2YPRA

Crystal structure of the dna binding ets domain of human protein fev
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
KGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PROTEIN FEV
total genus 28
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yprA00
4U88A 5LHHA 4DQ2A 1W5SA 4ZZDA 3RKXA 3BWGA 3QP6A 4XRFA 2IA0A 1MKMA 1P4AA 1IN4A 2ZMEB 4I02A 5LLQA 5LRRA 4ESFA 4EQQA 1ZAOA 2DTRA 3D0SA 3F23A 1IW7F 5H6QA 1REPC 3F21A 3LWFA 1XGNA 3B73A 4EJOA 4HBLA 1ZRFA 4EGZA 4FT8A 2CGPA 2EFPA 2CG4A 2DAOA 5AIPA 1BC7C 2NNNA 2KRFA 3VODA 1K78A 1HW5A 4HF2A 3GUDA 4IRHA 3F8BA 3ZMZA 1ZG5A 1O57A 1UHMA 1BI2A 1ZG3A 3BDDA 3DEUA 1FOKA 3ZP5A 3OOPA 3F6OA 1QQIA 3TDUC 1OYWA 4LLGF 2OAZA 3RYRA 2DI3A 2FEZA 3WGGA 2ISZA 6PAXA 2PFBA 1RUOA 4KICA 1BIAA 4ZH4F 2VOPA 3CTAA 2OA4A 1T2KA 4EJVA 4HF0A 1J5YA 4KMUX 5F1RA 5FGMA 2DK8A 4R8HA 3F6VA 3KCCA 1XCVA 2R7DA 3P9CA 5D6EA 3H3ZA 2EV6A 4ZZLA 2VE9A 4N0BA 5IT9Z 4L0YB 4MTDA 1B9NA 2DQLA 3V7SA 1MDMB 2FMYA 4GYIA 4FX4A 4YIFA 3ECOA 4Y17A 1WI9A 1S7AA 4MGRA 5BOXA 1MGTA 2AS5F 2L54A 2Z33A 3EQLF 3KLNA 5DD8A 2DPDA 1BIBA 2F5EA 1PP8F 2EK5A 2FA5A 4KFCA 2VBWA 3I71A 1JE8A 4EJTA 4P9UA 4HAMA 3KEQA 3T8TA 5D4RA 3REOA 1GXPA 5LHGA 4M9SA 5LGTA 3ZMTA 4I0BA 5H6RA 4IPAA 1XDSA 4M9ZA 1GHCA 4R1HA 3HSEA 1FBQA 4LFUA 5JR3A 4HZFA 4EMSA 1U5TC 4O5VA 1YG2A 2L4AA 4Q47A 2DQRA 3TOBA 1B6AA 1SFEA 3RYPA 5ERIA 4KN7X 2PI0A 4XLNF 1Q1HA 4A0XA 2IP2A 5FB2A 1U5TB 3GXOA 3QAHA 1ULYA 3LA2A 2WTEA 1OKRA 2PN6A 3RTRA 1S3JA 3BOQA 3HOSA 2QBYB 3ROUA 2V1XA 3Q9SA 4OU0A 3R61A 3K1MA 5K1YA 2HTJA 3F22A 3BJAA 5E1XA 2HDCA 2YX4A 3EETA 5HVQC 1G3WA 4CXFA 1TW3A 2V6CA 4A0ZA 2HEOA 1D5VA 2Z9OA 2EWNA 1UFMA 1F9NA 1UHWA 1PUEE 3DF8A 2Y48A 3QPTA 2A5YB 5DUKA 2Z99A 1Z6RA 3JTHA 2WWYA 3H3UA 2FF4A 3ECHA 4HV6A 2QENA 2XHKA 3K9TA 5E8IA 1FWZA 3U9GA 1YIOA 1G3YA 3F8CA 2A6HF 2GWRA 1F1ZA 5DEQA 1VTNC 4L9TA 5H20A 2J5PA 5LEJA 4BYYA 2V9VA 4CHUA 4H0EA 5A2QK 3L09A 1YS7A 3FMRA 1ZREA 2MLGA 1T98A 5IT9K 1T39A 3CUOA 4GCVA 4L9NA 1YW8A 3GO5A 4JQFA 3BROA 1IN5A 4KNYA 4BH9A 1L3LA 1KA8A 3E3VA 2GZWA 5L3CA 3QPHA 1XSDA 3HHGA 2STWA 4YG2F 4HA8A 3WG9A 2EJRA 2FSWA 3BPVA 3KFWX 3E97A 3HSFA 1H9TA 1J2XA 4U0VA 4CYDA 3GZ5A 4UNOA 1FNNA 1BI3A 2A69F 2ZFWA 3GFJA 2VE8A 1LB2A 3P7NA 2P6TA 3WODF 1TQIA 2O61A 3JSPA 3WTTC 2FU4A 3M1EA 1X3UA 1CF7A 1CGPA 1KQ0A 4YFKF 2K7LA 1YYVA 5HLIA 4IRIA 3KE2A 1D8KA 5BMZA 3EYIA 1S6LA 2P5LC 4Y13A 4Q48A 2FRHA 4YIIA 2FXAA 4U7BA 4DNCA 3FMSA 4B8XA 2LF8A 2M8EA 2ZCWA 4EM0B 5D6FA 1SD5A 4A0YA 3L00A 1WSUA 1FBUA 4M73A 5FD6A 4EM2A 2CYYA 5HDGA 4G94A 2BE5F 4Q4ZF 1F4KA 2NS0A 2J5OA 1Z05A 1T6SA 3K2ZA 2UWMA 1T0FA 2D1VA 4RAZA 5ILVA 1IN7A 4P9FA 1TBXA 2HFHA 1RI7A 1I5ZA 3K1NA 3ZN0A 2ZKZA 3HTSB 4I2OA 3PFIA 1P6RA 1J9IA 1TNSA 3MZHA 3R6SA 1O3RA 4HLYA 4HX8A 3E5QA 4ESBA 1SMYF 4AD9A 3KP3A 2LNBA 4R79A 4M6YA 2VN2A 1LDDA 2KKOA 3O2PE 5D8KB 2CFXA 4OIPF 2PQ8A 2K4JA 2H6BA 3V8JA 2X0LA 3V7CA 4P5OA 5DD4A 3W6KB 4MNUA 2MH2A 2O8XA 3QOPA 2JZYA 5CLSA 3AAFA 1R36A 2BYVE 1B9MA 2RV8A 4LD5A 4GO1A 4WF2A 4IJAA 3N4MA 4AIKA 1K6OA 3L9FA 2XIGA 2MLKA 4A2UA 5CVIA 1K78B 4OMYA 3HHHA 3O6BB 1ZGJA 1YW9A 3C3WA 1DPUA 2EA4A 3QU3A 2JPBA 5E1ZB 1BN5A 3RKYA 1WKMA 1I27A 2JTVA 1SFXA 2WC2A 1DPRA 2UXNA 1W4MA 2HOEA 4G8XA 5D4SA 2VODA 4RGXA 4FHTA 3RI4A 1O7LA 2PBIA 2JSCA 1IN8A 1ZHFA 2XVCA 2HZTA 1O3SA 2FOKA 4A5NA 3P9KA 4BQAA 1KU3A 5LHIA 3J80Z 1MJBA 5F6FA 2EB7A 2Q8KA 1FP1D 1IRFA 2M30A 1O3TA 3MZYA 1WQ2A 1D3YA 1IZ1A 5KK1A 4EGYA 2HTSA 1GVJA 3IRQA 4LK1F 5E8GA 1IAWA 3K1PA 2FBKA 2GA1A 4EM1A 5E1WA 1ZGAA 5HDKA 2QWWA 2E1NA 2CSOA 2XAQA 3N97A 2HQRA 4QWQA 2E1CA 2MD5A 4RGRA 4L18B 1ZLJA 2FBHA 3ABTA 1IUYA 2VXZA 4KDPA 5D5WB 4BHPA 3SHFA 1B1BA 3C18A 5DCMA 2ZO4A 4HF1A 3HUGA 2IA1A 2IRFG 2L01A 1J75A 5FD5A 2M45A 2ADUA 1EH6A 3CUQA 2CWEA 4I01A 2VC1A 3SZPA 1A04A 3H92A 2FBIA 1W7PA 4ENNA 5ICCA 3FXQA 5BPIA 2ESNA 3HSRA 4Z2YA 4OIRF 2W85A 3ELKA 1R23A 3BJ6A 3SFZA 5L3EA 2H94A 1JGSA 5ED4A 1KQ8A 4O3MA 2KIFA 3WE2A 2D1HA 1ZRCA 1HSTA 5ILUA 2A3SA 3MEXA 3DFGA 5DCMB 3HRMA 4I0AA 1V3FA 2O03A 3V7RA 3ZN1A 2QQBA 1FSHA 2NNYA 2G7HA 3WE3A 3ZPLA 2HYGD 1WRJA 2OZUA 4HOBA 1FY7A 1E2XA 2F5DA 4QLCU 5L3GA 4HQMA 1FZPB 1ZH5A 4LG0B 2FNAA 3C1DA 4BAYA 3BJOA 3G3ZA 1BBYA 1U6GA 1SAXA 1SD4A 3KLOA 4G6QA 1MJAA 4EJWA 3NQOA 1U8RA 5L3FA 5FFXA 2NYXA 3HOTA 4UXNA 4B09A 2IPQX 4XSXF 5JI6A 3MCZA 3S2WA 1ON1A 5ICGA 3KZYA 4I09A 5DUIA 4G9YA 3E5XA 3ULQB 4OINF 3ZMVA 5HS7A 2X4HA 2P7CB 2LKPA 3IRRA 5D5UB 1SFUA 3KETA 2P7VB 4AIHA 1FYMA 4CO8A 4S04A 5AIQA 1OYIA 4S05A 4HV5A 1ZG1A 3RPUA 1K79A 1NHAA 5JHUA 1J0RA 2XKOA 5IT3A 5ICEA 3T0YA 1KU2A 3QP5A 1RNLA 2CW0F 2XKPA 2EFWA 1FP2A 4UHTA 3J81Z 4ESJA 2KIMA 2XV4S 3GLXA 2XAGA 3T5XA 1ZARA 3P9IA 1KQ9A 2UXXA 3GFLA 4ON0A 5E17F 1G3TA 2Y0MA 2JT1A 1Z1DA 1LQ1A 2H6CA 2ZXJA 3LAJA 4RB2C 2P4WA 2XAJA 1AOYA 4I98B 5DDGA 1KU7A 4YFXF 3GZ6A 3TGNA 1YO5C 1Y0UA 3ML6A 1IRGA 1BC8C 2K27A 1R1TA 4UUVA 2RC4A 2JPCA 2HGCA 4LG0A 2H09A 3HRSA 5CVRA 1XMKA 3RIRA 3O3KA 2HWVA 2OZ6A 4UV9A 1FC3A 4ETSA 5CVUA 2EFOA 2QM3A 2G7UA 1PDNC 4IXAA 2YPRA 1LVAA 2P5KA 4HX7A 1YW7A 1YS6A 3GYHX 5CVVA 4RGUA 4OIOF 4KT5C 2HKOA 3Q5FA 1XMAA 2RNJA 4ZYDA 4KIGA 3I4PA 3FXRA 3IHUA 2IVMA 2RKHA 4NHJA 3F72A 4FX0A 4KMFA 1P4WA 4WXDA 1IXSB 3E6MA 1BOAA 3CUQC 5BS6A 2KJBA 2A6EF 4UVAA 2M1BA 3E6DA 3GVAA 4BXUA 3NRVA 3I0TA 1ZYRF 3FM3A 2DFIA 1RUNA 2YSRA 1JXSA 1FT9A 3F8MA 2D45A 3CUQB 1AWCA 1O3QA 3QU6A 5KVRA 2UZKA 3FZVA 2IW5A 1XGSA 4L9VA 4ASNA 2BEOA 1BM9A 1TQPA 2FMLA 3K0LA 3V4GA 2W84A 3ZMSA 4LGWA 1KGSA 1ONVA 4OOIA 2EFQA 2GXGA 2RDPA 5JFRA 4G6DA 2DW4A 3EYYA 2V1DA 1JHHA 1Z7UA 1J59A 2COMA 1MZBA 2VBZA 2A61A 3TO7A 3I53A 1U78A 4G7OF 5E18F 2A68F 1P4XA 1IXCA 2KIUA 4IHTA 1C0WA 4UVCA 5D5XB 5J8FA 2BBYA 2E7XA 5TJJA 4MTEA 2QLZA 3BY6A 3U2RA 4K2EA 3VEPA 4PZJA 3GEZA 4L5JA 1QBJA 4CICA 2F5FA 4IRGA 5CVJA 5LEKA 4RAYA 1WWXA 5FFZA 2PJPA 1KYWA 4MQVA 5F64A 3TO6A 2XRNA 2HQNA 3R4KA 3RDIA 1FYLA 1LDKB 1S8NA 3MFKA 1V4RA 2PG4A 3HYIA 3GFMA 1F5TA 2VT2A 1U3EM 4YFNF 5EEGA 1OYYA 3ZMUA 1TNTA 1DDNA 4JBAA 3JAMZ 1H0MA 1QPMA 4LJZF 2FNPA 4M9XA 2DPUA 3PQJA 4HDVA 3GFIA 4Q5SF 1K7AA 2M87A 4O6JA 1JHFA 3PQKA 2E7WA 2LDUA 3DPLC 1FYKA 4MEYF 2LF7A 4L5IA 4MQ9F 3LQRA 4RS8A 3WTYC 1G6NA 2L02A 1W5TA 2Q0OA 4LK0F 3BZ6A 3LA3A 5HS9A 3TQNA 1EH7A 3FWEA 5E20A 4WWCA 2B0LA 5AONA 3R0AA 5A2QZ 2VT3A 5FO5A 2QVOA 2VONA 3VOEA 4F7ZA 1OR7A 2BV6A 1FSEA 3GF2A 1O7FA 1G4DA 2NRAC 2C6YA 3ERED 3KEOA 1LJ9A 2YU3A 2QUFA 3HRTA 2EV5A 2FE3A 3T8RA 3WU1B 3SQNA 5K5OA 2HS5A 3WGHA 3RJPA 1IN6A 2VC0A 2XASA 1CF7B 3EDPA 1OPCA 2O0YA 2RGVA 1XSVA 3E5UA 1XGMA 3F3XA 2DBBA 3R0JA 2XUBA 1J7KA 1I6XA 3DXJF 1E17A 2L3DA 3IKVA 5FLXK 1B4AA 3K69A 4RGSA 4U0YA 3U1DA 3WGIA 2HYFA 1MDMA 1Z6TA 5EEHA 4A5MA 2ACJA 2PLYA 1SD7A 2K4BA 1XB4A 3CO6C 2OQRA 3WU0A 2Y75A 3RKWA 1LNWA 2OQGA 1XSXA 2ZNZA 3SZTA 3J81K 3ZMDA 3SXYA 3ISPA 5DV5A 2DU9A 3KZZA 2QQ9A 4A6DA 2GXBA 3DPTA 1HKTA 1BI0A 4ENJA 2GIVA 3J80K 1BJAA 2PEXA 1HKQA 2PMUA 5CJ9A 4A12A 4LB5A 4PGGA 4KN4X 1IXRC 2DO7A 3QRFF 2G9WA 2STTA 2BGCA 1XD7A 2ISYA 2GA2A 3I58A 2XAFA 1TW2A 1TQMA 1FPQA 4WK8F 4MHGA 2DT5A 3I54A 3FX3A 4PDKA 4KIBA 5FLXZ 1USSA 2EFNA 5ILSA 3FHZA 3KP7A 4LLNA 3G73A 1HKSA 3Q9VA 4HDUA 4G7HF 1GXQA 4GYGA 4LB6B 3TO9A 3W6JB 1KYZA 1RZ4A 4BHBA 2V1UA 3MWMA 1BI1A 1MD0A 4IF4A 3WTUC 1B59A 1R00A 2QYOA 3T1BA 3WTZA 4P96A 1U2WA 1QNTA 4HX4A 4AIJA 4ENMA 1HW2A 1W7PD 1T38A 2W57A 3COAC 4U7DA 2P6SA 1QZZA 5LRSA 2ESHA 3IKTA 3L2CA 2Z5UA 2Q2EA 3TOAA 2GQQA 5DYMA 2O6GE 4WXHA 1QGPA 4XLPF 1DUXC 1RIOH 3M8EA 3EUHA 5K5QA 3DP7A 3GX4X 3CLOA 4NQWA 3F8FA 3M9AA 4UV8A 1R1VA 1IF1A 5BQTA 2W24A 3FM5A 1LEAA 5CYVA 3B02A 5J6XA 5K5RA 2ZBKA 2Z3YA 3HIFA 3BP8A 4G7ZF 4ZYGA 1XDUA 4WXCA 4LLLA 4BNCA 5TRDA 2EV0A 2ZNYA 1UCRA 1FBSA 4GGGA 3MAJA 4WX9A 5HDNA 1MJ9A 2D2WA 2HKXA 2A07F 3LAPA 1Z9CA 2MC3A 1LDJA 3TDZC 3NEUA 2P5VA 2MA3A 3JAMK 1S29A 2RN7A 4M74A 3FXUA 4Y15A 1HBXG 4IVNA 4RB3C 3LA7A 1U5TA 1I1GA 3WTWC 2H27A 2JRTA 4HW0A 2R7FA 4EVIA 1ZLKA 2NAZA 4P55A 2FQ3A 2IT0A 2M5WA 3DKWA 4BHCA 1R5HA 1R7JA 3E6CC 4XSZF 2VOOA 4M72A 1SD6A 5L3BA 1R22A 3IL2A 3DQVC 4U0WA 3KP6A 2QBYA 1S7OA 2L4MA 2CO5A 4L0ZB 3WTVC 3CJNA 1HSJA 3VFZA 2MBFA 2W25A 3OV8A 2DLLA 3DV8A 4XBFA 3V8LA 3JW4A 1R58A 4A6EA 4EV0A 5HOOA 1QZYA 1SMTA 4L9JA 5L3DA 3JTGA 3IC7A 4CDGA 3IWZA 1Z91A 4LMYA 1FLIA 4M71A 3I5UA 4AVPA 1L0OC 1HQCA 1KU9A 3GWZA 4M6XA 4RB0A 2RVCA 5HLGA 3KP5A 5HLHA 1ZRDA 3ZQ7A 3V8KA 1TLHB 5J8CA 1OMIA 4ZYHA 2LSOA 3FMQA 3I59A 3ABUA 4TV7A 3LFKA 4I7HA 4NB5A 3HTUA 2RQPA 2TDXA 3I59B 4HYEA 2YR2A 4AWXB 2DK5A 2VBYA 2OU2A 1R5GA 4EJUA 4CZZA 5D5VB 2HR3A 1PP7U 5BPDA 2F5CA 4UVBA 1EV7A 3L7WA 2O3FA 3BPXA 2K86A 3HRUA 1HW1A 3I64A 2IA2A 1XCBA 2ETHA 2P8TA 3LSTA 1H9GA 2WV0A 3R60A 4KIFA 3KP4A 4D0PA 4OIQF 3KP2A 4PGHA 2AXLA 2PMHA 3MQ0A 2OBPA 2XGXA 1YFHA 2EA2A 4E70A 4PCQA 3D5LA 4CGZA 4GXOA 3IWFA 4ZYEA 1ZN2A 2KJCA 1YQAA 5LGUA 1D8JA 1YLFA 1FX7A 3M7GA 4HLXA 2ZMEA 3J7AO 1ODDA 1G3SA 2QQAA 1XGOA 2ELHA 1W7PB 4JK1X 1ON2A 2XAHA 4N9IA 4WCGA 2K02A 2CQKA 2MH9A 3RPQA 2V79A 4OMZA 5HS8A 1P2FA 3M8FA 5ICFA 1LEBA 5DCFA 1HXDA 4N9HA 2YX7A 4KUMA 4HQEA 1QO0D 2QZ8A 2F2EA 1TTYA 5D8LB 2GAUA 1USTA 1STZA 1EH8A 1I1SA 3JSOA 3E6BA 3WTSC 3WTXC 3GW2A 1YTYA 2ZJ2A 4KA4A 3CO7C 2VBXA 4IHSA 1UB9A 2IJLA 4ENKA 4KYWA 4MEXF 3CDHA 2XROA 4RB1A 3TKYA 2OD5A 1DP7P 3FF5A 1XN7A 3VB2A 2R3SA 3F8NA 3C7JA 5LBQA 1R1UA 1P92A 5JVTA 5LGNA 3LQQA
chains in the Genus database with same CATH superfamily
4U88A 2MGQA 3A1YA 5LHHA 5HODA 4DQ2A 3HOXJ 1W5SA 4ZZDA 5KNLA 4B4CA 3QOEA 2VJJA 5DS9A 3RKXA 3CCEI 3BWGA 3QP6A 4IZZA 4XRFA 1OCPA 3MN2A 2IA0A 3FBNB 2JRMA 1MKMA 2QEXI 1P4AA 1IN4A 2ZMEB 1MH4A 3ESWB 4I02A 1Y8QB 5LLQA 4RBOA 5LRRA 2HPMA 4ESFA 2VKHA 4RAFA 1ZAOA 2DTRA 3D0SA 4EQQA 3F23A 1IW7F 5H6QA 1Y8RB 1REPC 3F21A 1SFOJ 3AG2H 5B5EC 3LWFA 3GTJJ 1ETXA 1XGNA 2NS8A 4DOZA 3B73A 4EJOA 4HBLA 1ZRFA 3CDLA 4EGZA 2VIXA 2R7TA 2H8RA 2IS6A 3AL0B 3NWTA 4FT8A 5FRMA 2RAEA 2CGPA 2EFPA 2JJ7A 5LFAA 5J1RA 2CG4A 1WH5A 5FROA 1FOYA 2DAOA 5AIPA 2LY2A 1BC7C 2NNNA 2KRFA 3VODA 2ID3A 1X3WB 1K78A 3LSHA 1HW5A 4HF2A 3DKXA 1F36A 3GUDA 5JLWA 3VWBA 4IRHA 2M0MA 3F8BA 5EJCA 3ZMZA 1ZG5A 1O57A 1UHMA 1BI2A 2XAUA 1ZG3A 2Y0SN 3BDDA 3GCMA 3DEUA 3IV5A 1FOKA 3ZP5A 2NOJB 2W4SA 1W36C 3OOPA 3CESA 3F6OA 1QQIA 1MSFC 3TDUC 4IHWA 1OYWA 3QPLA 4LLGF 2OAZA 4PJNA 3RYRA 2DI3A 1GLNA 2FEZA 2XB5A 3WGGA 2LVSA 2ISZA 1A36A 6PAXA 4UB6C 2PFBA 1RUOA 1K6YA 4KICA 1BIAA 3RQ4A 4A3JJ 1G59A 4ZH4F 2VOPA 5HLTA 3CTAA 3CCSI 2XDVA 2QCOA 2OA4A 4NDLA 4XN0A 1T2KA 4UUSB 4EJVA 4HF0A 4M3FA 1J5YA 4KMUX 2F6CA 5F1RA 2GIZA 1ZGWA 1T33A 2Y2ZA 5FGMA 3L2RA 2DK8A 4R8HA 3TEDA 2HNHA 3F6VA 3KCCA 1ZR4A 2R7DA 2EPFA 2CW8A 3GBGA 1NK2P 3RKQA 4C9YA 2L2OA 3P9CA 1JUSA 5D6EA 2P81A 3H3ZA 2EV6A 4OWRB 4ZZLA 2VE9A 4N0BA 1VF9A 5IT9Z 4L0YB 3S17J 4MTDA 5GTIC 1A5JA 2ICWG 4BQQA 1B9NA 1FMVA 4ITVA 2DQLA 3V7SA 1MDMB 3WHCA 1HDDC 2FMYA 4GYIA 2JA6J 1ETYA 3KPHA 3S1MJ 4RAGA 2UUZA 4FX4A 4YIFA 3OIOA 3ECOA 4Y17A 3CJRB 4B3XA 1WI9A 3EUKL 2TRTA 5GPCA 1JKQC 1S7AA 3VYSB 4MGRA 1FMWA 4AYBA 4XM3A 3P5JA 5BOXA 1MGTA 1P7JA 2AS5F 2L54A 1UG0A 2Z33A 4GFBA 1LFBA 3EQLF 1H8AC 1EJ9A 3KLNA 4DBRA 5DD8A 2DPDA 1BIBA 2ZC2A 3BQZA 2X6WA 2F5EA 1PP8F 1QZEA 2CQNA 2EK5A 2FA5A 5GAEJ 4KFCA 2AO9A 2VBWA 3OYCA 2R4GA 1ZKGA 3I71A 1JE8A 4D7MA 4EJTA 4P9UA 3KYLA 2BY1A 4HAMA 3KEQA 3T8TA 5D4RA 3REOA 1GXPA 5LHGA 4M9SA 1R6RA 5LGTA 4M3EA 2K9LA 3ZMTA 5IP7J 1ETWA 4I0BA 5H6RA 4IPAA 5J40A 3PL8A 1XDSA 2IGNA 4M9ZA 1GHCA 3CJTB 2BHZA 4R1HA 3S16J 3OS0A 3ZCOA 3HSEA 4QPOA 1FBQA 3FXMA 3OR1C 4LFUA 4QTRA 5JR3A 2R5YA 4HZFA 4EMSA 2PJRA 1U5TC 4O5VA 1YG2A 2L4AA 4Q47A 4F92B 2ECBA 2HXOA 2DQRA 1KONA 3TOBA 1B6AA 1SFEA 3S1NJ 3RYPA 5ERIA 4KN7X 2PI0A 2LR8A 4XLNF 2M9HA 1Q1HA 4A0XA 1MBHA 3GTLJ 2IP2A 5FB2A 4IHYA 4RA2A 2HPIA 3G1LA 1U5TB 3GXOA 2L7KA 3QAHA 1ULYA 1Y39A 3LA2A 2WTEA 1I39A 1OKRA 4LOCA 2PN6A 4BXFA 3RTRA 1S3JA 1XX5A 1WVRA 3BOQA 3HOSA 3ROUA 3S1RJ 2V1XA 3Q9SA 4OU0A 4CYCB 2QBYB 2E1MB 2JVHA 3R61A 2ME6A 1G8XA 3K1MA 5EGOA 2M8GX 5K1YA 3FKIJ 2HTJA 3K4BA 2WAQA 2IGKA 2CUEA 3F22A 4QIWN 3BJAA 2DJNA 3S32A 5E1XA 5E3OA 1X1BA 2D5VA 1J09A 2HDCA 2JA5J 2W1OA 3G6EI 5IOZA 2BHYA 2YX4A 3DTEA 3EETA 4FTHA 2KQRA 3A02A 5HVQC 1TL8A 1G3WA 3QYFA 1TW3A 1UZCA 4LITA 4CXFA 4XRSG 2V6CA 4A0ZA 4HPQA 2HEOA 2Z9OA 1D5VA 2EWNA 3HG9A 1UFMA 3LMMA 1F9NA 2E60A 4II2A 2E34A 5CPRB 1MNEA 1UHWA 2K9SA 5EF6A 1S9HA 2JUGA 3DF8A 1PUEE 2Y48A 5EEAA 3CP8A 4M6VA 4Z6YA 3QPTA 2A5YB 2F5VA 5DUKA 2LRDA 3MD2A 2Z99A 1Z6RA 3JTHA 2WWYA 2OTJI 4DW6A 3OYAA 3H3UA 2FF4A 4BL0B 3ECHA 4HV6A 3NAUA 3HDDA 2QENA 2XHKA 4Y7NJ 1VFCA 1W1WE 2PMZA 3K9TA 5E8IA 3S15J 1FWZA 3U9GA 3BR3A 2M2EA 1XPXA 3S93A 2HDDA 1YIOA 3LSRA 2KDOA 1G3YA 3F8CA 3A0HC 2A6HF 2GWRA 1F1ZA 5DEQA 1A6IA 1VTNC 1JTXA 4L9TA 5H20A 4H4KC 2J5PA 2Z2SB 5LEJA 1NTCA 3ZRGA 2V9VA 4BYYA 4CHUA 4H0EA 1LE8A 2X1DA 5A2QK 3L09A 3ZQLA 3CLQA 1YS7A 2Q1ZB 2Q2EB 3FMRA 1X58A 1ZREA 2MLGA 1T98A 1IRXA 5IT9K 3GTKJ 1T39A 2E36A 3CUOA 4GCVA 4L9NA 1YW8A 1MMAA 2IEKA 3GO5A 4JQFA 2X51A 3FXJA 4DYRA 3BROA 1VQ5I 1IN5A 3OYGA 4KNYA 4BH9A 1L3LA 3HOZJ 4RM2A 4DYQA 1KA8A 3E3VA 2GZWA 2X48A 5GAHJ 5HNHA 4Y3OA 4NNJA 5L3CA 5J4YA 4A3BJ 3QPHA 1XSDA 1RKTA 4C3JJ 3HHGA 1G2HA 2NVYJ 2ME0A 2STWA 4YG2F 4HA8A 3WG9A 4D5FA 1TP4A 2EJRA 2FSWA 3BPVA 2VQCA 3KFWX 3E97A 2JWTA 3HSFA 1H9TA 1J2XA 4U0VA 4CYDA 3LSPA 3GZ5A 3ZR8X 2ZJRF 4F93B 4UNOA 2HVQA 3DWLE 1FNNA 2ZFWA 1BI3A 2A69F 1WJCA 3GFJA 1VNDA 2XF5A 2VE8A 1LB2A 3RQIA 4C3HJ 3P7NA 2P6TA 2V9KA 2CQXA 2NVQJ 1VQ6I 3WODF 3IAS2 2AXTC 3A0BC 5HNFA 1TQIA 2O61A 3SEZA 2M4KA 3JSPA 3WTTC 2FU4A 3OYMA 3M1EA 1FTZA 1YHQI 3CMAI 1X3UA 1CF7A 1ORKA 1CGPA 2DA7A 4QPQA 2VQLA 4F55A 1KQ0A 5DTDA 4YFKF 3LQQA 2K7LA 1YYVA 3G1OA 1NK3P 5HLIA 4IRIA 2I5UA 3PIPF 3KE2A 1D8KA 4HSTA 3PNVA 3MZ8A 2DODA 5BMZA 3EYIA 3RZOJ 1E3PA 1S6LA 2VKDA 2P5LC 3EUAA 4Y13A 1D5YA 1B8IB 3W6VA 4Q48A 4MIMA 2HU9A 2FRHA 4YIIA 2FXAA 3SDGA 5GTHC 2G0EA 4U7BA 3B6AA 1DQUA 3BC8A 3FMSA 4B8XA 4DNCA 2LF8A 2M8EA 2VJIA 1Q1VA 2O9LA 2ZCWA 1K4TA 4EM0B 3BQYA 5D6FA 5JLXA 1SD5A 4A0YA 1I3QJ 4S0HB 3L00A 3VSKA 2B63J 1FBUA 1WSUA 1A31A 2R5YB 4M73A 2O5RA 5FD6A 2QKMB 2CYYA 2MC4A 4EM2A 4A3IJ 4XMYA 1B72A 1PYVA 5HDGA 4G94A 3WG7H 3ZQFA 2VPRA 2BE5F 4Q4ZF 1F4KA 4YIRX 3ABKH 2NS0A 2J5OA 1Z05A 1LE8B 1T6SA 3K2ZA 3G2BA 2UWMA 1T0FA 3K4JA 4F91B 4II3A 1MNMC 1S7EA 3GLLA 2OUMA 2D1VA 4RAZA 5ILVA 1IN7A 4P9FA 4AM3A 5F08A 4FETA 1TBXA 1YX3A 2HFHA 2LBFA 1RI7A 2WA0A 2KMUA 1I5ZA 1JUPA 3DCFA 4CCJA 3FXLA 4PFOA 3GTMJ 1D0YA 3K1NA 1MMDA 3V42A 3ZN0A 2DT6A 2ZKZA 3HTSB 4I2OA 1IO2A 3PFIA 2CW7A 1P6RA 4A3EJ 1J9IA 3K4NA 1TNSA 3MZHA 3R6SA 1QVUA 2JMWA 3DPUA 1O3RA 2LG4A 4HLYA 4E7ZA 4HX8A 3E5QA 4ESBA 5JHFA 1SMYF 2E19A 2UV1A 3DBRB 2NVXJ 1DU0A 4AD9A 3KP3A 2LNBA 4R79A 1VQ9I 3ZOBA 3BTLA 4M6YA 5KAIC 1R9TJ 2VN2A 3Q0UA 2ZJPF 1LDDA 5K7HA 2KKOA 2GXAA 5GAGJ 3O2PE 1MBEA 2NOGA 1EF4A 5D8KB 2CFXA 2GBYA 4OIPF 2PQ8A 2K4JA 3QQAA 2VI6A 2H6BA 3V8JA 2X0LA 3HEFA 2R7SA 3V7CA 2KZGA 4RMNA 4P5OA 5DD4A 3W6KB 3LSKA 4M3BA 4MNUA 2TCTA 1HC8A 2MH2A 5GADJ 5C44J 1EKEA 3F0CA 4ZDOA 2O8XA 2K9QA 2HDWA 3QOPA 2JZYA 5CLSA 3AAFA 1R36A 2ZJQF 4U87A 2BYVE 4J00A 1B9MA 1JGGA 2RV8A 3OSGA 1T95A 2IGOA 4LD5A 4GO1A 4WF2A 1N75A 4IJAA 2R7QA 4LG3A 3N4MA 2IBDA 2EBIA 4AIKA 2NXNB 2X1CA 1K6OA 3L9FA 2XIGA 4A2UA 1WFXA 5CVIA 3UR3C 3BZCA 4HEA2 1K78B 4OMYA 3HHHA 4X0GA 1WH7A 3O6BB 2F4MB 2X6OA 4MO7A 1ZGJA 1YW9A 1CQTA 3C3WA 3OYIA 1DPUA 1GUUA 2EA4A 1WJ5A 4RLFA 3QU3A 4MLOA 4J19A 3LFUA 3TP3A 2RNGA 1QHHD 3DLAA 2JPBA 2MW8A 5E3MA 2A5WA 5E1ZB 3GTPJ 1U9OA 4XONA 3A2KA 1BN5A 2XGEA 3HC7A 3RKYA 1WKMA 1P7IA 3N05A 1I27A 3MKLA 2JTVA 1SFXA 2WC2A 1DPRA 2JA2A 1JI8A 2UXNA 5M3MJ 3FK7A 3O8HA 3VDXA 3GMEA 1W4MA 2R5ZB 2HOEA 4G8XA 5FKMA 3E1SA 5D4SA 3X2QH 5F0HA 2VODA 2DDBA 1T0FC 4GRIA 4RGXA 4RLQA 2B9SA 2OPTA 4FHTA 2P0WA 3RI4A 1O7LA 2PBIA 2JSCA 1IN8A 3LOCA 2XGDA 2AQFA 1ZHFA 3D5SC 2XVCA 2HZTA 1O3SA 2FOKA 1JTYA 2L7ZA 4A5NA 3P9KA 3PFYA 2EZIA 4PSXA 1TWGJ 2ZMEC 4XLEA 4BQAA 4XOTA 2LP0A 1KU3A 2QKLB 5LHIA 1NG7A 3I4NJ 3J80Z 1MJBA 5F6FA 2EB7A 4XKCA 1FP1D 3LSIA 2Q8KA 1IRFA 2M30A 3HOVJ 2CS3A 4M3GA 3MZYA 1WQ2A 1D3YA 1IZ1A 5KK1A 3OS1A 4EGYA 1O3TA 5KAFC 3CC7I 1X19A 2HTSA 3ABLH 1BR4A 1GVJA 1X1DA 4RM3A 3IRQA 4I6ZA 4LK1F 3I3LA 5E8GA 1IAWA 3K1PA 2EIMH 2FBKA 3VYUB 2GA1A 1YITI 4EM1A 5E1WA 3FISA 4N4NB 1ZGAA 5HDKA 2K3FA 1X3ZB 2QWWA 4KITB 1ENHA 2E1NA 3F9KA 5DM6F 2CSOA 2XAQA 3N97A 2HQRA 4RDUA 4QWQA 2E1CA 4HNTA 1QPIA 2MD5A 2HI3A 1GV2A 4RGRA 3HBLA 1D1AA 1ZLJA 2FBHA 4L18B 3ABTA 3K6GA 5IOYA 5FRNA 1HDPA 2DXIA 2NVUB 4XKVA 3ZQQA 1IUYA 3DLLF 3ASOH 1VQMI 2DA1A 2VXZA 4KDPA 3CCJI 5D5WB 4BHPA 3SHFA 1BL0A 3C18A 1B1BA 2EIJH 5DCMA 4D9JA 1LKXA 4HRIA 2ZB9A 2ZO4A 3PSIA 1PUFA 2QF7A 4V19K 4HF1A 2HXIA 4IX7A 3HUGA 2IA1A 2IRFG 4YRVA 2L01A 2XF6A 3PSFA 3CCRI 1J75A 5FD5A 2M45A 2ADUA 1EH6A 3CUQA 3QYEA 2CWEA 1OCTC 4I01A 2VC1A 4G12A 3SZPA 1YRNA 1A04A 2VASA 3H92A 2CV2A 2FBIA 4B43A 4HNUA 1O4XA 1W7PA 1ZK8A 4ENNA 5ICCA 3FXQA 3AG1H 2LK2A 4CZCA 5BPIA 4W97A 4V2FA 2CUJA 2ESNA 3M3YJ 4CCLA 2E2JJ 3HSRA 1Z0XA 4Z2YA 3JRFA 4C2UA 1NG6A 5GP9A 4OIRF 2W85A 1QHGA 3ELKA 2DN0A 2W48A 1MBKA 1R23A 3BJ6A 3SFZA 5L3EA 2H94A 1JGSA 5ED4A 1KQ8A 3GTQJ 1IV8A 2VQHA 1Y0NA 2ZFUA 1D1BA 4O3MA 2KIFA 5EGOB 3WE2A 2KDZA 2D1HA 4A3FJ 1ZRCA 1HSTA 2HVSA 2L0KA 4CYCA 3MKYB 4A3CJ 1UELB 5ILUA 2A3SA 4IOCF 2LLKA 3MEXA 2IS4A 3JRHA 3S3OA 3DFGA 4D5CA 5DCMB 2COBA 3A01A 3HRMA 4I0AA 1V3FA 2I8DA 2O03A 4NC8A 3KYCB 3V7RA 1KZHA 4C2MJ 5J4VA 2H1LA 3B6CA 3ZN1A 3PIOF 1LFPA 2JVGA 2QQBA 2RQQA 1FSHA 2NNYA 3IH3A 2CJJA 3OYFA 2G7HA 1FOWA 3G71I 3WE3A 3ZPLA 3H3VK 2HYGD 4ZDLA 1MMNA 2IAIA 4LIVA 1WRJA 2OZUA 4HOBA 1FY7A 1E2XA 2F5DA 2CQQA 2DMPA 4QLCU 5L3GA 4HQMA 3L2WA 1FZPB 1ZH5A 3BT9A 3CF5F 4LG0B 1D1CA 2VUMJ 2FNAA 3C1DA 4BAYA 3BJOA 2KHMA 4UB8C 2BW3A 3G3ZA 2KLOA 1FIPA 2FX0A 4N4OB 4B48A 1BBYA 4D1QA 3HOWJ 1U6GA 1W5CC 1Z67A 1SAXA 1H89C 2Y31A 2ELJA 3L2QA 2L9NA 1SD4A 4EEFG 2L9RA 2EZHA 2OV7A 3KLOA 4G6QA 1GT0C 1MJAA 4EJWA 3NQOA 1U8RA 4CCNA 2BY2A 5L3FA 4ANJA 2WBMA 3EUHC 5FFXA 2NYXA 4BE2A 2IS1A 3HOTA 2K9MA 4UXNA 2VB6A 4B09A 2IPQX 1OFCX 5DM7F 3CJQB 1Y56A 3G4SI 4XSXF 1APLC 5JI6A 3OS2A 1U0JA 3MCZA 3CQZJ 2ZXHA 2DFHA 3S2WA 3S3NA 1ON1A 3OIPA 2ZXWH 5ICGA 1VQ4I 2K40A 3FBIB 3H9QA 3SFIA 2YUSA 2LKXA 3KZYA 4I09A 5DUIA 2HOAA 1WZ2A 4G9YA 3E5XA 3ULQB 2M7AA 2K85A 4XR6A 3TL4X 4OINF 1PVEA 3ZMVA 5HS7A 2PX9A 2X4HA 2P7CB 2AQEA 2LKPA 5M5WJ 1E3OC 4A3DJ 3IRRA 4MFDA 5D5UB 3IUOA 3CP2A 4V2GA 1SFUA 3KETA 4BKXA 4XIDA 1IDYA 3CMEI 1ZTRA 2P7VB 3K10A 5J3LA 5FLVA 3BLYA 2L7FP 4AIHA 1T8IA 1FYMA 5M5XJ 1GVDA 4CO8A 4BXXJ 1VQNI 4XRSA 1T56A 4S04A 4PK4A 5AIQA 1ETVA 1OYIA 4S05A 1V54H 2XRLA 4HV5A 1ZG1A 4BQNA 3RPUA 1IG7A 3HKZA 1K79A 2GOMA 1NHAA 5JHUA 2XPUA 4I76A 4XNFA 1R4NB 4XICA 1J0RA 2XKOA 5IT3A 5ICEA 4G6TB 3JRBA 4ABZA 1SAUA 2AHQA 3T0YA 1KU2A 1RNLA 2CW0F 2MABA 2XKPA 3QP5A 2EFWA 1FP2A 4UHTA 5FKKA 3J81Z 4BDYA 2CFOA 1X4PA 1BJZA 1LUJB 2KIMA 4PUSA 3MKZA 4ESJA 2CRGA 2XV4S 3GLXA 3PUBA 1OCRH 2XAGA 3T5XA 3RPUD 2X9DA 4B1RA 1ZARA 5J1YA 3P9IA 3LNQA 3O8GA 2MFZA 1QRYA 4A3KJ 3CCMI 1KQ9A 2UXXA 3GFLA 4Y33A 4ON0A 5E17F 2O8KA 1G3TA 4P1WA 2Y0MA 2JT1A 1Z1DA 2W82A 3RSNA 4BY1J 3HGYA 2YU9J 2LFBA 1LQ1A 4AUXA 4AIDA 2H6CA 2ZXJA 3LAJA 2VKVA 3L1PA 4RB2C 2P4WA 2XAJA 2BVLA 1AOYA 3U21A 4XKWA 2VJ5A 4I98B 5DDGA 1KU7A 3E0JB 4BU2A 4X1EA 1UHSA 4YFXF 2DJIA 2JA7J 3GZ6A 3TGNA 1YO5C 3OR2C 1Y0UA 3ML6A 4W1UA 1IRGA 5J47A 3KEYA 1BC8C 2K27A 1R1TA 5IP9J 3NWSA 4UUVA 2RC4A 2JPCA 4Y52J 3UNGC 1Z3XA 2HGCA 4LG0A 4JOMA 1MBFA 2H09A 5LD2C 3HRSA 5CVRA 3Q3SA 1XMKA 3RIRA 3OYDA 3O3KA 2HWVA 4A3GJ 4BS9A 3D1NI 1YI2I 5EYRA 2OZ6A 4UV9A 1FC3A 4ETSA 1RPWA 2LOOA 5CVUA 3SZGA 2EFOA 2QM3A 2OCCH 2LBFB 2G7UA 1PDNC 4PJMA 4IXAA 2YPRA 1LVAA 1POGA 2P5KA 4HX7A 3A01B 4CA0A 1MW7A 1YW7A 1YS6A 1GV5A 3BG3A 3H0GJ 2CUFA 5CVVA 3VYTB 3GYHX 3CCLI 1WJDA 2MD0A 1TZLA 3ZXSA 4RGUA 2X6YA 4OIOF 4KT5C 2HKOA 4NQWB 3FIWA 2X85A 3Q5FA 1XMAA 2RNJA 4ZYDA 3S14J 4C2TA 1MNDA 3VYRB 4OAZA 2VKEA 2GM4A 4BE1A 4KIGA 5B3SH 3I4PA 1WGXA 1I3AA 3FXRA 3IHUA 5FKNA 2IVMA 2ZSHB 2RKHA 4NHJA 3F72A 1VQ8I 2V4JC 3DU6A 4FX0A 2BW3B 1TWAJ 4KMFA 2LYCA 1V55H 1P4WA 3H5NA 1DU6A 2OCEA 2HQ5A 4WXDA 3AG4H 1IXSB 3E6MA 4C30A 1BOAA 3CUQC 5BS6A 2Y30A 2KJBA 2A6EF 4UVAA 2M1BA 3E6DA 2R92J 3GVAA 2QSGX 4JX4A 3C2HA 3BG9A 1TWCJ 1TT0A 4BXUA 3BTIA 3NRVA 3I0TA 1ZYRF 4MFEA 3FM3A 2DFIA 2JK3A 1FJLA 1RUNA 2YSRA 1HCRA 1JXSA 5FJ8J 1FT9A 3F8MA 3PUFA 2D45A 3CUQB 1AWCA 3AFHA 4UUTA 1O3QA 1VI0A 2QA4I 3KIOA 3QU6A 5KVRA 5IYBJ 2UZKA 1XG1A 2M3AA 1T08B 3QODA 3FZVA 2LY9A 3DTIA 2IW5A 1XGSA 1D0XA 4L9VA 2DDAA 4ASNA 2QGUA 2BEOA 1BM9A 1TQPA 1EA3A 2FMLA 3K0LA 2N8GA 3V4GA 1V5EA 1MIJA 5E3LA 2W84A 3HOUJ 3ZMSA 2CV1A 4LGWA 1KGSA 1ONVA 2E2HJ 1Z77A 2VL8A 4OOIA 1HA8A 2EFQA 2K9NA 4AU7A 2GXGA 2RDPA 5JFRA 2BZTA 4I99C 3JRAA 1RRJA 4E6KG 4G6DA 1FTTA 2DW4A 3EYYA 2V1DA 3MMYB 5F04A 1JHHA 1OCZH 1SC7A 1Z7UA 4PJ0C 1J59A 1XMXA 3OIQA 2COMA 1MZBA 2KIQA 3DBHB 2VBZA 1YJWI 3HPHA 2Y69H 2A61A 3TO7A 3I53A 3HUGB 5E79C 1U78A 3CMYA 4G7OF 5H2FC 3W2WA 5E18F 1AA7A 2A68F 3H35A 1P4XA 1IXCA 2KIUA 4IHTA 1OCCH 1FIAA 1C0WA 1MBJA 3Q0VA 1MMSA 3OYNA 4AYBN 5TISC 4UVCA 1WCMJ 2LC2A 5D5XB 5J8FA 2BBYA 2E7XA 5TJJA 4MTEA 1A6QA 1X2NA 2QLZA 1X1PA 2FUG2 3FXOA 2DT7B 3BY6A 3U2RA 2MSYA 4K2EA 3H0DA 1AU7A 1BA5A 3OY9A 3VEPA 4HNVA 4PZJA 1JJ6C 3GEZA 4L5JA 3FK6A 2R7ZJ 1AKHB 3NARA 1QBJA 4CICA 3DEEA 3BG6A 2F5FA 5M5YJ 4IRGA 3WHBA 5CVJA 5LEKA 1JKOC 1ACIA 5IYDJ 4RAYA 4KT6A 4CCMA 1WWXA 5FFZA 2PJPA 1OISA 1KYWA 2LMDA 4MQVA 5F64A 2XRNA 2HQNA 3R4KA 3TO6A 2CQ7A 3RDIA 1FYLA 1LDKB 1S8NA 2VLAA 2F4OB 3OYLA 4ZJZA 1PJRA 4E4HA 1HLVA 4FASD 3TP0A 1AHDP 3MFKA 2Z16A 3IH4A 1V4RA 5BNGA 4B47A 2PG4A 3HL2A 3HYIA 4B44A 3H9JA 1SVOA 4XN3A 2H1KA 3OSFA 3GFMA 1F5TA 4IO9F 2WB1N 4BBSJ 1IDZA 2VT2A 3K4KA 1U3EM 1HOMA 4YFNF 5EEGA 1OYYA 1JKPC 3ZMUA 1TNTA 2V9PA 1DDNA 4JBAA 1W36D 3JAMZ 1TWFJ 3AKZA 1H0MA 4DJAA 2L7MP 2HVRA 4KISA 5C4JJ 3W2VA 2R5ZA 1BR2A 2RREA 3S3MA 2VPLA 1A35A 1QPMA 4LJZF 2FNPA 4M9XA 2DPUA 3PQJA 4HDVA 3GFIA 5M3FJ 2FJ1A 3OYBA 3PNTA 4Q5SF 1X2MA 3DBLB 1K7AA 2M87A 1LVKA 2OC6A 1RR7A 4A93J 3J7ZI 4O6JA 2DOEA 1JHFA 3PQKA 4AC0A 2E7WA 2LDUA 3DPLC 3HM5A 1FYKA 4MEYF 3AG3H 2DA2A 1MH3A 1UJ8A 2LF7A 3ZQHA 3H36A 4L5IA 4MQ9F 3LQRA 4RS8A 1R49A 2LY1A 2DOFA 3PM1A 3QWLA 4C3IJ 1G6NA 3WTYC 2L02A 2R7UA 4BEHA 1QVTA 1W5TA 2Q0OA 4LK0F 3BR2A 3BZ6A 1BR1A 4NC7A 3LA3A 2DTZA 2LH9A 1E0EA 5HS9A 3TQNA 1EH7A 2NS7A 3FWEA 2E71A 5GPAA 5E20A 3PO3J 4WWCA 2XGCA 2B0LA 5AONA 4IQJA 4XLFA 1E3HA 3R0AA 1TC3C 5A2QZ 4PJJA 3HGGA 3I55I 1ITYA 2KRCA 3JRDA 2KISA 2VT3A 5FO5A 2KPMA 2QVOA 2VONA 3CZ6A 3VOEA 2F48A 3ZQIA 1OR7A 2BV6A 4F7ZA 1FSEA 3GF2A 4XL9A 1O7FA 4XLCA 2PJRB 2DA4A 2K5CA 1G4DA 2NRAC 3A4CA 2W00A 2C6YA 3ERED 4IHXA 3KEOA 1LJ9A 2DFEA 2QUFA 2YU3A 4X6AJ 3HRTA 1K83J 2EV5A 2KRHA 1JJ8C 1X1CA 2FE3A 3I4MJ 4EATA 5J1UA 2QSHX 4BEHB 3T8RA 3WU1B 3SQNA 2FQ4A 4DGWB 1OQYA 5K5OA 2HS5A 4DZJA 3WGHA 2QQ8A 1VQPI 4ZTJA 3RJPA 1IN6A 3QYBA 2VC0A 2XASA 1CF7B 3EDPA 1OPCA 2O0YA 2RGVA 2WV1A 1RR8C 1XSVA 1R5ID 3E5UA 1XGMA 3F3XA 1OR7C 2DBBA 1IC8A 4D7NA 2DMUA 3R0JA 3CCVI 1RESA 3ZGKA 2OF7A 2JUCA 1B72B 2IGMA 2XUBA 1J7KA 1I6XA 1X4OA 3DXJF 2V26A 1E17A 3CDIA 2A05A 3BR0A 2L3DA 1AKHA 3OL3A 3M4OJ 3IKVA 1BW5A 4DYCA 3VSLA 2MYSA 2KL4A 5FLXK 3BTCA 1B4AA 1MBGA 3K69A 3HKZN 5F1JA 4BE0A 4RGSA 4U0YA 3BG5A 3U1DA 1YOVB 3IP4B 1LPQA 5EDNA 3WGIA 2HYFA 3FKJA 1MDMA 2GLOA 3HJEA 2KP6A 1Z6TA 1SFKA 5EEHA 1HF0A 4A5MA 2ACJA 2VQGA 2PLYA 1SD7A 2K4BA 3PJRA 1I50J 1XB4A 3CO6C 3ASNH 2OQRA 3WU0A 2Y75A 3RKWA 1LNWA 2OQGA 1XSXA 2ZNZA 4NBQA 2X6XA 3JRCA 2HYJA 3RZDJ 3SZTA 3C2BA 2VJ4A 2BOLA 4DBQA 3C2GA 3SXYA 3ISPA 5DV5A 3ZMDA 2DU9A 2R7WA 3KZZA 2QQ9A 3Q0WA 4A6DA 2GXBA 2ZSIB 3DPTA 2R0QC 3CMMA 3KX2A 1HKTA 3CF2A 1WPKA 1V5GA 4BJ5C 1IGNA 1BI0A 4ENJA 5K7ZA 3M8JA 5IY5H 2GIVA 3J80K 1BJAA 1ZELA 3BTJA 2PEXA 3JREA 1HKQA 1JUMA 2PMUA 5CJ9A 4A12A 4PGGA 4LB5A 2IXSA 4KN4X 1IXRC 2DO7A 3QRFF 2G9WA 2STTA 2BGCA 1VQLI 4QSHA 1XD7A 3SEQA 2ISYA 4FE4A 2GA2A 4FQGA 3I58A 2XAFA 5E3NA 4BUPA 3TW6A 1TW2A 1RKWA 1TQMA 1FPQA 2PMZN 4WK8F 4MHGA 1R71A 2DT5A 3I54A 3FX3A 4XKBA 1YIJI 3CCUI 4PDKA 2JN6A 2DYRH 2E5ZA 2L9SA 4KIBA 1B8IA 1OCOH 2Y9YA 5FLXZ 1USSA 4IKFA 2EFNA 4YELA 1V5FA 3ERMA 2EQRA 3KP7A 5ILSA 3FHZA 4LLNA 3G73A 1HKSA 2ZXIA 3Q9VA 4HDUA 4G7HF 5FKOA 1GXQA 2E35A 4GYGA 4BGDA 4LB6B 3TO9A 3W6JB 4XK4A 1KYZA 3BCAA 1RZ4A 1WJFA 4BHBA 2V1UA 3MWMA 1BI1A 1MD0A 4IF4A 3WTUC 1B59A 1R00A 2QYOA 1DGWY 5F0FA 1R4MB 4CH7A 1VQ7I 1YX5A 3T1BA 3K4LA 3WTZA 2EZLA 3DU5A 1RETA 2WY7Q 4P96A 3FXKA 1U2WA 2BY3A 1QNTA 3BR6A 3GTOJ 2Y0SA 4HX4A 4NUBA 4ZC3A 4AIJA 4ENMA 1HW2A 1W7PD 2EINH 1T38A 2EZKA 2CU7A 1SEUA 2W57A 3COAC 1JKRC 4U7DA 4M3DA 2P6SA 1QZZA 5LRSA 2ESHA 3IKTA 3H5AA 3L2CA 1NH3A 2Z5UA 1WHUA 4F3QA 2Q2EA 1DGRM 4JX6A 1K4SA 1WJAA 3TOAA 2GQQA 5DYMA 2O6GE 4WXHA 2DOAA 1QGPA 4XLPF 1DUXC 1RIOH 3BR1A 3M8EA 4JX5A 3EUHA 5F0CA 5KHDA 3JRIA 5K5QA 2CUZA 2EILH 1M1EB 1TWHJ 3DP7A 3GX4X 3E7LA 5FLMJ 1ETQA 3CLOA 2A6TA 4NQWA 1U8BA 3F8FA 3M9AA 4UV8A 1R1VA 2NVTJ 1IF1A 5BQTA 5B1AH 2W24A 4E7LA 3FM5A 1LEAA 3L2VA 4CCOA 5CYVA 4F52A 1DP3A 2LD5A 1BOBA 4E7JA 3OYJA 3SJMA 3B02A 5J6XA 5K5RA 1ZR2A 2HQAA 2ZBKA 2B7EA 2CH0A 2Z3YA 3HIFA 3BP8A 1ERDA 5C3EJ 4G7ZF 3K70C 3U1KA 4ZYGA 1XDUA 4WXCA 3ZQGA 4LLLA 2XF7A 1JT6A 4BNCA 5KCMA 2EV0A 3OL4A 5TRDA 1MSEC 2XPVA 2ZNYA 3HB9A 1UCRA 3LSJA 1FBSA 2M34A 4GGGA 3W2AA 1UMQA 4GDFA 3MAJA 1X1AA 2V6EA 1Z3YA 5TGTA 2BY0A 4XORA 5HDNA 4WX9A 1MJ9A 1XTAA 2V1NA 4A3MJ 2D2WA 2HKXA 2A07F 1MMGA 1VZ0A 1UG2A 3PNYA 2MC3A 2EIKH 3LAPA 1Z9CA 1LDJA 1ZQ3P 2VXDA 3HZJA 3TDZC 3NEUA 4B3AA 2DA6A 3BG7A 5F27A 2P5VA 2MA3A 3K4CA 3JAMK 3G1MA 3H1CA 3GTGJ 1I6HJ 2M4GA 1SANA 1S29A 2RN7A 4M74A 3FXUA 2EH3A 3TBIA 2M0CA 4Y15A 3K7AJ 1HBXG 4IVNA 4RB3C 1WJBA 2ELKA 2O7OA 3LA7A 3OMYA 1IRZA 1U5TA 1I1GA 2CV0A 1K61A 1IUFA 3WTWC 2WB1A 2H27A 2JRTA 2GOXB 4HW0A 1QU3A 2I10A 2LREA 5IP6A 2R7FA 4EVIA 2KFDA 1SVLA 2CMPA 4IEJA 4E7KA 2NAZA 1ZLKA 1N77A 4P55A 2FQ3A 2IT0A 2HZDA 2M5WA 3DKWA 3JCUC 4L5EA 3L2UA 3OWTA 2IS2A 4BHCA 1R5HA 1R7JA 2X1EA 3E6CC 1GDTA 4XSZF 3WU2C 4JP0A 3ZQCA 9ANTA 1Y1WJ 1UAAA 3LSGA 4IL6C 4E7IA 2VOOA 3VPRA 2HOSA 2E1OA 4BACA 1XC5A 4M72A 1SD6A 5L3BA 1R22A 1Y6IA 3DQVC 4NC6A 3IL2A 4U0WA 3KP6A 2V7FA 3JRGA 2BXZA 3FDYA 2QBYA 1S7OA 2L4MA 1OLTA 3ONQA 2CO5A 2WAQN 3OYHA 2MG4A 1OJLA 5LGNA 2HOTA 3DKYA 3HPGA 4L0ZB 1N25A 3CJNA 3WTVC 1HSJA 3MVPA 4HSRA 3VFZA 2JQ7A 2MBFA 2W25A 2BVMA 4AVZA 4A69C 1D0ZA 3OOUA 2DLLA 3OV8A 1RC9A 3DV8A 2KZVA 4XBFA 4BBRJ 3V8LA 3JW4A 1R58A 4A6EA 3M1CA 4EV0A 5HOOA 1QZYA 2Y9ZA 1SMTA 4L9JA 5L3DA 2LKSA 2YS9A 3JTGA 3CC2I 3BCBA 3IC7A 1Y1VJ 4KJZA 3IWZA 4CDGA 3OYEA 5CQEA 4XQFA 2WADA 3J81K 1Z91A 1VQKI 4LMYA 4OAYA 4Y4RA 1FLIA 4M71A 2BXYA 5FKLA 3FHNA 4FE7A 3I5UA 1H88C 4AVPA 1L0OC 1HQCA 2R7OA 5B66C 1KU9A 3GWZA 4M6XA 4RB0A 3BZKA 1W0TA 4PSWA 4JYKA 2L5QA 5IYCJ 1YJNI 2RVCA 5HLGA 3KP5A 5HLHA 3BR5A 3ZQ7A 3V8KA 1TLHB 1ZRDA 1N78A 3A03A 2DA5A 5J8CA 1OMIA 4ZYHA 2LSOA 3CCYA 3FMQA 3I59A 1ETKA 1XS9A 3ABUA 4TV7A 3LFKA 4CCKA 4IHVA 2R7XA 4CSWA 4I7HA 4NB5A 3HTUA 4BJTA 2RQPA 2TDXA 2R7VA 3I59B 4HYEA 3S2HJ 5EZGA 2YR2A 4AWXB 3I9V2 2DK5A 2VBYA 2KT0A 2OU2A 3EPZA 4UUSA 2OJED 3S2DJ 1R5GA 3W3CA 4EJUA 3CCQI 3DTKA 4CZZA 5D5VB 2WAFA 2HR3A 1PP7U 1VQOI 5BPDA 2F5CA 4UVBA 1EV7A 1JT0A 2WAEA 3JR9A 1LFUP 4IQ4A 4XLAA 3L7WA 3AL0C 3K2AA 2O3FA 3BPXA 2FOWA 2K86A 3HRUA 3RCOA 1HW1A 3H9GA 3I64A 4BJ6C 1S72I 3K70D 1F43A 2IA2A 1S5LC 1XCBA 4PJLA 1TT5B 2M7BA 2ETHA 2R93J 2P8TA 3QPSA 2DYSH 3OYKA 3KZIC 3LSTA 3I56I 1H9GA 2XC7A 2WV0A 3R60A 4XOPA 4KIFA 2H8WA 3KP4A 1BW6A 4D0PA 2FD5A 4OIQF 3LL7A 5CQGA 1W0UA 2E5NA 2JA8J 3KP2A 5C4XJ 3J7AY 4PGHA 2AXLA 2PMHA 4BDZA 1WI3A 2OBPA 2XGXA 3MQ0A 2EA2A 1YFHA 4LIUA 4E70A 4PCQA 3D5LA 4CGZA 3J7YJ 1FOXA 4GXOA 3HOYJ 3IWFA 3K4MA 4ZYEA 1ZN2A 2KJCA 1YQAA 5LGUA 1FEXA 5B1BH 1D8JA 1YLFA 1FX7A 4E7HA 3M7GA 2K3PA 2XB0X 4HLXA 3SDBA 4HG2A 2ZMEA 3MKWB 3J7AO 2DMNA 1ODDA 4PFPA 1G3SA 2DMQA 2QQAA 1XGOA 2ELHA 3M07A 1W7PB 4ZTFA 4JK1X 3D5RC 1ON2A 2XAHA 3UKGA 2DFFA 4N9IA 4J01A 1YRNB 2JSPA 3TMOA 4E7SA 3PO2J 1U9NA 2F4IA 4WCGA 2K02A 2CQKA 2MH9A 1IV6A 3H5RA 3RPQA 4YEJA 3S8PA 2L9VA 2V79A 4OMZA 5HS8A 1P2FA 1Z21A 3GZNB 4FCYA 1ETOA 3S1QJ 3M8FA 5ICFA 2XSDC 1PUFB 5JVGF 4XRMA 1LEBA 5DCFA 4IOAF 4UY8I 2W7NA 1HXDA 4N9HA 3ABMH 2YX7A 5EG0B 4KUMA 4HQEA 2ECCA 2LTPA 1QO0D 2OTLI 2QZ8A 4FISA 3IAM2 2F2EA 1TTYA 2XPWA 3TW7A 5D8LB 4XLHA 1QA6A 2DA3A 1SVMA 2GAUA 1USTA 1STZA 1Z7LA 1EH8A 1I1SA 4ZDPA 3JSOA 3E6BA 3WTSC 1YJ9I 1IJWC 3WTXC 3GW2A 3DEWA 4BY7J 2WY8Q 1YTYA 1YE9A 2DCEA 2E1MC 2ZJ2A 4KA4A 2R7RA 3CO7C 2Z1DA 4A3LJ 2VBXA 1WJEA 2XSJC 5EZHA 1UB9A 5CKTA 4IHSA 2IJLA 4ENKA 4KYWA 4MEXF 1P9QC 3CDHA 4DZPA 2XROA 4RB1A 4CUGA 5K7FA 5EG0A 4DIQA 2E2IJ 3TKYA 2OD5A 1DP7P 2ID6A 3FF5A 3SYTA 1XN7A 3VB2A 2R3SA 3CC4I 2DMTA 3F8NA 4ZYAA 2QSFX 3C7JA 3LSMA 3IH2A 5IPAA 5LBQA 3CD6I 4BQOA 1R1UA 1P92A 5JVTA 3HXLA 1XCVA 3KYDB 2MLKA
chains in the Genus database with same CATH topology
4U88A 5LHHA 4DQ2A 1W5SA 4ZZDA 3RKXA 3BWGA 3QP6A 4XRFA 2IA0A 1MKMA 1P4AA 1IN4A 2ZMEB 4I02A 5LLQA 5LRRA 4ESFA 4EQQA 1ZAOA 2DTRA 3D0SA 3F23A 1IW7F 5H6QA 1REPC 3F21A 3LWFA 1XGNA 3B73A 4EJOA 4HBLA 1ZRFA 4EGZA 4FT8A 2CGPA 2EFPA 2CG4A 2DAOA 5AIPA 1BC7C 2NNNA 2KRFA 3VODA 1K78A 1HW5A 4HF2A 3GUDA 4IRHA 3F8BA 3ZMZA 1ZG5A 1O57A 1UHMA 1BI2A 1ZG3A 3BDDA 3DEUA 1FOKA 3ZP5A 3OOPA 3F6OA 1QQIA 3TDUC 1OYWA 4LLGF 2OAZA 3RYRA 2DI3A 2FEZA 3WGGA 2ISZA 6PAXA 2PFBA 1RUOA 4KICA 1BIAA 4ZH4F 2VOPA 3CTAA 2OA4A 1T2KA 4EJVA 4HF0A 1J5YA 4KMUX 5F1RA 5FGMA 2DK8A 4R8HA 3F6VA 3KCCA 1XCVA 2R7DA 3P9CA 5D6EA 3H3ZA 2EV6A 4ZZLA 2VE9A 4N0BA 5IT9Z 4L0YB 4MTDA 1B9NA 2DQLA 3V7SA 1MDMB 2FMYA 4GYIA 4FX4A 4YIFA 3ECOA 4Y17A 1WI9A 1S7AA 4MGRA 5BOXA 1MGTA 2AS5F 2L54A 2Z33A 3EQLF 3KLNA 5DD8A 2DPDA 1BIBA 2F5EA 1PP8F 2EK5A 2FA5A 4KFCA 2VBWA 3I71A 1JE8A 4EJTA 4P9UA 4HAMA 3KEQA 3T8TA 5D4RA 3REOA 1GXPA 5LHGA 4M9SA 5LGTA 3ZMTA 4I0BA 5H6RA 4IPAA 1XDSA 4M9ZA 1GHCA 4R1HA 3HSEA 1FBQA 4LFUA 5JR3A 4HZFA 4EMSA 1U5TC 4O5VA 1YG2A 2L4AA 4Q47A 2DQRA 3TOBA 1B6AA 1SFEA 3RYPA 5ERIA 4KN7X 2PI0A 4XLNF 1Q1HA 4A0XA 2IP2A 5FB2A 1U5TB 3GXOA 3QAHA 1ULYA 3LA2A 2WTEA 1OKRA 2PN6A 3RTRA 1S3JA 3BOQA 3HOSA 2QBYB 3ROUA 2V1XA 3Q9SA 4OU0A 3R61A 3K1MA 5K1YA 2HTJA 3F22A 3BJAA 5E1XA 2HDCA 2YX4A 3EETA 5HVQC 1G3WA 4CXFA 1TW3A 2V6CA 4A0ZA 2HEOA 1D5VA 2Z9OA 2EWNA 1UFMA 1F9NA 1UHWA 1PUEE 3DF8A 2Y48A 3QPTA 2A5YB 5DUKA 2Z99A 1Z6RA 3JTHA 2WWYA 3H3UA 2FF4A 3ECHA 4HV6A 2QENA 2XHKA 3K9TA 5E8IA 1FWZA 3U9GA 1YIOA 1G3YA 3F8CA 2A6HF 2GWRA 1F1ZA 5DEQA 1VTNC 4L9TA 5H20A 2J5PA 5LEJA 4BYYA 2V9VA 4CHUA 4H0EA 5A2QK 3L09A 1YS7A 3FMRA 1ZREA 2MLGA 1T98A 5IT9K 1T39A 3CUOA 4GCVA 4L9NA 1YW8A 3GO5A 4JQFA 3BROA 1IN5A 4KNYA 4BH9A 1L3LA 1KA8A 3E3VA 2GZWA 5L3CA 3QPHA 1XSDA 3HHGA 2STWA 4YG2F 4HA8A 3WG9A 2EJRA 2FSWA 3BPVA 3KFWX 3E97A 3HSFA 1H9TA 1J2XA 4U0VA 4CYDA 3GZ5A 4UNOA 1FNNA 1BI3A 2A69F 2ZFWA 3GFJA 2VE8A 1LB2A 3P7NA 2P6TA 3WODF 1TQIA 2O61A 3JSPA 3WTTC 2FU4A 3M1EA 1X3UA 1CF7A 1CGPA 1KQ0A 4YFKF 2K7LA 1YYVA 5HLIA 4IRIA 3KE2A 1D8KA 5BMZA 3EYIA 1S6LA 2P5LC 4Y13A 4Q48A 2FRHA 4YIIA 2FXAA 4U7BA 4DNCA 3FMSA 4B8XA 2LF8A 2M8EA 2ZCWA 4EM0B 5D6FA 1SD5A 4A0YA 3L00A 1WSUA 1FBUA 4M73A 5FD6A 4EM2A 2CYYA 5HDGA 4G94A 2BE5F 4Q4ZF 1F4KA 2NS0A 2J5OA 1Z05A 1T6SA 3K2ZA 2UWMA 1T0FA 2D1VA 4RAZA 5ILVA 1IN7A 4P9FA 1TBXA 2HFHA 1RI7A 1I5ZA 3K1NA 3ZN0A 2ZKZA 3HTSB 4I2OA 3PFIA 1P6RA 1J9IA 1TNSA 3MZHA 3R6SA 1O3RA 4HLYA 4HX8A 3E5QA 4ESBA 1SMYF 4AD9A 3KP3A 2LNBA 4R79A 4M6YA 2VN2A 1LDDA 2KKOA 3O2PE 5D8KB 2CFXA 4OIPF 2PQ8A 2K4JA 2H6BA 3V8JA 2X0LA 3V7CA 4P5OA 5DD4A 3W6KB 4MNUA 2MH2A 2O8XA 3QOPA 2JZYA 5CLSA 3AAFA 1R36A 2BYVE 1B9MA 2RV8A 4LD5A 4GO1A 4WF2A 4IJAA 3N4MA 4AIKA 1K6OA 3L9FA 2XIGA 2MLKA 4A2UA 5CVIA 1K78B 4OMYA 3HHHA 3O6BB 1ZGJA 1YW9A 3C3WA 1DPUA 2EA4A 3QU3A 2JPBA 5E1ZB 1BN5A 3RKYA 1WKMA 1I27A 2JTVA 1SFXA 2WC2A 1DPRA 2UXNA 1W4MA 2HOEA 4G8XA 5D4SA 2VODA 4RGXA 4FHTA 3RI4A 1O7LA 2PBIA 2JSCA 1IN8A 1ZHFA 2XVCA 2HZTA 1O3SA 2FOKA 4A5NA 3P9KA 4BQAA 1KU3A 5LHIA 3J80Z 1MJBA 5F6FA 2EB7A 2Q8KA 1FP1D 1IRFA 2M30A 1O3TA 3MZYA 1WQ2A 1D3YA 1IZ1A 5KK1A 4EGYA 2HTSA 1GVJA 3IRQA 4LK1F 5E8GA 1IAWA 3K1PA 2FBKA 2GA1A 4EM1A 5E1WA 1ZGAA 5HDKA 2QWWA 2E1NA 2CSOA 2XAQA 3N97A 2HQRA 4QWQA 2E1CA 2MD5A 4RGRA 4L18B 1ZLJA 2FBHA 3ABTA 1IUYA 2VXZA 4KDPA 5D5WB 4BHPA 3SHFA 1B1BA 3C18A 5DCMA 2ZO4A 4HF1A 3HUGA 2IA1A 2IRFG 2L01A 1J75A 5FD5A 2M45A 2ADUA 1EH6A 3CUQA 2CWEA 4I01A 2VC1A 3SZPA 1A04A 3H92A 2FBIA 1W7PA 4ENNA 5ICCA 3FXQA 5BPIA 2ESNA 3HSRA 4Z2YA 4OIRF 2W85A 3ELKA 1R23A 3BJ6A 3SFZA 5L3EA 2H94A 1JGSA 5ED4A 1KQ8A 4O3MA 2KIFA 3WE2A 2D1HA 1ZRCA 1HSTA 5ILUA 2A3SA 3MEXA 3DFGA 5DCMB 3HRMA 4I0AA 1V3FA 2O03A 3V7RA 3ZN1A 2QQBA 1FSHA 2NNYA 2G7HA 3WE3A 3ZPLA 2HYGD 1WRJA 2OZUA 4HOBA 1FY7A 1E2XA 2F5DA 4QLCU 5L3GA 4HQMA 1FZPB 1ZH5A 4LG0B 2FNAA 3C1DA 4BAYA 3BJOA 3G3ZA 1BBYA 1U6GA 1SAXA 1SD4A 3KLOA 4G6QA 1MJAA 4EJWA 3NQOA 1U8RA 5L3FA 5FFXA 2NYXA 3HOTA 4UXNA 4B09A 2IPQX 4XSXF 5JI6A 3MCZA 3S2WA 1ON1A 5ICGA 3KZYA 4I09A 5DUIA 4G9YA 3E5XA 3ULQB 4OINF 3ZMVA 5HS7A 2X4HA 2P7CB 2LKPA 3IRRA 5D5UB 1SFUA 3KETA 2P7VB 4AIHA 1FYMA 4CO8A 4S04A 5AIQA 1OYIA 4S05A 4HV5A 1ZG1A 3RPUA 1K79A 1NHAA 5JHUA 1J0RA 2XKOA 5IT3A 5ICEA 3T0YA 1KU2A 3QP5A 1RNLA 2CW0F 2XKPA 2EFWA 1FP2A 4UHTA 3J81Z 4ESJA 2KIMA 2XV4S 3GLXA 2XAGA 3T5XA 1ZARA 3P9IA 1KQ9A 2UXXA 3GFLA 4ON0A 5E17F 1G3TA 2Y0MA 2JT1A 1Z1DA 1LQ1A 2H6CA 2ZXJA 3LAJA 4RB2C 2P4WA 2XAJA 1AOYA 4I98B 5DDGA 1KU7A 4YFXF 3GZ6A 3TGNA 1YO5C 1Y0UA 3ML6A 1IRGA 1BC8C 2K27A 1R1TA 4UUVA 2RC4A 2JPCA 2HGCA 4LG0A 2H09A 3HRSA 5CVRA 1XMKA 3RIRA 3O3KA 2HWVA 2OZ6A 4UV9A 1FC3A 4ETSA 5CVUA 2EFOA 2QM3A 2G7UA 1PDNC 4IXAA 2YPRA 1LVAA 2P5KA 4HX7A 1YW7A 1YS6A 3GYHX 5CVVA 4RGUA 4OIOF 4KT5C 2HKOA 3Q5FA 1XMAA 2RNJA 4ZYDA 4KIGA 3I4PA 3FXRA 3IHUA 2IVMA 2RKHA 4NHJA 3F72A 4FX0A 4KMFA 1P4WA 4WXDA 1IXSB 3E6MA 1BOAA 3CUQC 5BS6A 2KJBA 2A6EF 4UVAA 2M1BA 3E6DA 3GVAA 4BXUA 3NRVA 3I0TA 1ZYRF 3FM3A 2DFIA 1RUNA 2YSRA 1JXSA 1FT9A 3F8MA 2D45A 3CUQB 1AWCA 1O3QA 3QU6A 5KVRA 2UZKA 3FZVA 2IW5A 1XGSA 4L9VA 4ASNA 2BEOA 1BM9A 1TQPA 2FMLA 3K0LA 3V4GA 2W84A 3ZMSA 4LGWA 1KGSA 1ONVA 4OOIA 2EFQA 2GXGA 2RDPA 5JFRA 4G6DA 2DW4A 3EYYA 2V1DA 1JHHA 1Z7UA 1J59A 2COMA 1MZBA 2VBZA 2A61A 3TO7A 3I53A 1U78A 4G7OF 5E18F 2A68F 1P4XA 1IXCA 2KIUA 4IHTA 1C0WA 4UVCA 5D5XB 5J8FA 2BBYA 2E7XA 5TJJA 4MTEA 2QLZA 3BY6A 3U2RA 4K2EA 3VEPA 4PZJA 3GEZA 4L5JA 1QBJA 4CICA 2F5FA 4IRGA 5CVJA 5LEKA 4RAYA 1WWXA 5FFZA 2PJPA 1KYWA 4MQVA 5F64A 3TO6A 2XRNA 2HQNA 3R4KA 3RDIA 1FYLA 1LDKB 1S8NA 3MFKA 1V4RA 2PG4A 3HYIA 3GFMA 1F5TA 2VT2A 1U3EM 4YFNF 5EEGA 1OYYA 3ZMUA 1TNTA 1DDNA 4JBAA 3JAMZ 1H0MA 1QPMA 4LJZF 2FNPA 4M9XA 2DPUA 3PQJA 4HDVA 3GFIA 4Q5SF 1K7AA 2M87A 4O6JA 1JHFA 3PQKA 2E7WA 2LDUA 3DPLC 1FYKA 4MEYF 2LF7A 4L5IA 4MQ9F 3LQRA 4RS8A 3WTYC 1G6NA 2L02A 1W5TA 2Q0OA 4LK0F 3BZ6A 3LA3A 5HS9A 3TQNA 1EH7A 3FWEA 5E20A 4WWCA 2B0LA 5AONA 3R0AA 5A2QZ 2VT3A 5FO5A 2QVOA 2VONA 3VOEA 4F7ZA 1OR7A 2BV6A 1FSEA 3GF2A 1O7FA 1G4DA 2NRAC 2C6YA 3ERED 3KEOA 1LJ9A 2YU3A 2QUFA 3HRTA 2EV5A 2FE3A 3T8RA 3WU1B 3SQNA 5K5OA 2HS5A 3WGHA 3RJPA 1IN6A 2VC0A 2XASA 1CF7B 3EDPA 1OPCA 2O0YA 2RGVA 1XSVA 3E5UA 1XGMA 3F3XA 2DBBA 3R0JA 2XUBA 1J7KA 1I6XA 3DXJF 1E17A 2L3DA 3IKVA 5FLXK 1B4AA 3K69A 4RGSA 4U0YA 3U1DA 3WGIA 2HYFA 1MDMA 1Z6TA 5EEHA 4A5MA 2ACJA 2PLYA 1SD7A 2K4BA 1XB4A 3CO6C 2OQRA 3WU0A 2Y75A 3RKWA 1LNWA 2OQGA 1XSXA 2ZNZA 3SZTA 3J81K 3ZMDA 3SXYA 3ISPA 5DV5A 2DU9A 3KZZA 2QQ9A 4A6DA 2GXBA 3DPTA 1HKTA 1BI0A 4ENJA 2GIVA 3J80K 1BJAA 2PEXA 1HKQA 2PMUA 5CJ9A 4A12A 4LB5A 4PGGA 4KN4X 1IXRC 2DO7A 3QRFF 2G9WA 2STTA 2BGCA 1XD7A 2ISYA 2GA2A 3I58A 2XAFA 1TW2A 1TQMA 1FPQA 4WK8F 4MHGA 2DT5A 3I54A 3FX3A 4PDKA 4KIBA 5FLXZ 1USSA 2EFNA 5ILSA 3FHZA 3KP7A 4LLNA 3G73A 1HKSA 3Q9VA 4HDUA 4G7HF 1GXQA 4GYGA 4LB6B 3TO9A 3W6JB 1KYZA 1RZ4A 4BHBA 2V1UA 3MWMA 1BI1A 1MD0A 4IF4A 3WTUC 1B59A 1R00A 2QYOA 3T1BA 3WTZA 4P96A 1U2WA 1QNTA 4HX4A 4AIJA 4ENMA 1HW2A 1W7PD 1T38A 2W57A 3COAC 4U7DA 2P6SA 1QZZA 5LRSA 2ESHA 3IKTA 3L2CA 2Z5UA 2Q2EA 3TOAA 2GQQA 5DYMA 2O6GE 4WXHA 1QGPA 4XLPF 1DUXC 1RIOH 3M8EA 3EUHA 5K5QA 3DP7A 3GX4X 3CLOA 4NQWA 3F8FA 3M9AA 4UV8A 1R1VA 1IF1A 5BQTA 2W24A 3FM5A 1LEAA 5CYVA 3B02A 5J6XA 5K5RA 2ZBKA 2Z3YA 3HIFA 3BP8A 4G7ZF 4ZYGA 1XDUA 4WXCA 4LLLA 4BNCA 5TRDA 2EV0A 2ZNYA 1UCRA 1FBSA 4GGGA 3MAJA 4WX9A 5HDNA 1MJ9A 2D2WA 2HKXA 2A07F 3LAPA 1Z9CA 2MC3A 1LDJA 3TDZC 3NEUA 2P5VA 2MA3A 3JAMK 1S29A 2RN7A 4M74A 3FXUA 4Y15A 1HBXG 4IVNA 4RB3C 3LA7A 1U5TA 1I1GA 3WTWC 2H27A 2JRTA 4HW0A 2R7FA 4EVIA 1ZLKA 2NAZA 4P55A 2FQ3A 2IT0A 2M5WA 3DKWA 4BHCA 1R5HA 1R7JA 3E6CC 4XSZF 2VOOA 4M72A 1SD6A 5L3BA 1R22A 3IL2A 3DQVC 4U0WA 3KP6A 2QBYA 1S7OA 2L4MA 2CO5A 4L0ZB 3WTVC 3CJNA 1HSJA 3VFZA 2MBFA 2W25A 3OV8A 2DLLA 3DV8A 4XBFA 3V8LA 3JW4A 1R58A 4A6EA 4EV0A 5HOOA 1QZYA 1SMTA 4L9JA 5L3DA 3JTGA 3IC7A 4CDGA 3IWZA 1Z91A 4LMYA 1FLIA 4M71A 3I5UA 4AVPA 1L0OC 1HQCA 1KU9A 3GWZA 4M6XA 4RB0A 2RVCA 5HLGA 3KP5A 5HLHA 1ZRDA 3ZQ7A 3V8KA 1TLHB 5J8CA 1OMIA 4ZYHA 2LSOA 3FMQA 3I59A 3ABUA 4TV7A 3LFKA 4I7HA 4NB5A 3HTUA 2RQPA 2TDXA 3I59B 4HYEA 2YR2A 4AWXB 2DK5A 2VBYA 2OU2A 1R5GA 4EJUA 4CZZA 5D5VB 2HR3A 1PP7U 5BPDA 2F5CA 4UVBA 1EV7A 3L7WA 2O3FA 3BPXA 2K86A 3HRUA 1HW1A 3I64A 2IA2A 1XCBA 2ETHA 2P8TA 3LSTA 1H9GA 2WV0A 3R60A 4KIFA 3KP4A 4D0PA 4OIQF 3KP2A 4PGHA 2AXLA 2PMHA 3MQ0A 2OBPA 2XGXA 1YFHA 2EA2A 4E70A 4PCQA 3D5LA 4CGZA 4GXOA 3IWFA 4ZYEA 1ZN2A 2KJCA 1YQAA 5LGUA 1D8JA 1YLFA 1FX7A 3M7GA 4HLXA 2ZMEA 3J7AO 1ODDA 1G3SA 2QQAA 1XGOA 2ELHA 1W7PB 4JK1X 1ON2A 2XAHA 4N9IA 4WCGA 2K02A 2CQKA 2MH9A 3RPQA 2V79A 4OMZA 5HS8A 1P2FA 3M8FA 5ICFA 1LEBA 5DCFA 1HXDA 4N9HA 2YX7A 4KUMA 4HQEA 1QO0D 2QZ8A 2F2EA 1TTYA 5D8LB 2GAUA 1USTA 1STZA 1EH8A 1I1SA 3JSOA 3E6BA 3WTSC 3WTXC 3GW2A 1YTYA 2ZJ2A 4KA4A 3CO7C 2VBXA 4IHSA 1UB9A 2IJLA 4ENKA 4KYWA 4MEXF 3CDHA 2XROA 4RB1A 3TKYA 2OD5A 1DP7P 3FF5A 1XN7A 3VB2A 2R3SA 3F8NA 3C7JA 5LBQA 1R1UA 1P92A 5JVTA 5LGNA 3LQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U88 A;  5LHH A;  4DQ2 A;  1W5S A;  4ZZD A;  3RKX A;  3BWG A;  3QP6 A;  4XRF A;  2IA0 A;  1MKM A;  1P4A A;  1IN4 A;  2ZME B;  4I02 A;  5LLQ A;  5LRR A;  4ESF A;  4EQQ A;  1ZAO A;  2DTR A;  3D0S A;  3F23 A;  1IW7 F;  5H6Q A;  1REP C;  3F21 A;  3LWF A;  1XGN A;  3B73 A;  4EJO A;  4HBL A;  1ZRF A;  4EGZ A;  4FT8 A;  2CGP A;  2EFP A;  2CG4 A;  2DAO A;  5AIP A;  1BC7 C;  2NNN A;  2KRF A;  3VOD A;  1K78 A;  1HW5 A;  4HF2 A;  3GUD A;  4IRH A;  3F8B A;  3ZMZ A;  1ZG5 A;  1O57 A;  1UHM A;  1BI2 A;  1ZG3 A;  3BDD A;  3DEU A;  1FOK A;  3ZP5 A;  3OOP A;  3F6O A;  1QQI A;  3TDU C;  1OYW A;  4LLG F;  2OAZ A;  3RYR A;  2DI3 A;  2FEZ A;  3WGG A;  2ISZ A;  6PAX A;  2PFB A;  1RUO A;  4KIC A;  1BIA A;  4ZH4 F;  2VOP A;  3CTA A;  2OA4 A;  1T2K A;  4EJV A;  4HF0 A;  1J5Y A;  4KMU X;  5F1R A;  5FGM A;  2DK8 A;  4R8H A;  3F6V A;  3KCC A;  1XCV A;  2R7D A;  3P9C A;  5D6E A;  3H3Z A;  2EV6 A;  4ZZL A;  2VE9 A;  4N0B A;  5IT9 Z;  4L0Y B;  4MTD A;  1B9N A;  2DQL A;  3V7S A;  1MDM B;  2FMY A;  4GYI A;  4FX4 A;  4YIF A;  3ECO A;  4Y17 A;  1WI9 A;  1S7A A;  4MGR A;  5BOX A;  1MGT A;  2AS5 F;  2L54 A;  2Z33 A;  3EQL F;  3KLN A;  5DD8 A;  2DPD A;  1BIB A;  2F5E A;  1PP8 F;  2EK5 A;  2FA5 A;  4KFC A;  2VBW A;  3I71 A;  1JE8 A;  4EJT A;  4P9U A;  4HAM A;  3KEQ A;  3T8T A;  5D4R A;  3REO A;  1GXP A;  5LHG A;  4M9S A;  5LGT A;  3ZMT A;  4I0B A;  5H6R A;  4IPA A;  1XDS A;  4M9Z A;  1GHC A;  4R1H A;  3HSE A;  1FBQ A;  4LFU A;  5JR3 A;  4HZF A;  4EMS A;  1U5T C;  4O5V A;  1YG2 A;  2L4A A;  4Q47 A;  2DQR A;  3TOB A;  1B6A A;  1SFE A;  3RYP A;  5ERI A;  4KN7 X;  2PI0 A;  4XLN F;  1Q1H A;  4A0X A;  2IP2 A;  5FB2 A;  1U5T B;  3GXO A;  3QAH A;  1ULY A;  3LA2 A;  2WTE A;  1OKR A;  2PN6 A;  3RTR A;  1S3J A;  3BOQ A;  3HOS A;  2QBY B;  3ROU A;  2V1X A;  3Q9S A;  4OU0 A;  3R61 A;  3K1M A;  5K1Y A;  2HTJ A;  3F22 A;  3BJA A;  5E1X A;  2HDC A;  2YX4 A;  3EET A;  5HVQ C;  1G3W A;  4CXF A;  1TW3 A;  2V6C A;  4A0Z A;  2HEO A;  1D5V A;  2Z9O A;  2EWN A;  1UFM A;  1F9N A;  1UHW A;  1PUE E;  3DF8 A;  2Y48 A;  3QPT A;  2A5Y B;  5DUK A;  2Z99 A;  1Z6R A;  3JTH A;  2WWY A;  3H3U A;  2FF4 A;  3ECH A;  4HV6 A;  2QEN A;  2XHK A;  3K9T A;  5E8I A;  1FWZ A;  3U9G A;  1YIO A;  1G3Y A;  3F8C A;  2A6H F;  2GWR A;  1F1Z A;  5DEQ A;  1VTN C;  4L9T A;  5H20 A;  2J5P A;  5LEJ A;  4BYY A;  2V9V A;  4CHU A;  4H0E A;  5A2Q K;  3L09 A;  1YS7 A;  3FMR A;  1ZRE A;  2MLG A;  1T98 A;  5IT9 K;  1T39 A;  3CUO A;  4GCV A;  4L9N A;  1YW8 A;  3GO5 A;  4JQF A;  3BRO A;  1IN5 A;  4KNY A;  4BH9 A;  1L3L A;  1KA8 A;  3E3V A;  2GZW A;  5L3C A;  3QPH A;  1XSD A;  3HHG A;  2STW A;  4YG2 F;  4HA8 A;  3WG9 A;  2EJR A;  2FSW A;  3BPV A;  3KFW X;  3E97 A;  3HSF A;  1H9T A;  1J2X A;  4U0V A;  4CYD A;  3GZ5 A;  4UNO A;  1FNN A;  1BI3 A;  2A69 F;  2ZFW A;  3GFJ A;  2VE8 A;  1LB2 A;  3P7N A;  2P6T A;  3WOD F;  1TQI A;  2O61 A;  3JSP A;  3WTT C;  2FU4 A;  3M1E A;  1X3U A;  1CF7 A;  1CGP A;  1KQ0 A;  4YFK F;  2K7L A;  1YYV A;  5HLI A;  4IRI A;  3KE2 A;  1D8K A;  5BMZ A;  3EYI A;  1S6L A;  2P5L C;  4Y13 A;  4Q48 A;  2FRH A;  4YII A;  2FXA A;  4U7B A;  4DNC A;  3FMS A;  4B8X A;  2LF8 A;  2M8E A;  2ZCW A;  4EM0 B;  5D6F A;  1SD5 A;  4A0Y A;  3L00 A;  1WSU A;  1FBU A;  4M73 A;  5FD6 A;  4EM2 A;  2CYY A;  5HDG A;  4G94 A;  2BE5 F;  4Q4Z F;  1F4K A;  2NS0 A;  2J5O A;  1Z05 A;  1T6S A;  3K2Z A;  2UWM A;  1T0F A;  2D1V A;  4RAZ A;  5ILV A;  1IN7 A;  4P9F A;  1TBX A;  2HFH A;  1RI7 A;  1I5Z A;  3K1N A;  3ZN0 A;  2ZKZ A;  3HTS B;  4I2O A;  3PFI A;  1P6R A;  1J9I A;  1TNS A;  3MZH A;  3R6S A;  1O3R A;  4HLY A;  4HX8 A;  3E5Q A;  4ESB A;  1SMY F;  4AD9 A;  3KP3 A;  2LNB A;  4R79 A;  4M6Y A;  2VN2 A;  1LDD A;  2KKO A;  3O2P E;  5D8K B;  2CFX A;  4OIP F;  2PQ8 A;  2K4J A;  2H6B A;  3V8J A;  2X0L A;  3V7C A;  4P5O A;  5DD4 A;  3W6K B;  4MNU A;  2MH2 A;  2O8X A;  3QOP A;  2JZY A;  5CLS A;  3AAF A;  1R36 A;  2BYV E;  1B9M A;  2RV8 A;  4LD5 A;  4GO1 A;  4WF2 A;  4IJA A;  3N4M A;  4AIK A;  1K6O A;  3L9F A;  2XIG A;  2MLK A;  4A2U A;  5CVI A;  1K78 B;  4OMY A;  3HHH A;  3O6B B;  1ZGJ A;  1YW9 A;  3C3W A;  1DPU A;  2EA4 A;  3QU3 A;  2JPB A;  5E1Z B;  1BN5 A;  3RKY A;  1WKM A;  1I27 A;  2JTV A;  1SFX A;  2WC2 A;  1DPR A;  2UXN A;  1W4M A;  2HOE A;  4G8X A;  5D4S A;  2VOD A;  4RGX A;  4FHT A;  3RI4 A;  1O7L A;  2PBI A;  2JSC A;  1IN8 A;  1ZHF A;  2XVC A;  2HZT A;  1O3S A;  2FOK A;  4A5N A;  3P9K A;  4BQA A;  1KU3 A;  5LHI A;  3J80 Z;  1MJB A;  5F6F A;  2EB7 A;  2Q8K A;  1FP1 D;  1IRF A;  2M30 A;  1O3T A;  3MZY A;  1WQ2 A;  1D3Y A;  1IZ1 A;  5KK1 A;  4EGY A;  2HTS A;  1GVJ A;  3IRQ A;  4LK1 F;  5E8G A;  1IAW A;  3K1P A;  2FBK A;  2GA1 A;  4EM1 A;  5E1W A;  1ZGA A;  5HDK A;  2QWW A;  2E1N A;  2CSO A;  2XAQ A;  3N97 A;  2HQR A;  4QWQ A;  2E1C A;  2MD5 A;  4RGR A;  4L18 B;  1ZLJ A;  2FBH A;  3ABT A;  1IUY A;  2VXZ A;  4KDP A;  5D5W B;  4BHP A;  3SHF A;  1B1B A;  3C18 A;  5DCM A;  2ZO4 A;  4HF1 A;  3HUG A;  2IA1 A;  2IRF G;  2L01 A;  1J75 A;  5FD5 A;  2M45 A;  2ADU A;  1EH6 A;  3CUQ A;  2CWE A;  4I01 A;  2VC1 A;  3SZP A;  1A04 A;  3H92 A;  2FBI A;  1W7P A;  4ENN A;  5ICC A;  3FXQ A;  5BPI A;  2ESN A;  3HSR A;  4Z2Y A;  4OIR F;  2W85 A;  3ELK A;  1R23 A;  3BJ6 A;  3SFZ A;  5L3E A;  2H94 A;  1JGS A;  5ED4 A;  1KQ8 A;  4O3M A;  2KIF A;  3WE2 A;  2D1H A;  1ZRC A;  1HST A;  5ILU A;  2A3S A;  3MEX A;  3DFG A;  5DCM B;  3HRM A;  4I0A A;  1V3F A;  2O03 A;  3V7R A;  3ZN1 A;  2QQB A;  1FSH A;  2NNY A;  2G7H A;  3WE3 A;  3ZPL A;  2HYG D;  1WRJ A;  2OZU A;  4HOB A;  1FY7 A;  1E2X A;  2F5D A;  4QLC U;  5L3G A;  4HQM A;  1FZP B;  1ZH5 A;  4LG0 B;  2FNA A;  3C1D A;  4BAY A;  3BJO A;  3G3Z A;  1BBY A;  1U6G A;  1SAX A;  1SD4 A;  3KLO A;  4G6Q A;  1MJA A;  4EJW A;  3NQO A;  1U8R A;  5L3F A;  5FFX A;  2NYX A;  3HOT A;  4UXN A;  4B09 A;  2IPQ X;  4XSX F;  5JI6 A;  3MCZ A;  3S2W A;  1ON1 A;  5ICG A;  3KZY A;  4I09 A;  5DUI A;  4G9Y A;  3E5X A;  3ULQ B;  4OIN F;  3ZMV A;  5HS7 A;  2X4H A;  2P7C B;  2LKP A;  3IRR A;  5D5U B;  1SFU A;  3KET A;  2P7V B;  4AIH A;  1FYM A;  4CO8 A;  4S04 A;  5AIQ A;  1OYI A;  4S05 A;  4HV5 A;  1ZG1 A;  3RPU A;  1K79 A;  1NHA A;  5JHU A;  1J0R A;  2XKO A;  5IT3 A;  5ICE A;  3T0Y A;  1KU2 A;  3QP5 A;  1RNL A;  2CW0 F;  2XKP A;  2EFW A;  1FP2 A;  4UHT A;  3J81 Z;  4ESJ A;  2KIM A;  2XV4 S;  3GLX A;  2XAG A;  3T5X A;  1ZAR A;  3P9I A;  1KQ9 A;  2UXX A;  3GFL A;  4ON0 A;  5E17 F;  1G3T A;  2Y0M A;  2JT1 A;  1Z1D A;  1LQ1 A;  2H6C A;  2ZXJ A;  3LAJ A;  4RB2 C;  2P4W A;  2XAJ A;  1AOY A;  4I98 B;  5DDG A;  1KU7 A;  4YFX F;  3GZ6 A;  3TGN A;  1YO5 C;  1Y0U A;  3ML6 A;  1IRG A;  1BC8 C;  2K27 A;  1R1T A;  4UUV A;  2RC4 A;  2JPC A;  2HGC A;  4LG0 A;  2H09 A;  3HRS A;  5CVR A;  1XMK A;  3RIR A;  3O3K A;  2HWV A;  2OZ6 A;  4UV9 A;  1FC3 A;  4ETS A;  5CVU A;  2EFO A;  2QM3 A;  2G7U A;  1PDN C;  4IXA A;  2YPR A;  1LVA A;  2P5K A;  4HX7 A;  1YW7 A;  1YS6 A;  3GYH X;  5CVV A;  4RGU A;  4OIO F;  4KT5 C;  2HKO A;  3Q5F A;  1XMA A;  2RNJ A;  4ZYD A;  4KIG A;  3I4P A;  3FXR A;  3IHU A;  2IVM A;  2RKH A;  4NHJ A;  3F72 A;  4FX0 A;  4KMF A;  1P4W A;  4WXD A;  1IXS B;  3E6M A;  1BOA A;  3CUQ C;  5BS6 A;  2KJB A;  2A6E F;  4UVA A;  2M1B A;  3E6D A;  3GVA A;  4BXU A;  3NRV A;  3I0T A;  1ZYR F;  3FM3 A;  2DFI A;  1RUN A;  2YSR A;  1JXS A;  1FT9 A;  3F8M A;  2D45 A;  3CUQ B;  1AWC A;  1O3Q A;  3QU6 A;  5KVR A;  2UZK A;  3FZV A;  2IW5 A;  1XGS A;  4L9V A;  4ASN A;  2BEO A;  1BM9 A;  1TQP A;  2FML A;  3K0L A;  3V4G A;  2W84 A;  3ZMS A;  4LGW A;  1KGS A;  1ONV A;  4OOI A;  2EFQ A;  2GXG A;  2RDP A;  5JFR A;  4G6D A;  2DW4 A;  3EYY A;  2V1D A;  1JHH A;  1Z7U A;  1J59 A;  2COM A;  1MZB A;  2VBZ A;  2A61 A;  3TO7 A;  3I53 A;  1U78 A;  4G7O F;  5E18 F;  2A68 F;  1P4X A;  1IXC A;  2KIU A;  4IHT A;  1C0W A;  4UVC A;  5D5X B;  5J8F A;  2BBY A;  2E7X A;  5TJJ A;  4MTE A;  2QLZ A;  3BY6 A;  3U2R A;  4K2E A;  3VEP A;  4PZJ A;  3GEZ A;  4L5J A;  1QBJ A;  4CIC A;  2F5F A;  4IRG A;  5CVJ A;  5LEK A;  4RAY A;  1WWX A;  5FFZ A;  2PJP A;  1KYW A;  4MQV A;  5F64 A;  3TO6 A;  2XRN A;  2HQN A;  3R4K A;  3RDI A;  1FYL A;  1LDK B;  1S8N A;  3MFK A;  1V4R A;  2PG4 A;  3HYI A;  3GFM A;  1F5T A;  2VT2 A;  1U3E M;  4YFN F;  5EEG A;  1OYY A;  3ZMU A;  1TNT A;  1DDN A;  4JBA A;  3JAM Z;  1H0M A;  1QPM A;  4LJZ F;  2FNP A;  4M9X A;  2DPU A;  3PQJ A;  4HDV A;  3GFI A;  4Q5S F;  1K7A A;  2M87 A;  4O6J A;  1JHF A;  3PQK A;  2E7W A;  2LDU A;  3DPL C;  1FYK A;  4MEY F;  2LF7 A;  4L5I A;  4MQ9 F;  3LQR A;  4RS8 A;  3WTY C;  1G6N A;  2L02 A;  1W5T A;  2Q0O A;  4LK0 F;  3BZ6 A;  3LA3 A;  5HS9 A;  3TQN A;  1EH7 A;  3FWE A;  5E20 A;  4WWC A;  2B0L A;  5AON A;  3R0A A;  5A2Q Z;  2VT3 A;  5FO5 A;  2QVO A;  2VON A;  3VOE A;  4F7Z A;  1OR7 A;  2BV6 A;  1FSE A;  3GF2 A;  1O7F A;  1G4D A;  2NRA C;  2C6Y A;  3ERE D;  3KEO A;  1LJ9 A;  2YU3 A;  2QUF A;  3HRT A;  2EV5 A;  2FE3 A;  3T8R A;  3WU1 B;  3SQN A;  5K5O A;  2HS5 A;  3WGH A;  3RJP A;  1IN6 A;  2VC0 A;  2XAS A;  1CF7 B;  3EDP A;  1OPC A;  2O0Y A;  2RGV A;  1XSV A;  3E5U A;  1XGM A;  3F3X A;  2DBB A;  3R0J A;  2XUB A;  1J7K A;  1I6X A;  3DXJ F;  1E17 A;  2L3D A;  3IKV A;  5FLX K;  1B4A A;  3K69 A;  4RGS A;  4U0Y A;  3U1D A;  3WGI A;  2HYF A;  1MDM A;  1Z6T A;  5EEH A;  4A5M A;  2ACJ A;  2PLY A;  1SD7 A;  2K4B A;  1XB4 A;  3CO6 C;  2OQR A;  3WU0 A;  2Y75 A;  3RKW A;  1LNW A;  2OQG A;  1XSX A;  2ZNZ A;  3SZT A;  3J81 K;  3ZMD A;  3SXY A;  3ISP A;  5DV5 A;  2DU9 A;  3KZZ A;  2QQ9 A;  4A6D A;  2GXB A;  3DPT A;  1HKT A;  1BI0 A;  4ENJ A;  2GIV A;  3J80 K;  1BJA A;  2PEX A;  1HKQ A;  2PMU A;  5CJ9 A;  4A12 A;  4LB5 A;  4PGG A;  4KN4 X;  1IXR C;  2DO7 A;  3QRF F;  2G9W A;  2STT A;  2BGC A;  1XD7 A;  2ISY A;  2GA2 A;  3I58 A;  2XAF A;  1TW2 A;  1TQM A;  1FPQ A;  4WK8 F;  4MHG A;  2DT5 A;  3I54 A;  3FX3 A;  4PDK A;  4KIB A;  5FLX Z;  1USS A;  2EFN A;  5ILS A;  3FHZ A;  3KP7 A;  4LLN A;  3G73 A;  1HKS A;  3Q9V A;  4HDU A;  4G7H F;  1GXQ A;  4GYG A;  4LB6 B;  3TO9 A;  3W6J B;  1KYZ A;  1RZ4 A;  4BHB A;  2V1U A;  3MWM A;  1BI1 A;  1MD0 A;  4IF4 A;  3WTU C;  1B59 A;  1R00 A;  2QYO A;  3T1B A;  3WTZ A;  4P96 A;  1U2W A;  1QNT A;  4HX4 A;  4AIJ A;  4ENM A;  1HW2 A;  1W7P D;  1T38 A;  2W57 A;  3COA C;  4U7D A;  2P6S A;  1QZZ A;  5LRS A;  2ESH A;  3IKT A;  3L2C A;  2Z5U A;  2Q2E A;  3TOA A;  2GQQ A;  5DYM A;  2O6G E;  4WXH A;  1QGP A;  4XLP F;  1DUX C;  1RIO H;  3M8E A;  3EUH A;  5K5Q A;  3DP7 A;  3GX4 X;  3CLO A;  4NQW A;  3F8F A;  3M9A A;  4UV8 A;  1R1V A;  1IF1 A;  5BQT A;  2W24 A;  3FM5 A;  1LEA A;  5CYV A;  3B02 A;  5J6X A;  5K5R A;  2ZBK A;  2Z3Y A;  3HIF A;  3BP8 A;  4G7Z F;  4ZYG A;  1XDU A;  4WXC A;  4LLL A;  4BNC A;  5TRD A;  2EV0 A;  2ZNY A;  1UCR A;  1FBS A;  4GGG A;  3MAJ A;  4WX9 A;  5HDN A;  1MJ9 A;  2D2W A;  2HKX A;  2A07 F;  3LAP A;  1Z9C A;  2MC3 A;  1LDJ A;  3TDZ C;  3NEU A;  2P5V A;  2MA3 A;  3JAM K;  1S29 A;  2RN7 A;  4M74 A;  3FXU A;  4Y15 A;  1HBX G;  4IVN A;  4RB3 C;  3LA7 A;  1U5T A;  1I1G A;  3WTW C;  2H27 A;  2JRT A;  4HW0 A;  2R7F A;  4EVI A;  1ZLK A;  2NAZ A;  4P55 A;  2FQ3 A;  2IT0 A;  2M5W A;  3DKW A;  4BHC A;  1R5H A;  1R7J A;  3E6C C;  4XSZ F;  2VOO A;  4M72 A;  1SD6 A;  5L3B A;  1R22 A;  3IL2 A;  3DQV C;  4U0W A;  3KP6 A;  2QBY A;  1S7O A;  2L4M A;  2CO5 A;  4L0Z B;  3WTV C;  3CJN A;  1HSJ A;  3VFZ A;  2MBF A;  2W25 A;  3OV8 A;  2DLL A;  3DV8 A;  4XBF A;  3V8L A;  3JW4 A;  1R58 A;  4A6E A;  4EV0 A;  5HOO A;  1QZY A;  1SMT A;  4L9J A;  5L3D A;  3JTG A;  3IC7 A;  4CDG A;  3IWZ A;  1Z91 A;  4LMY A;  1FLI A;  4M71 A;  3I5U A;  4AVP A;  1L0O C;  1HQC A;  1KU9 A;  3GWZ A;  4M6X A;  4RB0 A;  2RVC A;  5HLG A;  3KP5 A;  5HLH A;  1ZRD A;  3ZQ7 A;  3V8K A;  1TLH B;  5J8C A;  1OMI A;  4ZYH A;  2LSO A;  3FMQ A;  3I59 A;  3ABU A;  4TV7 A;  3LFK A;  4I7H A;  4NB5 A;  3HTU A;  2RQP A;  2TDX A;  3I59 B;  4HYE A;  2YR2 A;  4AWX B;  2DK5 A;  2VBY A;  2OU2 A;  1R5G A;  4EJU A;  4CZZ A;  5D5V B;  2HR3 A;  1PP7 U;  5BPD A;  2F5C A;  4UVB A;  1EV7 A;  3L7W A;  2O3F A;  3BPX A;  2K86 A;  3HRU A;  1HW1 A;  3I64 A;  2IA2 A;  1XCB A;  2ETH A;  2P8T A;  3LST A;  1H9G A;  2WV0 A;  3R60 A;  4KIF A;  3KP4 A;  4D0P A;  4OIQ F;  3KP2 A;  4PGH A;  2AXL A;  2PMH A;  3MQ0 A;  2OBP A;  2XGX A;  1YFH A;  2EA2 A;  4E70 A;  4PCQ A;  3D5L A;  4CGZ A;  4GXO A;  3IWF A;  4ZYE A;  1ZN2 A;  2KJC A;  1YQA A;  5LGU A;  1D8J A;  1YLF A;  1FX7 A;  3M7G A;  4HLX A;  2ZME A;  3J7A O;  1ODD A;  1G3S A;  2QQA A;  1XGO A;  2ELH A;  1W7P B;  4JK1 X;  1ON2 A;  2XAH A;  4N9I A;  4WCG A;  2K02 A;  2CQK A;  2MH9 A;  3RPQ A;  2V79 A;  4OMZ A;  5HS8 A;  1P2F A;  3M8F A;  5ICF A;  1LEB A;  5DCF A;  1HXD A;  4N9H A;  2YX7 A;  4KUM A;  4HQE A;  1QO0 D;  2QZ8 A;  2F2E A;  1TTY A;  5D8L B;  2GAU A;  1UST A;  1STZ A;  1EH8 A;  1I1S A;  3JSO A;  3E6B A;  3WTS C;  3WTX C;  3GW2 A;  1YTY A;  2ZJ2 A;  4KA4 A;  3CO7 C;  2VBX A;  4IHS A;  1UB9 A;  2IJL A;  4ENK A;  4KYW A;  4MEX F;  3CDH A;  2XRO A;  4RB1 A;  3TKY A;  2OD5 A;  1DP7 P;  3FF5 A;  1XN7 A;  3VB2 A;  2R3S A;  3F8N A;  3C7J A;  5LBQ A;  1R1U A;  1P92 A;  5JVT A;  5LGN A;  3LQQ A; 
#chains in the Genus database with same CATH topology
 4U88 A;  2MGQ A;  3A1Y A;  5LHH A;  5HOD A;  4DQ2 A;  3HOX J;  1W5S A;  4ZZD A;  5KNL A;  4B4C A;  3QOE A;  2VJJ A;  5DS9 A;  3RKX A;  3CCE I;  3BWG A;  3QP6 A;  4IZZ A;  4XRF A;  1OCP A;  3MN2 A;  2IA0 A;  3FBN B;  2JRM A;  1MKM A;  2QEX I;  1P4A A;  1IN4 A;  2ZME B;  1MH4 A;  3ESW B;  4I02 A;  1Y8Q B;  5LLQ A;  4RBO A;  5LRR A;  2HPM A;  4ESF A;  2VKH A;  4RAF A;  1ZAO A;  2DTR A;  3D0S A;  4EQQ A;  3F23 A;  1IW7 F;  5H6Q A;  1Y8R B;  1REP C;  3F21 A;  1SFO J;  3AG2 H;  5B5E C;  3LWF A;  3GTJ J;  1ETX A;  1XGN A;  2NS8 A;  4DOZ A;  3B73 A;  4EJO A;  4HBL A;  1ZRF A;  3CDL A;  4EGZ A;  2VIX A;  2R7T A;  2H8R A;  2IS6 A;  3AL0 B;  3NWT A;  4FT8 A;  5FRM A;  2RAE A;  2CGP A;  2EFP A;  2JJ7 A;  5LFA A;  5J1R A;  2CG4 A;  1WH5 A;  5FRO A;  1FOY A;  2DAO A;  5AIP A;  2LY2 A;  1BC7 C;  2NNN A;  2KRF A;  3VOD A;  2ID3 A;  1X3W B;  1K78 A;  3LSH A;  1HW5 A;  4HF2 A;  3DKX A;  1F36 A;  3GUD A;  5JLW A;  3VWB A;  4IRH A;  2M0M A;  3F8B A;  5EJC A;  3ZMZ A;  1ZG5 A;  1O57 A;  1UHM A;  1BI2 A;  2XAU A;  1ZG3 A;  2Y0S N;  3BDD A;  3GCM A;  3DEU A;  3IV5 A;  1FOK A;  3ZP5 A;  2NOJ B;  2W4S A;  1W36 C;  3OOP A;  3CES A;  3F6O A;  1QQI A;  1MSF C;  3TDU C;  4IHW A;  1OYW A;  3QPL A;  4LLG F;  2OAZ A;  4PJN A;  3RYR A;  2DI3 A;  1GLN A;  2FEZ A;  2XB5 A;  3WGG A;  2LVS A;  2ISZ A;  1A36 A;  6PAX A;  4UB6 C;  2PFB A;  1RUO A;  1K6Y A;  4KIC A;  1BIA A;  3RQ4 A;  4A3J J;  1G59 A;  4ZH4 F;  2VOP A;  5HLT A;  3CTA A;  3CCS I;  2XDV A;  2QCO A;  2OA4 A;  4NDL A;  4XN0 A;  1T2K A;  4UUS B;  4EJV A;  4HF0 A;  4M3F A;  1J5Y A;  4KMU X;  2F6C A;  5F1R A;  2GIZ A;  1ZGW A;  1T33 A;  2Y2Z A;  5FGM A;  3L2R A;  2DK8 A;  4R8H A;  3TED A;  2HNH A;  3F6V A;  3KCC A;  1ZR4 A;  2R7D A;  2EPF A;  2CW8 A;  3GBG A;  1NK2 P;  3RKQ A;  4C9Y A;  2L2O A;  3P9C A;  1JUS A;  5D6E A;  2P81 A;  3H3Z A;  2EV6 A;  4OWR B;  4ZZL A;  2VE9 A;  4N0B A;  1VF9 A;  5IT9 Z;  4L0Y B;  3S17 J;  4MTD A;  5GTI C;  1A5J A;  2ICW G;  4BQQ A;  1B9N A;  1FMV A;  4ITV A;  2DQL A;  3V7S A;  1MDM B;  3WHC A;  1HDD C;  2FMY A;  4GYI A;  2JA6 J;  1ETY A;  3KPH A;  3S1M J;  4RAG A;  2UUZ A;  4FX4 A;  4YIF A;  3OIO A;  3ECO A;  4Y17 A;  3CJR B;  4B3X A;  1WI9 A;  3EUK L;  2TRT A;  5GPC A;  1JKQ C;  1S7A A;  3VYS B;  4MGR A;  1FMW A;  4AYB A;  4XM3 A;  3P5J A;  5BOX A;  1MGT A;  1P7J A;  2AS5 F;  2L54 A;  1UG0 A;  2Z33 A;  4GFB A;  1LFB A;  3EQL F;  1H8A C;  1EJ9 A;  3KLN A;  4DBR A;  5DD8 A;  2DPD A;  1BIB A;  2ZC2 A;  3BQZ A;  2X6W A;  2F5E A;  1PP8 F;  1QZE A;  2CQN A;  2EK5 A;  2FA5 A;  5GAE J;  4KFC A;  2AO9 A;  2VBW A;  3OYC A;  2R4G A;  1ZKG A;  3I71 A;  1JE8 A;  4D7M A;  4EJT A;  4P9U A;  3KYL A;  2BY1 A;  4HAM A;  3KEQ A;  3T8T A;  5D4R A;  3REO A;  1GXP A;  5LHG A;  4M9S A;  1R6R A;  5LGT A;  4M3E A;  2K9L A;  3ZMT A;  5IP7 J;  1ETW A;  4I0B A;  5H6R A;  4IPA A;  5J40 A;  3PL8 A;  1XDS A;  2IGN A;  4M9Z A;  1GHC A;  3CJT B;  2BHZ A;  4R1H A;  3S16 J;  3OS0 A;  3ZCO A;  3HSE A;  4QPO A;  1FBQ A;  3FXM A;  3OR1 C;  4LFU A;  4QTR A;  5JR3 A;  2R5Y A;  4HZF A;  4EMS A;  2PJR A;  1U5T C;  4O5V A;  1YG2 A;  2L4A A;  4Q47 A;  4F92 B;  2ECB A;  2HXO A;  2DQR A;  1KON A;  3TOB A;  1B6A A;  1SFE A;  3S1N J;  3RYP A;  5ERI A;  4KN7 X;  2PI0 A;  2LR8 A;  4XLN F;  2M9H A;  1Q1H A;  4A0X A;  1MBH A;  3GTL J;  2IP2 A;  5FB2 A;  4IHY A;  4RA2 A;  2HPI A;  3G1L A;  1U5T B;  3GXO A;  2L7K A;  3QAH A;  1ULY A;  1Y39 A;  3LA2 A;  2WTE A;  1I39 A;  1OKR A;  4LOC A;  2PN6 A;  4BXF A;  3RTR A;  1S3J A;  1XX5 A;  1WVR A;  3BOQ A;  3HOS A;  3ROU A;  3S1R J;  2V1X A;  3Q9S A;  4OU0 A;  4CYC B;  2QBY B;  2E1M B;  2JVH A;  3R61 A;  2ME6 A;  1G8X A;  3K1M A;  5EGO A;  2M8G X;  5K1Y A;  3FKI J;  2HTJ A;  3K4B A;  2WAQ A;  2IGK A;  2CUE A;  3F22 A;  4QIW N;  3BJA A;  2DJN A;  3S32 A;  5E1X A;  5E3O A;  1X1B A;  2D5V A;  1J09 A;  2HDC A;  2JA5 J;  2W1O A;  3G6E I;  5IOZ A;  2BHY A;  2YX4 A;  3DTE A;  3EET A;  4FTH A;  2KQR A;  3A02 A;  5HVQ C;  1TL8 A;  1G3W A;  3QYF A;  1TW3 A;  1UZC A;  4LIT A;  4CXF A;  4XRS G;  2V6C A;  4A0Z A;  4HPQ A;  2HEO A;  2Z9O A;  1D5V A;  2EWN A;  3HG9 A;  1UFM A;  3LMM A;  1F9N A;  2E60 A;  4II2 A;  2E34 A;  5CPR B;  1MNE A;  1UHW A;  2K9S A;  5EF6 A;  1S9H A;  2JUG A;  3DF8 A;  1PUE E;  2Y48 A;  5EEA A;  3CP8 A;  4M6V A;  4Z6Y A;  3QPT A;  2A5Y B;  2F5V A;  5DUK A;  2LRD A;  3MD2 A;  2Z99 A;  1Z6R A;  3JTH A;  2WWY A;  2OTJ I;  4DW6 A;  3OYA A;  3H3U A;  2FF4 A;  4BL0 B;  3ECH A;  4HV6 A;  3NAU A;  3HDD A;  2QEN A;  2XHK A;  4Y7N J;  1VFC A;  1W1W E;  2PMZ A;  3K9T A;  5E8I A;  3S15 J;  1FWZ A;  3U9G A;  3BR3 A;  2M2E A;  1XPX A;  3S93 A;  2HDD A;  1YIO A;  3LSR A;  2KDO A;  1G3Y A;  3F8C A;  3A0H C;  2A6H F;  2GWR A;  1F1Z A;  5DEQ A;  1A6I A;  1VTN C;  1JTX A;  4L9T A;  5H20 A;  4H4K C;  2J5P A;  2Z2S B;  5LEJ A;  1NTC A;  3ZRG A;  2V9V A;  4BYY A;  4CHU A;  4H0E A;  1LE8 A;  2X1D A;  5A2Q K;  3L09 A;  3ZQL A;  3CLQ A;  1YS7 A;  2Q1Z B;  2Q2E B;  3FMR A;  1X58 A;  1ZRE A;  2MLG A;  1T98 A;  1IRX A;  5IT9 K;  3GTK J;  1T39 A;  2E36 A;  3CUO A;  4GCV A;  4L9N A;  1YW8 A;  1MMA A;  2IEK A;  3GO5 A;  4JQF A;  2X51 A;  3FXJ A;  4DYR A;  3BRO A;  1VQ5 I;  1IN5 A;  3OYG A;  4KNY A;  4BH9 A;  1L3L A;  3HOZ J;  4RM2 A;  4DYQ A;  1KA8 A;  3E3V A;  2GZW A;  2X48 A;  5GAH J;  5HNH A;  4Y3O A;  4NNJ A;  5L3C A;  5J4Y A;  4A3B J;  3QPH A;  1XSD A;  1RKT A;  4C3J J;  3HHG A;  1G2H A;  2NVY J;  2ME0 A;  2STW A;  4YG2 F;  4HA8 A;  3WG9 A;  4D5F A;  1TP4 A;  2EJR A;  2FSW A;  3BPV A;  2VQC A;  3KFW X;  3E97 A;  2JWT A;  3HSF A;  1H9T A;  1J2X A;  4U0V A;  4CYD A;  3LSP A;  3GZ5 A;  3ZR8 X;  2ZJR F;  4F93 B;  4UNO A;  2HVQ A;  3DWL E;  1FNN A;  2ZFW A;  1BI3 A;  2A69 F;  1WJC A;  3GFJ A;  1VND A;  2XF5 A;  2VE8 A;  1LB2 A;  3RQI A;  4C3H J;  3P7N A;  2P6T A;  2V9K A;  2CQX A;  2NVQ J;  1VQ6 I;  3WOD F;  3IAS 2;  2AXT C;  3A0B C;  5HNF A;  1TQI A;  2O61 A;  3SEZ A;  2M4K A;  3JSP A;  3WTT C;  2FU4 A;  3OYM A;  3M1E A;  1FTZ A;  1YHQ I;  3CMA I;  1X3U A;  1CF7 A;  1ORK A;  1CGP A;  2DA7 A;  4QPQ A;  2VQL A;  4F55 A;  1KQ0 A;  5DTD A;  4YFK F;  3LQQ A;  2K7L A;  1YYV A;  3G1O A;  1NK3 P;  5HLI A;  4IRI A;  2I5U A;  3PIP F;  3KE2 A;  1D8K A;  4HST A;  3PNV A;  3MZ8 A;  2DOD A;  5BMZ A;  3EYI A;  3RZO J;  1E3P A;  1S6L A;  2VKD A;  2P5L C;  3EUA A;  4Y13 A;  1D5Y A;  1B8I B;  3W6V A;  4Q48 A;  4MIM A;  2HU9 A;  2FRH A;  4YII A;  2FXA A;  3SDG A;  5GTH C;  2G0E A;  4U7B A;  3B6A A;  1DQU A;  3BC8 A;  3FMS A;  4B8X A;  4DNC A;  2LF8 A;  2M8E A;  2VJI A;  1Q1V A;  2O9L A;  2ZCW A;  1K4T A;  4EM0 B;  3BQY A;  5D6F A;  5JLX A;  1SD5 A;  4A0Y A;  1I3Q J;  4S0H B;  3L00 A;  3VSK A;  2B63 J;  1FBU A;  1WSU A;  1A31 A;  2R5Y B;  4M73 A;  2O5R A;  5FD6 A;  2QKM B;  2CYY A;  2MC4 A;  4EM2 A;  4A3I J;  4XMY A;  1B72 A;  1PYV A;  5HDG A;  4G94 A;  3WG7 H;  3ZQF A;  2VPR A;  2BE5 F;  4Q4Z F;  1F4K A;  4YIR X;  3ABK H;  2NS0 A;  2J5O A;  1Z05 A;  1LE8 B;  1T6S A;  3K2Z A;  3G2B A;  2UWM A;  1T0F A;  3K4J A;  4F91 B;  4II3 A;  1MNM C;  1S7E A;  3GLL A;  2OUM A;  2D1V A;  4RAZ A;  5ILV A;  1IN7 A;  4P9F A;  4AM3 A;  5F08 A;  4FET A;  1TBX A;  1YX3 A;  2HFH A;  2LBF A;  1RI7 A;  2WA0 A;  2KMU A;  1I5Z A;  1JUP A;  3DCF A;  4CCJ A;  3FXL A;  4PFO A;  3GTM J;  1D0Y A;  3K1N A;  1MMD A;  3V42 A;  3ZN0 A;  2DT6 A;  2ZKZ A;  3HTS B;  4I2O A;  1IO2 A;  3PFI A;  2CW7 A;  1P6R A;  4A3E J;  1J9I A;  3K4N A;  1TNS A;  3MZH A;  3R6S A;  1QVU A;  2JMW A;  3DPU A;  1O3R A;  2LG4 A;  4HLY A;  4E7Z A;  4HX8 A;  3E5Q A;  4ESB A;  5JHF A;  1SMY F;  2E19 A;  2UV1 A;  3DBR B;  2NVX J;  1DU0 A;  4AD9 A;  3KP3 A;  2LNB A;  4R79 A;  1VQ9 I;  3ZOB A;  3BTL A;  4M6Y A;  5KAI C;  1R9T J;  2VN2 A;  3Q0U A;  2ZJP F;  1LDD A;  5K7H A;  2KKO A;  2GXA A;  5GAG J;  3O2P E;  1MBE A;  2NOG A;  1EF4 A;  5D8K B;  2CFX A;  2GBY A;  4OIP F;  2PQ8 A;  2K4J A;  3QQA A;  2VI6 A;  2H6B A;  3V8J A;  2X0L A;  3HEF A;  2R7S A;  3V7C A;  2KZG A;  4RMN A;  4P5O A;  5DD4 A;  3W6K B;  3LSK A;  4M3B A;  4MNU A;  2TCT A;  1HC8 A;  2MH2 A;  5GAD J;  5C44 J;  1EKE A;  3F0C A;  4ZDO A;  2O8X A;  2K9Q A;  2HDW A;  3QOP A;  2JZY A;  5CLS A;  3AAF A;  1R36 A;  2ZJQ F;  4U87 A;  2BYV E;  4J00 A;  1B9M A;  1JGG A;  2RV8 A;  3OSG A;  1T95 A;  2IGO A;  4LD5 A;  4GO1 A;  4WF2 A;  1N75 A;  4IJA A;  2R7Q A;  4LG3 A;  3N4M A;  2IBD A;  2EBI A;  4AIK A;  2NXN B;  2X1C A;  1K6O A;  3L9F A;  2XIG A;  4A2U A;  1WFX A;  5CVI A;  3UR3 C;  3BZC A;  4HEA 2;  1K78 B;  4OMY A;  3HHH A;  4X0G A;  1WH7 A;  3O6B B;  2F4M B;  2X6O A;  4MO7 A;  1ZGJ A;  1YW9 A;  1CQT A;  3C3W A;  3OYI A;  1DPU A;  1GUU A;  2EA4 A;  1WJ5 A;  4RLF A;  3QU3 A;  4MLO A;  4J19 A;  3LFU A;  3TP3 A;  2RNG A;  1QHH D;  3DLA A;  2JPB A;  2MW8 A;  5E3M A;  2A5W A;  5E1Z B;  3GTP J;  1U9O A;  4XON A;  3A2K A;  1BN5 A;  2XGE A;  3HC7 A;  3RKY A;  1WKM A;  1P7I A;  3N05 A;  1I27 A;  3MKL A;  2JTV A;  1SFX A;  2WC2 A;  1DPR A;  2JA2 A;  1JI8 A;  2UXN A;  5M3M J;  3FK7 A;  3O8H A;  3VDX A;  3GME A;  1W4M A;  2R5Z B;  2HOE A;  4G8X A;  5FKM A;  3E1S A;  5D4S A;  3X2Q H;  5F0H A;  2VOD A;  2DDB A;  1T0F C;  4GRI A;  4RGX A;  4RLQ A;  2B9S A;  2OPT A;  4FHT A;  2P0W A;  3RI4 A;  1O7L A;  2PBI A;  2JSC A;  1IN8 A;  3LOC A;  2XGD A;  2AQF A;  1ZHF A;  3D5S C;  2XVC A;  2HZT A;  1O3S A;  2FOK A;  1JTY A;  2L7Z A;  4A5N A;  3P9K A;  3PFY A;  2EZI A;  4PSX A;  1TWG J;  2ZME C;  4XLE A;  4BQA A;  4XOT A;  2LP0 A;  1KU3 A;  2QKL B;  5LHI A;  1NG7 A;  3I4N J;  3J80 Z;  1MJB A;  5F6F A;  2EB7 A;  4XKC A;  1FP1 D;  3LSI A;  2Q8K A;  1IRF A;  2M30 A;  3HOV J;  2CS3 A;  4M3G A;  3MZY A;  1WQ2 A;  1D3Y A;  1IZ1 A;  5KK1 A;  3OS1 A;  4EGY A;  1O3T A;  5KAF C;  3CC7 I;  1X19 A;  2HTS A;  3ABL H;  1BR4 A;  1GVJ A;  1X1D A;  4RM3 A;  3IRQ A;  4I6Z A;  4LK1 F;  3I3L A;  5E8G A;  1IAW A;  3K1P A;  2EIM H;  2FBK A;  3VYU B;  2GA1 A;  1YIT I;  4EM1 A;  5E1W A;  3FIS A;  4N4N B;  1ZGA A;  5HDK A;  2K3F A;  1X3Z B;  2QWW A;  4KIT B;  1ENH A;  2E1N A;  3F9K A;  5DM6 F;  2CSO A;  2XAQ A;  3N97 A;  2HQR A;  4RDU A;  4QWQ A;  2E1C A;  4HNT A;  1QPI A;  2MD5 A;  2HI3 A;  1GV2 A;  4RGR A;  3HBL A;  1D1A A;  1ZLJ A;  2FBH A;  4L18 B;  3ABT A;  3K6G A;  5IOY A;  5FRN A;  1HDP A;  2DXI A;  2NVU B;  4XKV A;  3ZQQ A;  1IUY A;  3DLL F;  3ASO H;  1VQM I;  2DA1 A;  2VXZ A;  4KDP A;  3CCJ I;  5D5W B;  4BHP A;  3SHF A;  1BL0 A;  3C18 A;  1B1B A;  2EIJ H;  5DCM A;  4D9J A;  1LKX A;  4HRI A;  2ZB9 A;  2ZO4 A;  3PSI A;  1PUF A;  2QF7 A;  4V19 K;  4HF1 A;  2HXI A;  4IX7 A;  3HUG A;  2IA1 A;  2IRF G;  4YRV A;  2L01 A;  2XF6 A;  3PSF A;  3CCR I;  1J75 A;  5FD5 A;  2M45 A;  2ADU A;  1EH6 A;  3CUQ A;  3QYE A;  2CWE A;  1OCT C;  4I01 A;  2VC1 A;  4G12 A;  3SZP A;  1YRN A;  1A04 A;  2VAS A;  3H92 A;  2CV2 A;  2FBI A;  4B43 A;  4HNU A;  1O4X A;  1W7P A;  1ZK8 A;  4ENN A;  5ICC A;  3FXQ A;  3AG1 H;  2LK2 A;  4CZC A;  5BPI A;  4W97 A;  4V2F A;  2CUJ A;  2ESN A;  3M3Y J;  4CCL A;  2E2J J;  3HSR A;  1Z0X A;  4Z2Y A;  3JRF A;  4C2U A;  1NG6 A;  5GP9 A;  4OIR F;  2W85 A;  1QHG A;  3ELK A;  2DN0 A;  2W48 A;  1MBK A;  1R23 A;  3BJ6 A;  3SFZ A;  5L3E A;  2H94 A;  1JGS A;  5ED4 A;  1KQ8 A;  3GTQ J;  1IV8 A;  2VQH A;  1Y0N A;  2ZFU A;  1D1B A;  4O3M A;  2KIF A;  5EGO B;  3WE2 A;  2KDZ A;  2D1H A;  4A3F J;  1ZRC A;  1HST A;  2HVS A;  2L0K A;  4CYC A;  3MKY B;  4A3C J;  1UEL B;  5ILU A;  2A3S A;  4IOC F;  2LLK A;  3MEX A;  2IS4 A;  3JRH A;  3S3O A;  3DFG A;  4D5C A;  5DCM B;  2COB A;  3A01 A;  3HRM A;  4I0A A;  1V3F A;  2I8D A;  2O03 A;  4NC8 A;  3KYC B;  3V7R A;  1KZH A;  4C2M J;  5J4V A;  2H1L A;  3B6C A;  3ZN1 A;  3PIO F;  1LFP A;  2JVG A;  2QQB A;  2RQQ A;  1FSH A;  2NNY A;  3IH3 A;  2CJJ A;  3OYF A;  2G7H A;  1FOW A;  3G71 I;  3WE3 A;  3ZPL A;  3H3V K;  2HYG D;  4ZDL A;  1MMN A;  2IAI A;  4LIV A;  1WRJ A;  2OZU A;  4HOB A;  1FY7 A;  1E2X A;  2F5D A;  2CQQ A;  2DMP A;  4QLC U;  5L3G A;  4HQM A;  3L2W A;  1FZP B;  1ZH5 A;  3BT9 A;  3CF5 F;  4LG0 B;  1D1C A;  2VUM J;  2FNA A;  3C1D A;  4BAY A;  3BJO A;  2KHM A;  4UB8 C;  2BW3 A;  3G3Z A;  2KLO A;  1FIP A;  2FX0 A;  4N4O B;  4B48 A;  1BBY A;  4D1Q A;  3HOW J;  1U6G A;  1W5C C;  1Z67 A;  1SAX A;  1H89 C;  2Y31 A;  2ELJ A;  3L2Q A;  2L9N A;  1SD4 A;  4EEF G;  2L9R A;  2EZH A;  2OV7 A;  3KLO A;  4G6Q A;  1GT0 C;  1MJA A;  4EJW A;  3NQO A;  1U8R A;  4CCN A;  2BY2 A;  5L3F A;  4ANJ A;  2WBM A;  3EUH C;  5FFX A;  2NYX A;  4BE2 A;  2IS1 A;  3HOT A;  2K9M A;  4UXN A;  2VB6 A;  4B09 A;  2IPQ X;  1OFC X;  5DM7 F;  3CJQ B;  1Y56 A;  3G4S I;  4XSX F;  1APL C;  5JI6 A;  3OS2 A;  1U0J A;  3MCZ A;  3CQZ J;  2ZXH A;  2DFH A;  3S2W A;  3S3N A;  1ON1 A;  3OIP A;  2ZXW H;  5ICG A;  1VQ4 I;  2K40 A;  3FBI B;  3H9Q A;  3SFI A;  2YUS A;  2LKX A;  3KZY A;  4I09 A;  5DUI A;  2HOA A;  1WZ2 A;  4G9Y A;  3E5X A;  3ULQ B;  2M7A A;  2K85 A;  4XR6 A;  3TL4 X;  4OIN F;  1PVE A;  3ZMV A;  5HS7 A;  2PX9 A;  2X4H A;  2P7C B;  2AQE A;  2LKP A;  5M5W J;  1E3O C;  4A3D J;  3IRR A;  4MFD A;  5D5U B;  3IUO A;  3CP2 A;  4V2G A;  1SFU A;  3KET A;  4BKX A;  4XID A;  1IDY A;  3CME I;  1ZTR A;  2P7V B;  3K10 A;  5J3L A;  5FLV A;  3BLY A;  2L7F P;  4AIH A;  1T8I A;  1FYM A;  5M5X J;  1GVD A;  4CO8 A;  4BXX J;  1VQN I;  4XRS A;  1T56 A;  4S04 A;  4PK4 A;  5AIQ A;  1ETV A;  1OYI A;  4S05 A;  1V54 H;  2XRL A;  4HV5 A;  1ZG1 A;  4BQN A;  3RPU A;  1IG7 A;  3HKZ A;  1K79 A;  2GOM A;  1NHA A;  5JHU A;  2XPU A;  4I76 A;  4XNF A;  1R4N B;  4XIC A;  1J0R A;  2XKO A;  5IT3 A;  5ICE A;  4G6T B;  3JRB A;  4ABZ A;  1SAU A;  2AHQ A;  3T0Y A;  1KU2 A;  1RNL A;  2CW0 F;  2MAB A;  2XKP A;  3QP5 A;  2EFW A;  1FP2 A;  4UHT A;  5FKK A;  3J81 Z;  4BDY A;  2CFO A;  1X4P A;  1BJZ A;  1LUJ B;  2KIM A;  4PUS A;  3MKZ A;  4ESJ A;  2CRG A;  2XV4 S;  3GLX A;  3PUB A;  1OCR H;  2XAG A;  3T5X A;  3RPU D;  2X9D A;  4B1R A;  1ZAR A;  5J1Y A;  3P9I A;  3LNQ A;  3O8G A;  2MFZ A;  1QRY A;  4A3K J;  3CCM I;  1KQ9 A;  2UXX A;  3GFL A;  4Y33 A;  4ON0 A;  5E17 F;  2O8K A;  1G3T A;  4P1W A;  2Y0M A;  2JT1 A;  1Z1D A;  2W82 A;  3RSN A;  4BY1 J;  3HGY A;  2YU9 J;  2LFB A;  1LQ1 A;  4AUX A;  4AID A;  2H6C A;  2ZXJ A;  3LAJ A;  2VKV A;  3L1P A;  4RB2 C;  2P4W A;  2XAJ A;  2BVL A;  1AOY A;  3U21 A;  4XKW A;  2VJ5 A;  4I98 B;  5DDG A;  1KU7 A;  3E0J B;  4BU2 A;  4X1E A;  1UHS A;  4YFX F;  2DJI A;  2JA7 J;  3GZ6 A;  3TGN A;  1YO5 C;  3OR2 C;  1Y0U A;  3ML6 A;  4W1U A;  1IRG A;  5J47 A;  3KEY A;  1BC8 C;  2K27 A;  1R1T A;  5IP9 J;  3NWS A;  4UUV A;  2RC4 A;  2JPC A;  4Y52 J;  3UNG C;  1Z3X A;  2HGC A;  4LG0 A;  4JOM A;  1MBF A;  2H09 A;  5LD2 C;  3HRS A;  5CVR A;  3Q3S A;  1XMK A;  3RIR A;  3OYD A;  3O3K A;  2HWV A;  4A3G J;  4BS9 A;  3D1N I;  1YI2 I;  5EYR A;  2OZ6 A;  4UV9 A;  1FC3 A;  4ETS A;  1RPW A;  2LOO A;  5CVU A;  3SZG A;  2EFO A;  2QM3 A;  2OCC H;  2LBF B;  2G7U A;  1PDN C;  4PJM A;  4IXA A;  2YPR A;  1LVA A;  1POG A;  2P5K A;  4HX7 A;  3A01 B;  4CA0 A;  1MW7 A;  1YW7 A;  1YS6 A;  1GV5 A;  3BG3 A;  3H0G J;  2CUF A;  5CVV A;  3VYT B;  3GYH X;  3CCL I;  1WJD A;  2MD0 A;  1TZL A;  3ZXS A;  4RGU A;  2X6Y A;  4OIO F;  4KT5 C;  2HKO A;  4NQW B;  3FIW A;  2X85 A;  3Q5F A;  1XMA A;  2RNJ A;  4ZYD A;  3S14 J;  4C2T A;  1MND A;  3VYR B;  4OAZ A;  2VKE A;  2GM4 A;  4BE1 A;  4KIG A;  5B3S H;  3I4P A;  1WGX A;  1I3A A;  3FXR A;  3IHU A;  5FKN A;  2IVM A;  2ZSH B;  2RKH A;  4NHJ A;  3F72 A;  1VQ8 I;  2V4J C;  3DU6 A;  4FX0 A;  2BW3 B;  1TWA J;  4KMF A;  2LYC A;  1V55 H;  1P4W A;  3H5N A;  1DU6 A;  2OCE A;  2HQ5 A;  4WXD A;  3AG4 H;  1IXS B;  3E6M A;  4C30 A;  1BOA A;  3CUQ C;  5BS6 A;  2Y30 A;  2KJB A;  2A6E F;  4UVA A;  2M1B A;  3E6D A;  2R92 J;  3GVA A;  2QSG X;  4JX4 A;  3C2H A;  3BG9 A;  1TWC J;  1TT0 A;  4BXU A;  3BTI A;  3NRV A;  3I0T A;  1ZYR F;  4MFE A;  3FM3 A;  2DFI A;  2JK3 A;  1FJL A;  1RUN A;  2YSR A;  1HCR A;  1JXS A;  5FJ8 J;  1FT9 A;  3F8M A;  3PUF A;  2D45 A;  3CUQ B;  1AWC A;  3AFH A;  4UUT A;  1O3Q A;  1VI0 A;  2QA4 I;  3KIO A;  3QU6 A;  5KVR A;  5IYB J;  2UZK A;  1XG1 A;  2M3A A;  1T08 B;  3QOD A;  3FZV A;  2LY9 A;  3DTI A;  2IW5 A;  1XGS A;  1D0X A;  4L9V A;  2DDA A;  4ASN A;  2QGU A;  2BEO A;  1BM9 A;  1TQP A;  1EA3 A;  2FML A;  3K0L A;  2N8G A;  3V4G A;  1V5E A;  1MIJ A;  5E3L A;  2W84 A;  3HOU J;  3ZMS A;  2CV1 A;  4LGW A;  1KGS A;  1ONV A;  2E2H J;  1Z77 A;  2VL8 A;  4OOI A;  1HA8 A;  2EFQ A;  2K9N A;  4AU7 A;  2GXG A;  2RDP A;  5JFR A;  2BZT A;  4I99 C;  3JRA A;  1RRJ A;  4E6K G;  4G6D A;  1FTT A;  2DW4 A;  3EYY A;  2V1D A;  3MMY B;  5F04 A;  1JHH A;  1OCZ H;  1SC7 A;  1Z7U A;  4PJ0 C;  1J59 A;  1XMX A;  3OIQ A;  2COM A;  1MZB A;  2KIQ A;  3DBH B;  2VBZ A;  1YJW I;  3HPH A;  2Y69 H;  2A61 A;  3TO7 A;  3I53 A;  3HUG B;  5E79 C;  1U78 A;  3CMY A;  4G7O F;  5H2F C;  3W2W A;  5E18 F;  1AA7 A;  2A68 F;  3H35 A;  1P4X A;  1IXC A;  2KIU A;  4IHT A;  1OCC H;  1FIA A;  1C0W A;  1MBJ A;  3Q0V A;  1MMS A;  3OYN A;  4AYB N;  5TIS C;  4UVC A;  1WCM J;  2LC2 A;  5D5X B;  5J8F A;  2BBY A;  2E7X A;  5TJJ A;  4MTE A;  1A6Q A;  1X2N A;  2QLZ A;  1X1P A;  2FUG 2;  3FXO A;  2DT7 B;  3BY6 A;  3U2R A;  2MSY A;  4K2E A;  3H0D A;  1AU7 A;  1BA5 A;  3OY9 A;  3VEP A;  4HNV A;  4PZJ A;  1JJ6 C;  3GEZ A;  4L5J A;  3FK6 A;  2R7Z J;  1AKH B;  3NAR A;  1QBJ A;  4CIC A;  3DEE A;  3BG6 A;  2F5F A;  5M5Y J;  4IRG A;  3WHB A;  5CVJ A;  5LEK A;  1JKO C;  1ACI A;  5IYD J;  4RAY A;  4KT6 A;  4CCM A;  1WWX A;  5FFZ A;  2PJP A;  1OIS A;  1KYW A;  2LMD A;  4MQV A;  5F64 A;  2XRN A;  2HQN A;  3R4K A;  3TO6 A;  2CQ7 A;  3RDI A;  1FYL A;  1LDK B;  1S8N A;  2VLA A;  2F4O B;  3OYL A;  4ZJZ A;  1PJR A;  4E4H A;  1HLV A;  4FAS D;  3TP0 A;  1AHD P;  3MFK A;  2Z16 A;  3IH4 A;  1V4R A;  5BNG A;  4B47 A;  2PG4 A;  3HL2 A;  3HYI A;  4B44 A;  3H9J A;  1SVO A;  4XN3 A;  2H1K A;  3OSF A;  3GFM A;  1F5T A;  4IO9 F;  2WB1 N;  4BBS J;  1IDZ A;  2VT2 A;  3K4K A;  1U3E M;  1HOM A;  4YFN F;  5EEG A;  1OYY A;  1JKP C;  3ZMU A;  1TNT A;  2V9P A;  1DDN A;  4JBA A;  1W36 D;  3JAM Z;  1TWF J;  3AKZ A;  1H0M A;  4DJA A;  2L7M P;  2HVR A;  4KIS A;  5C4J J;  3W2V A;  2R5Z A;  1BR2 A;  2RRE A;  3S3M A;  2VPL A;  1A35 A;  1QPM A;  4LJZ F;  2FNP A;  4M9X A;  2DPU A;  3PQJ A;  4HDV A;  3GFI A;  5M3F J;  2FJ1 A;  3OYB A;  3PNT A;  4Q5S F;  1X2M A;  3DBL B;  1K7A A;  2M87 A;  1LVK A;  2OC6 A;  1RR7 A;  4A93 J;  3J7Z I;  4O6J A;  2DOE A;  1JHF A;  3PQK A;  4AC0 A;  2E7W A;  2LDU A;  3DPL C;  3HM5 A;  1FYK A;  4MEY F;  3AG3 H;  2DA2 A;  1MH3 A;  1UJ8 A;  2LF7 A;  3ZQH A;  3H36 A;  4L5I A;  4MQ9 F;  3LQR A;  4RS8 A;  1R49 A;  2LY1 A;  2DOF A;  3PM1 A;  3QWL A;  4C3I J;  1G6N A;  3WTY C;  2L02 A;  2R7U A;  4BEH A;  1QVT A;  1W5T A;  2Q0O A;  4LK0 F;  3BR2 A;  3BZ6 A;  1BR1 A;  4NC7 A;  3LA3 A;  2DTZ A;  2LH9 A;  1E0E A;  5HS9 A;  3TQN A;  1EH7 A;  2NS7 A;  3FWE A;  2E71 A;  5GPA A;  5E20 A;  3PO3 J;  4WWC A;  2XGC A;  2B0L A;  5AON A;  4IQJ A;  4XLF A;  1E3H A;  3R0A A;  1TC3 C;  5A2Q Z;  4PJJ A;  3HGG A;  3I55 I;  1ITY A;  2KRC A;  3JRD A;  2KIS A;  2VT3 A;  5FO5 A;  2KPM A;  2QVO A;  2VON A;  3CZ6 A;  3VOE A;  2F48 A;  3ZQI A;  1OR7 A;  2BV6 A;  4F7Z A;  1FSE A;  3GF2 A;  4XL9 A;  1O7F A;  4XLC A;  2PJR B;  2DA4 A;  2K5C A;  1G4D A;  2NRA C;  3A4C A;  2W00 A;  2C6Y A;  3ERE D;  4IHX A;  3KEO A;  1LJ9 A;  2DFE A;  2QUF A;  2YU3 A;  4X6A J;  3HRT A;  1K83 J;  2EV5 A;  2KRH A;  1JJ8 C;  1X1C A;  2FE3 A;  3I4M J;  4EAT A;  5J1U A;  2QSH X;  4BEH B;  3T8R A;  3WU1 B;  3SQN A;  2FQ4 A;  4DGW B;  1OQY A;  5K5O A;  2HS5 A;  4DZJ A;  3WGH A;  2QQ8 A;  1VQP I;  4ZTJ A;  3RJP A;  1IN6 A;  3QYB A;  2VC0 A;  2XAS A;  1CF7 B;  3EDP A;  1OPC A;  2O0Y A;  2RGV A;  2WV1 A;  1RR8 C;  1XSV A;  1R5I D;  3E5U A;  1XGM A;  3F3X A;  1OR7 C;  2DBB A;  1IC8 A;  4D7N A;  2DMU A;  3R0J A;  3CCV I;  1RES A;  3ZGK A;  2OF7 A;  2JUC A;  1B72 B;  2IGM A;  2XUB A;  1J7K A;  1I6X A;  1X4O A;  3DXJ F;  2V26 A;  1E17 A;  3CDI A;  2A05 A;  3BR0 A;  2L3D A;  1AKH A;  3OL3 A;  3M4O J;  3IKV A;  1BW5 A;  4DYC A;  3VSL A;  2MYS A;  2KL4 A;  5FLX K;  3BTC A;  1B4A A;  1MBG A;  3K69 A;  3HKZ N;  5F1J A;  4BE0 A;  4RGS A;  4U0Y A;  3BG5 A;  3U1D A;  1YOV B;  3IP4 B;  1LPQ A;  5EDN A;  3WGI A;  2HYF A;  3FKJ A;  1MDM A;  2GLO A;  3HJE A;  2KP6 A;  1Z6T A;  1SFK A;  5EEH A;  1HF0 A;  4A5M A;  2ACJ A;  2VQG A;  2PLY A;  1SD7 A;  2K4B A;  3PJR A;  1I50 J;  1XB4 A;  3CO6 C;  3ASN H;  2OQR A;  3WU0 A;  2Y75 A;  3RKW A;  1LNW A;  2OQG A;  1XSX A;  2ZNZ A;  4NBQ A;  2X6X A;  3JRC A;  2HYJ A;  3RZD J;  3SZT A;  3C2B A;  2VJ4 A;  2BOL A;  4DBQ A;  3C2G A;  3SXY A;  3ISP A;  5DV5 A;  3ZMD A;  2DU9 A;  2R7W A;  3KZZ A;  2QQ9 A;  3Q0W A;  4A6D A;  2GXB A;  2ZSI B;  3DPT A;  2R0Q C;  3CMM A;  3KX2 A;  1HKT A;  3CF2 A;  1WPK A;  1V5G A;  4BJ5 C;  1IGN A;  1BI0 A;  4ENJ A;  5K7Z A;  3M8J A;  5IY5 H;  2GIV A;  3J80 K;  1BJA A;  1ZEL A;  3BTJ A;  2PEX A;  3JRE A;  1HKQ A;  1JUM A;  2PMU A;  5CJ9 A;  4A12 A;  4PGG A;  4LB5 A;  2IXS A;  4KN4 X;  1IXR C;  2DO7 A;  3QRF F;  2G9W A;  2STT A;  2BGC A;  1VQL I;  4QSH A;  1XD7 A;  3SEQ A;  2ISY A;  4FE4 A;  2GA2 A;  4FQG A;  3I58 A;  2XAF A;  5E3N A;  4BUP A;  3TW6 A;  1TW2 A;  1RKW A;  1TQM A;  1FPQ A;  2PMZ N;  4WK8 F;  4MHG A;  1R71 A;  2DT5 A;  3I54 A;  3FX3 A;  4XKB A;  1YIJ I;  3CCU I;  4PDK A;  2JN6 A;  2DYR H;  2E5Z A;  2L9S A;  4KIB A;  1B8I A;  1OCO H;  2Y9Y A;  5FLX Z;  1USS A;  4IKF A;  2EFN A;  4YEL A;  1V5F A;  3ERM A;  2EQR A;  3KP7 A;  5ILS A;  3FHZ A;  4LLN A;  3G73 A;  1HKS A;  2ZXI A;  3Q9V A;  4HDU A;  4G7H F;  5FKO A;  1GXQ A;  2E35 A;  4GYG A;  4BGD A;  4LB6 B;  3TO9 A;  3W6J B;  4XK4 A;  1KYZ A;  3BCA A;  1RZ4 A;  1WJF A;  4BHB A;  2V1U A;  3MWM A;  1BI1 A;  1MD0 A;  4IF4 A;  3WTU C;  1B59 A;  1R00 A;  2QYO A;  1DGW Y;  5F0F A;  1R4M B;  4CH7 A;  1VQ7 I;  1YX5 A;  3T1B A;  3K4L A;  3WTZ A;  2EZL A;  3DU5 A;  1RET A;  2WY7 Q;  4P96 A;  3FXK A;  1U2W A;  2BY3 A;  1QNT A;  3BR6 A;  3GTO J;  2Y0S A;  4HX4 A;  4NUB A;  4ZC3 A;  4AIJ A;  4ENM A;  1HW2 A;  1W7P D;  2EIN H;  1T38 A;  2EZK A;  2CU7 A;  1SEU A;  2W57 A;  3COA C;  1JKR C;  4U7D A;  4M3D A;  2P6S A;  1QZZ A;  5LRS A;  2ESH A;  3IKT A;  3H5A A;  3L2C A;  1NH3 A;  2Z5U A;  1WHU A;  4F3Q A;  2Q2E A;  1DGR M;  4JX6 A;  1K4S A;  1WJA A;  3TOA A;  2GQQ A;  5DYM A;  2O6G E;  4WXH A;  2DOA A;  1QGP A;  4XLP F;  1DUX C;  1RIO H;  3BR1 A;  3M8E A;  4JX5 A;  3EUH A;  5F0C A;  5KHD A;  3JRI A;  5K5Q A;  2CUZ A;  2EIL H;  1M1E B;  1TWH J;  3DP7 A;  3GX4 X;  3E7L A;  5FLM J;  1ETQ A;  3CLO A;  2A6T A;  4NQW A;  1U8B A;  3F8F A;  3M9A A;  4UV8 A;  1R1V A;  2NVT J;  1IF1 A;  5BQT A;  5B1A H;  2W24 A;  4E7L A;  3FM5 A;  1LEA A;  3L2V A;  4CCO A;  5CYV A;  4F52 A;  1DP3 A;  2LD5 A;  1BOB A;  4E7J A;  3OYJ A;  3SJM A;  3B02 A;  5J6X A;  5K5R A;  1ZR2 A;  2HQA A;  2ZBK A;  2B7E A;  2CH0 A;  2Z3Y A;  3HIF A;  3BP8 A;  1ERD A;  5C3E J;  4G7Z F;  3K70 C;  3U1K A;  4ZYG A;  1XDU A;  4WXC A;  3ZQG A;  4LLL A;  2XF7 A;  1JT6 A;  4BNC A;  5KCM A;  2EV0 A;  3OL4 A;  5TRD A;  1MSE C;  2XPV A;  2ZNY A;  3HB9 A;  1UCR A;  3LSJ A;  1FBS A;  2M34 A;  4GGG A;  3W2A A;  1UMQ A;  4GDF A;  3MAJ A;  1X1A A;  2V6E A;  1Z3Y A;  5TGT A;  2BY0 A;  4XOR A;  5HDN A;  4WX9 A;  1MJ9 A;  1XTA A;  2V1N A;  4A3M J;  2D2W A;  2HKX A;  2A07 F;  1MMG A;  1VZ0 A;  1UG2 A;  3PNY A;  2MC3 A;  2EIK H;  3LAP A;  1Z9C A;  1LDJ A;  1ZQ3 P;  2VXD A;  3HZJ A;  3TDZ C;  3NEU A;  4B3A A;  2DA6 A;  3BG7 A;  5F27 A;  2P5V A;  2MA3 A;  3K4C A;  3JAM K;  3G1M A;  3H1C A;  3GTG J;  1I6H J;  2M4G A;  1SAN A;  1S29 A;  2RN7 A;  4M74 A;  3FXU A;  2EH3 A;  3TBI A;  2M0C A;  4Y15 A;  3K7A J;  1HBX G;  4IVN A;  4RB3 C;  1WJB A;  2ELK A;  2O7O A;  3LA7 A;  3OMY A;  1IRZ A;  1U5T A;  1I1G A;  2CV0 A;  1K61 A;  1IUF A;  3WTW C;  2WB1 A;  2H27 A;  2JRT A;  2GOX B;  4HW0 A;  1QU3 A;  2I10 A;  2LRE A;  5IP6 A;  2R7F A;  4EVI A;  2KFD A;  1SVL A;  2CMP A;  4IEJ A;  4E7K A;  2NAZ A;  1ZLK A;  1N77 A;  4P55 A;  2FQ3 A;  2IT0 A;  2HZD A;  2M5W A;  3DKW A;  3JCU C;  4L5E A;  3L2U A;  3OWT A;  2IS2 A;  4BHC A;  1R5H A;  1R7J A;  2X1E A;  3E6C C;  1GDT A;  4XSZ F;  3WU2 C;  4JP0 A;  3ZQC A;  9ANT A;  1Y1W J;  1UAA A;  3LSG A;  4IL6 C;  4E7I A;  2VOO A;  3VPR A;  2HOS A;  2E1O A;  4BAC A;  1XC5 A;  4M72 A;  1SD6 A;  5L3B A;  1R22 A;  1Y6I A;  3DQV C;  4NC6 A;  3IL2 A;  4U0W A;  3KP6 A;  2V7F A;  3JRG A;  2BXZ A;  3FDY A;  2QBY A;  1S7O A;  2L4M A;  1OLT A;  3ONQ A;  2CO5 A;  2WAQ N;  3OYH A;  2MG4 A;  1OJL A;  5LGN A;  2HOT A;  3DKY A;  3HPG A;  4L0Z B;  1N25 A;  3CJN A;  3WTV C;  1HSJ A;  3MVP A;  4HSR A;  3VFZ A;  2JQ7 A;  2MBF A;  2W25 A;  2BVM A;  4AVZ A;  4A69 C;  1D0Z A;  3OOU A;  2DLL A;  3OV8 A;  1RC9 A;  3DV8 A;  2KZV A;  4XBF A;  4BBR J;  3V8L A;  3JW4 A;  1R58 A;  4A6E A;  3M1C A;  4EV0 A;  5HOO A;  1QZY A;  2Y9Z A;  1SMT A;  4L9J A;  5L3D A;  2LKS A;  2YS9 A;  3JTG A;  3CC2 I;  3BCB A;  3IC7 A;  1Y1V J;  4KJZ A;  3IWZ A;  4CDG A;  3OYE A;  5CQE A;  4XQF A;  2WAD A;  3J81 K;  1Z91 A;  1VQK I;  4LMY A;  4OAY A;  4Y4R A;  1FLI A;  4M71 A;  2BXY A;  5FKL A;  3FHN A;  4FE7 A;  3I5U A;  1H88 C;  4AVP A;  1L0O C;  1HQC A;  2R7O A;  5B66 C;  1KU9 A;  3GWZ A;  4M6X A;  4RB0 A;  3BZK A;  1W0T A;  4PSW A;  4JYK A;  2L5Q A;  5IYC J;  1YJN I;  2RVC A;  5HLG A;  3KP5 A;  5HLH A;  3BR5 A;  3ZQ7 A;  3V8K A;  1TLH B;  1ZRD A;  1N78 A;  3A03 A;  2DA5 A;  5J8C A;  1OMI A;  4ZYH A;  2LSO A;  3CCY A;  3FMQ A;  3I59 A;  1ETK A;  1XS9 A;  3ABU A;  4TV7 A;  3LFK A;  4CCK A;  4IHV A;  2R7X A;  4CSW A;  4I7H A;  4NB5 A;  3HTU A;  4BJT A;  2RQP A;  2TDX A;  2R7V A;  3I59 B;  4HYE A;  3S2H J;  5EZG A;  2YR2 A;  4AWX B;  3I9V 2;  2DK5 A;  2VBY A;  2KT0 A;  2OU2 A;  3EPZ A;  4UUS A;  2OJE D;  3S2D J;  1R5G A;  3W3C A;  4EJU A;  3CCQ I;  3DTK A;  4CZZ A;  5D5V B;  2WAF A;  2HR3 A;  1PP7 U;  1VQO I;  5BPD A;  2F5C A;  4UVB A;  1EV7 A;  1JT0 A;  2WAE A;  3JR9 A;  1LFU P;  4IQ4 A;  4XLA A;  3L7W A;  3AL0 C;  3K2A A;  2O3F A;  3BPX A;  2FOW A;  2K86 A;  3HRU A;  3RCO A;  1HW1 A;  3H9G A;  3I64 A;  4BJ6 C;  1S72 I;  3K70 D;  1F43 A;  2IA2 A;  1S5L C;  1XCB A;  4PJL A;  1TT5 B;  2M7B A;  2ETH A;  2R93 J;  2P8T A;  3QPS A;  2DYS H;  3OYK A;  3KZI C;  3LST A;  3I56 I;  1H9G A;  2XC7 A;  2WV0 A;  3R60 A;  4XOP A;  4KIF A;  2H8W A;  3KP4 A;  1BW6 A;  4D0P A;  2FD5 A;  4OIQ F;  3LL7 A;  5CQG A;  1W0U A;  2E5N A;  2JA8 J;  3KP2 A;  5C4X J;  3J7A Y;  4PGH A;  2AXL A;  2PMH A;  4BDZ A;  1WI3 A;  2OBP A;  2XGX A;  3MQ0 A;  2EA2 A;  1YFH A;  4LIU A;  4E70 A;  4PCQ A;  3D5L A;  4CGZ A;  3J7Y J;  1FOX A;  4GXO A;  3HOY J;  3IWF A;  3K4M A;  4ZYE A;  1ZN2 A;  2KJC A;  1YQA A;  5LGU A;  1FEX A;  5B1B H;  1D8J A;  1YLF A;  1FX7 A;  4E7H A;  3M7G A;  2K3P A;  2XB0 X;  4HLX A;  3SDB A;  4HG2 A;  2ZME A;  3MKW B;  3J7A O;  2DMN A;  1ODD A;  4PFP A;  1G3S A;  2DMQ A;  2QQA A;  1XGO A;  2ELH A;  3M07 A;  1W7P B;  4ZTF A;  4JK1 X;  3D5R C;  1ON2 A;  2XAH A;  3UKG A;  2DFF A;  4N9I A;  4J01 A;  1YRN B;  2JSP A;  3TMO A;  4E7S A;  3PO2 J;  1U9N A;  2F4I A;  4WCG A;  2K02 A;  2CQK A;  2MH9 A;  1IV6 A;  3H5R A;  3RPQ A;  4YEJ A;  3S8P A;  2L9V A;  2V79 A;  4OMZ A;  5HS8 A;  1P2F A;  1Z21 A;  3GZN B;  4FCY A;  1ETO A;  3S1Q J;  3M8F A;  5ICF A;  2XSD C;  1PUF B;  5JVG F;  4XRM A;  1LEB A;  5DCF A;  4IOA F;  4UY8 I;  2W7N A;  1HXD A;  4N9H A;  3ABM H;  2YX7 A;  5EG0 B;  4KUM A;  4HQE A;  2ECC A;  2LTP A;  1QO0 D;  2OTL I;  2QZ8 A;  4FIS A;  3IAM 2;  2F2E A;  1TTY A;  2XPW A;  3TW7 A;  5D8L B;  4XLH A;  1QA6 A;  2DA3 A;  1SVM A;  2GAU A;  1UST A;  1STZ A;  1Z7L A;  1EH8 A;  1I1S A;  4ZDP A;  3JSO A;  3E6B A;  3WTS C;  1YJ9 I;  1IJW C;  3WTX C;  3GW2 A;  3DEW A;  4BY7 J;  2WY8 Q;  1YTY A;  1YE9 A;  2DCE A;  2E1M C;  2ZJ2 A;  4KA4 A;  2R7R A;  3CO7 C;  2Z1D A;  4A3L J;  2VBX A;  1WJE A;  2XSJ C;  5EZH A;  1UB9 A;  5CKT A;  4IHS A;  2IJL A;  4ENK A;  4KYW A;  4MEX F;  1P9Q C;  3CDH A;  4DZP A;  2XRO A;  4RB1 A;  4CUG A;  5K7F A;  5EG0 A;  4DIQ A;  2E2I J;  3TKY A;  2OD5 A;  1DP7 P;  2ID6 A;  3FF5 A;  3SYT A;  1XN7 A;  3VB2 A;  2R3S A;  3CC4 I;  2DMT A;  3F8N A;  4ZYA A;  2QSF X;  3C7J A;  3LSM A;  3IH2 A;  5IPA A;  5LBQ A;  3CD6 I;  4BQO A;  1R1U A;  1P92 A;  5JVT A;  3HXL A;  1XCV A;  3KYD B;  2MLK A; 
#chains in the Genus database with same CATH homology
 4U88 A;  5LHH A;  4DQ2 A;  1W5S A;  4ZZD A;  3RKX A;  3BWG A;  3QP6 A;  4XRF A;  2IA0 A;  1MKM A;  1P4A A;  1IN4 A;  2ZME B;  4I02 A;  5LLQ A;  5LRR A;  4ESF A;  4EQQ A;  1ZAO A;  2DTR A;  3D0S A;  3F23 A;  1IW7 F;  5H6Q A;  1REP C;  3F21 A;  3LWF A;  1XGN A;  3B73 A;  4EJO A;  4HBL A;  1ZRF A;  4EGZ A;  4FT8 A;  2CGP A;  2EFP A;  2CG4 A;  2DAO A;  5AIP A;  1BC7 C;  2NNN A;  2KRF A;  3VOD A;  1K78 A;  1HW5 A;  4HF2 A;  3GUD A;  4IRH A;  3F8B A;  3ZMZ A;  1ZG5 A;  1O57 A;  1UHM A;  1BI2 A;  1ZG3 A;  3BDD A;  3DEU A;  1FOK A;  3ZP5 A;  3OOP A;  3F6O A;  1QQI A;  3TDU C;  1OYW A;  4LLG F;  2OAZ A;  3RYR A;  2DI3 A;  2FEZ A;  3WGG A;  2ISZ A;  6PAX A;  2PFB A;  1RUO A;  4KIC A;  1BIA A;  4ZH4 F;  2VOP A;  3CTA A;  2OA4 A;  1T2K A;  4EJV A;  4HF0 A;  1J5Y A;  4KMU X;  5F1R A;  5FGM A;  2DK8 A;  4R8H A;  3F6V A;  3KCC A;  1XCV A;  2R7D A;  3P9C A;  5D6E A;  3H3Z A;  2EV6 A;  4ZZL A;  2VE9 A;  4N0B A;  5IT9 Z;  4L0Y B;  4MTD A;  1B9N A;  2DQL A;  3V7S A;  1MDM B;  2FMY A;  4GYI A;  4FX4 A;  4YIF A;  3ECO A;  4Y17 A;  1WI9 A;  1S7A A;  4MGR A;  5BOX A;  1MGT A;  2AS5 F;  2L54 A;  2Z33 A;  3EQL F;  3KLN A;  5DD8 A;  2DPD A;  1BIB A;  2F5E A;  1PP8 F;  2EK5 A;  2FA5 A;  4KFC A;  2VBW A;  3I71 A;  1JE8 A;  4EJT A;  4P9U A;  4HAM A;  3KEQ A;  3T8T A;  5D4R A;  3REO A;  1GXP A;  5LHG A;  4M9S A;  5LGT A;  3ZMT A;  4I0B A;  5H6R A;  4IPA A;  1XDS A;  4M9Z A;  1GHC A;  4R1H A;  3HSE A;  1FBQ A;  4LFU A;  5JR3 A;  4HZF A;  4EMS A;  1U5T C;  4O5V A;  1YG2 A;  2L4A A;  4Q47 A;  2DQR A;  3TOB A;  1B6A A;  1SFE A;  3RYP A;  5ERI A;  4KN7 X;  2PI0 A;  4XLN F;  1Q1H A;  4A0X A;  2IP2 A;  5FB2 A;  1U5T B;  3GXO A;  3QAH A;  1ULY A;  3LA2 A;  2WTE A;  1OKR A;  2PN6 A;  3RTR A;  1S3J A;  3BOQ A;  3HOS A;  2QBY B;  3ROU A;  2V1X A;  3Q9S A;  4OU0 A;  3R61 A;  3K1M A;  5K1Y A;  2HTJ A;  3F22 A;  3BJA A;  5E1X A;  2HDC A;  2YX4 A;  3EET A;  5HVQ C;  1G3W A;  4CXF A;  1TW3 A;  2V6C A;  4A0Z A;  2HEO A;  1D5V A;  2Z9O A;  2EWN A;  1UFM A;  1F9N A;  1UHW A;  1PUE E;  3DF8 A;  2Y48 A;  3QPT A;  2A5Y B;  5DUK A;  2Z99 A;  1Z6R A;  3JTH A;  2WWY A;  3H3U A;  2FF4 A;  3ECH A;  4HV6 A;  2QEN A;  2XHK A;  3K9T A;  5E8I A;  1FWZ A;  3U9G A;  1YIO A;  1G3Y A;  3F8C A;  2A6H F;  2GWR A;  1F1Z A;  5DEQ A;  1VTN C;  4L9T A;  5H20 A;  2J5P A;  5LEJ A;  4BYY A;  2V9V A;  4CHU A;  4H0E A;  5A2Q K;  3L09 A;  1YS7 A;  3FMR A;  1ZRE A;  2MLG A;  1T98 A;  5IT9 K;  1T39 A;  3CUO A;  4GCV A;  4L9N A;  1YW8 A;  3GO5 A;  4JQF A;  3BRO A;  1IN5 A;  4KNY A;  4BH9 A;  1L3L A;  1KA8 A;  3E3V A;  2GZW A;  5L3C A;  3QPH A;  1XSD A;  3HHG A;  2STW A;  4YG2 F;  4HA8 A;  3WG9 A;  2EJR A;  2FSW A;  3BPV A;  3KFW X;  3E97 A;  3HSF A;  1H9T A;  1J2X A;  4U0V A;  4CYD A;  3GZ5 A;  4UNO A;  1FNN A;  1BI3 A;  2A69 F;  2ZFW A;  3GFJ A;  2VE8 A;  1LB2 A;  3P7N A;  2P6T A;  3WOD F;  1TQI A;  2O61 A;  3JSP A;  3WTT C;  2FU4 A;  3M1E A;  1X3U A;  1CF7 A;  1CGP A;  1KQ0 A;  4YFK F;  2K7L A;  1YYV A;  5HLI A;  4IRI A;  3KE2 A;  1D8K A;  5BMZ A;  3EYI A;  1S6L A;  2P5L C;  4Y13 A;  4Q48 A;  2FRH A;  4YII A;  2FXA A;  4U7B A;  4DNC A;  3FMS A;  4B8X A;  2LF8 A;  2M8E A;  2ZCW A;  4EM0 B;  5D6F A;  1SD5 A;  4A0Y A;  3L00 A;  1WSU A;  1FBU A;  4M73 A;  5FD6 A;  4EM2 A;  2CYY A;  5HDG A;  4G94 A;  2BE5 F;  4Q4Z F;  1F4K A;  2NS0 A;  2J5O A;  1Z05 A;  1T6S A;  3K2Z A;  2UWM A;  1T0F A;  2D1V A;  4RAZ A;  5ILV A;  1IN7 A;  4P9F A;  1TBX A;  2HFH A;  1RI7 A;  1I5Z A;  3K1N A;  3ZN0 A;  2ZKZ A;  3HTS B;  4I2O A;  3PFI A;  1P6R A;  1J9I A;  1TNS A;  3MZH A;  3R6S A;  1O3R A;  4HLY A;  4HX8 A;  3E5Q A;  4ESB A;  1SMY F;  4AD9 A;  3KP3 A;  2LNB A;  4R79 A;  4M6Y A;  2VN2 A;  1LDD A;  2KKO A;  3O2P E;  5D8K B;  2CFX A;  4OIP F;  2PQ8 A;  2K4J A;  2H6B A;  3V8J A;  2X0L A;  3V7C A;  4P5O A;  5DD4 A;  3W6K B;  4MNU A;  2MH2 A;  2O8X A;  3QOP A;  2JZY A;  5CLS A;  3AAF A;  1R36 A;  2BYV E;  1B9M A;  2RV8 A;  4LD5 A;  4GO1 A;  4WF2 A;  4IJA A;  3N4M A;  4AIK A;  1K6O A;  3L9F A;  2XIG A;  2MLK A;  4A2U A;  5CVI A;  1K78 B;  4OMY A;  3HHH A;  3O6B B;  1ZGJ A;  1YW9 A;  3C3W A;  1DPU A;  2EA4 A;  3QU3 A;  2JPB A;  5E1Z B;  1BN5 A;  3RKY A;  1WKM A;  1I27 A;  2JTV A;  1SFX A;  2WC2 A;  1DPR A;  2UXN A;  1W4M A;  2HOE A;  4G8X A;  5D4S A;  2VOD A;  4RGX A;  4FHT A;  3RI4 A;  1O7L A;  2PBI A;  2JSC A;  1IN8 A;  1ZHF A;  2XVC A;  2HZT A;  1O3S A;  2FOK A;  4A5N A;  3P9K A;  4BQA A;  1KU3 A;  5LHI A;  3J80 Z;  1MJB A;  5F6F A;  2EB7 A;  2Q8K A;  1FP1 D;  1IRF A;  2M30 A;  1O3T A;  3MZY A;  1WQ2 A;  1D3Y A;  1IZ1 A;  5KK1 A;  4EGY A;  2HTS A;  1GVJ A;  3IRQ A;  4LK1 F;  5E8G A;  1IAW A;  3K1P A;  2FBK A;  2GA1 A;  4EM1 A;  5E1W A;  1ZGA A;  5HDK A;  2QWW A;  2E1N A;  2CSO A;  2XAQ A;  3N97 A;  2HQR A;  4QWQ A;  2E1C A;  2MD5 A;  4RGR A;  4L18 B;  1ZLJ A;  2FBH A;  3ABT A;  1IUY A;  2VXZ A;  4KDP A;  5D5W B;  4BHP A;  3SHF A;  1B1B A;  3C18 A;  5DCM A;  2ZO4 A;  4HF1 A;  3HUG A;  2IA1 A;  2IRF G;  2L01 A;  1J75 A;  5FD5 A;  2M45 A;  2ADU A;  1EH6 A;  3CUQ A;  2CWE A;  4I01 A;  2VC1 A;  3SZP A;  1A04 A;  3H92 A;  2FBI A;  1W7P A;  4ENN A;  5ICC A;  3FXQ A;  5BPI A;  2ESN A;  3HSR A;  4Z2Y A;  4OIR F;  2W85 A;  3ELK A;  1R23 A;  3BJ6 A;  3SFZ A;  5L3E A;  2H94 A;  1JGS A;  5ED4 A;  1KQ8 A;  4O3M A;  2KIF A;  3WE2 A;  2D1H A;  1ZRC A;  1HST A;  5ILU A;  2A3S A;  3MEX A;  3DFG A;  5DCM B;  3HRM A;  4I0A A;  1V3F A;  2O03 A;  3V7R A;  3ZN1 A;  2QQB A;  1FSH A;  2NNY A;  2G7H A;  3WE3 A;  3ZPL A;  2HYG D;  1WRJ A;  2OZU A;  4HOB A;  1FY7 A;  1E2X A;  2F5D A;  4QLC U;  5L3G A;  4HQM A;  1FZP B;  1ZH5 A;  4LG0 B;  2FNA A;  3C1D A;  4BAY A;  3BJO A;  3G3Z A;  1BBY A;  1U6G A;  1SAX A;  1SD4 A;  3KLO A;  4G6Q A;  1MJA A;  4EJW A;  3NQO A;  1U8R A;  5L3F A;  5FFX A;  2NYX A;  3HOT A;  4UXN A;  4B09 A;  2IPQ X;  4XSX F;  5JI6 A;  3MCZ A;  3S2W A;  1ON1 A;  5ICG A;  3KZY A;  4I09 A;  5DUI A;  4G9Y A;  3E5X A;  3ULQ B;  4OIN F;  3ZMV A;  5HS7 A;  2X4H A;  2P7C B;  2LKP A;  3IRR A;  5D5U B;  1SFU A;  3KET A;  2P7V B;  4AIH A;  1FYM A;  4CO8 A;  4S04 A;  5AIQ A;  1OYI A;  4S05 A;  4HV5 A;  1ZG1 A;  3RPU A;  1K79 A;  1NHA A;  5JHU A;  1J0R A;  2XKO A;  5IT3 A;  5ICE A;  3T0Y A;  1KU2 A;  3QP5 A;  1RNL A;  2CW0 F;  2XKP A;  2EFW A;  1FP2 A;  4UHT A;  3J81 Z;  4ESJ A;  2KIM A;  2XV4 S;  3GLX A;  2XAG A;  3T5X A;  1ZAR A;  3P9I A;  1KQ9 A;  2UXX A;  3GFL A;  4ON0 A;  5E17 F;  1G3T A;  2Y0M A;  2JT1 A;  1Z1D A;  1LQ1 A;  2H6C A;  2ZXJ A;  3LAJ A;  4RB2 C;  2P4W A;  2XAJ A;  1AOY A;  4I98 B;  5DDG A;  1KU7 A;  4YFX F;  3GZ6 A;  3TGN A;  1YO5 C;  1Y0U A;  3ML6 A;  1IRG A;  1BC8 C;  2K27 A;  1R1T A;  4UUV A;  2RC4 A;  2JPC A;  2HGC A;  4LG0 A;  2H09 A;  3HRS A;  5CVR A;  1XMK A;  3RIR A;  3O3K A;  2HWV A;  2OZ6 A;  4UV9 A;  1FC3 A;  4ETS A;  5CVU A;  2EFO A;  2QM3 A;  2G7U A;  1PDN C;  4IXA A;  2YPR A;  1LVA A;  2P5K A;  4HX7 A;  1YW7 A;  1YS6 A;  3GYH X;  5CVV A;  4RGU A;  4OIO F;  4KT5 C;  2HKO A;  3Q5F A;  1XMA A;  2RNJ A;  4ZYD A;  4KIG A;  3I4P A;  3FXR A;  3IHU A;  2IVM A;  2RKH A;  4NHJ A;  3F72 A;  4FX0 A;  4KMF A;  1P4W A;  4WXD A;  1IXS B;  3E6M A;  1BOA A;  3CUQ C;  5BS6 A;  2KJB A;  2A6E F;  4UVA A;  2M1B A;  3E6D A;  3GVA A;  4BXU A;  3NRV A;  3I0T A;  1ZYR F;  3FM3 A;  2DFI A;  1RUN A;  2YSR A;  1JXS A;  1FT9 A;  3F8M A;  2D45 A;  3CUQ B;  1AWC A;  1O3Q A;  3QU6 A;  5KVR A;  2UZK A;  3FZV A;  2IW5 A;  1XGS A;  4L9V A;  4ASN A;  2BEO A;  1BM9 A;  1TQP A;  2FML A;  3K0L A;  3V4G A;  2W84 A;  3ZMS A;  4LGW A;  1KGS A;  1ONV A;  4OOI A;  2EFQ A;  2GXG A;  2RDP A;  5JFR A;  4G6D A;  2DW4 A;  3EYY A;  2V1D A;  1JHH A;  1Z7U A;  1J59 A;  2COM A;  1MZB A;  2VBZ A;  2A61 A;  3TO7 A;  3I53 A;  1U78 A;  4G7O F;  5E18 F;  2A68 F;  1P4X A;  1IXC A;  2KIU A;  4IHT A;  1C0W A;  4UVC A;  5D5X B;  5J8F A;  2BBY A;  2E7X A;  5TJJ A;  4MTE A;  2QLZ A;  3BY6 A;  3U2R A;  4K2E A;  3VEP A;  4PZJ A;  3GEZ A;  4L5J A;  1QBJ A;  4CIC A;  2F5F A;  4IRG A;  5CVJ A;  5LEK A;  4RAY A;  1WWX A;  5FFZ A;  2PJP A;  1KYW A;  4MQV A;  5F64 A;  3TO6 A;  2XRN A;  2HQN A;  3R4K A;  3RDI A;  1FYL A;  1LDK B;  1S8N A;  3MFK A;  1V4R A;  2PG4 A;  3HYI A;  3GFM A;  1F5T A;  2VT2 A;  1U3E M;  4YFN F;  5EEG A;  1OYY A;  3ZMU A;  1TNT A;  1DDN A;  4JBA A;  3JAM Z;  1H0M A;  1QPM A;  4LJZ F;  2FNP A;  4M9X A;  2DPU A;  3PQJ A;  4HDV A;  3GFI A;  4Q5S F;  1K7A A;  2M87 A;  4O6J A;  1JHF A;  3PQK A;  2E7W A;  2LDU A;  3DPL C;  1FYK A;  4MEY F;  2LF7 A;  4L5I A;  4MQ9 F;  3LQR A;  4RS8 A;  3WTY C;  1G6N A;  2L02 A;  1W5T A;  2Q0O A;  4LK0 F;  3BZ6 A;  3LA3 A;  5HS9 A;  3TQN A;  1EH7 A;  3FWE A;  5E20 A;  4WWC A;  2B0L A;  5AON A;  3R0A A;  5A2Q Z;  2VT3 A;  5FO5 A;  2QVO A;  2VON A;  3VOE A;  4F7Z A;  1OR7 A;  2BV6 A;  1FSE A;  3GF2 A;  1O7F A;  1G4D A;  2NRA C;  2C6Y A;  3ERE D;  3KEO A;  1LJ9 A;  2YU3 A;  2QUF A;  3HRT A;  2EV5 A;  2FE3 A;  3T8R A;  3WU1 B;  3SQN A;  5K5O A;  2HS5 A;  3WGH A;  3RJP A;  1IN6 A;  2VC0 A;  2XAS A;  1CF7 B;  3EDP A;  1OPC A;  2O0Y A;  2RGV A;  1XSV A;  3E5U A;  1XGM A;  3F3X A;  2DBB A;  3R0J A;  2XUB A;  1J7K A;  1I6X A;  3DXJ F;  1E17 A;  2L3D A;  3IKV A;  5FLX K;  1B4A A;  3K69 A;  4RGS A;  4U0Y A;  3U1D A;  3WGI A;  2HYF A;  1MDM A;  1Z6T A;  5EEH A;  4A5M A;  2ACJ A;  2PLY A;  1SD7 A;  2K4B A;  1XB4 A;  3CO6 C;  2OQR A;  3WU0 A;  2Y75 A;  3RKW A;  1LNW A;  2OQG A;  1XSX A;  2ZNZ A;  3SZT A;  3J81 K;  3ZMD A;  3SXY A;  3ISP A;  5DV5 A;  2DU9 A;  3KZZ A;  2QQ9 A;  4A6D A;  2GXB A;  3DPT A;  1HKT A;  1BI0 A;  4ENJ A;  2GIV A;  3J80 K;  1BJA A;  2PEX A;  1HKQ A;  2PMU A;  5CJ9 A;  4A12 A;  4LB5 A;  4PGG A;  4KN4 X;  1IXR C;  2DO7 A;  3QRF F;  2G9W A;  2STT A;  2BGC A;  1XD7 A;  2ISY A;  2GA2 A;  3I58 A;  2XAF A;  1TW2 A;  1TQM A;  1FPQ A;  4WK8 F;  4MHG A;  2DT5 A;  3I54 A;  3FX3 A;  4PDK A;  4KIB A;  5FLX Z;  1USS A;  2EFN A;  5ILS A;  3FHZ A;  3KP7 A;  4LLN A;  3G73 A;  1HKS A;  3Q9V A;  4HDU A;  4G7H F;  1GXQ A;  4GYG A;  4LB6 B;  3TO9 A;  3W6J B;  1KYZ A;  1RZ4 A;  4BHB A;  2V1U A;  3MWM A;  1BI1 A;  1MD0 A;  4IF4 A;  3WTU C;  1B59 A;  1R00 A;  2QYO A;  3T1B A;  3WTZ A;  4P96 A;  1U2W A;  1QNT A;  4HX4 A;  4AIJ A;  4ENM A;  1HW2 A;  1W7P D;  1T38 A;  2W57 A;  3COA C;  4U7D A;  2P6S A;  1QZZ A;  5LRS A;  2ESH A;  3IKT A;  3L2C A;  2Z5U A;  2Q2E A;  3TOA A;  2GQQ A;  5DYM A;  2O6G E;  4WXH A;  1QGP A;  4XLP F;  1DUX C;  1RIO H;  3M8E A;  3EUH A;  5K5Q A;  3DP7 A;  3GX4 X;  3CLO A;  4NQW A;  3F8F A;  3M9A A;  4UV8 A;  1R1V A;  1IF1 A;  5BQT A;  2W24 A;  3FM5 A;  1LEA A;  5CYV A;  3B02 A;  5J6X A;  5K5R A;  2ZBK A;  2Z3Y A;  3HIF A;  3BP8 A;  4G7Z F;  4ZYG A;  1XDU A;  4WXC A;  4LLL A;  4BNC A;  5TRD A;  2EV0 A;  2ZNY A;  1UCR A;  1FBS A;  4GGG A;  3MAJ A;  4WX9 A;  5HDN A;  1MJ9 A;  2D2W A;  2HKX A;  2A07 F;  3LAP A;  1Z9C A;  2MC3 A;  1LDJ A;  3TDZ C;  3NEU A;  2P5V A;  2MA3 A;  3JAM K;  1S29 A;  2RN7 A;  4M74 A;  3FXU A;  4Y15 A;  1HBX G;  4IVN A;  4RB3 C;  3LA7 A;  1U5T A;  1I1G A;  3WTW C;  2H27 A;  2JRT A;  4HW0 A;  2R7F A;  4EVI A;  1ZLK A;  2NAZ A;  4P55 A;  2FQ3 A;  2IT0 A;  2M5W A;  3DKW A;  4BHC A;  1R5H A;  1R7J A;  3E6C C;  4XSZ F;  2VOO A;  4M72 A;  1SD6 A;  5L3B A;  1R22 A;  3IL2 A;  3DQV C;  4U0W A;  3KP6 A;  2QBY A;  1S7O A;  2L4M A;  2CO5 A;  4L0Z B;  3WTV C;  3CJN A;  1HSJ A;  3VFZ A;  2MBF A;  2W25 A;  3OV8 A;  2DLL A;  3DV8 A;  4XBF A;  3V8L A;  3JW4 A;  1R58 A;  4A6E A;  4EV0 A;  5HOO A;  1QZY A;  1SMT A;  4L9J A;  5L3D A;  3JTG A;  3IC7 A;  4CDG A;  3IWZ A;  1Z91 A;  4LMY A;  1FLI A;  4M71 A;  3I5U A;  4AVP A;  1L0O C;  1HQC A;  1KU9 A;  3GWZ A;  4M6X A;  4RB0 A;  2RVC A;  5HLG A;  3KP5 A;  5HLH A;  1ZRD A;  3ZQ7 A;  3V8K A;  1TLH B;  5J8C A;  1OMI A;  4ZYH A;  2LSO A;  3FMQ A;  3I59 A;  3ABU A;  4TV7 A;  3LFK A;  4I7H A;  4NB5 A;  3HTU A;  2RQP A;  2TDX A;  3I59 B;  4HYE A;  2YR2 A;  4AWX B;  2DK5 A;  2VBY A;  2OU2 A;  1R5G A;  4EJU A;  4CZZ A;  5D5V B;  2HR3 A;  1PP7 U;  5BPD A;  2F5C A;  4UVB A;  1EV7 A;  3L7W A;  2O3F A;  3BPX A;  2K86 A;  3HRU A;  1HW1 A;  3I64 A;  2IA2 A;  1XCB A;  2ETH A;  2P8T A;  3LST A;  1H9G A;  2WV0 A;  3R60 A;  4KIF A;  3KP4 A;  4D0P A;  4OIQ F;  3KP2 A;  4PGH A;  2AXL A;  2PMH A;  3MQ0 A;  2OBP A;  2XGX A;  1YFH A;  2EA2 A;  4E70 A;  4PCQ A;  3D5L A;  4CGZ A;  4GXO A;  3IWF A;  4ZYE A;  1ZN2 A;  2KJC A;  1YQA A;  5LGU A;  1D8J A;  1YLF A;  1FX7 A;  3M7G A;  4HLX A;  2ZME A;  3J7A O;  1ODD A;  1G3S A;  2QQA A;  1XGO A;  2ELH A;  1W7P B;  4JK1 X;  1ON2 A;  2XAH A;  4N9I A;  4WCG A;  2K02 A;  2CQK A;  2MH9 A;  3RPQ A;  2V79 A;  4OMZ A;  5HS8 A;  1P2F A;  3M8F A;  5ICF A;  1LEB A;  5DCF A;  1HXD A;  4N9H A;  2YX7 A;  4KUM A;  4HQE A;  1QO0 D;  2QZ8 A;  2F2E A;  1TTY A;  5D8L B;  2GAU A;  1UST A;  1STZ A;  1EH8 A;  1I1S A;  3JSO A;  3E6B A;  3WTS C;  3WTX C;  3GW2 A;  1YTY A;  2ZJ2 A;  4KA4 A;  3CO7 C;  2VBX A;  4IHS A;  1UB9 A;  2IJL A;  4ENK A;  4KYW A;  4MEX F;  3CDH A;  2XRO A;  4RB1 A;  3TKY A;  2OD5 A;  1DP7 P;  3FF5 A;  1XN7 A;  3VB2 A;  2R3S A;  3F8N A;  3C7J A;  5LBQ A;  1R1U A;  1P92 A;  5JVT A;  5LGN A;  3LQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...