5IT3A

Swirm domain of human lsd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
85
structure length
85
Chain Sequence
LPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific histone demethylase 1A
publication title A Tlx-interacting peptide of Lsd1 inhibits the proliferation of brain tumor stem cells
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 29
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it3A00
5D8LB 2VC0A 5FO5A 2Y48A 3RKYA 3R6SA 3WU1B 3GF2A 4LMYA 1SD7A 2HKOA 3HTSB 3F3XA 2G7HA 4CYDA 2P8TA 3U1DA 2CO5A 5D5VB 1BIBA 1BC7C 2XASA 2ZXJA 4M73A 3REOA 3CDHA 2QZ8A 3F8NA 3ECOA 4L9TA 1JXSA 4CO8A 5ERIA 2DTRA 3F6OA 2AXLA 2P6SA 2K86A 1YLFA 3HRUA 5AONA 3F72A 5CVJA 3ZMTA 3EETA 3K0LA 3M1EA 4HV5A 3E5UA 5FFXA 4BHCA 1OYIA 5D5XB 1UHMA 3E6CC 4P9UA 1EV7A 2BGCA 3J81Z 3ZMUA 1LJ9A 1ZRDA 3EUHA 3SQNA 2ESNA 2KJCA 3DF8A 4ENNA 2VBXA 3HOTA 2YR2A 3WODF 1ZAOA 1WRJA 5FB2A 1YS7A 2P7VB 1IN5A 3L00A 2FEZA 3ZMVA 4KICA 2VODA 4ZH4F 4Y15A 1MGTA 4RGRA 5IT9K 5DD8A 3C1DA 3GWZA 2YX4A 3EDPA 2WC2A 3KLOA 4CGZA 4A5NA 2DQRA 2V79A 3M8EA 2ZMEA 1BOAA 1H9GA 5CVIA 2COMA 4JK1X 4S05A 3V8LA 4IVNA 2XIGA 4M9XA 1FBQA 3M8FA 1F5TA 2QWWA 4RGUA 3RKXA 1IN8A 3HYIA 3I54A 2ZKZA 1BI3A 3ML6A 4RB2C 5DEQA 3DKWA 3RYRA 2NAZA 5FD6A 5BPDA 1ZLKA 1U5TB 2VT2A 2RC4A 1YW8A 2FA5A 2YSRA 1IRGA 2QENA 3GX4X 3FM5A 2ELHA 4HLXA 3ZPLA 1BI2A 4N9IA 4FX4A 3IC7A 1ZARA 1OKRA 4ENMA 4U0YA 3P9IA 5CYVA 1B9NA 4KDPA 4WXHA 4G94A 5CJ9A 1T0FA 1YTYA 3RI4A 1FX7A 2DK8A 2PMUA 2KIFA 3E6MA 1BI1A 1OR7A 3R0AA 4LLNA 1NHAA 3KP2A 2HQRA 1QNTA 4L18B 4HA8A 2KIMA 2GQQA 3JAMZ 5K5RA 1J0RA 3LA3A 1R1UA 1T38A 1XGSA 2CGPA 2O61A 2PBIA 2Z9OA 2EFNA 2FXAA 1HW1A 1P6RA 1ZGAA 2W84A 3JTGA 1KGSA 4ESJA 1ZH5A 1ODDA 4EJWA 1KA8A 3LAPA 2DLLA 2FNAA 3R0JA 3KP4A 4GXOA 3LSTA 4IHSA 1XSXA 3JTHA 1UB9A 4WWCA 3WG9A 5D6FA 2WV0A 2L54A 3WE2A 1XDSA 3BDDA 4R8HA 1RIOH 4UVBA 2QQ9A 1RUNA 1U8RA 1TQIA 2FMLA 2NYXA 1P4WA 1G3TA 3KP6A 2E1NA 1GXPA 3L2CA 3J81K 2EFWA 2M1BA 3RDIA 3IWFA 3F22A 4HX4A 1IF1A 1KQ0A 3SFZA 5HS7A 1K78B 3I4PA 5FD5A 4U88A 1HW5A 4ASNA 2MC3A 2O8XA 2XGXA 3Q9SA 2D45A 1TBXA 4HF2A 2LNBA 3AAFA 2Q8KA 5A2QK 1KU7A 3TO6A 1GXQA 4A5MA 5L3EA 1IAWA 2W25A 1TNSA 1AOYA 4BAYA 2E7XA 1W7PA 4PDKA 4L9NA 4U0WA 2F2EA 3DEUA 2DO7A 1SMYF 1VTNC 5H6RA 3K1MA 4LG0A 3FX3A 3I59A 3T1BA 5ILVA 2PJPA 4MQVA 2Y75A 2MLGA 1S6LA 4WXDA 1F1ZA 5E1ZB 2HDCA 4GYGA 2QQBA 2O6GE 4MEXF 3BJOA 4P9FA 3DP7A 5BS6A 4L5JA 3ZQ7A 4CICA 1IW7F 3ERED 5FFZA 4I98B 2RDPA 1S29A 3WTYC 3CTAA 4CXFA 3T0YA 4RB3C 4ZYGA 3BY6A 4ON0A 3K1NA 2WWYA 4IJAA 2IRFG 3LA7A 5LEJA 4RB1A 1DUXC 5DD4A 1WWXA 4IPAA 5E20A 2EA4A 3GUDA 4KMFA 1KQ8A 2QBYB 2ZFWA 4EJOA 6PAXA 2ISYA 1PP7U 3SZPA 3JSPA 4BHBA 2ZNYA 4IXAA 2MBFA 1P92A 5IT9Z 4YFXF 1GHCA 2FMYA 2OU2A 2A5YB 3TO9A 4RGXA 4ZYHA 1K7AA 3JAMK 1MJAA 2EB7A 2MH9A 3D5LA 4IRIA 4MQ9F 1HKSA 3HHHA 1I1GA 2O03A 3SZTA 1P4XA 2R7FA 4AIJA 1O3QA 4XLNF 1UCRA 4HQEA 2D1HA 2L4MA 3HOSA 4LGWA 3IKTA 2JTVA 2PMHA 4MTEA 3HSFA 1RUOA 4IHTA 4LB6B 4IRHA 4KT5C 5LHHA 5EEGA 2RKHA 2G7UA 1TQPA 1UFMA 4AWXB 2FE3A 5LGUA 3PFIA 2V1XA 3KEQA 4O5VA 4Q5SF 4PCQA 2P5VA 1ZYRF 1Z9CA 2EJRA 4BH9A 1J2XA 1HXDA 2D2WA 1I6XA 2DT5A 2V1UA 1QZYA 2RGVA 2XV4S 1SFUA 2STWA 5CVUA 4A6EA 1S3JA 2JPCA 2ESHA 2UZKA 2IT0A 5ICGA 5J8CA 2FNPA 1YG2A 3ELKA 3J7AO 5HS8A 4HF1A 2F5CA 2GZWA 1P2FA 4O6JA 5DCMB 1R00A 2P4WA 3U2RA 4HBLA 1QGPA 2CFXA 1F4KA 3PQKA 5F1RA 2DPUA 1J59A 3VB2A 3NEUA 4RAZA 2F5DA 1LVAA 2VT3A 4FT8A 3JW4A 4M6YA 1W4MA 2MLKA 4M74A 3KETA 3CLOA 1YQAA 3KE2A 2L01A 3J80K 4KIFA 2EWNA 3LQQA 3LWFA 3W6JB 4BHPA 3JSOA 1AWCA 2L3DA 4YG2F 5EEHA 5D4RA 4LK0F 3OOPA 2X4HA 1K79A 4I02A 4L0YB 2HQNA 1STZA 1FYMA 5LEKA 2M87A 1XD7A 5E1WA 4ZZDA 4EGYA 1RZ4A 2W57A 3F23A 1FBUA 2XHKA 1SD5A 4M71A 3TQNA 1FBSA 4L0ZB 2ETHA 1V3FA 1T2KA 3R60A 2MD5A 3W6KB 2XVCA 2LF8A 4JQFA 3FMRA 1H9TA 1O7FA 1G3WA 2K7LA 1HQCA 1V4RA 3ULQB 1XMAA 4ENJA 4IRGA 3WTVC 4Y17A 3WGHA 2CYYA 2YPRA 3WTSC 5K5OA 5J6XA 4A12A 2J5PA 1WI9A 5L3FA 3T8TA 1FZPB 1ZG1A 1BI0A 5CVRA 5A2QZ 4HX8A 1REPC 3LA2A 2Q2EA 4U7DA 1IUYA 4EJVA 1XN7A 1EH6A 2XAHA 1BN5A 1IRFA 3E5QA 1ONVA 2ZCWA 2ADUA 3FM3A 3MCZA 1FPQA 4MGRA 1DDNA 3F6VA 4KUMA 4OOIA 4WXCA 4HV6A 4I01A 4QLCU 2CQKA 5D4SA 2PI0A 1S7AA 1Y0UA 2XROA 3TGNA 4G8XA 1ZN2A 2DAOA 2PG4A 1ON1A 1FWZA 5HS9A 3FZVA 3ZMDA 2HTJA 5E18F 4XLPF 3MWMA 1KU2A 2DK5A 1B1BA 2JSCA 3R4KA 3ZMSA 1D8KA 1W5SA 5HLIA 2GWRA 3C3WA 4UNOA 3L9FA 3IKVA 4RGSA 1LQ1A 2BV6A 2A6EF 2KJBA 2A69F 3GZ5A 3QP5A 1EH7A 1LEAA 3GFJA 2K27A 2O0YA 2IVMA 4KMUX 4N0BA 3F21A 4I0AA 3GYHX 1FT9A 4RB0A 4EM1A 2VE9A 4M6XA 5JHUA 2HYGD 2NNYA 3RYPA 5JI6A 2DPDA 5HDKA 1SD6A 2IA2A 3MEXA 2P6TA 4P5OA 2IPQX 1UHWA 1YS6A 2DFIA 1MDMA 3O3KA 2HKXA 2OQRA 4XRFA 2PN6A 4GYIA 3OV8A 1BJAA 2MA3A 2XAFA 4KA4A 4U0VA 2VE8A 5AIQA 2P5KA 1FOKA 1O7LA 2RVCA 3HHGA 3Q5FA 2GIVA 2ZMEB 2IW5A 4OMZA 2DBBA 5K5QA 1S7OA 1HSJA 1XSDA 1FYKA 4A0YA 2GA2A 3BP8A 1MD0A 4I0BA 3DXJF 2HOEA 2XUBA 3ZN1A 4A0ZA 5D8KB 5DUIA 1YYVA 2XAJA 4OINF 4GGGA 5KK1A 3ABTA 4B09A 2R3SA 3ABUA 1MJBA 1QQIA 2E7WA 2HS5A 1B59A 2ZO4A 1Z6TA 2Z33A 2D1VA 3WGIA 4DQ2A 4ESBA 3HTUA 5ICCA 2DW4A 4MEYF 1KU3A 4O3MA 1QZZA 2DQLA 2J5OA 1CF7A 1IN4A 4UVAA 2GAUA 3NQOA 4HW0A 1E2XA 3H3ZA 4KFCA 3J80Z 1O3TA 2ZBKA 4LFUA 4ZZLA 3FMSA 4PGGA 5DDGA 2H6BA 3IWZA 2GXBA 5E17F 3P7NA 3DQVC 3WU0A 4NQWA 3V7RA 1TW3A 2V9VA 3KLNA 4GCVA 5F6FA 2A68F 1EH8A 5DUKA 4UV8A 2QYOA 5ILUA 4HLYA 5E8GA 2OAZA 3CO7C 2M45A 2QVOA 2RV8A 4EQQA 4CHUA 4D0PA 4EJUA 2VBWA 3E97A 5L3DA 3CUQA 3IHUA 4I2OA 2VONA 2FSWA 2L02A 4P55A 3BPXA 2CW0F 1R1VA 1I5ZA 1SFEA 2ZNZA 3BWGA 3BZ6A 3KCCA 1QO0D 4ETSA 2Z99A 3MQ0A 5JFRA 1G3SA 4OIQF 3C18A 1MKMA 3E6DA 3N4MA 1SFXA 1A04A 2M8EA 2BE5F 3ZMZA 3MZYA 3FXUA 1LDKB 3LQRA 5H6QA 4WCGA 3EQLF 4CZZA 1OMIA 3EYIA 4WF2A 3E3VA 3M7GA 1SAXA 2E1CA 1BM9A 4LB5A 4M9ZA 2Q0OA 1XMKA 1Z1DA 5D5WB 2BEOA 2WTEA 4RAYA 1KYZA 4H0EA 3I0TA 4EM0B 4XBFA 1SMTA 1LB2A 3U9GA 4OU0A 2OZUA 2QM3A 1PDNC 2JZYA 1CGPA 1DPRA 3QRFF 2LDUA 1IXCA 2EV6A 4EVIA 5ED4A 1QPMA 1ULYA 3HIFA 2PEXA 2XKOA 3Q9VA 4LG0B 3F8CA 3I59B 3NRVA 2BYVE 3MFKA 2XAQA 2ISZA 1Q1HA 2M30A 4U7BA 3KFWX 2OQGA 1FSEA 1ZLJA 4HAMA 3H3UA 2F5EA 2HEOA 3DPTA 1ZGJA 2EK5A 4LK1F 2VXZA 1ZG5A 1ZRFA 1IXRC 3HRSA 4A2UA 4A0XA 4KN7X 1XGOA 2HTSA 3CUOA 1L3LA 1FLIA 5D6EA 4EMSA 5D5UB 2P5LC 3HRTA 4KYWA 3TO7A 3VODA 2TDXA 3B02A 4GO1A 2KIUA 4AD9A 3WGGA 4UV9A 3DPLC 4HYEA 5LRSA 3HRMA 1D5VA 2K4BA 1W7PD 4EV0A 1T98A 2FRHA 2F5FA 1D8JA 3GVAA 1USTA 1L0OC 3FMQA 1O3RA 4G6DA 2RN7A 1G6NA 1JHHA 5E1XA 2VOOA 4G7HF 5CLSA 4HX7A 1DP7P 5BOXA 4BYYA 2LF7A 3G3ZA 2VBYA 2OBPA 1K6OA 4AVPA 5DCFA 5E8IA 3DFGA 1BIAA 2OD5A 1C0WA 2QLZA 1Z91A 3D0SA 1YW7A 3V4GA 3VEPA 1U5TA 3TOBA 2Z5UA 4EJTA 2LSOA 3K9TA 2HFHA 1FP2A 2EA2A 2EFPA 1WKMA 4TV7A 1S8NA 4NHJA 3I64A 4OIPF 2A3SA 3GFLA 4YFNF 1PUEE 2NRAC 3GFIA 1KQ9A 4ESFA 2Y0MA 1WSUA 3M9AA 1WQ2A 4G7ZF 1I1SA 4OIRF 3KZZA 3T8RA 1PP8F 1QBJA 1YW9A 3COAC 1U2WA 3RTRA 5ILSA 2HR3A 4G9YA 3GXOA 3QPHA 2L4AA 2NNNA 3I5UA 4K2EA 4S04A 3GEZA 1ON2A 3DV8A 3KZYA 4YIIA 4UXNA 2IA0A 4Y13A 4L5IA 1T39A 4DNCA 5HLHA 1B4AA 1R23A 2YU3A 1J75A 1HKTA 2H6CA 1SD4A 2EV5A 2AS5F 3GFMA 1O57A 1F9NA 3R61A 1G3YA 2JRTA 1H0MA 2RNJA 5FGMA 2CG4A 1P4AA 4Q47A 4KN4X 3F8BA 2STTA 1FY7A 5LGNA 2YX7A 1FC3A 2QUFA 2IJLA 1R5HA 1U6GA 1KU9A 4FHTA 5LLQA 3CUQC 2VBZA 1RI7A 5FLXZ 3C7JA 1XDUA 3QPTA 4R1HA 2XRNA 1LEBA 4HZFA 3T5XA 3P9CA 1JGSA 2EFOA 1K78A 3GO5A 3G73A 2EV0A 2W85A 4EGZA 2KRFA 5J8FA 1U3EM 3HUGA 2G9WA 4NB5A 3ISPA 1HSTA 4ENKA 3CJNA 4HDVA 4PGHA 1R5GA 1RNLA 1XCBA 5KVRA 3MZHA 1BC8C 3IRQA 5ICEA 3HSEA 2UXNA 1HW2A 3L09A 4MHGA 3RKWA 3LAJA 1E17A 1IXSB 1BBYA 3LFKA 1TTYA 4P96A 1Z7UA 5BMZA 3BPVA 3F8MA 2K4JA 3KP5A 4L9VA 3MAJA 2VC1A 4R79A 5K1YA 5HVQC 4WK8F 5JR3A 2IA1A 2O3FA 1G4DA 3QP6A 3WTWC 4MTDA 4BNCA 2H94A 4B8XA 1FYLA 5BPIA 4AIHA 5CVVA 2QBYA 2EFQA 4OIOF 4XSXF 1D3YA 3N97A 2W24A 4UVCA 2FBIA 2Z3YA 1R7JA 4A6DA 3TDZC 3TKYA 2P7CB 3WTXC 3S2WA 3O2PE 4OMYA 2BBYA 2H09A 2A07F 3FWEA 2HGCA 4Q48A 3WTTC 2VN2A 3QOPA 1IN6A 4PZJA 3KEOA 2OA4A 5HDNA 1MJ9A 3GLXA 4XSZF 1XB4A 4L9JA 3GZ6A 1J5YA 3GW2A 1YFHA 1MDMB 1Z6RA 1XSVA 5HOOA 4RS8A 3KP3A 3BOQA 3E6BA 3IRRA 1LDJA 3PQJA 1TW2A 4G7OF 1YIOA 3FHZA 4WX9A 3CO6C 3QU6A 4G6QA 2FU4A 5TRDA 2H27A 1USSA 3I58A 4M9SA 1HBXG 2HWVA 1R36A 4KIBA 1U5TC 1XGMA 5LGTA 3V8KA 4N9HA 2R7DA 5LRRA 3RJPA 3ZN0A 4CDGA 3K2ZA 1OYYA 2UXXA 1HKQA 2CSOA 4BXUA 3ROUA 3L7WA 4IF4A 2CWEA 3SHFA 3RIRA 4E70A 5ICFA 3IL2A 3TOAA 5FLXK 2VOPA 2M5WA 5DCMA 3RPUA 3I53A 1B6AA 2JPBA 1YO5C 1R58A 4I09A 3WTUC 2GXGA 4KNYA 1T6SA 5AIPA 1ZG3A 1U78A 5IT3A 3VOEA 2ACJA 4M72A 5L3BA 4MNUA 2FQ3A 4JBAA 4HQMA 2DI3A 2PQ8A 1DPUA 5DV5A 1CF7B 3O6BB 2IP2A 1FP1D 2UWMA 1XCVA 4LLLA 2XAGA 3RPQA 2MH2A 1JHFA 2B0LA 1O3SA 3QAHA 1J7KA 2HZTA 1FNNA 3SXYA 4YFKF 1B9MA 1R22A 1W7PB 2ZJ2A 4KIGA 2NS0A 3KP7A 3TDUC 1OYWA 4FX0A 2V1DA 3ECHA 2DU9A 3V8JA 5HLGA 4YIFA 1GVJA 1MZBA 4LJZF 1LNWA 1R1TA 1ZREA 3F8FA 4UUVA 1W5TA 2XKPA 4ZYEA 4Q4ZF 1ZRCA 1J9IA 1KYWA 5JVTA 3FF5A 1TQMA 2K02A 2PFBA 3VFZA 4LD5A 2FBKA 4HOBA 5HDGA 4Z2YA 3FXQA 1IN7A 5DYMA 2HYFA 2LKPA 1Z05A 1XGNA 3B73A 3CUQB 3V7CA 3K1PA 4UHTA 2C6YA 2JT1A 2KKOA 4LLGF 4QWQA 1LDDA 2GA1A 2X0LA 2V6CA 4I7HA 1JE8A 2PLYA 5H20A 1TNTA 3K69A 4HDUA 5L3GA 1ZHFA 3WTZA 4HF0A 3WE3A 3BJAA 3ZP5A 4AIKA 5LHGA 2OZ6A 3I71A 5LHIA 4F7ZA 1I27A 4EM2A 5LBQA 2A61A 2A6HF 3FXRA 2RQPA 1X3UA 3QU3A 2FBHA 1OPCA 1FSHA 3E5XA 3P9KA 2QQAA 2FF4A 3BJ6A 3EYYA 1IZ1A 3HSRA 4ZYDA 3BROA 5L3CA 4BQAA 3V7SA 5F64A 5TJJA 2FOKA 1TLHB 5BQTA 3H92A
chains in the Genus database with same CATH superfamily
5D8LB 2VC0A 2ZXIA 2Y9ZA 5FO5A 1E3HA 2Y48A 3RKYA 3BTIA 3R6SA 3WU1B 3GF2A 4LMYA 1SD7A 3PO2J 1UG2A 2DA4A 2BVLA 2HKOA 3G4SI 1APLC 3HTSB 3F3XA 1G8XA 2G7HA 4CYDA 2P8TA 2CV0A 3J7ZI 3U1DA 2CO5A 5D5VB 1BIBA 1BC7C 2XASA 2ZXJA 4M73A 3REOA 3CDHA 2QZ8A 3F8NA 3ECOA 4L9TA 1JXSA 2L7KA 4CO8A 5ERIA 2DTRA 3F6OA 3GMEA 1FEXA 1YHQI 4DIQA 2AXLA 3VSLA 1QRYA 2P6SA 3F9KA 1VQOI 4YIRX 2K86A 1YLFA 2ZB9A 3ZGKA 3S16J 2NVXJ 3HRUA 5AONA 3F72A 5CVJA 3ZMTA 2LYCA 2KZVA 3EETA 3GTPJ 3K0LA 3M1EA 4HV5A 3E5UA 4LG3A 1YJ9I 4FE4A 4BY7J 5FFXA 1VQ5I 3GTGJ 4BHCA 1OYIA 1R4NB 5D5XB 2G0EA 3OS1A 1UHMA 2HXOA 2R7SA 1IRXA 5IOYA 4BBRJ 3E6CC 1WH7A 3AL0C 4P9UA 3ZOBA 1EV7A 3OY9A 3O8HA 2BGCA 3J81Z 3ZMUA 2DMQA 1LJ9A 1ZRDA 3EUHA 3SQNA 2ZFUA 2ESNA 2KJCA 1ETKA 3DF8A 2XDVA 5B1AH 2OV7A 4ENNA 2VBXA 3HOTA 2MFZA 2YR2A 3WODF 2K9LA 1ZAOA 5EZGA 4N4OB 1JT0A 2QQ8A 2VQHA 1WRJA 4FETA 5FB2A 1YS7A 2P7VB 3CCYA 2M7AA 1IN5A 3L00A 4FASD 2FEZA 3OYJA 1X58A 3ZMVA 1XPXA 5JHFA 4KICA 2VODA 4ZH4F 2VUMJ 3QPLA 2QA4I 1V5FA 1S7EA 4Y15A 1MBFA 1MGTA 2X6XA 4RGRA 5IT9K 3MVPA 1FMWA 5DD8A 3C1DA 3GWZA 2YX4A 2MC4A 3L2UA 4MIMA 3EDPA 2WC2A 3KLOA 4CGZA 2RAEA 4B3XA 4A5NA 4E6KG 2CJJA 1VQPI 2DQRA 3ABKH 2V79A 3M8EA 4A3KJ 3CESA 4MO7A 2ZMEA 1BOAA 1H9GA 5CVIA 5IPAA 2COMA 4JK1X 4S05A 5M3FJ 3V8LA 1X1AA 3LSJA 4IVNA 2XIGA 4M9XA 4XKVA 2IGOA 1T08B 1FBQA 1ZR4A 3GTQJ 2JK3A 4ZDOA 3M8FA 1F36A 1BJZA 1F5TA 2QWWA 3OR2C 2DA7A 2LC2A 4RGUA 1Y6IA 3MD2A 4IHXA 1HC8A 4C30A 3RKXA 2R93J 1IN8A 3HYIA 3I54A 2ZKZA 1BI3A 1M1EB 3ML6A 4RB2C 3KX2A 3G1LA 5DEQA 3DKWA 3RYRA 2NAZA 5FD6A 5BPDA 1ZLKA 2IXSA 4XLFA 1U5TB 1YOVB 2RC4A 2VT2A 2YU9J 1YW8A 2FA5A 2YSRA 1IRGA 3FXKA 3AG1H 2QENA 3ESWB 3GX4X 3FM5A 3G2BA 2V9PA 1VI0A 3G1MA 2BW3B 3DLLF 2ELHA 2XSJC 4HLXA 3ZPLA 1BI2A 4N9IA 3ZQFA 4FX4A 3IC7A 1ZARA 1OKRA 2JWTA 4ENMA 4U0YA 3K6GA 3P9IA 5CYVA 2R0QC 1B9NA 4OAYA 4KDPA 1SC7A 4WXHA 4G94A 5CJ9A 5F04A 1T0FA 1P7IA 2LR8A 1YTYA 3RI4A 2ID6A 1FX7A 4Y4RA 2DK8A 1JJ8C 5IOZA 4DZPA 2PMUA 2KIFA 2OCEA 3HPHA 1MBKA 3E6MA 1BI1A 1OR7A 4BJ5C 3GTMJ 3PUFA 1MMDA 3R0AA 4LLNA 1NHAA 1IJWC 3KP2A 1RR8C 2HQRA 1E3OC 3LSKA 2OC6A 2VPLA 1QNTA 1AA7A 4L18B 1SVOA 4HA8A 2E19A 2PX9A 3OYAA 4C2TA 3TEDA 2KIMA 2LY1A 1JJ6C 1QVUA 4A3CJ 1R6RA 2GQQA 2R4GA 3JAMZ 4G6TB 1TWFJ 3QPSA 3ZQQA 5K5RA 5H2FC 1J0RA 2E5NA 3LA3A 4BQNA 4M6VA 1UJ8A 4DJAA 3J7AY 5EYRA 2HU9A 1R1UA 4IOCF 1T38A 1XGSA 2CGPA 2O61A 2PBIA 2Z9OA 2EFNA 2FXAA 3GBGA 1VQ8I 1HW1A 3D5RC 1P6RA 1ZGAA 1T33A 2W84A 3JTGA 2W7NA 4YRVA 4UB8C 3HOXJ 2FD5A 2VJIA 1KGSA 4ESJA 1SVMA 3BG6A 1ZH5A 1EF4A 1ODDA 4EJWA 1OFCX 1KA8A 1SVLA 2ELKA 4W97A 3B6CA 1ZKGA 3LAPA 4RMNA 2DLLA 2FNAA 3R0JA 2K3PA 4OWRB 3L2RA 2O9LA 4RM3A 3K4NA 3KP4A 4GXOA 3LSTA 2EIJH 4IHSA 3L1PA 1XSXA 2L9NA 3ZQCA 4C2MJ 3JTHA 1UB9A 1RETA 4WWCA 3WG9A 5FJ8J 5D6FA 2WV0A 2F5VA 3P5JA 1VQ6I 4BL0B 2GM4A 4E4HA 2R7QA 3FK6A 2L54A 1Y1WJ 2QKMB 3WE2A 1XDSA 3BDDA 4ANJA 1X2MA 1AU7A 4R8HA 1RIOH 2NVYJ 4UVBA 3TL4X 2KISA 2QQ9A 1RUNA 1U8RA 1TQIA 3JCUC 1U9NA 2H1LA 1MMAA 2FMLA 3H1CA 4E7HA 5IYBJ 2NYXA 1DGWY 1U0JA 1P4WA 2WAQA 2DMTA 1G3TA 3KP6A 2E2IJ 1Y56A 2DDBA 2E1NA 2MABA 3A01A 1GXPA 2IGNA 4LIVA 3J81K 3AFHA 3L2CA 2EFWA 2M1BA 5M5WJ 2EQRA 3RDIA 3IWFA 3F22A 2VB6A 4HX4A 2M9HA 1IF1A 1KQ0A 2VPRA 1K4TA 3CC2I 4X1EA 3SFZA 2JUCA 1G59A 5HS7A 2LRDA 1K78B 3I4PA 5FD5A 4U88A 2PMZA 1TWCJ 3HM5A 1HW5A 4ASNA 1XS9A 2MC3A 2O8XA 2L7ZA 2XGXA 3Q9SA 2D45A 1X3ZB 2LMDA 1TBXA 4HF2A 2LNBA 3LNQA 3AAFA 3HUGB 2Q8KA 5A2QK 5JLXA 1KU7A 3TO6A 1GXQA 4A5MA 5L3EA 3SEQA 1IAWA 3E7LA 2W25A 1VQNI 3M4OJ 1TNSA 1AOYA 2M8GX 4E7KA 4BS9A 4BAYA 2E7XA 1W7PA 4PDKA 5GADJ 4L9NA 4DYCA 2DA5A 2HZDA 4U0WA 2F2EA 5KAIC 3DEUA 5CQEA 1XX5A 2CFOA 2DO7A 5J4VA 1ACIA 1SMYF 2CS3A 1VTNC 5H6RA 2W82A 5IP6A 3K1MA 4LG0A 2HVQA 2L2OA 3FX3A 3I59A 3W2AA 2LREA 3OYDA 3T1BA 5ILVA 2PJPA 2ZSHB 4MQVA 3DPUA 2JA2A 4PK4A 2Y75A 2MLGA 4JP0A 1S6LA 4Y7NJ 4WXDA 1F1ZA 5DS9A 5FRNA 5E1ZB 2XGCA 2HDCA 1SANA 3CCEI 3GTJJ 3U21A 2EINH 2AO9A 4GYGA 2QQBA 2O6GE 4MEXF 2Y31A 3BJOA 4JOMA 4P9FA 4QTRA 2IBDA 4ZYAA 3DP7A 5BS6A 4L5JA 3ZQ7A 5HODA 4Y52J 4LOCA 2A05A 4CICA 1OCCH 1IW7F 3JRCA 3ERED 2QEXI 3BG3A 4MLOA 2CV1A 5FFZA 3HPGA 4I98B 2RDPA 1IV8A 4XKBA 1S29A 3LOCA 1ETQA 3WTYC 2ICWG 2NXNB 4A3FJ 3KEYA 4UUSA 3OYBA 3CTAA 4CXFA 3T0YA 4RB3C 2DXIA 4ZYGA 3BY6A 4ON0A 3K1NA 2WWYA 4IJAA 2IRFG 2QCOA 2E2JJ 2ZXHA 2GIZA 3LA7A 5LEJA 4RB1A 1AKHA 1DUXC 3H36A 2HXIA 2DT6A 5DD4A 2HI3A 3CC7I 1WWXA 4IPAA 5E20A 4JX6A 2DMUA 2EA4A 3GUDA 4KMFA 3AL0B 1FIAA 1KQ8A 3MN2A 2QBYB 2ZFWA 4EJOA 2ELJA 4D9JA 3W6VA 3OYEA 6PAXA 2ISYA 1PP7U 1HDPA 3SZPA 3VYTB 3JSPA 4BHBA 2Q1ZB 2E35A 2Y0SA 1R71A 4IHYA 2ZNYA 4IXAA 2MBFA 4IKFA 1P92A 2KL4A 4PFPA 5IT9Z 3EUHC 3M07A 3G6EI 4YFXF 2DFEA 1GHCA 1A6QA 2HVSA 2FMYA 2OU2A 2QSFX 1P9QC 4B4CA 1LFBA 1IUFA 2A5YB 4BXFA 3TO9A 1H89C 4RGXA 4ZYHA 4A3BJ 4RLQA 5IYDJ 1DU0A 1K7AA 2X1CA 2VJJA 4XRSA 2IGMA 2XPVA 1UELB 2LH9A 3JAMK 4C2UA 1JKPC 1D0ZA 1MJAA 2L7MP 2EB7A 1K83J 3FKIJ 2MH9A 3D5LA 4IRIA 4MQ9F 1HKSA 3HHHA 1I1GA 2O03A 3H35A 3SZTA 1P4XA 1WJAA 2R7FA 5J1RA 4AIJA 1O3QA 4XLNF 1UCRA 5FKKA 4HQEA 2D1HA 2L4MA 4LGWA 3IKTA 3HOSA 2JTVA 2PMHA 4MTEA 3HSFA 1RUOA 1VNDA 4IHTA 2R7WA 2EZIA 4IHWA 1N25A 1CQTA 2ZMEC 3WU2C 3LSRA 4RAFA 1MW7A 4LB6B 2DYRH 4IRHA 4KT5C 4XN3A 5LHHA 3S2HJ 5EEGA 2NVTJ 2RKHA 3HG9A 2IS2A 2G7UA 1TQPA 1UFMA 2W00A 4AWXB 2EILH 4IOAF 2FE3A 3W2WA 3PFIA 5LGUA 2V1XA 3KEQA 1A36A 3S2DJ 4O5VA 1O4XA 2BY2A 2NVQJ 4Q5SF 1FOYA 1TWAJ 3K2AA 2XF6A 3OIPA 4PCQA 2LKSA 4D7NA 1FOXA 2P5VA 4CYCB 5HLTA 1ZYRF 1Z9CA 1D1AA 1MNMC 3CDLA 2EJRA 4BH9A 1J2XA 2DFFA 4PUSA 2R92J 5LD2C 1NTCA 1HXDA 2D2WA 1I6XA 2DT5A 2V1UA 3Q0WA 4F52A 1QZYA 2KDZA 2RGVA 3K4JA 3OYIA 1BW6A 2XV4S 4BE2A 1BW5A 4QPQA 2KT0A 1SFUA 1TT0A 2STWA 4C3JJ 5CVUA 3HC7A 3DBRB 2X85A 1HA8A 2E5ZA 2MYSA 4A6EA 1S3JA 2JPCA 2ESHA 2UZKA 1W0UA 3GTOJ 2IT0A 5ICGA 5J8CA 1IRZA 4BEHA 2FNPA 4CCOA 9ANTA 5IY5H 5EGOB 2XPWA 2LVSA 3DLAA 3MKLA 1YG2A 3ELKA 4W1UA 4A69C 4BU2A 4NC6A 3PFYA 2OF7A 3J7AO 5HS8A 1YRNA 4HF1A 1IDZA 1T0FC 2F5CA 1WVRA 1P2FA 2GZWA 4HBLA 1R00A 2P4WA 4O6JA 5DCMB 3U2RA 1QGPA 2CFXA 1F4KA 3PQKA 5F1RA 2DPUA 3ABMH 3CJQB 2AQEA 1J59A 3VB2A 1JGGA 2MSYA 3L2WA 1P7JA 2I8DA 3NEUA 4U87A 2M2EA 4RAZA 4M3BA 1OR7C 3OYCA 3PO3J 2F5DA 1WFXA 1QVTA 1LVAA 3LL7A 1R4MB 3I4NJ 2DOFA 2VT3A 1Z0XA 3PIPF 3CMYA 4M3DA 4FT8A 2V26A 3CLQA 3JW4A 4JX4A 4M6YA 1W4MA 1R9TJ 3I55I 2MLKA 2DJIA 4M74A 1LVKA 3BR1A 3KETA 1MIJA 3CLOA 1YQAA 3KE2A 2L01A 3OIOA 3J80K 4KIFA 3CCRI 4BJTA 2EWNA 3LQQA 3LWFA 3BR3A 3FK7A 3H9QA 4XLCA 4QSHA 3W6JB 3LSPA 4XQFA 3L2QA 5DTDA 1Y8QB 4HSTA 2OTJI 4BHPA 3UR3C 3JSOA 1AWCA 2PJRA 1GLNA 3C2GA 2L3DA 4YG2F 5EEHA 5D4RA 3CJTB 2Z16A 4LK0F 3OOPA 4XOPA 2X4HA 2VKDA 1MMNA 4I02A 4F3QA 1K79A 3JRFA 4S0HB 2F4OB 3CDIA 4XMYA 4L0YB 3CP8A 2HNHA 2BZTA 3BG7A 5GAHJ 5M3MJ 2HQNA 3CZ6A 1I3AA 1STZA 1FYMA 5LEKA 1V5GA 3ZRGA 2M87A 1NG7A 1XD7A 5E1WA 1POGA 4ZZDA 3W2VA 4CCNA 5KCMA 3RPUD 4EGYA 1JTYA 1RZ4A 2W57A 3F23A 3GTLJ 5IP9J 1FBUA 2XHKA 4HPQA 3M3YJ 3S1RJ 3K7AJ 1SD5A 3EPZA 4M71A 3TQNA 3DBLB 5EG0A 4PJMA 1MSEC 1FBSA 5FKOA 2R7RA 2ETHA 4L0ZB 1V3FA 1T2KA 1XG1A 2ZJQF 3R60A 5GP9A 1B72B 3HGGA 2MD5A 1B8IA 3QYBA 1HOMA 3W6KB 3KPHA 1WPKA 2F4IA 1UMQA 2XVCA 1X1BA 1JUMA 3BT9A 2LF8A 4XOTA 5FKMA 4JQFA 3FMRA 3S8PA 5GAEJ 4BGDA 1H9TA 1ZELA 1O7FA 2QSGX 1G3WA 2K7LA 4UUTA 1HQCA 1VQMI 1JKRC 1V4RA 3ULQB 3WG7H 3HKZA 2KHMA 5TISC 1XMAA 5C3EJ 1RRJA 4ENJA 2R5YA 4IRGA 3WTVC 3ERMA 4Y17A 3SFIA 3WGHA 3DTIA 4A3IJ 2CYYA 3IUOA 4JX5A 1UG0A 4CSWA 2YUSA 1WH5A 2YPRA 3FDYA 3WTSC 5K5OA 1LFUP 1K6YA 5J6XA 1OCTC 4E7LA 4A12A 2J5PA 3E1SA 1WI9A 3RSNA 1GT0C 3NARA 5L3FA 3T8TA 1FZPB 1RPWA 1Z3YA 1ZG1A 3RQ4A 1BI0A 5CVRA 5A2QZ 4HX8A 1REPC 2K3FA 3LA2A 1FJLA 1MBJA 2Q2EA 4U7DA 1N77A 1TT5B 1YX5A 1HF0A 1IUYA 4EJVA 3JRAA 1XN7A 1EH6A 1Y1VJ 2XAHA 3DEWA 4C9YA 3DU6A 2LK2A 1BN5A 5B1BH 1WJBA 3CD6I 1IRFA 2WAEA 5GTIC 3E5QA 2M4GA 2V1NA 5E3LA 1Z67A 1ONVA 2ZCWA 2ADUA 2AXTC 5F08A 4CCKA 3FM3A 2KDOA 3MCZA 2WB1N 2VJ4A 2NVUB 1FPQA 4MGRA 4LIUA 1DDNA 3F6VA 4KUMA 1ENHA 5E3NA 2DMNA 2LOOA 1OCZH 4OOIA 4WXCA 4PJLA 1Z77A 4HV6A 4I01A 4DBRA 4QLCU 1TL8A 2CQKA 1YE9A 2DOAA 3QYEA 5D4SA 2PI0A 1S7AA 1Y0UA 3PUBA 2XROA 3HOUJ 3TGNA 4G8XA 1ZN2A 2DAOA 2PG4A 1ON1A 1UAAA 3DU5A 1FWZA 5K7FA 1YJNI 1HCRA 5HS9A 1X3WB 3FZVA 3ZMDA 4DBQA 2HTJA 5E18F 4XLPF 3MWMA 2ECCA 3BTLA 1KU2A 4XONA 2DK5A 1OLTA 3TW7A 2OPTA 3GZNB 1B1BA 2JSCA 2P0WA 3R4KA 1FIPA 3ZMSA 2IS1A 1D8KA 3OMYA 2IGKA 5GTHC 3JREA 1W5SA 3NAUA 5HLIA 1I39A 5EF6A 3OYHA 4YELA 2GWRA 3C3WA 4Y33A 4UNOA 3L9FA 3IKVA 2R7OA 4RGSA 1LQ1A 2BV6A 2A6EF 2KJBA 2A69F 2LG4A 3GZ5A 3QP5A 3RCOA 4B44A 1EH7A 2X6YA 4XLHA 3SYTA 3PNYA 2QF7A 1LEAA 3GFJA 2K27A 2X6OA 2O0YA 2VJ5A 4KJZA 2IVMA 4P1WA 1FMVA 4PFOA 4KMUX 4N0BA 3F21A 4I0AA 1IDYA 3FBIB 3GYHX 1W5CC 5C4XJ 3H0GJ 1KONA 4AYBN 3LSIA 1FT9A 4RB0A 3FHNA 3CQZJ 2E2HJ 4EM1A 2VE9A 4M6XA 2DOEA 2E1MC 4ABZA 5JHUA 4FE7A 1LUJB 2HYGD 2NNYA 4PJNA 3BTJA 3RYPA 5JI6A 2DPDA 3UNGC 5HDKA 1SD6A 2IA2A 3MEXA 2P6TA 4P5OA 2IPQX 4E7JA 1UHWA 1YS6A 2V6EA 2DFIA 2XF5A 1MDMA 1WHUA 4DZJA 3O3KA 2HKXA 2KRHA 2OQRA 4XRFA 4ZJZA 1BA5A 2PN6A 4GYIA 3OV8A 1BJAA 2CRGA 2MA3A 1V55H 2XAFA 4V2GA 4KA4A 4U0VA 2UV1A 2VE8A 3W3CA 2P81A 4XLEA 2CU7A 5AIQA 2P5KA 3GLLA 1N75A 1FOKA 1O7LA 3S14J 2RVCA 1VQLI 4RAGA 2MG4A 3HHGA 3Q5FA 5EEAA 4AIDA 2GOXB 2GIVA 1NH3A 2ZMEB 1VQ9I 2DDAA 2IW5A 4OMZA 4BUPA 2DBBA 4B47A 5K5QA 4EEFG 3FXMA 4D5CA 1W0TA 3BZKA 1S7OA 1HSJA 1XSDA 1OCPA 3S1NJ 3HZJA 1FYKA 4A0YA 1BR4A 2GA2A 3BP8A 4II3A 1KZHA 1MD0A 4I0BA 3DXJF 2HOEA 2XUBA 5IYCJ 3MKYB 3ZN1A 3ASOH 2GXAA 2GLOA 4A0ZA 4AUXA 1MBEA 5D8KB 1PJRA 2X51A 5DUIA 1YYVA 4IQJA 2XPUA 5KNLA 4AC0A 2XAJA 4OINF 4GGGA 2JA7J 5KK1A 3ABTA 4B09A 4BQOA 3I56I 2R3SA 2Y2ZA 1LE8A 3ABUA 1MJBA 5JVGF 3TW6A 1QQIA 5TGTA 3HOZJ 1TP4A 2DMPA 2E7WA 2FUG2 1RC9A 2HS5A 2QKLB 1B59A 2XAUA 3OYKA 2ZO4A 4IEJA 4XORA 1Z6TA 5EDNA 3TBIA 2Z33A 1X4PA 2D1VA 3JRGA 3ZCOA 4GFBA 4BBSJ 2ZC2A 3WGIA 4DQ2A 4BACA 2LBFA 4ESBA 5CPRB 2X1EA 2Z2SB 3HTUA 5ICCA 2DW4A 5K7HA 1RKWA 4MEYF 1K61A 4B48A 3A03A 1ORKA 1GDTA 4L5EA 1KU3A 3G1OA 1QZZA 2DQLA 4NC7A 4O3MA 2J5OA 1CF7A 1IN4A 3OIQA 4UVAA 5KHDA 2GAUA 5HNHA 2DFHA 1XC5A 3NQOA 2DN0A 2V9KA 3CCLI 1X1DA 4HW0A 1E2XA 2I5UA 3GCMA 3H3ZA 1VQ4I 1TZLA 4KFCA 3J80Z 1O3TA 4LITA 2JN6A 1UHSA 2JRMA 4XR6A 5J47A 4ZDPA 2ZBKA 4LFUA 4ZZLA 2XSDC 3FMSA 4PGGA 5B66C 4I99C 1I3QJ 3K4MA 5DDGA 4XN0A 1U9OA 4BE1A 2H6BA 3IWZA 3BCAA 1MH4A 2GXBA 5E17F 3P7NA 2K9MA 3DQVC 4E7SA 3WU0A 2M7BA 2WBMA 4NQWA 2EPFA 3CJRB 3V7RA 1TW3A 2MW8A 3BR6A 5M5XJ 2V9VA 1G2HA 3DTEA 3KLNA 4KITB 4GCVA 4CCMA 2TCTA 5F6FA 2A68F 2JA5J 4RA2A 2F48A 1EH8A 4HRIA 5DUKA 4UV8A 1VQKI 2R7XA 1Y39A 3ABLH 4DW6A 2QYOA 2WV1A 3IH2A 5ILUA 4HLYA 3OS2A 3Q0VA 5E8GA 2OAZA 3CO7C 2M45A 2QVOA 4NNJA 4DYQA 1N78A 3D5SC 2HOSA 4X0GA 5E3MA 1QHHD 2RV8A 4EQQA 4CHUA 3C2HA 4RM2A 4D0PA 4EJUA 2LTPA 2RQQA 2VBWA 3CMMA 2WY8Q 3E97A 5L3DA 1LPQA 3L2VA 4PJJA 1ETXA 2BY1A 3CUQA 3IHUA 3VSKA 5J1UA 1JKQC 1I50J 4I2OA 1PUFA 2VONA 2FSWA 2L02A 4P55A 3BCBA 3BPXA 2CW0F 1R1VA 1I5ZA 1SFEA 2ZNZA 3BWGA 3BZ6A 2XB5A 2CQXA 3S1QJ 4J19A 3KCCA 1QO0D 4ETSA 2Z99A 4HNUA 3K70C 3MQ0A 2R5ZB 5JFRA 1G3SA 4OIQF 3C18A 3RZOJ 2H8WA 3CF2A 1MKMA 3E6DA 3N4MA 3VYRB 1RESA 1SFXA 1A04A 2M8EA 3MZ8A 2BE5F 3HL2A 1ETWA 3ZMZA 2IS6A 3MZYA 4E7IA 4RLFA 3ZQLA 3FXUA 3PSIA 1LDKB 3LQRA 1SAUA 1XMXA 5H6QA 4WCGA 3A01B 4BXXJ 3EQLF 4CZZA 1OMIA 1EA3A 2OCCH 3EYIA 3HOWJ 2R7UA 3RQIA 4WF2A 3E3VA 3D1NI 3M7GA 1A35A 1SAXA 2E1CA 1BM9A 3H0DA 4LB5A 4M9ZA 2Q0OA 1ETVA 1XMKA 1Z1DA 5D5WB 2BEOA 4IO9F 2JMWA 2E34A 2WTEA 2DTZA 4RAYA 5E3OA 1YITI 1ZGWA 2VQCA 1KYZA 3KYDB 1IC8A 4H0EA 3I0TA 4EM0B 3HXLA 5CQGA 4XBFA 1SMTA 2Y69H 1LB2A 3U9GA 3ZQIA 4OU0A 2OZUA 2PMZN 2QM3A 2HPMA 5F27A 1PDNC 3FXJA 3HB9A 1W1WE 2DA6A 2JZYA 1CGPA 3PNTA 1DPRA 3QRFF 2LDUA 1IXCA 4J00A 2EV6A 4EVIA 5ED4A 3BC8A 1QPMA 1ULYA 3BR0A 3HIFA 2Z1DA 2PEXA 3WHCA 1OCOH 2XKOA 4PSWA 1BOBA 3Q9VA 4M3EA 3F8CA 4LG0B 3SDBA 1MMGA 2ME0A 3I59B 2BYVE 3NRVA 4EATA 3MFKA 4XKWA 2XAQA 5CKTA 3HDDA 2ISZA 1Q1HA 2M30A 4U7BA 3KFWX 2OQGA 1FSEA 3Q0UA 2BY3A 2ZSIB 4A3DJ 1ZLJA 1R5ID 4V19K 4HAMA 3H3UA 2F5EA 2HEOA 2XRLA 4CCLA 2L9RA 3DPTA 1TWGJ 4G12A 1ZGJA 2JVHA 2EK5A 4LK1F 2EH3A 2VXZA 1D1BA 1ZG5A 5E79C 1ZRFA 1IXRC 3HRSA 3A2KA 4A2UA 3IP4B 4A0XA 4KN7X 1XGOA 2HTSA 3CUOA 1L3LA 1U8BA 5F0FA 1FLIA 2KLOA 4KT6A 4UUSB 1Y8RB 5D6EA 4EMSA 5D5UB 2P5LC 3HRTA 4KYWA 3TO7A 3VODA 2TDXA 3B02A 3GTKJ 2VKEA 2HDWA 4GO1A 3I9V2 2KIUA 4AD9A 1AKHB 3WGGA 5J3LA 4UV9A 4A3EJ 1WJCA 1OISA 2DA3A 3OYFA 2E1MB 3DPLC 4HYEA 2DJNA 3LSGA 3UKGA 4A3MJ 2LP0A 1MNDA 1WGXA 2RREA 2XGDA 3HRMA 5LRSA 1D5VA 2K4BA 4BJ6C 1T8IA 1W7PD 1LFPA 4EV0A 1T98A 5KAFC 2GOMA 3ONQA 1WJDA 2FRHA 2F5FA 3M1CA 2F6CA 3S3NA 2HDDA 1D8JA 1QHGA 3GVAA 1USTA 1L0OC 2HPIA 3FMQA 1O3RA 4G6DA 4XKCA 3U1KA 2RN7A 1G6NA 1JHHA 2M34A 5E1XA 3ASNH 1JKOC 2VOOA 1GUUA 4I6ZA 4G7HF 2COBA 5CLSA 1MNEA 4HX7A 2H8RA 1DP7P 3VPRA 3F0CA 5BOXA 4A93J 2FX0A 2B63J 4BYYA 2LF7A 3VYUB 3G3ZA 2VBYA 2VXDA 1ITYA 2OBPA 3IAM2 4AVPA 1K6OA 5DCFA 5E8IA 3DFGA 4J01A 1BIAA 1UZCA 3BTCA 2OD5A 2JA8J 5GAGJ 3TMOA 1C0WA 2VI6A 2QLZA 5B5EC 1Z91A 3D0SA 4A3GJ 1YW7A 3V4GA 3HJEA 3KZIC 2WA0A 3VEPA 2ECBA 1U5TA 2TRTA 1ETOA 3TOBA 2Z5UA 2DT7B 4KISA 4EJTA 2L0KA 2LSOA 5EZHA 2ZJRF 3K9TA 4ZC3A 2BHZA 2IEKA 5C44J 1DP3A 2HFHA 2IAIA 1FP2A 2EA2A 2EFPA 2H1KA 1WKMA 2BW3A 5J1YA 1Z7LA 3CCMI 2DODA 4TV7A 1S8NA 4NHJA 3VDXA 3OS0A 1MMSA 3OL4A 2XF7A 5DM7F 3I64A 3IV5A 3S3OA 4OIPF 3A1YA 1HDDC 1HLVA 4CZCA 2A3SA 2M0MA 3GFLA 3QWLA 2I10A 3ZR8X 2K5CA 3OSFA 4YFNF 1PUEE 2CQ7A 4AYBA 4PSXA 2CV2A 2NRAC 2CW8A 3DEEA 3GFIA 1KQ9A 4ESFA 1OCRH 2NOJB 1Y0NA 2FJ1A 2KRCA 2XGEA 2Y0MA 2HQ5A 1WSUA 2L7FP 1ETYA 3M9AA 4MFDA 4QPOA 1WQ2A 1NK3P 4G7ZF 4BKXA 1I1SA 4XLAA 2JSPA 4OIRF 2NOGA 1JI8A 3KZZA 2CQNA 2VL8A 3T8RA 3FXLA 4F91B 1PVEA 1OJLA 1PP8F 4UY8I 1QBJA 1YW9A 3COAC 2CUFA 1U2WA 3RTRA 2W4SA 3JRHA 4IZZA 3K4BA 5ILSA 2HR3A 2K85A 3JRDA 4G9YA 3GXOA 4BEHB 4RDUA 2B7EA 3QPHA 2L4AA 2NNNA 3CF5F 3JR9A 3I5UA 1ZR2A 1YRNB 4K2EA 4S04A 1X1CA 1JTXA 3GEZA 1ON2A 3DV8A 3KZYA 4YIIA 1J09A 3H5NA 4UXNA 1MBHA 4M3GA 4QIWN 2DYSH 2IA0A 5FROA 3CCSI 3A0BC 4Y13A 4L5IA 1T39A 4UB6C 3OYNA 4DNCA 5HLHA 1B4AA 3MKWB 1W36C 1YJWI 1R23A 2YU3A 1J75A 4F93B 1V5EA 2ZJPF 3K4KA 3CMEI 4XL9A 3DKYA 2OTLI 1A5JA 3HOVJ 1HKTA 2LKXA 5K7ZA 2EIMH 2E1OA 2H6CA 3LSHA 1SD4A 4V2FA 4H4KC 2EV5A 2AS5F 1DU6A 1Z3XA 2KZGA 3AKZA 1TWHJ 4FQGA 3GFMA 2L9SA 1O57A 1F9NA 2AHQA 3R61A 1G3YA 1FTZA 4FISA 4FCYA 2JRTA 3H5AA 3MMYB 3Q3SA 3QQAA 2DCEA 2A6TA 3C2BA 1H0MA 2RNJA 5FGMA 2CG4A 3OSGA 1E0EA 1P4AA 3G71I 4Q47A 5FKLA 3F8BA 3FBNB 4KN4X 1FY7A 4JYKA 1K4SA 2STTA 3PJRA 1WI3A 2CUJA 4M3FA 1LKXA 5LGNA 2BHYA 2MGQA 2YX7A 1FC3A 3DBHB 5M5YJ 2QUFA 2IJLA 2JVGA 1R5HA 1U6GA 1VFCA 2LY9A 1KU9A 4FHTA 2HVRA 3PSFA 4YEJA 5LLQA 4BDZA 1Z21A 4CUGA 3CUQC 2VBZA 1RI7A 2CQQA 3DTKA 5EG0B 5FLXZ 3C7JA 3BZCA 2LY2A 1XDUA 1MBGA 3QPTA 3RZDJ 4R1HA 2XRNA 4B3AA 1LEBA 4HZFA 1WJEA 3T5XA 1DQUA 1B8IB 1NK2P 2YS9A 3P9CA 1JGSA 2EFOA 1K78A 3GO5A 3BLYA 4NBQA 3HGYA 4HG2A 2CUZA 4AU7A 2PJRB 2W1OA 2E71A 3G73A 2EV0A 2W85A 4OAZA 4EGZA 2R5YB 2KRFA 2F4MB 5J8FA 1U3EM 3HUGA 3DWLE 2HOAA 3HKZN 2N8GA 2G9WA 4NB5A 3ISPA 4CA0A 1HSTA 5HNFA 3OR1C 2K40A 4ENKA 3CJNA 4HDVA 3LSMA 4PGHA 5FKNA 1S72I 1S9HA 1R5GA 1IGNA 3VWBA 1RNLA 1XCBA 4IQ4A 5KVRA 2ZXWH 3MZHA 1BC8C 3IRQA 1TC3C 5ICEA 2Q2EB 3HSEA 2UXNA 1HW2A 3L09A 4MHGA 3RKWA 1QPIA 3LFUA 1BR2A 3EUKL 3LAJA 1V54H 4X6AJ 1BR1A 1IXSB 1E17A 2EZKA 5FLVA 1BBYA 2E60A 5GPAA 2KPMA 1A6IA 2GBYA 1QU3A 2BOLA 3LMMA 2OUMA 4D5FA 3H9JA 2FOWA 3LFKA 2HQAA 1TTYA 4P96A 1GV5A 4GRIA 1Z7UA 3K70D 3OL3A 5BMZA 3BPVA 3F8MA 2K4JA 3KP5A 4L9VA 3MAJA 1T95A 2KFDA 3BR5A 2VC1A 4R79A 5K1YA 2EIKH 5HVQC 4WK8F 1ZQ3P 2HOTA 5J40A 3HBLA 2LD5A 5JR3A 1IO2A 2IA1A 2O3FA 3A02A 1G4DA 3QP6A 3WTWC 4DOZA 4MTDA 4BNCA 2A5WA 2H94A 4B8XA 2O8KA 1MSFC 3E0JB 1FTTA 4Y3OA 1FYLA 5BPIA 2X9DA 2R7VA 1QA6A 4PJ0C 4AIHA 5CVVA 2QBYA 1YI2I 2EFQA 1X1PA 2BY0A 4XRMA 4OIOF 4AM3A 4XSXF 1D3YA 2W24A 2R5ZA 3N97A 4UVCA 2FBIA 4IX7A 2Z3YA 1R7JA 2JJ7A 5LFAA 1D1CA 2K9QA 4A6DA 2O5RA 3TDZC 3BG9A 3PNVA 3TKYA 4NC8A 3KIOA 2JUGA 2P7CB 5F1JA 4F55A 3WTXC 3S2WA 4B1RA 3O2PE 3QODA 4OMYA 5BNGA 3ZQGA 4BQQA 3FIWA 4ZDLA 2BBYA 2H09A 3I4MJ 2A07F 1E3PA 3FWEA 3CCJI 5F0CA 2HGCA 4Q48A 3A0HC 3WTTC 2VN2A 3QOPA 2X6WA 2O7OA 4RBOA 1IN6A 4PZJA 2K9SA 2FQ4A 3KEOA 2OA4A 4ITVA 5GPCA 5HDNA 5EJCA 3SEZA 2VKVA 1MJ9A 1NG6A 3GLXA 4XSZF 3S17J 1XB4A 3IAS2 4L9JA 1S5LC 3GZ6A 1J5YA 3GW2A 3CCVI 1YFHA 1Z6RA 1MDMB 3DKXA 3B6AA 3HEFA 1XSVA 5HOOA 4RS8A 2X48A 3KP3A 1IG7A 2CH0A 2AQFA 3PM1A 3BOQA 2V4JC 3E6BA 3IRRA 2BXYA 1LDJA 4D1QA 3PQJA 3O8GA 5FRMA 1TW2A 1AHDP 4XIDA 5C4JJ 3S3MA 4G7OF 3H3VK 1YIOA 2XB0X 3FHZA 3JRIA 2HYJA 3IH3A 4WX9A 3CO6C 3QU6A 4G6QA 2FU4A 3FISA 4CYCA 5TRDA 1SFOJ 2H27A 1USSA 1H88C 5B3SH 3I58A 3IH4A 4M9SA 3H9GA 3OYGA 1HBXG 1H8AC 2HWVA 4IL6C 1R36A 2OJED 3FKJA 4KIBA 1U5TC 3PIOF 1X19A 1XGMA 2KIQA 5LGTA 3S93A 3S1MJ 2VIXA 3V8KA 4N9HA 2R7DA 5LRRA 3RJPA 3ZN0A 4CDGA 3K2ZA 1OYYA 2UXXA 1HKQA 3ZXSA 1D0XA 2CSOA 4BXUA 4FTHA 4XK4A 3ROUA 3L7WA 3N05A 1X4OA 3K10A 4IF4A 3BG5A 2CWEA 3SHFA 3OWTA 3RIRA 3CC4I 1QZEA 2RNGA 3BQZA 1LE8B 4E70A 1WZ2A 5EGOA 5ICFA 4A3JJ 2BVMA 3IL2A 1ZK8A 5J4YA 2VQLA 1GV2A 4N4NB 3TOAA 3H5RA 5FLXK 2UUZA 3SJMA 2VOPA 2M5WA 5DCMA 3RPUA 3I53A 5DM6F 1B6AA 1A31A 2JPBA 1JUPA 1YO5C 4D7MA 1R58A 4I09A 1MH3A 3WTUC 2WAQN 4F92B 2GXGA 1WJ5A 4HNTA 3CP2A 4NUBA 4DGWB 4KNYA 2LFBA 1RKTA 1T6SA 1SEUA 5AIPA 2LBFB 4GDFA 2CMPA 1ZG3A 1U78A 5IT3A 3VOEA 2ACJA 4M72A 5L3BA 4CCJA 2K9NA 1ZTRA 3K4LA 4MNUA 1ERDA 4HEA2 2FQ3A 2LLKA 2W48A 4JBAA 4HQMA 2DI3A 2PQ8A 1DPUA 2MD0A 5DV5A 3RKQA 1CF7B 4XICA 3O6BB 4BY1J 1I6HJ 4ZTFA 2IP2A 2ME6A 2DA2A 2EZLA 1FP1D 2XC7A 2UWMA 1XCVA 4IHVA 4LLLA 2WY7Q 2XAGA 3RPQA 2MH2A 4BDYA 4XNFA 1JHFA 3X2QH 4ZTJA 1YX3A 3SZGA 2B0LA 4XM3A 3ZQHA 3QAHA 1O3SA 2R7TA 3BR2A 1J7KA 1VZ0A 3NWTA 3A4CA 2HZTA 1FNNA 3SXYA 1JT6A 4YFKF 1B9MA 1GVDA 1R22A 1XTAA 3DCFA 1W7PB 3SDGA 5JLWA 2VLAA 2ZJ2A 4C3IJ 4KIGA 1YIJI 3NWSA 2NS0A 3AG4H 3VYSB 2KQRA 3KP7A 3TDUC 4NQWB 2WAFA 3PL8A 3OYMA 1OYWA 1R49A 1OQYA 2V1DA 4FX0A 3ECHA 2M3AA 1BL0A 2DU9A 3V8JA 1Q1VA 1GVJA 2VQGA 1MZBA 1RR7A 4C3HJ 4LJZF 4YIFA 5HLGA 1LNWA 2NS8A 1R1TA 1ZREA 1VF9A 3F8FA 3I3LA 3WHBA 2B9SA 4UUVA 3AG2H 3AG3H 2JA6J 3S15J 1W5TA 2VKHA 2XKPA 4ZYEA 2BXZA 4B43A 4Q4ZF 1ZRCA 1J9IA 2X1DA 1KYWA 5JVTA 3FF5A 1TQMA 2K02A 5F0HA 2PFBA 3KYCB 4LD5A 3VFZA 1B72A 2V7FA 2FBKA 2CUEA 4HOBA 5HDGA 2Y30A 4Z2YA 3FXQA 4CH7A 3K4CA 4I76A 3V42A 1IN7A 5DYMA 2HYFA 2LKPA 1DGRM 1Z05A 2IS4A 1WCMJ 2CW7A 1XGNA 3B73A 3CUQB 3V7CA 3K1PA 2L5QA 3FXOA 4UHTA 2C6YA 2WADA 3J7YJ 3KYLA 1PUFB 4NDLA 3CCQI 1EJ9A 4AVZA 2JT1A 3CMAI 1JUSA 1D5YA 2KKOA 4LLGF 4QWQA 1LDDA 2GA1A 4MFEA 1W36D 1SFKA 2X0LA 2V6CA 4I7HA 2M4KA 1JE8A 2PLYA 3MKZA 1VQ7I 4II2A 5H20A 1IV6A 2JQ7A 2KMUA 3OYLA 4A3LJ 1TNTA 2DA1A 3K69A 3TP0A 2QGUA 4HNVA 2D5VA 2L9VA 4DYRA 1F43A 4BE0A 4HDUA 3M8JA 3OOUA 1T56A 3JRBA 5L3GA 3QYFA 1ZHFA 3WTZA 2Y9YA 2Y0SN 1X2NA 4XRSG 2EZHA 2EBIA 5FLMJ 3CCUI 2QSHX 4HSRA 4HF0A 3WE3A 2WB1A 3BJAA 3ZP5A 4AIKA 5LHGA 2OZ6A 3I71A 3S32A 5LHIA 4F7ZA 1I27A 4EM2A 5LBQA 5IP7J 1FOWA 2A61A 4Z6YA 3QOEA 2A6HF 2ID3A 2RQPA 3FXRA 1X3UA 3QU3A 2FBHA 1OPCA 1FSHA 3HOYJ 3E5XA 1EKEA 3P9KA 2QQAA 3TP3A 1WJFA 2FF4A 3BJ6A 3EYYA 4E7ZA 2E36A 1IZ1A 3HSRA 1D0YA 4ZYDA 3BQYA 3BROA 2M0CA 5L3CA 3EUAA 4BQAA 3V7SA 2KP6A 2NS7A 5F64A 5TJJA 2FOKA 1TLHB 2VASA 5BQTA 2R7ZJ 1PYVA 3H92A
chains in the Genus database with same CATH topology
5D8LB 2VC0A 5FO5A 2Y48A 3RKYA 3R6SA 3WU1B 3GF2A 4LMYA 1SD7A 2HKOA 3HTSB 3F3XA 2G7HA 4CYDA 2P8TA 3U1DA 2CO5A 5D5VB 1BIBA 1BC7C 2XASA 2ZXJA 4M73A 3REOA 3CDHA 2QZ8A 3F8NA 3ECOA 4L9TA 1JXSA 4CO8A 5ERIA 2DTRA 3F6OA 2AXLA 2P6SA 2K86A 1YLFA 3HRUA 5AONA 3F72A 5CVJA 3ZMTA 3EETA 3K0LA 3M1EA 4HV5A 3E5UA 5FFXA 4BHCA 1OYIA 5D5XB 1UHMA 3E6CC 4P9UA 1EV7A 2BGCA 3J81Z 3ZMUA 1LJ9A 1ZRDA 3EUHA 3SQNA 2ESNA 2KJCA 3DF8A 4ENNA 2VBXA 3HOTA 2YR2A 3WODF 1ZAOA 1WRJA 5FB2A 1YS7A 2P7VB 1IN5A 3L00A 2FEZA 3ZMVA 4KICA 2VODA 4ZH4F 4Y15A 1MGTA 4RGRA 5IT9K 5DD8A 3C1DA 3GWZA 2YX4A 3EDPA 2WC2A 3KLOA 4CGZA 4A5NA 2DQRA 2V79A 3M8EA 2ZMEA 1BOAA 1H9GA 5CVIA 2COMA 4JK1X 4S05A 3V8LA 4IVNA 2XIGA 4M9XA 1FBQA 3M8FA 1F5TA 2QWWA 4RGUA 3RKXA 1IN8A 3HYIA 3I54A 2ZKZA 1BI3A 3ML6A 4RB2C 5DEQA 3DKWA 3RYRA 2NAZA 5FD6A 5BPDA 1ZLKA 1U5TB 2VT2A 2RC4A 1YW8A 2FA5A 2YSRA 1IRGA 2QENA 3GX4X 3FM5A 2ELHA 4HLXA 3ZPLA 1BI2A 4N9IA 4FX4A 3IC7A 1ZARA 1OKRA 4ENMA 4U0YA 3P9IA 5CYVA 1B9NA 4KDPA 4WXHA 4G94A 5CJ9A 1T0FA 1YTYA 3RI4A 1FX7A 2DK8A 2PMUA 2KIFA 3E6MA 1BI1A 1OR7A 3R0AA 4LLNA 1NHAA 3KP2A 2HQRA 1QNTA 4L18B 4HA8A 2KIMA 2GQQA 3JAMZ 5K5RA 1J0RA 3LA3A 1R1UA 1T38A 1XGSA 2CGPA 2O61A 2PBIA 2Z9OA 2EFNA 2FXAA 1HW1A 1P6RA 1ZGAA 2W84A 3JTGA 1KGSA 4ESJA 1ZH5A 1ODDA 4EJWA 1KA8A 3LAPA 2DLLA 2FNAA 3R0JA 3KP4A 4GXOA 3LSTA 4IHSA 1XSXA 3JTHA 1UB9A 4WWCA 3WG9A 5D6FA 2WV0A 2L54A 3WE2A 1XDSA 3BDDA 4R8HA 1RIOH 4UVBA 2QQ9A 1RUNA 1U8RA 1TQIA 2FMLA 2NYXA 1P4WA 1G3TA 3KP6A 2E1NA 1GXPA 3L2CA 3J81K 2EFWA 2M1BA 3RDIA 3IWFA 3F22A 4HX4A 1IF1A 1KQ0A 3SFZA 5HS7A 1K78B 3I4PA 5FD5A 4U88A 1HW5A 4ASNA 2MC3A 2O8XA 2XGXA 3Q9SA 2D45A 1TBXA 4HF2A 2LNBA 3AAFA 2Q8KA 5A2QK 1KU7A 3TO6A 1GXQA 4A5MA 5L3EA 1IAWA 2W25A 1TNSA 1AOYA 4BAYA 2E7XA 1W7PA 4PDKA 4L9NA 4U0WA 2F2EA 3DEUA 2DO7A 1SMYF 1VTNC 5H6RA 3K1MA 4LG0A 3FX3A 3I59A 3T1BA 5ILVA 2PJPA 4MQVA 2Y75A 2MLGA 1S6LA 4WXDA 1F1ZA 5E1ZB 2HDCA 4GYGA 2QQBA 2O6GE 4MEXF 3BJOA 4P9FA 3DP7A 5BS6A 4L5JA 3ZQ7A 4CICA 1IW7F 3ERED 5FFZA 4I98B 2RDPA 1S29A 3WTYC 3CTAA 4CXFA 3T0YA 4RB3C 4ZYGA 3BY6A 4ON0A 3K1NA 2WWYA 4IJAA 2IRFG 3LA7A 5LEJA 4RB1A 1DUXC 5DD4A 1WWXA 4IPAA 5E20A 2EA4A 3GUDA 4KMFA 1KQ8A 2QBYB 2ZFWA 4EJOA 6PAXA 2ISYA 1PP7U 3SZPA 3JSPA 4BHBA 2ZNYA 4IXAA 2MBFA 1P92A 5IT9Z 4YFXF 1GHCA 2FMYA 2OU2A 2A5YB 3TO9A 4RGXA 4ZYHA 1K7AA 3JAMK 1MJAA 2EB7A 2MH9A 3D5LA 4IRIA 4MQ9F 1HKSA 3HHHA 1I1GA 2O03A 3SZTA 1P4XA 2R7FA 4AIJA 1O3QA 4XLNF 1UCRA 4HQEA 2D1HA 2L4MA 3HOSA 4LGWA 3IKTA 2JTVA 2PMHA 4MTEA 3HSFA 1RUOA 4IHTA 4LB6B 4IRHA 4KT5C 5LHHA 5EEGA 2RKHA 2G7UA 1TQPA 1UFMA 4AWXB 2FE3A 5LGUA 3PFIA 2V1XA 3KEQA 4O5VA 4Q5SF 4PCQA 2P5VA 1ZYRF 1Z9CA 2EJRA 4BH9A 1J2XA 1HXDA 2D2WA 1I6XA 2DT5A 2V1UA 1QZYA 2RGVA 2XV4S 1SFUA 2STWA 5CVUA 4A6EA 1S3JA 2JPCA 2ESHA 2UZKA 2IT0A 5ICGA 5J8CA 2FNPA 1YG2A 3ELKA 3J7AO 5HS8A 4HF1A 2F5CA 2GZWA 1P2FA 4O6JA 5DCMB 1R00A 2P4WA 3U2RA 4HBLA 1QGPA 2CFXA 1F4KA 3PQKA 5F1RA 2DPUA 1J59A 3VB2A 3NEUA 4RAZA 2F5DA 1LVAA 2VT3A 4FT8A 3JW4A 4M6YA 1W4MA 2MLKA 4M74A 3KETA 3CLOA 1YQAA 3KE2A 2L01A 3J80K 4KIFA 2EWNA 3LQQA 3LWFA 3W6JB 4BHPA 3JSOA 1AWCA 2L3DA 4YG2F 5EEHA 5D4RA 4LK0F 3OOPA 2X4HA 1K79A 4I02A 4L0YB 2HQNA 1STZA 1FYMA 5LEKA 2M87A 1XD7A 5E1WA 4ZZDA 4EGYA 1RZ4A 2W57A 3F23A 1FBUA 2XHKA 1SD5A 4M71A 3TQNA 1FBSA 4L0ZB 2ETHA 1V3FA 1T2KA 3R60A 2MD5A 3W6KB 2XVCA 2LF8A 4JQFA 3FMRA 1H9TA 1O7FA 1G3WA 2K7LA 1HQCA 1V4RA 3ULQB 1XMAA 4ENJA 4IRGA 3WTVC 4Y17A 3WGHA 2CYYA 2YPRA 3WTSC 5K5OA 5J6XA 4A12A 2J5PA 1WI9A 5L3FA 3T8TA 1FZPB 1ZG1A 1BI0A 5CVRA 5A2QZ 4HX8A 1REPC 3LA2A 2Q2EA 4U7DA 1IUYA 4EJVA 1XN7A 1EH6A 2XAHA 1BN5A 1IRFA 3E5QA 1ONVA 2ZCWA 2ADUA 3FM3A 3MCZA 1FPQA 4MGRA 1DDNA 3F6VA 4KUMA 4OOIA 4WXCA 4HV6A 4I01A 4QLCU 2CQKA 5D4SA 2PI0A 1S7AA 1Y0UA 2XROA 3TGNA 4G8XA 1ZN2A 2DAOA 2PG4A 1ON1A 1FWZA 5HS9A 3FZVA 3ZMDA 2HTJA 5E18F 4XLPF 3MWMA 1KU2A 2DK5A 1B1BA 2JSCA 3R4KA 3ZMSA 1D8KA 1W5SA 5HLIA 2GWRA 3C3WA 4UNOA 3L9FA 3IKVA 4RGSA 1LQ1A 2BV6A 2A6EF 2KJBA 2A69F 3GZ5A 3QP5A 1EH7A 1LEAA 3GFJA 2K27A 2O0YA 2IVMA 4KMUX 4N0BA 3F21A 4I0AA 3GYHX 1FT9A 4RB0A 4EM1A 2VE9A 4M6XA 5JHUA 2HYGD 2NNYA 3RYPA 5JI6A 2DPDA 5HDKA 1SD6A 2IA2A 3MEXA 2P6TA 4P5OA 2IPQX 1UHWA 1YS6A 2DFIA 1MDMA 3O3KA 2HKXA 2OQRA 4XRFA 2PN6A 4GYIA 3OV8A 1BJAA 2MA3A 2XAFA 4KA4A 4U0VA 2VE8A 5AIQA 2P5KA 1FOKA 1O7LA 2RVCA 3HHGA 3Q5FA 2GIVA 2ZMEB 2IW5A 4OMZA 2DBBA 5K5QA 1S7OA 1HSJA 1XSDA 1FYKA 4A0YA 2GA2A 3BP8A 1MD0A 4I0BA 3DXJF 2HOEA 2XUBA 3ZN1A 4A0ZA 5D8KB 5DUIA 1YYVA 2XAJA 4OINF 4GGGA 5KK1A 3ABTA 4B09A 2R3SA 3ABUA 1MJBA 1QQIA 2E7WA 2HS5A 1B59A 2ZO4A 1Z6TA 2Z33A 2D1VA 3WGIA 4DQ2A 4ESBA 3HTUA 5ICCA 2DW4A 4MEYF 1KU3A 4O3MA 1QZZA 2DQLA 2J5OA 1CF7A 1IN4A 4UVAA 2GAUA 3NQOA 4HW0A 1E2XA 3H3ZA 4KFCA 3J80Z 1O3TA 2ZBKA 4LFUA 4ZZLA 3FMSA 4PGGA 5DDGA 2H6BA 3IWZA 2GXBA 5E17F 3P7NA 3DQVC 3WU0A 4NQWA 3V7RA 1TW3A 2V9VA 3KLNA 4GCVA 5F6FA 2A68F 1EH8A 5DUKA 4UV8A 2QYOA 5ILUA 4HLYA 5E8GA 2OAZA 3CO7C 2M45A 2QVOA 2RV8A 4EQQA 4CHUA 4D0PA 4EJUA 2VBWA 3E97A 5L3DA 3CUQA 3IHUA 4I2OA 2VONA 2FSWA 2L02A 4P55A 3BPXA 2CW0F 1R1VA 1I5ZA 1SFEA 2ZNZA 3BWGA 3BZ6A 3KCCA 1QO0D 4ETSA 2Z99A 3MQ0A 5JFRA 1G3SA 4OIQF 3C18A 1MKMA 3E6DA 3N4MA 1SFXA 1A04A 2M8EA 2BE5F 3ZMZA 3MZYA 3FXUA 1LDKB 3LQRA 5H6QA 4WCGA 3EQLF 4CZZA 1OMIA 3EYIA 4WF2A 3E3VA 3M7GA 1SAXA 2E1CA 1BM9A 4LB5A 4M9ZA 2Q0OA 1XMKA 1Z1DA 5D5WB 2BEOA 2WTEA 4RAYA 1KYZA 4H0EA 3I0TA 4EM0B 4XBFA 1SMTA 1LB2A 3U9GA 4OU0A 2OZUA 2QM3A 1PDNC 2JZYA 1CGPA 1DPRA 3QRFF 2LDUA 1IXCA 2EV6A 4EVIA 5ED4A 1QPMA 1ULYA 3HIFA 2PEXA 2XKOA 3Q9VA 4LG0B 3F8CA 3I59B 3NRVA 2BYVE 3MFKA 2XAQA 2ISZA 1Q1HA 2M30A 4U7BA 3KFWX 2OQGA 1FSEA 1ZLJA 4HAMA 3H3UA 2F5EA 2HEOA 3DPTA 1ZGJA 2EK5A 4LK1F 2VXZA 1ZG5A 1ZRFA 1IXRC 3HRSA 4A2UA 4A0XA 4KN7X 1XGOA 2HTSA 3CUOA 1L3LA 1FLIA 5D6EA 4EMSA 5D5UB 2P5LC 3HRTA 4KYWA 3TO7A 3VODA 2TDXA 3B02A 4GO1A 2KIUA 4AD9A 3WGGA 4UV9A 3DPLC 4HYEA 5LRSA 3HRMA 1D5VA 2K4BA 1W7PD 4EV0A 1T98A 2FRHA 2F5FA 1D8JA 3GVAA 1USTA 1L0OC 3FMQA 1O3RA 4G6DA 2RN7A 1G6NA 1JHHA 5E1XA 2VOOA 4G7HF 5CLSA 4HX7A 1DP7P 5BOXA 4BYYA 2LF7A 3G3ZA 2VBYA 2OBPA 1K6OA 4AVPA 5DCFA 5E8IA 3DFGA 1BIAA 2OD5A 1C0WA 2QLZA 1Z91A 3D0SA 1YW7A 3V4GA 3VEPA 1U5TA 3TOBA 2Z5UA 4EJTA 2LSOA 3K9TA 2HFHA 1FP2A 2EA2A 2EFPA 1WKMA 4TV7A 1S8NA 4NHJA 3I64A 4OIPF 2A3SA 3GFLA 4YFNF 1PUEE 2NRAC 3GFIA 1KQ9A 4ESFA 2Y0MA 1WSUA 3M9AA 1WQ2A 4G7ZF 1I1SA 4OIRF 3KZZA 3T8RA 1PP8F 1QBJA 1YW9A 3COAC 1U2WA 3RTRA 5ILSA 2HR3A 4G9YA 3GXOA 3QPHA 2L4AA 2NNNA 3I5UA 4K2EA 4S04A 3GEZA 1ON2A 3DV8A 3KZYA 4YIIA 4UXNA 2IA0A 4Y13A 4L5IA 1T39A 4DNCA 5HLHA 1B4AA 1R23A 2YU3A 1J75A 1HKTA 2H6CA 1SD4A 2EV5A 2AS5F 3GFMA 1O57A 1F9NA 3R61A 1G3YA 2JRTA 1H0MA 2RNJA 5FGMA 2CG4A 1P4AA 4Q47A 4KN4X 3F8BA 2STTA 1FY7A 5LGNA 2YX7A 1FC3A 2QUFA 2IJLA 1R5HA 1U6GA 1KU9A 4FHTA 5LLQA 3CUQC 2VBZA 1RI7A 5FLXZ 3C7JA 1XDUA 3QPTA 4R1HA 2XRNA 1LEBA 4HZFA 3T5XA 3P9CA 1JGSA 2EFOA 1K78A 3GO5A 3G73A 2EV0A 2W85A 4EGZA 2KRFA 5J8FA 1U3EM 3HUGA 2G9WA 4NB5A 3ISPA 1HSTA 4ENKA 3CJNA 4HDVA 4PGHA 1R5GA 1RNLA 1XCBA 5KVRA 3MZHA 1BC8C 3IRQA 5ICEA 3HSEA 2UXNA 1HW2A 3L09A 4MHGA 3RKWA 3LAJA 1E17A 1IXSB 1BBYA 3LFKA 1TTYA 4P96A 1Z7UA 5BMZA 3BPVA 3F8MA 2K4JA 3KP5A 4L9VA 3MAJA 2VC1A 4R79A 5K1YA 5HVQC 4WK8F 5JR3A 2IA1A 2O3FA 1G4DA 3QP6A 3WTWC 4MTDA 4BNCA 2H94A 4B8XA 1FYLA 5BPIA 4AIHA 5CVVA 2QBYA 2EFQA 4OIOF 4XSXF 1D3YA 3N97A 2W24A 4UVCA 2FBIA 2Z3YA 1R7JA 4A6DA 3TDZC 3TKYA 2P7CB 3WTXC 3S2WA 3O2PE 4OMYA 2BBYA 2H09A 2A07F 3FWEA 2HGCA 4Q48A 3WTTC 2VN2A 3QOPA 1IN6A 4PZJA 3KEOA 2OA4A 5HDNA 1MJ9A 3GLXA 4XSZF 1XB4A 4L9JA 3GZ6A 1J5YA 3GW2A 1YFHA 1MDMB 1Z6RA 1XSVA 5HOOA 4RS8A 3KP3A 3BOQA 3E6BA 3IRRA 1LDJA 3PQJA 1TW2A 4G7OF 1YIOA 3FHZA 4WX9A 3CO6C 3QU6A 4G6QA 2FU4A 5TRDA 2H27A 1USSA 3I58A 4M9SA 1HBXG 2HWVA 1R36A 4KIBA 1U5TC 1XGMA 5LGTA 3V8KA 4N9HA 2R7DA 5LRRA 3RJPA 3ZN0A 4CDGA 3K2ZA 1OYYA 2UXXA 1HKQA 2CSOA 4BXUA 3ROUA 3L7WA 4IF4A 2CWEA 3SHFA 3RIRA 4E70A 5ICFA 3IL2A 3TOAA 5FLXK 2VOPA 2M5WA 5DCMA 3RPUA 3I53A 1B6AA 2JPBA 1YO5C 1R58A 4I09A 3WTUC 2GXGA 4KNYA 1T6SA 5AIPA 1ZG3A 1U78A 5IT3A 3VOEA 2ACJA 4M72A 5L3BA 4MNUA 2FQ3A 4JBAA 4HQMA 2DI3A 2PQ8A 1DPUA 5DV5A 1CF7B 3O6BB 2IP2A 1FP1D 2UWMA 1XCVA 4LLLA 2XAGA 3RPQA 2MH2A 1JHFA 2B0LA 1O3SA 3QAHA 1J7KA 2HZTA 1FNNA 3SXYA 4YFKF 1B9MA 1R22A 1W7PB 2ZJ2A 4KIGA 2NS0A 3KP7A 3TDUC 1OYWA 4FX0A 2V1DA 3ECHA 2DU9A 3V8JA 5HLGA 4YIFA 1GVJA 1MZBA 4LJZF 1LNWA 1R1TA 1ZREA 3F8FA 4UUVA 1W5TA 2XKPA 4ZYEA 4Q4ZF 1ZRCA 1J9IA 1KYWA 5JVTA 3FF5A 1TQMA 2K02A 2PFBA 3VFZA 4LD5A 2FBKA 4HOBA 5HDGA 4Z2YA 3FXQA 1IN7A 5DYMA 2HYFA 2LKPA 1Z05A 1XGNA 3B73A 3CUQB 3V7CA 3K1PA 4UHTA 2C6YA 2JT1A 2KKOA 4LLGF 4QWQA 1LDDA 2GA1A 2X0LA 2V6CA 4I7HA 1JE8A 2PLYA 5H20A 1TNTA 3K69A 4HDUA 5L3GA 1ZHFA 3WTZA 4HF0A 3WE3A 3BJAA 3ZP5A 4AIKA 5LHGA 2OZ6A 3I71A 5LHIA 4F7ZA 1I27A 4EM2A 5LBQA 2A61A 2A6HF 3FXRA 2RQPA 1X3UA 3QU3A 2FBHA 1OPCA 1FSHA 3E5XA 3P9KA 2QQAA 2FF4A 3BJ6A 3EYYA 1IZ1A 3HSRA 4ZYDA 3BROA 5L3CA 4BQAA 3V7SA 5F64A 5TJJA 2FOKA 1TLHB 5BQTA 3H92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8L B;  2VC0 A;  5FO5 A;  2Y48 A;  3RKY A;  3R6S A;  3WU1 B;  3GF2 A;  4LMY A;  1SD7 A;  2HKO A;  3HTS B;  3F3X A;  2G7H A;  4CYD A;  2P8T A;  3U1D A;  2CO5 A;  5D5V B;  1BIB A;  1BC7 C;  2XAS A;  2ZXJ A;  4M73 A;  3REO A;  3CDH A;  2QZ8 A;  3F8N A;  3ECO A;  4L9T A;  1JXS A;  4CO8 A;  5ERI A;  2DTR A;  3F6O A;  2AXL A;  2P6S A;  2K86 A;  1YLF A;  3HRU A;  5AON A;  3F72 A;  5CVJ A;  3ZMT A;  3EET A;  3K0L A;  3M1E A;  4HV5 A;  3E5U A;  5FFX A;  4BHC A;  1OYI A;  5D5X B;  1UHM A;  3E6C C;  4P9U A;  1EV7 A;  2BGC A;  3J81 Z;  3ZMU A;  1LJ9 A;  1ZRD A;  3EUH A;  3SQN A;  2ESN A;  2KJC A;  3DF8 A;  4ENN A;  2VBX A;  3HOT A;  2YR2 A;  3WOD F;  1ZAO A;  1WRJ A;  5FB2 A;  1YS7 A;  2P7V B;  1IN5 A;  3L00 A;  2FEZ A;  3ZMV A;  4KIC A;  2VOD A;  4ZH4 F;  4Y15 A;  1MGT A;  4RGR A;  5IT9 K;  5DD8 A;  3C1D A;  3GWZ A;  2YX4 A;  3EDP A;  2WC2 A;  3KLO A;  4CGZ A;  4A5N A;  2DQR A;  2V79 A;  3M8E A;  2ZME A;  1BOA A;  1H9G A;  5CVI A;  2COM A;  4JK1 X;  4S05 A;  3V8L A;  4IVN A;  2XIG A;  4M9X A;  1FBQ A;  3M8F A;  1F5T A;  2QWW A;  4RGU A;  3RKX A;  1IN8 A;  3HYI A;  3I54 A;  2ZKZ A;  1BI3 A;  3ML6 A;  4RB2 C;  5DEQ A;  3DKW A;  3RYR A;  2NAZ A;  5FD6 A;  5BPD A;  1ZLK A;  1U5T B;  2VT2 A;  2RC4 A;  1YW8 A;  2FA5 A;  2YSR A;  1IRG A;  2QEN A;  3GX4 X;  3FM5 A;  2ELH A;  4HLX A;  3ZPL A;  1BI2 A;  4N9I A;  4FX4 A;  3IC7 A;  1ZAR A;  1OKR A;  4ENM A;  4U0Y A;  3P9I A;  5CYV A;  1B9N A;  4KDP A;  4WXH A;  4G94 A;  5CJ9 A;  1T0F A;  1YTY A;  3RI4 A;  1FX7 A;  2DK8 A;  2PMU A;  2KIF A;  3E6M A;  1BI1 A;  1OR7 A;  3R0A A;  4LLN A;  1NHA A;  3KP2 A;  2HQR A;  1QNT A;  4L18 B;  4HA8 A;  2KIM A;  2GQQ A;  3JAM Z;  5K5R A;  1J0R A;  3LA3 A;  1R1U A;  1T38 A;  1XGS A;  2CGP A;  2O61 A;  2PBI A;  2Z9O A;  2EFN A;  2FXA A;  1HW1 A;  1P6R A;  1ZGA A;  2W84 A;  3JTG A;  1KGS A;  4ESJ A;  1ZH5 A;  1ODD A;  4EJW A;  1KA8 A;  3LAP A;  2DLL A;  2FNA A;  3R0J A;  3KP4 A;  4GXO A;  3LST A;  4IHS A;  1XSX A;  3JTH A;  1UB9 A;  4WWC A;  3WG9 A;  5D6F A;  2WV0 A;  2L54 A;  3WE2 A;  1XDS A;  3BDD A;  4R8H A;  1RIO H;  4UVB A;  2QQ9 A;  1RUN A;  1U8R A;  1TQI A;  2FML A;  2NYX A;  1P4W A;  1G3T A;  3KP6 A;  2E1N A;  1GXP A;  3L2C A;  3J81 K;  2EFW A;  2M1B A;  3RDI A;  3IWF A;  3F22 A;  4HX4 A;  1IF1 A;  1KQ0 A;  3SFZ A;  5HS7 A;  1K78 B;  3I4P A;  5FD5 A;  4U88 A;  1HW5 A;  4ASN A;  2MC3 A;  2O8X A;  2XGX A;  3Q9S A;  2D45 A;  1TBX A;  4HF2 A;  2LNB A;  3AAF A;  2Q8K A;  5A2Q K;  1KU7 A;  3TO6 A;  1GXQ A;  4A5M A;  5L3E A;  1IAW A;  2W25 A;  1TNS A;  1AOY A;  4BAY A;  2E7X A;  1W7P A;  4PDK A;  4L9N A;  4U0W A;  2F2E A;  3DEU A;  2DO7 A;  1SMY F;  1VTN C;  5H6R A;  3K1M A;  4LG0 A;  3FX3 A;  3I59 A;  3T1B A;  5ILV A;  2PJP A;  4MQV A;  2Y75 A;  2MLG A;  1S6L A;  4WXD A;  1F1Z A;  5E1Z B;  2HDC A;  4GYG A;  2QQB A;  2O6G E;  4MEX F;  3BJO A;  4P9F A;  3DP7 A;  5BS6 A;  4L5J A;  3ZQ7 A;  4CIC A;  1IW7 F;  3ERE D;  5FFZ A;  4I98 B;  2RDP A;  1S29 A;  3WTY C;  3CTA A;  4CXF A;  3T0Y A;  4RB3 C;  4ZYG A;  3BY6 A;  4ON0 A;  3K1N A;  2WWY A;  4IJA A;  2IRF G;  3LA7 A;  5LEJ A;  4RB1 A;  1DUX C;  5DD4 A;  1WWX A;  4IPA A;  5E20 A;  2EA4 A;  3GUD A;  4KMF A;  1KQ8 A;  2QBY B;  2ZFW A;  4EJO A;  6PAX A;  2ISY A;  1PP7 U;  3SZP A;  3JSP A;  4BHB A;  2ZNY A;  4IXA A;  2MBF A;  1P92 A;  5IT9 Z;  4YFX F;  1GHC A;  2FMY A;  2OU2 A;  2A5Y B;  3TO9 A;  4RGX A;  4ZYH A;  1K7A A;  3JAM K;  1MJA A;  2EB7 A;  2MH9 A;  3D5L A;  4IRI A;  4MQ9 F;  1HKS A;  3HHH A;  1I1G A;  2O03 A;  3SZT A;  1P4X A;  2R7F A;  4AIJ A;  1O3Q A;  4XLN F;  1UCR A;  4HQE A;  2D1H A;  2L4M A;  3HOS A;  4LGW A;  3IKT A;  2JTV A;  2PMH A;  4MTE A;  3HSF A;  1RUO A;  4IHT A;  4LB6 B;  4IRH A;  4KT5 C;  5LHH A;  5EEG A;  2RKH A;  2G7U A;  1TQP A;  1UFM A;  4AWX B;  2FE3 A;  5LGU A;  3PFI A;  2V1X A;  3KEQ A;  4O5V A;  4Q5S F;  4PCQ A;  2P5V A;  1ZYR F;  1Z9C A;  2EJR A;  4BH9 A;  1J2X A;  1HXD A;  2D2W A;  1I6X A;  2DT5 A;  2V1U A;  1QZY A;  2RGV A;  2XV4 S;  1SFU A;  2STW A;  5CVU A;  4A6E A;  1S3J A;  2JPC A;  2ESH A;  2UZK A;  2IT0 A;  5ICG A;  5J8C A;  2FNP A;  1YG2 A;  3ELK A;  3J7A O;  5HS8 A;  4HF1 A;  2F5C A;  2GZW A;  1P2F A;  4O6J A;  5DCM B;  1R00 A;  2P4W A;  3U2R A;  4HBL A;  1QGP A;  2CFX A;  1F4K A;  3PQK A;  5F1R A;  2DPU A;  1J59 A;  3VB2 A;  3NEU A;  4RAZ A;  2F5D A;  1LVA A;  2VT3 A;  4FT8 A;  3JW4 A;  4M6Y A;  1W4M A;  2MLK A;  4M74 A;  3KET A;  3CLO A;  1YQA A;  3KE2 A;  2L01 A;  3J80 K;  4KIF A;  2EWN A;  3LQQ A;  3LWF A;  3W6J B;  4BHP A;  3JSO A;  1AWC A;  2L3D A;  4YG2 F;  5EEH A;  5D4R A;  4LK0 F;  3OOP A;  2X4H A;  1K79 A;  4I02 A;  4L0Y B;  2HQN A;  1STZ A;  1FYM A;  5LEK A;  2M87 A;  1XD7 A;  5E1W A;  4ZZD A;  4EGY A;  1RZ4 A;  2W57 A;  3F23 A;  1FBU A;  2XHK A;  1SD5 A;  4M71 A;  3TQN A;  1FBS A;  4L0Z B;  2ETH A;  1V3F A;  1T2K A;  3R60 A;  2MD5 A;  3W6K B;  2XVC A;  2LF8 A;  4JQF A;  3FMR A;  1H9T A;  1O7F A;  1G3W A;  2K7L A;  1HQC A;  1V4R A;  3ULQ B;  1XMA A;  4ENJ A;  4IRG A;  3WTV C;  4Y17 A;  3WGH A;  2CYY A;  2YPR A;  3WTS C;  5K5O A;  5J6X A;  4A12 A;  2J5P A;  1WI9 A;  5L3F A;  3T8T A;  1FZP B;  1ZG1 A;  1BI0 A;  5CVR A;  5A2Q Z;  4HX8 A;  1REP C;  3LA2 A;  2Q2E A;  4U7D A;  1IUY A;  4EJV A;  1XN7 A;  1EH6 A;  2XAH A;  1BN5 A;  1IRF A;  3E5Q A;  1ONV A;  2ZCW A;  2ADU A;  3FM3 A;  3MCZ A;  1FPQ A;  4MGR A;  1DDN A;  3F6V A;  4KUM A;  4OOI A;  4WXC A;  4HV6 A;  4I01 A;  4QLC U;  2CQK A;  5D4S A;  2PI0 A;  1S7A A;  1Y0U A;  2XRO A;  3TGN A;  4G8X A;  1ZN2 A;  2DAO A;  2PG4 A;  1ON1 A;  1FWZ A;  5HS9 A;  3FZV A;  3ZMD A;  2HTJ A;  5E18 F;  4XLP F;  3MWM A;  1KU2 A;  2DK5 A;  1B1B A;  2JSC A;  3R4K A;  3ZMS A;  1D8K A;  1W5S A;  5HLI A;  2GWR A;  3C3W A;  4UNO A;  3L9F A;  3IKV A;  4RGS A;  1LQ1 A;  2BV6 A;  2A6E F;  2KJB A;  2A69 F;  3GZ5 A;  3QP5 A;  1EH7 A;  1LEA A;  3GFJ A;  2K27 A;  2O0Y A;  2IVM A;  4KMU X;  4N0B A;  3F21 A;  4I0A A;  3GYH X;  1FT9 A;  4RB0 A;  4EM1 A;  2VE9 A;  4M6X A;  5JHU A;  2HYG D;  2NNY A;  3RYP A;  5JI6 A;  2DPD A;  5HDK A;  1SD6 A;  2IA2 A;  3MEX A;  2P6T A;  4P5O A;  2IPQ X;  1UHW A;  1YS6 A;  2DFI A;  1MDM A;  3O3K A;  2HKX A;  2OQR A;  4XRF A;  2PN6 A;  4GYI A;  3OV8 A;  1BJA A;  2MA3 A;  2XAF A;  4KA4 A;  4U0V A;  2VE8 A;  5AIQ A;  2P5K A;  1FOK A;  1O7L A;  2RVC A;  3HHG A;  3Q5F A;  2GIV A;  2ZME B;  2IW5 A;  4OMZ A;  2DBB A;  5K5Q A;  1S7O A;  1HSJ A;  1XSD A;  1FYK A;  4A0Y A;  2GA2 A;  3BP8 A;  1MD0 A;  4I0B A;  3DXJ F;  2HOE A;  2XUB A;  3ZN1 A;  4A0Z A;  5D8K B;  5DUI A;  1YYV A;  2XAJ A;  4OIN F;  4GGG A;  5KK1 A;  3ABT A;  4B09 A;  2R3S A;  3ABU A;  1MJB A;  1QQI A;  2E7W A;  2HS5 A;  1B59 A;  2ZO4 A;  1Z6T A;  2Z33 A;  2D1V A;  3WGI A;  4DQ2 A;  4ESB A;  3HTU A;  5ICC A;  2DW4 A;  4MEY F;  1KU3 A;  4O3M A;  1QZZ A;  2DQL A;  2J5O A;  1CF7 A;  1IN4 A;  4UVA A;  2GAU A;  3NQO A;  4HW0 A;  1E2X A;  3H3Z A;  4KFC A;  3J80 Z;  1O3T A;  2ZBK A;  4LFU A;  4ZZL A;  3FMS A;  4PGG A;  5DDG A;  2H6B A;  3IWZ A;  2GXB A;  5E17 F;  3P7N A;  3DQV C;  3WU0 A;  4NQW A;  3V7R A;  1TW3 A;  2V9V A;  3KLN A;  4GCV A;  5F6F A;  2A68 F;  1EH8 A;  5DUK A;  4UV8 A;  2QYO A;  5ILU A;  4HLY A;  5E8G A;  2OAZ A;  3CO7 C;  2M45 A;  2QVO A;  2RV8 A;  4EQQ A;  4CHU A;  4D0P A;  4EJU A;  2VBW A;  3E97 A;  5L3D A;  3CUQ A;  3IHU A;  4I2O A;  2VON A;  2FSW A;  2L02 A;  4P55 A;  3BPX A;  2CW0 F;  1R1V A;  1I5Z A;  1SFE A;  2ZNZ A;  3BWG A;  3BZ6 A;  3KCC A;  1QO0 D;  4ETS A;  2Z99 A;  3MQ0 A;  5JFR A;  1G3S A;  4OIQ F;  3C18 A;  1MKM A;  3E6D A;  3N4M A;  1SFX A;  1A04 A;  2M8E A;  2BE5 F;  3ZMZ A;  3MZY A;  3FXU A;  1LDK B;  3LQR A;  5H6Q A;  4WCG A;  3EQL F;  4CZZ A;  1OMI A;  3EYI A;  4WF2 A;  3E3V A;  3M7G A;  1SAX A;  2E1C A;  1BM9 A;  4LB5 A;  4M9Z A;  2Q0O A;  1XMK A;  1Z1D A;  5D5W B;  2BEO A;  2WTE A;  4RAY A;  1KYZ A;  4H0E A;  3I0T A;  4EM0 B;  4XBF A;  1SMT A;  1LB2 A;  3U9G A;  4OU0 A;  2OZU A;  2QM3 A;  1PDN C;  2JZY A;  1CGP A;  1DPR A;  3QRF F;  2LDU A;  1IXC A;  2EV6 A;  4EVI A;  5ED4 A;  1QPM A;  1ULY A;  3HIF A;  2PEX A;  2XKO A;  3Q9V A;  4LG0 B;  3F8C A;  3I59 B;  3NRV A;  2BYV E;  3MFK A;  2XAQ A;  2ISZ A;  1Q1H A;  2M30 A;  4U7B A;  3KFW X;  2OQG A;  1FSE A;  1ZLJ A;  4HAM A;  3H3U A;  2F5E A;  2HEO A;  3DPT A;  1ZGJ A;  2EK5 A;  4LK1 F;  2VXZ A;  1ZG5 A;  1ZRF A;  1IXR C;  3HRS A;  4A2U A;  4A0X A;  4KN7 X;  1XGO A;  2HTS A;  3CUO A;  1L3L A;  1FLI A;  5D6E A;  4EMS A;  5D5U B;  2P5L C;  3HRT A;  4KYW A;  3TO7 A;  3VOD A;  2TDX A;  3B02 A;  4GO1 A;  2KIU A;  4AD9 A;  3WGG A;  4UV9 A;  3DPL C;  4HYE A;  5LRS A;  3HRM A;  1D5V A;  2K4B A;  1W7P D;  4EV0 A;  1T98 A;  2FRH A;  2F5F A;  1D8J A;  3GVA A;  1UST A;  1L0O C;  3FMQ A;  1O3R A;  4G6D A;  2RN7 A;  1G6N A;  1JHH A;  5E1X A;  2VOO A;  4G7H F;  5CLS A;  4HX7 A;  1DP7 P;  5BOX A;  4BYY A;  2LF7 A;  3G3Z A;  2VBY A;  2OBP A;  1K6O A;  4AVP A;  5DCF A;  5E8I A;  3DFG A;  1BIA A;  2OD5 A;  1C0W A;  2QLZ A;  1Z91 A;  3D0S A;  1YW7 A;  3V4G A;  3VEP A;  1U5T A;  3TOB A;  2Z5U A;  4EJT A;  2LSO A;  3K9T A;  2HFH A;  1FP2 A;  2EA2 A;  2EFP A;  1WKM A;  4TV7 A;  1S8N A;  4NHJ A;  3I64 A;  4OIP F;  2A3S A;  3GFL A;  4YFN F;  1PUE E;  2NRA C;  3GFI A;  1KQ9 A;  4ESF A;  2Y0M A;  1WSU A;  3M9A A;  1WQ2 A;  4G7Z F;  1I1S A;  4OIR F;  3KZZ A;  3T8R A;  1PP8 F;  1QBJ A;  1YW9 A;  3COA C;  1U2W A;  3RTR A;  5ILS A;  2HR3 A;  4G9Y A;  3GXO A;  3QPH A;  2L4A A;  2NNN A;  3I5U A;  4K2E A;  4S04 A;  3GEZ A;  1ON2 A;  3DV8 A;  3KZY A;  4YII A;  4UXN A;  2IA0 A;  4Y13 A;  4L5I A;  1T39 A;  4DNC A;  5HLH A;  1B4A A;  1R23 A;  2YU3 A;  1J75 A;  1HKT A;  2H6C A;  1SD4 A;  2EV5 A;  2AS5 F;  3GFM A;  1O57 A;  1F9N A;  3R61 A;  1G3Y A;  2JRT A;  1H0M A;  2RNJ A;  5FGM A;  2CG4 A;  1P4A A;  4Q47 A;  4KN4 X;  3F8B A;  2STT A;  1FY7 A;  5LGN A;  2YX7 A;  1FC3 A;  2QUF A;  2IJL A;  1R5H A;  1U6G A;  1KU9 A;  4FHT A;  5LLQ A;  3CUQ C;  2VBZ A;  1RI7 A;  5FLX Z;  3C7J A;  1XDU A;  3QPT A;  4R1H A;  2XRN A;  1LEB A;  4HZF A;  3T5X A;  3P9C A;  1JGS A;  2EFO A;  1K78 A;  3GO5 A;  3G73 A;  2EV0 A;  2W85 A;  4EGZ A;  2KRF A;  5J8F A;  1U3E M;  3HUG A;  2G9W A;  4NB5 A;  3ISP A;  1HST A;  4ENK A;  3CJN A;  4HDV A;  4PGH A;  1R5G A;  1RNL A;  1XCB A;  5KVR A;  3MZH A;  1BC8 C;  3IRQ A;  5ICE A;  3HSE A;  2UXN A;  1HW2 A;  3L09 A;  4MHG A;  3RKW A;  3LAJ A;  1E17 A;  1IXS B;  1BBY A;  3LFK A;  1TTY A;  4P96 A;  1Z7U A;  5BMZ A;  3BPV A;  3F8M A;  2K4J A;  3KP5 A;  4L9V A;  3MAJ A;  2VC1 A;  4R79 A;  5K1Y A;  5HVQ C;  4WK8 F;  5JR3 A;  2IA1 A;  2O3F A;  1G4D A;  3QP6 A;  3WTW C;  4MTD A;  4BNC A;  2H94 A;  4B8X A;  1FYL A;  5BPI A;  4AIH A;  5CVV A;  2QBY A;  2EFQ A;  4OIO F;  4XSX F;  1D3Y A;  3N97 A;  2W24 A;  4UVC A;  2FBI A;  2Z3Y A;  1R7J A;  4A6D A;  3TDZ C;  3TKY A;  2P7C B;  3WTX C;  3S2W A;  3O2P E;  4OMY A;  2BBY A;  2H09 A;  2A07 F;  3FWE A;  2HGC A;  4Q48 A;  3WTT C;  2VN2 A;  3QOP A;  1IN6 A;  4PZJ A;  3KEO A;  2OA4 A;  5HDN A;  1MJ9 A;  3GLX A;  4XSZ F;  1XB4 A;  4L9J A;  3GZ6 A;  1J5Y A;  3GW2 A;  1YFH A;  1MDM B;  1Z6R A;  1XSV A;  5HOO A;  4RS8 A;  3KP3 A;  3BOQ A;  3E6B A;  3IRR A;  1LDJ A;  3PQJ A;  1TW2 A;  4G7O F;  1YIO A;  3FHZ A;  4WX9 A;  3CO6 C;  3QU6 A;  4G6Q A;  2FU4 A;  5TRD A;  2H27 A;  1USS A;  3I58 A;  4M9S A;  1HBX G;  2HWV A;  1R36 A;  4KIB A;  1U5T C;  1XGM A;  5LGT A;  3V8K A;  4N9H A;  2R7D A;  5LRR A;  3RJP A;  3ZN0 A;  4CDG A;  3K2Z A;  1OYY A;  2UXX A;  1HKQ A;  2CSO A;  4BXU A;  3ROU A;  3L7W A;  4IF4 A;  2CWE A;  3SHF A;  3RIR A;  4E70 A;  5ICF A;  3IL2 A;  3TOA A;  5FLX K;  2VOP A;  2M5W A;  5DCM A;  3RPU A;  3I53 A;  1B6A A;  2JPB A;  1YO5 C;  1R58 A;  4I09 A;  3WTU C;  2GXG A;  4KNY A;  1T6S A;  5AIP A;  1ZG3 A;  1U78 A;  5IT3 A;  3VOE A;  2ACJ A;  4M72 A;  5L3B A;  4MNU A;  2FQ3 A;  4JBA A;  4HQM A;  2DI3 A;  2PQ8 A;  1DPU A;  5DV5 A;  1CF7 B;  3O6B B;  2IP2 A;  1FP1 D;  2UWM A;  1XCV A;  4LLL A;  2XAG A;  3RPQ A;  2MH2 A;  1JHF A;  2B0L A;  1O3S A;  3QAH A;  1J7K A;  2HZT A;  1FNN A;  3SXY A;  4YFK F;  1B9M A;  1R22 A;  1W7P B;  2ZJ2 A;  4KIG A;  2NS0 A;  3KP7 A;  3TDU C;  1OYW A;  4FX0 A;  2V1D A;  3ECH A;  2DU9 A;  3V8J A;  5HLG A;  4YIF A;  1GVJ A;  1MZB A;  4LJZ F;  1LNW A;  1R1T A;  1ZRE A;  3F8F A;  4UUV A;  1W5T A;  2XKP A;  4ZYE A;  4Q4Z F;  1ZRC A;  1J9I A;  1KYW A;  5JVT A;  3FF5 A;  1TQM A;  2K02 A;  2PFB A;  3VFZ A;  4LD5 A;  2FBK A;  4HOB A;  5HDG A;  4Z2Y A;  3FXQ A;  1IN7 A;  5DYM A;  2HYF A;  2LKP A;  1Z05 A;  1XGN A;  3B73 A;  3CUQ B;  3V7C A;  3K1P A;  4UHT A;  2C6Y A;  2JT1 A;  2KKO A;  4LLG F;  4QWQ A;  1LDD A;  2GA1 A;  2X0L A;  2V6C A;  4I7H A;  1JE8 A;  2PLY A;  5H20 A;  1TNT A;  3K69 A;  4HDU A;  5L3G A;  1ZHF A;  3WTZ A;  4HF0 A;  3WE3 A;  3BJA A;  3ZP5 A;  4AIK A;  5LHG A;  2OZ6 A;  3I71 A;  5LHI A;  4F7Z A;  1I27 A;  4EM2 A;  5LBQ A;  2A61 A;  2A6H F;  3FXR A;  2RQP A;  1X3U A;  3QU3 A;  2FBH A;  1OPC A;  1FSH A;  3E5X A;  3P9K A;  2QQA A;  2FF4 A;  3BJ6 A;  3EYY A;  1IZ1 A;  3HSR A;  4ZYD A;  3BRO A;  5L3C A;  4BQA A;  3V7S A;  5F64 A;  5TJJ A;  2FOK A;  1TLH B;  5BQT A;  3H92 A; 
#chains in the Genus database with same CATH topology
 5D8L B;  2VC0 A;  2ZXI A;  2Y9Z A;  5FO5 A;  1E3H A;  2Y48 A;  3RKY A;  3BTI A;  3R6S A;  3WU1 B;  3GF2 A;  4LMY A;  1SD7 A;  3PO2 J;  1UG2 A;  2DA4 A;  2BVL A;  2HKO A;  3G4S I;  1APL C;  3HTS B;  3F3X A;  1G8X A;  2G7H A;  4CYD A;  2P8T A;  2CV0 A;  3J7Z I;  3U1D A;  2CO5 A;  5D5V B;  1BIB A;  1BC7 C;  2XAS A;  2ZXJ A;  4M73 A;  3REO A;  3CDH A;  2QZ8 A;  3F8N A;  3ECO A;  4L9T A;  1JXS A;  2L7K A;  4CO8 A;  5ERI A;  2DTR A;  3F6O A;  3GME A;  1FEX A;  1YHQ I;  4DIQ A;  2AXL A;  3VSL A;  1QRY A;  2P6S A;  3F9K A;  1VQO I;  4YIR X;  2K86 A;  1YLF A;  2ZB9 A;  3ZGK A;  3S16 J;  2NVX J;  3HRU A;  5AON A;  3F72 A;  5CVJ A;  3ZMT A;  2LYC A;  2KZV A;  3EET A;  3GTP J;  3K0L A;  3M1E A;  4HV5 A;  3E5U A;  4LG3 A;  1YJ9 I;  4FE4 A;  4BY7 J;  5FFX A;  1VQ5 I;  3GTG J;  4BHC A;  1OYI A;  1R4N B;  5D5X B;  2G0E A;  3OS1 A;  1UHM A;  2HXO A;  2R7S A;  1IRX A;  5IOY A;  4BBR J;  3E6C C;  1WH7 A;  3AL0 C;  4P9U A;  3ZOB A;  1EV7 A;  3OY9 A;  3O8H A;  2BGC A;  3J81 Z;  3ZMU A;  2DMQ A;  1LJ9 A;  1ZRD A;  3EUH A;  3SQN A;  2ZFU A;  2ESN A;  2KJC A;  1ETK A;  3DF8 A;  2XDV A;  5B1A H;  2OV7 A;  4ENN A;  2VBX A;  3HOT A;  2MFZ A;  2YR2 A;  3WOD F;  2K9L A;  1ZAO A;  5EZG A;  4N4O B;  1JT0 A;  2QQ8 A;  2VQH A;  1WRJ A;  4FET A;  5FB2 A;  1YS7 A;  2P7V B;  3CCY A;  2M7A A;  1IN5 A;  3L00 A;  4FAS D;  2FEZ A;  3OYJ A;  1X58 A;  3ZMV A;  1XPX A;  5JHF A;  4KIC A;  2VOD A;  4ZH4 F;  2VUM J;  3QPL A;  2QA4 I;  1V5F A;  1S7E A;  4Y15 A;  1MBF A;  1MGT A;  2X6X A;  4RGR A;  5IT9 K;  3MVP A;  1FMW A;  5DD8 A;  3C1D A;  3GWZ A;  2YX4 A;  2MC4 A;  3L2U A;  4MIM A;  3EDP A;  2WC2 A;  3KLO A;  4CGZ A;  2RAE A;  4B3X A;  4A5N A;  4E6K G;  2CJJ A;  1VQP I;  2DQR A;  3ABK H;  2V79 A;  3M8E A;  4A3K J;  3CES A;  4MO7 A;  2ZME A;  1BOA A;  1H9G A;  5CVI A;  5IPA A;  2COM A;  4JK1 X;  4S05 A;  5M3F J;  3V8L A;  1X1A A;  3LSJ A;  4IVN A;  2XIG A;  4M9X A;  4XKV A;  2IGO A;  1T08 B;  1FBQ A;  1ZR4 A;  3GTQ J;  2JK3 A;  4ZDO A;  3M8F A;  1F36 A;  1BJZ A;  1F5T A;  2QWW A;  3OR2 C;  2DA7 A;  2LC2 A;  4RGU A;  1Y6I A;  3MD2 A;  4IHX A;  1HC8 A;  4C30 A;  3RKX A;  2R93 J;  1IN8 A;  3HYI A;  3I54 A;  2ZKZ A;  1BI3 A;  1M1E B;  3ML6 A;  4RB2 C;  3KX2 A;  3G1L A;  5DEQ A;  3DKW A;  3RYR A;  2NAZ A;  5FD6 A;  5BPD A;  1ZLK A;  2IXS A;  4XLF A;  1U5T B;  1YOV B;  2RC4 A;  2VT2 A;  2YU9 J;  1YW8 A;  2FA5 A;  2YSR A;  1IRG A;  3FXK A;  3AG1 H;  2QEN A;  3ESW B;  3GX4 X;  3FM5 A;  3G2B A;  2V9P A;  1VI0 A;  3G1M A;  2BW3 B;  3DLL F;  2ELH A;  2XSJ C;  4HLX A;  3ZPL A;  1BI2 A;  4N9I A;  3ZQF A;  4FX4 A;  3IC7 A;  1ZAR A;  1OKR A;  2JWT A;  4ENM A;  4U0Y A;  3K6G A;  3P9I A;  5CYV A;  2R0Q C;  1B9N A;  4OAY A;  4KDP A;  1SC7 A;  4WXH A;  4G94 A;  5CJ9 A;  5F04 A;  1T0F A;  1P7I A;  2LR8 A;  1YTY A;  3RI4 A;  2ID6 A;  1FX7 A;  4Y4R A;  2DK8 A;  1JJ8 C;  5IOZ A;  4DZP A;  2PMU A;  2KIF A;  2OCE A;  3HPH A;  1MBK A;  3E6M A;  1BI1 A;  1OR7 A;  4BJ5 C;  3GTM J;  3PUF A;  1MMD A;  3R0A A;  4LLN A;  1NHA A;  1IJW C;  3KP2 A;  1RR8 C;  2HQR A;  1E3O C;  3LSK A;  2OC6 A;  2VPL A;  1QNT A;  1AA7 A;  4L18 B;  1SVO A;  4HA8 A;  2E19 A;  2PX9 A;  3OYA A;  4C2T A;  3TED A;  2KIM A;  2LY1 A;  1JJ6 C;  1QVU A;  4A3C J;  1R6R A;  2GQQ A;  2R4G A;  3JAM Z;  4G6T B;  1TWF J;  3QPS A;  3ZQQ A;  5K5R A;  5H2F C;  1J0R A;  2E5N A;  3LA3 A;  4BQN A;  4M6V A;  1UJ8 A;  4DJA A;  3J7A Y;  5EYR A;  2HU9 A;  1R1U A;  4IOC F;  1T38 A;  1XGS A;  2CGP A;  2O61 A;  2PBI A;  2Z9O A;  2EFN A;  2FXA A;  3GBG A;  1VQ8 I;  1HW1 A;  3D5R C;  1P6R A;  1ZGA A;  1T33 A;  2W84 A;  3JTG A;  2W7N A;  4YRV A;  4UB8 C;  3HOX J;  2FD5 A;  2VJI A;  1KGS A;  4ESJ A;  1SVM A;  3BG6 A;  1ZH5 A;  1EF4 A;  1ODD A;  4EJW A;  1OFC X;  1KA8 A;  1SVL A;  2ELK A;  4W97 A;  3B6C A;  1ZKG A;  3LAP A;  4RMN A;  2DLL A;  2FNA A;  3R0J A;  2K3P A;  4OWR B;  3L2R A;  2O9L A;  4RM3 A;  3K4N A;  3KP4 A;  4GXO A;  3LST A;  2EIJ H;  4IHS A;  3L1P A;  1XSX A;  2L9N A;  3ZQC A;  4C2M J;  3JTH A;  1UB9 A;  1RET A;  4WWC A;  3WG9 A;  5FJ8 J;  5D6F A;  2WV0 A;  2F5V A;  3P5J A;  1VQ6 I;  4BL0 B;  2GM4 A;  4E4H A;  2R7Q A;  3FK6 A;  2L54 A;  1Y1W J;  2QKM B;  3WE2 A;  1XDS A;  3BDD A;  4ANJ A;  1X2M A;  1AU7 A;  4R8H A;  1RIO H;  2NVY J;  4UVB A;  3TL4 X;  2KIS A;  2QQ9 A;  1RUN A;  1U8R A;  1TQI A;  3JCU C;  1U9N A;  2H1L A;  1MMA A;  2FML A;  3H1C A;  4E7H A;  5IYB J;  2NYX A;  1DGW Y;  1U0J A;  1P4W A;  2WAQ A;  2DMT A;  1G3T A;  3KP6 A;  2E2I J;  1Y56 A;  2DDB A;  2E1N A;  2MAB A;  3A01 A;  1GXP A;  2IGN A;  4LIV A;  3J81 K;  3AFH A;  3L2C A;  2EFW A;  2M1B A;  5M5W J;  2EQR A;  3RDI A;  3IWF A;  3F22 A;  2VB6 A;  4HX4 A;  2M9H A;  1IF1 A;  1KQ0 A;  2VPR A;  1K4T A;  3CC2 I;  4X1E A;  3SFZ A;  2JUC A;  1G59 A;  5HS7 A;  2LRD A;  1K78 B;  3I4P A;  5FD5 A;  4U88 A;  2PMZ A;  1TWC J;  3HM5 A;  1HW5 A;  4ASN A;  1XS9 A;  2MC3 A;  2O8X A;  2L7Z A;  2XGX A;  3Q9S A;  2D45 A;  1X3Z B;  2LMD A;  1TBX A;  4HF2 A;  2LNB A;  3LNQ A;  3AAF A;  3HUG B;  2Q8K A;  5A2Q K;  5JLX A;  1KU7 A;  3TO6 A;  1GXQ A;  4A5M A;  5L3E A;  3SEQ A;  1IAW A;  3E7L A;  2W25 A;  1VQN I;  3M4O J;  1TNS A;  1AOY A;  2M8G X;  4E7K A;  4BS9 A;  4BAY A;  2E7X A;  1W7P A;  4PDK A;  5GAD J;  4L9N A;  4DYC A;  2DA5 A;  2HZD A;  4U0W A;  2F2E A;  5KAI C;  3DEU A;  5CQE A;  1XX5 A;  2CFO A;  2DO7 A;  5J4V A;  1ACI A;  1SMY F;  2CS3 A;  1VTN C;  5H6R A;  2W82 A;  5IP6 A;  3K1M A;  4LG0 A;  2HVQ A;  2L2O A;  3FX3 A;  3I59 A;  3W2A A;  2LRE A;  3OYD A;  3T1B A;  5ILV A;  2PJP A;  2ZSH B;  4MQV A;  3DPU A;  2JA2 A;  4PK4 A;  2Y75 A;  2MLG A;  4JP0 A;  1S6L A;  4Y7N J;  4WXD A;  1F1Z A;  5DS9 A;  5FRN A;  5E1Z B;  2XGC A;  2HDC A;  1SAN A;  3CCE I;  3GTJ J;  3U21 A;  2EIN H;  2AO9 A;  4GYG A;  2QQB A;  2O6G E;  4MEX F;  2Y31 A;  3BJO A;  4JOM A;  4P9F A;  4QTR A;  2IBD A;  4ZYA A;  3DP7 A;  5BS6 A;  4L5J A;  3ZQ7 A;  5HOD A;  4Y52 J;  4LOC A;  2A05 A;  4CIC A;  1OCC H;  1IW7 F;  3JRC A;  3ERE D;  2QEX I;  3BG3 A;  4MLO A;  2CV1 A;  5FFZ A;  3HPG A;  4I98 B;  2RDP A;  1IV8 A;  4XKB A;  1S29 A;  3LOC A;  1ETQ A;  3WTY C;  2ICW G;  2NXN B;  4A3F J;  3KEY A;  4UUS A;  3OYB A;  3CTA A;  4CXF A;  3T0Y A;  4RB3 C;  2DXI A;  4ZYG A;  3BY6 A;  4ON0 A;  3K1N A;  2WWY A;  4IJA A;  2IRF G;  2QCO A;  2E2J J;  2ZXH A;  2GIZ A;  3LA7 A;  5LEJ A;  4RB1 A;  1AKH A;  1DUX C;  3H36 A;  2HXI A;  2DT6 A;  5DD4 A;  2HI3 A;  3CC7 I;  1WWX A;  4IPA A;  5E20 A;  4JX6 A;  2DMU A;  2EA4 A;  3GUD A;  4KMF A;  3AL0 B;  1FIA A;  1KQ8 A;  3MN2 A;  2QBY B;  2ZFW A;  4EJO A;  2ELJ A;  4D9J A;  3W6V A;  3OYE A;  6PAX A;  2ISY A;  1PP7 U;  1HDP A;  3SZP A;  3VYT B;  3JSP A;  4BHB A;  2Q1Z B;  2E35 A;  2Y0S A;  1R71 A;  4IHY A;  2ZNY A;  4IXA A;  2MBF A;  4IKF A;  1P92 A;  2KL4 A;  4PFP A;  5IT9 Z;  3EUH C;  3M07 A;  3G6E I;  4YFX F;  2DFE A;  1GHC A;  1A6Q A;  2HVS A;  2FMY A;  2OU2 A;  2QSF X;  1P9Q C;  4B4C A;  1LFB A;  1IUF A;  2A5Y B;  4BXF A;  3TO9 A;  1H89 C;  4RGX A;  4ZYH A;  4A3B J;  4RLQ A;  5IYD J;  1DU0 A;  1K7A A;  2X1C A;  2VJJ A;  4XRS A;  2IGM A;  2XPV A;  1UEL B;  2LH9 A;  3JAM K;  4C2U A;  1JKP C;  1D0Z A;  1MJA A;  2L7M P;  2EB7 A;  1K83 J;  3FKI J;  2MH9 A;  3D5L A;  4IRI A;  4MQ9 F;  1HKS A;  3HHH A;  1I1G A;  2O03 A;  3H35 A;  3SZT A;  1P4X A;  1WJA A;  2R7F A;  5J1R A;  4AIJ A;  1O3Q A;  4XLN F;  1UCR A;  5FKK A;  4HQE A;  2D1H A;  2L4M A;  4LGW A;  3IKT A;  3HOS A;  2JTV A;  2PMH A;  4MTE A;  3HSF A;  1RUO A;  1VND A;  4IHT A;  2R7W A;  2EZI A;  4IHW A;  1N25 A;  1CQT A;  2ZME C;  3WU2 C;  3LSR A;  4RAF A;  1MW7 A;  4LB6 B;  2DYR H;  4IRH A;  4KT5 C;  4XN3 A;  5LHH A;  3S2H J;  5EEG A;  2NVT J;  2RKH A;  3HG9 A;  2IS2 A;  2G7U A;  1TQP A;  1UFM A;  2W00 A;  4AWX B;  2EIL H;  4IOA F;  2FE3 A;  3W2W A;  3PFI A;  5LGU A;  2V1X A;  3KEQ A;  1A36 A;  3S2D J;  4O5V A;  1O4X A;  2BY2 A;  2NVQ J;  4Q5S F;  1FOY A;  1TWA J;  3K2A A;  2XF6 A;  3OIP A;  4PCQ A;  2LKS A;  4D7N A;  1FOX A;  2P5V A;  4CYC B;  5HLT A;  1ZYR F;  1Z9C A;  1D1A A;  1MNM C;  3CDL A;  2EJR A;  4BH9 A;  1J2X A;  2DFF A;  4PUS A;  2R92 J;  5LD2 C;  1NTC A;  1HXD A;  2D2W A;  1I6X A;  2DT5 A;  2V1U A;  3Q0W A;  4F52 A;  1QZY A;  2KDZ A;  2RGV A;  3K4J A;  3OYI A;  1BW6 A;  2XV4 S;  4BE2 A;  1BW5 A;  4QPQ A;  2KT0 A;  1SFU A;  1TT0 A;  2STW A;  4C3J J;  5CVU A;  3HC7 A;  3DBR B;  2X85 A;  1HA8 A;  2E5Z A;  2MYS A;  4A6E A;  1S3J A;  2JPC A;  2ESH A;  2UZK A;  1W0U A;  3GTO J;  2IT0 A;  5ICG A;  5J8C A;  1IRZ A;  4BEH A;  2FNP A;  4CCO A;  9ANT A;  5IY5 H;  5EGO B;  2XPW A;  2LVS A;  3DLA A;  3MKL A;  1YG2 A;  3ELK A;  4W1U A;  4A69 C;  4BU2 A;  4NC6 A;  3PFY A;  2OF7 A;  3J7A O;  5HS8 A;  1YRN A;  4HF1 A;  1IDZ A;  1T0F C;  2F5C A;  1WVR A;  1P2F A;  2GZW A;  4HBL A;  1R00 A;  2P4W A;  4O6J A;  5DCM B;  3U2R A;  1QGP A;  2CFX A;  1F4K A;  3PQK A;  5F1R A;  2DPU A;  3ABM H;  3CJQ B;  2AQE A;  1J59 A;  3VB2 A;  1JGG A;  2MSY A;  3L2W A;  1P7J A;  2I8D A;  3NEU A;  4U87 A;  2M2E A;  4RAZ A;  4M3B A;  1OR7 C;  3OYC A;  3PO3 J;  2F5D A;  1WFX A;  1QVT A;  1LVA A;  3LL7 A;  1R4M B;  3I4N J;  2DOF A;  2VT3 A;  1Z0X A;  3PIP F;  3CMY A;  4M3D A;  4FT8 A;  2V26 A;  3CLQ A;  3JW4 A;  4JX4 A;  4M6Y A;  1W4M A;  1R9T J;  3I55 I;  2MLK A;  2DJI A;  4M74 A;  1LVK A;  3BR1 A;  3KET A;  1MIJ A;  3CLO A;  1YQA A;  3KE2 A;  2L01 A;  3OIO A;  3J80 K;  4KIF A;  3CCR I;  4BJT A;  2EWN A;  3LQQ A;  3LWF A;  3BR3 A;  3FK7 A;  3H9Q A;  4XLC A;  4QSH A;  3W6J B;  3LSP A;  4XQF A;  3L2Q A;  5DTD A;  1Y8Q B;  4HST A;  2OTJ I;  4BHP A;  3UR3 C;  3JSO A;  1AWC A;  2PJR A;  1GLN A;  3C2G A;  2L3D A;  4YG2 F;  5EEH A;  5D4R A;  3CJT B;  2Z16 A;  4LK0 F;  3OOP A;  4XOP A;  2X4H A;  2VKD A;  1MMN A;  4I02 A;  4F3Q A;  1K79 A;  3JRF A;  4S0H B;  2F4O B;  3CDI A;  4XMY A;  4L0Y B;  3CP8 A;  2HNH A;  2BZT A;  3BG7 A;  5GAH J;  5M3M J;  2HQN A;  3CZ6 A;  1I3A A;  1STZ A;  1FYM A;  5LEK A;  1V5G A;  3ZRG A;  2M87 A;  1NG7 A;  1XD7 A;  5E1W A;  1POG A;  4ZZD A;  3W2V A;  4CCN A;  5KCM A;  3RPU D;  4EGY A;  1JTY A;  1RZ4 A;  2W57 A;  3F23 A;  3GTL J;  5IP9 J;  1FBU A;  2XHK A;  4HPQ A;  3M3Y J;  3S1R J;  3K7A J;  1SD5 A;  3EPZ A;  4M71 A;  3TQN A;  3DBL B;  5EG0 A;  4PJM A;  1MSE C;  1FBS A;  5FKO A;  2R7R A;  2ETH A;  4L0Z B;  1V3F A;  1T2K A;  1XG1 A;  2ZJQ F;  3R60 A;  5GP9 A;  1B72 B;  3HGG A;  2MD5 A;  1B8I A;  3QYB A;  1HOM A;  3W6K B;  3KPH A;  1WPK A;  2F4I A;  1UMQ A;  2XVC A;  1X1B A;  1JUM A;  3BT9 A;  2LF8 A;  4XOT A;  5FKM A;  4JQF A;  3FMR A;  3S8P A;  5GAE J;  4BGD A;  1H9T A;  1ZEL A;  1O7F A;  2QSG X;  1G3W A;  2K7L A;  4UUT A;  1HQC A;  1VQM I;  1JKR C;  1V4R A;  3ULQ B;  3WG7 H;  3HKZ A;  2KHM A;  5TIS C;  1XMA A;  5C3E J;  1RRJ A;  4ENJ A;  2R5Y A;  4IRG A;  3WTV C;  3ERM A;  4Y17 A;  3SFI A;  3WGH A;  3DTI A;  4A3I J;  2CYY A;  3IUO A;  4JX5 A;  1UG0 A;  4CSW A;  2YUS A;  1WH5 A;  2YPR A;  3FDY A;  3WTS C;  5K5O A;  1LFU P;  1K6Y A;  5J6X A;  1OCT C;  4E7L A;  4A12 A;  2J5P A;  3E1S A;  1WI9 A;  3RSN A;  1GT0 C;  3NAR A;  5L3F A;  3T8T A;  1FZP B;  1RPW A;  1Z3Y A;  1ZG1 A;  3RQ4 A;  1BI0 A;  5CVR A;  5A2Q Z;  4HX8 A;  1REP C;  2K3F A;  3LA2 A;  1FJL A;  1MBJ A;  2Q2E A;  4U7D A;  1N77 A;  1TT5 B;  1YX5 A;  1HF0 A;  1IUY A;  4EJV A;  3JRA A;  1XN7 A;  1EH6 A;  1Y1V J;  2XAH A;  3DEW A;  4C9Y A;  3DU6 A;  2LK2 A;  1BN5 A;  5B1B H;  1WJB A;  3CD6 I;  1IRF A;  2WAE A;  5GTI C;  3E5Q A;  2M4G A;  2V1N A;  5E3L A;  1Z67 A;  1ONV A;  2ZCW A;  2ADU A;  2AXT C;  5F08 A;  4CCK A;  3FM3 A;  2KDO A;  3MCZ A;  2WB1 N;  2VJ4 A;  2NVU B;  1FPQ A;  4MGR A;  4LIU A;  1DDN A;  3F6V A;  4KUM A;  1ENH A;  5E3N A;  2DMN A;  2LOO A;  1OCZ H;  4OOI A;  4WXC A;  4PJL A;  1Z77 A;  4HV6 A;  4I01 A;  4DBR A;  4QLC U;  1TL8 A;  2CQK A;  1YE9 A;  2DOA A;  3QYE A;  5D4S A;  2PI0 A;  1S7A A;  1Y0U A;  3PUB A;  2XRO A;  3HOU J;  3TGN A;  4G8X A;  1ZN2 A;  2DAO A;  2PG4 A;  1ON1 A;  1UAA A;  3DU5 A;  1FWZ A;  5K7F A;  1YJN I;  1HCR A;  5HS9 A;  1X3W B;  3FZV A;  3ZMD A;  4DBQ A;  2HTJ A;  5E18 F;  4XLP F;  3MWM A;  2ECC A;  3BTL A;  1KU2 A;  4XON A;  2DK5 A;  1OLT A;  3TW7 A;  2OPT A;  3GZN B;  1B1B A;  2JSC A;  2P0W A;  3R4K A;  1FIP A;  3ZMS A;  2IS1 A;  1D8K A;  3OMY A;  2IGK A;  5GTH C;  3JRE A;  1W5S A;  3NAU A;  5HLI A;  1I39 A;  5EF6 A;  3OYH A;  4YEL A;  2GWR A;  3C3W A;  4Y33 A;  4UNO A;  3L9F A;  3IKV A;  2R7O A;  4RGS A;  1LQ1 A;  2BV6 A;  2A6E F;  2KJB A;  2A69 F;  2LG4 A;  3GZ5 A;  3QP5 A;  3RCO A;  4B44 A;  1EH7 A;  2X6Y A;  4XLH A;  3SYT A;  3PNY A;  2QF7 A;  1LEA A;  3GFJ A;  2K27 A;  2X6O A;  2O0Y A;  2VJ5 A;  4KJZ A;  2IVM A;  4P1W A;  1FMV A;  4PFO A;  4KMU X;  4N0B A;  3F21 A;  4I0A A;  1IDY A;  3FBI B;  3GYH X;  1W5C C;  5C4X J;  3H0G J;  1KON A;  4AYB N;  3LSI A;  1FT9 A;  4RB0 A;  3FHN A;  3CQZ J;  2E2H J;  4EM1 A;  2VE9 A;  4M6X A;  2DOE A;  2E1M C;  4ABZ A;  5JHU A;  4FE7 A;  1LUJ B;  2HYG D;  2NNY A;  4PJN A;  3BTJ A;  3RYP A;  5JI6 A;  2DPD A;  3UNG C;  5HDK A;  1SD6 A;  2IA2 A;  3MEX A;  2P6T A;  4P5O A;  2IPQ X;  4E7J A;  1UHW A;  1YS6 A;  2V6E A;  2DFI A;  2XF5 A;  1MDM A;  1WHU A;  4DZJ A;  3O3K A;  2HKX A;  2KRH A;  2OQR A;  4XRF A;  4ZJZ A;  1BA5 A;  2PN6 A;  4GYI A;  3OV8 A;  1BJA A;  2CRG A;  2MA3 A;  1V55 H;  2XAF A;  4V2G A;  4KA4 A;  4U0V A;  2UV1 A;  2VE8 A;  3W3C A;  2P81 A;  4XLE A;  2CU7 A;  5AIQ A;  2P5K A;  3GLL A;  1N75 A;  1FOK A;  1O7L A;  3S14 J;  2RVC A;  1VQL I;  4RAG A;  2MG4 A;  3HHG A;  3Q5F A;  5EEA A;  4AID A;  2GOX B;  2GIV A;  1NH3 A;  2ZME B;  1VQ9 I;  2DDA A;  2IW5 A;  4OMZ A;  4BUP A;  2DBB A;  4B47 A;  5K5Q A;  4EEF G;  3FXM A;  4D5C A;  1W0T A;  3BZK A;  1S7O A;  1HSJ A;  1XSD A;  1OCP A;  3S1N J;  3HZJ A;  1FYK A;  4A0Y A;  1BR4 A;  2GA2 A;  3BP8 A;  4II3 A;  1KZH A;  1MD0 A;  4I0B A;  3DXJ F;  2HOE A;  2XUB A;  5IYC J;  3MKY B;  3ZN1 A;  3ASO H;  2GXA A;  2GLO A;  4A0Z A;  4AUX A;  1MBE A;  5D8K B;  1PJR A;  2X51 A;  5DUI A;  1YYV A;  4IQJ A;  2XPU A;  5KNL A;  4AC0 A;  2XAJ A;  4OIN F;  4GGG A;  2JA7 J;  5KK1 A;  3ABT A;  4B09 A;  4BQO A;  3I56 I;  2R3S A;  2Y2Z A;  1LE8 A;  3ABU A;  1MJB A;  5JVG F;  3TW6 A;  1QQI A;  5TGT A;  3HOZ J;  1TP4 A;  2DMP A;  2E7W A;  2FUG 2;  1RC9 A;  2HS5 A;  2QKL B;  1B59 A;  2XAU A;  3OYK A;  2ZO4 A;  4IEJ A;  4XOR A;  1Z6T A;  5EDN A;  3TBI A;  2Z33 A;  1X4P A;  2D1V A;  3JRG A;  3ZCO A;  4GFB A;  4BBS J;  2ZC2 A;  3WGI A;  4DQ2 A;  4BAC A;  2LBF A;  4ESB A;  5CPR B;  2X1E A;  2Z2S B;  3HTU A;  5ICC A;  2DW4 A;  5K7H A;  1RKW A;  4MEY F;  1K61 A;  4B48 A;  3A03 A;  1ORK A;  1GDT A;  4L5E A;  1KU3 A;  3G1O A;  1QZZ A;  2DQL A;  4NC7 A;  4O3M A;  2J5O A;  1CF7 A;  1IN4 A;  3OIQ A;  4UVA A;  5KHD A;  2GAU A;  5HNH A;  2DFH A;  1XC5 A;  3NQO A;  2DN0 A;  2V9K A;  3CCL I;  1X1D A;  4HW0 A;  1E2X A;  2I5U A;  3GCM A;  3H3Z A;  1VQ4 I;  1TZL A;  4KFC A;  3J80 Z;  1O3T A;  4LIT A;  2JN6 A;  1UHS A;  2JRM A;  4XR6 A;  5J47 A;  4ZDP A;  2ZBK A;  4LFU A;  4ZZL A;  2XSD C;  3FMS A;  4PGG A;  5B66 C;  4I99 C;  1I3Q J;  3K4M A;  5DDG A;  4XN0 A;  1U9O A;  4BE1 A;  2H6B A;  3IWZ A;  3BCA A;  1MH4 A;  2GXB A;  5E17 F;  3P7N A;  2K9M A;  3DQV C;  4E7S A;  3WU0 A;  2M7B A;  2WBM A;  4NQW A;  2EPF A;  3CJR B;  3V7R A;  1TW3 A;  2MW8 A;  3BR6 A;  5M5X J;  2V9V A;  1G2H A;  3DTE A;  3KLN A;  4KIT B;  4GCV A;  4CCM A;  2TCT A;  5F6F A;  2A68 F;  2JA5 J;  4RA2 A;  2F48 A;  1EH8 A;  4HRI A;  5DUK A;  4UV8 A;  1VQK I;  2R7X A;  1Y39 A;  3ABL H;  4DW6 A;  2QYO A;  2WV1 A;  3IH2 A;  5ILU A;  4HLY A;  3OS2 A;  3Q0V A;  5E8G A;  2OAZ A;  3CO7 C;  2M45 A;  2QVO A;  4NNJ A;  4DYQ A;  1N78 A;  3D5S C;  2HOS A;  4X0G A;  5E3M A;  1QHH D;  2RV8 A;  4EQQ A;  4CHU A;  3C2H A;  4RM2 A;  4D0P A;  4EJU A;  2LTP A;  2RQQ A;  2VBW A;  3CMM A;  2WY8 Q;  3E97 A;  5L3D A;  1LPQ A;  3L2V A;  4PJJ A;  1ETX A;  2BY1 A;  3CUQ A;  3IHU A;  3VSK A;  5J1U A;  1JKQ C;  1I50 J;  4I2O A;  1PUF A;  2VON A;  2FSW A;  2L02 A;  4P55 A;  3BCB A;  3BPX A;  2CW0 F;  1R1V A;  1I5Z A;  1SFE A;  2ZNZ A;  3BWG A;  3BZ6 A;  2XB5 A;  2CQX A;  3S1Q J;  4J19 A;  3KCC A;  1QO0 D;  4ETS A;  2Z99 A;  4HNU A;  3K70 C;  3MQ0 A;  2R5Z B;  5JFR A;  1G3S A;  4OIQ F;  3C18 A;  3RZO J;  2H8W A;  3CF2 A;  1MKM A;  3E6D A;  3N4M A;  3VYR B;  1RES A;  1SFX A;  1A04 A;  2M8E A;  3MZ8 A;  2BE5 F;  3HL2 A;  1ETW A;  3ZMZ A;  2IS6 A;  3MZY A;  4E7I A;  4RLF A;  3ZQL A;  3FXU A;  3PSI A;  1LDK B;  3LQR A;  1SAU A;  1XMX A;  5H6Q A;  4WCG A;  3A01 B;  4BXX J;  3EQL F;  4CZZ A;  1OMI A;  1EA3 A;  2OCC H;  3EYI A;  3HOW J;  2R7U A;  3RQI A;  4WF2 A;  3E3V A;  3D1N I;  3M7G A;  1A35 A;  1SAX A;  2E1C A;  1BM9 A;  3H0D A;  4LB5 A;  4M9Z A;  2Q0O A;  1ETV A;  1XMK A;  1Z1D A;  5D5W B;  2BEO A;  4IO9 F;  2JMW A;  2E34 A;  2WTE A;  2DTZ A;  4RAY A;  5E3O A;  1YIT I;  1ZGW A;  2VQC A;  1KYZ A;  3KYD B;  1IC8 A;  4H0E A;  3I0T A;  4EM0 B;  3HXL A;  5CQG A;  4XBF A;  1SMT A;  2Y69 H;  1LB2 A;  3U9G A;  3ZQI A;  4OU0 A;  2OZU A;  2PMZ N;  2QM3 A;  2HPM A;  5F27 A;  1PDN C;  3FXJ A;  3HB9 A;  1W1W E;  2DA6 A;  2JZY A;  1CGP A;  3PNT A;  1DPR A;  3QRF F;  2LDU A;  1IXC A;  4J00 A;  2EV6 A;  4EVI A;  5ED4 A;  3BC8 A;  1QPM A;  1ULY A;  3BR0 A;  3HIF A;  2Z1D A;  2PEX A;  3WHC A;  1OCO H;  2XKO A;  4PSW A;  1BOB A;  3Q9V A;  4M3E A;  3F8C A;  4LG0 B;  3SDB A;  1MMG A;  2ME0 A;  3I59 B;  2BYV E;  3NRV A;  4EAT A;  3MFK A;  4XKW A;  2XAQ A;  5CKT A;  3HDD A;  2ISZ A;  1Q1H A;  2M30 A;  4U7B A;  3KFW X;  2OQG A;  1FSE A;  3Q0U A;  2BY3 A;  2ZSI B;  4A3D J;  1ZLJ A;  1R5I D;  4V19 K;  4HAM A;  3H3U A;  2F5E A;  2HEO A;  2XRL A;  4CCL A;  2L9R A;  3DPT A;  1TWG J;  4G12 A;  1ZGJ A;  2JVH A;  2EK5 A;  4LK1 F;  2EH3 A;  2VXZ A;  1D1B A;  1ZG5 A;  5E79 C;  1ZRF A;  1IXR C;  3HRS A;  3A2K A;  4A2U A;  3IP4 B;  4A0X A;  4KN7 X;  1XGO A;  2HTS A;  3CUO A;  1L3L A;  1U8B A;  5F0F A;  1FLI A;  2KLO A;  4KT6 A;  4UUS B;  1Y8R B;  5D6E A;  4EMS A;  5D5U B;  2P5L C;  3HRT A;  4KYW A;  3TO7 A;  3VOD A;  2TDX A;  3B02 A;  3GTK J;  2VKE A;  2HDW A;  4GO1 A;  3I9V 2;  2KIU A;  4AD9 A;  1AKH B;  3WGG A;  5J3L A;  4UV9 A;  4A3E J;  1WJC A;  1OIS A;  2DA3 A;  3OYF A;  2E1M B;  3DPL C;  4HYE A;  2DJN A;  3LSG A;  3UKG A;  4A3M J;  2LP0 A;  1MND A;  1WGX A;  2RRE A;  2XGD A;  3HRM A;  5LRS A;  1D5V A;  2K4B A;  4BJ6 C;  1T8I A;  1W7P D;  1LFP A;  4EV0 A;  1T98 A;  5KAF C;  2GOM A;  3ONQ A;  1WJD A;  2FRH A;  2F5F A;  3M1C A;  2F6C A;  3S3N A;  2HDD A;  1D8J A;  1QHG A;  3GVA A;  1UST A;  1L0O C;  2HPI A;  3FMQ A;  1O3R A;  4G6D A;  4XKC A;  3U1K A;  2RN7 A;  1G6N A;  1JHH A;  2M34 A;  5E1X A;  3ASN H;  1JKO C;  2VOO A;  1GUU A;  4I6Z A;  4G7H F;  2COB A;  5CLS A;  1MNE A;  4HX7 A;  2H8R A;  1DP7 P;  3VPR A;  3F0C A;  5BOX A;  4A93 J;  2FX0 A;  2B63 J;  4BYY A;  2LF7 A;  3VYU B;  3G3Z A;  2VBY A;  2VXD A;  1ITY A;  2OBP A;  3IAM 2;  4AVP A;  1K6O A;  5DCF A;  5E8I A;  3DFG A;  4J01 A;  1BIA A;  1UZC A;  3BTC A;  2OD5 A;  2JA8 J;  5GAG J;  3TMO A;  1C0W A;  2VI6 A;  2QLZ A;  5B5E C;  1Z91 A;  3D0S A;  4A3G J;  1YW7 A;  3V4G A;  3HJE A;  3KZI C;  2WA0 A;  3VEP A;  2ECB A;  1U5T A;  2TRT A;  1ETO A;  3TOB A;  2Z5U A;  2DT7 B;  4KIS A;  4EJT A;  2L0K A;  2LSO A;  5EZH A;  2ZJR F;  3K9T A;  4ZC3 A;  2BHZ A;  2IEK A;  5C44 J;  1DP3 A;  2HFH A;  2IAI A;  1FP2 A;  2EA2 A;  2EFP A;  2H1K A;  1WKM A;  2BW3 A;  5J1Y A;  1Z7L A;  3CCM I;  2DOD A;  4TV7 A;  1S8N A;  4NHJ A;  3VDX A;  3OS0 A;  1MMS A;  3OL4 A;  2XF7 A;  5DM7 F;  3I64 A;  3IV5 A;  3S3O A;  4OIP F;  3A1Y A;  1HDD C;  1HLV A;  4CZC A;  2A3S A;  2M0M A;  3GFL A;  3QWL A;  2I10 A;  3ZR8 X;  2K5C A;  3OSF A;  4YFN F;  1PUE E;  2CQ7 A;  4AYB A;  4PSX A;  2CV2 A;  2NRA C;  2CW8 A;  3DEE A;  3GFI A;  1KQ9 A;  4ESF A;  1OCR H;  2NOJ B;  1Y0N A;  2FJ1 A;  2KRC A;  2XGE A;  2Y0M A;  2HQ5 A;  1WSU A;  2L7F P;  1ETY A;  3M9A A;  4MFD A;  4QPO A;  1WQ2 A;  1NK3 P;  4G7Z F;  4BKX A;  1I1S A;  4XLA A;  2JSP A;  4OIR F;  2NOG A;  1JI8 A;  3KZZ A;  2CQN A;  2VL8 A;  3T8R A;  3FXL A;  4F91 B;  1PVE A;  1OJL A;  1PP8 F;  4UY8 I;  1QBJ A;  1YW9 A;  3COA C;  2CUF A;  1U2W A;  3RTR A;  2W4S A;  3JRH A;  4IZZ A;  3K4B A;  5ILS A;  2HR3 A;  2K85 A;  3JRD A;  4G9Y A;  3GXO A;  4BEH B;  4RDU A;  2B7E A;  3QPH A;  2L4A A;  2NNN A;  3CF5 F;  3JR9 A;  3I5U A;  1ZR2 A;  1YRN B;  4K2E A;  4S04 A;  1X1C A;  1JTX A;  3GEZ A;  1ON2 A;  3DV8 A;  3KZY A;  4YII A;  1J09 A;  3H5N A;  4UXN A;  1MBH A;  4M3G A;  4QIW N;  2DYS H;  2IA0 A;  5FRO A;  3CCS I;  3A0B C;  4Y13 A;  4L5I A;  1T39 A;  4UB6 C;  3OYN A;  4DNC A;  5HLH A;  1B4A A;  3MKW B;  1W36 C;  1YJW I;  1R23 A;  2YU3 A;  1J75 A;  4F93 B;  1V5E A;  2ZJP F;  3K4K A;  3CME I;  4XL9 A;  3DKY A;  2OTL I;  1A5J A;  3HOV J;  1HKT A;  2LKX A;  5K7Z A;  2EIM H;  2E1O A;  2H6C A;  3LSH A;  1SD4 A;  4V2F A;  4H4K C;  2EV5 A;  2AS5 F;  1DU6 A;  1Z3X A;  2KZG A;  3AKZ A;  1TWH J;  4FQG A;  3GFM A;  2L9S A;  1O57 A;  1F9N A;  2AHQ A;  3R61 A;  1G3Y A;  1FTZ A;  4FIS A;  4FCY A;  2JRT A;  3H5A A;  3MMY B;  3Q3S A;  3QQA A;  2DCE A;  2A6T A;  3C2B A;  1H0M A;  2RNJ A;  5FGM A;  2CG4 A;  3OSG A;  1E0E A;  1P4A A;  3G71 I;  4Q47 A;  5FKL A;  3F8B A;  3FBN B;  4KN4 X;  1FY7 A;  4JYK A;  1K4S A;  2STT A;  3PJR A;  1WI3 A;  2CUJ A;  4M3F A;  1LKX A;  5LGN A;  2BHY A;  2MGQ A;  2YX7 A;  1FC3 A;  3DBH B;  5M5Y J;  2QUF A;  2IJL A;  2JVG A;  1R5H A;  1U6G A;  1VFC A;  2LY9 A;  1KU9 A;  4FHT A;  2HVR A;  3PSF A;  4YEJ A;  5LLQ A;  4BDZ A;  1Z21 A;  4CUG A;  3CUQ C;  2VBZ A;  1RI7 A;  2CQQ A;  3DTK A;  5EG0 B;  5FLX Z;  3C7J A;  3BZC A;  2LY2 A;  1XDU A;  1MBG A;  3QPT A;  3RZD J;  4R1H A;  2XRN A;  4B3A A;  1LEB A;  4HZF A;  1WJE A;  3T5X A;  1DQU A;  1B8I B;  1NK2 P;  2YS9 A;  3P9C A;  1JGS A;  2EFO A;  1K78 A;  3GO5 A;  3BLY A;  4NBQ A;  3HGY A;  4HG2 A;  2CUZ A;  4AU7 A;  2PJR B;  2W1O A;  2E71 A;  3G73 A;  2EV0 A;  2W85 A;  4OAZ A;  4EGZ A;  2R5Y B;  2KRF A;  2F4M B;  5J8F A;  1U3E M;  3HUG A;  3DWL E;  2HOA A;  3HKZ N;  2N8G A;  2G9W A;  4NB5 A;  3ISP A;  4CA0 A;  1HST A;  5HNF A;  3OR1 C;  2K40 A;  4ENK A;  3CJN A;  4HDV A;  3LSM A;  4PGH A;  5FKN A;  1S72 I;  1S9H A;  1R5G A;  1IGN A;  3VWB A;  1RNL A;  1XCB A;  4IQ4 A;  5KVR A;  2ZXW H;  3MZH A;  1BC8 C;  3IRQ A;  1TC3 C;  5ICE A;  2Q2E B;  3HSE A;  2UXN A;  1HW2 A;  3L09 A;  4MHG A;  3RKW A;  1QPI A;  3LFU A;  1BR2 A;  3EUK L;  3LAJ A;  1V54 H;  4X6A J;  1BR1 A;  1IXS B;  1E17 A;  2EZK A;  5FLV A;  1BBY A;  2E60 A;  5GPA A;  2KPM A;  1A6I A;  2GBY A;  1QU3 A;  2BOL A;  3LMM A;  2OUM A;  4D5F A;  3H9J A;  2FOW A;  3LFK A;  2HQA A;  1TTY A;  4P96 A;  1GV5 A;  4GRI A;  1Z7U A;  3K70 D;  3OL3 A;  5BMZ A;  3BPV A;  3F8M A;  2K4J A;  3KP5 A;  4L9V A;  3MAJ A;  1T95 A;  2KFD A;  3BR5 A;  2VC1 A;  4R79 A;  5K1Y A;  2EIK H;  5HVQ C;  4WK8 F;  1ZQ3 P;  2HOT A;  5J40 A;  3HBL A;  2LD5 A;  5JR3 A;  1IO2 A;  2IA1 A;  2O3F A;  3A02 A;  1G4D A;  3QP6 A;  3WTW C;  4DOZ A;  4MTD A;  4BNC A;  2A5W A;  2H94 A;  4B8X A;  2O8K A;  1MSF C;  3E0J B;  1FTT A;  4Y3O A;  1FYL A;  5BPI A;  2X9D A;  2R7V A;  1QA6 A;  4PJ0 C;  4AIH A;  5CVV A;  2QBY A;  1YI2 I;  2EFQ A;  1X1P A;  2BY0 A;  4XRM A;  4OIO F;  4AM3 A;  4XSX F;  1D3Y A;  2W24 A;  2R5Z A;  3N97 A;  4UVC A;  2FBI A;  4IX7 A;  2Z3Y A;  1R7J A;  2JJ7 A;  5LFA A;  1D1C A;  2K9Q A;  4A6D A;  2O5R A;  3TDZ C;  3BG9 A;  3PNV A;  3TKY A;  4NC8 A;  3KIO A;  2JUG A;  2P7C B;  5F1J A;  4F55 A;  3WTX C;  3S2W A;  4B1R A;  3O2P E;  3QOD A;  4OMY A;  5BNG A;  3ZQG A;  4BQQ A;  3FIW A;  4ZDL A;  2BBY A;  2H09 A;  3I4M J;  2A07 F;  1E3P A;  3FWE A;  3CCJ I;  5F0C A;  2HGC A;  4Q48 A;  3A0H C;  3WTT C;  2VN2 A;  3QOP A;  2X6W A;  2O7O A;  4RBO A;  1IN6 A;  4PZJ A;  2K9S A;  2FQ4 A;  3KEO A;  2OA4 A;  4ITV A;  5GPC A;  5HDN A;  5EJC A;  3SEZ A;  2VKV A;  1MJ9 A;  1NG6 A;  3GLX A;  4XSZ F;  3S17 J;  1XB4 A;  3IAS 2;  4L9J A;  1S5L C;  3GZ6 A;  1J5Y A;  3GW2 A;  3CCV I;  1YFH A;  1Z6R A;  1MDM B;  3DKX A;  3B6A A;  3HEF A;  1XSV A;  5HOO A;  4RS8 A;  2X48 A;  3KP3 A;  1IG7 A;  2CH0 A;  2AQF A;  3PM1 A;  3BOQ A;  2V4J C;  3E6B A;  3IRR A;  2BXY A;  1LDJ A;  4D1Q A;  3PQJ A;  3O8G A;  5FRM A;  1TW2 A;  1AHD P;  4XID A;  5C4J J;  3S3M A;  4G7O F;  3H3V K;  1YIO A;  2XB0 X;  3FHZ A;  3JRI A;  2HYJ A;  3IH3 A;  4WX9 A;  3CO6 C;  3QU6 A;  4G6Q A;  2FU4 A;  3FIS A;  4CYC A;  5TRD A;  1SFO J;  2H27 A;  1USS A;  1H88 C;  5B3S H;  3I58 A;  3IH4 A;  4M9S A;  3H9G A;  3OYG A;  1HBX G;  1H8A C;  2HWV A;  4IL6 C;  1R36 A;  2OJE D;  3FKJ A;  4KIB A;  1U5T C;  3PIO F;  1X19 A;  1XGM A;  2KIQ A;  5LGT A;  3S93 A;  3S1M J;  2VIX A;  3V8K A;  4N9H A;  2R7D A;  5LRR A;  3RJP A;  3ZN0 A;  4CDG A;  3K2Z A;  1OYY A;  2UXX A;  1HKQ A;  3ZXS A;  1D0X A;  2CSO A;  4BXU A;  4FTH A;  4XK4 A;  3ROU A;  3L7W A;  3N05 A;  1X4O A;  3K10 A;  4IF4 A;  3BG5 A;  2CWE A;  3SHF A;  3OWT A;  3RIR A;  3CC4 I;  1QZE A;  2RNG A;  3BQZ A;  1LE8 B;  4E70 A;  1WZ2 A;  5EGO A;  5ICF A;  4A3J J;  2BVM A;  3IL2 A;  1ZK8 A;  5J4Y A;  2VQL A;  1GV2 A;  4N4N B;  3TOA A;  3H5R A;  5FLX K;  2UUZ A;  3SJM A;  2VOP A;  2M5W A;  5DCM A;  3RPU A;  3I53 A;  5DM6 F;  1B6A A;  1A31 A;  2JPB A;  1JUP A;  1YO5 C;  4D7M A;  1R58 A;  4I09 A;  1MH3 A;  3WTU C;  2WAQ N;  4F92 B;  2GXG A;  1WJ5 A;  4HNT A;  3CP2 A;  4NUB A;  4DGW B;  4KNY A;  2LFB A;  1RKT A;  1T6S A;  1SEU A;  5AIP A;  2LBF B;  4GDF A;  2CMP A;  1ZG3 A;  1U78 A;  5IT3 A;  3VOE A;  2ACJ A;  4M72 A;  5L3B A;  4CCJ A;  2K9N A;  1ZTR A;  3K4L A;  4MNU A;  1ERD A;  4HEA 2;  2FQ3 A;  2LLK A;  2W48 A;  4JBA A;  4HQM A;  2DI3 A;  2PQ8 A;  1DPU A;  2MD0 A;  5DV5 A;  3RKQ A;  1CF7 B;  4XIC A;  3O6B B;  4BY1 J;  1I6H J;  4ZTF A;  2IP2 A;  2ME6 A;  2DA2 A;  2EZL A;  1FP1 D;  2XC7 A;  2UWM A;  1XCV A;  4IHV A;  4LLL A;  2WY7 Q;  2XAG A;  3RPQ A;  2MH2 A;  4BDY A;  4XNF A;  1JHF A;  3X2Q H;  4ZTJ A;  1YX3 A;  3SZG A;  2B0L A;  4XM3 A;  3ZQH A;  3QAH A;  1O3S A;  2R7T A;  3BR2 A;  1J7K A;  1VZ0 A;  3NWT A;  3A4C A;  2HZT A;  1FNN A;  3SXY A;  1JT6 A;  4YFK F;  1B9M A;  1GVD A;  1R22 A;  1XTA A;  3DCF A;  1W7P B;  3SDG A;  5JLW A;  2VLA A;  2ZJ2 A;  4C3I J;  4KIG A;  1YIJ I;  3NWS A;  2NS0 A;  3AG4 H;  3VYS B;  2KQR A;  3KP7 A;  3TDU C;  4NQW B;  2WAF A;  3PL8 A;  3OYM A;  1OYW A;  1R49 A;  1OQY A;  2V1D A;  4FX0 A;  3ECH A;  2M3A A;  1BL0 A;  2DU9 A;  3V8J A;  1Q1V A;  1GVJ A;  2VQG A;  1MZB A;  1RR7 A;  4C3H J;  4LJZ F;  4YIF A;  5HLG A;  1LNW A;  2NS8 A;  1R1T A;  1ZRE A;  1VF9 A;  3F8F A;  3I3L A;  3WHB A;  2B9S A;  4UUV A;  3AG2 H;  3AG3 H;  2JA6 J;  3S15 J;  1W5T A;  2VKH A;  2XKP A;  4ZYE A;  2BXZ A;  4B43 A;  4Q4Z F;  1ZRC A;  1J9I A;  2X1D A;  1KYW A;  5JVT A;  3FF5 A;  1TQM A;  2K02 A;  5F0H A;  2PFB A;  3KYC B;  4LD5 A;  3VFZ A;  1B72 A;  2V7F A;  2FBK A;  2CUE A;  4HOB A;  5HDG A;  2Y30 A;  4Z2Y A;  3FXQ A;  4CH7 A;  3K4C A;  4I76 A;  3V42 A;  1IN7 A;  5DYM A;  2HYF A;  2LKP A;  1DGR M;  1Z05 A;  2IS4 A;  1WCM J;  2CW7 A;  1XGN A;  3B73 A;  3CUQ B;  3V7C A;  3K1P A;  2L5Q A;  3FXO A;  4UHT A;  2C6Y A;  2WAD A;  3J7Y J;  3KYL A;  1PUF B;  4NDL A;  3CCQ I;  1EJ9 A;  4AVZ A;  2JT1 A;  3CMA I;  1JUS A;  1D5Y A;  2KKO A;  4LLG F;  4QWQ A;  1LDD A;  2GA1 A;  4MFE A;  1W36 D;  1SFK A;  2X0L A;  2V6C A;  4I7H A;  2M4K A;  1JE8 A;  2PLY A;  3MKZ A;  1VQ7 I;  4II2 A;  5H20 A;  1IV6 A;  2JQ7 A;  2KMU A;  3OYL A;  4A3L J;  1TNT A;  2DA1 A;  3K69 A;  3TP0 A;  2QGU A;  4HNV A;  2D5V A;  2L9V A;  4DYR A;  1F43 A;  4BE0 A;  4HDU A;  3M8J A;  3OOU A;  1T56 A;  3JRB A;  5L3G A;  3QYF A;  1ZHF A;  3WTZ A;  2Y9Y A;  2Y0S N;  1X2N A;  4XRS G;  2EZH A;  2EBI A;  5FLM J;  3CCU I;  2QSH X;  4HSR A;  4HF0 A;  3WE3 A;  2WB1 A;  3BJA A;  3ZP5 A;  4AIK A;  5LHG A;  2OZ6 A;  3I71 A;  3S32 A;  5LHI A;  4F7Z A;  1I27 A;  4EM2 A;  5LBQ A;  5IP7 J;  1FOW A;  2A61 A;  4Z6Y A;  3QOE A;  2A6H F;  2ID3 A;  2RQP A;  3FXR A;  1X3U A;  3QU3 A;  2FBH A;  1OPC A;  1FSH A;  3HOY J;  3E5X A;  1EKE A;  3P9K A;  2QQA A;  3TP3 A;  1WJF A;  2FF4 A;  3BJ6 A;  3EYY A;  4E7Z A;  2E36 A;  1IZ1 A;  3HSR A;  1D0Y A;  4ZYD A;  3BQY A;  3BRO A;  2M0C A;  5L3C A;  3EUA A;  4BQA A;  3V7S A;  2KP6 A;  2NS7 A;  5F64 A;  5TJJ A;  2FOK A;  1TLH B;  2VAS A;  5BQT A;  2R7Z J;  1PYV A;  3H92 A; 
#chains in the Genus database with same CATH homology
 5D8L B;  2VC0 A;  5FO5 A;  2Y48 A;  3RKY A;  3R6S A;  3WU1 B;  3GF2 A;  4LMY A;  1SD7 A;  2HKO A;  3HTS B;  3F3X A;  2G7H A;  4CYD A;  2P8T A;  3U1D A;  2CO5 A;  5D5V B;  1BIB A;  1BC7 C;  2XAS A;  2ZXJ A;  4M73 A;  3REO A;  3CDH A;  2QZ8 A;  3F8N A;  3ECO A;  4L9T A;  1JXS A;  4CO8 A;  5ERI A;  2DTR A;  3F6O A;  2AXL A;  2P6S A;  2K86 A;  1YLF A;  3HRU A;  5AON A;  3F72 A;  5CVJ A;  3ZMT A;  3EET A;  3K0L A;  3M1E A;  4HV5 A;  3E5U A;  5FFX A;  4BHC A;  1OYI A;  5D5X B;  1UHM A;  3E6C C;  4P9U A;  1EV7 A;  2BGC A;  3J81 Z;  3ZMU A;  1LJ9 A;  1ZRD A;  3EUH A;  3SQN A;  2ESN A;  2KJC A;  3DF8 A;  4ENN A;  2VBX A;  3HOT A;  2YR2 A;  3WOD F;  1ZAO A;  1WRJ A;  5FB2 A;  1YS7 A;  2P7V B;  1IN5 A;  3L00 A;  2FEZ A;  3ZMV A;  4KIC A;  2VOD A;  4ZH4 F;  4Y15 A;  1MGT A;  4RGR A;  5IT9 K;  5DD8 A;  3C1D A;  3GWZ A;  2YX4 A;  3EDP A;  2WC2 A;  3KLO A;  4CGZ A;  4A5N A;  2DQR A;  2V79 A;  3M8E A;  2ZME A;  1BOA A;  1H9G A;  5CVI A;  2COM A;  4JK1 X;  4S05 A;  3V8L A;  4IVN A;  2XIG A;  4M9X A;  1FBQ A;  3M8F A;  1F5T A;  2QWW A;  4RGU A;  3RKX A;  1IN8 A;  3HYI A;  3I54 A;  2ZKZ A;  1BI3 A;  3ML6 A;  4RB2 C;  5DEQ A;  3DKW A;  3RYR A;  2NAZ A;  5FD6 A;  5BPD A;  1ZLK A;  1U5T B;  2VT2 A;  2RC4 A;  1YW8 A;  2FA5 A;  2YSR A;  1IRG A;  2QEN A;  3GX4 X;  3FM5 A;  2ELH A;  4HLX A;  3ZPL A;  1BI2 A;  4N9I A;  4FX4 A;  3IC7 A;  1ZAR A;  1OKR A;  4ENM A;  4U0Y A;  3P9I A;  5CYV A;  1B9N A;  4KDP A;  4WXH A;  4G94 A;  5CJ9 A;  1T0F A;  1YTY A;  3RI4 A;  1FX7 A;  2DK8 A;  2PMU A;  2KIF A;  3E6M A;  1BI1 A;  1OR7 A;  3R0A A;  4LLN A;  1NHA A;  3KP2 A;  2HQR A;  1QNT A;  4L18 B;  4HA8 A;  2KIM A;  2GQQ A;  3JAM Z;  5K5R A;  1J0R A;  3LA3 A;  1R1U A;  1T38 A;  1XGS A;  2CGP A;  2O61 A;  2PBI A;  2Z9O A;  2EFN A;  2FXA A;  1HW1 A;  1P6R A;  1ZGA A;  2W84 A;  3JTG A;  1KGS A;  4ESJ A;  1ZH5 A;  1ODD A;  4EJW A;  1KA8 A;  3LAP A;  2DLL A;  2FNA A;  3R0J A;  3KP4 A;  4GXO A;  3LST A;  4IHS A;  1XSX A;  3JTH A;  1UB9 A;  4WWC A;  3WG9 A;  5D6F A;  2WV0 A;  2L54 A;  3WE2 A;  1XDS A;  3BDD A;  4R8H A;  1RIO H;  4UVB A;  2QQ9 A;  1RUN A;  1U8R A;  1TQI A;  2FML A;  2NYX A;  1P4W A;  1G3T A;  3KP6 A;  2E1N A;  1GXP A;  3L2C A;  3J81 K;  2EFW A;  2M1B A;  3RDI A;  3IWF A;  3F22 A;  4HX4 A;  1IF1 A;  1KQ0 A;  3SFZ A;  5HS7 A;  1K78 B;  3I4P A;  5FD5 A;  4U88 A;  1HW5 A;  4ASN A;  2MC3 A;  2O8X A;  2XGX A;  3Q9S A;  2D45 A;  1TBX A;  4HF2 A;  2LNB A;  3AAF A;  2Q8K A;  5A2Q K;  1KU7 A;  3TO6 A;  1GXQ A;  4A5M A;  5L3E A;  1IAW A;  2W25 A;  1TNS A;  1AOY A;  4BAY A;  2E7X A;  1W7P A;  4PDK A;  4L9N A;  4U0W A;  2F2E A;  3DEU A;  2DO7 A;  1SMY F;  1VTN C;  5H6R A;  3K1M A;  4LG0 A;  3FX3 A;  3I59 A;  3T1B A;  5ILV A;  2PJP A;  4MQV A;  2Y75 A;  2MLG A;  1S6L A;  4WXD A;  1F1Z A;  5E1Z B;  2HDC A;  4GYG A;  2QQB A;  2O6G E;  4MEX F;  3BJO A;  4P9F A;  3DP7 A;  5BS6 A;  4L5J A;  3ZQ7 A;  4CIC A;  1IW7 F;  3ERE D;  5FFZ A;  4I98 B;  2RDP A;  1S29 A;  3WTY C;  3CTA A;  4CXF A;  3T0Y A;  4RB3 C;  4ZYG A;  3BY6 A;  4ON0 A;  3K1N A;  2WWY A;  4IJA A;  2IRF G;  3LA7 A;  5LEJ A;  4RB1 A;  1DUX C;  5DD4 A;  1WWX A;  4IPA A;  5E20 A;  2EA4 A;  3GUD A;  4KMF A;  1KQ8 A;  2QBY B;  2ZFW A;  4EJO A;  6PAX A;  2ISY A;  1PP7 U;  3SZP A;  3JSP A;  4BHB A;  2ZNY A;  4IXA A;  2MBF A;  1P92 A;  5IT9 Z;  4YFX F;  1GHC A;  2FMY A;  2OU2 A;  2A5Y B;  3TO9 A;  4RGX A;  4ZYH A;  1K7A A;  3JAM K;  1MJA A;  2EB7 A;  2MH9 A;  3D5L A;  4IRI A;  4MQ9 F;  1HKS A;  3HHH A;  1I1G A;  2O03 A;  3SZT A;  1P4X A;  2R7F A;  4AIJ A;  1O3Q A;  4XLN F;  1UCR A;  4HQE A;  2D1H A;  2L4M A;  3HOS A;  4LGW A;  3IKT A;  2JTV A;  2PMH A;  4MTE A;  3HSF A;  1RUO A;  4IHT A;  4LB6 B;  4IRH A;  4KT5 C;  5LHH A;  5EEG A;  2RKH A;  2G7U A;  1TQP A;  1UFM A;  4AWX B;  2FE3 A;  5LGU A;  3PFI A;  2V1X A;  3KEQ A;  4O5V A;  4Q5S F;  4PCQ A;  2P5V A;  1ZYR F;  1Z9C A;  2EJR A;  4BH9 A;  1J2X A;  1HXD A;  2D2W A;  1I6X A;  2DT5 A;  2V1U A;  1QZY A;  2RGV A;  2XV4 S;  1SFU A;  2STW A;  5CVU A;  4A6E A;  1S3J A;  2JPC A;  2ESH A;  2UZK A;  2IT0 A;  5ICG A;  5J8C A;  2FNP A;  1YG2 A;  3ELK A;  3J7A O;  5HS8 A;  4HF1 A;  2F5C A;  2GZW A;  1P2F A;  4O6J A;  5DCM B;  1R00 A;  2P4W A;  3U2R A;  4HBL A;  1QGP A;  2CFX A;  1F4K A;  3PQK A;  5F1R A;  2DPU A;  1J59 A;  3VB2 A;  3NEU A;  4RAZ A;  2F5D A;  1LVA A;  2VT3 A;  4FT8 A;  3JW4 A;  4M6Y A;  1W4M A;  2MLK A;  4M74 A;  3KET A;  3CLO A;  1YQA A;  3KE2 A;  2L01 A;  3J80 K;  4KIF A;  2EWN A;  3LQQ A;  3LWF A;  3W6J B;  4BHP A;  3JSO A;  1AWC A;  2L3D A;  4YG2 F;  5EEH A;  5D4R A;  4LK0 F;  3OOP A;  2X4H A;  1K79 A;  4I02 A;  4L0Y B;  2HQN A;  1STZ A;  1FYM A;  5LEK A;  2M87 A;  1XD7 A;  5E1W A;  4ZZD A;  4EGY A;  1RZ4 A;  2W57 A;  3F23 A;  1FBU A;  2XHK A;  1SD5 A;  4M71 A;  3TQN A;  1FBS A;  4L0Z B;  2ETH A;  1V3F A;  1T2K A;  3R60 A;  2MD5 A;  3W6K B;  2XVC A;  2LF8 A;  4JQF A;  3FMR A;  1H9T A;  1O7F A;  1G3W A;  2K7L A;  1HQC A;  1V4R A;  3ULQ B;  1XMA A;  4ENJ A;  4IRG A;  3WTV C;  4Y17 A;  3WGH A;  2CYY A;  2YPR A;  3WTS C;  5K5O A;  5J6X A;  4A12 A;  2J5P A;  1WI9 A;  5L3F A;  3T8T A;  1FZP B;  1ZG1 A;  1BI0 A;  5CVR A;  5A2Q Z;  4HX8 A;  1REP C;  3LA2 A;  2Q2E A;  4U7D A;  1IUY A;  4EJV A;  1XN7 A;  1EH6 A;  2XAH A;  1BN5 A;  1IRF A;  3E5Q A;  1ONV A;  2ZCW A;  2ADU A;  3FM3 A;  3MCZ A;  1FPQ A;  4MGR A;  1DDN A;  3F6V A;  4KUM A;  4OOI A;  4WXC A;  4HV6 A;  4I01 A;  4QLC U;  2CQK A;  5D4S A;  2PI0 A;  1S7A A;  1Y0U A;  2XRO A;  3TGN A;  4G8X A;  1ZN2 A;  2DAO A;  2PG4 A;  1ON1 A;  1FWZ A;  5HS9 A;  3FZV A;  3ZMD A;  2HTJ A;  5E18 F;  4XLP F;  3MWM A;  1KU2 A;  2DK5 A;  1B1B A;  2JSC A;  3R4K A;  3ZMS A;  1D8K A;  1W5S A;  5HLI A;  2GWR A;  3C3W A;  4UNO A;  3L9F A;  3IKV A;  4RGS A;  1LQ1 A;  2BV6 A;  2A6E F;  2KJB A;  2A69 F;  3GZ5 A;  3QP5 A;  1EH7 A;  1LEA A;  3GFJ A;  2K27 A;  2O0Y A;  2IVM A;  4KMU X;  4N0B A;  3F21 A;  4I0A A;  3GYH X;  1FT9 A;  4RB0 A;  4EM1 A;  2VE9 A;  4M6X A;  5JHU A;  2HYG D;  2NNY A;  3RYP A;  5JI6 A;  2DPD A;  5HDK A;  1SD6 A;  2IA2 A;  3MEX A;  2P6T A;  4P5O A;  2IPQ X;  1UHW A;  1YS6 A;  2DFI A;  1MDM A;  3O3K A;  2HKX A;  2OQR A;  4XRF A;  2PN6 A;  4GYI A;  3OV8 A;  1BJA A;  2MA3 A;  2XAF A;  4KA4 A;  4U0V A;  2VE8 A;  5AIQ A;  2P5K A;  1FOK A;  1O7L A;  2RVC A;  3HHG A;  3Q5F A;  2GIV A;  2ZME B;  2IW5 A;  4OMZ A;  2DBB A;  5K5Q A;  1S7O A;  1HSJ A;  1XSD A;  1FYK A;  4A0Y A;  2GA2 A;  3BP8 A;  1MD0 A;  4I0B A;  3DXJ F;  2HOE A;  2XUB A;  3ZN1 A;  4A0Z A;  5D8K B;  5DUI A;  1YYV A;  2XAJ A;  4OIN F;  4GGG A;  5KK1 A;  3ABT A;  4B09 A;  2R3S A;  3ABU A;  1MJB A;  1QQI A;  2E7W A;  2HS5 A;  1B59 A;  2ZO4 A;  1Z6T A;  2Z33 A;  2D1V A;  3WGI A;  4DQ2 A;  4ESB A;  3HTU A;  5ICC A;  2DW4 A;  4MEY F;  1KU3 A;  4O3M A;  1QZZ A;  2DQL A;  2J5O A;  1CF7 A;  1IN4 A;  4UVA A;  2GAU A;  3NQO A;  4HW0 A;  1E2X A;  3H3Z A;  4KFC A;  3J80 Z;  1O3T A;  2ZBK A;  4LFU A;  4ZZL A;  3FMS A;  4PGG A;  5DDG A;  2H6B A;  3IWZ A;  2GXB A;  5E17 F;  3P7N A;  3DQV C;  3WU0 A;  4NQW A;  3V7R A;  1TW3 A;  2V9V A;  3KLN A;  4GCV A;  5F6F A;  2A68 F;  1EH8 A;  5DUK A;  4UV8 A;  2QYO A;  5ILU A;  4HLY A;  5E8G A;  2OAZ A;  3CO7 C;  2M45 A;  2QVO A;  2RV8 A;  4EQQ A;  4CHU A;  4D0P A;  4EJU A;  2VBW A;  3E97 A;  5L3D A;  3CUQ A;  3IHU A;  4I2O A;  2VON A;  2FSW A;  2L02 A;  4P55 A;  3BPX A;  2CW0 F;  1R1V A;  1I5Z A;  1SFE A;  2ZNZ A;  3BWG A;  3BZ6 A;  3KCC A;  1QO0 D;  4ETS A;  2Z99 A;  3MQ0 A;  5JFR A;  1G3S A;  4OIQ F;  3C18 A;  1MKM A;  3E6D A;  3N4M A;  1SFX A;  1A04 A;  2M8E A;  2BE5 F;  3ZMZ A;  3MZY A;  3FXU A;  1LDK B;  3LQR A;  5H6Q A;  4WCG A;  3EQL F;  4CZZ A;  1OMI A;  3EYI A;  4WF2 A;  3E3V A;  3M7G A;  1SAX A;  2E1C A;  1BM9 A;  4LB5 A;  4M9Z A;  2Q0O A;  1XMK A;  1Z1D A;  5D5W B;  2BEO A;  2WTE A;  4RAY A;  1KYZ A;  4H0E A;  3I0T A;  4EM0 B;  4XBF A;  1SMT A;  1LB2 A;  3U9G A;  4OU0 A;  2OZU A;  2QM3 A;  1PDN C;  2JZY A;  1CGP A;  1DPR A;  3QRF F;  2LDU A;  1IXC A;  2EV6 A;  4EVI A;  5ED4 A;  1QPM A;  1ULY A;  3HIF A;  2PEX A;  2XKO A;  3Q9V A;  4LG0 B;  3F8C A;  3I59 B;  3NRV A;  2BYV E;  3MFK A;  2XAQ A;  2ISZ A;  1Q1H A;  2M30 A;  4U7B A;  3KFW X;  2OQG A;  1FSE A;  1ZLJ A;  4HAM A;  3H3U A;  2F5E A;  2HEO A;  3DPT A;  1ZGJ A;  2EK5 A;  4LK1 F;  2VXZ A;  1ZG5 A;  1ZRF A;  1IXR C;  3HRS A;  4A2U A;  4A0X A;  4KN7 X;  1XGO A;  2HTS A;  3CUO A;  1L3L A;  1FLI A;  5D6E A;  4EMS A;  5D5U B;  2P5L C;  3HRT A;  4KYW A;  3TO7 A;  3VOD A;  2TDX A;  3B02 A;  4GO1 A;  2KIU A;  4AD9 A;  3WGG A;  4UV9 A;  3DPL C;  4HYE A;  5LRS A;  3HRM A;  1D5V A;  2K4B A;  1W7P D;  4EV0 A;  1T98 A;  2FRH A;  2F5F A;  1D8J A;  3GVA A;  1UST A;  1L0O C;  3FMQ A;  1O3R A;  4G6D A;  2RN7 A;  1G6N A;  1JHH A;  5E1X A;  2VOO A;  4G7H F;  5CLS A;  4HX7 A;  1DP7 P;  5BOX A;  4BYY A;  2LF7 A;  3G3Z A;  2VBY A;  2OBP A;  1K6O A;  4AVP A;  5DCF A;  5E8I A;  3DFG A;  1BIA A;  2OD5 A;  1C0W A;  2QLZ A;  1Z91 A;  3D0S A;  1YW7 A;  3V4G A;  3VEP A;  1U5T A;  3TOB A;  2Z5U A;  4EJT A;  2LSO A;  3K9T A;  2HFH A;  1FP2 A;  2EA2 A;  2EFP A;  1WKM A;  4TV7 A;  1S8N A;  4NHJ A;  3I64 A;  4OIP F;  2A3S A;  3GFL A;  4YFN F;  1PUE E;  2NRA C;  3GFI A;  1KQ9 A;  4ESF A;  2Y0M A;  1WSU A;  3M9A A;  1WQ2 A;  4G7Z F;  1I1S A;  4OIR F;  3KZZ A;  3T8R A;  1PP8 F;  1QBJ A;  1YW9 A;  3COA C;  1U2W A;  3RTR A;  5ILS A;  2HR3 A;  4G9Y A;  3GXO A;  3QPH A;  2L4A A;  2NNN A;  3I5U A;  4K2E A;  4S04 A;  3GEZ A;  1ON2 A;  3DV8 A;  3KZY A;  4YII A;  4UXN A;  2IA0 A;  4Y13 A;  4L5I A;  1T39 A;  4DNC A;  5HLH A;  1B4A A;  1R23 A;  2YU3 A;  1J75 A;  1HKT A;  2H6C A;  1SD4 A;  2EV5 A;  2AS5 F;  3GFM A;  1O57 A;  1F9N A;  3R61 A;  1G3Y A;  2JRT A;  1H0M A;  2RNJ A;  5FGM A;  2CG4 A;  1P4A A;  4Q47 A;  4KN4 X;  3F8B A;  2STT A;  1FY7 A;  5LGN A;  2YX7 A;  1FC3 A;  2QUF A;  2IJL A;  1R5H A;  1U6G A;  1KU9 A;  4FHT A;  5LLQ A;  3CUQ C;  2VBZ A;  1RI7 A;  5FLX Z;  3C7J A;  1XDU A;  3QPT A;  4R1H A;  2XRN A;  1LEB A;  4HZF A;  3T5X A;  3P9C A;  1JGS A;  2EFO A;  1K78 A;  3GO5 A;  3G73 A;  2EV0 A;  2W85 A;  4EGZ A;  2KRF A;  5J8F A;  1U3E M;  3HUG A;  2G9W A;  4NB5 A;  3ISP A;  1HST A;  4ENK A;  3CJN A;  4HDV A;  4PGH A;  1R5G A;  1RNL A;  1XCB A;  5KVR A;  3MZH A;  1BC8 C;  3IRQ A;  5ICE A;  3HSE A;  2UXN A;  1HW2 A;  3L09 A;  4MHG A;  3RKW A;  3LAJ A;  1E17 A;  1IXS B;  1BBY A;  3LFK A;  1TTY A;  4P96 A;  1Z7U A;  5BMZ A;  3BPV A;  3F8M A;  2K4J A;  3KP5 A;  4L9V A;  3MAJ A;  2VC1 A;  4R79 A;  5K1Y A;  5HVQ C;  4WK8 F;  5JR3 A;  2IA1 A;  2O3F A;  1G4D A;  3QP6 A;  3WTW C;  4MTD A;  4BNC A;  2H94 A;  4B8X A;  1FYL A;  5BPI A;  4AIH A;  5CVV A;  2QBY A;  2EFQ A;  4OIO F;  4XSX F;  1D3Y A;  3N97 A;  2W24 A;  4UVC A;  2FBI A;  2Z3Y A;  1R7J A;  4A6D A;  3TDZ C;  3TKY A;  2P7C B;  3WTX C;  3S2W A;  3O2P E;  4OMY A;  2BBY A;  2H09 A;  2A07 F;  3FWE A;  2HGC A;  4Q48 A;  3WTT C;  2VN2 A;  3QOP A;  1IN6 A;  4PZJ A;  3KEO A;  2OA4 A;  5HDN A;  1MJ9 A;  3GLX A;  4XSZ F;  1XB4 A;  4L9J A;  3GZ6 A;  1J5Y A;  3GW2 A;  1YFH A;  1MDM B;  1Z6R A;  1XSV A;  5HOO A;  4RS8 A;  3KP3 A;  3BOQ A;  3E6B A;  3IRR A;  1LDJ A;  3PQJ A;  1TW2 A;  4G7O F;  1YIO A;  3FHZ A;  4WX9 A;  3CO6 C;  3QU6 A;  4G6Q A;  2FU4 A;  5TRD A;  2H27 A;  1USS A;  3I58 A;  4M9S A;  1HBX G;  2HWV A;  1R36 A;  4KIB A;  1U5T C;  1XGM A;  5LGT A;  3V8K A;  4N9H A;  2R7D A;  5LRR A;  3RJP A;  3ZN0 A;  4CDG A;  3K2Z A;  1OYY A;  2UXX A;  1HKQ A;  2CSO A;  4BXU A;  3ROU A;  3L7W A;  4IF4 A;  2CWE A;  3SHF A;  3RIR A;  4E70 A;  5ICF A;  3IL2 A;  3TOA A;  5FLX K;  2VOP A;  2M5W A;  5DCM A;  3RPU A;  3I53 A;  1B6A A;  2JPB A;  1YO5 C;  1R58 A;  4I09 A;  3WTU C;  2GXG A;  4KNY A;  1T6S A;  5AIP A;  1ZG3 A;  1U78 A;  5IT3 A;  3VOE A;  2ACJ A;  4M72 A;  5L3B A;  4MNU A;  2FQ3 A;  4JBA A;  4HQM A;  2DI3 A;  2PQ8 A;  1DPU A;  5DV5 A;  1CF7 B;  3O6B B;  2IP2 A;  1FP1 D;  2UWM A;  1XCV A;  4LLL A;  2XAG A;  3RPQ A;  2MH2 A;  1JHF A;  2B0L A;  1O3S A;  3QAH A;  1J7K A;  2HZT A;  1FNN A;  3SXY A;  4YFK F;  1B9M A;  1R22 A;  1W7P B;  2ZJ2 A;  4KIG A;  2NS0 A;  3KP7 A;  3TDU C;  1OYW A;  4FX0 A;  2V1D A;  3ECH A;  2DU9 A;  3V8J A;  5HLG A;  4YIF A;  1GVJ A;  1MZB A;  4LJZ F;  1LNW A;  1R1T A;  1ZRE A;  3F8F A;  4UUV A;  1W5T A;  2XKP A;  4ZYE A;  4Q4Z F;  1ZRC A;  1J9I A;  1KYW A;  5JVT A;  3FF5 A;  1TQM A;  2K02 A;  2PFB A;  3VFZ A;  4LD5 A;  2FBK A;  4HOB A;  5HDG A;  4Z2Y A;  3FXQ A;  1IN7 A;  5DYM A;  2HYF A;  2LKP A;  1Z05 A;  1XGN A;  3B73 A;  3CUQ B;  3V7C A;  3K1P A;  4UHT A;  2C6Y A;  2JT1 A;  2KKO A;  4LLG F;  4QWQ A;  1LDD A;  2GA1 A;  2X0L A;  2V6C A;  4I7H A;  1JE8 A;  2PLY A;  5H20 A;  1TNT A;  3K69 A;  4HDU A;  5L3G A;  1ZHF A;  3WTZ A;  4HF0 A;  3WE3 A;  3BJA A;  3ZP5 A;  4AIK A;  5LHG A;  2OZ6 A;  3I71 A;  5LHI A;  4F7Z A;  1I27 A;  4EM2 A;  5LBQ A;  2A61 A;  2A6H F;  3FXR A;  2RQP A;  1X3U A;  3QU3 A;  2FBH A;  1OPC A;  1FSH A;  3E5X A;  3P9K A;  2QQA A;  2FF4 A;  3BJ6 A;  3EYY A;  1IZ1 A;  3HSR A;  4ZYD A;  3BRO A;  5L3C A;  4BQA A;  3V7S A;  5F64 A;  5TJJ A;  2FOK A;  1TLH B;  5BQT A;  3H92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...