4A69C

Structure of hdac3 bound to corepressor and inositol tetraphosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
KFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords HISTONE DEACETYLASE 3,
publication title Structure of Hdac3 Bound to Co-Repressor and Inositol Tetraphosphate.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a69C00
1MBGA 2VPRA 2R7ZJ 1JKOC 5FKKA 2HQ5A 1IJWC 3HDDA 2VKVA 4M3BA 3TP3A 1WI3A 5C3EJ 3IV5A 2TCTA 2EZLA 2LVSA 3D1NI 1SANA 3BG3A 1ZR4A 1JUSA 3FIWA 5F0FA 3E7LA 1MH4A 1EF4A 1MSEC 4MFDA 4I76A 1FTTA 4D5CA 2AO9A 1PUFB 2GBYA 3G1MA 2CQQA 2R5ZA 1H88C 3HOVJ 1GUUA 3LSPA 2NVQJ 4V2FA 5IYCJ 2JN6A 1F43A 1VFCA 3BQYA 3LSGA 4B3AA 2HXOA 1ETKA 3GTQJ 1RR7A 5F0CA 4A3FJ 3S17J 2R5ZB 1R9TJ 5IYBJ 1JJ6C 2ELKA 2Y31A 3S1QJ 1MBFA 4B4CA 3FK6A 3K7AJ 4G12A 3TW7A 1U8BA 1IC8A 3SJMA 1FEXA 5F27A 2HOTA 1JUMA 1Z77A 2M9HA 2JJ7A 3F0CA 3TW6A 2H8RA 1T33A 1MBHA 2LK2A 2L7FP 2DA3A 4Y7NJ 1RESA 3B6CA 4XK4A 4X6AJ 3RKQA 1NTCA 2EZKA 3LSJA 2FX0A 5M5YJ 1W0UA 4IEJA 4A93J 4ABZA 3WHCA 1MSFC 2ID6A 4M3GA 5FKMA 4IHYA 3MKLA 3I4NJ 1ZK8A 2ID3A 3H0GJ 2DMNA 5E3MA 3ZQHA 1AU7A 1BL0A 2KDZA 1OCTC 3GTLJ 2LD5A 4C2MJ 4CYCB 2X9DA 2M34A 3IH2A 1H89C 3CCYA 1APLC 2N8GA 4MO7A 3ZOBA 1QPIA 1VI0A 2EZIA 2E1OA 2NVTJ 1TWGJ 2EH3A 2QCOA 3JRIA 2NVYJ 2L7ZA 1IDZA 2GM4A 2MG4A 5C44J 2IBDA 1XS9A 2ME6A 3HOXJ 2R5YA 5IPAA 1IV6A 1LE8A 1ITYA 1HOMA 4IHWA 3JRGA 4EEFG 1A6IA 3UKGA 2JA5J 4BY7J 4A3CJ 5EG0A 1OFCX 2CJJA 3ZQFA 1Q1VA 2R92J 2DA5A 2R5YB 3JRBA 1VNDA 1LE8B 2ECBA 1QVUA 1IRZA 1ETXA 1D5YA 1HDDC 1S7EA 2E2JJ 2X6OA 4B1RA 2CU7A 4QTRA 4A3LJ 4S0HB 3LNQA 1OCPA 3W6VA 2FJ1A 3JR9A 2XGEA 1I50J 4XIDA 1BJZA 5JLXA 3ZQIA 5EEAA 1UG2A 2E19A 3BG5A 4XRSA 1IDYA 4I6ZA 3GTMJ 1LFBA 5EDNA 3M4OJ 4BKXA 2M0CA 3HB9A 3GTOJ 3TEDA 1K61A 2VKEA 1PUFA 1NK3P 4A3DJ 4MFEA 1A5JA 3OIOA 3DEWA 5K7HA 4FTHA 3BR2A 4W97A 3WHBA 2K9QA 1JKQC 4XRMA 5IOYA 1JUPA 4A3BJ 1IGNA 5M3FJ 3OSFA 3Q0UA 3PM1A 2XPVA 5IP6A 1H8AC 4AC0A 3HOZJ 1ENHA 3ZQLA 4QIWN 1RETA 3HGYA 3JREA 1ZR2A 2JMWA 3SDGA 3O8HA 1JT0A 3RZOJ 3SFIA 1ETVA 2XPUA 2DMPA 4D7MA 1WH7A 5IYDJ 4XRSG 1JKRC 9ANTA 2EBIA 2O8KA 3L1PA 2Y2ZA 2DA1A 3BR0A 1JTYA 4XICA 2QF7A 4IHXA 4AYBN 2WB1N 4LOCA 2LY9A 3PO3J 3S2DJ 4DZPA 1GV5A 5E3LA 4DYCA 1MH3A 5EZGA 3G1LA 2G0EA 2JA8J 4JP0A 4A3KJ 4CYCA 2Y9ZA 2XGCA 1O4XA 3O8GA 3Q0WA 5EF6A 5K7ZA 2JWTA 2YS9A 3JRFA 1JKPC 1UHSA 1W0TA 2COBA 3C2BA 4X1EA 1ZKGA 1UMQA 2XB5A 2Y30A 3IH3A 3QPLA 4C3JJ 3JRHA 2LP0A 3FK7A 1AHDP 4A3JJ 2K9SA 3IH4A 1IG7A 4M3DA 1DU6A 1AKHA 3BTCA 4A3IJ 1ETQA 4D7NA 4UUSA 4FE4A 4BY1J 2HXIA 1U9OA 2LLKA 4MLOA 3S15J 2XB0X 2O9LA 1E3OC 4A3GJ 1ORKA 2DMTA 2YUSA 2NOGA 2XRLA 1AKHB 2W48A 3GBGA 3K2AA 2JA6J 3CQZJ 1FIPA 2DMQA 4UUSB 2LTPA 2K9NA 2KT0A 4W1UA 5EGOB 1DU0A 5DS9A 4JX4A 1FJLA 1Z0XA 3RQIA 3H3VK 3CMYA 2LR8A 1FTZA 1U9NA 4DZJA 2R93J 1I6HJ 3BR3A 3HOYJ 5FLMJ 1G2HA 4A3MJ 2CUEA 5EYRA 3VPRA 2CRGA 2DA4A 1TWAJ 2RAEA 4JX6A 1MBEA 2VI6A 2DJNA 5E3OA 2HOSA 2L7MP 2HOAA 2DMUA 4BBRJ 2HDDA 3BTJA 1CQTA 2OPTA 1TC3C 1OJLA 1YRNA 3B6AA 2P81A 1FIAA 2DA6A 2L0KA 1BW6A 1TWHJ 3HBLA 3S2HJ 4A3EJ 1Y1VJ 2MGQA 3GTJJ 2M2EA 2EQRA 4DW6A 1K83J 5F0HA 4BBSJ 3HM5A 1YRNB 2HI3A 2OF7A 1WCMJ 1QVTA 1P7IA 1RKTA 1WGXA 3LSRA 2IAIA 4HNVA 1HDPA 4DYQA 1B72A 5HODA 5K7FA 4RBOA 4D5FA 1ETYA 2E2HJ 4GFBA 3A02A 3QQAA 2MW8A 3BQZA 5FKNA 3BR5A 1X2NA 3S16J 3NARA 5FJ8J 3RZDJ 5J1YA 1NK2P 5J1RA 5F04A 1B72B 1JJ8C 4BXXJ 1VF9A 5IOZA 5BNGA 2DN0A 1B8IB 2YU9J 5FLVA 3GTKJ 1SFOJ 3A01A 2XPWA 1HF0A 3GTPJ 2B63J 5F08A 4M3FA 5EZHA 3TP0A 1P7JA 1RKWA 2DA7A 2GLOA 1T56A 4DYRA 2ZB9A 5M3MJ 1ZQ3P 2MSYA 3Q0VA 3HKZN 3S14J 3G1OA 3A01B 3BR6A 1GV2A 2PMZN 2Y9YA 5F1JA 4IHVA 3MN2A 2AHQA 2FD5A 1X2MA 4MIMA 4Y52J 1GVDA 4RDUA 5M5WJ 1QRYA 3MVPA 4C3HJ 1GDTA 2L9RA 4UUTA 3BT9A 5C4JJ 3FISA 5J1UA 5IP7J 2CQXA 3BTIA 4C3IJ 3OOUA 4FISA 1ETOA 5DTDA 2M8GX 4M6VA 3PO2J 2DTZA 2I10A 1U78A 1POGA 2XGDA 2LFBA 2VUMJ 5M5XJ 2E2IJ 4JYKA 5EGOA 2D5VA 2NVXJ 1BW5A 3GTGJ 3OSGA 4NDLA 4J19A 1X58A 5C4XJ 1MNMC 3CDLA 2ECCA 1BA5A 2WAQN 3A03A 3BG9A 5JLWA 2XSDC 1I3QJ 1WPKA 1JGGA 4FCYA 1WH5A 2NS7A 5J3LA 4JX5A 3S1RJ 3I4MJ 4M3EA 3LOCA 3BTLA 4FE7A 2NS8A 3ZQCA 5GPCA 3HEFA 1XC5A 2JK3A 4A69C 1ETWA 2JA7J 2HYJA 1F36A 2EZHA 2Y0SN 5GP9A 5GPAA 1HLVA 3JRAA 3ZQGA 3HGGA 4AUXA 1LFUP 2TRTA 3M3YJ 3FKIJ 2FQ4A 1JTXA 5IP9J 5E3NA 1XG1A 3Q3SA 1TWCJ 2O7OA 1ZTRA 3NAUA 1JT6A 2X48A 1HCRA 1Y1WJ 3QPSA 1GT0C 4L5EA 2H1KA 2ME0A 1TWFJ 3HOWJ 3DCFA 1RPWA 3JRDA 3JRCA 2R0QC 4QSHA 2LKXA 2WV1A 3S1MJ 1MBKA 4V2GA 5EG0B 3HOUJ 3S1NJ 1IUFA 1MBJA 2K40A 3BR1A 2IEKA 5FKLA 2CUFA 1B8IA 2DA2A 1ZGWA 5FKOA
chains in the Genus database with same CATH superfamily
2VPRA 2ZJPF 1F4KA 4BH9A 4M3BA 1LDDA 1X1DA 2TCTA 3S3MA 3CZ6A 2EZLA 5CPRB 5HOOA 2ETHA 3FIWA 1RNLA 1MGTA 2KISA 5E1WA 2JUCA 1FOWA 4MFDA 1FTTA 4D5CA 4F93B 2IA0A 3K4CA 2GBYA 2PG4A 2GQQA 3RPQA 2R5ZA 3OYMA 3LSPA 2K9MA 2O3FA 2NVQJ 2IVMA 2JN6A 3PQKA 2ELJA 4EJUA 2Y48A 1I27A 1MDMB 2BBYA 1JJ6C 2A5YB 3H1CA 3S1QJ 1MBFA 4HNUA 3K7AJ 4G12A 2JVHA 2KLOA 1FMVA 4BXFA 5D5WB 3S93A 1DGWY 2JJ7A 3WU2C 2JZYA 3H5RA 1T33A 2W82A 4B47A 3J7AO 1RESA 3W2WA 3E3VA 3DBRB 2XROA 5J4VA 1X19A 3RPUD 2LKSA 1QNTA 3L09A 4ABZA 2P4WA 2XRNA 1BI0A 3K10A 3MKLA 2FXAA 2MD0A 3H5NA 2HR3A 3LSTA 1JGSA 2DMNA 2M1BA 3H0GJ 1FX7A 2FRHA 5E3MA 1J59A 3S3NA 1VQNI 1WQ2A 3HC7A 1E0EA 3S8PA 2EB7A 2H1LA 2K7LA 2LD5A 2KRHA 4C2MJ 5KAFC 4N9HA 1OCCH 2XDVA 4L9NA 4ZZLA 4LIUA 2JRMA 4CDGA 5JR3A 3CCYA 1R71A 1G59A 4OMZA 2MABA 3MFKA 1QQIA 4ENKA 1MMDA 3F6VA 3AL0C 4DQ2A 4RB3C 4RGRA 3JW4A 2EZIA 1GXPA 4ZYDA 3I59A 1QPMA 1TWGJ 3DPTA 3BPXA 2ZSHB 3V8JA 3B02A 2CW7A 2M87A 4RB1A 4BJ5C 3JRIA 5J4YA 1X1PA 3JSPA 2GM4A 2MG4A 4NHJA 1WJAA 2K5CA 3W2VA 2EA2A 2K02A 2ME6A 2VPLA 4E70A 1IV6A 2FBHA 4CCOA 2WWYA 3VODA 2ACJA 4EEFG 3S3OA 2HZDA 5LGTA 3HRSA 5L3EA 5LD2C 3CLOA 1X1AA 1SC7A 1OFCX 4RM3A 5CJ9A 3ZQFA 1Q1VA 3OL3A 1DUXC 3V7SA 2R92J 1VNDA 1LE8B 3EQLF 2BHYA 3M1CA 2WBMA 1ETXA 2DYRH 1ZG3A 3ULQB 2E2JJ 2X6OA 1R1TA 4MNUA 5JHFA 1OCPA 2CW8A 2FJ1A 4HA8A 3HUGB 1G6NA 5HS8A 3FXLA 4HLYA 1E17A 4I0AA 4XIDA 3JTGA 1BJZA 1AA7A 4HPQA 3M1EA 3HOTA 3SFZA 4FX0A 2E19A 1YW8A 2VXDA 3VSLA 1ULYA 3R0JA 4JOMA 3GTMJ 2K4BA 3M4OJ 2HS5A 3DWLE 4YEJA 4ZYEA 5CVRA 2B7EA 4BXUA 4M73A 1W7PD 1LDKB 3QYBA 1K61A 1IRXA 4A3DJ 3U9GA 3N97A 2XAGA 1FT9A 4W97A 2K9QA 3F9KA 1JUPA 5ERIA 4A3BJ 3JCUC 2AXLA 3K1MA 2ELHA 4CXFA 3GX4X 1MKMA 3G73A 3HTUA 3PM1A 4AIHA 1H9GA 4AIKA 4ZTJA 1MDMA 4WX9A 1Y0UA 1VQPI 3PFYA 1DPRA 1FBQA 5J47A 2JSPA 2NNYA 3HGYA 3X2QH 1Z7UA 1B1BA 2QEXI 2ZFUA 2VQGA 2DMPA 4N4OB 4D7MA 1MW7A 3H35A 1R5GA 5EEHA 4QPQA 2O8KA 3L1PA 4BQQA 2OJED 2QKLB 3KYLA 4RAYA 4ZZDA 4XICA 3L9FA 3AL0B 2QQBA 3HG9A 4PFOA 4N4NB 3J81K 2WB1N 2CV2A 1D1BA 4OOIA 2LY9A 3S2DJ 2Z33A 1OCZH 4DZPA 1JHFA 4U0WA 5E3LA 2F6CA 2A6HF 1MH3A 4D9JA 2JA8J 3G6EI 2Q2EB 3QODA 2V1DA 1LKXA 3BJOA 1BBYA 1WI9A 3WU0A 5LRRA 2XGCA 1EH7A 1WFXA 2VBWA 3O8GA 2B0LA 2JUGA 2YS9A 4PK4A 3GW2A 1JKPC 4A6EA 2VQLA 3RKWA 4UUVA 3P9CA 4CZZA 2WAQA 3D5SC 1B9NA 1R00A 3HZJA 3VB2A 3WE2A 1TQMA 3QPLA 4YELA 4PSWA 2OCCH 3V4GA 3W2AA 4G7OF 3FK7A 1T39A 5HDNA 4UB8C 1T95A 3CCLI 4M3DA 2CO5A 3ZMZA 3GUDA 2JPBA 1T98A 2ZBKA 2Z3YA 1X3ZB 3R61A 1PUEE 5FO5A 1VQMI 5D5VB 4HG2A 2V4JC 4YRVA 4UV8A 4MLOA 3S15J 2AXTC 2XB0X 2O9LA 1E3OC 2Q0OA 3J80K 2W25A 4X0GA 4PGGA 1TT0A 4BQOA 3GBGA 5LRSA 3K2AA 3H0DA 5FRMA 2FBKA 2HEOA 1EH8A 2R7OA 1SMTA 2DMQA 4UUSB 4CGZA 2LTPA 5DS9A 2Z16A 1FJLA 5TISC 1BN5A 2KP6A 3K2ZA 3ONQA 3CMYA 1B59A 1OLTA 2RDPA 5EEGA 3BR3A 2AQFA 1IUYA 5EYRA 2PFBA 4QWQA 2VI6A 1R5ID 2DJIA 3MKYB 2J5OA 1S7AA 2HOSA 4LJZF 5B66C 3L2WA 2DMUA 2KRFA 1ON1A 3LMMA 1Z05A 3E6DA 3MQ0A 1TC3C 1X1CA 4MHGA 1YRNA 3B6AA 3H5AA 2LDUA 4ASNA 1SD5A 1Z7LA 2DU9A 1TWHJ 2QVOA 4IO9F 1R7JA 4M6YA 3GZ5A 3GTJJ 2RN7A 2OTJI 2EQRA 3BJ6A 3FHZA 2HZTA 1K83J 2ISZA 1Z3XA 4IX7A 5J40A 2HI3A 4BS9A 3L2UA 3MEXA 3AKZA 4IVNA 1P7IA 4FT8A 4U7BA 3H9JA 2DBBA 3RPUA 3LSRA 1RI7A 3OS1A 4HNVA 2MD5A 2P8TA 2MC3A 1ODDA 3ABLH 2QA4I 4DJAA 5HODA 2KRCA 5K7FA 3V8KA 4A5NA 5K5OA 2E2HJ 1D0ZA 2DT7B 2A05A 3IP4B 3QQAA 1BI3A 3BQZA 3TO6A 5CKTA 5FKNA 2PMZA 3NARA 1UZCA 2E36A 3PUBA 5J1YA 1KU3A 3QYEA 3G4SI 1B72B 3OS2A 1S3JA 4LLLA 2EJRA 4EV0A 5ICCA 1YIJI 2XAHA 1SFOJ 4L18B 1HF0A 3VSKA 3GTPJ 2EV0A 4H0EA 2HQAA 3TP0A 1RKWA 5DEQA 3CJTB 2ZB9A 3NEUA 4ZC3A 3VOEA 4OU0A 1ZLKA 3E5UA 3Q0VA 2K3FA 2XAQA 2JVGA 2F5EA 3HKZN 4U0VA 2EIJH 1ZG1A 1T08B 4OMYA 3ZXSA 3BDDA 1XTAA 4OIRF 3DQVC 1GV2A 3QP6A 4RGUA 1IN6A 4I09A 4IL6C 4HW0A 5F1JA 4LG3A 3PSFA 4PDKA 1STZA 1UHMA 3WU1B 1V5EA 2XGXA 1IXCA 1WJ5A 4LGWA 1U6GA 1V54H 3ZN1A 4Y52J 1R1VA 4XKBA 2DCEA 3OR1C 4RDUA 4J00A 2LY2A 1LEAA 1TP4A 3F8NA 4XM3A 1I1SA 2L2OA 1FLIA 5TRDA 4C3IJ 4HNTA 2VL8A 1EV7A 4BE2A 3OYCA 4M6VA 1P9QC 2RVCA 2L9VA 4A0YA 3JSOA 2FNAA 4CH7A 3ELKA 2I10A 3ZN0A 4F3QA 2G9WA 4XLEA 3F72A 3PSIA 1IRFA 3TO7A 1J5YA 2LF8A 2D5VA 3GTGJ 2VLAA 5LHHA 4UVBA 2QYOA 3DPLC 3CMEI 4HBLA 4KIGA 3V7RA 4J19A 2BW3B 5C4XJ 1XGNA 1YLFA 3E6BA 3DU5A 1IV8A 4KYWA 1ZRFA 4IOAF 2X1CA 1YOVB 2KJBA 1BA5A 3VWBA 2VC0A 1W7PA 1VQ9I 1FSHA 4HSTA 1KA8A 3ESWB 2QM3A 3D5RC 1D0YA 1WPKA 2HVQA 1OMIA 1J7KA 4CYDA 1HQCA 4JX5A 3S1RJ 1K7AA 3F8MA 3CJNA 3BTLA 3PQJA 2VKHA 2JQ7A 2DTRA 1J9IA 3F3XA 1RIOH 1YX3A 2G7HA 3OL4A 2UXXA 1ETWA 1ZYRF 3IAM2 3BLYA 2HVSA 3ABMH 3PJRA 2XKPA 4KA4A 3S32A 3I64A 3ZQGA 1ZRDA 2DO7A 1KONA 2Y0MA 2X1DA 4NC6A 4AVPA 3FKIJ 2MH9A 1WRJA 5E3NA 1BOBA 3Q3SA 2O7OA 1ZTRA 5GADJ 5IY5H 3BG6A 3L00A 4CCNA 2LKPA 4HX7A 1GT0C 4IXAA 1Z9CA 1KQ9A 4L5EA 4B8XA 3U21A 3H3ZA 1TWFJ 3HOWJ 3ABTA 2YX7A 2KJCA 2IGOA 3F8FA 4M74A 3GLLA 3NWSA 2LKXA 4L9JA 1CF7A 3OYDA 3WTUC 5E1XA 3HPHA 5EG0B 2O61A 3K0LA 5DD8A 5J8CA 3S1NJ 1O57A 3C7JA 1BJAA 3BR1A 1LB2A 1MMSA 5A2QZ 2HVRA 1V55H 3M7GA 3FXQA 1MBGA 2R7ZJ 4I01A 3Q9VA 3K1PA 2HKXA 5FKKA 3R6SA 1IJWC 3WTSC 4LLNA 2F4OB 3CESA 3LA3A 3TOAA 2QKMB 2K86A 2PJRA 1FC3A 3T8TA 3BCAA 3I54A 2EK5A 2VXZA 2LNBA 3D1NI 3BG3A 1ZR4A 3AG3H 4U87A 2BY0A 1J0RA 3IC7A 4I76A 1R36A 2FBIA 2L3DA 2IA1A 3H9GA 1FOYA 5D5XB 1PUFB 3RQ4A 3OOPA 2I5UA 3E6MA 2CQQA 3ECOA 1H88C 3HOVJ 1FNNA 4IZZA 1W5TA 5IYCJ 1F43A 5L3CA 3HRMA 2LG4A 2JSCA 3CC7I 3KETA 2CMPA 4A12A 5HS7A 5HLGA 4AIDA 1NHAA 3KLOA 3GTQJ 1RR7A 3BJAA 2A07F 3FHNA 3S17J 2R5ZB 5IYBJ 3K69A 2ELKA 2Y31A 1VQOI 3MZHA 4B4CA 1H9TA 3SJMA 1Z77A 5DV5A 3TW6A 4KDPA 3DF8A 2P7CB 1WJEA 2A68F 2L7FP 1BI2A 3ZCOA 1WVRA 2CUZA 1O3TA 2EZKA 3C2HA 4XSZF 4R79A 1YG2A 5M5YJ 4G6QA 1W0UA 2IXSA 1VQ6I 3CF5F 2Y69H 2ID6A 4M3GA 3E6CC 4IHYA 3SEQA 4KMFA 4ANJA 4KT6A 2Z1DA 1ZK8A 3WGGA 2V26A 2VJJA 4XMYA 4G7HF 2KDZA 1OCTC 5ICFA 3CC2I 4PGHA 1TBXA 2FOWA 2WTEA 3SQNA 4GXOA 5AIQA 1V5FA 5LHGA 1O7FA 4XLPF 2EIKH 4CYCB 1UCRA 2X9DA 2M34A 3AAFA 3CJQB 1GVJA 1G3WA 2BOLA 2HQRA 3ERMA 4QLCU 2VOPA 3ZGKA 1T0FC 4MO7A 1RC9A 4LD5A 1LDJA 1VI0A 1UJ8A 4LB6B 2PLYA 4Y33A 4L0ZB 2V9KA 1IDZA 2L7KA 1QZYA 3R4KA 2VE9A 2VIXA 4EJTA 2M3AA 3HPGA 5LGUA 1XS9A 2OD5A 1W5CC 3HHGA 1ITYA 2G7UA 3GFJA 2V6CA 2JA5J 2HYGD 5EG0A 5FRNA 2R7UA 3JRBA 2ESNA 4IHSA 1U5TC 3C2GA 4M71A 1IRZA 2GIVA 3KP7A 1D5YA 2CWEA 1OYWA 2ZKZA 3QYFA 5ED4A 4BQNA 4B1RA 5E17F 3OYBA 3KP3A 4GGGA 4D0PA 1DGRM 3JR9A 1JI8A 1WJDA 1ON2A 3EUHC 5L3DA 5JLXA 1T38A 4S05A 3KEOA 3LFKA 3T1BA 4E7ZA 2P6TA 4ZDLA 5B5EC 1WJFA 1LFBA 2EFQA 4PJLA 4RMNA 4XOPA 1OCRH 1F5TA 2QBYA 1T8IA 3HRUA 3MZYA 4CSWA 5DYMA 2M0CA 2V79A 2RV8A 3GTOJ 4EMSA 5E18F 3OS0A 2VKEA 4UHTA 1PUFA 4RS8A 1NK3P 2IS1A 1ONVA 2DYSH 5GAEJ 3DLAA 4ZDOA 3OIOA 3DEWA 4PFPA 5K7HA 1KGSA 3FXKA 3PNVA 3BR2A 4Y3OA 1ZREA 2DT6A 1BIAA 3L7WA 4YG2F 2Z9OA 2Z2SB 2ZMEC 4ITVA 5M3FJ 1WJCA 3OSFA 4I02A 2XPVA 3LQRA 2BEOA 1EA3A 3GCMA 4AC0A 4CHUA 1Y0NA 2K4JA 3C1DA 4ZYGA 1XN7A 1ENHA 1L0OC 2HTSA 3JREA 3RZOJ 2JMWA 3LAPA 3O8HA 1YO5C 3K4MA 4HX4A 2EILH 2BXZA 1L3LA 2V9PA 2KHMA 1YYVA 3GWZA 1WH7A 2X6XA 1AWCA 3OYFA 3P9KA 4GCVA 3REOA 3DEUA 4G6TB 4HV6A 3DTKA 4LLGF 3KFWX 3BR0A 1OYYA 3ZPLA 3B73A 2OQGA 2XAJA 5E1ZB 1KU2A 3SHFA 4AYBN 1R23A 3MCZA 3IL2A 4KUMA 5AONA 2XASA 5EZGA 5DCFA 3KP6A 2G0EA 4A3KJ 1Z21A 2XAFA 4CYCA 2OCEA 2KIMA 3Q0WA 2JWTA 3DP7A 1LFPA 4NBQA 5B1BH 1QO0D 2XF6A 2M45A 2GXBA 4M9XA 5FROA 3V8LA 1HW1A 3RDIA 4EM0B 5LBQA 4LFUA 2Y30A 4EJOA 5DDGA 1DQUA 1TQPA 1IN4A 1FSEA 2XUBA 1FWZA 4C3JJ 3JRHA 2OTLI 2LP0A 1AHDP 2DK5A 2EWNA 4B44A 3OY9A 3DFGA 2K9SA 1IG7A 2PI0A 1REPC 1AKHA 2EPFA 1UHWA 4G7ZF 3NRVA 2P5KA 4A3IJ 3DEEA 4NC7A 3RCOA 2R7WA 4BY1J 2Y0SA 1D5VA 1F9NA 2D2WA 4M9SA 2JTVA 4IRGA 1ORKA 2QUFA 3CUOA 3CUQC 3GFMA 2QSGX 2DMTA 2NOGA 4BHBA 4KFCA 3TGNA 3LFUA 3KCCA 4U0YA 1D8KA 3R0AA 3E97A 2ZJQF 1HKQA 2JA6J 1KQ8A 5L3BA 4M9ZA 4KJZA 4D1QA 2KT0A 4W1UA 3HIFA 4JX4A 3H3VK 3A1YA 2CFOA 3CP8A 2VOOA 4OAYA 5ILVA 3KX2A 1WJBA 3OWTA 2ZJRF 4AD9A 2LC2A 5EJCA 4DZJA 2R93J 3L2QA 2IGMA 1ERDA 2R7XA 1OCOH 2VODA 3VPRA 3AFHA 3BWGA 2RAEA 2W85A 4Z6YA 4BDYA 1MIJA 4E7LA 4WF2A 2RQPA 1HW5A 4BBRJ 3SZGA 4PCQA 2OPTA 4C9YA 2UUZA 3I4PA 1FIAA 1BW6A 2L02A 1SD6A 1MJAA 5E8GA 3FKJA 1Y1VJ 2MGQA 2HQNA 4E6KG 4Y15A 4G9YA 4JQFA 4LK1F 2E7WA 5F0HA 1B9MA 4WXCA 1YRNB 1V5GA 2E5NA 3I5UA 1WCMJ 5LFAA 1MJBA 2IT0A 3J7YJ 2XC7A 1VQ8I 4DYQA 3OYGA 1ETYA 2KDOA 4GFBA 3HL2A 4IKFA 3TQNA 3P7NA 3BR5A 2UWMA 5H2FC 1NK2P 2F2EA 3BPVA 1P2FA 5E79C 3T8RA 3FWEA 3QOPA 1MMGA 5F04A 5J6XA 1JJ8C 1T0FA 3O2PE 5BNGA 1QA6A 2YU9J 3ZRGA 3HYIA 3A01A 2XPWA 3ZMVA 2GA2A 2B63J 4M3FA 5BQTA 4OAZA 5K5QA 2DW4A 5CLSA 1SFXA 2HDWA 1MNEA 4EJWA 1G3YA 1T56A 4E7HA 4II3A 2F5VA 1HKSA 2PQ8A 3UNGC 5IT3A 5GTHC 2MSYA 4ESJA 1PP7U 2KIFA 1YX5A 1IRGA 3S14J 2O0YA 5DUKA 1R5HA 2FF4A 3BR6A 3H3UA 4F7ZA 5ICEA 3ISPA 3KEYA 4UB6C 1IW7F 2PMZN 2GAUA 3CUQB 3FMSA 3LA7A 2X4HA 4IHVA 4XKCA 3MN2A 3S2WA 5FLXZ 2BV6A 5A2QK 3M07A 1X2MA 2ISYA 4XR6A 3CD6I 4MIMA 4E7KA 1YQAA 1GVDA 1U5TA 4BACA 3PNYA 3MVPA 3F6OA 3TDZC 5HNFA 4UUTA 1BR4A 3FISA 2MLKA 4RM2A 5J1UA 5IP7J 1D0XA 4L5IA 3DLLF 4XN0A 2H94A 2WAFA 4MQVA 5DTDA 4F92B 3EUHA 2M5WA 3R60A 2IPQX 1MMAA 3SDBA 3D0SA 2DDAA 3OYLA 2XGDA 2LFBA 5M5XJ 2OUMA 3F8BA 4JYKA 4BU2A 2OC6A 1S5LC 4Z2YA 3CDLA 1HXDA 2ECCA 1USTA 1U0JA 2ZMEA 1Q1HA 4F91B 5JLWA 2COMA 2E34A 2XSDC 4C2UA 1I3QJ 4EGYA 1IN7A 5H20A 2DXIA 1GHCA 1WH5A 2NS7A 1LVAA 5J3LA 3G3ZA 4M3EA 3LOCA 2W57A 3K1NA 4HLXA 5GPCA 2ZNYA 3HEFA 1W7PB 4P55A 4A69C 2JA7J 2HYJA 2VJ5A 1F36A 2E60A 5GP9A 5GPAA 2O6GE 2QZ8A 1HLVA 3OMYA 3QOEA 2F4IA 4B3XA 1D8JA 2KKOA 1YJNI 2TRTA 5FGMA 2DT5A 2RC4A 5IP9J 2GWRA 3ZMDA 1TWCJ 2LYCA 3DKXA 3K4NA 3NAUA 3GYHX 1P6RA 3TKYA 3QPSA 4JK1X 3LAJA 5HLTA 2H1KA 4BUPA 2ME0A 4HX8A 1Z3YA 4HZFA 4IPAA 1RUNA 1EH6A 3DCFA 1RPWA 2P5VA 4HAMA 2V1NA 2R0QC 1FP2A 3VYUB 1BR1A 3BZ6A 4FQGA 3S1MJ 1O3RA 1P4WA 3WG9A 5LEJA 4UY8I 4RLFA 4KNYA 3IWFA 1UAAA 1IUFA 1MBJA 2K40A 3EPZA 1TL8A 1MD0A 4PJNA 2E71A 2LH9A 3GVAA 4XOTA 2W00A 3QWLA 1ZGWA 1JKOC 2VN2A 1EKEA 1CF7B 1FOKA 5CVIA 2VKVA 3ROUA 3TP3A 1SAXA 4KITB 1WI3A 3H92A 4Y4RA 4YFXF 2PBIA 2LVSA 3OYNA 3CJRB 4P1WA 4XORA 3CUQA 5DUIA 1YW9A 4BEHA 1EF4A 1MSEC 5D4SA 5E20A 2AO9A 1E3HA 3Q9SA 2WAEA 1PP8F 2PJRB 4I0BA 3RKYA 4V2FA 1X4OA 1VFCA 4BQAA 1VQLI 4EM2A 2HPMA 1SVLA 3LSGA 3ZR8X 2HXOA 4FASD 1ETKA 1IN8A 1O7LA 1D1AA 1Z67A 5LEKA 2LY1A 1R9TJ 1Z91A 3QAHA 3FK6A 3TW7A 1U8BA 1FEXA 2RNJA 2HYFA 3F0CA 4XLCA 2NVUB 4HYEA 1MBHA 2LK2A 2Q8KA 2M0MA 2DA3A 4Y7NJ 4G8XA 2OZUA 2ZXHA 3B6CA 4XK4A 5L3FA 1D1CA 1I1GA 1NTCA 4HEA2 3N05A 3RKXA 4HF2A 2D1VA 4AIJA 3WHCA 1XX5A 2EV5A 3WTVC 3I4NJ 1XMKA 2F48A 1BL0A 3CCEI 3ZQHA 4M72A 1TW2A 5E8IA 4DNCA 4UVCA 2RKHA 5CQEA 3N4MA 4YFNF 1H89C 2JPCA 2BGCA 1Z1DA 1JXSA 4BE1A 3GF2A 3E5XA 1ZGAA 3ZOBA 1DP3A 1R1UA 4GYIA 4Q48A 4UNOA 2BHZA 1QPIA 2NVTJ 2FA5A 2FSWA 1I5ZA 3VYTB 2UXNA 2QCOA 2E35A 2DPUA 2NVYJ 5H6QA 1YE9A 1X1BA 3H36A 2BXYA 4MTEA 2IBDA 1YS7A 2W4SA 3HOXJ 2R5YA 4MQ9F 4MTDA 1XMXA 2CFXA 1HOMA 1W5SA 2QQAA 1K79A 1FMWA 2O03A 4XLHA 4IJAA 4EGZA 4A3CJ 3EUAA 1QBJA 1ZGJA 1C0WA 1UB9A 3K4BA 3OYIA 2XF5A 2ECBA 4E7SA 3K4LA 1YW7A 3J7ZI 5JHUA 2CU7A 4N0BA 5ICGA 2XGEA 2HU9A 3MAJA 3MKZA 4CZCA 1VQ4I 1I50J 5J8FA 1WZ2A 4RA2A 5JVGF 5EEAA 1UG2A 2CQKA 1GXQA 1YIOA 3WG7H 4XRSA 1IDYA 2UZKA 4DOZA 5HDGA 2HWVA 3Q5FA 2B9SA 2DDBA 3J81Z 3HB9A 2BY2A 4TV7A 2R4GA 5KHDA 2E1CA 3BC8A 3OYJA 4FTHA 3WHBA 4DBRA 2LF7A 1K4SA 1U8RA 3KP2A 1I3AA 1R22A 2LSOA 4MGRA 3AG1H 5DCMA 4ETSA 3K70D 2QBYB 3Q0UA 3HOZJ 2O5RA 3HXLA 1QGPA 2CW0F 3M8JA 3TO9A 1ZARA 4PJMA 3K70C 3JTHA 3ZQLA 1B4AA 1FP1D 2FOKA 1RETA 5D6EA 4UXNA 3M8FA 4CICA 4EVIA 1YS6A 2KL4A 5FFXA 4M6XA 3SDGA 2A5WA 1ETVA 1QZEA 2W24A 5IYDJ 3GO5A 4HRIA 4IOCF 1JKRC 3L2RA 4AU7A 1X4PA 1K78A 4V19K 3I71A 2R7QA 3J7AY 3KZYA 2EBIA 4NNJA 1OYIA 1KYWA 2X0LA 1D3YA 1JTYA 2ICWG 2M4KA 4P9UA 3J80Z 4GYGA 2P7VB 3ZQQA 3CCUI 1YITI 2Z99A 4I98B 4JP0A 2KZVA 3BROA 4L9VA 4EQQA 1HSJA 1K6YA 2Y9ZA 3OR2C 1O4XA 3DTEA 5K7ZA 3WODF 3FXUA 2E7XA 3ML6A 5JFRA 4OWRB 4X1EA 4Y17A 3MZ8A 3G2BA 4BGDA 4L9TA 2VE8A 5CVUA 3IH3A 1FYLA 1JHHA 1G3SA 2ESHA 4R1HA 3TBIA 3HJEA 1P4XA 3K9TA 1N75A 4A3JJ 3K4KA 4B43A 2YR2A 1YJWI 1DU6A 2XKOA 1R49A 4L5JA 1ETQA 4PJJA 1XGSA 2OU2A 2HXIA 1I6XA 4Q4ZF 3QU6A 4BE0A 1U9OA 2A6TA 2L4AA 2V7FA 1KZHA 2IJLA 1N78A 2HPIA 1AKHB 1R6RA 3CQZJ 5BS6A 2H6CA 3RYPA 1QHHD 2K9NA 3FXRA 2HKOA 1VQ5I 5FLXK 3G71I 2JRTA 4A2UA 2KMUA 2LR8A 2R7SA 1U9NA 3TL4X 1I6HJ 2MFZA 3K4JA 3OYHA 4A3MJ 2ZFWA 2CUEA 4XKWA 3PFIA 2CRGA 2DA4A 4JX6A 1MBEA 1S6LA 1IF1A 2DJNA 4DGWB 2DFFA 2ZSIB 5D6FA 2HDDA 4Q5SF 1SVMA 2A61A 3FX3A 3BTJA 3FZVA 2DQLA 1Z6TA 3C3WA 4IQ4A 1DDNA 2UV1A 2P81A 1S9HA 4WWCA 2X1EA 3IRRA 2GOMA 3HBLA 4LMYA 4HDVA 4LG0B 3S2HJ 4YIFA 1A5JA 2M2EA 4B09A 2K27A 2ZXWH 2VBYA 1K6OA 4A6DA 4O6JA 4KT5C 3HM5A 3HRTA 2EA4A 2R7VA 3KP4A 1HA8A 2L01A 1ZRCA 4FETA 5B3SH 5ILUA 2Q1ZB 2IAIA 1HDPA 1FY7A 4P5OA 2EFWA 3OIPA 2CYYA 4RBOA 4D5FA 1XSVA 4YIIA 2VONA 1EJ9A 3A02A 4RGXA 2E1MC 2IGKA 2ZXJA 3TDUC 5FJ8J 3GFIA 5CYVA 1S7OA 2DOAA 3L2VA 1VTNC 4RAFA 5IOZA 5AIPA 3OYAA 1YHQI 1B8IB 1XSXA 3GTKJ 5HLHA 4GDFA 1RZ4A 4NQWB 2PMUA 5EZHA 2QGUA 1P7JA 2GZWA 2DAOA 2DA7A 2GLOA 1YI2I 2ADUA 3CMMA 3O3KA 2EFOA 3WTTC 2LBFA 1ZQ3P 2CV0A 2OA4A 3G1OA 3A01B 4IHTA 3A0BC 4E4HA 1ZELA 2LOOA 4CO8A 2WY8Q 4KN4X 2W1OA 1R58A 1E2XA 1ZAOA 2F5CA 3EYYA 5HS9A 4A5MA 2Y9YA 2R3SA 2DOFA 5HDKA 2QENA 3SXYA 4ESFA 1BC8C 1S29A 1XPXA 1FPQA 4MEYF 3E1SA 1W4MA 1Y6IA 5M5WJ 1FYKA 4II2A 4PUSA 1QRYA 4G94A 3FBIB 3K6GA 4C3HJ 5BPIA 4AM3A 2M7AA 3NWTA 2P5LC 2M4GA 4IRHA 1T2KA 2RGVA 2L9RA 3BT9A 4RGSA 4CCKA 2IRFG 3WTYC 3EDPA 1S72I 2CQXA 2JT1A 2MLGA 3BTIA 3OOUA 1BOAA 3LSIA 4E7JA 1A31A 1ETOA 2XHKA 1U5TB 1TNTA 2P6SA 3ASOH 2D45A 4H4KC 1UFMA 4U7DA 2DTZA 1Y56A 2Y75A 2ZC2A 1POGA 3CTAA 1IN5A 1BW5A 4HDUA 3WTWC 3OSGA 4NDLA 2VB6A 2QSFX 2VBXA 2STWA 3QP5A 3A2KA 2V9VA 4PSXA 1V3FA 1IO2A 2HFHA 1XGOA 1FYMA 3A4CA 3KZIC 1IXRC 2WAQN 3A03A 5B1AH 1PDNC 2FUG2 2XVCA 4BL0B 3SEZA 5HVQC 2VJIA 4OIQF 1JGGA 2PEXA 2GIZA 3DV8A 1SFUA 4FCYA 1M1EB 2X6WA 2L9NA 5D5UB 3I4MJ 4GRIA 3W3CA 5D4RA 2HNHA 4Y13A 2EFPA 4XNFA 2QQ9A 1UG0A 2ZMEB 1IZ1A 2EZHA 4LG0A 3FBNB 2FU4A 5DM7F 1H0MA 1V4RA 2CG4A 2QQ8A 1J09A 2E1MB 4A0XA 3JRAA 4ON0A 3HGGA 3BP8A 4RAZA 3GFLA 3M3YJ 1K4TA 1R4MB 1JTXA 1A6QA 1S8NA 1BR2A 1WHUA 4KISA 5D8LB 1JT6A 2X48A 3W6JB 2CQNA 3VYRB 2HTJA 1Y1WJ 1N77A 1SAUA 1TTYA 2OV7A 3PNTA 4EJVA 1LEBA 3F8CA 4XRFA 3AG4H 1MNDA 1LPQA 1U3EM 4QSHA 2WV1A 2CQ7A 1MBKA 3CCSI 4AWXB 2GXGA 4I7HA 4XL9A 3HOUJ 4RAGA 4LITA 3PL8A 2FEZA 1B8IA 3JAMZ 2BYVE 2EFNA 1XCBA 1KYZA 1OKRA 1SVOA 4NQWA 5FKOA 1T6SA 3DKYA 2A69F 1TZLA 1OR7C 2HQ5A 5HLIA 2H8WA 3HDDA 1AOYA 5LGNA 1KU9A 3RJPA 4ZYAA 2E5ZA 1XMAA 5C3EJ 3IV5A 5BMZA 1J75A 2A3SA 2V1UA 5DM6F 4PZJA 3ERED 4G6DA 3U2RA 1SANA 1SD7A 2F4MB 1JUSA 5F0FA 1BC7C 1JE8A 3E7LA 3CO7C 1MH4A 4AYBA 3CF2A 4K2EA 2H09A 3U1DA 1FOXA 3G1MA 2XV4S 1XD7A 3PUFA 1Z6RA 4OIOF 1GUUA 2VASA 3DPUA 2FMYA 3QU3A 5IT9Z 4ESBA 2L9SA 2FNPA 3BQYA 3FXJA 4B3AA 4BEHB 2HDCA 4FX4A 4F55A 4XBFA 2WV0A 5F0CA 1TT5B 4A3FJ 2IS2A 2LMDA 3QPHA 3HHHA 1IC8A 5GTIC 2AQEA 3LL7A 2GXAA 3C18A 2WADA 5F27A 4WXHA 1JUMA 3ZQ7A 3BOQA 2HOTA 2M9HA 4P96A 2IS4A 2H8RA 3P5JA 3WTZA 2L4MA 5KCMA 2RQQA 1Y8RB 2K3PA 2YSRA 4GO1A 2DPDA 4X6AJ 2NNNA 3RKQA 3LSJA 2FX0A 4IEJA 4A93J 2LREA 4NUBA 4HQEA 1MSFC 5FKMA 3SYTA 3RSNA 3LSMA 2F5FA 2ID3A 1DPUA 1AU7A 1XGMA 1QZZA 2NYXA 3GTLJ 1FBSA 3KPHA 2J5PA 4MEXF 4XONA 1OQYA 2V1XA 4BJ6C 3GXOA 3KEQA 5F6FA 4WK8F 3FXMA 1B6AA 4KIFA 2R7RA 2E1NA 3CDIA 3IH2A 1PJRA 2L54A 3QRFF 2D1HA 5FB2A 1APLC 2N8GA 2DOEA 4B48A 2MA3A 3FM5A 2IW5A 2QLZA 2E1OA 3LWFA 4ENNA 1YTYA 4YFKF 1KU7A 2EH3A 1FZPB 3I53A 4OIPF 2L7ZA 3HSRA 4CUGA 2WY7Q 3CCVI 2CH0A 3VDXA 2ZCWA 5C44J 3P9IA 5IPAA 1LE8A 2M8EA 2R7TA 1A04A 1SFKA 3EUKL 4IHWA 3JRGA 2IA2A 4LIVA 4UV9A 3O6BB 1A6IA 1YJ9I 3UKGA 1DP7P 4QPOA 1IAWA 4BY7J 1MMNA 4ENMA 4CCJA 2CJJA 3HUGA 3LQQA 3SZPA 2DA5A 2OAZA 5FFZA 2R5YB 1QVUA 1PYVA 2MYSA 2DK8A 1HDDC 1S7EA 2ZJ2A 2QSHX 1RR8C 5HNHA 4HOBA 2XSJC 4A3LJ 4QTRA 3EYIA 4S0HB 3LNQA 5LHIA 3W6VA 1Y39A 5BPDA 3DU6A 3IHUA 4ZJZA 1A36A 1P4AA 1U2WA 1RRJA 3VFZA 4EM1A 1IXSB 3ZQIA 2OQRA 3BG5A 4I6ZA 4YIRX 3HOSA 3DTIA 4I99C 1TQIA 3HTSB 2YU3A 5EDNA 3PIPF 2YPRA 1CGPA 3ABKH 1LNWA 1NG7A 3F23A 2X51A 3ZMUA 4BKXA 5BOXA 3RI4A 2NS0A 3TEDA 3ZMTA 3FXOA 1O3QA 2KIUA 4MFEA 1XDSA 2P0WA 3IKVA 3FMRA 3PIOF 1R4NB 2QWWA 3KLNA 1JKQC 2K9LA 4XRMA 5IOYA 3H9QA 4CA0A 2DFHA 1IGNA 2MBFA 5KAIC 4KIBA 2WB1A 1H8AC 3E0JB 5IP6A 1NG6A 3MD2A 2EV6A 2AS5F 1F1ZA 2WC2A 1WSUA 1PVEA 2PN6A 1SD4A 1ZR2A 2DODA 1JT0A 3CMAI 3SFIA 1HC8A 2XPUA 5DCMB 3I56I 4F52A 3QPTA 3UR3C 2TDXA 3F21A 4XRSG 4I2OA 3CCRI 9ANTA 5GAGJ 2FMLA 1TLHB 2Q2EA 2CUJA 2Y2ZA 2DA1A 1HSTA 4HV5A 3W6KB 3ASNH 4XQFA 2QF7A 2KIQA 4FHTA 4IHXA 4BAYA 4LOCA 3PO3J 1K78B 1GV5A 3BY6A 4DYCA 1VQKI 2MH2A 1J2XA 3G1LA 1P92A 5JI6A 3IKTA 3L2CA 2KZGA 3FMQA 4XN3A 2F5DA 1LQ1A 2DLLA 4J01A 5KK1A 2NOJB 5FD5A 5EF6A 3IAS2 3GLXA 3JRFA 1UHSA 2VKDA 1W0TA 2COBA 5K5RA 4HF1A 4N9IA 4ENJA 3C2BA 2PX9A 1ZKGA 1UMQA 3WE3A 4CCLA 2EIMH 3D5LA 3CCQI 2XB5A 3KIOA 1VQ7I 2DI3A 2CS3A 5CVVA 4XLFA 2DFEA 3KYDB 4ZTFA 3COAC 2LRDA 2DQRA 2O8XA 3IH4A 3ABUA 4KICA 2XAUA 3BTCA 2HOEA 3GZNB 2K85A 2VJ4A 5TGTA 4D7NA 4UUSA 3GEZA 1XB4A 3KP5A 4FE4A 3I58A 2CGPA 1OR7A 5DD4A 2LLKA 3NQOA 3WGHA 3AG2H 4A3GJ 3OYKA 3CDHA 2X6YA 4O3MA 3ECHA 4BYYA 5LLQA 2YUSA 5FD6A 2XRLA 1QU3A 3GZ6A 2W48A 1MJ9A 3MMYB 3KZZA 2DFIA 1FIPA 3SZTA 2BZTA 5EGOB 1DU0A 2IS6A 2CSOA 1Z0XA 3RQIA 3GMEA 3CLQA 4CCMA 3I0TA 2BVLA 1FTZA 1N25A 2MC4A 4RLQA 3DXJF 3HOYJ 5FLMJ 3OYEA 1G2HA 1SMYF 3FF5A 3LA2A 1BIBA 1XCVA 2H6BA 3LSKA 1TWAJ 3I3LA 2W7NA 5E3OA 1USSA 2L7MP 2HOAA 1XDUA 4NB5A 1XSDA 1ZH5A 3BZCA 1CQTA 5D8KB 3U1KA 1TNSA 4WXDA 2PMHA 1OJLA 2VT2A 2RREA 1SFEA 2DA6A 2L0KA 3I55I 3MKWB 1RUOA 5CQGA 3BCBA 3EETA 2ZO4A 3ZMSA 4A3EJ 3DKWA 1X3WB 4DW6A 3T5XA 1VZ0A 4BBSJ 2VT3A 4BJTA 2OF7A 5F1RA 1QVTA 4DIQA 3RIRA 1WGXA 1RKTA 4XLNF 3RYRA 1WKMA 3IRQA 2STTA 2KPMA 3BZKA 2KQRA 2BE5F 1B72A 1ZLJA 3HKZA 1LUJB 1NH3A 1G8XA 4KMUX 2R7DA 1GLNA 4AVZA 1YFHA 2V6EA 4U88A 2MW8A 4PJ0C 1X2NA 5F64A 3S16J 3RZDJ 1FBUA 5J1RA 2ZXIA 3V7CA 1BM9A 4BXXJ 1VF9A 3CCMI 4IF4A 3WTXC 4Q47A 3MWMA 1O3SA 2DN0A 5FLVA 3HSFA 1OPCA 2VC1A 2XF7A 5F08A 4BNCA 3OV8A 4EATA 3FM3A 2NRAC 2X85A 4QIWN 2RNGA 4C30A 4DYRA 4ZYHA 5M3MJ 2VQCA 4KN7X 4NC8A 4RB2C 2EINH 2YX4A 2W84A 2VBZA 1HBXG 2BY3A 4E7IA 3M9AA 2C6YA 4HQMA 2LBFB 4ZDPA 2AHQA 2FD5A 2WA0A 4HF0A 1HKTA 3JAMK 1G3TA 5JVTA 1BI1A 1QHGA 2BY1A 4O5VA 2HGCA 3RTRA 1TW3A 4XSXF 1GDTA 5C4JJ 4P9FA 2IP2A 2FQ3A 3LSHA 4DBQA 1ACIA 2L5QA 1E3PA 4FISA 2M30A 3V42A 3CC4I 2M8GX 2Z5UA 4OINF 4HSRA 4BHPA 2BW3A 3VYSB 2BVMA 2GA1A 1U78A 3PO2J 5CVJA 6PAXA 4UVAA 4ZH4F 3WGIA 2KFDA 2H27A 4LB5A 2VUMJ 1X3UA 1ZN2A 3IWZA 5ILSA 5K1YA 3VEPA 5EGOA 1LJ9A 2E2IJ 2NVXJ 2ZNZA 2NAZA 3KYCB 1HW2A 1X58A 5IT9K 1MNMC 1OISA 3IUOA 2IGNA 3BG9A 2FE3A 2XIGA 5GAHJ 2GOXB 3CP2A 4BHCA 2NXNB 1WWXA 2OZ6A 5H6RA 1SEUA 3CCJI 1Y8QB 2M7BA 4A0ZA 2R7FA 1KQ0A 3F22A 1ZG5A 4S04A 3DBLB 4FE7A 2NS8A 3ZQCA 3OIQA 1XC5A 2JK3A 1MZBA 3BG7A 2Y0SN 5L3GA 2JA2A 3M8EA 3T0YA 1G4DA 4JBAA 3ZP5A 3DBHB 1W1WE 3I59B 4AUXA 1LFUP 3I9V2 4C2TA 2FQ4A 1W36D 1XG1A 2OBPA 4IQJA 4RB0A 1HCRA 3KE2A 4L0YB 4XLAA 4WCGA 2A6EF 4IRIA 1UELB 3A0HC 3FDYA 1W36C 1A35A 1ZHFA 5KVRA 3JRDA 3JRCA 4XKVA 3CO6C 2VQHA 4V2GA 5KNLA 2I8DA 4LK0F 3HSEA 5FKLA 2IEKA 1I39A 3TMOA 3E5QA 4BDZA 2CUFA 2PJPA 2DA2A 5TJJA 3TOBA 2CV1A 4R8HA 1LVKA
chains in the Genus database with same CATH topology
1MBGA 2VPRA 2R7ZJ 1JKOC 5FKKA 2HQ5A 1IJWC 3HDDA 2VKVA 4M3BA 3TP3A 1WI3A 5C3EJ 3IV5A 2TCTA 2EZLA 2LVSA 3D1NI 1SANA 3BG3A 1ZR4A 1JUSA 3FIWA 5F0FA 3E7LA 1MH4A 1EF4A 1MSEC 4MFDA 4I76A 1FTTA 4D5CA 2AO9A 1PUFB 2GBYA 3G1MA 2CQQA 2R5ZA 1H88C 3HOVJ 1GUUA 3LSPA 2NVQJ 4V2FA 5IYCJ 2JN6A 1F43A 1VFCA 3BQYA 3LSGA 4B3AA 2HXOA 1ETKA 3GTQJ 1RR7A 5F0CA 4A3FJ 3S17J 2R5ZB 1R9TJ 5IYBJ 1JJ6C 2ELKA 2Y31A 3S1QJ 1MBFA 4B4CA 3FK6A 3K7AJ 4G12A 3TW7A 1U8BA 1IC8A 3SJMA 1FEXA 5F27A 2HOTA 1JUMA 1Z77A 2M9HA 2JJ7A 3F0CA 3TW6A 2H8RA 1T33A 1MBHA 2LK2A 2L7FP 2DA3A 4Y7NJ 1RESA 3B6CA 4XK4A 4X6AJ 3RKQA 1NTCA 2EZKA 3LSJA 2FX0A 5M5YJ 1W0UA 4IEJA 4A93J 4ABZA 3WHCA 1MSFC 2ID6A 4M3GA 5FKMA 4IHYA 3MKLA 3I4NJ 1ZK8A 2ID3A 3H0GJ 2DMNA 5E3MA 3ZQHA 1AU7A 1BL0A 2KDZA 1OCTC 3GTLJ 2LD5A 4C2MJ 4CYCB 2X9DA 2M34A 3IH2A 1H89C 3CCYA 1APLC 2N8GA 4MO7A 3ZOBA 1QPIA 1VI0A 2EZIA 2E1OA 2NVTJ 1TWGJ 2EH3A 2QCOA 3JRIA 2NVYJ 2L7ZA 1IDZA 2GM4A 2MG4A 5C44J 2IBDA 1XS9A 2ME6A 3HOXJ 2R5YA 5IPAA 1IV6A 1LE8A 1ITYA 1HOMA 4IHWA 3JRGA 4EEFG 1A6IA 3UKGA 2JA5J 4BY7J 4A3CJ 5EG0A 1OFCX 2CJJA 3ZQFA 1Q1VA 2R92J 2DA5A 2R5YB 3JRBA 1VNDA 1LE8B 2ECBA 1QVUA 1IRZA 1ETXA 1D5YA 1HDDC 1S7EA 2E2JJ 2X6OA 4B1RA 2CU7A 4QTRA 4A3LJ 4S0HB 3LNQA 1OCPA 3W6VA 2FJ1A 3JR9A 2XGEA 1I50J 4XIDA 1BJZA 5JLXA 3ZQIA 5EEAA 1UG2A 2E19A 3BG5A 4XRSA 1IDYA 4I6ZA 3GTMJ 1LFBA 5EDNA 3M4OJ 4BKXA 2M0CA 3HB9A 3GTOJ 3TEDA 1K61A 2VKEA 1PUFA 1NK3P 4A3DJ 4MFEA 1A5JA 3OIOA 3DEWA 5K7HA 4FTHA 3BR2A 4W97A 3WHBA 2K9QA 1JKQC 4XRMA 5IOYA 1JUPA 4A3BJ 1IGNA 5M3FJ 3OSFA 3Q0UA 3PM1A 2XPVA 5IP6A 1H8AC 4AC0A 3HOZJ 1ENHA 3ZQLA 4QIWN 1RETA 3HGYA 3JREA 1ZR2A 2JMWA 3SDGA 3O8HA 1JT0A 3RZOJ 3SFIA 1ETVA 2XPUA 2DMPA 4D7MA 1WH7A 5IYDJ 4XRSG 1JKRC 9ANTA 2EBIA 2O8KA 3L1PA 2Y2ZA 2DA1A 3BR0A 1JTYA 4XICA 2QF7A 4IHXA 4AYBN 2WB1N 4LOCA 2LY9A 3PO3J 3S2DJ 4DZPA 1GV5A 5E3LA 4DYCA 1MH3A 5EZGA 3G1LA 2G0EA 2JA8J 4JP0A 4A3KJ 4CYCA 2Y9ZA 2XGCA 1O4XA 3O8GA 3Q0WA 5EF6A 5K7ZA 2JWTA 2YS9A 3JRFA 1JKPC 1UHSA 1W0TA 2COBA 3C2BA 4X1EA 1ZKGA 1UMQA 2XB5A 2Y30A 3IH3A 3QPLA 4C3JJ 3JRHA 2LP0A 3FK7A 1AHDP 4A3JJ 2K9SA 3IH4A 1IG7A 4M3DA 1DU6A 1AKHA 3BTCA 4A3IJ 1ETQA 4D7NA 4UUSA 4FE4A 4BY1J 2HXIA 1U9OA 2LLKA 4MLOA 3S15J 2XB0X 2O9LA 1E3OC 4A3GJ 1ORKA 2DMTA 2YUSA 2NOGA 2XRLA 1AKHB 2W48A 3GBGA 3K2AA 2JA6J 3CQZJ 1FIPA 2DMQA 4UUSB 2LTPA 2K9NA 2KT0A 4W1UA 5EGOB 1DU0A 5DS9A 4JX4A 1FJLA 1Z0XA 3RQIA 3H3VK 3CMYA 2LR8A 1FTZA 1U9NA 4DZJA 2R93J 1I6HJ 3BR3A 3HOYJ 5FLMJ 1G2HA 4A3MJ 2CUEA 5EYRA 3VPRA 2CRGA 2DA4A 1TWAJ 2RAEA 4JX6A 1MBEA 2VI6A 2DJNA 5E3OA 2HOSA 2L7MP 2HOAA 2DMUA 4BBRJ 2HDDA 3BTJA 1CQTA 2OPTA 1TC3C 1OJLA 1YRNA 3B6AA 2P81A 1FIAA 2DA6A 2L0KA 1BW6A 1TWHJ 3HBLA 3S2HJ 4A3EJ 1Y1VJ 2MGQA 3GTJJ 2M2EA 2EQRA 4DW6A 1K83J 5F0HA 4BBSJ 3HM5A 1YRNB 2HI3A 2OF7A 1WCMJ 1QVTA 1P7IA 1RKTA 1WGXA 3LSRA 2IAIA 4HNVA 1HDPA 4DYQA 1B72A 5HODA 5K7FA 4RBOA 4D5FA 1ETYA 2E2HJ 4GFBA 3A02A 3QQAA 2MW8A 3BQZA 5FKNA 3BR5A 1X2NA 3S16J 3NARA 5FJ8J 3RZDJ 5J1YA 1NK2P 5J1RA 5F04A 1B72B 1JJ8C 4BXXJ 1VF9A 5IOZA 5BNGA 2DN0A 1B8IB 2YU9J 5FLVA 3GTKJ 1SFOJ 3A01A 2XPWA 1HF0A 3GTPJ 2B63J 5F08A 4M3FA 5EZHA 3TP0A 1P7JA 1RKWA 2DA7A 2GLOA 1T56A 4DYRA 2ZB9A 5M3MJ 1ZQ3P 2MSYA 3Q0VA 3HKZN 3S14J 3G1OA 3A01B 3BR6A 1GV2A 2PMZN 2Y9YA 5F1JA 4IHVA 3MN2A 2AHQA 2FD5A 1X2MA 4MIMA 4Y52J 1GVDA 4RDUA 5M5WJ 1QRYA 3MVPA 4C3HJ 1GDTA 2L9RA 4UUTA 3BT9A 5C4JJ 3FISA 5J1UA 5IP7J 2CQXA 3BTIA 4C3IJ 3OOUA 4FISA 1ETOA 5DTDA 2M8GX 4M6VA 3PO2J 2DTZA 2I10A 1U78A 1POGA 2XGDA 2LFBA 2VUMJ 5M5XJ 2E2IJ 4JYKA 5EGOA 2D5VA 2NVXJ 1BW5A 3GTGJ 3OSGA 4NDLA 4J19A 1X58A 5C4XJ 1MNMC 3CDLA 2ECCA 1BA5A 2WAQN 3A03A 3BG9A 5JLWA 2XSDC 1I3QJ 1WPKA 1JGGA 4FCYA 1WH5A 2NS7A 5J3LA 4JX5A 3S1RJ 3I4MJ 4M3EA 3LOCA 3BTLA 4FE7A 2NS8A 3ZQCA 5GPCA 3HEFA 1XC5A 2JK3A 4A69C 1ETWA 2JA7J 2HYJA 1F36A 2EZHA 2Y0SN 5GP9A 5GPAA 1HLVA 3JRAA 3ZQGA 3HGGA 4AUXA 1LFUP 2TRTA 3M3YJ 3FKIJ 2FQ4A 1JTXA 5IP9J 5E3NA 1XG1A 3Q3SA 1TWCJ 2O7OA 1ZTRA 3NAUA 1JT6A 2X48A 1HCRA 1Y1WJ 3QPSA 1GT0C 4L5EA 2H1KA 2ME0A 1TWFJ 3HOWJ 3DCFA 1RPWA 3JRDA 3JRCA 2R0QC 4QSHA 2LKXA 2WV1A 3S1MJ 1MBKA 4V2GA 5EG0B 3HOUJ 3S1NJ 1IUFA 1MBJA 2K40A 3BR1A 2IEKA 5FKLA 2CUFA 1B8IA 2DA2A 1ZGWA 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBG A;  2VPR A;  2R7Z J;  1JKO C;  5FKK A;  2HQ5 A;  1IJW C;  3HDD A;  2VKV A;  4M3B A;  3TP3 A;  1WI3 A;  5C3E J;  3IV5 A;  2TCT A;  2EZL A;  2LVS A;  3D1N I;  1SAN A;  3BG3 A;  1ZR4 A;  1JUS A;  3FIW A;  5F0F A;  3E7L A;  1MH4 A;  1EF4 A;  1MSE C;  4MFD A;  4I76 A;  1FTT A;  4D5C A;  2AO9 A;  1PUF B;  2GBY A;  3G1M A;  2CQQ A;  2R5Z A;  1H88 C;  3HOV J;  1GUU A;  3LSP A;  2NVQ J;  4V2F A;  5IYC J;  2JN6 A;  1F43 A;  1VFC A;  3BQY A;  3LSG A;  4B3A A;  2HXO A;  1ETK A;  3GTQ J;  1RR7 A;  5F0C A;  4A3F J;  3S17 J;  2R5Z B;  1R9T J;  5IYB J;  1JJ6 C;  2ELK A;  2Y31 A;  3S1Q J;  1MBF A;  4B4C A;  3FK6 A;  3K7A J;  4G12 A;  3TW7 A;  1U8B A;  1IC8 A;  3SJM A;  1FEX A;  5F27 A;  2HOT A;  1JUM A;  1Z77 A;  2M9H A;  2JJ7 A;  3F0C A;  3TW6 A;  2H8R A;  1T33 A;  1MBH A;  2LK2 A;  2L7F P;  2DA3 A;  4Y7N J;  1RES A;  3B6C A;  4XK4 A;  4X6A J;  3RKQ A;  1NTC A;  2EZK A;  3LSJ A;  2FX0 A;  5M5Y J;  1W0U A;  4IEJ A;  4A93 J;  4ABZ A;  3WHC A;  1MSF C;  2ID6 A;  4M3G A;  5FKM A;  4IHY A;  3MKL A;  3I4N J;  1ZK8 A;  2ID3 A;  3H0G J;  2DMN A;  5E3M A;  3ZQH A;  1AU7 A;  1BL0 A;  2KDZ A;  1OCT C;  3GTL J;  2LD5 A;  4C2M J;  4CYC B;  2X9D A;  2M34 A;  3IH2 A;  1H89 C;  3CCY A;  1APL C;  2N8G A;  4MO7 A;  3ZOB A;  1QPI A;  1VI0 A;  2EZI A;  2E1O A;  2NVT J;  1TWG J;  2EH3 A;  2QCO A;  3JRI A;  2NVY J;  2L7Z A;  1IDZ A;  2GM4 A;  2MG4 A;  5C44 J;  2IBD A;  1XS9 A;  2ME6 A;  3HOX J;  2R5Y A;  5IPA A;  1IV6 A;  1LE8 A;  1ITY A;  1HOM A;  4IHW A;  3JRG A;  4EEF G;  1A6I A;  3UKG A;  2JA5 J;  4BY7 J;  4A3C J;  5EG0 A;  1OFC X;  2CJJ A;  3ZQF A;  1Q1V A;  2R92 J;  2DA5 A;  2R5Y B;  3JRB A;  1VND A;  1LE8 B;  2ECB A;  1QVU A;  1IRZ A;  1ETX A;  1D5Y A;  1HDD C;  1S7E A;  2E2J J;  2X6O A;  4B1R A;  2CU7 A;  4QTR A;  4A3L J;  4S0H B;  3LNQ A;  1OCP A;  3W6V A;  2FJ1 A;  3JR9 A;  2XGE A;  1I50 J;  4XID A;  1BJZ A;  5JLX A;  3ZQI A;  5EEA A;  1UG2 A;  2E19 A;  3BG5 A;  4XRS A;  1IDY A;  4I6Z A;  3GTM J;  1LFB A;  5EDN A;  3M4O J;  4BKX A;  2M0C A;  3HB9 A;  3GTO J;  3TED A;  1K61 A;  2VKE A;  1PUF A;  1NK3 P;  4A3D J;  4MFE A;  1A5J A;  3OIO A;  3DEW A;  5K7H A;  4FTH A;  3BR2 A;  4W97 A;  3WHB A;  2K9Q A;  1JKQ C;  4XRM A;  5IOY A;  1JUP A;  4A3B J;  1IGN A;  5M3F J;  3OSF A;  3Q0U A;  3PM1 A;  2XPV A;  5IP6 A;  1H8A C;  4AC0 A;  3HOZ J;  1ENH A;  3ZQL A;  4QIW N;  1RET A;  3HGY A;  3JRE A;  1ZR2 A;  2JMW A;  3SDG A;  3O8H A;  1JT0 A;  3RZO J;  3SFI A;  1ETV A;  2XPU A;  2DMP A;  4D7M A;  1WH7 A;  5IYD J;  4XRS G;  1JKR C;  9ANT A;  2EBI A;  2O8K A;  3L1P A;  2Y2Z A;  2DA1 A;  3BR0 A;  1JTY A;  4XIC A;  2QF7 A;  4IHX A;  4AYB N;  2WB1 N;  4LOC A;  2LY9 A;  3PO3 J;  3S2D J;  4DZP A;  1GV5 A;  5E3L A;  4DYC A;  1MH3 A;  5EZG A;  3G1L A;  2G0E A;  2JA8 J;  4JP0 A;  4A3K J;  4CYC A;  2Y9Z A;  2XGC A;  1O4X A;  3O8G A;  3Q0W A;  5EF6 A;  5K7Z A;  2JWT A;  2YS9 A;  3JRF A;  1JKP C;  1UHS A;  1W0T A;  2COB A;  3C2B A;  4X1E A;  1ZKG A;  1UMQ A;  2XB5 A;  2Y30 A;  3IH3 A;  3QPL A;  4C3J J;  3JRH A;  2LP0 A;  3FK7 A;  1AHD P;  4A3J J;  2K9S A;  3IH4 A;  1IG7 A;  4M3D A;  1DU6 A;  1AKH A;  3BTC A;  4A3I J;  1ETQ A;  4D7N A;  4UUS A;  4FE4 A;  4BY1 J;  2HXI A;  1U9O A;  2LLK A;  4MLO A;  3S15 J;  2XB0 X;  2O9L A;  1E3O C;  4A3G J;  1ORK A;  2DMT A;  2YUS A;  2NOG A;  2XRL A;  1AKH B;  2W48 A;  3GBG A;  3K2A A;  2JA6 J;  3CQZ J;  1FIP A;  2DMQ A;  4UUS B;  2LTP A;  2K9N A;  2KT0 A;  4W1U A;  5EGO B;  1DU0 A;  5DS9 A;  4JX4 A;  1FJL A;  1Z0X A;  3RQI A;  3H3V K;  3CMY A;  2LR8 A;  1FTZ A;  1U9N A;  4DZJ A;  2R93 J;  1I6H J;  3BR3 A;  3HOY J;  5FLM J;  1G2H A;  4A3M J;  2CUE A;  5EYR A;  3VPR A;  2CRG A;  2DA4 A;  1TWA J;  2RAE A;  4JX6 A;  1MBE A;  2VI6 A;  2DJN A;  5E3O A;  2HOS A;  2L7M P;  2HOA A;  2DMU A;  4BBR J;  2HDD A;  3BTJ A;  1CQT A;  2OPT A;  1TC3 C;  1OJL A;  1YRN A;  3B6A A;  2P81 A;  1FIA A;  2DA6 A;  2L0K A;  1BW6 A;  1TWH J;  3HBL A;  3S2H J;  4A3E J;  1Y1V J;  2MGQ A;  3GTJ J;  2M2E A;  2EQR A;  4DW6 A;  1K83 J;  5F0H A;  4BBS J;  3HM5 A;  1YRN B;  2HI3 A;  2OF7 A;  1WCM J;  1QVT A;  1P7I A;  1RKT A;  1WGX A;  3LSR A;  2IAI A;  4HNV A;  1HDP A;  4DYQ A;  1B72 A;  5HOD A;  5K7F A;  4RBO A;  4D5F A;  1ETY A;  2E2H J;  4GFB A;  3A02 A;  3QQA A;  2MW8 A;  3BQZ A;  5FKN A;  3BR5 A;  1X2N A;  3S16 J;  3NAR A;  5FJ8 J;  3RZD J;  5J1Y A;  1NK2 P;  5J1R A;  5F04 A;  1B72 B;  1JJ8 C;  4BXX J;  1VF9 A;  5IOZ A;  5BNG A;  2DN0 A;  1B8I B;  2YU9 J;  5FLV A;  3GTK J;  1SFO J;  3A01 A;  2XPW A;  1HF0 A;  3GTP J;  2B63 J;  5F08 A;  4M3F A;  5EZH A;  3TP0 A;  1P7J A;  1RKW A;  2DA7 A;  2GLO A;  1T56 A;  4DYR A;  2ZB9 A;  5M3M J;  1ZQ3 P;  2MSY A;  3Q0V A;  3HKZ N;  3S14 J;  3G1O A;  3A01 B;  3BR6 A;  1GV2 A;  2PMZ N;  2Y9Y A;  5F1J A;  4IHV A;  3MN2 A;  2AHQ A;  2FD5 A;  1X2M A;  4MIM A;  4Y52 J;  1GVD A;  4RDU A;  5M5W J;  1QRY A;  3MVP A;  4C3H J;  1GDT A;  2L9R A;  4UUT A;  3BT9 A;  5C4J J;  3FIS A;  5J1U A;  5IP7 J;  2CQX A;  3BTI A;  4C3I J;  3OOU A;  4FIS A;  1ETO A;  5DTD A;  2M8G X;  4M6V A;  3PO2 J;  2DTZ A;  2I10 A;  1U78 A;  1POG A;  2XGD A;  2LFB A;  2VUM J;  5M5X J;  2E2I J;  4JYK A;  5EGO A;  2D5V A;  2NVX J;  1BW5 A;  3GTG J;  3OSG A;  4NDL A;  4J19 A;  1X58 A;  5C4X J;  1MNM C;  3CDL A;  2ECC A;  1BA5 A;  2WAQ N;  3A03 A;  3BG9 A;  5JLW A;  2XSD C;  1I3Q J;  1WPK A;  1JGG A;  4FCY A;  1WH5 A;  2NS7 A;  5J3L A;  4JX5 A;  3S1R J;  3I4M J;  4M3E A;  3LOC A;  3BTL A;  4FE7 A;  2NS8 A;  3ZQC A;  5GPC A;  3HEF A;  1XC5 A;  2JK3 A;  4A69 C;  1ETW A;  2JA7 J;  2HYJ A;  1F36 A;  2EZH A;  2Y0S N;  5GP9 A;  5GPA A;  1HLV A;  3JRA A;  3ZQG A;  3HGG A;  4AUX A;  1LFU P;  2TRT A;  3M3Y J;  3FKI J;  2FQ4 A;  1JTX A;  5IP9 J;  5E3N A;  1XG1 A;  3Q3S A;  1TWC J;  2O7O A;  1ZTR A;  3NAU A;  1JT6 A;  2X48 A;  1HCR A;  1Y1W J;  3QPS A;  1GT0 C;  4L5E A;  2H1K A;  2ME0 A;  1TWF J;  3HOW J;  3DCF A;  1RPW A;  3JRD A;  3JRC A;  2R0Q C;  4QSH A;  2LKX A;  2WV1 A;  3S1M J;  1MBK A;  4V2G A;  5EG0 B;  3HOU J;  3S1N J;  1IUF A;  1MBJ A;  2K40 A;  3BR1 A;  2IEK A;  5FKL A;  2CUF A;  1B8I A;  2DA2 A;  1ZGW A;  5FKO A; 
#chains in the Genus database with same CATH topology
 2VPR A;  2ZJP F;  1F4K A;  4BH9 A;  4M3B A;  1LDD A;  1X1D A;  2TCT A;  3S3M A;  3CZ6 A;  2EZL A;  5CPR B;  5HOO A;  2ETH A;  3FIW A;  1RNL A;  1MGT A;  2KIS A;  5E1W A;  2JUC A;  1FOW A;  4MFD A;  1FTT A;  4D5C A;  4F93 B;  2IA0 A;  3K4C A;  2GBY A;  2PG4 A;  2GQQ A;  3RPQ A;  2R5Z A;  3OYM A;  3LSP A;  2K9M A;  2O3F A;  2NVQ J;  2IVM A;  2JN6 A;  3PQK A;  2ELJ A;  4EJU A;  2Y48 A;  1I27 A;  1MDM B;  2BBY A;  1JJ6 C;  2A5Y B;  3H1C A;  3S1Q J;  1MBF A;  4HNU A;  3K7A J;  4G12 A;  2JVH A;  2KLO A;  1FMV A;  4BXF A;  5D5W B;  3S93 A;  1DGW Y;  2JJ7 A;  3WU2 C;  2JZY A;  3H5R A;  1T33 A;  2W82 A;  4B47 A;  3J7A O;  1RES A;  3W2W A;  3E3V A;  3DBR B;  2XRO A;  5J4V A;  1X19 A;  3RPU D;  2LKS A;  1QNT A;  3L09 A;  4ABZ A;  2P4W A;  2XRN A;  1BI0 A;  3K10 A;  3MKL A;  2FXA A;  2MD0 A;  3H5N A;  2HR3 A;  3LST A;  1JGS A;  2DMN A;  2M1B A;  3H0G J;  1FX7 A;  2FRH A;  5E3M A;  1J59 A;  3S3N A;  1VQN I;  1WQ2 A;  3HC7 A;  1E0E A;  3S8P A;  2EB7 A;  2H1L A;  2K7L A;  2LD5 A;  2KRH A;  4C2M J;  5KAF C;  4N9H A;  1OCC H;  2XDV A;  4L9N A;  4ZZL A;  4LIU A;  2JRM A;  4CDG A;  5JR3 A;  3CCY A;  1R71 A;  1G59 A;  4OMZ A;  2MAB A;  3MFK A;  1QQI A;  4ENK A;  1MMD A;  3F6V A;  3AL0 C;  4DQ2 A;  4RB3 C;  4RGR A;  3JW4 A;  2EZI A;  1GXP A;  4ZYD A;  3I59 A;  1QPM A;  1TWG J;  3DPT A;  3BPX A;  2ZSH B;  3V8J A;  3B02 A;  2CW7 A;  2M87 A;  4RB1 A;  4BJ5 C;  3JRI A;  5J4Y A;  1X1P A;  3JSP A;  2GM4 A;  2MG4 A;  4NHJ A;  1WJA A;  2K5C A;  3W2V A;  2EA2 A;  2K02 A;  2ME6 A;  2VPL A;  4E70 A;  1IV6 A;  2FBH A;  4CCO A;  2WWY A;  3VOD A;  2ACJ A;  4EEF G;  3S3O A;  2HZD A;  5LGT A;  3HRS A;  5L3E A;  5LD2 C;  3CLO A;  1X1A A;  1SC7 A;  1OFC X;  4RM3 A;  5CJ9 A;  3ZQF A;  1Q1V A;  3OL3 A;  1DUX C;  3V7S A;  2R92 J;  1VND A;  1LE8 B;  3EQL F;  2BHY A;  3M1C A;  2WBM A;  1ETX A;  2DYR H;  1ZG3 A;  3ULQ B;  2E2J J;  2X6O A;  1R1T A;  4MNU A;  5JHF A;  1OCP A;  2CW8 A;  2FJ1 A;  4HA8 A;  3HUG B;  1G6N A;  5HS8 A;  3FXL A;  4HLY A;  1E17 A;  4I0A A;  4XID A;  3JTG A;  1BJZ A;  1AA7 A;  4HPQ A;  3M1E A;  3HOT A;  3SFZ A;  4FX0 A;  2E19 A;  1YW8 A;  2VXD A;  3VSL A;  1ULY A;  3R0J A;  4JOM A;  3GTM J;  2K4B A;  3M4O J;  2HS5 A;  3DWL E;  4YEJ A;  4ZYE A;  5CVR A;  2B7E A;  4BXU A;  4M73 A;  1W7P D;  1LDK B;  3QYB A;  1K61 A;  1IRX A;  4A3D J;  3U9G A;  3N97 A;  2XAG A;  1FT9 A;  4W97 A;  2K9Q A;  3F9K A;  1JUP A;  5ERI A;  4A3B J;  3JCU C;  2AXL A;  3K1M A;  2ELH A;  4CXF A;  3GX4 X;  1MKM A;  3G73 A;  3HTU A;  3PM1 A;  4AIH A;  1H9G A;  4AIK A;  4ZTJ A;  1MDM A;  4WX9 A;  1Y0U A;  1VQP I;  3PFY A;  1DPR A;  1FBQ A;  5J47 A;  2JSP A;  2NNY A;  3HGY A;  3X2Q H;  1Z7U A;  1B1B A;  2QEX I;  2ZFU A;  2VQG A;  2DMP A;  4N4O B;  4D7M A;  1MW7 A;  3H35 A;  1R5G A;  5EEH A;  4QPQ A;  2O8K A;  3L1P A;  4BQQ A;  2OJE D;  2QKL B;  3KYL A;  4RAY A;  4ZZD A;  4XIC A;  3L9F A;  3AL0 B;  2QQB A;  3HG9 A;  4PFO A;  4N4N B;  3J81 K;  2WB1 N;  2CV2 A;  1D1B A;  4OOI A;  2LY9 A;  3S2D J;  2Z33 A;  1OCZ H;  4DZP A;  1JHF A;  4U0W A;  5E3L A;  2F6C A;  2A6H F;  1MH3 A;  4D9J A;  2JA8 J;  3G6E I;  2Q2E B;  3QOD A;  2V1D A;  1LKX A;  3BJO A;  1BBY A;  1WI9 A;  3WU0 A;  5LRR A;  2XGC A;  1EH7 A;  1WFX A;  2VBW A;  3O8G A;  2B0L A;  2JUG A;  2YS9 A;  4PK4 A;  3GW2 A;  1JKP C;  4A6E A;  2VQL A;  3RKW A;  4UUV A;  3P9C A;  4CZZ A;  2WAQ A;  3D5S C;  1B9N A;  1R00 A;  3HZJ A;  3VB2 A;  3WE2 A;  1TQM A;  3QPL A;  4YEL A;  4PSW A;  2OCC H;  3V4G A;  3W2A A;  4G7O F;  3FK7 A;  1T39 A;  5HDN A;  4UB8 C;  1T95 A;  3CCL I;  4M3D A;  2CO5 A;  3ZMZ A;  3GUD A;  2JPB A;  1T98 A;  2ZBK A;  2Z3Y A;  1X3Z B;  3R61 A;  1PUE E;  5FO5 A;  1VQM I;  5D5V B;  4HG2 A;  2V4J C;  4YRV A;  4UV8 A;  4MLO A;  3S15 J;  2AXT C;  2XB0 X;  2O9L A;  1E3O C;  2Q0O A;  3J80 K;  2W25 A;  4X0G A;  4PGG A;  1TT0 A;  4BQO A;  3GBG A;  5LRS A;  3K2A A;  3H0D A;  5FRM A;  2FBK A;  2HEO A;  1EH8 A;  2R7O A;  1SMT A;  2DMQ A;  4UUS B;  4CGZ A;  2LTP A;  5DS9 A;  2Z16 A;  1FJL A;  5TIS C;  1BN5 A;  2KP6 A;  3K2Z A;  3ONQ A;  3CMY A;  1B59 A;  1OLT A;  2RDP A;  5EEG A;  3BR3 A;  2AQF A;  1IUY A;  5EYR A;  2PFB A;  4QWQ A;  2VI6 A;  1R5I D;  2DJI A;  3MKY B;  2J5O A;  1S7A A;  2HOS A;  4LJZ F;  5B66 C;  3L2W A;  2DMU A;  2KRF A;  1ON1 A;  3LMM A;  1Z05 A;  3E6D A;  3MQ0 A;  1TC3 C;  1X1C A;  4MHG A;  1YRN A;  3B6A A;  3H5A A;  2LDU A;  4ASN A;  1SD5 A;  1Z7L A;  2DU9 A;  1TWH J;  2QVO A;  4IO9 F;  1R7J A;  4M6Y A;  3GZ5 A;  3GTJ J;  2RN7 A;  2OTJ I;  2EQR A;  3BJ6 A;  3FHZ A;  2HZT A;  1K83 J;  2ISZ A;  1Z3X A;  4IX7 A;  5J40 A;  2HI3 A;  4BS9 A;  3L2U A;  3MEX A;  3AKZ A;  4IVN A;  1P7I A;  4FT8 A;  4U7B A;  3H9J A;  2DBB A;  3RPU A;  3LSR A;  1RI7 A;  3OS1 A;  4HNV A;  2MD5 A;  2P8T A;  2MC3 A;  1ODD A;  3ABL H;  2QA4 I;  4DJA A;  5HOD A;  2KRC A;  5K7F A;  3V8K A;  4A5N A;  5K5O A;  2E2H J;  1D0Z A;  2DT7 B;  2A05 A;  3IP4 B;  3QQA A;  1BI3 A;  3BQZ A;  3TO6 A;  5CKT A;  5FKN A;  2PMZ A;  3NAR A;  1UZC A;  2E36 A;  3PUB A;  5J1Y A;  1KU3 A;  3QYE A;  3G4S I;  1B72 B;  3OS2 A;  1S3J A;  4LLL A;  2EJR A;  4EV0 A;  5ICC A;  1YIJ I;  2XAH A;  1SFO J;  4L18 B;  1HF0 A;  3VSK A;  3GTP J;  2EV0 A;  4H0E A;  2HQA A;  3TP0 A;  1RKW A;  5DEQ A;  3CJT B;  2ZB9 A;  3NEU A;  4ZC3 A;  3VOE A;  4OU0 A;  1ZLK A;  3E5U A;  3Q0V A;  2K3F A;  2XAQ A;  2JVG A;  2F5E A;  3HKZ N;  4U0V A;  2EIJ H;  1ZG1 A;  1T08 B;  4OMY A;  3ZXS A;  3BDD A;  1XTA A;  4OIR F;  3DQV C;  1GV2 A;  3QP6 A;  4RGU A;  1IN6 A;  4I09 A;  4IL6 C;  4HW0 A;  5F1J A;  4LG3 A;  3PSF A;  4PDK A;  1STZ A;  1UHM A;  3WU1 B;  1V5E A;  2XGX A;  1IXC A;  1WJ5 A;  4LGW A;  1U6G A;  1V54 H;  3ZN1 A;  4Y52 J;  1R1V A;  4XKB A;  2DCE A;  3OR1 C;  4RDU A;  4J00 A;  2LY2 A;  1LEA A;  1TP4 A;  3F8N A;  4XM3 A;  1I1S A;  2L2O A;  1FLI A;  5TRD A;  4C3I J;  4HNT A;  2VL8 A;  1EV7 A;  4BE2 A;  3OYC A;  4M6V A;  1P9Q C;  2RVC A;  2L9V A;  4A0Y A;  3JSO A;  2FNA A;  4CH7 A;  3ELK A;  2I10 A;  3ZN0 A;  4F3Q A;  2G9W A;  4XLE A;  3F72 A;  3PSI A;  1IRF A;  3TO7 A;  1J5Y A;  2LF8 A;  2D5V A;  3GTG J;  2VLA A;  5LHH A;  4UVB A;  2QYO A;  3DPL C;  3CME I;  4HBL A;  4KIG A;  3V7R A;  4J19 A;  2BW3 B;  5C4X J;  1XGN A;  1YLF A;  3E6B A;  3DU5 A;  1IV8 A;  4KYW A;  1ZRF A;  4IOA F;  2X1C A;  1YOV B;  2KJB A;  1BA5 A;  3VWB A;  2VC0 A;  1W7P A;  1VQ9 I;  1FSH A;  4HST A;  1KA8 A;  3ESW B;  2QM3 A;  3D5R C;  1D0Y A;  1WPK A;  2HVQ A;  1OMI A;  1J7K A;  4CYD A;  1HQC A;  4JX5 A;  3S1R J;  1K7A A;  3F8M A;  3CJN A;  3BTL A;  3PQJ A;  2VKH A;  2JQ7 A;  2DTR A;  1J9I A;  3F3X A;  1RIO H;  1YX3 A;  2G7H A;  3OL4 A;  2UXX A;  1ETW A;  1ZYR F;  3IAM 2;  3BLY A;  2HVS A;  3ABM H;  3PJR A;  2XKP A;  4KA4 A;  3S32 A;  3I64 A;  3ZQG A;  1ZRD A;  2DO7 A;  1KON A;  2Y0M A;  2X1D A;  4NC6 A;  4AVP A;  3FKI J;  2MH9 A;  1WRJ A;  5E3N A;  1BOB A;  3Q3S A;  2O7O A;  1ZTR A;  5GAD J;  5IY5 H;  3BG6 A;  3L00 A;  4CCN A;  2LKP A;  4HX7 A;  1GT0 C;  4IXA A;  1Z9C A;  1KQ9 A;  4L5E A;  4B8X A;  3U21 A;  3H3Z A;  1TWF J;  3HOW J;  3ABT A;  2YX7 A;  2KJC A;  2IGO A;  3F8F A;  4M74 A;  3GLL A;  3NWS A;  2LKX A;  4L9J A;  1CF7 A;  3OYD A;  3WTU C;  5E1X A;  3HPH A;  5EG0 B;  2O61 A;  3K0L A;  5DD8 A;  5J8C A;  3S1N J;  1O57 A;  3C7J A;  1BJA A;  3BR1 A;  1LB2 A;  1MMS A;  5A2Q Z;  2HVR A;  1V55 H;  3M7G A;  3FXQ A;  1MBG A;  2R7Z J;  4I01 A;  3Q9V A;  3K1P A;  2HKX A;  5FKK A;  3R6S A;  1IJW C;  3WTS C;  4LLN A;  2F4O B;  3CES A;  3LA3 A;  3TOA A;  2QKM B;  2K86 A;  2PJR A;  1FC3 A;  3T8T A;  3BCA A;  3I54 A;  2EK5 A;  2VXZ A;  2LNB A;  3D1N I;  3BG3 A;  1ZR4 A;  3AG3 H;  4U87 A;  2BY0 A;  1J0R A;  3IC7 A;  4I76 A;  1R36 A;  2FBI A;  2L3D A;  2IA1 A;  3H9G A;  1FOY A;  5D5X B;  1PUF B;  3RQ4 A;  3OOP A;  2I5U A;  3E6M A;  2CQQ A;  3ECO A;  1H88 C;  3HOV J;  1FNN A;  4IZZ A;  1W5T A;  5IYC J;  1F43 A;  5L3C A;  3HRM A;  2LG4 A;  2JSC A;  3CC7 I;  3KET A;  2CMP A;  4A12 A;  5HS7 A;  5HLG A;  4AID A;  1NHA A;  3KLO A;  3GTQ J;  1RR7 A;  3BJA A;  2A07 F;  3FHN A;  3S17 J;  2R5Z B;  5IYB J;  3K69 A;  2ELK A;  2Y31 A;  1VQO I;  3MZH A;  4B4C A;  1H9T A;  3SJM A;  1Z77 A;  5DV5 A;  3TW6 A;  4KDP A;  3DF8 A;  2P7C B;  1WJE A;  2A68 F;  2L7F P;  1BI2 A;  3ZCO A;  1WVR A;  2CUZ A;  1O3T A;  2EZK A;  3C2H A;  4XSZ F;  4R79 A;  1YG2 A;  5M5Y J;  4G6Q A;  1W0U A;  2IXS A;  1VQ6 I;  3CF5 F;  2Y69 H;  2ID6 A;  4M3G A;  3E6C C;  4IHY A;  3SEQ A;  4KMF A;  4ANJ A;  4KT6 A;  2Z1D A;  1ZK8 A;  3WGG A;  2V26 A;  2VJJ A;  4XMY A;  4G7H F;  2KDZ A;  1OCT C;  5ICF A;  3CC2 I;  4PGH A;  1TBX A;  2FOW A;  2WTE A;  3SQN A;  4GXO A;  5AIQ A;  1V5F A;  5LHG A;  1O7F A;  4XLP F;  2EIK H;  4CYC B;  1UCR A;  2X9D A;  2M34 A;  3AAF A;  3CJQ B;  1GVJ A;  1G3W A;  2BOL A;  2HQR A;  3ERM A;  4QLC U;  2VOP A;  3ZGK A;  1T0F C;  4MO7 A;  1RC9 A;  4LD5 A;  1LDJ A;  1VI0 A;  1UJ8 A;  4LB6 B;  2PLY A;  4Y33 A;  4L0Z B;  2V9K A;  1IDZ A;  2L7K A;  1QZY A;  3R4K A;  2VE9 A;  2VIX A;  4EJT A;  2M3A A;  3HPG A;  5LGU A;  1XS9 A;  2OD5 A;  1W5C C;  3HHG A;  1ITY A;  2G7U A;  3GFJ A;  2V6C A;  2JA5 J;  2HYG D;  5EG0 A;  5FRN A;  2R7U A;  3JRB A;  2ESN A;  4IHS A;  1U5T C;  3C2G A;  4M71 A;  1IRZ A;  2GIV A;  3KP7 A;  1D5Y A;  2CWE A;  1OYW A;  2ZKZ A;  3QYF A;  5ED4 A;  4BQN A;  4B1R A;  5E17 F;  3OYB A;  3KP3 A;  4GGG A;  4D0P A;  1DGR M;  3JR9 A;  1JI8 A;  1WJD A;  1ON2 A;  3EUH C;  5L3D A;  5JLX A;  1T38 A;  4S05 A;  3KEO A;  3LFK A;  3T1B A;  4E7Z A;  2P6T A;  4ZDL A;  5B5E C;  1WJF A;  1LFB A;  2EFQ A;  4PJL A;  4RMN A;  4XOP A;  1OCR H;  1F5T A;  2QBY A;  1T8I A;  3HRU A;  3MZY A;  4CSW A;  5DYM A;  2M0C A;  2V79 A;  2RV8 A;  3GTO J;  4EMS A;  5E18 F;  3OS0 A;  2VKE A;  4UHT A;  1PUF A;  4RS8 A;  1NK3 P;  2IS1 A;  1ONV A;  2DYS H;  5GAE J;  3DLA A;  4ZDO A;  3OIO A;  3DEW A;  4PFP A;  5K7H A;  1KGS A;  3FXK A;  3PNV A;  3BR2 A;  4Y3O A;  1ZRE A;  2DT6 A;  1BIA A;  3L7W A;  4YG2 F;  2Z9O A;  2Z2S B;  2ZME C;  4ITV A;  5M3F J;  1WJC A;  3OSF A;  4I02 A;  2XPV A;  3LQR A;  2BEO A;  1EA3 A;  3GCM A;  4AC0 A;  4CHU A;  1Y0N A;  2K4J A;  3C1D A;  4ZYG A;  1XN7 A;  1ENH A;  1L0O C;  2HTS A;  3JRE A;  3RZO J;  2JMW A;  3LAP A;  3O8H A;  1YO5 C;  3K4M A;  4HX4 A;  2EIL H;  2BXZ A;  1L3L A;  2V9P A;  2KHM A;  1YYV A;  3GWZ A;  1WH7 A;  2X6X A;  1AWC A;  3OYF A;  3P9K A;  4GCV A;  3REO A;  3DEU A;  4G6T B;  4HV6 A;  3DTK A;  4LLG F;  3KFW X;  3BR0 A;  1OYY A;  3ZPL A;  3B73 A;  2OQG A;  2XAJ A;  5E1Z B;  1KU2 A;  3SHF A;  4AYB N;  1R23 A;  3MCZ A;  3IL2 A;  4KUM A;  5AON A;  2XAS A;  5EZG A;  5DCF A;  3KP6 A;  2G0E A;  4A3K J;  1Z21 A;  2XAF A;  4CYC A;  2OCE A;  2KIM A;  3Q0W A;  2JWT A;  3DP7 A;  1LFP A;  4NBQ A;  5B1B H;  1QO0 D;  2XF6 A;  2M45 A;  2GXB A;  4M9X A;  5FRO A;  3V8L A;  1HW1 A;  3RDI A;  4EM0 B;  5LBQ A;  4LFU A;  2Y30 A;  4EJO A;  5DDG A;  1DQU A;  1TQP A;  1IN4 A;  1FSE A;  2XUB A;  1FWZ A;  4C3J J;  3JRH A;  2OTL I;  2LP0 A;  1AHD P;  2DK5 A;  2EWN A;  4B44 A;  3OY9 A;  3DFG A;  2K9S A;  1IG7 A;  2PI0 A;  1REP C;  1AKH A;  2EPF A;  1UHW A;  4G7Z F;  3NRV A;  2P5K A;  4A3I J;  3DEE A;  4NC7 A;  3RCO A;  2R7W A;  4BY1 J;  2Y0S A;  1D5V A;  1F9N A;  2D2W A;  4M9S A;  2JTV A;  4IRG A;  1ORK A;  2QUF A;  3CUO A;  3CUQ C;  3GFM A;  2QSG X;  2DMT A;  2NOG A;  4BHB A;  4KFC A;  3TGN A;  3LFU A;  3KCC A;  4U0Y A;  1D8K A;  3R0A A;  3E97 A;  2ZJQ F;  1HKQ A;  2JA6 J;  1KQ8 A;  5L3B A;  4M9Z A;  4KJZ A;  4D1Q A;  2KT0 A;  4W1U A;  3HIF A;  4JX4 A;  3H3V K;  3A1Y A;  2CFO A;  3CP8 A;  2VOO A;  4OAY A;  5ILV A;  3KX2 A;  1WJB A;  3OWT A;  2ZJR F;  4AD9 A;  2LC2 A;  5EJC A;  4DZJ A;  2R93 J;  3L2Q A;  2IGM A;  1ERD A;  2R7X A;  1OCO H;  2VOD A;  3VPR A;  3AFH A;  3BWG A;  2RAE A;  2W85 A;  4Z6Y A;  4BDY A;  1MIJ A;  4E7L A;  4WF2 A;  2RQP A;  1HW5 A;  4BBR J;  3SZG A;  4PCQ A;  2OPT A;  4C9Y A;  2UUZ A;  3I4P A;  1FIA A;  1BW6 A;  2L02 A;  1SD6 A;  1MJA A;  5E8G A;  3FKJ A;  1Y1V J;  2MGQ A;  2HQN A;  4E6K G;  4Y15 A;  4G9Y A;  4JQF A;  4LK1 F;  2E7W A;  5F0H A;  1B9M A;  4WXC A;  1YRN B;  1V5G A;  2E5N A;  3I5U A;  1WCM J;  5LFA A;  1MJB A;  2IT0 A;  3J7Y J;  2XC7 A;  1VQ8 I;  4DYQ A;  3OYG A;  1ETY A;  2KDO A;  4GFB A;  3HL2 A;  4IKF A;  3TQN A;  3P7N A;  3BR5 A;  2UWM A;  5H2F C;  1NK2 P;  2F2E A;  3BPV A;  1P2F A;  5E79 C;  3T8R A;  3FWE A;  3QOP A;  1MMG A;  5F04 A;  5J6X A;  1JJ8 C;  1T0F A;  3O2P E;  5BNG A;  1QA6 A;  2YU9 J;  3ZRG A;  3HYI A;  3A01 A;  2XPW A;  3ZMV A;  2GA2 A;  2B63 J;  4M3F A;  5BQT A;  4OAZ A;  5K5Q A;  2DW4 A;  5CLS A;  1SFX A;  2HDW A;  1MNE A;  4EJW A;  1G3Y A;  1T56 A;  4E7H A;  4II3 A;  2F5V A;  1HKS A;  2PQ8 A;  3UNG C;  5IT3 A;  5GTH C;  2MSY A;  4ESJ A;  1PP7 U;  2KIF A;  1YX5 A;  1IRG A;  3S14 J;  2O0Y A;  5DUK A;  1R5H A;  2FF4 A;  3BR6 A;  3H3U A;  4F7Z A;  5ICE A;  3ISP A;  3KEY A;  4UB6 C;  1IW7 F;  2PMZ N;  2GAU A;  3CUQ B;  3FMS A;  3LA7 A;  2X4H A;  4IHV A;  4XKC A;  3MN2 A;  3S2W A;  5FLX Z;  2BV6 A;  5A2Q K;  3M07 A;  1X2M A;  2ISY A;  4XR6 A;  3CD6 I;  4MIM A;  4E7K A;  1YQA A;  1GVD A;  1U5T A;  4BAC A;  3PNY A;  3MVP A;  3F6O A;  3TDZ C;  5HNF A;  4UUT A;  1BR4 A;  3FIS A;  2MLK A;  4RM2 A;  5J1U A;  5IP7 J;  1D0X A;  4L5I A;  3DLL F;  4XN0 A;  2H94 A;  2WAF A;  4MQV A;  5DTD A;  4F92 B;  3EUH A;  2M5W A;  3R60 A;  2IPQ X;  1MMA A;  3SDB A;  3D0S A;  2DDA A;  3OYL A;  2XGD A;  2LFB A;  5M5X J;  2OUM A;  3F8B A;  4JYK A;  4BU2 A;  2OC6 A;  1S5L C;  4Z2Y A;  3CDL A;  1HXD A;  2ECC A;  1UST A;  1U0J A;  2ZME A;  1Q1H A;  4F91 B;  5JLW A;  2COM A;  2E34 A;  2XSD C;  4C2U A;  1I3Q J;  4EGY A;  1IN7 A;  5H20 A;  2DXI A;  1GHC A;  1WH5 A;  2NS7 A;  1LVA A;  5J3L A;  3G3Z A;  4M3E A;  3LOC A;  2W57 A;  3K1N A;  4HLX A;  5GPC A;  2ZNY A;  3HEF A;  1W7P B;  4P55 A;  4A69 C;  2JA7 J;  2HYJ A;  2VJ5 A;  1F36 A;  2E60 A;  5GP9 A;  5GPA A;  2O6G E;  2QZ8 A;  1HLV A;  3OMY A;  3QOE A;  2F4I A;  4B3X A;  1D8J A;  2KKO A;  1YJN I;  2TRT A;  5FGM A;  2DT5 A;  2RC4 A;  5IP9 J;  2GWR A;  3ZMD A;  1TWC J;  2LYC A;  3DKX A;  3K4N A;  3NAU A;  3GYH X;  1P6R A;  3TKY A;  3QPS A;  4JK1 X;  3LAJ A;  5HLT A;  2H1K A;  4BUP A;  2ME0 A;  4HX8 A;  1Z3Y A;  4HZF A;  4IPA A;  1RUN A;  1EH6 A;  3DCF A;  1RPW A;  2P5V A;  4HAM A;  2V1N A;  2R0Q C;  1FP2 A;  3VYU B;  1BR1 A;  3BZ6 A;  4FQG A;  3S1M J;  1O3R A;  1P4W A;  3WG9 A;  5LEJ A;  4UY8 I;  4RLF A;  4KNY A;  3IWF A;  1UAA A;  1IUF A;  1MBJ A;  2K40 A;  3EPZ A;  1TL8 A;  1MD0 A;  4PJN A;  2E71 A;  2LH9 A;  3GVA A;  4XOT A;  2W00 A;  3QWL A;  1ZGW A;  1JKO C;  2VN2 A;  1EKE A;  1CF7 B;  1FOK A;  5CVI A;  2VKV A;  3ROU A;  3TP3 A;  1SAX A;  4KIT B;  1WI3 A;  3H92 A;  4Y4R A;  4YFX F;  2PBI A;  2LVS A;  3OYN A;  3CJR B;  4P1W A;  4XOR A;  3CUQ A;  5DUI A;  1YW9 A;  4BEH A;  1EF4 A;  1MSE C;  5D4S A;  5E20 A;  2AO9 A;  1E3H A;  3Q9S A;  2WAE A;  1PP8 F;  2PJR B;  4I0B A;  3RKY A;  4V2F A;  1X4O A;  1VFC A;  4BQA A;  1VQL I;  4EM2 A;  2HPM A;  1SVL A;  3LSG A;  3ZR8 X;  2HXO A;  4FAS D;  1ETK A;  1IN8 A;  1O7L A;  1D1A A;  1Z67 A;  5LEK A;  2LY1 A;  1R9T J;  1Z91 A;  3QAH A;  3FK6 A;  3TW7 A;  1U8B A;  1FEX A;  2RNJ A;  2HYF A;  3F0C A;  4XLC A;  2NVU B;  4HYE A;  1MBH A;  2LK2 A;  2Q8K A;  2M0M A;  2DA3 A;  4Y7N J;  4G8X A;  2OZU A;  2ZXH A;  3B6C A;  4XK4 A;  5L3F A;  1D1C A;  1I1G A;  1NTC A;  4HEA 2;  3N05 A;  3RKX A;  4HF2 A;  2D1V A;  4AIJ A;  3WHC A;  1XX5 A;  2EV5 A;  3WTV C;  3I4N J;  1XMK A;  2F48 A;  1BL0 A;  3CCE I;  3ZQH A;  4M72 A;  1TW2 A;  5E8I A;  4DNC A;  4UVC A;  2RKH A;  5CQE A;  3N4M A;  4YFN F;  1H89 C;  2JPC A;  2BGC A;  1Z1D A;  1JXS A;  4BE1 A;  3GF2 A;  3E5X A;  1ZGA A;  3ZOB A;  1DP3 A;  1R1U A;  4GYI A;  4Q48 A;  4UNO A;  2BHZ A;  1QPI A;  2NVT J;  2FA5 A;  2FSW A;  1I5Z A;  3VYT B;  2UXN A;  2QCO A;  2E35 A;  2DPU A;  2NVY J;  5H6Q A;  1YE9 A;  1X1B A;  3H36 A;  2BXY A;  4MTE A;  2IBD A;  1YS7 A;  2W4S A;  3HOX J;  2R5Y A;  4MQ9 F;  4MTD A;  1XMX A;  2CFX A;  1HOM A;  1W5S A;  2QQA A;  1K79 A;  1FMW A;  2O03 A;  4XLH A;  4IJA A;  4EGZ A;  4A3C J;  3EUA A;  1QBJ A;  1ZGJ A;  1C0W A;  1UB9 A;  3K4B A;  3OYI A;  2XF5 A;  2ECB A;  4E7S A;  3K4L A;  1YW7 A;  3J7Z I;  5JHU A;  2CU7 A;  4N0B A;  5ICG A;  2XGE A;  2HU9 A;  3MAJ A;  3MKZ A;  4CZC A;  1VQ4 I;  1I50 J;  5J8F A;  1WZ2 A;  4RA2 A;  5JVG F;  5EEA A;  1UG2 A;  2CQK A;  1GXQ A;  1YIO A;  3WG7 H;  4XRS A;  1IDY A;  2UZK A;  4DOZ A;  5HDG A;  2HWV A;  3Q5F A;  2B9S A;  2DDB A;  3J81 Z;  3HB9 A;  2BY2 A;  4TV7 A;  2R4G A;  5KHD A;  2E1C A;  3BC8 A;  3OYJ A;  4FTH A;  3WHB A;  4DBR A;  2LF7 A;  1K4S A;  1U8R A;  3KP2 A;  1I3A A;  1R22 A;  2LSO A;  4MGR A;  3AG1 H;  5DCM A;  4ETS A;  3K70 D;  2QBY B;  3Q0U A;  3HOZ J;  2O5R A;  3HXL A;  1QGP A;  2CW0 F;  3M8J A;  3TO9 A;  1ZAR A;  4PJM A;  3K70 C;  3JTH A;  3ZQL A;  1B4A A;  1FP1 D;  2FOK A;  1RET A;  5D6E A;  4UXN A;  3M8F A;  4CIC A;  4EVI A;  1YS6 A;  2KL4 A;  5FFX A;  4M6X A;  3SDG A;  2A5W A;  1ETV A;  1QZE A;  2W24 A;  5IYD J;  3GO5 A;  4HRI A;  4IOC F;  1JKR C;  3L2R A;  4AU7 A;  1X4P A;  1K78 A;  4V19 K;  3I71 A;  2R7Q A;  3J7A Y;  3KZY A;  2EBI A;  4NNJ A;  1OYI A;  1KYW A;  2X0L A;  1D3Y A;  1JTY A;  2ICW G;  2M4K A;  4P9U A;  3J80 Z;  4GYG A;  2P7V B;  3ZQQ A;  3CCU I;  1YIT I;  2Z99 A;  4I98 B;  4JP0 A;  2KZV A;  3BRO A;  4L9V A;  4EQQ A;  1HSJ A;  1K6Y A;  2Y9Z A;  3OR2 C;  1O4X A;  3DTE A;  5K7Z A;  3WOD F;  3FXU A;  2E7X A;  3ML6 A;  5JFR A;  4OWR B;  4X1E A;  4Y17 A;  3MZ8 A;  3G2B A;  4BGD A;  4L9T A;  2VE8 A;  5CVU A;  3IH3 A;  1FYL A;  1JHH A;  1G3S A;  2ESH A;  4R1H A;  3TBI A;  3HJE A;  1P4X A;  3K9T A;  1N75 A;  4A3J J;  3K4K A;  4B43 A;  2YR2 A;  1YJW I;  1DU6 A;  2XKO A;  1R49 A;  4L5J A;  1ETQ A;  4PJJ A;  1XGS A;  2OU2 A;  2HXI A;  1I6X A;  4Q4Z F;  3QU6 A;  4BE0 A;  1U9O A;  2A6T A;  2L4A A;  2V7F A;  1KZH A;  2IJL A;  1N78 A;  2HPI A;  1AKH B;  1R6R A;  3CQZ J;  5BS6 A;  2H6C A;  3RYP A;  1QHH D;  2K9N A;  3FXR A;  2HKO A;  1VQ5 I;  5FLX K;  3G71 I;  2JRT A;  4A2U A;  2KMU A;  2LR8 A;  2R7S A;  1U9N A;  3TL4 X;  1I6H J;  2MFZ A;  3K4J A;  3OYH A;  4A3M J;  2ZFW A;  2CUE A;  4XKW A;  3PFI A;  2CRG A;  2DA4 A;  4JX6 A;  1MBE A;  1S6L A;  1IF1 A;  2DJN A;  4DGW B;  2DFF A;  2ZSI B;  5D6F A;  2HDD A;  4Q5S F;  1SVM A;  2A61 A;  3FX3 A;  3BTJ A;  3FZV A;  2DQL A;  1Z6T A;  3C3W A;  4IQ4 A;  1DDN A;  2UV1 A;  2P81 A;  1S9H A;  4WWC A;  2X1E A;  3IRR A;  2GOM A;  3HBL A;  4LMY A;  4HDV A;  4LG0 B;  3S2H J;  4YIF A;  1A5J A;  2M2E A;  4B09 A;  2K27 A;  2ZXW H;  2VBY A;  1K6O A;  4A6D A;  4O6J A;  4KT5 C;  3HM5 A;  3HRT A;  2EA4 A;  2R7V A;  3KP4 A;  1HA8 A;  2L01 A;  1ZRC A;  4FET A;  5B3S H;  5ILU A;  2Q1Z B;  2IAI A;  1HDP A;  1FY7 A;  4P5O A;  2EFW A;  3OIP A;  2CYY A;  4RBO A;  4D5F A;  1XSV A;  4YII A;  2VON A;  1EJ9 A;  3A02 A;  4RGX A;  2E1M C;  2IGK A;  2ZXJ A;  3TDU C;  5FJ8 J;  3GFI A;  5CYV A;  1S7O A;  2DOA A;  3L2V A;  1VTN C;  4RAF A;  5IOZ A;  5AIP A;  3OYA A;  1YHQ I;  1B8I B;  1XSX A;  3GTK J;  5HLH A;  4GDF A;  1RZ4 A;  4NQW B;  2PMU A;  5EZH A;  2QGU A;  1P7J A;  2GZW A;  2DAO A;  2DA7 A;  2GLO A;  1YI2 I;  2ADU A;  3CMM A;  3O3K A;  2EFO A;  3WTT C;  2LBF A;  1ZQ3 P;  2CV0 A;  2OA4 A;  3G1O A;  3A01 B;  4IHT A;  3A0B C;  4E4H A;  1ZEL A;  2LOO A;  4CO8 A;  2WY8 Q;  4KN4 X;  2W1O A;  1R58 A;  1E2X A;  1ZAO A;  2F5C A;  3EYY A;  5HS9 A;  4A5M A;  2Y9Y A;  2R3S A;  2DOF A;  5HDK A;  2QEN A;  3SXY A;  4ESF A;  1BC8 C;  1S29 A;  1XPX A;  1FPQ A;  4MEY F;  3E1S A;  1W4M A;  1Y6I A;  5M5W J;  1FYK A;  4II2 A;  4PUS A;  1QRY A;  4G94 A;  3FBI B;  3K6G A;  4C3H J;  5BPI A;  4AM3 A;  2M7A A;  3NWT A;  2P5L C;  2M4G A;  4IRH A;  1T2K A;  2RGV A;  2L9R A;  3BT9 A;  4RGS A;  4CCK A;  2IRF G;  3WTY C;  3EDP A;  1S72 I;  2CQX A;  2JT1 A;  2MLG A;  3BTI A;  3OOU A;  1BOA A;  3LSI A;  4E7J A;  1A31 A;  1ETO A;  2XHK A;  1U5T B;  1TNT A;  2P6S A;  3ASO H;  2D45 A;  4H4K C;  1UFM A;  4U7D A;  2DTZ A;  1Y56 A;  2Y75 A;  2ZC2 A;  1POG A;  3CTA A;  1IN5 A;  1BW5 A;  4HDU A;  3WTW C;  3OSG A;  4NDL A;  2VB6 A;  2QSF X;  2VBX A;  2STW A;  3QP5 A;  3A2K A;  2V9V A;  4PSX A;  1V3F A;  1IO2 A;  2HFH A;  1XGO A;  1FYM A;  3A4C A;  3KZI C;  1IXR C;  2WAQ N;  3A03 A;  5B1A H;  1PDN C;  2FUG 2;  2XVC A;  4BL0 B;  3SEZ A;  5HVQ C;  2VJI A;  4OIQ F;  1JGG A;  2PEX A;  2GIZ A;  3DV8 A;  1SFU A;  4FCY A;  1M1E B;  2X6W A;  2L9N A;  5D5U B;  3I4M J;  4GRI A;  3W3C A;  5D4R A;  2HNH A;  4Y13 A;  2EFP A;  4XNF A;  2QQ9 A;  1UG0 A;  2ZME B;  1IZ1 A;  2EZH A;  4LG0 A;  3FBN B;  2FU4 A;  5DM7 F;  1H0M A;  1V4R A;  2CG4 A;  2QQ8 A;  1J09 A;  2E1M B;  4A0X A;  3JRA A;  4ON0 A;  3HGG A;  3BP8 A;  4RAZ A;  3GFL A;  3M3Y J;  1K4T A;  1R4M B;  1JTX A;  1A6Q A;  1S8N A;  1BR2 A;  1WHU A;  4KIS A;  5D8L B;  1JT6 A;  2X48 A;  3W6J B;  2CQN A;  3VYR B;  2HTJ A;  1Y1W J;  1N77 A;  1SAU A;  1TTY A;  2OV7 A;  3PNT A;  4EJV A;  1LEB A;  3F8C A;  4XRF A;  3AG4 H;  1MND A;  1LPQ A;  1U3E M;  4QSH A;  2WV1 A;  2CQ7 A;  1MBK A;  3CCS I;  4AWX B;  2GXG A;  4I7H A;  4XL9 A;  3HOU J;  4RAG A;  4LIT A;  3PL8 A;  2FEZ A;  1B8I A;  3JAM Z;  2BYV E;  2EFN A;  1XCB A;  1KYZ A;  1OKR A;  1SVO A;  4NQW A;  5FKO A;  1T6S A;  3DKY A;  2A69 F;  1TZL A;  1OR7 C;  2HQ5 A;  5HLI A;  2H8W A;  3HDD A;  1AOY A;  5LGN A;  1KU9 A;  3RJP A;  4ZYA A;  2E5Z A;  1XMA A;  5C3E J;  3IV5 A;  5BMZ A;  1J75 A;  2A3S A;  2V1U A;  5DM6 F;  4PZJ A;  3ERE D;  4G6D A;  3U2R A;  1SAN A;  1SD7 A;  2F4M B;  1JUS A;  5F0F A;  1BC7 C;  1JE8 A;  3E7L A;  3CO7 C;  1MH4 A;  4AYB A;  3CF2 A;  4K2E A;  2H09 A;  3U1D A;  1FOX A;  3G1M A;  2XV4 S;  1XD7 A;  3PUF A;  1Z6R A;  4OIO F;  1GUU A;  2VAS A;  3DPU A;  2FMY A;  3QU3 A;  5IT9 Z;  4ESB A;  2L9S A;  2FNP A;  3BQY A;  3FXJ A;  4B3A A;  4BEH B;  2HDC A;  4FX4 A;  4F55 A;  4XBF A;  2WV0 A;  5F0C A;  1TT5 B;  4A3F J;  2IS2 A;  2LMD A;  3QPH A;  3HHH A;  1IC8 A;  5GTI C;  2AQE A;  3LL7 A;  2GXA A;  3C18 A;  2WAD A;  5F27 A;  4WXH A;  1JUM A;  3ZQ7 A;  3BOQ A;  2HOT A;  2M9H A;  4P96 A;  2IS4 A;  2H8R A;  3P5J A;  3WTZ A;  2L4M A;  5KCM A;  2RQQ A;  1Y8R B;  2K3P A;  2YSR A;  4GO1 A;  2DPD A;  4X6A J;  2NNN A;  3RKQ A;  3LSJ A;  2FX0 A;  4IEJ A;  4A93 J;  2LRE A;  4NUB A;  4HQE A;  1MSF C;  5FKM A;  3SYT A;  3RSN A;  3LSM A;  2F5F A;  2ID3 A;  1DPU A;  1AU7 A;  1XGM A;  1QZZ A;  2NYX A;  3GTL J;  1FBS A;  3KPH A;  2J5P A;  4MEX F;  4XON A;  1OQY A;  2V1X A;  4BJ6 C;  3GXO A;  3KEQ A;  5F6F A;  4WK8 F;  3FXM A;  1B6A A;  4KIF A;  2R7R A;  2E1N A;  3CDI A;  3IH2 A;  1PJR A;  2L54 A;  3QRF F;  2D1H A;  5FB2 A;  1APL C;  2N8G A;  2DOE A;  4B48 A;  2MA3 A;  3FM5 A;  2IW5 A;  2QLZ A;  2E1O A;  3LWF A;  4ENN A;  1YTY A;  4YFK F;  1KU7 A;  2EH3 A;  1FZP B;  3I53 A;  4OIP F;  2L7Z A;  3HSR A;  4CUG A;  2WY7 Q;  3CCV I;  2CH0 A;  3VDX A;  2ZCW A;  5C44 J;  3P9I A;  5IPA A;  1LE8 A;  2M8E A;  2R7T A;  1A04 A;  1SFK A;  3EUK L;  4IHW A;  3JRG A;  2IA2 A;  4LIV A;  4UV9 A;  3O6B B;  1A6I A;  1YJ9 I;  3UKG A;  1DP7 P;  4QPO A;  1IAW A;  4BY7 J;  1MMN A;  4ENM A;  4CCJ A;  2CJJ A;  3HUG A;  3LQQ A;  3SZP A;  2DA5 A;  2OAZ A;  5FFZ A;  2R5Y B;  1QVU A;  1PYV A;  2MYS A;  2DK8 A;  1HDD C;  1S7E A;  2ZJ2 A;  2QSH X;  1RR8 C;  5HNH A;  4HOB A;  2XSJ C;  4A3L J;  4QTR A;  3EYI A;  4S0H B;  3LNQ A;  5LHI A;  3W6V A;  1Y39 A;  5BPD A;  3DU6 A;  3IHU A;  4ZJZ A;  1A36 A;  1P4A A;  1U2W A;  1RRJ A;  3VFZ A;  4EM1 A;  1IXS B;  3ZQI A;  2OQR A;  3BG5 A;  4I6Z A;  4YIR X;  3HOS A;  3DTI A;  4I99 C;  1TQI A;  3HTS B;  2YU3 A;  5EDN A;  3PIP F;  2YPR A;  1CGP A;  3ABK H;  1LNW A;  1NG7 A;  3F23 A;  2X51 A;  3ZMU A;  4BKX A;  5BOX A;  3RI4 A;  2NS0 A;  3TED A;  3ZMT A;  3FXO A;  1O3Q A;  2KIU A;  4MFE A;  1XDS A;  2P0W A;  3IKV A;  3FMR A;  3PIO F;  1R4N B;  2QWW A;  3KLN A;  1JKQ C;  2K9L A;  4XRM A;  5IOY A;  3H9Q A;  4CA0 A;  2DFH A;  1IGN A;  2MBF A;  5KAI C;  4KIB A;  2WB1 A;  1H8A C;  3E0J B;  5IP6 A;  1NG6 A;  3MD2 A;  2EV6 A;  2AS5 F;  1F1Z A;  2WC2 A;  1WSU A;  1PVE A;  2PN6 A;  1SD4 A;  1ZR2 A;  2DOD A;  1JT0 A;  3CMA I;  3SFI A;  1HC8 A;  2XPU A;  5DCM B;  3I56 I;  4F52 A;  3QPT A;  3UR3 C;  2TDX A;  3F21 A;  4XRS G;  4I2O A;  3CCR I;  9ANT A;  5GAG J;  2FML A;  1TLH B;  2Q2E A;  2CUJ A;  2Y2Z A;  2DA1 A;  1HST A;  4HV5 A;  3W6K B;  3ASN H;  4XQF A;  2QF7 A;  2KIQ A;  4FHT A;  4IHX A;  4BAY A;  4LOC A;  3PO3 J;  1K78 B;  1GV5 A;  3BY6 A;  4DYC A;  1VQK I;  2MH2 A;  1J2X A;  3G1L A;  1P92 A;  5JI6 A;  3IKT A;  3L2C A;  2KZG A;  3FMQ A;  4XN3 A;  2F5D A;  1LQ1 A;  2DLL A;  4J01 A;  5KK1 A;  2NOJ B;  5FD5 A;  5EF6 A;  3IAS 2;  3GLX A;  3JRF A;  1UHS A;  2VKD A;  1W0T A;  2COB A;  5K5R A;  4HF1 A;  4N9I A;  4ENJ A;  3C2B A;  2PX9 A;  1ZKG A;  1UMQ A;  3WE3 A;  4CCL A;  2EIM H;  3D5L A;  3CCQ I;  2XB5 A;  3KIO A;  1VQ7 I;  2DI3 A;  2CS3 A;  5CVV A;  4XLF A;  2DFE A;  3KYD B;  4ZTF A;  3COA C;  2LRD A;  2DQR A;  2O8X A;  3IH4 A;  3ABU A;  4KIC A;  2XAU A;  3BTC A;  2HOE A;  3GZN B;  2K85 A;  2VJ4 A;  5TGT A;  4D7N A;  4UUS A;  3GEZ A;  1XB4 A;  3KP5 A;  4FE4 A;  3I58 A;  2CGP A;  1OR7 A;  5DD4 A;  2LLK A;  3NQO A;  3WGH A;  3AG2 H;  4A3G J;  3OYK A;  3CDH A;  2X6Y A;  4O3M A;  3ECH A;  4BYY A;  5LLQ A;  2YUS A;  5FD6 A;  2XRL A;  1QU3 A;  3GZ6 A;  2W48 A;  1MJ9 A;  3MMY B;  3KZZ A;  2DFI A;  1FIP A;  3SZT A;  2BZT A;  5EGO B;  1DU0 A;  2IS6 A;  2CSO A;  1Z0X A;  3RQI A;  3GME A;  3CLQ A;  4CCM A;  3I0T A;  2BVL A;  1FTZ A;  1N25 A;  2MC4 A;  4RLQ A;  3DXJ F;  3HOY J;  5FLM J;  3OYE A;  1G2H A;  1SMY F;  3FF5 A;  3LA2 A;  1BIB A;  1XCV A;  2H6B A;  3LSK A;  1TWA J;  3I3L A;  2W7N A;  5E3O A;  1USS A;  2L7M P;  2HOA A;  1XDU A;  4NB5 A;  1XSD A;  1ZH5 A;  3BZC A;  1CQT A;  5D8K B;  3U1K A;  1TNS A;  4WXD A;  2PMH A;  1OJL A;  2VT2 A;  2RRE A;  1SFE A;  2DA6 A;  2L0K A;  3I55 I;  3MKW B;  1RUO A;  5CQG A;  3BCB A;  3EET A;  2ZO4 A;  3ZMS A;  4A3E J;  3DKW A;  1X3W B;  4DW6 A;  3T5X A;  1VZ0 A;  4BBS J;  2VT3 A;  4BJT A;  2OF7 A;  5F1R A;  1QVT A;  4DIQ A;  3RIR A;  1WGX A;  1RKT A;  4XLN F;  3RYR A;  1WKM A;  3IRQ A;  2STT A;  2KPM A;  3BZK A;  2KQR A;  2BE5 F;  1B72 A;  1ZLJ A;  3HKZ A;  1LUJ B;  1NH3 A;  1G8X A;  4KMU X;  2R7D A;  1GLN A;  4AVZ A;  1YFH A;  2V6E A;  4U88 A;  2MW8 A;  4PJ0 C;  1X2N A;  5F64 A;  3S16 J;  3RZD J;  1FBU A;  5J1R A;  2ZXI A;  3V7C A;  1BM9 A;  4BXX J;  1VF9 A;  3CCM I;  4IF4 A;  3WTX C;  4Q47 A;  3MWM A;  1O3S A;  2DN0 A;  5FLV A;  3HSF A;  1OPC A;  2VC1 A;  2XF7 A;  5F08 A;  4BNC A;  3OV8 A;  4EAT A;  3FM3 A;  2NRA C;  2X85 A;  4QIW N;  2RNG A;  4C30 A;  4DYR A;  4ZYH A;  5M3M J;  2VQC A;  4KN7 X;  4NC8 A;  4RB2 C;  2EIN H;  2YX4 A;  2W84 A;  2VBZ A;  1HBX G;  2BY3 A;  4E7I A;  3M9A A;  2C6Y A;  4HQM A;  2LBF B;  4ZDP A;  2AHQ A;  2FD5 A;  2WA0 A;  4HF0 A;  1HKT A;  3JAM K;  1G3T A;  5JVT A;  1BI1 A;  1QHG A;  2BY1 A;  4O5V A;  2HGC A;  3RTR A;  1TW3 A;  4XSX F;  1GDT A;  5C4J J;  4P9F A;  2IP2 A;  2FQ3 A;  3LSH A;  4DBQ A;  1ACI A;  2L5Q A;  1E3P A;  4FIS A;  2M30 A;  3V42 A;  3CC4 I;  2M8G X;  2Z5U A;  4OIN F;  4HSR A;  4BHP A;  2BW3 A;  3VYS B;  2BVM A;  2GA1 A;  1U78 A;  3PO2 J;  5CVJ A;  6PAX A;  4UVA A;  4ZH4 F;  3WGI A;  2KFD A;  2H27 A;  4LB5 A;  2VUM J;  1X3U A;  1ZN2 A;  3IWZ A;  5ILS A;  5K1Y A;  3VEP A;  5EGO A;  1LJ9 A;  2E2I J;  2NVX J;  2ZNZ A;  2NAZ A;  3KYC B;  1HW2 A;  1X58 A;  5IT9 K;  1MNM C;  1OIS A;  3IUO A;  2IGN A;  3BG9 A;  2FE3 A;  2XIG A;  5GAH J;  2GOX B;  3CP2 A;  4BHC A;  2NXN B;  1WWX A;  2OZ6 A;  5H6R A;  1SEU A;  3CCJ I;  1Y8Q B;  2M7B A;  4A0Z A;  2R7F A;  1KQ0 A;  3F22 A;  1ZG5 A;  4S04 A;  3DBL B;  4FE7 A;  2NS8 A;  3ZQC A;  3OIQ A;  1XC5 A;  2JK3 A;  1MZB A;  3BG7 A;  2Y0S N;  5L3G A;  2JA2 A;  3M8E A;  3T0Y A;  1G4D A;  4JBA A;  3ZP5 A;  3DBH B;  1W1W E;  3I59 B;  4AUX A;  1LFU P;  3I9V 2;  4C2T A;  2FQ4 A;  1W36 D;  1XG1 A;  2OBP A;  4IQJ A;  4RB0 A;  1HCR A;  3KE2 A;  4L0Y B;  4XLA A;  4WCG A;  2A6E F;  4IRI A;  1UEL B;  3A0H C;  3FDY A;  1W36 C;  1A35 A;  1ZHF A;  5KVR A;  3JRD A;  3JRC A;  4XKV A;  3CO6 C;  2VQH A;  4V2G A;  5KNL A;  2I8D A;  4LK0 F;  3HSE A;  5FKL A;  2IEK A;  1I39 A;  3TMO A;  3E5Q A;  4BDZ A;  2CUF A;  2PJP A;  2DA2 A;  5TJJ A;  3TOB A;  2CV1 A;  4R8H A;  1LVK A; 
#chains in the Genus database with same CATH homology
 1MBG A;  2VPR A;  2R7Z J;  1JKO C;  5FKK A;  2HQ5 A;  1IJW C;  3HDD A;  2VKV A;  4M3B A;  3TP3 A;  1WI3 A;  5C3E J;  3IV5 A;  2TCT A;  2EZL A;  2LVS A;  3D1N I;  1SAN A;  3BG3 A;  1ZR4 A;  1JUS A;  3FIW A;  5F0F A;  3E7L A;  1MH4 A;  1EF4 A;  1MSE C;  4MFD A;  4I76 A;  1FTT A;  4D5C A;  2AO9 A;  1PUF B;  2GBY A;  3G1M A;  2CQQ A;  2R5Z A;  1H88 C;  3HOV J;  1GUU A;  3LSP A;  2NVQ J;  4V2F A;  5IYC J;  2JN6 A;  1F43 A;  1VFC A;  3BQY A;  3LSG A;  4B3A A;  2HXO A;  1ETK A;  3GTQ J;  1RR7 A;  5F0C A;  4A3F J;  3S17 J;  2R5Z B;  1R9T J;  5IYB J;  1JJ6 C;  2ELK A;  2Y31 A;  3S1Q J;  1MBF A;  4B4C A;  3FK6 A;  3K7A J;  4G12 A;  3TW7 A;  1U8B A;  1IC8 A;  3SJM A;  1FEX A;  5F27 A;  2HOT A;  1JUM A;  1Z77 A;  2M9H A;  2JJ7 A;  3F0C A;  3TW6 A;  2H8R A;  1T33 A;  1MBH A;  2LK2 A;  2L7F P;  2DA3 A;  4Y7N J;  1RES A;  3B6C A;  4XK4 A;  4X6A J;  3RKQ A;  1NTC A;  2EZK A;  3LSJ A;  2FX0 A;  5M5Y J;  1W0U A;  4IEJ A;  4A93 J;  4ABZ A;  3WHC A;  1MSF C;  2ID6 A;  4M3G A;  5FKM A;  4IHY A;  3MKL A;  3I4N J;  1ZK8 A;  2ID3 A;  3H0G J;  2DMN A;  5E3M A;  3ZQH A;  1AU7 A;  1BL0 A;  2KDZ A;  1OCT C;  3GTL J;  2LD5 A;  4C2M J;  4CYC B;  2X9D A;  2M34 A;  3IH2 A;  1H89 C;  3CCY A;  1APL C;  2N8G A;  4MO7 A;  3ZOB A;  1QPI A;  1VI0 A;  2EZI A;  2E1O A;  2NVT J;  1TWG J;  2EH3 A;  2QCO A;  3JRI A;  2NVY J;  2L7Z A;  1IDZ A;  2GM4 A;  2MG4 A;  5C44 J;  2IBD A;  1XS9 A;  2ME6 A;  3HOX J;  2R5Y A;  5IPA A;  1IV6 A;  1LE8 A;  1ITY A;  1HOM A;  4IHW A;  3JRG A;  4EEF G;  1A6I A;  3UKG A;  2JA5 J;  4BY7 J;  4A3C J;  5EG0 A;  1OFC X;  2CJJ A;  3ZQF A;  1Q1V A;  2R92 J;  2DA5 A;  2R5Y B;  3JRB A;  1VND A;  1LE8 B;  2ECB A;  1QVU A;  1IRZ A;  1ETX A;  1D5Y A;  1HDD C;  1S7E A;  2E2J J;  2X6O A;  4B1R A;  2CU7 A;  4QTR A;  4A3L J;  4S0H B;  3LNQ A;  1OCP A;  3W6V A;  2FJ1 A;  3JR9 A;  2XGE A;  1I50 J;  4XID A;  1BJZ A;  5JLX A;  3ZQI A;  5EEA A;  1UG2 A;  2E19 A;  3BG5 A;  4XRS A;  1IDY A;  4I6Z A;  3GTM J;  1LFB A;  5EDN A;  3M4O J;  4BKX A;  2M0C A;  3HB9 A;  3GTO J;  3TED A;  1K61 A;  2VKE A;  1PUF A;  1NK3 P;  4A3D J;  4MFE A;  1A5J A;  3OIO A;  3DEW A;  5K7H A;  4FTH A;  3BR2 A;  4W97 A;  3WHB A;  2K9Q A;  1JKQ C;  4XRM A;  5IOY A;  1JUP A;  4A3B J;  1IGN A;  5M3F J;  3OSF A;  3Q0U A;  3PM1 A;  2XPV A;  5IP6 A;  1H8A C;  4AC0 A;  3HOZ J;  1ENH A;  3ZQL A;  4QIW N;  1RET A;  3HGY A;  3JRE A;  1ZR2 A;  2JMW A;  3SDG A;  3O8H A;  1JT0 A;  3RZO J;  3SFI A;  1ETV A;  2XPU A;  2DMP A;  4D7M A;  1WH7 A;  5IYD J;  4XRS G;  1JKR C;  9ANT A;  2EBI A;  2O8K A;  3L1P A;  2Y2Z A;  2DA1 A;  3BR0 A;  1JTY A;  4XIC A;  2QF7 A;  4IHX A;  4AYB N;  2WB1 N;  4LOC A;  2LY9 A;  3PO3 J;  3S2D J;  4DZP A;  1GV5 A;  5E3L A;  4DYC A;  1MH3 A;  5EZG A;  3G1L A;  2G0E A;  2JA8 J;  4JP0 A;  4A3K J;  4CYC A;  2Y9Z A;  2XGC A;  1O4X A;  3O8G A;  3Q0W A;  5EF6 A;  5K7Z A;  2JWT A;  2YS9 A;  3JRF A;  1JKP C;  1UHS A;  1W0T A;  2COB A;  3C2B A;  4X1E A;  1ZKG A;  1UMQ A;  2XB5 A;  2Y30 A;  3IH3 A;  3QPL A;  4C3J J;  3JRH A;  2LP0 A;  3FK7 A;  1AHD P;  4A3J J;  2K9S A;  3IH4 A;  1IG7 A;  4M3D A;  1DU6 A;  1AKH A;  3BTC A;  4A3I J;  1ETQ A;  4D7N A;  4UUS A;  4FE4 A;  4BY1 J;  2HXI A;  1U9O A;  2LLK A;  4MLO A;  3S15 J;  2XB0 X;  2O9L A;  1E3O C;  4A3G J;  1ORK A;  2DMT A;  2YUS A;  2NOG A;  2XRL A;  1AKH B;  2W48 A;  3GBG A;  3K2A A;  2JA6 J;  3CQZ J;  1FIP A;  2DMQ A;  4UUS B;  2LTP A;  2K9N A;  2KT0 A;  4W1U A;  5EGO B;  1DU0 A;  5DS9 A;  4JX4 A;  1FJL A;  1Z0X A;  3RQI A;  3H3V K;  3CMY A;  2LR8 A;  1FTZ A;  1U9N A;  4DZJ A;  2R93 J;  1I6H J;  3BR3 A;  3HOY J;  5FLM J;  1G2H A;  4A3M J;  2CUE A;  5EYR A;  3VPR A;  2CRG A;  2DA4 A;  1TWA J;  2RAE A;  4JX6 A;  1MBE A;  2VI6 A;  2DJN A;  5E3O A;  2HOS A;  2L7M P;  2HOA A;  2DMU A;  4BBR J;  2HDD A;  3BTJ A;  1CQT A;  2OPT A;  1TC3 C;  1OJL A;  1YRN A;  3B6A A;  2P81 A;  1FIA A;  2DA6 A;  2L0K A;  1BW6 A;  1TWH J;  3HBL A;  3S2H J;  4A3E J;  1Y1V J;  2MGQ A;  3GTJ J;  2M2E A;  2EQR A;  4DW6 A;  1K83 J;  5F0H A;  4BBS J;  3HM5 A;  1YRN B;  2HI3 A;  2OF7 A;  1WCM J;  1QVT A;  1P7I A;  1RKT A;  1WGX A;  3LSR A;  2IAI A;  4HNV A;  1HDP A;  4DYQ A;  1B72 A;  5HOD A;  5K7F A;  4RBO A;  4D5F A;  1ETY A;  2E2H J;  4GFB A;  3A02 A;  3QQA A;  2MW8 A;  3BQZ A;  5FKN A;  3BR5 A;  1X2N A;  3S16 J;  3NAR A;  5FJ8 J;  3RZD J;  5J1Y A;  1NK2 P;  5J1R A;  5F04 A;  1B72 B;  1JJ8 C;  4BXX J;  1VF9 A;  5IOZ A;  5BNG A;  2DN0 A;  1B8I B;  2YU9 J;  5FLV A;  3GTK J;  1SFO J;  3A01 A;  2XPW A;  1HF0 A;  3GTP J;  2B63 J;  5F08 A;  4M3F A;  5EZH A;  3TP0 A;  1P7J A;  1RKW A;  2DA7 A;  2GLO A;  1T56 A;  4DYR A;  2ZB9 A;  5M3M J;  1ZQ3 P;  2MSY A;  3Q0V A;  3HKZ N;  3S14 J;  3G1O A;  3A01 B;  3BR6 A;  1GV2 A;  2PMZ N;  2Y9Y A;  5F1J A;  4IHV A;  3MN2 A;  2AHQ A;  2FD5 A;  1X2M A;  4MIM A;  4Y52 J;  1GVD A;  4RDU A;  5M5W J;  1QRY A;  3MVP A;  4C3H J;  1GDT A;  2L9R A;  4UUT A;  3BT9 A;  5C4J J;  3FIS A;  5J1U A;  5IP7 J;  2CQX A;  3BTI A;  4C3I J;  3OOU A;  4FIS A;  1ETO A;  5DTD A;  2M8G X;  4M6V A;  3PO2 J;  2DTZ A;  2I10 A;  1U78 A;  1POG A;  2XGD A;  2LFB A;  2VUM J;  5M5X J;  2E2I J;  4JYK A;  5EGO A;  2D5V A;  2NVX J;  1BW5 A;  3GTG J;  3OSG A;  4NDL A;  4J19 A;  1X58 A;  5C4X J;  1MNM C;  3CDL A;  2ECC A;  1BA5 A;  2WAQ N;  3A03 A;  3BG9 A;  5JLW A;  2XSD C;  1I3Q J;  1WPK A;  1JGG A;  4FCY A;  1WH5 A;  2NS7 A;  5J3L A;  4JX5 A;  3S1R J;  3I4M J;  4M3E A;  3LOC A;  3BTL A;  4FE7 A;  2NS8 A;  3ZQC A;  5GPC A;  3HEF A;  1XC5 A;  2JK3 A;  4A69 C;  1ETW A;  2JA7 J;  2HYJ A;  1F36 A;  2EZH A;  2Y0S N;  5GP9 A;  5GPA A;  1HLV A;  3JRA A;  3ZQG A;  3HGG A;  4AUX A;  1LFU P;  2TRT A;  3M3Y J;  3FKI J;  2FQ4 A;  1JTX A;  5IP9 J;  5E3N A;  1XG1 A;  3Q3S A;  1TWC J;  2O7O A;  1ZTR A;  3NAU A;  1JT6 A;  2X48 A;  1HCR A;  1Y1W J;  3QPS A;  1GT0 C;  4L5E A;  2H1K A;  2ME0 A;  1TWF J;  3HOW J;  3DCF A;  1RPW A;  3JRD A;  3JRC A;  2R0Q C;  4QSH A;  2LKX A;  2WV1 A;  3S1M J;  1MBK A;  4V2G A;  5EG0 B;  3HOU J;  3S1N J;  1IUF A;  1MBJ A;  2K40 A;  3BR1 A;  2IEK A;  5FKL A;  2CUF A;  1B8I A;  2DA2 A;  1ZGW A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...