2YPRA

Crystal structure of the dna binding ets domain of human protein fev
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
b'KGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FEV
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yprA00
4IHTA 1J7KA 2VBZA 3E6BA 5E8IA 2A61A 2M1BA 1SMTA 1XGSA 3ERED 3V8LA 3K2ZA 1EV7A 2QQBA 1MZBA 4IPAA 3F23A 5D5XB 1G4DA 2NRAC 4LD5A 3GLXA 5KK1A 2ZMEB 1ZAOA 2H27A 3HIFA 1FP1D 3HUGA 4CO8A 4O5VA 1FC3A 4MEXF 3GWZA 3HHHA 1FLIA 1LDJA 2D45A 2DPUA 2FQ3A 5FB2A 2K4JA 4ZZLA 5F1RA 1BC8C 4YFXF 3TO6A 4CZZA 2M8EA 3O6BB 4UVBA 2VE9A 1U2WA 4PGGA 2HKOA 3SZPA 1STZA 4LG0B 4OU0A 1WRJA 2EV5A 4HX4A 1YLFA 4YIFA 3FXRA 4L5JA 1HW2A 2J5OA 1TQPA 1PDNC 4RGXA 3MEXA 1XGMA 2MLKA 1YTYA 4L5IA 1OYIA 2OQGA 4EVIA 4RGRA 2EFWA 2JRTA 3F72A 3LQRA 1XB4A 3N4MA 1BI1A 3LFKA 1FY7A 1B9MA 4R1HA 2FOKA 2XAQA 1MJAA 2GQQA 5JVTA 3WE3A 1D8KA 4TV7A 2EV0A 4P96A 1KA8A 1WQ2A 2RKHA 1MGTA 4M73A 2BV6A 2GAUA 5EEGA 1BI0A 3M7GA 5BQTA 1P2FA 3CDHA 2E7XA 4E70A 1BBYA 1FBQA 4O6JA 2M45A 2E1CA 3GX4X 4MEYF 1Z7UA 3JTHA 3Q5FA 4D0PA 4LFUA 2OBPA 2F5CA 2W57A 2W84A 3R0JA 1TNTA 4Y17A 4HOBA 3FX3A 2L3DA 1Z6RA 2QWWA 4A6EA 1IXCA 4L18B 4A0YA 5IT9K 4WXCA 3NEUA 2V1UA 2XROA 4QWQA 4M72A 1XMAA 2HQRA 2K7LA 4UHTA 4HDVA 1HSJA 4U0YA 3QU3A 1J0RA 3ML6A 1ZHFA 4ENJA 1KU2A 3QP5A 4JBAA 3VOEA 1MKMA 1FYKA 1JHFA 3DV8A 4U88A 4KFCA 5FGMA 1U5TB 1I5ZA 4HQEA 4OIOF 2NYXA 4L9TA 2ESHA 2B0LA 3E5UA 1LVAA 4LK1F 3WU0A 4ESJA 3BP8A 3DKWA 2PLYA 1KGSA 3GFMA 1F5TA 2A3SA 1IN6A 1IZ1A 2DBBA 5EEHA 2KRFA 3CO7C 5BMZA 5J8FA 1R1VA 2WV0A 5E20A 3HTSB 3BROA 1O3SA 1SMYF 1Z1DA 2MC3A 2L02A 4HBLA 5FO5A 1RUNA 1DP7P 1OR7A 3J80Z 4KDPA 1QGPA 2QLZA 1KQ8A 3HHGA 3CUQA 2V79A 3BJOA 3F6VA 1T2KA 3T8TA 3OV8A 2L01A 5FD5A 3MZHA 1ZARA 4AIHA 3BY6A 2BEOA 1Z91A 3ZMTA 3QRFF 2KIFA 3V8JA 3KFWX 1QBJA 1RNLA 3FMSA 1SD6A 1IN8A 5DUIA 1FP2A 4LB5A 3MCZA 3VEPA 2CSOA 2IP2A 4KICA 2R3SA 4CDGA 1HKSA 5LHIA 3BZ6A 2UXXA 3HOSA 2QBYB 3ISPA 4UV9A 1QZYA 1G6NA 4CYDA 1R1TA 4RB2C 3I59B 2PG4A 4WF2A 1LJ9A 2PJPA 1GXPA 2KJCA 4HAMA 5FFXA 3TKYA 1WWXA 4I0AA 5JHUA 2A07F 3ZMSA 1GXQA 2COMA 1Z6TA 1FYMA 4WXHA 3RJPA 3T1BA 2GA2A 1FSHA 3ABUA 2FE3A 3KP5A 3I54A 2X0LA 1PP7U 2IA1A 5ICGA 5JR3A 4GYIA 2DQRA 1W7PA 4OMZA 3FHZA 5E1XA 3RI4A 1O7FA 2FNPA 4KIGA 1ULYA 1B4AA 3RDIA 5IT3A 5J8CA 3QPHA 4BYYA 4G6DA 2RV8A 4EJUA 4OIQF 5CJ9A 3GFIA 3KEOA 4A0XA 1RUOA 3PQJA 2F5EA 4ZYDA 3EUHA 1IRFA 1VTNC 3ECHA 4Q5SF 2M30A 4LK0F 4N9HA 3U1DA 4HX7A 3NRVA 3F3XA 4GYGA 3MFKA 2W25A 3BPVA 4A0ZA 2GZWA 1ZLKA 5DCMB 4ZYEA 3CO6C 3HTUA 1J5YA 2FNAA 3E3VA 3BDDA 5HOOA 4G7ZF 2FA5A 2GWRA 5H20A 4NHJA 1XD7A 2LF7A 3D5LA 3ABTA 2VN2A 3S2WA 1XSDA 1C0WA 1D3YA 4S05A 2DTRA 3KLOA 4MQVA 4HF1A 1KQ0A 3KETA 3DF8A 2A6EF 2DAOA 2Z99A 3LA7A 1ZREA 3K9TA 3EDPA 3O3KA 2XKOA 1F4KA 2DI3A 1MD0A 1H9GA 1MJ9A 2VT2A 2PBIA 1TQIA 2XRNA 1DDNA 3CUQC 1MDMA 2E1NA 1NHAA 1RIOH 4ENKA 1FBSA 2XAFA 4G9YA 2LKPA 4U0VA 2GA1A 3I0TA 2DQLA 2DT5A 3R60A 1FWZA 3QOPA 2R7DA 3GO5A 3RKXA 3HRUA 4I7HA 2H6CA 4EJTA 4MTDA 4IRIA 3WGIA 1CGPA 3SHFA 2DLLA 3Q9VA 3FM3A 2D1VA 2CO5A 4EJWA 1H0MA 3P9CA 3EYIA 4G8XA 1UB9A 2VBWA 3BJAA 2ZKZA 4YFKF 3ZQ7A 4OINF 1SFEA 4I09A 2BYVE 2FRHA 1IXSB 3CJNA 4G94A 2QUFA 3HOTA 4HA8A 1DPRA 1BJAA 1BC7C 4EGYA 2FBKA 4I0BA 4EJVA 5ICEA 2MLGA 2E7WA 1ON1A 2RC4A 5ED4A 2OQRA 5D8KB 2PN6A 2JTVA 4G7HF 5BOXA 1XSXA 2XHKA 4U7DA 2CGPA 3I53A 2A6HF 3HSEA 4M71A 3G73A 2VE8A 2XIGA 1HW5A 1GVJA 1ZRDA 3TO9A 1DUXC 2ZJ2A 1ZH5A 4A12A 2DK8A 4EM0B 1KU3A 1LEAA 2V9VA 1W5SA 5CVRA 1KQ9A 4RB3C 1XCBA 4BXUA 1EH7A 4BHCA 3JSOA 4ZYGA 4KYWA 4CHUA 1SD7A 3CUQB 5LHHA 1I27A 5A2QZ 2FU4A 2HOEA 1Y0UA 4MQ9F 4PGHA 4F7ZA 1IF1A 2JPCA 3COAC 2VXZA 3I71A 2RDPA 5L3CA 2XASA 2JT1A 1YW8A 4HV5A 3WTTC 4EJOA 3J80K 5ERIA 2VOOA 5CVVA 2O0YA 5DD4A 5DCFA 1YO5C 3RIRA 2IA0A 1ZLJA 2M87A 1ODDA 2LNBA 3K1NA 2ZCWA 2RVCA 4AWXB 2ISZA 1QO0D 1XGNA 3P9KA 3IRRA 3RPQA 5FFZA 4AVPA 1USSA 4MTEA 2QYOA 5D5VB 2XAGA 4HX8A 5K5OA 1CF7B 2WWYA 1FX7A 3WTVC 1XN7A 1R00A 3KLNA 3I5UA 3GZ5A 2UWMA 1JGSA 2DW4A 1XDSA 2WTEA 2V6CA 3LQQA 1BIAA 2ZXJA 3JSPA 2HGCA 4Y13A 1B6AA 4NB5A 4HZFA 4IJAA 5FD6A 2CQKA 3IWFA 5DEQA 2K02A 4A6DA 2FEZA 4O3MA 4A5MA 3DPTA 2UZKA 4QLCU 4L9VA 4IRGA 3L9FA 2DK5A 2O61A 3T8RA 1UFMA 2PMHA 2VBXA 2FMLA 4PZJA 1D8JA 1SFXA 2JSCA 2HEOA 4XLPF 4BNCA 2ZMEA 1LDDA 4FHTA 1ZG3A 2ESNA 5ICCA 4AD9A 2P6TA 1LDKB 1XSVA 2STWA 2W24A 3ROUA 1K6OA 2UXNA 3ZN0A 5HVQC 1U8RA 3LSTA 2V1XA 2O8XA 2P5LC 1T98A 2J5PA 1ZRCA 3I4PA 2Y0MA 3KCCA 2Z9OA 1R1UA 4RAYA 3K0LA 1K79A 2D2WA 3H92A 4LG0A 4XLNF 1ON2A 1P4XA 2L54A 1K78A 2HQNA 3CLOA 5L3DA 5HLGA 1F9NA 1W7PD 2EFPA 4CICA 3ELKA 2F5DA 1KU7A 1IUYA 5FLXZ 3LA2A 3B73A 2QQ9A 3R0AA 2M5WA 2K4BA 4PDKA 3FMRA 4KIBA 2FSWA 5HLHA 2XV4S 5F6FA 1OYWA 5D4SA 4L9JA 2ZBKA 3SZTA 1HSTA 2O03A 2MD5A 1T38A 5LGNA 3QP6A 1B59A 5D5UB 3ZMVA 2K86A 3CTAA 4ESFA 1RZ4A 1R36A 2DFIA 2VODA 4L9NA 3C7JA 3J81Z 5HS7A 3L2CA 3DPLC 3QAHA 2OZUA 1G3YA 1PUEE 1JE8A 4XSZF 3MZYA 2P5KA 2Q0OA 1R23A 1HBXG 3J7AO 4I98B 2CG4A 1U6GA 1B9NA 1BIBA 3TGNA 1B1BA 3SXYA 2BGCA 4EM2A 1W4MA 4UUVA 1J2XA 3Q9SA 3E97A 4WXDA 4UV8A 4UVCA 1L0OC 3D0SA 4P9FA 1IN4A 4N0BA 2XAJA 1BN5A 4Q47A 1YFHA 1U3EM 4IHSA 5D6FA 3QU6A 4CXFA 1O7LA 4WWCA 1TBXA 3RYPA 1YIOA 2CFXA 2IW5A 2Z3YA 2RNJA 3LAJA 2O6GE 1R22A 3ZP5A 1U5TA 3P9IA 2HDCA 1F1ZA 1FBUA 2XKPA 3E5QA 3AAFA 2NNNA 1R5HA 1AWCA 3L09A 1FYLA 2ZO4A 1T0FA 4AIJA 1HQCA 2A5YB 4KN4X 2KIUA 2QZ8A 3KP3A 2IJLA 4KNYA 1LQ1A 3M8EA 3NQOA 4CGZA 1WSUA 2HS5A 3GFLA 4WCGA 1Z9CA 1HXDA 3I64A 3F8FA 2NS0A 1TW3A 1D5VA 3O2PE 2WC2A 5D6EA 1KYZA 4KUMA 1S8NA 2IA2A 1J75A 4LLLA 3KP2A 4JK1X 2P6SA 3E5XA 4BQAA 1P6RA 1SD5A 1YG2A 2ACJA 2HZTA 1GHCA 2VT3A 4OOIA 5LRSA 4HV6A 4BHBA 3EQLF 2BBYA 2HFHA 5K5QA 3W6KB 1TQMA 4ASNA 4M6YA 1V3FA 4RS8A 5A2QK 1H9TA 1XDUA 2HTSA 4EV0A 2FBHA 2HTJA 3IRQA 1O3RA 4RB1A 2HYGD 2XUBA 4HQMA 2EA4A 3TOBA 2H09A 1KU9A 3I59A 1P4AA 1G3WA 3IWZA 1HKQA 4OIPF 5HDNA 3FF5A 2EFNA 3LWFA 1ZRFA 5JFRA 2XAHA 3V7CA 5K5RA 2ISYA 3VODA 2EK5A 2EFOA 3ZMDA 3MAJA 5DV5A 2ZNZA 1WKMA 3FXQA 4OIRF 3VFZA 2DU9A 1QNTA 2H94A 4XRFA 5AIQA 4YG2F 5CVIA 4IRHA 3V8KA 1OPCA 4I02A 2ZFWA 3WTXC 2PEXA 4G7OF 5L3FA 4KN7X 4MHGA 4FT8A 1BM9A 3SQNA 2EJRA 2KJBA 2NAZA 5E17F 4LMYA 3HRSA 2AXLA 2G7UA 4IXAA 1I1SA 4FX0A 1MJBA 5HS8A 3T0YA 2FF4A 1IXRC 2PMUA 4ZZDA 1LB2A 4G6QA 3H3UA 1IN7A 3V7RA 1O3TA 2OD5A 3N97A 2V1DA 5L3BA 1TTYA 4IVNA 3RPUA 2CW0F 1WI9A 1OYYA 4P55A 4U0WA 3RKWA 3GUDA 5LLQA 3FMQA 2P5VA 4M6XA 2RGVA 1TW2A 3FM5A 1FSEA 1REPC 1A04A 1IW7F 1TNSA 5DCMA 1ONVA 5LBQA 3RKYA 1U5TC 3GXOA 4BHPA 1FT9A 4YFNF 2Q8KA 2EWNA 3KP7A 1K78B 4Z2YA 2MH9A 3QPTA 1ZN2A 3E6DA 2LF8A 3ZMUA 5ICFA 3G3ZA 4LJZF 1FPQA 2NNYA 2Y75A 1QPMA 4R79A 3KE2A 3BJ6A 5AONA 1ZG5A 4UXNA 1V4RA 3TDZC 3I58A 3REOA 4HDUA 5TRDA 2EA2A 1S7AA 1EH8A 3OOPA 1J9IA 4UNOA 1EH6A 4XBFA 1R7JA 2ZNYA 2YSRA 3FXUA 3GFJA 3M9AA 1G3SA 2O3FA 2OA4A 4GCVA 1XCVA 3H3ZA 5FLXK 5ILVA 3F8CA 2Q2EA 4ENNA 2D1HA 1SAXA 2AS5F 5D8LB 3WODF 4FX4A 2HYFA 2L4MA 5LHGA 5E1WA 2JPBA 3B02A 1IN5A 3BWGA 1L3LA 5E1ZB 3ZPLA 4GO1A 3WGHA 4YIIA 4ETSA 2EV6A 2LSOA 2GIVA 1AOYA 3IKVA 1W7PB 4BAYA 4I2OA 3J81K 3HYIA 1FOKA 1P4WA 2STTA 5KVRA 2FMYA 3F8MA 4B09A 1P92A 2EFQA 3DXJF 3F8BA 4EGZA 4ENMA 3C18A 3K1MA 2VC1A 3DP7A 1KYWA 3M1EA 4P9UA 3DQVC 3JW4A 5HLIA 3L00A 4IF4A 1T39A 1XGOA 2Z33A 4N9IA 2DO7A 3LAPA 1K7AA 3IHUA 5BPIA 4LLNA 1XMKA 1IRGA 1BI3A 2XVCA 4HW0A 4HYEA 2YX7A 4LGWA 3WTYC 5K1YA 1ZYRF 4GXOA 1JHHA 2RQPA 3K1PA 1QQIA 3F6OA 4U7BA 3KZYA 3HRMA 1LNWA 5AIPA 1OMIA 5ILSA 5J6XA 1IAWA 2BE5F 3BOQA 4K2EA 2VC0A 3JAMK 5CLSA 4BH9A 4JQFA 4LB6B 2GXGA 1J59A 2W85A 3EYYA 1ZGJA 1I6XA 1YS6A 2YR2A 3WTSC 4AIKA 3F22A 3KP4A 4UVAA 3WG9A 3TO7A 3E6MA 2ETHA 5HS9A 2G9WA 1O57A 3GVAA 2IT0A 2OU2A 1USTA 2LDUA 4MNUA 1G3TA 5H6QA 3W6JB 2OZ6A 5LGTA 3U2RA 2YU3A 4I01A 2FXAA 5L3GA 3JTGA 2KKOA 1MDMB 2G7HA 4M9ZA 5DUKA 1BOAA 2RN7A 1X3UA 2F2EA 3K69A 4ZH4F 1JXSA 5IT9Z 3M8FA 1W5TA 3ZN1A 5L3EA 4WX9A 6PAXA 3V7SA 2CWEA 5D4RA 2KIMA 3TDUC 3P7NA 3E6CC 3DEUA 5TJJA 5LGUA 4HLXA 2FBIA 2H6BA 3PQKA 2L4AA 1Z05A 1DPUA 3F8NA 3WTUC 3R6SA 2HR3A 3HRTA 3BPXA 2MA3A 4PCQA 2IVMA 2HWVA 1ZGAA 5D5WB 1YQAA 2HKXA 5F64A 3WE2A 4HF2A 1CF7A 1E2XA 1YYVA 3GZ6A 3MWMA 4HLYA 1Q1HA 1PP8F 5LEKA 2P7CB 2PI0A 2XGXA 2VOPA 3WTWC 2PFBA 1S7OA 2PQ8A 3ZMZA 1FNNA 5HDKA 3FWEA 1RI7A 4A2UA 2QM3A 2IRFG 2YPRA 1R58A 1OKRA 2K27A 1SD4A 1S6LA 1YS7A 3JAMZ 2P7VB 3HSRA 1TLHB 4EMSA 1E17A 2DPDA 5CVUA 3C3WA 2P4WA 4M9XA 5ILUA 4ZYHA 3TOAA 1YW7A 3VB2A 4RAZA 1HKTA 4HF0A 2C6YA 3LA3A 1S3JA 4Q4ZF 1QZZA 1T6SA 3F21A 2QQAA 3CUOA 2QENA 2IPQX 4EM1A 2A68F 4L0ZB 3GEZA 3C1DA 3T5XA 1HW1A 4KMUX 5H6RA 2EB7A 1FZPB 2Y48A 2F5FA 3ULQB 3EETA 4Y15A 3ECOA 4KMFA 2CYYA 1UCRA 3FZVA 4RGSA 1UHWA 5DYMA 4KIFA 3PFIA 3KEQA 4NQWA 2OAZA 3KZZA 3GW2A 5LRRA 4GGGA 1SFUA 3DFGA 4M74A 3U9GA 3GF2A 4MGRA 4Q48A 2MH2A 1S29A 1UHMA 4B8XA 2VBYA 4R8HA 4S04A 5CVJA 1U78A 2R7FA 4L0YB 3RYRA 1BI2A 2QBYA 2QVOA 4LLGF 3WGGA 1I1GA 4EQQA 2JZYA 2YX4A 3WU1B 5CYVA 1LEBA 3IC7A 3GYHX 3MQ0A 4KA4A 3R61A 4WK8F 2ELHA 2Z5UA 1R5GA 5JI6A 2ADUA 4OMYA 4RB0A 3KP6A 5HDGA 3L7WA 1YW9A 4XSXF 3RTRA 4KT5C 3WTZA 4DQ2A 3TQNA 4RGUA 5BPDA 4P5OA 5DDGA 5E18F 2A69F 4ON0A 2MBFA 3IL2A 3V4GA 4ESBA 5DD8A 5BS6A 2P8TA 3SFZA 2X4HA 4DNCA 5E8GA 2GXBA 3HSFA 3IKTA 5LEJA 3R4KA 1ZG1A 2TDXA 4A5NA 4M9SA 2VONA 1O3QA 4H0EA
chains in the Genus database with same CATH superfamily
2CV2A 4IHTA 1J7KA 2VBZA 1ETQA 2HOAA 3E6BA 4UUTA 2K9NA 5E8IA 2A61A 1VI0A 2M1BA 1IV8A 1SMTA 3LSMA 1ETVA 2DA7A 5GPAA 1U0JA 3AL0C 1XGSA 3G1LA 3ERED 1Z7LA 3V8LA 4E4HA 3K2ZA 1EV7A 2QQBA 2EQRA 1R71A 3OYCA 1MZBA 4IPAA 3F23A 5D5XB 4DZPA 2ID3A 1G4DA 4UY8I 3VYUB 3I56I 4LD5A 3GLXA 5KK1A 2NRAC 3S2HJ 2BVMA 1ZAOA 2ZMEB 1UG0A 2HDWA 3A03A 3MZ8A 4JYKA 2H27A 2BY3A 1ENHA 3MKLA 3HIFA 1S5LC 2HOSA 1FP1D 3HUGA 4CO8A 1A6QA 4O5VA 4C2MJ 1FC3A 2Y31A 3C2GA 4MEXF 3GWZA 2XC7A 3HHHA 1FLIA 3BT9A 1LDJA 4IHYA 3SDBA 4B43A 2D45A 2DPUA 2FQ3A 5FB2A 2NVQJ 2K4JA 4ZZLA 5F1RA 1BC8C 4YFXF 4DZJA 4YRVA 3TO6A 4CZZA 2M8EA 1MIJA 3O6BB 4UVBA 3ONQA 2VE9A 3G2BA 1U2WA 5B66C 4CCMA 3KYLA 4PGGA 2HKOA 2CQXA 5C3EJ 3SZPA 1STZA 4LG0B 3GTJJ 1J09A 4OU0A 4RLFA 1WRJA 2EV5A 4HX4A 4HNVA 1YLFA 4YIFA 3CESA 3W2AA 1TWCJ 3FXRA 4L5JA 1HW2A 2QCOA 5J47A 1HDPA 3QQAA 2NVYJ 2J5OA 5E79C 1TQPA 1R9TJ 1PDNC 3H0GJ 5EGOB 4RGXA 3FXKA 3MEXA 2JUCA 1RR7A 1XGMA 3DCFA 5F04A 1VFCA 1W0TA 3CP2A 2MLKA 1YTYA 1Z67A 3C2BA 4L5IA 4EATA 3SFIA 1OYIA 2OQGA 1ERDA 2CFOA 3A0HC 4EVIA 2M4KA 4RGRA 2EFWA 2JRTA 4F3QA 3F72A 3LQRA 1VQ5I 3QWLA 2IS1A 3LSIA 4UB6C 1DQUA 1XB4A 3N4MA 1BI1A 3LFKA 2JJ7A 4D5FA 5J3LA 1FY7A 1B9MA 3H1CA 2FOKA 4R1HA 2OTLI 1SAUA 2XAQA 1E3HA 1OJLA 1MJAA 1Y0NA 5JLXA 1XMXA 2GQQA 2KFDA 1BL0A 5JVTA 2ZSHB 3WE3A 1D8KA 4TV7A 2XF7A 2EV0A 4P96A 1KA8A 1WQ2A 5K7HA 2RKHA 1MGTA 3OIOA 4M73A 3CCEI 5K7FA 3H9QA 2BV6A 1Y6IA 3S2DJ 2GAUA 5EEGA 1BI0A 3M7GA 4AYBA 1P2FA 5BQTA 2BY1A 4CYCB 1XTAA 3CDHA 2E7XA 4E70A 2VKVA 1BBYA 1FBQA 4O6JA 2M45A 2E1CA 1NTCA 2ZXIA 4BEHA 1FOYA 3IAM2 5F0HA 1JUSA 2CJJA 3BC8A 3GX4X 3H35A 4MEYF 1A36A 1Z7UA 3JTHA 3Q5FA 2M0CA 4D0PA 4LFUA 2OBPA 2F5CA 3FK7A 5EJCA 2W57A 3M3YJ 2W84A 4II3A 3R0JA 1TNTA 2LY9A 4Y17A 4HOBA 2JA6J 3BLYA 3FX3A 2L3DA 1Z6RA 4HPQA 1X2MA 2QWWA 4A6EA 2XSJC 4ZYAA 4D7MA 1LFPA 3FIWA 1IXCA 3LOCA 4RDUA 2F5VA 4L18B 4A0YA 5IT9K 2BOLA 4PFOA 4WXCA 3NEUA 2V1UA 2XROA 4QWQA 1JI8A 1VQ7I 3BTIA 1Y39A 1H88C 4M72A 3OYLA 1XMAA 2HQRA 2WAQA 3K10A 2K7LA 3WG7H 2XRLA 4UHTA 4BACA 2RREA 4HDVA 3QPSA 1HSJA 2K3PA 2X6YA 4U0YA 3QU3A 3ZRGA 3O8HA 1J0RA 3ML6A 1ZHFA 2AQFA 4ENJA 1KU2A 3NWTA 1G2HA 3QP5A 3H5AA 1TT0A 4JBAA 1NG7A 2E36A 2PJRB 3VOEA 1MKMA 1MNEA 3F0CA 1FYKA 1JHFA 4YIRX 2CRGA 3DV8A 4E6KG 4U88A 2LH9A 2NOGA 4KFCA 3FK6A 5FGMA 1U5TB 3OWTA 3TBIA 1X1CA 1I5ZA 4P1WA 2MW8A 4HQEA 4OIOF 3CMMA 2NYXA 4L9TA 1Z21A 2DTZA 2LVSA 2LR8A 2ESHA 1Y1WJ 2OCCH 2QGUA 2B0LA 2HXOA 1FOXA 3E5UA 1LVAA 4LK1F 2EIKH 3WU0A 4ESJA 3BP8A 3DKWA 2M0MA 4X6AJ 2E19A 2PLYA 1KGSA 3FXLA 5J1UA 3GFMA 1F5TA 2A3SA 3A2KA 1IN6A 1IZ1A 2DBBA 2NS8A 3TEDA 5EEHA 2KRFA 3K4KA 2GXAA 5FKKA 5FLMJ 3OYIA 3CO7C 4QTRA 5BMZA 5J8FA 1RR8C 2DFHA 4A3EJ 1FJLA 1R1VA 4MFDA 3FISA 5KHDA 2WV0A 5E20A 3HTSB 2LD5A 3BROA 1O3SA 1SMYF 1Z1DA 4RA2A 2MC3A 2L02A 4HBLA 2X1EA 4QSHA 1VQ6I 3I4NJ 2BY2A 4JX4A 5FO5A 1RUNA 1WFXA 1DP7P 1OR7A 3W3CA 3MN2A 1MMDA 3J80Z 5FROA 3LSJA 4KDPA 1QGPA 2X1DA 2QLZA 1KQ8A 3HHGA 3CUQA 3ERMA 2E1MC 2V79A 4M3EA 3BJOA 3F6VA 1T2KA 3T8TA 2VPLA 3OV8A 2L01A 2XB5A 5FD5A 3MZHA 1ZARA 4AIHA 2MABA 3BY6A 2BEOA 3U21A 3HOYJ 4YELA 1Z91A 3S17J 3ZMTA 3J7AY 3QRFF 2KIFA 2WY7Q 4NQWB 3V8JA 3KFWX 1QBJA 2DA4A 1RNLA 3CDLA 3FMSA 3AG1H 1SD6A 4XIDA 1IN8A 5DUIA 1WJDA 3DU5A 1FP2A 3HM5A 4LB5A 3MCZA 4MIMA 3VEPA 2H8RA 3DEEA 2CSOA 2IP2A 2VJJA 2LY1A 4KICA 4E7HA 2R3SA 3OYJA 3OMYA 5M5XJ 1ZR2A 4CDGA 2BW3A 4A3GJ 3HZJA 2LREA 1HKSA 2KLOA 5LHIA 3BZ6A 3GLLA 2UXXA 3HOSA 2QBYB 1ZTRA 3BQYA 3ISPA 4Y33A 4UV9A 2XGEA 1QZYA 4XN0A 1YJWI 4HG2A 4LITA 1G6NA 2IGKA 2VJ4A 4A3CJ 4CYDA 3GTMJ 1V5GA 1YE9A 1R1TA 2DFFA 4RB2C 1YX3A 3I59B 2PG4A 4WF2A 1LJ9A 3VPRA 2ICWG 1WJAA 3N05A 2PJPA 5EEAA 1GXPA 3CCJI 2KJCA 4HAMA 5FKMA 5FFXA 5GAGJ 3TKYA 5EG0A 1SVOA 1WWXA 2XAUA 4UB8C 1YRNA 4I0AA 3SJMA 1UZCA 5JHUA 1AHDP 2A07F 1TP4A 2R92J 3ZMSA 1GXQA 2R7ZJ 5JHFA 2DA6A 2COMA 3FDYA 4KITB 5K7ZA 4V2GA 3OYMA 1Z6TA 1FYMA 3ABLH 4WXHA 3RJPA 1OCCH 2MFZA 1Q1VA 4B1RA 4F93B 3ABKH 2MG4A 4IHVA 5EZGA 3T1BA 5DS9A 2GA2A 1FSHA 2KZGA 3ABUA 1Z3XA 3W6VA 3GTQJ 4DBRA 2FE3A 3KP5A 1LFUP 3I54A 2JA5J 2X0LA 4E7IA 2L7ZA 4D1QA 1ACIA 3DLAA 2DMQA 2R5ZA 4CZCA 1H8AC 4C2UA 1PP7U 2IA1A 2ZJQF 1RETA 2Z2SB 1XPXA 4GFBA 5ICGA 5JR3A 2X48A 3HOXJ 4GYIA 2DQRA 1Y8QB 1W7PA 4OMZA 3G1OA 2LC2A 3GMEA 1EKEA 3E0JB 2KHMA 3FHZA 4J01A 5E1XA 3RI4A 1O7FA 2FNPA 2KQRA 4KIGA 4D7NA 1ULYA 1B4AA 2E1MB 3RDIA 5IT3A 4ANJA 4OAZA 2ZJPF 1GV2A 1W0UA 1RC9A 5J8CA 3QPHA 4BYYA 1GV5A 4G6DA 1PUFB 2QF7A 2VQLA 5KAFC 2RV8A 4EJUA 4OIQF 5CJ9A 2WB1A 4AYBN 1AKHA 1NG6A 4QPQA 3CLQA 4XONA 3BR0A 3HUGB 3GFIA 3KEOA 4A0XA 2F4OB 3DPUA 1RUOA 3JRGA 3PQJA 2F5EA 3HEFA 2DMUA 3EUHA 4ZYDA 4QIWN 4XRSA 1IRFA 2DJNA 3CMYA 1VTNC 4B47A 2ME0A 5EZHA 3ECHA 5FLVA 1DGWY 2BHZA 4Q5SF 2M30A 4LK0F 4N9HA 3U1DA 4HX7A 3NRVA 1V54H 3F3XA 4GYGA 3MFKA 4CCOA 2W25A 3BPVA 4A0ZA 2WAEA 2GZWA 4IOAF 2LOOA 1ZLKA 3HBLA 5DCMB 4ZYEA 3CO6C 1HF0A 3HTUA 3NWSA 1JGGA 1J5YA 2FNAA 3E3VA 2V9PA 4CH7A 2GM4A 3BDDA 5HOOA 4G7ZF 2FA5A 2GWRA 4FE4A 5H20A 1ETYA 2WAQN 4NHJA 1XD7A 2LF7A 2AHQA 3D5LA 3ABTA 2VN2A 3S2WA 1XSDA 1T95A 1C0WA 1D3YA 3HPHA 4S05A 2DTRA 3KLOA 4MQVA 1JKPC 4XICA 4HF1A 1KQ0A 2DDAA 3KETA 2CUFA 3PNYA 4XQFA 3DF8A 3Q0VA 2A6EF 4V19K 2DAOA 2Z99A 2ME6A 3QYEA 2HPIA 3DBLB 4PSWA 3A01A 1HA8A 3LA7A 4DYRA 3RKQA 1ZREA 1OFCX 2FJ1A 4L5EA 3S14J 4XKCA 3K9TA 3EDPA 4Y7NJ 3O3KA 1PYVA 2XKOA 1F4KA 2CV1A 1OR7C 1LVKA 3A0BC 1MNMC 2DI3A 1H89C 1MD0A 1H9GA 1MJ9A 2VT2A 3S1MJ 4NC6A 1P7JA 4BY1J 2PBIA 1TQIA 2XRNA 2ZJRF 1DDNA 3CUQC 1I3QJ 2E1NA 1MDMA 1NHAA 1PJRA 1RIOH 2R7UA 4ENKA 3RPUD 1FBSA 2XAFA 4IZZA 2CQQA 2Z16A 4G9YA 2LKPA 4U0VA 2GA1A 2B63J 2NOJB 2DQLA 2DT5A 3I0TA 3R60A 1UHSA 1G59A 4FTHA 1FWZA 3TW6A 1MSFC 4E7LA 2X1CA 3H9GA 4A69C 3BR2A 3QOPA 4BEHB 2R7DA 4X1EA 3GO5A 2Q2EB 3RKXA 3HRUA 4I7HA 1FTTA 2H6CA 4EJTA 2COBA 5H2FC 3CP8A 5J4VA 4MTDA 1Z77A 2AO9A 3JRHA 1BW6A 3TW7A 4IRIA 3OYKA 3WGIA 1CGPA 2M2EA 3KYCB 3SHFA 3MKZA 4DJAA 2DLLA 3Q9VA 5LD2C 2CS3A 2D1VA 2CO5A 3FM3A 4EJWA 1H0MA 3P9CA 3EYIA 3TP3A 4G8XA 5EF6A 2M34A 4BL0B 5M5YJ 2L7MP 1UB9A 2VBWA 3BJAA 4IL6C 1VQMI 3AFHA 1EJ9A 3JRCA 2ZKZA 2JSPA 4YFKF 3ZQ7A 2F4MB 4OINF 1SFEA 4I09A 1IRXA 2BYVE 4BE2A 3ZQLA 2FRHA 3ZQIA 3ZXSA 1IXSB 3RSNA 1QHGA 2DJIA 2OV7A 3MKWB 3CJNA 2HI3A 3K7AJ 4G94A 3Q0WA 2LBFA 3LSPA 3L1PA 3FHNA 3LFUA 2QUFA 3WHCA 1VQNI 3HOTA 4HA8A 1DPRA 1TC3C 2E5NA 1BJAA 2W82A 4XKVA 1S7EA 2QSFX 1KZHA 1MBKA 1UELB 1BC7C 3H3VK 4EGYA 2FBKA 4I0BA 4EJVA 5ICEA 3CCMI 2MLGA 2E7WA 1HCRA 1ON1A 1LE8A 2RC4A 5ED4A 2OQRA 3M07A 5D8KB 3OYFA 2PN6A 1JUPA 4U87A 2JMWA 2JTVA 1FMWA 2VQHA 1X2NA 1R49A 2OPTA 2HNHA 4G7HF 5BOXA 4XKBA 3CQZJ 1SFKA 1X1AA 1XSXA 2XHKA 4XNFA 4U7DA 4N4NB 2CGPA 3I53A 2O8KA 2A6HF 3HSEA 3ZR8X 9ANTA 2W48A 4M71A 4E7ZA 3G73A 2VE8A 2XIGA 1HW5A 1GVJA 1ZRDA 3TO9A 1DUXC 2XSDC 2ZJ2A 4BQNA 4A12A 1ZH5A 5IP6A 2DK8A 1O4XA 1MNDA 4EM0B 3L2UA 3BR1A 3VYSB 1KU3A 3I4MJ 1X1BA 2RQQA 5FKLA 1YX5A 2E2HJ 1LEAA 2V9VA 1W5SA 5CVRA 4RBOA 1DP3A 1KQ9A 4RB3C 1X3ZB 2K85A 1XCBA 2QA4I 3DU6A 4CCLA 4BXUA 2DT7B 1EH7A 1K83J 2E2JJ 4BHCA 2DFEA 3JSOA 3LSRA 4ZYGA 4KYWA 4CHUA 1SD7A 1QVUA 3CUQB 5LHHA 1JKQC 2TCTA 4A3LJ 4H4KC 2XF5A 4A93J 1I27A 1AA7A 1MMAA 2FX0A 2M9HA 5A2QZ 2DT6A 1SEUA 2FU4A 2HOEA 1QA6A 3VYTB 1Y0UA 2VKHA 4MQ9F 3VSKA 2MSYA 3IP4B 4PGHA 3S1RJ 2A05A 4I76A 1WHUA 4F7ZA 2YS9A 4J19A 1IF1A 2JPCA 2IAIA 4IO9F 4JX5A 2VXZA 3COAC 2DDBA 3I71A 2RDPA 4G12A 1Y56A 5L3CA 2XASA 2R5YB 2JT1A 2Y2ZA 3EUHC 4IEJA 1YW8A 5E3NA 4HV5A 3WTTC 5J1RA 2JQ7A 1X4PA 2A6TA 4EJOA 3J80K 5ERIA 2VOOA 1P9QC 5CVVA 2GOMA 2O0YA 3TMOA 5DD4A 3K4BA 2BW3B 5DCFA 1GLNA 1YO5C 1MSEC 1B8IA 5GTHC 5F27A 3VDXA 3RIRA 2IA0A 1ZLJA 5IOYA 2M87A 1ODDA 2WB1N 1BR4A 2LNBA 1D1CA 3I3LA 1X1DA 3K1NA 2GBYA 3DKXA 4B44A 2ZCWA 5C4JJ 2RVCA 1X1PA 4PJLA 3PIOF 1A5JA 1ZGWA 3HGYA 4AWXB 1YOVB 2ISZA 4IHXA 1BOBA 3QYFA 5F1JA 1QO0D 1Y1VJ 2JRMA 3L2RA 1XGNA 3DTEA 2CQNA 3P9KA 5EG0B 3IRRA 1JKRC 3AL0B 5HNHA 1YRNB 3RPQA 4FQGA 5FFZA 1JTXA 4AVPA 1USSA 4XR6A 3BQZA 4MTEA 4AC0A 1JJ8C 1RPWA 4CCJA 2QYOA 5D5VB 2XAGA 4HX8A 2W1OA 2ECCA 1I50J 2R7SA 5K5OA 1CF7B 2WWYA 1FX7A 3WTVC 1XN7A 2VQCA 1R00A 4IQ4A 3KLNA 3PIPF 3HGGA 2LKXA 3I5UA 3GZ5A 3IH4A 2XDVA 2UWMA 4ZJZA 1ETWA 1JGSA 2DW4A 2MC4A 1XC5A 3KZIC 1D0ZA 2E35A 4AVZA 1XDSA 2R5ZB 2E2IJ 2WTEA 2V6CA 3LQQA 1BIAA 2I10A 2ZXJA 4B4CA 5HNFA 3BG5A 2QEXI 2KISA 2CUEA 4I6ZA 3JSPA 2K3FA 3MD2A 1QZEA 2HGCA 2TRTA 3OYBA 4Y13A 1B6AA 1E3PA 2AQEA 3BG6A 4HZFA 4NB5A 4IJAA 1XX5A 2CQKA 3IWFA 5FD6A 2EBIA 3B6CA 5C4XJ 5DEQA 2K02A 4A6DA 4BGDA 1MMSA 4N4OB 1TWGJ 2FEZA 1MW7A 3UR3C 4O3MA 5TISC 4A5MA 1V5EA 3DPTA 2BVLA 2UZKA 2QSGX 4QLCU 3OYGA 2F48A 3PSFA 4L9VA 1HOMA 5IOZA 4IRGA 1R4MB 2HZDA 3L9FA 1YIJI 2DK5A 4M3BA 2O61A 3T8RA 1UFMA 2PMHA 2VBXA 2FMLA 3CJRB 4PZJA 3CCUI 1D8JA 1SFXA 2JSCA 3IH2A 3CCRI 4J00A 2HEOA 3CCLI 2NVTJ 2IS6A 4XM3A 1IGNA 3GCMA 4XLPF 4BNCA 2ZMEA 1LDDA 2IS2A 2ECBA 4FHTA 2XF6A 1ZG3A 3G71I 2ESNA 4F52A 2KZVA 4AD9A 2P6TA 5ICCA 1MBJA 3I9V2 1LDKB 3PSIA 1TT5B 4II2A 1XSVA 2STWA 2W24A 3ROUA 1K6OA 1JTYA 4B3XA 2UXNA 3ZN0A 4Y52J 2DYRH 5HVQC 5TGTA 1U8RA 3LSTA 2KL4A 2V1XA 2O8XA 2P5LC 1T98A 2J5PA 3K2AA 2V1NA 1ZRCA 3I4PA 1R5ID 1MMNA 3RQ4A 2GOXB 4IX7A 1MMGA 2Y0MA 3KCCA 2M8GX 3G1MA 1R1UA 2Z9OA 4RAYA 4V2FA 3CCQI 3K0LA 5GTIC 3S8PA 1K79A 2D2WA 2V9KA 3PO2J 3H92A 4XORA 4LG0A 4XLNF 5JVGF 3CC2I 1ON2A 1IJWC 1P4XA 2L54A 2WY8Q 3PUBA 1K78A 3HOVJ 2HQNA 3CLOA 1X58A 3PUFA 5L3DA 3ZQGA 1E0EA 3JRAA 3BTLA 1F9NA 2BXYA 5HLGA 1W7PD 3A01B 2EFPA 1YHQI 4OWRB 3BTCA 4CICA 2IEKA 4NUBA 3ELKA 2K9QA 2F5DA 2R7OA 3H5NA 2LK2A 5EGOA 5CKTA 1KU7A 1IUYA 4BQOA 5FLXZ 3LA2A 4PUSA 3B73A 1OCZH 3O8GA 2QQ9A 3R0AA 2M5WA 2K4BA 4PDKA 5C44J 3FMRA 3KPHA 2WBMA 3EUKL 4KIBA 4PJNA 4XN3A 3S15J 1ITYA 2HYJA 3J7YJ 2FSWA 3ZQHA 5HLHA 2XV4S 5F6FA 1OYWA 2VL8A 5D4SA 5HLTA 1YI2I 3G6EI 4L9JA 1APLC 2CMPA 2CW7A 4MO7A 1MH4A 2ZBKA 3SZTA 1BW5A 1HSTA 2O03A 2MD5A 1T38A 2OUMA 5LGNA 3QP6A 4BDZA 4BY7J 1B59A 3BR3A 1EF4A 5D5UB 4C3HJ 2LP0A 3ZMVA 4CCKA 2Y0SA 2K86A 3KX2A 4A3IJ 1TWHJ 3CTAA 1NK2P 4ESFA 1RZ4A 1K4SA 1R36A 2DFIA 2VODA 3S16J 4L9NA 4DYQA 3C7JA 4CYCA 4HSRA 3J81Z 4W97A 5HS7A 3L2CA 3M8JA 3JRIA 1VQOI 3DPLC 2EZKA 3QAHA 2OZUA 1UAAA 3HOUJ 2JN6A 1G3YA 1PUEE 1JE8A 2P81A 4XSZF 2DYSH 3MZYA 3CMAI 2ZB9A 4BJTA 5FRNA 2P5KA 2Q0OA 1R23A 1Z0XA 3JCUC 1SVLA 4C2TA 1ZKGA 1HBXG 3J7AO 2HPMA 4I98B 1W36C 2CG4A 2E1OA 2NVUB 4CA0A 2DMPA 1U6GA 4AIDA 3OYAA 1B9NA 2I5UA 2MD0A 2QSHX 1BIBA 1NH3A 3TGNA 4A3FJ 1B1BA 3SXYA 1ETKA 4BKXA 2BGCA 5M5WJ 4RAFA 3W2WA 3ZCOA 2E5ZA 4EM2A 1W4MA 2XB0X 4UUVA 1J2XA 3Q9SA 2R7TA 3BR5A 3E97A 2ELJA 4WXDA 1VQ4I 3DBHB 2VXDA 4UV8A 2VLAA 1FEXA 3J7ZI 4UVCA 1L0OC 1D0YA 4CUGA 2CUJA 5GAHJ 3WHBA 3D0SA 1ZR4A 3K4MA 4P9FA 1IN4A 3CJTB 4N0BA 2XAJA 2DA3A 1HLVA 1RKWA 3Q3SA 1BN5A 4Q47A 1YFHA 4LIVA 1U3EM 4IHSA 5D6FA 3QU6A 3HJEA 3GTLJ 3LMMA 4CXFA 1O7LA 4WWCA 1WCMJ 1TBXA 3TL4X 5IYBJ 3RYPA 1W1WE 3OR1C 2PJRA 1YIOA 1WJ5A 2CFXA 2IW5A 2Z3YA 2XPWA 3CDIA 2RNJA 3LAJA 1LPQA 2O6GE 1V55H 1IDYA 1R22A 3ZP5A 1ORKA 3QPLA 1U5TA 2K9SA 2KIQA 3P9IA 2HDCA 1F1ZA 1FBUA 2XKPA 3E5QA 4FE7A 3AAFA 1OISA 1MBHA 2NNNA 2Y9YA 3P5JA 4BXFA 3CC7I 1R5HA 4FETA 2JVHA 1AWCA 3PFYA 3L09A 4JP0A 2IGOA 1FYLA 2ZO4A 1T0FA 3E7LA 2GIZA 4AIJA 1HQCA 1RKTA 5EDNA 2KMUA 2A5YB 2HDDA 3GBGA 2BHYA 4KN4X 3DLLF 2KIUA 2QZ8A 3KP3A 3CC4I 2IJLA 4KNYA 3JR9A 5EYRA 1VZ0A 3DTIA 4XOPA 5E3OA 1LQ1A 1BR2A 3M8EA 1IC8A 2NXNB 2CH0A 2FOWA 3K4LA 2VQGA 4C3JJ 3CF2A 3NQOA 4E7JA 2DCEA 4CGZA 1WSUA 2HS5A 1I39A 3GFLA 4WCGA 2QQ8A 1Z9CA 1HXDA 3I64A 4D9JA 3F8FA 3L2QA 2NS0A 3GZNB 4YEJA 1TW3A 5M3MJ 1JKOC 4HNUA 1X3WB 1D5VA 3JRFA 3O2PE 2WC2A 4PFPA 5D6EA 3ZOBA 1KYZA 4KUMA 1S8NA 3D1NI 2IA2A 1J75A 1PVEA 2V26A 3BG3A 4LLLA 3IH3A 3KP2A 4JK1X 2P0WA 2P6SA 3E5XA 2F4IA 3H36A 2B9SA 2JVGA 2NS7A 1AU7A 4BQAA 1P6RA 5J1YA 1SD5A 3I55I 3OSGA 1YG2A 1IO2A 2ACJA 2HZTA 2XGCA 3S3OA 1YITI 3BTJA 1GHCA 1KONA 2O7OA 2VT3A 4OOIA 2ZMEC 5LRSA 4HV6A 1FIAA 4BHBA 3EQLF 2BBYA 2HFHA 5K5QA 2XPVA 5FKNA 1OCRH 3W6KB 1TQMA 3K70C 2G0EA 1GDTA 4ASNA 2L9NA 4M6YA 3K4JA 2OF7A 3SZGA 1GVDA 1IDZA 3ABMH 2HQ5A 1ETOA 1V3FA 4RS8A 5A2QK 1H9TA 3FBNB 4M3GA 1XDUA 2HTSA 1ZK8A 4XRMA 4EV0A 2DODA 2FBHA 2H8WA 4UUSA 1U9OA 2L7FP 2DA2A 2HTJA 2V7FA 3BG7A 3IRQA 1O3RA 4RB1A 1D1AA 2HYGD 1N77A 2EIMH 2DXIA 2LKSA 3GTPJ 2XUBA 4HQMA 2JUGA 2EA4A 3TOBA 2H09A 1KU9A 2HU9A 3MMYB 4BDYA 3EUAA 3A1YA 2Y69H 1T08B 3I59A 1P4AA 1U8BA 2KPMA 3HC7A 1G3WA 4KJZA 3IWZA 1HKQA 2LY2A 5LFAA 4OIPF 4M6VA 5HDNA 5IPAA 3GTGJ 2E71A 1JJ6C 1E3OC 3FF5A 2EFNA 3HPGA 3LWFA 1Z3YA 2DOFA 1VNDA 5B5EC 1ZRFA 2AXTC 2IBDA 5JFRA 1LUJB 2EH3A 2XAHA 3V7CA 3CJQB 5K5RA 2ISYA 3VODA 3OL3A 4Y4RA 3QOEA 2EK5A 1WH5A 2EFOA 3ZMDA 3QODA 4XKWA 3VSLA 3MAJA 2JWTA 2X51A 5DV5A 1QU3A 2VKEA 2ZNZA 2IS4A 1WKMA 3FXQA 1HC8A 3HOWJ 4OIRF 3VFZA 2DU9A 5B1BH 1QNTA 2L0KA 2H94A 2DMNA 4JOMA 4XRFA 5CVIA 5AIQA 4YG2F 3S3MA 4IRHA 3V8KA 1OPCA 4I02A 1JT0A 2CU7A 4OAYA 4GDFA 2ZFWA 1VQLI 5HODA 3WTXC 4IHWA 2PEXA 3MVPA 1W36D 4G7OF 2WV1A 5L3FA 3FKIJ 4KN7X 4MHGA 4FT8A 1BM9A 3SQNA 3W2VA 2EJRA 2KJBA 2NAZA 5E17F 2ZC2A 3HRSA 4LMYA 2AXLA 1WJCA 4ZDOA 2QKLB 2G7UA 1BA5A 4IXAA 1I1SA 4FX0A 4A3MJ 1MJBA 5HS8A 3T0YA 2BY0A 2FF4A 2ZXWH 2PX9A 1K61A 3OIPA 2CQ7A 2QKMB 1IXRC 2PMUA 4ZZDA 1XS9A 1LB2A 4G6QA 3H3UA 4ZTJA 2UUZA 1IN7A 3V7RA 1O3TA 2OD5A 2Y0SN 3N97A 2V1DA 5L3BA 1TTYA 3NAUA 3NARA 4IVNA 1MH3A 2EINH 3SEZA 1PUFA 4XLFA 4XMYA 3HXLA 3M1CA 4M3FA 3RPUA 3HG9A 4ABZA 2CW0F 2DA1A 2VASA 1OCTC 1LKXA 1WI9A 1OYYA 4P55A 4FASD 4U0WA 3HOZJ 3RKWA 3GUDA 5LLQA 2HVQA 4IOCF 3FMQA 4BE1A 4A3DJ 3AG2H 3KEYA 3OIQA 2P5VA 4M6XA 2RGVA 1TW2A 3FM5A 1IRZA 3OR2C 1FSEA 1REPC 1A04A 3FXJA 1IW7F 1K6YA 1MBEA 2LTPA 3OS2A 1TNSA 4W1UA 3CCYA 5DCMA 1POGA 1ONVA 3H9JA 5LBQA 3RKYA 1U5TC 2F6CA 2KP6A 3OS0A 3GXOA 4BHPA 1OCOH 3DTKA 1FT9A 4ITVA 2Q8KA 4YFNF 1QPIA 2JA2A 4XLHA 3AKZA 2EWNA 3KP7A 1K78B 4F92B 4Z2YA 1T0FC 1WGXA 2MH9A 4LIUA 5F0FA 3QPTA 1ZN2A 3RZOJ 3E6DA 2HXIA 4A3KJ 2LF8A 3RCOA 3ZMUA 1XG1A 5ICFA 3OL4A 3S3NA 1MBFA 3H0DA 4IKFA 2E34A 1DGRM 3G3ZA 5IY5H 4NC8A 4NC7A 4HEA2 4LJZF 1D0XA 1FPQA 1R4NB 1MBGA 1W5CC 4ZDLA 2NNYA 2D5VA 2VUMJ 4A3BJ 4PK4A 2Q1ZB 2Y75A 1QPMA 4R79A 2R7XA 3KE2A 1OLTA 3BJ6A 5AONA 3LNQA 1ZG5A 4UXNA 2V4JC 4MLOA 1JT6A 3U1KA 2KRHA 1V4RA 3TDZC 2DMTA 2ID6A 3I58A 3REOA 5F0CA 1B72A 4GRIA 4HDUA 2KRCA 5TRDA 2EA2A 1S7AA 1EH8A 3Q0UA 3OOPA 3X2QH 2LRDA 4DBQA 1J9IA 4M3DA 4UNOA 4ZTFA 1EH6A 4XBFA 1CQTA 1R7JA 5B1AH 2V6EA 1U9NA 2ZNYA 2YSRA 3FXUA 3GFJA 3M9AA 2L9SA 1VQKI 1G3SA 2O3FA 5DM7F 1TZLA 2OA4A 4AU7A 3IAS2 4GCVA 1XCVA 2X6OA 3BCBA 3H3ZA 3K70D 3A4CA 3HDDA 5FLXK 2M7BA 5ILVA 3F8CA 5KNLA 2Q2EA 4ENNA 2D1HA 4I99C 4XRSG 1SAXA 2AS5F 5D8LB 2PMZA 4NNJA 3WODF 4FX4A 4BS9A 3D5SC 2HYFA 2L9VA 5GAEJ 3IV5A 2L4MA 5LHGA 2LG4A 5E1WA 2JPBA 3EPZA 3B02A 1IN5A 3TP0A 3BWGA 1L3LA 2ZXHA 1A6IA 1V5FA 3OS1A 1NK3P 1RESA 3PNVA 1M1EB 5E1ZB 3ZPLA 4GO1A 1YJ9I 3BG9A 2OCEA 3WGHA 4YIIA 4ETSA 2EV6A 1FIPA 1SC7A 4LG3A 2LSOA 1ZQ3P 3K4NA 2GIVA 3LSKA 4RLQA 1AOYA 3IKVA 1W7PB 2RAEA 4BAYA 4I2OA 3J81K 2K9MA 1N78A 3HYIA 3CCVI 1FOKA 1P4WA 2EIJH 3ASNH 2STTA 4HSTA 2FMYA 2KDOA 2MYSA 3F8MA 5KVRA 4B09A 1P92A 2EFQA 1D5YA 2JA7J 5DM6F 1WPKA 1WH7A 1OQYA 3DXJF 3F8BA 4EGZA 4ENMA 3C18A 1YJNI 2M3AA 4RM2A 3H5RA 3ESWB 3K1MA 2VC1A 2VIXA 3DP7A 1KYWA 3M1EA 4AUXA 4P9UA 5J4YA 3DQVC 2BXZA 3JW4A 4D5CA 5HLIA 3L00A 4IF4A 4Y3OA 1T39A 1XGOA 2R4GA 1AKHB 3A02A 2Z33A 4N9IA 4DOZA 2K9LA 2DO7A 3LAPA 1K7AA 3IHUA 5BPIA 5JLWA 1N25A 1F43A 3PO3J 4LLNA 3AG4H 2X6WA 2IXSA 1XMKA 4B3AA 1BI3A 3PNTA 1IRGA 2XVCA 4HW0A 4HYEA 1GUUA 1DU6A 2VJIA 2YX7A 4LGWA 4CSWA 3OY9A 2VB6A 3WTYC 5K1YA 1ZYRF 4GXOA 5DTDA 1JHHA 3CD6I 2RQPA 2XPUA 1QQIA 3K1PA 2L7KA 3F6OA 4U7BA 3KZYA 3HRMA 2VJ5A 2M7AA 1LNWA 4JX6A 1QRYA 5AIPA 4CCNA 1OMIA 1WJEA 5IYCJ 5ILSA 5J6XA 2DOEA 1IAWA 4FISA 2BE5F 3SEQA 3CCSI 2R0QC 3BOQA 2OTJI 1BJZA 3HKZA 4RM3A 4K2EA 2R7WA 2VC0A 4XLEA 5CLSA 3JAMK 1QVTA 2EZHA 4BH9A 3AG3H 4JQFA 3DWLE 4LB6B 2VPRA 2GXGA 1J59A 2W85A 2W00A 3EYYA 1ZGJA 5FKOA 3CF5F 1I6XA 1YS6A 2CV0A 2YR2A 3WTSC 2NVXJ 3VWBA 4AIKA 3F22A 3KP4A 4UVAA 3WG9A 3TO7A 4BJ6C 3E1SA 3E6MA 4XOTA 2ETHA 3RZDJ 1TWFJ 5HS9A 3MKYB 4C30A 2W4SA 2HVRA 2G9WA 1O57A 3GVAA 3K4CA 4XLAA 2IT0A 2OU2A 1USTA 3S1NJ 2LDUA 3L2WA 4EEFG 4MNUA 1G3TA 5H6QA 3W6JB 4E7SA 2B7EA 2OZ6A 5LGTA 2ELKA 3U2RA 4IQJA 1OCPA 2YU3A 3FBIB 4I01A 1X4OA 2HVSA 2R5YA 1T56A 1BR1A 2FXAA 5L3GA 4RAGA 2M4GA 1S72I 3JTGA 1I3AA 2CUZA 5M3FJ 2KKOA 1MDMB 5IYDJ 2G7HA 4M9ZA 5DUKA 1BOAA 4H0EA 2RN7A 3FKJA 5IP7J 1X3UA 2F2EA 1N75A 4DIQA 4UUSB 3K69A 4ZH4F 1JXSA 5IT9Z 3M8FA 2R93J 1FOWA 1W5TA 3ZN1A 4BUPA 5L3EA 3S1QJ 3FXOA 4WX9A 6PAXA 3V7SA 1ZELA 2CWEA 2FD5A 5D4RA 3PM1A 2KIMA 3TDUC 3IUOA 4A3JJ 3OOUA 3P7NA 1K4TA 3JRDA 3DEUA 3E6CC 1WVRA 2A5WA 5TJJA 5LGUA 4FCYA 4HLXA 1ETXA 2FBIA 3K6GA 5IP9J 2H6BA 4BE0A 3PQKA 2L4AA 1D1BA 5GADJ 1Z05A 4DW6A 3GTOJ 2L9RA 1P7IA 3F8NA 3OYNA 1DPUA 3WTUC 2Y9ZA 3R6SA 2HR3A 3GTKJ 4PSXA 3HRTA 4QPOA 3BPXA 2MA3A 4PCQA 2VI6A 2IVMA 3JRBA 2HWVA 1ZGAA 5D5WB 5FRMA 1VQPI 5E3MA 3DKYA 1YQAA 2HKXA 2VKDA 2LFBA 5F64A 3S32A 5CPRB 2YU9J 3F9KA 3WE2A 3VYRB 1SVMA 1S9HA 5F08A 1VQ8I 4HF2A 3DEWA 1CF7A 1E2XA 1YYVA 3FXMA 5KAIC 2LBFB 3GZ6A 3MWMA 4HLYA 4LOCA 1Q1HA 1PP8F 4XK4A 5LEKA 1UMQA 2FUG2 3BCAA 2P7CB 2PI0A 2JA8J 2XGXA 2VOPA 1LE8B 2R7VA 3WTWC 2R7RA 2PFBA 3OSFA 1RRJA 1S7OA 1I6HJ 2PQ8A 4X0GA 2LYCA 3ZMZA 3PJRA 1FNNA 5HDKA 3FWEA 1RI7A 4A2UA 1VF9A 3G4SI 2QM3A 2WAFA 5J40A 2IRFG 2YPRA 1R58A 2DA5A 1OKRA 4BU2A 2K27A 1SD4A 1S6LA 2KDZA 3ASOH 1YS7A 3JAMZ 2P7VB 3HSRA 1QHHD 1TLHB 4ZC3A 2N8GA 4EMSA 4PJJA 1E17A 2DPDA 5CVUA 1R6RA 3LL7A 2IGNA 1A35A 3C3WA 2P4WA 4M9XA 5ILUA 2EZIA 3BR6A 3OYDA 4ZYHA 3TOAA 1YW7A 3VB2A 2BZTA 3C2HA 4BBRJ 4RAZA 4HRIA 1HKTA 4HF0A 5GP9A 2C6YA 2K5CA 3LA3A 1S3JA 2X6XA 2X85A 4NBQA 4Q4ZF 4B48A 1QZZA 3CMEI 3RQIA 1T6SA 3F21A 3DBRB 2QQAA 3CUOA 1T33A 4ZDPA 1WZ2A 2QENA 2PMZN 2IPQX 4EM1A 2A68F 4E7KA 4L0ZB 2WADA 2ZSIB 3GEZA 3ZQCA 3C1DA 4KISA 1WJBA 4RMNA 2IGMA 3T5XA 1HW1A 2E60A 1LFBA 2RNGA 3LSHA 4KMUX 2EZLA 4XL9A 5H6RA 4F55A 2YUSA 2EB7A 3B6AA 1FZPB 2Y48A 2HQAA 2UV1A 4AM3A 2HOTA 4DGWB 2F5FA 3ULQB 5GPCA 2H1LA 4F91B 4BBSJ 2EPFA 4MFEA 3EETA 4Y15A 3ECOA 4KMFA 2CYYA 1UCRA 3FZVA 2DN0A 2KT0A 1GT0C 4RGSA 3SYTA 1UHWA 2L2OA 5DYMA 4KIFA 3PFIA 4BQQA 3SDGA 2H1KA 3UNGC 3KEQA 2L5QA 2OC6A 4NQWA 5KCMA 1JUMA 2OAZA 1SANA 3KZZA 4BJ5C 2K40A 1FTZA 3GW2A 3QYBA 5LRRA 5E3LA 1B8IB 1DU0A 3S93A 4GGGA 1SFUA 1EA3A 3DFGA 4M74A 3U9GA 3GF2A 4MGRA 3UKGA 5B3SH 4Q48A 4BXXJ 2W7NA 2MH2A 1S29A 1UHMA 4KT6A 4B8XA 1SFOJ 2VBYA 4R8HA 3ZGKA 4S04A 3CZ6A 5CVJA 1WJFA 1U78A 3WU2C 2R7FA 2LMDA 1B72B 3HL2A 4L0YB 3RYRA 4C3IJ 4XLCA 4Z6YA 2Y30A 1BI2A 2QBYA 2QVOA 2O5RA 4G6TB 4LLGF 3WGGA 1I1GA 2MGQA 3KIOA 4EQQA 2JK3A 2JZYA 2YX4A 1G8XA 3WU1B 5CYVA 4DYCA 1LEBA 5BNGA 4C9YA 3IC7A 3GYHX 3OYEA 3BZKA 3MQ0A 4KA4A 1WI3A 3R61A 4WK8F 2ELHA 2Z5UA 1R5GA 3PL8A 2FQ4A 1VQ9I 5JI6A 3V42A 1TL8A 2ADUA 3HB9A 3KYDB 3OYHA 4OMYA 4RB0A 1X19A 2CW8A 3L2VA 3KP6A 2O9LA 2EILH 2GLOA 3M4OJ 2OJED 1IG7A 5HDGA 3L7WA 1YW9A 4XSXF 3LSGA 2DOAA 3RTRA 3HKZN 1FMVA 1IV6A 4KT5C 5CQGA 3WTZA 4DQ2A 3TQNA 4RGUA 5BPDA 4HNTA 2X9DA 4P5OA 2R7QA 2Z1DA 1F36A 3ZQQA 3ZQFA 1UG2A 5DDGA 1TWAJ 5E18F 1T8IA 1HDDC 2A69F 2LLKA 4ON0A 2MBFA 3JREA 5CQEA 3IL2A 1IUFA 3V4GA 2I8DA 2WA0A 4ESBA 5DD8A 1Y8RB 5BS6A 2P8TA 3SFZA 2X4HA 4S0HB 2ZFUA 4DNCA 5FJ8J 5E8GA 2GXBA 4PJMA 3HSFA 3IKTA 5LEJA 3R4KA 1A31A 4PJ0C 1ZG1A 3D5RC 4NDLA 3BZCA 1UJ8A 2TDXA 4A5NA 4M9SA 2VONA 1O3QA 2XGDA
chains in the Genus database with same CATH topology
4IHTA 1J7KA 2VBZA 3E6BA 5E8IA 2A61A 2M1BA 1SMTA 1XGSA 3ERED 3V8LA 3K2ZA 1EV7A 2QQBA 1MZBA 4IPAA 3F23A 5D5XB 1G4DA 2NRAC 4LD5A 3GLXA 5KK1A 2ZMEB 1ZAOA 2H27A 3HIFA 1FP1D 3HUGA 4CO8A 4O5VA 1FC3A 4MEXF 3GWZA 3HHHA 1FLIA 1LDJA 2D45A 2DPUA 2FQ3A 5FB2A 2K4JA 4ZZLA 5F1RA 1BC8C 4YFXF 3TO6A 4CZZA 2M8EA 3O6BB 4UVBA 2VE9A 1U2WA 4PGGA 2HKOA 3SZPA 1STZA 4LG0B 4OU0A 1WRJA 2EV5A 4HX4A 1YLFA 4YIFA 3FXRA 4L5JA 1HW2A 2J5OA 1TQPA 1PDNC 4RGXA 3MEXA 1XGMA 2MLKA 1YTYA 4L5IA 1OYIA 2OQGA 4EVIA 4RGRA 2EFWA 2JRTA 3F72A 3LQRA 1XB4A 3N4MA 1BI1A 3LFKA 1FY7A 1B9MA 4R1HA 2FOKA 2XAQA 1MJAA 2GQQA 5JVTA 3WE3A 1D8KA 4TV7A 2EV0A 4P96A 1KA8A 1WQ2A 2RKHA 1MGTA 4M73A 2BV6A 2GAUA 5EEGA 1BI0A 3M7GA 5BQTA 1P2FA 3CDHA 2E7XA 4E70A 1BBYA 1FBQA 4O6JA 2M45A 2E1CA 3GX4X 4MEYF 1Z7UA 3JTHA 3Q5FA 4D0PA 4LFUA 2OBPA 2F5CA 2W57A 2W84A 3R0JA 1TNTA 4Y17A 4HOBA 3FX3A 2L3DA 1Z6RA 2QWWA 4A6EA 1IXCA 4L18B 4A0YA 5IT9K 4WXCA 3NEUA 2V1UA 2XROA 4QWQA 4M72A 1XMAA 2HQRA 2K7LA 4UHTA 4HDVA 1HSJA 4U0YA 3QU3A 1J0RA 3ML6A 1ZHFA 4ENJA 1KU2A 3QP5A 4JBAA 3VOEA 1MKMA 1FYKA 1JHFA 3DV8A 4U88A 4KFCA 5FGMA 1U5TB 1I5ZA 4HQEA 4OIOF 2NYXA 4L9TA 2ESHA 2B0LA 3E5UA 1LVAA 4LK1F 3WU0A 4ESJA 3BP8A 3DKWA 2PLYA 1KGSA 3GFMA 1F5TA 2A3SA 1IN6A 1IZ1A 2DBBA 5EEHA 2KRFA 3CO7C 5BMZA 5J8FA 1R1VA 2WV0A 5E20A 3HTSB 3BROA 1O3SA 1SMYF 1Z1DA 2MC3A 2L02A 4HBLA 5FO5A 1RUNA 1DP7P 1OR7A 3J80Z 4KDPA 1QGPA 2QLZA 1KQ8A 3HHGA 3CUQA 2V79A 3BJOA 3F6VA 1T2KA 3T8TA 3OV8A 2L01A 5FD5A 3MZHA 1ZARA 4AIHA 3BY6A 2BEOA 1Z91A 3ZMTA 3QRFF 2KIFA 3V8JA 3KFWX 1QBJA 1RNLA 3FMSA 1SD6A 1IN8A 5DUIA 1FP2A 4LB5A 3MCZA 3VEPA 2CSOA 2IP2A 4KICA 2R3SA 4CDGA 1HKSA 5LHIA 3BZ6A 2UXXA 3HOSA 2QBYB 3ISPA 4UV9A 1QZYA 1G6NA 4CYDA 1R1TA 4RB2C 3I59B 2PG4A 4WF2A 1LJ9A 2PJPA 1GXPA 2KJCA 4HAMA 5FFXA 3TKYA 1WWXA 4I0AA 5JHUA 2A07F 3ZMSA 1GXQA 2COMA 1Z6TA 1FYMA 4WXHA 3RJPA 3T1BA 2GA2A 1FSHA 3ABUA 2FE3A 3KP5A 3I54A 2X0LA 1PP7U 2IA1A 5ICGA 5JR3A 4GYIA 2DQRA 1W7PA 4OMZA 3FHZA 5E1XA 3RI4A 1O7FA 2FNPA 4KIGA 1ULYA 1B4AA 3RDIA 5IT3A 5J8CA 3QPHA 4BYYA 4G6DA 2RV8A 4EJUA 4OIQF 5CJ9A 3GFIA 3KEOA 4A0XA 1RUOA 3PQJA 2F5EA 4ZYDA 3EUHA 1IRFA 1VTNC 3ECHA 4Q5SF 2M30A 4LK0F 4N9HA 3U1DA 4HX7A 3NRVA 3F3XA 4GYGA 3MFKA 2W25A 3BPVA 4A0ZA 2GZWA 1ZLKA 5DCMB 4ZYEA 3CO6C 3HTUA 1J5YA 2FNAA 3E3VA 3BDDA 5HOOA 4G7ZF 2FA5A 2GWRA 5H20A 4NHJA 1XD7A 2LF7A 3D5LA 3ABTA 2VN2A 3S2WA 1XSDA 1C0WA 1D3YA 4S05A 2DTRA 3KLOA 4MQVA 4HF1A 1KQ0A 3KETA 3DF8A 2A6EF 2DAOA 2Z99A 3LA7A 1ZREA 3K9TA 3EDPA 3O3KA 2XKOA 1F4KA 2DI3A 1MD0A 1H9GA 1MJ9A 2VT2A 2PBIA 1TQIA 2XRNA 1DDNA 3CUQC 1MDMA 2E1NA 1NHAA 1RIOH 4ENKA 1FBSA 2XAFA 4G9YA 2LKPA 4U0VA 2GA1A 3I0TA 2DQLA 2DT5A 3R60A 1FWZA 3QOPA 2R7DA 3GO5A 3RKXA 3HRUA 4I7HA 2H6CA 4EJTA 4MTDA 4IRIA 3WGIA 1CGPA 3SHFA 2DLLA 3Q9VA 3FM3A 2D1VA 2CO5A 4EJWA 1H0MA 3P9CA 3EYIA 4G8XA 1UB9A 2VBWA 3BJAA 2ZKZA 4YFKF 3ZQ7A 4OINF 1SFEA 4I09A 2BYVE 2FRHA 1IXSB 3CJNA 4G94A 2QUFA 3HOTA 4HA8A 1DPRA 1BJAA 1BC7C 4EGYA 2FBKA 4I0BA 4EJVA 5ICEA 2MLGA 2E7WA 1ON1A 2RC4A 5ED4A 2OQRA 5D8KB 2PN6A 2JTVA 4G7HF 5BOXA 1XSXA 2XHKA 4U7DA 2CGPA 3I53A 2A6HF 3HSEA 4M71A 3G73A 2VE8A 2XIGA 1HW5A 1GVJA 1ZRDA 3TO9A 1DUXC 2ZJ2A 1ZH5A 4A12A 2DK8A 4EM0B 1KU3A 1LEAA 2V9VA 1W5SA 5CVRA 1KQ9A 4RB3C 1XCBA 4BXUA 1EH7A 4BHCA 3JSOA 4ZYGA 4KYWA 4CHUA 1SD7A 3CUQB 5LHHA 1I27A 5A2QZ 2FU4A 2HOEA 1Y0UA 4MQ9F 4PGHA 4F7ZA 1IF1A 2JPCA 3COAC 2VXZA 3I71A 2RDPA 5L3CA 2XASA 2JT1A 1YW8A 4HV5A 3WTTC 4EJOA 3J80K 5ERIA 2VOOA 5CVVA 2O0YA 5DD4A 5DCFA 1YO5C 3RIRA 2IA0A 1ZLJA 2M87A 1ODDA 2LNBA 3K1NA 2ZCWA 2RVCA 4AWXB 2ISZA 1QO0D 1XGNA 3P9KA 3IRRA 3RPQA 5FFZA 4AVPA 1USSA 4MTEA 2QYOA 5D5VB 2XAGA 4HX8A 5K5OA 1CF7B 2WWYA 1FX7A 3WTVC 1XN7A 1R00A 3KLNA 3I5UA 3GZ5A 2UWMA 1JGSA 2DW4A 1XDSA 2WTEA 2V6CA 3LQQA 1BIAA 2ZXJA 3JSPA 2HGCA 4Y13A 1B6AA 4NB5A 4HZFA 4IJAA 5FD6A 2CQKA 3IWFA 5DEQA 2K02A 4A6DA 2FEZA 4O3MA 4A5MA 3DPTA 2UZKA 4QLCU 4L9VA 4IRGA 3L9FA 2DK5A 2O61A 3T8RA 1UFMA 2PMHA 2VBXA 2FMLA 4PZJA 1D8JA 1SFXA 2JSCA 2HEOA 4XLPF 4BNCA 2ZMEA 1LDDA 4FHTA 1ZG3A 2ESNA 5ICCA 4AD9A 2P6TA 1LDKB 1XSVA 2STWA 2W24A 3ROUA 1K6OA 2UXNA 3ZN0A 5HVQC 1U8RA 3LSTA 2V1XA 2O8XA 2P5LC 1T98A 2J5PA 1ZRCA 3I4PA 2Y0MA 3KCCA 2Z9OA 1R1UA 4RAYA 3K0LA 1K79A 2D2WA 3H92A 4LG0A 4XLNF 1ON2A 1P4XA 2L54A 1K78A 2HQNA 3CLOA 5L3DA 5HLGA 1F9NA 1W7PD 2EFPA 4CICA 3ELKA 2F5DA 1KU7A 1IUYA 5FLXZ 3LA2A 3B73A 2QQ9A 3R0AA 2M5WA 2K4BA 4PDKA 3FMRA 4KIBA 2FSWA 5HLHA 2XV4S 5F6FA 1OYWA 5D4SA 4L9JA 2ZBKA 3SZTA 1HSTA 2O03A 2MD5A 1T38A 5LGNA 3QP6A 1B59A 5D5UB 3ZMVA 2K86A 3CTAA 4ESFA 1RZ4A 1R36A 2DFIA 2VODA 4L9NA 3C7JA 3J81Z 5HS7A 3L2CA 3DPLC 3QAHA 2OZUA 1G3YA 1PUEE 1JE8A 4XSZF 3MZYA 2P5KA 2Q0OA 1R23A 1HBXG 3J7AO 4I98B 2CG4A 1U6GA 1B9NA 1BIBA 3TGNA 1B1BA 3SXYA 2BGCA 4EM2A 1W4MA 4UUVA 1J2XA 3Q9SA 3E97A 4WXDA 4UV8A 4UVCA 1L0OC 3D0SA 4P9FA 1IN4A 4N0BA 2XAJA 1BN5A 4Q47A 1YFHA 1U3EM 4IHSA 5D6FA 3QU6A 4CXFA 1O7LA 4WWCA 1TBXA 3RYPA 1YIOA 2CFXA 2IW5A 2Z3YA 2RNJA 3LAJA 2O6GE 1R22A 3ZP5A 1U5TA 3P9IA 2HDCA 1F1ZA 1FBUA 2XKPA 3E5QA 3AAFA 2NNNA 1R5HA 1AWCA 3L09A 1FYLA 2ZO4A 1T0FA 4AIJA 1HQCA 2A5YB 4KN4X 2KIUA 2QZ8A 3KP3A 2IJLA 4KNYA 1LQ1A 3M8EA 3NQOA 4CGZA 1WSUA 2HS5A 3GFLA 4WCGA 1Z9CA 1HXDA 3I64A 3F8FA 2NS0A 1TW3A 1D5VA 3O2PE 2WC2A 5D6EA 1KYZA 4KUMA 1S8NA 2IA2A 1J75A 4LLLA 3KP2A 4JK1X 2P6SA 3E5XA 4BQAA 1P6RA 1SD5A 1YG2A 2ACJA 2HZTA 1GHCA 2VT3A 4OOIA 5LRSA 4HV6A 4BHBA 3EQLF 2BBYA 2HFHA 5K5QA 3W6KB 1TQMA 4ASNA 4M6YA 1V3FA 4RS8A 5A2QK 1H9TA 1XDUA 2HTSA 4EV0A 2FBHA 2HTJA 3IRQA 1O3RA 4RB1A 2HYGD 2XUBA 4HQMA 2EA4A 3TOBA 2H09A 1KU9A 3I59A 1P4AA 1G3WA 3IWZA 1HKQA 4OIPF 5HDNA 3FF5A 2EFNA 3LWFA 1ZRFA 5JFRA 2XAHA 3V7CA 5K5RA 2ISYA 3VODA 2EK5A 2EFOA 3ZMDA 3MAJA 5DV5A 2ZNZA 1WKMA 3FXQA 4OIRF 3VFZA 2DU9A 1QNTA 2H94A 4XRFA 5AIQA 4YG2F 5CVIA 4IRHA 3V8KA 1OPCA 4I02A 2ZFWA 3WTXC 2PEXA 4G7OF 5L3FA 4KN7X 4MHGA 4FT8A 1BM9A 3SQNA 2EJRA 2KJBA 2NAZA 5E17F 4LMYA 3HRSA 2AXLA 2G7UA 4IXAA 1I1SA 4FX0A 1MJBA 5HS8A 3T0YA 2FF4A 1IXRC 2PMUA 4ZZDA 1LB2A 4G6QA 3H3UA 1IN7A 3V7RA 1O3TA 2OD5A 3N97A 2V1DA 5L3BA 1TTYA 4IVNA 3RPUA 2CW0F 1WI9A 1OYYA 4P55A 4U0WA 3RKWA 3GUDA 5LLQA 3FMQA 2P5VA 4M6XA 2RGVA 1TW2A 3FM5A 1FSEA 1REPC 1A04A 1IW7F 1TNSA 5DCMA 1ONVA 5LBQA 3RKYA 1U5TC 3GXOA 4BHPA 1FT9A 4YFNF 2Q8KA 2EWNA 3KP7A 1K78B 4Z2YA 2MH9A 3QPTA 1ZN2A 3E6DA 2LF8A 3ZMUA 5ICFA 3G3ZA 4LJZF 1FPQA 2NNYA 2Y75A 1QPMA 4R79A 3KE2A 3BJ6A 5AONA 1ZG5A 4UXNA 1V4RA 3TDZC 3I58A 3REOA 4HDUA 5TRDA 2EA2A 1S7AA 1EH8A 3OOPA 1J9IA 4UNOA 1EH6A 4XBFA 1R7JA 2ZNYA 2YSRA 3FXUA 3GFJA 3M9AA 1G3SA 2O3FA 2OA4A 4GCVA 1XCVA 3H3ZA 5FLXK 5ILVA 3F8CA 2Q2EA 4ENNA 2D1HA 1SAXA 2AS5F 5D8LB 3WODF 4FX4A 2HYFA 2L4MA 5LHGA 5E1WA 2JPBA 3B02A 1IN5A 3BWGA 1L3LA 5E1ZB 3ZPLA 4GO1A 3WGHA 4YIIA 4ETSA 2EV6A 2LSOA 2GIVA 1AOYA 3IKVA 1W7PB 4BAYA 4I2OA 3J81K 3HYIA 1FOKA 1P4WA 2STTA 5KVRA 2FMYA 3F8MA 4B09A 1P92A 2EFQA 3DXJF 3F8BA 4EGZA 4ENMA 3C18A 3K1MA 2VC1A 3DP7A 1KYWA 3M1EA 4P9UA 3DQVC 3JW4A 5HLIA 3L00A 4IF4A 1T39A 1XGOA 2Z33A 4N9IA 2DO7A 3LAPA 1K7AA 3IHUA 5BPIA 4LLNA 1XMKA 1IRGA 1BI3A 2XVCA 4HW0A 4HYEA 2YX7A 4LGWA 3WTYC 5K1YA 1ZYRF 4GXOA 1JHHA 2RQPA 3K1PA 1QQIA 3F6OA 4U7BA 3KZYA 3HRMA 1LNWA 5AIPA 1OMIA 5ILSA 5J6XA 1IAWA 2BE5F 3BOQA 4K2EA 2VC0A 3JAMK 5CLSA 4BH9A 4JQFA 4LB6B 2GXGA 1J59A 2W85A 3EYYA 1ZGJA 1I6XA 1YS6A 2YR2A 3WTSC 4AIKA 3F22A 3KP4A 4UVAA 3WG9A 3TO7A 3E6MA 2ETHA 5HS9A 2G9WA 1O57A 3GVAA 2IT0A 2OU2A 1USTA 2LDUA 4MNUA 1G3TA 5H6QA 3W6JB 2OZ6A 5LGTA 3U2RA 2YU3A 4I01A 2FXAA 5L3GA 3JTGA 2KKOA 1MDMB 2G7HA 4M9ZA 5DUKA 1BOAA 2RN7A 1X3UA 2F2EA 3K69A 4ZH4F 1JXSA 5IT9Z 3M8FA 1W5TA 3ZN1A 5L3EA 4WX9A 6PAXA 3V7SA 2CWEA 5D4RA 2KIMA 3TDUC 3P7NA 3E6CC 3DEUA 5TJJA 5LGUA 4HLXA 2FBIA 2H6BA 3PQKA 2L4AA 1Z05A 1DPUA 3F8NA 3WTUC 3R6SA 2HR3A 3HRTA 3BPXA 2MA3A 4PCQA 2IVMA 2HWVA 1ZGAA 5D5WB 1YQAA 2HKXA 5F64A 3WE2A 4HF2A 1CF7A 1E2XA 1YYVA 3GZ6A 3MWMA 4HLYA 1Q1HA 1PP8F 5LEKA 2P7CB 2PI0A 2XGXA 2VOPA 3WTWC 2PFBA 1S7OA 2PQ8A 3ZMZA 1FNNA 5HDKA 3FWEA 1RI7A 4A2UA 2QM3A 2IRFG 2YPRA 1R58A 1OKRA 2K27A 1SD4A 1S6LA 1YS7A 3JAMZ 2P7VB 3HSRA 1TLHB 4EMSA 1E17A 2DPDA 5CVUA 3C3WA 2P4WA 4M9XA 5ILUA 4ZYHA 3TOAA 1YW7A 3VB2A 4RAZA 1HKTA 4HF0A 2C6YA 3LA3A 1S3JA 4Q4ZF 1QZZA 1T6SA 3F21A 2QQAA 3CUOA 2QENA 2IPQX 4EM1A 2A68F 4L0ZB 3GEZA 3C1DA 3T5XA 1HW1A 4KMUX 5H6RA 2EB7A 1FZPB 2Y48A 2F5FA 3ULQB 3EETA 4Y15A 3ECOA 4KMFA 2CYYA 1UCRA 3FZVA 4RGSA 1UHWA 5DYMA 4KIFA 3PFIA 3KEQA 4NQWA 2OAZA 3KZZA 3GW2A 5LRRA 4GGGA 1SFUA 3DFGA 4M74A 3U9GA 3GF2A 4MGRA 4Q48A 2MH2A 1S29A 1UHMA 4B8XA 2VBYA 4R8HA 4S04A 5CVJA 1U78A 2R7FA 4L0YB 3RYRA 1BI2A 2QBYA 2QVOA 4LLGF 3WGGA 1I1GA 4EQQA 2JZYA 2YX4A 3WU1B 5CYVA 1LEBA 3IC7A 3GYHX 3MQ0A 4KA4A 3R61A 4WK8F 2ELHA 2Z5UA 1R5GA 5JI6A 2ADUA 4OMYA 4RB0A 3KP6A 5HDGA 3L7WA 1YW9A 4XSXF 3RTRA 4KT5C 3WTZA 4DQ2A 3TQNA 4RGUA 5BPDA 4P5OA 5DDGA 5E18F 2A69F 4ON0A 2MBFA 3IL2A 3V4GA 4ESBA 5DD8A 5BS6A 2P8TA 3SFZA 2X4HA 4DNCA 5E8GA 2GXBA 3HSFA 3IKTA 5LEJA 3R4KA 1ZG1A 2TDXA 4A5NA 4M9SA 2VONA 1O3QA 4H0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHT A;  1J7K A;  2VBZ A;  3E6B A;  5E8I A;  2A61 A;  2M1B A;  1SMT A;  1XGS A;  3ERE D;  3V8L A;  3K2Z A;  1EV7 A;  2QQB A;  1MZB A;  4IPA A;  3F23 A;  5D5X B;  1G4D A;  2NRA C;  4LD5 A;  3GLX A;  5KK1 A;  2ZME B;  1ZAO A;  2H27 A;  3HIF A;  1FP1 D;  3HUG A;  4CO8 A;  4O5V A;  1FC3 A;  4MEX F;  3GWZ A;  3HHH A;  1FLI A;  1LDJ A;  2D45 A;  2DPU A;  2FQ3 A;  5FB2 A;  2K4J A;  4ZZL A;  5F1R A;  1BC8 C;  4YFX F;  3TO6 A;  4CZZ A;  2M8E A;  3O6B B;  4UVB A;  2VE9 A;  1U2W A;  4PGG A;  2HKO A;  3SZP A;  1STZ A;  4LG0 B;  4OU0 A;  1WRJ A;  2EV5 A;  4HX4 A;  1YLF A;  4YIF A;  3FXR A;  4L5J A;  1HW2 A;  2J5O A;  1TQP A;  1PDN C;  4RGX A;  3MEX A;  1XGM A;  2MLK A;  1YTY A;  4L5I A;  1OYI A;  2OQG A;  4EVI A;  4RGR A;  2EFW A;  2JRT A;  3F72 A;  3LQR A;  1XB4 A;  3N4M A;  1BI1 A;  3LFK A;  1FY7 A;  1B9M A;  4R1H A;  2FOK A;  2XAQ A;  1MJA A;  2GQQ A;  5JVT A;  3WE3 A;  1D8K A;  4TV7 A;  2EV0 A;  4P96 A;  1KA8 A;  1WQ2 A;  2RKH A;  1MGT A;  4M73 A;  2BV6 A;  2GAU A;  5EEG A;  1BI0 A;  3M7G A;  5BQT A;  1P2F A;  3CDH A;  2E7X A;  4E70 A;  1BBY A;  1FBQ A;  4O6J A;  2M45 A;  2E1C A;  3GX4 X;  4MEY F;  1Z7U A;  3JTH A;  3Q5F A;  4D0P A;  4LFU A;  2OBP A;  2F5C A;  2W57 A;  2W84 A;  3R0J A;  1TNT A;  4Y17 A;  4HOB A;  3FX3 A;  2L3D A;  1Z6R A;  2QWW A;  4A6E A;  1IXC A;  4L18 B;  4A0Y A;  5IT9 K;  4WXC A;  3NEU A;  2V1U A;  2XRO A;  4QWQ A;  4M72 A;  1XMA A;  2HQR A;  2K7L A;  4UHT A;  4HDV A;  1HSJ A;  4U0Y A;  3QU3 A;  1J0R A;  3ML6 A;  1ZHF A;  4ENJ A;  1KU2 A;  3QP5 A;  4JBA A;  3VOE A;  1MKM A;  1FYK A;  1JHF A;  3DV8 A;  4U88 A;  4KFC A;  5FGM A;  1U5T B;  1I5Z A;  4HQE A;  4OIO F;  2NYX A;  4L9T A;  2ESH A;  2B0L A;  3E5U A;  1LVA A;  4LK1 F;  3WU0 A;  4ESJ A;  3BP8 A;  3DKW A;  2PLY A;  1KGS A;  3GFM A;  1F5T A;  2A3S A;  1IN6 A;  1IZ1 A;  2DBB A;  5EEH A;  2KRF A;  3CO7 C;  5BMZ A;  5J8F A;  1R1V A;  2WV0 A;  5E20 A;  3HTS B;  3BRO A;  1O3S A;  1SMY F;  1Z1D A;  2MC3 A;  2L02 A;  4HBL A;  5FO5 A;  1RUN A;  1DP7 P;  1OR7 A;  3J80 Z;  4KDP A;  1QGP A;  2QLZ A;  1KQ8 A;  3HHG A;  3CUQ A;  2V79 A;  3BJO A;  3F6V A;  1T2K A;  3T8T A;  3OV8 A;  2L01 A;  5FD5 A;  3MZH A;  1ZAR A;  4AIH A;  3BY6 A;  2BEO A;  1Z91 A;  3ZMT A;  3QRF F;  2KIF A;  3V8J A;  3KFW X;  1QBJ A;  1RNL A;  3FMS A;  1SD6 A;  1IN8 A;  5DUI A;  1FP2 A;  4LB5 A;  3MCZ A;  3VEP A;  2CSO A;  2IP2 A;  4KIC A;  2R3S A;  4CDG A;  1HKS A;  5LHI A;  3BZ6 A;  2UXX A;  3HOS A;  2QBY B;  3ISP A;  4UV9 A;  1QZY A;  1G6N A;  4CYD A;  1R1T A;  4RB2 C;  3I59 B;  2PG4 A;  4WF2 A;  1LJ9 A;  2PJP A;  1GXP A;  2KJC A;  4HAM A;  5FFX A;  3TKY A;  1WWX A;  4I0A A;  5JHU A;  2A07 F;  3ZMS A;  1GXQ A;  2COM A;  1Z6T A;  1FYM A;  4WXH A;  3RJP A;  3T1B A;  2GA2 A;  1FSH A;  3ABU A;  2FE3 A;  3KP5 A;  3I54 A;  2X0L A;  1PP7 U;  2IA1 A;  5ICG A;  5JR3 A;  4GYI A;  2DQR A;  1W7P A;  4OMZ A;  3FHZ A;  5E1X A;  3RI4 A;  1O7F A;  2FNP A;  4KIG A;  1ULY A;  1B4A A;  3RDI A;  5IT3 A;  5J8C A;  3QPH A;  4BYY A;  4G6D A;  2RV8 A;  4EJU A;  4OIQ F;  5CJ9 A;  3GFI A;  3KEO A;  4A0X A;  1RUO A;  3PQJ A;  2F5E A;  4ZYD A;  3EUH A;  1IRF A;  1VTN C;  3ECH A;  4Q5S F;  2M30 A;  4LK0 F;  4N9H A;  3U1D A;  4HX7 A;  3NRV A;  3F3X A;  4GYG A;  3MFK A;  2W25 A;  3BPV A;  4A0Z A;  2GZW A;  1ZLK A;  5DCM B;  4ZYE A;  3CO6 C;  3HTU A;  1J5Y A;  2FNA A;  3E3V A;  3BDD A;  5HOO A;  4G7Z F;  2FA5 A;  2GWR A;  5H20 A;  4NHJ A;  1XD7 A;  2LF7 A;  3D5L A;  3ABT A;  2VN2 A;  3S2W A;  1XSD A;  1C0W A;  1D3Y A;  4S05 A;  2DTR A;  3KLO A;  4MQV A;  4HF1 A;  1KQ0 A;  3KET A;  3DF8 A;  2A6E F;  2DAO A;  2Z99 A;  3LA7 A;  1ZRE A;  3K9T A;  3EDP A;  3O3K A;  2XKO A;  1F4K A;  2DI3 A;  1MD0 A;  1H9G A;  1MJ9 A;  2VT2 A;  2PBI A;  1TQI A;  2XRN A;  1DDN A;  3CUQ C;  1MDM A;  2E1N A;  1NHA A;  1RIO H;  4ENK A;  1FBS A;  2XAF A;  4G9Y A;  2LKP A;  4U0V A;  2GA1 A;  3I0T A;  2DQL A;  2DT5 A;  3R60 A;  1FWZ A;  3QOP A;  2R7D A;  3GO5 A;  3RKX A;  3HRU A;  4I7H A;  2H6C A;  4EJT A;  4MTD A;  4IRI A;  3WGI A;  1CGP A;  3SHF A;  2DLL A;  3Q9V A;  3FM3 A;  2D1V A;  2CO5 A;  4EJW A;  1H0M A;  3P9C A;  3EYI A;  4G8X A;  1UB9 A;  2VBW A;  3BJA A;  2ZKZ A;  4YFK F;  3ZQ7 A;  4OIN F;  1SFE A;  4I09 A;  2BYV E;  2FRH A;  1IXS B;  3CJN A;  4G94 A;  2QUF A;  3HOT A;  4HA8 A;  1DPR A;  1BJA A;  1BC7 C;  4EGY A;  2FBK A;  4I0B A;  4EJV A;  5ICE A;  2MLG A;  2E7W A;  1ON1 A;  2RC4 A;  5ED4 A;  2OQR A;  5D8K B;  2PN6 A;  2JTV A;  4G7H F;  5BOX A;  1XSX A;  2XHK A;  4U7D A;  2CGP A;  3I53 A;  2A6H F;  3HSE A;  4M71 A;  3G73 A;  2VE8 A;  2XIG A;  1HW5 A;  1GVJ A;  1ZRD A;  3TO9 A;  1DUX C;  2ZJ2 A;  1ZH5 A;  4A12 A;  2DK8 A;  4EM0 B;  1KU3 A;  1LEA A;  2V9V A;  1W5S A;  5CVR A;  1KQ9 A;  4RB3 C;  1XCB A;  4BXU A;  1EH7 A;  4BHC A;  3JSO A;  4ZYG A;  4KYW A;  4CHU A;  1SD7 A;  3CUQ B;  5LHH A;  1I27 A;  5A2Q Z;  2FU4 A;  2HOE A;  1Y0U A;  4MQ9 F;  4PGH A;  4F7Z A;  1IF1 A;  2JPC A;  3COA C;  2VXZ A;  3I71 A;  2RDP A;  5L3C A;  2XAS A;  2JT1 A;  1YW8 A;  4HV5 A;  3WTT C;  4EJO A;  3J80 K;  5ERI A;  2VOO A;  5CVV A;  2O0Y A;  5DD4 A;  5DCF A;  1YO5 C;  3RIR A;  2IA0 A;  1ZLJ A;  2M87 A;  1ODD A;  2LNB A;  3K1N A;  2ZCW A;  2RVC A;  4AWX B;  2ISZ A;  1QO0 D;  1XGN A;  3P9K A;  3IRR A;  3RPQ A;  5FFZ A;  4AVP A;  1USS A;  4MTE A;  2QYO A;  5D5V B;  2XAG A;  4HX8 A;  5K5O A;  1CF7 B;  2WWY A;  1FX7 A;  3WTV C;  1XN7 A;  1R00 A;  3KLN A;  3I5U A;  3GZ5 A;  2UWM A;  1JGS A;  2DW4 A;  1XDS A;  2WTE A;  2V6C A;  3LQQ A;  1BIA A;  2ZXJ A;  3JSP A;  2HGC A;  4Y13 A;  1B6A A;  4NB5 A;  4HZF A;  4IJA A;  5FD6 A;  2CQK A;  3IWF A;  5DEQ A;  2K02 A;  4A6D A;  2FEZ A;  4O3M A;  4A5M A;  3DPT A;  2UZK A;  4QLC U;  4L9V A;  4IRG A;  3L9F A;  2DK5 A;  2O61 A;  3T8R A;  1UFM A;  2PMH A;  2VBX A;  2FML A;  4PZJ A;  1D8J A;  1SFX A;  2JSC A;  2HEO A;  4XLP F;  4BNC A;  2ZME A;  1LDD A;  4FHT A;  1ZG3 A;  2ESN A;  5ICC A;  4AD9 A;  2P6T A;  1LDK B;  1XSV A;  2STW A;  2W24 A;  3ROU A;  1K6O A;  2UXN A;  3ZN0 A;  5HVQ C;  1U8R A;  3LST A;  2V1X A;  2O8X A;  2P5L C;  1T98 A;  2J5P A;  1ZRC A;  3I4P A;  2Y0M A;  3KCC A;  2Z9O A;  1R1U A;  4RAY A;  3K0L A;  1K79 A;  2D2W A;  3H92 A;  4LG0 A;  4XLN F;  1ON2 A;  1P4X A;  2L54 A;  1K78 A;  2HQN A;  3CLO A;  5L3D A;  5HLG A;  1F9N A;  1W7P D;  2EFP A;  4CIC A;  3ELK A;  2F5D A;  1KU7 A;  1IUY A;  5FLX Z;  3LA2 A;  3B73 A;  2QQ9 A;  3R0A A;  2M5W A;  2K4B A;  4PDK A;  3FMR A;  4KIB A;  2FSW A;  5HLH A;  2XV4 S;  5F6F A;  1OYW A;  5D4S A;  4L9J A;  2ZBK A;  3SZT A;  1HST A;  2O03 A;  2MD5 A;  1T38 A;  5LGN A;  3QP6 A;  1B59 A;  5D5U B;  3ZMV A;  2K86 A;  3CTA A;  4ESF A;  1RZ4 A;  1R36 A;  2DFI A;  2VOD A;  4L9N A;  3C7J A;  3J81 Z;  5HS7 A;  3L2C A;  3DPL C;  3QAH A;  2OZU A;  1G3Y A;  1PUE E;  1JE8 A;  4XSZ F;  3MZY A;  2P5K A;  2Q0O A;  1R23 A;  1HBX G;  3J7A O;  4I98 B;  2CG4 A;  1U6G A;  1B9N A;  1BIB A;  3TGN A;  1B1B A;  3SXY A;  2BGC A;  4EM2 A;  1W4M A;  4UUV A;  1J2X A;  3Q9S A;  3E97 A;  4WXD A;  4UV8 A;  4UVC A;  1L0O C;  3D0S A;  4P9F A;  1IN4 A;  4N0B A;  2XAJ A;  1BN5 A;  4Q47 A;  1YFH A;  1U3E M;  4IHS A;  5D6F A;  3QU6 A;  4CXF A;  1O7L A;  4WWC A;  1TBX A;  3RYP A;  1YIO A;  2CFX A;  2IW5 A;  2Z3Y A;  2RNJ A;  3LAJ A;  2O6G E;  1R22 A;  3ZP5 A;  1U5T A;  3P9I A;  2HDC A;  1F1Z A;  1FBU A;  2XKP A;  3E5Q A;  3AAF A;  2NNN A;  1R5H A;  1AWC A;  3L09 A;  1FYL A;  2ZO4 A;  1T0F A;  4AIJ A;  1HQC A;  2A5Y B;  4KN4 X;  2KIU A;  2QZ8 A;  3KP3 A;  2IJL A;  4KNY A;  1LQ1 A;  3M8E A;  3NQO A;  4CGZ A;  1WSU A;  2HS5 A;  3GFL A;  4WCG A;  1Z9C A;  1HXD A;  3I64 A;  3F8F A;  2NS0 A;  1TW3 A;  1D5V A;  3O2P E;  2WC2 A;  5D6E A;  1KYZ A;  4KUM A;  1S8N A;  2IA2 A;  1J75 A;  4LLL A;  3KP2 A;  4JK1 X;  2P6S A;  3E5X A;  4BQA A;  1P6R A;  1SD5 A;  1YG2 A;  2ACJ A;  2HZT A;  1GHC A;  2VT3 A;  4OOI A;  5LRS A;  4HV6 A;  4BHB A;  3EQL F;  2BBY A;  2HFH A;  5K5Q A;  3W6K B;  1TQM A;  4ASN A;  4M6Y A;  1V3F A;  4RS8 A;  5A2Q K;  1H9T A;  1XDU A;  2HTS A;  4EV0 A;  2FBH A;  2HTJ A;  3IRQ A;  1O3R A;  4RB1 A;  2HYG D;  2XUB A;  4HQM A;  2EA4 A;  3TOB A;  2H09 A;  1KU9 A;  3I59 A;  1P4A A;  1G3W A;  3IWZ A;  1HKQ A;  4OIP F;  5HDN A;  3FF5 A;  2EFN A;  3LWF A;  1ZRF A;  5JFR A;  2XAH A;  3V7C A;  5K5R A;  2ISY A;  3VOD A;  2EK5 A;  2EFO A;  3ZMD A;  3MAJ A;  5DV5 A;  2ZNZ A;  1WKM A;  3FXQ A;  4OIR F;  3VFZ A;  2DU9 A;  1QNT A;  2H94 A;  4XRF A;  5AIQ A;  4YG2 F;  5CVI A;  4IRH A;  3V8K A;  1OPC A;  4I02 A;  2ZFW A;  3WTX C;  2PEX A;  4G7O F;  5L3F A;  4KN7 X;  4MHG A;  4FT8 A;  1BM9 A;  3SQN A;  2EJR A;  2KJB A;  2NAZ A;  5E17 F;  4LMY A;  3HRS A;  2AXL A;  2G7U A;  4IXA A;  1I1S A;  4FX0 A;  1MJB A;  5HS8 A;  3T0Y A;  2FF4 A;  1IXR C;  2PMU A;  4ZZD A;  1LB2 A;  4G6Q A;  3H3U A;  1IN7 A;  3V7R A;  1O3T A;  2OD5 A;  3N97 A;  2V1D A;  5L3B A;  1TTY A;  4IVN A;  3RPU A;  2CW0 F;  1WI9 A;  1OYY A;  4P55 A;  4U0W A;  3RKW A;  3GUD A;  5LLQ A;  3FMQ A;  2P5V A;  4M6X A;  2RGV A;  1TW2 A;  3FM5 A;  1FSE A;  1REP C;  1A04 A;  1IW7 F;  1TNS A;  5DCM A;  1ONV A;  5LBQ A;  3RKY A;  1U5T C;  3GXO A;  4BHP A;  1FT9 A;  4YFN F;  2Q8K A;  2EWN A;  3KP7 A;  1K78 B;  4Z2Y A;  2MH9 A;  3QPT A;  1ZN2 A;  3E6D A;  2LF8 A;  3ZMU A;  5ICF A;  3G3Z A;  4LJZ F;  1FPQ A;  2NNY A;  2Y75 A;  1QPM A;  4R79 A;  3KE2 A;  3BJ6 A;  5AON A;  1ZG5 A;  4UXN A;  1V4R A;  3TDZ C;  3I58 A;  3REO A;  4HDU A;  5TRD A;  2EA2 A;  1S7A A;  1EH8 A;  3OOP A;  1J9I A;  4UNO A;  1EH6 A;  4XBF A;  1R7J A;  2ZNY A;  2YSR A;  3FXU A;  3GFJ A;  3M9A A;  1G3S A;  2O3F A;  2OA4 A;  4GCV A;  1XCV A;  3H3Z A;  5FLX K;  5ILV A;  3F8C A;  2Q2E A;  4ENN A;  2D1H A;  1SAX A;  2AS5 F;  5D8L B;  3WOD F;  4FX4 A;  2HYF A;  2L4M A;  5LHG A;  5E1W A;  2JPB A;  3B02 A;  1IN5 A;  3BWG A;  1L3L A;  5E1Z B;  3ZPL A;  4GO1 A;  3WGH A;  4YII A;  4ETS A;  2EV6 A;  2LSO A;  2GIV A;  1AOY A;  3IKV A;  1W7P B;  4BAY A;  4I2O A;  3J81 K;  3HYI A;  1FOK A;  1P4W A;  2STT A;  5KVR A;  2FMY A;  3F8M A;  4B09 A;  1P92 A;  2EFQ A;  3DXJ F;  3F8B A;  4EGZ A;  4ENM A;  3C18 A;  3K1M A;  2VC1 A;  3DP7 A;  1KYW A;  3M1E A;  4P9U A;  3DQV C;  3JW4 A;  5HLI A;  3L00 A;  4IF4 A;  1T39 A;  1XGO A;  2Z33 A;  4N9I A;  2DO7 A;  3LAP A;  1K7A A;  3IHU A;  5BPI A;  4LLN A;  1XMK A;  1IRG A;  1BI3 A;  2XVC A;  4HW0 A;  4HYE A;  2YX7 A;  4LGW A;  3WTY C;  5K1Y A;  1ZYR F;  4GXO A;  1JHH A;  2RQP A;  3K1P A;  1QQI A;  3F6O A;  4U7B A;  3KZY A;  3HRM A;  1LNW A;  5AIP A;  1OMI A;  5ILS A;  5J6X A;  1IAW A;  2BE5 F;  3BOQ A;  4K2E A;  2VC0 A;  3JAM K;  5CLS A;  4BH9 A;  4JQF A;  4LB6 B;  2GXG A;  1J59 A;  2W85 A;  3EYY A;  1ZGJ A;  1I6X A;  1YS6 A;  2YR2 A;  3WTS C;  4AIK A;  3F22 A;  3KP4 A;  4UVA A;  3WG9 A;  3TO7 A;  3E6M A;  2ETH A;  5HS9 A;  2G9W A;  1O57 A;  3GVA A;  2IT0 A;  2OU2 A;  1UST A;  2LDU A;  4MNU A;  1G3T A;  5H6Q A;  3W6J B;  2OZ6 A;  5LGT A;  3U2R A;  2YU3 A;  4I01 A;  2FXA A;  5L3G A;  3JTG A;  2KKO A;  1MDM B;  2G7H A;  4M9Z A;  5DUK A;  1BOA A;  2RN7 A;  1X3U A;  2F2E A;  3K69 A;  4ZH4 F;  1JXS A;  5IT9 Z;  3M8F A;  1W5T A;  3ZN1 A;  5L3E A;  4WX9 A;  6PAX A;  3V7S A;  2CWE A;  5D4R A;  2KIM A;  3TDU C;  3P7N A;  3E6C C;  3DEU A;  5TJJ A;  5LGU A;  4HLX A;  2FBI A;  2H6B A;  3PQK A;  2L4A A;  1Z05 A;  1DPU A;  3F8N A;  3WTU C;  3R6S A;  2HR3 A;  3HRT A;  3BPX A;  2MA3 A;  4PCQ A;  2IVM A;  2HWV A;  1ZGA A;  5D5W B;  1YQA A;  2HKX A;  5F64 A;  3WE2 A;  4HF2 A;  1CF7 A;  1E2X A;  1YYV A;  3GZ6 A;  3MWM A;  4HLY A;  1Q1H A;  1PP8 F;  5LEK A;  2P7C B;  2PI0 A;  2XGX A;  2VOP A;  3WTW C;  2PFB A;  1S7O A;  2PQ8 A;  3ZMZ A;  1FNN A;  5HDK A;  3FWE A;  1RI7 A;  4A2U A;  2QM3 A;  2IRF G;  2YPR A;  1R58 A;  1OKR A;  2K27 A;  1SD4 A;  1S6L A;  1YS7 A;  3JAM Z;  2P7V B;  3HSR A;  1TLH B;  4EMS A;  1E17 A;  2DPD A;  5CVU A;  3C3W A;  2P4W A;  4M9X A;  5ILU A;  4ZYH A;  3TOA A;  1YW7 A;  3VB2 A;  4RAZ A;  1HKT A;  4HF0 A;  2C6Y A;  3LA3 A;  1S3J A;  4Q4Z F;  1QZZ A;  1T6S A;  3F21 A;  2QQA A;  3CUO A;  2QEN A;  2IPQ X;  4EM1 A;  2A68 F;  4L0Z B;  3GEZ A;  3C1D A;  3T5X A;  1HW1 A;  4KMU X;  5H6R A;  2EB7 A;  1FZP B;  2Y48 A;  2F5F A;  3ULQ B;  3EET A;  4Y15 A;  3ECO A;  4KMF A;  2CYY A;  1UCR A;  3FZV A;  4RGS A;  1UHW A;  5DYM A;  4KIF A;  3PFI A;  3KEQ A;  4NQW A;  2OAZ A;  3KZZ A;  3GW2 A;  5LRR A;  4GGG A;  1SFU A;  3DFG A;  4M74 A;  3U9G A;  3GF2 A;  4MGR A;  4Q48 A;  2MH2 A;  1S29 A;  1UHM A;  4B8X A;  2VBY A;  4R8H A;  4S04 A;  5CVJ A;  1U78 A;  2R7F A;  4L0Y B;  3RYR A;  1BI2 A;  2QBY A;  2QVO A;  4LLG F;  3WGG A;  1I1G A;  4EQQ A;  2JZY A;  2YX4 A;  3WU1 B;  5CYV A;  1LEB A;  3IC7 A;  3GYH X;  3MQ0 A;  4KA4 A;  3R61 A;  4WK8 F;  2ELH A;  2Z5U A;  1R5G A;  5JI6 A;  2ADU A;  4OMY A;  4RB0 A;  3KP6 A;  5HDG A;  3L7W A;  1YW9 A;  4XSX F;  3RTR A;  4KT5 C;  3WTZ A;  4DQ2 A;  3TQN A;  4RGU A;  5BPD A;  4P5O A;  5DDG A;  5E18 F;  2A69 F;  4ON0 A;  2MBF A;  3IL2 A;  3V4G A;  4ESB A;  5DD8 A;  5BS6 A;  2P8T A;  3SFZ A;  2X4H A;  4DNC A;  5E8G A;  2GXB A;  3HSF A;  3IKT A;  5LEJ A;  3R4K A;  1ZG1 A;  2TDX A;  4A5N A;  4M9S A;  2VON A;  1O3Q A;  4H0E A; 
#chains in the Genus database with same CATH topology
 2CV2 A;  4IHT A;  1J7K A;  2VBZ A;  1ETQ A;  2HOA A;  3E6B A;  4UUT A;  2K9N A;  5E8I A;  2A61 A;  1VI0 A;  2M1B A;  1IV8 A;  1SMT A;  3LSM A;  1ETV A;  2DA7 A;  5GPA A;  1U0J A;  3AL0 C;  1XGS A;  3G1L A;  3ERE D;  1Z7L A;  3V8L A;  4E4H A;  3K2Z A;  1EV7 A;  2QQB A;  2EQR A;  1R71 A;  3OYC A;  1MZB A;  4IPA A;  3F23 A;  5D5X B;  4DZP A;  2ID3 A;  1G4D A;  4UY8 I;  3VYU B;  3I56 I;  4LD5 A;  3GLX A;  5KK1 A;  2NRA C;  3S2H J;  2BVM A;  1ZAO A;  2ZME B;  1UG0 A;  2HDW A;  3A03 A;  3MZ8 A;  4JYK A;  2H27 A;  2BY3 A;  1ENH A;  3MKL A;  3HIF A;  1S5L C;  2HOS A;  1FP1 D;  3HUG A;  4CO8 A;  1A6Q A;  4O5V A;  4C2M J;  1FC3 A;  2Y31 A;  3C2G A;  4MEX F;  3GWZ A;  2XC7 A;  3HHH A;  1FLI A;  3BT9 A;  1LDJ A;  4IHY A;  3SDB A;  4B43 A;  2D45 A;  2DPU A;  2FQ3 A;  5FB2 A;  2NVQ J;  2K4J A;  4ZZL A;  5F1R A;  1BC8 C;  4YFX F;  4DZJ A;  4YRV A;  3TO6 A;  4CZZ A;  2M8E A;  1MIJ A;  3O6B B;  4UVB A;  3ONQ A;  2VE9 A;  3G2B A;  1U2W A;  5B66 C;  4CCM A;  3KYL A;  4PGG A;  2HKO A;  2CQX A;  5C3E J;  3SZP A;  1STZ A;  4LG0 B;  3GTJ J;  1J09 A;  4OU0 A;  4RLF A;  1WRJ A;  2EV5 A;  4HX4 A;  4HNV A;  1YLF A;  4YIF A;  3CES A;  3W2A A;  1TWC J;  3FXR A;  4L5J A;  1HW2 A;  2QCO A;  5J47 A;  1HDP A;  3QQA A;  2NVY J;  2J5O A;  5E79 C;  1TQP A;  1R9T J;  1PDN C;  3H0G J;  5EGO B;  4RGX A;  3FXK A;  3MEX A;  2JUC A;  1RR7 A;  1XGM A;  3DCF A;  5F04 A;  1VFC A;  1W0T A;  3CP2 A;  2MLK A;  1YTY A;  1Z67 A;  3C2B A;  4L5I A;  4EAT A;  3SFI A;  1OYI A;  2OQG A;  1ERD A;  2CFO A;  3A0H C;  4EVI A;  2M4K A;  4RGR A;  2EFW A;  2JRT A;  4F3Q A;  3F72 A;  3LQR A;  1VQ5 I;  3QWL A;  2IS1 A;  3LSI A;  4UB6 C;  1DQU A;  1XB4 A;  3N4M A;  1BI1 A;  3LFK A;  2JJ7 A;  4D5F A;  5J3L A;  1FY7 A;  1B9M A;  3H1C A;  2FOK A;  4R1H A;  2OTL I;  1SAU A;  2XAQ A;  1E3H A;  1OJL A;  1MJA A;  1Y0N A;  5JLX A;  1XMX A;  2GQQ A;  2KFD A;  1BL0 A;  5JVT A;  2ZSH B;  3WE3 A;  1D8K A;  4TV7 A;  2XF7 A;  2EV0 A;  4P96 A;  1KA8 A;  1WQ2 A;  5K7H A;  2RKH A;  1MGT A;  3OIO A;  4M73 A;  3CCE I;  5K7F A;  3H9Q A;  2BV6 A;  1Y6I A;  3S2D J;  2GAU A;  5EEG A;  1BI0 A;  3M7G A;  4AYB A;  1P2F A;  5BQT A;  2BY1 A;  4CYC B;  1XTA A;  3CDH A;  2E7X A;  4E70 A;  2VKV A;  1BBY A;  1FBQ A;  4O6J A;  2M45 A;  2E1C A;  1NTC A;  2ZXI A;  4BEH A;  1FOY A;  3IAM 2;  5F0H A;  1JUS A;  2CJJ A;  3BC8 A;  3GX4 X;  3H35 A;  4MEY F;  1A36 A;  1Z7U A;  3JTH A;  3Q5F A;  2M0C A;  4D0P A;  4LFU A;  2OBP A;  2F5C A;  3FK7 A;  5EJC A;  2W57 A;  3M3Y J;  2W84 A;  4II3 A;  3R0J A;  1TNT A;  2LY9 A;  4Y17 A;  4HOB A;  2JA6 J;  3BLY A;  3FX3 A;  2L3D A;  1Z6R A;  4HPQ A;  1X2M A;  2QWW A;  4A6E A;  2XSJ C;  4ZYA A;  4D7M A;  1LFP A;  3FIW A;  1IXC A;  3LOC A;  4RDU A;  2F5V A;  4L18 B;  4A0Y A;  5IT9 K;  2BOL A;  4PFO A;  4WXC A;  3NEU A;  2V1U A;  2XRO A;  4QWQ A;  1JI8 A;  1VQ7 I;  3BTI A;  1Y39 A;  1H88 C;  4M72 A;  3OYL A;  1XMA A;  2HQR A;  2WAQ A;  3K10 A;  2K7L A;  3WG7 H;  2XRL A;  4UHT A;  4BAC A;  2RRE A;  4HDV A;  3QPS A;  1HSJ A;  2K3P A;  2X6Y A;  4U0Y A;  3QU3 A;  3ZRG A;  3O8H A;  1J0R A;  3ML6 A;  1ZHF A;  2AQF A;  4ENJ A;  1KU2 A;  3NWT A;  1G2H A;  3QP5 A;  3H5A A;  1TT0 A;  4JBA A;  1NG7 A;  2E36 A;  2PJR B;  3VOE A;  1MKM A;  1MNE A;  3F0C A;  1FYK A;  1JHF A;  4YIR X;  2CRG A;  3DV8 A;  4E6K G;  4U88 A;  2LH9 A;  2NOG A;  4KFC A;  3FK6 A;  5FGM A;  1U5T B;  3OWT A;  3TBI A;  1X1C A;  1I5Z A;  4P1W A;  2MW8 A;  4HQE A;  4OIO F;  3CMM A;  2NYX A;  4L9T A;  1Z21 A;  2DTZ A;  2LVS A;  2LR8 A;  2ESH A;  1Y1W J;  2OCC H;  2QGU A;  2B0L A;  2HXO A;  1FOX A;  3E5U A;  1LVA A;  4LK1 F;  2EIK H;  3WU0 A;  4ESJ A;  3BP8 A;  3DKW A;  2M0M A;  4X6A J;  2E19 A;  2PLY A;  1KGS A;  3FXL A;  5J1U A;  3GFM A;  1F5T A;  2A3S A;  3A2K A;  1IN6 A;  1IZ1 A;  2DBB A;  2NS8 A;  3TED A;  5EEH A;  2KRF A;  3K4K A;  2GXA A;  5FKK A;  5FLM J;  3OYI A;  3CO7 C;  4QTR A;  5BMZ A;  5J8F A;  1RR8 C;  2DFH A;  4A3E J;  1FJL A;  1R1V A;  4MFD A;  3FIS A;  5KHD A;  2WV0 A;  5E20 A;  3HTS B;  2LD5 A;  3BRO A;  1O3S A;  1SMY F;  1Z1D A;  4RA2 A;  2MC3 A;  2L02 A;  4HBL A;  2X1E A;  4QSH A;  1VQ6 I;  3I4N J;  2BY2 A;  4JX4 A;  5FO5 A;  1RUN A;  1WFX A;  1DP7 P;  1OR7 A;  3W3C A;  3MN2 A;  1MMD A;  3J80 Z;  5FRO A;  3LSJ A;  4KDP A;  1QGP A;  2X1D A;  2QLZ A;  1KQ8 A;  3HHG A;  3CUQ A;  3ERM A;  2E1M C;  2V79 A;  4M3E A;  3BJO A;  3F6V A;  1T2K A;  3T8T A;  2VPL A;  3OV8 A;  2L01 A;  2XB5 A;  5FD5 A;  3MZH A;  1ZAR A;  4AIH A;  2MAB A;  3BY6 A;  2BEO A;  3U21 A;  3HOY J;  4YEL A;  1Z91 A;  3S17 J;  3ZMT A;  3J7A Y;  3QRF F;  2KIF A;  2WY7 Q;  4NQW B;  3V8J A;  3KFW X;  1QBJ A;  2DA4 A;  1RNL A;  3CDL A;  3FMS A;  3AG1 H;  1SD6 A;  4XID A;  1IN8 A;  5DUI A;  1WJD A;  3DU5 A;  1FP2 A;  3HM5 A;  4LB5 A;  3MCZ A;  4MIM A;  3VEP A;  2H8R A;  3DEE A;  2CSO A;  2IP2 A;  2VJJ A;  2LY1 A;  4KIC A;  4E7H A;  2R3S A;  3OYJ A;  3OMY A;  5M5X J;  1ZR2 A;  4CDG A;  2BW3 A;  4A3G J;  3HZJ A;  2LRE A;  1HKS A;  2KLO A;  5LHI A;  3BZ6 A;  3GLL A;  2UXX A;  3HOS A;  2QBY B;  1ZTR A;  3BQY A;  3ISP A;  4Y33 A;  4UV9 A;  2XGE A;  1QZY A;  4XN0 A;  1YJW I;  4HG2 A;  4LIT A;  1G6N A;  2IGK A;  2VJ4 A;  4A3C J;  4CYD A;  3GTM J;  1V5G A;  1YE9 A;  1R1T A;  2DFF A;  4RB2 C;  1YX3 A;  3I59 B;  2PG4 A;  4WF2 A;  1LJ9 A;  3VPR A;  2ICW G;  1WJA A;  3N05 A;  2PJP A;  5EEA A;  1GXP A;  3CCJ I;  2KJC A;  4HAM A;  5FKM A;  5FFX A;  5GAG J;  3TKY A;  5EG0 A;  1SVO A;  1WWX A;  2XAU A;  4UB8 C;  1YRN A;  4I0A A;  3SJM A;  1UZC A;  5JHU A;  1AHD P;  2A07 F;  1TP4 A;  2R92 J;  3ZMS A;  1GXQ A;  2R7Z J;  5JHF A;  2DA6 A;  2COM A;  3FDY A;  4KIT B;  5K7Z A;  4V2G A;  3OYM A;  1Z6T A;  1FYM A;  3ABL H;  4WXH A;  3RJP A;  1OCC H;  2MFZ A;  1Q1V A;  4B1R A;  4F93 B;  3ABK H;  2MG4 A;  4IHV A;  5EZG A;  3T1B A;  5DS9 A;  2GA2 A;  1FSH A;  2KZG A;  3ABU A;  1Z3X A;  3W6V A;  3GTQ J;  4DBR A;  2FE3 A;  3KP5 A;  1LFU P;  3I54 A;  2JA5 J;  2X0L A;  4E7I A;  2L7Z A;  4D1Q A;  1ACI A;  3DLA A;  2DMQ A;  2R5Z A;  4CZC A;  1H8A C;  4C2U A;  1PP7 U;  2IA1 A;  2ZJQ F;  1RET A;  2Z2S B;  1XPX A;  4GFB A;  5ICG A;  5JR3 A;  2X48 A;  3HOX J;  4GYI A;  2DQR A;  1Y8Q B;  1W7P A;  4OMZ A;  3G1O A;  2LC2 A;  3GME A;  1EKE A;  3E0J B;  2KHM A;  3FHZ A;  4J01 A;  5E1X A;  3RI4 A;  1O7F A;  2FNP A;  2KQR A;  4KIG A;  4D7N A;  1ULY A;  1B4A A;  2E1M B;  3RDI A;  5IT3 A;  4ANJ A;  4OAZ A;  2ZJP F;  1GV2 A;  1W0U A;  1RC9 A;  5J8C A;  3QPH A;  4BYY A;  1GV5 A;  4G6D A;  1PUF B;  2QF7 A;  2VQL A;  5KAF C;  2RV8 A;  4EJU A;  4OIQ F;  5CJ9 A;  2WB1 A;  4AYB N;  1AKH A;  1NG6 A;  4QPQ A;  3CLQ A;  4XON A;  3BR0 A;  3HUG B;  3GFI A;  3KEO A;  4A0X A;  2F4O B;  3DPU A;  1RUO A;  3JRG A;  3PQJ A;  2F5E A;  3HEF A;  2DMU A;  3EUH A;  4ZYD A;  4QIW N;  4XRS A;  1IRF A;  2DJN A;  3CMY A;  1VTN C;  4B47 A;  2ME0 A;  5EZH A;  3ECH A;  5FLV A;  1DGW Y;  2BHZ A;  4Q5S F;  2M30 A;  4LK0 F;  4N9H A;  3U1D A;  4HX7 A;  3NRV A;  1V54 H;  3F3X A;  4GYG A;  3MFK A;  4CCO A;  2W25 A;  3BPV A;  4A0Z A;  2WAE A;  2GZW A;  4IOA F;  2LOO A;  1ZLK A;  3HBL A;  5DCM B;  4ZYE A;  3CO6 C;  1HF0 A;  3HTU A;  3NWS A;  1JGG A;  1J5Y A;  2FNA A;  3E3V A;  2V9P A;  4CH7 A;  2GM4 A;  3BDD A;  5HOO A;  4G7Z F;  2FA5 A;  2GWR A;  4FE4 A;  5H20 A;  1ETY A;  2WAQ N;  4NHJ A;  1XD7 A;  2LF7 A;  2AHQ A;  3D5L A;  3ABT A;  2VN2 A;  3S2W A;  1XSD A;  1T95 A;  1C0W A;  1D3Y A;  3HPH A;  4S05 A;  2DTR A;  3KLO A;  4MQV A;  1JKP C;  4XIC A;  4HF1 A;  1KQ0 A;  2DDA A;  3KET A;  2CUF A;  3PNY A;  4XQF A;  3DF8 A;  3Q0V A;  2A6E F;  4V19 K;  2DAO A;  2Z99 A;  2ME6 A;  3QYE A;  2HPI A;  3DBL B;  4PSW A;  3A01 A;  1HA8 A;  3LA7 A;  4DYR A;  3RKQ A;  1ZRE A;  1OFC X;  2FJ1 A;  4L5E A;  3S14 J;  4XKC A;  3K9T A;  3EDP A;  4Y7N J;  3O3K A;  1PYV A;  2XKO A;  1F4K A;  2CV1 A;  1OR7 C;  1LVK A;  3A0B C;  1MNM C;  2DI3 A;  1H89 C;  1MD0 A;  1H9G A;  1MJ9 A;  2VT2 A;  3S1M J;  4NC6 A;  1P7J A;  4BY1 J;  2PBI A;  1TQI A;  2XRN A;  2ZJR F;  1DDN A;  3CUQ C;  1I3Q J;  2E1N A;  1MDM A;  1NHA A;  1PJR A;  1RIO H;  2R7U A;  4ENK A;  3RPU D;  1FBS A;  2XAF A;  4IZZ A;  2CQQ A;  2Z16 A;  4G9Y A;  2LKP A;  4U0V A;  2GA1 A;  2B63 J;  2NOJ B;  2DQL A;  2DT5 A;  3I0T A;  3R60 A;  1UHS A;  1G59 A;  4FTH A;  1FWZ A;  3TW6 A;  1MSF C;  4E7L A;  2X1C A;  3H9G A;  4A69 C;  3BR2 A;  3QOP A;  4BEH B;  2R7D A;  4X1E A;  3GO5 A;  2Q2E B;  3RKX A;  3HRU A;  4I7H A;  1FTT A;  2H6C A;  4EJT A;  2COB A;  5H2F C;  3CP8 A;  5J4V A;  4MTD A;  1Z77 A;  2AO9 A;  3JRH A;  1BW6 A;  3TW7 A;  4IRI A;  3OYK A;  3WGI A;  1CGP A;  2M2E A;  3KYC B;  3SHF A;  3MKZ A;  4DJA A;  2DLL A;  3Q9V A;  5LD2 C;  2CS3 A;  2D1V A;  2CO5 A;  3FM3 A;  4EJW A;  1H0M A;  3P9C A;  3EYI A;  3TP3 A;  4G8X A;  5EF6 A;  2M34 A;  4BL0 B;  5M5Y J;  2L7M P;  1UB9 A;  2VBW A;  3BJA A;  4IL6 C;  1VQM I;  3AFH A;  1EJ9 A;  3JRC A;  2ZKZ A;  2JSP A;  4YFK F;  3ZQ7 A;  2F4M B;  4OIN F;  1SFE A;  4I09 A;  1IRX A;  2BYV E;  4BE2 A;  3ZQL A;  2FRH A;  3ZQI A;  3ZXS A;  1IXS B;  3RSN A;  1QHG A;  2DJI A;  2OV7 A;  3MKW B;  3CJN A;  2HI3 A;  3K7A J;  4G94 A;  3Q0W A;  2LBF A;  3LSP A;  3L1P A;  3FHN A;  3LFU A;  2QUF A;  3WHC A;  1VQN I;  3HOT A;  4HA8 A;  1DPR A;  1TC3 C;  2E5N A;  1BJA A;  2W82 A;  4XKV A;  1S7E A;  2QSF X;  1KZH A;  1MBK A;  1UEL B;  1BC7 C;  3H3V K;  4EGY A;  2FBK A;  4I0B A;  4EJV A;  5ICE A;  3CCM I;  2MLG A;  2E7W A;  1HCR A;  1ON1 A;  1LE8 A;  2RC4 A;  5ED4 A;  2OQR A;  3M07 A;  5D8K B;  3OYF A;  2PN6 A;  1JUP A;  4U87 A;  2JMW A;  2JTV A;  1FMW A;  2VQH A;  1X2N A;  1R49 A;  2OPT A;  2HNH A;  4G7H F;  5BOX A;  4XKB A;  3CQZ J;  1SFK A;  1X1A A;  1XSX A;  2XHK A;  4XNF A;  4U7D A;  4N4N B;  2CGP A;  3I53 A;  2O8K A;  2A6H F;  3HSE A;  3ZR8 X;  9ANT A;  2W48 A;  4M71 A;  4E7Z A;  3G73 A;  2VE8 A;  2XIG A;  1HW5 A;  1GVJ A;  1ZRD A;  3TO9 A;  1DUX C;  2XSD C;  2ZJ2 A;  4BQN A;  4A12 A;  1ZH5 A;  5IP6 A;  2DK8 A;  1O4X A;  1MND A;  4EM0 B;  3L2U A;  3BR1 A;  3VYS B;  1KU3 A;  3I4M J;  1X1B A;  2RQQ A;  5FKL A;  1YX5 A;  2E2H J;  1LEA A;  2V9V A;  1W5S A;  5CVR A;  4RBO A;  1DP3 A;  1KQ9 A;  4RB3 C;  1X3Z B;  2K85 A;  1XCB A;  2QA4 I;  3DU6 A;  4CCL A;  4BXU A;  2DT7 B;  1EH7 A;  1K83 J;  2E2J J;  4BHC A;  2DFE A;  3JSO A;  3LSR A;  4ZYG A;  4KYW A;  4CHU A;  1SD7 A;  1QVU A;  3CUQ B;  5LHH A;  1JKQ C;  2TCT A;  4A3L J;  4H4K C;  2XF5 A;  4A93 J;  1I27 A;  1AA7 A;  1MMA A;  2FX0 A;  2M9H A;  5A2Q Z;  2DT6 A;  1SEU A;  2FU4 A;  2HOE A;  1QA6 A;  3VYT B;  1Y0U A;  2VKH A;  4MQ9 F;  3VSK A;  2MSY A;  3IP4 B;  4PGH A;  3S1R J;  2A05 A;  4I76 A;  1WHU A;  4F7Z A;  2YS9 A;  4J19 A;  1IF1 A;  2JPC A;  2IAI A;  4IO9 F;  4JX5 A;  2VXZ A;  3COA C;  2DDB A;  3I71 A;  2RDP A;  4G12 A;  1Y56 A;  5L3C A;  2XAS A;  2R5Y B;  2JT1 A;  2Y2Z A;  3EUH C;  4IEJ A;  1YW8 A;  5E3N A;  4HV5 A;  3WTT C;  5J1R A;  2JQ7 A;  1X4P A;  2A6T A;  4EJO A;  3J80 K;  5ERI A;  2VOO A;  1P9Q C;  5CVV A;  2GOM A;  2O0Y A;  3TMO A;  5DD4 A;  3K4B A;  2BW3 B;  5DCF A;  1GLN A;  1YO5 C;  1MSE C;  1B8I A;  5GTH C;  5F27 A;  3VDX A;  3RIR A;  2IA0 A;  1ZLJ A;  5IOY A;  2M87 A;  1ODD A;  2WB1 N;  1BR4 A;  2LNB A;  1D1C A;  3I3L A;  1X1D A;  3K1N A;  2GBY A;  3DKX A;  4B44 A;  2ZCW A;  5C4J J;  2RVC A;  1X1P A;  4PJL A;  3PIO F;  1A5J A;  1ZGW A;  3HGY A;  4AWX B;  1YOV B;  2ISZ A;  4IHX A;  1BOB A;  3QYF A;  5F1J A;  1QO0 D;  1Y1V J;  2JRM A;  3L2R A;  1XGN A;  3DTE A;  2CQN A;  3P9K A;  5EG0 B;  3IRR A;  1JKR C;  3AL0 B;  5HNH A;  1YRN B;  3RPQ A;  4FQG A;  5FFZ A;  1JTX A;  4AVP A;  1USS A;  4XR6 A;  3BQZ A;  4MTE A;  4AC0 A;  1JJ8 C;  1RPW A;  4CCJ A;  2QYO A;  5D5V B;  2XAG A;  4HX8 A;  2W1O A;  2ECC A;  1I50 J;  2R7S A;  5K5O A;  1CF7 B;  2WWY A;  1FX7 A;  3WTV C;  1XN7 A;  2VQC A;  1R00 A;  4IQ4 A;  3KLN A;  3PIP F;  3HGG A;  2LKX A;  3I5U A;  3GZ5 A;  3IH4 A;  2XDV A;  2UWM A;  4ZJZ A;  1ETW A;  1JGS A;  2DW4 A;  2MC4 A;  1XC5 A;  3KZI C;  1D0Z A;  2E35 A;  4AVZ A;  1XDS A;  2R5Z B;  2E2I J;  2WTE A;  2V6C A;  3LQQ A;  1BIA A;  2I10 A;  2ZXJ A;  4B4C A;  5HNF A;  3BG5 A;  2QEX I;  2KIS A;  2CUE A;  4I6Z A;  3JSP A;  2K3F A;  3MD2 A;  1QZE A;  2HGC A;  2TRT A;  3OYB A;  4Y13 A;  1B6A A;  1E3P A;  2AQE A;  3BG6 A;  4HZF A;  4NB5 A;  4IJA A;  1XX5 A;  2CQK A;  3IWF A;  5FD6 A;  2EBI A;  3B6C A;  5C4X J;  5DEQ A;  2K02 A;  4A6D A;  4BGD A;  1MMS A;  4N4O B;  1TWG J;  2FEZ A;  1MW7 A;  3UR3 C;  4O3M A;  5TIS C;  4A5M A;  1V5E A;  3DPT A;  2BVL A;  2UZK A;  2QSG X;  4QLC U;  3OYG A;  2F48 A;  3PSF A;  4L9V A;  1HOM A;  5IOZ A;  4IRG A;  1R4M B;  2HZD A;  3L9F A;  1YIJ I;  2DK5 A;  4M3B A;  2O61 A;  3T8R A;  1UFM A;  2PMH A;  2VBX A;  2FML A;  3CJR B;  4PZJ A;  3CCU I;  1D8J A;  1SFX A;  2JSC A;  3IH2 A;  3CCR I;  4J00 A;  2HEO A;  3CCL I;  2NVT J;  2IS6 A;  4XM3 A;  1IGN A;  3GCM A;  4XLP F;  4BNC A;  2ZME A;  1LDD A;  2IS2 A;  2ECB A;  4FHT A;  2XF6 A;  1ZG3 A;  3G71 I;  2ESN A;  4F52 A;  2KZV A;  4AD9 A;  2P6T A;  5ICC A;  1MBJ A;  3I9V 2;  1LDK B;  3PSI A;  1TT5 B;  4II2 A;  1XSV A;  2STW A;  2W24 A;  3ROU A;  1K6O A;  1JTY A;  4B3X A;  2UXN A;  3ZN0 A;  4Y52 J;  2DYR H;  5HVQ C;  5TGT A;  1U8R A;  3LST A;  2KL4 A;  2V1X A;  2O8X A;  2P5L C;  1T98 A;  2J5P A;  3K2A A;  2V1N A;  1ZRC A;  3I4P A;  1R5I D;  1MMN A;  3RQ4 A;  2GOX B;  4IX7 A;  1MMG A;  2Y0M A;  3KCC A;  2M8G X;  3G1M A;  1R1U A;  2Z9O A;  4RAY A;  4V2F A;  3CCQ I;  3K0L A;  5GTI C;  3S8P A;  1K79 A;  2D2W A;  2V9K A;  3PO2 J;  3H92 A;  4XOR A;  4LG0 A;  4XLN F;  5JVG F;  3CC2 I;  1ON2 A;  1IJW C;  1P4X A;  2L54 A;  2WY8 Q;  3PUB A;  1K78 A;  3HOV J;  2HQN A;  3CLO A;  1X58 A;  3PUF A;  5L3D A;  3ZQG A;  1E0E A;  3JRA A;  3BTL A;  1F9N A;  2BXY A;  5HLG A;  1W7P D;  3A01 B;  2EFP A;  1YHQ I;  4OWR B;  3BTC A;  4CIC A;  2IEK A;  4NUB A;  3ELK A;  2K9Q A;  2F5D A;  2R7O A;  3H5N A;  2LK2 A;  5EGO A;  5CKT A;  1KU7 A;  1IUY A;  4BQO A;  5FLX Z;  3LA2 A;  4PUS A;  3B73 A;  1OCZ H;  3O8G A;  2QQ9 A;  3R0A A;  2M5W A;  2K4B A;  4PDK A;  5C44 J;  3FMR A;  3KPH A;  2WBM A;  3EUK L;  4KIB A;  4PJN A;  4XN3 A;  3S15 J;  1ITY A;  2HYJ A;  3J7Y J;  2FSW A;  3ZQH A;  5HLH A;  2XV4 S;  5F6F A;  1OYW A;  2VL8 A;  5D4S A;  5HLT A;  1YI2 I;  3G6E I;  4L9J A;  1APL C;  2CMP A;  2CW7 A;  4MO7 A;  1MH4 A;  2ZBK A;  3SZT A;  1BW5 A;  1HST A;  2O03 A;  2MD5 A;  1T38 A;  2OUM A;  5LGN A;  3QP6 A;  4BDZ A;  4BY7 J;  1B59 A;  3BR3 A;  1EF4 A;  5D5U B;  4C3H J;  2LP0 A;  3ZMV A;  4CCK A;  2Y0S A;  2K86 A;  3KX2 A;  4A3I J;  1TWH J;  3CTA A;  1NK2 P;  4ESF A;  1RZ4 A;  1K4S A;  1R36 A;  2DFI A;  2VOD A;  3S16 J;  4L9N A;  4DYQ A;  3C7J A;  4CYC A;  4HSR A;  3J81 Z;  4W97 A;  5HS7 A;  3L2C A;  3M8J A;  3JRI A;  1VQO I;  3DPL C;  2EZK A;  3QAH A;  2OZU A;  1UAA A;  3HOU J;  2JN6 A;  1G3Y A;  1PUE E;  1JE8 A;  2P81 A;  4XSZ F;  2DYS H;  3MZY A;  3CMA I;  2ZB9 A;  4BJT A;  5FRN A;  2P5K A;  2Q0O A;  1R23 A;  1Z0X A;  3JCU C;  1SVL A;  4C2T A;  1ZKG A;  1HBX G;  3J7A O;  2HPM A;  4I98 B;  1W36 C;  2CG4 A;  2E1O A;  2NVU B;  4CA0 A;  2DMP A;  1U6G A;  4AID A;  3OYA A;  1B9N A;  2I5U A;  2MD0 A;  2QSH X;  1BIB A;  1NH3 A;  3TGN A;  4A3F J;  1B1B A;  3SXY A;  1ETK A;  4BKX A;  2BGC A;  5M5W J;  4RAF A;  3W2W A;  3ZCO A;  2E5Z A;  4EM2 A;  1W4M A;  2XB0 X;  4UUV A;  1J2X A;  3Q9S A;  2R7T A;  3BR5 A;  3E97 A;  2ELJ A;  4WXD A;  1VQ4 I;  3DBH B;  2VXD A;  4UV8 A;  2VLA A;  1FEX A;  3J7Z I;  4UVC A;  1L0O C;  1D0Y A;  4CUG A;  2CUJ A;  5GAH J;  3WHB A;  3D0S A;  1ZR4 A;  3K4M A;  4P9F A;  1IN4 A;  3CJT B;  4N0B A;  2XAJ A;  2DA3 A;  1HLV A;  1RKW A;  3Q3S A;  1BN5 A;  4Q47 A;  1YFH A;  4LIV A;  1U3E M;  4IHS A;  5D6F A;  3QU6 A;  3HJE A;  3GTL J;  3LMM A;  4CXF A;  1O7L A;  4WWC A;  1WCM J;  1TBX A;  3TL4 X;  5IYB J;  3RYP A;  1W1W E;  3OR1 C;  2PJR A;  1YIO A;  1WJ5 A;  2CFX A;  2IW5 A;  2Z3Y A;  2XPW A;  3CDI A;  2RNJ A;  3LAJ A;  1LPQ A;  2O6G E;  1V55 H;  1IDY A;  1R22 A;  3ZP5 A;  1ORK A;  3QPL A;  1U5T A;  2K9S A;  2KIQ A;  3P9I A;  2HDC A;  1F1Z A;  1FBU A;  2XKP A;  3E5Q A;  4FE7 A;  3AAF A;  1OIS A;  1MBH A;  2NNN A;  2Y9Y A;  3P5J A;  4BXF A;  3CC7 I;  1R5H A;  4FET A;  2JVH A;  1AWC A;  3PFY A;  3L09 A;  4JP0 A;  2IGO A;  1FYL A;  2ZO4 A;  1T0F A;  3E7L A;  2GIZ A;  4AIJ A;  1HQC A;  1RKT A;  5EDN A;  2KMU A;  2A5Y B;  2HDD A;  3GBG A;  2BHY A;  4KN4 X;  3DLL F;  2KIU A;  2QZ8 A;  3KP3 A;  3CC4 I;  2IJL A;  4KNY A;  3JR9 A;  5EYR A;  1VZ0 A;  3DTI A;  4XOP A;  5E3O A;  1LQ1 A;  1BR2 A;  3M8E A;  1IC8 A;  2NXN B;  2CH0 A;  2FOW A;  3K4L A;  2VQG A;  4C3J J;  3CF2 A;  3NQO A;  4E7J A;  2DCE A;  4CGZ A;  1WSU A;  2HS5 A;  1I39 A;  3GFL A;  4WCG A;  2QQ8 A;  1Z9C A;  1HXD A;  3I64 A;  4D9J A;  3F8F A;  3L2Q A;  2NS0 A;  3GZN B;  4YEJ A;  1TW3 A;  5M3M J;  1JKO C;  4HNU A;  1X3W B;  1D5V A;  3JRF A;  3O2P E;  2WC2 A;  4PFP A;  5D6E A;  3ZOB A;  1KYZ A;  4KUM A;  1S8N A;  3D1N I;  2IA2 A;  1J75 A;  1PVE A;  2V26 A;  3BG3 A;  4LLL A;  3IH3 A;  3KP2 A;  4JK1 X;  2P0W A;  2P6S A;  3E5X A;  2F4I A;  3H36 A;  2B9S A;  2JVG A;  2NS7 A;  1AU7 A;  4BQA A;  1P6R A;  5J1Y A;  1SD5 A;  3I55 I;  3OSG A;  1YG2 A;  1IO2 A;  2ACJ A;  2HZT A;  2XGC A;  3S3O A;  1YIT I;  3BTJ A;  1GHC A;  1KON A;  2O7O A;  2VT3 A;  4OOI A;  2ZME C;  5LRS A;  4HV6 A;  1FIA A;  4BHB A;  3EQL F;  2BBY A;  2HFH A;  5K5Q A;  2XPV A;  5FKN A;  1OCR H;  3W6K B;  1TQM A;  3K70 C;  2G0E A;  1GDT A;  4ASN A;  2L9N A;  4M6Y A;  3K4J A;  2OF7 A;  3SZG A;  1GVD A;  1IDZ A;  3ABM H;  2HQ5 A;  1ETO A;  1V3F A;  4RS8 A;  5A2Q K;  1H9T A;  3FBN B;  4M3G A;  1XDU A;  2HTS A;  1ZK8 A;  4XRM A;  4EV0 A;  2DOD A;  2FBH A;  2H8W A;  4UUS A;  1U9O A;  2L7F P;  2DA2 A;  2HTJ A;  2V7F A;  3BG7 A;  3IRQ A;  1O3R A;  4RB1 A;  1D1A A;  2HYG D;  1N77 A;  2EIM H;  2DXI A;  2LKS A;  3GTP J;  2XUB A;  4HQM A;  2JUG A;  2EA4 A;  3TOB A;  2H09 A;  1KU9 A;  2HU9 A;  3MMY B;  4BDY A;  3EUA A;  3A1Y A;  2Y69 H;  1T08 B;  3I59 A;  1P4A A;  1U8B A;  2KPM A;  3HC7 A;  1G3W A;  4KJZ A;  3IWZ A;  1HKQ A;  2LY2 A;  5LFA A;  4OIP F;  4M6V A;  5HDN A;  5IPA A;  3GTG J;  2E71 A;  1JJ6 C;  1E3O C;  3FF5 A;  2EFN A;  3HPG A;  3LWF A;  1Z3Y A;  2DOF A;  1VND A;  5B5E C;  1ZRF A;  2AXT C;  2IBD A;  5JFR A;  1LUJ B;  2EH3 A;  2XAH A;  3V7C A;  3CJQ B;  5K5R A;  2ISY A;  3VOD A;  3OL3 A;  4Y4R A;  3QOE A;  2EK5 A;  1WH5 A;  2EFO A;  3ZMD A;  3QOD A;  4XKW A;  3VSL A;  3MAJ A;  2JWT A;  2X51 A;  5DV5 A;  1QU3 A;  2VKE A;  2ZNZ A;  2IS4 A;  1WKM A;  3FXQ A;  1HC8 A;  3HOW J;  4OIR F;  3VFZ A;  2DU9 A;  5B1B H;  1QNT A;  2L0K A;  2H94 A;  2DMN A;  4JOM A;  4XRF A;  5CVI A;  5AIQ A;  4YG2 F;  3S3M A;  4IRH A;  3V8K A;  1OPC A;  4I02 A;  1JT0 A;  2CU7 A;  4OAY A;  4GDF A;  2ZFW A;  1VQL I;  5HOD A;  3WTX C;  4IHW A;  2PEX A;  3MVP A;  1W36 D;  4G7O F;  2WV1 A;  5L3F A;  3FKI J;  4KN7 X;  4MHG A;  4FT8 A;  1BM9 A;  3SQN A;  3W2V A;  2EJR A;  2KJB A;  2NAZ A;  5E17 F;  2ZC2 A;  3HRS A;  4LMY A;  2AXL A;  1WJC A;  4ZDO A;  2QKL B;  2G7U A;  1BA5 A;  4IXA A;  1I1S A;  4FX0 A;  4A3M J;  1MJB A;  5HS8 A;  3T0Y A;  2BY0 A;  2FF4 A;  2ZXW H;  2PX9 A;  1K61 A;  3OIP A;  2CQ7 A;  2QKM B;  1IXR C;  2PMU A;  4ZZD A;  1XS9 A;  1LB2 A;  4G6Q A;  3H3U A;  4ZTJ A;  2UUZ A;  1IN7 A;  3V7R A;  1O3T A;  2OD5 A;  2Y0S N;  3N97 A;  2V1D A;  5L3B A;  1TTY A;  3NAU A;  3NAR A;  4IVN A;  1MH3 A;  2EIN H;  3SEZ A;  1PUF A;  4XLF A;  4XMY A;  3HXL A;  3M1C A;  4M3F A;  3RPU A;  3HG9 A;  4ABZ A;  2CW0 F;  2DA1 A;  2VAS A;  1OCT C;  1LKX A;  1WI9 A;  1OYY A;  4P55 A;  4FAS D;  4U0W A;  3HOZ J;  3RKW A;  3GUD A;  5LLQ A;  2HVQ A;  4IOC F;  3FMQ A;  4BE1 A;  4A3D J;  3AG2 H;  3KEY A;  3OIQ A;  2P5V A;  4M6X A;  2RGV A;  1TW2 A;  3FM5 A;  1IRZ A;  3OR2 C;  1FSE A;  1REP C;  1A04 A;  3FXJ A;  1IW7 F;  1K6Y A;  1MBE A;  2LTP A;  3OS2 A;  1TNS A;  4W1U A;  3CCY A;  5DCM A;  1POG A;  1ONV A;  3H9J A;  5LBQ A;  3RKY A;  1U5T C;  2F6C A;  2KP6 A;  3OS0 A;  3GXO A;  4BHP A;  1OCO H;  3DTK A;  1FT9 A;  4ITV A;  2Q8K A;  4YFN F;  1QPI A;  2JA2 A;  4XLH A;  3AKZ A;  2EWN A;  3KP7 A;  1K78 B;  4F92 B;  4Z2Y A;  1T0F C;  1WGX A;  2MH9 A;  4LIU A;  5F0F A;  3QPT A;  1ZN2 A;  3RZO J;  3E6D A;  2HXI A;  4A3K J;  2LF8 A;  3RCO A;  3ZMU A;  1XG1 A;  5ICF A;  3OL4 A;  3S3N A;  1MBF A;  3H0D A;  4IKF A;  2E34 A;  1DGR M;  3G3Z A;  5IY5 H;  4NC8 A;  4NC7 A;  4HEA 2;  4LJZ F;  1D0X A;  1FPQ A;  1R4N B;  1MBG A;  1W5C C;  4ZDL A;  2NNY A;  2D5V A;  2VUM J;  4A3B J;  4PK4 A;  2Q1Z B;  2Y75 A;  1QPM A;  4R79 A;  2R7X A;  3KE2 A;  1OLT A;  3BJ6 A;  5AON A;  3LNQ A;  1ZG5 A;  4UXN A;  2V4J C;  4MLO A;  1JT6 A;  3U1K A;  2KRH A;  1V4R A;  3TDZ C;  2DMT A;  2ID6 A;  3I58 A;  3REO A;  5F0C A;  1B72 A;  4GRI A;  4HDU A;  2KRC A;  5TRD A;  2EA2 A;  1S7A A;  1EH8 A;  3Q0U A;  3OOP A;  3X2Q H;  2LRD A;  4DBQ A;  1J9I A;  4M3D A;  4UNO A;  4ZTF A;  1EH6 A;  4XBF A;  1CQT A;  1R7J A;  5B1A H;  2V6E A;  1U9N A;  2ZNY A;  2YSR A;  3FXU A;  3GFJ A;  3M9A A;  2L9S A;  1VQK I;  1G3S A;  2O3F A;  5DM7 F;  1TZL A;  2OA4 A;  4AU7 A;  3IAS 2;  4GCV A;  1XCV A;  2X6O A;  3BCB A;  3H3Z A;  3K70 D;  3A4C A;  3HDD A;  5FLX K;  2M7B A;  5ILV A;  3F8C A;  5KNL A;  2Q2E A;  4ENN A;  2D1H A;  4I99 C;  4XRS G;  1SAX A;  2AS5 F;  5D8L B;  2PMZ A;  4NNJ A;  3WOD F;  4FX4 A;  4BS9 A;  3D5S C;  2HYF A;  2L9V A;  5GAE J;  3IV5 A;  2L4M A;  5LHG A;  2LG4 A;  5E1W A;  2JPB A;  3EPZ A;  3B02 A;  1IN5 A;  3TP0 A;  3BWG A;  1L3L A;  2ZXH A;  1A6I A;  1V5F A;  3OS1 A;  1NK3 P;  1RES A;  3PNV A;  1M1E B;  5E1Z B;  3ZPL A;  4GO1 A;  1YJ9 I;  3BG9 A;  2OCE A;  3WGH A;  4YII A;  4ETS A;  2EV6 A;  1FIP A;  1SC7 A;  4LG3 A;  2LSO A;  1ZQ3 P;  3K4N A;  2GIV A;  3LSK A;  4RLQ A;  1AOY A;  3IKV A;  1W7P B;  2RAE A;  4BAY A;  4I2O A;  3J81 K;  2K9M A;  1N78 A;  3HYI A;  3CCV I;  1FOK A;  1P4W A;  2EIJ H;  3ASN H;  2STT A;  4HST A;  2FMY A;  2KDO A;  2MYS A;  3F8M A;  5KVR A;  4B09 A;  1P92 A;  2EFQ A;  1D5Y A;  2JA7 J;  5DM6 F;  1WPK A;  1WH7 A;  1OQY A;  3DXJ F;  3F8B A;  4EGZ A;  4ENM A;  3C18 A;  1YJN I;  2M3A A;  4RM2 A;  3H5R A;  3ESW B;  3K1M A;  2VC1 A;  2VIX A;  3DP7 A;  1KYW A;  3M1E A;  4AUX A;  4P9U A;  5J4Y A;  3DQV C;  2BXZ A;  3JW4 A;  4D5C A;  5HLI A;  3L00 A;  4IF4 A;  4Y3O A;  1T39 A;  1XGO A;  2R4G A;  1AKH B;  3A02 A;  2Z33 A;  4N9I A;  4DOZ A;  2K9L A;  2DO7 A;  3LAP A;  1K7A A;  3IHU A;  5BPI A;  5JLW A;  1N25 A;  1F43 A;  3PO3 J;  4LLN A;  3AG4 H;  2X6W A;  2IXS A;  1XMK A;  4B3A A;  1BI3 A;  3PNT A;  1IRG A;  2XVC A;  4HW0 A;  4HYE A;  1GUU A;  1DU6 A;  2VJI A;  2YX7 A;  4LGW A;  4CSW A;  3OY9 A;  2VB6 A;  3WTY C;  5K1Y A;  1ZYR F;  4GXO A;  5DTD A;  1JHH A;  3CD6 I;  2RQP A;  2XPU A;  1QQI A;  3K1P A;  2L7K A;  3F6O A;  4U7B A;  3KZY A;  3HRM A;  2VJ5 A;  2M7A A;  1LNW A;  4JX6 A;  1QRY A;  5AIP A;  4CCN A;  1OMI A;  1WJE A;  5IYC J;  5ILS A;  5J6X A;  2DOE A;  1IAW A;  4FIS A;  2BE5 F;  3SEQ A;  3CCS I;  2R0Q C;  3BOQ A;  2OTJ I;  1BJZ A;  3HKZ A;  4RM3 A;  4K2E A;  2R7W A;  2VC0 A;  4XLE A;  5CLS A;  3JAM K;  1QVT A;  2EZH A;  4BH9 A;  3AG3 H;  4JQF A;  3DWL E;  4LB6 B;  2VPR A;  2GXG A;  1J59 A;  2W85 A;  2W00 A;  3EYY A;  1ZGJ A;  5FKO A;  3CF5 F;  1I6X A;  1YS6 A;  2CV0 A;  2YR2 A;  3WTS C;  2NVX J;  3VWB A;  4AIK A;  3F22 A;  3KP4 A;  4UVA A;  3WG9 A;  3TO7 A;  4BJ6 C;  3E1S A;  3E6M A;  4XOT A;  2ETH A;  3RZD J;  1TWF J;  5HS9 A;  3MKY B;  4C30 A;  2W4S A;  2HVR A;  2G9W A;  1O57 A;  3GVA A;  3K4C A;  4XLA A;  2IT0 A;  2OU2 A;  1UST A;  3S1N J;  2LDU A;  3L2W A;  4EEF G;  4MNU A;  1G3T A;  5H6Q A;  3W6J B;  4E7S A;  2B7E A;  2OZ6 A;  5LGT A;  2ELK A;  3U2R A;  4IQJ A;  1OCP A;  2YU3 A;  3FBI B;  4I01 A;  1X4O A;  2HVS A;  2R5Y A;  1T56 A;  1BR1 A;  2FXA A;  5L3G A;  4RAG A;  2M4G A;  1S72 I;  3JTG A;  1I3A A;  2CUZ A;  5M3F J;  2KKO A;  1MDM B;  5IYD J;  2G7H A;  4M9Z A;  5DUK A;  1BOA A;  4H0E A;  2RN7 A;  3FKJ A;  5IP7 J;  1X3U A;  2F2E A;  1N75 A;  4DIQ A;  4UUS B;  3K69 A;  4ZH4 F;  1JXS A;  5IT9 Z;  3M8F A;  2R93 J;  1FOW A;  1W5T A;  3ZN1 A;  4BUP A;  5L3E A;  3S1Q J;  3FXO A;  4WX9 A;  6PAX A;  3V7S A;  1ZEL A;  2CWE A;  2FD5 A;  5D4R A;  3PM1 A;  2KIM A;  3TDU C;  3IUO A;  4A3J J;  3OOU A;  3P7N A;  1K4T A;  3JRD A;  3DEU A;  3E6C C;  1WVR A;  2A5W A;  5TJJ A;  5LGU A;  4FCY A;  4HLX A;  1ETX A;  2FBI A;  3K6G A;  5IP9 J;  2H6B A;  4BE0 A;  3PQK A;  2L4A A;  1D1B A;  5GAD J;  1Z05 A;  4DW6 A;  3GTO J;  2L9R A;  1P7I A;  3F8N A;  3OYN A;  1DPU A;  3WTU C;  2Y9Z A;  3R6S A;  2HR3 A;  3GTK J;  4PSX A;  3HRT A;  4QPO A;  3BPX A;  2MA3 A;  4PCQ A;  2VI6 A;  2IVM A;  3JRB A;  2HWV A;  1ZGA A;  5D5W B;  5FRM A;  1VQP I;  5E3M A;  3DKY A;  1YQA A;  2HKX A;  2VKD A;  2LFB A;  5F64 A;  3S32 A;  5CPR B;  2YU9 J;  3F9K A;  3WE2 A;  3VYR B;  1SVM A;  1S9H A;  5F08 A;  1VQ8 I;  4HF2 A;  3DEW A;  1CF7 A;  1E2X A;  1YYV A;  3FXM A;  5KAI C;  2LBF B;  3GZ6 A;  3MWM A;  4HLY A;  4LOC A;  1Q1H A;  1PP8 F;  4XK4 A;  5LEK A;  1UMQ A;  2FUG 2;  3BCA A;  2P7C B;  2PI0 A;  2JA8 J;  2XGX A;  2VOP A;  1LE8 B;  2R7V A;  3WTW C;  2R7R A;  2PFB A;  3OSF A;  1RRJ A;  1S7O A;  1I6H J;  2PQ8 A;  4X0G A;  2LYC A;  3ZMZ A;  3PJR A;  1FNN A;  5HDK A;  3FWE A;  1RI7 A;  4A2U A;  1VF9 A;  3G4S I;  2QM3 A;  2WAF A;  5J40 A;  2IRF G;  2YPR A;  1R58 A;  2DA5 A;  1OKR A;  4BU2 A;  2K27 A;  1SD4 A;  1S6L A;  2KDZ A;  3ASO H;  1YS7 A;  3JAM Z;  2P7V B;  3HSR A;  1QHH D;  1TLH B;  4ZC3 A;  2N8G A;  4EMS A;  4PJJ A;  1E17 A;  2DPD A;  5CVU A;  1R6R A;  3LL7 A;  2IGN A;  1A35 A;  3C3W A;  2P4W A;  4M9X A;  5ILU A;  2EZI A;  3BR6 A;  3OYD A;  4ZYH A;  3TOA A;  1YW7 A;  3VB2 A;  2BZT A;  3C2H A;  4BBR J;  4RAZ A;  4HRI A;  1HKT A;  4HF0 A;  5GP9 A;  2C6Y A;  2K5C A;  3LA3 A;  1S3J A;  2X6X A;  2X85 A;  4NBQ A;  4Q4Z F;  4B48 A;  1QZZ A;  3CME I;  3RQI A;  1T6S A;  3F21 A;  3DBR B;  2QQA A;  3CUO A;  1T33 A;  4ZDP A;  1WZ2 A;  2QEN A;  2PMZ N;  2IPQ X;  4EM1 A;  2A68 F;  4E7K A;  4L0Z B;  2WAD A;  2ZSI B;  3GEZ A;  3ZQC A;  3C1D A;  4KIS A;  1WJB A;  4RMN A;  2IGM A;  3T5X A;  1HW1 A;  2E60 A;  1LFB A;  2RNG A;  3LSH A;  4KMU X;  2EZL A;  4XL9 A;  5H6R A;  4F55 A;  2YUS A;  2EB7 A;  3B6A A;  1FZP B;  2Y48 A;  2HQA A;  2UV1 A;  4AM3 A;  2HOT A;  4DGW B;  2F5F A;  3ULQ B;  5GPC A;  2H1L A;  4F91 B;  4BBS J;  2EPF A;  4MFE A;  3EET A;  4Y15 A;  3ECO A;  4KMF A;  2CYY A;  1UCR A;  3FZV A;  2DN0 A;  2KT0 A;  1GT0 C;  4RGS A;  3SYT A;  1UHW A;  2L2O A;  5DYM A;  4KIF A;  3PFI A;  4BQQ A;  3SDG A;  2H1K A;  3UNG C;  3KEQ A;  2L5Q A;  2OC6 A;  4NQW A;  5KCM A;  1JUM A;  2OAZ A;  1SAN A;  3KZZ A;  4BJ5 C;  2K40 A;  1FTZ A;  3GW2 A;  3QYB A;  5LRR A;  5E3L A;  1B8I B;  1DU0 A;  3S93 A;  4GGG A;  1SFU A;  1EA3 A;  3DFG A;  4M74 A;  3U9G A;  3GF2 A;  4MGR A;  3UKG A;  5B3S H;  4Q48 A;  4BXX J;  2W7N A;  2MH2 A;  1S29 A;  1UHM A;  4KT6 A;  4B8X A;  1SFO J;  2VBY A;  4R8H A;  3ZGK A;  4S04 A;  3CZ6 A;  5CVJ A;  1WJF A;  1U78 A;  3WU2 C;  2R7F A;  2LMD A;  1B72 B;  3HL2 A;  4L0Y B;  3RYR A;  4C3I J;  4XLC A;  4Z6Y A;  2Y30 A;  1BI2 A;  2QBY A;  2QVO A;  2O5R A;  4G6T B;  4LLG F;  3WGG A;  1I1G A;  2MGQ A;  3KIO A;  4EQQ A;  2JK3 A;  2JZY A;  2YX4 A;  1G8X A;  3WU1 B;  5CYV A;  4DYC A;  1LEB A;  5BNG A;  4C9Y A;  3IC7 A;  3GYH X;  3OYE A;  3BZK A;  3MQ0 A;  4KA4 A;  1WI3 A;  3R61 A;  4WK8 F;  2ELH A;  2Z5U A;  1R5G A;  3PL8 A;  2FQ4 A;  1VQ9 I;  5JI6 A;  3V42 A;  1TL8 A;  2ADU A;  3HB9 A;  3KYD B;  3OYH A;  4OMY A;  4RB0 A;  1X19 A;  2CW8 A;  3L2V A;  3KP6 A;  2O9L A;  2EIL H;  2GLO A;  3M4O J;  2OJE D;  1IG7 A;  5HDG A;  3L7W A;  1YW9 A;  4XSX F;  3LSG A;  2DOA A;  3RTR A;  3HKZ N;  1FMV A;  1IV6 A;  4KT5 C;  5CQG A;  3WTZ A;  4DQ2 A;  3TQN A;  4RGU A;  5BPD A;  4HNT A;  2X9D A;  4P5O A;  2R7Q A;  2Z1D A;  1F36 A;  3ZQQ A;  3ZQF A;  1UG2 A;  5DDG A;  1TWA J;  5E18 F;  1T8I A;  1HDD C;  2A69 F;  2LLK A;  4ON0 A;  2MBF A;  3JRE A;  5CQE A;  3IL2 A;  1IUF A;  3V4G A;  2I8D A;  2WA0 A;  4ESB A;  5DD8 A;  1Y8R B;  5BS6 A;  2P8T A;  3SFZ A;  2X4H A;  4S0H B;  2ZFU A;  4DNC A;  5FJ8 J;  5E8G A;  2GXB A;  4PJM A;  3HSF A;  3IKT A;  5LEJ A;  3R4K A;  1A31 A;  4PJ0 C;  1ZG1 A;  3D5R C;  4NDL A;  3BZC A;  1UJ8 A;  2TDX A;  4A5N A;  4M9S A;  2VON A;  1O3Q A;  2XGD A; 
#chains in the Genus database with same CATH homology
 4IHT A;  1J7K A;  2VBZ A;  3E6B A;  5E8I A;  2A61 A;  2M1B A;  1SMT A;  1XGS A;  3ERE D;  3V8L A;  3K2Z A;  1EV7 A;  2QQB A;  1MZB A;  4IPA A;  3F23 A;  5D5X B;  1G4D A;  2NRA C;  4LD5 A;  3GLX A;  5KK1 A;  2ZME B;  1ZAO A;  2H27 A;  3HIF A;  1FP1 D;  3HUG A;  4CO8 A;  4O5V A;  1FC3 A;  4MEX F;  3GWZ A;  3HHH A;  1FLI A;  1LDJ A;  2D45 A;  2DPU A;  2FQ3 A;  5FB2 A;  2K4J A;  4ZZL A;  5F1R A;  1BC8 C;  4YFX F;  3TO6 A;  4CZZ A;  2M8E A;  3O6B B;  4UVB A;  2VE9 A;  1U2W A;  4PGG A;  2HKO A;  3SZP A;  1STZ A;  4LG0 B;  4OU0 A;  1WRJ A;  2EV5 A;  4HX4 A;  1YLF A;  4YIF A;  3FXR A;  4L5J A;  1HW2 A;  2J5O A;  1TQP A;  1PDN C;  4RGX A;  3MEX A;  1XGM A;  2MLK A;  1YTY A;  4L5I A;  1OYI A;  2OQG A;  4EVI A;  4RGR A;  2EFW A;  2JRT A;  3F72 A;  3LQR A;  1XB4 A;  3N4M A;  1BI1 A;  3LFK A;  1FY7 A;  1B9M A;  4R1H A;  2FOK A;  2XAQ A;  1MJA A;  2GQQ A;  5JVT A;  3WE3 A;  1D8K A;  4TV7 A;  2EV0 A;  4P96 A;  1KA8 A;  1WQ2 A;  2RKH A;  1MGT A;  4M73 A;  2BV6 A;  2GAU A;  5EEG A;  1BI0 A;  3M7G A;  5BQT A;  1P2F A;  3CDH A;  2E7X A;  4E70 A;  1BBY A;  1FBQ A;  4O6J A;  2M45 A;  2E1C A;  3GX4 X;  4MEY F;  1Z7U A;  3JTH A;  3Q5F A;  4D0P A;  4LFU A;  2OBP A;  2F5C A;  2W57 A;  2W84 A;  3R0J A;  1TNT A;  4Y17 A;  4HOB A;  3FX3 A;  2L3D A;  1Z6R A;  2QWW A;  4A6E A;  1IXC A;  4L18 B;  4A0Y A;  5IT9 K;  4WXC A;  3NEU A;  2V1U A;  2XRO A;  4QWQ A;  4M72 A;  1XMA A;  2HQR A;  2K7L A;  4UHT A;  4HDV A;  1HSJ A;  4U0Y A;  3QU3 A;  1J0R A;  3ML6 A;  1ZHF A;  4ENJ A;  1KU2 A;  3QP5 A;  4JBA A;  3VOE A;  1MKM A;  1FYK A;  1JHF A;  3DV8 A;  4U88 A;  4KFC A;  5FGM A;  1U5T B;  1I5Z A;  4HQE A;  4OIO F;  2NYX A;  4L9T A;  2ESH A;  2B0L A;  3E5U A;  1LVA A;  4LK1 F;  3WU0 A;  4ESJ A;  3BP8 A;  3DKW A;  2PLY A;  1KGS A;  3GFM A;  1F5T A;  2A3S A;  1IN6 A;  1IZ1 A;  2DBB A;  5EEH A;  2KRF A;  3CO7 C;  5BMZ A;  5J8F A;  1R1V A;  2WV0 A;  5E20 A;  3HTS B;  3BRO A;  1O3S A;  1SMY F;  1Z1D A;  2MC3 A;  2L02 A;  4HBL A;  5FO5 A;  1RUN A;  1DP7 P;  1OR7 A;  3J80 Z;  4KDP A;  1QGP A;  2QLZ A;  1KQ8 A;  3HHG A;  3CUQ A;  2V79 A;  3BJO A;  3F6V A;  1T2K A;  3T8T A;  3OV8 A;  2L01 A;  5FD5 A;  3MZH A;  1ZAR A;  4AIH A;  3BY6 A;  2BEO A;  1Z91 A;  3ZMT A;  3QRF F;  2KIF A;  3V8J A;  3KFW X;  1QBJ A;  1RNL A;  3FMS A;  1SD6 A;  1IN8 A;  5DUI A;  1FP2 A;  4LB5 A;  3MCZ A;  3VEP A;  2CSO A;  2IP2 A;  4KIC A;  2R3S A;  4CDG A;  1HKS A;  5LHI A;  3BZ6 A;  2UXX A;  3HOS A;  2QBY B;  3ISP A;  4UV9 A;  1QZY A;  1G6N A;  4CYD A;  1R1T A;  4RB2 C;  3I59 B;  2PG4 A;  4WF2 A;  1LJ9 A;  2PJP A;  1GXP A;  2KJC A;  4HAM A;  5FFX A;  3TKY A;  1WWX A;  4I0A A;  5JHU A;  2A07 F;  3ZMS A;  1GXQ A;  2COM A;  1Z6T A;  1FYM A;  4WXH A;  3RJP A;  3T1B A;  2GA2 A;  1FSH A;  3ABU A;  2FE3 A;  3KP5 A;  3I54 A;  2X0L A;  1PP7 U;  2IA1 A;  5ICG A;  5JR3 A;  4GYI A;  2DQR A;  1W7P A;  4OMZ A;  3FHZ A;  5E1X A;  3RI4 A;  1O7F A;  2FNP A;  4KIG A;  1ULY A;  1B4A A;  3RDI A;  5IT3 A;  5J8C A;  3QPH A;  4BYY A;  4G6D A;  2RV8 A;  4EJU A;  4OIQ F;  5CJ9 A;  3GFI A;  3KEO A;  4A0X A;  1RUO A;  3PQJ A;  2F5E A;  4ZYD A;  3EUH A;  1IRF A;  1VTN C;  3ECH A;  4Q5S F;  2M30 A;  4LK0 F;  4N9H A;  3U1D A;  4HX7 A;  3NRV A;  3F3X A;  4GYG A;  3MFK A;  2W25 A;  3BPV A;  4A0Z A;  2GZW A;  1ZLK A;  5DCM B;  4ZYE A;  3CO6 C;  3HTU A;  1J5Y A;  2FNA A;  3E3V A;  3BDD A;  5HOO A;  4G7Z F;  2FA5 A;  2GWR A;  5H20 A;  4NHJ A;  1XD7 A;  2LF7 A;  3D5L A;  3ABT A;  2VN2 A;  3S2W A;  1XSD A;  1C0W A;  1D3Y A;  4S05 A;  2DTR A;  3KLO A;  4MQV A;  4HF1 A;  1KQ0 A;  3KET A;  3DF8 A;  2A6E F;  2DAO A;  2Z99 A;  3LA7 A;  1ZRE A;  3K9T A;  3EDP A;  3O3K A;  2XKO A;  1F4K A;  2DI3 A;  1MD0 A;  1H9G A;  1MJ9 A;  2VT2 A;  2PBI A;  1TQI A;  2XRN A;  1DDN A;  3CUQ C;  1MDM A;  2E1N A;  1NHA A;  1RIO H;  4ENK A;  1FBS A;  2XAF A;  4G9Y A;  2LKP A;  4U0V A;  2GA1 A;  3I0T A;  2DQL A;  2DT5 A;  3R60 A;  1FWZ A;  3QOP A;  2R7D A;  3GO5 A;  3RKX A;  3HRU A;  4I7H A;  2H6C A;  4EJT A;  4MTD A;  4IRI A;  3WGI A;  1CGP A;  3SHF A;  2DLL A;  3Q9V A;  3FM3 A;  2D1V A;  2CO5 A;  4EJW A;  1H0M A;  3P9C A;  3EYI A;  4G8X A;  1UB9 A;  2VBW A;  3BJA A;  2ZKZ A;  4YFK F;  3ZQ7 A;  4OIN F;  1SFE A;  4I09 A;  2BYV E;  2FRH A;  1IXS B;  3CJN A;  4G94 A;  2QUF A;  3HOT A;  4HA8 A;  1DPR A;  1BJA A;  1BC7 C;  4EGY A;  2FBK A;  4I0B A;  4EJV A;  5ICE A;  2MLG A;  2E7W A;  1ON1 A;  2RC4 A;  5ED4 A;  2OQR A;  5D8K B;  2PN6 A;  2JTV A;  4G7H F;  5BOX A;  1XSX A;  2XHK A;  4U7D A;  2CGP A;  3I53 A;  2A6H F;  3HSE A;  4M71 A;  3G73 A;  2VE8 A;  2XIG A;  1HW5 A;  1GVJ A;  1ZRD A;  3TO9 A;  1DUX C;  2ZJ2 A;  1ZH5 A;  4A12 A;  2DK8 A;  4EM0 B;  1KU3 A;  1LEA A;  2V9V A;  1W5S A;  5CVR A;  1KQ9 A;  4RB3 C;  1XCB A;  4BXU A;  1EH7 A;  4BHC A;  3JSO A;  4ZYG A;  4KYW A;  4CHU A;  1SD7 A;  3CUQ B;  5LHH A;  1I27 A;  5A2Q Z;  2FU4 A;  2HOE A;  1Y0U A;  4MQ9 F;  4PGH A;  4F7Z A;  1IF1 A;  2JPC A;  3COA C;  2VXZ A;  3I71 A;  2RDP A;  5L3C A;  2XAS A;  2JT1 A;  1YW8 A;  4HV5 A;  3WTT C;  4EJO A;  3J80 K;  5ERI A;  2VOO A;  5CVV A;  2O0Y A;  5DD4 A;  5DCF A;  1YO5 C;  3RIR A;  2IA0 A;  1ZLJ A;  2M87 A;  1ODD A;  2LNB A;  3K1N A;  2ZCW A;  2RVC A;  4AWX B;  2ISZ A;  1QO0 D;  1XGN A;  3P9K A;  3IRR A;  3RPQ A;  5FFZ A;  4AVP A;  1USS A;  4MTE A;  2QYO A;  5D5V B;  2XAG A;  4HX8 A;  5K5O A;  1CF7 B;  2WWY A;  1FX7 A;  3WTV C;  1XN7 A;  1R00 A;  3KLN A;  3I5U A;  3GZ5 A;  2UWM A;  1JGS A;  2DW4 A;  1XDS A;  2WTE A;  2V6C A;  3LQQ A;  1BIA A;  2ZXJ A;  3JSP A;  2HGC A;  4Y13 A;  1B6A A;  4NB5 A;  4HZF A;  4IJA A;  5FD6 A;  2CQK A;  3IWF A;  5DEQ A;  2K02 A;  4A6D A;  2FEZ A;  4O3M A;  4A5M A;  3DPT A;  2UZK A;  4QLC U;  4L9V A;  4IRG A;  3L9F A;  2DK5 A;  2O61 A;  3T8R A;  1UFM A;  2PMH A;  2VBX A;  2FML A;  4PZJ A;  1D8J A;  1SFX A;  2JSC A;  2HEO A;  4XLP F;  4BNC A;  2ZME A;  1LDD A;  4FHT A;  1ZG3 A;  2ESN A;  5ICC A;  4AD9 A;  2P6T A;  1LDK B;  1XSV A;  2STW A;  2W24 A;  3ROU A;  1K6O A;  2UXN A;  3ZN0 A;  5HVQ C;  1U8R A;  3LST A;  2V1X A;  2O8X A;  2P5L C;  1T98 A;  2J5P A;  1ZRC A;  3I4P A;  2Y0M A;  3KCC A;  2Z9O A;  1R1U A;  4RAY A;  3K0L A;  1K79 A;  2D2W A;  3H92 A;  4LG0 A;  4XLN F;  1ON2 A;  1P4X A;  2L54 A;  1K78 A;  2HQN A;  3CLO A;  5L3D A;  5HLG A;  1F9N A;  1W7P D;  2EFP A;  4CIC A;  3ELK A;  2F5D A;  1KU7 A;  1IUY A;  5FLX Z;  3LA2 A;  3B73 A;  2QQ9 A;  3R0A A;  2M5W A;  2K4B A;  4PDK A;  3FMR A;  4KIB A;  2FSW A;  5HLH A;  2XV4 S;  5F6F A;  1OYW A;  5D4S A;  4L9J A;  2ZBK A;  3SZT A;  1HST A;  2O03 A;  2MD5 A;  1T38 A;  5LGN A;  3QP6 A;  1B59 A;  5D5U B;  3ZMV A;  2K86 A;  3CTA A;  4ESF A;  1RZ4 A;  1R36 A;  2DFI A;  2VOD A;  4L9N A;  3C7J A;  3J81 Z;  5HS7 A;  3L2C A;  3DPL C;  3QAH A;  2OZU A;  1G3Y A;  1PUE E;  1JE8 A;  4XSZ F;  3MZY A;  2P5K A;  2Q0O A;  1R23 A;  1HBX G;  3J7A O;  4I98 B;  2CG4 A;  1U6G A;  1B9N A;  1BIB A;  3TGN A;  1B1B A;  3SXY A;  2BGC A;  4EM2 A;  1W4M A;  4UUV A;  1J2X A;  3Q9S A;  3E97 A;  4WXD A;  4UV8 A;  4UVC A;  1L0O C;  3D0S A;  4P9F A;  1IN4 A;  4N0B A;  2XAJ A;  1BN5 A;  4Q47 A;  1YFH A;  1U3E M;  4IHS A;  5D6F A;  3QU6 A;  4CXF A;  1O7L A;  4WWC A;  1TBX A;  3RYP A;  1YIO A;  2CFX A;  2IW5 A;  2Z3Y A;  2RNJ A;  3LAJ A;  2O6G E;  1R22 A;  3ZP5 A;  1U5T A;  3P9I A;  2HDC A;  1F1Z A;  1FBU A;  2XKP A;  3E5Q A;  3AAF A;  2NNN A;  1R5H A;  1AWC A;  3L09 A;  1FYL A;  2ZO4 A;  1T0F A;  4AIJ A;  1HQC A;  2A5Y B;  4KN4 X;  2KIU A;  2QZ8 A;  3KP3 A;  2IJL A;  4KNY A;  1LQ1 A;  3M8E A;  3NQO A;  4CGZ A;  1WSU A;  2HS5 A;  3GFL A;  4WCG A;  1Z9C A;  1HXD A;  3I64 A;  3F8F A;  2NS0 A;  1TW3 A;  1D5V A;  3O2P E;  2WC2 A;  5D6E A;  1KYZ A;  4KUM A;  1S8N A;  2IA2 A;  1J75 A;  4LLL A;  3KP2 A;  4JK1 X;  2P6S A;  3E5X A;  4BQA A;  1P6R A;  1SD5 A;  1YG2 A;  2ACJ A;  2HZT A;  1GHC A;  2VT3 A;  4OOI A;  5LRS A;  4HV6 A;  4BHB A;  3EQL F;  2BBY A;  2HFH A;  5K5Q A;  3W6K B;  1TQM A;  4ASN A;  4M6Y A;  1V3F A;  4RS8 A;  5A2Q K;  1H9T A;  1XDU A;  2HTS A;  4EV0 A;  2FBH A;  2HTJ A;  3IRQ A;  1O3R A;  4RB1 A;  2HYG D;  2XUB A;  4HQM A;  2EA4 A;  3TOB A;  2H09 A;  1KU9 A;  3I59 A;  1P4A A;  1G3W A;  3IWZ A;  1HKQ A;  4OIP F;  5HDN A;  3FF5 A;  2EFN A;  3LWF A;  1ZRF A;  5JFR A;  2XAH A;  3V7C A;  5K5R A;  2ISY A;  3VOD A;  2EK5 A;  2EFO A;  3ZMD A;  3MAJ A;  5DV5 A;  2ZNZ A;  1WKM A;  3FXQ A;  4OIR F;  3VFZ A;  2DU9 A;  1QNT A;  2H94 A;  4XRF A;  5AIQ A;  4YG2 F;  5CVI A;  4IRH A;  3V8K A;  1OPC A;  4I02 A;  2ZFW A;  3WTX C;  2PEX A;  4G7O F;  5L3F A;  4KN7 X;  4MHG A;  4FT8 A;  1BM9 A;  3SQN A;  2EJR A;  2KJB A;  2NAZ A;  5E17 F;  4LMY A;  3HRS A;  2AXL A;  2G7U A;  4IXA A;  1I1S A;  4FX0 A;  1MJB A;  5HS8 A;  3T0Y A;  2FF4 A;  1IXR C;  2PMU A;  4ZZD A;  1LB2 A;  4G6Q A;  3H3U A;  1IN7 A;  3V7R A;  1O3T A;  2OD5 A;  3N97 A;  2V1D A;  5L3B A;  1TTY A;  4IVN A;  3RPU A;  2CW0 F;  1WI9 A;  1OYY A;  4P55 A;  4U0W A;  3RKW A;  3GUD A;  5LLQ A;  3FMQ A;  2P5V A;  4M6X A;  2RGV A;  1TW2 A;  3FM5 A;  1FSE A;  1REP C;  1A04 A;  1IW7 F;  1TNS A;  5DCM A;  1ONV A;  5LBQ A;  3RKY A;  1U5T C;  3GXO A;  4BHP A;  1FT9 A;  4YFN F;  2Q8K A;  2EWN A;  3KP7 A;  1K78 B;  4Z2Y A;  2MH9 A;  3QPT A;  1ZN2 A;  3E6D A;  2LF8 A;  3ZMU A;  5ICF A;  3G3Z A;  4LJZ F;  1FPQ A;  2NNY A;  2Y75 A;  1QPM A;  4R79 A;  3KE2 A;  3BJ6 A;  5AON A;  1ZG5 A;  4UXN A;  1V4R A;  3TDZ C;  3I58 A;  3REO A;  4HDU A;  5TRD A;  2EA2 A;  1S7A A;  1EH8 A;  3OOP A;  1J9I A;  4UNO A;  1EH6 A;  4XBF A;  1R7J A;  2ZNY A;  2YSR A;  3FXU A;  3GFJ A;  3M9A A;  1G3S A;  2O3F A;  2OA4 A;  4GCV A;  1XCV A;  3H3Z A;  5FLX K;  5ILV A;  3F8C A;  2Q2E A;  4ENN A;  2D1H A;  1SAX A;  2AS5 F;  5D8L B;  3WOD F;  4FX4 A;  2HYF A;  2L4M A;  5LHG A;  5E1W A;  2JPB A;  3B02 A;  1IN5 A;  3BWG A;  1L3L A;  5E1Z B;  3ZPL A;  4GO1 A;  3WGH A;  4YII A;  4ETS A;  2EV6 A;  2LSO A;  2GIV A;  1AOY A;  3IKV A;  1W7P B;  4BAY A;  4I2O A;  3J81 K;  3HYI A;  1FOK A;  1P4W A;  2STT A;  5KVR A;  2FMY A;  3F8M A;  4B09 A;  1P92 A;  2EFQ A;  3DXJ F;  3F8B A;  4EGZ A;  4ENM A;  3C18 A;  3K1M A;  2VC1 A;  3DP7 A;  1KYW A;  3M1E A;  4P9U A;  3DQV C;  3JW4 A;  5HLI A;  3L00 A;  4IF4 A;  1T39 A;  1XGO A;  2Z33 A;  4N9I A;  2DO7 A;  3LAP A;  1K7A A;  3IHU A;  5BPI A;  4LLN A;  1XMK A;  1IRG A;  1BI3 A;  2XVC A;  4HW0 A;  4HYE A;  2YX7 A;  4LGW A;  3WTY C;  5K1Y A;  1ZYR F;  4GXO A;  1JHH A;  2RQP A;  3K1P A;  1QQI A;  3F6O A;  4U7B A;  3KZY A;  3HRM A;  1LNW A;  5AIP A;  1OMI A;  5ILS A;  5J6X A;  1IAW A;  2BE5 F;  3BOQ A;  4K2E A;  2VC0 A;  3JAM K;  5CLS A;  4BH9 A;  4JQF A;  4LB6 B;  2GXG A;  1J59 A;  2W85 A;  3EYY A;  1ZGJ A;  1I6X A;  1YS6 A;  2YR2 A;  3WTS C;  4AIK A;  3F22 A;  3KP4 A;  4UVA A;  3WG9 A;  3TO7 A;  3E6M A;  2ETH A;  5HS9 A;  2G9W A;  1O57 A;  3GVA A;  2IT0 A;  2OU2 A;  1UST A;  2LDU A;  4MNU A;  1G3T A;  5H6Q A;  3W6J B;  2OZ6 A;  5LGT A;  3U2R A;  2YU3 A;  4I01 A;  2FXA A;  5L3G A;  3JTG A;  2KKO A;  1MDM B;  2G7H A;  4M9Z A;  5DUK A;  1BOA A;  2RN7 A;  1X3U A;  2F2E A;  3K69 A;  4ZH4 F;  1JXS A;  5IT9 Z;  3M8F A;  1W5T A;  3ZN1 A;  5L3E A;  4WX9 A;  6PAX A;  3V7S A;  2CWE A;  5D4R A;  2KIM A;  3TDU C;  3P7N A;  3E6C C;  3DEU A;  5TJJ A;  5LGU A;  4HLX A;  2FBI A;  2H6B A;  3PQK A;  2L4A A;  1Z05 A;  1DPU A;  3F8N A;  3WTU C;  3R6S A;  2HR3 A;  3HRT A;  3BPX A;  2MA3 A;  4PCQ A;  2IVM A;  2HWV A;  1ZGA A;  5D5W B;  1YQA A;  2HKX A;  5F64 A;  3WE2 A;  4HF2 A;  1CF7 A;  1E2X A;  1YYV A;  3GZ6 A;  3MWM A;  4HLY A;  1Q1H A;  1PP8 F;  5LEK A;  2P7C B;  2PI0 A;  2XGX A;  2VOP A;  3WTW C;  2PFB A;  1S7O A;  2PQ8 A;  3ZMZ A;  1FNN A;  5HDK A;  3FWE A;  1RI7 A;  4A2U A;  2QM3 A;  2IRF G;  2YPR A;  1R58 A;  1OKR A;  2K27 A;  1SD4 A;  1S6L A;  1YS7 A;  3JAM Z;  2P7V B;  3HSR A;  1TLH B;  4EMS A;  1E17 A;  2DPD A;  5CVU A;  3C3W A;  2P4W A;  4M9X A;  5ILU A;  4ZYH A;  3TOA A;  1YW7 A;  3VB2 A;  4RAZ A;  1HKT A;  4HF0 A;  2C6Y A;  3LA3 A;  1S3J A;  4Q4Z F;  1QZZ A;  1T6S A;  3F21 A;  2QQA A;  3CUO A;  2QEN A;  2IPQ X;  4EM1 A;  2A68 F;  4L0Z B;  3GEZ A;  3C1D A;  3T5X A;  1HW1 A;  4KMU X;  5H6R A;  2EB7 A;  1FZP B;  2Y48 A;  2F5F A;  3ULQ B;  3EET A;  4Y15 A;  3ECO A;  4KMF A;  2CYY A;  1UCR A;  3FZV A;  4RGS A;  1UHW A;  5DYM A;  4KIF A;  3PFI A;  3KEQ A;  4NQW A;  2OAZ A;  3KZZ A;  3GW2 A;  5LRR A;  4GGG A;  1SFU A;  3DFG A;  4M74 A;  3U9G A;  3GF2 A;  4MGR A;  4Q48 A;  2MH2 A;  1S29 A;  1UHM A;  4B8X A;  2VBY A;  4R8H A;  4S04 A;  5CVJ A;  1U78 A;  2R7F A;  4L0Y B;  3RYR A;  1BI2 A;  2QBY A;  2QVO A;  4LLG F;  3WGG A;  1I1G A;  4EQQ A;  2JZY A;  2YX4 A;  3WU1 B;  5CYV A;  1LEB A;  3IC7 A;  3GYH X;  3MQ0 A;  4KA4 A;  3R61 A;  4WK8 F;  2ELH A;  2Z5U A;  1R5G A;  5JI6 A;  2ADU A;  4OMY A;  4RB0 A;  3KP6 A;  5HDG A;  3L7W A;  1YW9 A;  4XSX F;  3RTR A;  4KT5 C;  3WTZ A;  4DQ2 A;  3TQN A;  4RGU A;  5BPD A;  4P5O A;  5DDG A;  5E18 F;  2A69 F;  4ON0 A;  2MBF A;  3IL2 A;  3V4G A;  4ESB A;  5DD8 A;  5BS6 A;  2P8T A;  3SFZ A;  2X4H A;  4DNC A;  5E8G A;  2GXB A;  3HSF A;  3IKT A;  5LEJ A;  3R4K A;  1ZG1 A;  2TDX A;  4A5N A;  4M9S A;  2VON A;  1O3Q A;  4H0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...