5IT3A

Swirm domain of human lsd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
LPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Lysine-specific histone demethylase 1A
publication title A Tlx-interacting peptide of Lsd1 inhibits the proliferation of brain tumor stem cells
rcsb
source organism Homo sapiens
total genus 29
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it3A00
1BOAA 1YIOA 4KMUX 1JHHA 5BQTA 4AIKA 2QLZA 3PQJA 2OAZA 2DW4A 3KEQA 3MFKA 1R7JA 2FE3A 4R79A 4A5NA 3ZN0A 1XGMA 2FRHA 2CSOA 1OYWA 4MHGA 3V7SA 5E20A 4CO8A 3IC7A 4UNOA 2BGCA 4YIIA 3KLNA 1B6AA 2A69F 3E97A 2EV0A 1U5TB 2IA2A 3C18A 3C7JA 1C0WA 4U7DA 1MZBA 2IT0A 4EQQA 1R5HA 4HX8A 4N9HA 3ZP5A 2EA2A 4XSXF 3KFWX 1D5VA 2FBHA 1MJBA 4L5IA 3TOAA 4P9FA 4P96A 1FYLA 1KA8A 1HKQA 3KETA 1H9GA 3QPHA 2ZMEB 4ENJA 4CYDA 5JR3A 1P4AA 2QYOA 3N97A 1DP7P 3O2PE 3T5XA 2FMLA 1ZREA 2UWMA 3BOQA 5EEGA 2KIMA 3QP5A 1BIBA 2ADUA 2P6SA 5LRRA 3LSTA 3WTTC 3CUQB 1K79A 5F1RA 5JI6A 1LEBA 1JXSA 3I0TA 1O57A 1MDMA 4CDGA 2Z9OA 2EA4A 3ELKA 5D8LB 3GFMA 5DCFA 5FGMA 1ZLKA 1UB9A 4L9TA 4R1HA 1T98A 4LK0F 5DDGA 2HGCA 5LEKA 2R7FA 2L02A 4L18B 2L54A 5AIPA 1U78A 2HS5A 2MBFA 3J80Z 2KIFA 4GXOA 2P5KA 4OIOF 1R1VA 2CG4A 2CW0F 1J75A 2C6YA 4KDPA 2XAFA 2L3DA 1OKRA 3RYPA 5HS9A 4PCQA 2PFBA 3KP7A 2DI3A 5J8CA 5LBQA 2F5EA 1FSHA 4GGGA 4I01A 2AS5F 5CVJA 1S8NA 3MCZA 3FMQA 3O3KA 2COMA 4A6EA 4S05A 1IN6A 3I53A 4M72A 1YW9A 3I59B 3M9AA 4BXUA 4OMZA 2UXXA 4LG0A 1TQPA 3LAPA 3I4PA 1MGTA 3WTSC 1ZRCA 1KU3A 1B59A 1K6OA 4DNCA 3EQLF 5FB2A 3FXUA 5CLSA 2O8XA 3K1NA 2FA5A 2DU9A 1B9NA 2VOOA 2W84A 4B8XA 4N9IA 3GFJA 2RKHA 2XKOA 3FZVA 2QBYB 2DFIA 2RN7A 3I71A 4BH9A 3CO6C 1FLIA 2Z5UA 1WQ2A 1D8JA 5HOOA 3F8MA 2IP2A 1KYZA 2JT1A 5BOXA 1IXSB 1G3WA 3VODA 1TTYA 5L3EA 4BAYA 4F7ZA 1FBUA 2Z3YA 1FSEA 1AOYA 3TQNA 5DUIA 2BYVE 2CQKA 1O7LA 1I6XA 4AIHA 2HOEA 1D3YA 1RI7A 4WXDA 5ILUA 3P9IA 1XMKA 4NB5A 2IW5A 3IRQA 2RVCA 5BPIA 5BMZA 3SZPA 3LA7A 3N4MA 2XASA 3FMSA 3HSEA 1J59A 4R8HA 2VT3A 3DPLC 4P5OA 1CF7B 3E5UA 2X0LA 4HV5A 5L3GA 2W24A 3KP5A 1RUNA 1ZGJA 5DUKA 1KQ9A 2QQ9A 2FQ3A 2R3SA 4ON0A 4ENKA 4LFUA 2EV6A 5D4SA 2ZXJA 1EH8A 4HYEA 4RGRA 3IKVA 3FWEA 1FYKA 4IF4A 2IA1A 3TOBA 2HFHA 1YTYA 2O03A 1ZRDA 2P7CB 2FSWA 3QOPA 1X3UA 5CVUA 2QVOA 3U9GA 2LKPA 1J0RA 1SFXA 3DF8A 2ESHA 1R58A 1P2FA 5A2QK 4KIGA 1WKMA 2PI0A 2HTJA 4P9UA 2NNYA 4LB5A 1KGSA 4G7HF 1U5TC 2IRFG 3REOA 1HKTA 4EV0A 2HQRA 4GCVA 2STTA 5HVQC 2A5YB 5D6FA 4WWCA 1Y0UA 1XSDA 3C1DA 5H20A 2Q0OA 3E6BA 5HDKA 4S04A 4ASNA 1ZYRF 2VT2A 5BPDA 3Q5FA 1W7PD 3DV8A 1KQ0A 4OU0A 1JE8A 1OR7A 1ZHFA 3WE3A 4WF2A 1BI3A 4ZYDA 1HKSA 2MD5A 4MQ9F 2VBXA 4XLNF 2KJCA 2YX7A 4WK8F 1DDNA 3GO5A 5LHIA 4A0YA 2UZKA 4LMYA 2W85A 2KRFA 4KUMA 1MJ9A 1ZG5A 1Z7UA 3QP6A 1D8KA 2F2EA 5LEJA 4UV9A 1PP7U 2OQGA 4BNCA 4LLNA 2DT5A 4IHTA 1T38A 1Z1DA 1STZA 1ZG3A 2HEOA 1W4MA 1FPQA 2NYXA 5K1YA 1TNTA 1TQMA 3ZMSA 2VBZA 3RI4A 1K78A 2WWYA 1F1ZA 1FP1D 4LG0B 4ENNA 2OA4A 3GX4X 1FNNA 2HKXA 2XKPA 5HLIA 4MEXF 2ZO4A 4H0EA 1GXQA 4OOIA 4UV8A 5L3BA 3W6JB 4DQ2A 3GXOA 5E1ZB 4YFKF 1USSA 5L3DA 1IAWA 1G3SA 3BJ6A 3S2WA 1YW7A 3KLOA 4PZJA 3ABUA 3I64A 3WG9A 1EH7A 2X4HA 3E6CC 1S3JA 3GEZA 3KZYA 2E7XA 3HYIA 1CGPA 5JHUA 1WSUA 4Y15A 4Q4ZF 4UVCA 2EB7A 5HLHA 2W57A 1IN7A 4AD9A 3V4GA 2CGPA 2JSCA 5HS7A 2PJPA 2JTVA 3K1MA 3M8FA 2CYYA 2VBWA 1DUXC 2M30A 3MQ0A 1XCBA 4CZZA 1KQ8A 3ZMZA 4PDKA 3I58A 4NQWA 5FFZA 3M8EA 1RZ4A 1ON2A 1O3QA 3WU0A 2XGXA 1P92A 4A12A 3DKWA 4HQEA 3QU3A 1O3TA 3BP8A 4U0WA 1V4RA 4A0XA 3J7AO 2G9WA 1SD6A 3QAHA 1QNTA 3HHGA 2A68F 3T8TA 2K4BA 3RKXA 2VC0A 3WTWC 4AIJA 1YYVA 2O6GE 4O6JA 1FWZA 3VB2A 2O61A 2YR2A 3G3ZA 4HA8A 3COAC 2KIUA 3L2CA 2EFOA 3ZMTA 3HRTA 2VODA 3BWGA 2K86A 4M9SA 3EDPA 4LGWA 1V3FA 3FXQA 3NEUA 4ZYGA 4LD5A 5LGUA 3GVAA 5KVRA 1T2KA 4RAZA 2GXBA 1FP2A 2MLGA 4RB0A 2DLLA 4UVBA 3WGGA 5E8GA 1LVAA 1I1GA 1RUOA 3F6OA 4A5MA 2XVCA 1LDDA 1Z91A 5ED4A 4G6QA 1XGSA 2PBIA 3KP2A 2VN2A 1ZG1A 3HRMA 4CGZA 2VC1A 3HRUA 1ZGAA 4HW0A 4KYWA 3SFZA 2RQPA 1ZAOA 3KZZA 4YFNF 3DEUA 1GHCA 4G8XA 1I5ZA 4EJVA 2H6BA 1KU9A 2K7LA 4L9VA 2DQLA 3IWFA 3GFLA 4HF0A 4Q48A 3GZ6A 3J81K 4QWQA 5A2QZ 1MJAA 3H92A 4EJOA 5HS8A 4WX9A 1F5TA 2QENA 4UXNA 5D6EA 3FMRA 1LQ1A 1LDKB 4FT8A 1OYYA 4U88A 2DPUA 3ZMDA 1HW1A 3HSRA 3WTUC 3SHFA 1L3LA 2ISZA 4OIRF 4Q47A 3V8LA 2XRNA 1W7PA 1R1TA 4LK1F 3F6VA 2HYFA 5AONA 2D2WA 2L4MA 2EWNA 1DPRA 4I2OA 5DEQA 2E1CA 2H27A 1P4WA 3GUDA 4Z2YA 1LEAA 1F4KA 4YIFA 1I27A 4I09A 1TNSA 4GYIA 5DV5A 2QZ8A 2BEOA 3K0LA 4MEYF 5ILVA 3JAMK 1E2XA 2HKOA 1TBXA 3KP4A 4ZZLA 2GWRA 5D5UB 2WTEA 4KN4X 4K2EA 5DD8A 4KN7X 5D5XB 1H9TA 2GQQA 2VOPA 2PMUA 2ZKZA 1IN5A 3HRSA 4UUVA 2PQ8A 4HX7A 4HZFA 2O0YA 1OPCA 2O3FA 3HTUA 4EJUA 2G7HA 1B4AA 1G4DA 4CICA 1IF1A 1YFHA 2ETHA 3F8NA 3OV8A 2NNNA 2NS0A 3E3VA 1S7AA 1Z6TA 1HQCA 4BHPA 4WXCA 3ZMUA 1XGOA 2ZNYA 4A6DA 3NQOA 3E5QA 2FNAA 4U0YA 1ZLJA 4KT5C 3ML6A 3RPUA 5JFRA 1QZZA 1P6RA 4M9XA 2DBBA 1IN4A 3TO7A 3B02A 3GFIA 4HV6A 2VXZA 3GZ5A 1XDSA 1XD7A 5CJ9A 4EMSA 1B9MA 4N0BA 2ZNZA 2GXGA 3P7NA 2BV6A 2HDCA 2HZTA 2EJRA 3Q9VA 1U5TA 4HX4A 3F21A 2EFNA 3GWZA 2JPBA 1KU7A 1LJ9A 4JBAA 2ZBKA 1U3EM 5H6RA 2OQRA 4OIPF 4GO1A 2DQRA 1WRJA 1OYIA 1LDJA 2LF8A 1W5TA 2PLYA 3H3ZA 4KNYA 2OZ6A 3MZYA 2Y75A 2ACJA 4ETSA 5HDGA 3JTGA 4MQVA 3I5UA 3RJPA 2PN6A 2AXLA 4RB2C 2RNJA 4AWXB 3F23A 4IHSA 3ECHA 5ERIA 4HAMA 4RGSA 1SAXA 3BDDA 1BI2A 1USTA 5CVRA 1HW5A 3R4KA 5HDNA 1XMAA 4E70A 3CUQA 3ERED 2RC4A 2MLKA 4HLXA 4XBFA 1MDMB 1VTNC 4G94A 1H0MA 1J2XA 3SXYA 4I02A 2IJLA 1SD7A 2E1NA 2H6CA 4GYGA 4A0ZA 3LFKA 3BPVA 2QM3A 3ABTA 2IVMA 4KIBA 5DD4A 5FO5A 4OIQF 3V7RA 2A07F 1G3TA 1DPUA 3KP3A 3ULQB 3V8KA 4HDVA 3BJAA 3FXRA 3ISPA 2M8EA 4YFXF 1NHAA 4BQAA 4CHUA 3CUQC 2VE9A 5FLXK 1QGPA 4M73A 1KU2A 2OBPA 2J5PA 1SFUA 4BHCA 2TDXA 1R22A 2ZJ2A 2XAHA 1UHWA 3WGIA 2EV5A 5L3CA 1IRGA 1O3RA 2JRTA 3GW2A 4RB1A 1G6NA 2Z99A 5D5WB 3WE2A 4AVPA 1XGNA 2WC2A 5CYVA 3DQVC 3GLXA 4HF1A 3FM5A 3R0AA 4OINF 3B73A 3W6KB 4ENMA 2IPQX 3WTZA 5ICCA 1IW7F 3IL2A 3J81Z 1P4XA 2H94A 3KE2A 2QQAA 5IT9K 1I1SA 2MH9A 4WXHA 3HOTA 3DP7A 3FHZA 4HBLA 3VEPA 3U2RA 2FBIA 1QZYA 4U0VA 3PFIA 4M6YA 3RTRA 3CTAA 1FX7A 2L4AA 1TW2A 2A6EF 1J5YA 1FBSA 5E8IA 4QLCU 5LHGA 3RKYA 1T6SA 3DXJF 2L01A 2XAQA 1PDNC 2ISYA 4M6XA 4IVNA 2Z33A 1HW2A 5TJJA 4LLLA 5J6XA 2UXNA 4KFCA 2YU3A 3JAMZ 3BPXA 1XSXA 2V1DA 1LB2A 4BHBA 2F5FA 2VE8A 3HOSA 3E6MA 3LA2A 4TV7A 2D45A 2XHKA 3QRFF 2FXAA 4IRHA 3BZ6A 1SMTA 3H3UA 3LQRA 4FX4A 3DFGA 3ZPLA 3M1EA 4JK1X 1T0FA 1QBJA 5FD5A 1U2WA 2V79A 4FHTA 4P55A 2K02A 3TKYA 2Q2EA 2HTSA 1CF7A 3F22A 4A2UA 2CO5A 1RNLA 1GXPA 1BM9A 4I0BA 4EVIA 4BYYA 2VONA 2NRAC 5D4RA 2F5DA 3HTSB 3R60A 2OD5A 3MWMA 3R0JA 2M1BA 3IHUA 4HF2A 3E6DA 3PQKA 2A6HF 2NAZA 2OU2A 4Y13A 2XUBA 5F6FA 4XRFA 2K27A 3L9FA 3L00A 2IA0A 3QPTA 4PGHA 5K5OA 3BJOA 4RS8A 3OOPA 5LLQA 4MGRA 4EJWA 1QPMA 1O7FA 1A04A 2P4WA 5FFXA 2RGVA 2QWWA 1BI1A 1MKMA 4KICA 1XDUA 1JHFA 3ZN1A 2EFQA 5D5VB 1YO5C 2BE5F 5BS6A 3F72A 5K5RA 1ULYA 4JQFA 3BY6A 4Q5SF 2OZUA 3VOEA 2JPCA 2DO7A 4EM2A 4LLGF 1UFMA 4OMYA 2HQNA 3WTVC 4G6DA 3LAJA 3SQNA 2RDPA 3CJNA 1S6LA 2D1HA 4G9YA 2FOKA 2Y0MA 1Z05A 6PAXA 2P8TA 3RYRA 2P7VB 4KIFA 5LHHA 1HSJA 1QO0D 4D0PA 1BJAA 1YS6A 3HHHA 1R36A 1W5SA 2ZCWA 3ZQ7A 3V8JA 4UVAA 5LGNA 2F5CA 4RGUA 2KJBA 4ZH4F 2GIVA 4L9JA 4L0YB 1O3SA 2BBYA 2FMYA 3EETA 2YPRA 3P9CA 4B09A 2R7DA 3IKTA 1Z6RA 1SMYF 2H09A 5TRDA 1G3YA 5ICGA 1FOKA 1ODDA 1EV7A 4IRGA 1K7AA 1B1BA 2XIGA 3RPQA 3F8BA 5H6QA 2CWEA 3CUOA 5DCMA 2P6TA 1SFEA 3R6SA 2GA2A 4L5JA 3R61A 1BIAA 3AAFA 2RV8A 3WGHA 2FF4A 4LJZF 1K78B 1WI9A 3IRRA 1L0OC 3MEXA 4EGZA 2V1UA 2M5WA 3M7GA 2DTRA 1ONVA 5FLXZ 3GF2A 3MZHA 1QQIA 3CDHA 3TO9A 4ZZDA 4I0AA 3GYHX 3D5LA 3EYIA 1LNWA 4ESBA 1HSTA 2HR3A 5LGTA 3TGNA 5L3FA 3E5XA 3KEOA 2MC3A 1YS7A 5JVTA 1IXCA 2ELHA 3EUHA 1BBYA 3RDIA 4EM1A 4ZYEA 3K1PA 4WCGA 2JZYA 1SD5A 1J7KA 2FU4A 4M9ZA 3KP6A 2M45A 2MA3A 5D8KB 3ROUA 4HOBA 5E17F 4KMFA 3CO7C 4IRIA 2CFXA 1TQIA 3F8CA 1KYWA 1YQAA 1R23A 2PMHA 5IT9Z 2V9VA 1BN5A 2M87A 2W25A 1FC3A 3WTYC 3ZMVA 1S29A 3C3WA 1HBXG 3QU6A 2XV4S 2Y48A 2V1XA 2LF7A 1F9NA 1HXDA 1YG2A 3KCCA 2A3SA 1J9IA 3WU1B 3Q9SA 4L0ZB 3HUGA 1BC7C 4O3MA 2J5OA 4HQMA 3LWFA 1XB4A 3NRVA 5AIQA 3O6BB 5LRSA 4MTEA 2P5VA 2STWA 4LB6B 4EGYA 2A61A 1UHMA 2DPDA 2GA1A 1ON1A 2K4JA 3IWZA 4MTDA 3FX3A 1UCRA 1T39A 2ZMEA 1U6GA 4FX0A 4PGGA 4RAYA 4MNUA 3SZTA 3V7CA 3T1BA 5IT3A 4KA4A 1XCVA 5KK1A 4UHTA 3LQQA 3J80K 3BROA 3F8FA 2WV0A 1Z9CA 3FM3A 2HWVA 4O5VA 2MH2A 2FEZA 2PEXA 1IRFA 3K2ZA 1R1UA 5HLGA 1ZARA 2YX4A 3T8RA 2V6CA 3DPTA 3JTHA 1BI0A 3TO6A 5CVIA 3D0SA 1AWCA 1IN8A 4EJTA 1PUEE 1REPC 3K69A 1TW3A 2B0LA 3JSOA 1ZH5A 2XROA 1YLFA 3TDZC 3F3XA 1FY7A 2FBKA 3WTXC 1U8RA 1RIOH 2GZWA 1S7OA 5ILSA 3CLOA 3VFZA 2DK8A 5CVVA 2FNPA 4XLPF 2PG4A 2YSRA 2VBYA 4U7BA 1E17A 2E7WA 1YW8A 2EFWA 1SD4A 3L7WA 4G7ZF 1JGSA 5E18F 2QQBA 2EK5A 4YG2F 2GAUA 3EYYA 2LSOA 5DYMA 1PP8F 4ZYHA 4NHJA 1GVJA 3HIFA 5FD6A 4I98B 1W7PB 1IZ1A 2QUFA 3JSPA 2EFPA 3L09A 3U1DA 2KKOA 3TDUC 4ESFA 5DCMB 4M74A 3I59A 5ICEA 4CXFA 4IXAA 5J8FA 1R00A 2ESNA 1OMIA 1BC8C 3ECOA 3RIRA 1IUYA 3HSFA 3WODF 1XN7A 1EH6A 2ZFWA 3G73A 4IJAA 1TLHB 1FT9A 1IXRC 2XAJA 2DK5A 4Y17A 1ZRFA 1WWXA 2QBYA 1R5GA 3RKWA 1XSVA 3T0YA 4I7HA 4EM0B 4RB3C 4HDUA 3K9TA 4G7OF 1FZPB 4HLYA 3FF5A 2HYGD 3MAJA 2LDUA 1Q1HA 5ICFA 4L9NA 2LNBA 5E1WA 2G7UA 1FYMA 2Q8KA 4IPAA 2XAGA 4M71A 5K5QA 2DAOA 4RGXA 1MD0A 4ESJA 1ZN2A 1FBQA 2P5LC 5EEHA 2D1VA 3P9KA 3JW4A 4XSZF 5E1XA 3I54A 5F64A 3LA3A
chains in the Genus database with same CATH superfamily
1BOAA 3CP8A 1YIOA 2ZXHA 4KMUX 4PJMA 1JHHA 2OF7A 5BQTA 4AIKA 1MSFC 2QLZA 3PQJA 3HDDA 2OAZA 1B72B 2DW4A 3KEQA 1WJCA 4B43A 1U0JA 3MFKA 1R7JA 2FE3A 1JUSA 4R79A 4A5NA 2R7TA 5J1UA 3ZN0A 2LVSA 1XGMA 3PSFA 2FRHA 2R7RA 2CSOA 3OYKA 1VQPI 2E34A 1OYWA 1MMDA 2VKVA 4MHGA 1TWCJ 3MKYB 3HUGB 2K3PA 3V7SA 3QPLA 5E20A 4CO8A 3IC7A 4UNOA 1Z3XA 2BGCA 2FJ1A 2XSDC 4A3BJ 1GV5A 2Y0SA 3ZQHA 5EZHA 4YIIA 2HVRA 4QTRA 2P81A 3GTLJ 3KLNA 1B6AA 2A69F 2HU9A 3E97A 3N05A 5F04A 2EV0A 1U5TB 1RRJA 3OIQA 2IA2A 3C18A 2CU7A 3C7JA 1C0WA 1RKWA 1MZBA 3K4NA 4U7DA 2IT0A 4EQQA 3JRDA 1R5HA 4HX8A 4N9HA 3ZP5A 2EA2A 2VKDA 3KFWX 4XSXF 2CMPA 4GFBA 1D5VA 2FBHA 4D7NA 4MFDA 1MJBA 2K5CA 4L5IA 3TOAA 1IDZA 4P9FA 4P96A 1FYLA 3KYLA 4M3EA 1KA8A 1HKQA 3MN2A 3KETA 1QU3A 1H9GA 3QPHA 2ZMEB 4ENJA 1NG7A 2E60A 4CYDA 5JR3A 3GTQJ 3JRIA 1P4AA 2QYOA 3HXLA 3N97A 1DP7P 3O2PE 3K2AA 3T5XA 5J47A 2FMLA 1ZREA 2UWMA 3BOQA 2L7ZA 2W1OA 5EEGA 3BG3A 2E2HJ 1JT6A 2K9QA 4ZYAA 1SANA 1OFCX 3ONQA 3K4JA 3CCEI 2KIMA 3QP5A 1BIBA 2EIKH 2ADUA 3B6CA 2P6SA 1T56A 5LRRA 3S1NJ 2V26A 3LSTA 3S16J 2HQ5A 2TCTA 3GLLA 3WTTC 1D1AA 3CUQB 1K79A 4ANJA 2R92J 5IYCJ 3AL0C 5F1RA 5JI6A 1LEBA 1JXSA 1WJ5A 3I0TA 1O57A 1DU6A 2VQLA 3OYMA 1MDMA 4XR6A 4CDGA 3G2BA 3BQYA 2XF6A 4Y7NJ 2L0KA 2Z9OA 2EA4A 3ELKA 5D8LB 1R6RA 2KP6A 2BY1A 3GFMA 5DCFA 5FGMA 1ZLKA 1UB9A 4L9TA 1OCCH 5C44J 4R1HA 2NVYJ 1T98A 3HOVJ 3OWTA 4LK0F 1NG6A 4N4OB 2HGCA 2VPRA 5DDGA 5E3LA 5LEKA 3PIOF 2R7FA 2L02A 4L18B 2L54A 3VSKA 5AIPA 1U78A 4B3AA 2HS5A 2BHZA 1VF9A 4J01A 2XB5A 5DTDA 2MBFA 3J80Z 3OSFA 1TWGJ 1NH3A 2KIFA 1IDYA 1CQTA 1WGXA 4GXOA 2P5KA 4OIOF 4B48A 1R1VA 2CG4A 1X3ZB 1SFOJ 1DP3A 5KAIC 2CW0F 3LMMA 1J75A 2C6YA 3KEYA 4KDPA 1FMWA 2XAFA 2L3DA 2NVUB 1OKRA 2VQGA 3RYPA 5HS9A 4PCQA 1ZTRA 3CF5F 2PFBA 3KP7A 2DI3A 3CMYA 3OS1A 5C4JJ 4F93B 5J8CA 1RESA 5LBQA 2F5EA 3PUFA 3AFHA 1FSHA 4BQQA 1ZK8A 1LPQA 2X48A 4RMNA 1X1DA 2KDOA 2JN6A 4GGGA 4I01A 2AS5F 5CVJA 1WJDA 4CCLA 1S8NA 2I10A 5EJCA 3MCZA 2V6EA 3MKLA 1YOVB 3FMQA 3O3KA 2COMA 4A6EA 4S05A 4NNJA 5M5WJ 1Y6IA 2BXYA 2QEXI 1IN6A 3I53A 4M72A 3S1RJ 1LUJB 1YW9A 1WCMJ 3GZNB 3I59B 3M9AA 4MIMA 4BXUA 5CPRB 1TWHJ 4OMZA 2UXXA 4LG0A 2PX9A 2MC4A 2M0MA 1TQPA 1Y56A 9ANTA 3LAPA 3I4PA 1MGTA 3H9GA 3OYJA 3PSIA 3WTSC 1BR2A 2DA6A 1ZRCA 2GIZA 1WJFA 1FOYA 1KU3A 1B59A 3FKIJ 4DNCA 1K6OA 4IHXA 3EQLF 3CC7I 2F4MB 2CJJA 3FXUA 5CLSA 1TWAJ 5FB2A 2O8XA 3K1NA 2FA5A 4F52A 2DU9A 1B9NA 2OCCH 2WY7Q 2VOOA 2W84A 2QQ8A 4B8XA 1X1BA 2AQEA 4N9IA 5B5EC 3GFJA 2LBFB 5EGOA 2EILH 2RKHA 4V2GA 1QHHD 1OQYA 1OCOH 2XKOA 2VQCA 3FZVA 2QBYB 2DFIA 2V1NA 1MMNA 3ZQIA 2RN7A 3I71A 3BTLA 4BH9A 3CO6C 1FLIA 1P7JA 4D1QA 4V19K 3HGYA 2DT7B 1B8IB 2OCEA 1R5ID 2K9MA 2Z5UA 4C30A 3DTIA 2DA4A 1WQ2A 3D5RC 5M3MJ 5HOOA 1LE8A 1EJ9A 1D8JA 3F8MA 2IP2A 4F55A 1GUUA 4FASD 1KYZA 2EZLA 2BW3A 2JT1A 4KISA 3UNGC 5BOXA 1IXSB 1G3WA 3VODA 1FIPA 2K9SA 2D5VA 2R5YA 1WJEA 1TTYA 4DYRA 3WHCA 5L3EA 5K7HA 1W36D 2VPLA 4BAYA 4F7ZA 3DBHB 2IEKA 1FBUA 4M3DA 2MSYA 2Z3YA 1FSEA 2WV1A 4CH7A 1FTTA 1MBEA 2NVTJ 1RKTA 1AOYA 1E3HA 3KYCB 3CZ6A 3JRAA 2EIMH 3MD2A 3TQNA 5DUIA 3CF2A 1H8AC 2IXSA 2BYVE 2W7NA 4DYCA 2CQKA 1O7LA 2M7BA 4QSHA 1OCZH 1I6XA 4AIHA 2HOEA 5FRNA 1D3YA 1RI7A 4WXDA 1FTZA 5ILUA 3P9IA 2EZIA 3LSHA 3PO2J 3TW6A 1XMKA 4I76A 4NC8A 4NB5A 2IW5A 3IRQA 4PSXA 4Y52J 2RVCA 1A6QA 4M3BA 5BPIA 5BMZA 3SZPA 3LA7A 2PMZN 1MMAA 2L7KA 3N4MA 2XASA 2MABA 3FMSA 4I6ZA 3NWTA 3W2WA 2KHMA 3HSEA 1YI2I 3JR9A 4R8HA 1J59A 3DEEA 2X51A 4IL6C 2VT3A 3VWBA 4CZCA 3DPLC 2WAFA 4CYCB 4C2MJ 2OV7A 2NS7A 4P5OA 2ZJRF 1BR4A 3FBIB 3J7AY 1CF7B 2V9PA 2X0LA 3E5UA 1YRNB 4HV5A 2AHQA 1ERDA 5L3GA 2W24A 3KP5A 2XF7A 1ZGJA 3PNVA 1SVOA 1RUNA 3Q0WA 5DUKA 1KQ9A 2QQ9A 2FQ3A 2R3SA 2R7OA 4ON0A 4AYBN 4E6KG 1DGRM 2XAUA 4ENKA 4LFUA 2EV6A 5D4SA 2DFHA 3JRCA 2QA4I 2ZXJA 3C2BA 1JT0A 3NARA 3MKZA 1EH8A 4RBOA 4HYEA 3BTIA 4RGRA 3IKVA 2ELJA 2DJNA 2AXTC 1UHSA 3K6GA 3FWEA 2ICWG 1FYKA 4IF4A 2IA1A 1X4OA 3TOBA 2HFHA 1YTYA 3RZDJ 2IS2A 2O03A 1ZRDA 2P7CB 2FSWA 3QOPA 1AA7A 3H5NA 1X3UA 3CJTB 3HOUJ 3OL3A 5CVUA 2QVOA 2LY9A 1I6HJ 2F6CA 2LKPA 3U9GA 1J0RA 1SFXA 4HEA2 3BT9A 4BY1J 3DF8A 3VDXA 2ESHA 1K61A 1HA8A 4OWRB 1ZR4A 2EZKA 3HJEA 4A3FJ 2IGNA 1Y1WJ 1R58A 3FBNB 2EIJH 4BUPA 1P2FA 5A2QK 4ZDLA 4KIGA 1WKMA 3QYFA 2PI0A 2HTJA 4P9UA 2NNYA 4LB5A 1KGSA 3CCYA 4G7HF 1Y1VJ 3CP2A 5C4XJ 1U5TC 4E7SA 1LFBA 2IRFG 3REOA 1WH7A 3FK6A 5M5YJ 1S7EA 4UB6C 1U8BA 1HKTA 5KAFC 3K7AJ 2O8KA 4EV0A 3H35A 2HQRA 2CQXA 2QCOA 4GCVA 2STTA 3BR0A 5HVQC 5JHFA 2M9HA 5B1BH 2A5YB 4MO7A 1I3QJ 2O9LA 5D6FA 4WWCA 2FD5A 1Y0UA 4I99C 5EEAA 4A3GJ 1XSDA 5FKLA 3C1DA 2BZTA 2P0WA 4LG3A 5H20A 2KZVA 2Q0OA 3ZGKA 3E6BA 5HDKA 4S04A 3F0CA 3HKZN 2XF5A 1ZYRF 4ASNA 4E7ZA 2VT2A 5BPDA 2VIXA 3Q5FA 1W7PD 1YJNI 2FUG2 4B3XA 3S2HJ 1SVLA 4D5CA 3DV8A 1X3WB 1V5FA 2L9RA 4A3EJ 1KQ0A 4OU0A 1JE8A 1XX5A 5EG0A 1OR7A 1Y39A 1ZHFA 3IH2A 1Y8RB 2BVLA 1RR7A 3IUOA 3WE3A 4WF2A 1BI3A 2ZSIB 5E79C 4ZYDA 1HKSA 4IEJA 2MD5A 4MQ9F 2VBXA 4XLNF 2KJCA 2YX7A 2Y31A 4WK8F 1DDNA 3GO5A 3ABKH 5LHIA 4A0YA 1NTCA 5J1YA 2UZKA 4LMYA 2W85A 2KRFA 4KUMA 1MJ9A 1ZG5A 1R49A 1X1AA 1Z7UA 1W0TA 2X85A 3QP6A 1OCTC 1D8KA 2F2EA 4A3KJ 4XQFA 5LEJA 4UV9A 4QPQA 1PP7U 2OQGA 4BNCA 4M3GA 4LLNA 2DT5A 4IHTA 1T38A 1Z1DA 1STZA 1ZG3A 3A0BC 5IOZA 2B7EA 3OYCA 1A5JA 1ETWA 2HEOA 1W4MA 2QF7A 1FPQA 3SZGA 2NYXA 3ZQGA 3ZXSA 5K1YA 1TNTA 2OC6A 1TQMA 3ZMSA 2IAIA 2Z2SB 2VBZA 4XORA 2JA8J 2JMWA 3RI4A 1K78A 4BXXJ 2WWYA 1F1ZA 1FP1D 4E7KA 4AUXA 2ID3A 1TP4A 3TW7A 4ENNA 4LG0B 1GV2A 1AKHA 2OA4A 3X2QH 3GX4X 1FNNA 2HKXA 2XKPA 5HLIA 4MEXF 1U9OA 2ZO4A 4H0EA 1GXQA 2QSFX 1KONA 3WHBA 1I39A 4OOIA 1GT0C 3VYRB 4UV8A 3CD6I 1MH3A 2E1MB 3HEFA 2M2EA 3H3VK 3PM1A 3KZIC 3W3CA 5L3BA 3W6JB 4DQ2A 3OYHA 3GXOA 5E1ZB 4YFKF 1USSA 5L3DA 1IAWA 2L7FP 1G3SA 3BJ6A 3S2WA 1YW7A 2OJED 5FLMJ 3KLOA 3U1KA 4PZJA 1S72I 3ABUA 2KIQA 4ABZA 3I64A 3DCFA 2VUMJ 3WG9A 1MBHA 1EH7A 2X4HA 3E6CC 3I4NJ 1S3JA 3GEZA 3KZYA 2DOFA 2E7XA 2BW3B 3PL8A 3HYIA 1CGPA 5JHUA 1WSUA 4Y15A 1VQ4I 2ZSHB 4Q4ZF 4UVCA 3UKGA 2EB7A 1WI3A 2K9NA 2R5YB 2DMQA 5B1AH 5HLHA 2F48A 3TP3A 2W57A 1IN7A 4CCMA 4RM3A 4AD9A 4Z6YA 3V4GA 2CGPA 2JSCA 2LRDA 4A3JJ 5HS7A 5GADJ 1X4PA 2XC7A 2PJPA 2JTVA 1HDPA 3K1MA 2CV2A 3M8FA 5KNLA 1VQKI 5F08A 4HSRA 2CYYA 2VBWA 1DUXC 1OCRH 2L2OA 2M30A 1XC5A 3MQ0A 1XCBA 4CZZA 1KQ8A 3ZMZA 4PDKA 4BE2A 3I58A 4NQWA 2DODA 5FFZA 3M8EA 5CQEA 1RZ4A 5GTIC 1K83J 3M1CA 1ON2A 2GXAA 3CCRI 1YIJI 2JSPA 3P5JA 1O3QA 3AG4H 3WU0A 3J7YJ 3FISA 4ZTFA 3BTJA 1ORKA 1JKQC 4XONA 2XGXA 1P92A 2NOGA 4A12A 4E7IA 3DKWA 3BTCA 1E3PA 4P1WA 2FQ4A 4HQEA 2HOTA 4CSWA 2KL4A 3QU3A 1O3TA 1DU0A 1I50J 5E3NA 3BP8A 4U0WA 1IC8A 1V4RA 2BHYA 2XGDA 4A0XA 3HPGA 3J7AO 5EYRA 3Q0UA 2G9WA 3K10A 2JA7J 1SD6A 3QAHA 1QNTA 3HHGA 4XRSA 2YU9J 5J40A 2A68F 3T8TA 1MW7A 2K4BA 2I5UA 3RKXA 2VC0A 3WTWC 4AIJA 1YYVA 2V7FA 2O6GE 1TT5B 4O6JA 1FWZA 2LP0A 3VB2A 4IOCF 2O61A 2YR2A 3G3ZA 4HA8A 3COAC 4FISA 2KIUA 2RNGA 2EFOA 3B6AA 4XMYA 3ZMTA 3HRTA 4BL0B 3L2CA 4D7MA 1YE9A 2VODA 1VQ5I 3BWGA 3HB9A 2K86A 4M9SA 5F27A 2NVXJ 4A3DJ 1RR8C 3EDPA 4LGWA 1V3FA 3FXQA 2TRTA 3NEUA 2X1EA 3L2VA 3L2WA 5K7FA 4ZYGA 1W36C 1MNEA 4LD5A 1VI0A 3GVAA 5LGUA 4IOAF 4CCOA 5KVRA 2DMNA 3BR5A 1T0FC 1T2KA 1F43A 4RAZA 2GXBA 1QHGA 2R7ZJ 4Y33A 1FP2A 2MLGA 4RB0A 3V42A 2M0CA 2DLLA 2DXIA 4UVBA 3WGGA 3A01A 4BDZA 2KRHA 1VFCA 4BBSJ 2K9LA 3IAS2 4L5EA 5E8GA 3TP0A 5EDNA 1LVAA 4FE7A 1I1GA 1RUOA 3F6OA 4A5MA 4Y3OA 2XVCA 1LDDA 4A3MJ 4ZTJA 2DOAA 1Z91A 3VYSB 2XPVA 5ED4A 2DTZA 2HDDA 1P7IA 2VJJA 4G6QA 2GLOA 4CCJA 2L9VA 1XGSA 2PBIA 4M3FA 4U87A 3ABMH 3FK7A 5KCMA 2DMTA 3KP2A 2VN2A 1ZG1A 3HRMA 2X1CA 1RC9A 1R4NB 1SC7A 4CGZA 3PIPF 3VYTB 2VC1A 4DOZA 3HRUA 1ZGAA 4HW0A 5JLWA 3VPRA 4KYWA 5F0CA 3SFZA 3LSGA 3LSRA 2QKLB 4IX7A 2RQPA 3CCLI 1JI8A 1ZAOA 3KZZA 3PNTA 4YFNF 4C2UA 3A4CA 2L7MP 3DEUA 1GHCA 5BNGA 4G8XA 3O8GA 4A3CJ 2JVHA 1I5ZA 5CQGA 4EJVA 3K4KA 1A35A 1N78A 2H6BA 2CQQA 3PNYA 1KU9A 2HI3A 2K7LA 4L9VA 2DQLA 3IWFA 3GFLA 4HF0A 1QA6A 4Q48A 3J7ZI 2Y9ZA 2CS3A 3D5SC 3CQZJ 3GZ6A 2X9DA 3J81K 5GAGJ 4QWQA 5A2QZ 1MJAA 2G0EA 4RLQA 3H92A 4EJOA 5EZGA 5HS8A 4WX9A 1F5TA 1MBFA 2WAEA 2QENA 4UXNA 5D6EA 2NVQJ 2R5ZA 2OPTA 4M6VA 3FMRA 1LQ1A 2CUEA 3ABLH 1LDKB 3A1YA 4FT8A 1OYYA 4U88A 5IP7J 1WHUA 3QQAA 3ZMDA 3JRFA 2DPUA 1FIAA 3IP4B 3HOXJ 1HW1A 3S3OA 3HSRA 3WTUC 3SHFA 4A93J 5K5RA 4C3HJ 2R7XA 1L3LA 1N77A 1SEUA 1D0YA 2ISZA 1ETKA 4OIRF 4Q47A 3H1CA 3G4SI 3V8LA 2XRNA 4BGDA 1W7PA 1R1TA 4LK1F 1G2HA 3F6VA 1K4TA 2HYFA 2CFOA 4UUSB 5AONA 2D2WA 2A5WA 1M1EB 2L4MA 2EWNA 1DPRA 2A05A 4I2OA 2X1DA 5DEQA 2E1CA 2H27A 2HOAA 2O5RA 4DIQA 1XMXA 3EUAA 1P4WA 3GUDA 4Z2YA 1LEAA 1F4KA 3E7LA 4YIFA 3LOCA 3ZCOA 4IHWA 1AKHB 1I27A 4I09A 1TNSA 5FLVA 4GYIA 5DM6F 5DV5A 2QZ8A 2BEOA 3K0LA 3MKWB 4MEYF 5ILVA 1LFPA 3JAMK 1IRXA 1E2XA 2HVQA 2HKOA 1TBXA 3KP4A 1IV6A 4ZZLA 2GWRA 4EATA 3F9KA 1W1WE 5D5UB 2KZGA 2WTEA 2WBMA 2VLAA 4KN4X 4ITVA 4K2EA 4XKVA 3ERMA 3H0GJ 3DU5A 4KN7X 4PJJA 5DD8A 5D5XB 2GQQA 1H9TA 3QYEA 2VOPA 2PMUA 3CMAI 4ZJZA 3K70D 2ZKZA 1IN5A 3HRSA 1UG2A 4UUVA 4HRIA 3DKXA 4BJTA 1K4SA 1W0UA 2PQ8A 3LSIA 4HX7A 4HZFA 2O0YA 1EKEA 2I8DA 4J19A 1QZEA 1T95A 2EPFA 1OPCA 2H8RA 3FXMA 4HSTA 2O3FA 2E1OA 3HTUA 1PUFA 2JWTA 4UUTA 5F0HA 4IO9F 3ESWB 4CCKA 4BE0A 2MG4A 3OYEA 4XN0A 4EJUA 2G7HA 5HODA 1B4AA 1BJZA 4IZZA 1G4DA 4CICA 3DU6A 3S1QJ 5LD2C 5IP6A 1IF1A 1YFHA 3G1LA 2ETHA 2LKXA 3IAM2 3F8NA 3CJQB 3OV8A 2NNNA 2NS0A 2X6OA 3E3VA 1S7AA 1Z6TA 1HQCA 3PUBA 1MBJA 2IS1A 4BHPA 4WXCA 3GCMA 3ZMUA 1XGOA 3NAUA 2ZNYA 4A6DA 3NQOA 5FKMA 3E5QA 4E7LA 2FNAA 2WAQN 3EUHC 2R4GA 3LSMA 2E35A 4U0YA 1ZLJA 2DFFA 2LG4A 4NQWB 4KT5C 3SFIA 2JRMA 3ML6A 3RPUA 5JFRA 1QZZA 1P6RA 4M9XA 2DBBA 1IN4A 2XDVA 3TO7A 4D5FA 3B02A 4YIRX 3GFIA 2RAEA 4FTHA 2XRLA 4HV6A 4HG2A 1NK3P 2VXZA 4ZDOA 2KMUA 3GZ5A 1VQ9I 3OYAA 4C2TA 1XDSA 1LKXA 3CDLA 1XD7A 3OYBA 2Y2ZA 3DLAA 3ASOH 5CJ9A 4EMSA 3AG2H 3W2VA 1MMSA 1B9MA 2KQRA 1BW5A 2L9NA 4JP0A 2DYRH 4FE4A 1IV8A 2CV0A 4N0BA 2ZNZA 2M34A 2M4GA 2GXGA 3P7NA 2JA5J 4DZJA 4NC7A 2BV6A 3HBLA 2HDCA 2HZTA 2IBDA 2EJRA 1YX3A 1U5TA 3Q9VA 3BG6A 4HX4A 3F21A 2EFNA 4A3IJ 2MGQA 3H0DA 2N8GA 1MBKA 3GWZA 3H9QA 2JPBA 3MMYB 1KU7A 1LJ9A 1EA3A 2CUFA 3BR3A 4JBAA 2YS9A 2ZBKA 1U3EM 5H6RA 2OQRA 4OIPF 4GO1A 2DCEA 2DQRA 1WRJA 1OYIA 1LDJA 2LF8A 1W5TA 3PFYA 3LL7A 2PLYA 3QYBA 3A0HC 2VXDA 3AG1H 3H3ZA 1QVTA 4B1RA 4HNTA 4KNYA 4UB8C 1FEXA 1Y0NA 2OZ6A 3MZYA 4E7JA 2BOLA 3LSJA 2MW8A 2Y75A 2ACJA 4PJLA 4ETSA 5HDGA 4IHVA 3SJMA 3JTGA 4MQVA 2QSGX 3I5UA 5LFAA 3O8HA 5E3OA 3CCQI 2HNHA 3DTEA 3RJPA 2PN6A 3W6VA 2IS4A 2W48A 2AXLA 5FRMA 3RSNA 4RB2C 3M8JA 5FJ8J 3A01B 2RNJA 2E19A 4PSWA 3DTKA 4AWXB 3F23A 1OLTA 2HVSA 3ECHA 1N75A 4IHSA 2M4KA 2CV1A 5ERIA 4HAMA 4RGSA 1SAXA 2KT0A 3BDDA 4XKBA 5FKKA 1BI2A 1USTA 2O7OA 5CVRA 1HW5A 3R4KA 5HDNA 3OYLA 4BQNA 1VQ6I 1XMAA 3G1OA 4BJ5C 4E70A 3JREA 3CUQA 3ERED 2RC4A 2MLKA 4HLXA 4XBFA 1S5LC 1MDMB 1VTNC 4G94A 1H0MA 1J2XA 1T33A 3SXYA 3GTMJ 4I02A 3ZRGA 1JUPA 3S1MJ 2IJLA 4XKCA 2HOSA 3CLQA 1SD7A 2ZMEC 2LOOA 2E1NA 2H6CA 4GYGA 2V4JC 1Z77A 4BEHA 4A0ZA 3S8PA 1V54H 2ZFUA 3LFKA 3BPVA 2QM3A 3ABTA 2R7SA 2ME6A 1QRYA 3PO3J 2LKSA 3OR1C 3M3YJ 2IVMA 4F92B 4KIBA 3CMMA 5DD4A 5FO5A 4OIQF 3V7RA 3CC4I 2XGEA 2A07F 1G3TA 1DPUA 3CDIA 3KP3A 3ULQB 2ZXWH 3V8KA 4HDVA 1JTXA 3BJAA 3FXRA 1D0XA 3ISPA 2M8EA 1WVRA 4YFXF 1EF4A 1NHAA 4BQAA 5EF6A 4CHUA 2CUJA 3BR6A 3CUQC 3BQZA 2VE9A 5FLXK 1QGPA 4M73A 1KU2A 2GM4A 2LR8A 2OBPA 2J5PA 1SFUA 4BHCA 1JGGA 3TL4X 2TDXA 1R22A 2ZJ2A 1XPXA 2XAHA 1UHWA 2HYJA 3WGIA 1XG1A 1WZ2A 3JRHA 2EV5A 5L3CA 1IRGA 3S14J 1O3RA 2JRTA 1BOBA 3GW2A 4RB1A 4B44A 1G6NA 2Z99A 5D5WB 3WG7H 3WE2A 4AVPA 1XGNA 2DFEA 1JUMA 1JKOC 2WC2A 4YELA 4JYKA 1ETYA 2M7AA 5CYVA 3DQVC 1LVKA 2ECBA 3GLXA 4HF1A 2R7VA 1H88C 4G6TB 3FM5A 3R0AA 2LY1A 4OINF 4D9JA 1HC8A 3KPHA 3CCVI 3B73A 3W6KB 4XL9A 3W2AA 4ENMA 2KFDA 5JLXA 2IPQX 2CUZA 3H5RA 3WTZA 5ICCA 1IW7F 2DA7A 2RQQA 4X1EA 3IL2A 3J81Z 1OJLA 3KX2A 1P4XA 4JOMA 2H94A 1GDTA 2PJRA 1W5CC 1SAUA 2JA2A 1J09A 2HPIA 3KE2A 1YJWI 2QQAA 4II2A 3L2RA 5IT9K 3VYUB 3FXLA 2B9SA 1I1SA 2MH9A 4WXHA 3SYTA 4AIDA 3HOTA 3QPSA 4JX6A 4XLAA 5EGOB 2HPMA 3DP7A 4HNUA 1UJ8A 5J4VA 3FHZA 2A6TA 4HBLA 4W1UA 1R4MB 3VEPA 3U2RA 3KIOA 3GMEA 2JA6J 1TC3C 2FBIA 1QZYA 4U0VA 1LE8B 4NC6A 1FOXA 3ZQCA 2DA5A 3PFIA 4YEJA 2W4SA 4M6YA 1B8IA 2DN0A 3RTRA 5GPAA 1FJLA 2VI6A 3DLLF 3CTAA 3HPHA 1TZLA 2V9KA 2QSHX 1H89C 1FX7A 2PMZA 1MMGA 4LOCA 2L4AA 1TW2A 3BCBA 2A6EF 3RQIA 1J5YA 3DEWA 1FBSA 5HNHA 5E8IA 1YX5A 4QLCU 5LHGA 3RKYA 1T6SA 3DXJF 2L01A 2XAQA 3BG7A 3MZ8A 1JJ8C 1PDNC 2ISYA 1PUFB 4M6XA 2DA2A 2LC2A 4IVNA 2Z33A 2COBA 1T8IA 2IS6A 3JRBA 1HW2A 2XPUA 5TJJA 3SDGA 5KHDA 4KJZA 4LLLA 5F1JA 4PJ0C 5J6XA 1APLC 2UXNA 4KFCA 1X19A 2LH9A 2YU3A 3JAMZ 3BPXA 1XSXA 3CESA 2V1DA 1LB2A 4AM3A 2R7UA 4BHBA 4AYBA 2F5FA 3ZQFA 2VE8A 4BE1A 1VQLI 3S15J 1QVUA 3HOSA 3E6MA 2ME0A 4JX4A 3LA2A 1E0EA 3LFUA 5DS9A 4TV7A 2D45A 3ASNH 2XHKA 3OIPA 4PFOA 3OYNA 3QRFF 2FXAA 4IRHA 1LFUP 3BZ6A 3D1NI 5FKNA 1R9TJ 1SMTA 3BG5A 3H3UA 3LQRA 4FX4A 1V55H 3DFGA 3G71I 3S17J 3RQ4A 2M8GX 4N4NB 2GOXB 3OIOA 2K3FA 3ZPLA 3M1EA 4JK1X 1T0FA 1QBJA 5FD5A 1U2WA 2V79A 4S0HB 3L1PA 2NOJB 3G6EI 2IGKA 4AU7A 4FHTA 2X6XA 1A6IA 4P55A 4CYCA 2K02A 3TKYA 1A31A 2Q2EA 3CCSI 1UAAA 2HTSA 1CF7A 1YRNA 2BY0A 3F22A 3BZCA 4A2UA 2HXOA 1ETVA 2CO5A 1RETA 1RNLA 1GXPA 1BA5A 1BM9A 4I0BA 4EVIA 4XOTA 4BYYA 4KITB 1NK2P 2VONA 2NRAC 4GDFA 5D4RA 1DQUA 2F5DA 3BC8A 1O4XA 1IJWC 3HTSB 4OAYA 1X1PA 3R60A 2OD5A 3K70C 5B66C 2ELKA 3MWMA 2AO9A 5FKOA 3R0JA 2M1BA 2AQFA 3IHUA 4HF2A 3BCAA 5HLTA 2R7WA 1VQ7I 1X58A 1OCPA 3E6DA 1VNDA 3PQKA 4ZC3A 2A6HF 2NAZA 3CJRB 1G8XA 2OU2A 3Q0VA 4Y13A 2XUBA 3C2HA 4XRFA 5F6FA 2K27A 2KPMA 2L5QA 3L9FA 2DA3A 2WY8Q 1VQ8I 2K40A 1D0ZA 4BU2A 3IV5A 3L00A 4LIVA 3HOYJ 2IA0A 1VQOI 3QPTA 4W97A 2WB1N 4PGHA 3HKZA 5K5OA 3BJOA 4RS8A 3OOPA 5LLQA 4MGRA 4EJWA 3SEZA 3CCMI 2OUMA 1QPMA 2DA1A 1O7FA 4DGWB 1A04A 2P4WA 4XK4A 3VSLA 5FFXA 5K7ZA 2OTJI 2RGVA 2QWWA 1QPIA 1BI1A 1MKMA 3A02A 4KICA 2ECCA 3ZR8X 3TMOA 1XDUA 2GOMA 5F0FA 1JHFA 1ITYA 3ZN1A 1HLVA 1TT0A 3HL2A 2EFQA 3FXKA 5D5VB 2DOEA 1YO5C 2BE5F 2VJIA 1UELB 3F72A 1ULYA 4JQFA 3BY6A 5BS6A 3K4MA 2DMUA 4Q5SF 1U9NA 2OZUA 3VOEA 5IYDJ 2JPCA 3I56I 2DO7A 2LTPA 1V5GA 2M3AA 4EM2A 2W00A 4LLGF 3OYDA 4IQJA 1UFMA 4OMYA 4ZDPA 1JKRC 2HQNA 3WTVC 4G6DA 3L2UA 1YHQI 3LAJA 4XLHA 4NBQA 3TEDA 3SQNA 2RDPA 3CJNA 1S6LA 2D1HA 4G9YA 4IHYA 1IUFA 4BEHB 1ACIA 2FOKA 3OS2A 4BBRJ 2Y0MA 1Z05A 2BVMA 2P8TA 6PAXA 3RYRA 2P7VB 4KIFA 3GTKJ 5LHHA 1HSJA 1QO0D 4RDUA 4D0PA 4J00A 1BJAA 3GTPJ 2EBIA 2F4OB 2DJIA 2Y30A 1YS6A 1R36A 3HHHA 1W5SA 2ZJPF 3OY9A 3A2KA 2ZCWA 3ZQ7A 2VASA 3V8JA 4UVAA 5LGNA 5EG0B 2F5CA 4RGUA 2VJ5A 3CMEI 2KJBA 3S93A 4ZH4F 2GIVA 4L9JA 4HNVA 1O3SA 4L0YB 1UZCA 3OS0A 1YITI 2BBYA 3K4LA 2FMYA 3EETA 2YPRA 3FXJA 3P9CA 4B09A 2R7DA 3IKTA 1FOWA 5J4YA 1Z6RA 4EEFG 1SMYF 2H09A 4E4HA 4QIWN 4C9YA 5TRDA 1MSEC 4OAZA 5J1RA 1G3YA 5ICGA 1FOKA 1T08B 2BXZA 2ZC2A 1ODDA 3MVPA 1EV7A 4IRGA 3HG9A 2MD0A 1UMQA 1K7AA 2W82A 1D1BA 1B1BA 4RA2A 2XIGA 3RPQA 3F8BA 5H6QA 3E0JB 4BACA 2CWEA 3CUOA 5DCMA 2P6TA 1SFEA 2HDWA 4LIUA 2EH3A 3R6SA 2GA2A 3TBIA 4CCNA 2Z1DA 4L5JA 4BDYA 4F3QA 2EQRA 2Y69H 3R61A 1BIAA 5GPCA 3AAFA 2RV8A 3WGHA 1BL0A 2FF4A 4LJZF 1K78B 1WI9A 3IRRA 1L0OC 3MEXA 4EGZA 2F5VA 2LREA 2V1UA 2M5WA 3M7GA 4C3JJ 2DTRA 4BKXA 1ONVA 5FLXZ 3LSKA 3GF2A 3MZHA 2PJRB 1QQIA 3CDHA 3TO9A 4ZZDA 4I0AA 3GYHX 2R0QC 1F36A 3D5LA 3EYIA 1LNWA 3JRGA 3HOZJ 4ESBA 1HSTA 2HR3A 2VB6A 3H9JA 1ZGWA 2LLKA 5LGTA 3BR1A 3TGNA 5L3FA 1IGNA 2QGUA 3E5XA 3KEOA 2MC3A 4X6AJ 2ZB9A 2H8WA 3BR2A 1ZELA 1X2MA 1YS7A 1ETOA 5JVTA 5IY5H 1IXCA 2ELHA 2B63J 1MIJA 3EUHA 2LD5A 1BBYA 3RDIA 1POGA 4EM1A 4XLEA 4ZYEA 3K1PA 4WCGA 3OYIA 4DBRA 2JZYA 4XIDA 1SD5A 1J7KA 2FU4A 3G1MA 3EPZA 3KP6A 4JX5A 4M9ZA 3S3MA 2M45A 3RCOA 5HNFA 5JVGF 2MA3A 5D8KB 1WPKA 3ROUA 4HOBA 3GTJJ 5E17F 1RPWA 3CO7C 4KMFA 4IRIA 2CFXA 3FDYA 2HQAA 1TQIA 3F8CA 1KYWA 1YQAA 1Z67A 1R23A 2E1MC 2PMHA 3E1SA 1N25A 2JUGA 2RREA 5IT9Z 4QPOA 1XS9A 1K6YA 5E3MA 3OOUA 2JVGA 2R93J 2V9VA 4E7HA 2Z16A 1BN5A 2FOWA 1ZKGA 2M87A 2W25A 1FC3A 2XSJC 3AG3H 4BQOA 2VJ4A 4A69C 3WTYC 4RM2A 1JTYA 3ZMVA 3DWLE 2XPWA 1S29A 3C3WA 3WU2C 3H5AA 5H2FC 2H1KA 1MH4A 1HBXG 1GLNA 2E5NA 3FIWA 3QWLA 4RAFA 4AC0A 3QU6A 4A3LJ 2XV4S 2Y48A 5B3SH 5IP9J 1D1CA 2V1XA 2LF7A 1B72A 1F9NA 1HXDA 4V2FA 1ETQA 5TISC 1YG2A 1VQNI 4XRMA 2K85A 3CCUI 3QOEA 3KCCA 2A3SA 2EINH 1SVMA 1J9IA 3WU1B 3DKYA 1Y8QB 3Q9SA 3OYGA 3GTGJ 4L0ZB 1XTAA 3HUGA 1BC7C 1TWFJ 4II3A 5M5XJ 2H1LA 4O3MA 5IOYA 2J5OA 4HQMA 4BJ6C 3GTOJ 3BZKA 1ENHA 1WJAA 2CQNA 3LWFA 1TL8A 2Q2EB 2KDZA 2GBYA 2CH0A 2WB1A 1XB4A 3OSGA 3NRVA 2JJ7A 5AIQA 1Z21A 3O6BB 2ZJQF 1IO2A 2VKEA 5LRSA 4MTEA 2P5VA 4B47A 2STWA 2BY3A 4LB6B 4GRIA 4EGYA 2A61A 4XLFA 5GAEJ 3K4CA 1P9QC 1UHMA 4PFPA 2DPDA 1X1CA 4PJNA 3I55I 3AL0B 2GA1A 4XLCA 1ON1A 2K4JA 3IWZA 1JJ6C 2HXIA 3FXOA 2WADA 1KZHA 3M4OJ 4MTDA 3FX3A 1UCRA 2NXNB 1VQMI 1T39A 2CW7A 3U21A 1GVDA 2ZMEA 4PUSA 1U6GA 4FX0A 2CW8A 4PGGA 4RAYA 4MNUA 3L2QA 3SZTA 3V7CA 3T1BA 4XRSG 5IT3A 1HDDC 2Y0SN 4KA4A 1Z7LA 1MNMC 4BXFA 1XCVA 2L9SA 5KK1A 4XNFA 5IPAA 1ZQ3P 3I4MJ 5CKTA 4UHTA 4BY7J 3ZQLA 4NDLA 3LQQA 3J80K 3BROA 3F8FA 2WV0A 3OL4A 3ZOBA 1Z9CA 3FM3A 2HWVA 4O5VA 2MH2A 2FEZA 2PEXA 3KYDB 1IRFA 4Y4RA 4CA0A 4DJAA 1S9HA 3K2ZA 1R1UA 5HLGA 1PVEA 4RAGA 2DMPA 1ZARA 1DGWY 2YX4A 2VQHA 3HM5A 3T8RA 2V6CA 3EUKL 4YRVA 3DPTA 1IG7A 5J3LA 3JTHA 1BI0A 3TO6A 3M07A 1A36A 3QODA 4PK4A 2LY2A 3CCJI 3OR2C 5CVIA 3D0SA 1AWCA 1IN8A 1WFXA 4EJTA 1PUEE 1REPC 3K69A 2DT6A 4C3IJ 2MFZA 1TW3A 2B0LA 4LITA 1X2NA 4XN3A 4XKWA 4DBQA 3JSOA 3C2GA 1ZH5A 3FHNA 3HZJA 2XROA 1YLFA 1Z3YA 3TDZC 3A03A 4FCYA 2E36A 1UG0A 4F91B 3F3XA 1FY7A 4HPQA 2FBKA 1MBGA 3S32A 3WTXC 1U8RA 2JQ7A 1RIOH 2GZWA 1S7OA 5ILSA 3CLOA 3VFZA 1PJRA 3HOWJ 2DK8A 2UV1A 2BY2A 5CVVA 1MNDA 2FNPA 1ZR2A 4XLPF 3LNQA 2XB0X 2PG4A 2YSRA 3I9V2 2VBYA 2JK3A 3H36A 4U7BA 1IRZA 1E17A 2E7WA 1YW8A 2EFWA 1SD4A 1I3AA 2XGCA 3HC7A 3L7WA 2VKHA 4G7ZF 4B4CA 1JGSA 2R5ZB 5TGTA 5E18F 4IKFA 2QQBA 2EK5A 4YG2F 2GAUA 3AKZA 1HOMA 3EYYA 2LSOA 3I3LA 4RLFA 4NUBA 2X6WA 2NS8A 1WH5A 5DYMA 1PP8F 4ZYHA 1YJ9I 3K4BA 1ETXA 2VL8A 4KT6A 3Q3SA 4NHJA 3RZOJ 1WJBA 2KISA 2R7QA 1V5EA 3GBGA 1FMVA 2QKMB 1GVJA 2YUSA 3HGGA 4G12A 3SEQA 3HIFA 1JKPC 4BS9A 4CUGA 2LFBA 5FD6A 5FROA 4I98B 3BLYA 1W7PB 5M3FJ 1IZ1A 1PYVA 2E5ZA 2QUFA 3JSPA 2LMDA 2EFPA 1AHDP 3L09A 2MYSA 2ID6A 3U1DA 2KKOA 3TDUC 4ESFA 5DCMB 4M74A 3I59A 5GP9A 4UUSA 5ICEA 2E2JJ 4CXFA 4IXAA 4IQ4A 3SDBA 5J8FA 1R00A 2ESNA 1OMIA 1AU7A 1BC8C 3ECOA 2E71A 3RIRA 1BR1A 1OR7C 2CRGA 2FX0A 2IGOA 1VZ0A 3DPUA 5GAHJ 1IUYA 3HSFA 3WODF 2OTLI 1XN7A 1EH6A 2ZFWA 2UUZA 3G73A 4AVZA 4MLOA 4MFEA 2Q1ZB 3DBRB 4IJAA 1TLHB 1R71A 3RKQA 4FQGA 1FT9A 4DYQA 3CC2I 1IXRC 2XAJA 2DK5A 4FETA 2LBFA 1HCRA 4Y17A 1SFKA 1ZRFA 2X6YA 2Y9YA 1WWXA 4H4KC 2QBYA 3S3NA 2HZDA 1R5GA 3ZQQA 3UR3C 2CQ7A 3RKWA 1Z0XA 1XSVA 3T0YA 4I7HA 3FKJA 2DYSH 3S2DJ 4EM0B 3LSPA 4RB3C 2WAQA 4HDUA 3IH3A 5DM7F 2F4IA 2EZHA 1BW6A 2LYCA 3K9TA 1HF0A 4G7OF 1FZPB 3FF5A 2HYGD 3IH4A 3MAJA 2LDUA 5GTHC 4HLYA 1Q1HA 2KRCA 5ICFA 3PJRA 3OMYA 4L9NA 3OYFA 3BG9A 5C3EJ 2LNBA 5E1WA 1E3OC 3RPUD 5IYBJ 2G7UA 1FYMA 1OISA 2Q8KA 4IPAA 1D5YA 2IGMA 2XAGA 4DZPA 4M71A 4DW6A 5K5QA 2DAOA 2KLOA 2E2IJ 4RGXA 4XICA 2DDBA 1MD0A 2WA0A 2ZXIA 4ESJA 1ZN2A 1G59A 4XM3A 1FBQA 2DDAA 3DBLB 1Q1VA 2P5LC 4UY8I 5EEHA 2D1VA 3JCUC 3P9KA 3JW4A 4XSZF 5E1XA 2JUCA 3I54A 2LK2A 4XOPA 5F64A 4X0GA 3NWSA 3LA3A
chains in the Genus database with same CATH topology
1BOAA 1YIOA 4KMUX 1JHHA 5BQTA 4AIKA 2QLZA 3PQJA 2OAZA 2DW4A 3KEQA 3MFKA 1R7JA 2FE3A 4R79A 4A5NA 3ZN0A 1XGMA 2FRHA 2CSOA 1OYWA 4MHGA 3V7SA 5E20A 4CO8A 3IC7A 4UNOA 2BGCA 4YIIA 3KLNA 1B6AA 2A69F 3E97A 2EV0A 1U5TB 2IA2A 3C18A 3C7JA 1C0WA 4U7DA 1MZBA 2IT0A 4EQQA 1R5HA 4HX8A 4N9HA 3ZP5A 2EA2A 4XSXF 3KFWX 1D5VA 2FBHA 1MJBA 4L5IA 3TOAA 4P9FA 4P96A 1FYLA 1KA8A 1HKQA 3KETA 1H9GA 3QPHA 2ZMEB 4ENJA 4CYDA 5JR3A 1P4AA 2QYOA 3N97A 1DP7P 3O2PE 3T5XA 2FMLA 1ZREA 2UWMA 3BOQA 5EEGA 2KIMA 3QP5A 1BIBA 2ADUA 2P6SA 5LRRA 3LSTA 3WTTC 3CUQB 1K79A 5F1RA 5JI6A 1LEBA 1JXSA 3I0TA 1O57A 1MDMA 4CDGA 2Z9OA 2EA4A 3ELKA 5D8LB 3GFMA 5DCFA 5FGMA 1ZLKA 1UB9A 4L9TA 4R1HA 1T98A 4LK0F 5DDGA 2HGCA 5LEKA 2R7FA 2L02A 4L18B 2L54A 5AIPA 1U78A 2HS5A 2MBFA 3J80Z 2KIFA 4GXOA 2P5KA 4OIOF 1R1VA 2CG4A 2CW0F 1J75A 2C6YA 4KDPA 2XAFA 2L3DA 1OKRA 3RYPA 5HS9A 4PCQA 2PFBA 3KP7A 2DI3A 5J8CA 5LBQA 2F5EA 1FSHA 4GGGA 4I01A 2AS5F 5CVJA 1S8NA 3MCZA 3FMQA 3O3KA 2COMA 4A6EA 4S05A 1IN6A 3I53A 4M72A 1YW9A 3I59B 3M9AA 4BXUA 4OMZA 2UXXA 4LG0A 1TQPA 3LAPA 3I4PA 1MGTA 3WTSC 1ZRCA 1KU3A 1B59A 1K6OA 4DNCA 3EQLF 5FB2A 3FXUA 5CLSA 2O8XA 3K1NA 2FA5A 2DU9A 1B9NA 2VOOA 2W84A 4B8XA 4N9IA 3GFJA 2RKHA 2XKOA 3FZVA 2QBYB 2DFIA 2RN7A 3I71A 4BH9A 3CO6C 1FLIA 2Z5UA 1WQ2A 1D8JA 5HOOA 3F8MA 2IP2A 1KYZA 2JT1A 5BOXA 1IXSB 1G3WA 3VODA 1TTYA 5L3EA 4BAYA 4F7ZA 1FBUA 2Z3YA 1FSEA 1AOYA 3TQNA 5DUIA 2BYVE 2CQKA 1O7LA 1I6XA 4AIHA 2HOEA 1D3YA 1RI7A 4WXDA 5ILUA 3P9IA 1XMKA 4NB5A 2IW5A 3IRQA 2RVCA 5BPIA 5BMZA 3SZPA 3LA7A 3N4MA 2XASA 3FMSA 3HSEA 1J59A 4R8HA 2VT3A 3DPLC 4P5OA 1CF7B 3E5UA 2X0LA 4HV5A 5L3GA 2W24A 3KP5A 1RUNA 1ZGJA 5DUKA 1KQ9A 2QQ9A 2FQ3A 2R3SA 4ON0A 4ENKA 4LFUA 2EV6A 5D4SA 2ZXJA 1EH8A 4HYEA 4RGRA 3IKVA 3FWEA 1FYKA 4IF4A 2IA1A 3TOBA 2HFHA 1YTYA 2O03A 1ZRDA 2P7CB 2FSWA 3QOPA 1X3UA 5CVUA 2QVOA 3U9GA 2LKPA 1J0RA 1SFXA 3DF8A 2ESHA 1R58A 1P2FA 5A2QK 4KIGA 1WKMA 2PI0A 2HTJA 4P9UA 2NNYA 4LB5A 1KGSA 4G7HF 1U5TC 2IRFG 3REOA 1HKTA 4EV0A 2HQRA 4GCVA 2STTA 5HVQC 2A5YB 5D6FA 4WWCA 1Y0UA 1XSDA 3C1DA 5H20A 2Q0OA 3E6BA 5HDKA 4S04A 4ASNA 1ZYRF 2VT2A 5BPDA 3Q5FA 1W7PD 3DV8A 1KQ0A 4OU0A 1JE8A 1OR7A 1ZHFA 3WE3A 4WF2A 1BI3A 4ZYDA 1HKSA 2MD5A 4MQ9F 2VBXA 4XLNF 2KJCA 2YX7A 4WK8F 1DDNA 3GO5A 5LHIA 4A0YA 2UZKA 4LMYA 2W85A 2KRFA 4KUMA 1MJ9A 1ZG5A 1Z7UA 3QP6A 1D8KA 2F2EA 5LEJA 4UV9A 1PP7U 2OQGA 4BNCA 4LLNA 2DT5A 4IHTA 1T38A 1Z1DA 1STZA 1ZG3A 2HEOA 1W4MA 1FPQA 2NYXA 5K1YA 1TNTA 1TQMA 3ZMSA 2VBZA 3RI4A 1K78A 2WWYA 1F1ZA 1FP1D 4LG0B 4ENNA 2OA4A 3GX4X 1FNNA 2HKXA 2XKPA 5HLIA 4MEXF 2ZO4A 4H0EA 1GXQA 4OOIA 4UV8A 5L3BA 3W6JB 4DQ2A 3GXOA 5E1ZB 4YFKF 1USSA 5L3DA 1IAWA 1G3SA 3BJ6A 3S2WA 1YW7A 3KLOA 4PZJA 3ABUA 3I64A 3WG9A 1EH7A 2X4HA 3E6CC 1S3JA 3GEZA 3KZYA 2E7XA 3HYIA 1CGPA 5JHUA 1WSUA 4Y15A 4Q4ZF 4UVCA 2EB7A 5HLHA 2W57A 1IN7A 4AD9A 3V4GA 2CGPA 2JSCA 5HS7A 2PJPA 2JTVA 3K1MA 3M8FA 2CYYA 2VBWA 1DUXC 2M30A 3MQ0A 1XCBA 4CZZA 1KQ8A 3ZMZA 4PDKA 3I58A 4NQWA 5FFZA 3M8EA 1RZ4A 1ON2A 1O3QA 3WU0A 2XGXA 1P92A 4A12A 3DKWA 4HQEA 3QU3A 1O3TA 3BP8A 4U0WA 1V4RA 4A0XA 3J7AO 2G9WA 1SD6A 3QAHA 1QNTA 3HHGA 2A68F 3T8TA 2K4BA 3RKXA 2VC0A 3WTWC 4AIJA 1YYVA 2O6GE 4O6JA 1FWZA 3VB2A 2O61A 2YR2A 3G3ZA 4HA8A 3COAC 2KIUA 3L2CA 2EFOA 3ZMTA 3HRTA 2VODA 3BWGA 2K86A 4M9SA 3EDPA 4LGWA 1V3FA 3FXQA 3NEUA 4ZYGA 4LD5A 5LGUA 3GVAA 5KVRA 1T2KA 4RAZA 2GXBA 1FP2A 2MLGA 4RB0A 2DLLA 4UVBA 3WGGA 5E8GA 1LVAA 1I1GA 1RUOA 3F6OA 4A5MA 2XVCA 1LDDA 1Z91A 5ED4A 4G6QA 1XGSA 2PBIA 3KP2A 2VN2A 1ZG1A 3HRMA 4CGZA 2VC1A 3HRUA 1ZGAA 4HW0A 4KYWA 3SFZA 2RQPA 1ZAOA 3KZZA 4YFNF 3DEUA 1GHCA 4G8XA 1I5ZA 4EJVA 2H6BA 1KU9A 2K7LA 4L9VA 2DQLA 3IWFA 3GFLA 4HF0A 4Q48A 3GZ6A 3J81K 4QWQA 5A2QZ 1MJAA 3H92A 4EJOA 5HS8A 4WX9A 1F5TA 2QENA 4UXNA 5D6EA 3FMRA 1LQ1A 1LDKB 4FT8A 1OYYA 4U88A 2DPUA 3ZMDA 1HW1A 3HSRA 3WTUC 3SHFA 1L3LA 2ISZA 4OIRF 4Q47A 3V8LA 2XRNA 1W7PA 1R1TA 4LK1F 3F6VA 2HYFA 5AONA 2D2WA 2L4MA 2EWNA 1DPRA 4I2OA 5DEQA 2E1CA 2H27A 1P4WA 3GUDA 4Z2YA 1LEAA 1F4KA 4YIFA 1I27A 4I09A 1TNSA 4GYIA 5DV5A 2QZ8A 2BEOA 3K0LA 4MEYF 5ILVA 3JAMK 1E2XA 2HKOA 1TBXA 3KP4A 4ZZLA 2GWRA 5D5UB 2WTEA 4KN4X 4K2EA 5DD8A 4KN7X 5D5XB 1H9TA 2GQQA 2VOPA 2PMUA 2ZKZA 1IN5A 3HRSA 4UUVA 2PQ8A 4HX7A 4HZFA 2O0YA 1OPCA 2O3FA 3HTUA 4EJUA 2G7HA 1B4AA 1G4DA 4CICA 1IF1A 1YFHA 2ETHA 3F8NA 3OV8A 2NNNA 2NS0A 3E3VA 1S7AA 1Z6TA 1HQCA 4BHPA 4WXCA 3ZMUA 1XGOA 2ZNYA 4A6DA 3NQOA 3E5QA 2FNAA 4U0YA 1ZLJA 4KT5C 3ML6A 3RPUA 5JFRA 1QZZA 1P6RA 4M9XA 2DBBA 1IN4A 3TO7A 3B02A 3GFIA 4HV6A 2VXZA 3GZ5A 1XDSA 1XD7A 5CJ9A 4EMSA 1B9MA 4N0BA 2ZNZA 2GXGA 3P7NA 2BV6A 2HDCA 2HZTA 2EJRA 3Q9VA 1U5TA 4HX4A 3F21A 2EFNA 3GWZA 2JPBA 1KU7A 1LJ9A 4JBAA 2ZBKA 1U3EM 5H6RA 2OQRA 4OIPF 4GO1A 2DQRA 1WRJA 1OYIA 1LDJA 2LF8A 1W5TA 2PLYA 3H3ZA 4KNYA 2OZ6A 3MZYA 2Y75A 2ACJA 4ETSA 5HDGA 3JTGA 4MQVA 3I5UA 3RJPA 2PN6A 2AXLA 4RB2C 2RNJA 4AWXB 3F23A 4IHSA 3ECHA 5ERIA 4HAMA 4RGSA 1SAXA 3BDDA 1BI2A 1USTA 5CVRA 1HW5A 3R4KA 5HDNA 1XMAA 4E70A 3CUQA 3ERED 2RC4A 2MLKA 4HLXA 4XBFA 1MDMB 1VTNC 4G94A 1H0MA 1J2XA 3SXYA 4I02A 2IJLA 1SD7A 2E1NA 2H6CA 4GYGA 4A0ZA 3LFKA 3BPVA 2QM3A 3ABTA 2IVMA 4KIBA 5DD4A 5FO5A 4OIQF 3V7RA 2A07F 1G3TA 1DPUA 3KP3A 3ULQB 3V8KA 4HDVA 3BJAA 3FXRA 3ISPA 2M8EA 4YFXF 1NHAA 4BQAA 4CHUA 3CUQC 2VE9A 5FLXK 1QGPA 4M73A 1KU2A 2OBPA 2J5PA 1SFUA 4BHCA 2TDXA 1R22A 2ZJ2A 2XAHA 1UHWA 3WGIA 2EV5A 5L3CA 1IRGA 1O3RA 2JRTA 3GW2A 4RB1A 1G6NA 2Z99A 5D5WB 3WE2A 4AVPA 1XGNA 2WC2A 5CYVA 3DQVC 3GLXA 4HF1A 3FM5A 3R0AA 4OINF 3B73A 3W6KB 4ENMA 2IPQX 3WTZA 5ICCA 1IW7F 3IL2A 3J81Z 1P4XA 2H94A 3KE2A 2QQAA 5IT9K 1I1SA 2MH9A 4WXHA 3HOTA 3DP7A 3FHZA 4HBLA 3VEPA 3U2RA 2FBIA 1QZYA 4U0VA 3PFIA 4M6YA 3RTRA 3CTAA 1FX7A 2L4AA 1TW2A 2A6EF 1J5YA 1FBSA 5E8IA 4QLCU 5LHGA 3RKYA 1T6SA 3DXJF 2L01A 2XAQA 1PDNC 2ISYA 4M6XA 4IVNA 2Z33A 1HW2A 5TJJA 4LLLA 5J6XA 2UXNA 4KFCA 2YU3A 3JAMZ 3BPXA 1XSXA 2V1DA 1LB2A 4BHBA 2F5FA 2VE8A 3HOSA 3E6MA 3LA2A 4TV7A 2D45A 2XHKA 3QRFF 2FXAA 4IRHA 3BZ6A 1SMTA 3H3UA 3LQRA 4FX4A 3DFGA 3ZPLA 3M1EA 4JK1X 1T0FA 1QBJA 5FD5A 1U2WA 2V79A 4FHTA 4P55A 2K02A 3TKYA 2Q2EA 2HTSA 1CF7A 3F22A 4A2UA 2CO5A 1RNLA 1GXPA 1BM9A 4I0BA 4EVIA 4BYYA 2VONA 2NRAC 5D4RA 2F5DA 3HTSB 3R60A 2OD5A 3MWMA 3R0JA 2M1BA 3IHUA 4HF2A 3E6DA 3PQKA 2A6HF 2NAZA 2OU2A 4Y13A 2XUBA 5F6FA 4XRFA 2K27A 3L9FA 3L00A 2IA0A 3QPTA 4PGHA 5K5OA 3BJOA 4RS8A 3OOPA 5LLQA 4MGRA 4EJWA 1QPMA 1O7FA 1A04A 2P4WA 5FFXA 2RGVA 2QWWA 1BI1A 1MKMA 4KICA 1XDUA 1JHFA 3ZN1A 2EFQA 5D5VB 1YO5C 2BE5F 5BS6A 3F72A 5K5RA 1ULYA 4JQFA 3BY6A 4Q5SF 2OZUA 3VOEA 2JPCA 2DO7A 4EM2A 4LLGF 1UFMA 4OMYA 2HQNA 3WTVC 4G6DA 3LAJA 3SQNA 2RDPA 3CJNA 1S6LA 2D1HA 4G9YA 2FOKA 2Y0MA 1Z05A 6PAXA 2P8TA 3RYRA 2P7VB 4KIFA 5LHHA 1HSJA 1QO0D 4D0PA 1BJAA 1YS6A 3HHHA 1R36A 1W5SA 2ZCWA 3ZQ7A 3V8JA 4UVAA 5LGNA 2F5CA 4RGUA 2KJBA 4ZH4F 2GIVA 4L9JA 4L0YB 1O3SA 2BBYA 2FMYA 3EETA 2YPRA 3P9CA 4B09A 2R7DA 3IKTA 1Z6RA 1SMYF 2H09A 5TRDA 1G3YA 5ICGA 1FOKA 1ODDA 1EV7A 4IRGA 1K7AA 1B1BA 2XIGA 3RPQA 3F8BA 5H6QA 2CWEA 3CUOA 5DCMA 2P6TA 1SFEA 3R6SA 2GA2A 4L5JA 3R61A 1BIAA 3AAFA 2RV8A 3WGHA 2FF4A 4LJZF 1K78B 1WI9A 3IRRA 1L0OC 3MEXA 4EGZA 2V1UA 2M5WA 3M7GA 2DTRA 1ONVA 5FLXZ 3GF2A 3MZHA 1QQIA 3CDHA 3TO9A 4ZZDA 4I0AA 3GYHX 3D5LA 3EYIA 1LNWA 4ESBA 1HSTA 2HR3A 5LGTA 3TGNA 5L3FA 3E5XA 3KEOA 2MC3A 1YS7A 5JVTA 1IXCA 2ELHA 3EUHA 1BBYA 3RDIA 4EM1A 4ZYEA 3K1PA 4WCGA 2JZYA 1SD5A 1J7KA 2FU4A 4M9ZA 3KP6A 2M45A 2MA3A 5D8KB 3ROUA 4HOBA 5E17F 4KMFA 3CO7C 4IRIA 2CFXA 1TQIA 3F8CA 1KYWA 1YQAA 1R23A 2PMHA 5IT9Z 2V9VA 1BN5A 2M87A 2W25A 1FC3A 3WTYC 3ZMVA 1S29A 3C3WA 1HBXG 3QU6A 2XV4S 2Y48A 2V1XA 2LF7A 1F9NA 1HXDA 1YG2A 3KCCA 2A3SA 1J9IA 3WU1B 3Q9SA 4L0ZB 3HUGA 1BC7C 4O3MA 2J5OA 4HQMA 3LWFA 1XB4A 3NRVA 5AIQA 3O6BB 5LRSA 4MTEA 2P5VA 2STWA 4LB6B 4EGYA 2A61A 1UHMA 2DPDA 2GA1A 1ON1A 2K4JA 3IWZA 4MTDA 3FX3A 1UCRA 1T39A 2ZMEA 1U6GA 4FX0A 4PGGA 4RAYA 4MNUA 3SZTA 3V7CA 3T1BA 5IT3A 4KA4A 1XCVA 5KK1A 4UHTA 3LQQA 3J80K 3BROA 3F8FA 2WV0A 1Z9CA 3FM3A 2HWVA 4O5VA 2MH2A 2FEZA 2PEXA 1IRFA 3K2ZA 1R1UA 5HLGA 1ZARA 2YX4A 3T8RA 2V6CA 3DPTA 3JTHA 1BI0A 3TO6A 5CVIA 3D0SA 1AWCA 1IN8A 4EJTA 1PUEE 1REPC 3K69A 1TW3A 2B0LA 3JSOA 1ZH5A 2XROA 1YLFA 3TDZC 3F3XA 1FY7A 2FBKA 3WTXC 1U8RA 1RIOH 2GZWA 1S7OA 5ILSA 3CLOA 3VFZA 2DK8A 5CVVA 2FNPA 4XLPF 2PG4A 2YSRA 2VBYA 4U7BA 1E17A 2E7WA 1YW8A 2EFWA 1SD4A 3L7WA 4G7ZF 1JGSA 5E18F 2QQBA 2EK5A 4YG2F 2GAUA 3EYYA 2LSOA 5DYMA 1PP8F 4ZYHA 4NHJA 1GVJA 3HIFA 5FD6A 4I98B 1W7PB 1IZ1A 2QUFA 3JSPA 2EFPA 3L09A 3U1DA 2KKOA 3TDUC 4ESFA 5DCMB 4M74A 3I59A 5ICEA 4CXFA 4IXAA 5J8FA 1R00A 2ESNA 1OMIA 1BC8C 3ECOA 3RIRA 1IUYA 3HSFA 3WODF 1XN7A 1EH6A 2ZFWA 3G73A 4IJAA 1TLHB 1FT9A 1IXRC 2XAJA 2DK5A 4Y17A 1ZRFA 1WWXA 2QBYA 1R5GA 3RKWA 1XSVA 3T0YA 4I7HA 4EM0B 4RB3C 4HDUA 3K9TA 4G7OF 1FZPB 4HLYA 3FF5A 2HYGD 3MAJA 2LDUA 1Q1HA 5ICFA 4L9NA 2LNBA 5E1WA 2G7UA 1FYMA 2Q8KA 4IPAA 2XAGA 4M71A 5K5QA 2DAOA 4RGXA 1MD0A 4ESJA 1ZN2A 1FBQA 2P5LC 5EEHA 2D1VA 3P9KA 3JW4A 4XSZF 5E1XA 3I54A 5F64A 3LA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOA A;  1YIO A;  4KMU X;  1JHH A;  5BQT A;  4AIK A;  2QLZ A;  3PQJ A;  2OAZ A;  2DW4 A;  3KEQ A;  3MFK A;  1R7J A;  2FE3 A;  4R79 A;  4A5N A;  3ZN0 A;  1XGM A;  2FRH A;  2CSO A;  1OYW A;  4MHG A;  3V7S A;  5E20 A;  4CO8 A;  3IC7 A;  4UNO A;  2BGC A;  4YII A;  3KLN A;  1B6A A;  2A69 F;  3E97 A;  2EV0 A;  1U5T B;  2IA2 A;  3C18 A;  3C7J A;  1C0W A;  4U7D A;  1MZB A;  2IT0 A;  4EQQ A;  1R5H A;  4HX8 A;  4N9H A;  3ZP5 A;  2EA2 A;  4XSX F;  3KFW X;  1D5V A;  2FBH A;  1MJB A;  4L5I A;  3TOA A;  4P9F A;  4P96 A;  1FYL A;  1KA8 A;  1HKQ A;  3KET A;  1H9G A;  3QPH A;  2ZME B;  4ENJ A;  4CYD A;  5JR3 A;  1P4A A;  2QYO A;  3N97 A;  1DP7 P;  3O2P E;  3T5X A;  2FML A;  1ZRE A;  2UWM A;  3BOQ A;  5EEG A;  2KIM A;  3QP5 A;  1BIB A;  2ADU A;  2P6S A;  5LRR A;  3LST A;  3WTT C;  3CUQ B;  1K79 A;  5F1R A;  5JI6 A;  1LEB A;  1JXS A;  3I0T A;  1O57 A;  1MDM A;  4CDG A;  2Z9O A;  2EA4 A;  3ELK A;  5D8L B;  3GFM A;  5DCF A;  5FGM A;  1ZLK A;  1UB9 A;  4L9T A;  4R1H A;  1T98 A;  4LK0 F;  5DDG A;  2HGC A;  5LEK A;  2R7F A;  2L02 A;  4L18 B;  2L54 A;  5AIP A;  1U78 A;  2HS5 A;  2MBF A;  3J80 Z;  2KIF A;  4GXO A;  2P5K A;  4OIO F;  1R1V A;  2CG4 A;  2CW0 F;  1J75 A;  2C6Y A;  4KDP A;  2XAF A;  2L3D A;  1OKR A;  3RYP A;  5HS9 A;  4PCQ A;  2PFB A;  3KP7 A;  2DI3 A;  5J8C A;  5LBQ A;  2F5E A;  1FSH A;  4GGG A;  4I01 A;  2AS5 F;  5CVJ A;  1S8N A;  3MCZ A;  3FMQ A;  3O3K A;  2COM A;  4A6E A;  4S05 A;  1IN6 A;  3I53 A;  4M72 A;  1YW9 A;  3I59 B;  3M9A A;  4BXU A;  4OMZ A;  2UXX A;  4LG0 A;  1TQP A;  3LAP A;  3I4P A;  1MGT A;  3WTS C;  1ZRC A;  1KU3 A;  1B59 A;  1K6O A;  4DNC A;  3EQL F;  5FB2 A;  3FXU A;  5CLS A;  2O8X A;  3K1N A;  2FA5 A;  2DU9 A;  1B9N A;  2VOO A;  2W84 A;  4B8X A;  4N9I A;  3GFJ A;  2RKH A;  2XKO A;  3FZV A;  2QBY B;  2DFI A;  2RN7 A;  3I71 A;  4BH9 A;  3CO6 C;  1FLI A;  2Z5U A;  1WQ2 A;  1D8J A;  5HOO A;  3F8M A;  2IP2 A;  1KYZ A;  2JT1 A;  5BOX A;  1IXS B;  1G3W A;  3VOD A;  1TTY A;  5L3E A;  4BAY A;  4F7Z A;  1FBU A;  2Z3Y A;  1FSE A;  1AOY A;  3TQN A;  5DUI A;  2BYV E;  2CQK A;  1O7L A;  1I6X A;  4AIH A;  2HOE A;  1D3Y A;  1RI7 A;  4WXD A;  5ILU A;  3P9I A;  1XMK A;  4NB5 A;  2IW5 A;  3IRQ A;  2RVC A;  5BPI A;  5BMZ A;  3SZP A;  3LA7 A;  3N4M A;  2XAS A;  3FMS A;  3HSE A;  1J59 A;  4R8H A;  2VT3 A;  3DPL C;  4P5O A;  1CF7 B;  3E5U A;  2X0L A;  4HV5 A;  5L3G A;  2W24 A;  3KP5 A;  1RUN A;  1ZGJ A;  5DUK A;  1KQ9 A;  2QQ9 A;  2FQ3 A;  2R3S A;  4ON0 A;  4ENK A;  4LFU A;  2EV6 A;  5D4S A;  2ZXJ A;  1EH8 A;  4HYE A;  4RGR A;  3IKV A;  3FWE A;  1FYK A;  4IF4 A;  2IA1 A;  3TOB A;  2HFH A;  1YTY A;  2O03 A;  1ZRD A;  2P7C B;  2FSW A;  3QOP A;  1X3U A;  5CVU A;  2QVO A;  3U9G A;  2LKP A;  1J0R A;  1SFX A;  3DF8 A;  2ESH A;  1R58 A;  1P2F A;  5A2Q K;  4KIG A;  1WKM A;  2PI0 A;  2HTJ A;  4P9U A;  2NNY A;  4LB5 A;  1KGS A;  4G7H F;  1U5T C;  2IRF G;  3REO A;  1HKT A;  4EV0 A;  2HQR A;  4GCV A;  2STT A;  5HVQ C;  2A5Y B;  5D6F A;  4WWC A;  1Y0U A;  1XSD A;  3C1D A;  5H20 A;  2Q0O A;  3E6B A;  5HDK A;  4S04 A;  4ASN A;  1ZYR F;  2VT2 A;  5BPD A;  3Q5F A;  1W7P D;  3DV8 A;  1KQ0 A;  4OU0 A;  1JE8 A;  1OR7 A;  1ZHF A;  3WE3 A;  4WF2 A;  1BI3 A;  4ZYD A;  1HKS A;  2MD5 A;  4MQ9 F;  2VBX A;  4XLN F;  2KJC A;  2YX7 A;  4WK8 F;  1DDN A;  3GO5 A;  5LHI A;  4A0Y A;  2UZK A;  4LMY A;  2W85 A;  2KRF A;  4KUM A;  1MJ9 A;  1ZG5 A;  1Z7U A;  3QP6 A;  1D8K A;  2F2E A;  5LEJ A;  4UV9 A;  1PP7 U;  2OQG A;  4BNC A;  4LLN A;  2DT5 A;  4IHT A;  1T38 A;  1Z1D A;  1STZ A;  1ZG3 A;  2HEO A;  1W4M A;  1FPQ A;  2NYX A;  5K1Y A;  1TNT A;  1TQM A;  3ZMS A;  2VBZ A;  3RI4 A;  1K78 A;  2WWY A;  1F1Z A;  1FP1 D;  4LG0 B;  4ENN A;  2OA4 A;  3GX4 X;  1FNN A;  2HKX A;  2XKP A;  5HLI A;  4MEX F;  2ZO4 A;  4H0E A;  1GXQ A;  4OOI A;  4UV8 A;  5L3B A;  3W6J B;  4DQ2 A;  3GXO A;  5E1Z B;  4YFK F;  1USS A;  5L3D A;  1IAW A;  1G3S A;  3BJ6 A;  3S2W A;  1YW7 A;  3KLO A;  4PZJ A;  3ABU A;  3I64 A;  3WG9 A;  1EH7 A;  2X4H A;  3E6C C;  1S3J A;  3GEZ A;  3KZY A;  2E7X A;  3HYI A;  1CGP A;  5JHU A;  1WSU A;  4Y15 A;  4Q4Z F;  4UVC A;  2EB7 A;  5HLH A;  2W57 A;  1IN7 A;  4AD9 A;  3V4G A;  2CGP A;  2JSC A;  5HS7 A;  2PJP A;  2JTV A;  3K1M A;  3M8F A;  2CYY A;  2VBW A;  1DUX C;  2M30 A;  3MQ0 A;  1XCB A;  4CZZ A;  1KQ8 A;  3ZMZ A;  4PDK A;  3I58 A;  4NQW A;  5FFZ A;  3M8E A;  1RZ4 A;  1ON2 A;  1O3Q A;  3WU0 A;  2XGX A;  1P92 A;  4A12 A;  3DKW A;  4HQE A;  3QU3 A;  1O3T A;  3BP8 A;  4U0W A;  1V4R A;  4A0X A;  3J7A O;  2G9W A;  1SD6 A;  3QAH A;  1QNT A;  3HHG A;  2A68 F;  3T8T A;  2K4B A;  3RKX A;  2VC0 A;  3WTW C;  4AIJ A;  1YYV A;  2O6G E;  4O6J A;  1FWZ A;  3VB2 A;  2O61 A;  2YR2 A;  3G3Z A;  4HA8 A;  3COA C;  2KIU A;  3L2C A;  2EFO A;  3ZMT A;  3HRT A;  2VOD A;  3BWG A;  2K86 A;  4M9S A;  3EDP A;  4LGW A;  1V3F A;  3FXQ A;  3NEU A;  4ZYG A;  4LD5 A;  5LGU A;  3GVA A;  5KVR A;  1T2K A;  4RAZ A;  2GXB A;  1FP2 A;  2MLG A;  4RB0 A;  2DLL A;  4UVB A;  3WGG A;  5E8G A;  1LVA A;  1I1G A;  1RUO A;  3F6O A;  4A5M A;  2XVC A;  1LDD A;  1Z91 A;  5ED4 A;  4G6Q A;  1XGS A;  2PBI A;  3KP2 A;  2VN2 A;  1ZG1 A;  3HRM A;  4CGZ A;  2VC1 A;  3HRU A;  1ZGA A;  4HW0 A;  4KYW A;  3SFZ A;  2RQP A;  1ZAO A;  3KZZ A;  4YFN F;  3DEU A;  1GHC A;  4G8X A;  1I5Z A;  4EJV A;  2H6B A;  1KU9 A;  2K7L A;  4L9V A;  2DQL A;  3IWF A;  3GFL A;  4HF0 A;  4Q48 A;  3GZ6 A;  3J81 K;  4QWQ A;  5A2Q Z;  1MJA A;  3H92 A;  4EJO A;  5HS8 A;  4WX9 A;  1F5T A;  2QEN A;  4UXN A;  5D6E A;  3FMR A;  1LQ1 A;  1LDK B;  4FT8 A;  1OYY A;  4U88 A;  2DPU A;  3ZMD A;  1HW1 A;  3HSR A;  3WTU C;  3SHF A;  1L3L A;  2ISZ A;  4OIR F;  4Q47 A;  3V8L A;  2XRN A;  1W7P A;  1R1T A;  4LK1 F;  3F6V A;  2HYF A;  5AON A;  2D2W A;  2L4M A;  2EWN A;  1DPR A;  4I2O A;  5DEQ A;  2E1C A;  2H27 A;  1P4W A;  3GUD A;  4Z2Y A;  1LEA A;  1F4K A;  4YIF A;  1I27 A;  4I09 A;  1TNS A;  4GYI A;  5DV5 A;  2QZ8 A;  2BEO A;  3K0L A;  4MEY F;  5ILV A;  3JAM K;  1E2X A;  2HKO A;  1TBX A;  3KP4 A;  4ZZL A;  2GWR A;  5D5U B;  2WTE A;  4KN4 X;  4K2E A;  5DD8 A;  4KN7 X;  5D5X B;  1H9T A;  2GQQ A;  2VOP A;  2PMU A;  2ZKZ A;  1IN5 A;  3HRS A;  4UUV A;  2PQ8 A;  4HX7 A;  4HZF A;  2O0Y A;  1OPC A;  2O3F A;  3HTU A;  4EJU A;  2G7H A;  1B4A A;  1G4D A;  4CIC A;  1IF1 A;  1YFH A;  2ETH A;  3F8N A;  3OV8 A;  2NNN A;  2NS0 A;  3E3V A;  1S7A A;  1Z6T A;  1HQC A;  4BHP A;  4WXC A;  3ZMU A;  1XGO A;  2ZNY A;  4A6D A;  3NQO A;  3E5Q A;  2FNA A;  4U0Y A;  1ZLJ A;  4KT5 C;  3ML6 A;  3RPU A;  5JFR A;  1QZZ A;  1P6R A;  4M9X A;  2DBB A;  1IN4 A;  3TO7 A;  3B02 A;  3GFI A;  4HV6 A;  2VXZ A;  3GZ5 A;  1XDS A;  1XD7 A;  5CJ9 A;  4EMS A;  1B9M A;  4N0B A;  2ZNZ A;  2GXG A;  3P7N A;  2BV6 A;  2HDC A;  2HZT A;  2EJR A;  3Q9V A;  1U5T A;  4HX4 A;  3F21 A;  2EFN A;  3GWZ A;  2JPB A;  1KU7 A;  1LJ9 A;  4JBA A;  2ZBK A;  1U3E M;  5H6R A;  2OQR A;  4OIP F;  4GO1 A;  2DQR A;  1WRJ A;  1OYI A;  1LDJ A;  2LF8 A;  1W5T A;  2PLY A;  3H3Z A;  4KNY A;  2OZ6 A;  3MZY A;  2Y75 A;  2ACJ A;  4ETS A;  5HDG A;  3JTG A;  4MQV A;  3I5U A;  3RJP A;  2PN6 A;  2AXL A;  4RB2 C;  2RNJ A;  4AWX B;  3F23 A;  4IHS A;  3ECH A;  5ERI A;  4HAM A;  4RGS A;  1SAX A;  3BDD A;  1BI2 A;  1UST A;  5CVR A;  1HW5 A;  3R4K A;  5HDN A;  1XMA A;  4E70 A;  3CUQ A;  3ERE D;  2RC4 A;  2MLK A;  4HLX A;  4XBF A;  1MDM B;  1VTN C;  4G94 A;  1H0M A;  1J2X A;  3SXY A;  4I02 A;  2IJL A;  1SD7 A;  2E1N A;  2H6C A;  4GYG A;  4A0Z A;  3LFK A;  3BPV A;  2QM3 A;  3ABT A;  2IVM A;  4KIB A;  5DD4 A;  5FO5 A;  4OIQ F;  3V7R A;  2A07 F;  1G3T A;  1DPU A;  3KP3 A;  3ULQ B;  3V8K A;  4HDV A;  3BJA A;  3FXR A;  3ISP A;  2M8E A;  4YFX F;  1NHA A;  4BQA A;  4CHU A;  3CUQ C;  2VE9 A;  5FLX K;  1QGP A;  4M73 A;  1KU2 A;  2OBP A;  2J5P A;  1SFU A;  4BHC A;  2TDX A;  1R22 A;  2ZJ2 A;  2XAH A;  1UHW A;  3WGI A;  2EV5 A;  5L3C A;  1IRG A;  1O3R A;  2JRT A;  3GW2 A;  4RB1 A;  1G6N A;  2Z99 A;  5D5W B;  3WE2 A;  4AVP A;  1XGN A;  2WC2 A;  5CYV A;  3DQV C;  3GLX A;  4HF1 A;  3FM5 A;  3R0A A;  4OIN F;  3B73 A;  3W6K B;  4ENM A;  2IPQ X;  3WTZ A;  5ICC A;  1IW7 F;  3IL2 A;  3J81 Z;  1P4X A;  2H94 A;  3KE2 A;  2QQA A;  5IT9 K;  1I1S A;  2MH9 A;  4WXH A;  3HOT A;  3DP7 A;  3FHZ A;  4HBL A;  3VEP A;  3U2R A;  2FBI A;  1QZY A;  4U0V A;  3PFI A;  4M6Y A;  3RTR A;  3CTA A;  1FX7 A;  2L4A A;  1TW2 A;  2A6E F;  1J5Y A;  1FBS A;  5E8I A;  4QLC U;  5LHG A;  3RKY A;  1T6S A;  3DXJ F;  2L01 A;  2XAQ A;  1PDN C;  2ISY A;  4M6X A;  4IVN A;  2Z33 A;  1HW2 A;  5TJJ A;  4LLL A;  5J6X A;  2UXN A;  4KFC A;  2YU3 A;  3JAM Z;  3BPX A;  1XSX A;  2V1D A;  1LB2 A;  4BHB A;  2F5F A;  2VE8 A;  3HOS A;  3E6M A;  3LA2 A;  4TV7 A;  2D45 A;  2XHK A;  3QRF F;  2FXA A;  4IRH A;  3BZ6 A;  1SMT A;  3H3U A;  3LQR A;  4FX4 A;  3DFG A;  3ZPL A;  3M1E A;  4JK1 X;  1T0F A;  1QBJ A;  5FD5 A;  1U2W A;  2V79 A;  4FHT A;  4P55 A;  2K02 A;  3TKY A;  2Q2E A;  2HTS A;  1CF7 A;  3F22 A;  4A2U A;  2CO5 A;  1RNL A;  1GXP A;  1BM9 A;  4I0B A;  4EVI A;  4BYY A;  2VON A;  2NRA C;  5D4R A;  2F5D A;  3HTS B;  3R60 A;  2OD5 A;  3MWM A;  3R0J A;  2M1B A;  3IHU A;  4HF2 A;  3E6D A;  3PQK A;  2A6H F;  2NAZ A;  2OU2 A;  4Y13 A;  2XUB A;  5F6F A;  4XRF A;  2K27 A;  3L9F A;  3L00 A;  2IA0 A;  3QPT A;  4PGH A;  5K5O A;  3BJO A;  4RS8 A;  3OOP A;  5LLQ A;  4MGR A;  4EJW A;  1QPM A;  1O7F A;  1A04 A;  2P4W A;  5FFX A;  2RGV A;  2QWW A;  1BI1 A;  1MKM A;  4KIC A;  1XDU A;  1JHF A;  3ZN1 A;  2EFQ A;  5D5V B;  1YO5 C;  2BE5 F;  5BS6 A;  3F72 A;  5K5R A;  1ULY A;  4JQF A;  3BY6 A;  4Q5S F;  2OZU A;  3VOE A;  2JPC A;  2DO7 A;  4EM2 A;  4LLG F;  1UFM A;  4OMY A;  2HQN A;  3WTV C;  4G6D A;  3LAJ A;  3SQN A;  2RDP A;  3CJN A;  1S6L A;  2D1H A;  4G9Y A;  2FOK A;  2Y0M A;  1Z05 A;  6PAX A;  2P8T A;  3RYR A;  2P7V B;  4KIF A;  5LHH A;  1HSJ A;  1QO0 D;  4D0P A;  1BJA A;  1YS6 A;  3HHH A;  1R36 A;  1W5S A;  2ZCW A;  3ZQ7 A;  3V8J A;  4UVA A;  5LGN A;  2F5C A;  4RGU A;  2KJB A;  4ZH4 F;  2GIV A;  4L9J A;  4L0Y B;  1O3S A;  2BBY A;  2FMY A;  3EET A;  2YPR A;  3P9C A;  4B09 A;  2R7D A;  3IKT A;  1Z6R A;  1SMY F;  2H09 A;  5TRD A;  1G3Y A;  5ICG A;  1FOK A;  1ODD A;  1EV7 A;  4IRG A;  1K7A A;  1B1B A;  2XIG A;  3RPQ A;  3F8B A;  5H6Q A;  2CWE A;  3CUO A;  5DCM A;  2P6T A;  1SFE A;  3R6S A;  2GA2 A;  4L5J A;  3R61 A;  1BIA A;  3AAF A;  2RV8 A;  3WGH A;  2FF4 A;  4LJZ F;  1K78 B;  1WI9 A;  3IRR A;  1L0O C;  3MEX A;  4EGZ A;  2V1U A;  2M5W A;  3M7G A;  2DTR A;  1ONV A;  5FLX Z;  3GF2 A;  3MZH A;  1QQI A;  3CDH A;  3TO9 A;  4ZZD A;  4I0A A;  3GYH X;  3D5L A;  3EYI A;  1LNW A;  4ESB A;  1HST A;  2HR3 A;  5LGT A;  3TGN A;  5L3F A;  3E5X A;  3KEO A;  2MC3 A;  1YS7 A;  5JVT A;  1IXC A;  2ELH A;  3EUH A;  1BBY A;  3RDI A;  4EM1 A;  4ZYE A;  3K1P A;  4WCG A;  2JZY A;  1SD5 A;  1J7K A;  2FU4 A;  4M9Z A;  3KP6 A;  2M45 A;  2MA3 A;  5D8K B;  3ROU A;  4HOB A;  5E17 F;  4KMF A;  3CO7 C;  4IRI A;  2CFX A;  1TQI A;  3F8C A;  1KYW A;  1YQA A;  1R23 A;  2PMH A;  5IT9 Z;  2V9V A;  1BN5 A;  2M87 A;  2W25 A;  1FC3 A;  3WTY C;  3ZMV A;  1S29 A;  3C3W A;  1HBX G;  3QU6 A;  2XV4 S;  2Y48 A;  2V1X A;  2LF7 A;  1F9N A;  1HXD A;  1YG2 A;  3KCC A;  2A3S A;  1J9I A;  3WU1 B;  3Q9S A;  4L0Z B;  3HUG A;  1BC7 C;  4O3M A;  2J5O A;  4HQM A;  3LWF A;  1XB4 A;  3NRV A;  5AIQ A;  3O6B B;  5LRS A;  4MTE A;  2P5V A;  2STW A;  4LB6 B;  4EGY A;  2A61 A;  1UHM A;  2DPD A;  2GA1 A;  1ON1 A;  2K4J A;  3IWZ A;  4MTD A;  3FX3 A;  1UCR A;  1T39 A;  2ZME A;  1U6G A;  4FX0 A;  4PGG A;  4RAY A;  4MNU A;  3SZT A;  3V7C A;  3T1B A;  5IT3 A;  4KA4 A;  1XCV A;  5KK1 A;  4UHT A;  3LQQ A;  3J80 K;  3BRO A;  3F8F A;  2WV0 A;  1Z9C A;  3FM3 A;  2HWV A;  4O5V A;  2MH2 A;  2FEZ A;  2PEX A;  1IRF A;  3K2Z A;  1R1U A;  5HLG A;  1ZAR A;  2YX4 A;  3T8R A;  2V6C A;  3DPT A;  3JTH A;  1BI0 A;  3TO6 A;  5CVI A;  3D0S A;  1AWC A;  1IN8 A;  4EJT A;  1PUE E;  1REP C;  3K69 A;  1TW3 A;  2B0L A;  3JSO A;  1ZH5 A;  2XRO A;  1YLF A;  3TDZ C;  3F3X A;  1FY7 A;  2FBK A;  3WTX C;  1U8R A;  1RIO H;  2GZW A;  1S7O A;  5ILS A;  3CLO A;  3VFZ A;  2DK8 A;  5CVV A;  2FNP A;  4XLP F;  2PG4 A;  2YSR A;  2VBY A;  4U7B A;  1E17 A;  2E7W A;  1YW8 A;  2EFW A;  1SD4 A;  3L7W A;  4G7Z F;  1JGS A;  5E18 F;  2QQB A;  2EK5 A;  4YG2 F;  2GAU A;  3EYY A;  2LSO A;  5DYM A;  1PP8 F;  4ZYH A;  4NHJ A;  1GVJ A;  3HIF A;  5FD6 A;  4I98 B;  1W7P B;  1IZ1 A;  2QUF A;  3JSP A;  2EFP A;  3L09 A;  3U1D A;  2KKO A;  3TDU C;  4ESF A;  5DCM B;  4M74 A;  3I59 A;  5ICE A;  4CXF A;  4IXA A;  5J8F A;  1R00 A;  2ESN A;  1OMI A;  1BC8 C;  3ECO A;  3RIR A;  1IUY A;  3HSF A;  3WOD F;  1XN7 A;  1EH6 A;  2ZFW A;  3G73 A;  4IJA A;  1TLH B;  1FT9 A;  1IXR C;  2XAJ A;  2DK5 A;  4Y17 A;  1ZRF A;  1WWX A;  2QBY A;  1R5G A;  3RKW A;  1XSV A;  3T0Y A;  4I7H A;  4EM0 B;  4RB3 C;  4HDU A;  3K9T A;  4G7O F;  1FZP B;  4HLY A;  3FF5 A;  2HYG D;  3MAJ A;  2LDU A;  1Q1H A;  5ICF A;  4L9N A;  2LNB A;  5E1W A;  2G7U A;  1FYM A;  2Q8K A;  4IPA A;  2XAG A;  4M71 A;  5K5Q A;  2DAO A;  4RGX A;  1MD0 A;  4ESJ A;  1ZN2 A;  1FBQ A;  2P5L C;  5EEH A;  2D1V A;  3P9K A;  3JW4 A;  4XSZ F;  5E1X A;  3I54 A;  5F64 A;  3LA3 A; 
#chains in the Genus database with same CATH topology
 1BOA A;  3CP8 A;  1YIO A;  2ZXH A;  4KMU X;  4PJM A;  1JHH A;  2OF7 A;  5BQT A;  4AIK A;  1MSF C;  2QLZ A;  3PQJ A;  3HDD A;  2OAZ A;  1B72 B;  2DW4 A;  3KEQ A;  1WJC A;  4B43 A;  1U0J A;  3MFK A;  1R7J A;  2FE3 A;  1JUS A;  4R79 A;  4A5N A;  2R7T A;  5J1U A;  3ZN0 A;  2LVS A;  1XGM A;  3PSF A;  2FRH A;  2R7R A;  2CSO A;  3OYK A;  1VQP I;  2E34 A;  1OYW A;  1MMD A;  2VKV A;  4MHG A;  1TWC J;  3MKY B;  3HUG B;  2K3P A;  3V7S A;  3QPL A;  5E20 A;  4CO8 A;  3IC7 A;  4UNO A;  1Z3X A;  2BGC A;  2FJ1 A;  2XSD C;  4A3B J;  1GV5 A;  2Y0S A;  3ZQH A;  5EZH A;  4YII A;  2HVR A;  4QTR A;  2P81 A;  3GTL J;  3KLN A;  1B6A A;  2A69 F;  2HU9 A;  3E97 A;  3N05 A;  5F04 A;  2EV0 A;  1U5T B;  1RRJ A;  3OIQ A;  2IA2 A;  3C18 A;  2CU7 A;  3C7J A;  1C0W A;  1RKW A;  1MZB A;  3K4N A;  4U7D A;  2IT0 A;  4EQQ A;  3JRD A;  1R5H A;  4HX8 A;  4N9H A;  3ZP5 A;  2EA2 A;  2VKD A;  3KFW X;  4XSX F;  2CMP A;  4GFB A;  1D5V A;  2FBH A;  4D7N A;  4MFD A;  1MJB A;  2K5C A;  4L5I A;  3TOA A;  1IDZ A;  4P9F A;  4P96 A;  1FYL A;  3KYL A;  4M3E A;  1KA8 A;  1HKQ A;  3MN2 A;  3KET A;  1QU3 A;  1H9G A;  3QPH A;  2ZME B;  4ENJ A;  1NG7 A;  2E60 A;  4CYD A;  5JR3 A;  3GTQ J;  3JRI A;  1P4A A;  2QYO A;  3HXL A;  3N97 A;  1DP7 P;  3O2P E;  3K2A A;  3T5X A;  5J47 A;  2FML A;  1ZRE A;  2UWM A;  3BOQ A;  2L7Z A;  2W1O A;  5EEG A;  3BG3 A;  2E2H J;  1JT6 A;  2K9Q A;  4ZYA A;  1SAN A;  1OFC X;  3ONQ A;  3K4J A;  3CCE I;  2KIM A;  3QP5 A;  1BIB A;  2EIK H;  2ADU A;  3B6C A;  2P6S A;  1T56 A;  5LRR A;  3S1N J;  2V26 A;  3LST A;  3S16 J;  2HQ5 A;  2TCT A;  3GLL A;  3WTT C;  1D1A A;  3CUQ B;  1K79 A;  4ANJ A;  2R92 J;  5IYC J;  3AL0 C;  5F1R A;  5JI6 A;  1LEB A;  1JXS A;  1WJ5 A;  3I0T A;  1O57 A;  1DU6 A;  2VQL A;  3OYM A;  1MDM A;  4XR6 A;  4CDG A;  3G2B A;  3BQY A;  2XF6 A;  4Y7N J;  2L0K A;  2Z9O A;  2EA4 A;  3ELK A;  5D8L B;  1R6R A;  2KP6 A;  2BY1 A;  3GFM A;  5DCF A;  5FGM A;  1ZLK A;  1UB9 A;  4L9T A;  1OCC H;  5C44 J;  4R1H A;  2NVY J;  1T98 A;  3HOV J;  3OWT A;  4LK0 F;  1NG6 A;  4N4O B;  2HGC A;  2VPR A;  5DDG A;  5E3L A;  5LEK A;  3PIO F;  2R7F A;  2L02 A;  4L18 B;  2L54 A;  3VSK A;  5AIP A;  1U78 A;  4B3A A;  2HS5 A;  2BHZ A;  1VF9 A;  4J01 A;  2XB5 A;  5DTD A;  2MBF A;  3J80 Z;  3OSF A;  1TWG J;  1NH3 A;  2KIF A;  1IDY A;  1CQT A;  1WGX A;  4GXO A;  2P5K A;  4OIO F;  4B48 A;  1R1V A;  2CG4 A;  1X3Z B;  1SFO J;  1DP3 A;  5KAI C;  2CW0 F;  3LMM A;  1J75 A;  2C6Y A;  3KEY A;  4KDP A;  1FMW A;  2XAF A;  2L3D A;  2NVU B;  1OKR A;  2VQG A;  3RYP A;  5HS9 A;  4PCQ A;  1ZTR A;  3CF5 F;  2PFB A;  3KP7 A;  2DI3 A;  3CMY A;  3OS1 A;  5C4J J;  4F93 B;  5J8C A;  1RES A;  5LBQ A;  2F5E A;  3PUF A;  3AFH A;  1FSH A;  4BQQ A;  1ZK8 A;  1LPQ A;  2X48 A;  4RMN A;  1X1D A;  2KDO A;  2JN6 A;  4GGG A;  4I01 A;  2AS5 F;  5CVJ A;  1WJD A;  4CCL A;  1S8N A;  2I10 A;  5EJC A;  3MCZ A;  2V6E A;  3MKL A;  1YOV B;  3FMQ A;  3O3K A;  2COM A;  4A6E A;  4S05 A;  4NNJ A;  5M5W J;  1Y6I A;  2BXY A;  2QEX I;  1IN6 A;  3I53 A;  4M72 A;  3S1R J;  1LUJ B;  1YW9 A;  1WCM J;  3GZN B;  3I59 B;  3M9A A;  4MIM A;  4BXU A;  5CPR B;  1TWH J;  4OMZ A;  2UXX A;  4LG0 A;  2PX9 A;  2MC4 A;  2M0M A;  1TQP A;  1Y56 A;  9ANT A;  3LAP A;  3I4P A;  1MGT A;  3H9G A;  3OYJ A;  3PSI A;  3WTS C;  1BR2 A;  2DA6 A;  1ZRC A;  2GIZ A;  1WJF A;  1FOY A;  1KU3 A;  1B59 A;  3FKI J;  4DNC A;  1K6O A;  4IHX A;  3EQL F;  3CC7 I;  2F4M B;  2CJJ A;  3FXU A;  5CLS A;  1TWA J;  5FB2 A;  2O8X A;  3K1N A;  2FA5 A;  4F52 A;  2DU9 A;  1B9N A;  2OCC H;  2WY7 Q;  2VOO A;  2W84 A;  2QQ8 A;  4B8X A;  1X1B A;  2AQE A;  4N9I A;  5B5E C;  3GFJ A;  2LBF B;  5EGO A;  2EIL H;  2RKH A;  4V2G A;  1QHH D;  1OQY A;  1OCO H;  2XKO A;  2VQC A;  3FZV A;  2QBY B;  2DFI A;  2V1N A;  1MMN A;  3ZQI A;  2RN7 A;  3I71 A;  3BTL A;  4BH9 A;  3CO6 C;  1FLI A;  1P7J A;  4D1Q A;  4V19 K;  3HGY A;  2DT7 B;  1B8I B;  2OCE A;  1R5I D;  2K9M A;  2Z5U A;  4C30 A;  3DTI A;  2DA4 A;  1WQ2 A;  3D5R C;  5M3M J;  5HOO A;  1LE8 A;  1EJ9 A;  1D8J A;  3F8M A;  2IP2 A;  4F55 A;  1GUU A;  4FAS D;  1KYZ A;  2EZL A;  2BW3 A;  2JT1 A;  4KIS A;  3UNG C;  5BOX A;  1IXS B;  1G3W A;  3VOD A;  1FIP A;  2K9S A;  2D5V A;  2R5Y A;  1WJE A;  1TTY A;  4DYR A;  3WHC A;  5L3E A;  5K7H A;  1W36 D;  2VPL A;  4BAY A;  4F7Z A;  3DBH B;  2IEK A;  1FBU A;  4M3D A;  2MSY A;  2Z3Y A;  1FSE A;  2WV1 A;  4CH7 A;  1FTT A;  1MBE A;  2NVT J;  1RKT A;  1AOY A;  1E3H A;  3KYC B;  3CZ6 A;  3JRA A;  2EIM H;  3MD2 A;  3TQN A;  5DUI A;  3CF2 A;  1H8A C;  2IXS A;  2BYV E;  2W7N A;  4DYC A;  2CQK A;  1O7L A;  2M7B A;  4QSH A;  1OCZ H;  1I6X A;  4AIH A;  2HOE A;  5FRN A;  1D3Y A;  1RI7 A;  4WXD A;  1FTZ A;  5ILU A;  3P9I A;  2EZI A;  3LSH A;  3PO2 J;  3TW6 A;  1XMK A;  4I76 A;  4NC8 A;  4NB5 A;  2IW5 A;  3IRQ A;  4PSX A;  4Y52 J;  2RVC A;  1A6Q A;  4M3B A;  5BPI A;  5BMZ A;  3SZP A;  3LA7 A;  2PMZ N;  1MMA A;  2L7K A;  3N4M A;  2XAS A;  2MAB A;  3FMS A;  4I6Z A;  3NWT A;  3W2W A;  2KHM A;  3HSE A;  1YI2 I;  3JR9 A;  4R8H A;  1J59 A;  3DEE A;  2X51 A;  4IL6 C;  2VT3 A;  3VWB A;  4CZC A;  3DPL C;  2WAF A;  4CYC B;  4C2M J;  2OV7 A;  2NS7 A;  4P5O A;  2ZJR F;  1BR4 A;  3FBI B;  3J7A Y;  1CF7 B;  2V9P A;  2X0L A;  3E5U A;  1YRN B;  4HV5 A;  2AHQ A;  1ERD A;  5L3G A;  2W24 A;  3KP5 A;  2XF7 A;  1ZGJ A;  3PNV A;  1SVO A;  1RUN A;  3Q0W A;  5DUK A;  1KQ9 A;  2QQ9 A;  2FQ3 A;  2R3S A;  2R7O A;  4ON0 A;  4AYB N;  4E6K G;  1DGR M;  2XAU A;  4ENK A;  4LFU A;  2EV6 A;  5D4S A;  2DFH A;  3JRC A;  2QA4 I;  2ZXJ A;  3C2B A;  1JT0 A;  3NAR A;  3MKZ A;  1EH8 A;  4RBO A;  4HYE A;  3BTI A;  4RGR A;  3IKV A;  2ELJ A;  2DJN A;  2AXT C;  1UHS A;  3K6G A;  3FWE A;  2ICW G;  1FYK A;  4IF4 A;  2IA1 A;  1X4O A;  3TOB A;  2HFH A;  1YTY A;  3RZD J;  2IS2 A;  2O03 A;  1ZRD A;  2P7C B;  2FSW A;  3QOP A;  1AA7 A;  3H5N A;  1X3U A;  3CJT B;  3HOU J;  3OL3 A;  5CVU A;  2QVO A;  2LY9 A;  1I6H J;  2F6C A;  2LKP A;  3U9G A;  1J0R A;  1SFX A;  4HEA 2;  3BT9 A;  4BY1 J;  3DF8 A;  3VDX A;  2ESH A;  1K61 A;  1HA8 A;  4OWR B;  1ZR4 A;  2EZK A;  3HJE A;  4A3F J;  2IGN A;  1Y1W J;  1R58 A;  3FBN B;  2EIJ H;  4BUP A;  1P2F A;  5A2Q K;  4ZDL A;  4KIG A;  1WKM A;  3QYF A;  2PI0 A;  2HTJ A;  4P9U A;  2NNY A;  4LB5 A;  1KGS A;  3CCY A;  4G7H F;  1Y1V J;  3CP2 A;  5C4X J;  1U5T C;  4E7S A;  1LFB A;  2IRF G;  3REO A;  1WH7 A;  3FK6 A;  5M5Y J;  1S7E A;  4UB6 C;  1U8B A;  1HKT A;  5KAF C;  3K7A J;  2O8K A;  4EV0 A;  3H35 A;  2HQR A;  2CQX A;  2QCO A;  4GCV A;  2STT A;  3BR0 A;  5HVQ C;  5JHF A;  2M9H A;  5B1B H;  2A5Y B;  4MO7 A;  1I3Q J;  2O9L A;  5D6F A;  4WWC A;  2FD5 A;  1Y0U A;  4I99 C;  5EEA A;  4A3G J;  1XSD A;  5FKL A;  3C1D A;  2BZT A;  2P0W A;  4LG3 A;  5H20 A;  2KZV A;  2Q0O A;  3ZGK A;  3E6B A;  5HDK A;  4S04 A;  3F0C A;  3HKZ N;  2XF5 A;  1ZYR F;  4ASN A;  4E7Z A;  2VT2 A;  5BPD A;  2VIX A;  3Q5F A;  1W7P D;  1YJN I;  2FUG 2;  4B3X A;  3S2H J;  1SVL A;  4D5C A;  3DV8 A;  1X3W B;  1V5F A;  2L9R A;  4A3E J;  1KQ0 A;  4OU0 A;  1JE8 A;  1XX5 A;  5EG0 A;  1OR7 A;  1Y39 A;  1ZHF A;  3IH2 A;  1Y8R B;  2BVL A;  1RR7 A;  3IUO A;  3WE3 A;  4WF2 A;  1BI3 A;  2ZSI B;  5E79 C;  4ZYD A;  1HKS A;  4IEJ A;  2MD5 A;  4MQ9 F;  2VBX A;  4XLN F;  2KJC A;  2YX7 A;  2Y31 A;  4WK8 F;  1DDN A;  3GO5 A;  3ABK H;  5LHI A;  4A0Y A;  1NTC A;  5J1Y A;  2UZK A;  4LMY A;  2W85 A;  2KRF A;  4KUM A;  1MJ9 A;  1ZG5 A;  1R49 A;  1X1A A;  1Z7U A;  1W0T A;  2X85 A;  3QP6 A;  1OCT C;  1D8K A;  2F2E A;  4A3K J;  4XQF A;  5LEJ A;  4UV9 A;  4QPQ A;  1PP7 U;  2OQG A;  4BNC A;  4M3G A;  4LLN A;  2DT5 A;  4IHT A;  1T38 A;  1Z1D A;  1STZ A;  1ZG3 A;  3A0B C;  5IOZ A;  2B7E A;  3OYC A;  1A5J A;  1ETW A;  2HEO A;  1W4M A;  2QF7 A;  1FPQ A;  3SZG A;  2NYX A;  3ZQG A;  3ZXS A;  5K1Y A;  1TNT A;  2OC6 A;  1TQM A;  3ZMS A;  2IAI A;  2Z2S B;  2VBZ A;  4XOR A;  2JA8 J;  2JMW A;  3RI4 A;  1K78 A;  4BXX J;  2WWY A;  1F1Z A;  1FP1 D;  4E7K A;  4AUX A;  2ID3 A;  1TP4 A;  3TW7 A;  4ENN A;  4LG0 B;  1GV2 A;  1AKH A;  2OA4 A;  3X2Q H;  3GX4 X;  1FNN A;  2HKX A;  2XKP A;  5HLI A;  4MEX F;  1U9O A;  2ZO4 A;  4H0E A;  1GXQ A;  2QSF X;  1KON A;  3WHB A;  1I39 A;  4OOI A;  1GT0 C;  3VYR B;  4UV8 A;  3CD6 I;  1MH3 A;  2E1M B;  3HEF A;  2M2E A;  3H3V K;  3PM1 A;  3KZI C;  3W3C A;  5L3B A;  3W6J B;  4DQ2 A;  3OYH A;  3GXO A;  5E1Z B;  4YFK F;  1USS A;  5L3D A;  1IAW A;  2L7F P;  1G3S A;  3BJ6 A;  3S2W A;  1YW7 A;  2OJE D;  5FLM J;  3KLO A;  3U1K A;  4PZJ A;  1S72 I;  3ABU A;  2KIQ A;  4ABZ A;  3I64 A;  3DCF A;  2VUM J;  3WG9 A;  1MBH A;  1EH7 A;  2X4H A;  3E6C C;  3I4N J;  1S3J A;  3GEZ A;  3KZY A;  2DOF A;  2E7X A;  2BW3 B;  3PL8 A;  3HYI A;  1CGP A;  5JHU A;  1WSU A;  4Y15 A;  1VQ4 I;  2ZSH B;  4Q4Z F;  4UVC A;  3UKG A;  2EB7 A;  1WI3 A;  2K9N A;  2R5Y B;  2DMQ A;  5B1A H;  5HLH A;  2F48 A;  3TP3 A;  2W57 A;  1IN7 A;  4CCM A;  4RM3 A;  4AD9 A;  4Z6Y A;  3V4G A;  2CGP A;  2JSC A;  2LRD A;  4A3J J;  5HS7 A;  5GAD J;  1X4P A;  2XC7 A;  2PJP A;  2JTV A;  1HDP A;  3K1M A;  2CV2 A;  3M8F A;  5KNL A;  1VQK I;  5F08 A;  4HSR A;  2CYY A;  2VBW A;  1DUX C;  1OCR H;  2L2O A;  2M30 A;  1XC5 A;  3MQ0 A;  1XCB A;  4CZZ A;  1KQ8 A;  3ZMZ A;  4PDK A;  4BE2 A;  3I58 A;  4NQW A;  2DOD A;  5FFZ A;  3M8E A;  5CQE A;  1RZ4 A;  5GTI C;  1K83 J;  3M1C A;  1ON2 A;  2GXA A;  3CCR I;  1YIJ I;  2JSP A;  3P5J A;  1O3Q A;  3AG4 H;  3WU0 A;  3J7Y J;  3FIS A;  4ZTF A;  3BTJ A;  1ORK A;  1JKQ C;  4XON A;  2XGX A;  1P92 A;  2NOG A;  4A12 A;  4E7I A;  3DKW A;  3BTC A;  1E3P A;  4P1W A;  2FQ4 A;  4HQE A;  2HOT A;  4CSW A;  2KL4 A;  3QU3 A;  1O3T A;  1DU0 A;  1I50 J;  5E3N A;  3BP8 A;  4U0W A;  1IC8 A;  1V4R A;  2BHY A;  2XGD A;  4A0X A;  3HPG A;  3J7A O;  5EYR A;  3Q0U A;  2G9W A;  3K10 A;  2JA7 J;  1SD6 A;  3QAH A;  1QNT A;  3HHG A;  4XRS A;  2YU9 J;  5J40 A;  2A68 F;  3T8T A;  1MW7 A;  2K4B A;  2I5U A;  3RKX A;  2VC0 A;  3WTW C;  4AIJ A;  1YYV A;  2V7F A;  2O6G E;  1TT5 B;  4O6J A;  1FWZ A;  2LP0 A;  3VB2 A;  4IOC F;  2O61 A;  2YR2 A;  3G3Z A;  4HA8 A;  3COA C;  4FIS A;  2KIU A;  2RNG A;  2EFO A;  3B6A A;  4XMY A;  3ZMT A;  3HRT A;  4BL0 B;  3L2C A;  4D7M A;  1YE9 A;  2VOD A;  1VQ5 I;  3BWG A;  3HB9 A;  2K86 A;  4M9S A;  5F27 A;  2NVX J;  4A3D J;  1RR8 C;  3EDP A;  4LGW A;  1V3F A;  3FXQ A;  2TRT A;  3NEU A;  2X1E A;  3L2V A;  3L2W A;  5K7F A;  4ZYG A;  1W36 C;  1MNE A;  4LD5 A;  1VI0 A;  3GVA A;  5LGU A;  4IOA F;  4CCO A;  5KVR A;  2DMN A;  3BR5 A;  1T0F C;  1T2K A;  1F43 A;  4RAZ A;  2GXB A;  1QHG A;  2R7Z J;  4Y33 A;  1FP2 A;  2MLG A;  4RB0 A;  3V42 A;  2M0C A;  2DLL A;  2DXI A;  4UVB A;  3WGG A;  3A01 A;  4BDZ A;  2KRH A;  1VFC A;  4BBS J;  2K9L A;  3IAS 2;  4L5E A;  5E8G A;  3TP0 A;  5EDN A;  1LVA A;  4FE7 A;  1I1G A;  1RUO A;  3F6O A;  4A5M A;  4Y3O A;  2XVC A;  1LDD A;  4A3M J;  4ZTJ A;  2DOA A;  1Z91 A;  3VYS B;  2XPV A;  5ED4 A;  2DTZ A;  2HDD A;  1P7I A;  2VJJ A;  4G6Q A;  2GLO A;  4CCJ A;  2L9V A;  1XGS A;  2PBI A;  4M3F A;  4U87 A;  3ABM H;  3FK7 A;  5KCM A;  2DMT A;  3KP2 A;  2VN2 A;  1ZG1 A;  3HRM A;  2X1C A;  1RC9 A;  1R4N B;  1SC7 A;  4CGZ A;  3PIP F;  3VYT B;  2VC1 A;  4DOZ A;  3HRU A;  1ZGA A;  4HW0 A;  5JLW A;  3VPR A;  4KYW A;  5F0C A;  3SFZ A;  3LSG A;  3LSR A;  2QKL B;  4IX7 A;  2RQP A;  3CCL I;  1JI8 A;  1ZAO A;  3KZZ A;  3PNT A;  4YFN F;  4C2U A;  3A4C A;  2L7M P;  3DEU A;  1GHC A;  5BNG A;  4G8X A;  3O8G A;  4A3C J;  2JVH A;  1I5Z A;  5CQG A;  4EJV A;  3K4K A;  1A35 A;  1N78 A;  2H6B A;  2CQQ A;  3PNY A;  1KU9 A;  2HI3 A;  2K7L A;  4L9V A;  2DQL A;  3IWF A;  3GFL A;  4HF0 A;  1QA6 A;  4Q48 A;  3J7Z I;  2Y9Z A;  2CS3 A;  3D5S C;  3CQZ J;  3GZ6 A;  2X9D A;  3J81 K;  5GAG J;  4QWQ A;  5A2Q Z;  1MJA A;  2G0E A;  4RLQ A;  3H92 A;  4EJO A;  5EZG A;  5HS8 A;  4WX9 A;  1F5T A;  1MBF A;  2WAE A;  2QEN A;  4UXN A;  5D6E A;  2NVQ J;  2R5Z A;  2OPT A;  4M6V A;  3FMR A;  1LQ1 A;  2CUE A;  3ABL H;  1LDK B;  3A1Y A;  4FT8 A;  1OYY A;  4U88 A;  5IP7 J;  1WHU A;  3QQA A;  3ZMD A;  3JRF A;  2DPU A;  1FIA A;  3IP4 B;  3HOX J;  1HW1 A;  3S3O A;  3HSR A;  3WTU C;  3SHF A;  4A93 J;  5K5R A;  4C3H J;  2R7X A;  1L3L A;  1N77 A;  1SEU A;  1D0Y A;  2ISZ A;  1ETK A;  4OIR F;  4Q47 A;  3H1C A;  3G4S I;  3V8L A;  2XRN A;  4BGD A;  1W7P A;  1R1T A;  4LK1 F;  1G2H A;  3F6V A;  1K4T A;  2HYF A;  2CFO A;  4UUS B;  5AON A;  2D2W A;  2A5W A;  1M1E B;  2L4M A;  2EWN A;  1DPR A;  2A05 A;  4I2O A;  2X1D A;  5DEQ A;  2E1C A;  2H27 A;  2HOA A;  2O5R A;  4DIQ A;  1XMX A;  3EUA A;  1P4W A;  3GUD A;  4Z2Y A;  1LEA A;  1F4K A;  3E7L A;  4YIF A;  3LOC A;  3ZCO A;  4IHW A;  1AKH B;  1I27 A;  4I09 A;  1TNS A;  5FLV A;  4GYI A;  5DM6 F;  5DV5 A;  2QZ8 A;  2BEO A;  3K0L A;  3MKW B;  4MEY F;  5ILV A;  1LFP A;  3JAM K;  1IRX A;  1E2X A;  2HVQ A;  2HKO A;  1TBX A;  3KP4 A;  1IV6 A;  4ZZL A;  2GWR A;  4EAT A;  3F9K A;  1W1W E;  5D5U B;  2KZG A;  2WTE A;  2WBM A;  2VLA A;  4KN4 X;  4ITV A;  4K2E A;  4XKV A;  3ERM A;  3H0G J;  3DU5 A;  4KN7 X;  4PJJ A;  5DD8 A;  5D5X B;  2GQQ A;  1H9T A;  3QYE A;  2VOP A;  2PMU A;  3CMA I;  4ZJZ A;  3K70 D;  2ZKZ A;  1IN5 A;  3HRS A;  1UG2 A;  4UUV A;  4HRI A;  3DKX A;  4BJT A;  1K4S A;  1W0U A;  2PQ8 A;  3LSI A;  4HX7 A;  4HZF A;  2O0Y A;  1EKE A;  2I8D A;  4J19 A;  1QZE A;  1T95 A;  2EPF A;  1OPC A;  2H8R A;  3FXM A;  4HST A;  2O3F A;  2E1O A;  3HTU A;  1PUF A;  2JWT A;  4UUT A;  5F0H A;  4IO9 F;  3ESW B;  4CCK A;  4BE0 A;  2MG4 A;  3OYE A;  4XN0 A;  4EJU A;  2G7H A;  5HOD A;  1B4A A;  1BJZ A;  4IZZ A;  1G4D A;  4CIC A;  3DU6 A;  3S1Q J;  5LD2 C;  5IP6 A;  1IF1 A;  1YFH A;  3G1L A;  2ETH A;  2LKX A;  3IAM 2;  3F8N A;  3CJQ B;  3OV8 A;  2NNN A;  2NS0 A;  2X6O A;  3E3V A;  1S7A A;  1Z6T A;  1HQC A;  3PUB A;  1MBJ A;  2IS1 A;  4BHP A;  4WXC A;  3GCM A;  3ZMU A;  1XGO A;  3NAU A;  2ZNY A;  4A6D A;  3NQO A;  5FKM A;  3E5Q A;  4E7L A;  2FNA A;  2WAQ N;  3EUH C;  2R4G A;  3LSM A;  2E35 A;  4U0Y A;  1ZLJ A;  2DFF A;  2LG4 A;  4NQW B;  4KT5 C;  3SFI A;  2JRM A;  3ML6 A;  3RPU A;  5JFR A;  1QZZ A;  1P6R A;  4M9X A;  2DBB A;  1IN4 A;  2XDV A;  3TO7 A;  4D5F A;  3B02 A;  4YIR X;  3GFI A;  2RAE A;  4FTH A;  2XRL A;  4HV6 A;  4HG2 A;  1NK3 P;  2VXZ A;  4ZDO A;  2KMU A;  3GZ5 A;  1VQ9 I;  3OYA A;  4C2T A;  1XDS A;  1LKX A;  3CDL A;  1XD7 A;  3OYB A;  2Y2Z A;  3DLA A;  3ASO H;  5CJ9 A;  4EMS A;  3AG2 H;  3W2V A;  1MMS A;  1B9M A;  2KQR A;  1BW5 A;  2L9N A;  4JP0 A;  2DYR H;  4FE4 A;  1IV8 A;  2CV0 A;  4N0B A;  2ZNZ A;  2M34 A;  2M4G A;  2GXG A;  3P7N A;  2JA5 J;  4DZJ A;  4NC7 A;  2BV6 A;  3HBL A;  2HDC A;  2HZT A;  2IBD A;  2EJR A;  1YX3 A;  1U5T A;  3Q9V A;  3BG6 A;  4HX4 A;  3F21 A;  2EFN A;  4A3I J;  2MGQ A;  3H0D A;  2N8G A;  1MBK A;  3GWZ A;  3H9Q A;  2JPB A;  3MMY B;  1KU7 A;  1LJ9 A;  1EA3 A;  2CUF A;  3BR3 A;  4JBA A;  2YS9 A;  2ZBK A;  1U3E M;  5H6R A;  2OQR A;  4OIP F;  4GO1 A;  2DCE A;  2DQR A;  1WRJ A;  1OYI A;  1LDJ A;  2LF8 A;  1W5T A;  3PFY A;  3LL7 A;  2PLY A;  3QYB A;  3A0H C;  2VXD A;  3AG1 H;  3H3Z A;  1QVT A;  4B1R A;  4HNT A;  4KNY A;  4UB8 C;  1FEX A;  1Y0N A;  2OZ6 A;  3MZY A;  4E7J A;  2BOL A;  3LSJ A;  2MW8 A;  2Y75 A;  2ACJ A;  4PJL A;  4ETS A;  5HDG A;  4IHV A;  3SJM A;  3JTG A;  4MQV A;  2QSG X;  3I5U A;  5LFA A;  3O8H A;  5E3O A;  3CCQ I;  2HNH A;  3DTE A;  3RJP A;  2PN6 A;  3W6V A;  2IS4 A;  2W48 A;  2AXL A;  5FRM A;  3RSN A;  4RB2 C;  3M8J A;  5FJ8 J;  3A01 B;  2RNJ A;  2E19 A;  4PSW A;  3DTK A;  4AWX B;  3F23 A;  1OLT A;  2HVS A;  3ECH A;  1N75 A;  4IHS A;  2M4K A;  2CV1 A;  5ERI A;  4HAM A;  4RGS A;  1SAX A;  2KT0 A;  3BDD A;  4XKB A;  5FKK A;  1BI2 A;  1UST A;  2O7O A;  5CVR A;  1HW5 A;  3R4K A;  5HDN A;  3OYL A;  4BQN A;  1VQ6 I;  1XMA A;  3G1O A;  4BJ5 C;  4E70 A;  3JRE A;  3CUQ A;  3ERE D;  2RC4 A;  2MLK A;  4HLX A;  4XBF A;  1S5L C;  1MDM B;  1VTN C;  4G94 A;  1H0M A;  1J2X A;  1T33 A;  3SXY A;  3GTM J;  4I02 A;  3ZRG A;  1JUP A;  3S1M J;  2IJL A;  4XKC A;  2HOS A;  3CLQ A;  1SD7 A;  2ZME C;  2LOO A;  2E1N A;  2H6C A;  4GYG A;  2V4J C;  1Z77 A;  4BEH A;  4A0Z A;  3S8P A;  1V54 H;  2ZFU A;  3LFK A;  3BPV A;  2QM3 A;  3ABT A;  2R7S A;  2ME6 A;  1QRY A;  3PO3 J;  2LKS A;  3OR1 C;  3M3Y J;  2IVM A;  4F92 B;  4KIB A;  3CMM A;  5DD4 A;  5FO5 A;  4OIQ F;  3V7R A;  3CC4 I;  2XGE A;  2A07 F;  1G3T A;  1DPU A;  3CDI A;  3KP3 A;  3ULQ B;  2ZXW H;  3V8K A;  4HDV A;  1JTX A;  3BJA A;  3FXR A;  1D0X A;  3ISP A;  2M8E A;  1WVR A;  4YFX F;  1EF4 A;  1NHA A;  4BQA A;  5EF6 A;  4CHU A;  2CUJ A;  3BR6 A;  3CUQ C;  3BQZ A;  2VE9 A;  5FLX K;  1QGP A;  4M73 A;  1KU2 A;  2GM4 A;  2LR8 A;  2OBP A;  2J5P A;  1SFU A;  4BHC A;  1JGG A;  3TL4 X;  2TDX A;  1R22 A;  2ZJ2 A;  1XPX A;  2XAH A;  1UHW A;  2HYJ A;  3WGI A;  1XG1 A;  1WZ2 A;  3JRH A;  2EV5 A;  5L3C A;  1IRG A;  3S14 J;  1O3R A;  2JRT A;  1BOB A;  3GW2 A;  4RB1 A;  4B44 A;  1G6N A;  2Z99 A;  5D5W B;  3WG7 H;  3WE2 A;  4AVP A;  1XGN A;  2DFE A;  1JUM A;  1JKO C;  2WC2 A;  4YEL A;  4JYK A;  1ETY A;  2M7A A;  5CYV A;  3DQV C;  1LVK A;  2ECB A;  3GLX A;  4HF1 A;  2R7V A;  1H88 C;  4G6T B;  3FM5 A;  3R0A A;  2LY1 A;  4OIN F;  4D9J A;  1HC8 A;  3KPH A;  3CCV I;  3B73 A;  3W6K B;  4XL9 A;  3W2A A;  4ENM A;  2KFD A;  5JLX A;  2IPQ X;  2CUZ A;  3H5R A;  3WTZ A;  5ICC A;  1IW7 F;  2DA7 A;  2RQQ A;  4X1E A;  3IL2 A;  3J81 Z;  1OJL A;  3KX2 A;  1P4X A;  4JOM A;  2H94 A;  1GDT A;  2PJR A;  1W5C C;  1SAU A;  2JA2 A;  1J09 A;  2HPI A;  3KE2 A;  1YJW I;  2QQA A;  4II2 A;  3L2R A;  5IT9 K;  3VYU B;  3FXL A;  2B9S A;  1I1S A;  2MH9 A;  4WXH A;  3SYT A;  4AID A;  3HOT A;  3QPS A;  4JX6 A;  4XLA A;  5EGO B;  2HPM A;  3DP7 A;  4HNU A;  1UJ8 A;  5J4V A;  3FHZ A;  2A6T A;  4HBL A;  4W1U A;  1R4M B;  3VEP A;  3U2R A;  3KIO A;  3GME A;  2JA6 J;  1TC3 C;  2FBI A;  1QZY A;  4U0V A;  1LE8 B;  4NC6 A;  1FOX A;  3ZQC A;  2DA5 A;  3PFI A;  4YEJ A;  2W4S A;  4M6Y A;  1B8I A;  2DN0 A;  3RTR A;  5GPA A;  1FJL A;  2VI6 A;  3DLL F;  3CTA A;  3HPH A;  1TZL A;  2V9K A;  2QSH X;  1H89 C;  1FX7 A;  2PMZ A;  1MMG A;  4LOC A;  2L4A A;  1TW2 A;  3BCB A;  2A6E F;  3RQI A;  1J5Y A;  3DEW A;  1FBS A;  5HNH A;  5E8I A;  1YX5 A;  4QLC U;  5LHG A;  3RKY A;  1T6S A;  3DXJ F;  2L01 A;  2XAQ A;  3BG7 A;  3MZ8 A;  1JJ8 C;  1PDN C;  2ISY A;  1PUF B;  4M6X A;  2DA2 A;  2LC2 A;  4IVN A;  2Z33 A;  2COB A;  1T8I A;  2IS6 A;  3JRB A;  1HW2 A;  2XPU A;  5TJJ A;  3SDG A;  5KHD A;  4KJZ A;  4LLL A;  5F1J A;  4PJ0 C;  5J6X A;  1APL C;  2UXN A;  4KFC A;  1X19 A;  2LH9 A;  2YU3 A;  3JAM Z;  3BPX A;  1XSX A;  3CES A;  2V1D A;  1LB2 A;  4AM3 A;  2R7U A;  4BHB A;  4AYB A;  2F5F A;  3ZQF A;  2VE8 A;  4BE1 A;  1VQL I;  3S15 J;  1QVU A;  3HOS A;  3E6M A;  2ME0 A;  4JX4 A;  3LA2 A;  1E0E A;  3LFU A;  5DS9 A;  4TV7 A;  2D45 A;  3ASN H;  2XHK A;  3OIP A;  4PFO A;  3OYN A;  3QRF F;  2FXA A;  4IRH A;  1LFU P;  3BZ6 A;  3D1N I;  5FKN A;  1R9T J;  1SMT A;  3BG5 A;  3H3U A;  3LQR A;  4FX4 A;  1V55 H;  3DFG A;  3G71 I;  3S17 J;  3RQ4 A;  2M8G X;  4N4N B;  2GOX B;  3OIO A;  2K3F A;  3ZPL A;  3M1E A;  4JK1 X;  1T0F A;  1QBJ A;  5FD5 A;  1U2W A;  2V79 A;  4S0H B;  3L1P A;  2NOJ B;  3G6E I;  2IGK A;  4AU7 A;  4FHT A;  2X6X A;  1A6I A;  4P55 A;  4CYC A;  2K02 A;  3TKY A;  1A31 A;  2Q2E A;  3CCS I;  1UAA A;  2HTS A;  1CF7 A;  1YRN A;  2BY0 A;  3F22 A;  3BZC A;  4A2U A;  2HXO A;  1ETV A;  2CO5 A;  1RET A;  1RNL A;  1GXP A;  1BA5 A;  1BM9 A;  4I0B A;  4EVI A;  4XOT A;  4BYY A;  4KIT B;  1NK2 P;  2VON A;  2NRA C;  4GDF A;  5D4R A;  1DQU A;  2F5D A;  3BC8 A;  1O4X A;  1IJW C;  3HTS B;  4OAY A;  1X1P A;  3R60 A;  2OD5 A;  3K70 C;  5B66 C;  2ELK A;  3MWM A;  2AO9 A;  5FKO A;  3R0J A;  2M1B A;  2AQF A;  3IHU A;  4HF2 A;  3BCA A;  5HLT A;  2R7W A;  1VQ7 I;  1X58 A;  1OCP A;  3E6D A;  1VND A;  3PQK A;  4ZC3 A;  2A6H F;  2NAZ A;  3CJR B;  1G8X A;  2OU2 A;  3Q0V A;  4Y13 A;  2XUB A;  3C2H A;  4XRF A;  5F6F A;  2K27 A;  2KPM A;  2L5Q A;  3L9F A;  2DA3 A;  2WY8 Q;  1VQ8 I;  2K40 A;  1D0Z A;  4BU2 A;  3IV5 A;  3L00 A;  4LIV A;  3HOY J;  2IA0 A;  1VQO I;  3QPT A;  4W97 A;  2WB1 N;  4PGH A;  3HKZ A;  5K5O A;  3BJO A;  4RS8 A;  3OOP A;  5LLQ A;  4MGR A;  4EJW A;  3SEZ A;  3CCM I;  2OUM A;  1QPM A;  2DA1 A;  1O7F A;  4DGW B;  1A04 A;  2P4W A;  4XK4 A;  3VSL A;  5FFX A;  5K7Z A;  2OTJ I;  2RGV A;  2QWW A;  1QPI A;  1BI1 A;  1MKM A;  3A02 A;  4KIC A;  2ECC A;  3ZR8 X;  3TMO A;  1XDU A;  2GOM A;  5F0F A;  1JHF A;  1ITY A;  3ZN1 A;  1HLV A;  1TT0 A;  3HL2 A;  2EFQ A;  3FXK A;  5D5V B;  2DOE A;  1YO5 C;  2BE5 F;  2VJI A;  1UEL B;  3F72 A;  1ULY A;  4JQF A;  3BY6 A;  5BS6 A;  3K4M A;  2DMU A;  4Q5S F;  1U9N A;  2OZU A;  3VOE A;  5IYD J;  2JPC A;  3I56 I;  2DO7 A;  2LTP A;  1V5G A;  2M3A A;  4EM2 A;  2W00 A;  4LLG F;  3OYD A;  4IQJ A;  1UFM A;  4OMY A;  4ZDP A;  1JKR C;  2HQN A;  3WTV C;  4G6D A;  3L2U A;  1YHQ I;  3LAJ A;  4XLH A;  4NBQ A;  3TED A;  3SQN A;  2RDP A;  3CJN A;  1S6L A;  2D1H A;  4G9Y A;  4IHY A;  1IUF A;  4BEH B;  1ACI A;  2FOK A;  3OS2 A;  4BBR J;  2Y0M A;  1Z05 A;  2BVM A;  2P8T A;  6PAX A;  3RYR A;  2P7V B;  4KIF A;  3GTK J;  5LHH A;  1HSJ A;  1QO0 D;  4RDU A;  4D0P A;  4J00 A;  1BJA A;  3GTP J;  2EBI A;  2F4O B;  2DJI A;  2Y30 A;  1YS6 A;  1R36 A;  3HHH A;  1W5S A;  2ZJP F;  3OY9 A;  3A2K A;  2ZCW A;  3ZQ7 A;  2VAS A;  3V8J A;  4UVA A;  5LGN A;  5EG0 B;  2F5C A;  4RGU A;  2VJ5 A;  3CME I;  2KJB A;  3S93 A;  4ZH4 F;  2GIV A;  4L9J A;  4HNV A;  1O3S A;  4L0Y B;  1UZC A;  3OS0 A;  1YIT I;  2BBY A;  3K4L A;  2FMY A;  3EET A;  2YPR A;  3FXJ A;  3P9C A;  4B09 A;  2R7D A;  3IKT A;  1FOW A;  5J4Y A;  1Z6R A;  4EEF G;  1SMY F;  2H09 A;  4E4H A;  4QIW N;  4C9Y A;  5TRD A;  1MSE C;  4OAZ A;  5J1R A;  1G3Y A;  5ICG A;  1FOK A;  1T08 B;  2BXZ A;  2ZC2 A;  1ODD A;  3MVP A;  1EV7 A;  4IRG A;  3HG9 A;  2MD0 A;  1UMQ A;  1K7A A;  2W82 A;  1D1B A;  1B1B A;  4RA2 A;  2XIG A;  3RPQ A;  3F8B A;  5H6Q A;  3E0J B;  4BAC A;  2CWE A;  3CUO A;  5DCM A;  2P6T A;  1SFE A;  2HDW A;  4LIU A;  2EH3 A;  3R6S A;  2GA2 A;  3TBI A;  4CCN A;  2Z1D A;  4L5J A;  4BDY A;  4F3Q A;  2EQR A;  2Y69 H;  3R61 A;  1BIA A;  5GPC A;  3AAF A;  2RV8 A;  3WGH A;  1BL0 A;  2FF4 A;  4LJZ F;  1K78 B;  1WI9 A;  3IRR A;  1L0O C;  3MEX A;  4EGZ A;  2F5V A;  2LRE A;  2V1U A;  2M5W A;  3M7G A;  4C3J J;  2DTR A;  4BKX A;  1ONV A;  5FLX Z;  3LSK A;  3GF2 A;  3MZH A;  2PJR B;  1QQI A;  3CDH A;  3TO9 A;  4ZZD A;  4I0A A;  3GYH X;  2R0Q C;  1F36 A;  3D5L A;  3EYI A;  1LNW A;  3JRG A;  3HOZ J;  4ESB A;  1HST A;  2HR3 A;  2VB6 A;  3H9J A;  1ZGW A;  2LLK A;  5LGT A;  3BR1 A;  3TGN A;  5L3F A;  1IGN A;  2QGU A;  3E5X A;  3KEO A;  2MC3 A;  4X6A J;  2ZB9 A;  2H8W A;  3BR2 A;  1ZEL A;  1X2M A;  1YS7 A;  1ETO A;  5JVT A;  5IY5 H;  1IXC A;  2ELH A;  2B63 J;  1MIJ A;  3EUH A;  2LD5 A;  1BBY A;  3RDI A;  1POG A;  4EM1 A;  4XLE A;  4ZYE A;  3K1P A;  4WCG A;  3OYI A;  4DBR A;  2JZY A;  4XID A;  1SD5 A;  1J7K A;  2FU4 A;  3G1M A;  3EPZ A;  3KP6 A;  4JX5 A;  4M9Z A;  3S3M A;  2M45 A;  3RCO A;  5HNF A;  5JVG F;  2MA3 A;  5D8K B;  1WPK A;  3ROU A;  4HOB A;  3GTJ J;  5E17 F;  1RPW A;  3CO7 C;  4KMF A;  4IRI A;  2CFX A;  3FDY A;  2HQA A;  1TQI A;  3F8C A;  1KYW A;  1YQA A;  1Z67 A;  1R23 A;  2E1M C;  2PMH A;  3E1S A;  1N25 A;  2JUG A;  2RRE A;  5IT9 Z;  4QPO A;  1XS9 A;  1K6Y A;  5E3M A;  3OOU A;  2JVG A;  2R93 J;  2V9V A;  4E7H A;  2Z16 A;  1BN5 A;  2FOW A;  1ZKG A;  2M87 A;  2W25 A;  1FC3 A;  2XSJ C;  3AG3 H;  4BQO A;  2VJ4 A;  4A69 C;  3WTY C;  4RM2 A;  1JTY A;  3ZMV A;  3DWL E;  2XPW A;  1S29 A;  3C3W A;  3WU2 C;  3H5A A;  5H2F C;  2H1K A;  1MH4 A;  1HBX G;  1GLN A;  2E5N A;  3FIW A;  3QWL A;  4RAF A;  4AC0 A;  3QU6 A;  4A3L J;  2XV4 S;  2Y48 A;  5B3S H;  5IP9 J;  1D1C A;  2V1X A;  2LF7 A;  1B72 A;  1F9N A;  1HXD A;  4V2F A;  1ETQ A;  5TIS C;  1YG2 A;  1VQN I;  4XRM A;  2K85 A;  3CCU I;  3QOE A;  3KCC A;  2A3S A;  2EIN H;  1SVM A;  1J9I A;  3WU1 B;  3DKY A;  1Y8Q B;  3Q9S A;  3OYG A;  3GTG J;  4L0Z B;  1XTA A;  3HUG A;  1BC7 C;  1TWF J;  4II3 A;  5M5X J;  2H1L A;  4O3M A;  5IOY A;  2J5O A;  4HQM A;  4BJ6 C;  3GTO J;  3BZK A;  1ENH A;  1WJA A;  2CQN A;  3LWF A;  1TL8 A;  2Q2E B;  2KDZ A;  2GBY A;  2CH0 A;  2WB1 A;  1XB4 A;  3OSG A;  3NRV A;  2JJ7 A;  5AIQ A;  1Z21 A;  3O6B B;  2ZJQ F;  1IO2 A;  2VKE A;  5LRS A;  4MTE A;  2P5V A;  4B47 A;  2STW A;  2BY3 A;  4LB6 B;  4GRI A;  4EGY A;  2A61 A;  4XLF A;  5GAE J;  3K4C A;  1P9Q C;  1UHM A;  4PFP A;  2DPD A;  1X1C A;  4PJN A;  3I55 I;  3AL0 B;  2GA1 A;  4XLC A;  1ON1 A;  2K4J A;  3IWZ A;  1JJ6 C;  2HXI A;  3FXO A;  2WAD A;  1KZH A;  3M4O J;  4MTD A;  3FX3 A;  1UCR A;  2NXN B;  1VQM I;  1T39 A;  2CW7 A;  3U21 A;  1GVD A;  2ZME A;  4PUS A;  1U6G A;  4FX0 A;  2CW8 A;  4PGG A;  4RAY A;  4MNU A;  3L2Q A;  3SZT A;  3V7C A;  3T1B A;  4XRS G;  5IT3 A;  1HDD C;  2Y0S N;  4KA4 A;  1Z7L A;  1MNM C;  4BXF A;  1XCV A;  2L9S A;  5KK1 A;  4XNF A;  5IPA A;  1ZQ3 P;  3I4M J;  5CKT A;  4UHT A;  4BY7 J;  3ZQL A;  4NDL A;  3LQQ A;  3J80 K;  3BRO A;  3F8F A;  2WV0 A;  3OL4 A;  3ZOB A;  1Z9C A;  3FM3 A;  2HWV A;  4O5V A;  2MH2 A;  2FEZ A;  2PEX A;  3KYD B;  1IRF A;  4Y4R A;  4CA0 A;  4DJA A;  1S9H A;  3K2Z A;  1R1U A;  5HLG A;  1PVE A;  4RAG A;  2DMP A;  1ZAR A;  1DGW Y;  2YX4 A;  2VQH A;  3HM5 A;  3T8R A;  2V6C A;  3EUK L;  4YRV A;  3DPT A;  1IG7 A;  5J3L A;  3JTH A;  1BI0 A;  3TO6 A;  3M07 A;  1A36 A;  3QOD A;  4PK4 A;  2LY2 A;  3CCJ I;  3OR2 C;  5CVI A;  3D0S A;  1AWC A;  1IN8 A;  1WFX A;  4EJT A;  1PUE E;  1REP C;  3K69 A;  2DT6 A;  4C3I J;  2MFZ A;  1TW3 A;  2B0L A;  4LIT A;  1X2N A;  4XN3 A;  4XKW A;  4DBQ A;  3JSO A;  3C2G A;  1ZH5 A;  3FHN A;  3HZJ A;  2XRO A;  1YLF A;  1Z3Y A;  3TDZ C;  3A03 A;  4FCY A;  2E36 A;  1UG0 A;  4F91 B;  3F3X A;  1FY7 A;  4HPQ A;  2FBK A;  1MBG A;  3S32 A;  3WTX C;  1U8R A;  2JQ7 A;  1RIO H;  2GZW A;  1S7O A;  5ILS A;  3CLO A;  3VFZ A;  1PJR A;  3HOW J;  2DK8 A;  2UV1 A;  2BY2 A;  5CVV A;  1MND A;  2FNP A;  1ZR2 A;  4XLP F;  3LNQ A;  2XB0 X;  2PG4 A;  2YSR A;  3I9V 2;  2VBY A;  2JK3 A;  3H36 A;  4U7B A;  1IRZ A;  1E17 A;  2E7W A;  1YW8 A;  2EFW A;  1SD4 A;  1I3A A;  2XGC A;  3HC7 A;  3L7W A;  2VKH A;  4G7Z F;  4B4C A;  1JGS A;  2R5Z B;  5TGT A;  5E18 F;  4IKF A;  2QQB A;  2EK5 A;  4YG2 F;  2GAU A;  3AKZ A;  1HOM A;  3EYY A;  2LSO A;  3I3L A;  4RLF A;  4NUB A;  2X6W A;  2NS8 A;  1WH5 A;  5DYM A;  1PP8 F;  4ZYH A;  1YJ9 I;  3K4B A;  1ETX A;  2VL8 A;  4KT6 A;  3Q3S A;  4NHJ A;  3RZO J;  1WJB A;  2KIS A;  2R7Q A;  1V5E A;  3GBG A;  1FMV A;  2QKM B;  1GVJ A;  2YUS A;  3HGG A;  4G12 A;  3SEQ A;  3HIF A;  1JKP C;  4BS9 A;  4CUG A;  2LFB A;  5FD6 A;  5FRO A;  4I98 B;  3BLY A;  1W7P B;  5M3F J;  1IZ1 A;  1PYV A;  2E5Z A;  2QUF A;  3JSP A;  2LMD A;  2EFP A;  1AHD P;  3L09 A;  2MYS A;  2ID6 A;  3U1D A;  2KKO A;  3TDU C;  4ESF A;  5DCM B;  4M74 A;  3I59 A;  5GP9 A;  4UUS A;  5ICE A;  2E2J J;  4CXF A;  4IXA A;  4IQ4 A;  3SDB A;  5J8F A;  1R00 A;  2ESN A;  1OMI A;  1AU7 A;  1BC8 C;  3ECO A;  2E71 A;  3RIR A;  1BR1 A;  1OR7 C;  2CRG A;  2FX0 A;  2IGO A;  1VZ0 A;  3DPU A;  5GAH J;  1IUY A;  3HSF A;  3WOD F;  2OTL I;  1XN7 A;  1EH6 A;  2ZFW A;  2UUZ A;  3G73 A;  4AVZ A;  4MLO A;  4MFE A;  2Q1Z B;  3DBR B;  4IJA A;  1TLH B;  1R71 A;  3RKQ A;  4FQG A;  1FT9 A;  4DYQ A;  3CC2 I;  1IXR C;  2XAJ A;  2DK5 A;  4FET A;  2LBF A;  1HCR A;  4Y17 A;  1SFK A;  1ZRF A;  2X6Y A;  2Y9Y A;  1WWX A;  4H4K C;  2QBY A;  3S3N A;  2HZD A;  1R5G A;  3ZQQ A;  3UR3 C;  2CQ7 A;  3RKW A;  1Z0X A;  1XSV A;  3T0Y A;  4I7H A;  3FKJ A;  2DYS H;  3S2D J;  4EM0 B;  3LSP A;  4RB3 C;  2WAQ A;  4HDU A;  3IH3 A;  5DM7 F;  2F4I A;  2EZH A;  1BW6 A;  2LYC A;  3K9T A;  1HF0 A;  4G7O F;  1FZP B;  3FF5 A;  2HYG D;  3IH4 A;  3MAJ A;  2LDU A;  5GTH C;  4HLY A;  1Q1H A;  2KRC A;  5ICF A;  3PJR A;  3OMY A;  4L9N A;  3OYF A;  3BG9 A;  5C3E J;  2LNB A;  5E1W A;  1E3O C;  3RPU D;  5IYB J;  2G7U A;  1FYM A;  1OIS A;  2Q8K A;  4IPA A;  1D5Y A;  2IGM A;  2XAG A;  4DZP A;  4M71 A;  4DW6 A;  5K5Q A;  2DAO A;  2KLO A;  2E2I J;  4RGX A;  4XIC A;  2DDB A;  1MD0 A;  2WA0 A;  2ZXI A;  4ESJ A;  1ZN2 A;  1G59 A;  4XM3 A;  1FBQ A;  2DDA A;  3DBL B;  1Q1V A;  2P5L C;  4UY8 I;  5EEH A;  2D1V A;  3JCU C;  3P9K A;  3JW4 A;  4XSZ F;  5E1X A;  2JUC A;  3I54 A;  2LK2 A;  4XOP A;  5F64 A;  4X0G A;  3NWS A;  3LA3 A; 
#chains in the Genus database with same CATH homology
 1BOA A;  1YIO A;  4KMU X;  1JHH A;  5BQT A;  4AIK A;  2QLZ A;  3PQJ A;  2OAZ A;  2DW4 A;  3KEQ A;  3MFK A;  1R7J A;  2FE3 A;  4R79 A;  4A5N A;  3ZN0 A;  1XGM A;  2FRH A;  2CSO A;  1OYW A;  4MHG A;  3V7S A;  5E20 A;  4CO8 A;  3IC7 A;  4UNO A;  2BGC A;  4YII A;  3KLN A;  1B6A A;  2A69 F;  3E97 A;  2EV0 A;  1U5T B;  2IA2 A;  3C18 A;  3C7J A;  1C0W A;  4U7D A;  1MZB A;  2IT0 A;  4EQQ A;  1R5H A;  4HX8 A;  4N9H A;  3ZP5 A;  2EA2 A;  4XSX F;  3KFW X;  1D5V A;  2FBH A;  1MJB A;  4L5I A;  3TOA A;  4P9F A;  4P96 A;  1FYL A;  1KA8 A;  1HKQ A;  3KET A;  1H9G A;  3QPH A;  2ZME B;  4ENJ A;  4CYD A;  5JR3 A;  1P4A A;  2QYO A;  3N97 A;  1DP7 P;  3O2P E;  3T5X A;  2FML A;  1ZRE A;  2UWM A;  3BOQ A;  5EEG A;  2KIM A;  3QP5 A;  1BIB A;  2ADU A;  2P6S A;  5LRR A;  3LST A;  3WTT C;  3CUQ B;  1K79 A;  5F1R A;  5JI6 A;  1LEB A;  1JXS A;  3I0T A;  1O57 A;  1MDM A;  4CDG A;  2Z9O A;  2EA4 A;  3ELK A;  5D8L B;  3GFM A;  5DCF A;  5FGM A;  1ZLK A;  1UB9 A;  4L9T A;  4R1H A;  1T98 A;  4LK0 F;  5DDG A;  2HGC A;  5LEK A;  2R7F A;  2L02 A;  4L18 B;  2L54 A;  5AIP A;  1U78 A;  2HS5 A;  2MBF A;  3J80 Z;  2KIF A;  4GXO A;  2P5K A;  4OIO F;  1R1V A;  2CG4 A;  2CW0 F;  1J75 A;  2C6Y A;  4KDP A;  2XAF A;  2L3D A;  1OKR A;  3RYP A;  5HS9 A;  4PCQ A;  2PFB A;  3KP7 A;  2DI3 A;  5J8C A;  5LBQ A;  2F5E A;  1FSH A;  4GGG A;  4I01 A;  2AS5 F;  5CVJ A;  1S8N A;  3MCZ A;  3FMQ A;  3O3K A;  2COM A;  4A6E A;  4S05 A;  1IN6 A;  3I53 A;  4M72 A;  1YW9 A;  3I59 B;  3M9A A;  4BXU A;  4OMZ A;  2UXX A;  4LG0 A;  1TQP A;  3LAP A;  3I4P A;  1MGT A;  3WTS C;  1ZRC A;  1KU3 A;  1B59 A;  1K6O A;  4DNC A;  3EQL F;  5FB2 A;  3FXU A;  5CLS A;  2O8X A;  3K1N A;  2FA5 A;  2DU9 A;  1B9N A;  2VOO A;  2W84 A;  4B8X A;  4N9I A;  3GFJ A;  2RKH A;  2XKO A;  3FZV A;  2QBY B;  2DFI A;  2RN7 A;  3I71 A;  4BH9 A;  3CO6 C;  1FLI A;  2Z5U A;  1WQ2 A;  1D8J A;  5HOO A;  3F8M A;  2IP2 A;  1KYZ A;  2JT1 A;  5BOX A;  1IXS B;  1G3W A;  3VOD A;  1TTY A;  5L3E A;  4BAY A;  4F7Z A;  1FBU A;  2Z3Y A;  1FSE A;  1AOY A;  3TQN A;  5DUI A;  2BYV E;  2CQK A;  1O7L A;  1I6X A;  4AIH A;  2HOE A;  1D3Y A;  1RI7 A;  4WXD A;  5ILU A;  3P9I A;  1XMK A;  4NB5 A;  2IW5 A;  3IRQ A;  2RVC A;  5BPI A;  5BMZ A;  3SZP A;  3LA7 A;  3N4M A;  2XAS A;  3FMS A;  3HSE A;  1J59 A;  4R8H A;  2VT3 A;  3DPL C;  4P5O A;  1CF7 B;  3E5U A;  2X0L A;  4HV5 A;  5L3G A;  2W24 A;  3KP5 A;  1RUN A;  1ZGJ A;  5DUK A;  1KQ9 A;  2QQ9 A;  2FQ3 A;  2R3S A;  4ON0 A;  4ENK A;  4LFU A;  2EV6 A;  5D4S A;  2ZXJ A;  1EH8 A;  4HYE A;  4RGR A;  3IKV A;  3FWE A;  1FYK A;  4IF4 A;  2IA1 A;  3TOB A;  2HFH A;  1YTY A;  2O03 A;  1ZRD A;  2P7C B;  2FSW A;  3QOP A;  1X3U A;  5CVU A;  2QVO A;  3U9G A;  2LKP A;  1J0R A;  1SFX A;  3DF8 A;  2ESH A;  1R58 A;  1P2F A;  5A2Q K;  4KIG A;  1WKM A;  2PI0 A;  2HTJ A;  4P9U A;  2NNY A;  4LB5 A;  1KGS A;  4G7H F;  1U5T C;  2IRF G;  3REO A;  1HKT A;  4EV0 A;  2HQR A;  4GCV A;  2STT A;  5HVQ C;  2A5Y B;  5D6F A;  4WWC A;  1Y0U A;  1XSD A;  3C1D A;  5H20 A;  2Q0O A;  3E6B A;  5HDK A;  4S04 A;  4ASN A;  1ZYR F;  2VT2 A;  5BPD A;  3Q5F A;  1W7P D;  3DV8 A;  1KQ0 A;  4OU0 A;  1JE8 A;  1OR7 A;  1ZHF A;  3WE3 A;  4WF2 A;  1BI3 A;  4ZYD A;  1HKS A;  2MD5 A;  4MQ9 F;  2VBX A;  4XLN F;  2KJC A;  2YX7 A;  4WK8 F;  1DDN A;  3GO5 A;  5LHI A;  4A0Y A;  2UZK A;  4LMY A;  2W85 A;  2KRF A;  4KUM A;  1MJ9 A;  1ZG5 A;  1Z7U A;  3QP6 A;  1D8K A;  2F2E A;  5LEJ A;  4UV9 A;  1PP7 U;  2OQG A;  4BNC A;  4LLN A;  2DT5 A;  4IHT A;  1T38 A;  1Z1D A;  1STZ A;  1ZG3 A;  2HEO A;  1W4M A;  1FPQ A;  2NYX A;  5K1Y A;  1TNT A;  1TQM A;  3ZMS A;  2VBZ A;  3RI4 A;  1K78 A;  2WWY A;  1F1Z A;  1FP1 D;  4LG0 B;  4ENN A;  2OA4 A;  3GX4 X;  1FNN A;  2HKX A;  2XKP A;  5HLI A;  4MEX F;  2ZO4 A;  4H0E A;  1GXQ A;  4OOI A;  4UV8 A;  5L3B A;  3W6J B;  4DQ2 A;  3GXO A;  5E1Z B;  4YFK F;  1USS A;  5L3D A;  1IAW A;  1G3S A;  3BJ6 A;  3S2W A;  1YW7 A;  3KLO A;  4PZJ A;  3ABU A;  3I64 A;  3WG9 A;  1EH7 A;  2X4H A;  3E6C C;  1S3J A;  3GEZ A;  3KZY A;  2E7X A;  3HYI A;  1CGP A;  5JHU A;  1WSU A;  4Y15 A;  4Q4Z F;  4UVC A;  2EB7 A;  5HLH A;  2W57 A;  1IN7 A;  4AD9 A;  3V4G A;  2CGP A;  2JSC A;  5HS7 A;  2PJP A;  2JTV A;  3K1M A;  3M8F A;  2CYY A;  2VBW A;  1DUX C;  2M30 A;  3MQ0 A;  1XCB A;  4CZZ A;  1KQ8 A;  3ZMZ A;  4PDK A;  3I58 A;  4NQW A;  5FFZ A;  3M8E A;  1RZ4 A;  1ON2 A;  1O3Q A;  3WU0 A;  2XGX A;  1P92 A;  4A12 A;  3DKW A;  4HQE A;  3QU3 A;  1O3T A;  3BP8 A;  4U0W A;  1V4R A;  4A0X A;  3J7A O;  2G9W A;  1SD6 A;  3QAH A;  1QNT A;  3HHG A;  2A68 F;  3T8T A;  2K4B A;  3RKX A;  2VC0 A;  3WTW C;  4AIJ A;  1YYV A;  2O6G E;  4O6J A;  1FWZ A;  3VB2 A;  2O61 A;  2YR2 A;  3G3Z A;  4HA8 A;  3COA C;  2KIU A;  3L2C A;  2EFO A;  3ZMT A;  3HRT A;  2VOD A;  3BWG A;  2K86 A;  4M9S A;  3EDP A;  4LGW A;  1V3F A;  3FXQ A;  3NEU A;  4ZYG A;  4LD5 A;  5LGU A;  3GVA A;  5KVR A;  1T2K A;  4RAZ A;  2GXB A;  1FP2 A;  2MLG A;  4RB0 A;  2DLL A;  4UVB A;  3WGG A;  5E8G A;  1LVA A;  1I1G A;  1RUO A;  3F6O A;  4A5M A;  2XVC A;  1LDD A;  1Z91 A;  5ED4 A;  4G6Q A;  1XGS A;  2PBI A;  3KP2 A;  2VN2 A;  1ZG1 A;  3HRM A;  4CGZ A;  2VC1 A;  3HRU A;  1ZGA A;  4HW0 A;  4KYW A;  3SFZ A;  2RQP A;  1ZAO A;  3KZZ A;  4YFN F;  3DEU A;  1GHC A;  4G8X A;  1I5Z A;  4EJV A;  2H6B A;  1KU9 A;  2K7L A;  4L9V A;  2DQL A;  3IWF A;  3GFL A;  4HF0 A;  4Q48 A;  3GZ6 A;  3J81 K;  4QWQ A;  5A2Q Z;  1MJA A;  3H92 A;  4EJO A;  5HS8 A;  4WX9 A;  1F5T A;  2QEN A;  4UXN A;  5D6E A;  3FMR A;  1LQ1 A;  1LDK B;  4FT8 A;  1OYY A;  4U88 A;  2DPU A;  3ZMD A;  1HW1 A;  3HSR A;  3WTU C;  3SHF A;  1L3L A;  2ISZ A;  4OIR F;  4Q47 A;  3V8L A;  2XRN A;  1W7P A;  1R1T A;  4LK1 F;  3F6V A;  2HYF A;  5AON A;  2D2W A;  2L4M A;  2EWN A;  1DPR A;  4I2O A;  5DEQ A;  2E1C A;  2H27 A;  1P4W A;  3GUD A;  4Z2Y A;  1LEA A;  1F4K A;  4YIF A;  1I27 A;  4I09 A;  1TNS A;  4GYI A;  5DV5 A;  2QZ8 A;  2BEO A;  3K0L A;  4MEY F;  5ILV A;  3JAM K;  1E2X A;  2HKO A;  1TBX A;  3KP4 A;  4ZZL A;  2GWR A;  5D5U B;  2WTE A;  4KN4 X;  4K2E A;  5DD8 A;  4KN7 X;  5D5X B;  1H9T A;  2GQQ A;  2VOP A;  2PMU A;  2ZKZ A;  1IN5 A;  3HRS A;  4UUV A;  2PQ8 A;  4HX7 A;  4HZF A;  2O0Y A;  1OPC A;  2O3F A;  3HTU A;  4EJU A;  2G7H A;  1B4A A;  1G4D A;  4CIC A;  1IF1 A;  1YFH A;  2ETH A;  3F8N A;  3OV8 A;  2NNN A;  2NS0 A;  3E3V A;  1S7A A;  1Z6T A;  1HQC A;  4BHP A;  4WXC A;  3ZMU A;  1XGO A;  2ZNY A;  4A6D A;  3NQO A;  3E5Q A;  2FNA A;  4U0Y A;  1ZLJ A;  4KT5 C;  3ML6 A;  3RPU A;  5JFR A;  1QZZ A;  1P6R A;  4M9X A;  2DBB A;  1IN4 A;  3TO7 A;  3B02 A;  3GFI A;  4HV6 A;  2VXZ A;  3GZ5 A;  1XDS A;  1XD7 A;  5CJ9 A;  4EMS A;  1B9M A;  4N0B A;  2ZNZ A;  2GXG A;  3P7N A;  2BV6 A;  2HDC A;  2HZT A;  2EJR A;  3Q9V A;  1U5T A;  4HX4 A;  3F21 A;  2EFN A;  3GWZ A;  2JPB A;  1KU7 A;  1LJ9 A;  4JBA A;  2ZBK A;  1U3E M;  5H6R A;  2OQR A;  4OIP F;  4GO1 A;  2DQR A;  1WRJ A;  1OYI A;  1LDJ A;  2LF8 A;  1W5T A;  2PLY A;  3H3Z A;  4KNY A;  2OZ6 A;  3MZY A;  2Y75 A;  2ACJ A;  4ETS A;  5HDG A;  3JTG A;  4MQV A;  3I5U A;  3RJP A;  2PN6 A;  2AXL A;  4RB2 C;  2RNJ A;  4AWX B;  3F23 A;  4IHS A;  3ECH A;  5ERI A;  4HAM A;  4RGS A;  1SAX A;  3BDD A;  1BI2 A;  1UST A;  5CVR A;  1HW5 A;  3R4K A;  5HDN A;  1XMA A;  4E70 A;  3CUQ A;  3ERE D;  2RC4 A;  2MLK A;  4HLX A;  4XBF A;  1MDM B;  1VTN C;  4G94 A;  1H0M A;  1J2X A;  3SXY A;  4I02 A;  2IJL A;  1SD7 A;  2E1N A;  2H6C A;  4GYG A;  4A0Z A;  3LFK A;  3BPV A;  2QM3 A;  3ABT A;  2IVM A;  4KIB A;  5DD4 A;  5FO5 A;  4OIQ F;  3V7R A;  2A07 F;  1G3T A;  1DPU A;  3KP3 A;  3ULQ B;  3V8K A;  4HDV A;  3BJA A;  3FXR A;  3ISP A;  2M8E A;  4YFX F;  1NHA A;  4BQA A;  4CHU A;  3CUQ C;  2VE9 A;  5FLX K;  1QGP A;  4M73 A;  1KU2 A;  2OBP A;  2J5P A;  1SFU A;  4BHC A;  2TDX A;  1R22 A;  2ZJ2 A;  2XAH A;  1UHW A;  3WGI A;  2EV5 A;  5L3C A;  1IRG A;  1O3R A;  2JRT A;  3GW2 A;  4RB1 A;  1G6N A;  2Z99 A;  5D5W B;  3WE2 A;  4AVP A;  1XGN A;  2WC2 A;  5CYV A;  3DQV C;  3GLX A;  4HF1 A;  3FM5 A;  3R0A A;  4OIN F;  3B73 A;  3W6K B;  4ENM A;  2IPQ X;  3WTZ A;  5ICC A;  1IW7 F;  3IL2 A;  3J81 Z;  1P4X A;  2H94 A;  3KE2 A;  2QQA A;  5IT9 K;  1I1S A;  2MH9 A;  4WXH A;  3HOT A;  3DP7 A;  3FHZ A;  4HBL A;  3VEP A;  3U2R A;  2FBI A;  1QZY A;  4U0V A;  3PFI A;  4M6Y A;  3RTR A;  3CTA A;  1FX7 A;  2L4A A;  1TW2 A;  2A6E F;  1J5Y A;  1FBS A;  5E8I A;  4QLC U;  5LHG A;  3RKY A;  1T6S A;  3DXJ F;  2L01 A;  2XAQ A;  1PDN C;  2ISY A;  4M6X A;  4IVN A;  2Z33 A;  1HW2 A;  5TJJ A;  4LLL A;  5J6X A;  2UXN A;  4KFC A;  2YU3 A;  3JAM Z;  3BPX A;  1XSX A;  2V1D A;  1LB2 A;  4BHB A;  2F5F A;  2VE8 A;  3HOS A;  3E6M A;  3LA2 A;  4TV7 A;  2D45 A;  2XHK A;  3QRF F;  2FXA A;  4IRH A;  3BZ6 A;  1SMT A;  3H3U A;  3LQR A;  4FX4 A;  3DFG A;  3ZPL A;  3M1E A;  4JK1 X;  1T0F A;  1QBJ A;  5FD5 A;  1U2W A;  2V79 A;  4FHT A;  4P55 A;  2K02 A;  3TKY A;  2Q2E A;  2HTS A;  1CF7 A;  3F22 A;  4A2U A;  2CO5 A;  1RNL A;  1GXP A;  1BM9 A;  4I0B A;  4EVI A;  4BYY A;  2VON A;  2NRA C;  5D4R A;  2F5D A;  3HTS B;  3R60 A;  2OD5 A;  3MWM A;  3R0J A;  2M1B A;  3IHU A;  4HF2 A;  3E6D A;  3PQK A;  2A6H F;  2NAZ A;  2OU2 A;  4Y13 A;  2XUB A;  5F6F A;  4XRF A;  2K27 A;  3L9F A;  3L00 A;  2IA0 A;  3QPT A;  4PGH A;  5K5O A;  3BJO A;  4RS8 A;  3OOP A;  5LLQ A;  4MGR A;  4EJW A;  1QPM A;  1O7F A;  1A04 A;  2P4W A;  5FFX A;  2RGV A;  2QWW A;  1BI1 A;  1MKM A;  4KIC A;  1XDU A;  1JHF A;  3ZN1 A;  2EFQ A;  5D5V B;  1YO5 C;  2BE5 F;  5BS6 A;  3F72 A;  5K5R A;  1ULY A;  4JQF A;  3BY6 A;  4Q5S F;  2OZU A;  3VOE A;  2JPC A;  2DO7 A;  4EM2 A;  4LLG F;  1UFM A;  4OMY A;  2HQN A;  3WTV C;  4G6D A;  3LAJ A;  3SQN A;  2RDP A;  3CJN A;  1S6L A;  2D1H A;  4G9Y A;  2FOK A;  2Y0M A;  1Z05 A;  6PAX A;  2P8T A;  3RYR A;  2P7V B;  4KIF A;  5LHH A;  1HSJ A;  1QO0 D;  4D0P A;  1BJA A;  1YS6 A;  3HHH A;  1R36 A;  1W5S A;  2ZCW A;  3ZQ7 A;  3V8J A;  4UVA A;  5LGN A;  2F5C A;  4RGU A;  2KJB A;  4ZH4 F;  2GIV A;  4L9J A;  4L0Y B;  1O3S A;  2BBY A;  2FMY A;  3EET A;  2YPR A;  3P9C A;  4B09 A;  2R7D A;  3IKT A;  1Z6R A;  1SMY F;  2H09 A;  5TRD A;  1G3Y A;  5ICG A;  1FOK A;  1ODD A;  1EV7 A;  4IRG A;  1K7A A;  1B1B A;  2XIG A;  3RPQ A;  3F8B A;  5H6Q A;  2CWE A;  3CUO A;  5DCM A;  2P6T A;  1SFE A;  3R6S A;  2GA2 A;  4L5J A;  3R61 A;  1BIA A;  3AAF A;  2RV8 A;  3WGH A;  2FF4 A;  4LJZ F;  1K78 B;  1WI9 A;  3IRR A;  1L0O C;  3MEX A;  4EGZ A;  2V1U A;  2M5W A;  3M7G A;  2DTR A;  1ONV A;  5FLX Z;  3GF2 A;  3MZH A;  1QQI A;  3CDH A;  3TO9 A;  4ZZD A;  4I0A A;  3GYH X;  3D5L A;  3EYI A;  1LNW A;  4ESB A;  1HST A;  2HR3 A;  5LGT A;  3TGN A;  5L3F A;  3E5X A;  3KEO A;  2MC3 A;  1YS7 A;  5JVT A;  1IXC A;  2ELH A;  3EUH A;  1BBY A;  3RDI A;  4EM1 A;  4ZYE A;  3K1P A;  4WCG A;  2JZY A;  1SD5 A;  1J7K A;  2FU4 A;  4M9Z A;  3KP6 A;  2M45 A;  2MA3 A;  5D8K B;  3ROU A;  4HOB A;  5E17 F;  4KMF A;  3CO7 C;  4IRI A;  2CFX A;  1TQI A;  3F8C A;  1KYW A;  1YQA A;  1R23 A;  2PMH A;  5IT9 Z;  2V9V A;  1BN5 A;  2M87 A;  2W25 A;  1FC3 A;  3WTY C;  3ZMV A;  1S29 A;  3C3W A;  1HBX G;  3QU6 A;  2XV4 S;  2Y48 A;  2V1X A;  2LF7 A;  1F9N A;  1HXD A;  1YG2 A;  3KCC A;  2A3S A;  1J9I A;  3WU1 B;  3Q9S A;  4L0Z B;  3HUG A;  1BC7 C;  4O3M A;  2J5O A;  4HQM A;  3LWF A;  1XB4 A;  3NRV A;  5AIQ A;  3O6B B;  5LRS A;  4MTE A;  2P5V A;  2STW A;  4LB6 B;  4EGY A;  2A61 A;  1UHM A;  2DPD A;  2GA1 A;  1ON1 A;  2K4J A;  3IWZ A;  4MTD A;  3FX3 A;  1UCR A;  1T39 A;  2ZME A;  1U6G A;  4FX0 A;  4PGG A;  4RAY A;  4MNU A;  3SZT A;  3V7C A;  3T1B A;  5IT3 A;  4KA4 A;  1XCV A;  5KK1 A;  4UHT A;  3LQQ A;  3J80 K;  3BRO A;  3F8F A;  2WV0 A;  1Z9C A;  3FM3 A;  2HWV A;  4O5V A;  2MH2 A;  2FEZ A;  2PEX A;  1IRF A;  3K2Z A;  1R1U A;  5HLG A;  1ZAR A;  2YX4 A;  3T8R A;  2V6C A;  3DPT A;  3JTH A;  1BI0 A;  3TO6 A;  5CVI A;  3D0S A;  1AWC A;  1IN8 A;  4EJT A;  1PUE E;  1REP C;  3K69 A;  1TW3 A;  2B0L A;  3JSO A;  1ZH5 A;  2XRO A;  1YLF A;  3TDZ C;  3F3X A;  1FY7 A;  2FBK A;  3WTX C;  1U8R A;  1RIO H;  2GZW A;  1S7O A;  5ILS A;  3CLO A;  3VFZ A;  2DK8 A;  5CVV A;  2FNP A;  4XLP F;  2PG4 A;  2YSR A;  2VBY A;  4U7B A;  1E17 A;  2E7W A;  1YW8 A;  2EFW A;  1SD4 A;  3L7W A;  4G7Z F;  1JGS A;  5E18 F;  2QQB A;  2EK5 A;  4YG2 F;  2GAU A;  3EYY A;  2LSO A;  5DYM A;  1PP8 F;  4ZYH A;  4NHJ A;  1GVJ A;  3HIF A;  5FD6 A;  4I98 B;  1W7P B;  1IZ1 A;  2QUF A;  3JSP A;  2EFP A;  3L09 A;  3U1D A;  2KKO A;  3TDU C;  4ESF A;  5DCM B;  4M74 A;  3I59 A;  5ICE A;  4CXF A;  4IXA A;  5J8F A;  1R00 A;  2ESN A;  1OMI A;  1BC8 C;  3ECO A;  3RIR A;  1IUY A;  3HSF A;  3WOD F;  1XN7 A;  1EH6 A;  2ZFW A;  3G73 A;  4IJA A;  1TLH B;  1FT9 A;  1IXR C;  2XAJ A;  2DK5 A;  4Y17 A;  1ZRF A;  1WWX A;  2QBY A;  1R5G A;  3RKW A;  1XSV A;  3T0Y A;  4I7H A;  4EM0 B;  4RB3 C;  4HDU A;  3K9T A;  4G7O F;  1FZP B;  4HLY A;  3FF5 A;  2HYG D;  3MAJ A;  2LDU A;  1Q1H A;  5ICF A;  4L9N A;  2LNB A;  5E1W A;  2G7U A;  1FYM A;  2Q8K A;  4IPA A;  2XAG A;  4M71 A;  5K5Q A;  2DAO A;  4RGX A;  1MD0 A;  4ESJ A;  1ZN2 A;  1FBQ A;  2P5L C;  5EEH A;  2D1V A;  3P9K A;  3JW4 A;  4XSZ F;  5E1X A;  3I54 A;  5F64 A;  3LA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...