5IT3A

Swirm domain of human lsd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
LPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific histone demethylase 1A
publication title A Tlx-interacting peptide of Lsd1 inhibits the proliferation of brain tumor stem cells
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 29
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it3A00
1TNTA 1R00A 4CO8A 1K6OA 1L0OC 1R5GA 2KIFA 1YW9A 4XBFA 3FMQA 1QZZA 5CVIA 1BBYA 2ZMEB 1W7PA 5K5QA 1YIOA 2JPCA 2WC2A 1TQIA 3J80Z 2FEZA 3B73A 1K78A 2HYGD 2CYYA 2ETHA 3F3XA 5D5VB 3QAHA 1ON2A 3GX4X 2YX4A 5FLXZ 2K7LA 2RN7A 2WTEA 4MEYF 3TDUC 1XD7A 3T0YA 2VOOA 3F8BA 4HYEA 3E6CC 4E70A 2DPDA 4YFNF 4HV6A 2DO7A 2QZ8A 3O2PE 2FMLA 1K7AA 1JHHA 3GO5A 4M9SA 4M72A 1MDMB 1GVJA 1T38A 4FT8A 3KETA 3I4PA 2XGXA 1STZA 3BROA 2DLLA 1TW2A 3HSRA 1RZ4A 1FLIA 2G7HA 2Q2EA 3DF8A 4R1HA 2EV0A 3K0LA 1SFEA 1S7OA 4ETSA 4NB5A 5CVJA 5L3GA 4HF0A 2H09A 3ZN0A 2L01A 1FBSA 1EH6A 2GQQA 1JHFA 2ZJ2A 2RVCA 4RB2C 2O6GE 3JW4A 1QQIA 4IRGA 4P9FA 1R36A 1YW7A 3I5UA 5L3EA 3JAMZ 1LQ1A 3HRTA 4KMFA 4XSZF 4LG0A 4EM2A 4ZYGA 2HEOA 3KP6A 3BPVA 2EK5A 2VXZA 4HOBA 3ZMVA 1WQ2A 3W6KB 5HOOA 1KA8A 1J7KA 2V9VA 4P5OA 5K5RA 2XAHA 4PGHA 5D8KB 4M6YA 4A6DA 5FD5A 3RKYA 3F8MA 3F6VA 4ENKA 1A04A 2KJBA 4LD5A 4BQAA 3WE3A 1C0WA 2ISZA 3FMSA 3P9CA 1I6XA 3ZQ7A 2L3DA 2EFNA 3CUOA 2ZBKA 4OIOF 3MQ0A 1HW5A 4AIHA 3ML6A 2FBKA 4KIFA 2XVCA 3D0SA 1IXCA 1W7PD 3F23A 1ZN2A 1LDKB 1QGPA 3WG9A 2ACJA 2G9WA 4L9NA 2QBYB 4R8HA 2VC1A 1G3WA 3V7RA 3E5UA 3H3UA 3E5QA 2KRFA 2CG4A 4O3MA 5CVRA 4KA4A 4WCGA 5ILUA 4HZFA 3OOPA 3BJOA 5D8LB 2XKPA 2FMYA 4HV5A 4PGGA 2E7XA 5K5OA 3F72A 1O7LA 3RYRA 5DCMA 2NRAC 3T8TA 1O3RA 2DK8A 2XUBA 2FA5A 5IT3A 5LRSA 2KJCA 1RUNA 1G4DA 3MFKA 1Y0UA 2MBFA 2P6TA 2PEXA 4RB3C 4BAYA 3QPHA 1Z6TA 2HQNA 3LA2A 3MZHA 2ZNYA 4PCQA 4N9IA 5D5UB 3O6BB 4Q48A 4G7HF 4B8XA 3HHGA 3TDZC 2P8TA 3EYYA 4I02A 4JBAA 3E3VA 5E1ZB 1PDNC 2YU3A 1SD4A 2MH2A 2EFOA 1H9TA 3LSTA 5DEQA 1LB2A 3L7WA 4AVPA 2HS5A 2O03A 5L3BA 1FOKA 4GGGA 5E17F 4OIRF 3HOSA 1FYLA 4KN7X 2CW0F 2JRTA 1BJAA 3ZMZA 1TLHB 4RB1A 3DP7A 4MHGA 2QVOA 3F6OA 1IN5A 2X4HA 4BHPA 4OU0A 4U7BA 4CXFA 1K78B 3BJ6A 3TKYA 1XCBA 2F2EA 3K2ZA 5ICFA 2A68F 1SAXA 1R1TA 3V7SA 2F5DA 1S3JA 1SD6A 1HW1A 1XSDA 1YS6A 1SFXA 4RB0A 3V7CA 4CHUA 2Z33A 4EJWA 1MZBA 1G3SA 1WRJA 1FPQA 1YO5C 1RNLA 3IC7A 5HLIA 3RKWA 4G7ZF 3DPLC 1OPCA 5H6RA 4OMYA 4JK1X 3GWZA 3WU1B 1R5HA 4BHCA 3WTTC 2KKOA 1HKQA 4BH9A 3GFJA 4IPAA 3Q5FA 4UVAA 4UNOA 4YFXF 3BOQA 3U2RA 5CVUA 1U5TA 5FFXA 4M71A 5FD6A 3WTZA 2FSWA 2EA2A 5ERIA 5HVQC 4UXNA 2QQ9A 2PMUA 3PQKA 4AWXB 1O3QA 4XLNF 1P4AA 1Z1DA 3HUGA 1V4RA 2OBPA 3ZMUA 1NHAA 1JXSA 4D0PA 1XMAA 5JFRA 1U8RA 4LG0B 3KZYA 1KQ8A 3LWFA 4HW0A 2VC0A 1AOYA 1Z91A 2E1CA 3WGGA 2IA2A 3REOA 6PAXA 1KU7A 5HLHA 2XASA 2PFBA 3C18A 3RI4A 2P6SA 2PJPA 4IF4A 5CVVA 4WK8F 4L5JA 5H6QA 3IRQA 1LEAA 3HSEA 2QWWA 5E1WA 2D1HA 2XV4S 5HS8A 2VE8A 2FF4A 3DPTA 4G7OF 1BM9A 3P7NA 2UWMA 4KDPA 5D6EA 5IT9Z 1R1VA 3QP6A 1R58A 2VT3A 4EJOA 1I27A 1CF7A 1ZH5A 4N9HA 1G3TA 3DV8A 3K1PA 2M8EA 3ROUA 2JTVA 3GFLA 2IVMA 2LDUA 1P6RA 1T0FA 5ICGA 4HLYA 4IRHA 2Y0MA 3SXYA 1MJBA 2H6BA 5JHUA 1FBUA 4KIBA 4RGUA 4GCVA 1R1UA 1IN6A 1UB9A 2FU4A 1EH7A 2Z99A 2IJLA 4XSXF 4NHJA 1ZLJA 3J80K 2A5YB 3I58A 5TJJA 5HDNA 3DFGA 4A0XA 1DUXC 4G94A 4LLNA 5DCMB 3WTXC 4L18B 2COMA 2D2WA 3DKWA 4MTEA 3GVAA 3L9FA 3CO6C 1Q1HA 1J2XA 3HYIA 4EJVA 2PBIA 3M9AA 4KUMA 3J81Z 3U1DA 5FFZA 1DPRA 1Z05A 2GZWA 2VONA 2NYXA 4A5MA 3B02A 3VODA 3GYHX 2VBZA 3ABTA 3WE2A 1JGSA 3ULQB 2O3FA 4M74A 1X3UA 3ZMDA 4CYDA 3LAPA 2MA3A 3HOTA 3KLOA 1FSEA 5HDGA 2DPUA 3K69A 1D8KA 4YFKF 1MD0A 4OIQF 1PP8F 3GF2A 2HGCA 2H94A 3R0JA 4OOIA 5L3DA 1ULYA 2GAUA 4ZYHA 1EV7A 2VE9A 2EFQA 1Z6RA 5LHGA 4PDKA 3VEPA 4EMSA 2HWVA 1FYMA 3OV8A 1FWZA 4G6DA 5BOXA 3EYIA 5EEHA 3L09A 3R0AA 1YS7A 3TQNA 5E20A 1XDUA 3GEZA 3FMRA 2R3SA 3PQJA 2A61A 2MH9A 5KVRA 5LBQA 5LRRA 2F5FA 2L02A 2R7FA 2IA0A 1ZG5A 2A07F 1BI0A 4ENNA 2GXGA 3P9IA 4MGRA 1S7AA 2P7VB 5F64A 3NQOA 5D5WB 5DV5A 4IHSA 2PG4A 1ZGAA 1ODDA 2VBYA 4U0WA 2P5VA 2FQ3A 1UHMA 2BBYA 1P4WA 1ZGJA 2PN6A 2M45A 3F8NA 4ON0A 5CLSA 3SFZA 2AS5F 5JR3A 5E8IA 3GFIA 3KP4A 2V6CA 1I5ZA 1S8NA 2STTA 1HKTA 3WTVC 2QUFA 4P96A 3H3ZA 3IHUA 2OQGA 4ENMA 1OYIA 1RIOH 2V79A 1J0RA 4LLLA 3TO9A 5D5XB 2H6CA 2EFPA 4FHTA 4KYWA 1DPUA 3IRRA 5ED4A 1O3SA 3WGHA 2A69F 5BQTA 1E17A 4HX4A 1ON1A 4P9UA 2ELHA 3Q9VA 2YR2A 4UVBA 2MD5A 4EGYA 4Q47A 4HA8A 3P9KA 3SHFA 1LNWA 1HQCA 3BPXA 3TO7A 3C1DA 1QZYA 1W5TA 1W4MA 3F8CA 4IHTA 2IW5A 4LK1F 2EWNA 3SQNA 2RC4A 2PI0A 3MCZA 1ZAOA 5HLGA 1USTA 4K2EA 3WTSC 2ADUA 3R61A 3KP3A 3IKTA 4A12A 2JT1A 5L3CA 2OZ6A 2W24A 1FT9A 2JPBA 1MJ9A 3FZVA 2P5LC 2XIGA 1YYVA 4LFUA 1V3FA 2ZO4A 2FNPA 3BY6A 1FYKA 1OR7A 3C3WA 4QLCU 3EDPA 2XAFA 3MWMA 4PZJA 4S05A 3GXOA 1T98A 4M9XA 1BC8C 1IUYA 2CGPA 2O0YA 3WGIA 4B09A 3QP5A 4ZZDA 4U88A 4G9YA 5H20A 3WTUC 4P55A 4RAZA 3DQVC 2HYFA 1XGNA 4UHTA 1ZG1A 2VBXA 4S04A 2PMHA 3BDDA 3N97A 1YLFA 1ZARA 4HDVA 4L0ZB 1WKMA 3T8RA 2EV6A 3JSOA 4HQEA 4IJAA 1B4AA 5F6FA 1LVAA 1G6NA 3E6BA 4F7ZA 3ZP5A 1U78A 3KLNA 1W7PB 3WTYC 4WWCA 2FOKA 5ILVA 4MEXF 3KCCA 4JQFA 3I0TA 2K02A 1D8JA 1OKRA 3ECOA 4O5VA 2D1VA 2FBHA 1LDDA 1ZRDA 2QQAA 1MDMA 4MTDA 1ZHFA 2Q8KA 1BIAA 4HX7A 4ZZLA 1XGOA 1F9NA 1IN7A 4I0AA 1UHWA 2Y75A 4BXUA 1J75A 3E5XA 4A6EA 2DU9A 4HQMA 2DBBA 4EGZA 4LLGF 1BN5A 3HHHA 4FX4A 4DQ2A 4UV9A 1IN4A 1TNSA 1HKSA 2XAQA 2B0LA 3D5LA 1LJ9A 3VFZA 3MZYA 3GFMA 3ISPA 3J7AO 3JSPA 4HF2A 4HX8A 4O6JA 3W6JB 4L0YB 3HTUA 1I1SA 2OAZA 1YW8A 1H9GA 5E1XA 3FXQA 4FX0A 2C6YA 5F1RA 5LEKA 1J59A 2E7WA 4MQVA 3EETA 4DNCA 3M7GA 2EA4A 1MGTA 3RDIA 2G7UA 3FX3A 5A2QZ 2J5PA 2OQRA 1SD7A 4NQWA 3F8FA 3R4KA 2ZXJA 3CUQA 4EM1A 1SMYF 1SFUA 3CLOA 2FE3A 1S29A 3BWGA 3LQRA 1DP7P 3VB2A 1PUEE 2K86A 3AAFA 2VT2A 1WSUA 2Z5UA 3V8JA 3LAJA 2QM3A 1ZRFA 2A6HF 2STWA 2PLYA 1SMTA 4EJTA 3ZN1A 2BYVE 2HTSA 3TOBA 3DXJF 3V8KA 5L3FA 5JI6A 2RGVA 4RGRA 2QENA 2DW4A 3DEUA 3MEXA 2XHKA 3V8LA 3ERED 1B9MA 4M73A 2HOEA 3WODF 1P2FA 2P4WA 1T2KA 2LSOA 1Z7UA 2DI3A 2BEOA 2CSOA 3QRFF 2YPRA 1XGSA 2RDPA 3LFKA 3TOAA 3KP5A 1YG2A 2ESHA 4I09A 2FXAA 3GLXA 4IVNA 1B6AA 3C7JA 1KQ9A 1ZYRF 2XAJA 2RKHA 4EQQA 3CO7C 1F4KA 3IWZA 3K1NA 5AONA 1T39A 1ZREA 3FXRA 1IN8A 3LA7A 5DD8A 5ICCA 3I54A 3H92A 5DCFA 4A0YA 4AIJA 2VOPA 1HSTA 2MLKA 1P92A 5FLXK 2Z3YA 2DTRA 3MAJA 2XRNA 4AD9A 5D6FA 4CZZA 2PQ8A 2QQBA 1OYWA 1KYZA 3N4MA 1W5SA 2FNAA 4XRFA 1MKMA 2NS0A 3HRSA 2RQPA 3FWEA 2IRFG 3RTRA 5LLQA 4HBLA 3KE2A 5DDGA 5AIPA 2HDCA 3QU6A 1P4XA 5LGTA 1IRGA 3GZ6A 2MLGA 4A0ZA 4RGSA 1XN7A 2L4AA 1ZRCA 1FP1D 4EVIA 4LB6B 1KGSA 2LF8A 3T1BA 1T6SA 5BPIA 2W25A 4QWQA 1U5TC 5K1YA 1IF1A 4U0VA 2LKPA 1G3YA 2HKOA 5J6XA 3ZMSA 3JAMK 5AIQA 3NEUA 5HS7A 1BI3A 3FM3A 2QYOA 2IPQX 4ASNA 2Q0OA 2X0LA 3CUQC 2D45A 4OMZA 2M30A 4U0YA 2DT5A 3ZMTA 1F5TA 4BHBA 1FSHA 2DQRA 1BOAA 1KU9A 5HDKA 4I7HA 4YIIA 3HIFA 3TGNA 5JVTA 4KNYA 4Y17A 2M1BA 4ESBA 1FBQA 1WI9A 1XB4A 4OIPF 5E18F 1R7JA 4EM0B 5FGMA 1S6LA 3CJNA 3QPTA 4L9TA 3BJAA 4CGZA 2E1NA 3I59A 2IP2A 2UXXA 2ESNA 2XROA 4KICA 1U5TB 3ZPLA 4M9ZA 4Q4ZF 4ZYEA 3M8EA 1USSA 3SZTA 1RI7A 4Q5SF 2VN2A 3JTHA 4WXCA 2CQKA 2BV6A 4YIFA 1TTYA 1FNNA 3F21A 2GWRA 1PP7U 3V4GA 2VBWA 1B59A 1IAWA 1QPMA 3L2CA 4LJZF 3S2WA 3CUQB 3CTAA 1XSXA 2FRHA 3KP7A 4ZH4F 4R79A 5LGNA 2UZKA 3T5XA 3KEOA 4HLXA 2WV0A 4LMYA 2HZTA 4WX9A 4MQ9F 3BZ6A 3WTWC 2K4JA 1O57A 2LNBA 3U9GA 4Z2YA 1QO0D 4AIKA 2HFHA 4Y13A 2RV8A 1D3YA 1R23A 2J5OA 2EJRA 1KU3A 5LGUA 4ENJA 4GO1A 1IXRC 3KP2A 2XAGA 4EV0A 5BMZA 5J8FA 5DYMA 1I1GA 3EUHA 5CJ9A 4G8XA 2LF7A 3VOEA 2HQRA 2A3SA 3RPQA 3IKVA 1ZLKA 3R6SA 3I53A 4IXAA 5DUIA 1CF7B 4I2OA 3L00A 2P7CB 2GXBA 5ICEA 2XKOA 4KMUX 5KK1A 1FY7A 1JE8A 1Z9CA 3FM5A 3ELKA 4WXDA 1GXPA 3JTGA 2Y48A 4RAYA 3HTSB 4GYGA 2ZMEA 3TO6A 2IT0A 4RS8A 3K9TA 4GYIA 4HDUA 1XSVA 4UVCA 1U3EM 2W57A 3G73A 2HKXA 3KEQA 4I0BA 1BI2A 3ECHA 1R22A 1TQPA 1KU2A 4L9VA 1MJAA 3QU3A 2OA4A 5CYVA 2F5EA 5EEGA 4KIGA 2KIUA 3R60A 4OINF 1B9NA 4U7DA 2HTJA 1E2XA 4ZYDA 3O3KA 1DDNA 4XLPF 2NAZA 3CDHA 3I71A 5TRDA 3FHZA 4UV8A 3GW2A 3NRVA 2DAOA 4N0BA 4CDGA 1H0MA 4CICA 2R7DA 5LEJA 1XDSA 2CO5A 2M5WA 1SD5A 2EFWA 1HSJA 3E6DA 2H27A 3G3ZA 2K27A 3M1EA 3E6MA 2DFIA 4Y15A 1QNTA 5A2QK 1FP2A 1UCRA 2L4MA 2UXNA 4GXOA 5D4RA 2A6EF 2K4BA 2NNYA 4BYYA 3KFWX 3EQLF 3PFIA 4HF1A 3HRMA 3FF5A 4M6XA 1HXDA 2GA1A 4WXHA 1CGPA 5ILSA 1AWCA 1K79A 4KN4X 3IL2A 1B1BA 2MC3A 4IRIA 2BE5F 2DQLA 4EJUA 2OZUA 2WWYA 1FC3A 1FZPB 1LDJA 4KT5C 1ZG3A 1VTNC 2W84A 2ISYA 5LHIA 4TV7A 2JSCA 1BI1A 1KYWA 2P5KA 1GXQA 2ZFWA 3LQQA 2HR3A 1YFHA 1TW3A 5BPDA 2IA1A 3RJPA 3IWFA 5IT9K 1ONVA 1J9IA 1OMIA 2YX7A 1RUOA 1XMKA 1J5YA 2TDXA 4WF2A 3ABUA 5DUKA 2O61A 3I59B 3E97A 1F1ZA 1BIBA 1WWXA 2QLZA 4I01A 2EV5A 1HBXG 3F22A 1U2WA 3RKXA 1REPC 2BGCA 2YSRA 2QBYA 3KZZA 4A5NA 4UUVA 3RIRA 3I64A 5LHHA 4RGXA 2Z9OA 1O3TA 1KQ0A 5BS6A 2F5CA 4LGWA 3RPUA 1D5VA 2W85A 1OYYA 4ESFA 3BP8A 2AXLA 1IXSB 3FXUA 2V1XA 1QBJA 3SZPA 4H0EA 1LEBA 1TQMA 4BNCA 3WU0A 1U6GA 2ZCWA 5FB2A 2CWEA 2NNNA 2ZKZA 4LB5A 3J81K 1EH8A 1YQAA 1FX7A 1IRFA 2OD5A 1HW2A 2CFXA 2JZYA 2GIVA 3Q9SA 2FBIA 4MNUA 2V1DA 3HRUA 5D4SA 1BC7C 3RYPA 2GA2A 3HSFA 3QOPA 4I98B 5HS9A 4ESJA 2RNJA 4KFCA 1TBXA 2DK5A 5E8GA 2VODA 2M87A 4HAMA 1IW7F 1O7FA 1XGMA 1UFMA 1GHCA 1L3LA 3COAC 4LK0F 2EB7A 3GZ5A 2O8XA 3K1MA 1IZ1A 4YG2F 5J8CA 4L5IA 2OU2A 2V1UA 2ZNZA 3M8FA 5DD4A 1YTYA 3LA3A 4A2UA 2KIMA 3GUDA 1XCVA 5FO5A 4L9JA 4G6QA 2L54A
chains in the Genus database with same CATH superfamily
3PNYA 4Y7NJ 4PJMA 4L5EA 4DW6A 1TNTA 5GPAA 1R00A 4A3FJ 4CO8A 2ID6A 3ZQHA 1K6OA 1L0OC 2VKHA 1R5GA 2KIFA 4C3IJ 3S1NJ 1YW9A 2LH9A 1OCCH 4XBFA 3CLQA 3FMQA 1QZZA 5CVIA 1BBYA 2ZMEB 1W7PA 5K5QA 1YIOA 2O7OA 1BA5A 2XGEA 2JPCA 2WC2A 1TQIA 3LSJA 5F0CA 4MIMA 1W5CC 3J80Z 2O9LA 2FEZA 4BGDA 3B73A 3I4MJ 1K78A 1HDDC 2HYGD 3PL8A 2KT0A 2CYYA 5H2FC 2BXZA 2ETHA 3SDGA 3F3XA 2YU9J 3H36A 4BEHA 5D5VB 2ZJQF 3QAHA 5EZGA 2X1CA 1V54H 3E1SA 2ID3A 1ON2A 2BW3B 3GX4X 3SYTA 2YX4A 3VYRB 4NC6A 5FLXZ 2K7LA 3CCEI 2RN7A 2YS9A 2WTEA 4MEYF 1T8IA 1MMSA 3TDUC 1XD7A 3DBHB 3ASNH 3T0YA 2VOOA 3F8BA 4HYEA 3HOVJ 3E6CC 4E70A 2DPDA 1OFCX 4YFNF 3ZQLA 1JUSA 2NVUB 2E34A 3BLYA 2LR8A 4HV6A 3S2HJ 2DO7A 2QZ8A 3O2PE 2FMLA 2GOXB 1K7AA 4IHVA 1JHHA 2Z2SB 1Y1WJ 2VJIA 3GO5A 4M9SA 4M72A 1MDMB 1GVJA 1T38A 4FT8A 3KETA 3I4PA 2XGXA 4DYRA 4M3GA 1STZA 3BROA 2PJRA 4ZJZA 3W2AA 2DLLA 1HOMA 1TW2A 3HSRA 1RZ4A 1FLIA 2G7HA 2Q2EA 3DF8A 1W0TA 4R1HA 2EV0A 3K0LA 2V9PA 3ZQQA 3RPUD 1SFEA 1S7OA 3BG5A 3S1QJ 4ETSA 2HOTA 4NB5A 5CVJA 3LMMA 1IV6A 5L3GA 4FQGA 2H09A 4HF0A 1W0UA 3ZN0A 4B1RA 2XGCA 2L01A 1FBSA 2HQ5A 1YJ9I 4A69C 2GBYA 1EH6A 2GQQA 1JHFA 5JLWA 2ZJ2A 2RVCA 3O8HA 4RB2C 2O6GE 2H1LA 3JW4A 3CCQI 1QQIA 3KYLA 4IRGA 4B43A 3A2KA 4P9FA 1R36A 1YW7A 3CD6I 3I5UA 5L3EA 3JAMZ 1LQ1A 3HRTA 2WA0A 4KMFA 4XSZF 1RESA 4LG0A 4A3DJ 1Y6IA 4HNTA 4EM2A 4ZYGA 2HEOA 3KP6A 1N77A 2EPFA 3JCUC 3BPVA 2EK5A 2VXZA 4HOBA 3OYLA 3ZMVA 1WQ2A 3W6KB 5HOOA 1KA8A 1J7KA 2V9VA 4P5OA 2F48A 3QOEA 1WJFA 5K5RA 4B3XA 2NVTJ 2XAHA 3B6CA 3CCSI 4PGHA 2WV1A 5D8KB 4LOCA 4M6YA 4A6DA 5B1AH 5FD5A 3S32A 4HEA2 5EEAA 3RKYA 3G2BA 1ZGWA 3F8MA 1D0XA 3F6VA 3SZGA 2YUSA 3G1MA 4NQWB 4ENKA 3S3MA 1A04A 1EF4A 1IDYA 2JUCA 2KJBA 4LD5A 4BQAA 3WE3A 3H5NA 1C0WA 2CQ7A 3LNQA 2NOGA 2EIKH 2ISZA 3FMSA 3P9CA 4Y33A 1I6XA 3ZQ7A 3IV5A 2JMWA 2L3DA 1NG6A 4A3MJ 2L9NA 3NWTA 1G59A 2KRHA 2EFNA 3CUOA 3OYAA 2ZBKA 2DMPA 3CMAI 4OIOF 2KZGA 3PO2J 3MQ0A 1A5JA 3MZ8A 4AUXA 2LD5A 4A3LJ 3DLAA 1HW5A 4AIHA 5IP9J 3RZDJ 2PMZA 3ML6A 2FBKA 4KIFA 2GIZA 2XVCA 2EINH 5IYDJ 2JA2A 3D0SA 1IXCA 4UB6C 1W7PD 2JA7J 1ENHA 3F23A 2CUEA 1ZN2A 3DEEA 1LDKB 4GFBA 1QGPA 1RKTA 3DTKA 2IEKA 4PFPA 3WG9A 2ACJA 2G9WA 3BR0A 4L9NA 4RMNA 4XIDA 2QBYB 4R8HA 2VC1A 1G3WA 3V7RA 1DGWY 3E5UA 1H88C 2K40A 1BOBA 2HOAA 3F0CA 4J01A 3ASOH 1TWAJ 3H3UA 3H3VK 3E5QA 2KRFA 2CG4A 4O3MA 1V55H 5CVRA 4KA4A 3OS1A 4WCGA 5ILUA 3QYFA 4HZFA 3OOPA 1OCZH 3BJOA 4IL6C 5D8LB 1GT0C 2LC2A 1X3WB 2XKPA 4PFOA 2R7TA 2FMYA 3F9KA 1JUPA 1X2NA 3OR2C 1TC3C 4HV5A 1O4XA 2IGNA 4PGGA 2JVHA 2E7XA 5K5OA 3S1MJ 2BVMA 2KQRA 3F72A 1O7LA 3VPRA 2VI6A 1N25A 3RYRA 3HOUJ 1IO2A 5DCMA 3JRDA 3TL4X 2NRAC 3T8TA 5E3MA 2CV2A 1OCTC 1BW5A 2DOFA 4W97A 5EGOA 1O3RA 3OL3A 1JKRC 2DK8A 2XUBA 2FA5A 5IT3A 3FXLA 5FKLA 2XSDC 3SEQA 5LRSA 4DBQA 4NNJA 5GADJ 2KJCA 4CSWA 2ICWG 4XKVA 2R7SA 1WCMJ 3GMEA 4NC8A 3W2VA 1RUNA 1G4DA 2Y69H 3OIQA 4EATA 3MFKA 2JQ7A 1Y0UA 2MBFA 1JJ6C 2P6TA 2HOSA 2PEXA 4Y3OA 1FOYA 4RB3C 1JKOC 4IZZA 4BAYA 5K7FA 3QPHA 5CPRB 1Z6TA 2HQNA 3LA2A 2GOMA 3G6EI 2VIXA 3MZHA 3HBLA 2COBA 2ZNYA 4PCQA 4N9IA 5D5UB 3O6BB 2XPUA 1U0JA 5GAEJ 1SVOA 4Q48A 1X1BA 4G7HF 2CUFA 4B8XA 3HHGA 2NVXJ 2P8TA 3EYYA 4I02A 3TDZC 3BR5A 4JBAA 3E3VA 5E1ZB 1PDNC 2YU3A 1OCOH 2BY2A 1OLTA 1SD4A 2MH2A 4JX4A 4AYBA 2EFOA 2R7WA 2CQNA 2LP0A 4P1WA 2TCTA 1RR8C 1H9TA 2VLAA 2IBDA 1K4TA 3LSTA 3H9QA 3HDDA 5DEQA 3BG7A 3L7WA 1LB2A 4AVPA 2HS5A 2O03A 2F5VA 2DA4A 5L3BA 4G12A 1FOKA 3S15J 4A3EJ 5M5YJ 2IS6A 3HKZA 2NXNB 2W00A 4GGGA 4ZTFA 3CMEI 1ZR2A 2E1MC 3ZQGA 4XKWA 1VQ4I 3S14J 5E17F 4OIRF 4DZPA 1J09A 1Y0NA 3A1YA 1Z3XA 3HOSA 1FYLA 1X2MA 4KN7X 2CW0F 1H89C 5M5XJ 2JRTA 1BJAA 3CCYA 1XC5A 3ZMZA 1TLHB 4RB1A 1FEXA 2FJ1A 2ME0A 3DP7A 4PK4A 4MHGA 2QVOA 1AA7A 4HG2A 3F6OA 2O5RA 1IN5A 3S3OA 2X4HA 4BHPA 4OU0A 1FTTA 5F0FA 3A0BC 4U7BA 4CXFA 1K78B 3BJ6A 3TKYA 1XCBA 3QQAA 2F2EA 3K2ZA 4BBSJ 1R4MB 3BG9A 5ICFA 2WAQA 2A68F 4C3JJ 1SAXA 3M1CA 2IGOA 4BEHB 1R1TA 1VQLI 1VQMI 3V7SA 2F5DA 1S3JA 4RDUA 1SD6A 1HW1A 4CYCA 3L1PA 3HGYA 2LK2A 1XSDA 5E79C 1YS6A 3LSGA 4C3HJ 1SFXA 5J47A 4RB0A 2V7FA 2RREA 3V7CA 4CHUA 2Z33A 2CUJA 3QWLA 4EJWA 1MZBA 1G3SA 1F36A 1TP4A 3CJTB 3CP8A 1WRJA 2PMZN 1JUMA 5GP9A 1FPQA 1VFCA 1YO5C 4NDLA 1RNLA 3IC7A 4PJLA 5HLIA 3RKWA 4UUSA 4G7ZF 2ZB9A 1VQ5I 3DPLC 1OPCA 2WY7Q 4IHXA 5H6RA 4C2MJ 1R9TJ 2HXIA 4OMYA 1BW6A 3E0JB 4YRVA 4JK1X 3GWZA 3WU1B 1IRZA 4JOMA 1R5HA 2TRTA 4BHCA 3ZOBA 4BUPA 2KKOA 3WTTC 1HKQA 4BH9A 3GFJA 4IPAA 3Q5FA 4UVAA 4UNOA 4YFXF 2XGDA 2DOEA 3BOQA 2LY1A 3U2RA 5CVUA 1U5TA 5FFXA 4M71A 1WJCA 5FD6A 4FCYA 2AQFA 1W36C 4HRIA 2O8KA 1WI3A 3WTZA 4AU7A 2FSWA 3OYDA 1GLNA 3Q0UA 2VUMJ 2EA2A 2E1MB 5ERIA 5HVQC 4UXNA 2QQ9A 2LKXA 2PMUA 4JYKA 1DQUA 3PQKA 2R92J 5M3MJ 2EIMH 3OYGA 4CA0A 4AWXB 1O3QA 3U1KA 1RR7A 5K7HA 4XLNF 1P4AA 1Z1DA 3HUGA 1V4RA 2JJ7A 1V5FA 3IUOA 2QGUA 2X51A 2OBPA 3ZMUA 2XB5A 5IPAA 1DU0A 1QVUA 3C2GA 1NHAA 3BTCA 2QSHX 1JXSA 4D0PA 2JN6A 1XMAA 5JFRA 1U8RA 4BJTA 3LSRA 3AKZA 4LG0B 3KZYA 1B8IA 2G0EA 3FKIJ 4BXXJ 1KQ8A 2X6WA 3LWFA 4HW0A 1QRYA 2VC0A 3EUHC 4II3A 1Z91A 2BXYA 2M0MA 2E1CA 1AOYA 1VQ7I 2MFZA 3WGGA 3S8PA 3RSNA 2IA2A 2RQQA 3REOA 6PAXA 3HOYJ 4A3IJ 1KU7A 3GTMJ 5HLHA 2XASA 2PFBA 3C18A 3RI4A 2P6SA 2PJPA 1I39A 4IF4A 5CVVA 1Z77A 4WK8F 1ZR4A 4F3QA 4L5JA 5H6QA 5EG0A 3IRQA 1IGNA 1LEAA 2LLKA 3HSEA 5F1JA 2B9SA 2L9RA 1LKXA 4PJJA 2QWWA 1H8AC 5E1WA 2HU9A 2D1HA 2XV4S 5HS8A 3FHNA 2VE8A 3MN2A 2FF4A 3DPTA 4AYBN 2M0CA 3W6VA 2K9LA 3RZOJ 4G7OF 1BM9A 1MW7A 3P7NA 1MSFC 1WJEA 3LL7A 4YIRX 2UWMA 1PUFB 1I50J 4KDPA 1N78A 5D6EA 3WHCA 5IT9Z 5HLTA 1R5ID 1R1VA 4AIDA 2VQHA 2M4GA 3QP6A 2E71A 5FKMA 4BL0B 1R58A 2VT3A 2ELKA 4EJOA 4KJZA 1I27A 2DMNA 2I8DA 1CF7A 1ZH5A 1NK3P 4N9HA 1G3TA 3L2WA 3DV8A 3DTEA 1V5GA 4DYCA 1G2HA 1ERDA 1Z0XA 3K1PA 4ITVA 1QZEA 2M8EA 3ROUA 2JTVA 3GFLA 2IVMA 4OAZA 5FLMJ 2LDUA 3PUBA 1P6RA 1T0FA 5KHDA 5ICGA 4HLYA 4IRHA 4M3EA 2Y0MA 4QPOA 3SXYA 1ETKA 3JRBA 1MJBA 2H6BA 1GVDA 5JHUA 1FBUA 2VQLA 3M8JA 2VKDA 4OAYA 3DPUA 2DN0A 3CJRB 4KIBA 4BY1J 4RGUA 3K4BA 4GCVA 3S93A 3AG1H 1R1UA 1IN6A 2WAQN 3CCJI 1D5YA 1UB9A 2FU4A 1T56A 1EH7A 3PM1A 2Z99A 4XK4A 1W1WE 2IJLA 3Q0VA 3ABMH 2K9QA 4XSXF 4NHJA 1ZLJA 2FUG2 4HSRA 4ZYAA 3J80K 1OJLA 2W7NA 2A5YB 3DCFA 4C30A 3UNGC 1LE8A 3I58A 1I3AA 3GTPJ 1OISA 5TJJA 5HDNA 4PSWA 4XOTA 2HVRA 2CV1A 3A02A 3DFGA 4A0XA 5J1RA 1X4PA 1DUXC 3HOWJ 3SJMA 4G94A 4LLNA 2NVYJ 2OF7A 2MGQA 5DCMB 2X6YA 3WTXC 4L18B 2COMA 2D2WA 4QSHA 3DKWA 2L9VA 4MTEA 3GVAA 3L9FA 4BU2A 3CO6C 1Q1HA 1J2XA 3HYIA 4EJVA 4E7JA 5EGOB 2PBIA 3M9AA 4MFDA 4KUMA 3J81Z 4X6AJ 1TWHJ 2K9MA 1VNDA 4LG3A 3U1DA 5FFZA 2I10A 9ANTA 3S2DJ 3I56I 1DPRA 1B72A 5IYCJ 1Z05A 2GZWA 2VONA 2X1DA 5KAIC 2NYXA 4A5MA 3B02A 3VODA 3GYHX 2L5QA 2VBZA 2XRLA 2HDWA 3ABTA 3CP2A 3WE2A 5JHFA 4A93J 3G4SI 1JGSA 1VI0A 3ULQB 2O3FA 3BG6A 3L2QA 3OYIA 1S7EA 2WY8Q 4M74A 1X3UA 4DGWB 3ZMDA 4XQFA 5J3LA 3ZQCA 2K5CA 2NS7A 2V4JC 2JA5J 4CYDA 3HPGA 3LAPA 2P0WA 2MA3A 1ACIA 3EUAA 3MD2A 5GAHJ 3HOTA 1XG1A 1U9NA 4H4KC 2ELJA 3KLOA 1FSEA 1U8BA 5HDGA 2DPUA 2R5YB 3K69A 1D8KA 4YFKF 3RQIA 2R4GA 2X6XA 1MD0A 4OIQF 1PP8F 3GF2A 2HGCA 2H94A 2BHYA 3R0JA 2A6TA 4OOIA 2DT6A 5L3DA 1ULYA 5GPCA 5HNHA 2GAUA 2H1KA 5J4VA 4ZYHA 1EV7A 2VE9A 2DFFA 2EFQA 1Z6RA 3PSIA 5LHGA 4PDKA 3VEPA 2Y0SA 4EMSA 2HWVA 4BE0A 3SFIA 2Y9ZA 1FYMA 3OV8A 5TISC 3BR6A 2WB1A 1FWZA 2L2OA 2HZDA 4G6DA 5BOXA 5FLVA 3EYIA 4D5FA 3R0AA 3L09A 5EEHA 3TP0A 2R7ZJ 3K4KA 1YS7A 4XMYA 1EKEA 5E20A 3TQNA 1XDUA 3GEZA 1WJAA 2WAFA 3DKXA 3FMRA 1JI8A 2R3SA 2DMUA 2A61A 3PQJA 4LIVA 2VL8A 3VSLA 1E3OC 2MH9A 2E1OA 2EZLA 5KVRA 5LBQA 4A3JJ 2ZJRF 2E19A 5LRRA 2FD5A 2F5FA 2L02A 4XOPA 2R7FA 2IA0A 2VXDA 1ZG5A 2A07F 1BI0A 4ENNA 2GXGA 3H1CA 4BBRJ 3PO3J 3P9IA 4MGRA 1ORKA 3BZKA 1S7AA 2P7VB 5F64A 3AL0C 4MLOA 2ZXHA 3NQOA 3MKWB 1LFUP 5D5WB 5DV5A 4IHSA 2PG4A 1ZGAA 2CUZA 1ODDA 1ETWA 3CC4I 2VBYA 1EA3A 3CCMI 4U0WA 4UUSB 2DXIA 3U21A 2P5VA 5J1UA 1MIJA 3I4NJ 2FQ3A 1UHMA 2E60A 1WVRA 3ZQFA 2BBYA 1K61A 1P4WA 1ZGJA 2F4MB 3CCVI 2CW8A 3BR1A 3OR1C 3FXJA 3HPHA 3HGGA 3OYBA 2PN6A 3OY9A 2M45A 3F8NA 2LYCA 4ON0A 5CLSA 3SFZA 2AS5F 4G6TB 5JR3A 5E8IA 2ZSHB 1MMDA 4ZDPA 3GFIA 3E7LA 2R5ZB 2IGKA 2JVGA 2L7FP 2AXTC 3KP4A 4GRIA 1KONA 2V6CA 1I5ZA 1S8NA 2STTA 1UELB 1D1AA 1OQYA 1MMGA 4C2TA 1HKTA 3WTVC 1YX3A 1VQNI 2QUFA 4P96A 3H3ZA 3HUGB 3IHUA 2OQGA 5E3NA 2R0QC 4ENMA 1D0ZA 4ZC3A 1K4SA 1OYIA 2EZHA 3S1RJ 3M07A 1RIOH 2V79A 4JX6A 1J0RA 4LLLA 1T0FC 3TO9A 5D5XB 2H6CA 4AC0A 2XPWA 2EFPA 4FHTA 4KYWA 2QEXI 4ZDLA 1DPUA 1JTXA 3IRRA 4ABZA 5ED4A 1O3SA 4RA2A 2F4IA 2LRDA 3G1OA 3WGHA 2A69F 5BQTA 1E17A 1GV2A 5FKNA 4UUTA 1SFKA 4HX4A 4XNFA 5K7ZA 1ON1A 4P9UA 2ELHA 3Q9VA 2DA1A 3CF2A 2YR2A 4UVBA 2BHZA 2MD5A 4EGYA 2OV7A 3AL0B 4Q47A 1M1EB 4RBOA 1JTYA 1UAAA 4HA8A 3P9KA 3SHFA 1LNWA 1D0YA 3DEWA 1HQCA 2Y9YA 4GDFA 3BPXA 4BY7J 3TO7A 2B63J 3N05A 3C1DA 5FKOA 1QZYA 4M3FA 2HYJA 1W5TA 2WAEA 1W4MA 1R49A 3LSKA 1FOWA 3F8CA 4IHTA 2IW5A 4LK1F 2EWNA 1WGXA 1I3QJ 1S5LC 2VKVA 4D9JA 3SQNA 2V1NA 1JGGA 2RC4A 2E2IJ 3S3NA 2PI0A 2Q1ZB 3MCZA 1ZAOA 4RM2A 5HLGA 2KRCA 3Q3SA 1ETXA 4U87A 3C2BA 1USTA 4K2EA 4IQ4A 3HC7A 1YOVB 3WTSC 4V19K 2VQGA 2ADUA 3RCOA 1S9HA 5IOZA 3HEFA 1HLVA 2ZFUA 3R61A 3KP3A 2OCCH 1LUJB 3IKTA 3K10A 4A12A 2JT1A 5L3CA 2OZ6A 2Y0SN 2W24A 3FIWA 5CQGA 1FT9A 2JPBA 1MJ9A 4NBQA 1WFXA 1AHDP 3PSFA 1FTZA 2K3FA 3DTIA 2WB1N 3FZVA 2P5LC 2XIGA 1YYVA 4LFUA 1V3FA 2ZO4A 2FNPA 3BY6A 2A5WA 2KPMA 3LFUA 4A3KJ 1FYKA 3NWSA 1OR7A 5E3OA 3D5RC 2XF7A 3C3WA 4HNUA 1YI2I 3OOUA 4QLCU 3EDPA 2XAFA 3MWMA 4AVZA 4PZJA 4S05A 4X0GA 3W3CA 3GXOA 1T98A 4M9XA 3I3LA 1FIAA 1BC8C 1IUYA 1YRNA 3HL2A 2CGPA 4XKBA 2O0YA 4HNVA 2EZKA 2EILH 3CCLI 2JK3A 3ERMA 3WGIA 3JRFA 4B3AA 1YX5A 4B09A 3QP5A 4XN0A 4ZZDA 4U88A 1BJZA 4G9YA 5H20A 3WTUC 2FX0A 5IP7J 4BQOA 4P55A 4RAZA 3DQVC 2HYFA 5B66C 3ZRGA 1XGNA 2Z1DA 3K4JA 4UHTA 1ZG1A 3CF5F 2VBXA 4S04A 1AKHB 2AHQA 2JRMA 2EIJH 2PMHA 3BDDA 3N97A 1YLFA 4FASD 1T95A 1ZARA 4AM3A 1F43A 4HDVA 2RNGA 1WKMA 4L0ZB 3T8RA 2EV6A 3JSOA 4HQEA 4IJAA 1B4AA 2DOAA 5F6FA 2VJ5A 4XLFA 1U9OA 1LVAA 1G6NA 3E6BA 4XKCA 5C4XJ 4F7ZA 3ZP5A 1I6HJ 1XPXA 1U78A 2QA4I 1HF0A 4UY8I 3KLNA 1W7PB 2VKEA 3WTYC 4IO9F 4WWCA 3BCAA 5EJCA 2FOKA 1HDPA 4PJ0C 5ILVA 4MEXF 1A6QA 3KCCA 4JQFA 1HCRA 2DJIA 3GTJJ 3I0TA 2K02A 1D8JA 1MMAA 1X3ZB 1OKRA 5TGTA 3ECOA 1FMWA 2D1VA 2FBHA 1LDDA 4O5VA 1ZRDA 2QQAA 1MDMA 3BG3A 4MTDA 1ZHFA 3HZJA 3A01A 2Q8KA 1BIAA 2A05A 3K6GA 2LG4A 3KPHA 4HX7A 4ZZLA 1XGOA 1F9NA 5KNLA 1IN7A 4JX5A 4I0AA 4J19A 5J1YA 1OCPA 1UHWA 1JJ8C 2Y75A 3OYJA 4BXUA 1NG7A 1J75A 1JKQC 1BL0A 2UUZA 2LOOA 4Y52J 3E5XA 4A6EA 3I55I 3UKGA 1R71A 2W82A 2DU9A 3ZGKA 4HQMA 2F4OB 2DBBA 4EGZA 2DA6A 4LLGF 4DZJA 1BN5A 4IHYA 2EQRA 2DDBA 3HHHA 4RLQA 4DQ2A 4FX4A 3NARA 4UV9A 1IN4A 2R7OA 2GM4A 1TNSA 3L2UA 1HKSA 2DFHA 2FOWA 2B0LA 2VB6A 2XAQA 3D5LA 4XRSG 3WHBA 4IX7A 1LJ9A 3LSMA 3VFZA 4BE1A 2DYRH 2DODA 3MZYA 3GFMA 3ISPA 2L7KA 3KIOA 3JSPA 3J7AO 2PJRB 4HF2A 4HX8A 4O6JA 3W6JB 1VQ6I 4L0YB 4B47A 1GUUA 2EZIA 3HTUA 3K7AJ 4II2A 4YEJA 1I1SA 3FISA 1EJ9A 2Q2EB 2KHMA 2OAZA 2W48A 5B1BH 3OIOA 3PUFA 2M2EA 5GAGJ 2R7XA 1YW8A 4B48A 1H9GA 3GLLA 2JA8J 1ZELA 5E1XA 2CH0A 1Y56A 3HG9A 3FXQA 4FX0A 1OCRH 1SVMA 2C6YA 3DBLB 1TWGJ 4XLEA 4F91B 1A6IA 5F1RA 2W1OA 1P7JA 4V2GA 5LEKA 2KL4A 1IUFA 3JRHA 3OYHA 2E7WA 1POGA 4MQVA 1J59A 3EETA 4DNCA 3M7GA 3JREA 2OTJI 4E7KA 2EA4A 1FOXA 1MGTA 2DA7A 3PJRA 4HSTA 2M4KA 3RDIA 2G7UA 1R6RA 5C3EJ 3FX3A 4E4HA 2HVSA 5A2QZ 4BDZA 2GXAA 2J5PA 2OQRA 1SD7A 3P5JA 2XF6A 4NQWA 3F8FA 3R4KA 4ZDOA 2ZXJA 2KDZA 3CUQA 4EM1A 1SMYF 4LITA 1NH3A 1Z3YA 2M8GX 1SFUA 3CLOA 2ZSIB 2FE3A 1S29A 3BWGA 3CQZJ 3DBRB 3HM5A 3QPLA 3LQRA 1A36A 1DP7P 3VB2A 1PUEE 3HOZJ 2K86A 3TP3A 3AAFA 2VT2A 3MKZA 1WSUA 1PJRA 2Z5UA 4E7HA 3V8JA 2VJJA 3LAJA 3TEDA 2QM3A 1ZRFA 2A6HF 4RLFA 2STWA 2PLYA 3CDLA 1SMTA 3ZQIA 4EJTA 3ZN1A 4S0HB 3PIOF 2BYVE 2HTSA 5F27A 3TOBA 3DXJF 3V8KA 3K4NA 5L3FA 1TZLA 2JUGA 3FXMA 2VPRA 5JI6A 3IH2A 1E0EA 2RGVA 4RGRA 4CZCA 3OWTA 2F6CA 2QENA 2DW4A 3K70D 4KT6A 3BCBA 2HVQA 3DEUA 3MEXA 3J7ZI 2VJ4A 4XN3A 1UJ8A 4FE7A 2XHKA 3V8LA 2BY0A 2IGMA 2HNHA 4NC7A 3ERED 1B9MA 4M73A 2HOEA 3WODF 3CDIA 1P2FA 2DDAA 2P4WA 1T2KA 2X48A 1K6YA 2OJED 2LSOA 1Z7UA 2DI3A 4OWRB 1OR7C 4IHWA 2BEOA 1T08B 2CSOA 3QRFF 2CU7A 2EBIA 2YPRA 3HKZN 3ONQA 5JLXA 1XGSA 2WADA 3FDYA 3VSKA 3CC2I 2RDPA 1PYVA 3LFKA 3TOAA 3KP5A 1YG2A 2ESHA 1WHUA 1QU3A 2HPMA 4HPQA 2BVLA 4I09A 4BJ6C 4LIUA 1Z67A 2FXAA 2M9HA 3GLXA 1SEUA 4IVNA 3H0GJ 1B6AA 2N8GA 4E7ZA 1QHHD 1P7IA 2K9SA 3EUKL 1VQKI 3C7JA 1KQ9A 3BR3A 1ZYRF 2FQ4A 3H5RA 1FMVA 2JSPA 3A0HC 2XAJA 2RKHA 4EQQA 3CO7C 1F4KA 4XORA 4BACA 3DU6A 3IWZA 3K1NA 5AONA 1T39A 1ZREA 4I6ZA 1CQTA 4I99C 3FXRA 1IN8A 4CUGA 4XLHA 3LA7A 5DD8A 2CJJA 5ICCA 3I54A 3H92A 5DCFA 4A0YA 4AIJA 2IS2A 2VOPA 1XX5A 1HSTA 2MLKA 1P92A 2BY1A 2CS3A 2Z16A 1Z7LA 5FLXK 2Z3YA 1P9QC 3KZIC 3FBIB 2DTRA 3H0DA 1IJWC 3MAJA 1V5EA 2XRNA 4AD9A 5D6FA 3EPZA 5GTIC 3G1LA 4CZZA 2LY2A 2PQ8A 2QQBA 2ZC2A 2B7EA 1OYWA 1KYZA 3N4MA 5B3SH 1W5SA 2FNAA 4XRFA 1MKMA 2XC7A 1ZKGA 1RPWA 2NS0A 3RQ4A 3HRSA 2RQPA 3FWEA 2IRFG 3RTRA 5LLQA 1LVKA 4HBLA 3KE2A 1VF9A 4BJ5C 3PNVA 4KITB 1YRNB 5DDGA 3WG7H 2X9DA 3OL4A 5AIPA 1MH4A 2HDCA 3QU6A 1P4XA 5LGTA 1IRGA 3GZ6A 2MLGA 4A0ZA 4RGSA 3VYSB 1XN7A 4M3BA 2L4AA 1ZRCA 1FP1D 4EVIA 5BNGA 4LB6B 1KGSA 4W1UA 2UV1A 2LREA 2LF8A 3ZR8X 3T1BA 1T6SA 2E35A 5BPIA 2W25A 3CMMA 4QWQA 3I9V2 2P81A 1JT0A 2XF5A 1U5TC 2CMPA 5K1YA 3NAUA 4MFEA 1IF1A 1QA6A 4U0VA 2LKPA 4B4CA 1G3YA 2HKOA 1SC7A 5J6XA 2L7MP 3ZMSA 3JAMK 5AIQA 2HPIA 1LFBA 1WJ5A 4CH7A 3QYBA 3NEUA 3FK6A 5C44J 4PSXA 5HS7A 2R7RA 5EF6A 1ZTRA 3LSPA 3IP4B 1ITYA 1BI3A 3FM3A 1MSEC 2QYOA 1SVLA 1Y8QB 2LMDA 2IPQX 3W2WA 3K4LA 4PUSA 3A4CA 1GDTA 2JA6J 4ASNA 2Q0OA 2X0LA 1WPKA 3A01B 4DBRA 1LFPA 3CUQC 3HOXJ 2D45A 3S16J 5M3FJ 4OMZA 2M30A 2DT7B 4DIQA 1RC9A 4BQNA 2R7UA 4U0YA 3GZNB 4FISA 1HA8A 2DT5A 3ZMTA 2KFDA 4C9YA 1F5TA 4BHBA 4CYCB 1FSHA 2DQRA 2KLOA 1BOAA 1WH5A 2KISA 4QIWN 2LBFA 4XM3A 1ETOA 1KU9A 3QODA 5HDKA 4I7HA 3SDBA 4CCMA 2DMTA 4YIIA 3HIFA 3TGNA 5JVTA 4KNYA 4XRSA 5FKKA 3K4MA 4Y17A 2M1BA 3IAM2 2D5VA 3FK7A 4ESBA 1FBQA 4D1QA 1IDZA 1WI9A 1XB4A 4OIPF 1Z21A 2GLOA 5E18F 3JRCA 1R7JA 3DLLF 4EM0B 5FGMA 1S6LA 1WJDA 3CJNA 3QPTA 4L9TA 5FJ8J 2CQXA 3BJAA 4Y4RA 3CCUI 3BQZA 3OIPA 3MMYB 1D1CA 3FBNB 4CGZA 2E1NA 3I59A 2IP2A 2UXXA 2ESNA 2XROA 4E7IA 4KICA 3CESA 2KDOA 1U5TB 3BTJA 4B44A 3ZPLA 4M9ZA 4Q4ZF 3OYCA 2Y31A 4ZYEA 3RKQA 3M8EA 4FETA 3J7AY 1USSA 2H8WA 1MH3A 2QSGX 3SZTA 1RI7A 4X1EA 4Q5SF 2VN2A 1BR4A 5LD2C 1ETVA 3JTHA 4WXCA 2ME6A 2CQKA 2BV6A 3MKLA 4D5CA 3OSGA 4YIFA 1TTYA 1FNNA 3F21A 2GWRA 4IOAF 1PP7U 4XLAA 2VBWA 3V4GA 3BTIA 3MVPA 3C2HA 1MBJA 1B59A 1IAWA 1QPMA 5KCMA 3L2CA 1TWFJ 3GCMA 3GTOJ 4LJZF 4ZTJA 3S2WA 3JRGA 4BXFA 1YJWI 3CUQB 3CTAA 2IXSA 1XSXA 2FRHA 1XTAA 3KP7A 5IYBJ 1X1DA 4ZH4F 4R79A 5LGNA 1B8IB 1X19A 5DM6F 1WZ2A 2UZKA 3T5XA 3KEOA 4A3GJ 1PUFA 3OYMA 4HLXA 1RRJA 2LFBA 3WU2C 2WV0A 4DOZA 3K2AA 4LMYA 2HZTA 3CZ6A 4WX9A 4MQ9F 2ZJPF 3BZ6A 2M7BA 3OS2A 4E7LA 2MSYA 2CFOA 3WTWC 1QPIA 2K4JA 1X1CA 5C4JJ 5J40A 1O57A 1VQOI 4CCNA 3H9JA 4J00A 2LNBA 3LOCA 2X1EA 2L9SA 3U9GA 3TW6A 5EG0B 4Z2YA 1QO0D 4AIKA 1E3HA 2HFHA 4Y13A 1DP3A 2RV8A 1D3YA 1MNEA 4BKXA 1R23A 2J5OA 2EJRA 1KU3A 1ZK8A 4FTHA 5LGUA 4ENJA 1X58A 4GO1A 1K83J 1IXRC 3KP2A 2XAGA 4EV0A 5KAFC 1ETQA 5BMZA 5J8FA 5DYMA 1I1GA 5IOYA 3Q0WA 3EUHA 5CJ9A 2HI3A 4G8XA 2LF7A 2E2HJ 1SANA 3VOEA 2HQRA 2A3SA 3FXKA 4N4NB 3IKVA 3RPQA 1ZLKA 3R6SA 3H35A 3I53A 4IXAA 5DUIA 1X1PA 1CF7B 5HODA 2OUMA 4I2OA 3L00A 2P7CB 3A03A 1X1AA 5J4YA 2X6OA 5F04A 4KISA 2GXBA 3BC8A 1MBHA 5ICEA 4QTRA 2R93J 3DKYA 5DM7F 3QYEA 3IH4A 4Z6YA 2XKOA 4KMUX 5KK1A 2L7ZA 3KX2A 1FY7A 1JE8A 2BOLA 1Z9CA 3FM5A 2LY9A 1Y1VJ 2AQEA 2DYSH 5EDNA 2CW7A 3ELKA 3JRIA 3AG2H 2K9NA 4WXDA 1GXPA 2X85A 4XICA 4CCOA 5IY5H 3JTGA 2Y48A 3FKJA 1YE9A 4RAYA 3SEZA 3ESWB 3HTSB 4GYGA 2DTZA 2ZMEA 3TO6A 2IT0A 4RS8A 3K9TA 1APLC 2MABA 4YELA 1BR2A 5HNFA 4GYIA 4HDUA 1XSVA 1LE8B 3AFHA 5CKTA 4UVCA 1U3EM 3OMYA 1UHSA 2W57A 3G73A 2HKXA 3KEQA 4I0BA 1BI2A 2MG4A 4D7MA 3ECHA 1WH7A 5F0HA 1R22A 3TW7A 1MBGA 1TQPA 1YIJI 1KU2A 4L9VA 1MJAA 3QU3A 3X2QH 1VQ8I 2OA4A 2BW3A 3HJEA 5CYVA 2F5EA 3JRAA 2IS1A 4M3DA 2NS8A 4BS9A 3CJQB 3H9GA 3CC7I 2R7VA 2XB0X 5EEGA 3OYFA 4KIGA 1NK2P 1UMQA 3UR3C 1G8XA 3KYCB 3GTQJ 2R5YA 2KIUA 5B5EC 2PX9A 2VQCA 2W4SA 3R60A 4IOCF 1B72B 2K85A 2OPTA 4UB8C 4OINF 1B9NA 1YHQI 1MBEA 4A3BJ 2LVSA 1YITI 1TT5B 4U7DA 5F08A 2QKMB 3IH3A 1A31A 5CQEA 3H5AA 1MNMC 2M3AA 2BY3A 1E2XA 2HTJA 4ZYDA 3O3KA 1DDNA 4XLPF 2NAZA 3CDHA 3I71A 1IV8A 3FHZA 5TRDA 1IG7A 4UV8A 3GW2A 1MMNA 3NRVA 3AG4H 2DAOA 2ZXWH 3PFYA 4N0BA 4CDGA 3FXOA 4CCLA 1H0MA 2L0KA 4CICA 1ETYA 1MBKA 3PNTA 2R7DA 5LEJA 3L2RA 1XDSA 3D5SC 2CRGA 4N4OB 1KZHA 3PIPF 3CMYA 2E36A 5JVGF 4ANJA 3ZXSA 2CO5A 5FROA 2M5WA 2LKSA 3S17J 2ZXIA 4EEFG 1SD5A 1XS9A 2EFWA 1HSJA 3E6DA 2H27A 3G3ZA 1GV5A 2K27A 3E6MA 3M1EA 1TWCJ 3VWBA 2DFIA 2VASA 1YJNI 1W36D 2QQ8A 2XDVA 1QNTA 3B6AA 4Y15A 5A2QK 2NVQJ 1FP2A 1UCRA 3OYNA 2L4MA 2CQQA 2UXNA 4GXOA 2A6EF 5D4RA 2K4BA 2NNYA 4BYYA 3HXLA 3KFWX 3MKYB 3EQLF 3PFIA 3M4OJ 4HF1A 3HRMA 2K3PA 3BT9A 3FF5A 3KEYA 4MO7A 4M6XA 1HXDA 2GA1A 4WXHA 3VYUB 2MD0A 1CGPA 2HDDA 2DJNA 3DU5A 5ILSA 3QPSA 4F52A 1UG0A 1TL8A 1AWCA 4DYQA 1K79A 1SFOJ 4KN4X 3IL2A 1B1BA 5IP6A 3TBIA 2MC3A 3GTLJ 4IRIA 2BE5F 3BQYA 4F93B 3OYEA 2DQLA 4EJUA 2OZUA 5DS9A 2HQAA 4NUBA 2KZVA 3JR9A 1MBFA 4RAFA 2WWYA 4C2UA 1FC3A 2M7AA 1FZPB 2XAUA 4A3CJ 5M5WJ 1LDJA 4KT5C 1ZG3A 1VTNC 2E5ZA 3OS0A 2W84A 2ISYA 4V2FA 5LHIA 2IAIA 2LBFB 2LTPA 4QPQA 4TV7A 2JSCA 1BI1A 2R5ZA 1KYWA 2P5KA 5EYRA 1GXQA 2ZFWA 3LQQA 3GTGJ 1FIPA 3HB9A 2DA5A 1RKWA 1DGRM 2HR3A 4PJNA 1YFHA 1TW3A 1S72I 5BPDA 2IA1A 2QKLB 2V26A 1QHGA 3RJPA 2IS4A 3IWFA 5IT9K 1E3PA 1PVEA 3KYDB 2QSFX 1ONVA 2XPVA 1J9IA 4IKFA 2E5NA 1OMIA 5GTHC 2YX7A 1Q1VA 1XMKA 1RUOA 1J5YA 2TDXA 3IAS2 4WF2A 3ABUA 5DUKA 2ECCA 4BDYA 2O61A 2OCEA 1UG2A 3E97A 3I59B 1F1ZA 1BIBA 4XL9A 1WWXA 1MNDA 2QLZA 3BTLA 1VQPI 4I01A 4M6VA 2EV5A 3BR2A 1Y8RB 3OSFA 2HXOA 1HBXG 3F22A 1U2WA 1T33A 3RKXA 1WJBA 1REPC 2DA2A 2Y2ZA 2BGCA 3L2VA 2DCEA 4BQQA 1DU6A 1SAUA 2YSRA 2QBYA 1ZQ3P 3ABKH 3KZZA 2QF7A 2NOJB 4A5NA 4UUVA 2AO9A 3RIRA 3I64A 5E3LA 1LPQA 5LHHA 2DMQA 1N75A 4RGXA 2Z9OA 1JKPC 5FRMA 1O3TA 1AU7A 4F55A 1KQ0A 2R7QA 5BS6A 2F5CA 2I5UA 4LGWA 3AG3H 5FRNA 1D1BA 3RPUA 1D5VA 2W85A 2DFEA 3GBGA 3M3YJ 4XLCA 1OYYA 4ESFA 2M34A 2AXLA 3BP8A 4JP0A 3GTKJ 1IXSB 1HC8A 3FXUA 3V42A 2MW8A 2V1XA 1TT0A 1QBJA 3TMOA 4DJAA 3SZPA 4H0EA 4BE2A 1LEBA 2Y30A 1NTCA 2ZMEC 2KMUA 4D7NA 1TQMA 2OTLI 4XONA 2OC6A 4BNCA 3WU0A 1U6GA 2QCOA 2ZCWA 1VQ9I 5FB2A 2CWEA 2NNNA 2V9KA 2ZKZA 3LSIA 3J81K 4LB5A 4IQJA 1EH8A 3J7YJ 1QVTA 1YQAA 2RAEA 3K70C 1FX7A 2H8RA 4E7SA 1IRFA 2OD5A 1BR1A 1HW2A 1JT6A 1RETA 3CCRI 1A35A 1UZCA 2CFXA 4E6KG 2JZYA 2GIVA 3VDXA 2EH3A 3Q9SA 4XRMA 3ABLH 2FBIA 5DTDA 4MNUA 1X4OA 2V1DA 4IEJA 3HRUA 2WBMA 5D4SA 1XMXA 4I76A 3BZCA 4F92B 1BC7C 3RYPA 2BZTA 4CCKA 2GA2A 3HSFA 3QOPA 4I98B 3K4CA 5HS9A 4ESJA 2RNJA 4KFCA 1TBXA 1IRXA 2DK5A 2MC4A 3DWLE 2ECBA 5E8GA 2VODA 2M87A 1Y39A 4HAMA 2VPLA 1IW7F 1O7FA 2KP6A 1XGMA 1UFMA 1GHCA 2KIQA 1L3LA 5EZHA 3COAC 4LK0F 2V6EA 1R4NB 3D1NI 2EB7A 5LFAA 3GZ5A 3G71I 2MYSA 3VYTB 2O8XA 1VZ0A 3K1MA 3O8GA 4XR6A 4FE4A 4RAGA 1FJLA 1IZ1A 4YG2F 3ZCOA 3LSHA 4L5IA 4CCJA 5J8CA 2OU2A 2JWTA 2CV0A 2V1UA 4RM3A 2ZNZA 3M8FA 1AKHA 5DD4A 1YTYA 2DA3A 1IC8A 2XSJC 3LA3A 4A2UA 2KIMA 3GUDA 1XCVA 3OYKA 5FO5A 4L9JA 2E2JJ 4G6QA 2L54A
chains in the Genus database with same CATH topology
1TNTA 1R00A 4CO8A 1K6OA 1L0OC 1R5GA 2KIFA 1YW9A 4XBFA 3FMQA 1QZZA 5CVIA 1BBYA 2ZMEB 1W7PA 5K5QA 1YIOA 2JPCA 2WC2A 1TQIA 3J80Z 2FEZA 3B73A 1K78A 2HYGD 2CYYA 2ETHA 3F3XA 5D5VB 3QAHA 1ON2A 3GX4X 2YX4A 5FLXZ 2K7LA 2RN7A 2WTEA 4MEYF 3TDUC 1XD7A 3T0YA 2VOOA 3F8BA 4HYEA 3E6CC 4E70A 2DPDA 4YFNF 4HV6A 2DO7A 2QZ8A 3O2PE 2FMLA 1K7AA 1JHHA 3GO5A 4M9SA 4M72A 1MDMB 1GVJA 1T38A 4FT8A 3KETA 3I4PA 2XGXA 1STZA 3BROA 2DLLA 1TW2A 3HSRA 1RZ4A 1FLIA 2G7HA 2Q2EA 3DF8A 4R1HA 2EV0A 3K0LA 1SFEA 1S7OA 4ETSA 4NB5A 5CVJA 5L3GA 4HF0A 2H09A 3ZN0A 2L01A 1FBSA 1EH6A 2GQQA 1JHFA 2ZJ2A 2RVCA 4RB2C 2O6GE 3JW4A 1QQIA 4IRGA 4P9FA 1R36A 1YW7A 3I5UA 5L3EA 3JAMZ 1LQ1A 3HRTA 4KMFA 4XSZF 4LG0A 4EM2A 4ZYGA 2HEOA 3KP6A 3BPVA 2EK5A 2VXZA 4HOBA 3ZMVA 1WQ2A 3W6KB 5HOOA 1KA8A 1J7KA 2V9VA 4P5OA 5K5RA 2XAHA 4PGHA 5D8KB 4M6YA 4A6DA 5FD5A 3RKYA 3F8MA 3F6VA 4ENKA 1A04A 2KJBA 4LD5A 4BQAA 3WE3A 1C0WA 2ISZA 3FMSA 3P9CA 1I6XA 3ZQ7A 2L3DA 2EFNA 3CUOA 2ZBKA 4OIOF 3MQ0A 1HW5A 4AIHA 3ML6A 2FBKA 4KIFA 2XVCA 3D0SA 1IXCA 1W7PD 3F23A 1ZN2A 1LDKB 1QGPA 3WG9A 2ACJA 2G9WA 4L9NA 2QBYB 4R8HA 2VC1A 1G3WA 3V7RA 3E5UA 3H3UA 3E5QA 2KRFA 2CG4A 4O3MA 5CVRA 4KA4A 4WCGA 5ILUA 4HZFA 3OOPA 3BJOA 5D8LB 2XKPA 2FMYA 4HV5A 4PGGA 2E7XA 5K5OA 3F72A 1O7LA 3RYRA 5DCMA 2NRAC 3T8TA 1O3RA 2DK8A 2XUBA 2FA5A 5IT3A 5LRSA 2KJCA 1RUNA 1G4DA 3MFKA 1Y0UA 2MBFA 2P6TA 2PEXA 4RB3C 4BAYA 3QPHA 1Z6TA 2HQNA 3LA2A 3MZHA 2ZNYA 4PCQA 4N9IA 5D5UB 3O6BB 4Q48A 4G7HF 4B8XA 3HHGA 3TDZC 2P8TA 3EYYA 4I02A 4JBAA 3E3VA 5E1ZB 1PDNC 2YU3A 1SD4A 2MH2A 2EFOA 1H9TA 3LSTA 5DEQA 1LB2A 3L7WA 4AVPA 2HS5A 2O03A 5L3BA 1FOKA 4GGGA 5E17F 4OIRF 3HOSA 1FYLA 4KN7X 2CW0F 2JRTA 1BJAA 3ZMZA 1TLHB 4RB1A 3DP7A 4MHGA 2QVOA 3F6OA 1IN5A 2X4HA 4BHPA 4OU0A 4U7BA 4CXFA 1K78B 3BJ6A 3TKYA 1XCBA 2F2EA 3K2ZA 5ICFA 2A68F 1SAXA 1R1TA 3V7SA 2F5DA 1S3JA 1SD6A 1HW1A 1XSDA 1YS6A 1SFXA 4RB0A 3V7CA 4CHUA 2Z33A 4EJWA 1MZBA 1G3SA 1WRJA 1FPQA 1YO5C 1RNLA 3IC7A 5HLIA 3RKWA 4G7ZF 3DPLC 1OPCA 5H6RA 4OMYA 4JK1X 3GWZA 3WU1B 1R5HA 4BHCA 3WTTC 2KKOA 1HKQA 4BH9A 3GFJA 4IPAA 3Q5FA 4UVAA 4UNOA 4YFXF 3BOQA 3U2RA 5CVUA 1U5TA 5FFXA 4M71A 5FD6A 3WTZA 2FSWA 2EA2A 5ERIA 5HVQC 4UXNA 2QQ9A 2PMUA 3PQKA 4AWXB 1O3QA 4XLNF 1P4AA 1Z1DA 3HUGA 1V4RA 2OBPA 3ZMUA 1NHAA 1JXSA 4D0PA 1XMAA 5JFRA 1U8RA 4LG0B 3KZYA 1KQ8A 3LWFA 4HW0A 2VC0A 1AOYA 1Z91A 2E1CA 3WGGA 2IA2A 3REOA 6PAXA 1KU7A 5HLHA 2XASA 2PFBA 3C18A 3RI4A 2P6SA 2PJPA 4IF4A 5CVVA 4WK8F 4L5JA 5H6QA 3IRQA 1LEAA 3HSEA 2QWWA 5E1WA 2D1HA 2XV4S 5HS8A 2VE8A 2FF4A 3DPTA 4G7OF 1BM9A 3P7NA 2UWMA 4KDPA 5D6EA 5IT9Z 1R1VA 3QP6A 1R58A 2VT3A 4EJOA 1I27A 1CF7A 1ZH5A 4N9HA 1G3TA 3DV8A 3K1PA 2M8EA 3ROUA 2JTVA 3GFLA 2IVMA 2LDUA 1P6RA 1T0FA 5ICGA 4HLYA 4IRHA 2Y0MA 3SXYA 1MJBA 2H6BA 5JHUA 1FBUA 4KIBA 4RGUA 4GCVA 1R1UA 1IN6A 1UB9A 2FU4A 1EH7A 2Z99A 2IJLA 4XSXF 4NHJA 1ZLJA 3J80K 2A5YB 3I58A 5TJJA 5HDNA 3DFGA 4A0XA 1DUXC 4G94A 4LLNA 5DCMB 3WTXC 4L18B 2COMA 2D2WA 3DKWA 4MTEA 3GVAA 3L9FA 3CO6C 1Q1HA 1J2XA 3HYIA 4EJVA 2PBIA 3M9AA 4KUMA 3J81Z 3U1DA 5FFZA 1DPRA 1Z05A 2GZWA 2VONA 2NYXA 4A5MA 3B02A 3VODA 3GYHX 2VBZA 3ABTA 3WE2A 1JGSA 3ULQB 2O3FA 4M74A 1X3UA 3ZMDA 4CYDA 3LAPA 2MA3A 3HOTA 3KLOA 1FSEA 5HDGA 2DPUA 3K69A 1D8KA 4YFKF 1MD0A 4OIQF 1PP8F 3GF2A 2HGCA 2H94A 3R0JA 4OOIA 5L3DA 1ULYA 2GAUA 4ZYHA 1EV7A 2VE9A 2EFQA 1Z6RA 5LHGA 4PDKA 3VEPA 4EMSA 2HWVA 1FYMA 3OV8A 1FWZA 4G6DA 5BOXA 3EYIA 5EEHA 3L09A 3R0AA 1YS7A 3TQNA 5E20A 1XDUA 3GEZA 3FMRA 2R3SA 3PQJA 2A61A 2MH9A 5KVRA 5LBQA 5LRRA 2F5FA 2L02A 2R7FA 2IA0A 1ZG5A 2A07F 1BI0A 4ENNA 2GXGA 3P9IA 4MGRA 1S7AA 2P7VB 5F64A 3NQOA 5D5WB 5DV5A 4IHSA 2PG4A 1ZGAA 1ODDA 2VBYA 4U0WA 2P5VA 2FQ3A 1UHMA 2BBYA 1P4WA 1ZGJA 2PN6A 2M45A 3F8NA 4ON0A 5CLSA 3SFZA 2AS5F 5JR3A 5E8IA 3GFIA 3KP4A 2V6CA 1I5ZA 1S8NA 2STTA 1HKTA 3WTVC 2QUFA 4P96A 3H3ZA 3IHUA 2OQGA 4ENMA 1OYIA 1RIOH 2V79A 1J0RA 4LLLA 3TO9A 5D5XB 2H6CA 2EFPA 4FHTA 4KYWA 1DPUA 3IRRA 5ED4A 1O3SA 3WGHA 2A69F 5BQTA 1E17A 4HX4A 1ON1A 4P9UA 2ELHA 3Q9VA 2YR2A 4UVBA 2MD5A 4EGYA 4Q47A 4HA8A 3P9KA 3SHFA 1LNWA 1HQCA 3BPXA 3TO7A 3C1DA 1QZYA 1W5TA 1W4MA 3F8CA 4IHTA 2IW5A 4LK1F 2EWNA 3SQNA 2RC4A 2PI0A 3MCZA 1ZAOA 5HLGA 1USTA 4K2EA 3WTSC 2ADUA 3R61A 3KP3A 3IKTA 4A12A 2JT1A 5L3CA 2OZ6A 2W24A 1FT9A 2JPBA 1MJ9A 3FZVA 2P5LC 2XIGA 1YYVA 4LFUA 1V3FA 2ZO4A 2FNPA 3BY6A 1FYKA 1OR7A 3C3WA 4QLCU 3EDPA 2XAFA 3MWMA 4PZJA 4S05A 3GXOA 1T98A 4M9XA 1BC8C 1IUYA 2CGPA 2O0YA 3WGIA 4B09A 3QP5A 4ZZDA 4U88A 4G9YA 5H20A 3WTUC 4P55A 4RAZA 3DQVC 2HYFA 1XGNA 4UHTA 1ZG1A 2VBXA 4S04A 2PMHA 3BDDA 3N97A 1YLFA 1ZARA 4HDVA 4L0ZB 1WKMA 3T8RA 2EV6A 3JSOA 4HQEA 4IJAA 1B4AA 5F6FA 1LVAA 1G6NA 3E6BA 4F7ZA 3ZP5A 1U78A 3KLNA 1W7PB 3WTYC 4WWCA 2FOKA 5ILVA 4MEXF 3KCCA 4JQFA 3I0TA 2K02A 1D8JA 1OKRA 3ECOA 4O5VA 2D1VA 2FBHA 1LDDA 1ZRDA 2QQAA 1MDMA 4MTDA 1ZHFA 2Q8KA 1BIAA 4HX7A 4ZZLA 1XGOA 1F9NA 1IN7A 4I0AA 1UHWA 2Y75A 4BXUA 1J75A 3E5XA 4A6EA 2DU9A 4HQMA 2DBBA 4EGZA 4LLGF 1BN5A 3HHHA 4FX4A 4DQ2A 4UV9A 1IN4A 1TNSA 1HKSA 2XAQA 2B0LA 3D5LA 1LJ9A 3VFZA 3MZYA 3GFMA 3ISPA 3J7AO 3JSPA 4HF2A 4HX8A 4O6JA 3W6JB 4L0YB 3HTUA 1I1SA 2OAZA 1YW8A 1H9GA 5E1XA 3FXQA 4FX0A 2C6YA 5F1RA 5LEKA 1J59A 2E7WA 4MQVA 3EETA 4DNCA 3M7GA 2EA4A 1MGTA 3RDIA 2G7UA 3FX3A 5A2QZ 2J5PA 2OQRA 1SD7A 4NQWA 3F8FA 3R4KA 2ZXJA 3CUQA 4EM1A 1SMYF 1SFUA 3CLOA 2FE3A 1S29A 3BWGA 3LQRA 1DP7P 3VB2A 1PUEE 2K86A 3AAFA 2VT2A 1WSUA 2Z5UA 3V8JA 3LAJA 2QM3A 1ZRFA 2A6HF 2STWA 2PLYA 1SMTA 4EJTA 3ZN1A 2BYVE 2HTSA 3TOBA 3DXJF 3V8KA 5L3FA 5JI6A 2RGVA 4RGRA 2QENA 2DW4A 3DEUA 3MEXA 2XHKA 3V8LA 3ERED 1B9MA 4M73A 2HOEA 3WODF 1P2FA 2P4WA 1T2KA 2LSOA 1Z7UA 2DI3A 2BEOA 2CSOA 3QRFF 2YPRA 1XGSA 2RDPA 3LFKA 3TOAA 3KP5A 1YG2A 2ESHA 4I09A 2FXAA 3GLXA 4IVNA 1B6AA 3C7JA 1KQ9A 1ZYRF 2XAJA 2RKHA 4EQQA 3CO7C 1F4KA 3IWZA 3K1NA 5AONA 1T39A 1ZREA 3FXRA 1IN8A 3LA7A 5DD8A 5ICCA 3I54A 3H92A 5DCFA 4A0YA 4AIJA 2VOPA 1HSTA 2MLKA 1P92A 5FLXK 2Z3YA 2DTRA 3MAJA 2XRNA 4AD9A 5D6FA 4CZZA 2PQ8A 2QQBA 1OYWA 1KYZA 3N4MA 1W5SA 2FNAA 4XRFA 1MKMA 2NS0A 3HRSA 2RQPA 3FWEA 2IRFG 3RTRA 5LLQA 4HBLA 3KE2A 5DDGA 5AIPA 2HDCA 3QU6A 1P4XA 5LGTA 1IRGA 3GZ6A 2MLGA 4A0ZA 4RGSA 1XN7A 2L4AA 1ZRCA 1FP1D 4EVIA 4LB6B 1KGSA 2LF8A 3T1BA 1T6SA 5BPIA 2W25A 4QWQA 1U5TC 5K1YA 1IF1A 4U0VA 2LKPA 1G3YA 2HKOA 5J6XA 3ZMSA 3JAMK 5AIQA 3NEUA 5HS7A 1BI3A 3FM3A 2QYOA 2IPQX 4ASNA 2Q0OA 2X0LA 3CUQC 2D45A 4OMZA 2M30A 4U0YA 2DT5A 3ZMTA 1F5TA 4BHBA 1FSHA 2DQRA 1BOAA 1KU9A 5HDKA 4I7HA 4YIIA 3HIFA 3TGNA 5JVTA 4KNYA 4Y17A 2M1BA 4ESBA 1FBQA 1WI9A 1XB4A 4OIPF 5E18F 1R7JA 4EM0B 5FGMA 1S6LA 3CJNA 3QPTA 4L9TA 3BJAA 4CGZA 2E1NA 3I59A 2IP2A 2UXXA 2ESNA 2XROA 4KICA 1U5TB 3ZPLA 4M9ZA 4Q4ZF 4ZYEA 3M8EA 1USSA 3SZTA 1RI7A 4Q5SF 2VN2A 3JTHA 4WXCA 2CQKA 2BV6A 4YIFA 1TTYA 1FNNA 3F21A 2GWRA 1PP7U 3V4GA 2VBWA 1B59A 1IAWA 1QPMA 3L2CA 4LJZF 3S2WA 3CUQB 3CTAA 1XSXA 2FRHA 3KP7A 4ZH4F 4R79A 5LGNA 2UZKA 3T5XA 3KEOA 4HLXA 2WV0A 4LMYA 2HZTA 4WX9A 4MQ9F 3BZ6A 3WTWC 2K4JA 1O57A 2LNBA 3U9GA 4Z2YA 1QO0D 4AIKA 2HFHA 4Y13A 2RV8A 1D3YA 1R23A 2J5OA 2EJRA 1KU3A 5LGUA 4ENJA 4GO1A 1IXRC 3KP2A 2XAGA 4EV0A 5BMZA 5J8FA 5DYMA 1I1GA 3EUHA 5CJ9A 4G8XA 2LF7A 3VOEA 2HQRA 2A3SA 3RPQA 3IKVA 1ZLKA 3R6SA 3I53A 4IXAA 5DUIA 1CF7B 4I2OA 3L00A 2P7CB 2GXBA 5ICEA 2XKOA 4KMUX 5KK1A 1FY7A 1JE8A 1Z9CA 3FM5A 3ELKA 4WXDA 1GXPA 3JTGA 2Y48A 4RAYA 3HTSB 4GYGA 2ZMEA 3TO6A 2IT0A 4RS8A 3K9TA 4GYIA 4HDUA 1XSVA 4UVCA 1U3EM 2W57A 3G73A 2HKXA 3KEQA 4I0BA 1BI2A 3ECHA 1R22A 1TQPA 1KU2A 4L9VA 1MJAA 3QU3A 2OA4A 5CYVA 2F5EA 5EEGA 4KIGA 2KIUA 3R60A 4OINF 1B9NA 4U7DA 2HTJA 1E2XA 4ZYDA 3O3KA 1DDNA 4XLPF 2NAZA 3CDHA 3I71A 5TRDA 3FHZA 4UV8A 3GW2A 3NRVA 2DAOA 4N0BA 4CDGA 1H0MA 4CICA 2R7DA 5LEJA 1XDSA 2CO5A 2M5WA 1SD5A 2EFWA 1HSJA 3E6DA 2H27A 3G3ZA 2K27A 3M1EA 3E6MA 2DFIA 4Y15A 1QNTA 5A2QK 1FP2A 1UCRA 2L4MA 2UXNA 4GXOA 5D4RA 2A6EF 2K4BA 2NNYA 4BYYA 3KFWX 3EQLF 3PFIA 4HF1A 3HRMA 3FF5A 4M6XA 1HXDA 2GA1A 4WXHA 1CGPA 5ILSA 1AWCA 1K79A 4KN4X 3IL2A 1B1BA 2MC3A 4IRIA 2BE5F 2DQLA 4EJUA 2OZUA 2WWYA 1FC3A 1FZPB 1LDJA 4KT5C 1ZG3A 1VTNC 2W84A 2ISYA 5LHIA 4TV7A 2JSCA 1BI1A 1KYWA 2P5KA 1GXQA 2ZFWA 3LQQA 2HR3A 1YFHA 1TW3A 5BPDA 2IA1A 3RJPA 3IWFA 5IT9K 1ONVA 1J9IA 1OMIA 2YX7A 1RUOA 1XMKA 1J5YA 2TDXA 4WF2A 3ABUA 5DUKA 2O61A 3I59B 3E97A 1F1ZA 1BIBA 1WWXA 2QLZA 4I01A 2EV5A 1HBXG 3F22A 1U2WA 3RKXA 1REPC 2BGCA 2YSRA 2QBYA 3KZZA 4A5NA 4UUVA 3RIRA 3I64A 5LHHA 4RGXA 2Z9OA 1O3TA 1KQ0A 5BS6A 2F5CA 4LGWA 3RPUA 1D5VA 2W85A 1OYYA 4ESFA 3BP8A 2AXLA 1IXSB 3FXUA 2V1XA 1QBJA 3SZPA 4H0EA 1LEBA 1TQMA 4BNCA 3WU0A 1U6GA 2ZCWA 5FB2A 2CWEA 2NNNA 2ZKZA 4LB5A 3J81K 1EH8A 1YQAA 1FX7A 1IRFA 2OD5A 1HW2A 2CFXA 2JZYA 2GIVA 3Q9SA 2FBIA 4MNUA 2V1DA 3HRUA 5D4SA 1BC7C 3RYPA 2GA2A 3HSFA 3QOPA 4I98B 5HS9A 4ESJA 2RNJA 4KFCA 1TBXA 2DK5A 5E8GA 2VODA 2M87A 4HAMA 1IW7F 1O7FA 1XGMA 1UFMA 1GHCA 1L3LA 3COAC 4LK0F 2EB7A 3GZ5A 2O8XA 3K1MA 1IZ1A 4YG2F 5J8CA 4L5IA 2OU2A 2V1UA 2ZNZA 3M8FA 5DD4A 1YTYA 3LA3A 4A2UA 2KIMA 3GUDA 1XCVA 5FO5A 4L9JA 4G6QA 2L54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNT A;  1R00 A;  4CO8 A;  1K6O A;  1L0O C;  1R5G A;  2KIF A;  1YW9 A;  4XBF A;  3FMQ A;  1QZZ A;  5CVI A;  1BBY A;  2ZME B;  1W7P A;  5K5Q A;  1YIO A;  2JPC A;  2WC2 A;  1TQI A;  3J80 Z;  2FEZ A;  3B73 A;  1K78 A;  2HYG D;  2CYY A;  2ETH A;  3F3X A;  5D5V B;  3QAH A;  1ON2 A;  3GX4 X;  2YX4 A;  5FLX Z;  2K7L A;  2RN7 A;  2WTE A;  4MEY F;  3TDU C;  1XD7 A;  3T0Y A;  2VOO A;  3F8B A;  4HYE A;  3E6C C;  4E70 A;  2DPD A;  4YFN F;  4HV6 A;  2DO7 A;  2QZ8 A;  3O2P E;  2FML A;  1K7A A;  1JHH A;  3GO5 A;  4M9S A;  4M72 A;  1MDM B;  1GVJ A;  1T38 A;  4FT8 A;  3KET A;  3I4P A;  2XGX A;  1STZ A;  3BRO A;  2DLL A;  1TW2 A;  3HSR A;  1RZ4 A;  1FLI A;  2G7H A;  2Q2E A;  3DF8 A;  4R1H A;  2EV0 A;  3K0L A;  1SFE A;  1S7O A;  4ETS A;  4NB5 A;  5CVJ A;  5L3G A;  4HF0 A;  2H09 A;  3ZN0 A;  2L01 A;  1FBS A;  1EH6 A;  2GQQ A;  1JHF A;  2ZJ2 A;  2RVC A;  4RB2 C;  2O6G E;  3JW4 A;  1QQI A;  4IRG A;  4P9F A;  1R36 A;  1YW7 A;  3I5U A;  5L3E A;  3JAM Z;  1LQ1 A;  3HRT A;  4KMF A;  4XSZ F;  4LG0 A;  4EM2 A;  4ZYG A;  2HEO A;  3KP6 A;  3BPV A;  2EK5 A;  2VXZ A;  4HOB A;  3ZMV A;  1WQ2 A;  3W6K B;  5HOO A;  1KA8 A;  1J7K A;  2V9V A;  4P5O A;  5K5R A;  2XAH A;  4PGH A;  5D8K B;  4M6Y A;  4A6D A;  5FD5 A;  3RKY A;  3F8M A;  3F6V A;  4ENK A;  1A04 A;  2KJB A;  4LD5 A;  4BQA A;  3WE3 A;  1C0W A;  2ISZ A;  3FMS A;  3P9C A;  1I6X A;  3ZQ7 A;  2L3D A;  2EFN A;  3CUO A;  2ZBK A;  4OIO F;  3MQ0 A;  1HW5 A;  4AIH A;  3ML6 A;  2FBK A;  4KIF A;  2XVC A;  3D0S A;  1IXC A;  1W7P D;  3F23 A;  1ZN2 A;  1LDK B;  1QGP A;  3WG9 A;  2ACJ A;  2G9W A;  4L9N A;  2QBY B;  4R8H A;  2VC1 A;  1G3W A;  3V7R A;  3E5U A;  3H3U A;  3E5Q A;  2KRF A;  2CG4 A;  4O3M A;  5CVR A;  4KA4 A;  4WCG A;  5ILU A;  4HZF A;  3OOP A;  3BJO A;  5D8L B;  2XKP A;  2FMY A;  4HV5 A;  4PGG A;  2E7X A;  5K5O A;  3F72 A;  1O7L A;  3RYR A;  5DCM A;  2NRA C;  3T8T A;  1O3R A;  2DK8 A;  2XUB A;  2FA5 A;  5IT3 A;  5LRS A;  2KJC A;  1RUN A;  1G4D A;  3MFK A;  1Y0U A;  2MBF A;  2P6T A;  2PEX A;  4RB3 C;  4BAY A;  3QPH A;  1Z6T A;  2HQN A;  3LA2 A;  3MZH A;  2ZNY A;  4PCQ A;  4N9I A;  5D5U B;  3O6B B;  4Q48 A;  4G7H F;  4B8X A;  3HHG A;  3TDZ C;  2P8T A;  3EYY A;  4I02 A;  4JBA A;  3E3V A;  5E1Z B;  1PDN C;  2YU3 A;  1SD4 A;  2MH2 A;  2EFO A;  1H9T A;  3LST A;  5DEQ A;  1LB2 A;  3L7W A;  4AVP A;  2HS5 A;  2O03 A;  5L3B A;  1FOK A;  4GGG A;  5E17 F;  4OIR F;  3HOS A;  1FYL A;  4KN7 X;  2CW0 F;  2JRT A;  1BJA A;  3ZMZ A;  1TLH B;  4RB1 A;  3DP7 A;  4MHG A;  2QVO A;  3F6O A;  1IN5 A;  2X4H A;  4BHP A;  4OU0 A;  4U7B A;  4CXF A;  1K78 B;  3BJ6 A;  3TKY A;  1XCB A;  2F2E A;  3K2Z A;  5ICF A;  2A68 F;  1SAX A;  1R1T A;  3V7S A;  2F5D A;  1S3J A;  1SD6 A;  1HW1 A;  1XSD A;  1YS6 A;  1SFX A;  4RB0 A;  3V7C A;  4CHU A;  2Z33 A;  4EJW A;  1MZB A;  1G3S A;  1WRJ A;  1FPQ A;  1YO5 C;  1RNL A;  3IC7 A;  5HLI A;  3RKW A;  4G7Z F;  3DPL C;  1OPC A;  5H6R A;  4OMY A;  4JK1 X;  3GWZ A;  3WU1 B;  1R5H A;  4BHC A;  3WTT C;  2KKO A;  1HKQ A;  4BH9 A;  3GFJ A;  4IPA A;  3Q5F A;  4UVA A;  4UNO A;  4YFX F;  3BOQ A;  3U2R A;  5CVU A;  1U5T A;  5FFX A;  4M71 A;  5FD6 A;  3WTZ A;  2FSW A;  2EA2 A;  5ERI A;  5HVQ C;  4UXN A;  2QQ9 A;  2PMU A;  3PQK A;  4AWX B;  1O3Q A;  4XLN F;  1P4A A;  1Z1D A;  3HUG A;  1V4R A;  2OBP A;  3ZMU A;  1NHA A;  1JXS A;  4D0P A;  1XMA A;  5JFR A;  1U8R A;  4LG0 B;  3KZY A;  1KQ8 A;  3LWF A;  4HW0 A;  2VC0 A;  1AOY A;  1Z91 A;  2E1C A;  3WGG A;  2IA2 A;  3REO A;  6PAX A;  1KU7 A;  5HLH A;  2XAS A;  2PFB A;  3C18 A;  3RI4 A;  2P6S A;  2PJP A;  4IF4 A;  5CVV A;  4WK8 F;  4L5J A;  5H6Q A;  3IRQ A;  1LEA A;  3HSE A;  2QWW A;  5E1W A;  2D1H A;  2XV4 S;  5HS8 A;  2VE8 A;  2FF4 A;  3DPT A;  4G7O F;  1BM9 A;  3P7N A;  2UWM A;  4KDP A;  5D6E A;  5IT9 Z;  1R1V A;  3QP6 A;  1R58 A;  2VT3 A;  4EJO A;  1I27 A;  1CF7 A;  1ZH5 A;  4N9H A;  1G3T A;  3DV8 A;  3K1P A;  2M8E A;  3ROU A;  2JTV A;  3GFL A;  2IVM A;  2LDU A;  1P6R A;  1T0F A;  5ICG A;  4HLY A;  4IRH A;  2Y0M A;  3SXY A;  1MJB A;  2H6B A;  5JHU A;  1FBU A;  4KIB A;  4RGU A;  4GCV A;  1R1U A;  1IN6 A;  1UB9 A;  2FU4 A;  1EH7 A;  2Z99 A;  2IJL A;  4XSX F;  4NHJ A;  1ZLJ A;  3J80 K;  2A5Y B;  3I58 A;  5TJJ A;  5HDN A;  3DFG A;  4A0X A;  1DUX C;  4G94 A;  4LLN A;  5DCM B;  3WTX C;  4L18 B;  2COM A;  2D2W A;  3DKW A;  4MTE A;  3GVA A;  3L9F A;  3CO6 C;  1Q1H A;  1J2X A;  3HYI A;  4EJV A;  2PBI A;  3M9A A;  4KUM A;  3J81 Z;  3U1D A;  5FFZ A;  1DPR A;  1Z05 A;  2GZW A;  2VON A;  2NYX A;  4A5M A;  3B02 A;  3VOD A;  3GYH X;  2VBZ A;  3ABT A;  3WE2 A;  1JGS A;  3ULQ B;  2O3F A;  4M74 A;  1X3U A;  3ZMD A;  4CYD A;  3LAP A;  2MA3 A;  3HOT A;  3KLO A;  1FSE A;  5HDG A;  2DPU A;  3K69 A;  1D8K A;  4YFK F;  1MD0 A;  4OIQ F;  1PP8 F;  3GF2 A;  2HGC A;  2H94 A;  3R0J A;  4OOI A;  5L3D A;  1ULY A;  2GAU A;  4ZYH A;  1EV7 A;  2VE9 A;  2EFQ A;  1Z6R A;  5LHG A;  4PDK A;  3VEP A;  4EMS A;  2HWV A;  1FYM A;  3OV8 A;  1FWZ A;  4G6D A;  5BOX A;  3EYI A;  5EEH A;  3L09 A;  3R0A A;  1YS7 A;  3TQN A;  5E20 A;  1XDU A;  3GEZ A;  3FMR A;  2R3S A;  3PQJ A;  2A61 A;  2MH9 A;  5KVR A;  5LBQ A;  5LRR A;  2F5F A;  2L02 A;  2R7F A;  2IA0 A;  1ZG5 A;  2A07 F;  1BI0 A;  4ENN A;  2GXG A;  3P9I A;  4MGR A;  1S7A A;  2P7V B;  5F64 A;  3NQO A;  5D5W B;  5DV5 A;  4IHS A;  2PG4 A;  1ZGA A;  1ODD A;  2VBY A;  4U0W A;  2P5V A;  2FQ3 A;  1UHM A;  2BBY A;  1P4W A;  1ZGJ A;  2PN6 A;  2M45 A;  3F8N A;  4ON0 A;  5CLS A;  3SFZ A;  2AS5 F;  5JR3 A;  5E8I A;  3GFI A;  3KP4 A;  2V6C A;  1I5Z A;  1S8N A;  2STT A;  1HKT A;  3WTV C;  2QUF A;  4P96 A;  3H3Z A;  3IHU A;  2OQG A;  4ENM A;  1OYI A;  1RIO H;  2V79 A;  1J0R A;  4LLL A;  3TO9 A;  5D5X B;  2H6C A;  2EFP A;  4FHT A;  4KYW A;  1DPU A;  3IRR A;  5ED4 A;  1O3S A;  3WGH A;  2A69 F;  5BQT A;  1E17 A;  4HX4 A;  1ON1 A;  4P9U A;  2ELH A;  3Q9V A;  2YR2 A;  4UVB A;  2MD5 A;  4EGY A;  4Q47 A;  4HA8 A;  3P9K A;  3SHF A;  1LNW A;  1HQC A;  3BPX A;  3TO7 A;  3C1D A;  1QZY A;  1W5T A;  1W4M A;  3F8C A;  4IHT A;  2IW5 A;  4LK1 F;  2EWN A;  3SQN A;  2RC4 A;  2PI0 A;  3MCZ A;  1ZAO A;  5HLG A;  1UST A;  4K2E A;  3WTS C;  2ADU A;  3R61 A;  3KP3 A;  3IKT A;  4A12 A;  2JT1 A;  5L3C A;  2OZ6 A;  2W24 A;  1FT9 A;  2JPB A;  1MJ9 A;  3FZV A;  2P5L C;  2XIG A;  1YYV A;  4LFU A;  1V3F A;  2ZO4 A;  2FNP A;  3BY6 A;  1FYK A;  1OR7 A;  3C3W A;  4QLC U;  3EDP A;  2XAF A;  3MWM A;  4PZJ A;  4S05 A;  3GXO A;  1T98 A;  4M9X A;  1BC8 C;  1IUY A;  2CGP A;  2O0Y A;  3WGI A;  4B09 A;  3QP5 A;  4ZZD A;  4U88 A;  4G9Y A;  5H20 A;  3WTU C;  4P55 A;  4RAZ A;  3DQV C;  2HYF A;  1XGN A;  4UHT A;  1ZG1 A;  2VBX A;  4S04 A;  2PMH A;  3BDD A;  3N97 A;  1YLF A;  1ZAR A;  4HDV A;  4L0Z B;  1WKM A;  3T8R A;  2EV6 A;  3JSO A;  4HQE A;  4IJA A;  1B4A A;  5F6F A;  1LVA A;  1G6N A;  3E6B A;  4F7Z A;  3ZP5 A;  1U78 A;  3KLN A;  1W7P B;  3WTY C;  4WWC A;  2FOK A;  5ILV A;  4MEX F;  3KCC A;  4JQF A;  3I0T A;  2K02 A;  1D8J A;  1OKR A;  3ECO A;  4O5V A;  2D1V A;  2FBH A;  1LDD A;  1ZRD A;  2QQA A;  1MDM A;  4MTD A;  1ZHF A;  2Q8K A;  1BIA A;  4HX7 A;  4ZZL A;  1XGO A;  1F9N A;  1IN7 A;  4I0A A;  1UHW A;  2Y75 A;  4BXU A;  1J75 A;  3E5X A;  4A6E A;  2DU9 A;  4HQM A;  2DBB A;  4EGZ A;  4LLG F;  1BN5 A;  3HHH A;  4FX4 A;  4DQ2 A;  4UV9 A;  1IN4 A;  1TNS A;  1HKS A;  2XAQ A;  2B0L A;  3D5L A;  1LJ9 A;  3VFZ A;  3MZY A;  3GFM A;  3ISP A;  3J7A O;  3JSP A;  4HF2 A;  4HX8 A;  4O6J A;  3W6J B;  4L0Y B;  3HTU A;  1I1S A;  2OAZ A;  1YW8 A;  1H9G A;  5E1X A;  3FXQ A;  4FX0 A;  2C6Y A;  5F1R A;  5LEK A;  1J59 A;  2E7W A;  4MQV A;  3EET A;  4DNC A;  3M7G A;  2EA4 A;  1MGT A;  3RDI A;  2G7U A;  3FX3 A;  5A2Q Z;  2J5P A;  2OQR A;  1SD7 A;  4NQW A;  3F8F A;  3R4K A;  2ZXJ A;  3CUQ A;  4EM1 A;  1SMY F;  1SFU A;  3CLO A;  2FE3 A;  1S29 A;  3BWG A;  3LQR A;  1DP7 P;  3VB2 A;  1PUE E;  2K86 A;  3AAF A;  2VT2 A;  1WSU A;  2Z5U A;  3V8J A;  3LAJ A;  2QM3 A;  1ZRF A;  2A6H F;  2STW A;  2PLY A;  1SMT A;  4EJT A;  3ZN1 A;  2BYV E;  2HTS A;  3TOB A;  3DXJ F;  3V8K A;  5L3F A;  5JI6 A;  2RGV A;  4RGR A;  2QEN A;  2DW4 A;  3DEU A;  3MEX A;  2XHK A;  3V8L A;  3ERE D;  1B9M A;  4M73 A;  2HOE A;  3WOD F;  1P2F A;  2P4W A;  1T2K A;  2LSO A;  1Z7U A;  2DI3 A;  2BEO A;  2CSO A;  3QRF F;  2YPR A;  1XGS A;  2RDP A;  3LFK A;  3TOA A;  3KP5 A;  1YG2 A;  2ESH A;  4I09 A;  2FXA A;  3GLX A;  4IVN A;  1B6A A;  3C7J A;  1KQ9 A;  1ZYR F;  2XAJ A;  2RKH A;  4EQQ A;  3CO7 C;  1F4K A;  3IWZ A;  3K1N A;  5AON A;  1T39 A;  1ZRE A;  3FXR A;  1IN8 A;  3LA7 A;  5DD8 A;  5ICC A;  3I54 A;  3H92 A;  5DCF A;  4A0Y A;  4AIJ A;  2VOP A;  1HST A;  2MLK A;  1P92 A;  5FLX K;  2Z3Y A;  2DTR A;  3MAJ A;  2XRN A;  4AD9 A;  5D6F A;  4CZZ A;  2PQ8 A;  2QQB A;  1OYW A;  1KYZ A;  3N4M A;  1W5S A;  2FNA A;  4XRF A;  1MKM A;  2NS0 A;  3HRS A;  2RQP A;  3FWE A;  2IRF G;  3RTR A;  5LLQ A;  4HBL A;  3KE2 A;  5DDG A;  5AIP A;  2HDC A;  3QU6 A;  1P4X A;  5LGT A;  1IRG A;  3GZ6 A;  2MLG A;  4A0Z A;  4RGS A;  1XN7 A;  2L4A A;  1ZRC A;  1FP1 D;  4EVI A;  4LB6 B;  1KGS A;  2LF8 A;  3T1B A;  1T6S A;  5BPI A;  2W25 A;  4QWQ A;  1U5T C;  5K1Y A;  1IF1 A;  4U0V A;  2LKP A;  1G3Y A;  2HKO A;  5J6X A;  3ZMS A;  3JAM K;  5AIQ A;  3NEU A;  5HS7 A;  1BI3 A;  3FM3 A;  2QYO A;  2IPQ X;  4ASN A;  2Q0O A;  2X0L A;  3CUQ C;  2D45 A;  4OMZ A;  2M30 A;  4U0Y A;  2DT5 A;  3ZMT A;  1F5T A;  4BHB A;  1FSH A;  2DQR A;  1BOA A;  1KU9 A;  5HDK A;  4I7H A;  4YII A;  3HIF A;  3TGN A;  5JVT A;  4KNY A;  4Y17 A;  2M1B A;  4ESB A;  1FBQ A;  1WI9 A;  1XB4 A;  4OIP F;  5E18 F;  1R7J A;  4EM0 B;  5FGM A;  1S6L A;  3CJN A;  3QPT A;  4L9T A;  3BJA A;  4CGZ A;  2E1N A;  3I59 A;  2IP2 A;  2UXX A;  2ESN A;  2XRO A;  4KIC A;  1U5T B;  3ZPL A;  4M9Z A;  4Q4Z F;  4ZYE A;  3M8E A;  1USS A;  3SZT A;  1RI7 A;  4Q5S F;  2VN2 A;  3JTH A;  4WXC A;  2CQK A;  2BV6 A;  4YIF A;  1TTY A;  1FNN A;  3F21 A;  2GWR A;  1PP7 U;  3V4G A;  2VBW A;  1B59 A;  1IAW A;  1QPM A;  3L2C A;  4LJZ F;  3S2W A;  3CUQ B;  3CTA A;  1XSX A;  2FRH A;  3KP7 A;  4ZH4 F;  4R79 A;  5LGN A;  2UZK A;  3T5X A;  3KEO A;  4HLX A;  2WV0 A;  4LMY A;  2HZT A;  4WX9 A;  4MQ9 F;  3BZ6 A;  3WTW C;  2K4J A;  1O57 A;  2LNB A;  3U9G A;  4Z2Y A;  1QO0 D;  4AIK A;  2HFH A;  4Y13 A;  2RV8 A;  1D3Y A;  1R23 A;  2J5O A;  2EJR A;  1KU3 A;  5LGU A;  4ENJ A;  4GO1 A;  1IXR C;  3KP2 A;  2XAG A;  4EV0 A;  5BMZ A;  5J8F A;  5DYM A;  1I1G A;  3EUH A;  5CJ9 A;  4G8X A;  2LF7 A;  3VOE A;  2HQR A;  2A3S A;  3RPQ A;  3IKV A;  1ZLK A;  3R6S A;  3I53 A;  4IXA A;  5DUI A;  1CF7 B;  4I2O A;  3L00 A;  2P7C B;  2GXB A;  5ICE A;  2XKO A;  4KMU X;  5KK1 A;  1FY7 A;  1JE8 A;  1Z9C A;  3FM5 A;  3ELK A;  4WXD A;  1GXP A;  3JTG A;  2Y48 A;  4RAY A;  3HTS B;  4GYG A;  2ZME A;  3TO6 A;  2IT0 A;  4RS8 A;  3K9T A;  4GYI A;  4HDU A;  1XSV A;  4UVC A;  1U3E M;  2W57 A;  3G73 A;  2HKX A;  3KEQ A;  4I0B A;  1BI2 A;  3ECH A;  1R22 A;  1TQP A;  1KU2 A;  4L9V A;  1MJA A;  3QU3 A;  2OA4 A;  5CYV A;  2F5E A;  5EEG A;  4KIG A;  2KIU A;  3R60 A;  4OIN F;  1B9N A;  4U7D A;  2HTJ A;  1E2X A;  4ZYD A;  3O3K A;  1DDN A;  4XLP F;  2NAZ A;  3CDH A;  3I71 A;  5TRD A;  3FHZ A;  4UV8 A;  3GW2 A;  3NRV A;  2DAO A;  4N0B A;  4CDG A;  1H0M A;  4CIC A;  2R7D A;  5LEJ A;  1XDS A;  2CO5 A;  2M5W A;  1SD5 A;  2EFW A;  1HSJ A;  3E6D A;  2H27 A;  3G3Z A;  2K27 A;  3M1E A;  3E6M A;  2DFI A;  4Y15 A;  1QNT A;  5A2Q K;  1FP2 A;  1UCR A;  2L4M A;  2UXN A;  4GXO A;  5D4R A;  2A6E F;  2K4B A;  2NNY A;  4BYY A;  3KFW X;  3EQL F;  3PFI A;  4HF1 A;  3HRM A;  3FF5 A;  4M6X A;  1HXD A;  2GA1 A;  4WXH A;  1CGP A;  5ILS A;  1AWC A;  1K79 A;  4KN4 X;  3IL2 A;  1B1B A;  2MC3 A;  4IRI A;  2BE5 F;  2DQL A;  4EJU A;  2OZU A;  2WWY A;  1FC3 A;  1FZP B;  1LDJ A;  4KT5 C;  1ZG3 A;  1VTN C;  2W84 A;  2ISY A;  5LHI A;  4TV7 A;  2JSC A;  1BI1 A;  1KYW A;  2P5K A;  1GXQ A;  2ZFW A;  3LQQ A;  2HR3 A;  1YFH A;  1TW3 A;  5BPD A;  2IA1 A;  3RJP A;  3IWF A;  5IT9 K;  1ONV A;  1J9I A;  1OMI A;  2YX7 A;  1RUO A;  1XMK A;  1J5Y A;  2TDX A;  4WF2 A;  3ABU A;  5DUK A;  2O61 A;  3I59 B;  3E97 A;  1F1Z A;  1BIB A;  1WWX A;  2QLZ A;  4I01 A;  2EV5 A;  1HBX G;  3F22 A;  1U2W A;  3RKX A;  1REP C;  2BGC A;  2YSR A;  2QBY A;  3KZZ A;  4A5N A;  4UUV A;  3RIR A;  3I64 A;  5LHH A;  4RGX A;  2Z9O A;  1O3T A;  1KQ0 A;  5BS6 A;  2F5C A;  4LGW A;  3RPU A;  1D5V A;  2W85 A;  1OYY A;  4ESF A;  3BP8 A;  2AXL A;  1IXS B;  3FXU A;  2V1X A;  1QBJ A;  3SZP A;  4H0E A;  1LEB A;  1TQM A;  4BNC A;  3WU0 A;  1U6G A;  2ZCW A;  5FB2 A;  2CWE A;  2NNN A;  2ZKZ A;  4LB5 A;  3J81 K;  1EH8 A;  1YQA A;  1FX7 A;  1IRF A;  2OD5 A;  1HW2 A;  2CFX A;  2JZY A;  2GIV A;  3Q9S A;  2FBI A;  4MNU A;  2V1D A;  3HRU A;  5D4S A;  1BC7 C;  3RYP A;  2GA2 A;  3HSF A;  3QOP A;  4I98 B;  5HS9 A;  4ESJ A;  2RNJ A;  4KFC A;  1TBX A;  2DK5 A;  5E8G A;  2VOD A;  2M87 A;  4HAM A;  1IW7 F;  1O7F A;  1XGM A;  1UFM A;  1GHC A;  1L3L A;  3COA C;  4LK0 F;  2EB7 A;  3GZ5 A;  2O8X A;  3K1M A;  1IZ1 A;  4YG2 F;  5J8C A;  4L5I A;  2OU2 A;  2V1U A;  2ZNZ A;  3M8F A;  5DD4 A;  1YTY A;  3LA3 A;  4A2U A;  2KIM A;  3GUD A;  1XCV A;  5FO5 A;  4L9J A;  4G6Q A;  2L54 A; 
#chains in the Genus database with same CATH topology
 3PNY A;  4Y7N J;  4PJM A;  4L5E A;  4DW6 A;  1TNT A;  5GPA A;  1R00 A;  4A3F J;  4CO8 A;  2ID6 A;  3ZQH A;  1K6O A;  1L0O C;  2VKH A;  1R5G A;  2KIF A;  4C3I J;  3S1N J;  1YW9 A;  2LH9 A;  1OCC H;  4XBF A;  3CLQ A;  3FMQ A;  1QZZ A;  5CVI A;  1BBY A;  2ZME B;  1W7P A;  5K5Q A;  1YIO A;  2O7O A;  1BA5 A;  2XGE A;  2JPC A;  2WC2 A;  1TQI A;  3LSJ A;  5F0C A;  4MIM A;  1W5C C;  3J80 Z;  2O9L A;  2FEZ A;  4BGD A;  3B73 A;  3I4M J;  1K78 A;  1HDD C;  2HYG D;  3PL8 A;  2KT0 A;  2CYY A;  5H2F C;  2BXZ A;  2ETH A;  3SDG A;  3F3X A;  2YU9 J;  3H36 A;  4BEH A;  5D5V B;  2ZJQ F;  3QAH A;  5EZG A;  2X1C A;  1V54 H;  3E1S A;  2ID3 A;  1ON2 A;  2BW3 B;  3GX4 X;  3SYT A;  2YX4 A;  3VYR B;  4NC6 A;  5FLX Z;  2K7L A;  3CCE I;  2RN7 A;  2YS9 A;  2WTE A;  4MEY F;  1T8I A;  1MMS A;  3TDU C;  1XD7 A;  3DBH B;  3ASN H;  3T0Y A;  2VOO A;  3F8B A;  4HYE A;  3HOV J;  3E6C C;  4E70 A;  2DPD A;  1OFC X;  4YFN F;  3ZQL A;  1JUS A;  2NVU B;  2E34 A;  3BLY A;  2LR8 A;  4HV6 A;  3S2H J;  2DO7 A;  2QZ8 A;  3O2P E;  2FML A;  2GOX B;  1K7A A;  4IHV A;  1JHH A;  2Z2S B;  1Y1W J;  2VJI A;  3GO5 A;  4M9S A;  4M72 A;  1MDM B;  1GVJ A;  1T38 A;  4FT8 A;  3KET A;  3I4P A;  2XGX A;  4DYR A;  4M3G A;  1STZ A;  3BRO A;  2PJR A;  4ZJZ A;  3W2A A;  2DLL A;  1HOM A;  1TW2 A;  3HSR A;  1RZ4 A;  1FLI A;  2G7H A;  2Q2E A;  3DF8 A;  1W0T A;  4R1H A;  2EV0 A;  3K0L A;  2V9P A;  3ZQQ A;  3RPU D;  1SFE A;  1S7O A;  3BG5 A;  3S1Q J;  4ETS A;  2HOT A;  4NB5 A;  5CVJ A;  3LMM A;  1IV6 A;  5L3G A;  4FQG A;  2H09 A;  4HF0 A;  1W0U A;  3ZN0 A;  4B1R A;  2XGC A;  2L01 A;  1FBS A;  2HQ5 A;  1YJ9 I;  4A69 C;  2GBY A;  1EH6 A;  2GQQ A;  1JHF A;  5JLW A;  2ZJ2 A;  2RVC A;  3O8H A;  4RB2 C;  2O6G E;  2H1L A;  3JW4 A;  3CCQ I;  1QQI A;  3KYL A;  4IRG A;  4B43 A;  3A2K A;  4P9F A;  1R36 A;  1YW7 A;  3CD6 I;  3I5U A;  5L3E A;  3JAM Z;  1LQ1 A;  3HRT A;  2WA0 A;  4KMF A;  4XSZ F;  1RES A;  4LG0 A;  4A3D J;  1Y6I A;  4HNT A;  4EM2 A;  4ZYG A;  2HEO A;  3KP6 A;  1N77 A;  2EPF A;  3JCU C;  3BPV A;  2EK5 A;  2VXZ A;  4HOB A;  3OYL A;  3ZMV A;  1WQ2 A;  3W6K B;  5HOO A;  1KA8 A;  1J7K A;  2V9V A;  4P5O A;  2F48 A;  3QOE A;  1WJF A;  5K5R A;  4B3X A;  2NVT J;  2XAH A;  3B6C A;  3CCS I;  4PGH A;  2WV1 A;  5D8K B;  4LOC A;  4M6Y A;  4A6D A;  5B1A H;  5FD5 A;  3S32 A;  4HEA 2;  5EEA A;  3RKY A;  3G2B A;  1ZGW A;  3F8M A;  1D0X A;  3F6V A;  3SZG A;  2YUS A;  3G1M A;  4NQW B;  4ENK A;  3S3M A;  1A04 A;  1EF4 A;  1IDY A;  2JUC A;  2KJB A;  4LD5 A;  4BQA A;  3WE3 A;  3H5N A;  1C0W A;  2CQ7 A;  3LNQ A;  2NOG A;  2EIK H;  2ISZ A;  3FMS A;  3P9C A;  4Y33 A;  1I6X A;  3ZQ7 A;  3IV5 A;  2JMW A;  2L3D A;  1NG6 A;  4A3M J;  2L9N A;  3NWT A;  1G59 A;  2KRH A;  2EFN A;  3CUO A;  3OYA A;  2ZBK A;  2DMP A;  3CMA I;  4OIO F;  2KZG A;  3PO2 J;  3MQ0 A;  1A5J A;  3MZ8 A;  4AUX A;  2LD5 A;  4A3L J;  3DLA A;  1HW5 A;  4AIH A;  5IP9 J;  3RZD J;  2PMZ A;  3ML6 A;  2FBK A;  4KIF A;  2GIZ A;  2XVC A;  2EIN H;  5IYD J;  2JA2 A;  3D0S A;  1IXC A;  4UB6 C;  1W7P D;  2JA7 J;  1ENH A;  3F23 A;  2CUE A;  1ZN2 A;  3DEE A;  1LDK B;  4GFB A;  1QGP A;  1RKT A;  3DTK A;  2IEK A;  4PFP A;  3WG9 A;  2ACJ A;  2G9W A;  3BR0 A;  4L9N A;  4RMN A;  4XID A;  2QBY B;  4R8H A;  2VC1 A;  1G3W A;  3V7R A;  1DGW Y;  3E5U A;  1H88 C;  2K40 A;  1BOB A;  2HOA A;  3F0C A;  4J01 A;  3ASO H;  1TWA J;  3H3U A;  3H3V K;  3E5Q A;  2KRF A;  2CG4 A;  4O3M A;  1V55 H;  5CVR A;  4KA4 A;  3OS1 A;  4WCG A;  5ILU A;  3QYF A;  4HZF A;  3OOP A;  1OCZ H;  3BJO A;  4IL6 C;  5D8L B;  1GT0 C;  2LC2 A;  1X3W B;  2XKP A;  4PFO A;  2R7T A;  2FMY A;  3F9K A;  1JUP A;  1X2N A;  3OR2 C;  1TC3 C;  4HV5 A;  1O4X A;  2IGN A;  4PGG A;  2JVH A;  2E7X A;  5K5O A;  3S1M J;  2BVM A;  2KQR A;  3F72 A;  1O7L A;  3VPR A;  2VI6 A;  1N25 A;  3RYR A;  3HOU J;  1IO2 A;  5DCM A;  3JRD A;  3TL4 X;  2NRA C;  3T8T A;  5E3M A;  2CV2 A;  1OCT C;  1BW5 A;  2DOF A;  4W97 A;  5EGO A;  1O3R A;  3OL3 A;  1JKR C;  2DK8 A;  2XUB A;  2FA5 A;  5IT3 A;  3FXL A;  5FKL A;  2XSD C;  3SEQ A;  5LRS A;  4DBQ A;  4NNJ A;  5GAD J;  2KJC A;  4CSW A;  2ICW G;  4XKV A;  2R7S A;  1WCM J;  3GME A;  4NC8 A;  3W2V A;  1RUN A;  1G4D A;  2Y69 H;  3OIQ A;  4EAT A;  3MFK A;  2JQ7 A;  1Y0U A;  2MBF A;  1JJ6 C;  2P6T A;  2HOS A;  2PEX A;  4Y3O A;  1FOY A;  4RB3 C;  1JKO C;  4IZZ A;  4BAY A;  5K7F A;  3QPH A;  5CPR B;  1Z6T A;  2HQN A;  3LA2 A;  2GOM A;  3G6E I;  2VIX A;  3MZH A;  3HBL A;  2COB A;  2ZNY A;  4PCQ A;  4N9I A;  5D5U B;  3O6B B;  2XPU A;  1U0J A;  5GAE J;  1SVO A;  4Q48 A;  1X1B A;  4G7H F;  2CUF A;  4B8X A;  3HHG A;  2NVX J;  2P8T A;  3EYY A;  4I02 A;  3TDZ C;  3BR5 A;  4JBA A;  3E3V A;  5E1Z B;  1PDN C;  2YU3 A;  1OCO H;  2BY2 A;  1OLT A;  1SD4 A;  2MH2 A;  4JX4 A;  4AYB A;  2EFO A;  2R7W A;  2CQN A;  2LP0 A;  4P1W A;  2TCT A;  1RR8 C;  1H9T A;  2VLA A;  2IBD A;  1K4T A;  3LST A;  3H9Q A;  3HDD A;  5DEQ A;  3BG7 A;  3L7W A;  1LB2 A;  4AVP A;  2HS5 A;  2O03 A;  2F5V A;  2DA4 A;  5L3B A;  4G12 A;  1FOK A;  3S15 J;  4A3E J;  5M5Y J;  2IS6 A;  3HKZ A;  2NXN B;  2W00 A;  4GGG A;  4ZTF A;  3CME I;  1ZR2 A;  2E1M C;  3ZQG A;  4XKW A;  1VQ4 I;  3S14 J;  5E17 F;  4OIR F;  4DZP A;  1J09 A;  1Y0N A;  3A1Y A;  1Z3X A;  3HOS A;  1FYL A;  1X2M A;  4KN7 X;  2CW0 F;  1H89 C;  5M5X J;  2JRT A;  1BJA A;  3CCY A;  1XC5 A;  3ZMZ A;  1TLH B;  4RB1 A;  1FEX A;  2FJ1 A;  2ME0 A;  3DP7 A;  4PK4 A;  4MHG A;  2QVO A;  1AA7 A;  4HG2 A;  3F6O A;  2O5R A;  1IN5 A;  3S3O A;  2X4H A;  4BHP A;  4OU0 A;  1FTT A;  5F0F A;  3A0B C;  4U7B A;  4CXF A;  1K78 B;  3BJ6 A;  3TKY A;  1XCB A;  3QQA A;  2F2E A;  3K2Z A;  4BBS J;  1R4M B;  3BG9 A;  5ICF A;  2WAQ A;  2A68 F;  4C3J J;  1SAX A;  3M1C A;  2IGO A;  4BEH B;  1R1T A;  1VQL I;  1VQM I;  3V7S A;  2F5D A;  1S3J A;  4RDU A;  1SD6 A;  1HW1 A;  4CYC A;  3L1P A;  3HGY A;  2LK2 A;  1XSD A;  5E79 C;  1YS6 A;  3LSG A;  4C3H J;  1SFX A;  5J47 A;  4RB0 A;  2V7F A;  2RRE A;  3V7C A;  4CHU A;  2Z33 A;  2CUJ A;  3QWL A;  4EJW A;  1MZB A;  1G3S A;  1F36 A;  1TP4 A;  3CJT B;  3CP8 A;  1WRJ A;  2PMZ N;  1JUM A;  5GP9 A;  1FPQ A;  1VFC A;  1YO5 C;  4NDL A;  1RNL A;  3IC7 A;  4PJL A;  5HLI A;  3RKW A;  4UUS A;  4G7Z F;  2ZB9 A;  1VQ5 I;  3DPL C;  1OPC A;  2WY7 Q;  4IHX A;  5H6R A;  4C2M J;  1R9T J;  2HXI A;  4OMY A;  1BW6 A;  3E0J B;  4YRV A;  4JK1 X;  3GWZ A;  3WU1 B;  1IRZ A;  4JOM A;  1R5H A;  2TRT A;  4BHC A;  3ZOB A;  4BUP A;  2KKO A;  3WTT C;  1HKQ A;  4BH9 A;  3GFJ A;  4IPA A;  3Q5F A;  4UVA A;  4UNO A;  4YFX F;  2XGD A;  2DOE A;  3BOQ A;  2LY1 A;  3U2R A;  5CVU A;  1U5T A;  5FFX A;  4M71 A;  1WJC A;  5FD6 A;  4FCY A;  2AQF A;  1W36 C;  4HRI A;  2O8K A;  1WI3 A;  3WTZ A;  4AU7 A;  2FSW A;  3OYD A;  1GLN A;  3Q0U A;  2VUM J;  2EA2 A;  2E1M B;  5ERI A;  5HVQ C;  4UXN A;  2QQ9 A;  2LKX A;  2PMU A;  4JYK A;  1DQU A;  3PQK A;  2R92 J;  5M3M J;  2EIM H;  3OYG A;  4CA0 A;  4AWX B;  1O3Q A;  3U1K A;  1RR7 A;  5K7H A;  4XLN F;  1P4A A;  1Z1D A;  3HUG A;  1V4R A;  2JJ7 A;  1V5F A;  3IUO A;  2QGU A;  2X51 A;  2OBP A;  3ZMU A;  2XB5 A;  5IPA A;  1DU0 A;  1QVU A;  3C2G A;  1NHA A;  3BTC A;  2QSH X;  1JXS A;  4D0P A;  2JN6 A;  1XMA A;  5JFR A;  1U8R A;  4BJT A;  3LSR A;  3AKZ A;  4LG0 B;  3KZY A;  1B8I A;  2G0E A;  3FKI J;  4BXX J;  1KQ8 A;  2X6W A;  3LWF A;  4HW0 A;  1QRY A;  2VC0 A;  3EUH C;  4II3 A;  1Z91 A;  2BXY A;  2M0M A;  2E1C A;  1AOY A;  1VQ7 I;  2MFZ A;  3WGG A;  3S8P A;  3RSN A;  2IA2 A;  2RQQ A;  3REO A;  6PAX A;  3HOY J;  4A3I J;  1KU7 A;  3GTM J;  5HLH A;  2XAS A;  2PFB A;  3C18 A;  3RI4 A;  2P6S A;  2PJP A;  1I39 A;  4IF4 A;  5CVV A;  1Z77 A;  4WK8 F;  1ZR4 A;  4F3Q A;  4L5J A;  5H6Q A;  5EG0 A;  3IRQ A;  1IGN A;  1LEA A;  2LLK A;  3HSE A;  5F1J A;  2B9S A;  2L9R A;  1LKX A;  4PJJ A;  2QWW A;  1H8A C;  5E1W A;  2HU9 A;  2D1H A;  2XV4 S;  5HS8 A;  3FHN A;  2VE8 A;  3MN2 A;  2FF4 A;  3DPT A;  4AYB N;  2M0C A;  3W6V A;  2K9L A;  3RZO J;  4G7O F;  1BM9 A;  1MW7 A;  3P7N A;  1MSF C;  1WJE A;  3LL7 A;  4YIR X;  2UWM A;  1PUF B;  1I50 J;  4KDP A;  1N78 A;  5D6E A;  3WHC A;  5IT9 Z;  5HLT A;  1R5I D;  1R1V A;  4AID A;  2VQH A;  2M4G A;  3QP6 A;  2E71 A;  5FKM A;  4BL0 B;  1R58 A;  2VT3 A;  2ELK A;  4EJO A;  4KJZ A;  1I27 A;  2DMN A;  2I8D A;  1CF7 A;  1ZH5 A;  1NK3 P;  4N9H A;  1G3T A;  3L2W A;  3DV8 A;  3DTE A;  1V5G A;  4DYC A;  1G2H A;  1ERD A;  1Z0X A;  3K1P A;  4ITV A;  1QZE A;  2M8E A;  3ROU A;  2JTV A;  3GFL A;  2IVM A;  4OAZ A;  5FLM J;  2LDU A;  3PUB A;  1P6R A;  1T0F A;  5KHD A;  5ICG A;  4HLY A;  4IRH A;  4M3E A;  2Y0M A;  4QPO A;  3SXY A;  1ETK A;  3JRB A;  1MJB A;  2H6B A;  1GVD A;  5JHU A;  1FBU A;  2VQL A;  3M8J A;  2VKD A;  4OAY A;  3DPU A;  2DN0 A;  3CJR B;  4KIB A;  4BY1 J;  4RGU A;  3K4B A;  4GCV A;  3S93 A;  3AG1 H;  1R1U A;  1IN6 A;  2WAQ N;  3CCJ I;  1D5Y A;  1UB9 A;  2FU4 A;  1T56 A;  1EH7 A;  3PM1 A;  2Z99 A;  4XK4 A;  1W1W E;  2IJL A;  3Q0V A;  3ABM H;  2K9Q A;  4XSX F;  4NHJ A;  1ZLJ A;  2FUG 2;  4HSR A;  4ZYA A;  3J80 K;  1OJL A;  2W7N A;  2A5Y B;  3DCF A;  4C30 A;  3UNG C;  1LE8 A;  3I58 A;  1I3A A;  3GTP J;  1OIS A;  5TJJ A;  5HDN A;  4PSW A;  4XOT A;  2HVR A;  2CV1 A;  3A02 A;  3DFG A;  4A0X A;  5J1R A;  1X4P A;  1DUX C;  3HOW J;  3SJM A;  4G94 A;  4LLN A;  2NVY J;  2OF7 A;  2MGQ A;  5DCM B;  2X6Y A;  3WTX C;  4L18 B;  2COM A;  2D2W A;  4QSH A;  3DKW A;  2L9V A;  4MTE A;  3GVA A;  3L9F A;  4BU2 A;  3CO6 C;  1Q1H A;  1J2X A;  3HYI A;  4EJV A;  4E7J A;  5EGO B;  2PBI A;  3M9A A;  4MFD A;  4KUM A;  3J81 Z;  4X6A J;  1TWH J;  2K9M A;  1VND A;  4LG3 A;  3U1D A;  5FFZ A;  2I10 A;  9ANT A;  3S2D J;  3I56 I;  1DPR A;  1B72 A;  5IYC J;  1Z05 A;  2GZW A;  2VON A;  2X1D A;  5KAI C;  2NYX A;  4A5M A;  3B02 A;  3VOD A;  3GYH X;  2L5Q A;  2VBZ A;  2XRL A;  2HDW A;  3ABT A;  3CP2 A;  3WE2 A;  5JHF A;  4A93 J;  3G4S I;  1JGS A;  1VI0 A;  3ULQ B;  2O3F A;  3BG6 A;  3L2Q A;  3OYI A;  1S7E A;  2WY8 Q;  4M74 A;  1X3U A;  4DGW B;  3ZMD A;  4XQF A;  5J3L A;  3ZQC A;  2K5C A;  2NS7 A;  2V4J C;  2JA5 J;  4CYD A;  3HPG A;  3LAP A;  2P0W A;  2MA3 A;  1ACI A;  3EUA A;  3MD2 A;  5GAH J;  3HOT A;  1XG1 A;  1U9N A;  4H4K C;  2ELJ A;  3KLO A;  1FSE A;  1U8B A;  5HDG A;  2DPU A;  2R5Y B;  3K69 A;  1D8K A;  4YFK F;  3RQI A;  2R4G A;  2X6X A;  1MD0 A;  4OIQ F;  1PP8 F;  3GF2 A;  2HGC A;  2H94 A;  2BHY A;  3R0J A;  2A6T A;  4OOI A;  2DT6 A;  5L3D A;  1ULY A;  5GPC A;  5HNH A;  2GAU A;  2H1K A;  5J4V A;  4ZYH A;  1EV7 A;  2VE9 A;  2DFF A;  2EFQ A;  1Z6R A;  3PSI A;  5LHG A;  4PDK A;  3VEP A;  2Y0S A;  4EMS A;  2HWV A;  4BE0 A;  3SFI A;  2Y9Z A;  1FYM A;  3OV8 A;  5TIS C;  3BR6 A;  2WB1 A;  1FWZ A;  2L2O A;  2HZD A;  4G6D A;  5BOX A;  5FLV A;  3EYI A;  4D5F A;  3R0A A;  3L09 A;  5EEH A;  3TP0 A;  2R7Z J;  3K4K A;  1YS7 A;  4XMY A;  1EKE A;  5E20 A;  3TQN A;  1XDU A;  3GEZ A;  1WJA A;  2WAF A;  3DKX A;  3FMR A;  1JI8 A;  2R3S A;  2DMU A;  2A61 A;  3PQJ A;  4LIV A;  2VL8 A;  3VSL A;  1E3O C;  2MH9 A;  2E1O A;  2EZL A;  5KVR A;  5LBQ A;  4A3J J;  2ZJR F;  2E19 A;  5LRR A;  2FD5 A;  2F5F A;  2L02 A;  4XOP A;  2R7F A;  2IA0 A;  2VXD A;  1ZG5 A;  2A07 F;  1BI0 A;  4ENN A;  2GXG A;  3H1C A;  4BBR J;  3PO3 J;  3P9I A;  4MGR A;  1ORK A;  3BZK A;  1S7A A;  2P7V B;  5F64 A;  3AL0 C;  4MLO A;  2ZXH A;  3NQO A;  3MKW B;  1LFU P;  5D5W B;  5DV5 A;  4IHS A;  2PG4 A;  1ZGA A;  2CUZ A;  1ODD A;  1ETW A;  3CC4 I;  2VBY A;  1EA3 A;  3CCM I;  4U0W A;  4UUS B;  2DXI A;  3U21 A;  2P5V A;  5J1U A;  1MIJ A;  3I4N J;  2FQ3 A;  1UHM A;  2E60 A;  1WVR A;  3ZQF A;  2BBY A;  1K61 A;  1P4W A;  1ZGJ A;  2F4M B;  3CCV I;  2CW8 A;  3BR1 A;  3OR1 C;  3FXJ A;  3HPH A;  3HGG A;  3OYB A;  2PN6 A;  3OY9 A;  2M45 A;  3F8N A;  2LYC A;  4ON0 A;  5CLS A;  3SFZ A;  2AS5 F;  4G6T B;  5JR3 A;  5E8I A;  2ZSH B;  1MMD A;  4ZDP A;  3GFI A;  3E7L A;  2R5Z B;  2IGK A;  2JVG A;  2L7F P;  2AXT C;  3KP4 A;  4GRI A;  1KON A;  2V6C A;  1I5Z A;  1S8N A;  2STT A;  1UEL B;  1D1A A;  1OQY A;  1MMG A;  4C2T A;  1HKT A;  3WTV C;  1YX3 A;  1VQN I;  2QUF A;  4P96 A;  3H3Z A;  3HUG B;  3IHU A;  2OQG A;  5E3N A;  2R0Q C;  4ENM A;  1D0Z A;  4ZC3 A;  1K4S A;  1OYI A;  2EZH A;  3S1R J;  3M07 A;  1RIO H;  2V79 A;  4JX6 A;  1J0R A;  4LLL A;  1T0F C;  3TO9 A;  5D5X B;  2H6C A;  4AC0 A;  2XPW A;  2EFP A;  4FHT A;  4KYW A;  2QEX I;  4ZDL A;  1DPU A;  1JTX A;  3IRR A;  4ABZ A;  5ED4 A;  1O3S A;  4RA2 A;  2F4I A;  2LRD A;  3G1O A;  3WGH A;  2A69 F;  5BQT A;  1E17 A;  1GV2 A;  5FKN A;  4UUT A;  1SFK A;  4HX4 A;  4XNF A;  5K7Z A;  1ON1 A;  4P9U A;  2ELH A;  3Q9V A;  2DA1 A;  3CF2 A;  2YR2 A;  4UVB A;  2BHZ A;  2MD5 A;  4EGY A;  2OV7 A;  3AL0 B;  4Q47 A;  1M1E B;  4RBO A;  1JTY A;  1UAA A;  4HA8 A;  3P9K A;  3SHF A;  1LNW A;  1D0Y A;  3DEW A;  1HQC A;  2Y9Y A;  4GDF A;  3BPX A;  4BY7 J;  3TO7 A;  2B63 J;  3N05 A;  3C1D A;  5FKO A;  1QZY A;  4M3F A;  2HYJ A;  1W5T A;  2WAE A;  1W4M A;  1R49 A;  3LSK A;  1FOW A;  3F8C A;  4IHT A;  2IW5 A;  4LK1 F;  2EWN A;  1WGX A;  1I3Q J;  1S5L C;  2VKV A;  4D9J A;  3SQN A;  2V1N A;  1JGG A;  2RC4 A;  2E2I J;  3S3N A;  2PI0 A;  2Q1Z B;  3MCZ A;  1ZAO A;  4RM2 A;  5HLG A;  2KRC A;  3Q3S A;  1ETX A;  4U87 A;  3C2B A;  1UST A;  4K2E A;  4IQ4 A;  3HC7 A;  1YOV B;  3WTS C;  4V19 K;  2VQG A;  2ADU A;  3RCO A;  1S9H A;  5IOZ A;  3HEF A;  1HLV A;  2ZFU A;  3R61 A;  3KP3 A;  2OCC H;  1LUJ B;  3IKT A;  3K10 A;  4A12 A;  2JT1 A;  5L3C A;  2OZ6 A;  2Y0S N;  2W24 A;  3FIW A;  5CQG A;  1FT9 A;  2JPB A;  1MJ9 A;  4NBQ A;  1WFX A;  1AHD P;  3PSF A;  1FTZ A;  2K3F A;  3DTI A;  2WB1 N;  3FZV A;  2P5L C;  2XIG A;  1YYV A;  4LFU A;  1V3F A;  2ZO4 A;  2FNP A;  3BY6 A;  2A5W A;  2KPM A;  3LFU A;  4A3K J;  1FYK A;  3NWS A;  1OR7 A;  5E3O A;  3D5R C;  2XF7 A;  3C3W A;  4HNU A;  1YI2 I;  3OOU A;  4QLC U;  3EDP A;  2XAF A;  3MWM A;  4AVZ A;  4PZJ A;  4S05 A;  4X0G A;  3W3C A;  3GXO A;  1T98 A;  4M9X A;  3I3L A;  1FIA A;  1BC8 C;  1IUY A;  1YRN A;  3HL2 A;  2CGP A;  4XKB A;  2O0Y A;  4HNV A;  2EZK A;  2EIL H;  3CCL I;  2JK3 A;  3ERM A;  3WGI A;  3JRF A;  4B3A A;  1YX5 A;  4B09 A;  3QP5 A;  4XN0 A;  4ZZD A;  4U88 A;  1BJZ A;  4G9Y A;  5H20 A;  3WTU C;  2FX0 A;  5IP7 J;  4BQO A;  4P55 A;  4RAZ A;  3DQV C;  2HYF A;  5B66 C;  3ZRG A;  1XGN A;  2Z1D A;  3K4J A;  4UHT A;  1ZG1 A;  3CF5 F;  2VBX A;  4S04 A;  1AKH B;  2AHQ A;  2JRM A;  2EIJ H;  2PMH A;  3BDD A;  3N97 A;  1YLF A;  4FAS D;  1T95 A;  1ZAR A;  4AM3 A;  1F43 A;  4HDV A;  2RNG A;  1WKM A;  4L0Z B;  3T8R A;  2EV6 A;  3JSO A;  4HQE A;  4IJA A;  1B4A A;  2DOA A;  5F6F A;  2VJ5 A;  4XLF A;  1U9O A;  1LVA A;  1G6N A;  3E6B A;  4XKC A;  5C4X J;  4F7Z A;  3ZP5 A;  1I6H J;  1XPX A;  1U78 A;  2QA4 I;  1HF0 A;  4UY8 I;  3KLN A;  1W7P B;  2VKE A;  3WTY C;  4IO9 F;  4WWC A;  3BCA A;  5EJC A;  2FOK A;  1HDP A;  4PJ0 C;  5ILV A;  4MEX F;  1A6Q A;  3KCC A;  4JQF A;  1HCR A;  2DJI A;  3GTJ J;  3I0T A;  2K02 A;  1D8J A;  1MMA A;  1X3Z B;  1OKR A;  5TGT A;  3ECO A;  1FMW A;  2D1V A;  2FBH A;  1LDD A;  4O5V A;  1ZRD A;  2QQA A;  1MDM A;  3BG3 A;  4MTD A;  1ZHF A;  3HZJ A;  3A01 A;  2Q8K A;  1BIA A;  2A05 A;  3K6G A;  2LG4 A;  3KPH A;  4HX7 A;  4ZZL A;  1XGO A;  1F9N A;  5KNL A;  1IN7 A;  4JX5 A;  4I0A A;  4J19 A;  5J1Y A;  1OCP A;  1UHW A;  1JJ8 C;  2Y75 A;  3OYJ A;  4BXU A;  1NG7 A;  1J75 A;  1JKQ C;  1BL0 A;  2UUZ A;  2LOO A;  4Y52 J;  3E5X A;  4A6E A;  3I55 I;  3UKG A;  1R71 A;  2W82 A;  2DU9 A;  3ZGK A;  4HQM A;  2F4O B;  2DBB A;  4EGZ A;  2DA6 A;  4LLG F;  4DZJ A;  1BN5 A;  4IHY A;  2EQR A;  2DDB A;  3HHH A;  4RLQ A;  4DQ2 A;  4FX4 A;  3NAR A;  4UV9 A;  1IN4 A;  2R7O A;  2GM4 A;  1TNS A;  3L2U A;  1HKS A;  2DFH A;  2FOW A;  2B0L A;  2VB6 A;  2XAQ A;  3D5L A;  4XRS G;  3WHB A;  4IX7 A;  1LJ9 A;  3LSM A;  3VFZ A;  4BE1 A;  2DYR H;  2DOD A;  3MZY A;  3GFM A;  3ISP A;  2L7K A;  3KIO A;  3JSP A;  3J7A O;  2PJR B;  4HF2 A;  4HX8 A;  4O6J A;  3W6J B;  1VQ6 I;  4L0Y B;  4B47 A;  1GUU A;  2EZI A;  3HTU A;  3K7A J;  4II2 A;  4YEJ A;  1I1S A;  3FIS A;  1EJ9 A;  2Q2E B;  2KHM A;  2OAZ A;  2W48 A;  5B1B H;  3OIO A;  3PUF A;  2M2E A;  5GAG J;  2R7X A;  1YW8 A;  4B48 A;  1H9G A;  3GLL A;  2JA8 J;  1ZEL A;  5E1X A;  2CH0 A;  1Y56 A;  3HG9 A;  3FXQ A;  4FX0 A;  1OCR H;  1SVM A;  2C6Y A;  3DBL B;  1TWG J;  4XLE A;  4F91 B;  1A6I A;  5F1R A;  2W1O A;  1P7J A;  4V2G A;  5LEK A;  2KL4 A;  1IUF A;  3JRH A;  3OYH A;  2E7W A;  1POG A;  4MQV A;  1J59 A;  3EET A;  4DNC A;  3M7G A;  3JRE A;  2OTJ I;  4E7K A;  2EA4 A;  1FOX A;  1MGT A;  2DA7 A;  3PJR A;  4HST A;  2M4K A;  3RDI A;  2G7U A;  1R6R A;  5C3E J;  3FX3 A;  4E4H A;  2HVS A;  5A2Q Z;  4BDZ A;  2GXA A;  2J5P A;  2OQR A;  1SD7 A;  3P5J A;  2XF6 A;  4NQW A;  3F8F A;  3R4K A;  4ZDO A;  2ZXJ A;  2KDZ A;  3CUQ A;  4EM1 A;  1SMY F;  4LIT A;  1NH3 A;  1Z3Y A;  2M8G X;  1SFU A;  3CLO A;  2ZSI B;  2FE3 A;  1S29 A;  3BWG A;  3CQZ J;  3DBR B;  3HM5 A;  3QPL A;  3LQR A;  1A36 A;  1DP7 P;  3VB2 A;  1PUE E;  3HOZ J;  2K86 A;  3TP3 A;  3AAF A;  2VT2 A;  3MKZ A;  1WSU A;  1PJR A;  2Z5U A;  4E7H A;  3V8J A;  2VJJ A;  3LAJ A;  3TED A;  2QM3 A;  1ZRF A;  2A6H F;  4RLF A;  2STW A;  2PLY A;  3CDL A;  1SMT A;  3ZQI A;  4EJT A;  3ZN1 A;  4S0H B;  3PIO F;  2BYV E;  2HTS A;  5F27 A;  3TOB A;  3DXJ F;  3V8K A;  3K4N A;  5L3F A;  1TZL A;  2JUG A;  3FXM A;  2VPR A;  5JI6 A;  3IH2 A;  1E0E A;  2RGV A;  4RGR A;  4CZC A;  3OWT A;  2F6C A;  2QEN A;  2DW4 A;  3K70 D;  4KT6 A;  3BCB A;  2HVQ A;  3DEU A;  3MEX A;  3J7Z I;  2VJ4 A;  4XN3 A;  1UJ8 A;  4FE7 A;  2XHK A;  3V8L A;  2BY0 A;  2IGM A;  2HNH A;  4NC7 A;  3ERE D;  1B9M A;  4M73 A;  2HOE A;  3WOD F;  3CDI A;  1P2F A;  2DDA A;  2P4W A;  1T2K A;  2X48 A;  1K6Y A;  2OJE D;  2LSO A;  1Z7U A;  2DI3 A;  4OWR B;  1OR7 C;  4IHW A;  2BEO A;  1T08 B;  2CSO A;  3QRF F;  2CU7 A;  2EBI A;  2YPR A;  3HKZ N;  3ONQ A;  5JLX A;  1XGS A;  2WAD A;  3FDY A;  3VSK A;  3CC2 I;  2RDP A;  1PYV A;  3LFK A;  3TOA A;  3KP5 A;  1YG2 A;  2ESH A;  1WHU A;  1QU3 A;  2HPM A;  4HPQ A;  2BVL A;  4I09 A;  4BJ6 C;  4LIU A;  1Z67 A;  2FXA A;  2M9H A;  3GLX A;  1SEU A;  4IVN A;  3H0G J;  1B6A A;  2N8G A;  4E7Z A;  1QHH D;  1P7I A;  2K9S A;  3EUK L;  1VQK I;  3C7J A;  1KQ9 A;  3BR3 A;  1ZYR F;  2FQ4 A;  3H5R A;  1FMV A;  2JSP A;  3A0H C;  2XAJ A;  2RKH A;  4EQQ A;  3CO7 C;  1F4K A;  4XOR A;  4BAC A;  3DU6 A;  3IWZ A;  3K1N A;  5AON A;  1T39 A;  1ZRE A;  4I6Z A;  1CQT A;  4I99 C;  3FXR A;  1IN8 A;  4CUG A;  4XLH A;  3LA7 A;  5DD8 A;  2CJJ A;  5ICC A;  3I54 A;  3H92 A;  5DCF A;  4A0Y A;  4AIJ A;  2IS2 A;  2VOP A;  1XX5 A;  1HST A;  2MLK A;  1P92 A;  2BY1 A;  2CS3 A;  2Z16 A;  1Z7L A;  5FLX K;  2Z3Y A;  1P9Q C;  3KZI C;  3FBI B;  2DTR A;  3H0D A;  1IJW C;  3MAJ A;  1V5E A;  2XRN A;  4AD9 A;  5D6F A;  3EPZ A;  5GTI C;  3G1L A;  4CZZ A;  2LY2 A;  2PQ8 A;  2QQB A;  2ZC2 A;  2B7E A;  1OYW A;  1KYZ A;  3N4M A;  5B3S H;  1W5S A;  2FNA A;  4XRF A;  1MKM A;  2XC7 A;  1ZKG A;  1RPW A;  2NS0 A;  3RQ4 A;  3HRS A;  2RQP A;  3FWE A;  2IRF G;  3RTR A;  5LLQ A;  1LVK A;  4HBL A;  3KE2 A;  1VF9 A;  4BJ5 C;  3PNV A;  4KIT B;  1YRN B;  5DDG A;  3WG7 H;  2X9D A;  3OL4 A;  5AIP A;  1MH4 A;  2HDC A;  3QU6 A;  1P4X A;  5LGT A;  1IRG A;  3GZ6 A;  2MLG A;  4A0Z A;  4RGS A;  3VYS B;  1XN7 A;  4M3B A;  2L4A A;  1ZRC A;  1FP1 D;  4EVI A;  5BNG A;  4LB6 B;  1KGS A;  4W1U A;  2UV1 A;  2LRE A;  2LF8 A;  3ZR8 X;  3T1B A;  1T6S A;  2E35 A;  5BPI A;  2W25 A;  3CMM A;  4QWQ A;  3I9V 2;  2P81 A;  1JT0 A;  2XF5 A;  1U5T C;  2CMP A;  5K1Y A;  3NAU A;  4MFE A;  1IF1 A;  1QA6 A;  4U0V A;  2LKP A;  4B4C A;  1G3Y A;  2HKO A;  1SC7 A;  5J6X A;  2L7M P;  3ZMS A;  3JAM K;  5AIQ A;  2HPI A;  1LFB A;  1WJ5 A;  4CH7 A;  3QYB A;  3NEU A;  3FK6 A;  5C44 J;  4PSX A;  5HS7 A;  2R7R A;  5EF6 A;  1ZTR A;  3LSP A;  3IP4 B;  1ITY A;  1BI3 A;  3FM3 A;  1MSE C;  2QYO A;  1SVL A;  1Y8Q B;  2LMD A;  2IPQ X;  3W2W A;  3K4L A;  4PUS A;  3A4C A;  1GDT A;  2JA6 J;  4ASN A;  2Q0O A;  2X0L A;  1WPK A;  3A01 B;  4DBR A;  1LFP A;  3CUQ C;  3HOX J;  2D45 A;  3S16 J;  5M3F J;  4OMZ A;  2M30 A;  2DT7 B;  4DIQ A;  1RC9 A;  4BQN A;  2R7U A;  4U0Y A;  3GZN B;  4FIS A;  1HA8 A;  2DT5 A;  3ZMT A;  2KFD A;  4C9Y A;  1F5T A;  4BHB A;  4CYC B;  1FSH A;  2DQR A;  2KLO A;  1BOA A;  1WH5 A;  2KIS A;  4QIW N;  2LBF A;  4XM3 A;  1ETO A;  1KU9 A;  3QOD A;  5HDK A;  4I7H A;  3SDB A;  4CCM A;  2DMT A;  4YII A;  3HIF A;  3TGN A;  5JVT A;  4KNY A;  4XRS A;  5FKK A;  3K4M A;  4Y17 A;  2M1B A;  3IAM 2;  2D5V A;  3FK7 A;  4ESB A;  1FBQ A;  4D1Q A;  1IDZ A;  1WI9 A;  1XB4 A;  4OIP F;  1Z21 A;  2GLO A;  5E18 F;  3JRC A;  1R7J A;  3DLL F;  4EM0 B;  5FGM A;  1S6L A;  1WJD A;  3CJN A;  3QPT A;  4L9T A;  5FJ8 J;  2CQX A;  3BJA A;  4Y4R A;  3CCU I;  3BQZ A;  3OIP A;  3MMY B;  1D1C A;  3FBN B;  4CGZ A;  2E1N A;  3I59 A;  2IP2 A;  2UXX A;  2ESN A;  2XRO A;  4E7I A;  4KIC A;  3CES A;  2KDO A;  1U5T B;  3BTJ A;  4B44 A;  3ZPL A;  4M9Z A;  4Q4Z F;  3OYC A;  2Y31 A;  4ZYE A;  3RKQ A;  3M8E A;  4FET A;  3J7A Y;  1USS A;  2H8W A;  1MH3 A;  2QSG X;  3SZT A;  1RI7 A;  4X1E A;  4Q5S F;  2VN2 A;  1BR4 A;  5LD2 C;  1ETV A;  3JTH A;  4WXC A;  2ME6 A;  2CQK A;  2BV6 A;  3MKL A;  4D5C A;  3OSG A;  4YIF A;  1TTY A;  1FNN A;  3F21 A;  2GWR A;  4IOA F;  1PP7 U;  4XLA A;  2VBW A;  3V4G A;  3BTI A;  3MVP A;  3C2H A;  1MBJ A;  1B59 A;  1IAW A;  1QPM A;  5KCM A;  3L2C A;  1TWF J;  3GCM A;  3GTO J;  4LJZ F;  4ZTJ A;  3S2W A;  3JRG A;  4BXF A;  1YJW I;  3CUQ B;  3CTA A;  2IXS A;  1XSX A;  2FRH A;  1XTA A;  3KP7 A;  5IYB J;  1X1D A;  4ZH4 F;  4R79 A;  5LGN A;  1B8I B;  1X19 A;  5DM6 F;  1WZ2 A;  2UZK A;  3T5X A;  3KEO A;  4A3G J;  1PUF A;  3OYM A;  4HLX A;  1RRJ A;  2LFB A;  3WU2 C;  2WV0 A;  4DOZ A;  3K2A A;  4LMY A;  2HZT A;  3CZ6 A;  4WX9 A;  4MQ9 F;  2ZJP F;  3BZ6 A;  2M7B A;  3OS2 A;  4E7L A;  2MSY A;  2CFO A;  3WTW C;  1QPI A;  2K4J A;  1X1C A;  5C4J J;  5J40 A;  1O57 A;  1VQO I;  4CCN A;  3H9J A;  4J00 A;  2LNB A;  3LOC A;  2X1E A;  2L9S A;  3U9G A;  3TW6 A;  5EG0 B;  4Z2Y A;  1QO0 D;  4AIK A;  1E3H A;  2HFH A;  4Y13 A;  1DP3 A;  2RV8 A;  1D3Y A;  1MNE A;  4BKX A;  1R23 A;  2J5O A;  2EJR A;  1KU3 A;  1ZK8 A;  4FTH A;  5LGU A;  4ENJ A;  1X58 A;  4GO1 A;  1K83 J;  1IXR C;  3KP2 A;  2XAG A;  4EV0 A;  5KAF C;  1ETQ A;  5BMZ A;  5J8F A;  5DYM A;  1I1G A;  5IOY A;  3Q0W A;  3EUH A;  5CJ9 A;  2HI3 A;  4G8X A;  2LF7 A;  2E2H J;  1SAN A;  3VOE A;  2HQR A;  2A3S A;  3FXK A;  4N4N B;  3IKV A;  3RPQ A;  1ZLK A;  3R6S A;  3H35 A;  3I53 A;  4IXA A;  5DUI A;  1X1P A;  1CF7 B;  5HOD A;  2OUM A;  4I2O A;  3L00 A;  2P7C B;  3A03 A;  1X1A A;  5J4Y A;  2X6O A;  5F04 A;  4KIS A;  2GXB A;  3BC8 A;  1MBH A;  5ICE A;  4QTR A;  2R93 J;  3DKY A;  5DM7 F;  3QYE A;  3IH4 A;  4Z6Y A;  2XKO A;  4KMU X;  5KK1 A;  2L7Z A;  3KX2 A;  1FY7 A;  1JE8 A;  2BOL A;  1Z9C A;  3FM5 A;  2LY9 A;  1Y1V J;  2AQE A;  2DYS H;  5EDN A;  2CW7 A;  3ELK A;  3JRI A;  3AG2 H;  2K9N A;  4WXD A;  1GXP A;  2X85 A;  4XIC A;  4CCO A;  5IY5 H;  3JTG A;  2Y48 A;  3FKJ A;  1YE9 A;  4RAY A;  3SEZ A;  3ESW B;  3HTS B;  4GYG A;  2DTZ A;  2ZME A;  3TO6 A;  2IT0 A;  4RS8 A;  3K9T A;  1APL C;  2MAB A;  4YEL A;  1BR2 A;  5HNF A;  4GYI A;  4HDU A;  1XSV A;  1LE8 B;  3AFH A;  5CKT A;  4UVC A;  1U3E M;  3OMY A;  1UHS A;  2W57 A;  3G73 A;  2HKX A;  3KEQ A;  4I0B A;  1BI2 A;  2MG4 A;  4D7M A;  3ECH A;  1WH7 A;  5F0H A;  1R22 A;  3TW7 A;  1MBG A;  1TQP A;  1YIJ I;  1KU2 A;  4L9V A;  1MJA A;  3QU3 A;  3X2Q H;  1VQ8 I;  2OA4 A;  2BW3 A;  3HJE A;  5CYV A;  2F5E A;  3JRA A;  2IS1 A;  4M3D A;  2NS8 A;  4BS9 A;  3CJQ B;  3H9G A;  3CC7 I;  2R7V A;  2XB0 X;  5EEG A;  3OYF A;  4KIG A;  1NK2 P;  1UMQ A;  3UR3 C;  1G8X A;  3KYC B;  3GTQ J;  2R5Y A;  2KIU A;  5B5E C;  2PX9 A;  2VQC A;  2W4S A;  3R60 A;  4IOC F;  1B72 B;  2K85 A;  2OPT A;  4UB8 C;  4OIN F;  1B9N A;  1YHQ I;  1MBE A;  4A3B J;  2LVS A;  1YIT I;  1TT5 B;  4U7D A;  5F08 A;  2QKM B;  3IH3 A;  1A31 A;  5CQE A;  3H5A A;  1MNM C;  2M3A A;  2BY3 A;  1E2X A;  2HTJ A;  4ZYD A;  3O3K A;  1DDN A;  4XLP F;  2NAZ A;  3CDH A;  3I71 A;  1IV8 A;  3FHZ A;  5TRD A;  1IG7 A;  4UV8 A;  3GW2 A;  1MMN A;  3NRV A;  3AG4 H;  2DAO A;  2ZXW H;  3PFY A;  4N0B A;  4CDG A;  3FXO A;  4CCL A;  1H0M A;  2L0K A;  4CIC A;  1ETY A;  1MBK A;  3PNT A;  2R7D A;  5LEJ A;  3L2R A;  1XDS A;  3D5S C;  2CRG A;  4N4O B;  1KZH A;  3PIP F;  3CMY A;  2E36 A;  5JVG F;  4ANJ A;  3ZXS A;  2CO5 A;  5FRO A;  2M5W A;  2LKS A;  3S17 J;  2ZXI A;  4EEF G;  1SD5 A;  1XS9 A;  2EFW A;  1HSJ A;  3E6D A;  2H27 A;  3G3Z A;  1GV5 A;  2K27 A;  3E6M A;  3M1E A;  1TWC J;  3VWB A;  2DFI A;  2VAS A;  1YJN I;  1W36 D;  2QQ8 A;  2XDV A;  1QNT A;  3B6A A;  4Y15 A;  5A2Q K;  2NVQ J;  1FP2 A;  1UCR A;  3OYN A;  2L4M A;  2CQQ A;  2UXN A;  4GXO A;  2A6E F;  5D4R A;  2K4B A;  2NNY A;  4BYY A;  3HXL A;  3KFW X;  3MKY B;  3EQL F;  3PFI A;  3M4O J;  4HF1 A;  3HRM A;  2K3P A;  3BT9 A;  3FF5 A;  3KEY A;  4MO7 A;  4M6X A;  1HXD A;  2GA1 A;  4WXH A;  3VYU B;  2MD0 A;  1CGP A;  2HDD A;  2DJN A;  3DU5 A;  5ILS A;  3QPS A;  4F52 A;  1UG0 A;  1TL8 A;  1AWC A;  4DYQ A;  1K79 A;  1SFO J;  4KN4 X;  3IL2 A;  1B1B A;  5IP6 A;  3TBI A;  2MC3 A;  3GTL J;  4IRI A;  2BE5 F;  3BQY A;  4F93 B;  3OYE A;  2DQL A;  4EJU A;  2OZU A;  5DS9 A;  2HQA A;  4NUB A;  2KZV A;  3JR9 A;  1MBF A;  4RAF A;  2WWY A;  4C2U A;  1FC3 A;  2M7A A;  1FZP B;  2XAU A;  4A3C J;  5M5W J;  1LDJ A;  4KT5 C;  1ZG3 A;  1VTN C;  2E5Z A;  3OS0 A;  2W84 A;  2ISY A;  4V2F A;  5LHI A;  2IAI A;  2LBF B;  2LTP A;  4QPQ A;  4TV7 A;  2JSC A;  1BI1 A;  2R5Z A;  1KYW A;  2P5K A;  5EYR A;  1GXQ A;  2ZFW A;  3LQQ A;  3GTG J;  1FIP A;  3HB9 A;  2DA5 A;  1RKW A;  1DGR M;  2HR3 A;  4PJN A;  1YFH A;  1TW3 A;  1S72 I;  5BPD A;  2IA1 A;  2QKL B;  2V26 A;  1QHG A;  3RJP A;  2IS4 A;  3IWF A;  5IT9 K;  1E3P A;  1PVE A;  3KYD B;  2QSF X;  1ONV A;  2XPV A;  1J9I A;  4IKF A;  2E5N A;  1OMI A;  5GTH C;  2YX7 A;  1Q1V A;  1XMK A;  1RUO A;  1J5Y A;  2TDX A;  3IAS 2;  4WF2 A;  3ABU A;  5DUK A;  2ECC A;  4BDY A;  2O61 A;  2OCE A;  1UG2 A;  3E97 A;  3I59 B;  1F1Z A;  1BIB A;  4XL9 A;  1WWX A;  1MND A;  2QLZ A;  3BTL A;  1VQP I;  4I01 A;  4M6V A;  2EV5 A;  3BR2 A;  1Y8R B;  3OSF A;  2HXO A;  1HBX G;  3F22 A;  1U2W A;  1T33 A;  3RKX A;  1WJB A;  1REP C;  2DA2 A;  2Y2Z A;  2BGC A;  3L2V A;  2DCE A;  4BQQ A;  1DU6 A;  1SAU A;  2YSR A;  2QBY A;  1ZQ3 P;  3ABK H;  3KZZ A;  2QF7 A;  2NOJ B;  4A5N A;  4UUV A;  2AO9 A;  3RIR A;  3I64 A;  5E3L A;  1LPQ A;  5LHH A;  2DMQ A;  1N75 A;  4RGX A;  2Z9O A;  1JKP C;  5FRM A;  1O3T A;  1AU7 A;  4F55 A;  1KQ0 A;  2R7Q A;  5BS6 A;  2F5C A;  2I5U A;  4LGW A;  3AG3 H;  5FRN A;  1D1B A;  3RPU A;  1D5V A;  2W85 A;  2DFE A;  3GBG A;  3M3Y J;  4XLC A;  1OYY A;  4ESF A;  2M34 A;  2AXL A;  3BP8 A;  4JP0 A;  3GTK J;  1IXS B;  1HC8 A;  3FXU A;  3V42 A;  2MW8 A;  2V1X A;  1TT0 A;  1QBJ A;  3TMO A;  4DJA A;  3SZP A;  4H0E A;  4BE2 A;  1LEB A;  2Y30 A;  1NTC A;  2ZME C;  2KMU A;  4D7N A;  1TQM A;  2OTL I;  4XON A;  2OC6 A;  4BNC A;  3WU0 A;  1U6G A;  2QCO A;  2ZCW A;  1VQ9 I;  5FB2 A;  2CWE A;  2NNN A;  2V9K A;  2ZKZ A;  3LSI A;  3J81 K;  4LB5 A;  4IQJ A;  1EH8 A;  3J7Y J;  1QVT A;  1YQA A;  2RAE A;  3K70 C;  1FX7 A;  2H8R A;  4E7S A;  1IRF A;  2OD5 A;  1BR1 A;  1HW2 A;  1JT6 A;  1RET A;  3CCR I;  1A35 A;  1UZC A;  2CFX A;  4E6K G;  2JZY A;  2GIV A;  3VDX A;  2EH3 A;  3Q9S A;  4XRM A;  3ABL H;  2FBI A;  5DTD A;  4MNU A;  1X4O A;  2V1D A;  4IEJ A;  3HRU A;  2WBM A;  5D4S A;  1XMX A;  4I76 A;  3BZC A;  4F92 B;  1BC7 C;  3RYP A;  2BZT A;  4CCK A;  2GA2 A;  3HSF A;  3QOP A;  4I98 B;  3K4C A;  5HS9 A;  4ESJ A;  2RNJ A;  4KFC A;  1TBX A;  1IRX A;  2DK5 A;  2MC4 A;  3DWL E;  2ECB A;  5E8G A;  2VOD A;  2M87 A;  1Y39 A;  4HAM A;  2VPL A;  1IW7 F;  1O7F A;  2KP6 A;  1XGM A;  1UFM A;  1GHC A;  2KIQ A;  1L3L A;  5EZH A;  3COA C;  4LK0 F;  2V6E A;  1R4N B;  3D1N I;  2EB7 A;  5LFA A;  3GZ5 A;  3G71 I;  2MYS A;  3VYT B;  2O8X A;  1VZ0 A;  3K1M A;  3O8G A;  4XR6 A;  4FE4 A;  4RAG A;  1FJL A;  1IZ1 A;  4YG2 F;  3ZCO A;  3LSH A;  4L5I A;  4CCJ A;  5J8C A;  2OU2 A;  2JWT A;  2CV0 A;  2V1U A;  4RM3 A;  2ZNZ A;  3M8F A;  1AKH A;  5DD4 A;  1YTY A;  2DA3 A;  1IC8 A;  2XSJ C;  3LA3 A;  4A2U A;  2KIM A;  3GUD A;  1XCV A;  3OYK A;  5FO5 A;  4L9J A;  2E2J J;  4G6Q A;  2L54 A; 
#chains in the Genus database with same CATH homology
 1TNT A;  1R00 A;  4CO8 A;  1K6O A;  1L0O C;  1R5G A;  2KIF A;  1YW9 A;  4XBF A;  3FMQ A;  1QZZ A;  5CVI A;  1BBY A;  2ZME B;  1W7P A;  5K5Q A;  1YIO A;  2JPC A;  2WC2 A;  1TQI A;  3J80 Z;  2FEZ A;  3B73 A;  1K78 A;  2HYG D;  2CYY A;  2ETH A;  3F3X A;  5D5V B;  3QAH A;  1ON2 A;  3GX4 X;  2YX4 A;  5FLX Z;  2K7L A;  2RN7 A;  2WTE A;  4MEY F;  3TDU C;  1XD7 A;  3T0Y A;  2VOO A;  3F8B A;  4HYE A;  3E6C C;  4E70 A;  2DPD A;  4YFN F;  4HV6 A;  2DO7 A;  2QZ8 A;  3O2P E;  2FML A;  1K7A A;  1JHH A;  3GO5 A;  4M9S A;  4M72 A;  1MDM B;  1GVJ A;  1T38 A;  4FT8 A;  3KET A;  3I4P A;  2XGX A;  1STZ A;  3BRO A;  2DLL A;  1TW2 A;  3HSR A;  1RZ4 A;  1FLI A;  2G7H A;  2Q2E A;  3DF8 A;  4R1H A;  2EV0 A;  3K0L A;  1SFE A;  1S7O A;  4ETS A;  4NB5 A;  5CVJ A;  5L3G A;  4HF0 A;  2H09 A;  3ZN0 A;  2L01 A;  1FBS A;  1EH6 A;  2GQQ A;  1JHF A;  2ZJ2 A;  2RVC A;  4RB2 C;  2O6G E;  3JW4 A;  1QQI A;  4IRG A;  4P9F A;  1R36 A;  1YW7 A;  3I5U A;  5L3E A;  3JAM Z;  1LQ1 A;  3HRT A;  4KMF A;  4XSZ F;  4LG0 A;  4EM2 A;  4ZYG A;  2HEO A;  3KP6 A;  3BPV A;  2EK5 A;  2VXZ A;  4HOB A;  3ZMV A;  1WQ2 A;  3W6K B;  5HOO A;  1KA8 A;  1J7K A;  2V9V A;  4P5O A;  5K5R A;  2XAH A;  4PGH A;  5D8K B;  4M6Y A;  4A6D A;  5FD5 A;  3RKY A;  3F8M A;  3F6V A;  4ENK A;  1A04 A;  2KJB A;  4LD5 A;  4BQA A;  3WE3 A;  1C0W A;  2ISZ A;  3FMS A;  3P9C A;  1I6X A;  3ZQ7 A;  2L3D A;  2EFN A;  3CUO A;  2ZBK A;  4OIO F;  3MQ0 A;  1HW5 A;  4AIH A;  3ML6 A;  2FBK A;  4KIF A;  2XVC A;  3D0S A;  1IXC A;  1W7P D;  3F23 A;  1ZN2 A;  1LDK B;  1QGP A;  3WG9 A;  2ACJ A;  2G9W A;  4L9N A;  2QBY B;  4R8H A;  2VC1 A;  1G3W A;  3V7R A;  3E5U A;  3H3U A;  3E5Q A;  2KRF A;  2CG4 A;  4O3M A;  5CVR A;  4KA4 A;  4WCG A;  5ILU A;  4HZF A;  3OOP A;  3BJO A;  5D8L B;  2XKP A;  2FMY A;  4HV5 A;  4PGG A;  2E7X A;  5K5O A;  3F72 A;  1O7L A;  3RYR A;  5DCM A;  2NRA C;  3T8T A;  1O3R A;  2DK8 A;  2XUB A;  2FA5 A;  5IT3 A;  5LRS A;  2KJC A;  1RUN A;  1G4D A;  3MFK A;  1Y0U A;  2MBF A;  2P6T A;  2PEX A;  4RB3 C;  4BAY A;  3QPH A;  1Z6T A;  2HQN A;  3LA2 A;  3MZH A;  2ZNY A;  4PCQ A;  4N9I A;  5D5U B;  3O6B B;  4Q48 A;  4G7H F;  4B8X A;  3HHG A;  3TDZ C;  2P8T A;  3EYY A;  4I02 A;  4JBA A;  3E3V A;  5E1Z B;  1PDN C;  2YU3 A;  1SD4 A;  2MH2 A;  2EFO A;  1H9T A;  3LST A;  5DEQ A;  1LB2 A;  3L7W A;  4AVP A;  2HS5 A;  2O03 A;  5L3B A;  1FOK A;  4GGG A;  5E17 F;  4OIR F;  3HOS A;  1FYL A;  4KN7 X;  2CW0 F;  2JRT A;  1BJA A;  3ZMZ A;  1TLH B;  4RB1 A;  3DP7 A;  4MHG A;  2QVO A;  3F6O A;  1IN5 A;  2X4H A;  4BHP A;  4OU0 A;  4U7B A;  4CXF A;  1K78 B;  3BJ6 A;  3TKY A;  1XCB A;  2F2E A;  3K2Z A;  5ICF A;  2A68 F;  1SAX A;  1R1T A;  3V7S A;  2F5D A;  1S3J A;  1SD6 A;  1HW1 A;  1XSD A;  1YS6 A;  1SFX A;  4RB0 A;  3V7C A;  4CHU A;  2Z33 A;  4EJW A;  1MZB A;  1G3S A;  1WRJ A;  1FPQ A;  1YO5 C;  1RNL A;  3IC7 A;  5HLI A;  3RKW A;  4G7Z F;  3DPL C;  1OPC A;  5H6R A;  4OMY A;  4JK1 X;  3GWZ A;  3WU1 B;  1R5H A;  4BHC A;  3WTT C;  2KKO A;  1HKQ A;  4BH9 A;  3GFJ A;  4IPA A;  3Q5F A;  4UVA A;  4UNO A;  4YFX F;  3BOQ A;  3U2R A;  5CVU A;  1U5T A;  5FFX A;  4M71 A;  5FD6 A;  3WTZ A;  2FSW A;  2EA2 A;  5ERI A;  5HVQ C;  4UXN A;  2QQ9 A;  2PMU A;  3PQK A;  4AWX B;  1O3Q A;  4XLN F;  1P4A A;  1Z1D A;  3HUG A;  1V4R A;  2OBP A;  3ZMU A;  1NHA A;  1JXS A;  4D0P A;  1XMA A;  5JFR A;  1U8R A;  4LG0 B;  3KZY A;  1KQ8 A;  3LWF A;  4HW0 A;  2VC0 A;  1AOY A;  1Z91 A;  2E1C A;  3WGG A;  2IA2 A;  3REO A;  6PAX A;  1KU7 A;  5HLH A;  2XAS A;  2PFB A;  3C18 A;  3RI4 A;  2P6S A;  2PJP A;  4IF4 A;  5CVV A;  4WK8 F;  4L5J A;  5H6Q A;  3IRQ A;  1LEA A;  3HSE A;  2QWW A;  5E1W A;  2D1H A;  2XV4 S;  5HS8 A;  2VE8 A;  2FF4 A;  3DPT A;  4G7O F;  1BM9 A;  3P7N A;  2UWM A;  4KDP A;  5D6E A;  5IT9 Z;  1R1V A;  3QP6 A;  1R58 A;  2VT3 A;  4EJO A;  1I27 A;  1CF7 A;  1ZH5 A;  4N9H A;  1G3T A;  3DV8 A;  3K1P A;  2M8E A;  3ROU A;  2JTV A;  3GFL A;  2IVM A;  2LDU A;  1P6R A;  1T0F A;  5ICG A;  4HLY A;  4IRH A;  2Y0M A;  3SXY A;  1MJB A;  2H6B A;  5JHU A;  1FBU A;  4KIB A;  4RGU A;  4GCV A;  1R1U A;  1IN6 A;  1UB9 A;  2FU4 A;  1EH7 A;  2Z99 A;  2IJL A;  4XSX F;  4NHJ A;  1ZLJ A;  3J80 K;  2A5Y B;  3I58 A;  5TJJ A;  5HDN A;  3DFG A;  4A0X A;  1DUX C;  4G94 A;  4LLN A;  5DCM B;  3WTX C;  4L18 B;  2COM A;  2D2W A;  3DKW A;  4MTE A;  3GVA A;  3L9F A;  3CO6 C;  1Q1H A;  1J2X A;  3HYI A;  4EJV A;  2PBI A;  3M9A A;  4KUM A;  3J81 Z;  3U1D A;  5FFZ A;  1DPR A;  1Z05 A;  2GZW A;  2VON A;  2NYX A;  4A5M A;  3B02 A;  3VOD A;  3GYH X;  2VBZ A;  3ABT A;  3WE2 A;  1JGS A;  3ULQ B;  2O3F A;  4M74 A;  1X3U A;  3ZMD A;  4CYD A;  3LAP A;  2MA3 A;  3HOT A;  3KLO A;  1FSE A;  5HDG A;  2DPU A;  3K69 A;  1D8K A;  4YFK F;  1MD0 A;  4OIQ F;  1PP8 F;  3GF2 A;  2HGC A;  2H94 A;  3R0J A;  4OOI A;  5L3D A;  1ULY A;  2GAU A;  4ZYH A;  1EV7 A;  2VE9 A;  2EFQ A;  1Z6R A;  5LHG A;  4PDK A;  3VEP A;  4EMS A;  2HWV A;  1FYM A;  3OV8 A;  1FWZ A;  4G6D A;  5BOX A;  3EYI A;  5EEH A;  3L09 A;  3R0A A;  1YS7 A;  3TQN A;  5E20 A;  1XDU A;  3GEZ A;  3FMR A;  2R3S A;  3PQJ A;  2A61 A;  2MH9 A;  5KVR A;  5LBQ A;  5LRR A;  2F5F A;  2L02 A;  2R7F A;  2IA0 A;  1ZG5 A;  2A07 F;  1BI0 A;  4ENN A;  2GXG A;  3P9I A;  4MGR A;  1S7A A;  2P7V B;  5F64 A;  3NQO A;  5D5W B;  5DV5 A;  4IHS A;  2PG4 A;  1ZGA A;  1ODD A;  2VBY A;  4U0W A;  2P5V A;  2FQ3 A;  1UHM A;  2BBY A;  1P4W A;  1ZGJ A;  2PN6 A;  2M45 A;  3F8N A;  4ON0 A;  5CLS A;  3SFZ A;  2AS5 F;  5JR3 A;  5E8I A;  3GFI A;  3KP4 A;  2V6C A;  1I5Z A;  1S8N A;  2STT A;  1HKT A;  3WTV C;  2QUF A;  4P96 A;  3H3Z A;  3IHU A;  2OQG A;  4ENM A;  1OYI A;  1RIO H;  2V79 A;  1J0R A;  4LLL A;  3TO9 A;  5D5X B;  2H6C A;  2EFP A;  4FHT A;  4KYW A;  1DPU A;  3IRR A;  5ED4 A;  1O3S A;  3WGH A;  2A69 F;  5BQT A;  1E17 A;  4HX4 A;  1ON1 A;  4P9U A;  2ELH A;  3Q9V A;  2YR2 A;  4UVB A;  2MD5 A;  4EGY A;  4Q47 A;  4HA8 A;  3P9K A;  3SHF A;  1LNW A;  1HQC A;  3BPX A;  3TO7 A;  3C1D A;  1QZY A;  1W5T A;  1W4M A;  3F8C A;  4IHT A;  2IW5 A;  4LK1 F;  2EWN A;  3SQN A;  2RC4 A;  2PI0 A;  3MCZ A;  1ZAO A;  5HLG A;  1UST A;  4K2E A;  3WTS C;  2ADU A;  3R61 A;  3KP3 A;  3IKT A;  4A12 A;  2JT1 A;  5L3C A;  2OZ6 A;  2W24 A;  1FT9 A;  2JPB A;  1MJ9 A;  3FZV A;  2P5L C;  2XIG A;  1YYV A;  4LFU A;  1V3F A;  2ZO4 A;  2FNP A;  3BY6 A;  1FYK A;  1OR7 A;  3C3W A;  4QLC U;  3EDP A;  2XAF A;  3MWM A;  4PZJ A;  4S05 A;  3GXO A;  1T98 A;  4M9X A;  1BC8 C;  1IUY A;  2CGP A;  2O0Y A;  3WGI A;  4B09 A;  3QP5 A;  4ZZD A;  4U88 A;  4G9Y A;  5H20 A;  3WTU C;  4P55 A;  4RAZ A;  3DQV C;  2HYF A;  1XGN A;  4UHT A;  1ZG1 A;  2VBX A;  4S04 A;  2PMH A;  3BDD A;  3N97 A;  1YLF A;  1ZAR A;  4HDV A;  4L0Z B;  1WKM A;  3T8R A;  2EV6 A;  3JSO A;  4HQE A;  4IJA A;  1B4A A;  5F6F A;  1LVA A;  1G6N A;  3E6B A;  4F7Z A;  3ZP5 A;  1U78 A;  3KLN A;  1W7P B;  3WTY C;  4WWC A;  2FOK A;  5ILV A;  4MEX F;  3KCC A;  4JQF A;  3I0T A;  2K02 A;  1D8J A;  1OKR A;  3ECO A;  4O5V A;  2D1V A;  2FBH A;  1LDD A;  1ZRD A;  2QQA A;  1MDM A;  4MTD A;  1ZHF A;  2Q8K A;  1BIA A;  4HX7 A;  4ZZL A;  1XGO A;  1F9N A;  1IN7 A;  4I0A A;  1UHW A;  2Y75 A;  4BXU A;  1J75 A;  3E5X A;  4A6E A;  2DU9 A;  4HQM A;  2DBB A;  4EGZ A;  4LLG F;  1BN5 A;  3HHH A;  4FX4 A;  4DQ2 A;  4UV9 A;  1IN4 A;  1TNS A;  1HKS A;  2XAQ A;  2B0L A;  3D5L A;  1LJ9 A;  3VFZ A;  3MZY A;  3GFM A;  3ISP A;  3J7A O;  3JSP A;  4HF2 A;  4HX8 A;  4O6J A;  3W6J B;  4L0Y B;  3HTU A;  1I1S A;  2OAZ A;  1YW8 A;  1H9G A;  5E1X A;  3FXQ A;  4FX0 A;  2C6Y A;  5F1R A;  5LEK A;  1J59 A;  2E7W A;  4MQV A;  3EET A;  4DNC A;  3M7G A;  2EA4 A;  1MGT A;  3RDI A;  2G7U A;  3FX3 A;  5A2Q Z;  2J5P A;  2OQR A;  1SD7 A;  4NQW A;  3F8F A;  3R4K A;  2ZXJ A;  3CUQ A;  4EM1 A;  1SMY F;  1SFU A;  3CLO A;  2FE3 A;  1S29 A;  3BWG A;  3LQR A;  1DP7 P;  3VB2 A;  1PUE E;  2K86 A;  3AAF A;  2VT2 A;  1WSU A;  2Z5U A;  3V8J A;  3LAJ A;  2QM3 A;  1ZRF A;  2A6H F;  2STW A;  2PLY A;  1SMT A;  4EJT A;  3ZN1 A;  2BYV E;  2HTS A;  3TOB A;  3DXJ F;  3V8K A;  5L3F A;  5JI6 A;  2RGV A;  4RGR A;  2QEN A;  2DW4 A;  3DEU A;  3MEX A;  2XHK A;  3V8L A;  3ERE D;  1B9M A;  4M73 A;  2HOE A;  3WOD F;  1P2F A;  2P4W A;  1T2K A;  2LSO A;  1Z7U A;  2DI3 A;  2BEO A;  2CSO A;  3QRF F;  2YPR A;  1XGS A;  2RDP A;  3LFK A;  3TOA A;  3KP5 A;  1YG2 A;  2ESH A;  4I09 A;  2FXA A;  3GLX A;  4IVN A;  1B6A A;  3C7J A;  1KQ9 A;  1ZYR F;  2XAJ A;  2RKH A;  4EQQ A;  3CO7 C;  1F4K A;  3IWZ A;  3K1N A;  5AON A;  1T39 A;  1ZRE A;  3FXR A;  1IN8 A;  3LA7 A;  5DD8 A;  5ICC A;  3I54 A;  3H92 A;  5DCF A;  4A0Y A;  4AIJ A;  2VOP A;  1HST A;  2MLK A;  1P92 A;  5FLX K;  2Z3Y A;  2DTR A;  3MAJ A;  2XRN A;  4AD9 A;  5D6F A;  4CZZ A;  2PQ8 A;  2QQB A;  1OYW A;  1KYZ A;  3N4M A;  1W5S A;  2FNA A;  4XRF A;  1MKM A;  2NS0 A;  3HRS A;  2RQP A;  3FWE A;  2IRF G;  3RTR A;  5LLQ A;  4HBL A;  3KE2 A;  5DDG A;  5AIP A;  2HDC A;  3QU6 A;  1P4X A;  5LGT A;  1IRG A;  3GZ6 A;  2MLG A;  4A0Z A;  4RGS A;  1XN7 A;  2L4A A;  1ZRC A;  1FP1 D;  4EVI A;  4LB6 B;  1KGS A;  2LF8 A;  3T1B A;  1T6S A;  5BPI A;  2W25 A;  4QWQ A;  1U5T C;  5K1Y A;  1IF1 A;  4U0V A;  2LKP A;  1G3Y A;  2HKO A;  5J6X A;  3ZMS A;  3JAM K;  5AIQ A;  3NEU A;  5HS7 A;  1BI3 A;  3FM3 A;  2QYO A;  2IPQ X;  4ASN A;  2Q0O A;  2X0L A;  3CUQ C;  2D45 A;  4OMZ A;  2M30 A;  4U0Y A;  2DT5 A;  3ZMT A;  1F5T A;  4BHB A;  1FSH A;  2DQR A;  1BOA A;  1KU9 A;  5HDK A;  4I7H A;  4YII A;  3HIF A;  3TGN A;  5JVT A;  4KNY A;  4Y17 A;  2M1B A;  4ESB A;  1FBQ A;  1WI9 A;  1XB4 A;  4OIP F;  5E18 F;  1R7J A;  4EM0 B;  5FGM A;  1S6L A;  3CJN A;  3QPT A;  4L9T A;  3BJA A;  4CGZ A;  2E1N A;  3I59 A;  2IP2 A;  2UXX A;  2ESN A;  2XRO A;  4KIC A;  1U5T B;  3ZPL A;  4M9Z A;  4Q4Z F;  4ZYE A;  3M8E A;  1USS A;  3SZT A;  1RI7 A;  4Q5S F;  2VN2 A;  3JTH A;  4WXC A;  2CQK A;  2BV6 A;  4YIF A;  1TTY A;  1FNN A;  3F21 A;  2GWR A;  1PP7 U;  3V4G A;  2VBW A;  1B59 A;  1IAW A;  1QPM A;  3L2C A;  4LJZ F;  3S2W A;  3CUQ B;  3CTA A;  1XSX A;  2FRH A;  3KP7 A;  4ZH4 F;  4R79 A;  5LGN A;  2UZK A;  3T5X A;  3KEO A;  4HLX A;  2WV0 A;  4LMY A;  2HZT A;  4WX9 A;  4MQ9 F;  3BZ6 A;  3WTW C;  2K4J A;  1O57 A;  2LNB A;  3U9G A;  4Z2Y A;  1QO0 D;  4AIK A;  2HFH A;  4Y13 A;  2RV8 A;  1D3Y A;  1R23 A;  2J5O A;  2EJR A;  1KU3 A;  5LGU A;  4ENJ A;  4GO1 A;  1IXR C;  3KP2 A;  2XAG A;  4EV0 A;  5BMZ A;  5J8F A;  5DYM A;  1I1G A;  3EUH A;  5CJ9 A;  4G8X A;  2LF7 A;  3VOE A;  2HQR A;  2A3S A;  3RPQ A;  3IKV A;  1ZLK A;  3R6S A;  3I53 A;  4IXA A;  5DUI A;  1CF7 B;  4I2O A;  3L00 A;  2P7C B;  2GXB A;  5ICE A;  2XKO A;  4KMU X;  5KK1 A;  1FY7 A;  1JE8 A;  1Z9C A;  3FM5 A;  3ELK A;  4WXD A;  1GXP A;  3JTG A;  2Y48 A;  4RAY A;  3HTS B;  4GYG A;  2ZME A;  3TO6 A;  2IT0 A;  4RS8 A;  3K9T A;  4GYI A;  4HDU A;  1XSV A;  4UVC A;  1U3E M;  2W57 A;  3G73 A;  2HKX A;  3KEQ A;  4I0B A;  1BI2 A;  3ECH A;  1R22 A;  1TQP A;  1KU2 A;  4L9V A;  1MJA A;  3QU3 A;  2OA4 A;  5CYV A;  2F5E A;  5EEG A;  4KIG A;  2KIU A;  3R60 A;  4OIN F;  1B9N A;  4U7D A;  2HTJ A;  1E2X A;  4ZYD A;  3O3K A;  1DDN A;  4XLP F;  2NAZ A;  3CDH A;  3I71 A;  5TRD A;  3FHZ A;  4UV8 A;  3GW2 A;  3NRV A;  2DAO A;  4N0B A;  4CDG A;  1H0M A;  4CIC A;  2R7D A;  5LEJ A;  1XDS A;  2CO5 A;  2M5W A;  1SD5 A;  2EFW A;  1HSJ A;  3E6D A;  2H27 A;  3G3Z A;  2K27 A;  3M1E A;  3E6M A;  2DFI A;  4Y15 A;  1QNT A;  5A2Q K;  1FP2 A;  1UCR A;  2L4M A;  2UXN A;  4GXO A;  5D4R A;  2A6E F;  2K4B A;  2NNY A;  4BYY A;  3KFW X;  3EQL F;  3PFI A;  4HF1 A;  3HRM A;  3FF5 A;  4M6X A;  1HXD A;  2GA1 A;  4WXH A;  1CGP A;  5ILS A;  1AWC A;  1K79 A;  4KN4 X;  3IL2 A;  1B1B A;  2MC3 A;  4IRI A;  2BE5 F;  2DQL A;  4EJU A;  2OZU A;  2WWY A;  1FC3 A;  1FZP B;  1LDJ A;  4KT5 C;  1ZG3 A;  1VTN C;  2W84 A;  2ISY A;  5LHI A;  4TV7 A;  2JSC A;  1BI1 A;  1KYW A;  2P5K A;  1GXQ A;  2ZFW A;  3LQQ A;  2HR3 A;  1YFH A;  1TW3 A;  5BPD A;  2IA1 A;  3RJP A;  3IWF A;  5IT9 K;  1ONV A;  1J9I A;  1OMI A;  2YX7 A;  1RUO A;  1XMK A;  1J5Y A;  2TDX A;  4WF2 A;  3ABU A;  5DUK A;  2O61 A;  3I59 B;  3E97 A;  1F1Z A;  1BIB A;  1WWX A;  2QLZ A;  4I01 A;  2EV5 A;  1HBX G;  3F22 A;  1U2W A;  3RKX A;  1REP C;  2BGC A;  2YSR A;  2QBY A;  3KZZ A;  4A5N A;  4UUV A;  3RIR A;  3I64 A;  5LHH A;  4RGX A;  2Z9O A;  1O3T A;  1KQ0 A;  5BS6 A;  2F5C A;  4LGW A;  3RPU A;  1D5V A;  2W85 A;  1OYY A;  4ESF A;  3BP8 A;  2AXL A;  1IXS B;  3FXU A;  2V1X A;  1QBJ A;  3SZP A;  4H0E A;  1LEB A;  1TQM A;  4BNC A;  3WU0 A;  1U6G A;  2ZCW A;  5FB2 A;  2CWE A;  2NNN A;  2ZKZ A;  4LB5 A;  3J81 K;  1EH8 A;  1YQA A;  1FX7 A;  1IRF A;  2OD5 A;  1HW2 A;  2CFX A;  2JZY A;  2GIV A;  3Q9S A;  2FBI A;  4MNU A;  2V1D A;  3HRU A;  5D4S A;  1BC7 C;  3RYP A;  2GA2 A;  3HSF A;  3QOP A;  4I98 B;  5HS9 A;  4ESJ A;  2RNJ A;  4KFC A;  1TBX A;  2DK5 A;  5E8G A;  2VOD A;  2M87 A;  4HAM A;  1IW7 F;  1O7F A;  1XGM A;  1UFM A;  1GHC A;  1L3L A;  3COA C;  4LK0 F;  2EB7 A;  3GZ5 A;  2O8X A;  3K1M A;  1IZ1 A;  4YG2 F;  5J8C A;  4L5I A;  2OU2 A;  2V1U A;  2ZNZ A;  3M8F A;  5DD4 A;  1YTY A;  3LA3 A;  4A2U A;  2KIM A;  3GUD A;  1XCV A;  5FO5 A;  4L9J A;  4G6Q A;  2L54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...