2YPRA

Crystal structure of the dna binding ets domain of human protein fev
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
KGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FEV
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yprA00
1FSHA 1F1ZA 3GO5A 2C6YA 1IN5A 3GYHX 3RYRA 3KP4A 4IRIA 2E7WA 1G3WA 5HDGA 2X4HA 4CZZA 3LAJA 1FX7A 2VT2A 5L3GA 2KRFA 1R1UA 3C7JA 2A69F 2ZBKA 1IW7F 4CDGA 1G3SA 4UVCA 4WCGA 4XSXF 1KYWA 1QPMA 1H0MA 1W7PD 2BGCA 3QPHA 4HF1A 1YG2A 2P5KA 4LB5A 1Z6RA 3R6SA 2R7DA 4XLNF 2HFHA 3C18A 2PBIA 2UWMA 3GZ6A 2EFNA 1QZYA 4M9ZA 1XDSA 1OKRA 1OYYA 4P9FA 2PI0A 1Z6TA 1FY7A 3V8KA 3N97A 3V7CA 3HHHA 3QU6A 1UCRA 2ZFWA 4JQFA 5D6EA 4P5OA 2FRHA 1MGTA 2RKHA 1H9GA 2AXLA 3KP5A 1W4MA 1QBJA 3IHUA 3GWZA 2EFPA 1ZHFA 1BC7C 2QBYB 3F21A 1B1BA 5K5OA 5KVRA 4L0ZB 3KE2A 3WTZA 4LLNA 2KKOA 2QYOA 2HZTA 1IXCA 1RI7A 5DUIA 3FMRA 2JZYA 2F5CA 3V7RA 1ZN2A 1YW9A 3TGNA 4KNYA 4OIPF 1ZARA 1FT9A 3ISPA 1DUXC 4KA4A 5DUKA 4PGGA 2DK5A 2XRNA 3QP5A 4ON0A 3H3UA 3LWFA 1PP8F 1CF7A 4MEYF 3L2CA 5FFZA 5ICFA 3L7WA 4NHJA 2HKXA 1SD5A 2GQQA 4WXDA 4AVPA 4RB3C 1YLFA 1IF1A 3BWGA 2Z33A 1K7AA 4WK8F 1DPUA 3N4MA 5HLGA 1SMYF 1FP1D 1FC3A 2JT1A 3M9AA 4Y17A 2V9VA 2V79A 1KU2A 3VODA 3JTGA 3NQOA 1WRJA 1CGPA 4HOBA 4S04A 1D8JA 4F7ZA 3GX4X 1FSEA 1FZPB 1MDMB 3HUGA 4YG2F 5D4RA 4R79A 4HW0A 4JBAA 2H09A 2XHKA 1D3YA 5FO5A 4HDVA 4XBFA 3RKXA 1I5ZA 2MD5A 4UV8A 3R4KA 1XD7A 5ILVA 1UFMA 4NQWA 4FT8A 4L5JA 3HYIA 4M74A 3CO7C 1DP7P 5FD6A 2XVCA 1MJAA 1WI9A 3RPQA 4ZH4F 4BQAA 2DQRA 5TRDA 2HQRA 4KIBA 4RGXA 2GXBA 4M72A 1DPRA 5EEHA 2JPCA 3W6JB 2KJCA 3WODF 5IT3A 2M45A 3V7SA 3OOPA 2UZKA 3QAHA 3MEXA 2YR2A 1EH7A 2HYGD 3CUOA 4L9NA 3SQNA 5FLXK 4N9IA 3LAPA 1JGSA 3WU0A 4U0YA 4R8HA 1IRFA 2F5DA 2LSOA 2OBPA 2PMHA 1B9NA 1BJAA 4WF2A 2CO5A 1FOKA 4I98B 1RUNA 1X3UA 5ERIA 1BI2A 1Q1HA 2VODA 3ZQ7A 2DBBA 4QWQA 1OR7A 2IJLA 2L54A 2OQGA 1KGSA 2EA4A 4KUMA 2YSRA 2MH2A 2HYFA 2JTVA 4MNUA 5E18F 3KEOA 5HDNA 1R7JA 3C3WA 3ROUA 2FBHA 3EQLF 2IP2A 2FMLA 1BOAA 4MQ9F 3IWFA 3V4GA 1LQ1A 5E1XA 2STWA 2QBYA 1T0FA 1R1VA 5TJJA 5ILUA 2FEZA 3F23A 5DDGA 3KCCA 2DTRA 4RGRA 4LG0B 3GXOA 3TO9A 3WTSC 4G7HF 1EH8A 3GFMA 1ON2A 2OD5A 2OA4A 1IUYA 4OOIA 1UHWA 4LK1F 3K2ZA 3KLNA 3B73A 4ENMA 2NAZA 3VEPA 1O3TA 1D5VA 3V8JA 2L4MA 4HLYA 4BH9A 2M5WA 5HLIA 1IXSB 3WTTC 5LRSA 3D5LA 3F6VA 1IN7A 4P96A 2XAJA 2J5OA 2VN2A 1KU7A 5AIQA 2DLLA 3ZMSA 5K5RA 3KFWX 1SFEA 3M1EA 4YFNF 3BJOA 3DQVC 2FOKA 2WC2A 1T6SA 4UXNA 1BC8C 1ODDA 1Z9CA 4DQ2A 3KEQA 4KMFA 4KICA 3ZPLA 3IKTA 2XAQA 3WE2A 5ICEA 1J2XA 1S7AA 5IT9Z 2R7FA 2ISYA 2K86A 2P7CB 1R5HA 4HV6A 2HTSA 3FM3A 5BOXA 4UHTA 1R5GA 3FX3A 1MDMA 2EFQA 1QGPA 2ESHA 3CJNA 4TV7A 1I1GA 2Z5UA 2NNYA 4M9XA 2HQNA 2OZUA 3KP3A 2DU9A 2WTEA 1J9IA 3I54A 2EJRA 2H6CA 2DPUA 3Q9SA 3K1NA 1R1TA 3E3VA 5E20A 2KIMA 3SZTA 3DPTA 3RI4A 3CUQB 1P4WA 3JAMZ 2Y48A 3HIFA 1UHMA 2W84A 2IA1A 2D1HA 2VE9A 3WGIA 3O3KA 4A0ZA 4OMYA 2EV0A 4ENKA 2QLZA 3HRUA 3BP8A 4M71A 5L3CA 1J59A 1FYKA 4FX0A 4D0PA 3FM5A 2DQLA 2HR3A 3ABUA 4NB5A 1Z1DA 3M7GA 3RIRA 4WX9A 1YTYA 5CYVA 4UUVA 1MJBA 4IRGA 3MCZA 1RNLA 1ZGAA 2HDCA 4KIFA 4HQMA 1KA8A 1GHCA 1GVJA 2GZWA 2ZJ2A 1O7LA 3W6KB 1ZLJA 4K2EA 2A3SA 2ISZA 1JXSA 4L9JA 1LB2A 1USTA 4Y15A 1G4DA 5FFXA 5DCMB 2L4AA 3TOBA 2E1NA 1YFHA 5E8IA 4HZFA 3VOEA 1WQ2A 3I58A 4MTEA 4LG0A 1ZRDA 3BJAA 1MZBA 4U88A 4U7DA 3E6BA 4OIQF 2ADUA 4EJUA 3LA7A 3TO7A 3C1DA 5LHHA 2VT3A 4IF4A 5JVTA 3JSOA 3U1DA 2VC1A 3WTWC 5HS9A 5F64A 1MJ9A 3MFKA 1R00A 1ZAOA 1AOYA 5LHGA 1GXQA 2FBKA 5JR3A 2YPRA 3HOTA 2W85A 3RYPA 3CTAA 1BIBA 3SHFA 3TDZC 2Y75A 1P2FA 3HRMA 4BAYA 1LEAA 5BMZA 3REOA 1WWXA 1L3LA 3QU3A 2PN6A 3L9FA 3AAFA 4LJZF 3T1BA 2XIGA 2XUBA 3EETA 4EQQA 2CSOA 3KZYA 4PGHA 1T39A 4FX4A 2GA1A 5H20A 3FHZA 2J5PA 5DYMA 1KQ0A 4LK0F 3RJPA 2KJBA 3CLOA 2ZKZA 3EYIA 3GFJA 3ZMTA 3MZHA 2JRTA 4ZYEA 2DFIA 3BDDA 2BV6A 1IN4A 1LDJA 2HTJA 4HDUA 2PMUA 3R0JA 1U5TB 3FXUA 4WXHA 2F2EA 3DXJF 3QP6A 2O03A 1HKTA 3K69A 2D45A 3S2WA 4GXOA 5L3DA 4WWCA 3I59A 1ZYRF 1OYIA 2Q2EA 2ZMEB 1SAXA 2KIFA 3E6DA 5BPIA 1MD0A 4EJOA 2OU2A 2MLKA 3CUQA 1TLHB 3J81Z 4ZZLA 2A5YB 2IRFG 2M1BA 2QQAA 2HEOA 1B6AA 1W5SA 1ZGJA 3LQRA 4IHTA 5LEKA 5ICGA 3QPTA 1TNSA 2IPQX 4L9TA 2HOEA 1F5TA 3KLOA 3OV8A 4KMUX 2G7UA 3IWZA 6PAXA 2ZNYA 2V1XA 4AD9A 4A0YA 3HTUA 3Q5FA 3F8NA 2RV8A 3J80K 1G6NA 5JI6A 3F3XA 2MLGA 2AS5F 1SD4A 2IA2A 4G6QA 3WGHA 2QZ8A 4G7OF 5CVIA 3RKYA 5HS8A 4GYGA 3HSEA 1FYLA 3LSTA 3I53A 3FXQA 5FB2A 2P8TA 3TOAA 3F22A 5CVVA 2RQPA 2Z3YA 1XSVA 1IN8A 3I71A 4EJTA 4GCVA 1QNTA 1USSA 4HF2A 3GFIA 1JE8A 1GXPA 3QOPA 3U9GA 2V6CA 1MKMA 4CGZA 1YW8A 3BY6A 2R3SA 5CVUA 4QLCU 3KZZA 5A2QK 5LLQA 1HKQA 2D2WA 2ETHA 2FBIA 1BI3A 5DCMA 3K1PA 4ETSA 1Z7UA 4HQEA 3EUHA 5J8CA 4CYDA 3GVAA 2Z9OA 3K1MA 5L3FA 3V8LA 5LBQA 1S3JA 1KQ8A 4B8XA 1K78B 4P55A 3ZMDA 5E8GA 2FQ3A 2K02A 2CQKA 3LQQA 1E17A 1SD6A 5HLHA 5LEJA 2FMYA 3WU1B 4AWXB 2FXAA 2O3FA 5LHIA 2CYYA 2HWVA 2Y0MA 4XRFA 1P4XA 4XLPF 2QM3A 3BROA 4FHTA 3GUDA 2CW0F 4U0VA 2K4BA 5F6FA 2K27A 2VBXA 3IKVA 1K6OA 3G3ZA 1FLIA 2H94A 2GIVA 2GWRA 1QO0D 1R22A 3R61A 4U7BA 4O3MA 4EGZA 4LFUA 4MTDA 3ZMVA 1KYZA 2Q8KA 3P9KA 3MZYA 1BI1A 5LGUA 2RN7A 4HBLA 1B4AA 3IL2A 4CICA 1LJ9A 3ECOA 1YS7A 4I0BA 4Q5SF 5CJ9A 1I1SA 3KP6A 4XSZF 1SFUA 2CFXA 1R23A 4RB2C 3JSPA 5D6FA 4JK1X 3SZPA 4KYWA 3J7AO 5CLSA 5EEGA 3JTHA 1G3YA 2PLYA 1PDNC 3VFZA 1U5TA 4L0YB 2A07F 2VBZA 3LFKA 2DPDA 3O6BB 5D4SA 4KN4X 2ZMEA 1O3QA 4L18B 1FP2A 1BN5A 1S29A 2DO7A 5L3EA 2L01A 3D0SA 3PFIA 1O3SA 3GLXA 1RZ4A 3WG9A 3RPUA 3E5QA 1T98A 2A6HF 3WTYC 4EM1A 3FMQA 4EJWA 1OPCA 4BNCA 2YX7A 5HDKA 1Z05A 4IPAA 4Q48A 4EVIA 4R1HA 3DF8A 3F72A 1J75A 3DEUA 2XASA 4KT5C 3F6OA 1XCVA 2G9WA 5E17F 2K4JA 4HX8A 3WE3A 4I01A 1HW1A 5K5QA 3KP2A 3CUQC 3I5UA 1XMAA 1KU3A 5FLXZ 2VONA 3IRRA 4OIRF 4OU0A 1BBYA 3FF5A 1U3EM 4AIKA 5H6RA 1YYVA 4HF0A 5FD5A 2ZCWA 3CO6C 2DW4A 1HBXG 4EM0B 5D5WB 4RGSA 1PP7U 3I59B 1J5YA 2RNJA 4BHBA 1SFXA 4A0XA 1TBXA 2RC4A 2QQBA 1LNWA 2IA0A 4G94A 1J7KA 4H0EA 2O8XA 2IT0A 2V1DA 2HS5A 1REPC 2VE8A 3T8TA 2ACJA 5K1YA 4OINF 3CDHA 2P5VA 3EYYA 1Z91A 3KP7A 3ZMUA 1K78A 2ZO4A 2FA5A 5HVQC 4CHUA 2Q0OA 1JHFA 4S05A 1P4AA 4OIOF 2OAZA 5L3BA 1DDNA 2L02A 2DAOA 5J6XA 2G7HA 4M6YA 4BHCA 4EGYA 4Q4ZF 2LF7A 3FMSA 2W24A 4G8XA 5F1RA 1P92A 1U6GA 5LGNA 4ESBA 5D5XB 2H6BA 1TQPA 3GF2A 1O57A 4A5MA 3HTSB 2QUFA 2MA3A 1XCBA 3GZ5A 1T2KA 4YFKF 2CWEA 1XSDA 2HGCA 2EA2A 1U8RA 2DI3A 2MBFA 4HLXA 3RKWA 3TDUC 1KU9A 5CVRA 2MC3A 2UXNA 3I4PA 4IXAA 1O7FA 4HYEA 3BPXA 2YU3A 3H92A 1FNNA 3COAC 1YW7A 4MQVA 1V4RA 3E5XA 3L00A 2ESNA 5H6QA 3ULQB 2ELHA 4L9VA 4A5NA 3BPVA 2DK8A 4CXFA 3DFGA 3MQ0A 2VC0A 3GEZA 1H9TA 5D8LB 1C0WA 1SD7A 1FBSA 2E1CA 4B09A 4L5IA 1BM9A 4M73A 2A61A 1L0OC 1W7PB 3TQNA 2ZNZA 4LGWA 5DV5A 3KETA 2W25A 1ZG1A 2FSWA 2KIUA 2TDXA 3HSRA 2NS0A 1NHAA 3WTUC 1U5TC 1STZA 1B59A 5DEQA 4UNOA 2XAHA 3Q9VA 4YFXF 3F8FA 1WSUA 3R0AA 4GGGA 2VXZA 3E6MA 1VTNC 1OYWA 1D8KA 2RDPA 1FYMA 1TNTA 2VOPA 2IW5A 1IZ1A 1XDUA 2M30A 2NNNA 3SFZA 4A2UA 2PG4A 1T38A 2EB7A 2GAUA 1ZG3A 1ZRFA 2P7VB 3GFLA 3ABTA 2VBYA 4EJVA 2OZ6A 4I09A 4IRHA 3ZP5A 3RDIA 4GYIA 5CVJA 4MGRA 4N9HA 4UVAA 4G7ZF 5LRRA 3SXYA 1G3TA 2NYXA 1FBQA 1XSXA 1R36A 3E5UA 2PEXA 1LDKB 4KFCA 3DPLC 3LA3A 3JW4A 4KN7X 2LDUA 4ZYDA 1SMTA 1TQIA 2V1UA 3ZN1A 4BYYA 1TW2A 1J0RA 4BHPA 4ZZDA 2Z99A 2JSCA 3HOSA 4I02A 4M6XA 5ICCA 1W5TA 4OMZA 4LD5A 2EFWA 1S7OA 5D5UB 4IJAA 2OQRA 1ON1A 1HW2A 1XN7A 5BPDA 3K0LA 3T8RA 2VBWA 4Y13A 3IC7A 3PQJA 4IVNA 1YS6A 3P7NA 5ILSA 3NRVA 1YQAA 1HKSA 1AWCA 4N0BA 1ZRCA 2RVCA 1JHHA 4ENNA 3K9TA 2P5LC 1U2WA 1YO5C 1R58A 3HRTA 2P4WA 4YIIA 2EFOA 3EDPA 1LDDA 2RGVA 1WKMA 3I64A 1TW3A 2XGXA 2GXGA 1TTYA 1P6RA 2CG4A 2QQ9A 4EV0A 2K7LA 4A12A 1XGSA 3B02A 5ED4A 1HSTA 2P6SA 3IRQA 5IT9K 1IAWA 4HAMA 2ZXJA 4HV5A 1ZH5A 1EH6A 3ECHA 1FPQA 4Q47A 3HSFA 2PFBA 4HX7A 2WWYA 2FF4A 3DKWA 4I7HA 4AIHA 1ONVA 3FZVA 5BS6A 4ZYGA 1W7PA 2EK5A 1ZLKA 2EWNA 1XB4A 1UB9A 3QRFF 2LNBA 4UV9A 3F8BA 3RTRA 2STTA 1ZREA 2FNPA 3WTXC 1V3FA 1O3RA 5HS7A 5JFRA 2UXXA 3BZ6A 1I27A 4Z2YA 3LA2A 1BI0A 1B9MA 3HHGA 4ENJA 4HX4A 3JAMK 1U78A 5AONA 5D8KB 4LLLA 3P9CA 3T0YA 3ML6A 4EMSA 2E7XA 1HSJA 1HXDA 1QQIA 2O0YA 2EV5A 1IXRC 2MH9A 1HQCA 5E1ZB 4PDKA 3WTVC 1BIAA 2XKOA 4ESJA 5JHUA 5DD4A 1K79A 3TO6A 2L3DA 3J80Z 5J8FA 3DP7A 3H3ZA 2YX4A 2QENA 1OMIA 4HA8A 3MAJA 4WXCA 3ZMZA 3R60A 3WGGA 5LGTA 4P9UA 1XGOA 2EV6A 3PQKA 2FU4A 4G9YA 3ELKA 1A04A 2M87A 3BOQA 5FGMA 1XGMA 4RAZA 1S6LA 3HRSA 4ESFA 2A6EF 2P6TA 5A2QZ 2JPBA 2W57A 3O2PE 4RB0A 4RGUA 2X0LA 2O61A 1LVAA 2IVMA 4CO8A 3F8CA 1EV7A 4IHSA 2D1VA 2GA2A 4PZJA 1RIOH 1IRGA 5AIPA 3ERED 3I0TA 1YIOA 4O6JA 3M8FA 2XAFA 3F8MA 5DCFA 3M8EA 1E2XA 2BE5F 3BJ6A 3MWMA 4G6DA 4A6EA 1HW5A 4PCQA 1KQ9A 2FE3A 4M9SA 1XGNA 4A6DA 1RUOA 4AIJA 1TQMA 2QVOA 2BEOA 1F9NA 4E70A 2NRAC 2PQ8A 3U2RA 2HKOA 4RS8A 2WV0A 4BXUA 1ZG5A 4RB1A 3VB2A 2O6GE 3L09A 2BYVE 1FBUA 1ULYA 3GW2A 2XROA 4EM2A 1CF7B 4RAYA 2H27A 3ZN0A 2XAGA 2FNAA 4UVBA 3G73A 1F4KA 2A68F 2F5EA 4I2OA 5E1WA 5HOOA 4MEXF 1XMKA 2DT5A 2B0LA 4U0WA 3FWEA 2LF8A 2QWWA 3FXRA 1PUEE 1LEBA 4KDPA 2LKPA 4LMYA 4DNCA 2VOOA 4LLGF 2M8EA 5KK1A 5DD8A 2COMA 1S8NA 1FWZA 4YIFA 4O5VA 3P9IA 3E97A 2CGPA 1Y0UA 3E6CC 2F5FA 4ASNA 4GO1A 2XV4S 2BBYA 4I0AA 3NEUA 5BQTA 3T5XA 4MHGA 2PJPA 3DV8A 2XKPA 1QZZA 1I6XA 5D5VB 3J81K 1IN6A 4LB6B 4KIGA 4ZYHA 3TKYA
chains in the Genus database with same CATH superfamily
1FSHA 1F1ZA 4CCNA 5GTIC 2VJ5A 3GO5A 4NQWB 2C6YA 1QA6A 1IN5A 3GYHX 3RYRA 3S1NJ 3M3YJ 1YHQI 3KP4A 4IRIA 2CQ7A 2E7WA 3LSIA 2E1MC 1G3WA 5HDGA 2X4HA 5GAEJ 5FKLA 4CZZA 5J4YA 2X6OA 4IEJA 4PJLA 2KT0A 3LAJA 1FX7A 2VT2A 5L3GA 2KRFA 2VJ4A 1R1UA 3C7JA 1JTYA 2DYRH 3OL4A 2A69F 3F0CA 2ZBKA 5IYCJ 1IW7F 2CFOA 1G3SA 4UVCA 1GV5A 4CDGA 3JRBA 1JI8A 4WCGA 1BW5A 4XSXF 1KYWA 1QPMA 2XDVA 4CZCA 2XGDA 1H0MA 3PSIA 4MFDA 1W7PD 3GCMA 2BGCA 1VQOI 3QPHA 5J3LA 4HF1A 1Y8QB 1YG2A 2P5KA 2E5NA 2CUJA 2WY7Q 3DKYA 4LB5A 1Z6RA 3R6SA 2EIKH 2R7DA 1WVRA 2NVQJ 2VASA 3KEYA 4XLNF 4YIRX 1W0TA 2HFHA 3C18A 3TMOA 5B1BH 4C3HJ 2KISA 2PBIA 4BJ6C 1VQ5I 1IGNA 1PYVA 2CUFA 2UWMA 2Y69H 3G4SI 4XLEA 4BJTA 3GZ6A 1WGXA 2EFNA 1QZYA 1WH7A 4M9ZA 1XDSA 1OKRA 1YX3A 1OYYA 4P9FA 2PI0A 1Z6TA 1FY7A 3V8KA 3N97A 1D0ZA 1MMGA 4ABZA 3CC7I 3V7CA 3CCVI 2O5RA 3HHHA 2JMWA 3QU6A 5H2FC 2NXNB 1UCRA 2ZMEC 3JRDA 2ZFWA 4JQFA 3I55I 5D6EA 2R7VA 4P5OA 3VDXA 2PMZN 4ZTJA 3CP2A 2FRHA 1MGTA 2RKHA 4E6KG 3NWSA 1H9GA 2AXLA 2VIXA 3KP5A 1W4MA 3RQIA 1QBJA 1ZQ3P 5FROA 2HYJA 3IHUA 3DU6A 3GWZA 2EFPA 1ZHFA 1BC7C 2QBYB 3NAUA 1KZHA 3F21A 2ZJPF 1YX5A 4DZJA 1VQMI 2A5WA 1B1BA 5K5OA 5KVRA 3JRGA 4L0ZB 5EDNA 1RETA 2HU9A 2HXOA 2XGCA 3MKWB 4BY7J 3KE2A 1B8IB 2BZTA 3WTZA 1WJCA 4LLNA 2KKOA 2QYOA 2VLAA 2HZTA 2HZDA 3DWLE 1IXCA 3HB9A 4G6TB 4CCJA 2AQFA 1RI7A 5DUIA 3FMRA 3OYLA 2JZYA 5DM7F 2F5CA 3OYMA 4ZDOA 3V7RA 2BY2A 1ZN2A 4XLCA 2M8GX 3MD2A 1YW9A 3TGNA 4KNYA 4OIPF 2DTZA 2IXSA 1ZARA 1FT9A 2BVMA 3ISPA 1DUXC 2VQLA 4KA4A 2LK2A 5DUKA 1WJ5A 4PGGA 2DK5A 3Q3SA 2XRNA 3AG2H 4D9JA 3S2DJ 3LSHA 3QP5A 4JP0A 1MH3A 4ON0A 3WHBA 3H3UA 3LWFA 1QU3A 1PP8F 1CF7A 4XLAA 2BXYA 1SEUA 4MEYF 3L2CA 4H4KC 5FFZA 3CC4I 3ONQA 1U9OA 4PJMA 3OS1A 1NK2P 1MH4A 2DA3A 5ICFA 3L7WA 2JN6A 4NHJA 2HKXA 1SD5A 2GQQA 2ELJA 2P81A 4WXDA 1I3QJ 4RDUA 3HDDA 2WAQN 1Y6IA 2E2IJ 2BY3A 1Z3YA 4AVPA 2IS4A 2XB0X 2QGUA 4RB3C 1YLFA 1IF1A 2E5ZA 2DOEA 3BWGA 2Z33A 2K3FA 1K7AA 4WK8F 1DPUA 3N4MA 2G0EA 5HLGA 1SMYF 4A3GJ 1FP1D 1OLTA 1FC3A 1IV6A 1VI0A 1X4OA 2JT1A 2GLOA 3M9AA 3OYIA 4Y17A 4M3BA 2L0KA 2V9VA 2V79A 1KU2A 2X6XA 1SC7A 3VODA 1MNEA 2RREA 4ZDLA 1YOVB 4DOZA 3JTGA 5C3EJ 1MNMC 3NQOA 1WRJA 1Z3XA 1CGPA 4OAZA 4HOBA 4S04A 1D8JA 4F7ZA 3BR1A 2KIQA 3GX4X 1FSEA 1FZPB 1E3HA 3S1MJ 4C3IJ 3IAS2 4BKXA 1MDMB 3HUGA 4RM3A 2Y30A 4YG2F 2QKMB 5D4RA 4R79A 4HW0A 4DW6A 4JBAA 2H09A 3S1QJ 2M34A 2XHKA 1D3YA 2EIMH 5FO5A 4HDVA 4A3MJ 5EG0A 3K7AJ 4XBFA 3RKXA 2R4GA 4BEHB 1I5ZA 2MD5A 4UV8A 3OSGA 4RM2A 3R4KA 1XD7A 1RR8C 5ILVA 4YEJA 1SANA 1UFMA 4NQWA 1IUFA 3CCYA 3ERMA 4FT8A 4L5JA 4XKVA 3S3NA 3HYIA 4M74A 5IY5H 3CO7C 4Z6YA 3CJRB 1DP7P 3PO3J 5FD6A 2XVCA 1MJAA 1WI9A 3RPQA 4ZH4F 4BQAA 4CCMA 2DQRA 5TRDA 2HQRA 4KIBA 3TW6A 5FLVA 2MFZA 1WH5A 3QOEA 4RGXA 2M9HA 5LD2C 2GXBA 4M72A 4DZPA 1DPRA 2KRHA 1UZCA 5EEHA 2JPCA 2JWTA 3W6JB 1VQNI 2DA7A 4BS9A 3FXKA 2KJCA 4S0HB 3KYLA 1YITI 3WODF 5IT3A 2M45A 3V7SA 3OOPA 3E7LA 4LIVA 2V9KA 2UZKA 3QAHA 3MEXA 2YR2A 1EH7A 1X2MA 2HYGD 2VJIA 3CUOA 4L9NA 5E3MA 1H8AC 1VQ8I 3SQNA 5FLXK 3RCOA 4N9IA 2OCEA 3LAPA 4BDYA 1IC8A 1JGSA 3WU0A 1NG7A 5EEAA 4U0YA 3CLQA 4R8HA 1IRFA 2YS9A 2LSOA 2OBPA 2F5DA 2PMHA 1Y1VJ 2LREA 1B9NA 2I5UA 1BJAA 2R7OA 4JOMA 3S8PA 1R5ID 4M3FA 4WF2A 4HNTA 1FIPA 2CO5A 1FOKA 2V4JC 4I98B 3BG3A 1RUNA 1X3UA 5ERIA 1BI2A 2H8WA 1Q1HA 2DXIA 2BY1A 2VODA 2Z2SB 3ZQ7A 2LC2A 4HNVA 3H1CA 2DBBA 2WB1N 1ZTRA 1BL0A 5E3NA 4QWQA 1OR7A 2IJLA 2L54A 3PNTA 2OQGA 1KGSA 2EA4A 4KUMA 2YSRA 2MH2A 2HYFA 2WBMA 2JTVA 3IV5A 2IBDA 4MNUA 1W36D 1Y56A 5E18F 5B66C 3KEOA 5HDNA 1R7JA 5IYDJ 4A3BJ 1YE9A 3JRFA 2EZHA 3C3WA 3ROUA 2FBHA 3D5SC 3SJMA 3EQLF 2IP2A 4PJNA 4EEFG 2V9PA 5K7ZA 3VPRA 2FMLA 1BOAA 4MQ9F 1FTTA 3IWFA 4NBQA 1FJLA 3V4GA 3E0JB 2L9RA 1LQ1A 5E1XA 2ZXIA 2E2HJ 2EQRA 4MFEA 5CQEA 2STWA 3OMYA 2QBYA 4PFOA 2CJJA 5F08A 2I8DA 1T0FA 1R1VA 2KPMA 5TJJA 2FEZA 2X48A 5ILUA 3F23A 3M1CA 2FQ4A 1T08B 2Z16A 2IGKA 2ECCA 5DDGA 3KCCA 2DTRA 1B8IA 4RGRA 1EJ9A 4LG0B 4CCOA 2CS3A 3V42A 1FMWA 2DCEA 4KT6A 3GXOA 3TO9A 3WTSC 1VNDA 4G7HF 1EH8A 2NOJB 3GFMA 2VQGA 4A3CJ 1JKPC 1ON2A 2DFHA 2OD5A 2OA4A 4F92B 1IUYA 4X0GA 1EKEA 4OOIA 1UHWA 1JUPA 4NC8A 1HC8A 2E1OA 1Y1WJ 4LK1F 3K2ZA 4A3LJ 5M5WJ 3KLNA 1LE8B 3B73A 4ENMA 1LUJB 2L2OA 2NAZA 4QIWN 3VEPA 3K4JA 1O3TA 1D5VA 3V8JA 2L4MA 2Z1DA 4HLYA 4BH9A 2M5WA 3A4CA 3I3LA 4Y7NJ 2LH9A 3BTIA 1KONA 4B48A 2L7MP 3JR9A 5HLIA 1IXSB 4XLHA 3WTTC 4C3JJ 1M1EB 3JCUC 5LRSA 3D5LA 1POGA 3F6VA 1IN7A 1OISA 4P96A 1TP4A 1UMQA 2PMZA 2XAJA 2R7WA 1AU7A 5CQGA 2J5OA 2VN2A 4DYQA 1KU7A 5AIQA 1NK3P 4AIDA 1RC9A 2DLLA 3WG7H 3ZMSA 4XLFA 3H9JA 5K5RA 3KFWX 2IS1A 1SFEA 2DMTA 3M1EA 3KYDB 3H0DA 1ZKGA 3KYCB 1TWFJ 4YFNF 3BJOA 4Y52J 4A3DJ 2K9SA 3K4KA 4XIDA 3DQVC 2FOKA 2WC2A 5M3FJ 2NVXJ 1T6SA 4UXNA 4B4CA 5FRMA 1IRZA 1G59A 5EZGA 1IV8A 1BC8C 1W1WE 1ODDA 1Z9CA 4DQ2A 3KEQA 4KMFA 4B3XA 1WPKA 4RBOA 4KICA 1Z7LA 2VJJA 2WADA 3ZRGA 3IKTA 3ZPLA 2XAQA 2UV1A 3WE2A 5ICEA 1J2XA 1S7AA 4I76A 3BQZA 5IT9Z 3MKLA 4AM3A 1F36A 2ISYA 2K86A 2R7FA 2P7CB 1R5HA 2QA4I 4HV6A 2HTSA 1X1BA 3L2WA 3AL0B 5IPAA 3FM3A 2OTJI 1TWGJ 5BOXA 3HZJA 4XR6A 3CZ6A 3A0BC 4A93J 4DGWB 4UHTA 3LL7A 1R5GA 3DTKA 3FX3A 1XMXA 1V5EA 4PFPA 4FQGA 2EFQA 1MDMA 1QGPA 2ESHA 4DIQA 1DGWY 2XAUA 2O8KA 2VL8A 1A6QA 3CJNA 4TV7A 1I1GA 2Z5UA 4A3JJ 4LG3A 4I6ZA 2NNYA 1R4NB 4M9XA 3L1PA 3GTGJ 3HJEA 2HQNA 1U0JA 4BEHA 2OZUA 3KP3A 3A01B 4X6AJ 3H5RA 2DU9A 3ZQQA 2WTEA 1J9IA 3I54A 2EJRA 2H6CA 4PUSA 1GUUA 2DPUA 4XONA 1MBKA 3Q9SA 1DGRM 2Q2EB 3CF2A 3K1NA 1R1TA 3E3VA 5E20A 2ZFUA 2KIMA 3SZTA 4IOCF 4XOPA 2N8GA 3DPTA 3OS2A 2XRLA 2WAQA 3RI4A 2MG4A 4FTHA 2LD5A 1V55H 3CUQB 4U87A 5B1AH 1P4WA 5E79C 1OCTC 3CC2I 1JJ6C 3JAMZ 2Y48A 3HIFA 3UKGA 2Y2ZA 1UHMA 4W1UA 2W84A 5JLWA 1HDPA 2IA1A 3PJRA 4HRIA 2D1HA 5BNGA 5KHDA 2VE9A 3WGIA 1MBGA 2LBFB 2CQXA 3O3KA 2EZLA 4A0ZA 4OMYA 2EV0A 2DA6A 4KJZA 1UG0A 2L9VA 5KCMA 4ENKA 1HOMA 2QLZA 4NC7A 3HRUA 3GTKJ 4PSXA 4E7IA 2VKDA 4A3IJ 3BP8A 4M71A 5L3CA 1J59A 1FYKA 4FX0A 3K4CA 2QSFX 3A03A 4D0PA 3FM5A 2DQLA 2HR3A 5B3SH 3ABUA 4QPOA 4QTRA 4A3KJ 4NB5A 5IP9J 1Z1DA 3M7GA 3FDYA 4F3QA 3RIRA 3D1NI 4WX9A 5IOYA 1YTYA 5CYVA 4UUVA 1MJBA 4IRGA 3SFIA 3MCZA 2CRGA 1RNLA 3DEEA 1ZGAA 2HDCA 4FE7A 4HQMA 4KIFA 4LOCA 1KA8A 1GHCA 1GVJA 3SZGA 2HDDA 2GZWA 1D1AA 2ZJ2A 2JK3A 2X1EA 1O7LA 1OCPA 3W6KB 2AQEA 1ZLJA 2M2EA 4K2EA 2A3SA 1WCMJ 2WA0A 4BBSJ 2DJNA 1VQKI 2XF5A 2ISZA 1JXSA 4L9JA 1ENHA 1LB2A 3BG6A 2HVSA 1USTA 4Y15A 5E3OA 1G4DA 3AG4H 1X4PA 1OR7C 5FFXA 2Y0SA 2K3PA 1TT0A 5DCMB 2L4AA 3TOBA 2E1NA 1YFHA 5E8IA 1Q1VA 4XQFA 2FUG2 1X2NA 3DU5A 4HZFA 3OYHA 5J1YA 3VOEA 3VYTB 1TC3C 1OCCH 1WQ2A 3I58A 2Y31A 4MTEA 4LG0A 4BL0B 1ZRDA 3BJAA 1MZBA 4U88A 3OYJA 2XPUA 4U7DA 4D7MA 3E6BA 2OTLI 3PO2J 4OIQF 2ADUA 3JREA 9ANTA 3ASOH 4EJUA 3LA7A 4DYCA 3TO7A 2QCOA 3C1DA 2HNHA 4YRVA 5LHHA 2VUMJ 2CUEA 2VT3A 4IF4A 5JVTA 2KMUA 3JSOA 1LE8A 3P5JA 2VC1A 3U1DA 4HNUA 3WTWC 1T0FC 1JUSA 3I9V2 2QSGX 3DTIA 4LIUA 4I99C 5HS9A 5F64A 2ZXHA 1MJ9A 3FKJA 3MFKA 1R00A 1ZAOA 1AOYA 5LHGA 3AG3H 1GXQA 2FBKA 5JR3A 2YPRA 4AC0A 3FXLA 3HOTA 2W85A 3RYPA 3CTAA 3B6AA 2L7ZA 2VQCA 2M3AA 1BIBA 2LR8A 3SHFA 3TDZC 4XOTA 5DS9A 4V2FA 2E34A 1P2FA 1Y0NA 2Y75A 3HRMA 4BAYA 1ETWA 1LEAA 3HOYJ 5BMZA 4UUSB 3REOA 2K40A 4UUTA 1WWXA 1L3LA 3QU3A 1H88C 1JKQC 2PN6A 4Y33A 3BZCA 3L9FA 3U21A 3AAFA 1R9TJ 2R5YB 4MIMA 3ABLH 3FKIJ 4NUBA 4LJZF 3T1BA 2OPTA 2XIGA 2XUBA 3EETA 2R7TA 2YU9J 4DYRA 4EQQA 4B3AA 3S32A 1AKHB 2CSOA 3KZYA 3HKZA 1A31A 4E4HA 4PGHA 1RKWA 1T39A 2IGOA 4FX4A 2GA1A 3OIOA 5H20A 4A69C 2LMDA 1XPXA 2LOOA 4XORA 3CCUI 3FHZA 2A05A 1OCZH 2LY1A 2J5PA 5DYMA 1KQ0A 4XK4A 3HOXJ 2VKHA 1ETQA 5GTHC 3LSJA 2X6YA 1DU6A 3HGGA 4LK0F 3CCLI 3RJPA 2KJBA 5JVGF 4NNJA 2VXDA 3CLOA 1BW6A 2HQAA 2ZKZA 3EYIA 2DOFA 3GFJA 3ZMTA 1VQPI 1N25A 3MZHA 1X3ZB 2JRTA 3BZKA 4ZYEA 2DFIA 2R7XA 2FX0A 3BDDA 2BV6A 1IN4A 1LDJA 2HTJA 2PMUA 3R0JA 4HDUA 1U5TB 3GTJJ 3FXUA 4WXHA 2F2EA 1WJEA 3A01A 1K83J 2K9LA 3DXJF 2HXIA 2O03A 3QP6A 1HKTA 3K69A 2D45A 3S2WA 1D1BA 2ZJRF 4QPQA 4GXOA 4IZZA 5L3DA 4WWCA 3I59A 1JUMA 2PX9A 1ZYRF 3BR0A 1OYIA 2Q2EA 2ZMEB 4OWRB 1SAXA 2KIFA 3E6DA 5BPIA 2M7AA 3RPUD 2CMPA 5EF6A 1K4TA 5F0CA 1MD0A 3CDLA 2OU2A 4EJOA 2DODA 5JHFA 1OJLA 2MLKA 3SEQA 3CUQA 1TLHB 3QYEA 3J81Z 4ZZLA 1IJWC 1LPQA 2DFFA 2A5YB 2DMQA 2IRFG 2M1BA 3LSKA 1MMDA 2QQAA 2HEOA 1B6AA 1W5SA 1PVEA 2KP6A 1TT5B 3QPLA 1ZGJA 1FIAA 3LQRA 2M4KA 2P0WA 5LEKA 5ICGA 3ESWB 3QPTA 3K70D 1TNSA 2KL4A 3FXOA 3JRIA 2IPQX 4L9TA 5F04A 3S3OA 2HOEA 2DOAA 3O8GA 2FOWA 1F5TA 3KLOA 3OV8A 5GADJ 1N77A 4KMUX 2G7UA 3IWZA 4IHYA 6PAXA 1TZLA 2ZNYA 2V1XA 3S16J 4AD9A 4A0YA 3HTUA 2LBFA 3F8NA 3Q5FA 2RV8A 3OYBA 2NVTJ 2GOMA 3J80K 1G6NA 5JI6A 3F3XA 2MLGA 2AS5F 1SD4A 4V2GA 3SDGA 3BG7A 3JRHA 2IA2A 2GOXB 4IOAF 3ASNH 4G6QA 1GVDA 3WGHA 5FJ8J 2KRCA 2QZ8A 4C2UA 4G7OF 5CVIA 3RKYA 5HS8A 2LKSA 4ZYAA 4GYGA 2HVQA 3RZOJ 4CCKA 2I10A 3HSEA 1FYLA 2DA2A 3HL2A 3LSTA 2ME6A 3M07A 3I53A 3FXQA 1P7JA 5FB2A 4BDZA 3OYDA 3S3MA 3N05A 2P8TA 3TOAA 3HG9A 3F22A 5CVVA 4BQNA 2RQPA 2Z3YA 1XSVA 1IN8A 3I71A 3MN2A 4GCVA 4EJTA 3GLLA 1MMAA 3CD6I 5FKKA 1QNTA 1USSA 4HF2A 3GFIA 1JE8A 1GXPA 3QOPA 2DT7B 3U9GA 2V6CA 2F5VA 2OCCH 2W1OA 2CUZA 4DJAA 4FCYA 1MKMA 4CGZA 1YW8A 3BY6A 2R3SA 4IO9F 3PSFA 5CVUA 4QLCU 3KZZA 1SFOJ 3AKZA 5A2QK 3K2AA 5LLQA 1HKQA 2D2WA 4IKFA 2ETHA 4E7JA 2BXZA 2FBIA 4PSWA 3BR6A 3G2BA 3VYRB 3C2BA 1BI3A 3AG1H 5DCMA 3LNQA 3K1PA 2B9SA 2E19A 2BVLA 4RA2A 4ETSA 3DBLB 1Z7UA 1TWCJ 4HQEA 2V1NA 3EUHA 5J4VA 4CYDA 1Z67A 3HC7A 5J8CA 3GVAA 1BR2A 4RLFA 2Z9OA 3K1MA 5L3FA 2GM4A 2RNGA 3MZ8A 3V8LA 5LBQA 1W36C 1VQ7I 2R93J 2R7UA 1S3JA 1KQ8A 4B8XA 3JRAA 1K78B 4P55A 2CW7A 2MSYA 5FKMA 2DMNA 4Y4RA 3ZMDA 5E8GA 2FQ3A 3Q0UA 1HCRA 2WAEA 2K02A 2CQKA 3LQQA 3MMYB 1E17A 3ZGKA 3L2VA 3LSPA 1SD6A 5HLHA 1RR7A 1RESA 1VQLI 5LEJA 4HPQA 1QHGA 2FMYA 4CCLA 3WU1B 1P9QC 2FXAA 4AWXB 1D0YA 2O3FA 5LHIA 2CYYA 2HWVA 3CESA 1NTCA 2Y0MA 3BC8A 4PJ0C 4W97A 1P4XA 4XRFA 1ZELA 2QM3A 4XLPF 3DLLF 4D1QA 3BROA 4FHTA 1IO2A 2LLKA 3CJTB 1ETXA 3GUDA 4G12A 5GPAA 4BE0A 2CW0F 4U0VA 3PL8A 2K4BA 4MLOA 2R92J 5F6FA 3LMMA 2K27A 3ZQLA 2VBXA 1NG6A 3IKVA 4D5CA 5HNHA 1S9HA 3G3ZA 2KQRA 1V5FA 1K6OA 1I6HJ 1MBHA 3U1KA 1FLIA 4UUSA 2H94A 2GIVA 2GWRA 2KZVA 1A5JA 1QO0D 1R22A 1QHHD 4BE2A 3R61A 1SAUA 4U7BA 1K4SA 2CV0A 4O3MA 2R5YA 4EGZA 1S5LC 3ZQFA 4LFUA 4MTDA 2JA5J 4BY1J 4IHWA 3ZMVA 1AHDP 1KYZA 2Q8KA 3OS0A 5GP9A 3KIOA 3P9KA 1HLVA 4B1RA 3MZYA 1BI1A 4XN3A 4DBRA 5LGUA 2RN7A 5KAIC 4HSRA 3GBGA 1VF9A 1AKHA 4IHTA 4HBLA 5GPCA 3S93A 1JGGA 1B4AA 3IL2A 4CICA 3CCSI 1LJ9A 3ECOA 1YS7A 4I0BA 3BTLA 4Q5SF 1YJ9I 5CJ9A 1I1SA 3KP6A 4RAFA 4F55A 4XSZF 1SFUA 2CFXA 1FTZA 2IGNA 4XL9A 2TCTA 2CU7A 2HI3A 1R23A 4RAGA 1LFUP 4RB2C 2V26A 4XN0A 2JUCA 2DA4A 1SFKA 3JSPA 1TL8A 2CQQA 5D6FA 4JK1X 3MKYB 2K85A 2X1CA 5TISC 1JKRC 4FISA 5EZHA 3SZPA 4KYWA 3J7AO 5CLSA 5C44J 1XTAA 5EEGA 4UY8I 3JTHA 2RQQA 2F6CA 1G3YA 2VPRA 2PLYA 4F93B 3A02A 1PDNC 2VQHA 3VFZA 1U5TA 2DT6A 4L0YB 2A07F 3VSKA 3TEDA 2VBZA 1GV2A 3LFKA 2DPDA 3O6BB 1O4XA 2WAFA 2W00A 5HODA 1K61A 5D4SA 4KN4X 5J47A 2ZMEA 1RPWA 3CP8A 1O3QA 1YI2I 4L18B 3AL0C 1FP2A 1BN5A 1S29A 5DTDA 2DO7A 5L3EA 2L01A 3VSLA 3D0SA 2E60A 3PFIA 1O3SA 3GLXA 1RZ4A 2F48A 4FE4A 3RPUA 3WG9A 3E5QA 2DMPA 1T98A 2A6HF 4M6VA 3WTYC 4EM1A 3FMQA 3OYEA 4EJWA 1EA3A 1OPCA 2YX7A 5HDKA 4BNCA 1R6RA 1Z05A 3LSRA 1A6IA 4IPAA 5JLXA 4Q48A 3FISA 4EVIA 4R1HA 3BR3A 3DF8A 3F72A 1J75A 4AU7A 4PK4A 3DEUA 2ZJQF 2AO9A 2R7QA 2XASA 4KT5C 4ITVA 1WJAA 1HDDC 2HOSA 1IDYA 2M7BA 3F6OA 1XCVA 2G9WA 3FK6A 4N4NB 3VYUB 5E17F 2LKXA 3GTLJ 2K4JA 3NWTA 4HX8A 3WE3A 5GAHJ 2PJRA 4I01A 2ECBA 2NVYJ 1HW1A 2IAIA 1YJNI 2NOGA 4N4OB 4LITA 1XC5A 5K5QA 3KP2A 3CUQC 4BQQA 3I5UA 3KX2A 2XF6A 1XMAA 3ZQIA 1KU3A 1ZK8A 1ITYA 1SVOA 2CH0A 5FLXZ 2HQ5A 2VONA 4XKBA 5EYRA 4Y3OA 5KNLA 4OIRF 3IRRA 4OU0A 3IH2A 1BBYA 1QVTA 2RAEA 1BR4A 3LFUA 3FF5A 1U3EM 4AIKA 3CMAI 3SEZA 1FOXA 5H6RA 1F43A 2CV2A 1YIJI 1YYVA 4HG2A 4HF0A 1XG1A 2X51A 1PJRA 5FD5A 3VYSB 2ZCWA 2B63J 2JA2A 4B47A 3CO6C 2DW4A 3QPSA 1HBXG 2BW3B 3I4MJ 4EM0B 2DDBA 5D5WB 4RGSA 1PP7U 3I59B 1J5YA 2RNJA 1GDTA 4BHBA 1SFXA 4A0XA 1TBXA 2RC4A 2QQBA 4BGDA 1LNWA 2IA0A 2KLOA 1J7KA 4G94A 3W6VA 4H0EA 4F91B 2O8XA 2IT0A 2OF7A 2HPIA 2V1DA 1P7IA 2HS5A 3I56I 1REPC 4JX5A 3FBIB 2EINH 1X1DA 2VE8A 3H35A 3T8TA 2VKVA 4BXFA 2ACJA 5K1YA 4X1EA 3IAM2 1UHSA 4XRSA 4OINF 3HM5A 3CDHA 1JKOC 2ZXWH 3CCRI 2P5VA 3EYYA 1Z91A 3KP7A 3ZMUA 1K78A 2EZKA 2ZO4A 2FA5A 5HVQC 4CHUA 1FEXA 2Q0OA 1JHFA 1PUFA 3S14J 4S05A 2M0CA 3OYNA 4C30A 1P4AA 4OIOF 2OAZA 5L3BA 3ABKH 3S1RJ 1DDNA 2L02A 2DJIA 2E35A 1WJFA 2DAOA 1BJZA 5HLTA 3SYTA 3JRCA 5J6XA 2G7HA 3S17J 4M6YA 2W7NA 1XX5A 2GIZA 2WY8Q 3CQZJ 4A3EJ 3EUHC 5C4JJ 1TWHJ 4BHCA 2XSDC 4EGYA 4Q4ZF 4IL6C 1WJDA 3TP0A 2X9DA 3E1SA 5J40A 2LF7A 3FMSA 2W24A 3ZCOA 3GZNB 2UUZA 4E7SA 3CMYA 3OIPA 4G8XA 2ZSHB 3CF5F 1WI3A 3B6CA 1ZR2A 3CMMA 3L2UA 4CUGA 1X1AA 5F1RA 2EPFA 1P92A 1U6GA 5LGNA 4ESBA 4IQ4A 5D5XB 2H6BA 2W4SA 1TQPA 3H3VK 5F0FA 3HEFA 3BTJA 3GF2A 5J1RA 4C2TA 4NDLA 1U9NA 1O57A 4A5MA 2MW8A 4E7LA 1I50J 2JUGA 4XKCA 1X1CA 2ELKA 3HTSB 1V5GA 3PNVA 4KITB 2QUFA 2MA3A 1XCBA 3GZ5A 2JSPA 1T2KA 4YFKF 2CWEA 1XSDA 2HGCA 1JT0A 3C2GA 3L2RA 2EA2A 1U8RA 2DI3A 2MBFA 4HLXA 2M4GA 3RKWA 3TDUC 2OJED 1KU9A 4XRMA 5CVRA 2MC3A 2YUSA 2UXNA 2VPLA 1JJ8C 3I4PA 4IXAA 1O7FA 3X2QH 4HYEA 1ETOA 3J7AY 3BPXA 2K9NA 2YU3A 3OR2C 3H92A 2X6WA 2OV7A 1DP3A 3OYKA 1WJBA 4JX4A 1FNNA 5TGTA 3COAC 3RQ4A 4XNFA 4CYCA 1YW7A 4MQVA 2F4IA 1V4RA 2BY0A 3E5XA 2V6EA 3L00A 1QRYA 2ESNA 3FXMA 5H6QA 3ULQB 2ELHA 3LSGA 1FOWA 4L9VA 4A5NA 3BPVA 2DK8A 4CXFA 2WB1A 3DFGA 3MQ0A 2VC0A 3GEZA 1H9TA 5D8LB 3BCAA 1C0WA 2LRDA 2BHZA 3OSFA 1SD7A 1FBSA 2E1CA 4B09A 4L5IA 3GTMJ 1BM9A 2HOAA 2Y9ZA 4M73A 2A61A 3D5RC 1L0OC 1W7PB 3TQNA 2ZNZA 1JT6A 5F1JA 1T33A 4XICA 2ZC2A 3M4OJ 2X1DA 1FOYA 1ETVA 4LGWA 2XPWA 5DV5A 5IP7J 3KETA 2W25A 1WFXA 4J19A 3DKXA 3SDBA 1ZG1A 1B72B 1LVKA 2E1MB 2FSWA 2ID6A 2KIUA 2TDXA 3HSRA 2NS0A 1X3WB 2WV1A 4AYBN 2EIJH 1NHAA 3WTUC 3UNGC 3QYFA 3DBRB 1U5TC 2M0MA 5FKNA 1STZA 1B59A 3W3CA 5DEQA 4ZC3A 3WU2C 3MVPA 2CV1A 4IHXA 3UR3C 1E3OC 4UNOA 2XAHA 3Q9VA 4YFXF 2O9LA 3F8FA 4BACA 3R0AA 1R4MB 3DEWA 2XGEA 4GGGA 2VXZA 5CPRB 3J7ZI 2DN0A 4KISA 3E6MA 1OYWA 1D8KA 2LYCA 1VTNC 2RDPA 3BCBA 4QSHA 1J09A 1FYMA 3IP4B 1X19A 1Y39A 1TNTA 2JA6J 4XM3A 1DQUA 2VOPA 1HA8A 2IW5A 2R7ZJ 1IZ1A 1XDUA 2M30A 2NNNA 3QYBA 4HSTA 3SFZA 4A2UA 4ZJZA 2JA8J 2PG4A 1T38A 2EB7A 1MSEC 3RKQA 2GAUA 1T95A 1ZG3A 1ZRFA 2LY9A 1R49A 2P7VB 4FASD 4CA0A 3DTEA 3G1MA 1UJ8A 2TRTA 4V19K 3GFLA 3RSNA 3ABTA 2K9MA 5FLMJ 3K70C 1OFCX 2VBYA 4BBRJ 4EJVA 1ZR4A 2OZ6A 4I09A 4IRHA 4EATA 4ZTFA 2MGQA 1X1PA 3ZP5A 3RDIA 3S2HJ 2EH3A 4GYIA 2H1KA 4JX6A 2BW3A 4MGRA 5CVJA 1OCOH 4N9HA 2IEKA 1R71A 4UVAA 3TW7A 4G7ZF 4II2A 4AUXA 5LRRA 1LFBA 4E7KA 2LP0A 3CCQI 2R7SA 3SXYA 3FBNB 1G3TA 2L5QA 2NYXA 3J7YJ 2NVUB 1N75A 1FBQA 1XSXA 1ZGWA 1R36A 3K4NA 3ABMH 3E5UA 2IGMA 2PEXA 1LDKB 4KFCA 3ZQCA 2VB6A 3DPLC 3IUOA 1VQ6I 1AA7A 2L9SA 3LA3A 5B5EC 3CCMI 3JW4A 4KN7X 3HOWJ 2KZGA 5M5XJ 2BHYA 2FD5A 2LDUA 4ZYDA 3H9QA 3EUAA 1SMTA 1TQIA 5J1UA 3ZXSA 1G2HA 3H0GJ 5CKTA 2MABA 4BE1A 2XSJC 2V1UA 3ZN1A 3PFYA 4BYYA 1TW2A 2DYSH 1MMNA 3HGYA 1J0RA 4BHPA 1N78A 1W5CC 2KDOA 4ZZDA 2Z99A 4XKWA 2JSCA 4OAYA 3HOSA 4FETA 4I02A 4M6XA 2PJRB 3BTCA 3NARA 3OY9A 3PIPF 5ICCA 1W5TA 1MW7A 1CQTA 4OMZA 3CJQB 4LD5A 2NS8A 2EFWA 1WSUA 1S7OA 3K4MA 5D5UB 4IJAA 1T8IA 2OQRA 1T56A 1ON1A 1HW2A 1XN7A 4RLQA 3ZR8X 5BPDA 3K0LA 1APLC 1QPIA 3KPHA 5F27A 5EGOB 1U8BA 3T8RA 2VBWA 4Y13A 5HNFA 3IC7A 1YRNB 3C2HA 3PQJA 4IVNA 1YS6A 4BXXJ 4BQOA 3P7NA 5ILSA 3NRVA 1YQAA 1HKSA 1AWCA 4N0BA 4UB8C 2GBYA 3HBLA 1ZRCA 4GFBA 2RVCA 1JHHA 3DLAA 1MNDA 3BQYA 3GMEA 3K9TA 2P5LC 4ENNA 2OC6A 1U2WA 1YO5C 1R58A 4ZDPA 4ANJA 3OR1C 2R5ZB 5IP6A 3HOVJ 1LKXA 3HRTA 2FJ1A 5K7FA 2P4WA 4YIIA 2EFOA 4E7ZA 2CQNA 3QQAA 3M8JA 5IYBJ 3OL3A 3EDPA 1LDDA 1I3AA 2XPVA 3ZQHA 1UELB 2R7RA 3I4NJ 2RGVA 1WKMA 3I64A 1TW3A 3OIQA 2XGXA 2GXGA 2EILH 1TTYA 2GXAA 1P6RA 3DPUA 5FKOA 2CG4A 2QQ9A 4EV0A 2K7LA 4BUPA 2HDWA 4A12A 2MD0A 4JYKA 2JQ7A 2NS7A 1XGSA 2ID3A 4F52A 3GTQJ 1MIJA 3PIOF 3B02A 1PUFB 5ED4A 1HSTA 2E36A 2P6SA 2VI6A 2H8RA 3IRQA 2Y0SN 2QSHX 5IT9K 2HPMA 1IAWA 4HAMA 2ZXJA 4HV5A 1ZH5A 1EH6A 3ECHA 1FPQA 4Q47A 5IOZA 3HSFA 1RRJA 2PFBA 2EBIA 4HX7A 2WWYA 2FF4A 1VQ4I 3DKWA 4I7HA 4AVZA 2V7FA 4AIHA 3BLYA 1ONVA 1VFCA 3FZVA 5BS6A 1JTXA 4ZYGA 1W7PA 2EK5A 1ZLKA 2AHQA 1WHUA 2CW8A 2EZIA 2EWNA 3WHCA 4A3FJ 1XB4A 1E3PA 3HPGA 2F4MB 4B44A 2JJ7A 2W48A 1MBEA 2Q1ZB 1UB9A 2HVRA 3QWLA 3QRFF 1V54H 5LFAA 2LNBA 4UV9A 1WZ2A 1B72A 3FK7A 3F8BA 1IDZA 3RTRA 3K4LA 1NH3A 3DBHB 2STTA 4J01A 1ZREA 2FNPA 2L9NA 4UB6C 3WTXC 1V3FA 4D7NA 2JVHA 3G1OA 5EJCA 1O3RA 1ETKA 5HS7A 3PM1A 2H1LA 3LSMA 2L7KA 5JFRA 2X85A 2UXXA 3W2AA 1ERDA 1XS9A 1Z0XA 3BZ6A 3HOZJ 3RZDJ 1I27A 4Z2YA 3LA2A 3CDIA 2QQ8A 4L5EA 1BI0A 3CCJI 1B9MA 3HHGA 2W82A 4ENJA 4HX4A 3JAMK 3H9GA 1U78A 5AONA 1A36A 5D8KB 4LLLA 3OOUA 3P9CA 3T0YA 1X58A 2L7FP 3ML6A 4EMSA 2E7XA 5M5YJ 1HSJA 1QVUA 2BOLA 1HXDA 1QQIA 2O0YA 2DDAA 4XRSG 2EV5A 1IXRC 2MH9A 1HQCA 1MSFC 4CYCB 5E1ZB 4PDKA 1D5YA 3ZQGA 3WTVC 1BIAA 2XKOA 4ESJA 1RKTA 5JHUA 5DD4A 1K79A 2IS2A 3TO6A 2L3DA 4D5FA 3J80Z 2DA5A 5J8FA 3G1LA 2KHMA 3S15J 1BOBA 3DP7A 3HKZN 3H3ZA 1MBFA 3K6GA 2YX4A 4RMNA 2QENA 3BR2A 2QKLB 5FRNA 3DCFA 1OMIA 4HA8A 2KDZA 3MAJA 4WXCA 3ZMZA 3FXJA 4YELA 3R60A 3WGGA 5LGTA 4XMYA 5K7HA 4P9UA 3G6EI 2JVGA 2ICWG 4NC6A 1TWAJ 1XGOA 4B43A 1Z77A 2EV6A 1ACIA 3PUBA 3FHNA 3PQKA 1DU0A 2FU4A 3BG9A 3W2VA 2JRMA 4AYBA 4G9YA 3ELKA 1A04A 2ME0A 2OUMA 2M87A 3BOQA 5FGMA 1XGMA 1E0EA 2ZB9A 4RAZA 3IH3A 4M3DA 3W2WA 4C2MJ 2XF7A 1S6LA 3HRSA 1GLNA 2E71A 4ESFA 2A6EF 1ETYA 2P6TA 5A2QZ 3OYCA 2COBA 4II3A 2JPBA 2W57A 2F4OB 3TP3A 1IRXA 3O2PE 2K9QA 4RB0A 4RGUA 3MKZA 2X0LA 2O61A 4CSWA 1LVAA 1K6YA 2IVMA 4CO8A 2XC7A 1ORKA 3F8CA 1EV7A 1Y8RB 1IG7A 4IHSA 2D1VA 1VQ9I 4J00A 1BR1A 2KFDA 2LFBA 4IHVA 2GA2A 4PZJA 2DFEA 3BG5A 1RIOH 1IRGA 5AIPA 3ERED 3HPHA 1I39A 3I0TA 5DM6F 4GDFA 4HEA2 1YIOA 4O6JA 3M8FA 2XAFA 3F8MA 4IQJA 5KAFC 1OQYA 2LY2A 5DCFA 3M8EA 2MC4A 1E2XA 2BE5F 3BJ6A 3MWMA 4G6DA 4A6EA 3A1YA 2Y9YA 1LFPA 1HW5A 5EGOA 5M3MJ 3PNYA 2A6TA 4PCQA 1KQ9A 2E2JJ 2FE3A 4M9SA 2DMUA 3TBIA 1XGNA 4A6DA 1YRNA 3TL4X 2IS6A 2LG4A 1RUOA 1A35A 3H5NA 4AIJA 1TQMA 2QVOA 3CCEI 2BEOA 1F9NA 3Q0WA 4E70A 1YJWI 2NRAC 3AFHA 4P1WA 4M3EA 3FIWA 2R5ZA 2PQ8A 1D1CA 3U2RA 2R0QC 2HKOA 4RS8A 2WV0A 3EPZA 2K5CA 4BXUA 3GTOJ 1ZG5A 3BR5A 4RB1A 3VB2A 2HOTA 1EF4A 2LTPA 5E3LA 2O6GE 3L09A 2BYVE 1FBUA 1S7EA 1ULYA 3F9KA 1FMVA 3G71I 3HXLA 4BJ5C 3LOCA 3A2KA 3KZIC 3GW2A 1G8XA 3H36A 3K10A 2XROA 1Z21A 2MYSA 4EM2A 1CF7B 2D5VA 3K4BA 1VZ0A 4RAYA 3L2QA 1UAAA 2H27A 3ZN0A 2XAGA 2FNAA 2QF7A 2O7OA 1QZEA 4UVBA 3G73A 3OYAA 1F4KA 2A68F 3HOUJ 2F5EA 4I2OA 1BA5A 3OYFA 5E1WA 3Q0VA 5HOOA 1D0XA 3H5AA 4MEXF 1XMKA 2DT5A 5GAGJ 2ZSIB 1UG2A 2B0LA 4U0WA 3FWEA 2LF8A 2QWWA 4E7HA 2LVSA 3FXRA 1PUEE 1LEBA 4KDPA 1GT0C 2LKPA 1SVMA 4BU2A 4LMYA 4DNCA 1W0UA 3VWBA 2VOOA 3EUKL 4LLGF 3GTPJ 4CH7A 1MBJA 2M8EA 4MO7A 2XB5A 5KK1A 3PUFA 3QODA 5DD8A 5F0HA 2COMA 2DA1A 1S72I 1S8NA 3ZOBA 1FWZA 4YIFA 4O5VA 3P9IA 4DBQA 1MMSA 3E97A 3OYGA 2CGPA 1Y0UA 1OCRH 2VKEA 3E6CC 2F5FA 4ASNA 4GO1A 4M3GA 1SVLA 2XV4S 2BBYA 4I0AA 4IX7A 3NEUA 3CMEI 3IH4A 5BQTA 2B7EA 3O8HA 3T5XA 2QEXI 3BT9A 3HUGB 4MHGA 2PJPA 1H89C 3DV8A 2XKPA 4PJJA 3OWTA 1QZZA 5C4XJ 2JA7J 1I6XA 1HF0A 5EG0B 4GRIA 5D5VB 3J81K 2AXTC 1IN6A 4LB6B 4C9YA 4KIGA 3A0HC 4ZYHA 3TKYA
chains in the Genus database with same CATH topology
1FSHA 1F1ZA 3GO5A 2C6YA 1IN5A 3GYHX 3RYRA 3KP4A 4IRIA 2E7WA 1G3WA 5HDGA 2X4HA 4CZZA 3LAJA 1FX7A 2VT2A 5L3GA 2KRFA 1R1UA 3C7JA 2A69F 2ZBKA 1IW7F 4CDGA 1G3SA 4UVCA 4WCGA 4XSXF 1KYWA 1QPMA 1H0MA 1W7PD 2BGCA 3QPHA 4HF1A 1YG2A 2P5KA 4LB5A 1Z6RA 3R6SA 2R7DA 4XLNF 2HFHA 3C18A 2PBIA 2UWMA 3GZ6A 2EFNA 1QZYA 4M9ZA 1XDSA 1OKRA 1OYYA 4P9FA 2PI0A 1Z6TA 1FY7A 3V8KA 3N97A 3V7CA 3HHHA 3QU6A 1UCRA 2ZFWA 4JQFA 5D6EA 4P5OA 2FRHA 1MGTA 2RKHA 1H9GA 2AXLA 3KP5A 1W4MA 1QBJA 3IHUA 3GWZA 2EFPA 1ZHFA 1BC7C 2QBYB 3F21A 1B1BA 5K5OA 5KVRA 4L0ZB 3KE2A 3WTZA 4LLNA 2KKOA 2QYOA 2HZTA 1IXCA 1RI7A 5DUIA 3FMRA 2JZYA 2F5CA 3V7RA 1ZN2A 1YW9A 3TGNA 4KNYA 4OIPF 1ZARA 1FT9A 3ISPA 1DUXC 4KA4A 5DUKA 4PGGA 2DK5A 2XRNA 3QP5A 4ON0A 3H3UA 3LWFA 1PP8F 1CF7A 4MEYF 3L2CA 5FFZA 5ICFA 3L7WA 4NHJA 2HKXA 1SD5A 2GQQA 4WXDA 4AVPA 4RB3C 1YLFA 1IF1A 3BWGA 2Z33A 1K7AA 4WK8F 1DPUA 3N4MA 5HLGA 1SMYF 1FP1D 1FC3A 2JT1A 3M9AA 4Y17A 2V9VA 2V79A 1KU2A 3VODA 3JTGA 3NQOA 1WRJA 1CGPA 4HOBA 4S04A 1D8JA 4F7ZA 3GX4X 1FSEA 1FZPB 1MDMB 3HUGA 4YG2F 5D4RA 4R79A 4HW0A 4JBAA 2H09A 2XHKA 1D3YA 5FO5A 4HDVA 4XBFA 3RKXA 1I5ZA 2MD5A 4UV8A 3R4KA 1XD7A 5ILVA 1UFMA 4NQWA 4FT8A 4L5JA 3HYIA 4M74A 3CO7C 1DP7P 5FD6A 2XVCA 1MJAA 1WI9A 3RPQA 4ZH4F 4BQAA 2DQRA 5TRDA 2HQRA 4KIBA 4RGXA 2GXBA 4M72A 1DPRA 5EEHA 2JPCA 3W6JB 2KJCA 3WODF 5IT3A 2M45A 3V7SA 3OOPA 2UZKA 3QAHA 3MEXA 2YR2A 1EH7A 2HYGD 3CUOA 4L9NA 3SQNA 5FLXK 4N9IA 3LAPA 1JGSA 3WU0A 4U0YA 4R8HA 1IRFA 2F5DA 2LSOA 2OBPA 2PMHA 1B9NA 1BJAA 4WF2A 2CO5A 1FOKA 4I98B 1RUNA 1X3UA 5ERIA 1BI2A 1Q1HA 2VODA 3ZQ7A 2DBBA 4QWQA 1OR7A 2IJLA 2L54A 2OQGA 1KGSA 2EA4A 4KUMA 2YSRA 2MH2A 2HYFA 2JTVA 4MNUA 5E18F 3KEOA 5HDNA 1R7JA 3C3WA 3ROUA 2FBHA 3EQLF 2IP2A 2FMLA 1BOAA 4MQ9F 3IWFA 3V4GA 1LQ1A 5E1XA 2STWA 2QBYA 1T0FA 1R1VA 5TJJA 5ILUA 2FEZA 3F23A 5DDGA 3KCCA 2DTRA 4RGRA 4LG0B 3GXOA 3TO9A 3WTSC 4G7HF 1EH8A 3GFMA 1ON2A 2OD5A 2OA4A 1IUYA 4OOIA 1UHWA 4LK1F 3K2ZA 3KLNA 3B73A 4ENMA 2NAZA 3VEPA 1O3TA 1D5VA 3V8JA 2L4MA 4HLYA 4BH9A 2M5WA 5HLIA 1IXSB 3WTTC 5LRSA 3D5LA 3F6VA 1IN7A 4P96A 2XAJA 2J5OA 2VN2A 1KU7A 5AIQA 2DLLA 3ZMSA 5K5RA 3KFWX 1SFEA 3M1EA 4YFNF 3BJOA 3DQVC 2FOKA 2WC2A 1T6SA 4UXNA 1BC8C 1ODDA 1Z9CA 4DQ2A 3KEQA 4KMFA 4KICA 3ZPLA 3IKTA 2XAQA 3WE2A 5ICEA 1J2XA 1S7AA 5IT9Z 2R7FA 2ISYA 2K86A 2P7CB 1R5HA 4HV6A 2HTSA 3FM3A 5BOXA 4UHTA 1R5GA 3FX3A 1MDMA 2EFQA 1QGPA 2ESHA 3CJNA 4TV7A 1I1GA 2Z5UA 2NNYA 4M9XA 2HQNA 2OZUA 3KP3A 2DU9A 2WTEA 1J9IA 3I54A 2EJRA 2H6CA 2DPUA 3Q9SA 3K1NA 1R1TA 3E3VA 5E20A 2KIMA 3SZTA 3DPTA 3RI4A 3CUQB 1P4WA 3JAMZ 2Y48A 3HIFA 1UHMA 2W84A 2IA1A 2D1HA 2VE9A 3WGIA 3O3KA 4A0ZA 4OMYA 2EV0A 4ENKA 2QLZA 3HRUA 3BP8A 4M71A 5L3CA 1J59A 1FYKA 4FX0A 4D0PA 3FM5A 2DQLA 2HR3A 3ABUA 4NB5A 1Z1DA 3M7GA 3RIRA 4WX9A 1YTYA 5CYVA 4UUVA 1MJBA 4IRGA 3MCZA 1RNLA 1ZGAA 2HDCA 4KIFA 4HQMA 1KA8A 1GHCA 1GVJA 2GZWA 2ZJ2A 1O7LA 3W6KB 1ZLJA 4K2EA 2A3SA 2ISZA 1JXSA 4L9JA 1LB2A 1USTA 4Y15A 1G4DA 5FFXA 5DCMB 2L4AA 3TOBA 2E1NA 1YFHA 5E8IA 4HZFA 3VOEA 1WQ2A 3I58A 4MTEA 4LG0A 1ZRDA 3BJAA 1MZBA 4U88A 4U7DA 3E6BA 4OIQF 2ADUA 4EJUA 3LA7A 3TO7A 3C1DA 5LHHA 2VT3A 4IF4A 5JVTA 3JSOA 3U1DA 2VC1A 3WTWC 5HS9A 5F64A 1MJ9A 3MFKA 1R00A 1ZAOA 1AOYA 5LHGA 1GXQA 2FBKA 5JR3A 2YPRA 3HOTA 2W85A 3RYPA 3CTAA 1BIBA 3SHFA 3TDZC 2Y75A 1P2FA 3HRMA 4BAYA 1LEAA 5BMZA 3REOA 1WWXA 1L3LA 3QU3A 2PN6A 3L9FA 3AAFA 4LJZF 3T1BA 2XIGA 2XUBA 3EETA 4EQQA 2CSOA 3KZYA 4PGHA 1T39A 4FX4A 2GA1A 5H20A 3FHZA 2J5PA 5DYMA 1KQ0A 4LK0F 3RJPA 2KJBA 3CLOA 2ZKZA 3EYIA 3GFJA 3ZMTA 3MZHA 2JRTA 4ZYEA 2DFIA 3BDDA 2BV6A 1IN4A 1LDJA 2HTJA 4HDUA 2PMUA 3R0JA 1U5TB 3FXUA 4WXHA 2F2EA 3DXJF 3QP6A 2O03A 1HKTA 3K69A 2D45A 3S2WA 4GXOA 5L3DA 4WWCA 3I59A 1ZYRF 1OYIA 2Q2EA 2ZMEB 1SAXA 2KIFA 3E6DA 5BPIA 1MD0A 4EJOA 2OU2A 2MLKA 3CUQA 1TLHB 3J81Z 4ZZLA 2A5YB 2IRFG 2M1BA 2QQAA 2HEOA 1B6AA 1W5SA 1ZGJA 3LQRA 4IHTA 5LEKA 5ICGA 3QPTA 1TNSA 2IPQX 4L9TA 2HOEA 1F5TA 3KLOA 3OV8A 4KMUX 2G7UA 3IWZA 6PAXA 2ZNYA 2V1XA 4AD9A 4A0YA 3HTUA 3Q5FA 3F8NA 2RV8A 3J80K 1G6NA 5JI6A 3F3XA 2MLGA 2AS5F 1SD4A 2IA2A 4G6QA 3WGHA 2QZ8A 4G7OF 5CVIA 3RKYA 5HS8A 4GYGA 3HSEA 1FYLA 3LSTA 3I53A 3FXQA 5FB2A 2P8TA 3TOAA 3F22A 5CVVA 2RQPA 2Z3YA 1XSVA 1IN8A 3I71A 4EJTA 4GCVA 1QNTA 1USSA 4HF2A 3GFIA 1JE8A 1GXPA 3QOPA 3U9GA 2V6CA 1MKMA 4CGZA 1YW8A 3BY6A 2R3SA 5CVUA 4QLCU 3KZZA 5A2QK 5LLQA 1HKQA 2D2WA 2ETHA 2FBIA 1BI3A 5DCMA 3K1PA 4ETSA 1Z7UA 4HQEA 3EUHA 5J8CA 4CYDA 3GVAA 2Z9OA 3K1MA 5L3FA 3V8LA 5LBQA 1S3JA 1KQ8A 4B8XA 1K78B 4P55A 3ZMDA 5E8GA 2FQ3A 2K02A 2CQKA 3LQQA 1E17A 1SD6A 5HLHA 5LEJA 2FMYA 3WU1B 4AWXB 2FXAA 2O3FA 5LHIA 2CYYA 2HWVA 2Y0MA 4XRFA 1P4XA 4XLPF 2QM3A 3BROA 4FHTA 3GUDA 2CW0F 4U0VA 2K4BA 5F6FA 2K27A 2VBXA 3IKVA 1K6OA 3G3ZA 1FLIA 2H94A 2GIVA 2GWRA 1QO0D 1R22A 3R61A 4U7BA 4O3MA 4EGZA 4LFUA 4MTDA 3ZMVA 1KYZA 2Q8KA 3P9KA 3MZYA 1BI1A 5LGUA 2RN7A 4HBLA 1B4AA 3IL2A 4CICA 1LJ9A 3ECOA 1YS7A 4I0BA 4Q5SF 5CJ9A 1I1SA 3KP6A 4XSZF 1SFUA 2CFXA 1R23A 4RB2C 3JSPA 5D6FA 4JK1X 3SZPA 4KYWA 3J7AO 5CLSA 5EEGA 3JTHA 1G3YA 2PLYA 1PDNC 3VFZA 1U5TA 4L0YB 2A07F 2VBZA 3LFKA 2DPDA 3O6BB 5D4SA 4KN4X 2ZMEA 1O3QA 4L18B 1FP2A 1BN5A 1S29A 2DO7A 5L3EA 2L01A 3D0SA 3PFIA 1O3SA 3GLXA 1RZ4A 3WG9A 3RPUA 3E5QA 1T98A 2A6HF 3WTYC 4EM1A 3FMQA 4EJWA 1OPCA 4BNCA 2YX7A 5HDKA 1Z05A 4IPAA 4Q48A 4EVIA 4R1HA 3DF8A 3F72A 1J75A 3DEUA 2XASA 4KT5C 3F6OA 1XCVA 2G9WA 5E17F 2K4JA 4HX8A 3WE3A 4I01A 1HW1A 5K5QA 3KP2A 3CUQC 3I5UA 1XMAA 1KU3A 5FLXZ 2VONA 3IRRA 4OIRF 4OU0A 1BBYA 3FF5A 1U3EM 4AIKA 5H6RA 1YYVA 4HF0A 5FD5A 2ZCWA 3CO6C 2DW4A 1HBXG 4EM0B 5D5WB 4RGSA 1PP7U 3I59B 1J5YA 2RNJA 4BHBA 1SFXA 4A0XA 1TBXA 2RC4A 2QQBA 1LNWA 2IA0A 4G94A 1J7KA 4H0EA 2O8XA 2IT0A 2V1DA 2HS5A 1REPC 2VE8A 3T8TA 2ACJA 5K1YA 4OINF 3CDHA 2P5VA 3EYYA 1Z91A 3KP7A 3ZMUA 1K78A 2ZO4A 2FA5A 5HVQC 4CHUA 2Q0OA 1JHFA 4S05A 1P4AA 4OIOF 2OAZA 5L3BA 1DDNA 2L02A 2DAOA 5J6XA 2G7HA 4M6YA 4BHCA 4EGYA 4Q4ZF 2LF7A 3FMSA 2W24A 4G8XA 5F1RA 1P92A 1U6GA 5LGNA 4ESBA 5D5XB 2H6BA 1TQPA 3GF2A 1O57A 4A5MA 3HTSB 2QUFA 2MA3A 1XCBA 3GZ5A 1T2KA 4YFKF 2CWEA 1XSDA 2HGCA 2EA2A 1U8RA 2DI3A 2MBFA 4HLXA 3RKWA 3TDUC 1KU9A 5CVRA 2MC3A 2UXNA 3I4PA 4IXAA 1O7FA 4HYEA 3BPXA 2YU3A 3H92A 1FNNA 3COAC 1YW7A 4MQVA 1V4RA 3E5XA 3L00A 2ESNA 5H6QA 3ULQB 2ELHA 4L9VA 4A5NA 3BPVA 2DK8A 4CXFA 3DFGA 3MQ0A 2VC0A 3GEZA 1H9TA 5D8LB 1C0WA 1SD7A 1FBSA 2E1CA 4B09A 4L5IA 1BM9A 4M73A 2A61A 1L0OC 1W7PB 3TQNA 2ZNZA 4LGWA 5DV5A 3KETA 2W25A 1ZG1A 2FSWA 2KIUA 2TDXA 3HSRA 2NS0A 1NHAA 3WTUC 1U5TC 1STZA 1B59A 5DEQA 4UNOA 2XAHA 3Q9VA 4YFXF 3F8FA 1WSUA 3R0AA 4GGGA 2VXZA 3E6MA 1VTNC 1OYWA 1D8KA 2RDPA 1FYMA 1TNTA 2VOPA 2IW5A 1IZ1A 1XDUA 2M30A 2NNNA 3SFZA 4A2UA 2PG4A 1T38A 2EB7A 2GAUA 1ZG3A 1ZRFA 2P7VB 3GFLA 3ABTA 2VBYA 4EJVA 2OZ6A 4I09A 4IRHA 3ZP5A 3RDIA 4GYIA 5CVJA 4MGRA 4N9HA 4UVAA 4G7ZF 5LRRA 3SXYA 1G3TA 2NYXA 1FBQA 1XSXA 1R36A 3E5UA 2PEXA 1LDKB 4KFCA 3DPLC 3LA3A 3JW4A 4KN7X 2LDUA 4ZYDA 1SMTA 1TQIA 2V1UA 3ZN1A 4BYYA 1TW2A 1J0RA 4BHPA 4ZZDA 2Z99A 2JSCA 3HOSA 4I02A 4M6XA 5ICCA 1W5TA 4OMZA 4LD5A 2EFWA 1S7OA 5D5UB 4IJAA 2OQRA 1ON1A 1HW2A 1XN7A 5BPDA 3K0LA 3T8RA 2VBWA 4Y13A 3IC7A 3PQJA 4IVNA 1YS6A 3P7NA 5ILSA 3NRVA 1YQAA 1HKSA 1AWCA 4N0BA 1ZRCA 2RVCA 1JHHA 4ENNA 3K9TA 2P5LC 1U2WA 1YO5C 1R58A 3HRTA 2P4WA 4YIIA 2EFOA 3EDPA 1LDDA 2RGVA 1WKMA 3I64A 1TW3A 2XGXA 2GXGA 1TTYA 1P6RA 2CG4A 2QQ9A 4EV0A 2K7LA 4A12A 1XGSA 3B02A 5ED4A 1HSTA 2P6SA 3IRQA 5IT9K 1IAWA 4HAMA 2ZXJA 4HV5A 1ZH5A 1EH6A 3ECHA 1FPQA 4Q47A 3HSFA 2PFBA 4HX7A 2WWYA 2FF4A 3DKWA 4I7HA 4AIHA 1ONVA 3FZVA 5BS6A 4ZYGA 1W7PA 2EK5A 1ZLKA 2EWNA 1XB4A 1UB9A 3QRFF 2LNBA 4UV9A 3F8BA 3RTRA 2STTA 1ZREA 2FNPA 3WTXC 1V3FA 1O3RA 5HS7A 5JFRA 2UXXA 3BZ6A 1I27A 4Z2YA 3LA2A 1BI0A 1B9MA 3HHGA 4ENJA 4HX4A 3JAMK 1U78A 5AONA 5D8KB 4LLLA 3P9CA 3T0YA 3ML6A 4EMSA 2E7XA 1HSJA 1HXDA 1QQIA 2O0YA 2EV5A 1IXRC 2MH9A 1HQCA 5E1ZB 4PDKA 3WTVC 1BIAA 2XKOA 4ESJA 5JHUA 5DD4A 1K79A 3TO6A 2L3DA 3J80Z 5J8FA 3DP7A 3H3ZA 2YX4A 2QENA 1OMIA 4HA8A 3MAJA 4WXCA 3ZMZA 3R60A 3WGGA 5LGTA 4P9UA 1XGOA 2EV6A 3PQKA 2FU4A 4G9YA 3ELKA 1A04A 2M87A 3BOQA 5FGMA 1XGMA 4RAZA 1S6LA 3HRSA 4ESFA 2A6EF 2P6TA 5A2QZ 2JPBA 2W57A 3O2PE 4RB0A 4RGUA 2X0LA 2O61A 1LVAA 2IVMA 4CO8A 3F8CA 1EV7A 4IHSA 2D1VA 2GA2A 4PZJA 1RIOH 1IRGA 5AIPA 3ERED 3I0TA 1YIOA 4O6JA 3M8FA 2XAFA 3F8MA 5DCFA 3M8EA 1E2XA 2BE5F 3BJ6A 3MWMA 4G6DA 4A6EA 1HW5A 4PCQA 1KQ9A 2FE3A 4M9SA 1XGNA 4A6DA 1RUOA 4AIJA 1TQMA 2QVOA 2BEOA 1F9NA 4E70A 2NRAC 2PQ8A 3U2RA 2HKOA 4RS8A 2WV0A 4BXUA 1ZG5A 4RB1A 3VB2A 2O6GE 3L09A 2BYVE 1FBUA 1ULYA 3GW2A 2XROA 4EM2A 1CF7B 4RAYA 2H27A 3ZN0A 2XAGA 2FNAA 4UVBA 3G73A 1F4KA 2A68F 2F5EA 4I2OA 5E1WA 5HOOA 4MEXF 1XMKA 2DT5A 2B0LA 4U0WA 3FWEA 2LF8A 2QWWA 3FXRA 1PUEE 1LEBA 4KDPA 2LKPA 4LMYA 4DNCA 2VOOA 4LLGF 2M8EA 5KK1A 5DD8A 2COMA 1S8NA 1FWZA 4YIFA 4O5VA 3P9IA 3E97A 2CGPA 1Y0UA 3E6CC 2F5FA 4ASNA 4GO1A 2XV4S 2BBYA 4I0AA 3NEUA 5BQTA 3T5XA 4MHGA 2PJPA 3DV8A 2XKPA 1QZZA 1I6XA 5D5VB 3J81K 1IN6A 4LB6B 4KIGA 4ZYHA 3TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSH A;  1F1Z A;  3GO5 A;  2C6Y A;  1IN5 A;  3GYH X;  3RYR A;  3KP4 A;  4IRI A;  2E7W A;  1G3W A;  5HDG A;  2X4H A;  4CZZ A;  3LAJ A;  1FX7 A;  2VT2 A;  5L3G A;  2KRF A;  1R1U A;  3C7J A;  2A69 F;  2ZBK A;  1IW7 F;  4CDG A;  1G3S A;  4UVC A;  4WCG A;  4XSX F;  1KYW A;  1QPM A;  1H0M A;  1W7P D;  2BGC A;  3QPH A;  4HF1 A;  1YG2 A;  2P5K A;  4LB5 A;  1Z6R A;  3R6S A;  2R7D A;  4XLN F;  2HFH A;  3C18 A;  2PBI A;  2UWM A;  3GZ6 A;  2EFN A;  1QZY A;  4M9Z A;  1XDS A;  1OKR A;  1OYY A;  4P9F A;  2PI0 A;  1Z6T A;  1FY7 A;  3V8K A;  3N97 A;  3V7C A;  3HHH A;  3QU6 A;  1UCR A;  2ZFW A;  4JQF A;  5D6E A;  4P5O A;  2FRH A;  1MGT A;  2RKH A;  1H9G A;  2AXL A;  3KP5 A;  1W4M A;  1QBJ A;  3IHU A;  3GWZ A;  2EFP A;  1ZHF A;  1BC7 C;  2QBY B;  3F21 A;  1B1B A;  5K5O A;  5KVR A;  4L0Z B;  3KE2 A;  3WTZ A;  4LLN A;  2KKO A;  2QYO A;  2HZT A;  1IXC A;  1RI7 A;  5DUI A;  3FMR A;  2JZY A;  2F5C A;  3V7R A;  1ZN2 A;  1YW9 A;  3TGN A;  4KNY A;  4OIP F;  1ZAR A;  1FT9 A;  3ISP A;  1DUX C;  4KA4 A;  5DUK A;  4PGG A;  2DK5 A;  2XRN A;  3QP5 A;  4ON0 A;  3H3U A;  3LWF A;  1PP8 F;  1CF7 A;  4MEY F;  3L2C A;  5FFZ A;  5ICF A;  3L7W A;  4NHJ A;  2HKX A;  1SD5 A;  2GQQ A;  4WXD A;  4AVP A;  4RB3 C;  1YLF A;  1IF1 A;  3BWG A;  2Z33 A;  1K7A A;  4WK8 F;  1DPU A;  3N4M A;  5HLG A;  1SMY F;  1FP1 D;  1FC3 A;  2JT1 A;  3M9A A;  4Y17 A;  2V9V A;  2V79 A;  1KU2 A;  3VOD A;  3JTG A;  3NQO A;  1WRJ A;  1CGP A;  4HOB A;  4S04 A;  1D8J A;  4F7Z A;  3GX4 X;  1FSE A;  1FZP B;  1MDM B;  3HUG A;  4YG2 F;  5D4R A;  4R79 A;  4HW0 A;  4JBA A;  2H09 A;  2XHK A;  1D3Y A;  5FO5 A;  4HDV A;  4XBF A;  3RKX A;  1I5Z A;  2MD5 A;  4UV8 A;  3R4K A;  1XD7 A;  5ILV A;  1UFM A;  4NQW A;  4FT8 A;  4L5J A;  3HYI A;  4M74 A;  3CO7 C;  1DP7 P;  5FD6 A;  2XVC A;  1MJA A;  1WI9 A;  3RPQ A;  4ZH4 F;  4BQA A;  2DQR A;  5TRD A;  2HQR A;  4KIB A;  4RGX A;  2GXB A;  4M72 A;  1DPR A;  5EEH A;  2JPC A;  3W6J B;  2KJC A;  3WOD F;  5IT3 A;  2M45 A;  3V7S A;  3OOP A;  2UZK A;  3QAH A;  3MEX A;  2YR2 A;  1EH7 A;  2HYG D;  3CUO A;  4L9N A;  3SQN A;  5FLX K;  4N9I A;  3LAP A;  1JGS A;  3WU0 A;  4U0Y A;  4R8H A;  1IRF A;  2F5D A;  2LSO A;  2OBP A;  2PMH A;  1B9N A;  1BJA A;  4WF2 A;  2CO5 A;  1FOK A;  4I98 B;  1RUN A;  1X3U A;  5ERI A;  1BI2 A;  1Q1H A;  2VOD A;  3ZQ7 A;  2DBB A;  4QWQ A;  1OR7 A;  2IJL A;  2L54 A;  2OQG A;  1KGS A;  2EA4 A;  4KUM A;  2YSR A;  2MH2 A;  2HYF A;  2JTV A;  4MNU A;  5E18 F;  3KEO A;  5HDN A;  1R7J A;  3C3W A;  3ROU A;  2FBH A;  3EQL F;  2IP2 A;  2FML A;  1BOA A;  4MQ9 F;  3IWF A;  3V4G A;  1LQ1 A;  5E1X A;  2STW A;  2QBY A;  1T0F A;  1R1V A;  5TJJ A;  5ILU A;  2FEZ A;  3F23 A;  5DDG A;  3KCC A;  2DTR A;  4RGR A;  4LG0 B;  3GXO A;  3TO9 A;  3WTS C;  4G7H F;  1EH8 A;  3GFM A;  1ON2 A;  2OD5 A;  2OA4 A;  1IUY A;  4OOI A;  1UHW A;  4LK1 F;  3K2Z A;  3KLN A;  3B73 A;  4ENM A;  2NAZ A;  3VEP A;  1O3T A;  1D5V A;  3V8J A;  2L4M A;  4HLY A;  4BH9 A;  2M5W A;  5HLI A;  1IXS B;  3WTT C;  5LRS A;  3D5L A;  3F6V A;  1IN7 A;  4P96 A;  2XAJ A;  2J5O A;  2VN2 A;  1KU7 A;  5AIQ A;  2DLL A;  3ZMS A;  5K5R A;  3KFW X;  1SFE A;  3M1E A;  4YFN F;  3BJO A;  3DQV C;  2FOK A;  2WC2 A;  1T6S A;  4UXN A;  1BC8 C;  1ODD A;  1Z9C A;  4DQ2 A;  3KEQ A;  4KMF A;  4KIC A;  3ZPL A;  3IKT A;  2XAQ A;  3WE2 A;  5ICE A;  1J2X A;  1S7A A;  5IT9 Z;  2R7F A;  2ISY A;  2K86 A;  2P7C B;  1R5H A;  4HV6 A;  2HTS A;  3FM3 A;  5BOX A;  4UHT A;  1R5G A;  3FX3 A;  1MDM A;  2EFQ A;  1QGP A;  2ESH A;  3CJN A;  4TV7 A;  1I1G A;  2Z5U A;  2NNY A;  4M9X A;  2HQN A;  2OZU A;  3KP3 A;  2DU9 A;  2WTE A;  1J9I A;  3I54 A;  2EJR A;  2H6C A;  2DPU A;  3Q9S A;  3K1N A;  1R1T A;  3E3V A;  5E20 A;  2KIM A;  3SZT A;  3DPT A;  3RI4 A;  3CUQ B;  1P4W A;  3JAM Z;  2Y48 A;  3HIF A;  1UHM A;  2W84 A;  2IA1 A;  2D1H A;  2VE9 A;  3WGI A;  3O3K A;  4A0Z A;  4OMY A;  2EV0 A;  4ENK A;  2QLZ A;  3HRU A;  3BP8 A;  4M71 A;  5L3C A;  1J59 A;  1FYK A;  4FX0 A;  4D0P A;  3FM5 A;  2DQL A;  2HR3 A;  3ABU A;  4NB5 A;  1Z1D A;  3M7G A;  3RIR A;  4WX9 A;  1YTY A;  5CYV A;  4UUV A;  1MJB A;  4IRG A;  3MCZ A;  1RNL A;  1ZGA A;  2HDC A;  4KIF A;  4HQM A;  1KA8 A;  1GHC A;  1GVJ A;  2GZW A;  2ZJ2 A;  1O7L A;  3W6K B;  1ZLJ A;  4K2E A;  2A3S A;  2ISZ A;  1JXS A;  4L9J A;  1LB2 A;  1UST A;  4Y15 A;  1G4D A;  5FFX A;  5DCM B;  2L4A A;  3TOB A;  2E1N A;  1YFH A;  5E8I A;  4HZF A;  3VOE A;  1WQ2 A;  3I58 A;  4MTE A;  4LG0 A;  1ZRD A;  3BJA A;  1MZB A;  4U88 A;  4U7D A;  3E6B A;  4OIQ F;  2ADU A;  4EJU A;  3LA7 A;  3TO7 A;  3C1D A;  5LHH A;  2VT3 A;  4IF4 A;  5JVT A;  3JSO A;  3U1D A;  2VC1 A;  3WTW C;  5HS9 A;  5F64 A;  1MJ9 A;  3MFK A;  1R00 A;  1ZAO A;  1AOY A;  5LHG A;  1GXQ A;  2FBK A;  5JR3 A;  2YPR A;  3HOT A;  2W85 A;  3RYP A;  3CTA A;  1BIB A;  3SHF A;  3TDZ C;  2Y75 A;  1P2F A;  3HRM A;  4BAY A;  1LEA A;  5BMZ A;  3REO A;  1WWX A;  1L3L A;  3QU3 A;  2PN6 A;  3L9F A;  3AAF A;  4LJZ F;  3T1B A;  2XIG A;  2XUB A;  3EET A;  4EQQ A;  2CSO A;  3KZY A;  4PGH A;  1T39 A;  4FX4 A;  2GA1 A;  5H20 A;  3FHZ A;  2J5P A;  5DYM A;  1KQ0 A;  4LK0 F;  3RJP A;  2KJB A;  3CLO A;  2ZKZ A;  3EYI A;  3GFJ A;  3ZMT A;  3MZH A;  2JRT A;  4ZYE A;  2DFI A;  3BDD A;  2BV6 A;  1IN4 A;  1LDJ A;  2HTJ A;  4HDU A;  2PMU A;  3R0J A;  1U5T B;  3FXU A;  4WXH A;  2F2E A;  3DXJ F;  3QP6 A;  2O03 A;  1HKT A;  3K69 A;  2D45 A;  3S2W A;  4GXO A;  5L3D A;  4WWC A;  3I59 A;  1ZYR F;  1OYI A;  2Q2E A;  2ZME B;  1SAX A;  2KIF A;  3E6D A;  5BPI A;  1MD0 A;  4EJO A;  2OU2 A;  2MLK A;  3CUQ A;  1TLH B;  3J81 Z;  4ZZL A;  2A5Y B;  2IRF G;  2M1B A;  2QQA A;  2HEO A;  1B6A A;  1W5S A;  1ZGJ A;  3LQR A;  4IHT A;  5LEK A;  5ICG A;  3QPT A;  1TNS A;  2IPQ X;  4L9T A;  2HOE A;  1F5T A;  3KLO A;  3OV8 A;  4KMU X;  2G7U A;  3IWZ A;  6PAX A;  2ZNY A;  2V1X A;  4AD9 A;  4A0Y A;  3HTU A;  3Q5F A;  3F8N A;  2RV8 A;  3J80 K;  1G6N A;  5JI6 A;  3F3X A;  2MLG A;  2AS5 F;  1SD4 A;  2IA2 A;  4G6Q A;  3WGH A;  2QZ8 A;  4G7O F;  5CVI A;  3RKY A;  5HS8 A;  4GYG A;  3HSE A;  1FYL A;  3LST A;  3I53 A;  3FXQ A;  5FB2 A;  2P8T A;  3TOA A;  3F22 A;  5CVV A;  2RQP A;  2Z3Y A;  1XSV A;  1IN8 A;  3I71 A;  4EJT A;  4GCV A;  1QNT A;  1USS A;  4HF2 A;  3GFI A;  1JE8 A;  1GXP A;  3QOP A;  3U9G A;  2V6C A;  1MKM A;  4CGZ A;  1YW8 A;  3BY6 A;  2R3S A;  5CVU A;  4QLC U;  3KZZ A;  5A2Q K;  5LLQ A;  1HKQ A;  2D2W A;  2ETH A;  2FBI A;  1BI3 A;  5DCM A;  3K1P A;  4ETS A;  1Z7U A;  4HQE A;  3EUH A;  5J8C A;  4CYD A;  3GVA A;  2Z9O A;  3K1M A;  5L3F A;  3V8L A;  5LBQ A;  1S3J A;  1KQ8 A;  4B8X A;  1K78 B;  4P55 A;  3ZMD A;  5E8G A;  2FQ3 A;  2K02 A;  2CQK A;  3LQQ A;  1E17 A;  1SD6 A;  5HLH A;  5LEJ A;  2FMY A;  3WU1 B;  4AWX B;  2FXA A;  2O3F A;  5LHI A;  2CYY A;  2HWV A;  2Y0M A;  4XRF A;  1P4X A;  4XLP F;  2QM3 A;  3BRO A;  4FHT A;  3GUD A;  2CW0 F;  4U0V A;  2K4B A;  5F6F A;  2K27 A;  2VBX A;  3IKV A;  1K6O A;  3G3Z A;  1FLI A;  2H94 A;  2GIV A;  2GWR A;  1QO0 D;  1R22 A;  3R61 A;  4U7B A;  4O3M A;  4EGZ A;  4LFU A;  4MTD A;  3ZMV A;  1KYZ A;  2Q8K A;  3P9K A;  3MZY A;  1BI1 A;  5LGU A;  2RN7 A;  4HBL A;  1B4A A;  3IL2 A;  4CIC A;  1LJ9 A;  3ECO A;  1YS7 A;  4I0B A;  4Q5S F;  5CJ9 A;  1I1S A;  3KP6 A;  4XSZ F;  1SFU A;  2CFX A;  1R23 A;  4RB2 C;  3JSP A;  5D6F A;  4JK1 X;  3SZP A;  4KYW A;  3J7A O;  5CLS A;  5EEG A;  3JTH A;  1G3Y A;  2PLY A;  1PDN C;  3VFZ A;  1U5T A;  4L0Y B;  2A07 F;  2VBZ A;  3LFK A;  2DPD A;  3O6B B;  5D4S A;  4KN4 X;  2ZME A;  1O3Q A;  4L18 B;  1FP2 A;  1BN5 A;  1S29 A;  2DO7 A;  5L3E A;  2L01 A;  3D0S A;  3PFI A;  1O3S A;  3GLX A;  1RZ4 A;  3WG9 A;  3RPU A;  3E5Q A;  1T98 A;  2A6H F;  3WTY C;  4EM1 A;  3FMQ A;  4EJW A;  1OPC A;  4BNC A;  2YX7 A;  5HDK A;  1Z05 A;  4IPA A;  4Q48 A;  4EVI A;  4R1H A;  3DF8 A;  3F72 A;  1J75 A;  3DEU A;  2XAS A;  4KT5 C;  3F6O A;  1XCV A;  2G9W A;  5E17 F;  2K4J A;  4HX8 A;  3WE3 A;  4I01 A;  1HW1 A;  5K5Q A;  3KP2 A;  3CUQ C;  3I5U A;  1XMA A;  1KU3 A;  5FLX Z;  2VON A;  3IRR A;  4OIR F;  4OU0 A;  1BBY A;  3FF5 A;  1U3E M;  4AIK A;  5H6R A;  1YYV A;  4HF0 A;  5FD5 A;  2ZCW A;  3CO6 C;  2DW4 A;  1HBX G;  4EM0 B;  5D5W B;  4RGS A;  1PP7 U;  3I59 B;  1J5Y A;  2RNJ A;  4BHB A;  1SFX A;  4A0X A;  1TBX A;  2RC4 A;  2QQB A;  1LNW A;  2IA0 A;  4G94 A;  1J7K A;  4H0E A;  2O8X A;  2IT0 A;  2V1D A;  2HS5 A;  1REP C;  2VE8 A;  3T8T A;  2ACJ A;  5K1Y A;  4OIN F;  3CDH A;  2P5V A;  3EYY A;  1Z91 A;  3KP7 A;  3ZMU A;  1K78 A;  2ZO4 A;  2FA5 A;  5HVQ C;  4CHU A;  2Q0O A;  1JHF A;  4S05 A;  1P4A A;  4OIO F;  2OAZ A;  5L3B A;  1DDN A;  2L02 A;  2DAO A;  5J6X A;  2G7H A;  4M6Y A;  4BHC A;  4EGY A;  4Q4Z F;  2LF7 A;  3FMS A;  2W24 A;  4G8X A;  5F1R A;  1P92 A;  1U6G A;  5LGN A;  4ESB A;  5D5X B;  2H6B A;  1TQP A;  3GF2 A;  1O57 A;  4A5M A;  3HTS B;  2QUF A;  2MA3 A;  1XCB A;  3GZ5 A;  1T2K A;  4YFK F;  2CWE A;  1XSD A;  2HGC A;  2EA2 A;  1U8R A;  2DI3 A;  2MBF A;  4HLX A;  3RKW A;  3TDU C;  1KU9 A;  5CVR A;  2MC3 A;  2UXN A;  3I4P A;  4IXA A;  1O7F A;  4HYE A;  3BPX A;  2YU3 A;  3H92 A;  1FNN A;  3COA C;  1YW7 A;  4MQV A;  1V4R A;  3E5X A;  3L00 A;  2ESN A;  5H6Q A;  3ULQ B;  2ELH A;  4L9V A;  4A5N A;  3BPV A;  2DK8 A;  4CXF A;  3DFG A;  3MQ0 A;  2VC0 A;  3GEZ A;  1H9T A;  5D8L B;  1C0W A;  1SD7 A;  1FBS A;  2E1C A;  4B09 A;  4L5I A;  1BM9 A;  4M73 A;  2A61 A;  1L0O C;  1W7P B;  3TQN A;  2ZNZ A;  4LGW A;  5DV5 A;  3KET A;  2W25 A;  1ZG1 A;  2FSW A;  2KIU A;  2TDX A;  3HSR A;  2NS0 A;  1NHA A;  3WTU C;  1U5T C;  1STZ A;  1B59 A;  5DEQ A;  4UNO A;  2XAH A;  3Q9V A;  4YFX F;  3F8F A;  1WSU A;  3R0A A;  4GGG A;  2VXZ A;  3E6M A;  1VTN C;  1OYW A;  1D8K A;  2RDP A;  1FYM A;  1TNT A;  2VOP A;  2IW5 A;  1IZ1 A;  1XDU A;  2M30 A;  2NNN A;  3SFZ A;  4A2U A;  2PG4 A;  1T38 A;  2EB7 A;  2GAU A;  1ZG3 A;  1ZRF A;  2P7V B;  3GFL A;  3ABT A;  2VBY A;  4EJV A;  2OZ6 A;  4I09 A;  4IRH A;  3ZP5 A;  3RDI A;  4GYI A;  5CVJ A;  4MGR A;  4N9H A;  4UVA A;  4G7Z F;  5LRR A;  3SXY A;  1G3T A;  2NYX A;  1FBQ A;  1XSX A;  1R36 A;  3E5U A;  2PEX A;  1LDK B;  4KFC A;  3DPL C;  3LA3 A;  3JW4 A;  4KN7 X;  2LDU A;  4ZYD A;  1SMT A;  1TQI A;  2V1U A;  3ZN1 A;  4BYY A;  1TW2 A;  1J0R A;  4BHP A;  4ZZD A;  2Z99 A;  2JSC A;  3HOS A;  4I02 A;  4M6X A;  5ICC A;  1W5T A;  4OMZ A;  4LD5 A;  2EFW A;  1S7O A;  5D5U B;  4IJA A;  2OQR A;  1ON1 A;  1HW2 A;  1XN7 A;  5BPD A;  3K0L A;  3T8R A;  2VBW A;  4Y13 A;  3IC7 A;  3PQJ A;  4IVN A;  1YS6 A;  3P7N A;  5ILS A;  3NRV A;  1YQA A;  1HKS A;  1AWC A;  4N0B A;  1ZRC A;  2RVC A;  1JHH A;  4ENN A;  3K9T A;  2P5L C;  1U2W A;  1YO5 C;  1R58 A;  3HRT A;  2P4W A;  4YII A;  2EFO A;  3EDP A;  1LDD A;  2RGV A;  1WKM A;  3I64 A;  1TW3 A;  2XGX A;  2GXG A;  1TTY A;  1P6R A;  2CG4 A;  2QQ9 A;  4EV0 A;  2K7L A;  4A12 A;  1XGS A;  3B02 A;  5ED4 A;  1HST A;  2P6S A;  3IRQ A;  5IT9 K;  1IAW A;  4HAM A;  2ZXJ A;  4HV5 A;  1ZH5 A;  1EH6 A;  3ECH A;  1FPQ A;  4Q47 A;  3HSF A;  2PFB A;  4HX7 A;  2WWY A;  2FF4 A;  3DKW A;  4I7H A;  4AIH A;  1ONV A;  3FZV A;  5BS6 A;  4ZYG A;  1W7P A;  2EK5 A;  1ZLK A;  2EWN A;  1XB4 A;  1UB9 A;  3QRF F;  2LNB A;  4UV9 A;  3F8B A;  3RTR A;  2STT A;  1ZRE A;  2FNP A;  3WTX C;  1V3F A;  1O3R A;  5HS7 A;  5JFR A;  2UXX A;  3BZ6 A;  1I27 A;  4Z2Y A;  3LA2 A;  1BI0 A;  1B9M A;  3HHG A;  4ENJ A;  4HX4 A;  3JAM K;  1U78 A;  5AON A;  5D8K B;  4LLL A;  3P9C A;  3T0Y A;  3ML6 A;  4EMS A;  2E7X A;  1HSJ A;  1HXD A;  1QQI A;  2O0Y A;  2EV5 A;  1IXR C;  2MH9 A;  1HQC A;  5E1Z B;  4PDK A;  3WTV C;  1BIA A;  2XKO A;  4ESJ A;  5JHU A;  5DD4 A;  1K79 A;  3TO6 A;  2L3D A;  3J80 Z;  5J8F A;  3DP7 A;  3H3Z A;  2YX4 A;  2QEN A;  1OMI A;  4HA8 A;  3MAJ A;  4WXC A;  3ZMZ A;  3R60 A;  3WGG A;  5LGT A;  4P9U A;  1XGO A;  2EV6 A;  3PQK A;  2FU4 A;  4G9Y A;  3ELK A;  1A04 A;  2M87 A;  3BOQ A;  5FGM A;  1XGM A;  4RAZ A;  1S6L A;  3HRS A;  4ESF A;  2A6E F;  2P6T A;  5A2Q Z;  2JPB A;  2W57 A;  3O2P E;  4RB0 A;  4RGU A;  2X0L A;  2O61 A;  1LVA A;  2IVM A;  4CO8 A;  3F8C A;  1EV7 A;  4IHS A;  2D1V A;  2GA2 A;  4PZJ A;  1RIO H;  1IRG A;  5AIP A;  3ERE D;  3I0T A;  1YIO A;  4O6J A;  3M8F A;  2XAF A;  3F8M A;  5DCF A;  3M8E A;  1E2X A;  2BE5 F;  3BJ6 A;  3MWM A;  4G6D A;  4A6E A;  1HW5 A;  4PCQ A;  1KQ9 A;  2FE3 A;  4M9S A;  1XGN A;  4A6D A;  1RUO A;  4AIJ A;  1TQM A;  2QVO A;  2BEO A;  1F9N A;  4E70 A;  2NRA C;  2PQ8 A;  3U2R A;  2HKO A;  4RS8 A;  2WV0 A;  4BXU A;  1ZG5 A;  4RB1 A;  3VB2 A;  2O6G E;  3L09 A;  2BYV E;  1FBU A;  1ULY A;  3GW2 A;  2XRO A;  4EM2 A;  1CF7 B;  4RAY A;  2H27 A;  3ZN0 A;  2XAG A;  2FNA A;  4UVB A;  3G73 A;  1F4K A;  2A68 F;  2F5E A;  4I2O A;  5E1W A;  5HOO A;  4MEX F;  1XMK A;  2DT5 A;  2B0L A;  4U0W A;  3FWE A;  2LF8 A;  2QWW A;  3FXR A;  1PUE E;  1LEB A;  4KDP A;  2LKP A;  4LMY A;  4DNC A;  2VOO A;  4LLG F;  2M8E A;  5KK1 A;  5DD8 A;  2COM A;  1S8N A;  1FWZ A;  4YIF A;  4O5V A;  3P9I A;  3E97 A;  2CGP A;  1Y0U A;  3E6C C;  2F5F A;  4ASN A;  4GO1 A;  2XV4 S;  2BBY A;  4I0A A;  3NEU A;  5BQT A;  3T5X A;  4MHG A;  2PJP A;  3DV8 A;  2XKP A;  1QZZ A;  1I6X A;  5D5V B;  3J81 K;  1IN6 A;  4LB6 B;  4KIG A;  4ZYH A;  3TKY A; 
#chains in the Genus database with same CATH topology
 1FSH A;  1F1Z A;  4CCN A;  5GTI C;  2VJ5 A;  3GO5 A;  4NQW B;  2C6Y A;  1QA6 A;  1IN5 A;  3GYH X;  3RYR A;  3S1N J;  3M3Y J;  1YHQ I;  3KP4 A;  4IRI A;  2CQ7 A;  2E7W A;  3LSI A;  2E1M C;  1G3W A;  5HDG A;  2X4H A;  5GAE J;  5FKL A;  4CZZ A;  5J4Y A;  2X6O A;  4IEJ A;  4PJL A;  2KT0 A;  3LAJ A;  1FX7 A;  2VT2 A;  5L3G A;  2KRF A;  2VJ4 A;  1R1U A;  3C7J A;  1JTY A;  2DYR H;  3OL4 A;  2A69 F;  3F0C A;  2ZBK A;  5IYC J;  1IW7 F;  2CFO A;  1G3S A;  4UVC A;  1GV5 A;  4CDG A;  3JRB A;  1JI8 A;  4WCG A;  1BW5 A;  4XSX F;  1KYW A;  1QPM A;  2XDV A;  4CZC A;  2XGD A;  1H0M A;  3PSI A;  4MFD A;  1W7P D;  3GCM A;  2BGC A;  1VQO I;  3QPH A;  5J3L A;  4HF1 A;  1Y8Q B;  1YG2 A;  2P5K A;  2E5N A;  2CUJ A;  2WY7 Q;  3DKY A;  4LB5 A;  1Z6R A;  3R6S A;  2EIK H;  2R7D A;  1WVR A;  2NVQ J;  2VAS A;  3KEY A;  4XLN F;  4YIR X;  1W0T A;  2HFH A;  3C18 A;  3TMO A;  5B1B H;  4C3H J;  2KIS A;  2PBI A;  4BJ6 C;  1VQ5 I;  1IGN A;  1PYV A;  2CUF A;  2UWM A;  2Y69 H;  3G4S I;  4XLE A;  4BJT A;  3GZ6 A;  1WGX A;  2EFN A;  1QZY A;  1WH7 A;  4M9Z A;  1XDS A;  1OKR A;  1YX3 A;  1OYY A;  4P9F A;  2PI0 A;  1Z6T A;  1FY7 A;  3V8K A;  3N97 A;  1D0Z A;  1MMG A;  4ABZ A;  3CC7 I;  3V7C A;  3CCV I;  2O5R A;  3HHH A;  2JMW A;  3QU6 A;  5H2F C;  2NXN B;  1UCR A;  2ZME C;  3JRD A;  2ZFW A;  4JQF A;  3I55 I;  5D6E A;  2R7V A;  4P5O A;  3VDX A;  2PMZ N;  4ZTJ A;  3CP2 A;  2FRH A;  1MGT A;  2RKH A;  4E6K G;  3NWS A;  1H9G A;  2AXL A;  2VIX A;  3KP5 A;  1W4M A;  3RQI A;  1QBJ A;  1ZQ3 P;  5FRO A;  2HYJ A;  3IHU A;  3DU6 A;  3GWZ A;  2EFP A;  1ZHF A;  1BC7 C;  2QBY B;  3NAU A;  1KZH A;  3F21 A;  2ZJP F;  1YX5 A;  4DZJ A;  1VQM I;  2A5W A;  1B1B A;  5K5O A;  5KVR A;  3JRG A;  4L0Z B;  5EDN A;  1RET A;  2HU9 A;  2HXO A;  2XGC A;  3MKW B;  4BY7 J;  3KE2 A;  1B8I B;  2BZT A;  3WTZ A;  1WJC A;  4LLN A;  2KKO A;  2QYO A;  2VLA A;  2HZT A;  2HZD A;  3DWL E;  1IXC A;  3HB9 A;  4G6T B;  4CCJ A;  2AQF A;  1RI7 A;  5DUI A;  3FMR A;  3OYL A;  2JZY A;  5DM7 F;  2F5C A;  3OYM A;  4ZDO A;  3V7R A;  2BY2 A;  1ZN2 A;  4XLC A;  2M8G X;  3MD2 A;  1YW9 A;  3TGN A;  4KNY A;  4OIP F;  2DTZ A;  2IXS A;  1ZAR A;  1FT9 A;  2BVM A;  3ISP A;  1DUX C;  2VQL A;  4KA4 A;  2LK2 A;  5DUK A;  1WJ5 A;  4PGG A;  2DK5 A;  3Q3S A;  2XRN A;  3AG2 H;  4D9J A;  3S2D J;  3LSH A;  3QP5 A;  4JP0 A;  1MH3 A;  4ON0 A;  3WHB A;  3H3U A;  3LWF A;  1QU3 A;  1PP8 F;  1CF7 A;  4XLA A;  2BXY A;  1SEU A;  4MEY F;  3L2C A;  4H4K C;  5FFZ A;  3CC4 I;  3ONQ A;  1U9O A;  4PJM A;  3OS1 A;  1NK2 P;  1MH4 A;  2DA3 A;  5ICF A;  3L7W A;  2JN6 A;  4NHJ A;  2HKX A;  1SD5 A;  2GQQ A;  2ELJ A;  2P81 A;  4WXD A;  1I3Q J;  4RDU A;  3HDD A;  2WAQ N;  1Y6I A;  2E2I J;  2BY3 A;  1Z3Y A;  4AVP A;  2IS4 A;  2XB0 X;  2QGU A;  4RB3 C;  1YLF A;  1IF1 A;  2E5Z A;  2DOE A;  3BWG A;  2Z33 A;  2K3F A;  1K7A A;  4WK8 F;  1DPU A;  3N4M A;  2G0E A;  5HLG A;  1SMY F;  4A3G J;  1FP1 D;  1OLT A;  1FC3 A;  1IV6 A;  1VI0 A;  1X4O A;  2JT1 A;  2GLO A;  3M9A A;  3OYI A;  4Y17 A;  4M3B A;  2L0K A;  2V9V A;  2V79 A;  1KU2 A;  2X6X A;  1SC7 A;  3VOD A;  1MNE A;  2RRE A;  4ZDL A;  1YOV B;  4DOZ A;  3JTG A;  5C3E J;  1MNM C;  3NQO A;  1WRJ A;  1Z3X A;  1CGP A;  4OAZ A;  4HOB A;  4S04 A;  1D8J A;  4F7Z A;  3BR1 A;  2KIQ A;  3GX4 X;  1FSE A;  1FZP B;  1E3H A;  3S1M J;  4C3I J;  3IAS 2;  4BKX A;  1MDM B;  3HUG A;  4RM3 A;  2Y30 A;  4YG2 F;  2QKM B;  5D4R A;  4R79 A;  4HW0 A;  4DW6 A;  4JBA A;  2H09 A;  3S1Q J;  2M34 A;  2XHK A;  1D3Y A;  2EIM H;  5FO5 A;  4HDV A;  4A3M J;  5EG0 A;  3K7A J;  4XBF A;  3RKX A;  2R4G A;  4BEH B;  1I5Z A;  2MD5 A;  4UV8 A;  3OSG A;  4RM2 A;  3R4K A;  1XD7 A;  1RR8 C;  5ILV A;  4YEJ A;  1SAN A;  1UFM A;  4NQW A;  1IUF A;  3CCY A;  3ERM A;  4FT8 A;  4L5J A;  4XKV A;  3S3N A;  3HYI A;  4M74 A;  5IY5 H;  3CO7 C;  4Z6Y A;  3CJR B;  1DP7 P;  3PO3 J;  5FD6 A;  2XVC A;  1MJA A;  1WI9 A;  3RPQ A;  4ZH4 F;  4BQA A;  4CCM A;  2DQR A;  5TRD A;  2HQR A;  4KIB A;  3TW6 A;  5FLV A;  2MFZ A;  1WH5 A;  3QOE A;  4RGX A;  2M9H A;  5LD2 C;  2GXB A;  4M72 A;  4DZP A;  1DPR A;  2KRH A;  1UZC A;  5EEH A;  2JPC A;  2JWT A;  3W6J B;  1VQN I;  2DA7 A;  4BS9 A;  3FXK A;  2KJC A;  4S0H B;  3KYL A;  1YIT I;  3WOD F;  5IT3 A;  2M45 A;  3V7S A;  3OOP A;  3E7L A;  4LIV A;  2V9K A;  2UZK A;  3QAH A;  3MEX A;  2YR2 A;  1EH7 A;  1X2M A;  2HYG D;  2VJI A;  3CUO A;  4L9N A;  5E3M A;  1H8A C;  1VQ8 I;  3SQN A;  5FLX K;  3RCO A;  4N9I A;  2OCE A;  3LAP A;  4BDY A;  1IC8 A;  1JGS A;  3WU0 A;  1NG7 A;  5EEA A;  4U0Y A;  3CLQ A;  4R8H A;  1IRF A;  2YS9 A;  2LSO A;  2OBP A;  2F5D A;  2PMH A;  1Y1V J;  2LRE A;  1B9N A;  2I5U A;  1BJA A;  2R7O A;  4JOM A;  3S8P A;  1R5I D;  4M3F A;  4WF2 A;  4HNT A;  1FIP A;  2CO5 A;  1FOK A;  2V4J C;  4I98 B;  3BG3 A;  1RUN A;  1X3U A;  5ERI A;  1BI2 A;  2H8W A;  1Q1H A;  2DXI A;  2BY1 A;  2VOD A;  2Z2S B;  3ZQ7 A;  2LC2 A;  4HNV A;  3H1C A;  2DBB A;  2WB1 N;  1ZTR A;  1BL0 A;  5E3N A;  4QWQ A;  1OR7 A;  2IJL A;  2L54 A;  3PNT A;  2OQG A;  1KGS A;  2EA4 A;  4KUM A;  2YSR A;  2MH2 A;  2HYF A;  2WBM A;  2JTV A;  3IV5 A;  2IBD A;  4MNU A;  1W36 D;  1Y56 A;  5E18 F;  5B66 C;  3KEO A;  5HDN A;  1R7J A;  5IYD J;  4A3B J;  1YE9 A;  3JRF A;  2EZH A;  3C3W A;  3ROU A;  2FBH A;  3D5S C;  3SJM A;  3EQL F;  2IP2 A;  4PJN A;  4EEF G;  2V9P A;  5K7Z A;  3VPR A;  2FML A;  1BOA A;  4MQ9 F;  1FTT A;  3IWF A;  4NBQ A;  1FJL A;  3V4G A;  3E0J B;  2L9R A;  1LQ1 A;  5E1X A;  2ZXI A;  2E2H J;  2EQR A;  4MFE A;  5CQE A;  2STW A;  3OMY A;  2QBY A;  4PFO A;  2CJJ A;  5F08 A;  2I8D A;  1T0F A;  1R1V A;  2KPM A;  5TJJ A;  2FEZ A;  2X48 A;  5ILU A;  3F23 A;  3M1C A;  2FQ4 A;  1T08 B;  2Z16 A;  2IGK A;  2ECC A;  5DDG A;  3KCC A;  2DTR A;  1B8I A;  4RGR A;  1EJ9 A;  4LG0 B;  4CCO A;  2CS3 A;  3V42 A;  1FMW A;  2DCE A;  4KT6 A;  3GXO A;  3TO9 A;  3WTS C;  1VND A;  4G7H F;  1EH8 A;  2NOJ B;  3GFM A;  2VQG A;  4A3C J;  1JKP C;  1ON2 A;  2DFH A;  2OD5 A;  2OA4 A;  4F92 B;  1IUY A;  4X0G A;  1EKE A;  4OOI A;  1UHW A;  1JUP A;  4NC8 A;  1HC8 A;  2E1O A;  1Y1W J;  4LK1 F;  3K2Z A;  4A3L J;  5M5W J;  3KLN A;  1LE8 B;  3B73 A;  4ENM A;  1LUJ B;  2L2O A;  2NAZ A;  4QIW N;  3VEP A;  3K4J A;  1O3T A;  1D5V A;  3V8J A;  2L4M A;  2Z1D A;  4HLY A;  4BH9 A;  2M5W A;  3A4C A;  3I3L A;  4Y7N J;  2LH9 A;  3BTI A;  1KON A;  4B48 A;  2L7M P;  3JR9 A;  5HLI A;  1IXS B;  4XLH A;  3WTT C;  4C3J J;  1M1E B;  3JCU C;  5LRS A;  3D5L A;  1POG A;  3F6V A;  1IN7 A;  1OIS A;  4P96 A;  1TP4 A;  1UMQ A;  2PMZ A;  2XAJ A;  2R7W A;  1AU7 A;  5CQG A;  2J5O A;  2VN2 A;  4DYQ A;  1KU7 A;  5AIQ A;  1NK3 P;  4AID A;  1RC9 A;  2DLL A;  3WG7 H;  3ZMS A;  4XLF A;  3H9J A;  5K5R A;  3KFW X;  2IS1 A;  1SFE A;  2DMT A;  3M1E A;  3KYD B;  3H0D A;  1ZKG A;  3KYC B;  1TWF J;  4YFN F;  3BJO A;  4Y52 J;  4A3D J;  2K9S A;  3K4K A;  4XID A;  3DQV C;  2FOK A;  2WC2 A;  5M3F J;  2NVX J;  1T6S A;  4UXN A;  4B4C A;  5FRM A;  1IRZ A;  1G59 A;  5EZG A;  1IV8 A;  1BC8 C;  1W1W E;  1ODD A;  1Z9C A;  4DQ2 A;  3KEQ A;  4KMF A;  4B3X A;  1WPK A;  4RBO A;  4KIC A;  1Z7L A;  2VJJ A;  2WAD A;  3ZRG A;  3IKT A;  3ZPL A;  2XAQ A;  2UV1 A;  3WE2 A;  5ICE A;  1J2X A;  1S7A A;  4I76 A;  3BQZ A;  5IT9 Z;  3MKL A;  4AM3 A;  1F36 A;  2ISY A;  2K86 A;  2R7F A;  2P7C B;  1R5H A;  2QA4 I;  4HV6 A;  2HTS A;  1X1B A;  3L2W A;  3AL0 B;  5IPA A;  3FM3 A;  2OTJ I;  1TWG J;  5BOX A;  3HZJ A;  4XR6 A;  3CZ6 A;  3A0B C;  4A93 J;  4DGW B;  4UHT A;  3LL7 A;  1R5G A;  3DTK A;  3FX3 A;  1XMX A;  1V5E A;  4PFP A;  4FQG A;  2EFQ A;  1MDM A;  1QGP A;  2ESH A;  4DIQ A;  1DGW Y;  2XAU A;  2O8K A;  2VL8 A;  1A6Q A;  3CJN A;  4TV7 A;  1I1G A;  2Z5U A;  4A3J J;  4LG3 A;  4I6Z A;  2NNY A;  1R4N B;  4M9X A;  3L1P A;  3GTG J;  3HJE A;  2HQN A;  1U0J A;  4BEH A;  2OZU A;  3KP3 A;  3A01 B;  4X6A J;  3H5R A;  2DU9 A;  3ZQQ A;  2WTE A;  1J9I A;  3I54 A;  2EJR A;  2H6C A;  4PUS A;  1GUU A;  2DPU A;  4XON A;  1MBK A;  3Q9S A;  1DGR M;  2Q2E B;  3CF2 A;  3K1N A;  1R1T A;  3E3V A;  5E20 A;  2ZFU A;  2KIM A;  3SZT A;  4IOC F;  4XOP A;  2N8G A;  3DPT A;  3OS2 A;  2XRL A;  2WAQ A;  3RI4 A;  2MG4 A;  4FTH A;  2LD5 A;  1V55 H;  3CUQ B;  4U87 A;  5B1A H;  1P4W A;  5E79 C;  1OCT C;  3CC2 I;  1JJ6 C;  3JAM Z;  2Y48 A;  3HIF A;  3UKG A;  2Y2Z A;  1UHM A;  4W1U A;  2W84 A;  5JLW A;  1HDP A;  2IA1 A;  3PJR A;  4HRI A;  2D1H A;  5BNG A;  5KHD A;  2VE9 A;  3WGI A;  1MBG A;  2LBF B;  2CQX A;  3O3K A;  2EZL A;  4A0Z A;  4OMY A;  2EV0 A;  2DA6 A;  4KJZ A;  1UG0 A;  2L9V A;  5KCM A;  4ENK A;  1HOM A;  2QLZ A;  4NC7 A;  3HRU A;  3GTK J;  4PSX A;  4E7I A;  2VKD A;  4A3I J;  3BP8 A;  4M71 A;  5L3C A;  1J59 A;  1FYK A;  4FX0 A;  3K4C A;  2QSF X;  3A03 A;  4D0P A;  3FM5 A;  2DQL A;  2HR3 A;  5B3S H;  3ABU A;  4QPO A;  4QTR A;  4A3K J;  4NB5 A;  5IP9 J;  1Z1D A;  3M7G A;  3FDY A;  4F3Q A;  3RIR A;  3D1N I;  4WX9 A;  5IOY A;  1YTY A;  5CYV A;  4UUV A;  1MJB A;  4IRG A;  3SFI A;  3MCZ A;  2CRG A;  1RNL A;  3DEE A;  1ZGA A;  2HDC A;  4FE7 A;  4HQM A;  4KIF A;  4LOC A;  1KA8 A;  1GHC A;  1GVJ A;  3SZG A;  2HDD A;  2GZW A;  1D1A A;  2ZJ2 A;  2JK3 A;  2X1E A;  1O7L A;  1OCP A;  3W6K B;  2AQE A;  1ZLJ A;  2M2E A;  4K2E A;  2A3S A;  1WCM J;  2WA0 A;  4BBS J;  2DJN A;  1VQK I;  2XF5 A;  2ISZ A;  1JXS A;  4L9J A;  1ENH A;  1LB2 A;  3BG6 A;  2HVS A;  1UST A;  4Y15 A;  5E3O A;  1G4D A;  3AG4 H;  1X4P A;  1OR7 C;  5FFX A;  2Y0S A;  2K3P A;  1TT0 A;  5DCM B;  2L4A A;  3TOB A;  2E1N A;  1YFH A;  5E8I A;  1Q1V A;  4XQF A;  2FUG 2;  1X2N A;  3DU5 A;  4HZF A;  3OYH A;  5J1Y A;  3VOE A;  3VYT B;  1TC3 C;  1OCC H;  1WQ2 A;  3I58 A;  2Y31 A;  4MTE A;  4LG0 A;  4BL0 B;  1ZRD A;  3BJA A;  1MZB A;  4U88 A;  3OYJ A;  2XPU A;  4U7D A;  4D7M A;  3E6B A;  2OTL I;  3PO2 J;  4OIQ F;  2ADU A;  3JRE A;  9ANT A;  3ASO H;  4EJU A;  3LA7 A;  4DYC A;  3TO7 A;  2QCO A;  3C1D A;  2HNH A;  4YRV A;  5LHH A;  2VUM J;  2CUE A;  2VT3 A;  4IF4 A;  5JVT A;  2KMU A;  3JSO A;  1LE8 A;  3P5J A;  2VC1 A;  3U1D A;  4HNU A;  3WTW C;  1T0F C;  1JUS A;  3I9V 2;  2QSG X;  3DTI A;  4LIU A;  4I99 C;  5HS9 A;  5F64 A;  2ZXH A;  1MJ9 A;  3FKJ A;  3MFK A;  1R00 A;  1ZAO A;  1AOY A;  5LHG A;  3AG3 H;  1GXQ A;  2FBK A;  5JR3 A;  2YPR A;  4AC0 A;  3FXL A;  3HOT A;  2W85 A;  3RYP A;  3CTA A;  3B6A A;  2L7Z A;  2VQC A;  2M3A A;  1BIB A;  2LR8 A;  3SHF A;  3TDZ C;  4XOT A;  5DS9 A;  4V2F A;  2E34 A;  1P2F A;  1Y0N A;  2Y75 A;  3HRM A;  4BAY A;  1ETW A;  1LEA A;  3HOY J;  5BMZ A;  4UUS B;  3REO A;  2K40 A;  4UUT A;  1WWX A;  1L3L A;  3QU3 A;  1H88 C;  1JKQ C;  2PN6 A;  4Y33 A;  3BZC A;  3L9F A;  3U21 A;  3AAF A;  1R9T J;  2R5Y B;  4MIM A;  3ABL H;  3FKI J;  4NUB A;  4LJZ F;  3T1B A;  2OPT A;  2XIG A;  2XUB A;  3EET A;  2R7T A;  2YU9 J;  4DYR A;  4EQQ A;  4B3A A;  3S32 A;  1AKH B;  2CSO A;  3KZY A;  3HKZ A;  1A31 A;  4E4H A;  4PGH A;  1RKW A;  1T39 A;  2IGO A;  4FX4 A;  2GA1 A;  3OIO A;  5H20 A;  4A69 C;  2LMD A;  1XPX A;  2LOO A;  4XOR A;  3CCU I;  3FHZ A;  2A05 A;  1OCZ H;  2LY1 A;  2J5P A;  5DYM A;  1KQ0 A;  4XK4 A;  3HOX J;  2VKH A;  1ETQ A;  5GTH C;  3LSJ A;  2X6Y A;  1DU6 A;  3HGG A;  4LK0 F;  3CCL I;  3RJP A;  2KJB A;  5JVG F;  4NNJ A;  2VXD A;  3CLO A;  1BW6 A;  2HQA A;  2ZKZ A;  3EYI A;  2DOF A;  3GFJ A;  3ZMT A;  1VQP I;  1N25 A;  3MZH A;  1X3Z B;  2JRT A;  3BZK A;  4ZYE A;  2DFI A;  2R7X A;  2FX0 A;  3BDD A;  2BV6 A;  1IN4 A;  1LDJ A;  2HTJ A;  2PMU A;  3R0J A;  4HDU A;  1U5T B;  3GTJ J;  3FXU A;  4WXH A;  2F2E A;  1WJE A;  3A01 A;  1K83 J;  2K9L A;  3DXJ F;  2HXI A;  2O03 A;  3QP6 A;  1HKT A;  3K69 A;  2D45 A;  3S2W A;  1D1B A;  2ZJR F;  4QPQ A;  4GXO A;  4IZZ A;  5L3D A;  4WWC A;  3I59 A;  1JUM A;  2PX9 A;  1ZYR F;  3BR0 A;  1OYI A;  2Q2E A;  2ZME B;  4OWR B;  1SAX A;  2KIF A;  3E6D A;  5BPI A;  2M7A A;  3RPU D;  2CMP A;  5EF6 A;  1K4T A;  5F0C A;  1MD0 A;  3CDL A;  2OU2 A;  4EJO A;  2DOD A;  5JHF A;  1OJL A;  2MLK A;  3SEQ A;  3CUQ A;  1TLH B;  3QYE A;  3J81 Z;  4ZZL A;  1IJW C;  1LPQ A;  2DFF A;  2A5Y B;  2DMQ A;  2IRF G;  2M1B A;  3LSK A;  1MMD A;  2QQA A;  2HEO A;  1B6A A;  1W5S A;  1PVE A;  2KP6 A;  1TT5 B;  3QPL A;  1ZGJ A;  1FIA A;  3LQR A;  2M4K A;  2P0W A;  5LEK A;  5ICG A;  3ESW B;  3QPT A;  3K70 D;  1TNS A;  2KL4 A;  3FXO A;  3JRI A;  2IPQ X;  4L9T A;  5F04 A;  3S3O A;  2HOE A;  2DOA A;  3O8G A;  2FOW A;  1F5T A;  3KLO A;  3OV8 A;  5GAD J;  1N77 A;  4KMU X;  2G7U A;  3IWZ A;  4IHY A;  6PAX A;  1TZL A;  2ZNY A;  2V1X A;  3S16 J;  4AD9 A;  4A0Y A;  3HTU A;  2LBF A;  3F8N A;  3Q5F A;  2RV8 A;  3OYB A;  2NVT J;  2GOM A;  3J80 K;  1G6N A;  5JI6 A;  3F3X A;  2MLG A;  2AS5 F;  1SD4 A;  4V2G A;  3SDG A;  3BG7 A;  3JRH A;  2IA2 A;  2GOX B;  4IOA F;  3ASN H;  4G6Q A;  1GVD A;  3WGH A;  5FJ8 J;  2KRC A;  2QZ8 A;  4C2U A;  4G7O F;  5CVI A;  3RKY A;  5HS8 A;  2LKS A;  4ZYA A;  4GYG A;  2HVQ A;  3RZO J;  4CCK A;  2I10 A;  3HSE A;  1FYL A;  2DA2 A;  3HL2 A;  3LST A;  2ME6 A;  3M07 A;  3I53 A;  3FXQ A;  1P7J A;  5FB2 A;  4BDZ A;  3OYD A;  3S3M A;  3N05 A;  2P8T A;  3TOA A;  3HG9 A;  3F22 A;  5CVV A;  4BQN A;  2RQP A;  2Z3Y A;  1XSV A;  1IN8 A;  3I71 A;  3MN2 A;  4GCV A;  4EJT A;  3GLL A;  1MMA A;  3CD6 I;  5FKK A;  1QNT A;  1USS A;  4HF2 A;  3GFI A;  1JE8 A;  1GXP A;  3QOP A;  2DT7 B;  3U9G A;  2V6C A;  2F5V A;  2OCC H;  2W1O A;  2CUZ A;  4DJA A;  4FCY A;  1MKM A;  4CGZ A;  1YW8 A;  3BY6 A;  2R3S A;  4IO9 F;  3PSF A;  5CVU A;  4QLC U;  3KZZ A;  1SFO J;  3AKZ A;  5A2Q K;  3K2A A;  5LLQ A;  1HKQ A;  2D2W A;  4IKF A;  2ETH A;  4E7J A;  2BXZ A;  2FBI A;  4PSW A;  3BR6 A;  3G2B A;  3VYR B;  3C2B A;  1BI3 A;  3AG1 H;  5DCM A;  3LNQ A;  3K1P A;  2B9S A;  2E19 A;  2BVL A;  4RA2 A;  4ETS A;  3DBL B;  1Z7U A;  1TWC J;  4HQE A;  2V1N A;  3EUH A;  5J4V A;  4CYD A;  1Z67 A;  3HC7 A;  5J8C A;  3GVA A;  1BR2 A;  4RLF A;  2Z9O A;  3K1M A;  5L3F A;  2GM4 A;  2RNG A;  3MZ8 A;  3V8L A;  5LBQ A;  1W36 C;  1VQ7 I;  2R93 J;  2R7U A;  1S3J A;  1KQ8 A;  4B8X A;  3JRA A;  1K78 B;  4P55 A;  2CW7 A;  2MSY A;  5FKM A;  2DMN A;  4Y4R A;  3ZMD A;  5E8G A;  2FQ3 A;  3Q0U A;  1HCR A;  2WAE A;  2K02 A;  2CQK A;  3LQQ A;  3MMY B;  1E17 A;  3ZGK A;  3L2V A;  3LSP A;  1SD6 A;  5HLH A;  1RR7 A;  1RES A;  1VQL I;  5LEJ A;  4HPQ A;  1QHG A;  2FMY A;  4CCL A;  3WU1 B;  1P9Q C;  2FXA A;  4AWX B;  1D0Y A;  2O3F A;  5LHI A;  2CYY A;  2HWV A;  3CES A;  1NTC A;  2Y0M A;  3BC8 A;  4PJ0 C;  4W97 A;  1P4X A;  4XRF A;  1ZEL A;  2QM3 A;  4XLP F;  3DLL F;  4D1Q A;  3BRO A;  4FHT A;  1IO2 A;  2LLK A;  3CJT B;  1ETX A;  3GUD A;  4G12 A;  5GPA A;  4BE0 A;  2CW0 F;  4U0V A;  3PL8 A;  2K4B A;  4MLO A;  2R92 J;  5F6F A;  3LMM A;  2K27 A;  3ZQL A;  2VBX A;  1NG6 A;  3IKV A;  4D5C A;  5HNH A;  1S9H A;  3G3Z A;  2KQR A;  1V5F A;  1K6O A;  1I6H J;  1MBH A;  3U1K A;  1FLI A;  4UUS A;  2H94 A;  2GIV A;  2GWR A;  2KZV A;  1A5J A;  1QO0 D;  1R22 A;  1QHH D;  4BE2 A;  3R61 A;  1SAU A;  4U7B A;  1K4S A;  2CV0 A;  4O3M A;  2R5Y A;  4EGZ A;  1S5L C;  3ZQF A;  4LFU A;  4MTD A;  2JA5 J;  4BY1 J;  4IHW A;  3ZMV A;  1AHD P;  1KYZ A;  2Q8K A;  3OS0 A;  5GP9 A;  3KIO A;  3P9K A;  1HLV A;  4B1R A;  3MZY A;  1BI1 A;  4XN3 A;  4DBR A;  5LGU A;  2RN7 A;  5KAI C;  4HSR A;  3GBG A;  1VF9 A;  1AKH A;  4IHT A;  4HBL A;  5GPC A;  3S93 A;  1JGG A;  1B4A A;  3IL2 A;  4CIC A;  3CCS I;  1LJ9 A;  3ECO A;  1YS7 A;  4I0B A;  3BTL A;  4Q5S F;  1YJ9 I;  5CJ9 A;  1I1S A;  3KP6 A;  4RAF A;  4F55 A;  4XSZ F;  1SFU A;  2CFX A;  1FTZ A;  2IGN A;  4XL9 A;  2TCT A;  2CU7 A;  2HI3 A;  1R23 A;  4RAG A;  1LFU P;  4RB2 C;  2V26 A;  4XN0 A;  2JUC A;  2DA4 A;  1SFK A;  3JSP A;  1TL8 A;  2CQQ A;  5D6F A;  4JK1 X;  3MKY B;  2K85 A;  2X1C A;  5TIS C;  1JKR C;  4FIS A;  5EZH A;  3SZP A;  4KYW A;  3J7A O;  5CLS A;  5C44 J;  1XTA A;  5EEG A;  4UY8 I;  3JTH A;  2RQQ A;  2F6C A;  1G3Y A;  2VPR A;  2PLY A;  4F93 B;  3A02 A;  1PDN C;  2VQH A;  3VFZ A;  1U5T A;  2DT6 A;  4L0Y B;  2A07 F;  3VSK A;  3TED A;  2VBZ A;  1GV2 A;  3LFK A;  2DPD A;  3O6B B;  1O4X A;  2WAF A;  2W00 A;  5HOD A;  1K61 A;  5D4S A;  4KN4 X;  5J47 A;  2ZME A;  1RPW A;  3CP8 A;  1O3Q A;  1YI2 I;  4L18 B;  3AL0 C;  1FP2 A;  1BN5 A;  1S29 A;  5DTD A;  2DO7 A;  5L3E A;  2L01 A;  3VSL A;  3D0S A;  2E60 A;  3PFI A;  1O3S A;  3GLX A;  1RZ4 A;  2F48 A;  4FE4 A;  3RPU A;  3WG9 A;  3E5Q A;  2DMP A;  1T98 A;  2A6H F;  4M6V A;  3WTY C;  4EM1 A;  3FMQ A;  3OYE A;  4EJW A;  1EA3 A;  1OPC A;  2YX7 A;  5HDK A;  4BNC A;  1R6R A;  1Z05 A;  3LSR A;  1A6I A;  4IPA A;  5JLX A;  4Q48 A;  3FIS A;  4EVI A;  4R1H A;  3BR3 A;  3DF8 A;  3F72 A;  1J75 A;  4AU7 A;  4PK4 A;  3DEU A;  2ZJQ F;  2AO9 A;  2R7Q A;  2XAS A;  4KT5 C;  4ITV A;  1WJA A;  1HDD C;  2HOS A;  1IDY A;  2M7B A;  3F6O A;  1XCV A;  2G9W A;  3FK6 A;  4N4N B;  3VYU B;  5E17 F;  2LKX A;  3GTL J;  2K4J A;  3NWT A;  4HX8 A;  3WE3 A;  5GAH J;  2PJR A;  4I01 A;  2ECB A;  2NVY J;  1HW1 A;  2IAI A;  1YJN I;  2NOG A;  4N4O B;  4LIT A;  1XC5 A;  5K5Q A;  3KP2 A;  3CUQ C;  4BQQ A;  3I5U A;  3KX2 A;  2XF6 A;  1XMA A;  3ZQI A;  1KU3 A;  1ZK8 A;  1ITY A;  1SVO A;  2CH0 A;  5FLX Z;  2HQ5 A;  2VON A;  4XKB A;  5EYR A;  4Y3O A;  5KNL A;  4OIR F;  3IRR A;  4OU0 A;  3IH2 A;  1BBY A;  1QVT A;  2RAE A;  1BR4 A;  3LFU A;  3FF5 A;  1U3E M;  4AIK A;  3CMA I;  3SEZ A;  1FOX A;  5H6R A;  1F43 A;  2CV2 A;  1YIJ I;  1YYV A;  4HG2 A;  4HF0 A;  1XG1 A;  2X51 A;  1PJR A;  5FD5 A;  3VYS B;  2ZCW A;  2B63 J;  2JA2 A;  4B47 A;  3CO6 C;  2DW4 A;  3QPS A;  1HBX G;  2BW3 B;  3I4M J;  4EM0 B;  2DDB A;  5D5W B;  4RGS A;  1PP7 U;  3I59 B;  1J5Y A;  2RNJ A;  1GDT A;  4BHB A;  1SFX A;  4A0X A;  1TBX A;  2RC4 A;  2QQB A;  4BGD A;  1LNW A;  2IA0 A;  2KLO A;  1J7K A;  4G94 A;  3W6V A;  4H0E A;  4F91 B;  2O8X A;  2IT0 A;  2OF7 A;  2HPI A;  2V1D A;  1P7I A;  2HS5 A;  3I56 I;  1REP C;  4JX5 A;  3FBI B;  2EIN H;  1X1D A;  2VE8 A;  3H35 A;  3T8T A;  2VKV A;  4BXF A;  2ACJ A;  5K1Y A;  4X1E A;  3IAM 2;  1UHS A;  4XRS A;  4OIN F;  3HM5 A;  3CDH A;  1JKO C;  2ZXW H;  3CCR I;  2P5V A;  3EYY A;  1Z91 A;  3KP7 A;  3ZMU A;  1K78 A;  2EZK A;  2ZO4 A;  2FA5 A;  5HVQ C;  4CHU A;  1FEX A;  2Q0O A;  1JHF A;  1PUF A;  3S14 J;  4S05 A;  2M0C A;  3OYN A;  4C30 A;  1P4A A;  4OIO F;  2OAZ A;  5L3B A;  3ABK H;  3S1R J;  1DDN A;  2L02 A;  2DJI A;  2E35 A;  1WJF A;  2DAO A;  1BJZ A;  5HLT A;  3SYT A;  3JRC A;  5J6X A;  2G7H A;  3S17 J;  4M6Y A;  2W7N A;  1XX5 A;  2GIZ A;  2WY8 Q;  3CQZ J;  4A3E J;  3EUH C;  5C4J J;  1TWH J;  4BHC A;  2XSD C;  4EGY A;  4Q4Z F;  4IL6 C;  1WJD A;  3TP0 A;  2X9D A;  3E1S A;  5J40 A;  2LF7 A;  3FMS A;  2W24 A;  3ZCO A;  3GZN B;  2UUZ A;  4E7S A;  3CMY A;  3OIP A;  4G8X A;  2ZSH B;  3CF5 F;  1WI3 A;  3B6C A;  1ZR2 A;  3CMM A;  3L2U A;  4CUG A;  1X1A A;  5F1R A;  2EPF A;  1P92 A;  1U6G A;  5LGN A;  4ESB A;  4IQ4 A;  5D5X B;  2H6B A;  2W4S A;  1TQP A;  3H3V K;  5F0F A;  3HEF A;  3BTJ A;  3GF2 A;  5J1R A;  4C2T A;  4NDL A;  1U9N A;  1O57 A;  4A5M A;  2MW8 A;  4E7L A;  1I50 J;  2JUG A;  4XKC A;  1X1C A;  2ELK A;  3HTS B;  1V5G A;  3PNV A;  4KIT B;  2QUF A;  2MA3 A;  1XCB A;  3GZ5 A;  2JSP A;  1T2K A;  4YFK F;  2CWE A;  1XSD A;  2HGC A;  1JT0 A;  3C2G A;  3L2R A;  2EA2 A;  1U8R A;  2DI3 A;  2MBF A;  4HLX A;  2M4G A;  3RKW A;  3TDU C;  2OJE D;  1KU9 A;  4XRM A;  5CVR A;  2MC3 A;  2YUS A;  2UXN A;  2VPL A;  1JJ8 C;  3I4P A;  4IXA A;  1O7F A;  3X2Q H;  4HYE A;  1ETO A;  3J7A Y;  3BPX A;  2K9N A;  2YU3 A;  3OR2 C;  3H92 A;  2X6W A;  2OV7 A;  1DP3 A;  3OYK A;  1WJB A;  4JX4 A;  1FNN A;  5TGT A;  3COA C;  3RQ4 A;  4XNF A;  4CYC A;  1YW7 A;  4MQV A;  2F4I A;  1V4R A;  2BY0 A;  3E5X A;  2V6E A;  3L00 A;  1QRY A;  2ESN A;  3FXM A;  5H6Q A;  3ULQ B;  2ELH A;  3LSG A;  1FOW A;  4L9V A;  4A5N A;  3BPV A;  2DK8 A;  4CXF A;  2WB1 A;  3DFG A;  3MQ0 A;  2VC0 A;  3GEZ A;  1H9T A;  5D8L B;  3BCA A;  1C0W A;  2LRD A;  2BHZ A;  3OSF A;  1SD7 A;  1FBS A;  2E1C A;  4B09 A;  4L5I A;  3GTM J;  1BM9 A;  2HOA A;  2Y9Z A;  4M73 A;  2A61 A;  3D5R C;  1L0O C;  1W7P B;  3TQN A;  2ZNZ A;  1JT6 A;  5F1J A;  1T33 A;  4XIC A;  2ZC2 A;  3M4O J;  2X1D A;  1FOY A;  1ETV A;  4LGW A;  2XPW A;  5DV5 A;  5IP7 J;  3KET A;  2W25 A;  1WFX A;  4J19 A;  3DKX A;  3SDB A;  1ZG1 A;  1B72 B;  1LVK A;  2E1M B;  2FSW A;  2ID6 A;  2KIU A;  2TDX A;  3HSR A;  2NS0 A;  1X3W B;  2WV1 A;  4AYB N;  2EIJ H;  1NHA A;  3WTU C;  3UNG C;  3QYF A;  3DBR B;  1U5T C;  2M0M A;  5FKN A;  1STZ A;  1B59 A;  3W3C A;  5DEQ A;  4ZC3 A;  3WU2 C;  3MVP A;  2CV1 A;  4IHX A;  3UR3 C;  1E3O C;  4UNO A;  2XAH A;  3Q9V A;  4YFX F;  2O9L A;  3F8F A;  4BAC A;  3R0A A;  1R4M B;  3DEW A;  2XGE A;  4GGG A;  2VXZ A;  5CPR B;  3J7Z I;  2DN0 A;  4KIS A;  3E6M A;  1OYW A;  1D8K A;  2LYC A;  1VTN C;  2RDP A;  3BCB A;  4QSH A;  1J09 A;  1FYM A;  3IP4 B;  1X19 A;  1Y39 A;  1TNT A;  2JA6 J;  4XM3 A;  1DQU A;  2VOP A;  1HA8 A;  2IW5 A;  2R7Z J;  1IZ1 A;  1XDU A;  2M30 A;  2NNN A;  3QYB A;  4HST A;  3SFZ A;  4A2U A;  4ZJZ A;  2JA8 J;  2PG4 A;  1T38 A;  2EB7 A;  1MSE C;  3RKQ A;  2GAU A;  1T95 A;  1ZG3 A;  1ZRF A;  2LY9 A;  1R49 A;  2P7V B;  4FAS D;  4CA0 A;  3DTE A;  3G1M A;  1UJ8 A;  2TRT A;  4V19 K;  3GFL A;  3RSN A;  3ABT A;  2K9M A;  5FLM J;  3K70 C;  1OFC X;  2VBY A;  4BBR J;  4EJV A;  1ZR4 A;  2OZ6 A;  4I09 A;  4IRH A;  4EAT A;  4ZTF A;  2MGQ A;  1X1P A;  3ZP5 A;  3RDI A;  3S2H J;  2EH3 A;  4GYI A;  2H1K A;  4JX6 A;  2BW3 A;  4MGR A;  5CVJ A;  1OCO H;  4N9H A;  2IEK A;  1R71 A;  4UVA A;  3TW7 A;  4G7Z F;  4II2 A;  4AUX A;  5LRR A;  1LFB A;  4E7K A;  2LP0 A;  3CCQ I;  2R7S A;  3SXY A;  3FBN B;  1G3T A;  2L5Q A;  2NYX A;  3J7Y J;  2NVU B;  1N75 A;  1FBQ A;  1XSX A;  1ZGW A;  1R36 A;  3K4N A;  3ABM H;  3E5U A;  2IGM A;  2PEX A;  1LDK B;  4KFC A;  3ZQC A;  2VB6 A;  3DPL C;  3IUO A;  1VQ6 I;  1AA7 A;  2L9S A;  3LA3 A;  5B5E C;  3CCM I;  3JW4 A;  4KN7 X;  3HOW J;  2KZG A;  5M5X J;  2BHY A;  2FD5 A;  2LDU A;  4ZYD A;  3H9Q A;  3EUA A;  1SMT A;  1TQI A;  5J1U A;  3ZXS A;  1G2H A;  3H0G J;  5CKT A;  2MAB A;  4BE1 A;  2XSJ C;  2V1U A;  3ZN1 A;  3PFY A;  4BYY A;  1TW2 A;  2DYS H;  1MMN A;  3HGY A;  1J0R A;  4BHP A;  1N78 A;  1W5C C;  2KDO A;  4ZZD A;  2Z99 A;  4XKW A;  2JSC A;  4OAY A;  3HOS A;  4FET A;  4I02 A;  4M6X A;  2PJR B;  3BTC A;  3NAR A;  3OY9 A;  3PIP F;  5ICC A;  1W5T A;  1MW7 A;  1CQT A;  4OMZ A;  3CJQ B;  4LD5 A;  2NS8 A;  2EFW A;  1WSU A;  1S7O A;  3K4M A;  5D5U B;  4IJA A;  1T8I A;  2OQR A;  1T56 A;  1ON1 A;  1HW2 A;  1XN7 A;  4RLQ A;  3ZR8 X;  5BPD A;  3K0L A;  1APL C;  1QPI A;  3KPH A;  5F27 A;  5EGO B;  1U8B A;  3T8R A;  2VBW A;  4Y13 A;  5HNF A;  3IC7 A;  1YRN B;  3C2H A;  3PQJ A;  4IVN A;  1YS6 A;  4BXX J;  4BQO A;  3P7N A;  5ILS A;  3NRV A;  1YQA A;  1HKS A;  1AWC A;  4N0B A;  4UB8 C;  2GBY A;  3HBL A;  1ZRC A;  4GFB A;  2RVC A;  1JHH A;  3DLA A;  1MND A;  3BQY A;  3GME A;  3K9T A;  2P5L C;  4ENN A;  2OC6 A;  1U2W A;  1YO5 C;  1R58 A;  4ZDP A;  4ANJ A;  3OR1 C;  2R5Z B;  5IP6 A;  3HOV J;  1LKX A;  3HRT A;  2FJ1 A;  5K7F A;  2P4W A;  4YII A;  2EFO A;  4E7Z A;  2CQN A;  3QQA A;  3M8J A;  5IYB J;  3OL3 A;  3EDP A;  1LDD A;  1I3A A;  2XPV A;  3ZQH A;  1UEL B;  2R7R A;  3I4N J;  2RGV A;  1WKM A;  3I64 A;  1TW3 A;  3OIQ A;  2XGX A;  2GXG A;  2EIL H;  1TTY A;  2GXA A;  1P6R A;  3DPU A;  5FKO A;  2CG4 A;  2QQ9 A;  4EV0 A;  2K7L A;  4BUP A;  2HDW A;  4A12 A;  2MD0 A;  4JYK A;  2JQ7 A;  2NS7 A;  1XGS A;  2ID3 A;  4F52 A;  3GTQ J;  1MIJ A;  3PIO F;  3B02 A;  1PUF B;  5ED4 A;  1HST A;  2E36 A;  2P6S A;  2VI6 A;  2H8R A;  3IRQ A;  2Y0S N;  2QSH X;  5IT9 K;  2HPM A;  1IAW A;  4HAM A;  2ZXJ A;  4HV5 A;  1ZH5 A;  1EH6 A;  3ECH A;  1FPQ A;  4Q47 A;  5IOZ A;  3HSF A;  1RRJ A;  2PFB A;  2EBI A;  4HX7 A;  2WWY A;  2FF4 A;  1VQ4 I;  3DKW A;  4I7H A;  4AVZ A;  2V7F A;  4AIH A;  3BLY A;  1ONV A;  1VFC A;  3FZV A;  5BS6 A;  1JTX A;  4ZYG A;  1W7P A;  2EK5 A;  1ZLK A;  2AHQ A;  1WHU A;  2CW8 A;  2EZI A;  2EWN A;  3WHC A;  4A3F J;  1XB4 A;  1E3P A;  3HPG A;  2F4M B;  4B44 A;  2JJ7 A;  2W48 A;  1MBE A;  2Q1Z B;  1UB9 A;  2HVR A;  3QWL A;  3QRF F;  1V54 H;  5LFA A;  2LNB A;  4UV9 A;  1WZ2 A;  1B72 A;  3FK7 A;  3F8B A;  1IDZ A;  3RTR A;  3K4L A;  1NH3 A;  3DBH B;  2STT A;  4J01 A;  1ZRE A;  2FNP A;  2L9N A;  4UB6 C;  3WTX C;  1V3F A;  4D7N A;  2JVH A;  3G1O A;  5EJC A;  1O3R A;  1ETK A;  5HS7 A;  3PM1 A;  2H1L A;  3LSM A;  2L7K A;  5JFR A;  2X85 A;  2UXX A;  3W2A A;  1ERD A;  1XS9 A;  1Z0X A;  3BZ6 A;  3HOZ J;  3RZD J;  1I27 A;  4Z2Y A;  3LA2 A;  3CDI A;  2QQ8 A;  4L5E A;  1BI0 A;  3CCJ I;  1B9M A;  3HHG A;  2W82 A;  4ENJ A;  4HX4 A;  3JAM K;  3H9G A;  1U78 A;  5AON A;  1A36 A;  5D8K B;  4LLL A;  3OOU A;  3P9C A;  3T0Y A;  1X58 A;  2L7F P;  3ML6 A;  4EMS A;  2E7X A;  5M5Y J;  1HSJ A;  1QVU A;  2BOL A;  1HXD A;  1QQI A;  2O0Y A;  2DDA A;  4XRS G;  2EV5 A;  1IXR C;  2MH9 A;  1HQC A;  1MSF C;  4CYC B;  5E1Z B;  4PDK A;  1D5Y A;  3ZQG A;  3WTV C;  1BIA A;  2XKO A;  4ESJ A;  1RKT A;  5JHU A;  5DD4 A;  1K79 A;  2IS2 A;  3TO6 A;  2L3D A;  4D5F A;  3J80 Z;  2DA5 A;  5J8F A;  3G1L A;  2KHM A;  3S15 J;  1BOB A;  3DP7 A;  3HKZ N;  3H3Z A;  1MBF A;  3K6G A;  2YX4 A;  4RMN A;  2QEN A;  3BR2 A;  2QKL B;  5FRN A;  3DCF A;  1OMI A;  4HA8 A;  2KDZ A;  3MAJ A;  4WXC A;  3ZMZ A;  3FXJ A;  4YEL A;  3R60 A;  3WGG A;  5LGT A;  4XMY A;  5K7H A;  4P9U A;  3G6E I;  2JVG A;  2ICW G;  4NC6 A;  1TWA J;  1XGO A;  4B43 A;  1Z77 A;  2EV6 A;  1ACI A;  3PUB A;  3FHN A;  3PQK A;  1DU0 A;  2FU4 A;  3BG9 A;  3W2V A;  2JRM A;  4AYB A;  4G9Y A;  3ELK A;  1A04 A;  2ME0 A;  2OUM A;  2M87 A;  3BOQ A;  5FGM A;  1XGM A;  1E0E A;  2ZB9 A;  4RAZ A;  3IH3 A;  4M3D A;  3W2W A;  4C2M J;  2XF7 A;  1S6L A;  3HRS A;  1GLN A;  2E71 A;  4ESF A;  2A6E F;  1ETY A;  2P6T A;  5A2Q Z;  3OYC A;  2COB A;  4II3 A;  2JPB A;  2W57 A;  2F4O B;  3TP3 A;  1IRX A;  3O2P E;  2K9Q A;  4RB0 A;  4RGU A;  3MKZ A;  2X0L A;  2O61 A;  4CSW A;  1LVA A;  1K6Y A;  2IVM A;  4CO8 A;  2XC7 A;  1ORK A;  3F8C A;  1EV7 A;  1Y8R B;  1IG7 A;  4IHS A;  2D1V A;  1VQ9 I;  4J00 A;  1BR1 A;  2KFD A;  2LFB A;  4IHV A;  2GA2 A;  4PZJ A;  2DFE A;  3BG5 A;  1RIO H;  1IRG A;  5AIP A;  3ERE D;  3HPH A;  1I39 A;  3I0T A;  5DM6 F;  4GDF A;  4HEA 2;  1YIO A;  4O6J A;  3M8F A;  2XAF A;  3F8M A;  4IQJ A;  5KAF C;  1OQY A;  2LY2 A;  5DCF A;  3M8E A;  2MC4 A;  1E2X A;  2BE5 F;  3BJ6 A;  3MWM A;  4G6D A;  4A6E A;  3A1Y A;  2Y9Y A;  1LFP A;  1HW5 A;  5EGO A;  5M3M J;  3PNY A;  2A6T A;  4PCQ A;  1KQ9 A;  2E2J J;  2FE3 A;  4M9S A;  2DMU A;  3TBI A;  1XGN A;  4A6D A;  1YRN A;  3TL4 X;  2IS6 A;  2LG4 A;  1RUO A;  1A35 A;  3H5N A;  4AIJ A;  1TQM A;  2QVO A;  3CCE I;  2BEO A;  1F9N A;  3Q0W A;  4E70 A;  1YJW I;  2NRA C;  3AFH A;  4P1W A;  4M3E A;  3FIW A;  2R5Z A;  2PQ8 A;  1D1C A;  3U2R A;  2R0Q C;  2HKO A;  4RS8 A;  2WV0 A;  3EPZ A;  2K5C A;  4BXU A;  3GTO J;  1ZG5 A;  3BR5 A;  4RB1 A;  3VB2 A;  2HOT A;  1EF4 A;  2LTP A;  5E3L A;  2O6G E;  3L09 A;  2BYV E;  1FBU A;  1S7E A;  1ULY A;  3F9K A;  1FMV A;  3G71 I;  3HXL A;  4BJ5 C;  3LOC A;  3A2K A;  3KZI C;  3GW2 A;  1G8X A;  3H36 A;  3K10 A;  2XRO A;  1Z21 A;  2MYS A;  4EM2 A;  1CF7 B;  2D5V A;  3K4B A;  1VZ0 A;  4RAY A;  3L2Q A;  1UAA A;  2H27 A;  3ZN0 A;  2XAG A;  2FNA A;  2QF7 A;  2O7O A;  1QZE A;  4UVB A;  3G73 A;  3OYA A;  1F4K A;  2A68 F;  3HOU J;  2F5E A;  4I2O A;  1BA5 A;  3OYF A;  5E1W A;  3Q0V A;  5HOO A;  1D0X A;  3H5A A;  4MEX F;  1XMK A;  2DT5 A;  5GAG J;  2ZSI B;  1UG2 A;  2B0L A;  4U0W A;  3FWE A;  2LF8 A;  2QWW A;  4E7H A;  2LVS A;  3FXR A;  1PUE E;  1LEB A;  4KDP A;  1GT0 C;  2LKP A;  1SVM A;  4BU2 A;  4LMY A;  4DNC A;  1W0U A;  3VWB A;  2VOO A;  3EUK L;  4LLG F;  3GTP J;  4CH7 A;  1MBJ A;  2M8E A;  4MO7 A;  2XB5 A;  5KK1 A;  3PUF A;  3QOD A;  5DD8 A;  5F0H A;  2COM A;  2DA1 A;  1S72 I;  1S8N A;  3ZOB A;  1FWZ A;  4YIF A;  4O5V A;  3P9I A;  4DBQ A;  1MMS A;  3E97 A;  3OYG A;  2CGP A;  1Y0U A;  1OCR H;  2VKE A;  3E6C C;  2F5F A;  4ASN A;  4GO1 A;  4M3G A;  1SVL A;  2XV4 S;  2BBY A;  4I0A A;  4IX7 A;  3NEU A;  3CME I;  3IH4 A;  5BQT A;  2B7E A;  3O8H A;  3T5X A;  2QEX I;  3BT9 A;  3HUG B;  4MHG A;  2PJP A;  1H89 C;  3DV8 A;  2XKP A;  4PJJ A;  3OWT A;  1QZZ A;  5C4X J;  2JA7 J;  1I6X A;  1HF0 A;  5EG0 B;  4GRI A;  5D5V B;  3J81 K;  2AXT C;  1IN6 A;  4LB6 B;  4C9Y A;  4KIG A;  3A0H C;  4ZYH A;  3TKY A; 
#chains in the Genus database with same CATH homology
 1FSH A;  1F1Z A;  3GO5 A;  2C6Y A;  1IN5 A;  3GYH X;  3RYR A;  3KP4 A;  4IRI A;  2E7W A;  1G3W A;  5HDG A;  2X4H A;  4CZZ A;  3LAJ A;  1FX7 A;  2VT2 A;  5L3G A;  2KRF A;  1R1U A;  3C7J A;  2A69 F;  2ZBK A;  1IW7 F;  4CDG A;  1G3S A;  4UVC A;  4WCG A;  4XSX F;  1KYW A;  1QPM A;  1H0M A;  1W7P D;  2BGC A;  3QPH A;  4HF1 A;  1YG2 A;  2P5K A;  4LB5 A;  1Z6R A;  3R6S A;  2R7D A;  4XLN F;  2HFH A;  3C18 A;  2PBI A;  2UWM A;  3GZ6 A;  2EFN A;  1QZY A;  4M9Z A;  1XDS A;  1OKR A;  1OYY A;  4P9F A;  2PI0 A;  1Z6T A;  1FY7 A;  3V8K A;  3N97 A;  3V7C A;  3HHH A;  3QU6 A;  1UCR A;  2ZFW A;  4JQF A;  5D6E A;  4P5O A;  2FRH A;  1MGT A;  2RKH A;  1H9G A;  2AXL A;  3KP5 A;  1W4M A;  1QBJ A;  3IHU A;  3GWZ A;  2EFP A;  1ZHF A;  1BC7 C;  2QBY B;  3F21 A;  1B1B A;  5K5O A;  5KVR A;  4L0Z B;  3KE2 A;  3WTZ A;  4LLN A;  2KKO A;  2QYO A;  2HZT A;  1IXC A;  1RI7 A;  5DUI A;  3FMR A;  2JZY A;  2F5C A;  3V7R A;  1ZN2 A;  1YW9 A;  3TGN A;  4KNY A;  4OIP F;  1ZAR A;  1FT9 A;  3ISP A;  1DUX C;  4KA4 A;  5DUK A;  4PGG A;  2DK5 A;  2XRN A;  3QP5 A;  4ON0 A;  3H3U A;  3LWF A;  1PP8 F;  1CF7 A;  4MEY F;  3L2C A;  5FFZ A;  5ICF A;  3L7W A;  4NHJ A;  2HKX A;  1SD5 A;  2GQQ A;  4WXD A;  4AVP A;  4RB3 C;  1YLF A;  1IF1 A;  3BWG A;  2Z33 A;  1K7A A;  4WK8 F;  1DPU A;  3N4M A;  5HLG A;  1SMY F;  1FP1 D;  1FC3 A;  2JT1 A;  3M9A A;  4Y17 A;  2V9V A;  2V79 A;  1KU2 A;  3VOD A;  3JTG A;  3NQO A;  1WRJ A;  1CGP A;  4HOB A;  4S04 A;  1D8J A;  4F7Z A;  3GX4 X;  1FSE A;  1FZP B;  1MDM B;  3HUG A;  4YG2 F;  5D4R A;  4R79 A;  4HW0 A;  4JBA A;  2H09 A;  2XHK A;  1D3Y A;  5FO5 A;  4HDV A;  4XBF A;  3RKX A;  1I5Z A;  2MD5 A;  4UV8 A;  3R4K A;  1XD7 A;  5ILV A;  1UFM A;  4NQW A;  4FT8 A;  4L5J A;  3HYI A;  4M74 A;  3CO7 C;  1DP7 P;  5FD6 A;  2XVC A;  1MJA A;  1WI9 A;  3RPQ A;  4ZH4 F;  4BQA A;  2DQR A;  5TRD A;  2HQR A;  4KIB A;  4RGX A;  2GXB A;  4M72 A;  1DPR A;  5EEH A;  2JPC A;  3W6J B;  2KJC A;  3WOD F;  5IT3 A;  2M45 A;  3V7S A;  3OOP A;  2UZK A;  3QAH A;  3MEX A;  2YR2 A;  1EH7 A;  2HYG D;  3CUO A;  4L9N A;  3SQN A;  5FLX K;  4N9I A;  3LAP A;  1JGS A;  3WU0 A;  4U0Y A;  4R8H A;  1IRF A;  2F5D A;  2LSO A;  2OBP A;  2PMH A;  1B9N A;  1BJA A;  4WF2 A;  2CO5 A;  1FOK A;  4I98 B;  1RUN A;  1X3U A;  5ERI A;  1BI2 A;  1Q1H A;  2VOD A;  3ZQ7 A;  2DBB A;  4QWQ A;  1OR7 A;  2IJL A;  2L54 A;  2OQG A;  1KGS A;  2EA4 A;  4KUM A;  2YSR A;  2MH2 A;  2HYF A;  2JTV A;  4MNU A;  5E18 F;  3KEO A;  5HDN A;  1R7J A;  3C3W A;  3ROU A;  2FBH A;  3EQL F;  2IP2 A;  2FML A;  1BOA A;  4MQ9 F;  3IWF A;  3V4G A;  1LQ1 A;  5E1X A;  2STW A;  2QBY A;  1T0F A;  1R1V A;  5TJJ A;  5ILU A;  2FEZ A;  3F23 A;  5DDG A;  3KCC A;  2DTR A;  4RGR A;  4LG0 B;  3GXO A;  3TO9 A;  3WTS C;  4G7H F;  1EH8 A;  3GFM A;  1ON2 A;  2OD5 A;  2OA4 A;  1IUY A;  4OOI A;  1UHW A;  4LK1 F;  3K2Z A;  3KLN A;  3B73 A;  4ENM A;  2NAZ A;  3VEP A;  1O3T A;  1D5V A;  3V8J A;  2L4M A;  4HLY A;  4BH9 A;  2M5W A;  5HLI A;  1IXS B;  3WTT C;  5LRS A;  3D5L A;  3F6V A;  1IN7 A;  4P96 A;  2XAJ A;  2J5O A;  2VN2 A;  1KU7 A;  5AIQ A;  2DLL A;  3ZMS A;  5K5R A;  3KFW X;  1SFE A;  3M1E A;  4YFN F;  3BJO A;  3DQV C;  2FOK A;  2WC2 A;  1T6S A;  4UXN A;  1BC8 C;  1ODD A;  1Z9C A;  4DQ2 A;  3KEQ A;  4KMF A;  4KIC A;  3ZPL A;  3IKT A;  2XAQ A;  3WE2 A;  5ICE A;  1J2X A;  1S7A A;  5IT9 Z;  2R7F A;  2ISY A;  2K86 A;  2P7C B;  1R5H A;  4HV6 A;  2HTS A;  3FM3 A;  5BOX A;  4UHT A;  1R5G A;  3FX3 A;  1MDM A;  2EFQ A;  1QGP A;  2ESH A;  3CJN A;  4TV7 A;  1I1G A;  2Z5U A;  2NNY A;  4M9X A;  2HQN A;  2OZU A;  3KP3 A;  2DU9 A;  2WTE A;  1J9I A;  3I54 A;  2EJR A;  2H6C A;  2DPU A;  3Q9S A;  3K1N A;  1R1T A;  3E3V A;  5E20 A;  2KIM A;  3SZT A;  3DPT A;  3RI4 A;  3CUQ B;  1P4W A;  3JAM Z;  2Y48 A;  3HIF A;  1UHM A;  2W84 A;  2IA1 A;  2D1H A;  2VE9 A;  3WGI A;  3O3K A;  4A0Z A;  4OMY A;  2EV0 A;  4ENK A;  2QLZ A;  3HRU A;  3BP8 A;  4M71 A;  5L3C A;  1J59 A;  1FYK A;  4FX0 A;  4D0P A;  3FM5 A;  2DQL A;  2HR3 A;  3ABU A;  4NB5 A;  1Z1D A;  3M7G A;  3RIR A;  4WX9 A;  1YTY A;  5CYV A;  4UUV A;  1MJB A;  4IRG A;  3MCZ A;  1RNL A;  1ZGA A;  2HDC A;  4KIF A;  4HQM A;  1KA8 A;  1GHC A;  1GVJ A;  2GZW A;  2ZJ2 A;  1O7L A;  3W6K B;  1ZLJ A;  4K2E A;  2A3S A;  2ISZ A;  1JXS A;  4L9J A;  1LB2 A;  1UST A;  4Y15 A;  1G4D A;  5FFX A;  5DCM B;  2L4A A;  3TOB A;  2E1N A;  1YFH A;  5E8I A;  4HZF A;  3VOE A;  1WQ2 A;  3I58 A;  4MTE A;  4LG0 A;  1ZRD A;  3BJA A;  1MZB A;  4U88 A;  4U7D A;  3E6B A;  4OIQ F;  2ADU A;  4EJU A;  3LA7 A;  3TO7 A;  3C1D A;  5LHH A;  2VT3 A;  4IF4 A;  5JVT A;  3JSO A;  3U1D A;  2VC1 A;  3WTW C;  5HS9 A;  5F64 A;  1MJ9 A;  3MFK A;  1R00 A;  1ZAO A;  1AOY A;  5LHG A;  1GXQ A;  2FBK A;  5JR3 A;  2YPR A;  3HOT A;  2W85 A;  3RYP A;  3CTA A;  1BIB A;  3SHF A;  3TDZ C;  2Y75 A;  1P2F A;  3HRM A;  4BAY A;  1LEA A;  5BMZ A;  3REO A;  1WWX A;  1L3L A;  3QU3 A;  2PN6 A;  3L9F A;  3AAF A;  4LJZ F;  3T1B A;  2XIG A;  2XUB A;  3EET A;  4EQQ A;  2CSO A;  3KZY A;  4PGH A;  1T39 A;  4FX4 A;  2GA1 A;  5H20 A;  3FHZ A;  2J5P A;  5DYM A;  1KQ0 A;  4LK0 F;  3RJP A;  2KJB A;  3CLO A;  2ZKZ A;  3EYI A;  3GFJ A;  3ZMT A;  3MZH A;  2JRT A;  4ZYE A;  2DFI A;  3BDD A;  2BV6 A;  1IN4 A;  1LDJ A;  2HTJ A;  4HDU A;  2PMU A;  3R0J A;  1U5T B;  3FXU A;  4WXH A;  2F2E A;  3DXJ F;  3QP6 A;  2O03 A;  1HKT A;  3K69 A;  2D45 A;  3S2W A;  4GXO A;  5L3D A;  4WWC A;  3I59 A;  1ZYR F;  1OYI A;  2Q2E A;  2ZME B;  1SAX A;  2KIF A;  3E6D A;  5BPI A;  1MD0 A;  4EJO A;  2OU2 A;  2MLK A;  3CUQ A;  1TLH B;  3J81 Z;  4ZZL A;  2A5Y B;  2IRF G;  2M1B A;  2QQA A;  2HEO A;  1B6A A;  1W5S A;  1ZGJ A;  3LQR A;  4IHT A;  5LEK A;  5ICG A;  3QPT A;  1TNS A;  2IPQ X;  4L9T A;  2HOE A;  1F5T A;  3KLO A;  3OV8 A;  4KMU X;  2G7U A;  3IWZ A;  6PAX A;  2ZNY A;  2V1X A;  4AD9 A;  4A0Y A;  3HTU A;  3Q5F A;  3F8N A;  2RV8 A;  3J80 K;  1G6N A;  5JI6 A;  3F3X A;  2MLG A;  2AS5 F;  1SD4 A;  2IA2 A;  4G6Q A;  3WGH A;  2QZ8 A;  4G7O F;  5CVI A;  3RKY A;  5HS8 A;  4GYG A;  3HSE A;  1FYL A;  3LST A;  3I53 A;  3FXQ A;  5FB2 A;  2P8T A;  3TOA A;  3F22 A;  5CVV A;  2RQP A;  2Z3Y A;  1XSV A;  1IN8 A;  3I71 A;  4EJT A;  4GCV A;  1QNT A;  1USS A;  4HF2 A;  3GFI A;  1JE8 A;  1GXP A;  3QOP A;  3U9G A;  2V6C A;  1MKM A;  4CGZ A;  1YW8 A;  3BY6 A;  2R3S A;  5CVU A;  4QLC U;  3KZZ A;  5A2Q K;  5LLQ A;  1HKQ A;  2D2W A;  2ETH A;  2FBI A;  1BI3 A;  5DCM A;  3K1P A;  4ETS A;  1Z7U A;  4HQE A;  3EUH A;  5J8C A;  4CYD A;  3GVA A;  2Z9O A;  3K1M A;  5L3F A;  3V8L A;  5LBQ A;  1S3J A;  1KQ8 A;  4B8X A;  1K78 B;  4P55 A;  3ZMD A;  5E8G A;  2FQ3 A;  2K02 A;  2CQK A;  3LQQ A;  1E17 A;  1SD6 A;  5HLH A;  5LEJ A;  2FMY A;  3WU1 B;  4AWX B;  2FXA A;  2O3F A;  5LHI A;  2CYY A;  2HWV A;  2Y0M A;  4XRF A;  1P4X A;  4XLP F;  2QM3 A;  3BRO A;  4FHT A;  3GUD A;  2CW0 F;  4U0V A;  2K4B A;  5F6F A;  2K27 A;  2VBX A;  3IKV A;  1K6O A;  3G3Z A;  1FLI A;  2H94 A;  2GIV A;  2GWR A;  1QO0 D;  1R22 A;  3R61 A;  4U7B A;  4O3M A;  4EGZ A;  4LFU A;  4MTD A;  3ZMV A;  1KYZ A;  2Q8K A;  3P9K A;  3MZY A;  1BI1 A;  5LGU A;  2RN7 A;  4HBL A;  1B4A A;  3IL2 A;  4CIC A;  1LJ9 A;  3ECO A;  1YS7 A;  4I0B A;  4Q5S F;  5CJ9 A;  1I1S A;  3KP6 A;  4XSZ F;  1SFU A;  2CFX A;  1R23 A;  4RB2 C;  3JSP A;  5D6F A;  4JK1 X;  3SZP A;  4KYW A;  3J7A O;  5CLS A;  5EEG A;  3JTH A;  1G3Y A;  2PLY A;  1PDN C;  3VFZ A;  1U5T A;  4L0Y B;  2A07 F;  2VBZ A;  3LFK A;  2DPD A;  3O6B B;  5D4S A;  4KN4 X;  2ZME A;  1O3Q A;  4L18 B;  1FP2 A;  1BN5 A;  1S29 A;  2DO7 A;  5L3E A;  2L01 A;  3D0S A;  3PFI A;  1O3S A;  3GLX A;  1RZ4 A;  3WG9 A;  3RPU A;  3E5Q A;  1T98 A;  2A6H F;  3WTY C;  4EM1 A;  3FMQ A;  4EJW A;  1OPC A;  4BNC A;  2YX7 A;  5HDK A;  1Z05 A;  4IPA A;  4Q48 A;  4EVI A;  4R1H A;  3DF8 A;  3F72 A;  1J75 A;  3DEU A;  2XAS A;  4KT5 C;  3F6O A;  1XCV A;  2G9W A;  5E17 F;  2K4J A;  4HX8 A;  3WE3 A;  4I01 A;  1HW1 A;  5K5Q A;  3KP2 A;  3CUQ C;  3I5U A;  1XMA A;  1KU3 A;  5FLX Z;  2VON A;  3IRR A;  4OIR F;  4OU0 A;  1BBY A;  3FF5 A;  1U3E M;  4AIK A;  5H6R A;  1YYV A;  4HF0 A;  5FD5 A;  2ZCW A;  3CO6 C;  2DW4 A;  1HBX G;  4EM0 B;  5D5W B;  4RGS A;  1PP7 U;  3I59 B;  1J5Y A;  2RNJ A;  4BHB A;  1SFX A;  4A0X A;  1TBX A;  2RC4 A;  2QQB A;  1LNW A;  2IA0 A;  4G94 A;  1J7K A;  4H0E A;  2O8X A;  2IT0 A;  2V1D A;  2HS5 A;  1REP C;  2VE8 A;  3T8T A;  2ACJ A;  5K1Y A;  4OIN F;  3CDH A;  2P5V A;  3EYY A;  1Z91 A;  3KP7 A;  3ZMU A;  1K78 A;  2ZO4 A;  2FA5 A;  5HVQ C;  4CHU A;  2Q0O A;  1JHF A;  4S05 A;  1P4A A;  4OIO F;  2OAZ A;  5L3B A;  1DDN A;  2L02 A;  2DAO A;  5J6X A;  2G7H A;  4M6Y A;  4BHC A;  4EGY A;  4Q4Z F;  2LF7 A;  3FMS A;  2W24 A;  4G8X A;  5F1R A;  1P92 A;  1U6G A;  5LGN A;  4ESB A;  5D5X B;  2H6B A;  1TQP A;  3GF2 A;  1O57 A;  4A5M A;  3HTS B;  2QUF A;  2MA3 A;  1XCB A;  3GZ5 A;  1T2K A;  4YFK F;  2CWE A;  1XSD A;  2HGC A;  2EA2 A;  1U8R A;  2DI3 A;  2MBF A;  4HLX A;  3RKW A;  3TDU C;  1KU9 A;  5CVR A;  2MC3 A;  2UXN A;  3I4P A;  4IXA A;  1O7F A;  4HYE A;  3BPX A;  2YU3 A;  3H92 A;  1FNN A;  3COA C;  1YW7 A;  4MQV A;  1V4R A;  3E5X A;  3L00 A;  2ESN A;  5H6Q A;  3ULQ B;  2ELH A;  4L9V A;  4A5N A;  3BPV A;  2DK8 A;  4CXF A;  3DFG A;  3MQ0 A;  2VC0 A;  3GEZ A;  1H9T A;  5D8L B;  1C0W A;  1SD7 A;  1FBS A;  2E1C A;  4B09 A;  4L5I A;  1BM9 A;  4M73 A;  2A61 A;  1L0O C;  1W7P B;  3TQN A;  2ZNZ A;  4LGW A;  5DV5 A;  3KET A;  2W25 A;  1ZG1 A;  2FSW A;  2KIU A;  2TDX A;  3HSR A;  2NS0 A;  1NHA A;  3WTU C;  1U5T C;  1STZ A;  1B59 A;  5DEQ A;  4UNO A;  2XAH A;  3Q9V A;  4YFX F;  3F8F A;  1WSU A;  3R0A A;  4GGG A;  2VXZ A;  3E6M A;  1VTN C;  1OYW A;  1D8K A;  2RDP A;  1FYM A;  1TNT A;  2VOP A;  2IW5 A;  1IZ1 A;  1XDU A;  2M30 A;  2NNN A;  3SFZ A;  4A2U A;  2PG4 A;  1T38 A;  2EB7 A;  2GAU A;  1ZG3 A;  1ZRF A;  2P7V B;  3GFL A;  3ABT A;  2VBY A;  4EJV A;  2OZ6 A;  4I09 A;  4IRH A;  3ZP5 A;  3RDI A;  4GYI A;  5CVJ A;  4MGR A;  4N9H A;  4UVA A;  4G7Z F;  5LRR A;  3SXY A;  1G3T A;  2NYX A;  1FBQ A;  1XSX A;  1R36 A;  3E5U A;  2PEX A;  1LDK B;  4KFC A;  3DPL C;  3LA3 A;  3JW4 A;  4KN7 X;  2LDU A;  4ZYD A;  1SMT A;  1TQI A;  2V1U A;  3ZN1 A;  4BYY A;  1TW2 A;  1J0R A;  4BHP A;  4ZZD A;  2Z99 A;  2JSC A;  3HOS A;  4I02 A;  4M6X A;  5ICC A;  1W5T A;  4OMZ A;  4LD5 A;  2EFW A;  1S7O A;  5D5U B;  4IJA A;  2OQR A;  1ON1 A;  1HW2 A;  1XN7 A;  5BPD A;  3K0L A;  3T8R A;  2VBW A;  4Y13 A;  3IC7 A;  3PQJ A;  4IVN A;  1YS6 A;  3P7N A;  5ILS A;  3NRV A;  1YQA A;  1HKS A;  1AWC A;  4N0B A;  1ZRC A;  2RVC A;  1JHH A;  4ENN A;  3K9T A;  2P5L C;  1U2W A;  1YO5 C;  1R58 A;  3HRT A;  2P4W A;  4YII A;  2EFO A;  3EDP A;  1LDD A;  2RGV A;  1WKM A;  3I64 A;  1TW3 A;  2XGX A;  2GXG A;  1TTY A;  1P6R A;  2CG4 A;  2QQ9 A;  4EV0 A;  2K7L A;  4A12 A;  1XGS A;  3B02 A;  5ED4 A;  1HST A;  2P6S A;  3IRQ A;  5IT9 K;  1IAW A;  4HAM A;  2ZXJ A;  4HV5 A;  1ZH5 A;  1EH6 A;  3ECH A;  1FPQ A;  4Q47 A;  3HSF A;  2PFB A;  4HX7 A;  2WWY A;  2FF4 A;  3DKW A;  4I7H A;  4AIH A;  1ONV A;  3FZV A;  5BS6 A;  4ZYG A;  1W7P A;  2EK5 A;  1ZLK A;  2EWN A;  1XB4 A;  1UB9 A;  3QRF F;  2LNB A;  4UV9 A;  3F8B A;  3RTR A;  2STT A;  1ZRE A;  2FNP A;  3WTX C;  1V3F A;  1O3R A;  5HS7 A;  5JFR A;  2UXX A;  3BZ6 A;  1I27 A;  4Z2Y A;  3LA2 A;  1BI0 A;  1B9M A;  3HHG A;  4ENJ A;  4HX4 A;  3JAM K;  1U78 A;  5AON A;  5D8K B;  4LLL A;  3P9C A;  3T0Y A;  3ML6 A;  4EMS A;  2E7X A;  1HSJ A;  1HXD A;  1QQI A;  2O0Y A;  2EV5 A;  1IXR C;  2MH9 A;  1HQC A;  5E1Z B;  4PDK A;  3WTV C;  1BIA A;  2XKO A;  4ESJ A;  5JHU A;  5DD4 A;  1K79 A;  3TO6 A;  2L3D A;  3J80 Z;  5J8F A;  3DP7 A;  3H3Z A;  2YX4 A;  2QEN A;  1OMI A;  4HA8 A;  3MAJ A;  4WXC A;  3ZMZ A;  3R60 A;  3WGG A;  5LGT A;  4P9U A;  1XGO A;  2EV6 A;  3PQK A;  2FU4 A;  4G9Y A;  3ELK A;  1A04 A;  2M87 A;  3BOQ A;  5FGM A;  1XGM A;  4RAZ A;  1S6L A;  3HRS A;  4ESF A;  2A6E F;  2P6T A;  5A2Q Z;  2JPB A;  2W57 A;  3O2P E;  4RB0 A;  4RGU A;  2X0L A;  2O61 A;  1LVA A;  2IVM A;  4CO8 A;  3F8C A;  1EV7 A;  4IHS A;  2D1V A;  2GA2 A;  4PZJ A;  1RIO H;  1IRG A;  5AIP A;  3ERE D;  3I0T A;  1YIO A;  4O6J A;  3M8F A;  2XAF A;  3F8M A;  5DCF A;  3M8E A;  1E2X A;  2BE5 F;  3BJ6 A;  3MWM A;  4G6D A;  4A6E A;  1HW5 A;  4PCQ A;  1KQ9 A;  2FE3 A;  4M9S A;  1XGN A;  4A6D A;  1RUO A;  4AIJ A;  1TQM A;  2QVO A;  2BEO A;  1F9N A;  4E70 A;  2NRA C;  2PQ8 A;  3U2R A;  2HKO A;  4RS8 A;  2WV0 A;  4BXU A;  1ZG5 A;  4RB1 A;  3VB2 A;  2O6G E;  3L09 A;  2BYV E;  1FBU A;  1ULY A;  3GW2 A;  2XRO A;  4EM2 A;  1CF7 B;  4RAY A;  2H27 A;  3ZN0 A;  2XAG A;  2FNA A;  4UVB A;  3G73 A;  1F4K A;  2A68 F;  2F5E A;  4I2O A;  5E1W A;  5HOO A;  4MEX F;  1XMK A;  2DT5 A;  2B0L A;  4U0W A;  3FWE A;  2LF8 A;  2QWW A;  3FXR A;  1PUE E;  1LEB A;  4KDP A;  2LKP A;  4LMY A;  4DNC A;  2VOO A;  4LLG F;  2M8E A;  5KK1 A;  5DD8 A;  2COM A;  1S8N A;  1FWZ A;  4YIF A;  4O5V A;  3P9I A;  3E97 A;  2CGP A;  1Y0U A;  3E6C C;  2F5F A;  4ASN A;  4GO1 A;  2XV4 S;  2BBY A;  4I0A A;  3NEU A;  5BQT A;  3T5X A;  4MHG A;  2PJP A;  3DV8 A;  2XKP A;  1QZZ A;  1I6X A;  5D5V B;  3J81 K;  1IN6 A;  4LB6 B;  4KIG A;  4ZYH A;  3TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...