1UG2A

Solution structure of mouse hypothetical gene (2610100b20rik) product homologous to myb dna-binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
GPSGSSGAGALPKASEATVCANNSKVSSTGEKVVLWTREADRVILTMCQEQGAQPHTFSVISQQLGNKTPVEVSHRFRELMQLFHTACESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2610100B20Rik gene product
publication title Solution Structure of Mouse Hypothetical Gene (2610100B20Rik) Product Homologous to Myb DNA-binding Domain
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ug2A01
4S0HB 4M3GA 2M8GX 3GTGJ 4BBSJ 1GV2A 1HCRA 2O8KA 1IRZA 4Y52J 4QIWN 5C4XJ 3GBGA 3NARA 3LNQA 4M3FA 2VI6A 3C2BA 4Y7NJ 2DA4A 3IH3A 3K2AA 4XICA 1EF4A 3BG9A 4G12A 1HDDC 5FJ8J 5IP7J 1ETXA 3S2HJ 2OPTA 2DN0A 3JRCA 5IP6A 3HDDA 4A3EJ 3JRDA 3FK7A 3BTCA 3Q3SA 3A01A 1LE8A 2X6OA 1LE8B 1BL0A 2HYJA 2E2JJ 3BR5A 2JN6A 1UHSA 3GTJJ 3B6CA 1RETA 4D7MA 2HQ5A 1NTCA 2VKEA 5FKOA 2LR8A 4CYCA 3O8HA 4CYCB 3S14J 2DA3A 4M6VA 2ELKA 1VF9A 1RR7A 5IYBJ 1ZTRA 2ID6A 2B63J 1JUMA 4D7NA 2JA5J 1VNDA 2XPVA 4JP0A 4W97A 4A69C 2DJNA 2LTPA 2M34A 4XRSA 2H1KA 1WH7A 4D5FA 4DYCA 3TW6A 1WI3A 3PO2J 2CUFA 1SFOJ 2EQRA 1P7JA 2WV1A 4M3BA 2M0CA 3K7AJ 4BY1J 5EDNA 4J19A 3MKLA 2EH3A 1APLC 1ETQA 5C4JJ 1WPKA 4X6AJ 5FKMA 4B1RA 9ANTA 2LVSA 3G1MA 2CU7A 5IOYA 4M3EA 1LFUP 3RZOJ 3OSFA 1F36A 2XB5A 4IHYA 4M3DA 1MBHA 4EEFG 2WB1N 3O8GA 1AU7A 3ZQLA 4A3JJ 2CUEA 4XK4A 1U9NA 1DU6A 4XIDA 3HGYA 3BR3A 1MBKA 2CJJA 1T33A 2Y30A 2NVQJ 4A3FJ 2FX0A 1YRNA 3HM5A 1YRNB 2LKXA 3OSGA 1JTYA 1IDZA 1FIAA 5JLXA 1JUSA 1W0TA 2PMZN 2TRTA 3L1PA 5M3FJ 4BKXA 1CQTA 3FKIJ 1HLVA 5E3LA 2HDDA 2O7OA 3GTPJ 2H8RA 4IHXA 3JREA 3S1RJ 1GDTA 2JMWA 2ECCA 4RBOA 2K9QA 1WCMJ 2DA1A 2LY9A 3QPSA 3SDGA 1R9TJ 1HDPA 1HOMA 3S1NJ 1H88C 4JX6A 3HOYJ 3I4NJ 1TC3C 1MSFC 1Q1VA 1JKOC 1ETKA 3TEDA 2E1OA 3JRIA 2CRGA 5HODA 2ZB9A 3LOCA 2LFBA 5EEAA 5FKKA 4A3BJ 3HOUJ 2CQXA 2XGEA 2KDZA 1JGGA 1OCPA 2DA2A 4D5CA 3BR1A 1DU0A 2FJ1A 2NOGA 4MIMA 3LSGA 2MG4A 1ETVA 2DA7A 3BR6A 4L5EA 5E3NA 5M5WJ 3S1QJ 2MGQA 2ME0A 2VUMJ 3HEFA 3ZQCA 5J1RA 2HXOA 4C2MJ 2G0EA 4DZJA 1I3QJ 1QPIA 2CQQA 4C3HJ 3FK6A 2ID3A 2YU9J 1VI0A 1MBFA 4V2FA 3ZOBA 2QF7A 3MN2A 4DZPA 1W0UA 1BJZA 1O4XA 4AC0A 3VPRA 2R0QC 2HOSA 4QSHA 3GTOJ 3B6AA 2LK2A 4I76A 5IYDJ 3CQZJ 2O9LA 1ETWA 3G1OA 5J3LA 2XB0X 1OFCX 4UUTA 1JKQC 1BW6A 5EGOA 3ZQIA 1JJ6C 5EGOB 2EBIA 3ZQHA 3BTJA 3JRAA 1MH3A 1LFBA 3SFIA 5C3EJ 3WHBA 3DEWA 5DS9A 2RAEA 1MBEA 3I4MJ 5IPAA 2E2IJ 1IC8A 4BY7J 5DTDA 1ZKGA 1X2NA 2HOTA 3Q0WA 4MFDA 4AYBN 5GPCA 4JYKA 2OF7A 2N8GA 2HI3A 2DMPA 1ENHA 2IAIA 2XPWA 1H89C 1IV6A 3GTQJ 3IH2A 3SJMA 1MH4A 2LP0A 2NVTJ 3OOUA 3S2DJ 5F0HA 4V2GA 1ZK8A 1JKRC 4QTRA 5FKLA 3BQYA 1FEXA 4UUSA 2L7MP 5EF6A 3HOWJ 4UUSB 1QVTA 2R5YA 2DMTA 3F0CA 3JRHA 2R5YB 3PM1A 4MO7A 1JT0A 2X48A 3S17J 5GP9A 2R5ZA 1P7IA 3TP0A 2R5ZB 2E2HJ 1MBJA 2VKVA 4DYQA 4B4CA 3OIOA 2JA6J 2ECBA 2JA8J 3A02A 2K40A 1BA5A 4B3AA 1ORKA 3RZDJ 1FTZA 3NAUA 1ETYA 1H8AC 5F04A 2EZHA 3CDLA 2Y9ZA 1FIPA 4X1EA 1JKPC 3LSJA 4JX5A 3BTLA 2NVXJ 1QVUA 4A3DJ 2HOAA 1A6IA 3BTIA 5M5YJ 4A3CJ 4MLOA 1U8BA 1JUPA 2XSDC 1MSEC 2EZLA 1ZGWA 1U9OA 3HBLA 3ZQFA 5F1JA 2E19A 3JRBA 1UMQA 2JWTA 2IEKA 2NS8A 2IBDA 5BNGA 1NK3P 2Y0SN 5E3OA 1TWGJ 3BG5A 4NDLA 2KT0A 5F0CA 5J1YA 4GFBA 4RDUA 5E3MA 2AO9A 3HOXJ 1B72A 3JRFA 4FTHA 1B72B 3M4OJ 2LD5A 4A3GJ 2EZIA 3BT9A 1ZR2A 1E3OC 2I10A 1GV5A 4IHVA 1SANA 3S15J 2DMNA 2X9DA 2NVYJ 3HOZJ 1ZQ3P 1OJLA 4BXXJ 2Y31A 1PUFA 5C44J 1I50J 1PUFB 2W48A 4A3MJ 1IG7A 4A93J 1RKWA 2R7ZJ 4FE4A 3BG3A 5EG0A 2DMUA 1D5YA 1Z0XA 5EG0B 3G1LA 1XG1A 1FTTA 3A01B 3A03A 2AHQA 1RPWA 3E7LA 4DYRA 3GTKJ 1AHDP 3GTLJ 1MBGA 4C3JJ 1BW5A 1IJWC 1MNMC 4A3KJ 1XC5A 1Y1WJ 4JX4A 2EZKA 5FKNA 1XS9A 2DTZA 1RKTA 2D5VA 1POGA 5FLMJ 3PO3J 2NS7A 1IDYA 4XRMA 3MVPA 4AUXA 2LLKA 1FJLA 1QRYA 3TP3A 1TWCJ 3IV5A 1TWFJ 5F27A 3HGGA 3S1MJ 2VPRA 3D1NI 3QQAA 1Y1VJ 2ME6A 3W6VA 4IHWA 2YS9A 1RESA 2Y2ZA 2GM4A 1I6HJ 1NK2P 2GBYA 3RKQA 1JTXA 4HNVA 1G2HA 1UG2A 2QCOA 5FLVA 2K9NA 3DCFA 4XRSG 1TWAJ 3Q0VA 2L7ZA 1Z77A 2XPUA 3CCYA 5F0FA 4A3IJ 4BBRJ 2R93J 5EZHA 2M2EA 2R92J 3BR2A 4IEJA 1K83J 2JJ7A 3Q0UA 2Y9YA 1IGNA 3QPLA 2HXIA 2L7FP 1AKHA 4W1UA 1AKHB 4FE7A 2JK3A 4MFEA 2MW8A 1ITYA 1ZR4A 2WAQN 1GT0C 2TCTA 3H3VK 1TWHJ 3BR0A 5IYCJ 5J1UA 5IP9J 3TW7A 1F43A 1WH5A 1GVDA 1X58A 2M9HA 3JR9A 3UKGA 4ABZA 3LSPA 3LSRA 2XGDA 1GUUA 1U78A 1X2MA 1B8IA 3CMYA 1JT6A 1B8IB 4I6ZA 5EYRA 5GPAA 2MSYA 3WHCA 2GLOA 3GTMJ 2JA7J 2P81A 3M3YJ 3S16J 3BQZA 5F08A 3ZQGA 1JJ8C 5IOZA 3HKZN 2XGCA 3JRGA 4DW6A 5JLWA 2DA5A 1IUFA 5M5XJ 2K9SA 2YUSA 1HF0A 4A3LJ 3H0GJ 3RQIA 2FQ4A 5K7ZA 5K7FA 2XRLA 1VFCA 4C3IJ 4LOCA 5EZGA 1T56A 1WGXA 3FISA 1S7EA 2L0KA 3FIWA 2COBA 2DMQA 1K61A 3HOVJ 2DA6A 1OCTC 4FISA 5K7HA 2FD5A 4FCYA 5M3MJ 3IH4A 3HB9A 1A5JA 2L9RA 1ETOA
chains in the Genus database with same CATH superfamily
2M8GX 4A12A 4QWQA 1MIJA 3Q9VA 1FOXA 4NC7A 3IAS2 1MKMA 2F4IA 3CUOA 5LLQA 3DWLE 2QGUA 5C4XJ 1HKSA 2FMLA 2LYCA 3NARA 2QA4I 3LNQA 3OS0A 2L7KA 1XDSA 3K2AA 4V19K 2MH2A 5HLIA 3K1PA 4H0EA 4PDKA 2W00A 2XF7A 4E7KA 2QVOA 2OPTA 2DN0A 2FXAA 3JRCA 3HDDA 2BY2A 1DPUA 4A3EJ 3N4MA 4ESBA 4KIBA 3FK7A 1ZYRF 2ZFUA 3DKYA 5EEHA 1LKXA 2DK8A 2BBYA 1XTAA 2HYJA 1QZEA 1SEUA 3T8TA 1VQNI 1KQ8A 1V3FA 3RPQA 3FX3A 3ROUA 1BC7C 5D5WB 2HDCA 4M6VA 4FX4A 1VF9A 3SQNA 1R1UA 2EV0A 2YX4A 1D5VA 2DCEA 4OINF 1BR2A 3N05A 2B63J 3M1EA 5GTHC 4HV5A 2JA5J 2XPVA 1IXSB 1D0ZA 4KMFA 2PX9A 2DJNA 5B1AH 2VBYA 4I01A 2LDUA 4DGWB 1V5EA 2V6EA 2NRAC 2XVCA 1HW5A 1Y6IA 3I59B 4FT8A 2HTJA 5GTIC 4WX9A 2KPMA 1USSA 3PO2J 2VONA 1Z21A 2O8XA 5EDNA 4BY1J 3OYLA 4Y33A 2VQLA 2XKOA 2E1MC 2V26A 2QSGX 3FWEA 5DUKA 5GAGJ 5J8CA 1ZELA 4M6YA 1F5TA 1MMDA 2CQKA 1D0YA 5IOYA 2ZCWA 2R7VA 3S3MA 3RZOJ 1U2WA 3ZMVA 4LG0B 4I2OA 1BI2A 4IHYA 5E1ZB 1ZG5A 1V4RA 1TLHB 3ZQLA 2DFEA 4G7OF 5CQGA 2E7WA 2Z33A 1U9NA 4EV0A 1DU6A 2IS2A 4MNUA 3DPTA 3BR3A 2EPFA 1T33A 1FT9A 2X1EA 3P9CA 4CHUA 2R4GA 3I53A 1YRNA 3HM5A 4KT5C 3BJOA 2L01A 3KZIC 2XAHA 3VSKA 3ZMTA 2LKXA 2HPIA 1IDZA 1ZGJA 2DT6A 2DI3A 1FIAA 2Z1DA 3H1CA 5JLXA 4Y3OA 1W0TA 5M3FJ 4O6JA 3DLAA 3FKIJ 3FBNB 2BW3B 2XDVA 3ECHA 4HBLA 3E5QA 2GOXB 2O7OA 4LJZF 2G7HA 3K69A 3JREA 3S1RJ 5IT9Z 3CUQB 1WCMJ 3ZMZA 2YSRA 2DA1A 2LY1A 3K10A 5B3SH 2J5OA 2L5QA 1VQ5I 4FHTA 1HDPA 1R9TJ 4MTDA 1H9GA 4OMZA 3WTTC 3RI4A 1TC3C 1R71A 3WU0A 4IKFA 4X0GA 3FHNA 2A05A 1TQPA 1T08B 1E3HA 4OMYA 2RGVA 2ZB9A 2LFBA 3Q9SA 4A3BJ 1QGPA 3CCQI 4CUGA 1ACIA 1JGGA 1XMAA 1OCPA 1MMAA 4D5CA 1B1BA 5CVRA 3TQNA 3LSIA 2DA7A 1KONA 4OAZA 3S1QJ 1FYLA 3WTXC 4EM1A 5CVJA 3HEFA 4HX7A 4CCMA 3HZJA 3ZQCA 3DFGA 1X4PA 3ECOA 3I64A 1VZ0A 3F8CA 3OYEA 3E3VA 2HQNA 1QPIA 4FETA 2DFIA 2CQQA 4ESFA 2LREA 3FK6A 3FM3A 4M73A 2XROA 1MBFA 3BLYA 2F2EA 2HNHA 5J6XA 4EJVA 1BJZA 2K02A 2RV8A 4B47A 2DTRA 1O4XA 1TZLA 3GTOJ 3B6AA 2LK2A 3J7AO 1G3YA 2PJRA 1ETWA 5J3LA 4C9YA 4CZCA 4E7SA 1MNDA 5D4SA 1BW6A 3GFMA 3AG4H 3DXJF 2BV6A 5EGOB 3CDHA 1BC8C 1ERDA 2EBIA 3O6BB 5TGTA 3JRAA 4XL9A 4KUMA 2Y75A 1G6NA 1W7PA 2DFHA 3DEWA 4GO1A 1PDNC 4L0ZB 5DS9A 3L2UA 1UB9A 1TTYA 2E2IJ 3S32A 3LA7A 1IC8A 2XKPA 1G3SA 2MLKA 3J80Z 1ZKGA 1FMVA 4KA4A 2FNAA 3Q0WA 2Y0SA 1ZREA 2IAIA 3R0AA 4O3MA 2DO7A 1VQKI 1X1PA 1R4NB 2CSOA 3IUOA 2ZFWA 1W5CC 3TOBA 1IN8A 3S2DJ 1O7FA 1VQPI 2LKSA 1JKRC 4QTRA 4AIJA 3BQYA 5LHHA 1FEXA 4HG2A 3HOWJ 4M9XA 4MQ9F 4U87A 1SFKA 2UZKA 1QVTA 3F0CA 4ON0A 2XIGA 3JRHA 2R5YB 3PM1A 2V9KA 2YPRA 3K1NA 5GP9A 4CCNA 1P7IA 4GXOA 3TP0A 1OYWA 2E2HJ 1LDJA 2PLYA 4B4CA 1OCOH 3KP2A 1SVLA 2EINH 4UY8I 4EGZA 3K4MA 2Y48A 2DODA 1ZH5A 2K4BA 4WF2A 1JXSA 1ORKA 3TMOA 2QYOA 4CH7A 2EV6A 3OS1A 2DOAA 4EGYA 1LFPA 2Y9ZA 5F64A 1W4MA 1JKPC 1BI3A 2E35A 4ANJA 2QQ8A 3S2WA 1MMSA 3NQOA 4JX5A 3HOTA 1FNNA 3BTLA 4ZJZA 1HW2A 3SFZA 3ZP5A 2HOAA 1YHQI 3CTAA 2OCCH 1XCVA 3CP8A 4IX7A 1FY7A 1U8BA 2QZ8A 4B3XA 1WWXA 1C0WA 1MW7A 2CG4A 1X4OA 1U9OA 2ZJQF 3ZQFA 1G3WA 2P6SA 2KRFA 3FXKA 1UMQA 4Y4RA 4AYBA 4PJMA 5L3CA 2A07F 2JQ7A 3C3WA 4CSWA 5L3FA 3CLOA 1WKMA 2EFOA 3RKXA 1NK3P 2Y0SN 3KPHA 4NB5A 2WTEA 3E5UA 3GX4X 2IA1A 2KT0A 2X85A 5F0CA 4U0WA 2XGXA 3JSPA 2VE8A 3HRSA 3CF5F 3OYMA 2IGNA 2QKLB 1ZRFA 2LD5A 1DGWY 2EZIA 2LF8A 3PFYA 1ZR2A 4I02A 4M9SA 5E1WA 1VQ9I 5DCMA 2D2WA 3S15J 1SD5A 1WQ2A 5FGMA 2NVYJ 1BR4A 4MHGA 1FSEA 2Y31A 3FKJA 1PUFA 3LSHA 3WG9A 1O3RA 4OIPF 4NBQA 2GXBA 1ZRDA 4FE4A 3QRFF 1D5YA 1Z0XA 2LSOA 4JOMA 3G1LA 1BM9A 2DOFA 4I7HA 4IJAA 1DP3A 3JAMZ 3H3ZA 5H6RA 4ZDPA 1RPWA 2L54A 2IGMA 4DYRA 2KIUA 4UB6C 1AHDP 3I9V2 4QPOA 4C3JJ 2W4SA 1IJWC 3TO9A 2ZKZA 2DQRA 1XC5A 1Y1WJ 3HTSB 2OTJI 3ASNH 5FKNA 1YS6A 4U0YA 5DDGA 3BPVA 5CQEA 3P9KA 1YITI 3HKZA 4Z2YA 2W84A 5FLMJ 3PO3J 2NS7A 1IDYA 2ADUA 2QKMB 2OCEA 3FXJA 5B66C 1FJLA 2A68F 2CUJA 2DFFA 3HGGA 3VOEA 4L0YB 3ISPA 2DYSH 3QQAA 4N4OB 1Y1VJ 2CWEA 3F8BA 5JVTA 1I5ZA 2XUBA 3W6VA 4IHWA 3WTUC 2CUZA 2YS9A 3V7CA 1R58A 3G73A 1I6HJ 4YIFA 4HNVA 2LOOA 3WTSC 1T95A 2GOMA 2QCOA 5FLVA 3PJRA 2DYRH 4P9UA 1TNTA 4BS9A 1YJNI 4XRSG 3NRVA 3LSKA 1SD4A 3Q0VA 5F0FA 1Z77A 2R93J 4H4KC 4IRIA 5ILVA 3ZMUA 2K7LA 1JI8A 2FBIA 2X51A 2ZMEC 2R92J 2X6YA 1W36D 4IEJA 1VQ7I 4KDPA 2DBBA 2JJ7A 1Z05A 1P6RA 3QPTA 2LBFA 1HBXG 2L7FP 4RGXA 1SC7A 4HAMA 3ZMDA 5IYCJ 5J1UA 5IP9J 5KHDA 4E7JA 4A0ZA 1F43A 2M30A 5DYMA 1GVDA 4WK8F 2EFNA 3JR9A 1T6SA 1B4AA 1MJAA 1PP7U 3P9IA 5EYRA 2MSYA 3WHCA 2V1NA 2BGCA 3M3YJ 2HQAA 5B5EC 2F5DA 3HKZN 4LB6B 4OU0A 4DW6A 3SEQA 1F4KA 5M5XJ 1X3WB 1HF0A 3TDUC 4LK1F 3MKZA 4HOBA 3W6KB 3H0GJ 4PK4A 4B48A 3IWZA 4RAGA 3RQIA 1FC3A 5K7ZA 2EFPA 2XRLA 5EZGA 1Z3XA 1RI7A 3FISA 2L0KA 2IXSA 3CDIA 3C18A 2NVUB 5D4RA 4GCVA 1OCTC 4GRIA 2JPBA 5LFAA 4FISA 2ETHA 4CCKA 1YW7A 5M3MJ 1B59A 3IH4A 3WTVC 2LRDA 1ETOA 4S0HB 4BBSJ 2DT5A 3K4JA 2O8KA 3OYCA 1IRZA 2KJBA 3J7ZI 4E70A 1R4MB 4BEHB 4QIWN 1RNLA 4I0BA 4I98B 4BGDA 3HSRA 1U5TB 5D8KB 4NNJA 3C2BA 1ON1A 3OYNA 4BJ5C 2V1UA 1V5GA 3IH3A 3ABUA 2KFDA 2HWVA 4XICA 3CMEI 4Y15A 5K5QA 4G7HF 1HDDC 5FJ8J 2VQCA 3C2GA 3LL7A 2E1MB 4F7ZA 2A61A 3U2RA 2IVMA 1SVOA 4L9JA 1SAXA 1Z3YA 2V9VA 3Q3SA 3A01A 4IOAF 2HFHA 1BL0A 1XGOA 3BC8A 4DJAA 3CMAI 3VWBA 4D9JA 3QWLA 2ISZA 1A35A 2JN6A 3GTJJ 5E79C 3F23A 1RETA 3TDZC 1N25A 2HQ5A 4L18B 3FXQA 1OCRH 3K4CA 1AWCA 1NTCA 4M72A 2A6TA 1IUYA 2QM3A 2F5VA 3QP5A 2LR8A 4ZZLA 3MEXA 4JK1X 2MA3A 3S14J 3J7YJ 1W7PD 2DA3A 2UWMA 2ELKA 1J5YA 1AA7A 2QENA 5CPRB 5IYBJ 1ZTRA 2DXIA 2VC1A 1QBJA 4L5IA 1F9NA 3IWFA 4HF2A 1JUMA 4CCJA 4L9NA 4S04A 4JP0A 1ONVA 3OOPA 1U6GA 2VBXA 3WGIA 1MD0A 4A69C 4U88A 3M8EA 4EM2A 1SMYF 4ZTJA 3HRMA 3PSFA 5HVQC 1YI2I 3I59A 4UVAA 2KRCA 1QPMA 5E17F 4DYCA 1FPQA 1B9NA 1Z9CA 3AL0C 1WI3A 2F5FA 3FMRA 4XLEA 1P7JA 1XB4A 2M0CA 2L9NA 1QO0D 4PJLA 2RN7A 4HQEA 2MYSA 2HDWA 2BY3A 5CYVA 4P55A 3H3UA 2VOPA 1WPKA 1XD7A 4HLYA 4B1RA 1ULYA 4IQ4A 2VT3A 1QZZA 1WHUA 3G1MA 4AVZA 5FD6A 4M3EA 4LG0A 1HA8A 1P92A 3DEEA 1I1GA 1WJ5A 2XB5A 2VBZA 2VKHA 1MBHA 4EEFG 3H35A 2ELJA 3KLOA 3K2ZA 5LEKA 4L9TA 3F6VA 1R36A 3F8NA 2YX7A 4KISA 2E60A 4RB1A 1ZN2A 5E8IA 3IRQA 1MJ9A 2CJJA 1O7LA 2DAOA 2Y30A 3FF5A 3K9TA 2OUMA 4DBRA 2EFWA 3Q5FA 2FX0A 1IRGA 5ILSA 2WY8Q 1K78B 3EUHC 1YOVB 3D0SA 1SFUA 4RGRA 1WRJA 3GMEA 3RIRA 3KE2A 1A31A 2BW3A 3COAC 2R7FA 3ZGKA 2CQNA 4HX8A 5GADJ 4D1QA 3A0BC 2HTSA 2EWNA 2L3DA 3GTPJ 2H8RA 4KN4X 3CUQA 3K4BA 2E7XA 3BG6A 2JMWA 2ECCA 1D1CA 2K9QA 4YFKF 3L09A 2B0LA 2LY9A 1KQ0A 4I0AA 5KK1A 1Y8RB 2JSPA 1HOMA 3S1NJ 2HU9A 3AG1H 4JX6A 5D5XB 4HZFA 2BHZA 2A5YB 2GXAA 2FRHA 2FE3A 4HW0A 4IRHA 4OIOF 3JRIA 1CF7B 3H92A 2CRGA 2ZBKA 3OS2A 4AIHA 2EIMH 5KAIC 2GIZA 3MFKA 1FBQA 3LSTA 4XRFA 2CS3A 3DV8A 1ZAOA 3PQJA 5CJ9A 4BQQA 2HVRA 5FO5A 2BOLA 5ED4A 2Z9OA 3RDIA 4ZDOA 4HA8A 2FJ1A 4ZYEA 2MG4A 2NYXA 5M5WJ 2QLZA 2MBFA 4ZTFA 2HXOA 3TKYA 3R6SA 2G0EA 4OAYA 3IL2A 3LMMA 1HXDA 3VYRB 3K70C 3KLNA 3BROA 2PBIA 2JPCA 4C3HJ 4F3QA 4V2FA 2M3AA 3ZOBA 1WZ2A 4Y17A 3MN2A 3U1DA 1W0UA 3GFJA 3KP4A 3ASOH 4ZDLA 2H6BA 2R0QC 4QSHA 3VSLA 2HOSA 1I1SA 1B6AA 5EJCA 5LRSA 4I76A 3KETA 2H94A 5L3GA 1WSUA 3CQZJ 1WJCA 2O9LA 1J59A 1ZLKA 4HSRA 1QNTA 2XB0X 1I3AA 3IP4B 1H0MA 2QBYA 3E6MA 5EGOA 5FLXK 2M8EA 3U9GA 3VDXA 1JJ6C 3CESA 3W2WA 2H09A 1ZRCA 2K4JA 3QAHA 1MH3A 3PQKA 1I39A 2R7DA 2OBPA 2RAEA 4IPAA 1MBEA 3I4MJ 2HKXA 3GZ5A 4LLLA 2LC2A 2JZYA 4XLPF 3OMYA 3JTHA 5J4VA 4IZZA 2OTLI 6PAXA 4MFDA 5J4YA 2RC4A 1NHAA 2HI3A 1S7OA 4KNYA 2XPWA 3D5LA 4HNUA 2LKPA 1MH4A 2NVTJ 2Q1ZB 4IF4A 3QOPA 4UV9A 1DP7P 1JHHA 1SVMA 4MTEA 4XORA 2COMA 2XF6A 5EF6A 1YW9A 4G94A 3CD6I 5DCFA 4CCLA 3RYRA 2DPDA 4WXHA 3CCEI 2R5YA 2VB6A 5FRNA 2O0YA 5AIQA 1I27A 1JT0A 1UAAA 1YIOA 3CF2A 2WBMA 2PJPA 2R5ZB 4IHSA 1J9IA 2HZTA 4DYQA 3OL4A 4KT6A 1SMTA 2Q8KA 1G8XA 1T39A 2ACJA 4KN7X 2IGOA 2VIXA 1R00A 2ECBA 3CCSI 2STTA 2ELHA 1BA5A 2UUZA 4RM2A 1SD6A 2ZC2A 2GXGA 3MZHA 2C6YA 1LEAA 1ETYA 2P4WA 4HLXA 3L2RA 3CDLA 3I3LA 3V7RA 4BHPA 3HHGA 2L4MA 4U0VA 5FFZA 4RB2C 2P5LC 5DD8A 2Z5UA 2NVXJ 1USTA 3JCUC 4XLNF 2F4MB 2KZGA 2F4OB 4L9VA 1MSEC 3BOQA 3HBLA 2VN2A 1DDNA 3WGHA 1LVAA 2JWTA 1R23A 1D1BA 5LHGA 2VC0A 2IJLA 4HF0A 2VXDA 1TWGJ 5J40A 4HYEA 1V54H 2XASA 4PZJA 3K4KA 2VOOA 2KJCA 3PNTA 1R6RA 3OIQA 4XLFA 4AM3A 1YW8A 2V7FA 3PNYA 5J47A 3JRFA 3KEYA 1B72B 3OYKA 3QP6A 4A6EA 3ERMA 3BT9A 1OR7A 2ISYA 3NWSA 3OYDA 2PI0A 2H8WA 4A0YA 1KQ9A 3AKZA 2PMHA 3C1DA 1UFMA 3MKYB 2ZNYA 2JTVA 2XF5A 3KX2A 1RUOA 1ZQ3P 1OJLA 1BI0A 1YIJI 5C44J 3VFZA 1I50J 1QA6A 2FF4A 3EPZA 1MZBA 2BXZA 4PJ0C 2WAQA 2CW7A 2ZMEB 1YQAA 1GXQA 3H5RA 1ZGAA 2AHQA 2IS4A 3H9GA 2KKOA 3E7LA 4CICA 1Z1DA 3OV8A 3GTKJ 1IAWA 3GTLJ 1BW5A 2V1XA 3LQRA 2DPUA 4NUBA 2W82A 2WC2A 2JUCA 4G8XA 2VJ5A 5HOOA 2EZKA 3KP3A 1XS9A 2DTZA 3B73A 3VB2A 1ZARA 3FZVA 3SEZA 1POGA 4G7ZF 2HR3A 5LRRA 1EV7A 2A5WA 3AAFA 3MVPA 4AUXA 2LLKA 1RUNA 1KU3A 1QRYA 4XKCA 3TP3A 2IRFG 1TWCJ 3IV5A 5F27A 2W25A 1TQMA 2FA5A 2NOJB 3D1NI 1HKQA 1T0FC 1QQIA 3HRUA 2JUGA 5D5VB 2Y2ZA 4A2UA 4Y13A 2A6EF 2OQRA 2Z3YA 2GBYA 3GW2A 1JTXA 1UG2A 4LD5A 1S3JA 3H9QA 1VQ8I 1T8IA 3DCFA 2QWWA 3BCAA 3GLXA 2PN6A 3CCYA 4BE1A 4BBRJ 5DEQA 1G59A 4BXFA 1FOYA 3DEUA 2JVHA 2JRMA 2Q2EB 1TBXA 4LLGF 1DPRA 3SZGA 3GFLA 4XNFA 3H36A 5FB2A 1R5GA 2VODA 4PGHA 4IO9F 2VE9A 3N97A 2VPLA 2V6CA 4IL6C 2XC7A 2JK3A 3DF8A 1YX3A 3REOA 1ZR4A 2WAQN 3TO7A 1GT0C 3GYHX 1STZA 4XR6A 3GWZA 4BQAA 4L5JA 5EEGA 3TW7A 4AD9A 4BU2A 3OYGA 1X58A 1XN7A 4U7DA 1D8KA 3UKGA 2OA4A 1U78A 3ZMSA 1X2MA 4KIFA 3CMYA 4E7LA 2AXLA 2G9WA 2Z99A 1B8IB 2FQ3A 4I6ZA 4M71A 3GTMJ 2P81A 3S16J 3GLLA 1KGSA 4GYGA 1QHHD 3ZQGA 1R7JA 2NNYA 4J00A 1VQOI 1MMGA 2XGCA 3JRGA 1IUFA 2DJIA 4IQJA 2K9MA 3DTIA 3D5SC 3PFIA 5IY5H 2X0LA 2MH9A 3K0LA 1MNEA 2XHKA 3F21A 2FQ4A 5K7FA 4LOCA 4BYYA 2XV4S 2M1BA 2UXNA 1E0EA 1E3PA 2VLAA 3DBLB 2DA6A 2E5NA 3HB9A 3UR3C 2KMUA 1O3QA 1GXPA 2DOEA 3GTGJ 1DGRM 1XCBA 3EDPA 4BEHA 1U5TA 3K1MA 3AL0B 2BY0A 5L3EA 2VI6A 4UVBA 4Y7NJ 2DA4A 4XBFA 1EF4A 3G2BA 1UG0A 5IP7J 4BE0A 1A04A 1FOWA 3BCBA 3S2HJ 3HL2A 5IP6A 3RSNA 1HC8A 2CGPA 3BTCA 3ABKH 3QYEA 2X6OA 4K2EA 1LE8B 3EYIA 4YIIA 2RDPA 2BEOA 2D1HA 2E2JJ 4B44A 3BR5A 1UHSA 3B6CA 2KRHA 2M87A 4XKWA 4D7MA 3CCLI 1XPXA 2NNNA 3C2HA 2VKEA 5FKOA 2OQGA 4CYCB 2IPQX 1W1WE 2DDBA 3CO6C 1EKEA 4KIGA 1UHWA 2CW8A 4EQQA 3FMQA 3KP7A 4A6DA 1Z6TA 1EH7A 1V5FA 4D7NA 1K79A 1VNDA 3I71A 4BHBA 4EATA 1X1BA 1M1EB 3WU1B 2LTPA 1TW3A 4Q5SF 1ON2A 2DK5A 2W57A 5JR3A 4HF1A 2M34A 1GHCA 4EM0B 4C2TA 1WH7A 5BPIA 3BZ6A 3FXUA 3V4GA 2HEOA 2WWYA 1E17A 2Y69H 2Y0MA 4N4NB 1SFOJ 2EQRA 2WV1A 3K7AJ 3TOAA 3SYTA 5F6FA 4PSWA 4J19A 3MKLA 2EH3A 1NH3A 2OC6A 2HQRA 3LA3A 4XSXF 2ZXHA 3T0YA 3BP8A 5HS7A 3PUBA 3R61A 3PIPF 3FBIB 2LVSA 2RNJA 3CJRB 2CU7A 2M7BA 2A6HF 1LFUP 2GA1A 3OSFA 1ODDA 1XSVA 4EJUA 3LWFA 1AU7A 1YFHA 1G4DA 2E71A 4XK4A 1HKTA 1Y0NA 3CZ6A 5HDGA 1EA3A 5KCMA 4XIDA 3LQQA 1N78A 3MAJA 4P9FA 1ZHFA 4WWCA 3DKWA 1PYVA 1MJBA 1A6QA 1KYWA 4A3FJ 4UV8A 4Q47A 3OSGA 1JTYA 2M4KA 1K78A 2WADA 2PQ8A 2MC3A 1JUSA 3L1PA 3DPUA 5J8FA 4BKXA 2QQ9A 3TBIA 5E3LA 1FOKA 4LB5A 3DBHB 2V1DA 2VQHA 4LIUA 1XMXA 2UXXA 3V7SA 5JVGF 2LNBA 5ICEA 1KA8A 1GDTA 4RBOA 1WVRA 3HUGB 2VL8A 3R60A 4M6XA 2EK5A 3SDGA 1SD7A 4CO8A 2X1DA 4BNCA 2LY2A 2OV7A 5CVVA 4BXUA 3I4NJ 1MSFC 2YU3A 1IXCA 3IKVA 1CF7A 1JKOC 1ETKA 4BDYA 2MABA 3T8RA 3L2WA 1I6XA 1FWZA 1RZ4A 5E1XA 1T2KA 4KYWA 2XGEA 1VQ4I 2OAZA 1YO5C 1UELB 3ZN1A 1XDUA 2W24A 2VASA 3BR1A 3ONQA 1IN4A 3LSMA 2NOGA 3M8FA 4MIMA 3LSGA 3J81K 2CH0A 3PSIA 4II3A 1PUEE 1ETVA 1TNSA 3BR6A 3MZYA 4L5EA 1A36A 2MGQA 1Z91A 2ME0A 3R0JA 3RQ4A 1W36C 1YE9A 3HC7A 1FP2A 2VUMJ 2JA2A 3KZYA 2EFQA 3IRRA 4G6QA 2I5UA 3E6DA 5LHIA 2R7RA 2NAZA 4DZJA 4CCOA 2X4HA 4F93B 2R7OA 4A0XA 1YLFA 2ZO4A 2ID3A 4P1WA 1N75A 2O03A 2QF7A 3I54A 1T98A 3LFUA 4YG2F 1JE8A 3VPRA 1U8RA 1REPC 1KU2A 4C30A 3VYSB 2H1LA 1IN7A 1WJFA 2R7SA 1AOYA 3KYLA 2E1CA 3G1OA 2MD5A 3HG9A 1OFCX 2G7UA 1KU9A 1XGSA 2RKHA 3HYIA 1J0RA 4G9YA 2CYYA 2GZWA 4LFUA 5BMZA 3BTJA 1OCCH 1LFBA 3L2CA 1PVEA 4RAZA 3KCCA 3WHBA 3W3CA 3OYFA 1MDMB 3I5UA 4HV6A 2PMUA 5HNFA 2K5CA 3C7JA 1FLIA 4UB8C 4BDZA 1CGPA 2ZSIB 4BJTA 4BY7J 2BHYA 3QYFA 2GQQA 3ELKA 1X2NA 4ZYGA 1R1VA 3F9KA 4JYKA 2OF7A 2N8GA 2DMPA 1OR7C 1ENHA 1H89C 4ENMA 2LMDA 3IH2A 1LNWA 4A5NA 3SJMA 2W7NA 3V8LA 5F0HA 4RA2A 2BY1A 4V2GA 1LVKA 3OR1C 5FKLA 3VYTB 2L7MP 3NEUA 4DOZA 1UZCA 3D5RC 4UUSB 2FUG2 2NXNB 1DQUA 1TL8A 3KEQA 1S8NA 4MO7A 1LB2A 3RCOA 2X48A 3S17J 2IS1A 1RC9A 3LFKA 2R5ZA 1BJAA 3QU6A 3F72A 1E2XA 5FLXZ 2HPMA 1MBJA 2R3SA 2FMYA 4NHJA 3OIOA 1FSHA 4BQNA 2JT1A 3F8MA 1U0JA 5TJJA 1T38A 2QSHX 2JA6J 5L3DA 1FBSA 3RPUD 2K40A 3BJ6A 3FMSA 1O3TA 3K4NA 4RAFA 5L3BA 1YG2A 3CO7C 3RZDJ 1R49A 2BVLA 3NAUA 3ZCOA 1H8AC 3WE3A 5A2QK 5F04A 1X3ZB 2EZHA 2PFBA 4ZYAA 1FIPA 3WGGA 2IP2A 3HJEA 2O6GE 3IHUA 1L0OC 3LSJA 1FMWA 2TDXA 1O57A 2KL4A 2AQEA 4A3DJ 2IA0A 3M9AA 1S7AA 1A6IA 4BACA 1Z67A 2MLGA 1K4TA 1RR8C 5M5YJ 4A3CJ 5ERIA 3OYIA 3BWGA 3OYAA 2XSDC 4MGRA 2EZLA 1ZGWA 5F1JA 3CMMA 4EMSA 3WG7H 3L2VA 1BR1A 3JRBA 3MKWB 2EA4A 2OU2A 5FD5A 2IEKA 3HTUA 3KZZA 2IBDA 4RGUA 1S6LA 2MD0A 4XN0A 2ZJ2A 5E3OA 3BG5A 4NDLA 2DQLA 3S8PA 5J1YA 2K86A 4RDUA 3DTKA 3BY6A 4YEJA 4ZYDA 1U3EM 3HOXJ 1B72A 4AVPA 2M0MA 4A3GJ 1IXRC 3RYPA 2KIFA 1E3OC 1WJAA 4F91B 3LAPA 2D1VA 5CVUA 4IHVA 1IZ1A 1IO2A 2XSJC 4M74A 3P7NA 1X1AA 5LGNA 4BXXJ 2FOKA 2UV1A 4HEA2 4RLFA 4B09A 1MGTA 4CGZA 4A3MJ 2P0WA 1P9QC 3NWTA 2FU4A 3ULQB 2R7XA 3L00A 2R7ZJ 4RAYA 4WXCA 2DMUA 2O3FA 5EG0B 2ZMEA 3OYHA 1Y0UA 3EETA 3QODA 3A01B 3ABLH 1P4AA 3H5NA 2QSFX 4XN3A 5E20A 1MBGA 4YELA 3AG2H 4A3KJ 2HYFA 3FXLA 1BIBA 2HKOA 4KITB 3AFHA 2WAFA 1LPQA 2V79A 3I58A 1RKTA 2EIKH 2PG4A 2D5VA 1Y56A 3O3KA 3CJNA 2QQAA 4NC6A 1KYZA 1K6OA 1LJ9A 2HOEA 2ZXJA 4B43A 3CCUI 1UHMA 4TV7A 3LA2A 3RTRA 5DD4A 3IC7A 2ME6A 3QOEA 5K1YA 3MWMA 2XAUA 1NK2P 1YYVA 2KIQA 3HPGA 1J09A 1G2HA 2OJED 3WU2C 5BOXA 1U5TC 3KFWX 5HLHA 1FYKA 2K9NA 3JSOA 4NQWB 2AXTC 2L7ZA 2XPUA 1LUJB 1B9MA 1OKRA 2AQFA 1TP4A 2M5WA 2A69F 5EZHA 2Q2EA 2DDAA 3FXMA 2MC4A 2M2EA 4WCGA 3CJTB 4RM3A 1XSDA 3GZ6A 5HDNA 2BYVE 1Q1HA 2X6WA 5BS6A 4AU7A 3F6OA 5ICGA 2LF7A 3BR2A 4KJZA 3A4CA 4R1HA 3G6EI 2P6TA 3HIFA 2F5CA 3U21A 4AWXB 1OLTA 3Q0UA 2Y9YA 1IGNA 1TQIA 1D8JA 4W1UA 1QHGA 1FZPB 1AKHB 2FNPA 4FE7A 4WXDA 1ITYA 2P8TA 2E36A 3TGNA 3BR0A 4XKBA 5LD2C 2VT2A 2XAQA 2M9HA 3ESWB 2XGDA 3A2KA 1B8IA 3BZKA 2MFZA 2EIJH 2GLOA 2OZUA 4B8XA 1J75A 3BQZA 4RLQA 2P5KA 4DIQA 1JJ8C 4RMNA 5IOZA 3E5XA 2JRTA 2K9SA 4N9IA 4A3LJ 2P7VB 1O3SA 4F55A 2O61A 3VEPA 4U7BA 2M45A 5CLSA 4RGSA 3BDDA 4CDGA 2IW5A 1VFCA 1T56A 1J2XA 4RS8A 3M8JA 1S7EA 2J5PA 3FIWA 1K61A 3CC4I 3HOVJ 3G4SI 3OYBA 3OL3A 3I4PA 3BZCA 1R22A 3ABMH 4HDVA 4FCYA 2ESNA 1A5JA 2H27A 4HRIA 2L9RA 4N9HA 1W5SA 4M3GA 1HSJA 1GV2A 2HYGD 2XRNA 1HCRA 1Z7UA 4Y52J 3A1YA 5D5UB 1BBYA 3GBGA 4E7HA 4M3FA 3E0JB 3RKYA 2HZDA 5LBQA 1BI1A 3IAM2 2BZTA 5JI6A 3HSFA 3BG9A 2ZXWH 4G12A 4PGGA 3PUFA 1S29A 2EA2A 3F8FA 3IKTA 1ETXA 3VYUB 3FXOA 3GXOA 2WB1A 4YFXF 3V42A 1XMKA 3PL8A 3JRDA 4LIVA 1LE8A 3VODA 1N77A 3TO6A 2VKDA 1P4WA 2VBWA 1FX7A 1TT5B 3RJPA 4YFNF 4OOIA 4II2A 3ZR8X 3A0HC 4ZZDA 1KZHA 2ESHA 4R8HA 2FOWA 3UNGC 1YS7A 4CYCA 3O8HA 3OY9A 2ICWG 4HPQA 3DP7A 2QQBA 1RR7A 4E6KG 2ID6A 4PSXA 2PMZA 3S3OA 1NG7A 2STWA 4ITVA 5BPDA 3HSEA 4ENNA 2P7CB 4W97A 2M4GA 2XAFA 3EUHA 5K5RA 2L2OA 4XRSA 2QBYB 2H1KA 1OMIA 2L02A 3M07A 4D5FA 5TRDA 5CKTA 3TW6A 2KZVA 3DLLF 2CUFA 3OIPA 5HS9A 2JVGA 3KP5A 4M3BA 3ERED 2L9VA 3OWTA 1BOAA 1ETQA 2VJIA 5HDKA 1APLC 5C4JJ 3H9JA 5IT9K 4X6AJ 1K7AA 5FKMA 1LDKB 9ANTA 4UVCA 4BAYA 1JHFA 4EJTA 3L2QA 3GCMA 2B7EA 2RREA 2Z2SB 1F36A 3QPHA 4XMYA 4M3DA 3MMYB 3JTGA 2I8DA 3SZTA 2WB1N 2DU9A 3O8GA 4BHCA 5JFRA 4A3JJ 1OYIA 2CV2A 2CUEA 2KP6A 1J7KA 2R7TA 2K85A 3E97A 4D0PA 3HGYA 2LG4A 4PFOA 5E8GA 4CYDA 4E4HA 2CV1A 3W2AA 1MBKA 4BJ6C 2Q0OA 4UUVA 2HVSA 1P4XA 1LDDA 4ZC3A 3MQ0A 4I99C 3HXLA 1WI9A 2KISA 2VXZA 1F1ZA 5E18F 2XAJA 5HS8A 1PP8F 1BN5A 2NVQJ 4F92B 4KFCA 1YRNB 3EUAA 5JHUA 5HNHA 3X2QH 3M7GA 4S05A 2ZSHB 1L3LA 2PMZN 2TRTA 3RPUA 4FX0A 1CQTA 3F22A 4GDFA 1V55H 1HLVA 2HDDA 1OPCA 1GLNA 3CCMI 5H2FC 2R7WA 3MCZA 4Z6YA 4IHXA 1Z6RA 5TISC 2F5EA 3HUGA 2HVQA 1R1TA 3T1BA 3G71I 3QPSA 1LQ1A 1IN5A 4XOTA 1UJ8A 3HRTA 2H6CA 5DM6F 1H88C 4N0BA 3HOYJ 2GAUA 1IV8A 4LGWA 4OIRF 2OZ6A 2VJ4A 3ML6A 4BH9A 1IW7F 1Q1VA 1X19A 3R4KA 3TEDA 2E1OA 5HODA 3LOCA 4HQMA 4CA0A 2EV5A 4XONA 5EEAA 3OR2C 2R7QA 3FDYA 4OWRB 5FKKA 1YJWI 4BE2A 3HOUJ 2CQXA 2KDZA 4HNTA 2DA2A 3ABTA 5FROA 1DU0A 1NG6A 2KIMA 1K6YA 2L4AA 3DBRB 4G6DA 5E3NA 1DUXC 3W6JB 3J80K 1X1DA 3F3XA 4MQVA 5J1RA 4C2MJ 3SXYA 5D6FA 1QU3A 1I3QJ 4XOPA 3MD2A 4FASD 5IT3A 1OISA 4XKVA 3V8JA 3BJAA 2V9PA 4MEXF 1LEBA 4IOCF 4E7ZA 5HLTA 4ZH4F 1BOBA 1VI0A 4FQGA 4ENJA 2D45A 2YU9J 4GYIA 5FRMA 2RNGA 4DZPA 3CCVI 4KMUX 1S5LC 2GWRA 4AC0A 3MZ8A 3CUQC 3DU6A 4XLCA 4JBAA 3CLQA 5IYDJ 3ZXSA 3S3NA 2DT7B 5HLGA 1HQCA 2Z16A 2PJRB 2K3FA 4UUTA 3SDBA 1JKQC 1XGNA 3PNVA 3ZQIA 4IXAA 2BE5F 4UXNA 2JSCA 3ZQHA 4UHTA 3ZN0A 4DBQA 4QPQA 5B1BH 2KLOA 3SFIA 4CZZA 5C3EJ 1MDMA 1ZLJA 1VTNC 4EJWA 1W7PB 2R7UA 4C2UA 2IT0A 1D1AA 2FEZA 4IRGA 1JGSA 5IPAA 3EUKL 3J81Z 1BIAA 4ESJA 4IHTA 5DTDA 2HS5A 2V4JC 4PUSA 2L9SA 2HOTA 4AYBN 5GPCA 4EJOA 2CFOA 2F6CA 2AS5F 3W2VA 1IV6A 3GTQJ 4A5MA 1X3UA 2LP0A 3OOUA 3L9FA 4XLHA 1QZYA 1ZK8A 3U1KA 1KU7A 2GA2A 4PCQA 4LMYA 4UNOA 4UUSA 3WE2A 4AIDA 2DMTA 4BL0B 3E6CC 3KIOA 2DLLA 2BVMA 2WAEA 3FHZA 1WJBA 3E1SA 4O5VA 2B9SA 2K27A 2ZXIA 1G3TA 1SAUA 5JHFA 2LH9A 2VKVA 4I09A 2WV0A 1Y39A 5GAEJ 3CC7I 2HGCA 2CMPA 1IF1A 3A02A 2IA2A 2JA8J 4LITA 1YTYA 5ICCA 4B3AA 2K3PA 1XX5A 1FTZA 5FFXA 3BG7A 3GVAA 2RQPA 4JQFA 3I0TA 1IRFA 4X1EA 3CC2I 1MMNA 4NC8A 3O2PE 4HDUA 1QVUA 3JAMK 4G6TB 4OIQF 3T5XA 2X6XA 1D0XA 3BTIA 2ZNZA 1D3YA 2FBHA 4MLOA 5LGTA 2QEXI 1JUPA 4E7IA 1H9TA 1UCRA 1GVJA 5D8LB 2E19A 2F48A 4IVNA 3B02A 2ZJPF 2E5ZA 1IRXA 5H6QA 3SZPA 3WTYC 2IS6A 3CCJI 5ICFA 1PJRA 2NS8A 4BUPA 3JW4A 3I56I 3KYDB 5BNGA 3EQLF 4BQOA 3I55I 1VQLI 2NS0A 3H5AA 3HPHA 2PEXA 2CV0A 3FM5A 1T0FA 2XAGA 2KDOA 2CW0F 1SFXA 4GFBA 2OD5A 4YRVA 5E3MA 2AO9A 3EYYA 4CXFA 3GF2A 4FTHA 3M4OJ 1P2FA 3V8KA 4XSZF 5AONA 2I10A 1GV5A 4LK0F 1SANA 1XGMA 2X1CA 4MEYF 5DV5A 5DCMB 4PJNA 2DMNA 2X9DA 3ZRGA 2FBKA 3HOZJ 1HW1A 1RRJA 4LLNA 3DQVC 3J7AY 1PUFB 2W48A 3ZPLA 5DM7F 5A2QZ 1IG7A 4A93J 1RKWA 4LG3A 3BG3A 1TT0A 3K4LA 5BQTA 5EG0A 4ASNA 3WTZA 5GAHJ 1XG1A 1FTTA 2P5VA 1S9HA 1HSTA 2GIVA 3A03A 2VJJA 4P96A 2VQGA 3ZQQA 3CJQB 1MNMC 1OQYA 3TL4X 4GGGA 2W1OA 3DTEA 4JX4A 4YIRX 1EH6A 5AIPA 3GO5A 3OYJA 2EJRA 5K5OA 2WY7Q 3RKWA 2EILH 4XLAA 3KYCB 5F1RA 2EB7A 3GEZA 4XRMA 1YJ9I 4RB0A 5DUIA 1TWFJ 2ZJRF 4XM3A 3S1MJ 2VPRA 1EJ9A 4F52A 1RESA 5KNLA 2E34A 2GM4A 1Z7LA 3HOSA 2O5RA 3RKQA 4ZYHA 2QUFA 4AIKA 1R5HA 4HX4A 2YR2A 3SHFA 4DNCA 5D6EA 4Q48A 1VQMI 4NQWA 3P5JA 1TWAJ 4A3IJ 4PJJA 4ENKA 3WTWC 4RB3C 3DU5A 4Q4ZF 4EVIA 2CO5A 3GUDA 2CFXA 1K4SA 1IN6A 1WJEA 1X1CA 5H20A 3BPXA 2K9LA 1K83J 3S93A 3PIOF 3KEOA 3KP6A 4P5OA 3GZNB 3QPLA 2HXIA 1W5TA 3DKXA 4M9ZA 2LBFB 1R5ID 3K70D 1AKHA 3QU3A 2A3SA 4MFEA 5KAFC 2MW8A 3GFIA 1FYMA 1TW2A 2TCTA 5KVRA 3H3VK 1TWHJ 3AG3H 2FSWA 1WH5A 3WODF 4R79A 5ILUA 3H0DA 3K6GA 4ABZA 2KHMA 3LSPA 3LSRA 1GUUA 1WFXA 2BXYA 3DPLC 3HHHA 1VQ6I 1OYYA 1JT6A 2RVCA 2E1NA 4XQFA 4ETSA 5GPAA 3G3ZA 1ZG1A 2JA7J 1EH8A 5CVIA 2IGKA 1XSXA 1SFEA 1ZG3A 3QYBA 5F08A 3ZQ7A 5JLWA 2DA5A 4KICA 4HSTA 1FBUA 1S72I 3CP2A 2YUSA 3L7WA 1WJDA 4PFPA 4DQ2A 3E6BA 3FXRA 1RIOH 2M7AA 4QLCU 3M1CA 4C3IJ 2DW4A 1WGXA 2WA0A 5LEJA 2COBA 1Y8QB 1OCZH 2DMQA 2CQ7A 4J01A 3LAJA 2KQRA 2RQQA 5K7HA 2FD5A 5LGUA 1FP1D 2W85A 3CCRI 1YX5A
chains in the Genus database with same CATH topology
4S0HB 4M3GA 2M8GX 3GTGJ 4BBSJ 1GV2A 1HCRA 2O8KA 1IRZA 4Y52J 4QIWN 5C4XJ 3GBGA 3NARA 3LNQA 4M3FA 2VI6A 3C2BA 4Y7NJ 2DA4A 3IH3A 3K2AA 4XICA 1EF4A 3BG9A 4G12A 1HDDC 5FJ8J 5IP7J 1ETXA 3S2HJ 2OPTA 2DN0A 3JRCA 5IP6A 3HDDA 4A3EJ 3JRDA 3FK7A 3BTCA 3Q3SA 3A01A 1LE8A 2X6OA 1LE8B 1BL0A 2HYJA 2E2JJ 3BR5A 2JN6A 1UHSA 3GTJJ 3B6CA 1RETA 4D7MA 2HQ5A 1NTCA 2VKEA 5FKOA 2LR8A 4CYCA 3O8HA 4CYCB 3S14J 2DA3A 4M6VA 2ELKA 1VF9A 1RR7A 5IYBJ 1ZTRA 2ID6A 2B63J 1JUMA 4D7NA 2JA5J 1VNDA 2XPVA 4JP0A 4W97A 4A69C 2DJNA 2LTPA 2M34A 4XRSA 2H1KA 1WH7A 4D5FA 4DYCA 3TW6A 1WI3A 3PO2J 2CUFA 1SFOJ 2EQRA 1P7JA 2WV1A 4M3BA 2M0CA 3K7AJ 4BY1J 5EDNA 4J19A 3MKLA 2EH3A 1APLC 1ETQA 5C4JJ 1WPKA 4X6AJ 5FKMA 4B1RA 9ANTA 2LVSA 3G1MA 2CU7A 5IOYA 4M3EA 1LFUP 3RZOJ 3OSFA 1F36A 2XB5A 4IHYA 4M3DA 1MBHA 4EEFG 2WB1N 3O8GA 1AU7A 3ZQLA 4A3JJ 2CUEA 4XK4A 1U9NA 1DU6A 4XIDA 3HGYA 3BR3A 1MBKA 2CJJA 1T33A 2Y30A 2NVQJ 4A3FJ 2FX0A 1YRNA 3HM5A 1YRNB 2LKXA 3OSGA 1JTYA 1IDZA 1FIAA 5JLXA 1JUSA 1W0TA 2PMZN 2TRTA 3L1PA 5M3FJ 4BKXA 1CQTA 3FKIJ 1HLVA 5E3LA 2HDDA 2O7OA 3GTPJ 2H8RA 4IHXA 3JREA 3S1RJ 1GDTA 2JMWA 2ECCA 4RBOA 2K9QA 1WCMJ 2DA1A 2LY9A 3QPSA 3SDGA 1R9TJ 1HDPA 1HOMA 3S1NJ 1H88C 4JX6A 3HOYJ 3I4NJ 1TC3C 1MSFC 1Q1VA 1JKOC 1ETKA 3TEDA 2E1OA 3JRIA 2CRGA 5HODA 2ZB9A 3LOCA 2LFBA 5EEAA 5FKKA 4A3BJ 3HOUJ 2CQXA 2XGEA 2KDZA 1JGGA 1OCPA 2DA2A 4D5CA 3BR1A 1DU0A 2FJ1A 2NOGA 4MIMA 3LSGA 2MG4A 1ETVA 2DA7A 3BR6A 4L5EA 5E3NA 5M5WJ 3S1QJ 2MGQA 2ME0A 2VUMJ 3HEFA 3ZQCA 5J1RA 2HXOA 4C2MJ 2G0EA 4DZJA 1I3QJ 1QPIA 2CQQA 4C3HJ 3FK6A 2ID3A 2YU9J 1VI0A 1MBFA 4V2FA 3ZOBA 2QF7A 3MN2A 4DZPA 1W0UA 1BJZA 1O4XA 4AC0A 3VPRA 2R0QC 2HOSA 4QSHA 3GTOJ 3B6AA 2LK2A 4I76A 5IYDJ 3CQZJ 2O9LA 1ETWA 3G1OA 5J3LA 2XB0X 1OFCX 4UUTA 1JKQC 1BW6A 5EGOA 3ZQIA 1JJ6C 5EGOB 2EBIA 3ZQHA 3BTJA 3JRAA 1MH3A 1LFBA 3SFIA 5C3EJ 3WHBA 3DEWA 5DS9A 2RAEA 1MBEA 3I4MJ 5IPAA 2E2IJ 1IC8A 4BY7J 5DTDA 1ZKGA 1X2NA 2HOTA 3Q0WA 4MFDA 4AYBN 5GPCA 4JYKA 2OF7A 2N8GA 2HI3A 2DMPA 1ENHA 2IAIA 2XPWA 1H89C 1IV6A 3GTQJ 3IH2A 3SJMA 1MH4A 2LP0A 2NVTJ 3OOUA 3S2DJ 5F0HA 4V2GA 1ZK8A 1JKRC 4QTRA 5FKLA 3BQYA 1FEXA 4UUSA 2L7MP 5EF6A 3HOWJ 4UUSB 1QVTA 2R5YA 2DMTA 3F0CA 3JRHA 2R5YB 3PM1A 4MO7A 1JT0A 2X48A 3S17J 5GP9A 2R5ZA 1P7IA 3TP0A 2R5ZB 2E2HJ 1MBJA 2VKVA 4DYQA 4B4CA 3OIOA 2JA6J 2ECBA 2JA8J 3A02A 2K40A 1BA5A 4B3AA 1ORKA 3RZDJ 1FTZA 3NAUA 1ETYA 1H8AC 5F04A 2EZHA 3CDLA 2Y9ZA 1FIPA 4X1EA 1JKPC 3LSJA 4JX5A 3BTLA 2NVXJ 1QVUA 4A3DJ 2HOAA 1A6IA 3BTIA 5M5YJ 4A3CJ 4MLOA 1U8BA 1JUPA 2XSDC 1MSEC 2EZLA 1ZGWA 1U9OA 3HBLA 3ZQFA 5F1JA 2E19A 3JRBA 1UMQA 2JWTA 2IEKA 2NS8A 2IBDA 5BNGA 1NK3P 2Y0SN 5E3OA 1TWGJ 3BG5A 4NDLA 2KT0A 5F0CA 5J1YA 4GFBA 4RDUA 5E3MA 2AO9A 3HOXJ 1B72A 3JRFA 4FTHA 1B72B 3M4OJ 2LD5A 4A3GJ 2EZIA 3BT9A 1ZR2A 1E3OC 2I10A 1GV5A 4IHVA 1SANA 3S15J 2DMNA 2X9DA 2NVYJ 3HOZJ 1ZQ3P 1OJLA 4BXXJ 2Y31A 1PUFA 5C44J 1I50J 1PUFB 2W48A 4A3MJ 1IG7A 4A93J 1RKWA 2R7ZJ 4FE4A 3BG3A 5EG0A 2DMUA 1D5YA 1Z0XA 5EG0B 3G1LA 1XG1A 1FTTA 3A01B 3A03A 2AHQA 1RPWA 3E7LA 4DYRA 3GTKJ 1AHDP 3GTLJ 1MBGA 4C3JJ 1BW5A 1IJWC 1MNMC 4A3KJ 1XC5A 1Y1WJ 4JX4A 2EZKA 5FKNA 1XS9A 2DTZA 1RKTA 2D5VA 1POGA 5FLMJ 3PO3J 2NS7A 1IDYA 4XRMA 3MVPA 4AUXA 2LLKA 1FJLA 1QRYA 3TP3A 1TWCJ 3IV5A 1TWFJ 5F27A 3HGGA 3S1MJ 2VPRA 3D1NI 3QQAA 1Y1VJ 2ME6A 3W6VA 4IHWA 2YS9A 1RESA 2Y2ZA 2GM4A 1I6HJ 1NK2P 2GBYA 3RKQA 1JTXA 4HNVA 1G2HA 1UG2A 2QCOA 5FLVA 2K9NA 3DCFA 4XRSG 1TWAJ 3Q0VA 2L7ZA 1Z77A 2XPUA 3CCYA 5F0FA 4A3IJ 4BBRJ 2R93J 5EZHA 2M2EA 2R92J 3BR2A 4IEJA 1K83J 2JJ7A 3Q0UA 2Y9YA 1IGNA 3QPLA 2HXIA 2L7FP 1AKHA 4W1UA 1AKHB 4FE7A 2JK3A 4MFEA 2MW8A 1ITYA 1ZR4A 2WAQN 1GT0C 2TCTA 3H3VK 1TWHJ 3BR0A 5IYCJ 5J1UA 5IP9J 3TW7A 1F43A 1WH5A 1GVDA 1X58A 2M9HA 3JR9A 3UKGA 4ABZA 3LSPA 3LSRA 2XGDA 1GUUA 1U78A 1X2MA 1B8IA 3CMYA 1JT6A 1B8IB 4I6ZA 5EYRA 5GPAA 2MSYA 3WHCA 2GLOA 3GTMJ 2JA7J 2P81A 3M3YJ 3S16J 3BQZA 5F08A 3ZQGA 1JJ8C 5IOZA 3HKZN 2XGCA 3JRGA 4DW6A 5JLWA 2DA5A 1IUFA 5M5XJ 2K9SA 2YUSA 1HF0A 4A3LJ 3H0GJ 3RQIA 2FQ4A 5K7ZA 5K7FA 2XRLA 1VFCA 4C3IJ 4LOCA 5EZGA 1T56A 1WGXA 3FISA 1S7EA 2L0KA 3FIWA 2COBA 2DMQA 1K61A 3HOVJ 2DA6A 1OCTC 4FISA 5K7HA 2FD5A 4FCYA 5M3MJ 3IH4A 3HB9A 1A5JA 2L9RA 1ETOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0H B;  4M3G A;  2M8G X;  3GTG J;  4BBS J;  1GV2 A;  1HCR A;  2O8K A;  1IRZ A;  4Y52 J;  4QIW N;  5C4X J;  3GBG A;  3NAR A;  3LNQ A;  4M3F A;  2VI6 A;  3C2B A;  4Y7N J;  2DA4 A;  3IH3 A;  3K2A A;  4XIC A;  1EF4 A;  3BG9 A;  4G12 A;  1HDD C;  5FJ8 J;  5IP7 J;  1ETX A;  3S2H J;  2OPT A;  2DN0 A;  3JRC A;  5IP6 A;  3HDD A;  4A3E J;  3JRD A;  3FK7 A;  3BTC A;  3Q3S A;  3A01 A;  1LE8 A;  2X6O A;  1LE8 B;  1BL0 A;  2HYJ A;  2E2J J;  3BR5 A;  2JN6 A;  1UHS A;  3GTJ J;  3B6C A;  1RET A;  4D7M A;  2HQ5 A;  1NTC A;  2VKE A;  5FKO A;  2LR8 A;  4CYC A;  3O8H A;  4CYC B;  3S14 J;  2DA3 A;  4M6V A;  2ELK A;  1VF9 A;  1RR7 A;  5IYB J;  1ZTR A;  2ID6 A;  2B63 J;  1JUM A;  4D7N A;  2JA5 J;  1VND A;  2XPV A;  4JP0 A;  4W97 A;  4A69 C;  2DJN A;  2LTP A;  2M34 A;  4XRS A;  2H1K A;  1WH7 A;  4D5F A;  4DYC A;  3TW6 A;  1WI3 A;  3PO2 J;  2CUF A;  1SFO J;  2EQR A;  1P7J A;  2WV1 A;  4M3B A;  2M0C A;  3K7A J;  4BY1 J;  5EDN A;  4J19 A;  3MKL A;  2EH3 A;  1APL C;  1ETQ A;  5C4J J;  1WPK A;  4X6A J;  5FKM A;  4B1R A;  9ANT A;  2LVS A;  3G1M A;  2CU7 A;  5IOY A;  4M3E A;  1LFU P;  3RZO J;  3OSF A;  1F36 A;  2XB5 A;  4IHY A;  4M3D A;  1MBH A;  4EEF G;  2WB1 N;  3O8G A;  1AU7 A;  3ZQL A;  4A3J J;  2CUE A;  4XK4 A;  1U9N A;  1DU6 A;  4XID A;  3HGY A;  3BR3 A;  1MBK A;  2CJJ A;  1T33 A;  2Y30 A;  2NVQ J;  4A3F J;  2FX0 A;  1YRN A;  3HM5 A;  1YRN B;  2LKX A;  3OSG A;  1JTY A;  1IDZ A;  1FIA A;  5JLX A;  1JUS A;  1W0T A;  2PMZ N;  2TRT A;  3L1P A;  5M3F J;  4BKX A;  1CQT A;  3FKI J;  1HLV A;  5E3L A;  2HDD A;  2O7O A;  3GTP J;  2H8R A;  4IHX A;  3JRE A;  3S1R J;  1GDT A;  2JMW A;  2ECC A;  4RBO A;  2K9Q A;  1WCM J;  2DA1 A;  2LY9 A;  3QPS A;  3SDG A;  1R9T J;  1HDP A;  1HOM A;  3S1N J;  1H88 C;  4JX6 A;  3HOY J;  3I4N J;  1TC3 C;  1MSF C;  1Q1V A;  1JKO C;  1ETK A;  3TED A;  2E1O A;  3JRI A;  2CRG A;  5HOD A;  2ZB9 A;  3LOC A;  2LFB A;  5EEA A;  5FKK A;  4A3B J;  3HOU J;  2CQX A;  2XGE A;  2KDZ A;  1JGG A;  1OCP A;  2DA2 A;  4D5C A;  3BR1 A;  1DU0 A;  2FJ1 A;  2NOG A;  4MIM A;  3LSG A;  2MG4 A;  1ETV A;  2DA7 A;  3BR6 A;  4L5E A;  5E3N A;  5M5W J;  3S1Q J;  2MGQ A;  2ME0 A;  2VUM J;  3HEF A;  3ZQC A;  5J1R A;  2HXO A;  4C2M J;  2G0E A;  4DZJ A;  1I3Q J;  1QPI A;  2CQQ A;  4C3H J;  3FK6 A;  2ID3 A;  2YU9 J;  1VI0 A;  1MBF A;  4V2F A;  3ZOB A;  2QF7 A;  3MN2 A;  4DZP A;  1W0U A;  1BJZ A;  1O4X A;  4AC0 A;  3VPR A;  2R0Q C;  2HOS A;  4QSH A;  3GTO J;  3B6A A;  2LK2 A;  4I76 A;  5IYD J;  3CQZ J;  2O9L A;  1ETW A;  3G1O A;  5J3L A;  2XB0 X;  1OFC X;  4UUT A;  1JKQ C;  1BW6 A;  5EGO A;  3ZQI A;  1JJ6 C;  5EGO B;  2EBI A;  3ZQH A;  3BTJ A;  3JRA A;  1MH3 A;  1LFB A;  3SFI A;  5C3E J;  3WHB A;  3DEW A;  5DS9 A;  2RAE A;  1MBE A;  3I4M J;  5IPA A;  2E2I J;  1IC8 A;  4BY7 J;  5DTD A;  1ZKG A;  1X2N A;  2HOT A;  3Q0W A;  4MFD A;  4AYB N;  5GPC A;  4JYK A;  2OF7 A;  2N8G A;  2HI3 A;  2DMP A;  1ENH A;  2IAI A;  2XPW A;  1H89 C;  1IV6 A;  3GTQ J;  3IH2 A;  3SJM A;  1MH4 A;  2LP0 A;  2NVT J;  3OOU A;  3S2D J;  5F0H A;  4V2G A;  1ZK8 A;  1JKR C;  4QTR A;  5FKL A;  3BQY A;  1FEX A;  4UUS A;  2L7M P;  5EF6 A;  3HOW J;  4UUS B;  1QVT A;  2R5Y A;  2DMT A;  3F0C A;  3JRH A;  2R5Y B;  3PM1 A;  4MO7 A;  1JT0 A;  2X48 A;  3S17 J;  5GP9 A;  2R5Z A;  1P7I A;  3TP0 A;  2R5Z B;  2E2H J;  1MBJ A;  2VKV A;  4DYQ A;  4B4C A;  3OIO A;  2JA6 J;  2ECB A;  2JA8 J;  3A02 A;  2K40 A;  1BA5 A;  4B3A A;  1ORK A;  3RZD J;  1FTZ A;  3NAU A;  1ETY A;  1H8A C;  5F04 A;  2EZH A;  3CDL A;  2Y9Z A;  1FIP A;  4X1E A;  1JKP C;  3LSJ A;  4JX5 A;  3BTL A;  2NVX J;  1QVU A;  4A3D J;  2HOA A;  1A6I A;  3BTI A;  5M5Y J;  4A3C J;  4MLO A;  1U8B A;  1JUP A;  2XSD C;  1MSE C;  2EZL A;  1ZGW A;  1U9O A;  3HBL A;  3ZQF A;  5F1J A;  2E19 A;  3JRB A;  1UMQ A;  2JWT A;  2IEK A;  2NS8 A;  2IBD A;  5BNG A;  1NK3 P;  2Y0S N;  5E3O A;  1TWG J;  3BG5 A;  4NDL A;  2KT0 A;  5F0C A;  5J1Y A;  4GFB A;  4RDU A;  5E3M A;  2AO9 A;  3HOX J;  1B72 A;  3JRF A;  4FTH A;  1B72 B;  3M4O J;  2LD5 A;  4A3G J;  2EZI A;  3BT9 A;  1ZR2 A;  1E3O C;  2I10 A;  1GV5 A;  4IHV A;  1SAN A;  3S15 J;  2DMN A;  2X9D A;  2NVY J;  3HOZ J;  1ZQ3 P;  1OJL A;  4BXX J;  2Y31 A;  1PUF A;  5C44 J;  1I50 J;  1PUF B;  2W48 A;  4A3M J;  1IG7 A;  4A93 J;  1RKW A;  2R7Z J;  4FE4 A;  3BG3 A;  5EG0 A;  2DMU A;  1D5Y A;  1Z0X A;  5EG0 B;  3G1L A;  1XG1 A;  1FTT A;  3A01 B;  3A03 A;  2AHQ A;  1RPW A;  3E7L A;  4DYR A;  3GTK J;  1AHD P;  3GTL J;  1MBG A;  4C3J J;  1BW5 A;  1IJW C;  1MNM C;  4A3K J;  1XC5 A;  1Y1W J;  4JX4 A;  2EZK A;  5FKN A;  1XS9 A;  2DTZ A;  1RKT A;  2D5V A;  1POG A;  5FLM J;  3PO3 J;  2NS7 A;  1IDY A;  4XRM A;  3MVP A;  4AUX A;  2LLK A;  1FJL A;  1QRY A;  3TP3 A;  1TWC J;  3IV5 A;  1TWF J;  5F27 A;  3HGG A;  3S1M J;  2VPR A;  3D1N I;  3QQA A;  1Y1V J;  2ME6 A;  3W6V A;  4IHW A;  2YS9 A;  1RES A;  2Y2Z A;  2GM4 A;  1I6H J;  1NK2 P;  2GBY A;  3RKQ A;  1JTX A;  4HNV A;  1G2H A;  1UG2 A;  2QCO A;  5FLV A;  2K9N A;  3DCF A;  4XRS G;  1TWA J;  3Q0V A;  2L7Z A;  1Z77 A;  2XPU A;  3CCY A;  5F0F A;  4A3I J;  4BBR J;  2R93 J;  5EZH A;  2M2E A;  2R92 J;  3BR2 A;  4IEJ A;  1K83 J;  2JJ7 A;  3Q0U A;  2Y9Y A;  1IGN A;  3QPL A;  2HXI A;  2L7F P;  1AKH A;  4W1U A;  1AKH B;  4FE7 A;  2JK3 A;  4MFE A;  2MW8 A;  1ITY A;  1ZR4 A;  2WAQ N;  1GT0 C;  2TCT A;  3H3V K;  1TWH J;  3BR0 A;  5IYC J;  5J1U A;  5IP9 J;  3TW7 A;  1F43 A;  1WH5 A;  1GVD A;  1X58 A;  2M9H A;  3JR9 A;  3UKG A;  4ABZ A;  3LSP A;  3LSR A;  2XGD A;  1GUU A;  1U78 A;  1X2M A;  1B8I A;  3CMY A;  1JT6 A;  1B8I B;  4I6Z A;  5EYR A;  5GPA A;  2MSY A;  3WHC A;  2GLO A;  3GTM J;  2JA7 J;  2P81 A;  3M3Y J;  3S16 J;  3BQZ A;  5F08 A;  3ZQG A;  1JJ8 C;  5IOZ A;  3HKZ N;  2XGC A;  3JRG A;  4DW6 A;  5JLW A;  2DA5 A;  1IUF A;  5M5X J;  2K9S A;  2YUS A;  1HF0 A;  4A3L J;  3H0G J;  3RQI A;  2FQ4 A;  5K7Z A;  5K7F A;  2XRL A;  1VFC A;  4C3I J;  4LOC A;  5EZG A;  1T56 A;  1WGX A;  3FIS A;  1S7E A;  2L0K A;  3FIW A;  2COB A;  2DMQ A;  1K61 A;  3HOV J;  2DA6 A;  1OCT C;  4FIS A;  5K7H A;  2FD5 A;  4FCY A;  5M3M J;  3IH4 A;  3HB9 A;  1A5J A;  2L9R A;  1ETO A; 
#chains in the Genus database with same CATH topology
 2M8G X;  4A12 A;  4QWQ A;  1MIJ A;  3Q9V A;  1FOX A;  4NC7 A;  3IAS 2;  1MKM A;  2F4I A;  3CUO A;  5LLQ A;  3DWL E;  2QGU A;  5C4X J;  1HKS A;  2FML A;  2LYC A;  3NAR A;  2QA4 I;  3LNQ A;  3OS0 A;  2L7K A;  1XDS A;  3K2A A;  4V19 K;  2MH2 A;  5HLI A;  3K1P A;  4H0E A;  4PDK A;  2W00 A;  2XF7 A;  4E7K A;  2QVO A;  2OPT A;  2DN0 A;  2FXA A;  3JRC A;  3HDD A;  2BY2 A;  1DPU A;  4A3E J;  3N4M A;  4ESB A;  4KIB A;  3FK7 A;  1ZYR F;  2ZFU A;  3DKY A;  5EEH A;  1LKX A;  2DK8 A;  2BBY A;  1XTA A;  2HYJ A;  1QZE A;  1SEU A;  3T8T A;  1VQN I;  1KQ8 A;  1V3F A;  3RPQ A;  3FX3 A;  3ROU A;  1BC7 C;  5D5W B;  2HDC A;  4M6V A;  4FX4 A;  1VF9 A;  3SQN A;  1R1U A;  2EV0 A;  2YX4 A;  1D5V A;  2DCE A;  4OIN F;  1BR2 A;  3N05 A;  2B63 J;  3M1E A;  5GTH C;  4HV5 A;  2JA5 J;  2XPV A;  1IXS B;  1D0Z A;  4KMF A;  2PX9 A;  2DJN A;  5B1A H;  2VBY A;  4I01 A;  2LDU A;  4DGW B;  1V5E A;  2V6E A;  2NRA C;  2XVC A;  1HW5 A;  1Y6I A;  3I59 B;  4FT8 A;  2HTJ A;  5GTI C;  4WX9 A;  2KPM A;  1USS A;  3PO2 J;  2VON A;  1Z21 A;  2O8X A;  5EDN A;  4BY1 J;  3OYL A;  4Y33 A;  2VQL A;  2XKO A;  2E1M C;  2V26 A;  2QSG X;  3FWE A;  5DUK A;  5GAG J;  5J8C A;  1ZEL A;  4M6Y A;  1F5T A;  1MMD A;  2CQK A;  1D0Y A;  5IOY A;  2ZCW A;  2R7V A;  3S3M A;  3RZO J;  1U2W A;  3ZMV A;  4LG0 B;  4I2O A;  1BI2 A;  4IHY A;  5E1Z B;  1ZG5 A;  1V4R A;  1TLH B;  3ZQL A;  2DFE A;  4G7O F;  5CQG A;  2E7W A;  2Z33 A;  1U9N A;  4EV0 A;  1DU6 A;  2IS2 A;  4MNU A;  3DPT A;  3BR3 A;  2EPF A;  1T33 A;  1FT9 A;  2X1E A;  3P9C A;  4CHU A;  2R4G A;  3I53 A;  1YRN A;  3HM5 A;  4KT5 C;  3BJO A;  2L01 A;  3KZI C;  2XAH A;  3VSK A;  3ZMT A;  2LKX A;  2HPI A;  1IDZ A;  1ZGJ A;  2DT6 A;  2DI3 A;  1FIA A;  2Z1D A;  3H1C A;  5JLX A;  4Y3O A;  1W0T A;  5M3F J;  4O6J A;  3DLA A;  3FKI J;  3FBN B;  2BW3 B;  2XDV A;  3ECH A;  4HBL A;  3E5Q A;  2GOX B;  2O7O A;  4LJZ F;  2G7H A;  3K69 A;  3JRE A;  3S1R J;  5IT9 Z;  3CUQ B;  1WCM J;  3ZMZ A;  2YSR A;  2DA1 A;  2LY1 A;  3K10 A;  5B3S H;  2J5O A;  2L5Q A;  1VQ5 I;  4FHT A;  1HDP A;  1R9T J;  4MTD A;  1H9G A;  4OMZ A;  3WTT C;  3RI4 A;  1TC3 C;  1R71 A;  3WU0 A;  4IKF A;  4X0G A;  3FHN A;  2A05 A;  1TQP A;  1T08 B;  1E3H A;  4OMY A;  2RGV A;  2ZB9 A;  2LFB A;  3Q9S A;  4A3B J;  1QGP A;  3CCQ I;  4CUG A;  1ACI A;  1JGG A;  1XMA A;  1OCP A;  1MMA A;  4D5C A;  1B1B A;  5CVR A;  3TQN A;  3LSI A;  2DA7 A;  1KON A;  4OAZ A;  3S1Q J;  1FYL A;  3WTX C;  4EM1 A;  5CVJ A;  3HEF A;  4HX7 A;  4CCM A;  3HZJ A;  3ZQC A;  3DFG A;  1X4P A;  3ECO A;  3I64 A;  1VZ0 A;  3F8C A;  3OYE A;  3E3V A;  2HQN A;  1QPI A;  4FET A;  2DFI A;  2CQQ A;  4ESF A;  2LRE A;  3FK6 A;  3FM3 A;  4M73 A;  2XRO A;  1MBF A;  3BLY A;  2F2E A;  2HNH A;  5J6X A;  4EJV A;  1BJZ A;  2K02 A;  2RV8 A;  4B47 A;  2DTR A;  1O4X A;  1TZL A;  3GTO J;  3B6A A;  2LK2 A;  3J7A O;  1G3Y A;  2PJR A;  1ETW A;  5J3L A;  4C9Y A;  4CZC A;  4E7S A;  1MND A;  5D4S A;  1BW6 A;  3GFM A;  3AG4 H;  3DXJ F;  2BV6 A;  5EGO B;  3CDH A;  1BC8 C;  1ERD A;  2EBI A;  3O6B B;  5TGT A;  3JRA A;  4XL9 A;  4KUM A;  2Y75 A;  1G6N A;  1W7P A;  2DFH A;  3DEW A;  4GO1 A;  1PDN C;  4L0Z B;  5DS9 A;  3L2U A;  1UB9 A;  1TTY A;  2E2I J;  3S32 A;  3LA7 A;  1IC8 A;  2XKP A;  1G3S A;  2MLK A;  3J80 Z;  1ZKG A;  1FMV A;  4KA4 A;  2FNA A;  3Q0W A;  2Y0S A;  1ZRE A;  2IAI A;  3R0A A;  4O3M A;  2DO7 A;  1VQK I;  1X1P A;  1R4N B;  2CSO A;  3IUO A;  2ZFW A;  1W5C C;  3TOB A;  1IN8 A;  3S2D J;  1O7F A;  1VQP I;  2LKS A;  1JKR C;  4QTR A;  4AIJ A;  3BQY A;  5LHH A;  1FEX A;  4HG2 A;  3HOW J;  4M9X A;  4MQ9 F;  4U87 A;  1SFK A;  2UZK A;  1QVT A;  3F0C A;  4ON0 A;  2XIG A;  3JRH A;  2R5Y B;  3PM1 A;  2V9K A;  2YPR A;  3K1N A;  5GP9 A;  4CCN A;  1P7I A;  4GXO A;  3TP0 A;  1OYW A;  2E2H J;  1LDJ A;  2PLY A;  4B4C A;  1OCO H;  3KP2 A;  1SVL A;  2EIN H;  4UY8 I;  4EGZ A;  3K4M A;  2Y48 A;  2DOD A;  1ZH5 A;  2K4B A;  4WF2 A;  1JXS A;  1ORK A;  3TMO A;  2QYO A;  4CH7 A;  2EV6 A;  3OS1 A;  2DOA A;  4EGY A;  1LFP A;  2Y9Z A;  5F64 A;  1W4M A;  1JKP C;  1BI3 A;  2E35 A;  4ANJ A;  2QQ8 A;  3S2W A;  1MMS A;  3NQO A;  4JX5 A;  3HOT A;  1FNN A;  3BTL A;  4ZJZ A;  1HW2 A;  3SFZ A;  3ZP5 A;  2HOA A;  1YHQ I;  3CTA A;  2OCC H;  1XCV A;  3CP8 A;  4IX7 A;  1FY7 A;  1U8B A;  2QZ8 A;  4B3X A;  1WWX A;  1C0W A;  1MW7 A;  2CG4 A;  1X4O A;  1U9O A;  2ZJQ F;  3ZQF A;  1G3W A;  2P6S A;  2KRF A;  3FXK A;  1UMQ A;  4Y4R A;  4AYB A;  4PJM A;  5L3C A;  2A07 F;  2JQ7 A;  3C3W A;  4CSW A;  5L3F A;  3CLO A;  1WKM A;  2EFO A;  3RKX A;  1NK3 P;  2Y0S N;  3KPH A;  4NB5 A;  2WTE A;  3E5U A;  3GX4 X;  2IA1 A;  2KT0 A;  2X85 A;  5F0C A;  4U0W A;  2XGX A;  3JSP A;  2VE8 A;  3HRS A;  3CF5 F;  3OYM A;  2IGN A;  2QKL B;  1ZRF A;  2LD5 A;  1DGW Y;  2EZI A;  2LF8 A;  3PFY A;  1ZR2 A;  4I02 A;  4M9S A;  5E1W A;  1VQ9 I;  5DCM A;  2D2W A;  3S15 J;  1SD5 A;  1WQ2 A;  5FGM A;  2NVY J;  1BR4 A;  4MHG A;  1FSE A;  2Y31 A;  3FKJ A;  1PUF A;  3LSH A;  3WG9 A;  1O3R A;  4OIP F;  4NBQ A;  2GXB A;  1ZRD A;  4FE4 A;  3QRF F;  1D5Y A;  1Z0X A;  2LSO A;  4JOM A;  3G1L A;  1BM9 A;  2DOF A;  4I7H A;  4IJA A;  1DP3 A;  3JAM Z;  3H3Z A;  5H6R A;  4ZDP A;  1RPW A;  2L54 A;  2IGM A;  4DYR A;  2KIU A;  4UB6 C;  1AHD P;  3I9V 2;  4QPO A;  4C3J J;  2W4S A;  1IJW C;  3TO9 A;  2ZKZ A;  2DQR A;  1XC5 A;  1Y1W J;  3HTS B;  2OTJ I;  3ASN H;  5FKN A;  1YS6 A;  4U0Y A;  5DDG A;  3BPV A;  5CQE A;  3P9K A;  1YIT I;  3HKZ A;  4Z2Y A;  2W84 A;  5FLM J;  3PO3 J;  2NS7 A;  1IDY A;  2ADU A;  2QKM B;  2OCE A;  3FXJ A;  5B66 C;  1FJL A;  2A68 F;  2CUJ A;  2DFF A;  3HGG A;  3VOE A;  4L0Y B;  3ISP A;  2DYS H;  3QQA A;  4N4O B;  1Y1V J;  2CWE A;  3F8B A;  5JVT A;  1I5Z A;  2XUB A;  3W6V A;  4IHW A;  3WTU C;  2CUZ A;  2YS9 A;  3V7C A;  1R58 A;  3G73 A;  1I6H J;  4YIF A;  4HNV A;  2LOO A;  3WTS C;  1T95 A;  2GOM A;  2QCO A;  5FLV A;  3PJR A;  2DYR H;  4P9U A;  1TNT A;  4BS9 A;  1YJN I;  4XRS G;  3NRV A;  3LSK A;  1SD4 A;  3Q0V A;  5F0F A;  1Z77 A;  2R93 J;  4H4K C;  4IRI A;  5ILV A;  3ZMU A;  2K7L A;  1JI8 A;  2FBI A;  2X51 A;  2ZME C;  2R92 J;  2X6Y A;  1W36 D;  4IEJ A;  1VQ7 I;  4KDP A;  2DBB A;  2JJ7 A;  1Z05 A;  1P6R A;  3QPT A;  2LBF A;  1HBX G;  2L7F P;  4RGX A;  1SC7 A;  4HAM A;  3ZMD A;  5IYC J;  5J1U A;  5IP9 J;  5KHD A;  4E7J A;  4A0Z A;  1F43 A;  2M30 A;  5DYM A;  1GVD A;  4WK8 F;  2EFN A;  3JR9 A;  1T6S A;  1B4A A;  1MJA A;  1PP7 U;  3P9I A;  5EYR A;  2MSY A;  3WHC A;  2V1N A;  2BGC A;  3M3Y J;  2HQA A;  5B5E C;  2F5D A;  3HKZ N;  4LB6 B;  4OU0 A;  4DW6 A;  3SEQ A;  1F4K A;  5M5X J;  1X3W B;  1HF0 A;  3TDU C;  4LK1 F;  3MKZ A;  4HOB A;  3W6K B;  3H0G J;  4PK4 A;  4B48 A;  3IWZ A;  4RAG A;  3RQI A;  1FC3 A;  5K7Z A;  2EFP A;  2XRL A;  5EZG A;  1Z3X A;  1RI7 A;  3FIS A;  2L0K A;  2IXS A;  3CDI A;  3C18 A;  2NVU B;  5D4R A;  4GCV A;  1OCT C;  4GRI A;  2JPB A;  5LFA A;  4FIS A;  2ETH A;  4CCK A;  1YW7 A;  5M3M J;  1B59 A;  3IH4 A;  3WTV C;  2LRD A;  1ETO A;  4S0H B;  4BBS J;  2DT5 A;  3K4J A;  2O8K A;  3OYC A;  1IRZ A;  2KJB A;  3J7Z I;  4E70 A;  1R4M B;  4BEH B;  4QIW N;  1RNL A;  4I0B A;  4I98 B;  4BGD A;  3HSR A;  1U5T B;  5D8K B;  4NNJ A;  3C2B A;  1ON1 A;  3OYN A;  4BJ5 C;  2V1U A;  1V5G A;  3IH3 A;  3ABU A;  2KFD A;  2HWV A;  4XIC A;  3CME I;  4Y15 A;  5K5Q A;  4G7H F;  1HDD C;  5FJ8 J;  2VQC A;  3C2G A;  3LL7 A;  2E1M B;  4F7Z A;  2A61 A;  3U2R A;  2IVM A;  1SVO A;  4L9J A;  1SAX A;  1Z3Y A;  2V9V A;  3Q3S A;  3A01 A;  4IOA F;  2HFH A;  1BL0 A;  1XGO A;  3BC8 A;  4DJA A;  3CMA I;  3VWB A;  4D9J A;  3QWL A;  2ISZ A;  1A35 A;  2JN6 A;  3GTJ J;  5E79 C;  3F23 A;  1RET A;  3TDZ C;  1N25 A;  2HQ5 A;  4L18 B;  3FXQ A;  1OCR H;  3K4C A;  1AWC A;  1NTC A;  4M72 A;  2A6T A;  1IUY A;  2QM3 A;  2F5V A;  3QP5 A;  2LR8 A;  4ZZL A;  3MEX A;  4JK1 X;  2MA3 A;  3S14 J;  3J7Y J;  1W7P D;  2DA3 A;  2UWM A;  2ELK A;  1J5Y A;  1AA7 A;  2QEN A;  5CPR B;  5IYB J;  1ZTR A;  2DXI A;  2VC1 A;  1QBJ A;  4L5I A;  1F9N A;  3IWF A;  4HF2 A;  1JUM A;  4CCJ A;  4L9N A;  4S04 A;  4JP0 A;  1ONV A;  3OOP A;  1U6G A;  2VBX A;  3WGI A;  1MD0 A;  4A69 C;  4U88 A;  3M8E A;  4EM2 A;  1SMY F;  4ZTJ A;  3HRM A;  3PSF A;  5HVQ C;  1YI2 I;  3I59 A;  4UVA A;  2KRC A;  1QPM A;  5E17 F;  4DYC A;  1FPQ A;  1B9N A;  1Z9C A;  3AL0 C;  1WI3 A;  2F5F A;  3FMR A;  4XLE A;  1P7J A;  1XB4 A;  2M0C A;  2L9N A;  1QO0 D;  4PJL A;  2RN7 A;  4HQE A;  2MYS A;  2HDW A;  2BY3 A;  5CYV A;  4P55 A;  3H3U A;  2VOP A;  1WPK A;  1XD7 A;  4HLY A;  4B1R A;  1ULY A;  4IQ4 A;  2VT3 A;  1QZZ A;  1WHU A;  3G1M A;  4AVZ A;  5FD6 A;  4M3E A;  4LG0 A;  1HA8 A;  1P92 A;  3DEE A;  1I1G A;  1WJ5 A;  2XB5 A;  2VBZ A;  2VKH A;  1MBH A;  4EEF G;  3H35 A;  2ELJ A;  3KLO A;  3K2Z A;  5LEK A;  4L9T A;  3F6V A;  1R36 A;  3F8N A;  2YX7 A;  4KIS A;  2E60 A;  4RB1 A;  1ZN2 A;  5E8I A;  3IRQ A;  1MJ9 A;  2CJJ A;  1O7L A;  2DAO A;  2Y30 A;  3FF5 A;  3K9T A;  2OUM A;  4DBR A;  2EFW A;  3Q5F A;  2FX0 A;  1IRG A;  5ILS A;  2WY8 Q;  1K78 B;  3EUH C;  1YOV B;  3D0S A;  1SFU A;  4RGR A;  1WRJ A;  3GME A;  3RIR A;  3KE2 A;  1A31 A;  2BW3 A;  3COA C;  2R7F A;  3ZGK A;  2CQN A;  4HX8 A;  5GAD J;  4D1Q A;  3A0B C;  2HTS A;  2EWN A;  2L3D A;  3GTP J;  2H8R A;  4KN4 X;  3CUQ A;  3K4B A;  2E7X A;  3BG6 A;  2JMW A;  2ECC A;  1D1C A;  2K9Q A;  4YFK F;  3L09 A;  2B0L A;  2LY9 A;  1KQ0 A;  4I0A A;  5KK1 A;  1Y8R B;  2JSP A;  1HOM A;  3S1N J;  2HU9 A;  3AG1 H;  4JX6 A;  5D5X B;  4HZF A;  2BHZ A;  2A5Y B;  2GXA A;  2FRH A;  2FE3 A;  4HW0 A;  4IRH A;  4OIO F;  3JRI A;  1CF7 B;  3H92 A;  2CRG A;  2ZBK A;  3OS2 A;  4AIH A;  2EIM H;  5KAI C;  2GIZ A;  3MFK A;  1FBQ A;  3LST A;  4XRF A;  2CS3 A;  3DV8 A;  1ZAO A;  3PQJ A;  5CJ9 A;  4BQQ A;  2HVR A;  5FO5 A;  2BOL A;  5ED4 A;  2Z9O A;  3RDI A;  4ZDO A;  4HA8 A;  2FJ1 A;  4ZYE A;  2MG4 A;  2NYX A;  5M5W J;  2QLZ A;  2MBF A;  4ZTF A;  2HXO A;  3TKY A;  3R6S A;  2G0E A;  4OAY A;  3IL2 A;  3LMM A;  1HXD A;  3VYR B;  3K70 C;  3KLN A;  3BRO A;  2PBI A;  2JPC A;  4C3H J;  4F3Q A;  4V2F A;  2M3A A;  3ZOB A;  1WZ2 A;  4Y17 A;  3MN2 A;  3U1D A;  1W0U A;  3GFJ A;  3KP4 A;  3ASO H;  4ZDL A;  2H6B A;  2R0Q C;  4QSH A;  3VSL A;  2HOS A;  1I1S A;  1B6A A;  5EJC A;  5LRS A;  4I76 A;  3KET A;  2H94 A;  5L3G A;  1WSU A;  3CQZ J;  1WJC A;  2O9L A;  1J59 A;  1ZLK A;  4HSR A;  1QNT A;  2XB0 X;  1I3A A;  3IP4 B;  1H0M A;  2QBY A;  3E6M A;  5EGO A;  5FLX K;  2M8E A;  3U9G A;  3VDX A;  1JJ6 C;  3CES A;  3W2W A;  2H09 A;  1ZRC A;  2K4J A;  3QAH A;  1MH3 A;  3PQK A;  1I39 A;  2R7D A;  2OBP A;  2RAE A;  4IPA A;  1MBE A;  3I4M J;  2HKX A;  3GZ5 A;  4LLL A;  2LC2 A;  2JZY A;  4XLP F;  3OMY A;  3JTH A;  5J4V A;  4IZZ A;  2OTL I;  6PAX A;  4MFD A;  5J4Y A;  2RC4 A;  1NHA A;  2HI3 A;  1S7O A;  4KNY A;  2XPW A;  3D5L A;  4HNU A;  2LKP A;  1MH4 A;  2NVT J;  2Q1Z B;  4IF4 A;  3QOP A;  4UV9 A;  1DP7 P;  1JHH A;  1SVM A;  4MTE A;  4XOR A;  2COM A;  2XF6 A;  5EF6 A;  1YW9 A;  4G94 A;  3CD6 I;  5DCF A;  4CCL A;  3RYR A;  2DPD A;  4WXH A;  3CCE I;  2R5Y A;  2VB6 A;  5FRN A;  2O0Y A;  5AIQ A;  1I27 A;  1JT0 A;  1UAA A;  1YIO A;  3CF2 A;  2WBM A;  2PJP A;  2R5Z B;  4IHS A;  1J9I A;  2HZT A;  4DYQ A;  3OL4 A;  4KT6 A;  1SMT A;  2Q8K A;  1G8X A;  1T39 A;  2ACJ A;  4KN7 X;  2IGO A;  2VIX A;  1R00 A;  2ECB A;  3CCS I;  2STT A;  2ELH A;  1BA5 A;  2UUZ A;  4RM2 A;  1SD6 A;  2ZC2 A;  2GXG A;  3MZH A;  2C6Y A;  1LEA A;  1ETY A;  2P4W A;  4HLX A;  3L2R A;  3CDL A;  3I3L A;  3V7R A;  4BHP A;  3HHG A;  2L4M A;  4U0V A;  5FFZ A;  4RB2 C;  2P5L C;  5DD8 A;  2Z5U A;  2NVX J;  1UST A;  3JCU C;  4XLN F;  2F4M B;  2KZG A;  2F4O B;  4L9V A;  1MSE C;  3BOQ A;  3HBL A;  2VN2 A;  1DDN A;  3WGH A;  1LVA A;  2JWT A;  1R23 A;  1D1B A;  5LHG A;  2VC0 A;  2IJL A;  4HF0 A;  2VXD A;  1TWG J;  5J40 A;  4HYE A;  1V54 H;  2XAS A;  4PZJ A;  3K4K A;  2VOO A;  2KJC A;  3PNT A;  1R6R A;  3OIQ A;  4XLF A;  4AM3 A;  1YW8 A;  2V7F A;  3PNY A;  5J47 A;  3JRF A;  3KEY A;  1B72 B;  3OYK A;  3QP6 A;  4A6E A;  3ERM A;  3BT9 A;  1OR7 A;  2ISY A;  3NWS A;  3OYD A;  2PI0 A;  2H8W A;  4A0Y A;  1KQ9 A;  3AKZ A;  2PMH A;  3C1D A;  1UFM A;  3MKY B;  2ZNY A;  2JTV A;  2XF5 A;  3KX2 A;  1RUO A;  1ZQ3 P;  1OJL A;  1BI0 A;  1YIJ I;  5C44 J;  3VFZ A;  1I50 J;  1QA6 A;  2FF4 A;  3EPZ A;  1MZB A;  2BXZ A;  4PJ0 C;  2WAQ A;  2CW7 A;  2ZME B;  1YQA A;  1GXQ A;  3H5R A;  1ZGA A;  2AHQ A;  2IS4 A;  3H9G A;  2KKO A;  3E7L A;  4CIC A;  1Z1D A;  3OV8 A;  3GTK J;  1IAW A;  3GTL J;  1BW5 A;  2V1X A;  3LQR A;  2DPU A;  4NUB A;  2W82 A;  2WC2 A;  2JUC A;  4G8X A;  2VJ5 A;  5HOO A;  2EZK A;  3KP3 A;  1XS9 A;  2DTZ A;  3B73 A;  3VB2 A;  1ZAR A;  3FZV A;  3SEZ A;  1POG A;  4G7Z F;  2HR3 A;  5LRR A;  1EV7 A;  2A5W A;  3AAF A;  3MVP A;  4AUX A;  2LLK A;  1RUN A;  1KU3 A;  1QRY A;  4XKC A;  3TP3 A;  2IRF G;  1TWC J;  3IV5 A;  5F27 A;  2W25 A;  1TQM A;  2FA5 A;  2NOJ B;  3D1N I;  1HKQ A;  1T0F C;  1QQI A;  3HRU A;  2JUG A;  5D5V B;  2Y2Z A;  4A2U A;  4Y13 A;  2A6E F;  2OQR A;  2Z3Y A;  2GBY A;  3GW2 A;  1JTX A;  1UG2 A;  4LD5 A;  1S3J A;  3H9Q A;  1VQ8 I;  1T8I A;  3DCF A;  2QWW A;  3BCA A;  3GLX A;  2PN6 A;  3CCY A;  4BE1 A;  4BBR J;  5DEQ A;  1G59 A;  4BXF A;  1FOY A;  3DEU A;  2JVH A;  2JRM A;  2Q2E B;  1TBX A;  4LLG F;  1DPR A;  3SZG A;  3GFL A;  4XNF A;  3H36 A;  5FB2 A;  1R5G A;  2VOD A;  4PGH A;  4IO9 F;  2VE9 A;  3N97 A;  2VPL A;  2V6C A;  4IL6 C;  2XC7 A;  2JK3 A;  3DF8 A;  1YX3 A;  3REO A;  1ZR4 A;  2WAQ N;  3TO7 A;  1GT0 C;  3GYH X;  1STZ A;  4XR6 A;  3GWZ A;  4BQA A;  4L5J A;  5EEG A;  3TW7 A;  4AD9 A;  4BU2 A;  3OYG A;  1X58 A;  1XN7 A;  4U7D A;  1D8K A;  3UKG A;  2OA4 A;  1U78 A;  3ZMS A;  1X2M A;  4KIF A;  3CMY A;  4E7L A;  2AXL A;  2G9W A;  2Z99 A;  1B8I B;  2FQ3 A;  4I6Z A;  4M71 A;  3GTM J;  2P81 A;  3S16 J;  3GLL A;  1KGS A;  4GYG A;  1QHH D;  3ZQG A;  1R7J A;  2NNY A;  4J00 A;  1VQO I;  1MMG A;  2XGC A;  3JRG A;  1IUF A;  2DJI A;  4IQJ A;  2K9M A;  3DTI A;  3D5S C;  3PFI A;  5IY5 H;  2X0L A;  2MH9 A;  3K0L A;  1MNE A;  2XHK A;  3F21 A;  2FQ4 A;  5K7F A;  4LOC A;  4BYY A;  2XV4 S;  2M1B A;  2UXN A;  1E0E A;  1E3P A;  2VLA A;  3DBL B;  2DA6 A;  2E5N A;  3HB9 A;  3UR3 C;  2KMU A;  1O3Q A;  1GXP A;  2DOE A;  3GTG J;  1DGR M;  1XCB A;  3EDP A;  4BEH A;  1U5T A;  3K1M A;  3AL0 B;  2BY0 A;  5L3E A;  2VI6 A;  4UVB A;  4Y7N J;  2DA4 A;  4XBF A;  1EF4 A;  3G2B A;  1UG0 A;  5IP7 J;  4BE0 A;  1A04 A;  1FOW A;  3BCB A;  3S2H J;  3HL2 A;  5IP6 A;  3RSN A;  1HC8 A;  2CGP A;  3BTC A;  3ABK H;  3QYE A;  2X6O A;  4K2E A;  1LE8 B;  3EYI A;  4YII A;  2RDP A;  2BEO A;  2D1H A;  2E2J J;  4B44 A;  3BR5 A;  1UHS A;  3B6C A;  2KRH A;  2M87 A;  4XKW A;  4D7M A;  3CCL I;  1XPX A;  2NNN A;  3C2H A;  2VKE A;  5FKO A;  2OQG A;  4CYC B;  2IPQ X;  1W1W E;  2DDB A;  3CO6 C;  1EKE A;  4KIG A;  1UHW A;  2CW8 A;  4EQQ A;  3FMQ A;  3KP7 A;  4A6D A;  1Z6T A;  1EH7 A;  1V5F A;  4D7N A;  1K79 A;  1VND A;  3I71 A;  4BHB A;  4EAT A;  1X1B A;  1M1E B;  3WU1 B;  2LTP A;  1TW3 A;  4Q5S F;  1ON2 A;  2DK5 A;  2W57 A;  5JR3 A;  4HF1 A;  2M34 A;  1GHC A;  4EM0 B;  4C2T A;  1WH7 A;  5BPI A;  3BZ6 A;  3FXU A;  3V4G A;  2HEO A;  2WWY A;  1E17 A;  2Y69 H;  2Y0M A;  4N4N B;  1SFO J;  2EQR A;  2WV1 A;  3K7A J;  3TOA A;  3SYT A;  5F6F A;  4PSW A;  4J19 A;  3MKL A;  2EH3 A;  1NH3 A;  2OC6 A;  2HQR A;  3LA3 A;  4XSX F;  2ZXH A;  3T0Y A;  3BP8 A;  5HS7 A;  3PUB A;  3R61 A;  3PIP F;  3FBI B;  2LVS A;  2RNJ A;  3CJR B;  2CU7 A;  2M7B A;  2A6H F;  1LFU P;  2GA1 A;  3OSF A;  1ODD A;  1XSV A;  4EJU A;  3LWF A;  1AU7 A;  1YFH A;  1G4D A;  2E71 A;  4XK4 A;  1HKT A;  1Y0N A;  3CZ6 A;  5HDG A;  1EA3 A;  5KCM A;  4XID A;  3LQQ A;  1N78 A;  3MAJ A;  4P9F A;  1ZHF A;  4WWC A;  3DKW A;  1PYV A;  1MJB A;  1A6Q A;  1KYW A;  4A3F J;  4UV8 A;  4Q47 A;  3OSG A;  1JTY A;  2M4K A;  1K78 A;  2WAD A;  2PQ8 A;  2MC3 A;  1JUS A;  3L1P A;  3DPU A;  5J8F A;  4BKX A;  2QQ9 A;  3TBI A;  5E3L A;  1FOK A;  4LB5 A;  3DBH B;  2V1D A;  2VQH A;  4LIU A;  1XMX A;  2UXX A;  3V7S A;  5JVG F;  2LNB A;  5ICE A;  1KA8 A;  1GDT A;  4RBO A;  1WVR A;  3HUG B;  2VL8 A;  3R60 A;  4M6X A;  2EK5 A;  3SDG A;  1SD7 A;  4CO8 A;  2X1D A;  4BNC A;  2LY2 A;  2OV7 A;  5CVV A;  4BXU A;  3I4N J;  1MSF C;  2YU3 A;  1IXC A;  3IKV A;  1CF7 A;  1JKO C;  1ETK A;  4BDY A;  2MAB A;  3T8R A;  3L2W A;  1I6X A;  1FWZ A;  1RZ4 A;  5E1X A;  1T2K A;  4KYW A;  2XGE A;  1VQ4 I;  2OAZ A;  1YO5 C;  1UEL B;  3ZN1 A;  1XDU A;  2W24 A;  2VAS A;  3BR1 A;  3ONQ A;  1IN4 A;  3LSM A;  2NOG A;  3M8F A;  4MIM A;  3LSG A;  3J81 K;  2CH0 A;  3PSI A;  4II3 A;  1PUE E;  1ETV A;  1TNS A;  3BR6 A;  3MZY A;  4L5E A;  1A36 A;  2MGQ A;  1Z91 A;  2ME0 A;  3R0J A;  3RQ4 A;  1W36 C;  1YE9 A;  3HC7 A;  1FP2 A;  2VUM J;  2JA2 A;  3KZY A;  2EFQ A;  3IRR A;  4G6Q A;  2I5U A;  3E6D A;  5LHI A;  2R7R A;  2NAZ A;  4DZJ A;  4CCO A;  2X4H A;  4F93 B;  2R7O A;  4A0X A;  1YLF A;  2ZO4 A;  2ID3 A;  4P1W A;  1N75 A;  2O03 A;  2QF7 A;  3I54 A;  1T98 A;  3LFU A;  4YG2 F;  1JE8 A;  3VPR A;  1U8R A;  1REP C;  1KU2 A;  4C30 A;  3VYS B;  2H1L A;  1IN7 A;  1WJF A;  2R7S A;  1AOY A;  3KYL A;  2E1C A;  3G1O A;  2MD5 A;  3HG9 A;  1OFC X;  2G7U A;  1KU9 A;  1XGS A;  2RKH A;  3HYI A;  1J0R A;  4G9Y A;  2CYY A;  2GZW A;  4LFU A;  5BMZ A;  3BTJ A;  1OCC H;  1LFB A;  3L2C A;  1PVE A;  4RAZ A;  3KCC A;  3WHB A;  3W3C A;  3OYF A;  1MDM B;  3I5U A;  4HV6 A;  2PMU A;  5HNF A;  2K5C A;  3C7J A;  1FLI A;  4UB8 C;  4BDZ A;  1CGP A;  2ZSI B;  4BJT A;  4BY7 J;  2BHY A;  3QYF A;  2GQQ A;  3ELK A;  1X2N A;  4ZYG A;  1R1V A;  3F9K A;  4JYK A;  2OF7 A;  2N8G A;  2DMP A;  1OR7 C;  1ENH A;  1H89 C;  4ENM A;  2LMD A;  3IH2 A;  1LNW A;  4A5N A;  3SJM A;  2W7N A;  3V8L A;  5F0H A;  4RA2 A;  2BY1 A;  4V2G A;  1LVK A;  3OR1 C;  5FKL A;  3VYT B;  2L7M P;  3NEU A;  4DOZ A;  1UZC A;  3D5R C;  4UUS B;  2FUG 2;  2NXN B;  1DQU A;  1TL8 A;  3KEQ A;  1S8N A;  4MO7 A;  1LB2 A;  3RCO A;  2X48 A;  3S17 J;  2IS1 A;  1RC9 A;  3LFK A;  2R5Z A;  1BJA A;  3QU6 A;  3F72 A;  1E2X A;  5FLX Z;  2HPM A;  1MBJ A;  2R3S A;  2FMY A;  4NHJ A;  3OIO A;  1FSH A;  4BQN A;  2JT1 A;  3F8M A;  1U0J A;  5TJJ A;  1T38 A;  2QSH X;  2JA6 J;  5L3D A;  1FBS A;  3RPU D;  2K40 A;  3BJ6 A;  3FMS A;  1O3T A;  3K4N A;  4RAF A;  5L3B A;  1YG2 A;  3CO7 C;  3RZD J;  1R49 A;  2BVL A;  3NAU A;  3ZCO A;  1H8A C;  3WE3 A;  5A2Q K;  5F04 A;  1X3Z B;  2EZH A;  2PFB A;  4ZYA A;  1FIP A;  3WGG A;  2IP2 A;  3HJE A;  2O6G E;  3IHU A;  1L0O C;  3LSJ A;  1FMW A;  2TDX A;  1O57 A;  2KL4 A;  2AQE A;  4A3D J;  2IA0 A;  3M9A A;  1S7A A;  1A6I A;  4BAC A;  1Z67 A;  2MLG A;  1K4T A;  1RR8 C;  5M5Y J;  4A3C J;  5ERI A;  3OYI A;  3BWG A;  3OYA A;  2XSD C;  4MGR A;  2EZL A;  1ZGW A;  5F1J A;  3CMM A;  4EMS A;  3WG7 H;  3L2V A;  1BR1 A;  3JRB A;  3MKW B;  2EA4 A;  2OU2 A;  5FD5 A;  2IEK A;  3HTU A;  3KZZ A;  2IBD A;  4RGU A;  1S6L A;  2MD0 A;  4XN0 A;  2ZJ2 A;  5E3O A;  3BG5 A;  4NDL A;  2DQL A;  3S8P A;  5J1Y A;  2K86 A;  4RDU A;  3DTK A;  3BY6 A;  4YEJ A;  4ZYD A;  1U3E M;  3HOX J;  1B72 A;  4AVP A;  2M0M A;  4A3G J;  1IXR C;  3RYP A;  2KIF A;  1E3O C;  1WJA A;  4F91 B;  3LAP A;  2D1V A;  5CVU A;  4IHV A;  1IZ1 A;  1IO2 A;  2XSJ C;  4M74 A;  3P7N A;  1X1A A;  5LGN A;  4BXX J;  2FOK A;  2UV1 A;  4HEA 2;  4RLF A;  4B09 A;  1MGT A;  4CGZ A;  4A3M J;  2P0W A;  1P9Q C;  3NWT A;  2FU4 A;  3ULQ B;  2R7X A;  3L00 A;  2R7Z J;  4RAY A;  4WXC A;  2DMU A;  2O3F A;  5EG0 B;  2ZME A;  3OYH A;  1Y0U A;  3EET A;  3QOD A;  3A01 B;  3ABL H;  1P4A A;  3H5N A;  2QSF X;  4XN3 A;  5E20 A;  1MBG A;  4YEL A;  3AG2 H;  4A3K J;  2HYF A;  3FXL A;  1BIB A;  2HKO A;  4KIT B;  3AFH A;  2WAF A;  1LPQ A;  2V79 A;  3I58 A;  1RKT A;  2EIK H;  2PG4 A;  2D5V A;  1Y56 A;  3O3K A;  3CJN A;  2QQA A;  4NC6 A;  1KYZ A;  1K6O A;  1LJ9 A;  2HOE A;  2ZXJ A;  4B43 A;  3CCU I;  1UHM A;  4TV7 A;  3LA2 A;  3RTR A;  5DD4 A;  3IC7 A;  2ME6 A;  3QOE A;  5K1Y A;  3MWM A;  2XAU A;  1NK2 P;  1YYV A;  2KIQ A;  3HPG A;  1J09 A;  1G2H A;  2OJE D;  3WU2 C;  5BOX A;  1U5T C;  3KFW X;  5HLH A;  1FYK A;  2K9N A;  3JSO A;  4NQW B;  2AXT C;  2L7Z A;  2XPU A;  1LUJ B;  1B9M A;  1OKR A;  2AQF A;  1TP4 A;  2M5W A;  2A69 F;  5EZH A;  2Q2E A;  2DDA A;  3FXM A;  2MC4 A;  2M2E A;  4WCG A;  3CJT B;  4RM3 A;  1XSD A;  3GZ6 A;  5HDN A;  2BYV E;  1Q1H A;  2X6W A;  5BS6 A;  4AU7 A;  3F6O A;  5ICG A;  2LF7 A;  3BR2 A;  4KJZ A;  3A4C A;  4R1H A;  3G6E I;  2P6T A;  3HIF A;  2F5C A;  3U21 A;  4AWX B;  1OLT A;  3Q0U A;  2Y9Y A;  1IGN A;  1TQI A;  1D8J A;  4W1U A;  1QHG A;  1FZP B;  1AKH B;  2FNP A;  4FE7 A;  4WXD A;  1ITY A;  2P8T A;  2E36 A;  3TGN A;  3BR0 A;  4XKB A;  5LD2 C;  2VT2 A;  2XAQ A;  2M9H A;  3ESW B;  2XGD A;  3A2K A;  1B8I A;  3BZK A;  2MFZ A;  2EIJ H;  2GLO A;  2OZU A;  4B8X A;  1J75 A;  3BQZ A;  4RLQ A;  2P5K A;  4DIQ A;  1JJ8 C;  4RMN A;  5IOZ A;  3E5X A;  2JRT A;  2K9S A;  4N9I A;  4A3L J;  2P7V B;  1O3S A;  4F55 A;  2O61 A;  3VEP A;  4U7B A;  2M45 A;  5CLS A;  4RGS A;  3BDD A;  4CDG A;  2IW5 A;  1VFC A;  1T56 A;  1J2X A;  4RS8 A;  3M8J A;  1S7E A;  2J5P A;  3FIW A;  1K61 A;  3CC4 I;  3HOV J;  3G4S I;  3OYB A;  3OL3 A;  3I4P A;  3BZC A;  1R22 A;  3ABM H;  4HDV A;  4FCY A;  2ESN A;  1A5J A;  2H27 A;  4HRI A;  2L9R A;  4N9H A;  1W5S A;  4M3G A;  1HSJ A;  1GV2 A;  2HYG D;  2XRN A;  1HCR A;  1Z7U A;  4Y52 J;  3A1Y A;  5D5U B;  1BBY A;  3GBG A;  4E7H A;  4M3F A;  3E0J B;  3RKY A;  2HZD A;  5LBQ A;  1BI1 A;  3IAM 2;  2BZT A;  5JI6 A;  3HSF A;  3BG9 A;  2ZXW H;  4G12 A;  4PGG A;  3PUF A;  1S29 A;  2EA2 A;  3F8F A;  3IKT A;  1ETX A;  3VYU B;  3FXO A;  3GXO A;  2WB1 A;  4YFX F;  3V42 A;  1XMK A;  3PL8 A;  3JRD A;  4LIV A;  1LE8 A;  3VOD A;  1N77 A;  3TO6 A;  2VKD A;  1P4W A;  2VBW A;  1FX7 A;  1TT5 B;  3RJP A;  4YFN F;  4OOI A;  4II2 A;  3ZR8 X;  3A0H C;  4ZZD A;  1KZH A;  2ESH A;  4R8H A;  2FOW A;  3UNG C;  1YS7 A;  4CYC A;  3O8H A;  3OY9 A;  2ICW G;  4HPQ A;  3DP7 A;  2QQB A;  1RR7 A;  4E6K G;  2ID6 A;  4PSX A;  2PMZ A;  3S3O A;  1NG7 A;  2STW A;  4ITV A;  5BPD A;  3HSE A;  4ENN A;  2P7C B;  4W97 A;  2M4G A;  2XAF A;  3EUH A;  5K5R A;  2L2O A;  4XRS A;  2QBY B;  2H1K A;  1OMI A;  2L02 A;  3M07 A;  4D5F A;  5TRD A;  5CKT A;  3TW6 A;  2KZV A;  3DLL F;  2CUF A;  3OIP A;  5HS9 A;  2JVG A;  3KP5 A;  4M3B A;  3ERE D;  2L9V A;  3OWT A;  1BOA A;  1ETQ A;  2VJI A;  5HDK A;  1APL C;  5C4J J;  3H9J A;  5IT9 K;  4X6A J;  1K7A A;  5FKM A;  1LDK B;  9ANT A;  4UVC A;  4BAY A;  1JHF A;  4EJT A;  3L2Q A;  3GCM A;  2B7E A;  2RRE A;  2Z2S B;  1F36 A;  3QPH A;  4XMY A;  4M3D A;  3MMY B;  3JTG A;  2I8D A;  3SZT A;  2WB1 N;  2DU9 A;  3O8G A;  4BHC A;  5JFR A;  4A3J J;  1OYI A;  2CV2 A;  2CUE A;  2KP6 A;  1J7K A;  2R7T A;  2K85 A;  3E97 A;  4D0P A;  3HGY A;  2LG4 A;  4PFO A;  5E8G A;  4CYD A;  4E4H A;  2CV1 A;  3W2A A;  1MBK A;  4BJ6 C;  2Q0O A;  4UUV A;  2HVS A;  1P4X A;  1LDD A;  4ZC3 A;  3MQ0 A;  4I99 C;  3HXL A;  1WI9 A;  2KIS A;  2VXZ A;  1F1Z A;  5E18 F;  2XAJ A;  5HS8 A;  1PP8 F;  1BN5 A;  2NVQ J;  4F92 B;  4KFC A;  1YRN B;  3EUA A;  5JHU A;  5HNH A;  3X2Q H;  3M7G A;  4S05 A;  2ZSH B;  1L3L A;  2PMZ N;  2TRT A;  3RPU A;  4FX0 A;  1CQT A;  3F22 A;  4GDF A;  1V55 H;  1HLV A;  2HDD A;  1OPC A;  1GLN A;  3CCM I;  5H2F C;  2R7W A;  3MCZ A;  4Z6Y A;  4IHX A;  1Z6R A;  5TIS C;  2F5E A;  3HUG A;  2HVQ A;  1R1T A;  3T1B A;  3G71 I;  3QPS A;  1LQ1 A;  1IN5 A;  4XOT A;  1UJ8 A;  3HRT A;  2H6C A;  5DM6 F;  1H88 C;  4N0B A;  3HOY J;  2GAU A;  1IV8 A;  4LGW A;  4OIR F;  2OZ6 A;  2VJ4 A;  3ML6 A;  4BH9 A;  1IW7 F;  1Q1V A;  1X19 A;  3R4K A;  3TED A;  2E1O A;  5HOD A;  3LOC A;  4HQM A;  4CA0 A;  2EV5 A;  4XON A;  5EEA A;  3OR2 C;  2R7Q A;  3FDY A;  4OWR B;  5FKK A;  1YJW I;  4BE2 A;  3HOU J;  2CQX A;  2KDZ A;  4HNT A;  2DA2 A;  3ABT A;  5FRO A;  1DU0 A;  1NG6 A;  2KIM A;  1K6Y A;  2L4A A;  3DBR B;  4G6D A;  5E3N A;  1DUX C;  3W6J B;  3J80 K;  1X1D A;  3F3X A;  4MQV A;  5J1R A;  4C2M J;  3SXY A;  5D6F A;  1QU3 A;  1I3Q J;  4XOP A;  3MD2 A;  4FAS D;  5IT3 A;  1OIS A;  4XKV A;  3V8J A;  3BJA A;  2V9P A;  4MEX F;  1LEB A;  4IOC F;  4E7Z A;  5HLT A;  4ZH4 F;  1BOB A;  1VI0 A;  4FQG A;  4ENJ A;  2D45 A;  2YU9 J;  4GYI A;  5FRM A;  2RNG A;  4DZP A;  3CCV I;  4KMU X;  1S5L C;  2GWR A;  4AC0 A;  3MZ8 A;  3CUQ C;  3DU6 A;  4XLC A;  4JBA A;  3CLQ A;  5IYD J;  3ZXS A;  3S3N A;  2DT7 B;  5HLG A;  1HQC A;  2Z16 A;  2PJR B;  2K3F A;  4UUT A;  3SDB A;  1JKQ C;  1XGN A;  3PNV A;  3ZQI A;  4IXA A;  2BE5 F;  4UXN A;  2JSC A;  3ZQH A;  4UHT A;  3ZN0 A;  4DBQ A;  4QPQ A;  5B1B H;  2KLO A;  3SFI A;  4CZZ A;  5C3E J;  1MDM A;  1ZLJ A;  1VTN C;  4EJW A;  1W7P B;  2R7U A;  4C2U A;  2IT0 A;  1D1A A;  2FEZ A;  4IRG A;  1JGS A;  5IPA A;  3EUK L;  3J81 Z;  1BIA A;  4ESJ A;  4IHT A;  5DTD A;  2HS5 A;  2V4J C;  4PUS A;  2L9S A;  2HOT A;  4AYB N;  5GPC A;  4EJO A;  2CFO A;  2F6C A;  2AS5 F;  3W2V A;  1IV6 A;  3GTQ J;  4A5M A;  1X3U A;  2LP0 A;  3OOU A;  3L9F A;  4XLH A;  1QZY A;  1ZK8 A;  3U1K A;  1KU7 A;  2GA2 A;  4PCQ A;  4LMY A;  4UNO A;  4UUS A;  3WE2 A;  4AID A;  2DMT A;  4BL0 B;  3E6C C;  3KIO A;  2DLL A;  2BVM A;  2WAE A;  3FHZ A;  1WJB A;  3E1S A;  4O5V A;  2B9S A;  2K27 A;  2ZXI A;  1G3T A;  1SAU A;  5JHF A;  2LH9 A;  2VKV A;  4I09 A;  2WV0 A;  1Y39 A;  5GAE J;  3CC7 I;  2HGC A;  2CMP A;  1IF1 A;  3A02 A;  2IA2 A;  2JA8 J;  4LIT A;  1YTY A;  5ICC A;  4B3A A;  2K3P A;  1XX5 A;  1FTZ A;  5FFX A;  3BG7 A;  3GVA A;  2RQP A;  4JQF A;  3I0T A;  1IRF A;  4X1E A;  3CC2 I;  1MMN A;  4NC8 A;  3O2P E;  4HDU A;  1QVU A;  3JAM K;  4G6T B;  4OIQ F;  3T5X A;  2X6X A;  1D0X A;  3BTI A;  2ZNZ A;  1D3Y A;  2FBH A;  4MLO A;  5LGT A;  2QEX I;  1JUP A;  4E7I A;  1H9T A;  1UCR A;  1GVJ A;  5D8L B;  2E19 A;  2F48 A;  4IVN A;  3B02 A;  2ZJP F;  2E5Z A;  1IRX A;  5H6Q A;  3SZP A;  3WTY C;  2IS6 A;  3CCJ I;  5ICF A;  1PJR A;  2NS8 A;  4BUP A;  3JW4 A;  3I56 I;  3KYD B;  5BNG A;  3EQL F;  4BQO A;  3I55 I;  1VQL I;  2NS0 A;  3H5A A;  3HPH A;  2PEX A;  2CV0 A;  3FM5 A;  1T0F A;  2XAG A;  2KDO A;  2CW0 F;  1SFX A;  4GFB A;  2OD5 A;  4YRV A;  5E3M A;  2AO9 A;  3EYY A;  4CXF A;  3GF2 A;  4FTH A;  3M4O J;  1P2F A;  3V8K A;  4XSZ F;  5AON A;  2I10 A;  1GV5 A;  4LK0 F;  1SAN A;  1XGM A;  2X1C A;  4MEY F;  5DV5 A;  5DCM B;  4PJN A;  2DMN A;  2X9D A;  3ZRG A;  2FBK A;  3HOZ J;  1HW1 A;  1RRJ A;  4LLN A;  3DQV C;  3J7A Y;  1PUF B;  2W48 A;  3ZPL A;  5DM7 F;  5A2Q Z;  1IG7 A;  4A93 J;  1RKW A;  4LG3 A;  3BG3 A;  1TT0 A;  3K4L A;  5BQT A;  5EG0 A;  4ASN A;  3WTZ A;  5GAH J;  1XG1 A;  1FTT A;  2P5V A;  1S9H A;  1HST A;  2GIV A;  3A03 A;  2VJJ A;  4P96 A;  2VQG A;  3ZQQ A;  3CJQ B;  1MNM C;  1OQY A;  3TL4 X;  4GGG A;  2W1O A;  3DTE A;  4JX4 A;  4YIR X;  1EH6 A;  5AIP A;  3GO5 A;  3OYJ A;  2EJR A;  5K5O A;  2WY7 Q;  3RKW A;  2EIL H;  4XLA A;  3KYC B;  5F1R A;  2EB7 A;  3GEZ A;  4XRM A;  1YJ9 I;  4RB0 A;  5DUI A;  1TWF J;  2ZJR F;  4XM3 A;  3S1M J;  2VPR A;  1EJ9 A;  4F52 A;  1RES A;  5KNL A;  2E34 A;  2GM4 A;  1Z7L A;  3HOS A;  2O5R A;  3RKQ A;  4ZYH A;  2QUF A;  4AIK A;  1R5H A;  4HX4 A;  2YR2 A;  3SHF A;  4DNC A;  5D6E A;  4Q48 A;  1VQM I;  4NQW A;  3P5J A;  1TWA J;  4A3I J;  4PJJ A;  4ENK A;  3WTW C;  4RB3 C;  3DU5 A;  4Q4Z F;  4EVI A;  2CO5 A;  3GUD A;  2CFX A;  1K4S A;  1IN6 A;  1WJE A;  1X1C A;  5H20 A;  3BPX A;  2K9L A;  1K83 J;  3S93 A;  3PIO F;  3KEO A;  3KP6 A;  4P5O A;  3GZN B;  3QPL A;  2HXI A;  1W5T A;  3DKX A;  4M9Z A;  2LBF B;  1R5I D;  3K70 D;  1AKH A;  3QU3 A;  2A3S A;  4MFE A;  5KAF C;  2MW8 A;  3GFI A;  1FYM A;  1TW2 A;  2TCT A;  5KVR A;  3H3V K;  1TWH J;  3AG3 H;  2FSW A;  1WH5 A;  3WOD F;  4R79 A;  5ILU A;  3H0D A;  3K6G A;  4ABZ A;  2KHM A;  3LSP A;  3LSR A;  1GUU A;  1WFX A;  2BXY A;  3DPL C;  3HHH A;  1VQ6 I;  1OYY A;  1JT6 A;  2RVC A;  2E1N A;  4XQF A;  4ETS A;  5GPA A;  3G3Z A;  1ZG1 A;  2JA7 J;  1EH8 A;  5CVI A;  2IGK A;  1XSX A;  1SFE A;  1ZG3 A;  3QYB A;  5F08 A;  3ZQ7 A;  5JLW A;  2DA5 A;  4KIC A;  4HST A;  1FBU A;  1S72 I;  3CP2 A;  2YUS A;  3L7W A;  1WJD A;  4PFP A;  4DQ2 A;  3E6B A;  3FXR A;  1RIO H;  2M7A A;  4QLC U;  3M1C A;  4C3I J;  2DW4 A;  1WGX A;  2WA0 A;  5LEJ A;  2COB A;  1Y8Q B;  1OCZ H;  2DMQ A;  2CQ7 A;  4J01 A;  3LAJ A;  2KQR A;  2RQQ A;  5K7H A;  2FD5 A;  5LGU A;  1FP1 D;  2W85 A;  3CCR I;  1YX5 A; 
#chains in the Genus database with same CATH homology
 4S0H B;  4M3G A;  2M8G X;  3GTG J;  4BBS J;  1GV2 A;  1HCR A;  2O8K A;  1IRZ A;  4Y52 J;  4QIW N;  5C4X J;  3GBG A;  3NAR A;  3LNQ A;  4M3F A;  2VI6 A;  3C2B A;  4Y7N J;  2DA4 A;  3IH3 A;  3K2A A;  4XIC A;  1EF4 A;  3BG9 A;  4G12 A;  1HDD C;  5FJ8 J;  5IP7 J;  1ETX A;  3S2H J;  2OPT A;  2DN0 A;  3JRC A;  5IP6 A;  3HDD A;  4A3E J;  3JRD A;  3FK7 A;  3BTC A;  3Q3S A;  3A01 A;  1LE8 A;  2X6O A;  1LE8 B;  1BL0 A;  2HYJ A;  2E2J J;  3BR5 A;  2JN6 A;  1UHS A;  3GTJ J;  3B6C A;  1RET A;  4D7M A;  2HQ5 A;  1NTC A;  2VKE A;  5FKO A;  2LR8 A;  4CYC A;  3O8H A;  4CYC B;  3S14 J;  2DA3 A;  4M6V A;  2ELK A;  1VF9 A;  1RR7 A;  5IYB J;  1ZTR A;  2ID6 A;  2B63 J;  1JUM A;  4D7N A;  2JA5 J;  1VND A;  2XPV A;  4JP0 A;  4W97 A;  4A69 C;  2DJN A;  2LTP A;  2M34 A;  4XRS A;  2H1K A;  1WH7 A;  4D5F A;  4DYC A;  3TW6 A;  1WI3 A;  3PO2 J;  2CUF A;  1SFO J;  2EQR A;  1P7J A;  2WV1 A;  4M3B A;  2M0C A;  3K7A J;  4BY1 J;  5EDN A;  4J19 A;  3MKL A;  2EH3 A;  1APL C;  1ETQ A;  5C4J J;  1WPK A;  4X6A J;  5FKM A;  4B1R A;  9ANT A;  2LVS A;  3G1M A;  2CU7 A;  5IOY A;  4M3E A;  1LFU P;  3RZO J;  3OSF A;  1F36 A;  2XB5 A;  4IHY A;  4M3D A;  1MBH A;  4EEF G;  2WB1 N;  3O8G A;  1AU7 A;  3ZQL A;  4A3J J;  2CUE A;  4XK4 A;  1U9N A;  1DU6 A;  4XID A;  3HGY A;  3BR3 A;  1MBK A;  2CJJ A;  1T33 A;  2Y30 A;  2NVQ J;  4A3F J;  2FX0 A;  1YRN A;  3HM5 A;  1YRN B;  2LKX A;  3OSG A;  1JTY A;  1IDZ A;  1FIA A;  5JLX A;  1JUS A;  1W0T A;  2PMZ N;  2TRT A;  3L1P A;  5M3F J;  4BKX A;  1CQT A;  3FKI J;  1HLV A;  5E3L A;  2HDD A;  2O7O A;  3GTP J;  2H8R A;  4IHX A;  3JRE A;  3S1R J;  1GDT A;  2JMW A;  2ECC A;  4RBO A;  2K9Q A;  1WCM J;  2DA1 A;  2LY9 A;  3QPS A;  3SDG A;  1R9T J;  1HDP A;  1HOM A;  3S1N J;  1H88 C;  4JX6 A;  3HOY J;  3I4N J;  1TC3 C;  1MSF C;  1Q1V A;  1JKO C;  1ETK A;  3TED A;  2E1O A;  3JRI A;  2CRG A;  5HOD A;  2ZB9 A;  3LOC A;  2LFB A;  5EEA A;  5FKK A;  4A3B J;  3HOU J;  2CQX A;  2XGE A;  2KDZ A;  1JGG A;  1OCP A;  2DA2 A;  4D5C A;  3BR1 A;  1DU0 A;  2FJ1 A;  2NOG A;  4MIM A;  3LSG A;  2MG4 A;  1ETV A;  2DA7 A;  3BR6 A;  4L5E A;  5E3N A;  5M5W J;  3S1Q J;  2MGQ A;  2ME0 A;  2VUM J;  3HEF A;  3ZQC A;  5J1R A;  2HXO A;  4C2M J;  2G0E A;  4DZJ A;  1I3Q J;  1QPI A;  2CQQ A;  4C3H J;  3FK6 A;  2ID3 A;  2YU9 J;  1VI0 A;  1MBF A;  4V2F A;  3ZOB A;  2QF7 A;  3MN2 A;  4DZP A;  1W0U A;  1BJZ A;  1O4X A;  4AC0 A;  3VPR A;  2R0Q C;  2HOS A;  4QSH A;  3GTO J;  3B6A A;  2LK2 A;  4I76 A;  5IYD J;  3CQZ J;  2O9L A;  1ETW A;  3G1O A;  5J3L A;  2XB0 X;  1OFC X;  4UUT A;  1JKQ C;  1BW6 A;  5EGO A;  3ZQI A;  1JJ6 C;  5EGO B;  2EBI A;  3ZQH A;  3BTJ A;  3JRA A;  1MH3 A;  1LFB A;  3SFI A;  5C3E J;  3WHB A;  3DEW A;  5DS9 A;  2RAE A;  1MBE A;  3I4M J;  5IPA A;  2E2I J;  1IC8 A;  4BY7 J;  5DTD A;  1ZKG A;  1X2N A;  2HOT A;  3Q0W A;  4MFD A;  4AYB N;  5GPC A;  4JYK A;  2OF7 A;  2N8G A;  2HI3 A;  2DMP A;  1ENH A;  2IAI A;  2XPW A;  1H89 C;  1IV6 A;  3GTQ J;  3IH2 A;  3SJM A;  1MH4 A;  2LP0 A;  2NVT J;  3OOU A;  3S2D J;  5F0H A;  4V2G A;  1ZK8 A;  1JKR C;  4QTR A;  5FKL A;  3BQY A;  1FEX A;  4UUS A;  2L7M P;  5EF6 A;  3HOW J;  4UUS B;  1QVT A;  2R5Y A;  2DMT A;  3F0C A;  3JRH A;  2R5Y B;  3PM1 A;  4MO7 A;  1JT0 A;  2X48 A;  3S17 J;  5GP9 A;  2R5Z A;  1P7I A;  3TP0 A;  2R5Z B;  2E2H J;  1MBJ A;  2VKV A;  4DYQ A;  4B4C A;  3OIO A;  2JA6 J;  2ECB A;  2JA8 J;  3A02 A;  2K40 A;  1BA5 A;  4B3A A;  1ORK A;  3RZD J;  1FTZ A;  3NAU A;  1ETY A;  1H8A C;  5F04 A;  2EZH A;  3CDL A;  2Y9Z A;  1FIP A;  4X1E A;  1JKP C;  3LSJ A;  4JX5 A;  3BTL A;  2NVX J;  1QVU A;  4A3D J;  2HOA A;  1A6I A;  3BTI A;  5M5Y J;  4A3C J;  4MLO A;  1U8B A;  1JUP A;  2XSD C;  1MSE C;  2EZL A;  1ZGW A;  1U9O A;  3HBL A;  3ZQF A;  5F1J A;  2E19 A;  3JRB A;  1UMQ A;  2JWT A;  2IEK A;  2NS8 A;  2IBD A;  5BNG A;  1NK3 P;  2Y0S N;  5E3O A;  1TWG J;  3BG5 A;  4NDL A;  2KT0 A;  5F0C A;  5J1Y A;  4GFB A;  4RDU A;  5E3M A;  2AO9 A;  3HOX J;  1B72 A;  3JRF A;  4FTH A;  1B72 B;  3M4O J;  2LD5 A;  4A3G J;  2EZI A;  3BT9 A;  1ZR2 A;  1E3O C;  2I10 A;  1GV5 A;  4IHV A;  1SAN A;  3S15 J;  2DMN A;  2X9D A;  2NVY J;  3HOZ J;  1ZQ3 P;  1OJL A;  4BXX J;  2Y31 A;  1PUF A;  5C44 J;  1I50 J;  1PUF B;  2W48 A;  4A3M J;  1IG7 A;  4A93 J;  1RKW A;  2R7Z J;  4FE4 A;  3BG3 A;  5EG0 A;  2DMU A;  1D5Y A;  1Z0X A;  5EG0 B;  3G1L A;  1XG1 A;  1FTT A;  3A01 B;  3A03 A;  2AHQ A;  1RPW A;  3E7L A;  4DYR A;  3GTK J;  1AHD P;  3GTL J;  1MBG A;  4C3J J;  1BW5 A;  1IJW C;  1MNM C;  4A3K J;  1XC5 A;  1Y1W J;  4JX4 A;  2EZK A;  5FKN A;  1XS9 A;  2DTZ A;  1RKT A;  2D5V A;  1POG A;  5FLM J;  3PO3 J;  2NS7 A;  1IDY A;  4XRM A;  3MVP A;  4AUX A;  2LLK A;  1FJL A;  1QRY A;  3TP3 A;  1TWC J;  3IV5 A;  1TWF J;  5F27 A;  3HGG A;  3S1M J;  2VPR A;  3D1N I;  3QQA A;  1Y1V J;  2ME6 A;  3W6V A;  4IHW A;  2YS9 A;  1RES A;  2Y2Z A;  2GM4 A;  1I6H J;  1NK2 P;  2GBY A;  3RKQ A;  1JTX A;  4HNV A;  1G2H A;  1UG2 A;  2QCO A;  5FLV A;  2K9N A;  3DCF A;  4XRS G;  1TWA J;  3Q0V A;  2L7Z A;  1Z77 A;  2XPU A;  3CCY A;  5F0F A;  4A3I J;  4BBR J;  2R93 J;  5EZH A;  2M2E A;  2R92 J;  3BR2 A;  4IEJ A;  1K83 J;  2JJ7 A;  3Q0U A;  2Y9Y A;  1IGN A;  3QPL A;  2HXI A;  2L7F P;  1AKH A;  4W1U A;  1AKH B;  4FE7 A;  2JK3 A;  4MFE A;  2MW8 A;  1ITY A;  1ZR4 A;  2WAQ N;  1GT0 C;  2TCT A;  3H3V K;  1TWH J;  3BR0 A;  5IYC J;  5J1U A;  5IP9 J;  3TW7 A;  1F43 A;  1WH5 A;  1GVD A;  1X58 A;  2M9H A;  3JR9 A;  3UKG A;  4ABZ A;  3LSP A;  3LSR A;  2XGD A;  1GUU A;  1U78 A;  1X2M A;  1B8I A;  3CMY A;  1JT6 A;  1B8I B;  4I6Z A;  5EYR A;  5GPA A;  2MSY A;  3WHC A;  2GLO A;  3GTM J;  2JA7 J;  2P81 A;  3M3Y J;  3S16 J;  3BQZ A;  5F08 A;  3ZQG A;  1JJ8 C;  5IOZ A;  3HKZ N;  2XGC A;  3JRG A;  4DW6 A;  5JLW A;  2DA5 A;  1IUF A;  5M5X J;  2K9S A;  2YUS A;  1HF0 A;  4A3L J;  3H0G J;  3RQI A;  2FQ4 A;  5K7Z A;  5K7F A;  2XRL A;  1VFC A;  4C3I J;  4LOC A;  5EZG A;  1T56 A;  1WGX A;  3FIS A;  1S7E A;  2L0K A;  3FIW A;  2COB A;  2DMQ A;  1K61 A;  3HOV J;  2DA6 A;  1OCT C;  4FIS A;  5K7H A;  2FD5 A;  4FCY A;  5M3M J;  3IH4 A;  3HB9 A;  1A5J A;  2L9R A;  1ETO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...