3ELKA

Crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
104
Chain Sequence
TRERILHGLITLYILKELVKRPMHGYELQKSMFETTGQALPQGSIYILLKTMKERGFVISESSVNKGQQLTVYHITDAGKKFLDHSQALQLARKIIDDLLSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator TA0346
publication title Crystal structure of putative transcriptional regulator TA0346 from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
total genus 26
structure length 104
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3elkA00
2VT2A 4P9UA 2DT5A 2XIGA 3FMRA 4I2OA 1R22A 1BJAA 2FA5A 3WGGA 1U78A 2VE8A 2D45A 4R1HA 4RB1A 1H0MA 4HOBA 4O6JA 5F6FA 1DDNA 3DXJF 1KYZA 1TBXA 3WGIA 1F9NA 2M45A 2DU9A 3R61A 4IJAA 4H0EA 1IF1A 4CZZA 1L0OC 4ASNA 2ISZA 3RKYA 3J80Z 4EJWA 2ZXJA 1BC8C 3QAHA 3LAPA 3F8NA 5LGTA 4ZZLA 4BHCA 4HLXA 2J5PA 4Q5SF 4WXCA 1IW7F 3DP7A 4PGGA 4A0ZA 3KLOA 1G4DA 5HLGA 4I01A 4JK1X 5HS8A 3RYPA 1W7PA 1LDJA 1PUEE 3RKWA 4HF0A 2V1UA 3L00A 5TRDA 2XKOA 1YFHA 1TQPA 1NHAA 4BH9A 2VODA 3RPUA 5LRSA 1USTA 4KIBA 4I02A 5CVVA 4ON0A 2XAJA 5D4SA 2DK5A 2DFIA 2QYOA 2BYVE 1IN6A 3GVAA 1G3SA 2JSCA 4HV5A 4MQ9F 2ZNZA 1FBQA 1LDKB 1T6SA 1FX7A 3V7SA 4S04A 2P7VB 1MKMA 1TW2A 1ULYA 2VBWA 3I5UA 2STWA 4NQWA 1S7OA 3T5XA 4ENMA 2V9VA 1HSJA 4Y13A 3COAC 1W5TA 4ZYEA 4IXAA 4MQVA 3BJAA 5BPDA 2PQ8A 2GWRA 4G7OF 1E17A 2OU2A 4KIGA 3IRRA 4OIQF 3V7CA 1LNWA 1R7JA 2P6TA 3BWGA 2A68F 4UUVA 4GO1A 3IHUA 2VC0A 4A6EA 1BI1A 4HAMA 5K1YA 5BQTA 1KU2A 1X3UA 5DCMA 1T98A 2F5EA 2VN2A 5FD5A 4EJUA 2ZBKA 4KNYA 1FP2A 5CVJA 2ELHA 2R7DA 2KJBA 2FMYA 1H9GA 2XUBA 1R5HA 4ENJA 4Q4ZF 3ZN1A 4AIKA 1K7AA 2Q2EA 1LDDA 2FBKA 5ILSA 1J59A 5L3CA 4PDKA 3S2WA 4MTDA 3LQQA 2QLZA 2HQNA 5HVQC 4WK8F 2OA4A 5D5VB 4HDUA 1HSTA 3F8CA 2QENA 5F64A 1J75A 2OQGA 1FYLA 1K6OA 3HUGA 4G6DA 1BIBA 1B59A 2C6YA 3CDHA 2HS5A 4BYYA 3KP3A 1E2XA 3KZZA 3TO7A 4HQEA 4OIPF 1WQ2A 3KFWX 1XCBA 2GA2A 1Z6TA 1UHMA 1P92A 1P4WA 2P5KA 1R1UA 5E1XA 1ON2A 4I98B 3WTVC 1RNLA 5BPIA 2QQ9A 2KIFA 2A5YB 4LB6B 4R8HA 2H09A 1D5VA 3JSOA 2COMA 3LA7A 2DBBA 3ML6A 3K1NA 1W7PB 3VFZA 4M6XA 2ZFWA 2UZKA 1ZG1A 1S6LA 2RC4A 4OOIA 3WTWC 3WTXC 4L5IA 1FNNA 4P5OA 3JSPA 2OD5A 1XB4A 1QZYA 2MLKA 2A07F 2K02A 3PQKA 2O8XA 1Z05A 2KRFA 5FD6A 4DQ2A 4IVNA 5ED4A 2BBYA 4ESBA 2FU4A 5LGNA 3CUQA 1FY7A 2XHKA 5FLXZ 4L5JA 1MGTA 1R58A 1HKSA 4OU0A 2FBIA 5JR3A 4G7HF 3DF8A 1KU9A 4ETSA 2XROA 1XMAA 4P55A 4UNOA 4ENNA 2CO5A 4TV7A 1F4KA 1FC3A 2BGCA 3ZN0A 4MHGA 3EDPA 4OINF 4CGZA 3ULQB 1I27A 1TLHB 3K69A 5DCMB 3VOEA 3TO6A 2XAGA 5L3EA 1IN4A 2LF8A 2XAQA 4BHBA 4LB5A 2DPDA 4CICA 1UB9A 3ZMTA 1O3QA 1I6XA 5HS9A 4KN7X 2VBXA 3WE3A 4RGRA 4EV0A 1O3TA 3EETA 3L09A 4L9JA 3QRFF 2EV6A 1RUNA 3IC7A 4WXDA 3GXOA 4FT8A 3WU0A 2E7WA 2FEZA 1SD7A 1WKMA 1XDSA 4WX9A 3R0AA 4S05A 3N4MA 1D8KA 3E5UA 2HEOA 1Y0UA 2JPBA 1KQ9A 1FYMA 1SFEA 1YYVA 3F23A 1I1SA 3WTUC 5HDKA 1O7FA 3RKXA 1GXQA 1RZ4A 4L0YB 5KVRA 1LQ1A 5K5OA 2VE9A 3LA2A 4U0VA 3W6KB 2YU3A 1ZRFA 4O3MA 2GAUA 3IL2A 2RV8A 4G7ZF 3EUHA 1IRFA 3K0LA 5IT9K 5K5RA 3SZPA 2MA3A 3RPQA 3GEZA 3L2CA 3HHGA 3CUQC 4UV9A 4EM0B 4HQMA 2AXLA 5LHGA 1B9MA 2GXGA 4AWXB 1P4XA 3R60A 3C1DA 3LSTA 1ZGJA 4EJOA 3O6BB 2P4WA 5L3FA 2GIVA 4EGZA 2DTRA 4IRHA 1WI9A 2Z99A 2H27A 4RAZA 2PFBA 2RVCA 2Z3YA 2FXAA 3F3XA 1FOKA 4IHTA 4LLLA 2CGPA 3CUQB 4EJTA 1J0RA 5J6XA 2ETHA 2AS5F 1P4AA 2LSOA 3DQVC 1SAXA 4XLNF 1QBJA 4KMUX 2M8EA 3ECHA 4I7HA 3RI4A 1W7PD 1O7LA 3BJ6A 3E6CC 5D5WB 1HXDA 3NEUA 5A2QZ 3BROA 3KEOA 3NQOA 2DAOA 1T2KA 2HWVA 3SXYA 3BP8A 4LLNA 2L4MA 4L9TA 5CVIA 2PJPA 4A12A 5CVRA 3TDUC 3WG9A 2E7XA 3L7WA 2L54A 1FPQA 1W4MA 5BOXA 2NNYA 2RQPA 4FHTA 4PZJA 3JAMK 4WWCA 4RB3C 4KN4X 5HDNA 4FX0A 5ILUA 1R1VA 1IN5A 3WTSC 2CQKA 1IUYA 4BXUA 1Z9CA 2VBZA 4OMZA 1ZHFA 3TDZC 1K78A 1R5GA 5H6QA 1FYKA 1J5YA 1KQ0A 3F6VA 3U1DA 1XSXA 3GZ6A 3FM5A 5CJ9A 3BDDA 2D2WA 1QGPA 2QM3A 2L02A 3D5LA 2Y0MA 2EV5A 4ZZDA 5D5XB 2L4AA 3K1MA 3V8LA 2R3SA 1SMTA 1R00A 1D8JA 2O6GE 1HKTA 3HTUA 3KLNA 3JTGA 2HKOA 3KE2A 3GF2A 2XASA 5ICEA 4GYGA 4HYEA 3P9IA 3I71A 5AIPA 3GO5A 2M5WA 3JTHA 4EJVA 3LA3A 4Y15A 3Q9VA 1XGOA 1YO5C 4YIIA 2OZ6A 2FE3A 1P6RA 3E3VA 3DEUA 3M8EA 2DQRA 3QOPA 4I0BA 3CO7C 4LK0F 1BI2A 2K4JA 2W25A 1YW7A 2BE5F 2VXZA 2P6SA 3OV8A 1V3FA 4YG2F 4HZFA 2EK5A 2MLGA 2QWWA 2YX4A 5DCFA 1XGNA 2JPCA 3P7NA 1UHWA 3QPHA 5ILVA 2EB7A 1YW8A 5DD4A 2VONA 4IHSA 3R6SA 3MQ0A 4CO8A 1ZYRF 4M73A 2EV0A 4B8XA 2KIMA 2XKPA 2QQAA 3B73A 4LFUA 2FMLA 5DEQA 5D8LB 2IJLA 2CG4A 2GQQA 2IW5A 4KIFA 1GVJA 1BC7C 1FBUA 2VOOA 3HYIA 1YS6A 2A61A 4HBLA 5HOOA 3FXRA 5E8GA 3VB2A 3CUOA 1ZH5A 5H6RA 2PMUA 4HLYA 1KGSA 3N97A 1FP1D 2FSWA 2FRHA 2ADUA 4UXNA 3F8MA 1PP8F 1DPRA 2L01A 3C7JA 2F2EA 4UV8A 3MZYA 2FQ3A 1IZ1A 1SD6A 1D3YA 2FOKA 5LGUA 2H6CA 1LB2A 3ZP5A 3FZVA 2QBYA 1KA8A 1JHFA 3KP7A 3M8FA 2K7LA 4L9NA 1TQIA 4ZYGA 4M74A 1IXCA 3E6BA 1YTYA 3SFZA 4EVIA 5HLHA 3GFIA 4ENKA 1XDUA 4M9SA 3PFIA 2HOEA 1MD0A 3G73A 1K78B 3Q5FA 2XRNA 2DW4A 1S7AA 2F5DA 2EFQA 2L3DA 2BEOA 1AOYA 2V79A 4EM1A 2DI3A 1Z1DA 1OYWA 1HW2A 3VODA 3J81K 2QQBA 3MZHA 4YFXF 4HX4A 2GA1A 1ZREA 4HDVA 3G3ZA 4WXHA 2WC2A 2JRTA 2EFWA 1Z7UA 3H3ZA 3EYIA 2CW0F 3ROUA 3ZMSA 5L3GA 2LDUA 1L3LA 1ZARA 2BV6A 3V4GA 1EV7A 3ABTA 1XN7A 1O3RA 3T8RA 2HTJA 1SFUA 3W6JB 3DKWA 3KP2A 5HDGA 2OZUA 3U2RA 2YX7A 2P7CB 2HGCA 5LHIA 3WGHA 2LKPA 4A5MA 3ZMUA 4U0YA 1T0FA 4L9VA 3WU1B 4N0BA 2HDCA 1OYIA 4Q47A 1BIAA 3EYYA 4HX7A 2ISYA 1ON1A 5E18F 1MJAA 4KUMA 2KJCA 1ZAOA 5ICGA 2V1DA 1RUOA 4E70A 1OYYA 2HQRA 5LRRA 1TQMA 1IAWA 3R4KA 2DLLA 3RYRA 1OPCA 2MH9A 5DUIA 3BOQA 3KP5A 5KK1A 2NS0A 2PG4A 2EA2A 2F5CA 3GW2A 4KFCA 1RIOH 1Z91A 3TOBA 1YS7A 1UCRA 2UWMA 2RGVA 5CYVA 1F1ZA 1SFXA 4M6YA 2O0YA 2RNJA 4G94A 2G7HA 3BJOA 3GLXA 3WTYC 2HTSA 3WTTC 4HA8A 1P2FA 2IP2A 4CHUA 1BI0A 1SMYF 4RB2C 3LAJA 3V8JA 4LK1F 2XGXA 2QBYB 4N9IA 3MCZA 2D1VA 4XRFA 5D5UB 4YIFA 2FBHA 1LEAA 4K2EA 1ZRCA 2PBIA 4RB0A 3TGNA 1EH6A 2JZYA 3HSFA 2Q0OA 1TW3A 2M30A 4BHPA 5J8CA 1G3WA 2MC3A 2DK8A 6PAXA 4FX4A 1XD7A 2LF7A 2XV4S 5ICFA 2ZKZA 1U5TA 1FZPB 2HR3A 5EEHA 5FFXA 1XGMA 4AIHA 2IA0A 2WTEA 2RN7A 2RKHA 3RDIA 1EH8A 1U6GA 1PDNC 1XSDA 4A0XA 3CO6C 4QLCU 4WCGA 3FMQA 4OMYA 2EWNA 3FX3A 2XVCA 3HRTA 3SHFA 3ZPLA 1ZLJA 4GCVA 2V1XA 2HYFA 5H20A 5JVTA 2X4HA 3QP5A 4ESJA 3O2PE 3P9CA 1FBSA 1YW9A 4IRIA 3LQRA 1STZA 4IPAA 2ZO4A 4UHTA 1YG2A 2X0LA 3GFJA 1OKRA 3F8BA 2ZJ2A 1IRGA 2OAZA 4KA4A 3HSRA 4Q48A 4EMSA 4XSZF 4G6QA 3DPTA 1BM9A 4ZYHA 1HBXG 3HIFA 2O03A 3DV8A 3M9AA 4R79A 2H94A 2CYYA 4HW0A 4I09A 1KU3A 2IRFG 1BI3A 1U3EM 2W85A 5CLSA 1Q1HA 1QO0D 5FLXK 3KZYA 4B09A 3CTAA 2IVMA 4AD9A 2MD5A 4L0ZB 5LBQA 3ZMVA 1MJ9A 2K4BA 1WWXA 2NYXA 4NHJA 1U2WA 1J9IA 3V7RA 1UFMA 2ZMEB 3U9GA 3ABUA 3ELKA 1LJ9A 3J81Z 3EQLF 1MJBA 5HLIA 3BY6A 2PMHA 3M1EA 1U5TC 1YIOA 4HF1A 2VT3A 2OBPA 3K1PA 2NAZA 1H9TA 4AIJA 1O3SA 4UVCA 4I0AA 4IF4A 3TOAA 1B9NA 3FHZA 2Z9OA 3FF5A 4ZH4F 2W24A 1BOAA 3ISPA 3E6DA 5D4RA 1CF7A 2FNPA 3F72A 4RS8A 1QNTA 3IWFA 2YPRA 3BPVA 4O5VA 1B4AA 4YFNF 4LMYA 3NRVA 1GXPA 1KYWA 1TNTA 3GUDA 2EJRA 1U5TB 2STTA 1G3YA 3HRMA 4ESFA 3GFMA 5AIQA 4HX8A 5ERIA 1LVAA 5FGMA 3VEPA 4KYWA 2O61A 1GHCA 2DQLA 1XMKA 4A0YA 1VTNC 4HF2A 3I64A 2W57A 2UXNA 2A3SA 2RDPA 1C0WA 1LEBA 3WE2A 2VOPA 2G7UA 4LJZF 1USSA 3QPTA 4LG0A 4L18B 3E6MA 4GYIA 1ZRDA 2A6EF 1XCVA 3KP6A 3KEQA 1IN7A 1REPC 4U0WA 5K5QA 3HOSA 3K2ZA 3BZ6A 3C18A 4P96A 3F8FA 3R0JA 4XBFA 3OOPA 5TJJA 4RGUA 2IPQX 3MFKA 2FNAA 4P9FA 2ZNYA 1O57A 3HTSB 1OMIA 4PGHA 3D0SA 3L9FA 5FFZA 4CXFA 5FB2A 4EM2A 3KP4A 3B02A 1QPMA 2A6HF 4LGWA 5D6EA 1OR7A 4UVAA 2HKXA 1XGSA 4QWQA 3I58A 1BBYA 4G8XA 3DFGA 3QU3A 1TNSA 5L3BA 1EH7A 1DUXC 4PCQA 4U7BA 5IT9Z 3TKYA 1JE8A 2NNNA 3I59A 4EGYA 3GFLA 1B6AA 2WV0A 5HS7A 4M72A 3ECOA 5JFRA 1YLFA 2QUFA 3T8TA 2ESNA 2W84A 4LLGF 5E1WA 4AVPA 1I1GA 5E8IA 5BS6A 2FF4A 2IA1A 2E1NA 5JI6A 5CVUA 2VC1A 2E1CA 2K86A 4RGXA 3T1BA 5A2QK 3GWZA 5AONA 2UXXA 1MDMA 1WRJA 2TDXA 1ZLKA 3HRSA 2EFPA 3V8KA 3FMSA 3TO9A 2EFNA 2ESHA 1HW1A 1QQIA 4M9ZA 1WSUA 3GX4X 2MH2A 4UVBA 3RJPA 4CDGA 2KKOA 1CF7B 5F1RA 1J7KA 4D0PA 4HV6A 3J80K 3E97A 4YFKF 2LNBA 4JBAA 3RTRA 2Y75A 2DPUA 4G9YA 4XSXF 1AWCA 4MEYF 3C3WA 4GGGA 1KU7A 3CJNA 1DP7P 5DDGA 3IKVA 1JHHA 2KIUA 1HQCA 2P5LC 1U8RA 4Y17A 3FXQA 3Q9SA 4EQQA 1R1TA 2F5FA 2Z5UA 3E5QA 2OQRA 3AAFA 4F7ZA 2V6CA 1S8NA 3F6OA 4M9XA 3TQNA 4LG0B 5D6FA 1ZG3A 4ZYDA 1XSVA 4GXOA 2PI0A 1PP7U 3RIRA 4U7DA 1QZZA 2QVOA 2HZTA 1B1BA 2Y48A 1IXSB 3JAMZ 3O3KA 2YR2A 2ZCWA 3JW4A 5D8KB 5LLQA 1G3TA 2GZWA 2IT0A 2QZ8A 1JXSA 1BN5A 1F5TA 2EA4A 3J7AO 4KMFA 4XLPF 4LD5A 5DUKA 1T38A 4IRGA 3MWMA 1R23A 2M87A 3ZMZA 2M1BA 2A69F 2Z33A 4KICA 5L3DA 3IRQA 2HFHA 3ERED 5DD8A 1TTYA 2J5OA 1ZG5A 3SZTA 4DNCA 3HRUA 2XAHA 3HHHA 2ZMEA 1ODDA 1FSHA 4N9HA 2K27A 2PLYA 1HW5A 1ZGAA 1SD5A 4RAYA 3HSEA 2PN6A 5JHUA 1SD4A 3K9TA 3I59B 3MAJA 3H92A 1A04A 2D1HA 3DPLC 5E17F 2XAFA 4MGRA 3I4PA 3QU6A 3SQNA 1R36A 2G9WA 3MEXA 2Q8KA 3T0YA 1S3JA 2R7FA 1J2XA 1G6NA 3WTZA 1DPUA 2P8TA 3KETA 5LEJA 4Z2YA 3I54A 2O3FA 4WF2A 2PEXA 3GYHX 5LHHA 3ZMDA 1MDMB 4MEXF 5EEGA 1W5SA 3HOTA 3F22A 2EFOA 5FO5A 1Z6RA 1KQ8A 3IKTA 2JT1A 4A2UA 1K79A 2CFXA 2DO7A 5E20A 2HYGD 3I0TA 1FSEA 3LWFA 2B0LA 3BPXA 3H3UA 3IWZA 3PQJA 3FXUA 2GXBA 1V4RA 3P9KA 2VBYA 2YSRA 1ONVA 1S29A 1RI7A 4NB5A 1FWZA 4MNUA 1FLIA 4BQAA 5IT3A 1IN8A 3WODF 1I5ZA 1IXRC 2JTVA 5LEKA 1T39A 3E5XA 5ICCA 5E1ZB 1CGPA 3FM3A 3REOA 4RGSA 2CWEA 1JGSA 4M71A 2CSOA 2NRAC 1MZBA 3QP6A 2WWYA 4BAYA 5DYMA 3KCCA 5BMZA 3I53A 3F21A 4MTEA 4A6DA 3CLOA 4BNCA 2MBFA 4JQFA 5J8FA 3M7GA 4OIOF 2IA2A 4A5NA 5DV5A 2P5VA 3ZQ7A 4U88A 3GZ5A 2ACJA 4KT5C 1HKQA 2H6BA 3LFKA 4OIRF 4KDPA 1YQAA 1FT9A 3FWEA 1ZN2A 4CYDA
chains in the Genus database with same CATH superfamily
3GMEA 2LTPA 3JRIA 2VT2A 4P9UA 2DT5A 1NK2P 3DU5A 1M1EB 2XIGA 3FMRA 1MBKA 4I2OA 3VPRA 1R22A 4A69C 3SZGA 1BJAA 2FA5A 3WGGA 3LFUA 1U78A 3TW6A 2DJNA 3A02A 2VE8A 2D45A 4R1HA 3IUOA 5KAIC 4RB1A 4HOBA 1H0MA 4Y7NJ 4O6JA 5F6FA 3M07A 3OYGA 1DDNA 3DXJF 4A3IJ 5IOZA 1KYZA 1YX3A 3PSFA 3ZQLA 2GM4A 1TBXA 3WGIA 2HXIA 4C3IJ 1F9NA 2M45A 3OSGA 1R49A 2DU9A 3R61A 3GBGA 4JP0A 4IJAA 2VI6A 1OCRH 2E5NA 4H0EA 1IF1A 2NVUB 2M4KA 2FQ4A 4CZZA 4XRSG 1L0OC 4ASNA 4N4OB 3HDDA 2ISZA 4UY8I 4CH7A 3GTPJ 3RKYA 2X51A 2MD0A 3J80Z 3EPZA 4EJWA 2ZXJA 1BC8C 3QAHA 3LAPA 5B5EC 3F8NA 4IEJA 5LGTA 2DA5A 4KISA 2EH3A 4ZZLA 3MKYB 5EDNA 4X0GA 1OISA 2DXIA 1RKWA 4BHCA 4XONA 4HLXA 2J5PA 5K7FA 4Q5SF 1SAUA 4WXCA 1IW7F 3DP7A 4PGGA 1VF9A 3OOUA 4A0ZA 5JLXA 2M0CA 3KLOA 2DA6A 2BVMA 1G4DA 5HLGA 2DJIA 4I01A 4JK1X 2H8RA 2CW7A 1JJ8C 5HS8A 5E3OA 3RYPA 2HOTA 1W7PA 1LDJA 1PUEE 1WJ5A 3RKWA 9ANTA 4HF0A 2V1UA 4HPQA 2R93J 3CD6I 1HCRA 3L00A 4J19A 5TRDA 2XKOA 5DM7F 3MN2A 1YFHA 1FMWA 1TQPA 1NHAA 4BH9A 2VODA 4D9JA 3RPUA 5FKNA 5LRSA 2F48A 1USTA 3CCSI 4KIBA 4I02A 5CVVA 4ON0A 4E7JA 3OR1C 2K9SA 4CCLA 2XAJA 1QRYA 5F1JA 5D4SA 2L9RA 2DK5A 2DFIA 3BCAA 2QYOA 4JX4A 2BYVE 5H2FC 1IN6A 3GVAA 1G3SA 2JSCA 4HV5A 4RLFA 2IAIA 4LOCA 1OCPA 4MQ9F 2ZNZA 5GAEJ 1B72A 1FBQA 1LDKB 1T6SA 4IL6C 4XKVA 4XRMA 1FX7A 2HDWA 4CCKA 4XIDA 4B47A 3V7SA 2NVTJ 4A3CJ 4S04A 2V1NA 2P7VB 1MKMA 4DZPA 1IV6A 1TW2A 1ULYA 2VBWA 3I5UA 4BQQA 4EATA 2STWA 4NQWA 1S7OA 3T5XA 4ENMA 3RQ4A 2EZIA 2B7EA 3N05A 3ZOBA 4C3JJ 3DTEA 4XL9A 2V9VA 1RPWA 1HSJA 2LVSA 4Y13A 3COAC 1W5TA 2RNGA 4E7SA 4ZYEA 1SFKA 1QA6A 2DYSH 3I9V2 1EA3A 1Y56A 2DA1A 4IXAA 4MQVA 3L2UA 2BHZA 3BJAA 3G4SI 2CUFA 5BPDA 2JVGA 2PQ8A 2GWRA 2E1MC 4G7OF 3M4OJ 1E17A 2GLOA 4ZYAA 4W1UA 4MLOA 2OU2A 4KIGA 1VQ9I 3IRRA 4OIQF 3CC4I 2XF7A 5EG0B 2Q1ZB 3V7CA 2DDAA 4A93J 1LNWA 1R7JA 2P6TA 3BWGA 4BE0A 2A68F 4UUVA 4BEHB 4GO1A 1ENHA 3IHUA 2VC0A 4A6EA 1BI1A 3OYLA 4HAMA 5K1YA 4F92B 5BQTA 4Y33A 1KU2A 1X3UA 2DOEA 1VQ6I 3FBIB 3DEEA 5DCMA 4E4HA 1T98A 2F5EA 2QKLB 2VN2A 5FD5A 4EJUA 2F4IA 2ZBKA 4KNYA 4FTHA 2XPVA 3LSGA 1FIPA 4HSTA 3DLLF 1UHSA 3BTJA 2V9KA 1G8XA 2E1MB 1FP2A 1VQKI 5CVJA 3FHNA 4CCNA 2ELHA 2R7DA 2KDOA 2KJBA 1FOYA 3BQYA 2FMYA 1X1PA 1H9GA 2XUBA 1R5HA 4BKXA 4ENJA 4Q4ZF 3PNYA 3ZN1A 4AIKA 4FE4A 4DW6A 1K7AA 2Q2EA 4RA2A 4AVZA 4DYQA 1YI2I 1LDDA 2FBKA 5ILSA 1J59A 4A3LJ 5L3CA 1U9OA 4PDKA 3S2WA 4MTDA 2OF7A 3LQQA 1HLVA 5KAFC 3JRHA 4XLFA 2QLZA 4J00A 3OYAA 2HQNA 5HVQC 4WK8F 2OA4A 1MMDA 2AHQA 4KITB 5D5VB 4HDUA 1HOMA 1DP3A 1HSTA 3P5JA 2IEKA 5EJCA 3CDLA 3F8CA 2QENA 5J40A 5F64A 2XPUA 1J75A 3DPUA 2KL4A 2OQGA 1FYLA 2VKVA 3J7YJ 1K6OA 3HUGA 4G6DA 1BIBA 4X1EA 1B59A 2C6YA 3BG3A 2E2IJ 3CDHA 2HS5A 1T8IA 4BYYA 3KP3A 5HNHA 2M9HA 1E2XA 1ERDA 3KZZA 3TO7A 1POGA 2VJJA 2CQNA 4HQEA 4OIPF 1WQ2A 2CQQA 3KFWX 1XCBA 2GA2A 3CLQA 2IS4A 1Z6TA 3DLAA 1UHMA 1P92A 1P4WA 2P5KA 1W0UA 3ONQA 1R1UA 1V5GA 1W36D 5E1XA 1ON2A 4I98B 3A03A 2X6WA 5E3LA 3WTVC 5HNFA 1XC5A 2UUZA 2VQLA 3MKLA 3G71I 4IHWA 1E3PA 1UJ8A 1RNLA 3K10A 5BPIA 2QQ9A 4ZTFA 2LY9A 5FLVA 2KIFA 3AFHA 2A5YB 2A05A 4LB6B 4OAZA 4R8HA 3HOUJ 2H09A 1D5VA 3DWLE 3JSOA 2COMA 4F3QA 3CCLI 1NG6A 3LA7A 2DBBA 3G2BA 3ML6A 3K1NA 1EKEA 1W7PB 3VFZA 4M6XA 2ZFWA 2UZKA 3OMYA 3BC8A 5FKOA 1ZG1A 1SVLA 1S6LA 2RC4A 2MYSA 4OOIA 3WTWC 3WTXC 2I10A 4L5IA 1FNNA 3S32A 1OFCX 4P5OA 4DYRA 1R5ID 3JSPA 2OD5A 1XB4A 3S3NA 1QZYA 4F55A 2MLKA 3VYUB 2EIJH 2A07F 3I56I 2DA7A 3HB9A 4L5EA 2DMPA 3HPHA 3OL3A 1TT5B 4D7NA 4A3DJ 1B72B 2F6CA 2K02A 3PQKA 2O8XA 1Z05A 2KRFA 5FD6A 4DQ2A 4IVNA 4DOZA 5ED4A 2VJ4A 2M7BA 2BBYA 4KT6A 4ESBA 1MNEA 3JRCA 3Q0VA 2ELJA 4BE2A 1LE8A 2FU4A 5BNGA 2X6XA 4HRIA 5LGNA 2E5ZA 1SEUA 3CUQA 1FY7A 2XHKA 5FLXZ 3BTCA 4L5JA 2ID6A 1MGTA 1R58A 2R4GA 4M3GA 3U1KA 1RR7A 5IPAA 1HKSA 4FCYA 3K4LA 4OU0A 3K2AA 4AUXA 4ZTJA 2FBIA 1Y8QB 2WAEA 5JR3A 2CV2A 4BDZA 4G7HF 1W5CC 3DF8A 1KU9A 4ETSA 2XROA 3MKWB 3JR9A 1XMAA 2CH0A 4P55A 4UNOA 2ELKA 4JX5A 2DT7B 1ZKGA 4ENNA 3H35A 4B4CA 5GAGJ 1H88C 2IS6A 2CO5A 3CZ6A 1DQUA 4TV7A 1F4KA 3W3CA 4IHYA 1FC3A 4I6ZA 1WJBA 2BGCA 2VJIA 3ZN0A 4MHGA 2LBFA 3EDPA 1IUFA 2FJ1A 3F0CA 4UUTA 4OINF 3ULQB 4CGZA 1I27A 4A3GJ 2BHYA 5HLTA 4ZDOA 1TLHB 1R4NB 3K69A 5DCMB 3VOEA 3TO6A 1ETXA 2XAGA 5L3EA 2AO9A 4XORA 5GTHC 1IN4A 2LF8A 2XAQA 3VSLA 4RDUA 4BHBA 2QGUA 2M3AA 1HDDC 4LB5A 4H4KC 2DPDA 4CICA 1UB9A 3ZMTA 1O3QA 1QVTA 2VJ5A 1I6XA 5HS9A 2KZGA 4KN7X 4CSWA 2VBXA 3JRBA 3WE3A 4RGRA 4EV0A 5DTDA 3LSPA 2R0QC 3B6CA 1O3TA 2HVRA 2O8KA 2Q2EB 3EETA 3L09A 1UMQA 4L9JA 1ETWA 3QRFF 2EV6A 1RUNA 3IC7A 3HOXJ 1I6HJ 4WXDA 3GXOA 4FT8A 3WU0A 2E7WA 2FEZA 1YJWI 3X2QH 3LSHA 2LY2A 2JA5J 3BTIA 1SD7A 4G6TB 2HQAA 1WKMA 3OY9A 2GBYA 3PFYA 3PM1A 2XC7A 3A0BC 1XDSA 3BQZA 4WX9A 1R6RA 5GP9A 1NH3A 5TGTA 2JA6J 3R0AA 4S05A 2LKXA 5DM6F 1YJ9I 3N4MA 1D8KA 5FROA 3E5UA 2IS1A 2K40A 4DYCA 1T56A 2VLAA 3HUGB 5GPAA 2HEOA 5M5WJ 1Y0UA 2JPBA 1KQ9A 2EZLA 2ID3A 3AG2H 5CQGA 2KP6A 2K9MA 3Q0UA 1YJNI 1FYMA 1ZELA 1SFEA 1YYVA 1MSFC 3F23A 1I1SA 3WTUC 2KRHA 5HDKA 3GTQJ 1O7FA 2OJED 4XK4A 3QPLA 3RKXA 3UKGA 1O4XA 2H1LA 2E1OA 2MG4A 1GXQA 1RZ4A 4XMYA 4L0YB 2X6YA 3LOCA 1EJ9A 5KVRA 2NVYJ 5K5OA 1LQ1A 2VE9A 1UG0A 1OCOH 3LA2A 3LSJA 4U0VA 2YU3A 3W6KB 1ZRFA 4IKFA 4O3MA 2GIZA 1JI8A 4BXXJ 2GAUA 1SC7A 2CQXA 2MABA 3IL2A 3G1OA 3BCBA 1RESA 2RV8A 3OIOA 3L2QA 4G7ZF 3EUHA 2AQEA 3BZCA 2MW8A 1XS9A 1IRFA 3K0LA 5IT9K 3A01A 5K5RA 3AKZA 3SZPA 5J47A 4BDYA 2MA3A 3RPQA 3GEZA 3L2CA 3HHGA 2WBMA 3CUQC 1ETKA 2VB6A 2KPMA 4UV9A 2HU9A 2R5ZA 3NWTA 4EM0B 4HQMA 3JRFA 3JRDA 5M5XJ 2AXLA 4PK4A 1ZR4A 5KCMA 5FKKA 3ZQGA 2TCTA 3WU2C 5LHGA 1B9MA 2GXGA 4AWXB 3FXMA 3OYFA 5KNLA 2NOJB 5C44J 1P4XA 3R60A 1XTAA 3ZQFA 5B3SH 4HNTA 3C1DA 3LSTA 1ZGJA 5FLMJ 4EJOA 3O6BB 2Z16A 4YEJA 2P4WA 2ZSHB 3E7LA 5L3FA 2GIVA 1E0EA 4A3KJ 4EGZA 1VQNI 2DTRA 4IRHA 2BXZA 1TL8A 2IGOA 1WI9A 1YOVB 2Z99A 4S0HB 1V5FA 1U8BA 2H27A 3ZR8X 4GDFA 4RAZA 2IS2A 2LREA 2PFBA 4NBQA 2RVCA 3HGGA 2Z3YA 2FXAA 3F3XA 1LE8B 1FOKA 4E7LA 4IHTA 4LLLA 5C4XJ 2CGPA 3CUQB 1ZR2A 1T08B 4EJTA 1CQTA 1J0RA 1MBFA 1JTXA 5J6XA 2ETHA 2AS5F 2TRTA 2XGCA 3OYJA 1P4AA 2DODA 2LKSA 1MIJA 2LSOA 2KFDA 2RAEA 2E35A 3QODA 3DQVC 3ABKH 5F04A 1SAXA 2L5QA 4XLNF 4DGWB 2WAFA 1QBJA 4KMUX 2M8EA 3S2DJ 2LBFB 3ECHA 4I7HA 2XAUA 3RI4A 3DCFA 4ZJZA 4RBOA 1W7PD 1O7LA 1E3HA 4QTRA 4DZJA 2CS3A 3BTLA 3BJ6A 4BJ6C 2EIMH 3E6CC 3RPUD 4E7IA 5D5WB 1RC9A 1HXDA 3DBRB 3NEUA 4ITVA 5A2QZ 3BROA 3KEOA 3AL0C 3NQOA 2IGNA 2DAOA 1T2KA 2CUEA 1MMNA 2HWVA 4ZDLA 3SXYA 3BP8A 2NVQJ 3OS0A 4LLNA 2L4MA 2A6TA 3PO3J 4L9TA 3K6GA 5CVIA 5EGOA 1Z7LA 2PJPA 3CCUI 1V55H 3VDXA 2OTJI 4A12A 4XR6A 1JUPA 3HBLA 1WJAA 1K61A 2P81A 2PJRA 5F0HA 1DU6A 5CVRA 5CPRB 4BXFA 3TDUC 3WG9A 3S1MJ 2E7XA 3DEWA 2XF6A 3L7WA 2L54A 2HXOA 1A35A 1FPQA 1W4MA 2CFOA 2FUG2 5BOXA 2NNYA 2RQPA 4FHTA 3DKXA 1WGXA 4LITA 4IOAF 4PZJA 3WG7H 3JAMK 4WWCA 4RB3C 1MH4A 4KN4X 5HDNA 2OPTA 3I55I 3EUHC 4FX0A 4QIWN 2M34A 5ILUA 4II2A 1R1VA 3F9KA 1SVOA 4F91B 2DMTA 1JGGA 2Y2ZA 1IN5A 3AL0B 3WTSC 2CQKA 1IUYA 4BXUA 1Z9CA 2VBZA 5M5YJ 4OMZA 2ZXIA 1ZHFA 3H0GJ 3TDZC 1K4SA 4XOTA 1K78A 1R5GA 4PJMA 5H6QA 3H1CA 1OCZH 1FYKA 1J5YA 2JVHA 1KQ0A 3F6VA 3U1DA 1XSXA 2DTZA 2FX0A 3GZ6A 3FM5A 5CJ9A 2QSHX 3BDDA 2D2WA 1QGPA 2QM3A 2L02A 3CMMA 4J01A 3D5LA 3NARA 2E2JJ 2Y0MA 2EV5A 5J1RA 1VQPI 2LP0A 2X1DA 4ZZDA 3FBNB 5D5XB 2L4AA 3ESWB 3L2VA 3D5RC 3K1MA 3HL2A 4V2FA 3V8LA 2R3SA 1SMTA 1R00A 1D8JA 3A01B 2O6GE 1HKTA 4DBQA 3TMOA 1BL0A 3HTUA 3KLNA 3JTGA 2R7RA 1V5EA 2HKOA 3M3YJ 1HC8A 3KE2A 1K6YA 3GF2A 3LSRA 3CJTB 2R5ZB 2XASA 4BJTA 2B9SA 5ICEA 4GYGA 4HYEA 3P9IA 1JKOC 3GLLA 3I71A 5AIPA 3GO5A 2BY0A 2M5WA 3JTHA 3DU6A 4EJVA 1XG1A 5CKTA 3LA3A 3BG5A 3JCUC 1D0XA 4Y15A 5FKLA 1EF4A 5HODA 3Q9VA 3H9JA 1XGOA 2V9PA 1YO5C 2ZSIB 4YIIA 1I3QJ 2VKEA 2OZ6A 2FE3A 2I5UA 3M8JA 2CMPA 1N25A 1FMVA 1P6RA 2HZDA 2X85A 3E3VA 3DEUA 3M8EA 3RSNA 2DQRA 3QOPA 4I0BA 2LY1A 3OYBA 4IQJA 3ABLH 3CO7C 4LK0F 1BI2A 3OIPA 2K4JA 2W25A 1HF0A 1YW7A 3RZDJ 2BE5F 2VXZA 2PX9A 2P6SA 4BGDA 5JVGF 2MFZA 1MBHA 3OV8A 1V3FA 2XGEA 4YG2F 2NVXJ 4HZFA 4D5CA 2EK5A 2NXNB 1Y6IA 2MLGA 2W1OA 2QWWA 1VQMI 2YX4A 5DCFA 1XGNA 2NS8A 2JPCA 4U87A 3P7NA 1UHWA 3QPHA 3FXKA 3RQIA 5ILVA 2EB7A 1YW8A 3CP2A 4AIDA 1MMGA 5M3FJ 5DD4A 2VONA 5F0CA 3A0HC 3QYFA 4IHSA 3G1LA 3R6SA 3CMYA 3BG9A 3MQ0A 5B1BH 4CO8A 1ZYRF 4UUSA 2EPFA 1BW5A 4M73A 2EV0A 4B8XA 1PJRA 3KX2A 2KIMA 2XKPA 2QQAA 3OYNA 3JREA 1H89C 3B73A 4LFUA 2FMLA 5DEQA 1N75A 4M6VA 5D8LB 2IJLA 2CG4A 2GQQA 2IW5A 4KIFA 1GVJA 1BC7C 2EIKH 1TT0A 2R7TA 1FBUA 2CU7A 3K7AJ 2VOOA 3HYIA 4IX7A 1YS6A 2A61A 4HBLA 1RKTA 2MGQA 5HOOA 1WHUA 3FXRA 5E8GA 3VB2A 2LC2A 3CUOA 2LFBA 3FDYA 2PMUA 5H6RA 1P7JA 3SEQA 4HLYA 2KLOA 1ZH5A 1KGSA 2KMUA 3N97A 1FP1D 2VUMJ 2FSWA 2FRHA 3SDBA 3CC2I 5F0FA 2DA4A 2DT6A 2BVLA 3W2VA 4BJ5C 1F36A 5J1YA 3VYSB 2ADUA 1XPXA 4HNVA 4NDLA 4UXNA 3F8MA 4JX6A 4MFDA 1DPRA 2L01A 3C7JA 1PP8F 1X2MA 2F2EA 2QCOA 4UV8A 3MZYA 1U9NA 2FQ3A 2XB0X 5EGOB 1IZ1A 1SD6A 1D3YA 2FOKA 1JKQC 3K4CA 2PJRB 5LGUA 2JSPA 2H6CA 2VXDA 2E36A 1LB2A 2L9SA 3ZP5A 3FZVA 2W82A 1KA8A 4AC0A 2QBYA 1JHFA 2CV0A 1YE9A 3KP7A 2JMWA 4Y4RA 3M8FA 2K7LA 4L9NA 2RQQA 1TQIA 2JUGA 4ZYGA 1WFXA 2L7KA 3FKIJ 4M74A 1IXCA 2ECBA 3E6BA 1YTYA 1D1AA 2KRCA 2IGMA 3ERMA 3SFZA 2P0WA 5C4JJ 3CF2A 1B8IA 3TBIA 1WI3A 5IYCJ 1YIJI 3LSKA 4XKWA 4EVIA 3ZQCA 1OCCH 3QOEA 5HLHA 3GFIA 4ENKA 5FRMA 3CF5F 4D1QA 1IO2A 1XDUA 4M9SA 3PFIA 2HOEA 3VYRB 1MD0A 3G73A 3QQAA 4G12A 1K78B 3Q5FA 2OV7A 2XRNA 2X1EA 2DW4A 1S7AA 2F5DA 5J4YA 1VQ7I 2EFQA 1F43A 1ETOA 2L3DA 1Y39A 2BEOA 1AOYA 1K83J 4AU7A 2V79A 3RKQA 3S16J 4EM1A 2DI3A 2LYCA 1Z1DA 4HSRA 2Y30A 4FETA 1OYWA 4P1WA 1HW2A 1YITI 3VODA 4E6KG 4E7ZA 1P9QC 3QYBA 3J81K 1IRZA 2QQBA 1X1AA 2EZKA 3MZHA 3CMEI 2L0KA 3IH3A 2JWTA 4HX4A 2GA1A 4YFXF 1ZREA 3CESA 5DS9A 3OR2C 2K5CA 4CYCA 3KIOA 3L2WA 4FISA 2LD5A 4HDVA 4Z6YA 1UZCA 2VQCA 1BR1A 3AG3H 3G3ZA 4WXHA 4B3XA 3HG9A 2X9DA 3CJRB 1Y8RB 4V19K 2WC2A 2JRTA 2EFWA 1Z7UA 3GTMJ 3H3ZA 4C2MJ 1MMAA 4ZDPA 3HM5A 3Q0WA 3EYIA 2CW0F 3ROUA 4N4NB 3ZMSA 5L3GA 2CRGA 2LDUA 2LLKA 1NG7A 3J7ZI 1L3LA 1ZARA 3CCEI 2BW3A 2BV6A 3IH2A 3G1MA 3V4GA 1EV7A 3ABTA 2V26A 1XN7A 1O3RA 1X3ZB 3T8RA 3DKYA 1A36A 5F27A 2HTJA 4EEFG 2Y9YA 3O8GA 3K4BA 5IP7J 2DN0A 3CC7I 1SFUA 4CYDA 3W6JB 3DKWA 5JLWA 4V2GA 2JA7J 3QYEA 1VNDA 2CUZA 1TC3C 3GTJJ 4XKCA 3PUBA 3KP2A 5HDGA 1LVKA 1JUSA 2OZUA 3U2RA 1YX5A 2A5WA 3MD2A 2VKHA 2YX7A 2VL8A 2P7CB 2HGCA 5LHIA 3S2HJ 3A1YA 3WGHA 2LKPA 2DMNA 4XOPA 4A5MA 5FJ8J 3ZMUA 4U0YA 2QA4I 5E79C 1T0FA 3HKZN 4L9VA 3WU1B 4N0BA 2HDCA 2R7XA 5K7HA 4AYBN 1OYIA 1FEXA 4PJLA 4XN0A 3IAM2 3H0DA 4Q47A 1BIAA 3CCMI 2DMUA 3FK7A 3EYYA 1Z67A 4HX7A 2ISYA 1ON1A 5E18F 1MJAA 3E0JB 4KUMA 2DA2A 2KJCA 5IYBJ 1FTTA 4UUSB 1ZAOA 1WJCA 2ECCA 3KYDB 5ICGA 3GTOJ 3JRGA 2V1DA 1RUOA 1LPQA 3D1NI 1ETYA 4E70A 1OYYA 2HQRA 5LRRA 1TQMA 2MC4A 4PFOA 1IRXA 1IAWA 3R4KA 3GZNB 2DLLA 4JOMA 1OPCA 5EYRA 3RYRA 2FOWA 3RCOA 2MH9A 3SYTA 5DUIA 3BOQA 2Z1DA 3KP5A 4NUBA 5KK1A 2NS0A 4B43A 2PG4A 2EA2A 2F5CA 3GW2A 4LIUA 1RIOH 4KFCA 1Z91A 3TOBA 1YS7A 1UCRA 3FXJA 4PFPA 1I3AA 2KT0A 2UWMA 4YIRX 2RGVA 4RM3A 5CYVA 4CCMA 3I3LA 1X1CA 2LR8A 1F1ZA 1SFXA 4M6YA 1UG2A 1MMSA 2O0YA 5E3NA 2RNJA 4G94A 3HOZJ 2G7HA 3BJOA 3OYEA 3GLXA 3WTYC 4XLEA 2Z2SB 4NNJA 2KISA 2HTSA 3WTTC 2CJJA 4HA8A 1P2FA 2V4JC 1S5LC 2DDBA 2IP2A 4CHUA 5FRNA 3O8HA 1BI0A 1SMYF 2BOLA 1W0TA 1MBGA 4RB2C 2OUMA 3LAJA 3V8JA 4LK1F 1I50J 2XGXA 3C2GA 4Y3OA 2QBYB 4N9IA 4PJ0C 3HGYA 3MCZA 2D1VA 2HPIA 3ZRGA 2K9LA 1WH5A 4XRFA 3KYCB 3SEZA 1UAAA 3IP4B 5D5UB 4YIFA 2OCEA 4ANJA 3G6EI 2JUCA 2E34A 3CCQI 1QPIA 2FBHA 1LEAA 1HA8A 4K2EA 1ZRCA 2PBIA 2HOAA 2WADA 3PIOF 2X6OA 1B8IB 4RB0A 3TGNA 1EH6A 4D7MA 2JZYA 3HSFA 2Q0OA 4PUSA 1TW3A 3C2HA 2M30A 4BHPA 2Y0SN 5J8CA 1WJFA 1G3WA 2MC3A 2DK8A 2JA8J 6PAXA 3C2BA 4FX4A 2E19A 3MVPA 1XD7A 5IP9J 2LF7A 2XV4S 5ICFA 3HKZA 2DA3A 3OL4A 2ZKZA 4DBRA 1U5TA 4AYBA 1FZPB 2HR3A 4YRVA 5EEHA 3LNQA 5FFXA 1TP4A 4BQOA 4IQ4A 4M3EA 3V42A 1XGMA 2W4SA 4F93B 4AIHA 2KZVA 2QF7A 2O7OA 2IA0A 1QZEA 2KQRA 2WTEA 2RN7A 2O9LA 2RKHA 3RDIA 1EH8A 1U6GA 1UELB 4CYCB 3OYDA 1X3WB 4XQFA 2E60A 1PDNC 4BY7J 1XSDA 1RETA 2PMZN 4A0XA 3CO6C 4E7HA 4II3A 4QLCU 4WCGA 3FMQA 1R4MB 2VPLA 3DBLB 4OMYA 2EWNA 3FX3A 2XVCA 1T0FC 1T95A 3HRTA 3SHFA 3ZPLA 1ZLJA 4GCVA 2V1XA 4B1RA 2HYFA 5H20A 5JVTA 2X4HA 1Z21A 3QP5A 4QPQA 4ESJA 5JHFA 1BW6A 3O2PE 3P9CA 5LD2C 1FBSA 5EF6A 2D5VA 2BW3B 1MBEA 1YW9A 3FXLA 1OCTC 4IRIA 1ITYA 3LQRA 1ZQ3P 1QU3A 1Q1VA 2LMDA 3H5NA 3DTKA 2ZXWH 2R5YA 1STZA 4Y52J 3SFIA 4IPAA 2GXAA 1GVDA 2ZO4A 1A6IA 2EILH 4UHTA 2ME6A 4FASD 1IV8A 1YG2A 3PNTA 4FE7A 2X0LA 3GFJA 2R7OA 4XKBA 1OKRA 3F8BA 1VQ4I 3OIQA 1U0JA 1AA7A 4RAFA 2ZJ2A 2X48A 1IRGA 2OAZA 4KA4A 3HSRA 4Q48A 4EMSA 4XSZF 1Z3YA 4G6QA 3K4KA 1IDZA 1VQ8I 2ZJQF 3DPTA 1BM9A 1H8AC 4ZYHA 2HVQA 3UNGC 4XM3A 1HBXG 3HIFA 5B66C 2O03A 1DU0A 3DV8A 3M9AA 4R79A 2H94A 2OC6A 3MZ8A 3S3MA 2CYYA 4HW0A 4B48A 3NWSA 4XLAA 3GCMA 3PSIA 4PJJA 4XNFA 4I09A 1KU3A 1A31A 2CUJA 2IRFG 2NOGA 1Y1WJ 3ZGKA 2Y0SA 4I76A 1BI3A 4OWRB 2GOXB 1WJDA 2XSJC 1LFBA 5EZGA 1U3EM 4C2UA 2W85A 5CLSA 1Q1HA 4A3EJ 2EBIA 1QO0D 5FLXK 3KZYA 4B09A 3CTAA 2IVMA 5EZHA 4AD9A 2MD5A 4L0ZB 5LBQA 3ZMVA 1MJ9A 2K4BA 1WWXA 2NYXA 1VZ0A 3EUAA 4DIQA 4IO9F 2Y31A 4LG3A 4XLCA 3Q3SA 4B44A 4CZCA 2H8WA 4NHJA 1ZGWA 1U2WA 1J9IA 2AXTC 3ZQQA 3V7RA 1X19A 2F5VA 3WHCA 3S1QJ 4JYKA 2HQ5A 2B63J 2HDDA 1UFMA 2ZMEB 3U9GA 3ABUA 3ELKA 4C30A 1HDPA 1LJ9A 1TWGJ 4CCJA 3J81Z 2PMZA 3EQLF 3H5AA 1MJBA 5HLIA 3PJRA 3QWLA 4ABZA 3BY6A 1VI0A 2M4GA 2WY7Q 1YRNA 4FQGA 5IP6A 2PMHA 1IG7A 3M1EA 4A3BJ 5F08A 1U5TC 1YIOA 4CUGA 5B1AH 4HF1A 3L2RA 2VT3A 2OBPA 3BG6A 1J09A 1N77A 3H5RA 3ZXSA 2BY3A 3OYMA 2L7ZA 3K1PA 3OYKA 1PVEA 2AQFA 2JK3A 2NAZA 2ZXHA 4KJZA 4AIJA 3S1RJ 1H9TA 1O3SA 4UVCA 4CCOA 4A3MJ 4NC7A 4RMNA 2ZJRF 4I0AA 2E71A 4IF4A 2G0EA 3TOAA 3GTGJ 4ZC3A 1ACIA 1B9NA 4C3HJ 3FHZA 2Z9OA 3FF5A 4ZH4F 2W24A 1BOAA 3ISPA 3E6DA 5D4RA 1GT0C 1CF7A 2FNPA 4BACA 4F52A 3F72A 4RS8A 1QNTA 3PL8A 3BR6A 2XB5A 3IWFA 4MFEA 4D5FA 1PUFA 1KONA 2YPRA 3ZQIA 3BPVA 4O5VA 1MSEC 3U21A 1B4AA 2K3PA 5E3MA 1N78A 4PJNA 4LMYA 4YFNF 3NRVA 1GXPA 4HNUA 1KYWA 1TNTA 3WHBA 3GUDA 2EJRA 1U5TB 3W2AA 2STTA 2JJ7A 1G3YA 1Z77A 4RAGA 3HRMA 3BR5A 4ESFA 5KHDA 2QSFX 3DTIA 3GFMA 5AIQA 4HX8A 3BLYA 1SVMA 5ERIA 1LVAA 5FGMA 1IDYA 3VEPA 4KYWA 2O61A 3FKJA 2V7FA 1GHCA 2R7UA 2DQLA 1XMKA 4A0YA 1VTNC 4HF2A 3I64A 2W57A 1R71A 3CCJI 4MIMA 3HC7A 2UXNA 2A3SA 2RDPA 1C0WA 2QEXI 2WB1N 3CDIA 1LEBA 2ICWG 3ZCOA 3WE2A 3GTLJ 2ME0A 4GRIA 5LFAA 1WJEA 2VOPA 1KZHA 2QSGX 1TWCJ 2G7UA 4LJZF 1USSA 3QPTA 4LG0A 4L18B 2XPWA 3E6MA 3BR2A 1X2NA 4GYIA 4HEA2 3D5SC 1ZRDA 1ETQA 2A6EF 1XCVA 3KP6A 3I4MJ 3KEQA 1IN7A 1REPC 4U0WA 5K5QA 3HOSA 3K2ZA 3FISA 3L1PA 3M1CA 3BZ6A 3C18A 4P96A 4MO7A 3ABMH 3KEYA 3F8FA 5J3LA 3R0JA 1VQ5I 4XBFA 3OOPA 1MH3A 5TJJA 1FIAA 2K9QA 4IHVA 4RGUA 2IPQX 3KYLA 2R5YB 2DOFA 3ASOH 2IXSA 3MFKA 2FNAA 1LFPA 2KIQA 1GV2A 4P9FA 4RLQA 2ZNYA 2M0MA 1O57A 5K7ZA 3HTSB 1OMIA 2YUSA 4PGHA 3VSKA 3E1SA 1TWHJ 3D0SA 3L9FA 3HOVJ 2VQGA 5FFZA 4M3BA 2HPMA 2NS7A 5EEAA 4CXFA 2HNHA 2V6EA 1TWAJ 3HOWJ 2YS9A 4BBSJ 4NC6A 5FB2A 4EM2A 3KP4A 2IGKA 3B02A 1QPMA 3CCRI 2A6HF 4LGWA 1D0ZA 3BR1A 1OR7A 3KPHA 5D6EA 4X6AJ 4NC8A 4UVAA 2HKXA 1XGSA 1APLC 1JT6A 4QWQA 4BY1J 3I58A 1BBYA 3FXOA 3H3VK 4G8XA 3OYIA 4IHXA 3DFGA 1YHQI 2XF5A 3QU3A 1TNSA 5L3BA 2VKDA 4BBRJ 3DBHB 1EH7A 3B6AA 2CW8A 1DUXC 4PCQA 2KDZA 4IOCF 1VQOI 2L7MP 4U7BA 5IT9Z 3TKYA 1JE8A 2NNNA 3S1NJ 3BT9A 2CV1A 1X58A 1MW7A 3I59A 4EGYA 3GFLA 5FKMA 3K70C 2FD5A 1B6AA 2JA2A 1AHDP 2WV0A 1X4OA 5HS7A 4M72A 4BUPA 3ECOA 5JFRA 1YLFA 2QUFA 3T8TA 2ESNA 1T33A 2O5RA 3JRAA 2W84A 4LLGF 3HJEA 5E1WA 4AVPA 1I1GA 5E8IA 3PO2J 2WB1A 4BU2A 5BS6A 1I39A 2FF4A 3BR0A 1VFCA 2IA1A 3W2WA 2ZJPF 2YU9J 2E1NA 2WAQN 3OWTA 2ZC2A 2VC1A 2XDVA 5CVUA 5JI6A 2E1CA 2K86A 4RGXA 3TL4X 3ZQHA 1BA5A 1Y0NA 1YRNB 1TWFJ 1K4TA 2R7QA 3T1BA 1X1BA 3H36A 5A2QK 3GWZA 1S72I 5AONA 3RZOJ 1JTYA 2HVSA 4PSXA 2UXXA 1MDMA 1WRJA 2VPRA 3CMAI 2TDXA 2Y9ZA 1ZLKA 3S8PA 3OYCA 3HRSA 2W48A 2EFPA 3V8KA 1WZ2A 3FMSA 5GADJ 3TO9A 1BJZA 3TP0A 5GTIC 1SANA 2ZFUA 2R7VA 2EFNA 2ESHA 1HW1A 2L9VA 1QQIA 4M9ZA 3PUFA 1WSUA 3GX4X 3TP3A 2LOOA 2MH2A 4M3FA 4UVBA 3RJPA 4CDGA 2KKOA 1CF7B 5F1RA 1WPKA 4OAYA 3BZKA 1J7KA 5CQEA 4PSWA 4HV6A 4D0PA 1PUFB 3IV5A 3J80K 2H1KA 3TEDA 3E97A 2K9NA 3OSFA 2JRMA 4YFKF 2LNBA 4JBAA 3RTRA 2DYRH 1OQYA 1ORKA 2VASA 1GLNA 2K3FA 1PYVA 2Y75A 4I99C 4UB8C 3SJMA 1D5YA 2DPUA 1VQLI 4G9YA 4XSXF 3CCVI 3LL7A 1AWCA 3NAUA 1AKHA 4MEYF 3C3WA 4GGGA 1KU7A 3CJNA 1DP7P 2WA0A 5DDGA 2ZB9A 5J4VA 3BG7A 3K4JA 1QHGA 2R92J 3IKVA 1JHHA 2KIUA 1HQCA 1Z3XA 2P5LC 1D1BA 1U8RA 3S15J 2EINH 4Y17A 1IGNA 3FXQA 2XSDC 3Q9SA 4EQQA 4NQWB 1DGRM 1R1TA 2F5FA 2DFFA 4IZZA 1IC8A 4XRSA 1LFUP 3J7AY 2Z5UA 4LIVA 3S17J 1D0YA 2DCEA 2OQRA 3E5QA 1JJ6C 3AAFA 2EQRA 2RREA 3ASNH 2XRLA 3HZJA 4F7ZA 2R7ZJ 2V6CA 5IYDJ 1S8NA 3F6OA 4M9XA 3TQNA 4LG0B 2EZHA 5D6FA 1Z0XA 1ZG3A 1JKRC 4ZYDA 1E3OC 1XSVA 2L2OA 4GXOA 2PI0A 2L9NA 1OR7C 1JUMA 3K4MA 2OTLI 3LMMA 2N8GA 1PP7U 3RIRA 4U7DA 2W00A 1QZZA 2QVOA 2HZTA 1B1BA 3QPSA 1X1DA 3HEFA 2WAQA 2Y48A 4XN3A 1IXSB 3S3OA 3JAMZ 3O3KA 2YR2A 2LH9A 2XGDA 2ZCWA 3JW4A 4XLHA 1GDTA 5D8KB 5LLQA 3FK6A 3MMYB 3KZIC 1AU7A 1G3TA 2GZWA 2IT0A 1S9HA 3VYTB 2F4MB 2QZ8A 1JXSA 1BN5A 1RR8C 2EA4A 2VIXA 1F5TA 3J7AO 4A3FJ 4KMFA 4XLPF 2DMQA 4LD5A 5DUKA 1T38A 2CQ7A 2DOAA 4HG2A 1G59A 2LRDA 3MWMA 1R23A 2M87A 4IRGA 3ZMZA 2M1BA 2A69F 2Z33A 4KICA 5L3DA 3IRQA 2JN6A 2HFHA 3ERED 1MNMC 3H9QA 3HXLA 5DD8A 4C9YA 1TTYA 2J5OA 3AG4H 1ZG5A 3SZTA 4DNCA 4BE1A 3HRUA 2XAHA 3HHHA 2ZMEA 3UR3C 2BZTA 1QHHD 3H9GA 5M3MJ 1ODDA 1FSHA 1GV5A 4N9HA 3SDGA 4BL0B 2K27A 2IBDA 2K85A 2PLYA 1HW5A 1SD5A 3CJQB 4RAYA 3HSEA 3LSIA 2MSYA 3MKZA 2W7NA 2GOMA 1P7IA 2LG4A 1W1WE 2PN6A 5JHUA 1GUUA 1SD4A 3K9TA 3I59B 3MAJA 3H92A 1BOBA 1A04A 2D1HA 3DPLC 5E17F 2XAFA 1NK3P 4MGRA 4QPOA 2QQ8A 3IH4A 3I4PA 3QU6A 3SQNA 1WVRA 2I8DA 1R36A 2G9WA 3PNVA 1SFOJ 5C3EJ 1D1CA 3MEXA 1FOWA 2BY2A 2Q8KA 3T0YA 1S3JA 4DJAA 2QKMB 2R7FA 1J2XA 1G6NA 3WTZA 1DPUA 3HPGA 4W97A 2P8TA 3KETA 1X4PA 5LEJA 2L7FP 4Z2YA 3I54A 1DGWY 2O3FA 4WF2A 2PEXA 4XICA 5LHHA 3GYHX 3ZMDA 1MDMB 1A6QA 5IOYA 4MEXF 1ZK8A 2UV1A 1Y1VJ 5EEGA 1W5SA 3HOTA 1JT0A 2WY8Q 3F22A 4BS9A 5GPCA 3GTKJ 3FIWA 2EFOA 4YELA 1OJLA 3S93A 5FO5A 1Z6RA 1KQ8A 4B3AA 3IKTA 2F4OB 2DFEA 2JT1A 1W36C 4A2UA 1K79A 3S14J 2CFXA 2M7AA 2DO7A 2X1CA 5E20A 2HOSA 2Y69H 2HYGD 3I0TA 1FSEA 3LWFA 1BR2A 2B0LA 3BPXA 1XX5A 3H3UA 3IWZA 3PQJA 3CQZJ 3FXUA 1LKXA 2GXBA 3LSMA 3EUKL 1V4RA 3P9KA 2LK2A 1FTZA 2JQ7A 2VBYA 2YSRA 3K4NA 1A5JA 1ONVA 1XMXA 3AG1H 1S29A 5J1UA 1RI7A 3VWBA 1FOXA 1NTCA 1WH7A 3OS2A 4QSHA 4NB5A 1FWZA 4MNUA 1AKHB 2VQHA 1ETVA 1FLIA 2M8GX 4BQAA 1ZTRA 2BXYA 5IT3A 5EG0A 4M3DA 1IN8A 3HOYJ 3WODF 3PIPF 1MBJA 1I5ZA 1IXRC 2JTVA 2KHMA 5LEKA 2R7WA 1T39A 3E5XA 1OLTA 4BEHA 1R9TJ 5ICCA 1FJLA 4GFBA 5E1ZB 1CGPA 4C2TA 1S7EA 3A4CA 3FM3A 3REOA 4BQNA 1MNDA 3W6VA 4CA0A 2E2HJ 4RGSA 2CWEA 1JGSA 2M2EA 4M71A 2CSOA 4RM2A 2COBA 2NRAC 1MZBA 1TZLA 3BR3A 3QP6A 5GAHJ 4UB6C 2BY1A 3CCYA 5IY5H 2WWYA 4BAYA 1G2HA 5DYMA 3KCCA 5BMZA 3I53A 4E7KA 3CP8A 2HYJA 3F21A 4MTEA 3A2KA 4A6DA 3OYHA 3CLOA 4BNCA 4A3JJ 2OCCH 3TW7A 2WV1A 2MBFA 4JQFA 5J8FA 2HI3A 1WCMJ 3M7GA 1RRJA 3I4NJ 4OIOF 1V54H 2ZMEC 2IA2A 3OS1A 2R7SA 4A5NA 5DV5A 2P5VA 4AM3A 3ZQ7A 1IJWC 4U88A 2DFHA 1QVUA 3GZ5A 2ACJA 4KT5C 3K70D 5TISC 1HKQA 1JKPC 2H6BA 3LFKA 4OIRF 4KDPA 3IAS2 1BR4A 1YQAA 1LUJB 1FT9A 3FWEA 1ZN2A 1ZGAA
chains in the Genus database with same CATH topology
2VT2A 4P9UA 2DT5A 2XIGA 3FMRA 4I2OA 1R22A 1BJAA 2FA5A 3WGGA 1U78A 2VE8A 2D45A 4R1HA 4RB1A 1H0MA 4HOBA 4O6JA 5F6FA 1DDNA 3DXJF 1KYZA 1TBXA 3WGIA 1F9NA 2M45A 2DU9A 3R61A 4IJAA 4H0EA 1IF1A 4CZZA 1L0OC 4ASNA 2ISZA 3RKYA 3J80Z 4EJWA 2ZXJA 1BC8C 3QAHA 3LAPA 3F8NA 5LGTA 4ZZLA 4BHCA 4HLXA 2J5PA 4Q5SF 4WXCA 1IW7F 3DP7A 4PGGA 4A0ZA 3KLOA 1G4DA 5HLGA 4I01A 4JK1X 5HS8A 3RYPA 1W7PA 1LDJA 1PUEE 3RKWA 4HF0A 2V1UA 3L00A 5TRDA 2XKOA 1YFHA 1TQPA 1NHAA 4BH9A 2VODA 3RPUA 5LRSA 1USTA 4KIBA 4I02A 5CVVA 4ON0A 2XAJA 5D4SA 2DK5A 2DFIA 2QYOA 2BYVE 1IN6A 3GVAA 1G3SA 2JSCA 4HV5A 4MQ9F 2ZNZA 1FBQA 1LDKB 1T6SA 1FX7A 3V7SA 4S04A 2P7VB 1MKMA 1TW2A 1ULYA 2VBWA 3I5UA 2STWA 4NQWA 1S7OA 3T5XA 4ENMA 2V9VA 1HSJA 4Y13A 3COAC 1W5TA 4ZYEA 4IXAA 4MQVA 3BJAA 5BPDA 2PQ8A 2GWRA 4G7OF 1E17A 2OU2A 4KIGA 3IRRA 4OIQF 3V7CA 1LNWA 1R7JA 2P6TA 3BWGA 2A68F 4UUVA 4GO1A 3IHUA 2VC0A 4A6EA 1BI1A 4HAMA 5K1YA 5BQTA 1KU2A 1X3UA 5DCMA 1T98A 2F5EA 2VN2A 5FD5A 4EJUA 2ZBKA 4KNYA 1FP2A 5CVJA 2ELHA 2R7DA 2KJBA 2FMYA 1H9GA 2XUBA 1R5HA 4ENJA 4Q4ZF 3ZN1A 4AIKA 1K7AA 2Q2EA 1LDDA 2FBKA 5ILSA 1J59A 5L3CA 4PDKA 3S2WA 4MTDA 3LQQA 2QLZA 2HQNA 5HVQC 4WK8F 2OA4A 5D5VB 4HDUA 1HSTA 3F8CA 2QENA 5F64A 1J75A 2OQGA 1FYLA 1K6OA 3HUGA 4G6DA 1BIBA 1B59A 2C6YA 3CDHA 2HS5A 4BYYA 3KP3A 1E2XA 3KZZA 3TO7A 4HQEA 4OIPF 1WQ2A 3KFWX 1XCBA 2GA2A 1Z6TA 1UHMA 1P92A 1P4WA 2P5KA 1R1UA 5E1XA 1ON2A 4I98B 3WTVC 1RNLA 5BPIA 2QQ9A 2KIFA 2A5YB 4LB6B 4R8HA 2H09A 1D5VA 3JSOA 2COMA 3LA7A 2DBBA 3ML6A 3K1NA 1W7PB 3VFZA 4M6XA 2ZFWA 2UZKA 1ZG1A 1S6LA 2RC4A 4OOIA 3WTWC 3WTXC 4L5IA 1FNNA 4P5OA 3JSPA 2OD5A 1XB4A 1QZYA 2MLKA 2A07F 2K02A 3PQKA 2O8XA 1Z05A 2KRFA 5FD6A 4DQ2A 4IVNA 5ED4A 2BBYA 4ESBA 2FU4A 5LGNA 3CUQA 1FY7A 2XHKA 5FLXZ 4L5JA 1MGTA 1R58A 1HKSA 4OU0A 2FBIA 5JR3A 4G7HF 3DF8A 1KU9A 4ETSA 2XROA 1XMAA 4P55A 4UNOA 4ENNA 2CO5A 4TV7A 1F4KA 1FC3A 2BGCA 3ZN0A 4MHGA 3EDPA 4OINF 4CGZA 3ULQB 1I27A 1TLHB 3K69A 5DCMB 3VOEA 3TO6A 2XAGA 5L3EA 1IN4A 2LF8A 2XAQA 4BHBA 4LB5A 2DPDA 4CICA 1UB9A 3ZMTA 1O3QA 1I6XA 5HS9A 4KN7X 2VBXA 3WE3A 4RGRA 4EV0A 1O3TA 3EETA 3L09A 4L9JA 3QRFF 2EV6A 1RUNA 3IC7A 4WXDA 3GXOA 4FT8A 3WU0A 2E7WA 2FEZA 1SD7A 1WKMA 1XDSA 4WX9A 3R0AA 4S05A 3N4MA 1D8KA 3E5UA 2HEOA 1Y0UA 2JPBA 1KQ9A 1FYMA 1SFEA 1YYVA 3F23A 1I1SA 3WTUC 5HDKA 1O7FA 3RKXA 1GXQA 1RZ4A 4L0YB 5KVRA 1LQ1A 5K5OA 2VE9A 3LA2A 4U0VA 3W6KB 2YU3A 1ZRFA 4O3MA 2GAUA 3IL2A 2RV8A 4G7ZF 3EUHA 1IRFA 3K0LA 5IT9K 5K5RA 3SZPA 2MA3A 3RPQA 3GEZA 3L2CA 3HHGA 3CUQC 4UV9A 4EM0B 4HQMA 2AXLA 5LHGA 1B9MA 2GXGA 4AWXB 1P4XA 3R60A 3C1DA 3LSTA 1ZGJA 4EJOA 3O6BB 2P4WA 5L3FA 2GIVA 4EGZA 2DTRA 4IRHA 1WI9A 2Z99A 2H27A 4RAZA 2PFBA 2RVCA 2Z3YA 2FXAA 3F3XA 1FOKA 4IHTA 4LLLA 2CGPA 3CUQB 4EJTA 1J0RA 5J6XA 2ETHA 2AS5F 1P4AA 2LSOA 3DQVC 1SAXA 4XLNF 1QBJA 4KMUX 2M8EA 3ECHA 4I7HA 3RI4A 1W7PD 1O7LA 3BJ6A 3E6CC 5D5WB 1HXDA 3NEUA 5A2QZ 3BROA 3KEOA 3NQOA 2DAOA 1T2KA 2HWVA 3SXYA 3BP8A 4LLNA 2L4MA 4L9TA 5CVIA 2PJPA 4A12A 5CVRA 3TDUC 3WG9A 2E7XA 3L7WA 2L54A 1FPQA 1W4MA 5BOXA 2NNYA 2RQPA 4FHTA 4PZJA 3JAMK 4WWCA 4RB3C 4KN4X 5HDNA 4FX0A 5ILUA 1R1VA 1IN5A 3WTSC 2CQKA 1IUYA 4BXUA 1Z9CA 2VBZA 4OMZA 1ZHFA 3TDZC 1K78A 1R5GA 5H6QA 1FYKA 1J5YA 1KQ0A 3F6VA 3U1DA 1XSXA 3GZ6A 3FM5A 5CJ9A 3BDDA 2D2WA 1QGPA 2QM3A 2L02A 3D5LA 2Y0MA 2EV5A 4ZZDA 5D5XB 2L4AA 3K1MA 3V8LA 2R3SA 1SMTA 1R00A 1D8JA 2O6GE 1HKTA 3HTUA 3KLNA 3JTGA 2HKOA 3KE2A 3GF2A 2XASA 5ICEA 4GYGA 4HYEA 3P9IA 3I71A 5AIPA 3GO5A 2M5WA 3JTHA 4EJVA 3LA3A 4Y15A 3Q9VA 1XGOA 1YO5C 4YIIA 2OZ6A 2FE3A 1P6RA 3E3VA 3DEUA 3M8EA 2DQRA 3QOPA 4I0BA 3CO7C 4LK0F 1BI2A 2K4JA 2W25A 1YW7A 2BE5F 2VXZA 2P6SA 3OV8A 1V3FA 4YG2F 4HZFA 2EK5A 2MLGA 2QWWA 2YX4A 5DCFA 1XGNA 2JPCA 3P7NA 1UHWA 3QPHA 5ILVA 2EB7A 1YW8A 5DD4A 2VONA 4IHSA 3R6SA 3MQ0A 4CO8A 1ZYRF 4M73A 2EV0A 4B8XA 2KIMA 2XKPA 2QQAA 3B73A 4LFUA 2FMLA 5DEQA 5D8LB 2IJLA 2CG4A 2GQQA 2IW5A 4KIFA 1GVJA 1BC7C 1FBUA 2VOOA 3HYIA 1YS6A 2A61A 4HBLA 5HOOA 3FXRA 5E8GA 3VB2A 3CUOA 1ZH5A 5H6RA 2PMUA 4HLYA 1KGSA 3N97A 1FP1D 2FSWA 2FRHA 2ADUA 4UXNA 3F8MA 1PP8F 1DPRA 2L01A 3C7JA 2F2EA 4UV8A 3MZYA 2FQ3A 1IZ1A 1SD6A 1D3YA 2FOKA 5LGUA 2H6CA 1LB2A 3ZP5A 3FZVA 2QBYA 1KA8A 1JHFA 3KP7A 3M8FA 2K7LA 4L9NA 1TQIA 4ZYGA 4M74A 1IXCA 3E6BA 1YTYA 3SFZA 4EVIA 5HLHA 3GFIA 4ENKA 1XDUA 4M9SA 3PFIA 2HOEA 1MD0A 3G73A 1K78B 3Q5FA 2XRNA 2DW4A 1S7AA 2F5DA 2EFQA 2L3DA 2BEOA 1AOYA 2V79A 4EM1A 2DI3A 1Z1DA 1OYWA 1HW2A 3VODA 3J81K 2QQBA 3MZHA 4YFXF 4HX4A 2GA1A 1ZREA 4HDVA 3G3ZA 4WXHA 2WC2A 2JRTA 2EFWA 1Z7UA 3H3ZA 3EYIA 2CW0F 3ROUA 3ZMSA 5L3GA 2LDUA 1L3LA 1ZARA 2BV6A 3V4GA 1EV7A 3ABTA 1XN7A 1O3RA 3T8RA 2HTJA 1SFUA 3W6JB 3DKWA 3KP2A 5HDGA 2OZUA 3U2RA 2YX7A 2P7CB 2HGCA 5LHIA 3WGHA 2LKPA 4A5MA 3ZMUA 4U0YA 1T0FA 4L9VA 3WU1B 4N0BA 2HDCA 1OYIA 4Q47A 1BIAA 3EYYA 4HX7A 2ISYA 1ON1A 5E18F 1MJAA 4KUMA 2KJCA 1ZAOA 5ICGA 2V1DA 1RUOA 4E70A 1OYYA 2HQRA 5LRRA 1TQMA 1IAWA 3R4KA 2DLLA 3RYRA 1OPCA 2MH9A 5DUIA 3BOQA 3KP5A 5KK1A 2NS0A 2PG4A 2EA2A 2F5CA 3GW2A 4KFCA 1RIOH 1Z91A 3TOBA 1YS7A 1UCRA 2UWMA 2RGVA 5CYVA 1F1ZA 1SFXA 4M6YA 2O0YA 2RNJA 4G94A 2G7HA 3BJOA 3GLXA 3WTYC 2HTSA 3WTTC 4HA8A 1P2FA 2IP2A 4CHUA 1BI0A 1SMYF 4RB2C 3LAJA 3V8JA 4LK1F 2XGXA 2QBYB 4N9IA 3MCZA 2D1VA 4XRFA 5D5UB 4YIFA 2FBHA 1LEAA 4K2EA 1ZRCA 2PBIA 4RB0A 3TGNA 1EH6A 2JZYA 3HSFA 2Q0OA 1TW3A 2M30A 4BHPA 5J8CA 1G3WA 2MC3A 2DK8A 6PAXA 4FX4A 1XD7A 2LF7A 2XV4S 5ICFA 2ZKZA 1U5TA 1FZPB 2HR3A 5EEHA 5FFXA 1XGMA 4AIHA 2IA0A 2WTEA 2RN7A 2RKHA 3RDIA 1EH8A 1U6GA 1PDNC 1XSDA 4A0XA 3CO6C 4QLCU 4WCGA 3FMQA 4OMYA 2EWNA 3FX3A 2XVCA 3HRTA 3SHFA 3ZPLA 1ZLJA 4GCVA 2V1XA 2HYFA 5H20A 5JVTA 2X4HA 3QP5A 4ESJA 3O2PE 3P9CA 1FBSA 1YW9A 4IRIA 3LQRA 1STZA 4IPAA 2ZO4A 4UHTA 1YG2A 2X0LA 3GFJA 1OKRA 3F8BA 2ZJ2A 1IRGA 2OAZA 4KA4A 3HSRA 4Q48A 4EMSA 4XSZF 4G6QA 3DPTA 1BM9A 4ZYHA 1HBXG 3HIFA 2O03A 3DV8A 3M9AA 4R79A 2H94A 2CYYA 4HW0A 4I09A 1KU3A 2IRFG 1BI3A 1U3EM 2W85A 5CLSA 1Q1HA 1QO0D 5FLXK 3KZYA 4B09A 3CTAA 2IVMA 4AD9A 2MD5A 4L0ZB 5LBQA 3ZMVA 1MJ9A 2K4BA 1WWXA 2NYXA 4NHJA 1U2WA 1J9IA 3V7RA 1UFMA 2ZMEB 3U9GA 3ABUA 3ELKA 1LJ9A 3J81Z 3EQLF 1MJBA 5HLIA 3BY6A 2PMHA 3M1EA 1U5TC 1YIOA 4HF1A 2VT3A 2OBPA 3K1PA 2NAZA 1H9TA 4AIJA 1O3SA 4UVCA 4I0AA 4IF4A 3TOAA 1B9NA 3FHZA 2Z9OA 3FF5A 4ZH4F 2W24A 1BOAA 3ISPA 3E6DA 5D4RA 1CF7A 2FNPA 3F72A 4RS8A 1QNTA 3IWFA 2YPRA 3BPVA 4O5VA 1B4AA 4YFNF 4LMYA 3NRVA 1GXPA 1KYWA 1TNTA 3GUDA 2EJRA 1U5TB 2STTA 1G3YA 3HRMA 4ESFA 3GFMA 5AIQA 4HX8A 5ERIA 1LVAA 5FGMA 3VEPA 4KYWA 2O61A 1GHCA 2DQLA 1XMKA 4A0YA 1VTNC 4HF2A 3I64A 2W57A 2UXNA 2A3SA 2RDPA 1C0WA 1LEBA 3WE2A 2VOPA 2G7UA 4LJZF 1USSA 3QPTA 4LG0A 4L18B 3E6MA 4GYIA 1ZRDA 2A6EF 1XCVA 3KP6A 3KEQA 1IN7A 1REPC 4U0WA 5K5QA 3HOSA 3K2ZA 3BZ6A 3C18A 4P96A 3F8FA 3R0JA 4XBFA 3OOPA 5TJJA 4RGUA 2IPQX 3MFKA 2FNAA 4P9FA 2ZNYA 1O57A 3HTSB 1OMIA 4PGHA 3D0SA 3L9FA 5FFZA 4CXFA 5FB2A 4EM2A 3KP4A 3B02A 1QPMA 2A6HF 4LGWA 5D6EA 1OR7A 4UVAA 2HKXA 1XGSA 4QWQA 3I58A 1BBYA 4G8XA 3DFGA 3QU3A 1TNSA 5L3BA 1EH7A 1DUXC 4PCQA 4U7BA 5IT9Z 3TKYA 1JE8A 2NNNA 3I59A 4EGYA 3GFLA 1B6AA 2WV0A 5HS7A 4M72A 3ECOA 5JFRA 1YLFA 2QUFA 3T8TA 2ESNA 2W84A 4LLGF 5E1WA 4AVPA 1I1GA 5E8IA 5BS6A 2FF4A 2IA1A 2E1NA 5JI6A 5CVUA 2VC1A 2E1CA 2K86A 4RGXA 3T1BA 5A2QK 3GWZA 5AONA 2UXXA 1MDMA 1WRJA 2TDXA 1ZLKA 3HRSA 2EFPA 3V8KA 3FMSA 3TO9A 2EFNA 2ESHA 1HW1A 1QQIA 4M9ZA 1WSUA 3GX4X 2MH2A 4UVBA 3RJPA 4CDGA 2KKOA 1CF7B 5F1RA 1J7KA 4D0PA 4HV6A 3J80K 3E97A 4YFKF 2LNBA 4JBAA 3RTRA 2Y75A 2DPUA 4G9YA 4XSXF 1AWCA 4MEYF 3C3WA 4GGGA 1KU7A 3CJNA 1DP7P 5DDGA 3IKVA 1JHHA 2KIUA 1HQCA 2P5LC 1U8RA 4Y17A 3FXQA 3Q9SA 4EQQA 1R1TA 2F5FA 2Z5UA 3E5QA 2OQRA 3AAFA 4F7ZA 2V6CA 1S8NA 3F6OA 4M9XA 3TQNA 4LG0B 5D6FA 1ZG3A 4ZYDA 1XSVA 4GXOA 2PI0A 1PP7U 3RIRA 4U7DA 1QZZA 2QVOA 2HZTA 1B1BA 2Y48A 1IXSB 3JAMZ 3O3KA 2YR2A 2ZCWA 3JW4A 5D8KB 5LLQA 1G3TA 2GZWA 2IT0A 2QZ8A 1JXSA 1BN5A 1F5TA 2EA4A 3J7AO 4KMFA 4XLPF 4LD5A 5DUKA 1T38A 4IRGA 3MWMA 1R23A 2M87A 3ZMZA 2M1BA 2A69F 2Z33A 4KICA 5L3DA 3IRQA 2HFHA 3ERED 5DD8A 1TTYA 2J5OA 1ZG5A 3SZTA 4DNCA 3HRUA 2XAHA 3HHHA 2ZMEA 1ODDA 1FSHA 4N9HA 2K27A 2PLYA 1HW5A 1ZGAA 1SD5A 4RAYA 3HSEA 2PN6A 5JHUA 1SD4A 3K9TA 3I59B 3MAJA 3H92A 1A04A 2D1HA 3DPLC 5E17F 2XAFA 4MGRA 3I4PA 3QU6A 3SQNA 1R36A 2G9WA 3MEXA 2Q8KA 3T0YA 1S3JA 2R7FA 1J2XA 1G6NA 3WTZA 1DPUA 2P8TA 3KETA 5LEJA 4Z2YA 3I54A 2O3FA 4WF2A 2PEXA 3GYHX 5LHHA 3ZMDA 1MDMB 4MEXF 5EEGA 1W5SA 3HOTA 3F22A 2EFOA 5FO5A 1Z6RA 1KQ8A 3IKTA 2JT1A 4A2UA 1K79A 2CFXA 2DO7A 5E20A 2HYGD 3I0TA 1FSEA 3LWFA 2B0LA 3BPXA 3H3UA 3IWZA 3PQJA 3FXUA 2GXBA 1V4RA 3P9KA 2VBYA 2YSRA 1ONVA 1S29A 1RI7A 4NB5A 1FWZA 4MNUA 1FLIA 4BQAA 5IT3A 1IN8A 3WODF 1I5ZA 1IXRC 2JTVA 5LEKA 1T39A 3E5XA 5ICCA 5E1ZB 1CGPA 3FM3A 3REOA 4RGSA 2CWEA 1JGSA 4M71A 2CSOA 2NRAC 1MZBA 3QP6A 2WWYA 4BAYA 5DYMA 3KCCA 5BMZA 3I53A 3F21A 4MTEA 4A6DA 3CLOA 4BNCA 2MBFA 4JQFA 5J8FA 3M7GA 4OIOF 2IA2A 4A5NA 5DV5A 2P5VA 3ZQ7A 4U88A 3GZ5A 2ACJA 4KT5C 1HKQA 2H6BA 3LFKA 4OIRF 4KDPA 1YQAA 1FT9A 3FWEA 1ZN2A 4CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VT2 A;  4P9U A;  2DT5 A;  2XIG A;  3FMR A;  4I2O A;  1R22 A;  1BJA A;  2FA5 A;  3WGG A;  1U78 A;  2VE8 A;  2D45 A;  4R1H A;  4RB1 A;  1H0M A;  4HOB A;  4O6J A;  5F6F A;  1DDN A;  3DXJ F;  1KYZ A;  1TBX A;  3WGI A;  1F9N A;  2M45 A;  2DU9 A;  3R61 A;  4IJA A;  4H0E A;  1IF1 A;  4CZZ A;  1L0O C;  4ASN A;  2ISZ A;  3RKY A;  3J80 Z;  4EJW A;  2ZXJ A;  1BC8 C;  3QAH A;  3LAP A;  3F8N A;  5LGT A;  4ZZL A;  4BHC A;  4HLX A;  2J5P A;  4Q5S F;  4WXC A;  1IW7 F;  3DP7 A;  4PGG A;  4A0Z A;  3KLO A;  1G4D A;  5HLG A;  4I01 A;  4JK1 X;  5HS8 A;  3RYP A;  1W7P A;  1LDJ A;  1PUE E;  3RKW A;  4HF0 A;  2V1U A;  3L00 A;  5TRD A;  2XKO A;  1YFH A;  1TQP A;  1NHA A;  4BH9 A;  2VOD A;  3RPU A;  5LRS A;  1UST A;  4KIB A;  4I02 A;  5CVV A;  4ON0 A;  2XAJ A;  5D4S A;  2DK5 A;  2DFI A;  2QYO A;  2BYV E;  1IN6 A;  3GVA A;  1G3S A;  2JSC A;  4HV5 A;  4MQ9 F;  2ZNZ A;  1FBQ A;  1LDK B;  1T6S A;  1FX7 A;  3V7S A;  4S04 A;  2P7V B;  1MKM A;  1TW2 A;  1ULY A;  2VBW A;  3I5U A;  2STW A;  4NQW A;  1S7O A;  3T5X A;  4ENM A;  2V9V A;  1HSJ A;  4Y13 A;  3COA C;  1W5T A;  4ZYE A;  4IXA A;  4MQV A;  3BJA A;  5BPD A;  2PQ8 A;  2GWR A;  4G7O F;  1E17 A;  2OU2 A;  4KIG A;  3IRR A;  4OIQ F;  3V7C A;  1LNW A;  1R7J A;  2P6T A;  3BWG A;  2A68 F;  4UUV A;  4GO1 A;  3IHU A;  2VC0 A;  4A6E A;  1BI1 A;  4HAM A;  5K1Y A;  5BQT A;  1KU2 A;  1X3U A;  5DCM A;  1T98 A;  2F5E A;  2VN2 A;  5FD5 A;  4EJU A;  2ZBK A;  4KNY A;  1FP2 A;  5CVJ A;  2ELH A;  2R7D A;  2KJB A;  2FMY A;  1H9G A;  2XUB A;  1R5H A;  4ENJ A;  4Q4Z F;  3ZN1 A;  4AIK A;  1K7A A;  2Q2E A;  1LDD A;  2FBK A;  5ILS A;  1J59 A;  5L3C A;  4PDK A;  3S2W A;  4MTD A;  3LQQ A;  2QLZ A;  2HQN A;  5HVQ C;  4WK8 F;  2OA4 A;  5D5V B;  4HDU A;  1HST A;  3F8C A;  2QEN A;  5F64 A;  1J75 A;  2OQG A;  1FYL A;  1K6O A;  3HUG A;  4G6D A;  1BIB A;  1B59 A;  2C6Y A;  3CDH A;  2HS5 A;  4BYY A;  3KP3 A;  1E2X A;  3KZZ A;  3TO7 A;  4HQE A;  4OIP F;  1WQ2 A;  3KFW X;  1XCB A;  2GA2 A;  1Z6T A;  1UHM A;  1P92 A;  1P4W A;  2P5K A;  1R1U A;  5E1X A;  1ON2 A;  4I98 B;  3WTV C;  1RNL A;  5BPI A;  2QQ9 A;  2KIF A;  2A5Y B;  4LB6 B;  4R8H A;  2H09 A;  1D5V A;  3JSO A;  2COM A;  3LA7 A;  2DBB A;  3ML6 A;  3K1N A;  1W7P B;  3VFZ A;  4M6X A;  2ZFW A;  2UZK A;  1ZG1 A;  1S6L A;  2RC4 A;  4OOI A;  3WTW C;  3WTX C;  4L5I A;  1FNN A;  4P5O A;  3JSP A;  2OD5 A;  1XB4 A;  1QZY A;  2MLK A;  2A07 F;  2K02 A;  3PQK A;  2O8X A;  1Z05 A;  2KRF A;  5FD6 A;  4DQ2 A;  4IVN A;  5ED4 A;  2BBY A;  4ESB A;  2FU4 A;  5LGN A;  3CUQ A;  1FY7 A;  2XHK A;  5FLX Z;  4L5J A;  1MGT A;  1R58 A;  1HKS A;  4OU0 A;  2FBI A;  5JR3 A;  4G7H F;  3DF8 A;  1KU9 A;  4ETS A;  2XRO A;  1XMA A;  4P55 A;  4UNO A;  4ENN A;  2CO5 A;  4TV7 A;  1F4K A;  1FC3 A;  2BGC A;  3ZN0 A;  4MHG A;  3EDP A;  4OIN F;  4CGZ A;  3ULQ B;  1I27 A;  1TLH B;  3K69 A;  5DCM B;  3VOE A;  3TO6 A;  2XAG A;  5L3E A;  1IN4 A;  2LF8 A;  2XAQ A;  4BHB A;  4LB5 A;  2DPD A;  4CIC A;  1UB9 A;  3ZMT A;  1O3Q A;  1I6X A;  5HS9 A;  4KN7 X;  2VBX A;  3WE3 A;  4RGR A;  4EV0 A;  1O3T A;  3EET A;  3L09 A;  4L9J A;  3QRF F;  2EV6 A;  1RUN A;  3IC7 A;  4WXD A;  3GXO A;  4FT8 A;  3WU0 A;  2E7W A;  2FEZ A;  1SD7 A;  1WKM A;  1XDS A;  4WX9 A;  3R0A A;  4S05 A;  3N4M A;  1D8K A;  3E5U A;  2HEO A;  1Y0U A;  2JPB A;  1KQ9 A;  1FYM A;  1SFE A;  1YYV A;  3F23 A;  1I1S A;  3WTU C;  5HDK A;  1O7F A;  3RKX A;  1GXQ A;  1RZ4 A;  4L0Y B;  5KVR A;  1LQ1 A;  5K5O A;  2VE9 A;  3LA2 A;  4U0V A;  3W6K B;  2YU3 A;  1ZRF A;  4O3M A;  2GAU A;  3IL2 A;  2RV8 A;  4G7Z F;  3EUH A;  1IRF A;  3K0L A;  5IT9 K;  5K5R A;  3SZP A;  2MA3 A;  3RPQ A;  3GEZ A;  3L2C A;  3HHG A;  3CUQ C;  4UV9 A;  4EM0 B;  4HQM A;  2AXL A;  5LHG A;  1B9M A;  2GXG A;  4AWX B;  1P4X A;  3R60 A;  3C1D A;  3LST A;  1ZGJ A;  4EJO A;  3O6B B;  2P4W A;  5L3F A;  2GIV A;  4EGZ A;  2DTR A;  4IRH A;  1WI9 A;  2Z99 A;  2H27 A;  4RAZ A;  2PFB A;  2RVC A;  2Z3Y A;  2FXA A;  3F3X A;  1FOK A;  4IHT A;  4LLL A;  2CGP A;  3CUQ B;  4EJT A;  1J0R A;  5J6X A;  2ETH A;  2AS5 F;  1P4A A;  2LSO A;  3DQV C;  1SAX A;  4XLN F;  1QBJ A;  4KMU X;  2M8E A;  3ECH A;  4I7H A;  3RI4 A;  1W7P D;  1O7L A;  3BJ6 A;  3E6C C;  5D5W B;  1HXD A;  3NEU A;  5A2Q Z;  3BRO A;  3KEO A;  3NQO A;  2DAO A;  1T2K A;  2HWV A;  3SXY A;  3BP8 A;  4LLN A;  2L4M A;  4L9T A;  5CVI A;  2PJP A;  4A12 A;  5CVR A;  3TDU C;  3WG9 A;  2E7X A;  3L7W A;  2L54 A;  1FPQ A;  1W4M A;  5BOX A;  2NNY A;  2RQP A;  4FHT A;  4PZJ A;  3JAM K;  4WWC A;  4RB3 C;  4KN4 X;  5HDN A;  4FX0 A;  5ILU A;  1R1V A;  1IN5 A;  3WTS C;  2CQK A;  1IUY A;  4BXU A;  1Z9C A;  2VBZ A;  4OMZ A;  1ZHF A;  3TDZ C;  1K78 A;  1R5G A;  5H6Q A;  1FYK A;  1J5Y A;  1KQ0 A;  3F6V A;  3U1D A;  1XSX A;  3GZ6 A;  3FM5 A;  5CJ9 A;  3BDD A;  2D2W A;  1QGP A;  2QM3 A;  2L02 A;  3D5L A;  2Y0M A;  2EV5 A;  4ZZD A;  5D5X B;  2L4A A;  3K1M A;  3V8L A;  2R3S A;  1SMT A;  1R00 A;  1D8J A;  2O6G E;  1HKT A;  3HTU A;  3KLN A;  3JTG A;  2HKO A;  3KE2 A;  3GF2 A;  2XAS A;  5ICE A;  4GYG A;  4HYE A;  3P9I A;  3I71 A;  5AIP A;  3GO5 A;  2M5W A;  3JTH A;  4EJV A;  3LA3 A;  4Y15 A;  3Q9V A;  1XGO A;  1YO5 C;  4YII A;  2OZ6 A;  2FE3 A;  1P6R A;  3E3V A;  3DEU A;  3M8E A;  2DQR A;  3QOP A;  4I0B A;  3CO7 C;  4LK0 F;  1BI2 A;  2K4J A;  2W25 A;  1YW7 A;  2BE5 F;  2VXZ A;  2P6S A;  3OV8 A;  1V3F A;  4YG2 F;  4HZF A;  2EK5 A;  2MLG A;  2QWW A;  2YX4 A;  5DCF A;  1XGN A;  2JPC A;  3P7N A;  1UHW A;  3QPH A;  5ILV A;  2EB7 A;  1YW8 A;  5DD4 A;  2VON A;  4IHS A;  3R6S A;  3MQ0 A;  4CO8 A;  1ZYR F;  4M73 A;  2EV0 A;  4B8X A;  2KIM A;  2XKP A;  2QQA A;  3B73 A;  4LFU A;  2FML A;  5DEQ A;  5D8L B;  2IJL A;  2CG4 A;  2GQQ A;  2IW5 A;  4KIF A;  1GVJ A;  1BC7 C;  1FBU A;  2VOO A;  3HYI A;  1YS6 A;  2A61 A;  4HBL A;  5HOO A;  3FXR A;  5E8G A;  3VB2 A;  3CUO A;  1ZH5 A;  5H6R A;  2PMU A;  4HLY A;  1KGS A;  3N97 A;  1FP1 D;  2FSW A;  2FRH A;  2ADU A;  4UXN A;  3F8M A;  1PP8 F;  1DPR A;  2L01 A;  3C7J A;  2F2E A;  4UV8 A;  3MZY A;  2FQ3 A;  1IZ1 A;  1SD6 A;  1D3Y A;  2FOK A;  5LGU A;  2H6C A;  1LB2 A;  3ZP5 A;  3FZV A;  2QBY A;  1KA8 A;  1JHF A;  3KP7 A;  3M8F A;  2K7L A;  4L9N A;  1TQI A;  4ZYG A;  4M74 A;  1IXC A;  3E6B A;  1YTY A;  3SFZ A;  4EVI A;  5HLH A;  3GFI A;  4ENK A;  1XDU A;  4M9S A;  3PFI A;  2HOE A;  1MD0 A;  3G73 A;  1K78 B;  3Q5F A;  2XRN A;  2DW4 A;  1S7A A;  2F5D A;  2EFQ A;  2L3D A;  2BEO A;  1AOY A;  2V79 A;  4EM1 A;  2DI3 A;  1Z1D A;  1OYW A;  1HW2 A;  3VOD A;  3J81 K;  2QQB A;  3MZH A;  4YFX F;  4HX4 A;  2GA1 A;  1ZRE A;  4HDV A;  3G3Z A;  4WXH A;  2WC2 A;  2JRT A;  2EFW A;  1Z7U A;  3H3Z A;  3EYI A;  2CW0 F;  3ROU A;  3ZMS A;  5L3G A;  2LDU A;  1L3L A;  1ZAR A;  2BV6 A;  3V4G A;  1EV7 A;  3ABT A;  1XN7 A;  1O3R A;  3T8R A;  2HTJ A;  1SFU A;  3W6J B;  3DKW A;  3KP2 A;  5HDG A;  2OZU A;  3U2R A;  2YX7 A;  2P7C B;  2HGC A;  5LHI A;  3WGH A;  2LKP A;  4A5M A;  3ZMU A;  4U0Y A;  1T0F A;  4L9V A;  3WU1 B;  4N0B A;  2HDC A;  1OYI A;  4Q47 A;  1BIA A;  3EYY A;  4HX7 A;  2ISY A;  1ON1 A;  5E18 F;  1MJA A;  4KUM A;  2KJC A;  1ZAO A;  5ICG A;  2V1D A;  1RUO A;  4E70 A;  1OYY A;  2HQR A;  5LRR A;  1TQM A;  1IAW A;  3R4K A;  2DLL A;  3RYR A;  1OPC A;  2MH9 A;  5DUI A;  3BOQ A;  3KP5 A;  5KK1 A;  2NS0 A;  2PG4 A;  2EA2 A;  2F5C A;  3GW2 A;  4KFC A;  1RIO H;  1Z91 A;  3TOB A;  1YS7 A;  1UCR A;  2UWM A;  2RGV A;  5CYV A;  1F1Z A;  1SFX A;  4M6Y A;  2O0Y A;  2RNJ A;  4G94 A;  2G7H A;  3BJO A;  3GLX A;  3WTY C;  2HTS A;  3WTT C;  4HA8 A;  1P2F A;  2IP2 A;  4CHU A;  1BI0 A;  1SMY F;  4RB2 C;  3LAJ A;  3V8J A;  4LK1 F;  2XGX A;  2QBY B;  4N9I A;  3MCZ A;  2D1V A;  4XRF A;  5D5U B;  4YIF A;  2FBH A;  1LEA A;  4K2E A;  1ZRC A;  2PBI A;  4RB0 A;  3TGN A;  1EH6 A;  2JZY A;  3HSF A;  2Q0O A;  1TW3 A;  2M30 A;  4BHP A;  5J8C A;  1G3W A;  2MC3 A;  2DK8 A;  6PAX A;  4FX4 A;  1XD7 A;  2LF7 A;  2XV4 S;  5ICF A;  2ZKZ A;  1U5T A;  1FZP B;  2HR3 A;  5EEH A;  5FFX A;  1XGM A;  4AIH A;  2IA0 A;  2WTE A;  2RN7 A;  2RKH A;  3RDI A;  1EH8 A;  1U6G A;  1PDN C;  1XSD A;  4A0X A;  3CO6 C;  4QLC U;  4WCG A;  3FMQ A;  4OMY A;  2EWN A;  3FX3 A;  2XVC A;  3HRT A;  3SHF A;  3ZPL A;  1ZLJ A;  4GCV A;  2V1X A;  2HYF A;  5H20 A;  5JVT A;  2X4H A;  3QP5 A;  4ESJ A;  3O2P E;  3P9C A;  1FBS A;  1YW9 A;  4IRI A;  3LQR A;  1STZ A;  4IPA A;  2ZO4 A;  4UHT A;  1YG2 A;  2X0L A;  3GFJ A;  1OKR A;  3F8B A;  2ZJ2 A;  1IRG A;  2OAZ A;  4KA4 A;  3HSR A;  4Q48 A;  4EMS A;  4XSZ F;  4G6Q A;  3DPT A;  1BM9 A;  4ZYH A;  1HBX G;  3HIF A;  2O03 A;  3DV8 A;  3M9A A;  4R79 A;  2H94 A;  2CYY A;  4HW0 A;  4I09 A;  1KU3 A;  2IRF G;  1BI3 A;  1U3E M;  2W85 A;  5CLS A;  1Q1H A;  1QO0 D;  5FLX K;  3KZY A;  4B09 A;  3CTA A;  2IVM A;  4AD9 A;  2MD5 A;  4L0Z B;  5LBQ A;  3ZMV A;  1MJ9 A;  2K4B A;  1WWX A;  2NYX A;  4NHJ A;  1U2W A;  1J9I A;  3V7R A;  1UFM A;  2ZME B;  3U9G A;  3ABU A;  3ELK A;  1LJ9 A;  3J81 Z;  3EQL F;  1MJB A;  5HLI A;  3BY6 A;  2PMH A;  3M1E A;  1U5T C;  1YIO A;  4HF1 A;  2VT3 A;  2OBP A;  3K1P A;  2NAZ A;  1H9T A;  4AIJ A;  1O3S A;  4UVC A;  4I0A A;  4IF4 A;  3TOA A;  1B9N A;  3FHZ A;  2Z9O A;  3FF5 A;  4ZH4 F;  2W24 A;  1BOA A;  3ISP A;  3E6D A;  5D4R A;  1CF7 A;  2FNP A;  3F72 A;  4RS8 A;  1QNT A;  3IWF A;  2YPR A;  3BPV A;  4O5V A;  1B4A A;  4YFN F;  4LMY A;  3NRV A;  1GXP A;  1KYW A;  1TNT A;  3GUD A;  2EJR A;  1U5T B;  2STT A;  1G3Y A;  3HRM A;  4ESF A;  3GFM A;  5AIQ A;  4HX8 A;  5ERI A;  1LVA A;  5FGM A;  3VEP A;  4KYW A;  2O61 A;  1GHC A;  2DQL A;  1XMK A;  4A0Y A;  1VTN C;  4HF2 A;  3I64 A;  2W57 A;  2UXN A;  2A3S A;  2RDP A;  1C0W A;  1LEB A;  3WE2 A;  2VOP A;  2G7U A;  4LJZ F;  1USS A;  3QPT A;  4LG0 A;  4L18 B;  3E6M A;  4GYI A;  1ZRD A;  2A6E F;  1XCV A;  3KP6 A;  3KEQ A;  1IN7 A;  1REP C;  4U0W A;  5K5Q A;  3HOS A;  3K2Z A;  3BZ6 A;  3C18 A;  4P96 A;  3F8F A;  3R0J A;  4XBF A;  3OOP A;  5TJJ A;  4RGU A;  2IPQ X;  3MFK A;  2FNA A;  4P9F A;  2ZNY A;  1O57 A;  3HTS B;  1OMI A;  4PGH A;  3D0S A;  3L9F A;  5FFZ A;  4CXF A;  5FB2 A;  4EM2 A;  3KP4 A;  3B02 A;  1QPM A;  2A6H F;  4LGW A;  5D6E A;  1OR7 A;  4UVA A;  2HKX A;  1XGS A;  4QWQ A;  3I58 A;  1BBY A;  4G8X A;  3DFG A;  3QU3 A;  1TNS A;  5L3B A;  1EH7 A;  1DUX C;  4PCQ A;  4U7B A;  5IT9 Z;  3TKY A;  1JE8 A;  2NNN A;  3I59 A;  4EGY A;  3GFL A;  1B6A A;  2WV0 A;  5HS7 A;  4M72 A;  3ECO A;  5JFR A;  1YLF A;  2QUF A;  3T8T A;  2ESN A;  2W84 A;  4LLG F;  5E1W A;  4AVP A;  1I1G A;  5E8I A;  5BS6 A;  2FF4 A;  2IA1 A;  2E1N A;  5JI6 A;  5CVU A;  2VC1 A;  2E1C A;  2K86 A;  4RGX A;  3T1B A;  5A2Q K;  3GWZ A;  5AON A;  2UXX A;  1MDM A;  1WRJ A;  2TDX A;  1ZLK A;  3HRS A;  2EFP A;  3V8K A;  3FMS A;  3TO9 A;  2EFN A;  2ESH A;  1HW1 A;  1QQI A;  4M9Z A;  1WSU A;  3GX4 X;  2MH2 A;  4UVB A;  3RJP A;  4CDG A;  2KKO A;  1CF7 B;  5F1R A;  1J7K A;  4D0P A;  4HV6 A;  3J80 K;  3E97 A;  4YFK F;  2LNB A;  4JBA A;  3RTR A;  2Y75 A;  2DPU A;  4G9Y A;  4XSX F;  1AWC A;  4MEY F;  3C3W A;  4GGG A;  1KU7 A;  3CJN A;  1DP7 P;  5DDG A;  3IKV A;  1JHH A;  2KIU A;  1HQC A;  2P5L C;  1U8R A;  4Y17 A;  3FXQ A;  3Q9S A;  4EQQ A;  1R1T A;  2F5F A;  2Z5U A;  3E5Q A;  2OQR A;  3AAF A;  4F7Z A;  2V6C A;  1S8N A;  3F6O A;  4M9X A;  3TQN A;  4LG0 B;  5D6F A;  1ZG3 A;  4ZYD A;  1XSV A;  4GXO A;  2PI0 A;  1PP7 U;  3RIR A;  4U7D A;  1QZZ A;  2QVO A;  2HZT A;  1B1B A;  2Y48 A;  1IXS B;  3JAM Z;  3O3K A;  2YR2 A;  2ZCW A;  3JW4 A;  5D8K B;  5LLQ A;  1G3T A;  2GZW A;  2IT0 A;  2QZ8 A;  1JXS A;  1BN5 A;  1F5T A;  2EA4 A;  3J7A O;  4KMF A;  4XLP F;  4LD5 A;  5DUK A;  1T38 A;  4IRG A;  3MWM A;  1R23 A;  2M87 A;  3ZMZ A;  2M1B A;  2A69 F;  2Z33 A;  4KIC A;  5L3D A;  3IRQ A;  2HFH A;  3ERE D;  5DD8 A;  1TTY A;  2J5O A;  1ZG5 A;  3SZT A;  4DNC A;  3HRU A;  2XAH A;  3HHH A;  2ZME A;  1ODD A;  1FSH A;  4N9H A;  2K27 A;  2PLY A;  1HW5 A;  1ZGA A;  1SD5 A;  4RAY A;  3HSE A;  2PN6 A;  5JHU A;  1SD4 A;  3K9T A;  3I59 B;  3MAJ A;  3H92 A;  1A04 A;  2D1H A;  3DPL C;  5E17 F;  2XAF A;  4MGR A;  3I4P A;  3QU6 A;  3SQN A;  1R36 A;  2G9W A;  3MEX A;  2Q8K A;  3T0Y A;  1S3J A;  2R7F A;  1J2X A;  1G6N A;  3WTZ A;  1DPU A;  2P8T A;  3KET A;  5LEJ A;  4Z2Y A;  3I54 A;  2O3F A;  4WF2 A;  2PEX A;  3GYH X;  5LHH A;  3ZMD A;  1MDM B;  4MEX F;  5EEG A;  1W5S A;  3HOT A;  3F22 A;  2EFO A;  5FO5 A;  1Z6R A;  1KQ8 A;  3IKT A;  2JT1 A;  4A2U A;  1K79 A;  2CFX A;  2DO7 A;  5E20 A;  2HYG D;  3I0T A;  1FSE A;  3LWF A;  2B0L A;  3BPX A;  3H3U A;  3IWZ A;  3PQJ A;  3FXU A;  2GXB A;  1V4R A;  3P9K A;  2VBY A;  2YSR A;  1ONV A;  1S29 A;  1RI7 A;  4NB5 A;  1FWZ A;  4MNU A;  1FLI A;  4BQA A;  5IT3 A;  1IN8 A;  3WOD F;  1I5Z A;  1IXR C;  2JTV A;  5LEK A;  1T39 A;  3E5X A;  5ICC A;  5E1Z B;  1CGP A;  3FM3 A;  3REO A;  4RGS A;  2CWE A;  1JGS A;  4M71 A;  2CSO A;  2NRA C;  1MZB A;  3QP6 A;  2WWY A;  4BAY A;  5DYM A;  3KCC A;  5BMZ A;  3I53 A;  3F21 A;  4MTE A;  4A6D A;  3CLO A;  4BNC A;  2MBF A;  4JQF A;  5J8F A;  3M7G A;  4OIO F;  2IA2 A;  4A5N A;  5DV5 A;  2P5V A;  3ZQ7 A;  4U88 A;  3GZ5 A;  2ACJ A;  4KT5 C;  1HKQ A;  2H6B A;  3LFK A;  4OIR F;  4KDP A;  1YQA A;  1FT9 A;  3FWE A;  1ZN2 A;  4CYD A; 
#chains in the Genus database with same CATH topology
 3GME A;  2LTP A;  3JRI A;  2VT2 A;  4P9U A;  2DT5 A;  1NK2 P;  3DU5 A;  1M1E B;  2XIG A;  3FMR A;  1MBK A;  4I2O A;  3VPR A;  1R22 A;  4A69 C;  3SZG A;  1BJA A;  2FA5 A;  3WGG A;  3LFU A;  1U78 A;  3TW6 A;  2DJN A;  3A02 A;  2VE8 A;  2D45 A;  4R1H A;  3IUO A;  5KAI C;  4RB1 A;  4HOB A;  1H0M A;  4Y7N J;  4O6J A;  5F6F A;  3M07 A;  3OYG A;  1DDN A;  3DXJ F;  4A3I J;  5IOZ A;  1KYZ A;  1YX3 A;  3PSF A;  3ZQL A;  2GM4 A;  1TBX A;  3WGI A;  2HXI A;  4C3I J;  1F9N A;  2M45 A;  3OSG A;  1R49 A;  2DU9 A;  3R61 A;  3GBG A;  4JP0 A;  4IJA A;  2VI6 A;  1OCR H;  2E5N A;  4H0E A;  1IF1 A;  2NVU B;  2M4K A;  2FQ4 A;  4CZZ A;  4XRS G;  1L0O C;  4ASN A;  4N4O B;  3HDD A;  2ISZ A;  4UY8 I;  4CH7 A;  3GTP J;  3RKY A;  2X51 A;  2MD0 A;  3J80 Z;  3EPZ A;  4EJW A;  2ZXJ A;  1BC8 C;  3QAH A;  3LAP A;  5B5E C;  3F8N A;  4IEJ A;  5LGT A;  2DA5 A;  4KIS A;  2EH3 A;  4ZZL A;  3MKY B;  5EDN A;  4X0G A;  1OIS A;  2DXI A;  1RKW A;  4BHC A;  4XON A;  4HLX A;  2J5P A;  5K7F A;  4Q5S F;  1SAU A;  4WXC A;  1IW7 F;  3DP7 A;  4PGG A;  1VF9 A;  3OOU A;  4A0Z A;  5JLX A;  2M0C A;  3KLO A;  2DA6 A;  2BVM A;  1G4D A;  5HLG A;  2DJI A;  4I01 A;  4JK1 X;  2H8R A;  2CW7 A;  1JJ8 C;  5HS8 A;  5E3O A;  3RYP A;  2HOT A;  1W7P A;  1LDJ A;  1PUE E;  1WJ5 A;  3RKW A;  9ANT A;  4HF0 A;  2V1U A;  4HPQ A;  2R93 J;  3CD6 I;  1HCR A;  3L00 A;  4J19 A;  5TRD A;  2XKO A;  5DM7 F;  3MN2 A;  1YFH A;  1FMW A;  1TQP A;  1NHA A;  4BH9 A;  2VOD A;  4D9J A;  3RPU A;  5FKN A;  5LRS A;  2F48 A;  1UST A;  3CCS I;  4KIB A;  4I02 A;  5CVV A;  4ON0 A;  4E7J A;  3OR1 C;  2K9S A;  4CCL A;  2XAJ A;  1QRY A;  5F1J A;  5D4S A;  2L9R A;  2DK5 A;  2DFI A;  3BCA A;  2QYO A;  4JX4 A;  2BYV E;  5H2F C;  1IN6 A;  3GVA A;  1G3S A;  2JSC A;  4HV5 A;  4RLF A;  2IAI A;  4LOC A;  1OCP A;  4MQ9 F;  2ZNZ A;  5GAE J;  1B72 A;  1FBQ A;  1LDK B;  1T6S A;  4IL6 C;  4XKV A;  4XRM A;  1FX7 A;  2HDW A;  4CCK A;  4XID A;  4B47 A;  3V7S A;  2NVT J;  4A3C J;  4S04 A;  2V1N A;  2P7V B;  1MKM A;  4DZP A;  1IV6 A;  1TW2 A;  1ULY A;  2VBW A;  3I5U A;  4BQQ A;  4EAT A;  2STW A;  4NQW A;  1S7O A;  3T5X A;  4ENM A;  3RQ4 A;  2EZI A;  2B7E A;  3N05 A;  3ZOB A;  4C3J J;  3DTE A;  4XL9 A;  2V9V A;  1RPW A;  1HSJ A;  2LVS A;  4Y13 A;  3COA C;  1W5T A;  2RNG A;  4E7S A;  4ZYE A;  1SFK A;  1QA6 A;  2DYS H;  3I9V 2;  1EA3 A;  1Y56 A;  2DA1 A;  4IXA A;  4MQV A;  3L2U A;  2BHZ A;  3BJA A;  3G4S I;  2CUF A;  5BPD A;  2JVG A;  2PQ8 A;  2GWR A;  2E1M C;  4G7O F;  3M4O J;  1E17 A;  2GLO A;  4ZYA A;  4W1U A;  4MLO A;  2OU2 A;  4KIG A;  1VQ9 I;  3IRR A;  4OIQ F;  3CC4 I;  2XF7 A;  5EG0 B;  2Q1Z B;  3V7C A;  2DDA A;  4A93 J;  1LNW A;  1R7J A;  2P6T A;  3BWG A;  4BE0 A;  2A68 F;  4UUV A;  4BEH B;  4GO1 A;  1ENH A;  3IHU A;  2VC0 A;  4A6E A;  1BI1 A;  3OYL A;  4HAM A;  5K1Y A;  4F92 B;  5BQT A;  4Y33 A;  1KU2 A;  1X3U A;  2DOE A;  1VQ6 I;  3FBI B;  3DEE A;  5DCM A;  4E4H A;  1T98 A;  2F5E A;  2QKL B;  2VN2 A;  5FD5 A;  4EJU A;  2F4I A;  2ZBK A;  4KNY A;  4FTH A;  2XPV A;  3LSG A;  1FIP A;  4HST A;  3DLL F;  1UHS A;  3BTJ A;  2V9K A;  1G8X A;  2E1M B;  1FP2 A;  1VQK I;  5CVJ A;  3FHN A;  4CCN A;  2ELH A;  2R7D A;  2KDO A;  2KJB A;  1FOY A;  3BQY A;  2FMY A;  1X1P A;  1H9G A;  2XUB A;  1R5H A;  4BKX A;  4ENJ A;  4Q4Z F;  3PNY A;  3ZN1 A;  4AIK A;  4FE4 A;  4DW6 A;  1K7A A;  2Q2E A;  4RA2 A;  4AVZ A;  4DYQ A;  1YI2 I;  1LDD A;  2FBK A;  5ILS A;  1J59 A;  4A3L J;  5L3C A;  1U9O A;  4PDK A;  3S2W A;  4MTD A;  2OF7 A;  3LQQ A;  1HLV A;  5KAF C;  3JRH A;  4XLF A;  2QLZ A;  4J00 A;  3OYA A;  2HQN A;  5HVQ C;  4WK8 F;  2OA4 A;  1MMD A;  2AHQ A;  4KIT B;  5D5V B;  4HDU A;  1HOM A;  1DP3 A;  1HST A;  3P5J A;  2IEK A;  5EJC A;  3CDL A;  3F8C A;  2QEN A;  5J40 A;  5F64 A;  2XPU A;  1J75 A;  3DPU A;  2KL4 A;  2OQG A;  1FYL A;  2VKV A;  3J7Y J;  1K6O A;  3HUG A;  4G6D A;  1BIB A;  4X1E A;  1B59 A;  2C6Y A;  3BG3 A;  2E2I J;  3CDH A;  2HS5 A;  1T8I A;  4BYY A;  3KP3 A;  5HNH A;  2M9H A;  1E2X A;  1ERD A;  3KZZ A;  3TO7 A;  1POG A;  2VJJ A;  2CQN A;  4HQE A;  4OIP F;  1WQ2 A;  2CQQ A;  3KFW X;  1XCB A;  2GA2 A;  3CLQ A;  2IS4 A;  1Z6T A;  3DLA A;  1UHM A;  1P92 A;  1P4W A;  2P5K A;  1W0U A;  3ONQ A;  1R1U A;  1V5G A;  1W36 D;  5E1X A;  1ON2 A;  4I98 B;  3A03 A;  2X6W A;  5E3L A;  3WTV C;  5HNF A;  1XC5 A;  2UUZ A;  2VQL A;  3MKL A;  3G71 I;  4IHW A;  1E3P A;  1UJ8 A;  1RNL A;  3K10 A;  5BPI A;  2QQ9 A;  4ZTF A;  2LY9 A;  5FLV A;  2KIF A;  3AFH A;  2A5Y B;  2A05 A;  4LB6 B;  4OAZ A;  4R8H A;  3HOU J;  2H09 A;  1D5V A;  3DWL E;  3JSO A;  2COM A;  4F3Q A;  3CCL I;  1NG6 A;  3LA7 A;  2DBB A;  3G2B A;  3ML6 A;  3K1N A;  1EKE A;  1W7P B;  3VFZ A;  4M6X A;  2ZFW A;  2UZK A;  3OMY A;  3BC8 A;  5FKO A;  1ZG1 A;  1SVL A;  1S6L A;  2RC4 A;  2MYS A;  4OOI A;  3WTW C;  3WTX C;  2I10 A;  4L5I A;  1FNN A;  3S32 A;  1OFC X;  4P5O A;  4DYR A;  1R5I D;  3JSP A;  2OD5 A;  1XB4 A;  3S3N A;  1QZY A;  4F55 A;  2MLK A;  3VYU B;  2EIJ H;  2A07 F;  3I56 I;  2DA7 A;  3HB9 A;  4L5E A;  2DMP A;  3HPH A;  3OL3 A;  1TT5 B;  4D7N A;  4A3D J;  1B72 B;  2F6C A;  2K02 A;  3PQK A;  2O8X A;  1Z05 A;  2KRF A;  5FD6 A;  4DQ2 A;  4IVN A;  4DOZ A;  5ED4 A;  2VJ4 A;  2M7B A;  2BBY A;  4KT6 A;  4ESB A;  1MNE A;  3JRC A;  3Q0V A;  2ELJ A;  4BE2 A;  1LE8 A;  2FU4 A;  5BNG A;  2X6X A;  4HRI A;  5LGN A;  2E5Z A;  1SEU A;  3CUQ A;  1FY7 A;  2XHK A;  5FLX Z;  3BTC A;  4L5J A;  2ID6 A;  1MGT A;  1R58 A;  2R4G A;  4M3G A;  3U1K A;  1RR7 A;  5IPA A;  1HKS A;  4FCY A;  3K4L A;  4OU0 A;  3K2A A;  4AUX A;  4ZTJ A;  2FBI A;  1Y8Q B;  2WAE A;  5JR3 A;  2CV2 A;  4BDZ A;  4G7H F;  1W5C C;  3DF8 A;  1KU9 A;  4ETS A;  2XRO A;  3MKW B;  3JR9 A;  1XMA A;  2CH0 A;  4P55 A;  4UNO A;  2ELK A;  4JX5 A;  2DT7 B;  1ZKG A;  4ENN A;  3H35 A;  4B4C A;  5GAG J;  1H88 C;  2IS6 A;  2CO5 A;  3CZ6 A;  1DQU A;  4TV7 A;  1F4K A;  3W3C A;  4IHY A;  1FC3 A;  4I6Z A;  1WJB A;  2BGC A;  2VJI A;  3ZN0 A;  4MHG A;  2LBF A;  3EDP A;  1IUF A;  2FJ1 A;  3F0C A;  4UUT A;  4OIN F;  3ULQ B;  4CGZ A;  1I27 A;  4A3G J;  2BHY A;  5HLT A;  4ZDO A;  1TLH B;  1R4N B;  3K69 A;  5DCM B;  3VOE A;  3TO6 A;  1ETX A;  2XAG A;  5L3E A;  2AO9 A;  4XOR A;  5GTH C;  1IN4 A;  2LF8 A;  2XAQ A;  3VSL A;  4RDU A;  4BHB A;  2QGU A;  2M3A A;  1HDD C;  4LB5 A;  4H4K C;  2DPD A;  4CIC A;  1UB9 A;  3ZMT A;  1O3Q A;  1QVT A;  2VJ5 A;  1I6X A;  5HS9 A;  2KZG A;  4KN7 X;  4CSW A;  2VBX A;  3JRB A;  3WE3 A;  4RGR A;  4EV0 A;  5DTD A;  3LSP A;  2R0Q C;  3B6C A;  1O3T A;  2HVR A;  2O8K A;  2Q2E B;  3EET A;  3L09 A;  1UMQ A;  4L9J A;  1ETW A;  3QRF F;  2EV6 A;  1RUN A;  3IC7 A;  3HOX J;  1I6H J;  4WXD A;  3GXO A;  4FT8 A;  3WU0 A;  2E7W A;  2FEZ A;  1YJW I;  3X2Q H;  3LSH A;  2LY2 A;  2JA5 J;  3BTI A;  1SD7 A;  4G6T B;  2HQA A;  1WKM A;  3OY9 A;  2GBY A;  3PFY A;  3PM1 A;  2XC7 A;  3A0B C;  1XDS A;  3BQZ A;  4WX9 A;  1R6R A;  5GP9 A;  1NH3 A;  5TGT A;  2JA6 J;  3R0A A;  4S05 A;  2LKX A;  5DM6 F;  1YJ9 I;  3N4M A;  1D8K A;  5FRO A;  3E5U A;  2IS1 A;  2K40 A;  4DYC A;  1T56 A;  2VLA A;  3HUG B;  5GPA A;  2HEO A;  5M5W J;  1Y0U A;  2JPB A;  1KQ9 A;  2EZL A;  2ID3 A;  3AG2 H;  5CQG A;  2KP6 A;  2K9M A;  3Q0U A;  1YJN I;  1FYM A;  1ZEL A;  1SFE A;  1YYV A;  1MSF C;  3F23 A;  1I1S A;  3WTU C;  2KRH A;  5HDK A;  3GTQ J;  1O7F A;  2OJE D;  4XK4 A;  3QPL A;  3RKX A;  3UKG A;  1O4X A;  2H1L A;  2E1O A;  2MG4 A;  1GXQ A;  1RZ4 A;  4XMY A;  4L0Y B;  2X6Y A;  3LOC A;  1EJ9 A;  5KVR A;  2NVY J;  5K5O A;  1LQ1 A;  2VE9 A;  1UG0 A;  1OCO H;  3LA2 A;  3LSJ A;  4U0V A;  2YU3 A;  3W6K B;  1ZRF A;  4IKF A;  4O3M A;  2GIZ A;  1JI8 A;  4BXX J;  2GAU A;  1SC7 A;  2CQX A;  2MAB A;  3IL2 A;  3G1O A;  3BCB A;  1RES A;  2RV8 A;  3OIO A;  3L2Q A;  4G7Z F;  3EUH A;  2AQE A;  3BZC A;  2MW8 A;  1XS9 A;  1IRF A;  3K0L A;  5IT9 K;  3A01 A;  5K5R A;  3AKZ A;  3SZP A;  5J47 A;  4BDY A;  2MA3 A;  3RPQ A;  3GEZ A;  3L2C A;  3HHG A;  2WBM A;  3CUQ C;  1ETK A;  2VB6 A;  2KPM A;  4UV9 A;  2HU9 A;  2R5Z A;  3NWT A;  4EM0 B;  4HQM A;  3JRF A;  3JRD A;  5M5X J;  2AXL A;  4PK4 A;  1ZR4 A;  5KCM A;  5FKK A;  3ZQG A;  2TCT A;  3WU2 C;  5LHG A;  1B9M A;  2GXG A;  4AWX B;  3FXM A;  3OYF A;  5KNL A;  2NOJ B;  5C44 J;  1P4X A;  3R60 A;  1XTA A;  3ZQF A;  5B3S H;  4HNT A;  3C1D A;  3LST A;  1ZGJ A;  5FLM J;  4EJO A;  3O6B B;  2Z16 A;  4YEJ A;  2P4W A;  2ZSH B;  3E7L A;  5L3F A;  2GIV A;  1E0E A;  4A3K J;  4EGZ A;  1VQN I;  2DTR A;  4IRH A;  2BXZ A;  1TL8 A;  2IGO A;  1WI9 A;  1YOV B;  2Z99 A;  4S0H B;  1V5F A;  1U8B A;  2H27 A;  3ZR8 X;  4GDF A;  4RAZ A;  2IS2 A;  2LRE A;  2PFB A;  4NBQ A;  2RVC A;  3HGG A;  2Z3Y A;  2FXA A;  3F3X A;  1LE8 B;  1FOK A;  4E7L A;  4IHT A;  4LLL A;  5C4X J;  2CGP A;  3CUQ B;  1ZR2 A;  1T08 B;  4EJT A;  1CQT A;  1J0R A;  1MBF A;  1JTX A;  5J6X A;  2ETH A;  2AS5 F;  2TRT A;  2XGC A;  3OYJ A;  1P4A A;  2DOD A;  2LKS A;  1MIJ A;  2LSO A;  2KFD A;  2RAE A;  2E35 A;  3QOD A;  3DQV C;  3ABK H;  5F04 A;  1SAX A;  2L5Q A;  4XLN F;  4DGW B;  2WAF A;  1QBJ A;  4KMU X;  2M8E A;  3S2D J;  2LBF B;  3ECH A;  4I7H A;  2XAU A;  3RI4 A;  3DCF A;  4ZJZ A;  4RBO A;  1W7P D;  1O7L A;  1E3H A;  4QTR A;  4DZJ A;  2CS3 A;  3BTL A;  3BJ6 A;  4BJ6 C;  2EIM H;  3E6C C;  3RPU D;  4E7I A;  5D5W B;  1RC9 A;  1HXD A;  3DBR B;  3NEU A;  4ITV A;  5A2Q Z;  3BRO A;  3KEO A;  3AL0 C;  3NQO A;  2IGN A;  2DAO A;  1T2K A;  2CUE A;  1MMN A;  2HWV A;  4ZDL A;  3SXY A;  3BP8 A;  2NVQ J;  3OS0 A;  4LLN A;  2L4M A;  2A6T A;  3PO3 J;  4L9T A;  3K6G A;  5CVI A;  5EGO A;  1Z7L A;  2PJP A;  3CCU I;  1V55 H;  3VDX A;  2OTJ I;  4A12 A;  4XR6 A;  1JUP A;  3HBL A;  1WJA A;  1K61 A;  2P81 A;  2PJR A;  5F0H A;  1DU6 A;  5CVR A;  5CPR B;  4BXF A;  3TDU C;  3WG9 A;  3S1M J;  2E7X A;  3DEW A;  2XF6 A;  3L7W A;  2L54 A;  2HXO A;  1A35 A;  1FPQ A;  1W4M A;  2CFO A;  2FUG 2;  5BOX A;  2NNY A;  2RQP A;  4FHT A;  3DKX A;  1WGX A;  4LIT A;  4IOA F;  4PZJ A;  3WG7 H;  3JAM K;  4WWC A;  4RB3 C;  1MH4 A;  4KN4 X;  5HDN A;  2OPT A;  3I55 I;  3EUH C;  4FX0 A;  4QIW N;  2M34 A;  5ILU A;  4II2 A;  1R1V A;  3F9K A;  1SVO A;  4F91 B;  2DMT A;  1JGG A;  2Y2Z A;  1IN5 A;  3AL0 B;  3WTS C;  2CQK A;  1IUY A;  4BXU A;  1Z9C A;  2VBZ A;  5M5Y J;  4OMZ A;  2ZXI A;  1ZHF A;  3H0G J;  3TDZ C;  1K4S A;  4XOT A;  1K78 A;  1R5G A;  4PJM A;  5H6Q A;  3H1C A;  1OCZ H;  1FYK A;  1J5Y A;  2JVH A;  1KQ0 A;  3F6V A;  3U1D A;  1XSX A;  2DTZ A;  2FX0 A;  3GZ6 A;  3FM5 A;  5CJ9 A;  2QSH X;  3BDD A;  2D2W A;  1QGP A;  2QM3 A;  2L02 A;  3CMM A;  4J01 A;  3D5L A;  3NAR A;  2E2J J;  2Y0M A;  2EV5 A;  5J1R A;  1VQP I;  2LP0 A;  2X1D A;  4ZZD A;  3FBN B;  5D5X B;  2L4A A;  3ESW B;  3L2V A;  3D5R C;  3K1M A;  3HL2 A;  4V2F A;  3V8L A;  2R3S A;  1SMT A;  1R00 A;  1D8J A;  3A01 B;  2O6G E;  1HKT A;  4DBQ A;  3TMO A;  1BL0 A;  3HTU A;  3KLN A;  3JTG A;  2R7R A;  1V5E A;  2HKO A;  3M3Y J;  1HC8 A;  3KE2 A;  1K6Y A;  3GF2 A;  3LSR A;  3CJT B;  2R5Z B;  2XAS A;  4BJT A;  2B9S A;  5ICE A;  4GYG A;  4HYE A;  3P9I A;  1JKO C;  3GLL A;  3I71 A;  5AIP A;  3GO5 A;  2BY0 A;  2M5W A;  3JTH A;  3DU6 A;  4EJV A;  1XG1 A;  5CKT A;  3LA3 A;  3BG5 A;  3JCU C;  1D0X A;  4Y15 A;  5FKL A;  1EF4 A;  5HOD A;  3Q9V A;  3H9J A;  1XGO A;  2V9P A;  1YO5 C;  2ZSI B;  4YII A;  1I3Q J;  2VKE A;  2OZ6 A;  2FE3 A;  2I5U A;  3M8J A;  2CMP A;  1N25 A;  1FMV A;  1P6R A;  2HZD A;  2X85 A;  3E3V A;  3DEU A;  3M8E A;  3RSN A;  2DQR A;  3QOP A;  4I0B A;  2LY1 A;  3OYB A;  4IQJ A;  3ABL H;  3CO7 C;  4LK0 F;  1BI2 A;  3OIP A;  2K4J A;  2W25 A;  1HF0 A;  1YW7 A;  3RZD J;  2BE5 F;  2VXZ A;  2PX9 A;  2P6S A;  4BGD A;  5JVG F;  2MFZ A;  1MBH A;  3OV8 A;  1V3F A;  2XGE A;  4YG2 F;  2NVX J;  4HZF A;  4D5C A;  2EK5 A;  2NXN B;  1Y6I A;  2MLG A;  2W1O A;  2QWW A;  1VQM I;  2YX4 A;  5DCF A;  1XGN A;  2NS8 A;  2JPC A;  4U87 A;  3P7N A;  1UHW A;  3QPH A;  3FXK A;  3RQI A;  5ILV A;  2EB7 A;  1YW8 A;  3CP2 A;  4AID A;  1MMG A;  5M3F J;  5DD4 A;  2VON A;  5F0C A;  3A0H C;  3QYF A;  4IHS A;  3G1L A;  3R6S A;  3CMY A;  3BG9 A;  3MQ0 A;  5B1B H;  4CO8 A;  1ZYR F;  4UUS A;  2EPF A;  1BW5 A;  4M73 A;  2EV0 A;  4B8X A;  1PJR A;  3KX2 A;  2KIM A;  2XKP A;  2QQA A;  3OYN A;  3JRE A;  1H89 C;  3B73 A;  4LFU A;  2FML A;  5DEQ A;  1N75 A;  4M6V A;  5D8L B;  2IJL A;  2CG4 A;  2GQQ A;  2IW5 A;  4KIF A;  1GVJ A;  1BC7 C;  2EIK H;  1TT0 A;  2R7T A;  1FBU A;  2CU7 A;  3K7A J;  2VOO A;  3HYI A;  4IX7 A;  1YS6 A;  2A61 A;  4HBL A;  1RKT A;  2MGQ A;  5HOO A;  1WHU A;  3FXR A;  5E8G A;  3VB2 A;  2LC2 A;  3CUO A;  2LFB A;  3FDY A;  2PMU A;  5H6R A;  1P7J A;  3SEQ A;  4HLY A;  2KLO A;  1ZH5 A;  1KGS A;  2KMU A;  3N97 A;  1FP1 D;  2VUM J;  2FSW A;  2FRH A;  3SDB A;  3CC2 I;  5F0F A;  2DA4 A;  2DT6 A;  2BVL A;  3W2V A;  4BJ5 C;  1F36 A;  5J1Y A;  3VYS B;  2ADU A;  1XPX A;  4HNV A;  4NDL A;  4UXN A;  3F8M A;  4JX6 A;  4MFD A;  1DPR A;  2L01 A;  3C7J A;  1PP8 F;  1X2M A;  2F2E A;  2QCO A;  4UV8 A;  3MZY A;  1U9N A;  2FQ3 A;  2XB0 X;  5EGO B;  1IZ1 A;  1SD6 A;  1D3Y A;  2FOK A;  1JKQ C;  3K4C A;  2PJR B;  5LGU A;  2JSP A;  2H6C A;  2VXD A;  2E36 A;  1LB2 A;  2L9S A;  3ZP5 A;  3FZV A;  2W82 A;  1KA8 A;  4AC0 A;  2QBY A;  1JHF A;  2CV0 A;  1YE9 A;  3KP7 A;  2JMW A;  4Y4R A;  3M8F A;  2K7L A;  4L9N A;  2RQQ A;  1TQI A;  2JUG A;  4ZYG A;  1WFX A;  2L7K A;  3FKI J;  4M74 A;  1IXC A;  2ECB A;  3E6B A;  1YTY A;  1D1A A;  2KRC A;  2IGM A;  3ERM A;  3SFZ A;  2P0W A;  5C4J J;  3CF2 A;  1B8I A;  3TBI A;  1WI3 A;  5IYC J;  1YIJ I;  3LSK A;  4XKW A;  4EVI A;  3ZQC A;  1OCC H;  3QOE A;  5HLH A;  3GFI A;  4ENK A;  5FRM A;  3CF5 F;  4D1Q A;  1IO2 A;  1XDU A;  4M9S A;  3PFI A;  2HOE A;  3VYR B;  1MD0 A;  3G73 A;  3QQA A;  4G12 A;  1K78 B;  3Q5F A;  2OV7 A;  2XRN A;  2X1E A;  2DW4 A;  1S7A A;  2F5D A;  5J4Y A;  1VQ7 I;  2EFQ A;  1F43 A;  1ETO A;  2L3D A;  1Y39 A;  2BEO A;  1AOY A;  1K83 J;  4AU7 A;  2V79 A;  3RKQ A;  3S16 J;  4EM1 A;  2DI3 A;  2LYC A;  1Z1D A;  4HSR A;  2Y30 A;  4FET A;  1OYW A;  4P1W A;  1HW2 A;  1YIT I;  3VOD A;  4E6K G;  4E7Z A;  1P9Q C;  3QYB A;  3J81 K;  1IRZ A;  2QQB A;  1X1A A;  2EZK A;  3MZH A;  3CME I;  2L0K A;  3IH3 A;  2JWT A;  4HX4 A;  2GA1 A;  4YFX F;  1ZRE A;  3CES A;  5DS9 A;  3OR2 C;  2K5C A;  4CYC A;  3KIO A;  3L2W A;  4FIS A;  2LD5 A;  4HDV A;  4Z6Y A;  1UZC A;  2VQC A;  1BR1 A;  3AG3 H;  3G3Z A;  4WXH A;  4B3X A;  3HG9 A;  2X9D A;  3CJR B;  1Y8R B;  4V19 K;  2WC2 A;  2JRT A;  2EFW A;  1Z7U A;  3GTM J;  3H3Z A;  4C2M J;  1MMA A;  4ZDP A;  3HM5 A;  3Q0W A;  3EYI A;  2CW0 F;  3ROU A;  4N4N B;  3ZMS A;  5L3G A;  2CRG A;  2LDU A;  2LLK A;  1NG7 A;  3J7Z I;  1L3L A;  1ZAR A;  3CCE I;  2BW3 A;  2BV6 A;  3IH2 A;  3G1M A;  3V4G A;  1EV7 A;  3ABT A;  2V26 A;  1XN7 A;  1O3R A;  1X3Z B;  3T8R A;  3DKY A;  1A36 A;  5F27 A;  2HTJ A;  4EEF G;  2Y9Y A;  3O8G A;  3K4B A;  5IP7 J;  2DN0 A;  3CC7 I;  1SFU A;  4CYD A;  3W6J B;  3DKW A;  5JLW A;  4V2G A;  2JA7 J;  3QYE A;  1VND A;  2CUZ A;  1TC3 C;  3GTJ J;  4XKC A;  3PUB A;  3KP2 A;  5HDG A;  1LVK A;  1JUS A;  2OZU A;  3U2R A;  1YX5 A;  2A5W A;  3MD2 A;  2VKH A;  2YX7 A;  2VL8 A;  2P7C B;  2HGC A;  5LHI A;  3S2H J;  3A1Y A;  3WGH A;  2LKP A;  2DMN A;  4XOP A;  4A5M A;  5FJ8 J;  3ZMU A;  4U0Y A;  2QA4 I;  5E79 C;  1T0F A;  3HKZ N;  4L9V A;  3WU1 B;  4N0B A;  2HDC A;  2R7X A;  5K7H A;  4AYB N;  1OYI A;  1FEX A;  4PJL A;  4XN0 A;  3IAM 2;  3H0D A;  4Q47 A;  1BIA A;  3CCM I;  2DMU A;  3FK7 A;  3EYY A;  1Z67 A;  4HX7 A;  2ISY A;  1ON1 A;  5E18 F;  1MJA A;  3E0J B;  4KUM A;  2DA2 A;  2KJC A;  5IYB J;  1FTT A;  4UUS B;  1ZAO A;  1WJC A;  2ECC A;  3KYD B;  5ICG A;  3GTO J;  3JRG A;  2V1D A;  1RUO A;  1LPQ A;  3D1N I;  1ETY A;  4E70 A;  1OYY A;  2HQR A;  5LRR A;  1TQM A;  2MC4 A;  4PFO A;  1IRX A;  1IAW A;  3R4K A;  3GZN B;  2DLL A;  4JOM A;  1OPC A;  5EYR A;  3RYR A;  2FOW A;  3RCO A;  2MH9 A;  3SYT A;  5DUI A;  3BOQ A;  2Z1D A;  3KP5 A;  4NUB A;  5KK1 A;  2NS0 A;  4B43 A;  2PG4 A;  2EA2 A;  2F5C A;  3GW2 A;  4LIU A;  1RIO H;  4KFC A;  1Z91 A;  3TOB A;  1YS7 A;  1UCR A;  3FXJ A;  4PFP A;  1I3A A;  2KT0 A;  2UWM A;  4YIR X;  2RGV A;  4RM3 A;  5CYV A;  4CCM A;  3I3L A;  1X1C A;  2LR8 A;  1F1Z A;  1SFX A;  4M6Y A;  1UG2 A;  1MMS A;  2O0Y A;  5E3N A;  2RNJ A;  4G94 A;  3HOZ J;  2G7H A;  3BJO A;  3OYE A;  3GLX A;  3WTY C;  4XLE A;  2Z2S B;  4NNJ A;  2KIS A;  2HTS A;  3WTT C;  2CJJ A;  4HA8 A;  1P2F A;  2V4J C;  1S5L C;  2DDB A;  2IP2 A;  4CHU A;  5FRN A;  3O8H A;  1BI0 A;  1SMY F;  2BOL A;  1W0T A;  1MBG A;  4RB2 C;  2OUM A;  3LAJ A;  3V8J A;  4LK1 F;  1I50 J;  2XGX A;  3C2G A;  4Y3O A;  2QBY B;  4N9I A;  4PJ0 C;  3HGY A;  3MCZ A;  2D1V A;  2HPI A;  3ZRG A;  2K9L A;  1WH5 A;  4XRF A;  3KYC B;  3SEZ A;  1UAA A;  3IP4 B;  5D5U B;  4YIF A;  2OCE A;  4ANJ A;  3G6E I;  2JUC A;  2E34 A;  3CCQ I;  1QPI A;  2FBH A;  1LEA A;  1HA8 A;  4K2E A;  1ZRC A;  2PBI A;  2HOA A;  2WAD A;  3PIO F;  2X6O A;  1B8I B;  4RB0 A;  3TGN A;  1EH6 A;  4D7M A;  2JZY A;  3HSF A;  2Q0O A;  4PUS A;  1TW3 A;  3C2H A;  2M30 A;  4BHP A;  2Y0S N;  5J8C A;  1WJF A;  1G3W A;  2MC3 A;  2DK8 A;  2JA8 J;  6PAX A;  3C2B A;  4FX4 A;  2E19 A;  3MVP A;  1XD7 A;  5IP9 J;  2LF7 A;  2XV4 S;  5ICF A;  3HKZ A;  2DA3 A;  3OL4 A;  2ZKZ A;  4DBR A;  1U5T A;  4AYB A;  1FZP B;  2HR3 A;  4YRV A;  5EEH A;  3LNQ A;  5FFX A;  1TP4 A;  4BQO A;  4IQ4 A;  4M3E A;  3V42 A;  1XGM A;  2W4S A;  4F93 B;  4AIH A;  2KZV A;  2QF7 A;  2O7O A;  2IA0 A;  1QZE A;  2KQR A;  2WTE A;  2RN7 A;  2O9L A;  2RKH A;  3RDI A;  1EH8 A;  1U6G A;  1UEL B;  4CYC B;  3OYD A;  1X3W B;  4XQF A;  2E60 A;  1PDN C;  4BY7 J;  1XSD A;  1RET A;  2PMZ N;  4A0X A;  3CO6 C;  4E7H A;  4II3 A;  4QLC U;  4WCG A;  3FMQ A;  1R4M B;  2VPL A;  3DBL B;  4OMY A;  2EWN A;  3FX3 A;  2XVC A;  1T0F C;  1T95 A;  3HRT A;  3SHF A;  3ZPL A;  1ZLJ A;  4GCV A;  2V1X A;  4B1R A;  2HYF A;  5H20 A;  5JVT A;  2X4H A;  1Z21 A;  3QP5 A;  4QPQ A;  4ESJ A;  5JHF A;  1BW6 A;  3O2P E;  3P9C A;  5LD2 C;  1FBS A;  5EF6 A;  2D5V A;  2BW3 B;  1MBE A;  1YW9 A;  3FXL A;  1OCT C;  4IRI A;  1ITY A;  3LQR A;  1ZQ3 P;  1QU3 A;  1Q1V A;  2LMD A;  3H5N A;  3DTK A;  2ZXW H;  2R5Y A;  1STZ A;  4Y52 J;  3SFI A;  4IPA A;  2GXA A;  1GVD A;  2ZO4 A;  1A6I A;  2EIL H;  4UHT A;  2ME6 A;  4FAS D;  1IV8 A;  1YG2 A;  3PNT A;  4FE7 A;  2X0L A;  3GFJ A;  2R7O A;  4XKB A;  1OKR A;  3F8B A;  1VQ4 I;  3OIQ A;  1U0J A;  1AA7 A;  4RAF A;  2ZJ2 A;  2X48 A;  1IRG A;  2OAZ A;  4KA4 A;  3HSR A;  4Q48 A;  4EMS A;  4XSZ F;  1Z3Y A;  4G6Q A;  3K4K A;  1IDZ A;  1VQ8 I;  2ZJQ F;  3DPT A;  1BM9 A;  1H8A C;  4ZYH A;  2HVQ A;  3UNG C;  4XM3 A;  1HBX G;  3HIF A;  5B66 C;  2O03 A;  1DU0 A;  3DV8 A;  3M9A A;  4R79 A;  2H94 A;  2OC6 A;  3MZ8 A;  3S3M A;  2CYY A;  4HW0 A;  4B48 A;  3NWS A;  4XLA A;  3GCM A;  3PSI A;  4PJJ A;  4XNF A;  4I09 A;  1KU3 A;  1A31 A;  2CUJ A;  2IRF G;  2NOG A;  1Y1W J;  3ZGK A;  2Y0S A;  4I76 A;  1BI3 A;  4OWR B;  2GOX B;  1WJD A;  2XSJ C;  1LFB A;  5EZG A;  1U3E M;  4C2U A;  2W85 A;  5CLS A;  1Q1H A;  4A3E J;  2EBI A;  1QO0 D;  5FLX K;  3KZY A;  4B09 A;  3CTA A;  2IVM A;  5EZH A;  4AD9 A;  2MD5 A;  4L0Z B;  5LBQ A;  3ZMV A;  1MJ9 A;  2K4B A;  1WWX A;  2NYX A;  1VZ0 A;  3EUA A;  4DIQ A;  4IO9 F;  2Y31 A;  4LG3 A;  4XLC A;  3Q3S A;  4B44 A;  4CZC A;  2H8W A;  4NHJ A;  1ZGW A;  1U2W A;  1J9I A;  2AXT C;  3ZQQ A;  3V7R A;  1X19 A;  2F5V A;  3WHC A;  3S1Q J;  4JYK A;  2HQ5 A;  2B63 J;  2HDD A;  1UFM A;  2ZME B;  3U9G A;  3ABU A;  3ELK A;  4C30 A;  1HDP A;  1LJ9 A;  1TWG J;  4CCJ A;  3J81 Z;  2PMZ A;  3EQL F;  3H5A A;  1MJB A;  5HLI A;  3PJR A;  3QWL A;  4ABZ A;  3BY6 A;  1VI0 A;  2M4G A;  2WY7 Q;  1YRN A;  4FQG A;  5IP6 A;  2PMH A;  1IG7 A;  3M1E A;  4A3B J;  5F08 A;  1U5T C;  1YIO A;  4CUG A;  5B1A H;  4HF1 A;  3L2R A;  2VT3 A;  2OBP A;  3BG6 A;  1J09 A;  1N77 A;  3H5R A;  3ZXS A;  2BY3 A;  3OYM A;  2L7Z A;  3K1P A;  3OYK A;  1PVE A;  2AQF A;  2JK3 A;  2NAZ A;  2ZXH A;  4KJZ A;  4AIJ A;  3S1R J;  1H9T A;  1O3S A;  4UVC A;  4CCO A;  4A3M J;  4NC7 A;  4RMN A;  2ZJR F;  4I0A A;  2E71 A;  4IF4 A;  2G0E A;  3TOA A;  3GTG J;  4ZC3 A;  1ACI A;  1B9N A;  4C3H J;  3FHZ A;  2Z9O A;  3FF5 A;  4ZH4 F;  2W24 A;  1BOA A;  3ISP A;  3E6D A;  5D4R A;  1GT0 C;  1CF7 A;  2FNP A;  4BAC A;  4F52 A;  3F72 A;  4RS8 A;  1QNT A;  3PL8 A;  3BR6 A;  2XB5 A;  3IWF A;  4MFE A;  4D5F A;  1PUF A;  1KON A;  2YPR A;  3ZQI A;  3BPV A;  4O5V A;  1MSE C;  3U21 A;  1B4A A;  2K3P A;  5E3M A;  1N78 A;  4PJN A;  4LMY A;  4YFN F;  3NRV A;  1GXP A;  4HNU A;  1KYW A;  1TNT A;  3WHB A;  3GUD A;  2EJR A;  1U5T B;  3W2A A;  2STT A;  2JJ7 A;  1G3Y A;  1Z77 A;  4RAG A;  3HRM A;  3BR5 A;  4ESF A;  5KHD A;  2QSF X;  3DTI A;  3GFM A;  5AIQ A;  4HX8 A;  3BLY A;  1SVM A;  5ERI A;  1LVA A;  5FGM A;  1IDY A;  3VEP A;  4KYW A;  2O61 A;  3FKJ A;  2V7F A;  1GHC A;  2R7U A;  2DQL A;  1XMK A;  4A0Y A;  1VTN C;  4HF2 A;  3I64 A;  2W57 A;  1R71 A;  3CCJ I;  4MIM A;  3HC7 A;  2UXN A;  2A3S A;  2RDP A;  1C0W A;  2QEX I;  2WB1 N;  3CDI A;  1LEB A;  2ICW G;  3ZCO A;  3WE2 A;  3GTL J;  2ME0 A;  4GRI A;  5LFA A;  1WJE A;  2VOP A;  1KZH A;  2QSG X;  1TWC J;  2G7U A;  4LJZ F;  1USS A;  3QPT A;  4LG0 A;  4L18 B;  2XPW A;  3E6M A;  3BR2 A;  1X2N A;  4GYI A;  4HEA 2;  3D5S C;  1ZRD A;  1ETQ A;  2A6E F;  1XCV A;  3KP6 A;  3I4M J;  3KEQ A;  1IN7 A;  1REP C;  4U0W A;  5K5Q A;  3HOS A;  3K2Z A;  3FIS A;  3L1P A;  3M1C A;  3BZ6 A;  3C18 A;  4P96 A;  4MO7 A;  3ABM H;  3KEY A;  3F8F A;  5J3L A;  3R0J A;  1VQ5 I;  4XBF A;  3OOP A;  1MH3 A;  5TJJ A;  1FIA A;  2K9Q A;  4IHV A;  4RGU A;  2IPQ X;  3KYL A;  2R5Y B;  2DOF A;  3ASO H;  2IXS A;  3MFK A;  2FNA A;  1LFP A;  2KIQ A;  1GV2 A;  4P9F A;  4RLQ A;  2ZNY A;  2M0M A;  1O57 A;  5K7Z A;  3HTS B;  1OMI A;  2YUS A;  4PGH A;  3VSK A;  3E1S A;  1TWH J;  3D0S A;  3L9F A;  3HOV J;  2VQG A;  5FFZ A;  4M3B A;  2HPM A;  2NS7 A;  5EEA A;  4CXF A;  2HNH A;  2V6E A;  1TWA J;  3HOW J;  2YS9 A;  4BBS J;  4NC6 A;  5FB2 A;  4EM2 A;  3KP4 A;  2IGK A;  3B02 A;  1QPM A;  3CCR I;  2A6H F;  4LGW A;  1D0Z A;  3BR1 A;  1OR7 A;  3KPH A;  5D6E A;  4X6A J;  4NC8 A;  4UVA A;  2HKX A;  1XGS A;  1APL C;  1JT6 A;  4QWQ A;  4BY1 J;  3I58 A;  1BBY A;  3FXO A;  3H3V K;  4G8X A;  3OYI A;  4IHX A;  3DFG A;  1YHQ I;  2XF5 A;  3QU3 A;  1TNS A;  5L3B A;  2VKD A;  4BBR J;  3DBH B;  1EH7 A;  3B6A A;  2CW8 A;  1DUX C;  4PCQ A;  2KDZ A;  4IOC F;  1VQO I;  2L7M P;  4U7B A;  5IT9 Z;  3TKY A;  1JE8 A;  2NNN A;  3S1N J;  3BT9 A;  2CV1 A;  1X58 A;  1MW7 A;  3I59 A;  4EGY A;  3GFL A;  5FKM A;  3K70 C;  2FD5 A;  1B6A A;  2JA2 A;  1AHD P;  2WV0 A;  1X4O A;  5HS7 A;  4M72 A;  4BUP A;  3ECO A;  5JFR A;  1YLF A;  2QUF A;  3T8T A;  2ESN A;  1T33 A;  2O5R A;  3JRA A;  2W84 A;  4LLG F;  3HJE A;  5E1W A;  4AVP A;  1I1G A;  5E8I A;  3PO2 J;  2WB1 A;  4BU2 A;  5BS6 A;  1I39 A;  2FF4 A;  3BR0 A;  1VFC A;  2IA1 A;  3W2W A;  2ZJP F;  2YU9 J;  2E1N A;  2WAQ N;  3OWT A;  2ZC2 A;  2VC1 A;  2XDV A;  5CVU A;  5JI6 A;  2E1C A;  2K86 A;  4RGX A;  3TL4 X;  3ZQH A;  1BA5 A;  1Y0N A;  1YRN B;  1TWF J;  1K4T A;  2R7Q A;  3T1B A;  1X1B A;  3H36 A;  5A2Q K;  3GWZ A;  1S72 I;  5AON A;  3RZO J;  1JTY A;  2HVS A;  4PSX A;  2UXX A;  1MDM A;  1WRJ A;  2VPR A;  3CMA I;  2TDX A;  2Y9Z A;  1ZLK A;  3S8P A;  3OYC A;  3HRS A;  2W48 A;  2EFP A;  3V8K A;  1WZ2 A;  3FMS A;  5GAD J;  3TO9 A;  1BJZ A;  3TP0 A;  5GTI C;  1SAN A;  2ZFU A;  2R7V A;  2EFN A;  2ESH A;  1HW1 A;  2L9V A;  1QQI A;  4M9Z A;  3PUF A;  1WSU A;  3GX4 X;  3TP3 A;  2LOO A;  2MH2 A;  4M3F A;  4UVB A;  3RJP A;  4CDG A;  2KKO A;  1CF7 B;  5F1R A;  1WPK A;  4OAY A;  3BZK A;  1J7K A;  5CQE A;  4PSW A;  4HV6 A;  4D0P A;  1PUF B;  3IV5 A;  3J80 K;  2H1K A;  3TED A;  3E97 A;  2K9N A;  3OSF A;  2JRM A;  4YFK F;  2LNB A;  4JBA A;  3RTR A;  2DYR H;  1OQY A;  1ORK A;  2VAS A;  1GLN A;  2K3F A;  1PYV A;  2Y75 A;  4I99 C;  4UB8 C;  3SJM A;  1D5Y A;  2DPU A;  1VQL I;  4G9Y A;  4XSX F;  3CCV I;  3LL7 A;  1AWC A;  3NAU A;  1AKH A;  4MEY F;  3C3W A;  4GGG A;  1KU7 A;  3CJN A;  1DP7 P;  2WA0 A;  5DDG A;  2ZB9 A;  5J4V A;  3BG7 A;  3K4J A;  1QHG A;  2R92 J;  3IKV A;  1JHH A;  2KIU A;  1HQC A;  1Z3X A;  2P5L C;  1D1B A;  1U8R A;  3S15 J;  2EIN H;  4Y17 A;  1IGN A;  3FXQ A;  2XSD C;  3Q9S A;  4EQQ A;  4NQW B;  1DGR M;  1R1T A;  2F5F A;  2DFF A;  4IZZ A;  1IC8 A;  4XRS A;  1LFU P;  3J7A Y;  2Z5U A;  4LIV A;  3S17 J;  1D0Y A;  2DCE A;  2OQR A;  3E5Q A;  1JJ6 C;  3AAF A;  2EQR A;  2RRE A;  3ASN H;  2XRL A;  3HZJ A;  4F7Z A;  2R7Z J;  2V6C A;  5IYD J;  1S8N A;  3F6O A;  4M9X A;  3TQN A;  4LG0 B;  2EZH A;  5D6F A;  1Z0X A;  1ZG3 A;  1JKR C;  4ZYD A;  1E3O C;  1XSV A;  2L2O A;  4GXO A;  2PI0 A;  2L9N A;  1OR7 C;  1JUM A;  3K4M A;  2OTL I;  3LMM A;  2N8G A;  1PP7 U;  3RIR A;  4U7D A;  2W00 A;  1QZZ A;  2QVO A;  2HZT A;  1B1B A;  3QPS A;  1X1D A;  3HEF A;  2WAQ A;  2Y48 A;  4XN3 A;  1IXS B;  3S3O A;  3JAM Z;  3O3K A;  2YR2 A;  2LH9 A;  2XGD A;  2ZCW A;  3JW4 A;  4XLH A;  1GDT A;  5D8K B;  5LLQ A;  3FK6 A;  3MMY B;  3KZI C;  1AU7 A;  1G3T A;  2GZW A;  2IT0 A;  1S9H A;  3VYT B;  2F4M B;  2QZ8 A;  1JXS A;  1BN5 A;  1RR8 C;  2EA4 A;  2VIX A;  1F5T A;  3J7A O;  4A3F J;  4KMF A;  4XLP F;  2DMQ A;  4LD5 A;  5DUK A;  1T38 A;  2CQ7 A;  2DOA A;  4HG2 A;  1G59 A;  2LRD A;  3MWM A;  1R23 A;  2M87 A;  4IRG A;  3ZMZ A;  2M1B A;  2A69 F;  2Z33 A;  4KIC A;  5L3D A;  3IRQ A;  2JN6 A;  2HFH A;  3ERE D;  1MNM C;  3H9Q A;  3HXL A;  5DD8 A;  4C9Y A;  1TTY A;  2J5O A;  3AG4 H;  1ZG5 A;  3SZT A;  4DNC A;  4BE1 A;  3HRU A;  2XAH A;  3HHH A;  2ZME A;  3UR3 C;  2BZT A;  1QHH D;  3H9G A;  5M3M J;  1ODD A;  1FSH A;  1GV5 A;  4N9H A;  3SDG A;  4BL0 B;  2K27 A;  2IBD A;  2K85 A;  2PLY A;  1HW5 A;  1SD5 A;  3CJQ B;  4RAY A;  3HSE A;  3LSI A;  2MSY A;  3MKZ A;  2W7N A;  2GOM A;  1P7I A;  2LG4 A;  1W1W E;  2PN6 A;  5JHU A;  1GUU A;  1SD4 A;  3K9T A;  3I59 B;  3MAJ A;  3H92 A;  1BOB A;  1A04 A;  2D1H A;  3DPL C;  5E17 F;  2XAF A;  1NK3 P;  4MGR A;  4QPO A;  2QQ8 A;  3IH4 A;  3I4P A;  3QU6 A;  3SQN A;  1WVR A;  2I8D A;  1R36 A;  2G9W A;  3PNV A;  1SFO J;  5C3E J;  1D1C A;  3MEX A;  1FOW A;  2BY2 A;  2Q8K A;  3T0Y A;  1S3J A;  4DJA A;  2QKM B;  2R7F A;  1J2X A;  1G6N A;  3WTZ A;  1DPU A;  3HPG A;  4W97 A;  2P8T A;  3KET A;  1X4P A;  5LEJ A;  2L7F P;  4Z2Y A;  3I54 A;  1DGW Y;  2O3F A;  4WF2 A;  2PEX A;  4XIC A;  5LHH A;  3GYH X;  3ZMD A;  1MDM B;  1A6Q A;  5IOY A;  4MEX F;  1ZK8 A;  2UV1 A;  1Y1V J;  5EEG A;  1W5S A;  3HOT A;  1JT0 A;  2WY8 Q;  3F22 A;  4BS9 A;  5GPC A;  3GTK J;  3FIW A;  2EFO A;  4YEL A;  1OJL A;  3S93 A;  5FO5 A;  1Z6R A;  1KQ8 A;  4B3A A;  3IKT A;  2F4O B;  2DFE A;  2JT1 A;  1W36 C;  4A2U A;  1K79 A;  3S14 J;  2CFX A;  2M7A A;  2DO7 A;  2X1C A;  5E20 A;  2HOS A;  2Y69 H;  2HYG D;  3I0T A;  1FSE A;  3LWF A;  1BR2 A;  2B0L A;  3BPX A;  1XX5 A;  3H3U A;  3IWZ A;  3PQJ A;  3CQZ J;  3FXU A;  1LKX A;  2GXB A;  3LSM A;  3EUK L;  1V4R A;  3P9K A;  2LK2 A;  1FTZ A;  2JQ7 A;  2VBY A;  2YSR A;  3K4N A;  1A5J A;  1ONV A;  1XMX A;  3AG1 H;  1S29 A;  5J1U A;  1RI7 A;  3VWB A;  1FOX A;  1NTC A;  1WH7 A;  3OS2 A;  4QSH A;  4NB5 A;  1FWZ A;  4MNU A;  1AKH B;  2VQH A;  1ETV A;  1FLI A;  2M8G X;  4BQA A;  1ZTR A;  2BXY A;  5IT3 A;  5EG0 A;  4M3D A;  1IN8 A;  3HOY J;  3WOD F;  3PIP F;  1MBJ A;  1I5Z A;  1IXR C;  2JTV A;  2KHM A;  5LEK A;  2R7W A;  1T39 A;  3E5X A;  1OLT A;  4BEH A;  1R9T J;  5ICC A;  1FJL A;  4GFB A;  5E1Z B;  1CGP A;  4C2T A;  1S7E A;  3A4C A;  3FM3 A;  3REO A;  4BQN A;  1MND A;  3W6V A;  4CA0 A;  2E2H J;  4RGS A;  2CWE A;  1JGS A;  2M2E A;  4M71 A;  2CSO A;  4RM2 A;  2COB A;  2NRA C;  1MZB A;  1TZL A;  3BR3 A;  3QP6 A;  5GAH J;  4UB6 C;  2BY1 A;  3CCY A;  5IY5 H;  2WWY A;  4BAY A;  1G2H A;  5DYM A;  3KCC A;  5BMZ A;  3I53 A;  4E7K A;  3CP8 A;  2HYJ A;  3F21 A;  4MTE A;  3A2K A;  4A6D A;  3OYH A;  3CLO A;  4BNC A;  4A3J J;  2OCC H;  3TW7 A;  2WV1 A;  2MBF A;  4JQF A;  5J8F A;  2HI3 A;  1WCM J;  3M7G A;  1RRJ A;  3I4N J;  4OIO F;  1V54 H;  2ZME C;  2IA2 A;  3OS1 A;  2R7S A;  4A5N A;  5DV5 A;  2P5V A;  4AM3 A;  3ZQ7 A;  1IJW C;  4U88 A;  2DFH A;  1QVU A;  3GZ5 A;  2ACJ A;  4KT5 C;  3K70 D;  5TIS C;  1HKQ A;  1JKP C;  2H6B A;  3LFK A;  4OIR F;  4KDP A;  3IAS 2;  1BR4 A;  1YQA A;  1LUJ B;  1FT9 A;  3FWE A;  1ZN2 A;  1ZGA A; 
#chains in the Genus database with same CATH homology
 2VT2 A;  4P9U A;  2DT5 A;  2XIG A;  3FMR A;  4I2O A;  1R22 A;  1BJA A;  2FA5 A;  3WGG A;  1U78 A;  2VE8 A;  2D45 A;  4R1H A;  4RB1 A;  1H0M A;  4HOB A;  4O6J A;  5F6F A;  1DDN A;  3DXJ F;  1KYZ A;  1TBX A;  3WGI A;  1F9N A;  2M45 A;  2DU9 A;  3R61 A;  4IJA A;  4H0E A;  1IF1 A;  4CZZ A;  1L0O C;  4ASN A;  2ISZ A;  3RKY A;  3J80 Z;  4EJW A;  2ZXJ A;  1BC8 C;  3QAH A;  3LAP A;  3F8N A;  5LGT A;  4ZZL A;  4BHC A;  4HLX A;  2J5P A;  4Q5S F;  4WXC A;  1IW7 F;  3DP7 A;  4PGG A;  4A0Z A;  3KLO A;  1G4D A;  5HLG A;  4I01 A;  4JK1 X;  5HS8 A;  3RYP A;  1W7P A;  1LDJ A;  1PUE E;  3RKW A;  4HF0 A;  2V1U A;  3L00 A;  5TRD A;  2XKO A;  1YFH A;  1TQP A;  1NHA A;  4BH9 A;  2VOD A;  3RPU A;  5LRS A;  1UST A;  4KIB A;  4I02 A;  5CVV A;  4ON0 A;  2XAJ A;  5D4S A;  2DK5 A;  2DFI A;  2QYO A;  2BYV E;  1IN6 A;  3GVA A;  1G3S A;  2JSC A;  4HV5 A;  4MQ9 F;  2ZNZ A;  1FBQ A;  1LDK B;  1T6S A;  1FX7 A;  3V7S A;  4S04 A;  2P7V B;  1MKM A;  1TW2 A;  1ULY A;  2VBW A;  3I5U A;  2STW A;  4NQW A;  1S7O A;  3T5X A;  4ENM A;  2V9V A;  1HSJ A;  4Y13 A;  3COA C;  1W5T A;  4ZYE A;  4IXA A;  4MQV A;  3BJA A;  5BPD A;  2PQ8 A;  2GWR A;  4G7O F;  1E17 A;  2OU2 A;  4KIG A;  3IRR A;  4OIQ F;  3V7C A;  1LNW A;  1R7J A;  2P6T A;  3BWG A;  2A68 F;  4UUV A;  4GO1 A;  3IHU A;  2VC0 A;  4A6E A;  1BI1 A;  4HAM A;  5K1Y A;  5BQT A;  1KU2 A;  1X3U A;  5DCM A;  1T98 A;  2F5E A;  2VN2 A;  5FD5 A;  4EJU A;  2ZBK A;  4KNY A;  1FP2 A;  5CVJ A;  2ELH A;  2R7D A;  2KJB A;  2FMY A;  1H9G A;  2XUB A;  1R5H A;  4ENJ A;  4Q4Z F;  3ZN1 A;  4AIK A;  1K7A A;  2Q2E A;  1LDD A;  2FBK A;  5ILS A;  1J59 A;  5L3C A;  4PDK A;  3S2W A;  4MTD A;  3LQQ A;  2QLZ A;  2HQN A;  5HVQ C;  4WK8 F;  2OA4 A;  5D5V B;  4HDU A;  1HST A;  3F8C A;  2QEN A;  5F64 A;  1J75 A;  2OQG A;  1FYL A;  1K6O A;  3HUG A;  4G6D A;  1BIB A;  1B59 A;  2C6Y A;  3CDH A;  2HS5 A;  4BYY A;  3KP3 A;  1E2X A;  3KZZ A;  3TO7 A;  4HQE A;  4OIP F;  1WQ2 A;  3KFW X;  1XCB A;  2GA2 A;  1Z6T A;  1UHM A;  1P92 A;  1P4W A;  2P5K A;  1R1U A;  5E1X A;  1ON2 A;  4I98 B;  3WTV C;  1RNL A;  5BPI A;  2QQ9 A;  2KIF A;  2A5Y B;  4LB6 B;  4R8H A;  2H09 A;  1D5V A;  3JSO A;  2COM A;  3LA7 A;  2DBB A;  3ML6 A;  3K1N A;  1W7P B;  3VFZ A;  4M6X A;  2ZFW A;  2UZK A;  1ZG1 A;  1S6L A;  2RC4 A;  4OOI A;  3WTW C;  3WTX C;  4L5I A;  1FNN A;  4P5O A;  3JSP A;  2OD5 A;  1XB4 A;  1QZY A;  2MLK A;  2A07 F;  2K02 A;  3PQK A;  2O8X A;  1Z05 A;  2KRF A;  5FD6 A;  4DQ2 A;  4IVN A;  5ED4 A;  2BBY A;  4ESB A;  2FU4 A;  5LGN A;  3CUQ A;  1FY7 A;  2XHK A;  5FLX Z;  4L5J A;  1MGT A;  1R58 A;  1HKS A;  4OU0 A;  2FBI A;  5JR3 A;  4G7H F;  3DF8 A;  1KU9 A;  4ETS A;  2XRO A;  1XMA A;  4P55 A;  4UNO A;  4ENN A;  2CO5 A;  4TV7 A;  1F4K A;  1FC3 A;  2BGC A;  3ZN0 A;  4MHG A;  3EDP A;  4OIN F;  4CGZ A;  3ULQ B;  1I27 A;  1TLH B;  3K69 A;  5DCM B;  3VOE A;  3TO6 A;  2XAG A;  5L3E A;  1IN4 A;  2LF8 A;  2XAQ A;  4BHB A;  4LB5 A;  2DPD A;  4CIC A;  1UB9 A;  3ZMT A;  1O3Q A;  1I6X A;  5HS9 A;  4KN7 X;  2VBX A;  3WE3 A;  4RGR A;  4EV0 A;  1O3T A;  3EET A;  3L09 A;  4L9J A;  3QRF F;  2EV6 A;  1RUN A;  3IC7 A;  4WXD A;  3GXO A;  4FT8 A;  3WU0 A;  2E7W A;  2FEZ A;  1SD7 A;  1WKM A;  1XDS A;  4WX9 A;  3R0A A;  4S05 A;  3N4M A;  1D8K A;  3E5U A;  2HEO A;  1Y0U A;  2JPB A;  1KQ9 A;  1FYM A;  1SFE A;  1YYV A;  3F23 A;  1I1S A;  3WTU C;  5HDK A;  1O7F A;  3RKX A;  1GXQ A;  1RZ4 A;  4L0Y B;  5KVR A;  1LQ1 A;  5K5O A;  2VE9 A;  3LA2 A;  4U0V A;  3W6K B;  2YU3 A;  1ZRF A;  4O3M A;  2GAU A;  3IL2 A;  2RV8 A;  4G7Z F;  3EUH A;  1IRF A;  3K0L A;  5IT9 K;  5K5R A;  3SZP A;  2MA3 A;  3RPQ A;  3GEZ A;  3L2C A;  3HHG A;  3CUQ C;  4UV9 A;  4EM0 B;  4HQM A;  2AXL A;  5LHG A;  1B9M A;  2GXG A;  4AWX B;  1P4X A;  3R60 A;  3C1D A;  3LST A;  1ZGJ A;  4EJO A;  3O6B B;  2P4W A;  5L3F A;  2GIV A;  4EGZ A;  2DTR A;  4IRH A;  1WI9 A;  2Z99 A;  2H27 A;  4RAZ A;  2PFB A;  2RVC A;  2Z3Y A;  2FXA A;  3F3X A;  1FOK A;  4IHT A;  4LLL A;  2CGP A;  3CUQ B;  4EJT A;  1J0R A;  5J6X A;  2ETH A;  2AS5 F;  1P4A A;  2LSO A;  3DQV C;  1SAX A;  4XLN F;  1QBJ A;  4KMU X;  2M8E A;  3ECH A;  4I7H A;  3RI4 A;  1W7P D;  1O7L A;  3BJ6 A;  3E6C C;  5D5W B;  1HXD A;  3NEU A;  5A2Q Z;  3BRO A;  3KEO A;  3NQO A;  2DAO A;  1T2K A;  2HWV A;  3SXY A;  3BP8 A;  4LLN A;  2L4M A;  4L9T A;  5CVI A;  2PJP A;  4A12 A;  5CVR A;  3TDU C;  3WG9 A;  2E7X A;  3L7W A;  2L54 A;  1FPQ A;  1W4M A;  5BOX A;  2NNY A;  2RQP A;  4FHT A;  4PZJ A;  3JAM K;  4WWC A;  4RB3 C;  4KN4 X;  5HDN A;  4FX0 A;  5ILU A;  1R1V A;  1IN5 A;  3WTS C;  2CQK A;  1IUY A;  4BXU A;  1Z9C A;  2VBZ A;  4OMZ A;  1ZHF A;  3TDZ C;  1K78 A;  1R5G A;  5H6Q A;  1FYK A;  1J5Y A;  1KQ0 A;  3F6V A;  3U1D A;  1XSX A;  3GZ6 A;  3FM5 A;  5CJ9 A;  3BDD A;  2D2W A;  1QGP A;  2QM3 A;  2L02 A;  3D5L A;  2Y0M A;  2EV5 A;  4ZZD A;  5D5X B;  2L4A A;  3K1M A;  3V8L A;  2R3S A;  1SMT A;  1R00 A;  1D8J A;  2O6G E;  1HKT A;  3HTU A;  3KLN A;  3JTG A;  2HKO A;  3KE2 A;  3GF2 A;  2XAS A;  5ICE A;  4GYG A;  4HYE A;  3P9I A;  3I71 A;  5AIP A;  3GO5 A;  2M5W A;  3JTH A;  4EJV A;  3LA3 A;  4Y15 A;  3Q9V A;  1XGO A;  1YO5 C;  4YII A;  2OZ6 A;  2FE3 A;  1P6R A;  3E3V A;  3DEU A;  3M8E A;  2DQR A;  3QOP A;  4I0B A;  3CO7 C;  4LK0 F;  1BI2 A;  2K4J A;  2W25 A;  1YW7 A;  2BE5 F;  2VXZ A;  2P6S A;  3OV8 A;  1V3F A;  4YG2 F;  4HZF A;  2EK5 A;  2MLG A;  2QWW A;  2YX4 A;  5DCF A;  1XGN A;  2JPC A;  3P7N A;  1UHW A;  3QPH A;  5ILV A;  2EB7 A;  1YW8 A;  5DD4 A;  2VON A;  4IHS A;  3R6S A;  3MQ0 A;  4CO8 A;  1ZYR F;  4M73 A;  2EV0 A;  4B8X A;  2KIM A;  2XKP A;  2QQA A;  3B73 A;  4LFU A;  2FML A;  5DEQ A;  5D8L B;  2IJL A;  2CG4 A;  2GQQ A;  2IW5 A;  4KIF A;  1GVJ A;  1BC7 C;  1FBU A;  2VOO A;  3HYI A;  1YS6 A;  2A61 A;  4HBL A;  5HOO A;  3FXR A;  5E8G A;  3VB2 A;  3CUO A;  1ZH5 A;  5H6R A;  2PMU A;  4HLY A;  1KGS A;  3N97 A;  1FP1 D;  2FSW A;  2FRH A;  2ADU A;  4UXN A;  3F8M A;  1PP8 F;  1DPR A;  2L01 A;  3C7J A;  2F2E A;  4UV8 A;  3MZY A;  2FQ3 A;  1IZ1 A;  1SD6 A;  1D3Y A;  2FOK A;  5LGU A;  2H6C A;  1LB2 A;  3ZP5 A;  3FZV A;  2QBY A;  1KA8 A;  1JHF A;  3KP7 A;  3M8F A;  2K7L A;  4L9N A;  1TQI A;  4ZYG A;  4M74 A;  1IXC A;  3E6B A;  1YTY A;  3SFZ A;  4EVI A;  5HLH A;  3GFI A;  4ENK A;  1XDU A;  4M9S A;  3PFI A;  2HOE A;  1MD0 A;  3G73 A;  1K78 B;  3Q5F A;  2XRN A;  2DW4 A;  1S7A A;  2F5D A;  2EFQ A;  2L3D A;  2BEO A;  1AOY A;  2V79 A;  4EM1 A;  2DI3 A;  1Z1D A;  1OYW A;  1HW2 A;  3VOD A;  3J81 K;  2QQB A;  3MZH A;  4YFX F;  4HX4 A;  2GA1 A;  1ZRE A;  4HDV A;  3G3Z A;  4WXH A;  2WC2 A;  2JRT A;  2EFW A;  1Z7U A;  3H3Z A;  3EYI A;  2CW0 F;  3ROU A;  3ZMS A;  5L3G A;  2LDU A;  1L3L A;  1ZAR A;  2BV6 A;  3V4G A;  1EV7 A;  3ABT A;  1XN7 A;  1O3R A;  3T8R A;  2HTJ A;  1SFU A;  3W6J B;  3DKW A;  3KP2 A;  5HDG A;  2OZU A;  3U2R A;  2YX7 A;  2P7C B;  2HGC A;  5LHI A;  3WGH A;  2LKP A;  4A5M A;  3ZMU A;  4U0Y A;  1T0F A;  4L9V A;  3WU1 B;  4N0B A;  2HDC A;  1OYI A;  4Q47 A;  1BIA A;  3EYY A;  4HX7 A;  2ISY A;  1ON1 A;  5E18 F;  1MJA A;  4KUM A;  2KJC A;  1ZAO A;  5ICG A;  2V1D A;  1RUO A;  4E70 A;  1OYY A;  2HQR A;  5LRR A;  1TQM A;  1IAW A;  3R4K A;  2DLL A;  3RYR A;  1OPC A;  2MH9 A;  5DUI A;  3BOQ A;  3KP5 A;  5KK1 A;  2NS0 A;  2PG4 A;  2EA2 A;  2F5C A;  3GW2 A;  4KFC A;  1RIO H;  1Z91 A;  3TOB A;  1YS7 A;  1UCR A;  2UWM A;  2RGV A;  5CYV A;  1F1Z A;  1SFX A;  4M6Y A;  2O0Y A;  2RNJ A;  4G94 A;  2G7H A;  3BJO A;  3GLX A;  3WTY C;  2HTS A;  3WTT C;  4HA8 A;  1P2F A;  2IP2 A;  4CHU A;  1BI0 A;  1SMY F;  4RB2 C;  3LAJ A;  3V8J A;  4LK1 F;  2XGX A;  2QBY B;  4N9I A;  3MCZ A;  2D1V A;  4XRF A;  5D5U B;  4YIF A;  2FBH A;  1LEA A;  4K2E A;  1ZRC A;  2PBI A;  4RB0 A;  3TGN A;  1EH6 A;  2JZY A;  3HSF A;  2Q0O A;  1TW3 A;  2M30 A;  4BHP A;  5J8C A;  1G3W A;  2MC3 A;  2DK8 A;  6PAX A;  4FX4 A;  1XD7 A;  2LF7 A;  2XV4 S;  5ICF A;  2ZKZ A;  1U5T A;  1FZP B;  2HR3 A;  5EEH A;  5FFX A;  1XGM A;  4AIH A;  2IA0 A;  2WTE A;  2RN7 A;  2RKH A;  3RDI A;  1EH8 A;  1U6G A;  1PDN C;  1XSD A;  4A0X A;  3CO6 C;  4QLC U;  4WCG A;  3FMQ A;  4OMY A;  2EWN A;  3FX3 A;  2XVC A;  3HRT A;  3SHF A;  3ZPL A;  1ZLJ A;  4GCV A;  2V1X A;  2HYF A;  5H20 A;  5JVT A;  2X4H A;  3QP5 A;  4ESJ A;  3O2P E;  3P9C A;  1FBS A;  1YW9 A;  4IRI A;  3LQR A;  1STZ A;  4IPA A;  2ZO4 A;  4UHT A;  1YG2 A;  2X0L A;  3GFJ A;  1OKR A;  3F8B A;  2ZJ2 A;  1IRG A;  2OAZ A;  4KA4 A;  3HSR A;  4Q48 A;  4EMS A;  4XSZ F;  4G6Q A;  3DPT A;  1BM9 A;  4ZYH A;  1HBX G;  3HIF A;  2O03 A;  3DV8 A;  3M9A A;  4R79 A;  2H94 A;  2CYY A;  4HW0 A;  4I09 A;  1KU3 A;  2IRF G;  1BI3 A;  1U3E M;  2W85 A;  5CLS A;  1Q1H A;  1QO0 D;  5FLX K;  3KZY A;  4B09 A;  3CTA A;  2IVM A;  4AD9 A;  2MD5 A;  4L0Z B;  5LBQ A;  3ZMV A;  1MJ9 A;  2K4B A;  1WWX A;  2NYX A;  4NHJ A;  1U2W A;  1J9I A;  3V7R A;  1UFM A;  2ZME B;  3U9G A;  3ABU A;  3ELK A;  1LJ9 A;  3J81 Z;  3EQL F;  1MJB A;  5HLI A;  3BY6 A;  2PMH A;  3M1E A;  1U5T C;  1YIO A;  4HF1 A;  2VT3 A;  2OBP A;  3K1P A;  2NAZ A;  1H9T A;  4AIJ A;  1O3S A;  4UVC A;  4I0A A;  4IF4 A;  3TOA A;  1B9N A;  3FHZ A;  2Z9O A;  3FF5 A;  4ZH4 F;  2W24 A;  1BOA A;  3ISP A;  3E6D A;  5D4R A;  1CF7 A;  2FNP A;  3F72 A;  4RS8 A;  1QNT A;  3IWF A;  2YPR A;  3BPV A;  4O5V A;  1B4A A;  4YFN F;  4LMY A;  3NRV A;  1GXP A;  1KYW A;  1TNT A;  3GUD A;  2EJR A;  1U5T B;  2STT A;  1G3Y A;  3HRM A;  4ESF A;  3GFM A;  5AIQ A;  4HX8 A;  5ERI A;  1LVA A;  5FGM A;  3VEP A;  4KYW A;  2O61 A;  1GHC A;  2DQL A;  1XMK A;  4A0Y A;  1VTN C;  4HF2 A;  3I64 A;  2W57 A;  2UXN A;  2A3S A;  2RDP A;  1C0W A;  1LEB A;  3WE2 A;  2VOP A;  2G7U A;  4LJZ F;  1USS A;  3QPT A;  4LG0 A;  4L18 B;  3E6M A;  4GYI A;  1ZRD A;  2A6E F;  1XCV A;  3KP6 A;  3KEQ A;  1IN7 A;  1REP C;  4U0W A;  5K5Q A;  3HOS A;  3K2Z A;  3BZ6 A;  3C18 A;  4P96 A;  3F8F A;  3R0J A;  4XBF A;  3OOP A;  5TJJ A;  4RGU A;  2IPQ X;  3MFK A;  2FNA A;  4P9F A;  2ZNY A;  1O57 A;  3HTS B;  1OMI A;  4PGH A;  3D0S A;  3L9F A;  5FFZ A;  4CXF A;  5FB2 A;  4EM2 A;  3KP4 A;  3B02 A;  1QPM A;  2A6H F;  4LGW A;  5D6E A;  1OR7 A;  4UVA A;  2HKX A;  1XGS A;  4QWQ A;  3I58 A;  1BBY A;  4G8X A;  3DFG A;  3QU3 A;  1TNS A;  5L3B A;  1EH7 A;  1DUX C;  4PCQ A;  4U7B A;  5IT9 Z;  3TKY A;  1JE8 A;  2NNN A;  3I59 A;  4EGY A;  3GFL A;  1B6A A;  2WV0 A;  5HS7 A;  4M72 A;  3ECO A;  5JFR A;  1YLF A;  2QUF A;  3T8T A;  2ESN A;  2W84 A;  4LLG F;  5E1W A;  4AVP A;  1I1G A;  5E8I A;  5BS6 A;  2FF4 A;  2IA1 A;  2E1N A;  5JI6 A;  5CVU A;  2VC1 A;  2E1C A;  2K86 A;  4RGX A;  3T1B A;  5A2Q K;  3GWZ A;  5AON A;  2UXX A;  1MDM A;  1WRJ A;  2TDX A;  1ZLK A;  3HRS A;  2EFP A;  3V8K A;  3FMS A;  3TO9 A;  2EFN A;  2ESH A;  1HW1 A;  1QQI A;  4M9Z A;  1WSU A;  3GX4 X;  2MH2 A;  4UVB A;  3RJP A;  4CDG A;  2KKO A;  1CF7 B;  5F1R A;  1J7K A;  4D0P A;  4HV6 A;  3J80 K;  3E97 A;  4YFK F;  2LNB A;  4JBA A;  3RTR A;  2Y75 A;  2DPU A;  4G9Y A;  4XSX F;  1AWC A;  4MEY F;  3C3W A;  4GGG A;  1KU7 A;  3CJN A;  1DP7 P;  5DDG A;  3IKV A;  1JHH A;  2KIU A;  1HQC A;  2P5L C;  1U8R A;  4Y17 A;  3FXQ A;  3Q9S A;  4EQQ A;  1R1T A;  2F5F A;  2Z5U A;  3E5Q A;  2OQR A;  3AAF A;  4F7Z A;  2V6C A;  1S8N A;  3F6O A;  4M9X A;  3TQN A;  4LG0 B;  5D6F A;  1ZG3 A;  4ZYD A;  1XSV A;  4GXO A;  2PI0 A;  1PP7 U;  3RIR A;  4U7D A;  1QZZ A;  2QVO A;  2HZT A;  1B1B A;  2Y48 A;  1IXS B;  3JAM Z;  3O3K A;  2YR2 A;  2ZCW A;  3JW4 A;  5D8K B;  5LLQ A;  1G3T A;  2GZW A;  2IT0 A;  2QZ8 A;  1JXS A;  1BN5 A;  1F5T A;  2EA4 A;  3J7A O;  4KMF A;  4XLP F;  4LD5 A;  5DUK A;  1T38 A;  4IRG A;  3MWM A;  1R23 A;  2M87 A;  3ZMZ A;  2M1B A;  2A69 F;  2Z33 A;  4KIC A;  5L3D A;  3IRQ A;  2HFH A;  3ERE D;  5DD8 A;  1TTY A;  2J5O A;  1ZG5 A;  3SZT A;  4DNC A;  3HRU A;  2XAH A;  3HHH A;  2ZME A;  1ODD A;  1FSH A;  4N9H A;  2K27 A;  2PLY A;  1HW5 A;  1ZGA A;  1SD5 A;  4RAY A;  3HSE A;  2PN6 A;  5JHU A;  1SD4 A;  3K9T A;  3I59 B;  3MAJ A;  3H92 A;  1A04 A;  2D1H A;  3DPL C;  5E17 F;  2XAF A;  4MGR A;  3I4P A;  3QU6 A;  3SQN A;  1R36 A;  2G9W A;  3MEX A;  2Q8K A;  3T0Y A;  1S3J A;  2R7F A;  1J2X A;  1G6N A;  3WTZ A;  1DPU A;  2P8T A;  3KET A;  5LEJ A;  4Z2Y A;  3I54 A;  2O3F A;  4WF2 A;  2PEX A;  3GYH X;  5LHH A;  3ZMD A;  1MDM B;  4MEX F;  5EEG A;  1W5S A;  3HOT A;  3F22 A;  2EFO A;  5FO5 A;  1Z6R A;  1KQ8 A;  3IKT A;  2JT1 A;  4A2U A;  1K79 A;  2CFX A;  2DO7 A;  5E20 A;  2HYG D;  3I0T A;  1FSE A;  3LWF A;  2B0L A;  3BPX A;  3H3U A;  3IWZ A;  3PQJ A;  3FXU A;  2GXB A;  1V4R A;  3P9K A;  2VBY A;  2YSR A;  1ONV A;  1S29 A;  1RI7 A;  4NB5 A;  1FWZ A;  4MNU A;  1FLI A;  4BQA A;  5IT3 A;  1IN8 A;  3WOD F;  1I5Z A;  1IXR C;  2JTV A;  5LEK A;  1T39 A;  3E5X A;  5ICC A;  5E1Z B;  1CGP A;  3FM3 A;  3REO A;  4RGS A;  2CWE A;  1JGS A;  4M71 A;  2CSO A;  2NRA C;  1MZB A;  3QP6 A;  2WWY A;  4BAY A;  5DYM A;  3KCC A;  5BMZ A;  3I53 A;  3F21 A;  4MTE A;  4A6D A;  3CLO A;  4BNC A;  2MBF A;  4JQF A;  5J8F A;  3M7G A;  4OIO F;  2IA2 A;  4A5N A;  5DV5 A;  2P5V A;  3ZQ7 A;  4U88 A;  3GZ5 A;  2ACJ A;  4KT5 C;  1HKQ A;  2H6B A;  3LFK A;  4OIR F;  4KDP A;  1YQA A;  1FT9 A;  3FWE A;  1ZN2 A;  4CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...