3ELKA

Crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
104
Chain Sequence
TRERILHGLITLYILKELVKRPMHGYELQKSMFETTGQALPQGSIYILLKTMKERGFVISESSVNKGQQLTVYHITDAGKKFLDHSQALQLARKIIDDLLSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative transcriptional regulator TA0346 from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator TA0346
total genus 26
structure length 104
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3elkA00
1I1GA 3LAJA 1LEAA 3BJ6A 4HF2A 3N4MA 1E17A 2OAZA 3ZPLA 4Y13A 1I27A 1HBXG 1BM9A 3O3KA 2QENA 4LFUA 4L5JA 4ASNA 1IN8A 5IT9K 1HW1A 3E6MA 5EEHA 2ELHA 4A2UA 1Y0UA 1J75A 2VE8A 4WF2A 2KRFA 2DQLA 3HRUA 2IT0A 4KIBA 3IRQA 3R0AA 2FXAA 3BPXA 4M72A 2FF4A 3CTAA 1R00A 3AAFA 2CW0F 3ISPA 2FNPA 3M1EA 2W84A 2W24A 3E5XA 1P4AA 3HRSA 1BOAA 3HSRA 1XGNA 2BE5F 2AS5F 2J5OA 1R1TA 1SD6A 4Q47A 1LB2A 1MDMA 1U8RA 3BWGA 3C7JA 3P7NA 4FX4A 3LAPA 1V4RA 4CGZA 1R1VA 3GO5A 5E8IA 1DPRA 3Q5FA 5LEJA 5D5WB 2M5WA 2ZXJA 1IN6A 1J9IA 1LDKB 1JHHA 4A0YA 2UZKA 3MEXA 4RAZA 1HSJA 2EK5A 3HYIA 3LFKA 1F9NA 2MC3A 3PQJA 1G3SA 3CO6C 2QQBA 1NHAA 3GUDA 1XGOA 1ZHFA 2PI0A 4HW0A 2HZTA 4OMZA 1XN7A 1BJAA 5FD5A 3MCZA 2P6TA 4MQ9F 4NB5A 5LRRA 3VOEA 5FFZA 1CF7A 3K0LA 4NQWA 1T38A 3BJAA 1LQ1A 3P9CA 2LSOA 1U2WA 2OU2A 1BN5A 1EH7A 2O03A 2ZJ2A 3H92A 1F5TA 4JQFA 2OA4A 1P92A 5JI6A 2STWA 5LHHA 1OYIA 1P6RA 3TGNA 1LDJA 1ZGAA 1YFHA 2UXXA 3WGGA 2JT1A 4RB0A 4XBFA 2BV6A 4N9IA 4UVCA 1F4KA 2PQ8A 4HDVA 4HX7A 4M9SA 4UV9A 3ML6A 4KN4X 1DDNA 3W6KB 3ZQ7A 5DYMA 5CVRA 5ILSA 1PDNC 5CLSA 1W7PD 3CUOA 2H6CA 3CJNA 1LJ9A 2K7LA 1BIBA 1XGMA 1DUXC 2G7HA 2NRAC 1G3WA 4GCVA 5TRDA 2EFNA 4IHTA 1IN5A 4OIOF 2VBYA 1R58A 2HKXA 2F5CA 1R23A 4IHSA 1SD5A 3Q9SA 2QM3A 4FX0A 2HEOA 4L9JA 2PMHA 3H3UA 1HSTA 3QP5A 1FYKA 2RGVA 1BI1A 3FHZA 5AIQA 5CVIA 2NNNA 4BXUA 3VB2A 2MLKA 5J8CA 1C0WA 1KGSA 5BPIA 5DD8A 4M74A 2BGCA 5LHGA 4RAYA 2O61A 5JFRA 1O7FA 5K5OA 2ADUA 2E1CA 3IWZA 1OYWA 2OZ6A 1H9GA 3EYIA 4Y17A 3DKWA 4ESFA 3ZN1A 1ULYA 1O3RA 3GW2A 4PDKA 5FGMA 1ZYRF 1U78A 4EJOA 1QNTA 2FE3A 2ZMEB 4S04A 1GVJA 2CSOA 2Q2EA 5HDKA 2FBHA 3FXRA 2B0LA 3WTSC 1HW5A 3V7SA 5IT3A 1ZLKA 1YS7A 5AIPA 4HX8A 3DV8A 4CZZA 4R1HA 1SMYF 4M71A 1DP7P 3I59B 1YQAA 2CFXA 3WTXC 4KFCA 1J5YA 1D8KA 2IVMA 4HBLA 4QLCU 2XAQA 1D5VA 4N0BA 2DBBA 5E8GA 5J6XA 3ECHA 1MDMB 4HAMA 3QPHA 3FM3A 3CO7C 2BYVE 2E1NA 1XCBA 3KFWX 4LLGF 1J59A 1KU9A 2P7CB 1H9TA 2V6CA 5JHUA 2VE9A 5E20A 3E97A 2HR3A 5CYVA 1R7JA 1KU2A 1J7KA 3WU1B 2IW5A 4A6EA 3HIFA 4YIIA 5HLGA 3I71A 3E3VA 4ESBA 2HYGD 2H94A 2EA2A 3M8EA 3K9TA 5FFXA 2V1DA 1Z7UA 3F21A 4LJZF 4EV0A 4L9NA 1YYVA 2R7DA 4BHCA 3LA2A 2VBXA 1FP2A 1B1BA 2PJPA 3RYRA 1U3EM 4WXDA 2YX4A 1XSDA 4WK8F 4HYEA 2MH9A 3EDPA 5J8FA 4MGRA 3BPVA 3L7WA 3GFMA 4DNCA 2GA2A 4BHPA 5L3GA 1FBSA 1HKSA 3K69A 1MD0A 2Q8KA 3KP7A 4KICA 3HHGA 4NHJA 3WU0A 2O3FA 4TV7A 1I1SA 1FWZA 2XHKA 1Z05A 4YFXF 2FU4A 4HLYA 1Z6TA 3CUQA 1RI7A 2RKHA 1AOYA 2KJBA 4XLNF 3HHHA 5A2QZ 4CDGA 3LQRA 3MZYA 3DXJF 4FHTA 3TQNA 3ABTA 1Z91A 4U0WA 2V1XA 1KU7A 1IN7A 3SZPA 3SFZA 5FD6A 1ZRCA 3T8TA 2RDPA 3H3ZA 4EGZA 1XD7A 5H20A 3BJOA 1P2FA 3ZMZA 2YU3A 3RIRA 3KZYA 3ABUA 3FMRA 1V3FA 2P6SA 4ON0A 5L3FA 2DTRA 3R60A 2L54A 3ZMVA 3PQKA 4RB1A 3F8NA 3D0SA 2LDUA 1XB4A 1ZAOA 3U9GA 2KKOA 1K7AA 1E2XA 4WX9A 2XAHA 1Q1HA 4HDUA 4UXNA 4YIFA 4YFNF 3TOBA 4HF0A 1UFMA 4LK0F 3E6BA 1T6SA 2XKOA 1OKRA 3RTRA 2IA1A 3BROA 4OMYA 3FZVA 5FB2A 3BDDA 4P9FA 1OYYA 3I0TA 1ZH5A 2JTVA 5TJJA 4ZYDA 2RQPA 3G73A 4BHBA 5IT9Z 2NS0A 1ZG3A 3DFGA 1DPUA 1P4WA 4OIQF 5KK1A 2EV5A 3C1DA 1FLIA 1O3SA 4LK1F 2L01A 4LGWA 4M6XA 2Z33A 4BH9A 3KEQA 5HOOA 2G7UA 1GXPA 4LMYA 1MJBA 1STZA 4L18B 2P5VA 5A2QK 1SAXA 3GLXA 3KLNA 2F2EA 3DPLC 3WE3A 1I5ZA 3RDIA 2ZFWA 4RGUA 3RKXA 2HKOA 2D1VA 1B9NA 2Q0OA 3F6VA 4GXOA 1IRFA 1Z1DA 4L5IA 2DI3A 1FYLA 5HLHA 4A12A 4AIJA 1LEBA 3LA3A 2FSWA 1KYZA 1WWXA 1ZARA 3N97A 1O3QA 1F1ZA 4BAYA 4G6QA 4BNCA 1QBJA 2XAGA 4B8XA 2P5KA 1WRJA 1L3LA 3DEUA 2FBIA 1FZPB 4G7HF 3IKTA 4AVPA 4CHUA 1RIOH 5D5UB 2JSCA 3S2WA 4A6DA 4RGXA 1TLHB 1FBUA 4Q4ZF 4IJAA 2K4JA 4GO1A 1S29A 1S7AA 2OD5A 1IW7F 3E5UA 2X0LA 2VN2A 1SMTA 3QOPA 2PLYA 2ZBKA 1J2XA 2ETHA 1FP1D 3IWFA 1IZ1A 2DU9A 4EJUA 3MQ0A 3L09A 3I58A 4HLXA 2F5EA 1CGPA 2HOEA 2DO7A 1XSXA 3LWFA 1W5TA 3CDHA 5D4RA 1QZZA 3HUGA 1FYMA 4Z2YA 1I6XA 3GF2A 3MAJA 1QQIA 5HS9A 1ON1A 5HVQC 3K1NA 3WGHA 4HF1A 2HQNA 4UVAA 3TO9A 3K2ZA 2IA0A 4IF4A 2L4MA 3MWMA 4RB2C 3RI4A 4ENMA 4G7OF 4ENJA 5K5RA 1HXDA 3SZTA 2WV0A 2R7FA 4L0ZB 4IRHA 2VT2A 3RPUA 2XKPA 3RYPA 5D4SA 1UHWA 3F8CA 3KP2A 2CYYA 1YO5C 3HTUA 3O2PE 3FMSA 3RKYA 5DEQA 5DV5A 3I53A 4RS8A 1IXSB 5ILUA 3GVAA 5CJ9A 5D6EA 2EA4A 4HQMA 3F23A 2GAUA 2HFHA 1BBYA 3L9FA 5HS7A 3FX3A 3WTYC 5DCFA 2VBWA 3NRVA 1R5GA 5FLXZ 2VOPA 5FLXK 5LGTA 2RC4A 5ICFA 1ZRDA 2O0YA 2A6EF 3G3ZA 3I5UA 2ZCWA 2R3SA 1K78A 3F8MA 2DLLA 1SFUA 2G9WA 4L9VA 1T98A 4LB5A 4I98B 2EB7A 2EFOA 1YW9A 3M9AA 5CVVA 1XDUA 3FXUA 5DUKA 2VXZA 2EFPA 5LHIA 2IP2A 1SD7A 4A5NA 4EM0B 2MA3A 3E6DA 4IXAA 4ENKA 2EFWA 4XSZF 2GXGA 3L00A 3LQQA 1KU3A 4OINF 2XAFA 2F5FA 4MQVA 2GZWA 5F64A 1XGSA 4XSXF 2GA1A 2GWRA 4FT8A 1D3YA 3GXOA 4KYWA 3M7GA 3V4GA 2CGPA 1XMKA 1BI2A 2NNYA 2P7VB 5BS6A 1PP7U 2YR2A 1TNTA 4CICA 2KIMA 1TW3A 4EMSA 1S6LA 1ONVA 3I64A 1KQ0A 4B09A 3T8RA 5AONA 5ED4A 1S8NA 5L3BA 3FF5A 2HYFA 3J81Z 1JGSA 2XAJA 2GQQA 2X4HA 4IPAA 3W6JB 3WTTC 3RPQA 4ZYGA 2M45A 1K79A 2PEXA 1YW8A 4AIKA 1ZGJA 1OPCA 3DF8A 2ZKZA 3KETA 2JZYA 1B6AA 2MH2A 2FMYA 1SD4A 1T39A 3V7CA 1B59A 2IPQX 3KCCA 1EV7A 1XSVA 4MTEA 4ZZDA 1KQ9A 3JSOA 3RKWA 1B9MA 4N9HA 3V8KA 5D8LB 2V1UA 3IHUA 2YPRA 1O7LA 4I02A 3KP5A 1FSHA 1SFXA 2EV6A 1TQIA 3QU3A 5DUIA 1O57A 2CO5A 4AIHA 1ZREA 5LBQA 4ETSA 3F6OA 3CLOA 4GYIA 4HQEA 1LVAA 4ESJA 2QUFA 3T1BA 1LDDA 1X3UA 3R6SA 2Z3YA 3T5XA 3KEOA 4O5VA 2FOKA 3VEPA 2DPDA 4KN7X 2DQRA 2K02A 2K86A 2V9VA 3F8BA 2COMA 3KP6A 4LLNA 4WWCA 3C3WA 2FNAA 2ZO4A 3KZZA 2Z9OA 1ZRFA 2EJRA 4Y15A 2VONA 4F7ZA 1MGTA 4MEXF 2EWNA 4HV6A 1RZ4A 2O6GE 2DW4A 5D6FA 4IRIA 3TOAA 1ZLJA 2VBZA 5K5QA 3ULQB 1T0FA 3FWEA 2M87A 4IRGA 2PG4A 1WQ2A 1USTA 2GIVA 3NQOA 3SXYA 3ZP5A 1QGPA 3T0YA 2IJLA 4KT5C 2V79A 4OU0A 5LLQA 5F6FA 1MZBA 1R22A 4A0XA 3KE2A 5DD4A 4RB3C 5F1RA 4MTDA 3FXQA 1P4XA 2VT3A 3K1PA 3CUQC 2HWVA 3JW4A 4HX4A 1RNLA 2QVOA 4U7BA 4ZH4F 2OQGA 1G3TA 3ELKA 1HKQA 4HA8A 2VOOA 4KNYA 2TDXA 5ICCA 5ERIA 4WCGA 2ZNZA 5BMZA 2BBYA 3COAC 4ZYEA 4U7DA 3O6BB 2WWYA 1PP8F 4KA4A 1FT9A 4P9UA 2F5DA 2A3SA 2ISYA 3HTSB 4JBAA 3SHFA 3ZMTA 4L9TA 3HRTA 1AWCA 4EM1A 2Z5UA 1UCRA 1FX7A 2NYXA 1ZG5A 4XLPF 2ZNYA 4LG0B 3ZN0A 3TDUC 2OBPA 2HTJA 1YG2A 1WKMA 3JTGA 5ICGA 2WTEA 2HGCA 2QYOA 2D2WA 1XMAA 2K27A 2DAOA 1PUEE 5H6QA 4KIFA 4LD5A 1SFEA 3NEUA 1HW2A 1U5TC 4M73A 4E70A 4OIRF 4UHTA 3FM5A 5L3EA 1WI9A 2A07F 1IXRC 2Z99A 4G94A 2M8EA 3V8JA 1ZN2A 2P4WA 2LF8A 5HDGA 1BI3A 4KMFA 3GZ5A 1U5TA 3F3XA 2D45A 2XV4S 3QU6A 2ZMEA 3HSFA 5E1ZB 1K78B 4MNUA 4K2EA 4I01A 2STTA 4KIGA 2HTSA 2EFQA 4WXCA 2PFBA 1FOKA 1Z9CA 4UNOA 4Q48A 3ECOA 1BIAA 3JSPA 3TDZC 4WXHA 1KQ8A 1YW7A 2XASA 1S7OA 5CVUA 2RVCA 1RUOA 4I0AA 4IVNA 2XROA 4U0YA 1UB9A 3VODA 5L3DA 1IUYA 2MBFA 3C18A 5BQTA 3WTZA 2JPCA 3B73A 2CQKA 3M8FA 3EYYA 5LGUA 3WE2A 1JXSA 3HOTA 5L3CA 1YIOA 2VC1A 2DT5A 3IKVA 3OV8A 2W85A 2UXNA 2RNJA 2UWMA 4EQQA 4R8HA 1D8JA 2XVCA 3QP6A 2FMLA 2ISZA 4KMUX 3WTUC 4KDPA 1YLFA 4L0YB 4O3MA 1ON2A 2FQ3A 5JR3A 5E18F 2H6BA 2QBYA 3V8LA 4M6YA 3I4PA 3U1DA 1G3YA 4A0ZA 1FC3A 3GFLA 2H09A 3PFIA 4I0BA 1BI0A 4G9YA 4RGRA 1H0MA 2ACJA 5LEKA 1JHFA 3SQNA 4EVIA 2OZUA 5DCMA 1U5TB 2XRNA 1WSUA 5HDNA 3BY6A 2VODA 1OMIA 2LF7A 1FBQA 3R61A 2L02A 5D8KB 2C6YA 1L0OC 1BC8C 2VC0A 2HDCA 1J0RA 3L2CA 3GFJA 3ERED 4P55A 2ESNA 1EH8A 3WG9A 1MJ9A 1TNSA 3HSEA 5ICEA 3J7AO 2J5PA 4MHGA 1U6GA 3J80K 3E6CC 1USSA 4YFKF 2QLZA 2QZ8A 3EETA 2D1HA 4ZZLA 3P9IA 3EUHA 4UVBA 3RJPA 3GZ6A 3I54A 2QBYB 3QAHA 2P8TA 1S3JA 4U0VA 1IF1A 3KP4A 4LLLA 3V7RA 1VTNC 5BOXA 5D5XB 2YX7A 2A5YB 1GHCA 1EH6A 4S05A 2CWEA 1GXQA 1QPMA 4HV5A 5CVJA 3R4KA 3WODF 1MKMA 1RUNA 2P5LC 1W5SA 4EJTA 3IC7A 2YSRA 5E1XA 5K1YA 1YS6A 2PN6A 4HZFA 1HKTA 2E7XA 3DQVC 1IXCA 1LNWA 4G6DA 3VFZA 5ILVA 2PBIA 4XRFA 1OR7A 1MJAA 1TQPA 4I09A 1CF7B 4CO8A 2EV0A 2E7WA 4LG0A 2FRHA 5HS8A 1FNNA 4RGSA 1B4AA 3D5LA 1O3TA 3REOA 1YTYA 4EJVA 5HLIA 2FBKA 3TKYA 4CXFA 3WTWC 4HOBA 3ZMDA 3OOPA 2FEZA 3F8FA 5DCMB 2W25A 1R1UA 2CG4A 3KP3A 4A5MA 4EJWA 4PGGA 4AD9A 1W7PA 2HQRA 1QZYA 4H0EA 4QWQA 2IA2A 2DK5A 2NAZA 3BZ6A 2DPUA 3MZHA 3GWZA 2Y48A 3EQLF 3LA7A 3K1MA 5DDGA 4M9XA 2AXLA 3DPTA 3GX4X 4YG2F 3IRRA 1QO0D 2GXBA 1FPQA 1IRGA 2QQ9A 3GEZA 2M30A 2Y0MA 2MD5A 1ODDA 2WC2A 3GFIA 3CUQB 1R5HA 4EM2A 3TO6A 2Y75A 4G7ZF 4AWXB 1FSEA 4R79A 3J81K 3DP7A 3I59A 3TO7A 3MFKA 3QPTA 4CYDA 2A69F 4PZJA 2XIGA 4M9ZA 1TW2A 1Z6RA 2DK8A 2RV8A 4GYGA 2H27A 1K6OA 4ZYHA 3B02A 1T2KA 2W57A 3KLOA 2XGXA 3FMQA 3IL2A 4MEYF 1W7PB 2QQAA 4BQAA 3R0JA 2A6HF 5LRSA 3F72A 3ZMUA 1A04A 3WGIA 2L3DA 4GGGA 5KVRA 5E1WA 2RN7A 1TQMA 3ZMSA 4I7HA 2A68F 5EEGA 2KIFA 4EGYA 2L4AA 4P5OA 2XUBA 3F22A 5E17F 3BOQA 2DFIA 2LNBA 4DQ2A 2KJCA 3U2RA 4OOIA 3WTVC 4PCQA 5BPDA 4KUMA 5JVTA 4LB6B 1KA8A 4OIPF 3Q9VA 5LGNA 3JTHA 1IAWA 2O8XA 4O6JA 4Q5SF 1XCVA 4D0PA 3GYHX 1BC7C 4P96A 2OQRA 1IN4A 6PAXA 1REPC 3E5QA 3P9KA 2BEOA 4UV8A 2M1BA 1W4MA 3JAMK 1G4DA 1TTYA 3ROUA 4BYYA 5H6RA 2QWWA 4PGHA 2FA5A 1FY7A 2PMUA 3LSTA 2MLGA 3HOSA 1JE8A 1XDSA 4U88A 3JAMZ 1G6NA 5D5VB 2LKPA 4UUVA 2K4BA 2ESHA 4I2OA 2IRFG 1TBXA 2HS5A 2KIUA 1UHMA 2JRTA 1R36A 4ENNA 4G8XA 5FO5A 1KYWA 3J80Z 2A61A 2JPBA 4JK1X 1HQCA 3QRFF 1ZG1A 3HRMA 3BP8A
chains in the Genus database with same CATH superfamily
1I1GA 1S7EA 2VQHA 3LAJA 1LEAA 4X6AJ 3ZQCA 3BJ6A 1SVLA 4HF2A 5EZGA 1S9HA 1XC5A 1T33A 3N4MA 1E17A 2IGOA 2OAZA 3ZPLA 5E3LA 4E7JA 1Y1WJ 4F93B 4Y13A 1I27A 1HBXG 2CQQA 2PMZN 5F1JA 2HVRA 1JT6A 1BM9A 3QODA 3O3KA 2QENA 2ZJPF 4LFUA 4L5JA 4ASNA 1F36A 2W48A 3BTCA 3SJMA 2EPFA 1IN8A 3MVPA 5FRMA 1X58A 2V7FA 3G1OA 1N78A 5IT9K 5FKKA 1HW1A 3E6MA 5EEHA 1D0ZA 2ELHA 3PFYA 4PJJA 4A2UA 4DOZA 3MMYB 1Y0UA 1YX5A 1J75A 2VE8A 4WF2A 2KRFA 2DQLA 1RKTA 3HRUA 2XF5A 2IT0A 4KIBA 4ZTFA 3IRQA 2QSGX 4FASD 1OJLA 3R0AA 4FTHA 2FXAA 4ANJA 3BPXA 4M72A 3RPUD 3L2VA 2CV2A 2FF4A 3CTAA 1R00A 2A6TA 3AAFA 3CCJI 3NWTA 2CQNA 3K10A 2CW0F 3ISPA 1QPIA 2FNPA 2KMUA 4PFPA 4FISA 1A35A 3M1EA 2P0WA 4Y7NJ 2W84A 4BEHA 2W24A 2HOAA 3FHNA 3WHCA 4C30A 4CCMA 3OYAA 2OTJI 3E5XA 1D1AA 3CF5F 2AO9A 1LVKA 2OCEA 4MIMA 4A69C 1P4AA 3HRSA 1BOAA 3HSRA 1GV5A 4PUSA 1XGNA 2BE5F 2AS5F 3TEDA 2J5OA 1R1TA 1SD6A 4Q47A 1BA5A 1JKPC 3E7LA 1LB2A 3OWTA 1VFCA 1MDMA 1U8RA 3BWGA 2EIJH 2F4OB 1VQPI 4CCOA 3C7JA 3P7NA 4HPQA 4FX4A 1T56A 3LAPA 4IQJA 2DJIA 3M4OJ 1V4RA 1P7JA 4IO9F 3OYMA 4CGZA 1R1VA 1D1BA 3GO5A 5E8IA 1DPRA 3Q5FA 5LEJA 3OYEA 3FXOA 2VJJA 5D5WB 1X3WB 4QSHA 3JRGA 1Z21A 2M5WA 2ZXJA 1IN6A 1J9IA 2H1LA 2L7FP 1WJDA 1UMQA 1LDKB 5K7ZA 5CQGA 1JHHA 4A0YA 2NVYJ 4NC7A 3L2QA 2XPWA 5JHFA 3MEXA 3RSNA 1BJZA 3ZRGA 2UZKA 3CP2A 3CCEI 3Q3SA 3OYLA 4RAZA 5CPRB 3ZXSA 1I3QJ 1XMXA 1HSJA 2EK5A 2M3AA 3HYIA 4PSWA 2IXSA 1F9NA 3LFKA 3S1QJ 2MC3A 4GDFA 2VUMJ 3PQJA 3BR2A 1MBGA 3GTPJ 5J4YA 1G3SA 3CO6C 4NDLA 2QQBA 1NHAA 3Q0VA 3GUDA 4B3AA 1LKXA 2F48A 1XGOA 1ZHFA 2PI0A 4HW0A 2XRLA 2HZTA 4OMZA 5C3EJ 3IH4A 2JUGA 1XN7A 2XF6A 4BUPA 1LE8B 1BJAA 2H8WA 5C4JJ 4HNTA 5FD5A 3MCZA 2P6TA 4MQ9F 4NB5A 2Y2ZA 3MKWB 5LRRA 2XGDA 3VOEA 5FFZA 1YI2I 1CF7A 3K0LA 3VYSB 4NQWA 3Q0WA 1T38A 4F91B 3HOYJ 3BJAA 1B8IA 2K3PA 2WAQA 5HODA 1LQ1A 3P9CA 1U9OA 2X6WA 4KJZA 2LSOA 1U2WA 2OU2A 1BN5A 4OAZA 1YJWI 1EH7A 3DWLE 2R93J 2O03A 2ZJ2A 3H92A 4NC8A 4ZTJA 1F5TA 1JUSA 4JQFA 2OA4A 1P92A 2LKXA 5JI6A 2STWA 3J7ZI 5LHHA 1OYIA 3GZNB 1P6RA 3TGNA 1B72A 1LDJA 1VQ6I 1ZGAA 1YFHA 2EIKH 2UXXA 2E35A 4V2GA 3CDLA 3TW7A 2JT1A 3WGGA 4RB0A 3OIOA 2BV6A 4N9IA 4UVCA 4XBFA 1F4KA 2PQ8A 4HDVA 3K4LA 2JA5J 3ZQIA 4HX7A 3FKIJ 3ASOH 3S16J 3OYCA 4M9SA 4UV9A 3ML6A 4B43A 4HNVA 4KN4X 4D9JA 1DDNA 3W6KB 4UY8I 2MW8A 4H4KC 3ZQ7A 3K70D 3L2WA 2R7UA 5DYMA 5CVRA 5ILSA 1PDNC 3FXJA 5CLSA 1ETKA 1W7PD 3CUOA 1HOMA 2H6CA 3CJNA 2DMTA 3A0HC 1LJ9A 2K7LA 1AHDP 1BIBA 4JYKA 4XN3A 4DYRA 1XGMA 4BY1J 1TWGJ 2K9NA 1DUXC 2FX0A 2G7HA 2NRAC 3BQZA 1G3WA 4GCVA 5TRDA 2CW8A 4DZJA 2Y0SN 2EFNA 4IHTA 2D5VA 2OPTA 4Y3OA 3GTMJ 1IN5A 1SVOA 4OIOF 3HUGB 2VBYA 1A6IA 2WV1A 5DTDA 1R58A 3C2HA 3A1YA 1HDPA 5EZHA 2HKXA 2F5CA 1R23A 4AIDA 4IHSA 3LFUA 1SD5A 1UELB 4V2FA 3Q9SA 2QM3A 4FCYA 4A3BJ 4FX0A 2H1KA 2YUSA 1Y0NA 2HEOA 5FROA 4L9JA 2JWTA 2PMHA 1BOBA 4M3EA 4LG3A 4FQGA 2OJED 3H3UA 1HSTA 2E1MC 3QP5A 1ETYA 1FYKA 2RGVA 3H5RA 1BI1A 2DFFA 2E19A 5AIQA 3FHZA 4IHWA 2L0KA 3A03A 2XPVA 5CVIA 3ZQQA 2JA6J 2NNNA 1LPQA 4BXUA 3VB2A 2MLKA 5J8CA 1C0WA 1JKOC 1KGSA 4YEJA 4C2UA 5BPIA 5DD8A 4M74A 2BGCA 2MC4A 3OYNA 3DCFA 1I6HJ 5LHGA 4RAYA 1YX3A 4BACA 1SFKA 1TC3C 2O61A 5TISC 5JFRA 1O7FA 5K5OA 2ADUA 2E1CA 2LY9A 3IWZA 1OYWA 3QPSA 4MLOA 2OZ6A 4IOAF 3PM1A 1H9GA 3EYIA 4Y17A 3DKWA 3DKYA 4ESFA 3ZN1A 1ULYA 1O3RA 4UUSB 2DT7B 3GW2A 4PDKA 5FKNA 5FGMA 2L2OA 1ZYRF 2ELKA 1U78A 4EJOA 1QNTA 2VJIA 2FE3A 3S1RJ 1SAUA 2I8DA 2ZMEB 3S32A 3AL0C 1DU0A 2IS6A 2DYRH 2DA5A 1WJBA 4S04A 3CMEI 1GVJA 2CSOA 2E5NA 2Q2EA 5HDKA 2FBHA 3FXRA 2B0LA 2ZXIA 3WTSC 5DM6F 1HW5A 3V7SA 5IT3A 1ZLKA 1YS7A 2BHZA 2HU9A 3DV8A 4HX8A 5AIPA 4CZZA 1LFUP 4R1HA 2A05A 1SMYF 1OCCH 4M71A 1DP7P 3I59B 1YQAA 2CFXA 3WTXC 2CUEA 4DJAA 4KFCA 3G1LA 2EZKA 1J5YA 2Z2SB 1D8KA 2IVMA 3BR6A 4X1EA 2KISA 4HBLA 3HOVJ 4QLCU 1ORKA 2Y31A 2XAQA 2B7EA 5GTHC 1D5VA 5GP9A 2BVMA 2LREA 2MFZA 1ZK8A 4N0BA 2DBBA 5B1BH 5E8GA 2JA2A 4BS9A 5J6XA 3ECHA 1X19A 1MDMB 2FOWA 4HAMA 2M0CA 1Z67A 2E5ZA 4QIWN 1MMSA 2FUG2 3QPHA 3FM3A 4ZYAA 3CO7C 2YU9J 2BYVE 1XCBA 2E1NA 4NBQA 3KFWX 4BQQA 2KT0A 4LLGF 1J59A 1KU9A 4XKWA 5IY5H 2KDZA 2P7CB 1H9TA 2V6CA 5F0CA 5JHUA 3ERMA 2VE9A 2BXZA 3NARA 4RAFA 1Y39A 3AG3H 5E20A 2HQ5A 3E97A 2HR3A 5J1UA 5CYVA 1R7JA 1KU2A 1J7KA 1EJ9A 3WU1B 2IW5A 2ZB9A 4BDYA 4ITVA 4A6EA 3HIFA 4YIIA 5HLGA 2XSJC 3I71A 1BW6A 3E3VA 4M3BA 1IJWC 4ESBA 2HYGD 2H94A 2EA2A 3TW6A 3M8EA 3S3MA 2FQ4A 3K9TA 3ZOBA 5FFXA 2V1DA 1Z7UA 1X4PA 4RBOA 3F21A 4LJZF 3D5RC 4L9NA 1YYVA 4EV0A 2PJRB 2R7DA 4BHCA 1VF9A 2LTPA 3LA2A 3K4JA 3JRHA 3BQYA 1IRXA 2VBXA 2NXNB 4MFEA 1FP2A 1B1BA 3RKQA 4DYCA 2PJPA 3RYRA 1U3EM 2ELJA 5E3NA 4WXDA 2YX4A 2MD0A 1XSDA 1YRNA 4WK8F 1U8BA 2R7ZJ 3O8GA 4HYEA 1G8XA 5EJCA 1F43A 1TWCJ 3EDPA 2MH9A 2JMWA 3CCUI 4XLCA 5J8FA 4MGRA 2XGCA 5F27A 1WH5A 3BPVA 4PFOA 2KFDA 1UHSA 4XLHA 3L7WA 2EIMH 2BXYA 3GFMA 3QYFA 3LSPA 4DNCA 2GA2A 4BHPA 1FBSA 5L3GA 1HKSA 3K69A 4NC6A 3I4NJ 1MD0A 1K4TA 2Q8KA 3H5NA 3G2BA 3KP7A 4KICA 1YIJI 1VQ9I 1R4NB 3HHGA 2DA1A 5BNGA 4JOMA 2JK3A 4B44A 1MNDA 3TMOA 1HF0A 3ZGKA 4NHJA 3WU0A 3S2DJ 4Y52J 1QVUA 2AQFA 2O3FA 4TV7A 1I1SA 1FWZA 1WH7A 2XHKA 4XL9A 4BE2A 2E2HJ 1Z05A 1GV2A 4YFXF 2FU4A 3DBRB 1DU6A 2RREA 2WY8Q 3MKLA 1Z6TA 4HLYA 3CUQA 1V55H 2DOAA 1RI7A 3IAM2 3VSKA 2RKHA 4JP0A 3X2QH 1AOYA 2KJBA 4XLNF 3HHHA 5A2QZ 4KISA 5J1RA 4CDGA 3LQRA 2L9NA 3MZYA 3VYRB 3DXJF 4FHTA 3TQNA 3ABTA 1Z91A 4U0WA 4D7NA 4B48A 2GM4A 2HPMA 2V1XA 3J7YJ 2Y9ZA 1KU7A 1IN7A 1D0YA 3SZPA 3SFZA 5FD6A 2GBYA 2KIQA 1ZRCA 1BL0A 3T8TA 2RDPA 3H3ZA 4EGZA 3FBNB 4HRIA 3BR3A 1XD7A 2M7AA 3KEYA 1OLTA 5H20A 3BJOA 4RLQA 4Z6YA 1ACIA 1P2FA 3BLYA 5KAIC 1RRJA 3ZMZA 1MNMC 2YU3A 3RIRA 3S2HJ 3KZYA 3ABUA 2L5QA 3CJRB 1QZEA 3FMRA 4FE7A 2QA4I 1V3FA 2P6SA 1FTZA 1X1CA 3GLLA 2KPMA 4ON0A 5L3FA 2R7TA 2DTRA 3R60A 3CJQB 2L54A 1OR7C 3ZMVA 3PQKA 4RB1A 3F8NA 3UNGC 3K70C 3H9JA 3D0SA 2LDUA 3H36A 1XB4A 1ZAOA 2K40A 4RMNA 3U9GA 3HOZJ 3JCUC 3GTLJ 2V1NA 2KKOA 4X0GA 2HQAA 5B5EC 1T95A 1K7AA 1E2XA 1B8IB 4WX9A 2VQLA 2W82A 2XAHA 5GTIC 2CMPA 2KHMA 1Q1HA 3BG7A 4NQWB 5B1AH 4HDUA 3CESA 2KRCA 3Q0UA 4UXNA 3OYHA 4YIFA 4YFNF 3TOBA 4S0HB 4HF0A 3HM5A 2TCTA 1UFMA 4LK0F 2WBMA 3OYKA 3E6BA 1T6SA 2JQ7A 2XKOA 3CMYA 1OKRA 2XF7A 4QPQA 3RTRA 2IA1A 3BROA 1Y6IA 1R4MB 3FZVA 5FB2A 3BR0A 4HEA2 4OMYA 2JVHA 3BDDA 1YRNB 4P9FA 1OYYA 3I0TA 1ZH5A 2JJ7A 2JTVA 5TJJA 4ZYDA 2RQPA 3G73A 1APLC 3JRCA 4BHBA 5IT9Z 2VJ4A 2NS0A 1AKHB 1ZG3A 3DFGA 1IC8A 1DPUA 4AUXA 1P4WA 4C2TA 4OIQF 5KK1A 5LD2C 2EV5A 3C1DA 1FLIA 2QF7A 3SYTA 3SFIA 1O3SA 4LK1F 2L01A 5EG0B 4LGWA 4KITB 5KAFC 4M6XA 2Z33A 3VDXA 2ZSHB 1FIPA 2ZMEC 3CC2I 4BH9A 3KEQA 2VXDA 4XRSG 5HOOA 2G7UA 4C2MJ 4LMYA 1GXPA 4HSTA 1TL8A 1MJBA 1STZA 1IG7A 1T08B 4L18B 2P5VA 2HI3A 5A2QK 1MBKA 1YITI 1SAXA 3CCVI 3GLXA 3KLNA 2F2EA 1JJ8C 3DPLC 2E2JJ 3WE3A 1I5ZA 3OS2A 3UKGA 3RDIA 2ZFWA 4RGUA 3RKXA 2QEXI 3BG3A 2HKOA 2PX9A 2D1VA 5GAEJ 1B9NA 3LSHA 3V42A 2Q0OA 3F6VA 2DOFA 2XAUA 3DLAA 4GXOA 1IRFA 1Z1DA 2EZIA 4L5IA 3OS0A 2DI3A 1FYLA 5HLHA 4XKVA 4AIJA 4A12A 1LEBA 3LA3A 1E3OC 2W00A 5C44J 4DYQA 2CQXA 2FSWA 1KYZA 1WWXA 2QGUA 3DLLF 1ZARA 3N97A 1O3QA 2FD5A 2DMQA 2M34A 3L2RA 1F1ZA 1XG1A 1XTAA 3KIOA 4BAYA 4G6QA 4BNCA 1QBJA 4A3EJ 2XAGA 1Z3XA 1LFPA 4B8XA 2P5KA 1WRJA 1MBJA 1L3LA 3K4MA 3DEUA 2FBIA 1FZPB 3S93A 2VKVA 4G7HF 3OYGA 3IKTA 4AVPA 4CHUA 1KZHA 1HA8A 2R7RA 2WADA 1RIOH 5D5UB 2JSCA 5EF6A 4RA2A 3JREA 4M3DA 3PNVA 3S2WA 4A6DA 4RGXA 1TLHB 1FBUA 3A0BC 3CMAI 4Q4ZF 5IOZA 2GOMA 4IJAA 3DKXA 2K4JA 4GO1A 4AYBN 3HC7A 1S29A 1S7AA 2CU7A 2OD5A 1IW7F 2MYSA 3E5UA 2X0LA 5IOYA 1VQOI 4CH7A 2VN2A 1SMTA 2DOEA 3QOPA 4XNFA 3FK6A 2PLYA 2NOGA 2IGKA 1VI0A 2HNHA 1NTCA 2M4GA 3CCMI 1EA3A 4JX5A 1I3AA 2ZBKA 1WCMJ 2UV1A 1QHGA 2DA4A 3H9GA 3VSLA 3WG7H 1JGGA 1J2XA 2ETHA 5E3MA 5FLMJ 1FP1D 3DPUA 3IWFA 1IZ1A 3CP8A 2DU9A 1A36A 2E1OA 3HXLA 4XKCA 2M4KA 2B9SA 3ZQLA 4EJUA 2E34A 3FXMA 1WVRA 1OCTC 3ABKH 1IV8A 3OY9A 3MQ0A 3L09A 3I58A 4XK4A 4HLXA 2F5EA 2X51A 1CGPA 1MNEA 4IZZA 2HOEA 2DO7A 1XSXA 2CRGA 3LWFA 1W5TA 3CDHA 3MN2A 5D4RA 1QZZA 2M2EA 5EEAA 3HUGA 4N4OB 1FYMA 3QPLA 2VASA 1U9NA 4Z2YA 1I6XA 3GF2A 1X4OA 2BY0A 4XONA 4FETA 3L1PA 5E3OA 3MAJA 1YJ9I 4II3A 1V5GA 5FKOA 3PSIA 3RQ4A 1QQIA 4BQNA 1JJ6C 5HS9A 1ON1A 5HVQC 3K1NA 4I76A 2BOLA 1FMWA 3WGHA 1VQ7I 4C3JJ 4HF1A 1JI8A 1JT0A 2HQNA 1VZ0A 2GOXB 3ABMH 4UVAA 1MBHA 3TO9A 3K2ZA 2IA0A 2BY3A 5CKTA 4IF4A 2L4MA 2QSHX 3MWMA 5EDNA 4RB2C 3RI4A 3BG6A 4XRMA 2NOJB 2X6XA 4ENMA 4XLAA 4G7OF 4ENJA 5K5RA 4E7IA 1HXDA 4XQFA 3SZTA 2Y9YA 2F5VA 2M9HA 1LE8A 3HOUJ 2WV0A 2LRDA 2R7FA 4L0ZB 4IRHA 2VT2A 3RPUA 2XKPA 1NG6A 2LY2A 3RYPA 5D4SA 1UHWA 3TP0A 1UG2A 1WJ5A 4G6TB 3F8CA 3W2AA 2W7NA 3KP2A 2CYYA 1YO5C 3HTUA 5KNLA 4I99C 1Z0XA 3FDYA 4OAYA 3O2PE 3FMSA 5IPAA 3RKYA 5DEQA 5DV5A 1Y8QB 3I53A 4RS8A 3QQAA 4DW6A 1IXSB 5ILUA 1IUFA 3GVAA 4M6VA 4A3LJ 2E36A 5CJ9A 5D6EA 2EA4A 4HQMA 3F23A 2GAUA 3ASNH 3NAUA 2HFHA 2DMUA 4AVZA 1HLVA 1BBYA 3L9FA 5HS7A 4II2A 3AG1H 1TWHJ 3FBIB 3ABLH 3HKZN 3CCQI 2E2IJ 1OCZH 1IO2A 3FX3A 1QHHD 3WTYC 1DQUA 5DCFA 2LFBA 1R49A 2VBWA 1RESA 3NRVA 1R5GA 3I56I 5FLXZ 3QOEA 3LNQA 2VOPA 5FLXK 2HDWA 3HPGA 2MSYA 4XOTA 5LGTA 2RC4A 5ICFA 3ZQGA 2DMPA 1ZRDA 3OOUA 5EG0A 2O0YA 4BE0A 2A6EF 3G3ZA 3S14J 3I5UA 2ZCWA 2R3SA 1K78A 3F8MA 2DLLA 1JUMA 3PL8A 1SFUA 2G9WA 4P1WA 4L9VA 1T98A 2BHYA 2VPLA 4ZJZA 4LB5A 2EILH 2AHQA 3CC4I 3ZR8X 2WY7Q 3ZCOA 4I98B 2R7WA 2EB7A 2EFOA 1I50J 1YW9A 2E1MB 3M9AA 5CVVA 1XDUA 3FXUA 5DUKA 2VXZA 1AA7A 2EFPA 4QPOA 5LHIA 1GVDA 2QCOA 1TWAJ 5JLWA 2IP2A 2O9LA 1SD7A 3S3NA 2LC2A 2YS9A 3K7AJ 1OCOH 2JVGA 4PJ0C 3P5JA 4A5NA 4EM0B 2MA3A 3E6DA 4IXAA 5FJ8J 4ENKA 1MBFA 4XSZF 2GXGA 3L00A 4NUBA 2EFWA 3EUAA 3LQQA 1KU3A 5F0HA 4BBSJ 4OINF 5C4XJ 4L5EA 2XAFA 2F5FA 4MQVA 2GZWA 5F64A 1XGSA 1Q1VA 4XSXF 2OTLI 5B66C 3IH2A 3BTJA 3S3OA 4CCJA 3CCLI 1YJNI 1MSEC 2K3FA 2QSFX 2GA1A 2VKEA 1IV6A 2GWRA 4FT8A 1D3YA 3GXOA 3OL4A 3GMEA 1OISA 2Q1ZB 5EGOB 2VI6A 4KYWA 3M7GA 1R9TJ 2CUZA 3V4GA 1UAAA 1NH3A 2CGPA 1XMKA 1BI2A 4B1RA 1PUFB 2NNYA 5GADJ 2P7VB 5BS6A 1PP7U 4AM3A 3RQIA 3KYLA 1N75A 1NK2P 2YR2A 1TNTA 2LVSA 4CICA 2KIMA 4BJ6C 3VYTB 1X3ZB 3B6AA 2HVSA 1TW3A 4EMSA 1S6LA 1ONVA 1D5YA 3I64A 1KQ0A 3CCRI 4B09A 4XR6A 1JKQC 2V6EA 3T8RA 2WAQN 5AONA 1G2HA 5ED4A 2HXOA 3UR3C 1S8NA 4BGDA 2OUMA 5L3BA 3FF5A 1HCRA 2HYFA 3SEQA 3PIOF 2ZJRF 3N05A 1JGSA 3J81Z 4KT6A 2XAJA 3OR1C 1BW5A 2GQQA 3GTGJ 2X4HA 4W1UA 2KDOA 4IPAA 3W6JB 1VQKI 3WTTC 3RPQA 1ETVA 4ZYGA 2M45A 3FISA 4Y4RA 1WFXA 3PO3J 4A3DJ 1K79A 2PEXA 4W97A 1MSFC 3BCAA 3QWLA 5M5YJ 4HSRA 1FOWA 2V9KA 1YW8A 2L7ZA 3JRFA 3CCSI 4AIKA 1ZGJA 1PJRA 1OPCA 3DF8A 1T8IA 3I4MJ 2ZKZA 3KETA 2K9QA 4DBQA 2JZYA 1B6AA 4XLFA 3H5AA 2MH2A 4HG2A 2I5UA 2FMYA 1WJFA 1SD4A 1T39A 3V7CA 5J4VA 1B59A 2IPQX 3KCCA 1EV7A 1XSVA 3GTJJ 3TL4X 1S72I 4MTEA 2AXTC 4ZZDA 3PUBA 2O8KA 1KQ9A 3JSOA 2ZSIB 3RKWA 1X1AA 1B9MA 3PJRA 4N9HA 3V8KA 4D7MA 1D1CA 5D8LB 2V1UA 3IHUA 3HGGA 2KRHA 2YPRA 1O7LA 5FLVA 4I02A 3KP5A 5J47A 2ID6A 1FSHA 1VQMI 1SFXA 4RDUA 2EV6A 1ETWA 1TQIA 3QU3A 5DUIA 1O57A 2CO5A 2X85A 1V5FA 1ZELA 3I9V2 4AIHA 3M07A 2R5ZB 1ZREA 5LBQA 4BQOA 3BR1A 4ETSA 3F6OA 3CLOA 4GYIA 1WPKA 3AG2H 5IP6A 5K7FA 3OYFA 4HQEA 1LVAA 4ESJA 1IRZA 2QUFA 3BR5A 2NS8A 2LR8A 3T1BA 1W5CC 1LDDA 1X3UA 3R6SA 1K61A 3GTQJ 2JN6A 2Z3YA 3T5XA 3LMMA 3CMMA 4U87A 3KEOA 4O5VA 4DIQA 1SEUA 2CUFA 2FOKA 3VEPA 3FXKA 3PIPF 2PJRA 2DPDA 4KN7X 4BBRJ 4XORA 2DQRA 2K02A 2IGMA 2CQ7A 3M1CA 1RETA 2K86A 3SDGA 2X6YA 4CCNA 2V9VA 3F8BA 2COMA 2R4GA 1JKRC 3KP6A 4LLNA 4WWCA 1WJEA 3C3WA 1MIJA 2FNAA 2ZO4A 2VQGA 3KZZA 1WJCA 3G6EI 2Z9OA 2GIZA 1BR2A 4CCLA 2CH0A 1ZRFA 4GFBA 1OQYA 2EJRA 4Y15A 2VONA 4F52A 4F7ZA 1MGTA 1DGRM 2BZTA 2EWNA 4MEXF 1A6QA 1RKWA 3OIPA 2R7VA 3F0CA 1YOVB 3HBLA 3BG5A 4HV6A 1RZ4A 3QYEA 2O6GE 2LK2A 1WGXA 2DW4A 5D6FA 4IRIA 3TOAA 2COBA 1RPWA 2RAEA 3BZKA 1ZLJA 2VJ5A 4C3IJ 2VBZA 1ENHA 1GUUA 1ZTRA 5K5QA 3HEFA 2BW3B 3AFHA 3ULQB 1T0FA 2ME6A 2V9PA 5IP7J 3FWEA 2M87A 4IRGA 2PG4A 1WQ2A 1EKEA 2XB0X 3JRIA 1USTA 2GIVA 3NQOA 4E7HA 3SXYA 3ZP5A 1FEXA 3A02A 5JVGF 2WB1A 1QGPA 3T0YA 1Y56A 2IJLA 1ETXA 1XX5A 2F4MB 4KT5C 2KP6A 2NVUB 2V26A 2V79A 4OU0A 4CSWA 2CV0A 1W0TA 1X1PA 5LLQA 5F6FA 4A3FJ 4XM3A 1MZBA 1R22A 1ZGWA 4A0XA 3KE2A 5DD4A 4RB3C 5F1RA 4C3HJ 4MTDA 1SVMA 2EBIA 3CCYA 3FXQA 4UB6C 3MD2A 1P4XA 5IP9J 2VT3A 3K1PA 3CUQC 3HDDA 2HWVA 3JW4A 2GLOA 4HX4A 1RNLA 2QVOA 2WA0A 4U7BA 1WZ2A 4M3FA 4A3IJ 4ZH4F 3OMYA 3A4CA 2X9DA 1X2MA 2OQGA 3E0JB 1G3TA 3ELKA 1HKQA 1JTYA 4HA8A 3ONQA 2O5RA 1RR8C 2KQRA 2MGQA 1YE9A 2VOOA 4KNYA 2TDXA 5ICCA 5ERIA 3IUOA 3IAS2 4WCGA 4BL0B 2ZNZA 5BMZA 2BBYA 5M3MJ 2CV1A 1MMDA 2ZC2A 2HVQA 3DEEA 4B3XA 3COAC 2EZHA 4A3KJ 4ZYEA 4U7DA 3U1KA 4RM2A 3BCBA 3O6BB 4YIRX 3DBLB 1WHUA 2WWYA 1T0FC 4E7KA 1PP8F 4KA4A 1FT9A 4ZDLA 4J00A 4P9UA 5M5WJ 2Y0SA 2F5DA 1A31A 2A3SA 2ISYA 3D5SC 3W3CA 3HTSB 4V19K 4JBAA 3SHFA 3ZMTA 3D1NI 3WHBA 1MW7A 2DA2A 2M0MA 1XPXA 5DM7F 4L9TA 3HRTA 4GRIA 4EM1A 1AWCA 2HDDA 2Z5UA 1UCRA 1FX7A 3KPHA 1RC9A 2NYXA 1ZG5A 4XLPF 1HC8A 2K9LA 2ZNYA 4LG0B 3AL0B 3FXLA 3ZN0A 4IKFA 3TDUC 1Z77A 1ERDA 5F08A 2OBPA 2HTJA 4XMYA 5F04A 1YG2A 1WKMA 3DEWA 3JTGA 5ICGA 2WTEA 1QA6A 2HGCA 2QYOA 4N4NB 4AU7A 2D2WA 3LL7A 1XMAA 1WI3A 4NNJA 1PUFA 2JUCA 2OC6A 2K27A 3OSFA 2FJ1A 2DAOA 1PUEE 5H6QA 4KIFA 4LD5A 1P9QC 1SFEA 3NEUA 4C9YA 3CLQA 1HW2A 1U5TC 2K9SA 4M73A 4E70A 4OIRF 4UHTA 3FM5A 5L3EA 4J01A 3S15J 2R5ZA 2LG4A 2X48A 4G12A 1WI9A 1NK3P 5HNHA 2A07F 1IXRC 2Z99A 4XOPA 2XDVA 4G94A 2DDAA 2M8EA 1PVEA 3DU6A 3V8JA 1LFBA 1ZN2A 2P4WA 3HOXJ 2LF8A 4A3JJ 5HDGA 5FKLA 2ECBA 3H1CA 1YHQI 1BI3A 4KMFA 3QYBA 4JX6A 1ZQ3P 2K9MA 3GZ5A 3JRBA 4BY7J 3PNTA 1U5TA 2WAEA 2F4IA 3H9QA 3F3XA 2Q2EB 3MZ8A 2D45A 2VLAA 2VB6A 2XV4S 2DA3A 3QU6A 2IGNA 5GPCA 2ZMEA 3HSFA 2CFOA 1QU3A 5E1ZB 1K78B 4MNUA 4K2EA 4I01A 2STTA 2KZGA 4KIGA 1OCPA 4E6KG 2HTSA 2EFQA 3K4CA 1MH4A 2PFBA 2DCEA 4WXCA 3H0DA 1CQTA 4DBRA 2F6CA 1UZCA 1FOKA 1Z9CA 4UNOA 4Q48A 1E0EA 1MMAA 3ECOA 1BIAA 4D1QA 3JSPA 1EF4A 1TZLA 3TDZC 4WXHA 2VKHA 1KQ8A 1YW7A 2XASA 1ZKGA 1S7OA 2PMZA 5CVUA 2IBDA 2RVCA 1SFOJ 1RUOA 1W1WE 3BTLA 2ECCA 2L9SA 4DZPA 1ITYA 1VQ4I 3G1MA 4I0AA 4IVNA 2XROA 2XB5A 3LSKA 4U0YA 5KHDA 1MMGA 1UB9A 3VODA 5L3DA 1XS9A 2LKSA 3EUHC 1IUYA 2MBFA 2K5CA 2CS3A 3C18A 5BQTA 3WTZA 2JPCA 3B73A 2LOOA 2CQKA 4LIVA 3M8FA 3EYYA 2LP0A 5LGUA 3WE2A 5K7HA 1JXSA 3HOTA 3RZOJ 1TT0A 5L3CA 1YIOA 2VC1A 1VQNI 2DT5A 3SZGA 3IKVA 3OV8A 4UB8C 2W85A 2UXNA 2VKDA 2L9VA 2RNJA 3HL2A 3OYJA 2G0EA 2Z1DA 4A3MJ 2UWMA 4EQQA 2DN0A 1DGWY 4R8HA 5EGOA 3CZ6A 1PYVA 4D5FA 1UJ8A 1D8JA 1VNDA 1KONA 3HG9A 5J1YA 3A01A 2XVCA 4PSXA 3QP6A 1POGA 2FMLA 2LYCA 2X1EA 2OV7A 1LUJB 4KMUX 3VPRA 4CYCB 3WTUC 2ISZA 4KDPA 1YLFA 5E18F 1ON2A 2FQ3A 5JR3A 2NVXJ 1AU7A 2H6BA 3I3LA 2QBYA 4L0YB 4O3MA 3CD6I 3V8LA 4M6YA 4IOCF 3BC8A 3I4PA 3U1DA 4XN0A 3HGYA 3IV5A 1G3YA 4A0ZA 3BTIA 1FC3A 3CF2A 3GFLA 1FMVA 2H09A 3PFIA 4I0BA 1VQ5I 1BI0A 4G9YA 4RGRA 1H0MA 1V54H 2CUJA 2ACJA 5LEKA 1JHFA 3SQNA 3LSJA 4EVIA 2R5YA 2OZUA 4CUGA 2ME0A 2ZXHA 3L2UA 5DCMA 5GAGJ 1U5TB 2XRNA 2W1OA 1WSUA 1DP3A 5HDNA 3BY6A 2VODA 2R5YB 2L9RA 1OMIA 1WJAA 4BDZA 2LF7A 1FBQA 2R0QC 3R61A 2KL4A 1A5JA 2L02A 2VL8A 3AG4H 5D8KB 2C6YA 1L0OC 2DODA 2RNGA 1BC8C 3FK7A 2VC0A 2M7BA 2HDCA 1J0RA 3G4SI 3L2CA 3HOWJ 3GFJA 2Y30A 3CQZJ 3ERED 2E71A 2QKLB 4P55A 3A2KA 2ESNA 1EH8A 3WG9A 3DTIA 1MJ9A 1TNSA 3HSEA 1X2NA 1TP4A 2EH3A 5ICEA 2CW7A 3J7AO 2JRMA 3F9KA 5IYCJ 2P81A 3RZDJ 2LD5A 2J5PA 4MHGA 5FRNA 4ZDOA 2KLOA 3PSFA 3HJEA 1U6GA 3J80K 3E6CC 2QQ8A 1USSA 1U0JA 1R6RA 2QLZA 1RR7A 2QZ8A 4YFKF 2IS2A 3HZJA 3EETA 3BG9A 2D1HA 4ZZLA 3P9IA 2LLKA 5M3FJ 3EUHA 4UVBA 4LOCA 3RJPA 3GZ6A 2LMDA 3K4BA 2KZVA 3GTKJ 3I54A 2QBYB 3QAHA 3OR2C 2P8TA 1S3JA 4U0VA 1IF1A 3KP4A 4F3QA 4A3CJ 3DBHB 1H89C 1JTXA 1J09A 4LLLA 3V7RA 1VTNC 3OYBA 5BOXA 5D5XB 4DGWB 1OCRH 1ETQA 2YX7A 2A5YB 1GHCA 2QKMB 1EH6A 4S05A 2CWEA 3BT9A 4BXXJ 1GXQA 1ETOA 1QPMA 4HV5A 5CVJA 3OSGA 4F92B 2RQQA 3R4KA 2IS4A 4I6ZA 1FOXA 3LSIA 4IQ4A 2R7XA 3WODF 1MKMA 1MBEA 1RUNA 2LY1A 2LH9A 2P5LC 1W5SA 4EJTA 2HXIA 3IC7A 3JR9A 2YSRA 5E1XA 5DS9A 5K1YA 1NG7A 1YS6A 2PN6A 4HZFA 5HNFA 1HKTA 2E7XA 3TP3A 2DTZA 3DQVC 1IXCA 4XRSA 3OYDA 1LNWA 4G6DA 3VFZA 4B4CA 3DTEA 5KCMA 5ILVA 3H0GJ 2PBIA 2CJJA 4XRFA 1W0UA 1AKHA 3PNYA 9ANTA 1JUPA 2LBFB 3LSGA 1OR7A 3ESWB 4E7LA 1MJAA 3GBGA 4CZCA 3S1MJ 3S1NJ 1S5LC 1TQPA 2L7MP 4Y33A 3MKZA 4I09A 3B6CA 3CDIA 1CF7B 2XGEA 1Y8RB 4CO8A 4EEFG 4BEHB 2EV0A 2E7WA 4LG0A 4OWRB 2FRHA 5HS8A 1FNNA 4RGSA 4BJ5C 1B4AA 1IGNA 2R7SA 3K4NA 5E79C 1W36C 3D5LA 3K4KA 1O3TA 3S17J 2WB1N 3REOA 2XSDC 1YTYA 4EJVA 1G59A 5HLIA 2FBKA 2OF7A 3TKYA 1I39A 4CXFA 2DFEA 3WTWC 1GLNA 4HOBA 3ZMDA 3OOPA 5LFAA 2JSPA 1QRYA 3NWSA 5J3LA 2BY1A 2DFHA 2FEZA 3VYUB 3F8FA 4MO7A 5DCMB 3KYDB 2W25A 1R1UA 2CG4A 3KP3A 2R7QA 2M8GX 4A5MA 2DJNA 4EJWA 2N8GA 4PGGA 4AD9A 2X6OA 1W7PA 3PO2J 1GDTA 2ZXWH 3TBIA 1K4SA 3DU5A 4CA0A 2HQRA 4IL6C 1QZYA 4H0EA 2BVLA 2DA7A 1O4XA 2R7OA 2XC7A 1E3HA 4LIUA 3FIWA 5EYRA 4E7SA 4QWQA 2IA2A 2K85A 1Z7LA 4E7ZA 1R71A 5HLTA 2DK5A 2NAZA 2HPIA 3BZ6A 2DPUA 3MZHA 3JRDA 4CYCA 4XICA 3C2BA 3GWZA 2Y48A 4ABZA 3EQLF 3LA7A 5B3SH 3A01B 3K1MA 2HOTA 5DDGA 2EQRA 4M9XA 4BXFA 2AXLA 2DXIA 3DPTA 4IEJA 1TWFJ 3GX4X 4YG2F 3IRRA 1W36D 4QTRA 1QO0D 1MMNA 2GXBA 3MKYB 2AQEA 5GAHJ 1FPQA 1IRGA 3SEZA 2H8RA 2QQ9A 2NVTJ 3GEZA 2M30A 2Y0MA 2MD5A 1ODDA 2WC2A 5H2FC 3GFIA 3IP4B 1H88C 3CUQB 3S8PA 2BY2A 1FJLA 1VQLI 1R5HA 4EM2A 3TO6A 5IYDJ 3ZQFA 4IHXA 1M1EB 2Y75A 2MG4A 1UG0A 4G7ZF 4AWXB 3OYIA 1FSEA 4E4HA 4PJNA 4R79A 3J81K 4IHVA 3DP7A 3I59A 3TO7A 1VQ8I 2DDBA 3C2GA 3HB9A 2VPRA 4PJMA 4AC0A 3ZQHA 3O8HA 3OIQA 3E1SA 5M5XJ 3MFKA 3CC7I 3QPTA 4CYDA 3LSMA 2A69F 4PZJA 2XIGA 4M9ZA 1TW2A 1Z6RA 1OFCX 2DK8A 2RV8A 3VWBA 4GYGA 2H27A 4BE1A 2O7OA 3CJTB 1K6OA 4ZYHA 3B02A 1ZR2A 2W57A 3HPHA 2A5WA 2XGXA 3KLOA 3FMQA 1T2KA 3IL2A 4MEYF 4RM3A 1W7PB 1HDDC 2QQAA 4BQAA 2V4JC 3R0JA 3J7AY 4UUTA 4A3GJ 2A6HF 5LRSA 3F72A 3ZMUA 4RAGA 1A04A 4ZC3A 4RLFA 3EPZA 3WGIA 4LITA 2L3DA 4GGGA 4EATA 5KVRA 1K6YA 2HOSA 4JX4A 2BW3A 4IHYA 5E1WA 4AYBA 1FIAA 2RN7A 1TQMA 3HKZA 1V5EA 3DTKA 4I7HA 3ZMSA 2IAIA 4YELA 2A68F 5EEGA 2KIFA 4EGYA 2L7KA 2L4AA 3IH3A 4P5OA 2XUBA 3F22A 1H8AC 5E17F 3W6VA 3BOQA 1QVTA 2DFIA 4BKXA 2LNBA 4DQ2A 2KJCA 3U2RA 4OOIA 3WTVC 3KX2A 4PCQA 5BPDA 2DA6A 4KUMA 5JVTA 3K6GA 1KA8A 4LB6B 5IYBJ 1IDYA 4OIPF 3GTOJ 2TRTA 3Q9VA 4XIDA 1SANA 2I10A 1K83J 1N25A 3H35A 5LGNA 3OL3A 3JTHA 4F55A 1IAWA 2O8XA 2UUZA 4O6JA 3WU2C 4Q5SF 2X1DA 3KYCB 3LSRA 4M3GA 2E60A 2ID3A 2Z16A 2R92J 3RCOA 1TT5B 1P7IA 1XCVA 3KZIC 4D0PA 1SC7A 2VIXA 3GYHX 1BC7C 4P96A 3W2VA 4BJTA 2NS7A 2OQRA 2Y69H 2OCCH 1IN4A 3BZCA 3FKJA 4CCKA 6PAXA 1REPC 3G71I 4BU2A 4XKBA 4IX7A 3E5QA 3P9KA 3U21A 2BEOA 2JA7J 1GT0C 1N77A 1BR4A 2X1CA 2HYJA 4UV8A 2M1BA 1W4MA 2W4SA 3JAMK 1G4DA 1E3PA 1TTYA 4PK4A 3ROUA 5F0FA 2MABA 4BYYA 3GCMA 2EZLA 5H6RA 1IDZA 4FE4A 2QWWA 5J40A 4PGHA 2EINH 2FA5A 2GXAA 4XLEA 2B63J 2IS1A 1FY7A 3OS1A 3W2WA 2LBFA 2XPUA 3I55I 3M3YJ 2HZDA 2PMUA 3LSTA 4YRVA 3JRAA 2JA8J 1B72B 2DT6A 2MLGA 3HOSA 1JE8A 1XDSA 4U88A 3JAMZ 2ZFUA 4MFDA 2WAFA 1G6NA 5D5VB 2LKPA 1ZR4A 4UUVA 1R5ID 3EUKL 3PUFA 2K4BA 3H3VK 2ESHA 1D0XA 4PJLA 4I2OA 2IRFG 2IEKA 2ZJQF 5TGTA 1TBXA 1X1BA 4B47A 5FKMA 1Z3YA 2HS5A 4D5CA 5JLXA 3K2AA 2KIUA 5GPAA 4UUSA 1UHMA 2JRTA 1Y1VJ 1R36A 3LOCA 4ENNA 2DMNA 4G8XA 3AKZA 2DYSH 5FO5A 2NVQJ 1MH3A 1FOYA 1KYWA 3J80Z 1BR1A 2A61A 2JPBA 4JK1X 5CQEA 3M8JA 1X1DA 3SDBA 1HQCA 4J19A 4HNUA 3QRFF 1FTTA 2VQCA 1ZG1A 3HRMA 3BP8A 2ICWG 4A93J 4ZDPA
chains in the Genus database with same CATH topology
1I1GA 3LAJA 1LEAA 3BJ6A 4HF2A 3N4MA 1E17A 2OAZA 3ZPLA 4Y13A 1I27A 1HBXG 1BM9A 3O3KA 2QENA 4LFUA 4L5JA 4ASNA 1IN8A 5IT9K 1HW1A 3E6MA 5EEHA 2ELHA 4A2UA 1Y0UA 1J75A 2VE8A 4WF2A 2KRFA 2DQLA 3HRUA 2IT0A 4KIBA 3IRQA 3R0AA 2FXAA 3BPXA 4M72A 2FF4A 3CTAA 1R00A 3AAFA 2CW0F 3ISPA 2FNPA 3M1EA 2W84A 2W24A 3E5XA 1P4AA 3HRSA 1BOAA 3HSRA 1XGNA 2BE5F 2AS5F 2J5OA 1R1TA 1SD6A 4Q47A 1LB2A 1MDMA 1U8RA 3BWGA 3C7JA 3P7NA 4FX4A 3LAPA 1V4RA 4CGZA 1R1VA 3GO5A 5E8IA 1DPRA 3Q5FA 5LEJA 5D5WB 2M5WA 2ZXJA 1IN6A 1J9IA 1LDKB 1JHHA 4A0YA 2UZKA 3MEXA 4RAZA 1HSJA 2EK5A 3HYIA 3LFKA 1F9NA 2MC3A 3PQJA 1G3SA 3CO6C 2QQBA 1NHAA 3GUDA 1XGOA 1ZHFA 2PI0A 4HW0A 2HZTA 4OMZA 1XN7A 1BJAA 5FD5A 3MCZA 2P6TA 4MQ9F 4NB5A 5LRRA 3VOEA 5FFZA 1CF7A 3K0LA 4NQWA 1T38A 3BJAA 1LQ1A 3P9CA 2LSOA 1U2WA 2OU2A 1BN5A 1EH7A 2O03A 2ZJ2A 3H92A 1F5TA 4JQFA 2OA4A 1P92A 5JI6A 2STWA 5LHHA 1OYIA 1P6RA 3TGNA 1LDJA 1ZGAA 1YFHA 2UXXA 3WGGA 2JT1A 4RB0A 4XBFA 2BV6A 4N9IA 4UVCA 1F4KA 2PQ8A 4HDVA 4HX7A 4M9SA 4UV9A 3ML6A 4KN4X 1DDNA 3W6KB 3ZQ7A 5DYMA 5CVRA 5ILSA 1PDNC 5CLSA 1W7PD 3CUOA 2H6CA 3CJNA 1LJ9A 2K7LA 1BIBA 1XGMA 1DUXC 2G7HA 2NRAC 1G3WA 4GCVA 5TRDA 2EFNA 4IHTA 1IN5A 4OIOF 2VBYA 1R58A 2HKXA 2F5CA 1R23A 4IHSA 1SD5A 3Q9SA 2QM3A 4FX0A 2HEOA 4L9JA 2PMHA 3H3UA 1HSTA 3QP5A 1FYKA 2RGVA 1BI1A 3FHZA 5AIQA 5CVIA 2NNNA 4BXUA 3VB2A 2MLKA 5J8CA 1C0WA 1KGSA 5BPIA 5DD8A 4M74A 2BGCA 5LHGA 4RAYA 2O61A 5JFRA 1O7FA 5K5OA 2ADUA 2E1CA 3IWZA 1OYWA 2OZ6A 1H9GA 3EYIA 4Y17A 3DKWA 4ESFA 3ZN1A 1ULYA 1O3RA 3GW2A 4PDKA 5FGMA 1ZYRF 1U78A 4EJOA 1QNTA 2FE3A 2ZMEB 4S04A 1GVJA 2CSOA 2Q2EA 5HDKA 2FBHA 3FXRA 2B0LA 3WTSC 1HW5A 3V7SA 5IT3A 1ZLKA 1YS7A 5AIPA 4HX8A 3DV8A 4CZZA 4R1HA 1SMYF 4M71A 1DP7P 3I59B 1YQAA 2CFXA 3WTXC 4KFCA 1J5YA 1D8KA 2IVMA 4HBLA 4QLCU 2XAQA 1D5VA 4N0BA 2DBBA 5E8GA 5J6XA 3ECHA 1MDMB 4HAMA 3QPHA 3FM3A 3CO7C 2BYVE 2E1NA 1XCBA 3KFWX 4LLGF 1J59A 1KU9A 2P7CB 1H9TA 2V6CA 5JHUA 2VE9A 5E20A 3E97A 2HR3A 5CYVA 1R7JA 1KU2A 1J7KA 3WU1B 2IW5A 4A6EA 3HIFA 4YIIA 5HLGA 3I71A 3E3VA 4ESBA 2HYGD 2H94A 2EA2A 3M8EA 3K9TA 5FFXA 2V1DA 1Z7UA 3F21A 4LJZF 4EV0A 4L9NA 1YYVA 2R7DA 4BHCA 3LA2A 2VBXA 1FP2A 1B1BA 2PJPA 3RYRA 1U3EM 4WXDA 2YX4A 1XSDA 4WK8F 4HYEA 2MH9A 3EDPA 5J8FA 4MGRA 3BPVA 3L7WA 3GFMA 4DNCA 2GA2A 4BHPA 5L3GA 1FBSA 1HKSA 3K69A 1MD0A 2Q8KA 3KP7A 4KICA 3HHGA 4NHJA 3WU0A 2O3FA 4TV7A 1I1SA 1FWZA 2XHKA 1Z05A 4YFXF 2FU4A 4HLYA 1Z6TA 3CUQA 1RI7A 2RKHA 1AOYA 2KJBA 4XLNF 3HHHA 5A2QZ 4CDGA 3LQRA 3MZYA 3DXJF 4FHTA 3TQNA 3ABTA 1Z91A 4U0WA 2V1XA 1KU7A 1IN7A 3SZPA 3SFZA 5FD6A 1ZRCA 3T8TA 2RDPA 3H3ZA 4EGZA 1XD7A 5H20A 3BJOA 1P2FA 3ZMZA 2YU3A 3RIRA 3KZYA 3ABUA 3FMRA 1V3FA 2P6SA 4ON0A 5L3FA 2DTRA 3R60A 2L54A 3ZMVA 3PQKA 4RB1A 3F8NA 3D0SA 2LDUA 1XB4A 1ZAOA 3U9GA 2KKOA 1K7AA 1E2XA 4WX9A 2XAHA 1Q1HA 4HDUA 4UXNA 4YIFA 4YFNF 3TOBA 4HF0A 1UFMA 4LK0F 3E6BA 1T6SA 2XKOA 1OKRA 3RTRA 2IA1A 3BROA 4OMYA 3FZVA 5FB2A 3BDDA 4P9FA 1OYYA 3I0TA 1ZH5A 2JTVA 5TJJA 4ZYDA 2RQPA 3G73A 4BHBA 5IT9Z 2NS0A 1ZG3A 3DFGA 1DPUA 1P4WA 4OIQF 5KK1A 2EV5A 3C1DA 1FLIA 1O3SA 4LK1F 2L01A 4LGWA 4M6XA 2Z33A 4BH9A 3KEQA 5HOOA 2G7UA 1GXPA 4LMYA 1MJBA 1STZA 4L18B 2P5VA 5A2QK 1SAXA 3GLXA 3KLNA 2F2EA 3DPLC 3WE3A 1I5ZA 3RDIA 2ZFWA 4RGUA 3RKXA 2HKOA 2D1VA 1B9NA 2Q0OA 3F6VA 4GXOA 1IRFA 1Z1DA 4L5IA 2DI3A 1FYLA 5HLHA 4A12A 4AIJA 1LEBA 3LA3A 2FSWA 1KYZA 1WWXA 1ZARA 3N97A 1O3QA 1F1ZA 4BAYA 4G6QA 4BNCA 1QBJA 2XAGA 4B8XA 2P5KA 1WRJA 1L3LA 3DEUA 2FBIA 1FZPB 4G7HF 3IKTA 4AVPA 4CHUA 1RIOH 5D5UB 2JSCA 3S2WA 4A6DA 4RGXA 1TLHB 1FBUA 4Q4ZF 4IJAA 2K4JA 4GO1A 1S29A 1S7AA 2OD5A 1IW7F 3E5UA 2X0LA 2VN2A 1SMTA 3QOPA 2PLYA 2ZBKA 1J2XA 2ETHA 1FP1D 3IWFA 1IZ1A 2DU9A 4EJUA 3MQ0A 3L09A 3I58A 4HLXA 2F5EA 1CGPA 2HOEA 2DO7A 1XSXA 3LWFA 1W5TA 3CDHA 5D4RA 1QZZA 3HUGA 1FYMA 4Z2YA 1I6XA 3GF2A 3MAJA 1QQIA 5HS9A 1ON1A 5HVQC 3K1NA 3WGHA 4HF1A 2HQNA 4UVAA 3TO9A 3K2ZA 2IA0A 4IF4A 2L4MA 3MWMA 4RB2C 3RI4A 4ENMA 4G7OF 4ENJA 5K5RA 1HXDA 3SZTA 2WV0A 2R7FA 4L0ZB 4IRHA 2VT2A 3RPUA 2XKPA 3RYPA 5D4SA 1UHWA 3F8CA 3KP2A 2CYYA 1YO5C 3HTUA 3O2PE 3FMSA 3RKYA 5DEQA 5DV5A 3I53A 4RS8A 1IXSB 5ILUA 3GVAA 5CJ9A 5D6EA 2EA4A 4HQMA 3F23A 2GAUA 2HFHA 1BBYA 3L9FA 5HS7A 3FX3A 3WTYC 5DCFA 2VBWA 3NRVA 1R5GA 5FLXZ 2VOPA 5FLXK 5LGTA 2RC4A 5ICFA 1ZRDA 2O0YA 2A6EF 3G3ZA 3I5UA 2ZCWA 2R3SA 1K78A 3F8MA 2DLLA 1SFUA 2G9WA 4L9VA 1T98A 4LB5A 4I98B 2EB7A 2EFOA 1YW9A 3M9AA 5CVVA 1XDUA 3FXUA 5DUKA 2VXZA 2EFPA 5LHIA 2IP2A 1SD7A 4A5NA 4EM0B 2MA3A 3E6DA 4IXAA 4ENKA 2EFWA 4XSZF 2GXGA 3L00A 3LQQA 1KU3A 4OINF 2XAFA 2F5FA 4MQVA 2GZWA 5F64A 1XGSA 4XSXF 2GA1A 2GWRA 4FT8A 1D3YA 3GXOA 4KYWA 3M7GA 3V4GA 2CGPA 1XMKA 1BI2A 2NNYA 2P7VB 5BS6A 1PP7U 2YR2A 1TNTA 4CICA 2KIMA 1TW3A 4EMSA 1S6LA 1ONVA 3I64A 1KQ0A 4B09A 3T8RA 5AONA 5ED4A 1S8NA 5L3BA 3FF5A 2HYFA 3J81Z 1JGSA 2XAJA 2GQQA 2X4HA 4IPAA 3W6JB 3WTTC 3RPQA 4ZYGA 2M45A 1K79A 2PEXA 1YW8A 4AIKA 1ZGJA 1OPCA 3DF8A 2ZKZA 3KETA 2JZYA 1B6AA 2MH2A 2FMYA 1SD4A 1T39A 3V7CA 1B59A 2IPQX 3KCCA 1EV7A 1XSVA 4MTEA 4ZZDA 1KQ9A 3JSOA 3RKWA 1B9MA 4N9HA 3V8KA 5D8LB 2V1UA 3IHUA 2YPRA 1O7LA 4I02A 3KP5A 1FSHA 1SFXA 2EV6A 1TQIA 3QU3A 5DUIA 1O57A 2CO5A 4AIHA 1ZREA 5LBQA 4ETSA 3F6OA 3CLOA 4GYIA 4HQEA 1LVAA 4ESJA 2QUFA 3T1BA 1LDDA 1X3UA 3R6SA 2Z3YA 3T5XA 3KEOA 4O5VA 2FOKA 3VEPA 2DPDA 4KN7X 2DQRA 2K02A 2K86A 2V9VA 3F8BA 2COMA 3KP6A 4LLNA 4WWCA 3C3WA 2FNAA 2ZO4A 3KZZA 2Z9OA 1ZRFA 2EJRA 4Y15A 2VONA 4F7ZA 1MGTA 4MEXF 2EWNA 4HV6A 1RZ4A 2O6GE 2DW4A 5D6FA 4IRIA 3TOAA 1ZLJA 2VBZA 5K5QA 3ULQB 1T0FA 3FWEA 2M87A 4IRGA 2PG4A 1WQ2A 1USTA 2GIVA 3NQOA 3SXYA 3ZP5A 1QGPA 3T0YA 2IJLA 4KT5C 2V79A 4OU0A 5LLQA 5F6FA 1MZBA 1R22A 4A0XA 3KE2A 5DD4A 4RB3C 5F1RA 4MTDA 3FXQA 1P4XA 2VT3A 3K1PA 3CUQC 2HWVA 3JW4A 4HX4A 1RNLA 2QVOA 4U7BA 4ZH4F 2OQGA 1G3TA 3ELKA 1HKQA 4HA8A 2VOOA 4KNYA 2TDXA 5ICCA 5ERIA 4WCGA 2ZNZA 5BMZA 2BBYA 3COAC 4ZYEA 4U7DA 3O6BB 2WWYA 1PP8F 4KA4A 1FT9A 4P9UA 2F5DA 2A3SA 2ISYA 3HTSB 4JBAA 3SHFA 3ZMTA 4L9TA 3HRTA 1AWCA 4EM1A 2Z5UA 1UCRA 1FX7A 2NYXA 1ZG5A 4XLPF 2ZNYA 4LG0B 3ZN0A 3TDUC 2OBPA 2HTJA 1YG2A 1WKMA 3JTGA 5ICGA 2WTEA 2HGCA 2QYOA 2D2WA 1XMAA 2K27A 2DAOA 1PUEE 5H6QA 4KIFA 4LD5A 1SFEA 3NEUA 1HW2A 1U5TC 4M73A 4E70A 4OIRF 4UHTA 3FM5A 5L3EA 1WI9A 2A07F 1IXRC 2Z99A 4G94A 2M8EA 3V8JA 1ZN2A 2P4WA 2LF8A 5HDGA 1BI3A 4KMFA 3GZ5A 1U5TA 3F3XA 2D45A 2XV4S 3QU6A 2ZMEA 3HSFA 5E1ZB 1K78B 4MNUA 4K2EA 4I01A 2STTA 4KIGA 2HTSA 2EFQA 4WXCA 2PFBA 1FOKA 1Z9CA 4UNOA 4Q48A 3ECOA 1BIAA 3JSPA 3TDZC 4WXHA 1KQ8A 1YW7A 2XASA 1S7OA 5CVUA 2RVCA 1RUOA 4I0AA 4IVNA 2XROA 4U0YA 1UB9A 3VODA 5L3DA 1IUYA 2MBFA 3C18A 5BQTA 3WTZA 2JPCA 3B73A 2CQKA 3M8FA 3EYYA 5LGUA 3WE2A 1JXSA 3HOTA 5L3CA 1YIOA 2VC1A 2DT5A 3IKVA 3OV8A 2W85A 2UXNA 2RNJA 2UWMA 4EQQA 4R8HA 1D8JA 2XVCA 3QP6A 2FMLA 2ISZA 4KMUX 3WTUC 4KDPA 1YLFA 4L0YB 4O3MA 1ON2A 2FQ3A 5JR3A 5E18F 2H6BA 2QBYA 3V8LA 4M6YA 3I4PA 3U1DA 1G3YA 4A0ZA 1FC3A 3GFLA 2H09A 3PFIA 4I0BA 1BI0A 4G9YA 4RGRA 1H0MA 2ACJA 5LEKA 1JHFA 3SQNA 4EVIA 2OZUA 5DCMA 1U5TB 2XRNA 1WSUA 5HDNA 3BY6A 2VODA 1OMIA 2LF7A 1FBQA 3R61A 2L02A 5D8KB 2C6YA 1L0OC 1BC8C 2VC0A 2HDCA 1J0RA 3L2CA 3GFJA 3ERED 4P55A 2ESNA 1EH8A 3WG9A 1MJ9A 1TNSA 3HSEA 5ICEA 3J7AO 2J5PA 4MHGA 1U6GA 3J80K 3E6CC 1USSA 4YFKF 2QLZA 2QZ8A 3EETA 2D1HA 4ZZLA 3P9IA 3EUHA 4UVBA 3RJPA 3GZ6A 3I54A 2QBYB 3QAHA 2P8TA 1S3JA 4U0VA 1IF1A 3KP4A 4LLLA 3V7RA 1VTNC 5BOXA 5D5XB 2YX7A 2A5YB 1GHCA 1EH6A 4S05A 2CWEA 1GXQA 1QPMA 4HV5A 5CVJA 3R4KA 3WODF 1MKMA 1RUNA 2P5LC 1W5SA 4EJTA 3IC7A 2YSRA 5E1XA 5K1YA 1YS6A 2PN6A 4HZFA 1HKTA 2E7XA 3DQVC 1IXCA 1LNWA 4G6DA 3VFZA 5ILVA 2PBIA 4XRFA 1OR7A 1MJAA 1TQPA 4I09A 1CF7B 4CO8A 2EV0A 2E7WA 4LG0A 2FRHA 5HS8A 1FNNA 4RGSA 1B4AA 3D5LA 1O3TA 3REOA 1YTYA 4EJVA 5HLIA 2FBKA 3TKYA 4CXFA 3WTWC 4HOBA 3ZMDA 3OOPA 2FEZA 3F8FA 5DCMB 2W25A 1R1UA 2CG4A 3KP3A 4A5MA 4EJWA 4PGGA 4AD9A 1W7PA 2HQRA 1QZYA 4H0EA 4QWQA 2IA2A 2DK5A 2NAZA 3BZ6A 2DPUA 3MZHA 3GWZA 2Y48A 3EQLF 3LA7A 3K1MA 5DDGA 4M9XA 2AXLA 3DPTA 3GX4X 4YG2F 3IRRA 1QO0D 2GXBA 1FPQA 1IRGA 2QQ9A 3GEZA 2M30A 2Y0MA 2MD5A 1ODDA 2WC2A 3GFIA 3CUQB 1R5HA 4EM2A 3TO6A 2Y75A 4G7ZF 4AWXB 1FSEA 4R79A 3J81K 3DP7A 3I59A 3TO7A 3MFKA 3QPTA 4CYDA 2A69F 4PZJA 2XIGA 4M9ZA 1TW2A 1Z6RA 2DK8A 2RV8A 4GYGA 2H27A 1K6OA 4ZYHA 3B02A 1T2KA 2W57A 3KLOA 2XGXA 3FMQA 3IL2A 4MEYF 1W7PB 2QQAA 4BQAA 3R0JA 2A6HF 5LRSA 3F72A 3ZMUA 1A04A 3WGIA 2L3DA 4GGGA 5KVRA 5E1WA 2RN7A 1TQMA 3ZMSA 4I7HA 2A68F 5EEGA 2KIFA 4EGYA 2L4AA 4P5OA 2XUBA 3F22A 5E17F 3BOQA 2DFIA 2LNBA 4DQ2A 2KJCA 3U2RA 4OOIA 3WTVC 4PCQA 5BPDA 4KUMA 5JVTA 4LB6B 1KA8A 4OIPF 3Q9VA 5LGNA 3JTHA 1IAWA 2O8XA 4O6JA 4Q5SF 1XCVA 4D0PA 3GYHX 1BC7C 4P96A 2OQRA 1IN4A 6PAXA 1REPC 3E5QA 3P9KA 2BEOA 4UV8A 2M1BA 1W4MA 3JAMK 1G4DA 1TTYA 3ROUA 4BYYA 5H6RA 2QWWA 4PGHA 2FA5A 1FY7A 2PMUA 3LSTA 2MLGA 3HOSA 1JE8A 1XDSA 4U88A 3JAMZ 1G6NA 5D5VB 2LKPA 4UUVA 2K4BA 2ESHA 4I2OA 2IRFG 1TBXA 2HS5A 2KIUA 1UHMA 2JRTA 1R36A 4ENNA 4G8XA 5FO5A 1KYWA 3J80Z 2A61A 2JPBA 4JK1X 1HQCA 3QRFF 1ZG1A 3HRMA 3BP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1G A;  3LAJ A;  1LEA A;  3BJ6 A;  4HF2 A;  3N4M A;  1E17 A;  2OAZ A;  3ZPL A;  4Y13 A;  1I27 A;  1HBX G;  1BM9 A;  3O3K A;  2QEN A;  4LFU A;  4L5J A;  4ASN A;  1IN8 A;  5IT9 K;  1HW1 A;  3E6M A;  5EEH A;  2ELH A;  4A2U A;  1Y0U A;  1J75 A;  2VE8 A;  4WF2 A;  2KRF A;  2DQL A;  3HRU A;  2IT0 A;  4KIB A;  3IRQ A;  3R0A A;  2FXA A;  3BPX A;  4M72 A;  2FF4 A;  3CTA A;  1R00 A;  3AAF A;  2CW0 F;  3ISP A;  2FNP A;  3M1E A;  2W84 A;  2W24 A;  3E5X A;  1P4A A;  3HRS A;  1BOA A;  3HSR A;  1XGN A;  2BE5 F;  2AS5 F;  2J5O A;  1R1T A;  1SD6 A;  4Q47 A;  1LB2 A;  1MDM A;  1U8R A;  3BWG A;  3C7J A;  3P7N A;  4FX4 A;  3LAP A;  1V4R A;  4CGZ A;  1R1V A;  3GO5 A;  5E8I A;  1DPR A;  3Q5F A;  5LEJ A;  5D5W B;  2M5W A;  2ZXJ A;  1IN6 A;  1J9I A;  1LDK B;  1JHH A;  4A0Y A;  2UZK A;  3MEX A;  4RAZ A;  1HSJ A;  2EK5 A;  3HYI A;  3LFK A;  1F9N A;  2MC3 A;  3PQJ A;  1G3S A;  3CO6 C;  2QQB A;  1NHA A;  3GUD A;  1XGO A;  1ZHF A;  2PI0 A;  4HW0 A;  2HZT A;  4OMZ A;  1XN7 A;  1BJA A;  5FD5 A;  3MCZ A;  2P6T A;  4MQ9 F;  4NB5 A;  5LRR A;  3VOE A;  5FFZ A;  1CF7 A;  3K0L A;  4NQW A;  1T38 A;  3BJA A;  1LQ1 A;  3P9C A;  2LSO A;  1U2W A;  2OU2 A;  1BN5 A;  1EH7 A;  2O03 A;  2ZJ2 A;  3H92 A;  1F5T A;  4JQF A;  2OA4 A;  1P92 A;  5JI6 A;  2STW A;  5LHH A;  1OYI A;  1P6R A;  3TGN A;  1LDJ A;  1ZGA A;  1YFH A;  2UXX A;  3WGG A;  2JT1 A;  4RB0 A;  4XBF A;  2BV6 A;  4N9I A;  4UVC A;  1F4K A;  2PQ8 A;  4HDV A;  4HX7 A;  4M9S A;  4UV9 A;  3ML6 A;  4KN4 X;  1DDN A;  3W6K B;  3ZQ7 A;  5DYM A;  5CVR A;  5ILS A;  1PDN C;  5CLS A;  1W7P D;  3CUO A;  2H6C A;  3CJN A;  1LJ9 A;  2K7L A;  1BIB A;  1XGM A;  1DUX C;  2G7H A;  2NRA C;  1G3W A;  4GCV A;  5TRD A;  2EFN A;  4IHT A;  1IN5 A;  4OIO F;  2VBY A;  1R58 A;  2HKX A;  2F5C A;  1R23 A;  4IHS A;  1SD5 A;  3Q9S A;  2QM3 A;  4FX0 A;  2HEO A;  4L9J A;  2PMH A;  3H3U A;  1HST A;  3QP5 A;  1FYK A;  2RGV A;  1BI1 A;  3FHZ A;  5AIQ A;  5CVI A;  2NNN A;  4BXU A;  3VB2 A;  2MLK A;  5J8C A;  1C0W A;  1KGS A;  5BPI A;  5DD8 A;  4M74 A;  2BGC A;  5LHG A;  4RAY A;  2O61 A;  5JFR A;  1O7F A;  5K5O A;  2ADU A;  2E1C A;  3IWZ A;  1OYW A;  2OZ6 A;  1H9G A;  3EYI A;  4Y17 A;  3DKW A;  4ESF A;  3ZN1 A;  1ULY A;  1O3R A;  3GW2 A;  4PDK A;  5FGM A;  1ZYR F;  1U78 A;  4EJO A;  1QNT A;  2FE3 A;  2ZME B;  4S04 A;  1GVJ A;  2CSO A;  2Q2E A;  5HDK A;  2FBH A;  3FXR A;  2B0L A;  3WTS C;  1HW5 A;  3V7S A;  5IT3 A;  1ZLK A;  1YS7 A;  5AIP A;  4HX8 A;  3DV8 A;  4CZZ A;  4R1H A;  1SMY F;  4M71 A;  1DP7 P;  3I59 B;  1YQA A;  2CFX A;  3WTX C;  4KFC A;  1J5Y A;  1D8K A;  2IVM A;  4HBL A;  4QLC U;  2XAQ A;  1D5V A;  4N0B A;  2DBB A;  5E8G A;  5J6X A;  3ECH A;  1MDM B;  4HAM A;  3QPH A;  3FM3 A;  3CO7 C;  2BYV E;  2E1N A;  1XCB A;  3KFW X;  4LLG F;  1J59 A;  1KU9 A;  2P7C B;  1H9T A;  2V6C A;  5JHU A;  2VE9 A;  5E20 A;  3E97 A;  2HR3 A;  5CYV A;  1R7J A;  1KU2 A;  1J7K A;  3WU1 B;  2IW5 A;  4A6E A;  3HIF A;  4YII A;  5HLG A;  3I71 A;  3E3V A;  4ESB A;  2HYG D;  2H94 A;  2EA2 A;  3M8E A;  3K9T A;  5FFX A;  2V1D A;  1Z7U A;  3F21 A;  4LJZ F;  4EV0 A;  4L9N A;  1YYV A;  2R7D A;  4BHC A;  3LA2 A;  2VBX A;  1FP2 A;  1B1B A;  2PJP A;  3RYR A;  1U3E M;  4WXD A;  2YX4 A;  1XSD A;  4WK8 F;  4HYE A;  2MH9 A;  3EDP A;  5J8F A;  4MGR A;  3BPV A;  3L7W A;  3GFM A;  4DNC A;  2GA2 A;  4BHP A;  5L3G A;  1FBS A;  1HKS A;  3K69 A;  1MD0 A;  2Q8K A;  3KP7 A;  4KIC A;  3HHG A;  4NHJ A;  3WU0 A;  2O3F A;  4TV7 A;  1I1S A;  1FWZ A;  2XHK A;  1Z05 A;  4YFX F;  2FU4 A;  4HLY A;  1Z6T A;  3CUQ A;  1RI7 A;  2RKH A;  1AOY A;  2KJB A;  4XLN F;  3HHH A;  5A2Q Z;  4CDG A;  3LQR A;  3MZY A;  3DXJ F;  4FHT A;  3TQN A;  3ABT A;  1Z91 A;  4U0W A;  2V1X A;  1KU7 A;  1IN7 A;  3SZP A;  3SFZ A;  5FD6 A;  1ZRC A;  3T8T A;  2RDP A;  3H3Z A;  4EGZ A;  1XD7 A;  5H20 A;  3BJO A;  1P2F A;  3ZMZ A;  2YU3 A;  3RIR A;  3KZY A;  3ABU A;  3FMR A;  1V3F A;  2P6S A;  4ON0 A;  5L3F A;  2DTR A;  3R60 A;  2L54 A;  3ZMV A;  3PQK A;  4RB1 A;  3F8N A;  3D0S A;  2LDU A;  1XB4 A;  1ZAO A;  3U9G A;  2KKO A;  1K7A A;  1E2X A;  4WX9 A;  2XAH A;  1Q1H A;  4HDU A;  4UXN A;  4YIF A;  4YFN F;  3TOB A;  4HF0 A;  1UFM A;  4LK0 F;  3E6B A;  1T6S A;  2XKO A;  1OKR A;  3RTR A;  2IA1 A;  3BRO A;  4OMY A;  3FZV A;  5FB2 A;  3BDD A;  4P9F A;  1OYY A;  3I0T A;  1ZH5 A;  2JTV A;  5TJJ A;  4ZYD A;  2RQP A;  3G73 A;  4BHB A;  5IT9 Z;  2NS0 A;  1ZG3 A;  3DFG A;  1DPU A;  1P4W A;  4OIQ F;  5KK1 A;  2EV5 A;  3C1D A;  1FLI A;  1O3S A;  4LK1 F;  2L01 A;  4LGW A;  4M6X A;  2Z33 A;  4BH9 A;  3KEQ A;  5HOO A;  2G7U A;  1GXP A;  4LMY A;  1MJB A;  1STZ A;  4L18 B;  2P5V A;  5A2Q K;  1SAX A;  3GLX A;  3KLN A;  2F2E A;  3DPL C;  3WE3 A;  1I5Z A;  3RDI A;  2ZFW A;  4RGU A;  3RKX A;  2HKO A;  2D1V A;  1B9N A;  2Q0O A;  3F6V A;  4GXO A;  1IRF A;  1Z1D A;  4L5I A;  2DI3 A;  1FYL A;  5HLH A;  4A12 A;  4AIJ A;  1LEB A;  3LA3 A;  2FSW A;  1KYZ A;  1WWX A;  1ZAR A;  3N97 A;  1O3Q A;  1F1Z A;  4BAY A;  4G6Q A;  4BNC A;  1QBJ A;  2XAG A;  4B8X A;  2P5K A;  1WRJ A;  1L3L A;  3DEU A;  2FBI A;  1FZP B;  4G7H F;  3IKT A;  4AVP A;  4CHU A;  1RIO H;  5D5U B;  2JSC A;  3S2W A;  4A6D A;  4RGX A;  1TLH B;  1FBU A;  4Q4Z F;  4IJA A;  2K4J A;  4GO1 A;  1S29 A;  1S7A A;  2OD5 A;  1IW7 F;  3E5U A;  2X0L A;  2VN2 A;  1SMT A;  3QOP A;  2PLY A;  2ZBK A;  1J2X A;  2ETH A;  1FP1 D;  3IWF A;  1IZ1 A;  2DU9 A;  4EJU A;  3MQ0 A;  3L09 A;  3I58 A;  4HLX A;  2F5E A;  1CGP A;  2HOE A;  2DO7 A;  1XSX A;  3LWF A;  1W5T A;  3CDH A;  5D4R A;  1QZZ A;  3HUG A;  1FYM A;  4Z2Y A;  1I6X A;  3GF2 A;  3MAJ A;  1QQI A;  5HS9 A;  1ON1 A;  5HVQ C;  3K1N A;  3WGH A;  4HF1 A;  2HQN A;  4UVA A;  3TO9 A;  3K2Z A;  2IA0 A;  4IF4 A;  2L4M A;  3MWM A;  4RB2 C;  3RI4 A;  4ENM A;  4G7O F;  4ENJ A;  5K5R A;  1HXD A;  3SZT A;  2WV0 A;  2R7F A;  4L0Z B;  4IRH A;  2VT2 A;  3RPU A;  2XKP A;  3RYP A;  5D4S A;  1UHW A;  3F8C A;  3KP2 A;  2CYY A;  1YO5 C;  3HTU A;  3O2P E;  3FMS A;  3RKY A;  5DEQ A;  5DV5 A;  3I53 A;  4RS8 A;  1IXS B;  5ILU A;  3GVA A;  5CJ9 A;  5D6E A;  2EA4 A;  4HQM A;  3F23 A;  2GAU A;  2HFH A;  1BBY A;  3L9F A;  5HS7 A;  3FX3 A;  3WTY C;  5DCF A;  2VBW A;  3NRV A;  1R5G A;  5FLX Z;  2VOP A;  5FLX K;  5LGT A;  2RC4 A;  5ICF A;  1ZRD A;  2O0Y A;  2A6E F;  3G3Z A;  3I5U A;  2ZCW A;  2R3S A;  1K78 A;  3F8M A;  2DLL A;  1SFU A;  2G9W A;  4L9V A;  1T98 A;  4LB5 A;  4I98 B;  2EB7 A;  2EFO A;  1YW9 A;  3M9A A;  5CVV A;  1XDU A;  3FXU A;  5DUK A;  2VXZ A;  2EFP A;  5LHI A;  2IP2 A;  1SD7 A;  4A5N A;  4EM0 B;  2MA3 A;  3E6D A;  4IXA A;  4ENK A;  2EFW A;  4XSZ F;  2GXG A;  3L00 A;  3LQQ A;  1KU3 A;  4OIN F;  2XAF A;  2F5F A;  4MQV A;  2GZW A;  5F64 A;  1XGS A;  4XSX F;  2GA1 A;  2GWR A;  4FT8 A;  1D3Y A;  3GXO A;  4KYW A;  3M7G A;  3V4G A;  2CGP A;  1XMK A;  1BI2 A;  2NNY A;  2P7V B;  5BS6 A;  1PP7 U;  2YR2 A;  1TNT A;  4CIC A;  2KIM A;  1TW3 A;  4EMS A;  1S6L A;  1ONV A;  3I64 A;  1KQ0 A;  4B09 A;  3T8R A;  5AON A;  5ED4 A;  1S8N A;  5L3B A;  3FF5 A;  2HYF A;  3J81 Z;  1JGS A;  2XAJ A;  2GQQ A;  2X4H A;  4IPA A;  3W6J B;  3WTT C;  3RPQ A;  4ZYG A;  2M45 A;  1K79 A;  2PEX A;  1YW8 A;  4AIK A;  1ZGJ A;  1OPC A;  3DF8 A;  2ZKZ A;  3KET A;  2JZY A;  1B6A A;  2MH2 A;  2FMY A;  1SD4 A;  1T39 A;  3V7C A;  1B59 A;  2IPQ X;  3KCC A;  1EV7 A;  1XSV A;  4MTE A;  4ZZD A;  1KQ9 A;  3JSO A;  3RKW A;  1B9M A;  4N9H A;  3V8K A;  5D8L B;  2V1U A;  3IHU A;  2YPR A;  1O7L A;  4I02 A;  3KP5 A;  1FSH A;  1SFX A;  2EV6 A;  1TQI A;  3QU3 A;  5DUI A;  1O57 A;  2CO5 A;  4AIH A;  1ZRE A;  5LBQ A;  4ETS A;  3F6O A;  3CLO A;  4GYI A;  4HQE A;  1LVA A;  4ESJ A;  2QUF A;  3T1B A;  1LDD A;  1X3U A;  3R6S A;  2Z3Y A;  3T5X A;  3KEO A;  4O5V A;  2FOK A;  3VEP A;  2DPD A;  4KN7 X;  2DQR A;  2K02 A;  2K86 A;  2V9V A;  3F8B A;  2COM A;  3KP6 A;  4LLN A;  4WWC A;  3C3W A;  2FNA A;  2ZO4 A;  3KZZ A;  2Z9O A;  1ZRF A;  2EJR A;  4Y15 A;  2VON A;  4F7Z A;  1MGT A;  4MEX F;  2EWN A;  4HV6 A;  1RZ4 A;  2O6G E;  2DW4 A;  5D6F A;  4IRI A;  3TOA A;  1ZLJ A;  2VBZ A;  5K5Q A;  3ULQ B;  1T0F A;  3FWE A;  2M87 A;  4IRG A;  2PG4 A;  1WQ2 A;  1UST A;  2GIV A;  3NQO A;  3SXY A;  3ZP5 A;  1QGP A;  3T0Y A;  2IJL A;  4KT5 C;  2V79 A;  4OU0 A;  5LLQ A;  5F6F A;  1MZB A;  1R22 A;  4A0X A;  3KE2 A;  5DD4 A;  4RB3 C;  5F1R A;  4MTD A;  3FXQ A;  1P4X A;  2VT3 A;  3K1P A;  3CUQ C;  2HWV A;  3JW4 A;  4HX4 A;  1RNL A;  2QVO A;  4U7B A;  4ZH4 F;  2OQG A;  1G3T A;  3ELK A;  1HKQ A;  4HA8 A;  2VOO A;  4KNY A;  2TDX A;  5ICC A;  5ERI A;  4WCG A;  2ZNZ A;  5BMZ A;  2BBY A;  3COA C;  4ZYE A;  4U7D A;  3O6B B;  2WWY A;  1PP8 F;  4KA4 A;  1FT9 A;  4P9U A;  2F5D A;  2A3S A;  2ISY A;  3HTS B;  4JBA A;  3SHF A;  3ZMT A;  4L9T A;  3HRT A;  1AWC A;  4EM1 A;  2Z5U A;  1UCR A;  1FX7 A;  2NYX A;  1ZG5 A;  4XLP F;  2ZNY A;  4LG0 B;  3ZN0 A;  3TDU C;  2OBP A;  2HTJ A;  1YG2 A;  1WKM A;  3JTG A;  5ICG A;  2WTE A;  2HGC A;  2QYO A;  2D2W A;  1XMA A;  2K27 A;  2DAO A;  1PUE E;  5H6Q A;  4KIF A;  4LD5 A;  1SFE A;  3NEU A;  1HW2 A;  1U5T C;  4M73 A;  4E70 A;  4OIR F;  4UHT A;  3FM5 A;  5L3E A;  1WI9 A;  2A07 F;  1IXR C;  2Z99 A;  4G94 A;  2M8E A;  3V8J A;  1ZN2 A;  2P4W A;  2LF8 A;  5HDG A;  1BI3 A;  4KMF A;  3GZ5 A;  1U5T A;  3F3X A;  2D45 A;  2XV4 S;  3QU6 A;  2ZME A;  3HSF A;  5E1Z B;  1K78 B;  4MNU A;  4K2E A;  4I01 A;  2STT A;  4KIG A;  2HTS A;  2EFQ A;  4WXC A;  2PFB A;  1FOK A;  1Z9C A;  4UNO A;  4Q48 A;  3ECO A;  1BIA A;  3JSP A;  3TDZ C;  4WXH A;  1KQ8 A;  1YW7 A;  2XAS A;  1S7O A;  5CVU A;  2RVC A;  1RUO A;  4I0A A;  4IVN A;  2XRO A;  4U0Y A;  1UB9 A;  3VOD A;  5L3D A;  1IUY A;  2MBF A;  3C18 A;  5BQT A;  3WTZ A;  2JPC A;  3B73 A;  2CQK A;  3M8F A;  3EYY A;  5LGU A;  3WE2 A;  1JXS A;  3HOT A;  5L3C A;  1YIO A;  2VC1 A;  2DT5 A;  3IKV A;  3OV8 A;  2W85 A;  2UXN A;  2RNJ A;  2UWM A;  4EQQ A;  4R8H A;  1D8J A;  2XVC A;  3QP6 A;  2FML A;  2ISZ A;  4KMU X;  3WTU C;  4KDP A;  1YLF A;  4L0Y B;  4O3M A;  1ON2 A;  2FQ3 A;  5JR3 A;  5E18 F;  2H6B A;  2QBY A;  3V8L A;  4M6Y A;  3I4P A;  3U1D A;  1G3Y A;  4A0Z A;  1FC3 A;  3GFL A;  2H09 A;  3PFI A;  4I0B A;  1BI0 A;  4G9Y A;  4RGR A;  1H0M A;  2ACJ A;  5LEK A;  1JHF A;  3SQN A;  4EVI A;  2OZU A;  5DCM A;  1U5T B;  2XRN A;  1WSU A;  5HDN A;  3BY6 A;  2VOD A;  1OMI A;  2LF7 A;  1FBQ A;  3R61 A;  2L02 A;  5D8K B;  2C6Y A;  1L0O C;  1BC8 C;  2VC0 A;  2HDC A;  1J0R A;  3L2C A;  3GFJ A;  3ERE D;  4P55 A;  2ESN A;  1EH8 A;  3WG9 A;  1MJ9 A;  1TNS A;  3HSE A;  5ICE A;  3J7A O;  2J5P A;  4MHG A;  1U6G A;  3J80 K;  3E6C C;  1USS A;  4YFK F;  2QLZ A;  2QZ8 A;  3EET A;  2D1H A;  4ZZL A;  3P9I A;  3EUH A;  4UVB A;  3RJP A;  3GZ6 A;  3I54 A;  2QBY B;  3QAH A;  2P8T A;  1S3J A;  4U0V A;  1IF1 A;  3KP4 A;  4LLL A;  3V7R A;  1VTN C;  5BOX A;  5D5X B;  2YX7 A;  2A5Y B;  1GHC A;  1EH6 A;  4S05 A;  2CWE A;  1GXQ A;  1QPM A;  4HV5 A;  5CVJ A;  3R4K A;  3WOD F;  1MKM A;  1RUN A;  2P5L C;  1W5S A;  4EJT A;  3IC7 A;  2YSR A;  5E1X A;  5K1Y A;  1YS6 A;  2PN6 A;  4HZF A;  1HKT A;  2E7X A;  3DQV C;  1IXC A;  1LNW A;  4G6D A;  3VFZ A;  5ILV A;  2PBI A;  4XRF A;  1OR7 A;  1MJA A;  1TQP A;  4I09 A;  1CF7 B;  4CO8 A;  2EV0 A;  2E7W A;  4LG0 A;  2FRH A;  5HS8 A;  1FNN A;  4RGS A;  1B4A A;  3D5L A;  1O3T A;  3REO A;  1YTY A;  4EJV A;  5HLI A;  2FBK A;  3TKY A;  4CXF A;  3WTW C;  4HOB A;  3ZMD A;  3OOP A;  2FEZ A;  3F8F A;  5DCM B;  2W25 A;  1R1U A;  2CG4 A;  3KP3 A;  4A5M A;  4EJW A;  4PGG A;  4AD9 A;  1W7P A;  2HQR A;  1QZY A;  4H0E A;  4QWQ A;  2IA2 A;  2DK5 A;  2NAZ A;  3BZ6 A;  2DPU A;  3MZH A;  3GWZ A;  2Y48 A;  3EQL F;  3LA7 A;  3K1M A;  5DDG A;  4M9X A;  2AXL A;  3DPT A;  3GX4 X;  4YG2 F;  3IRR A;  1QO0 D;  2GXB A;  1FPQ A;  1IRG A;  2QQ9 A;  3GEZ A;  2M30 A;  2Y0M A;  2MD5 A;  1ODD A;  2WC2 A;  3GFI A;  3CUQ B;  1R5H A;  4EM2 A;  3TO6 A;  2Y75 A;  4G7Z F;  4AWX B;  1FSE A;  4R79 A;  3J81 K;  3DP7 A;  3I59 A;  3TO7 A;  3MFK A;  3QPT A;  4CYD A;  2A69 F;  4PZJ A;  2XIG A;  4M9Z A;  1TW2 A;  1Z6R A;  2DK8 A;  2RV8 A;  4GYG A;  2H27 A;  1K6O A;  4ZYH A;  3B02 A;  1T2K A;  2W57 A;  3KLO A;  2XGX A;  3FMQ A;  3IL2 A;  4MEY F;  1W7P B;  2QQA A;  4BQA A;  3R0J A;  2A6H F;  5LRS A;  3F72 A;  3ZMU A;  1A04 A;  3WGI A;  2L3D A;  4GGG A;  5KVR A;  5E1W A;  2RN7 A;  1TQM A;  3ZMS A;  4I7H A;  2A68 F;  5EEG A;  2KIF A;  4EGY A;  2L4A A;  4P5O A;  2XUB A;  3F22 A;  5E17 F;  3BOQ A;  2DFI A;  2LNB A;  4DQ2 A;  2KJC A;  3U2R A;  4OOI A;  3WTV C;  4PCQ A;  5BPD A;  4KUM A;  5JVT A;  4LB6 B;  1KA8 A;  4OIP F;  3Q9V A;  5LGN A;  3JTH A;  1IAW A;  2O8X A;  4O6J A;  4Q5S F;  1XCV A;  4D0P A;  3GYH X;  1BC7 C;  4P96 A;  2OQR A;  1IN4 A;  6PAX A;  1REP C;  3E5Q A;  3P9K A;  2BEO A;  4UV8 A;  2M1B A;  1W4M A;  3JAM K;  1G4D A;  1TTY A;  3ROU A;  4BYY A;  5H6R A;  2QWW A;  4PGH A;  2FA5 A;  1FY7 A;  2PMU A;  3LST A;  2MLG A;  3HOS A;  1JE8 A;  1XDS A;  4U88 A;  3JAM Z;  1G6N A;  5D5V B;  2LKP A;  4UUV A;  2K4B A;  2ESH A;  4I2O A;  2IRF G;  1TBX A;  2HS5 A;  2KIU A;  1UHM A;  2JRT A;  1R36 A;  4ENN A;  4G8X A;  5FO5 A;  1KYW A;  3J80 Z;  2A61 A;  2JPB A;  4JK1 X;  1HQC A;  3QRF F;  1ZG1 A;  3HRM A;  3BP8 A; 
#chains in the Genus database with same CATH topology
 1I1G A;  1S7E A;  2VQH A;  3LAJ A;  1LEA A;  4X6A J;  3ZQC A;  3BJ6 A;  1SVL A;  4HF2 A;  5EZG A;  1S9H A;  1XC5 A;  1T33 A;  3N4M A;  1E17 A;  2IGO A;  2OAZ A;  3ZPL A;  5E3L A;  4E7J A;  1Y1W J;  4F93 B;  4Y13 A;  1I27 A;  1HBX G;  2CQQ A;  2PMZ N;  5F1J A;  2HVR A;  1JT6 A;  1BM9 A;  3QOD A;  3O3K A;  2QEN A;  2ZJP F;  4LFU A;  4L5J A;  4ASN A;  1F36 A;  2W48 A;  3BTC A;  3SJM A;  2EPF A;  1IN8 A;  3MVP A;  5FRM A;  1X58 A;  2V7F A;  3G1O A;  1N78 A;  5IT9 K;  5FKK A;  1HW1 A;  3E6M A;  5EEH A;  1D0Z A;  2ELH A;  3PFY A;  4PJJ A;  4A2U A;  4DOZ A;  3MMY B;  1Y0U A;  1YX5 A;  1J75 A;  2VE8 A;  4WF2 A;  2KRF A;  2DQL A;  1RKT A;  3HRU A;  2XF5 A;  2IT0 A;  4KIB A;  4ZTF A;  3IRQ A;  2QSG X;  4FAS D;  1OJL A;  3R0A A;  4FTH A;  2FXA A;  4ANJ A;  3BPX A;  4M72 A;  3RPU D;  3L2V A;  2CV2 A;  2FF4 A;  3CTA A;  1R00 A;  2A6T A;  3AAF A;  3CCJ I;  3NWT A;  2CQN A;  3K10 A;  2CW0 F;  3ISP A;  1QPI A;  2FNP A;  2KMU A;  4PFP A;  4FIS A;  1A35 A;  3M1E A;  2P0W A;  4Y7N J;  2W84 A;  4BEH A;  2W24 A;  2HOA A;  3FHN A;  3WHC A;  4C30 A;  4CCM A;  3OYA A;  2OTJ I;  3E5X A;  1D1A A;  3CF5 F;  2AO9 A;  1LVK A;  2OCE A;  4MIM A;  4A69 C;  1P4A A;  3HRS A;  1BOA A;  3HSR A;  1GV5 A;  4PUS A;  1XGN A;  2BE5 F;  2AS5 F;  3TED A;  2J5O A;  1R1T A;  1SD6 A;  4Q47 A;  1BA5 A;  1JKP C;  3E7L A;  1LB2 A;  3OWT A;  1VFC A;  1MDM A;  1U8R A;  3BWG A;  2EIJ H;  2F4O B;  1VQP I;  4CCO A;  3C7J A;  3P7N A;  4HPQ A;  4FX4 A;  1T56 A;  3LAP A;  4IQJ A;  2DJI A;  3M4O J;  1V4R A;  1P7J A;  4IO9 F;  3OYM A;  4CGZ A;  1R1V A;  1D1B A;  3GO5 A;  5E8I A;  1DPR A;  3Q5F A;  5LEJ A;  3OYE A;  3FXO A;  2VJJ A;  5D5W B;  1X3W B;  4QSH A;  3JRG A;  1Z21 A;  2M5W A;  2ZXJ A;  1IN6 A;  1J9I A;  2H1L A;  2L7F P;  1WJD A;  1UMQ A;  1LDK B;  5K7Z A;  5CQG A;  1JHH A;  4A0Y A;  2NVY J;  4NC7 A;  3L2Q A;  2XPW A;  5JHF A;  3MEX A;  3RSN A;  1BJZ A;  3ZRG A;  2UZK A;  3CP2 A;  3CCE I;  3Q3S A;  3OYL A;  4RAZ A;  5CPR B;  3ZXS A;  1I3Q J;  1XMX A;  1HSJ A;  2EK5 A;  2M3A A;  3HYI A;  4PSW A;  2IXS A;  1F9N A;  3LFK A;  3S1Q J;  2MC3 A;  4GDF A;  2VUM J;  3PQJ A;  3BR2 A;  1MBG A;  3GTP J;  5J4Y A;  1G3S A;  3CO6 C;  4NDL A;  2QQB A;  1NHA A;  3Q0V A;  3GUD A;  4B3A A;  1LKX A;  2F48 A;  1XGO A;  1ZHF A;  2PI0 A;  4HW0 A;  2XRL A;  2HZT A;  4OMZ A;  5C3E J;  3IH4 A;  2JUG A;  1XN7 A;  2XF6 A;  4BUP A;  1LE8 B;  1BJA A;  2H8W A;  5C4J J;  4HNT A;  5FD5 A;  3MCZ A;  2P6T A;  4MQ9 F;  4NB5 A;  2Y2Z A;  3MKW B;  5LRR A;  2XGD A;  3VOE A;  5FFZ A;  1YI2 I;  1CF7 A;  3K0L A;  3VYS B;  4NQW A;  3Q0W A;  1T38 A;  4F91 B;  3HOY J;  3BJA A;  1B8I A;  2K3P A;  2WAQ A;  5HOD A;  1LQ1 A;  3P9C A;  1U9O A;  2X6W A;  4KJZ A;  2LSO A;  1U2W A;  2OU2 A;  1BN5 A;  4OAZ A;  1YJW I;  1EH7 A;  3DWL E;  2R93 J;  2O03 A;  2ZJ2 A;  3H92 A;  4NC8 A;  4ZTJ A;  1F5T A;  1JUS A;  4JQF A;  2OA4 A;  1P92 A;  2LKX A;  5JI6 A;  2STW A;  3J7Z I;  5LHH A;  1OYI A;  3GZN B;  1P6R A;  3TGN A;  1B72 A;  1LDJ A;  1VQ6 I;  1ZGA A;  1YFH A;  2EIK H;  2UXX A;  2E35 A;  4V2G A;  3CDL A;  3TW7 A;  2JT1 A;  3WGG A;  4RB0 A;  3OIO A;  2BV6 A;  4N9I A;  4UVC A;  4XBF A;  1F4K A;  2PQ8 A;  4HDV A;  3K4L A;  2JA5 J;  3ZQI A;  4HX7 A;  3FKI J;  3ASO H;  3S16 J;  3OYC A;  4M9S A;  4UV9 A;  3ML6 A;  4B43 A;  4HNV A;  4KN4 X;  4D9J A;  1DDN A;  3W6K B;  4UY8 I;  2MW8 A;  4H4K C;  3ZQ7 A;  3K70 D;  3L2W A;  2R7U A;  5DYM A;  5CVR A;  5ILS A;  1PDN C;  3FXJ A;  5CLS A;  1ETK A;  1W7P D;  3CUO A;  1HOM A;  2H6C A;  3CJN A;  2DMT A;  3A0H C;  1LJ9 A;  2K7L A;  1AHD P;  1BIB A;  4JYK A;  4XN3 A;  4DYR A;  1XGM A;  4BY1 J;  1TWG J;  2K9N A;  1DUX C;  2FX0 A;  2G7H A;  2NRA C;  3BQZ A;  1G3W A;  4GCV A;  5TRD A;  2CW8 A;  4DZJ A;  2Y0S N;  2EFN A;  4IHT A;  2D5V A;  2OPT A;  4Y3O A;  3GTM J;  1IN5 A;  1SVO A;  4OIO F;  3HUG B;  2VBY A;  1A6I A;  2WV1 A;  5DTD A;  1R58 A;  3C2H A;  3A1Y A;  1HDP A;  5EZH A;  2HKX A;  2F5C A;  1R23 A;  4AID A;  4IHS A;  3LFU A;  1SD5 A;  1UEL B;  4V2F A;  3Q9S A;  2QM3 A;  4FCY A;  4A3B J;  4FX0 A;  2H1K A;  2YUS A;  1Y0N A;  2HEO A;  5FRO A;  4L9J A;  2JWT A;  2PMH A;  1BOB A;  4M3E A;  4LG3 A;  4FQG A;  2OJE D;  3H3U A;  1HST A;  2E1M C;  3QP5 A;  1ETY A;  1FYK A;  2RGV A;  3H5R A;  1BI1 A;  2DFF A;  2E19 A;  5AIQ A;  3FHZ A;  4IHW A;  2L0K A;  3A03 A;  2XPV A;  5CVI A;  3ZQQ A;  2JA6 J;  2NNN A;  1LPQ A;  4BXU A;  3VB2 A;  2MLK A;  5J8C A;  1C0W A;  1JKO C;  1KGS A;  4YEJ A;  4C2U A;  5BPI A;  5DD8 A;  4M74 A;  2BGC A;  2MC4 A;  3OYN A;  3DCF A;  1I6H J;  5LHG A;  4RAY A;  1YX3 A;  4BAC A;  1SFK A;  1TC3 C;  2O61 A;  5TIS C;  5JFR A;  1O7F A;  5K5O A;  2ADU A;  2E1C A;  2LY9 A;  3IWZ A;  1OYW A;  3QPS A;  4MLO A;  2OZ6 A;  4IOA F;  3PM1 A;  1H9G A;  3EYI A;  4Y17 A;  3DKW A;  3DKY A;  4ESF A;  3ZN1 A;  1ULY A;  1O3R A;  4UUS B;  2DT7 B;  3GW2 A;  4PDK A;  5FKN A;  5FGM A;  2L2O A;  1ZYR F;  2ELK A;  1U78 A;  4EJO A;  1QNT A;  2VJI A;  2FE3 A;  3S1R J;  1SAU A;  2I8D A;  2ZME B;  3S32 A;  3AL0 C;  1DU0 A;  2IS6 A;  2DYR H;  2DA5 A;  1WJB A;  4S04 A;  3CME I;  1GVJ A;  2CSO A;  2E5N A;  2Q2E A;  5HDK A;  2FBH A;  3FXR A;  2B0L A;  2ZXI A;  3WTS C;  5DM6 F;  1HW5 A;  3V7S A;  5IT3 A;  1ZLK A;  1YS7 A;  2BHZ A;  2HU9 A;  3DV8 A;  4HX8 A;  5AIP A;  4CZZ A;  1LFU P;  4R1H A;  2A05 A;  1SMY F;  1OCC H;  4M71 A;  1DP7 P;  3I59 B;  1YQA A;  2CFX A;  3WTX C;  2CUE A;  4DJA A;  4KFC A;  3G1L A;  2EZK A;  1J5Y A;  2Z2S B;  1D8K A;  2IVM A;  3BR6 A;  4X1E A;  2KIS A;  4HBL A;  3HOV J;  4QLC U;  1ORK A;  2Y31 A;  2XAQ A;  2B7E A;  5GTH C;  1D5V A;  5GP9 A;  2BVM A;  2LRE A;  2MFZ A;  1ZK8 A;  4N0B A;  2DBB A;  5B1B H;  5E8G A;  2JA2 A;  4BS9 A;  5J6X A;  3ECH A;  1X19 A;  1MDM B;  2FOW A;  4HAM A;  2M0C A;  1Z67 A;  2E5Z A;  4QIW N;  1MMS A;  2FUG 2;  3QPH A;  3FM3 A;  4ZYA A;  3CO7 C;  2YU9 J;  2BYV E;  1XCB A;  2E1N A;  4NBQ A;  3KFW X;  4BQQ A;  2KT0 A;  4LLG F;  1J59 A;  1KU9 A;  4XKW A;  5IY5 H;  2KDZ A;  2P7C B;  1H9T A;  2V6C A;  5F0C A;  5JHU A;  3ERM A;  2VE9 A;  2BXZ A;  3NAR A;  4RAF A;  1Y39 A;  3AG3 H;  5E20 A;  2HQ5 A;  3E97 A;  2HR3 A;  5J1U A;  5CYV A;  1R7J A;  1KU2 A;  1J7K A;  1EJ9 A;  3WU1 B;  2IW5 A;  2ZB9 A;  4BDY A;  4ITV A;  4A6E A;  3HIF A;  4YII A;  5HLG A;  2XSJ C;  3I71 A;  1BW6 A;  3E3V A;  4M3B A;  1IJW C;  4ESB A;  2HYG D;  2H94 A;  2EA2 A;  3TW6 A;  3M8E A;  3S3M A;  2FQ4 A;  3K9T A;  3ZOB A;  5FFX A;  2V1D A;  1Z7U A;  1X4P A;  4RBO A;  3F21 A;  4LJZ F;  3D5R C;  4L9N A;  1YYV A;  4EV0 A;  2PJR B;  2R7D A;  4BHC A;  1VF9 A;  2LTP A;  3LA2 A;  3K4J A;  3JRH A;  3BQY A;  1IRX A;  2VBX A;  2NXN B;  4MFE A;  1FP2 A;  1B1B A;  3RKQ A;  4DYC A;  2PJP A;  3RYR A;  1U3E M;  2ELJ A;  5E3N A;  4WXD A;  2YX4 A;  2MD0 A;  1XSD A;  1YRN A;  4WK8 F;  1U8B A;  2R7Z J;  3O8G A;  4HYE A;  1G8X A;  5EJC A;  1F43 A;  1TWC J;  3EDP A;  2MH9 A;  2JMW A;  3CCU I;  4XLC A;  5J8F A;  4MGR A;  2XGC A;  5F27 A;  1WH5 A;  3BPV A;  4PFO A;  2KFD A;  1UHS A;  4XLH A;  3L7W A;  2EIM H;  2BXY A;  3GFM A;  3QYF A;  3LSP A;  4DNC A;  2GA2 A;  4BHP A;  1FBS A;  5L3G A;  1HKS A;  3K69 A;  4NC6 A;  3I4N J;  1MD0 A;  1K4T A;  2Q8K A;  3H5N A;  3G2B A;  3KP7 A;  4KIC A;  1YIJ I;  1VQ9 I;  1R4N B;  3HHG A;  2DA1 A;  5BNG A;  4JOM A;  2JK3 A;  4B44 A;  1MND A;  3TMO A;  1HF0 A;  3ZGK A;  4NHJ A;  3WU0 A;  3S2D J;  4Y52 J;  1QVU A;  2AQF A;  2O3F A;  4TV7 A;  1I1S A;  1FWZ A;  1WH7 A;  2XHK A;  4XL9 A;  4BE2 A;  2E2H J;  1Z05 A;  1GV2 A;  4YFX F;  2FU4 A;  3DBR B;  1DU6 A;  2RRE A;  2WY8 Q;  3MKL A;  1Z6T A;  4HLY A;  3CUQ A;  1V55 H;  2DOA A;  1RI7 A;  3IAM 2;  3VSK A;  2RKH A;  4JP0 A;  3X2Q H;  1AOY A;  2KJB A;  4XLN F;  3HHH A;  5A2Q Z;  4KIS A;  5J1R A;  4CDG A;  3LQR A;  2L9N A;  3MZY A;  3VYR B;  3DXJ F;  4FHT A;  3TQN A;  3ABT A;  1Z91 A;  4U0W A;  4D7N A;  4B48 A;  2GM4 A;  2HPM A;  2V1X A;  3J7Y J;  2Y9Z A;  1KU7 A;  1IN7 A;  1D0Y A;  3SZP A;  3SFZ A;  5FD6 A;  2GBY A;  2KIQ A;  1ZRC A;  1BL0 A;  3T8T A;  2RDP A;  3H3Z A;  4EGZ A;  3FBN B;  4HRI A;  3BR3 A;  1XD7 A;  2M7A A;  3KEY A;  1OLT A;  5H20 A;  3BJO A;  4RLQ A;  4Z6Y A;  1ACI A;  1P2F A;  3BLY A;  5KAI C;  1RRJ A;  3ZMZ A;  1MNM C;  2YU3 A;  3RIR A;  3S2H J;  3KZY A;  3ABU A;  2L5Q A;  3CJR B;  1QZE A;  3FMR A;  4FE7 A;  2QA4 I;  1V3F A;  2P6S A;  1FTZ A;  1X1C A;  3GLL A;  2KPM A;  4ON0 A;  5L3F A;  2R7T A;  2DTR A;  3R60 A;  3CJQ B;  2L54 A;  1OR7 C;  3ZMV A;  3PQK A;  4RB1 A;  3F8N A;  3UNG C;  3K70 C;  3H9J A;  3D0S A;  2LDU A;  3H36 A;  1XB4 A;  1ZAO A;  2K40 A;  4RMN A;  3U9G A;  3HOZ J;  3JCU C;  3GTL J;  2V1N A;  2KKO A;  4X0G A;  2HQA A;  5B5E C;  1T95 A;  1K7A A;  1E2X A;  1B8I B;  4WX9 A;  2VQL A;  2W82 A;  2XAH A;  5GTI C;  2CMP A;  2KHM A;  1Q1H A;  3BG7 A;  4NQW B;  5B1A H;  4HDU A;  3CES A;  2KRC A;  3Q0U A;  4UXN A;  3OYH A;  4YIF A;  4YFN F;  3TOB A;  4S0H B;  4HF0 A;  3HM5 A;  2TCT A;  1UFM A;  4LK0 F;  2WBM A;  3OYK A;  3E6B A;  1T6S A;  2JQ7 A;  2XKO A;  3CMY A;  1OKR A;  2XF7 A;  4QPQ A;  3RTR A;  2IA1 A;  3BRO A;  1Y6I A;  1R4M B;  3FZV A;  5FB2 A;  3BR0 A;  4HEA 2;  4OMY A;  2JVH A;  3BDD A;  1YRN B;  4P9F A;  1OYY A;  3I0T A;  1ZH5 A;  2JJ7 A;  2JTV A;  5TJJ A;  4ZYD A;  2RQP A;  3G73 A;  1APL C;  3JRC A;  4BHB A;  5IT9 Z;  2VJ4 A;  2NS0 A;  1AKH B;  1ZG3 A;  3DFG A;  1IC8 A;  1DPU A;  4AUX A;  1P4W A;  4C2T A;  4OIQ F;  5KK1 A;  5LD2 C;  2EV5 A;  3C1D A;  1FLI A;  2QF7 A;  3SYT A;  3SFI A;  1O3S A;  4LK1 F;  2L01 A;  5EG0 B;  4LGW A;  4KIT B;  5KAF C;  4M6X A;  2Z33 A;  3VDX A;  2ZSH B;  1FIP A;  2ZME C;  3CC2 I;  4BH9 A;  3KEQ A;  2VXD A;  4XRS G;  5HOO A;  2G7U A;  4C2M J;  4LMY A;  1GXP A;  4HST A;  1TL8 A;  1MJB A;  1STZ A;  1IG7 A;  1T08 B;  4L18 B;  2P5V A;  2HI3 A;  5A2Q K;  1MBK A;  1YIT I;  1SAX A;  3CCV I;  3GLX A;  3KLN A;  2F2E A;  1JJ8 C;  3DPL C;  2E2J J;  3WE3 A;  1I5Z A;  3OS2 A;  3UKG A;  3RDI A;  2ZFW A;  4RGU A;  3RKX A;  2QEX I;  3BG3 A;  2HKO A;  2PX9 A;  2D1V A;  5GAE J;  1B9N A;  3LSH A;  3V42 A;  2Q0O A;  3F6V A;  2DOF A;  2XAU A;  3DLA A;  4GXO A;  1IRF A;  1Z1D A;  2EZI A;  4L5I A;  3OS0 A;  2DI3 A;  1FYL A;  5HLH A;  4XKV A;  4AIJ A;  4A12 A;  1LEB A;  3LA3 A;  1E3O C;  2W00 A;  5C44 J;  4DYQ A;  2CQX A;  2FSW A;  1KYZ A;  1WWX A;  2QGU A;  3DLL F;  1ZAR A;  3N97 A;  1O3Q A;  2FD5 A;  2DMQ A;  2M34 A;  3L2R A;  1F1Z A;  1XG1 A;  1XTA A;  3KIO A;  4BAY A;  4G6Q A;  4BNC A;  1QBJ A;  4A3E J;  2XAG A;  1Z3X A;  1LFP A;  4B8X A;  2P5K A;  1WRJ A;  1MBJ A;  1L3L A;  3K4M A;  3DEU A;  2FBI A;  1FZP B;  3S93 A;  2VKV A;  4G7H F;  3OYG A;  3IKT A;  4AVP A;  4CHU A;  1KZH A;  1HA8 A;  2R7R A;  2WAD A;  1RIO H;  5D5U B;  2JSC A;  5EF6 A;  4RA2 A;  3JRE A;  4M3D A;  3PNV A;  3S2W A;  4A6D A;  4RGX A;  1TLH B;  1FBU A;  3A0B C;  3CMA I;  4Q4Z F;  5IOZ A;  2GOM A;  4IJA A;  3DKX A;  2K4J A;  4GO1 A;  4AYB N;  3HC7 A;  1S29 A;  1S7A A;  2CU7 A;  2OD5 A;  1IW7 F;  2MYS A;  3E5U A;  2X0L A;  5IOY A;  1VQO I;  4CH7 A;  2VN2 A;  1SMT A;  2DOE A;  3QOP A;  4XNF A;  3FK6 A;  2PLY A;  2NOG A;  2IGK A;  1VI0 A;  2HNH A;  1NTC A;  2M4G A;  3CCM I;  1EA3 A;  4JX5 A;  1I3A A;  2ZBK A;  1WCM J;  2UV1 A;  1QHG A;  2DA4 A;  3H9G A;  3VSL A;  3WG7 H;  1JGG A;  1J2X A;  2ETH A;  5E3M A;  5FLM J;  1FP1 D;  3DPU A;  3IWF A;  1IZ1 A;  3CP8 A;  2DU9 A;  1A36 A;  2E1O A;  3HXL A;  4XKC A;  2M4K A;  2B9S A;  3ZQL A;  4EJU A;  2E34 A;  3FXM A;  1WVR A;  1OCT C;  3ABK H;  1IV8 A;  3OY9 A;  3MQ0 A;  3L09 A;  3I58 A;  4XK4 A;  4HLX A;  2F5E A;  2X51 A;  1CGP A;  1MNE A;  4IZZ A;  2HOE A;  2DO7 A;  1XSX A;  2CRG A;  3LWF A;  1W5T A;  3CDH A;  3MN2 A;  5D4R A;  1QZZ A;  2M2E A;  5EEA A;  3HUG A;  4N4O B;  1FYM A;  3QPL A;  2VAS A;  1U9N A;  4Z2Y A;  1I6X A;  3GF2 A;  1X4O A;  2BY0 A;  4XON A;  4FET A;  3L1P A;  5E3O A;  3MAJ A;  1YJ9 I;  4II3 A;  1V5G A;  5FKO A;  3PSI A;  3RQ4 A;  1QQI A;  4BQN A;  1JJ6 C;  5HS9 A;  1ON1 A;  5HVQ C;  3K1N A;  4I76 A;  2BOL A;  1FMW A;  3WGH A;  1VQ7 I;  4C3J J;  4HF1 A;  1JI8 A;  1JT0 A;  2HQN A;  1VZ0 A;  2GOX B;  3ABM H;  4UVA A;  1MBH A;  3TO9 A;  3K2Z A;  2IA0 A;  2BY3 A;  5CKT A;  4IF4 A;  2L4M A;  2QSH X;  3MWM A;  5EDN A;  4RB2 C;  3RI4 A;  3BG6 A;  4XRM A;  2NOJ B;  2X6X A;  4ENM A;  4XLA A;  4G7O F;  4ENJ A;  5K5R A;  4E7I A;  1HXD A;  4XQF A;  3SZT A;  2Y9Y A;  2F5V A;  2M9H A;  1LE8 A;  3HOU J;  2WV0 A;  2LRD A;  2R7F A;  4L0Z B;  4IRH A;  2VT2 A;  3RPU A;  2XKP A;  1NG6 A;  2LY2 A;  3RYP A;  5D4S A;  1UHW A;  3TP0 A;  1UG2 A;  1WJ5 A;  4G6T B;  3F8C A;  3W2A A;  2W7N A;  3KP2 A;  2CYY A;  1YO5 C;  3HTU A;  5KNL A;  4I99 C;  1Z0X A;  3FDY A;  4OAY A;  3O2P E;  3FMS A;  5IPA A;  3RKY A;  5DEQ A;  5DV5 A;  1Y8Q B;  3I53 A;  4RS8 A;  3QQA A;  4DW6 A;  1IXS B;  5ILU A;  1IUF A;  3GVA A;  4M6V A;  4A3L J;  2E36 A;  5CJ9 A;  5D6E A;  2EA4 A;  4HQM A;  3F23 A;  2GAU A;  3ASN H;  3NAU A;  2HFH A;  2DMU A;  4AVZ A;  1HLV A;  1BBY A;  3L9F A;  5HS7 A;  4II2 A;  3AG1 H;  1TWH J;  3FBI B;  3ABL H;  3HKZ N;  3CCQ I;  2E2I J;  1OCZ H;  1IO2 A;  3FX3 A;  1QHH D;  3WTY C;  1DQU A;  5DCF A;  2LFB A;  1R49 A;  2VBW A;  1RES A;  3NRV A;  1R5G A;  3I56 I;  5FLX Z;  3QOE A;  3LNQ A;  2VOP A;  5FLX K;  2HDW A;  3HPG A;  2MSY A;  4XOT A;  5LGT A;  2RC4 A;  5ICF A;  3ZQG A;  2DMP A;  1ZRD A;  3OOU A;  5EG0 A;  2O0Y A;  4BE0 A;  2A6E F;  3G3Z A;  3S14 J;  3I5U A;  2ZCW A;  2R3S A;  1K78 A;  3F8M A;  2DLL A;  1JUM A;  3PL8 A;  1SFU A;  2G9W A;  4P1W A;  4L9V A;  1T98 A;  2BHY A;  2VPL A;  4ZJZ A;  4LB5 A;  2EIL H;  2AHQ A;  3CC4 I;  3ZR8 X;  2WY7 Q;  3ZCO A;  4I98 B;  2R7W A;  2EB7 A;  2EFO A;  1I50 J;  1YW9 A;  2E1M B;  3M9A A;  5CVV A;  1XDU A;  3FXU A;  5DUK A;  2VXZ A;  1AA7 A;  2EFP A;  4QPO A;  5LHI A;  1GVD A;  2QCO A;  1TWA J;  5JLW A;  2IP2 A;  2O9L A;  1SD7 A;  3S3N A;  2LC2 A;  2YS9 A;  3K7A J;  1OCO H;  2JVG A;  4PJ0 C;  3P5J A;  4A5N A;  4EM0 B;  2MA3 A;  3E6D A;  4IXA A;  5FJ8 J;  4ENK A;  1MBF A;  4XSZ F;  2GXG A;  3L00 A;  4NUB A;  2EFW A;  3EUA A;  3LQQ A;  1KU3 A;  5F0H A;  4BBS J;  4OIN F;  5C4X J;  4L5E A;  2XAF A;  2F5F A;  4MQV A;  2GZW A;  5F64 A;  1XGS A;  1Q1V A;  4XSX F;  2OTL I;  5B66 C;  3IH2 A;  3BTJ A;  3S3O A;  4CCJ A;  3CCL I;  1YJN I;  1MSE C;  2K3F A;  2QSF X;  2GA1 A;  2VKE A;  1IV6 A;  2GWR A;  4FT8 A;  1D3Y A;  3GXO A;  3OL4 A;  3GME A;  1OIS A;  2Q1Z B;  5EGO B;  2VI6 A;  4KYW A;  3M7G A;  1R9T J;  2CUZ A;  3V4G A;  1UAA A;  1NH3 A;  2CGP A;  1XMK A;  1BI2 A;  4B1R A;  1PUF B;  2NNY A;  5GAD J;  2P7V B;  5BS6 A;  1PP7 U;  4AM3 A;  3RQI A;  3KYL A;  1N75 A;  1NK2 P;  2YR2 A;  1TNT A;  2LVS A;  4CIC A;  2KIM A;  4BJ6 C;  3VYT B;  1X3Z B;  3B6A A;  2HVS A;  1TW3 A;  4EMS A;  1S6L A;  1ONV A;  1D5Y A;  3I64 A;  1KQ0 A;  3CCR I;  4B09 A;  4XR6 A;  1JKQ C;  2V6E A;  3T8R A;  2WAQ N;  5AON A;  1G2H A;  5ED4 A;  2HXO A;  3UR3 C;  1S8N A;  4BGD A;  2OUM A;  5L3B A;  3FF5 A;  1HCR A;  2HYF A;  3SEQ A;  3PIO F;  2ZJR F;  3N05 A;  1JGS A;  3J81 Z;  4KT6 A;  2XAJ A;  3OR1 C;  1BW5 A;  2GQQ A;  3GTG J;  2X4H A;  4W1U A;  2KDO A;  4IPA A;  3W6J B;  1VQK I;  3WTT C;  3RPQ A;  1ETV A;  4ZYG A;  2M45 A;  3FIS A;  4Y4R A;  1WFX A;  3PO3 J;  4A3D J;  1K79 A;  2PEX A;  4W97 A;  1MSF C;  3BCA A;  3QWL A;  5M5Y J;  4HSR A;  1FOW A;  2V9K A;  1YW8 A;  2L7Z A;  3JRF A;  3CCS I;  4AIK A;  1ZGJ A;  1PJR A;  1OPC A;  3DF8 A;  1T8I A;  3I4M J;  2ZKZ A;  3KET A;  2K9Q A;  4DBQ A;  2JZY A;  1B6A A;  4XLF A;  3H5A A;  2MH2 A;  4HG2 A;  2I5U A;  2FMY A;  1WJF A;  1SD4 A;  1T39 A;  3V7C A;  5J4V A;  1B59 A;  2IPQ X;  3KCC A;  1EV7 A;  1XSV A;  3GTJ J;  3TL4 X;  1S72 I;  4MTE A;  2AXT C;  4ZZD A;  3PUB A;  2O8K A;  1KQ9 A;  3JSO A;  2ZSI B;  3RKW A;  1X1A A;  1B9M A;  3PJR A;  4N9H A;  3V8K A;  4D7M A;  1D1C A;  5D8L B;  2V1U A;  3IHU A;  3HGG A;  2KRH A;  2YPR A;  1O7L A;  5FLV A;  4I02 A;  3KP5 A;  5J47 A;  2ID6 A;  1FSH A;  1VQM I;  1SFX A;  4RDU A;  2EV6 A;  1ETW A;  1TQI A;  3QU3 A;  5DUI A;  1O57 A;  2CO5 A;  2X85 A;  1V5F A;  1ZEL A;  3I9V 2;  4AIH A;  3M07 A;  2R5Z B;  1ZRE A;  5LBQ A;  4BQO A;  3BR1 A;  4ETS A;  3F6O A;  3CLO A;  4GYI A;  1WPK A;  3AG2 H;  5IP6 A;  5K7F A;  3OYF A;  4HQE A;  1LVA A;  4ESJ A;  1IRZ A;  2QUF A;  3BR5 A;  2NS8 A;  2LR8 A;  3T1B A;  1W5C C;  1LDD A;  1X3U A;  3R6S A;  1K61 A;  3GTQ J;  2JN6 A;  2Z3Y A;  3T5X A;  3LMM A;  3CMM A;  4U87 A;  3KEO A;  4O5V A;  4DIQ A;  1SEU A;  2CUF A;  2FOK A;  3VEP A;  3FXK A;  3PIP F;  2PJR A;  2DPD A;  4KN7 X;  4BBR J;  4XOR A;  2DQR A;  2K02 A;  2IGM A;  2CQ7 A;  3M1C A;  1RET A;  2K86 A;  3SDG A;  2X6Y A;  4CCN A;  2V9V A;  3F8B A;  2COM A;  2R4G A;  1JKR C;  3KP6 A;  4LLN A;  4WWC A;  1WJE A;  3C3W A;  1MIJ A;  2FNA A;  2ZO4 A;  2VQG A;  3KZZ A;  1WJC A;  3G6E I;  2Z9O A;  2GIZ A;  1BR2 A;  4CCL A;  2CH0 A;  1ZRF A;  4GFB A;  1OQY A;  2EJR A;  4Y15 A;  2VON A;  4F52 A;  4F7Z A;  1MGT A;  1DGR M;  2BZT A;  2EWN A;  4MEX F;  1A6Q A;  1RKW A;  3OIP A;  2R7V A;  3F0C A;  1YOV B;  3HBL A;  3BG5 A;  4HV6 A;  1RZ4 A;  3QYE A;  2O6G E;  2LK2 A;  1WGX A;  2DW4 A;  5D6F A;  4IRI A;  3TOA A;  2COB A;  1RPW A;  2RAE A;  3BZK A;  1ZLJ A;  2VJ5 A;  4C3I J;  2VBZ A;  1ENH A;  1GUU A;  1ZTR A;  5K5Q A;  3HEF A;  2BW3 B;  3AFH A;  3ULQ B;  1T0F A;  2ME6 A;  2V9P A;  5IP7 J;  3FWE A;  2M87 A;  4IRG A;  2PG4 A;  1WQ2 A;  1EKE A;  2XB0 X;  3JRI A;  1UST A;  2GIV A;  3NQO A;  4E7H A;  3SXY A;  3ZP5 A;  1FEX A;  3A02 A;  5JVG F;  2WB1 A;  1QGP A;  3T0Y A;  1Y56 A;  2IJL A;  1ETX A;  1XX5 A;  2F4M B;  4KT5 C;  2KP6 A;  2NVU B;  2V26 A;  2V79 A;  4OU0 A;  4CSW A;  2CV0 A;  1W0T A;  1X1P A;  5LLQ A;  5F6F A;  4A3F J;  4XM3 A;  1MZB A;  1R22 A;  1ZGW A;  4A0X A;  3KE2 A;  5DD4 A;  4RB3 C;  5F1R A;  4C3H J;  4MTD A;  1SVM A;  2EBI A;  3CCY A;  3FXQ A;  4UB6 C;  3MD2 A;  1P4X A;  5IP9 J;  2VT3 A;  3K1P A;  3CUQ C;  3HDD A;  2HWV A;  3JW4 A;  2GLO A;  4HX4 A;  1RNL A;  2QVO A;  2WA0 A;  4U7B A;  1WZ2 A;  4M3F A;  4A3I J;  4ZH4 F;  3OMY A;  3A4C A;  2X9D A;  1X2M A;  2OQG A;  3E0J B;  1G3T A;  3ELK A;  1HKQ A;  1JTY A;  4HA8 A;  3ONQ A;  2O5R A;  1RR8 C;  2KQR A;  2MGQ A;  1YE9 A;  2VOO A;  4KNY A;  2TDX A;  5ICC A;  5ERI A;  3IUO A;  3IAS 2;  4WCG A;  4BL0 B;  2ZNZ A;  5BMZ A;  2BBY A;  5M3M J;  2CV1 A;  1MMD A;  2ZC2 A;  2HVQ A;  3DEE A;  4B3X A;  3COA C;  2EZH A;  4A3K J;  4ZYE A;  4U7D A;  3U1K A;  4RM2 A;  3BCB A;  3O6B B;  4YIR X;  3DBL B;  1WHU A;  2WWY A;  1T0F C;  4E7K A;  1PP8 F;  4KA4 A;  1FT9 A;  4ZDL A;  4J00 A;  4P9U A;  5M5W J;  2Y0S A;  2F5D A;  1A31 A;  2A3S A;  2ISY A;  3D5S C;  3W3C A;  3HTS B;  4V19 K;  4JBA A;  3SHF A;  3ZMT A;  3D1N I;  3WHB A;  1MW7 A;  2DA2 A;  2M0M A;  1XPX A;  5DM7 F;  4L9T A;  3HRT A;  4GRI A;  4EM1 A;  1AWC A;  2HDD A;  2Z5U A;  1UCR A;  1FX7 A;  3KPH A;  1RC9 A;  2NYX A;  1ZG5 A;  4XLP F;  1HC8 A;  2K9L A;  2ZNY A;  4LG0 B;  3AL0 B;  3FXL A;  3ZN0 A;  4IKF A;  3TDU C;  1Z77 A;  1ERD A;  5F08 A;  2OBP A;  2HTJ A;  4XMY A;  5F04 A;  1YG2 A;  1WKM A;  3DEW A;  3JTG A;  5ICG A;  2WTE A;  1QA6 A;  2HGC A;  2QYO A;  4N4N B;  4AU7 A;  2D2W A;  3LL7 A;  1XMA A;  1WI3 A;  4NNJ A;  1PUF A;  2JUC A;  2OC6 A;  2K27 A;  3OSF A;  2FJ1 A;  2DAO A;  1PUE E;  5H6Q A;  4KIF A;  4LD5 A;  1P9Q C;  1SFE A;  3NEU A;  4C9Y A;  3CLQ A;  1HW2 A;  1U5T C;  2K9S A;  4M73 A;  4E70 A;  4OIR F;  4UHT A;  3FM5 A;  5L3E A;  4J01 A;  3S15 J;  2R5Z A;  2LG4 A;  2X48 A;  4G12 A;  1WI9 A;  1NK3 P;  5HNH A;  2A07 F;  1IXR C;  2Z99 A;  4XOP A;  2XDV A;  4G94 A;  2DDA A;  2M8E A;  1PVE A;  3DU6 A;  3V8J A;  1LFB A;  1ZN2 A;  2P4W A;  3HOX J;  2LF8 A;  4A3J J;  5HDG A;  5FKL A;  2ECB A;  3H1C A;  1YHQ I;  1BI3 A;  4KMF A;  3QYB A;  4JX6 A;  1ZQ3 P;  2K9M A;  3GZ5 A;  3JRB A;  4BY7 J;  3PNT A;  1U5T A;  2WAE A;  2F4I A;  3H9Q A;  3F3X A;  2Q2E B;  3MZ8 A;  2D45 A;  2VLA A;  2VB6 A;  2XV4 S;  2DA3 A;  3QU6 A;  2IGN A;  5GPC A;  2ZME A;  3HSF A;  2CFO A;  1QU3 A;  5E1Z B;  1K78 B;  4MNU A;  4K2E A;  4I01 A;  2STT A;  2KZG A;  4KIG A;  1OCP A;  4E6K G;  2HTS A;  2EFQ A;  3K4C A;  1MH4 A;  2PFB A;  2DCE A;  4WXC A;  3H0D A;  1CQT A;  4DBR A;  2F6C A;  1UZC A;  1FOK A;  1Z9C A;  4UNO A;  4Q48 A;  1E0E A;  1MMA A;  3ECO A;  1BIA A;  4D1Q A;  3JSP A;  1EF4 A;  1TZL A;  3TDZ C;  4WXH A;  2VKH A;  1KQ8 A;  1YW7 A;  2XAS A;  1ZKG A;  1S7O A;  2PMZ A;  5CVU A;  2IBD A;  2RVC A;  1SFO J;  1RUO A;  1W1W E;  3BTL A;  2ECC A;  2L9S A;  4DZP A;  1ITY A;  1VQ4 I;  3G1M A;  4I0A A;  4IVN A;  2XRO A;  2XB5 A;  3LSK A;  4U0Y A;  5KHD A;  1MMG A;  1UB9 A;  3VOD A;  5L3D A;  1XS9 A;  2LKS A;  3EUH C;  1IUY A;  2MBF A;  2K5C A;  2CS3 A;  3C18 A;  5BQT A;  3WTZ A;  2JPC A;  3B73 A;  2LOO A;  2CQK A;  4LIV A;  3M8F A;  3EYY A;  2LP0 A;  5LGU A;  3WE2 A;  5K7H A;  1JXS A;  3HOT A;  3RZO J;  1TT0 A;  5L3C A;  1YIO A;  2VC1 A;  1VQN I;  2DT5 A;  3SZG A;  3IKV A;  3OV8 A;  4UB8 C;  2W85 A;  2UXN A;  2VKD A;  2L9V A;  2RNJ A;  3HL2 A;  3OYJ A;  2G0E A;  2Z1D A;  4A3M J;  2UWM A;  4EQQ A;  2DN0 A;  1DGW Y;  4R8H A;  5EGO A;  3CZ6 A;  1PYV A;  4D5F A;  1UJ8 A;  1D8J A;  1VND A;  1KON A;  3HG9 A;  5J1Y A;  3A01 A;  2XVC A;  4PSX A;  3QP6 A;  1POG A;  2FML A;  2LYC A;  2X1E A;  2OV7 A;  1LUJ B;  4KMU X;  3VPR A;  4CYC B;  3WTU C;  2ISZ A;  4KDP A;  1YLF A;  5E18 F;  1ON2 A;  2FQ3 A;  5JR3 A;  2NVX J;  1AU7 A;  2H6B A;  3I3L A;  2QBY A;  4L0Y B;  4O3M A;  3CD6 I;  3V8L A;  4M6Y A;  4IOC F;  3BC8 A;  3I4P A;  3U1D A;  4XN0 A;  3HGY A;  3IV5 A;  1G3Y A;  4A0Z A;  3BTI A;  1FC3 A;  3CF2 A;  3GFL A;  1FMV A;  2H09 A;  3PFI A;  4I0B A;  1VQ5 I;  1BI0 A;  4G9Y A;  4RGR A;  1H0M A;  1V54 H;  2CUJ A;  2ACJ A;  5LEK A;  1JHF A;  3SQN A;  3LSJ A;  4EVI A;  2R5Y A;  2OZU A;  4CUG A;  2ME0 A;  2ZXH A;  3L2U A;  5DCM A;  5GAG J;  1U5T B;  2XRN A;  2W1O A;  1WSU A;  1DP3 A;  5HDN A;  3BY6 A;  2VOD A;  2R5Y B;  2L9R A;  1OMI A;  1WJA A;  4BDZ A;  2LF7 A;  1FBQ A;  2R0Q C;  3R61 A;  2KL4 A;  1A5J A;  2L02 A;  2VL8 A;  3AG4 H;  5D8K B;  2C6Y A;  1L0O C;  2DOD A;  2RNG A;  1BC8 C;  3FK7 A;  2VC0 A;  2M7B A;  2HDC A;  1J0R A;  3G4S I;  3L2C A;  3HOW J;  3GFJ A;  2Y30 A;  3CQZ J;  3ERE D;  2E71 A;  2QKL B;  4P55 A;  3A2K A;  2ESN A;  1EH8 A;  3WG9 A;  3DTI A;  1MJ9 A;  1TNS A;  3HSE A;  1X2N A;  1TP4 A;  2EH3 A;  5ICE A;  2CW7 A;  3J7A O;  2JRM A;  3F9K A;  5IYC J;  2P81 A;  3RZD J;  2LD5 A;  2J5P A;  4MHG A;  5FRN A;  4ZDO A;  2KLO A;  3PSF A;  3HJE A;  1U6G A;  3J80 K;  3E6C C;  2QQ8 A;  1USS A;  1U0J A;  1R6R A;  2QLZ A;  1RR7 A;  2QZ8 A;  4YFK F;  2IS2 A;  3HZJ A;  3EET A;  3BG9 A;  2D1H A;  4ZZL A;  3P9I A;  2LLK A;  5M3F J;  3EUH A;  4UVB A;  4LOC A;  3RJP A;  3GZ6 A;  2LMD A;  3K4B A;  2KZV A;  3GTK J;  3I54 A;  2QBY B;  3QAH A;  3OR2 C;  2P8T A;  1S3J A;  4U0V A;  1IF1 A;  3KP4 A;  4F3Q A;  4A3C J;  3DBH B;  1H89 C;  1JTX A;  1J09 A;  4LLL A;  3V7R A;  1VTN C;  3OYB A;  5BOX A;  5D5X B;  4DGW B;  1OCR H;  1ETQ A;  2YX7 A;  2A5Y B;  1GHC A;  2QKM B;  1EH6 A;  4S05 A;  2CWE A;  3BT9 A;  4BXX J;  1GXQ A;  1ETO A;  1QPM A;  4HV5 A;  5CVJ A;  3OSG A;  4F92 B;  2RQQ A;  3R4K A;  2IS4 A;  4I6Z A;  1FOX A;  3LSI A;  4IQ4 A;  2R7X A;  3WOD F;  1MKM A;  1MBE A;  1RUN A;  2LY1 A;  2LH9 A;  2P5L C;  1W5S A;  4EJT A;  2HXI A;  3IC7 A;  3JR9 A;  2YSR A;  5E1X A;  5DS9 A;  5K1Y A;  1NG7 A;  1YS6 A;  2PN6 A;  4HZF A;  5HNF A;  1HKT A;  2E7X A;  3TP3 A;  2DTZ A;  3DQV C;  1IXC A;  4XRS A;  3OYD A;  1LNW A;  4G6D A;  3VFZ A;  4B4C A;  3DTE A;  5KCM A;  5ILV A;  3H0G J;  2PBI A;  2CJJ A;  4XRF A;  1W0U A;  1AKH A;  3PNY A;  9ANT A;  1JUP A;  2LBF B;  3LSG A;  1OR7 A;  3ESW B;  4E7L A;  1MJA A;  3GBG A;  4CZC A;  3S1M J;  3S1N J;  1S5L C;  1TQP A;  2L7M P;  4Y33 A;  3MKZ A;  4I09 A;  3B6C A;  3CDI A;  1CF7 B;  2XGE A;  1Y8R B;  4CO8 A;  4EEF G;  4BEH B;  2EV0 A;  2E7W A;  4LG0 A;  4OWR B;  2FRH A;  5HS8 A;  1FNN A;  4RGS A;  4BJ5 C;  1B4A A;  1IGN A;  2R7S A;  3K4N A;  5E79 C;  1W36 C;  3D5L A;  3K4K A;  1O3T A;  3S17 J;  2WB1 N;  3REO A;  2XSD C;  1YTY A;  4EJV A;  1G59 A;  5HLI A;  2FBK A;  2OF7 A;  3TKY A;  1I39 A;  4CXF A;  2DFE A;  3WTW C;  1GLN A;  4HOB A;  3ZMD A;  3OOP A;  5LFA A;  2JSP A;  1QRY A;  3NWS A;  5J3L A;  2BY1 A;  2DFH A;  2FEZ A;  3VYU B;  3F8F A;  4MO7 A;  5DCM B;  3KYD B;  2W25 A;  1R1U A;  2CG4 A;  3KP3 A;  2R7Q A;  2M8G X;  4A5M A;  2DJN A;  4EJW A;  2N8G A;  4PGG A;  4AD9 A;  2X6O A;  1W7P A;  3PO2 J;  1GDT A;  2ZXW H;  3TBI A;  1K4S A;  3DU5 A;  4CA0 A;  2HQR A;  4IL6 C;  1QZY A;  4H0E A;  2BVL A;  2DA7 A;  1O4X A;  2R7O A;  2XC7 A;  1E3H A;  4LIU A;  3FIW A;  5EYR A;  4E7S A;  4QWQ A;  2IA2 A;  2K85 A;  1Z7L A;  4E7Z A;  1R71 A;  5HLT A;  2DK5 A;  2NAZ A;  2HPI A;  3BZ6 A;  2DPU A;  3MZH A;  3JRD A;  4CYC A;  4XIC A;  3C2B A;  3GWZ A;  2Y48 A;  4ABZ A;  3EQL F;  3LA7 A;  5B3S H;  3A01 B;  3K1M A;  2HOT A;  5DDG A;  2EQR A;  4M9X A;  4BXF A;  2AXL A;  2DXI A;  3DPT A;  4IEJ A;  1TWF J;  3GX4 X;  4YG2 F;  3IRR A;  1W36 D;  4QTR A;  1QO0 D;  1MMN A;  2GXB A;  3MKY B;  2AQE A;  5GAH J;  1FPQ A;  1IRG A;  3SEZ A;  2H8R A;  2QQ9 A;  2NVT J;  3GEZ A;  2M30 A;  2Y0M A;  2MD5 A;  1ODD A;  2WC2 A;  5H2F C;  3GFI A;  3IP4 B;  1H88 C;  3CUQ B;  3S8P A;  2BY2 A;  1FJL A;  1VQL I;  1R5H A;  4EM2 A;  3TO6 A;  5IYD J;  3ZQF A;  4IHX A;  1M1E B;  2Y75 A;  2MG4 A;  1UG0 A;  4G7Z F;  4AWX B;  3OYI A;  1FSE A;  4E4H A;  4PJN A;  4R79 A;  3J81 K;  4IHV A;  3DP7 A;  3I59 A;  3TO7 A;  1VQ8 I;  2DDB A;  3C2G A;  3HB9 A;  2VPR A;  4PJM A;  4AC0 A;  3ZQH A;  3O8H A;  3OIQ A;  3E1S A;  5M5X J;  3MFK A;  3CC7 I;  3QPT A;  4CYD A;  3LSM A;  2A69 F;  4PZJ A;  2XIG A;  4M9Z A;  1TW2 A;  1Z6R A;  1OFC X;  2DK8 A;  2RV8 A;  3VWB A;  4GYG A;  2H27 A;  4BE1 A;  2O7O A;  3CJT B;  1K6O A;  4ZYH A;  3B02 A;  1ZR2 A;  2W57 A;  3HPH A;  2A5W A;  2XGX A;  3KLO A;  3FMQ A;  1T2K A;  3IL2 A;  4MEY F;  4RM3 A;  1W7P B;  1HDD C;  2QQA A;  4BQA A;  2V4J C;  3R0J A;  3J7A Y;  4UUT A;  4A3G J;  2A6H F;  5LRS A;  3F72 A;  3ZMU A;  4RAG A;  1A04 A;  4ZC3 A;  4RLF A;  3EPZ A;  3WGI A;  4LIT A;  2L3D A;  4GGG A;  4EAT A;  5KVR A;  1K6Y A;  2HOS A;  4JX4 A;  2BW3 A;  4IHY A;  5E1W A;  4AYB A;  1FIA A;  2RN7 A;  1TQM A;  3HKZ A;  1V5E A;  3DTK A;  4I7H A;  3ZMS A;  2IAI A;  4YEL A;  2A68 F;  5EEG A;  2KIF A;  4EGY A;  2L7K A;  2L4A A;  3IH3 A;  4P5O A;  2XUB A;  3F22 A;  1H8A C;  5E17 F;  3W6V A;  3BOQ A;  1QVT A;  2DFI A;  4BKX A;  2LNB A;  4DQ2 A;  2KJC A;  3U2R A;  4OOI A;  3WTV C;  3KX2 A;  4PCQ A;  5BPD A;  2DA6 A;  4KUM A;  5JVT A;  3K6G A;  1KA8 A;  4LB6 B;  5IYB J;  1IDY A;  4OIP F;  3GTO J;  2TRT A;  3Q9V A;  4XID A;  1SAN A;  2I10 A;  1K83 J;  1N25 A;  3H35 A;  5LGN A;  3OL3 A;  3JTH A;  4F55 A;  1IAW A;  2O8X A;  2UUZ A;  4O6J A;  3WU2 C;  4Q5S F;  2X1D A;  3KYC B;  3LSR A;  4M3G A;  2E60 A;  2ID3 A;  2Z16 A;  2R92 J;  3RCO A;  1TT5 B;  1P7I A;  1XCV A;  3KZI C;  4D0P A;  1SC7 A;  2VIX A;  3GYH X;  1BC7 C;  4P96 A;  3W2V A;  4BJT A;  2NS7 A;  2OQR A;  2Y69 H;  2OCC H;  1IN4 A;  3BZC A;  3FKJ A;  4CCK A;  6PAX A;  1REP C;  3G71 I;  4BU2 A;  4XKB A;  4IX7 A;  3E5Q A;  3P9K A;  3U21 A;  2BEO A;  2JA7 J;  1GT0 C;  1N77 A;  1BR4 A;  2X1C A;  2HYJ A;  4UV8 A;  2M1B A;  1W4M A;  2W4S A;  3JAM K;  1G4D A;  1E3P A;  1TTY A;  4PK4 A;  3ROU A;  5F0F A;  2MAB A;  4BYY A;  3GCM A;  2EZL A;  5H6R A;  1IDZ A;  4FE4 A;  2QWW A;  5J40 A;  4PGH A;  2EIN H;  2FA5 A;  2GXA A;  4XLE A;  2B63 J;  2IS1 A;  1FY7 A;  3OS1 A;  3W2W A;  2LBF A;  2XPU A;  3I55 I;  3M3Y J;  2HZD A;  2PMU A;  3LST A;  4YRV A;  3JRA A;  2JA8 J;  1B72 B;  2DT6 A;  2MLG A;  3HOS A;  1JE8 A;  1XDS A;  4U88 A;  3JAM Z;  2ZFU A;  4MFD A;  2WAF A;  1G6N A;  5D5V B;  2LKP A;  1ZR4 A;  4UUV A;  1R5I D;  3EUK L;  3PUF A;  2K4B A;  3H3V K;  2ESH A;  1D0X A;  4PJL A;  4I2O A;  2IRF G;  2IEK A;  2ZJQ F;  5TGT A;  1TBX A;  1X1B A;  4B47 A;  5FKM A;  1Z3Y A;  2HS5 A;  4D5C A;  5JLX A;  3K2A A;  2KIU A;  5GPA A;  4UUS A;  1UHM A;  2JRT A;  1Y1V J;  1R36 A;  3LOC A;  4ENN A;  2DMN A;  4G8X A;  3AKZ A;  2DYS H;  5FO5 A;  2NVQ J;  1MH3 A;  1FOY A;  1KYW A;  3J80 Z;  1BR1 A;  2A61 A;  2JPB A;  4JK1 X;  5CQE A;  3M8J A;  1X1D A;  3SDB A;  1HQC A;  4J19 A;  4HNU A;  3QRF F;  1FTT A;  2VQC A;  1ZG1 A;  3HRM A;  3BP8 A;  2ICW G;  4A93 J;  4ZDP A; 
#chains in the Genus database with same CATH homology
 1I1G A;  3LAJ A;  1LEA A;  3BJ6 A;  4HF2 A;  3N4M A;  1E17 A;  2OAZ A;  3ZPL A;  4Y13 A;  1I27 A;  1HBX G;  1BM9 A;  3O3K A;  2QEN A;  4LFU A;  4L5J A;  4ASN A;  1IN8 A;  5IT9 K;  1HW1 A;  3E6M A;  5EEH A;  2ELH A;  4A2U A;  1Y0U A;  1J75 A;  2VE8 A;  4WF2 A;  2KRF A;  2DQL A;  3HRU A;  2IT0 A;  4KIB A;  3IRQ A;  3R0A A;  2FXA A;  3BPX A;  4M72 A;  2FF4 A;  3CTA A;  1R00 A;  3AAF A;  2CW0 F;  3ISP A;  2FNP A;  3M1E A;  2W84 A;  2W24 A;  3E5X A;  1P4A A;  3HRS A;  1BOA A;  3HSR A;  1XGN A;  2BE5 F;  2AS5 F;  2J5O A;  1R1T A;  1SD6 A;  4Q47 A;  1LB2 A;  1MDM A;  1U8R A;  3BWG A;  3C7J A;  3P7N A;  4FX4 A;  3LAP A;  1V4R A;  4CGZ A;  1R1V A;  3GO5 A;  5E8I A;  1DPR A;  3Q5F A;  5LEJ A;  5D5W B;  2M5W A;  2ZXJ A;  1IN6 A;  1J9I A;  1LDK B;  1JHH A;  4A0Y A;  2UZK A;  3MEX A;  4RAZ A;  1HSJ A;  2EK5 A;  3HYI A;  3LFK A;  1F9N A;  2MC3 A;  3PQJ A;  1G3S A;  3CO6 C;  2QQB A;  1NHA A;  3GUD A;  1XGO A;  1ZHF A;  2PI0 A;  4HW0 A;  2HZT A;  4OMZ A;  1XN7 A;  1BJA A;  5FD5 A;  3MCZ A;  2P6T A;  4MQ9 F;  4NB5 A;  5LRR A;  3VOE A;  5FFZ A;  1CF7 A;  3K0L A;  4NQW A;  1T38 A;  3BJA A;  1LQ1 A;  3P9C A;  2LSO A;  1U2W A;  2OU2 A;  1BN5 A;  1EH7 A;  2O03 A;  2ZJ2 A;  3H92 A;  1F5T A;  4JQF A;  2OA4 A;  1P92 A;  5JI6 A;  2STW A;  5LHH A;  1OYI A;  1P6R A;  3TGN A;  1LDJ A;  1ZGA A;  1YFH A;  2UXX A;  3WGG A;  2JT1 A;  4RB0 A;  4XBF A;  2BV6 A;  4N9I A;  4UVC A;  1F4K A;  2PQ8 A;  4HDV A;  4HX7 A;  4M9S A;  4UV9 A;  3ML6 A;  4KN4 X;  1DDN A;  3W6K B;  3ZQ7 A;  5DYM A;  5CVR A;  5ILS A;  1PDN C;  5CLS A;  1W7P D;  3CUO A;  2H6C A;  3CJN A;  1LJ9 A;  2K7L A;  1BIB A;  1XGM A;  1DUX C;  2G7H A;  2NRA C;  1G3W A;  4GCV A;  5TRD A;  2EFN A;  4IHT A;  1IN5 A;  4OIO F;  2VBY A;  1R58 A;  2HKX A;  2F5C A;  1R23 A;  4IHS A;  1SD5 A;  3Q9S A;  2QM3 A;  4FX0 A;  2HEO A;  4L9J A;  2PMH A;  3H3U A;  1HST A;  3QP5 A;  1FYK A;  2RGV A;  1BI1 A;  3FHZ A;  5AIQ A;  5CVI A;  2NNN A;  4BXU A;  3VB2 A;  2MLK A;  5J8C A;  1C0W A;  1KGS A;  5BPI A;  5DD8 A;  4M74 A;  2BGC A;  5LHG A;  4RAY A;  2O61 A;  5JFR A;  1O7F A;  5K5O A;  2ADU A;  2E1C A;  3IWZ A;  1OYW A;  2OZ6 A;  1H9G A;  3EYI A;  4Y17 A;  3DKW A;  4ESF A;  3ZN1 A;  1ULY A;  1O3R A;  3GW2 A;  4PDK A;  5FGM A;  1ZYR F;  1U78 A;  4EJO A;  1QNT A;  2FE3 A;  2ZME B;  4S04 A;  1GVJ A;  2CSO A;  2Q2E A;  5HDK A;  2FBH A;  3FXR A;  2B0L A;  3WTS C;  1HW5 A;  3V7S A;  5IT3 A;  1ZLK A;  1YS7 A;  5AIP A;  4HX8 A;  3DV8 A;  4CZZ A;  4R1H A;  1SMY F;  4M71 A;  1DP7 P;  3I59 B;  1YQA A;  2CFX A;  3WTX C;  4KFC A;  1J5Y A;  1D8K A;  2IVM A;  4HBL A;  4QLC U;  2XAQ A;  1D5V A;  4N0B A;  2DBB A;  5E8G A;  5J6X A;  3ECH A;  1MDM B;  4HAM A;  3QPH A;  3FM3 A;  3CO7 C;  2BYV E;  2E1N A;  1XCB A;  3KFW X;  4LLG F;  1J59 A;  1KU9 A;  2P7C B;  1H9T A;  2V6C A;  5JHU A;  2VE9 A;  5E20 A;  3E97 A;  2HR3 A;  5CYV A;  1R7J A;  1KU2 A;  1J7K A;  3WU1 B;  2IW5 A;  4A6E A;  3HIF A;  4YII A;  5HLG A;  3I71 A;  3E3V A;  4ESB A;  2HYG D;  2H94 A;  2EA2 A;  3M8E A;  3K9T A;  5FFX A;  2V1D A;  1Z7U A;  3F21 A;  4LJZ F;  4EV0 A;  4L9N A;  1YYV A;  2R7D A;  4BHC A;  3LA2 A;  2VBX A;  1FP2 A;  1B1B A;  2PJP A;  3RYR A;  1U3E M;  4WXD A;  2YX4 A;  1XSD A;  4WK8 F;  4HYE A;  2MH9 A;  3EDP A;  5J8F A;  4MGR A;  3BPV A;  3L7W A;  3GFM A;  4DNC A;  2GA2 A;  4BHP A;  5L3G A;  1FBS A;  1HKS A;  3K69 A;  1MD0 A;  2Q8K A;  3KP7 A;  4KIC A;  3HHG A;  4NHJ A;  3WU0 A;  2O3F A;  4TV7 A;  1I1S A;  1FWZ A;  2XHK A;  1Z05 A;  4YFX F;  2FU4 A;  4HLY A;  1Z6T A;  3CUQ A;  1RI7 A;  2RKH A;  1AOY A;  2KJB A;  4XLN F;  3HHH A;  5A2Q Z;  4CDG A;  3LQR A;  3MZY A;  3DXJ F;  4FHT A;  3TQN A;  3ABT A;  1Z91 A;  4U0W A;  2V1X A;  1KU7 A;  1IN7 A;  3SZP A;  3SFZ A;  5FD6 A;  1ZRC A;  3T8T A;  2RDP A;  3H3Z A;  4EGZ A;  1XD7 A;  5H20 A;  3BJO A;  1P2F A;  3ZMZ A;  2YU3 A;  3RIR A;  3KZY A;  3ABU A;  3FMR A;  1V3F A;  2P6S A;  4ON0 A;  5L3F A;  2DTR A;  3R60 A;  2L54 A;  3ZMV A;  3PQK A;  4RB1 A;  3F8N A;  3D0S A;  2LDU A;  1XB4 A;  1ZAO A;  3U9G A;  2KKO A;  1K7A A;  1E2X A;  4WX9 A;  2XAH A;  1Q1H A;  4HDU A;  4UXN A;  4YIF A;  4YFN F;  3TOB A;  4HF0 A;  1UFM A;  4LK0 F;  3E6B A;  1T6S A;  2XKO A;  1OKR A;  3RTR A;  2IA1 A;  3BRO A;  4OMY A;  3FZV A;  5FB2 A;  3BDD A;  4P9F A;  1OYY A;  3I0T A;  1ZH5 A;  2JTV A;  5TJJ A;  4ZYD A;  2RQP A;  3G73 A;  4BHB A;  5IT9 Z;  2NS0 A;  1ZG3 A;  3DFG A;  1DPU A;  1P4W A;  4OIQ F;  5KK1 A;  2EV5 A;  3C1D A;  1FLI A;  1O3S A;  4LK1 F;  2L01 A;  4LGW A;  4M6X A;  2Z33 A;  4BH9 A;  3KEQ A;  5HOO A;  2G7U A;  1GXP A;  4LMY A;  1MJB A;  1STZ A;  4L18 B;  2P5V A;  5A2Q K;  1SAX A;  3GLX A;  3KLN A;  2F2E A;  3DPL C;  3WE3 A;  1I5Z A;  3RDI A;  2ZFW A;  4RGU A;  3RKX A;  2HKO A;  2D1V A;  1B9N A;  2Q0O A;  3F6V A;  4GXO A;  1IRF A;  1Z1D A;  4L5I A;  2DI3 A;  1FYL A;  5HLH A;  4A12 A;  4AIJ A;  1LEB A;  3LA3 A;  2FSW A;  1KYZ A;  1WWX A;  1ZAR A;  3N97 A;  1O3Q A;  1F1Z A;  4BAY A;  4G6Q A;  4BNC A;  1QBJ A;  2XAG A;  4B8X A;  2P5K A;  1WRJ A;  1L3L A;  3DEU A;  2FBI A;  1FZP B;  4G7H F;  3IKT A;  4AVP A;  4CHU A;  1RIO H;  5D5U B;  2JSC A;  3S2W A;  4A6D A;  4RGX A;  1TLH B;  1FBU A;  4Q4Z F;  4IJA A;  2K4J A;  4GO1 A;  1S29 A;  1S7A A;  2OD5 A;  1IW7 F;  3E5U A;  2X0L A;  2VN2 A;  1SMT A;  3QOP A;  2PLY A;  2ZBK A;  1J2X A;  2ETH A;  1FP1 D;  3IWF A;  1IZ1 A;  2DU9 A;  4EJU A;  3MQ0 A;  3L09 A;  3I58 A;  4HLX A;  2F5E A;  1CGP A;  2HOE A;  2DO7 A;  1XSX A;  3LWF A;  1W5T A;  3CDH A;  5D4R A;  1QZZ A;  3HUG A;  1FYM A;  4Z2Y A;  1I6X A;  3GF2 A;  3MAJ A;  1QQI A;  5HS9 A;  1ON1 A;  5HVQ C;  3K1N A;  3WGH A;  4HF1 A;  2HQN A;  4UVA A;  3TO9 A;  3K2Z A;  2IA0 A;  4IF4 A;  2L4M A;  3MWM A;  4RB2 C;  3RI4 A;  4ENM A;  4G7O F;  4ENJ A;  5K5R A;  1HXD A;  3SZT A;  2WV0 A;  2R7F A;  4L0Z B;  4IRH A;  2VT2 A;  3RPU A;  2XKP A;  3RYP A;  5D4S A;  1UHW A;  3F8C A;  3KP2 A;  2CYY A;  1YO5 C;  3HTU A;  3O2P E;  3FMS A;  3RKY A;  5DEQ A;  5DV5 A;  3I53 A;  4RS8 A;  1IXS B;  5ILU A;  3GVA A;  5CJ9 A;  5D6E A;  2EA4 A;  4HQM A;  3F23 A;  2GAU A;  2HFH A;  1BBY A;  3L9F A;  5HS7 A;  3FX3 A;  3WTY C;  5DCF A;  2VBW A;  3NRV A;  1R5G A;  5FLX Z;  2VOP A;  5FLX K;  5LGT A;  2RC4 A;  5ICF A;  1ZRD A;  2O0Y A;  2A6E F;  3G3Z A;  3I5U A;  2ZCW A;  2R3S A;  1K78 A;  3F8M A;  2DLL A;  1SFU A;  2G9W A;  4L9V A;  1T98 A;  4LB5 A;  4I98 B;  2EB7 A;  2EFO A;  1YW9 A;  3M9A A;  5CVV A;  1XDU A;  3FXU A;  5DUK A;  2VXZ A;  2EFP A;  5LHI A;  2IP2 A;  1SD7 A;  4A5N A;  4EM0 B;  2MA3 A;  3E6D A;  4IXA A;  4ENK A;  2EFW A;  4XSZ F;  2GXG A;  3L00 A;  3LQQ A;  1KU3 A;  4OIN F;  2XAF A;  2F5F A;  4MQV A;  2GZW A;  5F64 A;  1XGS A;  4XSX F;  2GA1 A;  2GWR A;  4FT8 A;  1D3Y A;  3GXO A;  4KYW A;  3M7G A;  3V4G A;  2CGP A;  1XMK A;  1BI2 A;  2NNY A;  2P7V B;  5BS6 A;  1PP7 U;  2YR2 A;  1TNT A;  4CIC A;  2KIM A;  1TW3 A;  4EMS A;  1S6L A;  1ONV A;  3I64 A;  1KQ0 A;  4B09 A;  3T8R A;  5AON A;  5ED4 A;  1S8N A;  5L3B A;  3FF5 A;  2HYF A;  3J81 Z;  1JGS A;  2XAJ A;  2GQQ A;  2X4H A;  4IPA A;  3W6J B;  3WTT C;  3RPQ A;  4ZYG A;  2M45 A;  1K79 A;  2PEX A;  1YW8 A;  4AIK A;  1ZGJ A;  1OPC A;  3DF8 A;  2ZKZ A;  3KET A;  2JZY A;  1B6A A;  2MH2 A;  2FMY A;  1SD4 A;  1T39 A;  3V7C A;  1B59 A;  2IPQ X;  3KCC A;  1EV7 A;  1XSV A;  4MTE A;  4ZZD A;  1KQ9 A;  3JSO A;  3RKW A;  1B9M A;  4N9H A;  3V8K A;  5D8L B;  2V1U A;  3IHU A;  2YPR A;  1O7L A;  4I02 A;  3KP5 A;  1FSH A;  1SFX A;  2EV6 A;  1TQI A;  3QU3 A;  5DUI A;  1O57 A;  2CO5 A;  4AIH A;  1ZRE A;  5LBQ A;  4ETS A;  3F6O A;  3CLO A;  4GYI A;  4HQE A;  1LVA A;  4ESJ A;  2QUF A;  3T1B A;  1LDD A;  1X3U A;  3R6S A;  2Z3Y A;  3T5X A;  3KEO A;  4O5V A;  2FOK A;  3VEP A;  2DPD A;  4KN7 X;  2DQR A;  2K02 A;  2K86 A;  2V9V A;  3F8B A;  2COM A;  3KP6 A;  4LLN A;  4WWC A;  3C3W A;  2FNA A;  2ZO4 A;  3KZZ A;  2Z9O A;  1ZRF A;  2EJR A;  4Y15 A;  2VON A;  4F7Z A;  1MGT A;  4MEX F;  2EWN A;  4HV6 A;  1RZ4 A;  2O6G E;  2DW4 A;  5D6F A;  4IRI A;  3TOA A;  1ZLJ A;  2VBZ A;  5K5Q A;  3ULQ B;  1T0F A;  3FWE A;  2M87 A;  4IRG A;  2PG4 A;  1WQ2 A;  1UST A;  2GIV A;  3NQO A;  3SXY A;  3ZP5 A;  1QGP A;  3T0Y A;  2IJL A;  4KT5 C;  2V79 A;  4OU0 A;  5LLQ A;  5F6F A;  1MZB A;  1R22 A;  4A0X A;  3KE2 A;  5DD4 A;  4RB3 C;  5F1R A;  4MTD A;  3FXQ A;  1P4X A;  2VT3 A;  3K1P A;  3CUQ C;  2HWV A;  3JW4 A;  4HX4 A;  1RNL A;  2QVO A;  4U7B A;  4ZH4 F;  2OQG A;  1G3T A;  3ELK A;  1HKQ A;  4HA8 A;  2VOO A;  4KNY A;  2TDX A;  5ICC A;  5ERI A;  4WCG A;  2ZNZ A;  5BMZ A;  2BBY A;  3COA C;  4ZYE A;  4U7D A;  3O6B B;  2WWY A;  1PP8 F;  4KA4 A;  1FT9 A;  4P9U A;  2F5D A;  2A3S A;  2ISY A;  3HTS B;  4JBA A;  3SHF A;  3ZMT A;  4L9T A;  3HRT A;  1AWC A;  4EM1 A;  2Z5U A;  1UCR A;  1FX7 A;  2NYX A;  1ZG5 A;  4XLP F;  2ZNY A;  4LG0 B;  3ZN0 A;  3TDU C;  2OBP A;  2HTJ A;  1YG2 A;  1WKM A;  3JTG A;  5ICG A;  2WTE A;  2HGC A;  2QYO A;  2D2W A;  1XMA A;  2K27 A;  2DAO A;  1PUE E;  5H6Q A;  4KIF A;  4LD5 A;  1SFE A;  3NEU A;  1HW2 A;  1U5T C;  4M73 A;  4E70 A;  4OIR F;  4UHT A;  3FM5 A;  5L3E A;  1WI9 A;  2A07 F;  1IXR C;  2Z99 A;  4G94 A;  2M8E A;  3V8J A;  1ZN2 A;  2P4W A;  2LF8 A;  5HDG A;  1BI3 A;  4KMF A;  3GZ5 A;  1U5T A;  3F3X A;  2D45 A;  2XV4 S;  3QU6 A;  2ZME A;  3HSF A;  5E1Z B;  1K78 B;  4MNU A;  4K2E A;  4I01 A;  2STT A;  4KIG A;  2HTS A;  2EFQ A;  4WXC A;  2PFB A;  1FOK A;  1Z9C A;  4UNO A;  4Q48 A;  3ECO A;  1BIA A;  3JSP A;  3TDZ C;  4WXH A;  1KQ8 A;  1YW7 A;  2XAS A;  1S7O A;  5CVU A;  2RVC A;  1RUO A;  4I0A A;  4IVN A;  2XRO A;  4U0Y A;  1UB9 A;  3VOD A;  5L3D A;  1IUY A;  2MBF A;  3C18 A;  5BQT A;  3WTZ A;  2JPC A;  3B73 A;  2CQK A;  3M8F A;  3EYY A;  5LGU A;  3WE2 A;  1JXS A;  3HOT A;  5L3C A;  1YIO A;  2VC1 A;  2DT5 A;  3IKV A;  3OV8 A;  2W85 A;  2UXN A;  2RNJ A;  2UWM A;  4EQQ A;  4R8H A;  1D8J A;  2XVC A;  3QP6 A;  2FML A;  2ISZ A;  4KMU X;  3WTU C;  4KDP A;  1YLF A;  4L0Y B;  4O3M A;  1ON2 A;  2FQ3 A;  5JR3 A;  5E18 F;  2H6B A;  2QBY A;  3V8L A;  4M6Y A;  3I4P A;  3U1D A;  1G3Y A;  4A0Z A;  1FC3 A;  3GFL A;  2H09 A;  3PFI A;  4I0B A;  1BI0 A;  4G9Y A;  4RGR A;  1H0M A;  2ACJ A;  5LEK A;  1JHF A;  3SQN A;  4EVI A;  2OZU A;  5DCM A;  1U5T B;  2XRN A;  1WSU A;  5HDN A;  3BY6 A;  2VOD A;  1OMI A;  2LF7 A;  1FBQ A;  3R61 A;  2L02 A;  5D8K B;  2C6Y A;  1L0O C;  1BC8 C;  2VC0 A;  2HDC A;  1J0R A;  3L2C A;  3GFJ A;  3ERE D;  4P55 A;  2ESN A;  1EH8 A;  3WG9 A;  1MJ9 A;  1TNS A;  3HSE A;  5ICE A;  3J7A O;  2J5P A;  4MHG A;  1U6G A;  3J80 K;  3E6C C;  1USS A;  4YFK F;  2QLZ A;  2QZ8 A;  3EET A;  2D1H A;  4ZZL A;  3P9I A;  3EUH A;  4UVB A;  3RJP A;  3GZ6 A;  3I54 A;  2QBY B;  3QAH A;  2P8T A;  1S3J A;  4U0V A;  1IF1 A;  3KP4 A;  4LLL A;  3V7R A;  1VTN C;  5BOX A;  5D5X B;  2YX7 A;  2A5Y B;  1GHC A;  1EH6 A;  4S05 A;  2CWE A;  1GXQ A;  1QPM A;  4HV5 A;  5CVJ A;  3R4K A;  3WOD F;  1MKM A;  1RUN A;  2P5L C;  1W5S A;  4EJT A;  3IC7 A;  2YSR A;  5E1X A;  5K1Y A;  1YS6 A;  2PN6 A;  4HZF A;  1HKT A;  2E7X A;  3DQV C;  1IXC A;  1LNW A;  4G6D A;  3VFZ A;  5ILV A;  2PBI A;  4XRF A;  1OR7 A;  1MJA A;  1TQP A;  4I09 A;  1CF7 B;  4CO8 A;  2EV0 A;  2E7W A;  4LG0 A;  2FRH A;  5HS8 A;  1FNN A;  4RGS A;  1B4A A;  3D5L A;  1O3T A;  3REO A;  1YTY A;  4EJV A;  5HLI A;  2FBK A;  3TKY A;  4CXF A;  3WTW C;  4HOB A;  3ZMD A;  3OOP A;  2FEZ A;  3F8F A;  5DCM B;  2W25 A;  1R1U A;  2CG4 A;  3KP3 A;  4A5M A;  4EJW A;  4PGG A;  4AD9 A;  1W7P A;  2HQR A;  1QZY A;  4H0E A;  4QWQ A;  2IA2 A;  2DK5 A;  2NAZ A;  3BZ6 A;  2DPU A;  3MZH A;  3GWZ A;  2Y48 A;  3EQL F;  3LA7 A;  3K1M A;  5DDG A;  4M9X A;  2AXL A;  3DPT A;  3GX4 X;  4YG2 F;  3IRR A;  1QO0 D;  2GXB A;  1FPQ A;  1IRG A;  2QQ9 A;  3GEZ A;  2M30 A;  2Y0M A;  2MD5 A;  1ODD A;  2WC2 A;  3GFI A;  3CUQ B;  1R5H A;  4EM2 A;  3TO6 A;  2Y75 A;  4G7Z F;  4AWX B;  1FSE A;  4R79 A;  3J81 K;  3DP7 A;  3I59 A;  3TO7 A;  3MFK A;  3QPT A;  4CYD A;  2A69 F;  4PZJ A;  2XIG A;  4M9Z A;  1TW2 A;  1Z6R A;  2DK8 A;  2RV8 A;  4GYG A;  2H27 A;  1K6O A;  4ZYH A;  3B02 A;  1T2K A;  2W57 A;  3KLO A;  2XGX A;  3FMQ A;  3IL2 A;  4MEY F;  1W7P B;  2QQA A;  4BQA A;  3R0J A;  2A6H F;  5LRS A;  3F72 A;  3ZMU A;  1A04 A;  3WGI A;  2L3D A;  4GGG A;  5KVR A;  5E1W A;  2RN7 A;  1TQM A;  3ZMS A;  4I7H A;  2A68 F;  5EEG A;  2KIF A;  4EGY A;  2L4A A;  4P5O A;  2XUB A;  3F22 A;  5E17 F;  3BOQ A;  2DFI A;  2LNB A;  4DQ2 A;  2KJC A;  3U2R A;  4OOI A;  3WTV C;  4PCQ A;  5BPD A;  4KUM A;  5JVT A;  4LB6 B;  1KA8 A;  4OIP F;  3Q9V A;  5LGN A;  3JTH A;  1IAW A;  2O8X A;  4O6J A;  4Q5S F;  1XCV A;  4D0P A;  3GYH X;  1BC7 C;  4P96 A;  2OQR A;  1IN4 A;  6PAX A;  1REP C;  3E5Q A;  3P9K A;  2BEO A;  4UV8 A;  2M1B A;  1W4M A;  3JAM K;  1G4D A;  1TTY A;  3ROU A;  4BYY A;  5H6R A;  2QWW A;  4PGH A;  2FA5 A;  1FY7 A;  2PMU A;  3LST A;  2MLG A;  3HOS A;  1JE8 A;  1XDS A;  4U88 A;  3JAM Z;  1G6N A;  5D5V B;  2LKP A;  4UUV A;  2K4B A;  2ESH A;  4I2O A;  2IRF G;  1TBX A;  2HS5 A;  2KIU A;  1UHM A;  2JRT A;  1R36 A;  4ENN A;  4G8X A;  5FO5 A;  1KYW A;  3J80 Z;  2A61 A;  2JPB A;  4JK1 X;  1HQC A;  3QRF F;  1ZG1 A;  3HRM A;  3BP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...