3ELKA

Crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
104
Chain Sequence
TRERILHGLITLYILKELVKRPMHGYELQKSMFETTGQALPQGSIYILLKTMKERGFVISESSVNKGQQLTVYHITDAGKKFLDHSQALQLARKIIDDLLSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative transcriptional regulator TA0346 from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator TA0346
total genus 26
structure length 104
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3elkA00
2EV6A 3SFZA 2XAJA 3QU6A 3F8CA 3EETA 3I5UA 2G7UA 4FT8A 4N9IA 1Z05A 1HSJA 4D0PA 4HDVA 3WTWC 2J5OA 5E20A 5CVJA 1BOAA 1YW8A 2IPQX 4HX4A 4IHSA 3WU1B 5FD6A 2IRFG 1T38A 1IN5A 2DW4A 1SD4A 4KIFA 1KQ8A 4KDPA 2M30A 2DK8A 3BY6A 2A61A 3DFGA 2CG4A 5J8FA 3OV8A 4OIPF 3JSOA 4G94A 1HQCA 3HRSA 2P5VA 4MTDA 1BN5A 4AIKA 2F5CA 4RGXA 5DUKA 1FYLA 3I64A 2KIUA 4CGZA 1R1VA 1MKMA 2MH9A 2HTSA 4CXFA 2EFPA 1XSDA 4LG0A 2UZKA 3F6OA 4ZYGA 4IRIA 2V9VA 2VC0A 3V7RA 1P2FA 5JR3A 3NQOA 2HQNA 2FQ3A 4EV0A 2ISYA 1UFMA 2BE5F 2QYOA 1KQ0A 1LVAA 2ZBKA 1P6RA 2OD5A 1ZLJA 1OKRA 2Y0MA 4L0YB 3CUOA 2STTA 2XAFA 2ZFWA 5ICFA 3L2CA 4P96A 4KFCA 1D5VA 4Y13A 4IVNA 2ESHA 1HKSA 1R5HA 3REOA 3F23A 2JTVA 2H94A 2VODA 4EGZA 1ZH5A 3WODF 2FBHA 3KP3A 1YS7A 2IA1A 5A2QK 2QBYA 3GFMA 1IZ1A 3KETA 4JQFA 5HLGA 2DFIA 1E17A 1CF7B 4BH9A 3ABTA 3MZHA 1QQIA 4WWCA 3FXQA 3DEUA 2VN2A 3ISPA 5E8IA 4ENMA 3IHUA 5CVIA 5LLQA 4RB2C 1ZN2A 1USTA 2KIFA 3EQLF 5E1ZB 4WXCA 2O6GE 2YPRA 2IP2A 2XASA 2ELHA 4KN4X 1BM9A 3QRFF 2IA0A 1UB9A 3F72A 4YFNF 5DUIA 3LAPA 3N97A 4UVCA 3TQNA 1AWCA 1BI2A 2JSCA 1TNSA 2JPBA 3WTZA 4MEXF 3J80Z 1L3LA 1U5TA 2KJCA 2VBXA 2CWEA 3ELKA 3LA3A 4PGGA 2HOEA 3WTSC 3TDZC 4KYWA 3H3ZA 2DTRA 4L9VA 3QU3A 5HS8A 5J8CA 1A04A 3C18A 3K2ZA 2NS0A 3O2PE 1XCVA 1J59A 3I59B 2C6YA 1F4KA 4YFXF 4EM2A 3MQ0A 2Z3YA 3I58A 3EYYA 1T98A 5H20A 3BROA 1PP7U 3P9KA 3R4KA 4CDGA 3JW4A 4DNCA 4G6DA 1EH8A 3I4PA 3KE2A 3GW2A 3E6MA 3FM5A 2Y48A 4EJWA 2PEXA 1I1GA 1QPMA 2P8TA 1OMIA 3E6CC 2ZXJA 1SD6A 1OYYA 4BXUA 4ETSA 4GYIA 3B02A 3HOSA 3Q9SA 3GLXA 2YR2A 2VONA 1W7PA 2W84A 3VOEA 1J0RA 3M1EA 2D1HA 1U78A 2F2EA 3CUQA 2RGVA 3K9TA 3WTXC 3IRRA 1EH6A 3AAFA 5E18F 2NRAC 2DT5A 3TO6A 3IKVA 1TW3A 1STZA 3WE2A 1BIAA 5K5OA 3M7GA 5FLXZ 3P7NA 4I98B 4XLPF 4BHCA 3GUDA 4CHUA 2IW5A 1K7AA 1P92A 4R79A 1BC8C 1U5TB 4OIQF 1O3TA 1TQMA 3I71A 1Q1HA 4CO8A 1FY7A 2R7DA 3IKTA 1J7KA 2Q2EA 2FXAA 2OZUA 5LRRA 2A69F 2H6CA 2OBPA 2GWRA 3EUHA 5AIPA 3IWZA 2QWWA 5L3FA 5LGNA 2GAUA 1F5TA 1R1UA 4M6XA 1YG2A 3SZTA 4YIIA 4HAMA 4HW0A 1KU3A 3KP4A 1C0WA 3ULQB 1IW7F 1LEBA 1FP2A 1USSA 3GYHX 5AONA 3BJOA 4HOBA 3ZMZA 4CYDA 1HKQA 2CQKA 2RDPA 1LNWA 4A6EA 2DBBA 4A0XA 3CUQB 2FF4A 4QLCU 4PCQA 2ISZA 4L18B 3BZ6A 4L9NA 1U3EM 3P9IA 4UV8A 4KUMA 2K4JA 1OYIA 1MJAA 2IJLA 1K78A 2EK5A 1ON2A 3LFKA 1B6AA 4GXOA 1QGPA 1WQ2A 3TOBA 2K02A 2X4HA 2W24A 3DQVC 1RUNA 3WG9A 2VBYA 3H3UA 2XKOA 1B9NA 3L9FA 3HTUA 1D8JA 1RNLA 4QWQA 1KU2A 4KICA 3W6KB 4L9JA 4LG0B 5DV5A 2VE9A 3COAC 4A12A 4G6QA 2FEZA 1FBUA 5LGUA 4ESJA 1G3WA 5CVUA 2FMYA 2MD5A 2STWA 4LLNA 2QVOA 4G8XA 1OR7A 5L3GA 3HHHA 1W7PB 2DK5A 4S04A 4KMUX 3ZPLA 3HIFA 2F5FA 2ZNYA 1YS6A 3K1NA 1ZRDA 2XRNA 1Y0UA 5DD8A 4B8XA 3MEXA 4P5OA 4UVAA 3M8FA 1ULYA 1FBSA 1PP8F 5DCMA 4I7HA 4WF2A 2UXNA 4WCGA 1ZRFA 2W25A 3TKYA 3HSFA 3LA7A 1XGMA 4M74A 2WWYA 2V6CA 1V4RA 3NEUA 5FGMA 3PQJA 4YG2F 4LB6B 3L7WA 1E2XA 3E6BA 1H9TA 4OMZA 2PLYA 2EV5A 3I59A 1IN8A 1I27A 4ZYDA 2BV6A 1BI1A 1L0OC 3LA2A 1P4XA 3FMRA 4NQWA 4PGHA 1SFEA 1ZGJA 2CSOA 2KKOA 1UCRA 4O3MA 3GEZA 2QQBA 3ML6A 3TGNA 4ZYEA 1F9NA 1JHFA 5L3EA 1QO0D 4WK8F 5D6FA 4IJAA 3V8JA 2D1VA 1LB2A 1KGSA 2FMLA 2B0LA 2XIGA 3LQQA 4OU0A 1YFHA 4M71A 1UHMA 1G3TA 3RIRA 3WGIA 4MEYF 4DQ2A 3QPTA 3WTYC 1T6SA 2QENA 3R60A 2H6BA 5KK1A 1EH7A 2L4AA 4MNUA 3ZN1A 1Z91A 1KU7A 1JHHA 4E70A 3RTRA 3JAMZ 4A5MA 2P6TA 2TDXA 4Q47A 1RZ4A 2DQRA 5LHHA 3TO7A 1G3SA 3FWEA 1R1TA 1SFXA 4L0ZB 2D2WA 3E3VA 2L01A 3RKWA 1XGNA 4HA8A 4I09A 2KRFA 4A6DA 4U0WA 5CLSA 2ZO4A 5K1YA 4LK1F 3K1MA 2E7XA 5DEQA 1LDDA 5A2QZ 1HW2A 4LK0F 4Y15A 4HF2A 3DPTA 3FXRA 3ZMUA 2HYGD 2MLGA 3GWZA 4AD9A 2VT3A 1PUEE 2R3SA 3T0YA 4UVBA 1BI3A 1O3QA 5LGTA 1QZZA 5ED4A 2HEOA 2L02A 5J6XA 2P7VB 3RJPA 3E6DA 3BJAA 2KJBA 5D5UB 3GFJA 3I54A 3RDIA 1FYKA 4RAZA 1ZGAA 1P4AA 2Z33A 2EV0A 3F8MA 3R61A 2DU9A 3RPUA 2P7CB 3Q5FA 1LDKB 5HS7A 1B9MA 1XN7A 5HDKA 4LLLA 1YYVA 1Z7UA 1IN4A 4NB5A 3CTAA 5ILVA 4LMYA 5F64A 5DD4A 4WXDA 4BYYA 1FSEA 1IN6A 3CUQC 3ZMDA 3DXJF 4Z2YA 4NHJA 1X3UA 2P5LC 4MQ9F 1FSHA 3V7SA 5L3DA 4ZZLA 1FX7A 4K2EA 4I01A 5IT3A 4HF0A 2GXBA 4GGGA 2ZNZA 4ZH4F 4LB5A 4YIFA 1O3SA 5K5RA 3KZZA 2DPDA 1IAWA 1H9GA 2PMHA 4RAYA 1DPRA 1IRFA 1YQAA 2L4MA 5LEKA 2RKHA 2LF7A 1SFUA 2XGXA 4G9YA 3BDDA 2YSRA 3U9GA 3G3ZA 2HFHA 2CGPA 1KYZA 1ZARA 5D5WB 4JBAA 2YX7A 5LHGA 1Z6RA 2XKPA 1ZG5A 4KIBA 3E5QA 3ZMSA 4KN7X 3V8KA 4XRFA 5BPDA 2NNNA 4GO1A 3H92A 5ICCA 1U5TC 2HZTA 4IRGA 5D8LB 2ACJA 3KP5A 4I02A 5HDNA 1YLFA 5FD5A 5BOXA 4RB1A 2RN7A 1H0MA 3KLOA 1W7PD 5ICGA 2HKXA 2FRHA 3ERED 3WU0A 4LD5A 1R36A 4BQAA 1WRJA 4G7HF 1FBQA 1REPC 2OU2A 5JI6A 5D4SA 3D5LA 4L5IA 2OZ6A 3E5XA 1JGSA 2M87A 4OIOF 1TQPA 4UHTA 5LRSA 3RKYA 4A2UA 1ZLKA 3RYPA 2A5YB 4EQQA 1GHCA 3RI4A 2O61A 4HQEA 2VT2A 1IF1A 3BP8A 1R7JA 1ZG3A 3BPXA 3CO7C 3BWGA 1QBJA 1O7FA 1RIOH 4A0ZA 3FMSA 3HSEA 1FWZA 1Z6TA 1IXRC 3FM3A 2GXGA 1F1ZA 2F5EA 3LWFA 1ZRCA 2GQQA 3T8TA 3L00A 2XAGA 5HOOA 1K6OA 4ENKA 2K7LA 2G9WA 1R22A 2HR3A 3KLNA 2MC3A 3ECHA 3WE3A 2V1XA 2ZJ2A 4ENNA 2XAQA 3DP7A 3WTVC 2EJRA 2G7HA 2UXXA 3KP2A 4XSXF 4KA4A 5KVRA 2ESNA 2XVCA 5DCMB 3JTGA 4KMFA 3GX4X 2Y75A 3ROUA 4OINF 1K78B 1ZYRF 4AWXB 4B09A 2E7WA 3F21A 3EYIA 3MAJA 2RC4A 2WC2A 5HDGA 3U2RA 3EDPA 3SQNA 1SMTA 2EB7A 2E1NA 2FSWA 2LF8A 4KIGA 1GXQA 4KT5C 3KEOA 3VODA 1OPCA 3W6JB 3I53A 1B4AA 1MDMB 3F22A 5D5XB 2RNJA 3O6BB 1XCBA 3LAJA 4MQVA 1V3FA 2W57A 1S3JA 2KIMA 1I1SA 3NRVA 4EJVA 4MHGA 2QUFA 1J75A 2RVCA 1BIBA 3T1BA 3J80K 5ILUA 2WTEA 1MJ9A 1K79A 3TO9A 4O6JA 3GFLA 3F6VA 1U6GA 2WV0A 1MDMA 2K86A 1KA8A 5H6RA 3MWMA 5DCFA 2EFNA 2V1DA 4P55A 5BS6A 4KNYA 4G7OF 2OA4A 4IRHA 2K4BA 5HLHA 1QNTA 1VTNC 1U8RA 2HKOA 3QAHA 2QZ8A 3HOTA 5CYVA 2GIVA 3WGGA 3V8LA 1T2KA 3C3WA 4OIRF 2LKPA 4BHPA 1T39A 3FMQA 1DUXC 3BJ6A 4U7DA 1PDNC 2VC1A 2A6EF 1DDNA 1FLIA 1WWXA 4WX9A 5HLIA 4RB0A 1XSVA 4AIJA 4HYEA 5L3BA 5JHUA 2OQRA 1S7AA 3HRMA 3RYRA 2IT0A 5D8KB 2XUBA 3BOQA 4EMSA 4IHTA 2HGCA 2P4WA 2PJPA 3HRTA 1JE8A 3GFIA 3TDUC 2GA2A 1HKTA 4EVIA 1HXDA 4FHTA 3HUGA 1S6LA 4HZFA 3IC7A 4HX7A 1RI7A 1WSUA 2UWMA 3QPHA 3IL2A 4H0EA 1R58A 2EFOA 1FZPB 1ODDA 3WTTC 1WKMA 2V1UA 2NAZA 2OQGA 3KZYA 1LDJA 5JFRA 3DKWA 3QP6A 4HLXA 4RGRA 4I2OA 3QP5A 5E1WA 2QLZA 3F3XA 2H09A 1WI9A 4I0BA 1O57A 4ASNA 1IXCA 3OOPA 5ICEA 1FYMA 4O5VA 2EWNA 2M1BA 1QZYA 3ZN0A 1LJ9A 3FX3A 4Q4ZF 4MGRA 2FU4A 4YFKF 2HQRA 4Q5SF 3F8BA 1HW5A 2K27A 4FX0A 4RGSA 1U2WA 2PMUA 5FO5A 3LSTA 4Y17A 4XBFA 5FFZA 2VBZA 4TV7A 1GVJA 1S29A 3HRUA 4WXHA 3GXOA 2Z99A 1Z9CA 3CO6C 1SD5A 2AS5F 3CLOA 3Q9VA 3K0LA 4P9FA 1I5ZA 1TNTA 2ZMEA 4AIHA 3ZQ7A 3I0TA 2AXLA 1KU9A 1XDUA 1DP7P 3D0SA 2GZWA 2PN6A 5H6QA 1ON1A 4EGYA 4IF4A 2P6SA 4L9TA 2CYYA 1YW9A 3GZ5A 4PZJA 1GXPA 2W85A 1B1BA 5BQTA 3B73A 3GO5A 2M45A 1D8KA 2BBYA 2L54A 2M5WA 2VXZA 4N0BA 2Q0OA 2ZKZA 2IA2A 3RKXA 1R00A 1TLHB 2QQ9A 3S2WA 2VOOA 2EFQA 5F1RA 3K1PA 3G73A 3KP6A 3HTSB 3R6SA 1XGOA 2EA4A 2HYFA 4MTEA 2DLLA 4JK1X 4U7BA 1MGTA 3J7AO 2A3SA 4OMYA 4PDKA 4HBLA 1ZAOA 4BNCA 1TTYA 4P9UA 2PI0A 4M9ZA 3VB2A 1IN7A 3U1DA 3TOAA 2H27A 4LFUA 4M9SA 5CVRA 2FNAA 4GCVA 1YO5C 4IPAA 2ETHA 3FHZA 5HS9A 2PFBA 2JT1A 2FBKA 3KCCA 3JSPA 1S8NA 3C7JA 3T8RA 3LQRA 4HX8A 1XB4A 1G6NA 4LJZF 6PAXA 3MFKA 5FB2A 1CF7A 2BGCA 5LHIA 2Z9OA 1YTYA 1W5SA 3M8EA 3JTHA 3E97A 3R0AA 2MH2A 2BYVE 2HDCA 2JZYA 3J81K 1YW7A 3DV8A 4L5JA 4A5NA 5HVQC 1S7OA 2A07F 2ADUA 5BMZA 4LGWA 1SD7A 3HHGA 5E17F 1R23A 2PQ8A 4CZZA 1TW2A 2XV4S 5K5QA 3JAMK 1IRGA 5JVTA 4LLGF 5E1XA 3E5UA 5F6FA 4N9HA 3P9CA 1P4WA 5LEJA 1BI0A 3FZVA 1BBYA 1J5YA 2FBIA 3R0JA 3ABUA 2QQAA 5CVVA 4XSZF 1SAXA 2LDUA 4RGUA 2RV8A 1FC3A 3ZP5A 2Q8KA 1W4MA 2PBIA 1FPQA 2O03A 2ZCWA 3CDHA 4FX4A 5DYMA 1MJBA 5BPIA 1DPUA 4M73A 1ONVA 5LBQA 2ZMEB 2A68F 1BJAA 2FNPA 5TRDA 3VFZA 2O3FA 2XHKA 2VOPA 2CO5A 2DQLA 2MLKA 4EJTA 1G4DA 4IXAA 4BAYA 1KQ9A 3N4MA 3F8NA 3FF5A 1HW1A 2O0YA 2XROA 2FA5A 4ESFA 3F8FA 3M9AA 3IRQA 3MZYA 2RQPA 1YIOA 3RPQA 5DDGA 1KYWA 1D3YA 2J5PA 4AVPA 1HSTA 1TQIA 4ENJA 4ON0A 4S05A 1T0FA 3PQKA 2DAOA 4HLYA 2O8XA 3VEPA 4U88A 4A0YA 5D6EA 2X0LA 5ILSA 5E8GA 3GF2A 3DPLC 1B59A 3MCZA 1OYWA 2XAHA 3ZMVA 2JPCA 2IVMA 1O3RA 5CJ9A 1XD7A 2FE3A 1J2XA 1HBXG 4ESBA 1AOYA 4ZZDA 1O7LA 4U0VA 4HV6A 4I0AA 1XGSA 2F5DA 4UNOA 1G3YA 4RS8A 1XSXA 5FLXK 1J9IA 2VE8A 4UUVA 2P5KA 2L3DA 3T5XA 3ZMTA 3IWFA 4Q48A 3C1DA 1FOKA 2CW0F 3BPVA 4R8HA 2DPUA 1CGPA 2MA3A 1FNNA 4UXNA 3SXYA 1R5GA 1XDSA 5FFXA 1I6XA 1Z1DA 5IT9Z 2EA2A 3SZPA 3HYIA 1ZHFA 2COMA 1UHWA 1SMYF 1TBXA 4HQMA 3O3KA 2QM3A 3QOPA 2FOKA 4R1HA 4M6YA 5D5VB 1RUOA 4F7ZA 2NYXA 5D4RA 4U0YA 4EJUA 1W5TA 1MD0A 2JRTA 2QBYB 2PG4A 3V7CA 3V4GA 3ECOA 3GZ6A 2GA1A 2DI3A 4EM1A 4GYGA 2D45A 2R7FA 1LEAA 5ERIA 3DF8A 3HSRA 4HDUA 1IXSB 2EFWA 2E1CA 4HV5A 1MZBA 2HS5A 4XLNF 3KEQA 4BHBA 2CFXA 4HF1A 1FT9A 2LNBA 2YU3A 3GVAA 1XMAA 2NNYA 2M8EA 3J81Z 2VBWA 2Z5UA 1LQ1A 3WTUC 3KFWX 4CICA 1IUYA 5EEHA 3PFIA 4M72A 3CJNA 2A6HF 4RB3C 4ZYHA 1EV7A 3L09A 1FP1D 1ZREA 5TJJA 3WGHA 2YX4A 1NHAA 5IT9K 3K69A 4M9XA 3FXUA 4OOIA 4UV9A 5L3CA 2HTJA 1BC7C 5AIQA 2V79A 4EM0B 2HWVA 4G7ZF 1JXSA 2LSOA 2OAZA 2DO7A 1XMKA 5EEGA 2BEOA 2MBFA 3SHFA 4EJOA 3KP7A 1ZG1A
chains in the Genus database with same CATH superfamily
3I4MJ 4BACA 4NQWB 3ZQIA 2ECCA 2EV6A 3OYDA 1D0ZA 3SFZA 2EIKH 2XAJA 3QU6A 4GRIA 4ZYAA 4XRSG 1AHDP 1TC3C 3F8CA 3EETA 4X1EA 5M5YJ 3I5UA 2G7UA 5KHDA 4FT8A 5J1RA 3NARA 4N9IA 1Z05A 4RBOA 1JKQC 5DM7F 4LOCA 2GM4A 2LREA 2OUMA 1X2MA 1HSJA 4D0PA 1MH4A 3H0DA 3B6AA 2E60A 4HDVA 5J40A 2VQLA 2EZKA 1ZELA 3WTWC 4DZPA 2J5OA 5E20A 5CVJA 1ACIA 3NAUA 1BOAA 2ZSHB 1LUJB 1YW8A 3H9QA 3FDYA 4XKCA 2IPQX 3H5RA 4HX4A 4IHSA 3WU1B 5FD6A 1FJLA 1BW5A 3AG2H 2IRFG 5GP9A 1T38A 4FETA 3D1NI 1IN5A 2DW4A 1W0UA 2XB0X 3IAM2 1ERDA 2EILH 2M7BA 5IYBJ 1SD4A 3GBGA 3IAS2 2HVRA 2WBMA 4KIFA 1KQ8A 3BG6A 3TP3A 4KDPA 4NC7A 2M30A 2NVXJ 1JT6A 2CUJA 2DK8A 3BY6A 2L9RA 2A61A 3DFGA 2CG4A 3HG9A 3CJTB 5J8FA 1MNMC 3BR5A 3OV8A 2CH0A 4OIPF 5FLMJ 3JSOA 2CMPA 5J4VA 4II3A 4G94A 2VUMJ 1HQCA 3VSKA 3HBLA 3HRSA 2P5VA 4MTDA 4PSXA 4IHYA 1BN5A 4AIKA 2F5CA 2ZJRF 2DMUA 3DTIA 4C3IJ 4RGXA 5DUKA 1FYLA 5E79C 1YIJI 2AQEA 4HNTA 4MFDA 2NOGA 3I64A 3C2HA 5EYRA 3JRFA 2KIUA 1HLVA 2XAUA 4RAFA 4CGZA 1R1VA 1V54H 1MKMA 2MH9A 3ZQQA 3ZQGA 2HTSA 5GTHC 1OCPA 4PJJA 4M6VA 4CXFA 2EFPA 1XSDA 4LG0A 2UZKA 1OFCX 2OPTA 3F6OA 4ZYGA 4IRIA 1HCRA 2V9VA 4BQNA 2VC0A 3F0CA 4E4HA 3V7RA 1P2FA 1SFOJ 4S0HB 2B9SA 5JR3A 4XRSA 3NQOA 2HQNA 2FQ3A 4EV0A 2ISYA 1UFMA 2NVYJ 1PUFA 1PVEA 2BE5F 2QYOA 3LFUA 1KQ0A 1Q1VA 1LVAA 2KRHA 2ZBKA 1P6RA 4IOCF 1FMVA 3S3NA 1X3ZB 4F93B 2OD5A 1ZLJA 1OKRA 2Y0MA 1JUSA 3S1MJ 3CCQI 1IRZA 3L2RA 2MW8A 4L0YB 2DJIA 3CUOA 2STTA 2YU9J 2XAFA 1AA7A 2ZFWA 1PJRA 2OJED 5ICFA 2IAIA 3L2CA 4P96A 4KFCA 3CCVI 1GV2A 1D5VA 3DTEA 3FBIB 2BY2A 1R4NB 4Y13A 4IVNA 2ESHA 1JKOC 1HKSA 1R5HA 3PJRA 3K4MA 1Y1VJ 5F0HA 3REOA 2AQFA 3K4BA 3F23A 2JTVA 2H94A 2VODA 3IV5A 1GUUA 5TISC 4AU7A 4EGZA 1ZH5A 3WODF 2FBHA 1LKXA 3KP3A 1YS7A 2IA1A 5A2QK 2QBYA 3J7ZI 3CCSI 1NK2P 2W7NA 2DA5A 3GFMA 1IZ1A 5FKMA 3KETA 2W1OA 3BLYA 4JQFA 2X1CA 5HLGA 2X6XA 4C2TA 2Z2SB 2DFIA 2VKEA 1E17A 2PJRB 1CF7B 4BH9A 3ABTA 4C9YA 4FCYA 3MZHA 2XB5A 2DMNA 1QQIA 3KYLA 4WWCA 4FE7A 5IOYA 3FXQA 3MD2A 3DEUA 4XIDA 2VN2A 4A93J 3ISPA 5E8IA 5M3MJ 4ENMA 1SFKA 3BT9A 5C4XJ 2QA4I 4B43A 3IHUA 3PM1A 5CVIA 4RLFA 5LLQA 4RB2C 3LL7A 1ZN2A 1USTA 2KIFA 3EQLF 3K6GA 5E1ZB 4WXCA 4F52A 4HSRA 2YPRA 2O6GE 2IP2A 2XASA 2ELHA 4KN4X 2P81A 1MW7A 1BM9A 3GZNB 5K7FA 4PJNA 3QRFF 2IA0A 1UB9A 3BR6A 4AIDA 4YEJA 5FJ8J 5F04A 3F72A 1Y8QB 4YFNF 2HYJA 2JMWA 4CYCA 4UB6C 1Y1WJ 5DUIA 3LAPA 3N97A 4UVCA 3O8GA 3HGGA 1YX5A 3PNYA 3TQNA 3OYBA 1AWCA 1BI2A 2JSCA 1PUFB 4N4OB 5IYDJ 1TNSA 3AG3H 4NBQA 2JPBA 3UKGA 3PFYA 3WTZA 5C44J 2IS4A 4MEXF 3ZCOA 2ID3A 3AKZA 3J80Z 1L3LA 1U5TA 2KJCA 5B5EC 2IGNA 2VBXA 2O5RA 2CWEA 3OOUA 1RR8C 3HXLA 3GTOJ 3ELKA 3LA3A 3K7AJ 5FLVA 4PGGA 3KYCB 2HOEA 3EUHC 3WTSC 4UB8C 4N4NB 1V5EA 3TDZC 4KYWA 3H3ZA 1X3WB 2DTRA 4HSTA 4L9VA 3IP4B 3QU3A 4E7JA 5HS8A 5J8CA 4X0GA 4IOAF 1A04A 4ANJA 3C18A 3K2ZA 2NS0A 3O2PE 1XCVA 1J59A 3I59B 2C6YA 1F4KA 4YFXF 3HKZN 4EM2A 1ZGWA 2E5NA 3ZQFA 3MQ0A 2Z3YA 1TP4A 3I58A 3EYYA 1T98A 5H20A 3BROA 3KPHA 3OS1A 1PP7U 3P9KA 3R4KA 3JW4A 2EBIA 2QGUA 4G6DA 4CDGA 1S9HA 2VI6A 1EH8A 3I4PA 3KE2A 4DNCA 3GW2A 3L2QA 2E2IJ 3E6MA 2V7FA 3FM5A 2Y48A 4EJWA 1MIJA 2PEXA 1I1GA 1QPMA 3DLLF 2MD0A 2DXIA 5F08A 5FKKA 2ZJQF 1R9TJ 1UZCA 2P8TA 2LG4A 1OMIA 3S32A 4MFEA 4ITVA 3E6CC 3CF2A 3H35A 5DM6F 2ZXJA 3PSFA 5HLTA 1SD6A 1OYYA 4BXUA 3GMEA 4ETSA 2VASA 3OL3A 4GYIA 3B02A 3HOSA 2JA2A 1RRJA 3Q9SA 3GLXA 4UUTA 2YR2A 2VONA 4C2UA 1GDTA 3PO3J 3QYBA 3S2HJ 1W7PA 2W84A 3VOEA 3OYHA 1J0RA 2OCEA 3VWBA 3M1EA 2D1HA 1U78A 2F2EA 2MABA 3CUQA 2RGVA 1FMWA 3K9TA 4LG3A 5C4JJ 3CCMI 3WTXC 1DGRM 5GADJ 3IRRA 2LKXA 1EH6A 3AAFA 5E18F 4G12A 4OWRB 2NRAC 1FTTA 1TWCJ 1DQUA 1VQ8I 3DBRB 1Y39A 2DT5A 2E1OA 2X9DA 4NDLA 1TL8A 3AG1H 3TO6A 3IKVA 3K10A 2CJJA 4RM2A 1YI2I 5FRNA 1YHQI 1FOWA 1TW3A 2JWTA 1STZA 3WE2A 3HOWJ 1BIAA 5K5OA 1IG7A 3M7GA 3N05A 5FLXZ 3DBLB 1RKTA 2CQXA 3P7NA 3QYFA 4I98B 3GTMJ 2K3FA 3TP0A 4XLPF 1MH3A 4BHCA 3GUDA 4CHUA 2IW5A 4F3QA 1K7AA 4BEHA 2X6WA 1P92A 3S1NJ 2QCOA 4PJ0C 3WHBA 4R79A 2OC6A 1IC8A 1BR4A 1BC8C 1U5TB 3OSGA 5EF6A 2HVSA 1VF9A 2JJ7A 4D5FA 2VXDA 4OIQF 1O3TA 1OLTA 4CCJA 1TQMA 4FQGA 3I71A 5EZHA 1Q1HA 2Q2EB 4CO8A 1XX5A 1FY7A 1Y6IA 3QPSA 4YELA 3CCLI 2R7DA 2WAEA 4BDZA 3G1MA 2QF7A 3IKTA 1BR1A 1YE9A 2DODA 3VPRA 5EZGA 4DGWB 4XN0A 4A3DJ 1VQMI 1J7KA 3DKYA 2Q2EA 2FXAA 3OYMA 1M1EB 2OZUA 5LRRA 2A69F 2FJ1A 3CCJI 1O4XA 2H6CA 2H8WA 1DGWY 2OBPA 3ASNH 1GLNA 3W2WA 4XMYA 5EJCA 2GWRA 4M3DA 3EUHA 5AIPA 3RQIA 3HOUJ 2GXAA 3AFHA 2JRMA 2VPRA 2QWWA 2HZDA 3IWZA 4PFOA 5L3FA 5LGNA 3OIQA 2GAUA 1NTCA 1F5TA 1UELB 2JQ7A 1R1UA 4M6XA 2HXIA 1YG2A 3SZTA 2WB1N 3FK6A 1R5ID 2ID6A 4HAMA 4YIIA 3LSMA 4HW0A 2XSDC 1KU3A 2JA5J 3M3YJ 3IUOA 3KP4A 2CRGA 1ETQA 2E36A 4NC6A 3OYFA 1C0WA 3OYLA 3ULQB 1OCCH 2EINH 1IW7F 5F1JA 2B7EA 3S15J 4F92B 1LEBA 5E3LA 4A3FJ 2NVQJ 4MO7A 2KISA 3M07A 4XOPA 1FP2A 1USSA 3RZOJ 5GAHJ 5B1AH 3GYHX 4NNJA 1N75A 5AONA 2HOAA 4BXXJ 2ELJA 3BJOA 2DFFA 3CCYA 3DBHB 4HOBA 3ZMZA 4A3LJ 2FD5A 4CYDA 4BKXA 3OYNA 2DYSH 1BA5A 1K61A 1HKQA 2CQKA 2HU9A 2KLOA 2RDPA 1IUFA 1SVOA 5IP7J 4A3JJ 2Y9YA 1LNWA 4A6EA 3H36A 2JA8J 2Q1ZB 2DBBA 4UUSA 4A0XA 2MYSA 2FF4A 3CUQB 5TGTA 1T56A 1W5CC 4QLCU 4PCQA 2ISZA 4L18B 2CV2A 3BZ6A 1YITI 4L9NA 1GT0C 4PJMA 3BG5A 1IDYA 1U3EM 2RREA 4D7NA 3P9IA 1OISA 4B44A 4UV8A 4KUMA 2K4JA 4XLHA 1OYIA 1MJAA 2IJLA 1K78A 2EK5A 3ASOH 1ON2A 3TW6A 5M3FJ 5J1YA 3LFKA 1B6AA 4GXOA 2WADA 2DA4A 1QGPA 1WQ2A 3TOBA 2K02A 2X4HA 3BZCA 4LIUA 2W24A 3A0BC 2F48A 2E5ZA 4JP0A 4BJ5C 3JR9A 4BE2A 3I55I 2B63J 2Z1DA 1SEUA 3DQVC 2PX9A 5E3MA 2NVTJ 1N77A 3S16J 1W36D 1RUNA 3WG9A 2VBYA 3H3UA 2XKOA 1B9NA 3L9FA 3HTUA 1D8JA 1RNLA 4QTRA 4QWQA 4KISA 3X2QH 3VYRB 1KU2A 4KICA 3W6KB 4L9JA 4LG0B 5DV5A 4A3EJ 2VE9A 3COAC 4A12A 4G6QA 2FEZA 3JCUC 4KJZA 1FBUA 3LSKA 3H0GJ 5LGUA 3FISA 1G3WA 4ESJA 5CVUA 2FMYA 1LFPA 4IZZA 3S3OA 3QPLA 4A69C 2DMTA 2MD5A 3HOZJ 1QPIA 4JYKA 1ITYA 2STWA 4LLNA 2QVOA 4G8XA 1OR7A 5L3GA 3HHHA 1W7PB 2DK5A 4S04A 3PNTA 4KMUX 5EGOA 3ZPLA 3HIFA 5M5WJ 3U21A 3L2UA 3Q0UA 2F5FA 2ZNYA 1TWAJ 1YS6A 3GCMA 4XORA 2F4IA 3K1NA 1ZRDA 2XRNA 1Y0UA 3BG7A 5DD8A 4B8XA 3MEXA 1LFUP 4P5OA 4UVAA 2CUEA 3M8FA 1ULYA 1FBSA 1PP8F 2X48A 5DCMA 1A5JA 4I7HA 2Y30A 5CKTA 2CQQA 1WPKA 4B47A 1KONA 4WF2A 2UXNA 4WCGA 1ZRFA 2W25A 3TKYA 3HSFA 2XPUA 3LA7A 4QPQA 1A31A 1XGMA 4M74A 2WWYA 4BGDA 2LKSA 2V6CA 3CMAI 2DA1A 3KIOA 2OV7A 1V4RA 3NEUA 5FGMA 3JRHA 3PUFA 2M0MA 1T0FC 3HL2A 3PQJA 2KIQA 4YG2F 3CC2I 4LB6B 3L7WA 2HVQA 1E2XA 3ABKH 4IEJA 3E6BA 4C2MJ 1AKHA 1RESA 1H9TA 4OMZA 2PLYA 2EV5A 3I59A 3LMMA 1IN8A 1I27A 3MKLA 4ZYDA 2BV6A 1BI1A 3JRDA 1L0OC 3EUAA 3LA2A 1P4XA 3FMRA 1ZKGA 4NQWA 4PGHA 3OYAA 1SFEA 1ZGJA 2PJRA 2CSOA 2KKOA 1UCRA 4O3MA 1A36A 3GEZA 2QQBA 3ML6A 3BQYA 3TGNA 4ZYEA 1F9NA 2F5VA 1EKEA 3OIPA 2LR8A 4D9JA 1JHFA 2LBFB 3FXKA 2N8GA 5L3EA 1E0EA 1LPQA 1QO0D 2MGQA 4WK8F 1DU0A 1RC9A 3U1KA 2MFZA 5D6FA 4IJAA 2WA0A 4RA2A 3V8JA 2D1VA 4DJAA 1LB2A 4GFBA 1KGSA 4CYCB 4XKWA 2FMLA 3JRGA 2B0LA 2X1DA 2L9NA 2BVLA 3A02A 4DYCA 2HXOA 2XIGA 2ZXIA 3LQQA 2LY9A 4OU0A 3GTKJ 2XGEA 4CA0A 3H5AA 1I6HJ 1YFHA 4M71A 1UHMA 1MNDA 4J01A 2VJIA 1G3TA 3QODA 4JX4A 3RIRA 4DBRA 2W48A 3WGIA 4MEYF 1P7IA 4CH7A 3QPTA 4DQ2A 3WTYC 2VKHA 1T6SA 2QENA 2CUZA 3R60A 2H6BA 5KK1A 5CQGA 2LY2A 4BDYA 1EH7A 2R5ZA 3EPZA 4AM3A 4HPQA 2L4AA 4MNUA 3QWLA 3ZN1A 3OMYA 2VJ5A 2D5VA 1Z91A 1KU7A 1JHHA 1XS9A 2KDOA 4BE0A 4E70A 3RTRA 3JAMZ 5IPAA 2HOTA 1XG1A 3KYDB 4A5MA 2P6TA 2TDXA 4Q47A 2JA7J 4AYBA 1I39A 1T33A 1RZ4A 2V9KA 2DQRA 1K83J 1QVUA 2RQQA 2HDWA 5LHHA 3TO7A 1G3SA 3FWEA 1R1TA 1SFXA 3SFIA 1BR2A 4L0ZB 1W1WE 2D2WA 3E3VA 4M3FA 2L01A 3RKWA 1XGNA 4HA8A 2L7ZA 4I09A 1NH3A 5FKOA 2KRFA 4A6DA 4U0WA 2BHZA 2KMUA 5K7ZA 3CDLA 5CLSA 2ZC2A 4BS9A 2ZO4A 5K1YA 4LK1F 1X1PA 3K1MA 2E7XA 2R92J 3PNVA 5DEQA 2L9VA 2DCEA 1LDDA 4Y15A 4LK0F 5A2QZ 1HW2A 4HF2A 4HNUA 3DPTA 3FXRA 3SEZA 3CZ6A 2UV1A 3ZMUA 2HYGD 1YJNI 1J09A 2MLGA 2GLOA 1VZ0A 3GWZA 4AD9A 4EATA 2XPWA 4ABZA 2VT3A 1PUEE 3HZJA 1VQ5I 2R3SA 5JHFA 1LFBA 3T0YA 4UVBA 1BI3A 1MMNA 5C3EJ 1QVTA 1O3QA 5LGTA 1VQLI 1QZZA 3FBNB 5ED4A 4DIQA 2HEOA 1XMXA 4LIVA 2L02A 1I3AA 2F4OB 3OL4A 1D5YA 5J4YA 1H8AC 5J6XA 2BW3A 1YX3A 2DT6A 5B66C 2P7VB 3HOVJ 1ETYA 2OTLI 3RJPA 2BOLA 3E6DA 1U0JA 3BJAA 2KJBA 3S93A 3BR2A 2ME6A 1JKPC 4ZC3A 2VIXA 5D5UB 3GFJA 2LYCA 4FASD 2XPVA 5HNHA 4XICA 2K9SA 3SDBA 3HM5A 3I54A 3RDIA 1OCRH 2LD5A 1FYKA 2BZTA 4RAZA 1MBJA 3FK7A 1ZGAA 1P4AA 2Z33A 1U9NA 4Y4RA 4M3EA 2EV0A 1R71A 2DOEA 3MZ8A 3F8MA 3JRIA 2R7VA 3HKZA 2X6YA 3R61A 4KT6A 4F91B 3G71I 5B3SH 4E7HA 2KQRA 2QQ8A 2H1KA 2DU9A 2BHYA 2JSPA 4XLFA 2E34A 3RPUA 5GTIC 2P7CB 2BVMA 2R4GA 1MSFC 2IGMA 1N78A 3SYTA 3Q5FA 1LDKB 2E19A 5HS7A 3FKIJ 3W6VA 4BE1A 1B9MA 3DPUA 3QOEA 1XN7A 5HDKA 4LLLA 3QQAA 3I4NJ 4BXFA 1TZLA 1YYVA 1IN4A 1Z7UA 3JRCA 2R7RA 4NB5A 2XF6A 3CTAA 2Y0SA 4LMYA 5ILVA 1MMDA 5F64A 2TRTA 5DD4A 4WXDA 4BYYA 1FSEA 3VYTB 1IN6A 3BTIA 2DT7B 2Y2ZA 3CUQC 2I8DA 5LFAA 3ZMDA 2HOSA 3DXJF 2MC4A 4Z2YA 4NHJA 3JRAA 3CC4I 1VQ7I 3H3VK 3IH4A 1X3UA 2O7OA 1NG6A 2P5LC 4MQ9F 2IBDA 3D5RC 1FSHA 2DA7A 1OQYA 3V7SA 5DS9A 5L3DA 1Z67A 3PUBA 2KRCA 3TL4X 1V55H 4ZZLA 2R5YB 1FX7A 2XGDA 4K2EA 4XRMA 4I01A 4CZCA 5IT3A 4HF0A 2GXBA 4E7IA 4GGGA 2ZNZA 4ZH4F 4XOTA 3MVPA 4LB5A 4YIFA 1WJBA 2JVGA 1O3SA 3VYUB 4XLCA 3WG7H 1WJFA 4RDUA 5K5RA 3KZZA 2DPDA 1IAWA 3K70D 1H9GA 1D1BA 2NS7A 2A05A 2PMHA 5FROA 3ABMH 4RAYA 1DPRA 3OS2A 3G1LA 1IRFA 2M2EA 1S72I 1T8IA 2Y31A 1YQAA 2L4MA 5LEKA 2RKHA 4BUPA 2LF7A 2K9MA 2XGXA 4G9YA 1SFUA 3BDDA 4D1QA 2YSRA 2R7UA 2E2HJ 1MNEA 1Y8RB 3U9GA 1YJ9I 3G3ZA 2HFHA 2QSGX 2CGPA 1KYZA 3S1RJ 1HDDC 5LD2C 1ZARA 5D5WB 4JBAA 2YX7A 1E3OC 1QHHD 5LHGA 1Z6RA 1G2HA 3OR2C 3ZQLA 4B48A 3HDDA 2XKPA 1ZG5A 4C3JJ 4KIBA 3E5QA 3ZMSA 3PSIA 1VQ4I 2LRDA 1H89C 4KN7X 1Z3XA 1JUMA 3V8KA 3G4SI 4QIWN 1FIPA 2K9QA 4XRFA 4D5CA 5BPDA 2NNNA 4GO1A 3H92A 3M1CA 2NS8A 1Z0XA 5ICCA 1VQOI 1U5TC 3TMOA 5GAGJ 2R5YA 1IGNA 2HZTA 4IRGA 5D8LB 2ACJA 3KP5A 9ANTA 4IL6C 3MKZA 4J19A 4I02A 1VFCA 3CJQB 4BBRJ 5HDNA 2H1LA 3LSRA 1YLFA 5FD5A 5BOXA 4RB1A 3S17J 1WHUA 2RN7A 3D5SC 3KLOA 1H0MA 3CJRB 4L5EA 1W7PD 4DW6A 1RETA 3HB9A 4DOZA 5ICGA 3DU6A 2NVUB 2DDBA 2M9HA 2HKXA 2FOWA 1XTAA 1U8BA 1ETVA 2FRHA 2V9PA 3ERED 4IHXA 3WU0A 4LD5A 2WV1A 1R36A 4BQAA 1WRJA 4G7HF 1FBQA 2XRLA 1REPC 5EG0B 1QZEA 4RMNA 3Q0VA 3GTQJ 2OU2A 5JI6A 1HDPA 5D4SA 3D5LA 4L5IA 2VPLA 3BR1A 1LVKA 2OZ6A 3E5XA 2KL4A 1T08B 4M3BA 1JGSA 2K40A 2M87A 4CCOA 4IHWA 2ZJPF 2L7MP 4OIOF 4CCLA 1TQPA 4UHTA 3A01A 5LRSA 3RKYA 4A2UA 1ZLKA 2JA6J 5CPRB 3OIOA 2A5WA 3RYPA 4AC0A 2A5YB 4EQQA 2GOMA 3CP8A 4BY1J 1GHCA 3K4NA 2XSJC 3RI4A 2O61A 4HQEA 2VT2A 3CCUI 4IQ4A 1WVRA 2RAEA 1MBFA 2GBYA 3BP8A 1IF1A 1R7JA 2FQ4A 1V5GA 1ZG3A 1X1DA 1XC5A 3BPXA 3CO7C 1W0TA 3BWGA 1QBJA 1O7FA 1RIOH 1X4OA 1FIAA 2M3AA 2E1MC 4A0ZA 5EGOB 3FMSA 3W2AA 3HSEA 2M8GX 2MG4A 1CQTA 1FWZA 1FOYA 1Z6TA 1IXRC 2TCTA 2FUG2 3C2BA 2ZFUA 3FM3A 2GXGA 1F1ZA 4A3MJ 2F5EA 4BU2A 2DN0A 3BG9A 3LWFA 1ZRCA 2GQQA 3J7AY 3T8TA 3E0JB 3L00A 3FXJA 3GTLJ 4DYRA 2XAGA 2R7TA 5HOOA 1K6OA 4ENKA 2E71A 4YIRX 1BL0A 1T95A 2K7LA 3HOXJ 2G9WA 4A3GJ 3I3LA 1R22A 5GPCA 2HR3A 3K2AA 3KLNA 1APLC 2MC3A 1HA8A 2O8KA 2WB1A 3ECHA 2KT0A 1ZK8A 3WE3A 1JJ8C 2IGKA 2V1XA 4Y52J 2ZJ2A 4ENNA 2XAQA 1MSEC 3DP7A 3WTVC 3KZIC 2EJRA 2G7HA 2UXXA 3NWTA 3KP2A 4XSXF 4KA4A 2CW7A 5KVRA 1WZ2A 1A6IA 2OTJI 2ESNA 3CP2A 2XVCA 1OR7C 5DCMB 3SJMA 3JTGA 4KMFA 3GX4X 2Y75A 2F4MB 3E7LA 2KHMA 5JLXA 3ROUA 4HRIA 1OCZH 4OINF 1K78B 1F43A 1ZYRF 4AWXB 4B09A 2E7WA 3F21A 3MN2A 3EYIA 4E7SA 2NXNB 3MAJA 2RC4A 2WAQN 2WC2A 3OSFA 5HDGA 2NOJB 1B8IA 3U2RA 5FKLA 3ABLH 3EDPA 3SQNA 4C30A 1SMTA 3CF5F 2EB7A 3BC8A 2E1NA 2R7ZJ 2FSWA 2LF8A 4KIGA 1GXQA 2ZMEC 4KT5C 3KEOA 1N25A 2CW8A 3WHCA 3CMEI 3VODA 2BXYA 2MSYA 3CMMA 1OPCA 4CCKA 5J47A 3W6JB 2DFEA 3I53A 2G0EA 1B4AA 1MDMB 3F22A 2QSFX 5D5XB 1X19A 2RNJA 3BCAA 3OYEA 3BCBA 3O6BB 1XCBA 3LAJA 5E3OA 4MQVA 1MMAA 3FHNA 1JI8A 1MBGA 3HGYA 4BJ6C 1V3FA 2W57A 3A1YA 1S3JA 2ELKA 2K85A 2KIMA 3NRVA 2L0KA 3RQ4A 2AXTC 4EJVA 4PUSA 1I1SA 4MHGA 1X4PA 2CQNA 2QUFA 3Q0WA 1J75A 2RVCA 1BIBA 3T1BA 2E35A 3J80K 5ILUA 2WTEA 1VI0A 1HF0A 1MJ9A 1K79A 3TO9A 4O6JA 3GFLA 3F6VA 1U6GA 2R7XA 2WV0A 1MDMA 2K86A 1Y56A 1KA8A 4DZJA 5H6RA 4DYQA 3J7YJ 1K4SA 1FEXA 3MWMA 3BG3A 5DCFA 4A3CJ 1ETWA 4P1WA 2EFNA 2V1DA 4P55A 3ESWB 5BS6A 1MBHA 4KNYA 1R4MB 4G7OF 2OA4A 1ZQ3P 4IRHA 1QA6A 3RPUD 2DOFA 2K4BA 2L5QA 1E3PA 5HLHA 4A3IJ 1QNTA 3CCEI 4XQFA 2UUZA 1VTNC 1LE8A 1U8RA 2R0QC 1ENHA 2HKOA 2HPIA 4B1RA 3QAHA 2WY8Q 2YS9A 2QZ8A 2LH9A 5CYVA 2X51A 2GIVA 3WGGA 3B6CA 3V8LA 3HOTA 1T2KA 4A3BJ 3C3WA 4OIRF 2LKPA 4BHPA 4ZTFA 1T39A 3FMQA 2OF7A 1DUXC 3BJ6A 2DMPA 1QRYA 2WY7Q 4U7DA 2VC1A 2EZLA 1PDNC 2A6EF 1DDNA 2M4KA 1FLIA 1WWXA 5EEAA 3MKYB 4WX9A 1JKRC 4A3KJ 5HLIA 3S1QJ 3OYIA 2ME0A 1S5LC 3OYGA 4RB0A 1XSVA 4AIJA 4HYEA 5L3BA 5JHUA 2OQRA 4OAYA 3FXMA 1S7AA 3AG4H 3HRMA 3RYRA 2IT0A 5M5XJ 2PMZA 2QKLB 5D8KB 5FRMA 1AU7A 1AKHB 2ZXHA 2XUBA 4IX7A 2LC2A 3BOQA 1ZR4A 4EMSA 2EQRA 2W4SA 4IHTA 4YRVA 2HGCA 3DU5A 2P4WA 2QKMB 5GAEJ 2PJPA 3HRTA 4PK4A 1WJAA 3RZDJ 2COBA 1JE8A 3GFIA 3TDUC 3OR1C 2ICWG 2GA2A 2R5ZB 1DU6A 4XONA 1HKTA 4AVZA 4EVIA 1HXDA 2CUFA 3H9GA 1D1AA 4NC8A 4FHTA 2LOOA 3OYCA 3L2VA 3CD6I 3HUGA 1S6LA 4HZFA 3ONQA 4BJTA 2BY3A 2K9LA 1Z77A 3IC7A 1RI7A 4HX7A 1WSUA 1SVMA 2UWMA 4F55A 3I56I 2KP6A 3QPHA 3IL2A 4H0EA 1R58A 1WJCA 1MMGA 1R6RA 4XM3A 4E6KG 2V4JC 3SDGA 2EFOA 2ZSIB 1FZPB 1ODDA 1JTXA 2FX0A 3WTTC 1WKMA 2V1UA 2NAZA 3K4JA 2OQGA 3KZYA 1LDJA 2H8RA 5BNGA 2X85A 5JFRA 3RSNA 2XF7A 3DKWA 3QP6A 2IS1A 4HLXA 4H4KC 2IS6A 4RGRA 4I2OA 3QP5A 5E1WA 2QLZA 2L7KA 3F3XA 2JN6A 1HC8A 2M7AA 4CSWA 1BW6A 3FXLA 2H09A 2L2OA 4B3XA 1WI9A 4I0BA 1O57A 4ASNA 1IXCA 3OOPA 5JLWA 5ICEA 3VDXA 1FYMA 4AUXA 1SC7A 4O5VA 2EWNA 2XDVA 3H5NA 5H2FC 2M1BA 1QZYA 4UY8I 1QU3A 2LP0A 3ZN0A 1LJ9A 2EZIA 1UHSA 2XF5A 2AO9A 3FX3A 4Q4ZF 1FTZA 3VSLA 4XR6A 1V5FA 4MGRA 2FU4A 4YFKF 4IKFA 2HQRA 2EH3A 4Q5SF 2JK3A 3F8BA 3FKJA 1HW5A 2K27A 4FX0A 4RGSA 1U2WA 2WAQA 2PMUA 4XL9A 5FO5A 1K4TA 3LSTA 4FTHA 1B72A 1UJ8A 2Z16A 4Y17A 4XBFA 3JRBA 5FFZA 2BXZA 2VBZA 4TV7A 1UMQA 3HJEA 1GVJA 1S29A 1TT0A 3HRUA 3CDIA 4WXHA 3GXOA 2Z99A 1Z9CA 2LVSA 3CO6C 3JREA 3A4CA 1SD5A 2AS5F 2W00A 3CLOA 3Q9VA 2V26A 3K0LA 2AHQA 2R7QA 2VB6A 3F9KA 4LITA 3K4LA 4P9FA 1I5ZA 5F0FA 1TNTA 3CC7I 2ZMEA 4QPOA 4AIHA 3PL8A 3ZQ7A 3I0TA 2IEKA 2AXLA 4Y7NJ 1KU9A 1XDUA 1DP7P 3LSHA 3D0SA 2V6EA 3G1OA 3DTKA 2GZWA 2PN6A 5H6QA 3UNGC 1YRNB 1ON1A 4EGYA 3HUGB 4IF4A 2P6SA 3M4OJ 4L9TA 4IO9F 2CYYA 1Z21A 1YW9A 2KFDA 3GZ5A 4PZJA 1GXPA 4XKVA 2W85A 1U9OA 1B1BA 5BQTA 1KZHA 4MIMA 3B73A 3GO5A 4BY7J 2M45A 1D8KA 3E1SA 2BBYA 3CQZJ 2L54A 3LOCA 2M5WA 2VXZA 4N0BA 2Q0OA 2ZKZA 2IA2A 3RKXA 1R00A 1DP3A 4XLAA 1TLHB 4D7MA 3L2WA 1WCMJ 5DTDA 1HOMA 2QQ9A 3S2WA 2VOOA 2EFQA 3OYJA 3PIOF 5F1RA 3K1PA 3G73A 3KP6A 3LNQA 3HTSB 2BY1A 3R6SA 1UAAA 4GDFA 1P9QC 3M8JA 1XGOA 2EA4A 2HYFA 3IH2A 2DLLA 4JK1X 4MTEA 3HOYJ 4XKBA 4U7BA 3QYEA 2I5UA 1MGTA 5F0CA 3J7AO 1VQ6I 2A3SA 4OMYA 3BR0A 2CU7A 4PDKA 4ZJZA 4HBLA 4HG2A 3S2DJ 1ZAOA 4FE4A 1WJDA 3PIPF 4BNCA 1TTYA 1I3QJ 3A0HC 2LY1A 4P9UA 1X58A 1WFXA 4I76A 4M9ZA 3VB2A 2PI0A 1IN7A 1X1CA 2KZGA 3OYKA 3U1DA 3TOAA 4B3AA 2H27A 1R49A 1TWHJ 2F6CA 1YRNA 4LFUA 4M9SA 5CVRA 2FNAA 4GCVA 1LE8B 1YO5C 1TWGJ 3DEEA 2ETHA 4IPAA 3FHZA 5HS9A 2PMZN 2PFBA 3GTPJ 2JT1A 3PO2J 4E7LA 2FBKA 4BL0B 3KCCA 1IV6A 3AL0C 2O9LA 3JSPA 1S8NA 3C7JA 3S8PA 1NK3P 3T8RA 3LSGA 3SZGA 3W3CA 3LQRA 4HX8A 1XB4A 1G6NA 4LJZF 6PAXA 1EJ9A 2ECBA 3MFKA 2DMQA 5FB2A 1CF7A 1UG2A 2BGCA 5LHIA 1WJ5A 2Z9OA 4KITB 2LFBA 1A35A 2LBFA 2JVHA 4B4CA 2R7OA 4ZDPA 1YTYA 1JGGA 2VKDA 1B72B 1W5SA 1WH5A 3M8EA 3JTHA 1WI3A 3E97A 3GTJJ 3R0AA 2E2JJ 2MH2A 2DFHA 3DLAA 3CLQA 1P7JA 3FIWA 4RLQA 3W2VA 2BYVE 2HDCA 1D0YA 4HNVA 1TWFJ 4OAZA 4ZDLA 2ZXWH 2JZYA 3J81K 1MBKA 4E7ZA 5KAIC 1YW7A 3DV8A 4L5JA 4A5NA 3MKWB 1D1CA 4V2FA 5HVQC 1S7OA 2A07F 3ZOBA 2ADUA 4I6ZA 3ZR8X 2DTZA 5BMZA 2BW3B 2VJ4A 1BJZA 4Z6YA 2CQ7A 4BQQA 2DOAA 3DCFA 3Q3SA 5IOZA 2X6OA 5KNLA 1RKWA 1OJLA 4LGWA 5EDNA 1SD7A 3HHGA 1I50J 5E17F 1R23A 2PQ8A 2DA6A 1BOBA 4CZZA 1JJ6C 1TW2A 4XLEA 2XV4S 5K5QA 3DEWA 3JAMK 3ZQCA 5J3LA 2M4GA 3O8HA 3HPHA 3DWLE 2DDAA 1IRGA 4ZDOA 3CMYA 5JVTA 1QHGA 5KCMA 4LLGF 5E1XA 1ETOA 1ETXA 2M0CA 2K3PA 3E5UA 5F6FA 4N9HA 1VQKI 3P9CA 1P4WA 1SAUA 4W1UA 3TBIA 5IP9J 5LEJA 3K4KA 3ZXSA 1BI0A 5JVGF 3FZVA 4JX5A 1BBYA 1J5YA 2FBIA 1GVDA 3R0JA 2HI3A 2V1NA 3ABUA 2QQAA 5CVVA 4JX6A 4XSZF 4NUBA 1SAXA 2LDUA 4RGUA 2RV8A 1FC3A 5HODA 3OS0A 3ZP5A 2Y0SN 2Q8KA 1W4MA 2PBIA 4CUGA 2KZVA 1A6QA 3EUKL 4DBQA 1RPWA 2GIZA 2WAFA 2A6TA 4CCMA 2Y69H 1FPQA 2CV0A 2EIMH 2O03A 2ZCWA 2IXSA 2P0WA 5GPAA 3CDHA 2Y9ZA 4FX4A 4RAGA 1IV8A 4RM3A 5DYMA 1MJBA 5BPIA 1DPUA 2EZHA 4ZTJA 4M73A 1ONVA 1WGXA 5LBQA 5FKNA 2ZMEB 4XK4A 2A68F 1VQPI 1ZR2A 1BJAA 1VQ9I 2FNPA 5TRDA 3VFZA 2O3FA 3NWSA 2XHKA 3ERMA 1H88C 2VOPA 3CESA 2BY0A 2CO5A 2DQLA 1K6YA 1ZTRA 1YOVB 2MLKA 4EJTA 1WJEA 1G4DA 4IXAA 3P5JA 1KQ9A 4BAYA 3N4MA 2CS3A 2DYRH 3F8NA 3FF5A 1HW1A 2IS2A 3BTLA 2O0YA 2VJJA 3A03A 4PFPA 2XROA 4C3HJ 2FA5A 4ESFA 2DJNA 3F8FA 3M9AA 1VNDA 2OCCH 3IRQA 1XPXA 3MZYA 2RQPA 3A01B 1YIOA 3RPQA 4CCNA 5DDGA 3ZQHA 1KYWA 3RCOA 3RKQA 1YJWI 4IQJA 1D3YA 2J5PA 2HNHA 3BTJA 4FISA 4AVPA 1ORKA 2LMDA 5EG0A 1FOXA 1HSTA 1TQIA 3ZGKA 1Z7LA 4ENJA 1WH7A 1X1BA 2R7WA 4ON0A 4AYBN 4S05A 1T0FA 3PQKA 2DAOA 4HLYA 2HQ5A 3TW7A 5IYCJ 2O8XA 3VEPA 4U88A 4A0YA 5D6EA 2X0LA 4XNFA 5ILSA 5KAFC 5E8GA 3GF2A 4M3GA 3DPLC 2YUSA 1B59A 1G8XA 5F27A 3MCZA 2KPMA 1POGA 2HPMA 4HEA2 1OYWA 3S14J 3K70C 2XAHA 3ZMVA 3AL0B 3OY9A 2JPCA 2IVMA 1O3RA 5CJ9A 1XD7A 2FE3A 1J2XA 3LSPA 4ESBA 1HBXG 4Y33A 1AOYA 2CFOA 4ZZDA 1O7LA 4U0VA 3A2KA 4HV6A 2E1MB 4I0AA 3HPGA 5IY5H 2I10A 5K7HA 2RNGA 3CCRI 1XGSA 2F5DA 2HDDA 4UNOA 2GOXB 1UG0A 1MMSA 2LLKA 4PSWA 1G3YA 4RS8A 1XSXA 3V42A 2QEXI 3K4CA 5FLXK 2XGCA 2VKVA 4IHVA 3DKXA 1J9IA 2VE8A 4UUVA 2L9SA 1S7EA 1GV5A 5CQEA 2P5KA 2VLAA 4UUSB 2L3DA 3T5XA 3ZMTA 2JUGA 5HNFA 3IWFA 4Q48A 3C1DA 1SVLA 1FOKA 4XN3A 2CW0F 3BPVA 2VQCA 4R8HA 2IGOA 2DPUA 1B8IB 1CGPA 5E3NA 2MA3A 1FNNA 4UXNA 4BQOA 3UR3C 3BQZA 3SXYA 1R5GA 2EPFA 1D0XA 4W97A 1IRXA 1X1AA 2M34A 3ZRGA 2HQAA 1XDSA 5FFXA 2XC7A 1I6XA 1Z1DA 5IT9Z 2EA2A 1X2NA 3SZPA 3S3MA 3KX2A 3HYIA 1ZHFA 2COMA 4JOMA 1UHWA 3KEYA 3GTGJ 1RR7A 2X1EA 1SMYF 1TBXA 4HQMA 3O3KA 1IO2A 2QM3A 3C2GA 1EA3A 2FOKA 3QOPA 1MBEA 4R1HA 1EF4A 4M6YA 2ZB9A 5D5VB 3SEQA 4U87A 2K9NA 1RUOA 4F7ZA 1G59A 2LTPA 2DA2A 2NYXA 5D4RA 4U0YA 1VQNI 1OCTC 1E3HA 4G6TB 4EJUA 1W5TA 1MD0A 4EEFG 2JRTA 3HC7A 2QBYB 2PG4A 3V7CA 3V4GA 3ECOA 3GZ6A 1IJWC 2GA1A 2L7FP 3BZKA 2DI3A 4EM1A 4GYGA 2VQGA 2D45A 1ETKA 1LEAA 2R7FA 3DF8A 3HSRA 5ERIA 3IH3A 3LSIA 1IXSB 3MMYB 4HDUA 2EFWA 2E1CA 4HV5A 4V19K 1MZBA 1W36C 3FXOA 2HS5A 3TEDA 4XLNF 2DA3A 3BTCA 3KEQA 3GLLA 2VL8A 4BHBA 2CFXA 4HF1A 1FT9A 2LNBA 3H9JA 1TT5B 3G2BA 2YU3A 1JUPA 5IP6A 4MLOA 3GVAA 1XMAA 2NNYA 3L1PA 2M8EA 3J81Z 2VBWA 1OCOH 2Z5UA 1LQ1A 3WTUC 3KFWX 2W82A 2JUCA 2EIJH 4CICA 1IUYA 5EEHA 3PFIA 4M72A 3CJNA 2A6HF 4RB3C 4ZYHA 1EV7A 3L09A 3HEFA 2VQHA 1FP1D 4Y3OA 4QSHA 1ZREA 5TJJA 3WGHA 4BEHB 2YX4A 1NHAA 1F36A 5IT9K 3K69A 1NG7A 4V2GA 4M9XA 4E7KA 3FXUA 4OOIA 3OWTA 4UV9A 5B1BH 5L3CA 2HTJA 1BC7C 5AIQA 2QSHX 1JTYA 2LK2A 3BR3A 2V79A 4II2A 4EM0B 2HWVA 1Y0NA 2CV1A 2R93J 4X6AJ 4I99C 1SANA 3VYSB 1JT0A 4G7ZF 2R7SA 3G6EI 1Z3YA 1JXSA 3H1CA 3WU2C 2K5CA 2LSOA 2OAZA 4PJLA 2DO7A 5J1UA 1XMKA 4J00A 5EEGA 4BBSJ 3LSJA 2BEOA 1PYVA 2MBFA 3SHFA 1IDZA 3I9V2 2KDZA 4EJOA 3KP7A 1ZG1A
chains in the Genus database with same CATH topology
2EV6A 3SFZA 2XAJA 3QU6A 3F8CA 3EETA 3I5UA 2G7UA 4FT8A 4N9IA 1Z05A 1HSJA 4D0PA 4HDVA 3WTWC 2J5OA 5E20A 5CVJA 1BOAA 1YW8A 2IPQX 4HX4A 4IHSA 3WU1B 5FD6A 2IRFG 1T38A 1IN5A 2DW4A 1SD4A 4KIFA 1KQ8A 4KDPA 2M30A 2DK8A 3BY6A 2A61A 3DFGA 2CG4A 5J8FA 3OV8A 4OIPF 3JSOA 4G94A 1HQCA 3HRSA 2P5VA 4MTDA 1BN5A 4AIKA 2F5CA 4RGXA 5DUKA 1FYLA 3I64A 2KIUA 4CGZA 1R1VA 1MKMA 2MH9A 2HTSA 4CXFA 2EFPA 1XSDA 4LG0A 2UZKA 3F6OA 4ZYGA 4IRIA 2V9VA 2VC0A 3V7RA 1P2FA 5JR3A 3NQOA 2HQNA 2FQ3A 4EV0A 2ISYA 1UFMA 2BE5F 2QYOA 1KQ0A 1LVAA 2ZBKA 1P6RA 2OD5A 1ZLJA 1OKRA 2Y0MA 4L0YB 3CUOA 2STTA 2XAFA 2ZFWA 5ICFA 3L2CA 4P96A 4KFCA 1D5VA 4Y13A 4IVNA 2ESHA 1HKSA 1R5HA 3REOA 3F23A 2JTVA 2H94A 2VODA 4EGZA 1ZH5A 3WODF 2FBHA 3KP3A 1YS7A 2IA1A 5A2QK 2QBYA 3GFMA 1IZ1A 3KETA 4JQFA 5HLGA 2DFIA 1E17A 1CF7B 4BH9A 3ABTA 3MZHA 1QQIA 4WWCA 3FXQA 3DEUA 2VN2A 3ISPA 5E8IA 4ENMA 3IHUA 5CVIA 5LLQA 4RB2C 1ZN2A 1USTA 2KIFA 3EQLF 5E1ZB 4WXCA 2O6GE 2YPRA 2IP2A 2XASA 2ELHA 4KN4X 1BM9A 3QRFF 2IA0A 1UB9A 3F72A 4YFNF 5DUIA 3LAPA 3N97A 4UVCA 3TQNA 1AWCA 1BI2A 2JSCA 1TNSA 2JPBA 3WTZA 4MEXF 3J80Z 1L3LA 1U5TA 2KJCA 2VBXA 2CWEA 3ELKA 3LA3A 4PGGA 2HOEA 3WTSC 3TDZC 4KYWA 3H3ZA 2DTRA 4L9VA 3QU3A 5HS8A 5J8CA 1A04A 3C18A 3K2ZA 2NS0A 3O2PE 1XCVA 1J59A 3I59B 2C6YA 1F4KA 4YFXF 4EM2A 3MQ0A 2Z3YA 3I58A 3EYYA 1T98A 5H20A 3BROA 1PP7U 3P9KA 3R4KA 4CDGA 3JW4A 4DNCA 4G6DA 1EH8A 3I4PA 3KE2A 3GW2A 3E6MA 3FM5A 2Y48A 4EJWA 2PEXA 1I1GA 1QPMA 2P8TA 1OMIA 3E6CC 2ZXJA 1SD6A 1OYYA 4BXUA 4ETSA 4GYIA 3B02A 3HOSA 3Q9SA 3GLXA 2YR2A 2VONA 1W7PA 2W84A 3VOEA 1J0RA 3M1EA 2D1HA 1U78A 2F2EA 3CUQA 2RGVA 3K9TA 3WTXC 3IRRA 1EH6A 3AAFA 5E18F 2NRAC 2DT5A 3TO6A 3IKVA 1TW3A 1STZA 3WE2A 1BIAA 5K5OA 3M7GA 5FLXZ 3P7NA 4I98B 4XLPF 4BHCA 3GUDA 4CHUA 2IW5A 1K7AA 1P92A 4R79A 1BC8C 1U5TB 4OIQF 1O3TA 1TQMA 3I71A 1Q1HA 4CO8A 1FY7A 2R7DA 3IKTA 1J7KA 2Q2EA 2FXAA 2OZUA 5LRRA 2A69F 2H6CA 2OBPA 2GWRA 3EUHA 5AIPA 3IWZA 2QWWA 5L3FA 5LGNA 2GAUA 1F5TA 1R1UA 4M6XA 1YG2A 3SZTA 4YIIA 4HAMA 4HW0A 1KU3A 3KP4A 1C0WA 3ULQB 1IW7F 1LEBA 1FP2A 1USSA 3GYHX 5AONA 3BJOA 4HOBA 3ZMZA 4CYDA 1HKQA 2CQKA 2RDPA 1LNWA 4A6EA 2DBBA 4A0XA 3CUQB 2FF4A 4QLCU 4PCQA 2ISZA 4L18B 3BZ6A 4L9NA 1U3EM 3P9IA 4UV8A 4KUMA 2K4JA 1OYIA 1MJAA 2IJLA 1K78A 2EK5A 1ON2A 3LFKA 1B6AA 4GXOA 1QGPA 1WQ2A 3TOBA 2K02A 2X4HA 2W24A 3DQVC 1RUNA 3WG9A 2VBYA 3H3UA 2XKOA 1B9NA 3L9FA 3HTUA 1D8JA 1RNLA 4QWQA 1KU2A 4KICA 3W6KB 4L9JA 4LG0B 5DV5A 2VE9A 3COAC 4A12A 4G6QA 2FEZA 1FBUA 5LGUA 4ESJA 1G3WA 5CVUA 2FMYA 2MD5A 2STWA 4LLNA 2QVOA 4G8XA 1OR7A 5L3GA 3HHHA 1W7PB 2DK5A 4S04A 4KMUX 3ZPLA 3HIFA 2F5FA 2ZNYA 1YS6A 3K1NA 1ZRDA 2XRNA 1Y0UA 5DD8A 4B8XA 3MEXA 4P5OA 4UVAA 3M8FA 1ULYA 1FBSA 1PP8F 5DCMA 4I7HA 4WF2A 2UXNA 4WCGA 1ZRFA 2W25A 3TKYA 3HSFA 3LA7A 1XGMA 4M74A 2WWYA 2V6CA 1V4RA 3NEUA 5FGMA 3PQJA 4YG2F 4LB6B 3L7WA 1E2XA 3E6BA 1H9TA 4OMZA 2PLYA 2EV5A 3I59A 1IN8A 1I27A 4ZYDA 2BV6A 1BI1A 1L0OC 3LA2A 1P4XA 3FMRA 4NQWA 4PGHA 1SFEA 1ZGJA 2CSOA 2KKOA 1UCRA 4O3MA 3GEZA 2QQBA 3ML6A 3TGNA 4ZYEA 1F9NA 1JHFA 5L3EA 1QO0D 4WK8F 5D6FA 4IJAA 3V8JA 2D1VA 1LB2A 1KGSA 2FMLA 2B0LA 2XIGA 3LQQA 4OU0A 1YFHA 4M71A 1UHMA 1G3TA 3RIRA 3WGIA 4MEYF 4DQ2A 3QPTA 3WTYC 1T6SA 2QENA 3R60A 2H6BA 5KK1A 1EH7A 2L4AA 4MNUA 3ZN1A 1Z91A 1KU7A 1JHHA 4E70A 3RTRA 3JAMZ 4A5MA 2P6TA 2TDXA 4Q47A 1RZ4A 2DQRA 5LHHA 3TO7A 1G3SA 3FWEA 1R1TA 1SFXA 4L0ZB 2D2WA 3E3VA 2L01A 3RKWA 1XGNA 4HA8A 4I09A 2KRFA 4A6DA 4U0WA 5CLSA 2ZO4A 5K1YA 4LK1F 3K1MA 2E7XA 5DEQA 1LDDA 5A2QZ 1HW2A 4LK0F 4Y15A 4HF2A 3DPTA 3FXRA 3ZMUA 2HYGD 2MLGA 3GWZA 4AD9A 2VT3A 1PUEE 2R3SA 3T0YA 4UVBA 1BI3A 1O3QA 5LGTA 1QZZA 5ED4A 2HEOA 2L02A 5J6XA 2P7VB 3RJPA 3E6DA 3BJAA 2KJBA 5D5UB 3GFJA 3I54A 3RDIA 1FYKA 4RAZA 1ZGAA 1P4AA 2Z33A 2EV0A 3F8MA 3R61A 2DU9A 3RPUA 2P7CB 3Q5FA 1LDKB 5HS7A 1B9MA 1XN7A 5HDKA 4LLLA 1YYVA 1Z7UA 1IN4A 4NB5A 3CTAA 5ILVA 4LMYA 5F64A 5DD4A 4WXDA 4BYYA 1FSEA 1IN6A 3CUQC 3ZMDA 3DXJF 4Z2YA 4NHJA 1X3UA 2P5LC 4MQ9F 1FSHA 3V7SA 5L3DA 4ZZLA 1FX7A 4K2EA 4I01A 5IT3A 4HF0A 2GXBA 4GGGA 2ZNZA 4ZH4F 4LB5A 4YIFA 1O3SA 5K5RA 3KZZA 2DPDA 1IAWA 1H9GA 2PMHA 4RAYA 1DPRA 1IRFA 1YQAA 2L4MA 5LEKA 2RKHA 2LF7A 1SFUA 2XGXA 4G9YA 3BDDA 2YSRA 3U9GA 3G3ZA 2HFHA 2CGPA 1KYZA 1ZARA 5D5WB 4JBAA 2YX7A 5LHGA 1Z6RA 2XKPA 1ZG5A 4KIBA 3E5QA 3ZMSA 4KN7X 3V8KA 4XRFA 5BPDA 2NNNA 4GO1A 3H92A 5ICCA 1U5TC 2HZTA 4IRGA 5D8LB 2ACJA 3KP5A 4I02A 5HDNA 1YLFA 5FD5A 5BOXA 4RB1A 2RN7A 1H0MA 3KLOA 1W7PD 5ICGA 2HKXA 2FRHA 3ERED 3WU0A 4LD5A 1R36A 4BQAA 1WRJA 4G7HF 1FBQA 1REPC 2OU2A 5JI6A 5D4SA 3D5LA 4L5IA 2OZ6A 3E5XA 1JGSA 2M87A 4OIOF 1TQPA 4UHTA 5LRSA 3RKYA 4A2UA 1ZLKA 3RYPA 2A5YB 4EQQA 1GHCA 3RI4A 2O61A 4HQEA 2VT2A 1IF1A 3BP8A 1R7JA 1ZG3A 3BPXA 3CO7C 3BWGA 1QBJA 1O7FA 1RIOH 4A0ZA 3FMSA 3HSEA 1FWZA 1Z6TA 1IXRC 3FM3A 2GXGA 1F1ZA 2F5EA 3LWFA 1ZRCA 2GQQA 3T8TA 3L00A 2XAGA 5HOOA 1K6OA 4ENKA 2K7LA 2G9WA 1R22A 2HR3A 3KLNA 2MC3A 3ECHA 3WE3A 2V1XA 2ZJ2A 4ENNA 2XAQA 3DP7A 3WTVC 2EJRA 2G7HA 2UXXA 3KP2A 4XSXF 4KA4A 5KVRA 2ESNA 2XVCA 5DCMB 3JTGA 4KMFA 3GX4X 2Y75A 3ROUA 4OINF 1K78B 1ZYRF 4AWXB 4B09A 2E7WA 3F21A 3EYIA 3MAJA 2RC4A 2WC2A 5HDGA 3U2RA 3EDPA 3SQNA 1SMTA 2EB7A 2E1NA 2FSWA 2LF8A 4KIGA 1GXQA 4KT5C 3KEOA 3VODA 1OPCA 3W6JB 3I53A 1B4AA 1MDMB 3F22A 5D5XB 2RNJA 3O6BB 1XCBA 3LAJA 4MQVA 1V3FA 2W57A 1S3JA 2KIMA 1I1SA 3NRVA 4EJVA 4MHGA 2QUFA 1J75A 2RVCA 1BIBA 3T1BA 3J80K 5ILUA 2WTEA 1MJ9A 1K79A 3TO9A 4O6JA 3GFLA 3F6VA 1U6GA 2WV0A 1MDMA 2K86A 1KA8A 5H6RA 3MWMA 5DCFA 2EFNA 2V1DA 4P55A 5BS6A 4KNYA 4G7OF 2OA4A 4IRHA 2K4BA 5HLHA 1QNTA 1VTNC 1U8RA 2HKOA 3QAHA 2QZ8A 3HOTA 5CYVA 2GIVA 3WGGA 3V8LA 1T2KA 3C3WA 4OIRF 2LKPA 4BHPA 1T39A 3FMQA 1DUXC 3BJ6A 4U7DA 1PDNC 2VC1A 2A6EF 1DDNA 1FLIA 1WWXA 4WX9A 5HLIA 4RB0A 1XSVA 4AIJA 4HYEA 5L3BA 5JHUA 2OQRA 1S7AA 3HRMA 3RYRA 2IT0A 5D8KB 2XUBA 3BOQA 4EMSA 4IHTA 2HGCA 2P4WA 2PJPA 3HRTA 1JE8A 3GFIA 3TDUC 2GA2A 1HKTA 4EVIA 1HXDA 4FHTA 3HUGA 1S6LA 4HZFA 3IC7A 4HX7A 1RI7A 1WSUA 2UWMA 3QPHA 3IL2A 4H0EA 1R58A 2EFOA 1FZPB 1ODDA 3WTTC 1WKMA 2V1UA 2NAZA 2OQGA 3KZYA 1LDJA 5JFRA 3DKWA 3QP6A 4HLXA 4RGRA 4I2OA 3QP5A 5E1WA 2QLZA 3F3XA 2H09A 1WI9A 4I0BA 1O57A 4ASNA 1IXCA 3OOPA 5ICEA 1FYMA 4O5VA 2EWNA 2M1BA 1QZYA 3ZN0A 1LJ9A 3FX3A 4Q4ZF 4MGRA 2FU4A 4YFKF 2HQRA 4Q5SF 3F8BA 1HW5A 2K27A 4FX0A 4RGSA 1U2WA 2PMUA 5FO5A 3LSTA 4Y17A 4XBFA 5FFZA 2VBZA 4TV7A 1GVJA 1S29A 3HRUA 4WXHA 3GXOA 2Z99A 1Z9CA 3CO6C 1SD5A 2AS5F 3CLOA 3Q9VA 3K0LA 4P9FA 1I5ZA 1TNTA 2ZMEA 4AIHA 3ZQ7A 3I0TA 2AXLA 1KU9A 1XDUA 1DP7P 3D0SA 2GZWA 2PN6A 5H6QA 1ON1A 4EGYA 4IF4A 2P6SA 4L9TA 2CYYA 1YW9A 3GZ5A 4PZJA 1GXPA 2W85A 1B1BA 5BQTA 3B73A 3GO5A 2M45A 1D8KA 2BBYA 2L54A 2M5WA 2VXZA 4N0BA 2Q0OA 2ZKZA 2IA2A 3RKXA 1R00A 1TLHB 2QQ9A 3S2WA 2VOOA 2EFQA 5F1RA 3K1PA 3G73A 3KP6A 3HTSB 3R6SA 1XGOA 2EA4A 2HYFA 4MTEA 2DLLA 4JK1X 4U7BA 1MGTA 3J7AO 2A3SA 4OMYA 4PDKA 4HBLA 1ZAOA 4BNCA 1TTYA 4P9UA 2PI0A 4M9ZA 3VB2A 1IN7A 3U1DA 3TOAA 2H27A 4LFUA 4M9SA 5CVRA 2FNAA 4GCVA 1YO5C 4IPAA 2ETHA 3FHZA 5HS9A 2PFBA 2JT1A 2FBKA 3KCCA 3JSPA 1S8NA 3C7JA 3T8RA 3LQRA 4HX8A 1XB4A 1G6NA 4LJZF 6PAXA 3MFKA 5FB2A 1CF7A 2BGCA 5LHIA 2Z9OA 1YTYA 1W5SA 3M8EA 3JTHA 3E97A 3R0AA 2MH2A 2BYVE 2HDCA 2JZYA 3J81K 1YW7A 3DV8A 4L5JA 4A5NA 5HVQC 1S7OA 2A07F 2ADUA 5BMZA 4LGWA 1SD7A 3HHGA 5E17F 1R23A 2PQ8A 4CZZA 1TW2A 2XV4S 5K5QA 3JAMK 1IRGA 5JVTA 4LLGF 5E1XA 3E5UA 5F6FA 4N9HA 3P9CA 1P4WA 5LEJA 1BI0A 3FZVA 1BBYA 1J5YA 2FBIA 3R0JA 3ABUA 2QQAA 5CVVA 4XSZF 1SAXA 2LDUA 4RGUA 2RV8A 1FC3A 3ZP5A 2Q8KA 1W4MA 2PBIA 1FPQA 2O03A 2ZCWA 3CDHA 4FX4A 5DYMA 1MJBA 5BPIA 1DPUA 4M73A 1ONVA 5LBQA 2ZMEB 2A68F 1BJAA 2FNPA 5TRDA 3VFZA 2O3FA 2XHKA 2VOPA 2CO5A 2DQLA 2MLKA 4EJTA 1G4DA 4IXAA 4BAYA 1KQ9A 3N4MA 3F8NA 3FF5A 1HW1A 2O0YA 2XROA 2FA5A 4ESFA 3F8FA 3M9AA 3IRQA 3MZYA 2RQPA 1YIOA 3RPQA 5DDGA 1KYWA 1D3YA 2J5PA 4AVPA 1HSTA 1TQIA 4ENJA 4ON0A 4S05A 1T0FA 3PQKA 2DAOA 4HLYA 2O8XA 3VEPA 4U88A 4A0YA 5D6EA 2X0LA 5ILSA 5E8GA 3GF2A 3DPLC 1B59A 3MCZA 1OYWA 2XAHA 3ZMVA 2JPCA 2IVMA 1O3RA 5CJ9A 1XD7A 2FE3A 1J2XA 1HBXG 4ESBA 1AOYA 4ZZDA 1O7LA 4U0VA 4HV6A 4I0AA 1XGSA 2F5DA 4UNOA 1G3YA 4RS8A 1XSXA 5FLXK 1J9IA 2VE8A 4UUVA 2P5KA 2L3DA 3T5XA 3ZMTA 3IWFA 4Q48A 3C1DA 1FOKA 2CW0F 3BPVA 4R8HA 2DPUA 1CGPA 2MA3A 1FNNA 4UXNA 3SXYA 1R5GA 1XDSA 5FFXA 1I6XA 1Z1DA 5IT9Z 2EA2A 3SZPA 3HYIA 1ZHFA 2COMA 1UHWA 1SMYF 1TBXA 4HQMA 3O3KA 2QM3A 3QOPA 2FOKA 4R1HA 4M6YA 5D5VB 1RUOA 4F7ZA 2NYXA 5D4RA 4U0YA 4EJUA 1W5TA 1MD0A 2JRTA 2QBYB 2PG4A 3V7CA 3V4GA 3ECOA 3GZ6A 2GA1A 2DI3A 4EM1A 4GYGA 2D45A 2R7FA 1LEAA 5ERIA 3DF8A 3HSRA 4HDUA 1IXSB 2EFWA 2E1CA 4HV5A 1MZBA 2HS5A 4XLNF 3KEQA 4BHBA 2CFXA 4HF1A 1FT9A 2LNBA 2YU3A 3GVAA 1XMAA 2NNYA 2M8EA 3J81Z 2VBWA 2Z5UA 1LQ1A 3WTUC 3KFWX 4CICA 1IUYA 5EEHA 3PFIA 4M72A 3CJNA 2A6HF 4RB3C 4ZYHA 1EV7A 3L09A 1FP1D 1ZREA 5TJJA 3WGHA 2YX4A 1NHAA 5IT9K 3K69A 4M9XA 3FXUA 4OOIA 4UV9A 5L3CA 2HTJA 1BC7C 5AIQA 2V79A 4EM0B 2HWVA 4G7ZF 1JXSA 2LSOA 2OAZA 2DO7A 1XMKA 5EEGA 2BEOA 2MBFA 3SHFA 4EJOA 3KP7A 1ZG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EV6 A;  3SFZ A;  2XAJ A;  3QU6 A;  3F8C A;  3EET A;  3I5U A;  2G7U A;  4FT8 A;  4N9I A;  1Z05 A;  1HSJ A;  4D0P A;  4HDV A;  3WTW C;  2J5O A;  5E20 A;  5CVJ A;  1BOA A;  1YW8 A;  2IPQ X;  4HX4 A;  4IHS A;  3WU1 B;  5FD6 A;  2IRF G;  1T38 A;  1IN5 A;  2DW4 A;  1SD4 A;  4KIF A;  1KQ8 A;  4KDP A;  2M30 A;  2DK8 A;  3BY6 A;  2A61 A;  3DFG A;  2CG4 A;  5J8F A;  3OV8 A;  4OIP F;  3JSO A;  4G94 A;  1HQC A;  3HRS A;  2P5V A;  4MTD A;  1BN5 A;  4AIK A;  2F5C A;  4RGX A;  5DUK A;  1FYL A;  3I64 A;  2KIU A;  4CGZ A;  1R1V A;  1MKM A;  2MH9 A;  2HTS A;  4CXF A;  2EFP A;  1XSD A;  4LG0 A;  2UZK A;  3F6O A;  4ZYG A;  4IRI A;  2V9V A;  2VC0 A;  3V7R A;  1P2F A;  5JR3 A;  3NQO A;  2HQN A;  2FQ3 A;  4EV0 A;  2ISY A;  1UFM A;  2BE5 F;  2QYO A;  1KQ0 A;  1LVA A;  2ZBK A;  1P6R A;  2OD5 A;  1ZLJ A;  1OKR A;  2Y0M A;  4L0Y B;  3CUO A;  2STT A;  2XAF A;  2ZFW A;  5ICF A;  3L2C A;  4P96 A;  4KFC A;  1D5V A;  4Y13 A;  4IVN A;  2ESH A;  1HKS A;  1R5H A;  3REO A;  3F23 A;  2JTV A;  2H94 A;  2VOD A;  4EGZ A;  1ZH5 A;  3WOD F;  2FBH A;  3KP3 A;  1YS7 A;  2IA1 A;  5A2Q K;  2QBY A;  3GFM A;  1IZ1 A;  3KET A;  4JQF A;  5HLG A;  2DFI A;  1E17 A;  1CF7 B;  4BH9 A;  3ABT A;  3MZH A;  1QQI A;  4WWC A;  3FXQ A;  3DEU A;  2VN2 A;  3ISP A;  5E8I A;  4ENM A;  3IHU A;  5CVI A;  5LLQ A;  4RB2 C;  1ZN2 A;  1UST A;  2KIF A;  3EQL F;  5E1Z B;  4WXC A;  2O6G E;  2YPR A;  2IP2 A;  2XAS A;  2ELH A;  4KN4 X;  1BM9 A;  3QRF F;  2IA0 A;  1UB9 A;  3F72 A;  4YFN F;  5DUI A;  3LAP A;  3N97 A;  4UVC A;  3TQN A;  1AWC A;  1BI2 A;  2JSC A;  1TNS A;  2JPB A;  3WTZ A;  4MEX F;  3J80 Z;  1L3L A;  1U5T A;  2KJC A;  2VBX A;  2CWE A;  3ELK A;  3LA3 A;  4PGG A;  2HOE A;  3WTS C;  3TDZ C;  4KYW A;  3H3Z A;  2DTR A;  4L9V A;  3QU3 A;  5HS8 A;  5J8C A;  1A04 A;  3C18 A;  3K2Z A;  2NS0 A;  3O2P E;  1XCV A;  1J59 A;  3I59 B;  2C6Y A;  1F4K A;  4YFX F;  4EM2 A;  3MQ0 A;  2Z3Y A;  3I58 A;  3EYY A;  1T98 A;  5H20 A;  3BRO A;  1PP7 U;  3P9K A;  3R4K A;  4CDG A;  3JW4 A;  4DNC A;  4G6D A;  1EH8 A;  3I4P A;  3KE2 A;  3GW2 A;  3E6M A;  3FM5 A;  2Y48 A;  4EJW A;  2PEX A;  1I1G A;  1QPM A;  2P8T A;  1OMI A;  3E6C C;  2ZXJ A;  1SD6 A;  1OYY A;  4BXU A;  4ETS A;  4GYI A;  3B02 A;  3HOS A;  3Q9S A;  3GLX A;  2YR2 A;  2VON A;  1W7P A;  2W84 A;  3VOE A;  1J0R A;  3M1E A;  2D1H A;  1U78 A;  2F2E A;  3CUQ A;  2RGV A;  3K9T A;  3WTX C;  3IRR A;  1EH6 A;  3AAF A;  5E18 F;  2NRA C;  2DT5 A;  3TO6 A;  3IKV A;  1TW3 A;  1STZ A;  3WE2 A;  1BIA A;  5K5O A;  3M7G A;  5FLX Z;  3P7N A;  4I98 B;  4XLP F;  4BHC A;  3GUD A;  4CHU A;  2IW5 A;  1K7A A;  1P92 A;  4R79 A;  1BC8 C;  1U5T B;  4OIQ F;  1O3T A;  1TQM A;  3I71 A;  1Q1H A;  4CO8 A;  1FY7 A;  2R7D A;  3IKT A;  1J7K A;  2Q2E A;  2FXA A;  2OZU A;  5LRR A;  2A69 F;  2H6C A;  2OBP A;  2GWR A;  3EUH A;  5AIP A;  3IWZ A;  2QWW A;  5L3F A;  5LGN A;  2GAU A;  1F5T A;  1R1U A;  4M6X A;  1YG2 A;  3SZT A;  4YII A;  4HAM A;  4HW0 A;  1KU3 A;  3KP4 A;  1C0W A;  3ULQ B;  1IW7 F;  1LEB A;  1FP2 A;  1USS A;  3GYH X;  5AON A;  3BJO A;  4HOB A;  3ZMZ A;  4CYD A;  1HKQ A;  2CQK A;  2RDP A;  1LNW A;  4A6E A;  2DBB A;  4A0X A;  3CUQ B;  2FF4 A;  4QLC U;  4PCQ A;  2ISZ A;  4L18 B;  3BZ6 A;  4L9N A;  1U3E M;  3P9I A;  4UV8 A;  4KUM A;  2K4J A;  1OYI A;  1MJA A;  2IJL A;  1K78 A;  2EK5 A;  1ON2 A;  3LFK A;  1B6A A;  4GXO A;  1QGP A;  1WQ2 A;  3TOB A;  2K02 A;  2X4H A;  2W24 A;  3DQV C;  1RUN A;  3WG9 A;  2VBY A;  3H3U A;  2XKO A;  1B9N A;  3L9F A;  3HTU A;  1D8J A;  1RNL A;  4QWQ A;  1KU2 A;  4KIC A;  3W6K B;  4L9J A;  4LG0 B;  5DV5 A;  2VE9 A;  3COA C;  4A12 A;  4G6Q A;  2FEZ A;  1FBU A;  5LGU A;  4ESJ A;  1G3W A;  5CVU A;  2FMY A;  2MD5 A;  2STW A;  4LLN A;  2QVO A;  4G8X A;  1OR7 A;  5L3G A;  3HHH A;  1W7P B;  2DK5 A;  4S04 A;  4KMU X;  3ZPL A;  3HIF A;  2F5F A;  2ZNY A;  1YS6 A;  3K1N A;  1ZRD A;  2XRN A;  1Y0U A;  5DD8 A;  4B8X A;  3MEX A;  4P5O A;  4UVA A;  3M8F A;  1ULY A;  1FBS A;  1PP8 F;  5DCM A;  4I7H A;  4WF2 A;  2UXN A;  4WCG A;  1ZRF A;  2W25 A;  3TKY A;  3HSF A;  3LA7 A;  1XGM A;  4M74 A;  2WWY A;  2V6C A;  1V4R A;  3NEU A;  5FGM A;  3PQJ A;  4YG2 F;  4LB6 B;  3L7W A;  1E2X A;  3E6B A;  1H9T A;  4OMZ A;  2PLY A;  2EV5 A;  3I59 A;  1IN8 A;  1I27 A;  4ZYD A;  2BV6 A;  1BI1 A;  1L0O C;  3LA2 A;  1P4X A;  3FMR A;  4NQW A;  4PGH A;  1SFE A;  1ZGJ A;  2CSO A;  2KKO A;  1UCR A;  4O3M A;  3GEZ A;  2QQB A;  3ML6 A;  3TGN A;  4ZYE A;  1F9N A;  1JHF A;  5L3E A;  1QO0 D;  4WK8 F;  5D6F A;  4IJA A;  3V8J A;  2D1V A;  1LB2 A;  1KGS A;  2FML A;  2B0L A;  2XIG A;  3LQQ A;  4OU0 A;  1YFH A;  4M71 A;  1UHM A;  1G3T A;  3RIR A;  3WGI A;  4MEY F;  4DQ2 A;  3QPT A;  3WTY C;  1T6S A;  2QEN A;  3R60 A;  2H6B A;  5KK1 A;  1EH7 A;  2L4A A;  4MNU A;  3ZN1 A;  1Z91 A;  1KU7 A;  1JHH A;  4E70 A;  3RTR A;  3JAM Z;  4A5M A;  2P6T A;  2TDX A;  4Q47 A;  1RZ4 A;  2DQR A;  5LHH A;  3TO7 A;  1G3S A;  3FWE A;  1R1T A;  1SFX A;  4L0Z B;  2D2W A;  3E3V A;  2L01 A;  3RKW A;  1XGN A;  4HA8 A;  4I09 A;  2KRF A;  4A6D A;  4U0W A;  5CLS A;  2ZO4 A;  5K1Y A;  4LK1 F;  3K1M A;  2E7X A;  5DEQ A;  1LDD A;  5A2Q Z;  1HW2 A;  4LK0 F;  4Y15 A;  4HF2 A;  3DPT A;  3FXR A;  3ZMU A;  2HYG D;  2MLG A;  3GWZ A;  4AD9 A;  2VT3 A;  1PUE E;  2R3S A;  3T0Y A;  4UVB A;  1BI3 A;  1O3Q A;  5LGT A;  1QZZ A;  5ED4 A;  2HEO A;  2L02 A;  5J6X A;  2P7V B;  3RJP A;  3E6D A;  3BJA A;  2KJB A;  5D5U B;  3GFJ A;  3I54 A;  3RDI A;  1FYK A;  4RAZ A;  1ZGA A;  1P4A A;  2Z33 A;  2EV0 A;  3F8M A;  3R61 A;  2DU9 A;  3RPU A;  2P7C B;  3Q5F A;  1LDK B;  5HS7 A;  1B9M A;  1XN7 A;  5HDK A;  4LLL A;  1YYV A;  1Z7U A;  1IN4 A;  4NB5 A;  3CTA A;  5ILV A;  4LMY A;  5F64 A;  5DD4 A;  4WXD A;  4BYY A;  1FSE A;  1IN6 A;  3CUQ C;  3ZMD A;  3DXJ F;  4Z2Y A;  4NHJ A;  1X3U A;  2P5L C;  4MQ9 F;  1FSH A;  3V7S A;  5L3D A;  4ZZL A;  1FX7 A;  4K2E A;  4I01 A;  5IT3 A;  4HF0 A;  2GXB A;  4GGG A;  2ZNZ A;  4ZH4 F;  4LB5 A;  4YIF A;  1O3S A;  5K5R A;  3KZZ A;  2DPD A;  1IAW A;  1H9G A;  2PMH A;  4RAY A;  1DPR A;  1IRF A;  1YQA A;  2L4M A;  5LEK A;  2RKH A;  2LF7 A;  1SFU A;  2XGX A;  4G9Y A;  3BDD A;  2YSR A;  3U9G A;  3G3Z A;  2HFH A;  2CGP A;  1KYZ A;  1ZAR A;  5D5W B;  4JBA A;  2YX7 A;  5LHG A;  1Z6R A;  2XKP A;  1ZG5 A;  4KIB A;  3E5Q A;  3ZMS A;  4KN7 X;  3V8K A;  4XRF A;  5BPD A;  2NNN A;  4GO1 A;  3H92 A;  5ICC A;  1U5T C;  2HZT A;  4IRG A;  5D8L B;  2ACJ A;  3KP5 A;  4I02 A;  5HDN A;  1YLF A;  5FD5 A;  5BOX A;  4RB1 A;  2RN7 A;  1H0M A;  3KLO A;  1W7P D;  5ICG A;  2HKX A;  2FRH A;  3ERE D;  3WU0 A;  4LD5 A;  1R36 A;  4BQA A;  1WRJ A;  4G7H F;  1FBQ A;  1REP C;  2OU2 A;  5JI6 A;  5D4S A;  3D5L A;  4L5I A;  2OZ6 A;  3E5X A;  1JGS A;  2M87 A;  4OIO F;  1TQP A;  4UHT A;  5LRS A;  3RKY A;  4A2U A;  1ZLK A;  3RYP A;  2A5Y B;  4EQQ A;  1GHC A;  3RI4 A;  2O61 A;  4HQE A;  2VT2 A;  1IF1 A;  3BP8 A;  1R7J A;  1ZG3 A;  3BPX A;  3CO7 C;  3BWG A;  1QBJ A;  1O7F A;  1RIO H;  4A0Z A;  3FMS A;  3HSE A;  1FWZ A;  1Z6T A;  1IXR C;  3FM3 A;  2GXG A;  1F1Z A;  2F5E A;  3LWF A;  1ZRC A;  2GQQ A;  3T8T A;  3L00 A;  2XAG A;  5HOO A;  1K6O A;  4ENK A;  2K7L A;  2G9W A;  1R22 A;  2HR3 A;  3KLN A;  2MC3 A;  3ECH A;  3WE3 A;  2V1X A;  2ZJ2 A;  4ENN A;  2XAQ A;  3DP7 A;  3WTV C;  2EJR A;  2G7H A;  2UXX A;  3KP2 A;  4XSX F;  4KA4 A;  5KVR A;  2ESN A;  2XVC A;  5DCM B;  3JTG A;  4KMF A;  3GX4 X;  2Y75 A;  3ROU A;  4OIN F;  1K78 B;  1ZYR F;  4AWX B;  4B09 A;  2E7W A;  3F21 A;  3EYI A;  3MAJ A;  2RC4 A;  2WC2 A;  5HDG A;  3U2R A;  3EDP A;  3SQN A;  1SMT A;  2EB7 A;  2E1N A;  2FSW A;  2LF8 A;  4KIG A;  1GXQ A;  4KT5 C;  3KEO A;  3VOD A;  1OPC A;  3W6J B;  3I53 A;  1B4A A;  1MDM B;  3F22 A;  5D5X B;  2RNJ A;  3O6B B;  1XCB A;  3LAJ A;  4MQV A;  1V3F A;  2W57 A;  1S3J A;  2KIM A;  1I1S A;  3NRV A;  4EJV A;  4MHG A;  2QUF A;  1J75 A;  2RVC A;  1BIB A;  3T1B A;  3J80 K;  5ILU A;  2WTE A;  1MJ9 A;  1K79 A;  3TO9 A;  4O6J A;  3GFL A;  3F6V A;  1U6G A;  2WV0 A;  1MDM A;  2K86 A;  1KA8 A;  5H6R A;  3MWM A;  5DCF A;  2EFN A;  2V1D A;  4P55 A;  5BS6 A;  4KNY A;  4G7O F;  2OA4 A;  4IRH A;  2K4B A;  5HLH A;  1QNT A;  1VTN C;  1U8R A;  2HKO A;  3QAH A;  2QZ8 A;  3HOT A;  5CYV A;  2GIV A;  3WGG A;  3V8L A;  1T2K A;  3C3W A;  4OIR F;  2LKP A;  4BHP A;  1T39 A;  3FMQ A;  1DUX C;  3BJ6 A;  4U7D A;  1PDN C;  2VC1 A;  2A6E F;  1DDN A;  1FLI A;  1WWX A;  4WX9 A;  5HLI A;  4RB0 A;  1XSV A;  4AIJ A;  4HYE A;  5L3B A;  5JHU A;  2OQR A;  1S7A A;  3HRM A;  3RYR A;  2IT0 A;  5D8K B;  2XUB A;  3BOQ A;  4EMS A;  4IHT A;  2HGC A;  2P4W A;  2PJP A;  3HRT A;  1JE8 A;  3GFI A;  3TDU C;  2GA2 A;  1HKT A;  4EVI A;  1HXD A;  4FHT A;  3HUG A;  1S6L A;  4HZF A;  3IC7 A;  4HX7 A;  1RI7 A;  1WSU A;  2UWM A;  3QPH A;  3IL2 A;  4H0E A;  1R58 A;  2EFO A;  1FZP B;  1ODD A;  3WTT C;  1WKM A;  2V1U A;  2NAZ A;  2OQG A;  3KZY A;  1LDJ A;  5JFR A;  3DKW A;  3QP6 A;  4HLX A;  4RGR A;  4I2O A;  3QP5 A;  5E1W A;  2QLZ A;  3F3X A;  2H09 A;  1WI9 A;  4I0B A;  1O57 A;  4ASN A;  1IXC A;  3OOP A;  5ICE A;  1FYM A;  4O5V A;  2EWN A;  2M1B A;  1QZY A;  3ZN0 A;  1LJ9 A;  3FX3 A;  4Q4Z F;  4MGR A;  2FU4 A;  4YFK F;  2HQR A;  4Q5S F;  3F8B A;  1HW5 A;  2K27 A;  4FX0 A;  4RGS A;  1U2W A;  2PMU A;  5FO5 A;  3LST A;  4Y17 A;  4XBF A;  5FFZ A;  2VBZ A;  4TV7 A;  1GVJ A;  1S29 A;  3HRU A;  4WXH A;  3GXO A;  2Z99 A;  1Z9C A;  3CO6 C;  1SD5 A;  2AS5 F;  3CLO A;  3Q9V A;  3K0L A;  4P9F A;  1I5Z A;  1TNT A;  2ZME A;  4AIH A;  3ZQ7 A;  3I0T A;  2AXL A;  1KU9 A;  1XDU A;  1DP7 P;  3D0S A;  2GZW A;  2PN6 A;  5H6Q A;  1ON1 A;  4EGY A;  4IF4 A;  2P6S A;  4L9T A;  2CYY A;  1YW9 A;  3GZ5 A;  4PZJ A;  1GXP A;  2W85 A;  1B1B A;  5BQT A;  3B73 A;  3GO5 A;  2M45 A;  1D8K A;  2BBY A;  2L54 A;  2M5W A;  2VXZ A;  4N0B A;  2Q0O A;  2ZKZ A;  2IA2 A;  3RKX A;  1R00 A;  1TLH B;  2QQ9 A;  3S2W A;  2VOO A;  2EFQ A;  5F1R A;  3K1P A;  3G73 A;  3KP6 A;  3HTS B;  3R6S A;  1XGO A;  2EA4 A;  2HYF A;  4MTE A;  2DLL A;  4JK1 X;  4U7B A;  1MGT A;  3J7A O;  2A3S A;  4OMY A;  4PDK A;  4HBL A;  1ZAO A;  4BNC A;  1TTY A;  4P9U A;  2PI0 A;  4M9Z A;  3VB2 A;  1IN7 A;  3U1D A;  3TOA A;  2H27 A;  4LFU A;  4M9S A;  5CVR A;  2FNA A;  4GCV A;  1YO5 C;  4IPA A;  2ETH A;  3FHZ A;  5HS9 A;  2PFB A;  2JT1 A;  2FBK A;  3KCC A;  3JSP A;  1S8N A;  3C7J A;  3T8R A;  3LQR A;  4HX8 A;  1XB4 A;  1G6N A;  4LJZ F;  6PAX A;  3MFK A;  5FB2 A;  1CF7 A;  2BGC A;  5LHI A;  2Z9O A;  1YTY A;  1W5S A;  3M8E A;  3JTH A;  3E97 A;  3R0A A;  2MH2 A;  2BYV E;  2HDC A;  2JZY A;  3J81 K;  1YW7 A;  3DV8 A;  4L5J A;  4A5N A;  5HVQ C;  1S7O A;  2A07 F;  2ADU A;  5BMZ A;  4LGW A;  1SD7 A;  3HHG A;  5E17 F;  1R23 A;  2PQ8 A;  4CZZ A;  1TW2 A;  2XV4 S;  5K5Q A;  3JAM K;  1IRG A;  5JVT A;  4LLG F;  5E1X A;  3E5U A;  5F6F A;  4N9H A;  3P9C A;  1P4W A;  5LEJ A;  1BI0 A;  3FZV A;  1BBY A;  1J5Y A;  2FBI A;  3R0J A;  3ABU A;  2QQA A;  5CVV A;  4XSZ F;  1SAX A;  2LDU A;  4RGU A;  2RV8 A;  1FC3 A;  3ZP5 A;  2Q8K A;  1W4M A;  2PBI A;  1FPQ A;  2O03 A;  2ZCW A;  3CDH A;  4FX4 A;  5DYM A;  1MJB A;  5BPI A;  1DPU A;  4M73 A;  1ONV A;  5LBQ A;  2ZME B;  2A68 F;  1BJA A;  2FNP A;  5TRD A;  3VFZ A;  2O3F A;  2XHK A;  2VOP A;  2CO5 A;  2DQL A;  2MLK A;  4EJT A;  1G4D A;  4IXA A;  4BAY A;  1KQ9 A;  3N4M A;  3F8N A;  3FF5 A;  1HW1 A;  2O0Y A;  2XRO A;  2FA5 A;  4ESF A;  3F8F A;  3M9A A;  3IRQ A;  3MZY A;  2RQP A;  1YIO A;  3RPQ A;  5DDG A;  1KYW A;  1D3Y A;  2J5P A;  4AVP A;  1HST A;  1TQI A;  4ENJ A;  4ON0 A;  4S05 A;  1T0F A;  3PQK A;  2DAO A;  4HLY A;  2O8X A;  3VEP A;  4U88 A;  4A0Y A;  5D6E A;  2X0L A;  5ILS A;  5E8G A;  3GF2 A;  3DPL C;  1B59 A;  3MCZ A;  1OYW A;  2XAH A;  3ZMV A;  2JPC A;  2IVM A;  1O3R A;  5CJ9 A;  1XD7 A;  2FE3 A;  1J2X A;  1HBX G;  4ESB A;  1AOY A;  4ZZD A;  1O7L A;  4U0V A;  4HV6 A;  4I0A A;  1XGS A;  2F5D A;  4UNO A;  1G3Y A;  4RS8 A;  1XSX A;  5FLX K;  1J9I A;  2VE8 A;  4UUV A;  2P5K A;  2L3D A;  3T5X A;  3ZMT A;  3IWF A;  4Q48 A;  3C1D A;  1FOK A;  2CW0 F;  3BPV A;  4R8H A;  2DPU A;  1CGP A;  2MA3 A;  1FNN A;  4UXN A;  3SXY A;  1R5G A;  1XDS A;  5FFX A;  1I6X A;  1Z1D A;  5IT9 Z;  2EA2 A;  3SZP A;  3HYI A;  1ZHF A;  2COM A;  1UHW A;  1SMY F;  1TBX A;  4HQM A;  3O3K A;  2QM3 A;  3QOP A;  2FOK A;  4R1H A;  4M6Y A;  5D5V B;  1RUO A;  4F7Z A;  2NYX A;  5D4R A;  4U0Y A;  4EJU A;  1W5T A;  1MD0 A;  2JRT A;  2QBY B;  2PG4 A;  3V7C A;  3V4G A;  3ECO A;  3GZ6 A;  2GA1 A;  2DI3 A;  4EM1 A;  4GYG A;  2D45 A;  2R7F A;  1LEA A;  5ERI A;  3DF8 A;  3HSR A;  4HDU A;  1IXS B;  2EFW A;  2E1C A;  4HV5 A;  1MZB A;  2HS5 A;  4XLN F;  3KEQ A;  4BHB A;  2CFX A;  4HF1 A;  1FT9 A;  2LNB A;  2YU3 A;  3GVA A;  1XMA A;  2NNY A;  2M8E A;  3J81 Z;  2VBW A;  2Z5U A;  1LQ1 A;  3WTU C;  3KFW X;  4CIC A;  1IUY A;  5EEH A;  3PFI A;  4M72 A;  3CJN A;  2A6H F;  4RB3 C;  4ZYH A;  1EV7 A;  3L09 A;  1FP1 D;  1ZRE A;  5TJJ A;  3WGH A;  2YX4 A;  1NHA A;  5IT9 K;  3K69 A;  4M9X A;  3FXU A;  4OOI A;  4UV9 A;  5L3C A;  2HTJ A;  1BC7 C;  5AIQ A;  2V79 A;  4EM0 B;  2HWV A;  4G7Z F;  1JXS A;  2LSO A;  2OAZ A;  2DO7 A;  1XMK A;  5EEG A;  2BEO A;  2MBF A;  3SHF A;  4EJO A;  3KP7 A;  1ZG1 A; 
#chains in the Genus database with same CATH topology
 3I4M J;  4BAC A;  4NQW B;  3ZQI A;  2ECC A;  2EV6 A;  3OYD A;  1D0Z A;  3SFZ A;  2EIK H;  2XAJ A;  3QU6 A;  4GRI A;  4ZYA A;  4XRS G;  1AHD P;  1TC3 C;  3F8C A;  3EET A;  4X1E A;  5M5Y J;  3I5U A;  2G7U A;  5KHD A;  4FT8 A;  5J1R A;  3NAR A;  4N9I A;  1Z05 A;  4RBO A;  1JKQ C;  5DM7 F;  4LOC A;  2GM4 A;  2LRE A;  2OUM A;  1X2M A;  1HSJ A;  4D0P A;  1MH4 A;  3H0D A;  3B6A A;  2E60 A;  4HDV A;  5J40 A;  2VQL A;  2EZK A;  1ZEL A;  3WTW C;  4DZP A;  2J5O A;  5E20 A;  5CVJ A;  1ACI A;  3NAU A;  1BOA A;  2ZSH B;  1LUJ B;  1YW8 A;  3H9Q A;  3FDY A;  4XKC A;  2IPQ X;  3H5R A;  4HX4 A;  4IHS A;  3WU1 B;  5FD6 A;  1FJL A;  1BW5 A;  3AG2 H;  2IRF G;  5GP9 A;  1T38 A;  4FET A;  3D1N I;  1IN5 A;  2DW4 A;  1W0U A;  2XB0 X;  3IAM 2;  1ERD A;  2EIL H;  2M7B A;  5IYB J;  1SD4 A;  3GBG A;  3IAS 2;  2HVR A;  2WBM A;  4KIF A;  1KQ8 A;  3BG6 A;  3TP3 A;  4KDP A;  4NC7 A;  2M30 A;  2NVX J;  1JT6 A;  2CUJ A;  2DK8 A;  3BY6 A;  2L9R A;  2A61 A;  3DFG A;  2CG4 A;  3HG9 A;  3CJT B;  5J8F A;  1MNM C;  3BR5 A;  3OV8 A;  2CH0 A;  4OIP F;  5FLM J;  3JSO A;  2CMP A;  5J4V A;  4II3 A;  4G94 A;  2VUM J;  1HQC A;  3VSK A;  3HBL A;  3HRS A;  2P5V A;  4MTD A;  4PSX A;  4IHY A;  1BN5 A;  4AIK A;  2F5C A;  2ZJR F;  2DMU A;  3DTI A;  4C3I J;  4RGX A;  5DUK A;  1FYL A;  5E79 C;  1YIJ I;  2AQE A;  4HNT A;  4MFD A;  2NOG A;  3I64 A;  3C2H A;  5EYR A;  3JRF A;  2KIU A;  1HLV A;  2XAU A;  4RAF A;  4CGZ A;  1R1V A;  1V54 H;  1MKM A;  2MH9 A;  3ZQQ A;  3ZQG A;  2HTS A;  5GTH C;  1OCP A;  4PJJ A;  4M6V A;  4CXF A;  2EFP A;  1XSD A;  4LG0 A;  2UZK A;  1OFC X;  2OPT A;  3F6O A;  4ZYG A;  4IRI A;  1HCR A;  2V9V A;  4BQN A;  2VC0 A;  3F0C A;  4E4H A;  3V7R A;  1P2F A;  1SFO J;  4S0H B;  2B9S A;  5JR3 A;  4XRS A;  3NQO A;  2HQN A;  2FQ3 A;  4EV0 A;  2ISY A;  1UFM A;  2NVY J;  1PUF A;  1PVE A;  2BE5 F;  2QYO A;  3LFU A;  1KQ0 A;  1Q1V A;  1LVA A;  2KRH A;  2ZBK A;  1P6R A;  4IOC F;  1FMV A;  3S3N A;  1X3Z B;  4F93 B;  2OD5 A;  1ZLJ A;  1OKR A;  2Y0M A;  1JUS A;  3S1M J;  3CCQ I;  1IRZ A;  3L2R A;  2MW8 A;  4L0Y B;  2DJI A;  3CUO A;  2STT A;  2YU9 J;  2XAF A;  1AA7 A;  2ZFW A;  1PJR A;  2OJE D;  5ICF A;  2IAI A;  3L2C A;  4P96 A;  4KFC A;  3CCV I;  1GV2 A;  1D5V A;  3DTE A;  3FBI B;  2BY2 A;  1R4N B;  4Y13 A;  4IVN A;  2ESH A;  1JKO C;  1HKS A;  1R5H A;  3PJR A;  3K4M A;  1Y1V J;  5F0H A;  3REO A;  2AQF A;  3K4B A;  3F23 A;  2JTV A;  2H94 A;  2VOD A;  3IV5 A;  1GUU A;  5TIS C;  4AU7 A;  4EGZ A;  1ZH5 A;  3WOD F;  2FBH A;  1LKX A;  3KP3 A;  1YS7 A;  2IA1 A;  5A2Q K;  2QBY A;  3J7Z I;  3CCS I;  1NK2 P;  2W7N A;  2DA5 A;  3GFM A;  1IZ1 A;  5FKM A;  3KET A;  2W1O A;  3BLY A;  4JQF A;  2X1C A;  5HLG A;  2X6X A;  4C2T A;  2Z2S B;  2DFI A;  2VKE A;  1E17 A;  2PJR B;  1CF7 B;  4BH9 A;  3ABT A;  4C9Y A;  4FCY A;  3MZH A;  2XB5 A;  2DMN A;  1QQI A;  3KYL A;  4WWC A;  4FE7 A;  5IOY A;  3FXQ A;  3MD2 A;  3DEU A;  4XID A;  2VN2 A;  4A93 J;  3ISP A;  5E8I A;  5M3M J;  4ENM A;  1SFK A;  3BT9 A;  5C4X J;  2QA4 I;  4B43 A;  3IHU A;  3PM1 A;  5CVI A;  4RLF A;  5LLQ A;  4RB2 C;  3LL7 A;  1ZN2 A;  1UST A;  2KIF A;  3EQL F;  3K6G A;  5E1Z B;  4WXC A;  4F52 A;  4HSR A;  2YPR A;  2O6G E;  2IP2 A;  2XAS A;  2ELH A;  4KN4 X;  2P81 A;  1MW7 A;  1BM9 A;  3GZN B;  5K7F A;  4PJN A;  3QRF F;  2IA0 A;  1UB9 A;  3BR6 A;  4AID A;  4YEJ A;  5FJ8 J;  5F04 A;  3F72 A;  1Y8Q B;  4YFN F;  2HYJ A;  2JMW A;  4CYC A;  4UB6 C;  1Y1W J;  5DUI A;  3LAP A;  3N97 A;  4UVC A;  3O8G A;  3HGG A;  1YX5 A;  3PNY A;  3TQN A;  3OYB A;  1AWC A;  1BI2 A;  2JSC A;  1PUF B;  4N4O B;  5IYD J;  1TNS A;  3AG3 H;  4NBQ A;  2JPB A;  3UKG A;  3PFY A;  3WTZ A;  5C44 J;  2IS4 A;  4MEX F;  3ZCO A;  2ID3 A;  3AKZ A;  3J80 Z;  1L3L A;  1U5T A;  2KJC A;  5B5E C;  2IGN A;  2VBX A;  2O5R A;  2CWE A;  3OOU A;  1RR8 C;  3HXL A;  3GTO J;  3ELK A;  3LA3 A;  3K7A J;  5FLV A;  4PGG A;  3KYC B;  2HOE A;  3EUH C;  3WTS C;  4UB8 C;  4N4N B;  1V5E A;  3TDZ C;  4KYW A;  3H3Z A;  1X3W B;  2DTR A;  4HST A;  4L9V A;  3IP4 B;  3QU3 A;  4E7J A;  5HS8 A;  5J8C A;  4X0G A;  4IOA F;  1A04 A;  4ANJ A;  3C18 A;  3K2Z A;  2NS0 A;  3O2P E;  1XCV A;  1J59 A;  3I59 B;  2C6Y A;  1F4K A;  4YFX F;  3HKZ N;  4EM2 A;  1ZGW A;  2E5N A;  3ZQF A;  3MQ0 A;  2Z3Y A;  1TP4 A;  3I58 A;  3EYY A;  1T98 A;  5H20 A;  3BRO A;  3KPH A;  3OS1 A;  1PP7 U;  3P9K A;  3R4K A;  3JW4 A;  2EBI A;  2QGU A;  4G6D A;  4CDG A;  1S9H A;  2VI6 A;  1EH8 A;  3I4P A;  3KE2 A;  4DNC A;  3GW2 A;  3L2Q A;  2E2I J;  3E6M A;  2V7F A;  3FM5 A;  2Y48 A;  4EJW A;  1MIJ A;  2PEX A;  1I1G A;  1QPM A;  3DLL F;  2MD0 A;  2DXI A;  5F08 A;  5FKK A;  2ZJQ F;  1R9T J;  1UZC A;  2P8T A;  2LG4 A;  1OMI A;  3S32 A;  4MFE A;  4ITV A;  3E6C C;  3CF2 A;  3H35 A;  5DM6 F;  2ZXJ A;  3PSF A;  5HLT A;  1SD6 A;  1OYY A;  4BXU A;  3GME A;  4ETS A;  2VAS A;  3OL3 A;  4GYI A;  3B02 A;  3HOS A;  2JA2 A;  1RRJ A;  3Q9S A;  3GLX A;  4UUT A;  2YR2 A;  2VON A;  4C2U A;  1GDT A;  3PO3 J;  3QYB A;  3S2H J;  1W7P A;  2W84 A;  3VOE A;  3OYH A;  1J0R A;  2OCE A;  3VWB A;  3M1E A;  2D1H A;  1U78 A;  2F2E A;  2MAB A;  3CUQ A;  2RGV A;  1FMW A;  3K9T A;  4LG3 A;  5C4J J;  3CCM I;  3WTX C;  1DGR M;  5GAD J;  3IRR A;  2LKX A;  1EH6 A;  3AAF A;  5E18 F;  4G12 A;  4OWR B;  2NRA C;  1FTT A;  1TWC J;  1DQU A;  1VQ8 I;  3DBR B;  1Y39 A;  2DT5 A;  2E1O A;  2X9D A;  4NDL A;  1TL8 A;  3AG1 H;  3TO6 A;  3IKV A;  3K10 A;  2CJJ A;  4RM2 A;  1YI2 I;  5FRN A;  1YHQ I;  1FOW A;  1TW3 A;  2JWT A;  1STZ A;  3WE2 A;  3HOW J;  1BIA A;  5K5O A;  1IG7 A;  3M7G A;  3N05 A;  5FLX Z;  3DBL B;  1RKT A;  2CQX A;  3P7N A;  3QYF A;  4I98 B;  3GTM J;  2K3F A;  3TP0 A;  4XLP F;  1MH3 A;  4BHC A;  3GUD A;  4CHU A;  2IW5 A;  4F3Q A;  1K7A A;  4BEH A;  2X6W A;  1P92 A;  3S1N J;  2QCO A;  4PJ0 C;  3WHB A;  4R79 A;  2OC6 A;  1IC8 A;  1BR4 A;  1BC8 C;  1U5T B;  3OSG A;  5EF6 A;  2HVS A;  1VF9 A;  2JJ7 A;  4D5F A;  2VXD A;  4OIQ F;  1O3T A;  1OLT A;  4CCJ A;  1TQM A;  4FQG A;  3I71 A;  5EZH A;  1Q1H A;  2Q2E B;  4CO8 A;  1XX5 A;  1FY7 A;  1Y6I A;  3QPS A;  4YEL A;  3CCL I;  2R7D A;  2WAE A;  4BDZ A;  3G1M A;  2QF7 A;  3IKT A;  1BR1 A;  1YE9 A;  2DOD A;  3VPR A;  5EZG A;  4DGW B;  4XN0 A;  4A3D J;  1VQM I;  1J7K A;  3DKY A;  2Q2E A;  2FXA A;  3OYM A;  1M1E B;  2OZU A;  5LRR A;  2A69 F;  2FJ1 A;  3CCJ I;  1O4X A;  2H6C A;  2H8W A;  1DGW Y;  2OBP A;  3ASN H;  1GLN A;  3W2W A;  4XMY A;  5EJC A;  2GWR A;  4M3D A;  3EUH A;  5AIP A;  3RQI A;  3HOU J;  2GXA A;  3AFH A;  2JRM A;  2VPR A;  2QWW A;  2HZD A;  3IWZ A;  4PFO A;  5L3F A;  5LGN A;  3OIQ A;  2GAU A;  1NTC A;  1F5T A;  1UEL B;  2JQ7 A;  1R1U A;  4M6X A;  2HXI A;  1YG2 A;  3SZT A;  2WB1 N;  3FK6 A;  1R5I D;  2ID6 A;  4HAM A;  4YII A;  3LSM A;  4HW0 A;  2XSD C;  1KU3 A;  2JA5 J;  3M3Y J;  3IUO A;  3KP4 A;  2CRG A;  1ETQ A;  2E36 A;  4NC6 A;  3OYF A;  1C0W A;  3OYL A;  3ULQ B;  1OCC H;  2EIN H;  1IW7 F;  5F1J A;  2B7E A;  3S15 J;  4F92 B;  1LEB A;  5E3L A;  4A3F J;  2NVQ J;  4MO7 A;  2KIS A;  3M07 A;  4XOP A;  1FP2 A;  1USS A;  3RZO J;  5GAH J;  5B1A H;  3GYH X;  4NNJ A;  1N75 A;  5AON A;  2HOA A;  4BXX J;  2ELJ A;  3BJO A;  2DFF A;  3CCY A;  3DBH B;  4HOB A;  3ZMZ A;  4A3L J;  2FD5 A;  4CYD A;  4BKX A;  3OYN A;  2DYS H;  1BA5 A;  1K61 A;  1HKQ A;  2CQK A;  2HU9 A;  2KLO A;  2RDP A;  1IUF A;  1SVO A;  5IP7 J;  4A3J J;  2Y9Y A;  1LNW A;  4A6E A;  3H36 A;  2JA8 J;  2Q1Z B;  2DBB A;  4UUS A;  4A0X A;  2MYS A;  2FF4 A;  3CUQ B;  5TGT A;  1T56 A;  1W5C C;  4QLC U;  4PCQ A;  2ISZ A;  4L18 B;  2CV2 A;  3BZ6 A;  1YIT I;  4L9N A;  1GT0 C;  4PJM A;  3BG5 A;  1IDY A;  1U3E M;  2RRE A;  4D7N A;  3P9I A;  1OIS A;  4B44 A;  4UV8 A;  4KUM A;  2K4J A;  4XLH A;  1OYI A;  1MJA A;  2IJL A;  1K78 A;  2EK5 A;  3ASO H;  1ON2 A;  3TW6 A;  5M3F J;  5J1Y A;  3LFK A;  1B6A A;  4GXO A;  2WAD A;  2DA4 A;  1QGP A;  1WQ2 A;  3TOB A;  2K02 A;  2X4H A;  3BZC A;  4LIU A;  2W24 A;  3A0B C;  2F48 A;  2E5Z A;  4JP0 A;  4BJ5 C;  3JR9 A;  4BE2 A;  3I55 I;  2B63 J;  2Z1D A;  1SEU A;  3DQV C;  2PX9 A;  5E3M A;  2NVT J;  1N77 A;  3S16 J;  1W36 D;  1RUN A;  3WG9 A;  2VBY A;  3H3U A;  2XKO A;  1B9N A;  3L9F A;  3HTU A;  1D8J A;  1RNL A;  4QTR A;  4QWQ A;  4KIS A;  3X2Q H;  3VYR B;  1KU2 A;  4KIC A;  3W6K B;  4L9J A;  4LG0 B;  5DV5 A;  4A3E J;  2VE9 A;  3COA C;  4A12 A;  4G6Q A;  2FEZ A;  3JCU C;  4KJZ A;  1FBU A;  3LSK A;  3H0G J;  5LGU A;  3FIS A;  1G3W A;  4ESJ A;  5CVU A;  2FMY A;  1LFP A;  4IZZ A;  3S3O A;  3QPL A;  4A69 C;  2DMT A;  2MD5 A;  3HOZ J;  1QPI A;  4JYK A;  1ITY A;  2STW A;  4LLN A;  2QVO A;  4G8X A;  1OR7 A;  5L3G A;  3HHH A;  1W7P B;  2DK5 A;  4S04 A;  3PNT A;  4KMU X;  5EGO A;  3ZPL A;  3HIF A;  5M5W J;  3U21 A;  3L2U A;  3Q0U A;  2F5F A;  2ZNY A;  1TWA J;  1YS6 A;  3GCM A;  4XOR A;  2F4I A;  3K1N A;  1ZRD A;  2XRN A;  1Y0U A;  3BG7 A;  5DD8 A;  4B8X A;  3MEX A;  1LFU P;  4P5O A;  4UVA A;  2CUE A;  3M8F A;  1ULY A;  1FBS A;  1PP8 F;  2X48 A;  5DCM A;  1A5J A;  4I7H A;  2Y30 A;  5CKT A;  2CQQ A;  1WPK A;  4B47 A;  1KON A;  4WF2 A;  2UXN A;  4WCG A;  1ZRF A;  2W25 A;  3TKY A;  3HSF A;  2XPU A;  3LA7 A;  4QPQ A;  1A31 A;  1XGM A;  4M74 A;  2WWY A;  4BGD A;  2LKS A;  2V6C A;  3CMA I;  2DA1 A;  3KIO A;  2OV7 A;  1V4R A;  3NEU A;  5FGM A;  3JRH A;  3PUF A;  2M0M A;  1T0F C;  3HL2 A;  3PQJ A;  2KIQ A;  4YG2 F;  3CC2 I;  4LB6 B;  3L7W A;  2HVQ A;  1E2X A;  3ABK H;  4IEJ A;  3E6B A;  4C2M J;  1AKH A;  1RES A;  1H9T A;  4OMZ A;  2PLY A;  2EV5 A;  3I59 A;  3LMM A;  1IN8 A;  1I27 A;  3MKL A;  4ZYD A;  2BV6 A;  1BI1 A;  3JRD A;  1L0O C;  3EUA A;  3LA2 A;  1P4X A;  3FMR A;  1ZKG A;  4NQW A;  4PGH A;  3OYA A;  1SFE A;  1ZGJ A;  2PJR A;  2CSO A;  2KKO A;  1UCR A;  4O3M A;  1A36 A;  3GEZ A;  2QQB A;  3ML6 A;  3BQY A;  3TGN A;  4ZYE A;  1F9N A;  2F5V A;  1EKE A;  3OIP A;  2LR8 A;  4D9J A;  1JHF A;  2LBF B;  3FXK A;  2N8G A;  5L3E A;  1E0E A;  1LPQ A;  1QO0 D;  2MGQ A;  4WK8 F;  1DU0 A;  1RC9 A;  3U1K A;  2MFZ A;  5D6F A;  4IJA A;  2WA0 A;  4RA2 A;  3V8J A;  2D1V A;  4DJA A;  1LB2 A;  4GFB A;  1KGS A;  4CYC B;  4XKW A;  2FML A;  3JRG A;  2B0L A;  2X1D A;  2L9N A;  2BVL A;  3A02 A;  4DYC A;  2HXO A;  2XIG A;  2ZXI A;  3LQQ A;  2LY9 A;  4OU0 A;  3GTK J;  2XGE A;  4CA0 A;  3H5A A;  1I6H J;  1YFH A;  4M71 A;  1UHM A;  1MND A;  4J01 A;  2VJI A;  1G3T A;  3QOD A;  4JX4 A;  3RIR A;  4DBR A;  2W48 A;  3WGI A;  4MEY F;  1P7I A;  4CH7 A;  3QPT A;  4DQ2 A;  3WTY C;  2VKH A;  1T6S A;  2QEN A;  2CUZ A;  3R60 A;  2H6B A;  5KK1 A;  5CQG A;  2LY2 A;  4BDY A;  1EH7 A;  2R5Z A;  3EPZ A;  4AM3 A;  4HPQ A;  2L4A A;  4MNU A;  3QWL A;  3ZN1 A;  3OMY A;  2VJ5 A;  2D5V A;  1Z91 A;  1KU7 A;  1JHH A;  1XS9 A;  2KDO A;  4BE0 A;  4E70 A;  3RTR A;  3JAM Z;  5IPA A;  2HOT A;  1XG1 A;  3KYD B;  4A5M A;  2P6T A;  2TDX A;  4Q47 A;  2JA7 J;  4AYB A;  1I39 A;  1T33 A;  1RZ4 A;  2V9K A;  2DQR A;  1K83 J;  1QVU A;  2RQQ A;  2HDW A;  5LHH A;  3TO7 A;  1G3S A;  3FWE A;  1R1T A;  1SFX A;  3SFI A;  1BR2 A;  4L0Z B;  1W1W E;  2D2W A;  3E3V A;  4M3F A;  2L01 A;  3RKW A;  1XGN A;  4HA8 A;  2L7Z A;  4I09 A;  1NH3 A;  5FKO A;  2KRF A;  4A6D A;  4U0W A;  2BHZ A;  2KMU A;  5K7Z A;  3CDL A;  5CLS A;  2ZC2 A;  4BS9 A;  2ZO4 A;  5K1Y A;  4LK1 F;  1X1P A;  3K1M A;  2E7X A;  2R92 J;  3PNV A;  5DEQ A;  2L9V A;  2DCE A;  1LDD A;  4Y15 A;  4LK0 F;  5A2Q Z;  1HW2 A;  4HF2 A;  4HNU A;  3DPT A;  3FXR A;  3SEZ A;  3CZ6 A;  2UV1 A;  3ZMU A;  2HYG D;  1YJN I;  1J09 A;  2MLG A;  2GLO A;  1VZ0 A;  3GWZ A;  4AD9 A;  4EAT A;  2XPW A;  4ABZ A;  2VT3 A;  1PUE E;  3HZJ A;  1VQ5 I;  2R3S A;  5JHF A;  1LFB A;  3T0Y A;  4UVB A;  1BI3 A;  1MMN A;  5C3E J;  1QVT A;  1O3Q A;  5LGT A;  1VQL I;  1QZZ A;  3FBN B;  5ED4 A;  4DIQ A;  2HEO A;  1XMX A;  4LIV A;  2L02 A;  1I3A A;  2F4O B;  3OL4 A;  1D5Y A;  5J4Y A;  1H8A C;  5J6X A;  2BW3 A;  1YX3 A;  2DT6 A;  5B66 C;  2P7V B;  3HOV J;  1ETY A;  2OTL I;  3RJP A;  2BOL A;  3E6D A;  1U0J A;  3BJA A;  2KJB A;  3S93 A;  3BR2 A;  2ME6 A;  1JKP C;  4ZC3 A;  2VIX A;  5D5U B;  3GFJ A;  2LYC A;  4FAS D;  2XPV A;  5HNH A;  4XIC A;  2K9S A;  3SDB A;  3HM5 A;  3I54 A;  3RDI A;  1OCR H;  2LD5 A;  1FYK A;  2BZT A;  4RAZ A;  1MBJ A;  3FK7 A;  1ZGA A;  1P4A A;  2Z33 A;  1U9N A;  4Y4R A;  4M3E A;  2EV0 A;  1R71 A;  2DOE A;  3MZ8 A;  3F8M A;  3JRI A;  2R7V A;  3HKZ A;  2X6Y A;  3R61 A;  4KT6 A;  4F91 B;  3G71 I;  5B3S H;  4E7H A;  2KQR A;  2QQ8 A;  2H1K A;  2DU9 A;  2BHY A;  2JSP A;  4XLF A;  2E34 A;  3RPU A;  5GTI C;  2P7C B;  2BVM A;  2R4G A;  1MSF C;  2IGM A;  1N78 A;  3SYT A;  3Q5F A;  1LDK B;  2E19 A;  5HS7 A;  3FKI J;  3W6V A;  4BE1 A;  1B9M A;  3DPU A;  3QOE A;  1XN7 A;  5HDK A;  4LLL A;  3QQA A;  3I4N J;  4BXF A;  1TZL A;  1YYV A;  1IN4 A;  1Z7U A;  3JRC A;  2R7R A;  4NB5 A;  2XF6 A;  3CTA A;  2Y0S A;  4LMY A;  5ILV A;  1MMD A;  5F64 A;  2TRT A;  5DD4 A;  4WXD A;  4BYY A;  1FSE A;  3VYT B;  1IN6 A;  3BTI A;  2DT7 B;  2Y2Z A;  3CUQ C;  2I8D A;  5LFA A;  3ZMD A;  2HOS A;  3DXJ F;  2MC4 A;  4Z2Y A;  4NHJ A;  3JRA A;  3CC4 I;  1VQ7 I;  3H3V K;  3IH4 A;  1X3U A;  2O7O A;  1NG6 A;  2P5L C;  4MQ9 F;  2IBD A;  3D5R C;  1FSH A;  2DA7 A;  1OQY A;  3V7S A;  5DS9 A;  5L3D A;  1Z67 A;  3PUB A;  2KRC A;  3TL4 X;  1V55 H;  4ZZL A;  2R5Y B;  1FX7 A;  2XGD A;  4K2E A;  4XRM A;  4I01 A;  4CZC A;  5IT3 A;  4HF0 A;  2GXB A;  4E7I A;  4GGG A;  2ZNZ A;  4ZH4 F;  4XOT A;  3MVP A;  4LB5 A;  4YIF A;  1WJB A;  2JVG A;  1O3S A;  3VYU B;  4XLC A;  3WG7 H;  1WJF A;  4RDU A;  5K5R A;  3KZZ A;  2DPD A;  1IAW A;  3K70 D;  1H9G A;  1D1B A;  2NS7 A;  2A05 A;  2PMH A;  5FRO A;  3ABM H;  4RAY A;  1DPR A;  3OS2 A;  3G1L A;  1IRF A;  2M2E A;  1S72 I;  1T8I A;  2Y31 A;  1YQA A;  2L4M A;  5LEK A;  2RKH A;  4BUP A;  2LF7 A;  2K9M A;  2XGX A;  4G9Y A;  1SFU A;  3BDD A;  4D1Q A;  2YSR A;  2R7U A;  2E2H J;  1MNE A;  1Y8R B;  3U9G A;  1YJ9 I;  3G3Z A;  2HFH A;  2QSG X;  2CGP A;  1KYZ A;  3S1R J;  1HDD C;  5LD2 C;  1ZAR A;  5D5W B;  4JBA A;  2YX7 A;  1E3O C;  1QHH D;  5LHG A;  1Z6R A;  1G2H A;  3OR2 C;  3ZQL A;  4B48 A;  3HDD A;  2XKP A;  1ZG5 A;  4C3J J;  4KIB A;  3E5Q A;  3ZMS A;  3PSI A;  1VQ4 I;  2LRD A;  1H89 C;  4KN7 X;  1Z3X A;  1JUM A;  3V8K A;  3G4S I;  4QIW N;  1FIP A;  2K9Q A;  4XRF A;  4D5C A;  5BPD A;  2NNN A;  4GO1 A;  3H92 A;  3M1C A;  2NS8 A;  1Z0X A;  5ICC A;  1VQO I;  1U5T C;  3TMO A;  5GAG J;  2R5Y A;  1IGN A;  2HZT A;  4IRG A;  5D8L B;  2ACJ A;  3KP5 A;  9ANT A;  4IL6 C;  3MKZ A;  4J19 A;  4I02 A;  1VFC A;  3CJQ B;  4BBR J;  5HDN A;  2H1L A;  3LSR A;  1YLF A;  5FD5 A;  5BOX A;  4RB1 A;  3S17 J;  1WHU A;  2RN7 A;  3D5S C;  3KLO A;  1H0M A;  3CJR B;  4L5E A;  1W7P D;  4DW6 A;  1RET A;  3HB9 A;  4DOZ A;  5ICG A;  3DU6 A;  2NVU B;  2DDB A;  2M9H A;  2HKX A;  2FOW A;  1XTA A;  1U8B A;  1ETV A;  2FRH A;  2V9P A;  3ERE D;  4IHX A;  3WU0 A;  4LD5 A;  2WV1 A;  1R36 A;  4BQA A;  1WRJ A;  4G7H F;  1FBQ A;  2XRL A;  1REP C;  5EG0 B;  1QZE A;  4RMN A;  3Q0V A;  3GTQ J;  2OU2 A;  5JI6 A;  1HDP A;  5D4S A;  3D5L A;  4L5I A;  2VPL A;  3BR1 A;  1LVK A;  2OZ6 A;  3E5X A;  2KL4 A;  1T08 B;  4M3B A;  1JGS A;  2K40 A;  2M87 A;  4CCO A;  4IHW A;  2ZJP F;  2L7M P;  4OIO F;  4CCL A;  1TQP A;  4UHT A;  3A01 A;  5LRS A;  3RKY A;  4A2U A;  1ZLK A;  2JA6 J;  5CPR B;  3OIO A;  2A5W A;  3RYP A;  4AC0 A;  2A5Y B;  4EQQ A;  2GOM A;  3CP8 A;  4BY1 J;  1GHC A;  3K4N A;  2XSJ C;  3RI4 A;  2O61 A;  4HQE A;  2VT2 A;  3CCU I;  4IQ4 A;  1WVR A;  2RAE A;  1MBF A;  2GBY A;  3BP8 A;  1IF1 A;  1R7J A;  2FQ4 A;  1V5G A;  1ZG3 A;  1X1D A;  1XC5 A;  3BPX A;  3CO7 C;  1W0T A;  3BWG A;  1QBJ A;  1O7F A;  1RIO H;  1X4O A;  1FIA A;  2M3A A;  2E1M C;  4A0Z A;  5EGO B;  3FMS A;  3W2A A;  3HSE A;  2M8G X;  2MG4 A;  1CQT A;  1FWZ A;  1FOY A;  1Z6T A;  1IXR C;  2TCT A;  2FUG 2;  3C2B A;  2ZFU A;  3FM3 A;  2GXG A;  1F1Z A;  4A3M J;  2F5E A;  4BU2 A;  2DN0 A;  3BG9 A;  3LWF A;  1ZRC A;  2GQQ A;  3J7A Y;  3T8T A;  3E0J B;  3L00 A;  3FXJ A;  3GTL J;  4DYR A;  2XAG A;  2R7T A;  5HOO A;  1K6O A;  4ENK A;  2E71 A;  4YIR X;  1BL0 A;  1T95 A;  2K7L A;  3HOX J;  2G9W A;  4A3G J;  3I3L A;  1R22 A;  5GPC A;  2HR3 A;  3K2A A;  3KLN A;  1APL C;  2MC3 A;  1HA8 A;  2O8K A;  2WB1 A;  3ECH A;  2KT0 A;  1ZK8 A;  3WE3 A;  1JJ8 C;  2IGK A;  2V1X A;  4Y52 J;  2ZJ2 A;  4ENN A;  2XAQ A;  1MSE C;  3DP7 A;  3WTV C;  3KZI C;  2EJR A;  2G7H A;  2UXX A;  3NWT A;  3KP2 A;  4XSX F;  4KA4 A;  2CW7 A;  5KVR A;  1WZ2 A;  1A6I A;  2OTJ I;  2ESN A;  3CP2 A;  2XVC A;  1OR7 C;  5DCM B;  3SJM A;  3JTG A;  4KMF A;  3GX4 X;  2Y75 A;  2F4M B;  3E7L A;  2KHM A;  5JLX A;  3ROU A;  4HRI A;  1OCZ H;  4OIN F;  1K78 B;  1F43 A;  1ZYR F;  4AWX B;  4B09 A;  2E7W A;  3F21 A;  3MN2 A;  3EYI A;  4E7S A;  2NXN B;  3MAJ A;  2RC4 A;  2WAQ N;  2WC2 A;  3OSF A;  5HDG A;  2NOJ B;  1B8I A;  3U2R A;  5FKL A;  3ABL H;  3EDP A;  3SQN A;  4C30 A;  1SMT A;  3CF5 F;  2EB7 A;  3BC8 A;  2E1N A;  2R7Z J;  2FSW A;  2LF8 A;  4KIG A;  1GXQ A;  2ZME C;  4KT5 C;  3KEO A;  1N25 A;  2CW8 A;  3WHC A;  3CME I;  3VOD A;  2BXY A;  2MSY A;  3CMM A;  1OPC A;  4CCK A;  5J47 A;  3W6J B;  2DFE A;  3I53 A;  2G0E A;  1B4A A;  1MDM B;  3F22 A;  2QSF X;  5D5X B;  1X19 A;  2RNJ A;  3BCA A;  3OYE A;  3BCB A;  3O6B B;  1XCB A;  3LAJ A;  5E3O A;  4MQV A;  1MMA A;  3FHN A;  1JI8 A;  1MBG A;  3HGY A;  4BJ6 C;  1V3F A;  2W57 A;  3A1Y A;  1S3J A;  2ELK A;  2K85 A;  2KIM A;  3NRV A;  2L0K A;  3RQ4 A;  2AXT C;  4EJV A;  4PUS A;  1I1S A;  4MHG A;  1X4P A;  2CQN A;  2QUF A;  3Q0W A;  1J75 A;  2RVC A;  1BIB A;  3T1B A;  2E35 A;  3J80 K;  5ILU A;  2WTE A;  1VI0 A;  1HF0 A;  1MJ9 A;  1K79 A;  3TO9 A;  4O6J A;  3GFL A;  3F6V A;  1U6G A;  2R7X A;  2WV0 A;  1MDM A;  2K86 A;  1Y56 A;  1KA8 A;  4DZJ A;  5H6R A;  4DYQ A;  3J7Y J;  1K4S A;  1FEX A;  3MWM A;  3BG3 A;  5DCF A;  4A3C J;  1ETW A;  4P1W A;  2EFN A;  2V1D A;  4P55 A;  3ESW B;  5BS6 A;  1MBH A;  4KNY A;  1R4M B;  4G7O F;  2OA4 A;  1ZQ3 P;  4IRH A;  1QA6 A;  3RPU D;  2DOF A;  2K4B A;  2L5Q A;  1E3P A;  5HLH A;  4A3I J;  1QNT A;  3CCE I;  4XQF A;  2UUZ A;  1VTN C;  1LE8 A;  1U8R A;  2R0Q C;  1ENH A;  2HKO A;  2HPI A;  4B1R A;  3QAH A;  2WY8 Q;  2YS9 A;  2QZ8 A;  2LH9 A;  5CYV A;  2X51 A;  2GIV A;  3WGG A;  3B6C A;  3V8L A;  3HOT A;  1T2K A;  4A3B J;  3C3W A;  4OIR F;  2LKP A;  4BHP A;  4ZTF A;  1T39 A;  3FMQ A;  2OF7 A;  1DUX C;  3BJ6 A;  2DMP A;  1QRY A;  2WY7 Q;  4U7D A;  2VC1 A;  2EZL A;  1PDN C;  2A6E F;  1DDN A;  2M4K A;  1FLI A;  1WWX A;  5EEA A;  3MKY B;  4WX9 A;  1JKR C;  4A3K J;  5HLI A;  3S1Q J;  3OYI A;  2ME0 A;  1S5L C;  3OYG A;  4RB0 A;  1XSV A;  4AIJ A;  4HYE A;  5L3B A;  5JHU A;  2OQR A;  4OAY A;  3FXM A;  1S7A A;  3AG4 H;  3HRM A;  3RYR A;  2IT0 A;  5M5X J;  2PMZ A;  2QKL B;  5D8K B;  5FRM A;  1AU7 A;  1AKH B;  2ZXH A;  2XUB A;  4IX7 A;  2LC2 A;  3BOQ A;  1ZR4 A;  4EMS A;  2EQR A;  2W4S A;  4IHT A;  4YRV A;  2HGC A;  3DU5 A;  2P4W A;  2QKM B;  5GAE J;  2PJP A;  3HRT A;  4PK4 A;  1WJA A;  3RZD J;  2COB A;  1JE8 A;  3GFI A;  3TDU C;  3OR1 C;  2ICW G;  2GA2 A;  2R5Z B;  1DU6 A;  4XON A;  1HKT A;  4AVZ A;  4EVI A;  1HXD A;  2CUF A;  3H9G A;  1D1A A;  4NC8 A;  4FHT A;  2LOO A;  3OYC A;  3L2V A;  3CD6 I;  3HUG A;  1S6L A;  4HZF A;  3ONQ A;  4BJT A;  2BY3 A;  2K9L A;  1Z77 A;  3IC7 A;  1RI7 A;  4HX7 A;  1WSU A;  1SVM A;  2UWM A;  4F55 A;  3I56 I;  2KP6 A;  3QPH A;  3IL2 A;  4H0E A;  1R58 A;  1WJC A;  1MMG A;  1R6R A;  4XM3 A;  4E6K G;  2V4J C;  3SDG A;  2EFO A;  2ZSI B;  1FZP B;  1ODD A;  1JTX A;  2FX0 A;  3WTT C;  1WKM A;  2V1U A;  2NAZ A;  3K4J A;  2OQG A;  3KZY A;  1LDJ A;  2H8R A;  5BNG A;  2X85 A;  5JFR A;  3RSN A;  2XF7 A;  3DKW A;  3QP6 A;  2IS1 A;  4HLX A;  4H4K C;  2IS6 A;  4RGR A;  4I2O A;  3QP5 A;  5E1W A;  2QLZ A;  2L7K A;  3F3X A;  2JN6 A;  1HC8 A;  2M7A A;  4CSW A;  1BW6 A;  3FXL A;  2H09 A;  2L2O A;  4B3X A;  1WI9 A;  4I0B A;  1O57 A;  4ASN A;  1IXC A;  3OOP A;  5JLW A;  5ICE A;  3VDX A;  1FYM A;  4AUX A;  1SC7 A;  4O5V A;  2EWN A;  2XDV A;  3H5N A;  5H2F C;  2M1B A;  1QZY A;  4UY8 I;  1QU3 A;  2LP0 A;  3ZN0 A;  1LJ9 A;  2EZI A;  1UHS A;  2XF5 A;  2AO9 A;  3FX3 A;  4Q4Z F;  1FTZ A;  3VSL A;  4XR6 A;  1V5F A;  4MGR A;  2FU4 A;  4YFK F;  4IKF A;  2HQR A;  2EH3 A;  4Q5S F;  2JK3 A;  3F8B A;  3FKJ A;  1HW5 A;  2K27 A;  4FX0 A;  4RGS A;  1U2W A;  2WAQ A;  2PMU A;  4XL9 A;  5FO5 A;  1K4T A;  3LST A;  4FTH A;  1B72 A;  1UJ8 A;  2Z16 A;  4Y17 A;  4XBF A;  3JRB A;  5FFZ A;  2BXZ A;  2VBZ A;  4TV7 A;  1UMQ A;  3HJE A;  1GVJ A;  1S29 A;  1TT0 A;  3HRU A;  3CDI A;  4WXH A;  3GXO A;  2Z99 A;  1Z9C A;  2LVS A;  3CO6 C;  3JRE A;  3A4C A;  1SD5 A;  2AS5 F;  2W00 A;  3CLO A;  3Q9V A;  2V26 A;  3K0L A;  2AHQ A;  2R7Q A;  2VB6 A;  3F9K A;  4LIT A;  3K4L A;  4P9F A;  1I5Z A;  5F0F A;  1TNT A;  3CC7 I;  2ZME A;  4QPO A;  4AIH A;  3PL8 A;  3ZQ7 A;  3I0T A;  2IEK A;  2AXL A;  4Y7N J;  1KU9 A;  1XDU A;  1DP7 P;  3LSH A;  3D0S A;  2V6E A;  3G1O A;  3DTK A;  2GZW A;  2PN6 A;  5H6Q A;  3UNG C;  1YRN B;  1ON1 A;  4EGY A;  3HUG B;  4IF4 A;  2P6S A;  3M4O J;  4L9T A;  4IO9 F;  2CYY A;  1Z21 A;  1YW9 A;  2KFD A;  3GZ5 A;  4PZJ A;  1GXP A;  4XKV A;  2W85 A;  1U9O A;  1B1B A;  5BQT A;  1KZH A;  4MIM A;  3B73 A;  3GO5 A;  4BY7 J;  2M45 A;  1D8K A;  3E1S A;  2BBY A;  3CQZ J;  2L54 A;  3LOC A;  2M5W A;  2VXZ A;  4N0B A;  2Q0O A;  2ZKZ A;  2IA2 A;  3RKX A;  1R00 A;  1DP3 A;  4XLA A;  1TLH B;  4D7M A;  3L2W A;  1WCM J;  5DTD A;  1HOM A;  2QQ9 A;  3S2W A;  2VOO A;  2EFQ A;  3OYJ A;  3PIO F;  5F1R A;  3K1P A;  3G73 A;  3KP6 A;  3LNQ A;  3HTS B;  2BY1 A;  3R6S A;  1UAA A;  4GDF A;  1P9Q C;  3M8J A;  1XGO A;  2EA4 A;  2HYF A;  3IH2 A;  2DLL A;  4JK1 X;  4MTE A;  3HOY J;  4XKB A;  4U7B A;  3QYE A;  2I5U A;  1MGT A;  5F0C A;  3J7A O;  1VQ6 I;  2A3S A;  4OMY A;  3BR0 A;  2CU7 A;  4PDK A;  4ZJZ A;  4HBL A;  4HG2 A;  3S2D J;  1ZAO A;  4FE4 A;  1WJD A;  3PIP F;  4BNC A;  1TTY A;  1I3Q J;  3A0H C;  2LY1 A;  4P9U A;  1X58 A;  1WFX A;  4I76 A;  4M9Z A;  3VB2 A;  2PI0 A;  1IN7 A;  1X1C A;  2KZG A;  3OYK A;  3U1D A;  3TOA A;  4B3A A;  2H27 A;  1R49 A;  1TWH J;  2F6C A;  1YRN A;  4LFU A;  4M9S A;  5CVR A;  2FNA A;  4GCV A;  1LE8 B;  1YO5 C;  1TWG J;  3DEE A;  2ETH A;  4IPA A;  3FHZ A;  5HS9 A;  2PMZ N;  2PFB A;  3GTP J;  2JT1 A;  3PO2 J;  4E7L A;  2FBK A;  4BL0 B;  3KCC A;  1IV6 A;  3AL0 C;  2O9L A;  3JSP A;  1S8N A;  3C7J A;  3S8P A;  1NK3 P;  3T8R A;  3LSG A;  3SZG A;  3W3C A;  3LQR A;  4HX8 A;  1XB4 A;  1G6N A;  4LJZ F;  6PAX A;  1EJ9 A;  2ECB A;  3MFK A;  2DMQ A;  5FB2 A;  1CF7 A;  1UG2 A;  2BGC A;  5LHI A;  1WJ5 A;  2Z9O A;  4KIT B;  2LFB A;  1A35 A;  2LBF A;  2JVH A;  4B4C A;  2R7O A;  4ZDP A;  1YTY A;  1JGG A;  2VKD A;  1B72 B;  1W5S A;  1WH5 A;  3M8E A;  3JTH A;  1WI3 A;  3E97 A;  3GTJ J;  3R0A A;  2E2J J;  2MH2 A;  2DFH A;  3DLA A;  3CLQ A;  1P7J A;  3FIW A;  4RLQ A;  3W2V A;  2BYV E;  2HDC A;  1D0Y A;  4HNV A;  1TWF J;  4OAZ A;  4ZDL A;  2ZXW H;  2JZY A;  3J81 K;  1MBK A;  4E7Z A;  5KAI C;  1YW7 A;  3DV8 A;  4L5J A;  4A5N A;  3MKW B;  1D1C A;  4V2F A;  5HVQ C;  1S7O A;  2A07 F;  3ZOB A;  2ADU A;  4I6Z A;  3ZR8 X;  2DTZ A;  5BMZ A;  2BW3 B;  2VJ4 A;  1BJZ A;  4Z6Y A;  2CQ7 A;  4BQQ A;  2DOA A;  3DCF A;  3Q3S A;  5IOZ A;  2X6O A;  5KNL A;  1RKW A;  1OJL A;  4LGW A;  5EDN A;  1SD7 A;  3HHG A;  1I50 J;  5E17 F;  1R23 A;  2PQ8 A;  2DA6 A;  1BOB A;  4CZZ A;  1JJ6 C;  1TW2 A;  4XLE A;  2XV4 S;  5K5Q A;  3DEW A;  3JAM K;  3ZQC A;  5J3L A;  2M4G A;  3O8H A;  3HPH A;  3DWL E;  2DDA A;  1IRG A;  4ZDO A;  3CMY A;  5JVT A;  1QHG A;  5KCM A;  4LLG F;  5E1X A;  1ETO A;  1ETX A;  2M0C A;  2K3P A;  3E5U A;  5F6F A;  4N9H A;  1VQK I;  3P9C A;  1P4W A;  1SAU A;  4W1U A;  3TBI A;  5IP9 J;  5LEJ A;  3K4K A;  3ZXS A;  1BI0 A;  5JVG F;  3FZV A;  4JX5 A;  1BBY A;  1J5Y A;  2FBI A;  1GVD A;  3R0J A;  2HI3 A;  2V1N A;  3ABU A;  2QQA A;  5CVV A;  4JX6 A;  4XSZ F;  4NUB A;  1SAX A;  2LDU A;  4RGU A;  2RV8 A;  1FC3 A;  5HOD A;  3OS0 A;  3ZP5 A;  2Y0S N;  2Q8K A;  1W4M A;  2PBI A;  4CUG A;  2KZV A;  1A6Q A;  3EUK L;  4DBQ A;  1RPW A;  2GIZ A;  2WAF A;  2A6T A;  4CCM A;  2Y69 H;  1FPQ A;  2CV0 A;  2EIM H;  2O03 A;  2ZCW A;  2IXS A;  2P0W A;  5GPA A;  3CDH A;  2Y9Z A;  4FX4 A;  4RAG A;  1IV8 A;  4RM3 A;  5DYM A;  1MJB A;  5BPI A;  1DPU A;  2EZH A;  4ZTJ A;  4M73 A;  1ONV A;  1WGX A;  5LBQ A;  5FKN A;  2ZME B;  4XK4 A;  2A68 F;  1VQP I;  1ZR2 A;  1BJA A;  1VQ9 I;  2FNP A;  5TRD A;  3VFZ A;  2O3F A;  3NWS A;  2XHK A;  3ERM A;  1H88 C;  2VOP A;  3CES A;  2BY0 A;  2CO5 A;  2DQL A;  1K6Y A;  1ZTR A;  1YOV B;  2MLK A;  4EJT A;  1WJE A;  1G4D A;  4IXA A;  3P5J A;  1KQ9 A;  4BAY A;  3N4M A;  2CS3 A;  2DYR H;  3F8N A;  3FF5 A;  1HW1 A;  2IS2 A;  3BTL A;  2O0Y A;  2VJJ A;  3A03 A;  4PFP A;  2XRO A;  4C3H J;  2FA5 A;  4ESF A;  2DJN A;  3F8F A;  3M9A A;  1VND A;  2OCC H;  3IRQ A;  1XPX A;  3MZY A;  2RQP A;  3A01 B;  1YIO A;  3RPQ A;  4CCN A;  5DDG A;  3ZQH A;  1KYW A;  3RCO A;  3RKQ A;  1YJW I;  4IQJ A;  1D3Y A;  2J5P A;  2HNH A;  3BTJ A;  4FIS A;  4AVP A;  1ORK A;  2LMD A;  5EG0 A;  1FOX A;  1HST A;  1TQI A;  3ZGK A;  1Z7L A;  4ENJ A;  1WH7 A;  1X1B A;  2R7W A;  4ON0 A;  4AYB N;  4S05 A;  1T0F A;  3PQK A;  2DAO A;  4HLY A;  2HQ5 A;  3TW7 A;  5IYC J;  2O8X A;  3VEP A;  4U88 A;  4A0Y A;  5D6E A;  2X0L A;  4XNF A;  5ILS A;  5KAF C;  5E8G A;  3GF2 A;  4M3G A;  3DPL C;  2YUS A;  1B59 A;  1G8X A;  5F27 A;  3MCZ A;  2KPM A;  1POG A;  2HPM A;  4HEA 2;  1OYW A;  3S14 J;  3K70 C;  2XAH A;  3ZMV A;  3AL0 B;  3OY9 A;  2JPC A;  2IVM A;  1O3R A;  5CJ9 A;  1XD7 A;  2FE3 A;  1J2X A;  3LSP A;  4ESB A;  1HBX G;  4Y33 A;  1AOY A;  2CFO A;  4ZZD A;  1O7L A;  4U0V A;  3A2K A;  4HV6 A;  2E1M B;  4I0A A;  3HPG A;  5IY5 H;  2I10 A;  5K7H A;  2RNG A;  3CCR I;  1XGS A;  2F5D A;  2HDD A;  4UNO A;  2GOX B;  1UG0 A;  1MMS A;  2LLK A;  4PSW A;  1G3Y A;  4RS8 A;  1XSX A;  3V42 A;  2QEX I;  3K4C A;  5FLX K;  2XGC A;  2VKV A;  4IHV A;  3DKX A;  1J9I A;  2VE8 A;  4UUV A;  2L9S A;  1S7E A;  1GV5 A;  5CQE A;  2P5K A;  2VLA A;  4UUS B;  2L3D A;  3T5X A;  3ZMT A;  2JUG A;  5HNF A;  3IWF A;  4Q48 A;  3C1D A;  1SVL A;  1FOK A;  4XN3 A;  2CW0 F;  3BPV A;  2VQC A;  4R8H A;  2IGO A;  2DPU A;  1B8I B;  1CGP A;  5E3N A;  2MA3 A;  1FNN A;  4UXN A;  4BQO A;  3UR3 C;  3BQZ A;  3SXY A;  1R5G A;  2EPF A;  1D0X A;  4W97 A;  1IRX A;  1X1A A;  2M34 A;  3ZRG A;  2HQA A;  1XDS A;  5FFX A;  2XC7 A;  1I6X A;  1Z1D A;  5IT9 Z;  2EA2 A;  1X2N A;  3SZP A;  3S3M A;  3KX2 A;  3HYI A;  1ZHF A;  2COM A;  4JOM A;  1UHW A;  3KEY A;  3GTG J;  1RR7 A;  2X1E A;  1SMY F;  1TBX A;  4HQM A;  3O3K A;  1IO2 A;  2QM3 A;  3C2G A;  1EA3 A;  2FOK A;  3QOP A;  1MBE A;  4R1H A;  1EF4 A;  4M6Y A;  2ZB9 A;  5D5V B;  3SEQ A;  4U87 A;  2K9N A;  1RUO A;  4F7Z A;  1G59 A;  2LTP A;  2DA2 A;  2NYX A;  5D4R A;  4U0Y A;  1VQN I;  1OCT C;  1E3H A;  4G6T B;  4EJU A;  1W5T A;  1MD0 A;  4EEF G;  2JRT A;  3HC7 A;  2QBY B;  2PG4 A;  3V7C A;  3V4G A;  3ECO A;  3GZ6 A;  1IJW C;  2GA1 A;  2L7F P;  3BZK A;  2DI3 A;  4EM1 A;  4GYG A;  2VQG A;  2D45 A;  1ETK A;  1LEA A;  2R7F A;  3DF8 A;  3HSR A;  5ERI A;  3IH3 A;  3LSI A;  1IXS B;  3MMY B;  4HDU A;  2EFW A;  2E1C A;  4HV5 A;  4V19 K;  1MZB A;  1W36 C;  3FXO A;  2HS5 A;  3TED A;  4XLN F;  2DA3 A;  3BTC A;  3KEQ A;  3GLL A;  2VL8 A;  4BHB A;  2CFX A;  4HF1 A;  1FT9 A;  2LNB A;  3H9J A;  1TT5 B;  3G2B A;  2YU3 A;  1JUP A;  5IP6 A;  4MLO A;  3GVA A;  1XMA A;  2NNY A;  3L1P A;  2M8E A;  3J81 Z;  2VBW A;  1OCO H;  2Z5U A;  1LQ1 A;  3WTU C;  3KFW X;  2W82 A;  2JUC A;  2EIJ H;  4CIC A;  1IUY A;  5EEH A;  3PFI A;  4M72 A;  3CJN A;  2A6H F;  4RB3 C;  4ZYH A;  1EV7 A;  3L09 A;  3HEF A;  2VQH A;  1FP1 D;  4Y3O A;  4QSH A;  1ZRE A;  5TJJ A;  3WGH A;  4BEH B;  2YX4 A;  1NHA A;  1F36 A;  5IT9 K;  3K69 A;  1NG7 A;  4V2G A;  4M9X A;  4E7K A;  3FXU A;  4OOI A;  3OWT A;  4UV9 A;  5B1B H;  5L3C A;  2HTJ A;  1BC7 C;  5AIQ A;  2QSH X;  1JTY A;  2LK2 A;  3BR3 A;  2V79 A;  4II2 A;  4EM0 B;  2HWV A;  1Y0N A;  2CV1 A;  2R93 J;  4X6A J;  4I99 C;  1SAN A;  3VYS B;  1JT0 A;  4G7Z F;  2R7S A;  3G6E I;  1Z3Y A;  1JXS A;  3H1C A;  3WU2 C;  2K5C A;  2LSO A;  2OAZ A;  4PJL A;  2DO7 A;  5J1U A;  1XMK A;  4J00 A;  5EEG A;  4BBS J;  3LSJ A;  2BEO A;  1PYV A;  2MBF A;  3SHF A;  1IDZ A;  3I9V 2;  2KDZ A;  4EJO A;  3KP7 A;  1ZG1 A; 
#chains in the Genus database with same CATH homology
 2EV6 A;  3SFZ A;  2XAJ A;  3QU6 A;  3F8C A;  3EET A;  3I5U A;  2G7U A;  4FT8 A;  4N9I A;  1Z05 A;  1HSJ A;  4D0P A;  4HDV A;  3WTW C;  2J5O A;  5E20 A;  5CVJ A;  1BOA A;  1YW8 A;  2IPQ X;  4HX4 A;  4IHS A;  3WU1 B;  5FD6 A;  2IRF G;  1T38 A;  1IN5 A;  2DW4 A;  1SD4 A;  4KIF A;  1KQ8 A;  4KDP A;  2M30 A;  2DK8 A;  3BY6 A;  2A61 A;  3DFG A;  2CG4 A;  5J8F A;  3OV8 A;  4OIP F;  3JSO A;  4G94 A;  1HQC A;  3HRS A;  2P5V A;  4MTD A;  1BN5 A;  4AIK A;  2F5C A;  4RGX A;  5DUK A;  1FYL A;  3I64 A;  2KIU A;  4CGZ A;  1R1V A;  1MKM A;  2MH9 A;  2HTS A;  4CXF A;  2EFP A;  1XSD A;  4LG0 A;  2UZK A;  3F6O A;  4ZYG A;  4IRI A;  2V9V A;  2VC0 A;  3V7R A;  1P2F A;  5JR3 A;  3NQO A;  2HQN A;  2FQ3 A;  4EV0 A;  2ISY A;  1UFM A;  2BE5 F;  2QYO A;  1KQ0 A;  1LVA A;  2ZBK A;  1P6R A;  2OD5 A;  1ZLJ A;  1OKR A;  2Y0M A;  4L0Y B;  3CUO A;  2STT A;  2XAF A;  2ZFW A;  5ICF A;  3L2C A;  4P96 A;  4KFC A;  1D5V A;  4Y13 A;  4IVN A;  2ESH A;  1HKS A;  1R5H A;  3REO A;  3F23 A;  2JTV A;  2H94 A;  2VOD A;  4EGZ A;  1ZH5 A;  3WOD F;  2FBH A;  3KP3 A;  1YS7 A;  2IA1 A;  5A2Q K;  2QBY A;  3GFM A;  1IZ1 A;  3KET A;  4JQF A;  5HLG A;  2DFI A;  1E17 A;  1CF7 B;  4BH9 A;  3ABT A;  3MZH A;  1QQI A;  4WWC A;  3FXQ A;  3DEU A;  2VN2 A;  3ISP A;  5E8I A;  4ENM A;  3IHU A;  5CVI A;  5LLQ A;  4RB2 C;  1ZN2 A;  1UST A;  2KIF A;  3EQL F;  5E1Z B;  4WXC A;  2O6G E;  2YPR A;  2IP2 A;  2XAS A;  2ELH A;  4KN4 X;  1BM9 A;  3QRF F;  2IA0 A;  1UB9 A;  3F72 A;  4YFN F;  5DUI A;  3LAP A;  3N97 A;  4UVC A;  3TQN A;  1AWC A;  1BI2 A;  2JSC A;  1TNS A;  2JPB A;  3WTZ A;  4MEX F;  3J80 Z;  1L3L A;  1U5T A;  2KJC A;  2VBX A;  2CWE A;  3ELK A;  3LA3 A;  4PGG A;  2HOE A;  3WTS C;  3TDZ C;  4KYW A;  3H3Z A;  2DTR A;  4L9V A;  3QU3 A;  5HS8 A;  5J8C A;  1A04 A;  3C18 A;  3K2Z A;  2NS0 A;  3O2P E;  1XCV A;  1J59 A;  3I59 B;  2C6Y A;  1F4K A;  4YFX F;  4EM2 A;  3MQ0 A;  2Z3Y A;  3I58 A;  3EYY A;  1T98 A;  5H20 A;  3BRO A;  1PP7 U;  3P9K A;  3R4K A;  4CDG A;  3JW4 A;  4DNC A;  4G6D A;  1EH8 A;  3I4P A;  3KE2 A;  3GW2 A;  3E6M A;  3FM5 A;  2Y48 A;  4EJW A;  2PEX A;  1I1G A;  1QPM A;  2P8T A;  1OMI A;  3E6C C;  2ZXJ A;  1SD6 A;  1OYY A;  4BXU A;  4ETS A;  4GYI A;  3B02 A;  3HOS A;  3Q9S A;  3GLX A;  2YR2 A;  2VON A;  1W7P A;  2W84 A;  3VOE A;  1J0R A;  3M1E A;  2D1H A;  1U78 A;  2F2E A;  3CUQ A;  2RGV A;  3K9T A;  3WTX C;  3IRR A;  1EH6 A;  3AAF A;  5E18 F;  2NRA C;  2DT5 A;  3TO6 A;  3IKV A;  1TW3 A;  1STZ A;  3WE2 A;  1BIA A;  5K5O A;  3M7G A;  5FLX Z;  3P7N A;  4I98 B;  4XLP F;  4BHC A;  3GUD A;  4CHU A;  2IW5 A;  1K7A A;  1P92 A;  4R79 A;  1BC8 C;  1U5T B;  4OIQ F;  1O3T A;  1TQM A;  3I71 A;  1Q1H A;  4CO8 A;  1FY7 A;  2R7D A;  3IKT A;  1J7K A;  2Q2E A;  2FXA A;  2OZU A;  5LRR A;  2A69 F;  2H6C A;  2OBP A;  2GWR A;  3EUH A;  5AIP A;  3IWZ A;  2QWW A;  5L3F A;  5LGN A;  2GAU A;  1F5T A;  1R1U A;  4M6X A;  1YG2 A;  3SZT A;  4YII A;  4HAM A;  4HW0 A;  1KU3 A;  3KP4 A;  1C0W A;  3ULQ B;  1IW7 F;  1LEB A;  1FP2 A;  1USS A;  3GYH X;  5AON A;  3BJO A;  4HOB A;  3ZMZ A;  4CYD A;  1HKQ A;  2CQK A;  2RDP A;  1LNW A;  4A6E A;  2DBB A;  4A0X A;  3CUQ B;  2FF4 A;  4QLC U;  4PCQ A;  2ISZ A;  4L18 B;  3BZ6 A;  4L9N A;  1U3E M;  3P9I A;  4UV8 A;  4KUM A;  2K4J A;  1OYI A;  1MJA A;  2IJL A;  1K78 A;  2EK5 A;  1ON2 A;  3LFK A;  1B6A A;  4GXO A;  1QGP A;  1WQ2 A;  3TOB A;  2K02 A;  2X4H A;  2W24 A;  3DQV C;  1RUN A;  3WG9 A;  2VBY A;  3H3U A;  2XKO A;  1B9N A;  3L9F A;  3HTU A;  1D8J A;  1RNL A;  4QWQ A;  1KU2 A;  4KIC A;  3W6K B;  4L9J A;  4LG0 B;  5DV5 A;  2VE9 A;  3COA C;  4A12 A;  4G6Q A;  2FEZ A;  1FBU A;  5LGU A;  4ESJ A;  1G3W A;  5CVU A;  2FMY A;  2MD5 A;  2STW A;  4LLN A;  2QVO A;  4G8X A;  1OR7 A;  5L3G A;  3HHH A;  1W7P B;  2DK5 A;  4S04 A;  4KMU X;  3ZPL A;  3HIF A;  2F5F A;  2ZNY A;  1YS6 A;  3K1N A;  1ZRD A;  2XRN A;  1Y0U A;  5DD8 A;  4B8X A;  3MEX A;  4P5O A;  4UVA A;  3M8F A;  1ULY A;  1FBS A;  1PP8 F;  5DCM A;  4I7H A;  4WF2 A;  2UXN A;  4WCG A;  1ZRF A;  2W25 A;  3TKY A;  3HSF A;  3LA7 A;  1XGM A;  4M74 A;  2WWY A;  2V6C A;  1V4R A;  3NEU A;  5FGM A;  3PQJ A;  4YG2 F;  4LB6 B;  3L7W A;  1E2X A;  3E6B A;  1H9T A;  4OMZ A;  2PLY A;  2EV5 A;  3I59 A;  1IN8 A;  1I27 A;  4ZYD A;  2BV6 A;  1BI1 A;  1L0O C;  3LA2 A;  1P4X A;  3FMR A;  4NQW A;  4PGH A;  1SFE A;  1ZGJ A;  2CSO A;  2KKO A;  1UCR A;  4O3M A;  3GEZ A;  2QQB A;  3ML6 A;  3TGN A;  4ZYE A;  1F9N A;  1JHF A;  5L3E A;  1QO0 D;  4WK8 F;  5D6F A;  4IJA A;  3V8J A;  2D1V A;  1LB2 A;  1KGS A;  2FML A;  2B0L A;  2XIG A;  3LQQ A;  4OU0 A;  1YFH A;  4M71 A;  1UHM A;  1G3T A;  3RIR A;  3WGI A;  4MEY F;  4DQ2 A;  3QPT A;  3WTY C;  1T6S A;  2QEN A;  3R60 A;  2H6B A;  5KK1 A;  1EH7 A;  2L4A A;  4MNU A;  3ZN1 A;  1Z91 A;  1KU7 A;  1JHH A;  4E70 A;  3RTR A;  3JAM Z;  4A5M A;  2P6T A;  2TDX A;  4Q47 A;  1RZ4 A;  2DQR A;  5LHH A;  3TO7 A;  1G3S A;  3FWE A;  1R1T A;  1SFX A;  4L0Z B;  2D2W A;  3E3V A;  2L01 A;  3RKW A;  1XGN A;  4HA8 A;  4I09 A;  2KRF A;  4A6D A;  4U0W A;  5CLS A;  2ZO4 A;  5K1Y A;  4LK1 F;  3K1M A;  2E7X A;  5DEQ A;  1LDD A;  5A2Q Z;  1HW2 A;  4LK0 F;  4Y15 A;  4HF2 A;  3DPT A;  3FXR A;  3ZMU A;  2HYG D;  2MLG A;  3GWZ A;  4AD9 A;  2VT3 A;  1PUE E;  2R3S A;  3T0Y A;  4UVB A;  1BI3 A;  1O3Q A;  5LGT A;  1QZZ A;  5ED4 A;  2HEO A;  2L02 A;  5J6X A;  2P7V B;  3RJP A;  3E6D A;  3BJA A;  2KJB A;  5D5U B;  3GFJ A;  3I54 A;  3RDI A;  1FYK A;  4RAZ A;  1ZGA A;  1P4A A;  2Z33 A;  2EV0 A;  3F8M A;  3R61 A;  2DU9 A;  3RPU A;  2P7C B;  3Q5F A;  1LDK B;  5HS7 A;  1B9M A;  1XN7 A;  5HDK A;  4LLL A;  1YYV A;  1Z7U A;  1IN4 A;  4NB5 A;  3CTA A;  5ILV A;  4LMY A;  5F64 A;  5DD4 A;  4WXD A;  4BYY A;  1FSE A;  1IN6 A;  3CUQ C;  3ZMD A;  3DXJ F;  4Z2Y A;  4NHJ A;  1X3U A;  2P5L C;  4MQ9 F;  1FSH A;  3V7S A;  5L3D A;  4ZZL A;  1FX7 A;  4K2E A;  4I01 A;  5IT3 A;  4HF0 A;  2GXB A;  4GGG A;  2ZNZ A;  4ZH4 F;  4LB5 A;  4YIF A;  1O3S A;  5K5R A;  3KZZ A;  2DPD A;  1IAW A;  1H9G A;  2PMH A;  4RAY A;  1DPR A;  1IRF A;  1YQA A;  2L4M A;  5LEK A;  2RKH A;  2LF7 A;  1SFU A;  2XGX A;  4G9Y A;  3BDD A;  2YSR A;  3U9G A;  3G3Z A;  2HFH A;  2CGP A;  1KYZ A;  1ZAR A;  5D5W B;  4JBA A;  2YX7 A;  5LHG A;  1Z6R A;  2XKP A;  1ZG5 A;  4KIB A;  3E5Q A;  3ZMS A;  4KN7 X;  3V8K A;  4XRF A;  5BPD A;  2NNN A;  4GO1 A;  3H92 A;  5ICC A;  1U5T C;  2HZT A;  4IRG A;  5D8L B;  2ACJ A;  3KP5 A;  4I02 A;  5HDN A;  1YLF A;  5FD5 A;  5BOX A;  4RB1 A;  2RN7 A;  1H0M A;  3KLO A;  1W7P D;  5ICG A;  2HKX A;  2FRH A;  3ERE D;  3WU0 A;  4LD5 A;  1R36 A;  4BQA A;  1WRJ A;  4G7H F;  1FBQ A;  1REP C;  2OU2 A;  5JI6 A;  5D4S A;  3D5L A;  4L5I A;  2OZ6 A;  3E5X A;  1JGS A;  2M87 A;  4OIO F;  1TQP A;  4UHT A;  5LRS A;  3RKY A;  4A2U A;  1ZLK A;  3RYP A;  2A5Y B;  4EQQ A;  1GHC A;  3RI4 A;  2O61 A;  4HQE A;  2VT2 A;  1IF1 A;  3BP8 A;  1R7J A;  1ZG3 A;  3BPX A;  3CO7 C;  3BWG A;  1QBJ A;  1O7F A;  1RIO H;  4A0Z A;  3FMS A;  3HSE A;  1FWZ A;  1Z6T A;  1IXR C;  3FM3 A;  2GXG A;  1F1Z A;  2F5E A;  3LWF A;  1ZRC A;  2GQQ A;  3T8T A;  3L00 A;  2XAG A;  5HOO A;  1K6O A;  4ENK A;  2K7L A;  2G9W A;  1R22 A;  2HR3 A;  3KLN A;  2MC3 A;  3ECH A;  3WE3 A;  2V1X A;  2ZJ2 A;  4ENN A;  2XAQ A;  3DP7 A;  3WTV C;  2EJR A;  2G7H A;  2UXX A;  3KP2 A;  4XSX F;  4KA4 A;  5KVR A;  2ESN A;  2XVC A;  5DCM B;  3JTG A;  4KMF A;  3GX4 X;  2Y75 A;  3ROU A;  4OIN F;  1K78 B;  1ZYR F;  4AWX B;  4B09 A;  2E7W A;  3F21 A;  3EYI A;  3MAJ A;  2RC4 A;  2WC2 A;  5HDG A;  3U2R A;  3EDP A;  3SQN A;  1SMT A;  2EB7 A;  2E1N A;  2FSW A;  2LF8 A;  4KIG A;  1GXQ A;  4KT5 C;  3KEO A;  3VOD A;  1OPC A;  3W6J B;  3I53 A;  1B4A A;  1MDM B;  3F22 A;  5D5X B;  2RNJ A;  3O6B B;  1XCB A;  3LAJ A;  4MQV A;  1V3F A;  2W57 A;  1S3J A;  2KIM A;  1I1S A;  3NRV A;  4EJV A;  4MHG A;  2QUF A;  1J75 A;  2RVC A;  1BIB A;  3T1B A;  3J80 K;  5ILU A;  2WTE A;  1MJ9 A;  1K79 A;  3TO9 A;  4O6J A;  3GFL A;  3F6V A;  1U6G A;  2WV0 A;  1MDM A;  2K86 A;  1KA8 A;  5H6R A;  3MWM A;  5DCF A;  2EFN A;  2V1D A;  4P55 A;  5BS6 A;  4KNY A;  4G7O F;  2OA4 A;  4IRH A;  2K4B A;  5HLH A;  1QNT A;  1VTN C;  1U8R A;  2HKO A;  3QAH A;  2QZ8 A;  3HOT A;  5CYV A;  2GIV A;  3WGG A;  3V8L A;  1T2K A;  3C3W A;  4OIR F;  2LKP A;  4BHP A;  1T39 A;  3FMQ A;  1DUX C;  3BJ6 A;  4U7D A;  1PDN C;  2VC1 A;  2A6E F;  1DDN A;  1FLI A;  1WWX A;  4WX9 A;  5HLI A;  4RB0 A;  1XSV A;  4AIJ A;  4HYE A;  5L3B A;  5JHU A;  2OQR A;  1S7A A;  3HRM A;  3RYR A;  2IT0 A;  5D8K B;  2XUB A;  3BOQ A;  4EMS A;  4IHT A;  2HGC A;  2P4W A;  2PJP A;  3HRT A;  1JE8 A;  3GFI A;  3TDU C;  2GA2 A;  1HKT A;  4EVI A;  1HXD A;  4FHT A;  3HUG A;  1S6L A;  4HZF A;  3IC7 A;  4HX7 A;  1RI7 A;  1WSU A;  2UWM A;  3QPH A;  3IL2 A;  4H0E A;  1R58 A;  2EFO A;  1FZP B;  1ODD A;  3WTT C;  1WKM A;  2V1U A;  2NAZ A;  2OQG A;  3KZY A;  1LDJ A;  5JFR A;  3DKW A;  3QP6 A;  4HLX A;  4RGR A;  4I2O A;  3QP5 A;  5E1W A;  2QLZ A;  3F3X A;  2H09 A;  1WI9 A;  4I0B A;  1O57 A;  4ASN A;  1IXC A;  3OOP A;  5ICE A;  1FYM A;  4O5V A;  2EWN A;  2M1B A;  1QZY A;  3ZN0 A;  1LJ9 A;  3FX3 A;  4Q4Z F;  4MGR A;  2FU4 A;  4YFK F;  2HQR A;  4Q5S F;  3F8B A;  1HW5 A;  2K27 A;  4FX0 A;  4RGS A;  1U2W A;  2PMU A;  5FO5 A;  3LST A;  4Y17 A;  4XBF A;  5FFZ A;  2VBZ A;  4TV7 A;  1GVJ A;  1S29 A;  3HRU A;  4WXH A;  3GXO A;  2Z99 A;  1Z9C A;  3CO6 C;  1SD5 A;  2AS5 F;  3CLO A;  3Q9V A;  3K0L A;  4P9F A;  1I5Z A;  1TNT A;  2ZME A;  4AIH A;  3ZQ7 A;  3I0T A;  2AXL A;  1KU9 A;  1XDU A;  1DP7 P;  3D0S A;  2GZW A;  2PN6 A;  5H6Q A;  1ON1 A;  4EGY A;  4IF4 A;  2P6S A;  4L9T A;  2CYY A;  1YW9 A;  3GZ5 A;  4PZJ A;  1GXP A;  2W85 A;  1B1B A;  5BQT A;  3B73 A;  3GO5 A;  2M45 A;  1D8K A;  2BBY A;  2L54 A;  2M5W A;  2VXZ A;  4N0B A;  2Q0O A;  2ZKZ A;  2IA2 A;  3RKX A;  1R00 A;  1TLH B;  2QQ9 A;  3S2W A;  2VOO A;  2EFQ A;  5F1R A;  3K1P A;  3G73 A;  3KP6 A;  3HTS B;  3R6S A;  1XGO A;  2EA4 A;  2HYF A;  4MTE A;  2DLL A;  4JK1 X;  4U7B A;  1MGT A;  3J7A O;  2A3S A;  4OMY A;  4PDK A;  4HBL A;  1ZAO A;  4BNC A;  1TTY A;  4P9U A;  2PI0 A;  4M9Z A;  3VB2 A;  1IN7 A;  3U1D A;  3TOA A;  2H27 A;  4LFU A;  4M9S A;  5CVR A;  2FNA A;  4GCV A;  1YO5 C;  4IPA A;  2ETH A;  3FHZ A;  5HS9 A;  2PFB A;  2JT1 A;  2FBK A;  3KCC A;  3JSP A;  1S8N A;  3C7J A;  3T8R A;  3LQR A;  4HX8 A;  1XB4 A;  1G6N A;  4LJZ F;  6PAX A;  3MFK A;  5FB2 A;  1CF7 A;  2BGC A;  5LHI A;  2Z9O A;  1YTY A;  1W5S A;  3M8E A;  3JTH A;  3E97 A;  3R0A A;  2MH2 A;  2BYV E;  2HDC A;  2JZY A;  3J81 K;  1YW7 A;  3DV8 A;  4L5J A;  4A5N A;  5HVQ C;  1S7O A;  2A07 F;  2ADU A;  5BMZ A;  4LGW A;  1SD7 A;  3HHG A;  5E17 F;  1R23 A;  2PQ8 A;  4CZZ A;  1TW2 A;  2XV4 S;  5K5Q A;  3JAM K;  1IRG A;  5JVT A;  4LLG F;  5E1X A;  3E5U A;  5F6F A;  4N9H A;  3P9C A;  1P4W A;  5LEJ A;  1BI0 A;  3FZV A;  1BBY A;  1J5Y A;  2FBI A;  3R0J A;  3ABU A;  2QQA A;  5CVV A;  4XSZ F;  1SAX A;  2LDU A;  4RGU A;  2RV8 A;  1FC3 A;  3ZP5 A;  2Q8K A;  1W4M A;  2PBI A;  1FPQ A;  2O03 A;  2ZCW A;  3CDH A;  4FX4 A;  5DYM A;  1MJB A;  5BPI A;  1DPU A;  4M73 A;  1ONV A;  5LBQ A;  2ZME B;  2A68 F;  1BJA A;  2FNP A;  5TRD A;  3VFZ A;  2O3F A;  2XHK A;  2VOP A;  2CO5 A;  2DQL A;  2MLK A;  4EJT A;  1G4D A;  4IXA A;  4BAY A;  1KQ9 A;  3N4M A;  3F8N A;  3FF5 A;  1HW1 A;  2O0Y A;  2XRO A;  2FA5 A;  4ESF A;  3F8F A;  3M9A A;  3IRQ A;  3MZY A;  2RQP A;  1YIO A;  3RPQ A;  5DDG A;  1KYW A;  1D3Y A;  2J5P A;  4AVP A;  1HST A;  1TQI A;  4ENJ A;  4ON0 A;  4S05 A;  1T0F A;  3PQK A;  2DAO A;  4HLY A;  2O8X A;  3VEP A;  4U88 A;  4A0Y A;  5D6E A;  2X0L A;  5ILS A;  5E8G A;  3GF2 A;  3DPL C;  1B59 A;  3MCZ A;  1OYW A;  2XAH A;  3ZMV A;  2JPC A;  2IVM A;  1O3R A;  5CJ9 A;  1XD7 A;  2FE3 A;  1J2X A;  1HBX G;  4ESB A;  1AOY A;  4ZZD A;  1O7L A;  4U0V A;  4HV6 A;  4I0A A;  1XGS A;  2F5D A;  4UNO A;  1G3Y A;  4RS8 A;  1XSX A;  5FLX K;  1J9I A;  2VE8 A;  4UUV A;  2P5K A;  2L3D A;  3T5X A;  3ZMT A;  3IWF A;  4Q48 A;  3C1D A;  1FOK A;  2CW0 F;  3BPV A;  4R8H A;  2DPU A;  1CGP A;  2MA3 A;  1FNN A;  4UXN A;  3SXY A;  1R5G A;  1XDS A;  5FFX A;  1I6X A;  1Z1D A;  5IT9 Z;  2EA2 A;  3SZP A;  3HYI A;  1ZHF A;  2COM A;  1UHW A;  1SMY F;  1TBX A;  4HQM A;  3O3K A;  2QM3 A;  3QOP A;  2FOK A;  4R1H A;  4M6Y A;  5D5V B;  1RUO A;  4F7Z A;  2NYX A;  5D4R A;  4U0Y A;  4EJU A;  1W5T A;  1MD0 A;  2JRT A;  2QBY B;  2PG4 A;  3V7C A;  3V4G A;  3ECO A;  3GZ6 A;  2GA1 A;  2DI3 A;  4EM1 A;  4GYG A;  2D45 A;  2R7F A;  1LEA A;  5ERI A;  3DF8 A;  3HSR A;  4HDU A;  1IXS B;  2EFW A;  2E1C A;  4HV5 A;  1MZB A;  2HS5 A;  4XLN F;  3KEQ A;  4BHB A;  2CFX A;  4HF1 A;  1FT9 A;  2LNB A;  2YU3 A;  3GVA A;  1XMA A;  2NNY A;  2M8E A;  3J81 Z;  2VBW A;  2Z5U A;  1LQ1 A;  3WTU C;  3KFW X;  4CIC A;  1IUY A;  5EEH A;  3PFI A;  4M72 A;  3CJN A;  2A6H F;  4RB3 C;  4ZYH A;  1EV7 A;  3L09 A;  1FP1 D;  1ZRE A;  5TJJ A;  3WGH A;  2YX4 A;  1NHA A;  5IT9 K;  3K69 A;  4M9X A;  3FXU A;  4OOI A;  4UV9 A;  5L3C A;  2HTJ A;  1BC7 C;  5AIQ A;  2V79 A;  4EM0 B;  2HWV A;  4G7Z F;  1JXS A;  2LSO A;  2OAZ A;  2DO7 A;  1XMK A;  5EEG A;  2BEO A;  2MBF A;  3SHF A;  4EJO A;  3KP7 A;  1ZG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...