2YPRA

Crystal structure of the dna binding ets domain of human protein fev
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
KGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PROTEIN FEV
total genus 28
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yprA00
3IKTA 2QQAA 4ON0A 3ZP5A 4ENMA 3F8NA 1SAXA 2LF8A 3MWMA 2OZ6A 4OIOF 2A6HF 1F5TA 1LVAA 2JPBA 3LAJA 1ZRDA 1IAWA 2V9VA 3IL2A 2WC2A 4LFUA 5E20A 5LRRA 5LEJA 3JSPA 2LKPA 1SD4A 2RDPA 2AS5F 2GXBA 4LK1F 1AWCA 2Z3YA 1GHCA 2QYOA 1FYKA 3VEPA 1KQ0A 4CGZA 4HV5A 1HKTA 1XCVA 4BH9A 2HYFA 3V4GA 1D5VA 1YG2A 1YLFA 4OIPF 1ZG3A 2NNYA 3JTHA 4I02A 2HEOA 4KT5C 3CUQA 4LK0F 2R3SA 1QGPA 3Q5FA 3FWEA 4ESJA 3C3WA 4LG0B 1S8NA 2G7UA 3ZMUA 2NNNA 4FX0A 1XN7A 1BJAA 5D8LB 2EFQA 3RPUA 2RGVA 3H92A 3RYPA 1TW2A 2MH9A 3O6BB 2P6SA 1DP7P 4K2EA 1FX7A 2L4MA 3WTYC 2ZMEA 4GO1A 3BY6A 1K78A 1YW9A 1GVJA 4RAYA 4CYDA 1IRGA 3TOBA 1XGNA 3QP5A 5JR3A 3E6MA 4N0BA 1WWXA 2W25A 1MDMB 5E18F 3GFMA 1CF7B 2FA5A 4G6QA 1FBUA 4HV6A 2PJPA 3CO6C 4I09A 3ZN1A 3H3UA 2AXLA 2FU4A 1YO5C 2IJLA 1R1UA 1K78B 3N4MA 2P7CB 4YG2F 2V1UA 1EH8A 3KP2A 5AONA 1UHMA 2QWWA 1QZZA 1XSDA 4MHGA 1HSJA 3IRQA 4IHTA 4IF4A 1OPCA 4BHPA 1SMTA 1BC8C 2M8EA 2JT1A 4P5OA 3O2PE 1JHHA 2HTJA 5TRDA 3BPVA 2QQ9A 3OOPA 5HLHA 4Q48A 2FBKA 2ZBKA 3KLNA 1ZAOA 3GZ6A 1FC3A 1USTA 4IXAA 2MD5A 2Y48A 5H6QA 2ELHA 3ULQB 4G8XA 3F3XA 2IVMA 4U0WA 4M73A 3F8CA 5DCFA 3E3VA 1YS6A 3MAJA 3FM5A 5D5UB 4HF1A 4KYWA 4XRFA 1W7PB 2KJBA 1FBQA 2X4HA 4G94A 3RPQA 3KCCA 4MEYF 2H6CA 3RKYA 1S6LA 1XD7A 4U7DA 2EFOA 1P92A 2VOPA 2ETHA 1WRJA 2K02A 3LQQA 3OV8A 4L9VA 5ICEA 2EFWA 3B02A 4AVPA 3U9GA 3FF5A 1KU7A 1C0WA 3VFZA 2X0LA 1USSA 2FNPA 2IP2A 5D5XB 1U78A 2COMA 3M8EA 3DXJF 1ZG1A 5K5OA 2HTSA 1MD0A 4M71A 5DDGA 2J5PA 2EWNA 3T1BA 3JSOA 1ON2A 3QPHA 2P5VA 3WU1B 3V8JA 1J2XA 3G73A 2OU2A 3R61A 2F5DA 4E70A 1IF1A 3JAMZ 1JGSA 5J6XA 2ESHA 2F2EA 1L3LA 4U7BA 1SD5A 2KIMA 4KIBA 1ZYRF 2RVCA 2A6EF 4GGGA 2W85A 1DUXC 4LB5A 1ZRCA 1KU3A 1LQ1A 4IVNA 3I64A 3BJOA 4IRIA 5E8IA 2FNAA 3ISPA 2HS5A 2P7VB 2WV0A 1B9MA 3FM3A 4CO8A 1OYYA 2IA2A 3MZHA 4HQEA 5J8FA 1K7AA 2GWRA 4EM2A 3ZQ7A 4M72A 1XMAA 1B59A 1CF7A 2KIFA 3I53A 2B0LA 2W24A 2BE5F 2DQLA 1R5GA 2D2WA 4G9YA 5CVRA 1XB4A 4EMSA 3GVAA 2FBHA 3DEUA 1SD6A 4B8XA 3T8TA 1FSHA 1K6OA 1ONVA 4OU0A 3T0YA 1KA8A 2XRNA 3WGHA 4Q4ZF 1CGPA 5LGNA 5BQTA 5DCMA 2DPDA 4LMYA 1LDDA 3K1MA 4BQAA 2GIVA 2A07F 2FOKA 3EYYA 2TDXA 1ZREA 1BI1A 3RDIA 5ICGA 2OD5A 3VOEA 3M8FA 3AAFA 2ISZA 1QPMA 2CFXA 2VT2A 2YSRA 2E7WA 2FEZA 2ISYA 2QQBA 3LAPA 2VXZA 2L3DA 5LHGA 4CDGA 1OMIA 4ZYHA 3GFIA 3MCZA 3HTUA 3R4KA 2VBZA 3JAMK 5ED4A 5E1ZB 4LB6B 1UCRA 2C6YA 1QNTA 4KN7X 1QQIA 3F72A 4HX4A 3GFLA 1BI2A 2XIGA 3F21A 1ULYA 4JQFA 3HUGA 1F9NA 5FGMA 3T8RA 4KUMA 1ZG5A 1P4WA 2IPQX 3B73A 5ICFA 2ZKZA 1OYIA 1FWZA 2EFPA 3TO6A 2FXAA 3J80Z 3K1PA 3FHZA 1BN5A 1BI0A 2L02A 3BOQA 4P55A 3Q9VA 1IW7F 1G6NA 3GF2A 5DUKA 5FFXA 1E17A 3P9IA 2Z99A 1S29A 4I01A 1V3FA 1KGSA 1R7JA 3IRRA 4HF2A 5A2QK 3DV8A 1BOAA 1ZN2A 1PP7U 3F6VA 1HKQA 3DF8A 2O3FA 5FO5A 4HA8A 3KEQA 2O0YA 2RQPA 3GX4X 2CSOA 4FHTA 4LD5A 4WXHA 2Q0OA 1TQIA 1Z1DA 1QO0D 4WCGA 2DAOA 1U3EM 3KEOA 4A6EA 1O57A 2STTA 1JE8A 3SFZA 2VE9A 5LEKA 3LWFA 1EH7A 2ZO4A 5D5WB 3G3ZA 2CW0F 4L5JA 2P8TA 2G9WA 5HDNA 4L0YB 3V8LA 1GXPA 3BPXA 4XBFA 3W6JB 3HOSA 6PAXA 3BDDA 2PN6A 1IUYA 2O8XA 1MJ9A 2GQQA 2RNJA 2PBIA 3U1DA 1IN8A 5D4RA 1OR7A 4ENKA 2HQRA 4A5MA 4ESBA 2IRFG 1W5SA 2ZFWA 4UVAA 1R23A 3RKXA 4YIFA 5EEGA 3F8BA 5H6RA 1KU2A 2JZYA 2XASA 2EJRA 2JPCA 2ZCWA 3TO9A 5JI6A 1J75A 3CJNA 5IT9Z 4YFNF 1FBSA 1WSUA 1IXSB 2FQ3A 5DV5A 1DPUA 3KP7A 1S7AA 4P9FA 2XKOA 4ESFA 2MC3A 5HVQC 3VODA 4GXOA 2JRTA 2HOEA 4OMYA 2YX7A 1IXCA 5D8KB 2K7LA 1KU9A 1XDUA 2M30A 2A3SA 3HOTA 3W6KB 2PMUA 4M74A 1T38A 3IHUA 1IN7A 4RGXA 4QLCU 2K4BA 4GYGA 2E1NA 4GCVA 3I59B 4I7HA 4WX9A 1FOKA 3TOAA 2FE3A 4EGZA 1ZLKA 5JHUA 1J5YA 4HAMA 5CJ9A 1HQCA 3MZYA 3QOPA 1KQ8A 1YQAA 3FXUA 3HRSA 3HTSB 3F6OA 2GA2A 1BIBA 1B9NA 1J9IA 1ZHFA 3ECHA 5F6FA 2CWEA 2DO7A 3HRUA 1FLIA 1EV7A 2PI0A 1IRFA 3CUOA 2ZXJA 5ILUA 3SZTA 4U0VA 2H27A 3K1NA 1J59A 3J81K 3RYRA 3RTRA 1XSVA 1ZLJA 2FBIA 4EQQA 5D5VB 4CZZA 3BWGA 5EEHA 1TBXA 3BP8A 2K27A 1G3WA 3R6SA 1D3YA 3DQVC 1HSTA 4EJWA 4HDVA 2ADUA 2Z33A 4I0AA 1ZRFA 3WTVC 3WG9A 3ZN0A 2VONA 4RB1A 1U2WA 4I98B 1P2FA 1HXDA 2K86A 4A0YA 5BOXA 3TQNA 2M5WA 4GYIA 2DBBA 3WE2A 3DKWA 4UUVA 4XLPF 4HX7A 3EQLF 2XVCA 3J81Z 2QVOA 3QU6A 4L5IA 4NQWA 4AIKA 1RIOH 4AWXB 2D45A 3KP4A 2XV4S 3IWZA 5ERIA 1UFMA 2F5EA 1TNSA 4U88A 3F8MA 4EJOA 4M9ZA 2EK5A 2ZJ2A 4A5NA 1XDSA 5L3DA 2DFIA 4ZYGA 1Z9CA 1UB9A 3I5UA 4BHCA 1SFUA 1S3JA 2UZKA 1T39A 1TQPA 2KJCA 3ZMSA 3L7WA 1S7OA 4RAZA 2VC1A 3CLOA 5F1RA 3E5XA 4H0EA 5FD6A 1H0MA 2P5KA 5DD4A 1BIAA 4Z2YA 3KP5A 1I1GA 2OQGA 3LA3A 2H6BA 5CVVA 1W4MA 3E97A 4AIHA 2BBYA 2IW5A 2BEOA 1KQ9A 5HLIA 3NQOA 5AIQA 3ROUA 3DP7A 5DCMB 4A6DA 1BC7C 5BPDA 3HHGA 4HLYA 4MTDA 4JBAA 3BJ6A 3V7CA 2MA3A 2R7DA 2GAUA 2UXXA 2O6GE 4UXNA 5HDKA 5FB2A 2YU3A 3ELKA 5IT9K 2E7XA 3Q9SA 3RKWA 3KP3A 1BM9A 3WTTC 4ENJA 5AIPA 1TLHB 2JSCA 3J7AO 5LLQA 3C7JA 5DYMA 4IHSA 1WI9A 1SMYF 4EV0A 3HYIA 2V79A 1FYLA 1R36A 1BI3A 2MH2A 5HS9A 1YW7A 4KNYA 1O3RA 4HYEA 3LSTA 2HDCA 2VC0A 4AIJA 2LF7A 3PFIA 3L2CA 3WU0A 3WTSC 3LFKA 5D6FA 3I71A 1R1VA 4WF2A 3KZZA 1SFXA 1XGOA 1P6RA 1XMKA 4YFXF 2FMYA 1G3TA 4N9IA 5FLXZ 1REPC 2EV6A 4A0XA 1HBXG 4O3MA 1H9GA 4LLLA 2MLKA 1STZA 2A68F 3IWFA 2HR3A 1R22A 2NAZA 3FMRA 4RGUA 5A2QZ 3BROA 4B09A 4ZZDA 1IXRC 2L01A 1UHWA 4HOBA 4LLNA 3SZPA 4M9XA 4ENNA 3ABUA 1NHAA 1YYVA 2HWVA 3EDPA 4G6DA 2WTEA 2ZMEB 4AD9A 5DUIA 4G7ZF 2O03A 1P4XA 1QZYA 1PUEE 4RGRA 5L3CA 3J80K 1IN6A 3ZMDA 1XGSA 4LLGF 2EA4A 2OAZA 2RKHA 5HS7A 4OIQF 2VN2A 4P96A 3LA7A 2J5OA 1R58A 4IJAA 2DK5A 2O61A 3P7NA 5HDGA 5E1WA 3MQ0A 5JVTA 3QRFF 4LJZF 2P5LC 4Y13A 1WQ2A 3TO7A 1YS7A 2HQNA 2QBYB 4N9HA 3U2RA 1FSEA 2NYXA 2D1VA 2F5FA 4HBLA 4CICA 1R5HA 3E5QA 4RB0A 2HKXA 3TDUC 2DI3A 4UV8A 5FD5A 4OMZA 5BMZA 2Z5UA 3CUQB 4KICA 3NEUA 4L18B 3M7GA 5DD8A 1F1ZA 1G3SA 2Z9OA 1SD7A 3I58A 5CVUA 4EM1A 5L3FA 3REOA 3FMQA 3FXRA 1W7PA 5J8CA 4A2UA 1XCBA 3F23A 4PGHA 3K69A 3WTWC 2ESNA 2CGPA 4PGGA 2MLGA 2XAFA 2VT3A 4NHJA 2XAGA 2QBYA 3COAC 1GXQA 4ZYDA 1KYZA 4OIRF 3EETA 1LNWA 2KRFA 5E1XA 3JTGA 2PMHA 3E6CC 2H09A 4HF0A 2CO5A 1FY7A 1MJBA 2CG4A 4LGWA 1W7PD 4UHTA 2ACJA 3M9AA 4HQMA 5K1YA 3HRTA 3ECOA 3K9TA 3ML6A 4UNOA 1T6SA 2P4WA 2QENA 2VBXA 4XLNF 1O3QA 2EFNA 1I1SA 1XSXA 3GLXA 2VE8A 5ICCA 2VBYA 1O3SA 2M45A 1Z91A 5ILVA 3D5LA 1B1BA 3IKVA 1FPQA 2EV0A 2XGXA 1ON1A 2STWA 1JXSA 1Y0UA 1FP2A 5K5RA 1DPRA 1Z7UA 2V1XA 3K2ZA 4WWCA 3CO7C 1PP8F 3P9CA 1U5TC 2FSWA 3PQJA 4KFCA 4MEXF 2W84A 3ABTA 3TGNA 3GFJA 4U0YA 5FLXK 2HYGD 2EA2A 4D0PA 4LG0A 5BS6A 2OZUA 2F5CA 3SQNA 3EYIA 2LDUA 1BBYA 1U5TA 1TTYA 1XGMA 2V1DA 4G7HF 1RI7A 2HGCA 2RC4A 4RS8A 4UVCA 5LHHA 3H3ZA 2YPRA 2DLLA 3L09A 3QU3A 1FP1D 3JW4A 1ZGAA 3FZVA 1KYWA 1D8KA 4CHUA 2VBWA 2L54A 1K79A 1TNTA 1ODDA 1LB2A 2XAHA 1G4DA 3NRVA 3WGGA 4HDUA 1MDMA 4RB2C 4FX4A 1WKMA 2DT5A 4KIGA 4IPAA 4ETSA 1E2XA 2GA1A 1J7KA 4O6JA 2WWYA 1A04A 4A12A 1YFHA 1R1TA 2CQKA 3CTAA 2OQRA 2Q2EA 2QM3A 4FT8A 3LQRA 3HRMA 2A69F 1O7LA 5E17F 5LGUA 3C18A 5CVJA 5LHIA 3ZPLA 2EV5A 3CDHA 1AOYA 5LGTA 3DPTA 4KN4X 1RUOA 1P4AA 3LA2A 2DQRA 5ILSA 4Q47A 2XHKA 3I4PA 3QP6A 4ZH4F 2RV8A 5FFZA 1HKSA 1Z6RA 5KVRA 4L9JA 4Q5SF 4WK8F 2P6TA 5DEQA 1SFEA 4KA4A 3V7RA 4ZZLA 1X3UA 2EB7A 2FRHA 1W5TA 4RGSA 2G7HA 3TDZC 1YTYA 4PZJA 2IT0A 1O7FA 2ZNZA 1RZ4A 4ZYEA 4I2OA 1I6XA 4PCQA 1FZPB 2LNBA 4KIFA 3KP6A 5TJJA 2OA4A 3L9FA 1LJ9A 3GUDA 3KZYA 2PQ8A 4HW0A 2DK8A 4YFKF 1Z6TA 2R7FA 3BJAA 3D0SA 4TV7A 4RB3C 4L9NA 2UXNA 1YW8A 3HIFA 1T98A 2E1CA 1OYWA 4WXDA 1IN4A 3R0JA 2BYVE 3MFKA 2DW4A 4NB5A 2IA1A 1HW2A 4IRGA 3I0TA 1R00A 4EM0B 3R0AA 3M1EA 1FT9A 1FNNA 2RN7A 3T5XA 5HS8A 5IT3A 3L00A 4ASNA 1J0RA 1G3YA 1TQMA 3QAHA 1HW5A 3FXQA 3ZMTA 3R60A 2DTRA 4IRHA 5L3BA 4R1HA 2VODA 4G7OF 2JTVA 3GXOA 1RUNA 4DQ2A 2A61A 4EVIA 1U5TB 2NS0A 5LRSA 3WGIA 2Y0MA 2XAJA 4I0BA 3DFGA 4EGYA 3F8FA 4BHBA 5HLGA 4KMFA 4MTEA 5D6EA 3E5UA 2GZWA 1O3TA 2BV6A 4HLXA 2QLZA 3SHFA 3FX3A 2FF4A 3QPTA 3GEZA 3ERED 1YIOA 3MEXA 3DPLC 3V8KA 3GW2A 1JHFA 2K4JA 4S04A 3GZ5A 2D1HA 3IC7A 4MNUA 2PEXA 1F4KA 1H9TA 4CXFA 2L4AA 1LEAA 4BAYA 3WTZA 1LDJA 1T2KA 5D4SA 4OOIA 3GO5A 4XSXF 5JFRA 3WTUC 3I59A 4QWQA 1U6GA 3O3KA 4O5VA 3V7SA 3E6DA 5H20A 1QBJA 3KFWX 4F7ZA 2CYYA 3HSEA 3GWZA 1T0FA 3ZMZA 3RJPA 2OBPA 1IZ1A 1ZGJA 3TKYA 1ZARA 2YR2A 1I27A 4Y17A 2DU9A 1L0OC 3CUQC 4UVBA 2H94A 4EJUA 1PDNC 2HKOA 2Y75A 4Y15A 3HHHA 3VB2A 5L3EA 1LEBA 4EJVA 2M87A 2ZNYA 2M1BA 2QZ8A 4MQ9F 4R79A 4A0ZA 4MGRA 3RI4A 3HSFA 2XKPA 4BXUA 4BYYA 5CYVA 3F22A 2KIUA 5F64A 1DDNA 1VTNC 2FMLA 3PQKA 3S2WA 2A5YB 1HW1A 3KE2A 4XSZF 1MKMA 1LDKB 5BPIA 1EH6A 4MQVA 2V6CA 3N97A 1FYMA 4S05A 2Q8KA 4OINF 1OKRA 4EJTA 2W57A 4UV9A 3P9KA 2HFHA 1V4RA 4WXCA 1ZH5A 4M6XA 2UWMA 5LBQA 2GXGA 5K5QA 3KLOA 4KMUX 2PLYA 1D8JA 2HZTA 2VOOA 2KKOA 4M6YA 3WTXC 4L9TA 3KETA 1MGTA 4PDKA 3E6BA 4R8HA 4DNCA 3I54A 1Q1HA 3ZMVA 5E8GA 2PG4A 4L0ZB 5KK1A 2BGCA 4JK1X 5CVIA 2DPUA 1IN5A 3EUHA 4HX8A 3RIRA 1MZBA 2QUFA 2XROA 3SXYA 3FMSA 1B6AA 1B4AA 1I5ZA 2IA0A 3GYHX 1RNLA 2MBFA 4HZFA 1MJAA 3WODF 3BZ6A 3HSRA 2XAQA 3WE3A 1U8RA 4KDPA 2XUBA 2YX4A 5CLSA 3C1DA 3K0LA 2LSOA 4BNCA 4M9SA 4P9UA 2PFBA 5L3GA 2NRAC 4YIIA 5HOOA 1TW3A 1Z05A
chains in the Genus database with same CATH superfamily
3IKTA 2QQAA 4ON0A 2LTPA 4D5CA 3ZP5A 4ENMA 3F8NA 1X4OA 3DWLE 2XGDA 4BJ6C 2EIKH 4DYCA 4BEHB 1FMVA 1SAXA 2LF8A 3A4CA 2KLOA 3MWMA 2OZ6A 4OIOF 2A6HF 2HOAA 1F5TA 5F04A 1LVAA 2JPBA 2HNHA 3LAJA 1ZRDA 1IAWA 1AA7A 1GDTA 3ZXSA 4PJMA 2VQLA 5FKMA 4CH7A 3S1RJ 3HJEA 4RA2A 3Q0UA 5EGOA 1I39A 2V9VA 3IL2A 2WC2A 4LFUA 5E20A 5LRRA 5LEJA 3JSPA 2LKPA 1SD4A 2RDPA 1D0YA 2AS5F 1N75A 2HI3A 2GXBA 5F27A 4DW6A 1XS9A 4LK1F 2XSJC 1AWCA 4IHVA 2Z3YA 3IV5A 1GHCA 2QYOA 1FYKA 1BA5A 5FLVA 3A02A 3G71I 3VEPA 2M9HA 1KQ0A 1HLVA 3ZGKA 4CGZA 4HV5A 1HKTA 2BY3A 2ELKA 1XCVA 2GLOA 3K70D 4ITVA 1W36D 4BH9A 4NDLA 4FQGA 1D0XA 2BHZA 2HYFA 3C2BA 2K9QA 2LH9A 3V4GA 1D5VA 1YG2A 1YLFA 4OIPF 1ZG3A 2NNYA 1EA3A 3JTHA 4I02A 2HEOA 4KT5C 3L2WA 5FLMJ 3CUQA 4LK0F 2R3SA 1QGPA 3A03A 3Q5FA 3CCEI 3FWEA 1GUUA 4ESJA 3M1CA 2R4GA 3FXLA 1A6IA 3C3WA 5GADJ 4Y7NJ 4XLEA 4LG0B 1S8NA 2G7UA 3ZMUA 1A6QA 2NNNA 2AO9A 2PMZN 4FX0A 1XN7A 1BJAA 5D8LB 2E35A 3K4JA 2BXYA 2EFQA 2KZVA 3RPUA 3RZDJ 4HG2A 1RR7A 4D5FA 3JCUC 2RGVA 1AKHB 3H92A 3RYPA 1TWAJ 1TW2A 2KRHA 3VSKA 2DCEA 2MH9A 2R5YA 5F0HA 3CCYA 3O6BB 1Z67A 2P6SA 2CV2A 1DP7P 4K2EA 1FX7A 3DBRB 3PL8A 2L4MA 5IYDJ 4Z6YA 3WTYC 1VQPI 2ID6A 2ZMEA 2LBFB 3IH2A 1YRNA 4GO1A 3BY6A 1K78A 5EYRA 2RAEA 1YW9A 1GVJA 4XLCA 4RAYA 4G6TB 4CYDA 4JP0A 2IGKA 2TRTA 1I50J 1IRGA 3TOBA 3GTGJ 2E2HJ 1ETOA 3PM1A 3MKZA 1FMWA 2L7FP 1XGNA 2QQ8A 3QP5A 1X1BA 3TW6A 3K4MA 5KCMA 2HOSA 1OLTA 2KIQA 5JR3A 2CQQA 2Y31A 1Y6IA 2R7OA 3E6MA 4N0BA 5DS9A 5DM6F 1WWXA 2DMUA 3OR2C 1A31A 2W25A 1MDMB 5E18F 2XGEA 3H1CA 2ELJA 3N05A 3H5NA 1G2HA 3GFMA 1CF7B 2FA5A 2VPRA 4QIWN 3KYCB 4G6QA 3L1PA 4I6ZA 1FBUA 4HV6A 5JLXA 3W2WA 3ZCOA 2PJPA 3CO6C 4F52A 2DA7A 2O7OA 3OIQA 4E7ZA 4OWRB 4I09A 3ZN1A 3H3UA 5GTHC 1JUSA 1SVOA 2AXLA 2FU4A 5CPRB 1YO5C 3PO2J 2IJLA 2VKEA 1R1UA 2GOXB 1K78B 1VI0A 3G1MA 3OYNA 3N4MA 3HOZJ 1Y8QB 2P7CB 4YG2F 2V1UA 1EH8A 2F4MB 3KP2A 5AONA 1UHMA 2QWWA 3U21A 1QZZA 4XIDA 4F92B 3QPLA 3H36A 3IH4A 2VLAA 1XSDA 1D1BA 3BZCA 1OCRH 4MHGA 3ZR8X 5IY5H 2R7ZJ 2O9LA 1HSJA 2VJJA 1G59A 3IRQA 4IHTA 4IF4A 4DGWB 1OPCA 4CYCB 2JN6A 3BTJA 4BHPA 1TP4A 3CF5F 1BR1A 1SMTA 1BC8C 1VQ9I 2M8EA 4E7SA 2JT1A 1V54H 4P5OA 3PUBA 3O2PE 1JHHA 2HTJA 5TRDA 2AHQA 4F55A 3BPVA 2BW3B 2QQ9A 1YX5A 2E5ZA 3OOPA 2NVQJ 3BT9A 5HLHA 4B44A 3PJRA 3CCRI 2JA2A 4Q48A 2FBKA 3OYGA 3CCQI 1E3PA 2ZBKA 2QSHX 3KLNA 4UUTA 4IQJA 1ZAOA 3GZ6A 4P1WA 1SFKA 3OMYA 1FC3A 3NAUA 3HOUJ 3G1LA 1USTA 4YIRX 4IXAA 2MD5A 3CC7I 2Y48A 2OTLI 4XKVA 2DOEA 4HSRA 2WB1N 2ELHA 5H6QA 3ULQB 3TW7A 4G8XA 3F3XA 3DKYA 2W82A 2IVMA 4U0WA 4BQOA 1LFUP 2LMDA 4M73A 3F8CA 2DDAA 5DCFA 3E3VA 1YS6A 2E34A 3MAJA 3FM5A 5D5UB 4HF1A 2DJNA 4KYWA 3NWTA 3PUFA 3MMYB 1YIJI 1YI2I 4XRFA 4B1RA 2NOGA 1W7PB 3HBLA 2KJBA 1FBQA 1TL8A 2V7FA 1IDZA 2X4HA 4G94A 3RPQA 1NK2P 1QRYA 3KCCA 4MEYF 2K9LA 1XG1A 2H6CA 3RKYA 5IOYA 3GTOJ 2PMZA 3OYCA 5C4JJ 1S6LA 2LY1A 1XD7A 4CCOA 4U7DA 2DOAA 2EFOA 1P92A 1FTTA 1GT0C 3IP4B 2VOPA 2ETHA 2HDWA 3W2VA 3H5RA 2R7TA 1WRJA 2M8GX 1VQNI 4ZTFA 2K02A 2MFZA 1N25A 3LQQA 3OV8A 2FD5A 4L9VA 5ICEA 2EFWA 3JRGA 3B02A 2CV1A 4BY7J 4AVPA 3M07A 2R7WA 5B3SH 3U9GA 3FF5A 1KU7A 1MNEA 3FXKA 3VFZA 1C0WA 3Q0VA 2X0LA 3I56I 1H89C 1VZ0A 1USSA 2FNPA 2IP2A 2CFOA 3FK7A 2E1OA 5C4XJ 5D5XB 1QHHD 1U78A 2OJED 2LKXA 1IV8A 2COMA 3M8EA 2HQAA 2XB5A 2XRLA 3DXJF 4DYQA 1ZG1A 5K5OA 2HTSA 5CKTA 1MD0A 4M71A 5DDGA 1HOMA 1JKRC 2J5PA 1LKXA 2EWNA 1NTCA 3T1BA 3JSOA 1ON2A 3QPHA 4A3BJ 1X1PA 1N78A 4NQWB 3LSGA 2V4JC 3MN2A 2P5VA 2VJIA 3OYLA 3WU1B 3V8JA 1J2XA 3G73A 1LE8B 1UHSA 2OU2A 5EG0B 2QKLB 3R61A 2F5DA 1I3AA 3TL4X 3BCBA 4E70A 2NS8A 1IF1A 1S5LC 4CZCA 3JREA 4J19A 3JAMZ 3HC7A 1JGSA 5J6XA 3G2BA 2L9RA 5CQEA 2ESHA 2Y0SA 2F2EA 1L3LA 4U7BA 1RKWA 1VQ5I 4FETA 1SD5A 1TWGJ 3G4SI 3PSIA 2WY8Q 2KIMA 4KIBA 1FEXA 1ZYRF 2RVCA 2A6EF 2IS6A 3Q3SA 3RCOA 3TMOA 4GGGA 4IQ4A 3GTPJ 5BNGA 4CCKA 2ZJQF 2W85A 1DUXC 4LB5A 1ZRCA 1KU3A 5HNFA 1LQ1A 4IVNA 2JA7J 3KEYA 3CQZJ 2WAFA 3I64A 4Y3OA 1JKQC 2E2JJ 4HRIA 1MSFC 3BJOA 4IRIA 2UUZA 5E8IA 2FNAA 2OV7A 2L9SA 3ISPA 2HS5A 2P7VB 2W48A 3D5SC 1FIAA 1B9MA 2WV0A 3FM3A 2ME0A 4CO8A 2AXTC 1OYYA 3ZQHA 3OSFA 2IA2A 3MZHA 4HQEA 5J8FA 1K7AA 2GWRA 4EM2A 3ZQ7A 2VKVA 3OS1A 2XPUA 1QA6A 4M72A 1XMAA 5GAEJ 1B59A 1CF7A 1RKTA 1RESA 2LY9A 2KIFA 2WAQA 3I53A 3S1NJ 1I6HJ 2CRGA 2NS7A 2B0LA 3HPGA 3JRBA 4XICA 2W24A 2BE5F 1EJ9A 2DQLA 4PJLA 1R5GA 2X6YA 2D2WA 3AG3H 4G9YA 1LFPA 5CVRA 3UKGA 1XB4A 4EMSA 4XK4A 3E1SA 5IOZA 5IPAA 3GVAA 2AQEA 2FBHA 1SD6A 3DEUA 2HYJA 4B8XA 4CCMA 4KITB 4CYCA 3T8TA 1FSHA 1K6OA 2K9MA 1ONVA 2E60A 2R7QA 4OU0A 3T0YA 1KA8A 2ECBA 2XRNA 3JRAA 1U9NA 3WGHA 2JVHA 4Q4ZF 3LSPA 5LGNA 5BQTA 4XRSG 1CGPA 2OCCH 5DCMA 5E79C 1X1CA 4LMYA 2DPDA 1LDDA 2DTZA 3K1MA 1T56A 1WFXA 2GIVA 2A07F 4G12A 4BQAA 2FOKA 3QOEA 5KAFC 4NC7A 3EYYA 2TDXA 3SZGA 1ZREA 5IP7J 1QU3A 1MBGA 4MFDA 1BI1A 3RDIA 1QHGA 2HQ5A 5ICGA 2OD5A 2VIXA 3M8FA 3VOEA 3OYKA 3AAFA 1QPMA 4D1QA 1SC7A 2ISZA 2CFXA 2VT2A 2YSRA 2E7WA 2FEZA 1GV5A 2ISYA 3SJMA 1ZR2A 2QQBA 3HPHA 1KONA 3LAPA 4BS9A 4FE4A 2KQRA 2VXZA 1XPXA 2L3DA 1R71A 5LHGA 1B72A 3ABKH 4CDGA 1IJWC 1OMIA 4ZYHA 1TT0A 4FISA 3GFIA 3MCZA 3IAS2 4A3FJ 3HTUA 3R4KA 1X2NA 4UUSB 2E2IJ 2VBZA 3MVPA 3JAMK 3S93A 2QKMB 5ED4A 1OCOH 1TWHJ 5E1ZB 4LB6B 2H8RA 1BL0A 1UCRA 4A69C 3K4LA 1FIPA 2C6YA 1QNTA 3S1MJ 2DA6A 3LMMA 4KN7X 2NXNB 1QQIA 3F72A 4HX4A 4ZDOA 3DBLB 4AM3A 2GIZA 3GFLA 1BI2A 5KHDA 2XIGA 3BQZA 3F21A 1R9TJ 3HG9A 1MMAA 1ULYA 4JQFA 3HUGA 4BGDA 2JA8J 1F9NA 2E71A 4HSTA 2IS4A 3S3MA 3CDIA 3PNTA 2IGNA 5F0CA 5FGMA 3T8RA 4KUMA 1ZG5A 1P4WA 1UG2A 2IPQX 3B73A 1IGNA 5ICFA 2OPTA 2ZKZA 1OYIA 5IP9J 1FWZA 4ABZA 1X1DA 4LITA 4E7KA 2EFPA 3TO6A 4J01A 2FXAA 1XMXA 2EZHA 3LSRA 3V42A 1WJDA 3AKZA 1JJ6C 3MKLA 1B72B 4AIDA 3J80Z 2EH3A 3K1PA 3FHZA 4IKFA 3S15J 1BN5A 1BI0A 2L02A 3BG3A 4CCLA 3BOQA 4J00A 1D1CA 4P55A 1HDPA 1K61A 3SEQA 3L2RA 5IYBJ 4E4HA 3Q9VA 2CS3A 4E7LA 3CDLA 3BG6A 2HXIA 1IW7F 1G6NA 1X3WB 3GF2A 2BHYA 5DUKA 3FIWA 4DIQA 5FFXA 1E17A 3P9IA 2FOWA 2Z99A 1S29A 1IV6A 1OR7C 3H9JA 1WH5A 3D5RC 4I01A 1V3FA 1KGSA 1A36A 1R7JA 3IRRA 3S2HJ 2LLKA 4HF2A 5EZGA 5A2QK 3DV8A 1BOAA 1ZN2A 1PP7U 4BUPA 3F6VA 3GTKJ 4Y33A 1HKQA 2WY7Q 3DF8A 2MABA 2O3FA 4PJ0C 5FO5A 2EBIA 4HA8A 1UJ8A 3KEQA 2O0YA 2RQPA 4AYBN 1TZLA 3GX4X 2CSOA 4FHTA 1S72I 4LD5A 2ZC2A 5B5EC 2G0EA 3BG7A 4WXHA 2Q0OA 1TQIA 1Z1DA 2QCOA 1QO0D 3HB9A 4WCGA 3CJTB 2DAOA 1U3EM 1AKHA 2BY2A 1ZQ3P 2LC2A 3A1YA 3KEOA 4A6EA 1O57A 2STTA 2R7UA 1JE8A 3SFZA 2VE9A 5LEKA 1M1EB 3LWFA 1EH7A 2ZO4A 5D5WB 4BQNA 1VQ6I 3KYDB 4RBOA 1F36A 2DJIA 3G3ZA 2CW0F 4L5JA 3MZ8A 2P8TA 2G9WA 3CMYA 5HDNA 4L0YB 3DEEA 3V8LA 2JVGA 3ZRGA 1GXPA 1W1WE 3BPXA 1YRNB 4XBFA 3JRDA 3KX2A 2M34A 3W6JB 2VI6A 3HOSA 6PAXA 3BDDA 2PN6A 3BTLA 3VYRB 4FE7A 4A3EJ 2ZXIA 1JJ8C 1IUYA 2O8XA 1MBEA 1MJ9A 2GQQA 1P7IA 2QA4I 2F4IA 2RNJA 1MNMC 2PBIA 3U1DA 5E3NA 1IN8A 1RRJA 4B47A 5D4RA 1OR7A 1WPKA 2HQRA 4A5MA 3DCFA 4ESBA 4ENKA 2IRFG 1W5SA 3ZQIA 2ZFWA 1JTYA 2EIMH 3BTIA 4UVAA 1V5GA 4JYKA 4D7NA 1R23A 3RKXA 4YIFA 5EEGA 3KZIC 3F8BA 5H6RA 3OYEA 1MH4A 1KU2A 2HVSA 1MMGA 3H0GJ 2WB1A 2DMQA 1WZ2A 2DYSH 3S14J 2JZYA 2XASA 2EJRA 2JPCA 2ZCWA 2WBMA 3TO9A 4IO9F 4NUBA 5JI6A 3IUOA 2RQQA 3RZOJ 1J75A 4E7JA 3HXLA 1B8IA 3CJNA 5IT9Z 4YFNF 1FBSA 2KRCA 4KISA 4NC6A 1WSUA 1IXSB 2FQ3A 4IOCF 1K4SA 1FOXA 2L0KA 3KIOA 5DV5A 2W00A 1DPUA 3KP7A 1MMSA 1BW5A 1S7AA 4P9FA 2XKOA 4ESFA 2BXZA 3PNVA 2O8KA 4NNJA 1MMDA 2MC3A 2VQCA 3E7LA 4FASD 1ZK8A 1K83J 4YELA 5HVQC 3VODA 2V1NA 1NG7A 2IGOA 1VQ4I 3FK6A 3TP3A 4GXOA 2E36A 3TP0A 1T8IA 1DU0A 2JRTA 2HOEA 1W0UA 1ERDA 3PIPF 2R7XA 4OMYA 2YX7A 5LFAA 1IXCA 5D8KB 1F43A 2KFDA 2K7LA 2ZB9A 2HDDA 1KU9A 1XDUA 2M30A 3HL2A 2A3SA 3J7YJ 3HOTA 3W6KB 2PMUA 2M7AA 1W36C 1CQTA 1ETWA 2DA4A 4M74A 1T38A 3IHUA 2M0MA 5E3OA 2JMWA 3K70C 2I5UA 1MSEC 1IN7A 1BW6A 1MH3A 4RGXA 2QSGX 4QLCU 2K4BA 4GYGA 2E1NA 4GCVA 2BVLA 3I59B 1RR8C 2OUMA 2M4GA 4I7HA 4B3AA 4WX9A 1OCCH 1FOKA 3TOAA 2FE3A 4EGZA 2F5VA 1ZLKA 4I76A 5JHUA 1J5YA 4HAMA 5J3LA 1BJZA 1Z21A 5CJ9A 1HQCA 4C3JJ 1WHUA 2Q2EB 1WI3A 1MBHA 3S3NA 2E19A 3MZYA 3A0HC 3QOPA 1KQ8A 1YQAA 3DU6A 3EUKL 3FXUA 3HRSA 3DPUA 1V5EA 1OCTC 4DZPA 3HTSB 3F6OA 3OYFA 2GA2A 1BIBA 2YU9J 1B9NA 1J9IA 2R92J 4XORA 5FKOA 3QYBA 2DA3A 1ZHFA 2K3PA 3ECHA 3VYTB 2JA6J 5F6FA 2CWEA 2XAUA 2DO7A 3HRUA 1FLIA 1EV7A 2PI0A 1IRFA 3S17J 3CUOA 4MFEA 2ZXJA 2RNGA 5ILUA 4XRMA 2Y9ZA 3SZTA 2WAQN 4U0VA 2H27A 3K1NA 1J59A 1R6RA 3HKZN 3J81K 1MBFA 3RYRA 3RTRA 1XSVA 1D0ZA 1ZLJA 2JQ7A 4PFPA 2IEKA 3LSMA 2FBIA 5JHFA 4A3DJ 2B63J 3BG5A 4EQQA 5D5VB 4CZZA 1D5YA 4M3GA 1NG6A 3BWGA 5EEHA 3Q0WA 5CQGA 2ZXWH 1VQMI 2Z16A 1TBXA 3BP8A 4AVZA 2K27A 1G3WA 3R6SA 2E1MB 4X6AJ 1D3YA 3DQVC 3M4OJ 1HSTA 4EJWA 3PFYA 4HDVA 2ADUA 2Z33A 5JLWA 4UY8I 4I0AA 1ZRFA 2KT0A 3WTVC 1JI8A 3WG9A 3ZN0A 2VONA 4RB1A 1U2WA 4I98B 5FRNA 1P2FA 4XLHA 4XR6A 3OYIA 1HXDA 2K86A 3L2QA 4XOTA 4A0YA 2LR8A 5BOXA 3EUAA 3TQNA 2M5WA 4GYIA 5H2FC 2DA5A 2CUEA 2DBBA 3WE2A 3DKWA 1BOBA 2UV1A 4C2MJ 4UUVA 4XLPF 4BBSJ 1TT5B 3KYLA 4HX7A 3H0DA 3EQLF 2OTJI 4XN0A 3J7AY 2XVCA 3J81Z 4XONA 3FXOA 4EATA 2ZFUA 2QVOA 3HGGA 1HDDC 3QU6A 4L5IA 4NQWA 4AIKA 1RIOH 4AWXB 1Z3XA 2EILH 2D45A 3OYJA 1YOVB 3KP4A 2XV4S 2IBDA 3IWZA 3HOXJ 5ERIA 3HOWJ 1UFMA 2NVXJ 2F5EA 1IRZA 5GPCA 3ASNH 3A01A 1TNSA 2VJ5A 4ZDLA 4U88A 3F8MA 4EJOA 1DQUA 3SEZA 4M9ZA 2EK5A 2ZSIB 2ZJ2A 4A5NA 1XDSA 1VNDA 5L3DA 2DFIA 1JTXA 5EEAA 5TISC 4ZYGA 3OYAA 4E7HA 1Z9CA 1UB9A 3I5UA 4BHCA 1ORKA 4F3QA 1VFCA 1SFUA 2FQ4A 1S3JA 3K4CA 2UZKA 4ZYAA 1TQPA 1T39A 1DP3A 1P9QC 2HU9A 2KJCA 3ZMSA 3L7WA 1S7OA 3ZQQA 2DYRH 4RAZA 2VC1A 3ZQGA 3CLOA 3QWLA 5F1RA 3E5XA 4C3IJ 1IG7A 5M5YJ 4H0EA 5FD6A 1H0MA 2W4SA 4BXFA 2COBA 2P5KA 4A3KJ 5DD4A 1V5FA 1WJAA 1BIAA 1Y0NA 1FTZA 4Z2YA 1ENHA 2DN0A 3KP5A 4PFOA 3UR3C 1I1GA 2OQGA 3CJRB 3LA3A 3RPUD 4ZTJA 2K9SA 3SYTA 2H6BA 5CVVA 1W4MA 1WJCA 3E97A 2ME6A 3ESWB 5M5XJ 2M4KA 4BJTA 3A01B 4JX5A 1G8XA 4AIHA 2K85A 1W0TA 3ABLH 2BBYA 2IW5A 3LNQA 2BEOA 1KQ9A 1TWFJ 5HLIA 3H3VK 3NQOA 5AIQA 3ROUA 1I3QJ 3DP7A 5DCMB 4A6DA 4XLAA 3PNYA 1BC7C 3GMEA 3KPHA 5BPDA 5J47A 3HHGA 4HLYA 4MTDA 1U9OA 4JBAA 3BJ6A 4X1EA 3V7CA 1YJWI 3X2QH 2MA3A 2R7DA 2GAUA 2UXXA 4NBQA 2O6GE 4UXNA 2XDVA 3I55I 2DA1A 5HDKA 5FB2A 3RSNA 2YU3A 2XPWA 3ELKA 5IT9K 1SANA 2BY1A 2E7XA 3FBNB 2EIJH 3Q9SA 3RKWA 3KP3A 1N77A 3A2KA 3LSJA 1BM9A 5TGTA 2PJRA 3WTTC 4ENJA 3QQAA 5AIPA 1BR4A 4FCYA 1TLHB 2A6TA 2JSCA 3J7AO 5LLQA 3C7JA 3BR6A 5DYMA 4RAGA 1R5ID 2VXDA 4MIMA 4C3HJ 1JGGA 4IHSA 3LSHA 4XLFA 1WI9A 2X9DA 1SMYF 2CMPA 5J4YA 2M3AA 4EV0A 2GOMA 2WA0A 3HYIA 4CA0A 2V79A 4BDYA 1FYLA 1R36A 2L5QA 1BI3A 2MH2A 3TBIA 2LP0A 5HS9A 1YW7A 4KNYA 2JK3A 3K4KA 1O3RA 1Z7LA 3WHCA 4HYEA 3LSTA 2HDCA 2DODA 2VC0A 3FKJA 2ICWG 4XKCA 5FKNA 2VQGA 4AIJA 2LF7A 3A0BC 2FUG2 2Y2ZA 3PFIA 3L2CA 3CCUI 3QPSA 3OL3A 3WU0A 2X48A 3WTSC 3LFKA 5D6FA 4RM2A 2AQFA 2JUGA 3I71A 4A3GJ 1R1VA 4WF2A 5EDNA 1PUFA 3KZZA 3OWTA 2X85A 2LVSA 2F4OB 1WVRA 3OYBA 3S16J 1SFXA 1XGOA 3QYFA 2GXAA 1P6RA 1XMKA 4GRIA 4YFXF 2FMYA 2CW8A 1G3TA 4N9IA 5FLXZ 1REPC 2EV6A 2MGQA 4A0XA 4F93B 2EZIA 4BU2A 4LIVA 3K6GA 1HBXG 1DU6A 4O3MA 1H9GA 1ZR4A 1GVDA 4LLLA 2MLKA 1STZA 4BE1A 2A68F 1PYVA 3JRFA 2R5ZB 3VSLA 3F0CA 3IWFA 2HR3A 1R22A 2NAZA 3FMRA 4RGUA 5A2QZ 2TCTA 3BROA 2ZXHA 4PSWA 4B09A 1IXRC 4ZZDA 4XN3A 5KAIC 3ZQCA 1WGXA 2JUCA 2LKSA 3FHNA 4RM3A 2KHMA 2L01A 1AHDP 3DTKA 3PO3J 3U1KA 1UHWA 4HOBA 4MLOA 4LLNA 3SZPA 3CCSI 1YE9A 4M9XA 4XNFA 4ENNA 3ABUA 3BCAA 1NHAA 1Y1VJ 3O8HA 1YYVA 2HWVA 3EDPA 3S3OA 2O5RA 4G6DA 3WU2C 2WTEA 2LBFA 2ZMEB 1Z0XA 4AD9A 1UZCA 5DUIA 4G7ZF 3BR0A 2LOOA 2O03A 3AG2H 1P4XA 1QZYA 1PUEE 4RGRA 5L3CA 3J80K 1E0EA 2CQXA 1IN6A 1IUFA 5GAHJ 3B6AA 5K7FA 3OYMA 3ZMDA 1XGSA 3BQYA 4LLGF 2EA4A 4BACA 2OAZA 2RKHA 5HS7A 4OIQF 2VN2A 1LUJB 4P96A 4QTRA 2V6EA 3LA7A 3BR3A 2J5OA 4A3LJ 3G6EI 4YEJA 3HKZA 1DGRM 2CV0A 1R58A 4IJAA 2DK5A 4LIUA 2O61A 2CUJA 1S7EA 3K4BA 3P7NA 5HDGA 5E1WA 3BR1A 3MQ0A 5JVTA 4LOCA 4OAZA 5HNHA 3QRFF 4LJZF 2P5LC 2L9VA 4Y13A 1WQ2A 3VWBA 5HLTA 1ZTRA 2IGMA 3FXJA 3BR5A 3TO7A 1Q1VA 1YS7A 5DM7F 1VQLI 4XKBA 2HQNA 2QBYB 3I4NJ 4N9HA 3U2RA 1FSEA 3C2HA 5FKLA 2NYXA 4KJZA 2D1VA 3FISA 2F5FA 3OR1C 4HBLA 4CSWA 4CICA 3W3CA 1R5HA 3E5QA 4DBRA 3MKWB 4IL6C 5K7ZA 2MW8A 4RB0A 2FX0A 3RQ4A 4M3BA 2HKXA 1R49A 3TDUC 2DI3A 4UV8A 2LK2A 3DEWA 5FD5A 4OMZA 5BMZA 2HOTA 1Y8RB 2Z5UA 3CUQB 4KICA 3NEUA 4L18B 2P0WA 3M7GA 5DD8A 1F1ZA 1G3SA 2K9NA 4PJJA 1OQYA 1ZGWA 2Z9OA 4Y4RA 1SD7A 2ZJPF 3I58A 5CVUA 1T33A 3S1QJ 2KDZA 4M6VA 4EM1A 2L9NA 4RDUA 3CMEI 1RETA 5L3FA 3CLQA 3CJQB 3REOA 2IS2A 1HA8A 4NC8A 3FMQA 3FXRA 3DLLF 4II2A 2MD0A 1W7PA 5J8CA 2QEXI 2HZDA 3CESA 4A2UA 3DLAA 3B6CA 1FOWA 1QVTA 1XCBA 3F23A 1HCRA 4PGHA 3K69A 2LYCA 3WTWC 1Y39A 2ESNA 3CMAI 2CGPA 4PGGA 2MLGA 2XAFA 2W7NA 3K7AJ 2DT7B 4A3IJ 1WJEA 2MC4A 1WCMJ 4IX7A 3NWSA 2VT3A 3K10A 4NHJA 2XAGA 2QBYA 2CQ7A 2M0CA 3COAC 2NVUB 1GXQA 4ZYDA 1ZKGA 1KYZA 3LOCA 4OIRF 1AU7A 3BG9A 3D1NI 3EETA 2E5NA 4I99C 1JT0A 1LNWA 2A05A 2KRFA 5E1XA 2X6WA 3JTGA 2PMHA 3E6CC 1POGA 2H09A 4HF0A 2I10A 2CO5A 2DOFA 1FY7A 1MJBA 2B7EA 1OCZH 4DZJA 1O4XA 2DMTA 2CG4A 4LGWA 1W7PD 4A3JJ 4UHTA 3S32A 3UNGC 3M9AA 2ACJA 1H88C 4CCJA 4S0HB 1PVEA 4HQMA 5IYCJ 5K1YA 1WJFA 2L7KA 3HRTA 3ECOA 3K9TA 2VQHA 2VUMJ 3AL0C 4BXXJ 2XC7A 3ML6A 3S8PA 4UNOA 4M3FA 1FJLA 5HODA 1T6SA 1YITI 2P4WA 1E3HA 1LPQA 2QENA 2P81A 3H9QA 2MG4A 2EPFA 3IAM2 4ZJZA 4PUSA 2DFFA 2VBXA 2R93J 4XLNF 1O3QA 1UAAA 2EFNA 3GTMJ 1VF9A 3HEFA 1I1SA 1XSXA 3GLXA 2VE8A 5ICCA 2H1LA 2VBYA 4BQQA 4ZC3A 2M45A 1O3SA 1Z91A 2HXOA 5ILVA 1SFOJ 3D5LA 1B1BA 4HPQA 3IKVA 4M3EA 1FPQA 2DMPA 2EV0A 4QPOA 5K7HA 2XGXA 1SAUA 1ON1A 2STWA 1JXSA 4E7IA 4HNTA 1Y0UA 4XRSA 4IHWA 1FP2A 4B43A 1S9HA 5IP6A 1SVLA 3JRCA 5K5RA 1DPRA 1Z7UA 1X19A 3S2DJ 2V1XA 2IS1A 3K2ZA 2NVYJ 4WWCA 4OAYA 5F1JA 1EKEA 3ONQA 1ETVA 2CQNA 3CO7C 1PP8F 3P9CA 3CCMI 1U5TC 1T0FC 2EQRA 4DBQA 2FSWA 3PQJA 4KFCA 4MO7A 4MEXF 1W5CC 2W84A 3ABTA 3RQIA 3TGNA 3GFJA 2V26A 2Y69H 4U0YA 4AU7A 5FLXK 1MIJA 1UELB 4UB8C 2HYGD 2EA2A 4D0PA 1TWCJ 4LG0A 5BS6A 2OZUA 2F5CA 5M3MJ 2QF7A 4AC0A 3SQNA 2PX9A 3WHBA 2X6OA 3GCMA 5F0FA 3EYIA 2LDUA 1BBYA 1U5TA 4ANJA 1TTYA 1XGMA 2V1DA 4G7HF 1TC3C 1RI7A 3ASOH 9ANTA 2HGCA 2RC4A 2XF6A 4RS8A 4UVCA 3JRHA 2LD5A 5LHHA 3H3ZA 2YPRA 2DLLA 3L09A 3QU3A 1FP1D 2A5WA 1OCPA 3JW4A 1ZGAA 2H1KA 3GTLJ 1T95A 3FZVA 3HGYA 2LREA 1KYWA 1D8KA 2BVMA 3HZJA 3OS2A 4CHUA 2VBWA 2L54A 1K79A 5M3FJ 4II3A 4N4NB 2X51A 3OL4A 1XTAA 1TNTA 2Y9YA 1ODDA 2XAHA 1VQOI 1LB2A 1G4DA 2ZSHB 3NRVA 3M3YJ 2L7ZA 3WGGA 1WH7A 4HDUA 1MDMA 4RB2C 5E3MA 4BEHA 4FX4A 3DU5A 1WKMA 2DT5A 4KIGA 3I4MJ 4IPAA 4ETSA 1E2XA 1XC5A 2GA1A 2KL4A 1J7KA 4O6JA 2WWYA 1U8BA 3I3LA 3AG1H 1JUPA 1A04A 4A12A 1YFHA 1R1TA 2CQKA 3CTAA 4KT6A 2OQRA 2Q2EA 3CF2A 2QM3A 4FT8A 4RLFA 2JSPA 3OOUA 2XSDC 1FOYA 4U87A 3LQRA 3HRMA 1J09A 1JKOC 1WJ5A 2A69F 1O7LA 5E17F 3K4NA 4DOZA 3LL7A 5LGUA 3C18A 4B3XA 5CVJA 5LHIA 3ZPLA 3LFUA 5J1YA 2EV5A 2OC6A 3CDHA 2LG4A 2BW3A 1AOYA 4IEJA 3BC8A 3VDXA 5LGTA 3DPTA 4GDFA 5EJCA 4KN4X 1D1AA 5EZHA 3HDDA 1RUOA 1P4AA 3PSFA 3H35A 3LA2A 2DQRA 1LE8A 2BOLA 5EG0A 3EPZA 4L5EA 1MMNA 5ILSA 3CC4I 2Q1ZB 3CC2I 2VPLA 4Q47A 3IH3A 2XHKA 3FBIB 4XMYA 1QZEA 3I4PA 3QP6A 4ZH4F 2RV8A 5FFZA 1HKSA 3DBHB 2R5YB 1Z6RA 2V9KA 5KVRA 2XGCA 4W1UA 3OIPA 4L9JA 4F91B 4Q5SF 3OSGA 4WK8F 2P6TA 5DEQA 1QPIA 1SFEA 4KA4A 5C44J 3V7RA 5DTDA 3K2AA 4ZZLA 1X3UA 4PJNA 2KMUA 3C2GA 2EB7A 2FRHA 1W5TA 3CP8A 3FDYA 4RGSA 2G7HA 3TDZC 5C3EJ 1YTYA 2WV1A 4BE2A 5B1BH 4GFBA 4PZJA 3P5JA 2IT0A 3AFHA 1O7FA 2ZNZA 1RZ4A 1RC9A 4ZYEA 2XF7A 3GZNB 4XKWA 5E3LA 2EZLA 1ETYA 4XM3A 1OFCX 4I2OA 5F08A 3VPRA 5B1AH 1I6XA 4PCQA 1JKPC 1FZPB 5B66C 2LNBA 4V19K 2EZKA 3KP6A 4KIFA 5TJJA 4DJAA 2OA4A 4QSHA 3L9FA 1LJ9A 2K3FA 1Y56A 1DGWY 4RLQA 3GUDA 3KZYA 2N8GA 2PQ8A 4HW0A 4UB6C 2DK8A 4YFKF 1X1AA 1Z6TA 2R7FA 3BJAA 3D0SA 4A3MJ 1KZHA 4TV7A 3OY9A 4BBRJ 4RB3C 4L9NA 2VJ4A 2UXNA 1YW8A 4IHYA 3AG4H 3HIFA 2JA5J 4XL9A 2RREA 2PJRB 1T98A 1XX5A 1V55H 2MSYA 3CCVI 1GLNA 2E1CA 1OYWA 4WXDA 5LD2C 2Z2SB 3OYDA 2DXIA 4QPQA 1IN4A 4E6KG 3R0JA 4AYBA 4HNVA 4EEFG 2BYVE 3DKXA 2HPIA 3MFKA 2DW4A 4C30A 4NB5A 2IA1A 3L2UA 1HW2A 1IRXA 4V2GA 4IRGA 3I0TA 1R00A 4EM0B 3ZQLA 3R0AA 3M1EA 3M8JA 1FT9A 2LRDA 1FNNA 2KISA 2RN7A 3T5XA 4A93J 2CU7A 5HS8A 5IT3A 1IO2A 2YUSA 4BDZA 3L00A 2QSFX 4M3DA 1YJ9I 4ASNA 1J0RA 1G3YA 3CMMA 1MW7A 4W97A 3HOVJ 3PIOF 4BL0B 4BY1J 5JVGF 1TQMA 3QAHA 1HW5A 1Z77A 3FXQA 3DTEA 3ZMTA 4D7MA 3R60A 2DTRA 4IRHA 1R4NB 2ID3A 5L3BA 4R1HA 2YS9A 2VODA 3MKYB 1VQ8I 1K4TA 2CH0A 4G7OF 3OS0A 2R5ZA 2JTVA 3GXOA 1RUNA 4DQ2A 1ITYA 1Z3YA 2A61A 2Y0SN 2KZGA 4EVIA 1U5TB 2NS0A 5LRSA 3WGIA 2Y0MA 2XAJA 4I0BA 3DFGA 4EGYA 3F8FA 1MNDA 1RPWA 2IAIA 2IXSA 3GTJJ 1LVKA 4BHBA 5HLGA 4KMFA 2NVTJ 4HNUA 2DFHA 4MTEA 5D6EA 4RMNA 3E5UA 2CUFA 2GZWA 1PJRA 1O3TA 2BV6A 4A3CJ 4HLXA 2R0QC 2QLZA 2VB6A 3SHFA 2ZJRF 3H9GA 2QGUA 3FX3A 2FF4A 3TEDA 5M5WJ 1A5JA 3QPTA 1IC8A 3CP2A 3G1OA 2OF7A 3GEZA 2VKDA 3ERED 1YIOA 3MEXA 5FKKA 3SDGA 3DPLC 3V8KA 3GW2A 1E3OC 2K5CA 1JHFA 2K4JA 2ECCA 2KP6A 3GZ5A 4S04A 3WG7H 2FJ1A 5J4VA 4D9JA 2D1HA 2JJ7A 2K40A 3IC7A 4ZDPA 4CCNA 4MNUA 2JWTA 5EF6A 4X0GA 1MBJA 4BKXA 2PEXA 1F4KA 1H9TA 4CXFA 2XF5A 2L4AA 1LEAA 3W2AA 4BAYA 3WTZA 1NK3P 2D5VA 1UMQA 1LDJA 1T2KA 4LG3A 5D4SA 4OOIA 3GO5A 4XSXF 2Z1DA 5JFRA 3WTUC 2OCEA 3I59A 4QWQA 1PUFB 1U6GA 3O3KA 2KPMA 2VKHA 4O5VA 1APLC 2DMNA 3V7SA 3HM5A 3E6DA 2CUZA 2VL8A 5H20A 3JR9A 3L2VA 1QBJA 3KFWX 4F7ZA 2CYYA 3HSEA 3E0JB 1ZELA 3GWZA 1T0FA 3MD2A 2KDOA 3ZMZA 2M7BA 1VQKI 2F48A 4Y52J 2HVRA 2LY2A 3RJPA 2OBPA 2V9PA 1IZ1A 1ZGJA 3TKYA 1X2MA 2HVQA 1ZARA 1EF4A 2YR2A 1I27A 4Y17A 2DU9A 2Y30A 1L0OC 3CUQC 3F9KA 4UUSA 4UVBA 3I9V2 5EGOB 3AL0B 1OJLA 3SDBA 2L2OA 1HC8A 2H94A 4EJUA 1PDNC 2HKOA 1YX3A 2H8WA 2M2EA 2Y75A 3CD6I 5GP9A 2CW7A 3CCJI 4Y15A 3HHHA 1H8AC 1R4MB 3VB2A 5GAGJ 5L3EA 3VYSB 1LEBA 5KNLA 4EJVA 2M87A 3O8GA 3LSIA 2ZNYA 4CUGA 2M1BA 2WADA 2QZ8A 3HOYJ 4MQ9F 1JUMA 2JRMA 4R79A 4H4KC 4A0ZA 4MGRA 1WJBA 3RI4A 1LFBA 3DTIA 1YJNI 2MYSA 3HSFA 4C2TA 2XKPA 4BXUA 2R7RA 2DA2A 2B9SA 4XQFA 4BYYA 4FTHA 1SVMA 2X1EA 1UG0A 4HEA2 5CYVA 3F22A 2KIUA 4YRVA 2X1DA 5F64A 3ZQFA 1DDNA 2DT6A 1VTNC 2FMLA 2E1MC 3PQKA 3S2WA 2A5YB 2HPMA 1HW1A 3KE2A 3BLYA 4XSZF 3GTQJ 2CJJA 3CCLI 2R7SA 1MKMA 1LDKB 3QODA 5FJ8J 1ACIA 1ETKA 1SEUA 3EUHC 3LSKA 5BPIA 1EH6A 1OISA 2VASA 4MQVA 4PSXA 1NH3A 1BR2A 2V6CA 1Y1WJ 5FRMA 2L7MP 4PK4A 3N97A 1FYMA 4BJ5C 4S05A 2Q8KA 3FXMA 1B8IB 1P7JA 4OINF 1OKRA 4EJTA 5GPAA 2W57A 1ETQA 4C2UA 3CZ6A 5J40A 4UV9A 5J1UA 3P9KA 2HFHA 1V4RA 4JX6A 4WXCA 4B48A 2BY0A 1ZH5A 4M6XA 1QVUA 2UWMA 5LBQA 2GXGA 5K5QA 2WAEA 1K6YA 2X1CA 1GV2A 4JOMA 3KLOA 4KMUX 2PLYA 4IOAF 3GBGA 1VQ7I 1D8JA 1U0JA 2HZTA 3ZOBA 2VOOA 2KKOA 4M6YA 3WTXC 3JRIA 1HF0A 3W6VA 2R7VA 1X3ZB 4L9TA 3KETA 3H5AA 1MGTA 2NOJB 4PDKA 4V2FA 3E6BA 4R8HA 4IHXA 4BE0A 1JT6A 4DNCA 3I54A 3OYHA 1Q1HA 3ZMVA 1X4PA 4JX4A 5E8GA 4C9YA 5GTIC 2PG4A 4L0ZB 3BTCA 4N4OB 2F6CA 1IDYA 5KK1A 2BGCA 1ETXA 4JK1X 5CVIA 2DPUA 3VYUB 1IN5A 3EUHA 2XB0X 4HX8A 4B4CA 2XPVA 3RIRA 1A35A 1MZBA 2QUFA 3NARA 2XROA 4IZZA 3SXYA 4XOPA 2GM4A 3FMSA 2DFEA 1B6AA 2BZTA 1B4AA 1I5ZA 2IA0A 3GYHX 3GLLA 5J1RA 2DDBA 1RNLA 2MBFA 1MBKA 4HZFA 3RKQA 1MJAA 3WODF 3BZ6A 2GBYA 3HUGB 3HSRA 3ABMH 1YHQI 2XAQA 3WE3A 1U8RA 4KDPA 2LFBA 2XUBA 3QYEA 2YX4A 3BR2A 3C1DA 5CLSA 4DYRA 3SFIA 3BZKA 3K0LA 2LSOA 3J7ZI 1X58A 4BNCA 4M9SA 4P9UA 3ERMA 2ZMEC 4AUXA 4RAFA 2W1OA 3OIOA 2PFBA 5L3GA 2NRAC 2I8DA 4YIIA 2X6XA 3FKIJ 5FROA 5HOOA 1T08B 2EINH 1TW3A 1Z05A
chains in the Genus database with same CATH topology
3IKTA 2QQAA 4ON0A 3ZP5A 4ENMA 3F8NA 1SAXA 2LF8A 3MWMA 2OZ6A 4OIOF 2A6HF 1F5TA 1LVAA 2JPBA 3LAJA 1ZRDA 1IAWA 2V9VA 3IL2A 2WC2A 4LFUA 5E20A 5LRRA 5LEJA 3JSPA 2LKPA 1SD4A 2RDPA 2AS5F 2GXBA 4LK1F 1AWCA 2Z3YA 1GHCA 2QYOA 1FYKA 3VEPA 1KQ0A 4CGZA 4HV5A 1HKTA 1XCVA 4BH9A 2HYFA 3V4GA 1D5VA 1YG2A 1YLFA 4OIPF 1ZG3A 2NNYA 3JTHA 4I02A 2HEOA 4KT5C 3CUQA 4LK0F 2R3SA 1QGPA 3Q5FA 3FWEA 4ESJA 3C3WA 4LG0B 1S8NA 2G7UA 3ZMUA 2NNNA 4FX0A 1XN7A 1BJAA 5D8LB 2EFQA 3RPUA 2RGVA 3H92A 3RYPA 1TW2A 2MH9A 3O6BB 2P6SA 1DP7P 4K2EA 1FX7A 2L4MA 3WTYC 2ZMEA 4GO1A 3BY6A 1K78A 1YW9A 1GVJA 4RAYA 4CYDA 1IRGA 3TOBA 1XGNA 3QP5A 5JR3A 3E6MA 4N0BA 1WWXA 2W25A 1MDMB 5E18F 3GFMA 1CF7B 2FA5A 4G6QA 1FBUA 4HV6A 2PJPA 3CO6C 4I09A 3ZN1A 3H3UA 2AXLA 2FU4A 1YO5C 2IJLA 1R1UA 1K78B 3N4MA 2P7CB 4YG2F 2V1UA 1EH8A 3KP2A 5AONA 1UHMA 2QWWA 1QZZA 1XSDA 4MHGA 1HSJA 3IRQA 4IHTA 4IF4A 1OPCA 4BHPA 1SMTA 1BC8C 2M8EA 2JT1A 4P5OA 3O2PE 1JHHA 2HTJA 5TRDA 3BPVA 2QQ9A 3OOPA 5HLHA 4Q48A 2FBKA 2ZBKA 3KLNA 1ZAOA 3GZ6A 1FC3A 1USTA 4IXAA 2MD5A 2Y48A 5H6QA 2ELHA 3ULQB 4G8XA 3F3XA 2IVMA 4U0WA 4M73A 3F8CA 5DCFA 3E3VA 1YS6A 3MAJA 3FM5A 5D5UB 4HF1A 4KYWA 4XRFA 1W7PB 2KJBA 1FBQA 2X4HA 4G94A 3RPQA 3KCCA 4MEYF 2H6CA 3RKYA 1S6LA 1XD7A 4U7DA 2EFOA 1P92A 2VOPA 2ETHA 1WRJA 2K02A 3LQQA 3OV8A 4L9VA 5ICEA 2EFWA 3B02A 4AVPA 3U9GA 3FF5A 1KU7A 1C0WA 3VFZA 2X0LA 1USSA 2FNPA 2IP2A 5D5XB 1U78A 2COMA 3M8EA 3DXJF 1ZG1A 5K5OA 2HTSA 1MD0A 4M71A 5DDGA 2J5PA 2EWNA 3T1BA 3JSOA 1ON2A 3QPHA 2P5VA 3WU1B 3V8JA 1J2XA 3G73A 2OU2A 3R61A 2F5DA 4E70A 1IF1A 3JAMZ 1JGSA 5J6XA 2ESHA 2F2EA 1L3LA 4U7BA 1SD5A 2KIMA 4KIBA 1ZYRF 2RVCA 2A6EF 4GGGA 2W85A 1DUXC 4LB5A 1ZRCA 1KU3A 1LQ1A 4IVNA 3I64A 3BJOA 4IRIA 5E8IA 2FNAA 3ISPA 2HS5A 2P7VB 2WV0A 1B9MA 3FM3A 4CO8A 1OYYA 2IA2A 3MZHA 4HQEA 5J8FA 1K7AA 2GWRA 4EM2A 3ZQ7A 4M72A 1XMAA 1B59A 1CF7A 2KIFA 3I53A 2B0LA 2W24A 2BE5F 2DQLA 1R5GA 2D2WA 4G9YA 5CVRA 1XB4A 4EMSA 3GVAA 2FBHA 3DEUA 1SD6A 4B8XA 3T8TA 1FSHA 1K6OA 1ONVA 4OU0A 3T0YA 1KA8A 2XRNA 3WGHA 4Q4ZF 1CGPA 5LGNA 5BQTA 5DCMA 2DPDA 4LMYA 1LDDA 3K1MA 4BQAA 2GIVA 2A07F 2FOKA 3EYYA 2TDXA 1ZREA 1BI1A 3RDIA 5ICGA 2OD5A 3VOEA 3M8FA 3AAFA 2ISZA 1QPMA 2CFXA 2VT2A 2YSRA 2E7WA 2FEZA 2ISYA 2QQBA 3LAPA 2VXZA 2L3DA 5LHGA 4CDGA 1OMIA 4ZYHA 3GFIA 3MCZA 3HTUA 3R4KA 2VBZA 3JAMK 5ED4A 5E1ZB 4LB6B 1UCRA 2C6YA 1QNTA 4KN7X 1QQIA 3F72A 4HX4A 3GFLA 1BI2A 2XIGA 3F21A 1ULYA 4JQFA 3HUGA 1F9NA 5FGMA 3T8RA 4KUMA 1ZG5A 1P4WA 2IPQX 3B73A 5ICFA 2ZKZA 1OYIA 1FWZA 2EFPA 3TO6A 2FXAA 3J80Z 3K1PA 3FHZA 1BN5A 1BI0A 2L02A 3BOQA 4P55A 3Q9VA 1IW7F 1G6NA 3GF2A 5DUKA 5FFXA 1E17A 3P9IA 2Z99A 1S29A 4I01A 1V3FA 1KGSA 1R7JA 3IRRA 4HF2A 5A2QK 3DV8A 1BOAA 1ZN2A 1PP7U 3F6VA 1HKQA 3DF8A 2O3FA 5FO5A 4HA8A 3KEQA 2O0YA 2RQPA 3GX4X 2CSOA 4FHTA 4LD5A 4WXHA 2Q0OA 1TQIA 1Z1DA 1QO0D 4WCGA 2DAOA 1U3EM 3KEOA 4A6EA 1O57A 2STTA 1JE8A 3SFZA 2VE9A 5LEKA 3LWFA 1EH7A 2ZO4A 5D5WB 3G3ZA 2CW0F 4L5JA 2P8TA 2G9WA 5HDNA 4L0YB 3V8LA 1GXPA 3BPXA 4XBFA 3W6JB 3HOSA 6PAXA 3BDDA 2PN6A 1IUYA 2O8XA 1MJ9A 2GQQA 2RNJA 2PBIA 3U1DA 1IN8A 5D4RA 1OR7A 4ENKA 2HQRA 4A5MA 4ESBA 2IRFG 1W5SA 2ZFWA 4UVAA 1R23A 3RKXA 4YIFA 5EEGA 3F8BA 5H6RA 1KU2A 2JZYA 2XASA 2EJRA 2JPCA 2ZCWA 3TO9A 5JI6A 1J75A 3CJNA 5IT9Z 4YFNF 1FBSA 1WSUA 1IXSB 2FQ3A 5DV5A 1DPUA 3KP7A 1S7AA 4P9FA 2XKOA 4ESFA 2MC3A 5HVQC 3VODA 4GXOA 2JRTA 2HOEA 4OMYA 2YX7A 1IXCA 5D8KB 2K7LA 1KU9A 1XDUA 2M30A 2A3SA 3HOTA 3W6KB 2PMUA 4M74A 1T38A 3IHUA 1IN7A 4RGXA 4QLCU 2K4BA 4GYGA 2E1NA 4GCVA 3I59B 4I7HA 4WX9A 1FOKA 3TOAA 2FE3A 4EGZA 1ZLKA 5JHUA 1J5YA 4HAMA 5CJ9A 1HQCA 3MZYA 3QOPA 1KQ8A 1YQAA 3FXUA 3HRSA 3HTSB 3F6OA 2GA2A 1BIBA 1B9NA 1J9IA 1ZHFA 3ECHA 5F6FA 2CWEA 2DO7A 3HRUA 1FLIA 1EV7A 2PI0A 1IRFA 3CUOA 2ZXJA 5ILUA 3SZTA 4U0VA 2H27A 3K1NA 1J59A 3J81K 3RYRA 3RTRA 1XSVA 1ZLJA 2FBIA 4EQQA 5D5VB 4CZZA 3BWGA 5EEHA 1TBXA 3BP8A 2K27A 1G3WA 3R6SA 1D3YA 3DQVC 1HSTA 4EJWA 4HDVA 2ADUA 2Z33A 4I0AA 1ZRFA 3WTVC 3WG9A 3ZN0A 2VONA 4RB1A 1U2WA 4I98B 1P2FA 1HXDA 2K86A 4A0YA 5BOXA 3TQNA 2M5WA 4GYIA 2DBBA 3WE2A 3DKWA 4UUVA 4XLPF 4HX7A 3EQLF 2XVCA 3J81Z 2QVOA 3QU6A 4L5IA 4NQWA 4AIKA 1RIOH 4AWXB 2D45A 3KP4A 2XV4S 3IWZA 5ERIA 1UFMA 2F5EA 1TNSA 4U88A 3F8MA 4EJOA 4M9ZA 2EK5A 2ZJ2A 4A5NA 1XDSA 5L3DA 2DFIA 4ZYGA 1Z9CA 1UB9A 3I5UA 4BHCA 1SFUA 1S3JA 2UZKA 1T39A 1TQPA 2KJCA 3ZMSA 3L7WA 1S7OA 4RAZA 2VC1A 3CLOA 5F1RA 3E5XA 4H0EA 5FD6A 1H0MA 2P5KA 5DD4A 1BIAA 4Z2YA 3KP5A 1I1GA 2OQGA 3LA3A 2H6BA 5CVVA 1W4MA 3E97A 4AIHA 2BBYA 2IW5A 2BEOA 1KQ9A 5HLIA 3NQOA 5AIQA 3ROUA 3DP7A 5DCMB 4A6DA 1BC7C 5BPDA 3HHGA 4HLYA 4MTDA 4JBAA 3BJ6A 3V7CA 2MA3A 2R7DA 2GAUA 2UXXA 2O6GE 4UXNA 5HDKA 5FB2A 2YU3A 3ELKA 5IT9K 2E7XA 3Q9SA 3RKWA 3KP3A 1BM9A 3WTTC 4ENJA 5AIPA 1TLHB 2JSCA 3J7AO 5LLQA 3C7JA 5DYMA 4IHSA 1WI9A 1SMYF 4EV0A 3HYIA 2V79A 1FYLA 1R36A 1BI3A 2MH2A 5HS9A 1YW7A 4KNYA 1O3RA 4HYEA 3LSTA 2HDCA 2VC0A 4AIJA 2LF7A 3PFIA 3L2CA 3WU0A 3WTSC 3LFKA 5D6FA 3I71A 1R1VA 4WF2A 3KZZA 1SFXA 1XGOA 1P6RA 1XMKA 4YFXF 2FMYA 1G3TA 4N9IA 5FLXZ 1REPC 2EV6A 4A0XA 1HBXG 4O3MA 1H9GA 4LLLA 2MLKA 1STZA 2A68F 3IWFA 2HR3A 1R22A 2NAZA 3FMRA 4RGUA 5A2QZ 3BROA 4B09A 4ZZDA 1IXRC 2L01A 1UHWA 4HOBA 4LLNA 3SZPA 4M9XA 4ENNA 3ABUA 1NHAA 1YYVA 2HWVA 3EDPA 4G6DA 2WTEA 2ZMEB 4AD9A 5DUIA 4G7ZF 2O03A 1P4XA 1QZYA 1PUEE 4RGRA 5L3CA 3J80K 1IN6A 3ZMDA 1XGSA 4LLGF 2EA4A 2OAZA 2RKHA 5HS7A 4OIQF 2VN2A 4P96A 3LA7A 2J5OA 1R58A 4IJAA 2DK5A 2O61A 3P7NA 5HDGA 5E1WA 3MQ0A 5JVTA 3QRFF 4LJZF 2P5LC 4Y13A 1WQ2A 3TO7A 1YS7A 2HQNA 2QBYB 4N9HA 3U2RA 1FSEA 2NYXA 2D1VA 2F5FA 4HBLA 4CICA 1R5HA 3E5QA 4RB0A 2HKXA 3TDUC 2DI3A 4UV8A 5FD5A 4OMZA 5BMZA 2Z5UA 3CUQB 4KICA 3NEUA 4L18B 3M7GA 5DD8A 1F1ZA 1G3SA 2Z9OA 1SD7A 3I58A 5CVUA 4EM1A 5L3FA 3REOA 3FMQA 3FXRA 1W7PA 5J8CA 4A2UA 1XCBA 3F23A 4PGHA 3K69A 3WTWC 2ESNA 2CGPA 4PGGA 2MLGA 2XAFA 2VT3A 4NHJA 2XAGA 2QBYA 3COAC 1GXQA 4ZYDA 1KYZA 4OIRF 3EETA 1LNWA 2KRFA 5E1XA 3JTGA 2PMHA 3E6CC 2H09A 4HF0A 2CO5A 1FY7A 1MJBA 2CG4A 4LGWA 1W7PD 4UHTA 2ACJA 3M9AA 4HQMA 5K1YA 3HRTA 3ECOA 3K9TA 3ML6A 4UNOA 1T6SA 2P4WA 2QENA 2VBXA 4XLNF 1O3QA 2EFNA 1I1SA 1XSXA 3GLXA 2VE8A 5ICCA 2VBYA 1O3SA 2M45A 1Z91A 5ILVA 3D5LA 1B1BA 3IKVA 1FPQA 2EV0A 2XGXA 1ON1A 2STWA 1JXSA 1Y0UA 1FP2A 5K5RA 1DPRA 1Z7UA 2V1XA 3K2ZA 4WWCA 3CO7C 1PP8F 3P9CA 1U5TC 2FSWA 3PQJA 4KFCA 4MEXF 2W84A 3ABTA 3TGNA 3GFJA 4U0YA 5FLXK 2HYGD 2EA2A 4D0PA 4LG0A 5BS6A 2OZUA 2F5CA 3SQNA 3EYIA 2LDUA 1BBYA 1U5TA 1TTYA 1XGMA 2V1DA 4G7HF 1RI7A 2HGCA 2RC4A 4RS8A 4UVCA 5LHHA 3H3ZA 2YPRA 2DLLA 3L09A 3QU3A 1FP1D 3JW4A 1ZGAA 3FZVA 1KYWA 1D8KA 4CHUA 2VBWA 2L54A 1K79A 1TNTA 1ODDA 1LB2A 2XAHA 1G4DA 3NRVA 3WGGA 4HDUA 1MDMA 4RB2C 4FX4A 1WKMA 2DT5A 4KIGA 4IPAA 4ETSA 1E2XA 2GA1A 1J7KA 4O6JA 2WWYA 1A04A 4A12A 1YFHA 1R1TA 2CQKA 3CTAA 2OQRA 2Q2EA 2QM3A 4FT8A 3LQRA 3HRMA 2A69F 1O7LA 5E17F 5LGUA 3C18A 5CVJA 5LHIA 3ZPLA 2EV5A 3CDHA 1AOYA 5LGTA 3DPTA 4KN4X 1RUOA 1P4AA 3LA2A 2DQRA 5ILSA 4Q47A 2XHKA 3I4PA 3QP6A 4ZH4F 2RV8A 5FFZA 1HKSA 1Z6RA 5KVRA 4L9JA 4Q5SF 4WK8F 2P6TA 5DEQA 1SFEA 4KA4A 3V7RA 4ZZLA 1X3UA 2EB7A 2FRHA 1W5TA 4RGSA 2G7HA 3TDZC 1YTYA 4PZJA 2IT0A 1O7FA 2ZNZA 1RZ4A 4ZYEA 4I2OA 1I6XA 4PCQA 1FZPB 2LNBA 4KIFA 3KP6A 5TJJA 2OA4A 3L9FA 1LJ9A 3GUDA 3KZYA 2PQ8A 4HW0A 2DK8A 4YFKF 1Z6TA 2R7FA 3BJAA 3D0SA 4TV7A 4RB3C 4L9NA 2UXNA 1YW8A 3HIFA 1T98A 2E1CA 1OYWA 4WXDA 1IN4A 3R0JA 2BYVE 3MFKA 2DW4A 4NB5A 2IA1A 1HW2A 4IRGA 3I0TA 1R00A 4EM0B 3R0AA 3M1EA 1FT9A 1FNNA 2RN7A 3T5XA 5HS8A 5IT3A 3L00A 4ASNA 1J0RA 1G3YA 1TQMA 3QAHA 1HW5A 3FXQA 3ZMTA 3R60A 2DTRA 4IRHA 5L3BA 4R1HA 2VODA 4G7OF 2JTVA 3GXOA 1RUNA 4DQ2A 2A61A 4EVIA 1U5TB 2NS0A 5LRSA 3WGIA 2Y0MA 2XAJA 4I0BA 3DFGA 4EGYA 3F8FA 4BHBA 5HLGA 4KMFA 4MTEA 5D6EA 3E5UA 2GZWA 1O3TA 2BV6A 4HLXA 2QLZA 3SHFA 3FX3A 2FF4A 3QPTA 3GEZA 3ERED 1YIOA 3MEXA 3DPLC 3V8KA 3GW2A 1JHFA 2K4JA 4S04A 3GZ5A 2D1HA 3IC7A 4MNUA 2PEXA 1F4KA 1H9TA 4CXFA 2L4AA 1LEAA 4BAYA 3WTZA 1LDJA 1T2KA 5D4SA 4OOIA 3GO5A 4XSXF 5JFRA 3WTUC 3I59A 4QWQA 1U6GA 3O3KA 4O5VA 3V7SA 3E6DA 5H20A 1QBJA 3KFWX 4F7ZA 2CYYA 3HSEA 3GWZA 1T0FA 3ZMZA 3RJPA 2OBPA 1IZ1A 1ZGJA 3TKYA 1ZARA 2YR2A 1I27A 4Y17A 2DU9A 1L0OC 3CUQC 4UVBA 2H94A 4EJUA 1PDNC 2HKOA 2Y75A 4Y15A 3HHHA 3VB2A 5L3EA 1LEBA 4EJVA 2M87A 2ZNYA 2M1BA 2QZ8A 4MQ9F 4R79A 4A0ZA 4MGRA 3RI4A 3HSFA 2XKPA 4BXUA 4BYYA 5CYVA 3F22A 2KIUA 5F64A 1DDNA 1VTNC 2FMLA 3PQKA 3S2WA 2A5YB 1HW1A 3KE2A 4XSZF 1MKMA 1LDKB 5BPIA 1EH6A 4MQVA 2V6CA 3N97A 1FYMA 4S05A 2Q8KA 4OINF 1OKRA 4EJTA 2W57A 4UV9A 3P9KA 2HFHA 1V4RA 4WXCA 1ZH5A 4M6XA 2UWMA 5LBQA 2GXGA 5K5QA 3KLOA 4KMUX 2PLYA 1D8JA 2HZTA 2VOOA 2KKOA 4M6YA 3WTXC 4L9TA 3KETA 1MGTA 4PDKA 3E6BA 4R8HA 4DNCA 3I54A 1Q1HA 3ZMVA 5E8GA 2PG4A 4L0ZB 5KK1A 2BGCA 4JK1X 5CVIA 2DPUA 1IN5A 3EUHA 4HX8A 3RIRA 1MZBA 2QUFA 2XROA 3SXYA 3FMSA 1B6AA 1B4AA 1I5ZA 2IA0A 3GYHX 1RNLA 2MBFA 4HZFA 1MJAA 3WODF 3BZ6A 3HSRA 2XAQA 3WE3A 1U8RA 4KDPA 2XUBA 2YX4A 5CLSA 3C1DA 3K0LA 2LSOA 4BNCA 4M9SA 4P9UA 2PFBA 5L3GA 2NRAC 4YIIA 5HOOA 1TW3A 1Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKT A;  2QQA A;  4ON0 A;  3ZP5 A;  4ENM A;  3F8N A;  1SAX A;  2LF8 A;  3MWM A;  2OZ6 A;  4OIO F;  2A6H F;  1F5T A;  1LVA A;  2JPB A;  3LAJ A;  1ZRD A;  1IAW A;  2V9V A;  3IL2 A;  2WC2 A;  4LFU A;  5E20 A;  5LRR A;  5LEJ A;  3JSP A;  2LKP A;  1SD4 A;  2RDP A;  2AS5 F;  2GXB A;  4LK1 F;  1AWC A;  2Z3Y A;  1GHC A;  2QYO A;  1FYK A;  3VEP A;  1KQ0 A;  4CGZ A;  4HV5 A;  1HKT A;  1XCV A;  4BH9 A;  2HYF A;  3V4G A;  1D5V A;  1YG2 A;  1YLF A;  4OIP F;  1ZG3 A;  2NNY A;  3JTH A;  4I02 A;  2HEO A;  4KT5 C;  3CUQ A;  4LK0 F;  2R3S A;  1QGP A;  3Q5F A;  3FWE A;  4ESJ A;  3C3W A;  4LG0 B;  1S8N A;  2G7U A;  3ZMU A;  2NNN A;  4FX0 A;  1XN7 A;  1BJA A;  5D8L B;  2EFQ A;  3RPU A;  2RGV A;  3H92 A;  3RYP A;  1TW2 A;  2MH9 A;  3O6B B;  2P6S A;  1DP7 P;  4K2E A;  1FX7 A;  2L4M A;  3WTY C;  2ZME A;  4GO1 A;  3BY6 A;  1K78 A;  1YW9 A;  1GVJ A;  4RAY A;  4CYD A;  1IRG A;  3TOB A;  1XGN A;  3QP5 A;  5JR3 A;  3E6M A;  4N0B A;  1WWX A;  2W25 A;  1MDM B;  5E18 F;  3GFM A;  1CF7 B;  2FA5 A;  4G6Q A;  1FBU A;  4HV6 A;  2PJP A;  3CO6 C;  4I09 A;  3ZN1 A;  3H3U A;  2AXL A;  2FU4 A;  1YO5 C;  2IJL A;  1R1U A;  1K78 B;  3N4M A;  2P7C B;  4YG2 F;  2V1U A;  1EH8 A;  3KP2 A;  5AON A;  1UHM A;  2QWW A;  1QZZ A;  1XSD A;  4MHG A;  1HSJ A;  3IRQ A;  4IHT A;  4IF4 A;  1OPC A;  4BHP A;  1SMT A;  1BC8 C;  2M8E A;  2JT1 A;  4P5O A;  3O2P E;  1JHH A;  2HTJ A;  5TRD A;  3BPV A;  2QQ9 A;  3OOP A;  5HLH A;  4Q48 A;  2FBK A;  2ZBK A;  3KLN A;  1ZAO A;  3GZ6 A;  1FC3 A;  1UST A;  4IXA A;  2MD5 A;  2Y48 A;  5H6Q A;  2ELH A;  3ULQ B;  4G8X A;  3F3X A;  2IVM A;  4U0W A;  4M73 A;  3F8C A;  5DCF A;  3E3V A;  1YS6 A;  3MAJ A;  3FM5 A;  5D5U B;  4HF1 A;  4KYW A;  4XRF A;  1W7P B;  2KJB A;  1FBQ A;  2X4H A;  4G94 A;  3RPQ A;  3KCC A;  4MEY F;  2H6C A;  3RKY A;  1S6L A;  1XD7 A;  4U7D A;  2EFO A;  1P92 A;  2VOP A;  2ETH A;  1WRJ A;  2K02 A;  3LQQ A;  3OV8 A;  4L9V A;  5ICE A;  2EFW A;  3B02 A;  4AVP A;  3U9G A;  3FF5 A;  1KU7 A;  1C0W A;  3VFZ A;  2X0L A;  1USS A;  2FNP A;  2IP2 A;  5D5X B;  1U78 A;  2COM A;  3M8E A;  3DXJ F;  1ZG1 A;  5K5O A;  2HTS A;  1MD0 A;  4M71 A;  5DDG A;  2J5P A;  2EWN A;  3T1B A;  3JSO A;  1ON2 A;  3QPH A;  2P5V A;  3WU1 B;  3V8J A;  1J2X A;  3G73 A;  2OU2 A;  3R61 A;  2F5D A;  4E70 A;  1IF1 A;  3JAM Z;  1JGS A;  5J6X A;  2ESH A;  2F2E A;  1L3L A;  4U7B A;  1SD5 A;  2KIM A;  4KIB A;  1ZYR F;  2RVC A;  2A6E F;  4GGG A;  2W85 A;  1DUX C;  4LB5 A;  1ZRC A;  1KU3 A;  1LQ1 A;  4IVN A;  3I64 A;  3BJO A;  4IRI A;  5E8I A;  2FNA A;  3ISP A;  2HS5 A;  2P7V B;  2WV0 A;  1B9M A;  3FM3 A;  4CO8 A;  1OYY A;  2IA2 A;  3MZH A;  4HQE A;  5J8F A;  1K7A A;  2GWR A;  4EM2 A;  3ZQ7 A;  4M72 A;  1XMA A;  1B59 A;  1CF7 A;  2KIF A;  3I53 A;  2B0L A;  2W24 A;  2BE5 F;  2DQL A;  1R5G A;  2D2W A;  4G9Y A;  5CVR A;  1XB4 A;  4EMS A;  3GVA A;  2FBH A;  3DEU A;  1SD6 A;  4B8X A;  3T8T A;  1FSH A;  1K6O A;  1ONV A;  4OU0 A;  3T0Y A;  1KA8 A;  2XRN A;  3WGH A;  4Q4Z F;  1CGP A;  5LGN A;  5BQT A;  5DCM A;  2DPD A;  4LMY A;  1LDD A;  3K1M A;  4BQA A;  2GIV A;  2A07 F;  2FOK A;  3EYY A;  2TDX A;  1ZRE A;  1BI1 A;  3RDI A;  5ICG A;  2OD5 A;  3VOE A;  3M8F A;  3AAF A;  2ISZ A;  1QPM A;  2CFX A;  2VT2 A;  2YSR A;  2E7W A;  2FEZ A;  2ISY A;  2QQB A;  3LAP A;  2VXZ A;  2L3D A;  5LHG A;  4CDG A;  1OMI A;  4ZYH A;  3GFI A;  3MCZ A;  3HTU A;  3R4K A;  2VBZ A;  3JAM K;  5ED4 A;  5E1Z B;  4LB6 B;  1UCR A;  2C6Y A;  1QNT A;  4KN7 X;  1QQI A;  3F72 A;  4HX4 A;  3GFL A;  1BI2 A;  2XIG A;  3F21 A;  1ULY A;  4JQF A;  3HUG A;  1F9N A;  5FGM A;  3T8R A;  4KUM A;  1ZG5 A;  1P4W A;  2IPQ X;  3B73 A;  5ICF A;  2ZKZ A;  1OYI A;  1FWZ A;  2EFP A;  3TO6 A;  2FXA A;  3J80 Z;  3K1P A;  3FHZ A;  1BN5 A;  1BI0 A;  2L02 A;  3BOQ A;  4P55 A;  3Q9V A;  1IW7 F;  1G6N A;  3GF2 A;  5DUK A;  5FFX A;  1E17 A;  3P9I A;  2Z99 A;  1S29 A;  4I01 A;  1V3F A;  1KGS A;  1R7J A;  3IRR A;  4HF2 A;  5A2Q K;  3DV8 A;  1BOA A;  1ZN2 A;  1PP7 U;  3F6V A;  1HKQ A;  3DF8 A;  2O3F A;  5FO5 A;  4HA8 A;  3KEQ A;  2O0Y A;  2RQP A;  3GX4 X;  2CSO A;  4FHT A;  4LD5 A;  4WXH A;  2Q0O A;  1TQI A;  1Z1D A;  1QO0 D;  4WCG A;  2DAO A;  1U3E M;  3KEO A;  4A6E A;  1O57 A;  2STT A;  1JE8 A;  3SFZ A;  2VE9 A;  5LEK A;  3LWF A;  1EH7 A;  2ZO4 A;  5D5W B;  3G3Z A;  2CW0 F;  4L5J A;  2P8T A;  2G9W A;  5HDN A;  4L0Y B;  3V8L A;  1GXP A;  3BPX A;  4XBF A;  3W6J B;  3HOS A;  6PAX A;  3BDD A;  2PN6 A;  1IUY A;  2O8X A;  1MJ9 A;  2GQQ A;  2RNJ A;  2PBI A;  3U1D A;  1IN8 A;  5D4R A;  1OR7 A;  4ENK A;  2HQR A;  4A5M A;  4ESB A;  2IRF G;  1W5S A;  2ZFW A;  4UVA A;  1R23 A;  3RKX A;  4YIF A;  5EEG A;  3F8B A;  5H6R A;  1KU2 A;  2JZY A;  2XAS A;  2EJR A;  2JPC A;  2ZCW A;  3TO9 A;  5JI6 A;  1J75 A;  3CJN A;  5IT9 Z;  4YFN F;  1FBS A;  1WSU A;  1IXS B;  2FQ3 A;  5DV5 A;  1DPU A;  3KP7 A;  1S7A A;  4P9F A;  2XKO A;  4ESF A;  2MC3 A;  5HVQ C;  3VOD A;  4GXO A;  2JRT A;  2HOE A;  4OMY A;  2YX7 A;  1IXC A;  5D8K B;  2K7L A;  1KU9 A;  1XDU A;  2M30 A;  2A3S A;  3HOT A;  3W6K B;  2PMU A;  4M74 A;  1T38 A;  3IHU A;  1IN7 A;  4RGX A;  4QLC U;  2K4B A;  4GYG A;  2E1N A;  4GCV A;  3I59 B;  4I7H A;  4WX9 A;  1FOK A;  3TOA A;  2FE3 A;  4EGZ A;  1ZLK A;  5JHU A;  1J5Y A;  4HAM A;  5CJ9 A;  1HQC A;  3MZY A;  3QOP A;  1KQ8 A;  1YQA A;  3FXU A;  3HRS A;  3HTS B;  3F6O A;  2GA2 A;  1BIB A;  1B9N A;  1J9I A;  1ZHF A;  3ECH A;  5F6F A;  2CWE A;  2DO7 A;  3HRU A;  1FLI A;  1EV7 A;  2PI0 A;  1IRF A;  3CUO A;  2ZXJ A;  5ILU A;  3SZT A;  4U0V A;  2H27 A;  3K1N A;  1J59 A;  3J81 K;  3RYR A;  3RTR A;  1XSV A;  1ZLJ A;  2FBI A;  4EQQ A;  5D5V B;  4CZZ A;  3BWG A;  5EEH A;  1TBX A;  3BP8 A;  2K27 A;  1G3W A;  3R6S A;  1D3Y A;  3DQV C;  1HST A;  4EJW A;  4HDV A;  2ADU A;  2Z33 A;  4I0A A;  1ZRF A;  3WTV C;  3WG9 A;  3ZN0 A;  2VON A;  4RB1 A;  1U2W A;  4I98 B;  1P2F A;  1HXD A;  2K86 A;  4A0Y A;  5BOX A;  3TQN A;  2M5W A;  4GYI A;  2DBB A;  3WE2 A;  3DKW A;  4UUV A;  4XLP F;  4HX7 A;  3EQL F;  2XVC A;  3J81 Z;  2QVO A;  3QU6 A;  4L5I A;  4NQW A;  4AIK A;  1RIO H;  4AWX B;  2D45 A;  3KP4 A;  2XV4 S;  3IWZ A;  5ERI A;  1UFM A;  2F5E A;  1TNS A;  4U88 A;  3F8M A;  4EJO A;  4M9Z A;  2EK5 A;  2ZJ2 A;  4A5N A;  1XDS A;  5L3D A;  2DFI A;  4ZYG A;  1Z9C A;  1UB9 A;  3I5U A;  4BHC A;  1SFU A;  1S3J A;  2UZK A;  1T39 A;  1TQP A;  2KJC A;  3ZMS A;  3L7W A;  1S7O A;  4RAZ A;  2VC1 A;  3CLO A;  5F1R A;  3E5X A;  4H0E A;  5FD6 A;  1H0M A;  2P5K A;  5DD4 A;  1BIA A;  4Z2Y A;  3KP5 A;  1I1G A;  2OQG A;  3LA3 A;  2H6B A;  5CVV A;  1W4M A;  3E97 A;  4AIH A;  2BBY A;  2IW5 A;  2BEO A;  1KQ9 A;  5HLI A;  3NQO A;  5AIQ A;  3ROU A;  3DP7 A;  5DCM B;  4A6D A;  1BC7 C;  5BPD A;  3HHG A;  4HLY A;  4MTD A;  4JBA A;  3BJ6 A;  3V7C A;  2MA3 A;  2R7D A;  2GAU A;  2UXX A;  2O6G E;  4UXN A;  5HDK A;  5FB2 A;  2YU3 A;  3ELK A;  5IT9 K;  2E7X A;  3Q9S A;  3RKW A;  3KP3 A;  1BM9 A;  3WTT C;  4ENJ A;  5AIP A;  1TLH B;  2JSC A;  3J7A O;  5LLQ A;  3C7J A;  5DYM A;  4IHS A;  1WI9 A;  1SMY F;  4EV0 A;  3HYI A;  2V79 A;  1FYL A;  1R36 A;  1BI3 A;  2MH2 A;  5HS9 A;  1YW7 A;  4KNY A;  1O3R A;  4HYE A;  3LST A;  2HDC A;  2VC0 A;  4AIJ A;  2LF7 A;  3PFI A;  3L2C A;  3WU0 A;  3WTS C;  3LFK A;  5D6F A;  3I71 A;  1R1V A;  4WF2 A;  3KZZ A;  1SFX A;  1XGO A;  1P6R A;  1XMK A;  4YFX F;  2FMY A;  1G3T A;  4N9I A;  5FLX Z;  1REP C;  2EV6 A;  4A0X A;  1HBX G;  4O3M A;  1H9G A;  4LLL A;  2MLK A;  1STZ A;  2A68 F;  3IWF A;  2HR3 A;  1R22 A;  2NAZ A;  3FMR A;  4RGU A;  5A2Q Z;  3BRO A;  4B09 A;  4ZZD A;  1IXR C;  2L01 A;  1UHW A;  4HOB A;  4LLN A;  3SZP A;  4M9X A;  4ENN A;  3ABU A;  1NHA A;  1YYV A;  2HWV A;  3EDP A;  4G6D A;  2WTE A;  2ZME B;  4AD9 A;  5DUI A;  4G7Z F;  2O03 A;  1P4X A;  1QZY A;  1PUE E;  4RGR A;  5L3C A;  3J80 K;  1IN6 A;  3ZMD A;  1XGS A;  4LLG F;  2EA4 A;  2OAZ A;  2RKH A;  5HS7 A;  4OIQ F;  2VN2 A;  4P96 A;  3LA7 A;  2J5O A;  1R58 A;  4IJA A;  2DK5 A;  2O61 A;  3P7N A;  5HDG A;  5E1W A;  3MQ0 A;  5JVT A;  3QRF F;  4LJZ F;  2P5L C;  4Y13 A;  1WQ2 A;  3TO7 A;  1YS7 A;  2HQN A;  2QBY B;  4N9H A;  3U2R A;  1FSE A;  2NYX A;  2D1V A;  2F5F A;  4HBL A;  4CIC A;  1R5H A;  3E5Q A;  4RB0 A;  2HKX A;  3TDU C;  2DI3 A;  4UV8 A;  5FD5 A;  4OMZ A;  5BMZ A;  2Z5U A;  3CUQ B;  4KIC A;  3NEU A;  4L18 B;  3M7G A;  5DD8 A;  1F1Z A;  1G3S A;  2Z9O A;  1SD7 A;  3I58 A;  5CVU A;  4EM1 A;  5L3F A;  3REO A;  3FMQ A;  3FXR A;  1W7P A;  5J8C A;  4A2U A;  1XCB A;  3F23 A;  4PGH A;  3K69 A;  3WTW C;  2ESN A;  2CGP A;  4PGG A;  2MLG A;  2XAF A;  2VT3 A;  4NHJ A;  2XAG A;  2QBY A;  3COA C;  1GXQ A;  4ZYD A;  1KYZ A;  4OIR F;  3EET A;  1LNW A;  2KRF A;  5E1X A;  3JTG A;  2PMH A;  3E6C C;  2H09 A;  4HF0 A;  2CO5 A;  1FY7 A;  1MJB A;  2CG4 A;  4LGW A;  1W7P D;  4UHT A;  2ACJ A;  3M9A A;  4HQM A;  5K1Y A;  3HRT A;  3ECO A;  3K9T A;  3ML6 A;  4UNO A;  1T6S A;  2P4W A;  2QEN A;  2VBX A;  4XLN F;  1O3Q A;  2EFN A;  1I1S A;  1XSX A;  3GLX A;  2VE8 A;  5ICC A;  2VBY A;  1O3S A;  2M45 A;  1Z91 A;  5ILV A;  3D5L A;  1B1B A;  3IKV A;  1FPQ A;  2EV0 A;  2XGX A;  1ON1 A;  2STW A;  1JXS A;  1Y0U A;  1FP2 A;  5K5R A;  1DPR A;  1Z7U A;  2V1X A;  3K2Z A;  4WWC A;  3CO7 C;  1PP8 F;  3P9C A;  1U5T C;  2FSW A;  3PQJ A;  4KFC A;  4MEX F;  2W84 A;  3ABT A;  3TGN A;  3GFJ A;  4U0Y A;  5FLX K;  2HYG D;  2EA2 A;  4D0P A;  4LG0 A;  5BS6 A;  2OZU A;  2F5C A;  3SQN A;  3EYI A;  2LDU A;  1BBY A;  1U5T A;  1TTY A;  1XGM A;  2V1D A;  4G7H F;  1RI7 A;  2HGC A;  2RC4 A;  4RS8 A;  4UVC A;  5LHH A;  3H3Z A;  2YPR A;  2DLL A;  3L09 A;  3QU3 A;  1FP1 D;  3JW4 A;  1ZGA A;  3FZV A;  1KYW A;  1D8K A;  4CHU A;  2VBW A;  2L54 A;  1K79 A;  1TNT A;  1ODD A;  1LB2 A;  2XAH A;  1G4D A;  3NRV A;  3WGG A;  4HDU A;  1MDM A;  4RB2 C;  4FX4 A;  1WKM A;  2DT5 A;  4KIG A;  4IPA A;  4ETS A;  1E2X A;  2GA1 A;  1J7K A;  4O6J A;  2WWY A;  1A04 A;  4A12 A;  1YFH A;  1R1T A;  2CQK A;  3CTA A;  2OQR A;  2Q2E A;  2QM3 A;  4FT8 A;  3LQR A;  3HRM A;  2A69 F;  1O7L A;  5E17 F;  5LGU A;  3C18 A;  5CVJ A;  5LHI A;  3ZPL A;  2EV5 A;  3CDH A;  1AOY A;  5LGT A;  3DPT A;  4KN4 X;  1RUO A;  1P4A A;  3LA2 A;  2DQR A;  5ILS A;  4Q47 A;  2XHK A;  3I4P A;  3QP6 A;  4ZH4 F;  2RV8 A;  5FFZ A;  1HKS A;  1Z6R A;  5KVR A;  4L9J A;  4Q5S F;  4WK8 F;  2P6T A;  5DEQ A;  1SFE A;  4KA4 A;  3V7R A;  4ZZL A;  1X3U A;  2EB7 A;  2FRH A;  1W5T A;  4RGS A;  2G7H A;  3TDZ C;  1YTY A;  4PZJ A;  2IT0 A;  1O7F A;  2ZNZ A;  1RZ4 A;  4ZYE A;  4I2O A;  1I6X A;  4PCQ A;  1FZP B;  2LNB A;  4KIF A;  3KP6 A;  5TJJ A;  2OA4 A;  3L9F A;  1LJ9 A;  3GUD A;  3KZY A;  2PQ8 A;  4HW0 A;  2DK8 A;  4YFK F;  1Z6T A;  2R7F A;  3BJA A;  3D0S A;  4TV7 A;  4RB3 C;  4L9N A;  2UXN A;  1YW8 A;  3HIF A;  1T98 A;  2E1C A;  1OYW A;  4WXD A;  1IN4 A;  3R0J A;  2BYV E;  3MFK A;  2DW4 A;  4NB5 A;  2IA1 A;  1HW2 A;  4IRG A;  3I0T A;  1R00 A;  4EM0 B;  3R0A A;  3M1E A;  1FT9 A;  1FNN A;  2RN7 A;  3T5X A;  5HS8 A;  5IT3 A;  3L00 A;  4ASN A;  1J0R A;  1G3Y A;  1TQM A;  3QAH A;  1HW5 A;  3FXQ A;  3ZMT A;  3R60 A;  2DTR A;  4IRH A;  5L3B A;  4R1H A;  2VOD A;  4G7O F;  2JTV A;  3GXO A;  1RUN A;  4DQ2 A;  2A61 A;  4EVI A;  1U5T B;  2NS0 A;  5LRS A;  3WGI A;  2Y0M A;  2XAJ A;  4I0B A;  3DFG A;  4EGY A;  3F8F A;  4BHB A;  5HLG A;  4KMF A;  4MTE A;  5D6E A;  3E5U A;  2GZW A;  1O3T A;  2BV6 A;  4HLX A;  2QLZ A;  3SHF A;  3FX3 A;  2FF4 A;  3QPT A;  3GEZ A;  3ERE D;  1YIO A;  3MEX A;  3DPL C;  3V8K A;  3GW2 A;  1JHF A;  2K4J A;  4S04 A;  3GZ5 A;  2D1H A;  3IC7 A;  4MNU A;  2PEX A;  1F4K A;  1H9T A;  4CXF A;  2L4A A;  1LEA A;  4BAY A;  3WTZ A;  1LDJ A;  1T2K A;  5D4S A;  4OOI A;  3GO5 A;  4XSX F;  5JFR A;  3WTU C;  3I59 A;  4QWQ A;  1U6G A;  3O3K A;  4O5V A;  3V7S A;  3E6D A;  5H20 A;  1QBJ A;  3KFW X;  4F7Z A;  2CYY A;  3HSE A;  3GWZ A;  1T0F A;  3ZMZ A;  3RJP A;  2OBP A;  1IZ1 A;  1ZGJ A;  3TKY A;  1ZAR A;  2YR2 A;  1I27 A;  4Y17 A;  2DU9 A;  1L0O C;  3CUQ C;  4UVB A;  2H94 A;  4EJU A;  1PDN C;  2HKO A;  2Y75 A;  4Y15 A;  3HHH A;  3VB2 A;  5L3E A;  1LEB A;  4EJV A;  2M87 A;  2ZNY A;  2M1B A;  2QZ8 A;  4MQ9 F;  4R79 A;  4A0Z A;  4MGR A;  3RI4 A;  3HSF A;  2XKP A;  4BXU A;  4BYY A;  5CYV A;  3F22 A;  2KIU A;  5F64 A;  1DDN A;  1VTN C;  2FML A;  3PQK A;  3S2W A;  2A5Y B;  1HW1 A;  3KE2 A;  4XSZ F;  1MKM A;  1LDK B;  5BPI A;  1EH6 A;  4MQV A;  2V6C A;  3N97 A;  1FYM A;  4S05 A;  2Q8K A;  4OIN F;  1OKR A;  4EJT A;  2W57 A;  4UV9 A;  3P9K A;  2HFH A;  1V4R A;  4WXC A;  1ZH5 A;  4M6X A;  2UWM A;  5LBQ A;  2GXG A;  5K5Q A;  3KLO A;  4KMU X;  2PLY A;  1D8J A;  2HZT A;  2VOO A;  2KKO A;  4M6Y A;  3WTX C;  4L9T A;  3KET A;  1MGT A;  4PDK A;  3E6B A;  4R8H A;  4DNC A;  3I54 A;  1Q1H A;  3ZMV A;  5E8G A;  2PG4 A;  4L0Z B;  5KK1 A;  2BGC A;  4JK1 X;  5CVI A;  2DPU A;  1IN5 A;  3EUH A;  4HX8 A;  3RIR A;  1MZB A;  2QUF A;  2XRO A;  3SXY A;  3FMS A;  1B6A A;  1B4A A;  1I5Z A;  2IA0 A;  3GYH X;  1RNL A;  2MBF A;  4HZF A;  1MJA A;  3WOD F;  3BZ6 A;  3HSR A;  2XAQ A;  3WE3 A;  1U8R A;  4KDP A;  2XUB A;  2YX4 A;  5CLS A;  3C1D A;  3K0L A;  2LSO A;  4BNC A;  4M9S A;  4P9U A;  2PFB A;  5L3G A;  2NRA C;  4YII A;  5HOO A;  1TW3 A;  1Z05 A; 
#chains in the Genus database with same CATH topology
 3IKT A;  2QQA A;  4ON0 A;  2LTP A;  4D5C A;  3ZP5 A;  4ENM A;  3F8N A;  1X4O A;  3DWL E;  2XGD A;  4BJ6 C;  2EIK H;  4DYC A;  4BEH B;  1FMV A;  1SAX A;  2LF8 A;  3A4C A;  2KLO A;  3MWM A;  2OZ6 A;  4OIO F;  2A6H F;  2HOA A;  1F5T A;  5F04 A;  1LVA A;  2JPB A;  2HNH A;  3LAJ A;  1ZRD A;  1IAW A;  1AA7 A;  1GDT A;  3ZXS A;  4PJM A;  2VQL A;  5FKM A;  4CH7 A;  3S1R J;  3HJE A;  4RA2 A;  3Q0U A;  5EGO A;  1I39 A;  2V9V A;  3IL2 A;  2WC2 A;  4LFU A;  5E20 A;  5LRR A;  5LEJ A;  3JSP A;  2LKP A;  1SD4 A;  2RDP A;  1D0Y A;  2AS5 F;  1N75 A;  2HI3 A;  2GXB A;  5F27 A;  4DW6 A;  1XS9 A;  4LK1 F;  2XSJ C;  1AWC A;  4IHV A;  2Z3Y A;  3IV5 A;  1GHC A;  2QYO A;  1FYK A;  1BA5 A;  5FLV A;  3A02 A;  3G71 I;  3VEP A;  2M9H A;  1KQ0 A;  1HLV A;  3ZGK A;  4CGZ A;  4HV5 A;  1HKT A;  2BY3 A;  2ELK A;  1XCV A;  2GLO A;  3K70 D;  4ITV A;  1W36 D;  4BH9 A;  4NDL A;  4FQG A;  1D0X A;  2BHZ A;  2HYF A;  3C2B A;  2K9Q A;  2LH9 A;  3V4G A;  1D5V A;  1YG2 A;  1YLF A;  4OIP F;  1ZG3 A;  2NNY A;  1EA3 A;  3JTH A;  4I02 A;  2HEO A;  4KT5 C;  3L2W A;  5FLM J;  3CUQ A;  4LK0 F;  2R3S A;  1QGP A;  3A03 A;  3Q5F A;  3CCE I;  3FWE A;  1GUU A;  4ESJ A;  3M1C A;  2R4G A;  3FXL A;  1A6I A;  3C3W A;  5GAD J;  4Y7N J;  4XLE A;  4LG0 B;  1S8N A;  2G7U A;  3ZMU A;  1A6Q A;  2NNN A;  2AO9 A;  2PMZ N;  4FX0 A;  1XN7 A;  1BJA A;  5D8L B;  2E35 A;  3K4J A;  2BXY A;  2EFQ A;  2KZV A;  3RPU A;  3RZD J;  4HG2 A;  1RR7 A;  4D5F A;  3JCU C;  2RGV A;  1AKH B;  3H92 A;  3RYP A;  1TWA J;  1TW2 A;  2KRH A;  3VSK A;  2DCE A;  2MH9 A;  2R5Y A;  5F0H A;  3CCY A;  3O6B B;  1Z67 A;  2P6S A;  2CV2 A;  1DP7 P;  4K2E A;  1FX7 A;  3DBR B;  3PL8 A;  2L4M A;  5IYD J;  4Z6Y A;  3WTY C;  1VQP I;  2ID6 A;  2ZME A;  2LBF B;  3IH2 A;  1YRN A;  4GO1 A;  3BY6 A;  1K78 A;  5EYR A;  2RAE A;  1YW9 A;  1GVJ A;  4XLC A;  4RAY A;  4G6T B;  4CYD A;  4JP0 A;  2IGK A;  2TRT A;  1I50 J;  1IRG A;  3TOB A;  3GTG J;  2E2H J;  1ETO A;  3PM1 A;  3MKZ A;  1FMW A;  2L7F P;  1XGN A;  2QQ8 A;  3QP5 A;  1X1B A;  3TW6 A;  3K4M A;  5KCM A;  2HOS A;  1OLT A;  2KIQ A;  5JR3 A;  2CQQ A;  2Y31 A;  1Y6I A;  2R7O A;  3E6M A;  4N0B A;  5DS9 A;  5DM6 F;  1WWX A;  2DMU A;  3OR2 C;  1A31 A;  2W25 A;  1MDM B;  5E18 F;  2XGE A;  3H1C A;  2ELJ A;  3N05 A;  3H5N A;  1G2H A;  3GFM A;  1CF7 B;  2FA5 A;  2VPR A;  4QIW N;  3KYC B;  4G6Q A;  3L1P A;  4I6Z A;  1FBU A;  4HV6 A;  5JLX A;  3W2W A;  3ZCO A;  2PJP A;  3CO6 C;  4F52 A;  2DA7 A;  2O7O A;  3OIQ A;  4E7Z A;  4OWR B;  4I09 A;  3ZN1 A;  3H3U A;  5GTH C;  1JUS A;  1SVO A;  2AXL A;  2FU4 A;  5CPR B;  1YO5 C;  3PO2 J;  2IJL A;  2VKE A;  1R1U A;  2GOX B;  1K78 B;  1VI0 A;  3G1M A;  3OYN A;  3N4M A;  3HOZ J;  1Y8Q B;  2P7C B;  4YG2 F;  2V1U A;  1EH8 A;  2F4M B;  3KP2 A;  5AON A;  1UHM A;  2QWW A;  3U21 A;  1QZZ A;  4XID A;  4F92 B;  3QPL A;  3H36 A;  3IH4 A;  2VLA A;  1XSD A;  1D1B A;  3BZC A;  1OCR H;  4MHG A;  3ZR8 X;  5IY5 H;  2R7Z J;  2O9L A;  1HSJ A;  2VJJ A;  1G59 A;  3IRQ A;  4IHT A;  4IF4 A;  4DGW B;  1OPC A;  4CYC B;  2JN6 A;  3BTJ A;  4BHP A;  1TP4 A;  3CF5 F;  1BR1 A;  1SMT A;  1BC8 C;  1VQ9 I;  2M8E A;  4E7S A;  2JT1 A;  1V54 H;  4P5O A;  3PUB A;  3O2P E;  1JHH A;  2HTJ A;  5TRD A;  2AHQ A;  4F55 A;  3BPV A;  2BW3 B;  2QQ9 A;  1YX5 A;  2E5Z A;  3OOP A;  2NVQ J;  3BT9 A;  5HLH A;  4B44 A;  3PJR A;  3CCR I;  2JA2 A;  4Q48 A;  2FBK A;  3OYG A;  3CCQ I;  1E3P A;  2ZBK A;  2QSH X;  3KLN A;  4UUT A;  4IQJ A;  1ZAO A;  3GZ6 A;  4P1W A;  1SFK A;  3OMY A;  1FC3 A;  3NAU A;  3HOU J;  3G1L A;  1UST A;  4YIR X;  4IXA A;  2MD5 A;  3CC7 I;  2Y48 A;  2OTL I;  4XKV A;  2DOE A;  4HSR A;  2WB1 N;  2ELH A;  5H6Q A;  3ULQ B;  3TW7 A;  4G8X A;  3F3X A;  3DKY A;  2W82 A;  2IVM A;  4U0W A;  4BQO A;  1LFU P;  2LMD A;  4M73 A;  3F8C A;  2DDA A;  5DCF A;  3E3V A;  1YS6 A;  2E34 A;  3MAJ A;  3FM5 A;  5D5U B;  4HF1 A;  2DJN A;  4KYW A;  3NWT A;  3PUF A;  3MMY B;  1YIJ I;  1YI2 I;  4XRF A;  4B1R A;  2NOG A;  1W7P B;  3HBL A;  2KJB A;  1FBQ A;  1TL8 A;  2V7F A;  1IDZ A;  2X4H A;  4G94 A;  3RPQ A;  1NK2 P;  1QRY A;  3KCC A;  4MEY F;  2K9L A;  1XG1 A;  2H6C A;  3RKY A;  5IOY A;  3GTO J;  2PMZ A;  3OYC A;  5C4J J;  1S6L A;  2LY1 A;  1XD7 A;  4CCO A;  4U7D A;  2DOA A;  2EFO A;  1P92 A;  1FTT A;  1GT0 C;  3IP4 B;  2VOP A;  2ETH A;  2HDW A;  3W2V A;  3H5R A;  2R7T A;  1WRJ A;  2M8G X;  1VQN I;  4ZTF A;  2K02 A;  2MFZ A;  1N25 A;  3LQQ A;  3OV8 A;  2FD5 A;  4L9V A;  5ICE A;  2EFW A;  3JRG A;  3B02 A;  2CV1 A;  4BY7 J;  4AVP A;  3M07 A;  2R7W A;  5B3S H;  3U9G A;  3FF5 A;  1KU7 A;  1MNE A;  3FXK A;  3VFZ A;  1C0W A;  3Q0V A;  2X0L A;  3I56 I;  1H89 C;  1VZ0 A;  1USS A;  2FNP A;  2IP2 A;  2CFO A;  3FK7 A;  2E1O A;  5C4X J;  5D5X B;  1QHH D;  1U78 A;  2OJE D;  2LKX A;  1IV8 A;  2COM A;  3M8E A;  2HQA A;  2XB5 A;  2XRL A;  3DXJ F;  4DYQ A;  1ZG1 A;  5K5O A;  2HTS A;  5CKT A;  1MD0 A;  4M71 A;  5DDG A;  1HOM A;  1JKR C;  2J5P A;  1LKX A;  2EWN A;  1NTC A;  3T1B A;  3JSO A;  1ON2 A;  3QPH A;  4A3B J;  1X1P A;  1N78 A;  4NQW B;  3LSG A;  2V4J C;  3MN2 A;  2P5V A;  2VJI A;  3OYL A;  3WU1 B;  3V8J A;  1J2X A;  3G73 A;  1LE8 B;  1UHS A;  2OU2 A;  5EG0 B;  2QKL B;  3R61 A;  2F5D A;  1I3A A;  3TL4 X;  3BCB A;  4E70 A;  2NS8 A;  1IF1 A;  1S5L C;  4CZC A;  3JRE A;  4J19 A;  3JAM Z;  3HC7 A;  1JGS A;  5J6X A;  3G2B A;  2L9R A;  5CQE A;  2ESH A;  2Y0S A;  2F2E A;  1L3L A;  4U7B A;  1RKW A;  1VQ5 I;  4FET A;  1SD5 A;  1TWG J;  3G4S I;  3PSI A;  2WY8 Q;  2KIM A;  4KIB A;  1FEX A;  1ZYR F;  2RVC A;  2A6E F;  2IS6 A;  3Q3S A;  3RCO A;  3TMO A;  4GGG A;  4IQ4 A;  3GTP J;  5BNG A;  4CCK A;  2ZJQ F;  2W85 A;  1DUX C;  4LB5 A;  1ZRC A;  1KU3 A;  5HNF A;  1LQ1 A;  4IVN A;  2JA7 J;  3KEY A;  3CQZ J;  2WAF A;  3I64 A;  4Y3O A;  1JKQ C;  2E2J J;  4HRI A;  1MSF C;  3BJO A;  4IRI A;  2UUZ A;  5E8I A;  2FNA A;  2OV7 A;  2L9S A;  3ISP A;  2HS5 A;  2P7V B;  2W48 A;  3D5S C;  1FIA A;  1B9M A;  2WV0 A;  3FM3 A;  2ME0 A;  4CO8 A;  2AXT C;  1OYY A;  3ZQH A;  3OSF A;  2IA2 A;  3MZH A;  4HQE A;  5J8F A;  1K7A A;  2GWR A;  4EM2 A;  3ZQ7 A;  2VKV A;  3OS1 A;  2XPU A;  1QA6 A;  4M72 A;  1XMA A;  5GAE J;  1B59 A;  1CF7 A;  1RKT A;  1RES A;  2LY9 A;  2KIF A;  2WAQ A;  3I53 A;  3S1N J;  1I6H J;  2CRG A;  2NS7 A;  2B0L A;  3HPG A;  3JRB A;  4XIC A;  2W24 A;  2BE5 F;  1EJ9 A;  2DQL A;  4PJL A;  1R5G A;  2X6Y A;  2D2W A;  3AG3 H;  4G9Y A;  1LFP A;  5CVR A;  3UKG A;  1XB4 A;  4EMS A;  4XK4 A;  3E1S A;  5IOZ A;  5IPA A;  3GVA A;  2AQE A;  2FBH A;  1SD6 A;  3DEU A;  2HYJ A;  4B8X A;  4CCM A;  4KIT B;  4CYC A;  3T8T A;  1FSH A;  1K6O A;  2K9M A;  1ONV A;  2E60 A;  2R7Q A;  4OU0 A;  3T0Y A;  1KA8 A;  2ECB A;  2XRN A;  3JRA A;  1U9N A;  3WGH A;  2JVH A;  4Q4Z F;  3LSP A;  5LGN A;  5BQT A;  4XRS G;  1CGP A;  2OCC H;  5DCM A;  5E79 C;  1X1C A;  4LMY A;  2DPD A;  1LDD A;  2DTZ A;  3K1M A;  1T56 A;  1WFX A;  2GIV A;  2A07 F;  4G12 A;  4BQA A;  2FOK A;  3QOE A;  5KAF C;  4NC7 A;  3EYY A;  2TDX A;  3SZG A;  1ZRE A;  5IP7 J;  1QU3 A;  1MBG A;  4MFD A;  1BI1 A;  3RDI A;  1QHG A;  2HQ5 A;  5ICG A;  2OD5 A;  2VIX A;  3M8F A;  3VOE A;  3OYK A;  3AAF A;  1QPM A;  4D1Q A;  1SC7 A;  2ISZ A;  2CFX A;  2VT2 A;  2YSR A;  2E7W A;  2FEZ A;  1GV5 A;  2ISY A;  3SJM A;  1ZR2 A;  2QQB A;  3HPH A;  1KON A;  3LAP A;  4BS9 A;  4FE4 A;  2KQR A;  2VXZ A;  1XPX A;  2L3D A;  1R71 A;  5LHG A;  1B72 A;  3ABK H;  4CDG A;  1IJW C;  1OMI A;  4ZYH A;  1TT0 A;  4FIS A;  3GFI A;  3MCZ A;  3IAS 2;  4A3F J;  3HTU A;  3R4K A;  1X2N A;  4UUS B;  2E2I J;  2VBZ A;  3MVP A;  3JAM K;  3S93 A;  2QKM B;  5ED4 A;  1OCO H;  1TWH J;  5E1Z B;  4LB6 B;  2H8R A;  1BL0 A;  1UCR A;  4A69 C;  3K4L A;  1FIP A;  2C6Y A;  1QNT A;  3S1M J;  2DA6 A;  3LMM A;  4KN7 X;  2NXN B;  1QQI A;  3F72 A;  4HX4 A;  4ZDO A;  3DBL B;  4AM3 A;  2GIZ A;  3GFL A;  1BI2 A;  5KHD A;  2XIG A;  3BQZ A;  3F21 A;  1R9T J;  3HG9 A;  1MMA A;  1ULY A;  4JQF A;  3HUG A;  4BGD A;  2JA8 J;  1F9N A;  2E71 A;  4HST A;  2IS4 A;  3S3M A;  3CDI A;  3PNT A;  2IGN A;  5F0C A;  5FGM A;  3T8R A;  4KUM A;  1ZG5 A;  1P4W A;  1UG2 A;  2IPQ X;  3B73 A;  1IGN A;  5ICF A;  2OPT A;  2ZKZ A;  1OYI A;  5IP9 J;  1FWZ A;  4ABZ A;  1X1D A;  4LIT A;  4E7K A;  2EFP A;  3TO6 A;  4J01 A;  2FXA A;  1XMX A;  2EZH A;  3LSR A;  3V42 A;  1WJD A;  3AKZ A;  1JJ6 C;  3MKL A;  1B72 B;  4AID A;  3J80 Z;  2EH3 A;  3K1P A;  3FHZ A;  4IKF A;  3S15 J;  1BN5 A;  1BI0 A;  2L02 A;  3BG3 A;  4CCL A;  3BOQ A;  4J00 A;  1D1C A;  4P55 A;  1HDP A;  1K61 A;  3SEQ A;  3L2R A;  5IYB J;  4E4H A;  3Q9V A;  2CS3 A;  4E7L A;  3CDL A;  3BG6 A;  2HXI A;  1IW7 F;  1G6N A;  1X3W B;  3GF2 A;  2BHY A;  5DUK A;  3FIW A;  4DIQ A;  5FFX A;  1E17 A;  3P9I A;  2FOW A;  2Z99 A;  1S29 A;  1IV6 A;  1OR7 C;  3H9J A;  1WH5 A;  3D5R C;  4I01 A;  1V3F A;  1KGS A;  1A36 A;  1R7J A;  3IRR A;  3S2H J;  2LLK A;  4HF2 A;  5EZG A;  5A2Q K;  3DV8 A;  1BOA A;  1ZN2 A;  1PP7 U;  4BUP A;  3F6V A;  3GTK J;  4Y33 A;  1HKQ A;  2WY7 Q;  3DF8 A;  2MAB A;  2O3F A;  4PJ0 C;  5FO5 A;  2EBI A;  4HA8 A;  1UJ8 A;  3KEQ A;  2O0Y A;  2RQP A;  4AYB N;  1TZL A;  3GX4 X;  2CSO A;  4FHT A;  1S72 I;  4LD5 A;  2ZC2 A;  5B5E C;  2G0E A;  3BG7 A;  4WXH A;  2Q0O A;  1TQI A;  1Z1D A;  2QCO A;  1QO0 D;  3HB9 A;  4WCG A;  3CJT B;  2DAO A;  1U3E M;  1AKH A;  2BY2 A;  1ZQ3 P;  2LC2 A;  3A1Y A;  3KEO A;  4A6E A;  1O57 A;  2STT A;  2R7U A;  1JE8 A;  3SFZ A;  2VE9 A;  5LEK A;  1M1E B;  3LWF A;  1EH7 A;  2ZO4 A;  5D5W B;  4BQN A;  1VQ6 I;  3KYD B;  4RBO A;  1F36 A;  2DJI A;  3G3Z A;  2CW0 F;  4L5J A;  3MZ8 A;  2P8T A;  2G9W A;  3CMY A;  5HDN A;  4L0Y B;  3DEE A;  3V8L A;  2JVG A;  3ZRG A;  1GXP A;  1W1W E;  3BPX A;  1YRN B;  4XBF A;  3JRD A;  3KX2 A;  2M34 A;  3W6J B;  2VI6 A;  3HOS A;  6PAX A;  3BDD A;  2PN6 A;  3BTL A;  3VYR B;  4FE7 A;  4A3E J;  2ZXI A;  1JJ8 C;  1IUY A;  2O8X A;  1MBE A;  1MJ9 A;  2GQQ A;  1P7I A;  2QA4 I;  2F4I A;  2RNJ A;  1MNM C;  2PBI A;  3U1D A;  5E3N A;  1IN8 A;  1RRJ A;  4B47 A;  5D4R A;  1OR7 A;  1WPK A;  2HQR A;  4A5M A;  3DCF A;  4ESB A;  4ENK A;  2IRF G;  1W5S A;  3ZQI A;  2ZFW A;  1JTY A;  2EIM H;  3BTI A;  4UVA A;  1V5G A;  4JYK A;  4D7N A;  1R23 A;  3RKX A;  4YIF A;  5EEG A;  3KZI C;  3F8B A;  5H6R A;  3OYE A;  1MH4 A;  1KU2 A;  2HVS A;  1MMG A;  3H0G J;  2WB1 A;  2DMQ A;  1WZ2 A;  2DYS H;  3S14 J;  2JZY A;  2XAS A;  2EJR A;  2JPC A;  2ZCW A;  2WBM A;  3TO9 A;  4IO9 F;  4NUB A;  5JI6 A;  3IUO A;  2RQQ A;  3RZO J;  1J75 A;  4E7J A;  3HXL A;  1B8I A;  3CJN A;  5IT9 Z;  4YFN F;  1FBS A;  2KRC A;  4KIS A;  4NC6 A;  1WSU A;  1IXS B;  2FQ3 A;  4IOC F;  1K4S A;  1FOX A;  2L0K A;  3KIO A;  5DV5 A;  2W00 A;  1DPU A;  3KP7 A;  1MMS A;  1BW5 A;  1S7A A;  4P9F A;  2XKO A;  4ESF A;  2BXZ A;  3PNV A;  2O8K A;  4NNJ A;  1MMD A;  2MC3 A;  2VQC A;  3E7L A;  4FAS D;  1ZK8 A;  1K83 J;  4YEL A;  5HVQ C;  3VOD A;  2V1N A;  1NG7 A;  2IGO A;  1VQ4 I;  3FK6 A;  3TP3 A;  4GXO A;  2E36 A;  3TP0 A;  1T8I A;  1DU0 A;  2JRT A;  2HOE A;  1W0U A;  1ERD A;  3PIP F;  2R7X A;  4OMY A;  2YX7 A;  5LFA A;  1IXC A;  5D8K B;  1F43 A;  2KFD A;  2K7L A;  2ZB9 A;  2HDD A;  1KU9 A;  1XDU A;  2M30 A;  3HL2 A;  2A3S A;  3J7Y J;  3HOT A;  3W6K B;  2PMU A;  2M7A A;  1W36 C;  1CQT A;  1ETW A;  2DA4 A;  4M74 A;  1T38 A;  3IHU A;  2M0M A;  5E3O A;  2JMW A;  3K70 C;  2I5U A;  1MSE C;  1IN7 A;  1BW6 A;  1MH3 A;  4RGX A;  2QSG X;  4QLC U;  2K4B A;  4GYG A;  2E1N A;  4GCV A;  2BVL A;  3I59 B;  1RR8 C;  2OUM A;  2M4G A;  4I7H A;  4B3A A;  4WX9 A;  1OCC H;  1FOK A;  3TOA A;  2FE3 A;  4EGZ A;  2F5V A;  1ZLK A;  4I76 A;  5JHU A;  1J5Y A;  4HAM A;  5J3L A;  1BJZ A;  1Z21 A;  5CJ9 A;  1HQC A;  4C3J J;  1WHU A;  2Q2E B;  1WI3 A;  1MBH A;  3S3N A;  2E19 A;  3MZY A;  3A0H C;  3QOP A;  1KQ8 A;  1YQA A;  3DU6 A;  3EUK L;  3FXU A;  3HRS A;  3DPU A;  1V5E A;  1OCT C;  4DZP A;  3HTS B;  3F6O A;  3OYF A;  2GA2 A;  1BIB A;  2YU9 J;  1B9N A;  1J9I A;  2R92 J;  4XOR A;  5FKO A;  3QYB A;  2DA3 A;  1ZHF A;  2K3P A;  3ECH A;  3VYT B;  2JA6 J;  5F6F A;  2CWE A;  2XAU A;  2DO7 A;  3HRU A;  1FLI A;  1EV7 A;  2PI0 A;  1IRF A;  3S17 J;  3CUO A;  4MFE A;  2ZXJ A;  2RNG A;  5ILU A;  4XRM A;  2Y9Z A;  3SZT A;  2WAQ N;  4U0V A;  2H27 A;  3K1N A;  1J59 A;  1R6R A;  3HKZ N;  3J81 K;  1MBF A;  3RYR A;  3RTR A;  1XSV A;  1D0Z A;  1ZLJ A;  2JQ7 A;  4PFP A;  2IEK A;  3LSM A;  2FBI A;  5JHF A;  4A3D J;  2B63 J;  3BG5 A;  4EQQ A;  5D5V B;  4CZZ A;  1D5Y A;  4M3G A;  1NG6 A;  3BWG A;  5EEH A;  3Q0W A;  5CQG A;  2ZXW H;  1VQM I;  2Z16 A;  1TBX A;  3BP8 A;  4AVZ A;  2K27 A;  1G3W A;  3R6S A;  2E1M B;  4X6A J;  1D3Y A;  3DQV C;  3M4O J;  1HST A;  4EJW A;  3PFY A;  4HDV A;  2ADU A;  2Z33 A;  5JLW A;  4UY8 I;  4I0A A;  1ZRF A;  2KT0 A;  3WTV C;  1JI8 A;  3WG9 A;  3ZN0 A;  2VON A;  4RB1 A;  1U2W A;  4I98 B;  5FRN A;  1P2F A;  4XLH A;  4XR6 A;  3OYI A;  1HXD A;  2K86 A;  3L2Q A;  4XOT A;  4A0Y A;  2LR8 A;  5BOX A;  3EUA A;  3TQN A;  2M5W A;  4GYI A;  5H2F C;  2DA5 A;  2CUE A;  2DBB A;  3WE2 A;  3DKW A;  1BOB A;  2UV1 A;  4C2M J;  4UUV A;  4XLP F;  4BBS J;  1TT5 B;  3KYL A;  4HX7 A;  3H0D A;  3EQL F;  2OTJ I;  4XN0 A;  3J7A Y;  2XVC A;  3J81 Z;  4XON A;  3FXO A;  4EAT A;  2ZFU A;  2QVO A;  3HGG A;  1HDD C;  3QU6 A;  4L5I A;  4NQW A;  4AIK A;  1RIO H;  4AWX B;  1Z3X A;  2EIL H;  2D45 A;  3OYJ A;  1YOV B;  3KP4 A;  2XV4 S;  2IBD A;  3IWZ A;  3HOX J;  5ERI A;  3HOW J;  1UFM A;  2NVX J;  2F5E A;  1IRZ A;  5GPC A;  3ASN H;  3A01 A;  1TNS A;  2VJ5 A;  4ZDL A;  4U88 A;  3F8M A;  4EJO A;  1DQU A;  3SEZ A;  4M9Z A;  2EK5 A;  2ZSI B;  2ZJ2 A;  4A5N A;  1XDS A;  1VND A;  5L3D A;  2DFI A;  1JTX A;  5EEA A;  5TIS C;  4ZYG A;  3OYA A;  4E7H A;  1Z9C A;  1UB9 A;  3I5U A;  4BHC A;  1ORK A;  4F3Q A;  1VFC A;  1SFU A;  2FQ4 A;  1S3J A;  3K4C A;  2UZK A;  4ZYA A;  1TQP A;  1T39 A;  1DP3 A;  1P9Q C;  2HU9 A;  2KJC A;  3ZMS A;  3L7W A;  1S7O A;  3ZQQ A;  2DYR H;  4RAZ A;  2VC1 A;  3ZQG A;  3CLO A;  3QWL A;  5F1R A;  3E5X A;  4C3I J;  1IG7 A;  5M5Y J;  4H0E A;  5FD6 A;  1H0M A;  2W4S A;  4BXF A;  2COB A;  2P5K A;  4A3K J;  5DD4 A;  1V5F A;  1WJA A;  1BIA A;  1Y0N A;  1FTZ A;  4Z2Y A;  1ENH A;  2DN0 A;  3KP5 A;  4PFO A;  3UR3 C;  1I1G A;  2OQG A;  3CJR B;  3LA3 A;  3RPU D;  4ZTJ A;  2K9S A;  3SYT A;  2H6B A;  5CVV A;  1W4M A;  1WJC A;  3E97 A;  2ME6 A;  3ESW B;  5M5X J;  2M4K A;  4BJT A;  3A01 B;  4JX5 A;  1G8X A;  4AIH A;  2K85 A;  1W0T A;  3ABL H;  2BBY A;  2IW5 A;  3LNQ A;  2BEO A;  1KQ9 A;  1TWF J;  5HLI A;  3H3V K;  3NQO A;  5AIQ A;  3ROU A;  1I3Q J;  3DP7 A;  5DCM B;  4A6D A;  4XLA A;  3PNY A;  1BC7 C;  3GME A;  3KPH A;  5BPD A;  5J47 A;  3HHG A;  4HLY A;  4MTD A;  1U9O A;  4JBA A;  3BJ6 A;  4X1E A;  3V7C A;  1YJW I;  3X2Q H;  2MA3 A;  2R7D A;  2GAU A;  2UXX A;  4NBQ A;  2O6G E;  4UXN A;  2XDV A;  3I55 I;  2DA1 A;  5HDK A;  5FB2 A;  3RSN A;  2YU3 A;  2XPW A;  3ELK A;  5IT9 K;  1SAN A;  2BY1 A;  2E7X A;  3FBN B;  2EIJ H;  3Q9S A;  3RKW A;  3KP3 A;  1N77 A;  3A2K A;  3LSJ A;  1BM9 A;  5TGT A;  2PJR A;  3WTT C;  4ENJ A;  3QQA A;  5AIP A;  1BR4 A;  4FCY A;  1TLH B;  2A6T A;  2JSC A;  3J7A O;  5LLQ A;  3C7J A;  3BR6 A;  5DYM A;  4RAG A;  1R5I D;  2VXD A;  4MIM A;  4C3H J;  1JGG A;  4IHS A;  3LSH A;  4XLF A;  1WI9 A;  2X9D A;  1SMY F;  2CMP A;  5J4Y A;  2M3A A;  4EV0 A;  2GOM A;  2WA0 A;  3HYI A;  4CA0 A;  2V79 A;  4BDY A;  1FYL A;  1R36 A;  2L5Q A;  1BI3 A;  2MH2 A;  3TBI A;  2LP0 A;  5HS9 A;  1YW7 A;  4KNY A;  2JK3 A;  3K4K A;  1O3R A;  1Z7L A;  3WHC A;  4HYE A;  3LST A;  2HDC A;  2DOD A;  2VC0 A;  3FKJ A;  2ICW G;  4XKC A;  5FKN A;  2VQG A;  4AIJ A;  2LF7 A;  3A0B C;  2FUG 2;  2Y2Z A;  3PFI A;  3L2C A;  3CCU I;  3QPS A;  3OL3 A;  3WU0 A;  2X48 A;  3WTS C;  3LFK A;  5D6F A;  4RM2 A;  2AQF A;  2JUG A;  3I71 A;  4A3G J;  1R1V A;  4WF2 A;  5EDN A;  1PUF A;  3KZZ A;  3OWT A;  2X85 A;  2LVS A;  2F4O B;  1WVR A;  3OYB A;  3S16 J;  1SFX A;  1XGO A;  3QYF A;  2GXA A;  1P6R A;  1XMK A;  4GRI A;  4YFX F;  2FMY A;  2CW8 A;  1G3T A;  4N9I A;  5FLX Z;  1REP C;  2EV6 A;  2MGQ A;  4A0X A;  4F93 B;  2EZI A;  4BU2 A;  4LIV A;  3K6G A;  1HBX G;  1DU6 A;  4O3M A;  1H9G A;  1ZR4 A;  1GVD A;  4LLL A;  2MLK A;  1STZ A;  4BE1 A;  2A68 F;  1PYV A;  3JRF A;  2R5Z B;  3VSL A;  3F0C A;  3IWF A;  2HR3 A;  1R22 A;  2NAZ A;  3FMR A;  4RGU A;  5A2Q Z;  2TCT A;  3BRO A;  2ZXH A;  4PSW A;  4B09 A;  1IXR C;  4ZZD A;  4XN3 A;  5KAI C;  3ZQC A;  1WGX A;  2JUC A;  2LKS A;  3FHN A;  4RM3 A;  2KHM A;  2L01 A;  1AHD P;  3DTK A;  3PO3 J;  3U1K A;  1UHW A;  4HOB A;  4MLO A;  4LLN A;  3SZP A;  3CCS I;  1YE9 A;  4M9X A;  4XNF A;  4ENN A;  3ABU A;  3BCA A;  1NHA A;  1Y1V J;  3O8H A;  1YYV A;  2HWV A;  3EDP A;  3S3O A;  2O5R A;  4G6D A;  3WU2 C;  2WTE A;  2LBF A;  2ZME B;  1Z0X A;  4AD9 A;  1UZC A;  5DUI A;  4G7Z F;  3BR0 A;  2LOO A;  2O03 A;  3AG2 H;  1P4X A;  1QZY A;  1PUE E;  4RGR A;  5L3C A;  3J80 K;  1E0E A;  2CQX A;  1IN6 A;  1IUF A;  5GAH J;  3B6A A;  5K7F A;  3OYM A;  3ZMD A;  1XGS A;  3BQY A;  4LLG F;  2EA4 A;  4BAC A;  2OAZ A;  2RKH A;  5HS7 A;  4OIQ F;  2VN2 A;  1LUJ B;  4P96 A;  4QTR A;  2V6E A;  3LA7 A;  3BR3 A;  2J5O A;  4A3L J;  3G6E I;  4YEJ A;  3HKZ A;  1DGR M;  2CV0 A;  1R58 A;  4IJA A;  2DK5 A;  4LIU A;  2O61 A;  2CUJ A;  1S7E A;  3K4B A;  3P7N A;  5HDG A;  5E1W A;  3BR1 A;  3MQ0 A;  5JVT A;  4LOC A;  4OAZ A;  5HNH A;  3QRF F;  4LJZ F;  2P5L C;  2L9V A;  4Y13 A;  1WQ2 A;  3VWB A;  5HLT A;  1ZTR A;  2IGM A;  3FXJ A;  3BR5 A;  3TO7 A;  1Q1V A;  1YS7 A;  5DM7 F;  1VQL I;  4XKB A;  2HQN A;  2QBY B;  3I4N J;  4N9H A;  3U2R A;  1FSE A;  3C2H A;  5FKL A;  2NYX A;  4KJZ A;  2D1V A;  3FIS A;  2F5F A;  3OR1 C;  4HBL A;  4CSW A;  4CIC A;  3W3C A;  1R5H A;  3E5Q A;  4DBR A;  3MKW B;  4IL6 C;  5K7Z A;  2MW8 A;  4RB0 A;  2FX0 A;  3RQ4 A;  4M3B A;  2HKX A;  1R49 A;  3TDU C;  2DI3 A;  4UV8 A;  2LK2 A;  3DEW A;  5FD5 A;  4OMZ A;  5BMZ A;  2HOT A;  1Y8R B;  2Z5U A;  3CUQ B;  4KIC A;  3NEU A;  4L18 B;  2P0W A;  3M7G A;  5DD8 A;  1F1Z A;  1G3S A;  2K9N A;  4PJJ A;  1OQY A;  1ZGW A;  2Z9O A;  4Y4R A;  1SD7 A;  2ZJP F;  3I58 A;  5CVU A;  1T33 A;  3S1Q J;  2KDZ A;  4M6V A;  4EM1 A;  2L9N A;  4RDU A;  3CME I;  1RET A;  5L3F A;  3CLQ A;  3CJQ B;  3REO A;  2IS2 A;  1HA8 A;  4NC8 A;  3FMQ A;  3FXR A;  3DLL F;  4II2 A;  2MD0 A;  1W7P A;  5J8C A;  2QEX I;  2HZD A;  3CES A;  4A2U A;  3DLA A;  3B6C A;  1FOW A;  1QVT A;  1XCB A;  3F23 A;  1HCR A;  4PGH A;  3K69 A;  2LYC A;  3WTW C;  1Y39 A;  2ESN A;  3CMA I;  2CGP A;  4PGG A;  2MLG A;  2XAF A;  2W7N A;  3K7A J;  2DT7 B;  4A3I J;  1WJE A;  2MC4 A;  1WCM J;  4IX7 A;  3NWS A;  2VT3 A;  3K10 A;  4NHJ A;  2XAG A;  2QBY A;  2CQ7 A;  2M0C A;  3COA C;  2NVU B;  1GXQ A;  4ZYD A;  1ZKG A;  1KYZ A;  3LOC A;  4OIR F;  1AU7 A;  3BG9 A;  3D1N I;  3EET A;  2E5N A;  4I99 C;  1JT0 A;  1LNW A;  2A05 A;  2KRF A;  5E1X A;  2X6W A;  3JTG A;  2PMH A;  3E6C C;  1POG A;  2H09 A;  4HF0 A;  2I10 A;  2CO5 A;  2DOF A;  1FY7 A;  1MJB A;  2B7E A;  1OCZ H;  4DZJ A;  1O4X A;  2DMT A;  2CG4 A;  4LGW A;  1W7P D;  4A3J J;  4UHT A;  3S32 A;  3UNG C;  3M9A A;  2ACJ A;  1H88 C;  4CCJ A;  4S0H B;  1PVE A;  4HQM A;  5IYC J;  5K1Y A;  1WJF A;  2L7K A;  3HRT A;  3ECO A;  3K9T A;  2VQH A;  2VUM J;  3AL0 C;  4BXX J;  2XC7 A;  3ML6 A;  3S8P A;  4UNO A;  4M3F A;  1FJL A;  5HOD A;  1T6S A;  1YIT I;  2P4W A;  1E3H A;  1LPQ A;  2QEN A;  2P81 A;  3H9Q A;  2MG4 A;  2EPF A;  3IAM 2;  4ZJZ A;  4PUS A;  2DFF A;  2VBX A;  2R93 J;  4XLN F;  1O3Q A;  1UAA A;  2EFN A;  3GTM J;  1VF9 A;  3HEF A;  1I1S A;  1XSX A;  3GLX A;  2VE8 A;  5ICC A;  2H1L A;  2VBY A;  4BQQ A;  4ZC3 A;  2M45 A;  1O3S A;  1Z91 A;  2HXO A;  5ILV A;  1SFO J;  3D5L A;  1B1B A;  4HPQ A;  3IKV A;  4M3E A;  1FPQ A;  2DMP A;  2EV0 A;  4QPO A;  5K7H A;  2XGX A;  1SAU A;  1ON1 A;  2STW A;  1JXS A;  4E7I A;  4HNT A;  1Y0U A;  4XRS A;  4IHW A;  1FP2 A;  4B43 A;  1S9H A;  5IP6 A;  1SVL A;  3JRC A;  5K5R A;  1DPR A;  1Z7U A;  1X19 A;  3S2D J;  2V1X A;  2IS1 A;  3K2Z A;  2NVY J;  4WWC A;  4OAY A;  5F1J A;  1EKE A;  3ONQ A;  1ETV A;  2CQN A;  3CO7 C;  1PP8 F;  3P9C A;  3CCM I;  1U5T C;  1T0F C;  2EQR A;  4DBQ A;  2FSW A;  3PQJ A;  4KFC A;  4MO7 A;  4MEX F;  1W5C C;  2W84 A;  3ABT A;  3RQI A;  3TGN A;  3GFJ A;  2V26 A;  2Y69 H;  4U0Y A;  4AU7 A;  5FLX K;  1MIJ A;  1UEL B;  4UB8 C;  2HYG D;  2EA2 A;  4D0P A;  1TWC J;  4LG0 A;  5BS6 A;  2OZU A;  2F5C A;  5M3M J;  2QF7 A;  4AC0 A;  3SQN A;  2PX9 A;  3WHB A;  2X6O A;  3GCM A;  5F0F A;  3EYI A;  2LDU A;  1BBY A;  1U5T A;  4ANJ A;  1TTY A;  1XGM A;  2V1D A;  4G7H F;  1TC3 C;  1RI7 A;  3ASO H;  9ANT A;  2HGC A;  2RC4 A;  2XF6 A;  4RS8 A;  4UVC A;  3JRH A;  2LD5 A;  5LHH A;  3H3Z A;  2YPR A;  2DLL A;  3L09 A;  3QU3 A;  1FP1 D;  2A5W A;  1OCP A;  3JW4 A;  1ZGA A;  2H1K A;  3GTL J;  1T95 A;  3FZV A;  3HGY A;  2LRE A;  1KYW A;  1D8K A;  2BVM A;  3HZJ A;  3OS2 A;  4CHU A;  2VBW A;  2L54 A;  1K79 A;  5M3F J;  4II3 A;  4N4N B;  2X51 A;  3OL4 A;  1XTA A;  1TNT A;  2Y9Y A;  1ODD A;  2XAH A;  1VQO I;  1LB2 A;  1G4D A;  2ZSH B;  3NRV A;  3M3Y J;  2L7Z A;  3WGG A;  1WH7 A;  4HDU A;  1MDM A;  4RB2 C;  5E3M A;  4BEH A;  4FX4 A;  3DU5 A;  1WKM A;  2DT5 A;  4KIG A;  3I4M J;  4IPA A;  4ETS A;  1E2X A;  1XC5 A;  2GA1 A;  2KL4 A;  1J7K A;  4O6J A;  2WWY A;  1U8B A;  3I3L A;  3AG1 H;  1JUP A;  1A04 A;  4A12 A;  1YFH A;  1R1T A;  2CQK A;  3CTA A;  4KT6 A;  2OQR A;  2Q2E A;  3CF2 A;  2QM3 A;  4FT8 A;  4RLF A;  2JSP A;  3OOU A;  2XSD C;  1FOY A;  4U87 A;  3LQR A;  3HRM A;  1J09 A;  1JKO C;  1WJ5 A;  2A69 F;  1O7L A;  5E17 F;  3K4N A;  4DOZ A;  3LL7 A;  5LGU A;  3C18 A;  4B3X A;  5CVJ A;  5LHI A;  3ZPL A;  3LFU A;  5J1Y A;  2EV5 A;  2OC6 A;  3CDH A;  2LG4 A;  2BW3 A;  1AOY A;  4IEJ A;  3BC8 A;  3VDX A;  5LGT A;  3DPT A;  4GDF A;  5EJC A;  4KN4 X;  1D1A A;  5EZH A;  3HDD A;  1RUO A;  1P4A A;  3PSF A;  3H35 A;  3LA2 A;  2DQR A;  1LE8 A;  2BOL A;  5EG0 A;  3EPZ A;  4L5E A;  1MMN A;  5ILS A;  3CC4 I;  2Q1Z B;  3CC2 I;  2VPL A;  4Q47 A;  3IH3 A;  2XHK A;  3FBI B;  4XMY A;  1QZE A;  3I4P A;  3QP6 A;  4ZH4 F;  2RV8 A;  5FFZ A;  1HKS A;  3DBH B;  2R5Y B;  1Z6R A;  2V9K A;  5KVR A;  2XGC A;  4W1U A;  3OIP A;  4L9J A;  4F91 B;  4Q5S F;  3OSG A;  4WK8 F;  2P6T A;  5DEQ A;  1QPI A;  1SFE A;  4KA4 A;  5C44 J;  3V7R A;  5DTD A;  3K2A A;  4ZZL A;  1X3U A;  4PJN A;  2KMU A;  3C2G A;  2EB7 A;  2FRH A;  1W5T A;  3CP8 A;  3FDY A;  4RGS A;  2G7H A;  3TDZ C;  5C3E J;  1YTY A;  2WV1 A;  4BE2 A;  5B1B H;  4GFB A;  4PZJ A;  3P5J A;  2IT0 A;  3AFH A;  1O7F A;  2ZNZ A;  1RZ4 A;  1RC9 A;  4ZYE A;  2XF7 A;  3GZN B;  4XKW A;  5E3L A;  2EZL A;  1ETY A;  4XM3 A;  1OFC X;  4I2O A;  5F08 A;  3VPR A;  5B1A H;  1I6X A;  4PCQ A;  1JKP C;  1FZP B;  5B66 C;  2LNB A;  4V19 K;  2EZK A;  3KP6 A;  4KIF A;  5TJJ A;  4DJA A;  2OA4 A;  4QSH A;  3L9F A;  1LJ9 A;  2K3F A;  1Y56 A;  1DGW Y;  4RLQ A;  3GUD A;  3KZY A;  2N8G A;  2PQ8 A;  4HW0 A;  4UB6 C;  2DK8 A;  4YFK F;  1X1A A;  1Z6T A;  2R7F A;  3BJA A;  3D0S A;  4A3M J;  1KZH A;  4TV7 A;  3OY9 A;  4BBR J;  4RB3 C;  4L9N A;  2VJ4 A;  2UXN A;  1YW8 A;  4IHY A;  3AG4 H;  3HIF A;  2JA5 J;  4XL9 A;  2RRE A;  2PJR B;  1T98 A;  1XX5 A;  1V55 H;  2MSY A;  3CCV I;  1GLN A;  2E1C A;  1OYW A;  4WXD A;  5LD2 C;  2Z2S B;  3OYD A;  2DXI A;  4QPQ A;  1IN4 A;  4E6K G;  3R0J A;  4AYB A;  4HNV A;  4EEF G;  2BYV E;  3DKX A;  2HPI A;  3MFK A;  2DW4 A;  4C30 A;  4NB5 A;  2IA1 A;  3L2U A;  1HW2 A;  1IRX A;  4V2G A;  4IRG A;  3I0T A;  1R00 A;  4EM0 B;  3ZQL A;  3R0A A;  3M1E A;  3M8J A;  1FT9 A;  2LRD A;  1FNN A;  2KIS A;  2RN7 A;  3T5X A;  4A93 J;  2CU7 A;  5HS8 A;  5IT3 A;  1IO2 A;  2YUS A;  4BDZ A;  3L00 A;  2QSF X;  4M3D A;  1YJ9 I;  4ASN A;  1J0R A;  1G3Y A;  3CMM A;  1MW7 A;  4W97 A;  3HOV J;  3PIO F;  4BL0 B;  4BY1 J;  5JVG F;  1TQM A;  3QAH A;  1HW5 A;  1Z77 A;  3FXQ A;  3DTE A;  3ZMT A;  4D7M A;  3R60 A;  2DTR A;  4IRH A;  1R4N B;  2ID3 A;  5L3B A;  4R1H A;  2YS9 A;  2VOD A;  3MKY B;  1VQ8 I;  1K4T A;  2CH0 A;  4G7O F;  3OS0 A;  2R5Z A;  2JTV A;  3GXO A;  1RUN A;  4DQ2 A;  1ITY A;  1Z3Y A;  2A61 A;  2Y0S N;  2KZG A;  4EVI A;  1U5T B;  2NS0 A;  5LRS A;  3WGI A;  2Y0M A;  2XAJ A;  4I0B A;  3DFG A;  4EGY A;  3F8F A;  1MND A;  1RPW A;  2IAI A;  2IXS A;  3GTJ J;  1LVK A;  4BHB A;  5HLG A;  4KMF A;  2NVT J;  4HNU A;  2DFH A;  4MTE A;  5D6E A;  4RMN A;  3E5U A;  2CUF A;  2GZW A;  1PJR A;  1O3T A;  2BV6 A;  4A3C J;  4HLX A;  2R0Q C;  2QLZ A;  2VB6 A;  3SHF A;  2ZJR F;  3H9G A;  2QGU A;  3FX3 A;  2FF4 A;  3TED A;  5M5W J;  1A5J A;  3QPT A;  1IC8 A;  3CP2 A;  3G1O A;  2OF7 A;  3GEZ A;  2VKD A;  3ERE D;  1YIO A;  3MEX A;  5FKK A;  3SDG A;  3DPL C;  3V8K A;  3GW2 A;  1E3O C;  2K5C A;  1JHF A;  2K4J A;  2ECC A;  2KP6 A;  3GZ5 A;  4S04 A;  3WG7 H;  2FJ1 A;  5J4V A;  4D9J A;  2D1H A;  2JJ7 A;  2K40 A;  3IC7 A;  4ZDP A;  4CCN A;  4MNU A;  2JWT A;  5EF6 A;  4X0G A;  1MBJ A;  4BKX A;  2PEX A;  1F4K A;  1H9T A;  4CXF A;  2XF5 A;  2L4A A;  1LEA A;  3W2A A;  4BAY A;  3WTZ A;  1NK3 P;  2D5V A;  1UMQ A;  1LDJ A;  1T2K A;  4LG3 A;  5D4S A;  4OOI A;  3GO5 A;  4XSX F;  2Z1D A;  5JFR A;  3WTU C;  2OCE A;  3I59 A;  4QWQ A;  1PUF B;  1U6G A;  3O3K A;  2KPM A;  2VKH A;  4O5V A;  1APL C;  2DMN A;  3V7S A;  3HM5 A;  3E6D A;  2CUZ A;  2VL8 A;  5H20 A;  3JR9 A;  3L2V A;  1QBJ A;  3KFW X;  4F7Z A;  2CYY A;  3HSE A;  3E0J B;  1ZEL A;  3GWZ A;  1T0F A;  3MD2 A;  2KDO A;  3ZMZ A;  2M7B A;  1VQK I;  2F48 A;  4Y52 J;  2HVR A;  2LY2 A;  3RJP A;  2OBP A;  2V9P A;  1IZ1 A;  1ZGJ A;  3TKY A;  1X2M A;  2HVQ A;  1ZAR A;  1EF4 A;  2YR2 A;  1I27 A;  4Y17 A;  2DU9 A;  2Y30 A;  1L0O C;  3CUQ C;  3F9K A;  4UUS A;  4UVB A;  3I9V 2;  5EGO B;  3AL0 B;  1OJL A;  3SDB A;  2L2O A;  1HC8 A;  2H94 A;  4EJU A;  1PDN C;  2HKO A;  1YX3 A;  2H8W A;  2M2E A;  2Y75 A;  3CD6 I;  5GP9 A;  2CW7 A;  3CCJ I;  4Y15 A;  3HHH A;  1H8A C;  1R4M B;  3VB2 A;  5GAG J;  5L3E A;  3VYS B;  1LEB A;  5KNL A;  4EJV A;  2M87 A;  3O8G A;  3LSI A;  2ZNY A;  4CUG A;  2M1B A;  2WAD A;  2QZ8 A;  3HOY J;  4MQ9 F;  1JUM A;  2JRM A;  4R79 A;  4H4K C;  4A0Z A;  4MGR A;  1WJB A;  3RI4 A;  1LFB A;  3DTI A;  1YJN I;  2MYS A;  3HSF A;  4C2T A;  2XKP A;  4BXU A;  2R7R A;  2DA2 A;  2B9S A;  4XQF A;  4BYY A;  4FTH A;  1SVM A;  2X1E A;  1UG0 A;  4HEA 2;  5CYV A;  3F22 A;  2KIU A;  4YRV A;  2X1D A;  5F64 A;  3ZQF A;  1DDN A;  2DT6 A;  1VTN C;  2FML A;  2E1M C;  3PQK A;  3S2W A;  2A5Y B;  2HPM A;  1HW1 A;  3KE2 A;  3BLY A;  4XSZ F;  3GTQ J;  2CJJ A;  3CCL I;  2R7S A;  1MKM A;  1LDK B;  3QOD A;  5FJ8 J;  1ACI A;  1ETK A;  1SEU A;  3EUH C;  3LSK A;  5BPI A;  1EH6 A;  1OIS A;  2VAS A;  4MQV A;  4PSX A;  1NH3 A;  1BR2 A;  2V6C A;  1Y1W J;  5FRM A;  2L7M P;  4PK4 A;  3N97 A;  1FYM A;  4BJ5 C;  4S05 A;  2Q8K A;  3FXM A;  1B8I B;  1P7J A;  4OIN F;  1OKR A;  4EJT A;  5GPA A;  2W57 A;  1ETQ A;  4C2U A;  3CZ6 A;  5J40 A;  4UV9 A;  5J1U A;  3P9K A;  2HFH A;  1V4R A;  4JX6 A;  4WXC A;  4B48 A;  2BY0 A;  1ZH5 A;  4M6X A;  1QVU A;  2UWM A;  5LBQ A;  2GXG A;  5K5Q A;  2WAE A;  1K6Y A;  2X1C A;  1GV2 A;  4JOM A;  3KLO A;  4KMU X;  2PLY A;  4IOA F;  3GBG A;  1VQ7 I;  1D8J A;  1U0J A;  2HZT A;  3ZOB A;  2VOO A;  2KKO A;  4M6Y A;  3WTX C;  3JRI A;  1HF0 A;  3W6V A;  2R7V A;  1X3Z B;  4L9T A;  3KET A;  3H5A A;  1MGT A;  2NOJ B;  4PDK A;  4V2F A;  3E6B A;  4R8H A;  4IHX A;  4BE0 A;  1JT6 A;  4DNC A;  3I54 A;  3OYH A;  1Q1H A;  3ZMV A;  1X4P A;  4JX4 A;  5E8G A;  4C9Y A;  5GTI C;  2PG4 A;  4L0Z B;  3BTC A;  4N4O B;  2F6C A;  1IDY A;  5KK1 A;  2BGC A;  1ETX A;  4JK1 X;  5CVI A;  2DPU A;  3VYU B;  1IN5 A;  3EUH A;  2XB0 X;  4HX8 A;  4B4C A;  2XPV A;  3RIR A;  1A35 A;  1MZB A;  2QUF A;  3NAR A;  2XRO A;  4IZZ A;  3SXY A;  4XOP A;  2GM4 A;  3FMS A;  2DFE A;  1B6A A;  2BZT A;  1B4A A;  1I5Z A;  2IA0 A;  3GYH X;  3GLL A;  5J1R A;  2DDB A;  1RNL A;  2MBF A;  1MBK A;  4HZF A;  3RKQ A;  1MJA A;  3WOD F;  3BZ6 A;  2GBY A;  3HUG B;  3HSR A;  3ABM H;  1YHQ I;  2XAQ A;  3WE3 A;  1U8R A;  4KDP A;  2LFB A;  2XUB A;  3QYE A;  2YX4 A;  3BR2 A;  3C1D A;  5CLS A;  4DYR A;  3SFI A;  3BZK A;  3K0L A;  2LSO A;  3J7Z I;  1X58 A;  4BNC A;  4M9S A;  4P9U A;  3ERM A;  2ZME C;  4AUX A;  4RAF A;  2W1O A;  3OIO A;  2PFB A;  5L3G A;  2NRA C;  2I8D A;  4YII A;  2X6X A;  3FKI J;  5FRO A;  5HOO A;  1T08 B;  2EIN H;  1TW3 A;  1Z05 A; 
#chains in the Genus database with same CATH homology
 3IKT A;  2QQA A;  4ON0 A;  3ZP5 A;  4ENM A;  3F8N A;  1SAX A;  2LF8 A;  3MWM A;  2OZ6 A;  4OIO F;  2A6H F;  1F5T A;  1LVA A;  2JPB A;  3LAJ A;  1ZRD A;  1IAW A;  2V9V A;  3IL2 A;  2WC2 A;  4LFU A;  5E20 A;  5LRR A;  5LEJ A;  3JSP A;  2LKP A;  1SD4 A;  2RDP A;  2AS5 F;  2GXB A;  4LK1 F;  1AWC A;  2Z3Y A;  1GHC A;  2QYO A;  1FYK A;  3VEP A;  1KQ0 A;  4CGZ A;  4HV5 A;  1HKT A;  1XCV A;  4BH9 A;  2HYF A;  3V4G A;  1D5V A;  1YG2 A;  1YLF A;  4OIP F;  1ZG3 A;  2NNY A;  3JTH A;  4I02 A;  2HEO A;  4KT5 C;  3CUQ A;  4LK0 F;  2R3S A;  1QGP A;  3Q5F A;  3FWE A;  4ESJ A;  3C3W A;  4LG0 B;  1S8N A;  2G7U A;  3ZMU A;  2NNN A;  4FX0 A;  1XN7 A;  1BJA A;  5D8L B;  2EFQ A;  3RPU A;  2RGV A;  3H92 A;  3RYP A;  1TW2 A;  2MH9 A;  3O6B B;  2P6S A;  1DP7 P;  4K2E A;  1FX7 A;  2L4M A;  3WTY C;  2ZME A;  4GO1 A;  3BY6 A;  1K78 A;  1YW9 A;  1GVJ A;  4RAY A;  4CYD A;  1IRG A;  3TOB A;  1XGN A;  3QP5 A;  5JR3 A;  3E6M A;  4N0B A;  1WWX A;  2W25 A;  1MDM B;  5E18 F;  3GFM A;  1CF7 B;  2FA5 A;  4G6Q A;  1FBU A;  4HV6 A;  2PJP A;  3CO6 C;  4I09 A;  3ZN1 A;  3H3U A;  2AXL A;  2FU4 A;  1YO5 C;  2IJL A;  1R1U A;  1K78 B;  3N4M A;  2P7C B;  4YG2 F;  2V1U A;  1EH8 A;  3KP2 A;  5AON A;  1UHM A;  2QWW A;  1QZZ A;  1XSD A;  4MHG A;  1HSJ A;  3IRQ A;  4IHT A;  4IF4 A;  1OPC A;  4BHP A;  1SMT A;  1BC8 C;  2M8E A;  2JT1 A;  4P5O A;  3O2P E;  1JHH A;  2HTJ A;  5TRD A;  3BPV A;  2QQ9 A;  3OOP A;  5HLH A;  4Q48 A;  2FBK A;  2ZBK A;  3KLN A;  1ZAO A;  3GZ6 A;  1FC3 A;  1UST A;  4IXA A;  2MD5 A;  2Y48 A;  5H6Q A;  2ELH A;  3ULQ B;  4G8X A;  3F3X A;  2IVM A;  4U0W A;  4M73 A;  3F8C A;  5DCF A;  3E3V A;  1YS6 A;  3MAJ A;  3FM5 A;  5D5U B;  4HF1 A;  4KYW A;  4XRF A;  1W7P B;  2KJB A;  1FBQ A;  2X4H A;  4G94 A;  3RPQ A;  3KCC A;  4MEY F;  2H6C A;  3RKY A;  1S6L A;  1XD7 A;  4U7D A;  2EFO A;  1P92 A;  2VOP A;  2ETH A;  1WRJ A;  2K02 A;  3LQQ A;  3OV8 A;  4L9V A;  5ICE A;  2EFW A;  3B02 A;  4AVP A;  3U9G A;  3FF5 A;  1KU7 A;  1C0W A;  3VFZ A;  2X0L A;  1USS A;  2FNP A;  2IP2 A;  5D5X B;  1U78 A;  2COM A;  3M8E A;  3DXJ F;  1ZG1 A;  5K5O A;  2HTS A;  1MD0 A;  4M71 A;  5DDG A;  2J5P A;  2EWN A;  3T1B A;  3JSO A;  1ON2 A;  3QPH A;  2P5V A;  3WU1 B;  3V8J A;  1J2X A;  3G73 A;  2OU2 A;  3R61 A;  2F5D A;  4E70 A;  1IF1 A;  3JAM Z;  1JGS A;  5J6X A;  2ESH A;  2F2E A;  1L3L A;  4U7B A;  1SD5 A;  2KIM A;  4KIB A;  1ZYR F;  2RVC A;  2A6E F;  4GGG A;  2W85 A;  1DUX C;  4LB5 A;  1ZRC A;  1KU3 A;  1LQ1 A;  4IVN A;  3I64 A;  3BJO A;  4IRI A;  5E8I A;  2FNA A;  3ISP A;  2HS5 A;  2P7V B;  2WV0 A;  1B9M A;  3FM3 A;  4CO8 A;  1OYY A;  2IA2 A;  3MZH A;  4HQE A;  5J8F A;  1K7A A;  2GWR A;  4EM2 A;  3ZQ7 A;  4M72 A;  1XMA A;  1B59 A;  1CF7 A;  2KIF A;  3I53 A;  2B0L A;  2W24 A;  2BE5 F;  2DQL A;  1R5G A;  2D2W A;  4G9Y A;  5CVR A;  1XB4 A;  4EMS A;  3GVA A;  2FBH A;  3DEU A;  1SD6 A;  4B8X A;  3T8T A;  1FSH A;  1K6O A;  1ONV A;  4OU0 A;  3T0Y A;  1KA8 A;  2XRN A;  3WGH A;  4Q4Z F;  1CGP A;  5LGN A;  5BQT A;  5DCM A;  2DPD A;  4LMY A;  1LDD A;  3K1M A;  4BQA A;  2GIV A;  2A07 F;  2FOK A;  3EYY A;  2TDX A;  1ZRE A;  1BI1 A;  3RDI A;  5ICG A;  2OD5 A;  3VOE A;  3M8F A;  3AAF A;  2ISZ A;  1QPM A;  2CFX A;  2VT2 A;  2YSR A;  2E7W A;  2FEZ A;  2ISY A;  2QQB A;  3LAP A;  2VXZ A;  2L3D A;  5LHG A;  4CDG A;  1OMI A;  4ZYH A;  3GFI A;  3MCZ A;  3HTU A;  3R4K A;  2VBZ A;  3JAM K;  5ED4 A;  5E1Z B;  4LB6 B;  1UCR A;  2C6Y A;  1QNT A;  4KN7 X;  1QQI A;  3F72 A;  4HX4 A;  3GFL A;  1BI2 A;  2XIG A;  3F21 A;  1ULY A;  4JQF A;  3HUG A;  1F9N A;  5FGM A;  3T8R A;  4KUM A;  1ZG5 A;  1P4W A;  2IPQ X;  3B73 A;  5ICF A;  2ZKZ A;  1OYI A;  1FWZ A;  2EFP A;  3TO6 A;  2FXA A;  3J80 Z;  3K1P A;  3FHZ A;  1BN5 A;  1BI0 A;  2L02 A;  3BOQ A;  4P55 A;  3Q9V A;  1IW7 F;  1G6N A;  3GF2 A;  5DUK A;  5FFX A;  1E17 A;  3P9I A;  2Z99 A;  1S29 A;  4I01 A;  1V3F A;  1KGS A;  1R7J A;  3IRR A;  4HF2 A;  5A2Q K;  3DV8 A;  1BOA A;  1ZN2 A;  1PP7 U;  3F6V A;  1HKQ A;  3DF8 A;  2O3F A;  5FO5 A;  4HA8 A;  3KEQ A;  2O0Y A;  2RQP A;  3GX4 X;  2CSO A;  4FHT A;  4LD5 A;  4WXH A;  2Q0O A;  1TQI A;  1Z1D A;  1QO0 D;  4WCG A;  2DAO A;  1U3E M;  3KEO A;  4A6E A;  1O57 A;  2STT A;  1JE8 A;  3SFZ A;  2VE9 A;  5LEK A;  3LWF A;  1EH7 A;  2ZO4 A;  5D5W B;  3G3Z A;  2CW0 F;  4L5J A;  2P8T A;  2G9W A;  5HDN A;  4L0Y B;  3V8L A;  1GXP A;  3BPX A;  4XBF A;  3W6J B;  3HOS A;  6PAX A;  3BDD A;  2PN6 A;  1IUY A;  2O8X A;  1MJ9 A;  2GQQ A;  2RNJ A;  2PBI A;  3U1D A;  1IN8 A;  5D4R A;  1OR7 A;  4ENK A;  2HQR A;  4A5M A;  4ESB A;  2IRF G;  1W5S A;  2ZFW A;  4UVA A;  1R23 A;  3RKX A;  4YIF A;  5EEG A;  3F8B A;  5H6R A;  1KU2 A;  2JZY A;  2XAS A;  2EJR A;  2JPC A;  2ZCW A;  3TO9 A;  5JI6 A;  1J75 A;  3CJN A;  5IT9 Z;  4YFN F;  1FBS A;  1WSU A;  1IXS B;  2FQ3 A;  5DV5 A;  1DPU A;  3KP7 A;  1S7A A;  4P9F A;  2XKO A;  4ESF A;  2MC3 A;  5HVQ C;  3VOD A;  4GXO A;  2JRT A;  2HOE A;  4OMY A;  2YX7 A;  1IXC A;  5D8K B;  2K7L A;  1KU9 A;  1XDU A;  2M30 A;  2A3S A;  3HOT A;  3W6K B;  2PMU A;  4M74 A;  1T38 A;  3IHU A;  1IN7 A;  4RGX A;  4QLC U;  2K4B A;  4GYG A;  2E1N A;  4GCV A;  3I59 B;  4I7H A;  4WX9 A;  1FOK A;  3TOA A;  2FE3 A;  4EGZ A;  1ZLK A;  5JHU A;  1J5Y A;  4HAM A;  5CJ9 A;  1HQC A;  3MZY A;  3QOP A;  1KQ8 A;  1YQA A;  3FXU A;  3HRS A;  3HTS B;  3F6O A;  2GA2 A;  1BIB A;  1B9N A;  1J9I A;  1ZHF A;  3ECH A;  5F6F A;  2CWE A;  2DO7 A;  3HRU A;  1FLI A;  1EV7 A;  2PI0 A;  1IRF A;  3CUO A;  2ZXJ A;  5ILU A;  3SZT A;  4U0V A;  2H27 A;  3K1N A;  1J59 A;  3J81 K;  3RYR A;  3RTR A;  1XSV A;  1ZLJ A;  2FBI A;  4EQQ A;  5D5V B;  4CZZ A;  3BWG A;  5EEH A;  1TBX A;  3BP8 A;  2K27 A;  1G3W A;  3R6S A;  1D3Y A;  3DQV C;  1HST A;  4EJW A;  4HDV A;  2ADU A;  2Z33 A;  4I0A A;  1ZRF A;  3WTV C;  3WG9 A;  3ZN0 A;  2VON A;  4RB1 A;  1U2W A;  4I98 B;  1P2F A;  1HXD A;  2K86 A;  4A0Y A;  5BOX A;  3TQN A;  2M5W A;  4GYI A;  2DBB A;  3WE2 A;  3DKW A;  4UUV A;  4XLP F;  4HX7 A;  3EQL F;  2XVC A;  3J81 Z;  2QVO A;  3QU6 A;  4L5I A;  4NQW A;  4AIK A;  1RIO H;  4AWX B;  2D45 A;  3KP4 A;  2XV4 S;  3IWZ A;  5ERI A;  1UFM A;  2F5E A;  1TNS A;  4U88 A;  3F8M A;  4EJO A;  4M9Z A;  2EK5 A;  2ZJ2 A;  4A5N A;  1XDS A;  5L3D A;  2DFI A;  4ZYG A;  1Z9C A;  1UB9 A;  3I5U A;  4BHC A;  1SFU A;  1S3J A;  2UZK A;  1T39 A;  1TQP A;  2KJC A;  3ZMS A;  3L7W A;  1S7O A;  4RAZ A;  2VC1 A;  3CLO A;  5F1R A;  3E5X A;  4H0E A;  5FD6 A;  1H0M A;  2P5K A;  5DD4 A;  1BIA A;  4Z2Y A;  3KP5 A;  1I1G A;  2OQG A;  3LA3 A;  2H6B A;  5CVV A;  1W4M A;  3E97 A;  4AIH A;  2BBY A;  2IW5 A;  2BEO A;  1KQ9 A;  5HLI A;  3NQO A;  5AIQ A;  3ROU A;  3DP7 A;  5DCM B;  4A6D A;  1BC7 C;  5BPD A;  3HHG A;  4HLY A;  4MTD A;  4JBA A;  3BJ6 A;  3V7C A;  2MA3 A;  2R7D A;  2GAU A;  2UXX A;  2O6G E;  4UXN A;  5HDK A;  5FB2 A;  2YU3 A;  3ELK A;  5IT9 K;  2E7X A;  3Q9S A;  3RKW A;  3KP3 A;  1BM9 A;  3WTT C;  4ENJ A;  5AIP A;  1TLH B;  2JSC A;  3J7A O;  5LLQ A;  3C7J A;  5DYM A;  4IHS A;  1WI9 A;  1SMY F;  4EV0 A;  3HYI A;  2V79 A;  1FYL A;  1R36 A;  1BI3 A;  2MH2 A;  5HS9 A;  1YW7 A;  4KNY A;  1O3R A;  4HYE A;  3LST A;  2HDC A;  2VC0 A;  4AIJ A;  2LF7 A;  3PFI A;  3L2C A;  3WU0 A;  3WTS C;  3LFK A;  5D6F A;  3I71 A;  1R1V A;  4WF2 A;  3KZZ A;  1SFX A;  1XGO A;  1P6R A;  1XMK A;  4YFX F;  2FMY A;  1G3T A;  4N9I A;  5FLX Z;  1REP C;  2EV6 A;  4A0X A;  1HBX G;  4O3M A;  1H9G A;  4LLL A;  2MLK A;  1STZ A;  2A68 F;  3IWF A;  2HR3 A;  1R22 A;  2NAZ A;  3FMR A;  4RGU A;  5A2Q Z;  3BRO A;  4B09 A;  4ZZD A;  1IXR C;  2L01 A;  1UHW A;  4HOB A;  4LLN A;  3SZP A;  4M9X A;  4ENN A;  3ABU A;  1NHA A;  1YYV A;  2HWV A;  3EDP A;  4G6D A;  2WTE A;  2ZME B;  4AD9 A;  5DUI A;  4G7Z F;  2O03 A;  1P4X A;  1QZY A;  1PUE E;  4RGR A;  5L3C A;  3J80 K;  1IN6 A;  3ZMD A;  1XGS A;  4LLG F;  2EA4 A;  2OAZ A;  2RKH A;  5HS7 A;  4OIQ F;  2VN2 A;  4P96 A;  3LA7 A;  2J5O A;  1R58 A;  4IJA A;  2DK5 A;  2O61 A;  3P7N A;  5HDG A;  5E1W A;  3MQ0 A;  5JVT A;  3QRF F;  4LJZ F;  2P5L C;  4Y13 A;  1WQ2 A;  3TO7 A;  1YS7 A;  2HQN A;  2QBY B;  4N9H A;  3U2R A;  1FSE A;  2NYX A;  2D1V A;  2F5F A;  4HBL A;  4CIC A;  1R5H A;  3E5Q A;  4RB0 A;  2HKX A;  3TDU C;  2DI3 A;  4UV8 A;  5FD5 A;  4OMZ A;  5BMZ A;  2Z5U A;  3CUQ B;  4KIC A;  3NEU A;  4L18 B;  3M7G A;  5DD8 A;  1F1Z A;  1G3S A;  2Z9O A;  1SD7 A;  3I58 A;  5CVU A;  4EM1 A;  5L3F A;  3REO A;  3FMQ A;  3FXR A;  1W7P A;  5J8C A;  4A2U A;  1XCB A;  3F23 A;  4PGH A;  3K69 A;  3WTW C;  2ESN A;  2CGP A;  4PGG A;  2MLG A;  2XAF A;  2VT3 A;  4NHJ A;  2XAG A;  2QBY A;  3COA C;  1GXQ A;  4ZYD A;  1KYZ A;  4OIR F;  3EET A;  1LNW A;  2KRF A;  5E1X A;  3JTG A;  2PMH A;  3E6C C;  2H09 A;  4HF0 A;  2CO5 A;  1FY7 A;  1MJB A;  2CG4 A;  4LGW A;  1W7P D;  4UHT A;  2ACJ A;  3M9A A;  4HQM A;  5K1Y A;  3HRT A;  3ECO A;  3K9T A;  3ML6 A;  4UNO A;  1T6S A;  2P4W A;  2QEN A;  2VBX A;  4XLN F;  1O3Q A;  2EFN A;  1I1S A;  1XSX A;  3GLX A;  2VE8 A;  5ICC A;  2VBY A;  1O3S A;  2M45 A;  1Z91 A;  5ILV A;  3D5L A;  1B1B A;  3IKV A;  1FPQ A;  2EV0 A;  2XGX A;  1ON1 A;  2STW A;  1JXS A;  1Y0U A;  1FP2 A;  5K5R A;  1DPR A;  1Z7U A;  2V1X A;  3K2Z A;  4WWC A;  3CO7 C;  1PP8 F;  3P9C A;  1U5T C;  2FSW A;  3PQJ A;  4KFC A;  4MEX F;  2W84 A;  3ABT A;  3TGN A;  3GFJ A;  4U0Y A;  5FLX K;  2HYG D;  2EA2 A;  4D0P A;  4LG0 A;  5BS6 A;  2OZU A;  2F5C A;  3SQN A;  3EYI A;  2LDU A;  1BBY A;  1U5T A;  1TTY A;  1XGM A;  2V1D A;  4G7H F;  1RI7 A;  2HGC A;  2RC4 A;  4RS8 A;  4UVC A;  5LHH A;  3H3Z A;  2YPR A;  2DLL A;  3L09 A;  3QU3 A;  1FP1 D;  3JW4 A;  1ZGA A;  3FZV A;  1KYW A;  1D8K A;  4CHU A;  2VBW A;  2L54 A;  1K79 A;  1TNT A;  1ODD A;  1LB2 A;  2XAH A;  1G4D A;  3NRV A;  3WGG A;  4HDU A;  1MDM A;  4RB2 C;  4FX4 A;  1WKM A;  2DT5 A;  4KIG A;  4IPA A;  4ETS A;  1E2X A;  2GA1 A;  1J7K A;  4O6J A;  2WWY A;  1A04 A;  4A12 A;  1YFH A;  1R1T A;  2CQK A;  3CTA A;  2OQR A;  2Q2E A;  2QM3 A;  4FT8 A;  3LQR A;  3HRM A;  2A69 F;  1O7L A;  5E17 F;  5LGU A;  3C18 A;  5CVJ A;  5LHI A;  3ZPL A;  2EV5 A;  3CDH A;  1AOY A;  5LGT A;  3DPT A;  4KN4 X;  1RUO A;  1P4A A;  3LA2 A;  2DQR A;  5ILS A;  4Q47 A;  2XHK A;  3I4P A;  3QP6 A;  4ZH4 F;  2RV8 A;  5FFZ A;  1HKS A;  1Z6R A;  5KVR A;  4L9J A;  4Q5S F;  4WK8 F;  2P6T A;  5DEQ A;  1SFE A;  4KA4 A;  3V7R A;  4ZZL A;  1X3U A;  2EB7 A;  2FRH A;  1W5T A;  4RGS A;  2G7H A;  3TDZ C;  1YTY A;  4PZJ A;  2IT0 A;  1O7F A;  2ZNZ A;  1RZ4 A;  4ZYE A;  4I2O A;  1I6X A;  4PCQ A;  1FZP B;  2LNB A;  4KIF A;  3KP6 A;  5TJJ A;  2OA4 A;  3L9F A;  1LJ9 A;  3GUD A;  3KZY A;  2PQ8 A;  4HW0 A;  2DK8 A;  4YFK F;  1Z6T A;  2R7F A;  3BJA A;  3D0S A;  4TV7 A;  4RB3 C;  4L9N A;  2UXN A;  1YW8 A;  3HIF A;  1T98 A;  2E1C A;  1OYW A;  4WXD A;  1IN4 A;  3R0J A;  2BYV E;  3MFK A;  2DW4 A;  4NB5 A;  2IA1 A;  1HW2 A;  4IRG A;  3I0T A;  1R00 A;  4EM0 B;  3R0A A;  3M1E A;  1FT9 A;  1FNN A;  2RN7 A;  3T5X A;  5HS8 A;  5IT3 A;  3L00 A;  4ASN A;  1J0R A;  1G3Y A;  1TQM A;  3QAH A;  1HW5 A;  3FXQ A;  3ZMT A;  3R60 A;  2DTR A;  4IRH A;  5L3B A;  4R1H A;  2VOD A;  4G7O F;  2JTV A;  3GXO A;  1RUN A;  4DQ2 A;  2A61 A;  4EVI A;  1U5T B;  2NS0 A;  5LRS A;  3WGI A;  2Y0M A;  2XAJ A;  4I0B A;  3DFG A;  4EGY A;  3F8F A;  4BHB A;  5HLG A;  4KMF A;  4MTE A;  5D6E A;  3E5U A;  2GZW A;  1O3T A;  2BV6 A;  4HLX A;  2QLZ A;  3SHF A;  3FX3 A;  2FF4 A;  3QPT A;  3GEZ A;  3ERE D;  1YIO A;  3MEX A;  3DPL C;  3V8K A;  3GW2 A;  1JHF A;  2K4J A;  4S04 A;  3GZ5 A;  2D1H A;  3IC7 A;  4MNU A;  2PEX A;  1F4K A;  1H9T A;  4CXF A;  2L4A A;  1LEA A;  4BAY A;  3WTZ A;  1LDJ A;  1T2K A;  5D4S A;  4OOI A;  3GO5 A;  4XSX F;  5JFR A;  3WTU C;  3I59 A;  4QWQ A;  1U6G A;  3O3K A;  4O5V A;  3V7S A;  3E6D A;  5H20 A;  1QBJ A;  3KFW X;  4F7Z A;  2CYY A;  3HSE A;  3GWZ A;  1T0F A;  3ZMZ A;  3RJP A;  2OBP A;  1IZ1 A;  1ZGJ A;  3TKY A;  1ZAR A;  2YR2 A;  1I27 A;  4Y17 A;  2DU9 A;  1L0O C;  3CUQ C;  4UVB A;  2H94 A;  4EJU A;  1PDN C;  2HKO A;  2Y75 A;  4Y15 A;  3HHH A;  3VB2 A;  5L3E A;  1LEB A;  4EJV A;  2M87 A;  2ZNY A;  2M1B A;  2QZ8 A;  4MQ9 F;  4R79 A;  4A0Z A;  4MGR A;  3RI4 A;  3HSF A;  2XKP A;  4BXU A;  4BYY A;  5CYV A;  3F22 A;  2KIU A;  5F64 A;  1DDN A;  1VTN C;  2FML A;  3PQK A;  3S2W A;  2A5Y B;  1HW1 A;  3KE2 A;  4XSZ F;  1MKM A;  1LDK B;  5BPI A;  1EH6 A;  4MQV A;  2V6C A;  3N97 A;  1FYM A;  4S05 A;  2Q8K A;  4OIN F;  1OKR A;  4EJT A;  2W57 A;  4UV9 A;  3P9K A;  2HFH A;  1V4R A;  4WXC A;  1ZH5 A;  4M6X A;  2UWM A;  5LBQ A;  2GXG A;  5K5Q A;  3KLO A;  4KMU X;  2PLY A;  1D8J A;  2HZT A;  2VOO A;  2KKO A;  4M6Y A;  3WTX C;  4L9T A;  3KET A;  1MGT A;  4PDK A;  3E6B A;  4R8H A;  4DNC A;  3I54 A;  1Q1H A;  3ZMV A;  5E8G A;  2PG4 A;  4L0Z B;  5KK1 A;  2BGC A;  4JK1 X;  5CVI A;  2DPU A;  1IN5 A;  3EUH A;  4HX8 A;  3RIR A;  1MZB A;  2QUF A;  2XRO A;  3SXY A;  3FMS A;  1B6A A;  1B4A A;  1I5Z A;  2IA0 A;  3GYH X;  1RNL A;  2MBF A;  4HZF A;  1MJA A;  3WOD F;  3BZ6 A;  3HSR A;  2XAQ A;  3WE3 A;  1U8R A;  4KDP A;  2XUB A;  2YX4 A;  5CLS A;  3C1D A;  3K0L A;  2LSO A;  4BNC A;  4M9S A;  4P9U A;  2PFB A;  5L3G A;  2NRA C;  4YII A;  5HOO A;  1TW3 A;  1Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...