1UG2A

Solution structure of mouse hypothetical gene (2610100b20rik) product homologous to myb dna-binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
GPSGSSGAGALPKASEATVCANNSKVSSTGEKVVLWTREADRVILTMCQEQGAQPHTFSVISQQLGNKTPVEVSHRFRELMQLFHTACESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 2610100B20Rik gene product
publication title Solution Structure of Mouse Hypothetical Gene (2610100B20Rik) Product Homologous to Myb DNA-binding Domain
rcsb
source organism Mus musculus
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ug2A01
1ZK8A 3BTJA 1JKQC 2R93J 2MGQA 3WHBA 2NS8A 4JX5A 2OF7A 4FE7A 3DCFA 4D5FA 4RBOA 1H88C 2R92J 2XPWA 1TWHJ 3GTOJ 5IYDJ 4M6VA 4MIMA 5K7HA 4A93J 2ELKA 4DYRA 4AC0A 1HF0A 2DA3A 2GBYA 5E3LA 1HCRA 4B1RA 5K7FA 2KT0A 5FKLA 3S14J 5IYBJ 2RAEA 3IV5A 3HB9A 1ZR4A 1B72A 1WH5A 3WHCA 2AHQA 3GTGJ 5J1RA 2CUEA 2HDDA 2DA6A 4IHXA 2Y0SN 4A3JJ 4M3BA 2DMTA 3JRBA 2WAQN 1Q1VA 2L7MP 4CYCA 3S16J 1QVUA 1MSFC 4AUXA 5FKNA 2M0CA 4ABZA 2LY9A 4XICA 3K2AA 3JRAA 2B63J 4A3LJ 5K7ZA 2R0QC 1RETA 3RQIA 2JJ7A 5J1YA 2E1OA 1MBFA 4M3DA 3G1OA 3G1MA 1YRNB 4M3FA 1MBHA 2HYJA 3A01B 2MW8A 4IHYA 1U78A 5JLWA 2R7ZJ 1WH7A 4Y7NJ 4A3BJ 2MG4A 4B3AA 2NVQJ 2WB1N 1D5YA 1MBEA 3FISA 4IHVA 1FIAA 1JKRC 3MN2A 2YS9A 4W97A 4Y52J 5IPAA 2ECCA 1I50J 5IOYA 2XGDA 1LE8A 3G1LA 1E3OC 4A69C 5C4JJ 3MKLA 3B6CA 5FKKA 3NARA 3JRCA 4D5CA 1X58A 2CJJA 2M34A 2ID6A 3GTKJ 1XS9A 4B4CA 3GTPJ 4BXXJ 3M4OJ 2DMUA 5EYRA 5EG0A 5F0CA 3GTQJ 1VI0A 1X2NA 2TCTA 5M3MJ 1ITYA 2E2JJ 3RZDJ 2DA1A 3I4MJ 1TWAJ 2L9RA 1JT6A 3S2HJ 4V2GA 3BR3A 3ZQGA 5F0FA 3SJMA 3HGGA 5F27A 2DA5A 5EEAA 2ZB9A 1JGGA 4DYQA 1ETQA 1MNMC 1SANA 1JKPC 1I6HJ 2H8RA 4XRMA 2XSDC 2EQRA 2HXOA 1FJLA 2EBIA 4S0HB 2M8GX 3BTCA 3LNQA 1ETWA 3TP0A 3FIWA 5GP9A 1QRYA 2W48A 3SDGA 4BKXA 4FISA 1JUSA 1PUFA 3CMYA 4D7NA 3MVPA 3O8HA 1JJ6C 1GVDA 3L1PA 4MO7A 1AU7A 4BY1J 2VI6A 5DS9A 1A5JA 2IAIA 3CCYA 3LOCA 3HOYJ 2VPRA 2ME6A 4XRSG 1A6IA 1ETYA 3BG9A 1MBKA 1DU6A 2FJ1A 1U8BA 5IP7J 3QPSA 5F08A 1GT0C 2HXIA 1JUPA 2XGCA 1T56A 3OSGA 1RPWA 2JK3A 2R5YA 5M5WJ 3VPRA 1IV6A 3ZQHA 5FLMJ 3LSRA 2X6OA 4W1UA 2COBA 2NOGA 1B8IB 5JLXA 5F04A 2LR8A 1X2MA 3JR9A 5EGOA 1P7IA 1IDYA 5FKMA 3HGYA 2CU7A 2HQ5A 4UUSB 3JRHA 3Q0UA 1BL0A 3BR6A 2Y2ZA 4UUTA 1TWGJ 3HBLA 4DZPA 1U9OA 4C3JJ 1AKHA 2ME0A 5E3MA 4JYKA 3GTMJ 4FCYA 2EH3A 3JREA 2XPUA 4L5EA 4A3MJ 3D1NI 3HOUJ 3CDLA 9ANTA 2LD5A 5EZGA 1WGXA 1FTTA 2XGEA 1P7JA 4XRSA 1IGNA 3HEFA 3Q0VA 3TP3A 3IH2A 3M3YJ 3HOWJ 3E7LA 2O9LA 1ZKGA 2VKVA 2YUSA 2QF7A 3BTIA 2LP0A 5M3FJ 1ETOA 1IJWC 2CQXA 2NVTJ 2XB0X 4A3DJ 2G0EA 5BNGA 3OIOA 5HODA 1XG1A 3HKZN 3S2DJ 2HI3A 2K40A 5M5YJ 1NK3P 1HLVA 3BR2A 1K83J 1Z77A 2EZLA 5J1UA 4FE4A 4JP0A 2K9NA 2GLOA 1BA5A 3OSFA 1GDTA 2HOTA 2ECBA 4DW6A 1Z0XA 1MBJA 2DA7A 2DMQA 5GPCA 4BBSJ 3HDDA 3W6VA 5EZHA 3HOZJ 3UKGA 1BW6A 4D7MA 5E3NA 2JA8J 3S15J 4IHWA 4XK4A 1MSEC 3ZOBA 1B72B 4JX6A 1AHDP 1JTYA 1GV2A 1GV5A 4QIWN 1HDDC 1BJZA 2DTZA 2CRGA 4BBRJ 1BW5A 2FD5A 1WI3A 2IEKA 1QPIA 1UG2A 1I3QJ 5GPAA 3JRFA 1IDZA 3BQYA 3HM5A 2HOAA 2JWTA 3S17J 1RR7A 1ENHA 2JA6J 5J3LA 1H8AC 1FEXA 2X48A 4CYCB 2K9SA 3IH3A 4AYBN 2MSYA 2NVXJ 4EEFG 5EF6A 4I6ZA 1JKOC 1ETKA 3C2BA 3PO3J 1H89C 3LSPA 4XIDA 3BG5A 3Q3SA 3TW6A 3QPLA 4BY7J 1RESA 2P81A 2Y30A 3ZQIA 2WV1A 2KDZA 2K9QA 4X1EA 4LOCA 2E19A 4A3FJ 3FK7A 2JA5J 3PO2J 2DMNA 5IP9J 4GFBA 1Y1VJ 5C44J 1T33A 1IG7A 4FTHA 4C3IJ 2E2IJ 3BT9A 4QTRA 3TW7A 4I76A 1JJ8C 5E3OA 1YRNA 2LLKA 1LE8B 1OCTC 3A01A 2YU9J 2H1KA 1LFBA 5F1JA 4A3IJ 1FIPA 3JRGA 2XRLA 4A3KJ 2OPTA 1S7EA 3LSGA 4DZJA 2EZHA 4HNVA 5EG0B 5IOZA 2NVYJ 2O7OA 1POGA 1O4XA 1OJLA 2NS7A 5IYCJ 4MFDA 1TWFJ 3BQZA 1LFUP 4M3EA 2O8KA 2FQ4A 5C4XJ 1K61A 1UHSA 1ZTRA 3B6AA 3Q0WA 4IEJA 3HOVJ 1OCPA 3K7AJ 3S1MJ 1ORKA 3FK6A 2L7FP 4QSHA 5C3EJ 3BG3A 3SFIA 4M3GA 4C3HJ 1FTZA 4C2MJ 1U9NA 4NDLA 3BTLA 3NAUA 1PUFB 2L7ZA 2XPVA 1IRZA 3JRDA 3H0GJ 4X6AJ 2LKXA 1WPKA 2DN0A 4V2FA 3GBGA 1JTXA 2Y31A 1NK2P 1F36A 1ETXA 1Y1WJ 3BR0A 3O8GA 4A3GJ 1HDPA 1RKTA 2M2EA 1HOMA 2CQQA 3LSJA 2FX0A 2TRTA 3IH4A 2R5ZA 1W0UA 1CQTA 2AO9A 5DTDA 2E2HJ 2CUFA 1ETVA 5IP6A 2R5YB 5FKOA 1RKWA 4RDUA 3ZQLA 2LVSA 1ZGWA 1ZR2A 1XC5A 4MLOA 2QCOA 3S1QJ 2DA2A 3PM1A 1MH4A 4MFEA 2DJNA 3A02A 1SFOJ 3QQAA 2JMWA 2XB5A 1OFCX 5EGOB 3JRIA 1MBGA 4J19A 3ZQFA 1F43A 2ID3A 1VNDA 2HOSA 2JN6A 1IC8A 1VF9A 5EDNA 2DA4A 2VKEA 2EZIA 3F0CA 2JA7J 2IBDA 1AKHB 1B8IA 1APLC 2N8GA 1ZQ3P 2D5VA 3FKIJ 5FLVA 4G12A 1JT0A 1R9TJ 1TC3C 1UMQA 1GUUA 1TWCJ 2LK2A 3GTLJ 4UUSA 4A3EJ 2GM4A 2I10A 3S1RJ 4DYCA 1W0TA 3HOXJ 2X9DA 3A03A 5F0HA 1G2HA 2DMPA 5FJ8J 3S1NJ 2VUMJ 2LFBA 3I4NJ 2M9HA 2L0KA 1MH3A 2Y9YA 1EF4A 2LTPA 3RKQA 1JUMA 3OOUA 3CQZJ 1NTCA 3H3VK 3RZOJ 1WCMJ 1QVTA 4JX4A 1VFCA 3DEWA 2Y9ZA 3TEDA 2R5ZB 2PMZN 3GTJJ 1IUFA 3ZQCA 1DU0A 3BR1A 2EZKA 5M5XJ 3BR5A 4A3CJ
chains in the Genus database with same CATH superfamily
1O7FA 2QSFX 2R93J 4CCKA 2L4AA 6PAXA 2FMYA 1U5TB 2NS8A 4JX5A 4RM2A 1K79A 3K4LA 4D5FA 4RBOA 2QM3A 1VQ8I 1KU3A 4MEYF 3H5RA 2XPWA 5IYDJ 4PJJA 4PFOA 3K4BA 4MQVA 1ZH5A 3OYNA 2FBKA 2X6YA 1J09A 2ELJA 4F92B 1HF0A 2DT5A 4KITB 2BY3A 2VB6A 1HCRA 1D8KA 4WWCA 2KT0A 5FKLA 5IYBJ 1R00A 5ICFA 3IV5A 3B73A 3S2WA 3SYTA 3CCJI 3CTAA 2A6EF 3KFWX 1W36D 2XAGA 1NHAA 2IGKA 1SMTA 2CG4A 5D5XB 1FMWA 1FX7A 2O3FA 1TBXA 3LWFA 3WTWC 2JUGA 1ZN2A 3FMQA 1V55H 1Q1VA 3JSOA 2Z2SB 2L7MP 2JSPA 3S16J 1MSFC 1XGMA 3AG1H 2M0CA 2K5CA 2KFDA 3L2CA 4A3LJ 2KZVA 3QRFF 1TL8A 3KP5A 2WAFA 3J7ZI 2TDXA 2BXYA 2M87A 1TW2A 1BIBA 3MFKA 4OWRB 5DM6F 2L02A 5D6EA 3M8JA 4M3DA 2FNAA 4D1QA 4UXNA 4F55A 2HYJA 2CFXA 4HW0A 2P6TA 3GMEA 1WJBA 5LGUA 1SD5A 4Y3OA 2HGCA 5L3BA 4B3AA 4WXDA 3OYHA 1MBEA 3FISA 2E36A 1JKRC 1O57A 3LSIA 4OAZA 1R1VA 4W97A 4Y52J 2ECCA 2E5NA 1YW7A 3FZVA 5DDGA 2XGDA 5IOYA 2R7QA 3DPUA 3G1LA 1E3OC 3L9FA 3FXOA 2IGNA 4L9TA 5B1BH 1U3EM 3SFZA 3P5JA 2QQBA 1ZYRF 2OJED 2VBXA 1B6AA 1X58A 2M34A 2ID6A 2ZC2A 4U0VA 3GTKJ 4BXXJ 2PMUA 1FMVA 3IHUA 4M6YA 3TDZC 2O5RA 5F0CA 5EG0A 3PJRA 1J75A 3GTQJ 1X2NA 2TCTA 1Y56A 5M3MJ 2HTJA 1FOXA 1I39A 3RZDJ 5FRNA 1J5YA 2VXDA 4G6QA 1TWAJ 1XN7A 2F6CA 3V8LA 1A31A 2UXXA 2DK5A 2O03A 3BR3A 2HVSA 3ZQGA 5BS6A 3MCZA 5LFAA 1W7PD 2LBFB 2CH0A 4P55A 2HDWA 5EEAA 4AIKA 2ZJPF 1JGGA 4DYQA 4HLXA 1ETQA 1YIOA 4XLEA 1JI8A 4F52A 3PUFA 5JI6A 2XKOA 3MD2A 2XSDC 2KRCA 2HXOA 1PP7U 3KE2A 3DPTA 4PK4A 4HF1A 2M8GX 4IPAA 1ETWA 4LGWA 3TP0A 3CJRB 4A0YA 2DQLA 4EM1A 1PUFA 1VQLI 4D7NA 1ERDA 2E7WA 1V5EA 4CZZA 4E70A 1U8RA 4OMZA 1VQ7I 1LQ1A 2HWVA 3DP7A 1XCBA 5LGNA 2HZTA 1JJ6C 1GVDA 2LNBA 4XONA 2EFOA 5FO5A 4KISA 2VI6A 3OYEA 2P7VB 2YU3A 1A5JA 3CMAI 3LA2A 2ME6A 4XRSG 2M4KA 3TBIA 3FM3A 4YELA 4HG2A 1MBKA 2GA2A 4G9YA 2Y48A 3CCMI 5J4YA 3K4KA 1U8BA 4RB3C 3QPSA 5HDKA 1R36A 1T56A 3QPHA 3V8KA 4HAMA 1P9QC 3S8PA 3VSLA 4KA4A 4B8XA 5M5WJ 1LDDA 1DPUA 3C3WA 1UHMA 2D1HA 3DEEA 4HOBA 3D5SC 3H3ZA 2CQKA 3MZ8A 3FM5A 3HRTA 4HNTA 5K5OA 4W1UA 4ZTJA 2DBBA 3FHNA 2COBA 1B8IB 2K27A 5F04A 2KKOA 2VJJA 1X2MA 4U88A 1STZA 3WTYC 4D9JA 2XASA 1P7IA 3JAMZ 3MKYB 2STTA 3HRMA 4GO1A 2KIFA 2OZUA 2CU7A 1S5LC 3CUQA 3E6DA 1XSVA 2CW0F 2ZMEB 2ZNZA 3GZNB 2OTJI 1OCZH 1BL0A 4C3JJ 4ENKA 2I5UA 5L3EA 4I09A 3DLAA 1WWXA 4IX7A 2EH3A 3JREA 2XPUA 2DYRH 1BI0A 4R8HA 1RR8C 1H9TA 3VEPA 2ZKZA 2VODA 2IT0A 2X85A 1IF1A 2E5ZA 1UHWA 4C2UA 3PFYA 1FYKA 2M1BA 9ANTA 5HS7A 3S32A 2IA2A 4KIBA 1YE9A 2W00A 4Y15A 2GXAA 2W1OA 4YFXF 3HEFA 3IH2A 3M3YJ 3HOWJ 4L5JA 5B3SH 5E20A 3KZIC 2O9LA 2EA4A 2A61A 3H92A 3K70C 3MWMA 2VQLA 3D5LA 2CQXA 2LYCA 4N9IA 2XB0X 4GXOA 3OIOA 5K5RA 3RQ4A 2A3SA 2O0YA 3T5XA 2AXLA 3BR2A 4M73A 2Q0OA 1PYVA 5KHDA 1MKMA 4KN7X 1S72I 5HLTA 4G6TB 3PSFA 2V1NA 2ZJQF 3I9V2 3IKVA 1U5TA 5GPCA 3IC7A 1EH6A 3SXYA 5BOXA 3DU5A 2KRHA 2DDBA 3C18A 2JA8J 2VBWA 3BDDA 4XK4A 1R71A 2PJRB 1AHDP 4RLQA 1GV2A 1LVAA 3ROUA 4WK8F 2DTZA 2CRGA 1OQYA 2DXIA 2DT6A 1QPIA 1GVJA 5LGTA 2JWTA 5ILSA 4UVCA 2JA6J 2HQAA 3JAMK 3VYSB 3SDBA 2MSYA 1BBYA 4EEFG 5CQEA 2VXZA 4I6ZA 2E34A 3W6KB 5BQTA 3GVAA 1DGRM 2CGPA 4ZYDA 4BH9A 1ODDA 3LSPA 3WGHA 4BQQA 2L7KA 4XIDA 1VQKI 3LSKA 1B4AA 1R1TA 2P81A 5BPDA 2WV1A 4BE2A 4NC8A 5IP9J 1Y1VJ 4HSTA 1IG7A 3MMYB 4Z6YA 4FTHA 2IS1A 2W4SA 3OYMA 4I76A 4E7KA 3B02A 3BROA 3WE3A 5LRSA 4FX4A 3K0LA 3N05A 1HXDA 4LFUA 2HKOA 5F1JA 4CO8A 4PGHA 1G3SA 1BJAA 2OPTA 3KCCA 2QYOA 3WE2A 3AL0C 2L2OA 3LSGA 3AG3H 2IW5A 3DKYA 3OYBA 3P9KA 2O6GE 2OBPA 2PLYA 5L3GA 1IN6A 2RGVA 2KDOA 4RAZA 1A6QA 1O4XA 1OJLA 3K4CA 4CXFA 1Z6TA 4MFDA 1K78B 3HYIA 3FBNB 4LB6B 5C4XJ 2EV5A 1FBQA 3KZZA 2PX9A 3FK6A 2L7FP 2DK8A 2XAUA 3CDHA 3KP7A 2R7WA 1ZELA 3HL2A 4C3HJ 2PJPA 2BZTA 3F22A 1FTZA 1CGPA 4P5OA 3CMEI 3BPVA 2LBFA 2LF7A 1JGSA 2R7FA 1KONA 1G3WA 1LB2A 2DFEA 5H2FC 2V1UA 2XPVA 1WJDA 2HOEA 3JRDA 4QWQA 4CA0A 1TNSA 3GBGA 4ESBA 3WTXC 5CVVA 3S3NA 1F36A 1SD6A 1J59A 5E17F 4HPQA 3LFUA 1R22A 4XRFA 1D5VA 3CLQA 3ZP5A 4C9YA 1XX5A 2H09A 1BOAA 1Y0UA 2FX0A 1SFXA 4RGXA 1U0JA 2K3PA 5CVIA 3RDIA 4B47A 4PZJA 1RUNA 1X1BA 3G73A 4AU7A 5H20A 2P5VA 1ETVA 5IP6A 4BHBA 2ZXHA 3LA7A 4Q48A 2BW3B 2R5YB 1HQCA 1D1BA 2F5FA 2KRFA 4EMSA 5KNLA 4HQEA 1OR7A 2WADA 2D2WA 4L9VA 2QCOA 4IKFA 1XCVA 3BG7A 3DXJF 3HXLA 3QQAA 3H9JA 1Z6RA 5EGOB 4J19A 2BHYA 2EV0A 1MMNA 4JQFA 2VQHA 4RAYA 1HSTA 2NNYA 3H0DA 2HOSA 4XLNF 4PJNA 2EINH 2EB7A 3RYPA 1OCCH 1VF9A 5EDNA 2EZIA 5DCFA 4BQOA 1B8IA 1AKHB 1S8NA 3WGGA 5J6XA 2D5VA 2H1LA 2FBIA 3FKIJ 4KMFA 2FOWA 2QLZA 1XMAA 2K7LA 2EFQA 5FRMA 1T39A 2PEXA 4RS8A 2OZ6A 1F1ZA 1PP8F 5TISC 2GM4A 5LBQA 2DFHA 3CCUI 3Q9VA 4AD9A 4RM3A 3ZRGA 2M0MA 4ZYEA 2X9DA 2ZSHB 4S04A 3V4GA 3I0TA 4LIVA 3GW2A 4KDPA 1P4WA 1G2HA 2Z1DA 1A36A 1XDSA 2M9HA 1H9GA 1YJWI 3E5QA 1YHQI 4CDGA 4G7HF 1LJ9A 1TQPA 2RV8A 1NTCA 4YIFA 3ECOA 1JXSA 3RZOJ 1VFCA 3M9AA 2DQRA 1ZG5A 2R5ZB 4B09A 3ZQCA 2A6TA 2H6BA 4CCMA 2EZKA 5M5XJ 1S6LA 2P6SA 4IXAA 4A3CJ 1I3AA 3ZMVA 3BTJA 3K6GA 2MGQA 1XSDA 1Z67A 4OMYA 3HC7A 2A05A 3KX2A 3PNTA 4FE7A 3DCFA 2A6HF 4OOIA 3HPGA 1TWHJ 4M6VA 3OR1C 4MIMA 1VZ0A 1W7PB 2ELKA 4DYRA 4AC0A 3F8NA 1QZEA 5E3LA 5BMZA 3GX4X 2EILH 3K4NA 2F4IA 2YX4A 4AM3A 5L3CA 4OAYA 5L3FA 2PI0A 2RAEA 4L18B 3DKWA 4XLHA 1WI9A 5ICGA 2L9SA 1W5TA 2KIQA 1ZR4A 3LA3A 5ILVA 1LKXA 2PJRA 3G3ZA 5FFZA 3QYEA 1LEAA 5J1RA 3I53A 2ADUA 4BDZA 5JR3A 4LLLA 1VQPI 2Y0SN 4A3JJ 1HKQA 1FSEA 2ZFWA 2DMTA 4KYWA 1HBXG 5DCMB 3IRQA 3F6VA 1SFUA 5FKNA 4U7DA 4U0WA 1BR4A 4E6KG 4ABZA 4ENJA 2LH9A 4G8XA 5IT9Z 2EA2A 3LSTA 2R0QC 1U6GA 2QSHX 1KQ9A 3RI4A 5FLXZ 1YRNB 1MIJA 4PJMA 1MBHA 4M3FA 3H5NA 4ZYGA 3JTGA 2QBYA 5JLWA 2R7ZJ 3RPUA 4L9JA 4E7IA 1YW9A 2IGMA 4A3BJ 3I56I 4F3QA 2HNHA 2MG4A 2VE9A 4EJUA 3R0AA 1FZPB 2YS9A 1D0YA 2JT1A 1LDKB 2KP6A 2EJRA 2PBIA 3L00A 1Z91A 3HZJA 4XSZF 2HDCA 4RB2C 2VJ4A 5FKKA 5E1ZB 1X4PA 1D0XA 1B9MA 4D5CA 3V7SA 1XS9A 3M4OJ 2PQ8A 2VKDA 3CC7I 2H94A 3K4MA 2HPIA 4I2OA 5EEGA 2FA5A 1ZRFA 1EV7A 2XV4S 3WG7H 2VN2A 1K78A 3S2HJ 4V2GA 3QP5A 1SVLA 1ZREA 4GGGA 4P1WA 3L2WA 3QOEA 2DA5A 2E35A 2ZB9A 3KETA 3WU2C 5CQGA 1Q1HA 4EM0B 1OISA 1DDNA 4DBQA 5D8LB 4RAGA 5TJJA 1E3HA 3ZMTA 4PDKA 1FJLA 2EBIA 4G7OF 1SFKA 2LOOA 2VL8A 1Z1DA 4LJZF 5GP9A 2HVQA 2JA2A 2ZCWA 3SDGA 3ASNH 4FISA 1IN8A 4NC6A 5KK1A 3MVPA 2WC2A 3I59B 4XOPA 2D45A 3A1YA 3M07A 5DS9A 2A69F 3LOCA 4BJ6C 5IT9K 5ICCA 1A6IA 1P92A 2IJLA 1T98A 1U5TC 3E97A 1DU6A 1VQ4I 3FMSA 2KL4A 2XAHA 2FJ1A 5FLXK 4KIFA 1F9NA 3K2ZA 2VBZA 2GWRA 5IP7J 2CFOA 5F08A 2M7AA 2MABA 1JUPA 3RJPA 1DPRA 3OSGA 5CKTA 1LPQA 2ZFUA 2R5YA 4M72A 4UY8I 2DODA 3LSHA 1FYMA 3ECHA 3RTRA 3ZQHA 3GYHX 2XGXA 3M8FA 2Z3YA 2ZXIA 1TQMA 2HYGD 4PFPA 1UCRA 2P8TA 2NOJB 3ABKH 2NOGA 2WBMA 3DTKA 3PFIA 3E1SA 4XKCA 1VQ5I 3GEZA 4NUBA 2H27A 2DPDA 5EGOA 1IDYA 4LB5A 2I8DA 4NC7A 5IY5H 3M1EA 2RREA 3IAM2 4C30A 1XMKA 1WJFA 2Y2ZA 4UUTA 3HBLA 1AKHA 1YITI 2ME0A 2DW4A 4HX7A 4HLYA 3GTMJ 1KYZA 4A3MJ 3CJQB 2GOMA 1I6XA 1SVOA 2MH2A 5HOOA 1K4SA 4RGUA 2BYVE 3CDLA 1YJNI 3VYTB 4V19K 2MH9A 1FTTA 2IS4A 5F1RA 3Q0VA 2CYYA 4KT6A 2Y0SA 3E6MA 1TLHB 2K3FA 2VKVA 3H35A 3K1MA 3BTIA 3FBIB 1ETOA 1IJWC 4IHTA 5HNHA 4HDUA 2QUFA 5BNGA 2KIMA 1XG1A 3RKXA 4EJOA 2LMDA 3QAHA 5D4RA 2WY8Q 2HI3A 2K40A 3CD6I 3TOBA 1Z77A 2EZLA 3G2BA 3U2RA 1F5TA 4CUGA 2K9NA 4BXUA 4BDYA 4DW6A 3CP2A 2CW7A 1S7OA 1Z0XA 1TNTA 4KNYA 2DA7A 4HQMA 4BBSJ 4JK1X 1YYVA 1V5GA 4ZH4F 4X0GA 3W6VA 2X1EA 2W85A 2XSJC 1YX5A 4RB1A 3UKGA 2QQAA 3BPXA 4YFNF 1K6OA 3S15J 5HS9A 1MSEC 1JHHA 3DF8A 1IW7F 1W7PA 3SEZA 5LHHA 4JX6A 3WTTC 3CF2A 1IN5A 1JTYA 4ENMA 2J5OA 3KYDB 3M8EA 2BE5F 4BBRJ 1CF7B 4Q5SF 2FD5A 3GUDA 3S3MA 1PDNC 4IRIA 1UG2A 3H5AA 3HHGA 3J7YJ 1IDZA 1ON1A 1H8AC 1FEXA 3IH3A 2ZO4A 4AYBN 1NH3A 4XN0A 1EJ9A 1J0RA 4TV7A 4CICA 3J7AY 3NWSA 3OYAA 1IRFA 4WXCA 2RKHA 2V1DA 5DCMA 2OAZA 3BG5A 2IS2A 2JRTA 2COMA 4JBAA 2EK5A 1YIJI 2WY7Q 5AONA 4IF4A 3WTUC 2BEOA 3ZQIA 3H1CA 2KDZA 4LOCA 2IRFG 1OR7C 4GFBA 2OQRA 3P9CA 2KMUA 3RSNA 2IVMA 1OYIA 3FXRA 2OV7A 5J40A 1KQ8A 1YRNA 2XROA 4BGDA 1QPMA 4II2A 1LE8B 1OCTC 4BQAA 1WVRA 2H8WA 1MNDA 2YU9J 2W24A 4ZDPA 2M3AA 3KP3A 2H1KA 4XQFA 1FIPA 3JRGA 4YIRX 1S9HA 3WGIA 3KP2A 2KQRA 2HQRA 1EKEA 3GF2A 2Q1ZB 3QU3A 4RMNA 3RIRA 1FT9A 2EZHA 2ZXJA 1KGSA 1DQUA 2ETHA 1MW7A 4BQNA 2RN7A 5JHFA 3BP8A 2A5YB 3I3LA 3I64A 5E79C 3DWLE 2GIZA 3JSPA 2R7XA 2XAFA 1B1BA 3ESWB 5JVGF 3F8BA 2O8KA 2GOXB 2XAQA 1I1GA 2EWNA 4HF2A 1UHSA 1EA3A 1ZTRA 3B6AA 5CJ9A 4ETSA 3K7AJ 4B44A 2QQ8A 4RAFA 4IO9F 2QQ9A 4M3GA 2WAEA 4CSWA 2Y69H 5E1WA 4NDLA 3IP4B 2BY0A 3OYDA 2KISA 3BG6A 2OCCH 2OU2A 4X6AJ 4KJZA 1WPKA 3MZYA 1Z21A 2Y31A 3EPZA 2JSCA 2DFFA 2STWA 1ETXA 3DU6A 3N97A 2R3SA 1HKSA 3TKYA 1Y1WJ 2VONA 3BR0A 1WJEA 1HOMA 2VT2A 3LSJA 4BXFA 2W25A 5CYVA 1O3QA 2TRTA 3I59A 2VLAA 3FXQA 1P4XA 4HX8A 1XGSA 1KU9A 1CQTA 2R7DA 2P5LC 2AO9A 1IXRC 3C2HA 2EPFA 1BI1A 4EGYA 2O8XA 2X6WA 4RDUA 4B43A 4HV5A 1FBUA 3VODA 2ESNA 2LVSA 3COAC 3ASOH 3HJEA 2DLLA 1ZR2A 3REOA 3S1QJ 3LMMA 4MFEA 1RNLA 3EYYA 2DJNA 5DUKA 2DOFA 1MNEA 3A02A 1YTYA 1SFEA 1SFOJ 2JMWA 2QVOA 2V7FA 3WODF 4A6DA 3L2RA 5LD2C 3KLNA 4OIRF 5DM7F 1IRGA 1VNDA 2KLOA 4E7HA 3FMRA 4RLFA 1J9IA 2JN6A 2VKEA 1GLNA 1Y0NA 2R7VA 2N8GA 5ICEA 3HTUA 2NNNA 3OIQA 5FLVA 4G12A 2B9SA 4IRHA 1R9TJ 1ULYA 1UMQA 1WKMA 4CGZA 1ZHFA 2LK2A 3GTLJ 3ZMZA 1X1PA 1L3LA 1USTA 3F8FA 3QWLA 3S1RJ 1N75A 3C1DA 3DEUA 4ITVA 2MYSA 5J47A 3AKZA 5FJ8J 2W7NA 3D5RC 2VUMJ 3S3OA 5CVUA 1I27A 3K4JA 1MH3A 1EF4A 2LTPA 4AYBA 1O3RA 1JUMA 3A2KA 1OKRA 4EVIA 1FP1D 3OOUA 4IOCF 2BV6A 2Y9ZA 1ZAOA 5A2QZ 3WU1B 3G71I 3GTJJ 1DU0A 2NXNB 3I4PA 2EFPA 3BR1A 2VQCA 1WQ2A 3BR5A 3R4KA 3DBHB 4MNUA 2V9KA 3NRVA 5LEJA 2YSRA 4E7ZA 2X1CA 3OYCA 1JKQC 3ZXSA 3CUOA 1MDMB 1FC3A 1AOYA 3CP8A 3ZQQA 4BU2A 3IWZA 1GXPA 1QU3A 2X1DA 2L3DA 2R92J 4RB0A 4LMYA 4A93J 2EV6A 4UV8A 2GBYA 3SEQA 2MD0A 2X6XA 2AS5F 3OL3A 5K7FA 1N77A 3HRUA 3FF5A 4FX0A 5D4SA 4CCNA 3RPQA 3RKWA 1K7AA 3HOSA 3KYCB 3HB9A 2CUJA 5B1AH 5ILUA 1WH5A 4BAYA 3WTSC 1WJCA 3WHCA 5DD8A 1PUEE 4LG0B 3GTGJ 3K10A 2FOKA 1MMSA 3VOEA 1CF7A 2NAZA 4M3BA 3PQJA 2X51A 3JRBA 1YO5C 1WFXA 1H0MA 2ZBKA 5B66C 2KJBA 4PCQA 1Y8RB 3BJ6A 1XD7A 3CCQI 2HYFA 2OD5A 4AUXA 2KZGA 3EETA 1TQIA 2E1MB 2LY9A 4XICA 3K2AA 2B63J 2W84A 4BJTA 2Z16A 5ED4A 3SQNA 4XNFA 1RI7A 4EJVA 1RETA 1XB4A 2JJ7A 5J1YA 3DTIA 4GDFA 1REPC 3CJNA 2Z99A 2E1OA 2NVUB 1MBFA 5HLGA 3G1OA 2MW8A 2M45A 3HUGB 4ZZDA 2M7BA 1U78A 1LDJA 2XUBA 3LL7A 2V6CA 2WB1N 3R60A 1WHUA 4ANJA 1D5YA 1N25A 1G3TA 2GXGA 2HZDA 1Z7LA 2QKLB 3E6BA 5LHIA 1W36C 5H6RA 4F91B 5A2QK 5AIPA 4XBFA 1LE8A 3BY6A 4A69C 5L3DA 2XIGA 3NARA 3JRCA 3A4CA 1VQ9I 3OOPA 2X0LA 4YRVA 1HSJA 1W5SA 4B4CA 1T6SA 4HV6A 3GTPJ 1Y39A 5EYRA 1VI0A 2MBFA 1UB9A 4KIGA 3P9IA 3AG2H 3O3KA 2BOLA 5HVQC 1RRJA 2CV2A 1ITYA 2E2JJ 3NWTA 1T08B 1IZ1A 2DA1A 3TMOA 2LRDA 1AA7A 5CPRB 2M8EA 1RIOH 2VOPA 2KJCA 1SAUA 2L9RA 2ZXWH 3EQLF 1QO0D 1P2FA 3DKXA 3SJMA 2ZMEA 3KIOA 5F27A 1MMAA 1QNTA 4BE0A 2QA4I 1TT0A 1QZYA 3ZGKA 2ISYA 2RNGA 1SANA 4CH7A 2EFWA 1BC8C 2VIXA 1KYWA 4II3A 4XRMA 2JVHA 4EATA 4BHPA 3BTCA 4Y13A 3MEXA 1QRYA 2HKXA 2W48A 4BKXA 1MJBA 1JUSA 3CMYA 3I5UA 1QQIA 1FYLA 1M1EB 1A04A 1YS7A 2OCEA 4E4HA 4Q47A 4BY1J 4GCVA 2HR3A 2IAIA 5GADJ 1SD4A 4AIHA 3HOYJ 3ABTA 4ZC3A 1PJRA 1G3YA 3CESA 3DBLB 4LLGF 3MZHA 1V5FA 1F4KA 2UV1A 4CYDA 4Y4RA 2ZJ2A 2P7CB 4E7SA 2HPMA 2HXIA 4EJWA 5J8FA 3G4SI 4R1HA 1RPWA 1OYYA 2JK3A 4PSXA 4FASD 2L01A 2Y0MA 3K70D 3FDYA 4QPOA 3VPRA 1W1WE 5FLMJ 3W2WA 2R7RA 2V26A 5LLQA 1IAWA 5ERIA 3C2GA 2X6OA 3PIOF 1O7LA 1MJAA 3CCEI 4H4KC 2GXBA 1ON2A 2UZKA 1Y6IA 4N9HA 2MC4A 1O3SA 3BZ6A 4HF0A 5DD4A 2XKPA 3NQOA 4Y33A 3SZGA 3U1DA 3E5XA 3HGYA 3F23A 3PUBA 5HDGA 1UJ8A 1HW5A 1HKTA 3JRHA 1IUYA 1GXQA 4BYYA 3Q0UA 1MJ9A 1FOKA 4BEHB 3EUAA 2DJIA 3RCOA 1U9OA 2FBHA 3OIPA 3MKWB 2WWYA 2FXAA 5E3MA 2NS0A 4JYKA 2ESHA 2V9VA 4FCYA 2Z9OA 4L5EA 1BI3A 3GLLA 3HG9A 3OWTA 3D1NI 2VQGA 5FD6A 3GFIA 4LIUA 5EZGA 1WGXA 5KAIC 3HTSB 2Q2EB 5JHUA 2XGEA 2FQ3A 4OIPF 5K1YA 4IJAA 4XRSA 1IGNA 2R7OA 3Q5FA 4P96A 1X19A 3E7LA 1NG7A 1ZKGA 3EYIA 2QF7A 5M3FJ 2M30A 4A3DJ 1S7AA 3HOTA 2L9VA 2RDPA 4IQ4A 3HKZN 3S2DJ 3ZR8X 5M5YJ 3QYFA 4KN4X 1HLVA 1D8JA 1ZGAA 3KEYA 1K83J 3SZPA 5J1UA 4A0ZA 4IZZA 2BVLA 1ACIA 1DGWY 5DEQA 4FE4A 1VQ6I 4N4OB 3I54A 2GLOA 1BA5A 3A0HC 3OSFA 3SHFA 3ZMUA 2CQ7A 1GDTA 4XSXF 1XMXA 2RVCA 1Z3YA 1MDMA 2DMQA 3HDDA 2WB1A 2IXSA 5EZHA 4UVAA 2LY1A 1BW6A 1YW8A 2YPRA 4D7MA 2JRMA 5E3NA 1LEBA 3ERMA 1Z05A 1G4DA 1B72B 1FNNA 1D0ZA 2JPBA 4PUSA 4QIWN 5HLHA 1BJZA 1WJAA 1YFHA 3CUQB 1V4RA 4EQQA 2CQNA 3ABMH 1S3JA 1J7KA 2ZJRF 2VOOA 3DBRB 3HSFA 1SVMA 1WI3A 2IEKA 5GPAA 3TO7A 1WRJA 3BQYA 2Z33A 3HM5A 3U9GA 4KT5C 1RR7A 2CMPA 1VQMI 3OS2A 2X48A 4CYCB 2K9SA 3PNYA 2YX7A 3C7JA 5LHGA 3OS0A 4DIQA 2JTVA 2NVXJ 3T8RA 3LQQA 5EF6A 4LG0A 1BI2A 4FT8A 3OYIA 1JKOC 3T8TA 4E7LA 3C2BA 2XHKA 5HLIA 3EUKL 3J81Z 2KHMA 3Q3SA 4FQGA 3TW6A 4ZYAA 4BY7J 5EEHA 2VC1A 1RESA 3O6BB 1OLTA 4X1EA 4BHCA 5TRDA 3CCSI 3EUHA 3FK7A 4A3FJ 2JA5J 2W82A 2DMNA 2IA0A 5C44J 4BL0B 1T33A 3GWZA 5FD5A 4ZYHA 4C3IJ 2E2IJ 4B48A 4QTRA 3TW7A 2FF4A 4B3XA 5E3OA 2P5KA 2DO7A 2BGCA 4U7BA 2LY2A 2LF8A 3KP4A 1R1UA 4I01A 2FUG2 2G9WA 2BW3A 4O6JA 1ZLKA 2OUMA 3HSEA 2GQQA 4LD5A 2XRLA 4ENNA 4UUVA 4RA2A 4ZDLA 4AVPA 3ZPLA 4DZJA 4QLCU 2DFIA 1ZRCA 1R5HA 4KUMA 4YIIA 5IOZA 4LK0F 2NVYJ 2O7OA 3HPHA 3TOAA 1POGA 2NS7A 5IYCJ 1NG6A 1TWFJ 3OS1A 4J01A 4R79A 3BQZA 1K61A 4L0ZB 1FPQA 4ZDOA 3H36A 3TO9A 2HS5A 3BCAA 5J4VA 3CCLI 1DP7P 4AWXB 2K02A 4QSHA 3M7GA 4AIDA 4ZTFA 3BG3A 3ULQB 3PSIA 1YG2A 2MLKA 5KCMA 2BY2A 4C2MJ 1U9NA 1LUJB 3NAUA 2PG4A 2Z5UA 1C0WA 3K1PA 2L7ZA 4ESFA 3H0GJ 3DFGA 2LKXA 5AIQA 4V2FA 2EIMH 2V4JC 1JTXA 5FB2A 1T8IA 3BJAA 2IPQX 3GFJA 4DJAA 4A0XA 1A35A 3O8GA 1USSA 4HNUA 1HDPA 2M2EA 2V6EA 2CQQA 2WV0A 4BE1A 3J81K 3DPLC 3IH4A 2R5ZA 1W0UA 4P9UA 2EIKH 3U21A 2HTSA 5DTDA 1WSUA 2E2HJ 3TGNA 4BJ5C 1SMYF 3I71A 3VB2A 4HA8A 2CWEA 3KP6A 5FKOA 1RKWA 1T0FC 1ZLJA 2BXZA 1SAXA 1EH7A 3F21A 3AG4H 4YEJA 1MD0A 3ZQLA 2ACJA 3CO7C 5F6FA 2R4GA 1E2XA 1T38A 4KFCA 1FSHA 3E6CC 1XC5A 4C2TA 4MLOA 3CC2I 2BY1A 3HKZA 4N4NB 2PFBA 1K6YA 5CLSA 4A6EA 4J00A 1OFCX 3J80Z 3JRIA 2GIVA 1MBGA 1BR1A 2ID3A 3VFZA 4M71A 2CV1A 3R61A 2GA1A 4CCLA 3GZ6A 3OMYA 3ELKA 2JA7J 3SZTA 5IT3A 4EJTA 1MGTA 1ZQ3P 3CDIA 3MQ0A 1O3TA 1AWCA 2DT7B 2GAUA 4BS9A 3FXJA 2CW8A 2ZSIB 2FRHA 4LG3A 4NBQA 1BIAA 1JHFA 1FLIA 5D8KB 4A3EJ 2J5PA 2R7TA 4BEHA 2I10A 5GAGJ 3W3CA 1K4TA 3IRRA 2GZWA 4I99C 3QP6A 5F0HA 4M9SA 4N0BA 3E5UA 1IO2A 2DMPA 5D5WB 1YS6A 2FMLA 3I55I 3S1NJ 2K9LA 4EM2A 4OIOF 3I4NJ 1YLFA 2BVMA 2Y9YA 2E71A 2Q2EA 2UXNA 3RKQA 2L54A 1VQNI 3GZ5A 3CQZJ 3KPHA 1OYWA 1IN4A 3HHHA 4MHGA 2H6CA 4OU0A 1QVTA 3DEWA 2LKSA 1ZG1A 3IAS2 2PMZN 1Z3XA 2MA3A 2Y75A 3ZMDA 2VT3A 4Q4ZF 3OYFA 2DI3A 1ZK8A 1YI2I 2KPMA 3OL4A 4KMUX 4A2UA 2VBYA 3WHBA 4Y17A 2WA0A 2A68F 2OF7A 3LSMA 2MC3A 1QZZA 2MLGA 1H88C 1E3PA 3GTOJ 1X1CA 3O2PE 5K5QA 5K7HA 2OTLI 2JZYA 1QBJA 4I02A 3W6JB 2ZMEC 4E7JA 2DA3A 2G7UA 5DUIA 4B1RA 2CUZA 3OV8A 3S14J 5BPIA 4LLNA 1TTYA 4YFKF 3J80K 3ERED 1B72A 3V8JA 3KEQA 2AHQA 2VPLA 3V7RA 3IWFA 1KA8A 2CUEA 4EV0A 2HDDA 3LFKA 2DA6A 4IHXA 4M6XA 3RKYA 2XC7A 3GXOA 2WAQN 3F72A 4ASNA 4CCJA 1R49A 4CYCA 2HQNA 1QVUA 2LKPA 1TW3A 2XF5A 1GHCA 2L9NA 3JRAA 3WU0A 5K7ZA 5J8CA 1XPXA 5JFRA 3RQIA 3NEUA 2HFHA 1IXSB 3G1MA 3OYGA 3FKJA 1OCRH 3A01B 4HEA2 2UUZA 4IHYA 3VSKA 1WH7A 4IVNA 4Y7NJ 3HRSA 4HYEA 2NVQJ 2M5WA 2DYSH 4IHVA 1FIAA 3MN2A 1XDUA 5IPAA 3U1KA 1I50J 4L5IA 2QWWA 3TO6A 5C4JJ 2R7SA 3MKLA 3B6CA 4I98B 3KZYA 1ZG3A 2CJJA 5GTIC 4PGGA 3KYLA 1MZBA 3AFHA 2DMUA 5H6QA 1UZCA 3OY9A 4DOZA 4IOAF 3K69A 1JE8A 1KQ0A 3JCUC 3I4MJ 2RNJA 1IV8A 4K2EA 3W2AA 2B0LA 1JT6A 1IXCA 2V79A 3OYJA 2K85A 2XAJA 5F0FA 1EH8A 2HEOA 3HGGA 4KICA 4NQWB 3L09A 1X1AA 3J7AO 2CO5A 2AQEA 3HIFA 2K9MA 2LREA 4ZZLA 4CHUA 1MNMC 1HW2A 2DOAA 4O3MA 2V9PA 4LITA 1JKPC 1IRXA 1I6HJ 2H8RA 5LEKA 1ZARA 1TP4A 2EQRA 1MMDA 2VKHA 2YR2A 2AQFA 4S0HB 2LDUA 4BACA 2DPUA 3LNQA 1IN7A 4HRIA 3FIWA 3VWBA 2XDVA 3JTHA 4XM3A 1W4MA 2IP2A 4ON0A 3O8HA 3L2UA 1Y8QB 2QGUA 3FXKA 4RGSA 4XLCA 4DQ2A 3L1PA 3LAJA 3N4MA 1B9NA 4WX9A 1V3FA 1X3WB 4MO7A 3CCRI 1AU7A 1KZHA 2XF7A 4H0EA 5JVTA 1R4NB 3M1CA 3CCYA 1I1SA 2FNPA 2VPRA 2ZNYA 2QBYB 1ETYA 2G7HA 1MMGA 2K4JA 3K1NA 1T2KA 2E1NA 3BG9A 4PSWA 5CVRA 5E8GA 4LK1F 2QENA 4WF2A 1GT0C 2XGCA 3H9QA 1ZGJA 4XORA 1ONVA 3FHZA 2PMZA 2CSOA 2IA1A 4F93B 2ICWG 5F64A 1HC8A 3ABUA 1T0FA 1IV6A 1FOYA 2K4BA 3WTZA 2IS6A 1U2WA 3LSRA 4XR6A 3AL0B 3CMMA 1Z9CA 2L4MA 2HVRA 3F8MA 3F6OA 5JLXA 2LR8A 1QA6A 1D3YA 3JR9A 3BJOA 2RC4A 1ZRDA 2QEXI 1LVKA 5FKMA 4FHTA 1UFMA 4M74A 3BZKA 2HQ5A 4Z2YA 4UUSB 2LG4A 4S05A 2NYXA 3BR6A 1TWGJ 4DZPA 3I58A 3CCVI 1J2XA 4A5MA 1HW1A 4XLFA 3QODA 3UNGC 2P4WA 2A07F 1FP2A 1QHHD 2Q8KA 2VJ5A 3CJTB 2AXTC 2E1MC 3TDUC 2ISZA 3V7CA 3WG9A 3ML6A 3HOUJ 3V42A 4NHJA 2JPCA 3EUHC 2LD5A 3QU6A 3VDXA 4G7ZF 5LRRA 1P7JA 3LQRA 3GCMA 3TP3A 3CLOA 1YOVB 3ZN1A 3RYRA 4GYGA 2YUSA 2WAQA 4L0YB 1G59A 2LP0A 2NVTJ 2X4HA 3GO5A 1G8XA 2XVCA 4XL9A 4QPQA 4A12A 2A5WA 3T0YA 2G0EA 5HODA 1RC9A 2HU9A 4RGRA 1R5GA 1XSXA 1QGPA 3ISPA 2QSGX 1NK3P 3LAPA 3PIPF 3DV8A 5EJCA 4CCOA 1P4AA 1XGNA 5GTHC 1KU2A 1R58A 1R6RA 3GFMA 1QHGA 2ELHA 4JP0A 3BWGA 5DV5A 3QPTA 4NNJA 5TGTA 2HOTA 2ECBA 4G94A 3FXUA 1SEUA 2XRNA 1MBJA 3QYBA 3ZMSA 2LSOA 3HOZJ 2VC0A 4U87A 4IHWA 3H9GA 2F5EA 3MAJA 3ZOBA 3BOQA 1TZLA 4BUPA 4M9XA 2UWMA 1HDDC 1GV5A 4XLAA 2LC2A 3QOPA 4EGZA 4FETA 1BW5A 2DAOA 1I3QJ 1YJ9I 3JRFA 2HOAA 3S17J 1ENHA 3GLXA 4DBRA 5J3LA 3JW4A 1XGOA 3EDPA 4NB5A 2BHZA 2RQPA 4MEXF 4UB8C 2F2EA 1BC7C 3BLYA 4AIJA 2M4GA 2OC6A 1DUXC 2DTRA 1ETKA 3G6EI 2O61A 3PO3J 1H89C 3UR3C 2OQGA 3QPLA 3CF5F 3R0JA 1TT5B 1R23A 2Y30A 4ESJA 5E18F 2K9QA 2VASA 4U0YA 1D1CA 2E19A 3PO2J 5D5UB 3R6SA 2E60A 2BBYA 2FE3A 2VJIA 1BR2A 2F5CA 3BT9A 5FFXA 4D0PA 4UV9A 1LNWA 1JJ8C 3L7WA 2LLKA 1RUOA 3FXLA 1HA8A 3A01A 4PJLA 1LFBA 1X3UA 1W5CC 3Q9SA 4HDVA 1L0OC 4DGWB 2VE8A 3BC8A 4A3IJ 1E17A 1X4OA 2KIUA 3K9TA 4A3KJ 1BM9A 1S7EA 2D1VA 2EFNA 2F48A 4UVBA 4ZJZA 1PVEA 4XOTA 2E7XA 4HNVA 5B5EC 1I5ZA 5EG0B 3ZN0A 5HS8A 5GAEJ 4DNCA 1SC7A 3ABLH 3CC4I 1DP3A 5HNFA 4G6DA 3OYLA 3HSRA 1G6NA 2E1CA 2F4OB 4F7ZA 4AVZA 2R7UA 1LFUP 4IHSA 4M3EA 2FQ4A 4HSRA 3OYKA 3Q0WA 2DOEA 4IEJA 1OCPA 2B7EA 2FEZA 4CZCA 1VQOI 3HOVJ 4WXHA 1ORKA 2JUCA 5D6FA 1VTNC 5C3EJ 2JVGA 4MTDA 1P6RA 5FROA 3E0JB 3SFIA 2IGOA 1R7JA 1KU7A 4OINF 4MTEA 2QZ8A 1FOWA 4NQWA 3S93A 3A0BC 4XN3A 3BTLA 1PUFB 4HZFA 5HDNA 4I7HA 4MQ9F 3IUOA 3KEOA 1IRZA 2K86A 4HX4A 3VYRB 4XMYA 4PJ0C 2RQQA 1OPCA 3DLLF 2DN0A 2MD5A 1Z7UA 4XKWA 3X2QH 1NK2P 1E0EA 2C6YA 3BCBA 3W2VA 3PNVA 5E8IA 1X1DA 2F5DA 3H3UA 5DYMA 3FXMA 4A3GJ 3WTVC 2JQ7A 1RKTA 3PL8A 4P9FA 3PQKA 3CO6C 4UHTA 1BOBA 1B59A 2PMHA 2QKMB 2NRAC 4YG2F 3MKZA 2F4MB 4I0AA 4I0BA 2FSWA 3GFLA 4O5VA 1WZ2A 2CUFA 3AAFA 3F3XA 4MGRA 1X3ZB 3L2QA 4HBLA 4XKBA 3RPUD 2FU4A 2W57A 2V1XA 3VYUB 1ZGWA 2DU9A 5D5VB 4BNCA 3T1BA 1D1AA 1FY7A 2DA2A 2WTEA 3PM1A 1MH4A 3CZ6A 3TQNA 3ZCOA 1YX3A 1OCOH 2XB5A 1YQAA 4JOMA 3FX3A 4GRIA 5KVRA 3CUQC 3ZQFA 1F43A 1S29A 5KAFC 3TL4X 1IC8A 1N78A 1R4MB 2DA4A 2XF6A 3F0CA 5E1XA 2P0WA 2IBDA 1APLC 3P7NA 4IQJA 2EIJH 3DTEA 1JT0A 3L2VA 4OIQF 1XTAA 2PN6A 5GAHJ 1TC3C 1GUUA 1TWCJ 1UG0A 2L5QA 3E3VA 4UUSA 3ZQ7A 3ONQA 4UNOA 1UELB 4XLPF 3F8CA 4IL6C 4DYCA 1W0TA 2OA4A 3HOXJ 3KLOA 4M9ZA 4UB6C 1WJ5A 3A03A 1V54H 4A5NA 3FWEA 2DCEA 1T95A 3DQVC 2LFBA 1OMIA 2F5VA 2L0KA 1BN5A 2DDAA 3BZCA 1LFPA 3IL2A 4IRGA 2MFZA 3H3VK 4GYIA 1WCMJ 4JX4A 3D0SA 1FWZA 1UAAA 3TEDA 2CV0A 5CVJA 3HUGA 3IKTA 3OR2C 1IUFA 1RZ4A 4WCGA 1SD7A 4XKVA 3F9KA 2CS3A 5FGMA 1FBSA 4L9NA 1R5ID 3S1MJ
chains in the Genus database with same CATH topology
1ZK8A 3BTJA 1JKQC 2R93J 2MGQA 3WHBA 2NS8A 4JX5A 2OF7A 4FE7A 3DCFA 4D5FA 4RBOA 1H88C 2R92J 2XPWA 1TWHJ 3GTOJ 5IYDJ 4M6VA 4MIMA 5K7HA 4A93J 2ELKA 4DYRA 4AC0A 1HF0A 2DA3A 2GBYA 5E3LA 1HCRA 4B1RA 5K7FA 2KT0A 5FKLA 3S14J 5IYBJ 2RAEA 3IV5A 3HB9A 1ZR4A 1B72A 1WH5A 3WHCA 2AHQA 3GTGJ 5J1RA 2CUEA 2HDDA 2DA6A 4IHXA 2Y0SN 4A3JJ 4M3BA 2DMTA 3JRBA 2WAQN 1Q1VA 2L7MP 4CYCA 3S16J 1QVUA 1MSFC 4AUXA 5FKNA 2M0CA 4ABZA 2LY9A 4XICA 3K2AA 3JRAA 2B63J 4A3LJ 5K7ZA 2R0QC 1RETA 3RQIA 2JJ7A 5J1YA 2E1OA 1MBFA 4M3DA 3G1OA 3G1MA 1YRNB 4M3FA 1MBHA 2HYJA 3A01B 2MW8A 4IHYA 1U78A 5JLWA 2R7ZJ 1WH7A 4Y7NJ 4A3BJ 2MG4A 4B3AA 2NVQJ 2WB1N 1D5YA 1MBEA 3FISA 4IHVA 1FIAA 1JKRC 3MN2A 2YS9A 4W97A 4Y52J 5IPAA 2ECCA 1I50J 5IOYA 2XGDA 1LE8A 3G1LA 1E3OC 4A69C 5C4JJ 3MKLA 3B6CA 5FKKA 3NARA 3JRCA 4D5CA 1X58A 2CJJA 2M34A 2ID6A 3GTKJ 1XS9A 4B4CA 3GTPJ 4BXXJ 3M4OJ 2DMUA 5EYRA 5EG0A 5F0CA 3GTQJ 1VI0A 1X2NA 2TCTA 5M3MJ 1ITYA 2E2JJ 3RZDJ 2DA1A 3I4MJ 1TWAJ 2L9RA 1JT6A 3S2HJ 4V2GA 3BR3A 3ZQGA 5F0FA 3SJMA 3HGGA 5F27A 2DA5A 5EEAA 2ZB9A 1JGGA 4DYQA 1ETQA 1MNMC 1SANA 1JKPC 1I6HJ 2H8RA 4XRMA 2XSDC 2EQRA 2HXOA 1FJLA 2EBIA 4S0HB 2M8GX 3BTCA 3LNQA 1ETWA 3TP0A 3FIWA 5GP9A 1QRYA 2W48A 3SDGA 4BKXA 4FISA 1JUSA 1PUFA 3CMYA 4D7NA 3MVPA 3O8HA 1JJ6C 1GVDA 3L1PA 4MO7A 1AU7A 4BY1J 2VI6A 5DS9A 1A5JA 2IAIA 3CCYA 3LOCA 3HOYJ 2VPRA 2ME6A 4XRSG 1A6IA 1ETYA 3BG9A 1MBKA 1DU6A 2FJ1A 1U8BA 5IP7J 3QPSA 5F08A 1GT0C 2HXIA 1JUPA 2XGCA 1T56A 3OSGA 1RPWA 2JK3A 2R5YA 5M5WJ 3VPRA 1IV6A 3ZQHA 5FLMJ 3LSRA 2X6OA 4W1UA 2COBA 2NOGA 1B8IB 5JLXA 5F04A 2LR8A 1X2MA 3JR9A 5EGOA 1P7IA 1IDYA 5FKMA 3HGYA 2CU7A 2HQ5A 4UUSB 3JRHA 3Q0UA 1BL0A 3BR6A 2Y2ZA 4UUTA 1TWGJ 3HBLA 4DZPA 1U9OA 4C3JJ 1AKHA 2ME0A 5E3MA 4JYKA 3GTMJ 4FCYA 2EH3A 3JREA 2XPUA 4L5EA 4A3MJ 3D1NI 3HOUJ 3CDLA 9ANTA 2LD5A 5EZGA 1WGXA 1FTTA 2XGEA 1P7JA 4XRSA 1IGNA 3HEFA 3Q0VA 3TP3A 3IH2A 3M3YJ 3HOWJ 3E7LA 2O9LA 1ZKGA 2VKVA 2YUSA 2QF7A 3BTIA 2LP0A 5M3FJ 1ETOA 1IJWC 2CQXA 2NVTJ 2XB0X 4A3DJ 2G0EA 5BNGA 3OIOA 5HODA 1XG1A 3HKZN 3S2DJ 2HI3A 2K40A 5M5YJ 1NK3P 1HLVA 3BR2A 1K83J 1Z77A 2EZLA 5J1UA 4FE4A 4JP0A 2K9NA 2GLOA 1BA5A 3OSFA 1GDTA 2HOTA 2ECBA 4DW6A 1Z0XA 1MBJA 2DA7A 2DMQA 5GPCA 4BBSJ 3HDDA 3W6VA 5EZHA 3HOZJ 3UKGA 1BW6A 4D7MA 5E3NA 2JA8J 3S15J 4IHWA 4XK4A 1MSEC 3ZOBA 1B72B 4JX6A 1AHDP 1JTYA 1GV2A 1GV5A 4QIWN 1HDDC 1BJZA 2DTZA 2CRGA 4BBRJ 1BW5A 2FD5A 1WI3A 2IEKA 1QPIA 1UG2A 1I3QJ 5GPAA 3JRFA 1IDZA 3BQYA 3HM5A 2HOAA 2JWTA 3S17J 1RR7A 1ENHA 2JA6J 5J3LA 1H8AC 1FEXA 2X48A 4CYCB 2K9SA 3IH3A 4AYBN 2MSYA 2NVXJ 4EEFG 5EF6A 4I6ZA 1JKOC 1ETKA 3C2BA 3PO3J 1H89C 3LSPA 4XIDA 3BG5A 3Q3SA 3TW6A 3QPLA 4BY7J 1RESA 2P81A 2Y30A 3ZQIA 2WV1A 2KDZA 2K9QA 4X1EA 4LOCA 2E19A 4A3FJ 3FK7A 2JA5J 3PO2J 2DMNA 5IP9J 4GFBA 1Y1VJ 5C44J 1T33A 1IG7A 4FTHA 4C3IJ 2E2IJ 3BT9A 4QTRA 3TW7A 4I76A 1JJ8C 5E3OA 1YRNA 2LLKA 1LE8B 1OCTC 3A01A 2YU9J 2H1KA 1LFBA 5F1JA 4A3IJ 1FIPA 3JRGA 2XRLA 4A3KJ 2OPTA 1S7EA 3LSGA 4DZJA 2EZHA 4HNVA 5EG0B 5IOZA 2NVYJ 2O7OA 1POGA 1O4XA 1OJLA 2NS7A 5IYCJ 4MFDA 1TWFJ 3BQZA 1LFUP 4M3EA 2O8KA 2FQ4A 5C4XJ 1K61A 1UHSA 1ZTRA 3B6AA 3Q0WA 4IEJA 3HOVJ 1OCPA 3K7AJ 3S1MJ 1ORKA 3FK6A 2L7FP 4QSHA 5C3EJ 3BG3A 3SFIA 4M3GA 4C3HJ 1FTZA 4C2MJ 1U9NA 4NDLA 3BTLA 3NAUA 1PUFB 2L7ZA 2XPVA 1IRZA 3JRDA 3H0GJ 4X6AJ 2LKXA 1WPKA 2DN0A 4V2FA 3GBGA 1JTXA 2Y31A 1NK2P 1F36A 1ETXA 1Y1WJ 3BR0A 3O8GA 4A3GJ 1HDPA 1RKTA 2M2EA 1HOMA 2CQQA 3LSJA 2FX0A 2TRTA 3IH4A 2R5ZA 1W0UA 1CQTA 2AO9A 5DTDA 2E2HJ 2CUFA 1ETVA 5IP6A 2R5YB 5FKOA 1RKWA 4RDUA 3ZQLA 2LVSA 1ZGWA 1ZR2A 1XC5A 4MLOA 2QCOA 3S1QJ 2DA2A 3PM1A 1MH4A 4MFEA 2DJNA 3A02A 1SFOJ 3QQAA 2JMWA 2XB5A 1OFCX 5EGOB 3JRIA 1MBGA 4J19A 3ZQFA 1F43A 2ID3A 1VNDA 2HOSA 2JN6A 1IC8A 1VF9A 5EDNA 2DA4A 2VKEA 2EZIA 3F0CA 2JA7J 2IBDA 1AKHB 1B8IA 1APLC 2N8GA 1ZQ3P 2D5VA 3FKIJ 5FLVA 4G12A 1JT0A 1R9TJ 1TC3C 1UMQA 1GUUA 1TWCJ 2LK2A 3GTLJ 4UUSA 4A3EJ 2GM4A 2I10A 3S1RJ 4DYCA 1W0TA 3HOXJ 2X9DA 3A03A 5F0HA 1G2HA 2DMPA 5FJ8J 3S1NJ 2VUMJ 2LFBA 3I4NJ 2M9HA 2L0KA 1MH3A 2Y9YA 1EF4A 2LTPA 3RKQA 1JUMA 3OOUA 3CQZJ 1NTCA 3H3VK 3RZOJ 1WCMJ 1QVTA 4JX4A 1VFCA 3DEWA 2Y9ZA 3TEDA 2R5ZB 2PMZN 3GTJJ 1IUFA 3ZQCA 1DU0A 3BR1A 2EZKA 5M5XJ 3BR5A 4A3CJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK8 A;  3BTJ A;  1JKQ C;  2R93 J;  2MGQ A;  3WHB A;  2NS8 A;  4JX5 A;  2OF7 A;  4FE7 A;  3DCF A;  4D5F A;  4RBO A;  1H88 C;  2R92 J;  2XPW A;  1TWH J;  3GTO J;  5IYD J;  4M6V A;  4MIM A;  5K7H A;  4A93 J;  2ELK A;  4DYR A;  4AC0 A;  1HF0 A;  2DA3 A;  2GBY A;  5E3L A;  1HCR A;  4B1R A;  5K7F A;  2KT0 A;  5FKL A;  3S14 J;  5IYB J;  2RAE A;  3IV5 A;  3HB9 A;  1ZR4 A;  1B72 A;  1WH5 A;  3WHC A;  2AHQ A;  3GTG J;  5J1R A;  2CUE A;  2HDD A;  2DA6 A;  4IHX A;  2Y0S N;  4A3J J;  4M3B A;  2DMT A;  3JRB A;  2WAQ N;  1Q1V A;  2L7M P;  4CYC A;  3S16 J;  1QVU A;  1MSF C;  4AUX A;  5FKN A;  2M0C A;  4ABZ A;  2LY9 A;  4XIC A;  3K2A A;  3JRA A;  2B63 J;  4A3L J;  5K7Z A;  2R0Q C;  1RET A;  3RQI A;  2JJ7 A;  5J1Y A;  2E1O A;  1MBF A;  4M3D A;  3G1O A;  3G1M A;  1YRN B;  4M3F A;  1MBH A;  2HYJ A;  3A01 B;  2MW8 A;  4IHY A;  1U78 A;  5JLW A;  2R7Z J;  1WH7 A;  4Y7N J;  4A3B J;  2MG4 A;  4B3A A;  2NVQ J;  2WB1 N;  1D5Y A;  1MBE A;  3FIS A;  4IHV A;  1FIA A;  1JKR C;  3MN2 A;  2YS9 A;  4W97 A;  4Y52 J;  5IPA A;  2ECC A;  1I50 J;  5IOY A;  2XGD A;  1LE8 A;  3G1L A;  1E3O C;  4A69 C;  5C4J J;  3MKL A;  3B6C A;  5FKK A;  3NAR A;  3JRC A;  4D5C A;  1X58 A;  2CJJ A;  2M34 A;  2ID6 A;  3GTK J;  1XS9 A;  4B4C A;  3GTP J;  4BXX J;  3M4O J;  2DMU A;  5EYR A;  5EG0 A;  5F0C A;  3GTQ J;  1VI0 A;  1X2N A;  2TCT A;  5M3M J;  1ITY A;  2E2J J;  3RZD J;  2DA1 A;  3I4M J;  1TWA J;  2L9R A;  1JT6 A;  3S2H J;  4V2G A;  3BR3 A;  3ZQG A;  5F0F A;  3SJM A;  3HGG A;  5F27 A;  2DA5 A;  5EEA A;  2ZB9 A;  1JGG A;  4DYQ A;  1ETQ A;  1MNM C;  1SAN A;  1JKP C;  1I6H J;  2H8R A;  4XRM A;  2XSD C;  2EQR A;  2HXO A;  1FJL A;  2EBI A;  4S0H B;  2M8G X;  3BTC A;  3LNQ A;  1ETW A;  3TP0 A;  3FIW A;  5GP9 A;  1QRY A;  2W48 A;  3SDG A;  4BKX A;  4FIS A;  1JUS A;  1PUF A;  3CMY A;  4D7N A;  3MVP A;  3O8H A;  1JJ6 C;  1GVD A;  3L1P A;  4MO7 A;  1AU7 A;  4BY1 J;  2VI6 A;  5DS9 A;  1A5J A;  2IAI A;  3CCY A;  3LOC A;  3HOY J;  2VPR A;  2ME6 A;  4XRS G;  1A6I A;  1ETY A;  3BG9 A;  1MBK A;  1DU6 A;  2FJ1 A;  1U8B A;  5IP7 J;  3QPS A;  5F08 A;  1GT0 C;  2HXI A;  1JUP A;  2XGC A;  1T56 A;  3OSG A;  1RPW A;  2JK3 A;  2R5Y A;  5M5W J;  3VPR A;  1IV6 A;  3ZQH A;  5FLM J;  3LSR A;  2X6O A;  4W1U A;  2COB A;  2NOG A;  1B8I B;  5JLX A;  5F04 A;  2LR8 A;  1X2M A;  3JR9 A;  5EGO A;  1P7I A;  1IDY A;  5FKM A;  3HGY A;  2CU7 A;  2HQ5 A;  4UUS B;  3JRH A;  3Q0U A;  1BL0 A;  3BR6 A;  2Y2Z A;  4UUT A;  1TWG J;  3HBL A;  4DZP A;  1U9O A;  4C3J J;  1AKH A;  2ME0 A;  5E3M A;  4JYK A;  3GTM J;  4FCY A;  2EH3 A;  3JRE A;  2XPU A;  4L5E A;  4A3M J;  3D1N I;  3HOU J;  3CDL A;  9ANT A;  2LD5 A;  5EZG A;  1WGX A;  1FTT A;  2XGE A;  1P7J A;  4XRS A;  1IGN A;  3HEF A;  3Q0V A;  3TP3 A;  3IH2 A;  3M3Y J;  3HOW J;  3E7L A;  2O9L A;  1ZKG A;  2VKV A;  2YUS A;  2QF7 A;  3BTI A;  2LP0 A;  5M3F J;  1ETO A;  1IJW C;  2CQX A;  2NVT J;  2XB0 X;  4A3D J;  2G0E A;  5BNG A;  3OIO A;  5HOD A;  1XG1 A;  3HKZ N;  3S2D J;  2HI3 A;  2K40 A;  5M5Y J;  1NK3 P;  1HLV A;  3BR2 A;  1K83 J;  1Z77 A;  2EZL A;  5J1U A;  4FE4 A;  4JP0 A;  2K9N A;  2GLO A;  1BA5 A;  3OSF A;  1GDT A;  2HOT A;  2ECB A;  4DW6 A;  1Z0X A;  1MBJ A;  2DA7 A;  2DMQ A;  5GPC A;  4BBS J;  3HDD A;  3W6V A;  5EZH A;  3HOZ J;  3UKG A;  1BW6 A;  4D7M A;  5E3N A;  2JA8 J;  3S15 J;  4IHW A;  4XK4 A;  1MSE C;  3ZOB A;  1B72 B;  4JX6 A;  1AHD P;  1JTY A;  1GV2 A;  1GV5 A;  4QIW N;  1HDD C;  1BJZ A;  2DTZ A;  2CRG A;  4BBR J;  1BW5 A;  2FD5 A;  1WI3 A;  2IEK A;  1QPI A;  1UG2 A;  1I3Q J;  5GPA A;  3JRF A;  1IDZ A;  3BQY A;  3HM5 A;  2HOA A;  2JWT A;  3S17 J;  1RR7 A;  1ENH A;  2JA6 J;  5J3L A;  1H8A C;  1FEX A;  2X48 A;  4CYC B;  2K9S A;  3IH3 A;  4AYB N;  2MSY A;  2NVX J;  4EEF G;  5EF6 A;  4I6Z A;  1JKO C;  1ETK A;  3C2B A;  3PO3 J;  1H89 C;  3LSP A;  4XID A;  3BG5 A;  3Q3S A;  3TW6 A;  3QPL A;  4BY7 J;  1RES A;  2P81 A;  2Y30 A;  3ZQI A;  2WV1 A;  2KDZ A;  2K9Q A;  4X1E A;  4LOC A;  2E19 A;  4A3F J;  3FK7 A;  2JA5 J;  3PO2 J;  2DMN A;  5IP9 J;  4GFB A;  1Y1V J;  5C44 J;  1T33 A;  1IG7 A;  4FTH A;  4C3I J;  2E2I J;  3BT9 A;  4QTR A;  3TW7 A;  4I76 A;  1JJ8 C;  5E3O A;  1YRN A;  2LLK A;  1LE8 B;  1OCT C;  3A01 A;  2YU9 J;  2H1K A;  1LFB A;  5F1J A;  4A3I J;  1FIP A;  3JRG A;  2XRL A;  4A3K J;  2OPT A;  1S7E A;  3LSG A;  4DZJ A;  2EZH A;  4HNV A;  5EG0 B;  5IOZ A;  2NVY J;  2O7O A;  1POG A;  1O4X A;  1OJL A;  2NS7 A;  5IYC J;  4MFD A;  1TWF J;  3BQZ A;  1LFU P;  4M3E A;  2O8K A;  2FQ4 A;  5C4X J;  1K61 A;  1UHS A;  1ZTR A;  3B6A A;  3Q0W A;  4IEJ A;  3HOV J;  1OCP A;  3K7A J;  3S1M J;  1ORK A;  3FK6 A;  2L7F P;  4QSH A;  5C3E J;  3BG3 A;  3SFI A;  4M3G A;  4C3H J;  1FTZ A;  4C2M J;  1U9N A;  4NDL A;  3BTL A;  3NAU A;  1PUF B;  2L7Z A;  2XPV A;  1IRZ A;  3JRD A;  3H0G J;  4X6A J;  2LKX A;  1WPK A;  2DN0 A;  4V2F A;  3GBG A;  1JTX A;  2Y31 A;  1NK2 P;  1F36 A;  1ETX A;  1Y1W J;  3BR0 A;  3O8G A;  4A3G J;  1HDP A;  1RKT A;  2M2E A;  1HOM A;  2CQQ A;  3LSJ A;  2FX0 A;  2TRT A;  3IH4 A;  2R5Z A;  1W0U A;  1CQT A;  2AO9 A;  5DTD A;  2E2H J;  2CUF A;  1ETV A;  5IP6 A;  2R5Y B;  5FKO A;  1RKW A;  4RDU A;  3ZQL A;  2LVS A;  1ZGW A;  1ZR2 A;  1XC5 A;  4MLO A;  2QCO A;  3S1Q J;  2DA2 A;  3PM1 A;  1MH4 A;  4MFE A;  2DJN A;  3A02 A;  1SFO J;  3QQA A;  2JMW A;  2XB5 A;  1OFC X;  5EGO B;  3JRI A;  1MBG A;  4J19 A;  3ZQF A;  1F43 A;  2ID3 A;  1VND A;  2HOS A;  2JN6 A;  1IC8 A;  1VF9 A;  5EDN A;  2DA4 A;  2VKE A;  2EZI A;  3F0C A;  2JA7 J;  2IBD A;  1AKH B;  1B8I A;  1APL C;  2N8G A;  1ZQ3 P;  2D5V A;  3FKI J;  5FLV A;  4G12 A;  1JT0 A;  1R9T J;  1TC3 C;  1UMQ A;  1GUU A;  1TWC J;  2LK2 A;  3GTL J;  4UUS A;  4A3E J;  2GM4 A;  2I10 A;  3S1R J;  4DYC A;  1W0T A;  3HOX J;  2X9D A;  3A03 A;  5F0H A;  1G2H A;  2DMP A;  5FJ8 J;  3S1N J;  2VUM J;  2LFB A;  3I4N J;  2M9H A;  2L0K A;  1MH3 A;  2Y9Y A;  1EF4 A;  2LTP A;  3RKQ A;  1JUM A;  3OOU A;  3CQZ J;  1NTC A;  3H3V K;  3RZO J;  1WCM J;  1QVT A;  4JX4 A;  1VFC A;  3DEW A;  2Y9Z A;  3TED A;  2R5Z B;  2PMZ N;  3GTJ J;  1IUF A;  3ZQC A;  1DU0 A;  3BR1 A;  2EZK A;  5M5X J;  3BR5 A;  4A3C J; 
#chains in the Genus database with same CATH topology
 1O7F A;  2QSF X;  2R93 J;  4CCK A;  2L4A A;  6PAX A;  2FMY A;  1U5T B;  2NS8 A;  4JX5 A;  4RM2 A;  1K79 A;  3K4L A;  4D5F A;  4RBO A;  2QM3 A;  1VQ8 I;  1KU3 A;  4MEY F;  3H5R A;  2XPW A;  5IYD J;  4PJJ A;  4PFO A;  3K4B A;  4MQV A;  1ZH5 A;  3OYN A;  2FBK A;  2X6Y A;  1J09 A;  2ELJ A;  4F92 B;  1HF0 A;  2DT5 A;  4KIT B;  2BY3 A;  2VB6 A;  1HCR A;  1D8K A;  4WWC A;  2KT0 A;  5FKL A;  5IYB J;  1R00 A;  5ICF A;  3IV5 A;  3B73 A;  3S2W A;  3SYT A;  3CCJ I;  3CTA A;  2A6E F;  3KFW X;  1W36 D;  2XAG A;  1NHA A;  2IGK A;  1SMT A;  2CG4 A;  5D5X B;  1FMW A;  1FX7 A;  2O3F A;  1TBX A;  3LWF A;  3WTW C;  2JUG A;  1ZN2 A;  3FMQ A;  1V55 H;  1Q1V A;  3JSO A;  2Z2S B;  2L7M P;  2JSP A;  3S16 J;  1MSF C;  1XGM A;  3AG1 H;  2M0C A;  2K5C A;  2KFD A;  3L2C A;  4A3L J;  2KZV A;  3QRF F;  1TL8 A;  3KP5 A;  2WAF A;  3J7Z I;  2TDX A;  2BXY A;  2M87 A;  1TW2 A;  1BIB A;  3MFK A;  4OWR B;  5DM6 F;  2L02 A;  5D6E A;  3M8J A;  4M3D A;  2FNA A;  4D1Q A;  4UXN A;  4F55 A;  2HYJ A;  2CFX A;  4HW0 A;  2P6T A;  3GME A;  1WJB A;  5LGU A;  1SD5 A;  4Y3O A;  2HGC A;  5L3B A;  4B3A A;  4WXD A;  3OYH A;  1MBE A;  3FIS A;  2E36 A;  1JKR C;  1O57 A;  3LSI A;  4OAZ A;  1R1V A;  4W97 A;  4Y52 J;  2ECC A;  2E5N A;  1YW7 A;  3FZV A;  5DDG A;  2XGD A;  5IOY A;  2R7Q A;  3DPU A;  3G1L A;  1E3O C;  3L9F A;  3FXO A;  2IGN A;  4L9T A;  5B1B H;  1U3E M;  3SFZ A;  3P5J A;  2QQB A;  1ZYR F;  2OJE D;  2VBX A;  1B6A A;  1X58 A;  2M34 A;  2ID6 A;  2ZC2 A;  4U0V A;  3GTK J;  4BXX J;  2PMU A;  1FMV A;  3IHU A;  4M6Y A;  3TDZ C;  2O5R A;  5F0C A;  5EG0 A;  3PJR A;  1J75 A;  3GTQ J;  1X2N A;  2TCT A;  1Y56 A;  5M3M J;  2HTJ A;  1FOX A;  1I39 A;  3RZD J;  5FRN A;  1J5Y A;  2VXD A;  4G6Q A;  1TWA J;  1XN7 A;  2F6C A;  3V8L A;  1A31 A;  2UXX A;  2DK5 A;  2O03 A;  3BR3 A;  2HVS A;  3ZQG A;  5BS6 A;  3MCZ A;  5LFA A;  1W7P D;  2LBF B;  2CH0 A;  4P55 A;  2HDW A;  5EEA A;  4AIK A;  2ZJP F;  1JGG A;  4DYQ A;  4HLX A;  1ETQ A;  1YIO A;  4XLE A;  1JI8 A;  4F52 A;  3PUF A;  5JI6 A;  2XKO A;  3MD2 A;  2XSD C;  2KRC A;  2HXO A;  1PP7 U;  3KE2 A;  3DPT A;  4PK4 A;  4HF1 A;  2M8G X;  4IPA A;  1ETW A;  4LGW A;  3TP0 A;  3CJR B;  4A0Y A;  2DQL A;  4EM1 A;  1PUF A;  1VQL I;  4D7N A;  1ERD A;  2E7W A;  1V5E A;  4CZZ A;  4E70 A;  1U8R A;  4OMZ A;  1VQ7 I;  1LQ1 A;  2HWV A;  3DP7 A;  1XCB A;  5LGN A;  2HZT A;  1JJ6 C;  1GVD A;  2LNB A;  4XON A;  2EFO A;  5FO5 A;  4KIS A;  2VI6 A;  3OYE A;  2P7V B;  2YU3 A;  1A5J A;  3CMA I;  3LA2 A;  2ME6 A;  4XRS G;  2M4K A;  3TBI A;  3FM3 A;  4YEL A;  4HG2 A;  1MBK A;  2GA2 A;  4G9Y A;  2Y48 A;  3CCM I;  5J4Y A;  3K4K A;  1U8B A;  4RB3 C;  3QPS A;  5HDK A;  1R36 A;  1T56 A;  3QPH A;  3V8K A;  4HAM A;  1P9Q C;  3S8P A;  3VSL A;  4KA4 A;  4B8X A;  5M5W J;  1LDD A;  1DPU A;  3C3W A;  1UHM A;  2D1H A;  3DEE A;  4HOB A;  3D5S C;  3H3Z A;  2CQK A;  3MZ8 A;  3FM5 A;  3HRT A;  4HNT A;  5K5O A;  4W1U A;  4ZTJ A;  2DBB A;  3FHN A;  2COB A;  1B8I B;  2K27 A;  5F04 A;  2KKO A;  2VJJ A;  1X2M A;  4U88 A;  1STZ A;  3WTY C;  4D9J A;  2XAS A;  1P7I A;  3JAM Z;  3MKY B;  2STT A;  3HRM A;  4GO1 A;  2KIF A;  2OZU A;  2CU7 A;  1S5L C;  3CUQ A;  3E6D A;  1XSV A;  2CW0 F;  2ZME B;  2ZNZ A;  3GZN B;  2OTJ I;  1OCZ H;  1BL0 A;  4C3J J;  4ENK A;  2I5U A;  5L3E A;  4I09 A;  3DLA A;  1WWX A;  4IX7 A;  2EH3 A;  3JRE A;  2XPU A;  2DYR H;  1BI0 A;  4R8H A;  1RR8 C;  1H9T A;  3VEP A;  2ZKZ A;  2VOD A;  2IT0 A;  2X85 A;  1IF1 A;  2E5Z A;  1UHW A;  4C2U A;  3PFY A;  1FYK A;  2M1B A;  9ANT A;  5HS7 A;  3S32 A;  2IA2 A;  4KIB A;  1YE9 A;  2W00 A;  4Y15 A;  2GXA A;  2W1O A;  4YFX F;  3HEF A;  3IH2 A;  3M3Y J;  3HOW J;  4L5J A;  5B3S H;  5E20 A;  3KZI C;  2O9L A;  2EA4 A;  2A61 A;  3H92 A;  3K70 C;  3MWM A;  2VQL A;  3D5L A;  2CQX A;  2LYC A;  4N9I A;  2XB0 X;  4GXO A;  3OIO A;  5K5R A;  3RQ4 A;  2A3S A;  2O0Y A;  3T5X A;  2AXL A;  3BR2 A;  4M73 A;  2Q0O A;  1PYV A;  5KHD A;  1MKM A;  4KN7 X;  1S72 I;  5HLT A;  4G6T B;  3PSF A;  2V1N A;  2ZJQ F;  3I9V 2;  3IKV A;  1U5T A;  5GPC A;  3IC7 A;  1EH6 A;  3SXY A;  5BOX A;  3DU5 A;  2KRH A;  2DDB A;  3C18 A;  2JA8 J;  2VBW A;  3BDD A;  4XK4 A;  1R71 A;  2PJR B;  1AHD P;  4RLQ A;  1GV2 A;  1LVA A;  3ROU A;  4WK8 F;  2DTZ A;  2CRG A;  1OQY A;  2DXI A;  2DT6 A;  1QPI A;  1GVJ A;  5LGT A;  2JWT A;  5ILS A;  4UVC A;  2JA6 J;  2HQA A;  3JAM K;  3VYS B;  3SDB A;  2MSY A;  1BBY A;  4EEF G;  5CQE A;  2VXZ A;  4I6Z A;  2E34 A;  3W6K B;  5BQT A;  3GVA A;  1DGR M;  2CGP A;  4ZYD A;  4BH9 A;  1ODD A;  3LSP A;  3WGH A;  4BQQ A;  2L7K A;  4XID A;  1VQK I;  3LSK A;  1B4A A;  1R1T A;  2P81 A;  5BPD A;  2WV1 A;  4BE2 A;  4NC8 A;  5IP9 J;  1Y1V J;  4HST A;  1IG7 A;  3MMY B;  4Z6Y A;  4FTH A;  2IS1 A;  2W4S A;  3OYM A;  4I76 A;  4E7K A;  3B02 A;  3BRO A;  3WE3 A;  5LRS A;  4FX4 A;  3K0L A;  3N05 A;  1HXD A;  4LFU A;  2HKO A;  5F1J A;  4CO8 A;  4PGH A;  1G3S A;  1BJA A;  2OPT A;  3KCC A;  2QYO A;  3WE2 A;  3AL0 C;  2L2O A;  3LSG A;  3AG3 H;  2IW5 A;  3DKY A;  3OYB A;  3P9K A;  2O6G E;  2OBP A;  2PLY A;  5L3G A;  1IN6 A;  2RGV A;  2KDO A;  4RAZ A;  1A6Q A;  1O4X A;  1OJL A;  3K4C A;  4CXF A;  1Z6T A;  4MFD A;  1K78 B;  3HYI A;  3FBN B;  4LB6 B;  5C4X J;  2EV5 A;  1FBQ A;  3KZZ A;  2PX9 A;  3FK6 A;  2L7F P;  2DK8 A;  2XAU A;  3CDH A;  3KP7 A;  2R7W A;  1ZEL A;  3HL2 A;  4C3H J;  2PJP A;  2BZT A;  3F22 A;  1FTZ A;  1CGP A;  4P5O A;  3CME I;  3BPV A;  2LBF A;  2LF7 A;  1JGS A;  2R7F A;  1KON A;  1G3W A;  1LB2 A;  2DFE A;  5H2F C;  2V1U A;  2XPV A;  1WJD A;  2HOE A;  3JRD A;  4QWQ A;  4CA0 A;  1TNS A;  3GBG A;  4ESB A;  3WTX C;  5CVV A;  3S3N A;  1F36 A;  1SD6 A;  1J59 A;  5E17 F;  4HPQ A;  3LFU A;  1R22 A;  4XRF A;  1D5V A;  3CLQ A;  3ZP5 A;  4C9Y A;  1XX5 A;  2H09 A;  1BOA A;  1Y0U A;  2FX0 A;  1SFX A;  4RGX A;  1U0J A;  2K3P A;  5CVI A;  3RDI A;  4B47 A;  4PZJ A;  1RUN A;  1X1B A;  3G73 A;  4AU7 A;  5H20 A;  2P5V A;  1ETV A;  5IP6 A;  4BHB A;  2ZXH A;  3LA7 A;  4Q48 A;  2BW3 B;  2R5Y B;  1HQC A;  1D1B A;  2F5F A;  2KRF A;  4EMS A;  5KNL A;  4HQE A;  1OR7 A;  2WAD A;  2D2W A;  4L9V A;  2QCO A;  4IKF A;  1XCV A;  3BG7 A;  3DXJ F;  3HXL A;  3QQA A;  3H9J A;  1Z6R A;  5EGO B;  4J19 A;  2BHY A;  2EV0 A;  1MMN A;  4JQF A;  2VQH A;  4RAY A;  1HST A;  2NNY A;  3H0D A;  2HOS A;  4XLN F;  4PJN A;  2EIN H;  2EB7 A;  3RYP A;  1OCC H;  1VF9 A;  5EDN A;  2EZI A;  5DCF A;  4BQO A;  1B8I A;  1AKH B;  1S8N A;  3WGG A;  5J6X A;  2D5V A;  2H1L A;  2FBI A;  3FKI J;  4KMF A;  2FOW A;  2QLZ A;  1XMA A;  2K7L A;  2EFQ A;  5FRM A;  1T39 A;  2PEX A;  4RS8 A;  2OZ6 A;  1F1Z A;  1PP8 F;  5TIS C;  2GM4 A;  5LBQ A;  2DFH A;  3CCU I;  3Q9V A;  4AD9 A;  4RM3 A;  3ZRG A;  2M0M A;  4ZYE A;  2X9D A;  2ZSH B;  4S04 A;  3V4G A;  3I0T A;  4LIV A;  3GW2 A;  4KDP A;  1P4W A;  1G2H A;  2Z1D A;  1A36 A;  1XDS A;  2M9H A;  1H9G A;  1YJW I;  3E5Q A;  1YHQ I;  4CDG A;  4G7H F;  1LJ9 A;  1TQP A;  2RV8 A;  1NTC A;  4YIF A;  3ECO A;  1JXS A;  3RZO J;  1VFC A;  3M9A A;  2DQR A;  1ZG5 A;  2R5Z B;  4B09 A;  3ZQC A;  2A6T A;  2H6B A;  4CCM A;  2EZK A;  5M5X J;  1S6L A;  2P6S A;  4IXA A;  4A3C J;  1I3A A;  3ZMV A;  3BTJ A;  3K6G A;  2MGQ A;  1XSD A;  1Z67 A;  4OMY A;  3HC7 A;  2A05 A;  3KX2 A;  3PNT A;  4FE7 A;  3DCF A;  2A6H F;  4OOI A;  3HPG A;  1TWH J;  4M6V A;  3OR1 C;  4MIM A;  1VZ0 A;  1W7P B;  2ELK A;  4DYR A;  4AC0 A;  3F8N A;  1QZE A;  5E3L A;  5BMZ A;  3GX4 X;  2EIL H;  3K4N A;  2F4I A;  2YX4 A;  4AM3 A;  5L3C A;  4OAY A;  5L3F A;  2PI0 A;  2RAE A;  4L18 B;  3DKW A;  4XLH A;  1WI9 A;  5ICG A;  2L9S A;  1W5T A;  2KIQ A;  1ZR4 A;  3LA3 A;  5ILV A;  1LKX A;  2PJR A;  3G3Z A;  5FFZ A;  3QYE A;  1LEA A;  5J1R A;  3I53 A;  2ADU A;  4BDZ A;  5JR3 A;  4LLL A;  1VQP I;  2Y0S N;  4A3J J;  1HKQ A;  1FSE A;  2ZFW A;  2DMT A;  4KYW A;  1HBX G;  5DCM B;  3IRQ A;  3F6V A;  1SFU A;  5FKN A;  4U7D A;  4U0W A;  1BR4 A;  4E6K G;  4ABZ A;  4ENJ A;  2LH9 A;  4G8X A;  5IT9 Z;  2EA2 A;  3LST A;  2R0Q C;  1U6G A;  2QSH X;  1KQ9 A;  3RI4 A;  5FLX Z;  1YRN B;  1MIJ A;  4PJM A;  1MBH A;  4M3F A;  3H5N A;  4ZYG A;  3JTG A;  2QBY A;  5JLW A;  2R7Z J;  3RPU A;  4L9J A;  4E7I A;  1YW9 A;  2IGM A;  4A3B J;  3I56 I;  4F3Q A;  2HNH A;  2MG4 A;  2VE9 A;  4EJU A;  3R0A A;  1FZP B;  2YS9 A;  1D0Y A;  2JT1 A;  1LDK B;  2KP6 A;  2EJR A;  2PBI A;  3L00 A;  1Z91 A;  3HZJ A;  4XSZ F;  2HDC A;  4RB2 C;  2VJ4 A;  5FKK A;  5E1Z B;  1X4P A;  1D0X A;  1B9M A;  4D5C A;  3V7S A;  1XS9 A;  3M4O J;  2PQ8 A;  2VKD A;  3CC7 I;  2H94 A;  3K4M A;  2HPI A;  4I2O A;  5EEG A;  2FA5 A;  1ZRF A;  1EV7 A;  2XV4 S;  3WG7 H;  2VN2 A;  1K78 A;  3S2H J;  4V2G A;  3QP5 A;  1SVL A;  1ZRE A;  4GGG A;  4P1W A;  3L2W A;  3QOE A;  2DA5 A;  2E35 A;  2ZB9 A;  3KET A;  3WU2 C;  5CQG A;  1Q1H A;  4EM0 B;  1OIS A;  1DDN A;  4DBQ A;  5D8L B;  4RAG A;  5TJJ A;  1E3H A;  3ZMT A;  4PDK A;  1FJL A;  2EBI A;  4G7O F;  1SFK A;  2LOO A;  2VL8 A;  1Z1D A;  4LJZ F;  5GP9 A;  2HVQ A;  2JA2 A;  2ZCW A;  3SDG A;  3ASN H;  4FIS A;  1IN8 A;  4NC6 A;  5KK1 A;  3MVP A;  2WC2 A;  3I59 B;  4XOP A;  2D45 A;  3A1Y A;  3M07 A;  5DS9 A;  2A69 F;  3LOC A;  4BJ6 C;  5IT9 K;  5ICC A;  1A6I A;  1P92 A;  2IJL A;  1T98 A;  1U5T C;  3E97 A;  1DU6 A;  1VQ4 I;  3FMS A;  2KL4 A;  2XAH A;  2FJ1 A;  5FLX K;  4KIF A;  1F9N A;  3K2Z A;  2VBZ A;  2GWR A;  5IP7 J;  2CFO A;  5F08 A;  2M7A A;  2MAB A;  1JUP A;  3RJP A;  1DPR A;  3OSG A;  5CKT A;  1LPQ A;  2ZFU A;  2R5Y A;  4M72 A;  4UY8 I;  2DOD A;  3LSH A;  1FYM A;  3ECH A;  3RTR A;  3ZQH A;  3GYH X;  2XGX A;  3M8F A;  2Z3Y A;  2ZXI A;  1TQM A;  2HYG D;  4PFP A;  1UCR A;  2P8T A;  2NOJ B;  3ABK H;  2NOG A;  2WBM A;  3DTK A;  3PFI A;  3E1S A;  4XKC A;  1VQ5 I;  3GEZ A;  4NUB A;  2H27 A;  2DPD A;  5EGO A;  1IDY A;  4LB5 A;  2I8D A;  4NC7 A;  5IY5 H;  3M1E A;  2RRE A;  3IAM 2;  4C30 A;  1XMK A;  1WJF A;  2Y2Z A;  4UUT A;  3HBL A;  1AKH A;  1YIT I;  2ME0 A;  2DW4 A;  4HX7 A;  4HLY A;  3GTM J;  1KYZ A;  4A3M J;  3CJQ B;  2GOM A;  1I6X A;  1SVO A;  2MH2 A;  5HOO A;  1K4S A;  4RGU A;  2BYV E;  3CDL A;  1YJN I;  3VYT B;  4V19 K;  2MH9 A;  1FTT A;  2IS4 A;  5F1R A;  3Q0V A;  2CYY A;  4KT6 A;  2Y0S A;  3E6M A;  1TLH B;  2K3F A;  2VKV A;  3H35 A;  3K1M A;  3BTI A;  3FBI B;  1ETO A;  1IJW C;  4IHT A;  5HNH A;  4HDU A;  2QUF A;  5BNG A;  2KIM A;  1XG1 A;  3RKX A;  4EJO A;  2LMD A;  3QAH A;  5D4R A;  2WY8 Q;  2HI3 A;  2K40 A;  3CD6 I;  3TOB A;  1Z77 A;  2EZL A;  3G2B A;  3U2R A;  1F5T A;  4CUG A;  2K9N A;  4BXU A;  4BDY A;  4DW6 A;  3CP2 A;  2CW7 A;  1S7O A;  1Z0X A;  1TNT A;  4KNY A;  2DA7 A;  4HQM A;  4BBS J;  4JK1 X;  1YYV A;  1V5G A;  4ZH4 F;  4X0G A;  3W6V A;  2X1E A;  2W85 A;  2XSJ C;  1YX5 A;  4RB1 A;  3UKG A;  2QQA A;  3BPX A;  4YFN F;  1K6O A;  3S15 J;  5HS9 A;  1MSE C;  1JHH A;  3DF8 A;  1IW7 F;  1W7P A;  3SEZ A;  5LHH A;  4JX6 A;  3WTT C;  3CF2 A;  1IN5 A;  1JTY A;  4ENM A;  2J5O A;  3KYD B;  3M8E A;  2BE5 F;  4BBR J;  1CF7 B;  4Q5S F;  2FD5 A;  3GUD A;  3S3M A;  1PDN C;  4IRI A;  1UG2 A;  3H5A A;  3HHG A;  3J7Y J;  1IDZ A;  1ON1 A;  1H8A C;  1FEX A;  3IH3 A;  2ZO4 A;  4AYB N;  1NH3 A;  4XN0 A;  1EJ9 A;  1J0R A;  4TV7 A;  4CIC A;  3J7A Y;  3NWS A;  3OYA A;  1IRF A;  4WXC A;  2RKH A;  2V1D A;  5DCM A;  2OAZ A;  3BG5 A;  2IS2 A;  2JRT A;  2COM A;  4JBA A;  2EK5 A;  1YIJ I;  2WY7 Q;  5AON A;  4IF4 A;  3WTU C;  2BEO A;  3ZQI A;  3H1C A;  2KDZ A;  4LOC A;  2IRF G;  1OR7 C;  4GFB A;  2OQR A;  3P9C A;  2KMU A;  3RSN A;  2IVM A;  1OYI A;  3FXR A;  2OV7 A;  5J40 A;  1KQ8 A;  1YRN A;  2XRO A;  4BGD A;  1QPM A;  4II2 A;  1LE8 B;  1OCT C;  4BQA A;  1WVR A;  2H8W A;  1MND A;  2YU9 J;  2W24 A;  4ZDP A;  2M3A A;  3KP3 A;  2H1K A;  4XQF A;  1FIP A;  3JRG A;  4YIR X;  1S9H A;  3WGI A;  3KP2 A;  2KQR A;  2HQR A;  1EKE A;  3GF2 A;  2Q1Z B;  3QU3 A;  4RMN A;  3RIR A;  1FT9 A;  2EZH A;  2ZXJ A;  1KGS A;  1DQU A;  2ETH A;  1MW7 A;  4BQN A;  2RN7 A;  5JHF A;  3BP8 A;  2A5Y B;  3I3L A;  3I64 A;  5E79 C;  3DWL E;  2GIZ A;  3JSP A;  2R7X A;  2XAF A;  1B1B A;  3ESW B;  5JVG F;  3F8B A;  2O8K A;  2GOX B;  2XAQ A;  1I1G A;  2EWN A;  4HF2 A;  1UHS A;  1EA3 A;  1ZTR A;  3B6A A;  5CJ9 A;  4ETS A;  3K7A J;  4B44 A;  2QQ8 A;  4RAF A;  4IO9 F;  2QQ9 A;  4M3G A;  2WAE A;  4CSW A;  2Y69 H;  5E1W A;  4NDL A;  3IP4 B;  2BY0 A;  3OYD A;  2KIS A;  3BG6 A;  2OCC H;  2OU2 A;  4X6A J;  4KJZ A;  1WPK A;  3MZY A;  1Z21 A;  2Y31 A;  3EPZ A;  2JSC A;  2DFF A;  2STW A;  1ETX A;  3DU6 A;  3N97 A;  2R3S A;  1HKS A;  3TKY A;  1Y1W J;  2VON A;  3BR0 A;  1WJE A;  1HOM A;  2VT2 A;  3LSJ A;  4BXF A;  2W25 A;  5CYV A;  1O3Q A;  2TRT A;  3I59 A;  2VLA A;  3FXQ A;  1P4X A;  4HX8 A;  1XGS A;  1KU9 A;  1CQT A;  2R7D A;  2P5L C;  2AO9 A;  1IXR C;  3C2H A;  2EPF A;  1BI1 A;  4EGY A;  2O8X A;  2X6W A;  4RDU A;  4B43 A;  4HV5 A;  1FBU A;  3VOD A;  2ESN A;  2LVS A;  3COA C;  3ASO H;  3HJE A;  2DLL A;  1ZR2 A;  3REO A;  3S1Q J;  3LMM A;  4MFE A;  1RNL A;  3EYY A;  2DJN A;  5DUK A;  2DOF A;  1MNE A;  3A02 A;  1YTY A;  1SFE A;  1SFO J;  2JMW A;  2QVO A;  2V7F A;  3WOD F;  4A6D A;  3L2R A;  5LD2 C;  3KLN A;  4OIR F;  5DM7 F;  1IRG A;  1VND A;  2KLO A;  4E7H A;  3FMR A;  4RLF A;  1J9I A;  2JN6 A;  2VKE A;  1GLN A;  1Y0N A;  2R7V A;  2N8G A;  5ICE A;  3HTU A;  2NNN A;  3OIQ A;  5FLV A;  4G12 A;  2B9S A;  4IRH A;  1R9T J;  1ULY A;  1UMQ A;  1WKM A;  4CGZ A;  1ZHF A;  2LK2 A;  3GTL J;  3ZMZ A;  1X1P A;  1L3L A;  1UST A;  3F8F A;  3QWL A;  3S1R J;  1N75 A;  3C1D A;  3DEU A;  4ITV A;  2MYS A;  5J47 A;  3AKZ A;  5FJ8 J;  2W7N A;  3D5R C;  2VUM J;  3S3O A;  5CVU A;  1I27 A;  3K4J A;  1MH3 A;  1EF4 A;  2LTP A;  4AYB A;  1O3R A;  1JUM A;  3A2K A;  1OKR A;  4EVI A;  1FP1 D;  3OOU A;  4IOC F;  2BV6 A;  2Y9Z A;  1ZAO A;  5A2Q Z;  3WU1 B;  3G71 I;  3GTJ J;  1DU0 A;  2NXN B;  3I4P A;  2EFP A;  3BR1 A;  2VQC A;  1WQ2 A;  3BR5 A;  3R4K A;  3DBH B;  4MNU A;  2V9K A;  3NRV A;  5LEJ A;  2YSR A;  4E7Z A;  2X1C A;  3OYC A;  1JKQ C;  3ZXS A;  3CUO A;  1MDM B;  1FC3 A;  1AOY A;  3CP8 A;  3ZQQ A;  4BU2 A;  3IWZ A;  1GXP A;  1QU3 A;  2X1D A;  2L3D A;  2R92 J;  4RB0 A;  4LMY A;  4A93 J;  2EV6 A;  4UV8 A;  2GBY A;  3SEQ A;  2MD0 A;  2X6X A;  2AS5 F;  3OL3 A;  5K7F A;  1N77 A;  3HRU A;  3FF5 A;  4FX0 A;  5D4S A;  4CCN A;  3RPQ A;  3RKW A;  1K7A A;  3HOS A;  3KYC B;  3HB9 A;  2CUJ A;  5B1A H;  5ILU A;  1WH5 A;  4BAY A;  3WTS C;  1WJC A;  3WHC A;  5DD8 A;  1PUE E;  4LG0 B;  3GTG J;  3K10 A;  2FOK A;  1MMS A;  3VOE A;  1CF7 A;  2NAZ A;  4M3B A;  3PQJ A;  2X51 A;  3JRB A;  1YO5 C;  1WFX A;  1H0M A;  2ZBK A;  5B66 C;  2KJB A;  4PCQ A;  1Y8R B;  3BJ6 A;  1XD7 A;  3CCQ I;  2HYF A;  2OD5 A;  4AUX A;  2KZG A;  3EET A;  1TQI A;  2E1M B;  2LY9 A;  4XIC A;  3K2A A;  2B63 J;  2W84 A;  4BJT A;  2Z16 A;  5ED4 A;  3SQN A;  4XNF A;  1RI7 A;  4EJV A;  1RET A;  1XB4 A;  2JJ7 A;  5J1Y A;  3DTI A;  4GDF A;  1REP C;  3CJN A;  2Z99 A;  2E1O A;  2NVU B;  1MBF A;  5HLG A;  3G1O A;  2MW8 A;  2M45 A;  3HUG B;  4ZZD A;  2M7B A;  1U78 A;  1LDJ A;  2XUB A;  3LL7 A;  2V6C A;  2WB1 N;  3R60 A;  1WHU A;  4ANJ A;  1D5Y A;  1N25 A;  1G3T A;  2GXG A;  2HZD A;  1Z7L A;  2QKL B;  3E6B A;  5LHI A;  1W36 C;  5H6R A;  4F91 B;  5A2Q K;  5AIP A;  4XBF A;  1LE8 A;  3BY6 A;  4A69 C;  5L3D A;  2XIG A;  3NAR A;  3JRC A;  3A4C A;  1VQ9 I;  3OOP A;  2X0L A;  4YRV A;  1HSJ A;  1W5S A;  4B4C A;  1T6S A;  4HV6 A;  3GTP J;  1Y39 A;  5EYR A;  1VI0 A;  2MBF A;  1UB9 A;  4KIG A;  3P9I A;  3AG2 H;  3O3K A;  2BOL A;  5HVQ C;  1RRJ A;  2CV2 A;  1ITY A;  2E2J J;  3NWT A;  1T08 B;  1IZ1 A;  2DA1 A;  3TMO A;  2LRD A;  1AA7 A;  5CPR B;  2M8E A;  1RIO H;  2VOP A;  2KJC A;  1SAU A;  2L9R A;  2ZXW H;  3EQL F;  1QO0 D;  1P2F A;  3DKX A;  3SJM A;  2ZME A;  3KIO A;  5F27 A;  1MMA A;  1QNT A;  4BE0 A;  2QA4 I;  1TT0 A;  1QZY A;  3ZGK A;  2ISY A;  2RNG A;  1SAN A;  4CH7 A;  2EFW A;  1BC8 C;  2VIX A;  1KYW A;  4II3 A;  4XRM A;  2JVH A;  4EAT A;  4BHP A;  3BTC A;  4Y13 A;  3MEX A;  1QRY A;  2HKX A;  2W48 A;  4BKX A;  1MJB A;  1JUS A;  3CMY A;  3I5U A;  1QQI A;  1FYL A;  1M1E B;  1A04 A;  1YS7 A;  2OCE A;  4E4H A;  4Q47 A;  4BY1 J;  4GCV A;  2HR3 A;  2IAI A;  5GAD J;  1SD4 A;  4AIH A;  3HOY J;  3ABT A;  4ZC3 A;  1PJR A;  1G3Y A;  3CES A;  3DBL B;  4LLG F;  3MZH A;  1V5F A;  1F4K A;  2UV1 A;  4CYD A;  4Y4R A;  2ZJ2 A;  2P7C B;  4E7S A;  2HPM A;  2HXI A;  4EJW A;  5J8F A;  3G4S I;  4R1H A;  1RPW A;  1OYY A;  2JK3 A;  4PSX A;  4FAS D;  2L01 A;  2Y0M A;  3K70 D;  3FDY A;  4QPO A;  3VPR A;  1W1W E;  5FLM J;  3W2W A;  2R7R A;  2V26 A;  5LLQ A;  1IAW A;  5ERI A;  3C2G A;  2X6O A;  3PIO F;  1O7L A;  1MJA A;  3CCE I;  4H4K C;  2GXB A;  1ON2 A;  2UZK A;  1Y6I A;  4N9H A;  2MC4 A;  1O3S A;  3BZ6 A;  4HF0 A;  5DD4 A;  2XKP A;  3NQO A;  4Y33 A;  3SZG A;  3U1D A;  3E5X A;  3HGY A;  3F23 A;  3PUB A;  5HDG A;  1UJ8 A;  1HW5 A;  1HKT A;  3JRH A;  1IUY A;  1GXQ A;  4BYY A;  3Q0U A;  1MJ9 A;  1FOK A;  4BEH B;  3EUA A;  2DJI A;  3RCO A;  1U9O A;  2FBH A;  3OIP A;  3MKW B;  2WWY A;  2FXA A;  5E3M A;  2NS0 A;  4JYK A;  2ESH A;  2V9V A;  4FCY A;  2Z9O A;  4L5E A;  1BI3 A;  3GLL A;  3HG9 A;  3OWT A;  3D1N I;  2VQG A;  5FD6 A;  3GFI A;  4LIU A;  5EZG A;  1WGX A;  5KAI C;  3HTS B;  2Q2E B;  5JHU A;  2XGE A;  2FQ3 A;  4OIP F;  5K1Y A;  4IJA A;  4XRS A;  1IGN A;  2R7O A;  3Q5F A;  4P96 A;  1X19 A;  3E7L A;  1NG7 A;  1ZKG A;  3EYI A;  2QF7 A;  5M3F J;  2M30 A;  4A3D J;  1S7A A;  3HOT A;  2L9V A;  2RDP A;  4IQ4 A;  3HKZ N;  3S2D J;  3ZR8 X;  5M5Y J;  3QYF A;  4KN4 X;  1HLV A;  1D8J A;  1ZGA A;  3KEY A;  1K83 J;  3SZP A;  5J1U A;  4A0Z A;  4IZZ A;  2BVL A;  1ACI A;  1DGW Y;  5DEQ A;  4FE4 A;  1VQ6 I;  4N4O B;  3I54 A;  2GLO A;  1BA5 A;  3A0H C;  3OSF A;  3SHF A;  3ZMU A;  2CQ7 A;  1GDT A;  4XSX F;  1XMX A;  2RVC A;  1Z3Y A;  1MDM A;  2DMQ A;  3HDD A;  2WB1 A;  2IXS A;  5EZH A;  4UVA A;  2LY1 A;  1BW6 A;  1YW8 A;  2YPR A;  4D7M A;  2JRM A;  5E3N A;  1LEB A;  3ERM A;  1Z05 A;  1G4D A;  1B72 B;  1FNN A;  1D0Z A;  2JPB A;  4PUS A;  4QIW N;  5HLH A;  1BJZ A;  1WJA A;  1YFH A;  3CUQ B;  1V4R A;  4EQQ A;  2CQN A;  3ABM H;  1S3J A;  1J7K A;  2ZJR F;  2VOO A;  3DBR B;  3HSF A;  1SVM A;  1WI3 A;  2IEK A;  5GPA A;  3TO7 A;  1WRJ A;  3BQY A;  2Z33 A;  3HM5 A;  3U9G A;  4KT5 C;  1RR7 A;  2CMP A;  1VQM I;  3OS2 A;  2X48 A;  4CYC B;  2K9S A;  3PNY A;  2YX7 A;  3C7J A;  5LHG A;  3OS0 A;  4DIQ A;  2JTV A;  2NVX J;  3T8R A;  3LQQ A;  5EF6 A;  4LG0 A;  1BI2 A;  4FT8 A;  3OYI A;  1JKO C;  3T8T A;  4E7L A;  3C2B A;  2XHK A;  5HLI A;  3EUK L;  3J81 Z;  2KHM A;  3Q3S A;  4FQG A;  3TW6 A;  4ZYA A;  4BY7 J;  5EEH A;  2VC1 A;  1RES A;  3O6B B;  1OLT A;  4X1E A;  4BHC A;  5TRD A;  3CCS I;  3EUH A;  3FK7 A;  4A3F J;  2JA5 J;  2W82 A;  2DMN A;  2IA0 A;  5C44 J;  4BL0 B;  1T33 A;  3GWZ A;  5FD5 A;  4ZYH A;  4C3I J;  2E2I J;  4B48 A;  4QTR A;  3TW7 A;  2FF4 A;  4B3X A;  5E3O A;  2P5K A;  2DO7 A;  2BGC A;  4U7B A;  2LY2 A;  2LF8 A;  3KP4 A;  1R1U A;  4I01 A;  2FUG 2;  2G9W A;  2BW3 A;  4O6J A;  1ZLK A;  2OUM A;  3HSE A;  2GQQ A;  4LD5 A;  2XRL A;  4ENN A;  4UUV A;  4RA2 A;  4ZDL A;  4AVP A;  3ZPL A;  4DZJ A;  4QLC U;  2DFI A;  1ZRC A;  1R5H A;  4KUM A;  4YII A;  5IOZ A;  4LK0 F;  2NVY J;  2O7O A;  3HPH A;  3TOA A;  1POG A;  2NS7 A;  5IYC J;  1NG6 A;  1TWF J;  3OS1 A;  4J01 A;  4R79 A;  3BQZ A;  1K61 A;  4L0Z B;  1FPQ A;  4ZDO A;  3H36 A;  3TO9 A;  2HS5 A;  3BCA A;  5J4V A;  3CCL I;  1DP7 P;  4AWX B;  2K02 A;  4QSH A;  3M7G A;  4AID A;  4ZTF A;  3BG3 A;  3ULQ B;  3PSI A;  1YG2 A;  2MLK A;  5KCM A;  2BY2 A;  4C2M J;  1U9N A;  1LUJ B;  3NAU A;  2PG4 A;  2Z5U A;  1C0W A;  3K1P A;  2L7Z A;  4ESF A;  3H0G J;  3DFG A;  2LKX A;  5AIQ A;  4V2F A;  2EIM H;  2V4J C;  1JTX A;  5FB2 A;  1T8I A;  3BJA A;  2IPQ X;  3GFJ A;  4DJA A;  4A0X A;  1A35 A;  3O8G A;  1USS A;  4HNU A;  1HDP A;  2M2E A;  2V6E A;  2CQQ A;  2WV0 A;  4BE1 A;  3J81 K;  3DPL C;  3IH4 A;  2R5Z A;  1W0U A;  4P9U A;  2EIK H;  3U21 A;  2HTS A;  5DTD A;  1WSU A;  2E2H J;  3TGN A;  4BJ5 C;  1SMY F;  3I71 A;  3VB2 A;  4HA8 A;  2CWE A;  3KP6 A;  5FKO A;  1RKW A;  1T0F C;  1ZLJ A;  2BXZ A;  1SAX A;  1EH7 A;  3F21 A;  3AG4 H;  4YEJ A;  1MD0 A;  3ZQL A;  2ACJ A;  3CO7 C;  5F6F A;  2R4G A;  1E2X A;  1T38 A;  4KFC A;  1FSH A;  3E6C C;  1XC5 A;  4C2T A;  4MLO A;  3CC2 I;  2BY1 A;  3HKZ A;  4N4N B;  2PFB A;  1K6Y A;  5CLS A;  4A6E A;  4J00 A;  1OFC X;  3J80 Z;  3JRI A;  2GIV A;  1MBG A;  1BR1 A;  2ID3 A;  3VFZ A;  4M71 A;  2CV1 A;  3R61 A;  2GA1 A;  4CCL A;  3GZ6 A;  3OMY A;  3ELK A;  2JA7 J;  3SZT A;  5IT3 A;  4EJT A;  1MGT A;  1ZQ3 P;  3CDI A;  3MQ0 A;  1O3T A;  1AWC A;  2DT7 B;  2GAU A;  4BS9 A;  3FXJ A;  2CW8 A;  2ZSI B;  2FRH A;  4LG3 A;  4NBQ A;  1BIA A;  1JHF A;  1FLI A;  5D8K B;  4A3E J;  2J5P A;  2R7T A;  4BEH A;  2I10 A;  5GAG J;  3W3C A;  1K4T A;  3IRR A;  2GZW A;  4I99 C;  3QP6 A;  5F0H A;  4M9S A;  4N0B A;  3E5U A;  1IO2 A;  2DMP A;  5D5W B;  1YS6 A;  2FML A;  3I55 I;  3S1N J;  2K9L A;  4EM2 A;  4OIO F;  3I4N J;  1YLF A;  2BVM A;  2Y9Y A;  2E71 A;  2Q2E A;  2UXN A;  3RKQ A;  2L54 A;  1VQN I;  3GZ5 A;  3CQZ J;  3KPH A;  1OYW A;  1IN4 A;  3HHH A;  4MHG A;  2H6C A;  4OU0 A;  1QVT A;  3DEW A;  2LKS A;  1ZG1 A;  3IAS 2;  2PMZ N;  1Z3X A;  2MA3 A;  2Y75 A;  3ZMD A;  2VT3 A;  4Q4Z F;  3OYF A;  2DI3 A;  1ZK8 A;  1YI2 I;  2KPM A;  3OL4 A;  4KMU X;  4A2U A;  2VBY A;  3WHB A;  4Y17 A;  2WA0 A;  2A68 F;  2OF7 A;  3LSM A;  2MC3 A;  1QZZ A;  2MLG A;  1H88 C;  1E3P A;  3GTO J;  1X1C A;  3O2P E;  5K5Q A;  5K7H A;  2OTL I;  2JZY A;  1QBJ A;  4I02 A;  3W6J B;  2ZME C;  4E7J A;  2DA3 A;  2G7U A;  5DUI A;  4B1R A;  2CUZ A;  3OV8 A;  3S14 J;  5BPI A;  4LLN A;  1TTY A;  4YFK F;  3J80 K;  3ERE D;  1B72 A;  3V8J A;  3KEQ A;  2AHQ A;  2VPL A;  3V7R A;  3IWF A;  1KA8 A;  2CUE A;  4EV0 A;  2HDD A;  3LFK A;  2DA6 A;  4IHX A;  4M6X A;  3RKY A;  2XC7 A;  3GXO A;  2WAQ N;  3F72 A;  4ASN A;  4CCJ A;  1R49 A;  4CYC A;  2HQN A;  1QVU A;  2LKP A;  1TW3 A;  2XF5 A;  1GHC A;  2L9N A;  3JRA A;  3WU0 A;  5K7Z A;  5J8C A;  1XPX A;  5JFR A;  3RQI A;  3NEU A;  2HFH A;  1IXS B;  3G1M A;  3OYG A;  3FKJ A;  1OCR H;  3A01 B;  4HEA 2;  2UUZ A;  4IHY A;  3VSK A;  1WH7 A;  4IVN A;  4Y7N J;  3HRS A;  4HYE A;  2NVQ J;  2M5W A;  2DYS H;  4IHV A;  1FIA A;  3MN2 A;  1XDU A;  5IPA A;  3U1K A;  1I50 J;  4L5I A;  2QWW A;  3TO6 A;  5C4J J;  2R7S A;  3MKL A;  3B6C A;  4I98 B;  3KZY A;  1ZG3 A;  2CJJ A;  5GTI C;  4PGG A;  3KYL A;  1MZB A;  3AFH A;  2DMU A;  5H6Q A;  1UZC A;  3OY9 A;  4DOZ A;  4IOA F;  3K69 A;  1JE8 A;  1KQ0 A;  3JCU C;  3I4M J;  2RNJ A;  1IV8 A;  4K2E A;  3W2A A;  2B0L A;  1JT6 A;  1IXC A;  2V79 A;  3OYJ A;  2K85 A;  2XAJ A;  5F0F A;  1EH8 A;  2HEO A;  3HGG A;  4KIC A;  4NQW B;  3L09 A;  1X1A A;  3J7A O;  2CO5 A;  2AQE A;  3HIF A;  2K9M A;  2LRE A;  4ZZL A;  4CHU A;  1MNM C;  1HW2 A;  2DOA A;  4O3M A;  2V9P A;  4LIT A;  1JKP C;  1IRX A;  1I6H J;  2H8R A;  5LEK A;  1ZAR A;  1TP4 A;  2EQR A;  1MMD A;  2VKH A;  2YR2 A;  2AQF A;  4S0H B;  2LDU A;  4BAC A;  2DPU A;  3LNQ A;  1IN7 A;  4HRI A;  3FIW A;  3VWB A;  2XDV A;  3JTH A;  4XM3 A;  1W4M A;  2IP2 A;  4ON0 A;  3O8H A;  3L2U A;  1Y8Q B;  2QGU A;  3FXK A;  4RGS A;  4XLC A;  4DQ2 A;  3L1P A;  3LAJ A;  3N4M A;  1B9N A;  4WX9 A;  1V3F A;  1X3W B;  4MO7 A;  3CCR I;  1AU7 A;  1KZH A;  2XF7 A;  4H0E A;  5JVT A;  1R4N B;  3M1C A;  3CCY A;  1I1S A;  2FNP A;  2VPR A;  2ZNY A;  2QBY B;  1ETY A;  2G7H A;  1MMG A;  2K4J A;  3K1N A;  1T2K A;  2E1N A;  3BG9 A;  4PSW A;  5CVR A;  5E8G A;  4LK1 F;  2QEN A;  4WF2 A;  1GT0 C;  2XGC A;  3H9Q A;  1ZGJ A;  4XOR A;  1ONV A;  3FHZ A;  2PMZ A;  2CSO A;  2IA1 A;  4F93 B;  2ICW G;  5F64 A;  1HC8 A;  3ABU A;  1T0F A;  1IV6 A;  1FOY A;  2K4B A;  3WTZ A;  2IS6 A;  1U2W A;  3LSR A;  4XR6 A;  3AL0 B;  3CMM A;  1Z9C A;  2L4M A;  2HVR A;  3F8M A;  3F6O A;  5JLX A;  2LR8 A;  1QA6 A;  1D3Y A;  3JR9 A;  3BJO A;  2RC4 A;  1ZRD A;  2QEX I;  1LVK A;  5FKM A;  4FHT A;  1UFM A;  4M74 A;  3BZK A;  2HQ5 A;  4Z2Y A;  4UUS B;  2LG4 A;  4S05 A;  2NYX A;  3BR6 A;  1TWG J;  4DZP A;  3I58 A;  3CCV I;  1J2X A;  4A5M A;  1HW1 A;  4XLF A;  3QOD A;  3UNG C;  2P4W A;  2A07 F;  1FP2 A;  1QHH D;  2Q8K A;  2VJ5 A;  3CJT B;  2AXT C;  2E1M C;  3TDU C;  2ISZ A;  3V7C A;  3WG9 A;  3ML6 A;  3HOU J;  3V42 A;  4NHJ A;  2JPC A;  3EUH C;  2LD5 A;  3QU6 A;  3VDX A;  4G7Z F;  5LRR A;  1P7J A;  3LQR A;  3GCM A;  3TP3 A;  3CLO A;  1YOV B;  3ZN1 A;  3RYR A;  4GYG A;  2YUS A;  2WAQ A;  4L0Y B;  1G59 A;  2LP0 A;  2NVT J;  2X4H A;  3GO5 A;  1G8X A;  2XVC A;  4XL9 A;  4QPQ A;  4A12 A;  2A5W A;  3T0Y A;  2G0E A;  5HOD A;  1RC9 A;  2HU9 A;  4RGR A;  1R5G A;  1XSX A;  1QGP A;  3ISP A;  2QSG X;  1NK3 P;  3LAP A;  3PIP F;  3DV8 A;  5EJC A;  4CCO A;  1P4A A;  1XGN A;  5GTH C;  1KU2 A;  1R58 A;  1R6R A;  3GFM A;  1QHG A;  2ELH A;  4JP0 A;  3BWG A;  5DV5 A;  3QPT A;  4NNJ A;  5TGT A;  2HOT A;  2ECB A;  4G94 A;  3FXU A;  1SEU A;  2XRN A;  1MBJ A;  3QYB A;  3ZMS A;  2LSO A;  3HOZ J;  2VC0 A;  4U87 A;  4IHW A;  3H9G A;  2F5E A;  3MAJ A;  3ZOB A;  3BOQ A;  1TZL A;  4BUP A;  4M9X A;  2UWM A;  1HDD C;  1GV5 A;  4XLA A;  2LC2 A;  3QOP A;  4EGZ A;  4FET A;  1BW5 A;  2DAO A;  1I3Q J;  1YJ9 I;  3JRF A;  2HOA A;  3S17 J;  1ENH A;  3GLX A;  4DBR A;  5J3L A;  3JW4 A;  1XGO A;  3EDP A;  4NB5 A;  2BHZ A;  2RQP A;  4MEX F;  4UB8 C;  2F2E A;  1BC7 C;  3BLY A;  4AIJ A;  2M4G A;  2OC6 A;  1DUX C;  2DTR A;  1ETK A;  3G6E I;  2O61 A;  3PO3 J;  1H89 C;  3UR3 C;  2OQG A;  3QPL A;  3CF5 F;  3R0J A;  1TT5 B;  1R23 A;  2Y30 A;  4ESJ A;  5E18 F;  2K9Q A;  2VAS A;  4U0Y A;  1D1C A;  2E19 A;  3PO2 J;  5D5U B;  3R6S A;  2E60 A;  2BBY A;  2FE3 A;  2VJI A;  1BR2 A;  2F5C A;  3BT9 A;  5FFX A;  4D0P A;  4UV9 A;  1LNW A;  1JJ8 C;  3L7W A;  2LLK A;  1RUO A;  3FXL A;  1HA8 A;  3A01 A;  4PJL A;  1LFB A;  1X3U A;  1W5C C;  3Q9S A;  4HDV A;  1L0O C;  4DGW B;  2VE8 A;  3BC8 A;  4A3I J;  1E17 A;  1X4O A;  2KIU A;  3K9T A;  4A3K J;  1BM9 A;  1S7E A;  2D1V A;  2EFN A;  2F48 A;  4UVB A;  4ZJZ A;  1PVE A;  4XOT A;  2E7X A;  4HNV A;  5B5E C;  1I5Z A;  5EG0 B;  3ZN0 A;  5HS8 A;  5GAE J;  4DNC A;  1SC7 A;  3ABL H;  3CC4 I;  1DP3 A;  5HNF A;  4G6D A;  3OYL A;  3HSR A;  1G6N A;  2E1C A;  2F4O B;  4F7Z A;  4AVZ A;  2R7U A;  1LFU P;  4IHS A;  4M3E A;  2FQ4 A;  4HSR A;  3OYK A;  3Q0W A;  2DOE A;  4IEJ A;  1OCP A;  2B7E A;  2FEZ A;  4CZC A;  1VQO I;  3HOV J;  4WXH A;  1ORK A;  2JUC A;  5D6F A;  1VTN C;  5C3E J;  2JVG A;  4MTD A;  1P6R A;  5FRO A;  3E0J B;  3SFI A;  2IGO A;  1R7J A;  1KU7 A;  4OIN F;  4MTE A;  2QZ8 A;  1FOW A;  4NQW A;  3S93 A;  3A0B C;  4XN3 A;  3BTL A;  1PUF B;  4HZF A;  5HDN A;  4I7H A;  4MQ9 F;  3IUO A;  3KEO A;  1IRZ A;  2K86 A;  4HX4 A;  3VYR B;  4XMY A;  4PJ0 C;  2RQQ A;  1OPC A;  3DLL F;  2DN0 A;  2MD5 A;  1Z7U A;  4XKW A;  3X2Q H;  1NK2 P;  1E0E A;  2C6Y A;  3BCB A;  3W2V A;  3PNV A;  5E8I A;  1X1D A;  2F5D A;  3H3U A;  5DYM A;  3FXM A;  4A3G J;  3WTV C;  2JQ7 A;  1RKT A;  3PL8 A;  4P9F A;  3PQK A;  3CO6 C;  4UHT A;  1BOB A;  1B59 A;  2PMH A;  2QKM B;  2NRA C;  4YG2 F;  3MKZ A;  2F4M B;  4I0A A;  4I0B A;  2FSW A;  3GFL A;  4O5V A;  1WZ2 A;  2CUF A;  3AAF A;  3F3X A;  4MGR A;  1X3Z B;  3L2Q A;  4HBL A;  4XKB A;  3RPU D;  2FU4 A;  2W57 A;  2V1X A;  3VYU B;  1ZGW A;  2DU9 A;  5D5V B;  4BNC A;  3T1B A;  1D1A A;  1FY7 A;  2DA2 A;  2WTE A;  3PM1 A;  1MH4 A;  3CZ6 A;  3TQN A;  3ZCO A;  1YX3 A;  1OCO H;  2XB5 A;  1YQA A;  4JOM A;  3FX3 A;  4GRI A;  5KVR A;  3CUQ C;  3ZQF A;  1F43 A;  1S29 A;  5KAF C;  3TL4 X;  1IC8 A;  1N78 A;  1R4M B;  2DA4 A;  2XF6 A;  3F0C A;  5E1X A;  2P0W A;  2IBD A;  1APL C;  3P7N A;  4IQJ A;  2EIJ H;  3DTE A;  1JT0 A;  3L2V A;  4OIQ F;  1XTA A;  2PN6 A;  5GAH J;  1TC3 C;  1GUU A;  1TWC J;  1UG0 A;  2L5Q A;  3E3V A;  4UUS A;  3ZQ7 A;  3ONQ A;  4UNO A;  1UEL B;  4XLP F;  3F8C A;  4IL6 C;  4DYC A;  1W0T A;  2OA4 A;  3HOX J;  3KLO A;  4M9Z A;  4UB6 C;  1WJ5 A;  3A03 A;  1V54 H;  4A5N A;  3FWE A;  2DCE A;  1T95 A;  3DQV C;  2LFB A;  1OMI A;  2F5V A;  2L0K A;  1BN5 A;  2DDA A;  3BZC A;  1LFP A;  3IL2 A;  4IRG A;  2MFZ A;  3H3V K;  4GYI A;  1WCM J;  4JX4 A;  3D0S A;  1FWZ A;  1UAA A;  3TED A;  2CV0 A;  5CVJ A;  3HUG A;  3IKT A;  3OR2 C;  1IUF A;  1RZ4 A;  4WCG A;  1SD7 A;  4XKV A;  3F9K A;  2CS3 A;  5FGM A;  1FBS A;  4L9N A;  1R5I D;  3S1M J; 
#chains in the Genus database with same CATH homology
 1ZK8 A;  3BTJ A;  1JKQ C;  2R93 J;  2MGQ A;  3WHB A;  2NS8 A;  4JX5 A;  2OF7 A;  4FE7 A;  3DCF A;  4D5F A;  4RBO A;  1H88 C;  2R92 J;  2XPW A;  1TWH J;  3GTO J;  5IYD J;  4M6V A;  4MIM A;  5K7H A;  4A93 J;  2ELK A;  4DYR A;  4AC0 A;  1HF0 A;  2DA3 A;  2GBY A;  5E3L A;  1HCR A;  4B1R A;  5K7F A;  2KT0 A;  5FKL A;  3S14 J;  5IYB J;  2RAE A;  3IV5 A;  3HB9 A;  1ZR4 A;  1B72 A;  1WH5 A;  3WHC A;  2AHQ A;  3GTG J;  5J1R A;  2CUE A;  2HDD A;  2DA6 A;  4IHX A;  2Y0S N;  4A3J J;  4M3B A;  2DMT A;  3JRB A;  2WAQ N;  1Q1V A;  2L7M P;  4CYC A;  3S16 J;  1QVU A;  1MSF C;  4AUX A;  5FKN A;  2M0C A;  4ABZ A;  2LY9 A;  4XIC A;  3K2A A;  3JRA A;  2B63 J;  4A3L J;  5K7Z A;  2R0Q C;  1RET A;  3RQI A;  2JJ7 A;  5J1Y A;  2E1O A;  1MBF A;  4M3D A;  3G1O A;  3G1M A;  1YRN B;  4M3F A;  1MBH A;  2HYJ A;  3A01 B;  2MW8 A;  4IHY A;  1U78 A;  5JLW A;  2R7Z J;  1WH7 A;  4Y7N J;  4A3B J;  2MG4 A;  4B3A A;  2NVQ J;  2WB1 N;  1D5Y A;  1MBE A;  3FIS A;  4IHV A;  1FIA A;  1JKR C;  3MN2 A;  2YS9 A;  4W97 A;  4Y52 J;  5IPA A;  2ECC A;  1I50 J;  5IOY A;  2XGD A;  1LE8 A;  3G1L A;  1E3O C;  4A69 C;  5C4J J;  3MKL A;  3B6C A;  5FKK A;  3NAR A;  3JRC A;  4D5C A;  1X58 A;  2CJJ A;  2M34 A;  2ID6 A;  3GTK J;  1XS9 A;  4B4C A;  3GTP J;  4BXX J;  3M4O J;  2DMU A;  5EYR A;  5EG0 A;  5F0C A;  3GTQ J;  1VI0 A;  1X2N A;  2TCT A;  5M3M J;  1ITY A;  2E2J J;  3RZD J;  2DA1 A;  3I4M J;  1TWA J;  2L9R A;  1JT6 A;  3S2H J;  4V2G A;  3BR3 A;  3ZQG A;  5F0F A;  3SJM A;  3HGG A;  5F27 A;  2DA5 A;  5EEA A;  2ZB9 A;  1JGG A;  4DYQ A;  1ETQ A;  1MNM C;  1SAN A;  1JKP C;  1I6H J;  2H8R A;  4XRM A;  2XSD C;  2EQR A;  2HXO A;  1FJL A;  2EBI A;  4S0H B;  2M8G X;  3BTC A;  3LNQ A;  1ETW A;  3TP0 A;  3FIW A;  5GP9 A;  1QRY A;  2W48 A;  3SDG A;  4BKX A;  4FIS A;  1JUS A;  1PUF A;  3CMY A;  4D7N A;  3MVP A;  3O8H A;  1JJ6 C;  1GVD A;  3L1P A;  4MO7 A;  1AU7 A;  4BY1 J;  2VI6 A;  5DS9 A;  1A5J A;  2IAI A;  3CCY A;  3LOC A;  3HOY J;  2VPR A;  2ME6 A;  4XRS G;  1A6I A;  1ETY A;  3BG9 A;  1MBK A;  1DU6 A;  2FJ1 A;  1U8B A;  5IP7 J;  3QPS A;  5F08 A;  1GT0 C;  2HXI A;  1JUP A;  2XGC A;  1T56 A;  3OSG A;  1RPW A;  2JK3 A;  2R5Y A;  5M5W J;  3VPR A;  1IV6 A;  3ZQH A;  5FLM J;  3LSR A;  2X6O A;  4W1U A;  2COB A;  2NOG A;  1B8I B;  5JLX A;  5F04 A;  2LR8 A;  1X2M A;  3JR9 A;  5EGO A;  1P7I A;  1IDY A;  5FKM A;  3HGY A;  2CU7 A;  2HQ5 A;  4UUS B;  3JRH A;  3Q0U A;  1BL0 A;  3BR6 A;  2Y2Z A;  4UUT A;  1TWG J;  3HBL A;  4DZP A;  1U9O A;  4C3J J;  1AKH A;  2ME0 A;  5E3M A;  4JYK A;  3GTM J;  4FCY A;  2EH3 A;  3JRE A;  2XPU A;  4L5E A;  4A3M J;  3D1N I;  3HOU J;  3CDL A;  9ANT A;  2LD5 A;  5EZG A;  1WGX A;  1FTT A;  2XGE A;  1P7J A;  4XRS A;  1IGN A;  3HEF A;  3Q0V A;  3TP3 A;  3IH2 A;  3M3Y J;  3HOW J;  3E7L A;  2O9L A;  1ZKG A;  2VKV A;  2YUS A;  2QF7 A;  3BTI A;  2LP0 A;  5M3F J;  1ETO A;  1IJW C;  2CQX A;  2NVT J;  2XB0 X;  4A3D J;  2G0E A;  5BNG A;  3OIO A;  5HOD A;  1XG1 A;  3HKZ N;  3S2D J;  2HI3 A;  2K40 A;  5M5Y J;  1NK3 P;  1HLV A;  3BR2 A;  1K83 J;  1Z77 A;  2EZL A;  5J1U A;  4FE4 A;  4JP0 A;  2K9N A;  2GLO A;  1BA5 A;  3OSF A;  1GDT A;  2HOT A;  2ECB A;  4DW6 A;  1Z0X A;  1MBJ A;  2DA7 A;  2DMQ A;  5GPC A;  4BBS J;  3HDD A;  3W6V A;  5EZH A;  3HOZ J;  3UKG A;  1BW6 A;  4D7M A;  5E3N A;  2JA8 J;  3S15 J;  4IHW A;  4XK4 A;  1MSE C;  3ZOB A;  1B72 B;  4JX6 A;  1AHD P;  1JTY A;  1GV2 A;  1GV5 A;  4QIW N;  1HDD C;  1BJZ A;  2DTZ A;  2CRG A;  4BBR J;  1BW5 A;  2FD5 A;  1WI3 A;  2IEK A;  1QPI A;  1UG2 A;  1I3Q J;  5GPA A;  3JRF A;  1IDZ A;  3BQY A;  3HM5 A;  2HOA A;  2JWT A;  3S17 J;  1RR7 A;  1ENH A;  2JA6 J;  5J3L A;  1H8A C;  1FEX A;  2X48 A;  4CYC B;  2K9S A;  3IH3 A;  4AYB N;  2MSY A;  2NVX J;  4EEF G;  5EF6 A;  4I6Z A;  1JKO C;  1ETK A;  3C2B A;  3PO3 J;  1H89 C;  3LSP A;  4XID A;  3BG5 A;  3Q3S A;  3TW6 A;  3QPL A;  4BY7 J;  1RES A;  2P81 A;  2Y30 A;  3ZQI A;  2WV1 A;  2KDZ A;  2K9Q A;  4X1E A;  4LOC A;  2E19 A;  4A3F J;  3FK7 A;  2JA5 J;  3PO2 J;  2DMN A;  5IP9 J;  4GFB A;  1Y1V J;  5C44 J;  1T33 A;  1IG7 A;  4FTH A;  4C3I J;  2E2I J;  3BT9 A;  4QTR A;  3TW7 A;  4I76 A;  1JJ8 C;  5E3O A;  1YRN A;  2LLK A;  1LE8 B;  1OCT C;  3A01 A;  2YU9 J;  2H1K A;  1LFB A;  5F1J A;  4A3I J;  1FIP A;  3JRG A;  2XRL A;  4A3K J;  2OPT A;  1S7E A;  3LSG A;  4DZJ A;  2EZH A;  4HNV A;  5EG0 B;  5IOZ A;  2NVY J;  2O7O A;  1POG A;  1O4X A;  1OJL A;  2NS7 A;  5IYC J;  4MFD A;  1TWF J;  3BQZ A;  1LFU P;  4M3E A;  2O8K A;  2FQ4 A;  5C4X J;  1K61 A;  1UHS A;  1ZTR A;  3B6A A;  3Q0W A;  4IEJ A;  3HOV J;  1OCP A;  3K7A J;  3S1M J;  1ORK A;  3FK6 A;  2L7F P;  4QSH A;  5C3E J;  3BG3 A;  3SFI A;  4M3G A;  4C3H J;  1FTZ A;  4C2M J;  1U9N A;  4NDL A;  3BTL A;  3NAU A;  1PUF B;  2L7Z A;  2XPV A;  1IRZ A;  3JRD A;  3H0G J;  4X6A J;  2LKX A;  1WPK A;  2DN0 A;  4V2F A;  3GBG A;  1JTX A;  2Y31 A;  1NK2 P;  1F36 A;  1ETX A;  1Y1W J;  3BR0 A;  3O8G A;  4A3G J;  1HDP A;  1RKT A;  2M2E A;  1HOM A;  2CQQ A;  3LSJ A;  2FX0 A;  2TRT A;  3IH4 A;  2R5Z A;  1W0U A;  1CQT A;  2AO9 A;  5DTD A;  2E2H J;  2CUF A;  1ETV A;  5IP6 A;  2R5Y B;  5FKO A;  1RKW A;  4RDU A;  3ZQL A;  2LVS A;  1ZGW A;  1ZR2 A;  1XC5 A;  4MLO A;  2QCO A;  3S1Q J;  2DA2 A;  3PM1 A;  1MH4 A;  4MFE A;  2DJN A;  3A02 A;  1SFO J;  3QQA A;  2JMW A;  2XB5 A;  1OFC X;  5EGO B;  3JRI A;  1MBG A;  4J19 A;  3ZQF A;  1F43 A;  2ID3 A;  1VND A;  2HOS A;  2JN6 A;  1IC8 A;  1VF9 A;  5EDN A;  2DA4 A;  2VKE A;  2EZI A;  3F0C A;  2JA7 J;  2IBD A;  1AKH B;  1B8I A;  1APL C;  2N8G A;  1ZQ3 P;  2D5V A;  3FKI J;  5FLV A;  4G12 A;  1JT0 A;  1R9T J;  1TC3 C;  1UMQ A;  1GUU A;  1TWC J;  2LK2 A;  3GTL J;  4UUS A;  4A3E J;  2GM4 A;  2I10 A;  3S1R J;  4DYC A;  1W0T A;  3HOX J;  2X9D A;  3A03 A;  5F0H A;  1G2H A;  2DMP A;  5FJ8 J;  3S1N J;  2VUM J;  2LFB A;  3I4N J;  2M9H A;  2L0K A;  1MH3 A;  2Y9Y A;  1EF4 A;  2LTP A;  3RKQ A;  1JUM A;  3OOU A;  3CQZ J;  1NTC A;  3H3V K;  3RZO J;  1WCM J;  1QVT A;  4JX4 A;  1VFC A;  3DEW A;  2Y9Z A;  3TED A;  2R5Z B;  2PMZ N;  3GTJ J;  1IUF A;  3ZQC A;  1DU0 A;  3BR1 A;  2EZK A;  5M5X J;  3BR5 A;  4A3C J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...