2L54A

Solution structure of the zalpha domain mutant of adar1 (n43a,y47a)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
YQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEIARVLASLAKKGKLQKEAGTPPLWKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title Alternate rRNA secondary structures as regulators of translation
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 63
sequence length 63
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l54A00
2KRFA 2VODA 4CXFA 3FX3A 4RAZA 1FSEA 2ZMEA 3I64A 1Z9CA 2A3SA 2L3DA 1KQ0A 5BPIA 1P6RA 1U5TC 3WTZA 2YSRA 2QLZA 1D8JA 2IA0A 1KU3A 4TV7A 3U9GA 1J9IA 4ZYDA 4ZYEA 3M9AA 3V7RA 3GZ5A 1J7KA 3JAMZ 4N0BA 3VFZA 2JPCA 3KCCA 4GXOA 5DUIA 1FBQA 1PP8F 3EETA 4P9UA 2PFBA 4AIKA 2YR2A 4M72A 1WQ2A 2KIFA 4MGRA 2EJRA 2P4WA 4EM2A 3GX4X 3SZTA 1ZHFA 2FBIA 3D0SA 2UXXA 3VEPA 4HDUA 3DPTA 5BQTA 1U5TB 1S29A 1TQIA 2DQRA 4G9YA 1B6AA 1IZ1A 2D2WA 4ZH4F 2ZNZA 1IXRC 4OIPF 1B4AA 1I27A 5DCMB 4EQQA 1JHFA 3V4GA 3F72A 2LF7A 3HYIA 3ZMDA 1LJ9A 4AD9A 2O0YA 4P55A 3RTRA 1LDJA 3KEQA 4B09A 4QWQA 1R1UA 1XMAA 1TTYA 2YU3A 2EV6A 3K0LA 2NNYA 2Z5UA 2MH2A 2QUFA 3R60A 1AWCA 4LFUA 2A69F 4L9TA 2QBYB 4I0AA 3WTSC 2H6CA 3ZMSA 4KMUX 4MTEA 1UFMA 3FHZA 3IWZA 3FMRA 2DPUA 2XAJA 3P9KA 1WWXA 5ED4A 2XROA 1BC8C 1HKSA 1KYZA 3F23A 1YW9A 3J7AO 5LEJA 3JSPA 1R36A 4KIBA 1RNLA 2IA2A 2VBXA 5CVIA 2PBIA 2XAGA 3DXJF 2MD5A 1H0MA 2CGPA 2EV5A 3GZ6A 4D0PA 5J6XA 3RJPA 1FX7A 4PDKA 3WGHA 1JE8A 4IVNA 3MEXA 2ESHA 3R0AA 3I58A 4WK8F 4UV9A 4BNCA 5CLSA 1S7AA 4YFNF 4BHCA 1PUEE 1FPQA 3RKWA 1MZBA 2EFNA 2DLLA 1E2XA 4AVPA 5BPDA 5H20A 2ZO4A 3ZN0A 2HYGD 3GFMA 5LRRA 3F8FA 5HDGA 3HRMA 1ON2A 3SFZA 5CVJA 3E5XA 2DI3A 1EH7A 4EJTA 2MH9A 2RN7A 5FFZA 1XCVA 1HQCA 3ROUA 3GLXA 3FMQA 4L5IA 2HQRA 3ECHA 3W6KB 4Y13A 3KETA 2A6HF 2HOEA 2KIUA 1DUXC 3OV8A 1YG2A 3ABTA 4LK1F 2RV8A 4MTDA 5KVRA 3OOPA 1TQMA 3LSTA 2XASA 4I7HA 1FBSA 3WTWC 3BPVA 3NRVA 3KE2A 2VXZA 1IAWA 5HVQC 5LRSA 3WE3A 1H9TA 2HS5A 1O3QA 4PZJA 4CICA 2IA1A 1HKTA 3PQKA 1GXPA 2LSOA 2H94A 1G6NA 2QENA 2H09A 1I1GA 2DO7A 2NYXA 4P5OA 5L3CA 3EYIA 4CO8A 4AIHA 5D4RA 4I09A 4LG0B 1OMIA 4OIRF 3LA2A 1I5ZA 2OU2A 1TBXA 4ESJA 3T0YA 1BJAA 1Z91A 3V8KA 1FZPB 3BOQA 2V9VA 4Q48A 2V1XA 5F6FA 2X0LA 4A12A 2KJCA 3F6VA 2G7HA 4Q4ZF 3TO7A 2G7UA 3KP5A 4HV5A 2MC3A 2A6EF 1ZREA 1Z6TA 5L3FA 1XGSA 4JBAA 3DKWA 2AS5F 1HW1A 1IRFA 3I59A 2EWNA 3TGNA 4A5NA 1Q1HA 4BAYA 4HX4A 3QP6A 4I2OA 1SD5A 1P2FA 5AIQA 2ELHA 3LFKA 4R8HA 3QRFF 1KA8A 1WRJA 2QWWA 4IXAA 2LDUA 5JI6A 5L3DA 2KKOA 4FT8A 4LLNA 3DQVC 3QOPA 1G3TA 2GZWA 1QQIA 2ZNYA 1U2WA 2MBFA 4KFCA 4NB5A 5JR3A 1ZG3A 3HRSA 4H0EA 3GO5A 2EFWA 3R0JA 4KMFA 4PGGA 1O3TA 4HOBA 1KYWA 3Q5FA 2E1NA 4HDVA 1T38A 3GF2A 4DQ2A 2VOPA 3L7WA 1YFHA 2LF8A 3RPUA 2VN2A 1IXSB 3O2PE 5E1WA 1AOYA 1I6XA 4R79A 5FB2A 2BYVE 2RDPA 3CDHA 1ON1A 2K27A 1PP7U 3Q9SA 4YIFA 2DBBA 2RGVA 4DNCA 1W7PB 1G4DA 3F3XA 3P9IA 4OOIA 4XLNF 4E70A 1MDMB 2FA5A 1TNTA 5LHGA 4CGZA 1HXDA 4Q47A 4BQAA 2Y75A 4WXCA 4EVIA 2STTA 3E6MA 1WKMA 1YQAA 5D5XB 1NHAA 2JZYA 1S7OA 3T1BA 1FYMA 1USSA 2KIMA 4M9XA 5E1ZB 1F1ZA 4RS8A 1T6SA 1TQPA 3R6SA 2XHKA 1I1SA 1OKRA 2L4MA 2STWA 5LEKA 2JTVA 1XCBA 2VBWA 1LQ1A 3LQQA 2WWYA 5ILUA 4HBLA 4FX0A 4ZZLA 1IW7F 4I98B 5DYMA 3J80Z 4EJVA 2XUBA 3LQRA 1BC7C 3TKYA 1Z6RA 3NQOA 5HDKA 1ZLKA 4BXUA 1WI9A 2IP2A 1FLIA 4EJWA 2FMLA 4ENJA 2EB7A 1XMKA 4QLCU 3U1DA 3V8JA 1FP2A 2DW4A 3EYYA 3SHFA 3FXQA 4KN7X 2BBYA 3C3WA 1FC3A 4MHGA 5LGUA 4HZFA 3HRUA 1T2KA 5ILVA 4ENNA 2O03A 1O57A 1TW2A 3DEUA 3C18A 2F5CA 5K5QA 2VC0A 5CJ9A 1MGTA 1R00A 4HW0A 3CTAA 2Q8KA 1CGPA 3QAHA 5EEHA 1BI3A 2K86A 2P7CB 1ZRCA 2COMA 3RI4A 4M74A 4A0ZA 2XV4S 2F5DA 3FWEA 1QZZA 3T5XA 4YFKF 2H27A 4IHTA 4KDPA 4UV8A 1O3SA 1YS7A 2PEXA 3BJOA 1U5TA 5DEQA 1LDDA 4M71A 2P5LC 4ON0A 3E5UA 5D6FA 3WGIA 3H3ZA 3GVAA 2HQNA 2DU9A 2AXLA 1XDSA 2W84A 1K79A 3I4PA 3ZMTA 2QYOA 1W5TA 2Y0MA 3DPLC 4Z2YA 3IKTA 1BI2A 5D8KB 2GAUA 1FSHA 2GXGA 1A04A 4AWXB 3KZYA 3IL2A 4CZZA 4WWCA 3ULQB 2O6GE 3ZMZA 2M87A 1L3LA 2YPRA 3K69A 3MAJA 1BM9A 2OQRA 3AAFA 3EQLF 5E20A 4S05A 4BHPA 3O6BB 4OIQF 2QBYA 3LAJA 1XGOA 3W6JB 3KP7A 1RI7A 3EDPA 1D3YA 4HQMA 3B02A 2DK5A 1UCRA 3KZZA 1RZ4A 5ICGA 2DK8A 1HKQA 3MZHA 2FE3A 4Y17A 3IHUA 1R7JA 2JRTA 2O3FA 1C0WA 4WCGA 3B73A 2VT2A 2XAHA 4LGWA 1SMYF 3M8FA 1D5VA 1IN5A 2F5FA 2FXAA 3FM3A 1J59A 1PDNC 1YO5C 4BH9A 1UB9A 2A61A 2FBHA 1EH6A 3L09A 3FMSA 3HRTA 1K78A 3H92A 1J0RA 5ILSA 1SD6A 1ODDA 2OA4A 3BJAA 3HTUA 4IF4A 2P7VB 5HLIA 2GWRA 5AIPA 4EGZA 2ETHA 2FMYA 2MLGA 3KP6A 3TQNA 4ZZDA 2L54A 2D1VA 1B1BA 2CFXA 2FU4A 1KU7A 4Q5SF 5HLGA 2Q0OA 3H3UA 3SXYA 3LA7A 5J8FA 4EMSA 5ICEA 3WTYC 5D5WB 2UXNA 4U7DA 4RB0A 2ZFWA 1T98A 4B8XA 1Y0UA 3U2RA 3F8BA 2IPQX 4ENKA 1IN4A 3ZMUA 1U78A 4G7OF 2MLKA 1KGSA 3KFWX 2VE8A 1FYLA 2RNJA 5LHHA 5H6QA 4UVCA 4XRFA 4M6YA 2YX7A 3FXUA 6PAXA 3RYPA 3L2CA 3ERED 3DP7A 4L9VA 2P5VA 3KEOA 4HA8A 1R1TA 3J80K 1WSUA 3R4KA 1MKMA 4HV6A 2DT5A 5EEGA 2K7LA 4LB5A 1ZGJA 1YW7A 5F64A 2CQKA 4IRGA 2HGCA 3F8MA 1XD7A 3GWZA 5ICFA 1F4KA 1FOKA 3VOEA 3N4MA 2Y48A 1XSDA 3KLNA 4M9ZA 1XDUA 3HSRA 2M30A 2CYYA 3L9FA 1LDKB 2V1UA 3WTXC 5LHIA 4GCVA 1HW2A 1SFEA 3QPTA 2BE5F 2DFIA 2X4HA 3HHHA 3CJNA 3CUQC 3Q9VA 4HF0A 3V7SA 5BS6A 2HFHA 2VOOA 2CO5A 1FY7A 2QQAA 4M9SA 4A0XA 1O7LA 1P4XA 2OAZA 3FF5A 2ISYA 3WODF 3F22A 4U0WA 2K4JA 1CF7B 1R5HA 1XGNA 3WTTC 5BMZA 2ZJ2A 1MD0A 2A5YB 2QVOA 4IPAA 5K5RA 2J5PA 4PCQA 3T8RA 1MJAA 2QQBA 3LA3A 4LJZF 2ACJA 3REOA 4KNYA 4BYYA 1W4MA 1DDNA 1OYWA 3CUQB 2V79A 2QZ8A 2EA4A 2WTEA 5DUKA 1XSVA 4HF1A 3ELKA 5K5OA 3TOAA 3M7GA 3QP5A 2BV6A 2DAOA 2IVMA 3ZMVA 3C1DA 3ZPLA 5DD4A 5L3EA 2GIVA 5JHUA 5DD8A 4A0YA 3E5QA 1YTYA 4L9JA 1XN7A 2V6CA 2KJBA 2UWMA 4XSXF 1REPC 1IRGA 2YX4A 5K1YA 3MQ0A 1W7PA 4EJOA 1KQ9A 3G3ZA 4UXNA 4ENMA 4O3MA 4RAYA 1R5GA 3EUHA 4ESBA 1W5SA 1QGPA 4G8XA 1JHHA 3KP2A 4LLLA 2ZCWA 2RC4A 1IN8A 1STZA 3TDUC 2EFPA 1J2XA 5FD6A 5KK1A 2XRNA 4MQVA 1SMTA 2W57A 2Z3YA 4AIJA 5D5VB 1USTA 1ZAOA 1V3FA 2FQ3A 2HEOA 4A2UA 2FEZA 5E8GA 5A2QZ 2Z99A 2PI0A 3HOSA 2HKOA 1EH8A 4R1HA 4LK0F 2B0LA 2P8TA 4RB2C 4ETSA 1SFXA 2D45A 3IRRA 1F9NA 2PG4A 4LD5A 5DCFA 4UVBA 2L01A 1ZYRF 1ZH5A 2K02A 1TNSA 3WU1B 3MFKA 3IWFA 4GYGA 3K1NA 3WE2A 5LBQA 3GFLA 4G7HF 4ASNA 1ZG1A 3I5UA 2HTSA 4NQWA 4I0BA 2WC2A 2V1DA 3F21A 1K6OA 1J5YA 3SZPA 5F1RA 4KYWA 2G9WA 5LGNA 1MJ9A 5ERIA 1P4WA 2XAQA 2PLYA 5FLXZ 3K2ZA 3BJ6A 3BP8A 5H6RA 3ECOA 1X3UA 2F2EA 3CLOA 3TO9A 4RGRA 5L3BA 2GXBA 2QM3A 3SQNA 5HLHA 2O61A 3E3VA 4O5VA 3E6DA 2JSCA 1KQ8A 3BZ6A 2EFQA 4L0YB 2BEOA 5CVUA 5J8CA 1W7PD 4HX7A 4G6DA 2GQQA 3ABUA 4OMZA 5D8LB 1DPRA 2F5EA 3RDIA 2EV0A 2MA3A 2WV0A 4G6QA 3LWFA 3GXOA 4WXHA 4P96A 1BOAA 4Y15A 1SD4A 2NNNA 3FZVA 4EJUA 4KICA 2ZMEB 2PJPA 3JW4A 3M8EA 1E17A 1BI0A 1B59A 3QU6A 5DCMA 5FD5A 4NHJA 2EFOA 3VODA 5CVRA 3HUGA 1UHWA 3DFGA 3R61A 4RB1A 3F8NA 2Q2EA 3WU0A 3LAPA 2OZ6A 2FOKA 4S04A 3IRQA 2K4BA 4K2EA 1FP1D 3GUDA 4A6DA 1SFUA 1U8RA 1S6LA 5LGTA 1ZGAA 2JT1A 2L4AA 4BHBA 5HOOA 4I02A 4OMYA 1ZRDA 1ONVA 5IT3A 3BDDA 3ZP5A 4OINF 1HSJA 2CSOA 1ZLJA 4LB6B 1FNNA 2FRHA 3GFIA 5TRDA 3WTVC 2R7FA 4CHUA 4JQFA 2M45A 3F8CA 3KLOA 4U0YA 2HYFA 3PFIA 3COAC 3J81Z 2QQ9A 2CG4A 1T0FA 4GYIA 4HLYA 1ZG5A 3BWGA 4GO1A 1KU2A 3MWMA 1VTNC 1DP7P 4L5JA 5BOXA 3I0TA 2ZXJA 4IJAA 2UZKA 3K1PA 5IT9Z 4HYEA 1G3SA 1OYIA 5TJJA 3KP3A 3RKYA 1R1VA 2TDXA 2PQ8A 1BI1A 3HHGA 4P9FA 4F7ZA 2FBKA 1MJBA 3CUOA 3V8LA 3GW2A 1Z1DA 2OQGA 2NAZA 2LNBA 5CVVA 4WF2A 5FO5A 2JPBA 5E18F 5HDNA 1LNWA 3F6OA 4FX4A 1U6GA 1G3YA 3CO7C 4L18B 5E17F 2LKPA 2A07F 1FWZA 2M8EA 3I53A 2HKXA 3S2WA 1IN6A 3RKXA 2L02A 2P5KA 3WTUC 4HLXA 1K7AA 2OZUA 5HS7A 2VBZA 2J5OA 4CDGA 4N9IA 2XIGA 1JXSA 4HX8A 1GXQA 4MQ9F 2PMUA 1FT9A 1B9NA 4IHSA 4EM1A 2Z33A 4M73A 4KIFA 4KUMA 5L3GA 3HOTA 3GFJA 1K78B 3M1EA 2ADUA 1S8NA 4N9HA 4XBFA 3KP4A 1OR7A 3PQJA 4A5MA 5FGMA 5CYVA 2DQLA 4EM0B 2C6YA 4YIIA 1Z05A 5A2QK 1R58A 4L9NA 2O8XA 1IN7A 5ICCA 4IRHA 4EGYA 1P92A 5E8IA 2VBYA 5HS8A 1BBYA 2IT0A 1QBJA 1RUNA 2CWEA 2NS0A 5D5UB 2Z9OA 3TOBA 4IRIA 4G7ZF 1OPCA 2HZTA 2OD5A 2W25A 4MNUA 4I01A 2A68F 1SD7A 2IW5A 2HDCA 4LG0A 1QO0D 1DPUA 3ZQ7A 1R23A 5D6EA 4L0ZB 2RQPA 5FLXK 3V7CA 5DDGA 4ZYHA 1YLFA 1IXCA 3T8TA 3QPHA 5FFXA 5JFRA 1O3RA 3NEUA 3JTHA 4OU0A 4RB3C 4GGGA 1FYKA 3RYRA 2IJLA 1RUOA 4HF2A 1XGMA 2GA2A 2RVCA 1YS6A 1CF7A 1XSXA 4XLPF 4KA4A 1H9GA 3TDZC 2CW0F 2M5WA 3P7NA 1BN5A 1HW5A 1RIOH 4LMYA 4UUVA 3I71A 3P9CA 3ML6A 2RKHA 3CUQA 4MEXF 2XKOA 3FM5A 3JAMK 3HIFA 1TLHB 4HQEA 2VONA 1B9MA 4UHTA 3MZYA 2VC1A 3GEZA 2XVCA 2DPDA 3E97A 4CYDA 2ZKZA 5HS9A 1P4AA 2E1CA 1XB4A 4KN4X 1ZARA 1LVAA 3QU3A 3E6CC 1J75A 1ZRFA 1FBUA 2FF4A 4OIOF 2W24A 3JSOA 4RGSA 1V4RA 3I59B 1IUYA 1KU9A 3CO6C 2HWVA 1ZN2A 1LEBA 1U3EM 5JVTA 3N97A 5DV5A 4YFXF 3HTSB 3ISPA 3ZN1A 2R3SA 1GHCA 1TW3A 3IKVA 2E7WA 2GA1A 3RIRA 1GVJA 3G73A 3MCZA 1MDMA 2OBPA 4WX9A 1HBXG 3J81K 4EV0A 2HTJA 2DTRA 4FHTA 3BROA 1IF1A 3I54A 1BIBA 3BPXA 2D1HA 2VE9A 4RGUA 5IT9K 4HAMA 3JTGA 3L00A 4M6XA 2H6BA 5LLQA 2IRFG 1F5TA 4KT5C 1OYYA 5D4SA 2XKPA 1SAXA 2PMHA 1YIOA 3BY6A 1L0OC 3C7JA 3HSEA 1LB2A 1UHMA 1LEAA 4YG2F 1QNTA 1HSTA 2E7XA 1QPMA 1QZYA 4RGXA 4LLGF 3DV8A 2BGCA 3GYHX 4ESFA 2P6TA 4G94A 3IC7A 1D8KA 1Z7UA 1G3WA 4WXDA 2PN6A 3FXRA 2EK5A 2NRAC 4UVAA 4O6JA 3DF8A 1BIAA 1ULYA 2FSWA 1EV7A 4JK1X 2P6SA 2R7DA 2FNAA 3K1MA 3RPQA 2ESNA 2VT3A 3E6BA 3VB2A 3D5LA 4U88A 4A6EA 1YYVA 4KIGA 2M1BA 1JGSA 3O3KA 1R22A 2W85A 3WG9A 2FNPA 2EA2A 2HR3A 1T39A 2ISZA 4XSZF 5AONA 4UNOA 4U7BA 4MEYF 1O7FA 4PGHA 2XAFA 1YW8A 3TO6A 1S3JA 4ZYGA 2ZBKA 4U0VA 3HSFA 5E1XA 3K9TA 2XGXA 3WGGA
chains in the Genus database with same CATH superfamily
1SEUA 1V55H 2KRFA 2VODA 4CXFA 3DTIA 4B1RA 4DW6A 3FX3A 2R7QA 3LOCA 4RAZA 1UELB 2GBYA 1FSEA 4J19A 2ZMEA 3I64A 1Z9CA 2A3SA 1WCMJ 2L3DA 1KQ0A 5BPIA 1P6RA 1U5TC 4GFBA 3WTZA 2YSRA 4UB6C 2QLZA 4HNUA 1D8JA 2OC6A 2IA0A 5DM7F 1KU3A 5GP9A 4XNFA 1XPXA 4IHVA 2E71A 4TV7A 3U9GA 1J9IA 1KONA 4ZYDA 4ZYEA 1VQ6I 3M9AA 3V7RA 3GZ5A 3CESA 1J7KA 3JAMZ 4N0BA 2G0EA 3MKLA 1IV8A 2JPCA 4XOPA 3VFZA 3KYDB 3KCCA 4GXOA 5DUIA 4XRSA 1FBQA 4PFPA 3I55I 1PP8F 4PJNA 1A35A 3EETA 4P9UA 2PFBA 4AIKA 2YR2A 1A6IA 4M72A 1MBGA 1WQ2A 2KIFA 3BTIA 4MGRA 1N77A 2EJRA 4FTHA 3PJRA 4BQNA 1QPIA 2P4WA 5B1BH 4EM2A 3GX4X 1MBEA 3SZTA 1ZHFA 2FBIA 3D0SA 1VQOI 2UXXA 2Z16A 3VEPA 4BDYA 2KHMA 4HDUA 4D7MA 3DPTA 3KYLA 1DP3A 1HDDC 1SVLA 1U5TB 1S29A 1TQIA 2DQRA 5BQTA 1VF9A 2WADA 4G9YA 1B6AA 1IZ1A 2D2WA 4CZCA 1D0XA 3PIPF 5HLTA 4ZH4F 2ZNZA 2WAFA 2CJJA 4BJ6C 1IXRC 1Y6IA 4OIPF 1B4AA 4DZPA 1I27A 2WY7Q 2KLOA 5DCMB 2B7EA 2IGMA 1JHFA 2W00A 4EQQA 3V4GA 3PL8A 3F72A 3S16J 1OFCX 4UUSB 3LSJA 3K70C 2HQ5A 2LF7A 2VPLA 1E3PA 3HYIA 4XKVA 5E79C 1FIAA 3ZMDA 1LJ9A 1JTYA 4AD9A 2O0YA 3CCLI 1BJZA 4E7HA 1Y8RB 4P55A 3QODA 3RTRA 1LDJA 1X4PA 3KEQA 4B09A 3BQZA 4QWQA 1R1UA 2WB1N 1XMAA 2BVLA 1T0FC 1TTYA 2YU3A 3MKZA 3L2VA 5FKLA 2EV6A 3K0LA 2BW3A 3AG3H 4LIUA 2NNYA 2X1DA 2Z5UA 3E1SA 2O7OA 3Q0WA 2MH2A 1MMSA 2QUFA 3R60A 1AWCA 1MW7A 4PJMA 1YITI 2Y9YA 4LFUA 2A69F 4L9TA 4DIQA 5FKNA 4BGDA 1JKOC 2ELJA 3IUOA 2QBYB 3HXLA 4I0AA 3LL7A 3WTSC 2H6CA 3ZMSA 3K4JA 4KMUX 4MTEA 1UFMA 1TWCJ 2LBFA 3FHZA 3IWZA 2NVYJ 3FMRA 3K10A 3U21A 2L9VA 5F0CA 4J00A 2DPUA 1CQTA 2XAJA 3P9KA 1WWXA 5FLVA 2JA8J 5ED4A 1YE9A 2XROA 3CLQA 1F43A 1BC8C 2CRGA 1HKSA 1IG7A 1VQ8I 1KYZA 3F23A 1YW9A 2EZHA 1G59A 3J7AO 2WAQN 5LEJA 3JSPA 2VJIA 3DBHB 2DMPA 2E60A 1FIPA 1R36A 2QGUA 2XB0X 4JX5A 1RNLA 4KIBA 4CH7A 1WH7A 1LFUP 3HPGA 2IA2A 2VBXA 2VJ5A 5CVIA 1QA6A 2PBIA 1IUFA 2ZB9A 1I50J 2XAGA 2L9NA 1UMQA 3OS2A 3DXJF 4EEFG 2HQAA 2MD5A 1H0MA 2CGPA 1AA7A 4MFEA 4BJ5C 2EV5A 3ZGKA 4ZJZA 3GZ6A 1MMAA 4DYQA 4XRMA 4D0PA 5J6XA 3RJPA 2Q1ZB 4BBRJ 3CCJI 3DTKA 1FX7A 4PDKA 3WGHA 5M5XJ 1JE8A 1P9QC 3K4NA 4IVNA 2PX9A 2AXTC 3MEXA 1AU7A 1YRNB 3OYFA 2EIMH 2ESHA 3PNTA 1RKWA 5K7ZA 3H5NA 3R0AA 3JRHA 2GM4A 2NVXJ 2IBDA 3I58A 4U87A 3ZRGA 2LOOA 4WK8F 4DYCA 4UV9A 1LPQA 3HOZJ 4BNCA 5CLSA 1S7AA 3CMAI 4YFNF 4BHCA 1PUEE 1FPQA 4II3A 1JUSA 3RKWA 1MZBA 4Y33A 2EFNA 2DLLA 5IYBJ 1E2XA 4PSXA 4I99C 4AVPA 3H9GA 5BPDA 5H20A 2ZO4A 3ZN0A 3S17J 2HYGD 4N4OB 2Z1DA 3GFMA 5LRRA 3F8FA 3BTCA 4E7LA 5HDGA 3HRMA 2BHYA 1ON2A 3SFZA 1RKTA 4IOCF 5CVJA 3E5XA 2DI3A 4XRSG 2RREA 2DA6A 3OOUA 2ZSIB 1HF0A 1LVKA 1EH7A 2CS3A 2W1OA 1RR8C 1PUFB 4EJTA 4X1EA 2MH9A 1JJ8C 2RN7A 4XLFA 5FFZA 2XPUA 5C4JJ 2PJRA 2GXAA 2A5WA 2DFFA 1XCVA 1HQCA 3ROUA 3SFIA 3GLXA 3FMQA 2WAQA 4BU2A 3QPLA 2JWTA 4L5IA 3K4BA 2L0KA 3MVPA 2IGKA 2HQRA 3ECHA 3W6KB 4J01A 3S3OA 4OAYA 3HC7A 4Y13A 3KETA 3EPZA 2CQNA 2A6HF 2L7ZA 2VUMJ 3FK6A 5B3SH 4MO7A 2HOEA 2KIUA 1DUXC 2ZSHB 4IEJA 3OV8A 4V2GA 3KIOA 3GTLJ 2EINH 3CDIA 4RM2A 1YG2A 2NS8A 3TL4X 3EUAA 2JA5J 1OCPA 3ABTA 4LK1F 3ABMH 1WGXA 2RV8A 4MTDA 1D1BA 4XLEA 5K7HA 5KVRA 3OOPA 1N25A 1TQMA 3LNQA 1MSEC 2DMNA 3LSTA 2XASA 2ECCA 2XGCA 4HRIA 4I7HA 1FBSA 3D5RC 3BPVA 3WTWC 3NRVA 1Z3YA 2ID6A 4E4HA 2E1OA 3KE2A 3JRAA 2MSYA 2LY2A 2VXZA 1IAWA 5HVQC 4G12A 4BY7J 3FHNA 5LRSA 3WE3A 1IO2A 2LY9A 1H9TA 2HS5A 1O3QA 4PZJA 4CICA 3HEFA 3S1RJ 1V54H 2IA1A 1HKTA 3OYCA 3PQKA 1GXPA 2LSOA 2H94A 3DKYA 3WG7H 4RLQA 2HPMA 3B6AA 1G6NA 5TGTA 2QENA 1B72B 3JRFA 2H09A 1DGRM 2K9LA 1I1GA 2DO7A 1YJWI 5EYRA 2NYXA 4P5OA 5L3CA 5F0HA 3EYIA 1J09A 2VKEA 4CO8A 4XM3A 1W36C 4AIHA 1D0YA 3FBIB 5J4VA 4BXFA 5D4RA 4I09A 4LG0B 3G1OA 1OMIA 1WJBA 4OIRF 3CJQB 4UUTA 3LA2A 1BR1A 2DMTA 1I5ZA 2OU2A 3L2WA 3E0JB 3O8HA 1G2HA 4IHWA 1TBXA 4ESJA 3M4OJ 3T0YA 3W3CA 1BJAA 1Z91A 2XB5A 4V19K 3S1NJ 1VQ7I 3V8KA 5E3MA 1SVOA 1FZPB 2V26A 3GTQJ 3BOQA 2V9VA 4Q48A 5F27A 3JRBA 2PMZN 5EJCA 1ZELA 2V1XA 2CUJA 5F6FA 2ZJPF 2X0LA 4A12A 2KJCA 3F6VA 1IRZA 2G7HA 4Q4ZF 3TO7A 2G7UA 4A3EJ 3KP5A 1R4NB 4ZTFA 3J7AY 4HV5A 2KL4A 2MC3A 4XOTA 4I76A 2I8DA 4ZDLA 2HVRA 2HDDA 2A6EF 1ZREA 1Z6TA 5L3FA 1XGSA 2VKDA 1A31A 4JBAA 1SAUA 3DKWA 2AS5F 1HW1A 1OLTA 1IRFA 3I59A 1YI2I 5IYDJ 2EWNA 2OPTA 4RBOA 1X4OA 4RAGA 3OYMA 3TGNA 4A5NA 1Q1HA 4BAYA 3GZNB 2HNHA 2V1NA 3QP6A 4HX4A 2X48A 3M3YJ 3QYEA 5KAIC 4CCNA 1SD5A 4I2OA 2ZXHA 4F91B 1P2FA 1XG1A 2BZTA 5CPRB 5AIQA 2ELHA 3LFKA 4R8HA 3QRFF 1KA8A 1WRJA 2QWWA 1EA3A 4HSTA 4IXAA 2LDUA 5E3NA 5JI6A 2OTJI 5L3DA 3U1KA 3TEDA 3L2UA 2NVTJ 2M8GX 3ONQA 4D1QA 4RM3A 5LD2C 3LSIA 2X6OA 2FQ4A 3A1YA 3HKZA 1LE8B 2KKOA 4FT8A 4LLNA 2AQEA 3DQVC 3QOPA 1G3TA 3VDXA 2GZWA 2X51A 1QQIA 2ZNYA 1SANA 4HNVA 1U2WA 2MBFA 2LLKA 4KFCA 4NB5A 5JR3A 2DYSH 2KZGA 3AL0C 1ZG3A 3HRSA 5M3MJ 4DYRA 5CQEA 4H0EA 3GO5A 3OYDA 5EG0A 4IZZA 4RDUA 3M07A 1B8IB 2EFWA 1R9TJ 2CUFA 1DU0A 2CW7A 2L2OA 2LP0A 4BUPA 4Y52J 3R0JA 5LFAA 2H1KA 4KMFA 4Y3OA 5DS9A 4BS9A 4PGGA 1O3TA 4HOBA 4JOMA 1KYWA 3NARA 2E1NA 3Q5FA 4HDVA 3QPSA 3HOWJ 4YELA 3H0GJ 4MLOA 1R71A 1T38A 3GF2A 4DQ2A 2VOPA 2IXSA 1T8IA 2XF7A 3L7WA 1GV5A 1YFHA 4MFDA 2VL8A 4E7IA 3DWLE 2LF8A 3RPUA 2VN2A 5CKTA 1IXSB 3HOVJ 3O2PE 5E1WA 1AOYA 1I6XA 5E3LA 4R79A 5FB2A 2BYVE 2JA6J 2RDPA 3CDHA 1ON1A 2K27A 2LFBA 1PP7U 3JREA 3Q9SA 4E6KG 4YIFA 2DBBA 2RGVA 4DNCA 3S3NA 1ETQA 3CCVI 3CMYA 1R4MB 1W7PB 1G4DA 4BACA 3JRCA 3F3XA 3VYSB 3AL0B 3P9IA 1TWGJ 3CC2I 4OOIA 4XLNF 1OCOH 4E70A 4NDLA 2R7RA 1MDMB 2FA5A 1MIJA 1RETA 1TNTA 5LHGA 3W2AA 4CGZA 1HXDA 4Q47A 1YJ9I 1ETXA 4BQAA 2Y75A 1JTXA 4WXCA 4EVIA 2STTA 3E6MA 1WKMA 1YQAA 4QPQA 5D5XB 3FXJA 1NHAA 1YOVB 2JZYA 1S7OA 1PYVA 3T1BA 1FYMA 3C2BA 1WH5A 1USSA 2KIMA 4FE7A 3OYEA 2QEXI 4M9XA 5E1ZB 3NAUA 1F1ZA 3MKYB 4RS8A 3D1NI 1X3ZB 1T6SA 1TQPA 3R6SA 2XHKA 1I1SA 1OKRA 1DU6A 3FK7A 3S93A 2ZJRF 2VB6A 1K6YA 3HZJA 2L4MA 2STWA 3LSMA 2DA4A 2CFOA 4RA2A 2BXZA 2DT7B 5LEKA 2LYCA 1FOWA 1T08B 2JTVA 1H8AC 1JI8A 1W0UA 4RMNA 1XCBA 4V2FA 2VBWA 1WZ2A 1QVUA 1ZGWA 5EZGA 4Z6YA 2QF7A 2CH0A 1LQ1A 2LKSA 3LSRA 3AFHA 2LRDA 3LQQA 5J3LA 4BBSJ 1VQNI 2BY2A 2WWYA 5ILUA 3ZXSA 4HBLA 4FX0A 3DKXA 4ZZLA 1IW7F 4I98B 5DYMA 1X2MA 5EGOA 4YIRX 3J80Z 3I4NJ 1JGGA 3PO3J 4EJVA 2XPVA 2XUBA 3LQRA 1BC7C 3TKYA 1Z6RA 3NQOA 5KNLA 5HDKA 2K5CA 2HVQA 2KMUA 2WBMA 3DCFA 1ZLKA 3A2KA 3S2HJ 2I10A 4BL0B 4BXUA 1WI9A 1X1PA 2IP2A 1FLIA 4EJWA 2FMLA 4ENJA 2EB7A 1XMKA 2E2HJ 4QLCU 3L1PA 3U1DA 3V8JA 1FP2A 3Q0VA 2DW4A 4M6VA 5FKKA 3HBLA 3OYNA 3EYYA 4YRVA 1R49A 3SHFA 3FXQA 4ABZA 3I3LA 4AUXA 2L9SA 2Y0SA 3H5RA 1QRYA 5E3OA 4KN7X 4NQWB 4C2TA 1ZQ3P 2K9NA 1MBKA 2BBYA 3K2AA 3ZQIA 3WU2C 3C3WA 1FC3A 2LD5A 4MHGA 5LGUA 4HZFA 5F08A 3HRUA 2CU7A 2JVHA 4PJJA 1T2KA 3AG2H 2DA5A 5ILVA 2LK2A 4PSWA 4ENNA 2O03A 1O57A 1RR7A 1TW2A 3DEUA 3C18A 3DTEA 4PFOA 3G1MA 2OV7A 2F5CA 5K5QA 2VC0A 5CJ9A 2H1LA 2OCEA 2ZMEC 4E7JA 1MGTA 1R00A 2MW8A 4HW0A 1I3AA 2B63J 2B9SA 3CTAA 2Q8KA 1X58A 1CGPA 1DGWY 3BR0A 3QAHA 5HNHA 2IS2A 5EEHA 3FKJA 3A02A 1BI3A 2K86A 4XK4A 2P7CB 2X9DA 2VKHA 1ZRCA 1A5JA 2COMA 3RI4A 4A3FJ 3RZOJ 1Z3XA 4M74A 4A0ZA 2VQCA 2XV4S 2F5DA 3H5AA 3FWEA 4N4NB 1QZZA 3T5XA 4BQOA 3RPUD 1WVRA 3HOUJ 4YFKF 2H27A 4RLFA 4IHTA 4KDPA 2VIXA 4HNTA 4UV8A 4UY8I 1O3SA 3OSGA 1YS7A 2PEXA 3BJOA 1U5TA 5DEQA 1LDDA 2JUGA 2M4KA 4A3GJ 2BY3A 4M71A 4IOAF 3CCUI 2P5LC 2CV0A 1I3QJ 4ON0A 3ZQQA 3E5UA 5D6FA 3WGIA 3H3ZA 5GAGJ 3GVAA 2DMUA 1UZCA 2R5ZB 3E7LA 2HQNA 4B43A 2OUMA 2DU9A 4CCLA 2AXLA 1XDSA 2W84A 1K79A 4UUSA 3CCRI 3CCSI 2R7VA 3OIQA 3I4PA 3ZMTA 2R5YB 2QYOA 2COBA 1W5TA 2LMDA 2Y0MA 3DPLC 4Z2YA 3IKTA 1BI2A 5D8KB 2GAUA 1FSHA 2GXGA 1A04A 2FD5A 4AWXB 3KZYA 3IL2A 4CZZA 4WWCA 2XSDC 4RAFA 4XLAA 4QTRA 3ULQB 2O6GE 1OCTC 1U9NA 3ZMZA 2M87A 1L3LA 4F3QA 3GTGJ 2YPRA 4CCJA 1S72I 3HUGB 3K69A 2MC4A 3MAJA 3MMYB 4JYKA 3OS0A 1BM9A 3W6VA 2OQRA 1ACIA 1IJWC 3AAFA 3EQLF 5E20A 2L7KA 3CJRB 2Q2EB 4G6TB 4S05A 4BHPA 4FETA 3EUKL 3O6BB 5FKOA 4OIQF 2QBYA 3LAJA 4X6AJ 4I6ZA 1XGOA 3W6JB 4BE2A 5FKMA 3LSKA 1XMXA 3A0BC 3BTLA 2DFEA 2LREA 4CSWA 3RSNA 3BG9A 5IYCJ 3KP7A 1RI7A 3EDPA 1D3YA 4HQMA 3BC8A 3A01B 1AHDP 3J7ZI 2M7AA 3B02A 1TT0A 3BT9A 2DK5A 1UCRA 2OJED 5J1YA 2FUG2 3KZZA 2LH9A 1VNDA 2F6CA 2UUZA 1RZ4A 5ICGA 2ZFUA 2DK8A 1HKQA 5J1RA 3MZHA 2FE3A 4HSRA 3IHUA 4Y17A 1R7JA 2FX0A 2JRTA 3GLLA 1FOYA 4BE0A 2O3FA 1QU3A 1C0WA 3OMYA 4XLHA 1S9HA 1VI0A 4WCGA 3B73A 1LFBA 2VT2A 2XAHA 4LGWA 1SMYF 1NG6A 3CMMA 4S0HB 3TP0A 1FTZA 4HEA2 3M8FA 1D5VA 2JA7J 3OYAA 1XC5A 1IN5A 2F5FA 1ETKA 2FXAA 3FM3A 1JKQC 1J59A 4QPOA 2ZXIA 2V9PA 1PDNC 1Y0NA 2DYRH 2QSGX 3ASOH 1YO5C 1D1AA 4AIDA 4Y4RA 4BH9A 2LR8A 4IO9F 1K83J 1QHGA 2HI3A 1UB9A 3LFUA 2A61A 2ELKA 2LBFB 5B66C 4C3JJ 1X1CA 2FBHA 1ITYA 1EH6A 3K6GA 3L09A 2KQRA 1X2NA 3BLYA 5FJ8J 3SEQA 3Q0UA 2KRHA 3Q3SA 3ZQFA 2ICWG 3FMSA 3HRTA 4LITA 3JRDA 3M8JA 3DEEA 1K78A 3H92A 1J0RA 5ILSA 1SD6A 1ODDA 2OA4A 3BJAA 1PJRA 1IV6A 2E5NA 3HTUA 4IF4A 2P7VB 5HLIA 2GWRA 5AIPA 4BXXJ 4EGZA 2ETHA 2FMYA 1MBFA 2MLGA 4MIMA 1NK2P 5IOYA 3KP6A 3TQNA 4ZZDA 2L54A 1MNDA 2D1VA 2MG4A 1OR7C 3FDYA 2M9HA 3FBNB 1B1BA 2AO9A 2CFXA 5J40A 2FU4A 4AYBA 3IV5A 4FE4A 1KU7A 2DA2A 1SC7A 5HLGA 4Q5SF 2Q0OA 3H3UA 3SXYA 3LA7A 4XN3A 1MH4A 1FEXA 2BHZA 5J8FA 4C2UA 4EMSA 3CF5F 5ICEA 3WTYC 5D5WB 2UXNA 3VSKA 2EBIA 4U7DA 4RB0A 1ZR2A 2VQHA 2ZFWA 3DLLF 4BJTA 2VI6A 1T98A 4B8XA 3K4MA 3CD6I 1Y0UA 3U2RA 4YEJA 3F8BA 4C30A 4B48A 2IPQX 3LSPA 4ENKA 1IN4A 3L2QA 2Y31A 1T33A 3ZMUA 3PNYA 1U78A 4G7OF 2A6TA 2MLKA 1KGSA 3GTJJ 3KFWX 5JHFA 2VE8A 1FYLA 2RNJA 5LHHA 1ETVA 5H6QA 3ASNH 1U8BA 2L5QA 4UVCA 1UJ8A 5JVGF 4XRFA 4M6YA 2Z2SB 3ZR8X 2DJNA 2YX7A 5M5WJ 3FXUA 3OL3A 3UKGA 4B4CA 1OJLA 6PAXA 3RYPA 3OYIA 3GMEA 3VYTB 2M34A 4QSHA 3MD2A 2F48A 5GTHC 3L2CA 3ERED 1OCCH 3DP7A 4L9VA 2P5VA 2CV2A 3KEOA 2AHQA 4JP0A 4HA8A 1R1TA 3CCYA 3J80K 3G4SI 2KZVA 1WSUA 2TCTA 2XAUA 3R4KA 1MKMA 4HG2A 3LMMA 4HV6A 3G2BA 1B72A 2HYJA 2IGNA 2DT5A 4M3EA 2K7LA 5EEGA 2K40A 3OR1C 4LB5A 1ZGJA 2H8RA 1YW7A 5F64A 4CYCB 4LG3A 2CQKA 2DODA 2A05A 4IRGA 9ANTA 2HGCA 3F8MA 1XD7A 3GWZA 2HOSA 1GDTA 5ICFA 5KHDA 3DLAA 4UB8C 1F4KA 2XSJC 3B6CA 1FOKA 3VOEA 3N4MA 2Y48A 1XSDA 3W2VA 3KLNA 4ITVA 2EILH 3HKZN 2KDZA 4M9ZA 1XDUA 4A3CJ 3HSRA 4ZC3A 3RQ4A 2M30A 1AKHB 2CYYA 3L9FA 1LDKB 3KEYA 1H88C 2NOGA 2V1UA 3WTXC 1T56A 5LHIA 4GCVA 3PUBA 4B3XA 2LG4A 1HW2A 4KITB 3TW7A 3DEWA 3QWLA 1SFEA 4IHYA 3QPTA 2LVSA 1A36A 2BE5F 2O8KA 2BVMA 2DFIA 1D0ZA 3H9QA 2NVUB 2X4HA 3HHHA 3CJNA 3CUQC 3UNGC 3Q9VA 4HF0A 4D5CA 3V7SA 5BS6A 4QIWN 2HFHA 2VOOA 2CO5A 2Y2ZA 3HG9A 1YHQI 4CA0A 1FY7A 3PNVA 5B5EC 2L9RA 2QQAA 1IGNA 2XDVA 4M9SA 4A0XA 3OY9A 1O7LA 1P4XA 2OAZA 1OISA 3FF5A 2ISYA 3GBGA 3WODF 3CDLA 3F22A 2R0QC 4U0WA 2K4JA 1CF7B 1R5HA 1XGNA 2V4JC 3WTTC 5BMZA 2ZJ2A 4ZDOA 1YX3A 2XGDA 3G6EI 3IH2A 1MD0A 2JSPA 2A5YB 2ZXWH 2QVOA 4IPAA 1Z7LA 2KDOA 2W48A 3FXMA 4IQJA 5K5RA 1MBJA 2J5PA 4PCQA 3T8RA 1MJAA 2QQBA 1BR4A 3LA3A 1LE8A 1T95A 1MSFC 4LJZF 2ACJA 3REOA 4KNYA 2WY8Q 3ZCOA 3CCEI 4BYYA 2E35A 1W4MA 4L5EA 4XKCA 1DDNA 1OYWA 3CUQB 2V79A 1Y1WJ 2QZ8A 2EA4A 2WTEA 3ERMA 5DUKA 1XSVA 3DPUA 3LSHA 4HF1A 4AM3A 3ELKA 5K5OA 1B8IA 3TOAA 3M7GA 3QP5A 2BV6A 2DAOA 5GAEJ 2IVMA 3ZMVA 3C1DA 3ZPLA 1VQMI 5DD4A 5L3EA 2XF5A 2GIVA 5JHUA 4BQQA 5DD8A 2M3AA 4A0YA 5J1UA 4EATA 3E5QA 1YTYA 2XRLA 4L9JA 2JK3A 1XN7A 2V6CA 2KJBA 1QZEA 2RNGA 2UWMA 4XSXF 1X1AA 1REPC 1IRXA 2E36A 2R7XA 3S1QJ 1IRGA 2DOEA 3GCMA 2YX4A 3CQZJ 5K1YA 3MQ0A 5IP7J 1R6RA 1W7PA 4EJOA 2R93J 2MGQA 1KQ9A 1MNEA 1ZTRA 4FASD 2XGEA 3G3ZA 4UXNA 4ENMA 2HOTA 4O3MA 4RAYA 5FROA 3D5SC 1R5GA 3VSLA 3EUHA 4BDZA 4IQ4A 4ESBA 1W5SA 1QGPA 1G8XA 4G8XA 3I4MJ 2Y0SN 4GDFA 2WV1A 3MKWB 1JHHA 3KP2A 4LLLA 2ZCWA 3DU6A 2RC4A 1WPKA 1IN8A 1STZA 1Y8QB 3TDUC 2EFPA 4D7NA 1NH3A 1J2XA 1PVEA 2DTZA 5FD6A 5KK1A 2ID3A 2XRNA 3OWTA 2R7TA 3UR3C 4MQVA 1SMTA 2W57A 2Z3YA 4AIJA 5D5VB 1USTA 1ZAOA 1SVMA 5BNGA 3ABLH 1V3FA 2FQ3A 2HEOA 4A2UA 2FEZA 1BW6A 5E8GA 2GOXB 2E2IJ 3CP8A 5A2QZ 2Z99A 1FOXA 1N75A 2PI0A 3H1CA 3HOSA 2HKOA 1EH8A 4R1HA 1BOBA 4LK0F 5IP9J 2B0LA 2TRTA 4XLCA 2P8TA 4RB2C 4ETSA 1SFXA 4XN0A 3IRRA 2D45A 1F9NA 2PG4A 2R4GA 4LD5A 1UG2A 1Q1VA 1Y1VJ 2IGOA 5DCFA 4UVBA 2L01A 1ZYRF 1MMNA 1ZH5A 4DOZA 3OYHA 2K02A 1TNSA 3WU1B 3S3MA 2KRCA 4CUGA 3L2RA 4DGWB 2EPFA 3MFKA 3IWFA 3K4CA 4GYGA 3K1NA 3WE2A 3CP2A 3GFLA 5LBQA 4G7HF 4ASNA 4LIVA 3OYGA 1ZG1A 3DU5A 1TWFJ 3OIPA 5CQGA 3I5UA 2KIQA 2HTSA 4NQWA 4I0BA 2DA1A 2XPWA 2QSHX 2O5RA 2UV1A 2WC2A 2V1DA 3F21A 1K6OA 3IAS2 2DA7A 1J5YA 2W82A 2HPIA 3BG7A 3SZPA 1GLNA 3SEZA 1WJFA 2E1MC 5F1RA 4KYWA 2G9WA 3TBIA 1MJ9A 2W4SA 5LGNA 1TT5B 2N8GA 3A0HC 5EEAA 2F4MB 5ERIA 4H4KC 1P4WA 2XAQA 2PLYA 5FLXZ 3K2ZA 3CC7I 3BJ6A 3BP8A 1D5YA 3C2GA 3BR6A 3M1CA 5H6RA 2AQFA 2V7FA 1Y39A 1W5CC 3ECOA 1X3UA 2MABA 2JVGA 1VQ5I 2F2EA 1MNMC 3CLOA 3TO9A 3ZQGA 3HJEA 1FMVA 4RGRA 1SFOJ 5EZHA 1Z77A 3HB9A 2IS6A 5L3BA 2GXBA 2QM3A 3ZQHA 5C44J 2Y30A 4OWRB 3NWSA 3SQNA 5HLHA 2O61A 3E3VA 4O5VA 1I6HJ 2QCOA 3E6DA 2JSCA 3BTJA 3QYFA 1KQ8A 3BZ6A 3PIOF 1YIJI 2EFQA 4L0YB 4IHXA 4C9YA 2BEOA 3S32A 5CVUA 2VASA 3CMEI 5J8CA 4E7ZA 3BR3A 2LKXA 4XMYA 3HPHA 1TP4A 1W7PD 4HX7A 4IX7A 4G6DA 2NXNB 2KFDA 2GQQA 3ABUA 4CCKA 4OMZA 2CQ7A 5D8LB 4DJAA 2K9MA 1DPRA 1S5LC 3BCAA 2F5EA 3RDIA 2R5ZA 2EV0A 4XIDA 4BEHB 1K61A 2MA3A 3AG4H 2WV0A 4G6QA 3LWFA 2CQXA 3GXOA 3K4LA 4WXHA 1V5FA 4P96A 1BOAA 4XL9A 4Y15A 4M3BA 1SD4A 3WHBA 2NNNA 2JMWA 3FZVA 4EJUA 2R5YA 4KICA 2ZMEB 2PJPA 1UHSA 3JW4A 3M8EA 1W0TA 1E17A 1BI0A 1B59A 1HLVA 2MD0A 4A69C 1RC9A 3QU6A 5DCMA 3BZKA 5FD5A 4PUSA 4NHJA 1K4TA 4JX6A 2JN6A 2EFOA 2VQLA 1U0JA 1YX5A 3BR2A 3SDBA 3VODA 1JT0A 3A4CA 1FTTA 5CVRA 1RPWA 3JRIA 3HUGA 1UHWA 3DFGA 3KX2A 3R61A 1TL8A 5EF6A 3H36A 4RB1A 2GIZA 3F8NA 3KYCB 4M3FA 2Q2EA 3WU0A 4BE1A 3LAPA 3F9KA 2OZ6A 2FOKA 1S7EA 1APLC 4S04A 3IRQA 2K4BA 4K2EA 1FP1D 3S15J 3GUDA 3OL4A 1TWAJ 3BG3A 4A6DA 1SFUA 1GVDA 1U8RA 2ECBA 2ME6A 1XTAA 1S6LA 2K3FA 5LGTA 1ZGAA 2JT1A 2L4AA 1MMDA 4BHBA 3A01A 1FJLA 5HOOA 3BCBA 4I02A 4C3IJ 2DA3A 2VQGA 3HGYA 4OMYA 3PUFA 2GLOA 1ZRDA 1ONVA 5IT3A 3BDDA 3ZP5A 4OINF 1HSJA 5KAFC 2CSOA 5F1JA 1ZLJA 4LB6B 1FNNA 1OCZH 3ESWB 2BY1A 2FRHA 3GFIA 2CV1A 5TRDA 4AYBN 2KT0A 3WTVC 1JUMA 2R7FA 4CHUA 4JQFA 2M45A 3F8CA 3KLOA 1FMWA 4U0YA 2HYFA 3ABKH 3PFIA 3COAC 3J81Z 1OCRH 2QQ9A 2CG4A 4LOCA 1T0FA 4GYIA 4HLYA 1ZG5A 3BWGA 4GO1A 4ZDPA 1KU2A 3MWMA 3S14J 1JUPA 2NS7A 1VTNC 1DP7P 4L5JA 5BOXA 1W1WE 2CUZA 2ZXJA 3I0TA 3OYBA 4D9JA 1VFCA 1EF4A 1LKXA 4IJAA 2UZKA 4NBQA 3K1PA 2BW3B 5IT9Z 4HYEA 1VQLI 4A3DJ 1G3SA 1OYIA 4C2MJ 2OF7A 5TJJA 1WFXA 3KP3A 3RKYA 1R1VA 2TDXA 2PQ8A 3G1LA 4D5FA 1BI1A 3HHGA 4P9FA 4F7ZA 2FBKA 4KT6A 4NC7A 1MJBA 3CUOA 1WJCA 4B47A 3CZ6A 1UG0A 3V8LA 3GW2A 2R92J 1Z1DA 2OQGA 2NAZA 1HA8A 3HL2A 3JRGA 5DM6F 2R7ZJ 1M1EB 2LNBA 2HDWA 5HODA 2IS1A 1YRNA 1WHUA 3O8GA 4A3MJ 1QVTA 1ZR4A 5CVVA 4WF2A 5FO5A 3HDDA 2JPBA 1POGA 1NK3P 2QKMB 5E18F 5HDNA 3G71I 1LNWA 1LUJB 3F6OA 4FX4A 1U6GA 1G3YA 2VPRA 4AU7A 3VPRA 2EZLA 3CO7C 2HU9A 4L18B 5E17F 2QQ8A 2F5VA 4HPQA 2LKPA 2JJ7A 2A07F 1BR2A 4A3BJ 1FWZA 2F4OB 2M8EA 3I53A 2ZJQF 3P5JA 2HKXA 3S2WA 1IN6A 3RKXA 2L02A 2P5KA 4XR6A 1VZ0A 3WTUC 1Z67A 4HLXA 3PM1A 3RCOA 1K7AA 1OQYA 2OZUA 5HS7A 2VBZA 2O9LA 4NC8A 1MH3A 2J5OA 4CDGA 2WB1A 4N9IA 2XIGA 1PUFA 3NWTA 3WHCA 2DMQA 1JXSA 4A3IJ 4HX8A 1GXQA 4MQ9F 2PMUA 1FT9A 1B9NA 2BOLA 3W2WA 1XS9A 4IHSA 4EM1A 2Z33A 4M73A 4KIFA 2QSFX 4B3AA 4KUMA 5L3GA 3HOTA 5M3FJ 3C2HA 3GFJA 1K78B 4FCYA 1I39A 3M1EA 2ADUA 1S8NA 4N9HA 4XBFA 3KP4A 2GOMA 1V5GA 3OR2C 1VQ4I 2LY1A 1OR7A 4DBRA 2DXIA 2K9SA 1DQUA 2X1CA 1IDZA 1LFPA 3PQJA 4A5MA 5J47A 2HXOA 5FGMA 5CYVA 4M3DA 2DQLA 4EM0B 2FJ1A 2C6YA 2KISA 4E7SA 4YIIA 1Z05A 5A2QK 1R58A 1X1BA 3HM5A 4L9NA 3SDGA 2O8XA 1IN7A 3AKZA 3JR9A 4CCOA 3TW6A 1VQPI 5ICCA 1BW5A 3OYLA 4IRHA 5E8IA 1P92A 4EGYA 4F55A 2VBYA 5HS8A 3K7AJ 1BBYA 2IT0A 3QOEA 1QBJA 3MN2A 4CCMA 1RUNA 2CWEA 4DZJA 2NS0A 5D5UB 4BKXA 1RESA 3HOXJ 4CYCA 3BG5A 4JX4A 1F36A 3K70D 1ERDA 2PJRB 2Z9OA 5IY5H 2E19A 3TOBA 2XC7A 4IRIA 3S8PA 4XQFA 5GPCA 1IC8A 5M5YJ 4G7ZF 1OPCA 2M0CA 2HZTA 1WI3A 5IPAA 2OD5A 2W25A 5GTIC 5C4XJ 4MNUA 4I01A 2A68F 1XX5A 4FQGA 1SD7A 2R7SA 2WA0A 2IW5A 3IH4A 4A3KJ 2HDCA 4B44A 1AKHA 2RAEA 3OYJA 1HOMA 1E3HA 4LG0A 1QO0D 2JRMA 1DPUA 3S1MJ 3ZQ7A 4KJZA 1R23A 5D6EA 4L0ZB 3GTKJ 2RQPA 5FLXK 1QHHD 2EIKH 3SZGA 3V7CA 2LTPA 2DOFA 2P0WA 3IH3A 5DDGA 4ZYHA 1YLFA 5F04A 3OIOA 1IXCA 3T8TA 1X19A 2BY0A 2IAIA 2IEKA 2Y69H 1KZHA 2CW8A 4M3GA 3QPHA 2ME0A 1HC8A 2M7BA 5FFXA 1ENHA 2K3PA 5JFRA 2X85A 1O3RA 3NEUA 2M0MA 3HGGA 3JTHA 3FISA 4OU0A 3SYTA 4RB3C 2IS4A 4GGGA 1FYKA 3BR5A 3GTOJ 3RYRA 2IJLA 1RUOA 4HF2A 2FOWA 3CCQI 1XGMA 2KPMA 1ZKGA 4AC0A 2GA2A 1WJEA 3H9JA 1V5EA 2RVCA 2HVSA 3CJTB 2DDBA 4PJLA 1YS6A 2R7WA 1CF7A 1ZK8A 1XSXA 4XLPF 5GPAA 4KA4A 1H9GA 1JT6A 1A6QA 4NUBA 3TDZC 2CW0F 2M5WA 2EZIA 2KP6A 4NC6A 3P7NA 3BR1A 5IP6A 1BN5A 1HW5A 1RIOH 2OCCH 2DN0A 4LMYA 4UUVA 2JQ7A 2P81A 3I71A 2YU9J 4AVZA 1P7IA 3P9CA 2EQRA 3ML6A 4DBQA 2MFZA 3QQAA 3CC4I 2K9QA 3ZQLA 2CMPA 2RKHA 2ZC2A 4W1UA 3VYRB 3CUQA 4MEXF 2HOAA 2H8WA 2XKOA 3FM5A 3JAMK 3HIFA 4ZYAA 1TLHB 4A3JJ 4HQEA 2X6YA 2VONA 2D5VA 1B9MA 4UHTA 3TP3A 2L7FP 4XORA 5FRMA 3LSGA 3MZYA 3N05A 4IKFA 2VC1A 3GEZA 2XVCA 3IP4B 3I56I 2DPDA 3JCUC 3HOYJ 2V9KA 3E97A 5HNFA 1H89C 4CYDA 2ZKZA 5HS9A 3PFYA 1P4AA 2E1CA 2DT6A 3H35A 5GADJ 1XB4A 2BXYA 1ZARA 4KN4X 1JKPC 1VQKI 1LVAA 3QU3A 3E6CC 1J75A 1ZRFA 3FXOA 1FBUA 1UAAA 2FF4A 4OIOF 2W24A 3JSOA 4RGSA 1V4RA 2E2JJ 3I59B 1IUYA 1E0EA 1KU9A 3CO6C 1MMGA 2HWVA 3PSIA 2HXIA 1ZN2A 3OS1A 1LEBA 1U3EM 1VQ9I 3RQIA 3KZIC 3BQYA 5H2FC 5JVTA 3N97A 5DV5A 2R7OA 3PSFA 4YFXF 4E7KA 1NTCA 3HTSB 3ISPA 3ZQCA 4XKBA 4Y7NJ 4BY1J 3FXKA 2K85A 3SJMA 3ZN1A 2R3SA 4F52A 2LC2A 2VKVA 2Y9ZA 4XKWA 3FXLA 4F92B 2DOAA 1GHCA 1TW3A 3PO2J 1P7JA 2HZDA 2XF6A 4II2A 1U9OA 4P1WA 3IKVA 3J7YJ 2VLAA 1Y56A 5J4YA 2E7WA 2GA1A 2F4IA 3RIRA 1GVJA 3G73A 5FRNA 3MCZA 3EUHC 1WJDA 2YUSA 2JUCA 3GTPJ 1Z21A 1MDMA 2OBPA 4F93B 1EJ9A 4WX9A 1EKEA 2E34A 1GT0C 1HBXG 3J81K 2PMZA 4EV0A 2VJ4A 5C3EJ 2X6WA 1X3WB 3RKQA 1YJNI 2HTJA 3BG6A 1NG7A 5EG0B 2DTRA 1ETWA 4FHTA 4X0GA 3BROA 1IF1A 3F0CA 3X2QH 5JLXA 3I54A 1BIBA 1Z0XA 2M4GA 4XONA 3BPXA 2D1HA 2V6EA 2VE9A 4RGUA 5EDNA 3OSFA 4HAMA 3JTGA 5IT9K 2X6XA 2DFHA 2NVQJ 3L00A 4M6XA 2H6BA 5LLQA 2QKLB 2IRFG 3RZDJ 1TWHJ 1F5TA 1IDYA 3I9V2 1OYYA 2XKPA 4KT5C 5D4SA 5JLWA 3OYKA 2QA4I 1SAXA 2PMHA 1YIOA 2R7UA 3BY6A 3CCMI 1TZLA 4C3HJ 4ZTJA 5B1AH 1L0OC 2VJJA 3C7JA 4NNJA 3HSEA 1LB2A 1UHMA 1ETYA 1LEAA 4YG2F 1RRJA 3DBLB 1QNTA 3DBRB 1JKRC 2DJIA 1HSTA 4GRIA 3IAM2 2E7XA 4FISA 3ZOBA 1QPMA 1WJ5A 2EZKA 1QZYA 1W36D 1HCRA 3KPHA 4RGXA 4LLGF 2CUEA 2BGCA 3DV8A 3MZ8A 3GYHX 2CQQA 4ANJA 4ESFA 5GAHJ 3GTMJ 4A93J 1N78A 2P6TA 4G94A 3A03A 3IC7A 5F0FA 1D8KA 1Z7UA 2L7MP 1G3WA 3AG1H 4WXDA 2PN6A 1MBHA 4XICA 4PK4A 3FXRA 2EK5A 1WJAA 2NRAC 4UVAA 5K7FA 1D1CA 3H0DA 2EIJH 2W7NA 4O6JA 1BL0A 3DF8A 1BIAA 2WAEA 5KCMA 1ULYA 1K4SA 2FSWA 1EV7A 4JK1X 2DCEA 2P6SA 2RQQA 4W97A 2R7DA 2FNAA 3K1MA 3RPQA 3QYBA 2ESNA 5FLMJ 2VT3A 4PJ0C 3H3VK 3FIWA 3E6BA 3FKIJ 3D5LA 3VB2A 1O4XA 4U88A 3S2DJ 4A6EA 1YYVA 4KIGA 2DDAA 3CF2A 2M1BA 2M2EA 1GV2A 1GUUA 1JGSA 2OTLI 2X1EA 3O3KA 1R22A 2W85A 1HDPA 1ORKA 2MYSA 3WG9A 2FNPA 2EA2A 2E5ZA 2HR3A 3BZCA 1JJ6C 3V42A 5EGOB 1T39A 2NOJB 2ISZA 4IL6C 3VYUB 4XSZF 5AONA 4UNOA 4U7BA 2JA2A 4MEYF 4KISA 1O7FA 4PGHA 2XAFA 2YS9A 1R5ID 1YW8A 5IOZA 4A3LJ 2VXDA 3TMOA 1SFKA 2I5UA 4OAZA 1ETOA 3TO6A 1S3JA 4ZYGA 2EH3A 3K4KA 2ZBKA 1X1DA 1BA5A 4U0VA 5DTDA 3HSFA 5E1XA 1TC3C 4BEHA 3K9TA 2E1MB 2XGXA 5TISC 1E3OC 3VWBA 3WGGA
chains in the Genus database with same CATH topology
2KRFA 2VODA 4CXFA 3FX3A 4RAZA 1FSEA 2ZMEA 3I64A 1Z9CA 2A3SA 2L3DA 1KQ0A 5BPIA 1P6RA 1U5TC 3WTZA 2YSRA 2QLZA 1D8JA 2IA0A 1KU3A 4TV7A 3U9GA 1J9IA 4ZYDA 4ZYEA 3M9AA 3V7RA 3GZ5A 1J7KA 3JAMZ 4N0BA 3VFZA 2JPCA 3KCCA 4GXOA 5DUIA 1FBQA 1PP8F 3EETA 4P9UA 2PFBA 4AIKA 2YR2A 4M72A 1WQ2A 2KIFA 4MGRA 2EJRA 2P4WA 4EM2A 3GX4X 3SZTA 1ZHFA 2FBIA 3D0SA 2UXXA 3VEPA 4HDUA 3DPTA 5BQTA 1U5TB 1S29A 1TQIA 2DQRA 4G9YA 1B6AA 1IZ1A 2D2WA 4ZH4F 2ZNZA 1IXRC 4OIPF 1B4AA 1I27A 5DCMB 4EQQA 1JHFA 3V4GA 3F72A 2LF7A 3HYIA 3ZMDA 1LJ9A 4AD9A 2O0YA 4P55A 3RTRA 1LDJA 3KEQA 4B09A 4QWQA 1R1UA 1XMAA 1TTYA 2YU3A 2EV6A 3K0LA 2NNYA 2Z5UA 2MH2A 2QUFA 3R60A 1AWCA 4LFUA 2A69F 4L9TA 2QBYB 4I0AA 3WTSC 2H6CA 3ZMSA 4KMUX 4MTEA 1UFMA 3FHZA 3IWZA 3FMRA 2DPUA 2XAJA 3P9KA 1WWXA 5ED4A 2XROA 1BC8C 1HKSA 1KYZA 3F23A 1YW9A 3J7AO 5LEJA 3JSPA 1R36A 4KIBA 1RNLA 2IA2A 2VBXA 5CVIA 2PBIA 2XAGA 3DXJF 2MD5A 1H0MA 2CGPA 2EV5A 3GZ6A 4D0PA 5J6XA 3RJPA 1FX7A 4PDKA 3WGHA 1JE8A 4IVNA 3MEXA 2ESHA 3R0AA 3I58A 4WK8F 4UV9A 4BNCA 5CLSA 1S7AA 4YFNF 4BHCA 1PUEE 1FPQA 3RKWA 1MZBA 2EFNA 2DLLA 1E2XA 4AVPA 5BPDA 5H20A 2ZO4A 3ZN0A 2HYGD 3GFMA 5LRRA 3F8FA 5HDGA 3HRMA 1ON2A 3SFZA 5CVJA 3E5XA 2DI3A 1EH7A 4EJTA 2MH9A 2RN7A 5FFZA 1XCVA 1HQCA 3ROUA 3GLXA 3FMQA 4L5IA 2HQRA 3ECHA 3W6KB 4Y13A 3KETA 2A6HF 2HOEA 2KIUA 1DUXC 3OV8A 1YG2A 3ABTA 4LK1F 2RV8A 4MTDA 5KVRA 3OOPA 1TQMA 3LSTA 2XASA 4I7HA 1FBSA 3WTWC 3BPVA 3NRVA 3KE2A 2VXZA 1IAWA 5HVQC 5LRSA 3WE3A 1H9TA 2HS5A 1O3QA 4PZJA 4CICA 2IA1A 1HKTA 3PQKA 1GXPA 2LSOA 2H94A 1G6NA 2QENA 2H09A 1I1GA 2DO7A 2NYXA 4P5OA 5L3CA 3EYIA 4CO8A 4AIHA 5D4RA 4I09A 4LG0B 1OMIA 4OIRF 3LA2A 1I5ZA 2OU2A 1TBXA 4ESJA 3T0YA 1BJAA 1Z91A 3V8KA 1FZPB 3BOQA 2V9VA 4Q48A 2V1XA 5F6FA 2X0LA 4A12A 2KJCA 3F6VA 2G7HA 4Q4ZF 3TO7A 2G7UA 3KP5A 4HV5A 2MC3A 2A6EF 1ZREA 1Z6TA 5L3FA 1XGSA 4JBAA 3DKWA 2AS5F 1HW1A 1IRFA 3I59A 2EWNA 3TGNA 4A5NA 1Q1HA 4BAYA 4HX4A 3QP6A 4I2OA 1SD5A 1P2FA 5AIQA 2ELHA 3LFKA 4R8HA 3QRFF 1KA8A 1WRJA 2QWWA 4IXAA 2LDUA 5JI6A 5L3DA 2KKOA 4FT8A 4LLNA 3DQVC 3QOPA 1G3TA 2GZWA 1QQIA 2ZNYA 1U2WA 2MBFA 4KFCA 4NB5A 5JR3A 1ZG3A 3HRSA 4H0EA 3GO5A 2EFWA 3R0JA 4KMFA 4PGGA 1O3TA 4HOBA 1KYWA 3Q5FA 2E1NA 4HDVA 1T38A 3GF2A 4DQ2A 2VOPA 3L7WA 1YFHA 2LF8A 3RPUA 2VN2A 1IXSB 3O2PE 5E1WA 1AOYA 1I6XA 4R79A 5FB2A 2BYVE 2RDPA 3CDHA 1ON1A 2K27A 1PP7U 3Q9SA 4YIFA 2DBBA 2RGVA 4DNCA 1W7PB 1G4DA 3F3XA 3P9IA 4OOIA 4XLNF 4E70A 1MDMB 2FA5A 1TNTA 5LHGA 4CGZA 1HXDA 4Q47A 4BQAA 2Y75A 4WXCA 4EVIA 2STTA 3E6MA 1WKMA 1YQAA 5D5XB 1NHAA 2JZYA 1S7OA 3T1BA 1FYMA 1USSA 2KIMA 4M9XA 5E1ZB 1F1ZA 4RS8A 1T6SA 1TQPA 3R6SA 2XHKA 1I1SA 1OKRA 2L4MA 2STWA 5LEKA 2JTVA 1XCBA 2VBWA 1LQ1A 3LQQA 2WWYA 5ILUA 4HBLA 4FX0A 4ZZLA 1IW7F 4I98B 5DYMA 3J80Z 4EJVA 2XUBA 3LQRA 1BC7C 3TKYA 1Z6RA 3NQOA 5HDKA 1ZLKA 4BXUA 1WI9A 2IP2A 1FLIA 4EJWA 2FMLA 4ENJA 2EB7A 1XMKA 4QLCU 3U1DA 3V8JA 1FP2A 2DW4A 3EYYA 3SHFA 3FXQA 4KN7X 2BBYA 3C3WA 1FC3A 4MHGA 5LGUA 4HZFA 3HRUA 1T2KA 5ILVA 4ENNA 2O03A 1O57A 1TW2A 3DEUA 3C18A 2F5CA 5K5QA 2VC0A 5CJ9A 1MGTA 1R00A 4HW0A 3CTAA 2Q8KA 1CGPA 3QAHA 5EEHA 1BI3A 2K86A 2P7CB 1ZRCA 2COMA 3RI4A 4M74A 4A0ZA 2XV4S 2F5DA 3FWEA 1QZZA 3T5XA 4YFKF 2H27A 4IHTA 4KDPA 4UV8A 1O3SA 1YS7A 2PEXA 3BJOA 1U5TA 5DEQA 1LDDA 4M71A 2P5LC 4ON0A 3E5UA 5D6FA 3WGIA 3H3ZA 3GVAA 2HQNA 2DU9A 2AXLA 1XDSA 2W84A 1K79A 3I4PA 3ZMTA 2QYOA 1W5TA 2Y0MA 3DPLC 4Z2YA 3IKTA 1BI2A 5D8KB 2GAUA 1FSHA 2GXGA 1A04A 4AWXB 3KZYA 3IL2A 4CZZA 4WWCA 3ULQB 2O6GE 3ZMZA 2M87A 1L3LA 2YPRA 3K69A 3MAJA 1BM9A 2OQRA 3AAFA 3EQLF 5E20A 4S05A 4BHPA 3O6BB 4OIQF 2QBYA 3LAJA 1XGOA 3W6JB 3KP7A 1RI7A 3EDPA 1D3YA 4HQMA 3B02A 2DK5A 1UCRA 3KZZA 1RZ4A 5ICGA 2DK8A 1HKQA 3MZHA 2FE3A 4Y17A 3IHUA 1R7JA 2JRTA 2O3FA 1C0WA 4WCGA 3B73A 2VT2A 2XAHA 4LGWA 1SMYF 3M8FA 1D5VA 1IN5A 2F5FA 2FXAA 3FM3A 1J59A 1PDNC 1YO5C 4BH9A 1UB9A 2A61A 2FBHA 1EH6A 3L09A 3FMSA 3HRTA 1K78A 3H92A 1J0RA 5ILSA 1SD6A 1ODDA 2OA4A 3BJAA 3HTUA 4IF4A 2P7VB 5HLIA 2GWRA 5AIPA 4EGZA 2ETHA 2FMYA 2MLGA 3KP6A 3TQNA 4ZZDA 2L54A 2D1VA 1B1BA 2CFXA 2FU4A 1KU7A 4Q5SF 5HLGA 2Q0OA 3H3UA 3SXYA 3LA7A 5J8FA 4EMSA 5ICEA 3WTYC 5D5WB 2UXNA 4U7DA 4RB0A 2ZFWA 1T98A 4B8XA 1Y0UA 3U2RA 3F8BA 2IPQX 4ENKA 1IN4A 3ZMUA 1U78A 4G7OF 2MLKA 1KGSA 3KFWX 2VE8A 1FYLA 2RNJA 5LHHA 5H6QA 4UVCA 4XRFA 4M6YA 2YX7A 3FXUA 6PAXA 3RYPA 3L2CA 3ERED 3DP7A 4L9VA 2P5VA 3KEOA 4HA8A 1R1TA 3J80K 1WSUA 3R4KA 1MKMA 4HV6A 2DT5A 5EEGA 2K7LA 4LB5A 1ZGJA 1YW7A 5F64A 2CQKA 4IRGA 2HGCA 3F8MA 1XD7A 3GWZA 5ICFA 1F4KA 1FOKA 3VOEA 3N4MA 2Y48A 1XSDA 3KLNA 4M9ZA 1XDUA 3HSRA 2M30A 2CYYA 3L9FA 1LDKB 2V1UA 3WTXC 5LHIA 4GCVA 1HW2A 1SFEA 3QPTA 2BE5F 2DFIA 2X4HA 3HHHA 3CJNA 3CUQC 3Q9VA 4HF0A 3V7SA 5BS6A 2HFHA 2VOOA 2CO5A 1FY7A 2QQAA 4M9SA 4A0XA 1O7LA 1P4XA 2OAZA 3FF5A 2ISYA 3WODF 3F22A 4U0WA 2K4JA 1CF7B 1R5HA 1XGNA 3WTTC 5BMZA 2ZJ2A 1MD0A 2A5YB 2QVOA 4IPAA 5K5RA 2J5PA 4PCQA 3T8RA 1MJAA 2QQBA 3LA3A 4LJZF 2ACJA 3REOA 4KNYA 4BYYA 1W4MA 1DDNA 1OYWA 3CUQB 2V79A 2QZ8A 2EA4A 2WTEA 5DUKA 1XSVA 4HF1A 3ELKA 5K5OA 3TOAA 3M7GA 3QP5A 2BV6A 2DAOA 2IVMA 3ZMVA 3C1DA 3ZPLA 5DD4A 5L3EA 2GIVA 5JHUA 5DD8A 4A0YA 3E5QA 1YTYA 4L9JA 1XN7A 2V6CA 2KJBA 2UWMA 4XSXF 1REPC 1IRGA 2YX4A 5K1YA 3MQ0A 1W7PA 4EJOA 1KQ9A 3G3ZA 4UXNA 4ENMA 4O3MA 4RAYA 1R5GA 3EUHA 4ESBA 1W5SA 1QGPA 4G8XA 1JHHA 3KP2A 4LLLA 2ZCWA 2RC4A 1IN8A 1STZA 3TDUC 2EFPA 1J2XA 5FD6A 5KK1A 2XRNA 4MQVA 1SMTA 2W57A 2Z3YA 4AIJA 5D5VB 1USTA 1ZAOA 1V3FA 2FQ3A 2HEOA 4A2UA 2FEZA 5E8GA 5A2QZ 2Z99A 2PI0A 3HOSA 2HKOA 1EH8A 4R1HA 4LK0F 2B0LA 2P8TA 4RB2C 4ETSA 1SFXA 2D45A 3IRRA 1F9NA 2PG4A 4LD5A 5DCFA 4UVBA 2L01A 1ZYRF 1ZH5A 2K02A 1TNSA 3WU1B 3MFKA 3IWFA 4GYGA 3K1NA 3WE2A 5LBQA 3GFLA 4G7HF 4ASNA 1ZG1A 3I5UA 2HTSA 4NQWA 4I0BA 2WC2A 2V1DA 3F21A 1K6OA 1J5YA 3SZPA 5F1RA 4KYWA 2G9WA 5LGNA 1MJ9A 5ERIA 1P4WA 2XAQA 2PLYA 5FLXZ 3K2ZA 3BJ6A 3BP8A 5H6RA 3ECOA 1X3UA 2F2EA 3CLOA 3TO9A 4RGRA 5L3BA 2GXBA 2QM3A 3SQNA 5HLHA 2O61A 3E3VA 4O5VA 3E6DA 2JSCA 1KQ8A 3BZ6A 2EFQA 4L0YB 2BEOA 5CVUA 5J8CA 1W7PD 4HX7A 4G6DA 2GQQA 3ABUA 4OMZA 5D8LB 1DPRA 2F5EA 3RDIA 2EV0A 2MA3A 2WV0A 4G6QA 3LWFA 3GXOA 4WXHA 4P96A 1BOAA 4Y15A 1SD4A 2NNNA 3FZVA 4EJUA 4KICA 2ZMEB 2PJPA 3JW4A 3M8EA 1E17A 1BI0A 1B59A 3QU6A 5DCMA 5FD5A 4NHJA 2EFOA 3VODA 5CVRA 3HUGA 1UHWA 3DFGA 3R61A 4RB1A 3F8NA 2Q2EA 3WU0A 3LAPA 2OZ6A 2FOKA 4S04A 3IRQA 2K4BA 4K2EA 1FP1D 3GUDA 4A6DA 1SFUA 1U8RA 1S6LA 5LGTA 1ZGAA 2JT1A 2L4AA 4BHBA 5HOOA 4I02A 4OMYA 1ZRDA 1ONVA 5IT3A 3BDDA 3ZP5A 4OINF 1HSJA 2CSOA 1ZLJA 4LB6B 1FNNA 2FRHA 3GFIA 5TRDA 3WTVC 2R7FA 4CHUA 4JQFA 2M45A 3F8CA 3KLOA 4U0YA 2HYFA 3PFIA 3COAC 3J81Z 2QQ9A 2CG4A 1T0FA 4GYIA 4HLYA 1ZG5A 3BWGA 4GO1A 1KU2A 3MWMA 1VTNC 1DP7P 4L5JA 5BOXA 3I0TA 2ZXJA 4IJAA 2UZKA 3K1PA 5IT9Z 4HYEA 1G3SA 1OYIA 5TJJA 3KP3A 3RKYA 1R1VA 2TDXA 2PQ8A 1BI1A 3HHGA 4P9FA 4F7ZA 2FBKA 1MJBA 3CUOA 3V8LA 3GW2A 1Z1DA 2OQGA 2NAZA 2LNBA 5CVVA 4WF2A 5FO5A 2JPBA 5E18F 5HDNA 1LNWA 3F6OA 4FX4A 1U6GA 1G3YA 3CO7C 4L18B 5E17F 2LKPA 2A07F 1FWZA 2M8EA 3I53A 2HKXA 3S2WA 1IN6A 3RKXA 2L02A 2P5KA 3WTUC 4HLXA 1K7AA 2OZUA 5HS7A 2VBZA 2J5OA 4CDGA 4N9IA 2XIGA 1JXSA 4HX8A 1GXQA 4MQ9F 2PMUA 1FT9A 1B9NA 4IHSA 4EM1A 2Z33A 4M73A 4KIFA 4KUMA 5L3GA 3HOTA 3GFJA 1K78B 3M1EA 2ADUA 1S8NA 4N9HA 4XBFA 3KP4A 1OR7A 3PQJA 4A5MA 5FGMA 5CYVA 2DQLA 4EM0B 2C6YA 4YIIA 1Z05A 5A2QK 1R58A 4L9NA 2O8XA 1IN7A 5ICCA 4IRHA 4EGYA 1P92A 5E8IA 2VBYA 5HS8A 1BBYA 2IT0A 1QBJA 1RUNA 2CWEA 2NS0A 5D5UB 2Z9OA 3TOBA 4IRIA 4G7ZF 1OPCA 2HZTA 2OD5A 2W25A 4MNUA 4I01A 2A68F 1SD7A 2IW5A 2HDCA 4LG0A 1QO0D 1DPUA 3ZQ7A 1R23A 5D6EA 4L0ZB 2RQPA 5FLXK 3V7CA 5DDGA 4ZYHA 1YLFA 1IXCA 3T8TA 3QPHA 5FFXA 5JFRA 1O3RA 3NEUA 3JTHA 4OU0A 4RB3C 4GGGA 1FYKA 3RYRA 2IJLA 1RUOA 4HF2A 1XGMA 2GA2A 2RVCA 1YS6A 1CF7A 1XSXA 4XLPF 4KA4A 1H9GA 3TDZC 2CW0F 2M5WA 3P7NA 1BN5A 1HW5A 1RIOH 4LMYA 4UUVA 3I71A 3P9CA 3ML6A 2RKHA 3CUQA 4MEXF 2XKOA 3FM5A 3JAMK 3HIFA 1TLHB 4HQEA 2VONA 1B9MA 4UHTA 3MZYA 2VC1A 3GEZA 2XVCA 2DPDA 3E97A 4CYDA 2ZKZA 5HS9A 1P4AA 2E1CA 1XB4A 4KN4X 1ZARA 1LVAA 3QU3A 3E6CC 1J75A 1ZRFA 1FBUA 2FF4A 4OIOF 2W24A 3JSOA 4RGSA 1V4RA 3I59B 1IUYA 1KU9A 3CO6C 2HWVA 1ZN2A 1LEBA 1U3EM 5JVTA 3N97A 5DV5A 4YFXF 3HTSB 3ISPA 3ZN1A 2R3SA 1GHCA 1TW3A 3IKVA 2E7WA 2GA1A 3RIRA 1GVJA 3G73A 3MCZA 1MDMA 2OBPA 4WX9A 1HBXG 3J81K 4EV0A 2HTJA 2DTRA 4FHTA 3BROA 1IF1A 3I54A 1BIBA 3BPXA 2D1HA 2VE9A 4RGUA 5IT9K 4HAMA 3JTGA 3L00A 4M6XA 2H6BA 5LLQA 2IRFG 1F5TA 4KT5C 1OYYA 5D4SA 2XKPA 1SAXA 2PMHA 1YIOA 3BY6A 1L0OC 3C7JA 3HSEA 1LB2A 1UHMA 1LEAA 4YG2F 1QNTA 1HSTA 2E7XA 1QPMA 1QZYA 4RGXA 4LLGF 3DV8A 2BGCA 3GYHX 4ESFA 2P6TA 4G94A 3IC7A 1D8KA 1Z7UA 1G3WA 4WXDA 2PN6A 3FXRA 2EK5A 2NRAC 4UVAA 4O6JA 3DF8A 1BIAA 1ULYA 2FSWA 1EV7A 4JK1X 2P6SA 2R7DA 2FNAA 3K1MA 3RPQA 2ESNA 2VT3A 3E6BA 3VB2A 3D5LA 4U88A 4A6EA 1YYVA 4KIGA 2M1BA 1JGSA 3O3KA 1R22A 2W85A 3WG9A 2FNPA 2EA2A 2HR3A 1T39A 2ISZA 4XSZF 5AONA 4UNOA 4U7BA 4MEYF 1O7FA 4PGHA 2XAFA 1YW8A 3TO6A 1S3JA 4ZYGA 2ZBKA 4U0VA 3HSFA 5E1XA 3K9TA 2XGXA 3WGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRF A;  2VOD A;  4CXF A;  3FX3 A;  4RAZ A;  1FSE A;  2ZME A;  3I64 A;  1Z9C A;  2A3S A;  2L3D A;  1KQ0 A;  5BPI A;  1P6R A;  1U5T C;  3WTZ A;  2YSR A;  2QLZ A;  1D8J A;  2IA0 A;  1KU3 A;  4TV7 A;  3U9G A;  1J9I A;  4ZYD A;  4ZYE A;  3M9A A;  3V7R A;  3GZ5 A;  1J7K A;  3JAM Z;  4N0B A;  3VFZ A;  2JPC A;  3KCC A;  4GXO A;  5DUI A;  1FBQ A;  1PP8 F;  3EET A;  4P9U A;  2PFB A;  4AIK A;  2YR2 A;  4M72 A;  1WQ2 A;  2KIF A;  4MGR A;  2EJR A;  2P4W A;  4EM2 A;  3GX4 X;  3SZT A;  1ZHF A;  2FBI A;  3D0S A;  2UXX A;  3VEP A;  4HDU A;  3DPT A;  5BQT A;  1U5T B;  1S29 A;  1TQI A;  2DQR A;  4G9Y A;  1B6A A;  1IZ1 A;  2D2W A;  4ZH4 F;  2ZNZ A;  1IXR C;  4OIP F;  1B4A A;  1I27 A;  5DCM B;  4EQQ A;  1JHF A;  3V4G A;  3F72 A;  2LF7 A;  3HYI A;  3ZMD A;  1LJ9 A;  4AD9 A;  2O0Y A;  4P55 A;  3RTR A;  1LDJ A;  3KEQ A;  4B09 A;  4QWQ A;  1R1U A;  1XMA A;  1TTY A;  2YU3 A;  2EV6 A;  3K0L A;  2NNY A;  2Z5U A;  2MH2 A;  2QUF A;  3R60 A;  1AWC A;  4LFU A;  2A69 F;  4L9T A;  2QBY B;  4I0A A;  3WTS C;  2H6C A;  3ZMS A;  4KMU X;  4MTE A;  1UFM A;  3FHZ A;  3IWZ A;  3FMR A;  2DPU A;  2XAJ A;  3P9K A;  1WWX A;  5ED4 A;  2XRO A;  1BC8 C;  1HKS A;  1KYZ A;  3F23 A;  1YW9 A;  3J7A O;  5LEJ A;  3JSP A;  1R36 A;  4KIB A;  1RNL A;  2IA2 A;  2VBX A;  5CVI A;  2PBI A;  2XAG A;  3DXJ F;  2MD5 A;  1H0M A;  2CGP A;  2EV5 A;  3GZ6 A;  4D0P A;  5J6X A;  3RJP A;  1FX7 A;  4PDK A;  3WGH A;  1JE8 A;  4IVN A;  3MEX A;  2ESH A;  3R0A A;  3I58 A;  4WK8 F;  4UV9 A;  4BNC A;  5CLS A;  1S7A A;  4YFN F;  4BHC A;  1PUE E;  1FPQ A;  3RKW A;  1MZB A;  2EFN A;  2DLL A;  1E2X A;  4AVP A;  5BPD A;  5H20 A;  2ZO4 A;  3ZN0 A;  2HYG D;  3GFM A;  5LRR A;  3F8F A;  5HDG A;  3HRM A;  1ON2 A;  3SFZ A;  5CVJ A;  3E5X A;  2DI3 A;  1EH7 A;  4EJT A;  2MH9 A;  2RN7 A;  5FFZ A;  1XCV A;  1HQC A;  3ROU A;  3GLX A;  3FMQ A;  4L5I A;  2HQR A;  3ECH A;  3W6K B;  4Y13 A;  3KET A;  2A6H F;  2HOE A;  2KIU A;  1DUX C;  3OV8 A;  1YG2 A;  3ABT A;  4LK1 F;  2RV8 A;  4MTD A;  5KVR A;  3OOP A;  1TQM A;  3LST A;  2XAS A;  4I7H A;  1FBS A;  3WTW C;  3BPV A;  3NRV A;  3KE2 A;  2VXZ A;  1IAW A;  5HVQ C;  5LRS A;  3WE3 A;  1H9T A;  2HS5 A;  1O3Q A;  4PZJ A;  4CIC A;  2IA1 A;  1HKT A;  3PQK A;  1GXP A;  2LSO A;  2H94 A;  1G6N A;  2QEN A;  2H09 A;  1I1G A;  2DO7 A;  2NYX A;  4P5O A;  5L3C A;  3EYI A;  4CO8 A;  4AIH A;  5D4R A;  4I09 A;  4LG0 B;  1OMI A;  4OIR F;  3LA2 A;  1I5Z A;  2OU2 A;  1TBX A;  4ESJ A;  3T0Y A;  1BJA A;  1Z91 A;  3V8K A;  1FZP B;  3BOQ A;  2V9V A;  4Q48 A;  2V1X A;  5F6F A;  2X0L A;  4A12 A;  2KJC A;  3F6V A;  2G7H A;  4Q4Z F;  3TO7 A;  2G7U A;  3KP5 A;  4HV5 A;  2MC3 A;  2A6E F;  1ZRE A;  1Z6T A;  5L3F A;  1XGS A;  4JBA A;  3DKW A;  2AS5 F;  1HW1 A;  1IRF A;  3I59 A;  2EWN A;  3TGN A;  4A5N A;  1Q1H A;  4BAY A;  4HX4 A;  3QP6 A;  4I2O A;  1SD5 A;  1P2F A;  5AIQ A;  2ELH A;  3LFK A;  4R8H A;  3QRF F;  1KA8 A;  1WRJ A;  2QWW A;  4IXA A;  2LDU A;  5JI6 A;  5L3D A;  2KKO A;  4FT8 A;  4LLN A;  3DQV C;  3QOP A;  1G3T A;  2GZW A;  1QQI A;  2ZNY A;  1U2W A;  2MBF A;  4KFC A;  4NB5 A;  5JR3 A;  1ZG3 A;  3HRS A;  4H0E A;  3GO5 A;  2EFW A;  3R0J A;  4KMF A;  4PGG A;  1O3T A;  4HOB A;  1KYW A;  3Q5F A;  2E1N A;  4HDV A;  1T38 A;  3GF2 A;  4DQ2 A;  2VOP A;  3L7W A;  1YFH A;  2LF8 A;  3RPU A;  2VN2 A;  1IXS B;  3O2P E;  5E1W A;  1AOY A;  1I6X A;  4R79 A;  5FB2 A;  2BYV E;  2RDP A;  3CDH A;  1ON1 A;  2K27 A;  1PP7 U;  3Q9S A;  4YIF A;  2DBB A;  2RGV A;  4DNC A;  1W7P B;  1G4D A;  3F3X A;  3P9I A;  4OOI A;  4XLN F;  4E70 A;  1MDM B;  2FA5 A;  1TNT A;  5LHG A;  4CGZ A;  1HXD A;  4Q47 A;  4BQA A;  2Y75 A;  4WXC A;  4EVI A;  2STT A;  3E6M A;  1WKM A;  1YQA A;  5D5X B;  1NHA A;  2JZY A;  1S7O A;  3T1B A;  1FYM A;  1USS A;  2KIM A;  4M9X A;  5E1Z B;  1F1Z A;  4RS8 A;  1T6S A;  1TQP A;  3R6S A;  2XHK A;  1I1S A;  1OKR A;  2L4M A;  2STW A;  5LEK A;  2JTV A;  1XCB A;  2VBW A;  1LQ1 A;  3LQQ A;  2WWY A;  5ILU A;  4HBL A;  4FX0 A;  4ZZL A;  1IW7 F;  4I98 B;  5DYM A;  3J80 Z;  4EJV A;  2XUB A;  3LQR A;  1BC7 C;  3TKY A;  1Z6R A;  3NQO A;  5HDK A;  1ZLK A;  4BXU A;  1WI9 A;  2IP2 A;  1FLI A;  4EJW A;  2FML A;  4ENJ A;  2EB7 A;  1XMK A;  4QLC U;  3U1D A;  3V8J A;  1FP2 A;  2DW4 A;  3EYY A;  3SHF A;  3FXQ A;  4KN7 X;  2BBY A;  3C3W A;  1FC3 A;  4MHG A;  5LGU A;  4HZF A;  3HRU A;  1T2K A;  5ILV A;  4ENN A;  2O03 A;  1O57 A;  1TW2 A;  3DEU A;  3C18 A;  2F5C A;  5K5Q A;  2VC0 A;  5CJ9 A;  1MGT A;  1R00 A;  4HW0 A;  3CTA A;  2Q8K A;  1CGP A;  3QAH A;  5EEH A;  1BI3 A;  2K86 A;  2P7C B;  1ZRC A;  2COM A;  3RI4 A;  4M74 A;  4A0Z A;  2XV4 S;  2F5D A;  3FWE A;  1QZZ A;  3T5X A;  4YFK F;  2H27 A;  4IHT A;  4KDP A;  4UV8 A;  1O3S A;  1YS7 A;  2PEX A;  3BJO A;  1U5T A;  5DEQ A;  1LDD A;  4M71 A;  2P5L C;  4ON0 A;  3E5U A;  5D6F A;  3WGI A;  3H3Z A;  3GVA A;  2HQN A;  2DU9 A;  2AXL A;  1XDS A;  2W84 A;  1K79 A;  3I4P A;  3ZMT A;  2QYO A;  1W5T A;  2Y0M A;  3DPL C;  4Z2Y A;  3IKT A;  1BI2 A;  5D8K B;  2GAU A;  1FSH A;  2GXG A;  1A04 A;  4AWX B;  3KZY A;  3IL2 A;  4CZZ A;  4WWC A;  3ULQ B;  2O6G E;  3ZMZ A;  2M87 A;  1L3L A;  2YPR A;  3K69 A;  3MAJ A;  1BM9 A;  2OQR A;  3AAF A;  3EQL F;  5E20 A;  4S05 A;  4BHP A;  3O6B B;  4OIQ F;  2QBY A;  3LAJ A;  1XGO A;  3W6J B;  3KP7 A;  1RI7 A;  3EDP A;  1D3Y A;  4HQM A;  3B02 A;  2DK5 A;  1UCR A;  3KZZ A;  1RZ4 A;  5ICG A;  2DK8 A;  1HKQ A;  3MZH A;  2FE3 A;  4Y17 A;  3IHU A;  1R7J A;  2JRT A;  2O3F A;  1C0W A;  4WCG A;  3B73 A;  2VT2 A;  2XAH A;  4LGW A;  1SMY F;  3M8F A;  1D5V A;  1IN5 A;  2F5F A;  2FXA A;  3FM3 A;  1J59 A;  1PDN C;  1YO5 C;  4BH9 A;  1UB9 A;  2A61 A;  2FBH A;  1EH6 A;  3L09 A;  3FMS A;  3HRT A;  1K78 A;  3H92 A;  1J0R A;  5ILS A;  1SD6 A;  1ODD A;  2OA4 A;  3BJA A;  3HTU A;  4IF4 A;  2P7V B;  5HLI A;  2GWR A;  5AIP A;  4EGZ A;  2ETH A;  2FMY A;  2MLG A;  3KP6 A;  3TQN A;  4ZZD A;  2L54 A;  2D1V A;  1B1B A;  2CFX A;  2FU4 A;  1KU7 A;  4Q5S F;  5HLG A;  2Q0O A;  3H3U A;  3SXY A;  3LA7 A;  5J8F A;  4EMS A;  5ICE A;  3WTY C;  5D5W B;  2UXN A;  4U7D A;  4RB0 A;  2ZFW A;  1T98 A;  4B8X A;  1Y0U A;  3U2R A;  3F8B A;  2IPQ X;  4ENK A;  1IN4 A;  3ZMU A;  1U78 A;  4G7O F;  2MLK A;  1KGS A;  3KFW X;  2VE8 A;  1FYL A;  2RNJ A;  5LHH A;  5H6Q A;  4UVC A;  4XRF A;  4M6Y A;  2YX7 A;  3FXU A;  6PAX A;  3RYP A;  3L2C A;  3ERE D;  3DP7 A;  4L9V A;  2P5V A;  3KEO A;  4HA8 A;  1R1T A;  3J80 K;  1WSU A;  3R4K A;  1MKM A;  4HV6 A;  2DT5 A;  5EEG A;  2K7L A;  4LB5 A;  1ZGJ A;  1YW7 A;  5F64 A;  2CQK A;  4IRG A;  2HGC A;  3F8M A;  1XD7 A;  3GWZ A;  5ICF A;  1F4K A;  1FOK A;  3VOE A;  3N4M A;  2Y48 A;  1XSD A;  3KLN A;  4M9Z A;  1XDU A;  3HSR A;  2M30 A;  2CYY A;  3L9F A;  1LDK B;  2V1U A;  3WTX C;  5LHI A;  4GCV A;  1HW2 A;  1SFE A;  3QPT A;  2BE5 F;  2DFI A;  2X4H A;  3HHH A;  3CJN A;  3CUQ C;  3Q9V A;  4HF0 A;  3V7S A;  5BS6 A;  2HFH A;  2VOO A;  2CO5 A;  1FY7 A;  2QQA A;  4M9S A;  4A0X A;  1O7L A;  1P4X A;  2OAZ A;  3FF5 A;  2ISY A;  3WOD F;  3F22 A;  4U0W A;  2K4J A;  1CF7 B;  1R5H A;  1XGN A;  3WTT C;  5BMZ A;  2ZJ2 A;  1MD0 A;  2A5Y B;  2QVO A;  4IPA A;  5K5R A;  2J5P A;  4PCQ A;  3T8R A;  1MJA A;  2QQB A;  3LA3 A;  4LJZ F;  2ACJ A;  3REO A;  4KNY A;  4BYY A;  1W4M A;  1DDN A;  1OYW A;  3CUQ B;  2V79 A;  2QZ8 A;  2EA4 A;  2WTE A;  5DUK A;  1XSV A;  4HF1 A;  3ELK A;  5K5O A;  3TOA A;  3M7G A;  3QP5 A;  2BV6 A;  2DAO A;  2IVM A;  3ZMV A;  3C1D A;  3ZPL A;  5DD4 A;  5L3E A;  2GIV A;  5JHU A;  5DD8 A;  4A0Y A;  3E5Q A;  1YTY A;  4L9J A;  1XN7 A;  2V6C A;  2KJB A;  2UWM A;  4XSX F;  1REP C;  1IRG A;  2YX4 A;  5K1Y A;  3MQ0 A;  1W7P A;  4EJO A;  1KQ9 A;  3G3Z A;  4UXN A;  4ENM A;  4O3M A;  4RAY A;  1R5G A;  3EUH A;  4ESB A;  1W5S A;  1QGP A;  4G8X A;  1JHH A;  3KP2 A;  4LLL A;  2ZCW A;  2RC4 A;  1IN8 A;  1STZ A;  3TDU C;  2EFP A;  1J2X A;  5FD6 A;  5KK1 A;  2XRN A;  4MQV A;  1SMT A;  2W57 A;  2Z3Y A;  4AIJ A;  5D5V B;  1UST A;  1ZAO A;  1V3F A;  2FQ3 A;  2HEO A;  4A2U A;  2FEZ A;  5E8G A;  5A2Q Z;  2Z99 A;  2PI0 A;  3HOS A;  2HKO A;  1EH8 A;  4R1H A;  4LK0 F;  2B0L A;  2P8T A;  4RB2 C;  4ETS A;  1SFX A;  2D45 A;  3IRR A;  1F9N A;  2PG4 A;  4LD5 A;  5DCF A;  4UVB A;  2L01 A;  1ZYR F;  1ZH5 A;  2K02 A;  1TNS A;  3WU1 B;  3MFK A;  3IWF A;  4GYG A;  3K1N A;  3WE2 A;  5LBQ A;  3GFL A;  4G7H F;  4ASN A;  1ZG1 A;  3I5U A;  2HTS A;  4NQW A;  4I0B A;  2WC2 A;  2V1D A;  3F21 A;  1K6O A;  1J5Y A;  3SZP A;  5F1R A;  4KYW A;  2G9W A;  5LGN A;  1MJ9 A;  5ERI A;  1P4W A;  2XAQ A;  2PLY A;  5FLX Z;  3K2Z A;  3BJ6 A;  3BP8 A;  5H6R A;  3ECO A;  1X3U A;  2F2E A;  3CLO A;  3TO9 A;  4RGR A;  5L3B A;  2GXB A;  2QM3 A;  3SQN A;  5HLH A;  2O61 A;  3E3V A;  4O5V A;  3E6D A;  2JSC A;  1KQ8 A;  3BZ6 A;  2EFQ A;  4L0Y B;  2BEO A;  5CVU A;  5J8C A;  1W7P D;  4HX7 A;  4G6D A;  2GQQ A;  3ABU A;  4OMZ A;  5D8L B;  1DPR A;  2F5E A;  3RDI A;  2EV0 A;  2MA3 A;  2WV0 A;  4G6Q A;  3LWF A;  3GXO A;  4WXH A;  4P96 A;  1BOA A;  4Y15 A;  1SD4 A;  2NNN A;  3FZV A;  4EJU A;  4KIC A;  2ZME B;  2PJP A;  3JW4 A;  3M8E A;  1E17 A;  1BI0 A;  1B59 A;  3QU6 A;  5DCM A;  5FD5 A;  4NHJ A;  2EFO A;  3VOD A;  5CVR A;  3HUG A;  1UHW A;  3DFG A;  3R61 A;  4RB1 A;  3F8N A;  2Q2E A;  3WU0 A;  3LAP A;  2OZ6 A;  2FOK A;  4S04 A;  3IRQ A;  2K4B A;  4K2E A;  1FP1 D;  3GUD A;  4A6D A;  1SFU A;  1U8R A;  1S6L A;  5LGT A;  1ZGA A;  2JT1 A;  2L4A A;  4BHB A;  5HOO A;  4I02 A;  4OMY A;  1ZRD A;  1ONV A;  5IT3 A;  3BDD A;  3ZP5 A;  4OIN F;  1HSJ A;  2CSO A;  1ZLJ A;  4LB6 B;  1FNN A;  2FRH A;  3GFI A;  5TRD A;  3WTV C;  2R7F A;  4CHU A;  4JQF A;  2M45 A;  3F8C A;  3KLO A;  4U0Y A;  2HYF A;  3PFI A;  3COA C;  3J81 Z;  2QQ9 A;  2CG4 A;  1T0F A;  4GYI A;  4HLY A;  1ZG5 A;  3BWG A;  4GO1 A;  1KU2 A;  3MWM A;  1VTN C;  1DP7 P;  4L5J A;  5BOX A;  3I0T A;  2ZXJ A;  4IJA A;  2UZK A;  3K1P A;  5IT9 Z;  4HYE A;  1G3S A;  1OYI A;  5TJJ A;  3KP3 A;  3RKY A;  1R1V A;  2TDX A;  2PQ8 A;  1BI1 A;  3HHG A;  4P9F A;  4F7Z A;  2FBK A;  1MJB A;  3CUO A;  3V8L A;  3GW2 A;  1Z1D A;  2OQG A;  2NAZ A;  2LNB A;  5CVV A;  4WF2 A;  5FO5 A;  2JPB A;  5E18 F;  5HDN A;  1LNW A;  3F6O A;  4FX4 A;  1U6G A;  1G3Y A;  3CO7 C;  4L18 B;  5E17 F;  2LKP A;  2A07 F;  1FWZ A;  2M8E A;  3I53 A;  2HKX A;  3S2W A;  1IN6 A;  3RKX A;  2L02 A;  2P5K A;  3WTU C;  4HLX A;  1K7A A;  2OZU A;  5HS7 A;  2VBZ A;  2J5O A;  4CDG A;  4N9I A;  2XIG A;  1JXS A;  4HX8 A;  1GXQ A;  4MQ9 F;  2PMU A;  1FT9 A;  1B9N A;  4IHS A;  4EM1 A;  2Z33 A;  4M73 A;  4KIF A;  4KUM A;  5L3G A;  3HOT A;  3GFJ A;  1K78 B;  3M1E A;  2ADU A;  1S8N A;  4N9H A;  4XBF A;  3KP4 A;  1OR7 A;  3PQJ A;  4A5M A;  5FGM A;  5CYV A;  2DQL A;  4EM0 B;  2C6Y A;  4YII A;  1Z05 A;  5A2Q K;  1R58 A;  4L9N A;  2O8X A;  1IN7 A;  5ICC A;  4IRH A;  4EGY A;  1P92 A;  5E8I A;  2VBY A;  5HS8 A;  1BBY A;  2IT0 A;  1QBJ A;  1RUN A;  2CWE A;  2NS0 A;  5D5U B;  2Z9O A;  3TOB A;  4IRI A;  4G7Z F;  1OPC A;  2HZT A;  2OD5 A;  2W25 A;  4MNU A;  4I01 A;  2A68 F;  1SD7 A;  2IW5 A;  2HDC A;  4LG0 A;  1QO0 D;  1DPU A;  3ZQ7 A;  1R23 A;  5D6E A;  4L0Z B;  2RQP A;  5FLX K;  3V7C A;  5DDG A;  4ZYH A;  1YLF A;  1IXC A;  3T8T A;  3QPH A;  5FFX A;  5JFR A;  1O3R A;  3NEU A;  3JTH A;  4OU0 A;  4RB3 C;  4GGG A;  1FYK A;  3RYR A;  2IJL A;  1RUO A;  4HF2 A;  1XGM A;  2GA2 A;  2RVC A;  1YS6 A;  1CF7 A;  1XSX A;  4XLP F;  4KA4 A;  1H9G A;  3TDZ C;  2CW0 F;  2M5W A;  3P7N A;  1BN5 A;  1HW5 A;  1RIO H;  4LMY A;  4UUV A;  3I71 A;  3P9C A;  3ML6 A;  2RKH A;  3CUQ A;  4MEX F;  2XKO A;  3FM5 A;  3JAM K;  3HIF A;  1TLH B;  4HQE A;  2VON A;  1B9M A;  4UHT A;  3MZY A;  2VC1 A;  3GEZ A;  2XVC A;  2DPD A;  3E97 A;  4CYD A;  2ZKZ A;  5HS9 A;  1P4A A;  2E1C A;  1XB4 A;  4KN4 X;  1ZAR A;  1LVA A;  3QU3 A;  3E6C C;  1J75 A;  1ZRF A;  1FBU A;  2FF4 A;  4OIO F;  2W24 A;  3JSO A;  4RGS A;  1V4R A;  3I59 B;  1IUY A;  1KU9 A;  3CO6 C;  2HWV A;  1ZN2 A;  1LEB A;  1U3E M;  5JVT A;  3N97 A;  5DV5 A;  4YFX F;  3HTS B;  3ISP A;  3ZN1 A;  2R3S A;  1GHC A;  1TW3 A;  3IKV A;  2E7W A;  2GA1 A;  3RIR A;  1GVJ A;  3G73 A;  3MCZ A;  1MDM A;  2OBP A;  4WX9 A;  1HBX G;  3J81 K;  4EV0 A;  2HTJ A;  2DTR A;  4FHT A;  3BRO A;  1IF1 A;  3I54 A;  1BIB A;  3BPX A;  2D1H A;  2VE9 A;  4RGU A;  5IT9 K;  4HAM A;  3JTG A;  3L00 A;  4M6X A;  2H6B A;  5LLQ A;  2IRF G;  1F5T A;  4KT5 C;  1OYY A;  5D4S A;  2XKP A;  1SAX A;  2PMH A;  1YIO A;  3BY6 A;  1L0O C;  3C7J A;  3HSE A;  1LB2 A;  1UHM A;  1LEA A;  4YG2 F;  1QNT A;  1HST A;  2E7X A;  1QPM A;  1QZY A;  4RGX A;  4LLG F;  3DV8 A;  2BGC A;  3GYH X;  4ESF A;  2P6T A;  4G94 A;  3IC7 A;  1D8K A;  1Z7U A;  1G3W A;  4WXD A;  2PN6 A;  3FXR A;  2EK5 A;  2NRA C;  4UVA A;  4O6J A;  3DF8 A;  1BIA A;  1ULY A;  2FSW A;  1EV7 A;  4JK1 X;  2P6S A;  2R7D A;  2FNA A;  3K1M A;  3RPQ A;  2ESN A;  2VT3 A;  3E6B A;  3VB2 A;  3D5L A;  4U88 A;  4A6E A;  1YYV A;  4KIG A;  2M1B A;  1JGS A;  3O3K A;  1R22 A;  2W85 A;  3WG9 A;  2FNP A;  2EA2 A;  2HR3 A;  1T39 A;  2ISZ A;  4XSZ F;  5AON A;  4UNO A;  4U7B A;  4MEY F;  1O7F A;  4PGH A;  2XAF A;  1YW8 A;  3TO6 A;  1S3J A;  4ZYG A;  2ZBK A;  4U0V A;  3HSF A;  5E1X A;  3K9T A;  2XGX A;  3WGG A; 
#chains in the Genus database with same CATH topology
 1SEU A;  1V55 H;  2KRF A;  2VOD A;  4CXF A;  3DTI A;  4B1R A;  4DW6 A;  3FX3 A;  2R7Q A;  3LOC A;  4RAZ A;  1UEL B;  2GBY A;  1FSE A;  4J19 A;  2ZME A;  3I64 A;  1Z9C A;  2A3S A;  1WCM J;  2L3D A;  1KQ0 A;  5BPI A;  1P6R A;  1U5T C;  4GFB A;  3WTZ A;  2YSR A;  4UB6 C;  2QLZ A;  4HNU A;  1D8J A;  2OC6 A;  2IA0 A;  5DM7 F;  1KU3 A;  5GP9 A;  4XNF A;  1XPX A;  4IHV A;  2E71 A;  4TV7 A;  3U9G A;  1J9I A;  1KON A;  4ZYD A;  4ZYE A;  1VQ6 I;  3M9A A;  3V7R A;  3GZ5 A;  3CES A;  1J7K A;  3JAM Z;  4N0B A;  2G0E A;  3MKL A;  1IV8 A;  2JPC A;  4XOP A;  3VFZ A;  3KYD B;  3KCC A;  4GXO A;  5DUI A;  4XRS A;  1FBQ A;  4PFP A;  3I55 I;  1PP8 F;  4PJN A;  1A35 A;  3EET A;  4P9U A;  2PFB A;  4AIK A;  2YR2 A;  1A6I A;  4M72 A;  1MBG A;  1WQ2 A;  2KIF A;  3BTI A;  4MGR A;  1N77 A;  2EJR A;  4FTH A;  3PJR A;  4BQN A;  1QPI A;  2P4W A;  5B1B H;  4EM2 A;  3GX4 X;  1MBE A;  3SZT A;  1ZHF A;  2FBI A;  3D0S A;  1VQO I;  2UXX A;  2Z16 A;  3VEP A;  4BDY A;  2KHM A;  4HDU A;  4D7M A;  3DPT A;  3KYL A;  1DP3 A;  1HDD C;  1SVL A;  1U5T B;  1S29 A;  1TQI A;  2DQR A;  5BQT A;  1VF9 A;  2WAD A;  4G9Y A;  1B6A A;  1IZ1 A;  2D2W A;  4CZC A;  1D0X A;  3PIP F;  5HLT A;  4ZH4 F;  2ZNZ A;  2WAF A;  2CJJ A;  4BJ6 C;  1IXR C;  1Y6I A;  4OIP F;  1B4A A;  4DZP A;  1I27 A;  2WY7 Q;  2KLO A;  5DCM B;  2B7E A;  2IGM A;  1JHF A;  2W00 A;  4EQQ A;  3V4G A;  3PL8 A;  3F72 A;  3S16 J;  1OFC X;  4UUS B;  3LSJ A;  3K70 C;  2HQ5 A;  2LF7 A;  2VPL A;  1E3P A;  3HYI A;  4XKV A;  5E79 C;  1FIA A;  3ZMD A;  1LJ9 A;  1JTY A;  4AD9 A;  2O0Y A;  3CCL I;  1BJZ A;  4E7H A;  1Y8R B;  4P55 A;  3QOD A;  3RTR A;  1LDJ A;  1X4P A;  3KEQ A;  4B09 A;  3BQZ A;  4QWQ A;  1R1U A;  2WB1 N;  1XMA A;  2BVL A;  1T0F C;  1TTY A;  2YU3 A;  3MKZ A;  3L2V A;  5FKL A;  2EV6 A;  3K0L A;  2BW3 A;  3AG3 H;  4LIU A;  2NNY A;  2X1D A;  2Z5U A;  3E1S A;  2O7O A;  3Q0W A;  2MH2 A;  1MMS A;  2QUF A;  3R60 A;  1AWC A;  1MW7 A;  4PJM A;  1YIT I;  2Y9Y A;  4LFU A;  2A69 F;  4L9T A;  4DIQ A;  5FKN A;  4BGD A;  1JKO C;  2ELJ A;  3IUO A;  2QBY B;  3HXL A;  4I0A A;  3LL7 A;  3WTS C;  2H6C A;  3ZMS A;  3K4J A;  4KMU X;  4MTE A;  1UFM A;  1TWC J;  2LBF A;  3FHZ A;  3IWZ A;  2NVY J;  3FMR A;  3K10 A;  3U21 A;  2L9V A;  5F0C A;  4J00 A;  2DPU A;  1CQT A;  2XAJ A;  3P9K A;  1WWX A;  5FLV A;  2JA8 J;  5ED4 A;  1YE9 A;  2XRO A;  3CLQ A;  1F43 A;  1BC8 C;  2CRG A;  1HKS A;  1IG7 A;  1VQ8 I;  1KYZ A;  3F23 A;  1YW9 A;  2EZH A;  1G59 A;  3J7A O;  2WAQ N;  5LEJ A;  3JSP A;  2VJI A;  3DBH B;  2DMP A;  2E60 A;  1FIP A;  1R36 A;  2QGU A;  2XB0 X;  4JX5 A;  1RNL A;  4KIB A;  4CH7 A;  1WH7 A;  1LFU P;  3HPG A;  2IA2 A;  2VBX A;  2VJ5 A;  5CVI A;  1QA6 A;  2PBI A;  1IUF A;  2ZB9 A;  1I50 J;  2XAG A;  2L9N A;  1UMQ A;  3OS2 A;  3DXJ F;  4EEF G;  2HQA A;  2MD5 A;  1H0M A;  2CGP A;  1AA7 A;  4MFE A;  4BJ5 C;  2EV5 A;  3ZGK A;  4ZJZ A;  3GZ6 A;  1MMA A;  4DYQ A;  4XRM A;  4D0P A;  5J6X A;  3RJP A;  2Q1Z B;  4BBR J;  3CCJ I;  3DTK A;  1FX7 A;  4PDK A;  3WGH A;  5M5X J;  1JE8 A;  1P9Q C;  3K4N A;  4IVN A;  2PX9 A;  2AXT C;  3MEX A;  1AU7 A;  1YRN B;  3OYF A;  2EIM H;  2ESH A;  3PNT A;  1RKW A;  5K7Z A;  3H5N A;  3R0A A;  3JRH A;  2GM4 A;  2NVX J;  2IBD A;  3I58 A;  4U87 A;  3ZRG A;  2LOO A;  4WK8 F;  4DYC A;  4UV9 A;  1LPQ A;  3HOZ J;  4BNC A;  5CLS A;  1S7A A;  3CMA I;  4YFN F;  4BHC A;  1PUE E;  1FPQ A;  4II3 A;  1JUS A;  3RKW A;  1MZB A;  4Y33 A;  2EFN A;  2DLL A;  5IYB J;  1E2X A;  4PSX A;  4I99 C;  4AVP A;  3H9G A;  5BPD A;  5H20 A;  2ZO4 A;  3ZN0 A;  3S17 J;  2HYG D;  4N4O B;  2Z1D A;  3GFM A;  5LRR A;  3F8F A;  3BTC A;  4E7L A;  5HDG A;  3HRM A;  2BHY A;  1ON2 A;  3SFZ A;  1RKT A;  4IOC F;  5CVJ A;  3E5X A;  2DI3 A;  4XRS G;  2RRE A;  2DA6 A;  3OOU A;  2ZSI B;  1HF0 A;  1LVK A;  1EH7 A;  2CS3 A;  2W1O A;  1RR8 C;  1PUF B;  4EJT A;  4X1E A;  2MH9 A;  1JJ8 C;  2RN7 A;  4XLF A;  5FFZ A;  2XPU A;  5C4J J;  2PJR A;  2GXA A;  2A5W A;  2DFF A;  1XCV A;  1HQC A;  3ROU A;  3SFI A;  3GLX A;  3FMQ A;  2WAQ A;  4BU2 A;  3QPL A;  2JWT A;  4L5I A;  3K4B A;  2L0K A;  3MVP A;  2IGK A;  2HQR A;  3ECH A;  3W6K B;  4J01 A;  3S3O A;  4OAY A;  3HC7 A;  4Y13 A;  3KET A;  3EPZ A;  2CQN A;  2A6H F;  2L7Z A;  2VUM J;  3FK6 A;  5B3S H;  4MO7 A;  2HOE A;  2KIU A;  1DUX C;  2ZSH B;  4IEJ A;  3OV8 A;  4V2G A;  3KIO A;  3GTL J;  2EIN H;  3CDI A;  4RM2 A;  1YG2 A;  2NS8 A;  3TL4 X;  3EUA A;  2JA5 J;  1OCP A;  3ABT A;  4LK1 F;  3ABM H;  1WGX A;  2RV8 A;  4MTD A;  1D1B A;  4XLE A;  5K7H A;  5KVR A;  3OOP A;  1N25 A;  1TQM A;  3LNQ A;  1MSE C;  2DMN A;  3LST A;  2XAS A;  2ECC A;  2XGC A;  4HRI A;  4I7H A;  1FBS A;  3D5R C;  3BPV A;  3WTW C;  3NRV A;  1Z3Y A;  2ID6 A;  4E4H A;  2E1O A;  3KE2 A;  3JRA A;  2MSY A;  2LY2 A;  2VXZ A;  1IAW A;  5HVQ C;  4G12 A;  4BY7 J;  3FHN A;  5LRS A;  3WE3 A;  1IO2 A;  2LY9 A;  1H9T A;  2HS5 A;  1O3Q A;  4PZJ A;  4CIC A;  3HEF A;  3S1R J;  1V54 H;  2IA1 A;  1HKT A;  3OYC A;  3PQK A;  1GXP A;  2LSO A;  2H94 A;  3DKY A;  3WG7 H;  4RLQ A;  2HPM A;  3B6A A;  1G6N A;  5TGT A;  2QEN A;  1B72 B;  3JRF A;  2H09 A;  1DGR M;  2K9L A;  1I1G A;  2DO7 A;  1YJW I;  5EYR A;  2NYX A;  4P5O A;  5L3C A;  5F0H A;  3EYI A;  1J09 A;  2VKE A;  4CO8 A;  4XM3 A;  1W36 C;  4AIH A;  1D0Y A;  3FBI B;  5J4V A;  4BXF A;  5D4R A;  4I09 A;  4LG0 B;  3G1O A;  1OMI A;  1WJB A;  4OIR F;  3CJQ B;  4UUT A;  3LA2 A;  1BR1 A;  2DMT A;  1I5Z A;  2OU2 A;  3L2W A;  3E0J B;  3O8H A;  1G2H A;  4IHW A;  1TBX A;  4ESJ A;  3M4O J;  3T0Y A;  3W3C A;  1BJA A;  1Z91 A;  2XB5 A;  4V19 K;  3S1N J;  1VQ7 I;  3V8K A;  5E3M A;  1SVO A;  1FZP B;  2V26 A;  3GTQ J;  3BOQ A;  2V9V A;  4Q48 A;  5F27 A;  3JRB A;  2PMZ N;  5EJC A;  1ZEL A;  2V1X A;  2CUJ A;  5F6F A;  2ZJP F;  2X0L A;  4A12 A;  2KJC A;  3F6V A;  1IRZ A;  2G7H A;  4Q4Z F;  3TO7 A;  2G7U A;  4A3E J;  3KP5 A;  1R4N B;  4ZTF A;  3J7A Y;  4HV5 A;  2KL4 A;  2MC3 A;  4XOT A;  4I76 A;  2I8D A;  4ZDL A;  2HVR A;  2HDD A;  2A6E F;  1ZRE A;  1Z6T A;  5L3F A;  1XGS A;  2VKD A;  1A31 A;  4JBA A;  1SAU A;  3DKW A;  2AS5 F;  1HW1 A;  1OLT A;  1IRF A;  3I59 A;  1YI2 I;  5IYD J;  2EWN A;  2OPT A;  4RBO A;  1X4O A;  4RAG A;  3OYM A;  3TGN A;  4A5N A;  1Q1H A;  4BAY A;  3GZN B;  2HNH A;  2V1N A;  3QP6 A;  4HX4 A;  2X48 A;  3M3Y J;  3QYE A;  5KAI C;  4CCN A;  1SD5 A;  4I2O A;  2ZXH A;  4F91 B;  1P2F A;  1XG1 A;  2BZT A;  5CPR B;  5AIQ A;  2ELH A;  3LFK A;  4R8H A;  3QRF F;  1KA8 A;  1WRJ A;  2QWW A;  1EA3 A;  4HST A;  4IXA A;  2LDU A;  5E3N A;  5JI6 A;  2OTJ I;  5L3D A;  3U1K A;  3TED A;  3L2U A;  2NVT J;  2M8G X;  3ONQ A;  4D1Q A;  4RM3 A;  5LD2 C;  3LSI A;  2X6O A;  2FQ4 A;  3A1Y A;  3HKZ A;  1LE8 B;  2KKO A;  4FT8 A;  4LLN A;  2AQE A;  3DQV C;  3QOP A;  1G3T A;  3VDX A;  2GZW A;  2X51 A;  1QQI A;  2ZNY A;  1SAN A;  4HNV A;  1U2W A;  2MBF A;  2LLK A;  4KFC A;  4NB5 A;  5JR3 A;  2DYS H;  2KZG A;  3AL0 C;  1ZG3 A;  3HRS A;  5M3M J;  4DYR A;  5CQE A;  4H0E A;  3GO5 A;  3OYD A;  5EG0 A;  4IZZ A;  4RDU A;  3M07 A;  1B8I B;  2EFW A;  1R9T J;  2CUF A;  1DU0 A;  2CW7 A;  2L2O A;  2LP0 A;  4BUP A;  4Y52 J;  3R0J A;  5LFA A;  2H1K A;  4KMF A;  4Y3O A;  5DS9 A;  4BS9 A;  4PGG A;  1O3T A;  4HOB A;  4JOM A;  1KYW A;  3NAR A;  2E1N A;  3Q5F A;  4HDV A;  3QPS A;  3HOW J;  4YEL A;  3H0G J;  4MLO A;  1R71 A;  1T38 A;  3GF2 A;  4DQ2 A;  2VOP A;  2IXS A;  1T8I A;  2XF7 A;  3L7W A;  1GV5 A;  1YFH A;  4MFD A;  2VL8 A;  4E7I A;  3DWL E;  2LF8 A;  3RPU A;  2VN2 A;  5CKT A;  1IXS B;  3HOV J;  3O2P E;  5E1W A;  1AOY A;  1I6X A;  5E3L A;  4R79 A;  5FB2 A;  2BYV E;  2JA6 J;  2RDP A;  3CDH A;  1ON1 A;  2K27 A;  2LFB A;  1PP7 U;  3JRE A;  3Q9S A;  4E6K G;  4YIF A;  2DBB A;  2RGV A;  4DNC A;  3S3N A;  1ETQ A;  3CCV I;  3CMY A;  1R4M B;  1W7P B;  1G4D A;  4BAC A;  3JRC A;  3F3X A;  3VYS B;  3AL0 B;  3P9I A;  1TWG J;  3CC2 I;  4OOI A;  4XLN F;  1OCO H;  4E70 A;  4NDL A;  2R7R A;  1MDM B;  2FA5 A;  1MIJ A;  1RET A;  1TNT A;  5LHG A;  3W2A A;  4CGZ A;  1HXD A;  4Q47 A;  1YJ9 I;  1ETX A;  4BQA A;  2Y75 A;  1JTX A;  4WXC A;  4EVI A;  2STT A;  3E6M A;  1WKM A;  1YQA A;  4QPQ A;  5D5X B;  3FXJ A;  1NHA A;  1YOV B;  2JZY A;  1S7O A;  1PYV A;  3T1B A;  1FYM A;  3C2B A;  1WH5 A;  1USS A;  2KIM A;  4FE7 A;  3OYE A;  2QEX I;  4M9X A;  5E1Z B;  3NAU A;  1F1Z A;  3MKY B;  4RS8 A;  3D1N I;  1X3Z B;  1T6S A;  1TQP A;  3R6S A;  2XHK A;  1I1S A;  1OKR A;  1DU6 A;  3FK7 A;  3S93 A;  2ZJR F;  2VB6 A;  1K6Y A;  3HZJ A;  2L4M A;  2STW A;  3LSM A;  2DA4 A;  2CFO A;  4RA2 A;  2BXZ A;  2DT7 B;  5LEK A;  2LYC A;  1FOW A;  1T08 B;  2JTV A;  1H8A C;  1JI8 A;  1W0U A;  4RMN A;  1XCB A;  4V2F A;  2VBW A;  1WZ2 A;  1QVU A;  1ZGW A;  5EZG A;  4Z6Y A;  2QF7 A;  2CH0 A;  1LQ1 A;  2LKS A;  3LSR A;  3AFH A;  2LRD A;  3LQQ A;  5J3L A;  4BBS J;  1VQN I;  2BY2 A;  2WWY A;  5ILU A;  3ZXS A;  4HBL A;  4FX0 A;  3DKX A;  4ZZL A;  1IW7 F;  4I98 B;  5DYM A;  1X2M A;  5EGO A;  4YIR X;  3J80 Z;  3I4N J;  1JGG A;  3PO3 J;  4EJV A;  2XPV A;  2XUB A;  3LQR A;  1BC7 C;  3TKY A;  1Z6R A;  3NQO A;  5KNL A;  5HDK A;  2K5C A;  2HVQ A;  2KMU A;  2WBM A;  3DCF A;  1ZLK A;  3A2K A;  3S2H J;  2I10 A;  4BL0 B;  4BXU A;  1WI9 A;  1X1P A;  2IP2 A;  1FLI A;  4EJW A;  2FML A;  4ENJ A;  2EB7 A;  1XMK A;  2E2H J;  4QLC U;  3L1P A;  3U1D A;  3V8J A;  1FP2 A;  3Q0V A;  2DW4 A;  4M6V A;  5FKK A;  3HBL A;  3OYN A;  3EYY A;  4YRV A;  1R49 A;  3SHF A;  3FXQ A;  4ABZ A;  3I3L A;  4AUX A;  2L9S A;  2Y0S A;  3H5R A;  1QRY A;  5E3O A;  4KN7 X;  4NQW B;  4C2T A;  1ZQ3 P;  2K9N A;  1MBK A;  2BBY A;  3K2A A;  3ZQI A;  3WU2 C;  3C3W A;  1FC3 A;  2LD5 A;  4MHG A;  5LGU A;  4HZF A;  5F08 A;  3HRU A;  2CU7 A;  2JVH A;  4PJJ A;  1T2K A;  3AG2 H;  2DA5 A;  5ILV A;  2LK2 A;  4PSW A;  4ENN A;  2O03 A;  1O57 A;  1RR7 A;  1TW2 A;  3DEU A;  3C18 A;  3DTE A;  4PFO A;  3G1M A;  2OV7 A;  2F5C A;  5K5Q A;  2VC0 A;  5CJ9 A;  2H1L A;  2OCE A;  2ZME C;  4E7J A;  1MGT A;  1R00 A;  2MW8 A;  4HW0 A;  1I3A A;  2B63 J;  2B9S A;  3CTA A;  2Q8K A;  1X58 A;  1CGP A;  1DGW Y;  3BR0 A;  3QAH A;  5HNH A;  2IS2 A;  5EEH A;  3FKJ A;  3A02 A;  1BI3 A;  2K86 A;  4XK4 A;  2P7C B;  2X9D A;  2VKH A;  1ZRC A;  1A5J A;  2COM A;  3RI4 A;  4A3F J;  3RZO J;  1Z3X A;  4M74 A;  4A0Z A;  2VQC A;  2XV4 S;  2F5D A;  3H5A A;  3FWE A;  4N4N B;  1QZZ A;  3T5X A;  4BQO A;  3RPU D;  1WVR A;  3HOU J;  4YFK F;  2H27 A;  4RLF A;  4IHT A;  4KDP A;  2VIX A;  4HNT A;  4UV8 A;  4UY8 I;  1O3S A;  3OSG A;  1YS7 A;  2PEX A;  3BJO A;  1U5T A;  5DEQ A;  1LDD A;  2JUG A;  2M4K A;  4A3G J;  2BY3 A;  4M71 A;  4IOA F;  3CCU I;  2P5L C;  2CV0 A;  1I3Q J;  4ON0 A;  3ZQQ A;  3E5U A;  5D6F A;  3WGI A;  3H3Z A;  5GAG J;  3GVA A;  2DMU A;  1UZC A;  2R5Z B;  3E7L A;  2HQN A;  4B43 A;  2OUM A;  2DU9 A;  4CCL A;  2AXL A;  1XDS A;  2W84 A;  1K79 A;  4UUS A;  3CCR I;  3CCS I;  2R7V A;  3OIQ A;  3I4P A;  3ZMT A;  2R5Y B;  2QYO A;  2COB A;  1W5T A;  2LMD A;  2Y0M A;  3DPL C;  4Z2Y A;  3IKT A;  1BI2 A;  5D8K B;  2GAU A;  1FSH A;  2GXG A;  1A04 A;  2FD5 A;  4AWX B;  3KZY A;  3IL2 A;  4CZZ A;  4WWC A;  2XSD C;  4RAF A;  4XLA A;  4QTR A;  3ULQ B;  2O6G E;  1OCT C;  1U9N A;  3ZMZ A;  2M87 A;  1L3L A;  4F3Q A;  3GTG J;  2YPR A;  4CCJ A;  1S72 I;  3HUG B;  3K69 A;  2MC4 A;  3MAJ A;  3MMY B;  4JYK A;  3OS0 A;  1BM9 A;  3W6V A;  2OQR A;  1ACI A;  1IJW C;  3AAF A;  3EQL F;  5E20 A;  2L7K A;  3CJR B;  2Q2E B;  4G6T B;  4S05 A;  4BHP A;  4FET A;  3EUK L;  3O6B B;  5FKO A;  4OIQ F;  2QBY A;  3LAJ A;  4X6A J;  4I6Z A;  1XGO A;  3W6J B;  4BE2 A;  5FKM A;  3LSK A;  1XMX A;  3A0B C;  3BTL A;  2DFE A;  2LRE A;  4CSW A;  3RSN A;  3BG9 A;  5IYC J;  3KP7 A;  1RI7 A;  3EDP A;  1D3Y A;  4HQM A;  3BC8 A;  3A01 B;  1AHD P;  3J7Z I;  2M7A A;  3B02 A;  1TT0 A;  3BT9 A;  2DK5 A;  1UCR A;  2OJE D;  5J1Y A;  2FUG 2;  3KZZ A;  2LH9 A;  1VND A;  2F6C A;  2UUZ A;  1RZ4 A;  5ICG A;  2ZFU A;  2DK8 A;  1HKQ A;  5J1R A;  3MZH A;  2FE3 A;  4HSR A;  3IHU A;  4Y17 A;  1R7J A;  2FX0 A;  2JRT A;  3GLL A;  1FOY A;  4BE0 A;  2O3F A;  1QU3 A;  1C0W A;  3OMY A;  4XLH A;  1S9H A;  1VI0 A;  4WCG A;  3B73 A;  1LFB A;  2VT2 A;  2XAH A;  4LGW A;  1SMY F;  1NG6 A;  3CMM A;  4S0H B;  3TP0 A;  1FTZ A;  4HEA 2;  3M8F A;  1D5V A;  2JA7 J;  3OYA A;  1XC5 A;  1IN5 A;  2F5F A;  1ETK A;  2FXA A;  3FM3 A;  1JKQ C;  1J59 A;  4QPO A;  2ZXI A;  2V9P A;  1PDN C;  1Y0N A;  2DYR H;  2QSG X;  3ASO H;  1YO5 C;  1D1A A;  4AID A;  4Y4R A;  4BH9 A;  2LR8 A;  4IO9 F;  1K83 J;  1QHG A;  2HI3 A;  1UB9 A;  3LFU A;  2A61 A;  2ELK A;  2LBF B;  5B66 C;  4C3J J;  1X1C A;  2FBH A;  1ITY A;  1EH6 A;  3K6G A;  3L09 A;  2KQR A;  1X2N A;  3BLY A;  5FJ8 J;  3SEQ A;  3Q0U A;  2KRH A;  3Q3S A;  3ZQF A;  2ICW G;  3FMS A;  3HRT A;  4LIT A;  3JRD A;  3M8J A;  3DEE A;  1K78 A;  3H92 A;  1J0R A;  5ILS A;  1SD6 A;  1ODD A;  2OA4 A;  3BJA A;  1PJR A;  1IV6 A;  2E5N A;  3HTU A;  4IF4 A;  2P7V B;  5HLI A;  2GWR A;  5AIP A;  4BXX J;  4EGZ A;  2ETH A;  2FMY A;  1MBF A;  2MLG A;  4MIM A;  1NK2 P;  5IOY A;  3KP6 A;  3TQN A;  4ZZD A;  2L54 A;  1MND A;  2D1V A;  2MG4 A;  1OR7 C;  3FDY A;  2M9H A;  3FBN B;  1B1B A;  2AO9 A;  2CFX A;  5J40 A;  2FU4 A;  4AYB A;  3IV5 A;  4FE4 A;  1KU7 A;  2DA2 A;  1SC7 A;  5HLG A;  4Q5S F;  2Q0O A;  3H3U A;  3SXY A;  3LA7 A;  4XN3 A;  1MH4 A;  1FEX A;  2BHZ A;  5J8F A;  4C2U A;  4EMS A;  3CF5 F;  5ICE A;  3WTY C;  5D5W B;  2UXN A;  3VSK A;  2EBI A;  4U7D A;  4RB0 A;  1ZR2 A;  2VQH A;  2ZFW A;  3DLL F;  4BJT A;  2VI6 A;  1T98 A;  4B8X A;  3K4M A;  3CD6 I;  1Y0U A;  3U2R A;  4YEJ A;  3F8B A;  4C30 A;  4B48 A;  2IPQ X;  3LSP A;  4ENK A;  1IN4 A;  3L2Q A;  2Y31 A;  1T33 A;  3ZMU A;  3PNY A;  1U78 A;  4G7O F;  2A6T A;  2MLK A;  1KGS A;  3GTJ J;  3KFW X;  5JHF A;  2VE8 A;  1FYL A;  2RNJ A;  5LHH A;  1ETV A;  5H6Q A;  3ASN H;  1U8B A;  2L5Q A;  4UVC A;  1UJ8 A;  5JVG F;  4XRF A;  4M6Y A;  2Z2S B;  3ZR8 X;  2DJN A;  2YX7 A;  5M5W J;  3FXU A;  3OL3 A;  3UKG A;  4B4C A;  1OJL A;  6PAX A;  3RYP A;  3OYI A;  3GME A;  3VYT B;  2M34 A;  4QSH A;  3MD2 A;  2F48 A;  5GTH C;  3L2C A;  3ERE D;  1OCC H;  3DP7 A;  4L9V A;  2P5V A;  2CV2 A;  3KEO A;  2AHQ A;  4JP0 A;  4HA8 A;  1R1T A;  3CCY A;  3J80 K;  3G4S I;  2KZV A;  1WSU A;  2TCT A;  2XAU A;  3R4K A;  1MKM A;  4HG2 A;  3LMM A;  4HV6 A;  3G2B A;  1B72 A;  2HYJ A;  2IGN A;  2DT5 A;  4M3E A;  2K7L A;  5EEG A;  2K40 A;  3OR1 C;  4LB5 A;  1ZGJ A;  2H8R A;  1YW7 A;  5F64 A;  4CYC B;  4LG3 A;  2CQK A;  2DOD A;  2A05 A;  4IRG A;  9ANT A;  2HGC A;  3F8M A;  1XD7 A;  3GWZ A;  2HOS A;  1GDT A;  5ICF A;  5KHD A;  3DLA A;  4UB8 C;  1F4K A;  2XSJ C;  3B6C A;  1FOK A;  3VOE A;  3N4M A;  2Y48 A;  1XSD A;  3W2V A;  3KLN A;  4ITV A;  2EIL H;  3HKZ N;  2KDZ A;  4M9Z A;  1XDU A;  4A3C J;  3HSR A;  4ZC3 A;  3RQ4 A;  2M30 A;  1AKH B;  2CYY A;  3L9F A;  1LDK B;  3KEY A;  1H88 C;  2NOG A;  2V1U A;  3WTX C;  1T56 A;  5LHI A;  4GCV A;  3PUB A;  4B3X A;  2LG4 A;  1HW2 A;  4KIT B;  3TW7 A;  3DEW A;  3QWL A;  1SFE A;  4IHY A;  3QPT A;  2LVS A;  1A36 A;  2BE5 F;  2O8K A;  2BVM A;  2DFI A;  1D0Z A;  3H9Q A;  2NVU B;  2X4H A;  3HHH A;  3CJN A;  3CUQ C;  3UNG C;  3Q9V A;  4HF0 A;  4D5C A;  3V7S A;  5BS6 A;  4QIW N;  2HFH A;  2VOO A;  2CO5 A;  2Y2Z A;  3HG9 A;  1YHQ I;  4CA0 A;  1FY7 A;  3PNV A;  5B5E C;  2L9R A;  2QQA A;  1IGN A;  2XDV A;  4M9S A;  4A0X A;  3OY9 A;  1O7L A;  1P4X A;  2OAZ A;  1OIS A;  3FF5 A;  2ISY A;  3GBG A;  3WOD F;  3CDL A;  3F22 A;  2R0Q C;  4U0W A;  2K4J A;  1CF7 B;  1R5H A;  1XGN A;  2V4J C;  3WTT C;  5BMZ A;  2ZJ2 A;  4ZDO A;  1YX3 A;  2XGD A;  3G6E I;  3IH2 A;  1MD0 A;  2JSP A;  2A5Y B;  2ZXW H;  2QVO A;  4IPA A;  1Z7L A;  2KDO A;  2W48 A;  3FXM A;  4IQJ A;  5K5R A;  1MBJ A;  2J5P A;  4PCQ A;  3T8R A;  1MJA A;  2QQB A;  1BR4 A;  3LA3 A;  1LE8 A;  1T95 A;  1MSF C;  4LJZ F;  2ACJ A;  3REO A;  4KNY A;  2WY8 Q;  3ZCO A;  3CCE I;  4BYY A;  2E35 A;  1W4M A;  4L5E A;  4XKC A;  1DDN A;  1OYW A;  3CUQ B;  2V79 A;  1Y1W J;  2QZ8 A;  2EA4 A;  2WTE A;  3ERM A;  5DUK A;  1XSV A;  3DPU A;  3LSH A;  4HF1 A;  4AM3 A;  3ELK A;  5K5O A;  1B8I A;  3TOA A;  3M7G A;  3QP5 A;  2BV6 A;  2DAO A;  5GAE J;  2IVM A;  3ZMV A;  3C1D A;  3ZPL A;  1VQM I;  5DD4 A;  5L3E A;  2XF5 A;  2GIV A;  5JHU A;  4BQQ A;  5DD8 A;  2M3A A;  4A0Y A;  5J1U A;  4EAT A;  3E5Q A;  1YTY A;  2XRL A;  4L9J A;  2JK3 A;  1XN7 A;  2V6C A;  2KJB A;  1QZE A;  2RNG A;  2UWM A;  4XSX F;  1X1A A;  1REP C;  1IRX A;  2E36 A;  2R7X A;  3S1Q J;  1IRG A;  2DOE A;  3GCM A;  2YX4 A;  3CQZ J;  5K1Y A;  3MQ0 A;  5IP7 J;  1R6R A;  1W7P A;  4EJO A;  2R93 J;  2MGQ A;  1KQ9 A;  1MNE A;  1ZTR A;  4FAS D;  2XGE A;  3G3Z A;  4UXN A;  4ENM A;  2HOT A;  4O3M A;  4RAY A;  5FRO A;  3D5S C;  1R5G A;  3VSL A;  3EUH A;  4BDZ A;  4IQ4 A;  4ESB A;  1W5S A;  1QGP A;  1G8X A;  4G8X A;  3I4M J;  2Y0S N;  4GDF A;  2WV1 A;  3MKW B;  1JHH A;  3KP2 A;  4LLL A;  2ZCW A;  3DU6 A;  2RC4 A;  1WPK A;  1IN8 A;  1STZ A;  1Y8Q B;  3TDU C;  2EFP A;  4D7N A;  1NH3 A;  1J2X A;  1PVE A;  2DTZ A;  5FD6 A;  5KK1 A;  2ID3 A;  2XRN A;  3OWT A;  2R7T A;  3UR3 C;  4MQV A;  1SMT A;  2W57 A;  2Z3Y A;  4AIJ A;  5D5V B;  1UST A;  1ZAO A;  1SVM A;  5BNG A;  3ABL H;  1V3F A;  2FQ3 A;  2HEO A;  4A2U A;  2FEZ A;  1BW6 A;  5E8G A;  2GOX B;  2E2I J;  3CP8 A;  5A2Q Z;  2Z99 A;  1FOX A;  1N75 A;  2PI0 A;  3H1C A;  3HOS A;  2HKO A;  1EH8 A;  4R1H A;  1BOB A;  4LK0 F;  5IP9 J;  2B0L A;  2TRT A;  4XLC A;  2P8T A;  4RB2 C;  4ETS A;  1SFX A;  4XN0 A;  3IRR A;  2D45 A;  1F9N A;  2PG4 A;  2R4G A;  4LD5 A;  1UG2 A;  1Q1V A;  1Y1V J;  2IGO A;  5DCF A;  4UVB A;  2L01 A;  1ZYR F;  1MMN A;  1ZH5 A;  4DOZ A;  3OYH A;  2K02 A;  1TNS A;  3WU1 B;  3S3M A;  2KRC A;  4CUG A;  3L2R A;  4DGW B;  2EPF A;  3MFK A;  3IWF A;  3K4C A;  4GYG A;  3K1N A;  3WE2 A;  3CP2 A;  3GFL A;  5LBQ A;  4G7H F;  4ASN A;  4LIV A;  3OYG A;  1ZG1 A;  3DU5 A;  1TWF J;  3OIP A;  5CQG A;  3I5U A;  2KIQ A;  2HTS A;  4NQW A;  4I0B A;  2DA1 A;  2XPW A;  2QSH X;  2O5R A;  2UV1 A;  2WC2 A;  2V1D A;  3F21 A;  1K6O A;  3IAS 2;  2DA7 A;  1J5Y A;  2W82 A;  2HPI A;  3BG7 A;  3SZP A;  1GLN A;  3SEZ A;  1WJF A;  2E1M C;  5F1R A;  4KYW A;  2G9W A;  3TBI A;  1MJ9 A;  2W4S A;  5LGN A;  1TT5 B;  2N8G A;  3A0H C;  5EEA A;  2F4M B;  5ERI A;  4H4K C;  1P4W A;  2XAQ A;  2PLY A;  5FLX Z;  3K2Z A;  3CC7 I;  3BJ6 A;  3BP8 A;  1D5Y A;  3C2G A;  3BR6 A;  3M1C A;  5H6R A;  2AQF A;  2V7F A;  1Y39 A;  1W5C C;  3ECO A;  1X3U A;  2MAB A;  2JVG A;  1VQ5 I;  2F2E A;  1MNM C;  3CLO A;  3TO9 A;  3ZQG A;  3HJE A;  1FMV A;  4RGR A;  1SFO J;  5EZH A;  1Z77 A;  3HB9 A;  2IS6 A;  5L3B A;  2GXB A;  2QM3 A;  3ZQH A;  5C44 J;  2Y30 A;  4OWR B;  3NWS A;  3SQN A;  5HLH A;  2O61 A;  3E3V A;  4O5V A;  1I6H J;  2QCO A;  3E6D A;  2JSC A;  3BTJ A;  3QYF A;  1KQ8 A;  3BZ6 A;  3PIO F;  1YIJ I;  2EFQ A;  4L0Y B;  4IHX A;  4C9Y A;  2BEO A;  3S32 A;  5CVU A;  2VAS A;  3CME I;  5J8C A;  4E7Z A;  3BR3 A;  2LKX A;  4XMY A;  3HPH A;  1TP4 A;  1W7P D;  4HX7 A;  4IX7 A;  4G6D A;  2NXN B;  2KFD A;  2GQQ A;  3ABU A;  4CCK A;  4OMZ A;  2CQ7 A;  5D8L B;  4DJA A;  2K9M A;  1DPR A;  1S5L C;  3BCA A;  2F5E A;  3RDI A;  2R5Z A;  2EV0 A;  4XID A;  4BEH B;  1K61 A;  2MA3 A;  3AG4 H;  2WV0 A;  4G6Q A;  3LWF A;  2CQX A;  3GXO A;  3K4L A;  4WXH A;  1V5F A;  4P96 A;  1BOA A;  4XL9 A;  4Y15 A;  4M3B A;  1SD4 A;  3WHB A;  2NNN A;  2JMW A;  3FZV A;  4EJU A;  2R5Y A;  4KIC A;  2ZME B;  2PJP A;  1UHS A;  3JW4 A;  3M8E A;  1W0T A;  1E17 A;  1BI0 A;  1B59 A;  1HLV A;  2MD0 A;  4A69 C;  1RC9 A;  3QU6 A;  5DCM A;  3BZK A;  5FD5 A;  4PUS A;  4NHJ A;  1K4T A;  4JX6 A;  2JN6 A;  2EFO A;  2VQL A;  1U0J A;  1YX5 A;  3BR2 A;  3SDB A;  3VOD A;  1JT0 A;  3A4C A;  1FTT A;  5CVR A;  1RPW A;  3JRI A;  3HUG A;  1UHW A;  3DFG A;  3KX2 A;  3R61 A;  1TL8 A;  5EF6 A;  3H36 A;  4RB1 A;  2GIZ A;  3F8N A;  3KYC B;  4M3F A;  2Q2E A;  3WU0 A;  4BE1 A;  3LAP A;  3F9K A;  2OZ6 A;  2FOK A;  1S7E A;  1APL C;  4S04 A;  3IRQ A;  2K4B A;  4K2E A;  1FP1 D;  3S15 J;  3GUD A;  3OL4 A;  1TWA J;  3BG3 A;  4A6D A;  1SFU A;  1GVD A;  1U8R A;  2ECB A;  2ME6 A;  1XTA A;  1S6L A;  2K3F A;  5LGT A;  1ZGA A;  2JT1 A;  2L4A A;  1MMD A;  4BHB A;  3A01 A;  1FJL A;  5HOO A;  3BCB A;  4I02 A;  4C3I J;  2DA3 A;  2VQG A;  3HGY A;  4OMY A;  3PUF A;  2GLO A;  1ZRD A;  1ONV A;  5IT3 A;  3BDD A;  3ZP5 A;  4OIN F;  1HSJ A;  5KAF C;  2CSO A;  5F1J A;  1ZLJ A;  4LB6 B;  1FNN A;  1OCZ H;  3ESW B;  2BY1 A;  2FRH A;  3GFI A;  2CV1 A;  5TRD A;  4AYB N;  2KT0 A;  3WTV C;  1JUM A;  2R7F A;  4CHU A;  4JQF A;  2M45 A;  3F8C A;  3KLO A;  1FMW A;  4U0Y A;  2HYF A;  3ABK H;  3PFI A;  3COA C;  3J81 Z;  1OCR H;  2QQ9 A;  2CG4 A;  4LOC A;  1T0F A;  4GYI A;  4HLY A;  1ZG5 A;  3BWG A;  4GO1 A;  4ZDP A;  1KU2 A;  3MWM A;  3S14 J;  1JUP A;  2NS7 A;  1VTN C;  1DP7 P;  4L5J A;  5BOX A;  1W1W E;  2CUZ A;  2ZXJ A;  3I0T A;  3OYB A;  4D9J A;  1VFC A;  1EF4 A;  1LKX A;  4IJA A;  2UZK A;  4NBQ A;  3K1P A;  2BW3 B;  5IT9 Z;  4HYE A;  1VQL I;  4A3D J;  1G3S A;  1OYI A;  4C2M J;  2OF7 A;  5TJJ A;  1WFX A;  3KP3 A;  3RKY A;  1R1V A;  2TDX A;  2PQ8 A;  3G1L A;  4D5F A;  1BI1 A;  3HHG A;  4P9F A;  4F7Z A;  2FBK A;  4KT6 A;  4NC7 A;  1MJB A;  3CUO A;  1WJC A;  4B47 A;  3CZ6 A;  1UG0 A;  3V8L A;  3GW2 A;  2R92 J;  1Z1D A;  2OQG A;  2NAZ A;  1HA8 A;  3HL2 A;  3JRG A;  5DM6 F;  2R7Z J;  1M1E B;  2LNB A;  2HDW A;  5HOD A;  2IS1 A;  1YRN A;  1WHU A;  3O8G A;  4A3M J;  1QVT A;  1ZR4 A;  5CVV A;  4WF2 A;  5FO5 A;  3HDD A;  2JPB A;  1POG A;  1NK3 P;  2QKM B;  5E18 F;  5HDN A;  3G71 I;  1LNW A;  1LUJ B;  3F6O A;  4FX4 A;  1U6G A;  1G3Y A;  2VPR A;  4AU7 A;  3VPR A;  2EZL A;  3CO7 C;  2HU9 A;  4L18 B;  5E17 F;  2QQ8 A;  2F5V A;  4HPQ A;  2LKP A;  2JJ7 A;  2A07 F;  1BR2 A;  4A3B J;  1FWZ A;  2F4O B;  2M8E A;  3I53 A;  2ZJQ F;  3P5J A;  2HKX A;  3S2W A;  1IN6 A;  3RKX A;  2L02 A;  2P5K A;  4XR6 A;  1VZ0 A;  3WTU C;  1Z67 A;  4HLX A;  3PM1 A;  3RCO A;  1K7A A;  1OQY A;  2OZU A;  5HS7 A;  2VBZ A;  2O9L A;  4NC8 A;  1MH3 A;  2J5O A;  4CDG A;  2WB1 A;  4N9I A;  2XIG A;  1PUF A;  3NWT A;  3WHC A;  2DMQ A;  1JXS A;  4A3I J;  4HX8 A;  1GXQ A;  4MQ9 F;  2PMU A;  1FT9 A;  1B9N A;  2BOL A;  3W2W A;  1XS9 A;  4IHS A;  4EM1 A;  2Z33 A;  4M73 A;  4KIF A;  2QSF X;  4B3A A;  4KUM A;  5L3G A;  3HOT A;  5M3F J;  3C2H A;  3GFJ A;  1K78 B;  4FCY A;  1I39 A;  3M1E A;  2ADU A;  1S8N A;  4N9H A;  4XBF A;  3KP4 A;  2GOM A;  1V5G A;  3OR2 C;  1VQ4 I;  2LY1 A;  1OR7 A;  4DBR A;  2DXI A;  2K9S A;  1DQU A;  2X1C A;  1IDZ A;  1LFP A;  3PQJ A;  4A5M A;  5J47 A;  2HXO A;  5FGM A;  5CYV A;  4M3D A;  2DQL A;  4EM0 B;  2FJ1 A;  2C6Y A;  2KIS A;  4E7S A;  4YII A;  1Z05 A;  5A2Q K;  1R58 A;  1X1B A;  3HM5 A;  4L9N A;  3SDG A;  2O8X A;  1IN7 A;  3AKZ A;  3JR9 A;  4CCO A;  3TW6 A;  1VQP I;  5ICC A;  1BW5 A;  3OYL A;  4IRH A;  5E8I A;  1P92 A;  4EGY A;  4F55 A;  2VBY A;  5HS8 A;  3K7A J;  1BBY A;  2IT0 A;  3QOE A;  1QBJ A;  3MN2 A;  4CCM A;  1RUN A;  2CWE A;  4DZJ A;  2NS0 A;  5D5U B;  4BKX A;  1RES A;  3HOX J;  4CYC A;  3BG5 A;  4JX4 A;  1F36 A;  3K70 D;  1ERD A;  2PJR B;  2Z9O A;  5IY5 H;  2E19 A;  3TOB A;  2XC7 A;  4IRI A;  3S8P A;  4XQF A;  5GPC A;  1IC8 A;  5M5Y J;  4G7Z F;  1OPC A;  2M0C A;  2HZT A;  1WI3 A;  5IPA A;  2OD5 A;  2W25 A;  5GTI C;  5C4X J;  4MNU A;  4I01 A;  2A68 F;  1XX5 A;  4FQG A;  1SD7 A;  2R7S A;  2WA0 A;  2IW5 A;  3IH4 A;  4A3K J;  2HDC A;  4B44 A;  1AKH A;  2RAE A;  3OYJ A;  1HOM A;  1E3H A;  4LG0 A;  1QO0 D;  2JRM A;  1DPU A;  3S1M J;  3ZQ7 A;  4KJZ A;  1R23 A;  5D6E A;  4L0Z B;  3GTK J;  2RQP A;  5FLX K;  1QHH D;  2EIK H;  3SZG A;  3V7C A;  2LTP A;  2DOF A;  2P0W A;  3IH3 A;  5DDG A;  4ZYH A;  1YLF A;  5F04 A;  3OIO A;  1IXC A;  3T8T A;  1X19 A;  2BY0 A;  2IAI A;  2IEK A;  2Y69 H;  1KZH A;  2CW8 A;  4M3G A;  3QPH A;  2ME0 A;  1HC8 A;  2M7B A;  5FFX A;  1ENH A;  2K3P A;  5JFR A;  2X85 A;  1O3R A;  3NEU A;  2M0M A;  3HGG A;  3JTH A;  3FIS A;  4OU0 A;  3SYT A;  4RB3 C;  2IS4 A;  4GGG A;  1FYK A;  3BR5 A;  3GTO J;  3RYR A;  2IJL A;  1RUO A;  4HF2 A;  2FOW A;  3CCQ I;  1XGM A;  2KPM A;  1ZKG A;  4AC0 A;  2GA2 A;  1WJE A;  3H9J A;  1V5E A;  2RVC A;  2HVS A;  3CJT B;  2DDB A;  4PJL A;  1YS6 A;  2R7W A;  1CF7 A;  1ZK8 A;  1XSX A;  4XLP F;  5GPA A;  4KA4 A;  1H9G A;  1JT6 A;  1A6Q A;  4NUB A;  3TDZ C;  2CW0 F;  2M5W A;  2EZI A;  2KP6 A;  4NC6 A;  3P7N A;  3BR1 A;  5IP6 A;  1BN5 A;  1HW5 A;  1RIO H;  2OCC H;  2DN0 A;  4LMY A;  4UUV A;  2JQ7 A;  2P81 A;  3I71 A;  2YU9 J;  4AVZ A;  1P7I A;  3P9C A;  2EQR A;  3ML6 A;  4DBQ A;  2MFZ A;  3QQA A;  3CC4 I;  2K9Q A;  3ZQL A;  2CMP A;  2RKH A;  2ZC2 A;  4W1U A;  3VYR B;  3CUQ A;  4MEX F;  2HOA A;  2H8W A;  2XKO A;  3FM5 A;  3JAM K;  3HIF A;  4ZYA A;  1TLH B;  4A3J J;  4HQE A;  2X6Y A;  2VON A;  2D5V A;  1B9M A;  4UHT A;  3TP3 A;  2L7F P;  4XOR A;  5FRM A;  3LSG A;  3MZY A;  3N05 A;  4IKF A;  2VC1 A;  3GEZ A;  2XVC A;  3IP4 B;  3I56 I;  2DPD A;  3JCU C;  3HOY J;  2V9K A;  3E97 A;  5HNF A;  1H89 C;  4CYD A;  2ZKZ A;  5HS9 A;  3PFY A;  1P4A A;  2E1C A;  2DT6 A;  3H35 A;  5GAD J;  1XB4 A;  2BXY A;  1ZAR A;  4KN4 X;  1JKP C;  1VQK I;  1LVA A;  3QU3 A;  3E6C C;  1J75 A;  1ZRF A;  3FXO A;  1FBU A;  1UAA A;  2FF4 A;  4OIO F;  2W24 A;  3JSO A;  4RGS A;  1V4R A;  2E2J J;  3I59 B;  1IUY A;  1E0E A;  1KU9 A;  3CO6 C;  1MMG A;  2HWV A;  3PSI A;  2HXI A;  1ZN2 A;  3OS1 A;  1LEB A;  1U3E M;  1VQ9 I;  3RQI A;  3KZI C;  3BQY A;  5H2F C;  5JVT A;  3N97 A;  5DV5 A;  2R7O A;  3PSF A;  4YFX F;  4E7K A;  1NTC A;  3HTS B;  3ISP A;  3ZQC A;  4XKB A;  4Y7N J;  4BY1 J;  3FXK A;  2K85 A;  3SJM A;  3ZN1 A;  2R3S A;  4F52 A;  2LC2 A;  2VKV A;  2Y9Z A;  4XKW A;  3FXL A;  4F92 B;  2DOA A;  1GHC A;  1TW3 A;  3PO2 J;  1P7J A;  2HZD A;  2XF6 A;  4II2 A;  1U9O A;  4P1W A;  3IKV A;  3J7Y J;  2VLA A;  1Y56 A;  5J4Y A;  2E7W A;  2GA1 A;  2F4I A;  3RIR A;  1GVJ A;  3G73 A;  5FRN A;  3MCZ A;  3EUH C;  1WJD A;  2YUS A;  2JUC A;  3GTP J;  1Z21 A;  1MDM A;  2OBP A;  4F93 B;  1EJ9 A;  4WX9 A;  1EKE A;  2E34 A;  1GT0 C;  1HBX G;  3J81 K;  2PMZ A;  4EV0 A;  2VJ4 A;  5C3E J;  2X6W A;  1X3W B;  3RKQ A;  1YJN I;  2HTJ A;  3BG6 A;  1NG7 A;  5EG0 B;  2DTR A;  1ETW A;  4FHT A;  4X0G A;  3BRO A;  1IF1 A;  3F0C A;  3X2Q H;  5JLX A;  3I54 A;  1BIB A;  1Z0X A;  2M4G A;  4XON A;  3BPX A;  2D1H A;  2V6E A;  2VE9 A;  4RGU A;  5EDN A;  3OSF A;  4HAM A;  3JTG A;  5IT9 K;  2X6X A;  2DFH A;  2NVQ J;  3L00 A;  4M6X A;  2H6B A;  5LLQ A;  2QKL B;  2IRF G;  3RZD J;  1TWH J;  1F5T A;  1IDY A;  3I9V 2;  1OYY A;  2XKP A;  4KT5 C;  5D4S A;  5JLW A;  3OYK A;  2QA4 I;  1SAX A;  2PMH A;  1YIO A;  2R7U A;  3BY6 A;  3CCM I;  1TZL A;  4C3H J;  4ZTJ A;  5B1A H;  1L0O C;  2VJJ A;  3C7J A;  4NNJ A;  3HSE A;  1LB2 A;  1UHM A;  1ETY A;  1LEA A;  4YG2 F;  1RRJ A;  3DBL B;  1QNT A;  3DBR B;  1JKR C;  2DJI A;  1HST A;  4GRI A;  3IAM 2;  2E7X A;  4FIS A;  3ZOB A;  1QPM A;  1WJ5 A;  2EZK A;  1QZY A;  1W36 D;  1HCR A;  3KPH A;  4RGX A;  4LLG F;  2CUE A;  2BGC A;  3DV8 A;  3MZ8 A;  3GYH X;  2CQQ A;  4ANJ A;  4ESF A;  5GAH J;  3GTM J;  4A93 J;  1N78 A;  2P6T A;  4G94 A;  3A03 A;  3IC7 A;  5F0F A;  1D8K A;  1Z7U A;  2L7M P;  1G3W A;  3AG1 H;  4WXD A;  2PN6 A;  1MBH A;  4XIC A;  4PK4 A;  3FXR A;  2EK5 A;  1WJA A;  2NRA C;  4UVA A;  5K7F A;  1D1C A;  3H0D A;  2EIJ H;  2W7N A;  4O6J A;  1BL0 A;  3DF8 A;  1BIA A;  2WAE A;  5KCM A;  1ULY A;  1K4S A;  2FSW A;  1EV7 A;  4JK1 X;  2DCE A;  2P6S A;  2RQQ A;  4W97 A;  2R7D A;  2FNA A;  3K1M A;  3RPQ A;  3QYB A;  2ESN A;  5FLM J;  2VT3 A;  4PJ0 C;  3H3V K;  3FIW A;  3E6B A;  3FKI J;  3D5L A;  3VB2 A;  1O4X A;  4U88 A;  3S2D J;  4A6E A;  1YYV A;  4KIG A;  2DDA A;  3CF2 A;  2M1B A;  2M2E A;  1GV2 A;  1GUU A;  1JGS A;  2OTL I;  2X1E A;  3O3K A;  1R22 A;  2W85 A;  1HDP A;  1ORK A;  2MYS A;  3WG9 A;  2FNP A;  2EA2 A;  2E5Z A;  2HR3 A;  3BZC A;  1JJ6 C;  3V42 A;  5EGO B;  1T39 A;  2NOJ B;  2ISZ A;  4IL6 C;  3VYU B;  4XSZ F;  5AON A;  4UNO A;  4U7B A;  2JA2 A;  4MEY F;  4KIS A;  1O7F A;  4PGH A;  2XAF A;  2YS9 A;  1R5I D;  1YW8 A;  5IOZ A;  4A3L J;  2VXD A;  3TMO A;  1SFK A;  2I5U A;  4OAZ A;  1ETO A;  3TO6 A;  1S3J A;  4ZYG A;  2EH3 A;  3K4K A;  2ZBK A;  1X1D A;  1BA5 A;  4U0V A;  5DTD A;  3HSF A;  5E1X A;  1TC3 C;  4BEH A;  3K9T A;  2E1M B;  2XGX A;  5TIS C;  1E3O C;  3VWB A;  3WGG A; 
#chains in the Genus database with same CATH homology
 2KRF A;  2VOD A;  4CXF A;  3FX3 A;  4RAZ A;  1FSE A;  2ZME A;  3I64 A;  1Z9C A;  2A3S A;  2L3D A;  1KQ0 A;  5BPI A;  1P6R A;  1U5T C;  3WTZ A;  2YSR A;  2QLZ A;  1D8J A;  2IA0 A;  1KU3 A;  4TV7 A;  3U9G A;  1J9I A;  4ZYD A;  4ZYE A;  3M9A A;  3V7R A;  3GZ5 A;  1J7K A;  3JAM Z;  4N0B A;  3VFZ A;  2JPC A;  3KCC A;  4GXO A;  5DUI A;  1FBQ A;  1PP8 F;  3EET A;  4P9U A;  2PFB A;  4AIK A;  2YR2 A;  4M72 A;  1WQ2 A;  2KIF A;  4MGR A;  2EJR A;  2P4W A;  4EM2 A;  3GX4 X;  3SZT A;  1ZHF A;  2FBI A;  3D0S A;  2UXX A;  3VEP A;  4HDU A;  3DPT A;  5BQT A;  1U5T B;  1S29 A;  1TQI A;  2DQR A;  4G9Y A;  1B6A A;  1IZ1 A;  2D2W A;  4ZH4 F;  2ZNZ A;  1IXR C;  4OIP F;  1B4A A;  1I27 A;  5DCM B;  4EQQ A;  1JHF A;  3V4G A;  3F72 A;  2LF7 A;  3HYI A;  3ZMD A;  1LJ9 A;  4AD9 A;  2O0Y A;  4P55 A;  3RTR A;  1LDJ A;  3KEQ A;  4B09 A;  4QWQ A;  1R1U A;  1XMA A;  1TTY A;  2YU3 A;  2EV6 A;  3K0L A;  2NNY A;  2Z5U A;  2MH2 A;  2QUF A;  3R60 A;  1AWC A;  4LFU A;  2A69 F;  4L9T A;  2QBY B;  4I0A A;  3WTS C;  2H6C A;  3ZMS A;  4KMU X;  4MTE A;  1UFM A;  3FHZ A;  3IWZ A;  3FMR A;  2DPU A;  2XAJ A;  3P9K A;  1WWX A;  5ED4 A;  2XRO A;  1BC8 C;  1HKS A;  1KYZ A;  3F23 A;  1YW9 A;  3J7A O;  5LEJ A;  3JSP A;  1R36 A;  4KIB A;  1RNL A;  2IA2 A;  2VBX A;  5CVI A;  2PBI A;  2XAG A;  3DXJ F;  2MD5 A;  1H0M A;  2CGP A;  2EV5 A;  3GZ6 A;  4D0P A;  5J6X A;  3RJP A;  1FX7 A;  4PDK A;  3WGH A;  1JE8 A;  4IVN A;  3MEX A;  2ESH A;  3R0A A;  3I58 A;  4WK8 F;  4UV9 A;  4BNC A;  5CLS A;  1S7A A;  4YFN F;  4BHC A;  1PUE E;  1FPQ A;  3RKW A;  1MZB A;  2EFN A;  2DLL A;  1E2X A;  4AVP A;  5BPD A;  5H20 A;  2ZO4 A;  3ZN0 A;  2HYG D;  3GFM A;  5LRR A;  3F8F A;  5HDG A;  3HRM A;  1ON2 A;  3SFZ A;  5CVJ A;  3E5X A;  2DI3 A;  1EH7 A;  4EJT A;  2MH9 A;  2RN7 A;  5FFZ A;  1XCV A;  1HQC A;  3ROU A;  3GLX A;  3FMQ A;  4L5I A;  2HQR A;  3ECH A;  3W6K B;  4Y13 A;  3KET A;  2A6H F;  2HOE A;  2KIU A;  1DUX C;  3OV8 A;  1YG2 A;  3ABT A;  4LK1 F;  2RV8 A;  4MTD A;  5KVR A;  3OOP A;  1TQM A;  3LST A;  2XAS A;  4I7H A;  1FBS A;  3WTW C;  3BPV A;  3NRV A;  3KE2 A;  2VXZ A;  1IAW A;  5HVQ C;  5LRS A;  3WE3 A;  1H9T A;  2HS5 A;  1O3Q A;  4PZJ A;  4CIC A;  2IA1 A;  1HKT A;  3PQK A;  1GXP A;  2LSO A;  2H94 A;  1G6N A;  2QEN A;  2H09 A;  1I1G A;  2DO7 A;  2NYX A;  4P5O A;  5L3C A;  3EYI A;  4CO8 A;  4AIH A;  5D4R A;  4I09 A;  4LG0 B;  1OMI A;  4OIR F;  3LA2 A;  1I5Z A;  2OU2 A;  1TBX A;  4ESJ A;  3T0Y A;  1BJA A;  1Z91 A;  3V8K A;  1FZP B;  3BOQ A;  2V9V A;  4Q48 A;  2V1X A;  5F6F A;  2X0L A;  4A12 A;  2KJC A;  3F6V A;  2G7H A;  4Q4Z F;  3TO7 A;  2G7U A;  3KP5 A;  4HV5 A;  2MC3 A;  2A6E F;  1ZRE A;  1Z6T A;  5L3F A;  1XGS A;  4JBA A;  3DKW A;  2AS5 F;  1HW1 A;  1IRF A;  3I59 A;  2EWN A;  3TGN A;  4A5N A;  1Q1H A;  4BAY A;  4HX4 A;  3QP6 A;  4I2O A;  1SD5 A;  1P2F A;  5AIQ A;  2ELH A;  3LFK A;  4R8H A;  3QRF F;  1KA8 A;  1WRJ A;  2QWW A;  4IXA A;  2LDU A;  5JI6 A;  5L3D A;  2KKO A;  4FT8 A;  4LLN A;  3DQV C;  3QOP A;  1G3T A;  2GZW A;  1QQI A;  2ZNY A;  1U2W A;  2MBF A;  4KFC A;  4NB5 A;  5JR3 A;  1ZG3 A;  3HRS A;  4H0E A;  3GO5 A;  2EFW A;  3R0J A;  4KMF A;  4PGG A;  1O3T A;  4HOB A;  1KYW A;  3Q5F A;  2E1N A;  4HDV A;  1T38 A;  3GF2 A;  4DQ2 A;  2VOP A;  3L7W A;  1YFH A;  2LF8 A;  3RPU A;  2VN2 A;  1IXS B;  3O2P E;  5E1W A;  1AOY A;  1I6X A;  4R79 A;  5FB2 A;  2BYV E;  2RDP A;  3CDH A;  1ON1 A;  2K27 A;  1PP7 U;  3Q9S A;  4YIF A;  2DBB A;  2RGV A;  4DNC A;  1W7P B;  1G4D A;  3F3X A;  3P9I A;  4OOI A;  4XLN F;  4E70 A;  1MDM B;  2FA5 A;  1TNT A;  5LHG A;  4CGZ A;  1HXD A;  4Q47 A;  4BQA A;  2Y75 A;  4WXC A;  4EVI A;  2STT A;  3E6M A;  1WKM A;  1YQA A;  5D5X B;  1NHA A;  2JZY A;  1S7O A;  3T1B A;  1FYM A;  1USS A;  2KIM A;  4M9X A;  5E1Z B;  1F1Z A;  4RS8 A;  1T6S A;  1TQP A;  3R6S A;  2XHK A;  1I1S A;  1OKR A;  2L4M A;  2STW A;  5LEK A;  2JTV A;  1XCB A;  2VBW A;  1LQ1 A;  3LQQ A;  2WWY A;  5ILU A;  4HBL A;  4FX0 A;  4ZZL A;  1IW7 F;  4I98 B;  5DYM A;  3J80 Z;  4EJV A;  2XUB A;  3LQR A;  1BC7 C;  3TKY A;  1Z6R A;  3NQO A;  5HDK A;  1ZLK A;  4BXU A;  1WI9 A;  2IP2 A;  1FLI A;  4EJW A;  2FML A;  4ENJ A;  2EB7 A;  1XMK A;  4QLC U;  3U1D A;  3V8J A;  1FP2 A;  2DW4 A;  3EYY A;  3SHF A;  3FXQ A;  4KN7 X;  2BBY A;  3C3W A;  1FC3 A;  4MHG A;  5LGU A;  4HZF A;  3HRU A;  1T2K A;  5ILV A;  4ENN A;  2O03 A;  1O57 A;  1TW2 A;  3DEU A;  3C18 A;  2F5C A;  5K5Q A;  2VC0 A;  5CJ9 A;  1MGT A;  1R00 A;  4HW0 A;  3CTA A;  2Q8K A;  1CGP A;  3QAH A;  5EEH A;  1BI3 A;  2K86 A;  2P7C B;  1ZRC A;  2COM A;  3RI4 A;  4M74 A;  4A0Z A;  2XV4 S;  2F5D A;  3FWE A;  1QZZ A;  3T5X A;  4YFK F;  2H27 A;  4IHT A;  4KDP A;  4UV8 A;  1O3S A;  1YS7 A;  2PEX A;  3BJO A;  1U5T A;  5DEQ A;  1LDD A;  4M71 A;  2P5L C;  4ON0 A;  3E5U A;  5D6F A;  3WGI A;  3H3Z A;  3GVA A;  2HQN A;  2DU9 A;  2AXL A;  1XDS A;  2W84 A;  1K79 A;  3I4P A;  3ZMT A;  2QYO A;  1W5T A;  2Y0M A;  3DPL C;  4Z2Y A;  3IKT A;  1BI2 A;  5D8K B;  2GAU A;  1FSH A;  2GXG A;  1A04 A;  4AWX B;  3KZY A;  3IL2 A;  4CZZ A;  4WWC A;  3ULQ B;  2O6G E;  3ZMZ A;  2M87 A;  1L3L A;  2YPR A;  3K69 A;  3MAJ A;  1BM9 A;  2OQR A;  3AAF A;  3EQL F;  5E20 A;  4S05 A;  4BHP A;  3O6B B;  4OIQ F;  2QBY A;  3LAJ A;  1XGO A;  3W6J B;  3KP7 A;  1RI7 A;  3EDP A;  1D3Y A;  4HQM A;  3B02 A;  2DK5 A;  1UCR A;  3KZZ A;  1RZ4 A;  5ICG A;  2DK8 A;  1HKQ A;  3MZH A;  2FE3 A;  4Y17 A;  3IHU A;  1R7J A;  2JRT A;  2O3F A;  1C0W A;  4WCG A;  3B73 A;  2VT2 A;  2XAH A;  4LGW A;  1SMY F;  3M8F A;  1D5V A;  1IN5 A;  2F5F A;  2FXA A;  3FM3 A;  1J59 A;  1PDN C;  1YO5 C;  4BH9 A;  1UB9 A;  2A61 A;  2FBH A;  1EH6 A;  3L09 A;  3FMS A;  3HRT A;  1K78 A;  3H92 A;  1J0R A;  5ILS A;  1SD6 A;  1ODD A;  2OA4 A;  3BJA A;  3HTU A;  4IF4 A;  2P7V B;  5HLI A;  2GWR A;  5AIP A;  4EGZ A;  2ETH A;  2FMY A;  2MLG A;  3KP6 A;  3TQN A;  4ZZD A;  2L54 A;  2D1V A;  1B1B A;  2CFX A;  2FU4 A;  1KU7 A;  4Q5S F;  5HLG A;  2Q0O A;  3H3U A;  3SXY A;  3LA7 A;  5J8F A;  4EMS A;  5ICE A;  3WTY C;  5D5W B;  2UXN A;  4U7D A;  4RB0 A;  2ZFW A;  1T98 A;  4B8X A;  1Y0U A;  3U2R A;  3F8B A;  2IPQ X;  4ENK A;  1IN4 A;  3ZMU A;  1U78 A;  4G7O F;  2MLK A;  1KGS A;  3KFW X;  2VE8 A;  1FYL A;  2RNJ A;  5LHH A;  5H6Q A;  4UVC A;  4XRF A;  4M6Y A;  2YX7 A;  3FXU A;  6PAX A;  3RYP A;  3L2C A;  3ERE D;  3DP7 A;  4L9V A;  2P5V A;  3KEO A;  4HA8 A;  1R1T A;  3J80 K;  1WSU A;  3R4K A;  1MKM A;  4HV6 A;  2DT5 A;  5EEG A;  2K7L A;  4LB5 A;  1ZGJ A;  1YW7 A;  5F64 A;  2CQK A;  4IRG A;  2HGC A;  3F8M A;  1XD7 A;  3GWZ A;  5ICF A;  1F4K A;  1FOK A;  3VOE A;  3N4M A;  2Y48 A;  1XSD A;  3KLN A;  4M9Z A;  1XDU A;  3HSR A;  2M30 A;  2CYY A;  3L9F A;  1LDK B;  2V1U A;  3WTX C;  5LHI A;  4GCV A;  1HW2 A;  1SFE A;  3QPT A;  2BE5 F;  2DFI A;  2X4H A;  3HHH A;  3CJN A;  3CUQ C;  3Q9V A;  4HF0 A;  3V7S A;  5BS6 A;  2HFH A;  2VOO A;  2CO5 A;  1FY7 A;  2QQA A;  4M9S A;  4A0X A;  1O7L A;  1P4X A;  2OAZ A;  3FF5 A;  2ISY A;  3WOD F;  3F22 A;  4U0W A;  2K4J A;  1CF7 B;  1R5H A;  1XGN A;  3WTT C;  5BMZ A;  2ZJ2 A;  1MD0 A;  2A5Y B;  2QVO A;  4IPA A;  5K5R A;  2J5P A;  4PCQ A;  3T8R A;  1MJA A;  2QQB A;  3LA3 A;  4LJZ F;  2ACJ A;  3REO A;  4KNY A;  4BYY A;  1W4M A;  1DDN A;  1OYW A;  3CUQ B;  2V79 A;  2QZ8 A;  2EA4 A;  2WTE A;  5DUK A;  1XSV A;  4HF1 A;  3ELK A;  5K5O A;  3TOA A;  3M7G A;  3QP5 A;  2BV6 A;  2DAO A;  2IVM A;  3ZMV A;  3C1D A;  3ZPL A;  5DD4 A;  5L3E A;  2GIV A;  5JHU A;  5DD8 A;  4A0Y A;  3E5Q A;  1YTY A;  4L9J A;  1XN7 A;  2V6C A;  2KJB A;  2UWM A;  4XSX F;  1REP C;  1IRG A;  2YX4 A;  5K1Y A;  3MQ0 A;  1W7P A;  4EJO A;  1KQ9 A;  3G3Z A;  4UXN A;  4ENM A;  4O3M A;  4RAY A;  1R5G A;  3EUH A;  4ESB A;  1W5S A;  1QGP A;  4G8X A;  1JHH A;  3KP2 A;  4LLL A;  2ZCW A;  2RC4 A;  1IN8 A;  1STZ A;  3TDU C;  2EFP A;  1J2X A;  5FD6 A;  5KK1 A;  2XRN A;  4MQV A;  1SMT A;  2W57 A;  2Z3Y A;  4AIJ A;  5D5V B;  1UST A;  1ZAO A;  1V3F A;  2FQ3 A;  2HEO A;  4A2U A;  2FEZ A;  5E8G A;  5A2Q Z;  2Z99 A;  2PI0 A;  3HOS A;  2HKO A;  1EH8 A;  4R1H A;  4LK0 F;  2B0L A;  2P8T A;  4RB2 C;  4ETS A;  1SFX A;  2D45 A;  3IRR A;  1F9N A;  2PG4 A;  4LD5 A;  5DCF A;  4UVB A;  2L01 A;  1ZYR F;  1ZH5 A;  2K02 A;  1TNS A;  3WU1 B;  3MFK A;  3IWF A;  4GYG A;  3K1N A;  3WE2 A;  5LBQ A;  3GFL A;  4G7H F;  4ASN A;  1ZG1 A;  3I5U A;  2HTS A;  4NQW A;  4I0B A;  2WC2 A;  2V1D A;  3F21 A;  1K6O A;  1J5Y A;  3SZP A;  5F1R A;  4KYW A;  2G9W A;  5LGN A;  1MJ9 A;  5ERI A;  1P4W A;  2XAQ A;  2PLY A;  5FLX Z;  3K2Z A;  3BJ6 A;  3BP8 A;  5H6R A;  3ECO A;  1X3U A;  2F2E A;  3CLO A;  3TO9 A;  4RGR A;  5L3B A;  2GXB A;  2QM3 A;  3SQN A;  5HLH A;  2O61 A;  3E3V A;  4O5V A;  3E6D A;  2JSC A;  1KQ8 A;  3BZ6 A;  2EFQ A;  4L0Y B;  2BEO A;  5CVU A;  5J8C A;  1W7P D;  4HX7 A;  4G6D A;  2GQQ A;  3ABU A;  4OMZ A;  5D8L B;  1DPR A;  2F5E A;  3RDI A;  2EV0 A;  2MA3 A;  2WV0 A;  4G6Q A;  3LWF A;  3GXO A;  4WXH A;  4P96 A;  1BOA A;  4Y15 A;  1SD4 A;  2NNN A;  3FZV A;  4EJU A;  4KIC A;  2ZME B;  2PJP A;  3JW4 A;  3M8E A;  1E17 A;  1BI0 A;  1B59 A;  3QU6 A;  5DCM A;  5FD5 A;  4NHJ A;  2EFO A;  3VOD A;  5CVR A;  3HUG A;  1UHW A;  3DFG A;  3R61 A;  4RB1 A;  3F8N A;  2Q2E A;  3WU0 A;  3LAP A;  2OZ6 A;  2FOK A;  4S04 A;  3IRQ A;  2K4B A;  4K2E A;  1FP1 D;  3GUD A;  4A6D A;  1SFU A;  1U8R A;  1S6L A;  5LGT A;  1ZGA A;  2JT1 A;  2L4A A;  4BHB A;  5HOO A;  4I02 A;  4OMY A;  1ZRD A;  1ONV A;  5IT3 A;  3BDD A;  3ZP5 A;  4OIN F;  1HSJ A;  2CSO A;  1ZLJ A;  4LB6 B;  1FNN A;  2FRH A;  3GFI A;  5TRD A;  3WTV C;  2R7F A;  4CHU A;  4JQF A;  2M45 A;  3F8C A;  3KLO A;  4U0Y A;  2HYF A;  3PFI A;  3COA C;  3J81 Z;  2QQ9 A;  2CG4 A;  1T0F A;  4GYI A;  4HLY A;  1ZG5 A;  3BWG A;  4GO1 A;  1KU2 A;  3MWM A;  1VTN C;  1DP7 P;  4L5J A;  5BOX A;  3I0T A;  2ZXJ A;  4IJA A;  2UZK A;  3K1P A;  5IT9 Z;  4HYE A;  1G3S A;  1OYI A;  5TJJ A;  3KP3 A;  3RKY A;  1R1V A;  2TDX A;  2PQ8 A;  1BI1 A;  3HHG A;  4P9F A;  4F7Z A;  2FBK A;  1MJB A;  3CUO A;  3V8L A;  3GW2 A;  1Z1D A;  2OQG A;  2NAZ A;  2LNB A;  5CVV A;  4WF2 A;  5FO5 A;  2JPB A;  5E18 F;  5HDN A;  1LNW A;  3F6O A;  4FX4 A;  1U6G A;  1G3Y A;  3CO7 C;  4L18 B;  5E17 F;  2LKP A;  2A07 F;  1FWZ A;  2M8E A;  3I53 A;  2HKX A;  3S2W A;  1IN6 A;  3RKX A;  2L02 A;  2P5K A;  3WTU C;  4HLX A;  1K7A A;  2OZU A;  5HS7 A;  2VBZ A;  2J5O A;  4CDG A;  4N9I A;  2XIG A;  1JXS A;  4HX8 A;  1GXQ A;  4MQ9 F;  2PMU A;  1FT9 A;  1B9N A;  4IHS A;  4EM1 A;  2Z33 A;  4M73 A;  4KIF A;  4KUM A;  5L3G A;  3HOT A;  3GFJ A;  1K78 B;  3M1E A;  2ADU A;  1S8N A;  4N9H A;  4XBF A;  3KP4 A;  1OR7 A;  3PQJ A;  4A5M A;  5FGM A;  5CYV A;  2DQL A;  4EM0 B;  2C6Y A;  4YII A;  1Z05 A;  5A2Q K;  1R58 A;  4L9N A;  2O8X A;  1IN7 A;  5ICC A;  4IRH A;  4EGY A;  1P92 A;  5E8I A;  2VBY A;  5HS8 A;  1BBY A;  2IT0 A;  1QBJ A;  1RUN A;  2CWE A;  2NS0 A;  5D5U B;  2Z9O A;  3TOB A;  4IRI A;  4G7Z F;  1OPC A;  2HZT A;  2OD5 A;  2W25 A;  4MNU A;  4I01 A;  2A68 F;  1SD7 A;  2IW5 A;  2HDC A;  4LG0 A;  1QO0 D;  1DPU A;  3ZQ7 A;  1R23 A;  5D6E A;  4L0Z B;  2RQP A;  5FLX K;  3V7C A;  5DDG A;  4ZYH A;  1YLF A;  1IXC A;  3T8T A;  3QPH A;  5FFX A;  5JFR A;  1O3R A;  3NEU A;  3JTH A;  4OU0 A;  4RB3 C;  4GGG A;  1FYK A;  3RYR A;  2IJL A;  1RUO A;  4HF2 A;  1XGM A;  2GA2 A;  2RVC A;  1YS6 A;  1CF7 A;  1XSX A;  4XLP F;  4KA4 A;  1H9G A;  3TDZ C;  2CW0 F;  2M5W A;  3P7N A;  1BN5 A;  1HW5 A;  1RIO H;  4LMY A;  4UUV A;  3I71 A;  3P9C A;  3ML6 A;  2RKH A;  3CUQ A;  4MEX F;  2XKO A;  3FM5 A;  3JAM K;  3HIF A;  1TLH B;  4HQE A;  2VON A;  1B9M A;  4UHT A;  3MZY A;  2VC1 A;  3GEZ A;  2XVC A;  2DPD A;  3E97 A;  4CYD A;  2ZKZ A;  5HS9 A;  1P4A A;  2E1C A;  1XB4 A;  4KN4 X;  1ZAR A;  1LVA A;  3QU3 A;  3E6C C;  1J75 A;  1ZRF A;  1FBU A;  2FF4 A;  4OIO F;  2W24 A;  3JSO A;  4RGS A;  1V4R A;  3I59 B;  1IUY A;  1KU9 A;  3CO6 C;  2HWV A;  1ZN2 A;  1LEB A;  1U3E M;  5JVT A;  3N97 A;  5DV5 A;  4YFX F;  3HTS B;  3ISP A;  3ZN1 A;  2R3S A;  1GHC A;  1TW3 A;  3IKV A;  2E7W A;  2GA1 A;  3RIR A;  1GVJ A;  3G73 A;  3MCZ A;  1MDM A;  2OBP A;  4WX9 A;  1HBX G;  3J81 K;  4EV0 A;  2HTJ A;  2DTR A;  4FHT A;  3BRO A;  1IF1 A;  3I54 A;  1BIB A;  3BPX A;  2D1H A;  2VE9 A;  4RGU A;  5IT9 K;  4HAM A;  3JTG A;  3L00 A;  4M6X A;  2H6B A;  5LLQ A;  2IRF G;  1F5T A;  4KT5 C;  1OYY A;  5D4S A;  2XKP A;  1SAX A;  2PMH A;  1YIO A;  3BY6 A;  1L0O C;  3C7J A;  3HSE A;  1LB2 A;  1UHM A;  1LEA A;  4YG2 F;  1QNT A;  1HST A;  2E7X A;  1QPM A;  1QZY A;  4RGX A;  4LLG F;  3DV8 A;  2BGC A;  3GYH X;  4ESF A;  2P6T A;  4G94 A;  3IC7 A;  1D8K A;  1Z7U A;  1G3W A;  4WXD A;  2PN6 A;  3FXR A;  2EK5 A;  2NRA C;  4UVA A;  4O6J A;  3DF8 A;  1BIA A;  1ULY A;  2FSW A;  1EV7 A;  4JK1 X;  2P6S A;  2R7D A;  2FNA A;  3K1M A;  3RPQ A;  2ESN A;  2VT3 A;  3E6B A;  3VB2 A;  3D5L A;  4U88 A;  4A6E A;  1YYV A;  4KIG A;  2M1B A;  1JGS A;  3O3K A;  1R22 A;  2W85 A;  3WG9 A;  2FNP A;  2EA2 A;  2HR3 A;  1T39 A;  2ISZ A;  4XSZ F;  5AON A;  4UNO A;  4U7B A;  4MEY F;  1O7F A;  4PGH A;  2XAF A;  1YW8 A;  3TO6 A;  1S3J A;  4ZYG A;  2ZBK A;  4U0V A;  3HSF A;  5E1X A;  3K9T A;  2XGX A;  3WGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...