4A69C

Structure of hdac3 bound to corepressor and inositol tetraphosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
KFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Hdac3 Bound to Co-Repressor and Inositol Tetraphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords HISTONE DEACETYLASE 3,
total genus 19
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a69C00
1JTXA 5GP9A 1IG7A 4A3IJ 2B63J 3A02A 2P81A 4MFEA 1VNDA 5J1YA 2HOSA 1IDZA 4LOCA 1VFCA 4MLOA 1Z77A 4M3FA 4JYKA 1UMQA 1MBGA 1RESA 2MG4A 5JLXA 5DTDA 1OFCX 5IP9J 1XC5A 1RETA 3HEFA 2XPVA 1X2NA 2YU9J 2E2IJ 2HXOA 4XRSA 2JWTA 3G1OA 3DCFA 5IYBJ 3CQZJ 2R0QC 4A3MJ 5F27A 4J19A 1MBKA 5FKLA 4A3EJ 3BG5A 2FD5A 3OSFA 4C3JJ 4XRMA 4M3BA 4DZPA 2ECCA 3HBLA 3GTPJ 4V2GA 3UKGA 1H89C 1DU6A 3HDDA 5FKOA 5E3NA 1B8IB 2DJNA 4A3GJ 1F36A 3ZQCA 3HOVJ 4UUSB 3I4NJ 1U78A 3K2AA 2HYJA 2NOGA 3SFIA 1SFOJ 1MSEC 1TWHJ 2HI3A 1E3OC 2VKEA 1K83J 5M3FJ 1JKPC 1MBHA 5EG0A 4NDLA 4XIDA 1GV2A 1MBEA 2LK2A 1F43A 5K7ZA 4FTHA 3S14J 4Y52J 4FCYA 1IGNA 2E2JJ 5EZHA 3BTCA 3HGGA 1JJ6C 3Q0WA 3JREA 4A3KJ 2VKVA 1GDTA 3BR2A 2M0CA 2EZHA 1U8BA 1ZQ3P 1GV5A 2M34A 2VPRA 2LFBA 3JR9A 5C44J 3F0CA 2YUSA 3RQIA 4C3IJ 2Y0SN 3S1NJ 3O8GA 1TWGJ 5EGOB 2G0EA 1MH3A 2M8GX 4IHVA 4DYCA 2HOAA 3VPRA 1FTZA 3JRIA 3JRBA 1QRYA 5FKKA 3PO3J 1RKWA 1ZKGA 2W48A 1HCRA 4A3JJ 1FIAA 5GPCA 4D5FA 1LE8A 1IRZA 1B72A 3H0GJ 1IJWC 1VI0A 2ZB9A 4C2MJ 2CQQA 1TWCJ 4GFBA 2IEKA 3HOZJ 2HXIA 3IV5A 3BR5A 1TWAJ 2E2HJ 1ETQA 1P7IA 1Y1VJ 2TRTA 4IHYA 5F0CA 1NK3P 3FK6A 3PO2J 2XPWA 4JX4A 5EZGA 3HGYA 4DYQA 1AKHB 3HOUJ 2R5ZA 3LNQA 3JRCA 1ZR4A 1K61A 1DU0A 2X48A 3JRHA 4V2FA 1G2HA 1HDPA 3L1PA 2WV1A 2DMTA 3BR3A 2KDZA 3QPSA 4HNVA 4QTRA 4MO7A 3LSPA 5C4JJ 4M3EA 1JKOC 3G1MA 4FE4A 3S2HJ 4DZJA 3RZOJ 2HQ5A 2IAIA 4UUTA 2N8GA 4G12A 1XS9A 5F1JA 4QSHA 2PMZN 1I3QJ 2XGDA 2CUEA 3MVPA 2JA7J 2NVQJ 4A3DJ 3ZQFA 2M9HA 1JKQC 5EYRA 1WH7A 2DA3A 3GTJJ 2JA8J 5DS9A 2L7ZA 4W1UA 1BJZA 3LSRA 4M6VA 4JX6A 2GBYA 4M3GA 2Y9YA 3CMYA 5EG0B 2HDDA 1HOMA 5FKNA 2DA2A 1P7JA 2DMPA 3NAUA 4W97A 4X6AJ 2QCOA 2CU7A 1QPIA 1A6IA 4XICA 2M2EA 3ZQGA 4DYRA 1BA5A 2O8KA 2L7MP 1JT0A 1IV6A 3HOWJ 3D1NI 3FISA 5JLWA 3BTLA 1JUMA 2ID3A 2AO9A 2JA5J 1FEXA 1JTYA 1U9OA 2GM4A 1T33A 5GPAA 2FX0A 3TP0A 1OCPA 5E3MA 2R92J 2MW8A 1NK2P 4BBRJ 3S1RJ 3IH3A 1QVUA 3WHBA 3CCYA 3JRAA 2MGQA 3S15J 5M5WJ 3C2BA 4I76A 2DA4A 3ZQHA 1RR7A 2XRLA 5M5XJ 3G1LA 3GTQJ 4A3LJ 2R5YB 2HOTA 2DMNA 5FKMA 1HF0A 1A5JA 3QPLA 2NS7A 3BTJA 1T56A 5EF6A 4B3AA 3A01B 5FJ8J 5F04A 1ENHA 1ETOA 3DEWA 2JA6J 1Z0XA 2EZKA 2EZLA 1ETXA 3FKIJ 1GT0C 3WHCA 1X2MA 1W0UA 2K9NA 3S17J 4FISA 1AHDP 1D5YA 3Q0VA 1B8IA 4X1EA 2EZIA 3PM1A 2VUMJ 1IC8A 1BW5A 4BY1J 2EH3A 2DMUA 4D5CA 2DA6A 3HOYJ 5F08A 1LE8B 4D7MA 4IEJA 4A69C 4XK4A 2K9SA 2CJJA 1HDDC 5IPAA 2Y2ZA 3LSGA 3ZQLA 3GTLJ 5IOYA 1WCMJ 2WAQN 5J1UA 4A3CJ 1TC3C 3JRFA 1EF4A 1CQTA 3GTGJ 1IUFA 4L5EA 1JUSA 5C3EJ 3S1QJ 1JGGA 2Y30A 5FLVA 4A3BJ 4IHXA 1WGXA 1RKTA 2ME0A 4ABZA 1WI3A 1SANA 3GTOJ 3I4MJ 3M3YJ 2GLOA 3OSGA 1UG2A 2MSYA 2NVTJ 3IH2A 1IDYA 5J1RA 2LVSA 2NVYJ 5M5YJ 2CRGA 2DMQA 5K7HA 1B72B 2JN6A 3B6AA 1ZK8A 3BR6A 1FTTA 3BTIA 5EEAA 1PUFA 3Q0UA 3GTKJ 1JT6A 2K9QA 1RPWA 1YRNA 1I50J 4JP0A 3ZOBA 3BQYA 3IH4A 2JMWA 1H88C 1ZGWA 1MBFA 1TWFJ 3S1MJ 5EGOA 1VF9A 1GVDA 2LTPA 2LP0A 3LSJA 4RDUA 4CYCB 3JRGA 2ECBA 3O8HA 4BKXA 1HLVA 2H1KA 3BG3A 4EEFG 3MKLA 1BL0A 1BW6A 2L9RA 1ETWA 5E3OA 3SDGA 2AHQA 1ETKA 3S2DJ 4D7NA 5IOZA 5IP6A 5HODA 1ETVA 2KT0A 1MSFC 3M4OJ 3BT9A 2TCTA 3HOXJ 2JK3A 4XRSG 1I6HJ 4MIMA 2O9LA 1FJLA 2XPUA 2X9DA 3BR0A 4UUSA 2OPTA 1POGA 1APLC 2XGCA 4CYCA 3W6VA 3BR1A 4B1RA 2JJ7A 2ID6A 2E1OA 2ELKA 3GBGA 4M3DA 2O7OA 3TP3A 4AC0A 2R93J 2DTZA 1R9TJ 1Y1WJ 2EBIA 2OF7A 2LD5A 2LR8A 2FJ1A 5E3LA 1S7EA 3TW7A 1LFBA 1WH5A 1FIPA 3RZDJ 1AU7A 1OCTC 3JRDA 2YS9A 1LFUP 2NVXJ 3OIOA 5J3LA 4JX5A 2FQ4A 3CDLA 4A3FJ 2LY9A 2L7FP 3OOUA 1MBJA 2DA5A 3NARA 5IYCJ 2R5ZB 1ZR2A 1GUUA 3A03A 5IP7J 2R7ZJ 5FLMJ 1O4XA 5IYDJ 2IBDA 1XG1A 2LKXA 2VI6A 3RKQA 2Y9ZA 3K7AJ 2LLKA 2XB0X 3BG9A 2CUFA 3HB9A 3MN2A 4C3HJ 1MNMC 1U9NA 4MFDA 2QF7A 1JJ8C 9ANTA 2R5YA 3H3VK 2DA1A 5C4XJ 2XGEA 5BNGA 3TEDA 1YRNB 2D5VA 3SJMA 2EQRA 2CQXA 2RAEA 2Y31A 4FE7A 4IHWA 1UHSA 2I10A 2H8RA 1ETYA 2NS8A 2WB1N 5EDNA 3HKZN 3Q3SA 2X6OA 1QVTA 2L0KA 2E19A 3HM5A 3GTMJ 1AKHA 1WPKA 4QIWN 4BBSJ 2DA7A 4DW6A 2XB5A 5K7FA 3LOCA 3B6CA 4BY7J 1ITYA 1ZTRA 2K40A 4AUXA 4BXXJ 1Q1VA 3E7LA 1W0TA 3ZQIA 3QQAA 4B4CA 3A01A 1NTCA 4Y7NJ 5M3MJ 5F0FA 3BQZA 2ME6A 3TW6A 4S0HB 2COBA 4I6ZA 1JKRC 1ORKA 1X58A 1PUFB 1JUPA 3FK7A 3FIWA 3S16J 1MH4A 1H8AC 4RBOA 4A93J 1OJLA 5F0HA 2XSDC 4AYBN 2DN0A
chains in the Genus database with same CATH superfamily
2ZJ2A 2H1LA 1B4AA 2L7KA 3KZIC 4NQWA 4BEHB 2BVMA 1IG7A 5ILSA 4IOCF 3ZR8X 3SZGA 3KZZA 1RUOA 3FWEA 5LLQA 5EEHA 5ICGA 5KHDA 4CO8A 4MLOA 3Q9SA 1MBGA 1RESA 2MG4A 1G59A 2M45A 5DTDA 5FLXK 4N9HA 3HEFA 3CJTB 3ZGKA 4B44A 4B48A 2E2IJ 3TQNA 1BI2A 3G1OA 4LB5A 3CQZJ 3UNGC 2AQFA 5F27A 2EFQA 4RGRA 4CH7A 1XMXA 2BW3B 4B47A 2FRHA 4LD5A 1T08B 5FKLA 1RC9A 2DLLA 2EILH 4HNTA 1O57A 2EFWA 1J5YA 1N78A 1JHFA 2ECCA 1VQ4I 3HBLA 2EJRA 1JE8A 4QPQA 2IT0A 4A3GJ 2NNYA 3QOEA 2A6EF 4N4NB 1IO2A 3G4SI 1U78A 2HYJA 5FGMA 5BPIA 2HI3A 5A2QK 4HLYA 4HDUA 1OPCA 2VKEA 3C1DA 3GMEA 5EG0A 3GFMA 4K2EA 2CV0A 1MBEA 2LK2A 5GAHJ 5B1AH 1KU2A 1F43A 2L9VA 1B9NA 1TQMA 4FTHA 4FCYA 3QPHA 4Y17A 2E2JJ 3BTCA 3HGGA 1JJ6C 4BHPA 1XDSA 2R3SA 2EPFA 3X2QH 1OCOH 2M0CA 4F55A 1U8BA 3LSKA 3FXMA 2M34A 3OV8A 2F5CA 2LFBA 1ZARA 1S5LC 5CVVA 4E7LA 1NG7A 1TQPA 1BIAA 2JPBA 2NS0A 3AL0C 3OR2C 5DYMA 3K4LA 2EB7A 2ZSIB 4WK8F 3ZP5A 2BGCA 4XLEA 3J7AO 4A12A 3JRIA 1R4NB 4EMSA 2XSJC 1XDUA 4I0AA 4HX8A 3RQ4A 3G2BA 1VQ9I 5FKKA 4ZYHA 5IT9K 1WJEA 1IN7A 2X1EA 5FFXA 3RYRA 2XKOA 3LQRA 5J6XA 1B72A 1XX5A 3MCZA 3WTSC 4BEHA 2IEKA 1E0EA 1LVAA 1UZCA 2ZNYA 3E0JB 1E3HA 3EYIA 2XGXA 2IGKA 4IQJA 5D6FA 3I54A 3MKWB 2HNHA 4OMZA 2WY7Q 3MD2A 1IXRC 5HS8A 5J47A 2MABA 1FMVA 2K3FA 3MMYB 4S05A 4JX4A 5ICCA 2KHMA 2MC4A 2GWRA 4DYQA 1Z6TA 4AWXB 1ZR4A 1DU0A 4KMUX 5D4RA 1O3SA 3L1PA 2DO7A 3D0SA 3BR3A 3MAJA 2WA0A 3P9KA 4BJ6C 4QTRA 3LSPA 4LLNA 2NAZA 4RLQA 4M3EA 5A2QZ 4FE4A 4DZJA 3CMEI 2HQ5A 1D1CA 1YIOA 3HSFA 3HKZA 3TDZC 3FXQA 4N0BA 1T2KA 2G9WA 2O3FA 5DDGA 4RB0A 2NVQJ 1SVMA 4E7IA 2LH9A 2PJPA 2WBMA 3HXLA 3JSOA 2IW5A 4O3MA 2L7ZA 5CKTA 3U1KA 4JX6A 2GBYA 2RREA 1Z05A 3IAS2 4UV9A 2DAOA 3IC7A 2L02A 4L9VA 4ZTFA 2W25A 3CMYA 3J80Z 2ZKZA 1YITI 1KONA 1S29A 1P7JA 1X3WB 2HYGD 3DLAA 4W97A 3TGNA 3OOPA 3HRSA 4Y4RA 1YG2A 2CMPA 5JHUA 2A68F 2FEZA 3VDXA 2IS6A 3CJQB 4BDYA 1LQ1A 2M2EA 1FWZA 3CO6C 3OR1C 3CCJI 1ACIA 2CWEA 3WTVC 1JT0A 2F4MB 4KITB 3I55I 1R6RA 2DOEA 2CGPA 1HW1A 3U1DA 2ID3A 5LEJA 1YIJI 3WGHA 4P55A 2KRFA 3BZKA 5LHHA 2VJJA 3DPLC 3CP2A 3TP0A 1OCPA 2KKOA 2NOJB 2EFOA 4P9FA 1SD7A 5FFZA 1QVUA 4CZZA 3FXRA 3CCYA 2K7LA 4UB8C 1O3QA 3ZQHA 4KFCA 4EATA 3G1LA 3ZMSA 2RNGA 2OCEA 5CVJA 2DMNA 4HF2A 2NRAC 4ZYDA 3IHUA 3GO5A 4U0WA 3OYIA 3MZHA 1KYZA 3G3ZA 3BTJA 2CUZA 2IS1A 2UWMA 1T56A 1XCBA 5EF6A 2YSRA 4B3AA 2VQGA 5F04A 1OCRH 3LSHA 2JA6J 2EZLA 1ETXA 3FKIJ 1GLNA 4YRVA 3HYIA 3WHCA 3W2VA 2Z3YA 4PCQA 1W0UA 4FISA 5FB2A 1D5YA 1ZRCA 4X1EA 3GFLA 2EZIA 3MWMA 2VUMJ 1BW5A 4XN0A 1A31A 2A5WA 2DMUA 2PMUA 3CUQC 3A4CA 3TOBA 5F08A 3WTZA 2QKLB 1W1WE 2CO5A 4A0YA 2LOOA 3GZ5A 4RAYA 1O3RA 4A69C 1QPMA 2K9SA 3F21A 3R0JA 4NBQA 4LLLA 2JQ7A 1HDDC 5E1WA 2JSPA 2Y2ZA 1RI7A 3ECOA 1ULYA 2VJ4A 2M4KA 4LG0B 2QM3A 1KYWA 3H9JA 3RDIA 1X19A 3KYCB 3NEUA 2IGOA 1ZLJA 1H0MA 3BOQA 2VKDA 4ENJA 4L5EA 2X85A 4EJUA 3GW2A 2OZ6A 3LMMA 5BOXA 1R22A 4G6QA 4IHXA 3HG9A 2ZXWH 1Y0NA 1RKTA 2VLAA 1WI3A 4HQMA 2DU9A 4X0GA 1PJRA 4E7KA 3R4KA 4LIVA 2GLOA 2ADUA 1SC7A 1T95A 2FA5A 1HSJA 1LDJA 2NVTJ 2L3DA 4ZDLA 1VQLI 2X1DA 3CCVI 2LC2A 4RB2C 3KP4A 1FZPB 1ZK8A 4PJ0C 3BR6A 2A5YB 2HQAA 4HZFA 2L9SA 2V6EA 4OAZA 3F8FA 2VE9A 3GTKJ 2BHZA 1LEAA 1VQ5I 2DK5A 4IRGA 2GXBA 3CO7C 3I59B 1R23A 1MDMB 2OC6A 1USTA 3ZOBA 2D1VA 3BQYA 2JMWA 1ZGWA 2K27A 4PJJA 4ITVA 1WJAA 3DBHB 4XLAA 3ABUA 1HSTA 1VF9A 3F3XA 4WXHA 4XLHA 1GVDA 4RDUA 1TL8A 1FBSA 4QLCU 3F6VA 2ECBA 3KPHA 5B1BH 2EINH 3DFGA 2VT2A 5H6RA 3BG3A 3MKLA 2DCEA 4Z6YA 2ZCWA 1BL0A 1TT5B 2L9RA 4YFNF 4U0VA 1ZAOA 4EVIA 3GX4X 1KGSA 4PJLA 4PFOA 2HEOA 4HYEA 4IVNA 5IP6A 3QYEA 4AD9A 4EJOA 1ETVA 4GRIA 4BDZA 1MSFC 4WCGA 4LLGF 3BT9A 3K1PA 2YX4A 4XQFA 1AWCA 2PLYA 4IJAA 2M4GA 2OTJI 4BJTA 2O9LA 1FJLA 2XPUA 4KNYA 2W84A 1SD5A 2FE3A 4IO9F 1POGA 3VEPA 2Z16A 2DQRA 3ZMUA 2NYXA 1K4SA 1OYIA 3HOTA 2CW7A 2FOKA 3K1MA 3GBGA 1XGNA 2NNNA 2O7OA 2OF7A 2K02A 4IZZA 1W4MA 4E70A 1LB2A 2ZBKA 4I01A 5E3LA 2WADA 1AU7A 2HTSA 3RZDJ 2YS9A 1LFUP 2VJIA 1KU9A 2D45A 4XKVA 1ZG5A 4JX5A 2FQ4A 2LBFA 2VL8A 3OS1A 5LGUA 4LIUA 1TLHB 1GUUA 1S9HA 1S8NA 4M72A 2LSOA 5E1XA 2R7ZJ 1O4XA 4LK1F 3Q5FA 1A6QA 2RKHA 3FF5A 1IV8A 5ED4A 2KP6A 1D0ZA 2VI6A 2Y9ZA 3K7AJ 1W5CC 1WJCA 3M1CA 2EIJH 2X4HA 3CUQA 3MN2A 3W2AA 2XAJA 1U9NA 2R7TA 2PMHA 1MJBA 1JJ8C 2V26A 2KIMA 2DA1A 3WG7H 3GFJA 1D1AA 4UUVA 5BNGA 1YRNB 3CP8A 2D5VA 4GXOA 4ESJA 2RAEA 2VBYA 2OCCH 1J7KA 1UHSA 2I10A 3I0TA 3F8BA 5F6FA 2NS8A 2WB1N 3WTWC 4HDVA 1XSXA 3HM5A 2E19A 3AG1H 1K79A 1MD0A 1MGTA 4LFUA 2DA7A 1LUJB 1ITYA 3E6MA 2E60A 4ETSA 3K4MA 2E7WA 4EV0A 5LD2C 4BH9A 1Q1VA 2A3SA 2M5WA 1ZELA 2VONA 1W0TA 3ZQIA 1F9NA 3QQAA 4ESBA 1SD6A 1NTCA 3GVAA 1YX3A 1N25A 2ME6A 1BR1A 2COBA 4S0HB 4NHJA 1FYLA 1J2XA 5E18F 4Y13A 1FSHA 1JUPA 1JHHA 3FIWA 3FK7A 3JAMK 3AL0B 2VQLA 1U5TA 4RBOA 2XSDC 5DUKA 1MKMA 3OYBA 3WODF 1YI2I 4B09A 5GP9A 1P4AA 1V5EA 4RAZA 2FNPA 2GOMA 3I5UA 4PSXA 2HKXA 4P96A 4LOCA 1T0FA 4Y15A 3I64A 2L01A 1LFPA 2O8XA 3AG2H 3DPTA 4A0ZA 2ZXIA 4M3FA 4P1WA 4E7JA 1FT9A 3HL2A 5JLXA 2FU4A 4UVBA 4OWRB 2FF4A 3ZMZA 1XC5A 1RETA 3F8CA 2YU9J 4CCOA 3ELKA 4B8XA 1VQKI 3BG6A 4MHGA 3T8TA 1W5SA 1YX5A 3BPXA 4Y3OA 4A3MJ 1QU3A 3PJRA 2QBYA 4YFKF 4OIPF 5HDKA 5D5UB 1MW7A 1W5TA 4FHTA 4NQWB 2Z33A 1MBKA 4J19A 3OSFA 3BG5A 2OTLI 3OIQA 2B7EA 2DJIA 1K6OA 2OZUA 4WWCA 4DZPA 3QAHA 1R5ID 4IQ4A 1H89C 1DU6A 1IN4A 3KIOA 4HSTA 1BI3A 3EPZA 4EGZA 5DM6F 1FOKA 4EGYA 1F36A 2X1CA 2D1HA 2MC3A 3LQQA 3KP6A 3VWBA 1TWHJ 4F3QA 2LF8A 3S3OA 1E3OC 2KLOA 2HZDA 2L54A 4AYBA 1MBHA 1GV2A 1LDKB 2K86A 1SMTA 1DPRA 4GGGA 2ZSHB 2Y0MA 1WJ5A 5K7ZA 3K9TA 3S14J 4Y52J 3V8KA 2HQNA 3SFZA 1T0FC 5D5XB 4IOAF 1F1ZA 4DBQA 5H6QA 3K0LA 3JREA 4A3KJ 2K9MA 2EZHA 3J7YJ 1RRJA 1ZQ3P 1GV5A 2O6GE 2DYRH 2ZMEB 3JR9A 3KEOA 3F0CA 4N9IA 2CS3A 1W36C 3PFIA 3RQIA 2V1XA 4KJZA 4ZDOA 1ZHFA 3S1NJ 1U5TC 2COMA 2ISYA 2W4SA 3U2RA 3LAJA 2FMYA 2IP2A 3MKZA 2QQBA 1VQMI 4IHVA 2TDXA 3CDHA 3G6EI 5CVRA 4DYCA 3TBIA 1FTZA 2VKHA 4KIBA 1ZRFA 2ICWG 2H6BA 2P5KA 1S7AA 1UB9A 3AG4H 3CLQA 1FBQA 5J40A 1Y56A 1RKWA 1ZKGA 1FBUA 2W48A 5D4SA 1HCRA 1FIAA 5GPCA 4D5FA 2OQGA 3KCCA 4DGWB 1LE8A 1P6RA 5H2FC 1IJWC 2ZJRF 1I6XA 1VI0A 3IWFA 2UUZA 2CQQA 5AIQA 2HXIA 3RKXA 4AM3A 3MKYB 3BR5A 3ZQQA 1MNDA 1G8XA 2ESNA 4XKWA 3FK6A 2F48A 1FPQA 1Y6IA 3OMYA 4H4KC 4HRIA 2XPWA 2VODA 1HKQA 3F8MA 2ZNZA 3CCEI 2LKPA 5EZGA 5LRSA 1YO5C 3HGYA 4RGSA 2OBPA 1YS6A 4CSWA 1UHMA 1Z7UA 5HOOA 1FP1D 5B5EC 3OYDA 4V2FA 3S32A 3ZXSA 3M7GA 3QP5A 3HRTA 3OYKA 3QPSA 4E6KG 3CJRB 5CQEA 2IGMA 2DBBA 3HPHA 3ERED 2VC0A 3G71I 3RZOJ 2JUGA 3H9GA 3E5QA 3LWFA 2CYYA 2N8GA 1WRJA 4G12A 2XIGA 2BW3A 3K4BA 4A6DA 3V42A 3BCAA 5K5OA 1AA7A 3TDUC 2C6YA 3JSPA 3ZQFA 4A3DJ 4RLFA 5EYRA 3GTJJ 5DS9A 2P4WA 1HKTA 2V9PA 3A1YA 3LSRA 1X4OA 3V8LA 3ZCOA 2W7NA 4M3GA 1UFMA 3ASNH 5FD5A 5DEQA 1K7AA 1V4RA 2Y9YA 2EV0A 2HDWA 3CUQB 4JOMA 5EG0B 3QU6A 4U7DA 4YIFA 1HOMA 2DA2A 2F4IA 2MH9A 2E1CA 3BJOA 4UVCA 2UV1A 2QCOA 2XKPA 2CU7A 1ON1A 4XICA 2QEXI 1R5GA 3OYMA 1F5TA 3SEZA 3DBRB 3R0AA 1BA5A 4UNOA 1KZHA 5LGTA 4RGUA 5BMZA 1IV6A 2MLGA 2YX7A 3FISA 4PZJA 1E17A 1JUMA 1ZYRF 2HFHA 2AO9A 1FEXA 1XGOA 4P5OA 2LY1A 2GM4A 1T33A 4MQ9F 3I9V2 2R7OA 4HOBA 4ON0A 4CCMA 2BZTA 2R92J 2MW8A 2P6SA 3KP2A 3S1RJ 3IH3A 3JRAA 3N97A 4B3XA 2HYFA 4F91B 3S15J 4RB1A 4RAFA 5M5WJ 1I1SA 2Q2EA 2DA4A 3IUOA 1RR7A 2XRLA 5M5XJ 3CMMA 5D5VB 1XMAA 3IKVA 5JI6A 3DF8A 2ESHA 4OIOF 2HOTA 1LNWA 2O61A 2QA4I 1TQIA 1VQ7I 3T8RA 2BOLA 2NS7A 5GAEJ 3IRQA 1VQPI 2PJRB 2QKMB 2B0LA 2HGCA 3VFZA 3GEZA 3TO6A 1VQ8I 3A01B 4CUGA 5FJ8J 5KAFC 2QSFX 1Z0XA 2UXNA 3PNVA 2W24A 4M74A 3QODA 4LK0F 4BHBA 1GT0C 1X2MA 1JXSA 2FQ3A 2GA1A 3K4NA 2K9NA 5TISC 4KIFA 3Q0VA 2H27A 1BOBA 3PM1A 3TO9A 4BY1J 1RZ4A 2EH3A 4BQNA 3DKWA 4G94A 3N05A 1SFXA 3U9GA 2ZXJA 4D7MA 3BP8A 2PQ8A 4XK4A 1BJAA 3K2ZA 5GADJ 1RIOH 2CQKA 3ZQLA 1OKRA 2IS4A 3GTLJ 2P5LC 5IOYA 2WAQN 4A3CJ 1FY7A 1TC3C 3KX2A 4R79A 4Q5SF 3FXOA 3L7WA 3FM3A 3OY9A 3GTGJ 3BG7A 2WV0A 5LRRA 1IUFA 1K4TA 3BWGA 3DXJF 4C2TA 4EJTA 1JGGA 5FLVA 1IF1A 4A6EA 1L0OC 2BEOA 1HXDA 1V3FA 5D8LB 3LA2A 2PMZA 1SANA 4OOIA 3I4MJ 2KFDA 3WE2A 3R60A 2IS2A 4NUBA 2AXLA 3C2HA 4C30A 4OINF 1OR7A 1Z3YA 3WG9A 3DKXA 5M5YJ 2CRGA 4LG0A 2KISA 1T6SA 3HRUA 1DP3A 2JN6A 3B6AA 4RAGA 5HLIA 2G7UA 1FTTA 3SYTA 2V7FA 2HPIA 3IP4B 3JAMZ 5HVQC 3PL8A 1XCVA 1O7FA 4ESFA 1PUFA 2Z2SB 1JT6A 2MD5A 2K9LA 3FMRA 3I71A 2IRFG 1YJWI 2M7BA 2FBKA 3PIOF 4JQFA 3GYHX 2VBWA 3C18A 1YFHA 1H88C 5LFAA 1MBFA 2NXNB 1XSDA 1S6LA 3S1MJ 3ZMTA 5EGOA 1Z3XA 4RS8A 4ANJA 1Z21A 2LP0A 1I3AA 2LTPA 4M9XA 1Y8RB 3DTIA 3RSNA 4ZTJA 2QSGX 2DW4A 2IGNA 2VJ5A 1ON2A 2MH2A 3P7NA 3JRGA 3GCMA 2BY2A 4BKXA 1R49A 2GIZA 2CG4A 4ZDPA 2EA4A 2ZMEA 3NWTA 1O3TA 3VYUB 1BW6A 1ETWA 3KYLA 2UZKA 1R4MB 3K70C 4UB6C 3LSTA 3CLOA 2TCTA 4L5IA 3W6KB 1K78A 1IUYA 3FXKA 5E17F 3HIFA 3CD6I 3OIPA 4AIKA 3L2RA 2HDCA 4MIMA 1I6HJ 1UHWA 3BR0A 3L00A 2KIUA 2DYSH 4OAYA 3K70D 4HV5A 1XB4A 2JJ7A 2MBFA 2ID6A 2LREA 4M3DA 1OQYA 5L3DA 4KA4A 1Y1WJ 5L3CA 2LD5A 2LR8A 3B73A 4M71A 4RGXA 2VB6A 1MMSA 2DOFA 2KPMA 4IRHA 4CCKA 4ASNA 4CICA 2EA2A 2F5DA 1LFBA 1WH5A 3TW7A 1ONVA 4E7ZA 3EDPA 3QWLA 4DIQA 3OIOA 3H0DA 2KZVA 4PFPA 5J3LA 3BCBA 1ZRDA 4IF4A 2ZFWA 2XF5A 2JT1A 4BXUA 2L7FP 3RYPA 3TL4X 1X1BA 5E1ZB 5IYCJ 5HS7A 2GA2A 2F4OB 3JTHA 4IX7A 3ABTA 3BPVA 2R7WA 4CGZA 2BY1A 5IYDJ 2FBHA 4ENMA 1OMIA 2IBDA 4PJMA 2IA1A 4I02A 2M87A 3BG9A 4YG2F 1MNMC 2ZO4A 3FM5A 1P4XA 2QF7A 5J8FA 1XMKA 2FXAA 3RPUD 9ANTA 1UJ8A 5CQGA 4GYGA 1SVOA 2DQLA 3H3VK 3E3VA 4BE1A 1Z67A 4CCNA 2CV1A 3BY6A 3H1CA 4ZZDA 3PUFA 4S04A 3CESA 2P8TA 4HW0A 2QLZA 2GZWA 2EQRA 4FE7A 4RB3C 4XBFA 3J7AY 1BI1A 3F72A 2M3AA 1ETYA 3S93A 4A5MA 5K5QA 2DT5A 4YEJA 4E4HA 3Q3SA 1TP4A 2Z5UA 1QVTA 2LYCA 1BI0A 1G6NA 1DDNA 4IKFA 2JPCA 3GTMJ 1WPKA 1W7PD 2F5EA 2XB5A 1ZREA 3CZ6A 3LOCA 3N4MA 1X3UA 1ZTRA 1B1BA 4AUXA 4LGWA 4BXXJ 3COAC 3E7LA 2VQHA 2L4AA 4UXNA 1O7LA 3WTXC 1WJFA 3SZPA 3I56I 4IHSA 4Y7NJ 1C0WA 3K1NA 2R7VA 1Y8QB 4BQAA 3TW6A 4I6ZA 3S3NA 4E7SA 1L3LA 2HVRA 2OD5A 1X58A 3OS2A 5BQTA 1SEUA 4F92B 3S16J 2R7UA 5JVGF 1DGWY 1H8AC 4F52A 4AYBN 1JTXA 4ZYGA 3AFHA 4OIRF 2ZJQF 2P81A 4I99C 1HA8A 1VNDA 3KP3A 2EWNA 2HTJA 1IDZA 2I8DA 3M8FA 2E34A 2VC1A 1V55H 2V9VA 1PP7U 3ZPLA 1MJ9A 1Z77A 4UV8A 3CCLI 4JYKA 3VOEA 1YW9A 2V79A 1UMQA 1T39A 3ONQA 1U6GA 2J5OA 3REOA 5IP9J 1DGRM 2LBFB 1YQAA 4F93B 1IXSB 2JVHA 2XPVA 1X2NA 5DM7F 3WTTC 2V6CA 5HNHA 4Q4ZF 2HXOA 2JWTA 3T1BA 3WTUC 2OUMA 5IYBJ 2OA4A 2R0QC 4HA8A 1IRGA 1HQCA 2FMLA 4UVAA 1DQUA 2GAUA 1IXCA 1NG6A 4HLXA 4U0YA 4A3EJ 3IKTA 4M3BA 4WXCA 1OCZH 1S7OA 1K6YA 3HDDA 5FKOA 2UXXA 2DJNA 3ZQCA 3HOSA 2XAFA 1X3ZB 1HBXG 1MSEC 5K1YA 1D0YA 2W00A 1IRXA 5IT9Z 5E8GA 2QSHX 1K83J 4NDLA 4XIDA 3CCSI 1MIJA 4I09A 1RR8C 1GHCA 2GOXB 3EUKL 2RDPA 2O0YA 1QQIA 3WGGA 3WU0A 2HR3A 4ZYEA 4L9NA 1B6AA 5EZHA 1LKXA 2XHKA 4HV6A 3PSFA 2VKVA 1GDTA 3BR2A 1B9MA 2K4BA 4DOZA 4D9JA 3OYJA 2Y48A 4F7ZA 1STZA 5C44J 4V19K 4C3IJ 3OYAA 3OYFA 1QGPA 4ENNA 2OJED 4RA2A 4YFXF 3WU1B 2CV2A 2ELJA 1MH3A 2G7HA 2M8GX 4YIIA 1H9GA 1QHHD 2HOAA 3RKYA 3VPRA 3GFIA 1HW5A 3CC4I 2F2EA 5B3SH 1PUEE 3JRBA 1QRYA 3GUDA 2A6TA 3FBNB 4BE0A 1D5VA 2QUFA 1XTAA 1V5GA 5CJ9A 3CJNA 3H0GJ 1LEBA 2EV6A 4C2MJ 3DLLF 1TWCJ 1XGSA 3IV5A 3HOZJ 1YE9A 2XASA 1MNEA 4G7HF 2E2HJ 1ETQA 2JRMA 4HBLA 3OYHA 1Y1VJ 2TRTA 5J8CA 2Q1ZB 2DPDA 1WWXA 5F0CA 3VSLA 2ZXHA 4IXAA 1E2XA 3L2WA 3FMQA 3ULQB 2X6XA 2E1MB 5CPRB 3I58A 5LBQA 1QHGA 3KE2A 4HF1A 2GXAA 1DPUA 3DV8A 1YTYA 3HOUJ 4CCLA 2R5ZA 3LNQA 1FYKA 1J0RA 2X48A 3JRHA 1W36D 1G2HA 4LITA 2DMTA 2KDZA 4MO7A 3KEYA 3ZMDA 3RI4A 4NNJA 2DT7B 1JKOC 3FBIB 4G6TB 3S2HJ 4RM2A 1B59A 2IAIA 2H8WA 4EQQA 2Y69H 3AAFA 3LA7A 2A07F 2AQEA 2JVGA 3F6OA 2HU9A 3C7JA 1R36A 4QSHA 3TKYA 3NRVA 3DWLE 1I3QJ 1YJ9I 2XGDA 4AVPA 2CUEA 3MVPA 3KP5A 3RCOA 2JUCA 5DD8A 1JKQC 1WH7A 2DA3A 2JA8J 3E1SA 2DOAA 2X51A 4KUMA 3F23A 4M6VA 4ENKA 4XN3A 4HQEA 2E36A 1QZZA 1ZG3A 1GXQA 2KJBA 2XRNA 5H20A 1RUNA 2HDDA 2VOOA 4L5JA 1YHQI 5GAGJ 1X1PA 3NAUA 3FXJA 4X6AJ 3RPQA 5CVUA 4XLCA 1QPIA 3ZQGA 1F4KA 5TGTA 5FRNA 3DPUA 3S3MA 2L7MP 2BBYA 3EYYA 3ZN0A 3H35A 4EM1A 5JLWA 3BTLA 3CUOA 5CYVA 4ZYAA 4OMYA 2EIMH 3MQ0A 3SQNA 1P4WA 4M6XA 3PNTA 4FQGA 4TV7A 4HNUA 2FX0A 4DBRA 4G7ZF 5E3MA 2E1MC 2EFNA 2R7FA 3KEQA 3SXYA 4ZZLA 1VZ0A 5HS9A 2FNAA 1Q1HA 3WHBA 5AONA 2MGQA 1J59A 1J9IA 3L9FA 3HUGA 4I76A 2P7CB 4KISA 5LGNA 3I4PA 3GWZA 1FOWA 5D8KB 3I53A 4A3LJ 3EQLF 3IL2A 3C3WA 3QPLA 3DU6A 4HX4A 2EIKH 1SFEA 4G9YA 5LEKA 3KP7A 4CZCA 1I27A 5E8IA 1X1AA 3FX3A 1EH8A 3LL7A 2RGVA 3HHHA 3DEWA 1ODDA 2XDVA 1KQ8A 2R7XA 4CHUA 2EZKA 3P5JA 3M07A 4DJAA 1KA8A 5BS6A 4J00A 2Q2EB 2XAHA 4U88A 4L9JA 3PUBA 4P9UA 2QQ8A 4GO1A 1B8IA 2KIFA 5HNFA 3OL4A 1WHUA 1EH6A 5DV5A 2DA6A 3HOYJ 1YOVB 4II2A 2HPMA 1LE8B 3J80K 4NC6A 4BGDA 4IEJA 3OL3A 3IRRA 2CJJA 2LRDA 1D3YA 3RJPA 5TJJA 5IPAA 4KMFA 3LSGA 5JHFA 3FDYA 4N4OB 4D0PA 1WCMJ 3J81Z 4E7HA 1R71A 3A0BC 1HKSA 2BY3A 4R1HA 1EF4A 3QYFA 3M8JA 1WZ2A 4KICA 1CQTA 3HPGA 4BJ5C 4IRIA 1ERDA 5CVIA 4FX0A 3S1QJ 2LDUA 3MEXA 2R7QA 2WAFA 1OYWA 1IRFA 3CF5F 1TZLA 1WGXA 2ME0A 5FRMA 2W85A 3VSKA 1P9QC 2A69F 2HOEA 1QO0D 3OSGA 3LFUA 3CC7I 2KZGA 3EETA 5K5RA 3IH2A 1IDYA 5J1RA 2LVSA 2NVYJ 3ASOH 2PG4A 2QVOA 4JK1X 1PP8F 1R1TA 2HKOA 3PFYA 3A2KA 2STWA 4PGGA 3MZ8A 1QZYA 1OISA 5EEAA 4Q48A 3VB2A 5JR3A 3OYGA 4O5VA 4FT8A 1IZ1A 1UAAA 4BAYA 1SMYF 4GCVA 1JI8A 2ACJA 3W6JB 4C2UA 2O5RA 4NC7A 2IPQX 3BROA 5AIPA 3DTKA 4WXDA 2KRCA 3IH4A 1TNTA 1E3PA 2Z9OA 4OIQF 2QZ8A 1R5HA 1TWFJ 4ZH4F 2E1NA 2QENA 4YIRX 4PK4A 4A2UA 5LHGA 1IN6A 2M1BA 1NH3A 1VQNI 1RNLA 2L4MA 3O8HA 4HSRA 2PBIA 3E6DA 4CCJA 1BR4A 4KYWA 2FOWA 3SDBA 5KK1A 3OWTA 2HS5A 3MFKA 2LKSA 5E3OA 3SDGA 2VXZA 3HHGA 3E6CC 2AHQA 2BXYA 1ETKA 3S2DJ 4D7NA 3RIRA 1EJ9A 2KJCA 3AKZA 2PX9A 3GF2A 3M4OJ 2Z1DA 3HJEA 4WF2A 2KIQA 1G3TA 3L2CA 2JTVA 1KU3A 4JBAA 3HC7A 1D0XA 4UUSA 1APLC 2XGCA 3K4JA 3HSEA 3L2VA 3W6VA 3L09A 2KMUA 4B1RA 3ESWB 2ELKA 3TP3A 4AC0A 2R93J 2DTZA 2EBIA 3LAPA 5DCMA 4MEYF 4R8HA 3P9CA 1Z6RA 4ZC3A 2BV6A 1ZH5A 1FIPA 1OCTC 3JRDA 3L2UA 3ERMA 1CF7B 3G73A 3H5AA 4M9SA 4MTEA 3WE3A 4LB6B 2V4JC 2FSWA 4HX7A 2KDOA 2QGUA 1MBJA 2DA5A 3NARA 2R5ZB 2DFEA 2VPLA 1YJNI 3CDIA 2GIVA 2VXDA 2XC7A 1PDNC 1V54H 1X1DA 1T8IA 1XG1A 2KRHA 2LKXA 3F22A 5JVTA 4NC8A 4XL9A 4EJVA 3OYNA 3DQVC 1FLIA 1U5TB 2XB0X 1USSA 2CUFA 2BHYA 3HB9A 3ZMVA 4XSZF 3CF2A 3D5LA 4MFDA 1I5ZA 1D8KA 3GLLA 1MJAA 1FMWA 2DODA 1JGSA 5LHIA 2XROA 2R7RA 5C4XJ 1FYMA 2WTEA 2PN6A 3F9KA 2EFPA 3TEDA 1LVKA 2DDAA 3L2QA 3SJMA 2MA3A 3J81K 2KL4A 2Y31A 2QYOA 3PIPF 3CCUI 2H8RA 2Y0SA 2DFIA 2XV4S 3HKZN 3FMSA 4XOTA 3VYTB 1A35A 2L0KA 3QU3A 1I1GA 3CCMI 1AKHA 4BNCA 4BBSJ 5K7FA 4U7BA 2STTA 1R00A 2RNJA 4UY8I 2E35A 4OU0A 1WSUA 4BY7J 2X6YA 2QBYB 1REPC 2K40A 3ISPA 3CC2I 1W7PA 5L3BA 2VT3A 3H36A 2XUBA 5B66C 1WVRA 4B4CA 3A01A 2HVSA 2DFFA 4AU7A 4I2OA 3E5UA 5M3MJ 2Y75A 1BM9A 4HAMA 1JKRC 3M8EA 5FLXZ 3BJAA 5EEGA 4MEXF 1PUFB 1NHAA 1K78B 1R1UA 4A93J 1OJLA 5ILUA 3W2WA 2DN0A 2IJLA 4A3IJ 2R7DA 2B63J 3A02A 1J75A 1OYYA 4MFEA 2L5QA 2V1DA 5J1YA 2HOSA 3E5XA 2ZJPF 5KCMA 3H3ZA 2RQPA 3VYSB 2FUG2 1W7PB 1VFCA 2I5UA 3SEQA 2WAEA 3UR3C 2WWYA 1CF7A 3H5NA 1J09A 1OFCX 1PYVA 1MZBA 5FROA 2M8EA 3KZYA 5J4YA 2HZTA 2OQRA 4I7HA 4XRSA 3DCFA 4FETA 1VQOI 4BQOA 1GXPA 1BN5A 1FSEA 2MFZA 2FD5A 1CGPA 4C3JJ 2VQCA 4XRMA 2PFBA 1WKMA 1XGMA 1U8RA 4ZJZA 3GTPJ 4V2GA 3UKGA 4AVZA 5E3NA 4XONA 1B8IB 3HTUA 3HOVJ 3O2PE 4UUSB 3I4NJ 3K2AA 3SFIA 2NOGA 1SFOJ 4CA0A 1Z1DA 1YS7A 3LSIA 5M3FJ 3JCUC 1JKPC 2EK5A 4XLPF 1QBJA 1HC8A 3V7SA 1TW2A 3V7CA 1IGNA 1BC7C 2X6WA 3GZNB 4L9TA 3Q0WA 4II3A 4EM2A 4KT6A 1TTYA 2VN2A 2A6HF 4LMYA 2DFHA 3ZQ7A 4CDGA 2VPRA 3AG3H 1IN8A 4XRFA 2YUSA 3H5RA 1EA3A 2Y0SN 4BUPA 3O8GA 1TWGJ 3FKJA 5EGOB 2G0EA 3DEEA 2YPRA 4L0YB 3J7ZI 2E7XA 3TOAA 3QYBA 2CSOA 4A5NA 1WI9A 5HLGA 2IXSA 4LG3A 3DTEA 3PO3J 4PSWA 4A3JJ 5FD6A 2ZMEC 2Z99A 1IRZA 3P9IA 3W3CA 4XNFA 5D6EA 4GDFA 1OCCH 2MD0A 2ZB9A 3K69A 3H3UA 3QPTA 4GFBA 1U2WA 1BC8C 4CXFA 1TWAJ 5F1RA 1QNTA 4A0XA 1LPQA 3PSIA 1P7IA 5DD4A 1EKEA 3RPUA 1D8JA 4PDKA 4IHYA 4PUSA 2A61A 3WGIA 1FX7A 2CQ7A 2MYSA 1NK3P 4YELA 1XN7A 5DCFA 3PO2J 3H9QA 1UG0A 4BE2A 4KT5C 2VE8A 4QPOA 4XOPA 2K4JA 1AKHB 2MLKA 2V1NA 1G3YA 3JRCA 3C2GA 1IN5A 2J5PA 1K61A 4FASD 2CFOA 1TW3A 1A04A 1ZGJA 4U87A 3T0YA 1HDPA 5E79C 2O03A 2Q0OA 2WV1A 3B02A 4HNVA 3FHZA 1AOYA 1D1BA 2XVCA 2ZC2A 2CW0F 1P92A 2M30A 4XKBA 5C4JJ 2CW8A 3GXOA 3G1MA 3PQJA 4UUTA 3IWZA 3NQOA 1XS9A 1I39A 5F1JA 1N75A 1OLTA 5GTHC 1Z9CA 2AS5F 2PMZN 4J01A 1BBYA 1M1EB 1YYVA 2JA7J 2XF6A 2M9HA 2LF7A 5D5WB 1Z91A 2H09A 4W1UA 1FOYA 1BJZA 2Q8KA 1QA6A 4H0EA 2P7VB 3IAM2 3HZJA 4IL6C 5ICEA 1S72I 3KLOA 2ELHA 2K85A 2E5ZA 1YLFA 2WAQA 2YR2A 5FKNA 2IVMA 4G7OF 1LJ9A 2DMPA 3OS0A 1HW2A 2OV7A 1A6IA 5IY5H 2VOPA 4DYRA 2O8KA 4DNCA 3DU5A 2XAQA 3HOWJ 1TT0A 3D1NI 2DTRA 5IT3A 1WJDA 1X1CA 2M7AA 5HLHA 2YU3A 2RN7A 2JA5J 4EM0B 1ZN2A 3FZVA 1JTYA 3VYRB 1U9OA 2R4GA 5L3EA 2OAZA 5GPAA 2KQRA 3M9AA 2BE5F 1SFKA 1T98A 4XSXF 4G6DA 1NK2P 4BBRJ 1MDMA 3SHFA 3QP6A 2DT6A 3C2BA 1MMNA 3HSRA 1SD4A 3BZ6A 2P0WA 2K3PA 1KU7A 3GTQJ 3CTAA 5ILVA 2R5YB 2WB1A 3CCQI 4M6YA 2NVUB 3QOPA 5FKMA 1HF0A 1A5JA 4MQVA 3CMAI 1BR2A 2GQQA 1X4PA 1U0JA 2VBXA 3DP7A 3FXUA 1KQ0A 3EUHA 3DEUA 3SZTA 5L3GA 3JTGA 2PI0A 2LNBA 3D5SC 3ABLH 3H92A 4CYDA 1ENHA 1IW7F 1ETOA 2CUJA 3ECHA 5KAIC 5JFRA 2PJRA 2FBIA 2HWVA 5FO5A 4BU2A 3ML6A 3BLYA 1LDDA 1V5FA 3ZN1A 1P2FA 3S17J 1AHDP 2EV5A 1UELB 2L2OA 3E6BA 4WX9A 3R61A 1IC8A 1FC3A 1FP2A 1H9TA 4D5CA 3MZYA 2R7SA 3OYEA 3LSMA 3K4KA 2V1UA 4EJWA 1MMAA 2D2WA 1A36A 4D1QA 1Y39A 4AIHA 4BYYA 5J4VA 4KIGA 2PEXA 5J1UA 2HQRA 2A05A 2P5VA 3JRFA 3NWSA 3F8NA 3M1EA 3RTRA 1KQ9A 4MTDA 4M73A 3KETA 2BXZA 4BHCA 1JUSA 5C3EJ 1YW8A 2GXGA 3RKWA 5KVRA 2Y30A 4HG2A 3LA3A 4Y33A 4A3BJ 3BDDA 1FNNA 1TNSA 1R7JA 1SAXA 3K4CA 4ABZA 4UHTA 3VODA 1XSVA 3WU2C 3GTOJ 3HTSB 3M3YJ 2K5CA 3CCRI 2DXIA 1BOAA 2F6CA 1UG2A 2MSYA 1XD7A 4KDPA 2IA2A 2JSCA 4AIJA 4KN7X 2LG4A 4MGRA 2DMQA 5K7HA 1B72B 1R58A 2RV8A 3O6BB 2AXTC 2BY0A 3ABKH 3BTIA 1SFUA 3R6SA 3Q0UA 4L0ZB 2DI3A 4GYIA 4DQ2A 3BC8A 2JA2A 2DDBA 2K9QA 2RVCA 3V8JA 1RPWA 1SVLA 1DP7P 1YRNA 3T5XA 2HVQA 1I50J 1WFXA 4JP0A 4QWQA 2CQNA 3HUGB 2X0LA 4BXFA 2M0MA 2F5VA 3HRMA 3QRFF 4I98B 1MMDA 2DPUA 3I59A 2VASA 3BJ6A 2LY2A 3LSJA 3EUHC 2XAUA 4CYCB 5HLTA 3FXLA 4Q47A 2VIXA 4Z2YA 3K10A 2JZYA 2P6TA 5ICFA 4M9ZA 1ZGAA 1IAWA 1HLVA 2H1KA 4EEFG 1VQ6I 1Z7LA 3WTYC 1EV7A 5IOZA 2ISZA 2V9KA 5HODA 2KT0A 2RC4A 3A0HC 1SAUA 5EJCA 4LJZF 4BACA 2XAGA 4XLNF 3PQKA 2WY8Q 4BL0B 3HOXJ 2JK3A 3ROUA 3U21A 5ERIA 4XRSG 1ZG1A 4KN4X 3FHNA 2X9DA 1MMGA 2OPTA 2L9NA 3KLNA 3V7RA 5DUIA 2QWWA 4CYCA 1N77A 2LMDA 1FOXA 3BR1A 4XKCA 1BIBA 1OR7C 2B9SA 2E1OA 1Y0UA 1TBXA 4PGHA 2XF7A 1R9TJ 4RMNA 2W1OA 2W57A 5L3FA 3V4GA 2FJ1A 2F5FA 4O6JA 2ZFUA 4XMYA 6PAXA 4BQQA 1S7EA 3S2WA 1UCRA 4I0BA 1S3JA 2NVXJ 4MNUA 3K6GA 4BS9A 4FX4A 1R1VA 3S8PA 3KFWX 2E71A 4HPQA 3CDLA 4A3FJ 4HF0A 3ZRGA 2CFXA 2LY9A 3OOUA 4AIDA 2BVLA 4IPAA 4XORA 1ZR2A 2BYVE 3OYCA 3E97A 3A03A 5IP7J 3TMOA 5FLMJ 2JRTA 4PJNA 1G4DA 3O3KA 3DBLB 2DK8A 3RKQA 4XLFA 5F64A 2LLKA 4C9YA 5HDNA 4C3HJ 2CH0A 2W82A 4G8XA 1EH7A 4NB5A 2R5YA 2H94A 1G3SA 1WQ2A 2XGEA 1PVEA 2ETHA 4B43A 1XPXA 1DUXC 2RQQA 3D5RC 2CQXA 3DKYA 4IHTA 4IHWA 1YW7A 4HEA2 5DCMB 1WJBA 2QQAA 1GVJA 3PNYA 3EUAA 5EDNA 2X6OA 1VTNC 2E5NA 4L18B 1QZEA 4QIWN 4DW6A 1U3EM 4XM3A 3B6CA 5KNLA 4RM3A 5TRDA 3JW4A 3BZCA 5E20A 1ZLKA 2VBZA 3GZ6A 2OU2A 1G3WA 3KYDB 3ABMH 3LFKA 3TO7A 2IA0A 3I3LA 5GTIC 5F0FA 5BPDA 3BQZA 1ORKA 5CLSA 4XR6A 2QQ9A 1T38A 5HDGA 1MH4A 3Q9VA 5F0HA 3GLXA 3OYLA 2WC2A 2H6CA
chains in the Genus database with same CATH topology
1JTXA 5GP9A 1IG7A 4A3IJ 2B63J 3A02A 2P81A 4MFEA 1VNDA 5J1YA 2HOSA 1IDZA 4LOCA 1VFCA 4MLOA 1Z77A 4M3FA 4JYKA 1UMQA 1MBGA 1RESA 2MG4A 5JLXA 5DTDA 1OFCX 5IP9J 1XC5A 1RETA 3HEFA 2XPVA 1X2NA 2YU9J 2E2IJ 2HXOA 4XRSA 2JWTA 3G1OA 3DCFA 5IYBJ 3CQZJ 2R0QC 4A3MJ 5F27A 4J19A 1MBKA 5FKLA 4A3EJ 3BG5A 2FD5A 3OSFA 4C3JJ 4XRMA 4M3BA 4DZPA 2ECCA 3HBLA 3GTPJ 4V2GA 3UKGA 1H89C 1DU6A 3HDDA 5FKOA 5E3NA 1B8IB 2DJNA 4A3GJ 1F36A 3ZQCA 3HOVJ 4UUSB 3I4NJ 1U78A 3K2AA 2HYJA 2NOGA 3SFIA 1SFOJ 1MSEC 1TWHJ 2HI3A 1E3OC 2VKEA 1K83J 5M3FJ 1JKPC 1MBHA 5EG0A 4NDLA 4XIDA 1GV2A 1MBEA 2LK2A 1F43A 5K7ZA 4FTHA 3S14J 4Y52J 4FCYA 1IGNA 2E2JJ 5EZHA 3BTCA 3HGGA 1JJ6C 3Q0WA 3JREA 4A3KJ 2VKVA 1GDTA 3BR2A 2M0CA 2EZHA 1U8BA 1ZQ3P 1GV5A 2M34A 2VPRA 2LFBA 3JR9A 5C44J 3F0CA 2YUSA 3RQIA 4C3IJ 2Y0SN 3S1NJ 3O8GA 1TWGJ 5EGOB 2G0EA 1MH3A 2M8GX 4IHVA 4DYCA 2HOAA 3VPRA 1FTZA 3JRIA 3JRBA 1QRYA 5FKKA 3PO3J 1RKWA 1ZKGA 2W48A 1HCRA 4A3JJ 1FIAA 5GPCA 4D5FA 1LE8A 1IRZA 1B72A 3H0GJ 1IJWC 1VI0A 2ZB9A 4C2MJ 2CQQA 1TWCJ 4GFBA 2IEKA 3HOZJ 2HXIA 3IV5A 3BR5A 1TWAJ 2E2HJ 1ETQA 1P7IA 1Y1VJ 2TRTA 4IHYA 5F0CA 1NK3P 3FK6A 3PO2J 2XPWA 4JX4A 5EZGA 3HGYA 4DYQA 1AKHB 3HOUJ 2R5ZA 3LNQA 3JRCA 1ZR4A 1K61A 1DU0A 2X48A 3JRHA 4V2FA 1G2HA 1HDPA 3L1PA 2WV1A 2DMTA 3BR3A 2KDZA 3QPSA 4HNVA 4QTRA 4MO7A 3LSPA 5C4JJ 4M3EA 1JKOC 3G1MA 4FE4A 3S2HJ 4DZJA 3RZOJ 2HQ5A 2IAIA 4UUTA 2N8GA 4G12A 1XS9A 5F1JA 4QSHA 2PMZN 1I3QJ 2XGDA 2CUEA 3MVPA 2JA7J 2NVQJ 4A3DJ 3ZQFA 2M9HA 1JKQC 5EYRA 1WH7A 2DA3A 3GTJJ 2JA8J 5DS9A 2L7ZA 4W1UA 1BJZA 3LSRA 4M6VA 4JX6A 2GBYA 4M3GA 2Y9YA 3CMYA 5EG0B 2HDDA 1HOMA 5FKNA 2DA2A 1P7JA 2DMPA 3NAUA 4W97A 4X6AJ 2QCOA 2CU7A 1QPIA 1A6IA 4XICA 2M2EA 3ZQGA 4DYRA 1BA5A 2O8KA 2L7MP 1JT0A 1IV6A 3HOWJ 3D1NI 3FISA 5JLWA 3BTLA 1JUMA 2ID3A 2AO9A 2JA5J 1FEXA 1JTYA 1U9OA 2GM4A 1T33A 5GPAA 2FX0A 3TP0A 1OCPA 5E3MA 2R92J 2MW8A 1NK2P 4BBRJ 3S1RJ 3IH3A 1QVUA 3WHBA 3CCYA 3JRAA 2MGQA 3S15J 5M5WJ 3C2BA 4I76A 2DA4A 3ZQHA 1RR7A 2XRLA 5M5XJ 3G1LA 3GTQJ 4A3LJ 2R5YB 2HOTA 2DMNA 5FKMA 1HF0A 1A5JA 3QPLA 2NS7A 3BTJA 1T56A 5EF6A 4B3AA 3A01B 5FJ8J 5F04A 1ENHA 1ETOA 3DEWA 2JA6J 1Z0XA 2EZKA 2EZLA 1ETXA 3FKIJ 1GT0C 3WHCA 1X2MA 1W0UA 2K9NA 3S17J 4FISA 1AHDP 1D5YA 3Q0VA 1B8IA 4X1EA 2EZIA 3PM1A 2VUMJ 1IC8A 1BW5A 4BY1J 2EH3A 2DMUA 4D5CA 2DA6A 3HOYJ 5F08A 1LE8B 4D7MA 4IEJA 4A69C 4XK4A 2K9SA 2CJJA 1HDDC 5IPAA 2Y2ZA 3LSGA 3ZQLA 3GTLJ 5IOYA 1WCMJ 2WAQN 5J1UA 4A3CJ 1TC3C 3JRFA 1EF4A 1CQTA 3GTGJ 1IUFA 4L5EA 1JUSA 5C3EJ 3S1QJ 1JGGA 2Y30A 5FLVA 4A3BJ 4IHXA 1WGXA 1RKTA 2ME0A 4ABZA 1WI3A 1SANA 3GTOJ 3I4MJ 3M3YJ 2GLOA 3OSGA 1UG2A 2MSYA 2NVTJ 3IH2A 1IDYA 5J1RA 2LVSA 2NVYJ 5M5YJ 2CRGA 2DMQA 5K7HA 1B72B 2JN6A 3B6AA 1ZK8A 3BR6A 1FTTA 3BTIA 5EEAA 1PUFA 3Q0UA 3GTKJ 1JT6A 2K9QA 1RPWA 1YRNA 1I50J 4JP0A 3ZOBA 3BQYA 3IH4A 2JMWA 1H88C 1ZGWA 1MBFA 1TWFJ 3S1MJ 5EGOA 1VF9A 1GVDA 2LTPA 2LP0A 3LSJA 4RDUA 4CYCB 3JRGA 2ECBA 3O8HA 4BKXA 1HLVA 2H1KA 3BG3A 4EEFG 3MKLA 1BL0A 1BW6A 2L9RA 1ETWA 5E3OA 3SDGA 2AHQA 1ETKA 3S2DJ 4D7NA 5IOZA 5IP6A 5HODA 1ETVA 2KT0A 1MSFC 3M4OJ 3BT9A 2TCTA 3HOXJ 2JK3A 4XRSG 1I6HJ 4MIMA 2O9LA 1FJLA 2XPUA 2X9DA 3BR0A 4UUSA 2OPTA 1POGA 1APLC 2XGCA 4CYCA 3W6VA 3BR1A 4B1RA 2JJ7A 2ID6A 2E1OA 2ELKA 3GBGA 4M3DA 2O7OA 3TP3A 4AC0A 2R93J 2DTZA 1R9TJ 1Y1WJ 2EBIA 2OF7A 2LD5A 2LR8A 2FJ1A 5E3LA 1S7EA 3TW7A 1LFBA 1WH5A 1FIPA 3RZDJ 1AU7A 1OCTC 3JRDA 2YS9A 1LFUP 2NVXJ 3OIOA 5J3LA 4JX5A 2FQ4A 3CDLA 4A3FJ 2LY9A 2L7FP 3OOUA 1MBJA 2DA5A 3NARA 5IYCJ 2R5ZB 1ZR2A 1GUUA 3A03A 5IP7J 2R7ZJ 5FLMJ 1O4XA 5IYDJ 2IBDA 1XG1A 2LKXA 2VI6A 3RKQA 2Y9ZA 3K7AJ 2LLKA 2XB0X 3BG9A 2CUFA 3HB9A 3MN2A 4C3HJ 1MNMC 1U9NA 4MFDA 2QF7A 1JJ8C 9ANTA 2R5YA 3H3VK 2DA1A 5C4XJ 2XGEA 5BNGA 3TEDA 1YRNB 2D5VA 3SJMA 2EQRA 2CQXA 2RAEA 2Y31A 4FE7A 4IHWA 1UHSA 2I10A 2H8RA 1ETYA 2NS8A 2WB1N 5EDNA 3HKZN 3Q3SA 2X6OA 1QVTA 2L0KA 2E19A 3HM5A 3GTMJ 1AKHA 1WPKA 4QIWN 4BBSJ 2DA7A 4DW6A 2XB5A 5K7FA 3LOCA 3B6CA 4BY7J 1ITYA 1ZTRA 2K40A 4AUXA 4BXXJ 1Q1VA 3E7LA 1W0TA 3ZQIA 3QQAA 4B4CA 3A01A 1NTCA 4Y7NJ 5M3MJ 5F0FA 3BQZA 2ME6A 3TW6A 4S0HB 2COBA 4I6ZA 1JKRC 1ORKA 1X58A 1PUFB 1JUPA 3FK7A 3FIWA 3S16J 1MH4A 1H8AC 4RBOA 4A93J 1OJLA 5F0HA 2XSDC 4AYBN 2DN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTX A;  5GP9 A;  1IG7 A;  4A3I J;  2B63 J;  3A02 A;  2P81 A;  4MFE A;  1VND A;  5J1Y A;  2HOS A;  1IDZ A;  4LOC A;  1VFC A;  4MLO A;  1Z77 A;  4M3F A;  4JYK A;  1UMQ A;  1MBG A;  1RES A;  2MG4 A;  5JLX A;  5DTD A;  1OFC X;  5IP9 J;  1XC5 A;  1RET A;  3HEF A;  2XPV A;  1X2N A;  2YU9 J;  2E2I J;  2HXO A;  4XRS A;  2JWT A;  3G1O A;  3DCF A;  5IYB J;  3CQZ J;  2R0Q C;  4A3M J;  5F27 A;  4J19 A;  1MBK A;  5FKL A;  4A3E J;  3BG5 A;  2FD5 A;  3OSF A;  4C3J J;  4XRM A;  4M3B A;  4DZP A;  2ECC A;  3HBL A;  3GTP J;  4V2G A;  3UKG A;  1H89 C;  1DU6 A;  3HDD A;  5FKO A;  5E3N A;  1B8I B;  2DJN A;  4A3G J;  1F36 A;  3ZQC A;  3HOV J;  4UUS B;  3I4N J;  1U78 A;  3K2A A;  2HYJ A;  2NOG A;  3SFI A;  1SFO J;  1MSE C;  1TWH J;  2HI3 A;  1E3O C;  2VKE A;  1K83 J;  5M3F J;  1JKP C;  1MBH A;  5EG0 A;  4NDL A;  4XID A;  1GV2 A;  1MBE A;  2LK2 A;  1F43 A;  5K7Z A;  4FTH A;  3S14 J;  4Y52 J;  4FCY A;  1IGN A;  2E2J J;  5EZH A;  3BTC A;  3HGG A;  1JJ6 C;  3Q0W A;  3JRE A;  4A3K J;  2VKV A;  1GDT A;  3BR2 A;  2M0C A;  2EZH A;  1U8B A;  1ZQ3 P;  1GV5 A;  2M34 A;  2VPR A;  2LFB A;  3JR9 A;  5C44 J;  3F0C A;  2YUS A;  3RQI A;  4C3I J;  2Y0S N;  3S1N J;  3O8G A;  1TWG J;  5EGO B;  2G0E A;  1MH3 A;  2M8G X;  4IHV A;  4DYC A;  2HOA A;  3VPR A;  1FTZ A;  3JRI A;  3JRB A;  1QRY A;  5FKK A;  3PO3 J;  1RKW A;  1ZKG A;  2W48 A;  1HCR A;  4A3J J;  1FIA A;  5GPC A;  4D5F A;  1LE8 A;  1IRZ A;  1B72 A;  3H0G J;  1IJW C;  1VI0 A;  2ZB9 A;  4C2M J;  2CQQ A;  1TWC J;  4GFB A;  2IEK A;  3HOZ J;  2HXI A;  3IV5 A;  3BR5 A;  1TWA J;  2E2H J;  1ETQ A;  1P7I A;  1Y1V J;  2TRT A;  4IHY A;  5F0C A;  1NK3 P;  3FK6 A;  3PO2 J;  2XPW A;  4JX4 A;  5EZG A;  3HGY A;  4DYQ A;  1AKH B;  3HOU J;  2R5Z A;  3LNQ A;  3JRC A;  1ZR4 A;  1K61 A;  1DU0 A;  2X48 A;  3JRH A;  4V2F A;  1G2H A;  1HDP A;  3L1P A;  2WV1 A;  2DMT A;  3BR3 A;  2KDZ A;  3QPS A;  4HNV A;  4QTR A;  4MO7 A;  3LSP A;  5C4J J;  4M3E A;  1JKO C;  3G1M A;  4FE4 A;  3S2H J;  4DZJ A;  3RZO J;  2HQ5 A;  2IAI A;  4UUT A;  2N8G A;  4G12 A;  1XS9 A;  5F1J A;  4QSH A;  2PMZ N;  1I3Q J;  2XGD A;  2CUE A;  3MVP A;  2JA7 J;  2NVQ J;  4A3D J;  3ZQF A;  2M9H A;  1JKQ C;  5EYR A;  1WH7 A;  2DA3 A;  3GTJ J;  2JA8 J;  5DS9 A;  2L7Z A;  4W1U A;  1BJZ A;  3LSR A;  4M6V A;  4JX6 A;  2GBY A;  4M3G A;  2Y9Y A;  3CMY A;  5EG0 B;  2HDD A;  1HOM A;  5FKN A;  2DA2 A;  1P7J A;  2DMP A;  3NAU A;  4W97 A;  4X6A J;  2QCO A;  2CU7 A;  1QPI A;  1A6I A;  4XIC A;  2M2E A;  3ZQG A;  4DYR A;  1BA5 A;  2O8K A;  2L7M P;  1JT0 A;  1IV6 A;  3HOW J;  3D1N I;  3FIS A;  5JLW A;  3BTL A;  1JUM A;  2ID3 A;  2AO9 A;  2JA5 J;  1FEX A;  1JTY A;  1U9O A;  2GM4 A;  1T33 A;  5GPA A;  2FX0 A;  3TP0 A;  1OCP A;  5E3M A;  2R92 J;  2MW8 A;  1NK2 P;  4BBR J;  3S1R J;  3IH3 A;  1QVU A;  3WHB A;  3CCY A;  3JRA A;  2MGQ A;  3S15 J;  5M5W J;  3C2B A;  4I76 A;  2DA4 A;  3ZQH A;  1RR7 A;  2XRL A;  5M5X J;  3G1L A;  3GTQ J;  4A3L J;  2R5Y B;  2HOT A;  2DMN A;  5FKM A;  1HF0 A;  1A5J A;  3QPL A;  2NS7 A;  3BTJ A;  1T56 A;  5EF6 A;  4B3A A;  3A01 B;  5FJ8 J;  5F04 A;  1ENH A;  1ETO A;  3DEW A;  2JA6 J;  1Z0X A;  2EZK A;  2EZL A;  1ETX A;  3FKI J;  1GT0 C;  3WHC A;  1X2M A;  1W0U A;  2K9N A;  3S17 J;  4FIS A;  1AHD P;  1D5Y A;  3Q0V A;  1B8I A;  4X1E A;  2EZI A;  3PM1 A;  2VUM J;  1IC8 A;  1BW5 A;  4BY1 J;  2EH3 A;  2DMU A;  4D5C A;  2DA6 A;  3HOY J;  5F08 A;  1LE8 B;  4D7M A;  4IEJ A;  4A69 C;  4XK4 A;  2K9S A;  2CJJ A;  1HDD C;  5IPA A;  2Y2Z A;  3LSG A;  3ZQL A;  3GTL J;  5IOY A;  1WCM J;  2WAQ N;  5J1U A;  4A3C J;  1TC3 C;  3JRF A;  1EF4 A;  1CQT A;  3GTG J;  1IUF A;  4L5E A;  1JUS A;  5C3E J;  3S1Q J;  1JGG A;  2Y30 A;  5FLV A;  4A3B J;  4IHX A;  1WGX A;  1RKT A;  2ME0 A;  4ABZ A;  1WI3 A;  1SAN A;  3GTO J;  3I4M J;  3M3Y J;  2GLO A;  3OSG A;  1UG2 A;  2MSY A;  2NVT J;  3IH2 A;  1IDY A;  5J1R A;  2LVS A;  2NVY J;  5M5Y J;  2CRG A;  2DMQ A;  5K7H A;  1B72 B;  2JN6 A;  3B6A A;  1ZK8 A;  3BR6 A;  1FTT A;  3BTI A;  5EEA A;  1PUF A;  3Q0U A;  3GTK J;  1JT6 A;  2K9Q A;  1RPW A;  1YRN A;  1I50 J;  4JP0 A;  3ZOB A;  3BQY A;  3IH4 A;  2JMW A;  1H88 C;  1ZGW A;  1MBF A;  1TWF J;  3S1M J;  5EGO A;  1VF9 A;  1GVD A;  2LTP A;  2LP0 A;  3LSJ A;  4RDU A;  4CYC B;  3JRG A;  2ECB A;  3O8H A;  4BKX A;  1HLV A;  2H1K A;  3BG3 A;  4EEF G;  3MKL A;  1BL0 A;  1BW6 A;  2L9R A;  1ETW A;  5E3O A;  3SDG A;  2AHQ A;  1ETK A;  3S2D J;  4D7N A;  5IOZ A;  5IP6 A;  5HOD A;  1ETV A;  2KT0 A;  1MSF C;  3M4O J;  3BT9 A;  2TCT A;  3HOX J;  2JK3 A;  4XRS G;  1I6H J;  4MIM A;  2O9L A;  1FJL A;  2XPU A;  2X9D A;  3BR0 A;  4UUS A;  2OPT A;  1POG A;  1APL C;  2XGC A;  4CYC A;  3W6V A;  3BR1 A;  4B1R A;  2JJ7 A;  2ID6 A;  2E1O A;  2ELK A;  3GBG A;  4M3D A;  2O7O A;  3TP3 A;  4AC0 A;  2R93 J;  2DTZ A;  1R9T J;  1Y1W J;  2EBI A;  2OF7 A;  2LD5 A;  2LR8 A;  2FJ1 A;  5E3L A;  1S7E A;  3TW7 A;  1LFB A;  1WH5 A;  1FIP A;  3RZD J;  1AU7 A;  1OCT C;  3JRD A;  2YS9 A;  1LFU P;  2NVX J;  3OIO A;  5J3L A;  4JX5 A;  2FQ4 A;  3CDL A;  4A3F J;  2LY9 A;  2L7F P;  3OOU A;  1MBJ A;  2DA5 A;  3NAR A;  5IYC J;  2R5Z B;  1ZR2 A;  1GUU A;  3A03 A;  5IP7 J;  2R7Z J;  5FLM J;  1O4X A;  5IYD J;  2IBD A;  1XG1 A;  2LKX A;  2VI6 A;  3RKQ A;  2Y9Z A;  3K7A J;  2LLK A;  2XB0 X;  3BG9 A;  2CUF A;  3HB9 A;  3MN2 A;  4C3H J;  1MNM C;  1U9N A;  4MFD A;  2QF7 A;  1JJ8 C;  9ANT A;  2R5Y A;  3H3V K;  2DA1 A;  5C4X J;  2XGE A;  5BNG A;  3TED A;  1YRN B;  2D5V A;  3SJM A;  2EQR A;  2CQX A;  2RAE A;  2Y31 A;  4FE7 A;  4IHW A;  1UHS A;  2I10 A;  2H8R A;  1ETY A;  2NS8 A;  2WB1 N;  5EDN A;  3HKZ N;  3Q3S A;  2X6O A;  1QVT A;  2L0K A;  2E19 A;  3HM5 A;  3GTM J;  1AKH A;  1WPK A;  4QIW N;  4BBS J;  2DA7 A;  4DW6 A;  2XB5 A;  5K7F A;  3LOC A;  3B6C A;  4BY7 J;  1ITY A;  1ZTR A;  2K40 A;  4AUX A;  4BXX J;  1Q1V A;  3E7L A;  1W0T A;  3ZQI A;  3QQA A;  4B4C A;  3A01 A;  1NTC A;  4Y7N J;  5M3M J;  5F0F A;  3BQZ A;  2ME6 A;  3TW6 A;  4S0H B;  2COB A;  4I6Z A;  1JKR C;  1ORK A;  1X58 A;  1PUF B;  1JUP A;  3FK7 A;  3FIW A;  3S16 J;  1MH4 A;  1H8A C;  4RBO A;  4A93 J;  1OJL A;  5F0H A;  2XSD C;  4AYB N;  2DN0 A; 
#chains in the Genus database with same CATH topology
 2ZJ2 A;  2H1L A;  1B4A A;  2L7K A;  3KZI C;  4NQW A;  4BEH B;  2BVM A;  1IG7 A;  5ILS A;  4IOC F;  3ZR8 X;  3SZG A;  3KZZ A;  1RUO A;  3FWE A;  5LLQ A;  5EEH A;  5ICG A;  5KHD A;  4CO8 A;  4MLO A;  3Q9S A;  1MBG A;  1RES A;  2MG4 A;  1G59 A;  2M45 A;  5DTD A;  5FLX K;  4N9H A;  3HEF A;  3CJT B;  3ZGK A;  4B44 A;  4B48 A;  2E2I J;  3TQN A;  1BI2 A;  3G1O A;  4LB5 A;  3CQZ J;  3UNG C;  2AQF A;  5F27 A;  2EFQ A;  4RGR A;  4CH7 A;  1XMX A;  2BW3 B;  4B47 A;  2FRH A;  4LD5 A;  1T08 B;  5FKL A;  1RC9 A;  2DLL A;  2EIL H;  4HNT A;  1O57 A;  2EFW A;  1J5Y A;  1N78 A;  1JHF A;  2ECC A;  1VQ4 I;  3HBL A;  2EJR A;  1JE8 A;  4QPQ A;  2IT0 A;  4A3G J;  2NNY A;  3QOE A;  2A6E F;  4N4N B;  1IO2 A;  3G4S I;  1U78 A;  2HYJ A;  5FGM A;  5BPI A;  2HI3 A;  5A2Q K;  4HLY A;  4HDU A;  1OPC A;  2VKE A;  3C1D A;  3GME A;  5EG0 A;  3GFM A;  4K2E A;  2CV0 A;  1MBE A;  2LK2 A;  5GAH J;  5B1A H;  1KU2 A;  1F43 A;  2L9V A;  1B9N A;  1TQM A;  4FTH A;  4FCY A;  3QPH A;  4Y17 A;  2E2J J;  3BTC A;  3HGG A;  1JJ6 C;  4BHP A;  1XDS A;  2R3S A;  2EPF A;  3X2Q H;  1OCO H;  2M0C A;  4F55 A;  1U8B A;  3LSK A;  3FXM A;  2M34 A;  3OV8 A;  2F5C A;  2LFB A;  1ZAR A;  1S5L C;  5CVV A;  4E7L A;  1NG7 A;  1TQP A;  1BIA A;  2JPB A;  2NS0 A;  3AL0 C;  3OR2 C;  5DYM A;  3K4L A;  2EB7 A;  2ZSI B;  4WK8 F;  3ZP5 A;  2BGC A;  4XLE A;  3J7A O;  4A12 A;  3JRI A;  1R4N B;  4EMS A;  2XSJ C;  1XDU A;  4I0A A;  4HX8 A;  3RQ4 A;  3G2B A;  1VQ9 I;  5FKK A;  4ZYH A;  5IT9 K;  1WJE A;  1IN7 A;  2X1E A;  5FFX A;  3RYR A;  2XKO A;  3LQR A;  5J6X A;  1B72 A;  1XX5 A;  3MCZ A;  3WTS C;  4BEH A;  2IEK A;  1E0E A;  1LVA A;  1UZC A;  2ZNY A;  3E0J B;  1E3H A;  3EYI A;  2XGX A;  2IGK A;  4IQJ A;  5D6F A;  3I54 A;  3MKW B;  2HNH A;  4OMZ A;  2WY7 Q;  3MD2 A;  1IXR C;  5HS8 A;  5J47 A;  2MAB A;  1FMV A;  2K3F A;  3MMY B;  4S05 A;  4JX4 A;  5ICC A;  2KHM A;  2MC4 A;  2GWR A;  4DYQ A;  1Z6T A;  4AWX B;  1ZR4 A;  1DU0 A;  4KMU X;  5D4R A;  1O3S A;  3L1P A;  2DO7 A;  3D0S A;  3BR3 A;  3MAJ A;  2WA0 A;  3P9K A;  4BJ6 C;  4QTR A;  3LSP A;  4LLN A;  2NAZ A;  4RLQ A;  4M3E A;  5A2Q Z;  4FE4 A;  4DZJ A;  3CME I;  2HQ5 A;  1D1C A;  1YIO A;  3HSF A;  3HKZ A;  3TDZ C;  3FXQ A;  4N0B A;  1T2K A;  2G9W A;  2O3F A;  5DDG A;  4RB0 A;  2NVQ J;  1SVM A;  4E7I A;  2LH9 A;  2PJP A;  2WBM A;  3HXL A;  3JSO A;  2IW5 A;  4O3M A;  2L7Z A;  5CKT A;  3U1K A;  4JX6 A;  2GBY A;  2RRE A;  1Z05 A;  3IAS 2;  4UV9 A;  2DAO A;  3IC7 A;  2L02 A;  4L9V A;  4ZTF A;  2W25 A;  3CMY A;  3J80 Z;  2ZKZ A;  1YIT I;  1KON A;  1S29 A;  1P7J A;  1X3W B;  2HYG D;  3DLA A;  4W97 A;  3TGN A;  3OOP A;  3HRS A;  4Y4R A;  1YG2 A;  2CMP A;  5JHU A;  2A68 F;  2FEZ A;  3VDX A;  2IS6 A;  3CJQ B;  4BDY A;  1LQ1 A;  2M2E A;  1FWZ A;  3CO6 C;  3OR1 C;  3CCJ I;  1ACI A;  2CWE A;  3WTV C;  1JT0 A;  2F4M B;  4KIT B;  3I55 I;  1R6R A;  2DOE A;  2CGP A;  1HW1 A;  3U1D A;  2ID3 A;  5LEJ A;  1YIJ I;  3WGH A;  4P55 A;  2KRF A;  3BZK A;  5LHH A;  2VJJ A;  3DPL C;  3CP2 A;  3TP0 A;  1OCP A;  2KKO A;  2NOJ B;  2EFO A;  4P9F A;  1SD7 A;  5FFZ A;  1QVU A;  4CZZ A;  3FXR A;  3CCY A;  2K7L A;  4UB8 C;  1O3Q A;  3ZQH A;  4KFC A;  4EAT A;  3G1L A;  3ZMS A;  2RNG A;  2OCE A;  5CVJ A;  2DMN A;  4HF2 A;  2NRA C;  4ZYD A;  3IHU A;  3GO5 A;  4U0W A;  3OYI A;  3MZH A;  1KYZ A;  3G3Z A;  3BTJ A;  2CUZ A;  2IS1 A;  2UWM A;  1T56 A;  1XCB A;  5EF6 A;  2YSR A;  4B3A A;  2VQG A;  5F04 A;  1OCR H;  3LSH A;  2JA6 J;  2EZL A;  1ETX A;  3FKI J;  1GLN A;  4YRV A;  3HYI A;  3WHC A;  3W2V A;  2Z3Y A;  4PCQ A;  1W0U A;  4FIS A;  5FB2 A;  1D5Y A;  1ZRC A;  4X1E A;  3GFL A;  2EZI A;  3MWM A;  2VUM J;  1BW5 A;  4XN0 A;  1A31 A;  2A5W A;  2DMU A;  2PMU A;  3CUQ C;  3A4C A;  3TOB A;  5F08 A;  3WTZ A;  2QKL B;  1W1W E;  2CO5 A;  4A0Y A;  2LOO A;  3GZ5 A;  4RAY A;  1O3R A;  4A69 C;  1QPM A;  2K9S A;  3F21 A;  3R0J A;  4NBQ A;  4LLL A;  2JQ7 A;  1HDD C;  5E1W A;  2JSP A;  2Y2Z A;  1RI7 A;  3ECO A;  1ULY A;  2VJ4 A;  2M4K A;  4LG0 B;  2QM3 A;  1KYW A;  3H9J A;  3RDI A;  1X19 A;  3KYC B;  3NEU A;  2IGO A;  1ZLJ A;  1H0M A;  3BOQ A;  2VKD A;  4ENJ A;  4L5E A;  2X85 A;  4EJU A;  3GW2 A;  2OZ6 A;  3LMM A;  5BOX A;  1R22 A;  4G6Q A;  4IHX A;  3HG9 A;  2ZXW H;  1Y0N A;  1RKT A;  2VLA A;  1WI3 A;  4HQM A;  2DU9 A;  4X0G A;  1PJR A;  4E7K A;  3R4K A;  4LIV A;  2GLO A;  2ADU A;  1SC7 A;  1T95 A;  2FA5 A;  1HSJ A;  1LDJ A;  2NVT J;  2L3D A;  4ZDL A;  1VQL I;  2X1D A;  3CCV I;  2LC2 A;  4RB2 C;  3KP4 A;  1FZP B;  1ZK8 A;  4PJ0 C;  3BR6 A;  2A5Y B;  2HQA A;  4HZF A;  2L9S A;  2V6E A;  4OAZ A;  3F8F A;  2VE9 A;  3GTK J;  2BHZ A;  1LEA A;  1VQ5 I;  2DK5 A;  4IRG A;  2GXB A;  3CO7 C;  3I59 B;  1R23 A;  1MDM B;  2OC6 A;  1UST A;  3ZOB A;  2D1V A;  3BQY A;  2JMW A;  1ZGW A;  2K27 A;  4PJJ A;  4ITV A;  1WJA A;  3DBH B;  4XLA A;  3ABU A;  1HST A;  1VF9 A;  3F3X A;  4WXH A;  4XLH A;  1GVD A;  4RDU A;  1TL8 A;  1FBS A;  4QLC U;  3F6V A;  2ECB A;  3KPH A;  5B1B H;  2EIN H;  3DFG A;  2VT2 A;  5H6R A;  3BG3 A;  3MKL A;  2DCE A;  4Z6Y A;  2ZCW A;  1BL0 A;  1TT5 B;  2L9R A;  4YFN F;  4U0V A;  1ZAO A;  4EVI A;  3GX4 X;  1KGS A;  4PJL A;  4PFO A;  2HEO A;  4HYE A;  4IVN A;  5IP6 A;  3QYE A;  4AD9 A;  4EJO A;  1ETV A;  4GRI A;  4BDZ A;  1MSF C;  4WCG A;  4LLG F;  3BT9 A;  3K1P A;  2YX4 A;  4XQF A;  1AWC A;  2PLY A;  4IJA A;  2M4G A;  2OTJ I;  4BJT A;  2O9L A;  1FJL A;  2XPU A;  4KNY A;  2W84 A;  1SD5 A;  2FE3 A;  4IO9 F;  1POG A;  3VEP A;  2Z16 A;  2DQR A;  3ZMU A;  2NYX A;  1K4S A;  1OYI A;  3HOT A;  2CW7 A;  2FOK A;  3K1M A;  3GBG A;  1XGN A;  2NNN A;  2O7O A;  2OF7 A;  2K02 A;  4IZZ A;  1W4M A;  4E70 A;  1LB2 A;  2ZBK A;  4I01 A;  5E3L A;  2WAD A;  1AU7 A;  2HTS A;  3RZD J;  2YS9 A;  1LFU P;  2VJI A;  1KU9 A;  2D45 A;  4XKV A;  1ZG5 A;  4JX5 A;  2FQ4 A;  2LBF A;  2VL8 A;  3OS1 A;  5LGU A;  4LIU A;  1TLH B;  1GUU A;  1S9H A;  1S8N A;  4M72 A;  2LSO A;  5E1X A;  2R7Z J;  1O4X A;  4LK1 F;  3Q5F A;  1A6Q A;  2RKH A;  3FF5 A;  1IV8 A;  5ED4 A;  2KP6 A;  1D0Z A;  2VI6 A;  2Y9Z A;  3K7A J;  1W5C C;  1WJC A;  3M1C A;  2EIJ H;  2X4H A;  3CUQ A;  3MN2 A;  3W2A A;  2XAJ A;  1U9N A;  2R7T A;  2PMH A;  1MJB A;  1JJ8 C;  2V26 A;  2KIM A;  2DA1 A;  3WG7 H;  3GFJ A;  1D1A A;  4UUV A;  5BNG A;  1YRN B;  3CP8 A;  2D5V A;  4GXO A;  4ESJ A;  2RAE A;  2VBY A;  2OCC H;  1J7K A;  1UHS A;  2I10 A;  3I0T A;  3F8B A;  5F6F A;  2NS8 A;  2WB1 N;  3WTW C;  4HDV A;  1XSX A;  3HM5 A;  2E19 A;  3AG1 H;  1K79 A;  1MD0 A;  1MGT A;  4LFU A;  2DA7 A;  1LUJ B;  1ITY A;  3E6M A;  2E60 A;  4ETS A;  3K4M A;  2E7W A;  4EV0 A;  5LD2 C;  4BH9 A;  1Q1V A;  2A3S A;  2M5W A;  1ZEL A;  2VON A;  1W0T A;  3ZQI A;  1F9N A;  3QQA A;  4ESB A;  1SD6 A;  1NTC A;  3GVA A;  1YX3 A;  1N25 A;  2ME6 A;  1BR1 A;  2COB A;  4S0H B;  4NHJ A;  1FYL A;  1J2X A;  5E18 F;  4Y13 A;  1FSH A;  1JUP A;  1JHH A;  3FIW A;  3FK7 A;  3JAM K;  3AL0 B;  2VQL A;  1U5T A;  4RBO A;  2XSD C;  5DUK A;  1MKM A;  3OYB A;  3WOD F;  1YI2 I;  4B09 A;  5GP9 A;  1P4A A;  1V5E A;  4RAZ A;  2FNP A;  2GOM A;  3I5U A;  4PSX A;  2HKX A;  4P96 A;  4LOC A;  1T0F A;  4Y15 A;  3I64 A;  2L01 A;  1LFP A;  2O8X A;  3AG2 H;  3DPT A;  4A0Z A;  2ZXI A;  4M3F A;  4P1W A;  4E7J A;  1FT9 A;  3HL2 A;  5JLX A;  2FU4 A;  4UVB A;  4OWR B;  2FF4 A;  3ZMZ A;  1XC5 A;  1RET A;  3F8C A;  2YU9 J;  4CCO A;  3ELK A;  4B8X A;  1VQK I;  3BG6 A;  4MHG A;  3T8T A;  1W5S A;  1YX5 A;  3BPX A;  4Y3O A;  4A3M J;  1QU3 A;  3PJR A;  2QBY A;  4YFK F;  4OIP F;  5HDK A;  5D5U B;  1MW7 A;  1W5T A;  4FHT A;  4NQW B;  2Z33 A;  1MBK A;  4J19 A;  3OSF A;  3BG5 A;  2OTL I;  3OIQ A;  2B7E A;  2DJI A;  1K6O A;  2OZU A;  4WWC A;  4DZP A;  3QAH A;  1R5I D;  4IQ4 A;  1H89 C;  1DU6 A;  1IN4 A;  3KIO A;  4HST A;  1BI3 A;  3EPZ A;  4EGZ A;  5DM6 F;  1FOK A;  4EGY A;  1F36 A;  2X1C A;  2D1H A;  2MC3 A;  3LQQ A;  3KP6 A;  3VWB A;  1TWH J;  4F3Q A;  2LF8 A;  3S3O A;  1E3O C;  2KLO A;  2HZD A;  2L54 A;  4AYB A;  1MBH A;  1GV2 A;  1LDK B;  2K86 A;  1SMT A;  1DPR A;  4GGG A;  2ZSH B;  2Y0M A;  1WJ5 A;  5K7Z A;  3K9T A;  3S14 J;  4Y52 J;  3V8K A;  2HQN A;  3SFZ A;  1T0F C;  5D5X B;  4IOA F;  1F1Z A;  4DBQ A;  5H6Q A;  3K0L A;  3JRE A;  4A3K J;  2K9M A;  2EZH A;  3J7Y J;  1RRJ A;  1ZQ3 P;  1GV5 A;  2O6G E;  2DYR H;  2ZME B;  3JR9 A;  3KEO A;  3F0C A;  4N9I A;  2CS3 A;  1W36 C;  3PFI A;  3RQI A;  2V1X A;  4KJZ A;  4ZDO A;  1ZHF A;  3S1N J;  1U5T C;  2COM A;  2ISY A;  2W4S A;  3U2R A;  3LAJ A;  2FMY A;  2IP2 A;  3MKZ A;  2QQB A;  1VQM I;  4IHV A;  2TDX A;  3CDH A;  3G6E I;  5CVR A;  4DYC A;  3TBI A;  1FTZ A;  2VKH A;  4KIB A;  1ZRF A;  2ICW G;  2H6B A;  2P5K A;  1S7A A;  1UB9 A;  3AG4 H;  3CLQ A;  1FBQ A;  5J40 A;  1Y56 A;  1RKW A;  1ZKG A;  1FBU A;  2W48 A;  5D4S A;  1HCR A;  1FIA A;  5GPC A;  4D5F A;  2OQG A;  3KCC A;  4DGW B;  1LE8 A;  1P6R A;  5H2F C;  1IJW C;  2ZJR F;  1I6X A;  1VI0 A;  3IWF A;  2UUZ A;  2CQQ A;  5AIQ A;  2HXI A;  3RKX A;  4AM3 A;  3MKY B;  3BR5 A;  3ZQQ A;  1MND A;  1G8X A;  2ESN A;  4XKW A;  3FK6 A;  2F48 A;  1FPQ A;  1Y6I A;  3OMY A;  4H4K C;  4HRI A;  2XPW A;  2VOD A;  1HKQ A;  3F8M A;  2ZNZ A;  3CCE I;  2LKP A;  5EZG A;  5LRS A;  1YO5 C;  3HGY A;  4RGS A;  2OBP A;  1YS6 A;  4CSW A;  1UHM A;  1Z7U A;  5HOO A;  1FP1 D;  5B5E C;  3OYD A;  4V2F A;  3S32 A;  3ZXS A;  3M7G A;  3QP5 A;  3HRT A;  3OYK A;  3QPS A;  4E6K G;  3CJR B;  5CQE A;  2IGM A;  2DBB A;  3HPH A;  3ERE D;  2VC0 A;  3G71 I;  3RZO J;  2JUG A;  3H9G A;  3E5Q A;  3LWF A;  2CYY A;  2N8G A;  1WRJ A;  4G12 A;  2XIG A;  2BW3 A;  3K4B A;  4A6D A;  3V42 A;  3BCA A;  5K5O A;  1AA7 A;  3TDU C;  2C6Y A;  3JSP A;  3ZQF A;  4A3D J;  4RLF A;  5EYR A;  3GTJ J;  5DS9 A;  2P4W A;  1HKT A;  2V9P A;  3A1Y A;  3LSR A;  1X4O A;  3V8L A;  3ZCO A;  2W7N A;  4M3G A;  1UFM A;  3ASN H;  5FD5 A;  5DEQ A;  1K7A A;  1V4R A;  2Y9Y A;  2EV0 A;  2HDW A;  3CUQ B;  4JOM A;  5EG0 B;  3QU6 A;  4U7D A;  4YIF A;  1HOM A;  2DA2 A;  2F4I A;  2MH9 A;  2E1C A;  3BJO A;  4UVC A;  2UV1 A;  2QCO A;  2XKP A;  2CU7 A;  1ON1 A;  4XIC A;  2QEX I;  1R5G A;  3OYM A;  1F5T A;  3SEZ A;  3DBR B;  3R0A A;  1BA5 A;  4UNO A;  1KZH A;  5LGT A;  4RGU A;  5BMZ A;  1IV6 A;  2MLG A;  2YX7 A;  3FIS A;  4PZJ A;  1E17 A;  1JUM A;  1ZYR F;  2HFH A;  2AO9 A;  1FEX A;  1XGO A;  4P5O A;  2LY1 A;  2GM4 A;  1T33 A;  4MQ9 F;  3I9V 2;  2R7O A;  4HOB A;  4ON0 A;  4CCM A;  2BZT A;  2R92 J;  2MW8 A;  2P6S A;  3KP2 A;  3S1R J;  3IH3 A;  3JRA A;  3N97 A;  4B3X A;  2HYF A;  4F91 B;  3S15 J;  4RB1 A;  4RAF A;  5M5W J;  1I1S A;  2Q2E A;  2DA4 A;  3IUO A;  1RR7 A;  2XRL A;  5M5X J;  3CMM A;  5D5V B;  1XMA A;  3IKV A;  5JI6 A;  3DF8 A;  2ESH A;  4OIO F;  2HOT A;  1LNW A;  2O61 A;  2QA4 I;  1TQI A;  1VQ7 I;  3T8R A;  2BOL A;  2NS7 A;  5GAE J;  3IRQ A;  1VQP I;  2PJR B;  2QKM B;  2B0L A;  2HGC A;  3VFZ A;  3GEZ A;  3TO6 A;  1VQ8 I;  3A01 B;  4CUG A;  5FJ8 J;  5KAF C;  2QSF X;  1Z0X A;  2UXN A;  3PNV A;  2W24 A;  4M74 A;  3QOD A;  4LK0 F;  4BHB A;  1GT0 C;  1X2M A;  1JXS A;  2FQ3 A;  2GA1 A;  3K4N A;  2K9N A;  5TIS C;  4KIF A;  3Q0V A;  2H27 A;  1BOB A;  3PM1 A;  3TO9 A;  4BY1 J;  1RZ4 A;  2EH3 A;  4BQN A;  3DKW A;  4G94 A;  3N05 A;  1SFX A;  3U9G A;  2ZXJ A;  4D7M A;  3BP8 A;  2PQ8 A;  4XK4 A;  1BJA A;  3K2Z A;  5GAD J;  1RIO H;  2CQK A;  3ZQL A;  1OKR A;  2IS4 A;  3GTL J;  2P5L C;  5IOY A;  2WAQ N;  4A3C J;  1FY7 A;  1TC3 C;  3KX2 A;  4R79 A;  4Q5S F;  3FXO A;  3L7W A;  3FM3 A;  3OY9 A;  3GTG J;  3BG7 A;  2WV0 A;  5LRR A;  1IUF A;  1K4T A;  3BWG A;  3DXJ F;  4C2T A;  4EJT A;  1JGG A;  5FLV A;  1IF1 A;  4A6E A;  1L0O C;  2BEO A;  1HXD A;  1V3F A;  5D8L B;  3LA2 A;  2PMZ A;  1SAN A;  4OOI A;  3I4M J;  2KFD A;  3WE2 A;  3R60 A;  2IS2 A;  4NUB A;  2AXL A;  3C2H A;  4C30 A;  4OIN F;  1OR7 A;  1Z3Y A;  3WG9 A;  3DKX A;  5M5Y J;  2CRG A;  4LG0 A;  2KIS A;  1T6S A;  3HRU A;  1DP3 A;  2JN6 A;  3B6A A;  4RAG A;  5HLI A;  2G7U A;  1FTT A;  3SYT A;  2V7F A;  2HPI A;  3IP4 B;  3JAM Z;  5HVQ C;  3PL8 A;  1XCV A;  1O7F A;  4ESF A;  1PUF A;  2Z2S B;  1JT6 A;  2MD5 A;  2K9L A;  3FMR A;  3I71 A;  2IRF G;  1YJW I;  2M7B A;  2FBK A;  3PIO F;  4JQF A;  3GYH X;  2VBW A;  3C18 A;  1YFH A;  1H88 C;  5LFA A;  1MBF A;  2NXN B;  1XSD A;  1S6L A;  3S1M J;  3ZMT A;  5EGO A;  1Z3X A;  4RS8 A;  4ANJ A;  1Z21 A;  2LP0 A;  1I3A A;  2LTP A;  4M9X A;  1Y8R B;  3DTI A;  3RSN A;  4ZTJ A;  2QSG X;  2DW4 A;  2IGN A;  2VJ5 A;  1ON2 A;  2MH2 A;  3P7N A;  3JRG A;  3GCM A;  2BY2 A;  4BKX A;  1R49 A;  2GIZ A;  2CG4 A;  4ZDP A;  2EA4 A;  2ZME A;  3NWT A;  1O3T A;  3VYU B;  1BW6 A;  1ETW A;  3KYL A;  2UZK A;  1R4M B;  3K70 C;  4UB6 C;  3LST A;  3CLO A;  2TCT A;  4L5I A;  3W6K B;  1K78 A;  1IUY A;  3FXK A;  5E17 F;  3HIF A;  3CD6 I;  3OIP A;  4AIK A;  3L2R A;  2HDC A;  4MIM A;  1I6H J;  1UHW A;  3BR0 A;  3L00 A;  2KIU A;  2DYS H;  4OAY A;  3K70 D;  4HV5 A;  1XB4 A;  2JJ7 A;  2MBF A;  2ID6 A;  2LRE A;  4M3D A;  1OQY A;  5L3D A;  4KA4 A;  1Y1W J;  5L3C A;  2LD5 A;  2LR8 A;  3B73 A;  4M71 A;  4RGX A;  2VB6 A;  1MMS A;  2DOF A;  2KPM A;  4IRH A;  4CCK A;  4ASN A;  4CIC A;  2EA2 A;  2F5D A;  1LFB A;  1WH5 A;  3TW7 A;  1ONV A;  4E7Z A;  3EDP A;  3QWL A;  4DIQ A;  3OIO A;  3H0D A;  2KZV A;  4PFP A;  5J3L A;  3BCB A;  1ZRD A;  4IF4 A;  2ZFW A;  2XF5 A;  2JT1 A;  4BXU A;  2L7F P;  3RYP A;  3TL4 X;  1X1B A;  5E1Z B;  5IYC J;  5HS7 A;  2GA2 A;  2F4O B;  3JTH A;  4IX7 A;  3ABT A;  3BPV A;  2R7W A;  4CGZ A;  2BY1 A;  5IYD J;  2FBH A;  4ENM A;  1OMI A;  2IBD A;  4PJM A;  2IA1 A;  4I02 A;  2M87 A;  3BG9 A;  4YG2 F;  1MNM C;  2ZO4 A;  3FM5 A;  1P4X A;  2QF7 A;  5J8F A;  1XMK A;  2FXA A;  3RPU D;  9ANT A;  1UJ8 A;  5CQG A;  4GYG A;  1SVO A;  2DQL A;  3H3V K;  3E3V A;  4BE1 A;  1Z67 A;  4CCN A;  2CV1 A;  3BY6 A;  3H1C A;  4ZZD A;  3PUF A;  4S04 A;  3CES A;  2P8T A;  4HW0 A;  2QLZ A;  2GZW A;  2EQR A;  4FE7 A;  4RB3 C;  4XBF A;  3J7A Y;  1BI1 A;  3F72 A;  2M3A A;  1ETY A;  3S93 A;  4A5M A;  5K5Q A;  2DT5 A;  4YEJ A;  4E4H A;  3Q3S A;  1TP4 A;  2Z5U A;  1QVT A;  2LYC A;  1BI0 A;  1G6N A;  1DDN A;  4IKF A;  2JPC A;  3GTM J;  1WPK A;  1W7P D;  2F5E A;  2XB5 A;  1ZRE A;  3CZ6 A;  3LOC A;  3N4M A;  1X3U A;  1ZTR A;  1B1B A;  4AUX A;  4LGW A;  4BXX J;  3COA C;  3E7L A;  2VQH A;  2L4A A;  4UXN A;  1O7L A;  3WTX C;  1WJF A;  3SZP A;  3I56 I;  4IHS A;  4Y7N J;  1C0W A;  3K1N A;  2R7V A;  1Y8Q B;  4BQA A;  3TW6 A;  4I6Z A;  3S3N A;  4E7S A;  1L3L A;  2HVR A;  2OD5 A;  1X58 A;  3OS2 A;  5BQT A;  1SEU A;  4F92 B;  3S16 J;  2R7U A;  5JVG F;  1DGW Y;  1H8A C;  4F52 A;  4AYB N;  1JTX A;  4ZYG A;  3AFH A;  4OIR F;  2ZJQ F;  2P81 A;  4I99 C;  1HA8 A;  1VND A;  3KP3 A;  2EWN A;  2HTJ A;  1IDZ A;  2I8D A;  3M8F A;  2E34 A;  2VC1 A;  1V55 H;  2V9V A;  1PP7 U;  3ZPL A;  1MJ9 A;  1Z77 A;  4UV8 A;  3CCL I;  4JYK A;  3VOE A;  1YW9 A;  2V79 A;  1UMQ A;  1T39 A;  3ONQ A;  1U6G A;  2J5O A;  3REO A;  5IP9 J;  1DGR M;  2LBF B;  1YQA A;  4F93 B;  1IXS B;  2JVH A;  2XPV A;  1X2N A;  5DM7 F;  3WTT C;  2V6C A;  5HNH A;  4Q4Z F;  2HXO A;  2JWT A;  3T1B A;  3WTU C;  2OUM A;  5IYB J;  2OA4 A;  2R0Q C;  4HA8 A;  1IRG A;  1HQC A;  2FML A;  4UVA A;  1DQU A;  2GAU A;  1IXC A;  1NG6 A;  4HLX A;  4U0Y A;  4A3E J;  3IKT A;  4M3B A;  4WXC A;  1OCZ H;  1S7O A;  1K6Y A;  3HDD A;  5FKO A;  2UXX A;  2DJN A;  3ZQC A;  3HOS A;  2XAF A;  1X3Z B;  1HBX G;  1MSE C;  5K1Y A;  1D0Y A;  2W00 A;  1IRX A;  5IT9 Z;  5E8G A;  2QSH X;  1K83 J;  4NDL A;  4XID A;  3CCS I;  1MIJ A;  4I09 A;  1RR8 C;  1GHC A;  2GOX B;  3EUK L;  2RDP A;  2O0Y A;  1QQI A;  3WGG A;  3WU0 A;  2HR3 A;  4ZYE A;  4L9N A;  1B6A A;  5EZH A;  1LKX A;  2XHK A;  4HV6 A;  3PSF A;  2VKV A;  1GDT A;  3BR2 A;  1B9M A;  2K4B A;  4DOZ A;  4D9J A;  3OYJ A;  2Y48 A;  4F7Z A;  1STZ A;  5C44 J;  4V19 K;  4C3I J;  3OYA A;  3OYF A;  1QGP A;  4ENN A;  2OJE D;  4RA2 A;  4YFX F;  3WU1 B;  2CV2 A;  2ELJ A;  1MH3 A;  2G7H A;  2M8G X;  4YII A;  1H9G A;  1QHH D;  2HOA A;  3RKY A;  3VPR A;  3GFI A;  1HW5 A;  3CC4 I;  2F2E A;  5B3S H;  1PUE E;  3JRB A;  1QRY A;  3GUD A;  2A6T A;  3FBN B;  4BE0 A;  1D5V A;  2QUF A;  1XTA A;  1V5G A;  5CJ9 A;  3CJN A;  3H0G J;  1LEB A;  2EV6 A;  4C2M J;  3DLL F;  1TWC J;  1XGS A;  3IV5 A;  3HOZ J;  1YE9 A;  2XAS A;  1MNE A;  4G7H F;  2E2H J;  1ETQ A;  2JRM A;  4HBL A;  3OYH A;  1Y1V J;  2TRT A;  5J8C A;  2Q1Z B;  2DPD A;  1WWX A;  5F0C A;  3VSL A;  2ZXH A;  4IXA A;  1E2X A;  3L2W A;  3FMQ A;  3ULQ B;  2X6X A;  2E1M B;  5CPR B;  3I58 A;  5LBQ A;  1QHG A;  3KE2 A;  4HF1 A;  2GXA A;  1DPU A;  3DV8 A;  1YTY A;  3HOU J;  4CCL A;  2R5Z A;  3LNQ A;  1FYK A;  1J0R A;  2X48 A;  3JRH A;  1W36 D;  1G2H A;  4LIT A;  2DMT A;  2KDZ A;  4MO7 A;  3KEY A;  3ZMD A;  3RI4 A;  4NNJ A;  2DT7 B;  1JKO C;  3FBI B;  4G6T B;  3S2H J;  4RM2 A;  1B59 A;  2IAI A;  2H8W A;  4EQQ A;  2Y69 H;  3AAF A;  3LA7 A;  2A07 F;  2AQE A;  2JVG A;  3F6O A;  2HU9 A;  3C7J A;  1R36 A;  4QSH A;  3TKY A;  3NRV A;  3DWL E;  1I3Q J;  1YJ9 I;  2XGD A;  4AVP A;  2CUE A;  3MVP A;  3KP5 A;  3RCO A;  2JUC A;  5DD8 A;  1JKQ C;  1WH7 A;  2DA3 A;  2JA8 J;  3E1S A;  2DOA A;  2X51 A;  4KUM A;  3F23 A;  4M6V A;  4ENK A;  4XN3 A;  4HQE A;  2E36 A;  1QZZ A;  1ZG3 A;  1GXQ A;  2KJB A;  2XRN A;  5H20 A;  1RUN A;  2HDD A;  2VOO A;  4L5J A;  1YHQ I;  5GAG J;  1X1P A;  3NAU A;  3FXJ A;  4X6A J;  3RPQ A;  5CVU A;  4XLC A;  1QPI A;  3ZQG A;  1F4K A;  5TGT A;  5FRN A;  3DPU A;  3S3M A;  2L7M P;  2BBY A;  3EYY A;  3ZN0 A;  3H35 A;  4EM1 A;  5JLW A;  3BTL A;  3CUO A;  5CYV A;  4ZYA A;  4OMY A;  2EIM H;  3MQ0 A;  3SQN A;  1P4W A;  4M6X A;  3PNT A;  4FQG A;  4TV7 A;  4HNU A;  2FX0 A;  4DBR A;  4G7Z F;  5E3M A;  2E1M C;  2EFN A;  2R7F A;  3KEQ A;  3SXY A;  4ZZL A;  1VZ0 A;  5HS9 A;  2FNA A;  1Q1H A;  3WHB A;  5AON A;  2MGQ A;  1J59 A;  1J9I A;  3L9F A;  3HUG A;  4I76 A;  2P7C B;  4KIS A;  5LGN A;  3I4P A;  3GWZ A;  1FOW A;  5D8K B;  3I53 A;  4A3L J;  3EQL F;  3IL2 A;  3C3W A;  3QPL A;  3DU6 A;  4HX4 A;  2EIK H;  1SFE A;  4G9Y A;  5LEK A;  3KP7 A;  4CZC A;  1I27 A;  5E8I A;  1X1A A;  3FX3 A;  1EH8 A;  3LL7 A;  2RGV A;  3HHH A;  3DEW A;  1ODD A;  2XDV A;  1KQ8 A;  2R7X A;  4CHU A;  2EZK A;  3P5J A;  3M07 A;  4DJA A;  1KA8 A;  5BS6 A;  4J00 A;  2Q2E B;  2XAH A;  4U88 A;  4L9J A;  3PUB A;  4P9U A;  2QQ8 A;  4GO1 A;  1B8I A;  2KIF A;  5HNF A;  3OL4 A;  1WHU A;  1EH6 A;  5DV5 A;  2DA6 A;  3HOY J;  1YOV B;  4II2 A;  2HPM A;  1LE8 B;  3J80 K;  4NC6 A;  4BGD A;  4IEJ A;  3OL3 A;  3IRR A;  2CJJ A;  2LRD A;  1D3Y A;  3RJP A;  5TJJ A;  5IPA A;  4KMF A;  3LSG A;  5JHF A;  3FDY A;  4N4O B;  4D0P A;  1WCM J;  3J81 Z;  4E7H A;  1R71 A;  3A0B C;  1HKS A;  2BY3 A;  4R1H A;  1EF4 A;  3QYF A;  3M8J A;  1WZ2 A;  4KIC A;  1CQT A;  3HPG A;  4BJ5 C;  4IRI A;  1ERD A;  5CVI A;  4FX0 A;  3S1Q J;  2LDU A;  3MEX A;  2R7Q A;  2WAF A;  1OYW A;  1IRF A;  3CF5 F;  1TZL A;  1WGX A;  2ME0 A;  5FRM A;  2W85 A;  3VSK A;  1P9Q C;  2A69 F;  2HOE A;  1QO0 D;  3OSG A;  3LFU A;  3CC7 I;  2KZG A;  3EET A;  5K5R A;  3IH2 A;  1IDY A;  5J1R A;  2LVS A;  2NVY J;  3ASO H;  2PG4 A;  2QVO A;  4JK1 X;  1PP8 F;  1R1T A;  2HKO A;  3PFY A;  3A2K A;  2STW A;  4PGG A;  3MZ8 A;  1QZY A;  1OIS A;  5EEA A;  4Q48 A;  3VB2 A;  5JR3 A;  3OYG A;  4O5V A;  4FT8 A;  1IZ1 A;  1UAA A;  4BAY A;  1SMY F;  4GCV A;  1JI8 A;  2ACJ A;  3W6J B;  4C2U A;  2O5R A;  4NC7 A;  2IPQ X;  3BRO A;  5AIP A;  3DTK A;  4WXD A;  2KRC A;  3IH4 A;  1TNT A;  1E3P A;  2Z9O A;  4OIQ F;  2QZ8 A;  1R5H A;  1TWF J;  4ZH4 F;  2E1N A;  2QEN A;  4YIR X;  4PK4 A;  4A2U A;  5LHG A;  1IN6 A;  2M1B A;  1NH3 A;  1VQN I;  1RNL A;  2L4M A;  3O8H A;  4HSR A;  2PBI A;  3E6D A;  4CCJ A;  1BR4 A;  4KYW A;  2FOW A;  3SDB A;  5KK1 A;  3OWT A;  2HS5 A;  3MFK A;  2LKS A;  5E3O A;  3SDG A;  2VXZ A;  3HHG A;  3E6C C;  2AHQ A;  2BXY A;  1ETK A;  3S2D J;  4D7N A;  3RIR A;  1EJ9 A;  2KJC A;  3AKZ A;  2PX9 A;  3GF2 A;  3M4O J;  2Z1D A;  3HJE A;  4WF2 A;  2KIQ A;  1G3T A;  3L2C A;  2JTV A;  1KU3 A;  4JBA A;  3HC7 A;  1D0X A;  4UUS A;  1APL C;  2XGC A;  3K4J A;  3HSE A;  3L2V A;  3W6V A;  3L09 A;  2KMU A;  4B1R A;  3ESW B;  2ELK A;  3TP3 A;  4AC0 A;  2R93 J;  2DTZ A;  2EBI A;  3LAP A;  5DCM A;  4MEY F;  4R8H A;  3P9C A;  1Z6R A;  4ZC3 A;  2BV6 A;  1ZH5 A;  1FIP A;  1OCT C;  3JRD A;  3L2U A;  3ERM A;  1CF7 B;  3G73 A;  3H5A A;  4M9S A;  4MTE A;  3WE3 A;  4LB6 B;  2V4J C;  2FSW A;  4HX7 A;  2KDO A;  2QGU A;  1MBJ A;  2DA5 A;  3NAR A;  2R5Z B;  2DFE A;  2VPL A;  1YJN I;  3CDI A;  2GIV A;  2VXD A;  2XC7 A;  1PDN C;  1V54 H;  1X1D A;  1T8I A;  1XG1 A;  2KRH A;  2LKX A;  3F22 A;  5JVT A;  4NC8 A;  4XL9 A;  4EJV A;  3OYN A;  3DQV C;  1FLI A;  1U5T B;  2XB0 X;  1USS A;  2CUF A;  2BHY A;  3HB9 A;  3ZMV A;  4XSZ F;  3CF2 A;  3D5L A;  4MFD A;  1I5Z A;  1D8K A;  3GLL A;  1MJA A;  1FMW A;  2DOD A;  1JGS A;  5LHI A;  2XRO A;  2R7R A;  5C4X J;  1FYM A;  2WTE A;  2PN6 A;  3F9K A;  2EFP A;  3TED A;  1LVK A;  2DDA A;  3L2Q A;  3SJM A;  2MA3 A;  3J81 K;  2KL4 A;  2Y31 A;  2QYO A;  3PIP F;  3CCU I;  2H8R A;  2Y0S A;  2DFI A;  2XV4 S;  3HKZ N;  3FMS A;  4XOT A;  3VYT B;  1A35 A;  2L0K A;  3QU3 A;  1I1G A;  3CCM I;  1AKH A;  4BNC A;  4BBS J;  5K7F A;  4U7B A;  2STT A;  1R00 A;  2RNJ A;  4UY8 I;  2E35 A;  4OU0 A;  1WSU A;  4BY7 J;  2X6Y A;  2QBY B;  1REP C;  2K40 A;  3ISP A;  3CC2 I;  1W7P A;  5L3B A;  2VT3 A;  3H36 A;  2XUB A;  5B66 C;  1WVR A;  4B4C A;  3A01 A;  2HVS A;  2DFF A;  4AU7 A;  4I2O A;  3E5U A;  5M3M J;  2Y75 A;  1BM9 A;  4HAM A;  1JKR C;  3M8E A;  5FLX Z;  3BJA A;  5EEG A;  4MEX F;  1PUF B;  1NHA A;  1K78 B;  1R1U A;  4A93 J;  1OJL A;  5ILU A;  3W2W A;  2DN0 A;  2IJL A;  4A3I J;  2R7D A;  2B63 J;  3A02 A;  1J75 A;  1OYY A;  4MFE A;  2L5Q A;  2V1D A;  5J1Y A;  2HOS A;  3E5X A;  2ZJP F;  5KCM A;  3H3Z A;  2RQP A;  3VYS B;  2FUG 2;  1W7P B;  1VFC A;  2I5U A;  3SEQ A;  2WAE A;  3UR3 C;  2WWY A;  1CF7 A;  3H5N A;  1J09 A;  1OFC X;  1PYV A;  1MZB A;  5FRO A;  2M8E A;  3KZY A;  5J4Y A;  2HZT A;  2OQR A;  4I7H A;  4XRS A;  3DCF A;  4FET A;  1VQO I;  4BQO A;  1GXP A;  1BN5 A;  1FSE A;  2MFZ A;  2FD5 A;  1CGP A;  4C3J J;  2VQC A;  4XRM A;  2PFB A;  1WKM A;  1XGM A;  1U8R A;  4ZJZ A;  3GTP J;  4V2G A;  3UKG A;  4AVZ A;  5E3N A;  4XON A;  1B8I B;  3HTU A;  3HOV J;  3O2P E;  4UUS B;  3I4N J;  3K2A A;  3SFI A;  2NOG A;  1SFO J;  4CA0 A;  1Z1D A;  1YS7 A;  3LSI A;  5M3F J;  3JCU C;  1JKP C;  2EK5 A;  4XLP F;  1QBJ A;  1HC8 A;  3V7S A;  1TW2 A;  3V7C A;  1IGN A;  1BC7 C;  2X6W A;  3GZN B;  4L9T A;  3Q0W A;  4II3 A;  4EM2 A;  4KT6 A;  1TTY A;  2VN2 A;  2A6H F;  4LMY A;  2DFH A;  3ZQ7 A;  4CDG A;  2VPR A;  3AG3 H;  1IN8 A;  4XRF A;  2YUS A;  3H5R A;  1EA3 A;  2Y0S N;  4BUP A;  3O8G A;  1TWG J;  3FKJ A;  5EGO B;  2G0E A;  3DEE A;  2YPR A;  4L0Y B;  3J7Z I;  2E7X A;  3TOA A;  3QYB A;  2CSO A;  4A5N A;  1WI9 A;  5HLG A;  2IXS A;  4LG3 A;  3DTE A;  3PO3 J;  4PSW A;  4A3J J;  5FD6 A;  2ZME C;  2Z99 A;  1IRZ A;  3P9I A;  3W3C A;  4XNF A;  5D6E A;  4GDF A;  1OCC H;  2MD0 A;  2ZB9 A;  3K69 A;  3H3U A;  3QPT A;  4GFB A;  1U2W A;  1BC8 C;  4CXF A;  1TWA J;  5F1R A;  1QNT A;  4A0X A;  1LPQ A;  3PSI A;  1P7I A;  5DD4 A;  1EKE A;  3RPU A;  1D8J A;  4PDK A;  4IHY A;  4PUS A;  2A61 A;  3WGI A;  1FX7 A;  2CQ7 A;  2MYS A;  1NK3 P;  4YEL A;  1XN7 A;  5DCF A;  3PO2 J;  3H9Q A;  1UG0 A;  4BE2 A;  4KT5 C;  2VE8 A;  4QPO A;  4XOP A;  2K4J A;  1AKH B;  2MLK A;  2V1N A;  1G3Y A;  3JRC A;  3C2G A;  1IN5 A;  2J5P A;  1K61 A;  4FAS D;  2CFO A;  1TW3 A;  1A04 A;  1ZGJ A;  4U87 A;  3T0Y A;  1HDP A;  5E79 C;  2O03 A;  2Q0O A;  2WV1 A;  3B02 A;  4HNV A;  3FHZ A;  1AOY A;  1D1B A;  2XVC A;  2ZC2 A;  2CW0 F;  1P92 A;  2M30 A;  4XKB A;  5C4J J;  2CW8 A;  3GXO A;  3G1M A;  3PQJ A;  4UUT A;  3IWZ A;  3NQO A;  1XS9 A;  1I39 A;  5F1J A;  1N75 A;  1OLT A;  5GTH C;  1Z9C A;  2AS5 F;  2PMZ N;  4J01 A;  1BBY A;  1M1E B;  1YYV A;  2JA7 J;  2XF6 A;  2M9H A;  2LF7 A;  5D5W B;  1Z91 A;  2H09 A;  4W1U A;  1FOY A;  1BJZ A;  2Q8K A;  1QA6 A;  4H0E A;  2P7V B;  3IAM 2;  3HZJ A;  4IL6 C;  5ICE A;  1S72 I;  3KLO A;  2ELH A;  2K85 A;  2E5Z A;  1YLF A;  2WAQ A;  2YR2 A;  5FKN A;  2IVM A;  4G7O F;  1LJ9 A;  2DMP A;  3OS0 A;  1HW2 A;  2OV7 A;  1A6I A;  5IY5 H;  2VOP A;  4DYR A;  2O8K A;  4DNC A;  3DU5 A;  2XAQ A;  3HOW J;  1TT0 A;  3D1N I;  2DTR A;  5IT3 A;  1WJD A;  1X1C A;  2M7A A;  5HLH A;  2YU3 A;  2RN7 A;  2JA5 J;  4EM0 B;  1ZN2 A;  3FZV A;  1JTY A;  3VYR B;  1U9O A;  2R4G A;  5L3E A;  2OAZ A;  5GPA A;  2KQR A;  3M9A A;  2BE5 F;  1SFK A;  1T98 A;  4XSX F;  4G6D A;  1NK2 P;  4BBR J;  1MDM A;  3SHF A;  3QP6 A;  2DT6 A;  3C2B A;  1MMN A;  3HSR A;  1SD4 A;  3BZ6 A;  2P0W A;  2K3P A;  1KU7 A;  3GTQ J;  3CTA A;  5ILV A;  2R5Y B;  2WB1 A;  3CCQ I;  4M6Y A;  2NVU B;  3QOP A;  5FKM A;  1HF0 A;  1A5J A;  4MQV A;  3CMA I;  1BR2 A;  2GQQ A;  1X4P A;  1U0J A;  2VBX A;  3DP7 A;  3FXU A;  1KQ0 A;  3EUH A;  3DEU A;  3SZT A;  5L3G A;  3JTG A;  2PI0 A;  2LNB A;  3D5S C;  3ABL H;  3H92 A;  4CYD A;  1ENH A;  1IW7 F;  1ETO A;  2CUJ A;  3ECH A;  5KAI C;  5JFR A;  2PJR A;  2FBI A;  2HWV A;  5FO5 A;  4BU2 A;  3ML6 A;  3BLY A;  1LDD A;  1V5F A;  3ZN1 A;  1P2F A;  3S17 J;  1AHD P;  2EV5 A;  1UEL B;  2L2O A;  3E6B A;  4WX9 A;  3R61 A;  1IC8 A;  1FC3 A;  1FP2 A;  1H9T A;  4D5C A;  3MZY A;  2R7S A;  3OYE A;  3LSM A;  3K4K A;  2V1U A;  4EJW A;  1MMA A;  2D2W A;  1A36 A;  4D1Q A;  1Y39 A;  4AIH A;  4BYY A;  5J4V A;  4KIG A;  2PEX A;  5J1U A;  2HQR A;  2A05 A;  2P5V A;  3JRF A;  3NWS A;  3F8N A;  3M1E A;  3RTR A;  1KQ9 A;  4MTD A;  4M73 A;  3KET A;  2BXZ A;  4BHC A;  1JUS A;  5C3E J;  1YW8 A;  2GXG A;  3RKW A;  5KVR A;  2Y30 A;  4HG2 A;  3LA3 A;  4Y33 A;  4A3B J;  3BDD A;  1FNN A;  1TNS A;  1R7J A;  1SAX A;  3K4C A;  4ABZ A;  4UHT A;  3VOD A;  1XSV A;  3WU2 C;  3GTO J;  3HTS B;  3M3Y J;  2K5C A;  3CCR I;  2DXI A;  1BOA A;  2F6C A;  1UG2 A;  2MSY A;  1XD7 A;  4KDP A;  2IA2 A;  2JSC A;  4AIJ A;  4KN7 X;  2LG4 A;  4MGR A;  2DMQ A;  5K7H A;  1B72 B;  1R58 A;  2RV8 A;  3O6B B;  2AXT C;  2BY0 A;  3ABK H;  3BTI A;  1SFU A;  3R6S A;  3Q0U A;  4L0Z B;  2DI3 A;  4GYI A;  4DQ2 A;  3BC8 A;  2JA2 A;  2DDB A;  2K9Q A;  2RVC A;  3V8J A;  1RPW A;  1SVL A;  1DP7 P;  1YRN A;  3T5X A;  2HVQ A;  1I50 J;  1WFX A;  4JP0 A;  4QWQ A;  2CQN A;  3HUG B;  2X0L A;  4BXF A;  2M0M A;  2F5V A;  3HRM A;  3QRF F;  4I98 B;  1MMD A;  2DPU A;  3I59 A;  2VAS A;  3BJ6 A;  2LY2 A;  3LSJ A;  3EUH C;  2XAU A;  4CYC B;  5HLT A;  3FXL A;  4Q47 A;  2VIX A;  4Z2Y A;  3K10 A;  2JZY A;  2P6T A;  5ICF A;  4M9Z A;  1ZGA A;  1IAW A;  1HLV A;  2H1K A;  4EEF G;  1VQ6 I;  1Z7L A;  3WTY C;  1EV7 A;  5IOZ A;  2ISZ A;  2V9K A;  5HOD A;  2KT0 A;  2RC4 A;  3A0H C;  1SAU A;  5EJC A;  4LJZ F;  4BAC A;  2XAG A;  4XLN F;  3PQK A;  2WY8 Q;  4BL0 B;  3HOX J;  2JK3 A;  3ROU A;  3U21 A;  5ERI A;  4XRS G;  1ZG1 A;  4KN4 X;  3FHN A;  2X9D A;  1MMG A;  2OPT A;  2L9N A;  3KLN A;  3V7R A;  5DUI A;  2QWW A;  4CYC A;  1N77 A;  2LMD A;  1FOX A;  3BR1 A;  4XKC A;  1BIB A;  1OR7 C;  2B9S A;  2E1O A;  1Y0U A;  1TBX A;  4PGH A;  2XF7 A;  1R9T J;  4RMN A;  2W1O A;  2W57 A;  5L3F A;  3V4G A;  2FJ1 A;  2F5F A;  4O6J A;  2ZFU A;  4XMY A;  6PAX A;  4BQQ A;  1S7E A;  3S2W A;  1UCR A;  4I0B A;  1S3J A;  2NVX J;  4MNU A;  3K6G A;  4BS9 A;  4FX4 A;  1R1V A;  3S8P A;  3KFW X;  2E71 A;  4HPQ A;  3CDL A;  4A3F J;  4HF0 A;  3ZRG A;  2CFX A;  2LY9 A;  3OOU A;  4AID A;  2BVL A;  4IPA A;  4XOR A;  1ZR2 A;  2BYV E;  3OYC A;  3E97 A;  3A03 A;  5IP7 J;  3TMO A;  5FLM J;  2JRT A;  4PJN A;  1G4D A;  3O3K A;  3DBL B;  2DK8 A;  3RKQ A;  4XLF A;  5F64 A;  2LLK A;  4C9Y A;  5HDN A;  4C3H J;  2CH0 A;  2W82 A;  4G8X A;  1EH7 A;  4NB5 A;  2R5Y A;  2H94 A;  1G3S A;  1WQ2 A;  2XGE A;  1PVE A;  2ETH A;  4B43 A;  1XPX A;  1DUX C;  2RQQ A;  3D5R C;  2CQX A;  3DKY A;  4IHT A;  4IHW A;  1YW7 A;  4HEA 2;  5DCM B;  1WJB A;  2QQA A;  1GVJ A;  3PNY A;  3EUA A;  5EDN A;  2X6O A;  1VTN C;  2E5N A;  4L18 B;  1QZE A;  4QIW N;  4DW6 A;  1U3E M;  4XM3 A;  3B6C A;  5KNL A;  4RM3 A;  5TRD A;  3JW4 A;  3BZC A;  5E20 A;  1ZLK A;  2VBZ A;  3GZ6 A;  2OU2 A;  1G3W A;  3KYD B;  3ABM H;  3LFK A;  3TO7 A;  2IA0 A;  3I3L A;  5GTI C;  5F0F A;  5BPD A;  3BQZ A;  1ORK A;  5CLS A;  4XR6 A;  2QQ9 A;  1T38 A;  5HDG A;  1MH4 A;  3Q9V A;  5F0H A;  3GLX A;  3OYL A;  2WC2 A;  2H6C A; 
#chains in the Genus database with same CATH homology
 1JTX A;  5GP9 A;  1IG7 A;  4A3I J;  2B63 J;  3A02 A;  2P81 A;  4MFE A;  1VND A;  5J1Y A;  2HOS A;  1IDZ A;  4LOC A;  1VFC A;  4MLO A;  1Z77 A;  4M3F A;  4JYK A;  1UMQ A;  1MBG A;  1RES A;  2MG4 A;  5JLX A;  5DTD A;  1OFC X;  5IP9 J;  1XC5 A;  1RET A;  3HEF A;  2XPV A;  1X2N A;  2YU9 J;  2E2I J;  2HXO A;  4XRS A;  2JWT A;  3G1O A;  3DCF A;  5IYB J;  3CQZ J;  2R0Q C;  4A3M J;  5F27 A;  4J19 A;  1MBK A;  5FKL A;  4A3E J;  3BG5 A;  2FD5 A;  3OSF A;  4C3J J;  4XRM A;  4M3B A;  4DZP A;  2ECC A;  3HBL A;  3GTP J;  4V2G A;  3UKG A;  1H89 C;  1DU6 A;  3HDD A;  5FKO A;  5E3N A;  1B8I B;  2DJN A;  4A3G J;  1F36 A;  3ZQC A;  3HOV J;  4UUS B;  3I4N J;  1U78 A;  3K2A A;  2HYJ A;  2NOG A;  3SFI A;  1SFO J;  1MSE C;  1TWH J;  2HI3 A;  1E3O C;  2VKE A;  1K83 J;  5M3F J;  1JKP C;  1MBH A;  5EG0 A;  4NDL A;  4XID A;  1GV2 A;  1MBE A;  2LK2 A;  1F43 A;  5K7Z A;  4FTH A;  3S14 J;  4Y52 J;  4FCY A;  1IGN A;  2E2J J;  5EZH A;  3BTC A;  3HGG A;  1JJ6 C;  3Q0W A;  3JRE A;  4A3K J;  2VKV A;  1GDT A;  3BR2 A;  2M0C A;  2EZH A;  1U8B A;  1ZQ3 P;  1GV5 A;  2M34 A;  2VPR A;  2LFB A;  3JR9 A;  5C44 J;  3F0C A;  2YUS A;  3RQI A;  4C3I J;  2Y0S N;  3S1N J;  3O8G A;  1TWG J;  5EGO B;  2G0E A;  1MH3 A;  2M8G X;  4IHV A;  4DYC A;  2HOA A;  3VPR A;  1FTZ A;  3JRI A;  3JRB A;  1QRY A;  5FKK A;  3PO3 J;  1RKW A;  1ZKG A;  2W48 A;  1HCR A;  4A3J J;  1FIA A;  5GPC A;  4D5F A;  1LE8 A;  1IRZ A;  1B72 A;  3H0G J;  1IJW C;  1VI0 A;  2ZB9 A;  4C2M J;  2CQQ A;  1TWC J;  4GFB A;  2IEK A;  3HOZ J;  2HXI A;  3IV5 A;  3BR5 A;  1TWA J;  2E2H J;  1ETQ A;  1P7I A;  1Y1V J;  2TRT A;  4IHY A;  5F0C A;  1NK3 P;  3FK6 A;  3PO2 J;  2XPW A;  4JX4 A;  5EZG A;  3HGY A;  4DYQ A;  1AKH B;  3HOU J;  2R5Z A;  3LNQ A;  3JRC A;  1ZR4 A;  1K61 A;  1DU0 A;  2X48 A;  3JRH A;  4V2F A;  1G2H A;  1HDP A;  3L1P A;  2WV1 A;  2DMT A;  3BR3 A;  2KDZ A;  3QPS A;  4HNV A;  4QTR A;  4MO7 A;  3LSP A;  5C4J J;  4M3E A;  1JKO C;  3G1M A;  4FE4 A;  3S2H J;  4DZJ A;  3RZO J;  2HQ5 A;  2IAI A;  4UUT A;  2N8G A;  4G12 A;  1XS9 A;  5F1J A;  4QSH A;  2PMZ N;  1I3Q J;  2XGD A;  2CUE A;  3MVP A;  2JA7 J;  2NVQ J;  4A3D J;  3ZQF A;  2M9H A;  1JKQ C;  5EYR A;  1WH7 A;  2DA3 A;  3GTJ J;  2JA8 J;  5DS9 A;  2L7Z A;  4W1U A;  1BJZ A;  3LSR A;  4M6V A;  4JX6 A;  2GBY A;  4M3G A;  2Y9Y A;  3CMY A;  5EG0 B;  2HDD A;  1HOM A;  5FKN A;  2DA2 A;  1P7J A;  2DMP A;  3NAU A;  4W97 A;  4X6A J;  2QCO A;  2CU7 A;  1QPI A;  1A6I A;  4XIC A;  2M2E A;  3ZQG A;  4DYR A;  1BA5 A;  2O8K A;  2L7M P;  1JT0 A;  1IV6 A;  3HOW J;  3D1N I;  3FIS A;  5JLW A;  3BTL A;  1JUM A;  2ID3 A;  2AO9 A;  2JA5 J;  1FEX A;  1JTY A;  1U9O A;  2GM4 A;  1T33 A;  5GPA A;  2FX0 A;  3TP0 A;  1OCP A;  5E3M A;  2R92 J;  2MW8 A;  1NK2 P;  4BBR J;  3S1R J;  3IH3 A;  1QVU A;  3WHB A;  3CCY A;  3JRA A;  2MGQ A;  3S15 J;  5M5W J;  3C2B A;  4I76 A;  2DA4 A;  3ZQH A;  1RR7 A;  2XRL A;  5M5X J;  3G1L A;  3GTQ J;  4A3L J;  2R5Y B;  2HOT A;  2DMN A;  5FKM A;  1HF0 A;  1A5J A;  3QPL A;  2NS7 A;  3BTJ A;  1T56 A;  5EF6 A;  4B3A A;  3A01 B;  5FJ8 J;  5F04 A;  1ENH A;  1ETO A;  3DEW A;  2JA6 J;  1Z0X A;  2EZK A;  2EZL A;  1ETX A;  3FKI J;  1GT0 C;  3WHC A;  1X2M A;  1W0U A;  2K9N A;  3S17 J;  4FIS A;  1AHD P;  1D5Y A;  3Q0V A;  1B8I A;  4X1E A;  2EZI A;  3PM1 A;  2VUM J;  1IC8 A;  1BW5 A;  4BY1 J;  2EH3 A;  2DMU A;  4D5C A;  2DA6 A;  3HOY J;  5F08 A;  1LE8 B;  4D7M A;  4IEJ A;  4A69 C;  4XK4 A;  2K9S A;  2CJJ A;  1HDD C;  5IPA A;  2Y2Z A;  3LSG A;  3ZQL A;  3GTL J;  5IOY A;  1WCM J;  2WAQ N;  5J1U A;  4A3C J;  1TC3 C;  3JRF A;  1EF4 A;  1CQT A;  3GTG J;  1IUF A;  4L5E A;  1JUS A;  5C3E J;  3S1Q J;  1JGG A;  2Y30 A;  5FLV A;  4A3B J;  4IHX A;  1WGX A;  1RKT A;  2ME0 A;  4ABZ A;  1WI3 A;  1SAN A;  3GTO J;  3I4M J;  3M3Y J;  2GLO A;  3OSG A;  1UG2 A;  2MSY A;  2NVT J;  3IH2 A;  1IDY A;  5J1R A;  2LVS A;  2NVY J;  5M5Y J;  2CRG A;  2DMQ A;  5K7H A;  1B72 B;  2JN6 A;  3B6A A;  1ZK8 A;  3BR6 A;  1FTT A;  3BTI A;  5EEA A;  1PUF A;  3Q0U A;  3GTK J;  1JT6 A;  2K9Q A;  1RPW A;  1YRN A;  1I50 J;  4JP0 A;  3ZOB A;  3BQY A;  3IH4 A;  2JMW A;  1H88 C;  1ZGW A;  1MBF A;  1TWF J;  3S1M J;  5EGO A;  1VF9 A;  1GVD A;  2LTP A;  2LP0 A;  3LSJ A;  4RDU A;  4CYC B;  3JRG A;  2ECB A;  3O8H A;  4BKX A;  1HLV A;  2H1K A;  3BG3 A;  4EEF G;  3MKL A;  1BL0 A;  1BW6 A;  2L9R A;  1ETW A;  5E3O A;  3SDG A;  2AHQ A;  1ETK A;  3S2D J;  4D7N A;  5IOZ A;  5IP6 A;  5HOD A;  1ETV A;  2KT0 A;  1MSF C;  3M4O J;  3BT9 A;  2TCT A;  3HOX J;  2JK3 A;  4XRS G;  1I6H J;  4MIM A;  2O9L A;  1FJL A;  2XPU A;  2X9D A;  3BR0 A;  4UUS A;  2OPT A;  1POG A;  1APL C;  2XGC A;  4CYC A;  3W6V A;  3BR1 A;  4B1R A;  2JJ7 A;  2ID6 A;  2E1O A;  2ELK A;  3GBG A;  4M3D A;  2O7O A;  3TP3 A;  4AC0 A;  2R93 J;  2DTZ A;  1R9T J;  1Y1W J;  2EBI A;  2OF7 A;  2LD5 A;  2LR8 A;  2FJ1 A;  5E3L A;  1S7E A;  3TW7 A;  1LFB A;  1WH5 A;  1FIP A;  3RZD J;  1AU7 A;  1OCT C;  3JRD A;  2YS9 A;  1LFU P;  2NVX J;  3OIO A;  5J3L A;  4JX5 A;  2FQ4 A;  3CDL A;  4A3F J;  2LY9 A;  2L7F P;  3OOU A;  1MBJ A;  2DA5 A;  3NAR A;  5IYC J;  2R5Z B;  1ZR2 A;  1GUU A;  3A03 A;  5IP7 J;  2R7Z J;  5FLM J;  1O4X A;  5IYD J;  2IBD A;  1XG1 A;  2LKX A;  2VI6 A;  3RKQ A;  2Y9Z A;  3K7A J;  2LLK A;  2XB0 X;  3BG9 A;  2CUF A;  3HB9 A;  3MN2 A;  4C3H J;  1MNM C;  1U9N A;  4MFD A;  2QF7 A;  1JJ8 C;  9ANT A;  2R5Y A;  3H3V K;  2DA1 A;  5C4X J;  2XGE A;  5BNG A;  3TED A;  1YRN B;  2D5V A;  3SJM A;  2EQR A;  2CQX A;  2RAE A;  2Y31 A;  4FE7 A;  4IHW A;  1UHS A;  2I10 A;  2H8R A;  1ETY A;  2NS8 A;  2WB1 N;  5EDN A;  3HKZ N;  3Q3S A;  2X6O A;  1QVT A;  2L0K A;  2E19 A;  3HM5 A;  3GTM J;  1AKH A;  1WPK A;  4QIW N;  4BBS J;  2DA7 A;  4DW6 A;  2XB5 A;  5K7F A;  3LOC A;  3B6C A;  4BY7 J;  1ITY A;  1ZTR A;  2K40 A;  4AUX A;  4BXX J;  1Q1V A;  3E7L A;  1W0T A;  3ZQI A;  3QQA A;  4B4C A;  3A01 A;  1NTC A;  4Y7N J;  5M3M J;  5F0F A;  3BQZ A;  2ME6 A;  3TW6 A;  4S0H B;  2COB A;  4I6Z A;  1JKR C;  1ORK A;  1X58 A;  1PUF B;  1JUP A;  3FK7 A;  3FIW A;  3S16 J;  1MH4 A;  1H8A C;  4RBO A;  4A93 J;  1OJL A;  5F0H A;  2XSD C;  4AYB N;  2DN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...