2L54A

Solution structure of the zalpha domain mutant of adar1 (n43a,y47a)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
YQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEIARVLASLAKKGKLQKEAGTPPLWKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternate rRNA secondary structures as regulators of translation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Double-stranded RNA-specific adenosine deaminase
total genus 17
structure length 63
sequence length 63
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2010-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l54A00
4BHBA 2V1XA 3JAMZ 5DUIA 1ZGJA 2CFXA 2DK5A 2P5KA 2Q0OA 4ESFA 5FB2A 4N0BA 3SZPA 3DQVC 4KDPA 4EJUA 3DF8A 4U7DA 1XMAA 1OR7A 3W6JB 2ELHA 4L5JA 3ECHA 2P5VA 4XRFA 5H6QA 3R0JA 3M8FA 2Z99A 2YSRA 4ENMA 2P7VB 1ZHFA 4DQ2A 3GFJA 1STZA 2J5PA 3HSEA 2AS5F 3FHZA 1B59A 3EUHA 4ZH4F 3S2WA 5DV5A 1ON2A 2W57A 1Q1HA 5KK1A 2ZMEA 3RKWA 1LDDA 3I59A 3D5LA 2KIFA 1OYIA 5L3DA 1QBJA 2XKPA 2C6YA 5CVJA 2FNAA 4HQMA 2GZWA 1LEBA 1YQAA 2L4AA 5DCMA 3F6OA 1IUYA 1SD5A 3C7JA 3QOPA 3KLOA 4Q5SF 4IHTA 1GXQA 2H27A 3REOA 3HHGA 2A6EF 3MEXA 5L3BA 3ML6A 5LEJA 3JSOA 4CZZA 3N4MA 1KYZA 2L3DA 3MZYA 1FSHA 3GFIA 1XGSA 3MCZA 4GO1A 5CYVA 3SZTA 3R60A 4UXNA 1TQMA 2FEZA 3WE2A 1WRJA 2XHKA 5TJJA 1ZGAA 1KU3A 5CVIA 1ZLKA 1TLHB 3F8BA 4M9SA 1R1VA 1H9GA 1OPCA 3K1PA 2Q8KA 5D5VB 2UXNA 2XIGA 2EV0A 2LF8A 2QQBA 4M6YA 2GA2A 4A0ZA 5D6FA 5D5XB 4IRIA 1IN6A 4RGRA 3LSTA 4WF2A 1DPRA 4CICA 5DCMB 2JPCA 2RVCA 2RGVA 4MGRA 1XMKA 3VB2A 3CLOA 5D5UB 4IRGA 3ZP5A 4WXCA 1O3RA 3QP6A 3K9TA 1XSDA 2JTVA 2EV6A 3ERED 2Z33A 1X3UA 3TGNA 4OU0A 5LGUA 3FM3A 2PG4A 2RC4A 3DPTA 4Z2YA 1BI2A 2K4JA 4I0BA 2O8XA 4EVIA 3KCCA 2YX7A 4ESBA 1Z6RA 1J9IA 3ZMVA 2NS0A 4I09A 4HF2A 1J59A 1F5TA 3O3KA 4P9UA 4OIOF 1I1SA 1FP2A 3CO7C 1REPC 4BHCA 2A5YB 4ASNA 1ZLJA 5A2QZ 4KIGA 1MKMA 4GGGA 1JXSA 3RPQA 3DPLC 1FLIA 1ZAOA 2EA2A 1IF1A 3L2CA 2BE5F 2Y75A 4CYDA 3RYPA 1XDUA 2IVMA 2O6GE 2VOOA 1IRGA 5JHUA 4DNCA 3KP2A 1O57A 2RNJA 2IJLA 4Y13A 3IRRA 3EQLF 5JI6A 1DPUA 3CUQA 1SFXA 4MEYF 2ZKZA 1USTA 2IA2A 5HOOA 4WXDA 1ZRFA 1B9NA 1F9NA 2K27A 4O5VA 1ODDA 1WSUA 4L18B 2M45A 3FMQA 2QBYA 1SMYF 1E17A 2VC1A 1WWXA 4OIRF 4I02A 5D5WB 3P9CA 5D8KB 4S05A 2VONA 3J81Z 1LEAA 3EETA 4OIQF 1B6AA 3KP3A 5LBQA 3Q9SA 2DI3A 2XUBA 1BC8C 1U6GA 5E1WA 4A0YA 3E5UA 1XB4A 2VBZA 5CJ9A 4L5IA 2HYFA 1W5TA 3QPHA 2DQRA 5F1RA 3PFIA 4L0YB 3HOTA 2R7FA 1Y0UA 5E8GA 3BP8A 2YX4A 1JGSA 2E1NA 4EJWA 3WTXC 2P7CB 5K5OA 2AXLA 1XD7A 4PCQA 2QQAA 3HRUA 2XROA 3F8NA 1IN7A 3HYIA 1IN8A 1C0WA 3IKVA 1QPMA 4UV9A 1GXPA 3WODF 4RGUA 3EDPA 2VE8A 4U0WA 2E7XA 2M30A 2OA4A 2RV8A 2HTSA 3V7CA 1YLFA 5D4RA 3GFMA 1ZG1A 4H0EA 2HGCA 1P2FA 3MWMA 2EWNA 4FX4A 1FZPB 3KETA 3EYIA 4KMFA 4AIKA 4LLNA 3IRQA 1W4MA 3FX3A 1FY7A 3K1NA 3WGGA 2DLLA 3CJNA 3LFKA 3LQQA 5J6XA 2IP2A 3QPTA 4LG0B 1D8KA 2ESHA 4A5MA 2NNNA 1MJBA 3I5UA 4A12A 2FXAA 1CF7B 1HSJA 1O7LA 2ACJA 3WU1B 3ZMUA 2EK5A 4EJTA 5E18F 1R36A 2KRFA 2Y0MA 2DU9A 3GYHX 4RGSA 3M9AA 1IW7F 2DAOA 5FO5A 1B9MA 3M7GA 1UHMA 4HX8A 2OQRA 4LK1F 3BDDA 4Q4ZF 4I0AA 3PQJA 1FBQA 1Z91A 4GCVA 3GW2A 3H3UA 1Z1DA 3G73A 4RB3C 4YFKF 2ISYA 4M71A 3GO5A 1PP7U 2W25A 3BJ6A 3F8CA 1BC7C 1GHCA 3FMSA 3RJPA 4HQEA 3I59B 5ILUA 2OD5A 1HKTA 2WC2A 4EJVA 5LGNA 2O61A 2PQ8A 2QVOA 2ZFWA 2HQNA 3LWFA 4IVNA 3JTHA 5ICEA 1IXSB 3MQ0A 1PDNC 3B02A 1R1UA 4ZYDA 3HUGA 4AIHA 3QU3A 1HW1A 4HF0A 1QZZA 2IA0A 1MJ9A 2HDCA 1IXCA 4JBAA 2BEOA 5L3FA 2JSCA 4MTDA 2PFBA 4LJZF 3NEUA 4EGYA 2L4MA 5FFZA 4EMSA 2J5OA 4BAYA 5ED4A 1KGSA 3P7NA 3GLXA 1D3YA 1H0MA 4G9YA 1FYLA 4S04A 4G6QA 3BPXA 4G7OF 2XV4S 5ICGA 3T8TA 4FT8A 4XSZF 1UB9A 1UCRA 4P55A 4BHPA 5J8CA 4ZYHA 1BOAA 3DKWA 1BI0A 2YPRA 4UVBA 5CLSA 3HRTA 5FLXK 1SD6A 3HTUA 3ABUA 5A2QK 2B0LA 1XGNA 2VE9A 3VOEA 4FX0A 1HSTA 4HAMA 4NB5A 2QZ8A 2ESNA 4EM1A 2H6BA 2LSOA 4GXOA 2GA1A 1ZG3A 3ZMTA 1J5YA 5DUKA 2EFOA 4WWCA 2HWVA 3M8EA 4UUVA 2FA5A 2LDUA 5L3EA 3F23A 1L3LA 3I0TA 1L0OC 3HRSA 5FGMA 3T8RA 3NQOA 1P4WA 5H6RA 5DD8A 1BM9A 1KA8A 3T0YA 3RPUA 1I6XA 1P6RA 3KFWX 4LLLA 2FSWA 2Z5UA 4JQFA 4L9VA 1U2WA 1TQIA 1LDKB 3IKTA 5HS7A 1R22A 2P4WA 1DUXC 1DDNA 1T0FA 4XBFA 2RQPA 5D4SA 2V79A 2HEOA 3O2PE 2KJCA 1XDSA 1F1ZA 1T6SA 1R7JA 3QRFF 3HTSB 2PMUA 4RS8A 2D45A 1ZARA 2XAHA 3CUQB 1QNTA 1G4DA 3QU6A 2XAQA 2E1CA 1R00A 2M5WA 4PGHA 4AVPA 4KUMA 4LK0F 2EFWA 3GUDA 3LAJA 2W24A 1T98A 4KMUX 1V3FA 2VC0A 2OU2A 3N97A 2IPQX 3MAJA 3F8MA 5E1ZB 4HLYA 4EM2A 4KN7X 3TOBA 4G94A 3BJOA 1UHWA 3JAMK 2NAZA 4TV7A 4EV0A 1LNWA 5CVUA 1AWCA 1HW5A 2O0YA 4CXFA 4XLPF 4LMYA 2STWA 2WV0A 4D0PA 4EGZA 1KQ0A 5JFRA 4Q47A 3BWGA 3FWEA 5DD4A 2HKOA 2MA3A 1BN5A 3D0SA 3ZN0A 4WX9A 2MD5A 3WTYC 4RB0A 2CG4A 2GXGA 1EV7A 5E17F 2X0LA 5FFXA 3WTUC 3F72A 1U8RA 4EQQA 1TTYA 2GWRA 4F7ZA 2UWMA 4I2OA 2ZCWA 3P9IA 1LJ9A 3V8LA 3T5XA 4B09A 5EEGA 3COAC 3W6KB 3EYYA 2W85A 1JHFA 2XAFA 4KIBA 3E6MA 3ABTA 5DDGA 5K5RA 3WTTC 4XSXF 4LB5A 3GZ5A 1J0RA 4IPAA 2O3FA 1LDJA 5K5QA 1TW3A 3KEQA 4ZYGA 4IRHA 2HZTA 4P5OA 1QGPA 3FM5A 2FF4A 3I54A 2P6SA 3F6VA 3IWZA 2DFIA 5HLGA 2F5EA 1K79A 4LG0A 2KIUA 3HSFA 1R23A 4M9ZA 3F3XA 4RGXA 4E70A 2ZBKA 2DW4A 2KIMA 1G3WA 3CUQC 4KT5C 4M73A 3BROA 1LQ1A 2RN7A 4AIJA 3ZQ7A 4LGWA 2VBXA 2XRNA 3IWFA 4HV6A 2ZNZA 1DP7P 3H92A 3IC7A 2MC3A 2NNYA 4FHTA 2F5CA 1D8JA 1IAWA 1SD4A 3SQNA 3GF2A 5LHIA 3K1MA 2ZMEB 3ROUA 5AONA 2A07F 4HF1A 5AIPA 1HXDA 4U88A 1T2KA 5K1YA 2VOPA 3E97A 3GVAA 2ADUA 4KICA 1E2XA 1R58A 2QLZA 5DEQA 4KNYA 5TRDA 4L9JA 3RIRA 2PBIA 4AWXB 1UFMA 3R4KA 2DBBA 2CWEA 4KFCA 2CQKA 3I53A 5HLIA 1R5GA 3LQRA 1G6NA 2A6HF 3E5XA 2QM3A 5JVTA 4NQWA 1RIOH 5IT9Z 1MGTA 3ECOA 2JZYA 1HKQA 1HW2A 3TO9A 3OV8A 3KP7A 4MQ9F 4PDKA 3GX4X 3V8JA 3TO6A 1FT9A 2HOEA 2FMLA 2A61A 1WKMA 2JPBA 4CGZA 3GZ6A 1I27A 1IRFA 1IN4A 2R7DA 1U5TC 1ZRDA 1I5ZA 3MFKA 2W84A 1TNSA 4BQAA 1ZH5A 1Z7UA 2XGXA 3WTZA 5LRRA 4A6DA 4R79A 4OIPF 3WTVC 1U5TB 1HKSA 3ZMDA 2KJBA 3GFLA 2V1DA 4P96A 2K02A 3VFZA 1YTYA 1FC3A 2H94A 3I58A 4UVAA 1KU2A 1S29A 2QENA 4GYIA 2WTEA 5HDKA 1P92A 5BPIA 2FBKA 2F5DA 1KYWA 1MDMA 5HDGA 2Q2EA 1NHAA 1WI9A 3ZPLA 1B1BA 5KVRA 4ON0A 1F4KA 2V9VA 1W7PD 1XGMA 5EEHA 2QUFA 3K69A 1ONVA 3GWZA 2FOKA 1PP8F 1S3JA 3JW4A 2OQGA 4BXUA 5HS8A 4M9XA 2EFPA 2MBFA 3WGHA 3LA7A 2V6CA 1XN7A 4HDVA 1W7PA 4HZFA 4I7HA 5FD5A 2DQLA 3QAHA 2ZXJA 2DO7A 1QO0D 4L9TA 4Q48A 5HVQC 3KZYA 2L02A 4G7ZF 4HA8A 4M6XA 1FP1D 1IN5A 5CVVA 1Z9CA 6PAXA 1P4XA 4BH9A 2M8EA 3ISPA 3KE2A 3L00A 1J7KA 5LHGA 4L0ZB 1YW7A 1K78A 2A68F 4YIFA 2XKOA 4P9FA 4R8HA 1S6LA 5HDNA 2K4BA 2ZJ2A 1TBXA 4HX7A 3C1DA 1QQIA 3F21A 4A5NA 1HQCA 4IXAA 5DYMA 2YR2A 1O3SA 5BOXA 4AD9A 4I01A 1SAXA 5E1XA 4HYEA 2P6TA 4Y15A 2G9WA 4OINF 3RI4A 2VN2A 2M87A 3DXJF 2HS5A 3V7RA 3ULQB 2A69F 3BZ6A 4R1HA 3V4GA 3JSPA 1BBYA 3J81K 1RZ4A 1GVJA 2ZO4A 3CUOA 1ZN2A 4ENNA 2LKPA 5H20A 5LLQA 3I64A 2L54A 4RAZA 1VTNC 3E3VA 2H09A 1YYVA 2D1VA 1KQ9A 4IF4A 5E8IA 3FXQA 3LA2A 1W5SA 2GIVA 2IA1A 4CO8A 4PZJA 1BI3A 5J8FA 4ZZDA 2CYYA 1XSXA 1ULYA 2L01A 1YW8A 4LLGF 3CO6C 3WGIA 2V1UA 2QYOA 2PEXA 1JE8A 3F22A 2ZNYA 5HLHA 3WTWC 2LNBA 1W7PB 2XASA 3H3ZA 3KP4A 1G3TA 2K86A 2R3SA 1FX7A 4YG2F 4CDGA 2PMHA 1CGPA 1RNLA 1PUEE 2HTJA 2DK8A 5ILSA 4MHGA 3RTRA 3BOQA 3DFGA 1S7OA 2EFNA 4WXHA 1YS7A 3G3ZA 1V4RA 2UXXA 1G3YA 1XCBA 1K78B 1BJAA 3U9GA 2FE3A 2G7UA 2WWYA 1IXRC 2TDXA 1MD0A 3U1DA 2D2WA 3R0AA 3V8KA 3TQNA 2HFHA 1MDMB 2CO5A 3DEUA 3C3WA 1SFEA 2FBHA 1JHHA 1R1TA 1YFHA 1FBSA 2DPUA 3CDHA 5FLXZ 5HS9A 5BQTA 3U2RA 1HBXG 5LGTA 2QQ9A 4HLXA 2FU4A 4B8XA 1ZG5A 5BMZA 4ENKA 1I1GA 2D1HA 3VODA 1BI1A 5IT3A 3J80Z 1YS6A 2CSOA 1FNNA 3TO7A 4MEXF 4QWQA 1CF7A 1WQ2A 4XLNF 5L3GA 2BV6A 4ETSA 2OBPA 4A2UA 3IL2A 1FYKA 2K7LA 4G7HF 4HV5A 2P5LC 1U78A 4MTEA 1S7AA 3B73A 4KA4A 3V7SA 2HYGD 3HOSA 2X4HA 5L3CA 3GEZA 2FNPA 5AIQA 3P9KA 4OMZA 4RAYA 4WK8F 5BPDA 2PJPA 3QP5A 1SMTA 3K0LA 1FPQA 2MH2A 3ZMSA 1A04A 1B4AA 1EH7A 2JT1A 4HOBA 1EH8A 2BBYA 3R6SA 4UHTA 3HRMA 4Y17A 4EJOA 2GQQA 4OOIA 2OAZA 1LB2A 4EM0B 3HIFA 3GXOA 3RKYA 1KU9A 1K6OA 3SXYA 2LF7A 2Z3YA 3ELKA 3ZN1A 3KP5A 5ICCA 2GAUA 2HR3A 1O7FA 3WU0A 3L7WA 1ZYRF 2DPDA 1J75A 1OMIA 1MJAA 3R61A 3Q9VA 1ZRCA 2OZ6A 1OYYA 2JRTA 4U7BA 3RKXA 5ERIA 4QLCU 4UV8A 3VEPA 2QBYB 3MZHA 1XSVA 1H9TA 1D5VA 3KZZA 2OZUA 2PI0A 3RDIA 1EH6A 2STTA 3I71A 5CVRA 2VBWA 4IJAA 1USSA 3KP6A 1K7AA 2IRFG 4ZYEA 1YO5C 3F8FA 4MNUA 1R5HA 2RKHA 2MLKA 1FBUA 2COMA 1Z05A 1T39A 4M72A 5F64A 3FMRA 2G7HA 1YIOA 4HBLA 1BIAA 2Y48A 4HX4A 1IZ1A 1RUOA 2A3SA 2IW5A 2QWWA 4U0YA 3E6DA 2BYVE 4BNCA 2FMYA 5F6FA 5JR3A 2VBYA 4N9HA 1QZYA 2IT0A 4GYGA 2KKOA 3E6CC 4UNOA 4O3MA 4UVCA 1SD7A 3KEOA 4HW0A 5BS6A 5ICFA 4ESJA 4WCGA 2F2EA 1OYWA 1U3EM 4RB2C 4G8XA 5LRSA 2CW0F 1G3SA 1U5TA 3TOAA 4ENJA 1OKRA 1XGOA 3L9FA 5LEKA 3FXRA 3HSRA 1O3QA 4CHUA 4NHJA 3DV8A 5LHHA 2EJRA 1S8NA 1FOKA 4PGGA 2EA4A 5D6EA 3K2ZA 4BYYA 1J2XA 2VXZA 2UZKA 1LVAA 2F5FA 3NRVA 3FF5A 3JTGA 2FBIA 4K2EA 2VT2A 4IHSA 4MQVA 4OMYA 2NRAC 1BIBA 3FZVA 2CGPA 1TQPA 1MZBA 4M74A 4U0VA 1TNTA 4YIIA 5ILVA 3CTAA 5FD6A 3O6BB 2NYXA 2DTRA 1P4AA 3LA3A 2VT3A 1FSEA 2M1BA 3M1EA 4LD5A 3WG9A 2O03A 1YG2A 1AOYA 3J7AO 1TW2A 4I98B 3I4PA 2PN6A 2DT5A 2ISZA 3RYRA 4RB1A 2PLYA 2XVCA 1O3TA 1SFUA 3SFZA 2EV5A 1KQ8A 4KYWA 1T38A 3WE3A 3DP7A 3TDZC 1ON1A 4LB6B 3FXUA 2EB7A 2XAJA 1RUNA 4N9IA 1KU7A 5D8LB 5IT9K 1Z6TA 2FQ3A 2HQRA 3BY6A 1FYMA 2P8TA 3C18A 3KLNA 3OOPA 3PQKA 5E20A 3HHHA 4G6DA 4JK1X 3BJAA 2H6CA 3E5QA 2E7WA 4O6JA 3T1BA 4LFUA 4YFNF 2EFQA 3SHFA 4KIFA 3IHUA 2HKXA 2RDPA 1FWZA 2YU3A 2VODA 1RI7A 3J80K 3TDUC 4HDUA 5DCFA 2Z9OA 3ZMZA 3BPVA 1YW9A 2ETHA 4A0XA 2XAGA 3Q5FA 4KN4X 3WTSC 4ZZLA 3E6BA 2MLGA 4L9NA 1ZREA 4YFXF 4A6EA 1XCVA 3LAPA 3TKYA 2BGCA 3AAFA 2MH9A 3L09A 2FRHA 2GXBA
chains in the Genus database with same CATH superfamily
4BHBA 2AHQA 2H8RA 2LY2A 3OIPA 2V1XA 3JAMZ 5DUIA 1YHQI 1ZGJA 2CFXA 2DK5A 3CD6I 3S16J 2EINH 2P5KA 4BBRJ 2Q0OA 1UHSA 2IS6A 4IZZA 4IEJA 2XRLA 4ESFA 3W2WA 3FHNA 5FB2A 1PYVA 4N0BA 2M4KA 3RCOA 3IH4A 3SZPA 1FIPA 3DQVC 5B3SH 2ZMEC 4EJUA 4KDPA 2LOOA 3MD2A 3DF8A 4U7DA 3OYIA 4ZC3A 1H8AC 1XMAA 2Y0SA 1OR7A 3W6JB 2ELHA 2PX9A 4QIWN 2VI6A 4L5JA 3ECHA 2NOJB 2P5VA 4XRFA 5H6QA 3S93A 1WPKA 1FMWA 3A0HC 3R0JA 4ZTJA 3M8FA 5FKLA 2Z99A 2YSRA 4ENMA 2P7VB 1PJRA 3CCYA 1ZHFA 2E5ZA 3CP8A 4DQ2A 3GFJA 1STZA 2QF7A 2J5PA 3HSEA 2AS5F 1P7IA 3FHZA 1B59A 3CCUI 2EIKH 3EUHA 4ZH4F 3S2WA 1AKHB 5DV5A 4ANJA 1K4SA 1TT5B 2DOEA 1ON2A 4V19K 2W57A 1OLTA 1Q1HA 3PO2J 2Q2EB 1V5FA 3I56I 1UELB 3BLYA 3DKYA 5KK1A 1LE8A 2ZMEA 3RKWA 2ECCA 2ZFUA 3M1CA 4JYKA 1LDDA 3I59A 3D5LA 2KIFA 3NARA 1OYIA 5L3DA 2X1CA 2NS7A 3CMYA 5FKKA 1QBJA 2XKPA 2C6YA 1D1AA 3O8GA 5CVJA 1IV6A 5GP9A 2FNAA 2ZC2A 3KX2A 4HQMA 1BJZA 2L7KA 1FJLA 1BR2A 2GZWA 2X1EA 3H5AA 2MSYA 3OWTA 3CCMI 2NVTJ 1YQAA 1LEBA 1R71A 2L4AA 5DCMA 3F6OA 1IUYA 2PJRA 1TP4A 3OSFA 1SD5A 3C7JA 3BG5A 3QOPA 3KLOA 2YUSA 4Q5SF 4C3HJ 4IHTA 1GXQA 2H27A 2B9SA 3REOA 3HHGA 1R9TJ 2A6EF 3MEXA 3Q0VA 4Y3OA 4BDYA 5L3BA 1VQKI 3CMAI 4NQWB 3CCEI 3ML6A 5LEJA 1FIAA 5E3OA 3JSOA 4RLFA 2GXAA 5KAIC 2I8DA 4CZZA 3N4MA 1KYZA 2MGQA 2HVQA 5KAFC 2KZGA 4JX4A 4BS9A 2VL8A 5F04A 3SZGA 1WJAA 2L3DA 3MZYA 3L1PA 3DTKA 3JRGA 1HF0A 1FSHA 3GFIA 2CQXA 1XGSA 1D1CA 3MCZA 2X9DA 4GO1A 2LKXA 1ZQ3P 3C2BA 5CYVA 3SZTA 3PSFA 3R60A 4UXNA 1TQMA 2EZIA 2FEZA 3WE2A 3JRBA 3H9QA 1WRJA 2I10A 2XHKA 5TJJA 1ZGAA 1KU3A 5CVIA 3OYJA 1ZLKA 1TLHB 5GAEJ 3F8BA 2XPWA 4M9SA 1RETA 2O8KA 1OISA 2WY8Q 1R1VA 1H9GA 3HEFA 5LFAA 1OPCA 3K1PA 2Q8KA 5D5VB 2UXNA 4RA2A 2XIGA 2CV1A 1R4MB 2EV0A 2LF8A 2QQBA 4OAZA 2ME0A 2L2OA 1VQ6I 4M6YA 2GA2A 3IP4B 3ZQCA 4A0ZA 5HLTA 5D6FA 1ZELA 5D5XB 4IRIA 1IN6A 1APLC 4RGRA 3LSTA 4WF2A 1DPRA 4CICA 1MW7A 5DCMB 2DXIA 2JPCA 2RVCA 2RGVA 4MGRA 4XICA 3SEQA 1XMKA 3VB2A 3TMOA 3CLOA 5EDNA 2KPMA 2IGNA 3HC7A 4IRGA 5D5UB 3S3MA 3ZP5A 3QPLA 4WXCA 3I55I 1O3RA 3QP6A 4AIDA 3K9TA 1XSDA 2DMTA 3WHBA 1QPIA 2AQFA 2I5UA 2JTVA 2EV6A 3ERED 1POGA 1EKEA 1V55H 3H1CA 4II2A 2Z33A 1X3UA 3TGNA 3K4LA 3IAM2 4OU0A 1VQ7I 4KISA 2VJ5A 5LGUA 3FM3A 2PG4A 3PL8A 2RC4A 3DPTA 4Z2YA 3AG2H 2E60A 4ZTFA 2CV0A 1BI2A 2K4JA 5EGOB 4I0BA 2O8XA 1Y0NA 4EVIA 3KCCA 1U9OA 2KZVA 2YX7A 3BTJA 4ESBA 5EGOA 1Z6RA 2XSDC 3FKJA 3GTQJ 1J9IA 1LE8B 1MMSA 3ZMVA 2NS0A 4I09A 1ZKGA 4HF2A 1J59A 1F5TA 2P81A 4KJZA 3O3KA 4P9UA 4OIOF 1I1SA 1FP2A 3CO7C 1REPC 4BHCA 2CUJA 2A5YB 2K9SA 3AKZA 4ASNA 1ZLJA 3TP3A 4E7LA 5A2QZ 4KIGA 1MKMA 4GGGA 4XM3A 1JXSA 3RPQA 4MIMA 2ELKA 3DPLC 1FLIA 2W82A 2DYSH 4IO9F 4AM3A 2CQQA 1ZAOA 2JN6A 1PUFB 1QU3A 1YX3A 2JWTA 2EA2A 1IF1A 3PM1A 2LRDA 2NOGA 3L2CA 2BE5F 2Y75A 2MABA 3K2AA 4CYDA 1VNDA 3RYPA 4FCYA 1XDUA 2IVMA 4PSWA 2V6EA 2O6GE 2BXZA 4AU7A 3DLLF 2JA6J 2VOOA 1DU6A 1IRGA 5JHUA 4DNCA 1X1AA 1MNEA 2CUEA 4CCKA 2BY1A 1V5GA 3KP2A 2EIMH 1RRJA 1O57A 1YITI 2RNJA 2IJLA 3MZ8A 1SEUA 4Y13A 3IRRA 3EQLF 5JI6A 1DPUA 4NC6A 2B63J 4XIDA 3K70C 3CUQA 1SFXA 4MEYF 2ZKZA 2EPFA 3DPUA 1IC8A 1USTA 2IA2A 1WHUA 4WXDA 5HOOA 3OYBA 1XPXA 1ZRFA 1B9NA 1ERDA 1K83J 1F9NA 1Y8QB 2IXSA 2K27A 3BZKA 4O5VA 1LFUP 1ODDA 1WSUA 4L18B 2M45A 1YIJI 3FMQA 2QBYA 2XF5A 4RM2A 1SMYF 3DTIA 4ZYAA 2DA6A 1E17A 2VC1A 2DODA 4XLCA 4HNTA 1WWXA 4OIRF 1U8BA 4I02A 4XLFA 5D5WB 4X6AJ 3P9CA 4E7ZA 5D8KB 2BY2A 4S05A 4AC0A 1D0XA 3CCRI 2AQEA 2VONA 1OJLA 3TW6A 1LEAA 2GBYA 3EETA 3J81Z 1UZCA 3QYEA 4OIQF 3CMEI 1B6AA 2E19A 5BNGA 3KP3A 5LBQA 3Q9SA 1S5LC 2DI3A 2XUBA 3CCQI 1BC8C 4CCMA 3D5SC 1U6GA 5E1WA 3HUGB 3JRCA 1SAUA 1XG1A 2DA4A 2FJ1A 1JT0A 4A0YA 3E5UA 3NWTA 1XB4A 4G6TB 2VBZA 1SVLA 5M5XJ 4BDZA 2F4MB 5CJ9A 3ASNH 1N78A 2PMZN 4M3EA 3CCLI 4L5IA 2HYFA 1W5TA 2FUG2 3QPHA 2KP6A 4LIUA 4A3MJ 3CQZJ 2DQRA 3JRAA 5F1RA 1O4XA 3H36A 3CCVI 4CCJA 3JCUC 3PFIA 4XRSG 3HOTA 4L0YB 2GIZA 5KNLA 2R7FA 4DYRA 1TL8A 2D5VA 4PK4A 2JUCA 4E4HA 1Y0UA 3PFYA 2OJED 2BOLA 5E8GA 3LSRA 1U0JA 3BP8A 2YX4A 1JGSA 1M1EB 2E1NA 3CDIA 4EJWA 2KT0A 5IYCJ 4BBSJ 4LITA 3WTXC 2P7CB 5K5OA 5E79C 1VQ8I 1GUUA 1B8IB 2AXLA 1XD7A 4PCQA 2R7VA 2QQAA 3F0CA 3HRUA 2XROA 1UMQA 3F8NA 3L2UA 1IN7A 3HYIA 1IN8A 1RR8C 2K9NA 3A03A 1C0WA 2DDAA 2DFHA 2X51A 3IKVA 3PUFA 1QPMA 4UV9A 1ETXA 4BXFA 3HGYA 1GXPA 4IHXA 1JGGA 3WODF 3Q3SA 1FTZA 2EILH 2VJIA 2X48A 1U9NA 4RGUA 3EDPA 2VE8A 4U0WA 2E7XA 2M30A 2OA4A 2RV8A 2HTSA 4BE2A 3V7CA 1YLFA 1OQYA 5D4RA 3GFMA 1ZG1A 2KRHA 2A05A 3SYTA 4A3LJ 4H0EA 1MSEC 4ZDOA 4JP0A 1K4TA 2CH0A 2IBDA 3MKWB 2HGCA 3AG3H 4EATA 1W0UA 3K4CA 2Y2ZA 2OTJI 1P2FA 3MWMA 3A01A 2EWNA 4FX4A 2OUMA 1FZPB 1JUMA 3HOWJ 2OF7A 3ASOH 4IQ4A 2E71A 1VQOI 3LMMA 2WAEA 3KETA 3EYIA 4KMFA 5FJ8J 4AIKA 5IP9J 4LLNA 2QA4I 3IRQA 1W4MA 3FX3A 1SFKA 3I4NJ 1FY7A 1ORKA 3K1NA 3WGGA 4RLQA 2ZJPF 2DLLA 2LH9A 2WB1N 3CJNA 5C3EJ 3S1RJ 3BG3A 1JKQC 1ETVA 4XR6A 1MH3A 2DTZA 2O7OA 4L5EA 2HDDA 3LFKA 3LQQA 2HXOA 4C3IJ 5J6XA 2IP2A 3QPTA 3CC7I 4LG0B 5FRNA 2LBFB 2LMDA 4C2TA 1D8KA 2ESHA 4QSHA 4CZCA 1WH5A 2YS9A 4A5MA 2NNNA 3K4KA 1UG0A 1MJBA 2BY3A 4HEA2 3I5UA 4OWRB 4Y33A 1OCPA 4A12A 1HOMA 1WCMJ 2FXAA 3OMYA 3FIWA 1CF7B 1HSJA 1O7LA 4BEHA 2R5YA 3S1NJ 2ACJA 3ZQGA 5LD2C 3WU1B 1UG2A 3ZMUA 2FOWA 1X1BA 3MMYB 2EK5A 4EJTA 2WAQA 5E18F 4PFPA 2DA5A 1R36A 3EUAA 2KRFA 2Y0MA 2DU9A 3GYHX 3PNVA 4RGSA 3M9AA 1IW7F 2KDOA 4MFEA 2QSHX 2DAOA 5FO5A 1B9MA 3M7GA 1AA7A 1UHMA 4XN0A 4HX8A 2F5VA 2OQRA 4LK1F 2QCOA 3BDDA 2LY1A 5CPRB 4XQFA 4Q4ZF 2JA8J 2KMUA 4I0AA 4E7KA 2BHYA 3PQJA 1FBQA 1YJNI 1Z91A 3TP0A 1EF4A 4B48A 4BQQA 4GCVA 1P7JA 3GW2A 3H3UA 3GTOJ 1Z1DA 3G73A 4RB3C 4YFKF 2ISYA 3VYTB 1D0YA 4M71A 3GO5A 2K3FA 4CCOA 4D7NA 5JHFA 1PP7U 2W25A 4C30A 4XK4A 3BJ6A 3F8CA 1BC7C 5CQGA 3A2KA 3FXLA 1GHCA 3FMSA 3RJPA 4M3DA 4F52A 3I59B 5ILUA 4HQEA 2OD5A 1HKTA 3GMEA 3FKIJ 2E5NA 2WC2A 4EJVA 5LGNA 3BG7A 2O61A 2PQ8A 2CFOA 2QVOA 2MC4A 3CC2I 2ZFWA 2HQNA 1FOYA 3LWFA 3VWBA 4IVNA 3JTHA 1IG7A 5ICEA 2EH3A 3DTEA 1JKOC 2VQCA 1KONA 1IXSB 3MQ0A 3OYAA 3B02A 1PDNC 2NVYJ 1R1UA 4ZYDA 1NG6A 3HUGA 4AIHA 4A3GJ 3ZQLA 3QU3A 2XGDA 3TEDA 1HW1A 1SVOA 4HF0A 1QZZA 4ABZA 3VSLA 2IA0A 1Z67A 1MJ9A 5IOZA 1G8XA 2HDCA 3BC8A 1SFOJ 1X2MA 2Q1ZB 4IQJA 1IXCA 4JBAA 2BEOA 3TW7A 5L3FA 3CLQA 2JSCA 4MTDA 2PFBA 4B43A 2ELJA 4LJZF 4NUBA 1QA6A 3NEUA 4DBRA 5EZGA 2L4MA 5FFZA 4EMSA 4EGYA 2J5OA 4BAYA 5ED4A 2KLOA 1KGSA 3P7NA 3GLXA 1D3YA 2ZJRF 5E3NA 3EUHC 1H0MA 3S2DJ 4G9YA 1FYLA 1HLVA 4S04A 3OYEA 2CV2A 3G1LA 1PVEA 4G6QA 3H35A 3DEWA 2HOSA 4XKVA 3BPXA 4G7OF 2XV4S 4F93B 5ICGA 3T8TA 1T8IA 4FT8A 4XSZF 4V2GA 1VQ5I 2GXBA 1DQUA 1UB9A 1UCRA 4P55A 4BHPA 5J8CA 1H88C 4ZYHA 4B44A 1BOAA 2E2JJ 3DKWA 1OCRH 1BI0A 2YPRA 4UVBA 5CLSA 3ZXSA 5IP7J 3KYCB 2Y9YA 3HRTA 4FE4A 3UNGC 2L9NA 5FLXK 5K7HA 1SD6A 5HODA 4A3CJ 5DTDA 2LK2A 3HTUA 3ABUA 4FISA 5A2QK 2B0LA 4I6ZA 5IYDJ 1XGNA 4CA0A 4RMNA 1SANA 2VE9A 3VOEA 5F27A 1MBKA 3E7LA 4FX0A 2HI3A 3VPRA 1HSTA 2H1LA 4HAMA 4NB5A 3TL4X 2QZ8A 4E7SA 4C2UA 2ESNA 4EM1A 2H6BA 2LSOA 1E0EA 4GXOA 4AYBA 2GA1A 2R7SA 3HKZA 1ZG3A 1J5YA 1QRYA 3ZQIA 3ZMTA 5DUKA 2EFOA 1OCCH 4WWCA 5B66C 2EZKA 1ETWA 2HWVA 2DA1A 3OL4A 2JVGA 3M8EA 5FRMA 1LVKA 4UUVA 2XSJC 2XPUA 2FA5A 1A35A 2LDUA 3MKYB 4IHWA 5L3EA 3KYLA 1AHDP 3F23A 4FTHA 2KHMA 3D5RC 2V9KA 4XLHA 1L3LA 3UR3C 2L9SA 2W7NA 3I0TA 1L0OC 3HRSA 5FGMA 1GV2A 3T8RA 2VKVA 3NQOA 2IGKA 1P4WA 5H6RA 5DD8A 5F0FA 1BM9A 1KA8A 4W97A 3OS0A 2K3PA 3T0YA 3RPUA 5IP6A 3W6VA 1B72A 1I6XA 1P6RA 2EQRA 2IEKA 1VQLI 3ABKH 3KFWX 3QYFA 4LLLA 2FSWA 2JMWA 2Z5UA 5JVGF 2JSPA 2LY9A 2F48A 3HZJA 4JQFA 4L9VA 1U2WA 1TQIA 1JTYA 1LDKB 3BR1A 3IKTA 2HQAA 3A1YA 3GZNB 2FQ4A 5HS7A 1YE9A 1X1PA 2ZSHB 4B3XA 2XF7A 1R22A 2P4WA 4CYCB 3J7ZI 1DUXC 1D0ZA 4RM3A 3K10A 1DDNA 2JVHA 5E3MA 1I3AA 3LSGA 1T0FA 4XBFA 1VFCA 2RQPA 2WADA 2V79A 3FBNB 3GBGA 3O2PE 5D4SA 2HEOA 4GFBA 1T56A 5GAHJ 2KJCA 2TRTA 1XDSA 1VQPI 1E3OC 1F1ZA 2CRGA 3MVPA 2BVMA 5M5YJ 2IGOA 1T6SA 2KL4A 1R7JA 2W4SA 5FROA 3QRFF 5H2FC 4M6VA 3HTSB 2PMUA 4RS8A 1TWHJ 2D45A 1ZARA 5F1JA 2XAHA 2QEXI 5FKNA 1JKPC 3CUQB 4I99C 1DGRM 1QNTA 4IHVA 1WJBA 1G4DA 3QU6A 3H9GA 2XAQA 4I76A 2E1CA 1E3PA 2A6TA 1R00A 2M5WA 4PGHA 4AVPA 4BUPA 4A3JJ 1GV5A 4KUMA 1IRZA 2OV7A 4LK0F 2X6YA 2LYCA 3BTCA 3OYCA 1WZ2A 3A4CA 2DMNA 2EFWA 3GUDA 4HRIA 4BQNA 3LAJA 2W24A 1T98A 3H0GJ 1V3FA 4KMUX 2VC0A 2OU2A 3N97A 4YEJA 2H8WA 2Z2SB 2IPQX 3HPGA 2KISA 3MAJA 3BQZA 4W1UA 1H89C 3F8MA 5E1ZB 1XX5A 4HLYA 4EM2A 4HSTA 4KN7X 3TOBA 4G94A 3BJOA 1RR7A 5EG0A 4Y52J 1UHWA 2V1NA 3WU2C 3JAMK 3KZIC 2DOFA 3L2VA 4MFDA 1I50J 2Y9ZA 3DKXA 2HNHA 2NAZA 4TV7A 1OCTC 4DJAA 4EV0A 2L7ZA 1LNWA 1VQMI 2CUFA 4BU2A 5J4YA 2R7UA 3FISA 3RZDJ 5CVUA 2DJIA 1AWCA 1HW5A 2O0YA 3FXKA 2W1OA 4CXFA 4LMYA 4XLPF 4BQOA 2STWA 2WV0A 4D0PA 2RQQA 3KEYA 4EGZA 3LFUA 3QODA 1KQ0A 2HOAA 5JFRA 4Q47A 3BWGA 3FWEA 5DD4A 2HKOA 2MA3A 1BN5A 3D0SA 3ZN0A 1Z3XA 1FEXA 4X1EA 2CS3A 4WX9A 5GAGJ 2E1MB 2MD5A 2XB0X 4JX6A 4RB0A 3WTYC 2JA5J 2CG4A 2GXGA 5GTIC 2L5QA 1EV7A 4A93J 2COBA 2X0LA 2MG4A 3OYKA 5E17F 5FFXA 3WTUC 4IKFA 3S3NA 3F72A 2H1KA 1EA3A 1WGXA 1U8RA 4EQQA 1TTYA 1X58A 2GWRA 4OAYA 2WBMA 4F7ZA 4YRVA 2UWMA 2XB5A 1QVUA 4I2OA 2ZCWA 4A3BJ 2GOXB 3P9IA 3SDGA 1LJ9A 4ITVA 5J4VA 2KFDA 2BHZA 3A02A 4RAGA 3V8LA 2E36A 3T5XA 4ZJZA 4BXXJ 3ZGKA 5GADJ 2L7FP 2PJRB 3I4MJ 4B09A 4XMYA 5EEGA 2VUMJ 3G2BA 1YRNA 3COAC 3W6KB 3EYYA 2W85A 2M34A 1JHFA 2XAFA 2EIJH 1RC9A 4KIBA 2OTLI 1XC5A 2Y31A 4KITB 2MW8A 3J7YJ 3E6MA 3ABTA 3BCBA 5DDGA 5K5RA 3WTTC 3S3OA 2O9LA 4XSXF 4LB5A 4XL9A 3GZ5A 3U1KA 2DT7B 1J0RA 4IPAA 2O3FA 1LDJA 2QGUA 3BQYA 5K5QA 1TW3A 3GCMA 3KEQA 4ZYGA 4IRHA 2R7TA 4NDLA 2HZTA 1FOWA 3FXOA 3HOVJ 4P5OA 1QGPA 3FM5A 3PIOF 5M3FJ 2FF4A 2LP0A 2VKEA 3I54A 2X6XA 1A31A 2P6SA 3CJQB 3F6VA 3IWZA 2M8GX 3V42A 2DFIA 4JOMA 5HLGA 3S1MJ 3PSIA 2F5EA 1TC3C 2Y0SN 1QVTA 1K79A 3KYDB 4LG0A 4UY8I 2BZTA 2K85A 2KIUA 3HSFA 1HCRA 1R23A 4M9ZA 3F3XA 3K4NA 2DMUA 4RGXA 4E70A 2ZBKA 2DW4A 2KIMA 3OSGA 5GPAA 3CDLA 1G3WA 3CUQC 4KT5C 2VPLA 4M73A 1YRNB 3BROA 1LQ1A 2RN7A 5FKOA 4A69C 4A3KJ 4AIJA 3ZQ7A 4LGWA 2VBXA 3JRHA 2XRNA 3IWFA 3ZQHA 4HV6A 2ZNZA 1DP7P 2ID3A 3H92A 1Y1WJ 3IC7A 2EBIA 5IYBJ 2MC3A 2NNYA 4BGDA 4FHTA 2HXIA 1TT0A 2F5CA 2QKLB 1D8JA 4A3EJ 2DMQA 1SD4A 1IAWA 2W00A 3ZR8X 1BW5A 3OYFA 1OFCX 3SQNA 3BTIA 4DW6A 2EZLA 1WJDA 3GF2A 3JR9A 2DYRH 5LHIA 3NAUA 3K1MA 2ZMEB 2LC2A 3ROUA 5AONA 2A07F 2K9MA 3A01B 3HOUJ 4HF1A 5AIPA 1HXDA 4U88A 2ZXHA 1T2KA 1MBFA 5K1YA 1MMGA 2VOPA 3E97A 4QTRA 3GVAA 1X2NA 3OR2C 2IGMA 3FK6A 2ADUA 3SFIA 4KICA 2JUGA 1E2XA 1R58A 2DCEA 2QLZA 5DEQA 4B47A 1PUFA 2GLOA 4KNYA 5K7FA 5TRDA 4L9JA 3RIRA 2PBIA 2HU9A 4AWXB 1UFMA 3R4KA 3W2AA 2DBBA 2CWEA 1GT0C 4KFCA 2CQKA 3M3YJ 3C2GA 3I53A 5HLIA 1R5GA 5TISC 3LQRA 1X4OA 1G6NA 2A6HF 3CESA 2QM3A 3E5XA 2TCTA 4NQWA 5JVTA 1RIOH 4PJNA 5IT9Z 1MGTA 4A3FJ 1GDTA 1MMDA 3B6AA 3ECOA 1RKWA 3CC4I 3LSPA 2JZYA 1HKQA 1HW2A 1EJ9A 3TO9A 3OV8A 2R7RA 3KP7A 1ZK8A 1YX5A 3BR5A 3HM5A 2QKMB 2XGEA 4MQ9F 4H4KC 4PDKA 3GX4X 3ESWB 3V8JA 3TO6A 2HPIA 3CMMA 1FT9A 2HOEA 2FMLA 2A61A 1WKMA 2JPBA 4CGZA 3BR3A 2CW7A 1ENHA 3N05A 1YJWI 3GZ6A 1I27A 2ID6A 3L2WA 1IRFA 2HDWA 4BJ6C 4CSWA 1IN4A 2R7DA 3DBRB 5F0CA 2GM4A 1U5TC 1ZRDA 1I5ZA 1WH7A 3MFKA 2W84A 1TNSA 5IY5H 4IX7A 4BQAA 4Y7NJ 2IAIA 1ZH5A 1NG7A 2X1DA 5DM7F 1DU0A 2E1OA 3VSKA 1Z7UA 2LBFA 5IPAA 2XGXA 3WTZA 5LRRA 4A6DA 3CCSI 4R79A 4OIPF 1XMXA 3WTVC 1U5TB 1HKSA 4D5CA 5HNHA 4PSXA 3ZMDA 3JRIA 2KJBA 3GFLA 2V1DA 4P96A 2M0MA 2IS2A 3WHCA 2K02A 3VFZA 1YTYA 1JUSA 2JQ7A 2CW8A 3Q0WA 1IJWC 1FC3A 2CMPA 1T08B 2H94A 2Z16A 3I58A 4UVAA 2VKHA 4IL6C 1KU2A 2F4IA 4FETA 4AUXA 1S29A 2K9LA 1IDZA 2QENA 3DBLB 4GYIA 2WTEA 5HDKA 3EUKL 1P92A 3BT9A 3SEZA 5BPIA 3OIQA 2FBKA 1ETYA 3BR6A 2F5DA 1KYWA 2R7QA 1V5EA 3HOXJ 2LVSA 1MDMA 5HDGA 1VI0A 2Q2EA 1NHAA 4E7JA 4CYCA 1WI9A 5C44J 2X6OA 3ZPLA 1B1BA 3HGGA 5KVRA 2R93J 4ON0A 1F4KA 2V9VA 5CKTA 3HL2A 3K4JA 1W7PD 5KHDA 2L0KA 1XGMA 5EEHA 2QUFA 3K69A 1ONVA 2FD5A 1MBJA 3GWZA 4CH7A 2FOKA 1PP8F 3ZQQA 2ZJQF 1S3JA 2QQ8A 3JW4A 1T0FC 2OQGA 4BXUA 5HS8A 2VJJA 2EZHA 2V7FA 4M9XA 2EFPA 2MBFA 3WGHA 3LA7A 1I6HJ 2V6CA 1NTCA 1XN7A 3LSMA 4HDVA 1W7PA 4HZFA 4II3A 4I7HA 5FD5A 2KQRA 2DQLA 3QAHA 2UV1A 1YI2I 2ICWG 4D5FA 4FASD 4BY1J 2LD5A 3CJRB 2ZXJA 2DO7A 1QO0D 4L9TA 3OYMA 4Q48A 3NWSA 4F3QA 5HVQC 3KZYA 2GOMA 2L02A 4G7ZF 4HA8A 2HOTA 3FXJA 2VQLA 4M6XA 5GPCA 1FP1D 1IN5A 5CVVA 1Z9CA 6PAXA 3EPZA 1P4XA 2CQNA 4BH9A 2M8EA 3ISPA 3MN2A 3KE2A 2OCCH 3L00A 1J7KA 5LHGA 1HDPA 3HG9A 4L0ZB 1YW7A 1WI3A 2G0EA 2A68F 1K78A 3S2HJ 4YIFA 1BOBA 5J47A 2XKOA 4P9FA 4R8HA 1S6LA 4S0HB 5HDNA 5JLXA 2K4BA 2ZJ2A 1AKHA 1TBXA 4HX7A 4DGWB 3C1DA 1QQIA 5K7ZA 3F21A 4A5NA 1OCOH 9ANTA 1HQCA 4IXAA 5DYMA 2YR2A 3FK7A 3S8PA 3I3LA 3SDBA 5F08A 4QPOA 1O3SA 3DEEA 5BOXA 4BL0B 1BR4A 4AD9A 4I01A 5TGTA 4E7HA 4PUSA 3HOYJ 1SAXA 3HBLA 2R7WA 1T95A 3ABLH 1G2HA 1DGWY 2E2IJ 5E1XA 4HYEA 2P6TA 3GTPJ 5C4JJ 1JI8A 4Y15A 4Y4RA 1G59A 2G9WA 4PJMA 4OINF 3RI4A 4UUSB 2VN2A 2M87A 2E34A 3DXJF 3ERMA 2HS5A 1Y6IA 2OCEA 3FBIB 3V7RA 4IHYA 3ULQB 2A69F 3BZ6A 4R1HA 3V4GA 2K5CA 3JSPA 1BBYA 1J09A 1IDYA 1JUPA 3PNYA 4XRSA 3RKQA 3J81K 1RZ4A 1GVJA 2WA0A 2ZO4A 3CUOA 5IOYA 1ZN2A 5B1BH 4ENNA 2LKPA 4XONA 5H20A 1Z0XA 1Q1VA 3I64A 4FQGA 5F0HA 1Y8RB 5LLQA 2L54A 4BKXA 4RAZA 2R7ZJ 1B72B 1VTNC 3E3VA 2H09A 1YYVA 3AL0C 2D1VA 1KQ9A 4IF4A 5E8IA 3FXQA 3LA2A 1W5SA 4F55A 2GIVA 2IA1A 4CO8A 3ZCOA 3IUOA 2DN0A 2JA7J 3K4BA 4BEHB 4PZJA 4XORA 1BI3A 2P0WA 4HG2A 1MBGA 3CZ6A 1ITYA 5J8FA 1A6QA 4ZZDA 2CYYA 1XSXA 1JT6A 1ULYA 2L01A 5E3LA 2QSFX 1YW8A 5EF6A 1D1BA 4LLGF 5DM6F 1NK3P 1AU7A 3CO6C 5HNFA 3WGIA 2V1UA 5EEAA 2QYOA 3RQ4A 2PEXA 2R92J 1JE8A 3P5JA 4F91B 1VZ0A 3VYUB 3F22A 2MFZA 3OY9A 2ZNYA 4RAFA 3HB9A 4PJJA 5B1AH 1IV8A 1F43A 3MKZA 4J19A 5HLHA 5J1UA 2LNBA 3WTWC 3M4OJ 1W7PB 3H3ZA 1BR1A 2XASA 3KP4A 3PUBA 1G3TA 2K86A 2R3SA 1FX7A 1MMNA 4UUSA 4YG2F 4CDGA 2PMHA 4LOCA 1D5YA 4M3BA 4B1RA 4NBQA 1Y1VJ 1RNLA 1CGPA 4AVZA 1PUEE 2HTJA 3F9KA 1Y56A 1DP3A 2DK8A 1OCZH 1V54H 1I3QJ 3K6GA 2VKDA 5ILSA 4XKWA 4MHGA 3RTRA 3BOQA 4QPQA 3DFGA 1VQNI 1S7OA 3H5RA 3S15J 3U21A 4X0GA 2EFNA 3GLLA 4WXHA 1JTXA 4D9JA 1YS7A 4UB8C 3S1QJ 2UUZA 1Y39A 3DLAA 3G3ZA 1V4RA 2UXXA 3RSNA 2JA2A 2NVQJ 1G3YA 2KRCA 1XCBA 5FKMA 2XF6A 1K78B 1BJAA 4DOZA 2XC7A 3U9GA 2FE3A 1GLNA 2V26A 3LSKA 2G7UA 2WWYA 1IXRC 2TDXA 1MD0A 1TWGJ 3U1DA 2D2WA 3R0AA 4LIVA 3V8KA 3TQNA 4HSRA 2HFHA 1JJ8C 4ZDPA 1MDMB 2CO5A 3DEUA 3IH2A 4IOAF 5EJCA 3C3WA 1SFEA 3WG7H 3ZRGA 2FBHA 1WFXA 1JHHA 1R1TA 2ME6A 1YFHA 1FBSA 1S9HA 2DPUA 1R4NB 3CDHA 1SC7A 5FLXZ 2M2EA 2HPMA 2L7MP 5HS9A 3H9JA 2W48A 4P1WA 1RESA 2VASA 3KIOA 5BQTA 3HDDA 2AO9A 3U2RA 1HBXG 2OC6A 5LGTA 2QSGX 2QQ9A 3OS2A 4HLXA 2FU4A 4B8XA 1ZG5A 5BMZA 2MD0A 2OPTA 1W1WE 4ENKA 1I1GA 2D1HA 2DMPA 1LUJB 3VODA 2DA2A 4GDFA 2NVUB 1BI1A 5IT3A 4F92B 3J80Z 1VQ4I 1YS6A 4XN3A 2CSOA 4HNVA 4NC8A 1JJ6C 5EZHA 1QZEA 1MIJA 1FNNA 2LFBA 3TO7A 2LKSA 4MEXF 1A5JA 2ECBA 4QWQA 4E6KG 1YOVB 1MH4A 2VIXA 2LREA 3VYSB 3QWLA 4DYQA 1CF7A 4N4OB 1WQ2A 2WAQN 4XLNF 5L3GA 3S14J 4RBOA 2VXDA 1OR7C 1ZR2A 2BV6A 4ETSA 3LSIA 2OBPA 2R4GA 1K6YA 3ZQFA 4A2UA 2XDVA 3IL2A 4NNJA 1FYKA 2K7LA 4G7HF 4HV5A 1MNMC 2P5LC 2NXNB 1R49A 1U78A 3W2VA 4MTEA 1S7AA 3B73A 3VDXA 4DZPA 3DU5A 3V7SA 4KA4A 2B7EA 4BE0A 2HYGD 2XPVA 3HOSA 2X4HA 5L3CA 2BVLA 1NH3A 3UKGA 3GEZA 2FNPA 5AIQA 3P9KA 4OMZA 4RAYA 4B4CA 5J1YA 4WK8F 5BPDA 1HDDC 3BG9A 2PJPA 3QP5A 2NVXJ 1SMTA 3K0LA 1FPQA 2MH2A 1FTTA 3QPSA 3K4MA 3AG1H 4CCLA 3ZMSA 2BW3A 4A3IJ 1A04A 3I9V2 2HQ5A 1TZLA 1TWFJ 1B4AA 1EH7A 2JT1A 4HOBA 1EH8A 2BBYA 3R6SA 4UHTA 4V2FA 3HRMA 4Y17A 4BACA 4XKBA 4EJOA 4PJLA 2DA3A 3L2RA 2GQQA 4YIRX 1W0TA 1HA8A 3K70D 1W36D 4OOIA 2KDZA 4XLEA 2OAZA 1LB2A 4EM0B 3LSJA 3HIFA 1MSFC 3S32A 1WVRA 2VQHA 1KU9A 2M7AA 3GXOA 3RKYA 1K6OA 3SXYA 2K9QA 2LF7A 2VB6A 2Z3YA 3BTLA 3ELKA 2PMZA 4ZDLA 3KP5A 3ZN1A 4DIQA 5ICCA 2GAUA 2HR3A 4DBQA 2HVSA 1O7FA 3WU0A 2R5ZA 3L7WA 4EEFG 1S7EA 1ZYRF 2DPDA 1J75A 1OMIA 4B3AA 1MJAA 2XAUA 3R61A 1BW6A 4DZJA 3Q9VA 1W5CC 2LLKA 2ZXIA 3LL7A 1ZRCA 3RQIA 2OZ6A 4CUGA 3DWLE 1OYYA 2VJ4A 2JRTA 1P9QC 1Z21A 2DT6A 2XGCA 4U7BA 2K40A 3RKXA 3PO3J 1X1CA 5ERIA 3LOCA 4N4NB 2IS1A 4BJTA 4M3FA 4QLCU 1MBHA 2DA7A 4UV8A 3HOZJ 1ZTRA 1ETOA 3VEPA 2QBYB 3MZHA 1XSVA 2HZDA 1A6IA 3IAS2 3K7AJ 1H9TA 3G1OA 1VQ9I 1D5VA 3KZZA 2OZUA 2PI0A 3RDIA 1EH6A 2LR8A 2N8GA 4BY7J 4KT6A 4UUTA 2STTA 3I71A 5CVRA 2FX0A 2VBWA 3BZCA 2DJNA 4IJAA 1R5ID 4MO7A 2R5YB 1USSA 4J00A 1F36A 3HKZN 3KP6A 1K7AA 3CJTB 2IRFG 3G71I 2CUZA 1QHHD 2AXTC 4ZYEA 1YO5C 1N77A 3F8FA 4MNUA 4NC7A 2F4OB 1R5HA 2RKHA 3CF5F 2MLKA 1FBUA 2COMA 1Z05A 1T39A 4M72A 1Z3YA 1QHGA 5F64A 5JLWA 3E0JB 2A5WA 3FMRA 2G7HA 1YIOA 2DDBA 2M0CA 3M8JA 4HBLA 1BIAA 2Y48A 4HX4A 4C9YA 1IZ1A 4XOPA 3AL0B 4PFOA 1IRXA 1RUOA 2A3SA 2IW5A 2RAEA 2WB1A 2QWWA 4U0YA 3IV5A 2Y69H 3ONQA 3AG4H 3E6DA 2BYVE 2WV1A 1UAAA 4BNCA 2FMYA 3LSHA 5F6FA 2CQ7A 2VQGA 5JR3A 1X3WB 3M07A 2VBYA 4N9HA 1YJ9I 1QZYA 2IT0A 1B8IA 1JKRC 4GYGA 1XTAA 2CU7A 3BR0A 4UB6C 2KKOA 3C2HA 2VLAA 3VYRB 3GTMJ 1X4PA 3E6CC 2M7BA 1XS9A 3G4SI 2LTPA 4UNOA 1MBEA 1WJFA 2CJJA 1K61A 1BL0A 4LG3A 4O3MA 4UVCA 3BG6A 3IH3A 1SD7A 3KEOA 4HW0A 5BS6A 3AFHA 5ICFA 3G6EI 2JRMA 3JREA 4MLOA 4ESJA 1WJ5A 4WCGA 3D1NI 2F2EA 1OYWA 1U3EM 4RB2C 1KZHA 1Z7LA 3JRDA 4G8XA 2L9VA 2DFEA 2WY7Q 2CW0F 5LRSA 4DYCA 1G3SA 1U5TA 3TOAA 1X3ZB 2LG4A 1ACIA 2VPRA 4ENJA 1VF9A 1OKRA 1XGOA 3GTKJ 3L9FA 5LEKA 3FXRA 3HSRA 1O3QA 3SJMA 2YU9J 4CHUA 4NHJA 2V4JC 1W36C 3DV8A 4Z6YA 1IUFA 1TWAJ 1N25A 3HJEA 5LHHA 4BE1A 4J01A 2EJRA 5EG0B 1S8NA 3FXMA 1Z77A 4PGGA 4U87A 1FOKA 3QQAA 2EA4A 3W3CA 3GTGJ 4D1QA 5D6EA 3K2ZA 2BXYA 1BA5A 3O8HA 5GTHC 4M3GA 4BYYA 1T33A 2Y30A 3JRFA 3OL3A 3OYLA 1J2XA 2X6WA 2M4GA 4FE7A 3RPUD 2VXZA 2UZKA 1LVAA 1N75A 3A0BC 1HC8A 2F5FA 4BJ5C 3NRVA 2F6CA 3FF5A 3JTGA 1E3HA 1LPQA 2FBIA 4K2EA 2VT2A 4PJ0C 1LFBA 4IHSA 4MQVA 3J7AY 3DBHB 2O5RA 4OMYA 4D7MA 5C4XJ 2NRAC 1BIBA 3FZVA 2CGPA 3MKLA 1TQPA 3DU6A 3HXLA 1IO2A 1MZBA 2ZXWH 4HPQA 4M74A 1ETQA 1A36A 2E2HJ 4U0VA 1TNTA 4YIIA 3DCFA 3GTJJ 2RREA 5ILVA 5J1RA 4E7IA 5M3MJ 3CTAA 5FD6A 3O6BB 3H0DA 2NYXA 1UJ8A 1X1DA 2BY0A 3OS1A 2DTRA 2JJ7A 2R7OA 3LNQA 3S17J 1P4AA 3LA3A 2MYSA 2VT3A 1FSEA 4AYBN 2M1BA 3M1EA 4LD5A 5KCMA 2O03A 1YG2A 3WG9A 1AOYA 1LFPA 3PJRA 3J7AO 4C2MJ 3OR1C 1TW2A 2E1MC 4I98B 3I4PA 4XKCA 2PN6A 2DT5A 1S72I 1NK2P 3RYRA 4RB1A 3L2QA 2ISZA 2PLYA 3H3VK 3BR2A 2XVCA 2ZSIB 1O3TA 1SFUA 3SFZA 2EV5A 4XOTA 5FLMJ 2R5ZB 1KQ8A 2RNGA 1WJEA 4KYWA 1ZR4A 4IOCF 1T38A 3ABMH 3WE3A 3DP7A 5CQEA 3TDZC 1ON1A 4LB6B 3OYNA 5J40A 3FXUA 5FLVA 2X85A 3CP2A 1IGNA 4HNUA 2HVRA 2M3AA 2EB7A 3GTLJ 3B6CA 2XAJA 4N9IA 3OYDA 1RUNA 1KU7A 5D8LB 5IT9K 1LKXA 4JX5A 1Z6TA 4CCNA 2FQ3A 2WAFA 2DFFA 2HQRA 3QYBA 3Q0UA 3BY6A 3H5NA 1FYMA 1RKTA 1GVDA 4XLAA 2R0QC 2P8TA 1WJCA 2Z1DA 3C18A 5DS9A 2IS4A 3KLNA 3OOPA 2JK3A 3PQKA 3CF2A 5E20A 3HHHA 5EYRA 1X19A 4G6DA 4JK1X 3BJAA 2BW3B 3RZOJ 2H6CA 4XNFA 3E5QA 3OYGA 2E7WA 3PIPF 3X2QH 4O6JA 2V9PA 3T1BA 4LFUA 3ZOBA 4YFNF 2EFQA 2L9RA 2R7XA 1FOXA 1CQTA 3SHFA 4KIFA 3CCJI 3IHUA 2HKXA 2HYJA 3OIOA 2M9HA 2RDPA 3FDYA 1FWZA 3OOUA 2YU3A 2VODA 4G12A 1ETKA 1RI7A 1ZGWA 1RPWA 1SVMA 3PNTA 3QOEA 5B5EC 3J80K 3TDUC 4HDUA 1TWCJ 2E35A 5DCFA 1R6RA 2Z9OA 3HPHA 3ZMZA 5M5WJ 3BPVA 1YW9A 1I39A 2ETHA 4A0XA 1MMAA 2XAGA 2KIQA 5J3LA 3Q5FA 4YELA 4KN4X 4C3JJ 3G1MA 3WTSC 4ZZLA 3E6BA 4XRMA 2MLGA 3OYHA 3BCAA 2NS8A 2ZB9A 4L9NA 1ZREA 2DOAA 4YFXF 4A6EA 1XCVA 3LAPA 3TKYA 4A3DJ 2BGCA 1MNDA 3AAFA 1FMVA 4RDUA 3KPHA 2MH9A 3L09A 4GRIA 2FRHA 3TBIA 3E1SA
chains in the Genus database with same CATH topology
4BHBA 2V1XA 3JAMZ 5DUIA 1ZGJA 2CFXA 2DK5A 2P5KA 2Q0OA 4ESFA 5FB2A 4N0BA 3SZPA 3DQVC 4KDPA 4EJUA 3DF8A 4U7DA 1XMAA 1OR7A 3W6JB 2ELHA 4L5JA 3ECHA 2P5VA 4XRFA 5H6QA 3R0JA 3M8FA 2Z99A 2YSRA 4ENMA 2P7VB 1ZHFA 4DQ2A 3GFJA 1STZA 2J5PA 3HSEA 2AS5F 3FHZA 1B59A 3EUHA 4ZH4F 3S2WA 5DV5A 1ON2A 2W57A 1Q1HA 5KK1A 2ZMEA 3RKWA 1LDDA 3I59A 3D5LA 2KIFA 1OYIA 5L3DA 1QBJA 2XKPA 2C6YA 5CVJA 2FNAA 4HQMA 2GZWA 1LEBA 1YQAA 2L4AA 5DCMA 3F6OA 1IUYA 1SD5A 3C7JA 3QOPA 3KLOA 4Q5SF 4IHTA 1GXQA 2H27A 3REOA 3HHGA 2A6EF 3MEXA 5L3BA 3ML6A 5LEJA 3JSOA 4CZZA 3N4MA 1KYZA 2L3DA 3MZYA 1FSHA 3GFIA 1XGSA 3MCZA 4GO1A 5CYVA 3SZTA 3R60A 4UXNA 1TQMA 2FEZA 3WE2A 1WRJA 2XHKA 5TJJA 1ZGAA 1KU3A 5CVIA 1ZLKA 1TLHB 3F8BA 4M9SA 1R1VA 1H9GA 1OPCA 3K1PA 2Q8KA 5D5VB 2UXNA 2XIGA 2EV0A 2LF8A 2QQBA 4M6YA 2GA2A 4A0ZA 5D6FA 5D5XB 4IRIA 1IN6A 4RGRA 3LSTA 4WF2A 1DPRA 4CICA 5DCMB 2JPCA 2RVCA 2RGVA 4MGRA 1XMKA 3VB2A 3CLOA 5D5UB 4IRGA 3ZP5A 4WXCA 1O3RA 3QP6A 3K9TA 1XSDA 2JTVA 2EV6A 3ERED 2Z33A 1X3UA 3TGNA 4OU0A 5LGUA 3FM3A 2PG4A 2RC4A 3DPTA 4Z2YA 1BI2A 2K4JA 4I0BA 2O8XA 4EVIA 3KCCA 2YX7A 4ESBA 1Z6RA 1J9IA 3ZMVA 2NS0A 4I09A 4HF2A 1J59A 1F5TA 3O3KA 4P9UA 4OIOF 1I1SA 1FP2A 3CO7C 1REPC 4BHCA 2A5YB 4ASNA 1ZLJA 5A2QZ 4KIGA 1MKMA 4GGGA 1JXSA 3RPQA 3DPLC 1FLIA 1ZAOA 2EA2A 1IF1A 3L2CA 2BE5F 2Y75A 4CYDA 3RYPA 1XDUA 2IVMA 2O6GE 2VOOA 1IRGA 5JHUA 4DNCA 3KP2A 1O57A 2RNJA 2IJLA 4Y13A 3IRRA 3EQLF 5JI6A 1DPUA 3CUQA 1SFXA 4MEYF 2ZKZA 1USTA 2IA2A 5HOOA 4WXDA 1ZRFA 1B9NA 1F9NA 2K27A 4O5VA 1ODDA 1WSUA 4L18B 2M45A 3FMQA 2QBYA 1SMYF 1E17A 2VC1A 1WWXA 4OIRF 4I02A 5D5WB 3P9CA 5D8KB 4S05A 2VONA 3J81Z 1LEAA 3EETA 4OIQF 1B6AA 3KP3A 5LBQA 3Q9SA 2DI3A 2XUBA 1BC8C 1U6GA 5E1WA 4A0YA 3E5UA 1XB4A 2VBZA 5CJ9A 4L5IA 2HYFA 1W5TA 3QPHA 2DQRA 5F1RA 3PFIA 4L0YB 3HOTA 2R7FA 1Y0UA 5E8GA 3BP8A 2YX4A 1JGSA 2E1NA 4EJWA 3WTXC 2P7CB 5K5OA 2AXLA 1XD7A 4PCQA 2QQAA 3HRUA 2XROA 3F8NA 1IN7A 3HYIA 1IN8A 1C0WA 3IKVA 1QPMA 4UV9A 1GXPA 3WODF 4RGUA 3EDPA 2VE8A 4U0WA 2E7XA 2M30A 2OA4A 2RV8A 2HTSA 3V7CA 1YLFA 5D4RA 3GFMA 1ZG1A 4H0EA 2HGCA 1P2FA 3MWMA 2EWNA 4FX4A 1FZPB 3KETA 3EYIA 4KMFA 4AIKA 4LLNA 3IRQA 1W4MA 3FX3A 1FY7A 3K1NA 3WGGA 2DLLA 3CJNA 3LFKA 3LQQA 5J6XA 2IP2A 3QPTA 4LG0B 1D8KA 2ESHA 4A5MA 2NNNA 1MJBA 3I5UA 4A12A 2FXAA 1CF7B 1HSJA 1O7LA 2ACJA 3WU1B 3ZMUA 2EK5A 4EJTA 5E18F 1R36A 2KRFA 2Y0MA 2DU9A 3GYHX 4RGSA 3M9AA 1IW7F 2DAOA 5FO5A 1B9MA 3M7GA 1UHMA 4HX8A 2OQRA 4LK1F 3BDDA 4Q4ZF 4I0AA 3PQJA 1FBQA 1Z91A 4GCVA 3GW2A 3H3UA 1Z1DA 3G73A 4RB3C 4YFKF 2ISYA 4M71A 3GO5A 1PP7U 2W25A 3BJ6A 3F8CA 1BC7C 1GHCA 3FMSA 3RJPA 4HQEA 3I59B 5ILUA 2OD5A 1HKTA 2WC2A 4EJVA 5LGNA 2O61A 2PQ8A 2QVOA 2ZFWA 2HQNA 3LWFA 4IVNA 3JTHA 5ICEA 1IXSB 3MQ0A 1PDNC 3B02A 1R1UA 4ZYDA 3HUGA 4AIHA 3QU3A 1HW1A 4HF0A 1QZZA 2IA0A 1MJ9A 2HDCA 1IXCA 4JBAA 2BEOA 5L3FA 2JSCA 4MTDA 2PFBA 4LJZF 3NEUA 4EGYA 2L4MA 5FFZA 4EMSA 2J5OA 4BAYA 5ED4A 1KGSA 3P7NA 3GLXA 1D3YA 1H0MA 4G9YA 1FYLA 4S04A 4G6QA 3BPXA 4G7OF 2XV4S 5ICGA 3T8TA 4FT8A 4XSZF 1UB9A 1UCRA 4P55A 4BHPA 5J8CA 4ZYHA 1BOAA 3DKWA 1BI0A 2YPRA 4UVBA 5CLSA 3HRTA 5FLXK 1SD6A 3HTUA 3ABUA 5A2QK 2B0LA 1XGNA 2VE9A 3VOEA 4FX0A 1HSTA 4HAMA 4NB5A 2QZ8A 2ESNA 4EM1A 2H6BA 2LSOA 4GXOA 2GA1A 1ZG3A 3ZMTA 1J5YA 5DUKA 2EFOA 4WWCA 2HWVA 3M8EA 4UUVA 2FA5A 2LDUA 5L3EA 3F23A 1L3LA 3I0TA 1L0OC 3HRSA 5FGMA 3T8RA 3NQOA 1P4WA 5H6RA 5DD8A 1BM9A 1KA8A 3T0YA 3RPUA 1I6XA 1P6RA 3KFWX 4LLLA 2FSWA 2Z5UA 4JQFA 4L9VA 1U2WA 1TQIA 1LDKB 3IKTA 5HS7A 1R22A 2P4WA 1DUXC 1DDNA 1T0FA 4XBFA 2RQPA 5D4SA 2V79A 2HEOA 3O2PE 2KJCA 1XDSA 1F1ZA 1T6SA 1R7JA 3QRFF 3HTSB 2PMUA 4RS8A 2D45A 1ZARA 2XAHA 3CUQB 1QNTA 1G4DA 3QU6A 2XAQA 2E1CA 1R00A 2M5WA 4PGHA 4AVPA 4KUMA 4LK0F 2EFWA 3GUDA 3LAJA 2W24A 1T98A 4KMUX 1V3FA 2VC0A 2OU2A 3N97A 2IPQX 3MAJA 3F8MA 5E1ZB 4HLYA 4EM2A 4KN7X 3TOBA 4G94A 3BJOA 1UHWA 3JAMK 2NAZA 4TV7A 4EV0A 1LNWA 5CVUA 1AWCA 1HW5A 2O0YA 4CXFA 4XLPF 4LMYA 2STWA 2WV0A 4D0PA 4EGZA 1KQ0A 5JFRA 4Q47A 3BWGA 3FWEA 5DD4A 2HKOA 2MA3A 1BN5A 3D0SA 3ZN0A 4WX9A 2MD5A 3WTYC 4RB0A 2CG4A 2GXGA 1EV7A 5E17F 2X0LA 5FFXA 3WTUC 3F72A 1U8RA 4EQQA 1TTYA 2GWRA 4F7ZA 2UWMA 4I2OA 2ZCWA 3P9IA 1LJ9A 3V8LA 3T5XA 4B09A 5EEGA 3COAC 3W6KB 3EYYA 2W85A 1JHFA 2XAFA 4KIBA 3E6MA 3ABTA 5DDGA 5K5RA 3WTTC 4XSXF 4LB5A 3GZ5A 1J0RA 4IPAA 2O3FA 1LDJA 5K5QA 1TW3A 3KEQA 4ZYGA 4IRHA 2HZTA 4P5OA 1QGPA 3FM5A 2FF4A 3I54A 2P6SA 3F6VA 3IWZA 2DFIA 5HLGA 2F5EA 1K79A 4LG0A 2KIUA 3HSFA 1R23A 4M9ZA 3F3XA 4RGXA 4E70A 2ZBKA 2DW4A 2KIMA 1G3WA 3CUQC 4KT5C 4M73A 3BROA 1LQ1A 2RN7A 4AIJA 3ZQ7A 4LGWA 2VBXA 2XRNA 3IWFA 4HV6A 2ZNZA 1DP7P 3H92A 3IC7A 2MC3A 2NNYA 4FHTA 2F5CA 1D8JA 1IAWA 1SD4A 3SQNA 3GF2A 5LHIA 3K1MA 2ZMEB 3ROUA 5AONA 2A07F 4HF1A 5AIPA 1HXDA 4U88A 1T2KA 5K1YA 2VOPA 3E97A 3GVAA 2ADUA 4KICA 1E2XA 1R58A 2QLZA 5DEQA 4KNYA 5TRDA 4L9JA 3RIRA 2PBIA 4AWXB 1UFMA 3R4KA 2DBBA 2CWEA 4KFCA 2CQKA 3I53A 5HLIA 1R5GA 3LQRA 1G6NA 2A6HF 3E5XA 2QM3A 5JVTA 4NQWA 1RIOH 5IT9Z 1MGTA 3ECOA 2JZYA 1HKQA 1HW2A 3TO9A 3OV8A 3KP7A 4MQ9F 4PDKA 3GX4X 3V8JA 3TO6A 1FT9A 2HOEA 2FMLA 2A61A 1WKMA 2JPBA 4CGZA 3GZ6A 1I27A 1IRFA 1IN4A 2R7DA 1U5TC 1ZRDA 1I5ZA 3MFKA 2W84A 1TNSA 4BQAA 1ZH5A 1Z7UA 2XGXA 3WTZA 5LRRA 4A6DA 4R79A 4OIPF 3WTVC 1U5TB 1HKSA 3ZMDA 2KJBA 3GFLA 2V1DA 4P96A 2K02A 3VFZA 1YTYA 1FC3A 2H94A 3I58A 4UVAA 1KU2A 1S29A 2QENA 4GYIA 2WTEA 5HDKA 1P92A 5BPIA 2FBKA 2F5DA 1KYWA 1MDMA 5HDGA 2Q2EA 1NHAA 1WI9A 3ZPLA 1B1BA 5KVRA 4ON0A 1F4KA 2V9VA 1W7PD 1XGMA 5EEHA 2QUFA 3K69A 1ONVA 3GWZA 2FOKA 1PP8F 1S3JA 3JW4A 2OQGA 4BXUA 5HS8A 4M9XA 2EFPA 2MBFA 3WGHA 3LA7A 2V6CA 1XN7A 4HDVA 1W7PA 4HZFA 4I7HA 5FD5A 2DQLA 3QAHA 2ZXJA 2DO7A 1QO0D 4L9TA 4Q48A 5HVQC 3KZYA 2L02A 4G7ZF 4HA8A 4M6XA 1FP1D 1IN5A 5CVVA 1Z9CA 6PAXA 1P4XA 4BH9A 2M8EA 3ISPA 3KE2A 3L00A 1J7KA 5LHGA 4L0ZB 1YW7A 1K78A 2A68F 4YIFA 2XKOA 4P9FA 4R8HA 1S6LA 5HDNA 2K4BA 2ZJ2A 1TBXA 4HX7A 3C1DA 1QQIA 3F21A 4A5NA 1HQCA 4IXAA 5DYMA 2YR2A 1O3SA 5BOXA 4AD9A 4I01A 1SAXA 5E1XA 4HYEA 2P6TA 4Y15A 2G9WA 4OINF 3RI4A 2VN2A 2M87A 3DXJF 2HS5A 3V7RA 3ULQB 2A69F 3BZ6A 4R1HA 3V4GA 3JSPA 1BBYA 3J81K 1RZ4A 1GVJA 2ZO4A 3CUOA 1ZN2A 4ENNA 2LKPA 5H20A 5LLQA 3I64A 2L54A 4RAZA 1VTNC 3E3VA 2H09A 1YYVA 2D1VA 1KQ9A 4IF4A 5E8IA 3FXQA 3LA2A 1W5SA 2GIVA 2IA1A 4CO8A 4PZJA 1BI3A 5J8FA 4ZZDA 2CYYA 1XSXA 1ULYA 2L01A 1YW8A 4LLGF 3CO6C 3WGIA 2V1UA 2QYOA 2PEXA 1JE8A 3F22A 2ZNYA 5HLHA 3WTWC 2LNBA 1W7PB 2XASA 3H3ZA 3KP4A 1G3TA 2K86A 2R3SA 1FX7A 4YG2F 4CDGA 2PMHA 1CGPA 1RNLA 1PUEE 2HTJA 2DK8A 5ILSA 4MHGA 3RTRA 3BOQA 3DFGA 1S7OA 2EFNA 4WXHA 1YS7A 3G3ZA 1V4RA 2UXXA 1G3YA 1XCBA 1K78B 1BJAA 3U9GA 2FE3A 2G7UA 2WWYA 1IXRC 2TDXA 1MD0A 3U1DA 2D2WA 3R0AA 3V8KA 3TQNA 2HFHA 1MDMB 2CO5A 3DEUA 3C3WA 1SFEA 2FBHA 1JHHA 1R1TA 1YFHA 1FBSA 2DPUA 3CDHA 5FLXZ 5HS9A 5BQTA 3U2RA 1HBXG 5LGTA 2QQ9A 4HLXA 2FU4A 4B8XA 1ZG5A 5BMZA 4ENKA 1I1GA 2D1HA 3VODA 1BI1A 5IT3A 3J80Z 1YS6A 2CSOA 1FNNA 3TO7A 4MEXF 4QWQA 1CF7A 1WQ2A 4XLNF 5L3GA 2BV6A 4ETSA 2OBPA 4A2UA 3IL2A 1FYKA 2K7LA 4G7HF 4HV5A 2P5LC 1U78A 4MTEA 1S7AA 3B73A 4KA4A 3V7SA 2HYGD 3HOSA 2X4HA 5L3CA 3GEZA 2FNPA 5AIQA 3P9KA 4OMZA 4RAYA 4WK8F 5BPDA 2PJPA 3QP5A 1SMTA 3K0LA 1FPQA 2MH2A 3ZMSA 1A04A 1B4AA 1EH7A 2JT1A 4HOBA 1EH8A 2BBYA 3R6SA 4UHTA 3HRMA 4Y17A 4EJOA 2GQQA 4OOIA 2OAZA 1LB2A 4EM0B 3HIFA 3GXOA 3RKYA 1KU9A 1K6OA 3SXYA 2LF7A 2Z3YA 3ELKA 3ZN1A 3KP5A 5ICCA 2GAUA 2HR3A 1O7FA 3WU0A 3L7WA 1ZYRF 2DPDA 1J75A 1OMIA 1MJAA 3R61A 3Q9VA 1ZRCA 2OZ6A 1OYYA 2JRTA 4U7BA 3RKXA 5ERIA 4QLCU 4UV8A 3VEPA 2QBYB 3MZHA 1XSVA 1H9TA 1D5VA 3KZZA 2OZUA 2PI0A 3RDIA 1EH6A 2STTA 3I71A 5CVRA 2VBWA 4IJAA 1USSA 3KP6A 1K7AA 2IRFG 4ZYEA 1YO5C 3F8FA 4MNUA 1R5HA 2RKHA 2MLKA 1FBUA 2COMA 1Z05A 1T39A 4M72A 5F64A 3FMRA 2G7HA 1YIOA 4HBLA 1BIAA 2Y48A 4HX4A 1IZ1A 1RUOA 2A3SA 2IW5A 2QWWA 4U0YA 3E6DA 2BYVE 4BNCA 2FMYA 5F6FA 5JR3A 2VBYA 4N9HA 1QZYA 2IT0A 4GYGA 2KKOA 3E6CC 4UNOA 4O3MA 4UVCA 1SD7A 3KEOA 4HW0A 5BS6A 5ICFA 4ESJA 4WCGA 2F2EA 1OYWA 1U3EM 4RB2C 4G8XA 5LRSA 2CW0F 1G3SA 1U5TA 3TOAA 4ENJA 1OKRA 1XGOA 3L9FA 5LEKA 3FXRA 3HSRA 1O3QA 4CHUA 4NHJA 3DV8A 5LHHA 2EJRA 1S8NA 1FOKA 4PGGA 2EA4A 5D6EA 3K2ZA 4BYYA 1J2XA 2VXZA 2UZKA 1LVAA 2F5FA 3NRVA 3FF5A 3JTGA 2FBIA 4K2EA 2VT2A 4IHSA 4MQVA 4OMYA 2NRAC 1BIBA 3FZVA 2CGPA 1TQPA 1MZBA 4M74A 4U0VA 1TNTA 4YIIA 5ILVA 3CTAA 5FD6A 3O6BB 2NYXA 2DTRA 1P4AA 3LA3A 2VT3A 1FSEA 2M1BA 3M1EA 4LD5A 3WG9A 2O03A 1YG2A 1AOYA 3J7AO 1TW2A 4I98B 3I4PA 2PN6A 2DT5A 2ISZA 3RYRA 4RB1A 2PLYA 2XVCA 1O3TA 1SFUA 3SFZA 2EV5A 1KQ8A 4KYWA 1T38A 3WE3A 3DP7A 3TDZC 1ON1A 4LB6B 3FXUA 2EB7A 2XAJA 1RUNA 4N9IA 1KU7A 5D8LB 5IT9K 1Z6TA 2FQ3A 2HQRA 3BY6A 1FYMA 2P8TA 3C18A 3KLNA 3OOPA 3PQKA 5E20A 3HHHA 4G6DA 4JK1X 3BJAA 2H6CA 3E5QA 2E7WA 4O6JA 3T1BA 4LFUA 4YFNF 2EFQA 3SHFA 4KIFA 3IHUA 2HKXA 2RDPA 1FWZA 2YU3A 2VODA 1RI7A 3J80K 3TDUC 4HDUA 5DCFA 2Z9OA 3ZMZA 3BPVA 1YW9A 2ETHA 4A0XA 2XAGA 3Q5FA 4KN4X 3WTSC 4ZZLA 3E6BA 2MLGA 4L9NA 1ZREA 4YFXF 4A6EA 1XCVA 3LAPA 3TKYA 2BGCA 3AAFA 2MH9A 3L09A 2FRHA 2GXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHB A;  2V1X A;  3JAM Z;  5DUI A;  1ZGJ A;  2CFX A;  2DK5 A;  2P5K A;  2Q0O A;  4ESF A;  5FB2 A;  4N0B A;  3SZP A;  3DQV C;  4KDP A;  4EJU A;  3DF8 A;  4U7D A;  1XMA A;  1OR7 A;  3W6J B;  2ELH A;  4L5J A;  3ECH A;  2P5V A;  4XRF A;  5H6Q A;  3R0J A;  3M8F A;  2Z99 A;  2YSR A;  4ENM A;  2P7V B;  1ZHF A;  4DQ2 A;  3GFJ A;  1STZ A;  2J5P A;  3HSE A;  2AS5 F;  3FHZ A;  1B59 A;  3EUH A;  4ZH4 F;  3S2W A;  5DV5 A;  1ON2 A;  2W57 A;  1Q1H A;  5KK1 A;  2ZME A;  3RKW A;  1LDD A;  3I59 A;  3D5L A;  2KIF A;  1OYI A;  5L3D A;  1QBJ A;  2XKP A;  2C6Y A;  5CVJ A;  2FNA A;  4HQM A;  2GZW A;  1LEB A;  1YQA A;  2L4A A;  5DCM A;  3F6O A;  1IUY A;  1SD5 A;  3C7J A;  3QOP A;  3KLO A;  4Q5S F;  4IHT A;  1GXQ A;  2H27 A;  3REO A;  3HHG A;  2A6E F;  3MEX A;  5L3B A;  3ML6 A;  5LEJ A;  3JSO A;  4CZZ A;  3N4M A;  1KYZ A;  2L3D A;  3MZY A;  1FSH A;  3GFI A;  1XGS A;  3MCZ A;  4GO1 A;  5CYV A;  3SZT A;  3R60 A;  4UXN A;  1TQM A;  2FEZ A;  3WE2 A;  1WRJ A;  2XHK A;  5TJJ A;  1ZGA A;  1KU3 A;  5CVI A;  1ZLK A;  1TLH B;  3F8B A;  4M9S A;  1R1V A;  1H9G A;  1OPC A;  3K1P A;  2Q8K A;  5D5V B;  2UXN A;  2XIG A;  2EV0 A;  2LF8 A;  2QQB A;  4M6Y A;  2GA2 A;  4A0Z A;  5D6F A;  5D5X B;  4IRI A;  1IN6 A;  4RGR A;  3LST A;  4WF2 A;  1DPR A;  4CIC A;  5DCM B;  2JPC A;  2RVC A;  2RGV A;  4MGR A;  1XMK A;  3VB2 A;  3CLO A;  5D5U B;  4IRG A;  3ZP5 A;  4WXC A;  1O3R A;  3QP6 A;  3K9T A;  1XSD A;  2JTV A;  2EV6 A;  3ERE D;  2Z33 A;  1X3U A;  3TGN A;  4OU0 A;  5LGU A;  3FM3 A;  2PG4 A;  2RC4 A;  3DPT A;  4Z2Y A;  1BI2 A;  2K4J A;  4I0B A;  2O8X A;  4EVI A;  3KCC A;  2YX7 A;  4ESB A;  1Z6R A;  1J9I A;  3ZMV A;  2NS0 A;  4I09 A;  4HF2 A;  1J59 A;  1F5T A;  3O3K A;  4P9U A;  4OIO F;  1I1S A;  1FP2 A;  3CO7 C;  1REP C;  4BHC A;  2A5Y B;  4ASN A;  1ZLJ A;  5A2Q Z;  4KIG A;  1MKM A;  4GGG A;  1JXS A;  3RPQ A;  3DPL C;  1FLI A;  1ZAO A;  2EA2 A;  1IF1 A;  3L2C A;  2BE5 F;  2Y75 A;  4CYD A;  3RYP A;  1XDU A;  2IVM A;  2O6G E;  2VOO A;  1IRG A;  5JHU A;  4DNC A;  3KP2 A;  1O57 A;  2RNJ A;  2IJL A;  4Y13 A;  3IRR A;  3EQL F;  5JI6 A;  1DPU A;  3CUQ A;  1SFX A;  4MEY F;  2ZKZ A;  1UST A;  2IA2 A;  5HOO A;  4WXD A;  1ZRF A;  1B9N A;  1F9N A;  2K27 A;  4O5V A;  1ODD A;  1WSU A;  4L18 B;  2M45 A;  3FMQ A;  2QBY A;  1SMY F;  1E17 A;  2VC1 A;  1WWX A;  4OIR F;  4I02 A;  5D5W B;  3P9C A;  5D8K B;  4S05 A;  2VON A;  3J81 Z;  1LEA A;  3EET A;  4OIQ F;  1B6A A;  3KP3 A;  5LBQ A;  3Q9S A;  2DI3 A;  2XUB A;  1BC8 C;  1U6G A;  5E1W A;  4A0Y A;  3E5U A;  1XB4 A;  2VBZ A;  5CJ9 A;  4L5I A;  2HYF A;  1W5T A;  3QPH A;  2DQR A;  5F1R A;  3PFI A;  4L0Y B;  3HOT A;  2R7F A;  1Y0U A;  5E8G A;  3BP8 A;  2YX4 A;  1JGS A;  2E1N A;  4EJW A;  3WTX C;  2P7C B;  5K5O A;  2AXL A;  1XD7 A;  4PCQ A;  2QQA A;  3HRU A;  2XRO A;  3F8N A;  1IN7 A;  3HYI A;  1IN8 A;  1C0W A;  3IKV A;  1QPM A;  4UV9 A;  1GXP A;  3WOD F;  4RGU A;  3EDP A;  2VE8 A;  4U0W A;  2E7X A;  2M30 A;  2OA4 A;  2RV8 A;  2HTS A;  3V7C A;  1YLF A;  5D4R A;  3GFM A;  1ZG1 A;  4H0E A;  2HGC A;  1P2F A;  3MWM A;  2EWN A;  4FX4 A;  1FZP B;  3KET A;  3EYI A;  4KMF A;  4AIK A;  4LLN A;  3IRQ A;  1W4M A;  3FX3 A;  1FY7 A;  3K1N A;  3WGG A;  2DLL A;  3CJN A;  3LFK A;  3LQQ A;  5J6X A;  2IP2 A;  3QPT A;  4LG0 B;  1D8K A;  2ESH A;  4A5M A;  2NNN A;  1MJB A;  3I5U A;  4A12 A;  2FXA A;  1CF7 B;  1HSJ A;  1O7L A;  2ACJ A;  3WU1 B;  3ZMU A;  2EK5 A;  4EJT A;  5E18 F;  1R36 A;  2KRF A;  2Y0M A;  2DU9 A;  3GYH X;  4RGS A;  3M9A A;  1IW7 F;  2DAO A;  5FO5 A;  1B9M A;  3M7G A;  1UHM A;  4HX8 A;  2OQR A;  4LK1 F;  3BDD A;  4Q4Z F;  4I0A A;  3PQJ A;  1FBQ A;  1Z91 A;  4GCV A;  3GW2 A;  3H3U A;  1Z1D A;  3G73 A;  4RB3 C;  4YFK F;  2ISY A;  4M71 A;  3GO5 A;  1PP7 U;  2W25 A;  3BJ6 A;  3F8C A;  1BC7 C;  1GHC A;  3FMS A;  3RJP A;  4HQE A;  3I59 B;  5ILU A;  2OD5 A;  1HKT A;  2WC2 A;  4EJV A;  5LGN A;  2O61 A;  2PQ8 A;  2QVO A;  2ZFW A;  2HQN A;  3LWF A;  4IVN A;  3JTH A;  5ICE A;  1IXS B;  3MQ0 A;  1PDN C;  3B02 A;  1R1U A;  4ZYD A;  3HUG A;  4AIH A;  3QU3 A;  1HW1 A;  4HF0 A;  1QZZ A;  2IA0 A;  1MJ9 A;  2HDC A;  1IXC A;  4JBA A;  2BEO A;  5L3F A;  2JSC A;  4MTD A;  2PFB A;  4LJZ F;  3NEU A;  4EGY A;  2L4M A;  5FFZ A;  4EMS A;  2J5O A;  4BAY A;  5ED4 A;  1KGS A;  3P7N A;  3GLX A;  1D3Y A;  1H0M A;  4G9Y A;  1FYL A;  4S04 A;  4G6Q A;  3BPX A;  4G7O F;  2XV4 S;  5ICG A;  3T8T A;  4FT8 A;  4XSZ F;  1UB9 A;  1UCR A;  4P55 A;  4BHP A;  5J8C A;  4ZYH A;  1BOA A;  3DKW A;  1BI0 A;  2YPR A;  4UVB A;  5CLS A;  3HRT A;  5FLX K;  1SD6 A;  3HTU A;  3ABU A;  5A2Q K;  2B0L A;  1XGN A;  2VE9 A;  3VOE A;  4FX0 A;  1HST A;  4HAM A;  4NB5 A;  2QZ8 A;  2ESN A;  4EM1 A;  2H6B A;  2LSO A;  4GXO A;  2GA1 A;  1ZG3 A;  3ZMT A;  1J5Y A;  5DUK A;  2EFO A;  4WWC A;  2HWV A;  3M8E A;  4UUV A;  2FA5 A;  2LDU A;  5L3E A;  3F23 A;  1L3L A;  3I0T A;  1L0O C;  3HRS A;  5FGM A;  3T8R A;  3NQO A;  1P4W A;  5H6R A;  5DD8 A;  1BM9 A;  1KA8 A;  3T0Y A;  3RPU A;  1I6X A;  1P6R A;  3KFW X;  4LLL A;  2FSW A;  2Z5U A;  4JQF A;  4L9V A;  1U2W A;  1TQI A;  1LDK B;  3IKT A;  5HS7 A;  1R22 A;  2P4W A;  1DUX C;  1DDN A;  1T0F A;  4XBF A;  2RQP A;  5D4S A;  2V79 A;  2HEO A;  3O2P E;  2KJC A;  1XDS A;  1F1Z A;  1T6S A;  1R7J A;  3QRF F;  3HTS B;  2PMU A;  4RS8 A;  2D45 A;  1ZAR A;  2XAH A;  3CUQ B;  1QNT A;  1G4D A;  3QU6 A;  2XAQ A;  2E1C A;  1R00 A;  2M5W A;  4PGH A;  4AVP A;  4KUM A;  4LK0 F;  2EFW A;  3GUD A;  3LAJ A;  2W24 A;  1T98 A;  4KMU X;  1V3F A;  2VC0 A;  2OU2 A;  3N97 A;  2IPQ X;  3MAJ A;  3F8M A;  5E1Z B;  4HLY A;  4EM2 A;  4KN7 X;  3TOB A;  4G94 A;  3BJO A;  1UHW A;  3JAM K;  2NAZ A;  4TV7 A;  4EV0 A;  1LNW A;  5CVU A;  1AWC A;  1HW5 A;  2O0Y A;  4CXF A;  4XLP F;  4LMY A;  2STW A;  2WV0 A;  4D0P A;  4EGZ A;  1KQ0 A;  5JFR A;  4Q47 A;  3BWG A;  3FWE A;  5DD4 A;  2HKO A;  2MA3 A;  1BN5 A;  3D0S A;  3ZN0 A;  4WX9 A;  2MD5 A;  3WTY C;  4RB0 A;  2CG4 A;  2GXG A;  1EV7 A;  5E17 F;  2X0L A;  5FFX A;  3WTU C;  3F72 A;  1U8R A;  4EQQ A;  1TTY A;  2GWR A;  4F7Z A;  2UWM A;  4I2O A;  2ZCW A;  3P9I A;  1LJ9 A;  3V8L A;  3T5X A;  4B09 A;  5EEG A;  3COA C;  3W6K B;  3EYY A;  2W85 A;  1JHF A;  2XAF A;  4KIB A;  3E6M A;  3ABT A;  5DDG A;  5K5R A;  3WTT C;  4XSX F;  4LB5 A;  3GZ5 A;  1J0R A;  4IPA A;  2O3F A;  1LDJ A;  5K5Q A;  1TW3 A;  3KEQ A;  4ZYG A;  4IRH A;  2HZT A;  4P5O A;  1QGP A;  3FM5 A;  2FF4 A;  3I54 A;  2P6S A;  3F6V A;  3IWZ A;  2DFI A;  5HLG A;  2F5E A;  1K79 A;  4LG0 A;  2KIU A;  3HSF A;  1R23 A;  4M9Z A;  3F3X A;  4RGX A;  4E70 A;  2ZBK A;  2DW4 A;  2KIM A;  1G3W A;  3CUQ C;  4KT5 C;  4M73 A;  3BRO A;  1LQ1 A;  2RN7 A;  4AIJ A;  3ZQ7 A;  4LGW A;  2VBX A;  2XRN A;  3IWF A;  4HV6 A;  2ZNZ A;  1DP7 P;  3H92 A;  3IC7 A;  2MC3 A;  2NNY A;  4FHT A;  2F5C A;  1D8J A;  1IAW A;  1SD4 A;  3SQN A;  3GF2 A;  5LHI A;  3K1M A;  2ZME B;  3ROU A;  5AON A;  2A07 F;  4HF1 A;  5AIP A;  1HXD A;  4U88 A;  1T2K A;  5K1Y A;  2VOP A;  3E97 A;  3GVA A;  2ADU A;  4KIC A;  1E2X A;  1R58 A;  2QLZ A;  5DEQ A;  4KNY A;  5TRD A;  4L9J A;  3RIR A;  2PBI A;  4AWX B;  1UFM A;  3R4K A;  2DBB A;  2CWE A;  4KFC A;  2CQK A;  3I53 A;  5HLI A;  1R5G A;  3LQR A;  1G6N A;  2A6H F;  3E5X A;  2QM3 A;  5JVT A;  4NQW A;  1RIO H;  5IT9 Z;  1MGT A;  3ECO A;  2JZY A;  1HKQ A;  1HW2 A;  3TO9 A;  3OV8 A;  3KP7 A;  4MQ9 F;  4PDK A;  3GX4 X;  3V8J A;  3TO6 A;  1FT9 A;  2HOE A;  2FML A;  2A61 A;  1WKM A;  2JPB A;  4CGZ A;  3GZ6 A;  1I27 A;  1IRF A;  1IN4 A;  2R7D A;  1U5T C;  1ZRD A;  1I5Z A;  3MFK A;  2W84 A;  1TNS A;  4BQA A;  1ZH5 A;  1Z7U A;  2XGX A;  3WTZ A;  5LRR A;  4A6D A;  4R79 A;  4OIP F;  3WTV C;  1U5T B;  1HKS A;  3ZMD A;  2KJB A;  3GFL A;  2V1D A;  4P96 A;  2K02 A;  3VFZ A;  1YTY A;  1FC3 A;  2H94 A;  3I58 A;  4UVA A;  1KU2 A;  1S29 A;  2QEN A;  4GYI A;  2WTE A;  5HDK A;  1P92 A;  5BPI A;  2FBK A;  2F5D A;  1KYW A;  1MDM A;  5HDG A;  2Q2E A;  1NHA A;  1WI9 A;  3ZPL A;  1B1B A;  5KVR A;  4ON0 A;  1F4K A;  2V9V A;  1W7P D;  1XGM A;  5EEH A;  2QUF A;  3K69 A;  1ONV A;  3GWZ A;  2FOK A;  1PP8 F;  1S3J A;  3JW4 A;  2OQG A;  4BXU A;  5HS8 A;  4M9X A;  2EFP A;  2MBF A;  3WGH A;  3LA7 A;  2V6C A;  1XN7 A;  4HDV A;  1W7P A;  4HZF A;  4I7H A;  5FD5 A;  2DQL A;  3QAH A;  2ZXJ A;  2DO7 A;  1QO0 D;  4L9T A;  4Q48 A;  5HVQ C;  3KZY A;  2L02 A;  4G7Z F;  4HA8 A;  4M6X A;  1FP1 D;  1IN5 A;  5CVV A;  1Z9C A;  6PAX A;  1P4X A;  4BH9 A;  2M8E A;  3ISP A;  3KE2 A;  3L00 A;  1J7K A;  5LHG A;  4L0Z B;  1YW7 A;  1K78 A;  2A68 F;  4YIF A;  2XKO A;  4P9F A;  4R8H A;  1S6L A;  5HDN A;  2K4B A;  2ZJ2 A;  1TBX A;  4HX7 A;  3C1D A;  1QQI A;  3F21 A;  4A5N A;  1HQC A;  4IXA A;  5DYM A;  2YR2 A;  1O3S A;  5BOX A;  4AD9 A;  4I01 A;  1SAX A;  5E1X A;  4HYE A;  2P6T A;  4Y15 A;  2G9W A;  4OIN F;  3RI4 A;  2VN2 A;  2M87 A;  3DXJ F;  2HS5 A;  3V7R A;  3ULQ B;  2A69 F;  3BZ6 A;  4R1H A;  3V4G A;  3JSP A;  1BBY A;  3J81 K;  1RZ4 A;  1GVJ A;  2ZO4 A;  3CUO A;  1ZN2 A;  4ENN A;  2LKP A;  5H20 A;  5LLQ A;  3I64 A;  2L54 A;  4RAZ A;  1VTN C;  3E3V A;  2H09 A;  1YYV A;  2D1V A;  1KQ9 A;  4IF4 A;  5E8I A;  3FXQ A;  3LA2 A;  1W5S A;  2GIV A;  2IA1 A;  4CO8 A;  4PZJ A;  1BI3 A;  5J8F A;  4ZZD A;  2CYY A;  1XSX A;  1ULY A;  2L01 A;  1YW8 A;  4LLG F;  3CO6 C;  3WGI A;  2V1U A;  2QYO A;  2PEX A;  1JE8 A;  3F22 A;  2ZNY A;  5HLH A;  3WTW C;  2LNB A;  1W7P B;  2XAS A;  3H3Z A;  3KP4 A;  1G3T A;  2K86 A;  2R3S A;  1FX7 A;  4YG2 F;  4CDG A;  2PMH A;  1CGP A;  1RNL A;  1PUE E;  2HTJ A;  2DK8 A;  5ILS A;  4MHG A;  3RTR A;  3BOQ A;  3DFG A;  1S7O A;  2EFN A;  4WXH A;  1YS7 A;  3G3Z A;  1V4R A;  2UXX A;  1G3Y A;  1XCB A;  1K78 B;  1BJA A;  3U9G A;  2FE3 A;  2G7U A;  2WWY A;  1IXR C;  2TDX A;  1MD0 A;  3U1D A;  2D2W A;  3R0A A;  3V8K A;  3TQN A;  2HFH A;  1MDM B;  2CO5 A;  3DEU A;  3C3W A;  1SFE A;  2FBH A;  1JHH A;  1R1T A;  1YFH A;  1FBS A;  2DPU A;  3CDH A;  5FLX Z;  5HS9 A;  5BQT A;  3U2R A;  1HBX G;  5LGT A;  2QQ9 A;  4HLX A;  2FU4 A;  4B8X A;  1ZG5 A;  5BMZ A;  4ENK A;  1I1G A;  2D1H A;  3VOD A;  1BI1 A;  5IT3 A;  3J80 Z;  1YS6 A;  2CSO A;  1FNN A;  3TO7 A;  4MEX F;  4QWQ A;  1CF7 A;  1WQ2 A;  4XLN F;  5L3G A;  2BV6 A;  4ETS A;  2OBP A;  4A2U A;  3IL2 A;  1FYK A;  2K7L A;  4G7H F;  4HV5 A;  2P5L C;  1U78 A;  4MTE A;  1S7A A;  3B73 A;  4KA4 A;  3V7S A;  2HYG D;  3HOS A;  2X4H A;  5L3C A;  3GEZ A;  2FNP A;  5AIQ A;  3P9K A;  4OMZ A;  4RAY A;  4WK8 F;  5BPD A;  2PJP A;  3QP5 A;  1SMT A;  3K0L A;  1FPQ A;  2MH2 A;  3ZMS A;  1A04 A;  1B4A A;  1EH7 A;  2JT1 A;  4HOB A;  1EH8 A;  2BBY A;  3R6S A;  4UHT A;  3HRM A;  4Y17 A;  4EJO A;  2GQQ A;  4OOI A;  2OAZ A;  1LB2 A;  4EM0 B;  3HIF A;  3GXO A;  3RKY A;  1KU9 A;  1K6O A;  3SXY A;  2LF7 A;  2Z3Y A;  3ELK A;  3ZN1 A;  3KP5 A;  5ICC A;  2GAU A;  2HR3 A;  1O7F A;  3WU0 A;  3L7W A;  1ZYR F;  2DPD A;  1J75 A;  1OMI A;  1MJA A;  3R61 A;  3Q9V A;  1ZRC A;  2OZ6 A;  1OYY A;  2JRT A;  4U7B A;  3RKX A;  5ERI A;  4QLC U;  4UV8 A;  3VEP A;  2QBY B;  3MZH A;  1XSV A;  1H9T A;  1D5V A;  3KZZ A;  2OZU A;  2PI0 A;  3RDI A;  1EH6 A;  2STT A;  3I71 A;  5CVR A;  2VBW A;  4IJA A;  1USS A;  3KP6 A;  1K7A A;  2IRF G;  4ZYE A;  1YO5 C;  3F8F A;  4MNU A;  1R5H A;  2RKH A;  2MLK A;  1FBU A;  2COM A;  1Z05 A;  1T39 A;  4M72 A;  5F64 A;  3FMR A;  2G7H A;  1YIO A;  4HBL A;  1BIA A;  2Y48 A;  4HX4 A;  1IZ1 A;  1RUO A;  2A3S A;  2IW5 A;  2QWW A;  4U0Y A;  3E6D A;  2BYV E;  4BNC A;  2FMY A;  5F6F A;  5JR3 A;  2VBY A;  4N9H A;  1QZY A;  2IT0 A;  4GYG A;  2KKO A;  3E6C C;  4UNO A;  4O3M A;  4UVC A;  1SD7 A;  3KEO A;  4HW0 A;  5BS6 A;  5ICF A;  4ESJ A;  4WCG A;  2F2E A;  1OYW A;  1U3E M;  4RB2 C;  4G8X A;  5LRS A;  2CW0 F;  1G3S A;  1U5T A;  3TOA A;  4ENJ A;  1OKR A;  1XGO A;  3L9F A;  5LEK A;  3FXR A;  3HSR A;  1O3Q A;  4CHU A;  4NHJ A;  3DV8 A;  5LHH A;  2EJR A;  1S8N A;  1FOK A;  4PGG A;  2EA4 A;  5D6E A;  3K2Z A;  4BYY A;  1J2X A;  2VXZ A;  2UZK A;  1LVA A;  2F5F A;  3NRV A;  3FF5 A;  3JTG A;  2FBI A;  4K2E A;  2VT2 A;  4IHS A;  4MQV A;  4OMY A;  2NRA C;  1BIB A;  3FZV A;  2CGP A;  1TQP A;  1MZB A;  4M74 A;  4U0V A;  1TNT A;  4YII A;  5ILV A;  3CTA A;  5FD6 A;  3O6B B;  2NYX A;  2DTR A;  1P4A A;  3LA3 A;  2VT3 A;  1FSE A;  2M1B A;  3M1E A;  4LD5 A;  3WG9 A;  2O03 A;  1YG2 A;  1AOY A;  3J7A O;  1TW2 A;  4I98 B;  3I4P A;  2PN6 A;  2DT5 A;  2ISZ A;  3RYR A;  4RB1 A;  2PLY A;  2XVC A;  1O3T A;  1SFU A;  3SFZ A;  2EV5 A;  1KQ8 A;  4KYW A;  1T38 A;  3WE3 A;  3DP7 A;  3TDZ C;  1ON1 A;  4LB6 B;  3FXU A;  2EB7 A;  2XAJ A;  1RUN A;  4N9I A;  1KU7 A;  5D8L B;  5IT9 K;  1Z6T A;  2FQ3 A;  2HQR A;  3BY6 A;  1FYM A;  2P8T A;  3C18 A;  3KLN A;  3OOP A;  3PQK A;  5E20 A;  3HHH A;  4G6D A;  4JK1 X;  3BJA A;  2H6C A;  3E5Q A;  2E7W A;  4O6J A;  3T1B A;  4LFU A;  4YFN F;  2EFQ A;  3SHF A;  4KIF A;  3IHU A;  2HKX A;  2RDP A;  1FWZ A;  2YU3 A;  2VOD A;  1RI7 A;  3J80 K;  3TDU C;  4HDU A;  5DCF A;  2Z9O A;  3ZMZ A;  3BPV A;  1YW9 A;  2ETH A;  4A0X A;  2XAG A;  3Q5F A;  4KN4 X;  3WTS C;  4ZZL A;  3E6B A;  2MLG A;  4L9N A;  1ZRE A;  4YFX F;  4A6E A;  1XCV A;  3LAP A;  3TKY A;  2BGC A;  3AAF A;  2MH9 A;  3L09 A;  2FRH A;  2GXB A; 
#chains in the Genus database with same CATH topology
 4BHB A;  2AHQ A;  2H8R A;  2LY2 A;  3OIP A;  2V1X A;  3JAM Z;  5DUI A;  1YHQ I;  1ZGJ A;  2CFX A;  2DK5 A;  3CD6 I;  3S16 J;  2EIN H;  2P5K A;  4BBR J;  2Q0O A;  1UHS A;  2IS6 A;  4IZZ A;  4IEJ A;  2XRL A;  4ESF A;  3W2W A;  3FHN A;  5FB2 A;  1PYV A;  4N0B A;  2M4K A;  3RCO A;  3IH4 A;  3SZP A;  1FIP A;  3DQV C;  5B3S H;  2ZME C;  4EJU A;  4KDP A;  2LOO A;  3MD2 A;  3DF8 A;  4U7D A;  3OYI A;  4ZC3 A;  1H8A C;  1XMA A;  2Y0S A;  1OR7 A;  3W6J B;  2ELH A;  2PX9 A;  4QIW N;  2VI6 A;  4L5J A;  3ECH A;  2NOJ B;  2P5V A;  4XRF A;  5H6Q A;  3S93 A;  1WPK A;  1FMW A;  3A0H C;  3R0J A;  4ZTJ A;  3M8F A;  5FKL A;  2Z99 A;  2YSR A;  4ENM A;  2P7V B;  1PJR A;  3CCY A;  1ZHF A;  2E5Z A;  3CP8 A;  4DQ2 A;  3GFJ A;  1STZ A;  2QF7 A;  2J5P A;  3HSE A;  2AS5 F;  1P7I A;  3FHZ A;  1B59 A;  3CCU I;  2EIK H;  3EUH A;  4ZH4 F;  3S2W A;  1AKH B;  5DV5 A;  4ANJ A;  1K4S A;  1TT5 B;  2DOE A;  1ON2 A;  4V19 K;  2W57 A;  1OLT A;  1Q1H A;  3PO2 J;  2Q2E B;  1V5F A;  3I56 I;  1UEL B;  3BLY A;  3DKY A;  5KK1 A;  1LE8 A;  2ZME A;  3RKW A;  2ECC A;  2ZFU A;  3M1C A;  4JYK A;  1LDD A;  3I59 A;  3D5L A;  2KIF A;  3NAR A;  1OYI A;  5L3D A;  2X1C A;  2NS7 A;  3CMY A;  5FKK A;  1QBJ A;  2XKP A;  2C6Y A;  1D1A A;  3O8G A;  5CVJ A;  1IV6 A;  5GP9 A;  2FNA A;  2ZC2 A;  3KX2 A;  4HQM A;  1BJZ A;  2L7K A;  1FJL A;  1BR2 A;  2GZW A;  2X1E A;  3H5A A;  2MSY A;  3OWT A;  3CCM I;  2NVT J;  1YQA A;  1LEB A;  1R71 A;  2L4A A;  5DCM A;  3F6O A;  1IUY A;  2PJR A;  1TP4 A;  3OSF A;  1SD5 A;  3C7J A;  3BG5 A;  3QOP A;  3KLO A;  2YUS A;  4Q5S F;  4C3H J;  4IHT A;  1GXQ A;  2H27 A;  2B9S A;  3REO A;  3HHG A;  1R9T J;  2A6E F;  3MEX A;  3Q0V A;  4Y3O A;  4BDY A;  5L3B A;  1VQK I;  3CMA I;  4NQW B;  3CCE I;  3ML6 A;  5LEJ A;  1FIA A;  5E3O A;  3JSO A;  4RLF A;  2GXA A;  5KAI C;  2I8D A;  4CZZ A;  3N4M A;  1KYZ A;  2MGQ A;  2HVQ A;  5KAF C;  2KZG A;  4JX4 A;  4BS9 A;  2VL8 A;  5F04 A;  3SZG A;  1WJA A;  2L3D A;  3MZY A;  3L1P A;  3DTK A;  3JRG A;  1HF0 A;  1FSH A;  3GFI A;  2CQX A;  1XGS A;  1D1C A;  3MCZ A;  2X9D A;  4GO1 A;  2LKX A;  1ZQ3 P;  3C2B A;  5CYV A;  3SZT A;  3PSF A;  3R60 A;  4UXN A;  1TQM A;  2EZI A;  2FEZ A;  3WE2 A;  3JRB A;  3H9Q A;  1WRJ A;  2I10 A;  2XHK A;  5TJJ A;  1ZGA A;  1KU3 A;  5CVI A;  3OYJ A;  1ZLK A;  1TLH B;  5GAE J;  3F8B A;  2XPW A;  4M9S A;  1RET A;  2O8K A;  1OIS A;  2WY8 Q;  1R1V A;  1H9G A;  3HEF A;  5LFA A;  1OPC A;  3K1P A;  2Q8K A;  5D5V B;  2UXN A;  4RA2 A;  2XIG A;  2CV1 A;  1R4M B;  2EV0 A;  2LF8 A;  2QQB A;  4OAZ A;  2ME0 A;  2L2O A;  1VQ6 I;  4M6Y A;  2GA2 A;  3IP4 B;  3ZQC A;  4A0Z A;  5HLT A;  5D6F A;  1ZEL A;  5D5X B;  4IRI A;  1IN6 A;  1APL C;  4RGR A;  3LST A;  4WF2 A;  1DPR A;  4CIC A;  1MW7 A;  5DCM B;  2DXI A;  2JPC A;  2RVC A;  2RGV A;  4MGR A;  4XIC A;  3SEQ A;  1XMK A;  3VB2 A;  3TMO A;  3CLO A;  5EDN A;  2KPM A;  2IGN A;  3HC7 A;  4IRG A;  5D5U B;  3S3M A;  3ZP5 A;  3QPL A;  4WXC A;  3I55 I;  1O3R A;  3QP6 A;  4AID A;  3K9T A;  1XSD A;  2DMT A;  3WHB A;  1QPI A;  2AQF A;  2I5U A;  2JTV A;  2EV6 A;  3ERE D;  1POG A;  1EKE A;  1V55 H;  3H1C A;  4II2 A;  2Z33 A;  1X3U A;  3TGN A;  3K4L A;  3IAM 2;  4OU0 A;  1VQ7 I;  4KIS A;  2VJ5 A;  5LGU A;  3FM3 A;  2PG4 A;  3PL8 A;  2RC4 A;  3DPT A;  4Z2Y A;  3AG2 H;  2E60 A;  4ZTF A;  2CV0 A;  1BI2 A;  2K4J A;  5EGO B;  4I0B A;  2O8X A;  1Y0N A;  4EVI A;  3KCC A;  1U9O A;  2KZV A;  2YX7 A;  3BTJ A;  4ESB A;  5EGO A;  1Z6R A;  2XSD C;  3FKJ A;  3GTQ J;  1J9I A;  1LE8 B;  1MMS A;  3ZMV A;  2NS0 A;  4I09 A;  1ZKG A;  4HF2 A;  1J59 A;  1F5T A;  2P81 A;  4KJZ A;  3O3K A;  4P9U A;  4OIO F;  1I1S A;  1FP2 A;  3CO7 C;  1REP C;  4BHC A;  2CUJ A;  2A5Y B;  2K9S A;  3AKZ A;  4ASN A;  1ZLJ A;  3TP3 A;  4E7L A;  5A2Q Z;  4KIG A;  1MKM A;  4GGG A;  4XM3 A;  1JXS A;  3RPQ A;  4MIM A;  2ELK A;  3DPL C;  1FLI A;  2W82 A;  2DYS H;  4IO9 F;  4AM3 A;  2CQQ A;  1ZAO A;  2JN6 A;  1PUF B;  1QU3 A;  1YX3 A;  2JWT A;  2EA2 A;  1IF1 A;  3PM1 A;  2LRD A;  2NOG A;  3L2C A;  2BE5 F;  2Y75 A;  2MAB A;  3K2A A;  4CYD A;  1VND A;  3RYP A;  4FCY A;  1XDU A;  2IVM A;  4PSW A;  2V6E A;  2O6G E;  2BXZ A;  4AU7 A;  3DLL F;  2JA6 J;  2VOO A;  1DU6 A;  1IRG A;  5JHU A;  4DNC A;  1X1A A;  1MNE A;  2CUE A;  4CCK A;  2BY1 A;  1V5G A;  3KP2 A;  2EIM H;  1RRJ A;  1O57 A;  1YIT I;  2RNJ A;  2IJL A;  3MZ8 A;  1SEU A;  4Y13 A;  3IRR A;  3EQL F;  5JI6 A;  1DPU A;  4NC6 A;  2B63 J;  4XID A;  3K70 C;  3CUQ A;  1SFX A;  4MEY F;  2ZKZ A;  2EPF A;  3DPU A;  1IC8 A;  1UST A;  2IA2 A;  1WHU A;  4WXD A;  5HOO A;  3OYB A;  1XPX A;  1ZRF A;  1B9N A;  1ERD A;  1K83 J;  1F9N A;  1Y8Q B;  2IXS A;  2K27 A;  3BZK A;  4O5V A;  1LFU P;  1ODD A;  1WSU A;  4L18 B;  2M45 A;  1YIJ I;  3FMQ A;  2QBY A;  2XF5 A;  4RM2 A;  1SMY F;  3DTI A;  4ZYA A;  2DA6 A;  1E17 A;  2VC1 A;  2DOD A;  4XLC A;  4HNT A;  1WWX A;  4OIR F;  1U8B A;  4I02 A;  4XLF A;  5D5W B;  4X6A J;  3P9C A;  4E7Z A;  5D8K B;  2BY2 A;  4S05 A;  4AC0 A;  1D0X A;  3CCR I;  2AQE A;  2VON A;  1OJL A;  3TW6 A;  1LEA A;  2GBY A;  3EET A;  3J81 Z;  1UZC A;  3QYE A;  4OIQ F;  3CME I;  1B6A A;  2E19 A;  5BNG A;  3KP3 A;  5LBQ A;  3Q9S A;  1S5L C;  2DI3 A;  2XUB A;  3CCQ I;  1BC8 C;  4CCM A;  3D5S C;  1U6G A;  5E1W A;  3HUG B;  3JRC A;  1SAU A;  1XG1 A;  2DA4 A;  2FJ1 A;  1JT0 A;  4A0Y A;  3E5U A;  3NWT A;  1XB4 A;  4G6T B;  2VBZ A;  1SVL A;  5M5X J;  4BDZ A;  2F4M B;  5CJ9 A;  3ASN H;  1N78 A;  2PMZ N;  4M3E A;  3CCL I;  4L5I A;  2HYF A;  1W5T A;  2FUG 2;  3QPH A;  2KP6 A;  4LIU A;  4A3M J;  3CQZ J;  2DQR A;  3JRA A;  5F1R A;  1O4X A;  3H36 A;  3CCV I;  4CCJ A;  3JCU C;  3PFI A;  4XRS G;  3HOT A;  4L0Y B;  2GIZ A;  5KNL A;  2R7F A;  4DYR A;  1TL8 A;  2D5V A;  4PK4 A;  2JUC A;  4E4H A;  1Y0U A;  3PFY A;  2OJE D;  2BOL A;  5E8G A;  3LSR A;  1U0J A;  3BP8 A;  2YX4 A;  1JGS A;  1M1E B;  2E1N A;  3CDI A;  4EJW A;  2KT0 A;  5IYC J;  4BBS J;  4LIT A;  3WTX C;  2P7C B;  5K5O A;  5E79 C;  1VQ8 I;  1GUU A;  1B8I B;  2AXL A;  1XD7 A;  4PCQ A;  2R7V A;  2QQA A;  3F0C A;  3HRU A;  2XRO A;  1UMQ A;  3F8N A;  3L2U A;  1IN7 A;  3HYI A;  1IN8 A;  1RR8 C;  2K9N A;  3A03 A;  1C0W A;  2DDA A;  2DFH A;  2X51 A;  3IKV A;  3PUF A;  1QPM A;  4UV9 A;  1ETX A;  4BXF A;  3HGY A;  1GXP A;  4IHX A;  1JGG A;  3WOD F;  3Q3S A;  1FTZ A;  2EIL H;  2VJI A;  2X48 A;  1U9N A;  4RGU A;  3EDP A;  2VE8 A;  4U0W A;  2E7X A;  2M30 A;  2OA4 A;  2RV8 A;  2HTS A;  4BE2 A;  3V7C A;  1YLF A;  1OQY A;  5D4R A;  3GFM A;  1ZG1 A;  2KRH A;  2A05 A;  3SYT A;  4A3L J;  4H0E A;  1MSE C;  4ZDO A;  4JP0 A;  1K4T A;  2CH0 A;  2IBD A;  3MKW B;  2HGC A;  3AG3 H;  4EAT A;  1W0U A;  3K4C A;  2Y2Z A;  2OTJ I;  1P2F A;  3MWM A;  3A01 A;  2EWN A;  4FX4 A;  2OUM A;  1FZP B;  1JUM A;  3HOW J;  2OF7 A;  3ASO H;  4IQ4 A;  2E71 A;  1VQO I;  3LMM A;  2WAE A;  3KET A;  3EYI A;  4KMF A;  5FJ8 J;  4AIK A;  5IP9 J;  4LLN A;  2QA4 I;  3IRQ A;  1W4M A;  3FX3 A;  1SFK A;  3I4N J;  1FY7 A;  1ORK A;  3K1N A;  3WGG A;  4RLQ A;  2ZJP F;  2DLL A;  2LH9 A;  2WB1 N;  3CJN A;  5C3E J;  3S1R J;  3BG3 A;  1JKQ C;  1ETV A;  4XR6 A;  1MH3 A;  2DTZ A;  2O7O A;  4L5E A;  2HDD A;  3LFK A;  3LQQ A;  2HXO A;  4C3I J;  5J6X A;  2IP2 A;  3QPT A;  3CC7 I;  4LG0 B;  5FRN A;  2LBF B;  2LMD A;  4C2T A;  1D8K A;  2ESH A;  4QSH A;  4CZC A;  1WH5 A;  2YS9 A;  4A5M A;  2NNN A;  3K4K A;  1UG0 A;  1MJB A;  2BY3 A;  4HEA 2;  3I5U A;  4OWR B;  4Y33 A;  1OCP A;  4A12 A;  1HOM A;  1WCM J;  2FXA A;  3OMY A;  3FIW A;  1CF7 B;  1HSJ A;  1O7L A;  4BEH A;  2R5Y A;  3S1N J;  2ACJ A;  3ZQG A;  5LD2 C;  3WU1 B;  1UG2 A;  3ZMU A;  2FOW A;  1X1B A;  3MMY B;  2EK5 A;  4EJT A;  2WAQ A;  5E18 F;  4PFP A;  2DA5 A;  1R36 A;  3EUA A;  2KRF A;  2Y0M A;  2DU9 A;  3GYH X;  3PNV A;  4RGS A;  3M9A A;  1IW7 F;  2KDO A;  4MFE A;  2QSH X;  2DAO A;  5FO5 A;  1B9M A;  3M7G A;  1AA7 A;  1UHM A;  4XN0 A;  4HX8 A;  2F5V A;  2OQR A;  4LK1 F;  2QCO A;  3BDD A;  2LY1 A;  5CPR B;  4XQF A;  4Q4Z F;  2JA8 J;  2KMU A;  4I0A A;  4E7K A;  2BHY A;  3PQJ A;  1FBQ A;  1YJN I;  1Z91 A;  3TP0 A;  1EF4 A;  4B48 A;  4BQQ A;  4GCV A;  1P7J A;  3GW2 A;  3H3U A;  3GTO J;  1Z1D A;  3G73 A;  4RB3 C;  4YFK F;  2ISY A;  3VYT B;  1D0Y A;  4M71 A;  3GO5 A;  2K3F A;  4CCO A;  4D7N A;  5JHF A;  1PP7 U;  2W25 A;  4C30 A;  4XK4 A;  3BJ6 A;  3F8C A;  1BC7 C;  5CQG A;  3A2K A;  3FXL A;  1GHC A;  3FMS A;  3RJP A;  4M3D A;  4F52 A;  3I59 B;  5ILU A;  4HQE A;  2OD5 A;  1HKT A;  3GME A;  3FKI J;  2E5N A;  2WC2 A;  4EJV A;  5LGN A;  3BG7 A;  2O61 A;  2PQ8 A;  2CFO A;  2QVO A;  2MC4 A;  3CC2 I;  2ZFW A;  2HQN A;  1FOY A;  3LWF A;  3VWB A;  4IVN A;  3JTH A;  1IG7 A;  5ICE A;  2EH3 A;  3DTE A;  1JKO C;  2VQC A;  1KON A;  1IXS B;  3MQ0 A;  3OYA A;  3B02 A;  1PDN C;  2NVY J;  1R1U A;  4ZYD A;  1NG6 A;  3HUG A;  4AIH A;  4A3G J;  3ZQL A;  3QU3 A;  2XGD A;  3TED A;  1HW1 A;  1SVO A;  4HF0 A;  1QZZ A;  4ABZ A;  3VSL A;  2IA0 A;  1Z67 A;  1MJ9 A;  5IOZ A;  1G8X A;  2HDC A;  3BC8 A;  1SFO J;  1X2M A;  2Q1Z B;  4IQJ A;  1IXC A;  4JBA A;  2BEO A;  3TW7 A;  5L3F A;  3CLQ A;  2JSC A;  4MTD A;  2PFB A;  4B43 A;  2ELJ A;  4LJZ F;  4NUB A;  1QA6 A;  3NEU A;  4DBR A;  5EZG A;  2L4M A;  5FFZ A;  4EMS A;  4EGY A;  2J5O A;  4BAY A;  5ED4 A;  2KLO A;  1KGS A;  3P7N A;  3GLX A;  1D3Y A;  2ZJR F;  5E3N A;  3EUH C;  1H0M A;  3S2D J;  4G9Y A;  1FYL A;  1HLV A;  4S04 A;  3OYE A;  2CV2 A;  3G1L A;  1PVE A;  4G6Q A;  3H35 A;  3DEW A;  2HOS A;  4XKV A;  3BPX A;  4G7O F;  2XV4 S;  4F93 B;  5ICG A;  3T8T A;  1T8I A;  4FT8 A;  4XSZ F;  4V2G A;  1VQ5 I;  2GXB A;  1DQU A;  1UB9 A;  1UCR A;  4P55 A;  4BHP A;  5J8C A;  1H88 C;  4ZYH A;  4B44 A;  1BOA A;  2E2J J;  3DKW A;  1OCR H;  1BI0 A;  2YPR A;  4UVB A;  5CLS A;  3ZXS A;  5IP7 J;  3KYC B;  2Y9Y A;  3HRT A;  4FE4 A;  3UNG C;  2L9N A;  5FLX K;  5K7H A;  1SD6 A;  5HOD A;  4A3C J;  5DTD A;  2LK2 A;  3HTU A;  3ABU A;  4FIS A;  5A2Q K;  2B0L A;  4I6Z A;  5IYD J;  1XGN A;  4CA0 A;  4RMN A;  1SAN A;  2VE9 A;  3VOE A;  5F27 A;  1MBK A;  3E7L A;  4FX0 A;  2HI3 A;  3VPR A;  1HST A;  2H1L A;  4HAM A;  4NB5 A;  3TL4 X;  2QZ8 A;  4E7S A;  4C2U A;  2ESN A;  4EM1 A;  2H6B A;  2LSO A;  1E0E A;  4GXO A;  4AYB A;  2GA1 A;  2R7S A;  3HKZ A;  1ZG3 A;  1J5Y A;  1QRY A;  3ZQI A;  3ZMT A;  5DUK A;  2EFO A;  1OCC H;  4WWC A;  5B66 C;  2EZK A;  1ETW A;  2HWV A;  2DA1 A;  3OL4 A;  2JVG A;  3M8E A;  5FRM A;  1LVK A;  4UUV A;  2XSJ C;  2XPU A;  2FA5 A;  1A35 A;  2LDU A;  3MKY B;  4IHW A;  5L3E A;  3KYL A;  1AHD P;  3F23 A;  4FTH A;  2KHM A;  3D5R C;  2V9K A;  4XLH A;  1L3L A;  3UR3 C;  2L9S A;  2W7N A;  3I0T A;  1L0O C;  3HRS A;  5FGM A;  1GV2 A;  3T8R A;  2VKV A;  3NQO A;  2IGK A;  1P4W A;  5H6R A;  5DD8 A;  5F0F A;  1BM9 A;  1KA8 A;  4W97 A;  3OS0 A;  2K3P A;  3T0Y A;  3RPU A;  5IP6 A;  3W6V A;  1B72 A;  1I6X A;  1P6R A;  2EQR A;  2IEK A;  1VQL I;  3ABK H;  3KFW X;  3QYF A;  4LLL A;  2FSW A;  2JMW A;  2Z5U A;  5JVG F;  2JSP A;  2LY9 A;  2F48 A;  3HZJ A;  4JQF A;  4L9V A;  1U2W A;  1TQI A;  1JTY A;  1LDK B;  3BR1 A;  3IKT A;  2HQA A;  3A1Y A;  3GZN B;  2FQ4 A;  5HS7 A;  1YE9 A;  1X1P A;  2ZSH B;  4B3X A;  2XF7 A;  1R22 A;  2P4W A;  4CYC B;  3J7Z I;  1DUX C;  1D0Z A;  4RM3 A;  3K10 A;  1DDN A;  2JVH A;  5E3M A;  1I3A A;  3LSG A;  1T0F A;  4XBF A;  1VFC A;  2RQP A;  2WAD A;  2V79 A;  3FBN B;  3GBG A;  3O2P E;  5D4S A;  2HEO A;  4GFB A;  1T56 A;  5GAH J;  2KJC A;  2TRT A;  1XDS A;  1VQP I;  1E3O C;  1F1Z A;  2CRG A;  3MVP A;  2BVM A;  5M5Y J;  2IGO A;  1T6S A;  2KL4 A;  1R7J A;  2W4S A;  5FRO A;  3QRF F;  5H2F C;  4M6V A;  3HTS B;  2PMU A;  4RS8 A;  1TWH J;  2D45 A;  1ZAR A;  5F1J A;  2XAH A;  2QEX I;  5FKN A;  1JKP C;  3CUQ B;  4I99 C;  1DGR M;  1QNT A;  4IHV A;  1WJB A;  1G4D A;  3QU6 A;  3H9G A;  2XAQ A;  4I76 A;  2E1C A;  1E3P A;  2A6T A;  1R00 A;  2M5W A;  4PGH A;  4AVP A;  4BUP A;  4A3J J;  1GV5 A;  4KUM A;  1IRZ A;  2OV7 A;  4LK0 F;  2X6Y A;  2LYC A;  3BTC A;  3OYC A;  1WZ2 A;  3A4C A;  2DMN A;  2EFW A;  3GUD A;  4HRI A;  4BQN A;  3LAJ A;  2W24 A;  1T98 A;  3H0G J;  1V3F A;  4KMU X;  2VC0 A;  2OU2 A;  3N97 A;  4YEJ A;  2H8W A;  2Z2S B;  2IPQ X;  3HPG A;  2KIS A;  3MAJ A;  3BQZ A;  4W1U A;  1H89 C;  3F8M A;  5E1Z B;  1XX5 A;  4HLY A;  4EM2 A;  4HST A;  4KN7 X;  3TOB A;  4G94 A;  3BJO A;  1RR7 A;  5EG0 A;  4Y52 J;  1UHW A;  2V1N A;  3WU2 C;  3JAM K;  3KZI C;  2DOF A;  3L2V A;  4MFD A;  1I50 J;  2Y9Z A;  3DKX A;  2HNH A;  2NAZ A;  4TV7 A;  1OCT C;  4DJA A;  4EV0 A;  2L7Z A;  1LNW A;  1VQM I;  2CUF A;  4BU2 A;  5J4Y A;  2R7U A;  3FIS A;  3RZD J;  5CVU A;  2DJI A;  1AWC A;  1HW5 A;  2O0Y A;  3FXK A;  2W1O A;  4CXF A;  4LMY A;  4XLP F;  4BQO A;  2STW A;  2WV0 A;  4D0P A;  2RQQ A;  3KEY A;  4EGZ A;  3LFU A;  3QOD A;  1KQ0 A;  2HOA A;  5JFR A;  4Q47 A;  3BWG A;  3FWE A;  5DD4 A;  2HKO A;  2MA3 A;  1BN5 A;  3D0S A;  3ZN0 A;  1Z3X A;  1FEX A;  4X1E A;  2CS3 A;  4WX9 A;  5GAG J;  2E1M B;  2MD5 A;  2XB0 X;  4JX6 A;  4RB0 A;  3WTY C;  2JA5 J;  2CG4 A;  2GXG A;  5GTI C;  2L5Q A;  1EV7 A;  4A93 J;  2COB A;  2X0L A;  2MG4 A;  3OYK A;  5E17 F;  5FFX A;  3WTU C;  4IKF A;  3S3N A;  3F72 A;  2H1K A;  1EA3 A;  1WGX A;  1U8R A;  4EQQ A;  1TTY A;  1X58 A;  2GWR A;  4OAY A;  2WBM A;  4F7Z A;  4YRV A;  2UWM A;  2XB5 A;  1QVU A;  4I2O A;  2ZCW A;  4A3B J;  2GOX B;  3P9I A;  3SDG A;  1LJ9 A;  4ITV A;  5J4V A;  2KFD A;  2BHZ A;  3A02 A;  4RAG A;  3V8L A;  2E36 A;  3T5X A;  4ZJZ A;  4BXX J;  3ZGK A;  5GAD J;  2L7F P;  2PJR B;  3I4M J;  4B09 A;  4XMY A;  5EEG A;  2VUM J;  3G2B A;  1YRN A;  3COA C;  3W6K B;  3EYY A;  2W85 A;  2M34 A;  1JHF A;  2XAF A;  2EIJ H;  1RC9 A;  4KIB A;  2OTL I;  1XC5 A;  2Y31 A;  4KIT B;  2MW8 A;  3J7Y J;  3E6M A;  3ABT A;  3BCB A;  5DDG A;  5K5R A;  3WTT C;  3S3O A;  2O9L A;  4XSX F;  4LB5 A;  4XL9 A;  3GZ5 A;  3U1K A;  2DT7 B;  1J0R A;  4IPA A;  2O3F A;  1LDJ A;  2QGU A;  3BQY A;  5K5Q A;  1TW3 A;  3GCM A;  3KEQ A;  4ZYG A;  4IRH A;  2R7T A;  4NDL A;  2HZT A;  1FOW A;  3FXO A;  3HOV J;  4P5O A;  1QGP A;  3FM5 A;  3PIO F;  5M3F J;  2FF4 A;  2LP0 A;  2VKE A;  3I54 A;  2X6X A;  1A31 A;  2P6S A;  3CJQ B;  3F6V A;  3IWZ A;  2M8G X;  3V42 A;  2DFI A;  4JOM A;  5HLG A;  3S1M J;  3PSI A;  2F5E A;  1TC3 C;  2Y0S N;  1QVT A;  1K79 A;  3KYD B;  4LG0 A;  4UY8 I;  2BZT A;  2K85 A;  2KIU A;  3HSF A;  1HCR A;  1R23 A;  4M9Z A;  3F3X A;  3K4N A;  2DMU A;  4RGX A;  4E70 A;  2ZBK A;  2DW4 A;  2KIM A;  3OSG A;  5GPA A;  3CDL A;  1G3W A;  3CUQ C;  4KT5 C;  2VPL A;  4M73 A;  1YRN B;  3BRO A;  1LQ1 A;  2RN7 A;  5FKO A;  4A69 C;  4A3K J;  4AIJ A;  3ZQ7 A;  4LGW A;  2VBX A;  3JRH A;  2XRN A;  3IWF A;  3ZQH A;  4HV6 A;  2ZNZ A;  1DP7 P;  2ID3 A;  3H92 A;  1Y1W J;  3IC7 A;  2EBI A;  5IYB J;  2MC3 A;  2NNY A;  4BGD A;  4FHT A;  2HXI A;  1TT0 A;  2F5C A;  2QKL B;  1D8J A;  4A3E J;  2DMQ A;  1SD4 A;  1IAW A;  2W00 A;  3ZR8 X;  1BW5 A;  3OYF A;  1OFC X;  3SQN A;  3BTI A;  4DW6 A;  2EZL A;  1WJD A;  3GF2 A;  3JR9 A;  2DYR H;  5LHI A;  3NAU A;  3K1M A;  2ZME B;  2LC2 A;  3ROU A;  5AON A;  2A07 F;  2K9M A;  3A01 B;  3HOU J;  4HF1 A;  5AIP A;  1HXD A;  4U88 A;  2ZXH A;  1T2K A;  1MBF A;  5K1Y A;  1MMG A;  2VOP A;  3E97 A;  4QTR A;  3GVA A;  1X2N A;  3OR2 C;  2IGM A;  3FK6 A;  2ADU A;  3SFI A;  4KIC A;  2JUG A;  1E2X A;  1R58 A;  2DCE A;  2QLZ A;  5DEQ A;  4B47 A;  1PUF A;  2GLO A;  4KNY A;  5K7F A;  5TRD A;  4L9J A;  3RIR A;  2PBI A;  2HU9 A;  4AWX B;  1UFM A;  3R4K A;  3W2A A;  2DBB A;  2CWE A;  1GT0 C;  4KFC A;  2CQK A;  3M3Y J;  3C2G A;  3I53 A;  5HLI A;  1R5G A;  5TIS C;  3LQR A;  1X4O A;  1G6N A;  2A6H F;  3CES A;  2QM3 A;  3E5X A;  2TCT A;  4NQW A;  5JVT A;  1RIO H;  4PJN A;  5IT9 Z;  1MGT A;  4A3F J;  1GDT A;  1MMD A;  3B6A A;  3ECO A;  1RKW A;  3CC4 I;  3LSP A;  2JZY A;  1HKQ A;  1HW2 A;  1EJ9 A;  3TO9 A;  3OV8 A;  2R7R A;  3KP7 A;  1ZK8 A;  1YX5 A;  3BR5 A;  3HM5 A;  2QKM B;  2XGE A;  4MQ9 F;  4H4K C;  4PDK A;  3GX4 X;  3ESW B;  3V8J A;  3TO6 A;  2HPI A;  3CMM A;  1FT9 A;  2HOE A;  2FML A;  2A61 A;  1WKM A;  2JPB A;  4CGZ A;  3BR3 A;  2CW7 A;  1ENH A;  3N05 A;  1YJW I;  3GZ6 A;  1I27 A;  2ID6 A;  3L2W A;  1IRF A;  2HDW A;  4BJ6 C;  4CSW A;  1IN4 A;  2R7D A;  3DBR B;  5F0C A;  2GM4 A;  1U5T C;  1ZRD A;  1I5Z A;  1WH7 A;  3MFK A;  2W84 A;  1TNS A;  5IY5 H;  4IX7 A;  4BQA A;  4Y7N J;  2IAI A;  1ZH5 A;  1NG7 A;  2X1D A;  5DM7 F;  1DU0 A;  2E1O A;  3VSK A;  1Z7U A;  2LBF A;  5IPA A;  2XGX A;  3WTZ A;  5LRR A;  4A6D A;  3CCS I;  4R79 A;  4OIP F;  1XMX A;  3WTV C;  1U5T B;  1HKS A;  4D5C A;  5HNH A;  4PSX A;  3ZMD A;  3JRI A;  2KJB A;  3GFL A;  2V1D A;  4P96 A;  2M0M A;  2IS2 A;  3WHC A;  2K02 A;  3VFZ A;  1YTY A;  1JUS A;  2JQ7 A;  2CW8 A;  3Q0W A;  1IJW C;  1FC3 A;  2CMP A;  1T08 B;  2H94 A;  2Z16 A;  3I58 A;  4UVA A;  2VKH A;  4IL6 C;  1KU2 A;  2F4I A;  4FET A;  4AUX A;  1S29 A;  2K9L A;  1IDZ A;  2QEN A;  3DBL B;  4GYI A;  2WTE A;  5HDK A;  3EUK L;  1P92 A;  3BT9 A;  3SEZ A;  5BPI A;  3OIQ A;  2FBK A;  1ETY A;  3BR6 A;  2F5D A;  1KYW A;  2R7Q A;  1V5E A;  3HOX J;  2LVS A;  1MDM A;  5HDG A;  1VI0 A;  2Q2E A;  1NHA A;  4E7J A;  4CYC A;  1WI9 A;  5C44 J;  2X6O A;  3ZPL A;  1B1B A;  3HGG A;  5KVR A;  2R93 J;  4ON0 A;  1F4K A;  2V9V A;  5CKT A;  3HL2 A;  3K4J A;  1W7P D;  5KHD A;  2L0K A;  1XGM A;  5EEH A;  2QUF A;  3K69 A;  1ONV A;  2FD5 A;  1MBJ A;  3GWZ A;  4CH7 A;  2FOK A;  1PP8 F;  3ZQQ A;  2ZJQ F;  1S3J A;  2QQ8 A;  3JW4 A;  1T0F C;  2OQG A;  4BXU A;  5HS8 A;  2VJJ A;  2EZH A;  2V7F A;  4M9X A;  2EFP A;  2MBF A;  3WGH A;  3LA7 A;  1I6H J;  2V6C A;  1NTC A;  1XN7 A;  3LSM A;  4HDV A;  1W7P A;  4HZF A;  4II3 A;  4I7H A;  5FD5 A;  2KQR A;  2DQL A;  3QAH A;  2UV1 A;  1YI2 I;  2ICW G;  4D5F A;  4FAS D;  4BY1 J;  2LD5 A;  3CJR B;  2ZXJ A;  2DO7 A;  1QO0 D;  4L9T A;  3OYM A;  4Q48 A;  3NWS A;  4F3Q A;  5HVQ C;  3KZY A;  2GOM A;  2L02 A;  4G7Z F;  4HA8 A;  2HOT A;  3FXJ A;  2VQL A;  4M6X A;  5GPC A;  1FP1 D;  1IN5 A;  5CVV A;  1Z9C A;  6PAX A;  3EPZ A;  1P4X A;  2CQN A;  4BH9 A;  2M8E A;  3ISP A;  3MN2 A;  3KE2 A;  2OCC H;  3L00 A;  1J7K A;  5LHG A;  1HDP A;  3HG9 A;  4L0Z B;  1YW7 A;  1WI3 A;  2G0E A;  2A68 F;  1K78 A;  3S2H J;  4YIF A;  1BOB A;  5J47 A;  2XKO A;  4P9F A;  4R8H A;  1S6L A;  4S0H B;  5HDN A;  5JLX A;  2K4B A;  2ZJ2 A;  1AKH A;  1TBX A;  4HX7 A;  4DGW B;  3C1D A;  1QQI A;  5K7Z A;  3F21 A;  4A5N A;  1OCO H;  9ANT A;  1HQC A;  4IXA A;  5DYM A;  2YR2 A;  3FK7 A;  3S8P A;  3I3L A;  3SDB A;  5F08 A;  4QPO A;  1O3S A;  3DEE A;  5BOX A;  4BL0 B;  1BR4 A;  4AD9 A;  4I01 A;  5TGT A;  4E7H A;  4PUS A;  3HOY J;  1SAX A;  3HBL A;  2R7W A;  1T95 A;  3ABL H;  1G2H A;  1DGW Y;  2E2I J;  5E1X A;  4HYE A;  2P6T A;  3GTP J;  5C4J J;  1JI8 A;  4Y15 A;  4Y4R A;  1G59 A;  2G9W A;  4PJM A;  4OIN F;  3RI4 A;  4UUS B;  2VN2 A;  2M87 A;  2E34 A;  3DXJ F;  3ERM A;  2HS5 A;  1Y6I A;  2OCE A;  3FBI B;  3V7R A;  4IHY A;  3ULQ B;  2A69 F;  3BZ6 A;  4R1H A;  3V4G A;  2K5C A;  3JSP A;  1BBY A;  1J09 A;  1IDY A;  1JUP A;  3PNY A;  4XRS A;  3RKQ A;  3J81 K;  1RZ4 A;  1GVJ A;  2WA0 A;  2ZO4 A;  3CUO A;  5IOY A;  1ZN2 A;  5B1B H;  4ENN A;  2LKP A;  4XON A;  5H20 A;  1Z0X A;  1Q1V A;  3I64 A;  4FQG A;  5F0H A;  1Y8R B;  5LLQ A;  2L54 A;  4BKX A;  4RAZ A;  2R7Z J;  1B72 B;  1VTN C;  3E3V A;  2H09 A;  1YYV A;  3AL0 C;  2D1V A;  1KQ9 A;  4IF4 A;  5E8I A;  3FXQ A;  3LA2 A;  1W5S A;  4F55 A;  2GIV A;  2IA1 A;  4CO8 A;  3ZCO A;  3IUO A;  2DN0 A;  2JA7 J;  3K4B A;  4BEH B;  4PZJ A;  4XOR A;  1BI3 A;  2P0W A;  4HG2 A;  1MBG A;  3CZ6 A;  1ITY A;  5J8F A;  1A6Q A;  4ZZD A;  2CYY A;  1XSX A;  1JT6 A;  1ULY A;  2L01 A;  5E3L A;  2QSF X;  1YW8 A;  5EF6 A;  1D1B A;  4LLG F;  5DM6 F;  1NK3 P;  1AU7 A;  3CO6 C;  5HNF A;  3WGI A;  2V1U A;  5EEA A;  2QYO A;  3RQ4 A;  2PEX A;  2R92 J;  1JE8 A;  3P5J A;  4F91 B;  1VZ0 A;  3VYU B;  3F22 A;  2MFZ A;  3OY9 A;  2ZNY A;  4RAF A;  3HB9 A;  4PJJ A;  5B1A H;  1IV8 A;  1F43 A;  3MKZ A;  4J19 A;  5HLH A;  5J1U A;  2LNB A;  3WTW C;  3M4O J;  1W7P B;  3H3Z A;  1BR1 A;  2XAS A;  3KP4 A;  3PUB A;  1G3T A;  2K86 A;  2R3S A;  1FX7 A;  1MMN A;  4UUS A;  4YG2 F;  4CDG A;  2PMH A;  4LOC A;  1D5Y A;  4M3B A;  4B1R A;  4NBQ A;  1Y1V J;  1RNL A;  1CGP A;  4AVZ A;  1PUE E;  2HTJ A;  3F9K A;  1Y56 A;  1DP3 A;  2DK8 A;  1OCZ H;  1V54 H;  1I3Q J;  3K6G A;  2VKD A;  5ILS A;  4XKW A;  4MHG A;  3RTR A;  3BOQ A;  4QPQ A;  3DFG A;  1VQN I;  1S7O A;  3H5R A;  3S15 J;  3U21 A;  4X0G A;  2EFN A;  3GLL A;  4WXH A;  1JTX A;  4D9J A;  1YS7 A;  4UB8 C;  3S1Q J;  2UUZ A;  1Y39 A;  3DLA A;  3G3Z A;  1V4R A;  2UXX A;  3RSN A;  2JA2 A;  2NVQ J;  1G3Y A;  2KRC A;  1XCB A;  5FKM A;  2XF6 A;  1K78 B;  1BJA A;  4DOZ A;  2XC7 A;  3U9G A;  2FE3 A;  1GLN A;  2V26 A;  3LSK A;  2G7U A;  2WWY A;  1IXR C;  2TDX A;  1MD0 A;  1TWG J;  3U1D A;  2D2W A;  3R0A A;  4LIV A;  3V8K A;  3TQN A;  4HSR A;  2HFH A;  1JJ8 C;  4ZDP A;  1MDM B;  2CO5 A;  3DEU A;  3IH2 A;  4IOA F;  5EJC A;  3C3W A;  1SFE A;  3WG7 H;  3ZRG A;  2FBH A;  1WFX A;  1JHH A;  1R1T A;  2ME6 A;  1YFH A;  1FBS A;  1S9H A;  2DPU A;  1R4N B;  3CDH A;  1SC7 A;  5FLX Z;  2M2E A;  2HPM A;  2L7M P;  5HS9 A;  3H9J A;  2W48 A;  4P1W A;  1RES A;  2VAS A;  3KIO A;  5BQT A;  3HDD A;  2AO9 A;  3U2R A;  1HBX G;  2OC6 A;  5LGT A;  2QSG X;  2QQ9 A;  3OS2 A;  4HLX A;  2FU4 A;  4B8X A;  1ZG5 A;  5BMZ A;  2MD0 A;  2OPT A;  1W1W E;  4ENK A;  1I1G A;  2D1H A;  2DMP A;  1LUJ B;  3VOD A;  2DA2 A;  4GDF A;  2NVU B;  1BI1 A;  5IT3 A;  4F92 B;  3J80 Z;  1VQ4 I;  1YS6 A;  4XN3 A;  2CSO A;  4HNV A;  4NC8 A;  1JJ6 C;  5EZH A;  1QZE A;  1MIJ A;  1FNN A;  2LFB A;  3TO7 A;  2LKS A;  4MEX F;  1A5J A;  2ECB A;  4QWQ A;  4E6K G;  1YOV B;  1MH4 A;  2VIX A;  2LRE A;  3VYS B;  3QWL A;  4DYQ A;  1CF7 A;  4N4O B;  1WQ2 A;  2WAQ N;  4XLN F;  5L3G A;  3S14 J;  4RBO A;  2VXD A;  1OR7 C;  1ZR2 A;  2BV6 A;  4ETS A;  3LSI A;  2OBP A;  2R4G A;  1K6Y A;  3ZQF A;  4A2U A;  2XDV A;  3IL2 A;  4NNJ A;  1FYK A;  2K7L A;  4G7H F;  4HV5 A;  1MNM C;  2P5L C;  2NXN B;  1R49 A;  1U78 A;  3W2V A;  4MTE A;  1S7A A;  3B73 A;  3VDX A;  4DZP A;  3DU5 A;  3V7S A;  4KA4 A;  2B7E A;  4BE0 A;  2HYG D;  2XPV A;  3HOS A;  2X4H A;  5L3C A;  2BVL A;  1NH3 A;  3UKG A;  3GEZ A;  2FNP A;  5AIQ A;  3P9K A;  4OMZ A;  4RAY A;  4B4C A;  5J1Y A;  4WK8 F;  5BPD A;  1HDD C;  3BG9 A;  2PJP A;  3QP5 A;  2NVX J;  1SMT A;  3K0L A;  1FPQ A;  2MH2 A;  1FTT A;  3QPS A;  3K4M A;  3AG1 H;  4CCL A;  3ZMS A;  2BW3 A;  4A3I J;  1A04 A;  3I9V 2;  2HQ5 A;  1TZL A;  1TWF J;  1B4A A;  1EH7 A;  2JT1 A;  4HOB A;  1EH8 A;  2BBY A;  3R6S A;  4UHT A;  4V2F A;  3HRM A;  4Y17 A;  4BAC A;  4XKB A;  4EJO A;  4PJL A;  2DA3 A;  3L2R A;  2GQQ A;  4YIR X;  1W0T A;  1HA8 A;  3K70 D;  1W36 D;  4OOI A;  2KDZ A;  4XLE A;  2OAZ A;  1LB2 A;  4EM0 B;  3LSJ A;  3HIF A;  1MSF C;  3S32 A;  1WVR A;  2VQH A;  1KU9 A;  2M7A A;  3GXO A;  3RKY A;  1K6O A;  3SXY A;  2K9Q A;  2LF7 A;  2VB6 A;  2Z3Y A;  3BTL A;  3ELK A;  2PMZ A;  4ZDL A;  3KP5 A;  3ZN1 A;  4DIQ A;  5ICC A;  2GAU A;  2HR3 A;  4DBQ A;  2HVS A;  1O7F A;  3WU0 A;  2R5Z A;  3L7W A;  4EEF G;  1S7E A;  1ZYR F;  2DPD A;  1J75 A;  1OMI A;  4B3A A;  1MJA A;  2XAU A;  3R61 A;  1BW6 A;  4DZJ A;  3Q9V A;  1W5C C;  2LLK A;  2ZXI A;  3LL7 A;  1ZRC A;  3RQI A;  2OZ6 A;  4CUG A;  3DWL E;  1OYY A;  2VJ4 A;  2JRT A;  1P9Q C;  1Z21 A;  2DT6 A;  2XGC A;  4U7B A;  2K40 A;  3RKX A;  3PO3 J;  1X1C A;  5ERI A;  3LOC A;  4N4N B;  2IS1 A;  4BJT A;  4M3F A;  4QLC U;  1MBH A;  2DA7 A;  4UV8 A;  3HOZ J;  1ZTR A;  1ETO A;  3VEP A;  2QBY B;  3MZH A;  1XSV A;  2HZD A;  1A6I A;  3IAS 2;  3K7A J;  1H9T A;  3G1O A;  1VQ9 I;  1D5V A;  3KZZ A;  2OZU A;  2PI0 A;  3RDI A;  1EH6 A;  2LR8 A;  2N8G A;  4BY7 J;  4KT6 A;  4UUT A;  2STT A;  3I71 A;  5CVR A;  2FX0 A;  2VBW A;  3BZC A;  2DJN A;  4IJA A;  1R5I D;  4MO7 A;  2R5Y B;  1USS A;  4J00 A;  1F36 A;  3HKZ N;  3KP6 A;  1K7A A;  3CJT B;  2IRF G;  3G71 I;  2CUZ A;  1QHH D;  2AXT C;  4ZYE A;  1YO5 C;  1N77 A;  3F8F A;  4MNU A;  4NC7 A;  2F4O B;  1R5H A;  2RKH A;  3CF5 F;  2MLK A;  1FBU A;  2COM A;  1Z05 A;  1T39 A;  4M72 A;  1Z3Y A;  1QHG A;  5F64 A;  5JLW A;  3E0J B;  2A5W A;  3FMR A;  2G7H A;  1YIO A;  2DDB A;  2M0C A;  3M8J A;  4HBL A;  1BIA A;  2Y48 A;  4HX4 A;  4C9Y A;  1IZ1 A;  4XOP A;  3AL0 B;  4PFO A;  1IRX A;  1RUO A;  2A3S A;  2IW5 A;  2RAE A;  2WB1 A;  2QWW A;  4U0Y A;  3IV5 A;  2Y69 H;  3ONQ A;  3AG4 H;  3E6D A;  2BYV E;  2WV1 A;  1UAA A;  4BNC A;  2FMY A;  3LSH A;  5F6F A;  2CQ7 A;  2VQG A;  5JR3 A;  1X3W B;  3M07 A;  2VBY A;  4N9H A;  1YJ9 I;  1QZY A;  2IT0 A;  1B8I A;  1JKR C;  4GYG A;  1XTA A;  2CU7 A;  3BR0 A;  4UB6 C;  2KKO A;  3C2H A;  2VLA A;  3VYR B;  3GTM J;  1X4P A;  3E6C C;  2M7B A;  1XS9 A;  3G4S I;  2LTP A;  4UNO A;  1MBE A;  1WJF A;  2CJJ A;  1K61 A;  1BL0 A;  4LG3 A;  4O3M A;  4UVC A;  3BG6 A;  3IH3 A;  1SD7 A;  3KEO A;  4HW0 A;  5BS6 A;  3AFH A;  5ICF A;  3G6E I;  2JRM A;  3JRE A;  4MLO A;  4ESJ A;  1WJ5 A;  4WCG A;  3D1N I;  2F2E A;  1OYW A;  1U3E M;  4RB2 C;  1KZH A;  1Z7L A;  3JRD A;  4G8X A;  2L9V A;  2DFE A;  2WY7 Q;  2CW0 F;  5LRS A;  4DYC A;  1G3S A;  1U5T A;  3TOA A;  1X3Z B;  2LG4 A;  1ACI A;  2VPR A;  4ENJ A;  1VF9 A;  1OKR A;  1XGO A;  3GTK J;  3L9F A;  5LEK A;  3FXR A;  3HSR A;  1O3Q A;  3SJM A;  2YU9 J;  4CHU A;  4NHJ A;  2V4J C;  1W36 C;  3DV8 A;  4Z6Y A;  1IUF A;  1TWA J;  1N25 A;  3HJE A;  5LHH A;  4BE1 A;  4J01 A;  2EJR A;  5EG0 B;  1S8N A;  3FXM A;  1Z77 A;  4PGG A;  4U87 A;  1FOK A;  3QQA A;  2EA4 A;  3W3C A;  3GTG J;  4D1Q A;  5D6E A;  3K2Z A;  2BXY A;  1BA5 A;  3O8H A;  5GTH C;  4M3G A;  4BYY A;  1T33 A;  2Y30 A;  3JRF A;  3OL3 A;  3OYL A;  1J2X A;  2X6W A;  2M4G A;  4FE7 A;  3RPU D;  2VXZ A;  2UZK A;  1LVA A;  1N75 A;  3A0B C;  1HC8 A;  2F5F A;  4BJ5 C;  3NRV A;  2F6C A;  3FF5 A;  3JTG A;  1E3H A;  1LPQ A;  2FBI A;  4K2E A;  2VT2 A;  4PJ0 C;  1LFB A;  4IHS A;  4MQV A;  3J7A Y;  3DBH B;  2O5R A;  4OMY A;  4D7M A;  5C4X J;  2NRA C;  1BIB A;  3FZV A;  2CGP A;  3MKL A;  1TQP A;  3DU6 A;  3HXL A;  1IO2 A;  1MZB A;  2ZXW H;  4HPQ A;  4M74 A;  1ETQ A;  1A36 A;  2E2H J;  4U0V A;  1TNT A;  4YII A;  3DCF A;  3GTJ J;  2RRE A;  5ILV A;  5J1R A;  4E7I A;  5M3M J;  3CTA A;  5FD6 A;  3O6B B;  3H0D A;  2NYX A;  1UJ8 A;  1X1D A;  2BY0 A;  3OS1 A;  2DTR A;  2JJ7 A;  2R7O A;  3LNQ A;  3S17 J;  1P4A A;  3LA3 A;  2MYS A;  2VT3 A;  1FSE A;  4AYB N;  2M1B A;  3M1E A;  4LD5 A;  5KCM A;  2O03 A;  1YG2 A;  3WG9 A;  1AOY A;  1LFP A;  3PJR A;  3J7A O;  4C2M J;  3OR1 C;  1TW2 A;  2E1M C;  4I98 B;  3I4P A;  4XKC A;  2PN6 A;  2DT5 A;  1S72 I;  1NK2 P;  3RYR A;  4RB1 A;  3L2Q A;  2ISZ A;  2PLY A;  3H3V K;  3BR2 A;  2XVC A;  2ZSI B;  1O3T A;  1SFU A;  3SFZ A;  2EV5 A;  4XOT A;  5FLM J;  2R5Z B;  1KQ8 A;  2RNG A;  1WJE A;  4KYW A;  1ZR4 A;  4IOC F;  1T38 A;  3ABM H;  3WE3 A;  3DP7 A;  5CQE A;  3TDZ C;  1ON1 A;  4LB6 B;  3OYN A;  5J40 A;  3FXU A;  5FLV A;  2X85 A;  3CP2 A;  1IGN A;  4HNU A;  2HVR A;  2M3A A;  2EB7 A;  3GTL J;  3B6C A;  2XAJ A;  4N9I A;  3OYD A;  1RUN A;  1KU7 A;  5D8L B;  5IT9 K;  1LKX A;  4JX5 A;  1Z6T A;  4CCN A;  2FQ3 A;  2WAF A;  2DFF A;  2HQR A;  3QYB A;  3Q0U A;  3BY6 A;  3H5N A;  1FYM A;  1RKT A;  1GVD A;  4XLA A;  2R0Q C;  2P8T A;  1WJC A;  2Z1D A;  3C18 A;  5DS9 A;  2IS4 A;  3KLN A;  3OOP A;  2JK3 A;  3PQK A;  3CF2 A;  5E20 A;  3HHH A;  5EYR A;  1X19 A;  4G6D A;  4JK1 X;  3BJA A;  2BW3 B;  3RZO J;  2H6C A;  4XNF A;  3E5Q A;  3OYG A;  2E7W A;  3PIP F;  3X2Q H;  4O6J A;  2V9P A;  3T1B A;  4LFU A;  3ZOB A;  4YFN F;  2EFQ A;  2L9R A;  2R7X A;  1FOX A;  1CQT A;  3SHF A;  4KIF A;  3CCJ I;  3IHU A;  2HKX A;  2HYJ A;  3OIO A;  2M9H A;  2RDP A;  3FDY A;  1FWZ A;  3OOU A;  2YU3 A;  2VOD A;  4G12 A;  1ETK A;  1RI7 A;  1ZGW A;  1RPW A;  1SVM A;  3PNT A;  3QOE A;  5B5E C;  3J80 K;  3TDU C;  4HDU A;  1TWC J;  2E35 A;  5DCF A;  1R6R A;  2Z9O A;  3HPH A;  3ZMZ A;  5M5W J;  3BPV A;  1YW9 A;  1I39 A;  2ETH A;  4A0X A;  1MMA A;  2XAG A;  2KIQ A;  5J3L A;  3Q5F A;  4YEL A;  4KN4 X;  4C3J J;  3G1M A;  3WTS C;  4ZZL A;  3E6B A;  4XRM A;  2MLG A;  3OYH A;  3BCA A;  2NS8 A;  2ZB9 A;  4L9N A;  1ZRE A;  2DOA A;  4YFX F;  4A6E A;  1XCV A;  3LAP A;  3TKY A;  4A3D J;  2BGC A;  1MND A;  3AAF A;  1FMV A;  4RDU A;  3KPH A;  2MH9 A;  3L09 A;  4GRI A;  2FRH A;  3TBI A;  3E1S A; 
#chains in the Genus database with same CATH homology
 4BHB A;  2V1X A;  3JAM Z;  5DUI A;  1ZGJ A;  2CFX A;  2DK5 A;  2P5K A;  2Q0O A;  4ESF A;  5FB2 A;  4N0B A;  3SZP A;  3DQV C;  4KDP A;  4EJU A;  3DF8 A;  4U7D A;  1XMA A;  1OR7 A;  3W6J B;  2ELH A;  4L5J A;  3ECH A;  2P5V A;  4XRF A;  5H6Q A;  3R0J A;  3M8F A;  2Z99 A;  2YSR A;  4ENM A;  2P7V B;  1ZHF A;  4DQ2 A;  3GFJ A;  1STZ A;  2J5P A;  3HSE A;  2AS5 F;  3FHZ A;  1B59 A;  3EUH A;  4ZH4 F;  3S2W A;  5DV5 A;  1ON2 A;  2W57 A;  1Q1H A;  5KK1 A;  2ZME A;  3RKW A;  1LDD A;  3I59 A;  3D5L A;  2KIF A;  1OYI A;  5L3D A;  1QBJ A;  2XKP A;  2C6Y A;  5CVJ A;  2FNA A;  4HQM A;  2GZW A;  1LEB A;  1YQA A;  2L4A A;  5DCM A;  3F6O A;  1IUY A;  1SD5 A;  3C7J A;  3QOP A;  3KLO A;  4Q5S F;  4IHT A;  1GXQ A;  2H27 A;  3REO A;  3HHG A;  2A6E F;  3MEX A;  5L3B A;  3ML6 A;  5LEJ A;  3JSO A;  4CZZ A;  3N4M A;  1KYZ A;  2L3D A;  3MZY A;  1FSH A;  3GFI A;  1XGS A;  3MCZ A;  4GO1 A;  5CYV A;  3SZT A;  3R60 A;  4UXN A;  1TQM A;  2FEZ A;  3WE2 A;  1WRJ A;  2XHK A;  5TJJ A;  1ZGA A;  1KU3 A;  5CVI A;  1ZLK A;  1TLH B;  3F8B A;  4M9S A;  1R1V A;  1H9G A;  1OPC A;  3K1P A;  2Q8K A;  5D5V B;  2UXN A;  2XIG A;  2EV0 A;  2LF8 A;  2QQB A;  4M6Y A;  2GA2 A;  4A0Z A;  5D6F A;  5D5X B;  4IRI A;  1IN6 A;  4RGR A;  3LST A;  4WF2 A;  1DPR A;  4CIC A;  5DCM B;  2JPC A;  2RVC A;  2RGV A;  4MGR A;  1XMK A;  3VB2 A;  3CLO A;  5D5U B;  4IRG A;  3ZP5 A;  4WXC A;  1O3R A;  3QP6 A;  3K9T A;  1XSD A;  2JTV A;  2EV6 A;  3ERE D;  2Z33 A;  1X3U A;  3TGN A;  4OU0 A;  5LGU A;  3FM3 A;  2PG4 A;  2RC4 A;  3DPT A;  4Z2Y A;  1BI2 A;  2K4J A;  4I0B A;  2O8X A;  4EVI A;  3KCC A;  2YX7 A;  4ESB A;  1Z6R A;  1J9I A;  3ZMV A;  2NS0 A;  4I09 A;  4HF2 A;  1J59 A;  1F5T A;  3O3K A;  4P9U A;  4OIO F;  1I1S A;  1FP2 A;  3CO7 C;  1REP C;  4BHC A;  2A5Y B;  4ASN A;  1ZLJ A;  5A2Q Z;  4KIG A;  1MKM A;  4GGG A;  1JXS A;  3RPQ A;  3DPL C;  1FLI A;  1ZAO A;  2EA2 A;  1IF1 A;  3L2C A;  2BE5 F;  2Y75 A;  4CYD A;  3RYP A;  1XDU A;  2IVM A;  2O6G E;  2VOO A;  1IRG A;  5JHU A;  4DNC A;  3KP2 A;  1O57 A;  2RNJ A;  2IJL A;  4Y13 A;  3IRR A;  3EQL F;  5JI6 A;  1DPU A;  3CUQ A;  1SFX A;  4MEY F;  2ZKZ A;  1UST A;  2IA2 A;  5HOO A;  4WXD A;  1ZRF A;  1B9N A;  1F9N A;  2K27 A;  4O5V A;  1ODD A;  1WSU A;  4L18 B;  2M45 A;  3FMQ A;  2QBY A;  1SMY F;  1E17 A;  2VC1 A;  1WWX A;  4OIR F;  4I02 A;  5D5W B;  3P9C A;  5D8K B;  4S05 A;  2VON A;  3J81 Z;  1LEA A;  3EET A;  4OIQ F;  1B6A A;  3KP3 A;  5LBQ A;  3Q9S A;  2DI3 A;  2XUB A;  1BC8 C;  1U6G A;  5E1W A;  4A0Y A;  3E5U A;  1XB4 A;  2VBZ A;  5CJ9 A;  4L5I A;  2HYF A;  1W5T A;  3QPH A;  2DQR A;  5F1R A;  3PFI A;  4L0Y B;  3HOT A;  2R7F A;  1Y0U A;  5E8G A;  3BP8 A;  2YX4 A;  1JGS A;  2E1N A;  4EJW A;  3WTX C;  2P7C B;  5K5O A;  2AXL A;  1XD7 A;  4PCQ A;  2QQA A;  3HRU A;  2XRO A;  3F8N A;  1IN7 A;  3HYI A;  1IN8 A;  1C0W A;  3IKV A;  1QPM A;  4UV9 A;  1GXP A;  3WOD F;  4RGU A;  3EDP A;  2VE8 A;  4U0W A;  2E7X A;  2M30 A;  2OA4 A;  2RV8 A;  2HTS A;  3V7C A;  1YLF A;  5D4R A;  3GFM A;  1ZG1 A;  4H0E A;  2HGC A;  1P2F A;  3MWM A;  2EWN A;  4FX4 A;  1FZP B;  3KET A;  3EYI A;  4KMF A;  4AIK A;  4LLN A;  3IRQ A;  1W4M A;  3FX3 A;  1FY7 A;  3K1N A;  3WGG A;  2DLL A;  3CJN A;  3LFK A;  3LQQ A;  5J6X A;  2IP2 A;  3QPT A;  4LG0 B;  1D8K A;  2ESH A;  4A5M A;  2NNN A;  1MJB A;  3I5U A;  4A12 A;  2FXA A;  1CF7 B;  1HSJ A;  1O7L A;  2ACJ A;  3WU1 B;  3ZMU A;  2EK5 A;  4EJT A;  5E18 F;  1R36 A;  2KRF A;  2Y0M A;  2DU9 A;  3GYH X;  4RGS A;  3M9A A;  1IW7 F;  2DAO A;  5FO5 A;  1B9M A;  3M7G A;  1UHM A;  4HX8 A;  2OQR A;  4LK1 F;  3BDD A;  4Q4Z F;  4I0A A;  3PQJ A;  1FBQ A;  1Z91 A;  4GCV A;  3GW2 A;  3H3U A;  1Z1D A;  3G73 A;  4RB3 C;  4YFK F;  2ISY A;  4M71 A;  3GO5 A;  1PP7 U;  2W25 A;  3BJ6 A;  3F8C A;  1BC7 C;  1GHC A;  3FMS A;  3RJP A;  4HQE A;  3I59 B;  5ILU A;  2OD5 A;  1HKT A;  2WC2 A;  4EJV A;  5LGN A;  2O61 A;  2PQ8 A;  2QVO A;  2ZFW A;  2HQN A;  3LWF A;  4IVN A;  3JTH A;  5ICE A;  1IXS B;  3MQ0 A;  1PDN C;  3B02 A;  1R1U A;  4ZYD A;  3HUG A;  4AIH A;  3QU3 A;  1HW1 A;  4HF0 A;  1QZZ A;  2IA0 A;  1MJ9 A;  2HDC A;  1IXC A;  4JBA A;  2BEO A;  5L3F A;  2JSC A;  4MTD A;  2PFB A;  4LJZ F;  3NEU A;  4EGY A;  2L4M A;  5FFZ A;  4EMS A;  2J5O A;  4BAY A;  5ED4 A;  1KGS A;  3P7N A;  3GLX A;  1D3Y A;  1H0M A;  4G9Y A;  1FYL A;  4S04 A;  4G6Q A;  3BPX A;  4G7O F;  2XV4 S;  5ICG A;  3T8T A;  4FT8 A;  4XSZ F;  1UB9 A;  1UCR A;  4P55 A;  4BHP A;  5J8C A;  4ZYH A;  1BOA A;  3DKW A;  1BI0 A;  2YPR A;  4UVB A;  5CLS A;  3HRT A;  5FLX K;  1SD6 A;  3HTU A;  3ABU A;  5A2Q K;  2B0L A;  1XGN A;  2VE9 A;  3VOE A;  4FX0 A;  1HST A;  4HAM A;  4NB5 A;  2QZ8 A;  2ESN A;  4EM1 A;  2H6B A;  2LSO A;  4GXO A;  2GA1 A;  1ZG3 A;  3ZMT A;  1J5Y A;  5DUK A;  2EFO A;  4WWC A;  2HWV A;  3M8E A;  4UUV A;  2FA5 A;  2LDU A;  5L3E A;  3F23 A;  1L3L A;  3I0T A;  1L0O C;  3HRS A;  5FGM A;  3T8R A;  3NQO A;  1P4W A;  5H6R A;  5DD8 A;  1BM9 A;  1KA8 A;  3T0Y A;  3RPU A;  1I6X A;  1P6R A;  3KFW X;  4LLL A;  2FSW A;  2Z5U A;  4JQF A;  4L9V A;  1U2W A;  1TQI A;  1LDK B;  3IKT A;  5HS7 A;  1R22 A;  2P4W A;  1DUX C;  1DDN A;  1T0F A;  4XBF A;  2RQP A;  5D4S A;  2V79 A;  2HEO A;  3O2P E;  2KJC A;  1XDS A;  1F1Z A;  1T6S A;  1R7J A;  3QRF F;  3HTS B;  2PMU A;  4RS8 A;  2D45 A;  1ZAR A;  2XAH A;  3CUQ B;  1QNT A;  1G4D A;  3QU6 A;  2XAQ A;  2E1C A;  1R00 A;  2M5W A;  4PGH A;  4AVP A;  4KUM A;  4LK0 F;  2EFW A;  3GUD A;  3LAJ A;  2W24 A;  1T98 A;  4KMU X;  1V3F A;  2VC0 A;  2OU2 A;  3N97 A;  2IPQ X;  3MAJ A;  3F8M A;  5E1Z B;  4HLY A;  4EM2 A;  4KN7 X;  3TOB A;  4G94 A;  3BJO A;  1UHW A;  3JAM K;  2NAZ A;  4TV7 A;  4EV0 A;  1LNW A;  5CVU A;  1AWC A;  1HW5 A;  2O0Y A;  4CXF A;  4XLP F;  4LMY A;  2STW A;  2WV0 A;  4D0P A;  4EGZ A;  1KQ0 A;  5JFR A;  4Q47 A;  3BWG A;  3FWE A;  5DD4 A;  2HKO A;  2MA3 A;  1BN5 A;  3D0S A;  3ZN0 A;  4WX9 A;  2MD5 A;  3WTY C;  4RB0 A;  2CG4 A;  2GXG A;  1EV7 A;  5E17 F;  2X0L A;  5FFX A;  3WTU C;  3F72 A;  1U8R A;  4EQQ A;  1TTY A;  2GWR A;  4F7Z A;  2UWM A;  4I2O A;  2ZCW A;  3P9I A;  1LJ9 A;  3V8L A;  3T5X A;  4B09 A;  5EEG A;  3COA C;  3W6K B;  3EYY A;  2W85 A;  1JHF A;  2XAF A;  4KIB A;  3E6M A;  3ABT A;  5DDG A;  5K5R A;  3WTT C;  4XSX F;  4LB5 A;  3GZ5 A;  1J0R A;  4IPA A;  2O3F A;  1LDJ A;  5K5Q A;  1TW3 A;  3KEQ A;  4ZYG A;  4IRH A;  2HZT A;  4P5O A;  1QGP A;  3FM5 A;  2FF4 A;  3I54 A;  2P6S A;  3F6V A;  3IWZ A;  2DFI A;  5HLG A;  2F5E A;  1K79 A;  4LG0 A;  2KIU A;  3HSF A;  1R23 A;  4M9Z A;  3F3X A;  4RGX A;  4E70 A;  2ZBK A;  2DW4 A;  2KIM A;  1G3W A;  3CUQ C;  4KT5 C;  4M73 A;  3BRO A;  1LQ1 A;  2RN7 A;  4AIJ A;  3ZQ7 A;  4LGW A;  2VBX A;  2XRN A;  3IWF A;  4HV6 A;  2ZNZ A;  1DP7 P;  3H92 A;  3IC7 A;  2MC3 A;  2NNY A;  4FHT A;  2F5C A;  1D8J A;  1IAW A;  1SD4 A;  3SQN A;  3GF2 A;  5LHI A;  3K1M A;  2ZME B;  3ROU A;  5AON A;  2A07 F;  4HF1 A;  5AIP A;  1HXD A;  4U88 A;  1T2K A;  5K1Y A;  2VOP A;  3E97 A;  3GVA A;  2ADU A;  4KIC A;  1E2X A;  1R58 A;  2QLZ A;  5DEQ A;  4KNY A;  5TRD A;  4L9J A;  3RIR A;  2PBI A;  4AWX B;  1UFM A;  3R4K A;  2DBB A;  2CWE A;  4KFC A;  2CQK A;  3I53 A;  5HLI A;  1R5G A;  3LQR A;  1G6N A;  2A6H F;  3E5X A;  2QM3 A;  5JVT A;  4NQW A;  1RIO H;  5IT9 Z;  1MGT A;  3ECO A;  2JZY A;  1HKQ A;  1HW2 A;  3TO9 A;  3OV8 A;  3KP7 A;  4MQ9 F;  4PDK A;  3GX4 X;  3V8J A;  3TO6 A;  1FT9 A;  2HOE A;  2FML A;  2A61 A;  1WKM A;  2JPB A;  4CGZ A;  3GZ6 A;  1I27 A;  1IRF A;  1IN4 A;  2R7D A;  1U5T C;  1ZRD A;  1I5Z A;  3MFK A;  2W84 A;  1TNS A;  4BQA A;  1ZH5 A;  1Z7U A;  2XGX A;  3WTZ A;  5LRR A;  4A6D A;  4R79 A;  4OIP F;  3WTV C;  1U5T B;  1HKS A;  3ZMD A;  2KJB A;  3GFL A;  2V1D A;  4P96 A;  2K02 A;  3VFZ A;  1YTY A;  1FC3 A;  2H94 A;  3I58 A;  4UVA A;  1KU2 A;  1S29 A;  2QEN A;  4GYI A;  2WTE A;  5HDK A;  1P92 A;  5BPI A;  2FBK A;  2F5D A;  1KYW A;  1MDM A;  5HDG A;  2Q2E A;  1NHA A;  1WI9 A;  3ZPL A;  1B1B A;  5KVR A;  4ON0 A;  1F4K A;  2V9V A;  1W7P D;  1XGM A;  5EEH A;  2QUF A;  3K69 A;  1ONV A;  3GWZ A;  2FOK A;  1PP8 F;  1S3J A;  3JW4 A;  2OQG A;  4BXU A;  5HS8 A;  4M9X A;  2EFP A;  2MBF A;  3WGH A;  3LA7 A;  2V6C A;  1XN7 A;  4HDV A;  1W7P A;  4HZF A;  4I7H A;  5FD5 A;  2DQL A;  3QAH A;  2ZXJ A;  2DO7 A;  1QO0 D;  4L9T A;  4Q48 A;  5HVQ C;  3KZY A;  2L02 A;  4G7Z F;  4HA8 A;  4M6X A;  1FP1 D;  1IN5 A;  5CVV A;  1Z9C A;  6PAX A;  1P4X A;  4BH9 A;  2M8E A;  3ISP A;  3KE2 A;  3L00 A;  1J7K A;  5LHG A;  4L0Z B;  1YW7 A;  1K78 A;  2A68 F;  4YIF A;  2XKO A;  4P9F A;  4R8H A;  1S6L A;  5HDN A;  2K4B A;  2ZJ2 A;  1TBX A;  4HX7 A;  3C1D A;  1QQI A;  3F21 A;  4A5N A;  1HQC A;  4IXA A;  5DYM A;  2YR2 A;  1O3S A;  5BOX A;  4AD9 A;  4I01 A;  1SAX A;  5E1X A;  4HYE A;  2P6T A;  4Y15 A;  2G9W A;  4OIN F;  3RI4 A;  2VN2 A;  2M87 A;  3DXJ F;  2HS5 A;  3V7R A;  3ULQ B;  2A69 F;  3BZ6 A;  4R1H A;  3V4G A;  3JSP A;  1BBY A;  3J81 K;  1RZ4 A;  1GVJ A;  2ZO4 A;  3CUO A;  1ZN2 A;  4ENN A;  2LKP A;  5H20 A;  5LLQ A;  3I64 A;  2L54 A;  4RAZ A;  1VTN C;  3E3V A;  2H09 A;  1YYV A;  2D1V A;  1KQ9 A;  4IF4 A;  5E8I A;  3FXQ A;  3LA2 A;  1W5S A;  2GIV A;  2IA1 A;  4CO8 A;  4PZJ A;  1BI3 A;  5J8F A;  4ZZD A;  2CYY A;  1XSX A;  1ULY A;  2L01 A;  1YW8 A;  4LLG F;  3CO6 C;  3WGI A;  2V1U A;  2QYO A;  2PEX A;  1JE8 A;  3F22 A;  2ZNY A;  5HLH A;  3WTW C;  2LNB A;  1W7P B;  2XAS A;  3H3Z A;  3KP4 A;  1G3T A;  2K86 A;  2R3S A;  1FX7 A;  4YG2 F;  4CDG A;  2PMH A;  1CGP A;  1RNL A;  1PUE E;  2HTJ A;  2DK8 A;  5ILS A;  4MHG A;  3RTR A;  3BOQ A;  3DFG A;  1S7O A;  2EFN A;  4WXH A;  1YS7 A;  3G3Z A;  1V4R A;  2UXX A;  1G3Y A;  1XCB A;  1K78 B;  1BJA A;  3U9G A;  2FE3 A;  2G7U A;  2WWY A;  1IXR C;  2TDX A;  1MD0 A;  3U1D A;  2D2W A;  3R0A A;  3V8K A;  3TQN A;  2HFH A;  1MDM B;  2CO5 A;  3DEU A;  3C3W A;  1SFE A;  2FBH A;  1JHH A;  1R1T A;  1YFH A;  1FBS A;  2DPU A;  3CDH A;  5FLX Z;  5HS9 A;  5BQT A;  3U2R A;  1HBX G;  5LGT A;  2QQ9 A;  4HLX A;  2FU4 A;  4B8X A;  1ZG5 A;  5BMZ A;  4ENK A;  1I1G A;  2D1H A;  3VOD A;  1BI1 A;  5IT3 A;  3J80 Z;  1YS6 A;  2CSO A;  1FNN A;  3TO7 A;  4MEX F;  4QWQ A;  1CF7 A;  1WQ2 A;  4XLN F;  5L3G A;  2BV6 A;  4ETS A;  2OBP A;  4A2U A;  3IL2 A;  1FYK A;  2K7L A;  4G7H F;  4HV5 A;  2P5L C;  1U78 A;  4MTE A;  1S7A A;  3B73 A;  4KA4 A;  3V7S A;  2HYG D;  3HOS A;  2X4H A;  5L3C A;  3GEZ A;  2FNP A;  5AIQ A;  3P9K A;  4OMZ A;  4RAY A;  4WK8 F;  5BPD A;  2PJP A;  3QP5 A;  1SMT A;  3K0L A;  1FPQ A;  2MH2 A;  3ZMS A;  1A04 A;  1B4A A;  1EH7 A;  2JT1 A;  4HOB A;  1EH8 A;  2BBY A;  3R6S A;  4UHT A;  3HRM A;  4Y17 A;  4EJO A;  2GQQ A;  4OOI A;  2OAZ A;  1LB2 A;  4EM0 B;  3HIF A;  3GXO A;  3RKY A;  1KU9 A;  1K6O A;  3SXY A;  2LF7 A;  2Z3Y A;  3ELK A;  3ZN1 A;  3KP5 A;  5ICC A;  2GAU A;  2HR3 A;  1O7F A;  3WU0 A;  3L7W A;  1ZYR F;  2DPD A;  1J75 A;  1OMI A;  1MJA A;  3R61 A;  3Q9V A;  1ZRC A;  2OZ6 A;  1OYY A;  2JRT A;  4U7B A;  3RKX A;  5ERI A;  4QLC U;  4UV8 A;  3VEP A;  2QBY B;  3MZH A;  1XSV A;  1H9T A;  1D5V A;  3KZZ A;  2OZU A;  2PI0 A;  3RDI A;  1EH6 A;  2STT A;  3I71 A;  5CVR A;  2VBW A;  4IJA A;  1USS A;  3KP6 A;  1K7A A;  2IRF G;  4ZYE A;  1YO5 C;  3F8F A;  4MNU A;  1R5H A;  2RKH A;  2MLK A;  1FBU A;  2COM A;  1Z05 A;  1T39 A;  4M72 A;  5F64 A;  3FMR A;  2G7H A;  1YIO A;  4HBL A;  1BIA A;  2Y48 A;  4HX4 A;  1IZ1 A;  1RUO A;  2A3S A;  2IW5 A;  2QWW A;  4U0Y A;  3E6D A;  2BYV E;  4BNC A;  2FMY A;  5F6F A;  5JR3 A;  2VBY A;  4N9H A;  1QZY A;  2IT0 A;  4GYG A;  2KKO A;  3E6C C;  4UNO A;  4O3M A;  4UVC A;  1SD7 A;  3KEO A;  4HW0 A;  5BS6 A;  5ICF A;  4ESJ A;  4WCG A;  2F2E A;  1OYW A;  1U3E M;  4RB2 C;  4G8X A;  5LRS A;  2CW0 F;  1G3S A;  1U5T A;  3TOA A;  4ENJ A;  1OKR A;  1XGO A;  3L9F A;  5LEK A;  3FXR A;  3HSR A;  1O3Q A;  4CHU A;  4NHJ A;  3DV8 A;  5LHH A;  2EJR A;  1S8N A;  1FOK A;  4PGG A;  2EA4 A;  5D6E A;  3K2Z A;  4BYY A;  1J2X A;  2VXZ A;  2UZK A;  1LVA A;  2F5F A;  3NRV A;  3FF5 A;  3JTG A;  2FBI A;  4K2E A;  2VT2 A;  4IHS A;  4MQV A;  4OMY A;  2NRA C;  1BIB A;  3FZV A;  2CGP A;  1TQP A;  1MZB A;  4M74 A;  4U0V A;  1TNT A;  4YII A;  5ILV A;  3CTA A;  5FD6 A;  3O6B B;  2NYX A;  2DTR A;  1P4A A;  3LA3 A;  2VT3 A;  1FSE A;  2M1B A;  3M1E A;  4LD5 A;  3WG9 A;  2O03 A;  1YG2 A;  1AOY A;  3J7A O;  1TW2 A;  4I98 B;  3I4P A;  2PN6 A;  2DT5 A;  2ISZ A;  3RYR A;  4RB1 A;  2PLY A;  2XVC A;  1O3T A;  1SFU A;  3SFZ A;  2EV5 A;  1KQ8 A;  4KYW A;  1T38 A;  3WE3 A;  3DP7 A;  3TDZ C;  1ON1 A;  4LB6 B;  3FXU A;  2EB7 A;  2XAJ A;  1RUN A;  4N9I A;  1KU7 A;  5D8L B;  5IT9 K;  1Z6T A;  2FQ3 A;  2HQR A;  3BY6 A;  1FYM A;  2P8T A;  3C18 A;  3KLN A;  3OOP A;  3PQK A;  5E20 A;  3HHH A;  4G6D A;  4JK1 X;  3BJA A;  2H6C A;  3E5Q A;  2E7W A;  4O6J A;  3T1B A;  4LFU A;  4YFN F;  2EFQ A;  3SHF A;  4KIF A;  3IHU A;  2HKX A;  2RDP A;  1FWZ A;  2YU3 A;  2VOD A;  1RI7 A;  3J80 K;  3TDU C;  4HDU A;  5DCF A;  2Z9O A;  3ZMZ A;  3BPV A;  1YW9 A;  2ETH A;  4A0X A;  2XAG A;  3Q5F A;  4KN4 X;  3WTS C;  4ZZL A;  3E6B A;  2MLG A;  4L9N A;  1ZRE A;  4YFX F;  4A6E A;  1XCV A;  3LAP A;  3TKY A;  2BGC A;  3AAF A;  2MH9 A;  3L09 A;  2FRH A;  2GXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...