  2CW0 F;  1VTN C;  3GFI A;  3E5Q A;  1MDM B;  4M73 A;  4FHT A;  3HTU A;  5E1Z B;  3U2R A;  4L9J A;  4A0Z A;  1W5T A;  5CVI A;  3KLN A;  4HX4 A;  1P2F A;  3N4M A;  4ENN A;  2O6G E;  1EH7 A;  2VOP A;  2DAO A;  4OIR F;  4KN4 X;  1IRF A;  2D1H A;  3LFK A;  2W25 A;  4LJZ F;  1FBS A;  1ZG1 A;  2WTE A;  2EV6 A;  2P6S A;  1Z91 A;  2K7L A;  5HS7 A;  3MQ0 A;  4L5I A;  1HQC A;  2DK8 A;  3BPX A;  1Z9C A;  2IA1 A;  1G3S A;  2Z33 A;  3FMQ A;  5K5R A;  2FRH A;  1S29 A;  4G6Q A;  5LHG A;  3M9A A;  3WU1 B;  2RKH A;  5D4R A;  1P92 A;  3E6B A;  3H3Z A;  5DCM A;  4P96 A;  3FXQ A;  1IXC A;  4Y17 A;  5LEK A;  4IVN A;  5AIP A;  2XAF A;  2ZJ2 A;  2P5V A;  1T39 A;  3NEU A;  4BHC A;  4OMZ A;  5H6Q A;  2L4M A;  1FSE A;  4M74 A;  2XUB A;  2GXG A;  4PGH A;  4KUM A;  3QU6 A;  1V3F A;  4P55 A;  1S6L A;  1RUO A;  2K02 A;  3CUQ B;  2HKO A;  2XAQ A;  3VEP A;  3HTS B;  5FLX Z;  3ZN0 A;  2FOK A;  3TOB A;  3CDH A;  2DO7 A;  5HLI A;  3PQJ A;  3SHF A;  4OIQ F;  2PFB A;  5L3C A;  4ESJ A;  4BH9 A;  2XHK A;  1SD6 A;  2XVC A;  1YTY A;  1DPR A;  2NNN A;  3B73 A;  3KFW X;  1K7A A;  1SMT A;  3L09 A;  3O6B B;  4KT5 C;  1C0W A;  1FBQ A;  1PP7 U;  4MQV A;  1KU2 A;  2L01 A;  4HQM A;  4F7Z A;  4HAM A;  4I0A A;  2ESH A;  3CJN A;  3K9T A;  1BI1 A;  3FXU A;  4I98 B;  1XGO A;  1TQP A;  1D5V A;  2P5K A;  2P5L C;  4EGZ A;  1UST A;  1R1V A;  4EM1 A;  3J81 Z;  4RAY A;  1IN8 A;  4ENK A;  5H20 A;  3LA3 A;  3QP5 A;  4RB0 A;  3AAF A;  1LEB A;  2DBB A;  2PN6 A;  2IW5 A;  1UFM A;  2G7H A;  4G9Y A;  1WWX A;  2EA2 A;  2JTV A;  3WTU C;  2B0L A;  3U1D A;  1YW7 A;  3SZP A;  1RI7 A;  3I4P A;  5LRS A;  2D45 A;  1J2X A;  3RYR A;  4UXN A;  1DDN A;  1OYW A;  3HRU A;  2C6Y A;  3I0T A;  1R22 A;  4P9F A;  1XDU A;  3KP4 A;  1I1S A;  1R1T A;  1G3W A;  3F8F A;  4L18 B;  4G7H F;  2RN7 A;  3ZMT A;  2XRN A;  2O03 A;  4ZH4 F;  4HOB A;  3QAH A;  3P9C A;  5FD6 A;  3M8F A;  1ZRF A;  1KGS A;  3WGG A;  1SAX A;  4N9H A;  2GQQ A;  3HSE A;  1YW9 A;  4KMF A;  2FEZ A;  3WE3 A;  1QPM A;  2K27 A;  2L4A A;  4UV9 A;  4OIP F;  4BHB A;  3HOS A;  4R8H A;  2GIV A;  1ZRD A;  1J9I A;  2ZBK A;  2L02 A;  5ILS A;  4U0Y A;  3TO6 A;  4MTE A;  1GVJ A;  2G9W A;  2A69 F;  2H27 A;  1B9N A;  3QP6 A;  1NHA A;  4JBA A;  3RIR A;  4ESF A;  3ISP A;  4BHP A;  2EFO A;  2A5Y B;  3ML6 A;  2Q8K A;  1BI3 A;  4UHT A;  4WXC A;  1K78 A;  3J80 Z;  4A0X A;  1QNT A;  4RB3 C;  5CLS A;  1ZG5 A;  2O0Y A;  3P9K A;  2STW A;  1YFH A;  2HTS A;  4LK1 F;  4LK0 F;  3KP3 A;  4YII A;  2OU2 A;  5E1X A;  5BQT A;  4RGX A;  2MLG A;  2D2W A;  5K5O A;  4MQ9 F;  1UHW A;  3NQO A;  4QLC U;  2CWE A;  4BQA A;  3KCC A;  2OQG A;  1UHM A;  3DFG A;  4Q4Z F;  3I5U A;  3WTV C;  5E18 F;  2FBK A;  4KA4 A;  4EJV A;  2MD5 A;  3COA C;  4PDK A;  4HLY A;  3RKY A;  1SD7 A;  3ZMS A;  4YFX F;  3HOT A;  3R0A A;  4FX0 A;  4OMY A;  1O3Q A;  1MDM A;  3RTR A;  1HKT A;  2KJB A;  2ZNZ A;  4UVB A;  1TW2 A;  2ZFW A;  4L5J A;  1ON1 A;  1R58 A;  5J8F A;  4RGR A;  1XD7 A;  3CUQ C;  1W4M A;  1XGM A;  3DPL C;  1LB2 A;  1D3Y A;  2EA4 A;  3Q9S A;  3T5X A;  1T98 A;  4IRI A;  1XCV A;  3F22 A;  2H6C A;  3F8M A;  3MWM A;  4KYW A;  4NB5 A;  4HF0 A;  3IRQ A;  5LGT A;  4OU0 A;  4I0B A;  2MLK A;  3LQR A;  1XMA A;  1FY7 A;  3LAP A;  4G7O F;  2HYG D;  5CYV A;  2YU3 A;  3G3Z A;  3QPH A;  3BJ6 A;  4TV7 A;  4UVA A;  1OYY A;  1H0M A;  3F72 A;  3FX3 A;  1FNN A;  4IRG A;  2Y75 A;  5FD5 A;  1TQM A;  3DPT A;  3TGN A;  3REO A;  2NAZ A;  4LLG F;  4IHS A;  2K4J A;  3K1P A;  1PDN C;  4EVI A;  1YQA A;  4MEX F;  4I01 A;  4I2O A;  3DKW A;  2RNJ A;  3RKW A;  3CUQ A;  5TRD A;  4I09 A;  4UUV A;  4R79 A;  4MEY F;  4P5O A;  4U0W A;  1R23 A;  2M1B A;  4BAY A;  4ZYG A;  1ZG3 A;  5FO5 A;  2ADU A;  4AIJ A;  4I7H A;  1ODD A;  3GLX A;  3IWF A;  3B02 A;  1FOK A;  1R1U A;  1UB9 A;  2EV5 A;  5HS9 A;  5D5U B;  4OOI A;  3SXY A;  3ROU A;  5H6R A;  5DEQ A;  3LA2 A;  2CSO A;  3V7R A;  1G4D A;  3FMS A;  3P9I A;  2FBH A;  4G6D A;  2FQ3 A;  2GA1 A;  5LHH A;  1USS A;  4RB1 A;  4WWC A;  1Z6T A;  1MJB A;  1L0O C;  4M6Y A;  3R6S A;  2JT1 A;  2YX4 A;  1IN6 A;  2AXL A;  2J5O A;  3IKV A;  1J59 A;  2QEN A;  2XAJ A;  4UNO A;  2V79 A;  1ULY A;  4HF1 A;  4JK1 X;  3GVA A;  5JR3 A;  3C1D A;  1E17 A;  1W7P B;  1SFE A;  2QLZ A;  4XBF A;  2DQL A;  3BRO A;  3KE2 A;  3EUH A;  3TO9 A;  1GHC A;  3ZP5 A;  2A3S A;  3D0S A;  5E17 F;  4HYE A;  3IHU A;  3FF5 A;  1RUN A;  1KYZ A;  1F5T A;  2H6B A;  4GXO A;  4KIG A;  1Z7U A;  2X0L A;  4XSX F;  3IRR A;  4L9N A;  1P4X A;  2EFW A;  1IN7 A;  4K2E A;  1F1Z A;  3WG9 A;  4IXA A;  4XLP F;  3RDI A;  4H0E A;  3W6K B;  2BEO A;  2L3D A;  1I5Z A;  5LRR A;  3GW2 A;  1H9G A;  1KU3 A;  2IA0 A;  4AIK A;  2CGP A;  3QRF F;  4ZYD A;  4UVC A;  3WU0 A;  4KDP A;  5CJ9 A;  3BJA A;  1LQ1 A;  1XSD A;  1R00 A;  1SD4 A;  3W6J B;  1ZGJ A;  1LDD A;  3LAJ A;  1HXD A;  1G3T A;  1MKM A;  1JE8 A;  5BMZ A;  2D1V A;  5CVV A;  2VON A;  2VC1 A;  3M7G A;  3I59 A;  2R7D A;  2Z5U A;  3E3V A;  1Q1H A;  2KIF A;  3T1B A;  1MZB A;  4XLN F;  4UV8 A;  2ZKZ A;  3I71 A;  3ZMU A;  1FPQ A;  2VOO A;  4KIF A;  3ERE D;  4YIF A;  1FYK A;  5L3F A;  3TDU C;  2VOD A;  5JVT A;  1YIO A;  3DQV C;  2QQB A;  2WV0 A;  2VE8 A;  4QWQ A;  1LJ9 A;  5IT3 A;  4IHT A;  4G94 A;  2DTR A;  4MTD A;  4LGW A;  4U7D A;  2M8E A;  1K6O A;  4AVP A;  2Y48 A;  2XAS A;  3EYI A;  4YFK F;  2EJR A;  4M72 A;  1TW3 A;  1HBX G;  2FXA A;  5FFX A;  2RC4 A;  4CYD A;  2NNY A;  2YSR A;  3KLO A;  3ULQ B;  2F5D A;  4M9S A;  4KFC A;  5CVJ A;  3GFM A;  3KZY A;  1CF7 B;  5J8C A;  2A6H F;  1T38 A;  3GFJ A;  4RGU A;  1FZP B;  1U5T C;  4G8X A;  5K1Y A;  4S05 A;  3G73 A;  4LLL A;  4MNU A;  3GXO A;  4OIN F;  2Z9O A;  1U2W A;  1STZ A;  3D5L A;  5ERI A;  4EJU A;  2GA2 A;  2MBF A;  2PEX A;  1SFX A;  4I02 A;  2RV8 A;  1L3L A;  1KU7 A;  3C18 A;  2Q0O A;  1AOY A;  2ETH A;  4L9T A;  1IN5 A;  5F64 A;  3DEU A;  3LWF A;  4D0P A;  1RNL A;  2UWM A;  2GXB A;  1GXQ A;  5LBQ A;  1QBJ A;  3OV8 A;  3BJO A;  2E1N A;  2W84 A;  2LKP A;  1X3U A;  4HX7 A;  3KP7 A;  1XN7 A;  3RJP A;  3ABU A;  3I54 A;  4U7B A;  1HW5 A;  4EJT A;  1ZN2 A;  3MAJ A;  4EJW A;  1TNS A;  2OZ6 A;  1XDS A;  3MEX A;  4FT8 A;  4HV6 A;  3I58 A;  2KJC A;  4HA8 A;  1BIA A;  2BBY A;  1BM9 A;  5JHU A;  4YFN F;  3FZV A;  1IXS B;  5A2Q K;  3ECO A;  4KIB A;  3WTT C;  3R4K A;  1O57 A;  1O3S A;  3I59 B;  1BOA A;  3KP2 A;  3SFZ A;  1WSU A;  4B8X A;  2LDU A;  3T8T A;  4M9Z A;  2IP2 A;  5D6E A;  2L54 A;  1BBY A;  4LFU A;  3PFI A;  4DQ2 A;  4N9I A;  4YG2 F;  1J7K A;  1YW8 A;  3WTY C;  3ELK A;  2KKO A;  4AIH A;  5BPD A;  1O7F A;  3V8J A;  4XSZ F;  1FYL A;  2ZXJ A;  4EJO A;  4HDU A;  1V4R A;  3R0J A;  1W5S A;  2LSO A;  5LLQ A;  5L3E A;  1JGS A;  1I1G A;  2BV6 A;  3GFL A;  4NHJ A;  3Q5F A;  2G7U A;  3K2Z A;  1D8K A;  3H92 A;  2BYV E;  4A5N A;  5DUI A;  1P4A A;  2FU4 A;  2MH9 A;  4JQF A;  3V8L A;  4EMS A;  3HRM A;  3TQN A;  2EFQ A;  4AWX B;  1OMI A;  4ENM A;  2HR3 A;  5HDG A;  1LDK B;  4HQE A;  3CTA A;  1SFU A;  4HV5 A;  3F6O A;  2CFX A;  3E6D A;  3BWG A;  1S8N A;  1IF1 A;  1YS6 A;  2DI3 A;  2X4H A;  1W7P A;  5D5W B;  1QO0 D;  1DP7 P;  3BY6 A;  2HS5 A;  1F9N A;  4LB6 B;  2ELH A;  4E70 A;  1JHH A;  1BI2 A;  4A0Y A;  1A04 A;  5LHI A;  2EFP A;  5JFR A;  2IT0 A;  1H9T A;  2ISZ A;  1ZLK A;  4EM2 A;  2AS5 F;  2GAU A;  1U6G A;  3Q9V A;  1Y0U A;  3PQK A;  1ONV A;  4IRH A;  3HYI A;  4RB2 C;  4U0V A;  3ZMV A;  3L7W A;  3JTG A;  5BOX A;  1TBX A;  1IXR C;  1XSV A;  2JRT A;  2HWV A;  3GEZ A;  3RPQ A;  4WXH A;  1BI0 A;  5ICE A;  6PAX A;  2VBY A;  1IAW A;  5L3B A;  2A68 F;  2IVM A;  1B9M A;  2JPB A;  4WF2 A;  2PBI A;  5IT9 K;  2YR2 A;  1UCR A;  1PP8 F;  2BGC A;  3SQN A;  3T0Y A;  3GUD A;  3M1E A;  1FC3 A;  3CO6 C;  2FMY A;  2K4B A;  2OA4 A;  3EYY A;  4WCG A;  2HDC A;  2J5P A;  3IL2 A;  1U5T B;  1MD0 A;  1IZ1 A;  3HHG A;  2JZY A;  3CO7 C;  3RPU A;  1OPC A;  3IC7 A;  4IJA A;  2HKX A;  1Z05 A;  1YYV A;  1OR7 A;  3ECH A;  3E6M A;  1FP2 A;  2QBY B;  2PMU A;  1QGP A;  2UZK A;  4EGY A;  3GF2 A;  1B1B A;  2CYY A;  3KZZ A;  1P4W A;  4O3M A;  2ISY A;  3WTZ A;  1WI9 A;  1R5G A;  3HSF A;  2EFN A;  3JAM K;  4LG0 B;  3O2P E;  3F3X A;  3BPV A;  4AD9 A;  2MA3 A;  2M5W A;  1BIB A;  4GO1 A;  1T2K A;  1XMK A;  4B09 A;  4IF4 A;  3DXJ F;  4U88 A;  1GXP A;  3FM5 A;  2H94 A;  4R1H A;  2F5F A;  1LDJ A;  2OQR A;  3C3W A;  2HEO A;  4NQW A;  3SZT A;  5LGN A;  1FLI A;  2FML A;  2V1X A;  2HOE A;  2A6E F;  2GWR A;  4GCV A;  1OKR A;  3K0L A;  3JSO A;  2DU9 A;  4MHG A;  3E6C C;  4O5V A;  4ON0 A;  4PCQ A;  5DD4 A;  2E7W A;  3WTS C;  2DK5 A;  5D5V B;  5ICF A;  2ZNY A;  1FWZ A;  2VT3 A;  3R61 A;  1CF7 A;  2P8T A;  2ZO4 A;  1FP1 D;  3E5U A;  3TKY A;  2V9V A;  2HZT A;  2R3S A;  1MGT A;  3L2C A;  2QVO A;  2K86 A;  1ZRE A;  5ICG A;  3DV8 A;  3JSP A;  2EV0 A;  2OZU A;  2IPQ X;  2ZME A;  2M87 A;  5E8G A;  4Q48 A;  3HRT A;  2RVC A;  2YPR A;  2XRO A;  3L9F A;  2RDP A;  2QQ9 A;  4PGG A;  3MZH A;  1ZGA A;  2O8X A;  2PLY A;  1FX7 A;  3WOD F;  5A2Q Z;  5HDK A;  5FGM A;  2VBZ A;  3GX4 X;  4M6X A;  3MZY A;  3V7S A;  5ICC A;  2W24 A;  3P7N A;  1KQ9 A;  2W85 A;  3HSR A;  1PUE E;  1OYI A;  1Z1D A;  2TDX A;  2DQR A;  5AON A;  1I6X A;  1KQ0 A;  4CZZ A;  5DYM A;  2E1C A;  2Y0M A;  3IKT A;  3K1N A;  4LD5 A;  1ZYR F;  2FE3 A;  3M8E A;  2DPU A;  4A12 A;  2CQK A;  1HKS A;  2KIU A;  1FYM A;  3U9G A;  3ZQ7 A;  2HFH A;  4HF2 A;  2BE5 F;  4HZF A;  2Z99 A;  1ZH5 A;  5F6F A;  4BYY A;  1XB4 A;  3S2W A;  4KIC A;  3DF8 A;  3GWZ A;  5DV5 A;  4CGZ A;  4LLN A;  2XAG A;  5HS8 A;  3IWZ A;  2VT2 A;  1O7L A;  3FMR A;  1EH6 A;  3VOD A;  4S04 A;  4EM0 B;  1XCB A;  2OD5 A;  4ASN A;  5D8L B;  5LGU A;  5HVQ C;  3BOQ A;  4CXF A;  4CHU A;  2EK5 A;  1XGS A;  2FBI A;  4WK8 F;  3KET A;  1ZAR A;  4L9V A;  5CVU A;  2QQA A;  4ZZL A;  4KNY A;  3VFZ A;  4CO8 A;  3GO5 A;  4Y15 A;  4HDV A;  2HYF A;  2ACJ A;  3LQQ A;  2KIM A;  5D6F A;  3ZPL A;  3K1M A;  2O3F A;  4WX9 A;  1IRG A;  1HST A;  2R7F A;  5HOO A;  1J5Y A;  2WC2 A;  1QZZ A;  1REP C;  1LEA A;  2P6T A;  3TOA A;  1F4K A;  4CIC A;  4Z2Y A;  3VB2 A;  2P7V B;  3MCZ A;  4P9U A;  1FT9 A;  2UXX A;  1WRJ A;  5HLH A;  2NYX A;  1KU9 A;  2M45 A;  1S7A A;  1FBU A;  2JSC A;  5CVR A;  2FSW A;  2P7C B;  4XRF A;  2HQN A;  4O6J A;  2NS0 A;  1MJ9 A;  1R5H A;  4PZJ A;  3KP5 A;  4L0Y B;  1JHF A;  4KMU X;  2ZME B;  5K5Q A;  3KEQ A;  2A07 F;  1RZ4 A;  4OIO F;  3F8B A;  3VOE A;  3WGH A;  4Y13 A;  1MJA A;  1T0F A;  1TNT A;  5IT9 Z;  3BP8 A;  1HSJ A;  1P6R A;  2RQP A;  1LNW A;  3H3U A;  4FX4 A;  2DW4 A;  3FWE A;  2CG4 A;  3V4G A;  4RAZ A;  5BS6 A;  3HHH A;  1QZY A;  3JTH A;  3HIF A;  2VBX A;  2O61 A;  3E97 A;  2QWW A;  5AIQ A;  1WQ2 A;  5KK1 A;  1FSH A;  2MC3 A;  5ILU A;  2F5C A;  5EEG A; 
#chains in the Genus database with same CATH topology
 3DP7 A;  1A6Q A;  3DLL F;  1KA8 A;  3BDD A;  2CO5 A;  4BKX A;  4A3M J;  1PYV A;  2VE9 A;  3S3N A;  2CUJ A;  4Y52 J;  1X1P A;  4EV0 A;  4LMY A;  2V6E A;  2EWN A;  4DNC A;  4E7K A;  1KYW A;  1O3T A;  2VPL A;  1D0Y A;  5E20 A;  4ZDL A;  3VYS B;  4ESB A;  2O9L A;  2OBP A;  4A6E A;  4FQG A;  2AQF A;  2X51 A;  5IOY A;  1NG7 A;  2CJJ A;  1HW2 A;  1HCR A;  3S3M A;  5DCM B;  4A3I J;  1MBJ A;  4G6T B;  2CFO A;  1FJL A;  3JAM Z;  3CLO A;  2KMU A;  2COM A;  1MMG A;  1QVU A;  3RYP A;  4BXF A;  1O4X A;  2Y30 A;  1KQ8 A;  4RAG A;  1DU0 A;  3VDX A;  1BC7 C;  2VPR A;  2E5N A;  3IH2 A;  1JKO C;  3LST A;  1IUY A;  2WWY A;  2HU9 A;  2R5Z A;  5EG0 B;  2W57 A;  1U5T A;  4GRI A;  2CQX A;  3JRB A;  3CCQ I;  2EB7 A;  3E5X A;  1EKE A;  3T8R A;  2Q2E A;  3F6V A;  2M3A A;  2LF7 A;  3QU3 A;  2ESN A;  3QOP A;  2ECB A;  4XOP A;  2LF8 A;  2ZJP F;  2CUF A;  2XV4 S;  4LB5 A;  2V1D A;  3TDZ C;  2V1U A;  2WA0 A;  1MBH A;  3EQL F;  3F8N A;  3G2B A;  4S0H B;  4ETS A;  3K69 A;  1S72 I;  2HVS A;  1QVT A;  4MGR A;  1J75 A;  2QBY A;  1T08 B;  2VKH A;  2EIN H;  5B1B H;  1SD5 A;  4A2U A;  4HLX A;  3CCL I;  1Z6R A;  3WHC A;  4ZYE A;  3AG2 H;  2LKX A;  2DLL A;  3F21 A;  5KVR A;  2F2E A;  2HDW A;  3M3Y J;  1LKX A;  2KRF A;  2DMP A;  1LPQ A;  1XX5 A;  3G1M A;  3ZMD A;  4A5M A;  3HUG A;  4HX8 A;  3BR5 A;  2GOM A;  3U1K A;  1DUX C;  2YU9 J;  1H8A C;  3S1N J;  2MH2 A;  3EET A;  4XOT A;  5FRO A;  2F6C A;  4LG0 A;  2RQQ A;  2TRT A;  2E2H J;  5F27 A;  1AHD P;  3W2W A;  1AWC A;  2OUM A;  1U8R A;  4P1W A;  3A0H C;  1ON2 A;  3WTW C;  2PJP A;  3OR1 C;  1TQI A;  3CCV I;  3I64 A;  1WKM A;  3KEO A;  5TIS C;  1U78 A;  5EZH A;  3WU2 C;  2CRG A;  5D4S A;  1K79 A;  2VN2 A;  3C2G A;  4A6D A;  5J47 A;  3CP8 A;  3FHZ A;  2XDV A;  4A3G J;  3BTL A;  4JYK A;  4M71 A;  3HRS A;  2ID6 A;  5BPI A;  3CC7 I;  1W7P D;  5JI6 A;  4LIV A;  2IS4 A;  1VQ6 I;  2WAD A;  4N4N B;  1R49 A;  2JPC A;  2CW7 A;  4B43 A;  3S15 J;  1OCC H;  1WJD A;  3GTM J;  2HNH A;  2DA3 A;  5FLX K;  5EEH A;  2HYJ A;  4Q5S F;  4XLC A;  1MMS A;  5J1Y A;  3GZ5 A;  1EH8 A;  3FXO A;  3TO7 A;  4A3E J;  4WXD A;  3C7J A;  5L3G A;  2STT A;  1ZHF A;  2PQ8 A;  3ESW B;  3QPT A;  4JX6 A;  1J0R A;  1ZLJ A;  2VXD A;  3V7C A;  2XAH A;  3O3K A;  2ZCW A;  2WAQ A;  3LSH A;  2CV1 A;  2Z3Y A;  2OAZ A;  4E7J A;  1SVL A;  1ZRC A;  1B72 B;  4M9X A;  3F23 A;  3RI4 A;  2XF6 A;  4BQN A;  2GLO A;  2LNB A;  4XN0 A;  3DEE A;  2W7N A;  3OSF A;  3A02 A;  1G6N A;  1D8J A;  4GGG A;  5DUK A;  5DDG A;  1SEU A;  3AL0 B;  2E60 A;  3QPL A;  4RS8 A;  1XGN A;  2A61 A;  1WZ2 A;  2P4W A;  2XF7 A;  4GYI A;  4IHV A;  2PI0 A;  1JT6 A;  3H9J A;  3ONQ A;  2JJ7 A;  2HPI A;  4ZDO A;  1BC8 C;  4BNC A;  3L2U A;  3EDP A;  2QM3 A;  3LSP A;  1JXS A;  2L2O A;  5CQE A;  3RKX A;  4X6A J;  5J6X A;  3KP6 A;  2BZT A;  1RET A;  2OJE D;  3EUK L;  5TJJ A;  2R7Q A;  4C3H J;  4BL0 B;  1U3E M;  1R7J A;  1T6S A;  3ZQF A;  3QWL A;  4BXU A;  2F5E A;  5D5X B;  4BGD A;  2DMT A;  2PJR B;  3LMM A;  2QYO A;  3J7A O;  3CCY A;  3GZ6 A;  5M5W J;  3FM3 A;  2IA2 A;  1ZTR A;  2VXZ A;  1EV7 A;  3CUO A;  4N0B A;  1FEX A;  3ABT A;  3MFK A;  2VQL A;  3I53 A;  1HOM A;  1G59 A;  3KPH A;  3ZMZ A;  3JW4 A;  3J81 K;  1S7O A;  5GAD J;  1G2H A;  2HTJ A;  1B59 A;  2E7X A;  2NRA C;  4L0Z B;  1ZGW A;  3PIP F;  3HG9 A;  2FF4 A;  1I27 A;  3O8H A;  1QQI A;  2M30 A;  4PK4 A;  1B6A A;  1LVA A;  1FOW A;  2DFI A;  3GYH X;  3SFI A;  4BJT A;  4HW0 A;  3LA7 A;  5BNG A;  2FNA A;  1YS7 A;  5HLG A;  1O3R A;  1IN4 A;  3V8K A;  2FA5 A;  4CCL A;  3K6G A;  3DU6 A;  5D8K B;  1CGP A;  2V7F A;  2HDD A;  4Q47 A;  2IRF G;  3FXR A;  3PNT A;  3PM1 A;  1JGG A;  2LY9 A;  2DJI A;  2FNP A;  2OTJ I;  1D0Z A;  2M2E A;  1IDY A;  1TTY A;  2OF7 A;  3HZJ A;  5DCF A;  4CDG A;  4RGS A;  4DZP A;  2KRC A;  2HOS A;  1D5Y A;  1XSX A;  1A36 A;  3R60 A;  2JN6 A;  2KLO A;  2X1E A;  3WE2 A;  1S3J A;  2ZB9 A;  4G7Z F;  1ZEL A;  2HQR A;  1E0E A;  3ZN1 A;  5F1R A;  2F48 A;  3FDY A;  1MSE C;  4ZZD A;  3F8C A;  4KN7 X;  5ED4 A;  1V54 H;  3OS0 A;  1K78 B;  1WJ5 A;  3W3C A;  2BW3 B;  2HGC A;  1DPU A;  2DXI A;  1B4A A;  3PSI A;  1YO5 C;  2VC0 A;  2VQC A;  2QCO A;  1BJA A;  2H09 A;  2H1L A;  2X6W A;  2XGX A;  4HBL A;  1G3Y A;  4IHX A;  3EUH C;  2BY2 A;  3L00 A;  4LG3 A;  2WB1 A;  1HKQ A;  3GCM A;  2RGV A;  2K9N A;  2GZW A;  3WGI A;  4AM3 A;  4FIS A;  2QZ8 A;  1WFX A;  3OYD A;  4XLE A;  1X2N A;  2EZI A;  1LUJ B;  5F0F A;  2NVT J;  1TLH B;  1HW1 A;  1I3A A;  2UXN A;  2MYS A;  3N97 A;  2YX7 A;  3VSK A;  2V6C A;  4EQQ A;  5M3F J;  5L3D A;  2PG4 A;  4IPA A;  5FB2 A;  1E2X A;  2CU7 A;  2HXI A;  2MC4 A;  1FIP A;  2DPD A;  2A6T A;  1YG2 A;  1ZAO A;  5FFZ A;  5C44 J;  2PMH A;  5HDN A;  1TL8 A;  5KCM A;  1R36 A;  1WHU A;  4ZYH A;  3BZ6 A;  5FJ8 J;  5GTI C;  5E1W A;  4ENJ A;  2IJL A;  1GUU A;  2DT5 A;  3ZGK A;  4D7M A;  4E7H A;  1RIO H;  4GYG A;  5J40 A;  3WTX C;  3TW6 A;  2OTL I;  2XKO A;  3D1N I;  3OYC A;  1OQY A;  1SMY F;  3OOP A;  5DD8 A;  2XKP A;  2QUF A;  5ILV A;  2VJI A;  1QPI A;  2R7V A;  5E8I A;  1BN5 A;  1MMN A;  3NRV A;  3C2H A;  4AC0 A;  3J80 K;  2WV1 A;  1BL0 A;  1YLF A;  2XIG A;  2L7K A;  2UV1 A;  5LEJ A;  1YJ9 I;  2VBW A;  1IW7 F;  3CJT B;  2CW0 F;  1VTN C;  3GFI A;  3E5Q A;  3NAU A;  1M1E B;  1YRN A;  3BCB A;  1R6R A;  3JCU C;  4NDL A;  3N05 A;  1MDM B;  1WJB A;  4M73 A;  1YIT I;  1Y0N A;  4FHT A;  3HKZ A;  2DDB A;  3HTU A;  3L2W A;  5E1Z B;  1SC7 A;  2KZV A;  3QYE A;  3U2R A;  4L9J A;  4A0Z A;  3GTJ J;  1W5T A;  3TL4 X;  5CVI A;  4DW6 A;  3CF2 A;  3KLN A;  4HX4 A;  3HPH A;  1P2F A;  1VND A;  2BXZ A;  3N4M A;  4ENN A;  3H5A A;  1RKT A;  2O6G E;  2F4I A;  1EH7 A;  2EBI A;  2KZG A;  4XMY A;  2VOP A;  2DAO A;  2X85 A;  4OIR F;  4KN4 X;  5JLW A;  2JA8 J;  1IRF A;  3HEF A;  2D1H A;  3LFK A;  2W25 A;  4DIQ A;  2OPT A;  1NG6 A;  4LJZ F;  3SEQ A;  1FBS A;  1ZG1 A;  2WTE A;  2M4K A;  2EV6 A;  1OIS A;  2P6S A;  3BR2 A;  1Z0X A;  1Z91 A;  4RAF A;  4BXX J;  2K7L A;  5HS7 A;  4D5F A;  2V1N A;  2ZJR F;  3GLL A;  3IUO A;  2ZSI B;  3MQ0 A;  2DOF A;  2MGQ A;  2Q1Z B;  4L5I A;  1SFO J;  3CCM I;  2M7A A;  3ZQQ A;  1HQC A;  2DK8 A;  3BPX A;  2LY2 A;  1Z9C A;  3HGY A;  2IA1 A;  1G3S A;  3JRG A;  2Z33 A;  4IHW A;  3NWT A;  2HOA A;  2LOO A;  1S5L C;  3FMQ A;  3DTE A;  5K5R A;  2FRH A;  2W00 A;  1S29 A;  3OYM A;  4G6Q A;  5LHG A;  3M9A A;  3WU1 B;  2RKH A;  2HPM A;  4DZJ A;  5D4R A;  2AQE A;  1P92 A;  3E6B A;  3H3Z A;  3PSF A;  4P96 A;  5DCM A;  3FXQ A;  4CCK A;  1FMV A;  1IXC A;  3ZQH A;  4Y17 A;  5LEK A;  4IVN A;  5AIP A;  2LY1 A;  2WAQ N;  3JR9 A;  2XAF A;  2ZJ2 A;  2P5V A;  1T39 A;  4BE2 A;  3NEU A;  5DM6 F;  4BHC A;  2L4M A;  4OMZ A;  5H6Q A;  5B3S H;  1FSE A;  1Z3Y A;  2M0C A;  4PFP A;  4M74 A;  5EG0 A;  2XUB A;  1WJE A;  2GXG A;  1TP4 A;  2BVL A;  4PGH A;  1W5C C;  4KUM A;  4X0G A;  4C2T A;  2X1C A;  3QU6 A;  1V3F A;  2QSF X;  1EA3 A;  3QOD A;  4MO7 A;  1MH4 A;  4IOA F;  3PNY A;  3OYG A;  4P55 A;  1S6L A;  1OCR H;  2XPV A;  5F0H A;  1RUO A;  2K02 A;  3CUQ B;  1NK3 P;  2HKO A;  2XAQ A;  3D5S C;  3VEP A;  4A69 C;  5J4V A;  2OCE A;  3HTS B;  5FLX Z;  1ENH A;  3ZN0 A;  3LL7 A;  3OYK A;  2FOK A;  2EH3 A;  3TOB A;  1GDT A;  3CDH A;  2DO7 A;  5HLI A;  3PQJ A;  3BLY A;  4II2 A;  3SHF A;  4OIQ F;  5EGO B;  1ETO A;  2PFB A;  2K9M A;  2Y0S A;  5L3C A;  4W97 A;  4ESJ A;  4BH9 A;  2XHK A;  4NC8 A;  1SD6 A;  4D9J A;  3GTG J;  1YHQ I;  1MND A;  1W1W E;  2XVC A;  3JRF A;  1MSF C;  4C2U A;  5JHF A;  1YTY A;  4HNT A;  1SVM A;  1WJC A;  1DPR A;  2NNN A;  2Z16 A;  3B73 A;  3KFW X;  4RBO A;  3L2V A;  1K7A A;  4XM3 A;  1SMT A;  3HOV J;  1NTC A;  2R4G A;  3L09 A;  1ETK A;  4A3C J;  4BUP A;  3O6B B;  4KT5 C;  1TWC J;  1C0W A;  3MKY B;  1YJW I;  3AG4 H;  1FBQ A;  4IKF A;  1PP7 U;  4MQV A;  1KU2 A;  2L01 A;  4HQM A;  4F7Z A;  2R7R A;  3I4M J;  4HAM A;  2IS2 A;  4Y3O A;  4I0A A;  4AYB A;  1IRZ A;  4D1Q A;  2ESH A;  3CJN A;  3K9T A;  5K7H A;  1BI1 A;  1IV8 A;  3FXU A;  3OL4 A;  4I98 B;  5J1R A;  1B8I B;  1XGO A;  1TQP A;  1D5V A;  2XRL A;  1WH5 A;  2P5K A;  4QSH A;  2K3F A;  4HG2 A;  2P5L C;  4EGZ A;  1UST A;  1R1V A;  4EM1 A;  1FIA A;  3B6A A;  2JA6 J;  2VLA A;  3J81 Z;  1YRN B;  4RAY A;  1IN8 A;  4ENK A;  5H20 A;  3LA3 A;  3F0C A;  4I99 C;  3QP5 A;  4RB0 A;  5JLX A;  3AAF A;  3OYB A;  4PFO A;  4LIU A;  2KDZ A;  5CQG A;  1LEB A;  2AHQ A;  2Y9Y A;  2DBB A;  2PN6 A;  3A03 A;  4PSW A;  1VQK I;  2IW5 A;  1UFM A;  2G7H A;  2X1D A;  4G9Y A;  1WWX A;  2EA2 A;  2JTV A;  2NVQ J;  3WTU C;  1GLN A;  2B0L A;  3FKJ A;  3KEY A;  3U1D A;  4AU7 A;  2LRE A;  3O8G A;  1YW7 A;  3SZP A;  1RI7 A;  3I4P A;  5LRS A;  2DA2 A;  2D45 A;  3K70 D;  1J2X A;  3RYR A;  4UXN A;  1YI2 I;  2FQ4 A;  1DDN A;  1OYW A;  2WY7 Q;  4QPQ A;  3HRU A;  2C6Y A;  3I0T A;  1R22 A;  1Y6I A;  4DYR A;  2DMN A;  2LRD A;  2PJR A;  4P9F A;  1XDU A;  3KP4 A;  3KZI C;  1I1S A;  1R1T A;  3CDI A;  1G3W A;  1BJZ A;  3F8F A;  4L18 B;  4BU2 A;  4G7H F;  2KFD A;  2B9S A;  2LMD A;  2LFB A;  2RN7 A;  3ZMT A;  2XRN A;  2O03 A;  4ZH4 F;  2VL8 A;  4HOB A;  3QAH A;  2MFZ A;  2GM4 A;  3P9C A;  2R7T A;  5FD6 A;  3M8F A;  1ZRF A;  3Q3S A;  1KGS A;  3WGG A;  2E36 A;  1SAX A;  4N9H A;  2GQQ A;  5HNH A;  2CH0 A;  1RES A;  3HSE A;  4C3I J;  1WI3 A;  1YW9 A;  1TT0 A;  1P9Q C;  2E5Z A;  4KMF A;  2FEZ A;  3WE3 A;  1QPM A;  2K27 A;  3BR1 A;  2JWT A;  2L4A A;  3JRE A;  1T8I A;  3S17 J;  4BEH A;  2RRE A;  4UV9 A;  4Z6Y A;  3M4O J;  4OIP F;  1X58 A;  4BHB A;  1JUS A;  3HOS A;  4R8H A;  2GIV A;  1ZRD A;  1J9I A;  2E19 A;  2ZBK A;  1QA6 A;  2L02 A;  3HKZ N;  3QPS A;  5ILS A;  2VI6 A;  2Z1D A;  3K4B A;  4U0Y A;  3DCF A;  4XIC A;  3H36 A;  3V42 A;  3ASO H;  3TO6 A;  4MTE A;  1XPX A;  1GVJ A;  2G9W A;  2A69 F;  2H27 A;  1B9N A;  4UB8 C;  2I8D A;  3MKW B;  4IHY A;  3QP6 A;  3RCO A;  3BG5 A;  2P81 A;  1NHA A;  4JBA A;  2WAF A;  5FLV A;  3DTK A;  3RIR A;  2EPF A;  4ESF A;  3ISP A;  3CCS I;  4JP0 A;  4BHP A;  3IV5 A;  1LFU P;  3OR2 C;  2EFO A;  2A5Y B;  3K10 A;  3GTO J;  2ZXW H;  4CUG A;  3ML6 A;  1HLV A;  2Q8K A;  1BI3 A;  4UHT A;  5FRM A;  4WXC A;  1S9H A;  2DFE A;  1K78 A;  1ZKG A;  4J01 A;  5FKN A;  2BW3 A;  3J80 Z;  1WJA A;  3FBI B;  3AKZ A;  4A0X A;  3S2H J;  1QNT A;  4RB3 C;  4NBQ A;  5FKK A;  3G1O A;  5CLS A;  5F08 A;  1ZG5 A;  3HOZ J;  2O0Y A;  2F4O B;  3P9K A;  2EIK H;  2STW A;  2NOG A;  1YFH A;  2HTS A;  4LK1 F;  3HOU J;  1LVK A;  4LK0 F;  3ZOB A;  3C2B A;  4NC7 A;  3I3L A;  3KP3 A;  4YII A;  2OU2 A;  5E1X A;  5BQT A;  4HNV A;  4RGX A;  2MLG A;  2D2W A;  3FBN B;  5K5O A;  4MQ9 F;  1UHW A;  3RZD J;  2VKV A;  2HI3 A;  3NQO A;  4QLC U;  2CWE A;  3FXK A;  4BQA A;  1MBE A;  2PMZ A;  3KCC A;  3SEZ A;  2OQG A;  1UHM A;  3DFG A;  4Q4Z F;  3I5U A;  3WTV C;  3MVP A;  1K83 J;  3CES A;  5E18 F;  1OCO H;  2P0W A;  4M3F A;  3FIS A;  1XMX A;  2FBK A;  4KA4 A;  4EJV A;  2MD5 A;  3K7A J;  4PDK A;  3COA C;  2GBY A;  3BC8 A;  2K40 A;  4HLY A;  4CCJ A;  3RKY A;  2E1M C;  2BHY A;  3S2D J;  1SD7 A;  2MW8 A;  4BJ5 C;  3S93 A;  2M7B A;  3CCE I;  3ZMS A;  4YFX F;  1TWF J;  4PJL A;  4M3B A;  1IRX A;  4B3A A;  4HRI A;  3KYD B;  2QSH X;  3HOT A;  1IUF A;  2JRM A;  2W1O A;  3R0A A;  4FX0 A;  4OMY A;  2KL4 A;  5GAE J;  2K3P A;  1O3Q A;  1MDM A;  4XN3 A;  3RTR A;  1HKT A;  2XC7 A;  2E71 A;  4A3L J;  2KJB A;  2ZNZ A;  3A0B C;  3W6V A;  1N78 A;  3CCU I;  2X9D A;  3QYF A;  4UVB A;  3HB9 A;  4F52 A;  2B7E A;  1TW2 A;  1A6I A;  4OAZ A;  2ZFW A;  4L5J A;  1WJF A;  1ON1 A;  2Y0S N;  1IJW C;  1R58 A;  3BR3 A;  4XK4 A;  1NK2 P;  2BHZ A;  4RGR A;  5J8F A;  1XD7 A;  1ACI A;  5IYD J;  2F4M B;  3M07 A;  3OWT A;  3CUQ C;  2OCC H;  1W4M A;  1LFB A;  1XGM A;  3DPL C;  1LB2 A;  1D1A A;  1D3Y A;  3IH3 A;  1X1C A;  4II3 A;  1Y1W J;  2EA4 A;  3Q9S A;  3T5X A;  2JA5 J;  1OR7 C;  1T98 A;  4IRI A;  4RM2 A;  1XCV A;  3CF5 F;  3F22 A;  4FAS D;  2JA2 A;  4F91 B;  2H6C A;  2HQ5 A;  2XB0 X;  3TP3 A;  1BR2 A;  2XSJ C;  3CJQ B;  3OYJ A;  3X2Q H;  2DMU A;  1OFC X;  3F8M A;  3MWM A;  4KYW A;  4NB5 A;  4HF0 A;  3I9V 2;  4AYB N;  3JRC A;  3IRQ A;  5LGT A;  4OU0 A;  2K9Q A;  4I0B A;  1IC8 A;  2MLK A;  1TC3 C;  4IQJ A;  2KDO A;  5KHD A;  1X3Z B;  2ZXH A;  3CZ6 A;  4E7I A;  3RZO J;  2VKD A;  3LQR A;  1XMA A;  1FY7 A;  2R5Y B;  1U8B A;  3HL2 A;  2L7F P;  1K6Y A;  3LAP A;  2QF7 A;  4G7O F;  5F04 A;  2HYG D;  5CYV A;  3SZG A;  2YU3 A;  3RPU D;  3G3Z A;  3QPH A;  3BJ6 A;  4BEH B;  4TV7 A;  3CDL A;  3BZK A;  2G0E A;  1JTX A;  4UVA A;  1OYY A;  1H0M A;  2ICW G;  4HNU A;  3F72 A;  3FX3 A;  1FNN A;  1TWG J;  2LG4 A;  4IRG A;  1N77 A;  3HOW J;  3LOC A;  4KIS A;  2Y75 A;  2QA4 I;  3JRD A;  3K4M A;  5FD5 A;  2VJ5 A;  1TQM A;  3DPT A;  2COB A;  3TGN A;  2W4S A;  2ELJ A;  3REO A;  4C2M J;  4YRV A;  3BTJ A;  4PSX A;  3CLQ A;  3VSL A;  2NAZ A;  4LLG F;  4IHS A;  2K4J A;  3K1P A;  2K85 A;  1MMA A;  4Y4R A;  2EIM H;  1H89 C;  1P7J A;  4XON A;  1AKH B;  1PVE A;  1PDN C;  5C4X J;  4EVI A;  1YQA A;  4MEX F;  4NNJ A;  1ITY A;  4I01 A;  4I2O A;  3DKW A;  5LFA A;  4B4C A;  3E0J B;  2RNJ A;  3RKW A;  4B48 A;  3PUB A;  3CUQ A;  2OV7 A;  5TRD A;  3W2A A;  3EPZ A;  4I09 A;  5HNF A;  4XKB A;  2IAI A;  2HVQ A;  4UUV A;  4R79 A;  4KJZ A;  4MEY F;  4P5O A;  4U0W A;  1FTT A;  2JA7 J;  3WG7 H;  1R23 A;  2M1B A;  4BAY A;  4ZYG A;  2EZL A;  5EGO A;  1ZG3 A;  2M4G A;  5FO5 A;  2DOE A;  4RMN A;  3VYR B;  2ADU A;  2Z2S B;  4AIJ A;  3VPR A;  4DBR A;  4I7H A;  1ODD A;  1ETY A;  3GLX A;  3IWF A;  3B02 A;  3UKG A;  1FOK A;  1R1U A;  3HBL A;  1UB9 A;  2EV5 A;  3LSM A;  5IYB J;  4F3Q A;  5HS9 A;  5D5U B;  4OOI A;  4ZTF A;  3SXY A;  3HM5 A;  3ROU A;  5H6R A;  2JVG A;  1WGX A;  2M0M A;  3EUA A;  5DEQ A;  3LA2 A;  2CSO A;  5IP9 J;  2DFH A;  3V7R A;  3DLA A;  3FXM A;  2X48 A;  1W0T A;  3BR6 A;  4M3E A;  1VQ5 I;  5GAH J;  2R7Z J;  4J19 A;  2HZD A;  2FX0 A;  1G4D A;  1OCT C;  3FMS A;  3P9I A;  2CV2 A;  1EF4 A;  3H3V K;  2FBH A;  5E3L A;  2K5C A;  4G6D A;  4LOC A;  2FQ3 A;  2GA1 A;  1B8I A;  2DOD A;  3PO3 J;  1RC9 A;  2L7M P;  5LHH A;  1USS A;  4RB1 A;  4EAT A;  4WWC A;  1Z6T A;  3G4S I;  1MJB A;  3DKX A;  1L0O C;  1VQ8 I;  4M6Y A;  3R6S A;  4E7Z A;  2JT1 A;  2R92 J;  2LR8 A;  2YX4 A;  3K2A A;  2VB6 A;  1D0X A;  2L7Z A;  1IN6 A;  2AXL A;  2J5O A;  2XF5 A;  3IKV A;  1Z77 A;  2KT0 A;  1J59 A;  2QEN A;  2XAJ A;  4UNO A;  2V79 A;  1ULY A;  4HF1 A;  4JK1 X;  2DT7 B;  2Y31 A;  5FKO A;  3GVA A;  3CMM A;  2JVH A;  5JR3 A;  3C1D A;  3MZ8 A;  1E17 A;  1WVR A;  1W7P B;  4E7S A;  3GTL J;  1SFE A;  2HVR A;  2QLZ A;  1UZC A;  4XBF A;  3ABK H;  2DQL A;  3BRO A;  1K61 A;  3KE2 A;  4RM3 A;  3EUH A;  3TO9 A;  2DT6 A;  2CUE A;  4GDF A;  1MBG A;  3BZC A;  1GHC A;  3BG9 A;  3ZP5 A;  2R7S A;  4MIM A;  2A3S A;  3D0S A;  1W36 D;  2WBM A;  5E17 F;  4HYE A;  3A01 B;  2NVY J;  5E3M A;  3CC4 I;  3IHU A;  3FF5 A;  2DOA A;  1YX5 A;  2RNG A;  3K4N A;  1RUN A;  1KYZ A;  1UJ8 A;  2IBD A;  2ZC2 A;  1F5T A;  5EZG A;  4XL9 A;  2H6B A;  4GXO A;  5GP9 A;  4KIG A;  1Z7U A;  2X0L A;  3FIW A;  4XSX F;  3GBG A;  1JUM A;  4I76 A;  4L9N A;  1P4X A;  3IRR A;  2EFW A;  1IN7 A;  3LSI A;  4K2E A;  1F1Z A;  2VQG A;  3WG9 A;  4IXA A;  4CH7 A;  2MG4 A;  2BY0 A;  1FOX A;  1X19 A;  4XLP F;  2E1M B;  1RR8 C;  1V55 H;  3K4L A;  3RDI A;  4H0E A;  3W6K B;  2BEO A;  2L3D A;  2OC6 A;  2DTZ A;  3H5R A;  2GIZ A;  4C30 A;  1I5Z A;  5LRR A;  1JI8 A;  3RKQ A;  3GW2 A;  5EDN A;  2DJN A;  1H9G A;  1KU3 A;  2IA0 A;  4AIK A;  4XKV A;  2CGP A;  3QRF F;  4ZYD A;  4UVC A;  2AO9 A;  3WU0 A;  1TWH J;  1X2M A;  3OL3 A;  4HEA 2;  5GPA A;  5IYC J;  3OYL A;  3OYI A;  1HF0 A;  2JQ7 A;  4KDP A;  2R7U A;  5CJ9 A;  3BJA A;  3L1P A;  1GV5 A;  2KIS A;  3L2R A;  5E3N A;  1LQ1 A;  1XSD A;  1R00 A;  1H88 C;  1SD4 A;  3W6J B;  2Y9Z A;  1ZGJ A;  1LDD A;  2CUZ A;  2ME6 A;  1MNE A;  1SFK A;  3LAJ A;  3OS1 A;  3CQZ J;  2QKL B;  1HXD A;  3OIP A;  2DMQ A;  4QTR A;  1G3T A;  1MKM A;  1JE8 A;  2CQN A;  5BMZ A;  3LSG A;  2D1V A;  1FTZ A;  5CVV A;  2L0K A;  2VON A;  2VC1 A;  1YOV B;  3M7G A;  1ZR2 A;  2ZFU A;  5EEA A;  3B6C A;  3I59 A;  1POG A;  2LTP A;  5FKM A;  2R7D A;  4BDY A;  2BY1 A;  4F93 B;  2Z5U A;  1KZH A;  3E3V A;  1Q1H A;  2KIF A;  4XRS G;  3T1B A;  4EEF G;  1MZB A;  4XLN F;  3DPU A;  4UV8 A;  2ZKZ A;  3I71 A;  5IOZ A;  4OAY A;  4PUS A;  3ZMU A;  5EYR A;  4BQQ A;  1FPQ A;  2VOO A;  2M8G X;  4KIF A;  1RPW A;  4M3G A;  3QQA A;  4BJ6 C;  3ERE D;  1PUF B;  2ELK A;  4YIF A;  1FYK A;  5L3F A;  1E3P A;  3TDU C;  2VOD A;  4ANJ A;  5JVT A;  1E3H A;  1YIO A;  4F92 B;  3DQV C;  2QQB A;  2WV0 A;  4W1U A;  2D5V A;  5J4Y A;  1ZQ3 P;  2BVM A;  2LYC A;  3DEW A;  4CYC B;  2VE8 A;  3S16 J;  2IEK A;  3K4J A;  4QWQ A;  4BQO A;  1LJ9 A;  5IT3 A;  5C4J J;  3OS2 A;  4XLA A;  4IHT A;  2A5W A;  2DA5 A;  4G94 A;  5FKL A;  2DTR A;  4MTD A;  3S1M J;  4LGW A;  4U7D A;  1MBK A;  2M8E A;  1K6O A;  4AVP A;  1YX3 A;  1QHH D;  2Y48 A;  2XAS A;  3EYI A;  4NQW B;  4UB6 C;  2PX9 A;  3IP4 B;  2EJR A;  2O5R A;  4M72 A;  4YFK F;  1XC5 A;  1AU7 A;  1TW3 A;  1HBX G;  3K70 C;  2FOW A;  1BA5 A;  3BTC A;  2FXA A;  5FFX A;  2RC4 A;  4CYD A;  4NUB A;  2NNY A;  4GFB A;  1UHS A;  3KX2 A;  2GOX B;  2KPM A;  2YSR A;  3KLO A;  3OSG A;  2GXA A;  3HOX J;  1Z21 A;  2R0Q C;  3OOU A;  2I10 A;  3ULQ B;  4CZC A;  2VAS A;  2L9R A;  2F5D A;  3S1Q J;  3E1S A;  1MNM C;  1X1A A;  4M9S A;  2LBF B;  4KFC A;  2FUG 2;  2XPW A;  3GFM A;  3KZY A;  5CVJ A;  1CF7 B;  5J8C A;  2A6H F;  2K9S A;  1T38 A;  5DM7 F;  2FD5 A;  3GFJ A;  4I6Z A;  3BG6 A;  2YS9 A;  2WB1 N;  4RGU A;  3HOY J;  3ZXS A;  1FZP B;  2QSG X;  1EJ9 A;  1U5T C;  4MLO A;  4V2G A;  1GVD A;  4G8X A;  5K1Y A;  2XSD C;  4ZTJ A;  4KT6 A;  4S05 A;  4DBQ A;  2R7X A;  3G73 A;  1MH3 A;  2DA1 A;  4LLL A;  4MNU A;  3CP2 A;  3GXO A;  4OIN F;  4X1E A;  4FCY A;  1F43 A;  2Z9O A;  5DS9 A;  1U2W A;  2Y2Z A;  3RQI A;  1STZ A;  1JTY A;  3D5L A;  5ERI A;  4EJU A;  4JX5 A;  4AVZ A;  2LD5 A;  2GA2 A;  3LFU A;  2WAE A;  1I6H J;  1UG0 A;  2MBF A;  1WPK A;  2PEX A;  1SFX A;  4I02 A;  2NXN B;  2LK2 A;  2M9H A;  4M6V A;  1JJ8 C;  2RV8 A;  1L3L A;  1KU7 A;  1R4M B;  3C18 A;  4C3J J;  2Q0O A;  2LH9 A;  1AOY A;  2ETH A;  4L9T A;  1IN5 A;  2LVS A;  5F64 A;  3DEU A;  3VYU B;  3LWF A;  4D0P A;  1RNL A;  3TP0 A;  5F1J A;  5F0C A;  2UWM A;  2QKM B;  2R5Y A;  3HC7 A;  1UMQ A;  3AG3 H;  4B1R A;  3OYA A;  2GXB A;  1GXQ A;  1QU3 A;  5LBQ A;  1P7I A;  4IEJ A;  1QBJ A;  3OV8 A;  5B1A H;  2X6O A;  3BJO A;  1SAN A;  4D7N A;  1VQO I;  2E1N A;  1VZ0 A;  3TMO A;  2W84 A;  5TGT A;  2LKP A;  1X3U A;  2R7W A;  4E4H A;  2L5Q A;  4HX7 A;  2CQQ A;  3KP7 A;  2ZSH B;  1XN7 A;  2ID3 A;  3RJP A;  3ABU A;  4XRM A;  3I54 A;  1I3Q J;  4U7B A;  5M3M J;  1HW5 A;  2IGO A;  4EJT A;  1ZN2 A;  3MAJ A;  4EJW A;  1TNS A;  2OZ6 A;  2CS3 A;  1XDS A;  3MEX A;  4FT8 A;  4HV6 A;  3I58 A;  2KRH A;  3FK6 A;  2KJC A;  4E7L A;  4HA8 A;  1BIA A;  4ABZ A;  1AKH A;  1BW6 A;  2BBY A;  1BM9 A;  5JHU A;  4YFN F;  1VQN I;  3FZV A;  4OWR B;  1LE8 B;  1IXS B;  5A2Q K;  3ZR8 X;  2WY8 Q;  3ECO A;  4KIB A;  3WTT C;  3R4K A;  1O57 A;  1O3S A;  3I59 B;  1BOA A;  3KP2 A;  3SFZ A;  3CME I;  1VFC A;  4B8X A;  5K7F A;  2LDU A;  2VJ4 A;  2DN0 A;  3Q0U A;  1WSU A;  3T8T A;  1WCM J;  4M9Z A;  2IP2 A;  2E2I J;  2X6Y A;  5D6E A;  1VQM I;  2L54 A;  4A3F J;  1MW7 A;  4XID A;  4ITV A;  1BBY A;  2A05 A;  4LFU A;  4UY8 I;  4AUX A;  3PFI A;  2LLK A;  4N9I A;  4DQ2 A;  4YG2 F;  2BXY A;  1J7K A;  1YW8 A;  3DBR B;  3LSJ A;  2E34 A;  3WTY C;  3ELK A;  3ASN H;  3DWL E;  2KKO A;  4HST A;  3BG3 A;  4AIH A;  4V2F A;  5BPD A;  1O7F A;  3AFH A;  2DDA A;  1A5J A;  1D1C A;  3V8J A;  3S3O A;  4XSZ F;  1FYL A;  2ZXJ A;  1DQU A;  4EJO A;  4HDU A;  1V4R A;  4XLH A;  1D1B A;  5E3O A;  2V9K A;  3R0J A;  3CD6 I;  1W5S A;  2LSO A;  4JOM A;  1WH7 A;  2CMP A;  5IPA A;  4Y33 A;  5LLQ A;  5L3E A;  1BW5 A;  1X4P A;  1OJL A;  1JGS A;  4PJN A;  2DCE A;  1ZR4 A;  1T56 A;  1I1G A;  2BV6 A;  3GFL A;  3H9Q A;  4NHJ A;  1IO2 A;  2L9N A;  4RA2 A;  3Q5F A;  2G7U A;  2H1K A;  3K2Z A;  9ANT A;  1D8K A;  3H92 A;  1HC8 A;  2BYV E;  4N4O B;  5C3E J;  3JRI A;  4A5N A;  1UAA A;  5DUI A;  1P4A A;  2FU4 A;  3KYL A;  2MH9 A;  4JQF A;  3PO2 J;  3V8L A;  1QRY A;  1V5G A;  2L9S A;  4KIT B;  4EMS A;  3FKI J;  3ERM A;  2F5V A;  1VQ9 I;  3HRM A;  5FRN A;  3S8P A;  4XKW A;  4CSW A;  2R7O A;  3TQN A;  2EFQ A;  4AWX B;  1OMI A;  5J1U A;  4FTH A;  2HR3 A;  4ENM A;  5HDG A;  1LDK B;  4HQE A;  3CTA A;  1SFU A;  2NOJ B;  5B66 C;  4HV5 A;  3F6O A;  3BTI A;  2CFX A;  2JK3 A;  3KIO A;  4XQF A;  3E6D A;  3SDB A;  4CCO A;  3CMY A;  3I4N J;  3BWG A;  1LFP A;  3FK7 A;  1S8N A;  3TW7 A;  1IF1 A;  3ZQL A;  3GME A;  1YS6 A;  1OCP A;  1OCZ H;  2DI3 A;  3F9K A;  2X4H A;  1W7P A;  4BE1 A;  5D5W B;  1OLT A;  1QO0 D;  5LD2 C;  1DP7 P;  3UNG C;  3BY6 A;  2HS5 A;  2AXT C;  4ZDP A;  1F9N A;  1U9N A;  4LB6 B;  2ELH A;  4E70 A;  1JHH A;  1BI2 A;  4A0Y A;  1A04 A;  5LHI A;  2EFP A;  1APL C;  3OY9 A;  4ZC3 A;  2KHM A;  5JFR A;  3ZRG A;  2IT0 A;  1Y8R B;  1H9T A;  2ISZ A;  3E7L A;  1K4T A;  3NAR A;  3U21 A;  3JRH A;  1ZLK A;  2MSY A;  4EM2 A;  2AS5 F;  3A01 A;  2GAU A;  2BOL A;  4UUS B;  1PJR A;  1U6G A;  3Q9V A;  1Y0U A;  1X1B A;  5B5E C;  3PQK A;  2Y69 H;  3FXJ A;  2LKS A;  1ONV A;  4IRH A;  1DGW Y;  3LSR A;  2R93 J;  3QOE A;  3HYI A;  3HJE A;  4RLQ A;  3PUF A;  3H1C A;  1QZE A;  3ZQI A;  4RB2 C;  4U0V A;  1K4S A;  1JT0 A;  3ZMV A;  2QQ8 A;  4ZJZ A;  2W82 A;  3L7W A;  3KYC B;  2KP6 A;  5KAF C;  4BY7 J;  3JTG A;  5BOX A;  2IGM A;  2E35 A;  1TBX A;  1IXR C;  2M34 A;  1XSV A;  1E3O C;  1HA8 A;  2ZXI A;  1MIJ A;  5CKT A;  3I55 I;  2JRT A;  2LP0 A;  2HWV A;  3GEZ A;  4NC6 A;  1GV2 A;  2B63 J;  3RPQ A;  4A3J J;  1ETX A;  2UUZ A;  5KNL A;  3RSN A;  4WXH A;  1AA7 A;  3DTI A;  1Z67 A;  1BI0 A;  1Z7L A;  5ICE A;  3FHN A;  6PAX A;  2VBY A;  2XGE A;  1IAW A;  5L3B A;  2LC2 A;  2A68 F;  2IVM A;  3ABL H;  1B9M A;  1KON A;  2JPB A;  2K9L A;  2PBI A;  4WF2 A;  2IS1 A;  4YEL A;  5IT9 K;  2YR2 A;  4YEJ A;  1UCR A;  1PP8 F;  2BGC A;  3SQN A;  3HXL A;  3T0Y A;  3GUD A;  3M1E A;  1FC3 A;  2NVU B;  1I50 J;  3W2V A;  2FMY A;  3CO6 C;  2K4B A;  1A31 A;  2OA4 A;  2R5Z B;  3H9G A;  3EYY A;  4WCG A;  2HDC A;  2J5P A;  3IL2 A;  1U5T B;  1DP3 A;  2N8G A;  3HGG A;  1MD0 A;  1IZ1 A;  1N75 A;  3HHG A;  4PJJ A;  2Q2E B;  2JZY A;  3CO7 C;  1FOY A;  1BOB A;  4ZYA A;  3RPU A;  1OPC A;  3IC7 A;  3SDG A;  1TT5 B;  2EZH A;  2BY3 A;  1IV6 A;  2NS8 A;  4IJA A;  2HKX A;  1Z05 A;  3ZQG A;  1YYV A;  1OR7 A;  3ECH A;  1JJ6 C;  3E6M A;  1FP2 A;  2JUC A;  1UG2 A;  1Z3X A;  2QBY B;  2VJJ A;  2PMU A;  5KAI C;  4FE4 A;  1RRJ A;  3IAS 2;  1QGP A;  2UZK A;  4EGY A;  5CPR B;  5FLM J;  2ECC A;  2ZME C;  3GF2 A;  1B1B A;  2CYY A;  3KZZ A;  1P4W A;  4XR6 A;  5GTH C;  1PUF A;  4O3M A;  5H2F C;  2ISY A;  4M3D A;  4G12 A;  3HUG B;  4B3X A;  3PIO F;  3WTZ A;  1WI9 A;  1R5G A;  3HSF A;  2EFN A;  3JAM K;  4LG0 B;  3O2P E;  1NH3 A;  3F3X A;  2HQA A;  2O7O A;  3BPV A;  4AD9 A;  2MA3 A;  2M5W A;  1BIB A;  4GO1 A;  1T2K A;  1XMK A;  4YIR X;  4CYC A;  4B09 A;  4IF4 A;  3DXJ F;  4U88 A;  1GXP A;  3DBH B;  3FM5 A;  3OIO A;  1CQT A;  3OYH A;  5J3L A;  2H94 A;  3GZN B;  1IG7 A;  1YE9 A;  1F36 A;  4R1H A;  1GT0 C;  2ZJQ F;  2F5F A;  1LDJ A;  2OQR A;  1DGR M;  1YIJ I;  3C3W A;  3MD2 A;  2HEO A;  2XB5 A;  4NQW A;  3SZT A;  5LGN A;  4A3D J;  2FML A;  1FLI A;  1S7E A;  2V1X A;  2HOE A;  3DU5 A;  3TBI A;  2A6E F;  2GWR A;  4GCV A;  1OKR A;  3LSK A;  2CV0 A;  3K0L A;  4AID A;  4DOZ A;  3JSO A;  2DU9 A;  3BR0 A;  4MHG A;  1VI0 A;  2O8K A;  3E6C C;  1W36 C;  3OYF A;  4O5V A;  5M5X J;  4Y7N J;  3DBL B;  4ON0 A;  4PCQ A;  4BAC A;  1ETV A;  2V9P A;  2DFF A;  4DYC A;  1JKR C;  3A4C A;  2VQH A;  5DD4 A;  2E7W A;  3WTS C;  2DK5 A;  1N25 A;  2LBF A;  5D5V B;  5ICF A;  3A1Y A;  2H8W A;  2ZNY A;  1Y1V J;  3P5J A;  1FWZ A;  2VT3 A;  3R61 A;  1CF7 A;  1G8X A;  3OMY A;  4FET A;  5M5Y J;  3G1L A;  2EQR A;  5EF6 A;  2H8R A;  2NVX J;  2P8T A;  2ZO4 A;  4H4K C;  1FP1 D;  3E5U A;  3TKY A;  1SAU A;  2CW8 A;  2KIQ A;  2V9V A;  4MFE A;  4J00 A;  2HZT A;  3M1C A;  1FMW A;  1MGT A;  2R3S A;  5GPC A;  3L2C A;  3A2K A;  2DYS H;  2DA6 A;  2K86 A;  2QVO A;  1ZRE A;  2DA7 A;  5ICG A;  3DV8 A;  3JSP A;  1VQ7 I;  2EV0 A;  2OZU A;  3MKL A;  2IPQ X;  3K4C A;  2ZME A;  2M87 A;  1X3W B;  5E8G A;  3CCR I;  2VKE A;  3HRT A;  4Q48 A;  3BQZ A;  3H0D A;  4V19 K;  2RVC A;  2YPR A;  2XRO A;  3BT9 A;  3L9F A;  5HLT A;  2RDP A;  2QQ9 A;  4PGG A;  3MZH A;  1HDD C;  3MKZ A;  3H5N A;  2PMZ N;  3GTQ J;  1ZGA A;  3S1R J;  4XOR A;  3MN2 A;  2O8X A;  4CA0 A;  2PLY A;  3Q0V A;  1FX7 A;  1VQP I;  1JKQ C;  2HXO A;  2MAB A;  4A3B J;  2JUG A;  3PL8 A;  3WOD F;  5A2Q Z;  5HOD A;  2E1O A;  4MFD A;  5HDK A;  3WHB A;  5FGM A;  2V4J C;  2VBZ A;  3GX4 X;  2E2J J;  1BR4 A;  4M6X A;  5GAG J;  3J7Z I;  3MZY A;  4IOC F;  3V7S A;  2QGU A;  1R9T J;  5ICC A;  3K4K A;  3J7A Y;  2W48 A;  2W24 A;  4IO9 F;  5JVG F;  3P7N A;  3IAM 2;  1KQ9 A;  2I5U A;  3BCA A;  2W85 A;  3CC2 I;  3HSR A;  4B44 A;  1XG1 A;  4XNF A;  3RQ4 A;  3G6E I;  1PUE E;  1OYI A;  4IQ4 A;  4C9Y A;  1Z1D A;  2VUM J;  2TDX A;  2DQR A;  5AON A;  3OYN A;  1I6X A;  1KQ0 A;  4CZZ A;  3DKY A;  4E6K G;  5DYM A;  2E1C A;  2IGN A;  1ERD A;  4BY1 J;  2Y0M A;  4XKC A;  3IKT A;  2XPU A;  3JRA A;  3PNV A;  1HDP A;  3K1N A;  4LD5 A;  1DU6 A;  1T33 A;  3ZCO A;  1ZYR F;  3ZQC A;  3AG1 H;  2FE3 A;  3D5R C;  3M8E A;  2DPU A;  4A12 A;  2CQK A;  1IDZ A;  4PJM A;  1HKS A;  2KIU A;  1T95 A;  1FYM A;  3MMY B;  3U9G A;  1VQ4 I;  3ZQ7 A;  2HFH A;  4FE7 A;  4UUT A;  3BQY A;  2V26 A;  4HF2 A;  2IS6 A;  2BE5 F;  4QPO A;  1LE8 A;  4HZF A;  2Z99 A;  2X6X A;  5F6F A;  1ZH5 A;  4BYY A;  1ZK8 A;  2XAU A;  1XB4 A;  2L9V A;  3S2W A;  3HPG A;  4KIC A;  3DF8 A;  3GWZ A;  5DV5 A;  4CGZ A;  4LLN A;  1TWA J;  3I56 I;  2XAG A;  5HS8 A;  3IWZ A;  3H0G J;  4DGW B;  2VT2 A;  1O7L A;  1MBF A;  4B47 A;  2XGC A;  3H35 A;  2EZK A;  3SYT A;  5K7Z A;  3FMR A;  1EH6 A;  1XTA A;  3VOD A;  2YUS A;  4IZZ A;  3AL0 C;  3OYE A;  4S04 A;  4DJA A;  3LNQ A;  1Y8Q B;  4EM0 B;  1TZL A;  2KQR A;  2DA4 A;  1VF9 A;  1XCB A;  4HSR A;  4XRS A;  2OD5 A;  4ASN A;  5D8L B;  5LGU A;  3HDD A;  5HVQ C;  4BE0 A;  5EJC A;  1T0F C;  2VIX A;  3BOQ A;  3BG7 A;  4QIW N;  4CXF A;  4CHU A;  2EK5 A;  3S32 A;  3SJM A;  1XGS A;  3NWS A;  2FBI A;  4WK8 F;  1Q1V A;  5IY5 H;  3KET A;  2FJ1 A;  1ZAR A;  4A93 J;  3Q0W A;  4L9V A;  5CVU A;  1BR1 A;  2EIL H;  4XLF A;  4IX7 A;  2QQA A;  4BDZ A;  4ZZL A;  1Y56 A;  1V5E A;  5IP6 A;  1R4N B;  4KNY A;  3VFZ A;  1MMD A;  2ME0 A;  4CCM A;  4CO8 A;  3GO5 A;  4Y15 A;  4HDV A;  2HYF A;  2ACJ A;  3IH4 A;  2TCT A;  1R71 A;  2IXS A;  4PJ0 C;  4RDU A;  3GTK J;  3LQQ A;  2KIM A;  4BBS J;  1RR7 A;  5D6F A;  3TED A;  3ZPL A;  3K1M A;  2O3F A;  4WX9 A;  4RLF A;  1IRG A;  1HST A;  2R7F A;  1XS9 A;  5HOO A;  3J7Y J;  1JKP C;  1J5Y A;  1U0J A;  3CJR B;  2WC2 A;  1A35 A;  3PFY A;  1QZZ A;  4BBR J;  1REP C;  4U87 A;  1LEA A;  1R5I D;  4D5C A;  2MD0 A;  2P6T A;  3TOA A;  1F4K A;  1J09 A;  4CIC A;  2QEX I;  4Z2Y A;  3CCJ I;  5E79 C;  1X4O A;  3VB2 A;  3CMA I;  1ORK A;  2P7V B;  3MCZ A;  4P9U A;  1FT9 A;  3ABM H;  2UXX A;  1V5F A;  1WRJ A;  5HLH A;  3VYT B;  2NYX A;  1KU9 A;  2M45 A;  3OIQ A;  1S7A A;  1ETQ A;  2CQ7 A;  4HPQ A;  1FBU A;  2JSC A;  5CVR A;  4IL6 C;  1W0U A;  2FSW A;  5DTD A;  2EIJ H;  2P7C B;  3FXL A;  4XRF A;  1B72 A;  4A3K J;  4BS9 A;  2HQN A;  3M8J A;  4F55 A;  4O6J A;  2NS0 A;  3UR3 C;  3GTP J;  1MJ9 A;  1ETW A;  1QHG A;  1R5H A;  4PZJ A;  4DYQ A;  3KP5 A;  4L0Y B;  1JHF A;  4KMU X;  2ZME B;  3PJR A;  5K5Q A;  3KEQ A;  2A07 F;  4LIT A;  1RZ4 A;  2RAE A;  4CCN A;  3G71 I;  1IGN A;  4OIO F;  3F8B A;  3VOE A;  1U9O A;  3WGH A;  4Y13 A;  1MJA A;  1T0F A;  4UUS A;  1TNT A;  2JSP A;  1I39 A;  5IT9 Z;  1JUP A;  3BP8 A;  1HSJ A;  1P6R A;  2HOT A;  2RQP A;  3VWB A;  1LNW A;  1UEL B;  2NS7 A;  3H3U A;  4FX4 A;  2IGK A;  1X1D A;  2DW4 A;  5IP7 J;  3FWE A;  4JX4 A;  2CG4 A;  3S14 J;  1SVO A;  3V4G A;  4RAZ A;  2DYR H;  1VQL I;  5BS6 A;  3HHH A;  1QZY A;  3JTH A;  3HIF A;  3L2Q A;  2VBX A;  1YJN I;  3E97 A;  1Y39 A;  2O61 A;  2QWW A;  5AIQ A;  1WQ2 A;  3QYB A;  5KK1 A;  4L5E A;  1FSH A;  2MC3 A;  5ILU A;  2JMW A;  1RKW A;  2F5C A;  2XGD A;  5EEG A; 
#chains in the Genus database with same CATH homology
 3DP7 A;  1KA8 A;  3BDD A;  2CO5 A;  2VE9 A;  4EV0 A;  4LMY A;  2EWN A;  4DNC A;  1KYW A;  1O3T A;  5E20 A;  4ESB A;  2OBP A;  4A6E A;  1HW2 A;  5DCM B;  3JAM Z;  3CLO A;  2COM A;  3RYP A;  1KQ8 A;  1BC7 C;  3LST A;  1IUY A;  2WWY A;  2W57 A;  1U5T A;  2EB7 A;  3E5X A;  3T8R A;  2Q2E A;  3F6V A;  2LF7 A;  3QU3 A;  2ESN A;  3QOP A;  2LF8 A;  2XV4 S;  4LB5 A;  2V1D A;  3TDZ C;  2V1U A;  3EQL F;  3F8N A;  4ETS A;  3K69 A;  4MGR A;  1J75 A;  2QBY A;  1SD5 A;  4A2U A;  4HLX A;  1Z6R A;  4ZYE A;  2DLL A;  3F21 A;  5KVR A;  2F2E A;  2KRF A;  3ZMD A;  4A5M A;  3HUG A;  4HX8 A;  1DUX C;  2MH2 A;  3EET A;  4LG0 A;  1AWC A;  1U8R A;  2PJP A;  1ON2 A;  3WTW C;  1TQI A;  3I64 A;  1WKM A;  3KEO A;  1U78 A;  5D4S A;  1K79 A;  2VN2 A;  4A6D A;  3FHZ A;  4M71 A;  5BPI A;  3HRS A;  1W7P D;  5JI6 A;  2JPC A;  5FLX K;  5EEH A;  4Q5S F;  3GZ5 A;  1EH8 A;  3TO7 A;  4WXD A;  3C7J A;  5L3G A;  2STT A;  1ZHF A;  2PQ8 A;  3QPT A;  1J0R A;  1ZLJ A;  3V7C A;  2XAH A;  3O3K A;  2ZCW A;  2Z3Y A;  2OAZ A;  1ZRC A;  4M9X A;  3F23 A;  3RI4 A;  2LNB A;  1D8J A;  1G6N A;  4GGG A;  5DUK A;  5DDG A;  4RS8 A;  1XGN A;  2A61 A;  2P4W A;  4GYI A;  2PI0 A;  1BC8 C;  4BNC A;  3EDP A;  2QM3 A;  1JXS A;  3RKX A;  5J6X A;  3KP6 A;  5TJJ A;  1U3E M;  1R7J A;  1T6S A;  4BXU A;  2F5E A;  5D5X B;  2QYO A;  3J7A O;  3GZ6 A;  3FM3 A;  2IA2 A;  2VXZ A;  1EV7 A;  3CUO A;  4N0B A;  3ABT A;  3MFK A;  3I53 A;  3ZMZ A;  3JW4 A;  3J81 K;  1S7O A;  2HTJ A;  1B59 A;  2E7X A;  2NRA C;  4L0Z B;  2FF4 A;  1I27 A;  1QQI A;  2M30 A;  1B6A A;  1LVA A;  2DFI A;  3GYH X;  4HW0 A;  3LA7 A;  2FNA A;  1YS7 A;  5HLG A;  1O3R A;  1IN4 A;  3V8K A;  2FA5 A;  5D8K B;  1CGP A;  4Q47 A;  2IRF G;  3FXR A;  2FNP A;  1TTY A;  5DCF A;  4CDG A;  4RGS A;  1XSX A;  3R60 A;  3WE2 A;  1S3J A;  4G7Z F;  2HQR A;  3ZN1 A;  5F1R A;  4ZZD A;  3F8C A;  4KN7 X;  5ED4 A;  1K78 B;  2HGC A;  1DPU A;  1B4A A;  1YO5 C;  2VC0 A;  1BJA A;  2H09 A;  2XGX A;  4HBL A;  1G3Y A;  3L00 A;  1HKQ A;  2RGV A;  2GZW A;  3WGI A;  2QZ8 A;  1TLH B;  1HW1 A;  2UXN A;  3N97 A;  2YX7 A;  2V6C A;  4EQQ A;  5L3D A;  2PG4 A;  4IPA A;  5FB2 A;  1E2X A;  2DPD A;  1YG2 A;  1ZAO A;  5FFZ A;  2PMH A;  5HDN A;  1R36 A;  4ZYH A;  3BZ6 A;  5E1W A;  4ENJ A;  2IJL A;  2DT5 A;  1RIO H;  4GYG A;  3WTX C;  2XKO A;  1SMY F;  3OOP A;  5DD8 A;  2XKP A;  2QUF A;  5ILV A;  5E8I A;  1BN5 A;  3NRV A;  3J80 K;  1YLF A;  2XIG A;  5LEJ A;  2VBW A;  1IW7 F;  2CW0 F;  1VTN C;  3GFI A;  3E5Q A;  1MDM B;  4M73 A;  4FHT A;  3HTU A;  5E1Z B;  3U2R A;  4L9J A;  4A0Z A;  1W5T A;  5CVI A;  3KLN A;  4HX4 A;  1P2F A;  3N4M A;  4ENN A;  2O6G E;  1EH7 A;  2VOP A;  2DAO A;  4OIR F;  4KN4 X;  1IRF A;  2D1H A;  3LFK A;  2W25 A;  4LJZ F;  1FBS A;  1ZG1 A;  2WTE A;  2EV6 A;  2P6S A;  1Z91 A;  2K7L A;  5HS7 A;  3MQ0 A;  4L5I A;  1HQC A;  2DK8 A;  3BPX A;  1Z9C A;  2IA1 A;  1G3S A;  2Z33 A;  3FMQ A;  5K5R A;  2FRH A;  1S29 A;  4G6Q A;  5LHG A;  3M9A A;  3WU1 B;  2RKH A;  5D4R A;  1P92 A;  3E6B A;  3H3Z A;  5DCM A;  4P96 A;  3FXQ A;  1IXC A;  4Y17 A;  5LEK A;  4IVN A;  5AIP A;  2XAF A;  2ZJ2 A;  2P5V A;  1T39 A;  3NEU A;  4BHC A;  4OMZ A;  5H6Q A;  2L4M A;  1FSE A;  4M74 A;  2XUB A;  2GXG A;  4PGH A;  4KUM A;  3QU6 A;  1V3F A;  4P55 A;  1S6L A;  1RUO A;  2K02 A;  3CUQ B;  2HKO A;  2XAQ A;  3VEP A;  3HTS B;  5FLX Z;  3ZN0 A;  2FOK A;  3TOB A;  3CDH A;  2DO7 A;  5HLI A;  3PQJ A;  3SHF A;  4OIQ F;  2PFB A;  5L3C A;  4ESJ A;  4BH9 A;  2XHK A;  1SD6 A;  2XVC A;  1YTY A;  1DPR A;  2NNN A;  3B73 A;  3KFW X;  1K7A A;  1SMT A;  3L09 A;  3O6B B;  4KT5 C;  1C0W A;  1FBQ A;  1PP7 U;  4MQV A;  1KU2 A;  2L01 A;  4HQM A;  4F7Z A;  4HAM A;  4I0A A;  2ESH A;  3CJN A;  3K9T A;  1BI1 A;  3FXU A;  4I98 B;  1XGO A;  1TQP A;  1D5V A;  2P5K A;  2P5L C;  4EGZ A;  1UST A;  1R1V A;  4EM1 A;  3J81 Z;  4RAY A;  1IN8 A;  4ENK A;  5H20 A;  3LA3 A;  3QP5 A;  4RB0 A;  3AAF A;  1LEB A;  2DBB A;  2PN6 A;  2IW5 A;  1UFM A;  2G7H A;  4G9Y A;  1WWX A;  2EA2 A;  2JTV A;  3WTU C;  2B0L A;  3U1D A;  1YW7 A;  3SZP A;  1RI7 A;  3I4P A;  5LRS A;  2D45 A;  1J2X A;  3RYR A;  4UXN A;  1DDN A;  1OYW A;  3HRU A;  2C6Y A;  3I0T A;  1R22 A;  4P9F A;  1XDU A;  3KP4 A;  1I1S A;  1R1T A;  1G3W A;  3F8F A;  4L18 B;  4G7H F;  2RN7 A;  3ZMT A;  2XRN A;  2O03 A;  4ZH4 F;  4HOB A;  3QAH A;  3P9C A;  5FD6 A;  3M8F A;  1ZRF A;  1KGS A;  3WGG A;  1SAX A;  4N9H A;  2GQQ A;  3HSE A;  1YW9 A;  4KMF A;  2FEZ A;  3WE3 A;  1QPM A;  2K27 A;  2L4A A;  4UV9 A;  4OIP F;  4BHB A;  3HOS A;  4R8H A;  2GIV A;  1ZRD A;  1J9I A;  2ZBK A;  2L02 A;  5ILS A;  4U0Y A;  3TO6 A;  4MTE A;  1GVJ A;  2G9W A;  2A69 F;  2H27 A;  1B9N A;  3QP6 A;  1NHA A;  4JBA A;  3RIR A;  4ESF A;  3ISP A;  4BHP A;  2EFO A;  2A5Y B;  3ML6 A;  2Q8K A;  1BI3 A;  4UHT A;  4WXC A;  1K78 A;  3J80 Z;  4A0X A;  1QNT A;  4RB3 C;  5CLS A;  1ZG5 A;  2O0Y A;  3P9K A;  2STW A;  1YFH A;  2HTS A;  4LK1 F;  4LK0 F;  3KP3 A;  4YII A;  2OU2 A;  5E1X A;  5BQT A;  4RGX A;  2MLG A;  2D2W A;  5K5O A;  4MQ9 F;  1UHW A;  3NQO A;  4QLC U;  2CWE A;  4BQA A;  3KCC A;  2OQG A;  1UHM A;  3DFG A;  4Q4Z F;  3I5U A;  3WTV C;  5E18 F;  2FBK A;  4KA4 A;  4EJV A;  2MD5 A;  3COA C;  4PDK A;  4HLY A;  3RKY A;  1SD7 A;  3ZMS A;  4YFX F;  3HOT A;  3R0A A;  4FX0 A;  4OMY A;  1O3Q A;  1MDM A;  3RTR A;  1HKT A;  2KJB A;  2ZNZ A;  4UVB A;  1TW2 A;  2ZFW A;  4L5J A;  1ON1 A;  1R58 A;  5J8F A;  4RGR A;  1XD7 A;  3CUQ C;  1W4M A;  1XGM A;  3DPL C;  1LB2 A;  1D3Y A;  2EA4 A;  3Q9S A;  3T5X A;  1T98 A;  4IRI A;  1XCV A;  3F22 A;  2H6C A;  3F8M A;  3MWM A;  4KYW A;  4NB5 A;  4HF0 A;  3IRQ A;  5LGT A;  4OU0 A;  4I0B A;  2MLK A;  3LQR A;  1XMA A;  1FY7 A;  3LAP A;  4G7O F;  2HYG D;  5CYV A;  2YU3 A;  3G3Z A;  3QPH A;  3BJ6 A;  4TV7 A;  4UVA A;  1OYY A;  1H0M A;  3F72 A;  3FX3 A;  1FNN A;  4IRG A;  2Y75 A;  5FD5 A;  1TQM A;  3DPT A;  3TGN A;  3REO A;  2NAZ A;  4LLG F;  4IHS A;  2K4J A;  3K1P A;  1PDN C;  4EVI A;  1YQA A;  4MEX F;  4I01 A;  4I2O A;  3DKW A;  2RNJ A;  3RKW A;  3CUQ A;  5TRD A;  4I09 A;  4UUV A;  4R79 A;  4MEY F;  4P5O A;  4U0W A;  1R23 A;  2M1B A;  4BAY A;  4ZYG A;  1ZG3 A;  5FO5 A;  2ADU A;  4AIJ A;  4I7H A;  1ODD A;  3GLX A;  3IWF A;  3B02 A;  1FOK A;  1R1U A;  1UB9 A;  2EV5 A;  5HS9 A;  5D5U B;  4OOI A;  3SXY A;  3ROU A;  5H6R A;  5DEQ A;  3LA2 A;  2CSO A;  3V7R A;  1G4D A;  3FMS A;  3P9I A;  2FBH A;  4G6D A;  2FQ3 A;  2GA1 A;  5LHH A;  1USS A;  4RB1 A;  4WWC A;  1Z6T A;  1MJB A;  1L0O C;  4M6Y A;  3R6S A;  2JT1 A;  2YX4 A;  1IN6 A;  2AXL A;  2J5O A;  3IKV A;  1J59 A;  2QEN A;  2XAJ A;  4UNO A;  2V79 A;  1ULY A;  4HF1 A;  4JK1 X;  3GVA A;  5JR3 A;  3C1D A;  1E17 A;  1W7P B;  1SFE A;  2QLZ A;  4XBF A;  2DQL A;  3BRO A;  3KE2 A;  3EUH A;  3TO9 A;  1GHC A;  3ZP5 A;  2A3S A;  3D0S A;  5E17 F;  4HYE A;  3IHU A;  3FF5 A;  1RUN A;  1KYZ A;  1F5T A;  2H6B A;  4GXO A;  4KIG A;  1Z7U A;  2X0L A;  4XSX F;  3IRR A;  4L9N A;  1P4X A;  2EFW A;  1IN7 A;  4K2E A;  1F1Z A;  3WG9 A;  4IXA A;  4XLP F;  3RDI A;  4H0E A;  3W6K B;  2BEO A;  2L3D A;  1I5Z A;  5LRR A;  3GW2 A;  1H9G A;  1KU3 A;  2IA0 A;  4AIK A;  2CGP A;  3QRF F;  4ZYD A;  4UVC A;  3WU0 A;  4KDP A;  5CJ9 A;  3BJA A;  1LQ1 A;  1XSD A;  1R00 A;  1SD4 A;  3W6J B;  1ZGJ A;  1LDD A;  3LAJ A;  1HXD A;  1G3T A;  1MKM A;  1JE8 A;  5BMZ A;  2D1V A;  5CVV A;  2VON A;  2VC1 A;  3M7G A;  3I59 A;  2R7D A;  2Z5U A;  3E3V A;  1Q1H A;  2KIF A;  3T1B A;  1MZB A;  4XLN F;  4UV8 A;  2ZKZ A;  3I71 A;  3ZMU A;  1FPQ A;  2VOO A;  4KIF A;  3ERE D;  4YIF A;  1FYK A;  5L3F A;  3TDU C;  2VOD A;  5JVT A;  1YIO A;  3DQV C;  2QQB A;  2WV0 A;  2VE8 A;  4QWQ A;  1LJ9 A;  5IT3 A;  4IHT A;  4G94 A;  2DTR A;  4MTD A;  4LGW A;  4U7D A;  2M8E A;  1K6O A;  4AVP A;  2Y48 A;  2XAS A;  3EYI A;  4YFK F;  2EJR A;  4M72 A;  1TW3 A;  1HBX G;  2FXA A;  5FFX A;  2RC4 A;  4CYD A;  2NNY A;  2YSR A;  3KLO A;  3ULQ B;  2F5D A;  4M9S A;  4KFC A;  5CVJ A;  3GFM A;  3KZY A;  1CF7 B;  5J8C A;  2A6H F;  1T38 A;  3GFJ A;  4RGU A;  1FZP B;  1U5T C;  4G8X A;  5K1Y A;  4S05 A;  3G73 A;  4LLL A;  4MNU A;  3GXO A;  4OIN F;  2Z9O A;  1U2W A;  1STZ A;  3D5L A;  5ERI A;  4EJU A;  2GA2 A;  2MBF A;  2PEX A;  1SFX A;  4I02 A;  2RV8 A;  1L3L A;  1KU7 A;  3C18 A;  2Q0O A;  1AOY A;  2ETH A;  4L9T A;  1IN5 A;  5F64 A;  3DEU A;  3LWF A;  4D0P A;  1RNL A;  2UWM A;  2GXB A;  1GXQ A;  5LBQ A;  1QBJ A;  3OV8 A;  3BJO A;  2E1N A;  2W84 A;  2LKP A;  1X3U A;  4HX7 A;  3KP7 A;  1XN7 A;  3RJP A;  3ABU A;  3I54 A;  4U7B A;  1HW5 A;  4EJT A;  1ZN2 A;  3MAJ A;  4EJW A;  1TNS A;  2OZ6 A;  1XDS A;  3MEX A;  4FT8 A;  4HV6 A;  3I58 A;  2KJC A;  4HA8 A;  1BIA A;  2BBY A;  1BM9 A;  5JHU A;  4YFN F;  3FZV A;  1IXS B;  5A2Q K;  3ECO A;  4KIB A;  3WTT C;  3R4K A;  1O57 A;  1O3S A;  3I59 B;  1BOA A;  3KP2 A;  3SFZ A;  1WSU A;  4B8X A;  2LDU A;  3T8T A;  4M9Z A;  2IP2 A;  5D6E A;  2L54 A;  1BBY A;  4LFU A;  3PFI A;  4DQ2 A;  4N9I A;  4YG2 F;  1J7K A;  1YW8 A;  3WTY C;  3ELK A;  2KKO A;  4AIH A;  5BPD A;  1O7F A;  3V8J A;  4XSZ F;  1FYL A;  2ZXJ A;  4EJO A;  4HDU A;  1V4R A;  3R0J A;  1W5S A;  2LSO A;  5LLQ A;  5L3E A;  1JGS A;  1I1G A;  2BV6 A;  3GFL A;  4NHJ A;  3Q5F A;  2G7U A;  3K2Z A;  1D8K A;  3H92 A;  2BYV E;  4A5N A;  5DUI A;  1P4A A;  2FU4 A;  2MH9 A;  4JQF A;  3V8L A;  4EMS A;  3HRM A;  3TQN A;  2EFQ A;  4AWX B;  1OMI A;  4ENM A;  2HR3 A;  5HDG A;  1LDK B;  4HQE A;  3CTA A;  1SFU A;  4HV5 A;  3F6O A;  2CFX A;  3E6D A;  3BWG A;  1S8N A;  1IF1 A;  1YS6 A;  2DI3 A;  2X4H A;  1W7P A;  5D5W B;  1QO0 D;  1DP7 P;  3BY6 A;  2HS5 A;  1F9N A;  4LB6 B;  2ELH A;  4E70 A;  1JHH A;  1BI2 A;  4A0Y A;  1A04 A;  5LHI A;  2EFP A;  5JFR A;  2IT0 A;  1H9T A;  2ISZ A;  1ZLK A;  4EM2 A;  2AS5 F;  2GAU A;  1U6G A;  3Q9V A;  1Y0U A;  3PQK A;  1ONV A;  4IRH A;  3HYI A;  4RB2 C;  4U0V A;  3ZMV A;  3L7W A;  3JTG A;  5BOX A;  1TBX A;  1IXR C;  1XSV A;  2JRT A;  2HWV A;  3GEZ A;  3RPQ A;  4WXH A;  1BI0 A;  5ICE A;  6PAX A;  2VBY A;  1IAW A;  5L3B A;  2A68 F;  2IVM A;  1B9M A;  2JPB A;  4WF2 A;  2PBI A;  5IT9 K;  2YR2 A;  1UCR A;  1PP8 F;  2BGC A;  3SQN A;  3T0Y A;  3GUD A;  3M1E A;  1FC3 A;  3CO6 C;  2FMY A;  2K4B A;  2OA4 A;  3EYY A;  4WCG A;  2HDC A;  2J5P A;  3IL2 A;  1U5T B;  1MD0 A;  1IZ1 A;  3HHG A;  2JZY A;  3CO7 C;  3RPU A;  1OPC A;  3IC7 A;  4IJA A;  2HKX A;  1Z05 A;  1YYV A;  1OR7 A;  3ECH A;  3E6M A;  1FP2 A;  2QBY B;  2PMU A;  1QGP A;  2UZK A;  4EGY A;  3GF2 A;  1B1B A;  2CYY A;  3KZZ A;  1P4W A;  4O3M A;  2ISY A;  3WTZ A;  1WI9 A;  1R5G A;  3HSF A;  2EFN A;  3JAM K;  4LG0 B;  3O2P E;  3F3X A;  3BPV A;  4AD9 A;  2MA3 A;  2M5W A;  1BIB A;  4GO1 A;  1T2K A;  1XMK A;  4B09 A;  4IF4 A;  3DXJ F;  4U88 A;  1GXP A;  3FM5 A;  2H94 A;  4R1H A;  2F5F A;  1LDJ A;  2OQR A;  3C3W A;  2HEO A;  4NQW A;  3SZT A;  5LGN A;  1FLI A;  2FML A;  2V1X A;  2HOE A;  2A6E F;  2GWR A;  4GCV A;  1OKR A;  3K0L A;  3JSO A;  2DU9 A;  4MHG A;  3E6C C;  4O5V A;  4ON0 A;  4PCQ A;  5DD4 A;  2E7W A;  3WTS C;  2DK5 A;  5D5V B;  5ICF A;  2ZNY A;  1FWZ A;  2VT3 A;  3R61 A;  1CF7 A;  2P8T A;  2ZO4 A;  1FP1 D;  3E5U A;  3TKY A;  2V9V A;  2HZT A;  2R3S A;  1MGT A;  3L2C A;  2QVO A;  2K86 A;  1ZRE A;  5ICG A;  3DV8 A;  3JSP A;  2EV0 A;  2OZU A;  2IPQ X;  2ZME A;  2M87 A;  5E8G A;  4Q48 A;  3HRT A;  2RVC A;  2YPR A;  2XRO A;  3L9F A;  2RDP A;  2QQ9 A;  4PGG A;  3MZH A;  1ZGA A;  2O8X A;  2PLY A;  1FX7 A;  3WOD F;  5A2Q Z;  5HDK A;  5FGM A;  2VBZ A;  3GX4 X;  4M6X A;  3MZY A;  3V7S A;  5ICC A;  2W24 A;  3P7N A;  1KQ9 A;  2W85 A;  3HSR A;  1PUE E;  1OYI A;  1Z1D A;  2TDX A;  2DQR A;  5AON A;  1I6X A;  1KQ0 A;  4CZZ A;  5DYM A;  2E1C A;  2Y0M A;  3IKT A;  3K1N A;  4LD5 A;  1ZYR F;  2FE3 A;  3M8E A;  2DPU A;  4A12 A;  2CQK A;  1HKS A;  2KIU A;  1FYM A;  3U9G A;  3ZQ7 A;  2HFH A;  4HF2 A;  2BE5 F;  4HZF A;  2Z99 A;  1ZH5 A;  5F6F A;  4BYY A;  1XB4 A;  3S2W A;  4KIC A;  3DF8 A;  3GWZ A;  5DV5 A;  4CGZ A;  4LLN A;  2XAG A;  5HS8 A;  3IWZ A;  2VT2 A;  1O7L A;  3FMR A;  1EH6 A;  3VOD A;  4S04 A;  4EM0 B;  1XCB A;  2OD5 A;  4ASN A;  5D8L B;  5LGU A;  5HVQ C;  3BOQ A;  4CXF A;  4CHU A;  2EK5 A;  1XGS A;  2FBI A;  4WK8 F;  3KET A;  1ZAR A;  4L9V A;  5CVU A;  2QQA A;  4ZZL A;  4KNY A;  3VFZ A;  4CO8 A;  3GO5 A;  4Y15 A;  4HDV A;  2HYF A;  2ACJ A;  3LQQ A;  2KIM A;  5D6F A;  3ZPL A;  3K1M A;  2O3F A;  4WX9 A;  1IRG A;  1HST A;  2R7F A;  5HOO A;  1J5Y A;  2WC2 A;  1QZZ A;  1REP C;  1LEA A;  2P6T A;  3TOA A;  1F4K A;  4CIC A;  4Z2Y A;  3VB2 A;  2P7V B;  3MCZ A;  4P9U A;  1FT9 A;  2UXX A;  1WRJ A;  5HLH A;  2NYX A;  1KU9 A;  2M45 A;  1S7A A;  1FBU A;  2JSC A;  5CVR A;  2FSW A;  2P7C B;  4XRF A;  2HQN A;  4O6J A;  2NS0 A;  1MJ9 A;  1R5H A;  4PZJ A;  3KP5 A;  4L0Y B;  1JHF A;  4KMU X;  2ZME B;  5K5Q A;  3KEQ A;  2A07 F;  1RZ4 A;  4OIO F;  3F8B A;  3VOE A;  3WGH A;  4Y13 A;  1MJA A;  1T0F A;  1TNT A;  5IT9 Z;  3BP8 A;  1HSJ A;  1P6R A;  2RQP A;  1LNW A;  3H3U A;  4FX4 A;  2DW4 A;  3FWE A;  2CG4 A;  3V4G A;  4RAZ A;  5BS6 A;  3HHH A;  1QZY A;  3JTH A;  3HIF A;  2VBX A;  2O61 A;  3E97 A;  2QWW A;  5AIQ A;  1WQ2 A;  5KK1 A;  1FSH A;  2MC3 A;  5ILU A;  2F5C A;  5EEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...