1UG2A

Solution structure of mouse hypothetical gene (2610100b20rik) product homologous to myb dna-binding domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
b'GPSGSSGAGALPKASEATVCANNSKVSSTGEKVVLWTREADRVILTMCQEQGAQPHTFSVISQQLGNKTPVEVSHRFRELMQLFHTACESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2610100B20Rik gene product
molecule tags Structural genomics, unknown function
source organism Mus musculus
publication title Solution Structure of Mouse Hypothetical Gene (2610100B20Rik) Product Homologous to Myb DNA-binding Domain
rcsb
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ug2A01
4XRSG 3ZQCA 4MIMA 1ZTRA 2AO9A 2NS8A 3BQYA 4FISA 1ENHA 3LSRA 1A5JA 2X48A 4DW6A 5EG0B 5C4JJ 3GTJJ 3GBGA 2JA6J 3S1MJ 1XC5A 3SJMA 2IBDA 3JRFA 1NTCA 2HOSA 1MH4A 2R5YA 1B72A 1MBKA 4UUSB 3QPLA 3A01B 1PUFB 4A3CJ 3JR9A 5K7ZA 1Q1VA 2K9NA 3BG5A 1NK3P 4QIWN 2EZKA 1D5YA 2FQ4A 5J1UA 1IUFA 3IV5A 3JRCA 3GTQJ 1H88C 4V2GA 2HYJA 2Y9YA 2Y9ZA 2O9LA 1GT0C 5F1JA 4LOCA 1OCTC 1RETA 1ITYA 1JJ8C 3D1NI 2XPUA 2HXOA 1ETYA 2DA7A 4BKXA 2OPTA 2DA2A 2GM4A 1WGXA 1LFUP 2QF7A 5FJ8J 2K9QA 1ETXA 3S14J 3RKQA 4FE4A 5FKLA 1IDYA 3A03A 3HOZJ 1FEXA 4C3JJ 4G12A 1YRNB 1Z0XA 3CMYA 4M3BA 2K40A 2LLKA 3OSGA 3GTGJ 2DTZA 2N8GA 1H89C 3TW6A 2XGDA 3HKZN 1IG7A 2JWTA 3Q0UA 4BY1J 1TWFJ 1TWHJ 4D5FA 2HDDA 2LFBA 1B72B 3SFIA 4M3DA 5FLVA 1JTXA 2X9DA 2FJ1A 4DYCA 1MSEC 1JUSA 2CQQA 2TRTA 5DS9A 3BR0A 2DA1A 5IOZA 2EH3A 4QTRA 3BG9A 4FTHA 3S1RJ 4JX4A 1B8IB 3UKGA 3LNQA 1JUMA 3JRBA 3BR1A 4AC0A 5M5WJ 2DMQA 3B6AA 1R9TJ 2MSYA 1BA5A 1XG1A 3ZQIA 2XGEA 2R5ZB 2ME6A 2XB5A 2QCOA 4S0HB 4XRMA 3BR6A 1TWCJ 1JGGA 3IH2A 5GPAA 1F43A 3BR2A 4BY7J 3HEFA 1RESA 3HGYA 1I3QJ 3QPSA 2NVYJ 1QPIA 1MH3A 2H8RA 2LVSA 1HF0A 4GFBA 1WCMJ 4A3DJ 4A3MJ 2DMUA 1UMQA 1FTZA 5J1YA 4A3GJ 1UHSA 5F27A 2R7ZJ 2CJJA 2CUEA 2MGQA 1JKOC 4XRSA 4A69C 1F36A 1MBJA 2DA4A 2H1KA 1B8IA 4A3EJ 2LP0A 3FISA 2LTPA 3LSGA 4RBOA 3O8HA 2O7OA 1U78A 1GUUA 5IYDJ 4XK4A 2M34A 2ID3A 2Y30A 1ETQA 4HNVA 1FIAA 5IP7J 2Y31A 4MFDA 3ZOBA 4IHYA 1HDPA 2CRGA 9ANTA 4MO7A 2JJ7A 3FK6A 1ETKA 4IHWA 2XSDC 1VF9A 2YS9A 2M2EA 1IJWC 4M6VA 1GV2A 4A3LJ 2L0KA 3FIWA 2JN6A 4JX6A 2ME0A 2DJNA 2R93J 3IH3A 3BTLA 5IPAA 2XB0X 2M9HA 1ETOA 2VPRA 3PO2J 2JA8J 2GLOA 4A3KJ 3PO3J 2ECBA 1BJZA 1JUPA 4BXXJ 4RDUA 1SANA 3BQZA 4B1RA 4M3EA 3BR3A 3SDGA 1DU0A 3HBLA 4I6ZA 4D7NA 3NARA 1TC3C 2EZHA 3JRDA 2EZLA 2DMNA 3S1QJ 3JREA 3GTMJ 4BBRJ 1SFOJ 2RAEA 1MBFA 4I76A 5EG0A 3CQZJ 4EEFG 2L9RA 3HB9A 5EZGA 1LFBA 4JYKA 2IEKA 1BW6A 3JRHA 5M5XJ 3HOVJ 4A3FJ 2IAIA 3GTKJ 4L5EA 4XICA 1HCRA 5FKKA 3HOUJ 4UUSA 3A01A 5EF6A 3LSPA 1HOMA 5IYCJ 3F0CA 2M0CA 3ZQGA 4AYBN 1OCPA 3MKLA 2EZIA 2VKEA 1JKQC 3S2DJ 4CYCA 1P7IA 1U9OA 2ID6A 1ZQ3P 1JTYA 1WH7A 2HQ5A 2COBA 3B6CA 4D7MA 5K7HA 4IEJA 1IRZA 5FLMJ 1FIPA 3MN2A 1IV6A 3VPRA 3OIOA 3S16J 5JLXA 3S15J 5DTDA 4DYRA 2E2HJ 3BT9A 5IP9J 5M5YJ 1IDZA 3FK7A 1ZK8A 3A02A 2JA7J 4IHVA 4XIDA 3OSFA 1ZGWA 2B63J 1HLVA 2Y0SN 4X1EA 4M3GA 4MLOA 1RKTA 2DA5A 1X2NA 2XGCA 1IC8A 2CQXA 1G2HA 5F08A 4ABZA 2HXIA 3FKIJ 3JRGA 3HGGA 2D5VA 5EDNA 1DU6A 2E2JJ 1U8BA 1JKPC 2ZB9A 1CQTA 1IGNA 1MBGA 5C3EJ 1BL0A 5C4XJ 3M4OJ 1E3OC 3CDLA 1ZR2A 1Y1VJ 2DA6A 1O4XA 2NVQJ 2GBYA 5BNGA 3Q0WA 1QRYA 2YUSA 5C44J 3Q0VA 3ZQFA 5K7FA 1BW5A 1GVDA 5FKOA 5GP9A 3GTOJ 1AHDP 1APLC 5E3MA 5FKNA 2LK2A 4IHXA 3BG3A 3GTLJ 1QVTA 3S17J 3K2AA 1WH5A 1UG2A 1QVUA 3HOWJ 5EGOB 1S7EA 2NS7A 1TWGJ 2HI3A 4D5CA 2P81A 3RZOJ 3H0GJ 1MBEA 5J1RA 5IYBJ 5EGOA 2FX0A 1VI0A 2M8GX 4W1UA 4X6AJ 4W97A 2K9SA 2CUFA 1MNMC 3OOUA 1Y1WJ 1FTTA 4B3AA 2FD5A 1X58A 1MSFC 3BTIA 4V2FA 4C2MJ 1XS9A 5JLWA 2R0QC 1K61A 4M3FA 4Y7NJ 2X6OA 1K83J 2E1OA 5F0FA 4C3IJ 2I10A 3TW7A 4DYQA 1LE8A 3PM1A 5HODA 5F04A 2LD5A 5F0CA 3HDDA 2DMPA 2ECCA 5M3FJ 3I4MJ 3G1MA 1FJLA 1T56A 2JMWA 2WB1N 1VNDA 1GV5A 2JA5J 2R5YB 2WAQN 2KDZA 3H3VK 2W48A 5EEAA 4BBSJ 1LE8B 3M3YJ 1ETWA 1W0TA 3ZQHA 2KT0A 5E3OA 2R92J 4QSHA 2LR8A 4NDLA 3I4NJ 1VFCA 5F0HA 2L7FP 1TWAJ 1OFCX 2OF7A 2VI6A 3L1PA 3WHCA 3Q3SA 1ZR4A 1WI3A 1HDDC 5IP6A 1PUFA 3JRIA 2LKXA 1WPKA 5E3LA 4DZJA 4A93J 4A3BJ 2EBIA 3TP0A 1I6HJ 1I50J 3BTJA 1JT6A 3S2HJ 3BR5A 1U9NA 3HOYJ 1AKHA 3G1OA 1POGA 1AU7A 5IOYA 1NK2P 2L7ZA 2G0EA 3C2BA 2O8KA 1Z77A 1P7JA 3O8GA 4J19A 1MBHA 4CYCB 4JX5A 1RR7A 3RZDJ 2PMZN 4MFEA 2AHQA 1T33A 2CU7A 2DN0A 3S1NJ 1YRNA 1H8AC 1OJLA 1A6IA 3W6VA 3LSJA 2L7MP 2MG4A 3ZQLA 1EF4A 3BTCA 3G1LA 2YU9J 3CCYA 5EZHA 2E19A 2XPVA 3LOCA 2VKVA 3DEWA 5M3MJ 1W0UA 2HOAA 1ZKGA 4AUXA 2Y2ZA 4UUTA 1GDTA 1ETVA 3QQAA 2NOGA 2E2IJ 2NVTJ 2JK3A 5EYRA 2NVXJ 1ORKA 4B4CA 4FCYA 3E7LA 1X2MA 1JKRC 2EQRA 3HM5A 3WHBA 4A3IJ 3NAUA 2XRLA 2DA3A 3JRAA 2HOTA 4FE7A 2TCTA 2XPWA 5J3LA 1JT0A 3DCFA 3TP3A 2VUMJ 1JJ6C 1AKHB 4C3HJ 3GTPJ 3RQIA 4DZPA 4JP0A 2ELKA 3MVPA 3HOXJ 2WV1A 5FKMA 4Y52J 1RPWA 2R5ZA 1RKWA 5E3NA 3IH4A 2LY9A 3K7AJ 2MW8A 2DMTA 4A3JJ 5GPCA 3TEDA
chains in the Genus database with same CATH superfamily
1KGSA 3MKYB 3SZGA 3ZQCA 4OIQF 1ULYA 3H5AA 1ZTRA 2AO9A 3BQYA 3VB2A 3LSRA 1XN7A 3ZN0A 3CCLI 2IA2A 1A5JA 3R6SA 3PJRA 1DUXC 4IRGA 3CLQA 2L7KA 3A0BC 1XC5A 5IY5H 2WTEA 4U0YA 1YITI 1AOYA 1BC7C 2ZMEC 3DKXA 2AXTC 3OYMA 5D5XB 4II3A 2HWVA 1KU7A 4M72A 4D0PA 3BG5A 5K1YA 1D5YA 3JRCA 3T8TA 2WADA 1P4XA 4L18B 2K02A 3PIPF 1OCTC 1WJCA 2XDVA 3FDYA 2R7QA 5JI6A 2F4IA 1JJ8C 4M9XA 1SAXA 4A6DA 1ON1A 3OL4A 5DV5A 2DA2A 1WHUA 2GA2A 2HPMA 1SAUA 2P0WA 3O3KA 3HSRA 3K2ZA 2VQLA 3I0TA 1QO0D 1A35A 2CV2A 4BXUA 1G4DA 2VODA 1IDYA 3RKYA 2KJCA 4BJ5C 1YRNB 4DJAA 3ASNH 3ZMSA 2FMYA 3PSFA 2VIXA 1UELB 3F23A 3OSGA 3ERMA 3WTTC 3GTGJ 1RRJA 2N8GA 2QZ8A 1MJAA 1RC9A 3J81K 3CF5F 3OOPA 1B1BA 5KNLA 4BY1J 3S32A 2ICWG 2ZC2A 5DM6F 1BI2A 2XVCA 1MIJA 4M3DA 2IT0A 3QU6A 3X2QH 4HDVA 2IXSA 2FNAA 1SVMA 4ZYHA 3F6VA 4NB5A 1MSEC 2IGNA 3CCRI 2BYVE 2OU2A 2YR2A 4BQNA 5DS9A 1FP2A 2DA1A 5IOZA 4E70A 4ZH4F 3MAJA 4HG2A 4KJZA 5DD8A 5LHHA 1PUEE 4LLNA 3CTAA 3JRBA 2P6TA 4QPOA 4AC0A 5CVIA 3ABMH 2WA0A 2DXIA 4OMYA 4LIUA 5TJJA 3G73A 1R9TJ 1BC8C 2MFZA 2ME6A 3L2QA 2XB5A 4RAFA 3JAMK 4B47A 4XRMA 2VXDA 2DK5A 1TWCJ 1JGGA 4NUBA 3J7YJ 4BHCA 2NNYA 3VWBA 3HGYA 2HGCA 3MWMA 4GFBA 4C2UA 2A6EF 3CZ6A 1UMQA 3F22A 1UHSA 1ONVA 3ABLH 1G8XA 2XAQA 5FLXK 3WTXC 2VJ4A 1S9HA 1YE9A 2FU4A 1VQLI 5ILUA 1IN4A 3LA7A 4A5NA 2EV5A 2CQKA 1BR2A 4A69C 3QODA 1MBJA 4GYGA 1YYVA 3SEZA 4YRVA 3LSHA 3J80Z 4Y4RA 1B8IA 4U0VA 3CUQB 1KA8A 4RBOA 1U78A 3O8HA 1VQ5I 4G6TB 2PMZA 4XK4A 5CVUA 2ID3A 1ETQA 4E7LA 1SFXA 2A5YB 4FQGA 3CJTB 3WTWC 2IA0A 3QAHA 1W5SA 2JJ7A 5LGUA 3FHZA 2PG4A 2DYRH 1VF9A 4LG0A 3B02A 3KZIC 4A3LJ 3FIWA 2ISYA 4JX6A 2ME0A 2DJNA 1SFEA 1A31A 5BQTA 4HLYA 5IPAA 5TISC 1LEBA 2CH0A 2M9HA 3ZR8X 4ZZDA 2VPRA 4GO1A 4A3KJ 3GMEA 1JUPA 2W84A 4RDUA 1ZG3A 2FBIA 2GXGA 2HDWA 3FF5A 3BQZA 3S2WA 4YIFA 3ZCOA 5JHFA 2ZSHB 3SDGA 4I6ZA 4GYIA 4D7NA 2R4GA 3WTUC 4M6XA 4U87A 3JREA 2PX9A 3I5UA 3WU1B 3QP5A 4I99C 1SFOJ 2E71A 2ZFWA 2JZYA 2OCEA 3Q5FA 3K4CA 3LAPA 4L9TA 2W24A 3LFUA 2QENA 1IW7F 1X1PA 1Z1DA 1LQ1A 3PUBA 2ELJA 1HXDA 3H9GA 3DPTA 4A3FJ 2OTLI 3ESWB 4XICA 1HCRA 4ZYGA 5FKKA 4M9SA 3HOUJ 1G3TA 4UUSA 3A01A 1K6OA 1W36C 3LSPA 3OYAA 4K2EA 3SXYA 3DBLB 2M0CA 1OCPA 3MKLA 4HLXA 1JKQC 2O03A 1R58A 2XF6A 5D5UB 3RYPA 1LEAA 1R5ID 3DTIA 2V7FA 2ZJPF 2A6HF 3KP7A 2M8EA 5D8KB 4D7MA 5K7HA 4IEJA 2GOXB 1YLFA 4DBRA 1IRZA 2XUBA 1YIOA 2XAUA 4BUPA 3DPUA 5FROA 1OCZH 3OIOA 5D8LB 3LWFA 3S15J 5AIQA 5LGNA 2E2HJ 5IP9J 1YX3A 3HG9A 3SYTA 3ROUA 3KFWX 1RUOA 2BVMA 3CJNA 1ZK8A 2JA7J 4HAMA 2L2OA 4RB1A 3K4KA 2RQPA 1QQIA 3E6DA 5AIPA 2CV1A 4MLOA 1XGOA 1RKTA 2K86A 2KDOA 3DFGA 3LQRA 1F5TA 2CQXA 2ZXWH 3ISPA 5F08A 2RVCA 4EV0A 3JSOA 1ZREA 4Q5SF 2CW8A 1G2HA 4PJJA 3OYLA 4LJZF 2D5VA 5EDNA 3U1DA 2E2JJ 2VJ5A 4FT8A 4F55A 3V8LA 3L2UA 1USSA 3IAS2 2MBFA 4RAYA 1YHQI 4U88A 1O4XA 2NVQJ 1G3WA 2DA6A 3EPZA 1G6NA 5BNGA 4O6JA 3M8JA 3GYHX 3Q0WA 2V1XA 2YUSA 4AYBA 4GXOA 2YSRA 3ZQFA 3T8RA 1YFHA 1B6AA 3CMMA 4XBFA 2Y0MA 5FKOA 1Z91A 5LBQA 1HW5A 5L3GA 1I3AA 4CCNA 1NHAA 2ZBKA 2M3AA 3F8BA 1KYZA 4U0WA 3TO7A 5D5VB 1SMTA 3G4SI 4IHXA 3BG3A 3GTLJ 3P9IA 2DO7A 3MKZA 3P9KA 2NNNA 2EA4A 3K2AA 3EUHC 4Y17A 4FX4A 1S7EA 4RM3A 3SEQA 3ZMDA 1J09A 4WXDA 4AWXB 2XRNA 3EDPA 3DKWA 4DQ2A 4W97A 4EJWA 4F3QA 3K10A 2K9SA 4I98B 4XKWA 2CUFA 2LF8A 2G9WA 4IHTA 4AU7A 1MJBA 2NOJB 2XKPA 4V2FA 1XS9A 3L2WA 5JLWA 4B44A 1D5VA 2GWRA 2E7XA 2R0QC 2K5CA 4HDUA 1OCCH 1TBXA 4C3IJ 1Z05A 2VKDA 3TW7A 4G6QA 1T38A 5E20A 4XNFA 1LE8A 1M1EB 5F0CA 1Z6RA 3BJAA 3REOA 3DTKA 2V6CA 2H6CA 4ASNA 2OAZA 1Z3XA 2WB1N 4PJ0C 4Q48A 2JA5J 2O6GE 2EIMH 2W25A 2RV8A 3IKTA 5IT9Z 2WAQN 2KDZA 3H3VK 4NQWB 4BBSJ 4OAYA 2Y0SA 4XKCA 1TLHB 1U5TB 3PFIA 5JVGF 2VLAA 2KT0A 5E3OA 2KIQA 3QYBA 1FWZA 1MMDA 5FRMA 4NDLA 4UHTA 4C9YA 5LRRA 2H8WA 2OF7A 1RZ4A 3HRSA 1WSUA 3L1PA 2HTSA 3AAFA 2JUCA 2BHYA 2ZNZA 1HDDC 3LA3A 1PUFA 1WPKA 5E3LA 4A93J 4A3BJ 3TP0A 3LSIA 1I50J 3I58A 1JT6A 3BCAA 3E6CC 3I59A 3BR5A 1IN5A 3HOYJ 2LH9A 5A2QZ 2KIMA 4MHGA 2ACJA 2ETHA 1POGA 5IOYA 3C2BA 2KZGA 1V5FA 2L9SA 2CUJA 1MKMA 2QGUA 4JX5A 3RZDJ 1MNDA 2PMZN 4CCKA 2F5EA 3JTHA 2AHQA 2LMDA 2HPIA 1BIBA 3MD2A 2CYYA 4XN0A 4NBQA 2M5WA 4XLNF 4P9UA 3LQQA 1A6IA 3L2RA 3I64A 3CMEI 3LSJA 2L7MP 3DV8A 4YEJA 1EF4A 2RN7A 4BNCA 1O7FA 3CCYA 2Z1DA 2XPVA 1ZRFA 2VKVA 5M3MJ 3OYIA 2DYSH 1HA8A 5HOOA 1BN5A 1ETVA 4ESFA 2RC4A 2JA2A 3K1MA 4RAZA 1QPMA 3QOPA 2UWMA 4B4CA 3TDZC 3ZQQA 4CCOA 1OYYA 5B5EC 4CXFA 1CF7B 1JKRC 2L02A 1XGSA 2HZDA 2M30A 1IN6A 3I55I 2PJPA 4KUMA 3KP4A 2EFNA 2XRLA 1TQPA 4S05A 3OYKA 5D5WB 2DI3A 3SZPA 3TP3A 5HLGA 2BHZA 4BEHB 3OY9A 1AKHB 2VUMJ 3GTPJ 5IT9K 1U5TC 2PI0A 1WJBA 3HOXJ 2WV1A 1FLIA 1I1GA 1HKQA 5ICEA 4CUGA 2FOKA 4AIJA 3KETA 3IH4A 3CCSI 5CQGA 2LY9A 3HSEA 4HA8A 2JUGA 1CGPA 1ZARA 1W4MA 4C2TA 4XRSG 1Y8RB 2P7VB 3QU3A 1S3JA 2G7HA 5BS6A 2OQRA 5HDNA 2CSOA 3JSPA 3OYCA 3GBGA 5LEKA 2JA6J 4ITVA 1MMAA 2ZXJA 2IBDA 4IQJA 3A4CA 2F5CA 3E5XA 3OS2A 1MH4A 1V55H 1MBKA 3GO5A 1Q1HA 3QPLA 4UUSB 3A01B 5LFAA 1LFPA 3J7ZI 5K7ZA 1LB2A 2PMHA 1Q1VA 2CQNA 2FMLA 2XAJA 3TO9A 3LAJA 1IO2A 1QZEA 3FXJA 3F72A 4IVNA 2CW7A 3K69A 3N05A 2HQRA 3CESA 2O61A 1ZG1A 2B7EA 4V2GA 3DLLF 2O9LA 2KRHA 1RNLA 3KEYA 2Y9ZA 1GT0C 1FBUA 1ITYA 1RETA 2DAOA 2FA5A 4Y13A 5ED4A 2P5VA 2EWNA 4WXHA 2Q2EB 4S04A 3FXQA 3EETA 4BKXA 2OPTA 4XLEA 1VQNI 3ZMUA 1J0RA 1J7KA 1LFUP 1D1AA 3EUAA 5LLQA 2IP2A 1TW2A 3B73A 3RKXA 1ETXA 5GAEJ 3RKQA 3U1KA 2MH9A 2ZJRF 1XTAA 5FKLA 2E1NA 2JT1A 3PQKA 4ZC3A 3A03A 1T98A 2P6SA 2A61A 1J2XA 2LREA 2R7DA 2EFPA 3CMYA 4BJTA 3ZXSA 3SFZA 4GRIA 4E7JA 2DTZA 1UB9A 1X1CA 4IOAF 1HKSA 1R1VA 1IG7A 2E7WA 4QLCU 3OYHA 2QBYA 1TWHJ 1K78B 2LFBA 4CCJA 1EV7A 1JTXA 3WU0A 4P55A 4KT6A 3W6KB 4B43A 2ESHA 3OR2C 2O5RA 3BR0A 2EH3A 2JRMA 4FTHA 2HNHA 2VN2A 2OJED 2L4MA 4EJVA 2R7UA 3RIRA 2E1MC 1AA7A 3M1CA 5M5WJ 1J5YA 1Z21A 3RPUD 4PZJA 4RLFA 4HX4A 3F8CA 3KPHA 2FEZA 2DQLA 1FYKA 2HOEA 2VPLA 2D2WA 3BR6A 1F43A 3HUGA 3ABKH 3BR2A 5B66C 2YPRA 1RESA 4CSWA 2XF5A 5KHDA 2H8RA 3GEZA 5HDGA 5CVVA 4E7ZA 1S29A 1IRXA 1WJEA 4A3MJ 2DMUA 3EYYA 3TOAA 4LG3A 1FTZA 1D0YA 1KU3A 3RSNA 4OOIA 1HKTA 3CDHA 2X6XA 4HEA2 5F27A 2IS2A 2CUEA 1DDNA 3FKJA 1JKOC 2NRAC 4RAGA 3SHFA 2KL4A 4N4OB 5LHIA 4XRSA 3RJPA 2VE9A 2ZNYA 3KE2A 4FETA 3S8PA 3HTSB 4RB3C 1FMWA 4A3EJ 2LP0A 2KJBA 4YFXF 3TO6A 1BBYA 2VT3A 1GUUA 2NAZA 2R7FA 2M34A 3UR3C 1OYIA 1R7JA 3GLXA 5E8IA 1QZZA 4MFDA 1WJDA 1YQAA 2HQAA 2CRGA 1E0EA 4HV6A 1L0OC 3EUKL 3ZMTA 1SVLA 3FZVA 4DGWB 4EM0B 3OV8A 3SZTA 4NC8A 2R93J 3IH3A 3BTLA 1IV8A 2XB0X 4EMSA 3L2CA 2P4WA 2JSPA 2GLOA 4HPQA 1UFMA 1XGMA 5J6XA 4ZDOA 4O5VA 2V26A 2HQNA 4PDKA 2BW3A 3BCBA 3ERED 1R71A 1OCRH 1TC3C 3NARA 2EZLA 3RTRA 3LMMA 5H2FC 2CO5A 3S1QJ 2E34A 3KYCB 2ZCWA 4BBRJ 3COAC 1ZRCA 4KT5C 3K9TA 4UUVA 4QPQA 2Z5UA 3KLNA 2QQAA 1MBFA 2M87A 3N4MA 3F9KA 4EVIA 3CQZJ 4IO9F 3G71I 2L9RA 3OS1A 5FO5A 2QA4I 5J47A 1ZRDA 2A5WA 1QU3A 2IEKA 3T5XA 3CUOA 2P5KA 2QM3A 4L5EA 3W2WA 4F92B 1SD6A 2EB7A 2HYFA 4EGYA 1U0JA 1FMVA 2DFIA 1HOMA 4RB0A 4CGZA 2Q8KA 3F0CA 2E60A 4LFUA 1I5ZA 1S5LC 4ON0A 1Y0UA 1WH7A 2HQ5A 1OMIA 1U5TA 2COBA 3B6CA 4N4NB 1R5HA 2ZJ2A 3K4MA 3DTEA 1FIPA 1EH7A 5FLMJ 1IV6A 4II2A 2E5NA 1IXRC 2YX7A 3VYRB 1I6XA 4LGWA 2M7AA 1E17A 2L01A 2KP6A 3BT9A 4RGSA 3E6BA 1YW7A 1HBXG 2XGXA 2B0LA 1P6RA 2F2EA 1WFXA 2VBWA 1VQ4I 3RPQA 4B3XA 1FSHA 1R4MB 1Y0NA 4JBAA 4IHVA 4XIDA 1ZGWA 4UVCA 3K70D 1HLVA 1U2WA 2XSJC 1FYLA 2KKOA 4AVPA 2OBPA 2VC1A 2VQHA 4HSTA 3V4GA 3K4NA 4HX8A 3W2AA 2WV0A 3WE3A 3HOTA 1X2NA 2XGCA 2HDCA 1GHCA 5LEJA 4ABZA 3BPVA 2Z16A 3K1NA 3HGGA 4A12A 3IKVA 5CJ9A 4ENMA 1O3RA 2EJRA 5HNHA 2L54A 3F8FA 1CQTA 1IGNA 2GA1A 2V79A 1P9QC 5JR3A 1E3HA 2A68F 2VASA 3HUGB 3M4OJ 1ZR2A 3GXOA 4KMUX 2MC4A 5HS7A 1JHFA 1QRYA 5C44J 1X4OA 2QQ8A 1XMXA 3LSKA 1SEUA 3BZCA 5K7FA 4ZDPA 3A0HC 3WTYC 4V19K 1GVDA 2K9MA 5LGTA 5GP9A 3BDDA 3MZHA 4PJMA 2NS0A 1APLC 5E3MA 4AIDA 1WJAA 3DEUA 2BOLA 2QSFX 5CPRB 2V1NA 1EKEA 3OYJA 4XORA 2DODA 1KONA 2LK2A 4KIFA 3J81Z 4KFCA 3WE2A 1WH5A 1UG2A 1QNTA 3R60A 2PFBA 3HOWJ 4BQQA 5EGOB 1MDMA 2NS7A 1TWGJ 2CG4A 2HI3A 2LDUA 4D5CA 1D8JA 2P81A 1STZA 2IGOA 3H9QA 3RZOJ 4NQWA 4RMNA 1VI0A 2CW0F 2Z99A 4JQFA 5JVTA 3VODA 2LY2A 2JPBA 2LKSA 5DM7F 1MNMC 4XMYA 1XX5A 1UJ8A 1Y1WJ 4B3AA 3DBHB 3HJEA 1IZ1A 3GWZA 4PUSA 1K61A 5D6EA 1YJNI 2F5VA 1K83J 4M71A 4D9JA 4GDFA 2RNGA 4ZYEA 3BZ6A 4XKBA 2EV0A 4E4HA 2JVGA 2M0MA 2Y69H 3BPXA 1T08B 3KYDB 3QWLA 4KISA 2IVMA 3K0LA 2B9SA 3G1MA 1T56A 1R1TA 3FX3A 4YIIA 1VNDA 5TGTA 2R5YB 1LVAA 1LE8B 2GQQA 2ZFUA 3CMAI 2H94A 3D0SA 4E7KA 2X1DA 3FXRA 3H3UA 4XSZF 2R92J 4QSHA 3I4NJ 2BW3B 3EUHA 4XLHA 5F0HA 2L7FP 1OFCX 2VI6A 2FNPA 4UV8A 5D6FA 1K7AA 3H36A 1ZR4A 4CCLA 3IRQA 3JRIA 1QHGA 4L5JA 3V7RA 3V8KA 2LBFA 3BTJA 2CS3A 3S2HJ 2VC0A 2ZJQF 4BEHA 3BG7A 4KA4A 1AKHA 1Z7UA 3FM5A 3QP6A 2CFXA 4LK1F 3D5LA 2WAEA 2WY8Q 3OYNA 1O7LA 2G0EA 2L7ZA 5BPDA 1UHMA 2VONA 4J01A 3O8GA 4UVAA 3QRFF 1MBHA 4L0YB 1WVRA 5E1ZB 4KIBA 5KVRA 4RLQA 4WWCA 4MFEA 1T33A 4PJNA 3IP4B 1N77A 2JSCA 1OJLA 2IPQX 3ZRGA 3JCUC 5FFXA 3ZQLA 1PP8F 1Z67A 3P7NA 3G1LA 2V6EA 3CP2A 2YU9J 2W57A 2COMA 3DQVC 1YIJI 2E19A 1W0UA 3DEWA 5J4YA 2QQ9A 2K3FA 4AUXA 1SMYF 1XGNA 2Y2ZA 4XM3A 2PLYA 1USTA 3ECOA 1OYWA 2E2IJ 4WCGA 4LMYA 1HSJA 5ICFA 2M4GA 2ZSIB 1YTYA 4PCQA 1KQ8A 3HM5A 5E8GA 1IRFA 4KICA 4A3IJ 2HEOA 4RB2C 3R0JA 1XDUA 4OMZA 3DBRB 4UV9A 5E17F 2HU9A 2IW5A 3CCJI 2AQEA 2EIKH 1F9NA 3RDIA 2Q0OA 1JT0A 2MABA 1XSDA 4G8XA 3FBIB 5E79C 4C30A 5K5OA 1JJ6C 1BI0A 3JAMZ 4DZPA 2CGPA 3BROA 3K4LA 3MVPA 1KZHA 4Y52J 1RPWA 4A0YA 2DPUA 1RKWA 4U7BA 1EH6A 5E3NA 3K7AJ 4BU2A 2MW8A 2DMTA 1MMSA 3W6JB 4A3JJ 5GPCA 4BACA 5DD4A 4BYYA 2NS8A 2EA2A 4ESJA 4FISA 2A69F 3KZZA 2KMUA 2E36A 2Z3YA 2EINH 2X48A 1V3FA 1SD5A 3C2HA 3HRMA 4A5MA 4H4KC 5E18F 4UVBA 3N97A 1L3LA 2X1EA 5KCMA 3VFZA 3SJMA 3JRFA 1NTCA 2LF7A 2HOSA 2R5YA 1B72A 2HVRA 3J80K 3JR9A 2O0YA 2Y75A 1RIOH 2VOPA 2OUMA 1YI2I 1O3QA 3IC7A 1X3WB 3WGGA 4BL0B 4EM1A 5ICCA 4G9YA 3OYEA 1FOXA 2K9LA 1YJ9I 3IV5A 4PSXA 2K4BA 2ELHA 2Y9YA 1UZCA 4B09A 4F7ZA 1OQYA 3BY6A 2XPUA 3E0JB 2W82A 1XPXA 2BY1A 2HXOA 2RREA 4KDPA 3LL7A 3M8FA 3AFHA 1WGXA 3W2VA 5CKTA 2HZTA 3H92A 4MNUA 2KZVA 4A2UA 3CO6C 1IRGA 1DPUA 5FJ8J 1LDJA 2K9QA 1WWXA 4FE4A 3H0DA 2HVSA 2E1CA 1MMNA 4ZTFA 1FZPB 3HOZJ 1Z3YA 1FOKA 1ZH5A 3O6BB 1TT0A 1SD7A 1Z0XA 4EGZA 4M3BA 2LLKA 1FX7A 2X6YA 1G3YA 4ZTJA 2P7CB 4M73A 3WG7H 3L00A 2QVOA 2XGDA 3HKZN 3C1DA 3ULQB 4LB6B 4ENNA 3Q0UA 3GF2A 4D5FA 4JK1X 1B72B 3GX4X 4MGRA 2CUZA 3SFIA 1FSEA 2WAQA 2GIVA 3K4BA 2EILH 3CUQC 1VQPI 2UXNA 2X9DA 2FJ1A 2LNBA 3DU5A 4DYCA 4PFPA 2FF4A 2CQQA 5GAGJ 3K70C 3GZ5A 5HS8A 4LD5A 4R79A 2H1LA 1KU2A 4G6DA 4BQOA 2ZMEA 2M45A 4QTRA 3BG9A 3S1RJ 4JX4A 1T95A 1B8IB 3UKGA 1JUMA 3RQ4A 3WU2C 2BE5F 3RPUA 2JTVA 4UXNA 4UY8I 3BR1A 4MTDA 5EJCA 1FOWA 3WGHA 2DMQA 3B6AA 4GGGA 1BA5A 2MSYA 1XG1A 2XGEA 2GIZA 3FXLA 5DCMA 1W7PA 1ON2A 3IH2A 5GPAA 3DXJF 3GFIA 3RI4A 3LSTA 1PP7U 4RS8A 2DU9A 3HEFA 3QPSA 2NVYJ 1WKMA 3FWEA 4KNYA 2LVSA 3CC2I 1HF0A 1LDKB 5E1WA 1WCMJ 4A3DJ 3PNVA 1OLTA 2V9KA 1FT9A 2CJJA 2MGQA 2RKHA 2DQRA 3CDIA 5GADJ 4L5IA 1PYVA 3IRRA 2OC6A 3VEPA 1VQ7I 2I5UA 3DU6A 3H1CA 1FBQA 5CVJA 2XIGA 5GAHJ 2IS1A 3CO7C 2DA4A 2H1KA 2YX4A 3NRVA 4A6EA 4ENKA 2GOMA 2EFQA 3FISA 3TDUC 1BIAA 1W7PB 2O7OA 1OR7A 2KIFA 3E5UA 3HRUA 2KQRA 4RM2A 3BLYA 4CZZA 2VL8A 1TNTA 1FIAA 5F1RA 2Y31A 4I0AA 3ZOBA 2CV0A 1R4NB 1MDMB 1VQMI 1Y8QB 1P4AA 2DOAA 2UXXA 9ANTA 1YJWI 1D1CA 1V4RA 2AS5F 4BHPA 3FK6A 2UZKA 2VOOA 5FRNA 4U7DA 1IJWC 2YS9A 2M2EA 5FGMA 5FD6A 3BOQA 1GV2A 1I39A 3DP7A 5KAIC 2L0KA 3NWTA 1R49A 1HW2A 5L3CA 1PDNC 3M7GA 1C0WA 3QPTA 4LITA 4RA2A 2FRHA 2JA8J 2R7XA 3PO3J 2ECBA 2DFFA 4LK0F 2BXZA 3HOSA 4BXXJ 3PNTA 3KYLA 5ERIA 4B1RA 3OMYA 3BR3A 1DU0A 2EK5A 3HBLA 1JXSA 4YFNF 3C3WA 2X4HA 1YX5A 2EZHA 3CF2A 2LRDA 1IF1A 4UNOA 4IHSA 4P5OA 1TNSA 4BH9A 3GTMJ 2Z33A 3GFJA 2RAEA 4BXFA 5ICGA 5HS9A 3W3CA 2FUG2 4NC7A 1REPC 4WK8F 4LLGF 4I76A 3M07A 4EEFG 2KHMA 1YS7A 3HB9A 3TQNA 1LFBA 1T6SA 4EJTA 4Q47A 3VDXA 2HYGD 4XLPF 3JRHA 2IAIA 3GTKJ 2KFDA 3ZMVA 1TZLA 5B1BH 4EATA 4CHUA 2E35A 1HW1A 2ZO4A 4GCVA 4OINF 5GTHC 5IYCJ 3ZQGA 2EZIA 4BE2A 3S2DJ 4R8HA 3P5JA 4CYCA 3OYFA 1P7IA 1WJFA 1U9OA 2ID6A 1DP3A 2QQBA 1JTYA 5H6QA 3KEOA 2XAFA 1WZ2A 2OCCH 2ZMEB 4HZFA 4ZYAA 4ETSA 3MN2A 4IF4A 3KP3A 4IKFA 3DEEA 3VPRA 3S16J 4YELA 4PK4A 3CP8A 2LBFB 5DTDA 1N78A 3HIFA 2O3FA 3OIQA 3RCOA 1S72I 2BV6A 2EFOA 2IJLA 2PMUA 1U6GA 4BAYA 1IDZA 3FK7A 2VBXA 2GZWA 3OR1C 4KITB 1UG0A 3OSFA 3PSIA 3CJRB 1R00A 2M4KA 1D0ZA 1MW7A 3HKZA 1SVOA 2O8XA 4ANJA 2Y0SN 5CLSA 3M9AA 4N9IA 5FD5A 2UV1A 3FMSA 1LJ9A 2DA5A 1MMGA 4ZJZA 4KIGA 2LSOA 1PJRA 2WC2A 4FHTA 2HXIA 3FXKA 1LVKA 1R1UA 4HSRA 2A6TA 4QWQA 2QEXI 4AIKA 1K4TA 2STWA 2WY7Q 1U8BA 3GLLA 1ZLJA 2ZB9A 3PIOF 1W5TA 1NG7A 3MZYA 1BR1A 5C3EJ 1PUFB 4RGXA 3M1EA 3AG3H 3KP2A 3DKYA 4BJ6C 2R7WA 3HRTA 1Y1VJ 2GBYA 4YIRX 4EJUA 4PJLA 1VTNC 2OQGA 3ASOH 1RR8C 3V7SA 1OPCA 1FYMA 3RYRA 2F48A 4WF2A 2FSWA 5FKNA 2IRFG 1UHWA 4ZZLA 1QVTA 3KX2A 1QVUA 3FHNA 3IHUA 1K6YA 2FE3A 3CLOA 4B48A 4F52A 5LHGA 4BGDA 1R23A 5CVRA 2MD5A 3GW2A 1KU9A 5IT3A 1JHHA 4Y15A 1MBEA 5J1RA 2K7LA 2QSHX 5IYBJ 5EGOA 2FX0A 4W1UA 4TV7A 2P8TA 3QYEA 1XSXA 4IRHA 2HTJA 1T0FA 4BQAA 1X1AA 2RQQA 1MSFC 3HYIA 3CCQI 1ZG5A 3FXMA 2IGKA 4M3FA 4XRFA 2X6OA 2E1OA 3HTUA 3ECHA 4XSXF 3SDBA 3E6MA 4MEYF 4DYQA 1PVEA 5HODA 2R7VA 4H0EA 3HDDA 1GLNA 1F1ZA 2FOWA 4WXCA 2DMPA 3VSLA 2ECCA 3CD6I 5K5QA 5BMZA 3I4MJ 3AG1H 2YU3A 2JMWA 3BJOA 2XF7A 4LB5A 1GV5A 2BY3A 5FLXZ 2W48A 4D1QA 5HLIA 5EEAA 2VBYA 3F8MA 3E5QA 3A2KA 1ETWA 1VQ9I 3BC8A 1A04A 1W0TA 3ZQHA 3CCUI 4XL9A 4P1WA 2VQGA 3WTVC 1MNEA 1XMAA 2LR8A 2JPCA 4E7SA 2BY0A 4X0GA 2W1OA 3GFMA 2FBHA 2F4OB 1TWAJ 2OTJI 2VT2A 3ABTA 2X1CA 4CA0A 3WHCA 1G3SA 3VYSB 3Q3SA 3CC7I 3U21A 2X51A 3GCMA 1I27A 3QYFA 1W5CC 4DZJA 1VQKI 1I6HJ 1I1SA 1A36A 1FC3A 4OIRF 4YG2F 3OIPA 4BE1A 2F4MB 2X0LA 3MCZA 1B9NA 2NVUB 2QBYB 1WQ2A 2CMPA 2MH2A 2Q1ZB 1XD7A 2XROA 1O57A 2FBKA 2MC3A 1Z77A 2R7SA 2VB6A 1P7JA 2DDBA 2HKXA 4J19A 2H09A 4CYCB 2BY2A 3H35A 4IOCF 3I54A 4IZZA 5DCMB 1TP4A 4OU0A 2DN0A 3S1NJ 2CU7A 3LSMA 1YRNA 1H8AC 1JE8A 1QGPA 1T8IA 2CWEA 5BOXA 3S3NA 3L9FA 1FBSA 2G7UA 2XASA 3BTCA 4OIOF 5EZHA 2ADUA 1GVJA 3LOCA 4HRIA 5EEGA 1P2FA 2C6YA 3HC7A 1ZKGA 2DK8A 2QSGX 3DF8A 4UUTA 1YOVB 4FASD 1K79A 2NYXA 3QQAA 2NVTJ 2VQCA 2V4JC 2PQ8A 2NVXJ 1ZAOA 2X85A 1H9TA 1IXSB 2EQRA 4WX9A 1X3ZB 3V8JA 3ZN1A 3OL3A 4KMFA 3DPLC 1W7PD 3E97A 4OIPF 4HF1A 2HOTA 3MKWB 2TCTA 3UNGC 2ZKZA 2EFWA 5F64A 3DCFA 2PJRA 1NG6A 3L09A 4C3HJ 2XAGA 3I71A 2DT7B 2V1UA 4JP0A 2ELKA 2ZXHA 3FM3A 5F6FA 5FKMA 1MGTA 2H6BA 2OZ6A 4HV5A 4HF2A 4BDYA 3ML6A 1J75A 4G7HF 3VSKA 3DLAA 3S3OA 3GUDA 3TEDA 1EJ9A 1TW3A 4MIMA 3ZMZA 3J7AO 1ENHA 3KCCA 4DW6A 3LFKA 2NXNB 2LOOA 3IAM2 5EG0B 5C4JJ 2QLZA 5EEHA 3WTZA 3GTJJ 3K6GA 3IWFA 3HHHA 2RNJA 5CYVA 3S1MJ 3Q9SA 2XC7A 2WBMA 3AG2H 2DOFA 2KRCA 3KP5A 1ZHFA 2JVHA 3OYGA 4A3CJ 1DGRM 2OV7A 1J59A 3FMQA 2K9NA 3C7JA 1FOYA 5L3FA 1NK3P 1YS6A 1LNWA 4QIWN 3HXLA 2EZKA 3O2PE 2FQ4A 3BG6A 1IUFA 5J1UA 1YW9A 3GTQJ 1Y6IA 3S93A 4I0BA 1H88C 1GXQA 2LKPA 2DTRA 4PSWA 1Z7LA 2HYJA 3TMOA 4Z6YA 5D4RA 4XR6A 4N0BA 4LOCA 2DT5A 5F1JA 1BI1A 2DDAA 3MMYB 3D1NI 3Q9VA 1ETYA 2DA7A 5L3DA 1YO5C 2LC2A 1EH8A 3QOEA 4IQ4A 2GM4A 3KIOA 3F21A 4MEXF 4EM2A 4KYWA 3KLOA 2QF7A 4B8XA 4OAZA 3S14J 2V1DA 4NC6A 5J8FA 1O3TA 1LPQA 1JGSA 3NQOA 3L2VA 2QKMB 4RGUA 3R0AA 1FEXA 4C3JJ 4G12A 2RGVA 3BWGA 2K40A 2EPFA 2W4SA 4HX7A 3NWSA 4AIHA 1H89C 1BR4A 1E2XA 3TW6A 1YG2A 1NH3A 1B9MA 2JWTA 3CCVI 3QPHA 4DBQA 3AL0B 1B4AA 1TWFJ 5E1XA 2HDDA 2BBYA 2RDPA 1GXPA 5FLVA 4ZYDA 3F3XA 4IRIA 1QHHD 1JUSA 2FXAA 3AKZA 3I9V2 1U3EM 2TRTA 2HVQA 1K78A 3HPHA 3NEUA 5J4VA 4L9JA 3J7AY 1XCVA 2J5PA 2HS5A 2VJJA 2KRFA 3LNQA 3M8EA 2DFHA 3C18A 2F6CA 1AWCA 2A3SA 5HVQC 1DGWY 2DBBA 4HF0A 3ZQIA 2BGCA 4ENJA 2R5ZB 4G7ZF 2QCOA 5DCFA 4S0HB 5LRSA 2OZUA 1FP1D 4Y3OA 4CCMA 3I56I 4BY7J 2CQ7A 1QPIA 1I3QJ 4CZCA 1MH3A 2LY1A 1DQUA 2HKOA 2L3DA 3IWZA 4CDGA 4HW0A 2L9NA 4E7IA 2HR3A 3KZYA 2Z9OA 2H27A 2BEOA 5J1YA 4A3GJ 1S7OA 2Q2EA 2R7ZJ 2KIUA 3FMRA 2DOEA 3MEXA 3K1PA 2WWYA 4XKVA 5L3BA 4CH7A 2IGMA 1OKRA 1UAAA 1K4SA 3CUQA 1F36A 3HPGA 4Z2YA 2PJRB 2FQ3A 3IL2A 2GXAA 5ILSA 1LKXA 2LTPA 3LSGA 5IYDJ 4J00A 4Q4ZF 2P5LC 4KN7X 5HDKA 2Y30A 4HNVA 4F91B 5IP7J 2AQFA 4A0XA 4IHYA 1HDPA 1BI3A 1XDSA 2QWWA 4MO7A 3L7WA 2IS4A 2E1MB 1ETKA 3PQJA 4IHWA 4XLAA 4MTEA 2XSDC 3JTGA 3HZJA 2WB1A 4M6VA 2XV4S 3H5RA 3HSFA 5ILVA 1T2KA 4CO8A 2JN6A 4UB8C 4G7OF 1XMKA 3PUFA 1R5GA 5D4SA 3MZ8A 4A0ZA 1ETOA 2TDXA 1SD4A 2D1HA 3PO2J 2KISA 3LA2A 1BJZA 2WAFA 1MJ9A 2PBIA 5B1AH 1SANA 2ISZA 2K85A 3A1YA 4M3EA 1YW8A 2OA4A 4IJAA 5L3EA 1VQOI 2R7RA 2DFEA 1R36A 4HQEA 3GZ6A 3U2RA 3JRDA 1S8NA 3KEQA 2A07F 4I2OA 3HL2A 2DMNA 3CCMI 4PGHA 1BM9A 1FY7A 1D0XA 1ZLKA 2R7OA 2I8DA 4IPAA 3RKWA 2GXBA 3OYDA 1XCBA 3H9JA 5EG0A 5FB2A 2ZXIA 5B3SH 5EZGA 4DOZA 2OD5A 2IA1A 2ESNA 3F8NA 4JYKA 4R1HA 4YFKF 1BW6A 4O3MA 3WG9A 4XQFA 5M5XJ 5HLHA 4BE0A 3HOVJ 3VOEA 4IXAA 2KPMA 1VQ8I 5A2QK 5EF6A 1Y39A 1WJ5A 2X6WA 2JRTA 5J8CA 2GAUA 2STTA 1LDDA 3D5SC 2E5ZA 4AYBN 1BOAA 1E3PA 2VKEA 4LIVA 1F4KA 1DPRA 1R6RA 1P92A 4MQ9F 1ZQ3P 4Y33A 3TKYA 1SFUA 1W1WE 5DDGA 3OS0A 1J9IA 4M6YA 2DJIA 5JLXA 1T0FC 2DW4A 1KYWA 2QYOA 4DYRA 5M5YJ 4G94A 2PN6A 3DWLE 4HNTA 1D1BA 3A02A 3PFYA 5FFZA 3WODF 3U9GA 2B63J 2BVLA 3PL8A 4I01A 4P9FA 3OYBA 4X1EA 3G2BA 4PGGA 4M3GA 4BDZA 2J5OA 4E6KG 1QA6A 4HQMA 3E3VA 1ACIA 1IC8A 2W85A 3EQLF 2Z2SB 4ZDLA 3CC4I 2L9VA 3JRGA 3FKIJ 4L9VA 3K4JA 4KN4X 1DU6A 1D3YA 3S3MA 3ELKA 1TL8A 5DUIA 3V42A 1JKPC 2QKLB 4I02A 1TQIA 5GTIC 1S6LA 4CYDA 1MBGA 3JW4A 3GFLA 4NHJA 4EQQA 1BL0A 5C4XJ 1BOBA 1TT5B 1E3OC 3CDLA 4EJOA 4L9NA 3FXOA 1MD0A 5LD2C 3F6OA 1WRJA 2XHKA 1Y56A 3R4KA 1LUJB 4HYEA 2BZTA 3Q0VA 4E7HA 5H20A 4FX0A 2W7NA 2A05A 4NNJA 1BW5A 2JQ7A 3GTOJ 4IX7A 2MYSA 1AHDP 3C2GA 5JHUA 3H5NA 5TRDA 3P9CA 4DIQA 1G59A 6PAXA 3T0YA 3S17J 1QBJA 2F5FA 3AG4H 4LLLA 3TL4X 1N25A 4XLFA 2R7TA 1OCOH 2D1VA 5JFRA 2BXYA 1CF7A 4HNUA 3H0GJ 3R61A 5KK1A 3FXUA 1S7AA 2M8GX 1IAWA 4BS9A 4L0ZB 2VKHA 4X6AJ 4I09A 3OOUA 3V7CA 1FTTA 2FD5A 1X58A 5AONA 2AXLA 4JOMA 1R22A 4IL6C 3BTIA 4C2MJ 1O3SA 3I59B 2R3SA 5DYMA 1U8RA 4Y7NJ 5F0FA 1X19A 2F5DA 2I10A 4RGRA 3PM1A 3E1SA 5F04A 5K5RA 2LD5A 1RI7A 1ZYRF 1X4PA 2HFHA 4MQVA 1IN7A 1HSTA 4ESBA 5M3FJ 4AVZA 3FBNB 4BHBA 1FJLA 3D5RC 2CFOA 3ONQA 3ZPLA 3CJQB 3I4PA 4AD9A 1OISA 2MA3A 1KQ0A 1OR7C 3GVAA 5H6RA 4OWRB 3M3YJ 3SQNA 1BJAA 2VJIA 3VYTB 2MLGA 2V9PA 4P96A 3HHGA 1ZGAA 1DP7P 3OWTA 5KAFC 2KLOA 2D45A 1VFCA 2Y48A 2L5QA 1IXCA 2VE8A 2VXZA 1HQCA 3MFKA 1WI3A 1XSVA 4M74A 1W36D 5IP6A 3ZGKA 1MZBA 2LKXA 1H0MA 2K27A 2EBIA 5CQEA 1T39A 3G3ZA 2LG4A 3VYUB 3WTSC 2MLKA 3G6EI 3ZP5A 2IS6A 1U9NA 4HOBA 1V54H 1ODDA 2L4AA 2M7BA 4UB6C 4HBLA 3G1OA 1KQ9A 1AU7A 4LG0B 4PFOA 2K4JA 1NK2P 1V5GA 2O8KA 3CCEI 1TTYA 2DPDA 1VZ0A 2DCEA 2M1BA 4F93B 1FNNA 3WGIA 2EV6A 1RR7A 3ABUA 3BJ6A 3I53A 1WI9A 1ZGJA 1V5EA 2LYCA 4XONA 1VQ6I 4XOTA 1N75A 2V9VA 2EIJH 4XN3A 2PEXA 3W6VA 2MG4A 1FPQA 4XLCA 1RUNA 1EA3A 1QZYA 1SFKA 1ZELA 5DUKA 3KP6A 1UCRA 4AM3A 1ERDA 4XOPA 2HOAA 1P4WA 5J40A 1HC8A 1Z6TA 1GDTA 1D8KA 3TOBA 2NOGA 5HNFA 2DT6A 2JK3A 3T1BA 3BP8A 5EYRA 1H9GA 1ORKA 2DLLA 3I3LA 3EYIA 4FCYA 2K3PA 3IUOA 1X3UA 3E7LA 5DEQA 1X2MA 4DNCA 2UUZA 3WHBA 3NAUA 3TGNA 1TQMA 1A6QA 3AL0C 1XB4A 1ZN2A 3GZNB 2DA3A 3H3ZA 5BPIA 2XAHA 3JRAA 4FE7A 5J3LA 2XPWA 5HLTA 1JI8A 4M9ZA 4N9HA 2VBZA 3RQIA 3TBIA 3BZKA 1Z9CA 1IN8A 2W00A 3PNYA 4CICA 1X1DA 4I7HA 1X1BA 3MQ0A 2R5ZA 3ZQ7A 2QUFA 1IUYA 2MD0A 2XKOA 1SC7A 1B59A
chains in the Genus database with same CATH topology
4XRSG 3ZQCA 4MIMA 1ZTRA 2AO9A 2NS8A 3BQYA 4FISA 1ENHA 3LSRA 1A5JA 2X48A 4DW6A 5EG0B 5C4JJ 3GTJJ 3GBGA 2JA6J 3S1MJ 1XC5A 3SJMA 2IBDA 3JRFA 1NTCA 2HOSA 1MH4A 2R5YA 1B72A 1MBKA 4UUSB 3QPLA 3A01B 1PUFB 4A3CJ 3JR9A 5K7ZA 1Q1VA 2K9NA 3BG5A 1NK3P 4QIWN 2EZKA 1D5YA 2FQ4A 5J1UA 1IUFA 3IV5A 3JRCA 3GTQJ 1H88C 4V2GA 2HYJA 2Y9YA 2Y9ZA 2O9LA 1GT0C 5F1JA 4LOCA 1OCTC 1RETA 1ITYA 1JJ8C 3D1NI 2XPUA 2HXOA 1ETYA 2DA7A 4BKXA 2OPTA 2DA2A 2GM4A 1WGXA 1LFUP 2QF7A 5FJ8J 2K9QA 1ETXA 3S14J 3RKQA 4FE4A 5FKLA 1IDYA 3A03A 3HOZJ 1FEXA 4C3JJ 4G12A 1YRNB 1Z0XA 3CMYA 4M3BA 2K40A 2LLKA 3OSGA 3GTGJ 2DTZA 2N8GA 1H89C 3TW6A 2XGDA 3HKZN 1IG7A 2JWTA 3Q0UA 4BY1J 1TWFJ 1TWHJ 4D5FA 2HDDA 2LFBA 1B72B 3SFIA 4M3DA 5FLVA 1JTXA 2X9DA 2FJ1A 4DYCA 1MSEC 1JUSA 2CQQA 2TRTA 5DS9A 3BR0A 2DA1A 5IOZA 2EH3A 4QTRA 3BG9A 4FTHA 3S1RJ 4JX4A 1B8IB 3UKGA 3LNQA 1JUMA 3JRBA 3BR1A 4AC0A 5M5WJ 2DMQA 3B6AA 1R9TJ 2MSYA 1BA5A 1XG1A 3ZQIA 2XGEA 2R5ZB 2ME6A 2XB5A 2QCOA 4S0HB 4XRMA 3BR6A 1TWCJ 1JGGA 3IH2A 5GPAA 1F43A 3BR2A 4BY7J 3HEFA 1RESA 3HGYA 1I3QJ 3QPSA 2NVYJ 1QPIA 1MH3A 2H8RA 2LVSA 1HF0A 4GFBA 1WCMJ 4A3DJ 4A3MJ 2DMUA 1UMQA 1FTZA 5J1YA 4A3GJ 1UHSA 5F27A 2R7ZJ 2CJJA 2CUEA 2MGQA 1JKOC 4XRSA 4A69C 1F36A 1MBJA 2DA4A 2H1KA 1B8IA 4A3EJ 2LP0A 3FISA 2LTPA 3LSGA 4RBOA 3O8HA 2O7OA 1U78A 1GUUA 5IYDJ 4XK4A 2M34A 2ID3A 2Y30A 1ETQA 4HNVA 1FIAA 5IP7J 2Y31A 4MFDA 3ZOBA 4IHYA 1HDPA 2CRGA 9ANTA 4MO7A 2JJ7A 3FK6A 1ETKA 4IHWA 2XSDC 1VF9A 2YS9A 2M2EA 1IJWC 4M6VA 1GV2A 4A3LJ 2L0KA 3FIWA 2JN6A 4JX6A 2ME0A 2DJNA 2R93J 3IH3A 3BTLA 5IPAA 2XB0X 2M9HA 1ETOA 2VPRA 3PO2J 2JA8J 2GLOA 4A3KJ 3PO3J 2ECBA 1BJZA 1JUPA 4BXXJ 4RDUA 1SANA 3BQZA 4B1RA 4M3EA 3BR3A 3SDGA 1DU0A 3HBLA 4I6ZA 4D7NA 3NARA 1TC3C 2EZHA 3JRDA 2EZLA 2DMNA 3S1QJ 3JREA 3GTMJ 4BBRJ 1SFOJ 2RAEA 1MBFA 4I76A 5EG0A 3CQZJ 4EEFG 2L9RA 3HB9A 5EZGA 1LFBA 4JYKA 2IEKA 1BW6A 3JRHA 5M5XJ 3HOVJ 4A3FJ 2IAIA 3GTKJ 4L5EA 4XICA 1HCRA 5FKKA 3HOUJ 4UUSA 3A01A 5EF6A 3LSPA 1HOMA 5IYCJ 3F0CA 2M0CA 3ZQGA 4AYBN 1OCPA 3MKLA 2EZIA 2VKEA 1JKQC 3S2DJ 4CYCA 1P7IA 1U9OA 2ID6A 1ZQ3P 1JTYA 1WH7A 2HQ5A 2COBA 3B6CA 4D7MA 5K7HA 4IEJA 1IRZA 5FLMJ 1FIPA 3MN2A 1IV6A 3VPRA 3OIOA 3S16J 5JLXA 3S15J 5DTDA 4DYRA 2E2HJ 3BT9A 5IP9J 5M5YJ 1IDZA 3FK7A 1ZK8A 3A02A 2JA7J 4IHVA 4XIDA 3OSFA 1ZGWA 2B63J 1HLVA 2Y0SN 4X1EA 4M3GA 4MLOA 1RKTA 2DA5A 1X2NA 2XGCA 1IC8A 2CQXA 1G2HA 5F08A 4ABZA 2HXIA 3FKIJ 3JRGA 3HGGA 2D5VA 5EDNA 1DU6A 2E2JJ 1U8BA 1JKPC 2ZB9A 1CQTA 1IGNA 1MBGA 5C3EJ 1BL0A 5C4XJ 3M4OJ 1E3OC 3CDLA 1ZR2A 1Y1VJ 2DA6A 1O4XA 2NVQJ 2GBYA 5BNGA 3Q0WA 1QRYA 2YUSA 5C44J 3Q0VA 3ZQFA 5K7FA 1BW5A 1GVDA 5FKOA 5GP9A 3GTOJ 1AHDP 1APLC 5E3MA 5FKNA 2LK2A 4IHXA 3BG3A 3GTLJ 1QVTA 3S17J 3K2AA 1WH5A 1UG2A 1QVUA 3HOWJ 5EGOB 1S7EA 2NS7A 1TWGJ 2HI3A 4D5CA 2P81A 3RZOJ 3H0GJ 1MBEA 5J1RA 5IYBJ 5EGOA 2FX0A 1VI0A 2M8GX 4W1UA 4X6AJ 4W97A 2K9SA 2CUFA 1MNMC 3OOUA 1Y1WJ 1FTTA 4B3AA 2FD5A 1X58A 1MSFC 3BTIA 4V2FA 4C2MJ 1XS9A 5JLWA 2R0QC 1K61A 4M3FA 4Y7NJ 2X6OA 1K83J 2E1OA 5F0FA 4C3IJ 2I10A 3TW7A 4DYQA 1LE8A 3PM1A 5HODA 5F04A 2LD5A 5F0CA 3HDDA 2DMPA 2ECCA 5M3FJ 3I4MJ 3G1MA 1FJLA 1T56A 2JMWA 2WB1N 1VNDA 1GV5A 2JA5J 2R5YB 2WAQN 2KDZA 3H3VK 2W48A 5EEAA 4BBSJ 1LE8B 3M3YJ 1ETWA 1W0TA 3ZQHA 2KT0A 5E3OA 2R92J 4QSHA 2LR8A 4NDLA 3I4NJ 1VFCA 5F0HA 2L7FP 1TWAJ 1OFCX 2OF7A 2VI6A 3L1PA 3WHCA 3Q3SA 1ZR4A 1WI3A 1HDDC 5IP6A 1PUFA 3JRIA 2LKXA 1WPKA 5E3LA 4DZJA 4A93J 4A3BJ 2EBIA 3TP0A 1I6HJ 1I50J 3BTJA 1JT6A 3S2HJ 3BR5A 1U9NA 3HOYJ 1AKHA 3G1OA 1POGA 1AU7A 5IOYA 1NK2P 2L7ZA 2G0EA 3C2BA 2O8KA 1Z77A 1P7JA 3O8GA 4J19A 1MBHA 4CYCB 4JX5A 1RR7A 3RZDJ 2PMZN 4MFEA 2AHQA 1T33A 2CU7A 2DN0A 3S1NJ 1YRNA 1H8AC 1OJLA 1A6IA 3W6VA 3LSJA 2L7MP 2MG4A 3ZQLA 1EF4A 3BTCA 3G1LA 2YU9J 3CCYA 5EZHA 2E19A 2XPVA 3LOCA 2VKVA 3DEWA 5M3MJ 1W0UA 2HOAA 1ZKGA 4AUXA 2Y2ZA 4UUTA 1GDTA 1ETVA 3QQAA 2NOGA 2E2IJ 2NVTJ 2JK3A 5EYRA 2NVXJ 1ORKA 4B4CA 4FCYA 3E7LA 1X2MA 1JKRC 2EQRA 3HM5A 3WHBA 4A3IJ 3NAUA 2XRLA 2DA3A 3JRAA 2HOTA 4FE7A 2TCTA 2XPWA 5J3LA 1JT0A 3DCFA 3TP3A 2VUMJ 1JJ6C 1AKHB 4C3HJ 3GTPJ 3RQIA 4DZPA 4JP0A 2ELKA 3MVPA 3HOXJ 2WV1A 5FKMA 4Y52J 1RPWA 2R5ZA 1RKWA 5E3NA 3IH4A 2LY9A 3K7AJ 2MW8A 2DMTA 4A3JJ 5GPCA 3TEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRS G;  3ZQC A;  4MIM A;  1ZTR A;  2AO9 A;  2NS8 A;  3BQY A;  4FIS A;  1ENH A;  3LSR A;  1A5J A;  2X48 A;  4DW6 A;  5EG0 B;  5C4J J;  3GTJ J;  3GBG A;  2JA6 J;  3S1M J;  1XC5 A;  3SJM A;  2IBD A;  3JRF A;  1NTC A;  2HOS A;  1MH4 A;  2R5Y A;  1B72 A;  1MBK A;  4UUS B;  3QPL A;  3A01 B;  1PUF B;  4A3C J;  3JR9 A;  5K7Z A;  1Q1V A;  2K9N A;  3BG5 A;  1NK3 P;  4QIW N;  2EZK A;  1D5Y A;  2FQ4 A;  5J1U A;  1IUF A;  3IV5 A;  3JRC A;  3GTQ J;  1H88 C;  4V2G A;  2HYJ A;  2Y9Y A;  2Y9Z A;  2O9L A;  1GT0 C;  5F1J A;  4LOC A;  1OCT C;  1RET A;  1ITY A;  1JJ8 C;  3D1N I;  2XPU A;  2HXO A;  1ETY A;  2DA7 A;  4BKX A;  2OPT A;  2DA2 A;  2GM4 A;  1WGX A;  1LFU P;  2QF7 A;  5FJ8 J;  2K9Q A;  1ETX A;  3S14 J;  3RKQ A;  4FE4 A;  5FKL A;  1IDY A;  3A03 A;  3HOZ J;  1FEX A;  4C3J J;  4G12 A;  1YRN B;  1Z0X A;  3CMY A;  4M3B A;  2K40 A;  2LLK A;  3OSG A;  3GTG J;  2DTZ A;  2N8G A;  1H89 C;  3TW6 A;  2XGD A;  3HKZ N;  1IG7 A;  2JWT A;  3Q0U A;  4BY1 J;  1TWF J;  1TWH J;  4D5F A;  2HDD A;  2LFB A;  1B72 B;  3SFI A;  4M3D A;  5FLV A;  1JTX A;  2X9D A;  2FJ1 A;  4DYC A;  1MSE C;  1JUS A;  2CQQ A;  2TRT A;  5DS9 A;  3BR0 A;  2DA1 A;  5IOZ A;  2EH3 A;  4QTR A;  3BG9 A;  4FTH A;  3S1R J;  4JX4 A;  1B8I B;  3UKG A;  3LNQ A;  1JUM A;  3JRB A;  3BR1 A;  4AC0 A;  5M5W J;  2DMQ A;  3B6A A;  1R9T J;  2MSY A;  1BA5 A;  1XG1 A;  3ZQI A;  2XGE A;  2R5Z B;  2ME6 A;  2XB5 A;  2QCO A;  4S0H B;  4XRM A;  3BR6 A;  1TWC J;  1JGG A;  3IH2 A;  5GPA A;  1F43 A;  3BR2 A;  4BY7 J;  3HEF A;  1RES A;  3HGY A;  1I3Q J;  3QPS A;  2NVY J;  1QPI A;  1MH3 A;  2H8R A;  2LVS A;  1HF0 A;  4GFB A;  1WCM J;  4A3D J;  4A3M J;  2DMU A;  1UMQ A;  1FTZ A;  5J1Y A;  4A3G J;  1UHS A;  5F27 A;  2R7Z J;  2CJJ A;  2CUE A;  2MGQ A;  1JKO C;  4XRS A;  4A69 C;  1F36 A;  1MBJ A;  2DA4 A;  2H1K A;  1B8I A;  4A3E J;  2LP0 A;  3FIS A;  2LTP A;  3LSG A;  4RBO A;  3O8H A;  2O7O A;  1U78 A;  1GUU A;  5IYD J;  4XK4 A;  2M34 A;  2ID3 A;  2Y30 A;  1ETQ A;  4HNV A;  1FIA A;  5IP7 J;  2Y31 A;  4MFD A;  3ZOB A;  4IHY A;  1HDP A;  2CRG A;  9ANT A;  4MO7 A;  2JJ7 A;  3FK6 A;  1ETK A;  4IHW A;  2XSD C;  1VF9 A;  2YS9 A;  2M2E A;  1IJW C;  4M6V A;  1GV2 A;  4A3L J;  2L0K A;  3FIW A;  2JN6 A;  4JX6 A;  2ME0 A;  2DJN A;  2R93 J;  3IH3 A;  3BTL A;  5IPA A;  2XB0 X;  2M9H A;  1ETO A;  2VPR A;  3PO2 J;  2JA8 J;  2GLO A;  4A3K J;  3PO3 J;  2ECB A;  1BJZ A;  1JUP A;  4BXX J;  4RDU A;  1SAN A;  3BQZ A;  4B1R A;  4M3E A;  3BR3 A;  3SDG A;  1DU0 A;  3HBL A;  4I6Z A;  4D7N A;  3NAR A;  1TC3 C;  2EZH A;  3JRD A;  2EZL A;  2DMN A;  3S1Q J;  3JRE A;  3GTM J;  4BBR J;  1SFO J;  2RAE A;  1MBF A;  4I76 A;  5EG0 A;  3CQZ J;  4EEF G;  2L9R A;  3HB9 A;  5EZG A;  1LFB A;  4JYK A;  2IEK A;  1BW6 A;  3JRH A;  5M5X J;  3HOV J;  4A3F J;  2IAI A;  3GTK J;  4L5E A;  4XIC A;  1HCR A;  5FKK A;  3HOU J;  4UUS A;  3A01 A;  5EF6 A;  3LSP A;  1HOM A;  5IYC J;  3F0C A;  2M0C A;  3ZQG A;  4AYB N;  1OCP A;  3MKL A;  2EZI A;  2VKE A;  1JKQ C;  3S2D J;  4CYC A;  1P7I A;  1U9O A;  2ID6 A;  1ZQ3 P;  1JTY A;  1WH7 A;  2HQ5 A;  2COB A;  3B6C A;  4D7M A;  5K7H A;  4IEJ A;  1IRZ A;  5FLM J;  1FIP A;  3MN2 A;  1IV6 A;  3VPR A;  3OIO A;  3S16 J;  5JLX A;  3S15 J;  5DTD A;  4DYR A;  2E2H J;  3BT9 A;  5IP9 J;  5M5Y J;  1IDZ A;  3FK7 A;  1ZK8 A;  3A02 A;  2JA7 J;  4IHV A;  4XID A;  3OSF A;  1ZGW A;  2B63 J;  1HLV A;  2Y0S N;  4X1E A;  4M3G A;  4MLO A;  1RKT A;  2DA5 A;  1X2N A;  2XGC A;  1IC8 A;  2CQX A;  1G2H A;  5F08 A;  4ABZ A;  2HXI A;  3FKI J;  3JRG A;  3HGG A;  2D5V A;  5EDN A;  1DU6 A;  2E2J J;  1U8B A;  1JKP C;  2ZB9 A;  1CQT A;  1IGN A;  1MBG A;  5C3E J;  1BL0 A;  5C4X J;  3M4O J;  1E3O C;  3CDL A;  1ZR2 A;  1Y1V J;  2DA6 A;  1O4X A;  2NVQ J;  2GBY A;  5BNG A;  3Q0W A;  1QRY A;  2YUS A;  5C44 J;  3Q0V A;  3ZQF A;  5K7F A;  1BW5 A;  1GVD A;  5FKO A;  5GP9 A;  3GTO J;  1AHD P;  1APL C;  5E3M A;  5FKN A;  2LK2 A;  4IHX A;  3BG3 A;  3GTL J;  1QVT A;  3S17 J;  3K2A A;  1WH5 A;  1UG2 A;  1QVU A;  3HOW J;  5EGO B;  1S7E A;  2NS7 A;  1TWG J;  2HI3 A;  4D5C A;  2P81 A;  3RZO J;  3H0G J;  1MBE A;  5J1R A;  5IYB J;  5EGO A;  2FX0 A;  1VI0 A;  2M8G X;  4W1U A;  4X6A J;  4W97 A;  2K9S A;  2CUF A;  1MNM C;  3OOU A;  1Y1W J;  1FTT A;  4B3A A;  2FD5 A;  1X58 A;  1MSF C;  3BTI A;  4V2F A;  4C2M J;  1XS9 A;  5JLW A;  2R0Q C;  1K61 A;  4M3F A;  4Y7N J;  2X6O A;  1K83 J;  2E1O A;  5F0F A;  4C3I J;  2I10 A;  3TW7 A;  4DYQ A;  1LE8 A;  3PM1 A;  5HOD A;  5F04 A;  2LD5 A;  5F0C A;  3HDD A;  2DMP A;  2ECC A;  5M3F J;  3I4M J;  3G1M A;  1FJL A;  1T56 A;  2JMW A;  2WB1 N;  1VND A;  1GV5 A;  2JA5 J;  2R5Y B;  2WAQ N;  2KDZ A;  3H3V K;  2W48 A;  5EEA A;  4BBS J;  1LE8 B;  3M3Y J;  1ETW A;  1W0T A;  3ZQH A;  2KT0 A;  5E3O A;  2R92 J;  4QSH A;  2LR8 A;  4NDL A;  3I4N J;  1VFC A;  5F0H A;  2L7F P;  1TWA J;  1OFC X;  2OF7 A;  2VI6 A;  3L1P A;  3WHC A;  3Q3S A;  1ZR4 A;  1WI3 A;  1HDD C;  5IP6 A;  1PUF A;  3JRI A;  2LKX A;  1WPK A;  5E3L A;  4DZJ A;  4A93 J;  4A3B J;  2EBI A;  3TP0 A;  1I6H J;  1I50 J;  3BTJ A;  1JT6 A;  3S2H J;  3BR5 A;  1U9N A;  3HOY J;  1AKH A;  3G1O A;  1POG A;  1AU7 A;  5IOY A;  1NK2 P;  2L7Z A;  2G0E A;  3C2B A;  2O8K A;  1Z77 A;  1P7J A;  3O8G A;  4J19 A;  1MBH A;  4CYC B;  4JX5 A;  1RR7 A;  3RZD J;  2PMZ N;  4MFE A;  2AHQ A;  1T33 A;  2CU7 A;  2DN0 A;  3S1N J;  1YRN A;  1H8A C;  1OJL A;  1A6I A;  3W6V A;  3LSJ A;  2L7M P;  2MG4 A;  3ZQL A;  1EF4 A;  3BTC A;  3G1L A;  2YU9 J;  3CCY A;  5EZH A;  2E19 A;  2XPV A;  3LOC A;  2VKV A;  3DEW A;  5M3M J;  1W0U A;  2HOA A;  1ZKG A;  4AUX A;  2Y2Z A;  4UUT A;  1GDT A;  1ETV A;  3QQA A;  2NOG A;  2E2I J;  2NVT J;  2JK3 A;  5EYR A;  2NVX J;  1ORK A;  4B4C A;  4FCY A;  3E7L A;  1X2M A;  1JKR C;  2EQR A;  3HM5 A;  3WHB A;  4A3I J;  3NAU A;  2XRL A;  2DA3 A;  3JRA A;  2HOT A;  4FE7 A;  2TCT A;  2XPW A;  5J3L A;  1JT0 A;  3DCF A;  3TP3 A;  2VUM J;  1JJ6 C;  1AKH B;  4C3H J;  3GTP J;  3RQI A;  4DZP A;  4JP0 A;  2ELK A;  3MVP A;  3HOX J;  2WV1 A;  5FKM A;  4Y52 J;  1RPW A;  2R5Z A;  1RKW A;  5E3N A;  3IH4 A;  2LY9 A;  3K7A J;  2MW8 A;  2DMT A;  4A3J J;  5GPC A;  3TED A; 
#chains in the Genus database with same CATH topology
 1KGS A;  3MKY B;  3SZG A;  3ZQC A;  4OIQ F;  1ULY A;  3H5A A;  1ZTR A;  2AO9 A;  3BQY A;  3VB2 A;  3LSR A;  1XN7 A;  3ZN0 A;  3CCL I;  2IA2 A;  1A5J A;  3R6S A;  3PJR A;  1DUX C;  4IRG A;  3CLQ A;  2L7K A;  3A0B C;  1XC5 A;  5IY5 H;  2WTE A;  4U0Y A;  1YIT I;  1AOY A;  1BC7 C;  2ZME C;  3DKX A;  2AXT C;  3OYM A;  5D5X B;  4II3 A;  2HWV A;  1KU7 A;  4M72 A;  4D0P A;  3BG5 A;  5K1Y A;  1D5Y A;  3JRC A;  3T8T A;  2WAD A;  1P4X A;  4L18 B;  2K02 A;  3PIP F;  1OCT C;  1WJC A;  2XDV A;  3FDY A;  2R7Q A;  5JI6 A;  2F4I A;  1JJ8 C;  4M9X A;  1SAX A;  4A6D A;  1ON1 A;  3OL4 A;  5DV5 A;  2DA2 A;  1WHU A;  2GA2 A;  2HPM A;  1SAU A;  2P0W A;  3O3K A;  3HSR A;  3K2Z A;  2VQL A;  3I0T A;  1QO0 D;  1A35 A;  2CV2 A;  4BXU A;  1G4D A;  2VOD A;  1IDY A;  3RKY A;  2KJC A;  4BJ5 C;  1YRN B;  4DJA A;  3ASN H;  3ZMS A;  2FMY A;  3PSF A;  2VIX A;  1UEL B;  3F23 A;  3OSG A;  3ERM A;  3WTT C;  3GTG J;  1RRJ A;  2N8G A;  2QZ8 A;  1MJA A;  1RC9 A;  3J81 K;  3CF5 F;  3OOP A;  1B1B A;  5KNL A;  4BY1 J;  3S32 A;  2ICW G;  2ZC2 A;  5DM6 F;  1BI2 A;  2XVC A;  1MIJ A;  4M3D A;  2IT0 A;  3QU6 A;  3X2Q H;  4HDV A;  2IXS A;  2FNA A;  1SVM A;  4ZYH A;  3F6V A;  4NB5 A;  1MSE C;  2IGN A;  3CCR I;  2BYV E;  2OU2 A;  2YR2 A;  4BQN A;  5DS9 A;  1FP2 A;  2DA1 A;  5IOZ A;  4E70 A;  4ZH4 F;  3MAJ A;  4HG2 A;  4KJZ A;  5DD8 A;  5LHH A;  1PUE E;  4LLN A;  3CTA A;  3JRB A;  2P6T A;  4QPO A;  4AC0 A;  5CVI A;  3ABM H;  2WA0 A;  2DXI A;  4OMY A;  4LIU A;  5TJJ A;  3G73 A;  1R9T J;  1BC8 C;  2MFZ A;  2ME6 A;  3L2Q A;  2XB5 A;  4RAF A;  3JAM K;  4B47 A;  4XRM A;  2VXD A;  2DK5 A;  1TWC J;  1JGG A;  4NUB A;  3J7Y J;  4BHC A;  2NNY A;  3VWB A;  3HGY A;  2HGC A;  3MWM A;  4GFB A;  4C2U A;  2A6E F;  3CZ6 A;  1UMQ A;  3F22 A;  1UHS A;  1ONV A;  3ABL H;  1G8X A;  2XAQ A;  5FLX K;  3WTX C;  2VJ4 A;  1S9H A;  1YE9 A;  2FU4 A;  1VQL I;  5ILU A;  1IN4 A;  3LA7 A;  4A5N A;  2EV5 A;  2CQK A;  1BR2 A;  4A69 C;  3QOD A;  1MBJ A;  4GYG A;  1YYV A;  3SEZ A;  4YRV A;  3LSH A;  3J80 Z;  4Y4R A;  1B8I A;  4U0V A;  3CUQ B;  1KA8 A;  4RBO A;  1U78 A;  3O8H A;  1VQ5 I;  4G6T B;  2PMZ A;  4XK4 A;  5CVU A;  2ID3 A;  1ETQ A;  4E7L A;  1SFX A;  2A5Y B;  4FQG A;  3CJT B;  3WTW C;  2IA0 A;  3QAH A;  1W5S A;  2JJ7 A;  5LGU A;  3FHZ A;  2PG4 A;  2DYR H;  1VF9 A;  4LG0 A;  3B02 A;  3KZI C;  4A3L J;  3FIW A;  2ISY A;  4JX6 A;  2ME0 A;  2DJN A;  1SFE A;  1A31 A;  5BQT A;  4HLY A;  5IPA A;  5TIS C;  1LEB A;  2CH0 A;  2M9H A;  3ZR8 X;  4ZZD A;  2VPR A;  4GO1 A;  4A3K J;  3GME A;  1JUP A;  2W84 A;  4RDU A;  1ZG3 A;  2FBI A;  2GXG A;  2HDW A;  3FF5 A;  3BQZ A;  3S2W A;  4YIF A;  3ZCO A;  5JHF A;  2ZSH B;  3SDG A;  4I6Z A;  4GYI A;  4D7N A;  2R4G A;  3WTU C;  4M6X A;  4U87 A;  3JRE A;  2PX9 A;  3I5U A;  3WU1 B;  3QP5 A;  4I99 C;  1SFO J;  2E71 A;  2ZFW A;  2JZY A;  2OCE A;  3Q5F A;  3K4C A;  3LAP A;  4L9T A;  2W24 A;  3LFU A;  2QEN A;  1IW7 F;  1X1P A;  1Z1D A;  1LQ1 A;  3PUB A;  2ELJ A;  1HXD A;  3H9G A;  3DPT A;  4A3F J;  2OTL I;  3ESW B;  4XIC A;  1HCR A;  4ZYG A;  5FKK A;  4M9S A;  3HOU J;  1G3T A;  4UUS A;  3A01 A;  1K6O A;  1W36 C;  3LSP A;  3OYA A;  4K2E A;  3SXY A;  3DBL B;  2M0C A;  1OCP A;  3MKL A;  4HLX A;  1JKQ C;  2O03 A;  1R58 A;  2XF6 A;  5D5U B;  3RYP A;  1LEA A;  1R5I D;  3DTI A;  2V7F A;  2ZJP F;  2A6H F;  3KP7 A;  2M8E A;  5D8K B;  4D7M A;  5K7H A;  4IEJ A;  2GOX B;  1YLF A;  4DBR A;  1IRZ A;  2XUB A;  1YIO A;  2XAU A;  4BUP A;  3DPU A;  5FRO A;  1OCZ H;  3OIO A;  5D8L B;  3LWF A;  3S15 J;  5AIQ A;  5LGN A;  2E2H J;  5IP9 J;  1YX3 A;  3HG9 A;  3SYT A;  3ROU A;  3KFW X;  1RUO A;  2BVM A;  3CJN A;  1ZK8 A;  2JA7 J;  4HAM A;  2L2O A;  4RB1 A;  3K4K A;  2RQP A;  1QQI A;  3E6D A;  5AIP A;  2CV1 A;  4MLO A;  1XGO A;  1RKT A;  2K86 A;  2KDO A;  3DFG A;  3LQR A;  1F5T A;  2CQX A;  2ZXW H;  3ISP A;  5F08 A;  2RVC A;  4EV0 A;  3JSO A;  1ZRE A;  4Q5S F;  2CW8 A;  1G2H A;  4PJJ A;  3OYL A;  4LJZ F;  2D5V A;  5EDN A;  3U1D A;  2E2J J;  2VJ5 A;  4FT8 A;  4F55 A;  3V8L A;  3L2U A;  1USS A;  3IAS 2;  2MBF A;  4RAY A;  1YHQ I;  4U88 A;  1O4X A;  2NVQ J;  1G3W A;  2DA6 A;  3EPZ A;  1G6N A;  5BNG A;  4O6J A;  3M8J A;  3GYH X;  3Q0W A;  2V1X A;  2YUS A;  4AYB A;  4GXO A;  2YSR A;  3ZQF A;  3T8R A;  1YFH A;  1B6A A;  3CMM A;  4XBF A;  2Y0M A;  5FKO A;  1Z91 A;  5LBQ A;  1HW5 A;  5L3G A;  1I3A A;  4CCN A;  1NHA A;  2ZBK A;  2M3A A;  3F8B A;  1KYZ A;  4U0W A;  3TO7 A;  5D5V B;  1SMT A;  3G4S I;  4IHX A;  3BG3 A;  3GTL J;  3P9I A;  2DO7 A;  3MKZ A;  3P9K A;  2NNN A;  2EA4 A;  3K2A A;  3EUH C;  4Y17 A;  4FX4 A;  1S7E A;  4RM3 A;  3SEQ A;  3ZMD A;  1J09 A;  4WXD A;  4AWX B;  2XRN A;  3EDP A;  3DKW A;  4DQ2 A;  4W97 A;  4EJW A;  4F3Q A;  3K10 A;  2K9S A;  4I98 B;  4XKW A;  2CUF A;  2LF8 A;  2G9W A;  4IHT A;  4AU7 A;  1MJB A;  2NOJ B;  2XKP A;  4V2F A;  1XS9 A;  3L2W A;  5JLW A;  4B44 A;  1D5V A;  2GWR A;  2E7X A;  2R0Q C;  2K5C A;  4HDU A;  1OCC H;  1TBX A;  4C3I J;  1Z05 A;  2VKD A;  3TW7 A;  4G6Q A;  1T38 A;  5E20 A;  4XNF A;  1LE8 A;  1M1E B;  5F0C A;  1Z6R A;  3BJA A;  3REO A;  3DTK A;  2V6C A;  2H6C A;  4ASN A;  2OAZ A;  1Z3X A;  2WB1 N;  4PJ0 C;  4Q48 A;  2JA5 J;  2O6G E;  2EIM H;  2W25 A;  2RV8 A;  3IKT A;  5IT9 Z;  2WAQ N;  2KDZ A;  3H3V K;  4NQW B;  4BBS J;  4OAY A;  2Y0S A;  4XKC A;  1TLH B;  1U5T B;  3PFI A;  5JVG F;  2VLA A;  2KT0 A;  5E3O A;  2KIQ A;  3QYB A;  1FWZ A;  1MMD A;  5FRM A;  4NDL A;  4UHT A;  4C9Y A;  5LRR A;  2H8W A;  2OF7 A;  1RZ4 A;  3HRS A;  1WSU A;  3L1P A;  2HTS A;  3AAF A;  2JUC A;  2BHY A;  2ZNZ A;  1HDD C;  3LA3 A;  1PUF A;  1WPK A;  5E3L A;  4A93 J;  4A3B J;  3TP0 A;  3LSI A;  1I50 J;  3I58 A;  1JT6 A;  3BCA A;  3E6C C;  3I59 A;  3BR5 A;  1IN5 A;  3HOY J;  2LH9 A;  5A2Q Z;  2KIM A;  4MHG A;  2ACJ A;  2ETH A;  1POG A;  5IOY A;  3C2B A;  2KZG A;  1V5F A;  2L9S A;  2CUJ A;  1MKM A;  2QGU A;  4JX5 A;  3RZD J;  1MND A;  2PMZ N;  4CCK A;  2F5E A;  3JTH A;  2AHQ A;  2LMD A;  2HPI A;  1BIB A;  3MD2 A;  2CYY A;  4XN0 A;  4NBQ A;  2M5W A;  4XLN F;  4P9U A;  3LQQ A;  1A6I A;  3L2R A;  3I64 A;  3CME I;  3LSJ A;  2L7M P;  3DV8 A;  4YEJ A;  1EF4 A;  2RN7 A;  4BNC A;  1O7F A;  3CCY A;  2Z1D A;  2XPV A;  1ZRF A;  2VKV A;  5M3M J;  3OYI A;  2DYS H;  1HA8 A;  5HOO A;  1BN5 A;  1ETV A;  4ESF A;  2RC4 A;  2JA2 A;  3K1M A;  4RAZ A;  1QPM A;  3QOP A;  2UWM A;  4B4C A;  3TDZ C;  3ZQQ A;  4CCO A;  1OYY A;  5B5E C;  4CXF A;  1CF7 B;  1JKR C;  2L02 A;  1XGS A;  2HZD A;  2M30 A;  1IN6 A;  3I55 I;  2PJP A;  4KUM A;  3KP4 A;  2EFN A;  2XRL A;  1TQP A;  4S05 A;  3OYK A;  5D5W B;  2DI3 A;  3SZP A;  3TP3 A;  5HLG A;  2BHZ A;  4BEH B;  3OY9 A;  1AKH B;  2VUM J;  3GTP J;  5IT9 K;  1U5T C;  2PI0 A;  1WJB A;  3HOX J;  2WV1 A;  1FLI A;  1I1G A;  1HKQ A;  5ICE A;  4CUG A;  2FOK A;  4AIJ A;  3KET A;  3IH4 A;  3CCS I;  5CQG A;  2LY9 A;  3HSE A;  4HA8 A;  2JUG A;  1CGP A;  1ZAR A;  1W4M A;  4C2T A;  4XRS G;  1Y8R B;  2P7V B;  3QU3 A;  1S3J A;  2G7H A;  5BS6 A;  2OQR A;  5HDN A;  2CSO A;  3JSP A;  3OYC A;  3GBG A;  5LEK A;  2JA6 J;  4ITV A;  1MMA A;  2ZXJ A;  2IBD A;  4IQJ A;  3A4C A;  2F5C A;  3E5X A;  3OS2 A;  1MH4 A;  1V55 H;  1MBK A;  3GO5 A;  1Q1H A;  3QPL A;  4UUS B;  3A01 B;  5LFA A;  1LFP A;  3J7Z I;  5K7Z A;  1LB2 A;  2PMH A;  1Q1V A;  2CQN A;  2FML A;  2XAJ A;  3TO9 A;  3LAJ A;  1IO2 A;  1QZE A;  3FXJ A;  3F72 A;  4IVN A;  2CW7 A;  3K69 A;  3N05 A;  2HQR A;  3CES A;  2O61 A;  1ZG1 A;  2B7E A;  4V2G A;  3DLL F;  2O9L A;  2KRH A;  1RNL A;  3KEY A;  2Y9Z A;  1GT0 C;  1FBU A;  1ITY A;  1RET A;  2DAO A;  2FA5 A;  4Y13 A;  5ED4 A;  2P5V A;  2EWN A;  4WXH A;  2Q2E B;  4S04 A;  3FXQ A;  3EET A;  4BKX A;  2OPT A;  4XLE A;  1VQN I;  3ZMU A;  1J0R A;  1J7K A;  1LFU P;  1D1A A;  3EUA A;  5LLQ A;  2IP2 A;  1TW2 A;  3B73 A;  3RKX A;  1ETX A;  5GAE J;  3RKQ A;  3U1K A;  2MH9 A;  2ZJR F;  1XTA A;  5FKL A;  2E1N A;  2JT1 A;  3PQK A;  4ZC3 A;  3A03 A;  1T98 A;  2P6S A;  2A61 A;  1J2X A;  2LRE A;  2R7D A;  2EFP A;  3CMY A;  4BJT A;  3ZXS A;  3SFZ A;  4GRI A;  4E7J A;  2DTZ A;  1UB9 A;  1X1C A;  4IOA F;  1HKS A;  1R1V A;  1IG7 A;  2E7W A;  4QLC U;  3OYH A;  2QBY A;  1TWH J;  1K78 B;  2LFB A;  4CCJ A;  1EV7 A;  1JTX A;  3WU0 A;  4P55 A;  4KT6 A;  3W6K B;  4B43 A;  2ESH A;  3OR2 C;  2O5R A;  3BR0 A;  2EH3 A;  2JRM A;  4FTH A;  2HNH A;  2VN2 A;  2OJE D;  2L4M A;  4EJV A;  2R7U A;  3RIR A;  2E1M C;  1AA7 A;  3M1C A;  5M5W J;  1J5Y A;  1Z21 A;  3RPU D;  4PZJ A;  4RLF A;  4HX4 A;  3F8C A;  3KPH A;  2FEZ A;  2DQL A;  1FYK A;  2HOE A;  2VPL A;  2D2W A;  3BR6 A;  1F43 A;  3HUG A;  3ABK H;  3BR2 A;  5B66 C;  2YPR A;  1RES A;  4CSW A;  2XF5 A;  5KHD A;  2H8R A;  3GEZ A;  5HDG A;  5CVV A;  4E7Z A;  1S29 A;  1IRX A;  1WJE A;  4A3M J;  2DMU A;  3EYY A;  3TOA A;  4LG3 A;  1FTZ A;  1D0Y A;  1KU3 A;  3RSN A;  4OOI A;  1HKT A;  3CDH A;  2X6X A;  4HEA 2;  5F27 A;  2IS2 A;  2CUE A;  1DDN A;  3FKJ A;  1JKO C;  2NRA C;  4RAG A;  3SHF A;  2KL4 A;  4N4O B;  5LHI A;  4XRS A;  3RJP A;  2VE9 A;  2ZNY A;  3KE2 A;  4FET A;  3S8P A;  3HTS B;  4RB3 C;  1FMW A;  4A3E J;  2LP0 A;  2KJB A;  4YFX F;  3TO6 A;  1BBY A;  2VT3 A;  1GUU A;  2NAZ A;  2R7F A;  2M34 A;  3UR3 C;  1OYI A;  1R7J A;  3GLX A;  5E8I A;  1QZZ A;  4MFD A;  1WJD A;  1YQA A;  2HQA A;  2CRG A;  1E0E A;  4HV6 A;  1L0O C;  3EUK L;  3ZMT A;  1SVL A;  3FZV A;  4DGW B;  4EM0 B;  3OV8 A;  3SZT A;  4NC8 A;  2R93 J;  3IH3 A;  3BTL A;  1IV8 A;  2XB0 X;  4EMS A;  3L2C A;  2P4W A;  2JSP A;  2GLO A;  4HPQ A;  1UFM A;  1XGM A;  5J6X A;  4ZDO A;  4O5V A;  2V26 A;  2HQN A;  4PDK A;  2BW3 A;  3BCB A;  3ERE D;  1R71 A;  1OCR H;  1TC3 C;  3NAR A;  2EZL A;  3RTR A;  3LMM A;  5H2F C;  2CO5 A;  3S1Q J;  2E34 A;  3KYC B;  2ZCW A;  4BBR J;  3COA C;  1ZRC A;  4KT5 C;  3K9T A;  4UUV A;  4QPQ A;  2Z5U A;  3KLN A;  2QQA A;  1MBF A;  2M87 A;  3N4M A;  3F9K A;  4EVI A;  3CQZ J;  4IO9 F;  3G71 I;  2L9R A;  3OS1 A;  5FO5 A;  2QA4 I;  5J47 A;  1ZRD A;  2A5W A;  1QU3 A;  2IEK A;  3T5X A;  3CUO A;  2P5K A;  2QM3 A;  4L5E A;  3W2W A;  4F92 B;  1SD6 A;  2EB7 A;  2HYF A;  4EGY A;  1U0J A;  1FMV A;  2DFI A;  1HOM A;  4RB0 A;  4CGZ A;  2Q8K A;  3F0C A;  2E60 A;  4LFU A;  1I5Z A;  1S5L C;  4ON0 A;  1Y0U A;  1WH7 A;  2HQ5 A;  1OMI A;  1U5T A;  2COB A;  3B6C A;  4N4N B;  1R5H A;  2ZJ2 A;  3K4M A;  3DTE A;  1FIP A;  1EH7 A;  5FLM J;  1IV6 A;  4II2 A;  2E5N A;  1IXR C;  2YX7 A;  3VYR B;  1I6X A;  4LGW A;  2M7A A;  1E17 A;  2L01 A;  2KP6 A;  3BT9 A;  4RGS A;  3E6B A;  1YW7 A;  1HBX G;  2XGX A;  2B0L A;  1P6R A;  2F2E A;  1WFX A;  2VBW A;  1VQ4 I;  3RPQ A;  4B3X A;  1FSH A;  1R4M B;  1Y0N A;  4JBA A;  4IHV A;  4XID A;  1ZGW A;  4UVC A;  3K70 D;  1HLV A;  1U2W A;  2XSJ C;  1FYL A;  2KKO A;  4AVP A;  2OBP A;  2VC1 A;  2VQH A;  4HST A;  3V4G A;  3K4N A;  4HX8 A;  3W2A A;  2WV0 A;  3WE3 A;  3HOT A;  1X2N A;  2XGC A;  2HDC A;  1GHC A;  5LEJ A;  4ABZ A;  3BPV A;  2Z16 A;  3K1N A;  3HGG A;  4A12 A;  3IKV A;  5CJ9 A;  4ENM A;  1O3R A;  2EJR A;  5HNH A;  2L54 A;  3F8F A;  1CQT A;  1IGN A;  2GA1 A;  2V79 A;  1P9Q C;  5JR3 A;  1E3H A;  2A68 F;  2VAS A;  3HUG B;  3M4O J;  1ZR2 A;  3GXO A;  4KMU X;  2MC4 A;  5HS7 A;  1JHF A;  1QRY A;  5C44 J;  1X4O A;  2QQ8 A;  1XMX A;  3LSK A;  1SEU A;  3BZC A;  5K7F A;  4ZDP A;  3A0H C;  3WTY C;  4V19 K;  1GVD A;  2K9M A;  5LGT A;  5GP9 A;  3BDD A;  3MZH A;  4PJM A;  2NS0 A;  1APL C;  5E3M A;  4AID A;  1WJA A;  3DEU A;  2BOL A;  2QSF X;  5CPR B;  2V1N A;  1EKE A;  3OYJ A;  4XOR A;  2DOD A;  1KON A;  2LK2 A;  4KIF A;  3J81 Z;  4KFC A;  3WE2 A;  1WH5 A;  1UG2 A;  1QNT A;  3R60 A;  2PFB A;  3HOW J;  4BQQ A;  5EGO B;  1MDM A;  2NS7 A;  1TWG J;  2CG4 A;  2HI3 A;  2LDU A;  4D5C A;  1D8J A;  2P81 A;  1STZ A;  2IGO A;  3H9Q A;  3RZO J;  4NQW A;  4RMN A;  1VI0 A;  2CW0 F;  2Z99 A;  4JQF A;  5JVT A;  3VOD A;  2LY2 A;  2JPB A;  2LKS A;  5DM7 F;  1MNM C;  4XMY A;  1XX5 A;  1UJ8 A;  1Y1W J;  4B3A A;  3DBH B;  3HJE A;  1IZ1 A;  3GWZ A;  4PUS A;  1K61 A;  5D6E A;  1YJN I;  2F5V A;  1K83 J;  4M71 A;  4D9J A;  4GDF A;  2RNG A;  4ZYE A;  3BZ6 A;  4XKB A;  2EV0 A;  4E4H A;  2JVG A;  2M0M A;  2Y69 H;  3BPX A;  1T08 B;  3KYD B;  3QWL A;  4KIS A;  2IVM A;  3K0L A;  2B9S A;  3G1M A;  1T56 A;  1R1T A;  3FX3 A;  4YII A;  1VND A;  5TGT A;  2R5Y B;  1LVA A;  1LE8 B;  2GQQ A;  2ZFU A;  3CMA I;  2H94 A;  3D0S A;  4E7K A;  2X1D A;  3FXR A;  3H3U A;  4XSZ F;  2R92 J;  4QSH A;  3I4N J;  2BW3 B;  3EUH A;  4XLH A;  5F0H A;  2L7F P;  1OFC X;  2VI6 A;  2FNP A;  4UV8 A;  5D6F A;  1K7A A;  3H36 A;  1ZR4 A;  4CCL A;  3IRQ A;  3JRI A;  1QHG A;  4L5J A;  3V7R A;  3V8K A;  2LBF A;  3BTJ A;  2CS3 A;  3S2H J;  2VC0 A;  2ZJQ F;  4BEH A;  3BG7 A;  4KA4 A;  1AKH A;  1Z7U A;  3FM5 A;  3QP6 A;  2CFX A;  4LK1 F;  3D5L A;  2WAE A;  2WY8 Q;  3OYN A;  1O7L A;  2G0E A;  2L7Z A;  5BPD A;  1UHM A;  2VON A;  4J01 A;  3O8G A;  4UVA A;  3QRF F;  1MBH A;  4L0Y B;  1WVR A;  5E1Z B;  4KIB A;  5KVR A;  4RLQ A;  4WWC A;  4MFE A;  1T33 A;  4PJN A;  3IP4 B;  1N77 A;  2JSC A;  1OJL A;  2IPQ X;  3ZRG A;  3JCU C;  5FFX A;  3ZQL A;  1PP8 F;  1Z67 A;  3P7N A;  3G1L A;  2V6E A;  3CP2 A;  2YU9 J;  2W57 A;  2COM A;  3DQV C;  1YIJ I;  2E19 A;  1W0U A;  3DEW A;  5J4Y A;  2QQ9 A;  2K3F A;  4AUX A;  1SMY F;  1XGN A;  2Y2Z A;  4XM3 A;  2PLY A;  1UST A;  3ECO A;  1OYW A;  2E2I J;  4WCG A;  4LMY A;  1HSJ A;  5ICF A;  2M4G A;  2ZSI B;  1YTY A;  4PCQ A;  1KQ8 A;  3HM5 A;  5E8G A;  1IRF A;  4KIC A;  4A3I J;  2HEO A;  4RB2 C;  3R0J A;  1XDU A;  4OMZ A;  3DBR B;  4UV9 A;  5E17 F;  2HU9 A;  2IW5 A;  3CCJ I;  2AQE A;  2EIK H;  1F9N A;  3RDI A;  2Q0O A;  1JT0 A;  2MAB A;  1XSD A;  4G8X A;  3FBI B;  5E79 C;  4C30 A;  5K5O A;  1JJ6 C;  1BI0 A;  3JAM Z;  4DZP A;  2CGP A;  3BRO A;  3K4L A;  3MVP A;  1KZH A;  4Y52 J;  1RPW A;  4A0Y A;  2DPU A;  1RKW A;  4U7B A;  1EH6 A;  5E3N A;  3K7A J;  4BU2 A;  2MW8 A;  2DMT A;  1MMS A;  3W6J B;  4A3J J;  5GPC A;  4BAC A;  5DD4 A;  4BYY A;  2NS8 A;  2EA2 A;  4ESJ A;  4FIS A;  2A69 F;  3KZZ A;  2KMU A;  2E36 A;  2Z3Y A;  2EIN H;  2X48 A;  1V3F A;  1SD5 A;  3C2H A;  3HRM A;  4A5M A;  4H4K C;  5E18 F;  4UVB A;  3N97 A;  1L3L A;  2X1E A;  5KCM A;  3VFZ A;  3SJM A;  3JRF A;  1NTC A;  2LF7 A;  2HOS A;  2R5Y A;  1B72 A;  2HVR A;  3J80 K;  3JR9 A;  2O0Y A;  2Y75 A;  1RIO H;  2VOP A;  2OUM A;  1YI2 I;  1O3Q A;  3IC7 A;  1X3W B;  3WGG A;  4BL0 B;  4EM1 A;  5ICC A;  4G9Y A;  3OYE A;  1FOX A;  2K9L A;  1YJ9 I;  3IV5 A;  4PSX A;  2K4B A;  2ELH A;  2Y9Y A;  1UZC A;  4B09 A;  4F7Z A;  1OQY A;  3BY6 A;  2XPU A;  3E0J B;  2W82 A;  1XPX A;  2BY1 A;  2HXO A;  2RRE A;  4KDP A;  3LL7 A;  3M8F A;  3AFH A;  1WGX A;  3W2V A;  5CKT A;  2HZT A;  3H92 A;  4MNU A;  2KZV A;  4A2U A;  3CO6 C;  1IRG A;  1DPU A;  5FJ8 J;  1LDJ A;  2K9Q A;  1WWX A;  4FE4 A;  3H0D A;  2HVS A;  2E1C A;  1MMN A;  4ZTF A;  1FZP B;  3HOZ J;  1Z3Y A;  1FOK A;  1ZH5 A;  3O6B B;  1TT0 A;  1SD7 A;  1Z0X A;  4EGZ A;  4M3B A;  2LLK A;  1FX7 A;  2X6Y A;  1G3Y A;  4ZTJ A;  2P7C B;  4M73 A;  3WG7 H;  3L00 A;  2QVO A;  2XGD A;  3HKZ N;  3C1D A;  3ULQ B;  4LB6 B;  4ENN A;  3Q0U A;  3GF2 A;  4D5F A;  4JK1 X;  1B72 B;  3GX4 X;  4MGR A;  2CUZ A;  3SFI A;  1FSE A;  2WAQ A;  2GIV A;  3K4B A;  2EIL H;  3CUQ C;  1VQP I;  2UXN A;  2X9D A;  2FJ1 A;  2LNB A;  3DU5 A;  4DYC A;  4PFP A;  2FF4 A;  2CQQ A;  5GAG J;  3K70 C;  3GZ5 A;  5HS8 A;  4LD5 A;  4R79 A;  2H1L A;  1KU2 A;  4G6D A;  4BQO A;  2ZME A;  2M45 A;  4QTR A;  3BG9 A;  3S1R J;  4JX4 A;  1T95 A;  1B8I B;  3UKG A;  1JUM A;  3RQ4 A;  3WU2 C;  2BE5 F;  3RPU A;  2JTV A;  4UXN A;  4UY8 I;  3BR1 A;  4MTD A;  5EJC A;  1FOW A;  3WGH A;  2DMQ A;  3B6A A;  4GGG A;  1BA5 A;  2MSY A;  1XG1 A;  2XGE A;  2GIZ A;  3FXL A;  5DCM A;  1W7P A;  1ON2 A;  3IH2 A;  5GPA A;  3DXJ F;  3GFI A;  3RI4 A;  3LST A;  1PP7 U;  4RS8 A;  2DU9 A;  3HEF A;  3QPS A;  2NVY J;  1WKM A;  3FWE A;  4KNY A;  2LVS A;  3CC2 I;  1HF0 A;  1LDK B;  5E1W A;  1WCM J;  4A3D J;  3PNV A;  1OLT A;  2V9K A;  1FT9 A;  2CJJ A;  2MGQ A;  2RKH A;  2DQR A;  3CDI A;  5GAD J;  4L5I A;  1PYV A;  3IRR A;  2OC6 A;  3VEP A;  1VQ7 I;  2I5U A;  3DU6 A;  3H1C A;  1FBQ A;  5CVJ A;  2XIG A;  5GAH J;  2IS1 A;  3CO7 C;  2DA4 A;  2H1K A;  2YX4 A;  3NRV A;  4A6E A;  4ENK A;  2GOM A;  2EFQ A;  3FIS A;  3TDU C;  1BIA A;  1W7P B;  2O7O A;  1OR7 A;  2KIF A;  3E5U A;  3HRU A;  2KQR A;  4RM2 A;  3BLY A;  4CZZ A;  2VL8 A;  1TNT A;  1FIA A;  5F1R A;  2Y31 A;  4I0A A;  3ZOB A;  2CV0 A;  1R4N B;  1MDM B;  1VQM I;  1Y8Q B;  1P4A A;  2DOA A;  2UXX A;  9ANT A;  1YJW I;  1D1C A;  1V4R A;  2AS5 F;  4BHP A;  3FK6 A;  2UZK A;  2VOO A;  5FRN A;  4U7D A;  1IJW C;  2YS9 A;  2M2E A;  5FGM A;  5FD6 A;  3BOQ A;  1GV2 A;  1I39 A;  3DP7 A;  5KAI C;  2L0K A;  3NWT A;  1R49 A;  1HW2 A;  5L3C A;  1PDN C;  3M7G A;  1C0W A;  3QPT A;  4LIT A;  4RA2 A;  2FRH A;  2JA8 J;  2R7X A;  3PO3 J;  2ECB A;  2DFF A;  4LK0 F;  2BXZ A;  3HOS A;  4BXX J;  3PNT A;  3KYL A;  5ERI A;  4B1R A;  3OMY A;  3BR3 A;  1DU0 A;  2EK5 A;  3HBL A;  1JXS A;  4YFN F;  3C3W A;  2X4H A;  1YX5 A;  2EZH A;  3CF2 A;  2LRD A;  1IF1 A;  4UNO A;  4IHS A;  4P5O A;  1TNS A;  4BH9 A;  3GTM J;  2Z33 A;  3GFJ A;  2RAE A;  4BXF A;  5ICG A;  5HS9 A;  3W3C A;  2FUG 2;  4NC7 A;  1REP C;  4WK8 F;  4LLG F;  4I76 A;  3M07 A;  4EEF G;  2KHM A;  1YS7 A;  3HB9 A;  3TQN A;  1LFB A;  1T6S A;  4EJT A;  4Q47 A;  3VDX A;  2HYG D;  4XLP F;  3JRH A;  2IAI A;  3GTK J;  2KFD A;  3ZMV A;  1TZL A;  5B1B H;  4EAT A;  4CHU A;  2E35 A;  1HW1 A;  2ZO4 A;  4GCV A;  4OIN F;  5GTH C;  5IYC J;  3ZQG A;  2EZI A;  4BE2 A;  3S2D J;  4R8H A;  3P5J A;  4CYC A;  3OYF A;  1P7I A;  1WJF A;  1U9O A;  2ID6 A;  1DP3 A;  2QQB A;  1JTY A;  5H6Q A;  3KEO A;  2XAF A;  1WZ2 A;  2OCC H;  2ZME B;  4HZF A;  4ZYA A;  4ETS A;  3MN2 A;  4IF4 A;  3KP3 A;  4IKF A;  3DEE A;  3VPR A;  3S16 J;  4YEL A;  4PK4 A;  3CP8 A;  2LBF B;  5DTD A;  1N78 A;  3HIF A;  2O3F A;  3OIQ A;  3RCO A;  1S72 I;  2BV6 A;  2EFO A;  2IJL A;  2PMU A;  1U6G A;  4BAY A;  1IDZ A;  3FK7 A;  2VBX A;  2GZW A;  3OR1 C;  4KIT B;  1UG0 A;  3OSF A;  3PSI A;  3CJR B;  1R00 A;  2M4K A;  1D0Z A;  1MW7 A;  3HKZ A;  1SVO A;  2O8X A;  4ANJ A;  2Y0S N;  5CLS A;  3M9A A;  4N9I A;  5FD5 A;  2UV1 A;  3FMS A;  1LJ9 A;  2DA5 A;  1MMG A;  4ZJZ A;  4KIG A;  2LSO A;  1PJR A;  2WC2 A;  4FHT A;  2HXI A;  3FXK A;  1LVK A;  1R1U A;  4HSR A;  2A6T A;  4QWQ A;  2QEX I;  4AIK A;  1K4T A;  2STW A;  2WY7 Q;  1U8B A;  3GLL A;  1ZLJ A;  2ZB9 A;  3PIO F;  1W5T A;  1NG7 A;  3MZY A;  1BR1 A;  5C3E J;  1PUF B;  4RGX A;  3M1E A;  3AG3 H;  3KP2 A;  3DKY A;  4BJ6 C;  2R7W A;  3HRT A;  1Y1V J;  2GBY A;  4YIR X;  4EJU A;  4PJL A;  1VTN C;  2OQG A;  3ASO H;  1RR8 C;  3V7S A;  1OPC A;  1FYM A;  3RYR A;  2F48 A;  4WF2 A;  2FSW A;  5FKN A;  2IRF G;  1UHW A;  4ZZL A;  1QVT A;  3KX2 A;  1QVU A;  3FHN A;  3IHU A;  1K6Y A;  2FE3 A;  3CLO A;  4B48 A;  4F52 A;  5LHG A;  4BGD A;  1R23 A;  5CVR A;  2MD5 A;  3GW2 A;  1KU9 A;  5IT3 A;  1JHH A;  4Y15 A;  1MBE A;  5J1R A;  2K7L A;  2QSH X;  5IYB J;  5EGO A;  2FX0 A;  4W1U A;  4TV7 A;  2P8T A;  3QYE A;  1XSX A;  4IRH A;  2HTJ A;  1T0F A;  4BQA A;  1X1A A;  2RQQ A;  1MSF C;  3HYI A;  3CCQ I;  1ZG5 A;  3FXM A;  2IGK A;  4M3F A;  4XRF A;  2X6O A;  2E1O A;  3HTU A;  3ECH A;  4XSX F;  3SDB A;  3E6M A;  4MEY F;  4DYQ A;  1PVE A;  5HOD A;  2R7V A;  4H0E A;  3HDD A;  1GLN A;  1F1Z A;  2FOW A;  4WXC A;  2DMP A;  3VSL A;  2ECC A;  3CD6 I;  5K5Q A;  5BMZ A;  3I4M J;  3AG1 H;  2YU3 A;  2JMW A;  3BJO A;  2XF7 A;  4LB5 A;  1GV5 A;  2BY3 A;  5FLX Z;  2W48 A;  4D1Q A;  5HLI A;  5EEA A;  2VBY A;  3F8M A;  3E5Q A;  3A2K A;  1ETW A;  1VQ9 I;  3BC8 A;  1A04 A;  1W0T A;  3ZQH A;  3CCU I;  4XL9 A;  4P1W A;  2VQG A;  3WTV C;  1MNE A;  1XMA A;  2LR8 A;  2JPC A;  4E7S A;  2BY0 A;  4X0G A;  2W1O A;  3GFM A;  2FBH A;  2F4O B;  1TWA J;  2OTJ I;  2VT2 A;  3ABT A;  2X1C A;  4CA0 A;  3WHC A;  1G3S A;  3VYS B;  3Q3S A;  3CC7 I;  3U21 A;  2X51 A;  3GCM A;  1I27 A;  3QYF A;  1W5C C;  4DZJ A;  1VQK I;  1I6H J;  1I1S A;  1A36 A;  1FC3 A;  4OIR F;  4YG2 F;  3OIP A;  4BE1 A;  2F4M B;  2X0L A;  3MCZ A;  1B9N A;  2NVU B;  2QBY B;  1WQ2 A;  2CMP A;  2MH2 A;  2Q1Z B;  1XD7 A;  2XRO A;  1O57 A;  2FBK A;  2MC3 A;  1Z77 A;  2R7S A;  2VB6 A;  1P7J A;  2DDB A;  2HKX A;  4J19 A;  2H09 A;  4CYC B;  2BY2 A;  3H35 A;  4IOC F;  3I54 A;  4IZZ A;  5DCM B;  1TP4 A;  4OU0 A;  2DN0 A;  3S1N J;  2CU7 A;  3LSM A;  1YRN A;  1H8A C;  1JE8 A;  1QGP A;  1T8I A;  2CWE A;  5BOX A;  3S3N A;  3L9F A;  1FBS A;  2G7U A;  2XAS A;  3BTC A;  4OIO F;  5EZH A;  2ADU A;  1GVJ A;  3LOC A;  4HRI A;  5EEG A;  1P2F A;  2C6Y A;  3HC7 A;  1ZKG A;  2DK8 A;  2QSG X;  3DF8 A;  4UUT A;  1YOV B;  4FAS D;  1K79 A;  2NYX A;  3QQA A;  2NVT J;  2VQC A;  2V4J C;  2PQ8 A;  2NVX J;  1ZAO A;  2X85 A;  1H9T A;  1IXS B;  2EQR A;  4WX9 A;  1X3Z B;  3V8J A;  3ZN1 A;  3OL3 A;  4KMF A;  3DPL C;  1W7P D;  3E97 A;  4OIP F;  4HF1 A;  2HOT A;  3MKW B;  2TCT A;  3UNG C;  2ZKZ A;  2EFW A;  5F64 A;  3DCF A;  2PJR A;  1NG6 A;  3L09 A;  4C3H J;  2XAG A;  3I71 A;  2DT7 B;  2V1U A;  4JP0 A;  2ELK A;  2ZXH A;  3FM3 A;  5F6F A;  5FKM A;  1MGT A;  2H6B A;  2OZ6 A;  4HV5 A;  4HF2 A;  4BDY A;  3ML6 A;  1J75 A;  4G7H F;  3VSK A;  3DLA A;  3S3O A;  3GUD A;  3TED A;  1EJ9 A;  1TW3 A;  4MIM A;  3ZMZ A;  3J7A O;  1ENH A;  3KCC A;  4DW6 A;  3LFK A;  2NXN B;  2LOO A;  3IAM 2;  5EG0 B;  5C4J J;  2QLZ A;  5EEH A;  3WTZ A;  3GTJ J;  3K6G A;  3IWF A;  3HHH A;  2RNJ A;  5CYV A;  3S1M J;  3Q9S A;  2XC7 A;  2WBM A;  3AG2 H;  2DOF A;  2KRC A;  3KP5 A;  1ZHF A;  2JVH A;  3OYG A;  4A3C J;  1DGR M;  2OV7 A;  1J59 A;  3FMQ A;  2K9N A;  3C7J A;  1FOY A;  5L3F A;  1NK3 P;  1YS6 A;  1LNW A;  4QIW N;  3HXL A;  2EZK A;  3O2P E;  2FQ4 A;  3BG6 A;  1IUF A;  5J1U A;  1YW9 A;  3GTQ J;  1Y6I A;  3S93 A;  4I0B A;  1H88 C;  1GXQ A;  2LKP A;  2DTR A;  4PSW A;  1Z7L A;  2HYJ A;  3TMO A;  4Z6Y A;  5D4R A;  4XR6 A;  4N0B A;  4LOC A;  2DT5 A;  5F1J A;  1BI1 A;  2DDA A;  3MMY B;  3D1N I;  3Q9V A;  1ETY A;  2DA7 A;  5L3D A;  1YO5 C;  2LC2 A;  1EH8 A;  3QOE A;  4IQ4 A;  2GM4 A;  3KIO A;  3F21 A;  4MEX F;  4EM2 A;  4KYW A;  3KLO A;  2QF7 A;  4B8X A;  4OAZ A;  3S14 J;  2V1D A;  4NC6 A;  5J8F A;  1O3T A;  1LPQ A;  1JGS A;  3NQO A;  3L2V A;  2QKM B;  4RGU A;  3R0A A;  1FEX A;  4C3J J;  4G12 A;  2RGV A;  3BWG A;  2K40 A;  2EPF A;  2W4S A;  4HX7 A;  3NWS A;  4AIH A;  1H89 C;  1BR4 A;  1E2X A;  3TW6 A;  1YG2 A;  1NH3 A;  1B9M A;  2JWT A;  3CCV I;  3QPH A;  4DBQ A;  3AL0 B;  1B4A A;  1TWF J;  5E1X A;  2HDD A;  2BBY A;  2RDP A;  1GXP A;  5FLV A;  4ZYD A;  3F3X A;  4IRI A;  1QHH D;  1JUS A;  2FXA A;  3AKZ A;  3I9V 2;  1U3E M;  2TRT A;  2HVQ A;  1K78 A;  3HPH A;  3NEU A;  5J4V A;  4L9J A;  3J7A Y;  1XCV A;  2J5P A;  2HS5 A;  2VJJ A;  2KRF A;  3LNQ A;  3M8E A;  2DFH A;  3C18 A;  2F6C A;  1AWC A;  2A3S A;  5HVQ C;  1DGW Y;  2DBB A;  4HF0 A;  3ZQI A;  2BGC A;  4ENJ A;  2R5Z B;  4G7Z F;  2QCO A;  5DCF A;  4S0H B;  5LRS A;  2OZU A;  1FP1 D;  4Y3O A;  4CCM A;  3I56 I;  4BY7 J;  2CQ7 A;  1QPI A;  1I3Q J;  4CZC A;  1MH3 A;  2LY1 A;  1DQU A;  2HKO A;  2L3D A;  3IWZ A;  4CDG A;  4HW0 A;  2L9N A;  4E7I A;  2HR3 A;  3KZY A;  2Z9O A;  2H27 A;  2BEO A;  5J1Y A;  4A3G J;  1S7O A;  2Q2E A;  2R7Z J;  2KIU A;  3FMR A;  2DOE A;  3MEX A;  3K1P A;  2WWY A;  4XKV A;  5L3B A;  4CH7 A;  2IGM A;  1OKR A;  1UAA A;  1K4S A;  3CUQ A;  1F36 A;  3HPG A;  4Z2Y A;  2PJR B;  2FQ3 A;  3IL2 A;  2GXA A;  5ILS A;  1LKX A;  2LTP A;  3LSG A;  5IYD J;  4J00 A;  4Q4Z F;  2P5L C;  4KN7 X;  5HDK A;  2Y30 A;  4HNV A;  4F91 B;  5IP7 J;  2AQF A;  4A0X A;  4IHY A;  1HDP A;  1BI3 A;  1XDS A;  2QWW A;  4MO7 A;  3L7W A;  2IS4 A;  2E1M B;  1ETK A;  3PQJ A;  4IHW A;  4XLA A;  4MTE A;  2XSD C;  3JTG A;  3HZJ A;  2WB1 A;  4M6V A;  2XV4 S;  3H5R A;  3HSF A;  5ILV A;  1T2K A;  4CO8 A;  2JN6 A;  4UB8 C;  4G7O F;  1XMK A;  3PUF A;  1R5G A;  5D4S A;  3MZ8 A;  4A0Z A;  1ETO A;  2TDX A;  1SD4 A;  2D1H A;  3PO2 J;  2KIS A;  3LA2 A;  1BJZ A;  2WAF A;  1MJ9 A;  2PBI A;  5B1A H;  1SAN A;  2ISZ A;  2K85 A;  3A1Y A;  4M3E A;  1YW8 A;  2OA4 A;  4IJA A;  5L3E A;  1VQO I;  2R7R A;  2DFE A;  1R36 A;  4HQE A;  3GZ6 A;  3U2R A;  3JRD A;  1S8N A;  3KEQ A;  2A07 F;  4I2O A;  3HL2 A;  2DMN A;  3CCM I;  4PGH A;  1BM9 A;  1FY7 A;  1D0X A;  1ZLK A;  2R7O A;  2I8D A;  4IPA A;  3RKW A;  2GXB A;  3OYD A;  1XCB A;  3H9J A;  5EG0 A;  5FB2 A;  2ZXI A;  5B3S H;  5EZG A;  4DOZ A;  2OD5 A;  2IA1 A;  2ESN A;  3F8N A;  4JYK A;  4R1H A;  4YFK F;  1BW6 A;  4O3M A;  3WG9 A;  4XQF A;  5M5X J;  5HLH A;  4BE0 A;  3HOV J;  3VOE A;  4IXA A;  2KPM A;  1VQ8 I;  5A2Q K;  5EF6 A;  1Y39 A;  1WJ5 A;  2X6W A;  2JRT A;  5J8C A;  2GAU A;  2STT A;  1LDD A;  3D5S C;  2E5Z A;  4AYB N;  1BOA A;  1E3P A;  2VKE A;  4LIV A;  1F4K A;  1DPR A;  1R6R A;  1P92 A;  4MQ9 F;  1ZQ3 P;  4Y33 A;  3TKY A;  1SFU A;  1W1W E;  5DDG A;  3OS0 A;  1J9I A;  4M6Y A;  2DJI A;  5JLX A;  1T0F C;  2DW4 A;  1KYW A;  2QYO A;  4DYR A;  5M5Y J;  4G94 A;  2PN6 A;  3DWL E;  4HNT A;  1D1B A;  3A02 A;  3PFY A;  5FFZ A;  3WOD F;  3U9G A;  2B63 J;  2BVL A;  3PL8 A;  4I01 A;  4P9F A;  3OYB A;  4X1E A;  3G2B A;  4PGG A;  4M3G A;  4BDZ A;  2J5O A;  4E6K G;  1QA6 A;  4HQM A;  3E3V A;  1ACI A;  1IC8 A;  2W85 A;  3EQL F;  2Z2S B;  4ZDL A;  3CC4 I;  2L9V A;  3JRG A;  3FKI J;  4L9V A;  3K4J A;  4KN4 X;  1DU6 A;  1D3Y A;  3S3M A;  3ELK A;  1TL8 A;  5DUI A;  3V42 A;  1JKP C;  2QKL B;  4I02 A;  1TQI A;  5GTI C;  1S6L A;  4CYD A;  1MBG A;  3JW4 A;  3GFL A;  4NHJ A;  4EQQ A;  1BL0 A;  5C4X J;  1BOB A;  1TT5 B;  1E3O C;  3CDL A;  4EJO A;  4L9N A;  3FXO A;  1MD0 A;  5LD2 C;  3F6O A;  1WRJ A;  2XHK A;  1Y56 A;  3R4K A;  1LUJ B;  4HYE A;  2BZT A;  3Q0V A;  4E7H A;  5H20 A;  4FX0 A;  2W7N A;  2A05 A;  4NNJ A;  1BW5 A;  2JQ7 A;  3GTO J;  4IX7 A;  2MYS A;  1AHD P;  3C2G A;  5JHU A;  3H5N A;  5TRD A;  3P9C A;  4DIQ A;  1G59 A;  6PAX A;  3T0Y A;  3S17 J;  1QBJ A;  2F5F A;  3AG4 H;  4LLL A;  3TL4 X;  1N25 A;  4XLF A;  2R7T A;  1OCO H;  2D1V A;  5JFR A;  2BXY A;  1CF7 A;  4HNU A;  3H0G J;  3R61 A;  5KK1 A;  3FXU A;  1S7A A;  2M8G X;  1IAW A;  4BS9 A;  4L0Z B;  2VKH A;  4X6A J;  4I09 A;  3OOU A;  3V7C A;  1FTT A;  2FD5 A;  1X58 A;  5AON A;  2AXL A;  4JOM A;  1R22 A;  4IL6 C;  3BTI A;  4C2M J;  1O3S A;  3I59 B;  2R3S A;  5DYM A;  1U8R A;  4Y7N J;  5F0F A;  1X19 A;  2F5D A;  2I10 A;  4RGR A;  3PM1 A;  3E1S A;  5F04 A;  5K5R A;  2LD5 A;  1RI7 A;  1ZYR F;  1X4P A;  2HFH A;  4MQV A;  1IN7 A;  1HST A;  4ESB A;  5M3F J;  4AVZ A;  3FBN B;  4BHB A;  1FJL A;  3D5R C;  2CFO A;  3ONQ A;  3ZPL A;  3CJQ B;  3I4P A;  4AD9 A;  1OIS A;  2MA3 A;  1KQ0 A;  1OR7 C;  3GVA A;  5H6R A;  4OWR B;  3M3Y J;  3SQN A;  1BJA A;  2VJI A;  3VYT B;  2MLG A;  2V9P A;  4P96 A;  3HHG A;  1ZGA A;  1DP7 P;  3OWT A;  5KAF C;  2KLO A;  2D45 A;  1VFC A;  2Y48 A;  2L5Q A;  1IXC A;  2VE8 A;  2VXZ A;  1HQC A;  3MFK A;  1WI3 A;  1XSV A;  4M74 A;  1W36 D;  5IP6 A;  3ZGK A;  1MZB A;  2LKX A;  1H0M A;  2K27 A;  2EBI A;  5CQE A;  1T39 A;  3G3Z A;  2LG4 A;  3VYU B;  3WTS C;  2MLK A;  3G6E I;  3ZP5 A;  2IS6 A;  1U9N A;  4HOB A;  1V54 H;  1ODD A;  2L4A A;  2M7B A;  4UB6 C;  4HBL A;  3G1O A;  1KQ9 A;  1AU7 A;  4LG0 B;  4PFO A;  2K4J A;  1NK2 P;  1V5G A;  2O8K A;  3CCE I;  1TTY A;  2DPD A;  1VZ0 A;  2DCE A;  2M1B A;  4F93 B;  1FNN A;  3WGI A;  2EV6 A;  1RR7 A;  3ABU A;  3BJ6 A;  3I53 A;  1WI9 A;  1ZGJ A;  1V5E A;  2LYC A;  4XON A;  1VQ6 I;  4XOT A;  1N75 A;  2V9V A;  2EIJ H;  4XN3 A;  2PEX A;  3W6V A;  2MG4 A;  1FPQ A;  4XLC A;  1RUN A;  1EA3 A;  1QZY A;  1SFK A;  1ZEL A;  5DUK A;  3KP6 A;  1UCR A;  4AM3 A;  1ERD A;  4XOP A;  2HOA A;  1P4W A;  5J40 A;  1HC8 A;  1Z6T A;  1GDT A;  1D8K A;  3TOB A;  2NOG A;  5HNF A;  2DT6 A;  2JK3 A;  3T1B A;  3BP8 A;  5EYR A;  1H9G A;  1ORK A;  2DLL A;  3I3L A;  3EYI A;  4FCY A;  2K3P A;  3IUO A;  1X3U A;  3E7L A;  5DEQ A;  1X2M A;  4DNC A;  2UUZ A;  3WHB A;  3NAU A;  3TGN A;  1TQM A;  1A6Q A;  3AL0 C;  1XB4 A;  1ZN2 A;  3GZN B;  2DA3 A;  3H3Z A;  5BPI A;  2XAH A;  3JRA A;  4FE7 A;  5J3L A;  2XPW A;  5HLT A;  1JI8 A;  4M9Z A;  4N9H A;  2VBZ A;  3RQI A;  3TBI A;  3BZK A;  1Z9C A;  1IN8 A;  2W00 A;  3PNY A;  4CIC A;  1X1D A;  4I7H A;  1X1B A;  3MQ0 A;  2R5Z A;  3ZQ7 A;  2QUF A;  1IUY A;  2MD0 A;  2XKO A;  1SC7 A;  1B59 A; 
#chains in the Genus database with same CATH homology
 4XRS G;  3ZQC A;  4MIM A;  1ZTR A;  2AO9 A;  2NS8 A;  3BQY A;  4FIS A;  1ENH A;  3LSR A;  1A5J A;  2X48 A;  4DW6 A;  5EG0 B;  5C4J J;  3GTJ J;  3GBG A;  2JA6 J;  3S1M J;  1XC5 A;  3SJM A;  2IBD A;  3JRF A;  1NTC A;  2HOS A;  1MH4 A;  2R5Y A;  1B72 A;  1MBK A;  4UUS B;  3QPL A;  3A01 B;  1PUF B;  4A3C J;  3JR9 A;  5K7Z A;  1Q1V A;  2K9N A;  3BG5 A;  1NK3 P;  4QIW N;  2EZK A;  1D5Y A;  2FQ4 A;  5J1U A;  1IUF A;  3IV5 A;  3JRC A;  3GTQ J;  1H88 C;  4V2G A;  2HYJ A;  2Y9Y A;  2Y9Z A;  2O9L A;  1GT0 C;  5F1J A;  4LOC A;  1OCT C;  1RET A;  1ITY A;  1JJ8 C;  3D1N I;  2XPU A;  2HXO A;  1ETY A;  2DA7 A;  4BKX A;  2OPT A;  2DA2 A;  2GM4 A;  1WGX A;  1LFU P;  2QF7 A;  5FJ8 J;  2K9Q A;  1ETX A;  3S14 J;  3RKQ A;  4FE4 A;  5FKL A;  1IDY A;  3A03 A;  3HOZ J;  1FEX A;  4C3J J;  4G12 A;  1YRN B;  1Z0X A;  3CMY A;  4M3B A;  2K40 A;  2LLK A;  3OSG A;  3GTG J;  2DTZ A;  2N8G A;  1H89 C;  3TW6 A;  2XGD A;  3HKZ N;  1IG7 A;  2JWT A;  3Q0U A;  4BY1 J;  1TWF J;  1TWH J;  4D5F A;  2HDD A;  2LFB A;  1B72 B;  3SFI A;  4M3D A;  5FLV A;  1JTX A;  2X9D A;  2FJ1 A;  4DYC A;  1MSE C;  1JUS A;  2CQQ A;  2TRT A;  5DS9 A;  3BR0 A;  2DA1 A;  5IOZ A;  2EH3 A;  4QTR A;  3BG9 A;  4FTH A;  3S1R J;  4JX4 A;  1B8I B;  3UKG A;  3LNQ A;  1JUM A;  3JRB A;  3BR1 A;  4AC0 A;  5M5W J;  2DMQ A;  3B6A A;  1R9T J;  2MSY A;  1BA5 A;  1XG1 A;  3ZQI A;  2XGE A;  2R5Z B;  2ME6 A;  2XB5 A;  2QCO A;  4S0H B;  4XRM A;  3BR6 A;  1TWC J;  1JGG A;  3IH2 A;  5GPA A;  1F43 A;  3BR2 A;  4BY7 J;  3HEF A;  1RES A;  3HGY A;  1I3Q J;  3QPS A;  2NVY J;  1QPI A;  1MH3 A;  2H8R A;  2LVS A;  1HF0 A;  4GFB A;  1WCM J;  4A3D J;  4A3M J;  2DMU A;  1UMQ A;  1FTZ A;  5J1Y A;  4A3G J;  1UHS A;  5F27 A;  2R7Z J;  2CJJ A;  2CUE A;  2MGQ A;  1JKO C;  4XRS A;  4A69 C;  1F36 A;  1MBJ A;  2DA4 A;  2H1K A;  1B8I A;  4A3E J;  2LP0 A;  3FIS A;  2LTP A;  3LSG A;  4RBO A;  3O8H A;  2O7O A;  1U78 A;  1GUU A;  5IYD J;  4XK4 A;  2M34 A;  2ID3 A;  2Y30 A;  1ETQ A;  4HNV A;  1FIA A;  5IP7 J;  2Y31 A;  4MFD A;  3ZOB A;  4IHY A;  1HDP A;  2CRG A;  9ANT A;  4MO7 A;  2JJ7 A;  3FK6 A;  1ETK A;  4IHW A;  2XSD C;  1VF9 A;  2YS9 A;  2M2E A;  1IJW C;  4M6V A;  1GV2 A;  4A3L J;  2L0K A;  3FIW A;  2JN6 A;  4JX6 A;  2ME0 A;  2DJN A;  2R93 J;  3IH3 A;  3BTL A;  5IPA A;  2XB0 X;  2M9H A;  1ETO A;  2VPR A;  3PO2 J;  2JA8 J;  2GLO A;  4A3K J;  3PO3 J;  2ECB A;  1BJZ A;  1JUP A;  4BXX J;  4RDU A;  1SAN A;  3BQZ A;  4B1R A;  4M3E A;  3BR3 A;  3SDG A;  1DU0 A;  3HBL A;  4I6Z A;  4D7N A;  3NAR A;  1TC3 C;  2EZH A;  3JRD A;  2EZL A;  2DMN A;  3S1Q J;  3JRE A;  3GTM J;  4BBR J;  1SFO J;  2RAE A;  1MBF A;  4I76 A;  5EG0 A;  3CQZ J;  4EEF G;  2L9R A;  3HB9 A;  5EZG A;  1LFB A;  4JYK A;  2IEK A;  1BW6 A;  3JRH A;  5M5X J;  3HOV J;  4A3F J;  2IAI A;  3GTK J;  4L5E A;  4XIC A;  1HCR A;  5FKK A;  3HOU J;  4UUS A;  3A01 A;  5EF6 A;  3LSP A;  1HOM A;  5IYC J;  3F0C A;  2M0C A;  3ZQG A;  4AYB N;  1OCP A;  3MKL A;  2EZI A;  2VKE A;  1JKQ C;  3S2D J;  4CYC A;  1P7I A;  1U9O A;  2ID6 A;  1ZQ3 P;  1JTY A;  1WH7 A;  2HQ5 A;  2COB A;  3B6C A;  4D7M A;  5K7H A;  4IEJ A;  1IRZ A;  5FLM J;  1FIP A;  3MN2 A;  1IV6 A;  3VPR A;  3OIO A;  3S16 J;  5JLX A;  3S15 J;  5DTD A;  4DYR A;  2E2H J;  3BT9 A;  5IP9 J;  5M5Y J;  1IDZ A;  3FK7 A;  1ZK8 A;  3A02 A;  2JA7 J;  4IHV A;  4XID A;  3OSF A;  1ZGW A;  2B63 J;  1HLV A;  2Y0S N;  4X1E A;  4M3G A;  4MLO A;  1RKT A;  2DA5 A;  1X2N A;  2XGC A;  1IC8 A;  2CQX A;  1G2H A;  5F08 A;  4ABZ A;  2HXI A;  3FKI J;  3JRG A;  3HGG A;  2D5V A;  5EDN A;  1DU6 A;  2E2J J;  1U8B A;  1JKP C;  2ZB9 A;  1CQT A;  1IGN A;  1MBG A;  5C3E J;  1BL0 A;  5C4X J;  3M4O J;  1E3O C;  3CDL A;  1ZR2 A;  1Y1V J;  2DA6 A;  1O4X A;  2NVQ J;  2GBY A;  5BNG A;  3Q0W A;  1QRY A;  2YUS A;  5C44 J;  3Q0V A;  3ZQF A;  5K7F A;  1BW5 A;  1GVD A;  5FKO A;  5GP9 A;  3GTO J;  1AHD P;  1APL C;  5E3M A;  5FKN A;  2LK2 A;  4IHX A;  3BG3 A;  3GTL J;  1QVT A;  3S17 J;  3K2A A;  1WH5 A;  1UG2 A;  1QVU A;  3HOW J;  5EGO B;  1S7E A;  2NS7 A;  1TWG J;  2HI3 A;  4D5C A;  2P81 A;  3RZO J;  3H0G J;  1MBE A;  5J1R A;  5IYB J;  5EGO A;  2FX0 A;  1VI0 A;  2M8G X;  4W1U A;  4X6A J;  4W97 A;  2K9S A;  2CUF A;  1MNM C;  3OOU A;  1Y1W J;  1FTT A;  4B3A A;  2FD5 A;  1X58 A;  1MSF C;  3BTI A;  4V2F A;  4C2M J;  1XS9 A;  5JLW A;  2R0Q C;  1K61 A;  4M3F A;  4Y7N J;  2X6O A;  1K83 J;  2E1O A;  5F0F A;  4C3I J;  2I10 A;  3TW7 A;  4DYQ A;  1LE8 A;  3PM1 A;  5HOD A;  5F04 A;  2LD5 A;  5F0C A;  3HDD A;  2DMP A;  2ECC A;  5M3F J;  3I4M J;  3G1M A;  1FJL A;  1T56 A;  2JMW A;  2WB1 N;  1VND A;  1GV5 A;  2JA5 J;  2R5Y B;  2WAQ N;  2KDZ A;  3H3V K;  2W48 A;  5EEA A;  4BBS J;  1LE8 B;  3M3Y J;  1ETW A;  1W0T A;  3ZQH A;  2KT0 A;  5E3O A;  2R92 J;  4QSH A;  2LR8 A;  4NDL A;  3I4N J;  1VFC A;  5F0H A;  2L7F P;  1TWA J;  1OFC X;  2OF7 A;  2VI6 A;  3L1P A;  3WHC A;  3Q3S A;  1ZR4 A;  1WI3 A;  1HDD C;  5IP6 A;  1PUF A;  3JRI A;  2LKX A;  1WPK A;  5E3L A;  4DZJ A;  4A93 J;  4A3B J;  2EBI A;  3TP0 A;  1I6H J;  1I50 J;  3BTJ A;  1JT6 A;  3S2H J;  3BR5 A;  1U9N A;  3HOY J;  1AKH A;  3G1O A;  1POG A;  1AU7 A;  5IOY A;  1NK2 P;  2L7Z A;  2G0E A;  3C2B A;  2O8K A;  1Z77 A;  1P7J A;  3O8G A;  4J19 A;  1MBH A;  4CYC B;  4JX5 A;  1RR7 A;  3RZD J;  2PMZ N;  4MFE A;  2AHQ A;  1T33 A;  2CU7 A;  2DN0 A;  3S1N J;  1YRN A;  1H8A C;  1OJL A;  1A6I A;  3W6V A;  3LSJ A;  2L7M P;  2MG4 A;  3ZQL A;  1EF4 A;  3BTC A;  3G1L A;  2YU9 J;  3CCY A;  5EZH A;  2E19 A;  2XPV A;  3LOC A;  2VKV A;  3DEW A;  5M3M J;  1W0U A;  2HOA A;  1ZKG A;  4AUX A;  2Y2Z A;  4UUT A;  1GDT A;  1ETV A;  3QQA A;  2NOG A;  2E2I J;  2NVT J;  2JK3 A;  5EYR A;  2NVX J;  1ORK A;  4B4C A;  4FCY A;  3E7L A;  1X2M A;  1JKR C;  2EQR A;  3HM5 A;  3WHB A;  4A3I J;  3NAU A;  2XRL A;  2DA3 A;  3JRA A;  2HOT A;  4FE7 A;  2TCT A;  2XPW A;  5J3L A;  1JT0 A;  3DCF A;  3TP3 A;  2VUM J;  1JJ6 C;  1AKH B;  4C3H J;  3GTP J;  3RQI A;  4DZP A;  4JP0 A;  2ELK A;  3MVP A;  3HOX J;  2WV1 A;  5FKM A;  4Y52 J;  1RPW A;  2R5Z A;  1RKW A;  5E3N A;  3IH4 A;  2LY9 A;  3K7A J;  2MW8 A;  2DMT A;  4A3J J;  5GPC A;  3TED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...