5IT3A

Swirm domain of human lsd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
LPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Tlx-interacting peptide of Lsd1 inhibits the proliferation of brain tumor stem cells
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific histone demethylase 1A
total genus 29
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it3A00
2HQNA 4HDUA 3HRUA 1H9TA 2HYGD 3NQOA 1JE8A 1CF7A 1BM9A 3JTGA 3W6KB 2BYVE 2RGVA 4I09A 1EH8A 1BI0A 5BQTA 4KN4X 3QU3A 1XSDA 3RYPA 3EETA 1XSVA 4AIKA 1TQPA 2IW5A 1LJ9A 3MQ0A 4ESJA 4UVAA 3W6JB 1IXCA 1MDMB 2FQ3A 4U0VA 2FMLA 2QBYA 1IXSB 2DAOA 2IA2A 4JQFA 2EFNA 1Q1HA 1S8NA 3SQNA 3QPTA 5DV5A 3T8TA 1XGNA 2EK5A 2QWWA 2ZBKA 4HOBA 2XAQA 3FZVA 4G7OF 3LAJA 1V4RA 2JPCA 2XAJA 2P6TA 2C6YA 2Z9OA 4A6DA 3FMSA 3DPTA 4S04A 3LA3A 3COAC 1SFEA 3EYYA 1D8KA 1IF1A 5K5OA 4XLPF 4MTEA 3N4MA 3KZZA 3GZ6A 4A5MA 4A0XA 1D5VA 4LMYA 2HTSA 2GA1A 1HQCA 4P9FA 4RAYA 1YW7A 1YLFA 4L9NA 3HOSA 3E6MA 4TV7A 1BN5A 5ERIA 2VBYA 3F72A 1O57A 4LLNA 4CO8A 2M45A 1O3SA 1YS7A 3I58A 2P5VA 2A69F 5HS8A 3FM5A 1K78B 5HS7A 1QPMA 5CVRA 3FMRA 4WX9A 4AIJA 3VOEA 5J8CA 2Z5UA 3ELKA 4P55A 2GXGA 5A2QK 4OIPF 3KCCA 2L4AA 2ZXJA 5CVIA 4KICA 2G9WA 2J5OA 4LG0A 1O7FA 4R8HA 3L09A 4ZYHA 3JW4A 4AIHA 5LHGA 3RPUA 5TJJA 3DPLC 2EV0A 5IT3A 3EQLF 3NRVA 1U5TC 2V1XA 2HWVA 2D45A 3TO9A 3LWFA 3KP5A 3I59A 3RKYA 4Y17A 2VODA 4HW0A 4RB2C 1FSHA 1BJAA 6PAXA 2XVCA 5HS9A 3LFKA 4Q5SF 1T38A 3ULQB 3ZMSA 2KJCA 1BI1A 3L00A 3C7JA 3ZP5A 3V7RA 4BHCA 1MJ9A 4N0BA 1LNWA 4CZZA 1ZG1A 4GXOA 4ZYEA 2FBKA 1IZ1A 3JSPA 3WE3A 2XAHA 5BS6A 3O6BB 4M6XA 2FF4A 1ZREA 5ICEA 1ZGAA 2DO7A 2R3SA 2PQ8A 3E5XA 2VBXA 1TW2A 1I1SA 4JK1X 3E5UA 5H6RA 4ON0A 1R5HA 3QPHA 1ZG3A 3M9AA 2UXXA 2PFBA 1STZA 4WK8F 2XASA 3VB2A 5D6FA 5D8KB 3PFIA 2LF7A 3WU1B 3LAPA 4LGWA 2QZ8A 3V4GA 3GFMA 1KYWA 1ZH5A 4IPAA 1IN6A 4IHTA 1DPRA 4L0YB 1QNTA 1K79A 4L18B 3J81K 3IWZA 3PQKA 1TQIA 4PCQA 4O6JA 2G7HA 2XAGA 3V8KA 4ZZDA 1G3WA 5FD6A 1ZRFA 5LRRA 5L3BA 3GLXA 1VTNC 3K1MA 2E1NA 1Z1DA 1F5TA 1B59A 1YW9A 1O7LA 2H94A 4JBAA 4RGUA 4LLLA 5ICFA 1MZBA 3HHGA 4AVPA 4G8XA 2Z33A 2ZMEB 5DEQA 5CVVA 2K4JA 1DDNA 2YR2A 1R1VA 3E6BA 4KDPA 4IHSA 2MBFA 1XN7A 1USSA 2Z3YA 4OIQF 2WTEA 2O61A 4HDVA 3K1PA 4MEXF 3ROUA 3O2PE 3QAHA 4G9YA 2DK8A 4WF2A 1F9NA 2EJRA 3DFGA 2M8EA 2QVOA 3ECHA 2M30A 3BZ6A 3OV8A 1SD6A 5E18F 5D6EA 5HLGA 4A12A 3C3WA 1T0FA 1FYMA 1B9NA 2DQRA 4UV9A 3BJAA 2KJBA 4WXCA 1TW3A 3WTZA 4ENMA 1W5SA 1G3SA 1XCVA 1KU2A 4RB0A 3F21A 2ISYA 1TTYA 2K7LA 4L0ZB 3R61A 4KNYA 5JHUA 3ABTA 2A68F 4DNCA 4BQAA 4EJTA 2QENA 3F6VA 3GF2A 4H0EA 2NRAC 1LDDA 5BPIA 1ZRDA 1FWZA 2NNYA 3IL2A 1RUOA 1JXSA 5LLQA 1F1ZA 2EWNA 5LHHA 4FHTA 4D0PA 5ILSA 3WODF 2VONA 4KYWA 4HZFA 2KKOA 3T8RA 3KLNA 3R0AA 4FX0A 3KEOA 2ZFWA 1U8RA 2IA1A 1QGPA 3IKTA 1ULYA 3J80Z 3I53A 1KQ9A 1FP1D 2GQQA 3C18A 2BE5F 2EFQA 1XGMA 1D3YA 1Z9CA 1ZLKA 1SFXA 5HOOA 1ON1A 1ZLJA 4M72A 4I2OA 2CFXA 4ENKA 1J5YA 4HYEA 2AS5F 1AOYA 3WE2A 4M73A 2ZO4A 1ZGJA 2P7CB 1RIOH 5HLIA 1P92A 3JAMK 4PGHA 1SMYF 3WTXC 2E7XA 2ESHA 2Y48A 1XMAA 1KU9A 1OKRA 1AWCA 1PDNC 1HKSA 4XSZF 4U0WA 4L9JA 4G7HF 5J8FA 4ZYGA 1TLHB 2XGXA 4HV5A 1YTYA 2HYFA 2CW0F 2DT5A 1MJBA 4UV8A 4LFUA 2VT3A 3TKYA 2IJLA 1Y0UA 3P9KA 4WWCA 3FXRA 4RGRA 3J7AO 4HAMA 3P9CA 3I0TA 1W5TA 1ZRCA 1BIBA 1IN8A 2H6CA 5LRSA 2JPBA 2FBHA 3QP6A 2ELHA 3MEXA 2NS0A 4EM1A 4PDKA 2LKPA 2E1CA 3BROA 4M9SA 1RNLA 1HSJA 4UXNA 4EV0A 2WC2A 3RI4A 1L3LA 3EUHA 1O3RA 2Q8KA 4O3MA 1Z6TA 3ZMDA 5FLXK 2M1BA 3G73A 2BEOA 4I02A 4A6EA 4LK1F 1R00A 3GUDA 2DW4A 5HDGA 2QYOA 4E70A 5BPDA 4MQVA 4HV6A 3F22A 3JTHA 2IPQX 1KQ0A 2IA0A 5JI6A 2DBBA 4YIFA 3QRFF 3AAFA 1IN7A 5FFZA 3BPVA 2LSOA 3DP7A 1NHAA 3CTAA 4IRGA 1IRGA 1IN4A 2V79A 3BOQA 2LF8A 3HTSB 1P4WA 3I64A 2W85A 2UWMA 3R4KA 1ZG5A 3ZN1A 1R58A 1IUYA 3IRQA 2Q2EA 3E5QA 2RQPA 4LLGF 5D5XB 3ERED 2DPUA 1XMKA 5E1ZB 3KEQA 5L3FA 3SZTA 5F6FA 2VBWA 4HX4A 1T39A 2MLKA 3BDDA 4L5IA 3BY6A 2IVMA 4KT5C 1PP8F 4IRHA 5FFXA 2H09A 4BHBA 3Q5FA 3K2ZA 5ILUA 1KYZA 2ZJ2A 3NEUA 3ZMVA 3M1EA 1G4DA 2QLZA 3P7NA 5FLXZ 1I1GA 3HSFA 5D8LB 1GXQA 3U2RA 5K1YA 3GFIA 4O5VA 1W7PA 3D0SA 5AIQA 1HW1A 2VBZA 1J0RA 4G94A 4KUMA 3VODA 3M8EA 2TDXA 1BIAA 3DXJF 2CQKA 2XAFA 2JZYA 3F8NA 3EDPA 3KP2A 3TOBA 5ED4A 2O0YA 1I5ZA 3CUQA 2K27A 2F2EA 1XGSA 1R22A 1BBYA 3KP3A 1UHMA 3J80K 1IRFA 1PP7U 3I71A 2G7UA 2A6HF 3RYRA 5D5VB 2LDUA 3FMQA 1QQIA 1ZAOA 3P9IA 1OYWA 2VC1A 2COMA 2BGCA 3KETA 3T1BA 2J5PA 5EEHA 1YW8A 1T2KA 2V1UA 1IW7F 3J81Z 2UZKA 1MKMA 4A5NA 2X0LA 4M9ZA 4EQQA 3GZ5A 1J2XA 1WSUA 1I27A 3K69A 3KFWX 1RZ4A 2E7WA 1BC8C 3I5UA 4ETSA 1W4MA 2HDCA 4UVBA 3F6OA 4QLCU 2D1HA 3REOA 2HQRA 3WG9A 3HRMA 1K7AA 2EB7A 3GW2A 1T6SA 1FBQA 1FP2A 3FWEA 1S3JA 2AXLA 4KA4A 4Q4ZF 1MGTA 3GX4X 4NB5A 5H6QA 2STWA 1ZN2A 1IAWA 2A3SA 2JRTA 4HX8A 4IVNA 2EV6A 2GAUA 2MH2A 4CXFA 4B8XA 4F7ZA 3KLOA 1G6NA 2YPRA 2H27A 2HS5A 3L7WA 2P5LC 3WTSC 4P9UA 1R7JA 5J6XA 2PLYA 2HEOA 2ZKZA 3OOPA 2F5CA 5BOXA 4MTDA 1ONVA 1OYYA 1R5GA 1KGSA 5IT9K 1T98A 2IRFG 4KMUX 3ML6A 1F4KA 1FT9A 4R1HA 1W7PB 3ZPLA 2V6CA 4YIIA 2Q0OA 1EV7A 1J59A 4XBFA 1GXPA 1QZYA 2EFOA 4GYIA 1KU7A 2K4BA 3FM3A 2FMYA 4BHPA 2MA3A 5DD4A 1HKTA 1QBJA 2QQBA 3SZPA 2VXZA 4I0BA 5EEGA 1SMTA 1OPCA 5DYMA 3CUQB 3TQNA 2W24A 1FZPB 4I0AA 3HSRA 2PG4A 1TNTA 3F8CA 2R7DA 5CVUA 3IC7A 3GVAA 4EJWA 4MQ9F 4CYDA 4KIGA 4FX4A 2DLLA 2FXAA 1RUNA 3V8JA 4EM0B 5JFRA 4UUVA 4S05A 2PMUA 2L54A 3LQQA 4AWXB 1DPUA 1FBUA 4LG0B 1EH7A 2O03A 4OIOF 4RB3C 2P7VB 2KIFA 3DF8A 1QZZA 1HBXG 3DKWA 3KP6A 1TNSA 4NHJA 1LDJA 1JHFA 3Q9VA 1IXRC 3DQVC 1LEBA 5CYVA 2FEZA 4EJUA 1R1TA 5HDNA 1FSEA 4M71A 5L3DA 2F5DA 3DV8A 1S6LA 2YX7A 5HVQC 3FX3A 1MD0A 4RGSA 5K5RA 1B6AA 3JSOA 2ETHA 4M6YA 4XLNF 1O3TA 1R1UA 2PJPA 4Y15A 5KK1A 4XRFA 4LJZF 1R36A 2V1DA 1LEAA 2F5EA 3HRTA 4UHTA 3F8FA 1O3QA 4LD5A 3N97A 3KZYA 4MEYF 2XUBA 1P2FA 5E1WA 1U3EM 2CSOA 3ISPA 5LGNA 2O3FA 2PI0A 3ZN0A 3QP5A 2MLGA 2XHKA 3K9TA 2HKXA 2DFIA 2M87A 1Z91A 3IHUA 5ILVA 5F1RA 3GYHX 5KVRA 3T0YA 5E8GA 3WTVC 2EFWA 1Z7UA 2A61A 1U5TB 2HGCA 3U1DA 5D4RA 2HOEA 1GHCA 2RKHA 4I98B 4OMZA 1UCRA 3H92A 3IWFA 1XDUA 2MC3A 4QWQA 4Z2YA 3RKWA 1G3TA 3K1NA 4FT8A 3WTWC 4WXDA 1YS6A 1HXDA 2W84A 2OD5A 3MZYA 4L9TA 3MCZA 4I01A 4M74A 5LGUA 1RI7A 4LB5A 4ESBA 2Z99A 3C1DA 2STTA 1HKQA 3LA7A 2XRNA 2DQLA 2A07F 4HF1A 4UVCA 3CUQC 1DUXC 4U7DA 2W25A 3L9FA 5DDGA 2GXBA 3WGHA 1Z6RA 2XROA 1SFUA 2CYYA 2Y0MA 2BBYA 2YX4A 4KIFA 2HTJA 2QBYB 2ZNZA 4BNCA 2ISZA 2A6EF 4U0YA 5L3GA 4OU0A 1J7KA 4HQEA 3IKVA 2K02A 4ENNA 1UHWA 2O6GE 1R23A 2LNBA 3Q9SA 3GWZA 1LVAA 3GEZA 2FRHA 2PN6A 3EYIA 1YQAA 4GYGA 4UNOA 3O3KA 2OU2A 1E17A 2FA5A 2R7FA 3KP4A 4L5JA 1B1BA 3ZMZA 2DK5A 3CUOA 4GGGA 4P96A 1SD4A 3FXUA 3TO6A 2EV5A 3WTTC 1HSTA 2QQ9A 1XGOA 3JAMZ 1WKMA 2HFHA 3HUGA 2P4WA 1I6XA 3GFLA 2YSRA 5D5WB 4B09A 5E17F 1P4XA 1V3FA 4RS8A 4PZJA 4Q47A 5DCMB 4HLYA 5DCFA 1D8JA 5BMZA 1XD7A 2L4MA 2X4HA 5DUIA 1YO5C 3KE2A 3MZHA 1K78A 4HBLA 3RDIA 1P6RA 3QU6A 1FNNA 3FHZA 2WWYA 1XDSA 2BV6A 3TDZC 4AD9A 5DD8A 2EFPA 4IF4A 3HYIA 3R60A 4RGXA 1H0MA 2QQAA 1TQMA 3D5LA 4A0ZA 1YFHA 2L01A 2RC4A 4EGZA 1X3UA 5K5QA 2JTVA 4N9IA 2CGPA 1FX7A 2FSWA 2GA2A 1OYIA 5E20A 3CO6C 3MWMA 5JVTA 3WU0A 3I59B 2DTRA 1C0WA 2RDPA 1CGPA 3IRRA 1BC7C 4A0YA 2EA4A 1CF7B 4CGZA 4OMYA 1KU3A 2D1VA 4IRIA 1FLIA 4U88A 2ZNYA 2ZMEA 4XSXF 4GCVA 4DQ2A 3E3VA 1JGSA 3HHHA 2L3DA 5H20A 3BP8A 1LDKB 1WI9A 2M5WA 1J75A 3SFZA 2DI3A 1FY7A 3HSEA 3VFZA 1YIOA 1FBSA 4EVIA 3T5XA 2RNJA 5AONA 1XCBA 4YFXF 4KMFA 1OMIA 3R0JA 3HRSA 2HZTA 1FPQA 2VT2A 4L9VA 4LB6B 1K6OA 3HIFA 4CHUA 3M8FA 3VEPA 4Y13A 5HLHA 5LEKA 1PUEE 1XB4A 1WRJA 5D4SA 1TBXA 2CWEA 2WV0A 1W7PD 4HF0A 4P5OA 3E6DA 3R6SA 4U7BA 2FU4A 5CLSA 2GIVA 4HF2A 4KFCA 2DU9A 2PMHA 3WGGA 3B02A 4MHGA 3L2CA 2KRFA 2NYXA 1MJAA 3HOTA 1EH6A 5FGMA 4YFNF 2O8XA 4ZZLA 4R79A 5A2QZ 3ZMUA 3V7SA 4KIBA 2KIMA 5FO5A 5CVJA 2RN7A 5LGTA 5DUKA 3U9GA 3B73A 2IT0A 5LEJA 4I7HA 2VN2A 1J9IA 2V9VA 5E8IA 2QUFA 4G6QA 1S7OA 2NNNA 1USTA 2FOKA 1G3YA 3ABUA 1QO0D 2K86A 1YYVA 2UXNA 3GFJA 2RV8A 2XKOA 3LSTA 1SD7A 4A2UA 1ZARA 1U78A 1BI2A 2H6BA 1HW5A 2XIGA 3KP7A 3WTUC 1JHHA 2JSCA 3ZMTA 3E6CC 2ESNA 2DPDA 2B0LA 3PQJA 4RB1A 3MFKA 1WQ2A 5E1XA 4LK0F 3FXQA 1UB9A 2Y75A 5JR3A 4G6DA 2GWRA 3BJOA 3SXYA 2VE9A 3WTYC 3I4PA 2XV4S 4Q48A 1SD5A 2OA4A 1FOKA 3BWGA 4EJVA 1IN5A 2VOOA 4ENJA 2EA2A 3H3ZA 5D5UB 3HTUA 4G7ZF 4KN7X 2MD5A 4ZH4F 5L3CA 2OZUA 1UFMA 4GO1A 4CICA 4EM2A 4WCGA 1YG2A 1ODDA 2D2WA 1ZHFA 2HR3A 1Z05A 2L02A 1B9MA 2OQRA 1BOAA 5FD5A 3CO7C 2PEXA 2P6SA 1MDMA 1U6GA 4ASNA 4MNUA 1S29A 2PBIA 4EMSA 3DEUA 1SAXA 3CLOA 4BYYA 3WGIA 4MGRA 3RIRA 4EJOA 4WXHA 5L3EA 2P5KA 4HQMA 4HLXA 2VOPA 4YG2F 2W57A 5AIPA 2CO5A 3H3UA 2OQGA 3TOAA 5CJ9A 2FNAA 4IXAA 3QOPA 3RJPA 1GVJA 2NAZA 1KA8A 2VE8A 2F5FA 1REPC 3F8BA 1U2WA 4IJAA 4YFKF 3TGNA 4OINF 4EGYA 3BJ6A 3MAJA 1A04A 1U5TA 2RVCA 3F8MA 4HA8A 5IT9Z 3I54A 1FYLA 3GXOA 2ADUA 1S7AA 4NQWA 3TO7A 2VC0A 4K2EA 1E2XA 4OOIA 2HKOA 2P8TA 3M7GA 2XKPA 5ICGA 4BXUA 2OBPA 4HX7A 2JT1A 2YU3A 3TDUC 4CDGA 5LBQA 3RTRA 1XSXA 5TRDA 1DP7P 3LQRA 1BI3A 2A5YB 3CDHA 4ESFA 3CJNA 2FBIA 5HDKA 4BAYA 5FB2A 3ZQ7A 3F23A 1LB2A 3SHFA 3RKXA 5ICCA 3V7CA 1H9GA 3K0LA 4RAZA 3S2WA 3BPXA 1FC3A 1ZYRF 2FNPA 4PGGA 1LQ1A 5F64A 2IP2A 1FYKA 4ZYDA 2FE3A 1HW2A 4OIRF 1L0OC 3GO5A 2CG4A 1WWXA 2ZCWA 3FF5A 2QM3A 1KQ8A 2GZWA 5LHIA 4M9XA 3V8LA 4BH9A 1B4AA 1ON2A 5DCMA 3ECOA 2MH9A 2KIUA 4N9HA 3RPQA 2OZ6A 3F3XA 2ACJA 2OAZA 1P4AA 3LA2A 1OR7A 3G3ZA 3E97A
chains in the Genus database with same CATH superfamily
4CUGA 4F55A 1LFPA 2HQNA 4HDUA 3HRUA 1H9TA 1B72A 3OYIA 3JREA 4NQWB 4RAFA 1VZ0A 1WZ2A 2E5ZA 2HYGD 1F36A 3NQOA 1K4SA 3AG4H 1JE8A 1CF7A 1BM9A 3JTGA 4GDFA 1JKPC 1Z7LA 4E6KG 3W6KB 2BYVE 5JLXA 2JJ7A 1QVUA 3C2GA 2BY3A 2RGVA 1XS9A 1MBGA 4I09A 2CV2A 1EH8A 1WJDA 3A01B 4YRVA 1BI0A 5BQTA 2VKVA 4KN4X 3QU3A 1XSDA 3RYPA 3BG5A 3OYJA 4HG2A 3EETA 5J40A 1XSVA 4AIKA 4LOCA 3J7YJ 4ZJZA 4HSTA 1TQPA 2IW5A 1X1DA 1T95A 1LJ9A 3MQ0A 3ONQA 4ESJA 2V9KA 4UVAA 3W6JB 1IXCA 1MDMB 2LRDA 2FQ3A 4U0VA 2FMLA 1JTYA 4ZYAA 2DA7A 1IXSB 1BR4A 4CA0A 2QBYA 2DAOA 2IA2A 4JQFA 1Y6IA 2EFNA 3U21A 1Q1HA 1S8NA 5FLVA 3SQNA 4Y3OA 3QPTA 3FDYA 2PX9A 2VKEA 5DV5A 1OCRH 3T8TA 3HL2A 3IH3A 4JOMA 5DM7F 4BDZA 1XGNA 2EK5A 2QWWA 4D7NA 2ZBKA 2H8WA 4HOBA 2XAQA 3FZVA 3HPHA 3OS1A 1Y1WJ 5F0HA 5IP6A 3CCQI 4G7OF 2CV0A 3Q0VA 3LAJA 3QPSA 1V4RA 2JPCA 2XAJA 1JJ8C 2P6TA 2C6YA 2Z9OA 4A6DA 3FMSA 3I9V2 4XRSA 2R5ZB 1U8BA 2AXTC 2M2EA 3DPTA 4S04A 3LA3A 1V5EA 3COAC 1SFEA 3EYYA 1D8KA 1IF1A 5K5OA 3GCMA 4XLPF 4MTEA 3N4MA 3KZZA 3GZ6A 4A5MA 5CQEA 3OS0A 4A0XA 3ZXSA 1D5VA 4LMYA 2HTSA 2GA1A 1HQCA 4P9FA 3W6VA 5F1JA 3DU6A 4RAYA 4CH7A 1WHUA 2DDAA 2NS7A 3MN2A 3D5RC 3IAS2 3EUAA 1YW7A 1VQLI 1TL8A 1YLFA 3S17J 4L9NA 3HOSA 3E6MA 2LREA 3S2HJ 3IH2A 2EIJH 4TV7A 1W0TA 4C3HJ 1BN5A 1VQ7I 3HKZN 4LIVA 5ERIA 5LFAA 1IDZA 2VBYA 2CS3A 3F72A 1O57A 1UAAA 4L5EA 1MH3A 1SVLA 5K7FA 4LLNA 4CO8A 1Y8QB 2E71A 2M45A 2WAQN 1YS7A 3I58A 1O3SA 1IG7A 1ETWA 1Y56A 5B1AH 2P5VA 3CF5F 2A69F 1S72I 4M3FA 1IO2A 1FOWA 1IUFA 5HS8A 3FM5A 1K78B 5HS7A 1QPMA 5CVRA 3FMRA 4WX9A 4AIJA 4Y52J 3VOEA 5J8CA 2Z5UA 2QGUA 3ELKA 4P55A 2GXGA 2X1EA 2R93J 1WGXA 3TL4X 2HVQA 1P7JA 5A2QK 2F6CA 2VJ5A 2ZSHB 5IYDJ 4OIPF 1YJNI 3KCCA 2IS4A 2L4AA 2ZXJA 2IS2A 5CVIA 1EA3A 1MBHA 4KICA 3CC7I 1AKHB 3HB9A 2G9WA 2J5OA 1S7EA 1D0ZA 2Y30A 2IS6A 4LG0A 1O7FA 2DYRH 2EPFA 2F48A 3FXMA 4R8HA 3L09A 4ZYHA 2GOXB 2JVHA 1OCTC 2ZXWH 3JW4A 4AIHA 1YI2I 5LHGA 2VB6A 1DGWY 5TJJA 3RPUA 3DPLC 2EV0A 5IT3A 3EQLF 1R4NB 2IS1A 3NRVA 1U5TC 1Y0NA 2HWVA 2V1XA 2D45A 3TO9A 3K4BA 2COBA 3LWFA 3KP5A 3K4CA 3I59A 3RKYA 4Y17A 2DMUA 4BL0B 5EGOB 2VODA 3L1PA 2R7ZJ 4HW0A 4RB2C 1FSHA 1OISA 1WH7A 3I55I 4BBSJ 1BJAA 4PSXA 6PAXA 2XVCA 5HS9A 5GP9A 2O8KA 3LFKA 4Q5SF 5EDNA 1T38A 3FKJA 3WHCA 2DODA 1XG1A 5EEAA 2M34A 3ULQB 3ZMSA 1FJLA 1T0FC 2KJCA 1BI1A 3HGYA 3L00A 4DYCA 3F9KA 4CSWA 4IEJA 3C7JA 3ZP5A 3V7RA 4BHCA 1T33A 1MJ9A 4X0GA 4N0BA 1LNWA 2DA6A 3BTCA 4CZZA 3CCMI 2R5YB 1OLTA 1ZG1A 4GXOA 4ZYEA 2FBKA 3B6CA 1IZ1A 3BR5A 3JSPA 1TWGJ 5B1BH 1PYVA 4RM2A 3WE3A 2KRCA 2XAHA 5BS6A 2IBDA 4FTHA 1JT6A 3O6BB 4F91B 2ZB9A 5F04A 4M6XA 5M3MJ 2FF4A 1B8IB 5ICEA 1ZREA 1ZGAA 3BR0A 2DO7A 2EINH 2R3SA 2PQ8A 1QVTA 4QIWN 4IZZA 3E5XA 4N4OB 2VBXA 2KISA 3LSJA 2A05A 1TW2A 1I1SA 4JK1X 3BG9A 3E5UA 5H6RA 4ON0A 1R5HA 3QPHA 1ZG3A 4DBRA 5C44J 4BY7J 4ZC3A 3M9AA 2UXXA 2WY7Q 5J1UA 2OUMA 2PFBA 1RKTA 1STZA 2OV7A 4WK8F 2XASA 3HGGA 2WB1A 4HSRA 3VB2A 5D6FA 5D8KB 2OF7A 3PFIA 3LSPA 2RAEA 2CQNA 2LF7A 3WU1B 1FMVA 3CMMA 4DOZA 4C2TA 2X48A 1SFKA 3LAPA 4D5CA 4NC7A 1AKHA 1RR8C 2FD5A 1SFOJ 4LGWA 2QZ8A 2ZXIA 3V4GA 3W2VA 3GFMA 1KYWA 2CFOA 1ZH5A 5FKKA 4IPAA 1IN6A 4IHTA 1DP3A 3HC7A 4E7IA 1DPRA 1MBJA 1UHSA 3A4CA 2LLKA 4L0YB 1QNTA 2R92J 3BTLA 1FIAA 1K79A 4L18B 1VNDA 2BZTA 3AG3H 4G12A 2DA4A 3J81K 3TBIA 3IWZA 3PQKA 1TQIA 3N05A 2AQFA 4PCQA 4O6JA 2G7HA 2XAGA 3V8KA 4B1RA 2ZFUA 3DKYA 4ZZDA 1G3WA 5FD6A 1ZRFA 5LRRA 2Z16A 5L3BA 3GLXA 1VTNC 1W36D 1POGA 2MSYA 3K1MA 2E1NA 1Z1DA 3DEEA 2NOGA 1F5TA 2K9MA 2Y31A 2B9SA 4UB6C 3H36A 2O5RA 4XOPA 1BA5A 1B59A 2MFZA 1YW9A 3JRCA 1O7LA 3GLLA 2X6WA 2H94A 4JBAA 4RGUA 3ABKH 4LLLA 5ICFA 1MZBA 2ZSIB 1HDPA 3HHGA 1FOYA 1OCCH 4AVPA 3CMAI 4CCMA 4G8XA 2Z33A 3MKLA 2ZMEB 5DEQA 2R5ZA 2DCEA 2ME6A 2K9SA 5CVVA 2K4JA 1CQTA 1DDNA 2Q1ZB 4E7ZA 2YR2A 1E3PA 1R1VA 3E6BA 1SANA 3Q3SA 4KDPA 5E3OA 2WB1N 1LPQA 4IHSA 2MBFA 1XN7A 1USSA 1P7IA 2Z3YA 4OIQF 1OFCX 2WTEA 3ASOH 3KYDB 2Y9ZA 4HDVA 2O61A 3BTJA 3K1PA 4MEXF 2VKDA 3H9JA 3ROUA 2DOAA 3O2PE 3QAHA 4G9YA 1HDDC 2DK8A 4WF2A 1F9NA 2EJRA 3DFGA 3H3VK 2LD5A 3NWTA 4PK4A 2M8EA 2QVOA 3IAM2 1I50J 1DQUA 3ECHA 2BY1A 2M30A 2WADA 4NC6A 3BZ6A 3S8PA 3OV8A 1SD6A 1XTAA 5E18F 5D6EA 5HLGA 2TRTA 4A12A 3C3WA 1T0FA 1FYMA 1B9NA 2DQRA 2P0WA 2HOTA 1JI8A 2JWTA 2E2JJ 4UV9A 2WY8Q 1K4TA 3BJAA 2KJBA 1YJ9I 4WXCA 1TW3A 3WTZA 4ENMA 1W5SA 4C2MJ 1G3SA 2MD0A 1I3AA 3OYDA 1XCVA 1KU2A 4RB0A 3AKZA 3I56I 3F21A 2CUFA 2WAQA 2ISYA 1TTYA 2K7LA 3A02A 4L0ZB 3R61A 1S5LC 4KNYA 2IEKA 1EJ9A 4U87A 5JHUA 3ABTA 4PFPA 2A68F 4PSWA 3CCLI 4AYBN 4DNCA 4BQAA 4EJTA 2QENA 3RZDJ 2ZMEC 3F6VA 2KIQA 1GLNA 3GF2A 4AU7A 4H0EA 2NRAC 1LDDA 5BPIA 1ZRDA 1ACIA 3DU5A 2K9LA 1FWZA 2BW3B 1LKXA 2NNYA 3VWBA 3JRHA 1ZTRA 3IL2A 1RUOA 3J7ZI 2IXSA 4IQJA 1JXSA 2LY1A 5LLQA 1F1ZA 2EWNA 5LHHA 3VDXA 4FHTA 3JCUC 4D0PA 2CW8A 5ILSA 1MMDA 3WODF 3WU2C 2VONA 2D5VA 3M07A 4KYWA 3SEQA 1YIJI 1DU0A 4CYCB 1OCZH 4HZFA 3MD2A 2KKOA 2VXDA 3KLNA 5EZGA 1N75A 3B6AA 3T8RA 3R0AA 4M3DA 2H8RA 2MABA 3FBNB 4FX0A 4MLOA 2E35A 3KEOA 2VJIA 2OC6A 2ZFWA 3FKIJ 1U8RA 5HLTA 4AIDA 3L2QA 2IA1A 3A0HC 3A01A 1QGPA 3KIOA 3IKTA 1N78A 4CCOA 1ULYA 3J80Z 3I53A 1KQ9A 1FP1D 5DTDA 3OR2C 1VQ8I 2GQQA 4QSHA 3OYMA 2HXOA 4BQNA 3C18A 2E36A 2XSJC 2BE5F 1KONA 2EFQA 1XGMA 4BY1J 2JA6J 1D3YA 2LP0A 2M9HA 1Z9CA 1ZLKA 1SFXA 2ELKA 5HOOA 5E3NA 4B3AA 3G1LA 4FCYA 1ON1A 5H2FC 1ZLJA 4M72A 1WJBA 2CQXA 3S15J 1TC3C 4I2OA 3RQ4A 2CFXA 2OPTA 5GAEJ 1MNEA 4ENKA 1J5YA 4HYEA 2AS5F 1AOYA 1U9OA 3VPRA 3WE2A 2LG4A 4M73A 1JT0A 3HOWJ 2ZO4A 1ZGJA 2P7CB 1RIOH 5HLIA 1P92A 3JAMK 2OTLI 3G1OA 4PGHA 2GLOA 3DPUA 4XLAA 2VPRA 1SMYF 3WTXC 2HPMA 2DT7B 2E7XA 2ESHA 2L7KA 3BC8A 2Y48A 1XMAA 1KU9A 1OKRA 3V42A 4BXXJ 2QKLB 4HNVA 2GIZA 2VJJA 1AWCA 1PDNC 1HKSA 4XSZF 4M3EA 4XRMA 4U0WA 4J01A 4L9JA 4G7HF 5J4VA 5J8FA 4E7LA 4ZYGA 1TLHB 3GTGJ 1WI3A 1ETYA 2AHQA 2XGXA 2X6XA 1GUUA 4HV5A 1YTYA 2HYFA 1QZEA 2CW0F 2DT5A 1MJBA 1UELB 3K4JA 2AO9A 4UV8A 2LMDA 3OL4A 4LFUA 2VT3A 3TKYA 2IJLA 1QA6A 1Y0UA 3P9KA 5DM6F 4G6TB 4WWCA 4HNUA 3CD6I 1ETXA 2KL4A 3BZKA 5CQGA 3FXRA 4RGRA 3J7AO 3FXLA 2DYSH 3OYGA 4HAMA 2EH3A 5TISC 2F5VA 3P9CA 4XRSG 3I0TA 1ZQ3P 5GAGJ 3FISA 1W5TA 2EBIA 2EZLA 2O7OA 1ZRCA 1ORKA 4B3XA 1BIBA 3DLAA 1IN8A 3K6GA 2H6CA 1GV2A 1RESA 1SAUA 3TP0A 5LRSA 4RM3A 1EKEA 1TP4A 4XLCA 2JPBA 2Y0SN 1FTTA 4DW6A 3ZQIA 2FBHA 3QP6A 1OCOH 2ELHA 3MEXA 3S3OA 3M1CA 2NS0A 4EM1A 4PDKA 2DN0A 1R4MB 1UJ8A 5HODA 2LKPA 2MYSA 2EILH 3HG9A 2E1CA 3BG6A 2JK3A 2M0CA 1D0XA 4JX4A 3W3CA 2V6EA 2EZKA 1K61A 3BROA 4MFDA 4M9SA 1RNLA 1HSJA 3L2WA 4UXNA 4EV0A 1RETA 1Z67A 2WC2A 3PO3J 4A3DJ 4AC0A 3RI4A 3PNVA 1L3LA 3S3NA 2Q2EB 3EUHA 3DKXA 1O3RA 3D5SC 2Q8KA 4O3MA 1Z6TA 3ZMDA 1TWCJ 5FLXK 2M1BA 4QPQA 3G73A 2BEOA 4I02A 4A6EA 4LK1F 2CH0A 1R00A 1WJEA 2X85A 3GUDA 2Y69H 2DW4A 5HDGA 1VI0A 2QYOA 5B5EC 4E70A 3QYBA 4KT6A 3GTJJ 4UB8C 2WBMA 5BPDA 4MQVA 4HV6A 1LFBA 3F22A 3E0JB 3PO2J 1A6QA 3H5NA 4W97A 3JTHA 3PIOF 2HVRA 2IPQX 3WG7H 4BUPA 2DA5A 1KQ0A 2IA0A 1IRXA 5JI6A 2L2OA 2FJ1A 4PFOA 4M3BA 4A3JJ 2DBBA 3TMOA 1IRZA 4YIFA 2OTJI 1BL0A 2NVYJ 3QRFF 3H35A 3AAFA 4IOAF 1IN7A 5FFZA 3QOEA 3BPVA 2LSOA 3BR2A 2QSFX 5FKOA 4YELA 3DP7A 1BW6A 1Z77A 2DJNA 4YEJA 2JMWA 3HOVJ 1NHAA 1WCMJ 3CTAA 3CF2A 4IRGA 1IRGA 1IN4A 3AG1H 4Z6YA 2CUZA 2V79A 3L2RA 3BOQA 2LF8A 1BOBA 5F0CA 3VYTB 1P4WA 2ID3A 3I64A 3HTSB 2HQAA 5EG0B 2W85A 2UWMA 3HZJA 3R4KA 1ZG5A 4C3IJ 3ZR8X 3BR6A 1YOVB 3ZN1A 3HJEA 4E7JA 1R58A 2ECCA 3CMEI 2B63J 3PUFA 1IUYA 3G6EI 3IRQA 2Q2EA 1TWFJ 3E5QA 2VUMJ 2RQPA 5IOZA 3LNQA 3C2BA 4LLGF 5D5XB 3ERED 2DPUA 3GBGA 1U9NA 1XMKA 2LFBA 2F4MB 5E1ZB 4BJ6C 3CLQA 1YX5A 3OYLA 1U0JA 3PFYA 3KEQA 5L3FA 3SZTA 5F6FA 2VBWA 2E1MC 4HX4A 4E4HA 1T39A 2MLKA 3BDDA 4L5IA 3BY6A 2IVMA 3QYFA 4KT5C 4B48A 3GTOJ 1PP8F 4IRHA 3MVPA 5FFXA 2MC4A 2IGNA 2H09A 4PJLA 3TP3A 4M6VA 4BHBA 3D1NI 3Q5FA 3FHNA 3K2ZA 1KYZA 2ZJ2A 5ILUA 2BY0A 3NEUA 3ZMVA 1TT5B 3M1EA 1VQMI 3IV5A 1G4DA 2QLZA 3OYAA 3P7NA 4XOTA 5FLXZ 1JUPA 1I1GA 1VQOI 3HSFA 4XONA 4NBQA 5D8LB 3QPLA 1GXQA 3U2RA 5K1YA 4A3EJ 4JYKA 2L7ZA 2XGEA 4O5VA 3GFIA 1W7PA 3D0SA 2DFEA 2FX0A 5AIQA 1HW1A 2VBZA 4RMNA 1TZLA 3DLLF 2DXIA 1J0RA 4G94A 5K7HA 4KUMA 3VODA 3M8EA 2TDXA 3ABLH 1K6YA 1BIAA 3DXJF 4X1EA 2CQKA 3NARA 2XAFA 2QSHX 2JZYA 3F8NA 1HC8A 3I4NJ 5GPAA 3EDPA 4N4NB 3KP2A 2JUCA 3TOBA 5ED4A 3HOYJ 2O0YA 4XL9A 3BCAA 2QKMB 4D1QA 2E2HJ 4GFBA 1I5ZA 2Y2ZA 3SDGA 2YU9J 3CUQA 2K27A 2LTPA 1QRYA 2F2EA 4Y4RA 1XGSA 1LE8B 1R22A 4DBQA 4LG3A 1X1CA 1BBYA 3KP3A 4C3JJ 2GM4A 3VSLA 4II2A 1UHMA 3J80K 2DOEA 1IRFA 1PP7U 3I71A 2CUEA 2V1NA 2KHMA 2G7UA 3A1YA 2A6HF 3RZOJ 1WJFA 3RYRA 5D5VB 4H4KC 1W0UA 4ZDLA 2ZJQF 2KRHA 5FKMA 2LDUA 2L7MP 2QF7A 2X1DA 3FMQA 1QQIA 1ZAOA 3FXKA 1MNDA 2LBFA 1MNMC 4NNJA 1X4OA 3P9IA 3OYKA 1OYWA 2I8DA 2VC1A 4E7HA 4A3IJ 2COMA 2W7NA 2BGCA 1ETKA 3AL0B 3OIQA 3KETA 3T1BA 4BBRJ 2J5PA 1YE9A 5EEHA 1YW8A 1J09A 1G8XA 1T2KA 2Z2SB 2IGOA 3CJRB 2V1UA 1TT0A 1MBKA 1IW7F 2BHYA 5B66C 4RDUA 2JQ7A 3J81Z 1H89C 2UZKA 2DJIA 1MKMA 3KYCB 1NK3P 4A5NA 2M0MA 2X0LA 4M9ZA 1A6IA 2BY2A 3H5RA 4PJJA 4EQQA 1ZR4A 3GZ5A 1J2XA 1VQ6I 1WSUA 2K5CA 1I27A 3K69A 3MKWB 3S16J 3KFWX 1RZ4A 2E7WA 1NTCA 3SEZA 3CQZJ 4BDYA 2KP6A 1SVMA 3PSIA 1BC8C 3I5UA 3K4NA 2V9PA 4UUSA 4ETSA 1W4MA 3VYRB 2HDCA 1V5GA 4UVBA 3F6OA 2I10A 3W2WA 4CCKA 1SEUA 4QLCU 2D1HA 3OWTA 3REOA 2HQRA 2HYJA 3WG9A 3CJTB 3HRMA 1K7AA 2EB7A 1JKRC 2R4GA 3G1MA 3GW2A 1R5ID 3CJQB 3PM1A 3I3LA 1T6SA 1V55H 1FBQA 4BGDA 1FP2A 2ZJPF 2DMQA 2JA8J 3CCJI 3FWEA 1S3JA 2W00A 2AXLA 1DGRM 1JTXA 4KA4A 1GT0C 2XGCA 4IX7A 4Q4ZF 1MGTA 4PJ0C 3GX4X 4NB5A 5H6QA 4BJTA 2BXZA 2STWA 1MMNA 2CU7A 2M4GA 1ZN2A 3LOCA 4XLHA 4ZDOA 1IAWA 1EF4A 3HXLA 2A3SA 2JRTA 3LL7A 1HA8A 4HX8A 4IVNA 3ESWB 5FKNA 1FTZA 2G0EA 2EV6A 2GAUA 2K3PA 2MH2A 4CXFA 4B8XA 3M8JA 4F7ZA 3KLOA 1MMGA 1WPKA 3HPGA 3E1SA 3JRAA 1G6NA 1XX5A 2YPRA 3UKGA 2H27A 1R49A 2HS5A 3L7WA 3RKQA 2P5LC 3WTSC 4P9UA 3E7LA 1R7JA 2P81A 4BE0A 2XRLA 5J6XA 2PLYA 3CCYA 1AA7A 4II3A 2I5UA 2HEOA 2QQ8A 2ZKZA 3OOPA 1ZGWA 1BR2A 2F5CA 4I99C 5BOXA 1E3HA 4AVZA 4MTDA 1ONVA 1OYYA 1R5GA 2K85A 1KGSA 5IT9K 1T98A 2IRFG 2KZVA 4KMUX 3ML6A 1F4KA 1FT9A 4R1HA 3OYNA 4KJZA 1W7PB 3ZPLA 2V6CA 4YIIA 2Q0OA 1A36A 1HOMA 1EV7A 2E34A 4XBFA 1J59A 1GXPA 3BR3A 2VL8A 1QZYA 2EFOA 3S2DJ 3OIOA 4GYIA 2BXYA 3CDIA 1KU7A 4BQOA 2K4BA 3FM3A 1E3OC 2FMYA 4BHPA 2FOWA 2MA3A 3IH4A 2CMPA 2KZGA 5DD4A 1HKTA 1QBJA 3H1CA 2W1OA 3K4LA 2QQBA 3K4MA 3SZPA 1RRJA 4ANJA 2XGDA 3CP2A 2VXZA 4I0BA 5EEGA 1SMTA 2LY9A 2R7QA 5M5WJ 1OPCA 1UMQA 3ABMH 3CUQB 2DMPA 5DYMA 2W24A 3TQNA 1FZPB 4I0AA 2JRMA 4A93J 3HSRA 2BW3A 2PG4A 2E1MB 1TNTA 3F8CA 3OIPA 4C30A 3BG7A 2R7DA 5CVUA 3IC7A 3GVAA 3UNGC 4EJWA 1YITI 2DA1A 1VQNI 4MO7A 2VJ4A 4MQ9F 4CYDA 4KIGA 4FX4A 3S1QJ 4EEFG 2DLLA 1G2HA 2FXAA 1RUNA 3V8JA 1MMSA 5JLWA 2ELJA 4EM0B 2EIMH 5JFRA 3KYLA 4UUVA 4S05A 2HDDA 2PMUA 2L54A 3LQQA 3RQIA 4AWXB 2X1CA 1DPUA 1D5YA 2BVMA 1FBUA 1HF0A 4LG0B 1EH7A 1Z0XA 2OJED 2O03A 3K10A 4OIOF 3K2AA 3SZGA 2P7VB 3LMMA 2KIFA 4RB3C 3M4OJ 3I4MJ 1WJAA 3DF8A 2E19A 4IQ4A 1QZZA 4IHXA 3PUBA 1HBXG 3DKWA 3KP6A 1TNSA 1X19A 4NHJA 3LFUA 1LDJA 2MW8A 1JHFA 2DMNA 3CCSI 3H0GJ 3CC2I 4JP0A 3Q9VA 1IXRC 1YHQI 2Y9YA 3SYTA 3P5JA 2A5WA 1VQ5I 4ABZA 4BU2A 1MBEA 3OMYA 3CCVI 1UG2A 4DJAA 3DEWA 3SFIA 1GDTA 3FK6A 3DQVC 2KDOA 1N77A 1LEBA 2V7FA 5CYVA 4BE2A 2KDZA 1QU3A 2FEZA 2V4JC 3DWLE 4EJUA 2R7RA 2R7VA 1R1TA 2BVLA 1Y8RB 4J00A 4XKCA 5HDNA 1FSEA 4M71A 5L3DA 2F5DA 3DV8A 3K70D 3KEYA 1S6LA 2YX7A 5HVQC 2NVXJ 2ZC2A 3FX3A 3G2BA 4DYQA 1MD0A 1UG0A 3HBLA 3AL0C 4RGSA 5K5RA 1B6AA 3JSOA 4HNTA 3ZQQA 1ETOA 2ETHA 4XM3A 4F3QA 4M6YA 2L9VA 4XLNF 1O3TA 1R1UA 2PJPA 3DTIA 4NDLA 1H8AC 3IUOA 3MZ8A 5IP7J 1X1AA 4Y15A 1VQ4I 2N8GA 1WVRA 3RCOA 4LITA 5KK1A 4BEHA 4XRFA 4LJZF 1R36A 2V1DA 4RLQA 1LEAA 2F5EA 3HRTA 2E5NA 4UHTA 3F8FA 3M3YJ 4IHWA 1X4PA 4XIDA 1V5FA 1ZELA 1O3QA 1OCPA 2AQEA 4ITVA 4LD5A 4IKFA 3N97A 1WJCA 3KZYA 4MEYF 2XUBA 1P2FA 5E1WA 4IOCF 1T8IA 1U3EM 2CSOA 2M8GX 4XK4A 3HM5A 1A5JA 3ISPA 5GTHC 1FEXA 2ECBA 4LIUA 5LGNA 2LKSA 2O3FA 3PNTA 2YS9A 2PI0A 3ZN0A 5C4JJ 3QP5A 4XORA 3NWSA 2KQRA 2XF7A 2GBYA 2MLGA 3PIPF 2XHKA 3BTIA 3K9TA 1Y1VJ 2HKXA 2DFIA 3H9QA 3PL8A 2KPMA 2M87A 1Z91A 3IHUA 5ILVA 3L2VA 2HXIA 2CV1A 1QPIA 5F1RA 3GYHX 5FLMJ 5KVRA 5J47A 2E60A 5E8GA 3T0YA 3WTVC 3DTEA 3LSRA 1VQKI 2PJRB 3MKYB 4XN3A 1ZR2A 3S93A 2EFWA 1W36C 1D0YA 1W5CC 1Z7UA 2A61A 3PSFA 1AU7A 1U5TB 2MG4A 3FBIB 2HGCA 3U1DA 4Y33A 5D4RA 2HOEA 3IP4B 3OL3A 1GHCA 2RKHA 3ZCOA 5CPRB 3HUGB 4I98B 4RLFA 2JA7J 2EZHA 1X2NA 4OMZA 1UCRA 1MSFC 3H92A 4A3KJ 2TCTA 4D5FA 3IWFA 1XDUA 2MC3A 4QWQA 2R0QC 4Z2YA 3RKWA 5HNHA 1G3TA 2HOAA 3K1NA 4FT8A 3WTWC 3MMYB 4WXDA 1JKQC 4DYRA 1YS6A 1SC7A 1HXDA 2W84A 2OD5A 3MZYA 4B43A 4L9TA 1F43A 3MCZA 4I01A 4M74A 5LGUA 1RI7A 2XDVA 4IL6C 4LB5A 4ESBA 1VF9A 2WV1A 2Z99A 2HVSA 5LD2C 4DZPA 3K4KA 1IJWC 2VI6A 3C1DA 2STTA 1HKQA 2L9SA 3LA7A 4FETA 5J3LA 2XRNA 4XLEA 4S0HB 5GADJ 2DQLA 2PJRA 2A07F 4M3GA 2GXAA 4HF1A 2M7BA 4UVCA 3GTQJ 3CUQC 1A35A 1DUXC 3C2HA 4U7DA 2NVTJ 2W25A 2E2IJ 4NC8A 3HOZJ 3L9FA 3ZQFA 1JUMA 5DDGA 2GXBA 3WGHA 5J1RA 1JKOC 2CQQA 1Z6RA 2NOJB 1YRNB 2XROA 4BACA 1SFUA 2CYYA 2Y0MA 4XR6A 5TGTA 2ZJRF 3X2QH 1MMAA 2BBYA 2YX4A 4KIFA 2HTJA 3S1NJ 3HDDA 2QBYB 2DFHA 2ID6A 2ZNZA 4BNCA 2ISZA 1ERDA 2A6EF 4U0YA 5EF6A 5L3GA 2XPVA 2CW7A 2XAUA 4BJ5C 4OU0A 1J7KA 2UV1A 4XQFA 3IKVA 4HQEA 2K02A 4ENNA 1RR7A 1UHWA 2O6GE 1R23A 4JX5A 4FQGA 2LNBA 2VQLA 3Q9SA 4BKXA 3GWZA 2CJJA 1LVAA 3GEZA 1HCRA 2H1KA 5KAFC 2FRHA 2PN6A 3EYIA 3CP8A 1PJRA 1R9TJ 2X9DA 1YQAA 1NG6A 5KNLA 4GYGA 2W4SA 4A69C 4UNOA 3O3KA 2OU2A 1IV6A 2IAIA 1G59A 1DU6A 3QQAA 1E17A 1K83J 2HQ5A 2DT6A 4HRIA 2FA5A 2R7FA 3H5AA 3KP4A 4L5JA 3OSFA 1B1BA 5F0FA 5EJCA 3ZMZA 2DK5A 3CUOA 4BE1A 4GGGA 4X6AJ 4P96A 1SD4A 3FXUA 3TO6A 5FRNA 5C3EJ 2EV5A 2QCOA 3WTTC 1HSTA 2QQ9A 1XGOA 4CCLA 4CCJA 3JAMZ 3A2KA 1WKMA 2HFHA 3S32A 3HUGA 4V19K 2P4WA 1XMXA 1I6XA 3GFLA 2YSRA 2R7TA 5D5WB 2R7XA 4B09A 5E17F 4I76A 2JA2A 1P4XA 2NXNB 1V3FA 3ZOBA 5J4YA 4RS8A 2HI3A 3W2AA 2K40A 4PZJA 4Q47A 2WAEA 3BT9A 4BQQA 4ZTJA 5DCMB 4HLYA 2RREA 5DCFA 1D8JA 2VQHA 4B4CA 5BMZA 1RC9A 2X6YA 1XD7A 2L4MA 5KAIC 2VLAA 2X4HA 1E0EA 5DUIA 1YO5C 3KE2A 5JHFA 3MZHA 1K78A 2VASA 2ZXHA 2QA4I 4HBLA 3ZGKA 3RDIA 1P6RA 4A3CJ 3QU6A 4KITB 1FNNA 3FHZA 2WWYA 1NG7A 1XDSA 1JGGA 3ZQHA 2KT0A 4DZJA 2L9RA 2BV6A 2K3FA 3Q0WA 1MW7A 3TDZC 4AD9A 5DD8A 2EFPA 3HEFA 4IF4A 5IPAA 5IY5H 3L2UA 3HYIA 1PUFB 2L9NA 3OOUA 3R60A 4RGXA 1H0MA 1APLC 3S1MJ 3VSKA 2QQAA 5KCMA 1TQMA 3GTPJ 1S9HA 2HPIA 2CQ7A 3D5LA 4A0ZA 4C2UA 4C9YA 1X3ZB 1YFHA 9ANTA 2L01A 2RC4A 4EGZA 5M5XJ 2PMZA 2FQ4A 1Z3XA 4BEHB 1X3UA 1YX3A 5K5QA 2JTVA 4N9IA 2CGPA 1FX7A 4A3MJ 5GAHJ 2FSWA 2GA2A 1OYIA 5E20A 1ETVA 2JA5J 3CO6C 4IHYA 3MWMA 5JVTA 4GRIA 1D1AA 2OCEA 3WU0A 3I59B 4A3BJ 4PUSA 2DTRA 2MGQA 1XPXA 2RDPA 5FJ8J 3IRRA 1C0WA 1BC7C 4A0YA 2EA4A 2K9QA 1CF7B 1CGPA 4CGZA 2HU9A 4OMYA 1KU3A 3BQZA 2M4KA 2D1VA 4IRIA 1FLIA 4XKVA 4U88A 2ZNYA 1XC5A 2ZMEA 4XSXF 4GCVA 4DQ2A 3E3VA 1B72B 1JGSA 3EPZA 3HHHA 2L3DA 5H20A 2XC7A 3BP8A 1LDKB 4UY8I 1ITYA 1WI9A 4D7MA 1ETQA 5IYBJ 4KISA 2M5WA 4EATA 3H0DA 1J75A 3SFZA 1H88C 1JUSA 4HEA2 2IGKA 2DI3A 3LSKA 2PMZN 3EUHC 2HNHA 2BOLA 1FY7A 3HSEA 3VFZA 5M5YJ 1YIOA 2DTZA 1FBSA 3G71I 4EVIA 3T5XA 1X2MA 5HNFA 2RNJA 5AONA 1XCBA 4YFXF 5IYCJ 4KMFA 1OMIA 3TEDA 3R0JA 3HRSA 2HZTA 4B47A 2R7UA 1FPQA 2VT2A 3JRFA 4L9VA 3ERMA 3QWLA 4LB6B 3HIFA 1K6OA 3A03A 2GOMA 4CHUA 3M8FA 3VEPA 4Y13A 5HLHA 4XLFA 1TWAJ 2L5QA 5LEKA 1PUEE 5E3MA 1XB4A 1WRJA 5B3SH 5D4SA 2EIKH 1TBXA 2RQQA 3LSGA 2CWEA 3DBHB 5IOYA 2WV0A 1MSEC 2R7SA 1W7PD 2E1OA 4HF0A 4P5OA 3E6DA 3R6SA 4U7BA 2FU4A 5CLSA 2GIVA 4HF2A 4KFCA 2DU9A 2PMHA 3WGGA 3B02A 1BR1A 4MHGA 3L2CA 4CCNA 2KRFA 3CC4I 2NYXA 1I3QJ 1MJAA 2M7AA 1EH6A 3HOTA 5E79C 3CDLA 5FGMA 1OR7C 4YFNF 2DA3A 2O8XA 2M3AA 4ZZLA 4R79A 3ZMUA 5A2QZ 3V7SA 1IDYA 3FXJA 4KIBA 2DOFA 2KIMA 2KMUA 3AFHA 5FO5A 4AUXA 3OSGA 5CVJA 2RN7A 3GZNB 4CYCA 5LGTA 1O4XA 5DUKA 3U9GA 3B73A 4ZTFA 5JVGF 2IT0A 2XPWA 3BQYA 5LEJA 3PJRA 4I7HA 3ZQCA 3K7AJ 2VN2A 1J9IA 2V9VA 5E8IA 2XPUA 2NVUB 2QUFA 2LY2A 4G6QA 4OWRB 1QHGA 3QYEA 1I6HJ 1S7OA 2NNNA 1USTA 2FOKA 4P1WA 1G3YA 4RBOA 3ABUA 4FASD 2W82A 4CZCA 1QO0D 2K86A 1YYVA 2UXNA 2XB0X 4YIRX 3GFJA 1I39A 3KPHA 1ZKGA 2RV8A 1LUJB 2XKOA 3LSTA 1SD7A 1R71A 4FISA 4A2UA 1ZARA 1U78A 1NH3A 2LOOA 3GMEA 2L7FP 1BI2A 2H6BA 2F4IA 1HW5A 2XIGA 3RSNA 3FXOA 3KP7A 3WTUC 1JHHA 1P9QC 4IHVA 2JSCA 5C4XJ 4E7KA 5EG0A 4DGWB 1OJLA 1IV8A 3H9GA 1V54H 5F27A 3ZMTA 5IP9J 3E6CC 2ESNA 2DPDA 2B0LA 3PQJA 5GTIC 2Y0SA 4RB1A 1MH4A 3GTMJ 3MFKA 1T56A 1WQ2A 5E1XA 4LK0F 3ASNH 3LSHA 3FXQA 3NAUA 2LK2A 4XICA 1UB9A 2Y75A 3U1KA 4BS9A 2KLOA 5JR3A 4G6DA 2GWRA 3BJOA 3SXYA 2VE9A 3WTYC 2RNGA 2WAFA 3I4PA 2XV4S 2R7OA 3MKZA 4Q48A 2LKXA 3CCRI 1HLVA 1SD5A 2OA4A 2NS8A 3O8GA 1FOKA 3BWGA 3FIWA 2ICWG 4EJVA 1YJWI 3OYEA 2VKHA 2LYCA 1IN5A 2VOOA 4ENJA 2EA2A 3H3ZA 4DIQA 2VQCA 2UUZA 1N25A 5F08A 2KFDA 5D5UB 3JRDA 3HTUA 3ZQGA 4KN7X 2MD5A 4ZH4F 4G7ZF 3QODA 5L3CA 4UUTA 3JRBA 2OZUA 3OR1C 3PNYA 4A3LJ 1UFMA 4GO1A 4CICA 4EM2A 4WCGA 1YG2A 1ODDA 2D2WA 1ZHFA 2HR3A 3BZCA 1PUFA 1YRNA 1Z05A 2L02A 2JN6A 2X51A 4Y7NJ 1B9MA 2OQRA 4E7SA 4NUBA 1SVOA 1BOAA 2HDWA 3JR9A 1LVKA 3BLYA 5FD5A 2PEXA 3CO7C 2P6SA 2V26A 4AYBA 3CCEI 1MDMA 1LE8A 1U6GA 4ASNA 4D9JA 4MNUA 1S29A 2FUG2 3HOXJ 2PBIA 4EMSA 1AHDP 3DEUA 1VQPI 5GPCA 3HOUJ 3KX2A 1SAXA 3Q0UA 3FK7A 1ZK8A 1RPWA 3CLOA 4BYYA 3WGIA 1OQYA 1Q1VA 4MGRA 3RIRA 4EJOA 4WXHA 1MBFA 1M1EB 5L3EA 2P5KA 4HQMA 4HLXA 2VOPA 1FOXA 4YG2F 2W57A 2L0KA 5AIPA 2CO5A 3H3UA 2ME0A 2OQGA 3DBRB 3TOAA 5CJ9A 2FNAA 4IXAA 3QOPA 4F93B 2O9LA 2EQRA 2JVGA 4UUSB 3RJPA 2LR8A 1Z21A 1GVJA 1UZCA 4JX6A 4I6ZA 2HZDA 2NAZA 3S1RJ 5BNGA 1KA8A 2VE8A 2F5FA 1REPC 3F8BA 3VYUB 2OCCH 1U2WA 4HPQA 4IJAA 4YFKF 4MFEA 3GTKJ 1D1BA 1R6RA 2HOSA 5E3LA 4ZDPA 3OYCA 4V2GA 3DTKA 3SDBA 1LFUP 1RKWA 3TGNA 4OINF 4EGYA 2VQGA 3BJ6A 4OAYA 3MAJA 1A04A 1U5TA 1X58A 1X1PA 3DBLB 2XF5A 4PJMA 5FRMA 1T08B 2RVCA 3F8MA 4OAZA 4HA8A 5IT9Z 4QTRA 2WA0A 4RAGA 3I54A 4IO9F 1FYLA 3GXOA 3VYSB 2ADUA 1S7AA 1Z3YA 2DDBA 4B44A 2QEXI 4NQWA 2VC0A 3TO7A 4K2EA 1NK2P 1E2XA 4OOIA 1D1CA 2HKOA 3J7AY 2YUSA 2P8TA 2XF6A 1A31A 4PJNA 3M7GA 2XSDC 1BW5A 2XKPA 5ICGA 4BXUA 3CCUI 2OBPA 4A3GJ 3CESA 3CMYA 4HX7A 2JT1A 2YU3A 4MIMA 2R5YA 2NVQJ 3TDUC 3G4SI 2DFFA 4CDGA 5LBQA 3JRIA 5FKLA 4W1UA 2QSGX 3RTRA 1W1WE 1FIPA 2X6OA 3AG2H 1XSXA 3OYHA 3KZIC 3LQRA 5EYRA 1GV5A 3O8HA 3OS2A 5TRDA 1DP7P 2CUJA 1BI3A 2A5YB 1BJZA 3CDHA 2EZIA 3BR1A 4ESFA 3OY9A 3CJNA 4XKBA 3F0CA 5EZHA 1PVEA 2FBIA 5HDKA 1WFXA 3A0BC 2R7WA 4BAYA 3HKZA 2F4OB 5FB2A 5J1YA 5EGOA 4XKWA 3ZQ7A 1MIJA 3F23A 1LB2A 3SHFA 3RKXA 4QPOA 1Y39A 4XN0A 5ICCA 2BHZA 1FMWA 1VFCA 3ZRGA 1X3WB 3V7CA 4AM3A 2VPLA 1H9GA 4V2FA 4F52A 3K0LA 4RAZA 2Z1DA 3S2WA 5FROA 2B7EA 3BPXA 1QHHD 1FC3A 4FE4A 1IGNA 4J19A 4RA2A 1ZYRF 2H1LA 3JRGA 2FNPA 3ZQLA 4PGGA 5F64A 1LQ1A 4XMYA 2IP2A 4BXFA 1WH5A 3BCBA 1JJ6C 1X1BA 3OYFA 1FYKA 2CRGA 3TW7A 4ZYDA 2FE3A 3EUKL 3DCFA 1HW2A 2DA2A 4OIRF 1L0OC 3LSIA 3GO5A 2CG4A 4FE7A 1GVDA 1KZHA 3S14J 1TWHJ 2JSPA 2VIXA 2LVSA 1WWXA 3K70C 2ZCWA 1B8IA 4A3FJ 2LH9A 3FF5A 2JUGA 5CKTA 5K7ZA 2QM3A 3CZ6A 3BG3A 2W48A 1KQ8A 2GZWA 5LHIA 4M9XA 3V8LA 3TW6A 3LSMA 2LBFB 4XNFA 3GTLJ 4BH9A 1B4AA 1ON2A 5DCMA 3S3MA 3ECOA 2MH9A 3WHBA 5DS9A 4F92B 1IC8A 1VQ9I 5M3FJ 2KIUA 4N9HA 3UR3C 5KHDA 3RPQA 2LC2A 3SJMA 2OZ6A 3RPUD 3F3XA 1ENHA 2ACJA 2OAZA 1WJ5A 2A6TA 2IGMA 2K9NA 1P4AA 2XB5A 3LA2A 2DMTA 1OR7A 3G3ZA 3OYBA 3E97A
chains in the Genus database with same CATH topology
2HQNA 4HDUA 3HRUA 1H9TA 2HYGD 3NQOA 1JE8A 1CF7A 1BM9A 3JTGA 3W6KB 2BYVE 2RGVA 4I09A 1EH8A 1BI0A 5BQTA 4KN4X 3QU3A 1XSDA 3RYPA 3EETA 1XSVA 4AIKA 1TQPA 2IW5A 1LJ9A 3MQ0A 4ESJA 4UVAA 3W6JB 1IXCA 1MDMB 2FQ3A 4U0VA 2FMLA 2QBYA 1IXSB 2DAOA 2IA2A 4JQFA 2EFNA 1Q1HA 1S8NA 3SQNA 3QPTA 5DV5A 3T8TA 1XGNA 2EK5A 2QWWA 2ZBKA 4HOBA 2XAQA 3FZVA 4G7OF 3LAJA 1V4RA 2JPCA 2XAJA 2P6TA 2C6YA 2Z9OA 4A6DA 3FMSA 3DPTA 4S04A 3LA3A 3COAC 1SFEA 3EYYA 1D8KA 1IF1A 5K5OA 4XLPF 4MTEA 3N4MA 3KZZA 3GZ6A 4A5MA 4A0XA 1D5VA 4LMYA 2HTSA 2GA1A 1HQCA 4P9FA 4RAYA 1YW7A 1YLFA 4L9NA 3HOSA 3E6MA 4TV7A 1BN5A 5ERIA 2VBYA 3F72A 1O57A 4LLNA 4CO8A 2M45A 1O3SA 1YS7A 3I58A 2P5VA 2A69F 5HS8A 3FM5A 1K78B 5HS7A 1QPMA 5CVRA 3FMRA 4WX9A 4AIJA 3VOEA 5J8CA 2Z5UA 3ELKA 4P55A 2GXGA 5A2QK 4OIPF 3KCCA 2L4AA 2ZXJA 5CVIA 4KICA 2G9WA 2J5OA 4LG0A 1O7FA 4R8HA 3L09A 4ZYHA 3JW4A 4AIHA 5LHGA 3RPUA 5TJJA 3DPLC 2EV0A 5IT3A 3EQLF 3NRVA 1U5TC 2V1XA 2HWVA 2D45A 3TO9A 3LWFA 3KP5A 3I59A 3RKYA 4Y17A 2VODA 4HW0A 4RB2C 1FSHA 1BJAA 6PAXA 2XVCA 5HS9A 3LFKA 4Q5SF 1T38A 3ULQB 3ZMSA 2KJCA 1BI1A 3L00A 3C7JA 3ZP5A 3V7RA 4BHCA 1MJ9A 4N0BA 1LNWA 4CZZA 1ZG1A 4GXOA 4ZYEA 2FBKA 1IZ1A 3JSPA 3WE3A 2XAHA 5BS6A 3O6BB 4M6XA 2FF4A 1ZREA 5ICEA 1ZGAA 2DO7A 2R3SA 2PQ8A 3E5XA 2VBXA 1TW2A 1I1SA 4JK1X 3E5UA 5H6RA 4ON0A 1R5HA 3QPHA 1ZG3A 3M9AA 2UXXA 2PFBA 1STZA 4WK8F 2XASA 3VB2A 5D6FA 5D8KB 3PFIA 2LF7A 3WU1B 3LAPA 4LGWA 2QZ8A 3V4GA 3GFMA 1KYWA 1ZH5A 4IPAA 1IN6A 4IHTA 1DPRA 4L0YB 1QNTA 1K79A 4L18B 3J81K 3IWZA 3PQKA 1TQIA 4PCQA 4O6JA 2G7HA 2XAGA 3V8KA 4ZZDA 1G3WA 5FD6A 1ZRFA 5LRRA 5L3BA 3GLXA 1VTNC 3K1MA 2E1NA 1Z1DA 1F5TA 1B59A 1YW9A 1O7LA 2H94A 4JBAA 4RGUA 4LLLA 5ICFA 1MZBA 3HHGA 4AVPA 4G8XA 2Z33A 2ZMEB 5DEQA 5CVVA 2K4JA 1DDNA 2YR2A 1R1VA 3E6BA 4KDPA 4IHSA 2MBFA 1XN7A 1USSA 2Z3YA 4OIQF 2WTEA 2O61A 4HDVA 3K1PA 4MEXF 3ROUA 3O2PE 3QAHA 4G9YA 2DK8A 4WF2A 1F9NA 2EJRA 3DFGA 2M8EA 2QVOA 3ECHA 2M30A 3BZ6A 3OV8A 1SD6A 5E18F 5D6EA 5HLGA 4A12A 3C3WA 1T0FA 1FYMA 1B9NA 2DQRA 4UV9A 3BJAA 2KJBA 4WXCA 1TW3A 3WTZA 4ENMA 1W5SA 1G3SA 1XCVA 1KU2A 4RB0A 3F21A 2ISYA 1TTYA 2K7LA 4L0ZB 3R61A 4KNYA 5JHUA 3ABTA 2A68F 4DNCA 4BQAA 4EJTA 2QENA 3F6VA 3GF2A 4H0EA 2NRAC 1LDDA 5BPIA 1ZRDA 1FWZA 2NNYA 3IL2A 1RUOA 1JXSA 5LLQA 1F1ZA 2EWNA 5LHHA 4FHTA 4D0PA 5ILSA 3WODF 2VONA 4KYWA 4HZFA 2KKOA 3T8RA 3KLNA 3R0AA 4FX0A 3KEOA 2ZFWA 1U8RA 2IA1A 1QGPA 3IKTA 1ULYA 3J80Z 3I53A 1KQ9A 1FP1D 2GQQA 3C18A 2BE5F 2EFQA 1XGMA 1D3YA 1Z9CA 1ZLKA 1SFXA 5HOOA 1ON1A 1ZLJA 4M72A 4I2OA 2CFXA 4ENKA 1J5YA 4HYEA 2AS5F 1AOYA 3WE2A 4M73A 2ZO4A 1ZGJA 2P7CB 1RIOH 5HLIA 1P92A 3JAMK 4PGHA 1SMYF 3WTXC 2E7XA 2ESHA 2Y48A 1XMAA 1KU9A 1OKRA 1AWCA 1PDNC 1HKSA 4XSZF 4U0WA 4L9JA 4G7HF 5J8FA 4ZYGA 1TLHB 2XGXA 4HV5A 1YTYA 2HYFA 2CW0F 2DT5A 1MJBA 4UV8A 4LFUA 2VT3A 3TKYA 2IJLA 1Y0UA 3P9KA 4WWCA 3FXRA 4RGRA 3J7AO 4HAMA 3P9CA 3I0TA 1W5TA 1ZRCA 1BIBA 1IN8A 2H6CA 5LRSA 2JPBA 2FBHA 3QP6A 2ELHA 3MEXA 2NS0A 4EM1A 4PDKA 2LKPA 2E1CA 3BROA 4M9SA 1RNLA 1HSJA 4UXNA 4EV0A 2WC2A 3RI4A 1L3LA 3EUHA 1O3RA 2Q8KA 4O3MA 1Z6TA 3ZMDA 5FLXK 2M1BA 3G73A 2BEOA 4I02A 4A6EA 4LK1F 1R00A 3GUDA 2DW4A 5HDGA 2QYOA 4E70A 5BPDA 4MQVA 4HV6A 3F22A 3JTHA 2IPQX 1KQ0A 2IA0A 5JI6A 2DBBA 4YIFA 3QRFF 3AAFA 1IN7A 5FFZA 3BPVA 2LSOA 3DP7A 1NHAA 3CTAA 4IRGA 1IRGA 1IN4A 2V79A 3BOQA 2LF8A 3HTSB 1P4WA 3I64A 2W85A 2UWMA 3R4KA 1ZG5A 3ZN1A 1R58A 1IUYA 3IRQA 2Q2EA 3E5QA 2RQPA 4LLGF 5D5XB 3ERED 2DPUA 1XMKA 5E1ZB 3KEQA 5L3FA 3SZTA 5F6FA 2VBWA 4HX4A 1T39A 2MLKA 3BDDA 4L5IA 3BY6A 2IVMA 4KT5C 1PP8F 4IRHA 5FFXA 2H09A 4BHBA 3Q5FA 3K2ZA 5ILUA 1KYZA 2ZJ2A 3NEUA 3ZMVA 3M1EA 1G4DA 2QLZA 3P7NA 5FLXZ 1I1GA 3HSFA 5D8LB 1GXQA 3U2RA 5K1YA 3GFIA 4O5VA 1W7PA 3D0SA 5AIQA 1HW1A 2VBZA 1J0RA 4G94A 4KUMA 3VODA 3M8EA 2TDXA 1BIAA 3DXJF 2CQKA 2XAFA 2JZYA 3F8NA 3EDPA 3KP2A 3TOBA 5ED4A 2O0YA 1I5ZA 3CUQA 2K27A 2F2EA 1XGSA 1R22A 1BBYA 3KP3A 1UHMA 3J80K 1IRFA 1PP7U 3I71A 2G7UA 2A6HF 3RYRA 5D5VB 2LDUA 3FMQA 1QQIA 1ZAOA 3P9IA 1OYWA 2VC1A 2COMA 2BGCA 3KETA 3T1BA 2J5PA 5EEHA 1YW8A 1T2KA 2V1UA 1IW7F 3J81Z 2UZKA 1MKMA 4A5NA 2X0LA 4M9ZA 4EQQA 3GZ5A 1J2XA 1WSUA 1I27A 3K69A 3KFWX 1RZ4A 2E7WA 1BC8C 3I5UA 4ETSA 1W4MA 2HDCA 4UVBA 3F6OA 4QLCU 2D1HA 3REOA 2HQRA 3WG9A 3HRMA 1K7AA 2EB7A 3GW2A 1T6SA 1FBQA 1FP2A 3FWEA 1S3JA 2AXLA 4KA4A 4Q4ZF 1MGTA 3GX4X 4NB5A 5H6QA 2STWA 1ZN2A 1IAWA 2A3SA 2JRTA 4HX8A 4IVNA 2EV6A 2GAUA 2MH2A 4CXFA 4B8XA 4F7ZA 3KLOA 1G6NA 2YPRA 2H27A 2HS5A 3L7WA 2P5LC 3WTSC 4P9UA 1R7JA 5J6XA 2PLYA 2HEOA 2ZKZA 3OOPA 2F5CA 5BOXA 4MTDA 1ONVA 1OYYA 1R5GA 1KGSA 5IT9K 1T98A 2IRFG 4KMUX 3ML6A 1F4KA 1FT9A 4R1HA 1W7PB 3ZPLA 2V6CA 4YIIA 2Q0OA 1EV7A 1J59A 4XBFA 1GXPA 1QZYA 2EFOA 4GYIA 1KU7A 2K4BA 3FM3A 2FMYA 4BHPA 2MA3A 5DD4A 1HKTA 1QBJA 2QQBA 3SZPA 2VXZA 4I0BA 5EEGA 1SMTA 1OPCA 5DYMA 3CUQB 3TQNA 2W24A 1FZPB 4I0AA 3HSRA 2PG4A 1TNTA 3F8CA 2R7DA 5CVUA 3IC7A 3GVAA 4EJWA 4MQ9F 4CYDA 4KIGA 4FX4A 2DLLA 2FXAA 1RUNA 3V8JA 4EM0B 5JFRA 4UUVA 4S05A 2PMUA 2L54A 3LQQA 4AWXB 1DPUA 1FBUA 4LG0B 1EH7A 2O03A 4OIOF 4RB3C 2P7VB 2KIFA 3DF8A 1QZZA 1HBXG 3DKWA 3KP6A 1TNSA 4NHJA 1LDJA 1JHFA 3Q9VA 1IXRC 3DQVC 1LEBA 5CYVA 2FEZA 4EJUA 1R1TA 5HDNA 1FSEA 4M71A 5L3DA 2F5DA 3DV8A 1S6LA 2YX7A 5HVQC 3FX3A 1MD0A 4RGSA 5K5RA 1B6AA 3JSOA 2ETHA 4M6YA 4XLNF 1O3TA 1R1UA 2PJPA 4Y15A 5KK1A 4XRFA 4LJZF 1R36A 2V1DA 1LEAA 2F5EA 3HRTA 4UHTA 3F8FA 1O3QA 4LD5A 3N97A 3KZYA 4MEYF 2XUBA 1P2FA 5E1WA 1U3EM 2CSOA 3ISPA 5LGNA 2O3FA 2PI0A 3ZN0A 3QP5A 2MLGA 2XHKA 3K9TA 2HKXA 2DFIA 2M87A 1Z91A 3IHUA 5ILVA 5F1RA 3GYHX 5KVRA 3T0YA 5E8GA 3WTVC 2EFWA 1Z7UA 2A61A 1U5TB 2HGCA 3U1DA 5D4RA 2HOEA 1GHCA 2RKHA 4I98B 4OMZA 1UCRA 3H92A 3IWFA 1XDUA 2MC3A 4QWQA 4Z2YA 3RKWA 1G3TA 3K1NA 4FT8A 3WTWC 4WXDA 1YS6A 1HXDA 2W84A 2OD5A 3MZYA 4L9TA 3MCZA 4I01A 4M74A 5LGUA 1RI7A 4LB5A 4ESBA 2Z99A 3C1DA 2STTA 1HKQA 3LA7A 2XRNA 2DQLA 2A07F 4HF1A 4UVCA 3CUQC 1DUXC 4U7DA 2W25A 3L9FA 5DDGA 2GXBA 3WGHA 1Z6RA 2XROA 1SFUA 2CYYA 2Y0MA 2BBYA 2YX4A 4KIFA 2HTJA 2QBYB 2ZNZA 4BNCA 2ISZA 2A6EF 4U0YA 5L3GA 4OU0A 1J7KA 4HQEA 3IKVA 2K02A 4ENNA 1UHWA 2O6GE 1R23A 2LNBA 3Q9SA 3GWZA 1LVAA 3GEZA 2FRHA 2PN6A 3EYIA 1YQAA 4GYGA 4UNOA 3O3KA 2OU2A 1E17A 2FA5A 2R7FA 3KP4A 4L5JA 1B1BA 3ZMZA 2DK5A 3CUOA 4GGGA 4P96A 1SD4A 3FXUA 3TO6A 2EV5A 3WTTC 1HSTA 2QQ9A 1XGOA 3JAMZ 1WKMA 2HFHA 3HUGA 2P4WA 1I6XA 3GFLA 2YSRA 5D5WB 4B09A 5E17F 1P4XA 1V3FA 4RS8A 4PZJA 4Q47A 5DCMB 4HLYA 5DCFA 1D8JA 5BMZA 1XD7A 2L4MA 2X4HA 5DUIA 1YO5C 3KE2A 3MZHA 1K78A 4HBLA 3RDIA 1P6RA 3QU6A 1FNNA 3FHZA 2WWYA 1XDSA 2BV6A 3TDZC 4AD9A 5DD8A 2EFPA 4IF4A 3HYIA 3R60A 4RGXA 1H0MA 2QQAA 1TQMA 3D5LA 4A0ZA 1YFHA 2L01A 2RC4A 4EGZA 1X3UA 5K5QA 2JTVA 4N9IA 2CGPA 1FX7A 2FSWA 2GA2A 1OYIA 5E20A 3CO6C 3MWMA 5JVTA 3WU0A 3I59B 2DTRA 1C0WA 2RDPA 1CGPA 3IRRA 1BC7C 4A0YA 2EA4A 1CF7B 4CGZA 4OMYA 1KU3A 2D1VA 4IRIA 1FLIA 4U88A 2ZNYA 2ZMEA 4XSXF 4GCVA 4DQ2A 3E3VA 1JGSA 3HHHA 2L3DA 5H20A 3BP8A 1LDKB 1WI9A 2M5WA 1J75A 3SFZA 2DI3A 1FY7A 3HSEA 3VFZA 1YIOA 1FBSA 4EVIA 3T5XA 2RNJA 5AONA 1XCBA 4YFXF 4KMFA 1OMIA 3R0JA 3HRSA 2HZTA 1FPQA 2VT2A 4L9VA 4LB6B 1K6OA 3HIFA 4CHUA 3M8FA 3VEPA 4Y13A 5HLHA 5LEKA 1PUEE 1XB4A 1WRJA 5D4SA 1TBXA 2CWEA 2WV0A 1W7PD 4HF0A 4P5OA 3E6DA 3R6SA 4U7BA 2FU4A 5CLSA 2GIVA 4HF2A 4KFCA 2DU9A 2PMHA 3WGGA 3B02A 4MHGA 3L2CA 2KRFA 2NYXA 1MJAA 3HOTA 1EH6A 5FGMA 4YFNF 2O8XA 4ZZLA 4R79A 5A2QZ 3ZMUA 3V7SA 4KIBA 2KIMA 5FO5A 5CVJA 2RN7A 5LGTA 5DUKA 3U9GA 3B73A 2IT0A 5LEJA 4I7HA 2VN2A 1J9IA 2V9VA 5E8IA 2QUFA 4G6QA 1S7OA 2NNNA 1USTA 2FOKA 1G3YA 3ABUA 1QO0D 2K86A 1YYVA 2UXNA 3GFJA 2RV8A 2XKOA 3LSTA 1SD7A 4A2UA 1ZARA 1U78A 1BI2A 2H6BA 1HW5A 2XIGA 3KP7A 3WTUC 1JHHA 2JSCA 3ZMTA 3E6CC 2ESNA 2DPDA 2B0LA 3PQJA 4RB1A 3MFKA 1WQ2A 5E1XA 4LK0F 3FXQA 1UB9A 2Y75A 5JR3A 4G6DA 2GWRA 3BJOA 3SXYA 2VE9A 3WTYC 3I4PA 2XV4S 4Q48A 1SD5A 2OA4A 1FOKA 3BWGA 4EJVA 1IN5A 2VOOA 4ENJA 2EA2A 3H3ZA 5D5UB 3HTUA 4G7ZF 4KN7X 2MD5A 4ZH4F 5L3CA 2OZUA 1UFMA 4GO1A 4CICA 4EM2A 4WCGA 1YG2A 1ODDA 2D2WA 1ZHFA 2HR3A 1Z05A 2L02A 1B9MA 2OQRA 1BOAA 5FD5A 3CO7C 2PEXA 2P6SA 1MDMA 1U6GA 4ASNA 4MNUA 1S29A 2PBIA 4EMSA 3DEUA 1SAXA 3CLOA 4BYYA 3WGIA 4MGRA 3RIRA 4EJOA 4WXHA 5L3EA 2P5KA 4HQMA 4HLXA 2VOPA 4YG2F 2W57A 5AIPA 2CO5A 3H3UA 2OQGA 3TOAA 5CJ9A 2FNAA 4IXAA 3QOPA 3RJPA 1GVJA 2NAZA 1KA8A 2VE8A 2F5FA 1REPC 3F8BA 1U2WA 4IJAA 4YFKF 3TGNA 4OINF 4EGYA 3BJ6A 3MAJA 1A04A 1U5TA 2RVCA 3F8MA 4HA8A 5IT9Z 3I54A 1FYLA 3GXOA 2ADUA 1S7AA 4NQWA 3TO7A 2VC0A 4K2EA 1E2XA 4OOIA 2HKOA 2P8TA 3M7GA 2XKPA 5ICGA 4BXUA 2OBPA 4HX7A 2JT1A 2YU3A 3TDUC 4CDGA 5LBQA 3RTRA 1XSXA 5TRDA 1DP7P 3LQRA 1BI3A 2A5YB 3CDHA 4ESFA 3CJNA 2FBIA 5HDKA 4BAYA 5FB2A 3ZQ7A 3F23A 1LB2A 3SHFA 3RKXA 5ICCA 3V7CA 1H9GA 3K0LA 4RAZA 3S2WA 3BPXA 1FC3A 1ZYRF 2FNPA 4PGGA 1LQ1A 5F64A 2IP2A 1FYKA 4ZYDA 2FE3A 1HW2A 4OIRF 1L0OC 3GO5A 2CG4A 1WWXA 2ZCWA 3FF5A 2QM3A 1KQ8A 2GZWA 5LHIA 4M9XA 3V8LA 4BH9A 1B4AA 1ON2A 5DCMA 3ECOA 2MH9A 2KIUA 4N9HA 3RPQA 2OZ6A 3F3XA 2ACJA 2OAZA 1P4AA 3LA2A 1OR7A 3G3ZA 3E97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQN A;  4HDU A;  3HRU A;  1H9T A;  2HYG D;  3NQO A;  1JE8 A;  1CF7 A;  1BM9 A;  3JTG A;  3W6K B;  2BYV E;  2RGV A;  4I09 A;  1EH8 A;  1BI0 A;  5BQT A;  4KN4 X;  3QU3 A;  1XSD A;  3RYP A;  3EET A;  1XSV A;  4AIK A;  1TQP A;  2IW5 A;  1LJ9 A;  3MQ0 A;  4ESJ A;  4UVA A;  3W6J B;  1IXC A;  1MDM B;  2FQ3 A;  4U0V A;  2FML A;  2QBY A;  1IXS B;  2DAO A;  2IA2 A;  4JQF A;  2EFN A;  1Q1H A;  1S8N A;  3SQN A;  3QPT A;  5DV5 A;  3T8T A;  1XGN A;  2EK5 A;  2QWW A;  2ZBK A;  4HOB A;  2XAQ A;  3FZV A;  4G7O F;  3LAJ A;  1V4R A;  2JPC A;  2XAJ A;  2P6T A;  2C6Y A;  2Z9O A;  4A6D A;  3FMS A;  3DPT A;  4S04 A;  3LA3 A;  3COA C;  1SFE A;  3EYY A;  1D8K A;  1IF1 A;  5K5O A;  4XLP F;  4MTE A;  3N4M A;  3KZZ A;  3GZ6 A;  4A5M A;  4A0X A;  1D5V A;  4LMY A;  2HTS A;  2GA1 A;  1HQC A;  4P9F A;  4RAY A;  1YW7 A;  1YLF A;  4L9N A;  3HOS A;  3E6M A;  4TV7 A;  1BN5 A;  5ERI A;  2VBY A;  3F72 A;  1O57 A;  4LLN A;  4CO8 A;  2M45 A;  1O3S A;  1YS7 A;  3I58 A;  2P5V A;  2A69 F;  5HS8 A;  3FM5 A;  1K78 B;  5HS7 A;  1QPM A;  5CVR A;  3FMR A;  4WX9 A;  4AIJ A;  3VOE A;  5J8C A;  2Z5U A;  3ELK A;  4P55 A;  2GXG A;  5A2Q K;  4OIP F;  3KCC A;  2L4A A;  2ZXJ A;  5CVI A;  4KIC A;  2G9W A;  2J5O A;  4LG0 A;  1O7F A;  4R8H A;  3L09 A;  4ZYH A;  3JW4 A;  4AIH A;  5LHG A;  3RPU A;  5TJJ A;  3DPL C;  2EV0 A;  5IT3 A;  3EQL F;  3NRV A;  1U5T C;  2V1X A;  2HWV A;  2D45 A;  3TO9 A;  3LWF A;  3KP5 A;  3I59 A;  3RKY A;  4Y17 A;  2VOD A;  4HW0 A;  4RB2 C;  1FSH A;  1BJA A;  6PAX A;  2XVC A;  5HS9 A;  3LFK A;  4Q5S F;  1T38 A;  3ULQ B;  3ZMS A;  2KJC A;  1BI1 A;  3L00 A;  3C7J A;  3ZP5 A;  3V7R A;  4BHC A;  1MJ9 A;  4N0B A;  1LNW A;  4CZZ A;  1ZG1 A;  4GXO A;  4ZYE A;  2FBK A;  1IZ1 A;  3JSP A;  3WE3 A;  2XAH A;  5BS6 A;  3O6B B;  4M6X A;  2FF4 A;  1ZRE A;  5ICE A;  1ZGA A;  2DO7 A;  2R3S A;  2PQ8 A;  3E5X A;  2VBX A;  1TW2 A;  1I1S A;  4JK1 X;  3E5U A;  5H6R A;  4ON0 A;  1R5H A;  3QPH A;  1ZG3 A;  3M9A A;  2UXX A;  2PFB A;  1STZ A;  4WK8 F;  2XAS A;  3VB2 A;  5D6F A;  5D8K B;  3PFI A;  2LF7 A;  3WU1 B;  3LAP A;  4LGW A;  2QZ8 A;  3V4G A;  3GFM A;  1KYW A;  1ZH5 A;  4IPA A;  1IN6 A;  4IHT A;  1DPR A;  4L0Y B;  1QNT A;  1K79 A;  4L18 B;  3J81 K;  3IWZ A;  3PQK A;  1TQI A;  4PCQ A;  4O6J A;  2G7H A;  2XAG A;  3V8K A;  4ZZD A;  1G3W A;  5FD6 A;  1ZRF A;  5LRR A;  5L3B A;  3GLX A;  1VTN C;  3K1M A;  2E1N A;  1Z1D A;  1F5T A;  1B59 A;  1YW9 A;  1O7L A;  2H94 A;  4JBA A;  4RGU A;  4LLL A;  5ICF A;  1MZB A;  3HHG A;  4AVP A;  4G8X A;  2Z33 A;  2ZME B;  5DEQ A;  5CVV A;  2K4J A;  1DDN A;  2YR2 A;  1R1V A;  3E6B A;  4KDP A;  4IHS A;  2MBF A;  1XN7 A;  1USS A;  2Z3Y A;  4OIQ F;  2WTE A;  2O61 A;  4HDV A;  3K1P A;  4MEX F;  3ROU A;  3O2P E;  3QAH A;  4G9Y A;  2DK8 A;  4WF2 A;  1F9N A;  2EJR A;  3DFG A;  2M8E A;  2QVO A;  3ECH A;  2M30 A;  3BZ6 A;  3OV8 A;  1SD6 A;  5E18 F;  5D6E A;  5HLG A;  4A12 A;  3C3W A;  1T0F A;  1FYM A;  1B9N A;  2DQR A;  4UV9 A;  3BJA A;  2KJB A;  4WXC A;  1TW3 A;  3WTZ A;  4ENM A;  1W5S A;  1G3S A;  1XCV A;  1KU2 A;  4RB0 A;  3F21 A;  2ISY A;  1TTY A;  2K7L A;  4L0Z B;  3R61 A;  4KNY A;  5JHU A;  3ABT A;  2A68 F;  4DNC A;  4BQA A;  4EJT A;  2QEN A;  3F6V A;  3GF2 A;  4H0E A;  2NRA C;  1LDD A;  5BPI A;  1ZRD A;  1FWZ A;  2NNY A;  3IL2 A;  1RUO A;  1JXS A;  5LLQ A;  1F1Z A;  2EWN A;  5LHH A;  4FHT A;  4D0P A;  5ILS A;  3WOD F;  2VON A;  4KYW A;  4HZF A;  2KKO A;  3T8R A;  3KLN A;  3R0A A;  4FX0 A;  3KEO A;  2ZFW A;  1U8R A;  2IA1 A;  1QGP A;  3IKT A;  1ULY A;  3J80 Z;  3I53 A;  1KQ9 A;  1FP1 D;  2GQQ A;  3C18 A;  2BE5 F;  2EFQ A;  1XGM A;  1D3Y A;  1Z9C A;  1ZLK A;  1SFX A;  5HOO A;  1ON1 A;  1ZLJ A;  4M72 A;  4I2O A;  2CFX A;  4ENK A;  1J5Y A;  4HYE A;  2AS5 F;  1AOY A;  3WE2 A;  4M73 A;  2ZO4 A;  1ZGJ A;  2P7C B;  1RIO H;  5HLI A;  1P92 A;  3JAM K;  4PGH A;  1SMY F;  3WTX C;  2E7X A;  2ESH A;  2Y48 A;  1XMA A;  1KU9 A;  1OKR A;  1AWC A;  1PDN C;  1HKS A;  4XSZ F;  4U0W A;  4L9J A;  4G7H F;  5J8F A;  4ZYG A;  1TLH B;  2XGX A;  4HV5 A;  1YTY A;  2HYF A;  2CW0 F;  2DT5 A;  1MJB A;  4UV8 A;  4LFU A;  2VT3 A;  3TKY A;  2IJL A;  1Y0U A;  3P9K A;  4WWC A;  3FXR A;  4RGR A;  3J7A O;  4HAM A;  3P9C A;  3I0T A;  1W5T A;  1ZRC A;  1BIB A;  1IN8 A;  2H6C A;  5LRS A;  2JPB A;  2FBH A;  3QP6 A;  2ELH A;  3MEX A;  2NS0 A;  4EM1 A;  4PDK A;  2LKP A;  2E1C A;  3BRO A;  4M9S A;  1RNL A;  1HSJ A;  4UXN A;  4EV0 A;  2WC2 A;  3RI4 A;  1L3L A;  3EUH A;  1O3R A;  2Q8K A;  4O3M A;  1Z6T A;  3ZMD A;  5FLX K;  2M1B A;  3G73 A;  2BEO A;  4I02 A;  4A6E A;  4LK1 F;  1R00 A;  3GUD A;  2DW4 A;  5HDG A;  2QYO A;  4E70 A;  5BPD A;  4MQV A;  4HV6 A;  3F22 A;  3JTH A;  2IPQ X;  1KQ0 A;  2IA0 A;  5JI6 A;  2DBB A;  4YIF A;  3QRF F;  3AAF A;  1IN7 A;  5FFZ A;  3BPV A;  2LSO A;  3DP7 A;  1NHA A;  3CTA A;  4IRG A;  1IRG A;  1IN4 A;  2V79 A;  3BOQ A;  2LF8 A;  3HTS B;  1P4W A;  3I64 A;  2W85 A;  2UWM A;  3R4K A;  1ZG5 A;  3ZN1 A;  1R58 A;  1IUY A;  3IRQ A;  2Q2E A;  3E5Q A;  2RQP A;  4LLG F;  5D5X B;  3ERE D;  2DPU A;  1XMK A;  5E1Z B;  3KEQ A;  5L3F A;  3SZT A;  5F6F A;  2VBW A;  4HX4 A;  1T39 A;  2MLK A;  3BDD A;  4L5I A;  3BY6 A;  2IVM A;  4KT5 C;  1PP8 F;  4IRH A;  5FFX A;  2H09 A;  4BHB A;  3Q5F A;  3K2Z A;  5ILU A;  1KYZ A;  2ZJ2 A;  3NEU A;  3ZMV A;  3M1E A;  1G4D A;  2QLZ A;  3P7N A;  5FLX Z;  1I1G A;  3HSF A;  5D8L B;  1GXQ A;  3U2R A;  5K1Y A;  3GFI A;  4O5V A;  1W7P A;  3D0S A;  5AIQ A;  1HW1 A;  2VBZ A;  1J0R A;  4G94 A;  4KUM A;  3VOD A;  3M8E A;  2TDX A;  1BIA A;  3DXJ F;  2CQK A;  2XAF A;  2JZY A;  3F8N A;  3EDP A;  3KP2 A;  3TOB A;  5ED4 A;  2O0Y A;  1I5Z A;  3CUQ A;  2K27 A;  2F2E A;  1XGS A;  1R22 A;  1BBY A;  3KP3 A;  1UHM A;  3J80 K;  1IRF A;  1PP7 U;  3I71 A;  2G7U A;  2A6H F;  3RYR A;  5D5V B;  2LDU A;  3FMQ A;  1QQI A;  1ZAO A;  3P9I A;  1OYW A;  2VC1 A;  2COM A;  2BGC A;  3KET A;  3T1B A;  2J5P A;  5EEH A;  1YW8 A;  1T2K A;  2V1U A;  1IW7 F;  3J81 Z;  2UZK A;  1MKM A;  4A5N A;  2X0L A;  4M9Z A;  4EQQ A;  3GZ5 A;  1J2X A;  1WSU A;  1I27 A;  3K69 A;  3KFW X;  1RZ4 A;  2E7W A;  1BC8 C;  3I5U A;  4ETS A;  1W4M A;  2HDC A;  4UVB A;  3F6O A;  4QLC U;  2D1H A;  3REO A;  2HQR A;  3WG9 A;  3HRM A;  1K7A A;  2EB7 A;  3GW2 A;  1T6S A;  1FBQ A;  1FP2 A;  3FWE A;  1S3J A;  2AXL A;  4KA4 A;  4Q4Z F;  1MGT A;  3GX4 X;  4NB5 A;  5H6Q A;  2STW A;  1ZN2 A;  1IAW A;  2A3S A;  2JRT A;  4HX8 A;  4IVN A;  2EV6 A;  2GAU A;  2MH2 A;  4CXF A;  4B8X A;  4F7Z A;  3KLO A;  1G6N A;  2YPR A;  2H27 A;  2HS5 A;  3L7W A;  2P5L C;  3WTS C;  4P9U A;  1R7J A;  5J6X A;  2PLY A;  2HEO A;  2ZKZ A;  3OOP A;  2F5C A;  5BOX A;  4MTD A;  1ONV A;  1OYY A;  1R5G A;  1KGS A;  5IT9 K;  1T98 A;  2IRF G;  4KMU X;  3ML6 A;  1F4K A;  1FT9 A;  4R1H A;  1W7P B;  3ZPL A;  2V6C A;  4YII A;  2Q0O A;  1EV7 A;  1J59 A;  4XBF A;  1GXP A;  1QZY A;  2EFO A;  4GYI A;  1KU7 A;  2K4B A;  3FM3 A;  2FMY A;  4BHP A;  2MA3 A;  5DD4 A;  1HKT A;  1QBJ A;  2QQB A;  3SZP A;  2VXZ A;  4I0B A;  5EEG A;  1SMT A;  1OPC A;  5DYM A;  3CUQ B;  3TQN A;  2W24 A;  1FZP B;  4I0A A;  3HSR A;  2PG4 A;  1TNT A;  3F8C A;  2R7D A;  5CVU A;  3IC7 A;  3GVA A;  4EJW A;  4MQ9 F;  4CYD A;  4KIG A;  4FX4 A;  2DLL A;  2FXA A;  1RUN A;  3V8J A;  4EM0 B;  5JFR A;  4UUV A;  4S05 A;  2PMU A;  2L54 A;  3LQQ A;  4AWX B;  1DPU A;  1FBU A;  4LG0 B;  1EH7 A;  2O03 A;  4OIO F;  4RB3 C;  2P7V B;  2KIF A;  3DF8 A;  1QZZ A;  1HBX G;  3DKW A;  3KP6 A;  1TNS A;  4NHJ A;  1LDJ A;  1JHF A;  3Q9V A;  1IXR C;  3DQV C;  1LEB A;  5CYV A;  2FEZ A;  4EJU A;  1R1T A;  5HDN A;  1FSE A;  4M71 A;  5L3D A;  2F5D A;  3DV8 A;  1S6L A;  2YX7 A;  5HVQ C;  3FX3 A;  1MD0 A;  4RGS A;  5K5R A;  1B6A A;  3JSO A;  2ETH A;  4M6Y A;  4XLN F;  1O3T A;  1R1U A;  2PJP A;  4Y15 A;  5KK1 A;  4XRF A;  4LJZ F;  1R36 A;  2V1D A;  1LEA A;  2F5E A;  3HRT A;  4UHT A;  3F8F A;  1O3Q A;  4LD5 A;  3N97 A;  3KZY A;  4MEY F;  2XUB A;  1P2F A;  5E1W A;  1U3E M;  2CSO A;  3ISP A;  5LGN A;  2O3F A;  2PI0 A;  3ZN0 A;  3QP5 A;  2MLG A;  2XHK A;  3K9T A;  2HKX A;  2DFI A;  2M87 A;  1Z91 A;  3IHU A;  5ILV A;  5F1R A;  3GYH X;  5KVR A;  3T0Y A;  5E8G A;  3WTV C;  2EFW A;  1Z7U A;  2A61 A;  1U5T B;  2HGC A;  3U1D A;  5D4R A;  2HOE A;  1GHC A;  2RKH A;  4I98 B;  4OMZ A;  1UCR A;  3H92 A;  3IWF A;  1XDU A;  2MC3 A;  4QWQ A;  4Z2Y A;  3RKW A;  1G3T A;  3K1N A;  4FT8 A;  3WTW C;  4WXD A;  1YS6 A;  1HXD A;  2W84 A;  2OD5 A;  3MZY A;  4L9T A;  3MCZ A;  4I01 A;  4M74 A;  5LGU A;  1RI7 A;  4LB5 A;  4ESB A;  2Z99 A;  3C1D A;  2STT A;  1HKQ A;  3LA7 A;  2XRN A;  2DQL A;  2A07 F;  4HF1 A;  4UVC A;  3CUQ C;  1DUX C;  4U7D A;  2W25 A;  3L9F A;  5DDG A;  2GXB A;  3WGH A;  1Z6R A;  2XRO A;  1SFU A;  2CYY A;  2Y0M A;  2BBY A;  2YX4 A;  4KIF A;  2HTJ A;  2QBY B;  2ZNZ A;  4BNC A;  2ISZ A;  2A6E F;  4U0Y A;  5L3G A;  4OU0 A;  1J7K A;  4HQE A;  3IKV A;  2K02 A;  4ENN A;  1UHW A;  2O6G E;  1R23 A;  2LNB A;  3Q9S A;  3GWZ A;  1LVA A;  3GEZ A;  2FRH A;  2PN6 A;  3EYI A;  1YQA A;  4GYG A;  4UNO A;  3O3K A;  2OU2 A;  1E17 A;  2FA5 A;  2R7F A;  3KP4 A;  4L5J A;  1B1B A;  3ZMZ A;  2DK5 A;  3CUO A;  4GGG A;  4P96 A;  1SD4 A;  3FXU A;  3TO6 A;  2EV5 A;  3WTT C;  1HST A;  2QQ9 A;  1XGO A;  3JAM Z;  1WKM A;  2HFH A;  3HUG A;  2P4W A;  1I6X A;  3GFL A;  2YSR A;  5D5W B;  4B09 A;  5E17 F;  1P4X A;  1V3F A;  4RS8 A;  4PZJ A;  4Q47 A;  5DCM B;  4HLY A;  5DCF A;  1D8J A;  5BMZ A;  1XD7 A;  2L4M A;  2X4H A;  5DUI A;  1YO5 C;  3KE2 A;  3MZH A;  1K78 A;  4HBL A;  3RDI A;  1P6R A;  3QU6 A;  1FNN A;  3FHZ A;  2WWY A;  1XDS A;  2BV6 A;  3TDZ C;  4AD9 A;  5DD8 A;  2EFP A;  4IF4 A;  3HYI A;  3R60 A;  4RGX A;  1H0M A;  2QQA A;  1TQM A;  3D5L A;  4A0Z A;  1YFH A;  2L01 A;  2RC4 A;  4EGZ A;  1X3U A;  5K5Q A;  2JTV A;  4N9I A;  2CGP A;  1FX7 A;  2FSW A;  2GA2 A;  1OYI A;  5E20 A;  3CO6 C;  3MWM A;  5JVT A;  3WU0 A;  3I59 B;  2DTR A;  1C0W A;  2RDP A;  1CGP A;  3IRR A;  1BC7 C;  4A0Y A;  2EA4 A;  1CF7 B;  4CGZ A;  4OMY A;  1KU3 A;  2D1V A;  4IRI A;  1FLI A;  4U88 A;  2ZNY A;  2ZME A;  4XSX F;  4GCV A;  4DQ2 A;  3E3V A;  1JGS A;  3HHH A;  2L3D A;  5H20 A;  3BP8 A;  1LDK B;  1WI9 A;  2M5W A;  1J75 A;  3SFZ A;  2DI3 A;  1FY7 A;  3HSE A;  3VFZ A;  1YIO A;  1FBS A;  4EVI A;  3T5X A;  2RNJ A;  5AON A;  1XCB A;  4YFX F;  4KMF A;  1OMI A;  3R0J A;  3HRS A;  2HZT A;  1FPQ A;  2VT2 A;  4L9V A;  4LB6 B;  1K6O A;  3HIF A;  4CHU A;  3M8F A;  3VEP A;  4Y13 A;  5HLH A;  5LEK A;  1PUE E;  1XB4 A;  1WRJ A;  5D4S A;  1TBX A;  2CWE A;  2WV0 A;  1W7P D;  4HF0 A;  4P5O A;  3E6D A;  3R6S A;  4U7B A;  2FU4 A;  5CLS A;  2GIV A;  4HF2 A;  4KFC A;  2DU9 A;  2PMH A;  3WGG A;  3B02 A;  4MHG A;  3L2C A;  2KRF A;  2NYX A;  1MJA A;  3HOT A;  1EH6 A;  5FGM A;  4YFN F;  2O8X A;  4ZZL A;  4R79 A;  5A2Q Z;  3ZMU A;  3V7S A;  4KIB A;  2KIM A;  5FO5 A;  5CVJ A;  2RN7 A;  5LGT A;  5DUK A;  3U9G A;  3B73 A;  2IT0 A;  5LEJ A;  4I7H A;  2VN2 A;  1J9I A;  2V9V A;  5E8I A;  2QUF A;  4G6Q A;  1S7O A;  2NNN A;  1UST A;  2FOK A;  1G3Y A;  3ABU A;  1QO0 D;  2K86 A;  1YYV A;  2UXN A;  3GFJ A;  2RV8 A;  2XKO A;  3LST A;  1SD7 A;  4A2U A;  1ZAR A;  1U78 A;  1BI2 A;  2H6B A;  1HW5 A;  2XIG A;  3KP7 A;  3WTU C;  1JHH A;  2JSC A;  3ZMT A;  3E6C C;  2ESN A;  2DPD A;  2B0L A;  3PQJ A;  4RB1 A;  3MFK A;  1WQ2 A;  5E1X A;  4LK0 F;  3FXQ A;  1UB9 A;  2Y75 A;  5JR3 A;  4G6D A;  2GWR A;  3BJO A;  3SXY A;  2VE9 A;  3WTY C;  3I4P A;  2XV4 S;  4Q48 A;  1SD5 A;  2OA4 A;  1FOK A;  3BWG A;  4EJV A;  1IN5 A;  2VOO A;  4ENJ A;  2EA2 A;  3H3Z A;  5D5U B;  3HTU A;  4G7Z F;  4KN7 X;  2MD5 A;  4ZH4 F;  5L3C A;  2OZU A;  1UFM A;  4GO1 A;  4CIC A;  4EM2 A;  4WCG A;  1YG2 A;  1ODD A;  2D2W A;  1ZHF A;  2HR3 A;  1Z05 A;  2L02 A;  1B9M A;  2OQR A;  1BOA A;  5FD5 A;  3CO7 C;  2PEX A;  2P6S A;  1MDM A;  1U6G A;  4ASN A;  4MNU A;  1S29 A;  2PBI A;  4EMS A;  3DEU A;  1SAX A;  3CLO A;  4BYY A;  3WGI A;  4MGR A;  3RIR A;  4EJO A;  4WXH A;  5L3E A;  2P5K A;  4HQM A;  4HLX A;  2VOP A;  4YG2 F;  2W57 A;  5AIP A;  2CO5 A;  3H3U A;  2OQG A;  3TOA A;  5CJ9 A;  2FNA A;  4IXA A;  3QOP A;  3RJP A;  1GVJ A;  2NAZ A;  1KA8 A;  2VE8 A;  2F5F A;  1REP C;  3F8B A;  1U2W A;  4IJA A;  4YFK F;  3TGN A;  4OIN F;  4EGY A;  3BJ6 A;  3MAJ A;  1A04 A;  1U5T A;  2RVC A;  3F8M A;  4HA8 A;  5IT9 Z;  3I54 A;  1FYL A;  3GXO A;  2ADU A;  1S7A A;  4NQW A;  3TO7 A;  2VC0 A;  4K2E A;  1E2X A;  4OOI A;  2HKO A;  2P8T A;  3M7G A;  2XKP A;  5ICG A;  4BXU A;  2OBP A;  4HX7 A;  2JT1 A;  2YU3 A;  3TDU C;  4CDG A;  5LBQ A;  3RTR A;  1XSX A;  5TRD A;  1DP7 P;  3LQR A;  1BI3 A;  2A5Y B;  3CDH A;  4ESF A;  3CJN A;  2FBI A;  5HDK A;  4BAY A;  5FB2 A;  3ZQ7 A;  3F23 A;  1LB2 A;  3SHF A;  3RKX A;  5ICC A;  3V7C A;  1H9G A;  3K0L A;  4RAZ A;  3S2W A;  3BPX A;  1FC3 A;  1ZYR F;  2FNP A;  4PGG A;  1LQ1 A;  5F64 A;  2IP2 A;  1FYK A;  4ZYD A;  2FE3 A;  1HW2 A;  4OIR F;  1L0O C;  3GO5 A;  2CG4 A;  1WWX A;  2ZCW A;  3FF5 A;  2QM3 A;  1KQ8 A;  2GZW A;  5LHI A;  4M9X A;  3V8L A;  4BH9 A;  1B4A A;  1ON2 A;  5DCM A;  3ECO A;  2MH9 A;  2KIU A;  4N9H A;  3RPQ A;  2OZ6 A;  3F3X A;  2ACJ A;  2OAZ A;  1P4A A;  3LA2 A;  1OR7 A;  3G3Z A;  3E97 A; 
#chains in the Genus database with same CATH topology
 4CUG A;  4F55 A;  1LFP A;  2HQN A;  4HDU A;  3HRU A;  1H9T A;  1B72 A;  3OYI A;  3JRE A;  4NQW B;  4RAF A;  1VZ0 A;  1WZ2 A;  2E5Z A;  2HYG D;  1F36 A;  3NQO A;  1K4S A;  3AG4 H;  1JE8 A;  1CF7 A;  1BM9 A;  3JTG A;  4GDF A;  1JKP C;  1Z7L A;  4E6K G;  3W6K B;  2BYV E;  5JLX A;  2JJ7 A;  1QVU A;  3C2G A;  2BY3 A;  2RGV A;  1XS9 A;  1MBG A;  4I09 A;  2CV2 A;  1EH8 A;  1WJD A;  3A01 B;  4YRV A;  1BI0 A;  5BQT A;  2VKV A;  4KN4 X;  3QU3 A;  1XSD A;  3RYP A;  3BG5 A;  3OYJ A;  4HG2 A;  3EET A;  5J40 A;  1XSV A;  4AIK A;  4LOC A;  3J7Y J;  4ZJZ A;  4HST A;  1TQP A;  2IW5 A;  1X1D A;  1T95 A;  1LJ9 A;  3MQ0 A;  3ONQ A;  4ESJ A;  2V9K A;  4UVA A;  3W6J B;  1IXC A;  1MDM B;  2LRD A;  2FQ3 A;  4U0V A;  2FML A;  1JTY A;  4ZYA A;  2DA7 A;  1IXS B;  1BR4 A;  4CA0 A;  2QBY A;  2DAO A;  2IA2 A;  4JQF A;  1Y6I A;  2EFN A;  3U21 A;  1Q1H A;  1S8N A;  5FLV A;  3SQN A;  4Y3O A;  3QPT A;  3FDY A;  2PX9 A;  2VKE A;  5DV5 A;  1OCR H;  3T8T A;  3HL2 A;  3IH3 A;  4JOM A;  5DM7 F;  4BDZ A;  1XGN A;  2EK5 A;  2QWW A;  4D7N A;  2ZBK A;  2H8W A;  4HOB A;  2XAQ A;  3FZV A;  3HPH A;  3OS1 A;  1Y1W J;  5F0H A;  5IP6 A;  3CCQ I;  4G7O F;  2CV0 A;  3Q0V A;  3LAJ A;  3QPS A;  1V4R A;  2JPC A;  2XAJ A;  1JJ8 C;  2P6T A;  2C6Y A;  2Z9O A;  4A6D A;  3FMS A;  3I9V 2;  4XRS A;  2R5Z B;  1U8B A;  2AXT C;  2M2E A;  3DPT A;  4S04 A;  3LA3 A;  1V5E A;  3COA C;  1SFE A;  3EYY A;  1D8K A;  1IF1 A;  5K5O A;  3GCM A;  4XLP F;  4MTE A;  3N4M A;  3KZZ A;  3GZ6 A;  4A5M A;  5CQE A;  3OS0 A;  4A0X A;  3ZXS A;  1D5V A;  4LMY A;  2HTS A;  2GA1 A;  1HQC A;  4P9F A;  3W6V A;  5F1J A;  3DU6 A;  4RAY A;  4CH7 A;  1WHU A;  2DDA A;  2NS7 A;  3MN2 A;  3D5R C;  3IAS 2;  3EUA A;  1YW7 A;  1VQL I;  1TL8 A;  1YLF A;  3S17 J;  4L9N A;  3HOS A;  3E6M A;  2LRE A;  3S2H J;  3IH2 A;  2EIJ H;  4TV7 A;  1W0T A;  4C3H J;  1BN5 A;  1VQ7 I;  3HKZ N;  4LIV A;  5ERI A;  5LFA A;  1IDZ A;  2VBY A;  2CS3 A;  3F72 A;  1O57 A;  1UAA A;  4L5E A;  1MH3 A;  1SVL A;  5K7F A;  4LLN A;  4CO8 A;  1Y8Q B;  2E71 A;  2M45 A;  2WAQ N;  1YS7 A;  3I58 A;  1O3S A;  1IG7 A;  1ETW A;  1Y56 A;  5B1A H;  2P5V A;  3CF5 F;  2A69 F;  1S72 I;  4M3F A;  1IO2 A;  1FOW A;  1IUF A;  5HS8 A;  3FM5 A;  1K78 B;  5HS7 A;  1QPM A;  5CVR A;  3FMR A;  4WX9 A;  4AIJ A;  4Y52 J;  3VOE A;  5J8C A;  2Z5U A;  2QGU A;  3ELK A;  4P55 A;  2GXG A;  2X1E A;  2R93 J;  1WGX A;  3TL4 X;  2HVQ A;  1P7J A;  5A2Q K;  2F6C A;  2VJ5 A;  2ZSH B;  5IYD J;  4OIP F;  1YJN I;  3KCC A;  2IS4 A;  2L4A A;  2ZXJ A;  2IS2 A;  5CVI A;  1EA3 A;  1MBH A;  4KIC A;  3CC7 I;  1AKH B;  3HB9 A;  2G9W A;  2J5O A;  1S7E A;  1D0Z A;  2Y30 A;  2IS6 A;  4LG0 A;  1O7F A;  2DYR H;  2EPF A;  2F48 A;  3FXM A;  4R8H A;  3L09 A;  4ZYH A;  2GOX B;  2JVH A;  1OCT C;  2ZXW H;  3JW4 A;  4AIH A;  1YI2 I;  5LHG A;  2VB6 A;  1DGW Y;  5TJJ A;  3RPU A;  3DPL C;  2EV0 A;  5IT3 A;  3EQL F;  1R4N B;  2IS1 A;  3NRV A;  1U5T C;  1Y0N A;  2HWV A;  2V1X A;  2D45 A;  3TO9 A;  3K4B A;  2COB A;  3LWF A;  3KP5 A;  3K4C A;  3I59 A;  3RKY A;  4Y17 A;  2DMU A;  4BL0 B;  5EGO B;  2VOD A;  3L1P A;  2R7Z J;  4HW0 A;  4RB2 C;  1FSH A;  1OIS A;  1WH7 A;  3I55 I;  4BBS J;  1BJA A;  4PSX A;  6PAX A;  2XVC A;  5HS9 A;  5GP9 A;  2O8K A;  3LFK A;  4Q5S F;  5EDN A;  1T38 A;  3FKJ A;  3WHC A;  2DOD A;  1XG1 A;  5EEA A;  2M34 A;  3ULQ B;  3ZMS A;  1FJL A;  1T0F C;  2KJC A;  1BI1 A;  3HGY A;  3L00 A;  4DYC A;  3F9K A;  4CSW A;  4IEJ A;  3C7J A;  3ZP5 A;  3V7R A;  4BHC A;  1T33 A;  1MJ9 A;  4X0G A;  4N0B A;  1LNW A;  2DA6 A;  3BTC A;  4CZZ A;  3CCM I;  2R5Y B;  1OLT A;  1ZG1 A;  4GXO A;  4ZYE A;  2FBK A;  3B6C A;  1IZ1 A;  3BR5 A;  3JSP A;  1TWG J;  5B1B H;  1PYV A;  4RM2 A;  3WE3 A;  2KRC A;  2XAH A;  5BS6 A;  2IBD A;  4FTH A;  1JT6 A;  3O6B B;  4F91 B;  2ZB9 A;  5F04 A;  4M6X A;  5M3M J;  2FF4 A;  1B8I B;  5ICE A;  1ZRE A;  1ZGA A;  3BR0 A;  2DO7 A;  2EIN H;  2R3S A;  2PQ8 A;  1QVT A;  4QIW N;  4IZZ A;  3E5X A;  4N4O B;  2VBX A;  2KIS A;  3LSJ A;  2A05 A;  1TW2 A;  1I1S A;  4JK1 X;  3BG9 A;  3E5U A;  5H6R A;  4ON0 A;  1R5H A;  3QPH A;  1ZG3 A;  4DBR A;  5C44 J;  4BY7 J;  4ZC3 A;  3M9A A;  2UXX A;  2WY7 Q;  5J1U A;  2OUM A;  2PFB A;  1RKT A;  1STZ A;  2OV7 A;  4WK8 F;  2XAS A;  3HGG A;  2WB1 A;  4HSR A;  3VB2 A;  5D6F A;  5D8K B;  2OF7 A;  3PFI A;  3LSP A;  2RAE A;  2CQN A;  2LF7 A;  3WU1 B;  1FMV A;  3CMM A;  4DOZ A;  4C2T A;  2X48 A;  1SFK A;  3LAP A;  4D5C A;  4NC7 A;  1AKH A;  1RR8 C;  2FD5 A;  1SFO J;  4LGW A;  2QZ8 A;  2ZXI A;  3V4G A;  3W2V A;  3GFM A;  1KYW A;  2CFO A;  1ZH5 A;  5FKK A;  4IPA A;  1IN6 A;  4IHT A;  1DP3 A;  3HC7 A;  4E7I A;  1DPR A;  1MBJ A;  1UHS A;  3A4C A;  2LLK A;  4L0Y B;  1QNT A;  2R92 J;  3BTL A;  1FIA A;  1K79 A;  4L18 B;  1VND A;  2BZT A;  3AG3 H;  4G12 A;  2DA4 A;  3J81 K;  3TBI A;  3IWZ A;  3PQK A;  1TQI A;  3N05 A;  2AQF A;  4PCQ A;  4O6J A;  2G7H A;  2XAG A;  3V8K A;  4B1R A;  2ZFU A;  3DKY A;  4ZZD A;  1G3W A;  5FD6 A;  1ZRF A;  5LRR A;  2Z16 A;  5L3B A;  3GLX A;  1VTN C;  1W36 D;  1POG A;  2MSY A;  3K1M A;  2E1N A;  1Z1D A;  3DEE A;  2NOG A;  1F5T A;  2K9M A;  2Y31 A;  2B9S A;  4UB6 C;  3H36 A;  2O5R A;  4XOP A;  1BA5 A;  1B59 A;  2MFZ A;  1YW9 A;  3JRC A;  1O7L A;  3GLL A;  2X6W A;  2H94 A;  4JBA A;  4RGU A;  3ABK H;  4LLL A;  5ICF A;  1MZB A;  2ZSI B;  1HDP A;  3HHG A;  1FOY A;  1OCC H;  4AVP A;  3CMA I;  4CCM A;  4G8X A;  2Z33 A;  3MKL A;  2ZME B;  5DEQ A;  2R5Z A;  2DCE A;  2ME6 A;  2K9S A;  5CVV A;  2K4J A;  1CQT A;  1DDN A;  2Q1Z B;  4E7Z A;  2YR2 A;  1E3P A;  1R1V A;  3E6B A;  1SAN A;  3Q3S A;  4KDP A;  5E3O A;  2WB1 N;  1LPQ A;  4IHS A;  2MBF A;  1XN7 A;  1USS A;  1P7I A;  2Z3Y A;  4OIQ F;  1OFC X;  2WTE A;  3ASO H;  3KYD B;  2Y9Z A;  4HDV A;  2O61 A;  3BTJ A;  3K1P A;  4MEX F;  2VKD A;  3H9J A;  3ROU A;  2DOA A;  3O2P E;  3QAH A;  4G9Y A;  1HDD C;  2DK8 A;  4WF2 A;  1F9N A;  2EJR A;  3DFG A;  3H3V K;  2LD5 A;  3NWT A;  4PK4 A;  2M8E A;  2QVO A;  3IAM 2;  1I50 J;  1DQU A;  3ECH A;  2BY1 A;  2M30 A;  2WAD A;  4NC6 A;  3BZ6 A;  3S8P A;  3OV8 A;  1SD6 A;  1XTA A;  5E18 F;  5D6E A;  5HLG A;  2TRT A;  4A12 A;  3C3W A;  1T0F A;  1FYM A;  1B9N A;  2DQR A;  2P0W A;  2HOT A;  1JI8 A;  2JWT A;  2E2J J;  4UV9 A;  2WY8 Q;  1K4T A;  3BJA A;  2KJB A;  1YJ9 I;  4WXC A;  1TW3 A;  3WTZ A;  4ENM A;  1W5S A;  4C2M J;  1G3S A;  2MD0 A;  1I3A A;  3OYD A;  1XCV A;  1KU2 A;  4RB0 A;  3AKZ A;  3I56 I;  3F21 A;  2CUF A;  2WAQ A;  2ISY A;  1TTY A;  2K7L A;  3A02 A;  4L0Z B;  3R61 A;  1S5L C;  4KNY A;  2IEK A;  1EJ9 A;  4U87 A;  5JHU A;  3ABT A;  4PFP A;  2A68 F;  4PSW A;  3CCL I;  4AYB N;  4DNC A;  4BQA A;  4EJT A;  2QEN A;  3RZD J;  2ZME C;  3F6V A;  2KIQ A;  1GLN A;  3GF2 A;  4AU7 A;  4H0E A;  2NRA C;  1LDD A;  5BPI A;  1ZRD A;  1ACI A;  3DU5 A;  2K9L A;  1FWZ A;  2BW3 B;  1LKX A;  2NNY A;  3VWB A;  3JRH A;  1ZTR A;  3IL2 A;  1RUO A;  3J7Z I;  2IXS A;  4IQJ A;  1JXS A;  2LY1 A;  5LLQ A;  1F1Z A;  2EWN A;  5LHH A;  3VDX A;  4FHT A;  3JCU C;  4D0P A;  2CW8 A;  5ILS A;  1MMD A;  3WOD F;  3WU2 C;  2VON A;  2D5V A;  3M07 A;  4KYW A;  3SEQ A;  1YIJ I;  1DU0 A;  4CYC B;  1OCZ H;  4HZF A;  3MD2 A;  2KKO A;  2VXD A;  3KLN A;  5EZG A;  1N75 A;  3B6A A;  3T8R A;  3R0A A;  4M3D A;  2H8R A;  2MAB A;  3FBN B;  4FX0 A;  4MLO A;  2E35 A;  3KEO A;  2VJI A;  2OC6 A;  2ZFW A;  3FKI J;  1U8R A;  5HLT A;  4AID A;  3L2Q A;  2IA1 A;  3A0H C;  3A01 A;  1QGP A;  3KIO A;  3IKT A;  1N78 A;  4CCO A;  1ULY A;  3J80 Z;  3I53 A;  1KQ9 A;  1FP1 D;  5DTD A;  3OR2 C;  1VQ8 I;  2GQQ A;  4QSH A;  3OYM A;  2HXO A;  4BQN A;  3C18 A;  2E36 A;  2XSJ C;  2BE5 F;  1KON A;  2EFQ A;  1XGM A;  4BY1 J;  2JA6 J;  1D3Y A;  2LP0 A;  2M9H A;  1Z9C A;  1ZLK A;  1SFX A;  2ELK A;  5HOO A;  5E3N A;  4B3A A;  3G1L A;  4FCY A;  1ON1 A;  5H2F C;  1ZLJ A;  4M72 A;  1WJB A;  2CQX A;  3S15 J;  1TC3 C;  4I2O A;  3RQ4 A;  2CFX A;  2OPT A;  5GAE J;  1MNE A;  4ENK A;  1J5Y A;  4HYE A;  2AS5 F;  1AOY A;  1U9O A;  3VPR A;  3WE2 A;  2LG4 A;  4M73 A;  1JT0 A;  3HOW J;  2ZO4 A;  1ZGJ A;  2P7C B;  1RIO H;  5HLI A;  1P92 A;  3JAM K;  2OTL I;  3G1O A;  4PGH A;  2GLO A;  3DPU A;  4XLA A;  2VPR A;  1SMY F;  3WTX C;  2HPM A;  2DT7 B;  2E7X A;  2ESH A;  2L7K A;  3BC8 A;  2Y48 A;  1XMA A;  1KU9 A;  1OKR A;  3V42 A;  4BXX J;  2QKL B;  4HNV A;  2GIZ A;  2VJJ A;  1AWC A;  1PDN C;  1HKS A;  4XSZ F;  4M3E A;  4XRM A;  4U0W A;  4J01 A;  4L9J A;  4G7H F;  5J4V A;  5J8F A;  4E7L A;  4ZYG A;  1TLH B;  3GTG J;  1WI3 A;  1ETY A;  2AHQ A;  2XGX A;  2X6X A;  1GUU A;  4HV5 A;  1YTY A;  2HYF A;  1QZE A;  2CW0 F;  2DT5 A;  1MJB A;  1UEL B;  3K4J A;  2AO9 A;  4UV8 A;  2LMD A;  3OL4 A;  4LFU A;  2VT3 A;  3TKY A;  2IJL A;  1QA6 A;  1Y0U A;  3P9K A;  5DM6 F;  4G6T B;  4WWC A;  4HNU A;  3CD6 I;  1ETX A;  2KL4 A;  3BZK A;  5CQG A;  3FXR A;  4RGR A;  3J7A O;  3FXL A;  2DYS H;  3OYG A;  4HAM A;  2EH3 A;  5TIS C;  2F5V A;  3P9C A;  4XRS G;  3I0T A;  1ZQ3 P;  5GAG J;  3FIS A;  1W5T A;  2EBI A;  2EZL A;  2O7O A;  1ZRC A;  1ORK A;  4B3X A;  1BIB A;  3DLA A;  1IN8 A;  3K6G A;  2H6C A;  1GV2 A;  1RES A;  1SAU A;  3TP0 A;  5LRS A;  4RM3 A;  1EKE A;  1TP4 A;  4XLC A;  2JPB A;  2Y0S N;  1FTT A;  4DW6 A;  3ZQI A;  2FBH A;  3QP6 A;  1OCO H;  2ELH A;  3MEX A;  3S3O A;  3M1C A;  2NS0 A;  4EM1 A;  4PDK A;  2DN0 A;  1R4M B;  1UJ8 A;  5HOD A;  2LKP A;  2MYS A;  2EIL H;  3HG9 A;  2E1C A;  3BG6 A;  2JK3 A;  2M0C A;  1D0X A;  4JX4 A;  3W3C A;  2V6E A;  2EZK A;  1K61 A;  3BRO A;  4MFD A;  4M9S A;  1RNL A;  1HSJ A;  3L2W A;  4UXN A;  4EV0 A;  1RET A;  1Z67 A;  2WC2 A;  3PO3 J;  4A3D J;  4AC0 A;  3RI4 A;  3PNV A;  1L3L A;  3S3N A;  2Q2E B;  3EUH A;  3DKX A;  1O3R A;  3D5S C;  2Q8K A;  4O3M A;  1Z6T A;  3ZMD A;  1TWC J;  5FLX K;  2M1B A;  4QPQ A;  3G73 A;  2BEO A;  4I02 A;  4A6E A;  4LK1 F;  2CH0 A;  1R00 A;  1WJE A;  2X85 A;  3GUD A;  2Y69 H;  2DW4 A;  5HDG A;  1VI0 A;  2QYO A;  5B5E C;  4E70 A;  3QYB A;  4KT6 A;  3GTJ J;  4UB8 C;  2WBM A;  5BPD A;  4MQV A;  4HV6 A;  1LFB A;  3F22 A;  3E0J B;  3PO2 J;  1A6Q A;  3H5N A;  4W97 A;  3JTH A;  3PIO F;  2HVR A;  2IPQ X;  3WG7 H;  4BUP A;  2DA5 A;  1KQ0 A;  2IA0 A;  1IRX A;  5JI6 A;  2L2O A;  2FJ1 A;  4PFO A;  4M3B A;  4A3J J;  2DBB A;  3TMO A;  1IRZ A;  4YIF A;  2OTJ I;  1BL0 A;  2NVY J;  3QRF F;  3H35 A;  3AAF A;  4IOA F;  1IN7 A;  5FFZ A;  3QOE A;  3BPV A;  2LSO A;  3BR2 A;  2QSF X;  5FKO A;  4YEL A;  3DP7 A;  1BW6 A;  1Z77 A;  2DJN A;  4YEJ A;  2JMW A;  3HOV J;  1NHA A;  1WCM J;  3CTA A;  3CF2 A;  4IRG A;  1IRG A;  1IN4 A;  3AG1 H;  4Z6Y A;  2CUZ A;  2V79 A;  3L2R A;  3BOQ A;  2LF8 A;  1BOB A;  5F0C A;  3VYT B;  1P4W A;  2ID3 A;  3I64 A;  3HTS B;  2HQA A;  5EG0 B;  2W85 A;  2UWM A;  3HZJ A;  3R4K A;  1ZG5 A;  4C3I J;  3ZR8 X;  3BR6 A;  1YOV B;  3ZN1 A;  3HJE A;  4E7J A;  1R58 A;  2ECC A;  3CME I;  2B63 J;  3PUF A;  1IUY A;  3G6E I;  3IRQ A;  2Q2E A;  1TWF J;  3E5Q A;  2VUM J;  2RQP A;  5IOZ A;  3LNQ A;  3C2B A;  4LLG F;  5D5X B;  3ERE D;  2DPU A;  3GBG A;  1U9N A;  1XMK A;  2LFB A;  2F4M B;  5E1Z B;  4BJ6 C;  3CLQ A;  1YX5 A;  3OYL A;  1U0J A;  3PFY A;  3KEQ A;  5L3F A;  3SZT A;  5F6F A;  2VBW A;  2E1M C;  4HX4 A;  4E4H A;  1T39 A;  2MLK A;  3BDD A;  4L5I A;  3BY6 A;  2IVM A;  3QYF A;  4KT5 C;  4B48 A;  3GTO J;  1PP8 F;  4IRH A;  3MVP A;  5FFX A;  2MC4 A;  2IGN A;  2H09 A;  4PJL A;  3TP3 A;  4M6V A;  4BHB A;  3D1N I;  3Q5F A;  3FHN A;  3K2Z A;  1KYZ A;  2ZJ2 A;  5ILU A;  2BY0 A;  3NEU A;  3ZMV A;  1TT5 B;  3M1E A;  1VQM I;  3IV5 A;  1G4D A;  2QLZ A;  3OYA A;  3P7N A;  4XOT A;  5FLX Z;  1JUP A;  1I1G A;  1VQO I;  3HSF A;  4XON A;  4NBQ A;  5D8L B;  3QPL A;  1GXQ A;  3U2R A;  5K1Y A;  4A3E J;  4JYK A;  2L7Z A;  2XGE A;  4O5V A;  3GFI A;  1W7P A;  3D0S A;  2DFE A;  2FX0 A;  5AIQ A;  1HW1 A;  2VBZ A;  4RMN A;  1TZL A;  3DLL F;  2DXI A;  1J0R A;  4G94 A;  5K7H A;  4KUM A;  3VOD A;  3M8E A;  2TDX A;  3ABL H;  1K6Y A;  1BIA A;  3DXJ F;  4X1E A;  2CQK A;  3NAR A;  2XAF A;  2QSH X;  2JZY A;  3F8N A;  1HC8 A;  3I4N J;  5GPA A;  3EDP A;  4N4N B;  3KP2 A;  2JUC A;  3TOB A;  5ED4 A;  3HOY J;  2O0Y A;  4XL9 A;  3BCA A;  2QKM B;  4D1Q A;  2E2H J;  4GFB A;  1I5Z A;  2Y2Z A;  3SDG A;  2YU9 J;  3CUQ A;  2K27 A;  2LTP A;  1QRY A;  2F2E A;  4Y4R A;  1XGS A;  1LE8 B;  1R22 A;  4DBQ A;  4LG3 A;  1X1C A;  1BBY A;  3KP3 A;  4C3J J;  2GM4 A;  3VSL A;  4II2 A;  1UHM A;  3J80 K;  2DOE A;  1IRF A;  1PP7 U;  3I71 A;  2CUE A;  2V1N A;  2KHM A;  2G7U A;  3A1Y A;  2A6H F;  3RZO J;  1WJF A;  3RYR A;  5D5V B;  4H4K C;  1W0U A;  4ZDL A;  2ZJQ F;  2KRH A;  5FKM A;  2LDU A;  2L7M P;  2QF7 A;  2X1D A;  3FMQ A;  1QQI A;  1ZAO A;  3FXK A;  1MND A;  2LBF A;  1MNM C;  4NNJ A;  1X4O A;  3P9I A;  3OYK A;  1OYW A;  2I8D A;  2VC1 A;  4E7H A;  4A3I J;  2COM A;  2W7N A;  2BGC A;  1ETK A;  3AL0 B;  3OIQ A;  3KET A;  3T1B A;  4BBR J;  2J5P A;  1YE9 A;  5EEH A;  1YW8 A;  1J09 A;  1G8X A;  1T2K A;  2Z2S B;  2IGO A;  3CJR B;  2V1U A;  1TT0 A;  1MBK A;  1IW7 F;  2BHY A;  5B66 C;  4RDU A;  2JQ7 A;  3J81 Z;  1H89 C;  2UZK A;  2DJI A;  1MKM A;  3KYC B;  1NK3 P;  4A5N A;  2M0M A;  2X0L A;  4M9Z A;  1A6I A;  2BY2 A;  3H5R A;  4PJJ A;  4EQQ A;  1ZR4 A;  3GZ5 A;  1J2X A;  1VQ6 I;  1WSU A;  2K5C A;  1I27 A;  3K69 A;  3MKW B;  3S16 J;  3KFW X;  1RZ4 A;  2E7W A;  1NTC A;  3SEZ A;  3CQZ J;  4BDY A;  2KP6 A;  1SVM A;  3PSI A;  1BC8 C;  3I5U A;  3K4N A;  2V9P A;  4UUS A;  4ETS A;  1W4M A;  3VYR B;  2HDC A;  1V5G A;  4UVB A;  3F6O A;  2I10 A;  3W2W A;  4CCK A;  1SEU A;  4QLC U;  2D1H A;  3OWT A;  3REO A;  2HQR A;  2HYJ A;  3WG9 A;  3CJT B;  3HRM A;  1K7A A;  2EB7 A;  1JKR C;  2R4G A;  3G1M A;  3GW2 A;  1R5I D;  3CJQ B;  3PM1 A;  3I3L A;  1T6S A;  1V55 H;  1FBQ A;  4BGD A;  1FP2 A;  2ZJP F;  2DMQ A;  2JA8 J;  3CCJ I;  3FWE A;  1S3J A;  2W00 A;  2AXL A;  1DGR M;  1JTX A;  4KA4 A;  1GT0 C;  2XGC A;  4IX7 A;  4Q4Z F;  1MGT A;  4PJ0 C;  3GX4 X;  4NB5 A;  5H6Q A;  4BJT A;  2BXZ A;  2STW A;  1MMN A;  2CU7 A;  2M4G A;  1ZN2 A;  3LOC A;  4XLH A;  4ZDO A;  1IAW A;  1EF4 A;  3HXL A;  2A3S A;  2JRT A;  3LL7 A;  1HA8 A;  4HX8 A;  4IVN A;  3ESW B;  5FKN A;  1FTZ A;  2G0E A;  2EV6 A;  2GAU A;  2K3P A;  2MH2 A;  4CXF A;  4B8X A;  3M8J A;  4F7Z A;  3KLO A;  1MMG A;  1WPK A;  3HPG A;  3E1S A;  3JRA A;  1G6N A;  1XX5 A;  2YPR A;  3UKG A;  2H27 A;  1R49 A;  2HS5 A;  3L7W A;  3RKQ A;  2P5L C;  3WTS C;  4P9U A;  3E7L A;  1R7J A;  2P81 A;  4BE0 A;  2XRL A;  5J6X A;  2PLY A;  3CCY A;  1AA7 A;  4II3 A;  2I5U A;  2HEO A;  2QQ8 A;  2ZKZ A;  3OOP A;  1ZGW A;  1BR2 A;  2F5C A;  4I99 C;  5BOX A;  1E3H A;  4AVZ A;  4MTD A;  1ONV A;  1OYY A;  1R5G A;  2K85 A;  1KGS A;  5IT9 K;  1T98 A;  2IRF G;  2KZV A;  4KMU X;  3ML6 A;  1F4K A;  1FT9 A;  4R1H A;  3OYN A;  4KJZ A;  1W7P B;  3ZPL A;  2V6C A;  4YII A;  2Q0O A;  1A36 A;  1HOM A;  1EV7 A;  2E34 A;  4XBF A;  1J59 A;  1GXP A;  3BR3 A;  2VL8 A;  1QZY A;  2EFO A;  3S2D J;  3OIO A;  4GYI A;  2BXY A;  3CDI A;  1KU7 A;  4BQO A;  2K4B A;  3FM3 A;  1E3O C;  2FMY A;  4BHP A;  2FOW A;  2MA3 A;  3IH4 A;  2CMP A;  2KZG A;  5DD4 A;  1HKT A;  1QBJ A;  3H1C A;  2W1O A;  3K4L A;  2QQB A;  3K4M A;  3SZP A;  1RRJ A;  4ANJ A;  2XGD A;  3CP2 A;  2VXZ A;  4I0B A;  5EEG A;  1SMT A;  2LY9 A;  2R7Q A;  5M5W J;  1OPC A;  1UMQ A;  3ABM H;  3CUQ B;  2DMP A;  5DYM A;  2W24 A;  3TQN A;  1FZP B;  4I0A A;  2JRM A;  4A93 J;  3HSR A;  2BW3 A;  2PG4 A;  2E1M B;  1TNT A;  3F8C A;  3OIP A;  4C30 A;  3BG7 A;  2R7D A;  5CVU A;  3IC7 A;  3GVA A;  3UNG C;  4EJW A;  1YIT I;  2DA1 A;  1VQN I;  4MO7 A;  2VJ4 A;  4MQ9 F;  4CYD A;  4KIG A;  4FX4 A;  3S1Q J;  4EEF G;  2DLL A;  1G2H A;  2FXA A;  1RUN A;  3V8J A;  1MMS A;  5JLW A;  2ELJ A;  4EM0 B;  2EIM H;  5JFR A;  3KYL A;  4UUV A;  4S05 A;  2HDD A;  2PMU A;  2L54 A;  3LQQ A;  3RQI A;  4AWX B;  2X1C A;  1DPU A;  1D5Y A;  2BVM A;  1FBU A;  1HF0 A;  4LG0 B;  1EH7 A;  1Z0X A;  2OJE D;  2O03 A;  3K10 A;  4OIO F;  3K2A A;  3SZG A;  2P7V B;  3LMM A;  2KIF A;  4RB3 C;  3M4O J;  3I4M J;  1WJA A;  3DF8 A;  2E19 A;  4IQ4 A;  1QZZ A;  4IHX A;  3PUB A;  1HBX G;  3DKW A;  3KP6 A;  1TNS A;  1X19 A;  4NHJ A;  3LFU A;  1LDJ A;  2MW8 A;  1JHF A;  2DMN A;  3CCS I;  3H0G J;  3CC2 I;  4JP0 A;  3Q9V A;  1IXR C;  1YHQ I;  2Y9Y A;  3SYT A;  3P5J A;  2A5W A;  1VQ5 I;  4ABZ A;  4BU2 A;  1MBE A;  3OMY A;  3CCV I;  1UG2 A;  4DJA A;  3DEW A;  3SFI A;  1GDT A;  3FK6 A;  3DQV C;  2KDO A;  1N77 A;  1LEB A;  2V7F A;  5CYV A;  4BE2 A;  2KDZ A;  1QU3 A;  2FEZ A;  2V4J C;  3DWL E;  4EJU A;  2R7R A;  2R7V A;  1R1T A;  2BVL A;  1Y8R B;  4J00 A;  4XKC A;  5HDN A;  1FSE A;  4M71 A;  5L3D A;  2F5D A;  3DV8 A;  3K70 D;  3KEY A;  1S6L A;  2YX7 A;  5HVQ C;  2NVX J;  2ZC2 A;  3FX3 A;  3G2B A;  4DYQ A;  1MD0 A;  1UG0 A;  3HBL A;  3AL0 C;  4RGS A;  5K5R A;  1B6A A;  3JSO A;  4HNT A;  3ZQQ A;  1ETO A;  2ETH A;  4XM3 A;  4F3Q A;  4M6Y A;  2L9V A;  4XLN F;  1O3T A;  1R1U A;  2PJP A;  3DTI A;  4NDL A;  1H8A C;  3IUO A;  3MZ8 A;  5IP7 J;  1X1A A;  4Y15 A;  1VQ4 I;  2N8G A;  1WVR A;  3RCO A;  4LIT A;  5KK1 A;  4BEH A;  4XRF A;  4LJZ F;  1R36 A;  2V1D A;  4RLQ A;  1LEA A;  2F5E A;  3HRT A;  2E5N A;  4UHT A;  3F8F A;  3M3Y J;  4IHW A;  1X4P A;  4XID A;  1V5F A;  1ZEL A;  1O3Q A;  1OCP A;  2AQE A;  4ITV A;  4LD5 A;  4IKF A;  3N97 A;  1WJC A;  3KZY A;  4MEY F;  2XUB A;  1P2F A;  5E1W A;  4IOC F;  1T8I A;  1U3E M;  2CSO A;  2M8G X;  4XK4 A;  3HM5 A;  1A5J A;  3ISP A;  5GTH C;  1FEX A;  2ECB A;  4LIU A;  5LGN A;  2LKS A;  2O3F A;  3PNT A;  2YS9 A;  2PI0 A;  3ZN0 A;  5C4J J;  3QP5 A;  4XOR A;  3NWS A;  2KQR A;  2XF7 A;  2GBY A;  2MLG A;  3PIP F;  2XHK A;  3BTI A;  3K9T A;  1Y1V J;  2HKX A;  2DFI A;  3H9Q A;  3PL8 A;  2KPM A;  2M87 A;  1Z91 A;  3IHU A;  5ILV A;  3L2V A;  2HXI A;  2CV1 A;  1QPI A;  5F1R A;  3GYH X;  5FLM J;  5KVR A;  5J47 A;  2E60 A;  5E8G A;  3T0Y A;  3WTV C;  3DTE A;  3LSR A;  1VQK I;  2PJR B;  3MKY B;  4XN3 A;  1ZR2 A;  3S93 A;  2EFW A;  1W36 C;  1D0Y A;  1W5C C;  1Z7U A;  2A61 A;  3PSF A;  1AU7 A;  1U5T B;  2MG4 A;  3FBI B;  2HGC A;  3U1D A;  4Y33 A;  5D4R A;  2HOE A;  3IP4 B;  3OL3 A;  1GHC A;  2RKH A;  3ZCO A;  5CPR B;  3HUG B;  4I98 B;  4RLF A;  2JA7 J;  2EZH A;  1X2N A;  4OMZ A;  1UCR A;  1MSF C;  3H92 A;  4A3K J;  2TCT A;  4D5F A;  3IWF A;  1XDU A;  2MC3 A;  4QWQ A;  2R0Q C;  4Z2Y A;  3RKW A;  5HNH A;  1G3T A;  2HOA A;  3K1N A;  4FT8 A;  3WTW C;  3MMY B;  4WXD A;  1JKQ C;  4DYR A;  1YS6 A;  1SC7 A;  1HXD A;  2W84 A;  2OD5 A;  3MZY A;  4B43 A;  4L9T A;  1F43 A;  3MCZ A;  4I01 A;  4M74 A;  5LGU A;  1RI7 A;  2XDV A;  4IL6 C;  4LB5 A;  4ESB A;  1VF9 A;  2WV1 A;  2Z99 A;  2HVS A;  5LD2 C;  4DZP A;  3K4K A;  1IJW C;  2VI6 A;  3C1D A;  2STT A;  1HKQ A;  2L9S A;  3LA7 A;  4FET A;  5J3L A;  2XRN A;  4XLE A;  4S0H B;  5GAD J;  2DQL A;  2PJR A;  2A07 F;  4M3G A;  2GXA A;  4HF1 A;  2M7B A;  4UVC A;  3GTQ J;  3CUQ C;  1A35 A;  1DUX C;  3C2H A;  4U7D A;  2NVT J;  2W25 A;  2E2I J;  4NC8 A;  3HOZ J;  3L9F A;  3ZQF A;  1JUM A;  5DDG A;  2GXB A;  3WGH A;  5J1R A;  1JKO C;  2CQQ A;  1Z6R A;  2NOJ B;  1YRN B;  2XRO A;  4BAC A;  1SFU A;  2CYY A;  2Y0M A;  4XR6 A;  5TGT A;  2ZJR F;  3X2Q H;  1MMA A;  2BBY A;  2YX4 A;  4KIF A;  2HTJ A;  3S1N J;  3HDD A;  2QBY B;  2DFH A;  2ID6 A;  2ZNZ A;  4BNC A;  2ISZ A;  1ERD A;  2A6E F;  4U0Y A;  5EF6 A;  5L3G A;  2XPV A;  2CW7 A;  2XAU A;  4BJ5 C;  4OU0 A;  1J7K A;  2UV1 A;  4XQF A;  3IKV A;  4HQE A;  2K02 A;  4ENN A;  1RR7 A;  1UHW A;  2O6G E;  1R23 A;  4JX5 A;  4FQG A;  2LNB A;  2VQL A;  3Q9S A;  4BKX A;  3GWZ A;  2CJJ A;  1LVA A;  3GEZ A;  1HCR A;  2H1K A;  5KAF C;  2FRH A;  2PN6 A;  3EYI A;  3CP8 A;  1PJR A;  1R9T J;  2X9D A;  1YQA A;  1NG6 A;  5KNL A;  4GYG A;  2W4S A;  4A69 C;  4UNO A;  3O3K A;  2OU2 A;  1IV6 A;  2IAI A;  1G59 A;  1DU6 A;  3QQA A;  1E17 A;  1K83 J;  2HQ5 A;  2DT6 A;  4HRI A;  2FA5 A;  2R7F A;  3H5A A;  3KP4 A;  4L5J A;  3OSF A;  1B1B A;  5F0F A;  5EJC A;  3ZMZ A;  2DK5 A;  3CUO A;  4BE1 A;  4GGG A;  4X6A J;  4P96 A;  1SD4 A;  3FXU A;  3TO6 A;  5FRN A;  5C3E J;  2EV5 A;  2QCO A;  3WTT C;  1HST A;  2QQ9 A;  1XGO A;  4CCL A;  4CCJ A;  3JAM Z;  3A2K A;  1WKM A;  2HFH A;  3S32 A;  3HUG A;  4V19 K;  2P4W A;  1XMX A;  1I6X A;  3GFL A;  2YSR A;  2R7T A;  5D5W B;  2R7X A;  4B09 A;  5E17 F;  4I76 A;  2JA2 A;  1P4X A;  2NXN B;  1V3F A;  3ZOB A;  5J4Y A;  4RS8 A;  2HI3 A;  3W2A A;  2K40 A;  4PZJ A;  4Q47 A;  2WAE A;  3BT9 A;  4BQQ A;  4ZTJ A;  5DCM B;  4HLY A;  2RRE A;  5DCF A;  1D8J A;  2VQH A;  4B4C A;  5BMZ A;  1RC9 A;  2X6Y A;  1XD7 A;  2L4M A;  5KAI C;  2VLA A;  2X4H A;  1E0E A;  5DUI A;  1YO5 C;  3KE2 A;  5JHF A;  3MZH A;  1K78 A;  2VAS A;  2ZXH A;  2QA4 I;  4HBL A;  3ZGK A;  3RDI A;  1P6R A;  4A3C J;  3QU6 A;  4KIT B;  1FNN A;  3FHZ A;  2WWY A;  1NG7 A;  1XDS A;  1JGG A;  3ZQH A;  2KT0 A;  4DZJ A;  2L9R A;  2BV6 A;  2K3F A;  3Q0W A;  1MW7 A;  3TDZ C;  4AD9 A;  5DD8 A;  2EFP A;  3HEF A;  4IF4 A;  5IPA A;  5IY5 H;  3L2U A;  3HYI A;  1PUF B;  2L9N A;  3OOU A;  3R60 A;  4RGX A;  1H0M A;  1APL C;  3S1M J;  3VSK A;  2QQA A;  5KCM A;  1TQM A;  3GTP J;  1S9H A;  2HPI A;  2CQ7 A;  3D5L A;  4A0Z A;  4C2U A;  4C9Y A;  1X3Z B;  1YFH A;  9ANT A;  2L01 A;  2RC4 A;  4EGZ A;  5M5X J;  2PMZ A;  2FQ4 A;  1Z3X A;  4BEH B;  1X3U A;  1YX3 A;  5K5Q A;  2JTV A;  4N9I A;  2CGP A;  1FX7 A;  4A3M J;  5GAH J;  2FSW A;  2GA2 A;  1OYI A;  5E20 A;  1ETV A;  2JA5 J;  3CO6 C;  4IHY A;  3MWM A;  5JVT A;  4GRI A;  1D1A A;  2OCE A;  3WU0 A;  3I59 B;  4A3B J;  4PUS A;  2DTR A;  2MGQ A;  1XPX A;  2RDP A;  5FJ8 J;  3IRR A;  1C0W A;  1BC7 C;  4A0Y A;  2EA4 A;  2K9Q A;  1CF7 B;  1CGP A;  4CGZ A;  2HU9 A;  4OMY A;  1KU3 A;  3BQZ A;  2M4K A;  2D1V A;  4IRI A;  1FLI A;  4XKV A;  4U88 A;  2ZNY A;  1XC5 A;  2ZME A;  4XSX F;  4GCV A;  4DQ2 A;  3E3V A;  1B72 B;  1JGS A;  3EPZ A;  3HHH A;  2L3D A;  5H20 A;  2XC7 A;  3BP8 A;  1LDK B;  4UY8 I;  1ITY A;  1WI9 A;  4D7M A;  1ETQ A;  5IYB J;  4KIS A;  2M5W A;  4EAT A;  3H0D A;  1J75 A;  3SFZ A;  1H88 C;  1JUS A;  4HEA 2;  2IGK A;  2DI3 A;  3LSK A;  2PMZ N;  3EUH C;  2HNH A;  2BOL A;  1FY7 A;  3HSE A;  3VFZ A;  5M5Y J;  1YIO A;  2DTZ A;  1FBS A;  3G71 I;  4EVI A;  3T5X A;  1X2M A;  5HNF A;  2RNJ A;  5AON A;  1XCB A;  4YFX F;  5IYC J;  4KMF A;  1OMI A;  3TED A;  3R0J A;  3HRS A;  2HZT A;  4B47 A;  2R7U A;  1FPQ A;  2VT2 A;  3JRF A;  4L9V A;  3ERM A;  3QWL A;  4LB6 B;  3HIF A;  1K6O A;  3A03 A;  2GOM A;  4CHU A;  3M8F A;  3VEP A;  4Y13 A;  5HLH A;  4XLF A;  1TWA J;  2L5Q A;  5LEK A;  1PUE E;  5E3M A;  1XB4 A;  1WRJ A;  5B3S H;  5D4S A;  2EIK H;  1TBX A;  2RQQ A;  3LSG A;  2CWE A;  3DBH B;  5IOY A;  2WV0 A;  1MSE C;  2R7S A;  1W7P D;  2E1O A;  4HF0 A;  4P5O A;  3E6D A;  3R6S A;  4U7B A;  2FU4 A;  5CLS A;  2GIV A;  4HF2 A;  4KFC A;  2DU9 A;  2PMH A;  3WGG A;  3B02 A;  1BR1 A;  4MHG A;  3L2C A;  4CCN A;  2KRF A;  3CC4 I;  2NYX A;  1I3Q J;  1MJA A;  2M7A A;  1EH6 A;  3HOT A;  5E79 C;  3CDL A;  5FGM A;  1OR7 C;  4YFN F;  2DA3 A;  2O8X A;  2M3A A;  4ZZL A;  4R79 A;  3ZMU A;  5A2Q Z;  3V7S A;  1IDY A;  3FXJ A;  4KIB A;  2DOF A;  2KIM A;  2KMU A;  3AFH A;  5FO5 A;  4AUX A;  3OSG A;  5CVJ A;  2RN7 A;  3GZN B;  4CYC A;  5LGT A;  1O4X A;  5DUK A;  3U9G A;  3B73 A;  4ZTF A;  5JVG F;  2IT0 A;  2XPW A;  3BQY A;  5LEJ A;  3PJR A;  4I7H A;  3ZQC A;  3K7A J;  2VN2 A;  1J9I A;  2V9V A;  5E8I A;  2XPU A;  2NVU B;  2QUF A;  2LY2 A;  4G6Q A;  4OWR B;  1QHG A;  3QYE A;  1I6H J;  1S7O A;  2NNN A;  1UST A;  2FOK A;  4P1W A;  1G3Y A;  4RBO A;  3ABU A;  4FAS D;  2W82 A;  4CZC A;  1QO0 D;  2K86 A;  1YYV A;  2UXN A;  2XB0 X;  4YIR X;  3GFJ A;  1I39 A;  3KPH A;  1ZKG A;  2RV8 A;  1LUJ B;  2XKO A;  3LST A;  1SD7 A;  1R71 A;  4FIS A;  4A2U A;  1ZAR A;  1U78 A;  1NH3 A;  2LOO A;  3GME A;  2L7F P;  1BI2 A;  2H6B A;  2F4I A;  1HW5 A;  2XIG A;  3RSN A;  3FXO A;  3KP7 A;  3WTU C;  1JHH A;  1P9Q C;  4IHV A;  2JSC A;  5C4X J;  4E7K A;  5EG0 A;  4DGW B;  1OJL A;  1IV8 A;  3H9G A;  1V54 H;  5F27 A;  3ZMT A;  5IP9 J;  3E6C C;  2ESN A;  2DPD A;  2B0L A;  3PQJ A;  5GTI C;  2Y0S A;  4RB1 A;  1MH4 A;  3GTM J;  3MFK A;  1T56 A;  1WQ2 A;  5E1X A;  4LK0 F;  3ASN H;  3LSH A;  3FXQ A;  3NAU A;  2LK2 A;  4XIC A;  1UB9 A;  2Y75 A;  3U1K A;  4BS9 A;  2KLO A;  5JR3 A;  4G6D A;  2GWR A;  3BJO A;  3SXY A;  2VE9 A;  3WTY C;  2RNG A;  2WAF A;  3I4P A;  2XV4 S;  2R7O A;  3MKZ A;  4Q48 A;  2LKX A;  3CCR I;  1HLV A;  1SD5 A;  2OA4 A;  2NS8 A;  3O8G A;  1FOK A;  3BWG A;  3FIW A;  2ICW G;  4EJV A;  1YJW I;  3OYE A;  2VKH A;  2LYC A;  1IN5 A;  2VOO A;  4ENJ A;  2EA2 A;  3H3Z A;  4DIQ A;  2VQC A;  2UUZ A;  1N25 A;  5F08 A;  2KFD A;  5D5U B;  3JRD A;  3HTU A;  3ZQG A;  4KN7 X;  2MD5 A;  4ZH4 F;  4G7Z F;  3QOD A;  5L3C A;  4UUT A;  3JRB A;  2OZU A;  3OR1 C;  3PNY A;  4A3L J;  1UFM A;  4GO1 A;  4CIC A;  4EM2 A;  4WCG A;  1YG2 A;  1ODD A;  2D2W A;  1ZHF A;  2HR3 A;  3BZC A;  1PUF A;  1YRN A;  1Z05 A;  2L02 A;  2JN6 A;  2X51 A;  4Y7N J;  1B9M A;  2OQR A;  4E7S A;  4NUB A;  1SVO A;  1BOA A;  2HDW A;  3JR9 A;  1LVK A;  3BLY A;  5FD5 A;  2PEX A;  3CO7 C;  2P6S A;  2V26 A;  4AYB A;  3CCE I;  1MDM A;  1LE8 A;  1U6G A;  4ASN A;  4D9J A;  4MNU A;  1S29 A;  2FUG 2;  3HOX J;  2PBI A;  4EMS A;  1AHD P;  3DEU A;  1VQP I;  5GPC A;  3HOU J;  3KX2 A;  1SAX A;  3Q0U A;  3FK7 A;  1ZK8 A;  1RPW A;  3CLO A;  4BYY A;  3WGI A;  1OQY A;  1Q1V A;  4MGR A;  3RIR A;  4EJO A;  4WXH A;  1MBF A;  1M1E B;  5L3E A;  2P5K A;  4HQM A;  4HLX A;  2VOP A;  1FOX A;  4YG2 F;  2W57 A;  2L0K A;  5AIP A;  2CO5 A;  3H3U A;  2ME0 A;  2OQG A;  3DBR B;  3TOA A;  5CJ9 A;  2FNA A;  4IXA A;  3QOP A;  4F93 B;  2O9L A;  2EQR A;  2JVG A;  4UUS B;  3RJP A;  2LR8 A;  1Z21 A;  1GVJ A;  1UZC A;  4JX6 A;  4I6Z A;  2HZD A;  2NAZ A;  3S1R J;  5BNG A;  1KA8 A;  2VE8 A;  2F5F A;  1REP C;  3F8B A;  3VYU B;  2OCC H;  1U2W A;  4HPQ A;  4IJA A;  4YFK F;  4MFE A;  3GTK J;  1D1B A;  1R6R A;  2HOS A;  5E3L A;  4ZDP A;  3OYC A;  4V2G A;  3DTK A;  3SDB A;  1LFU P;  1RKW A;  3TGN A;  4OIN F;  4EGY A;  2VQG A;  3BJ6 A;  4OAY A;  3MAJ A;  1A04 A;  1U5T A;  1X58 A;  1X1P A;  3DBL B;  2XF5 A;  4PJM A;  5FRM A;  1T08 B;  2RVC A;  3F8M A;  4OAZ A;  4HA8 A;  5IT9 Z;  4QTR A;  2WA0 A;  4RAG A;  3I54 A;  4IO9 F;  1FYL A;  3GXO A;  3VYS B;  2ADU A;  1S7A A;  1Z3Y A;  2DDB A;  4B44 A;  2QEX I;  4NQW A;  2VC0 A;  3TO7 A;  4K2E A;  1NK2 P;  1E2X A;  4OOI A;  1D1C A;  2HKO A;  3J7A Y;  2YUS A;  2P8T A;  2XF6 A;  1A31 A;  4PJN A;  3M7G A;  2XSD C;  1BW5 A;  2XKP A;  5ICG A;  4BXU A;  3CCU I;  2OBP A;  4A3G J;  3CES A;  3CMY A;  4HX7 A;  2JT1 A;  2YU3 A;  4MIM A;  2R5Y A;  2NVQ J;  3TDU C;  3G4S I;  2DFF A;  4CDG A;  5LBQ A;  3JRI A;  5FKL A;  4W1U A;  2QSG X;  3RTR A;  1W1W E;  1FIP A;  2X6O A;  3AG2 H;  1XSX A;  3OYH A;  3KZI C;  3LQR A;  5EYR A;  1GV5 A;  3O8H A;  3OS2 A;  5TRD A;  1DP7 P;  2CUJ A;  1BI3 A;  2A5Y B;  1BJZ A;  3CDH A;  2EZI A;  3BR1 A;  4ESF A;  3OY9 A;  3CJN A;  4XKB A;  3F0C A;  5EZH A;  1PVE A;  2FBI A;  5HDK A;  1WFX A;  3A0B C;  2R7W A;  4BAY A;  3HKZ A;  2F4O B;  5FB2 A;  5J1Y A;  5EGO A;  4XKW A;  3ZQ7 A;  1MIJ A;  3F23 A;  1LB2 A;  3SHF A;  3RKX A;  4QPO A;  1Y39 A;  4XN0 A;  5ICC A;  2BHZ A;  1FMW A;  1VFC A;  3ZRG A;  1X3W B;  3V7C A;  4AM3 A;  2VPL A;  1H9G A;  4V2F A;  4F52 A;  3K0L A;  4RAZ A;  2Z1D A;  3S2W A;  5FRO A;  2B7E A;  3BPX A;  1QHH D;  1FC3 A;  4FE4 A;  1IGN A;  4J19 A;  4RA2 A;  1ZYR F;  2H1L A;  3JRG A;  2FNP A;  3ZQL A;  4PGG A;  5F64 A;  1LQ1 A;  4XMY A;  2IP2 A;  4BXF A;  1WH5 A;  3BCB A;  1JJ6 C;  1X1B A;  3OYF A;  1FYK A;  2CRG A;  3TW7 A;  4ZYD A;  2FE3 A;  3EUK L;  3DCF A;  1HW2 A;  2DA2 A;  4OIR F;  1L0O C;  3LSI A;  3GO5 A;  2CG4 A;  4FE7 A;  1GVD A;  1KZH A;  3S14 J;  1TWH J;  2JSP A;  2VIX A;  2LVS A;  1WWX A;  3K70 C;  2ZCW A;  1B8I A;  4A3F J;  2LH9 A;  3FF5 A;  2JUG A;  5CKT A;  5K7Z A;  2QM3 A;  3CZ6 A;  3BG3 A;  2W48 A;  1KQ8 A;  2GZW A;  5LHI A;  4M9X A;  3V8L A;  3TW6 A;  3LSM A;  2LBF B;  4XNF A;  3GTL J;  4BH9 A;  1B4A A;  1ON2 A;  5DCM A;  3S3M A;  3ECO A;  2MH9 A;  3WHB A;  5DS9 A;  4F92 B;  1IC8 A;  1VQ9 I;  5M3F J;  2KIU A;  4N9H A;  3UR3 C;  5KHD A;  3RPQ A;  2LC2 A;  3SJM A;  2OZ6 A;  3RPU D;  3F3X A;  1ENH A;  2ACJ A;  2OAZ A;  1WJ5 A;  2A6T A;  2IGM A;  2K9N A;  1P4A A;  2XB5 A;  3LA2 A;  2DMT A;  1OR7 A;  3G3Z A;  3OYB A;  3E97 A; 
#chains in the Genus database with same CATH homology
 2HQN A;  4HDU A;  3HRU A;  1H9T A;  2HYG D;  3NQO A;  1JE8 A;  1CF7 A;  1BM9 A;  3JTG A;  3W6K B;  2BYV E;  2RGV A;  4I09 A;  1EH8 A;  1BI0 A;  5BQT A;  4KN4 X;  3QU3 A;  1XSD A;  3RYP A;  3EET A;  1XSV A;  4AIK A;  1TQP A;  2IW5 A;  1LJ9 A;  3MQ0 A;  4ESJ A;  4UVA A;  3W6J B;  1IXC A;  1MDM B;  2FQ3 A;  4U0V A;  2FML A;  2QBY A;  1IXS B;  2DAO A;  2IA2 A;  4JQF A;  2EFN A;  1Q1H A;  1S8N A;  3SQN A;  3QPT A;  5DV5 A;  3T8T A;  1XGN A;  2EK5 A;  2QWW A;  2ZBK A;  4HOB A;  2XAQ A;  3FZV A;  4G7O F;  3LAJ A;  1V4R A;  2JPC A;  2XAJ A;  2P6T A;  2C6Y A;  2Z9O A;  4A6D A;  3FMS A;  3DPT A;  4S04 A;  3LA3 A;  3COA C;  1SFE A;  3EYY A;  1D8K A;  1IF1 A;  5K5O A;  4XLP F;  4MTE A;  3N4M A;  3KZZ A;  3GZ6 A;  4A5M A;  4A0X A;  1D5V A;  4LMY A;  2HTS A;  2GA1 A;  1HQC A;  4P9F A;  4RAY A;  1YW7 A;  1YLF A;  4L9N A;  3HOS A;  3E6M A;  4TV7 A;  1BN5 A;  5ERI A;  2VBY A;  3F72 A;  1O57 A;  4LLN A;  4CO8 A;  2M45 A;  1O3S A;  1YS7 A;  3I58 A;  2P5V A;  2A69 F;  5HS8 A;  3FM5 A;  1K78 B;  5HS7 A;  1QPM A;  5CVR A;  3FMR A;  4WX9 A;  4AIJ A;  3VOE A;  5J8C A;  2Z5U A;  3ELK A;  4P55 A;  2GXG A;  5A2Q K;  4OIP F;  3KCC A;  2L4A A;  2ZXJ A;  5CVI A;  4KIC A;  2G9W A;  2J5O A;  4LG0 A;  1O7F A;  4R8H A;  3L09 A;  4ZYH A;  3JW4 A;  4AIH A;  5LHG A;  3RPU A;  5TJJ A;  3DPL C;  2EV0 A;  5IT3 A;  3EQL F;  3NRV A;  1U5T C;  2V1X A;  2HWV A;  2D45 A;  3TO9 A;  3LWF A;  3KP5 A;  3I59 A;  3RKY A;  4Y17 A;  2VOD A;  4HW0 A;  4RB2 C;  1FSH A;  1BJA A;  6PAX A;  2XVC A;  5HS9 A;  3LFK A;  4Q5S F;  1T38 A;  3ULQ B;  3ZMS A;  2KJC A;  1BI1 A;  3L00 A;  3C7J A;  3ZP5 A;  3V7R A;  4BHC A;  1MJ9 A;  4N0B A;  1LNW A;  4CZZ A;  1ZG1 A;  4GXO A;  4ZYE A;  2FBK A;  1IZ1 A;  3JSP A;  3WE3 A;  2XAH A;  5BS6 A;  3O6B B;  4M6X A;  2FF4 A;  1ZRE A;  5ICE A;  1ZGA A;  2DO7 A;  2R3S A;  2PQ8 A;  3E5X A;  2VBX A;  1TW2 A;  1I1S A;  4JK1 X;  3E5U A;  5H6R A;  4ON0 A;  1R5H A;  3QPH A;  1ZG3 A;  3M9A A;  2UXX A;  2PFB A;  1STZ A;  4WK8 F;  2XAS A;  3VB2 A;  5D6F A;  5D8K B;  3PFI A;  2LF7 A;  3WU1 B;  3LAP A;  4LGW A;  2QZ8 A;  3V4G A;  3GFM A;  1KYW A;  1ZH5 A;  4IPA A;  1IN6 A;  4IHT A;  1DPR A;  4L0Y B;  1QNT A;  1K79 A;  4L18 B;  3J81 K;  3IWZ A;  3PQK A;  1TQI A;  4PCQ A;  4O6J A;  2G7H A;  2XAG A;  3V8K A;  4ZZD A;  1G3W A;  5FD6 A;  1ZRF A;  5LRR A;  5L3B A;  3GLX A;  1VTN C;  3K1M A;  2E1N A;  1Z1D A;  1F5T A;  1B59 A;  1YW9 A;  1O7L A;  2H94 A;  4JBA A;  4RGU A;  4LLL A;  5ICF A;  1MZB A;  3HHG A;  4AVP A;  4G8X A;  2Z33 A;  2ZME B;  5DEQ A;  5CVV A;  2K4J A;  1DDN A;  2YR2 A;  1R1V A;  3E6B A;  4KDP A;  4IHS A;  2MBF A;  1XN7 A;  1USS A;  2Z3Y A;  4OIQ F;  2WTE A;  2O61 A;  4HDV A;  3K1P A;  4MEX F;  3ROU A;  3O2P E;  3QAH A;  4G9Y A;  2DK8 A;  4WF2 A;  1F9N A;  2EJR A;  3DFG A;  2M8E A;  2QVO A;  3ECH A;  2M30 A;  3BZ6 A;  3OV8 A;  1SD6 A;  5E18 F;  5D6E A;  5HLG A;  4A12 A;  3C3W A;  1T0F A;  1FYM A;  1B9N A;  2DQR A;  4UV9 A;  3BJA A;  2KJB A;  4WXC A;  1TW3 A;  3WTZ A;  4ENM A;  1W5S A;  1G3S A;  1XCV A;  1KU2 A;  4RB0 A;  3F21 A;  2ISY A;  1TTY A;  2K7L A;  4L0Z B;  3R61 A;  4KNY A;  5JHU A;  3ABT A;  2A68 F;  4DNC A;  4BQA A;  4EJT A;  2QEN A;  3F6V A;  3GF2 A;  4H0E A;  2NRA C;  1LDD A;  5BPI A;  1ZRD A;  1FWZ A;  2NNY A;  3IL2 A;  1RUO A;  1JXS A;  5LLQ A;  1F1Z A;  2EWN A;  5LHH A;  4FHT A;  4D0P A;  5ILS A;  3WOD F;  2VON A;  4KYW A;  4HZF A;  2KKO A;  3T8R A;  3KLN A;  3R0A A;  4FX0 A;  3KEO A;  2ZFW A;  1U8R A;  2IA1 A;  1QGP A;  3IKT A;  1ULY A;  3J80 Z;  3I53 A;  1KQ9 A;  1FP1 D;  2GQQ A;  3C18 A;  2BE5 F;  2EFQ A;  1XGM A;  1D3Y A;  1Z9C A;  1ZLK A;  1SFX A;  5HOO A;  1ON1 A;  1ZLJ A;  4M72 A;  4I2O A;  2CFX A;  4ENK A;  1J5Y A;  4HYE A;  2AS5 F;  1AOY A;  3WE2 A;  4M73 A;  2ZO4 A;  1ZGJ A;  2P7C B;  1RIO H;  5HLI A;  1P92 A;  3JAM K;  4PGH A;  1SMY F;  3WTX C;  2E7X A;  2ESH A;  2Y48 A;  1XMA A;  1KU9 A;  1OKR A;  1AWC A;  1PDN C;  1HKS A;  4XSZ F;  4U0W A;  4L9J A;  4G7H F;  5J8F A;  4ZYG A;  1TLH B;  2XGX A;  4HV5 A;  1YTY A;  2HYF A;  2CW0 F;  2DT5 A;  1MJB A;  4UV8 A;  4LFU A;  2VT3 A;  3TKY A;  2IJL A;  1Y0U A;  3P9K A;  4WWC A;  3FXR A;  4RGR A;  3J7A O;  4HAM A;  3P9C A;  3I0T A;  1W5T A;  1ZRC A;  1BIB A;  1IN8 A;  2H6C A;  5LRS A;  2JPB A;  2FBH A;  3QP6 A;  2ELH A;  3MEX A;  2NS0 A;  4EM1 A;  4PDK A;  2LKP A;  2E1C A;  3BRO A;  4M9S A;  1RNL A;  1HSJ A;  4UXN A;  4EV0 A;  2WC2 A;  3RI4 A;  1L3L A;  3EUH A;  1O3R A;  2Q8K A;  4O3M A;  1Z6T A;  3ZMD A;  5FLX K;  2M1B A;  3G73 A;  2BEO A;  4I02 A;  4A6E A;  4LK1 F;  1R00 A;  3GUD A;  2DW4 A;  5HDG A;  2QYO A;  4E70 A;  5BPD A;  4MQV A;  4HV6 A;  3F22 A;  3JTH A;  2IPQ X;  1KQ0 A;  2IA0 A;  5JI6 A;  2DBB A;  4YIF A;  3QRF F;  3AAF A;  1IN7 A;  5FFZ A;  3BPV A;  2LSO A;  3DP7 A;  1NHA A;  3CTA A;  4IRG A;  1IRG A;  1IN4 A;  2V79 A;  3BOQ A;  2LF8 A;  3HTS B;  1P4W A;  3I64 A;  2W85 A;  2UWM A;  3R4K A;  1ZG5 A;  3ZN1 A;  1R58 A;  1IUY A;  3IRQ A;  2Q2E A;  3E5Q A;  2RQP A;  4LLG F;  5D5X B;  3ERE D;  2DPU A;  1XMK A;  5E1Z B;  3KEQ A;  5L3F A;  3SZT A;  5F6F A;  2VBW A;  4HX4 A;  1T39 A;  2MLK A;  3BDD A;  4L5I A;  3BY6 A;  2IVM A;  4KT5 C;  1PP8 F;  4IRH A;  5FFX A;  2H09 A;  4BHB A;  3Q5F A;  3K2Z A;  5ILU A;  1KYZ A;  2ZJ2 A;  3NEU A;  3ZMV A;  3M1E A;  1G4D A;  2QLZ A;  3P7N A;  5FLX Z;  1I1G A;  3HSF A;  5D8L B;  1GXQ A;  3U2R A;  5K1Y A;  3GFI A;  4O5V A;  1W7P A;  3D0S A;  5AIQ A;  1HW1 A;  2VBZ A;  1J0R A;  4G94 A;  4KUM A;  3VOD A;  3M8E A;  2TDX A;  1BIA A;  3DXJ F;  2CQK A;  2XAF A;  2JZY A;  3F8N A;  3EDP A;  3KP2 A;  3TOB A;  5ED4 A;  2O0Y A;  1I5Z A;  3CUQ A;  2K27 A;  2F2E A;  1XGS A;  1R22 A;  1BBY A;  3KP3 A;  1UHM A;  3J80 K;  1IRF A;  1PP7 U;  3I71 A;  2G7U A;  2A6H F;  3RYR A;  5D5V B;  2LDU A;  3FMQ A;  1QQI A;  1ZAO A;  3P9I A;  1OYW A;  2VC1 A;  2COM A;  2BGC A;  3KET A;  3T1B A;  2J5P A;  5EEH A;  1YW8 A;  1T2K A;  2V1U A;  1IW7 F;  3J81 Z;  2UZK A;  1MKM A;  4A5N A;  2X0L A;  4M9Z A;  4EQQ A;  3GZ5 A;  1J2X A;  1WSU A;  1I27 A;  3K69 A;  3KFW X;  1RZ4 A;  2E7W A;  1BC8 C;  3I5U A;  4ETS A;  1W4M A;  2HDC A;  4UVB A;  3F6O A;  4QLC U;  2D1H A;  3REO A;  2HQR A;  3WG9 A;  3HRM A;  1K7A A;  2EB7 A;  3GW2 A;  1T6S A;  1FBQ A;  1FP2 A;  3FWE A;  1S3J A;  2AXL A;  4KA4 A;  4Q4Z F;  1MGT A;  3GX4 X;  4NB5 A;  5H6Q A;  2STW A;  1ZN2 A;  1IAW A;  2A3S A;  2JRT A;  4HX8 A;  4IVN A;  2EV6 A;  2GAU A;  2MH2 A;  4CXF A;  4B8X A;  4F7Z A;  3KLO A;  1G6N A;  2YPR A;  2H27 A;  2HS5 A;  3L7W A;  2P5L C;  3WTS C;  4P9U A;  1R7J A;  5J6X A;  2PLY A;  2HEO A;  2ZKZ A;  3OOP A;  2F5C A;  5BOX A;  4MTD A;  1ONV A;  1OYY A;  1R5G A;  1KGS A;  5IT9 K;  1T98 A;  2IRF G;  4KMU X;  3ML6 A;  1F4K A;  1FT9 A;  4R1H A;  1W7P B;  3ZPL A;  2V6C A;  4YII A;  2Q0O A;  1EV7 A;  1J59 A;  4XBF A;  1GXP A;  1QZY A;  2EFO A;  4GYI A;  1KU7 A;  2K4B A;  3FM3 A;  2FMY A;  4BHP A;  2MA3 A;  5DD4 A;  1HKT A;  1QBJ A;  2QQB A;  3SZP A;  2VXZ A;  4I0B A;  5EEG A;  1SMT A;  1OPC A;  5DYM A;  3CUQ B;  3TQN A;  2W24 A;  1FZP B;  4I0A A;  3HSR A;  2PG4 A;  1TNT A;  3F8C A;  2R7D A;  5CVU A;  3IC7 A;  3GVA A;  4EJW A;  4MQ9 F;  4CYD A;  4KIG A;  4FX4 A;  2DLL A;  2FXA A;  1RUN A;  3V8J A;  4EM0 B;  5JFR A;  4UUV A;  4S05 A;  2PMU A;  2L54 A;  3LQQ A;  4AWX B;  1DPU A;  1FBU A;  4LG0 B;  1EH7 A;  2O03 A;  4OIO F;  4RB3 C;  2P7V B;  2KIF A;  3DF8 A;  1QZZ A;  1HBX G;  3DKW A;  3KP6 A;  1TNS A;  4NHJ A;  1LDJ A;  1JHF A;  3Q9V A;  1IXR C;  3DQV C;  1LEB A;  5CYV A;  2FEZ A;  4EJU A;  1R1T A;  5HDN A;  1FSE A;  4M71 A;  5L3D A;  2F5D A;  3DV8 A;  1S6L A;  2YX7 A;  5HVQ C;  3FX3 A;  1MD0 A;  4RGS A;  5K5R A;  1B6A A;  3JSO A;  2ETH A;  4M6Y A;  4XLN F;  1O3T A;  1R1U A;  2PJP A;  4Y15 A;  5KK1 A;  4XRF A;  4LJZ F;  1R36 A;  2V1D A;  1LEA A;  2F5E A;  3HRT A;  4UHT A;  3F8F A;  1O3Q A;  4LD5 A;  3N97 A;  3KZY A;  4MEY F;  2XUB A;  1P2F A;  5E1W A;  1U3E M;  2CSO A;  3ISP A;  5LGN A;  2O3F A;  2PI0 A;  3ZN0 A;  3QP5 A;  2MLG A;  2XHK A;  3K9T A;  2HKX A;  2DFI A;  2M87 A;  1Z91 A;  3IHU A;  5ILV A;  5F1R A;  3GYH X;  5KVR A;  3T0Y A;  5E8G A;  3WTV C;  2EFW A;  1Z7U A;  2A61 A;  1U5T B;  2HGC A;  3U1D A;  5D4R A;  2HOE A;  1GHC A;  2RKH A;  4I98 B;  4OMZ A;  1UCR A;  3H92 A;  3IWF A;  1XDU A;  2MC3 A;  4QWQ A;  4Z2Y A;  3RKW A;  1G3T A;  3K1N A;  4FT8 A;  3WTW C;  4WXD A;  1YS6 A;  1HXD A;  2W84 A;  2OD5 A;  3MZY A;  4L9T A;  3MCZ A;  4I01 A;  4M74 A;  5LGU A;  1RI7 A;  4LB5 A;  4ESB A;  2Z99 A;  3C1D A;  2STT A;  1HKQ A;  3LA7 A;  2XRN A;  2DQL A;  2A07 F;  4HF1 A;  4UVC A;  3CUQ C;  1DUX C;  4U7D A;  2W25 A;  3L9F A;  5DDG A;  2GXB A;  3WGH A;  1Z6R A;  2XRO A;  1SFU A;  2CYY A;  2Y0M A;  2BBY A;  2YX4 A;  4KIF A;  2HTJ A;  2QBY B;  2ZNZ A;  4BNC A;  2ISZ A;  2A6E F;  4U0Y A;  5L3G A;  4OU0 A;  1J7K A;  4HQE A;  3IKV A;  2K02 A;  4ENN A;  1UHW A;  2O6G E;  1R23 A;  2LNB A;  3Q9S A;  3GWZ A;  1LVA A;  3GEZ A;  2FRH A;  2PN6 A;  3EYI A;  1YQA A;  4GYG A;  4UNO A;  3O3K A;  2OU2 A;  1E17 A;  2FA5 A;  2R7F A;  3KP4 A;  4L5J A;  1B1B A;  3ZMZ A;  2DK5 A;  3CUO A;  4GGG A;  4P96 A;  1SD4 A;  3FXU A;  3TO6 A;  2EV5 A;  3WTT C;  1HST A;  2QQ9 A;  1XGO A;  3JAM Z;  1WKM A;  2HFH A;  3HUG A;  2P4W A;  1I6X A;  3GFL A;  2YSR A;  5D5W B;  4B09 A;  5E17 F;  1P4X A;  1V3F A;  4RS8 A;  4PZJ A;  4Q47 A;  5DCM B;  4HLY A;  5DCF A;  1D8J A;  5BMZ A;  1XD7 A;  2L4M A;  2X4H A;  5DUI A;  1YO5 C;  3KE2 A;  3MZH A;  1K78 A;  4HBL A;  3RDI A;  1P6R A;  3QU6 A;  1FNN A;  3FHZ A;  2WWY A;  1XDS A;  2BV6 A;  3TDZ C;  4AD9 A;  5DD8 A;  2EFP A;  4IF4 A;  3HYI A;  3R60 A;  4RGX A;  1H0M A;  2QQA A;  1TQM A;  3D5L A;  4A0Z A;  1YFH A;  2L01 A;  2RC4 A;  4EGZ A;  1X3U A;  5K5Q A;  2JTV A;  4N9I A;  2CGP A;  1FX7 A;  2FSW A;  2GA2 A;  1OYI A;  5E20 A;  3CO6 C;  3MWM A;  5JVT A;  3WU0 A;  3I59 B;  2DTR A;  1C0W A;  2RDP A;  1CGP A;  3IRR A;  1BC7 C;  4A0Y A;  2EA4 A;  1CF7 B;  4CGZ A;  4OMY A;  1KU3 A;  2D1V A;  4IRI A;  1FLI A;  4U88 A;  2ZNY A;  2ZME A;  4XSX F;  4GCV A;  4DQ2 A;  3E3V A;  1JGS A;  3HHH A;  2L3D A;  5H20 A;  3BP8 A;  1LDK B;  1WI9 A;  2M5W A;  1J75 A;  3SFZ A;  2DI3 A;  1FY7 A;  3HSE A;  3VFZ A;  1YIO A;  1FBS A;  4EVI A;  3T5X A;  2RNJ A;  5AON A;  1XCB A;  4YFX F;  4KMF A;  1OMI A;  3R0J A;  3HRS A;  2HZT A;  1FPQ A;  2VT2 A;  4L9V A;  4LB6 B;  1K6O A;  3HIF A;  4CHU A;  3M8F A;  3VEP A;  4Y13 A;  5HLH A;  5LEK A;  1PUE E;  1XB4 A;  1WRJ A;  5D4S A;  1TBX A;  2CWE A;  2WV0 A;  1W7P D;  4HF0 A;  4P5O A;  3E6D A;  3R6S A;  4U7B A;  2FU4 A;  5CLS A;  2GIV A;  4HF2 A;  4KFC A;  2DU9 A;  2PMH A;  3WGG A;  3B02 A;  4MHG A;  3L2C A;  2KRF A;  2NYX A;  1MJA A;  3HOT A;  1EH6 A;  5FGM A;  4YFN F;  2O8X A;  4ZZL A;  4R79 A;  5A2Q Z;  3ZMU A;  3V7S A;  4KIB A;  2KIM A;  5FO5 A;  5CVJ A;  2RN7 A;  5LGT A;  5DUK A;  3U9G A;  3B73 A;  2IT0 A;  5LEJ A;  4I7H A;  2VN2 A;  1J9I A;  2V9V A;  5E8I A;  2QUF A;  4G6Q A;  1S7O A;  2NNN A;  1UST A;  2FOK A;  1G3Y A;  3ABU A;  1QO0 D;  2K86 A;  1YYV A;  2UXN A;  3GFJ A;  2RV8 A;  2XKO A;  3LST A;  1SD7 A;  4A2U A;  1ZAR A;  1U78 A;  1BI2 A;  2H6B A;  1HW5 A;  2XIG A;  3KP7 A;  3WTU C;  1JHH A;  2JSC A;  3ZMT A;  3E6C C;  2ESN A;  2DPD A;  2B0L A;  3PQJ A;  4RB1 A;  3MFK A;  1WQ2 A;  5E1X A;  4LK0 F;  3FXQ A;  1UB9 A;  2Y75 A;  5JR3 A;  4G6D A;  2GWR A;  3BJO A;  3SXY A;  2VE9 A;  3WTY C;  3I4P A;  2XV4 S;  4Q48 A;  1SD5 A;  2OA4 A;  1FOK A;  3BWG A;  4EJV A;  1IN5 A;  2VOO A;  4ENJ A;  2EA2 A;  3H3Z A;  5D5U B;  3HTU A;  4G7Z F;  4KN7 X;  2MD5 A;  4ZH4 F;  5L3C A;  2OZU A;  1UFM A;  4GO1 A;  4CIC A;  4EM2 A;  4WCG A;  1YG2 A;  1ODD A;  2D2W A;  1ZHF A;  2HR3 A;  1Z05 A;  2L02 A;  1B9M A;  2OQR A;  1BOA A;  5FD5 A;  3CO7 C;  2PEX A;  2P6S A;  1MDM A;  1U6G A;  4ASN A;  4MNU A;  1S29 A;  2PBI A;  4EMS A;  3DEU A;  1SAX A;  3CLO A;  4BYY A;  3WGI A;  4MGR A;  3RIR A;  4EJO A;  4WXH A;  5L3E A;  2P5K A;  4HQM A;  4HLX A;  2VOP A;  4YG2 F;  2W57 A;  5AIP A;  2CO5 A;  3H3U A;  2OQG A;  3TOA A;  5CJ9 A;  2FNA A;  4IXA A;  3QOP A;  3RJP A;  1GVJ A;  2NAZ A;  1KA8 A;  2VE8 A;  2F5F A;  1REP C;  3F8B A;  1U2W A;  4IJA A;  4YFK F;  3TGN A;  4OIN F;  4EGY A;  3BJ6 A;  3MAJ A;  1A04 A;  1U5T A;  2RVC A;  3F8M A;  4HA8 A;  5IT9 Z;  3I54 A;  1FYL A;  3GXO A;  2ADU A;  1S7A A;  4NQW A;  3TO7 A;  2VC0 A;  4K2E A;  1E2X A;  4OOI A;  2HKO A;  2P8T A;  3M7G A;  2XKP A;  5ICG A;  4BXU A;  2OBP A;  4HX7 A;  2JT1 A;  2YU3 A;  3TDU C;  4CDG A;  5LBQ A;  3RTR A;  1XSX A;  5TRD A;  1DP7 P;  3LQR A;  1BI3 A;  2A5Y B;  3CDH A;  4ESF A;  3CJN A;  2FBI A;  5HDK A;  4BAY A;  5FB2 A;  3ZQ7 A;  3F23 A;  1LB2 A;  3SHF A;  3RKX A;  5ICC A;  3V7C A;  1H9G A;  3K0L A;  4RAZ A;  3S2W A;  3BPX A;  1FC3 A;  1ZYR F;  2FNP A;  4PGG A;  1LQ1 A;  5F64 A;  2IP2 A;  1FYK A;  4ZYD A;  2FE3 A;  1HW2 A;  4OIR F;  1L0O C;  3GO5 A;  2CG4 A;  1WWX A;  2ZCW A;  3FF5 A;  2QM3 A;  1KQ8 A;  2GZW A;  5LHI A;  4M9X A;  3V8L A;  4BH9 A;  1B4A A;  1ON2 A;  5DCM A;  3ECO A;  2MH9 A;  2KIU A;  4N9H A;  3RPQ A;  2OZ6 A;  3F3X A;  2ACJ A;  2OAZ A;  1P4A A;  3LA2 A;  1OR7 A;  3G3Z A;  3E97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...