4A69C

Structure of hdac3 bound to corepressor and inositol tetraphosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
KFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE DEACETYLASE 3,
publication title Structure of Hdac3 Bound to Co-Repressor and Inositol Tetraphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a69C00
2DMNA 3B6AA 1IG7A 1LFBA 5J1UA 1HDDC 3GTLJ 3SJMA 3S1MJ 4G12A 5IPAA 2HOSA 2WAQN 2DMPA 1W0TA 1HOMA 3FIWA 5EDNA 1A6IA 4M3FA 5IOZA 2DA4A 5J1RA 1IDZA 2K40A 3MN2A 1G2HA 3JRAA 4A69C 2VUMJ 5EZHA 2M0CA 2QCOA 5GP9A 2CQQA 3HOYJ 1APLC 3HM5A 2M8GX 3BG9A 2GLOA 2QF7A 5IYDJ 3Q0UA 3Q3SA 1HDPA 1MSEC 3PM1A 2EZKA 3BR0A 5FKLA 1O4XA 2D5VA 1QVUA 4A3LJ 4JP0A 5EYRA 4UUSA 1JJ6C 1FTTA 2XPUA 3BG3A 3HB9A 1K83J 5JLXA 1B72B 4DZJA 2R5ZA 4I76A 1ZR4A 1H88C 4AUXA 3NARA 5K7ZA 5EEAA 3HGGA 1RETA 1HF0A 3LOCA 2LP0A 2DA1A 1IGNA 1SANA 1JT6A 4XRSA 2LY9A 3SFIA 5FLVA 1WPKA 5M3MJ 2NVXJ 1IV6A 3S1NJ 4XRMA 2JA5J 2VKVA 5FLMJ 1WGXA 2KT0A 3GTOJ 2R5YB 1Y1WJ 4MLOA 3QPLA 1MH4A 2HQ5A 2H1KA 2ECBA 1OCTC 4IEJA 1VNDA 3RZOJ 1MBJA 1JTXA 1U9NA 4IHXA 5JLWA 3OIOA 5EZGA 2CUEA 3FK6A 4AYBN 3BTJA 5DS9A 3HOZJ 1ETKA 1GVDA 3LSGA 4A3EJ 5M5YJ 1AKHA 1IRZA 3PO2J 1H89C 5IP6A 1XC5A 1Y1VJ 4LOCA 3HOVJ 4A3GJ 4BBRJ 1OCPA 3S1RJ 1BL0A 2AO9A 2OF7A 2CUFA 3TP3A 3S16J 4BY1J 1F43A 3GTGJ 5FKMA 1PUFB 1RPWA 2WB1N 5J3LA 3B6CA 1ZR2A 1FJLA 1P7JA 1BA5A 4M3BA 5F04A 1XG1A 2DJNA 2XB0X 2GM4A 2GBYA 4DYRA 3PO3J 1IDYA 1UMQA 4D5CA 5GPCA 1FEXA 1TWHJ 5J1YA 2COBA 4C3JJ 4FE4A 3NAUA 4CYCB 1OJLA 1JUSA 2XPWA 5EGOA 4M6VA 1K61A 3ZQHA 5EF6A 3ZQLA 3HDDA 4A3JJ 2FJ1A 3A02A 1Z0XA 4B4CA 2JA6J 3BQYA 2L7MP 3BR6A 2Y2ZA 2LTPA 4C3IJ 1T56A 3G1LA 1FTZA 1XS9A 1ETVA 3BR5A 1X2MA 4MFEA 3ZOBA 2CQXA 3BR1A 2L7ZA 1YRNB 1RESA 3FKIJ 4A3IJ 4V2FA 4ABZA 1JKQC 2EZHA 3SDGA 4DYCA 2L0KA 5IYBJ 1FIPA 2EQRA 2DTZA 3FK7A 2JK3A 1POGA 3HOWJ 3CQZJ 4Y7NJ 1JUMA 2MSYA 3JRBA 2NVQJ 1P7IA 1W0UA 3IV5A 3JRGA 2YUSA 1MBKA 4M3EA 4UUTA 3FISA 2L7FP 1RR7A 2YU9J 1JT0A 1ETYA 5F08A 3HGYA 5F27A 5FJ8J 3JREA 2Y9YA 3A03A 1JTYA 2VI6A 3BG5A 4W97A 3RZDJ 3BT9A 1GT0C 4C2MJ 1GUUA 4W1UA 1DU0A 2X6OA 2P81A 2K9QA 1HCRA 2XSDC 4BY7J 2H8RA 3JRCA 4D7NA 2JA8J 3RKQA 4XIDA 3LNQA 3JRIA 2FX0A 2XB5A 1B8IB 2R93J 1WI3A 2ID6A 5F0HA 1B72A 3GTQJ 3S14J 4DW6A 3ZQIA 2DA3A 3LSPA 2E2JJ 1OFCX 4V2GA 2Y0SN 1JUPA 4A3BJ 2LKXA 3A01B 3HOUJ 5HODA 4BXXJ 4MIMA 5IOYA 1JKPC 2XRLA 3IH2A 3DCFA 1U8BA 2TCTA 2IBDA 3HEFA 1MH3A 4S0HB 2R92J 1MBEA 3HKZN 3IH4A 4I6ZA 2RAEA 1ZK8A 1AHDP 3GTPJ 2R5YA 1ETXA 1U9OA 4A93J 3BR2A 2DMTA 1BW6A 5FKKA 3HOXJ 2B63J 2X9DA 1ZKGA 4D7MA 1VF9A 1D5YA 2G0EA 4A3CJ 2JN6A 1MBGA 1TWAJ 2JJ7A 1RKTA 1NK2P 3S2DJ 3K7AJ 4J19A 3MVPA 1RKWA 1QRYA 2MW8A 1DU6A 5FKNA 1JKOC 1IUFA 1JGGA 2K9NA 2E19A 4JX6A 1H8AC 2X48A 2LD5A 2ME0A 3Q0WA 3OSGA 2LFBA 3E7LA 3S2HJ 4JX4A 1PUFA 2E2HJ 2NVTJ 3O8GA 1X2NA 2ID3A 4NDLA 3G1OA 5EG0B 4RBOA 1X58A 3JRDA 1MBHA 5IP7J 4AC0A 5IP9J 1F36A 1I3QJ 2ZB9A 2MGQA 2DMUA 3GTJJ 4MO7A 2Y31A 2VPRA 1GDTA 2EH3A 4DYQA 2XGDA 4CYCA 2R7ZJ 3HBLA 1ORKA 4FCYA 3ZQCA 3DEWA 2VKEA 3TW7A 4IHVA 3GTMJ 3WHCA 4IHWA 2EZLA 3CCYA 1IJWC 3S17J 3QQAA 1VI0A 2O7OA 2DMQA 2EZIA 3K2AA 4QSHA 1I6HJ 1NTCA 3RQIA 3TP0A 3TW6A 3UKGA 2CJJA 5C4XJ 3F0CA 1WH5A 1LE8B 1I50J 2K9SA 2HXIA 2DA6A 3MKLA 1MBFA 2HYJA 4XICA 3CMYA 3W6VA 2JWTA 2FD5A 5F1JA 1S7EA 1GV5A 2R0QC 2LK2A 5E3OA 5E3NA 1WH7A 4FE7A 4B3AA 4BBSJ 5FKOA 3OSFA 4XRSG 3JRHA 1LFUP 2DA7A 5F0FA 4GFBA 1JKRC 4A3MJ 4IHYA 2YS9A 1QVTA 4JYKA 2DA2A 2CU7A 1TWCJ 2XGEA 3BTCA 2XGCA 3JR9A 2E2IJ 1ETQA 2NVYJ 5K7FA 1UHSA 3JRFA 3LSRA 1AU7A 3S1QJ 2PMZN 1ZGWA 2LR8A 5E3LA 1TWGJ 2M9HA 2WV1A 3OOUA 3QPSA 5GPAA 1ITYA 1T33A 1B8IA 1CQTA 3I4NJ 4UUSB 4DZPA 4QIWN 4BKXA 5E3MA 4M3DA 1ZTRA 2R5ZB 1UG2A 4X1EA 3WHBA 1HLVA 2HXOA 2I10A 1A5JA 4Y52J 2LLKA 1TC3C 3A01A 3L1PA 2ECCA 5C3EJ 2KDZA 1GV2A 5M5XJ 3O8HA 4M3GA 1SFOJ 4JX5A 4XK4A 2ELKA 3C2BA 4HNVA 1Z77A 1E3OC 5C44J 3GTKJ 3S15J 4MFDA 2E1OA 5M3FJ 4QTRA 3BR3A 2NS8A 4L5EA 1VFCA 1JJ8C 2O8KA 1R9TJ 2HOAA 5K7HA 1AKHB 2XPVA 3LSJA 3Q0VA 1U78A 5IYCJ 2DN0A 3D1NI 5M5WJ 2JA7J 2ME6A 4B1RA 1ENHA 1WCMJ 2CRGA 2MG4A 2EBIA 4C3HJ 2NOGA 3TEDA 3CDLA 3GBGA 4A3FJ 3M3YJ 1BW5A 3BTLA 4EEFG 3BTIA 3ZQGA 2IAIA 9ANTA 2LVSA 5EG0A 2Y30A 1QPIA 2W48A 5F0CA 1Q1VA 1EF4A 1ETWA 1TWFJ 3G1MA 3H3VK 1IC8A 2IEKA 2M2EA 2OPTA 2L9RA 3BQZA 2FQ4A 5EGOB 4FTHA 5DTDA 2Y9ZA 4FISA 3VPRA 3M4OJ 2HI3A 2JMWA 3I4MJ 1FIAA 3H0GJ 5BNGA 4A3KJ 1YRNA 1ZQ3P 2HDDA 2DA5A 2O9LA 1NK3P 1MNMC 1ETOA 2HOTA 1BJZA 3IH3A 5C4JJ 2N8GA 2TRTA 4A3DJ 4RDUA 4D5FA 1LE8A 4X6AJ 2NS7A 3ZQFA 1MSFC 2M34A 2AHQA
chains in the Genus database with same CATH superfamily
3ERED 3QU3A 1MJAA 3GTLJ 3S1MJ 4G12A 3VSLA 3JSOA 5IPAA 3LSMA 3GUDA 1UG0A 4UV9A 3W6JB 3R0AA 5FROA 2KQRA 5DM6F 5IOZA 1IAWA 1IDZA 1LEAA 2YPRA 3X2QH 4KNYA 3KZYA 4XONA 1R1TA 2QCOA 1UCRA 2Q1ZB 3CMEI 2CQQA 3GLXA 4E7IA 3K1NA 2ZXJA 3HM5A 2PJRB 2GAUA 4G6QA 4LB5A 3KP4A 5IYDJ 3IKTA 3M8FA 2L3DA 1R4MB 1HDPA 3J80K 3DWLE 3U1DA 2D5VA 3H0DA 3CCUI 5LRRA 1K83J 2VJJA 2V1XA 4DZJA 5HS8A 2L4MA 4BL0B 1H88C 1GXQA 4AUXA 3FKJA 3NARA 5K7ZA 1Y56A 3HYIA 5EEAA 1MJ9A 4QPOA 2LP0A 3QYFA 1IN8A 5FLVA 5IT9K 3AG2H 4XRMA 5CJ9A 4C30A 1B9NA 3H3UA 3M8EA 1VQMI 1D0XA 2VODA 2L01A 2LOOA 2KT0A 2MLKA 4BJ6C 3V42A 2ZO4A 2DAOA 2LDUA 1XGMA 3GCMA 3QPLA 2YU3A 3RZOJ 2Z5UA 1YJNI 1MBJA 3CC7I 2K4JA 2QVOA 3OIOA 4J00A 2CQKA 3CLOA 3FK6A 4FX0A 3BTJA 3RKXA 2E2IJ 1OKRA 4ZH4F 2AXLA 4A0XA 1S8NA 2EV6A 2FRHA 4WXCA 1GVDA 5M5YJ 1R49A 3PO2J 5K5OA 3QOEA 1SAXA 2KJBA 2J5OA 4LJZF 2HPIA 1V5FA 2IT0A 1BL0A 4ZYDA 1WHUA 2CUFA 1SD4A 2L54A 3KZIC 1ONVA 5CVJA 2DPDA 1YJWI 3FXRA 1FNNA 1K6YA 2GA2A 1F43A 4UXNA 3LA3A 3OYHA 4L9VA 1U0JA 3OYEA 1EV7A 3D5LA 5J3LA 3I54A 4XLPF 1H0MA 1L3LA 2XAUA 1HQCA 2CS3A 1ULYA 4DGWB 3VYRB 3K4MA 1XG1A 4ENJA 3CCMI 3QAHA 4AIJA 3TBIA 5CQEA 3PO3J 1UMQA 2TDXA 4I98B 1HKQA 3BOQA 4CYCB 4IQ4A 1JUSA 2XPWA 4OAZA 4M6VA 3T1BA 3ZQHA 5EF6A 3EPZA 2M5WA 5K5RA 1FX7A 1EH7A 1HSJA 3CUOA 3BQYA 3J7AO 3KPHA 1X4OA 1T8IA 2FQ3A 2IRFG 1JE8A 1XDUA 1Z9CA 1X2MA 4MFEA 3J7ZI 2EFOA 2CQXA 4HG2A 4BEHA 1SFXA 4V2FA 1ZGAA 2A61A 3GF2A 4HX4A 5GADJ 4RAFA 2KRFA 1O3TA 3HRTA 1DPRA 3QP5A 4FT8A 5GAEJ 2DTZA 5FGMA 3IRQA 1FMVA 3N05A 4ZZLA 1ZG3A 3HOWJ 2NNNA 2R7RA 4P1WA 1LJ9A 1D1AA 4NUBA 2V9VA 3SYTA 3WGGA 1Z7UA 1UHMA 4UUTA 1E17A 3ZMDA 4MTDA 4XLCA 3OR2C 5F1RA 2F4MB 2LNBA 2L7FP 4G8XA 1JT0A 1F5TA 5F08A 3HGYA 2KIFA 1XCVA 5F27A 2A68F 2HTJA 1JTYA 1G59A 2MLGA 3H36A 1MMGA 3BT9A 3UR3C 1FOXA 4C2MJ 4G7OF 3LWFA 1IF1A 1U5TA 5D8LB 2X6OA 3K1PA 2PMUA 2OTLI 3BWGA 2XSDC 3DKYA 1WSUA 3RKQA 2UWMA 2XDVA 2DCEA 1MMSA 4NQWB 2VL8A 4A12A 1ERDA 2FE3A 3SHFA 5HVQC 3OYDA 1B8IB 4E7HA 1FOYA 5IT9Z 2R93J 4I0BA 1WI3A 5LGNA 4R79A 3EETA 3S2WA 2FOKA 3ZMZA 3QPHA 3BLYA 1MMDA 2DA3A 3LSPA 4BACA 1KQ8A 4V2GA 3WGIA 2X4HA 4A3BJ 5BOXA 2LKXA 4HF2A 1K78A 1RIOH 5HODA 2RNJA 3AG4H 1J7KA 4BAYA 3U1KA 1YJ9I 3DCFA 3H9GA 2E1CA 2VOPA 4JQFA 1R71A 3HKZN 4RAYA 3TDZC 1ETXA 1U9OA 4A93J 3BR2A 4PFPA 2CFXA 2DMTA 5FKKA 2K27A 2NVUB 3HOXJ 3JTGA 3TOBA 1LNWA 1TQPA 2X9DA 4LG0B 1ZKGA 1JHFA 2XKOA 5LD2C 4CCLA 4N4NB 2LKSA 1QPMA 2LC2A 1YS7A 1RKTA 2NNYA 2KZVA 4HLYA 5AIPA 4J19A 5BS6A 1K7AA 3TDUC 3K10A 1PP8F 4U0WA 3S2DJ 2MW8A 1DU6A 1JKOC 1X1BA 2LY1A 2E19A 3ZQ7A 3E0JB 1J0RA 2KRCA 4GO1A 4N9IA 5FFXA 1HC8A 2EFQA 2LFBA 2R7OA 3OWTA 4WXDA 2L2OA 1PUFA 2Q2EB 3G71I 1VQ5I 3V7CA 4M6YA 2H6BA 5EG0B 4RBOA 4KIBA 2ELJA 1QBJA 5IP9J 3P9IA 1I3QJ 2ZB9A 3ABKH 3PQKA 2MGQA 3I4PA 4FX4A 3FXJA 5E20A 1A36A 4Y33A 3ISPA 1T0FC 1IXSB 2OCCH 5JVTA 3D5RC 4IVNA 1P6RA 1WKMA 1D8JA 4RS8A 5HNHA 2FF4A 3V7RA 2W7NA 3PSFA 2RC4A 3CP8A 3WHCA 3FHZA 1H9TA 2YX4A 3S8PA 4IKFA 3ECOA 4BH9A 2DMQA 1OCRH 2EZIA 2XUBA 5CPRB 3W2AA 1YIOA 4QSHA 1BIBA 4MEXF 2Z9OA 5E8GA 1O57A 5LEKA 1D0YA 2MH2A 1WH5A 3FDYA 2VB6A 1M1EB 3KYCB 2I5UA 2K4BA 4BQAA 3T8RA 4YG2F 5JHFA 1FWZA 3W6VA 2M8EA 2ZCWA 3K4LA 1R00A 2FD5A 2RQQA 4CH7A 3C18A 3P9CA 4KIGA 3CDIA 4EJUA 4FE7A 3FXKA 4HX7A 2QSHX 1QZEA 1S5LC 1ON2A 3KP6A 5E8IA 4DIQA 3WTSC 3OYGA 2WTEA 4GFBA 4HX8A 2JSPA 1JKRC 4RMNA 1QVTA 2L9NA 4JYKA 2E5NA 2LF8A 3F9KA 1Z05A 1TWCJ 4OU0A 2XGCA 3JR9A 2HR3A 1BIAA 1ETQA 3S1QJ 1AU7A 3H92A 1TBXA 2GWRA 2PMHA 2XGXA 2GXBA 3AG3H 3I0TA 2HQNA 3HUGA 2LR8A 2P7VB 1TWGJ 1UZCA 2CH0A 3PQJA 5A2QZ 3HHHA 3ASOH 1MGTA 1X4PA 2E36A 3QPSA 2VKDA 5DCFA 4PSWA 3Q5FA 4I09A 3RYPA 2OZ6A 4LIUA 4RGSA 3BG7A 4G94A 2A6HF 2I10A 3FBIB 2FSWA 2ETHA 3A01A 3RSNA 3CMAI 2DPUA 2CG4A 2DOFA 3HIFA 3RPQA 1GV2A 5M5XJ 4KFCA 4XLNF 2O0YA 4ZYEA 4KT6A 2M87A 1HKSA 4NHJA 5D6FA 4WXHA 4UB8C 1SFUA 1X3WB 4ZTFA 1RUNA 3HOSA 3RPUA 1E3OC 4MFDA 2WC2A 2KIQA 1BN5A 3HTUA 3F3XA 2A3SA 3PIOF 2NS8A 5KCMA 2R7SA 2HYFA 1FY7A 3DEUA 1JJ8C 1R9TJ 5K7HA 1MZBA 5D4SA 1O3QA 2XPVA 3BJOA 3L9FA 1FPQA 1XCBA 2DN0A 3F6OA 3K4BA 1OISA 2JA7J 3W6KB 4BQNA 1R6RA 1ENHA 1K6OA 2ACJA 3CCLI 1FSHA 2CRGA 1Z3XA 3M1EA 2M45A 2XAGA 2MG4A 4EM2A 4F91B 4BE1A 2EV5A 1DDNA 4A0YA 2W85A 4IRHA 3L2CA 3M3YJ 1Z6RA 2JSCA 3OYFA 1VQLI 3ABTA 2MABA 1BW5A 3LQQA 3OYNA 2JZYA 1IV8A 9ANTA 2Y30A 2IPQX 1ACIA 5AIQA 2DJIA 1Q1VA 1EF4A 2PBIA 1N75A 3KP3A 3H3VK 2VBYA 4RLFA 1IC8A 2M2EA 2K3PA 3BQZA 1FMWA 4LG3A 5DYMA 5H2FC 1R23A 1ZN2A 3GEZA 2KL4A 4P96A 2R4GA 4J01A 2R7XA 3L2QA 3M4OJ 5FLXZ 3WTTC 3OIPA 2IS4A 2HI3A 2LMDA 2XV4S 2JMWA 3I4MJ 1MKMA 2VE8A 1OYWA 4B43A 3FXLA 4HOBA 5J8CA 1ZLJA 3BCBA 3IWZA 3E5UA 4EGYA 2PJPA 2DA5A 1OYIA 2O9LA 1MNMC 2CQ7A 2HQAA 4BEHB 5ICEA 4A3DJ 2AQEA 4RDUA 5TRDA 4D5FA 1LE8A 5KNLA 5K1YA 2VJ5A 2RVCA 4PK4A 2GOXB 4AIDA 2NS7A 3CD6I 4CYDA 1FYMA 4Y4RA 1U8RA 2M34A 3FHNA 3B6AA 5JI6A 4CO8A 4GCVA 4FASD 1LFBA 3HTSB 3MKWB 2WAQA 1W7PD 3EYYA 3FIWA 2LSOA 3C1DA 2YSRA 3DU5A 1FP1D 4M3FA 5J1RA 3PSIA 3F72A 1D1CA 1BR1A 1G2HA 1N78A 4A69C 1YG2A 4I02A 3WODF 3CLQA 2A69F 5GP9A 2V1UA 3HOYJ 3J81K 2QQ8A 2M8GX 1RUOA 1Z67A 3CCJI 3LQRA 2IGMA 2DT5A 4YIRX 2QF7A 3MKYB 2JRTA 4CCKA 4ANJA 3Q3SA 2BW3B 1T2KA 3RTRA 5FKLA 2KMUA 1O4XA 4PJMA 3L2VA 1U5TC 4KN7X 5EYRA 4U7BA 4UUSA 2OCEA 2XPUA 3HB9A 1PP7U 3U9GA 4HDUA 1LB2A 2R7VA 1R5HA 2CO5A 1R4NB 2WY8Q 1KU3A 4U0VA 2VJIA 1RETA 3LOCA 3HOTA 2DA1A 1K78B 1E0EA 1JT6A 3IUOA 4ZC3A 1HKTA 4BJ5C 2OA4A 3SXYA 1IV6A 3S1NJ 2VKVA 2HVSA 2NS0A 1S72I 5F6FA 1P92A 3GTOJ 3JW4A 2WADA 2XC7A 2FXAA 3A1YA 3MZ8A 4E70A 5B1AH 3N97A 1EKEA 2P0WA 4MLOA 2MC3A 1D0ZA 2MD0A 1MH4A 1YS6A 2W24A 3OYLA 4IOCF 1OCTC 1B59A 1VNDA 2H1KA 1JTXA 4AYBA 5EZGA 1W5TA 2IGOA 4GYIA 1MMNA 5F64A 4G7HF 2DYRH 2HTSA 2G7UA 4Z2YA 1X1DA 5LHGA 4CCNA 4MHGA 2CV2A 4HPQA 1ETKA 1AKHA 2NXNB 1H89C 2P7CB 3ZXSA 2X85A 2P5LC 4UVBA 1Y0NA 4I0AA 4BBRJ 4F7ZA 1H9GA 3S1RJ 4ZYHA 5KK1A 1XX5A 4AIHA 3MZYA 4IHSA 3S16J 4EMSA 4LGWA 3GTGJ 1OCOH 1WRJA 1PUFB 5CVRA 1RPWA 2O6GE 4ZTJA 2LKPA 2KDOA 3M9AA 1FOKA 1B6AA 2DJNA 2GM4A 2HFHA 2ADUA 4ESFA 2WAFA 2EILH 1SMYF 1IN5A 3H35A 1IDYA 5GPCA 1TWHJ 2RREA 2IA1A 4FE4A 3NAUA 4C3JJ 2H94A 3DTKA 5LHIA 4HRIA 4L18B 2F48A 5LGTA 4IPAA 5J6XA 4BQQA 3R0JA 3T8TA 3COAC 2HZTA 1DPUA 2M3AA 1ETVA 3OYKA 1XS9A 1ON1A 2HVRA 5DD4A 1A04A 1I27A 3ZOBA 2XF5A 2L7ZA 3BR1A 4RGRA 1AWCA 1YRNB 1JKQC 2EZHA 1WZ2A 2IA2A 2BHZA 1BBYA 3CUQB 4HA8A 3GXOA 3HL2A 4HNTA 2CV0A 1FIPA 1P9QC 2M4KA 3OY9A 2JVHA 2EQRA 3FK7A 4N4OB 3AAFA 2P8TA 1XGOA 1JUMA 1I5ZA 2O03A 3JRBA 1IRGA 2GQQA 1TZLA 3KFWX 4CCOA 5TISC 2DLLA 5JVGF 3JRGA 1MBKA 4KT5C 4DNCA 1RR7A 4JBAA 3J81Z 4D0PA 2VT3A 3KYLA 3C2HA 1QHGA 3GO5A 5D5XB 4X0GA 1Y8QB 3LFKA 3BG5A 5EJCA 1MW7A 3F8MA 5H6QA 4ESBA 3JCUC 3V4GA 2P81A 2K9QA 4MGRA 1KYZA 3DBHB 3EUKL 4BY7J 1BC8C 1GVJA 2IJLA 4ENKA 1KU2A 2JA8J 4A2UA 3H5RA 1PUEE 3HUGB 3VB2A 3GX4X 2BOLA 3JRIA 2FX0A 1A6QA 2DOEA 4II2A 2QWWA 1OMIA 2MD5A 1TP4A 4HF0A 3IHUA 1F1ZA 1I39A 4KMUX 1YW9A 2BV6A 3G4SI 1O3SA 2Y0SA 5FD5A 2KFDA 1DGRM 1GHCA 2JPBA 2RN7A 3A01B 4UVCA 3HOUJ 5IOYA 3OMYA 3BC8A 1J5YA 2XRLA 3W3CA 3PNTA 3HSFA 3HEFA 4B47A 1JXSA 1P4XA 4KICA 1IN4A 1MBEA 2MYSA 5KAIC 4I6ZA 1AOYA 2RAEA 5E18F 4IOAF 3SDBA 1MMAA 5ED4A 4OAYA 1BW6A 1VQNI 4BJTA 3K9TA 3ML6A 1Z1DA 2EINH 5D5UB 1LEBA 4IL6C 1D5YA 4EJTA 2G0EA 3HG9A 1VQ8I 4O3MA 4Y15A 1MBGA 1ZG1A 2GOMA 4XKWA 3DTIA 5KHDA 3BDDA 1BOBA 1SFKA 4Q5SF 3U2RA 2D45A 3VDXA 3CO6C 4H0EA 2LH9A 3DPLC 1IUFA 3CJTB 3MAJA 4OIRF 2HNHA 1JGGA 2WB1A 2BXYA 2BZTA 3RDIA 1U6GA 4IO9F 3ZP5A 5BPDA 1IRXA 1IO2A 3LA2A 4N9HA 2X51A 3EUAA 3ULQB 3AKZA 2ZSHB 4BDYA 1LKXA 3LFUA 3J7YJ 1YW7A 2ZNZA 3HXLA 4AC0A 5IP7J 3B02A 2IS2A 3RKYA 4A6DA 3CF2A 3RI4A 1D1BA 3ROUA 4E4HA 3FMRA 1GDTA 2XAQA 5IT3A 1XMKA 2FNPA 3GFIA 2R7ZJ 3KX2A 1ODDA 1EA3A 3ZQCA 3DEWA 3GTMJ 4IHVA 5FFZA 4RLQA 4EM0B 1GXPA 4LK1F 4IHWA 4E7KA 3CCYA 1IJWC 5FO5A 3QWLA 1R5ID 4HDVA 3PIPF 1DUXC 1I6HJ 5HLTA 2QKMB 1XSVA 2B7EA 3TP0A 3OV8A 3TW6A 3DU6A 3UKGA 5C4XJ 3F0CA 4EQQA 2JUGA 2WAEA 3NRVA 1LE8B 4RGUA 2K9SA 3ONQA 2OTJI 3TOAA 4XN3A 1Z91A 4M9SA 1MBFA 4PGGA 4XICA 2JWTA 2HGCA 1NG7A 3E1SA 4FQGA 5F1JA 1S7EA 3HSEA 2VN2A 2R0QC 3FBNB 1O7FA 3DLAA 1S7OA 4E7JA 4BBSJ 1DP7P 4ENMA 2W82A 1UHWA 3OSFA 4A5MA 3J80Z 2ICWG 3KEQA 4EJWA 3JRHA 1LFUP 1Z3YA 3E97A 2V7FA 5F0FA 4XQFA 4U0YA 2WWYA 2DA2A 4XLFA 2A6EF 3DXJF 4PGHA 3WTZA 5LBQA 3CC4I 3A0BC 4Q48A 3BTCA 3RQ4A 3MQ0A 5B3SH 4BGDA 1FZPB 1WJFA 1XTAA 2W57A 2HVQA 2NVYJ 5K7FA 2PQ8A 2BW3A 2EB7A 3LSRA 2PMZN 3FXOA 3KP2A 1R36A 5E3LA 2M9HA 5GPAA 2K9LA 2X6XA 1FBSA 3DFGA 1BR4A 4WCGA 5H6RA 2P6SA 2ZFUA 1N25A 4UUSB 4DZPA 4QIWN 2WY7Q 4M3DA 4BUPA 2O5RA 1UG2A 3JTHA 4PJJA 4X1EA 1HLVA 5ILVA 4AVPA 4EATA 2QBYA 2ZJPF 1TC3C 3L09A 1ZLKA 4K2EA 5CYVA 3QRFF 1TNSA 1FP2A 5HNFA 3L2WA 3FXMA 4N0BA 3SEZA 1UELB 2K9MA 1FSEA 1HW5A 3V8JA 4IZZA 3SFZA 1Z77A 1CF7A 2A5WA 2BVMA 2YX7A 3WU0A 3HRUA 3S15J 3WTYC 2E1OA 5M3FJ 2F5CA 2CW7A 3IL2A 4PDKA 2COMA 4L5EA 3H9JA 2HEOA 1ZYRF 1UAAA 1Z21A 2HOAA 1AKHB 1R22A 3P7NA 4HV6A 1U78A 2VKHA 2W84A 2E7XA 5E1WA 4B1RA 2IGNA 2W25A 5DV5A 3ZMSA 5BPIA 3ZN1A 3I3LA 3KCCA 1WJCA 2EBIA 4C3HJ 5HDNA 2P5VA 3TEDA 3CDLA 3GBGA 4XRFA 3K4JA 3PJRA 1D5VA 4EEFG 2ZMEA 2KKOA 1TW2A 2GXAA 1QNTA 5HLIA 1T98A 5F0CA 2DXIA 4ZDLA 4RA2A 5CLSA 5HOOA 4MEYF 2G9WA 2K86A 1KZHA 2ZKZA 4DBQA 3CJRB 1G6NA 2Y9ZA 2WV0A 4FISA 2FNAA 4M72A 2Q8KA 1DQUA 2JTVA 3H0GJ 5BNGA 2BGCA 3IWFA 5GTHC 3VFZA 3DBRB 1QZZA 2LREA 2VE9A 1I1GA 3WTWC 5D8KB 1EH6A 1YRNA 1ZQ3P 1WI9A 2H09A 2R3SA 3CUQA 2HOTA 1BJZA 1PDNC 3IH3A 4I01A 2LYCA 1REPC 3S3OA 3MMYB 3ZMUA 2VJ4A 1JGSA 1IUYA 1QHHD 2A6TA 4X6AJ 1HBXG 1S9HA 3ZQFA 4P55A 5EEGA 1MSFC 2LBFA 1ZRDA 4IJAA 3GLLA 3E6DA 5J1UA 4YFXF 5HLHA 3MCZA 4GYGA 3SJMA 2HYGD 1HW2A 1HDDC 2XHKA 1RZ4A 2HOSA 3EYIA 2DMPA 4PJ0C 1W0TA 1KGSA 1HOMA 4EV0A 4S05A 4C2TA 5EDNA 2QA4I 1A6IA 2ELHA 2XF6A 3RKWA 5KAFC 2K40A 3MN2A 4LLGF 4KITB 3KETA 1WJAA 2BBYA 3SZTA 3CO7C 4KN4X 1ZH5A 2VUMJ 1WFXA 3KEYA 3OL3A 1SFEA 2CUZA 2EK5A 2RDPA 2PLYA 1WJ5A 5TGTA 1APLC 3RJPA 1SMTA 4M74A 3BG9A 5HS7A 3WG9A 1O7LA 2GLOA 4XSZF 1Z7LA 4AIKA 1YX3A 3Q0UA 1S29A 4F92B 2HU9A 3M1CA 4JK1X 1PVEA 1QVUA 3K70C 1XDSA 4JP0A 4E7ZA 3BG3A 3G6EI 2L02A 3AFHA 2Z16A 2VQHA 5HLGA 4LMYA 2ISZA 3F8CA 5DDGA 4F93B 2NYXA 1HF0A 3SQNA 1SVLA 3B73A 1LUJB 3GFMA 2L7KA 1BI1A 1YYVA 4XRSA 2LY9A 2BY0A 1WPKA 5J40A 2NVXJ 1P4WA 4BS9A 2MH9A 4WWCA 3OL4A 4F3QA 2JT1A 4IF4A 4L9NA 1YW8A 4WK8F 3CMMA 4GDFA 2K3FA 4M9XA 3OYBA 2HQ5A 2X6YA 2XVCA 3VYSB 4IEJA 1U9NA 3PL8A 1HW1A 3HZJA 3RPUD 2ZJQF 3KZZA 5DS9A 3HOZJ 1E3PA 3GZNB 2KISA 1E2XA 2KIUA 2QKLB 4A3EJ 1TQMA 2XKPA 2EA4A 2LRDA 3HOVJ 1XC5A 1Y1VJ 4LOCA 4A3GJ 3JAMK 2M4GA 4S04A 3KIOA 3KE2A 3CCSI 2OF7A 4UNOA 3KLOA 1V55H 3G3ZA 1FOWA 5LFAA 4CUGA 2VT2A 1KA8A 2ZC2A 3BROA 3LSHA 3M8JA 3DF8A 5FKMA 1X19A 2WB1N 3HSRA 3B6CA 3FWEA 1ZR2A 1P4AA 1FJLA 2HOEA 3I58A 2XAJA 5D5VB 2KP6A 1BA5A 3TO7A 4YRVA 4M3BA 4CDGA 2ZFWA 5ILSA 2XB0X 5DUIA 2OAZA 3FX3A 1SD5A 4DYRA 2W4SA 1FEXA 5J1YA 2DDBA 4GXOA 3DTEA 3Q9VA 4B8XA 2IVMA 3BJ6A 4A3JJ 2A07F 3HDDA 3A02A 3QU6A 2JA6J 3R4KA 2RKHA 2Y2ZA 1T56A 3G1LA 3TO9A 3IAS2 2JVGA 3ABLH 3BR5A 2OD5A 1J9IA 3E3VA 1YQAA 4PJNA 1TQIA 3FKIJ 1RI7A 3LMMA 3E6BA 5AONA 1G3SA 2V9KA 1HXDA 4P9UA 3O2PE 3OIQA 5GAGJ 2XROA 1POGA 3FZVA 4XKBA 3L2RA 2CW0F 2NAZA 2MSYA 2CQNA 3IRRA 3MKZA 4OIOF 1P7IA 1YE9A 4HZFA 1W0UA 3IV5A 2YUSA 4M73A 4M3EA 5L3EA 1UJ8A 2ZSIB 2F5VA 3K6GA 4EJVA 1ETYA 3SZGA 2E1MB 4UHTA 2K02A 3JREA 2Y9YA 3C2GA 2VI6A 4LFUA 4I2OA 2VPLA 2DFHA 4A6EA 3ZR8X 5J47A 4IRGA 2BEOA 3TL4X 4KJZA 1GT0C 4W1UA 2VQCA 4V19K 2CW8A 2F6CA 4AVZA 3OR1C 2H8RA 3E5QA 2W00A 4D7NA 1TT0A 3JRCA 2VXZA 3HPHA 4LITA 1KU7A 3J7AY 3ESWB 2E1MC 4XIDA 2X1EA 1OCZH 5BQTA 3ABUA 4HEA2 4YEJA 4ASNA 2XB5A 2J5PA 2K7LA 4HAMA 1SD7A 3S3MA 3KLNA 5F0HA 4EM1A 2OBPA 1B72A 2RV8A 3QYEA 1A35A 1STZA 4PFOA 4I7HA 5FB2A 2M0MA 5K5QA 2QBYB 1JUPA 4ZYAA 1AA7A 4MIMA 3IC7A 3GVAA 1W1WE 2V4JC 3MWMA 2TCTA 2IBDA 3HKZA 3Q9SA 3IH4A 4PSXA 1ZREA 1AHDP 2R5YA 2H27A 1CF7B 2ZJ2A 1JHHA 4HLXA 3BP8A 1TW3A 2IS1A 2G7HA 4D7MA 2FBHA 4OOIA 1VF9A 4IQJA 5HDKA 2KIMA 2GXGA 2JJ7A 2FOWA 1YLFA 1XSXA 1NK2P 1WVRA 2FMYA 2VC0A 3DEEA 4NBQA 3S3NA 3K7AJ 1X3UA 3MVPA 4UB6C 1RKWA 1QRYA 1T38A 1YOVB 2HKXA 3HJEA 3G73A 4M9ZA 4JX6A 1H8AC 2DT6A 2AQFA 2EA2A 1R58A 3ZGKA 2ME0A 3Q0WA 3REOA 1J2XA 2FA5A 3OSGA 3NQOA 2BY2A 3E7LA 4JX4A 4KUMA 2ZMEB 3M07A 1T6SA 3VOEA 3RYRA 3LAJA 1RRJA 1YX5A 2IXSA 3O8GA 1X2NA 2ID3A 4DBRA 1X58A 2F5DA 2EIMH 2VBXA 2Z1DA 3JRDA 1WQ2A 2BY1A 1MBHA 4M6XA 4HF1A 1U2WA 2QQ9A 1F36A 1MNEA 2DMUA 3H5NA 3GTJJ 2PN6A 1B4AA 1X3ZB 5GTIC 4MO7A 2Y31A 2VPRA 4DYQA 2XGDA 2ZMEC 4OINF 1ORKA 2WA0A 2L9SA 3VSKA 4IXAA 2QGUA 2Z99A 2VKEA 3TW7A 3VODA 2K85A 3H9QA 3NWSA 3ZMTA 2L4AA 2O7OA 1YHQI 2FU4A 3RIRA 1NTCA 1ZRCA 5HS9A 3RQIA 5ERIA 4LD5A 2OZUA 4OIPF 3O3KA 3A2KA 4YFNF 3WE3A 4PCQA 1I50J 1KQ0A 3HHGA 1ZHFA 4XLEA 3WU2C 2DA6A 3K1MA 1T08B 3MKLA 3AL0B 1T95A 5ILUA 2LBFB 4O5VA 2HWVA 3CUQC 2KRHA 2XF7A 2L5QA 2LK2A 2OC6A 5E3OA 1JI8A 1TT5B 3PNYA 2EFWA 1XMXA 2K5CA 5FKOA 4NC7A 1YTYA 1XB4A 4A0ZA 2EIJH 2DA7A 3W2VA 3AL0C 1NHAA 2DDAA 2FEZA 3I71A 4R1HA 1W36C 2CU7A 2LY2A 1FBUA 3FMSA 3GFLA 1FC3A 2CGPA 3F6VA 2Z33A 2XGEA 4RGXA 4QPQA 4XL9A 1UHSA 3JRFA 3K70D 4HQMA 4C2UA 1UB9A 1ZGWA 2DK5A 4P9FA 1R1UA 5L3GA 3CZ6A 3TO6A 1BI3A 4FETA 1T33A 1CQTA 2Y75A 3I4NJ 3QPTA 4R8HA 3IP4B 2ESNA 4BKXA 4YIIA 2XSJC 4A5NA 2M7BA 3H5AA 1ZTRA 5J4YA 3FXQA 2FUG2 2HXOA 5L3FA 2V1NA 2HZDA 2NOJB 4ZZDA 2JQ7A 4D1QA 3CCVI 4WX9A 3GFJA 3I59A 2KDZA 3ABMH 2B0LA 2RNGA 1OYYA 4M3GA 5JFRA 1SFOJ 4P5OA 3T5XA 1KU9A 4XK4A 3IKVA 4BXFA 4ZDOA 2E60A 3V8LA 4HNVA 1PYVA 3LSKA 1HA8A 2PEXA 4PJLA 3GTKJ 1FLIA 3QYBA 4QTRA 4NNJA 1FBQA 3BR3A 3FM3A 3OYMA 2C6YA 2FMLA 4CICA 4HNUA 1PJRA 4CZZA 2O8KA 2DW4A 1UFMA 2V6CA 4HW0A 4HV5A 3Q0VA 1OR7A 2LG4A 2A5YB 1IXRC 3DPUA 5M5WJ 4XMYA 1EH8A 1V3FA 5IY5H 1X1PA 2ME6A 1VQ6I 2Z3YA 3A4CA 2XAHA 1MDMA 1WCMJ 4B3XA 3WGHA 1XN7A 2CMPA 2VBWA 4ITVA 1U3EM 1I3AA 4A3FJ 3K2ZA 1ZG5A 3BTLA 1T39A 3BTIA 2W1OA 4RB3C 3ZQGA 4KISA 2I8DA 2IAIA 2W48A 2DI3A 1MNDA 4QLCU 5LEJA 1WJEA 2CSOA 3K4CA 1TWFJ 3LSIA 4RM2A 2DTRA 3OS0A 2R7TA 2OPTA 4HSTA 2L9RA 2H8WA 3QODA 3UNGC 4BYYA 2FQ4A 4XSXF 5DTDA 3VPRA 4HBLA 3OYIA 2X6WA 3KYDB 4A3KJ 4EVIA 3WTVC 5KVRA 2HDDA 4XR6A 1FYLA 2VOOA 1NK3P 1R5GA 4XLAA 1BOAA 1YFHA 3V8KA 5C4JJ 3GYHX 1WJBA 3R61A 2ISYA 2BVLA 5HDGA 2BE5F 4ENNA 4MQVA 2VQGA 5B5EC 1ZARA 3S32A 2STWA 2PFBA 3LSTA 3TKYA 3R6SA 2DMNA 1IG7A 3CCRI 3WTUC 5E79C 1W7PB 4BNCA 2WAQN 3SEQA 3R60A 1QGPA 3FXUA 4IHTA 1IW7F 2DA4A 1VQPI 3ZRGA 2EWNA 2AS5F 4E6KG 3JRAA 5EZHA 2EFPA 5E17F 1V5EA 1MD0A 1R1VA 3LA7A 4CGZA 1LVAA 3ASNH 2M0CA 2PI0A 2OU2A 3TQNA 3C3WA 1DGWY 3OYCA 2CV1A 3O6BB 2OJED 2BHYA 1SC7A 3OYJA 3HC7A 2HQRA 1J09A 1MSEC 2F4IA 3PM1A 2EZKA 3BR0A 3E6MA 4JOMA 5CQGA 4Z6YA 4A3LJ 3T0YA 4M71A 1JJ6C 1FTTA 3GZ5A 5ICGA 5JLXA 1B72B 2EIKH 3CJQB 2R5ZA 4I76A 1ZR4A 4BE2A 4F52A 2P6TA 3HGGA 4DOZA 6PAXA 1IGNA 1SANA 3SFIA 4D9JA 4ZJZA 4E7SA 5M3MJ 5H20A 1J75A 2P5KA 5A2QK 5DEQA 2JA5J 5FLMJ 3BZCA 1WGXA 1VQ4I 4Y17A 1LPQA 1F4KA 3OYAA 1OLTA 2BY3A 2DU9A 2R5YB 4DQ2A 1Y1WJ 1XGNA 2ECBA 4IHXA 1W5SA 5JLWA 3F8NA 3DKXA 2R7WA 2CUEA 2XIGA 4AYBN 2LF7A 1KONA 2CYYA 2UV1A 2V1DA 3MFKA 2DT7B 2GZWA 4L9JA 3LSGA 1W4MA 3EUHA 4O6JA 3TGNA 4ZDPA 4OMYA 1IRZA 3BZKA 4XLHA 1DP3A 1B1BA 2D1HA 3E5XA 4PZJA 2UZKA 5IP6A 1OCPA 4FHTA 2AO9A 4XORA 3L2UA 1P2FA 1QZYA 3TP3A 3BY6A 1BI2A 1N77A 1YI2I 1FT9A 5DM7F 1YIJI 1LDJA 4BY1J 3I53A 3MZHA 4RB0A 2FBIA 4TV7A 2VLAA 2Y0MA 2KJCA 5EEHA 2EFNA 2E5ZA 5L3DA 4DJAA 2Z2SB 3D5SC 3MEXA 1P7JA 3KP5A 5ICCA 1VQOI 3LL7A 5F04A 2IP2A 2GBYA 2X1CA 3EDPA 4XOPA 4BHCA 4D5CA 1QQIA 2COBA 1OJLA 2QLZA 5EGOA 1GLNA 1K61A 2VC1A 2F5EA 5LLQA 2B9SA 3WE2A 3ZQLA 2FJ1A 4HQEA 1Z0XA 4B4CA 2L7MP 3BR6A 1L0OC 2MBFA 5DUKA 4I99C 2LTPA 5DCMA 4C3IJ 3CCEI 1FTZA 4CCMA 2EJRA 2R7QA 3ELKA 2HS5A 2ZXHA 2DFFA 1RESA 3H1CA 4A3IJ 4ABZA 1IN6A 2DFIA 1OQYA 3SDGA 1XGSA 4DYCA 4RAZA 2L0KA 2X0LA 5IYBJ 3F22A 3HPGA 3KP7A 2QYOA 1HSTA 3F8BA 3F8FA 2JK3A 2IA0A 2X1DA 2Y69H 2ZNYA 3CQZJ 4Y7NJ 3U21A 5J4VA 5FLXK 1IZ1A 3VYUB 2E35A 4HYEA 3BPXA 4QWQA 4L0YB 2NVQJ 1BI0A 3AG1H 2QSGX 2WBMA 4AD9A 1W36D 3FISA 2YU9J 1TNTA 2L9VA 1XD7A 5FJ8J 5DD8A 3A03A 3PUBA 4W97A 4YIFA 1IN7A 3RZDJ 1Z6TA 2HKOA 3OS2A 2ZXIA 1GUUA 2BXZA 1DU0A 2OQRA 4ZYGA 4BE0A 1K4SA 4BU2A 1HCRA 1Y8RB 3QOPA 2Y48A 2STTA 1S3JA 2MFZA 2JPCA 3DV8A 2QEXI 2PJRA 2IS6A 2XASA 2Q0OA 3LNQA 3VEPA 1K79A 2F2EA 4G7ZF 4LLLA 2O8XA 1OCCH 4G9YA 4XOTA 4MNUA 4L5IA 2ID6A 5B1BH 3FMQA 3GMEA 2KZGA 2VQLA 5ICFA 1Q1HA 2QUFA 3LAPA 3GTQJ 3S14J 4DW6A 3ZQIA 2BYVE 3MD2A 2E2JJ 1OFCX 1D8KA 2Y0SN 3PUFA 5JHUA 4RB1A 1B9MA 4BXXJ 3VYTB 4AM3A 1JKPC 1VQKI 2DO7A 3IH2A 3TMOA 3I59B 1U8BA 1NH3A 1YITI 2R7UA 2DQRA 4EGZA 1MH3A 4S0HB 3I55I 2R92J 2F5FA 1ZK8A 4UVAA 1Y6IA 4YFKF 1CGPA 3I9V2 3NEUA 3HRMA 2B63J 2CUJA 4BDZA 3F21A 3FM5A 4IRIA 4A3CJ 2KLOA 2JN6A 5FRMA 1TWAJ 1BC7C 1XPXA 2E7WA 5LRSA 2E71A 1QA6A 1KQ9A 1ZELA 5FKNA 2DYSH 3EQLF 2IW5A 2GIVA 2K9NA 3BJAA 3DQVC 3RCOA 1MDMB 2X48A 3G2BA 2LD5A 1KYWA 1V54H 2E1NA 4Q47A 5D6EA 1RC9A 4BHBA 1QO0D 4AU7A 4KIFA 4CZCA 2YR2A 3S2HJ 2HDCA 2IGKA 2ZBKA 1VQ9I 4U87A 1OR7C 2E2HJ 3CC2I 2NVTJ 1X1CA 5J8FA 1SVMA 4NDLA 2RGVA 3G1OA 3K4KA 4L5JA 2M1BA 4XBFA 4UUVA 3F23A 4GGGA 2JRMA 1LQ1A 2DBBA 4XKVA 5LHHA 2OQGA 4OIQF 2P4WA 3P9KA 4XM3A 4ETSA 2O61A 3BCAA 1IXCA 3CESA 3CCQI 2EH3A 4AWXB 5D4RA 2D2WA 4G6DA 4CYCA 3N4MA 4PUSA 2VIXA 3HBLA 4FCYA 3M7GA 1BM9A 2V9PA 1V4RA 1D3YA 2PX9A 4HSRA 1SEUA 5CKTA 2RQPA 2EZLA 3DBLB 3S17J 3BPVA 4LK0F 3KEOA 3QQAA 2QQAA 1VI0A 3K2AA 4NB5A 1I6XA 1W5CC 5BMZA 1S7AA 2ESHA 2H6CA 1G3TA 2OV7A 1LDKB 3QP6A 4ON0A 2CJJA 3D0SA 2MA3A 3WG7H 5L3BA 1MIJA 2E34A 4LIVA 4CHUA 2HXIA 1BR2A 2H1LA 2R7FA 2HYJA 3CMYA 3NWTA 4OWRB 3DP7A 1W7PA 2XRNA 5CVUA 3WTXC 1G8XA 4CSWA 1GV5A 1C0WA 4XN0A 3FF5A 4B44A 4C9YA 3BZ6A 2V6EA 2UXNA 3CJNA 5E3NA 1USSA 1WH7A 4B3AA 1E3HA 3L7WA 1R7JA 2MC4A 2A05A 3ECHA 4XRSG 4MQ9F 3I56I 2VBZA 1O3RA 1NG6A 5L3CA 4LLNA 3DPTA 3L00A 2JA2A 2DFEA 4IHYA 4A3MJ 1QU3A 2YS9A 2UUZA 2AXTC 3JSPA 2FBKA 4GRIA 4NC6A 1J59A 4OMZA 3ERMA 3E6CC 2PMZA 1TLHB 1MJBA 1SVOA 1VTNC 3DKWA 1U5TB 2O3FA 2V26A 4LB6B 4F55A 1ZGJA 4KDPA 2WV1A 3OOUA 2CFOA 4NQWA 1ITYA 2EPFA 3CDHA 1B8IA 3DLLF 4BQOA 1Y0UA 2GIZA 3WU1B 5FRNA 4UV8A 5E3MA 3I5UA 5FD6A 4II3A 2R5ZB 2HDWA 3SZPA 1Y39A 3WHBA 4B48A 1A5JA 5CVVA 4G6TB 3OS1A 4Y52J 2LLKA 2QZ8A 5JR3A 1BJAA 2XAFA 3L1PA 2ECCA 2ZXWH 1ZRFA 5C3EJ 4KMFA 2F4OB 1XSDA 3A0HC 3GW2A 3W2WA 1SAUA 3OOPA 2VXDA 4BHPA 3O8HA 5E1ZB 3JAMZ 1G3WA 4JX5A 2ELKA 3C2BA 2EV0A 2UXXA 3V7SA 5C44J 4E7LA 4RM3A 2DK8A 1G3YA 2M30A 4L0ZB 3CP2A 2QSFX 2OUMA 4LG0A 3CF5F 1G4DA 4RB2C 5TJJA 1S6LA 4EJOA 3ZQQA 4CA0A 3S93A 2CWEA 4Y13A 1VFCA 4CCJA 3LSJA 2VASA 2KHMA 1FYKA 4XNFA 2D1VA 5IYCJ 3D1NI 4H4KC 1VQ7I 1EJ9A 1OPCA 3ZN0A 1RNLA 4WF2A 2GA1A 4CXFA 1VZ0A 3K0LA 5B66C 1IRFA 1X1AA 1XMAA 3H3ZA 4XKCA 3ZCOA 2ZJRF 1I1SA 2NOGA 1RR8C 1LDDA 1LVKA 3EUHC 1T0FA 2R7DA 3I64A 4KA4A 4MTEA 2Q2EA 1LFPA 1WWXA 2LVSA 5EG0A 3PNVA 1QPIA 1TTYA 4U88A 2DODA 2JUCA 4Q4ZF 5CVIA 1F9NA 2DOAA 3CTAA 1ETWA 4RAGA 3G1MA 2IEKA 1WJDA 2NRAC 5EGOB 1SD6A 5D5WB 4NC8A 4FTHA 5LGUA 3K4NA 2KPMA 2QQBA 3K69A 1K4TA 1FIAA 3BG6A 3ZMVA 2HPMA 3C7JA 3IAM2 5DCMB 4BXUA 2M7AA 4IX7A 3VWBA 5E1XA 3GWZA 3P5JA 1ETOA 1YO5C 4ESJA 2QM3A 4L9TA 2N8GA 2TRTA 4YELA 1USTA 2VONA 3HRSA 1ZAOA 1TL8A 4U7DA 3GZ6A 4KYWA 2PG4A 1V5GA 4Y3OA 3PFYA 2QENA 4UY8I 2V79A 2DQLA 3ZPLA 3PFIA 1A31A 5GAHJ 3GTPJ 4B09A 2AHQA
chains in the Genus database with same CATH topology
2DMNA 3B6AA 1IG7A 1LFBA 5J1UA 1HDDC 3GTLJ 3SJMA 3S1MJ 4G12A 5IPAA 2HOSA 2WAQN 2DMPA 1W0TA 1HOMA 3FIWA 5EDNA 1A6IA 4M3FA 5IOZA 2DA4A 5J1RA 1IDZA 2K40A 3MN2A 1G2HA 3JRAA 4A69C 2VUMJ 5EZHA 2M0CA 2QCOA 5GP9A 2CQQA 3HOYJ 1APLC 3HM5A 2M8GX 3BG9A 2GLOA 2QF7A 5IYDJ 3Q0UA 3Q3SA 1HDPA 1MSEC 3PM1A 2EZKA 3BR0A 5FKLA 1O4XA 2D5VA 1QVUA 4A3LJ 4JP0A 5EYRA 4UUSA 1JJ6C 1FTTA 2XPUA 3BG3A 3HB9A 1K83J 5JLXA 1B72B 4DZJA 2R5ZA 4I76A 1ZR4A 1H88C 4AUXA 3NARA 5K7ZA 5EEAA 3HGGA 1RETA 1HF0A 3LOCA 2LP0A 2DA1A 1IGNA 1SANA 1JT6A 4XRSA 2LY9A 3SFIA 5FLVA 1WPKA 5M3MJ 2NVXJ 1IV6A 3S1NJ 4XRMA 2JA5J 2VKVA 5FLMJ 1WGXA 2KT0A 3GTOJ 2R5YB 1Y1WJ 4MLOA 3QPLA 1MH4A 2HQ5A 2H1KA 2ECBA 1OCTC 4IEJA 1VNDA 3RZOJ 1MBJA 1JTXA 1U9NA 4IHXA 5JLWA 3OIOA 5EZGA 2CUEA 3FK6A 4AYBN 3BTJA 5DS9A 3HOZJ 1ETKA 1GVDA 3LSGA 4A3EJ 5M5YJ 1AKHA 1IRZA 3PO2J 1H89C 5IP6A 1XC5A 1Y1VJ 4LOCA 3HOVJ 4A3GJ 4BBRJ 1OCPA 3S1RJ 1BL0A 2AO9A 2OF7A 2CUFA 3TP3A 3S16J 4BY1J 1F43A 3GTGJ 5FKMA 1PUFB 1RPWA 2WB1N 5J3LA 3B6CA 1ZR2A 1FJLA 1P7JA 1BA5A 4M3BA 5F04A 1XG1A 2DJNA 2XB0X 2GM4A 2GBYA 4DYRA 3PO3J 1IDYA 1UMQA 4D5CA 5GPCA 1FEXA 1TWHJ 5J1YA 2COBA 4C3JJ 4FE4A 3NAUA 4CYCB 1OJLA 1JUSA 2XPWA 5EGOA 4M6VA 1K61A 3ZQHA 5EF6A 3ZQLA 3HDDA 4A3JJ 2FJ1A 3A02A 1Z0XA 4B4CA 2JA6J 3BQYA 2L7MP 3BR6A 2Y2ZA 2LTPA 4C3IJ 1T56A 3G1LA 1FTZA 1XS9A 1ETVA 3BR5A 1X2MA 4MFEA 3ZOBA 2CQXA 3BR1A 2L7ZA 1YRNB 1RESA 3FKIJ 4A3IJ 4V2FA 4ABZA 1JKQC 2EZHA 3SDGA 4DYCA 2L0KA 5IYBJ 1FIPA 2EQRA 2DTZA 3FK7A 2JK3A 1POGA 3HOWJ 3CQZJ 4Y7NJ 1JUMA 2MSYA 3JRBA 2NVQJ 1P7IA 1W0UA 3IV5A 3JRGA 2YUSA 1MBKA 4M3EA 4UUTA 3FISA 2L7FP 1RR7A 2YU9J 1JT0A 1ETYA 5F08A 3HGYA 5F27A 5FJ8J 3JREA 2Y9YA 3A03A 1JTYA 2VI6A 3BG5A 4W97A 3RZDJ 3BT9A 1GT0C 4C2MJ 1GUUA 4W1UA 1DU0A 2X6OA 2P81A 2K9QA 1HCRA 2XSDC 4BY7J 2H8RA 3JRCA 4D7NA 2JA8J 3RKQA 4XIDA 3LNQA 3JRIA 2FX0A 2XB5A 1B8IB 2R93J 1WI3A 2ID6A 5F0HA 1B72A 3GTQJ 3S14J 4DW6A 3ZQIA 2DA3A 3LSPA 2E2JJ 1OFCX 4V2GA 2Y0SN 1JUPA 4A3BJ 2LKXA 3A01B 3HOUJ 5HODA 4BXXJ 4MIMA 5IOYA 1JKPC 2XRLA 3IH2A 3DCFA 1U8BA 2TCTA 2IBDA 3HEFA 1MH3A 4S0HB 2R92J 1MBEA 3HKZN 3IH4A 4I6ZA 2RAEA 1ZK8A 1AHDP 3GTPJ 2R5YA 1ETXA 1U9OA 4A93J 3BR2A 2DMTA 1BW6A 5FKKA 3HOXJ 2B63J 2X9DA 1ZKGA 4D7MA 1VF9A 1D5YA 2G0EA 4A3CJ 2JN6A 1MBGA 1TWAJ 2JJ7A 1RKTA 1NK2P 3S2DJ 3K7AJ 4J19A 3MVPA 1RKWA 1QRYA 2MW8A 1DU6A 5FKNA 1JKOC 1IUFA 1JGGA 2K9NA 2E19A 4JX6A 1H8AC 2X48A 2LD5A 2ME0A 3Q0WA 3OSGA 2LFBA 3E7LA 3S2HJ 4JX4A 1PUFA 2E2HJ 2NVTJ 3O8GA 1X2NA 2ID3A 4NDLA 3G1OA 5EG0B 4RBOA 1X58A 3JRDA 1MBHA 5IP7J 4AC0A 5IP9J 1F36A 1I3QJ 2ZB9A 2MGQA 2DMUA 3GTJJ 4MO7A 2Y31A 2VPRA 1GDTA 2EH3A 4DYQA 2XGDA 4CYCA 2R7ZJ 3HBLA 1ORKA 4FCYA 3ZQCA 3DEWA 2VKEA 3TW7A 4IHVA 3GTMJ 3WHCA 4IHWA 2EZLA 3CCYA 1IJWC 3S17J 3QQAA 1VI0A 2O7OA 2DMQA 2EZIA 3K2AA 4QSHA 1I6HJ 1NTCA 3RQIA 3TP0A 3TW6A 3UKGA 2CJJA 5C4XJ 3F0CA 1WH5A 1LE8B 1I50J 2K9SA 2HXIA 2DA6A 3MKLA 1MBFA 2HYJA 4XICA 3CMYA 3W6VA 2JWTA 2FD5A 5F1JA 1S7EA 1GV5A 2R0QC 2LK2A 5E3OA 5E3NA 1WH7A 4FE7A 4B3AA 4BBSJ 5FKOA 3OSFA 4XRSG 3JRHA 1LFUP 2DA7A 5F0FA 4GFBA 1JKRC 4A3MJ 4IHYA 2YS9A 1QVTA 4JYKA 2DA2A 2CU7A 1TWCJ 2XGEA 3BTCA 2XGCA 3JR9A 2E2IJ 1ETQA 2NVYJ 5K7FA 1UHSA 3JRFA 3LSRA 1AU7A 3S1QJ 2PMZN 1ZGWA 2LR8A 5E3LA 1TWGJ 2M9HA 2WV1A 3OOUA 3QPSA 5GPAA 1ITYA 1T33A 1B8IA 1CQTA 3I4NJ 4UUSB 4DZPA 4QIWN 4BKXA 5E3MA 4M3DA 1ZTRA 2R5ZB 1UG2A 4X1EA 3WHBA 1HLVA 2HXOA 2I10A 1A5JA 4Y52J 2LLKA 1TC3C 3A01A 3L1PA 2ECCA 5C3EJ 2KDZA 1GV2A 5M5XJ 3O8HA 4M3GA 1SFOJ 4JX5A 4XK4A 2ELKA 3C2BA 4HNVA 1Z77A 1E3OC 5C44J 3GTKJ 3S15J 4MFDA 2E1OA 5M3FJ 4QTRA 3BR3A 2NS8A 4L5EA 1VFCA 1JJ8C 2O8KA 1R9TJ 2HOAA 5K7HA 1AKHB 2XPVA 3LSJA 3Q0VA 1U78A 5IYCJ 2DN0A 3D1NI 5M5WJ 2JA7J 2ME6A 4B1RA 1ENHA 1WCMJ 2CRGA 2MG4A 2EBIA 4C3HJ 2NOGA 3TEDA 3CDLA 3GBGA 4A3FJ 3M3YJ 1BW5A 3BTLA 4EEFG 3BTIA 3ZQGA 2IAIA 9ANTA 2LVSA 5EG0A 2Y30A 1QPIA 2W48A 5F0CA 1Q1VA 1EF4A 1ETWA 1TWFJ 3G1MA 3H3VK 1IC8A 2IEKA 2M2EA 2OPTA 2L9RA 3BQZA 2FQ4A 5EGOB 4FTHA 5DTDA 2Y9ZA 4FISA 3VPRA 3M4OJ 2HI3A 2JMWA 3I4MJ 1FIAA 3H0GJ 5BNGA 4A3KJ 1YRNA 1ZQ3P 2HDDA 2DA5A 2O9LA 1NK3P 1MNMC 1ETOA 2HOTA 1BJZA 3IH3A 5C4JJ 2N8GA 2TRTA 4A3DJ 4RDUA 4D5FA 1LE8A 4X6AJ 2NS7A 3ZQFA 1MSFC 2M34A 2AHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMN A;  3B6A A;  1IG7 A;  1LFB A;  5J1U A;  1HDD C;  3GTL J;  3SJM A;  3S1M J;  4G12 A;  5IPA A;  2HOS A;  2WAQ N;  2DMP A;  1W0T A;  1HOM A;  3FIW A;  5EDN A;  1A6I A;  4M3F A;  5IOZ A;  2DA4 A;  5J1R A;  1IDZ A;  2K40 A;  3MN2 A;  1G2H A;  3JRA A;  4A69 C;  2VUM J;  5EZH A;  2M0C A;  2QCO A;  5GP9 A;  2CQQ A;  3HOY J;  1APL C;  3HM5 A;  2M8G X;  3BG9 A;  2GLO A;  2QF7 A;  5IYD J;  3Q0U A;  3Q3S A;  1HDP A;  1MSE C;  3PM1 A;  2EZK A;  3BR0 A;  5FKL A;  1O4X A;  2D5V A;  1QVU A;  4A3L J;  4JP0 A;  5EYR A;  4UUS A;  1JJ6 C;  1FTT A;  2XPU A;  3BG3 A;  3HB9 A;  1K83 J;  5JLX A;  1B72 B;  4DZJ A;  2R5Z A;  4I76 A;  1ZR4 A;  1H88 C;  4AUX A;  3NAR A;  5K7Z A;  5EEA A;  3HGG A;  1RET A;  1HF0 A;  3LOC A;  2LP0 A;  2DA1 A;  1IGN A;  1SAN A;  1JT6 A;  4XRS A;  2LY9 A;  3SFI A;  5FLV A;  1WPK A;  5M3M J;  2NVX J;  1IV6 A;  3S1N J;  4XRM A;  2JA5 J;  2VKV A;  5FLM J;  1WGX A;  2KT0 A;  3GTO J;  2R5Y B;  1Y1W J;  4MLO A;  3QPL A;  1MH4 A;  2HQ5 A;  2H1K A;  2ECB A;  1OCT C;  4IEJ A;  1VND A;  3RZO J;  1MBJ A;  1JTX A;  1U9N A;  4IHX A;  5JLW A;  3OIO A;  5EZG A;  2CUE A;  3FK6 A;  4AYB N;  3BTJ A;  5DS9 A;  3HOZ J;  1ETK A;  1GVD A;  3LSG A;  4A3E J;  5M5Y J;  1AKH A;  1IRZ A;  3PO2 J;  1H89 C;  5IP6 A;  1XC5 A;  1Y1V J;  4LOC A;  3HOV J;  4A3G J;  4BBR J;  1OCP A;  3S1R J;  1BL0 A;  2AO9 A;  2OF7 A;  2CUF A;  3TP3 A;  3S16 J;  4BY1 J;  1F43 A;  3GTG J;  5FKM A;  1PUF B;  1RPW A;  2WB1 N;  5J3L A;  3B6C A;  1ZR2 A;  1FJL A;  1P7J A;  1BA5 A;  4M3B A;  5F04 A;  1XG1 A;  2DJN A;  2XB0 X;  2GM4 A;  2GBY A;  4DYR A;  3PO3 J;  1IDY A;  1UMQ A;  4D5C A;  5GPC A;  1FEX A;  1TWH J;  5J1Y A;  2COB A;  4C3J J;  4FE4 A;  3NAU A;  4CYC B;  1OJL A;  1JUS A;  2XPW A;  5EGO A;  4M6V A;  1K61 A;  3ZQH A;  5EF6 A;  3ZQL A;  3HDD A;  4A3J J;  2FJ1 A;  3A02 A;  1Z0X A;  4B4C A;  2JA6 J;  3BQY A;  2L7M P;  3BR6 A;  2Y2Z A;  2LTP A;  4C3I J;  1T56 A;  3G1L A;  1FTZ A;  1XS9 A;  1ETV A;  3BR5 A;  1X2M A;  4MFE A;  3ZOB A;  2CQX A;  3BR1 A;  2L7Z A;  1YRN B;  1RES A;  3FKI J;  4A3I J;  4V2F A;  4ABZ A;  1JKQ C;  2EZH A;  3SDG A;  4DYC A;  2L0K A;  5IYB J;  1FIP A;  2EQR A;  2DTZ A;  3FK7 A;  2JK3 A;  1POG A;  3HOW J;  3CQZ J;  4Y7N J;  1JUM A;  2MSY A;  3JRB A;  2NVQ J;  1P7I A;  1W0U A;  3IV5 A;  3JRG A;  2YUS A;  1MBK A;  4M3E A;  4UUT A;  3FIS A;  2L7F P;  1RR7 A;  2YU9 J;  1JT0 A;  1ETY A;  5F08 A;  3HGY A;  5F27 A;  5FJ8 J;  3JRE A;  2Y9Y A;  3A03 A;  1JTY A;  2VI6 A;  3BG5 A;  4W97 A;  3RZD J;  3BT9 A;  1GT0 C;  4C2M J;  1GUU A;  4W1U A;  1DU0 A;  2X6O A;  2P81 A;  2K9Q A;  1HCR A;  2XSD C;  4BY7 J;  2H8R A;  3JRC A;  4D7N A;  2JA8 J;  3RKQ A;  4XID A;  3LNQ A;  3JRI A;  2FX0 A;  2XB5 A;  1B8I B;  2R93 J;  1WI3 A;  2ID6 A;  5F0H A;  1B72 A;  3GTQ J;  3S14 J;  4DW6 A;  3ZQI A;  2DA3 A;  3LSP A;  2E2J J;  1OFC X;  4V2G A;  2Y0S N;  1JUP A;  4A3B J;  2LKX A;  3A01 B;  3HOU J;  5HOD A;  4BXX J;  4MIM A;  5IOY A;  1JKP C;  2XRL A;  3IH2 A;  3DCF A;  1U8B A;  2TCT A;  2IBD A;  3HEF A;  1MH3 A;  4S0H B;  2R92 J;  1MBE A;  3HKZ N;  3IH4 A;  4I6Z A;  2RAE A;  1ZK8 A;  1AHD P;  3GTP J;  2R5Y A;  1ETX A;  1U9O A;  4A93 J;  3BR2 A;  2DMT A;  1BW6 A;  5FKK A;  3HOX J;  2B63 J;  2X9D A;  1ZKG A;  4D7M A;  1VF9 A;  1D5Y A;  2G0E A;  4A3C J;  2JN6 A;  1MBG A;  1TWA J;  2JJ7 A;  1RKT A;  1NK2 P;  3S2D J;  3K7A J;  4J19 A;  3MVP A;  1RKW A;  1QRY A;  2MW8 A;  1DU6 A;  5FKN A;  1JKO C;  1IUF A;  1JGG A;  2K9N A;  2E19 A;  4JX6 A;  1H8A C;  2X48 A;  2LD5 A;  2ME0 A;  3Q0W A;  3OSG A;  2LFB A;  3E7L A;  3S2H J;  4JX4 A;  1PUF A;  2E2H J;  2NVT J;  3O8G A;  1X2N A;  2ID3 A;  4NDL A;  3G1O A;  5EG0 B;  4RBO A;  1X58 A;  3JRD A;  1MBH A;  5IP7 J;  4AC0 A;  5IP9 J;  1F36 A;  1I3Q J;  2ZB9 A;  2MGQ A;  2DMU A;  3GTJ J;  4MO7 A;  2Y31 A;  2VPR A;  1GDT A;  2EH3 A;  4DYQ A;  2XGD A;  4CYC A;  2R7Z J;  3HBL A;  1ORK A;  4FCY A;  3ZQC A;  3DEW A;  2VKE A;  3TW7 A;  4IHV A;  3GTM J;  3WHC A;  4IHW A;  2EZL A;  3CCY A;  1IJW C;  3S17 J;  3QQA A;  1VI0 A;  2O7O A;  2DMQ A;  2EZI A;  3K2A A;  4QSH A;  1I6H J;  1NTC A;  3RQI A;  3TP0 A;  3TW6 A;  3UKG A;  2CJJ A;  5C4X J;  3F0C A;  1WH5 A;  1LE8 B;  1I50 J;  2K9S A;  2HXI A;  2DA6 A;  3MKL A;  1MBF A;  2HYJ A;  4XIC A;  3CMY A;  3W6V A;  2JWT A;  2FD5 A;  5F1J A;  1S7E A;  1GV5 A;  2R0Q C;  2LK2 A;  5E3O A;  5E3N A;  1WH7 A;  4FE7 A;  4B3A A;  4BBS J;  5FKO A;  3OSF A;  4XRS G;  3JRH A;  1LFU P;  2DA7 A;  5F0F A;  4GFB A;  1JKR C;  4A3M J;  4IHY A;  2YS9 A;  1QVT A;  4JYK A;  2DA2 A;  2CU7 A;  1TWC J;  2XGE A;  3BTC A;  2XGC A;  3JR9 A;  2E2I J;  1ETQ A;  2NVY J;  5K7F A;  1UHS A;  3JRF A;  3LSR A;  1AU7 A;  3S1Q J;  2PMZ N;  1ZGW A;  2LR8 A;  5E3L A;  1TWG J;  2M9H A;  2WV1 A;  3OOU A;  3QPS A;  5GPA A;  1ITY A;  1T33 A;  1B8I A;  1CQT A;  3I4N J;  4UUS B;  4DZP A;  4QIW N;  4BKX A;  5E3M A;  4M3D A;  1ZTR A;  2R5Z B;  1UG2 A;  4X1E A;  3WHB A;  1HLV A;  2HXO A;  2I10 A;  1A5J A;  4Y52 J;  2LLK A;  1TC3 C;  3A01 A;  3L1P A;  2ECC A;  5C3E J;  2KDZ A;  1GV2 A;  5M5X J;  3O8H A;  4M3G A;  1SFO J;  4JX5 A;  4XK4 A;  2ELK A;  3C2B A;  4HNV A;  1Z77 A;  1E3O C;  5C44 J;  3GTK J;  3S15 J;  4MFD A;  2E1O A;  5M3F J;  4QTR A;  3BR3 A;  2NS8 A;  4L5E A;  1VFC A;  1JJ8 C;  2O8K A;  1R9T J;  2HOA A;  5K7H A;  1AKH B;  2XPV A;  3LSJ A;  3Q0V A;  1U78 A;  5IYC J;  2DN0 A;  3D1N I;  5M5W J;  2JA7 J;  2ME6 A;  4B1R A;  1ENH A;  1WCM J;  2CRG A;  2MG4 A;  2EBI A;  4C3H J;  2NOG A;  3TED A;  3CDL A;  3GBG A;  4A3F J;  3M3Y J;  1BW5 A;  3BTL A;  4EEF G;  3BTI A;  3ZQG A;  2IAI A;  9ANT A;  2LVS A;  5EG0 A;  2Y30 A;  1QPI A;  2W48 A;  5F0C A;  1Q1V A;  1EF4 A;  1ETW A;  1TWF J;  3G1M A;  3H3V K;  1IC8 A;  2IEK A;  2M2E A;  2OPT A;  2L9R A;  3BQZ A;  2FQ4 A;  5EGO B;  4FTH A;  5DTD A;  2Y9Z A;  4FIS A;  3VPR A;  3M4O J;  2HI3 A;  2JMW A;  3I4M J;  1FIA A;  3H0G J;  5BNG A;  4A3K J;  1YRN A;  1ZQ3 P;  2HDD A;  2DA5 A;  2O9L A;  1NK3 P;  1MNM C;  1ETO A;  2HOT A;  1BJZ A;  3IH3 A;  5C4J J;  2N8G A;  2TRT A;  4A3D J;  4RDU A;  4D5F A;  1LE8 A;  4X6A J;  2NS7 A;  3ZQF A;  1MSF C;  2M34 A;  2AHQ A; 
#chains in the Genus database with same CATH topology
 3ERE D;  3QU3 A;  1MJA A;  3GTL J;  3S1M J;  4G12 A;  3VSL A;  3JSO A;  5IPA A;  3LSM A;  3GUD A;  1UG0 A;  4UV9 A;  3W6J B;  3R0A A;  5FRO A;  2KQR A;  5DM6 F;  5IOZ A;  1IAW A;  1IDZ A;  1LEA A;  2YPR A;  3X2Q H;  4KNY A;  3KZY A;  4XON A;  1R1T A;  2QCO A;  1UCR A;  2Q1Z B;  3CME I;  2CQQ A;  3GLX A;  4E7I A;  3K1N A;  2ZXJ A;  3HM5 A;  2PJR B;  2GAU A;  4G6Q A;  4LB5 A;  3KP4 A;  5IYD J;  3IKT A;  3M8F A;  2L3D A;  1R4M B;  1HDP A;  3J80 K;  3DWL E;  3U1D A;  2D5V A;  3H0D A;  3CCU I;  5LRR A;  1K83 J;  2VJJ A;  2V1X A;  4DZJ A;  5HS8 A;  2L4M A;  4BL0 B;  1H88 C;  1GXQ A;  4AUX A;  3FKJ A;  3NAR A;  5K7Z A;  1Y56 A;  3HYI A;  5EEA A;  1MJ9 A;  4QPO A;  2LP0 A;  3QYF A;  1IN8 A;  5FLV A;  5IT9 K;  3AG2 H;  4XRM A;  5CJ9 A;  4C30 A;  1B9N A;  3H3U A;  3M8E A;  1VQM I;  1D0X A;  2VOD A;  2L01 A;  2LOO A;  2KT0 A;  2MLK A;  4BJ6 C;  3V42 A;  2ZO4 A;  2DAO A;  2LDU A;  1XGM A;  3GCM A;  3QPL A;  2YU3 A;  3RZO J;  2Z5U A;  1YJN I;  1MBJ A;  3CC7 I;  2K4J A;  2QVO A;  3OIO A;  4J00 A;  2CQK A;  3CLO A;  3FK6 A;  4FX0 A;  3BTJ A;  3RKX A;  2E2I J;  1OKR A;  4ZH4 F;  2AXL A;  4A0X A;  1S8N A;  2EV6 A;  2FRH A;  4WXC A;  1GVD A;  5M5Y J;  1R49 A;  3PO2 J;  5K5O A;  3QOE A;  1SAX A;  2KJB A;  2J5O A;  4LJZ F;  2HPI A;  1V5F A;  2IT0 A;  1BL0 A;  4ZYD A;  1WHU A;  2CUF A;  1SD4 A;  2L54 A;  3KZI C;  1ONV A;  5CVJ A;  2DPD A;  1YJW I;  3FXR A;  1FNN A;  1K6Y A;  2GA2 A;  1F43 A;  4UXN A;  3LA3 A;  3OYH A;  4L9V A;  1U0J A;  3OYE A;  1EV7 A;  3D5L A;  5J3L A;  3I54 A;  4XLP F;  1H0M A;  1L3L A;  2XAU A;  1HQC A;  2CS3 A;  1ULY A;  4DGW B;  3VYR B;  3K4M A;  1XG1 A;  4ENJ A;  3CCM I;  3QAH A;  4AIJ A;  3TBI A;  5CQE A;  3PO3 J;  1UMQ A;  2TDX A;  4I98 B;  1HKQ A;  3BOQ A;  4CYC B;  4IQ4 A;  1JUS A;  2XPW A;  4OAZ A;  4M6V A;  3T1B A;  3ZQH A;  5EF6 A;  3EPZ A;  2M5W A;  5K5R A;  1FX7 A;  1EH7 A;  1HSJ A;  3CUO A;  3BQY A;  3J7A O;  3KPH A;  1X4O A;  1T8I A;  2FQ3 A;  2IRF G;  1JE8 A;  1XDU A;  1Z9C A;  1X2M A;  4MFE A;  3J7Z I;  2EFO A;  2CQX A;  4HG2 A;  4BEH A;  1SFX A;  4V2F A;  1ZGA A;  2A61 A;  3GF2 A;  4HX4 A;  5GAD J;  4RAF A;  2KRF A;  1O3T A;  3HRT A;  1DPR A;  3QP5 A;  4FT8 A;  5GAE J;  2DTZ A;  5FGM A;  3IRQ A;  1FMV A;  3N05 A;  4ZZL A;  1ZG3 A;  3HOW J;  2NNN A;  2R7R A;  4P1W A;  1LJ9 A;  1D1A A;  4NUB A;  2V9V A;  3SYT A;  3WGG A;  1Z7U A;  1UHM A;  4UUT A;  1E17 A;  3ZMD A;  4MTD A;  4XLC A;  3OR2 C;  5F1R A;  2F4M B;  2LNB A;  2L7F P;  4G8X A;  1JT0 A;  1F5T A;  5F08 A;  3HGY A;  2KIF A;  1XCV A;  5F27 A;  2A68 F;  2HTJ A;  1JTY A;  1G59 A;  2MLG A;  3H36 A;  1MMG A;  3BT9 A;  3UR3 C;  1FOX A;  4C2M J;  4G7O F;  3LWF A;  1IF1 A;  1U5T A;  5D8L B;  2X6O A;  3K1P A;  2PMU A;  2OTL I;  3BWG A;  2XSD C;  3DKY A;  1WSU A;  3RKQ A;  2UWM A;  2XDV A;  2DCE A;  1MMS A;  4NQW B;  2VL8 A;  4A12 A;  1ERD A;  2FE3 A;  3SHF A;  5HVQ C;  3OYD A;  1B8I B;  4E7H A;  1FOY A;  5IT9 Z;  2R93 J;  4I0B A;  1WI3 A;  5LGN A;  4R79 A;  3EET A;  3S2W A;  2FOK A;  3ZMZ A;  3QPH A;  3BLY A;  1MMD A;  2DA3 A;  3LSP A;  4BAC A;  1KQ8 A;  4V2G A;  3WGI A;  2X4H A;  4A3B J;  5BOX A;  2LKX A;  4HF2 A;  1K78 A;  1RIO H;  5HOD A;  2RNJ A;  3AG4 H;  1J7K A;  4BAY A;  3U1K A;  1YJ9 I;  3DCF A;  3H9G A;  2E1C A;  2VOP A;  4JQF A;  1R71 A;  3HKZ N;  4RAY A;  3TDZ C;  1ETX A;  1U9O A;  4A93 J;  3BR2 A;  4PFP A;  2CFX A;  2DMT A;  5FKK A;  2K27 A;  2NVU B;  3HOX J;  3JTG A;  3TOB A;  1LNW A;  1TQP A;  2X9D A;  4LG0 B;  1ZKG A;  1JHF A;  2XKO A;  5LD2 C;  4CCL A;  4N4N B;  2LKS A;  1QPM A;  2LC2 A;  1YS7 A;  1RKT A;  2NNY A;  2KZV A;  4HLY A;  5AIP A;  4J19 A;  5BS6 A;  1K7A A;  3TDU C;  3K10 A;  1PP8 F;  4U0W A;  3S2D J;  2MW8 A;  1DU6 A;  1JKO C;  1X1B A;  2LY1 A;  2E19 A;  3ZQ7 A;  3E0J B;  1J0R A;  2KRC A;  4GO1 A;  4N9I A;  5FFX A;  1HC8 A;  2EFQ A;  2LFB A;  2R7O A;  3OWT A;  4WXD A;  2L2O A;  1PUF A;  2Q2E B;  3G71 I;  1VQ5 I;  3V7C A;  4M6Y A;  2H6B A;  5EG0 B;  4RBO A;  4KIB A;  2ELJ A;  1QBJ A;  5IP9 J;  3P9I A;  1I3Q J;  2ZB9 A;  3ABK H;  3PQK A;  2MGQ A;  3I4P A;  4FX4 A;  3FXJ A;  5E20 A;  1A36 A;  4Y33 A;  3ISP A;  1T0F C;  1IXS B;  2OCC H;  5JVT A;  3D5R C;  4IVN A;  1P6R A;  1WKM A;  1D8J A;  4RS8 A;  5HNH A;  2FF4 A;  3V7R A;  2W7N A;  3PSF A;  2RC4 A;  3CP8 A;  3WHC A;  3FHZ A;  1H9T A;  2YX4 A;  3S8P A;  4IKF A;  3ECO A;  4BH9 A;  2DMQ A;  1OCR H;  2EZI A;  2XUB A;  5CPR B;  3W2A A;  1YIO A;  4QSH A;  1BIB A;  4MEX F;  2Z9O A;  5E8G A;  1O57 A;  5LEK A;  1D0Y A;  2MH2 A;  1WH5 A;  3FDY A;  2VB6 A;  1M1E B;  3KYC B;  2I5U A;  2K4B A;  4BQA A;  3T8R A;  4YG2 F;  5JHF A;  1FWZ A;  3W6V A;  2M8E A;  2ZCW A;  3K4L A;  1R00 A;  2FD5 A;  2RQQ A;  4CH7 A;  3C18 A;  3P9C A;  4KIG A;  3CDI A;  4EJU A;  4FE7 A;  3FXK A;  4HX7 A;  2QSH X;  1QZE A;  1S5L C;  1ON2 A;  3KP6 A;  5E8I A;  4DIQ A;  3WTS C;  3OYG A;  2WTE A;  4GFB A;  4HX8 A;  2JSP A;  1JKR C;  4RMN A;  1QVT A;  2L9N A;  4JYK A;  2E5N A;  2LF8 A;  3F9K A;  1Z05 A;  1TWC J;  4OU0 A;  2XGC A;  3JR9 A;  2HR3 A;  1BIA A;  1ETQ A;  3S1Q J;  1AU7 A;  3H92 A;  1TBX A;  2GWR A;  2PMH A;  2XGX A;  2GXB A;  3AG3 H;  3I0T A;  2HQN A;  3HUG A;  2LR8 A;  2P7V B;  1TWG J;  1UZC A;  2CH0 A;  3PQJ A;  5A2Q Z;  3HHH A;  3ASO H;  1MGT A;  1X4P A;  2E36 A;  3QPS A;  2VKD A;  5DCF A;  4PSW A;  3Q5F A;  4I09 A;  3RYP A;  2OZ6 A;  4LIU A;  4RGS A;  3BG7 A;  4G94 A;  2A6H F;  2I10 A;  3FBI B;  2FSW A;  2ETH A;  3A01 A;  3RSN A;  3CMA I;  2DPU A;  2CG4 A;  2DOF A;  3HIF A;  3RPQ A;  1GV2 A;  5M5X J;  4KFC A;  4XLN F;  2O0Y A;  4ZYE A;  4KT6 A;  2M87 A;  1HKS A;  4NHJ A;  5D6F A;  4WXH A;  4UB8 C;  1SFU A;  1X3W B;  4ZTF A;  1RUN A;  3HOS A;  3RPU A;  1E3O C;  4MFD A;  2WC2 A;  2KIQ A;  1BN5 A;  3HTU A;  3F3X A;  2A3S A;  3PIO F;  2NS8 A;  5KCM A;  2R7S A;  2HYF A;  1FY7 A;  3DEU A;  1JJ8 C;  1R9T J;  5K7H A;  1MZB A;  5D4S A;  1O3Q A;  2XPV A;  3BJO A;  3L9F A;  1FPQ A;  1XCB A;  2DN0 A;  3F6O A;  3K4B A;  1OIS A;  2JA7 J;  3W6K B;  4BQN A;  1R6R A;  1ENH A;  1K6O A;  2ACJ A;  3CCL I;  1FSH A;  2CRG A;  1Z3X A;  3M1E A;  2M45 A;  2XAG A;  2MG4 A;  4EM2 A;  4F91 B;  4BE1 A;  2EV5 A;  1DDN A;  4A0Y A;  2W85 A;  4IRH A;  3L2C A;  3M3Y J;  1Z6R A;  2JSC A;  3OYF A;  1VQL I;  3ABT A;  2MAB A;  1BW5 A;  3LQQ A;  3OYN A;  2JZY A;  1IV8 A;  9ANT A;  2Y30 A;  2IPQ X;  1ACI A;  5AIQ A;  2DJI A;  1Q1V A;  1EF4 A;  2PBI A;  1N75 A;  3KP3 A;  3H3V K;  2VBY A;  4RLF A;  1IC8 A;  2M2E A;  2K3P A;  3BQZ A;  1FMW A;  4LG3 A;  5DYM A;  5H2F C;  1R23 A;  1ZN2 A;  3GEZ A;  2KL4 A;  4P96 A;  2R4G A;  4J01 A;  2R7X A;  3L2Q A;  3M4O J;  5FLX Z;  3WTT C;  3OIP A;  2IS4 A;  2HI3 A;  2LMD A;  2XV4 S;  2JMW A;  3I4M J;  1MKM A;  2VE8 A;  1OYW A;  4B43 A;  3FXL A;  4HOB A;  5J8C A;  1ZLJ A;  3BCB A;  3IWZ A;  3E5U A;  4EGY A;  2PJP A;  2DA5 A;  1OYI A;  2O9L A;  1MNM C;  2CQ7 A;  2HQA A;  4BEH B;  5ICE A;  4A3D J;  2AQE A;  4RDU A;  5TRD A;  4D5F A;  1LE8 A;  5KNL A;  5K1Y A;  2VJ5 A;  2RVC A;  4PK4 A;  2GOX B;  4AID A;  2NS7 A;  3CD6 I;  4CYD A;  1FYM A;  4Y4R A;  1U8R A;  2M34 A;  3FHN A;  3B6A A;  5JI6 A;  4CO8 A;  4GCV A;  4FAS D;  1LFB A;  3HTS B;  3MKW B;  2WAQ A;  1W7P D;  3EYY A;  3FIW A;  2LSO A;  3C1D A;  2YSR A;  3DU5 A;  1FP1 D;  4M3F A;  5J1R A;  3PSI A;  3F72 A;  1D1C A;  1BR1 A;  1G2H A;  1N78 A;  4A69 C;  1YG2 A;  4I02 A;  3WOD F;  3CLQ A;  2A69 F;  5GP9 A;  2V1U A;  3HOY J;  3J81 K;  2QQ8 A;  2M8G X;  1RUO A;  1Z67 A;  3CCJ I;  3LQR A;  2IGM A;  2DT5 A;  4YIR X;  2QF7 A;  3MKY B;  2JRT A;  4CCK A;  4ANJ A;  3Q3S A;  2BW3 B;  1T2K A;  3RTR A;  5FKL A;  2KMU A;  1O4X A;  4PJM A;  3L2V A;  1U5T C;  4KN7 X;  5EYR A;  4U7B A;  4UUS A;  2OCE A;  2XPU A;  3HB9 A;  1PP7 U;  3U9G A;  4HDU A;  1LB2 A;  2R7V A;  1R5H A;  2CO5 A;  1R4N B;  2WY8 Q;  1KU3 A;  4U0V A;  2VJI A;  1RET A;  3LOC A;  3HOT A;  2DA1 A;  1K78 B;  1E0E A;  1JT6 A;  3IUO A;  4ZC3 A;  1HKT A;  4BJ5 C;  2OA4 A;  3SXY A;  1IV6 A;  3S1N J;  2VKV A;  2HVS A;  2NS0 A;  1S72 I;  5F6F A;  1P92 A;  3GTO J;  3JW4 A;  2WAD A;  2XC7 A;  2FXA A;  3A1Y A;  3MZ8 A;  4E70 A;  5B1A H;  3N97 A;  1EKE A;  2P0W A;  4MLO A;  2MC3 A;  1D0Z A;  2MD0 A;  1MH4 A;  1YS6 A;  2W24 A;  3OYL A;  4IOC F;  1OCT C;  1B59 A;  1VND A;  2H1K A;  1JTX A;  4AYB A;  5EZG A;  1W5T A;  2IGO A;  4GYI A;  1MMN A;  5F64 A;  4G7H F;  2DYR H;  2HTS A;  2G7U A;  4Z2Y A;  1X1D A;  5LHG A;  4CCN A;  4MHG A;  2CV2 A;  4HPQ A;  1ETK A;  1AKH A;  2NXN B;  1H89 C;  2P7C B;  3ZXS A;  2X85 A;  2P5L C;  4UVB A;  1Y0N A;  4I0A A;  4BBR J;  4F7Z A;  1H9G A;  3S1R J;  4ZYH A;  5KK1 A;  1XX5 A;  4AIH A;  3MZY A;  4IHS A;  3S16 J;  4EMS A;  4LGW A;  3GTG J;  1OCO H;  1WRJ A;  1PUF B;  5CVR A;  1RPW A;  2O6G E;  4ZTJ A;  2LKP A;  2KDO A;  3M9A A;  1FOK A;  1B6A A;  2DJN A;  2GM4 A;  2HFH A;  2ADU A;  4ESF A;  2WAF A;  2EIL H;  1SMY F;  1IN5 A;  3H35 A;  1IDY A;  5GPC A;  1TWH J;  2RRE A;  2IA1 A;  4FE4 A;  3NAU A;  4C3J J;  2H94 A;  3DTK A;  5LHI A;  4HRI A;  4L18 B;  2F48 A;  5LGT A;  4IPA A;  5J6X A;  4BQQ A;  3R0J A;  3T8T A;  3COA C;  2HZT A;  1DPU A;  2M3A A;  1ETV A;  3OYK A;  1XS9 A;  1ON1 A;  2HVR A;  5DD4 A;  1A04 A;  1I27 A;  3ZOB A;  2XF5 A;  2L7Z A;  3BR1 A;  4RGR A;  1AWC A;  1YRN B;  1JKQ C;  2EZH A;  1WZ2 A;  2IA2 A;  2BHZ A;  1BBY A;  3CUQ B;  4HA8 A;  3GXO A;  3HL2 A;  4HNT A;  2CV0 A;  1FIP A;  1P9Q C;  2M4K A;  3OY9 A;  2JVH A;  2EQR A;  3FK7 A;  4N4O B;  3AAF A;  2P8T A;  1XGO A;  1JUM A;  1I5Z A;  2O03 A;  3JRB A;  1IRG A;  2GQQ A;  1TZL A;  3KFW X;  4CCO A;  5TIS C;  2DLL A;  5JVG F;  3JRG A;  1MBK A;  4KT5 C;  4DNC A;  1RR7 A;  4JBA A;  3J81 Z;  4D0P A;  2VT3 A;  3KYL A;  3C2H A;  1QHG A;  3GO5 A;  5D5X B;  4X0G A;  1Y8Q B;  3LFK A;  3BG5 A;  5EJC A;  1MW7 A;  3F8M A;  5H6Q A;  4ESB A;  3JCU C;  3V4G A;  2P81 A;  2K9Q A;  4MGR A;  1KYZ A;  3DBH B;  3EUK L;  4BY7 J;  1BC8 C;  1GVJ A;  2IJL A;  4ENK A;  1KU2 A;  2JA8 J;  4A2U A;  3H5R A;  1PUE E;  3HUG B;  3VB2 A;  3GX4 X;  2BOL A;  3JRI A;  2FX0 A;  1A6Q A;  2DOE A;  4II2 A;  2QWW A;  1OMI A;  2MD5 A;  1TP4 A;  4HF0 A;  3IHU A;  1F1Z A;  1I39 A;  4KMU X;  1YW9 A;  2BV6 A;  3G4S I;  1O3S A;  2Y0S A;  5FD5 A;  2KFD A;  1DGR M;  1GHC A;  2JPB A;  2RN7 A;  3A01 B;  4UVC A;  3HOU J;  5IOY A;  3OMY A;  3BC8 A;  1J5Y A;  2XRL A;  3W3C A;  3PNT A;  3HSF A;  3HEF A;  4B47 A;  1JXS A;  1P4X A;  4KIC A;  1IN4 A;  1MBE A;  2MYS A;  5KAI C;  4I6Z A;  1AOY A;  2RAE A;  5E18 F;  4IOA F;  3SDB A;  1MMA A;  5ED4 A;  4OAY A;  1BW6 A;  1VQN I;  4BJT A;  3K9T A;  3ML6 A;  1Z1D A;  2EIN H;  5D5U B;  1LEB A;  4IL6 C;  1D5Y A;  4EJT A;  2G0E A;  3HG9 A;  1VQ8 I;  4O3M A;  4Y15 A;  1MBG A;  1ZG1 A;  2GOM A;  4XKW A;  3DTI A;  5KHD A;  3BDD A;  1BOB A;  1SFK A;  4Q5S F;  3U2R A;  2D45 A;  3VDX A;  3CO6 C;  4H0E A;  2LH9 A;  3DPL C;  1IUF A;  3CJT B;  3MAJ A;  4OIR F;  2HNH A;  1JGG A;  2WB1 A;  2BXY A;  2BZT A;  3RDI A;  1U6G A;  4IO9 F;  3ZP5 A;  5BPD A;  1IRX A;  1IO2 A;  3LA2 A;  4N9H A;  2X51 A;  3EUA A;  3ULQ B;  3AKZ A;  2ZSH B;  4BDY A;  1LKX A;  3LFU A;  3J7Y J;  1YW7 A;  2ZNZ A;  3HXL A;  4AC0 A;  5IP7 J;  3B02 A;  2IS2 A;  3RKY A;  4A6D A;  3CF2 A;  3RI4 A;  1D1B A;  3ROU A;  4E4H A;  3FMR A;  1GDT A;  2XAQ A;  5IT3 A;  1XMK A;  2FNP A;  3GFI A;  2R7Z J;  3KX2 A;  1ODD A;  1EA3 A;  3ZQC A;  3DEW A;  3GTM J;  4IHV A;  5FFZ A;  4RLQ A;  4EM0 B;  1GXP A;  4LK1 F;  4IHW A;  4E7K A;  3CCY A;  1IJW C;  5FO5 A;  3QWL A;  1R5I D;  4HDV A;  3PIP F;  1DUX C;  1I6H J;  5HLT A;  2QKM B;  1XSV A;  2B7E A;  3TP0 A;  3OV8 A;  3TW6 A;  3DU6 A;  3UKG A;  5C4X J;  3F0C A;  4EQQ A;  2JUG A;  2WAE A;  3NRV A;  1LE8 B;  4RGU A;  2K9S A;  3ONQ A;  2OTJ I;  3TOA A;  4XN3 A;  1Z91 A;  4M9S A;  1MBF A;  4PGG A;  4XIC A;  2JWT A;  2HGC A;  1NG7 A;  3E1S A;  4FQG A;  5F1J A;  1S7E A;  3HSE A;  2VN2 A;  2R0Q C;  3FBN B;  1O7F A;  3DLA A;  1S7O A;  4E7J A;  4BBS J;  1DP7 P;  4ENM A;  2W82 A;  1UHW A;  3OSF A;  4A5M A;  3J80 Z;  2ICW G;  3KEQ A;  4EJW A;  3JRH A;  1LFU P;  1Z3Y A;  3E97 A;  2V7F A;  5F0F A;  4XQF A;  4U0Y A;  2WWY A;  2DA2 A;  4XLF A;  2A6E F;  3DXJ F;  4PGH A;  3WTZ A;  5LBQ A;  3CC4 I;  3A0B C;  4Q48 A;  3BTC A;  3RQ4 A;  3MQ0 A;  5B3S H;  4BGD A;  1FZP B;  1WJF A;  1XTA A;  2W57 A;  2HVQ A;  2NVY J;  5K7F A;  2PQ8 A;  2BW3 A;  2EB7 A;  3LSR A;  2PMZ N;  3FXO A;  3KP2 A;  1R36 A;  5E3L A;  2M9H A;  5GPA A;  2K9L A;  2X6X A;  1FBS A;  3DFG A;  1BR4 A;  4WCG A;  5H6R A;  2P6S A;  2ZFU A;  1N25 A;  4UUS B;  4DZP A;  4QIW N;  2WY7 Q;  4M3D A;  4BUP A;  2O5R A;  1UG2 A;  3JTH A;  4PJJ A;  4X1E A;  1HLV A;  5ILV A;  4AVP A;  4EAT A;  2QBY A;  2ZJP F;  1TC3 C;  3L09 A;  1ZLK A;  4K2E A;  5CYV A;  3QRF F;  1TNS A;  1FP2 A;  5HNF A;  3L2W A;  3FXM A;  4N0B A;  3SEZ A;  1UEL B;  2K9M A;  1FSE A;  1HW5 A;  3V8J A;  4IZZ A;  3SFZ A;  1Z77 A;  1CF7 A;  2A5W A;  2BVM A;  2YX7 A;  3WU0 A;  3HRU A;  3S15 J;  3WTY C;  2E1O A;  5M3F J;  2F5C A;  2CW7 A;  3IL2 A;  4PDK A;  2COM A;  4L5E A;  3H9J A;  2HEO A;  1ZYR F;  1UAA A;  1Z21 A;  2HOA A;  1AKH B;  1R22 A;  3P7N A;  4HV6 A;  1U78 A;  2VKH A;  2W84 A;  2E7X A;  5E1W A;  4B1R A;  2IGN A;  2W25 A;  5DV5 A;  3ZMS A;  5BPI A;  3ZN1 A;  3I3L A;  3KCC A;  1WJC A;  2EBI A;  4C3H J;  5HDN A;  2P5V A;  3TED A;  3CDL A;  3GBG A;  4XRF A;  3K4J A;  3PJR A;  1D5V A;  4EEF G;  2ZME A;  2KKO A;  1TW2 A;  2GXA A;  1QNT A;  5HLI A;  1T98 A;  5F0C A;  2DXI A;  4ZDL A;  4RA2 A;  5CLS A;  5HOO A;  4MEY F;  2G9W A;  2K86 A;  1KZH A;  2ZKZ A;  4DBQ A;  3CJR B;  1G6N A;  2Y9Z A;  2WV0 A;  4FIS A;  2FNA A;  4M72 A;  2Q8K A;  1DQU A;  2JTV A;  3H0G J;  5BNG A;  2BGC A;  3IWF A;  5GTH C;  3VFZ A;  3DBR B;  1QZZ A;  2LRE A;  2VE9 A;  1I1G A;  3WTW C;  5D8K B;  1EH6 A;  1YRN A;  1ZQ3 P;  1WI9 A;  2H09 A;  2R3S A;  3CUQ A;  2HOT A;  1BJZ A;  1PDN C;  3IH3 A;  4I01 A;  2LYC A;  1REP C;  3S3O A;  3MMY B;  3ZMU A;  2VJ4 A;  1JGS A;  1IUY A;  1QHH D;  2A6T A;  4X6A J;  1HBX G;  1S9H A;  3ZQF A;  4P55 A;  5EEG A;  1MSF C;  2LBF A;  1ZRD A;  4IJA A;  3GLL A;  3E6D A;  5J1U A;  4YFX F;  5HLH A;  3MCZ A;  4GYG A;  3SJM A;  2HYG D;  1HW2 A;  1HDD C;  2XHK A;  1RZ4 A;  2HOS A;  3EYI A;  2DMP A;  4PJ0 C;  1W0T A;  1KGS A;  1HOM A;  4EV0 A;  4S05 A;  4C2T A;  5EDN A;  2QA4 I;  1A6I A;  2ELH A;  2XF6 A;  3RKW A;  5KAF C;  2K40 A;  3MN2 A;  4LLG F;  4KIT B;  3KET A;  1WJA A;  2BBY A;  3SZT A;  3CO7 C;  4KN4 X;  1ZH5 A;  2VUM J;  1WFX A;  3KEY A;  3OL3 A;  1SFE A;  2CUZ A;  2EK5 A;  2RDP A;  2PLY A;  1WJ5 A;  5TGT A;  1APL C;  3RJP A;  1SMT A;  4M74 A;  3BG9 A;  5HS7 A;  3WG9 A;  1O7L A;  2GLO A;  4XSZ F;  1Z7L A;  4AIK A;  1YX3 A;  3Q0U A;  1S29 A;  4F92 B;  2HU9 A;  3M1C A;  4JK1 X;  1PVE A;  1QVU A;  3K70 C;  1XDS A;  4JP0 A;  4E7Z A;  3BG3 A;  3G6E I;  2L02 A;  3AFH A;  2Z16 A;  2VQH A;  5HLG A;  4LMY A;  2ISZ A;  3F8C A;  5DDG A;  4F93 B;  2NYX A;  1HF0 A;  3SQN A;  1SVL A;  3B73 A;  1LUJ B;  3GFM A;  2L7K A;  1BI1 A;  1YYV A;  4XRS A;  2LY9 A;  2BY0 A;  1WPK A;  5J40 A;  2NVX J;  1P4W A;  4BS9 A;  2MH9 A;  4WWC A;  3OL4 A;  4F3Q A;  2JT1 A;  4IF4 A;  4L9N A;  1YW8 A;  4WK8 F;  3CMM A;  4GDF A;  2K3F A;  4M9X A;  3OYB A;  2HQ5 A;  2X6Y A;  2XVC A;  3VYS B;  4IEJ A;  1U9N A;  3PL8 A;  1HW1 A;  3HZJ A;  3RPU D;  2ZJQ F;  3KZZ A;  5DS9 A;  3HOZ J;  1E3P A;  3GZN B;  2KIS A;  1E2X A;  2KIU A;  2QKL B;  4A3E J;  1TQM A;  2XKP A;  2EA4 A;  2LRD A;  3HOV J;  1XC5 A;  1Y1V J;  4LOC A;  4A3G J;  3JAM K;  2M4G A;  4S04 A;  3KIO A;  3KE2 A;  3CCS I;  2OF7 A;  4UNO A;  3KLO A;  1V55 H;  3G3Z A;  1FOW A;  5LFA A;  4CUG A;  2VT2 A;  1KA8 A;  2ZC2 A;  3BRO A;  3LSH A;  3M8J A;  3DF8 A;  5FKM A;  1X19 A;  2WB1 N;  3HSR A;  3B6C A;  3FWE A;  1ZR2 A;  1P4A A;  1FJL A;  2HOE A;  3I58 A;  2XAJ A;  5D5V B;  2KP6 A;  1BA5 A;  3TO7 A;  4YRV A;  4M3B A;  4CDG A;  2ZFW A;  5ILS A;  2XB0 X;  5DUI A;  2OAZ A;  3FX3 A;  1SD5 A;  4DYR A;  2W4S A;  1FEX A;  5J1Y A;  2DDB A;  4GXO A;  3DTE A;  3Q9V A;  4B8X A;  2IVM A;  3BJ6 A;  4A3J J;  2A07 F;  3HDD A;  3A02 A;  3QU6 A;  2JA6 J;  3R4K A;  2RKH A;  2Y2Z A;  1T56 A;  3G1L A;  3TO9 A;  3IAS 2;  2JVG A;  3ABL H;  3BR5 A;  2OD5 A;  1J9I A;  3E3V A;  1YQA A;  4PJN A;  1TQI A;  3FKI J;  1RI7 A;  3LMM A;  3E6B A;  5AON A;  1G3S A;  2V9K A;  1HXD A;  4P9U A;  3O2P E;  3OIQ A;  5GAG J;  2XRO A;  1POG A;  3FZV A;  4XKB A;  3L2R A;  2CW0 F;  2NAZ A;  2MSY A;  2CQN A;  3IRR A;  3MKZ A;  4OIO F;  1P7I A;  1YE9 A;  4HZF A;  1W0U A;  3IV5 A;  2YUS A;  4M73 A;  4M3E A;  5L3E A;  1UJ8 A;  2ZSI B;  2F5V A;  3K6G A;  4EJV A;  1ETY A;  3SZG A;  2E1M B;  4UHT A;  2K02 A;  3JRE A;  2Y9Y A;  3C2G A;  2VI6 A;  4LFU A;  4I2O A;  2VPL A;  2DFH A;  4A6E A;  3ZR8 X;  5J47 A;  4IRG A;  2BEO A;  3TL4 X;  4KJZ A;  1GT0 C;  4W1U A;  2VQC A;  4V19 K;  2CW8 A;  2F6C A;  4AVZ A;  3OR1 C;  2H8R A;  3E5Q A;  2W00 A;  4D7N A;  1TT0 A;  3JRC A;  2VXZ A;  3HPH A;  4LIT A;  1KU7 A;  3J7A Y;  3ESW B;  2E1M C;  4XID A;  2X1E A;  1OCZ H;  5BQT A;  3ABU A;  4HEA 2;  4YEJ A;  4ASN A;  2XB5 A;  2J5P A;  2K7L A;  4HAM A;  1SD7 A;  3S3M A;  3KLN A;  5F0H A;  4EM1 A;  2OBP A;  1B72 A;  2RV8 A;  3QYE A;  1A35 A;  1STZ A;  4PFO A;  4I7H A;  5FB2 A;  2M0M A;  5K5Q A;  2QBY B;  1JUP A;  4ZYA A;  1AA7 A;  4MIM A;  3IC7 A;  3GVA A;  1W1W E;  2V4J C;  3MWM A;  2TCT A;  2IBD A;  3HKZ A;  3Q9S A;  3IH4 A;  4PSX A;  1ZRE A;  1AHD P;  2R5Y A;  2H27 A;  1CF7 B;  2ZJ2 A;  1JHH A;  4HLX A;  3BP8 A;  1TW3 A;  2IS1 A;  2G7H A;  4D7M A;  2FBH A;  4OOI A;  1VF9 A;  4IQJ A;  5HDK A;  2KIM A;  2GXG A;  2JJ7 A;  2FOW A;  1YLF A;  1XSX A;  1NK2 P;  1WVR A;  2FMY A;  2VC0 A;  3DEE A;  4NBQ A;  3S3N A;  3K7A J;  1X3U A;  3MVP A;  4UB6 C;  1RKW A;  1QRY A;  1T38 A;  1YOV B;  2HKX A;  3HJE A;  3G73 A;  4M9Z A;  4JX6 A;  1H8A C;  2DT6 A;  2AQF A;  2EA2 A;  1R58 A;  3ZGK A;  2ME0 A;  3Q0W A;  3REO A;  1J2X A;  2FA5 A;  3OSG A;  3NQO A;  2BY2 A;  3E7L A;  4JX4 A;  4KUM A;  2ZME B;  3M07 A;  1T6S A;  3VOE A;  3RYR A;  3LAJ A;  1RRJ A;  1YX5 A;  2IXS A;  3O8G A;  1X2N A;  2ID3 A;  4DBR A;  1X58 A;  2F5D A;  2EIM H;  2VBX A;  2Z1D A;  3JRD A;  1WQ2 A;  2BY1 A;  1MBH A;  4M6X A;  4HF1 A;  1U2W A;  2QQ9 A;  1F36 A;  1MNE A;  2DMU A;  3H5N A;  3GTJ J;  2PN6 A;  1B4A A;  1X3Z B;  5GTI C;  4MO7 A;  2Y31 A;  2VPR A;  4DYQ A;  2XGD A;  2ZME C;  4OIN F;  1ORK A;  2WA0 A;  2L9S A;  3VSK A;  4IXA A;  2QGU A;  2Z99 A;  2VKE A;  3TW7 A;  3VOD A;  2K85 A;  3H9Q A;  3NWS A;  3ZMT A;  2L4A A;  2O7O A;  1YHQ I;  2FU4 A;  3RIR A;  1NTC A;  1ZRC A;  5HS9 A;  3RQI A;  5ERI A;  4LD5 A;  2OZU A;  4OIP F;  3O3K A;  3A2K A;  4YFN F;  3WE3 A;  4PCQ A;  1I50 J;  1KQ0 A;  3HHG A;  1ZHF A;  4XLE A;  3WU2 C;  2DA6 A;  3K1M A;  1T08 B;  3MKL A;  3AL0 B;  1T95 A;  5ILU A;  2LBF B;  4O5V A;  2HWV A;  3CUQ C;  2KRH A;  2XF7 A;  2L5Q A;  2LK2 A;  2OC6 A;  5E3O A;  1JI8 A;  1TT5 B;  3PNY A;  2EFW A;  1XMX A;  2K5C A;  5FKO A;  4NC7 A;  1YTY A;  1XB4 A;  4A0Z A;  2EIJ H;  2DA7 A;  3W2V A;  3AL0 C;  1NHA A;  2DDA A;  2FEZ A;  3I71 A;  4R1H A;  1W36 C;  2CU7 A;  2LY2 A;  1FBU A;  3FMS A;  3GFL A;  1FC3 A;  2CGP A;  3F6V A;  2Z33 A;  2XGE A;  4RGX A;  4QPQ A;  4XL9 A;  1UHS A;  3JRF A;  3K70 D;  4HQM A;  4C2U A;  1UB9 A;  1ZGW A;  2DK5 A;  4P9F A;  1R1U A;  5L3G A;  3CZ6 A;  3TO6 A;  1BI3 A;  4FET A;  1T33 A;  1CQT A;  2Y75 A;  3I4N J;  3QPT A;  4R8H A;  3IP4 B;  2ESN A;  4BKX A;  4YII A;  2XSJ C;  4A5N A;  2M7B A;  3H5A A;  1ZTR A;  5J4Y A;  3FXQ A;  2FUG 2;  2HXO A;  5L3F A;  2V1N A;  2HZD A;  2NOJ B;  4ZZD A;  2JQ7 A;  4D1Q A;  3CCV I;  4WX9 A;  3GFJ A;  3I59 A;  2KDZ A;  3ABM H;  2B0L A;  2RNG A;  1OYY A;  4M3G A;  5JFR A;  1SFO J;  4P5O A;  3T5X A;  1KU9 A;  4XK4 A;  3IKV A;  4BXF A;  4ZDO A;  2E60 A;  3V8L A;  4HNV A;  1PYV A;  3LSK A;  1HA8 A;  2PEX A;  4PJL A;  3GTK J;  1FLI A;  3QYB A;  4QTR A;  4NNJ A;  1FBQ A;  3BR3 A;  3FM3 A;  3OYM A;  2C6Y A;  2FML A;  4CIC A;  4HNU A;  1PJR A;  4CZZ A;  2O8K A;  2DW4 A;  1UFM A;  2V6C A;  4HW0 A;  4HV5 A;  3Q0V A;  1OR7 A;  2LG4 A;  2A5Y B;  1IXR C;  3DPU A;  5M5W J;  4XMY A;  1EH8 A;  1V3F A;  5IY5 H;  1X1P A;  2ME6 A;  1VQ6 I;  2Z3Y A;  3A4C A;  2XAH A;  1MDM A;  1WCM J;  4B3X A;  3WGH A;  1XN7 A;  2CMP A;  2VBW A;  4ITV A;  1U3E M;  1I3A A;  4A3F J;  3K2Z A;  1ZG5 A;  3BTL A;  1T39 A;  3BTI A;  2W1O A;  4RB3 C;  3ZQG A;  4KIS A;  2I8D A;  2IAI A;  2W48 A;  2DI3 A;  1MND A;  4QLC U;  5LEJ A;  1WJE A;  2CSO A;  3K4C A;  1TWF J;  3LSI A;  4RM2 A;  2DTR A;  3OS0 A;  2R7T A;  2OPT A;  4HST A;  2L9R A;  2H8W A;  3QOD A;  3UNG C;  4BYY A;  2FQ4 A;  4XSX F;  5DTD A;  3VPR A;  4HBL A;  3OYI A;  2X6W A;  3KYD B;  4A3K J;  4EVI A;  3WTV C;  5KVR A;  2HDD A;  4XR6 A;  1FYL A;  2VOO A;  1NK3 P;  1R5G A;  4XLA A;  1BOA A;  1YFH A;  3V8K A;  5C4J J;  3GYH X;  1WJB A;  3R61 A;  2ISY A;  2BVL A;  5HDG A;  2BE5 F;  4ENN A;  4MQV A;  2VQG A;  5B5E C;  1ZAR A;  3S32 A;  2STW A;  2PFB A;  3LST A;  3TKY A;  3R6S A;  2DMN A;  1IG7 A;  3CCR I;  3WTU C;  5E79 C;  1W7P B;  4BNC A;  2WAQ N;  3SEQ A;  3R60 A;  1QGP A;  3FXU A;  4IHT A;  1IW7 F;  2DA4 A;  1VQP I;  3ZRG A;  2EWN A;  2AS5 F;  4E6K G;  3JRA A;  5EZH A;  2EFP A;  5E17 F;  1V5E A;  1MD0 A;  1R1V A;  3LA7 A;  4CGZ A;  1LVA A;  3ASN H;  2M0C A;  2PI0 A;  2OU2 A;  3TQN A;  3C3W A;  1DGW Y;  3OYC A;  2CV1 A;  3O6B B;  2OJE D;  2BHY A;  1SC7 A;  3OYJ A;  3HC7 A;  2HQR A;  1J09 A;  1MSE C;  2F4I A;  3PM1 A;  2EZK A;  3BR0 A;  3E6M A;  4JOM A;  5CQG A;  4Z6Y A;  4A3L J;  3T0Y A;  4M71 A;  1JJ6 C;  1FTT A;  3GZ5 A;  5ICG A;  5JLX A;  1B72 B;  2EIK H;  3CJQ B;  2R5Z A;  4I76 A;  1ZR4 A;  4BE2 A;  4F52 A;  2P6T A;  3HGG A;  4DOZ A;  6PAX A;  1IGN A;  1SAN A;  3SFI A;  4D9J A;  4ZJZ A;  4E7S A;  5M3M J;  5H20 A;  1J75 A;  2P5K A;  5A2Q K;  5DEQ A;  2JA5 J;  5FLM J;  3BZC A;  1WGX A;  1VQ4 I;  4Y17 A;  1LPQ A;  1F4K A;  3OYA A;  1OLT A;  2BY3 A;  2DU9 A;  2R5Y B;  4DQ2 A;  1Y1W J;  1XGN A;  2ECB A;  4IHX A;  1W5S A;  5JLW A;  3F8N A;  3DKX A;  2R7W A;  2CUE A;  2XIG A;  4AYB N;  2LF7 A;  1KON A;  2CYY A;  2UV1 A;  2V1D A;  3MFK A;  2DT7 B;  2GZW A;  4L9J A;  3LSG A;  1W4M A;  3EUH A;  4O6J A;  3TGN A;  4ZDP A;  4OMY A;  1IRZ A;  3BZK A;  4XLH A;  1DP3 A;  1B1B A;  2D1H A;  3E5X A;  4PZJ A;  2UZK A;  5IP6 A;  1OCP A;  4FHT A;  2AO9 A;  4XOR A;  3L2U A;  1P2F A;  1QZY A;  3TP3 A;  3BY6 A;  1BI2 A;  1N77 A;  1YI2 I;  1FT9 A;  5DM7 F;  1YIJ I;  1LDJ A;  4BY1 J;  3I53 A;  3MZH A;  4RB0 A;  2FBI A;  4TV7 A;  2VLA A;  2Y0M A;  2KJC A;  5EEH A;  2EFN A;  2E5Z A;  5L3D A;  4DJA A;  2Z2S B;  3D5S C;  3MEX A;  1P7J A;  3KP5 A;  5ICC A;  1VQO I;  3LL7 A;  5F04 A;  2IP2 A;  2GBY A;  2X1C A;  3EDP A;  4XOP A;  4BHC A;  4D5C A;  1QQI A;  2COB A;  1OJL A;  2QLZ A;  5EGO A;  1GLN A;  1K61 A;  2VC1 A;  2F5E A;  5LLQ A;  2B9S A;  3WE2 A;  3ZQL A;  2FJ1 A;  4HQE A;  1Z0X A;  4B4C A;  2L7M P;  3BR6 A;  1L0O C;  2MBF A;  5DUK A;  4I99 C;  2LTP A;  5DCM A;  4C3I J;  3CCE I;  1FTZ A;  4CCM A;  2EJR A;  2R7Q A;  3ELK A;  2HS5 A;  2ZXH A;  2DFF A;  1RES A;  3H1C A;  4A3I J;  4ABZ A;  1IN6 A;  2DFI A;  1OQY A;  3SDG A;  1XGS A;  4DYC A;  4RAZ A;  2L0K A;  2X0L A;  5IYB J;  3F22 A;  3HPG A;  3KP7 A;  2QYO A;  1HST A;  3F8B A;  3F8F A;  2JK3 A;  2IA0 A;  2X1D A;  2Y69 H;  2ZNY A;  3CQZ J;  4Y7N J;  3U21 A;  5J4V A;  5FLX K;  1IZ1 A;  3VYU B;  2E35 A;  4HYE A;  3BPX A;  4QWQ A;  4L0Y B;  2NVQ J;  1BI0 A;  3AG1 H;  2QSG X;  2WBM A;  4AD9 A;  1W36 D;  3FIS A;  2YU9 J;  1TNT A;  2L9V A;  1XD7 A;  5FJ8 J;  5DD8 A;  3A03 A;  3PUB A;  4W97 A;  4YIF A;  1IN7 A;  3RZD J;  1Z6T A;  2HKO A;  3OS2 A;  2ZXI A;  1GUU A;  2BXZ A;  1DU0 A;  2OQR A;  4ZYG A;  4BE0 A;  1K4S A;  4BU2 A;  1HCR A;  1Y8R B;  3QOP A;  2Y48 A;  2STT A;  1S3J A;  2MFZ A;  2JPC A;  3DV8 A;  2QEX I;  2PJR A;  2IS6 A;  2XAS A;  2Q0O A;  3LNQ A;  3VEP A;  1K79 A;  2F2E A;  4G7Z F;  4LLL A;  2O8X A;  1OCC H;  4G9Y A;  4XOT A;  4MNU A;  4L5I A;  2ID6 A;  5B1B H;  3FMQ A;  3GME A;  2KZG A;  2VQL A;  5ICF A;  1Q1H A;  2QUF A;  3LAP A;  3GTQ J;  3S14 J;  4DW6 A;  3ZQI A;  2BYV E;  3MD2 A;  2E2J J;  1OFC X;  1D8K A;  2Y0S N;  3PUF A;  5JHU A;  4RB1 A;  1B9M A;  4BXX J;  3VYT B;  4AM3 A;  1JKP C;  1VQK I;  2DO7 A;  3IH2 A;  3TMO A;  3I59 B;  1U8B A;  1NH3 A;  1YIT I;  2R7U A;  2DQR A;  4EGZ A;  1MH3 A;  4S0H B;  3I55 I;  2R92 J;  2F5F A;  1ZK8 A;  4UVA A;  1Y6I A;  4YFK F;  1CGP A;  3I9V 2;  3NEU A;  3HRM A;  2B63 J;  2CUJ A;  4BDZ A;  3F21 A;  3FM5 A;  4IRI A;  4A3C J;  2KLO A;  2JN6 A;  5FRM A;  1TWA J;  1BC7 C;  1XPX A;  2E7W A;  5LRS A;  2E71 A;  1QA6 A;  1KQ9 A;  1ZEL A;  5FKN A;  2DYS H;  3EQL F;  2IW5 A;  2GIV A;  2K9N A;  3BJA A;  3DQV C;  3RCO A;  1MDM B;  2X48 A;  3G2B A;  2LD5 A;  1KYW A;  1V54 H;  2E1N A;  4Q47 A;  5D6E A;  1RC9 A;  4BHB A;  1QO0 D;  4AU7 A;  4KIF A;  4CZC A;  2YR2 A;  3S2H J;  2HDC A;  2IGK A;  2ZBK A;  1VQ9 I;  4U87 A;  1OR7 C;  2E2H J;  3CC2 I;  2NVT J;  1X1C A;  5J8F A;  1SVM A;  4NDL A;  2RGV A;  3G1O A;  3K4K A;  4L5J A;  2M1B A;  4XBF A;  4UUV A;  3F23 A;  4GGG A;  2JRM A;  1LQ1 A;  2DBB A;  4XKV A;  5LHH A;  2OQG A;  4OIQ F;  2P4W A;  3P9K A;  4XM3 A;  4ETS A;  2O61 A;  3BCA A;  1IXC A;  3CES A;  3CCQ I;  2EH3 A;  4AWX B;  5D4R A;  2D2W A;  4G6D A;  4CYC A;  3N4M A;  4PUS A;  2VIX A;  3HBL A;  4FCY A;  3M7G A;  1BM9 A;  2V9P A;  1V4R A;  1D3Y A;  2PX9 A;  4HSR A;  1SEU A;  5CKT A;  2RQP A;  2EZL A;  3DBL B;  3S17 J;  3BPV A;  4LK0 F;  3KEO A;  3QQA A;  2QQA A;  1VI0 A;  3K2A A;  4NB5 A;  1I6X A;  1W5C C;  5BMZ A;  1S7A A;  2ESH A;  2H6C A;  1G3T A;  2OV7 A;  1LDK B;  3QP6 A;  4ON0 A;  2CJJ A;  3D0S A;  2MA3 A;  3WG7 H;  5L3B A;  1MIJ A;  2E34 A;  4LIV A;  4CHU A;  2HXI A;  1BR2 A;  2H1L A;  2R7F A;  2HYJ A;  3CMY A;  3NWT A;  4OWR B;  3DP7 A;  1W7P A;  2XRN A;  5CVU A;  3WTX C;  1G8X A;  4CSW A;  1GV5 A;  1C0W A;  4XN0 A;  3FF5 A;  4B44 A;  4C9Y A;  3BZ6 A;  2V6E A;  2UXN A;  3CJN A;  5E3N A;  1USS A;  1WH7 A;  4B3A A;  1E3H A;  3L7W A;  1R7J A;  2MC4 A;  2A05 A;  3ECH A;  4XRS G;  4MQ9 F;  3I56 I;  2VBZ A;  1O3R A;  1NG6 A;  5L3C A;  4LLN A;  3DPT A;  3L00 A;  2JA2 A;  2DFE A;  4IHY A;  4A3M J;  1QU3 A;  2YS9 A;  2UUZ A;  2AXT C;  3JSP A;  2FBK A;  4GRI A;  4NC6 A;  1J59 A;  4OMZ A;  3ERM A;  3E6C C;  2PMZ A;  1TLH B;  1MJB A;  1SVO A;  1VTN C;  3DKW A;  1U5T B;  2O3F A;  2V26 A;  4LB6 B;  4F55 A;  1ZGJ A;  4KDP A;  2WV1 A;  3OOU A;  2CFO A;  4NQW A;  1ITY A;  2EPF A;  3CDH A;  1B8I A;  3DLL F;  4BQO A;  1Y0U A;  2GIZ A;  3WU1 B;  5FRN A;  4UV8 A;  5E3M A;  3I5U A;  5FD6 A;  4II3 A;  2R5Z B;  2HDW A;  3SZP A;  1Y39 A;  3WHB A;  4B48 A;  1A5J A;  5CVV A;  4G6T B;  3OS1 A;  4Y52 J;  2LLK A;  2QZ8 A;  5JR3 A;  1BJA A;  2XAF A;  3L1P A;  2ECC A;  2ZXW H;  1ZRF A;  5C3E J;  4KMF A;  2F4O B;  1XSD A;  3A0H C;  3GW2 A;  3W2W A;  1SAU A;  3OOP A;  2VXD A;  4BHP A;  3O8H A;  5E1Z B;  3JAM Z;  1G3W A;  4JX5 A;  2ELK A;  3C2B A;  2EV0 A;  2UXX A;  3V7S A;  5C44 J;  4E7L A;  4RM3 A;  2DK8 A;  1G3Y A;  2M30 A;  4L0Z B;  3CP2 A;  2QSF X;  2OUM A;  4LG0 A;  3CF5 F;  1G4D A;  4RB2 C;  5TJJ A;  1S6L A;  4EJO A;  3ZQQ A;  4CA0 A;  3S93 A;  2CWE A;  4Y13 A;  1VFC A;  4CCJ A;  3LSJ A;  2VAS A;  2KHM A;  1FYK A;  4XNF A;  2D1V A;  5IYC J;  3D1N I;  4H4K C;  1VQ7 I;  1EJ9 A;  1OPC A;  3ZN0 A;  1RNL A;  4WF2 A;  2GA1 A;  4CXF A;  1VZ0 A;  3K0L A;  5B66 C;  1IRF A;  1X1A A;  1XMA A;  3H3Z A;  4XKC A;  3ZCO A;  2ZJR F;  1I1S A;  2NOG A;  1RR8 C;  1LDD A;  1LVK A;  3EUH C;  1T0F A;  2R7D A;  3I64 A;  4KA4 A;  4MTE A;  2Q2E A;  1LFP A;  1WWX A;  2LVS A;  5EG0 A;  3PNV A;  1QPI A;  1TTY A;  4U88 A;  2DOD A;  2JUC A;  4Q4Z F;  5CVI A;  1F9N A;  2DOA A;  3CTA A;  1ETW A;  4RAG A;  3G1M A;  2IEK A;  1WJD A;  2NRA C;  5EGO B;  1SD6 A;  5D5W B;  4NC8 A;  4FTH A;  5LGU A;  3K4N A;  2KPM A;  2QQB A;  3K69 A;  1K4T A;  1FIA A;  3BG6 A;  3ZMV A;  2HPM A;  3C7J A;  3IAM 2;  5DCM B;  4BXU A;  2M7A A;  4IX7 A;  3VWB A;  5E1X A;  3GWZ A;  3P5J A;  1ETO A;  1YO5 C;  4ESJ A;  2QM3 A;  4L9T A;  2N8G A;  2TRT A;  4YEL A;  1UST A;  2VON A;  3HRS A;  1ZAO A;  1TL8 A;  4U7D A;  3GZ6 A;  4KYW A;  2PG4 A;  1V5G A;  4Y3O A;  3PFY A;  2QEN A;  4UY8 I;  2V79 A;  2DQL A;  3ZPL A;  3PFI A;  1A31 A;  5GAH J;  3GTP J;  4B09 A;  2AHQ A; 
#chains in the Genus database with same CATH homology
 2DMN A;  3B6A A;  1IG7 A;  1LFB A;  5J1U A;  1HDD C;  3GTL J;  3SJM A;  3S1M J;  4G12 A;  5IPA A;  2HOS A;  2WAQ N;  2DMP A;  1W0T A;  1HOM A;  3FIW A;  5EDN A;  1A6I A;  4M3F A;  5IOZ A;  2DA4 A;  5J1R A;  1IDZ A;  2K40 A;  3MN2 A;  1G2H A;  3JRA A;  4A69 C;  2VUM J;  5EZH A;  2M0C A;  2QCO A;  5GP9 A;  2CQQ A;  3HOY J;  1APL C;  3HM5 A;  2M8G X;  3BG9 A;  2GLO A;  2QF7 A;  5IYD J;  3Q0U A;  3Q3S A;  1HDP A;  1MSE C;  3PM1 A;  2EZK A;  3BR0 A;  5FKL A;  1O4X A;  2D5V A;  1QVU A;  4A3L J;  4JP0 A;  5EYR A;  4UUS A;  1JJ6 C;  1FTT A;  2XPU A;  3BG3 A;  3HB9 A;  1K83 J;  5JLX A;  1B72 B;  4DZJ A;  2R5Z A;  4I76 A;  1ZR4 A;  1H88 C;  4AUX A;  3NAR A;  5K7Z A;  5EEA A;  3HGG A;  1RET A;  1HF0 A;  3LOC A;  2LP0 A;  2DA1 A;  1IGN A;  1SAN A;  1JT6 A;  4XRS A;  2LY9 A;  3SFI A;  5FLV A;  1WPK A;  5M3M J;  2NVX J;  1IV6 A;  3S1N J;  4XRM A;  2JA5 J;  2VKV A;  5FLM J;  1WGX A;  2KT0 A;  3GTO J;  2R5Y B;  1Y1W J;  4MLO A;  3QPL A;  1MH4 A;  2HQ5 A;  2H1K A;  2ECB A;  1OCT C;  4IEJ A;  1VND A;  3RZO J;  1MBJ A;  1JTX A;  1U9N A;  4IHX A;  5JLW A;  3OIO A;  5EZG A;  2CUE A;  3FK6 A;  4AYB N;  3BTJ A;  5DS9 A;  3HOZ J;  1ETK A;  1GVD A;  3LSG A;  4A3E J;  5M5Y J;  1AKH A;  1IRZ A;  3PO2 J;  1H89 C;  5IP6 A;  1XC5 A;  1Y1V J;  4LOC A;  3HOV J;  4A3G J;  4BBR J;  1OCP A;  3S1R J;  1BL0 A;  2AO9 A;  2OF7 A;  2CUF A;  3TP3 A;  3S16 J;  4BY1 J;  1F43 A;  3GTG J;  5FKM A;  1PUF B;  1RPW A;  2WB1 N;  5J3L A;  3B6C A;  1ZR2 A;  1FJL A;  1P7J A;  1BA5 A;  4M3B A;  5F04 A;  1XG1 A;  2DJN A;  2XB0 X;  2GM4 A;  2GBY A;  4DYR A;  3PO3 J;  1IDY A;  1UMQ A;  4D5C A;  5GPC A;  1FEX A;  1TWH J;  5J1Y A;  2COB A;  4C3J J;  4FE4 A;  3NAU A;  4CYC B;  1OJL A;  1JUS A;  2XPW A;  5EGO A;  4M6V A;  1K61 A;  3ZQH A;  5EF6 A;  3ZQL A;  3HDD A;  4A3J J;  2FJ1 A;  3A02 A;  1Z0X A;  4B4C A;  2JA6 J;  3BQY A;  2L7M P;  3BR6 A;  2Y2Z A;  2LTP A;  4C3I J;  1T56 A;  3G1L A;  1FTZ A;  1XS9 A;  1ETV A;  3BR5 A;  1X2M A;  4MFE A;  3ZOB A;  2CQX A;  3BR1 A;  2L7Z A;  1YRN B;  1RES A;  3FKI J;  4A3I J;  4V2F A;  4ABZ A;  1JKQ C;  2EZH A;  3SDG A;  4DYC A;  2L0K A;  5IYB J;  1FIP A;  2EQR A;  2DTZ A;  3FK7 A;  2JK3 A;  1POG A;  3HOW J;  3CQZ J;  4Y7N J;  1JUM A;  2MSY A;  3JRB A;  2NVQ J;  1P7I A;  1W0U A;  3IV5 A;  3JRG A;  2YUS A;  1MBK A;  4M3E A;  4UUT A;  3FIS A;  2L7F P;  1RR7 A;  2YU9 J;  1JT0 A;  1ETY A;  5F08 A;  3HGY A;  5F27 A;  5FJ8 J;  3JRE A;  2Y9Y A;  3A03 A;  1JTY A;  2VI6 A;  3BG5 A;  4W97 A;  3RZD J;  3BT9 A;  1GT0 C;  4C2M J;  1GUU A;  4W1U A;  1DU0 A;  2X6O A;  2P81 A;  2K9Q A;  1HCR A;  2XSD C;  4BY7 J;  2H8R A;  3JRC A;  4D7N A;  2JA8 J;  3RKQ A;  4XID A;  3LNQ A;  3JRI A;  2FX0 A;  2XB5 A;  1B8I B;  2R93 J;  1WI3 A;  2ID6 A;  5F0H A;  1B72 A;  3GTQ J;  3S14 J;  4DW6 A;  3ZQI A;  2DA3 A;  3LSP A;  2E2J J;  1OFC X;  4V2G A;  2Y0S N;  1JUP A;  4A3B J;  2LKX A;  3A01 B;  3HOU J;  5HOD A;  4BXX J;  4MIM A;  5IOY A;  1JKP C;  2XRL A;  3IH2 A;  3DCF A;  1U8B A;  2TCT A;  2IBD A;  3HEF A;  1MH3 A;  4S0H B;  2R92 J;  1MBE A;  3HKZ N;  3IH4 A;  4I6Z A;  2RAE A;  1ZK8 A;  1AHD P;  3GTP J;  2R5Y A;  1ETX A;  1U9O A;  4A93 J;  3BR2 A;  2DMT A;  1BW6 A;  5FKK A;  3HOX J;  2B63 J;  2X9D A;  1ZKG A;  4D7M A;  1VF9 A;  1D5Y A;  2G0E A;  4A3C J;  2JN6 A;  1MBG A;  1TWA J;  2JJ7 A;  1RKT A;  1NK2 P;  3S2D J;  3K7A J;  4J19 A;  3MVP A;  1RKW A;  1QRY A;  2MW8 A;  1DU6 A;  5FKN A;  1JKO C;  1IUF A;  1JGG A;  2K9N A;  2E19 A;  4JX6 A;  1H8A C;  2X48 A;  2LD5 A;  2ME0 A;  3Q0W A;  3OSG A;  2LFB A;  3E7L A;  3S2H J;  4JX4 A;  1PUF A;  2E2H J;  2NVT J;  3O8G A;  1X2N A;  2ID3 A;  4NDL A;  3G1O A;  5EG0 B;  4RBO A;  1X58 A;  3JRD A;  1MBH A;  5IP7 J;  4AC0 A;  5IP9 J;  1F36 A;  1I3Q J;  2ZB9 A;  2MGQ A;  2DMU A;  3GTJ J;  4MO7 A;  2Y31 A;  2VPR A;  1GDT A;  2EH3 A;  4DYQ A;  2XGD A;  4CYC A;  2R7Z J;  3HBL A;  1ORK A;  4FCY A;  3ZQC A;  3DEW A;  2VKE A;  3TW7 A;  4IHV A;  3GTM J;  3WHC A;  4IHW A;  2EZL A;  3CCY A;  1IJW C;  3S17 J;  3QQA A;  1VI0 A;  2O7O A;  2DMQ A;  2EZI A;  3K2A A;  4QSH A;  1I6H J;  1NTC A;  3RQI A;  3TP0 A;  3TW6 A;  3UKG A;  2CJJ A;  5C4X J;  3F0C A;  1WH5 A;  1LE8 B;  1I50 J;  2K9S A;  2HXI A;  2DA6 A;  3MKL A;  1MBF A;  2HYJ A;  4XIC A;  3CMY A;  3W6V A;  2JWT A;  2FD5 A;  5F1J A;  1S7E A;  1GV5 A;  2R0Q C;  2LK2 A;  5E3O A;  5E3N A;  1WH7 A;  4FE7 A;  4B3A A;  4BBS J;  5FKO A;  3OSF A;  4XRS G;  3JRH A;  1LFU P;  2DA7 A;  5F0F A;  4GFB A;  1JKR C;  4A3M J;  4IHY A;  2YS9 A;  1QVT A;  4JYK A;  2DA2 A;  2CU7 A;  1TWC J;  2XGE A;  3BTC A;  2XGC A;  3JR9 A;  2E2I J;  1ETQ A;  2NVY J;  5K7F A;  1UHS A;  3JRF A;  3LSR A;  1AU7 A;  3S1Q J;  2PMZ N;  1ZGW A;  2LR8 A;  5E3L A;  1TWG J;  2M9H A;  2WV1 A;  3OOU A;  3QPS A;  5GPA A;  1ITY A;  1T33 A;  1B8I A;  1CQT A;  3I4N J;  4UUS B;  4DZP A;  4QIW N;  4BKX A;  5E3M A;  4M3D A;  1ZTR A;  2R5Z B;  1UG2 A;  4X1E A;  3WHB A;  1HLV A;  2HXO A;  2I10 A;  1A5J A;  4Y52 J;  2LLK A;  1TC3 C;  3A01 A;  3L1P A;  2ECC A;  5C3E J;  2KDZ A;  1GV2 A;  5M5X J;  3O8H A;  4M3G A;  1SFO J;  4JX5 A;  4XK4 A;  2ELK A;  3C2B A;  4HNV A;  1Z77 A;  1E3O C;  5C44 J;  3GTK J;  3S15 J;  4MFD A;  2E1O A;  5M3F J;  4QTR A;  3BR3 A;  2NS8 A;  4L5E A;  1VFC A;  1JJ8 C;  2O8K A;  1R9T J;  2HOA A;  5K7H A;  1AKH B;  2XPV A;  3LSJ A;  3Q0V A;  1U78 A;  5IYC J;  2DN0 A;  3D1N I;  5M5W J;  2JA7 J;  2ME6 A;  4B1R A;  1ENH A;  1WCM J;  2CRG A;  2MG4 A;  2EBI A;  4C3H J;  2NOG A;  3TED A;  3CDL A;  3GBG A;  4A3F J;  3M3Y J;  1BW5 A;  3BTL A;  4EEF G;  3BTI A;  3ZQG A;  2IAI A;  9ANT A;  2LVS A;  5EG0 A;  2Y30 A;  1QPI A;  2W48 A;  5F0C A;  1Q1V A;  1EF4 A;  1ETW A;  1TWF J;  3G1M A;  3H3V K;  1IC8 A;  2IEK A;  2M2E A;  2OPT A;  2L9R A;  3BQZ A;  2FQ4 A;  5EGO B;  4FTH A;  5DTD A;  2Y9Z A;  4FIS A;  3VPR A;  3M4O J;  2HI3 A;  2JMW A;  3I4M J;  1FIA A;  3H0G J;  5BNG A;  4A3K J;  1YRN A;  1ZQ3 P;  2HDD A;  2DA5 A;  2O9L A;  1NK3 P;  1MNM C;  1ETO A;  2HOT A;  1BJZ A;  3IH3 A;  5C4J J;  2N8G A;  2TRT A;  4A3D J;  4RDU A;  4D5F A;  1LE8 A;  4X6A J;  2NS7 A;  3ZQF A;  1MSF C;  2M34 A;  2AHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...