2YPRA

Crystal structure of the dna binding ets domain of human protein fev
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
KGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PROTEIN FEV
publication title Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2yprA00
1R58A 3ABUA 3FM5A 5ILVA 5CVUA 1B4AA 1XCVA 1KGSA 1U5TC 3KP3A 1HSJA 3TOAA 3REOA 5CJ9A 3BWGA 4BHCA 2FF4A 1R5HA 3KCCA 4RAZA 5EEGA 3KP2A 1Z7UA 3BJOA 3C1DA 1J9IA 2D2WA 1QGPA 2Y75A 1IRGA 5LGUA 3DPTA 4LLGF 4I01A 2HKXA 2RN7A 2DPDA 4Q47A 2Z5UA 3R6SA 4GCVA 3WTUC 4ZYEA 4KICA 2E1CA 1WWXA 1T98A 3BJAA 3IRQA 5HVQC 1K78A 5L3DA 3H3UA 2ZNYA 3DF8A 2YR2A 3GFMA 2QYOA 4RAYA 4A0ZA 2EFOA 1YW7A 3DFGA 2EV0A 2A3SA 3TOBA 4EMSA 4FX0A 5BOXA 1PUEE 2Q0OA 2Z33A 1FP1D 1GVJA 4P55A 2YSRA 4MTEA 4A5MA 1YFHA 3LAPA 3ECOA 1T2KA 3TDZC 3VEPA 2IA2A 5K5RA 1O3TA 1U5TA 2HYFA 3WG9A 4DQ2A 4HV6A 4CHUA 1SD6A 1FLIA 2FA5A 3F23A 4I2OA 2OQGA 3RYPA 1IZ1A 1TW2A 4U88A 1BOAA 2FSWA 4YG2F 3HRSA 5BPDA 2R7FA 1ZHFA 3WGHA 3I59A 2MC3A 1R1VA 5D5XB 2VE8A 2EFQA 4KIBA 4M9ZA 3FMRA 4U7BA 2DAOA 4DNCA 4BHBA 2NS0A 4HDUA 4EGYA 4HZFA 2Z3YA 3NEUA 1SMTA 1USTA 3E3VA 2VBZA 1ODDA 2XUBA 1Z6TA 1O57A 3HOTA 4Q4ZF 2LF7A 5JI6A 1WSUA 1O3SA 4OOIA 2GA1A 4LLNA 2RDPA 4LJZF 5IT9K 2OA4A 2ACJA 2L3DA 5E17F 2H6BA 3F8FA 2EK5A 1HW5A 3GLXA 1IRFA 3QRFF 4ETSA 4CICA 1W5SA 1KQ9A 2G7UA 4EM1A 5LHGA 5LGNA 3G3ZA 2IP2A 1QO0D 4I02A 2A5YB 4CO8A 1LEBA 2TDXA 1R00A 2YPRA 2PG4A 1OYIA 1XD7A 1G3SA 3OV8A 3P9KA 4HX8A 3ZN0A 1E2XA 4EM2A 1BIAA 4UV8A 2P5KA 4KNYA 5L3BA 2ETHA 1FY7A 3JAMK 1BN5A 1IN6A 3E5QA 2HEOA 4PZJA 4XRFA 3E97A 3LSTA 4KMUX 5K5OA 4GYGA 2IA0A 2IA1A 1ZGJA 1IN7A 2X4HA 1I6XA 5D8LB 2KJCA 3KLNA 3PQKA 1RNLA 4XSXF 2EJRA 3LA2A 1L0OC 3GZ5A 4G6QA 3FF5A 2IRFG 1OPCA 4U7DA 3C7JA 2LKPA 3GO5A 2GXBA 5FFXA 4KT5C 1JE8A 2NYXA 3WE2A 3R0AA 2EWNA 1TTYA 4KIGA 3ULQB 1G4DA 5IT3A 5LEKA 4HLXA 3HSFA 3KEQA 3SZPA 4ESJA 2LDUA 2ZBKA 3J80K 4L0ZB 1FBSA 3Q9VA 1J7KA 5F64A 4A6EA 2QQBA 4EJTA 2E1NA 3MZYA 4S04A 2PMUA 1S8NA 2YX4A 3SXYA 3GFJA 4IXAA 4WCGA 1J0RA 5L3FA 1L3LA 2K86A 2KRFA 4QWQA 2BGCA 4EJWA 2QWWA 3GZ6A 1MJAA 2OBPA 1XMKA 3K2ZA 1FZPB 1C0WA 2P7CB 1REPC 3SQNA 2YX7A 1W5TA 5FO5A 1UHMA 2DLLA 5AONA 2XV4S 3ERED 3G73A 3GYHX 2CG4A 3L2CA 2FXAA 3FXRA 2COMA 1U78A 1AWCA 3FX3A 3QU6A 5L3GA 3LFKA 3TO9A 3F6VA 4Q48A 1LQ1A 2O6GE 2UWMA 4G7HF 2RGVA 1T38A 1HKSA 2XROA 3DEUA 1WKMA 1JHHA 1A04A 3ZP5A 2P6TA 3V8KA 2DI3A 4N9HA 1BI3A 1QQIA 4L9JA 4M74A 4B09A 4BNCA 1YQAA 3K9TA 3IL2A 1YG2A 1KYZA 1SMYF 4L0YB 5H6RA 1IUYA 5ICCA 3QPTA 2L4MA 2Q8KA 4P96A 4EJVA 3QP6A 4YFXF 3I64A 4RGUA 3RPUA 2FEZA 4ENJA 2V1XA 1KQ0A 4LK1F 3CUQB 4Z2YA 1FYLA 2DPUA 1USSA 1IXSB 1K79A 1EH7A 4YIIA 1I27A 2A07F 1R23A 1P4WA 5FD6A 1FT9A 5AIPA 1F9NA 1Q1HA 1ZLJA 4L9VA 1ZREA 3CDHA 2P7VB 3F22A 3KP6A 1IN5A 3W6KB 1H9TA 1B9NA 2BEOA 3GVAA 2DTRA 3CUQC 3I58A 1DUXC 1R36A 3WTZA 1FYMA 1EV7A 1JHFA 3ZQ7A 4ZYHA 1BBYA 1OR7A 4WX9A 3O2PE 1LNWA 4KMFA 4BH9A 1TQMA 1Z9CA 3KP7A 3E6DA 4MNUA 4AIKA 1YW8A 4E70A 4OIRF 2V1UA 1FP2A 4O5VA 2DFIA 5BQTA 2MD5A 4L5JA 1CGPA 4GGGA 2K4BA 1BI0A 1KU3A 3ZMZA 2FBHA 5LHIA 1B1BA 4IHSA 2QVOA 5HS9A 2O8XA 4EM0B 3HRUA 5LRSA 2EA2A 1ZRDA 4IJAA 2Z99A 3FM3A 1ZGAA 3LA7A 3FWEA 1MJBA 5DDGA 3HHGA 2XAHA 2DO7A 4ZZDA 2CYYA 4XBFA 1XGOA 2VBWA 2HZTA 4LMYA 3L7WA 3BJ6A 1RIOH 4XLNF 4I98B 2RVCA 5DCMB 1YYVA 4ZYGA 4IRIA 1Z1DA 4KYWA 5BPIA 1LEAA 3KFWX 2A6HF 1FNNA 4IF4A 2A68F 3HOSA 3CUQA 4Y15A 1E17A 1FWZA 3LWFA 2XKOA 2MLGA 3IWZA 1YW9A 4I0AA 2CO5A 4UVBA 4GYIA 5K5QA 4LB5A 2CW0F 2DK8A 3J7AO 2X0LA 3CJNA 3RPQA 1ZLKA 2IW5A 2G7HA 3KEOA 5AIQA 4P9UA 1TNTA 4LFUA 4BHPA 4NB5A 1RZ4A 4EJUA 4ZH4F 1G3WA 5ICGA 5DUKA 2JPCA 1XSVA 1O7LA 5HDNA 2JZYA 5ERIA 3TGNA 4G7OF 2ZFWA 3WU0A 5EEHA 3GF2A 3P7NA 1RI7A 2RKHA 3T8TA 3CTAA 2AS5F 1IN8A 2Y48A 5CVIA 3V7SA 2GZWA 4G6DA 2STWA 4BYYA 4I09A 4ENMA 3EDPA 2XVCA 3L00A 2QENA 1UHWA 2XAGA 1X3UA 2WC2A 3ZPLA 5HLIA 4IRGA 1PP7U 2QZ8A 4N0BA 3L09A 3RTRA 4KIFA 2ZMEB 2HR3A 5KVRA 1BC7C 4AVPA 5CVRA 1H0MA 5CVJA 4I7HA 1VTNC 4CXFA 4CDGA 3KP5A 3WTWC 4M9SA 3GWZA 5LEJA 3RKYA 2NNYA 1HKQA 2XAJA 2F5EA 3V4GA 4WXCA 2WTEA 2JRTA 5D5VB 4KA4A 5F6FA 4GO1A 4G9YA 2BYVE 1ON1A 3BROA 3J81Z 1I5ZA 5K1YA 4MQ9F 3KP4A 1XCBA 2FQ3A 2EB7A 3DKWA 3TDUC 1QZZA 4UXNA 4RGRA 3WTVC 2Y0MA 2F5FA 5DCMA 3R61A 3FMSA 4R79A 5CYVA 3EUHA 1HW2A 3B02A 4EGZA 5E20A 2L01A 5FB2A 4TV7A 2FOKA 1SAXA 3MCZA 2VONA 3AAFA 2XASA 3I4PA 2R7DA 4M6XA 2PLYA 3DPLC 3Q9SA 1YTYA 1LB2A 3F72A 4MQVA 2VBXA 3RKXA 3KETA 5ICFA 1QZYA 2VOOA 2A61A 3RI4A 2IJLA 5TRDA 1S6LA 3ISPA 1PDNC 5CVVA 1OYWA 3H92A 2RV8A 1JGSA 3KLOA 4KN7X 2XAQA 4LG0B 3BPVA 3T5XA 4CZZA 4G94A 5DEQA 3E6CC 3P9IA 1IN4A 3WTXC 1Y0UA 2D1VA 3R60A 5D6FA 4MEXF 3E6BA 1ZG3A 3O6BB 4G7ZF 2MA3A 2L54A 4R1HA 1LDJA 5HDGA 5DYMA 4UV9A 1OKRA 2HTJA 3HRMA 2QBYB 4HV5A 3M9AA 2GQQA 3HRTA 2ZMEA 4ENNA 4M71A 1KQ8A 4WWCA 5D5UB 3F8BA 2GA2A 4NQWA 3T1BA 1R22A 4L9TA 3I5UA 3BP8A 1W7PB 5JR3A 5TJJA 3RYRA 2KIMA 4WF2A 3SZTA 2PJPA 2EFNA 3LA3A 1FBUA 4RGSA 4RB2C 2JPBA 4M9XA 1ZRCA 1ON2A 4AD9A 3VB2A 3OOPA 3ELKA 2Z9OA 3U2RA 4F7ZA 4JQFA 3BZ6A 3KE2A 2EV6A 3FXUA 4PGHA 4HF2A 3T8RA 2PBIA 3MFKA 2ZXJA 3FMQA 1LDKB 1G6NA 4RB1A 3WU1B 4UNOA 4NHJA 3V8LA 2BV6A 1UFMA 2XIGA 5A2QZ 4L18B 3CO6C 2VODA 2F5CA 3DV8A 4YIFA 2LSOA 1KU2A 5FLXZ 4KFCA 1S7AA 3ZMSA 5ED4A 4LG0A 2WV0A 2ESNA 2FBIA 2VC1A 5FGMA 1MD0A 1XGMA 4HX4A 3TO7A 2DQLA 1FX7A 2CWEA 3F21A 5BMZA 2KJBA 5ILUA 2KKOA 3KZZA 4ZYDA 4MGRA 4HF1A 3I71A 2ZKZA 1GXPA 4CYDA 5HLGA 1FC3A 3D0SA 3JW4A 1FYKA 1F5TA 1BC8C 4PCQA 1T39A 2QBYA 3ZMVA 1SD5A 1BJAA 1BI2A 1XDSA 1HQCA 2P6SA 3ROUA 5DCFA 4UVCA 1W7PA 3R4KA 4RB0A 3SFZA 5DUIA 3N4MA 2J5PA 3EETA 2O3FA 1FPQA 3DP7A 1W7PD 4OINF 1CF7B 5J8FA 4XLPF 1TBXA 2L02A 5D5WB 2P5LC 4G8XA 2OD5A 1YLFA 2LF8A 4JBAA 2OU2A 2DW4A 4S05A 3TKYA 4P5OA 1MJ9A 2HYGD 1LDDA 1NHAA 1STZA 1F4KA 1WRJA 2M8EA 1T0FA 3RJPA 1K78B 2ESHA 2VXZA 4PDKA 1Z6RA 5F1RA 2QM3A 1OMIA 1DP7P 3MAJA 1D5VA 1IAWA 1LVAA 3U1DA 1T6SA 2HS5A 1G3TA 2M1BA 1WQ2A 2K27A 2DK5A 3NQOA 3IKVA 4U0VA 3WTTC 3F8CA 5J6XA 5E1XA 5HS7A 2RC4A 2W57A 3JTHA 1D8JA 4P9FA 4B8XA 4Y13A 1RUNA 5JVTA 1BM9A 3GUDA 1DDNA 1FBQA 3RIRA 4M72A 4XSZF 4RB3C 1DPRA 3QP5A 4OMYA 2GAUA 4EQQA 1GHCA 3WE3A 3P9CA 3LQRA 4HOBA 3MWMA 2F2EA 1IF1A 3E5XA 2Q2EA 5E1WA 2VN2A 4FX4A 3HTSB 3HIFA 1U3EM 4YFNF 4N9IA 1B59A 2V1DA 2HDCA 4HYEA 4ZZLA 1KU9A 1QNTA 4KUMA 2BE5F 1IXCA 3BPXA 3CO7C 1HBXG 3IHUA 5IT9Z 2ISZA 3HSRA 5CLSA 3V7CA 1UB9A 4L5IA 4LGWA 2J5OA 1R7JA 5DD4A 5E1ZB 2M5WA 2K02A 2GWRA 4IRHA 1CF7A 1UCRA 4EV0A 2QUFA 4AIHA 4BXUA 1ZARA 3VOEA 3E6MA 3QAHA 4ESFA 2G9WA 1S7OA 2ZNZA 1P2FA 4M6YA 5L3CA 1J75A 2K4JA 1XSDA 2VT3A 1YO5C 1ZG5A 1R5GA 3MEXA 3RDIA 2IVMA 2PEXA 4BQAA 3BY6A 4EJOA 4HQMA 1Z91A 2P5VA 2RQPA 3JAMZ 1P6RA 2CSOA 1KU7A 2FBKA 5HLHA 2XGXA 4MTDA 5E8GA 1ONVA 2VC0A 4D0PA 2MH9A 3NRVA 2KIFA 2IT0A 3MZHA 1WI9A 1P4AA 1LJ9A 2NAZA 4OMZA 3DQVC 4A0YA 3L9FA 2HWVA 5BS6A 3IC7A 2PI0A 1P4XA 1I1GA 3D5LA 1XGNA 4AIJA 1ZH5A 5DD8A 2ADUA 3PQJA 2HKOA 5LRRA 1TQPA 1YIOA 3SHFA 1B9MA 5HOOA 2STTA 5JFRA 2PN6A 2VE9A 1S3JA 4HAMA 3VFZA 3J80Z 2JSCA 1BIBA 3LAJA 2ZCWA 5J8CA 2P4WA 2WWYA 4A0XA 2D45A 3H3ZA 4FHTA 3F8NA 3W6JB 3ABTA 2C6YA 1PP8F 3HYIA 5D8KB 5E8IA 1QPMA 3K1PA 4HW0A 1EH8A 2O03A 4Q5SF 2ZO4A 2MBFA 4KN4X 2PMHA 1OYYA 2DQRA 4RS8A 3K1MA 2EA4A 1ZAOA 3Q5FA 5LLQA 5D6EA 4EVIA 3E5UA 1K6OA 1TQIA 2QQ9A 4OIQF 2RNJA 2DT5A 3FZVA 2V79A 3ML6A 4U0WA 1H9GA 2MH2A 2E7XA 1R1TA 3GFLA 3ZMDA 2W85A 2MLKA 4I0BA 3CUOA 1SFXA 2HTSA 2H27A 3KZYA 2L4AA 3TO6A 4A5NA 1XDUA 2FMLA 3F8MA 2XRNA 1MZBA 2KIUA 2HGCA 2UXNA 4QLCU 1G3YA 1TNSA 2OQRA 2FMYA 2V9VA 1ZYRF 1W4MA 2H09A 4JK1X 1FSHA 2JT1A 5E18F 4O3MA 4WXDA 1ZN2A 3R0JA 1MKMA 4ENKA 3B73A 4YFKF 1SFUA 3GXOA 4IVNA 1IW7F 1YS6A 3I53A 3GEZA 1YS7A 3BOQA 1SD4A 3JTGA 2VBYA 4U0YA 5ICEA 2VOPA 1MDMB 3EYIA 1V3FA 2PFBA 1GXQA 2NRAC 3FXQA 3M8EA 3QPHA 4L9NA 3CLOA 2A6EF 4ASNA 4HLYA 5FD5A 3WGIA 4HQEA 2XAFA 2EV5A 3WTSC 1K7AA 2UZKA 2M45A 3HSEA 3GW2A 3EYYA 2NNNA 3J81K 2BBYA 3WGGA 1AOYA 3K0LA 3ZN1A 1HW1A 4OIOF 2R3SA 1BI1A 3I54A 2M30A 3T0YA 2EFPA 3V7RA 1O3RA 1J59A 2XKPA 1D8KA 3K69A 1B6AA 4LK0F 2CQKA 3ZMUA 5HDKA 1ZG1A 1SD7A 2V6CA 3COAC 4MHGA 5ILSA 3S2WA 1O3QA 2H94A 5D4RA 4WK8F 1Z05A 5D4SA 1QBJA 3GX4X 2OZ6A 2ELHA 2F5DA 1RUOA 2W24A 2FNPA 1MGTA 2ZJ2A 2VT2A 2P8TA 1KA8A 3EQLF 3M8FA 2DU9A 1U2WA 1TLHB 1I1SA 4UHTA 4Y17A 2H6CA 4BAYA 1J2XA 3C3WA 4LB6B 1U6GA 1XMAA 2OZUA 4RGXA 1U8RA 4A12A 2FU4A 3VODA 3ECHA 4O6JA 1KYWA 2W25A 3BDDA 5LGTA 5JHUA 2M87A 1MDMA 6PAXA 2JTVA 3PFIA 2XHKA 1V4RA 4H0EA 2GIVA 4UUVA 3IKTA 1IXRC 5HS8A 1XB4A 2FNAA 1ULYA 4K2EA 5H6QA 1XGSA 2D1HA 4M73A 3HUGA 4LLLA 2PQ8A 4HDVA 2O0YA 3IRRA 5KK1A 2CGPA 2QLZA 1F1ZA 1DPUA 1HSTA 3C18A 1D3YA 2E7WA 3HHHA 1XN7A 3O3KA 3TQNA 2UXXA 4A6DA 3U9GA 1SFEA 2HFHA 4LD5A 5LHHA 2QQAA 2FRHA 4HX7A 3K1NA 4HA8A 4HBLA 4PGGA 2O61A 3M1EA 3HTUA 3I0TA 3F6OA 3WTYC 3LQQA 2HQNA 2W84A 4AWXB 1R1UA 2IPQX 2K7LA 1FSEA 4CGZA 2CFXA 4OU0A 4MEYF 3WODF 4FT8A 3QOPA 4WXHA 4KDPA 5LBQA 4OIPF 4ON0A 3IWFA 2GXGA 3V8JA 2HQRA 1HXDA 1JXSA 3MQ0A 1TW3A 1EH6A 2HOEA 3N97A 4GXOA 4IPAA 1XSXA 3GFIA 4R8HA 2A69F 3JSOA 3DXJF 3FHZA 2ISYA 5DV5A 1FOKA 1ZRFA 4A2UA 5A2QK 5H20A 2OAZA 1U5TB 4ESBA 5FLXK 2DBBA 1O7FA 2EFWA 4IHTA 1S29A 3M7GA 3RKWA 3QU3A 2YU3A 1P92A 2FE3A 1J5YA 4HF0A 4UVAA 2LNBA 3F3XA 3JSPA 3I59B 2B0LA 3ZMTA 5FFZA 5L3EA 1HKTA 2AXLA
chains in the Genus database with same CATH superfamily
3CCEI 1R58A 3ABUA 4A3JJ 3CCVI 3FM5A 4V2GA 5ILVA 5CVUA 1B4AA 2EPFA 1XCVA 2LG4A 2OTLI 1KGSA 1MMSA 1U5TC 3KP3A 4A3DJ 1PUFA 1VQ4I 2FJ1A 2X1EA 3MKLA 4IEJA 1HSJA 3S3MA 4PJJA 4FCYA 3TOAA 1JT0A 3RZOJ 3REOA 2UV1A 5CJ9A 4ZYAA 2BOLA 1UJ8A 3BWGA 2HU9A 4BHCA 2FF4A 1XC5A 1R5HA 3KCCA 2R7WA 4RAZA 5EEGA 2QKMB 3KP2A 2LRDA 1Z7UA 1U8BA 4IQ4A 5H2FC 4Y52J 3BJOA 3C1DA 1J9IA 1E3PA 1MBJA 2D2WA 1ZQ3P 1QGPA 2Y75A 4IHXA 1IRGA 2CUZA 4NUBA 2MSYA 5DS9A 5LGUA 3K4MA 4GRIA 3D1NI 3DPTA 3CF5F 4FISA 2CUFA 4LLGF 2GOMA 4I01A 3OYDA 2HKXA 3BZCA 2RN7A 2DPDA 4Q47A 2H1KA 2Z5UA 5DTDA 3R6SA 2K85A 5FLMJ 3GTQJ 4GCVA 2ME0A 3B6CA 4PFOA 3DKYA 3M1CA 3OOUA 2QCOA 3WTUC 4ZYEA 4JP0A 4KICA 1MNEA 2E1CA 3TEDA 2K5CA 1WWXA 1T98A 3BJAA 3IRQA 5HVQC 3K4NA 1K78A 2LH9A 1X3WB 2VKEA 5L3DA 3H3UA 2LREA 2ZNYA 4BDYA 3HXLA 4H4KC 3DF8A 2YR2A 3PSFA 3GFMA 1WVRA 1NK2P 1X1BA 2QYOA 4G12A 2V9PA 3FKIJ 4BE2A 4RAYA 4YELA 4A0ZA 3BTCA 3MKWB 2EFOA 1ZGWA 4XKWA 1YW7A 3DFGA 3CMYA 4C2UA 3MN2A 2EV0A 2A3SA 3TOBA 3ZQGA 4EMSA 3OS0A 2UUZA 2QSFX 4FX0A 5BOXA 1PUEE 1MBFA 5HNFA 2Q0OA 4ZDOA 2Z33A 1FP1D 2FQ4A 5FKLA 3HGGA 1BR2A 1GVJA 1O4XA 4P55A 1LE8A 1UG0A 1G59A 4BJTA 2YSRA 4MTEA 4A5MA 5EEAA 1YFHA 2ZXHA 3LAPA 3ERMA 2PMZA 4CZCA 1UAAA 3CP8A 4C9YA 3ECOA 3VYRB 1XMXA 1T2KA 3TDZC 3VEPA 5HODA 2IA2A 2HQ5A 5GP9A 4BQQA 5JLXA 3OYKA 5K5RA 1O3TA 4DYRA 1U5TA 2HYFA 3WG9A 4DQ2A 5JVGF 3SJMA 1FIAA 4HV6A 4CHUA 1SD6A 1RKWA 1FLIA 4OAZA 2FA5A 3F23A 2AHQA 3NAUA 4I2OA 2OQGA 3RYPA 2L7FP 2NVYJ 4DYCA 3WHCA 3AFHA 1IZ1A 4JYKA 2IGNA 3CCQI 1TW2A 4U88A 3C2GA 2DXIA 1BOAA 1JI8A 2FSWA 4YG2F 3HRSA 5BPDA 2R7FA 3DLLF 3PUFA 2JRMA 1ZHFA 1D1BA 3WGHA 4B3AA 3VSKA 3DTKA 3I59A 2VL8A 2MC3A 1R1VA 3OSGA 3BCBA 2ID6A 2WAQA 4UB6C 5D5XB 2VE8A 2EFQA 4KIBA 4M9ZA 3PL8A 4BJ6C 3FMRA 1ETQA 1Z3XA 4U7BA 2DAOA 4DNCA 1F43A 4BHBA 4UB8C 4D7MA 2R7SA 2NS0A 2VKHA 4HDUA 4EGYA 4HZFA 2Z3YA 3NEUA 1SMTA 4RM2A 1USTA 3E3VA 5HNHA 2A05A 1ODDA 2VBZA 2XPVA 2BY0A 4Z6YA 2XUBA 1Z6TA 5JLWA 1O57A 3HOTA 3CF2A 2GOXB 3S14J 3O8HA 2LF7A 4Q4ZF 2JA2A 5JI6A 1WSUA 2JVHA 1O3SA 4OOIA 2GA1A 1B8IB 2CV1A 4LLNA 2RDPA 1A35A 1FIPA 3JR9A 4LJZF 5K7FA 4DIQA 5IT9K 2OA4A 2ACJA 2L3DA 5E17F 2H6BA 3ABMH 3F8FA 2EK5A 1HW5A 3GLXA 2OUMA 1IRFA 1XPXA 1DU6A 3QRFF 4ETSA 4CICA 1W5SA 2W00A 4FE4A 2GXAA 1KQ9A 3CCSI 1Y8RB 2HXIA 2G7UA 4EM1A 5LHGA 5LGNA 1SFOJ 2COBA 1VQ8I 4M3GA 4CCLA 2R7TA 2L9SA 2CUJA 3G3ZA 4JX6A 3H9GA 2IP2A 3LL7A 3K4LA 1QO0D 1MW7A 2A5YB 4I02A 4CO8A 4XR6A 2ZJQF 5CQGA 1YITI 3FXOA 2R0QC 1LEBA 5JHFA 3A01B 3J7AY 2TDXA 3M3YJ 2KPMA 4XNFA 2WADA 2GLOA 1ETKA 3JRIA 1EKEA 2F48A 1R00A 3U21A 3IAS2 2YPRA 1RPWA 2PG4A 1APLC 1OYIA 1XD7A 1G3SA 1ZTRA 1OCTC 1MBKA 2DOFA 3OV8A 3SDBA 5FROA 4BQNA 3P9KA 4HX8A 1HC8A 1ETYA 3ZN0A 5DM7F 3JRFA 1E2XA 4EM2A 1BIAA 1MH3A 4UV8A 2P5KA 4C3HJ 3Q0UA 4RM3A 4KNYA 4E7HA 5E3LA 4PFPA 2WY7Q 4RAGA 4IO9F 5L3BA 2ETHA 1FY7A 3DU6A 3JAMK 1BN5A 4BE0A 1IN6A 2KDOA 3A03A 3E5QA 3KIOA 1D1CA 3OYJA 3L2WA 2HEOA 3HC7A 4PZJA 4XLEA 2YU9J 4XRFA 3E97A 1FJLA 4DJAA 1YRNB 3LSTA 5FRMA 2XF6A 4KMUX 3PJRA 5M5XJ 4J01A 5K5OA 4ZTJA 4GYGA 2IA0A 2IA1A 1QZEA 1ZGJA 1AU7A 1IN7A 2X4HA 4F3QA 3CD6I 3QOEA 1I6XA 5D8LB 2KJCA 3KLNA 3PQKA 5EYRA 1RNLA 4XSXF 3DTEA 4PJLA 2IS6A 2DOEA 3I55I 2M2EA 2EJRA 3W2AA 3GLLA 3LA2A 4FE7A 2PX9A 1L0OC 3GZ5A 4G6QA 3VYSB 3FF5A 2IRFG 4XMYA 1OPCA 4U7DA 3L2RA 1I39A 3C7JA 2XGDA 4IHVA 2LKPA 3GO5A 2GXBA 4UUTA 5FFXA 1EA3A 3S1MJ 1OCOH 4KT5C 4ZTFA 1JE8A 2NYXA 4CCJA 3WE2A 2WAFA 3R0AA 2EIKH 2EWNA 3OIQA 2NS8A 2XSJC 1RR8C 1TTYA 4LIVA 4KIGA 3ULQB 2MD0A 2ZSHB 1JKRC 4A3GJ 4E7LA 1JKQC 2RAEA 5IT3A 3PIOF 3CZ6A 1G4DA 3ZGKA 5LEKA 4AYBN 4Y3OA 4HLXA 4FETA 4N4OB 3ZCOA 5J47A 1WFXA 3HSFA 3KEQA 3J7ZI 3SZPA 4ESJA 2LDUA 2YUSA 2ZBKA 3J80K 1VF9A 5J40A 4BBSJ 4L0ZB 1FBSA 3M8JA 3Q9VA 1J7KA 5F64A 4A6EA 2QQBA 4EJTA 3I4NJ 3K4BA 1WZ2A 1W36C 2DYRH 2E1NA 3MZYA 1FOXA 3UR3C 2PMUA 4S04A 1S8NA 4MIMA 1H8AC 2YX4A 4XORA 3SXYA 3GFJA 4IQJA 3DEEA 2HVRA 4IXAA 1B8IA 4WCGA 1J0RA 5L3FA 2RREA 1L3LA 1IG7A 2K86A 2KRFA 4QWQA 1PJRA 2BGCA 4B44A 3ZQCA 4EJWA 2QWWA 2VLAA 3GZ6A 1MJAA 1WPKA 2OBPA 1JKOC 1BJZA 1XMKA 3BQYA 4XKCA 3CCUI 3CJRB 3K2ZA 1R4NB 3PIPF 1FZPB 2VASA 4B48A 1MMNA 1C0WA 2E35A 5EDNA 2P7CB 1REPC 2LBFB 3SQNA 1WJCA 1D0ZA 2YX7A 3AG2H 1W5TA 5FO5A 3BR2A 1SEUA 3A0HC 3BTIA 1UHMA 2LK2A 3HJEA 2DTZA 3A01A 2QF7A 2DLLA 5AONA 4Y33A 2XV4S 3ERED 5K7HA 3G73A 3GYHX 1JKPC 1NTCA 1IO2A 2CG4A 3L2CA 2FXAA 3FXRA 2NOGA 3HKZA 2COMA 1TWHJ 1U78A 1AWCA 2NVQJ 3FX3A 1WGXA 3FXKA 3S1RJ 1OR7C 4W97A 3QU6A 5L3GA 4NC8A 3LFKA 3TO9A 3F6VA 4Q48A 1LQ1A 3BZKA 2O6GE 2UWMA 4G7HF 2RGVA 1T38A 1OCRH 1HKSA 2BXZA 2JQ7A 2XROA 1ZELA 4J19A 3DEUA 1WKMA 3BLYA 1JHHA 1A04A 3Q3SA 2CV2A 1OLTA 1VQ6I 5EGOB 3ZP5A 2F4IA 2P6TA 3V8KA 2DI3A 1GT0C 2KRCA 4N9HA 2ECBA 1BI3A 1YRNA 4XN0A 1QQIA 4L9JA 4M74A 4B09A 4DBQA 4BNCA 1YQAA 3K9TA 2NVUB 2I5UA 3IL2A 1YG2A 1KYZA 1LUJB 1SMYF 4L0YB 5H6RA 1IUYA 5ICCA 1YJNI 3QPTA 2L4MA 1TZLA 2Q8KA 1EF4A 4P96A 2VI6A 4FASD 4EJVA 3QP6A 4YFXF 3I64A 4RGUA 3RPUA 2FEZA 4ENJA 2V1XA 1KQ0A 4LK1F 2QQ8A 3CUQB 1W36D 4Z2YA 1Y0NA 1FYLA 1QPIA 2DFFA 2DPUA 1USSA 3RPUD 3S3OA 1IXSB 1K79A 1EH7A 4BL0B 1XG1A 4CCKA 1A31A 4YIIA 2ELJA 3JRHA 1W5CC 2JUCA 2XF5A 3H5RA 2GIZA 2JA5J 2F5VA 1I27A 1D0YA 1MMDA 4D5FA 2A07F 1IDZA 1R23A 1UZCA 4M3EA 1P7IA 1P4WA 1WH5A 5FD6A 3ZQHA 1FT9A 1X2NA 3P5JA 1HLVA 5AIPA 1F9NA 1D5YA 3HOUJ 1Q1HA 1ZLJA 2CJJA 4L9VA 5KAFC 4IOCF 4DZPA 1GV5A 1ZREA 3CDHA 2BW3B 1N78A 2P7VB 2JUGA 4BE1A 3VYTB 3F22A 3KP6A 4MFEA 1IN5A 3W6KB 4E4HA 3H0DA 1P7JA 1FTTA 1H9TA 5M5YJ 1B9NA 1UHSA 3EPZA 4CSWA 3ZQFA 2BEOA 2Y30A 3GVAA 5M3MJ 1JT6A 2JA7J 2WA0A 3FISA 2DTRA 3CQZJ 3CUQC 3I58A 1DUXC 1R36A 4MLOA 4ZDPA 3WTZA 2WBMA 1FYMA 1EV7A 4ZJZA 1VZ0A 1JHFA 3ZQ7A 2ZJPF 4ZYHA 1BBYA 1OR7A 4WX9A 3O2PE 1LNWA 3DU5A 3RCOA 5F04A 3DKXA 1AHDP 3JREA 2E2IJ 4KMFA 2V4JC 4BH9A 1TQMA 3CMMA 1GV2A 1Z9CA 1GHCA 3KP7A 4AC0A 1U9OA 3E6DA 4MNUA 3OYGA 2R5YB 4AIKA 1VQNI 1YW8A 1G2HA 3A1YA 2LBFA 2O7OA 2Y0SA 2ZC2A 4MFDA 4E70A 2AQFA 5K7ZA 4BXXJ 4RA2A 4OIRF 4B47A 5FKOA 2V1UA 1FP2A 4O5VA 2HXOA 2Y0SN 2XPUA 2Y9YA 4A69C 1R71A 2DFIA 3BG6A 2M4GA 2MD5A 3GZNB 4LITA 5BQTA 1RRJA 4L5JA 3EUAA 1CGPA 1UMQA 1VFCA 4GGGA 3OYLA 2Z16A 2K4BA 4BEHB 1DU0A 2LY1A 2A6TA 2LYCA 1BI0A 1KU3A 3ZMZA 5IOYA 2FBHA 2QGUA 5LHIA 3IUOA 3BR0A 4XONA 2LTPA 1B1BA 4IHSA 2ECCA 2QVOA 5IY5H 3HPGA 3GBGA 3I56I 5HS9A 3OYHA 2O8XA 2X9DA 3K70C 3OYIA 4EM0B 3HRUA 5LRSA 3BT9A 5KAIC 2EA2A 4B43A 4IX7A 1ZRDA 4XLHA 4IJAA 2Z99A 3FM3A 5EGOA 4HNTA 1ZGAA 3LA7A 3FWEA 1MJBA 2X85A 3LSJA 4M3FA 5DDGA 3HHGA 3CP2A 3TBIA 2XAHA 1FMVA 2DO7A 3OL3A 4ZZDA 2CYYA 2E5NA 4XBFA 1XGOA 1XS9A 2VBWA 3W6VA 4I76A 3E7LA 2HZTA 2O9LA 4LMYA 3L7WA 3BJ6A 1RIOH 2RNGA 4XLNF 1K61A 5IP7J 4I98B 5KCMA 3HL2A 1WCMJ 3I3LA 2RVCA 2MC4A 5DCMB 1YYVA 4ZYGA 4IRIA 1Z1DA 2CQQA 4KYWA 2CW8A 1YJWI 5BPIA 1LEAA 3KFWX 2A6HF 2IGOA 2IGKA 1FNNA 4IF4A 2A68F 2DMPA 3HOSA 3CUQA 2DN0A 3I9V2 4Y15A 1WI3A 3TW7A 1HF0A 2R93J 3HG9A 1E17A 2HNHA 2DFHA 3W2WA 1FWZA 1JUPA 3LWFA 2CQXA 2XKOA 2MLGA 3EUKL 3IWZA 3DBRB 3K4KA 4NC7A 1YW9A 2E5ZA 4I0AA 2CO5A 1BA5A 3BR3A 4UVBA 3AL0B 4GYIA 5K5QA 1X4OA 5B5EC 2CH0A 4LB5A 2WB1N 1A5JA 2CW0F 4OAYA 4DGWB 2DK8A 5CKTA 5LD2C 3FK7A 2BZTA 3J7AO 2X0LA 3CJNA 3S15J 1SVOA 2LOOA 1W0TA 1X1PA 2BW3A 3RPQA 1RR7A 3UKGA 3G6EI 1S9HA 3S2HJ 1ZLKA 1TP4A 2IW5A 2V26A 2G7HA 3KEOA 5AIQA 1K83J 4P9UA 1TNTA 4LFUA 1OISA 4PJMA 2KQRA 2L9RA 4BHPA 4NB5A 1RZ4A 4EJUA 4ZH4F 1G3WA 1JJ6C 4BUPA 4BY7J 3EUHC 1VQKI 5ICGA 5DUKA 5KNLA 2JPCA 4YIRX 2CMPA 1XSVA 4D7NA 1QHHD 3BTJA 1O7LA 5HDNA 2JZYA 2X6OA 5ERIA 5J4YA 3TGNA 3M4OJ 2ZFWA 1V54H 3WU0A 4G7OF 2E2JJ 5EEHA 2K3PA 1GVDA 1KONA 4A3KJ 3GF2A 1VQ5I 3AL0C 1QVTA 1RI7A 2RKHA 3P7NA 3T8TA 2ICWG 3CTAA 2AS5F 2F4OB 1Y6IA 2R5YA 1IN8A 2Y48A 5CVIA 2MABA 3V7SA 3G1LA 4HNVA 2GZWA 3OIPA 4G6DA 2DA6A 4BBRJ 3K70D 3RZDJ 5LFAA 3CC2I 2STWA 4BYYA 1R4MB 4I09A 4ENMA 3EDPA 1DGRM 2XVCA 4A3LJ 3L00A 2QENA 1UHWA 2LC2A 1AKHB 1MMGA 2XAGA 4XKBA 1X3UA 1X58A 1E3HA 3VSLA 2WC2A 1VQ9I 2JA8J 3ZPLA 5HLIA 4IRGA 1PP7U 2QZ8A 4N0BA 3L09A 2OF7A 1GDTA 3I4MJ 3RTRA 4KIFA 2ZMEB 2HR3A 5KVRA 2EILH 3MKZA 4BEHA 4AVPA 1BC7C 4PUSA 5CVRA 1H0MA 3H9JA 5CVJA 4I7HA 4NQWB 1VTNC 4CXFA 4CDGA 3OMYA 3HOVJ 1V5GA 2GM4A 1LFBA 3ZXSA 3KP5A 1IRXA 3WTWC 4M9SA 4X6AJ 3GWZA 5EF6A 3GMEA 5LEJA 3RKYA 2X1CA 2NNYA 1HKQA 2XAJA 3CDIA 2F5EA 3V4GA 3AKZA 4WXCA 4RDUA 2WTEA 2JRTA 5D5VB 4KA4A 3GTPJ 2X6WA 4C2TA 3DTIA 3CJQB 3G71I 5F6FA 4GO1A 4G9YA 1QU3A 1OJLA 1ON1A 2BYVE 3BROA 3J81Z 1I5ZA 5K1YA 4MQ9F 3KP4A 1XCBA 3OR2C 3KYCB 3MVPA 4BS9A 2CQ7A 2EB7A 2FQ3A 3DKWA 3TDUC 2F6CA 2ZMEC 1QZZA 4ABZA 4UXNA 2V1NA 4RGRA 4XKVA 4B4CA 2DT6A 2Y0MA 4CH7A 3WTVC 2KDZA 1X3ZB 1Z7LA 2F5FA 4KT6A 5DCMA 3R61A 3FMSA 4R79A 1ZR4A 1MMAA 5CYVA 3EUHA 2L7ZA 1HW2A 3B02A 1WJAA 2KT0A 4XRMA 4AVZA 4UUSB 2VPRA 3PM1A 4EGZA 3F0CA 5E20A 2L01A 2EZLA 3H36A 3KYLA 5FB2A 3K4JA 4U87A 3TW6A 4XRSA 4TV7A 4EATA 2FOKA 2NVXJ 1TWFJ 2A5WA 3MCZA 1SAXA 3S3NA 2VONA 2EZKA 2K40A 3KZIC 3AAFA 2XASA 4M3DA 2DYSH 1Y1VJ 3I4PA 1G8XA 2R7DA 4M6XA 2PLYA 3H9QA 4G6TB 3DPLC 2NXNB 2QKLB 3Q9SA 1YTYA 1LB2A 1BR1A 3F72A 2VBXA 4MQVA 3RKXA 3KETA 5ICFA 4LG3A 1QZYA 4DOZA 2A61A 3RI4A 4I99C 1HCRA 2VOOA 2IJLA 4IHWA 4HSTA 3HM5A 2Z2SB 1S6LA 3LSPA 5TRDA 4ANJA 2QSGX 3ISPA 1PDNC 2CV0A 2NVTJ 2HVSA 2EQRA 5CVVA 1QA6A 1MBGA 1OYWA 3H92A 1QRYA 2RV8A 1JGSA 1HDPA 2KRHA 2XRLA 1K6YA 1W1WE 2OV7A 2R7UA 1YX5A 3KLOA 4KN7X 3JRAA 2BHZA 2XAQA 4LG0B 3BPVA 1R9TJ 3NWSA 3T5XA 1LFUP 1ZR2A 4CZZA 4G94A 5DEQA 1X1AA 1ETVA 3W3CA 3E6CC 2DA7A 1KZHA 3P9IA 1IN4A 3LSKA 2KZVA 3WTXC 1Y0UA 2DMTA 2D1VA 3R60A 2R7ZJ 5D6FA 4MEXF 1Z0XA 3E6BA 1ZG3A 3O6BB 1A6IA 4G7ZF 2KP6A 2MA3A 2L54A 4R1HA 3SEQA 1U0JA 4XLFA 2HZDA 2QSHX 3IH2A 1LDJA 5HDGA 5DYMA 4UV9A 5FKKA 3IAM2 1OKRA 2HTJA 3HRMA 1AKHA 3CMEI 2M7AA 2EZHA 4HV5A 2HOSA 2QBYB 3M9AA 2GQQA 3HRTA 2ZFUA 4AIDA 4ITVA 2CW7A 2Y31A 2ZMEA 4ENNA 4M71A 4A3MJ 1KQ8A 4WWCA 1VQPI 2KIQA 5D5UB 3F8BA 3RQ4A 2ZSIB 4KITB 2GA2A 4NQWA 1MH4A 3LFUA 2EBIA 3T1BA 5FKNA 5TGTA 1R22A 2M9HA 1XTAA 4L9TA 3I5UA 3BP8A 3LMMA 3MD2A 1W7PB 3QYBA 2MFZA 1IDYA 4HEA2 5JR3A 2PJRB 1MNDA 1JGGA 5TJJA 3RYRA 2KIMA 4WF2A 4AYBA 3SZTA 2PJPA 4B1RA 1TL8A 2EFNA 2W7NA 1MSEC 3LA3A 3FKJA 4HRIA 2BXYA 5GPAA 1FBUA 4RGSA 4RB2C 2JPBA 4M9XA 1ZRCA 1ON2A 4P1WA 1BW6A 2DA5A 4NBQA 3VB2A 4AD9A 2JK3A 3OOPA 1HA8A 3ELKA 2Z9OA 4II2A 3U2RA 2HYJA 4F7ZA 3AG3H 5GAEJ 4JQFA 3BZ6A 4JX5A 4C2MJ 3KE2A 3JRBA 3GTOJ 2EV6A 3FXUA 4PGHA 2CFOA 4BDZA 4HF2A 3S32A 2KISA 2H1LA 3T8RA 2PBIA 1F36A 2AQEA 3MFKA 3OS1A 4UUSA 2VUMJ 2ZXJA 4V19K 4QTRA 2OCEA 3FMQA 2JJ7A 4XK4A 3U1KA 1LDKB 2L7KA 1T95A 3HOYJ 1LKXA 2VQHA 4RBOA 2E60A 1G6NA 1S7EA 3KEYA 4RB1A 3WU1B 4UNOA 4NHJA 1M1EB 2BV6A 2W1OA 3V8LA 1UFMA 2XIGA 3CC4I 4E7IA 2V9KA 3BR6A 3CCMI 3KYDB 2ID3A 5A2QZ 4L18B 3CO6C 2VODA 1D1AA 3PSIA 2F5CA 3DV8A 3GCMA 4YIFA 2LSOA 1KU2A 5FLXZ 2ZXIA 4KFCA 2R7QA 4RMNA 4JX4A 1S7AA 3ZMSA 4DZJA 5EZGA 5ED4A 4LG0A 2WV0A 1T0FC 2ESNA 4C3JJ 2B7EA 2FBIA 3RKQA 2VC1A 5FGMA 1MD0A 1XGMA 4HX4A 3TO7A 3K10A 3ZR8X 3DBLB 2DQLA 1FX7A 2CWEA 4F92B 1X4PA 3LSRA 4W1UA 3F21A 5BMZA 2DOAA 5FLVA 2DMNA 3OY9A 2KJBA 3CCYA 2O5RA 5ILUA 2KKOA 1GUUA 3BC8A 3KZZA 4N4NB 2K9MA 4ZYDA 3JRGA 4MGRA 2ME6A 2MW8A 4HF1A 5KHDA 2Q2EB 5EZHA 1K4TA 3I71A 2ZKZA 1GXPA 4BXFA 4CYDA 5DM6F 5HLGA 1FC3A 3D0SA 3JW4A 1FYKA 1QHGA 2KL4A 1F5TA 5C4XJ 4L5EA 1BC8C 1BR4A 5C4JJ 4PCQA 2HPIA 1T39A 5M3FJ 2QBYA 1NG7A 1I3QJ 1SD5A 3ZMVA 1K4SA 1BJAA 3OYAA 1BI2A 1JTXA 1ETXA 2DFEA 4QSHA 4CCMA 1XDSA 2Y9ZA 1HQCA 5TISC 1TWCJ 2P6SA 5IP6A 4M3BA 2XSDC 2XGEA 4RAFA 2HDWA 5F1JA 1HOMA 3ROUA 2OJED 3WU2C 5IP9J 4PK4A 5DCFA 3N05A 4UVCA 2Q1ZB 1W7PA 2OTJI 3R4KA 4RB0A 3SFZA 2KFDA 5DUIA 2PJRA 3N4MA 2J5PA 3EETA 2O3FA 2KZGA 1FPQA 1POGA 3DP7A 1W7PD 3ZRGA 3BG3A 3OL4A 4OINF 1CF7B 5J8FA 4CYCB 1T33A 4F55A 3IP4B 4XLPF 3S1QJ 1TBXA 4X1EA 2L02A 5D5WB 4IL6C 2DMQA 2P5LC 4A3FJ 2H8RA 4G8XA 2OD5A 4PSXA 3CDLA 3BG5A 3OYNA 1SVMA 1YLFA 1N25A 2LF8A 4JBAA 3S1NJ 2OU2A 2FD5A 3HOXJ 2DW4A 4S05A 4D5CA 2NS7A 3TKYA 4P5OA 2TCTA 4XL9A 2JVGA 1MJ9A 2HYGD 3D5SC 1LDDA 1NHAA 1STZA 3X2QH 1F4KA 1WRJA 3OR1C 3DLAA 5CPRB 2M8EA 4BJ5C 1LVKA 1T0FA 1S5LC 3RJPA 3ABLH 3BG9A 1K78B 4S0HB 2ESHA 5J3LA 3TMOA 2HDDA 2VXZA 4PDKA 5J1RA 1Z6RA 5F1RA 3BG7A 2EIMH 3FBNB 2QM3A 2EINH 4MO7A 2X48A 2MG4A 3GTMJ 1SFKA 1OMIA 1DP7P 3MAJA 1D5VA 3RQIA 1IAWA 1LVAA 3U1DA 1T6SA 2HS5A 3H1CA 4A3BJ 1IGNA 1G3TA 2M1BA 4JOMA 3HB9A 3KX2A 4ZC3A 3OSFA 3ZQLA 1WQ2A 2K9LA 2K27A 1RC9A 2DK5A 5M5WJ 3ZOBA 1QVUA 4DYQA 2OPTA 3NQOA 1IUFA 3IKVA 2VQGA 1Q1VA 4U0VA 3SZGA 3F8CA 3WTTC 3VPRA 2V6EA 3FDYA 4XIDA 5J6XA 5E1XA 5HS7A 2RC4A 2W57A 4KJZA 2DJNA 3FBIB 3JTHA 1D8JA 4P9FA 4B8XA 4BU2A 2EZIA 4Y13A 1RUNA 5JVTA 5B1BH 1BM9A 2EH3A 3GUDA 4RLFA 4BGDA 4BY1J 3H5NA 4CA0A 1DDNA 2HOTA 1FBQA 3RIRA 1OCZH 4M72A 1Y8QB 2K9NA 1TT0A 4XSZF 1OQYA 1TWAJ 2XPWA 4RB3C 1DPRA 1Z3YA 3QP5A 2DCEA 2G0EA 4OMYA 1WJ5A 3WG7H 2GAUA 2BY3A 4EQQA 5IYCJ 2IAIA 4V2FA 3WE3A 3FXMA 3P9CA 4I6ZA 3LQRA 4HOBA 2DA4A 3MWMA 1Y56A 2F2EA 4QIWN 1IF1A 3E5XA 2HI3A 2Q2EA 4HNUA 4PSWA 2X6XA 5E1WA 1TC3C 1R5ID 5GTHC 1WJEA 3OYMA 2VN2A 2L5QA 3O8GA 1X1CA 4FX4A 3OYFA 2B9SA 3HTSB 5GAGJ 3HIFA 1RESA 1T56A 1U3EM 1BOBA 4YFNF 4N9IA 1B59A 2V1DA 4NNJA 2HDCA 4HYEA 1J09A 4ZZLA 4C30A 2K9SA 2TRTA 1V5EA 1KU9A 1QNTA 4KUMA 2BE5F 4DBRA 1MSFC 1IXCA 3GTJJ 3BPXA 3CO7C 1HBXG 3HEFA 3IHUA 5IT9Z 2VQCA 2ISZA 3HSRA 5CLSA 3V7CA 1UB9A 4L5IA 4LGWA 4E7ZA 3B6AA 2J5OA 1R7JA 3H35A 5DD4A 1VQ7I 3S2DJ 5E1ZB 1Y39A 2M5WA 1YX3A 2K02A 2WB1A 5EJCA 2IS4A 4D9JA 1IJWC 1ITYA 3JRDA 3IH3A 2GWRA 1R6RA 4IRHA 4XOTA 1CF7A 5FRNA 1UCRA 4FQGA 3SEZA 4CYCA 3C2BA 4EV0A 3TP3A 2QUFA 4AIHA 4BXUA 1ZARA 3VOEA 3E6MA 4B3XA 2GBYA 3QAHA 3BR1A 3C2HA 4ESFA 2G9WA 3K6GA 1S7OA 2ZNZA 1P2FA 4M6YA 5L3CA 1J75A 2K4JA 1XSDA 3NWTA 2HPMA 3H3VK 5IPAA 2VT3A 1YO5C 2R7OA 1ZG5A 3HGYA 1WJFA 1R5GA 3MEXA 3RDIA 1DGWY 5B1AH 3K7AJ 1ETOA 2LY9A 5F0HA 2IVMA 2BVLA 1TWGJ 2MGQA 2IS2A 2PEXA 4BQAA 2L2OA 4HSRA 1DQUA 3BY6A 2DMUA 4EJOA 4HQMA 2O8KA 1Z91A 2P5VA 2P81A 1LPQA 1PVEA 2RQPA 3JAMZ 1P6RA 2L9VA 2M8GX 2CSOA 1KU7A 2B63J 2FBKA 5HLHA 2R5ZB 2VJIA 5F0CA 2XGXA 4MTDA 5E8GA 1YHQI 3DBHB 1ONVA 4E6KG 2VC0A 4D0PA 1UG2A 1YJ9I 2Y69H 1E0EA 2MH9A 1OCCH 3NRVA 2KIFA 2IT0A 3MZHA 3ASNH 1NH3A 1WI9A 1P4AA 4QPOA 1FMWA 1LJ9A 2NAZA 2M0CA 4OMZA 3DQVC 4A0YA 3HPHA 3L9FA 2HWVA 2M3AA 2K9QA 3CC7I 2ZB9A 4NC6A 1YE9A 2BHYA 1BL0A 2JN6A 2XGCA 5BS6A 3IC7A 2PI0A 4IKFA 2HOAA 1D0XA 4XQFA 3MKYB 1P4XA 1I1GA 2ELKA 2PMZN 3D5LA 5F0FA 1DP3A 1ETWA 2R4GA 1XGNA 4M6VA 4AIJA 3CCJI 1ZH5A 5DD8A 2ADUA 4LOCA 5EG0B 3M07A 3PQJA 5E3MA 2M4KA 2HKOA 2X6YA 1MBHA 4E7JA 2LMDA 4LIUA 5LRRA 3FHNA 4XICA 1TQPA 1UELB 1YIOA 3SHFA 1SC7A 4QPQA 4OWRB 1B9MA 3L1PA 5HOOA 2STTA 3ABKH 5JFRA 2PN6A 2VE9A 1WJDA 1S3JA 4HAMA 3FK6A 3VFZA 2DA3A 3J80Z 2JSCA 3IV5A 4BKXA 1AA7A 1BIBA 2FX0A 3LAJA 1IC8A 2ZCWA 2DODA 5J8CA 2P4WA 2WWYA 4A0XA 2D45A 3H3ZA 2P0WA 1N75A 4FHTA 3F8NA 3W6JB 3ABTA 4HG2A 2C6YA 1PP8F 2M0MA 4E7SA 3IH4A 1CQTA 3HYIA 5D8KB 5E8IA 1N77A 1QPMA 1ACIA 2WAQN 1MBEA 3K1PA 4AUXA 4A3IJ 3CJTB 3LSGA 3TL4X 4HW0A 9ANTA 1EH8A 4CUGA 2O03A 4Q5SF 2CU7A 2ZO4A 2MBFA 5IYDJ 4KN4X 2PMHA 1OYYA 2DQRA 4IZZA 4RS8A 3CLQA 3K1MA 2JA6J 3OWTA 2EA4A 2BVMA 1SANA 1ZAOA 4Y7NJ 3Q5FA 3DPUA 5LLQA 5D6EA 3DCFA 4EVIA 3E5UA 1K6OA 1TQIA 2QQ9A 4OIQF 2RNJA 2DT5A 3FZVA 2V79A 3ML6A 3PNTA 2DJIA 1WHUA 2Y2ZA 2V7FA 4U0WA 1H9GA 2MH2A 2E7XA 2DDAA 3AG4H 3GTKJ 2VIXA 2DA2A 1R1TA 3GFLA 4II3A 2WY8Q 3ZMDA 4XRSG 5E3NA 2W85A 2MLKA 4I0BA 2R7RA 3LSHA 2E1MB 4BQOA 2KMUA 2D5VA 3CUOA 1SFXA 2HTSA 3SDGA 2H27A 3KZYA 2XAUA 4C3IJ 3JRCA 2M7BA 4F91B 2L4AA 3TO6A 1SVLA 4A5NA 4XLCA 1XDUA 2FMLA 3F8MA 1MIJA 2XRNA 1MZBA 5GPCA 2KIUA 2HGCA 2UXNA 4QLCU 1G3YA 1TNSA 2OQRA 2FMYA 2XF7A 3HBLA 2V9VA 1ZYRF 1W4MA 2YS9A 2H09A 4JK1X 5GAHJ 4UY8I 3CCLI 4GFBA 1FSHA 1FTZA 4E7KA 3W2VA 2R5ZA 3E1SA 3L2QA 3OYBA 2JT1A 5E18F 4O3MA 5GTIC 1Z21A 2QA4I 4WXDA 1ZN2A 2AXTC 2VXDA 3R0JA 1ZKGA 1MKMA 2OCCH 2ZJRF 1JUSA 4ENKA 5FJ8J 3B73A 4A93J 2LVSA 4YFKF 3Q0WA 5J1YA 4D1QA 3FXJA 1SFUA 1VQOI 3GXOA 4IVNA 1IW7F 1ZK8A 5BNGA 1U9NA 1FOYA 1YS6A 2E1MC 3I53A 3GEZA 1YS7A 3BOQA 2W82A 2FOWA 1SD4A 2WV1A 3JTGA 2VBYA 2VJ4A 4NDLA 3LSIA 4U0YA 2IXSA 5ICEA 2VOPA 3BCAA 2NOJB 1MDMB 3EYIA 1V3FA 2LR8A 1A36A 2PFBA 2I10A 3RSNA 2RQQA 1H88C 3K4CA 3HDDA 1GXQA 2NRAC 3FXQA 2XDVA 3M8EA 5EG0A 3QPHA 4L9NA 3CLOA 2A6EF 5IOZA 4ASNA 3L2UA 2VQLA 3A0BC 4HLYA 4XLAA 5FD5A 2VB6A 3S93A 3WGIA 1VQMI 4HQEA 2CRGA 2XAFA 2EV5A 3WTSC 3HUGB 1K7AA 2X51A 2UZKA 2M45A 3HSEA 3OYCA 3MMYB 3GW2A 3EYYA 4ZDLA 5E79C 2NNNA 1BW5A 1FOWA 1V5FA 4Y4RA 1IV8A 4A3EJ 3S17J 4XN3A 2W48A 3J81K 1X1DA 2BBYA 3WGGA 3ASOH 3K0LA 2R7VA 1AOYA 3ZN1A 4X0GA 1HW1A 2EIJH 1W0UA 2IS1A 4OIOF 2R7XA 2R3SA 1BI1A 3I54A 1V55H 2K3FA 2M30A 1YI2I 4GDFA 3T0YA 2EFPA 2I8DA 4CCOA 3V7RA 3ONQA 1O3RA 1B72B 3G4SI 2Z1DA 3CESA 3FXLA 3CCRI 4EEFG 3A02A 1J59A 2XKPA 1D8KA 5J1UA 3S16J 1JJ8C 3HZJA 3PFYA 2QEXI 2BY2A 3K69A 1X19A 1B6AA 4LK0F 4BACA 2CQKA 3ZMUA 5HDKA 3HOWJ 3G1MA 3QODA 1ZG1A 1SD7A 2V6CA 3COAC 4MHGA 1OCPA 5ILSA 3S2WA 1O3QA 2H94A 1P9QC 1RKTA 4PJ0C 3V42A 1VQLI 5D4RA 2E34A 5FKMA 3SYTA 4WK8F 3L2VA 2L9NA 1Z67A 1Z05A 5D4SA 1QBJA 3CMAI 2L0KA 3PNVA 2OZ6A 3GX4X 1R49A 4CCNA 2LKXA 2KHMA 3GTLJ 3J7YJ 2ELHA 2F5DA 1RUOA 2E71A 2W24A 4YEJA 1T08B 5C3EJ 3HKZN 5F27A 3DEWA 2AO9A 2FNPA 1MGTA 2ZJ2A 2VT2A 2P8TA 2XB0X 1KA8A 3EQLF 3M8FA 2DU9A 1U2WA 2IBDA 2CS3A 1TLHB 3PNYA 1I1SA 4UHTA 4Y17A 2H6CA 2LFBA 4BAYA 5C44J 1J2XA 3OIOA 3C3WA 3VYUB 2N8GA 2HVQA 3NARA 4LB6B 3SFIA 5B66C 1U6GA 1XMAA 4IOAF 2OZUA 4RGXA 3H0GJ 1U8RA 3G1OA 2XB5A 1YIJI 1EJ9A 4A12A 2FU4A 5J4VA 4YRVA 1I3AA 3LNQA 3VODA 1I6HJ 3ECHA 4O6JA 1KYWA 2MYSA 2W25A 3G2BA 4XM3A 3BDDA 3VWBA 5LGTA 1WJBA 5JHUA 1I50J 1TT5B 3TP0A 2E2HJ 1PUFB 1RETA 2M87A 1Z77A 2E36A 1MDMA 6PAXA 3GTGJ 1YOVB 2JTVA 3PFIA 4IHYA 1Y1WJ 2XHKA 1V4RA 3A2KA 3K2AA 4H0EA 2GIVA 1H89C 3IKTA 1E3OC 4UUVA 1IXRC 3A4CA 2DT7B 1GLNA 2WAEA 5HS8A 1XB4A 2XC7A 2FNAA 1ULYA 4K2EA 5H6QA 4XOPA 3PUBA 5E3OA 1XGSA 1WH7A 3WHBA 2D1HA 1ORKA 4HPQA 2F4MB 3HUGA 4M73A 2LLKA 2BY1A 4LLLA 3ESWB 2PQ8A 2R92J 3JCUC 4F93B 4HDVA 2O0YA 3IRRA 5KK1A 3BR5A 2CGPA 2QLZA 2DA1A 1LFPA 1F1ZA 2VJJA 3S8PA 1DPUA 1HSTA 3C18A 2IGMA 1D3YA 3OS2A 2HQAA 2E7WA 2ZXWH 1VNDA 3HHHA 1XN7A 3O3KA 3TQNA 2UXXA 4A6DA 3BTLA 2JWTA 1VI0A 2X1DA 3U9GA 2OC6A 1SFEA 2HFHA 4LD5A 5LHHA 4J00A 2QQAA 2FRHA 3ZQQA 3K1NA 4HA8A 4HBLA 4HX7A 4PGGA 2O61A 3M1EA 3HTUA 3I0TA 1PYVA 3F6OA 3WTYC 1FEXA 3LQQA 1HDDC 1A6QA 2HQNA 2W84A 2E19A 2W4SA 3QPSA 3D5RC 4AWXB 2JSPA 5F08A 3DWLE 1R1UA 2IPQX 3QWLA 2K7LA 1JTYA 1FSEA 4CGZA 4A3CJ 2CFXA 4OU0A 3AG1H 4MEYF 3WODF 3QPLA 1ENHA 2IEKA 2L7MP 1B72A 4FT8A 3QOPA 3Q0VA 3E0JB 4WXHA 1NK3P 4KDPA 3UNGC 3LSMA 5LBQA 4F52A 4ON0A 4OIPF 3IWFA 3FIWA 5B3SH 2GXGA 3V8JA 2VKDA 5CQEA 2H8WA 3LOCA 2HQRA 5GADJ 1HXDA 1JXSA 1ERDA 1OFCX 2FUG2 3MQ0A 4FTHA 1IRZA 2VJ5A 1TW3A 1EH6A 2HOEA 4KISA 3N97A 1LE8B 2CQNA 2LD5A 4GXOA 2E1OA 1SAUA 4IPAA 2LKSA 1IV6A 1XSXA 3GFIA 4AM3A 4R8HA 5IYBJ 2A69F 4DW6A 3QYFA 3QQAA 3DXJF 3JSOA 3H5AA 2ISYA 3FHZA 5DV5A 3QYEA 1FOKA 1ZRFA 4A2UA 5A2QK 5H20A 2OAZA 3BQZA 1U5TB 4ESBA 1XX5A 5HLTA 4AU7A 5FLXK 2VKVA 3MZ8A 3HOZJ 2DBBA 1O7FA 1X2MA 4PJNA 2EFWA 2JMWA 1NG6A 4IHTA 1S29A 3F9KA 3PO2J 3M7GA 3RKWA 1S72I 3ZQIA 2CUEA 3KPHA 2VPLA 2KLOA 2LP0A 3OYEA 3QU3A 2YU3A 3VDXA 1P92A 2LY2A 2FE3A 1J5YA 4HF0A 4UVAA 2LNBA 1JUMA 3F3XA 4RLQA 3I59B 3JSPA 2B0LA 3PO3J 1MNMC 3ZMTA 2M34A 5FFZA 5L3EA 1T8IA 1HKTA 2AXLA 2DDBA
chains in the Genus database with same CATH topology
1R58A 3ABUA 3FM5A 5ILVA 5CVUA 1B4AA 1XCVA 1KGSA 1U5TC 3KP3A 1HSJA 3TOAA 3REOA 5CJ9A 3BWGA 4BHCA 2FF4A 1R5HA 3KCCA 4RAZA 5EEGA 3KP2A 1Z7UA 3BJOA 3C1DA 1J9IA 2D2WA 1QGPA 2Y75A 1IRGA 5LGUA 3DPTA 4LLGF 4I01A 2HKXA 2RN7A 2DPDA 4Q47A 2Z5UA 3R6SA 4GCVA 3WTUC 4ZYEA 4KICA 2E1CA 1WWXA 1T98A 3BJAA 3IRQA 5HVQC 1K78A 5L3DA 3H3UA 2ZNYA 3DF8A 2YR2A 3GFMA 2QYOA 4RAYA 4A0ZA 2EFOA 1YW7A 3DFGA 2EV0A 2A3SA 3TOBA 4EMSA 4FX0A 5BOXA 1PUEE 2Q0OA 2Z33A 1FP1D 1GVJA 4P55A 2YSRA 4MTEA 4A5MA 1YFHA 3LAPA 3ECOA 1T2KA 3TDZC 3VEPA 2IA2A 5K5RA 1O3TA 1U5TA 2HYFA 3WG9A 4DQ2A 4HV6A 4CHUA 1SD6A 1FLIA 2FA5A 3F23A 4I2OA 2OQGA 3RYPA 1IZ1A 1TW2A 4U88A 1BOAA 2FSWA 4YG2F 3HRSA 5BPDA 2R7FA 1ZHFA 3WGHA 3I59A 2MC3A 1R1VA 5D5XB 2VE8A 2EFQA 4KIBA 4M9ZA 3FMRA 4U7BA 2DAOA 4DNCA 4BHBA 2NS0A 4HDUA 4EGYA 4HZFA 2Z3YA 3NEUA 1SMTA 1USTA 3E3VA 2VBZA 1ODDA 2XUBA 1Z6TA 1O57A 3HOTA 4Q4ZF 2LF7A 5JI6A 1WSUA 1O3SA 4OOIA 2GA1A 4LLNA 2RDPA 4LJZF 5IT9K 2OA4A 2ACJA 2L3DA 5E17F 2H6BA 3F8FA 2EK5A 1HW5A 3GLXA 1IRFA 3QRFF 4ETSA 4CICA 1W5SA 1KQ9A 2G7UA 4EM1A 5LHGA 5LGNA 3G3ZA 2IP2A 1QO0D 4I02A 2A5YB 4CO8A 1LEBA 2TDXA 1R00A 2YPRA 2PG4A 1OYIA 1XD7A 1G3SA 3OV8A 3P9KA 4HX8A 3ZN0A 1E2XA 4EM2A 1BIAA 4UV8A 2P5KA 4KNYA 5L3BA 2ETHA 1FY7A 3JAMK 1BN5A 1IN6A 3E5QA 2HEOA 4PZJA 4XRFA 3E97A 3LSTA 4KMUX 5K5OA 4GYGA 2IA0A 2IA1A 1ZGJA 1IN7A 2X4HA 1I6XA 5D8LB 2KJCA 3KLNA 3PQKA 1RNLA 4XSXF 2EJRA 3LA2A 1L0OC 3GZ5A 4G6QA 3FF5A 2IRFG 1OPCA 4U7DA 3C7JA 2LKPA 3GO5A 2GXBA 5FFXA 4KT5C 1JE8A 2NYXA 3WE2A 3R0AA 2EWNA 1TTYA 4KIGA 3ULQB 1G4DA 5IT3A 5LEKA 4HLXA 3HSFA 3KEQA 3SZPA 4ESJA 2LDUA 2ZBKA 3J80K 4L0ZB 1FBSA 3Q9VA 1J7KA 5F64A 4A6EA 2QQBA 4EJTA 2E1NA 3MZYA 4S04A 2PMUA 1S8NA 2YX4A 3SXYA 3GFJA 4IXAA 4WCGA 1J0RA 5L3FA 1L3LA 2K86A 2KRFA 4QWQA 2BGCA 4EJWA 2QWWA 3GZ6A 1MJAA 2OBPA 1XMKA 3K2ZA 1FZPB 1C0WA 2P7CB 1REPC 3SQNA 2YX7A 1W5TA 5FO5A 1UHMA 2DLLA 5AONA 2XV4S 3ERED 3G73A 3GYHX 2CG4A 3L2CA 2FXAA 3FXRA 2COMA 1U78A 1AWCA 3FX3A 3QU6A 5L3GA 3LFKA 3TO9A 3F6VA 4Q48A 1LQ1A 2O6GE 2UWMA 4G7HF 2RGVA 1T38A 1HKSA 2XROA 3DEUA 1WKMA 1JHHA 1A04A 3ZP5A 2P6TA 3V8KA 2DI3A 4N9HA 1BI3A 1QQIA 4L9JA 4M74A 4B09A 4BNCA 1YQAA 3K9TA 3IL2A 1YG2A 1KYZA 1SMYF 4L0YB 5H6RA 1IUYA 5ICCA 3QPTA 2L4MA 2Q8KA 4P96A 4EJVA 3QP6A 4YFXF 3I64A 4RGUA 3RPUA 2FEZA 4ENJA 2V1XA 1KQ0A 4LK1F 3CUQB 4Z2YA 1FYLA 2DPUA 1USSA 1IXSB 1K79A 1EH7A 4YIIA 1I27A 2A07F 1R23A 1P4WA 5FD6A 1FT9A 5AIPA 1F9NA 1Q1HA 1ZLJA 4L9VA 1ZREA 3CDHA 2P7VB 3F22A 3KP6A 1IN5A 3W6KB 1H9TA 1B9NA 2BEOA 3GVAA 2DTRA 3CUQC 3I58A 1DUXC 1R36A 3WTZA 1FYMA 1EV7A 1JHFA 3ZQ7A 4ZYHA 1BBYA 1OR7A 4WX9A 3O2PE 1LNWA 4KMFA 4BH9A 1TQMA 1Z9CA 3KP7A 3E6DA 4MNUA 4AIKA 1YW8A 4E70A 4OIRF 2V1UA 1FP2A 4O5VA 2DFIA 5BQTA 2MD5A 4L5JA 1CGPA 4GGGA 2K4BA 1BI0A 1KU3A 3ZMZA 2FBHA 5LHIA 1B1BA 4IHSA 2QVOA 5HS9A 2O8XA 4EM0B 3HRUA 5LRSA 2EA2A 1ZRDA 4IJAA 2Z99A 3FM3A 1ZGAA 3LA7A 3FWEA 1MJBA 5DDGA 3HHGA 2XAHA 2DO7A 4ZZDA 2CYYA 4XBFA 1XGOA 2VBWA 2HZTA 4LMYA 3L7WA 3BJ6A 1RIOH 4XLNF 4I98B 2RVCA 5DCMB 1YYVA 4ZYGA 4IRIA 1Z1DA 4KYWA 5BPIA 1LEAA 3KFWX 2A6HF 1FNNA 4IF4A 2A68F 3HOSA 3CUQA 4Y15A 1E17A 1FWZA 3LWFA 2XKOA 2MLGA 3IWZA 1YW9A 4I0AA 2CO5A 4UVBA 4GYIA 5K5QA 4LB5A 2CW0F 2DK8A 3J7AO 2X0LA 3CJNA 3RPQA 1ZLKA 2IW5A 2G7HA 3KEOA 5AIQA 4P9UA 1TNTA 4LFUA 4BHPA 4NB5A 1RZ4A 4EJUA 4ZH4F 1G3WA 5ICGA 5DUKA 2JPCA 1XSVA 1O7LA 5HDNA 2JZYA 5ERIA 3TGNA 4G7OF 2ZFWA 3WU0A 5EEHA 3GF2A 3P7NA 1RI7A 2RKHA 3T8TA 3CTAA 2AS5F 1IN8A 2Y48A 5CVIA 3V7SA 2GZWA 4G6DA 2STWA 4BYYA 4I09A 4ENMA 3EDPA 2XVCA 3L00A 2QENA 1UHWA 2XAGA 1X3UA 2WC2A 3ZPLA 5HLIA 4IRGA 1PP7U 2QZ8A 4N0BA 3L09A 3RTRA 4KIFA 2ZMEB 2HR3A 5KVRA 1BC7C 4AVPA 5CVRA 1H0MA 5CVJA 4I7HA 1VTNC 4CXFA 4CDGA 3KP5A 3WTWC 4M9SA 3GWZA 5LEJA 3RKYA 2NNYA 1HKQA 2XAJA 2F5EA 3V4GA 4WXCA 2WTEA 2JRTA 5D5VB 4KA4A 5F6FA 4GO1A 4G9YA 2BYVE 1ON1A 3BROA 3J81Z 1I5ZA 5K1YA 4MQ9F 3KP4A 1XCBA 2FQ3A 2EB7A 3DKWA 3TDUC 1QZZA 4UXNA 4RGRA 3WTVC 2Y0MA 2F5FA 5DCMA 3R61A 3FMSA 4R79A 5CYVA 3EUHA 1HW2A 3B02A 4EGZA 5E20A 2L01A 5FB2A 4TV7A 2FOKA 1SAXA 3MCZA 2VONA 3AAFA 2XASA 3I4PA 2R7DA 4M6XA 2PLYA 3DPLC 3Q9SA 1YTYA 1LB2A 3F72A 4MQVA 2VBXA 3RKXA 3KETA 5ICFA 1QZYA 2VOOA 2A61A 3RI4A 2IJLA 5TRDA 1S6LA 3ISPA 1PDNC 5CVVA 1OYWA 3H92A 2RV8A 1JGSA 3KLOA 4KN7X 2XAQA 4LG0B 3BPVA 3T5XA 4CZZA 4G94A 5DEQA 3E6CC 3P9IA 1IN4A 3WTXC 1Y0UA 2D1VA 3R60A 5D6FA 4MEXF 3E6BA 1ZG3A 3O6BB 4G7ZF 2MA3A 2L54A 4R1HA 1LDJA 5HDGA 5DYMA 4UV9A 1OKRA 2HTJA 3HRMA 2QBYB 4HV5A 3M9AA 2GQQA 3HRTA 2ZMEA 4ENNA 4M71A 1KQ8A 4WWCA 5D5UB 3F8BA 2GA2A 4NQWA 3T1BA 1R22A 4L9TA 3I5UA 3BP8A 1W7PB 5JR3A 5TJJA 3RYRA 2KIMA 4WF2A 3SZTA 2PJPA 2EFNA 3LA3A 1FBUA 4RGSA 4RB2C 2JPBA 4M9XA 1ZRCA 1ON2A 4AD9A 3VB2A 3OOPA 3ELKA 2Z9OA 3U2RA 4F7ZA 4JQFA 3BZ6A 3KE2A 2EV6A 3FXUA 4PGHA 4HF2A 3T8RA 2PBIA 3MFKA 2ZXJA 3FMQA 1LDKB 1G6NA 4RB1A 3WU1B 4UNOA 4NHJA 3V8LA 2BV6A 1UFMA 2XIGA 5A2QZ 4L18B 3CO6C 2VODA 2F5CA 3DV8A 4YIFA 2LSOA 1KU2A 5FLXZ 4KFCA 1S7AA 3ZMSA 5ED4A 4LG0A 2WV0A 2ESNA 2FBIA 2VC1A 5FGMA 1MD0A 1XGMA 4HX4A 3TO7A 2DQLA 1FX7A 2CWEA 3F21A 5BMZA 2KJBA 5ILUA 2KKOA 3KZZA 4ZYDA 4MGRA 4HF1A 3I71A 2ZKZA 1GXPA 4CYDA 5HLGA 1FC3A 3D0SA 3JW4A 1FYKA 1F5TA 1BC8C 4PCQA 1T39A 2QBYA 3ZMVA 1SD5A 1BJAA 1BI2A 1XDSA 1HQCA 2P6SA 3ROUA 5DCFA 4UVCA 1W7PA 3R4KA 4RB0A 3SFZA 5DUIA 3N4MA 2J5PA 3EETA 2O3FA 1FPQA 3DP7A 1W7PD 4OINF 1CF7B 5J8FA 4XLPF 1TBXA 2L02A 5D5WB 2P5LC 4G8XA 2OD5A 1YLFA 2LF8A 4JBAA 2OU2A 2DW4A 4S05A 3TKYA 4P5OA 1MJ9A 2HYGD 1LDDA 1NHAA 1STZA 1F4KA 1WRJA 2M8EA 1T0FA 3RJPA 1K78B 2ESHA 2VXZA 4PDKA 1Z6RA 5F1RA 2QM3A 1OMIA 1DP7P 3MAJA 1D5VA 1IAWA 1LVAA 3U1DA 1T6SA 2HS5A 1G3TA 2M1BA 1WQ2A 2K27A 2DK5A 3NQOA 3IKVA 4U0VA 3WTTC 3F8CA 5J6XA 5E1XA 5HS7A 2RC4A 2W57A 3JTHA 1D8JA 4P9FA 4B8XA 4Y13A 1RUNA 5JVTA 1BM9A 3GUDA 1DDNA 1FBQA 3RIRA 4M72A 4XSZF 4RB3C 1DPRA 3QP5A 4OMYA 2GAUA 4EQQA 1GHCA 3WE3A 3P9CA 3LQRA 4HOBA 3MWMA 2F2EA 1IF1A 3E5XA 2Q2EA 5E1WA 2VN2A 4FX4A 3HTSB 3HIFA 1U3EM 4YFNF 4N9IA 1B59A 2V1DA 2HDCA 4HYEA 4ZZLA 1KU9A 1QNTA 4KUMA 2BE5F 1IXCA 3BPXA 3CO7C 1HBXG 3IHUA 5IT9Z 2ISZA 3HSRA 5CLSA 3V7CA 1UB9A 4L5IA 4LGWA 2J5OA 1R7JA 5DD4A 5E1ZB 2M5WA 2K02A 2GWRA 4IRHA 1CF7A 1UCRA 4EV0A 2QUFA 4AIHA 4BXUA 1ZARA 3VOEA 3E6MA 3QAHA 4ESFA 2G9WA 1S7OA 2ZNZA 1P2FA 4M6YA 5L3CA 1J75A 2K4JA 1XSDA 2VT3A 1YO5C 1ZG5A 1R5GA 3MEXA 3RDIA 2IVMA 2PEXA 4BQAA 3BY6A 4EJOA 4HQMA 1Z91A 2P5VA 2RQPA 3JAMZ 1P6RA 2CSOA 1KU7A 2FBKA 5HLHA 2XGXA 4MTDA 5E8GA 1ONVA 2VC0A 4D0PA 2MH9A 3NRVA 2KIFA 2IT0A 3MZHA 1WI9A 1P4AA 1LJ9A 2NAZA 4OMZA 3DQVC 4A0YA 3L9FA 2HWVA 5BS6A 3IC7A 2PI0A 1P4XA 1I1GA 3D5LA 1XGNA 4AIJA 1ZH5A 5DD8A 2ADUA 3PQJA 2HKOA 5LRRA 1TQPA 1YIOA 3SHFA 1B9MA 5HOOA 2STTA 5JFRA 2PN6A 2VE9A 1S3JA 4HAMA 3VFZA 3J80Z 2JSCA 1BIBA 3LAJA 2ZCWA 5J8CA 2P4WA 2WWYA 4A0XA 2D45A 3H3ZA 4FHTA 3F8NA 3W6JB 3ABTA 2C6YA 1PP8F 3HYIA 5D8KB 5E8IA 1QPMA 3K1PA 4HW0A 1EH8A 2O03A 4Q5SF 2ZO4A 2MBFA 4KN4X 2PMHA 1OYYA 2DQRA 4RS8A 3K1MA 2EA4A 1ZAOA 3Q5FA 5LLQA 5D6EA 4EVIA 3E5UA 1K6OA 1TQIA 2QQ9A 4OIQF 2RNJA 2DT5A 3FZVA 2V79A 3ML6A 4U0WA 1H9GA 2MH2A 2E7XA 1R1TA 3GFLA 3ZMDA 2W85A 2MLKA 4I0BA 3CUOA 1SFXA 2HTSA 2H27A 3KZYA 2L4AA 3TO6A 4A5NA 1XDUA 2FMLA 3F8MA 2XRNA 1MZBA 2KIUA 2HGCA 2UXNA 4QLCU 1G3YA 1TNSA 2OQRA 2FMYA 2V9VA 1ZYRF 1W4MA 2H09A 4JK1X 1FSHA 2JT1A 5E18F 4O3MA 4WXDA 1ZN2A 3R0JA 1MKMA 4ENKA 3B73A 4YFKF 1SFUA 3GXOA 4IVNA 1IW7F 1YS6A 3I53A 3GEZA 1YS7A 3BOQA 1SD4A 3JTGA 2VBYA 4U0YA 5ICEA 2VOPA 1MDMB 3EYIA 1V3FA 2PFBA 1GXQA 2NRAC 3FXQA 3M8EA 3QPHA 4L9NA 3CLOA 2A6EF 4ASNA 4HLYA 5FD5A 3WGIA 4HQEA 2XAFA 2EV5A 3WTSC 1K7AA 2UZKA 2M45A 3HSEA 3GW2A 3EYYA 2NNNA 3J81K 2BBYA 3WGGA 1AOYA 3K0LA 3ZN1A 1HW1A 4OIOF 2R3SA 1BI1A 3I54A 2M30A 3T0YA 2EFPA 3V7RA 1O3RA 1J59A 2XKPA 1D8KA 3K69A 1B6AA 4LK0F 2CQKA 3ZMUA 5HDKA 1ZG1A 1SD7A 2V6CA 3COAC 4MHGA 5ILSA 3S2WA 1O3QA 2H94A 5D4RA 4WK8F 1Z05A 5D4SA 1QBJA 3GX4X 2OZ6A 2ELHA 2F5DA 1RUOA 2W24A 2FNPA 1MGTA 2ZJ2A 2VT2A 2P8TA 1KA8A 3EQLF 3M8FA 2DU9A 1U2WA 1TLHB 1I1SA 4UHTA 4Y17A 2H6CA 4BAYA 1J2XA 3C3WA 4LB6B 1U6GA 1XMAA 2OZUA 4RGXA 1U8RA 4A12A 2FU4A 3VODA 3ECHA 4O6JA 1KYWA 2W25A 3BDDA 5LGTA 5JHUA 2M87A 1MDMA 6PAXA 2JTVA 3PFIA 2XHKA 1V4RA 4H0EA 2GIVA 4UUVA 3IKTA 1IXRC 5HS8A 1XB4A 2FNAA 1ULYA 4K2EA 5H6QA 1XGSA 2D1HA 4M73A 3HUGA 4LLLA 2PQ8A 4HDVA 2O0YA 3IRRA 5KK1A 2CGPA 2QLZA 1F1ZA 1DPUA 1HSTA 3C18A 1D3YA 2E7WA 3HHHA 1XN7A 3O3KA 3TQNA 2UXXA 4A6DA 3U9GA 1SFEA 2HFHA 4LD5A 5LHHA 2QQAA 2FRHA 4HX7A 3K1NA 4HA8A 4HBLA 4PGGA 2O61A 3M1EA 3HTUA 3I0TA 3F6OA 3WTYC 3LQQA 2HQNA 2W84A 4AWXB 1R1UA 2IPQX 2K7LA 1FSEA 4CGZA 2CFXA 4OU0A 4MEYF 3WODF 4FT8A 3QOPA 4WXHA 4KDPA 5LBQA 4OIPF 4ON0A 3IWFA 2GXGA 3V8JA 2HQRA 1HXDA 1JXSA 3MQ0A 1TW3A 1EH6A 2HOEA 3N97A 4GXOA 4IPAA 1XSXA 3GFIA 4R8HA 2A69F 3JSOA 3DXJF 3FHZA 2ISYA 5DV5A 1FOKA 1ZRFA 4A2UA 5A2QK 5H20A 2OAZA 1U5TB 4ESBA 5FLXK 2DBBA 1O7FA 2EFWA 4IHTA 1S29A 3M7GA 3RKWA 3QU3A 2YU3A 1P92A 2FE3A 1J5YA 4HF0A 4UVAA 2LNBA 3F3XA 3JSPA 3I59B 2B0LA 3ZMTA 5FFZA 5L3EA 1HKTA 2AXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R58 A;  3ABU A;  3FM5 A;  5ILV A;  5CVU A;  1B4A A;  1XCV A;  1KGS A;  1U5T C;  3KP3 A;  1HSJ A;  3TOA A;  3REO A;  5CJ9 A;  3BWG A;  4BHC A;  2FF4 A;  1R5H A;  3KCC A;  4RAZ A;  5EEG A;  3KP2 A;  1Z7U A;  3BJO A;  3C1D A;  1J9I A;  2D2W A;  1QGP A;  2Y75 A;  1IRG A;  5LGU A;  3DPT A;  4LLG F;  4I01 A;  2HKX A;  2RN7 A;  2DPD A;  4Q47 A;  2Z5U A;  3R6S A;  4GCV A;  3WTU C;  4ZYE A;  4KIC A;  2E1C A;  1WWX A;  1T98 A;  3BJA A;  3IRQ A;  5HVQ C;  1K78 A;  5L3D A;  3H3U A;  2ZNY A;  3DF8 A;  2YR2 A;  3GFM A;  2QYO A;  4RAY A;  4A0Z A;  2EFO A;  1YW7 A;  3DFG A;  2EV0 A;  2A3S A;  3TOB A;  4EMS A;  4FX0 A;  5BOX A;  1PUE E;  2Q0O A;  2Z33 A;  1FP1 D;  1GVJ A;  4P55 A;  2YSR A;  4MTE A;  4A5M A;  1YFH A;  3LAP A;  3ECO A;  1T2K A;  3TDZ C;  3VEP A;  2IA2 A;  5K5R A;  1O3T A;  1U5T A;  2HYF A;  3WG9 A;  4DQ2 A;  4HV6 A;  4CHU A;  1SD6 A;  1FLI A;  2FA5 A;  3F23 A;  4I2O A;  2OQG A;  3RYP A;  1IZ1 A;  1TW2 A;  4U88 A;  1BOA A;  2FSW A;  4YG2 F;  3HRS A;  5BPD A;  2R7F A;  1ZHF A;  3WGH A;  3I59 A;  2MC3 A;  1R1V A;  5D5X B;  2VE8 A;  2EFQ A;  4KIB A;  4M9Z A;  3FMR A;  4U7B A;  2DAO A;  4DNC A;  4BHB A;  2NS0 A;  4HDU A;  4EGY A;  4HZF A;  2Z3Y A;  3NEU A;  1SMT A;  1UST A;  3E3V A;  2VBZ A;  1ODD A;  2XUB A;  1Z6T A;  1O57 A;  3HOT A;  4Q4Z F;  2LF7 A;  5JI6 A;  1WSU A;  1O3S A;  4OOI A;  2GA1 A;  4LLN A;  2RDP A;  4LJZ F;  5IT9 K;  2OA4 A;  2ACJ A;  2L3D A;  5E17 F;  2H6B A;  3F8F A;  2EK5 A;  1HW5 A;  3GLX A;  1IRF A;  3QRF F;  4ETS A;  4CIC A;  1W5S A;  1KQ9 A;  2G7U A;  4EM1 A;  5LHG A;  5LGN A;  3G3Z A;  2IP2 A;  1QO0 D;  4I02 A;  2A5Y B;  4CO8 A;  1LEB A;  2TDX A;  1R00 A;  2YPR A;  2PG4 A;  1OYI A;  1XD7 A;  1G3S A;  3OV8 A;  3P9K A;  4HX8 A;  3ZN0 A;  1E2X A;  4EM2 A;  1BIA A;  4UV8 A;  2P5K A;  4KNY A;  5L3B A;  2ETH A;  1FY7 A;  3JAM K;  1BN5 A;  1IN6 A;  3E5Q A;  2HEO A;  4PZJ A;  4XRF A;  3E97 A;  3LST A;  4KMU X;  5K5O A;  4GYG A;  2IA0 A;  2IA1 A;  1ZGJ A;  1IN7 A;  2X4H A;  1I6X A;  5D8L B;  2KJC A;  3KLN A;  3PQK A;  1RNL A;  4XSX F;  2EJR A;  3LA2 A;  1L0O C;  3GZ5 A;  4G6Q A;  3FF5 A;  2IRF G;  1OPC A;  4U7D A;  3C7J A;  2LKP A;  3GO5 A;  2GXB A;  5FFX A;  4KT5 C;  1JE8 A;  2NYX A;  3WE2 A;  3R0A A;  2EWN A;  1TTY A;  4KIG A;  3ULQ B;  1G4D A;  5IT3 A;  5LEK A;  4HLX A;  3HSF A;  3KEQ A;  3SZP A;  4ESJ A;  2LDU A;  2ZBK A;  3J80 K;  4L0Z B;  1FBS A;  3Q9V A;  1J7K A;  5F64 A;  4A6E A;  2QQB A;  4EJT A;  2E1N A;  3MZY A;  4S04 A;  2PMU A;  1S8N A;  2YX4 A;  3SXY A;  3GFJ A;  4IXA A;  4WCG A;  1J0R A;  5L3F A;  1L3L A;  2K86 A;  2KRF A;  4QWQ A;  2BGC A;  4EJW A;  2QWW A;  3GZ6 A;  1MJA A;  2OBP A;  1XMK A;  3K2Z A;  1FZP B;  1C0W A;  2P7C B;  1REP C;  3SQN A;  2YX7 A;  1W5T A;  5FO5 A;  1UHM A;  2DLL A;  5AON A;  2XV4 S;  3ERE D;  3G73 A;  3GYH X;  2CG4 A;  3L2C A;  2FXA A;  3FXR A;  2COM A;  1U78 A;  1AWC A;  3FX3 A;  3QU6 A;  5L3G A;  3LFK A;  3TO9 A;  3F6V A;  4Q48 A;  1LQ1 A;  2O6G E;  2UWM A;  4G7H F;  2RGV A;  1T38 A;  1HKS A;  2XRO A;  3DEU A;  1WKM A;  1JHH A;  1A04 A;  3ZP5 A;  2P6T A;  3V8K A;  2DI3 A;  4N9H A;  1BI3 A;  1QQI A;  4L9J A;  4M74 A;  4B09 A;  4BNC A;  1YQA A;  3K9T A;  3IL2 A;  1YG2 A;  1KYZ A;  1SMY F;  4L0Y B;  5H6R A;  1IUY A;  5ICC A;  3QPT A;  2L4M A;  2Q8K A;  4P96 A;  4EJV A;  3QP6 A;  4YFX F;  3I64 A;  4RGU A;  3RPU A;  2FEZ A;  4ENJ A;  2V1X A;  1KQ0 A;  4LK1 F;  3CUQ B;  4Z2Y A;  1FYL A;  2DPU A;  1USS A;  1IXS B;  1K79 A;  1EH7 A;  4YII A;  1I27 A;  2A07 F;  1R23 A;  1P4W A;  5FD6 A;  1FT9 A;  5AIP A;  1F9N A;  1Q1H A;  1ZLJ A;  4L9V A;  1ZRE A;  3CDH A;  2P7V B;  3F22 A;  3KP6 A;  1IN5 A;  3W6K B;  1H9T A;  1B9N A;  2BEO A;  3GVA A;  2DTR A;  3CUQ C;  3I58 A;  1DUX C;  1R36 A;  3WTZ A;  1FYM A;  1EV7 A;  1JHF A;  3ZQ7 A;  4ZYH A;  1BBY A;  1OR7 A;  4WX9 A;  3O2P E;  1LNW A;  4KMF A;  4BH9 A;  1TQM A;  1Z9C A;  3KP7 A;  3E6D A;  4MNU A;  4AIK A;  1YW8 A;  4E70 A;  4OIR F;  2V1U A;  1FP2 A;  4O5V A;  2DFI A;  5BQT A;  2MD5 A;  4L5J A;  1CGP A;  4GGG A;  2K4B A;  1BI0 A;  1KU3 A;  3ZMZ A;  2FBH A;  5LHI A;  1B1B A;  4IHS A;  2QVO A;  5HS9 A;  2O8X A;  4EM0 B;  3HRU A;  5LRS A;  2EA2 A;  1ZRD A;  4IJA A;  2Z99 A;  3FM3 A;  1ZGA A;  3LA7 A;  3FWE A;  1MJB A;  5DDG A;  3HHG A;  2XAH A;  2DO7 A;  4ZZD A;  2CYY A;  4XBF A;  1XGO A;  2VBW A;  2HZT A;  4LMY A;  3L7W A;  3BJ6 A;  1RIO H;  4XLN F;  4I98 B;  2RVC A;  5DCM B;  1YYV A;  4ZYG A;  4IRI A;  1Z1D A;  4KYW A;  5BPI A;  1LEA A;  3KFW X;  2A6H F;  1FNN A;  4IF4 A;  2A68 F;  3HOS A;  3CUQ A;  4Y15 A;  1E17 A;  1FWZ A;  3LWF A;  2XKO A;  2MLG A;  3IWZ A;  1YW9 A;  4I0A A;  2CO5 A;  4UVB A;  4GYI A;  5K5Q A;  4LB5 A;  2CW0 F;  2DK8 A;  3J7A O;  2X0L A;  3CJN A;  3RPQ A;  1ZLK A;  2IW5 A;  2G7H A;  3KEO A;  5AIQ A;  4P9U A;  1TNT A;  4LFU A;  4BHP A;  4NB5 A;  1RZ4 A;  4EJU A;  4ZH4 F;  1G3W A;  5ICG A;  5DUK A;  2JPC A;  1XSV A;  1O7L A;  5HDN A;  2JZY A;  5ERI A;  3TGN A;  4G7O F;  2ZFW A;  3WU0 A;  5EEH A;  3GF2 A;  3P7N A;  1RI7 A;  2RKH A;  3T8T A;  3CTA A;  2AS5 F;  1IN8 A;  2Y48 A;  5CVI A;  3V7S A;  2GZW A;  4G6D A;  2STW A;  4BYY A;  4I09 A;  4ENM A;  3EDP A;  2XVC A;  3L00 A;  2QEN A;  1UHW A;  2XAG A;  1X3U A;  2WC2 A;  3ZPL A;  5HLI A;  4IRG A;  1PP7 U;  2QZ8 A;  4N0B A;  3L09 A;  3RTR A;  4KIF A;  2ZME B;  2HR3 A;  5KVR A;  1BC7 C;  4AVP A;  5CVR A;  1H0M A;  5CVJ A;  4I7H A;  1VTN C;  4CXF A;  4CDG A;  3KP5 A;  3WTW C;  4M9S A;  3GWZ A;  5LEJ A;  3RKY A;  2NNY A;  1HKQ A;  2XAJ A;  2F5E A;  3V4G A;  4WXC A;  2WTE A;  2JRT A;  5D5V B;  4KA4 A;  5F6F A;  4GO1 A;  4G9Y A;  2BYV E;  1ON1 A;  3BRO A;  3J81 Z;  1I5Z A;  5K1Y A;  4MQ9 F;  3KP4 A;  1XCB A;  2FQ3 A;  2EB7 A;  3DKW A;  3TDU C;  1QZZ A;  4UXN A;  4RGR A;  3WTV C;  2Y0M A;  2F5F A;  5DCM A;  3R61 A;  3FMS A;  4R79 A;  5CYV A;  3EUH A;  1HW2 A;  3B02 A;  4EGZ A;  5E20 A;  2L01 A;  5FB2 A;  4TV7 A;  2FOK A;  1SAX A;  3MCZ A;  2VON A;  3AAF A;  2XAS A;  3I4P A;  2R7D A;  4M6X A;  2PLY A;  3DPL C;  3Q9S A;  1YTY A;  1LB2 A;  3F72 A;  4MQV A;  2VBX A;  3RKX A;  3KET A;  5ICF A;  1QZY A;  2VOO A;  2A61 A;  3RI4 A;  2IJL A;  5TRD A;  1S6L A;  3ISP A;  1PDN C;  5CVV A;  1OYW A;  3H92 A;  2RV8 A;  1JGS A;  3KLO A;  4KN7 X;  2XAQ A;  4LG0 B;  3BPV A;  3T5X A;  4CZZ A;  4G94 A;  5DEQ A;  3E6C C;  3P9I A;  1IN4 A;  3WTX C;  1Y0U A;  2D1V A;  3R60 A;  5D6F A;  4MEX F;  3E6B A;  1ZG3 A;  3O6B B;  4G7Z F;  2MA3 A;  2L54 A;  4R1H A;  1LDJ A;  5HDG A;  5DYM A;  4UV9 A;  1OKR A;  2HTJ A;  3HRM A;  2QBY B;  4HV5 A;  3M9A A;  2GQQ A;  3HRT A;  2ZME A;  4ENN A;  4M71 A;  1KQ8 A;  4WWC A;  5D5U B;  3F8B A;  2GA2 A;  4NQW A;  3T1B A;  1R22 A;  4L9T A;  3I5U A;  3BP8 A;  1W7P B;  5JR3 A;  5TJJ A;  3RYR A;  2KIM A;  4WF2 A;  3SZT A;  2PJP A;  2EFN A;  3LA3 A;  1FBU A;  4RGS A;  4RB2 C;  2JPB A;  4M9X A;  1ZRC A;  1ON2 A;  4AD9 A;  3VB2 A;  3OOP A;  3ELK A;  2Z9O A;  3U2R A;  4F7Z A;  4JQF A;  3BZ6 A;  3KE2 A;  2EV6 A;  3FXU A;  4PGH A;  4HF2 A;  3T8R A;  2PBI A;  3MFK A;  2ZXJ A;  3FMQ A;  1LDK B;  1G6N A;  4RB1 A;  3WU1 B;  4UNO A;  4NHJ A;  3V8L A;  2BV6 A;  1UFM A;  2XIG A;  5A2Q Z;  4L18 B;  3CO6 C;  2VOD A;  2F5C A;  3DV8 A;  4YIF A;  2LSO A;  1KU2 A;  5FLX Z;  4KFC A;  1S7A A;  3ZMS A;  5ED4 A;  4LG0 A;  2WV0 A;  2ESN A;  2FBI A;  2VC1 A;  5FGM A;  1MD0 A;  1XGM A;  4HX4 A;  3TO7 A;  2DQL A;  1FX7 A;  2CWE A;  3F21 A;  5BMZ A;  2KJB A;  5ILU A;  2KKO A;  3KZZ A;  4ZYD A;  4MGR A;  4HF1 A;  3I71 A;  2ZKZ A;  1GXP A;  4CYD A;  5HLG A;  1FC3 A;  3D0S A;  3JW4 A;  1FYK A;  1F5T A;  1BC8 C;  4PCQ A;  1T39 A;  2QBY A;  3ZMV A;  1SD5 A;  1BJA A;  1BI2 A;  1XDS A;  1HQC A;  2P6S A;  3ROU A;  5DCF A;  4UVC A;  1W7P A;  3R4K A;  4RB0 A;  3SFZ A;  5DUI A;  3N4M A;  2J5P A;  3EET A;  2O3F A;  1FPQ A;  3DP7 A;  1W7P D;  4OIN F;  1CF7 B;  5J8F A;  4XLP F;  1TBX A;  2L02 A;  5D5W B;  2P5L C;  4G8X A;  2OD5 A;  1YLF A;  2LF8 A;  4JBA A;  2OU2 A;  2DW4 A;  4S05 A;  3TKY A;  4P5O A;  1MJ9 A;  2HYG D;  1LDD A;  1NHA A;  1STZ A;  1F4K A;  1WRJ A;  2M8E A;  1T0F A;  3RJP A;  1K78 B;  2ESH A;  2VXZ A;  4PDK A;  1Z6R A;  5F1R A;  2QM3 A;  1OMI A;  1DP7 P;  3MAJ A;  1D5V A;  1IAW A;  1LVA A;  3U1D A;  1T6S A;  2HS5 A;  1G3T A;  2M1B A;  1WQ2 A;  2K27 A;  2DK5 A;  3NQO A;  3IKV A;  4U0V A;  3WTT C;  3F8C A;  5J6X A;  5E1X A;  5HS7 A;  2RC4 A;  2W57 A;  3JTH A;  1D8J A;  4P9F A;  4B8X A;  4Y13 A;  1RUN A;  5JVT A;  1BM9 A;  3GUD A;  1DDN A;  1FBQ A;  3RIR A;  4M72 A;  4XSZ F;  4RB3 C;  1DPR A;  3QP5 A;  4OMY A;  2GAU A;  4EQQ A;  1GHC A;  3WE3 A;  3P9C A;  3LQR A;  4HOB A;  3MWM A;  2F2E A;  1IF1 A;  3E5X A;  2Q2E A;  5E1W A;  2VN2 A;  4FX4 A;  3HTS B;  3HIF A;  1U3E M;  4YFN F;  4N9I A;  1B59 A;  2V1D A;  2HDC A;  4HYE A;  4ZZL A;  1KU9 A;  1QNT A;  4KUM A;  2BE5 F;  1IXC A;  3BPX A;  3CO7 C;  1HBX G;  3IHU A;  5IT9 Z;  2ISZ A;  3HSR A;  5CLS A;  3V7C A;  1UB9 A;  4L5I A;  4LGW A;  2J5O A;  1R7J A;  5DD4 A;  5E1Z B;  2M5W A;  2K02 A;  2GWR A;  4IRH A;  1CF7 A;  1UCR A;  4EV0 A;  2QUF A;  4AIH A;  4BXU A;  1ZAR A;  3VOE A;  3E6M A;  3QAH A;  4ESF A;  2G9W A;  1S7O A;  2ZNZ A;  1P2F A;  4M6Y A;  5L3C A;  1J75 A;  2K4J A;  1XSD A;  2VT3 A;  1YO5 C;  1ZG5 A;  1R5G A;  3MEX A;  3RDI A;  2IVM A;  2PEX A;  4BQA A;  3BY6 A;  4EJO A;  4HQM A;  1Z91 A;  2P5V A;  2RQP A;  3JAM Z;  1P6R A;  2CSO A;  1KU7 A;  2FBK A;  5HLH A;  2XGX A;  4MTD A;  5E8G A;  1ONV A;  2VC0 A;  4D0P A;  2MH9 A;  3NRV A;  2KIF A;  2IT0 A;  3MZH A;  1WI9 A;  1P4A A;  1LJ9 A;  2NAZ A;  4OMZ A;  3DQV C;  4A0Y A;  3L9F A;  2HWV A;  5BS6 A;  3IC7 A;  2PI0 A;  1P4X A;  1I1G A;  3D5L A;  1XGN A;  4AIJ A;  1ZH5 A;  5DD8 A;  2ADU A;  3PQJ A;  2HKO A;  5LRR A;  1TQP A;  1YIO A;  3SHF A;  1B9M A;  5HOO A;  2STT A;  5JFR A;  2PN6 A;  2VE9 A;  1S3J A;  4HAM A;  3VFZ A;  3J80 Z;  2JSC A;  1BIB A;  3LAJ A;  2ZCW A;  5J8C A;  2P4W A;  2WWY A;  4A0X A;  2D45 A;  3H3Z A;  4FHT A;  3F8N A;  3W6J B;  3ABT A;  2C6Y A;  1PP8 F;  3HYI A;  5D8K B;  5E8I A;  1QPM A;  3K1P A;  4HW0 A;  1EH8 A;  2O03 A;  4Q5S F;  2ZO4 A;  2MBF A;  4KN4 X;  2PMH A;  1OYY A;  2DQR A;  4RS8 A;  3K1M A;  2EA4 A;  1ZAO A;  3Q5F A;  5LLQ A;  5D6E A;  4EVI A;  3E5U A;  1K6O A;  1TQI A;  2QQ9 A;  4OIQ F;  2RNJ A;  2DT5 A;  3FZV A;  2V79 A;  3ML6 A;  4U0W A;  1H9G A;  2MH2 A;  2E7X A;  1R1T A;  3GFL A;  3ZMD A;  2W85 A;  2MLK A;  4I0B A;  3CUO A;  1SFX A;  2HTS A;  2H27 A;  3KZY A;  2L4A A;  3TO6 A;  4A5N A;  1XDU A;  2FML A;  3F8M A;  2XRN A;  1MZB A;  2KIU A;  2HGC A;  2UXN A;  4QLC U;  1G3Y A;  1TNS A;  2OQR A;  2FMY A;  2V9V A;  1ZYR F;  1W4M A;  2H09 A;  4JK1 X;  1FSH A;  2JT1 A;  5E18 F;  4O3M A;  4WXD A;  1ZN2 A;  3R0J A;  1MKM A;  4ENK A;  3B73 A;  4YFK F;  1SFU A;  3GXO A;  4IVN A;  1IW7 F;  1YS6 A;  3I53 A;  3GEZ A;  1YS7 A;  3BOQ A;  1SD4 A;  3JTG A;  2VBY A;  4U0Y A;  5ICE A;  2VOP A;  1MDM B;  3EYI A;  1V3F A;  2PFB A;  1GXQ A;  2NRA C;  3FXQ A;  3M8E A;  3QPH A;  4L9N A;  3CLO A;  2A6E F;  4ASN A;  4HLY A;  5FD5 A;  3WGI A;  4HQE A;  2XAF A;  2EV5 A;  3WTS C;  1K7A A;  2UZK A;  2M45 A;  3HSE A;  3GW2 A;  3EYY A;  2NNN A;  3J81 K;  2BBY A;  3WGG A;  1AOY A;  3K0L A;  3ZN1 A;  1HW1 A;  4OIO F;  2R3S A;  1BI1 A;  3I54 A;  2M30 A;  3T0Y A;  2EFP A;  3V7R A;  1O3R A;  1J59 A;  2XKP A;  1D8K A;  3K69 A;  1B6A A;  4LK0 F;  2CQK A;  3ZMU A;  5HDK A;  1ZG1 A;  1SD7 A;  2V6C A;  3COA C;  4MHG A;  5ILS A;  3S2W A;  1O3Q A;  2H94 A;  5D4R A;  4WK8 F;  1Z05 A;  5D4S A;  1QBJ A;  3GX4 X;  2OZ6 A;  2ELH A;  2F5D A;  1RUO A;  2W24 A;  2FNP A;  1MGT A;  2ZJ2 A;  2VT2 A;  2P8T A;  1KA8 A;  3EQL F;  3M8F A;  2DU9 A;  1U2W A;  1TLH B;  1I1S A;  4UHT A;  4Y17 A;  2H6C A;  4BAY A;  1J2X A;  3C3W A;  4LB6 B;  1U6G A;  1XMA A;  2OZU A;  4RGX A;  1U8R A;  4A12 A;  2FU4 A;  3VOD A;  3ECH A;  4O6J A;  1KYW A;  2W25 A;  3BDD A;  5LGT A;  5JHU A;  2M87 A;  1MDM A;  6PAX A;  2JTV A;  3PFI A;  2XHK A;  1V4R A;  4H0E A;  2GIV A;  4UUV A;  3IKT A;  1IXR C;  5HS8 A;  1XB4 A;  2FNA A;  1ULY A;  4K2E A;  5H6Q A;  1XGS A;  2D1H A;  4M73 A;  3HUG A;  4LLL A;  2PQ8 A;  4HDV A;  2O0Y A;  3IRR A;  5KK1 A;  2CGP A;  2QLZ A;  1F1Z A;  1DPU A;  1HST A;  3C18 A;  1D3Y A;  2E7W A;  3HHH A;  1XN7 A;  3O3K A;  3TQN A;  2UXX A;  4A6D A;  3U9G A;  1SFE A;  2HFH A;  4LD5 A;  5LHH A;  2QQA A;  2FRH A;  4HX7 A;  3K1N A;  4HA8 A;  4HBL A;  4PGG A;  2O61 A;  3M1E A;  3HTU A;  3I0T A;  3F6O A;  3WTY C;  3LQQ A;  2HQN A;  2W84 A;  4AWX B;  1R1U A;  2IPQ X;  2K7L A;  1FSE A;  4CGZ A;  2CFX A;  4OU0 A;  4MEY F;  3WOD F;  4FT8 A;  3QOP A;  4WXH A;  4KDP A;  5LBQ A;  4OIP F;  4ON0 A;  3IWF A;  2GXG A;  3V8J A;  2HQR A;  1HXD A;  1JXS A;  3MQ0 A;  1TW3 A;  1EH6 A;  2HOE A;  3N97 A;  4GXO A;  4IPA A;  1XSX A;  3GFI A;  4R8H A;  2A69 F;  3JSO A;  3DXJ F;  3FHZ A;  2ISY A;  5DV5 A;  1FOK A;  1ZRF A;  4A2U A;  5A2Q K;  5H20 A;  2OAZ A;  1U5T B;  4ESB A;  5FLX K;  2DBB A;  1O7F A;  2EFW A;  4IHT A;  1S29 A;  3M7G A;  3RKW A;  3QU3 A;  2YU3 A;  1P92 A;  2FE3 A;  1J5Y A;  4HF0 A;  4UVA A;  2LNB A;  3F3X A;  3JSP A;  3I59 B;  2B0L A;  3ZMT A;  5FFZ A;  5L3E A;  1HKT A;  2AXL A; 
#chains in the Genus database with same CATH topology
 3CCE I;  1R58 A;  3ABU A;  4A3J J;  3CCV I;  3FM5 A;  4V2G A;  5ILV A;  5CVU A;  1B4A A;  2EPF A;  1XCV A;  2LG4 A;  2OTL I;  1KGS A;  1MMS A;  1U5T C;  3KP3 A;  4A3D J;  1PUF A;  1VQ4 I;  2FJ1 A;  2X1E A;  3MKL A;  4IEJ A;  1HSJ A;  3S3M A;  4PJJ A;  4FCY A;  3TOA A;  1JT0 A;  3RZO J;  3REO A;  2UV1 A;  5CJ9 A;  4ZYA A;  2BOL A;  1UJ8 A;  3BWG A;  2HU9 A;  4BHC A;  2FF4 A;  1XC5 A;  1R5H A;  3KCC A;  2R7W A;  4RAZ A;  5EEG A;  2QKM B;  3KP2 A;  2LRD A;  1Z7U A;  1U8B A;  4IQ4 A;  5H2F C;  4Y52 J;  3BJO A;  3C1D A;  1J9I A;  1E3P A;  1MBJ A;  2D2W A;  1ZQ3 P;  1QGP A;  2Y75 A;  4IHX A;  1IRG A;  2CUZ A;  4NUB A;  2MSY A;  5DS9 A;  5LGU A;  3K4M A;  4GRI A;  3D1N I;  3DPT A;  3CF5 F;  4FIS A;  2CUF A;  4LLG F;  2GOM A;  4I01 A;  3OYD A;  2HKX A;  3BZC A;  2RN7 A;  2DPD A;  4Q47 A;  2H1K A;  2Z5U A;  5DTD A;  3R6S A;  2K85 A;  5FLM J;  3GTQ J;  4GCV A;  2ME0 A;  3B6C A;  4PFO A;  3DKY A;  3M1C A;  3OOU A;  2QCO A;  3WTU C;  4ZYE A;  4JP0 A;  4KIC A;  1MNE A;  2E1C A;  3TED A;  2K5C A;  1WWX A;  1T98 A;  3BJA A;  3IRQ A;  5HVQ C;  3K4N A;  1K78 A;  2LH9 A;  1X3W B;  2VKE A;  5L3D A;  3H3U A;  2LRE A;  2ZNY A;  4BDY A;  3HXL A;  4H4K C;  3DF8 A;  2YR2 A;  3PSF A;  3GFM A;  1WVR A;  1NK2 P;  1X1B A;  2QYO A;  4G12 A;  2V9P A;  3FKI J;  4BE2 A;  4RAY A;  4YEL A;  4A0Z A;  3BTC A;  3MKW B;  2EFO A;  1ZGW A;  4XKW A;  1YW7 A;  3DFG A;  3CMY A;  4C2U A;  3MN2 A;  2EV0 A;  2A3S A;  3TOB A;  3ZQG A;  4EMS A;  3OS0 A;  2UUZ A;  2QSF X;  4FX0 A;  5BOX A;  1PUE E;  1MBF A;  5HNF A;  2Q0O A;  4ZDO A;  2Z33 A;  1FP1 D;  2FQ4 A;  5FKL A;  3HGG A;  1BR2 A;  1GVJ A;  1O4X A;  4P55 A;  1LE8 A;  1UG0 A;  1G59 A;  4BJT A;  2YSR A;  4MTE A;  4A5M A;  5EEA A;  1YFH A;  2ZXH A;  3LAP A;  3ERM A;  2PMZ A;  4CZC A;  1UAA A;  3CP8 A;  4C9Y A;  3ECO A;  3VYR B;  1XMX A;  1T2K A;  3TDZ C;  3VEP A;  5HOD A;  2IA2 A;  2HQ5 A;  5GP9 A;  4BQQ A;  5JLX A;  3OYK A;  5K5R A;  1O3T A;  4DYR A;  1U5T A;  2HYF A;  3WG9 A;  4DQ2 A;  5JVG F;  3SJM A;  1FIA A;  4HV6 A;  4CHU A;  1SD6 A;  1RKW A;  1FLI A;  4OAZ A;  2FA5 A;  3F23 A;  2AHQ A;  3NAU A;  4I2O A;  2OQG A;  3RYP A;  2L7F P;  2NVY J;  4DYC A;  3WHC A;  3AFH A;  1IZ1 A;  4JYK A;  2IGN A;  3CCQ I;  1TW2 A;  4U88 A;  3C2G A;  2DXI A;  1BOA A;  1JI8 A;  2FSW A;  4YG2 F;  3HRS A;  5BPD A;  2R7F A;  3DLL F;  3PUF A;  2JRM A;  1ZHF A;  1D1B A;  3WGH A;  4B3A A;  3VSK A;  3DTK A;  3I59 A;  2VL8 A;  2MC3 A;  1R1V A;  3OSG A;  3BCB A;  2ID6 A;  2WAQ A;  4UB6 C;  5D5X B;  2VE8 A;  2EFQ A;  4KIB A;  4M9Z A;  3PL8 A;  4BJ6 C;  3FMR A;  1ETQ A;  1Z3X A;  4U7B A;  2DAO A;  4DNC A;  1F43 A;  4BHB A;  4UB8 C;  4D7M A;  2R7S A;  2NS0 A;  2VKH A;  4HDU A;  4EGY A;  4HZF A;  2Z3Y A;  3NEU A;  1SMT A;  4RM2 A;  1UST A;  3E3V A;  5HNH A;  2A05 A;  1ODD A;  2VBZ A;  2XPV A;  2BY0 A;  4Z6Y A;  2XUB A;  1Z6T A;  5JLW A;  1O57 A;  3HOT A;  3CF2 A;  2GOX B;  3S14 J;  3O8H A;  2LF7 A;  4Q4Z F;  2JA2 A;  5JI6 A;  1WSU A;  2JVH A;  1O3S A;  4OOI A;  2GA1 A;  1B8I B;  2CV1 A;  4LLN A;  2RDP A;  1A35 A;  1FIP A;  3JR9 A;  4LJZ F;  5K7F A;  4DIQ A;  5IT9 K;  2OA4 A;  2ACJ A;  2L3D A;  5E17 F;  2H6B A;  3ABM H;  3F8F A;  2EK5 A;  1HW5 A;  3GLX A;  2OUM A;  1IRF A;  1XPX A;  1DU6 A;  3QRF F;  4ETS A;  4CIC A;  1W5S A;  2W00 A;  4FE4 A;  2GXA A;  1KQ9 A;  3CCS I;  1Y8R B;  2HXI A;  2G7U A;  4EM1 A;  5LHG A;  5LGN A;  1SFO J;  2COB A;  1VQ8 I;  4M3G A;  4CCL A;  2R7T A;  2L9S A;  2CUJ A;  3G3Z A;  4JX6 A;  3H9G A;  2IP2 A;  3LL7 A;  3K4L A;  1QO0 D;  1MW7 A;  2A5Y B;  4I02 A;  4CO8 A;  4XR6 A;  2ZJQ F;  5CQG A;  1YIT I;  3FXO A;  2R0Q C;  1LEB A;  5JHF A;  3A01 B;  3J7A Y;  2TDX A;  3M3Y J;  2KPM A;  4XNF A;  2WAD A;  2GLO A;  1ETK A;  3JRI A;  1EKE A;  2F48 A;  1R00 A;  3U21 A;  3IAS 2;  2YPR A;  1RPW A;  2PG4 A;  1APL C;  1OYI A;  1XD7 A;  1G3S A;  1ZTR A;  1OCT C;  1MBK A;  2DOF A;  3OV8 A;  3SDB A;  5FRO A;  4BQN A;  3P9K A;  4HX8 A;  1HC8 A;  1ETY A;  3ZN0 A;  5DM7 F;  3JRF A;  1E2X A;  4EM2 A;  1BIA A;  1MH3 A;  4UV8 A;  2P5K A;  4C3H J;  3Q0U A;  4RM3 A;  4KNY A;  4E7H A;  5E3L A;  4PFP A;  2WY7 Q;  4RAG A;  4IO9 F;  5L3B A;  2ETH A;  1FY7 A;  3DU6 A;  3JAM K;  1BN5 A;  4BE0 A;  1IN6 A;  2KDO A;  3A03 A;  3E5Q A;  3KIO A;  1D1C A;  3OYJ A;  3L2W A;  2HEO A;  3HC7 A;  4PZJ A;  4XLE A;  2YU9 J;  4XRF A;  3E97 A;  1FJL A;  4DJA A;  1YRN B;  3LST A;  5FRM A;  2XF6 A;  4KMU X;  3PJR A;  5M5X J;  4J01 A;  5K5O A;  4ZTJ A;  4GYG A;  2IA0 A;  2IA1 A;  1QZE A;  1ZGJ A;  1AU7 A;  1IN7 A;  2X4H A;  4F3Q A;  3CD6 I;  3QOE A;  1I6X A;  5D8L B;  2KJC A;  3KLN A;  3PQK A;  5EYR A;  1RNL A;  4XSX F;  3DTE A;  4PJL A;  2IS6 A;  2DOE A;  3I55 I;  2M2E A;  2EJR A;  3W2A A;  3GLL A;  3LA2 A;  4FE7 A;  2PX9 A;  1L0O C;  3GZ5 A;  4G6Q A;  3VYS B;  3FF5 A;  2IRF G;  4XMY A;  1OPC A;  4U7D A;  3L2R A;  1I39 A;  3C7J A;  2XGD A;  4IHV A;  2LKP A;  3GO5 A;  2GXB A;  4UUT A;  5FFX A;  1EA3 A;  3S1M J;  1OCO H;  4KT5 C;  4ZTF A;  1JE8 A;  2NYX A;  4CCJ A;  3WE2 A;  2WAF A;  3R0A A;  2EIK H;  2EWN A;  3OIQ A;  2NS8 A;  2XSJ C;  1RR8 C;  1TTY A;  4LIV A;  4KIG A;  3ULQ B;  2MD0 A;  2ZSH B;  1JKR C;  4A3G J;  4E7L A;  1JKQ C;  2RAE A;  5IT3 A;  3PIO F;  3CZ6 A;  1G4D A;  3ZGK A;  5LEK A;  4AYB N;  4Y3O A;  4HLX A;  4FET A;  4N4O B;  3ZCO A;  5J47 A;  1WFX A;  3HSF A;  3KEQ A;  3J7Z I;  3SZP A;  4ESJ A;  2LDU A;  2YUS A;  2ZBK A;  3J80 K;  1VF9 A;  5J40 A;  4BBS J;  4L0Z B;  1FBS A;  3M8J A;  3Q9V A;  1J7K A;  5F64 A;  4A6E A;  2QQB A;  4EJT A;  3I4N J;  3K4B A;  1WZ2 A;  1W36 C;  2DYR H;  2E1N A;  3MZY A;  1FOX A;  3UR3 C;  2PMU A;  4S04 A;  1S8N A;  4MIM A;  1H8A C;  2YX4 A;  4XOR A;  3SXY A;  3GFJ A;  4IQJ A;  3DEE A;  2HVR A;  4IXA A;  1B8I A;  4WCG A;  1J0R A;  5L3F A;  2RRE A;  1L3L A;  1IG7 A;  2K86 A;  2KRF A;  4QWQ A;  1PJR A;  2BGC A;  4B44 A;  3ZQC A;  4EJW A;  2QWW A;  2VLA A;  3GZ6 A;  1MJA A;  1WPK A;  2OBP A;  1JKO C;  1BJZ A;  1XMK A;  3BQY A;  4XKC A;  3CCU I;  3CJR B;  3K2Z A;  1R4N B;  3PIP F;  1FZP B;  2VAS A;  4B48 A;  1MMN A;  1C0W A;  2E35 A;  5EDN A;  2P7C B;  1REP C;  2LBF B;  3SQN A;  1WJC A;  1D0Z A;  2YX7 A;  3AG2 H;  1W5T A;  5FO5 A;  3BR2 A;  1SEU A;  3A0H C;  3BTI A;  1UHM A;  2LK2 A;  3HJE A;  2DTZ A;  3A01 A;  2QF7 A;  2DLL A;  5AON A;  4Y33 A;  2XV4 S;  3ERE D;  5K7H A;  3G73 A;  3GYH X;  1JKP C;  1NTC A;  1IO2 A;  2CG4 A;  3L2C A;  2FXA A;  3FXR A;  2NOG A;  3HKZ A;  2COM A;  1TWH J;  1U78 A;  1AWC A;  2NVQ J;  3FX3 A;  1WGX A;  3FXK A;  3S1R J;  1OR7 C;  4W97 A;  3QU6 A;  5L3G A;  4NC8 A;  3LFK A;  3TO9 A;  3F6V A;  4Q48 A;  1LQ1 A;  3BZK A;  2O6G E;  2UWM A;  4G7H F;  2RGV A;  1T38 A;  1OCR H;  1HKS A;  2BXZ A;  2JQ7 A;  2XRO A;  1ZEL A;  4J19 A;  3DEU A;  1WKM A;  3BLY A;  1JHH A;  1A04 A;  3Q3S A;  2CV2 A;  1OLT A;  1VQ6 I;  5EGO B;  3ZP5 A;  2F4I A;  2P6T A;  3V8K A;  2DI3 A;  1GT0 C;  2KRC A;  4N9H A;  2ECB A;  1BI3 A;  1YRN A;  4XN0 A;  1QQI A;  4L9J A;  4M74 A;  4B09 A;  4DBQ A;  4BNC A;  1YQA A;  3K9T A;  2NVU B;  2I5U A;  3IL2 A;  1YG2 A;  1KYZ A;  1LUJ B;  1SMY F;  4L0Y B;  5H6R A;  1IUY A;  5ICC A;  1YJN I;  3QPT A;  2L4M A;  1TZL A;  2Q8K A;  1EF4 A;  4P96 A;  2VI6 A;  4FAS D;  4EJV A;  3QP6 A;  4YFX F;  3I64 A;  4RGU A;  3RPU A;  2FEZ A;  4ENJ A;  2V1X A;  1KQ0 A;  4LK1 F;  2QQ8 A;  3CUQ B;  1W36 D;  4Z2Y A;  1Y0N A;  1FYL A;  1QPI A;  2DFF A;  2DPU A;  1USS A;  3RPU D;  3S3O A;  1IXS B;  1K79 A;  1EH7 A;  4BL0 B;  1XG1 A;  4CCK A;  1A31 A;  4YII A;  2ELJ A;  3JRH A;  1W5C C;  2JUC A;  2XF5 A;  3H5R A;  2GIZ A;  2JA5 J;  2F5V A;  1I27 A;  1D0Y A;  1MMD A;  4D5F A;  2A07 F;  1IDZ A;  1R23 A;  1UZC A;  4M3E A;  1P7I A;  1P4W A;  1WH5 A;  5FD6 A;  3ZQH A;  1FT9 A;  1X2N A;  3P5J A;  1HLV A;  5AIP A;  1F9N A;  1D5Y A;  3HOU J;  1Q1H A;  1ZLJ A;  2CJJ A;  4L9V A;  5KAF C;  4IOC F;  4DZP A;  1GV5 A;  1ZRE A;  3CDH A;  2BW3 B;  1N78 A;  2P7V B;  2JUG A;  4BE1 A;  3VYT B;  3F22 A;  3KP6 A;  4MFE A;  1IN5 A;  3W6K B;  4E4H A;  3H0D A;  1P7J A;  1FTT A;  1H9T A;  5M5Y J;  1B9N A;  1UHS A;  3EPZ A;  4CSW A;  3ZQF A;  2BEO A;  2Y30 A;  3GVA A;  5M3M J;  1JT6 A;  2JA7 J;  2WA0 A;  3FIS A;  2DTR A;  3CQZ J;  3CUQ C;  3I58 A;  1DUX C;  1R36 A;  4MLO A;  4ZDP A;  3WTZ A;  2WBM A;  1FYM A;  1EV7 A;  4ZJZ A;  1VZ0 A;  1JHF A;  3ZQ7 A;  2ZJP F;  4ZYH A;  1BBY A;  1OR7 A;  4WX9 A;  3O2P E;  1LNW A;  3DU5 A;  3RCO A;  5F04 A;  3DKX A;  1AHD P;  3JRE A;  2E2I J;  4KMF A;  2V4J C;  4BH9 A;  1TQM A;  3CMM A;  1GV2 A;  1Z9C A;  1GHC A;  3KP7 A;  4AC0 A;  1U9O A;  3E6D A;  4MNU A;  3OYG A;  2R5Y B;  4AIK A;  1VQN I;  1YW8 A;  1G2H A;  3A1Y A;  2LBF A;  2O7O A;  2Y0S A;  2ZC2 A;  4MFD A;  4E70 A;  2AQF A;  5K7Z A;  4BXX J;  4RA2 A;  4OIR F;  4B47 A;  5FKO A;  2V1U A;  1FP2 A;  4O5V A;  2HXO A;  2Y0S N;  2XPU A;  2Y9Y A;  4A69 C;  1R71 A;  2DFI A;  3BG6 A;  2M4G A;  2MD5 A;  3GZN B;  4LIT A;  5BQT A;  1RRJ A;  4L5J A;  3EUA A;  1CGP A;  1UMQ A;  1VFC A;  4GGG A;  3OYL A;  2Z16 A;  2K4B A;  4BEH B;  1DU0 A;  2LY1 A;  2A6T A;  2LYC A;  1BI0 A;  1KU3 A;  3ZMZ A;  5IOY A;  2FBH A;  2QGU A;  5LHI A;  3IUO A;  3BR0 A;  4XON A;  2LTP A;  1B1B A;  4IHS A;  2ECC A;  2QVO A;  5IY5 H;  3HPG A;  3GBG A;  3I56 I;  5HS9 A;  3OYH A;  2O8X A;  2X9D A;  3K70 C;  3OYI A;  4EM0 B;  3HRU A;  5LRS A;  3BT9 A;  5KAI C;  2EA2 A;  4B43 A;  4IX7 A;  1ZRD A;  4XLH A;  4IJA A;  2Z99 A;  3FM3 A;  5EGO A;  4HNT A;  1ZGA A;  3LA7 A;  3FWE A;  1MJB A;  2X85 A;  3LSJ A;  4M3F A;  5DDG A;  3HHG A;  3CP2 A;  3TBI A;  2XAH A;  1FMV A;  2DO7 A;  3OL3 A;  4ZZD A;  2CYY A;  2E5N A;  4XBF A;  1XGO A;  1XS9 A;  2VBW A;  3W6V A;  4I76 A;  3E7L A;  2HZT A;  2O9L A;  4LMY A;  3L7W A;  3BJ6 A;  1RIO H;  2RNG A;  4XLN F;  1K61 A;  5IP7 J;  4I98 B;  5KCM A;  3HL2 A;  1WCM J;  3I3L A;  2RVC A;  2MC4 A;  5DCM B;  1YYV A;  4ZYG A;  4IRI A;  1Z1D A;  2CQQ A;  4KYW A;  2CW8 A;  1YJW I;  5BPI A;  1LEA A;  3KFW X;  2A6H F;  2IGO A;  2IGK A;  1FNN A;  4IF4 A;  2A68 F;  2DMP A;  3HOS A;  3CUQ A;  2DN0 A;  3I9V 2;  4Y15 A;  1WI3 A;  3TW7 A;  1HF0 A;  2R93 J;  3HG9 A;  1E17 A;  2HNH A;  2DFH A;  3W2W A;  1FWZ A;  1JUP A;  3LWF A;  2CQX A;  2XKO A;  2MLG A;  3EUK L;  3IWZ A;  3DBR B;  3K4K A;  4NC7 A;  1YW9 A;  2E5Z A;  4I0A A;  2CO5 A;  1BA5 A;  3BR3 A;  4UVB A;  3AL0 B;  4GYI A;  5K5Q A;  1X4O A;  5B5E C;  2CH0 A;  4LB5 A;  2WB1 N;  1A5J A;  2CW0 F;  4OAY A;  4DGW B;  2DK8 A;  5CKT A;  5LD2 C;  3FK7 A;  2BZT A;  3J7A O;  2X0L A;  3CJN A;  3S15 J;  1SVO A;  2LOO A;  1W0T A;  1X1P A;  2BW3 A;  3RPQ A;  1RR7 A;  3UKG A;  3G6E I;  1S9H A;  3S2H J;  1ZLK A;  1TP4 A;  2IW5 A;  2V26 A;  2G7H A;  3KEO A;  5AIQ A;  1K83 J;  4P9U A;  1TNT A;  4LFU A;  1OIS A;  4PJM A;  2KQR A;  2L9R A;  4BHP A;  4NB5 A;  1RZ4 A;  4EJU A;  4ZH4 F;  1G3W A;  1JJ6 C;  4BUP A;  4BY7 J;  3EUH C;  1VQK I;  5ICG A;  5DUK A;  5KNL A;  2JPC A;  4YIR X;  2CMP A;  1XSV A;  4D7N A;  1QHH D;  3BTJ A;  1O7L A;  5HDN A;  2JZY A;  2X6O A;  5ERI A;  5J4Y A;  3TGN A;  3M4O J;  2ZFW A;  1V54 H;  3WU0 A;  4G7O F;  2E2J J;  5EEH A;  2K3P A;  1GVD A;  1KON A;  4A3K J;  3GF2 A;  1VQ5 I;  3AL0 C;  1QVT A;  1RI7 A;  2RKH A;  3P7N A;  3T8T A;  2ICW G;  3CTA A;  2AS5 F;  2F4O B;  1Y6I A;  2R5Y A;  1IN8 A;  2Y48 A;  5CVI A;  2MAB A;  3V7S A;  3G1L A;  4HNV A;  2GZW A;  3OIP A;  4G6D A;  2DA6 A;  4BBR J;  3K70 D;  3RZD J;  5LFA A;  3CC2 I;  2STW A;  4BYY A;  1R4M B;  4I09 A;  4ENM A;  3EDP A;  1DGR M;  2XVC A;  4A3L J;  3L00 A;  2QEN A;  1UHW A;  2LC2 A;  1AKH B;  1MMG A;  2XAG A;  4XKB A;  1X3U A;  1X58 A;  1E3H A;  3VSL A;  2WC2 A;  1VQ9 I;  2JA8 J;  3ZPL A;  5HLI A;  4IRG A;  1PP7 U;  2QZ8 A;  4N0B A;  3L09 A;  2OF7 A;  1GDT A;  3I4M J;  3RTR A;  4KIF A;  2ZME B;  2HR3 A;  5KVR A;  2EIL H;  3MKZ A;  4BEH A;  4AVP A;  1BC7 C;  4PUS A;  5CVR A;  1H0M A;  3H9J A;  5CVJ A;  4I7H A;  4NQW B;  1VTN C;  4CXF A;  4CDG A;  3OMY A;  3HOV J;  1V5G A;  2GM4 A;  1LFB A;  3ZXS A;  3KP5 A;  1IRX A;  3WTW C;  4M9S A;  4X6A J;  3GWZ A;  5EF6 A;  3GME A;  5LEJ A;  3RKY A;  2X1C A;  2NNY A;  1HKQ A;  2XAJ A;  3CDI A;  2F5E A;  3V4G A;  3AKZ A;  4WXC A;  4RDU A;  2WTE A;  2JRT A;  5D5V B;  4KA4 A;  3GTP J;  2X6W A;  4C2T A;  3DTI A;  3CJQ B;  3G71 I;  5F6F A;  4GO1 A;  4G9Y A;  1QU3 A;  1OJL A;  1ON1 A;  2BYV E;  3BRO A;  3J81 Z;  1I5Z A;  5K1Y A;  4MQ9 F;  3KP4 A;  1XCB A;  3OR2 C;  3KYC B;  3MVP A;  4BS9 A;  2CQ7 A;  2EB7 A;  2FQ3 A;  3DKW A;  3TDU C;  2F6C A;  2ZME C;  1QZZ A;  4ABZ A;  4UXN A;  2V1N A;  4RGR A;  4XKV A;  4B4C A;  2DT6 A;  2Y0M A;  4CH7 A;  3WTV C;  2KDZ A;  1X3Z B;  1Z7L A;  2F5F A;  4KT6 A;  5DCM A;  3R61 A;  3FMS A;  4R79 A;  1ZR4 A;  1MMA A;  5CYV A;  3EUH A;  2L7Z A;  1HW2 A;  3B02 A;  1WJA A;  2KT0 A;  4XRM A;  4AVZ A;  4UUS B;  2VPR A;  3PM1 A;  4EGZ A;  3F0C A;  5E20 A;  2L01 A;  2EZL A;  3H36 A;  3KYL A;  5FB2 A;  3K4J A;  4U87 A;  3TW6 A;  4XRS A;  4TV7 A;  4EAT A;  2FOK A;  2NVX J;  1TWF J;  2A5W A;  3MCZ A;  1SAX A;  3S3N A;  2VON A;  2EZK A;  2K40 A;  3KZI C;  3AAF A;  2XAS A;  4M3D A;  2DYS H;  1Y1V J;  3I4P A;  1G8X A;  2R7D A;  4M6X A;  2PLY A;  3H9Q A;  4G6T B;  3DPL C;  2NXN B;  2QKL B;  3Q9S A;  1YTY A;  1LB2 A;  1BR1 A;  3F72 A;  2VBX A;  4MQV A;  3RKX A;  3KET A;  5ICF A;  4LG3 A;  1QZY A;  4DOZ A;  2A61 A;  3RI4 A;  4I99 C;  1HCR A;  2VOO A;  2IJL A;  4IHW A;  4HST A;  3HM5 A;  2Z2S B;  1S6L A;  3LSP A;  5TRD A;  4ANJ A;  2QSG X;  3ISP A;  1PDN C;  2CV0 A;  2NVT J;  2HVS A;  2EQR A;  5CVV A;  1QA6 A;  1MBG A;  1OYW A;  3H92 A;  1QRY A;  2RV8 A;  1JGS A;  1HDP A;  2KRH A;  2XRL A;  1K6Y A;  1W1W E;  2OV7 A;  2R7U A;  1YX5 A;  3KLO A;  4KN7 X;  3JRA A;  2BHZ A;  2XAQ A;  4LG0 B;  3BPV A;  1R9T J;  3NWS A;  3T5X A;  1LFU P;  1ZR2 A;  4CZZ A;  4G94 A;  5DEQ A;  1X1A A;  1ETV A;  3W3C A;  3E6C C;  2DA7 A;  1KZH A;  3P9I A;  1IN4 A;  3LSK A;  2KZV A;  3WTX C;  1Y0U A;  2DMT A;  2D1V A;  3R60 A;  2R7Z J;  5D6F A;  4MEX F;  1Z0X A;  3E6B A;  1ZG3 A;  3O6B B;  1A6I A;  4G7Z F;  2KP6 A;  2MA3 A;  2L54 A;  4R1H A;  3SEQ A;  1U0J A;  4XLF A;  2HZD A;  2QSH X;  3IH2 A;  1LDJ A;  5HDG A;  5DYM A;  4UV9 A;  5FKK A;  3IAM 2;  1OKR A;  2HTJ A;  3HRM A;  1AKH A;  3CME I;  2M7A A;  2EZH A;  4HV5 A;  2HOS A;  2QBY B;  3M9A A;  2GQQ A;  3HRT A;  2ZFU A;  4AID A;  4ITV A;  2CW7 A;  2Y31 A;  2ZME A;  4ENN A;  4M71 A;  4A3M J;  1KQ8 A;  4WWC A;  1VQP I;  2KIQ A;  5D5U B;  3F8B A;  3RQ4 A;  2ZSI B;  4KIT B;  2GA2 A;  4NQW A;  1MH4 A;  3LFU A;  2EBI A;  3T1B A;  5FKN A;  5TGT A;  1R22 A;  2M9H A;  1XTA A;  4L9T A;  3I5U A;  3BP8 A;  3LMM A;  3MD2 A;  1W7P B;  3QYB A;  2MFZ A;  1IDY A;  4HEA 2;  5JR3 A;  2PJR B;  1MND A;  1JGG A;  5TJJ A;  3RYR A;  2KIM A;  4WF2 A;  4AYB A;  3SZT A;  2PJP A;  4B1R A;  1TL8 A;  2EFN A;  2W7N A;  1MSE C;  3LA3 A;  3FKJ A;  4HRI A;  2BXY A;  5GPA A;  1FBU A;  4RGS A;  4RB2 C;  2JPB A;  4M9X A;  1ZRC A;  1ON2 A;  4P1W A;  1BW6 A;  2DA5 A;  4NBQ A;  3VB2 A;  4AD9 A;  2JK3 A;  3OOP A;  1HA8 A;  3ELK A;  2Z9O A;  4II2 A;  3U2R A;  2HYJ A;  4F7Z A;  3AG3 H;  5GAE J;  4JQF A;  3BZ6 A;  4JX5 A;  4C2M J;  3KE2 A;  3JRB A;  3GTO J;  2EV6 A;  3FXU A;  4PGH A;  2CFO A;  4BDZ A;  4HF2 A;  3S32 A;  2KIS A;  2H1L A;  3T8R A;  2PBI A;  1F36 A;  2AQE A;  3MFK A;  3OS1 A;  4UUS A;  2VUM J;  2ZXJ A;  4V19 K;  4QTR A;  2OCE A;  3FMQ A;  2JJ7 A;  4XK4 A;  3U1K A;  1LDK B;  2L7K A;  1T95 A;  3HOY J;  1LKX A;  2VQH A;  4RBO A;  2E60 A;  1G6N A;  1S7E A;  3KEY A;  4RB1 A;  3WU1 B;  4UNO A;  4NHJ A;  1M1E B;  2BV6 A;  2W1O A;  3V8L A;  1UFM A;  2XIG A;  3CC4 I;  4E7I A;  2V9K A;  3BR6 A;  3CCM I;  3KYD B;  2ID3 A;  5A2Q Z;  4L18 B;  3CO6 C;  2VOD A;  1D1A A;  3PSI A;  2F5C A;  3DV8 A;  3GCM A;  4YIF A;  2LSO A;  1KU2 A;  5FLX Z;  2ZXI A;  4KFC A;  2R7Q A;  4RMN A;  4JX4 A;  1S7A A;  3ZMS A;  4DZJ A;  5EZG A;  5ED4 A;  4LG0 A;  2WV0 A;  1T0F C;  2ESN A;  4C3J J;  2B7E A;  2FBI A;  3RKQ A;  2VC1 A;  5FGM A;  1MD0 A;  1XGM A;  4HX4 A;  3TO7 A;  3K10 A;  3ZR8 X;  3DBL B;  2DQL A;  1FX7 A;  2CWE A;  4F92 B;  1X4P A;  3LSR A;  4W1U A;  3F21 A;  5BMZ A;  2DOA A;  5FLV A;  2DMN A;  3OY9 A;  2KJB A;  3CCY A;  2O5R A;  5ILU A;  2KKO A;  1GUU A;  3BC8 A;  3KZZ A;  4N4N B;  2K9M A;  4ZYD A;  3JRG A;  4MGR A;  2ME6 A;  2MW8 A;  4HF1 A;  5KHD A;  2Q2E B;  5EZH A;  1K4T A;  3I71 A;  2ZKZ A;  1GXP A;  4BXF A;  4CYD A;  5DM6 F;  5HLG A;  1FC3 A;  3D0S A;  3JW4 A;  1FYK A;  1QHG A;  2KL4 A;  1F5T A;  5C4X J;  4L5E A;  1BC8 C;  1BR4 A;  5C4J J;  4PCQ A;  2HPI A;  1T39 A;  5M3F J;  2QBY A;  1NG7 A;  1I3Q J;  1SD5 A;  3ZMV A;  1K4S A;  1BJA A;  3OYA A;  1BI2 A;  1JTX A;  1ETX A;  2DFE A;  4QSH A;  4CCM A;  1XDS A;  2Y9Z A;  1HQC A;  5TIS C;  1TWC J;  2P6S A;  5IP6 A;  4M3B A;  2XSD C;  2XGE A;  4RAF A;  2HDW A;  5F1J A;  1HOM A;  3ROU A;  2OJE D;  3WU2 C;  5IP9 J;  4PK4 A;  5DCF A;  3N05 A;  4UVC A;  2Q1Z B;  1W7P A;  2OTJ I;  3R4K A;  4RB0 A;  3SFZ A;  2KFD A;  5DUI A;  2PJR A;  3N4M A;  2J5P A;  3EET A;  2O3F A;  2KZG A;  1FPQ A;  1POG A;  3DP7 A;  1W7P D;  3ZRG A;  3BG3 A;  3OL4 A;  4OIN F;  1CF7 B;  5J8F A;  4CYC B;  1T33 A;  4F55 A;  3IP4 B;  4XLP F;  3S1Q J;  1TBX A;  4X1E A;  2L02 A;  5D5W B;  4IL6 C;  2DMQ A;  2P5L C;  4A3F J;  2H8R A;  4G8X A;  2OD5 A;  4PSX A;  3CDL A;  3BG5 A;  3OYN A;  1SVM A;  1YLF A;  1N25 A;  2LF8 A;  4JBA A;  3S1N J;  2OU2 A;  2FD5 A;  3HOX J;  2DW4 A;  4S05 A;  4D5C A;  2NS7 A;  3TKY A;  4P5O A;  2TCT A;  4XL9 A;  2JVG A;  1MJ9 A;  2HYG D;  3D5S C;  1LDD A;  1NHA A;  1STZ A;  3X2Q H;  1F4K A;  1WRJ A;  3OR1 C;  3DLA A;  5CPR B;  2M8E A;  4BJ5 C;  1LVK A;  1T0F A;  1S5L C;  3RJP A;  3ABL H;  3BG9 A;  1K78 B;  4S0H B;  2ESH A;  5J3L A;  3TMO A;  2HDD A;  2VXZ A;  4PDK A;  5J1R A;  1Z6R A;  5F1R A;  3BG7 A;  2EIM H;  3FBN B;  2QM3 A;  2EIN H;  4MO7 A;  2X48 A;  2MG4 A;  3GTM J;  1SFK A;  1OMI A;  1DP7 P;  3MAJ A;  1D5V A;  3RQI A;  1IAW A;  1LVA A;  3U1D A;  1T6S A;  2HS5 A;  3H1C A;  4A3B J;  1IGN A;  1G3T A;  2M1B A;  4JOM A;  3HB9 A;  3KX2 A;  4ZC3 A;  3OSF A;  3ZQL A;  1WQ2 A;  2K9L A;  2K27 A;  1RC9 A;  2DK5 A;  5M5W J;  3ZOB A;  1QVU A;  4DYQ A;  2OPT A;  3NQO A;  1IUF A;  3IKV A;  2VQG A;  1Q1V A;  4U0V A;  3SZG A;  3F8C A;  3WTT C;  3VPR A;  2V6E A;  3FDY A;  4XID A;  5J6X A;  5E1X A;  5HS7 A;  2RC4 A;  2W57 A;  4KJZ A;  2DJN A;  3FBI B;  3JTH A;  1D8J A;  4P9F A;  4B8X A;  4BU2 A;  2EZI A;  4Y13 A;  1RUN A;  5JVT A;  5B1B H;  1BM9 A;  2EH3 A;  3GUD A;  4RLF A;  4BGD A;  4BY1 J;  3H5N A;  4CA0 A;  1DDN A;  2HOT A;  1FBQ A;  3RIR A;  1OCZ H;  4M72 A;  1Y8Q B;  2K9N A;  1TT0 A;  4XSZ F;  1OQY A;  1TWA J;  2XPW A;  4RB3 C;  1DPR A;  1Z3Y A;  3QP5 A;  2DCE A;  2G0E A;  4OMY A;  1WJ5 A;  3WG7 H;  2GAU A;  2BY3 A;  4EQQ A;  5IYC J;  2IAI A;  4V2F A;  3WE3 A;  3FXM A;  3P9C A;  4I6Z A;  3LQR A;  4HOB A;  2DA4 A;  3MWM A;  1Y56 A;  2F2E A;  4QIW N;  1IF1 A;  3E5X A;  2HI3 A;  2Q2E A;  4HNU A;  4PSW A;  2X6X A;  5E1W A;  1TC3 C;  1R5I D;  5GTH C;  1WJE A;  3OYM A;  2VN2 A;  2L5Q A;  3O8G A;  1X1C A;  4FX4 A;  3OYF A;  2B9S A;  3HTS B;  5GAG J;  3HIF A;  1RES A;  1T56 A;  1U3E M;  1BOB A;  4YFN F;  4N9I A;  1B59 A;  2V1D A;  4NNJ A;  2HDC A;  4HYE A;  1J09 A;  4ZZL A;  4C30 A;  2K9S A;  2TRT A;  1V5E A;  1KU9 A;  1QNT A;  4KUM A;  2BE5 F;  4DBR A;  1MSF C;  1IXC A;  3GTJ J;  3BPX A;  3CO7 C;  1HBX G;  3HEF A;  3IHU A;  5IT9 Z;  2VQC A;  2ISZ A;  3HSR A;  5CLS A;  3V7C A;  1UB9 A;  4L5I A;  4LGW A;  4E7Z A;  3B6A A;  2J5O A;  1R7J A;  3H35 A;  5DD4 A;  1VQ7 I;  3S2D J;  5E1Z B;  1Y39 A;  2M5W A;  1YX3 A;  2K02 A;  2WB1 A;  5EJC A;  2IS4 A;  4D9J A;  1IJW C;  1ITY A;  3JRD A;  3IH3 A;  2GWR A;  1R6R A;  4IRH A;  4XOT A;  1CF7 A;  5FRN A;  1UCR A;  4FQG A;  3SEZ A;  4CYC A;  3C2B A;  4EV0 A;  3TP3 A;  2QUF A;  4AIH A;  4BXU A;  1ZAR A;  3VOE A;  3E6M A;  4B3X A;  2GBY A;  3QAH A;  3BR1 A;  3C2H A;  4ESF A;  2G9W A;  3K6G A;  1S7O A;  2ZNZ A;  1P2F A;  4M6Y A;  5L3C A;  1J75 A;  2K4J A;  1XSD A;  3NWT A;  2HPM A;  3H3V K;  5IPA A;  2VT3 A;  1YO5 C;  2R7O A;  1ZG5 A;  3HGY A;  1WJF A;  1R5G A;  3MEX A;  3RDI A;  1DGW Y;  5B1A H;  3K7A J;  1ETO A;  2LY9 A;  5F0H A;  2IVM A;  2BVL A;  1TWG J;  2MGQ A;  2IS2 A;  2PEX A;  4BQA A;  2L2O A;  4HSR A;  1DQU A;  3BY6 A;  2DMU A;  4EJO A;  4HQM A;  2O8K A;  1Z91 A;  2P5V A;  2P81 A;  1LPQ A;  1PVE A;  2RQP A;  3JAM Z;  1P6R A;  2L9V A;  2M8G X;  2CSO A;  1KU7 A;  2B63 J;  2FBK A;  5HLH A;  2R5Z B;  2VJI A;  5F0C A;  2XGX A;  4MTD A;  5E8G A;  1YHQ I;  3DBH B;  1ONV A;  4E6K G;  2VC0 A;  4D0P A;  1UG2 A;  1YJ9 I;  2Y69 H;  1E0E A;  2MH9 A;  1OCC H;  3NRV A;  2KIF A;  2IT0 A;  3MZH A;  3ASN H;  1NH3 A;  1WI9 A;  1P4A A;  4QPO A;  1FMW A;  1LJ9 A;  2NAZ A;  2M0C A;  4OMZ A;  3DQV C;  4A0Y A;  3HPH A;  3L9F A;  2HWV A;  2M3A A;  2K9Q A;  3CC7 I;  2ZB9 A;  4NC6 A;  1YE9 A;  2BHY A;  1BL0 A;  2JN6 A;  2XGC A;  5BS6 A;  3IC7 A;  2PI0 A;  4IKF A;  2HOA A;  1D0X A;  4XQF A;  3MKY B;  1P4X A;  1I1G A;  2ELK A;  2PMZ N;  3D5L A;  5F0F A;  1DP3 A;  1ETW A;  2R4G A;  1XGN A;  4M6V A;  4AIJ A;  3CCJ I;  1ZH5 A;  5DD8 A;  2ADU A;  4LOC A;  5EG0 B;  3M07 A;  3PQJ A;  5E3M A;  2M4K A;  2HKO A;  2X6Y A;  1MBH A;  4E7J A;  2LMD A;  4LIU A;  5LRR A;  3FHN A;  4XIC A;  1TQP A;  1UEL B;  1YIO A;  3SHF A;  1SC7 A;  4QPQ A;  4OWR B;  1B9M A;  3L1P A;  5HOO A;  2STT A;  3ABK H;  5JFR A;  2PN6 A;  2VE9 A;  1WJD A;  1S3J A;  4HAM A;  3FK6 A;  3VFZ A;  2DA3 A;  3J80 Z;  2JSC A;  3IV5 A;  4BKX A;  1AA7 A;  1BIB A;  2FX0 A;  3LAJ A;  1IC8 A;  2ZCW A;  2DOD A;  5J8C A;  2P4W A;  2WWY A;  4A0X A;  2D45 A;  3H3Z A;  2P0W A;  1N75 A;  4FHT A;  3F8N A;  3W6J B;  3ABT A;  4HG2 A;  2C6Y A;  1PP8 F;  2M0M A;  4E7S A;  3IH4 A;  1CQT A;  3HYI A;  5D8K B;  5E8I A;  1N77 A;  1QPM A;  1ACI A;  2WAQ N;  1MBE A;  3K1P A;  4AUX A;  4A3I J;  3CJT B;  3LSG A;  3TL4 X;  4HW0 A;  9ANT A;  1EH8 A;  4CUG A;  2O03 A;  4Q5S F;  2CU7 A;  2ZO4 A;  2MBF A;  5IYD J;  4KN4 X;  2PMH A;  1OYY A;  2DQR A;  4IZZ A;  4RS8 A;  3CLQ A;  3K1M A;  2JA6 J;  3OWT A;  2EA4 A;  2BVM A;  1SAN A;  1ZAO A;  4Y7N J;  3Q5F A;  3DPU A;  5LLQ A;  5D6E A;  3DCF A;  4EVI A;  3E5U A;  1K6O A;  1TQI A;  2QQ9 A;  4OIQ F;  2RNJ A;  2DT5 A;  3FZV A;  2V79 A;  3ML6 A;  3PNT A;  2DJI A;  1WHU A;  2Y2Z A;  2V7F A;  4U0W A;  1H9G A;  2MH2 A;  2E7X A;  2DDA A;  3AG4 H;  3GTK J;  2VIX A;  2DA2 A;  1R1T A;  3GFL A;  4II3 A;  2WY8 Q;  3ZMD A;  4XRS G;  5E3N A;  2W85 A;  2MLK A;  4I0B A;  2R7R A;  3LSH A;  2E1M B;  4BQO A;  2KMU A;  2D5V A;  3CUO A;  1SFX A;  2HTS A;  3SDG A;  2H27 A;  3KZY A;  2XAU A;  4C3I J;  3JRC A;  2M7B A;  4F91 B;  2L4A A;  3TO6 A;  1SVL A;  4A5N A;  4XLC A;  1XDU A;  2FML A;  3F8M A;  1MIJ A;  2XRN A;  1MZB A;  5GPC A;  2KIU A;  2HGC A;  2UXN A;  4QLC U;  1G3Y A;  1TNS A;  2OQR A;  2FMY A;  2XF7 A;  3HBL A;  2V9V A;  1ZYR F;  1W4M A;  2YS9 A;  2H09 A;  4JK1 X;  5GAH J;  4UY8 I;  3CCL I;  4GFB A;  1FSH A;  1FTZ A;  4E7K A;  3W2V A;  2R5Z A;  3E1S A;  3L2Q A;  3OYB A;  2JT1 A;  5E18 F;  4O3M A;  5GTI C;  1Z21 A;  2QA4 I;  4WXD A;  1ZN2 A;  2AXT C;  2VXD A;  3R0J A;  1ZKG A;  1MKM A;  2OCC H;  2ZJR F;  1JUS A;  4ENK A;  5FJ8 J;  3B73 A;  4A93 J;  2LVS A;  4YFK F;  3Q0W A;  5J1Y A;  4D1Q A;  3FXJ A;  1SFU A;  1VQO I;  3GXO A;  4IVN A;  1IW7 F;  1ZK8 A;  5BNG A;  1U9N A;  1FOY A;  1YS6 A;  2E1M C;  3I53 A;  3GEZ A;  1YS7 A;  3BOQ A;  2W82 A;  2FOW A;  1SD4 A;  2WV1 A;  3JTG A;  2VBY A;  2VJ4 A;  4NDL A;  3LSI A;  4U0Y A;  2IXS A;  5ICE A;  2VOP A;  3BCA A;  2NOJ B;  1MDM B;  3EYI A;  1V3F A;  2LR8 A;  1A36 A;  2PFB A;  2I10 A;  3RSN A;  2RQQ A;  1H88 C;  3K4C A;  3HDD A;  1GXQ A;  2NRA C;  3FXQ A;  2XDV A;  3M8E A;  5EG0 A;  3QPH A;  4L9N A;  3CLO A;  2A6E F;  5IOZ A;  4ASN A;  3L2U A;  2VQL A;  3A0B C;  4HLY A;  4XLA A;  5FD5 A;  2VB6 A;  3S93 A;  3WGI A;  1VQM I;  4HQE A;  2CRG A;  2XAF A;  2EV5 A;  3WTS C;  3HUG B;  1K7A A;  2X51 A;  2UZK A;  2M45 A;  3HSE A;  3OYC A;  3MMY B;  3GW2 A;  3EYY A;  4ZDL A;  5E79 C;  2NNN A;  1BW5 A;  1FOW A;  1V5F A;  4Y4R A;  1IV8 A;  4A3E J;  3S17 J;  4XN3 A;  2W48 A;  3J81 K;  1X1D A;  2BBY A;  3WGG A;  3ASO H;  3K0L A;  2R7V A;  1AOY A;  3ZN1 A;  4X0G A;  1HW1 A;  2EIJ H;  1W0U A;  2IS1 A;  4OIO F;  2R7X A;  2R3S A;  1BI1 A;  3I54 A;  1V55 H;  2K3F A;  2M30 A;  1YI2 I;  4GDF A;  3T0Y A;  2EFP A;  2I8D A;  4CCO A;  3V7R A;  3ONQ A;  1O3R A;  1B72 B;  3G4S I;  2Z1D A;  3CES A;  3FXL A;  3CCR I;  4EEF G;  3A02 A;  1J59 A;  2XKP A;  1D8K A;  5J1U A;  3S16 J;  1JJ8 C;  3HZJ A;  3PFY A;  2QEX I;  2BY2 A;  3K69 A;  1X19 A;  1B6A A;  4LK0 F;  4BAC A;  2CQK A;  3ZMU A;  5HDK A;  3HOW J;  3G1M A;  3QOD A;  1ZG1 A;  1SD7 A;  2V6C A;  3COA C;  4MHG A;  1OCP A;  5ILS A;  3S2W A;  1O3Q A;  2H94 A;  1P9Q C;  1RKT A;  4PJ0 C;  3V42 A;  1VQL I;  5D4R A;  2E34 A;  5FKM A;  3SYT A;  4WK8 F;  3L2V A;  2L9N A;  1Z67 A;  1Z05 A;  5D4S A;  1QBJ A;  3CMA I;  2L0K A;  3PNV A;  2OZ6 A;  3GX4 X;  1R49 A;  4CCN A;  2LKX A;  2KHM A;  3GTL J;  3J7Y J;  2ELH A;  2F5D A;  1RUO A;  2E71 A;  2W24 A;  4YEJ A;  1T08 B;  5C3E J;  3HKZ N;  5F27 A;  3DEW A;  2AO9 A;  2FNP A;  1MGT A;  2ZJ2 A;  2VT2 A;  2P8T A;  2XB0 X;  1KA8 A;  3EQL F;  3M8F A;  2DU9 A;  1U2W A;  2IBD A;  2CS3 A;  1TLH B;  3PNY A;  1I1S A;  4UHT A;  4Y17 A;  2H6C A;  2LFB A;  4BAY A;  5C44 J;  1J2X A;  3OIO A;  3C3W A;  3VYU B;  2N8G A;  2HVQ A;  3NAR A;  4LB6 B;  3SFI A;  5B66 C;  1U6G A;  1XMA A;  4IOA F;  2OZU A;  4RGX A;  3H0G J;  1U8R A;  3G1O A;  2XB5 A;  1YIJ I;  1EJ9 A;  4A12 A;  2FU4 A;  5J4V A;  4YRV A;  1I3A A;  3LNQ A;  3VOD A;  1I6H J;  3ECH A;  4O6J A;  1KYW A;  2MYS A;  2W25 A;  3G2B A;  4XM3 A;  3BDD A;  3VWB A;  5LGT A;  1WJB A;  5JHU A;  1I50 J;  1TT5 B;  3TP0 A;  2E2H J;  1PUF B;  1RET A;  2M87 A;  1Z77 A;  2E36 A;  1MDM A;  6PAX A;  3GTG J;  1YOV B;  2JTV A;  3PFI A;  4IHY A;  1Y1W J;  2XHK A;  1V4R A;  3A2K A;  3K2A A;  4H0E A;  2GIV A;  1H89 C;  3IKT A;  1E3O C;  4UUV A;  1IXR C;  3A4C A;  2DT7 B;  1GLN A;  2WAE A;  5HS8 A;  1XB4 A;  2XC7 A;  2FNA A;  1ULY A;  4K2E A;  5H6Q A;  4XOP A;  3PUB A;  5E3O A;  1XGS A;  1WH7 A;  3WHB A;  2D1H A;  1ORK A;  4HPQ A;  2F4M B;  3HUG A;  4M73 A;  2LLK A;  2BY1 A;  4LLL A;  3ESW B;  2PQ8 A;  2R92 J;  3JCU C;  4F93 B;  4HDV A;  2O0Y A;  3IRR A;  5KK1 A;  3BR5 A;  2CGP A;  2QLZ A;  2DA1 A;  1LFP A;  1F1Z A;  2VJJ A;  3S8P A;  1DPU A;  1HST A;  3C18 A;  2IGM A;  1D3Y A;  3OS2 A;  2HQA A;  2E7W A;  2ZXW H;  1VND A;  3HHH A;  1XN7 A;  3O3K A;  3TQN A;  2UXX A;  4A6D A;  3BTL A;  2JWT A;  1VI0 A;  2X1D A;  3U9G A;  2OC6 A;  1SFE A;  2HFH A;  4LD5 A;  5LHH A;  4J00 A;  2QQA A;  2FRH A;  3ZQQ A;  3K1N A;  4HA8 A;  4HBL A;  4HX7 A;  4PGG A;  2O61 A;  3M1E A;  3HTU A;  3I0T A;  1PYV A;  3F6O A;  3WTY C;  1FEX A;  3LQQ A;  1HDD C;  1A6Q A;  2HQN A;  2W84 A;  2E19 A;  2W4S A;  3QPS A;  3D5R C;  4AWX B;  2JSP A;  5F08 A;  3DWL E;  1R1U A;  2IPQ X;  3QWL A;  2K7L A;  1JTY A;  1FSE A;  4CGZ A;  4A3C J;  2CFX A;  4OU0 A;  3AG1 H;  4MEY F;  3WOD F;  3QPL A;  1ENH A;  2IEK A;  2L7M P;  1B72 A;  4FT8 A;  3QOP A;  3Q0V A;  3E0J B;  4WXH A;  1NK3 P;  4KDP A;  3UNG C;  3LSM A;  5LBQ A;  4F52 A;  4ON0 A;  4OIP F;  3IWF A;  3FIW A;  5B3S H;  2GXG A;  3V8J A;  2VKD A;  5CQE A;  2H8W A;  3LOC A;  2HQR A;  5GAD J;  1HXD A;  1JXS A;  1ERD A;  1OFC X;  2FUG 2;  3MQ0 A;  4FTH A;  1IRZ A;  2VJ5 A;  1TW3 A;  1EH6 A;  2HOE A;  4KIS A;  3N97 A;  1LE8 B;  2CQN A;  2LD5 A;  4GXO A;  2E1O A;  1SAU A;  4IPA A;  2LKS A;  1IV6 A;  1XSX A;  3GFI A;  4AM3 A;  4R8H A;  5IYB J;  2A69 F;  4DW6 A;  3QYF A;  3QQA A;  3DXJ F;  3JSO A;  3H5A A;  2ISY A;  3FHZ A;  5DV5 A;  3QYE A;  1FOK A;  1ZRF A;  4A2U A;  5A2Q K;  5H20 A;  2OAZ A;  3BQZ A;  1U5T B;  4ESB A;  1XX5 A;  5HLT A;  4AU7 A;  5FLX K;  2VKV A;  3MZ8 A;  3HOZ J;  2DBB A;  1O7F A;  1X2M A;  4PJN A;  2EFW A;  2JMW A;  1NG6 A;  4IHT A;  1S29 A;  3F9K A;  3PO2 J;  3M7G A;  3RKW A;  1S72 I;  3ZQI A;  2CUE A;  3KPH A;  2VPL A;  2KLO A;  2LP0 A;  3OYE A;  3QU3 A;  2YU3 A;  3VDX A;  1P92 A;  2LY2 A;  2FE3 A;  1J5Y A;  4HF0 A;  4UVA A;  2LNB A;  1JUM A;  3F3X A;  4RLQ A;  3I59 B;  3JSP A;  2B0L A;  3PO3 J;  1MNM C;  3ZMT A;  2M34 A;  5FFZ A;  5L3E A;  1T8I A;  1HKT A;  2AXL A;  2DDB A; 
#chains in the Genus database with same CATH homology
 1R58 A;  3ABU A;  3FM5 A;  5ILV A;  5CVU A;  1B4A A;  1XCV A;  1KGS A;  1U5T C;  3KP3 A;  1HSJ A;  3TOA A;  3REO A;  5CJ9 A;  3BWG A;  4BHC A;  2FF4 A;  1R5H A;  3KCC A;  4RAZ A;  5EEG A;  3KP2 A;  1Z7U A;  3BJO A;  3C1D A;  1J9I A;  2D2W A;  1QGP A;  2Y75 A;  1IRG A;  5LGU A;  3DPT A;  4LLG F;  4I01 A;  2HKX A;  2RN7 A;  2DPD A;  4Q47 A;  2Z5U A;  3R6S A;  4GCV A;  3WTU C;  4ZYE A;  4KIC A;  2E1C A;  1WWX A;  1T98 A;  3BJA A;  3IRQ A;  5HVQ C;  1K78 A;  5L3D A;  3H3U A;  2ZNY A;  3DF8 A;  2YR2 A;  3GFM A;  2QYO A;  4RAY A;  4A0Z A;  2EFO A;  1YW7 A;  3DFG A;  2EV0 A;  2A3S A;  3TOB A;  4EMS A;  4FX0 A;  5BOX A;  1PUE E;  2Q0O A;  2Z33 A;  1FP1 D;  1GVJ A;  4P55 A;  2YSR A;  4MTE A;  4A5M A;  1YFH A;  3LAP A;  3ECO A;  1T2K A;  3TDZ C;  3VEP A;  2IA2 A;  5K5R A;  1O3T A;  1U5T A;  2HYF A;  3WG9 A;  4DQ2 A;  4HV6 A;  4CHU A;  1SD6 A;  1FLI A;  2FA5 A;  3F23 A;  4I2O A;  2OQG A;  3RYP A;  1IZ1 A;  1TW2 A;  4U88 A;  1BOA A;  2FSW A;  4YG2 F;  3HRS A;  5BPD A;  2R7F A;  1ZHF A;  3WGH A;  3I59 A;  2MC3 A;  1R1V A;  5D5X B;  2VE8 A;  2EFQ A;  4KIB A;  4M9Z A;  3FMR A;  4U7B A;  2DAO A;  4DNC A;  4BHB A;  2NS0 A;  4HDU A;  4EGY A;  4HZF A;  2Z3Y A;  3NEU A;  1SMT A;  1UST A;  3E3V A;  2VBZ A;  1ODD A;  2XUB A;  1Z6T A;  1O57 A;  3HOT A;  4Q4Z F;  2LF7 A;  5JI6 A;  1WSU A;  1O3S A;  4OOI A;  2GA1 A;  4LLN A;  2RDP A;  4LJZ F;  5IT9 K;  2OA4 A;  2ACJ A;  2L3D A;  5E17 F;  2H6B A;  3F8F A;  2EK5 A;  1HW5 A;  3GLX A;  1IRF A;  3QRF F;  4ETS A;  4CIC A;  1W5S A;  1KQ9 A;  2G7U A;  4EM1 A;  5LHG A;  5LGN A;  3G3Z A;  2IP2 A;  1QO0 D;  4I02 A;  2A5Y B;  4CO8 A;  1LEB A;  2TDX A;  1R00 A;  2YPR A;  2PG4 A;  1OYI A;  1XD7 A;  1G3S A;  3OV8 A;  3P9K A;  4HX8 A;  3ZN0 A;  1E2X A;  4EM2 A;  1BIA A;  4UV8 A;  2P5K A;  4KNY A;  5L3B A;  2ETH A;  1FY7 A;  3JAM K;  1BN5 A;  1IN6 A;  3E5Q A;  2HEO A;  4PZJ A;  4XRF A;  3E97 A;  3LST A;  4KMU X;  5K5O A;  4GYG A;  2IA0 A;  2IA1 A;  1ZGJ A;  1IN7 A;  2X4H A;  1I6X A;  5D8L B;  2KJC A;  3KLN A;  3PQK A;  1RNL A;  4XSX F;  2EJR A;  3LA2 A;  1L0O C;  3GZ5 A;  4G6Q A;  3FF5 A;  2IRF G;  1OPC A;  4U7D A;  3C7J A;  2LKP A;  3GO5 A;  2GXB A;  5FFX A;  4KT5 C;  1JE8 A;  2NYX A;  3WE2 A;  3R0A A;  2EWN A;  1TTY A;  4KIG A;  3ULQ B;  1G4D A;  5IT3 A;  5LEK A;  4HLX A;  3HSF A;  3KEQ A;  3SZP A;  4ESJ A;  2LDU A;  2ZBK A;  3J80 K;  4L0Z B;  1FBS A;  3Q9V A;  1J7K A;  5F64 A;  4A6E A;  2QQB A;  4EJT A;  2E1N A;  3MZY A;  4S04 A;  2PMU A;  1S8N A;  2YX4 A;  3SXY A;  3GFJ A;  4IXA A;  4WCG A;  1J0R A;  5L3F A;  1L3L A;  2K86 A;  2KRF A;  4QWQ A;  2BGC A;  4EJW A;  2QWW A;  3GZ6 A;  1MJA A;  2OBP A;  1XMK A;  3K2Z A;  1FZP B;  1C0W A;  2P7C B;  1REP C;  3SQN A;  2YX7 A;  1W5T A;  5FO5 A;  1UHM A;  2DLL A;  5AON A;  2XV4 S;  3ERE D;  3G73 A;  3GYH X;  2CG4 A;  3L2C A;  2FXA A;  3FXR A;  2COM A;  1U78 A;  1AWC A;  3FX3 A;  3QU6 A;  5L3G A;  3LFK A;  3TO9 A;  3F6V A;  4Q48 A;  1LQ1 A;  2O6G E;  2UWM A;  4G7H F;  2RGV A;  1T38 A;  1HKS A;  2XRO A;  3DEU A;  1WKM A;  1JHH A;  1A04 A;  3ZP5 A;  2P6T A;  3V8K A;  2DI3 A;  4N9H A;  1BI3 A;  1QQI A;  4L9J A;  4M74 A;  4B09 A;  4BNC A;  1YQA A;  3K9T A;  3IL2 A;  1YG2 A;  1KYZ A;  1SMY F;  4L0Y B;  5H6R A;  1IUY A;  5ICC A;  3QPT A;  2L4M A;  2Q8K A;  4P96 A;  4EJV A;  3QP6 A;  4YFX F;  3I64 A;  4RGU A;  3RPU A;  2FEZ A;  4ENJ A;  2V1X A;  1KQ0 A;  4LK1 F;  3CUQ B;  4Z2Y A;  1FYL A;  2DPU A;  1USS A;  1IXS B;  1K79 A;  1EH7 A;  4YII A;  1I27 A;  2A07 F;  1R23 A;  1P4W A;  5FD6 A;  1FT9 A;  5AIP A;  1F9N A;  1Q1H A;  1ZLJ A;  4L9V A;  1ZRE A;  3CDH A;  2P7V B;  3F22 A;  3KP6 A;  1IN5 A;  3W6K B;  1H9T A;  1B9N A;  2BEO A;  3GVA A;  2DTR A;  3CUQ C;  3I58 A;  1DUX C;  1R36 A;  3WTZ A;  1FYM A;  1EV7 A;  1JHF A;  3ZQ7 A;  4ZYH A;  1BBY A;  1OR7 A;  4WX9 A;  3O2P E;  1LNW A;  4KMF A;  4BH9 A;  1TQM A;  1Z9C A;  3KP7 A;  3E6D A;  4MNU A;  4AIK A;  1YW8 A;  4E70 A;  4OIR F;  2V1U A;  1FP2 A;  4O5V A;  2DFI A;  5BQT A;  2MD5 A;  4L5J A;  1CGP A;  4GGG A;  2K4B A;  1BI0 A;  1KU3 A;  3ZMZ A;  2FBH A;  5LHI A;  1B1B A;  4IHS A;  2QVO A;  5HS9 A;  2O8X A;  4EM0 B;  3HRU A;  5LRS A;  2EA2 A;  1ZRD A;  4IJA A;  2Z99 A;  3FM3 A;  1ZGA A;  3LA7 A;  3FWE A;  1MJB A;  5DDG A;  3HHG A;  2XAH A;  2DO7 A;  4ZZD A;  2CYY A;  4XBF A;  1XGO A;  2VBW A;  2HZT A;  4LMY A;  3L7W A;  3BJ6 A;  1RIO H;  4XLN F;  4I98 B;  2RVC A;  5DCM B;  1YYV A;  4ZYG A;  4IRI A;  1Z1D A;  4KYW A;  5BPI A;  1LEA A;  3KFW X;  2A6H F;  1FNN A;  4IF4 A;  2A68 F;  3HOS A;  3CUQ A;  4Y15 A;  1E17 A;  1FWZ A;  3LWF A;  2XKO A;  2MLG A;  3IWZ A;  1YW9 A;  4I0A A;  2CO5 A;  4UVB A;  4GYI A;  5K5Q A;  4LB5 A;  2CW0 F;  2DK8 A;  3J7A O;  2X0L A;  3CJN A;  3RPQ A;  1ZLK A;  2IW5 A;  2G7H A;  3KEO A;  5AIQ A;  4P9U A;  1TNT A;  4LFU A;  4BHP A;  4NB5 A;  1RZ4 A;  4EJU A;  4ZH4 F;  1G3W A;  5ICG A;  5DUK A;  2JPC A;  1XSV A;  1O7L A;  5HDN A;  2JZY A;  5ERI A;  3TGN A;  4G7O F;  2ZFW A;  3WU0 A;  5EEH A;  3GF2 A;  3P7N A;  1RI7 A;  2RKH A;  3T8T A;  3CTA A;  2AS5 F;  1IN8 A;  2Y48 A;  5CVI A;  3V7S A;  2GZW A;  4G6D A;  2STW A;  4BYY A;  4I09 A;  4ENM A;  3EDP A;  2XVC A;  3L00 A;  2QEN A;  1UHW A;  2XAG A;  1X3U A;  2WC2 A;  3ZPL A;  5HLI A;  4IRG A;  1PP7 U;  2QZ8 A;  4N0B A;  3L09 A;  3RTR A;  4KIF A;  2ZME B;  2HR3 A;  5KVR A;  1BC7 C;  4AVP A;  5CVR A;  1H0M A;  5CVJ A;  4I7H A;  1VTN C;  4CXF A;  4CDG A;  3KP5 A;  3WTW C;  4M9S A;  3GWZ A;  5LEJ A;  3RKY A;  2NNY A;  1HKQ A;  2XAJ A;  2F5E A;  3V4G A;  4WXC A;  2WTE A;  2JRT A;  5D5V B;  4KA4 A;  5F6F A;  4GO1 A;  4G9Y A;  2BYV E;  1ON1 A;  3BRO A;  3J81 Z;  1I5Z A;  5K1Y A;  4MQ9 F;  3KP4 A;  1XCB A;  2FQ3 A;  2EB7 A;  3DKW A;  3TDU C;  1QZZ A;  4UXN A;  4RGR A;  3WTV C;  2Y0M A;  2F5F A;  5DCM A;  3R61 A;  3FMS A;  4R79 A;  5CYV A;  3EUH A;  1HW2 A;  3B02 A;  4EGZ A;  5E20 A;  2L01 A;  5FB2 A;  4TV7 A;  2FOK A;  1SAX A;  3MCZ A;  2VON A;  3AAF A;  2XAS A;  3I4P A;  2R7D A;  4M6X A;  2PLY A;  3DPL C;  3Q9S A;  1YTY A;  1LB2 A;  3F72 A;  4MQV A;  2VBX A;  3RKX A;  3KET A;  5ICF A;  1QZY A;  2VOO A;  2A61 A;  3RI4 A;  2IJL A;  5TRD A;  1S6L A;  3ISP A;  1PDN C;  5CVV A;  1OYW A;  3H92 A;  2RV8 A;  1JGS A;  3KLO A;  4KN7 X;  2XAQ A;  4LG0 B;  3BPV A;  3T5X A;  4CZZ A;  4G94 A;  5DEQ A;  3E6C C;  3P9I A;  1IN4 A;  3WTX C;  1Y0U A;  2D1V A;  3R60 A;  5D6F A;  4MEX F;  3E6B A;  1ZG3 A;  3O6B B;  4G7Z F;  2MA3 A;  2L54 A;  4R1H A;  1LDJ A;  5HDG A;  5DYM A;  4UV9 A;  1OKR A;  2HTJ A;  3HRM A;  2QBY B;  4HV5 A;  3M9A A;  2GQQ A;  3HRT A;  2ZME A;  4ENN A;  4M71 A;  1KQ8 A;  4WWC A;  5D5U B;  3F8B A;  2GA2 A;  4NQW A;  3T1B A;  1R22 A;  4L9T A;  3I5U A;  3BP8 A;  1W7P B;  5JR3 A;  5TJJ A;  3RYR A;  2KIM A;  4WF2 A;  3SZT A;  2PJP A;  2EFN A;  3LA3 A;  1FBU A;  4RGS A;  4RB2 C;  2JPB A;  4M9X A;  1ZRC A;  1ON2 A;  4AD9 A;  3VB2 A;  3OOP A;  3ELK A;  2Z9O A;  3U2R A;  4F7Z A;  4JQF A;  3BZ6 A;  3KE2 A;  2EV6 A;  3FXU A;  4PGH A;  4HF2 A;  3T8R A;  2PBI A;  3MFK A;  2ZXJ A;  3FMQ A;  1LDK B;  1G6N A;  4RB1 A;  3WU1 B;  4UNO A;  4NHJ A;  3V8L A;  2BV6 A;  1UFM A;  2XIG A;  5A2Q Z;  4L18 B;  3CO6 C;  2VOD A;  2F5C A;  3DV8 A;  4YIF A;  2LSO A;  1KU2 A;  5FLX Z;  4KFC A;  1S7A A;  3ZMS A;  5ED4 A;  4LG0 A;  2WV0 A;  2ESN A;  2FBI A;  2VC1 A;  5FGM A;  1MD0 A;  1XGM A;  4HX4 A;  3TO7 A;  2DQL A;  1FX7 A;  2CWE A;  3F21 A;  5BMZ A;  2KJB A;  5ILU A;  2KKO A;  3KZZ A;  4ZYD A;  4MGR A;  4HF1 A;  3I71 A;  2ZKZ A;  1GXP A;  4CYD A;  5HLG A;  1FC3 A;  3D0S A;  3JW4 A;  1FYK A;  1F5T A;  1BC8 C;  4PCQ A;  1T39 A;  2QBY A;  3ZMV A;  1SD5 A;  1BJA A;  1BI2 A;  1XDS A;  1HQC A;  2P6S A;  3ROU A;  5DCF A;  4UVC A;  1W7P A;  3R4K A;  4RB0 A;  3SFZ A;  5DUI A;  3N4M A;  2J5P A;  3EET A;  2O3F A;  1FPQ A;  3DP7 A;  1W7P D;  4OIN F;  1CF7 B;  5J8F A;  4XLP F;  1TBX A;  2L02 A;  5D5W B;  2P5L C;  4G8X A;  2OD5 A;  1YLF A;  2LF8 A;  4JBA A;  2OU2 A;  2DW4 A;  4S05 A;  3TKY A;  4P5O A;  1MJ9 A;  2HYG D;  1LDD A;  1NHA A;  1STZ A;  1F4K A;  1WRJ A;  2M8E A;  1T0F A;  3RJP A;  1K78 B;  2ESH A;  2VXZ A;  4PDK A;  1Z6R A;  5F1R A;  2QM3 A;  1OMI A;  1DP7 P;  3MAJ A;  1D5V A;  1IAW A;  1LVA A;  3U1D A;  1T6S A;  2HS5 A;  1G3T A;  2M1B A;  1WQ2 A;  2K27 A;  2DK5 A;  3NQO A;  3IKV A;  4U0V A;  3WTT C;  3F8C A;  5J6X A;  5E1X A;  5HS7 A;  2RC4 A;  2W57 A;  3JTH A;  1D8J A;  4P9F A;  4B8X A;  4Y13 A;  1RUN A;  5JVT A;  1BM9 A;  3GUD A;  1DDN A;  1FBQ A;  3RIR A;  4M72 A;  4XSZ F;  4RB3 C;  1DPR A;  3QP5 A;  4OMY A;  2GAU A;  4EQQ A;  1GHC A;  3WE3 A;  3P9C A;  3LQR A;  4HOB A;  3MWM A;  2F2E A;  1IF1 A;  3E5X A;  2Q2E A;  5E1W A;  2VN2 A;  4FX4 A;  3HTS B;  3HIF A;  1U3E M;  4YFN F;  4N9I A;  1B59 A;  2V1D A;  2HDC A;  4HYE A;  4ZZL A;  1KU9 A;  1QNT A;  4KUM A;  2BE5 F;  1IXC A;  3BPX A;  3CO7 C;  1HBX G;  3IHU A;  5IT9 Z;  2ISZ A;  3HSR A;  5CLS A;  3V7C A;  1UB9 A;  4L5I A;  4LGW A;  2J5O A;  1R7J A;  5DD4 A;  5E1Z B;  2M5W A;  2K02 A;  2GWR A;  4IRH A;  1CF7 A;  1UCR A;  4EV0 A;  2QUF A;  4AIH A;  4BXU A;  1ZAR A;  3VOE A;  3E6M A;  3QAH A;  4ESF A;  2G9W A;  1S7O A;  2ZNZ A;  1P2F A;  4M6Y A;  5L3C A;  1J75 A;  2K4J A;  1XSD A;  2VT3 A;  1YO5 C;  1ZG5 A;  1R5G A;  3MEX A;  3RDI A;  2IVM A;  2PEX A;  4BQA A;  3BY6 A;  4EJO A;  4HQM A;  1Z91 A;  2P5V A;  2RQP A;  3JAM Z;  1P6R A;  2CSO A;  1KU7 A;  2FBK A;  5HLH A;  2XGX A;  4MTD A;  5E8G A;  1ONV A;  2VC0 A;  4D0P A;  2MH9 A;  3NRV A;  2KIF A;  2IT0 A;  3MZH A;  1WI9 A;  1P4A A;  1LJ9 A;  2NAZ A;  4OMZ A;  3DQV C;  4A0Y A;  3L9F A;  2HWV A;  5BS6 A;  3IC7 A;  2PI0 A;  1P4X A;  1I1G A;  3D5L A;  1XGN A;  4AIJ A;  1ZH5 A;  5DD8 A;  2ADU A;  3PQJ A;  2HKO A;  5LRR A;  1TQP A;  1YIO A;  3SHF A;  1B9M A;  5HOO A;  2STT A;  5JFR A;  2PN6 A;  2VE9 A;  1S3J A;  4HAM A;  3VFZ A;  3J80 Z;  2JSC A;  1BIB A;  3LAJ A;  2ZCW A;  5J8C A;  2P4W A;  2WWY A;  4A0X A;  2D45 A;  3H3Z A;  4FHT A;  3F8N A;  3W6J B;  3ABT A;  2C6Y A;  1PP8 F;  3HYI A;  5D8K B;  5E8I A;  1QPM A;  3K1P A;  4HW0 A;  1EH8 A;  2O03 A;  4Q5S F;  2ZO4 A;  2MBF A;  4KN4 X;  2PMH A;  1OYY A;  2DQR A;  4RS8 A;  3K1M A;  2EA4 A;  1ZAO A;  3Q5F A;  5LLQ A;  5D6E A;  4EVI A;  3E5U A;  1K6O A;  1TQI A;  2QQ9 A;  4OIQ F;  2RNJ A;  2DT5 A;  3FZV A;  2V79 A;  3ML6 A;  4U0W A;  1H9G A;  2MH2 A;  2E7X A;  1R1T A;  3GFL A;  3ZMD A;  2W85 A;  2MLK A;  4I0B A;  3CUO A;  1SFX A;  2HTS A;  2H27 A;  3KZY A;  2L4A A;  3TO6 A;  4A5N A;  1XDU A;  2FML A;  3F8M A;  2XRN A;  1MZB A;  2KIU A;  2HGC A;  2UXN A;  4QLC U;  1G3Y A;  1TNS A;  2OQR A;  2FMY A;  2V9V A;  1ZYR F;  1W4M A;  2H09 A;  4JK1 X;  1FSH A;  2JT1 A;  5E18 F;  4O3M A;  4WXD A;  1ZN2 A;  3R0J A;  1MKM A;  4ENK A;  3B73 A;  4YFK F;  1SFU A;  3GXO A;  4IVN A;  1IW7 F;  1YS6 A;  3I53 A;  3GEZ A;  1YS7 A;  3BOQ A;  1SD4 A;  3JTG A;  2VBY A;  4U0Y A;  5ICE A;  2VOP A;  1MDM B;  3EYI A;  1V3F A;  2PFB A;  1GXQ A;  2NRA C;  3FXQ A;  3M8E A;  3QPH A;  4L9N A;  3CLO A;  2A6E F;  4ASN A;  4HLY A;  5FD5 A;  3WGI A;  4HQE A;  2XAF A;  2EV5 A;  3WTS C;  1K7A A;  2UZK A;  2M45 A;  3HSE A;  3GW2 A;  3EYY A;  2NNN A;  3J81 K;  2BBY A;  3WGG A;  1AOY A;  3K0L A;  3ZN1 A;  1HW1 A;  4OIO F;  2R3S A;  1BI1 A;  3I54 A;  2M30 A;  3T0Y A;  2EFP A;  3V7R A;  1O3R A;  1J59 A;  2XKP A;  1D8K A;  3K69 A;  1B6A A;  4LK0 F;  2CQK A;  3ZMU A;  5HDK A;  1ZG1 A;  1SD7 A;  2V6C A;  3COA C;  4MHG A;  5ILS A;  3S2W A;  1O3Q A;  2H94 A;  5D4R A;  4WK8 F;  1Z05 A;  5D4S A;  1QBJ A;  3GX4 X;  2OZ6 A;  2ELH A;  2F5D A;  1RUO A;  2W24 A;  2FNP A;  1MGT A;  2ZJ2 A;  2VT2 A;  2P8T A;  1KA8 A;  3EQL F;  3M8F A;  2DU9 A;  1U2W A;  1TLH B;  1I1S A;  4UHT A;  4Y17 A;  2H6C A;  4BAY A;  1J2X A;  3C3W A;  4LB6 B;  1U6G A;  1XMA A;  2OZU A;  4RGX A;  1U8R A;  4A12 A;  2FU4 A;  3VOD A;  3ECH A;  4O6J A;  1KYW A;  2W25 A;  3BDD A;  5LGT A;  5JHU A;  2M87 A;  1MDM A;  6PAX A;  2JTV A;  3PFI A;  2XHK A;  1V4R A;  4H0E A;  2GIV A;  4UUV A;  3IKT A;  1IXR C;  5HS8 A;  1XB4 A;  2FNA A;  1ULY A;  4K2E A;  5H6Q A;  1XGS A;  2D1H A;  4M73 A;  3HUG A;  4LLL A;  2PQ8 A;  4HDV A;  2O0Y A;  3IRR A;  5KK1 A;  2CGP A;  2QLZ A;  1F1Z A;  1DPU A;  1HST A;  3C18 A;  1D3Y A;  2E7W A;  3HHH A;  1XN7 A;  3O3K A;  3TQN A;  2UXX A;  4A6D A;  3U9G A;  1SFE A;  2HFH A;  4LD5 A;  5LHH A;  2QQA A;  2FRH A;  4HX7 A;  3K1N A;  4HA8 A;  4HBL A;  4PGG A;  2O61 A;  3M1E A;  3HTU A;  3I0T A;  3F6O A;  3WTY C;  3LQQ A;  2HQN A;  2W84 A;  4AWX B;  1R1U A;  2IPQ X;  2K7L A;  1FSE A;  4CGZ A;  2CFX A;  4OU0 A;  4MEY F;  3WOD F;  4FT8 A;  3QOP A;  4WXH A;  4KDP A;  5LBQ A;  4OIP F;  4ON0 A;  3IWF A;  2GXG A;  3V8J A;  2HQR A;  1HXD A;  1JXS A;  3MQ0 A;  1TW3 A;  1EH6 A;  2HOE A;  3N97 A;  4GXO A;  4IPA A;  1XSX A;  3GFI A;  4R8H A;  2A69 F;  3JSO A;  3DXJ F;  3FHZ A;  2ISY A;  5DV5 A;  1FOK A;  1ZRF A;  4A2U A;  5A2Q K;  5H20 A;  2OAZ A;  1U5T B;  4ESB A;  5FLX K;  2DBB A;  1O7F A;  2EFW A;  4IHT A;  1S29 A;  3M7G A;  3RKW A;  3QU3 A;  2YU3 A;  1P92 A;  2FE3 A;  1J5Y A;  4HF0 A;  4UVA A;  2LNB A;  3F3X A;  3JSP A;  3I59 B;  2B0L A;  3ZMT A;  5FFZ A;  5L3E A;  1HKT A;  2AXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...