1UG2A

Solution structure of mouse hypothetical gene (2610100b20rik) product homologous to myb dna-binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
GPSGSSGAGALPKASEATVCANNSKVSSTGEKVVLWTREADRVILTMCQEQGAQPHTFSVISQQLGNKTPVEVSHRFRELMQLFHTACESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Mouse Hypothetical Gene (2610100B20Rik) Product Homologous to Myb DNA-binding Domain
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords 2610100B20Rik gene product
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ug2A01
4D7MA 2HDDA 3O8GA 5IYDJ 1XG1A 2IEKA 2NS7A 5EG0A 3RZOJ 4A3KJ 2OF7A 3LSPA 3S14J 2DA1A 3JRCA 1ITYA 2VI6A 5K7HA 2Y9YA 4A3FJ 1XS9A 4I6ZA 3FK7A 2CUFA 2NOGA 3CDLA 3S1MJ 4A3JJ 4UUSA 3S17J 4FTHA 1BW6A 2JA8J 1TWHJ 1X2NA 3IH2A 4JX4A 1Z0XA 3RZDJ 3FIWA 3MVPA 1JT0A 2O8KA 3B6AA 1A5JA 1IUFA 2MSYA 1ZTRA 1ZK8A 1PUFA 4MIMA 3JRHA 3BR1A 2Y0SN 5FKMA 2EZKA 4BXXJ 4QIWN 2HXOA 4A3GJ 3A02A 1NTCA 1AKHB 3LNQA 5BNGA 2GLOA 2DMUA 3BTJA 2X6OA 3PO3J 4J19A 4BBRJ 2DA6A 2HOAA 2X48A 1DU0A 1SANA 1HLVA 3CQZJ 1F43A 2E19A 4JYKA 1JUSA 2NVQJ 4EEFG 2VPRA 3HOYJ 5IOZA 1QVTA 3O8HA 4AC0A 1F36A 2XGCA 1JKOC 2COBA 4JX6A 2LTPA 4D7NA 3GTGJ 4D5FA 1T56A 3QQAA 1JJ8C 1HCRA 1ZR2A 3S2DJ 1IGNA 2JA6J 2E2IJ 3JRBA 3JR9A 2YU9J 3TP3A 2K9QA 5F0HA 1B72B 1AU7A 5IOYA 4W97A 1I3QJ 2HOTA 1IG7A 5IYCJ 4M3GA 2R5ZA 5E3OA 1MBGA 4A3IJ 1MBKA 1IJWC 2XGDA 4I76A 4QSHA 1ORKA 1WH7A 3BTLA 3BR0A 3I4MJ 2FX0A 5F0FA 2JA5J 4FCYA 1YRNA 3ZQGA 2E1OA 4XIDA 1VI0A 1MBFA 3BR6A 3GTKJ 1B8IB 2DTZA 2LD5A 1FTZA 1UHSA 2FD5A 2JMWA 1MH3A 4X1EA 2CQQA 1GUUA 3BQZA 2DJNA 2W48A 2ME0A 4UUSB 2JK3A 4M3EA 2WV1A 3HOZJ 3M4OJ 4V2GA 4MLOA 4A3DJ 2O7OA 2GBYA 2HQ5A 3PM1A 4RDUA 1AHDP 1JT6A 2IBDA 3NAUA 1MSFC 1LE8A 1JKQC 4MFEA 1QPIA 4CYCA 2XPVA 5K7FA 1U9OA 2GM4A 2LP0A 1UG2A 5FKOA 4IHXA 1JKRC 1MSEC 4B1RA 1H88C 3BR3A 5FKNA 3LSRA 2ECBA 2XPWA 2ME6A 3IV5A 3H0GJ 2XPUA 1TWFJ 2CJJA 1T33A 1S7EA 2FJ1A 2N8GA 4A3CJ 3CCYA 1I6HJ 1G2HA 3S2HJ 1RPWA 1YRNB 4NDLA 3CMYA 3K2AA 1QRYA 1ETKA 1FTTA 3GTLJ 1OCPA 1TC3C 4FE4A 2EH3A 2MGQA 1X58A 2R5ZB 4JX5A 3HM5A 4DYRA 4M3FA 5E3LA 2EZLA 3BR5A 1B72A 3C2BA 3GTPJ 2DMPA 1ENHA 2Y30A 3L1PA 3BR2A 3K7AJ 5EDNA 3HOUJ 3QPSA 3ZOBA 2VUMJ 3TW6A 3G1MA 1P7IA 4V2FA 2R0QC 1EF4A 2LKXA 3E7LA 1RKTA 1WCMJ 3ZQIA 5F04A 4G12A 1ETOA 2EZHA 1FJLA 2VKEA 2XB5A 1FIAA 3S16J 3ZQFA 1FEXA 1K83J 4BKXA 2WB1N 5F1JA 4BBSJ 1WGXA 3HOVJ 4IEJA 3S1RJ 3RQIA 1U78A 2ID6A 1APLC 3GTJJ 3TEDA 1GT0C 1CQTA 1DU6A 4IHWA 5EZGA 3WHBA 2DMTA 2R93J 3UKGA 3PO2J 3B6CA 1MBJA 2VKVA 1JTYA 5F0CA 4BY1J 3FKIJ 1RESA 2L7FP 2MG4A 1BA5A 3Q0VA 3JRAA 4GFBA 5C4XJ 1IDYA 1GVDA 2DMQA 3LOCA 4W1UA 1JUPA 2AO9A 2M34A 3ZQHA 1HF0A 2CU7A 4BY7J 4XK4A 5J3LA 1JKPC 3TW7A 3BT9A 5FLMJ 2ECCA 1B8IA 1BW5A 1MBEA 3SJMA 3HOWJ 2NS8A 1VNDA 1GDTA 1VF9A 1POGA 2HXIA 1HDDC 2O9LA 1ETXA 2HI3A 2LVSA 2JWTA 4ABZA 2LR8A 4IHYA 1Y1WJ 4DYCA 2QCOA 2XSDC 4RBOA 1U9NA 3OSGA 2XB0X 5C44J 2Y31A 3FK6A 2EQRA 4JP0A 1HDPA 1ZKGA 2LLKA 3M3YJ 4M6VA 2CUEA 2HOSA 2XRLA 3BG5A 3QPLA 4LOCA 2LY9A 3ZQLA 1IC8A 1JTXA 1MH4A 2XGEA 3SDGA 4A93J 5HODA 4IHVA 3MKLA 5FJ8J 1QVUA 3HKZN 2DA5A 1RKWA 3OOUA 1MNMC 2DA4A 1IRZA 2JN6A 4A3BJ 1P7JA 5IP6A 4XRMA 4C3IJ 3S1QJ 1Z77A 5IP7J 3I4NJ 3MN2A 3JREA 5J1YA 1ZR4A 1HOMA 3JRFA 1TWCJ 1X2MA 3RKQA 1UMQA 2L7ZA 5J1RA 4DZPA 3HEFA 4XRSG 2Y2ZA 2CRGA 1A6IA 3NARA 3D1NI 1BL0A 2R5YB 1ZGWA 2E2HJ 3BTIA 1R9TJ 5E3MA 3BTCA 4DYQA 4XICA 4C3HJ 4DZJA 1JGGA 3GTQJ 3JRIA 4B4CA 3VPRA 5C4JJ 5K7ZA 2EZIA 5JLXA 5F27A 5EEAA 4X6AJ 5EF6A 2H8RA 5EZHA 4CYCB 3F0CA 2HYJA 3A03A 1E3OC 1IDZA 3HBLA 1LE8B 2NVXJ 1H89C 3GBGA 4Y52J 1W0UA 1VFCA 4Y7NJ 1ETWA 4A69C 3LSJA 4D5CA 5GPCA 1FIPA 3G1LA 5DTDA 4FISA 5EGOA 5EG0B 2ID3A 4M3DA 3A01B 2NVTJ 3S15J 1WI3A 5DS9A 2IAIA 2NVYJ 1O4XA 5IPAA 3Q0UA 3TP0A 4DW6A 2M0CA 2DN0A 1ETVA 3DCFA 3HGGA 3HB9A 1TWAJ 1H8AC 3HDDA 3ZQCA 4S0HB 3JRGA 2LFBA 2JA7J 3A01A 3GTMJ 5EGOB 5EYRA 2E2JJ 3HGYA 3Q0WA 3WHCA 3BG9A 3IH3A 1Y1VJ 2ZB9A 2G0EA 1OJLA 2R92J 1U8BA 4XRSA 3HOXJ 2H1KA 9ANTA 1LFUP 2TCTA 4FE7A 2B63J 2DMNA 1ETYA 1LFBA 1W0TA 2L9RA 4QTRA 2Y9ZA 2DA7A 4AYBN 2YS9A 2M2EA 4MO7A 2RAEA 3JRDA 2LK2A 3BQYA 4HNVA 2R7ZJ 3G1OA 1BJZA 2R5YA 5E3NA 2KT0A 1MBHA 1RETA 2K9SA 5C3EJ 2I10A 2P81A 5M3FJ 2TRTA 3LSGA 1WPKA 2K40A 1OFCX 3W6VA 1GV5A 1AKHA 4C2MJ 1GV2A 5JLWA 3H3VK 3GTOJ 1WH5A 3S1NJ 3FISA 5GPAA 4AUXA 1TWGJ 2KDZA 1K61A 2OPTA 1IV6A 2L0KA 3DEWA 5IYBJ 2JJ7A 2AHQA 2PMZN 5J1UA 1PUFB 5M5YJ 2WAQN 2EBIA 4B3AA 5M3MJ 1OCTC 4MFDA 1I50J 5GP9A 5F08A 4L5EA 2QF7A 1XC5A 5M5WJ 1Q1VA 2MW8A 3OSFA 4C3JJ 1RR7A 2DA2A 4A3LJ 2M8GX 3BG3A 3SFIA 5FLVA 1SFOJ 3IH4A 5FKKA 2ELKA 4UUTA 2L7MP 5FKLA 3OIOA 5IP9J 1JUMA 2DA3A 2X9DA 2YUSA 4A3EJ 1JJ6C 1NK2P 2D5VA 3Q3SA 2M9HA 5M5XJ 1ZQ3P 1ETQA 2CQXA 1D5YA 2K9NA 4M3BA 1NK3P 2FQ4A 4A3MJ
chains in the Genus database with same CATH superfamily
1BI2A 2R3SA 3IC7A 4OMYA 4EJTA 2BBYA 2FUG2 1FOWA 2HKXA 2AQFA 4XOTA 1R4NB 2OF7A 3OYNA 3LSPA 3S14J 2F5EA 2F4MB 4KIGA 2VI6A 4YRVA 4KNYA 1UHMA 4UV8A 4AU7A 5K7HA 2KRFA 2Y9YA 1XS9A 1EH7A 1OCCH 2Q8KA 4EJOA 3FK7A 4PCQA 2VOOA 3S1MJ 4HNTA 4A3JJ 3QOEA 3J81Z 1BW6A 1X2NA 3IH2A 4JX4A 1E17A 1Z0XA 4WWCA 3PSIA 1ZAOA 2LMDA 3FIWA 1J7KA 3MVPA 3T0YA 1E2XA 1OR7C 1LDJA 2HTSA 1V5EA 1ZTRA 4I0AA 4LMYA 3AG4H 3DXJF 3TKYA 3KX2A 3ZR8X 2J5PA 4U0WA 1SD4A 2Y0SN 3ROUA 2XGXA 2EFPA 1IZ1A 3CCEI 3GO5A 4F93B 3TDZC 1ERDA 4QIWN 4BAYA 1REPC 1LDDA 1NTCA 4UB6C 1P92A 2KMUA 1NG6A 3M9AA 2H6BA 1T38A 1EH6A 2QZ8A 3PIOF 1PVEA 1SANA 1X1DA 2O0YA 4JYKA 1Z67A 1OLTA 4E7KA 2BXZA 1VQPI 2VPRA 3BZKA 4F55A 1SC7A 3ZQQA 2KKOA 1V55H 1F36A 3QPTA 5CKTA 5DD4A 2XGCA 5ILSA 4ZZLA 2CWEA 3BG7A 4IPAA 4JX6A 3LSTA 1QU3A 4D5FA 1T56A 3QQAA 4FX4A 1JJ8C 4OWRB 3GVAA 1ZR2A 1Z6RA 2DJIA 3JRBA 3I5UA 4H0EA 1ZG1A 3CMEI 1B72B 2BVLA 5B66C 3KP3A 4W97A 2CV2A 4XSZF 2KZGA 3M1EA 2DT5A 3KEOA 4EV0A 1FYMA 3BTLA 3S93A 3KP6A 3V7SA 4EGYA 3O2PE 4LJZF 4XSXF 5KCMA 3KP5A 3K1NA 4IL6C 2Z3YA 2RV8A 1VI0A 3COAC 2B9SA 4C9YA 1D3YA 1B8IB 2X6WA 5CVUA 4IHTA 4KUMA 2KL4A 1YYVA 1BC7C 4LIUA 3RSNA 2DOAA 1Y0UA 2LD5A 2Y0MA 1QHGA 2R7SA 1FTZA 1XGMA 1MH3A 3I64A 4OIPF 2CQQA 3GFLA 3RQ4A 3BPVA 3BG6A 1O7LA 2KDOA 3M8FA 1H0MA 1ZLKA 1USSA 1B6AA 3OIPA 2YX4A 2IJLA 3HOZJ 2RC4A 4E6KG 1YITI 4U7DA 3E6BA 2GBYA 2M3AA 1LEBA 2HQ5A 2MLGA 3LA3A 4HNUA 2IBDA 3NAUA 2Q0OA 1LFPA 1ZLJA 5K7FA 1NH3A 3T1BA 2LP0A 3CUOA 3Q9SA 2M4GA 1JKRC 3BR3A 2UZKA 2OJED 2HEOA 3CESA 2ME6A 1FC3A 2LNBA 2XPUA 1YI2I 2N8GA 2HWVA 2V1DA 1D0XA 2DYRH 1X3ZB 1RPWA 4XLPF 2MC3A 1V4RA 1MMNA 4P55A 2QQ8A 1YRNB 3JSOA 1ZH5A 5TGTA 1ETKA 3I59A 3GTLJ 4IOAF 2Q1ZB 5LGTA 1U3EM 1D5YA 3H1CA 4IQ4A 3U2RA 3WE2A 4PJ0C 1X58A 5KHDA 1J59A 3ZXSA 2FOKA 3HM5A 1G6NA 2E5NA 4Q47A 4AIKA 5H6RA 1KU3A 1ULYA 1B72A 3WGIA 2G7HA 2XF5A 3H0DA 4AIJA 4AVZA 2V9PA 2GIZA 3LA2A 4N4OB 5EDNA 3OYGA 3G1MA 1MW7A 4LK0F 3DV8A 1HC8A 3D5RC 2WAQA 3LWFA 4G12A 3Q5FA 4HX7A 2AS5F 3S16J 3ERED 2WB1N 2C6YA 4BYYA 3QYEA 3CCUI 3MAJA 2DFEA 5D5VB 4IEJA 2LYCA 1FYLA 2DQLA 3VYTB 1A04A 3S1RJ 3QP6A 3RQIA 3CCJI 1OKRA 1U78A 2ID6A 3TEDA 5BOXA 3ZRGA 2UXNA 2XAFA 2DBBA 1S8NA 3KYCB 3M07A 4UVBA 3WHBA 1Y8RB 4R79A 1MKMA 3UKGA 3PO2J 3L2WA 2VJIA 2LRDA 2JUCA 3B02A 4XN3A 1Z1DA 2W82A 4RAGA 4FHTA 4E7JA 2RKHA 4K2EA 4BY1J 1MNDA 1RESA 1Y8QB 2MG4A 3OMYA 3MZYA 3HG9A 4ZDPA 1OYYA 3MD2A 2V6CA 2ZMEC 3QU3A 5C4XJ 1W7PD 1IDYA 3DU6A 3D5SC 1BOAA 1TNSA 2JZYA 2KIMA 3WU1B 2EV0A 2LBFA 3DTIA 1LNWA 2CU7A 3QWLA 4XR6A 3HIFA 3MZHA 1JKPC 2QYOA 1MMDA 2RVCA 5F1RA 3A2KA 2VKDA 5E1XA 3TGNA 2JSCA 3K1MA 4D1QA 3SJMA 3I9V2 1HW1A 1LQ1A 3GFMA 2WC2A 1K4TA 3DFGA 1ETXA 1XSXA 4ABZA 4MHGA 4DYCA 4CXFA 3LAPA 1SD6A 2OV7A 1XGNA 2VASA 3MMYB 3MWMA 1U9NA 1U0JA 5IT3A 3FK6A 2LF7A 2EQRA 4GXOA 1U6GA 4JP0A 4MTDA 1HDPA 1ZKGA 3GFJA 2DTRA 4XKCA 3BOQA 3QRFF 5B5EC 4CO8A 3LSMA 3NWSA 2H27A 5K5RA 1MH4A 3SDGA 2ZJPF 4DGWB 2VPLA 3WTZA 4LLGF 2OCCH 5HODA 1QVUA 4EMSA 5J4YA 4BUPA 4M74A 2NNNA 3A0BC 1PDNC 1KQ9A 1W7PA 2Z2SB 3OOUA 4DQ2A 4ZYDA 1IRZA 3O3KA 4ETSA 3S1QJ 1Z77A 2JVGA 3L7WA 5ED4A 1UFMA 1IW7F 2FRHA 4HAMA 5LGUA 3MN2A 3JREA 1OCZH 3HZJA 2XAGA 4HDVA 1HOMA 4IXAA 5EJCA 5FD6A 3SXYA 1YX5A 4RAZA 2K4JA 1UMQA 2PMZA 1K7AA 5D5UB 1TL8A 3HEFA 4XRSG 2GXBA 1X1BA 3BJAA 3J81K 2WY8Q 5LHHA 2VN2A 2VT3A 5HNFA 4C3HJ 1JGGA 2Y75A 2O5RA 3GTQJ 1MGTA 4B4CA 2A5YB 4R1HA 3B73A 3HPGA 3EUKL 1F4KA 3R6SA 4MTEA 5F27A 5JHUA 2FBKA 2XIGA 2L9NA 4U0YA 5LD2C 3E6CC 4CYCB 2ACJA 4YFNF 1A35A 2HYJA 3A03A 2ZJQF 4IKFA 3AL0B 2HNHA 3HBLA 2NVXJ 3KZZA 4A6DA 2BW3A 3K4MA 3K4BA 1T95A 1H89C 2VQLA 3GBGA 2HKOA 1VQ6I 2DFFA 2YX7A 2RGVA 1W0UA 2Q2EB 3VYUB 1VFCA 4BJTA 3OS0A 2DFHA 2E35A 2ID3A 1K4SA 2LH9A 2NVTJ 3CMAI 2D1VA 3AG2H 1VZ0A 1Y6IA 2LREA 1FY7A 4J01A 1VQ8I 3MQ0A 4A5MA 5CQGA 2HVSA 2WY7Q 1B1BA 1TWAJ 2FNPA 2VBXA 3C18A 1H8AC 3V8LA 1MMGA 4IQJA 3CCRI 3JRGA 1UCRA 2WWYA 1IRFA 5EGOB 5EYRA 3HGYA 1YG2A 3WODF 3HJEA 1BC8C 1WKMA 2P6SA 1R49A 3U1DA 2A68F 2W24A 2LY1A 5ICEA 1N25A 2ZB9A 2E34A 1Z3XA 1F1ZA 2K4BA 4B8XA 3I55I 1FP2A 3HOXJ 4HRIA 4FT8A 2ZXIA 3SYTA 2CGPA 4FE7A 2ESNA 4UHTA 1ETYA 3K4JA 5FO5A 3S3NA 2L2OA 2L9RA 4KT6A 2Y9ZA 2DA7A 2F4IA 2CUJA 2P4WA 3QP5A 4ZTFA 5IT9K 1KQ0A 2OA4A 3BCBA 2H6CA 3FXOA 4XKBA 2R7ZJ 1YHQI 4G94A 4BQNA 4BE1A 3E97A 2XRNA 1H9GA 3OYLA 2P81A 2LC2A 2TRTA 3LSGA 1FZPB 2HU9A 2K86A 3FMRA 1FWZA 2KIFA 2QA4I 4B48A 3KETA 1GV2A 5LHIA 5JLWA 2X6YA 3RPUD 2XSJC 3DTEA 4OAYA 3VB2A 5LBQA 2VBZA 3IWFA 2W7NA 2L02A 3WTYC 3OY9A 2FU4A 2L3DA 4AUXA 4XLAA 1HQCA 5KNLA 4HV6A 5B3SH 3RDIA 2OPTA 4EJWA 2L0KA 1LDKB 5IYBJ 4F52A 1IV6A 3PQJA 2JJ7A 2AHQA 2PMZN 3DTKA 3TL4X 4A12A 1PUFB 4IX7A 2WAQN 5M3MJ 3IRQA 3LSKA 3IAM2 4GO1A 4I98B 5F08A 3MCZA 3DF8A 2QF7A 4BGDA 1Q1VA 2M8EA 3OSFA 4HYEA 5GAHJ 1RR7A 2HPIA 4A3LJ 5FLVA 1HSJA 4BDZA 4UUTA 4WXDA 2L7MP 4O3MA 2DQRA 3MKZA 3F8BA 1XSDA 2GIVA 2YUSA 1EJ9A 1DQUA 4TV7A 4MEXF 5L3BA 3VYSB 2PN6A 1PP7U 1EKEA 2K9NA 4M3BA 4U7BA 4EGZA 4II2A 2ETHA 2DDAA 2P0WA 2X1DA 2P5VA 3OYFA 1XG1A 3ABUA 3HSRA 3A0HC 2NS7A 2DT6A 3RZOJ 5IY5H 3GUDA 4CHUA 3FMSA 2BZTA 3RKYA 1W4MA 1IXRC 1ITYA 1Z9CA 3F8NA 1N77A 1GXPA 1RUNA 3HUGA 1SVMA 1IN6A 1X1CA 3K2ZA 2BE5F 4UUSA 3S17J 5HLTA 5LEJA 4EJVA 3W2WA 3AFHA 3ZMVA 2QSHX 4EQQA 4A6EA 3RZDJ 3TBIA 4BEHA 4CCKA 4E7ZA 2DPDA 3ZMDA 2L01A 2V79A 5HDNA 1IUFA 4WXHA 3EUHA 1TW2A 5K5OA 3JSPA 1WI9A 2M7BA 1PUFA 1HSTA 1SAXA 2EILH 4A0ZA 4AVPA 3BR1A 3ZMTA 3JRHA 3PNYA 3R60A 4HLYA 3ISPA 2EB7A 3DKWA 2KIUA 5CLSA 1BR2A 4XBFA 2Y0SA 1AKHB 3H9GA 2DMUA 3IRRA 5CVRA 4HF0A 1NG7A 1FYKA 1LEAA 2IA1A 3P9IA 5H6QA 4BBRJ 2DA6A 2R7FA 5D8KB 2H94A 2VC0A 1JUSA 4LIVA 2ZBKA 4R8HA 1GLNA 1F5TA 3H5AA 1FP1D 1QVTA 4ESFA 4NQWA 4D7NA 3GTGJ 2IGNA 3L09A 4XKWA 1HCRA 1A36A 3HL2A 2JA6J 2CSOA 5JFRA 3KP7A 2YU9J 3TP3A 1AU7A 4L0YB 2D2WA 2LF8A 1U2WA 4P5OA 2VE9A 1IG7A 1PYVA 2BY3A 4WK8F 2R5ZA 1IJWC 4KFCA 3R0AA 4I76A 1YW9A 2NAZA 4IRHA 1ORKA 2BHYA 1W5TA 2G7UA 4ZTJA 2NRAC 2DXIA 3FXKA 2PJRA 1YRNA 3ZQGA 5FFXA 2E1OA 3KP4A 1MBFA 3CCVI 4BE0A 4FX0A 3V4GA 3TOBA 3H3ZA 2V26A 2V1UA 4BEHB 2K3PA 5ICGA 2WTEA 3J80K 4Z2YA 1GUUA 3BQZA 2DJNA 2L54A 2IS1A 4UUSB 2JK3A 3F21A 3F8CA 2WV1A 4KN4X 4HOBA 2DI3A 2MD5A 5H2FC 2EFWA 1YIJI 2A6EF 1E3HA 4A3DJ 1U5TB 1Z6TA 2XF6A 1BR4A 4RDUA 1ODDA 2HYGD 4MFEA 5DM6F 1YJNI 3KPHA 3DBLB 4Y15A 4QPQA 3V42A 3FZVA 5FKOA 1P4AA 1MSEC 4OOIA 2LKPA 1H88C 3G71I 2JT1A 2VBWA 3LSRA 2FQ3A 3IV5A 3H0GJ 1T33A 2BGCA 2O8XA 3RYPA 4BQOA 3GZNB 4A3CJ 2NNYA 3NQOA 4YELA 2COMA 5DDGA 1MIJA 1D0YA 2ZJ2A 1FTTA 1XN7A 3D0SA 3D5LA 1IN5A 5JI6A 4RB0A 2MGQA 2R7DA 5CVJA 2R5ZB 1ZRDA 4JX5A 2ZFWA 4DYRA 1BBYA 1IAWA 4ON0A 1BIAA 4M3FA 3HPHA 4PZJA 5E3LA 3BR5A 3BROA 3U9GA 3JTHA 1MZBA 4MQ9F 3GTPJ 1BN5A 3DBHB 3PFIA 3LQRA 3OYMA 4S05A 3DPLC 3K7AJ 2OZ6A 3N05A 2V9VA 5A2QZ 4V2FA 3GWZA 2R0QC 2WADA 4RLQA 2VT2A 2KZVA 3E7LA 1B59A 4ESBA 4KMUX 3CP8A 5F04A 1IRGA 3VYRB 2E71A 2ELHA 2P5LC 1ETOA 4M6YA 3J7AO 2VKEA 4Z6YA 1FIAA 5J8CA 3N4MA 4P1WA 1FEXA 4BKXA 3OYJA 2XAQA 2ZXHA 5F1JA 4M73A 2JVHA 4DJAA 4BBSJ 1W36C 4KN7X 2X1CA 2MABA 3M8EA 2W25A 2PMHA 3CJRB 1APLC 3VDXA 3QAHA 2JA2A 2HS5A 1DU6A 2FBHA 1VQOI 1OCOH 2FE3A 3BP8A 1VQKI 2R93J 4L9TA 2VKVA 2O3FA 1FX7A 1KU9A 2UUZA 5E20A 2CFXA 3IP4B 4RM3A 4PFOA 1R7JA 4I09A 3Q0VA 3RKWA 3J7YJ 3JRAA 2FXAA 1J9IA 1R1VA 1X1PA 3VFZA 1A31A 5CVIA 2ZC2A 1LUJB 2DMQA 5LRRA 3H3UA 1JUPA 2M34A 3FF5A 5GTIC 3FM5A 4BY7J 4XK4A 1UG0A 1C0WA 2A61A 3TW7A 3L9FA 1XD7A 5FLMJ 1I6XA 1B9MA 2ECCA 4G6QA 1B8IA 1W5SA 1BW5A 1EA3A 3K9TA 2DCEA 2QKLB 3M8JA 1F9NA 2HXIA 1HDDC 1G3WA 1PP8F 2O9LA 2BY1A 2HI3A 2LVSA 4L0ZB 1Y1WJ 4F3QA 1IF1A 2RN7A 2RQQA 3PNTA 4RGXA 3RKXA 3U1KA 3T8RA 3G6EI 3OSGA 2XB0X 1VQ7I 3M3YJ 2ZO4A 2XC7A 1VQ4I 3AAFA 1IO2A 1HW5A 2Y48A 1TT0A 2X51A 1R58A 1FMWA 3ESWB 2XGEA 5LRSA 3OYEA 4A93J 3S8PA 3ZN0A 4XRFA 2L5QA 2XAJA 3MKLA 5FJ8J 1J2XA 4CCLA 3HKZN 2QUFA 4ZH4F 4ZJZA 3PNVA 1T98A 2DA4A 4HF1A 3WGHA 2FF4A 4HSTA 2D45A 2IGMA 4ENNA 3FXRA 3Q9VA 4UUVA 3W2VA 1UHWA 1S29A 1I39A 3PJRA 3G4SI 1OYWA 3ELKA 1IXSB 1MDMA 3RKQA 3ECOA 3R4KA 1SVOA 2V4JC 1X3UA 2Y2ZA 1A6IA 3NARA 2PQ8A 3D1NI 4D9JA 3BTIA 1R9TJ 4IZZA 5E3MA 2JRTA 4DYQA 2VQCA 2A07F 3LSIA 5DYMA 4L9VA 3OR1C 3TOAA 2HZTA 1QPMA 3VPRA 5K7ZA 2EZIA 5JLXA 2WAEA 1W1WE 3DLAA 5J40A 2EK5A 2OCEA 1Y56A 2GA1A 4MNUA 3LSHA 3KE2A 4XL9A 1LE8B 3IKVA 1Y0NA 3HSEA 1KGSA 2L7KA 3HUGB 5H20A 2ZCWA 1G2HA 5BQTA 1ZYRF 5HVQC 1DP7P 1JE8A 4WCGA 2WAFA 1VQ5I 3LQQA 3GMEA 2CFOA 4IRIA 2DOEA 3LSJA 4D5CA 2D1HA 2M87A 2ZMEB 3F6VA 2QQ9A 3G1LA 5DTDA 3FHNA 5EG0B 3HSFA 5HDKA 3V8KA 1CF7B 1FBQA 3S15J 2DU9A 3DP7A 3RPUA 2IAIA 2GAUA 2OTJI 3KLOA 1MMAA 4KITB 1AOYA 2WBMA 1KA8A 1BOBA 3C2HA 3I4PA 4GYGA 3ZMSA 4UY8I 4DW6A 2M0MA 2M0CA 2DN0A 1ETVA 3HB9A 1R5HA 1W36D 2DAOA 2CQNA 1K78A 4M71A 3ML6A 4LG0B 4NB5A 2DLLA 3A01A 4U87A 2E2JJ 2QQAA 3Q0WA 2VLAA 4RAFA 3IH3A 4ESJA 1IV8A 1YW8A 3K70C 1Y1VJ 5ICCA 5LEKA 1SD5A 1U8BA 1RZ4A 1ZHFA 2CS3A 2GWRA 4A5NA 4Q5SF 1ZN2A 4PJJA 4BHCA 4AYBN 2HPMA 2KISA 4G6TB 5CYVA 3T8TA 2M2EA 5DCFA 1EH8A 2RAEA 5DUIA 2LK2A 2R7WA 1RIOH 5E79C 2V6EA 1YW7A 4KIBA 3J80Z 3RCOA 2HQNA 2KT0A 2K9SA 2E7WA 3FM3A 2Z1DA 3E5XA 1WPKA 1OFCX 3W6VA 1VQ9I 1SFUA 1GV5A 3E0JB 1I5ZA 4C2MJ 4B09A 4KDPA 3H3VK 1IXCA 3OL3A 3QU6A 2Z9OA 2OQRA 2LSOA 3S1NJ 5GPAA 3WG7H 2GXGA 4XOPA 2KDZA 1XB4A 2W85A 5EEHA 3CCSI 3DEWA 5FD5A 1T0FA 4Y33A 5M5YJ 4HX8A 2EBIA 4B3AA 2DPUA 3FWEA 1QZZA 2IPQX 4JQFA 1DUXC 4Y17A 2JPCA 1WJEA 2HGCA 1LJ9A 5JVTA 4GYIA 2MW8A 3I54A 3WTUC 4C3JJ 2YPRA 1HKSA 2M8GX 2UXXA 1OCRH 4GRIA 3SFIA 2CYYA 4CCJA 2OD5A 1SFOJ 3W2AA 1XDSA 3REOA 1WJDA 4U88A 1UELB 2M45A 1JUMA 2RREA 3CLQA 4A3EJ 4WX9A 4HBLA 1YS6A 2HQRA 4UVAA 3GZ5A 1NK3P 2JA8J 1KU2A 3VOEA 2M30A 3LFUA 2IEKA 4LGWA 4A3KJ 2ZMEA 3IAS2 2A6TA 2DA1A 4YIIA 3CUQA 1EV7A 3JRCA 4EVIA 5D4RA 5TJJA 3F6OA 2M7AA 3FMQA 4OIQF 4DOZA 1DDNA 1Z3YA 3F3XA 4I6ZA 3FBNB 2MA3A 3I58A 1QA6A 2F6CA 3EQLF 2JSPA 4HG2A 3UR3C 4XLCA 5LHGA 5JVGF 2X0LA 1QNTA 4CCOA 3GX4X 1X1AA 2H8WA 3H35A 1A5JA 1ZGAA 2MSYA 3DU5A 1OISA 1O7FA 4HSRA 3E6DA 3PIPF 1VQNI 4MIMA 1K6OA 4OAZA 5L3EA 5FKMA 2KFDA 5HLHA 4E4HA 3HTSB 2OUMA 1MDMB 4RLFA 3AKZA 1HBXG 3C2GA 4E7HA 1TQPA 2HXOA 2GA2A 1I3AA 3LNQA 5BNGA 5J47A 2X6OA 2AQEA 3KYDB 2X48A 1R4MB 2IRFG 1F43A 2A05A 2E19A 3K6GA 3SZGA 3RIRA 4PJMA 4ZYGA 3HOYJ 1LKXA 2P6TA 4RGSA 5IOZA 3TO6A 2TDXA 4A2UA 4HLXA 4C2UA 3WTXC 1FOXA 4A0XA 2F2EA 2LKSA 1JKOC 2COBA 5E17F 3OIQA 2LTPA 3OYAA 3CCQI 3ASOH 3GF2A 1VQLI 4LB5A 1IGNA 2E2IJ 2VXDA 2ZNYA 3SFZA 5IOYA 1YX3A 1I3QJ 2VC1A 2PLYA 2STTA 4M3GA 3AL0C 1MBKA 3WTWC 2XGDA 1YOVB 5GTHC 2IT0A 1I1SA 2FOWA 1J0RA 2IGKA 5E18F 1T39A 4NHJA 2FX0A 4II3A 4BJ5C 2JA5J 3I4MJ 1VTNC 4HPQA 1U5TC 2QKMB 5FB2A 3ONQA 1M1EB 2VOPA 3L2CA 3BR6A 2LOOA 2K85A 1FOKA 3GTKJ 2R7XA 2DTZA 5JR3A 4Q4ZF 2G9WA 3BZ6A 2FD5A 2JMWA 3VSKA 5BPIA 3G2BA 3S3OA 3KEYA 1S6LA 2FNAA 1H9TA 2YU3A 3FXLA 1D0ZA 4UVCA 3V8JA 3MFKA 4V19K 2KRHA 4O5VA 3W3CA 4M3EA 3WE3A 4KICA 4OIOF 2GZWA 3M4OJ 2BV6A 2GOMA 2JUGA 4V2GA 4MLOA 1ZG5A 2O7OA 3DWLE 2KP6A 5FROA 4CSWA 3A1YA 4GGGA 3PM1A 1AHDP 3MZ8A 3KIOA 3JAMK 1DGRM 1LE8A 1JKQC 1YLFA 1R6RA 3HOTA 2XPVA 1ZRCA 2LY2A 4IRGA 1LPQA 1G4DA 4IHXA 4HEA2 4CGZA 4B1RA 4LLLA 1X3WB 2OU2A 2FMLA 3K4NA 4XN0A 1T0FC 1TWFJ 2CJJA 4E7SA 2FJ1A 1I6HJ 3I71A 5CPRB 2A3SA 4PGHA 3S2HJ 3ERMA 2CG4A 1TNTA 1YIOA 3BJOA 4ASNA 2DW4A 4YG2F 4RB1A 1Z21A 3JCUC 4MGRA 4NDLA 3CMYA 4RGUA 1DPRA 1XGOA 5J4VA 2VL8A 2EA2A 4QLCU 2DDBA 3OR2C 2VB6A 1RR8C 3C3WA 4XM3A 3S32A 1DGWY 3BDDA 2KIQA 3CLOA 1XMXA 4LFUA 2V9KA 3M1CA 1ONVA 2IS2A 4EM0B 1BI0A 2O61A 2DMPA 1P9QC 4FQGA 5J8FA 5TISC 1D8JA 3EETA 4MQVA 1ENHA 4IO9F 2Y30A 2VUMJ 3BLYA 1P7IA 1S72I 3WG9A 2F5FA 1GXQA 3ZQIA 2NS0A 1E0EA 2EZHA 1FJLA 2XB5A 4EATA 4B3XA 1ZRFA 3OYIA 3CC4I 2X6XA 1K83J 3H92A 2VONA 3L2UA 1WGXA 2PEXA 4CCMA 2UWMA 3K1PA 2W4SA 2E1MC 3OYHA 4IHWA 1V54H 5EZGA 2K9MA 1ON1A 3LAJA 4PDKA 4P9FA 4YIFA 3B6CA 1MBJA 3GLLA 1JTYA 2VJ5A 4NC6A 5A2QK 2ZNZA 3GYHX 3I56I 2E36A 2AXTC 2MC4A 4JK1X 2L7FP 1RRJA 4I0BA 4GFBA 2MH9A 3ZQ7A 2LBFB 1GVDA 4W1UA 4LG0A 3T5XA 2AO9A 3ZQHA 1K79A 3SEQA 2X1EA 3HHHA 5EEGA 5J3LA 3K4CA 4LK1F 1QQIA 2VJ4A 2ZJRF 1FLIA 3RYRA 1ON2A 3OL4A 3ABLH 5KK1A 4G7HF 1MMSA 2V1NA 5FRNA 5KVRA 3HOWJ 2NS8A 1VNDA 1GDTA 1TW3A 3VODA 1VF9A 1POGA 4EM2A 1KZHA 4RM2A 1ACIA 2JWTA 2K27A 2LR8A 3HXLA 1R1UA 4IHYA 4CA0A 2K5CA 2PMUA 1UB9A 2RNJA 3E3VA 4RBOA 2A69F 1R36A 3DKYA 3FDYA 5D5WB 5B1AH 2W00A 4PJLA 5C44J 3WTTC 1FT9A 3U21A 3OWTA 3QPHA 4CICA 3DEUA 3CF2A 3RTRA 4X0GA 2KQRA 4M6VA 2MFZA 3BG5A 3QPLA 1KONA 1P2FA 2LY9A 1IC8A 4ITVA 1R00A 1TQIA 2NXNB 4QWQA 2HFHA 3K4LA 1HKTA 1I27A 2PI0A 1O3TA 2GXAA 3K69A 3I53A 4IF4A 1MNMC 2JN6A 5IP6A 4XRMA 3L00A 3HKZA 1I1GA 4C3IJ 1TT5B 2IA0A 3EUAA 3I4NJ 3E1SA 2L4MA 1V5GA 5J1YA 1ZREA 4KISA 2DK5A 1JXSA 2CQKA 5HOOA 3KEQA 3JRFA 1TBXA 2HVRA 1TWCJ 3TO7A 3FX3A 5J1RA 1SD7A 2VBYA 3PSFA 4DZPA 3I59B 1RNLA 3P5JA 3E6MA 1WJFA 4NC7A 1T6SA 2I8DA 2R5YB 4PSXA 2E2HJ 1PUEE 5BS6A 3KYLA 4XICA 3BTCA 4DZJA 2Z99A 3JRIA 2CV0A 1SFEA 2MH2A 2ZSHB 5C4JJ 2NVUB 2K9LA 2BHZA 4RS8A 4HX4A 2DO7A 3CC2I 1LVAA 2JPBA 2H8RA 5EZHA 3F0CA 2QENA 1E3OC 2ISZA 4S04A 3QYBA 2M4KA 4LITA 2F5VA 3OV8A 3DLLF 3M7GA 4EM1A 4Y52J 1HA8A 2V1XA 4DNCA 5DV5A 1V3FA 4A69C 2XVCA 3TMOA 5GPCA 3ZPLA 1FIPA 3X2QH 2M1BA 3C1DA 5E8GA 3HTUA 3ZCOA 3A01B 1TTYA 1V5FA 4M9ZA 5KAIC 1XGSA 3CC7I 1WI3A 1OPCA 5E1ZB 1BI3A 3CTAA 2L9SA 4UV9A 5D6EA 4P9UA 2QBYB 2DYSH 5IPAA 3Q0UA 3MKYB 2JQ7A 5FGMA 2ZXJA 2IS6A 5GAEJ 1WHUA 3TP0A 3DCFA 3HGGA 2KLOA 4I01A 1IUYA 3S3MA 1O3SA 3ZQCA 4PK4A 4S0HB 1X19A 3L2VA 2IP2A 4N0BA 2JA7J 1D1CA 4ENKA 2KRCA 2VKHA 5CJ9A 5E1WA 1XDUA 2K3FA 3BG9A 3WHCA 4L5IA 3TDUC 3CO6C 4WXCA 4DBRA 1OMIA 2G0EA 1OJLA 4CZZA 4RB2C 2BW3B 3QYFA 4N9IA 4XLHA 1XCBA 4XRSA 2H1KA 1LFUP 2TCTA 2W84A 2JRMA 3L2RA 4BDYA 1DPUA 1LFBA 1W0TA 4QTRA 2VODA 4I2OA 4XQFA 5AONA 1YQAA 5DCMB 1FSHA 3JRDA 2P8TA 3S2WA 5L3FA 1QZYA 4HNVA 4L18B 1BJZA 2R5YA 3ZMZA 4BL0B 3ABTA 3WTSC 1IN8A 1RETA 4LG3A 2I10A 4XMYA 5M3FJ 1IN4A 2R7RA 2K40A 3K0LA 1AKHA 1S5LC 3CDHA 3HRUA 3OS2A 2ELJA 4KT5C 1WH5A 3ULQB 3FXMA 1KYWA 3W6KB 2ZSIB 4J00A 2GQQA 4ZYEA 2W1OA 5J1UA 3MKWB 3UNGC 3RJPA 1XMAA 2EV5A 1XTAA 3FXJA 4BNCA 1OCTC 3SEZA 3P9CA 4RB3C 1I50J 5GP9A 4QPOA 2EINH 4L5EA 5D5XB 4AWXB 1TLHB 5D4SA 4ZDOA 3LA7A 2E1NA 2QWWA 1BI1A 3FXQA 1FNNA 5FKKA 2ELKA 3F9KA 2X4HA 5FKLA 1R22A 3OIOA 5IP9J 2X9DA 2DA3A 2F5CA 2HTJA 1JJ6C 1NK2P 1MJBA 2M9HA 1YFHA 1ETQA 1KQ8A 2A5WA 2VXZA 1QGPA 2ESHA 4A3MJ 4D7MA 2HDDA 3O8GA 6PAXA 5IYDJ 1W5CC 1USTA 3J7AY 1L0OC 3CUQC 5EG0A 1WQ2A 3BZCA 4LD5A 1WVRA 2JTVA 5GADJ 2P5KA 5FRMA 3QODA 4UXNA 3EYIA 2EV6A 4AYBA 4HF2A 2R7TA 1IN7A 2EJRA 2BEOA 3PFYA 4A3FJ 4C30A 4GDFA 4L9NA 2UV1A 4OIRF 4UNOA 2CUFA 2NOGA 2A6HF 3CDLA 4FTHA 3WGGA 2ISYA 1R71A 4RMNA 5B1BH 1NHAA 1TWHJ 2VE8A 4NUBA 1OQYA 1QBJA 3AG1H 4HW0A 4DIQA 1JT0A 3VEPA 3HHGA 2O8KA 5HLGA 2XAHA 1XSVA 3B6AA 3ZMUA 1ZK8A 3H36A 5IT9Z 1OR7A 1J75A 1OYIA 1KU7A 4YEJA 3WU0A 4M6XA 1VQMI 3ZGKA 3KZYA 2M5WA 3FKJA 4Q48A 1RUOA 3HYIA 2WV0A 2EZKA 4BXXJ 1YTYA 2XUBA 1Y39A 4H4KC 4A3GJ 3A02A 1D5VA 1SVLA 2NYXA 2GLOA 4G7OF 2QSGX 3V7CA 3BTJA 2J5OA 3CJTB 4ZC3A 4FETA 2B7EA 5DUKA 1BM9A 3PO3J 4J19A 2HOAA 1DU0A 1HLVA 1TZLA 1LB2A 3CQZJ 1G59A 1Z7LA 2NVQJ 3EPZA 2OAZA 1A6QA 1TP4A 4EEFG 1GVJA 1QHHD 4NQWB 3NWTA 2CW7A 3OYKA 5DCMA 3O8HA 3G3ZA 4AC0A 5D8LB 5HS8A 2VQHA 4HV5A 2XKOA 3IWZA 2P7VB 4CUGA 5KAFC 5BMZA 3S2DJ 4G7ZF 5JHFA 2MBFA 3JR9A 1UZCA 1JI8A 5F0HA 2K9QA 2EPFA 2XDVA 3P7NA 2F5DA 2RDPA 2HOTA 2RNGA 5J6XA 5IYCJ 3BC8A 5E3OA 1MBGA 4BS9A 4A3IJ 4N4NB 4PGGA 4QSHA 1T8IA 1WH7A 1J09A 3BR0A 3F22A 3H5NA 5F0FA 4L9JA 5AIPA 1FSEA 2EA4A 4FCYA 3JTGA 4XLNF 1STZA 4XIDA 3E5QA 1R5GA 3K10A 2KHMA 3IUOA 4CZCA 4F91B 5CVVA 5ILUA 1UHSA 1R23A 2CQ7A 5LFAA 1R5ID 2EWNA 4X1EA 1O3RA 3HRSA 4RAYA 2W48A 2EFNA 2PBIA 2ME0A 5HS9A 2R4GA 2QSFX 2O03A 4P96A 4IOCF 3RPQA 2EIKH 2OC6A 2VIXA 5LGNA 1FOYA 2EFQA 1JT6A 4EJUA 1MSFC 4IHSA 2QM3A 5FLXZ 4AM3A 3N97A 2K02A 2E1CA 2Z33A 4CYCA 1QPIA 2GM4A 1U9OA 3GXOA 2R7UA 3MEXA 1UG2A 2E60A 1RC9A 5FLXK 3F72A 1FMVA 4DBQA 3GZ6A 3CD6I 5FKNA 1QO0D 3E5UA 2ECBA 2XPWA 1ZARA 3HOSA 1YE9A 2HDCA 3TQNA 1S7EA 1XMKA 3CCYA 1YJWI 3KP2A 1RI7A 4G9YA 4XONA 4BHBA 1P4XA 1UJ8A 4XORA 3K2AA 1QRYA 1T08B 2HVQA 4HDUA 1OCPA 3GFIA 5HLIA 1TC3C 2HQAA 4FE4A 3H5RA 2EH3A 3OS1A 4KJZA 3CCMI 3CZ6A 5ILVA 2XROA 4I99C 2EFOA 4BE2A 3SDBA 2EZLA 4HQEA 1T2KA 3PQKA 5F6FA 4O6JA 3C2BA 3OOPA 5DEQA 1WWXA 2Z5UA 3LMMA 4FASD 4IVNA 2HZDA 1W7PB 1SAUA 3L1PA 3BR2A 3HOUJ 3QPSA 1KYZA 3ZOBA 2IGOA 3TW6A 4CDGA 1HW2A 1EF4A 3K4KA 3SQNA 4Y13A 1RKTA 2ICWG 2LKXA 3BPXA 1WCMJ 2WB1A 1JHHA 3GW2A 4ENMA 1WJAA 3KZIC 2QGUA 3IHUA 2W57A 4I7HA 3ZQFA 4BXUA 4KYWA 2FMYA 2XKPA 3SZTA 3ABKH 3HOVJ 4JOMA 3GCMA 3DBRB 3BY6A 2X85A 4NNJA 4OMZA 4L5JA 2DK8A 4YIRX 3GTJJ 4ZYAA 1GT0C 1CQTA 4F7ZA 1IRXA 1BJAA 1WJBA 2DMTA 3K70D 2MLKA 2L9VA 4HZFA 4UB8C 3C7JA 2OQGA 1TQMA 4U0VA 1QZEA 1ZG3A 2OBPA 2O6GE 2E5ZA 3CDIA 1WJ5A 2FBIA 3ASNH 5F0CA 4ENJA 1YS7A 3OYCA 3FKIJ 4PJNA 2AXLA 2CUZA 1BA5A 4BJ6C 2Z16A 3KLNA 3DPUA 3L2QA 3ECHA 1Z05A 4M9SA 1SEUA 2CH0A 3LOCA 5BPDA 1O3QA 2R7VA 1WJCA 2F4OB 3DPTA 5F64A 5CQEA 4BH9A 1HF0A 4AIDA 3JAMZ 3ABMH 3BT9A 1S3JA 2BY0A 3V7RA 4YFXF 1HKQA 1MBEA 1FPQA 1WFXA 1D1BA 1S9HA 2QBYA 3DKXA 5HDGA 2H09A 2DOFA 1CF7A 1MD0A 2H1LA 2QCOA 3EUHC 2XSDC 2HYFA 2R7QA 1MNEA 4N9HA 1P6RA 2Q2EA 2EIJH 1BR1A 2ZXWH 2Y31A 3CCLI 1YJ9I 2QLZA 2P7CB 3HRTA 2FSWA 4B43A 2LLKA 3R0JA 4G8XA 3IKTA 5DD8A 2PFBA 1AWCA 2LDUA 1G3YA 2CUEA 2BYVE 1K6YA 2HOSA 2XRLA 1B9NA 4LOCA 3NEUA 3ZQLA 1JTXA 1FBUA 4XKVA 2B0LA 4M9XA 3SZPA 2IW5A 5TRDA 4IHVA 2DA5A 1G8XA 1RKWA 2DT7B 3O6BB 3OYBA 2ADUA 2FEZA 4A3BJ 1P7JA 1XCVA 3H9JA 1XX5A 4IJAA 2Y69H 5IP7J 2HDWA 3ZN1A 5K5QA 2E7XA 3FBIB 4AD9A 1ZR4A 3FXUA 2CV1A 2HOEA 1GHCA 2FA5A 4E7IA 2XV4S 3JW4A 1YO5C 1X2MA 1X4OA 5LLQA 4XLEA 4LLNA 1G3SA 4ZYHA 4BQQA 2IA2A 2L7ZA 2XF7A 3EDPA 4ANJA 1ZELA 2CRGA 4Y4RA 2DFIA 1BL0A 1LVKA 3VSLA 1ZGWA 3HC7A 4HA8A 5E8IA 1SFKA 3CP2A 2LG4A 2YR2A 3LFKA 4HQMA 3RI4A 2VJJA 3DEEA 1SMYF 5AIQA 1BIBA 3KFWX 1XPXA 5L3DA 1D8KA 3DQVC 5EEAA 4X6AJ 5EF6A 1S7OA 2CMPA 3F8FA 4B47A 3GEZA 4BACA 1IDZA 3CF5F 4RA2A 2K7LA 5L3GA 4JBAA 2DODA 2YSRA 2PG4A 4OINF 1U5TA 1DP3A 1ZGJA 4ZDLA 5ICFA 4XLFA 2OTLI 5K1YA 4Y7NJ 1ETWA 2V7FA 2KJBA 5D6FA 4BHPA 4FISA 4PFPA 5EGOA 1Z91A 4M3DA 2I5UA 1K78B 3W6JB 2KJCA 1SFXA 3KCCA 3WTVC 3LL7A 5DS9A 2R7OA 5HS7A 2CW8A 2NVYJ 1O4XA 3CJNA 1P4WA 4YFKF 4KMFA 1HXDA 4A0YA 3OYDA 2XAUA 1D1AA 3CJQB 1O57A 3BCAA 1MJAA 4BQAA 3A4CA 2PJRB 3HDDA 1CGPA 3I3LA 2LFBA 3NRVA 5DM7F 3GTMJ 4CH7A 3PL8A 1WZ2A 3PUFA 3EYYA 1UAAA 2RQPA 1WSUA 1JHFA 1Q1HA 2BOLA 2ZKZA 4XNFA 4BXFA 5HNHA 1L3LA 2STWA 3HRMA 2E1MB 2KPMA 4M72A 2MD0A 4E70A 1JGSA 3IL2A 2R92J 2XASA 2ZFUA 1AA7A 4CCNA 1Z7UA 1FBSA 4PUSA 9ANTA 4GCVA 4BU2A 3F23A 2B63J 3R61A 4G6DA 3I0TA 2DMNA 3SHFA 4I02A 4RGRA 3CMMA 3G73A 4OU0A 2BVMA 4PSWA 2MYSA 2YS9A 5ERIA 4MO7A 1X4PA 3P9KA 1N78A 3BQYA 2EIMH 4KIFA 3G1OA 2NOJB 1SMTA 2QEXI 4C2TA 5E3NA 1U8RA 1MBHA 5C3EJ 3VWBA 3J7ZI 2L4AA 3F8MA 5L3CA 2WA0A 3CO7C 4MEYF 1G3TA 3AG3H 2IXSA 3GTOJ 1S7AA 3FISA 5FFZA 2BXYA 1TWGJ 3H9QA 1K61A 4AIHA 2BY2A 4CYDA 4D0PA 2CO5A 3WU2C 2QQBA 2CW0F 2OZUA 2IVMA 2IS4A 4MFDA 2HR3A 4NC8A 1WRJA 3QOPA 4B44A 4E7LA 2VQGA 5M5WJ 1XC5A 3BJ6A 2QVOA 1B4AA 3GLXA 2DA2A 5GAGJ 1R1TA 3BG3A 3PUBA 1E3PA 3IH4A 3FHZA 4KA4A 4WF2A 3ZP5A 2PJPA 3TO9A 4F92B 2GOXB 4Y3OA 1MJ9A 4LB6B 2D5VA 4NBQA 3BWGA 3Q3SA 5M5XJ 4ZZDA 1J5YA 3CUQB 1PJRA 2CQXA 2PX9A 2F48A 2XHKA 1ZQ3P 1N75A 2FQ4A
chains in the Genus database with same CATH topology
4D7MA 2HDDA 3O8GA 5IYDJ 1XG1A 2IEKA 2NS7A 5EG0A 3RZOJ 4A3KJ 2OF7A 3LSPA 3S14J 2DA1A 3JRCA 1ITYA 2VI6A 5K7HA 2Y9YA 4A3FJ 1XS9A 4I6ZA 3FK7A 2CUFA 2NOGA 3CDLA 3S1MJ 4A3JJ 4UUSA 3S17J 4FTHA 1BW6A 2JA8J 1TWHJ 1X2NA 3IH2A 4JX4A 1Z0XA 3RZDJ 3FIWA 3MVPA 1JT0A 2O8KA 3B6AA 1A5JA 1IUFA 2MSYA 1ZTRA 1ZK8A 1PUFA 4MIMA 3JRHA 3BR1A 2Y0SN 5FKMA 2EZKA 4BXXJ 4QIWN 2HXOA 4A3GJ 3A02A 1NTCA 1AKHB 3LNQA 5BNGA 2GLOA 2DMUA 3BTJA 2X6OA 3PO3J 4J19A 4BBRJ 2DA6A 2HOAA 2X48A 1DU0A 1SANA 1HLVA 3CQZJ 1F43A 2E19A 4JYKA 1JUSA 2NVQJ 4EEFG 2VPRA 3HOYJ 5IOZA 1QVTA 3O8HA 4AC0A 1F36A 2XGCA 1JKOC 2COBA 4JX6A 2LTPA 4D7NA 3GTGJ 4D5FA 1T56A 3QQAA 1JJ8C 1HCRA 1ZR2A 3S2DJ 1IGNA 2JA6J 2E2IJ 3JRBA 3JR9A 2YU9J 3TP3A 2K9QA 5F0HA 1B72B 1AU7A 5IOYA 4W97A 1I3QJ 2HOTA 1IG7A 5IYCJ 4M3GA 2R5ZA 5E3OA 1MBGA 4A3IJ 1MBKA 1IJWC 2XGDA 4I76A 4QSHA 1ORKA 1WH7A 3BTLA 3BR0A 3I4MJ 2FX0A 5F0FA 2JA5J 4FCYA 1YRNA 3ZQGA 2E1OA 4XIDA 1VI0A 1MBFA 3BR6A 3GTKJ 1B8IB 2DTZA 2LD5A 1FTZA 1UHSA 2FD5A 2JMWA 1MH3A 4X1EA 2CQQA 1GUUA 3BQZA 2DJNA 2W48A 2ME0A 4UUSB 2JK3A 4M3EA 2WV1A 3HOZJ 3M4OJ 4V2GA 4MLOA 4A3DJ 2O7OA 2GBYA 2HQ5A 3PM1A 4RDUA 1AHDP 1JT6A 2IBDA 3NAUA 1MSFC 1LE8A 1JKQC 4MFEA 1QPIA 4CYCA 2XPVA 5K7FA 1U9OA 2GM4A 2LP0A 1UG2A 5FKOA 4IHXA 1JKRC 1MSEC 4B1RA 1H88C 3BR3A 5FKNA 3LSRA 2ECBA 2XPWA 2ME6A 3IV5A 3H0GJ 2XPUA 1TWFJ 2CJJA 1T33A 1S7EA 2FJ1A 2N8GA 4A3CJ 3CCYA 1I6HJ 1G2HA 3S2HJ 1RPWA 1YRNB 4NDLA 3CMYA 3K2AA 1QRYA 1ETKA 1FTTA 3GTLJ 1OCPA 1TC3C 4FE4A 2EH3A 2MGQA 1X58A 2R5ZB 4JX5A 3HM5A 4DYRA 4M3FA 5E3LA 2EZLA 3BR5A 1B72A 3C2BA 3GTPJ 2DMPA 1ENHA 2Y30A 3L1PA 3BR2A 3K7AJ 5EDNA 3HOUJ 3QPSA 3ZOBA 2VUMJ 3TW6A 3G1MA 1P7IA 4V2FA 2R0QC 1EF4A 2LKXA 3E7LA 1RKTA 1WCMJ 3ZQIA 5F04A 4G12A 1ETOA 2EZHA 1FJLA 2VKEA 2XB5A 1FIAA 3S16J 3ZQFA 1FEXA 1K83J 4BKXA 2WB1N 5F1JA 4BBSJ 1WGXA 3HOVJ 4IEJA 3S1RJ 3RQIA 1U78A 2ID6A 1APLC 3GTJJ 3TEDA 1GT0C 1CQTA 1DU6A 4IHWA 5EZGA 3WHBA 2DMTA 2R93J 3UKGA 3PO2J 3B6CA 1MBJA 2VKVA 1JTYA 5F0CA 4BY1J 3FKIJ 1RESA 2L7FP 2MG4A 1BA5A 3Q0VA 3JRAA 4GFBA 5C4XJ 1IDYA 1GVDA 2DMQA 3LOCA 4W1UA 1JUPA 2AO9A 2M34A 3ZQHA 1HF0A 2CU7A 4BY7J 4XK4A 5J3LA 1JKPC 3TW7A 3BT9A 5FLMJ 2ECCA 1B8IA 1BW5A 1MBEA 3SJMA 3HOWJ 2NS8A 1VNDA 1GDTA 1VF9A 1POGA 2HXIA 1HDDC 2O9LA 1ETXA 2HI3A 2LVSA 2JWTA 4ABZA 2LR8A 4IHYA 1Y1WJ 4DYCA 2QCOA 2XSDC 4RBOA 1U9NA 3OSGA 2XB0X 5C44J 2Y31A 3FK6A 2EQRA 4JP0A 1HDPA 1ZKGA 2LLKA 3M3YJ 4M6VA 2CUEA 2HOSA 2XRLA 3BG5A 3QPLA 4LOCA 2LY9A 3ZQLA 1IC8A 1JTXA 1MH4A 2XGEA 3SDGA 4A93J 5HODA 4IHVA 3MKLA 5FJ8J 1QVUA 3HKZN 2DA5A 1RKWA 3OOUA 1MNMC 2DA4A 1IRZA 2JN6A 4A3BJ 1P7JA 5IP6A 4XRMA 4C3IJ 3S1QJ 1Z77A 5IP7J 3I4NJ 3MN2A 3JREA 5J1YA 1ZR4A 1HOMA 3JRFA 1TWCJ 1X2MA 3RKQA 1UMQA 2L7ZA 5J1RA 4DZPA 3HEFA 4XRSG 2Y2ZA 2CRGA 1A6IA 3NARA 3D1NI 1BL0A 2R5YB 1ZGWA 2E2HJ 3BTIA 1R9TJ 5E3MA 3BTCA 4DYQA 4XICA 4C3HJ 4DZJA 1JGGA 3GTQJ 3JRIA 4B4CA 3VPRA 5C4JJ 5K7ZA 2EZIA 5JLXA 5F27A 5EEAA 4X6AJ 5EF6A 2H8RA 5EZHA 4CYCB 3F0CA 2HYJA 3A03A 1E3OC 1IDZA 3HBLA 1LE8B 2NVXJ 1H89C 3GBGA 4Y52J 1W0UA 1VFCA 4Y7NJ 1ETWA 4A69C 3LSJA 4D5CA 5GPCA 1FIPA 3G1LA 5DTDA 4FISA 5EGOA 5EG0B 2ID3A 4M3DA 3A01B 2NVTJ 3S15J 1WI3A 5DS9A 2IAIA 2NVYJ 1O4XA 5IPAA 3Q0UA 3TP0A 4DW6A 2M0CA 2DN0A 1ETVA 3DCFA 3HGGA 3HB9A 1TWAJ 1H8AC 3HDDA 3ZQCA 4S0HB 3JRGA 2LFBA 2JA7J 3A01A 3GTMJ 5EGOB 5EYRA 2E2JJ 3HGYA 3Q0WA 3WHCA 3BG9A 3IH3A 1Y1VJ 2ZB9A 2G0EA 1OJLA 2R92J 1U8BA 4XRSA 3HOXJ 2H1KA 9ANTA 1LFUP 2TCTA 4FE7A 2B63J 2DMNA 1ETYA 1LFBA 1W0TA 2L9RA 4QTRA 2Y9ZA 2DA7A 4AYBN 2YS9A 2M2EA 4MO7A 2RAEA 3JRDA 2LK2A 3BQYA 4HNVA 2R7ZJ 3G1OA 1BJZA 2R5YA 5E3NA 2KT0A 1MBHA 1RETA 2K9SA 5C3EJ 2I10A 2P81A 5M3FJ 2TRTA 3LSGA 1WPKA 2K40A 1OFCX 3W6VA 1GV5A 1AKHA 4C2MJ 1GV2A 5JLWA 3H3VK 3GTOJ 1WH5A 3S1NJ 3FISA 5GPAA 4AUXA 1TWGJ 2KDZA 1K61A 2OPTA 1IV6A 2L0KA 3DEWA 5IYBJ 2JJ7A 2AHQA 2PMZN 5J1UA 1PUFB 5M5YJ 2WAQN 2EBIA 4B3AA 5M3MJ 1OCTC 4MFDA 1I50J 5GP9A 5F08A 4L5EA 2QF7A 1XC5A 5M5WJ 1Q1VA 2MW8A 3OSFA 4C3JJ 1RR7A 2DA2A 4A3LJ 2M8GX 3BG3A 3SFIA 5FLVA 1SFOJ 3IH4A 5FKKA 2ELKA 4UUTA 2L7MP 5FKLA 3OIOA 5IP9J 1JUMA 2DA3A 2X9DA 2YUSA 4A3EJ 1JJ6C 1NK2P 2D5VA 3Q3SA 2M9HA 5M5XJ 1ZQ3P 1ETQA 2CQXA 1D5YA 2K9NA 4M3BA 1NK3P 2FQ4A 4A3MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D7M A;  2HDD A;  3O8G A;  5IYD J;  1XG1 A;  2IEK A;  2NS7 A;  5EG0 A;  3RZO J;  4A3K J;  2OF7 A;  3LSP A;  3S14 J;  2DA1 A;  3JRC A;  1ITY A;  2VI6 A;  5K7H A;  2Y9Y A;  4A3F J;  1XS9 A;  4I6Z A;  3FK7 A;  2CUF A;  2NOG A;  3CDL A;  3S1M J;  4A3J J;  4UUS A;  3S17 J;  4FTH A;  1BW6 A;  2JA8 J;  1TWH J;  1X2N A;  3IH2 A;  4JX4 A;  1Z0X A;  3RZD J;  3FIW A;  3MVP A;  1JT0 A;  2O8K A;  3B6A A;  1A5J A;  1IUF A;  2MSY A;  1ZTR A;  1ZK8 A;  1PUF A;  4MIM A;  3JRH A;  3BR1 A;  2Y0S N;  5FKM A;  2EZK A;  4BXX J;  4QIW N;  2HXO A;  4A3G J;  3A02 A;  1NTC A;  1AKH B;  3LNQ A;  5BNG A;  2GLO A;  2DMU A;  3BTJ A;  2X6O A;  3PO3 J;  4J19 A;  4BBR J;  2DA6 A;  2HOA A;  2X48 A;  1DU0 A;  1SAN A;  1HLV A;  3CQZ J;  1F43 A;  2E19 A;  4JYK A;  1JUS A;  2NVQ J;  4EEF G;  2VPR A;  3HOY J;  5IOZ A;  1QVT A;  3O8H A;  4AC0 A;  1F36 A;  2XGC A;  1JKO C;  2COB A;  4JX6 A;  2LTP A;  4D7N A;  3GTG J;  4D5F A;  1T56 A;  3QQA A;  1JJ8 C;  1HCR A;  1ZR2 A;  3S2D J;  1IGN A;  2JA6 J;  2E2I J;  3JRB A;  3JR9 A;  2YU9 J;  3TP3 A;  2K9Q A;  5F0H A;  1B72 B;  1AU7 A;  5IOY A;  4W97 A;  1I3Q J;  2HOT A;  1IG7 A;  5IYC J;  4M3G A;  2R5Z A;  5E3O A;  1MBG A;  4A3I J;  1MBK A;  1IJW C;  2XGD A;  4I76 A;  4QSH A;  1ORK A;  1WH7 A;  3BTL A;  3BR0 A;  3I4M J;  2FX0 A;  5F0F A;  2JA5 J;  4FCY A;  1YRN A;  3ZQG A;  2E1O A;  4XID A;  1VI0 A;  1MBF A;  3BR6 A;  3GTK J;  1B8I B;  2DTZ A;  2LD5 A;  1FTZ A;  1UHS A;  2FD5 A;  2JMW A;  1MH3 A;  4X1E A;  2CQQ A;  1GUU A;  3BQZ A;  2DJN A;  2W48 A;  2ME0 A;  4UUS B;  2JK3 A;  4M3E A;  2WV1 A;  3HOZ J;  3M4O J;  4V2G A;  4MLO A;  4A3D J;  2O7O A;  2GBY A;  2HQ5 A;  3PM1 A;  4RDU A;  1AHD P;  1JT6 A;  2IBD A;  3NAU A;  1MSF C;  1LE8 A;  1JKQ C;  4MFE A;  1QPI A;  4CYC A;  2XPV A;  5K7F A;  1U9O A;  2GM4 A;  2LP0 A;  1UG2 A;  5FKO A;  4IHX A;  1JKR C;  1MSE C;  4B1R A;  1H88 C;  3BR3 A;  5FKN A;  3LSR A;  2ECB A;  2XPW A;  2ME6 A;  3IV5 A;  3H0G J;  2XPU A;  1TWF J;  2CJJ A;  1T33 A;  1S7E A;  2FJ1 A;  2N8G A;  4A3C J;  3CCY A;  1I6H J;  1G2H A;  3S2H J;  1RPW A;  1YRN B;  4NDL A;  3CMY A;  3K2A A;  1QRY A;  1ETK A;  1FTT A;  3GTL J;  1OCP A;  1TC3 C;  4FE4 A;  2EH3 A;  2MGQ A;  1X58 A;  2R5Z B;  4JX5 A;  3HM5 A;  4DYR A;  4M3F A;  5E3L A;  2EZL A;  3BR5 A;  1B72 A;  3C2B A;  3GTP J;  2DMP A;  1ENH A;  2Y30 A;  3L1P A;  3BR2 A;  3K7A J;  5EDN A;  3HOU J;  3QPS A;  3ZOB A;  2VUM J;  3TW6 A;  3G1M A;  1P7I A;  4V2F A;  2R0Q C;  1EF4 A;  2LKX A;  3E7L A;  1RKT A;  1WCM J;  3ZQI A;  5F04 A;  4G12 A;  1ETO A;  2EZH A;  1FJL A;  2VKE A;  2XB5 A;  1FIA A;  3S16 J;  3ZQF A;  1FEX A;  1K83 J;  4BKX A;  2WB1 N;  5F1J A;  4BBS J;  1WGX A;  3HOV J;  4IEJ A;  3S1R J;  3RQI A;  1U78 A;  2ID6 A;  1APL C;  3GTJ J;  3TED A;  1GT0 C;  1CQT A;  1DU6 A;  4IHW A;  5EZG A;  3WHB A;  2DMT A;  2R93 J;  3UKG A;  3PO2 J;  3B6C A;  1MBJ A;  2VKV A;  1JTY A;  5F0C A;  4BY1 J;  3FKI J;  1RES A;  2L7F P;  2MG4 A;  1BA5 A;  3Q0V A;  3JRA A;  4GFB A;  5C4X J;  1IDY A;  1GVD A;  2DMQ A;  3LOC A;  4W1U A;  1JUP A;  2AO9 A;  2M34 A;  3ZQH A;  1HF0 A;  2CU7 A;  4BY7 J;  4XK4 A;  5J3L A;  1JKP C;  3TW7 A;  3BT9 A;  5FLM J;  2ECC A;  1B8I A;  1BW5 A;  1MBE A;  3SJM A;  3HOW J;  2NS8 A;  1VND A;  1GDT A;  1VF9 A;  1POG A;  2HXI A;  1HDD C;  2O9L A;  1ETX A;  2HI3 A;  2LVS A;  2JWT A;  4ABZ A;  2LR8 A;  4IHY A;  1Y1W J;  4DYC A;  2QCO A;  2XSD C;  4RBO A;  1U9N A;  3OSG A;  2XB0 X;  5C44 J;  2Y31 A;  3FK6 A;  2EQR A;  4JP0 A;  1HDP A;  1ZKG A;  2LLK A;  3M3Y J;  4M6V A;  2CUE A;  2HOS A;  2XRL A;  3BG5 A;  3QPL A;  4LOC A;  2LY9 A;  3ZQL A;  1IC8 A;  1JTX A;  1MH4 A;  2XGE A;  3SDG A;  4A93 J;  5HOD A;  4IHV A;  3MKL A;  5FJ8 J;  1QVU A;  3HKZ N;  2DA5 A;  1RKW A;  3OOU A;  1MNM C;  2DA4 A;  1IRZ A;  2JN6 A;  4A3B J;  1P7J A;  5IP6 A;  4XRM A;  4C3I J;  3S1Q J;  1Z77 A;  5IP7 J;  3I4N J;  3MN2 A;  3JRE A;  5J1Y A;  1ZR4 A;  1HOM A;  3JRF A;  1TWC J;  1X2M A;  3RKQ A;  1UMQ A;  2L7Z A;  5J1R A;  4DZP A;  3HEF A;  4XRS G;  2Y2Z A;  2CRG A;  1A6I A;  3NAR A;  3D1N I;  1BL0 A;  2R5Y B;  1ZGW A;  2E2H J;  3BTI A;  1R9T J;  5E3M A;  3BTC A;  4DYQ A;  4XIC A;  4C3H J;  4DZJ A;  1JGG A;  3GTQ J;  3JRI A;  4B4C A;  3VPR A;  5C4J J;  5K7Z A;  2EZI A;  5JLX A;  5F27 A;  5EEA A;  4X6A J;  5EF6 A;  2H8R A;  5EZH A;  4CYC B;  3F0C A;  2HYJ A;  3A03 A;  1E3O C;  1IDZ A;  3HBL A;  1LE8 B;  2NVX J;  1H89 C;  3GBG A;  4Y52 J;  1W0U A;  1VFC A;  4Y7N J;  1ETW A;  4A69 C;  3LSJ A;  4D5C A;  5GPC A;  1FIP A;  3G1L A;  5DTD A;  4FIS A;  5EGO A;  5EG0 B;  2ID3 A;  4M3D A;  3A01 B;  2NVT J;  3S15 J;  1WI3 A;  5DS9 A;  2IAI A;  2NVY J;  1O4X A;  5IPA A;  3Q0U A;  3TP0 A;  4DW6 A;  2M0C A;  2DN0 A;  1ETV A;  3DCF A;  3HGG A;  3HB9 A;  1TWA J;  1H8A C;  3HDD A;  3ZQC A;  4S0H B;  3JRG A;  2LFB A;  2JA7 J;  3A01 A;  3GTM J;  5EGO B;  5EYR A;  2E2J J;  3HGY A;  3Q0W A;  3WHC A;  3BG9 A;  3IH3 A;  1Y1V J;  2ZB9 A;  2G0E A;  1OJL A;  2R92 J;  1U8B A;  4XRS A;  3HOX J;  2H1K A;  9ANT A;  1LFU P;  2TCT A;  4FE7 A;  2B63 J;  2DMN A;  1ETY A;  1LFB A;  1W0T A;  2L9R A;  4QTR A;  2Y9Z A;  2DA7 A;  4AYB N;  2YS9 A;  2M2E A;  4MO7 A;  2RAE A;  3JRD A;  2LK2 A;  3BQY A;  4HNV A;  2R7Z J;  3G1O A;  1BJZ A;  2R5Y A;  5E3N A;  2KT0 A;  1MBH A;  1RET A;  2K9S A;  5C3E J;  2I10 A;  2P81 A;  5M3F J;  2TRT A;  3LSG A;  1WPK A;  2K40 A;  1OFC X;  3W6V A;  1GV5 A;  1AKH A;  4C2M J;  1GV2 A;  5JLW A;  3H3V K;  3GTO J;  1WH5 A;  3S1N J;  3FIS A;  5GPA A;  4AUX A;  1TWG J;  2KDZ A;  1K61 A;  2OPT A;  1IV6 A;  2L0K A;  3DEW A;  5IYB J;  2JJ7 A;  2AHQ A;  2PMZ N;  5J1U A;  1PUF B;  5M5Y J;  2WAQ N;  2EBI A;  4B3A A;  5M3M J;  1OCT C;  4MFD A;  1I50 J;  5GP9 A;  5F08 A;  4L5E A;  2QF7 A;  1XC5 A;  5M5W J;  1Q1V A;  2MW8 A;  3OSF A;  4C3J J;  1RR7 A;  2DA2 A;  4A3L J;  2M8G X;  3BG3 A;  3SFI A;  5FLV A;  1SFO J;  3IH4 A;  5FKK A;  2ELK A;  4UUT A;  2L7M P;  5FKL A;  3OIO A;  5IP9 J;  1JUM A;  2DA3 A;  2X9D A;  2YUS A;  4A3E J;  1JJ6 C;  1NK2 P;  2D5V A;  3Q3S A;  2M9H A;  5M5X J;  1ZQ3 P;  1ETQ A;  2CQX A;  1D5Y A;  2K9N A;  4M3B A;  1NK3 P;  2FQ4 A;  4A3M J; 
#chains in the Genus database with same CATH topology
 1BI2 A;  2R3S A;  3IC7 A;  4OMY A;  4EJT A;  2BBY A;  2FUG 2;  1FOW A;  2HKX A;  2AQF A;  4XOT A;  1R4N B;  2OF7 A;  3OYN A;  3LSP A;  3S14 J;  2F5E A;  2F4M B;  4KIG A;  2VI6 A;  4YRV A;  4KNY A;  1UHM A;  4UV8 A;  4AU7 A;  5K7H A;  2KRF A;  2Y9Y A;  1XS9 A;  1EH7 A;  1OCC H;  2Q8K A;  4EJO A;  3FK7 A;  4PCQ A;  2VOO A;  3S1M J;  4HNT A;  4A3J J;  3QOE A;  3J81 Z;  1BW6 A;  1X2N A;  3IH2 A;  4JX4 A;  1E17 A;  1Z0X A;  4WWC A;  3PSI A;  1ZAO A;  2LMD A;  3FIW A;  1J7K A;  3MVP A;  3T0Y A;  1E2X A;  1OR7 C;  1LDJ A;  2HTS A;  1V5E A;  1ZTR A;  4I0A A;  4LMY A;  3AG4 H;  3DXJ F;  3TKY A;  3KX2 A;  3ZR8 X;  2J5P A;  4U0W A;  1SD4 A;  2Y0S N;  3ROU A;  2XGX A;  2EFP A;  1IZ1 A;  3CCE I;  3GO5 A;  4F93 B;  3TDZ C;  1ERD A;  4QIW N;  4BAY A;  1REP C;  1LDD A;  1NTC A;  4UB6 C;  1P92 A;  2KMU A;  1NG6 A;  3M9A A;  2H6B A;  1T38 A;  1EH6 A;  2QZ8 A;  3PIO F;  1PVE A;  1SAN A;  1X1D A;  2O0Y A;  4JYK A;  1Z67 A;  1OLT A;  4E7K A;  2BXZ A;  1VQP I;  2VPR A;  3BZK A;  4F55 A;  1SC7 A;  3ZQQ A;  2KKO A;  1V55 H;  1F36 A;  3QPT A;  5CKT A;  5DD4 A;  2XGC A;  5ILS A;  4ZZL A;  2CWE A;  3BG7 A;  4IPA A;  4JX6 A;  3LST A;  1QU3 A;  4D5F A;  1T56 A;  3QQA A;  4FX4 A;  1JJ8 C;  4OWR B;  3GVA A;  1ZR2 A;  1Z6R A;  2DJI A;  3JRB A;  3I5U A;  4H0E A;  1ZG1 A;  3CME I;  1B72 B;  2BVL A;  5B66 C;  3KP3 A;  4W97 A;  2CV2 A;  4XSZ F;  2KZG A;  3M1E A;  2DT5 A;  3KEO A;  4EV0 A;  1FYM A;  3BTL A;  3S93 A;  3KP6 A;  3V7S A;  4EGY A;  3O2P E;  4LJZ F;  4XSX F;  5KCM A;  3KP5 A;  3K1N A;  4IL6 C;  2Z3Y A;  2RV8 A;  1VI0 A;  3COA C;  2B9S A;  4C9Y A;  1D3Y A;  1B8I B;  2X6W A;  5CVU A;  4IHT A;  4KUM A;  2KL4 A;  1YYV A;  1BC7 C;  4LIU A;  3RSN A;  2DOA A;  1Y0U A;  2LD5 A;  2Y0M A;  1QHG A;  2R7S A;  1FTZ A;  1XGM A;  1MH3 A;  3I64 A;  4OIP F;  2CQQ A;  3GFL A;  3RQ4 A;  3BPV A;  3BG6 A;  1O7L A;  2KDO A;  3M8F A;  1H0M A;  1ZLK A;  1USS A;  1B6A A;  3OIP A;  2YX4 A;  2IJL A;  3HOZ J;  2RC4 A;  4E6K G;  1YIT I;  4U7D A;  3E6B A;  2GBY A;  2M3A A;  1LEB A;  2HQ5 A;  2MLG A;  3LA3 A;  4HNU A;  2IBD A;  3NAU A;  2Q0O A;  1LFP A;  1ZLJ A;  5K7F A;  1NH3 A;  3T1B A;  2LP0 A;  3CUO A;  3Q9S A;  2M4G A;  1JKR C;  3BR3 A;  2UZK A;  2OJE D;  2HEO A;  3CES A;  2ME6 A;  1FC3 A;  2LNB A;  2XPU A;  1YI2 I;  2N8G A;  2HWV A;  2V1D A;  1D0X A;  2DYR H;  1X3Z B;  1RPW A;  4XLP F;  2MC3 A;  1V4R A;  1MMN A;  4P55 A;  2QQ8 A;  1YRN B;  3JSO A;  1ZH5 A;  5TGT A;  1ETK A;  3I59 A;  3GTL J;  4IOA F;  2Q1Z B;  5LGT A;  1U3E M;  1D5Y A;  3H1C A;  4IQ4 A;  3U2R A;  3WE2 A;  4PJ0 C;  1X58 A;  5KHD A;  1J59 A;  3ZXS A;  2FOK A;  3HM5 A;  1G6N A;  2E5N A;  4Q47 A;  4AIK A;  5H6R A;  1KU3 A;  1ULY A;  1B72 A;  3WGI A;  2G7H A;  2XF5 A;  3H0D A;  4AIJ A;  4AVZ A;  2V9P A;  2GIZ A;  3LA2 A;  4N4O B;  5EDN A;  3OYG A;  3G1M A;  1MW7 A;  4LK0 F;  3DV8 A;  1HC8 A;  3D5R C;  2WAQ A;  3LWF A;  4G12 A;  3Q5F A;  4HX7 A;  2AS5 F;  3S16 J;  3ERE D;  2WB1 N;  2C6Y A;  4BYY A;  3QYE A;  3CCU I;  3MAJ A;  2DFE A;  5D5V B;  4IEJ A;  2LYC A;  1FYL A;  2DQL A;  3VYT B;  1A04 A;  3S1R J;  3QP6 A;  3RQI A;  3CCJ I;  1OKR A;  1U78 A;  2ID6 A;  3TED A;  5BOX A;  3ZRG A;  2UXN A;  2XAF A;  2DBB A;  1S8N A;  3KYC B;  3M07 A;  4UVB A;  3WHB A;  1Y8R B;  4R79 A;  1MKM A;  3UKG A;  3PO2 J;  3L2W A;  2VJI A;  2LRD A;  2JUC A;  3B02 A;  4XN3 A;  1Z1D A;  2W82 A;  4RAG A;  4FHT A;  4E7J A;  2RKH A;  4K2E A;  4BY1 J;  1MND A;  1RES A;  1Y8Q B;  2MG4 A;  3OMY A;  3MZY A;  3HG9 A;  4ZDP A;  1OYY A;  3MD2 A;  2V6C A;  2ZME C;  3QU3 A;  5C4X J;  1W7P D;  1IDY A;  3DU6 A;  3D5S C;  1BOA A;  1TNS A;  2JZY A;  2KIM A;  3WU1 B;  2EV0 A;  2LBF A;  3DTI A;  1LNW A;  2CU7 A;  3QWL A;  4XR6 A;  3HIF A;  3MZH A;  1JKP C;  2QYO A;  1MMD A;  2RVC A;  5F1R A;  3A2K A;  2VKD A;  5E1X A;  3TGN A;  2JSC A;  3K1M A;  4D1Q A;  3SJM A;  3I9V 2;  1HW1 A;  1LQ1 A;  3GFM A;  2WC2 A;  1K4T A;  3DFG A;  1ETX A;  1XSX A;  4ABZ A;  4MHG A;  4DYC A;  4CXF A;  3LAP A;  1SD6 A;  2OV7 A;  1XGN A;  2VAS A;  3MMY B;  3MWM A;  1U9N A;  1U0J A;  5IT3 A;  3FK6 A;  2LF7 A;  2EQR A;  4GXO A;  1U6G A;  4JP0 A;  4MTD A;  1HDP A;  1ZKG A;  3GFJ A;  2DTR A;  4XKC A;  3BOQ A;  3QRF F;  5B5E C;  4CO8 A;  3LSM A;  3NWS A;  2H27 A;  5K5R A;  1MH4 A;  3SDG A;  2ZJP F;  4DGW B;  2VPL A;  3WTZ A;  4LLG F;  2OCC H;  5HOD A;  1QVU A;  4EMS A;  5J4Y A;  4BUP A;  4M74 A;  2NNN A;  3A0B C;  1PDN C;  1KQ9 A;  1W7P A;  2Z2S B;  3OOU A;  4DQ2 A;  4ZYD A;  1IRZ A;  3O3K A;  4ETS A;  3S1Q J;  1Z77 A;  2JVG A;  3L7W A;  5ED4 A;  1UFM A;  1IW7 F;  2FRH A;  4HAM A;  5LGU A;  3MN2 A;  3JRE A;  1OCZ H;  3HZJ A;  2XAG A;  4HDV A;  1HOM A;  4IXA A;  5EJC A;  5FD6 A;  3SXY A;  1YX5 A;  4RAZ A;  2K4J A;  1UMQ A;  2PMZ A;  1K7A A;  5D5U B;  1TL8 A;  3HEF A;  4XRS G;  2GXB A;  1X1B A;  3BJA A;  3J81 K;  2WY8 Q;  5LHH A;  2VN2 A;  2VT3 A;  5HNF A;  4C3H J;  1JGG A;  2Y75 A;  2O5R A;  3GTQ J;  1MGT A;  4B4C A;  2A5Y B;  4R1H A;  3B73 A;  3HPG A;  3EUK L;  1F4K A;  3R6S A;  4MTE A;  5F27 A;  5JHU A;  2FBK A;  2XIG A;  2L9N A;  4U0Y A;  5LD2 C;  3E6C C;  4CYC B;  2ACJ A;  4YFN F;  1A35 A;  2HYJ A;  3A03 A;  2ZJQ F;  4IKF A;  3AL0 B;  2HNH A;  3HBL A;  2NVX J;  3KZZ A;  4A6D A;  2BW3 A;  3K4M A;  3K4B A;  1T95 A;  1H89 C;  2VQL A;  3GBG A;  2HKO A;  1VQ6 I;  2DFF A;  2YX7 A;  2RGV A;  1W0U A;  2Q2E B;  3VYU B;  1VFC A;  4BJT A;  3OS0 A;  2DFH A;  2E35 A;  2ID3 A;  1K4S A;  2LH9 A;  2NVT J;  3CMA I;  2D1V A;  3AG2 H;  1VZ0 A;  1Y6I A;  2LRE A;  1FY7 A;  4J01 A;  1VQ8 I;  3MQ0 A;  4A5M A;  5CQG A;  2HVS A;  2WY7 Q;  1B1B A;  1TWA J;  2FNP A;  2VBX A;  3C18 A;  1H8A C;  3V8L A;  1MMG A;  4IQJ A;  3CCR I;  3JRG A;  1UCR A;  2WWY A;  1IRF A;  5EGO B;  5EYR A;  3HGY A;  1YG2 A;  3WOD F;  3HJE A;  1BC8 C;  1WKM A;  2P6S A;  1R49 A;  3U1D A;  2A68 F;  2W24 A;  2LY1 A;  5ICE A;  1N25 A;  2ZB9 A;  2E34 A;  1Z3X A;  1F1Z A;  2K4B A;  4B8X A;  3I55 I;  1FP2 A;  3HOX J;  4HRI A;  4FT8 A;  2ZXI A;  3SYT A;  2CGP A;  4FE7 A;  2ESN A;  4UHT A;  1ETY A;  3K4J A;  5FO5 A;  3S3N A;  2L2O A;  2L9R A;  4KT6 A;  2Y9Z A;  2DA7 A;  2F4I A;  2CUJ A;  2P4W A;  3QP5 A;  4ZTF A;  5IT9 K;  1KQ0 A;  2OA4 A;  3BCB A;  2H6C A;  3FXO A;  4XKB A;  2R7Z J;  1YHQ I;  4G94 A;  4BQN A;  4BE1 A;  3E97 A;  2XRN A;  1H9G A;  3OYL A;  2P81 A;  2LC2 A;  2TRT A;  3LSG A;  1FZP B;  2HU9 A;  2K86 A;  3FMR A;  1FWZ A;  2KIF A;  2QA4 I;  4B48 A;  3KET A;  1GV2 A;  5LHI A;  5JLW A;  2X6Y A;  3RPU D;  2XSJ C;  3DTE A;  4OAY A;  3VB2 A;  5LBQ A;  2VBZ A;  3IWF A;  2W7N A;  2L02 A;  3WTY C;  3OY9 A;  2FU4 A;  2L3D A;  4AUX A;  4XLA A;  1HQC A;  5KNL A;  4HV6 A;  5B3S H;  3RDI A;  2OPT A;  4EJW A;  2L0K A;  1LDK B;  5IYB J;  4F52 A;  1IV6 A;  3PQJ A;  2JJ7 A;  2AHQ A;  2PMZ N;  3DTK A;  3TL4 X;  4A12 A;  1PUF B;  4IX7 A;  2WAQ N;  5M3M J;  3IRQ A;  3LSK A;  3IAM 2;  4GO1 A;  4I98 B;  5F08 A;  3MCZ A;  3DF8 A;  2QF7 A;  4BGD A;  1Q1V A;  2M8E A;  3OSF A;  4HYE A;  5GAH J;  1RR7 A;  2HPI A;  4A3L J;  5FLV A;  1HSJ A;  4BDZ A;  4UUT A;  4WXD A;  2L7M P;  4O3M A;  2DQR A;  3MKZ A;  3F8B A;  1XSD A;  2GIV A;  2YUS A;  1EJ9 A;  1DQU A;  4TV7 A;  4MEX F;  5L3B A;  3VYS B;  2PN6 A;  1PP7 U;  1EKE A;  2K9N A;  4M3B A;  4U7B A;  4EGZ A;  4II2 A;  2ETH A;  2DDA A;  2P0W A;  2X1D A;  2P5V A;  3OYF A;  1XG1 A;  3ABU A;  3HSR A;  3A0H C;  2NS7 A;  2DT6 A;  3RZO J;  5IY5 H;  3GUD A;  4CHU A;  3FMS A;  2BZT A;  3RKY A;  1W4M A;  1IXR C;  1ITY A;  1Z9C A;  3F8N A;  1N77 A;  1GXP A;  1RUN A;  3HUG A;  1SVM A;  1IN6 A;  1X1C A;  3K2Z A;  2BE5 F;  4UUS A;  3S17 J;  5HLT A;  5LEJ A;  4EJV A;  3W2W A;  3AFH A;  3ZMV A;  2QSH X;  4EQQ A;  4A6E A;  3RZD J;  3TBI A;  4BEH A;  4CCK A;  4E7Z A;  2DPD A;  3ZMD A;  2L01 A;  2V79 A;  5HDN A;  1IUF A;  4WXH A;  3EUH A;  1TW2 A;  5K5O A;  3JSP A;  1WI9 A;  2M7B A;  1PUF A;  1HST A;  1SAX A;  2EIL H;  4A0Z A;  4AVP A;  3BR1 A;  3ZMT A;  3JRH A;  3PNY A;  3R60 A;  4HLY A;  3ISP A;  2EB7 A;  3DKW A;  2KIU A;  5CLS A;  1BR2 A;  4XBF A;  2Y0S A;  1AKH B;  3H9G A;  2DMU A;  3IRR A;  5CVR A;  4HF0 A;  1NG7 A;  1FYK A;  1LEA A;  2IA1 A;  3P9I A;  5H6Q A;  4BBR J;  2DA6 A;  2R7F A;  5D8K B;  2H94 A;  2VC0 A;  1JUS A;  4LIV A;  2ZBK A;  4R8H A;  1GLN A;  1F5T A;  3H5A A;  1FP1 D;  1QVT A;  4ESF A;  4NQW A;  4D7N A;  3GTG J;  2IGN A;  3L09 A;  4XKW A;  1HCR A;  1A36 A;  3HL2 A;  2JA6 J;  2CSO A;  5JFR A;  3KP7 A;  2YU9 J;  3TP3 A;  1AU7 A;  4L0Y B;  2D2W A;  2LF8 A;  1U2W A;  4P5O A;  2VE9 A;  1IG7 A;  1PYV A;  2BY3 A;  4WK8 F;  2R5Z A;  1IJW C;  4KFC A;  3R0A A;  4I76 A;  1YW9 A;  2NAZ A;  4IRH A;  1ORK A;  2BHY A;  1W5T A;  2G7U A;  4ZTJ A;  2NRA C;  2DXI A;  3FXK A;  2PJR A;  1YRN A;  3ZQG A;  5FFX A;  2E1O A;  3KP4 A;  1MBF A;  3CCV I;  4BE0 A;  4FX0 A;  3V4G A;  3TOB A;  3H3Z A;  2V26 A;  2V1U A;  4BEH B;  2K3P A;  5ICG A;  2WTE A;  3J80 K;  4Z2Y A;  1GUU A;  3BQZ A;  2DJN A;  2L54 A;  2IS1 A;  4UUS B;  2JK3 A;  3F21 A;  3F8C A;  2WV1 A;  4KN4 X;  4HOB A;  2DI3 A;  2MD5 A;  5H2F C;  2EFW A;  1YIJ I;  2A6E F;  1E3H A;  4A3D J;  1U5T B;  1Z6T A;  2XF6 A;  1BR4 A;  4RDU A;  1ODD A;  2HYG D;  4MFE A;  5DM6 F;  1YJN I;  3KPH A;  3DBL B;  4Y15 A;  4QPQ A;  3V42 A;  3FZV A;  5FKO A;  1P4A A;  1MSE C;  4OOI A;  2LKP A;  1H88 C;  3G71 I;  2JT1 A;  2VBW A;  3LSR A;  2FQ3 A;  3IV5 A;  3H0G J;  1T33 A;  2BGC A;  2O8X A;  3RYP A;  4BQO A;  3GZN B;  4A3C J;  2NNY A;  3NQO A;  4YEL A;  2COM A;  5DDG A;  1MIJ A;  1D0Y A;  2ZJ2 A;  1FTT A;  1XN7 A;  3D0S A;  3D5L A;  1IN5 A;  5JI6 A;  4RB0 A;  2MGQ A;  2R7D A;  5CVJ A;  2R5Z B;  1ZRD A;  4JX5 A;  2ZFW A;  4DYR A;  1BBY A;  1IAW A;  4ON0 A;  1BIA A;  4M3F A;  3HPH A;  4PZJ A;  5E3L A;  3BR5 A;  3BRO A;  3U9G A;  3JTH A;  1MZB A;  4MQ9 F;  3GTP J;  1BN5 A;  3DBH B;  3PFI A;  3LQR A;  3OYM A;  4S05 A;  3DPL C;  3K7A J;  2OZ6 A;  3N05 A;  2V9V A;  5A2Q Z;  4V2F A;  3GWZ A;  2R0Q C;  2WAD A;  4RLQ A;  2VT2 A;  2KZV A;  3E7L A;  1B59 A;  4ESB A;  4KMU X;  3CP8 A;  5F04 A;  1IRG A;  3VYR B;  2E71 A;  2ELH A;  2P5L C;  1ETO A;  4M6Y A;  3J7A O;  2VKE A;  4Z6Y A;  1FIA A;  5J8C A;  3N4M A;  4P1W A;  1FEX A;  4BKX A;  3OYJ A;  2XAQ A;  2ZXH A;  5F1J A;  4M73 A;  2JVH A;  4DJA A;  4BBS J;  1W36 C;  4KN7 X;  2X1C A;  2MAB A;  3M8E A;  2W25 A;  2PMH A;  3CJR B;  1APL C;  3VDX A;  3QAH A;  2JA2 A;  2HS5 A;  1DU6 A;  2FBH A;  1VQO I;  1OCO H;  2FE3 A;  3BP8 A;  1VQK I;  2R93 J;  4L9T A;  2VKV A;  2O3F A;  1FX7 A;  1KU9 A;  2UUZ A;  5E20 A;  2CFX A;  3IP4 B;  4RM3 A;  4PFO A;  1R7J A;  4I09 A;  3Q0V A;  3RKW A;  3J7Y J;  3JRA A;  2FXA A;  1J9I A;  1R1V A;  1X1P A;  3VFZ A;  1A31 A;  5CVI A;  2ZC2 A;  1LUJ B;  2DMQ A;  5LRR A;  3H3U A;  1JUP A;  2M34 A;  3FF5 A;  5GTI C;  3FM5 A;  4BY7 J;  4XK4 A;  1UG0 A;  1C0W A;  2A61 A;  3TW7 A;  3L9F A;  1XD7 A;  5FLM J;  1I6X A;  1B9M A;  2ECC A;  4G6Q A;  1B8I A;  1W5S A;  1BW5 A;  1EA3 A;  3K9T A;  2DCE A;  2QKL B;  3M8J A;  1F9N A;  2HXI A;  1HDD C;  1G3W A;  1PP8 F;  2O9L A;  2BY1 A;  2HI3 A;  2LVS A;  4L0Z B;  1Y1W J;  4F3Q A;  1IF1 A;  2RN7 A;  2RQQ A;  3PNT A;  4RGX A;  3RKX A;  3U1K A;  3T8R A;  3G6E I;  3OSG A;  2XB0 X;  1VQ7 I;  3M3Y J;  2ZO4 A;  2XC7 A;  1VQ4 I;  3AAF A;  1IO2 A;  1HW5 A;  2Y48 A;  1TT0 A;  2X51 A;  1R58 A;  1FMW A;  3ESW B;  2XGE A;  5LRS A;  3OYE A;  4A93 J;  3S8P A;  3ZN0 A;  4XRF A;  2L5Q A;  2XAJ A;  3MKL A;  5FJ8 J;  1J2X A;  4CCL A;  3HKZ N;  2QUF A;  4ZH4 F;  4ZJZ A;  3PNV A;  1T98 A;  2DA4 A;  4HF1 A;  3WGH A;  2FF4 A;  4HST A;  2D45 A;  2IGM A;  4ENN A;  3FXR A;  3Q9V A;  4UUV A;  3W2V A;  1UHW A;  1S29 A;  1I39 A;  3PJR A;  3G4S I;  1OYW A;  3ELK A;  1IXS B;  1MDM A;  3RKQ A;  3ECO A;  3R4K A;  1SVO A;  2V4J C;  1X3U A;  2Y2Z A;  1A6I A;  3NAR A;  2PQ8 A;  3D1N I;  4D9J A;  3BTI A;  1R9T J;  4IZZ A;  5E3M A;  2JRT A;  4DYQ A;  2VQC A;  2A07 F;  3LSI A;  5DYM A;  4L9V A;  3OR1 C;  3TOA A;  2HZT A;  1QPM A;  3VPR A;  5K7Z A;  2EZI A;  5JLX A;  2WAE A;  1W1W E;  3DLA A;  5J40 A;  2EK5 A;  2OCE A;  1Y56 A;  2GA1 A;  4MNU A;  3LSH A;  3KE2 A;  4XL9 A;  1LE8 B;  3IKV A;  1Y0N A;  3HSE A;  1KGS A;  2L7K A;  3HUG B;  5H20 A;  2ZCW A;  1G2H A;  5BQT A;  1ZYR F;  5HVQ C;  1DP7 P;  1JE8 A;  4WCG A;  2WAF A;  1VQ5 I;  3LQQ A;  3GME A;  2CFO A;  4IRI A;  2DOE A;  3LSJ A;  4D5C A;  2D1H A;  2M87 A;  2ZME B;  3F6V A;  2QQ9 A;  3G1L A;  5DTD A;  3FHN A;  5EG0 B;  3HSF A;  5HDK A;  3V8K A;  1CF7 B;  1FBQ A;  3S15 J;  2DU9 A;  3DP7 A;  3RPU A;  2IAI A;  2GAU A;  2OTJ I;  3KLO A;  1MMA A;  4KIT B;  1AOY A;  2WBM A;  1KA8 A;  1BOB A;  3C2H A;  3I4P A;  4GYG A;  3ZMS A;  4UY8 I;  4DW6 A;  2M0M A;  2M0C A;  2DN0 A;  1ETV A;  3HB9 A;  1R5H A;  1W36 D;  2DAO A;  2CQN A;  1K78 A;  4M71 A;  3ML6 A;  4LG0 B;  4NB5 A;  2DLL A;  3A01 A;  4U87 A;  2E2J J;  2QQA A;  3Q0W A;  2VLA A;  4RAF A;  3IH3 A;  4ESJ A;  1IV8 A;  1YW8 A;  3K70 C;  1Y1V J;  5ICC A;  5LEK A;  1SD5 A;  1U8B A;  1RZ4 A;  1ZHF A;  2CS3 A;  2GWR A;  4A5N A;  4Q5S F;  1ZN2 A;  4PJJ A;  4BHC A;  4AYB N;  2HPM A;  2KIS A;  4G6T B;  5CYV A;  3T8T A;  2M2E A;  5DCF A;  1EH8 A;  2RAE A;  5DUI A;  2LK2 A;  2R7W A;  1RIO H;  5E79 C;  2V6E A;  1YW7 A;  4KIB A;  3J80 Z;  3RCO A;  2HQN A;  2KT0 A;  2K9S A;  2E7W A;  3FM3 A;  2Z1D A;  3E5X A;  1WPK A;  1OFC X;  3W6V A;  1VQ9 I;  1SFU A;  1GV5 A;  3E0J B;  1I5Z A;  4C2M J;  4B09 A;  4KDP A;  3H3V K;  1IXC A;  3OL3 A;  3QU6 A;  2Z9O A;  2OQR A;  2LSO A;  3S1N J;  5GPA A;  3WG7 H;  2GXG A;  4XOP A;  2KDZ A;  1XB4 A;  2W85 A;  5EEH A;  3CCS I;  3DEW A;  5FD5 A;  1T0F A;  4Y33 A;  5M5Y J;  4HX8 A;  2EBI A;  4B3A A;  2DPU A;  3FWE A;  1QZZ A;  2IPQ X;  4JQF A;  1DUX C;  4Y17 A;  2JPC A;  1WJE A;  2HGC A;  1LJ9 A;  5JVT A;  4GYI A;  2MW8 A;  3I54 A;  3WTU C;  4C3J J;  2YPR A;  1HKS A;  2M8G X;  2UXX A;  1OCR H;  4GRI A;  3SFI A;  2CYY A;  4CCJ A;  2OD5 A;  1SFO J;  3W2A A;  1XDS A;  3REO A;  1WJD A;  4U88 A;  1UEL B;  2M45 A;  1JUM A;  2RRE A;  3CLQ A;  4A3E J;  4WX9 A;  4HBL A;  1YS6 A;  2HQR A;  4UVA A;  3GZ5 A;  1NK3 P;  2JA8 J;  1KU2 A;  3VOE A;  2M30 A;  3LFU A;  2IEK A;  4LGW A;  4A3K J;  2ZME A;  3IAS 2;  2A6T A;  2DA1 A;  4YII A;  3CUQ A;  1EV7 A;  3JRC A;  4EVI A;  5D4R A;  5TJJ A;  3F6O A;  2M7A A;  3FMQ A;  4OIQ F;  4DOZ A;  1DDN A;  1Z3Y A;  3F3X A;  4I6Z A;  3FBN B;  2MA3 A;  3I58 A;  1QA6 A;  2F6C A;  3EQL F;  2JSP A;  4HG2 A;  3UR3 C;  4XLC A;  5LHG A;  5JVG F;  2X0L A;  1QNT A;  4CCO A;  3GX4 X;  1X1A A;  2H8W A;  3H35 A;  1A5J A;  1ZGA A;  2MSY A;  3DU5 A;  1OIS A;  1O7F A;  4HSR A;  3E6D A;  3PIP F;  1VQN I;  4MIM A;  1K6O A;  4OAZ A;  5L3E A;  5FKM A;  2KFD A;  5HLH A;  4E4H A;  3HTS B;  2OUM A;  1MDM B;  4RLF A;  3AKZ A;  1HBX G;  3C2G A;  4E7H A;  1TQP A;  2HXO A;  2GA2 A;  1I3A A;  3LNQ A;  5BNG A;  5J47 A;  2X6O A;  2AQE A;  3KYD B;  2X48 A;  1R4M B;  2IRF G;  1F43 A;  2A05 A;  2E19 A;  3K6G A;  3SZG A;  3RIR A;  4PJM A;  4ZYG A;  3HOY J;  1LKX A;  2P6T A;  4RGS A;  5IOZ A;  3TO6 A;  2TDX A;  4A2U A;  4HLX A;  4C2U A;  3WTX C;  1FOX A;  4A0X A;  2F2E A;  2LKS A;  1JKO C;  2COB A;  5E17 F;  3OIQ A;  2LTP A;  3OYA A;  3CCQ I;  3ASO H;  3GF2 A;  1VQL I;  4LB5 A;  1IGN A;  2E2I J;  2VXD A;  2ZNY A;  3SFZ A;  5IOY A;  1YX3 A;  1I3Q J;  2VC1 A;  2PLY A;  2STT A;  4M3G A;  3AL0 C;  1MBK A;  3WTW C;  2XGD A;  1YOV B;  5GTH C;  2IT0 A;  1I1S A;  2FOW A;  1J0R A;  2IGK A;  5E18 F;  1T39 A;  4NHJ A;  2FX0 A;  4II3 A;  4BJ5 C;  2JA5 J;  3I4M J;  1VTN C;  4HPQ A;  1U5T C;  2QKM B;  5FB2 A;  3ONQ A;  1M1E B;  2VOP A;  3L2C A;  3BR6 A;  2LOO A;  2K85 A;  1FOK A;  3GTK J;  2R7X A;  2DTZ A;  5JR3 A;  4Q4Z F;  2G9W A;  3BZ6 A;  2FD5 A;  2JMW A;  3VSK A;  5BPI A;  3G2B A;  3S3O A;  3KEY A;  1S6L A;  2FNA A;  1H9T A;  2YU3 A;  3FXL A;  1D0Z A;  4UVC A;  3V8J A;  3MFK A;  4V19 K;  2KRH A;  4O5V A;  3W3C A;  4M3E A;  3WE3 A;  4KIC A;  4OIO F;  2GZW A;  3M4O J;  2BV6 A;  2GOM A;  2JUG A;  4V2G A;  4MLO A;  1ZG5 A;  2O7O A;  3DWL E;  2KP6 A;  5FRO A;  4CSW A;  3A1Y A;  4GGG A;  3PM1 A;  1AHD P;  3MZ8 A;  3KIO A;  3JAM K;  1DGR M;  1LE8 A;  1JKQ C;  1YLF A;  1R6R A;  3HOT A;  2XPV A;  1ZRC A;  2LY2 A;  4IRG A;  1LPQ A;  1G4D A;  4IHX A;  4HEA 2;  4CGZ A;  4B1R A;  4LLL A;  1X3W B;  2OU2 A;  2FML A;  3K4N A;  4XN0 A;  1T0F C;  1TWF J;  2CJJ A;  4E7S A;  2FJ1 A;  1I6H J;  3I71 A;  5CPR B;  2A3S A;  4PGH A;  3S2H J;  3ERM A;  2CG4 A;  1TNT A;  1YIO A;  3BJO A;  4ASN A;  2DW4 A;  4YG2 F;  4RB1 A;  1Z21 A;  3JCU C;  4MGR A;  4NDL A;  3CMY A;  4RGU A;  1DPR A;  1XGO A;  5J4V A;  2VL8 A;  2EA2 A;  4QLC U;  2DDB A;  3OR2 C;  2VB6 A;  1RR8 C;  3C3W A;  4XM3 A;  3S32 A;  1DGW Y;  3BDD A;  2KIQ A;  3CLO A;  1XMX A;  4LFU A;  2V9K A;  3M1C A;  1ONV A;  2IS2 A;  4EM0 B;  1BI0 A;  2O61 A;  2DMP A;  1P9Q C;  4FQG A;  5J8F A;  5TIS C;  1D8J A;  3EET A;  4MQV A;  1ENH A;  4IO9 F;  2Y30 A;  2VUM J;  3BLY A;  1P7I A;  1S72 I;  3WG9 A;  2F5F A;  1GXQ A;  3ZQI A;  2NS0 A;  1E0E A;  2EZH A;  1FJL A;  2XB5 A;  4EAT A;  4B3X A;  1ZRF A;  3OYI A;  3CC4 I;  2X6X A;  1K83 J;  3H92 A;  2VON A;  3L2U A;  1WGX A;  2PEX A;  4CCM A;  2UWM A;  3K1P A;  2W4S A;  2E1M C;  3OYH A;  4IHW A;  1V54 H;  5EZG A;  2K9M A;  1ON1 A;  3LAJ A;  4PDK A;  4P9F A;  4YIF A;  3B6C A;  1MBJ A;  3GLL A;  1JTY A;  2VJ5 A;  4NC6 A;  5A2Q K;  2ZNZ A;  3GYH X;  3I56 I;  2E36 A;  2AXT C;  2MC4 A;  4JK1 X;  2L7F P;  1RRJ A;  4I0B A;  4GFB A;  2MH9 A;  3ZQ7 A;  2LBF B;  1GVD A;  4W1U A;  4LG0 A;  3T5X A;  2AO9 A;  3ZQH A;  1K79 A;  3SEQ A;  2X1E A;  3HHH A;  5EEG A;  5J3L A;  3K4C A;  4LK1 F;  1QQI A;  2VJ4 A;  2ZJR F;  1FLI A;  3RYR A;  1ON2 A;  3OL4 A;  3ABL H;  5KK1 A;  4G7H F;  1MMS A;  2V1N A;  5FRN A;  5KVR A;  3HOW J;  2NS8 A;  1VND A;  1GDT A;  1TW3 A;  3VOD A;  1VF9 A;  1POG A;  4EM2 A;  1KZH A;  4RM2 A;  1ACI A;  2JWT A;  2K27 A;  2LR8 A;  3HXL A;  1R1U A;  4IHY A;  4CA0 A;  2K5C A;  2PMU A;  1UB9 A;  2RNJ A;  3E3V A;  4RBO A;  2A69 F;  1R36 A;  3DKY A;  3FDY A;  5D5W B;  5B1A H;  2W00 A;  4PJL A;  5C44 J;  3WTT C;  1FT9 A;  3U21 A;  3OWT A;  3QPH A;  4CIC A;  3DEU A;  3CF2 A;  3RTR A;  4X0G A;  2KQR A;  4M6V A;  2MFZ A;  3BG5 A;  3QPL A;  1KON A;  1P2F A;  2LY9 A;  1IC8 A;  4ITV A;  1R00 A;  1TQI A;  2NXN B;  4QWQ A;  2HFH A;  3K4L A;  1HKT A;  1I27 A;  2PI0 A;  1O3T A;  2GXA A;  3K69 A;  3I53 A;  4IF4 A;  1MNM C;  2JN6 A;  5IP6 A;  4XRM A;  3L00 A;  3HKZ A;  1I1G A;  4C3I J;  1TT5 B;  2IA0 A;  3EUA A;  3I4N J;  3E1S A;  2L4M A;  1V5G A;  5J1Y A;  1ZRE A;  4KIS A;  2DK5 A;  1JXS A;  2CQK A;  5HOO A;  3KEQ A;  3JRF A;  1TBX A;  2HVR A;  1TWC J;  3TO7 A;  3FX3 A;  5J1R A;  1SD7 A;  2VBY A;  3PSF A;  4DZP A;  3I59 B;  1RNL A;  3P5J A;  3E6M A;  1WJF A;  4NC7 A;  1T6S A;  2I8D A;  2R5Y B;  4PSX A;  2E2H J;  1PUE E;  5BS6 A;  3KYL A;  4XIC A;  3BTC A;  4DZJ A;  2Z99 A;  3JRI A;  2CV0 A;  1SFE A;  2MH2 A;  2ZSH B;  5C4J J;  2NVU B;  2K9L A;  2BHZ A;  4RS8 A;  4HX4 A;  2DO7 A;  3CC2 I;  1LVA A;  2JPB A;  2H8R A;  5EZH A;  3F0C A;  2QEN A;  1E3O C;  2ISZ A;  4S04 A;  3QYB A;  2M4K A;  4LIT A;  2F5V A;  3OV8 A;  3DLL F;  3M7G A;  4EM1 A;  4Y52 J;  1HA8 A;  2V1X A;  4DNC A;  5DV5 A;  1V3F A;  4A69 C;  2XVC A;  3TMO A;  5GPC A;  3ZPL A;  1FIP A;  3X2Q H;  2M1B A;  3C1D A;  5E8G A;  3HTU A;  3ZCO A;  3A01 B;  1TTY A;  1V5F A;  4M9Z A;  5KAI C;  1XGS A;  3CC7 I;  1WI3 A;  1OPC A;  5E1Z B;  1BI3 A;  3CTA A;  2L9S A;  4UV9 A;  5D6E A;  4P9U A;  2QBY B;  2DYS H;  5IPA A;  3Q0U A;  3MKY B;  2JQ7 A;  5FGM A;  2ZXJ A;  2IS6 A;  5GAE J;  1WHU A;  3TP0 A;  3DCF A;  3HGG A;  2KLO A;  4I01 A;  1IUY A;  3S3M A;  1O3S A;  3ZQC A;  4PK4 A;  4S0H B;  1X19 A;  3L2V A;  2IP2 A;  4N0B A;  2JA7 J;  1D1C A;  4ENK A;  2KRC A;  2VKH A;  5CJ9 A;  5E1W A;  1XDU A;  2K3F A;  3BG9 A;  3WHC A;  4L5I A;  3TDU C;  3CO6 C;  4WXC A;  4DBR A;  1OMI A;  2G0E A;  1OJL A;  4CZZ A;  4RB2 C;  2BW3 B;  3QYF A;  4N9I A;  4XLH A;  1XCB A;  4XRS A;  2H1K A;  1LFU P;  2TCT A;  2W84 A;  2JRM A;  3L2R A;  4BDY A;  1DPU A;  1LFB A;  1W0T A;  4QTR A;  2VOD A;  4I2O A;  4XQF A;  5AON A;  1YQA A;  5DCM B;  1FSH A;  3JRD A;  2P8T A;  3S2W A;  5L3F A;  1QZY A;  4HNV A;  4L18 B;  1BJZ A;  2R5Y A;  3ZMZ A;  4BL0 B;  3ABT A;  3WTS C;  1IN8 A;  1RET A;  4LG3 A;  2I10 A;  4XMY A;  5M3F J;  1IN4 A;  2R7R A;  2K40 A;  3K0L A;  1AKH A;  1S5L C;  3CDH A;  3HRU A;  3OS2 A;  2ELJ A;  4KT5 C;  1WH5 A;  3ULQ B;  3FXM A;  1KYW A;  3W6K B;  2ZSI B;  4J00 A;  2GQQ A;  4ZYE A;  2W1O A;  5J1U A;  3MKW B;  3UNG C;  3RJP A;  1XMA A;  2EV5 A;  1XTA A;  3FXJ A;  4BNC A;  1OCT C;  3SEZ A;  3P9C A;  4RB3 C;  1I50 J;  5GP9 A;  4QPO A;  2EIN H;  4L5E A;  5D5X B;  4AWX B;  1TLH B;  5D4S A;  4ZDO A;  3LA7 A;  2E1N A;  2QWW A;  1BI1 A;  3FXQ A;  1FNN A;  5FKK A;  2ELK A;  3F9K A;  2X4H A;  5FKL A;  1R22 A;  3OIO A;  5IP9 J;  2X9D A;  2DA3 A;  2F5C A;  2HTJ A;  1JJ6 C;  1NK2 P;  1MJB A;  2M9H A;  1YFH A;  1ETQ A;  1KQ8 A;  2A5W A;  2VXZ A;  1QGP A;  2ESH A;  4A3M J;  4D7M A;  2HDD A;  3O8G A;  6PAX A;  5IYD J;  1W5C C;  1UST A;  3J7A Y;  1L0O C;  3CUQ C;  5EG0 A;  1WQ2 A;  3BZC A;  4LD5 A;  1WVR A;  2JTV A;  5GAD J;  2P5K A;  5FRM A;  3QOD A;  4UXN A;  3EYI A;  2EV6 A;  4AYB A;  4HF2 A;  2R7T A;  1IN7 A;  2EJR A;  2BEO A;  3PFY A;  4A3F J;  4C30 A;  4GDF A;  4L9N A;  2UV1 A;  4OIR F;  4UNO A;  2CUF A;  2NOG A;  2A6H F;  3CDL A;  4FTH A;  3WGG A;  2ISY A;  1R71 A;  4RMN A;  5B1B H;  1NHA A;  1TWH J;  2VE8 A;  4NUB A;  1OQY A;  1QBJ A;  3AG1 H;  4HW0 A;  4DIQ A;  1JT0 A;  3VEP A;  3HHG A;  2O8K A;  5HLG A;  2XAH A;  1XSV A;  3B6A A;  3ZMU A;  1ZK8 A;  3H36 A;  5IT9 Z;  1OR7 A;  1J75 A;  1OYI A;  1KU7 A;  4YEJ A;  3WU0 A;  4M6X A;  1VQM I;  3ZGK A;  3KZY A;  2M5W A;  3FKJ A;  4Q48 A;  1RUO A;  3HYI A;  2WV0 A;  2EZK A;  4BXX J;  1YTY A;  2XUB A;  1Y39 A;  4H4K C;  4A3G J;  3A02 A;  1D5V A;  1SVL A;  2NYX A;  2GLO A;  4G7O F;  2QSG X;  3V7C A;  3BTJ A;  2J5O A;  3CJT B;  4ZC3 A;  4FET A;  2B7E A;  5DUK A;  1BM9 A;  3PO3 J;  4J19 A;  2HOA A;  1DU0 A;  1HLV A;  1TZL A;  1LB2 A;  3CQZ J;  1G59 A;  1Z7L A;  2NVQ J;  3EPZ A;  2OAZ A;  1A6Q A;  1TP4 A;  4EEF G;  1GVJ A;  1QHH D;  4NQW B;  3NWT A;  2CW7 A;  3OYK A;  5DCM A;  3O8H A;  3G3Z A;  4AC0 A;  5D8L B;  5HS8 A;  2VQH A;  4HV5 A;  2XKO A;  3IWZ A;  2P7V B;  4CUG A;  5KAF C;  5BMZ A;  3S2D J;  4G7Z F;  5JHF A;  2MBF A;  3JR9 A;  1UZC A;  1JI8 A;  5F0H A;  2K9Q A;  2EPF A;  2XDV A;  3P7N A;  2F5D A;  2RDP A;  2HOT A;  2RNG A;  5J6X A;  5IYC J;  3BC8 A;  5E3O A;  1MBG A;  4BS9 A;  4A3I J;  4N4N B;  4PGG A;  4QSH A;  1T8I A;  1WH7 A;  1J09 A;  3BR0 A;  3F22 A;  3H5N A;  5F0F A;  4L9J A;  5AIP A;  1FSE A;  2EA4 A;  4FCY A;  3JTG A;  4XLN F;  1STZ A;  4XID A;  3E5Q A;  1R5G A;  3K10 A;  2KHM A;  3IUO A;  4CZC A;  4F91 B;  5CVV A;  5ILU A;  1UHS A;  1R23 A;  2CQ7 A;  5LFA A;  1R5I D;  2EWN A;  4X1E A;  1O3R A;  3HRS A;  4RAY A;  2W48 A;  2EFN A;  2PBI A;  2ME0 A;  5HS9 A;  2R4G A;  2QSF X;  2O03 A;  4P96 A;  4IOC F;  3RPQ A;  2EIK H;  2OC6 A;  2VIX A;  5LGN A;  1FOY A;  2EFQ A;  1JT6 A;  4EJU A;  1MSF C;  4IHS A;  2QM3 A;  5FLX Z;  4AM3 A;  3N97 A;  2K02 A;  2E1C A;  2Z33 A;  4CYC A;  1QPI A;  2GM4 A;  1U9O A;  3GXO A;  2R7U A;  3MEX A;  1UG2 A;  2E60 A;  1RC9 A;  5FLX K;  3F72 A;  1FMV A;  4DBQ A;  3GZ6 A;  3CD6 I;  5FKN A;  1QO0 D;  3E5U A;  2ECB A;  2XPW A;  1ZAR A;  3HOS A;  1YE9 A;  2HDC A;  3TQN A;  1S7E A;  1XMK A;  3CCY A;  1YJW I;  3KP2 A;  1RI7 A;  4G9Y A;  4XON A;  4BHB A;  1P4X A;  1UJ8 A;  4XOR A;  3K2A A;  1QRY A;  1T08 B;  2HVQ A;  4HDU A;  1OCP A;  3GFI A;  5HLI A;  1TC3 C;  2HQA A;  4FE4 A;  3H5R A;  2EH3 A;  3OS1 A;  4KJZ A;  3CCM I;  3CZ6 A;  5ILV A;  2XRO A;  4I99 C;  2EFO A;  4BE2 A;  3SDB A;  2EZL A;  4HQE A;  1T2K A;  3PQK A;  5F6F A;  4O6J A;  3C2B A;  3OOP A;  5DEQ A;  1WWX A;  2Z5U A;  3LMM A;  4FAS D;  4IVN A;  2HZD A;  1W7P B;  1SAU A;  3L1P A;  3BR2 A;  3HOU J;  3QPS A;  1KYZ A;  3ZOB A;  2IGO A;  3TW6 A;  4CDG A;  1HW2 A;  1EF4 A;  3K4K A;  3SQN A;  4Y13 A;  1RKT A;  2ICW G;  2LKX A;  3BPX A;  1WCM J;  2WB1 A;  1JHH A;  3GW2 A;  4ENM A;  1WJA A;  3KZI C;  2QGU A;  3IHU A;  2W57 A;  4I7H A;  3ZQF A;  4BXU A;  4KYW A;  2FMY A;  2XKP A;  3SZT A;  3ABK H;  3HOV J;  4JOM A;  3GCM A;  3DBR B;  3BY6 A;  2X85 A;  4NNJ A;  4OMZ A;  4L5J A;  2DK8 A;  4YIR X;  3GTJ J;  4ZYA A;  1GT0 C;  1CQT A;  4F7Z A;  1IRX A;  1BJA A;  1WJB A;  2DMT A;  3K70 D;  2MLK A;  2L9V A;  4HZF A;  4UB8 C;  3C7J A;  2OQG A;  1TQM A;  4U0V A;  1QZE A;  1ZG3 A;  2OBP A;  2O6G E;  2E5Z A;  3CDI A;  1WJ5 A;  2FBI A;  3ASN H;  5F0C A;  4ENJ A;  1YS7 A;  3OYC A;  3FKI J;  4PJN A;  2AXL A;  2CUZ A;  1BA5 A;  4BJ6 C;  2Z16 A;  3KLN A;  3DPU A;  3L2Q A;  3ECH A;  1Z05 A;  4M9S A;  1SEU A;  2CH0 A;  3LOC A;  5BPD A;  1O3Q A;  2R7V A;  1WJC A;  2F4O B;  3DPT A;  5F64 A;  5CQE A;  4BH9 A;  1HF0 A;  4AID A;  3JAM Z;  3ABM H;  3BT9 A;  1S3J A;  2BY0 A;  3V7R A;  4YFX F;  1HKQ A;  1MBE A;  1FPQ A;  1WFX A;  1D1B A;  1S9H A;  2QBY A;  3DKX A;  5HDG A;  2H09 A;  2DOF A;  1CF7 A;  1MD0 A;  2H1L A;  2QCO A;  3EUH C;  2XSD C;  2HYF A;  2R7Q A;  1MNE A;  4N9H A;  1P6R A;  2Q2E A;  2EIJ H;  1BR1 A;  2ZXW H;  2Y31 A;  3CCL I;  1YJ9 I;  2QLZ A;  2P7C B;  3HRT A;  2FSW A;  4B43 A;  2LLK A;  3R0J A;  4G8X A;  3IKT A;  5DD8 A;  2PFB A;  1AWC A;  2LDU A;  1G3Y A;  2CUE A;  2BYV E;  1K6Y A;  2HOS A;  2XRL A;  1B9N A;  4LOC A;  3NEU A;  3ZQL A;  1JTX A;  1FBU A;  4XKV A;  2B0L A;  4M9X A;  3SZP A;  2IW5 A;  5TRD A;  4IHV A;  2DA5 A;  1G8X A;  1RKW A;  2DT7 B;  3O6B B;  3OYB A;  2ADU A;  2FEZ A;  4A3B J;  1P7J A;  1XCV A;  3H9J A;  1XX5 A;  4IJA A;  2Y69 H;  5IP7 J;  2HDW A;  3ZN1 A;  5K5Q A;  2E7X A;  3FBI B;  4AD9 A;  1ZR4 A;  3FXU A;  2CV1 A;  2HOE A;  1GHC A;  2FA5 A;  4E7I A;  2XV4 S;  3JW4 A;  1YO5 C;  1X2M A;  1X4O A;  5LLQ A;  4XLE A;  4LLN A;  1G3S A;  4ZYH A;  4BQQ A;  2IA2 A;  2L7Z A;  2XF7 A;  3EDP A;  4ANJ A;  1ZEL A;  2CRG A;  4Y4R A;  2DFI A;  1BL0 A;  1LVK A;  3VSL A;  1ZGW A;  3HC7 A;  4HA8 A;  5E8I A;  1SFK A;  3CP2 A;  2LG4 A;  2YR2 A;  3LFK A;  4HQM A;  3RI4 A;  2VJJ A;  3DEE A;  1SMY F;  5AIQ A;  1BIB A;  3KFW X;  1XPX A;  5L3D A;  1D8K A;  3DQV C;  5EEA A;  4X6A J;  5EF6 A;  1S7O A;  2CMP A;  3F8F A;  4B47 A;  3GEZ A;  4BAC A;  1IDZ A;  3CF5 F;  4RA2 A;  2K7L A;  5L3G A;  4JBA A;  2DOD A;  2YSR A;  2PG4 A;  4OIN F;  1U5T A;  1DP3 A;  1ZGJ A;  4ZDL A;  5ICF A;  4XLF A;  2OTL I;  5K1Y A;  4Y7N J;  1ETW A;  2V7F A;  2KJB A;  5D6F A;  4BHP A;  4FIS A;  4PFP A;  5EGO A;  1Z91 A;  4M3D A;  2I5U A;  1K78 B;  3W6J B;  2KJC A;  1SFX A;  3KCC A;  3WTV C;  3LL7 A;  5DS9 A;  2R7O A;  5HS7 A;  2CW8 A;  2NVY J;  1O4X A;  3CJN A;  1P4W A;  4YFK F;  4KMF A;  1HXD A;  4A0Y A;  3OYD A;  2XAU A;  1D1A A;  3CJQ B;  1O57 A;  3BCA A;  1MJA A;  4BQA A;  3A4C A;  2PJR B;  3HDD A;  1CGP A;  3I3L A;  2LFB A;  3NRV A;  5DM7 F;  3GTM J;  4CH7 A;  3PL8 A;  1WZ2 A;  3PUF A;  3EYY A;  1UAA A;  2RQP A;  1WSU A;  1JHF A;  1Q1H A;  2BOL A;  2ZKZ A;  4XNF A;  4BXF A;  5HNH A;  1L3L A;  2STW A;  3HRM A;  2E1M B;  2KPM A;  4M72 A;  2MD0 A;  4E70 A;  1JGS A;  3IL2 A;  2R92 J;  2XAS A;  2ZFU A;  1AA7 A;  4CCN A;  1Z7U A;  1FBS A;  4PUS A;  9ANT A;  4GCV A;  4BU2 A;  3F23 A;  2B63 J;  3R61 A;  4G6D A;  3I0T A;  2DMN A;  3SHF A;  4I02 A;  4RGR A;  3CMM A;  3G73 A;  4OU0 A;  2BVM A;  4PSW A;  2MYS A;  2YS9 A;  5ERI A;  4MO7 A;  1X4P A;  3P9K A;  1N78 A;  3BQY A;  2EIM H;  4KIF A;  3G1O A;  2NOJ B;  1SMT A;  2QEX I;  4C2T A;  5E3N A;  1U8R A;  1MBH A;  5C3E J;  3VWB A;  3J7Z I;  2L4A A;  3F8M A;  5L3C A;  2WA0 A;  3CO7 C;  4MEY F;  1G3T A;  3AG3 H;  2IXS A;  3GTO J;  1S7A A;  3FIS A;  5FFZ A;  2BXY A;  1TWG J;  3H9Q A;  1K61 A;  4AIH A;  2BY2 A;  4CYD A;  4D0P A;  2CO5 A;  3WU2 C;  2QQB A;  2CW0 F;  2OZU A;  2IVM A;  2IS4 A;  4MFD A;  2HR3 A;  4NC8 A;  1WRJ A;  3QOP A;  4B44 A;  4E7L A;  2VQG A;  5M5W J;  1XC5 A;  3BJ6 A;  2QVO A;  1B4A A;  3GLX A;  2DA2 A;  5GAG J;  1R1T A;  3BG3 A;  3PUB A;  1E3P A;  3IH4 A;  3FHZ A;  4KA4 A;  4WF2 A;  3ZP5 A;  2PJP A;  3TO9 A;  4F92 B;  2GOX B;  4Y3O A;  1MJ9 A;  4LB6 B;  2D5V A;  4NBQ A;  3BWG A;  3Q3S A;  5M5X J;  4ZZD A;  1J5Y A;  3CUQ B;  1PJR A;  2CQX A;  2PX9 A;  2F48 A;  2XHK A;  1ZQ3 P;  1N75 A;  2FQ4 A; 
#chains in the Genus database with same CATH homology
 4D7M A;  2HDD A;  3O8G A;  5IYD J;  1XG1 A;  2IEK A;  2NS7 A;  5EG0 A;  3RZO J;  4A3K J;  2OF7 A;  3LSP A;  3S14 J;  2DA1 A;  3JRC A;  1ITY A;  2VI6 A;  5K7H A;  2Y9Y A;  4A3F J;  1XS9 A;  4I6Z A;  3FK7 A;  2CUF A;  2NOG A;  3CDL A;  3S1M J;  4A3J J;  4UUS A;  3S17 J;  4FTH A;  1BW6 A;  2JA8 J;  1TWH J;  1X2N A;  3IH2 A;  4JX4 A;  1Z0X A;  3RZD J;  3FIW A;  3MVP A;  1JT0 A;  2O8K A;  3B6A A;  1A5J A;  1IUF A;  2MSY A;  1ZTR A;  1ZK8 A;  1PUF A;  4MIM A;  3JRH A;  3BR1 A;  2Y0S N;  5FKM A;  2EZK A;  4BXX J;  4QIW N;  2HXO A;  4A3G J;  3A02 A;  1NTC A;  1AKH B;  3LNQ A;  5BNG A;  2GLO A;  2DMU A;  3BTJ A;  2X6O A;  3PO3 J;  4J19 A;  4BBR J;  2DA6 A;  2HOA A;  2X48 A;  1DU0 A;  1SAN A;  1HLV A;  3CQZ J;  1F43 A;  2E19 A;  4JYK A;  1JUS A;  2NVQ J;  4EEF G;  2VPR A;  3HOY J;  5IOZ A;  1QVT A;  3O8H A;  4AC0 A;  1F36 A;  2XGC A;  1JKO C;  2COB A;  4JX6 A;  2LTP A;  4D7N A;  3GTG J;  4D5F A;  1T56 A;  3QQA A;  1JJ8 C;  1HCR A;  1ZR2 A;  3S2D J;  1IGN A;  2JA6 J;  2E2I J;  3JRB A;  3JR9 A;  2YU9 J;  3TP3 A;  2K9Q A;  5F0H A;  1B72 B;  1AU7 A;  5IOY A;  4W97 A;  1I3Q J;  2HOT A;  1IG7 A;  5IYC J;  4M3G A;  2R5Z A;  5E3O A;  1MBG A;  4A3I J;  1MBK A;  1IJW C;  2XGD A;  4I76 A;  4QSH A;  1ORK A;  1WH7 A;  3BTL A;  3BR0 A;  3I4M J;  2FX0 A;  5F0F A;  2JA5 J;  4FCY A;  1YRN A;  3ZQG A;  2E1O A;  4XID A;  1VI0 A;  1MBF A;  3BR6 A;  3GTK J;  1B8I B;  2DTZ A;  2LD5 A;  1FTZ A;  1UHS A;  2FD5 A;  2JMW A;  1MH3 A;  4X1E A;  2CQQ A;  1GUU A;  3BQZ A;  2DJN A;  2W48 A;  2ME0 A;  4UUS B;  2JK3 A;  4M3E A;  2WV1 A;  3HOZ J;  3M4O J;  4V2G A;  4MLO A;  4A3D J;  2O7O A;  2GBY A;  2HQ5 A;  3PM1 A;  4RDU A;  1AHD P;  1JT6 A;  2IBD A;  3NAU A;  1MSF C;  1LE8 A;  1JKQ C;  4MFE A;  1QPI A;  4CYC A;  2XPV A;  5K7F A;  1U9O A;  2GM4 A;  2LP0 A;  1UG2 A;  5FKO A;  4IHX A;  1JKR C;  1MSE C;  4B1R A;  1H88 C;  3BR3 A;  5FKN A;  3LSR A;  2ECB A;  2XPW A;  2ME6 A;  3IV5 A;  3H0G J;  2XPU A;  1TWF J;  2CJJ A;  1T33 A;  1S7E A;  2FJ1 A;  2N8G A;  4A3C J;  3CCY A;  1I6H J;  1G2H A;  3S2H J;  1RPW A;  1YRN B;  4NDL A;  3CMY A;  3K2A A;  1QRY A;  1ETK A;  1FTT A;  3GTL J;  1OCP A;  1TC3 C;  4FE4 A;  2EH3 A;  2MGQ A;  1X58 A;  2R5Z B;  4JX5 A;  3HM5 A;  4DYR A;  4M3F A;  5E3L A;  2EZL A;  3BR5 A;  1B72 A;  3C2B A;  3GTP J;  2DMP A;  1ENH A;  2Y30 A;  3L1P A;  3BR2 A;  3K7A J;  5EDN A;  3HOU J;  3QPS A;  3ZOB A;  2VUM J;  3TW6 A;  3G1M A;  1P7I A;  4V2F A;  2R0Q C;  1EF4 A;  2LKX A;  3E7L A;  1RKT A;  1WCM J;  3ZQI A;  5F04 A;  4G12 A;  1ETO A;  2EZH A;  1FJL A;  2VKE A;  2XB5 A;  1FIA A;  3S16 J;  3ZQF A;  1FEX A;  1K83 J;  4BKX A;  2WB1 N;  5F1J A;  4BBS J;  1WGX A;  3HOV J;  4IEJ A;  3S1R J;  3RQI A;  1U78 A;  2ID6 A;  1APL C;  3GTJ J;  3TED A;  1GT0 C;  1CQT A;  1DU6 A;  4IHW A;  5EZG A;  3WHB A;  2DMT A;  2R93 J;  3UKG A;  3PO2 J;  3B6C A;  1MBJ A;  2VKV A;  1JTY A;  5F0C A;  4BY1 J;  3FKI J;  1RES A;  2L7F P;  2MG4 A;  1BA5 A;  3Q0V A;  3JRA A;  4GFB A;  5C4X J;  1IDY A;  1GVD A;  2DMQ A;  3LOC A;  4W1U A;  1JUP A;  2AO9 A;  2M34 A;  3ZQH A;  1HF0 A;  2CU7 A;  4BY7 J;  4XK4 A;  5J3L A;  1JKP C;  3TW7 A;  3BT9 A;  5FLM J;  2ECC A;  1B8I A;  1BW5 A;  1MBE A;  3SJM A;  3HOW J;  2NS8 A;  1VND A;  1GDT A;  1VF9 A;  1POG A;  2HXI A;  1HDD C;  2O9L A;  1ETX A;  2HI3 A;  2LVS A;  2JWT A;  4ABZ A;  2LR8 A;  4IHY A;  1Y1W J;  4DYC A;  2QCO A;  2XSD C;  4RBO A;  1U9N A;  3OSG A;  2XB0 X;  5C44 J;  2Y31 A;  3FK6 A;  2EQR A;  4JP0 A;  1HDP A;  1ZKG A;  2LLK A;  3M3Y J;  4M6V A;  2CUE A;  2HOS A;  2XRL A;  3BG5 A;  3QPL A;  4LOC A;  2LY9 A;  3ZQL A;  1IC8 A;  1JTX A;  1MH4 A;  2XGE A;  3SDG A;  4A93 J;  5HOD A;  4IHV A;  3MKL A;  5FJ8 J;  1QVU A;  3HKZ N;  2DA5 A;  1RKW A;  3OOU A;  1MNM C;  2DA4 A;  1IRZ A;  2JN6 A;  4A3B J;  1P7J A;  5IP6 A;  4XRM A;  4C3I J;  3S1Q J;  1Z77 A;  5IP7 J;  3I4N J;  3MN2 A;  3JRE A;  5J1Y A;  1ZR4 A;  1HOM A;  3JRF A;  1TWC J;  1X2M A;  3RKQ A;  1UMQ A;  2L7Z A;  5J1R A;  4DZP A;  3HEF A;  4XRS G;  2Y2Z A;  2CRG A;  1A6I A;  3NAR A;  3D1N I;  1BL0 A;  2R5Y B;  1ZGW A;  2E2H J;  3BTI A;  1R9T J;  5E3M A;  3BTC A;  4DYQ A;  4XIC A;  4C3H J;  4DZJ A;  1JGG A;  3GTQ J;  3JRI A;  4B4C A;  3VPR A;  5C4J J;  5K7Z A;  2EZI A;  5JLX A;  5F27 A;  5EEA A;  4X6A J;  5EF6 A;  2H8R A;  5EZH A;  4CYC B;  3F0C A;  2HYJ A;  3A03 A;  1E3O C;  1IDZ A;  3HBL A;  1LE8 B;  2NVX J;  1H89 C;  3GBG A;  4Y52 J;  1W0U A;  1VFC A;  4Y7N J;  1ETW A;  4A69 C;  3LSJ A;  4D5C A;  5GPC A;  1FIP A;  3G1L A;  5DTD A;  4FIS A;  5EGO A;  5EG0 B;  2ID3 A;  4M3D A;  3A01 B;  2NVT J;  3S15 J;  1WI3 A;  5DS9 A;  2IAI A;  2NVY J;  1O4X A;  5IPA A;  3Q0U A;  3TP0 A;  4DW6 A;  2M0C A;  2DN0 A;  1ETV A;  3DCF A;  3HGG A;  3HB9 A;  1TWA J;  1H8A C;  3HDD A;  3ZQC A;  4S0H B;  3JRG A;  2LFB A;  2JA7 J;  3A01 A;  3GTM J;  5EGO B;  5EYR A;  2E2J J;  3HGY A;  3Q0W A;  3WHC A;  3BG9 A;  3IH3 A;  1Y1V J;  2ZB9 A;  2G0E A;  1OJL A;  2R92 J;  1U8B A;  4XRS A;  3HOX J;  2H1K A;  9ANT A;  1LFU P;  2TCT A;  4FE7 A;  2B63 J;  2DMN A;  1ETY A;  1LFB A;  1W0T A;  2L9R A;  4QTR A;  2Y9Z A;  2DA7 A;  4AYB N;  2YS9 A;  2M2E A;  4MO7 A;  2RAE A;  3JRD A;  2LK2 A;  3BQY A;  4HNV A;  2R7Z J;  3G1O A;  1BJZ A;  2R5Y A;  5E3N A;  2KT0 A;  1MBH A;  1RET A;  2K9S A;  5C3E J;  2I10 A;  2P81 A;  5M3F J;  2TRT A;  3LSG A;  1WPK A;  2K40 A;  1OFC X;  3W6V A;  1GV5 A;  1AKH A;  4C2M J;  1GV2 A;  5JLW A;  3H3V K;  3GTO J;  1WH5 A;  3S1N J;  3FIS A;  5GPA A;  4AUX A;  1TWG J;  2KDZ A;  1K61 A;  2OPT A;  1IV6 A;  2L0K A;  3DEW A;  5IYB J;  2JJ7 A;  2AHQ A;  2PMZ N;  5J1U A;  1PUF B;  5M5Y J;  2WAQ N;  2EBI A;  4B3A A;  5M3M J;  1OCT C;  4MFD A;  1I50 J;  5GP9 A;  5F08 A;  4L5E A;  2QF7 A;  1XC5 A;  5M5W J;  1Q1V A;  2MW8 A;  3OSF A;  4C3J J;  1RR7 A;  2DA2 A;  4A3L J;  2M8G X;  3BG3 A;  3SFI A;  5FLV A;  1SFO J;  3IH4 A;  5FKK A;  2ELK A;  4UUT A;  2L7M P;  5FKL A;  3OIO A;  5IP9 J;  1JUM A;  2DA3 A;  2X9D A;  2YUS A;  4A3E J;  1JJ6 C;  1NK2 P;  2D5V A;  3Q3S A;  2M9H A;  5M5X J;  1ZQ3 P;  1ETQ A;  2CQX A;  1D5Y A;  2K9N A;  4M3B A;  1NK3 P;  2FQ4 A;  4A3M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...