4A69C

Structure of hdac3 bound to corepressor and inositol tetraphosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'KFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE DEACETYLASE 3,
publication title Structure of Hdac3 Bound to Co-Repressor and Inositol Tetraphosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 19
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a69C00
2OPTA 2YS9A 4V2FA 3PO2J 3BG5A 2EQRA 1HDDC 2XB0X 5IP9J 1OJLA 4BKXA 2KDZA 2ZB9A 1XG1A 1GDTA 2GBYA 4MO7A 3HOUJ 2JMWA 2LP0A 3E7LA 3ZQHA 1B8IA 4AYBN 1R9TJ 1MNMC 1W0TA 4A3MJ 5FKLA 4IHWA 4X1EA 4MLOA 2HXIA 2FJ1A 1JT6A 2I10A 1FEXA 4I76A 1POGA 1GV5A 3H3VK 2KT0A 3B6AA 2LD5A 1OCTC 3O8HA 2NS7A 3HKZN 1JUSA 2G0EA 3HEFA 4BBRJ 1UHSA 1D5YA 1S7EA 3RZOJ 4DYCA 2CQQA 2LVSA 2E2JJ 1JJ8C 4MFDA 3ZQCA 1VFCA 4RDUA 3JRFA 3JRBA 1IDYA 2EZKA 2ME0A 3TP3A 3UKGA 2HDDA 1JKPC 5IOZA 3GTOJ 3S15J 2L7ZA 4IEJA 2QCOA 4HNVA 2R0QC 3MKLA 5E3MA 1IRZA 3Q0VA 1MBJA 5M3MJ 1AU7A 2LY9A 1TC3C 1BJZA 4C3JJ 3JRCA 4XRMA 1YRNA 1FIPA 2E2HJ 2R5YB 1EF4A 3M3YJ 3LSJA 1A5JA 1X2MA 1JUMA 3MVPA 5EG0A 1Z0XA 1LE8B 3M4OJ 4DYQA 4D5FA 3LSPA 2YUSA 5C44J 2Y0SN 1RR7A 4A3EJ 2FX0A 1GUUA 2GLOA 3FK7A 2X9DA 3DEWA 1ZTRA 3RZDJ 3HOYJ 2JWTA 3S1NJ 2O9LA 3A01B 5GPAA 2AHQA 1WPKA 2CU7A 2LK2A 4UUTA 3LNQA 4D7MA 2MGQA 3CDLA 2DTZA 1BL0A 2XRLA 4BY1J 2Y2ZA 1K61A 3HOWJ 2HQ5A 5F08A 5FKMA 5EGOA 4A69C 5M5XJ 4QSHA 1FIAA 3HOVJ 4X6AJ 2LR8A 2EBIA 2WAQN 3QPSA 3HOXJ 5IYCJ 4JYKA 3TEDA 2WB1N 2L9RA 3BR3A 1ETOA 3S16J 3K7AJ 3JRIA 4G12A 3ZQGA 2NS8A 3A03A 1ZK8A 3SFIA 3C2BA 3HGYA 5FKKA 2O8KA 2HOSA 1BW5A 3CMYA 4M3EA 1I3QJ 4M3BA 4JX4A 2L0KA 1CQTA 1MH3A 1AHDP 2XB5A 2H1KA 1SFOJ 2CUEA 4MFEA 3BR6A 3S17J 1VF9A 2D5VA 2ELKA 4C3HJ 5FKNA 3GTPJ 5IPAA 1K83J 1TWGJ 2HXOA 2DA3A 3IH4A 1W0UA 2EZIA 2IAIA 2NVTJ 3PM1A 2R5ZB 1JTYA 1WH7A 4W1UA 1MBFA 3BQZA 5EZHA 5EZGA 2E1OA 4FE7A 4DZPA 3BQYA 4IHYA 1F36A 5M5WJ 1IJWC 2MSYA 3OSFA 5EDNA 2QF7A 4IHXA 3NAUA 4JP0A 1ETQA 1U78A 1JKRC 3BR1A 4UUSB 3GBGA 3H0GJ 4DZJA 3FK6A 3TP0A 3Q0UA 4CYCA 1X2NA 3BG3A 5IP6A 1UG2A 1ITYA 4V2GA 5EYRA 3K2AA 2P81A 2LTPA 1WGXA 1AKHB 5F0HA 2EZHA 3W6VA 2VKVA 2XGCA 1P7IA 2DMTA 3ZQFA 1FTTA 4D7NA 4EEFG 1RKWA 1ETVA 2HOAA 3RQIA 2CQXA 1H89C 1WI3A 3OIOA 1JKOC 1PUFB 4Y52J 2VI6A 4M6VA 5DTDA 2JA5J 1NK2P 1RETA 3S1MJ 3WHBA 2K9NA 2XGDA 1IV6A 1NTCA 1HCRA 3ZQLA 5E3LA 1ZGWA 1P7JA 5IP7J 2Y9YA 1RKTA 4M3DA 2XSDC 2LFBA 3SJMA 4QIWN 3S1RJ 5J3LA 2R92J 4QTRA 1JJ6C 5GP9A 2FD5A 2EH3A 1B72A 3S1QJ 1FJLA 2CRGA 3ZOBA 2N8GA 4B1RA 2JA8J 3FISA 3G1MA 1DU0A 2ME6A 4MIMA 2DMQA 2CJJA 1B8IB 1Y1VJ 2M2EA 1JKQC 1XS9A 2OF7A 1BW6A 4FE4A 4JX5A 5F27A 2DMNA 2RAEA 2JJ7A 1F43A 1IDZA 3OSGA 4XICA 2X48A 1IG7A 3HM5A 4GFBA 4D5CA 4B4CA 1H8AC 1DU6A 4FISA 1IGNA 2E2IJ 4C3IJ 4DW6A 3JREA 1JGGA 3HDDA 1QVUA 2L7MP 3BTLA 1MSEC 1NK3P 2ECCA 5FLVA 1ETKA 1JUPA 2M34A 1HLVA 1ETWA 4BBSJ 1HOMA 3O8GA 2ID3A 3TW6A 9ANTA 3FKIJ 1ZKGA 3GTLJ 3MN2A 1GVDA 3I4NJ 4I6ZA 4FTHA 1GV2A 5K7ZA 2JN6A 2L7FP 1LFBA 1ENHA 4J19A 1YRNB 3BR0A 3WHCA 3RKQA 1U9NA 4W97A 1U9OA 3NARA 5EG0B 4Y7NJ 2XPVA 2VUMJ 2HOTA 3JRAA 2E19A 2XPWA 3JRDA 3GTQJ 2R5YA 2XGEA 1TWFJ 4FCYA 2K9QA 1I50J 1MBGA 1ORKA 1LE8A 1Q1VA 5M5YJ 5IYDJ 2K9SA 1QRYA 3ZQIA 2ECBA 5FJ8J 3LSGA 1HF0A 1VI0A 1O4XA 5F0FA 5K7HA 3HB9A 5J1RA 4A3LJ 4S0HB 2DMPA 3A01A 2Y9ZA 3BTJA 3OOUA 2VKEA 2YU9J 5E3OA 4A3KJ 5EF6A 2W48A 2TRTA 1Y1WJ 2H8RA 5EGOB 1VNDA 1JTXA 5BNGA 3GTMJ 2K40A 3SDGA 2FQ4A 5EEAA 5FKOA 1ZQ3P 3CQZJ 1FTZA 3L1PA 5IOYA 3JR9A 4A3JJ 5JLXA 2Y31A 4IHVA 2R7ZJ 2PMZN 1OFCX 2DJNA 3JRHA 5C4JJ 2DA6A 3I4MJ 3Q3SA 2B63J 1T56A 3IV5A 2IEKA 5F04A 2X6OA 1MBHA 2NVYJ 1HDPA 3JRGA 3BT9A 2COBA 2MG4A 2DA1A 1Z77A 1MBEA 4ABZA 3GTKJ 4RBOA 5F1JA 1ZR4A 2DN0A 2HYJA 3CCYA 3IH3A 1LFUP 1IUFA 5C4XJ 4L5EA 3QQAA 2IBDA 4NDLA 3BTIA 1MSFC 1U8BA 3GTGJ 4A3FJ 1MH4A 1T33A 3S2HJ 2M9HA 5JLWA 1SANA 4JX6A 2R5ZA 1X58A 2R93J 4B3AA 2EZLA 2DA2A 4A3GJ 5DS9A 2JK3A 3BTCA 1QPIA 3QPLA 3F0CA 4AC0A 2CUFA 3HGGA 2HI3A 2Y30A 1TWAJ 2DA7A 2GM4A 1A6IA 4BXXJ 2DA5A 4A93J 1WCMJ 5M3FJ 3HBLA 3TW7A 4XRSG 3LOCA 2JA6J 2JA7J 4A3CJ 3VPRA 1ETYA 3D1NI 4CYCB 4M3FA 1BA5A 3G1LA 3BR2A 5E3NA 2XPUA 1UMQA 3DCFA 5K7FA 4XRSA 4UUSA 2LLKA 4A3DJ 4M3GA 4LOCA 5J1YA 1ZR2A 5GPCA 1TWHJ 1APLC 1JT0A 2WV1A 5IYBJ 3S2DJ 1E3OC 4A3BJ 2MW8A 2M8GX 1RESA 1AKHA 4DYRA 1XC5A 1OCPA 3Q0WA 4A3IJ 1H88C 1IC8A 5C3EJ 5FLMJ 2M0CA 1I6HJ 2AO9A 1RPWA 1GT0C 4AUXA 4BY7J 3G1OA 5HODA 2NVXJ 2ID6A 2DMUA 1PUFA 1G2HA 4XIDA 1ETXA 2VPRA 3HOZJ 1WH5A 2LKXA 3B6CA 3BR5A 2DA4A 1MBKA 1TWCJ 2O7OA 1QVTA 3BG9A 4C2MJ 3S14J 3GTJJ 3LSRA 4XK4A 2NOGA 3A02A 1B72B 3FIWA 2TCTA 2NVQJ 5F0CA 5J1UA 3PO3J 3IH2A
chains in the Genus database with same CATH superfamily
2YS9A 2B7EA 2LMDA 1UHMA 2VC1A 5ICCA 2GQQA 1MMNA 1U5TB 2VONA 4MHGA 3PNYA 2AXLA 1OJLA 2QZ8A 4BKXA 5CVIA 3SEZA 3C3WA 2KDZA 4XLNF 2ZB9A 2FBIA 4LIVA 1XG1A 1VQKI 4HZFA 4EJVA 4BE0A 2QGUA 1QZZA 3ZQHA 3UNGC 4B43A 1IRFA 5FKLA 4IHWA 1YS7A 1FP1D 2DFFA 1JT6A 1NG6A 2BY3A 3GWZA 4B48A 1FEXA 3ASNH 4M9ZA 1GV5A 4U88A 3S32A 2F4MB 2VQCA 2KT0A 1FLIA 2ZBKA 4EGYA 1FP2A 3HKZN 1JUSA 2G0EA 1DPRA 3HEFA 2E1MC 3DKWA 4ZYEA 3RI4A 3VDXA 1UHSA 3RZOJ 4KYWA 4RM2A 1IN5A 2CQQA 4KJZA 3HRMA 2EV5A 4XLPF 1K78A 3F8NA 3JRFA 2MC4A 4WXDA 3GEZA 3TOBA 2ME0A 1W7PB 3C18A 4OMZA 3SFZA 2DOFA 2QA4I 3S15J 1S7OA 3IKVA 3KP4A 5ICGA 1VQ8I 3OYKA 1IRXA 4GGGA 1IRZA 3I59A 3KEQA 1BIBA 5LFAA 1LVAA 5E79C 2A07F 2WY7Q 3FM3A 2CQKA 1G8XA 1TC3C 3ABKH 3P9CA 2STWA 3DLAA 4HNTA 3CCEI 1A5JA 1TW3A 2CMPA 1Z0XA 2VQGA 5FO5A 3GF2A 4HF2A 2RQQA 2HU9A 3C7JA 2UV1A 3H1CA 2ESHA 4PDKA 5K5QA 5HDKA 1JE8A 1RR7A 4FQGA 3HOTA 2FX0A 4CZCA 4WXCA 3WTVC 2JWTA 1F9NA 3ROUA 5GPAA 3WTTC 2P7CB 2ZJPF 3MD2A 1Y8QB 2CU7A 1FPQA 2R7WA 4LK0F 4D7MA 3IHUA 1T98A 2YU3A 3IRQA 4BY1J 3LSHA 3T8TA 1JI8A 4UB8C 4I99C 1BIAA 4GO1A 1R1TA 5F08A 5FKMA 1OYYA 3QYEA 4A69C 3CCQI 2MA3A 2YR2A 3RKWA 3DPLC 2KIMA 2LR8A 2XASA 2O8XA 3VSLA 4EM0B 4JYKA 3O6BB 4U0WA 5FFZA 2E5NA 1VQOI 1ETOA 3J80K 5HS8A 3S16J 2E1MB 5DM6F 3SQNA 1SD7A 2PQ8A 3KFWX 3I5UA 2NS8A 1ZK8A 3SFIA 1WFXA 1O3TA 2FA5A 3C2BA 1LPQA 5E17F 2RGVA 3E97A 1A35A 3BJ6A 4II2A 2HDWA 4M3EA 2WWYA 2L0KA 1CGPA 1CQTA 2GXAA 1AHDP 1T0FC 2HVSA 3A2KA 2DPUA 3OIQA 1IN4A 3MMYB 1XCBA 3CP2A 3E5XA 5FLXZ 2V1UA 2CUEA 2FE3A 4LLLA 3BR6A 4MTDA 1BI3A 1VF9A 2CW7A 3KP7A 3GZ6A 2ELKA 2A6HF 4M71A 5FKNA 4C3HJ 2D5VA 2ISYA 3GTPJ 1SAXA 2NYXA 2PX9A 4L9VA 1K83J 1V54H 3K1MA 3L2CA 3PM1A 1SFEA 3K4LA 2XHKA 1D8JA 1GXQA 2OJED 1MJ9A 2E1OA 4ZDOA 1YTYA 2CO5A 2QUFA 4ZYAA 4AD9A 4FE7A 4RGXA 4IHYA 3R6SA 3OL4A 2XAUA 5CVJA 3BZKA 1VQPI 4I7HA 3ZXSA 2V9PA 4JP0A 1RNLA 2HOEA 1EH6A 5HDGA 4ZTJA 1CF7A 5ICFA 1JKRC 3GW2A 3BR1A 1N77A 2L3DA 4WCGA 1A31A 3TP0A 2R7XA 4G7ZF 2P8TA 2XV4S 2EWNA 2ELJA 4CYCA 3DBHB 4KICA 2ZXIA 2IXSA 5LEKA 3KP6A 1ITYA 3GMEA 4S05A 3SZGA 2P81A 1AKHB 2C6YA 5F0HA 2LKPA 1OKRA 3CLQA 3W6VA 3H5NA 3MKWB 2ZXHA 4LB5A 4YIIA 5BS6A 1USSA 1PDNC 1ERDA 4EEFG 5D5WB 1HW2A 1KQ9A 1ETVA 2HOAA 1HW1A 3OR1C 4WF2A 2DBBA 4IQ4A 1OYWA 4Y52J 3G2BA 4K2EA 1NK2P 3HZJA 4IL6C 2XGDA 3E0JB 4LJZF 3BC8A 4GYIA 1P7JA 1I27A 3RPUA 5IP7J 3J7YJ 2AQFA 4UVAA 5E1ZB 3N4MA 2LREA 2BOLA 1MKMA 3SJMA 5J3LA 2DODA 2A5YB 1FBUA 1JJ6C 5GP9A 1B72A 1YOVB 5KHDA 5AIQA 1Z7LA 2QQBA 3P5JA 1YIJI 2DQLA 3T1BA 3ZMTA 2ZMEA 1Z3YA 2LSOA 5LRSA 1DU0A 1MNDA 4IOAF 1T6SA 1LUJB 2EIKH 3H5AA 4BHCA 5JVTA 1BOAA 2DTRA 1B8IB 1YJ9I 2LF7A 4HG2A 3OS2A 1XS9A 2GOXB 4KT5C 1BR1A 4PSWA 2IS2A 2Q1ZB 2Z3YA 4QLCU 5F27A 3P7NA 3K4NA 2CH0A 3VYSB 3HM5A 3CLOA 1E3PA 3W3CA 1N25A 4PJ0C 1LQ1A 4AU7A 5ERIA 2VIXA 2Y0SA 4M9SA 4Q5SF 2QQ8A 2DXIA 4ESBA 4UHTA 4UY8I 3BG6A 3BOQA 1ETKA 4L0YB 2FBHA 4E7SA 2BHYA 2DOEA 4Z6YA 4KN4X 5LHIA 1OYIA 4G6DA 4IQJA 2CYYA 3I4NJ 5DD8A 3U1DA 4LMYA 4ENMA 4P96A 3WHCA 4CCOA 3F3XA 1Y8RB 1U9OA 3ABMH 2NNYA 5EG0B 4Y7NJ 2XPVA 3CC7I 2HOTA 3GO5A 2WB1A 4BXUA 3WTSC 3CUOA 2JVGA 3OIPA 2R5YA 4M73A 3QAHA 2IGMA 2K9QA 3FXMA 1ODDA 2FSWA 3H92A 4Q48A 4OIOF 1WZ2A 4B44A 2HS5A 2BY0A 2E7WA 5D6FA 5IYDJ 1XD7A 5FJ8J 4AM3A 4YFNF 2R7SA 1R4MB 4E70A 5K7HA 1PP7U 3FMSA 5CKTA 2GWRA 2HVRA 1K6OA 2Y9ZA 3WU1B 5CYVA 3BTJA 3OOUA 3SDBA 2QKMB 3KYLA 3L2RA 2L4AA 3ZMVA 2TRTA 1Y1WJ 5EGOB 1J9IA 2WAFA 2VJJA 3OYBA 3FMRA 4PUSA 3N97A 5EEAA 1Z6TA 4DBRA 3R60A 3JR9A 4KN7X 4A3JJ 2HZTA 5JLXA 4IRGA 2LH9A 3KPHA 2HKOA 2L4MA 2EB7A 4ENKA 3C2HA 1OFCX 2BHZA 3JRHA 2Z9OA 2EPFA 3DEEA 5E8IA 3M8EA 3EUHC 2B63J 4GCVA 3U9GA 2F4IA 2MH2A 3Q9VA 2DT5A 1MBHA 3CDIA 4ZZDA 4P9FA 4DNCA 2COBA 3ZPLA 1Y0NA 3A4CA 2KPMA 3ECOA 1MBEA 2E1NA 4IPAA 3WTYC 4LFUA 3IC7A 3CCYA 4Z2YA 1LFUP 1IN6A 3BCAA 2V9VA 1LNWA 3TDUC 3CCJI 4ENJA 3K69A 1R36A 1OCOH 5HLIA 1WKMA 2HYFA 1DQUA 2IBDA 3BPVA 4NQWA 3LSIA 2D45A 4Q47A 2VXDA 1RUNA 4EQQA 2EV0A 3O2PE 4G7OF 4PCQA 4ZC3A 4JX6A 4N4NB 2R5ZA 2JRMA 3QYBA 2NAZA 3HRTA 3J81Z 3JW4A 3FX3A 2GA2A 3QPLA 3RJPA 3PSFA 5FFXA 2L7KA 2RNGA 5J4YA 2ZXWH 2DA7A 1NG7A 1YIOA 4Y15A 2IT0A 3TW7A 1HKTA 2KIQA 3HYIA 2JA6J 3VPRA 4B09A 1BA5A 3BR2A 2A6EF 2XPUA 3DCFA 3ZQQA 3F21A 3PFIA 5B3SH 2W82A 4OINF 2W57A 4LOCA 1TWHJ 2LRDA 4OWRB 4AIKA 5DYMA 1R1VA 1RESA 4RB3C 1MNEA 2XROA 1XC5A 3F72A 1J59A 1GLNA 4BYYA 5FLMJ 4HLYA 1RI7A 2HQNA 1I6HJ 2ZJQF 3ZCOA 2VASA 2UZKA 3GUDA 5GAEJ 3PL8A 3G1OA 1IF1A 2STTA 3AFHA 3FXQA 4MQ9F 1PUFA 1LB2A 1G2HA 4XIDA 1ETXA 3K0LA 3HOZJ 3OV8A 5D4SA 1P4AA 3WTZA 2WAQA 2FNPA 1NHAA 2X0LA 3OYCA 4F3QA 3HTUA 1TWCJ 5JVGF 4P5OA 1BI0A 4F91B 4BEHA 2R7TA 1KGSA 1KU9A 2KKOA 2NOGA 2H09A 4AIDA 2TCTA 1EA3A 2X51A 5K1YA 4IF4A 1DGRM 5K7FA 3F8BA 4BDZA 3FXKA 3TGNA 2X6XA 4V2FA 3PO2J 3MQ0A 4RA2A 2EK5A 4HNUA 1HDDC 3HPHA 4F7ZA 4R1HA 4BACA 2F48A 2X6WA 2E7XA 5FGMA 4KMFA 1IN7A 2VQHA 3C2GA 3JSOA 2P7VB 3NEUA 3E6MA 2ZO4A 2O3FA 3TOAA 2EV6A 2JRTA 1ZG3A 2WADA 3BZ6A 3L2UA 1VQNI 2K85A 1R9TJ 1TQPA 4OIQF 4DJAA 5E8GA 2Z16A 4A3MJ 2VL8A 4MLOA 5TJJA 4XORA 3L00A 2Y48A 2B0LA 4HDUA 3C1DA 3L2QA 4XNFA 4OIRF 1FOWA 1VQ7I 3AL0B 4XLEA 4NHJA 1ZELA 1S7EA 1ZREA 1UHWA 3I54A 3L09A 1JJ8C 3G4SI 1HBXG 3ZQCA 3R61A 4CICA 4RDUA 2CFOA 2M7BA 1LDDA 1HQCA 4FASD 3NWSA 5DV5A 2FMLA 4U87A 2NRAC 4CDGA 5IOZA 3V42A 1ZAOA 1D0XA 3MZHA 1I3AA 4RLQA 3V4GA 3TL4X 3ERED 4EM1A 1X19A 4A6DA 1ACIA 3CC2I 3ABTA 2PJRB 3KZZA 1XB4A 2EFWA 2CV0A 3AG4H 4BQOA 1R23A 1U5TC 2R7OA 4NC8A 1YRNA 2E2HJ 2OAZA 2YSRA 3LSJA 5EEHA 3BWGA 1OR7A 3MVPA 3M4OJ 2AS5F 5DEQA 1G4DA 1MMAA 3LSPA 1XMXA 4RGSA 5C44J 3H3UA 4YG2F 1QHGA 4BQNA 4A3EJ 5LGNA 2JT1A 1S8NA 2X9DA 3CP8A 3HHGA 5DCFA 3QP5A 2OTJI 1FSHA 1P6RA 4RAZA 2O9LA 3A01B 1UELB 1MGTA 2DK8A 2AHQA 1WRJA 4UUTA 1B59A 1O3SA 3LNQA 5HLGA 1SVOA 1UB9A 2YX7A 3CZ6A 2DTZA 1OCCH 3I9V2 2XDVA 2V1XA 2XRLA 3K2ZA 5LBQA 3FXJA 2VJ4A 3HOWJ 2HQ5A 5GAHJ 2R7DA 5M5XJ 4PJNA 4QSHA 2FMYA 4ZTFA 2WAQN 4A5MA 3HOXJ 4F92B 4RGRA 3BR3A 1SC7A 4IHTA 2FU4A 2XKPA 4G12A 4ANJA 2P0WA 3A03A 3CESA 2WC2A 4HPQA 4OAZA 1SD4A 2O8KA 4AIJA 1TQMA 4JX4A 1ZG5A 4RLFA 3AG1H 2DFHA 5J40A 3EDPA 2YPRA 2H1KA 1TNTA 2VQLA 5H2FC 4HQMA 1WJAA 4WXHA 1R1UA 4LITA 4BL0B 1VQMI 1X1AA 3L7WA 5HLTA 5A2QZ 1YJNI 3F8MA 5IPAA 2ELHA 2F5EA 1J75A 1W0UA 3IH4A 4XRFA 5B1BH 5TRDA 2EZIA 4IVNA 1WH7A 1XCVA 4W1UA 3HPGA 3V7RA 1FY7A 4YIFA 5EZHA 5EZGA 2PFBA 2VBZA 4KDPA 1B6AA 2PI0A 5KCMA 3SZPA 2BGCA 2IVMA 1ZLJA 2FEZA 3FBIB 5LGUA 2L02A 1I6XA 3KIOA 2MSYA 1RR8C 3BG7A 4LLGF 1FMWA 1ETQA 1QZYA 3K4MA 4I0AA 4YELA 2NVUB 4OAYA 4H4KC 2QLZA 4UUSB 2VN2A 5LHGA 1JHHA 2EFPA 4XN0A 3Q0UA 4HBLA 1IUYA 2F5VA 1X2NA 5IP6A 2KIFA 2E60A 4BJ6C 3W6KB 1EJ9A 1XN7A 1R58A 5EYRA 1LVKA 4N9HA 2W00A 1ZG1A 3BCBA 4CCJA 4CA0A 2VKVA 2ETHA 2O03A 4R79A 3ZQFA 1YX5A 4HA8A 2E5ZA 2QENA 1WQ2A 4G6TB 3B73A 4PK4A 2HTJA 4E7HA 3MAJA 3KZIC 4A5NA 2VI6A 3HG9A 1V55H 3ZRGA 2Q8KA 4AYBA 5B5EC 3WHBA 1W1WE 2LG4A 1HCRA 2VOPA 5E3LA 4ZJZA 2VJIA 2F5DA 2FQ3A 3CMMA 2Y9YA 4EJTA 4E7IA 4C2TA 1AOYA 1YW7A 3JCUC 3MKZA 4QIWN 3KX2A 4E7ZA 3ZGKA 1SMTA 3VOEA 3F8FA 2VBYA 1QQIA 2EH3A 3ZN0A 2PEXA 2V4JC 3NRVA 1FMVA 4AVPA 1FJLA 2M0MA 4D0PA 2CRGA 3OL3A 3ZOBA 2N8GA 4B1RA 2JA8J 2PJPA 3TKYA 3ERMA 3QU3A 1U5TA 3I4PA 2ISZA 2RN7A 2YX4A 2FOWA 4UUVA 2Y75A 4RB2C 5CVRA 1FOKA 4FT8A 1Y1VJ 4WX9A 4NB5A 4ZZLA 2M3AA 2ZNZA 2OF7A 4YFXF 1BW6A 4JX5A 1D5VA 2VBWA 2Q2EB 2D1HA 3RTRA 5AIPA 3K70D 3OSGA 1WWXA 2X48A 3GLXA 4CO8A 1T39A 1IG7A 3JAMZ 4H0EA 4D5CA 2LBFB 2F6CA 1D1CA 1IGNA 5EJCA 4DW6A 3K4BA 5DM7F 5LEJA 2EA4A 5GADJ 2JVHA 4NC6A 2R3SA 1MSEC 4MQVA 4UNOA 1YW8A 3M1EA 2M45A 1Z1DA 4RM3A 3ABUA 3M7GA 4UV9A 1FYMA 4EM2A 5EEGA 5KAIC 2FF4A 4HF1A 1SD5A 1HLVA 1I1SA 3E6DA 1MMSA 3TW6A 2XAFA 3CCMI 1FBSA 1XGOA 3FKIJ 1O3QA 9ANTA 1ZKGA 1W7PA 2DPDA 1QHHD 1V4RA 1W36D 2XAGA 4E7KA 3OR2C 2KMUA 3KP2A 1DP7P 1I39A 2L7FP 4X0GA 2BY2A 3QRFF 2VKDA 3V8KA 3RKQA 4LIUA 3V8JA 2QQ9A 4J00A 3HC7A 3Q5FA 1YYVA 2E19A 3JRDA 3GTQJ 2GXBA 1IO2A 4XOTA 1OCZH 3P9IA 3K1PA 3LFKA 1ZGJA 2ECBA 3LMMA 3IL2A 5E1WA 5ILSA 5L3EA 2QWWA 2ZFWA 3HB9A 4A12A 1SEUA 4KT6A 2OCEA 4A3LJ 4S0HB 2LY1A 2VPLA 4I0BA 1J0RA 2YU9J 1MDMB 4O3MA 5E3OA 2NOJB 5EF6A 4XKWA 1JTXA 5BNGA 3VYRB 3CCLI 2F5CA 4OOIA 5LLQA 3FZVA 3GFLA 3H9GA 5FROA 2DT6A 5IOYA 2OQGA 3RIRA 4MNUA 5DDGA 3L1PA 3I58A 2W84A 1P4WA 3W2VA 1MW7A 1Y56A 1FZPB 2HDCA 1YW9A 3QU6A 2QEXI 1VQLI 5IT9Z 4KNYA 2DA6A 3HJEA 2UUZA 2O0YA 4HV5A 4XL9A 3IV5A 2X6OA 1TT5B 1Z7UA 3K10A 2V7FA 2Z33A 2HVQA 1HDPA 2XF7A 2E36A 4L9NA 4A0XA 3JRGA 2ZSHB 1QNTA 5CVVA 1H9TA 2DA1A 1Z77A 2OTLI 5J8CA 3GTKJ 5GTHC 5F1JA 2B9SA 1BC7C 2W4SA 3U1KA 1D0YA 3IH3A 4DGWB 4IO9F 3ZMSA 4LG0B 1QA6A 2QYOA 2E35A 1G3TA 4L18B 1H9GA 2DCEA 3S8PA 1R5GA 2UXNA 4ESFA 3FWEA 4L5EA 3FKJA 3J7ZI 1D1BA 2VE8A 4NDLA 1E3HA 2VB6A 4MEXF 4IJAA 1KU7A 2XRNA 1MH4A 1X1DA 2IA0A 2R7UA 2V26A 2IPQX 5JLWA 3FM5A 3GFMA 4O6JA 4ZDLA 1SANA 1T2KA 2QBYB 2R93J 2F4OB 2VT3A 2X6YA 1F5TA 2DA2A 4A3GJ 2UXXA 4E4HA 2CQ7A 3OOPA 4U7BA 4AC0A 2CUFA 3HGGA 1BBYA 4G9YA 4XR6A 5GAGJ 3IAM2 3E3VA 1WJBA 3F9KA 1TWAJ 4S04A 2GM4A 2BW3B 2EIMH 4BGDA 4LB6B 2A68F 3HHHA 2JA7J 2VT2A 2RDPA 2CW8A 4A3CJ 2DI3A 3G1LA 1MJBA 4XRSA 1R6RA 2K3FA 2X1CA 1QO0D 1HA8A 4OIPF 3E1SA 3MZYA 5J1YA 5D6EA 2Q0OA 5GPCA 3L2WA 3H9JA 5K5RA 4A3BJ 3U21A 1TT0A 3FXLA 5HNHA 4CXFA 2AQEA 1AKHA 5FRNA 2CSOA 1OCPA 4L0ZB 2RNJA 3TO9A 2JA2A 2PN6A 1B4AA 3ZQ7A 1T8IA 2MH9A 1IXSB 5CLSA 3TO7A 2K5CA 5DCMB 3V8LA 3DBLB 1R4NB 5HDNA 2LC2A 4YEJA 2O6GE 1USTA 4CH7A 5HODA 2QVOA 3PIPF 2NVXJ 4OMYA 5IT3A 1N78A 2VPRA 2LKXA 4HF0A 4OU0A 1WSUA 2M87A 2JPCA 2LYCA 2DA4A 4M6YA 4HYEA 1T0FA 5D5VB 2L9VA 2O7OA 5DD4A 3GFJA 2VOOA 2XF6A 4XK4A 3RSNA 4ON0A 1YI2I 1G3WA 5J1UA 1H0MA 2LOOA 3DTIA 3RPUD 2IGNA 4IXAA 3ONQA 4HOBA 4Y13A 3UR3C 3A0BC 1TBXA 2R7FA 3HSFA 3ABLH 2K9LA 3CTAA 5IP9J 3M9AA 1BC8C 3E6BA 3K1NA 2RREA 3V7SA 2G7UA 2XSJC 3EYIA 3MZ8A 4A2UA 2H6CA 1QZEA 3CF5F 4U0VA 3E5UA 4EJUA 4HW0A 2GBYA 2HGCA 2HQRA 4MO7A 2GZWA 3HOUJ 1FC3A 2JMWA 2XGXA 1B8IA 2DDBA 3HUGB 4CCKA 2JSPA 1TQIA 1X4OA 2HEOA 4X1EA 5ILUA 3T0YA 1X3WB 2HXIA 3SHFA 2I10A 5ED4A 3ASOH 4I76A 1POGA 3H3VK 4EJOA 1PJRA 3GLLA 1R00A 2NS7A 2BZTA 3O8HA 2Z1DA 2GIVA 1AA7A 1G3YA 1G59A 3VYUB 2X85A 3J80Z 1UAAA 2A05A 1D5YA 4ENNA 2GA1A 4DYCA 3G71I 1LJ9A 5HVQC 1WI9A 4MFDA 1VFCA 2EFOA 3R0JA 2CUJA 3KEOA 3JRBA 1IDYA 1BOBA 2E34A 4NUBA 3TP3A 2D2WA 2DYRH 4ZYHA 2HDDA 5CQGA 3W2WA 2QCOA 3MKLA 2QQAA 1QU3A 2M8EA 5E3MA 1KYWA 3OMYA 3EQLF 4E6KG 3EPZA 3RCOA 1MBJA 4O5VA 1T95A 3EUAA 1YG2A 3PIOF 1AU7A 1FWZA 2XAJA 2X4HA 3DKYA 4ZYDA 1BJZA 4C3JJ 3JRCA 5E20A 1STZA 2PMZA 1X2MA 2BVMA 5EG0A 2V1NA 1LE8B 5GTIC 4DYQA 2DT7B 1D8KA 2RVCA 2H8WA 4D5FA 3OYNA 2OA4A 4JK1X 2YUSA 2M4GA 1K4SA 2ADUA 2K02A 2Y0SN 2CV1A 1BI2A 3VFZA 1XMAA 3FK7A 4BJTA 3HOYJ 1BR4A 5KNLA 4MGRA 3S1NJ 1U3EM 1OMIA 2PLYA 1X1PA 1WPKA 2LK2A 3L2VA 3F8CA 2P6TA 4TV7A 4EJWA 1I5ZA 2EFNA 2MGQA 3CDLA 1L0OC 1BL0A 3VODA 2JQ7A 2OU2A 3B02A 4FETA 4BS9A 2FNAA 2Y2ZA 1DUXC 1IXCA 1K61A 2E1CA 3AL0C 1FTZA 5EGOA 1XGNA 2QKLB 4HX7A 2PG4A 1FIAA 3HOVJ 4X6AJ 3U2RA 3QPSA 5IYCJ 4XKVA 1YJWI 2BYVE 2WB1N 3CUQB 3HTSB 3OWTA 1SVLA 4C30A 2ZJ2A 3K7AJ 3ZQGA 2CG4A 3BJOA 1WJCA 1Y0UA 4UXNA 3HGYA 5FKKA 1QPMA 3LAJA 1ON1A 2HOSA 1BW5A 3CJRB 3I71A 1I3QJ 3IWZA 4HSRA 4M3BA 3RKYA 2DYSH 4B8XA 5LD2C 1E0EA 3KYDB 1MH3A 1VZ0A 3KE2A 2V6CA 2XB5A 1WJDA 1ZH5A 2WBMA 1RZ4A 5BOXA 1S5LC 1I1GA 1IW7F 4ZYGA 4WK8F 1QBJA 2JPBA 1P9QC 3GYHX 2HXOA 4UVBA 1MMGA 1B1BA 2NVTJ 5L3FA 1JTYA 1MBFA 4DBQA 3QPTA 3W6JB 2G7HA 1GVJA 4E7LA 1SMYF 3I3LA 3K70C 3FHZA 4DZPA 1T38A 1E17A 2KQRA 3DTEA 1KQ8A 1F36A 4XBFA 2BE5F 4F52A 1BJAA 2Z99A 2QF7A 4IHXA 3NAUA 4LD5A 1U78A 5LGTA 2IJLA 4II3A 2L9SA 3PFYA 3MWMA 1PVEA 3FK6A 1JGSA 2DAOA 3VSKA 3BG3A 1FYKA 4V2GA 3K2AA 3GX4X 2R7RA 4ESJA 3DP7A 1W36C 2XGCA 1P7IA 2P5KA 5H6RA 3M8FA 2ZXJA 2DMTA 1MD0A 3CO6C 1FTTA 1A36A 4D7NA 2KP6A 3LL7A 1SVMA 2CQXA 1WI3A 4XONA 3EUKL 3WG9A 1Z9CA 3TO6A 4M6VA 3QOPA 5DTDA 4B47A 2JA5J 3EUHA 2GAUA 2JZYA 4M6XA 2CV2A 2K9NA 4XSXF 5FLXK 3ZQLA 3VWBA 1W5SA 1ZGWA 1X1CA 4M3DA 1RKTA 3RQ4A 1V5EA 4I01A 2XSDC 4AIHA 1SFXA 2CUZA 1X3ZB 3S1RJ 1JHFA 2P5VA 2R92J 3R4KA 4RAYA 4QTRA 3IAS2 1G6NA 2NNNA 2FD5A 2HFHA 3TBIA 3S1QJ 4HSTA 3KZYA 1G3SA 3TDZC 2X1DA 3JTGA 3KP5A 3FISA 2L5QA 1MZBA 5KAFC 1Y6IA 2H1LA 1XX5A 3OYLA 2ACJA 3DV8A 2DMQA 2VJ5A 2CJJA 2KJBA 5FD5A 5F6FA 5BPIA 2L2OA 3DPUA 5LHHA 1ZRCA 1UZCA 4NC7A 2KL4A 5K5OA 4FE4A 3JTHA 4XKCA 1UCRA 2GIZA 2JJ7A 2VKHA 4RB1A 4JQFA 4XICA 4V19K 2R7QA 2NXNB 3S3NA 1VQ6I 3IWFA 4B4CA 4Y17A 1TTYA 2J5OA 2E2IJ 4C3IJ 2F2EA 3JREA 3BDDA 2A61A 3ESWB 3FXOA 2G9WA 1J2XA 5L3BA 3HDDA 2XKOA 1K78B 2WA0A 2L7MP 2ECCA 4U0YA 4BJ5C 3OY9A 5FLVA 4U7DA 4JOMA 1DGWY 1JUPA 2DLLA 1ETWA 4BBSJ 3TMOA 3O8GA 1HOMA 5TGTA 4CYDA 2XAHA 5ICEA 2I8DA 3J7AO 1OQYA 3I59B 3CCRI 3MN2A 3PQJA 4FTHA 1YFHA 4IZZA 5ILVA 4Q4ZF 2XIGA 3MEXA 2V79A 5K7ZA 2RQPA 1TLHB 2BY1A 2KLOA 4J19A 3FXUA 4XN3A 3WE2A 2PJRA 1YO5C 1FX7A 4QWQA 3DU5A 1MIJA 3WODF 2VODA 4ASNA 2ZC2A 1TW2A 3H0DA 2XPWA 4Y3OA 3IP4B 3WGHA 1TWFJ 3ELKA 2Y69H 4XQFA 2H94A 4A0ZA 1FNNA 2K7LA 1IZ1A 3RKXA 5F1RA 1MBGA 1J09A 4HX4A 2A3SA 3JSPA 1Q1VA 2W85A 3M8JA 5M5YJ 4HDVA 1QRYA 3I64A 5B1AH 3LSGA 1HF0A 1VI0A 1O4XA 2JUGA 3E6CC 5F0FA 4XSZF 3PUBA 3DKXA 1IAWA 3A01A 4MTEA 1AWCA 2MLGA 4N4OB 5CQEA 2VKEA 3KLOA 3ZMDA 3DQVC 5D8KB 2MD0A 2W48A 1VQ4I 2DW4A 3GTMJ 2CS3A 2K40A 2HPMA 5FKOA 1BM9A 2P5LC 1ZQ3P 3CQZJ 3GXOA 4NBQA 3PQKA 1FOXA 2M4KA 4BH9A 4JBAA 2JUCA 2IW5A 2OZUA 1BI1A 1LEAA 4AVZA 2M7AA 2R4GA 2COMA 5C4JJ 3I4MJ 3LA3A 3AG3H 3CC4I 4LLNA 1T56A 5KVRA 1S6LA 4ZH4F 2NVYJ 1BN5A 1ZARA 1P2FA 4CSWA 1U6GA 2P4WA 3P9KA 1V3FA 4ABZA 4RBOA 2FBKA 2HYJA 2A6TA 1D0ZA 2HTSA 5HOOA 1R22A 3LQRA 1XSXA 3WU2C 1IUFA 3CJNA 4PJJA 2K4BA 5C4XJ 3H36A 1Z3XA 4KUMA 1RC9A 4UVCA 3H3ZA 3QQAA 4I98B 3QP6A 5FRMA 1XTAA 1V5FA 1RIOH 2ZMEC 4D9JA 1MSFC 3GTGJ 3S2HJ 1Z21A 3AG2H 2M9HA 3RYPA 1B9NA 1X58A 3WTXC 3DXJF 3OYHA 2WY8Q 1WJEA 3BJAA 2MD5A 5DS9A 1W5TA 3BTCA 1QPIA 3F0CA 5DUKA 5HS7A 1TNSA 3RYRA 2JTVA 4G7HF 5JHUA 1CF7B 3T8RA 4BXXJ 1A6IA 2DA5A 3CO7C 1WCMJ 1ZLKA 2P6SA 2W25A 4XRSG 3LOCA 4RS8A 1S29A 3K4CA 4P9UA 4CYCB 2ZJRF 5E3NA 2DFEA 5D8LB 4UUSA 4RAGA 4FHTA 4L5JA 2LLKA 3CCVI 4A3DJ 1ZN2A 4XLFA 4Y33A 1ZR2A 1APLC 1JT0A 4IKFA 3F22A 4GDFA 1E3OC 4DYRA 3BPXA 3Q0WA 2KFDA 4A3IJ 1H88C 4ZDPA 5C3EJ 2DOAA 3Q9SA 5F64A 1HXDA 4L9TA 4N0BA 2AO9A 1D3YA 1Q1HA 1PUEE 1GT0C 4AUXA 1Z05A 4KMUX 2CWEA 3OYEA 2ID6A 1K6YA 3V7CA 1Y39A 1O57A 3AKZA 1WH5A 2XC7A 2W1OA 3H9QA 2BXZA 2VBXA 3BR5A 3K4JA 1QVTA 1WVRA 1EV7A 2XAQA 3BG9A 4C2MJ 3GTJJ 4UV8A 4YIRX 2A5WA 3NQOA 3CJQB 3A02A 1HKSA 3OS0A 1B72B 3FIWA 3WU0A 2NVQJ 4BDYA 3IH2A 2OPTA 4CCLA 3IUOA 2ZMEB 1HKQA 3W2AA 1DPUA 3BG5A 2EQRA 1YLFA 2L54A 3KLNA 2XB0X 3GCMA 3J81K 3H5RA 2TDXA 1B9MA 1A04A 4RAFA 3HIFA 3WG7H 1ONVA 4WWCA 4RMNA 2HYGD 1GDTA 1OISA 2IA2A 2LP0A 3O3KA 3E7LA 1MNMC 4AYBN 2V6EA 4HRIA 1MJAA 3G73A 2H27A 1W0TA 1RUOA 3QOEA 3J7AY 3HOSA 2FJ1A 4ETSA 3I55I 5KK1A 4J01A 3RPQA 2Q2EA 2WV0A 1OCTC 3B6AA 2LD5A 1XGSA 3I53A 3K6GA 4XOPA 2VC0A 2F5FA 2LBFA 5BPDA 3DWLE 1YE9A 4BBRJ 1HW5A 3HSRA 1SFUA 3ZP5A 2IS1A 4DQ2A 5J47A 2E2JJ 3E5QA 2LVSA 3DU6A 3QYFA 1FT9A 4BNCA 5L3CA 2ZKZA 3L9FA 5CJ9A 2EZKA 3UKGA 3M07A 1OCRH 3NWTA 4I2OA 1JKPC 3ZMUA 3GTOJ 2K9MA 2L7ZA 1FYLA 4IEJA 2R0QC 4HNVA 5LRRA 3DBRB 5BQTA 2HWVA 1REPC 1T08B 1VQ5I 3Q0VA 3ZN1A 2OUMA 5M3MJ 3CMEI 2LNBA 4A0YA 1LKXA 4I02A 1W7PD 2LY9A 1O7FA 1F4KA 1ZRDA 2UWMA 3ML6A 4XRMA 1FIPA 3HSEA 2R5YB 1EF4A 3M3YJ 4BAYA 2KRCA 5AONA 1JUMA 1EKEA 1UJ8A 3QODA 3R0AA 3ISPA 4IX7A 1N75A 4EMSA 2EFQA 1RRJA 3G6EI 1JXSA 3I0TA 1GUUA 2GLOA 3DEWA 2WAEA 1ZTRA 3RZDJ 3I56I 1U8RA 4KIGA 1S72I 3HL2A 2HQAA 2MYSA 2MBFA 4IRIA 1YS6A 4BQQA 1R49A 1TZLA 1MDMA 2FOKA 4C9YA 3DF8A 5TISC 2LY2A 4XLHA 2W7NA 2MABA 2DU9A 2VXZA 6PAXA 5JI6A 1GXPA 3CCUI 4YFKF 2EBIA 5E18F 4EATA 2QSFX 4PZJA 1KA8A 3CJTB 3ZR8X 3TEDA 2L9RA 3T5XA 4MEYF 2M1BA 3D5SC 1LFPA 3GVAA 2KRHA 4R8HA 3JRIA 1HC8A 4CGZA 3SYTA 2OQRA 5J6XA 3LA7A 5HNFA 3CMYA 3LSMA 4KIBA 2RV8A 5D4RA 5J8FA 1ZRFA 1SFOJ 4MFEA 2IS4A 3S17J 4D1QA 1FBQA 1WHUA 2QM3A 4NQWB 2OZ6A 4LG0A 5FD6A 2PMUA 1TWGJ 4G94A 3D5RC 2DA3A 1IRGA 2IA1A 2IAIA 2R5ZB 3BQZA 1KONA 2BEOA 5IY5H 1D1AA 1LDJA 3OYFA 2DDAA 3A1YA 3PNTA 3OYDA 4F93B 2QBYA 2KDOA 4LGWA 3OS1A 2LDUA 3BQYA 3CDHA 2MC3A 1YQAA 5M5WJ 1IJWC 4BE1A 1R5ID 3OSFA 1TP4A 4ITVA 5EDNA 5HS9A 1K4TA 1Z6RA 4B3XA 2BW3A 2ZNYA 4KA4A 3GBGA 3H0GJ 4DZJA 2KISA 4BXFA 4M72A 1ULYA 3CUQC 1KQ0A 1O3RA 1UG2A 4QPOA 4CZZA 4PGHA 3S3OA 3F23A 2XF5A 3LSTA 2CFXA 2LTPA 1F1ZA 1WGXA 4KITB 5BMZA 3OYMA 2EZHA 2KZVA 3TQNA 3QWLA 4BHBA 4PGGA 3WGGA 2H6BA 3KYCB 1EH7A 1XPXA 2DQRA 3EYYA 1MMDA 3LA2A 1RKWA 5FB2A 2IGOA 3RQIA 1H89C 3OIOA 3SXYA 5D5UB 1JKOC 1PUFB 3HXLA 3PSIA 1RETA 1U2WA 5DCMA 1YX3A 2L01A 3S1MJ 1J5YA 3CMAI 1UFMA 1V5GA 2RKHA 1IV6A 4IRHA 2IRFG 5CVUA 5CPRB 3GZ5A 1NTCA 3LAPA 4BEHB 4L5IA 1XMKA 3CCSI 2ZCWA 2IP2A 1OR7C 2K86A 3A0HC 5A2QK 2O5RA 2V9KA 1S3JA 2LFBA 4CCMA 4HQEA 4KIFA 3S3MA 2I5UA 2DJIA 3FHNA 2K3PA 3LQQA 4HAMA 4XM3A 3S2WA 4P1WA 4A6EA 1FSEA 4CUGA 3BY6A 3OYAA 4Y4RA 4HV6A 1IV8A 1WJFA 4PJLA 2HNHA 2FRHA 2V1DA 5L3DA 2KHMA 2Z5UA 3GZNB 3G1MA 2OCCH 2ME6A 4MIMA 2EA2A 2QSHX 1X4PA 2HZDA 2Y0MA 2M2EA 1JKQC 1R7JA 3D0SA 3FXRA 1X1BA 3F6OA 2HR3A 3M1CA 4CCNA 1ZGAA 2DMNA 3SZTA 2M30A 2RAEA 3WE3A 3HUGA 1F43A 1IDZA 1DP3A 5H6QA 1KU3A 2VE9A 3KETA 3VEPA 3FBNB 4GYGA 1M1EB 2BV6A 4GFBA 2GXGA 3LWFA 1H8AC 1DU6A 4FISA 4XLAA 5DUIA 3CD6I 2O61A 4GRIA 3FDYA 1ZYRF 1JGGA 4P55A 3S93A 1Z91A 1QVUA 3SEQA 3BTLA 1XGMA 4NNJA 1NK3P 3ZMZA 4PFOA 3G3ZA 3WTWC 5L3GA 2D1VA 2BVLA 2KRFA 3OYIA 2MLKA 2M34A 2NS0A 2OC6A 1OPCA 1XSDA 3OYJA 3BROA 2ID3A 1FOYA 3HRSA 2HPIA 2KJCA 3VB2A 2CGPA 1EH8A 1L3LA 4BE2A 3GTLJ 3PJRA 1GVDA 2CW0F 2HKXA 2IGKA 4I6ZA 1K7AA 5H20A 1GV2A 1KZHA 5J4VA 2JN6A 2OD5A 1LFBA 1ENHA 3DEUA 4LK1F 1YRNB 4F55A 1O7LA 4E7JA 3BR0A 5JFRA 4YRVA 1DDNA 1U9NA 4W97A 4EV0A 3AAFA 3NARA 2VUMJ 1TL8A 3JRAA 5JHFA 2XGEA 1UG0A 2EJRA 4IOCF 4FCYA 1YITI 1P4XA 1IXRC 1I50J 4PJMA 3FF5A 1ORKA 2IS6A 1LE8A 4N9IA 3COAC 1VQ9I 2WTEA 4RB0A 4RGUA 2K9SA 3ZQIA 2AXTC 4HEA2 3LFUA 3OYGA 2VLAA 5J1RA 2DMPA 4M74A 4XLCA 3K9TA 2DK5A 1E2XA 1NH3A 4A3KJ 3WGIA 3GFIA 2H8RA 3FMQA 1VNDA 2XVCA 4EGZA 4HLXA 4AWXB 1S9HA 3SDGA 2FQ4A 4C2UA 1SFKA 2OV7A 4KFCA 4G8XA 4UB6C 2LF8A 3WTUC 1KYZA 2DO7A 2MFZA 3JAMK 2K27A 2PBIA 1XDSA 2Y31A 3EETA 4IHVA 1P92A 3PNVA 2R7ZJ 2PMZN 2DJNA 2KIUA 4FX4A 4GXOA 1W5CC 3Q3SA 4XMYA 3CUQA 4I09A 2IEKA 5F04A 4M9XA 3BLYA 1S7AA 1Z67A 4EVIA 3BT9A 1WJ5A 1R5HA 2FXAA 2MG4A 4BU2A 2EIJH 3REOA 3BZCA 2K4JA 3KCCA 1ZR4A 2DN0A 3N05A 4BUPA 5E1XA 2Z2SB 1LEBA 2L9NA 3MCZA 5HLHA 3HKZA 4KISA 2EINH 1IN8A 2ZFUA 2JSCA 2EILH 3LSKA 2W24A 3BTIA 3KEYA 4HX8A 4DIQA 1T33A 4FX0A 4A3FJ 1QGPA 1U8BA 1XDUA 2DFIA 2E71A 3MFKA 3F6VA 1PYVA 2ZSIB 1BR2A 2ICWG 2ESNA 3QPHA 5D5XB 4B3AA 2R7VA 2EZLA 3VYTB 3ULQB 2JK3A 1ZHFA 4IHSA 4G6QA 3CF2A 1U0JA 2HI3A 2Y30A 3DFGA 2OBPA 3RDIA 3DPTA 4DOZA 4A93J 5M3FJ 3HBLA 2M5WA 5B66C 4QPQA 1J7KA 1ETYA 3MKYB 5JR3A 1HSJA 3D1NI 1PP8F 4M3FA 4CHUA 4PFPA 3X2QH 1UMQA 3BP8A 3ECHA 2FUG2 2X1EA 4M3GA 3IKTA 4L9JA 1SD6A 3HRUA 2BBYA 2GOMA 2WV1A 5IYBJ 3S2DJ 2MW8A 2A69F 3D5LA 4BHPA 2M8GX 2KZGA 2PMHA 2CQNA 3H35A 5IT9K 2LKSA 1IC8A 1ON2A 3DTKA 2M0CA 1K79A 1RPWA 1LDKB 4BY7J 1VTNC 3KP3A 1KU2A 3PUFA 3IRRA 1YHQI 3K4KA 1GHCA 2DMUA 4PSXA 1XSVA 2J5PA 1HSTA 1X3UA 3B6CA 1SAUA 1R71A 1C0WA 4BQAA 1MBKA 1W4MA 1A6QA 4LG3A 3S14J 4XKBA 3LSRA 1OLTA 2BXYA 3DLLF 2QSGX 5F0CA 2XUBA 3PO3J 2RC4A
chains in the Genus database with same CATH topology
2OPTA 2YS9A 4V2FA 3PO2J 3BG5A 2EQRA 1HDDC 2XB0X 5IP9J 1OJLA 4BKXA 2KDZA 2ZB9A 1XG1A 1GDTA 2GBYA 4MO7A 3HOUJ 2JMWA 2LP0A 3E7LA 3ZQHA 1B8IA 4AYBN 1R9TJ 1MNMC 1W0TA 4A3MJ 5FKLA 4IHWA 4X1EA 4MLOA 2HXIA 2FJ1A 1JT6A 2I10A 1FEXA 4I76A 1POGA 1GV5A 3H3VK 2KT0A 3B6AA 2LD5A 1OCTC 3O8HA 2NS7A 3HKZN 1JUSA 2G0EA 3HEFA 4BBRJ 1UHSA 1D5YA 1S7EA 3RZOJ 4DYCA 2CQQA 2LVSA 2E2JJ 1JJ8C 4MFDA 3ZQCA 1VFCA 4RDUA 3JRFA 3JRBA 1IDYA 2EZKA 2ME0A 3TP3A 3UKGA 2HDDA 1JKPC 5IOZA 3GTOJ 3S15J 2L7ZA 4IEJA 2QCOA 4HNVA 2R0QC 3MKLA 5E3MA 1IRZA 3Q0VA 1MBJA 5M3MJ 1AU7A 2LY9A 1TC3C 1BJZA 4C3JJ 3JRCA 4XRMA 1YRNA 1FIPA 2E2HJ 2R5YB 1EF4A 3M3YJ 3LSJA 1A5JA 1X2MA 1JUMA 3MVPA 5EG0A 1Z0XA 1LE8B 3M4OJ 4DYQA 4D5FA 3LSPA 2YUSA 5C44J 2Y0SN 1RR7A 4A3EJ 2FX0A 1GUUA 2GLOA 3FK7A 2X9DA 3DEWA 1ZTRA 3RZDJ 3HOYJ 2JWTA 3S1NJ 2O9LA 3A01B 5GPAA 2AHQA 1WPKA 2CU7A 2LK2A 4UUTA 3LNQA 4D7MA 2MGQA 3CDLA 2DTZA 1BL0A 2XRLA 4BY1J 2Y2ZA 1K61A 3HOWJ 2HQ5A 5F08A 5FKMA 5EGOA 4A69C 5M5XJ 4QSHA 1FIAA 3HOVJ 4X6AJ 2LR8A 2EBIA 2WAQN 3QPSA 3HOXJ 5IYCJ 4JYKA 3TEDA 2WB1N 2L9RA 3BR3A 1ETOA 3S16J 3K7AJ 3JRIA 4G12A 3ZQGA 2NS8A 3A03A 1ZK8A 3SFIA 3C2BA 3HGYA 5FKKA 2O8KA 2HOSA 1BW5A 3CMYA 4M3EA 1I3QJ 4M3BA 4JX4A 2L0KA 1CQTA 1MH3A 1AHDP 2XB5A 2H1KA 1SFOJ 2CUEA 4MFEA 3BR6A 3S17J 1VF9A 2D5VA 2ELKA 4C3HJ 5FKNA 3GTPJ 5IPAA 1K83J 1TWGJ 2HXOA 2DA3A 3IH4A 1W0UA 2EZIA 2IAIA 2NVTJ 3PM1A 2R5ZB 1JTYA 1WH7A 4W1UA 1MBFA 3BQZA 5EZHA 5EZGA 2E1OA 4FE7A 4DZPA 3BQYA 4IHYA 1F36A 5M5WJ 1IJWC 2MSYA 3OSFA 5EDNA 2QF7A 4IHXA 3NAUA 4JP0A 1ETQA 1U78A 1JKRC 3BR1A 4UUSB 3GBGA 3H0GJ 4DZJA 3FK6A 3TP0A 3Q0UA 4CYCA 1X2NA 3BG3A 5IP6A 1UG2A 1ITYA 4V2GA 5EYRA 3K2AA 2P81A 2LTPA 1WGXA 1AKHB 5F0HA 2EZHA 3W6VA 2VKVA 2XGCA 1P7IA 2DMTA 3ZQFA 1FTTA 4D7NA 4EEFG 1RKWA 1ETVA 2HOAA 3RQIA 2CQXA 1H89C 1WI3A 3OIOA 1JKOC 1PUFB 4Y52J 2VI6A 4M6VA 5DTDA 2JA5J 1NK2P 1RETA 3S1MJ 3WHBA 2K9NA 2XGDA 1IV6A 1NTCA 1HCRA 3ZQLA 5E3LA 1ZGWA 1P7JA 5IP7J 2Y9YA 1RKTA 4M3DA 2XSDC 2LFBA 3SJMA 4QIWN 3S1RJ 5J3LA 2R92J 4QTRA 1JJ6C 5GP9A 2FD5A 2EH3A 1B72A 3S1QJ 1FJLA 2CRGA 3ZOBA 2N8GA 4B1RA 2JA8J 3FISA 3G1MA 1DU0A 2ME6A 4MIMA 2DMQA 2CJJA 1B8IB 1Y1VJ 2M2EA 1JKQC 1XS9A 2OF7A 1BW6A 4FE4A 4JX5A 5F27A 2DMNA 2RAEA 2JJ7A 1F43A 1IDZA 3OSGA 4XICA 2X48A 1IG7A 3HM5A 4GFBA 4D5CA 4B4CA 1H8AC 1DU6A 4FISA 1IGNA 2E2IJ 4C3IJ 4DW6A 3JREA 1JGGA 3HDDA 1QVUA 2L7MP 3BTLA 1MSEC 1NK3P 2ECCA 5FLVA 1ETKA 1JUPA 2M34A 1HLVA 1ETWA 4BBSJ 1HOMA 3O8GA 2ID3A 3TW6A 9ANTA 3FKIJ 1ZKGA 3GTLJ 3MN2A 1GVDA 3I4NJ 4I6ZA 4FTHA 1GV2A 5K7ZA 2JN6A 2L7FP 1LFBA 1ENHA 4J19A 1YRNB 3BR0A 3WHCA 3RKQA 1U9NA 4W97A 1U9OA 3NARA 5EG0B 4Y7NJ 2XPVA 2VUMJ 2HOTA 3JRAA 2E19A 2XPWA 3JRDA 3GTQJ 2R5YA 2XGEA 1TWFJ 4FCYA 2K9QA 1I50J 1MBGA 1ORKA 1LE8A 1Q1VA 5M5YJ 5IYDJ 2K9SA 1QRYA 3ZQIA 2ECBA 5FJ8J 3LSGA 1HF0A 1VI0A 1O4XA 5F0FA 5K7HA 3HB9A 5J1RA 4A3LJ 4S0HB 2DMPA 3A01A 2Y9ZA 3BTJA 3OOUA 2VKEA 2YU9J 5E3OA 4A3KJ 5EF6A 2W48A 2TRTA 1Y1WJ 2H8RA 5EGOB 1VNDA 1JTXA 5BNGA 3GTMJ 2K40A 3SDGA 2FQ4A 5EEAA 5FKOA 1ZQ3P 3CQZJ 1FTZA 3L1PA 5IOYA 3JR9A 4A3JJ 5JLXA 2Y31A 4IHVA 2R7ZJ 2PMZN 1OFCX 2DJNA 3JRHA 5C4JJ 2DA6A 3I4MJ 3Q3SA 2B63J 1T56A 3IV5A 2IEKA 5F04A 2X6OA 1MBHA 2NVYJ 1HDPA 3JRGA 3BT9A 2COBA 2MG4A 2DA1A 1Z77A 1MBEA 4ABZA 3GTKJ 4RBOA 5F1JA 1ZR4A 2DN0A 2HYJA 3CCYA 3IH3A 1LFUP 1IUFA 5C4XJ 4L5EA 3QQAA 2IBDA 4NDLA 3BTIA 1MSFC 1U8BA 3GTGJ 4A3FJ 1MH4A 1T33A 3S2HJ 2M9HA 5JLWA 1SANA 4JX6A 2R5ZA 1X58A 2R93J 4B3AA 2EZLA 2DA2A 4A3GJ 5DS9A 2JK3A 3BTCA 1QPIA 3QPLA 3F0CA 4AC0A 2CUFA 3HGGA 2HI3A 2Y30A 1TWAJ 2DA7A 2GM4A 1A6IA 4BXXJ 2DA5A 4A93J 1WCMJ 5M3FJ 3HBLA 3TW7A 4XRSG 3LOCA 2JA6J 2JA7J 4A3CJ 3VPRA 1ETYA 3D1NI 4CYCB 4M3FA 1BA5A 3G1LA 3BR2A 5E3NA 2XPUA 1UMQA 3DCFA 5K7FA 4XRSA 4UUSA 2LLKA 4A3DJ 4M3GA 4LOCA 5J1YA 1ZR2A 5GPCA 1TWHJ 1APLC 1JT0A 2WV1A 5IYBJ 3S2DJ 1E3OC 4A3BJ 2MW8A 2M8GX 1RESA 1AKHA 4DYRA 1XC5A 1OCPA 3Q0WA 4A3IJ 1H88C 1IC8A 5C3EJ 5FLMJ 2M0CA 1I6HJ 2AO9A 1RPWA 1GT0C 4AUXA 4BY7J 3G1OA 5HODA 2NVXJ 2ID6A 2DMUA 1PUFA 1G2HA 4XIDA 1ETXA 2VPRA 3HOZJ 1WH5A 2LKXA 3B6CA 3BR5A 2DA4A 1MBKA 1TWCJ 2O7OA 1QVTA 3BG9A 4C2MJ 3S14J 3GTJJ 3LSRA 4XK4A 2NOGA 3A02A 1B72B 3FIWA 2TCTA 2NVQJ 5F0CA 5J1UA 3PO3J 3IH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPT A;  2YS9 A;  4V2F A;  3PO2 J;  3BG5 A;  2EQR A;  1HDD C;  2XB0 X;  5IP9 J;  1OJL A;  4BKX A;  2KDZ A;  2ZB9 A;  1XG1 A;  1GDT A;  2GBY A;  4MO7 A;  3HOU J;  2JMW A;  2LP0 A;  3E7L A;  3ZQH A;  1B8I A;  4AYB N;  1R9T J;  1MNM C;  1W0T A;  4A3M J;  5FKL A;  4IHW A;  4X1E A;  4MLO A;  2HXI A;  2FJ1 A;  1JT6 A;  2I10 A;  1FEX A;  4I76 A;  1POG A;  1GV5 A;  3H3V K;  2KT0 A;  3B6A A;  2LD5 A;  1OCT C;  3O8H A;  2NS7 A;  3HKZ N;  1JUS A;  2G0E A;  3HEF A;  4BBR J;  1UHS A;  1D5Y A;  1S7E A;  3RZO J;  4DYC A;  2CQQ A;  2LVS A;  2E2J J;  1JJ8 C;  4MFD A;  3ZQC A;  1VFC A;  4RDU A;  3JRF A;  3JRB A;  1IDY A;  2EZK A;  2ME0 A;  3TP3 A;  3UKG A;  2HDD A;  1JKP C;  5IOZ A;  3GTO J;  3S15 J;  2L7Z A;  4IEJ A;  2QCO A;  4HNV A;  2R0Q C;  3MKL A;  5E3M A;  1IRZ A;  3Q0V A;  1MBJ A;  5M3M J;  1AU7 A;  2LY9 A;  1TC3 C;  1BJZ A;  4C3J J;  3JRC A;  4XRM A;  1YRN A;  1FIP A;  2E2H J;  2R5Y B;  1EF4 A;  3M3Y J;  3LSJ A;  1A5J A;  1X2M A;  1JUM A;  3MVP A;  5EG0 A;  1Z0X A;  1LE8 B;  3M4O J;  4DYQ A;  4D5F A;  3LSP A;  2YUS A;  5C44 J;  2Y0S N;  1RR7 A;  4A3E J;  2FX0 A;  1GUU A;  2GLO A;  3FK7 A;  2X9D A;  3DEW A;  1ZTR A;  3RZD J;  3HOY J;  2JWT A;  3S1N J;  2O9L A;  3A01 B;  5GPA A;  2AHQ A;  1WPK A;  2CU7 A;  2LK2 A;  4UUT A;  3LNQ A;  4D7M A;  2MGQ A;  3CDL A;  2DTZ A;  1BL0 A;  2XRL A;  4BY1 J;  2Y2Z A;  1K61 A;  3HOW J;  2HQ5 A;  5F08 A;  5FKM A;  5EGO A;  4A69 C;  5M5X J;  4QSH A;  1FIA A;  3HOV J;  4X6A J;  2LR8 A;  2EBI A;  2WAQ N;  3QPS A;  3HOX J;  5IYC J;  4JYK A;  3TED A;  2WB1 N;  2L9R A;  3BR3 A;  1ETO A;  3S16 J;  3K7A J;  3JRI A;  4G12 A;  3ZQG A;  2NS8 A;  3A03 A;  1ZK8 A;  3SFI A;  3C2B A;  3HGY A;  5FKK A;  2O8K A;  2HOS A;  1BW5 A;  3CMY A;  4M3E A;  1I3Q J;  4M3B A;  4JX4 A;  2L0K A;  1CQT A;  1MH3 A;  1AHD P;  2XB5 A;  2H1K A;  1SFO J;  2CUE A;  4MFE A;  3BR6 A;  3S17 J;  1VF9 A;  2D5V A;  2ELK A;  4C3H J;  5FKN A;  3GTP J;  5IPA A;  1K83 J;  1TWG J;  2HXO A;  2DA3 A;  3IH4 A;  1W0U A;  2EZI A;  2IAI A;  2NVT J;  3PM1 A;  2R5Z B;  1JTY A;  1WH7 A;  4W1U A;  1MBF A;  3BQZ A;  5EZH A;  5EZG A;  2E1O A;  4FE7 A;  4DZP A;  3BQY A;  4IHY A;  1F36 A;  5M5W J;  1IJW C;  2MSY A;  3OSF A;  5EDN A;  2QF7 A;  4IHX A;  3NAU A;  4JP0 A;  1ETQ A;  1U78 A;  1JKR C;  3BR1 A;  4UUS B;  3GBG A;  3H0G J;  4DZJ A;  3FK6 A;  3TP0 A;  3Q0U A;  4CYC A;  1X2N A;  3BG3 A;  5IP6 A;  1UG2 A;  1ITY A;  4V2G A;  5EYR A;  3K2A A;  2P81 A;  2LTP A;  1WGX A;  1AKH B;  5F0H A;  2EZH A;  3W6V A;  2VKV A;  2XGC A;  1P7I A;  2DMT A;  3ZQF A;  1FTT A;  4D7N A;  4EEF G;  1RKW A;  1ETV A;  2HOA A;  3RQI A;  2CQX A;  1H89 C;  1WI3 A;  3OIO A;  1JKO C;  1PUF B;  4Y52 J;  2VI6 A;  4M6V A;  5DTD A;  2JA5 J;  1NK2 P;  1RET A;  3S1M J;  3WHB A;  2K9N A;  2XGD A;  1IV6 A;  1NTC A;  1HCR A;  3ZQL A;  5E3L A;  1ZGW A;  1P7J A;  5IP7 J;  2Y9Y A;  1RKT A;  4M3D A;  2XSD C;  2LFB A;  3SJM A;  4QIW N;  3S1R J;  5J3L A;  2R92 J;  4QTR A;  1JJ6 C;  5GP9 A;  2FD5 A;  2EH3 A;  1B72 A;  3S1Q J;  1FJL A;  2CRG A;  3ZOB A;  2N8G A;  4B1R A;  2JA8 J;  3FIS A;  3G1M A;  1DU0 A;  2ME6 A;  4MIM A;  2DMQ A;  2CJJ A;  1B8I B;  1Y1V J;  2M2E A;  1JKQ C;  1XS9 A;  2OF7 A;  1BW6 A;  4FE4 A;  4JX5 A;  5F27 A;  2DMN A;  2RAE A;  2JJ7 A;  1F43 A;  1IDZ A;  3OSG A;  4XIC A;  2X48 A;  1IG7 A;  3HM5 A;  4GFB A;  4D5C A;  4B4C A;  1H8A C;  1DU6 A;  4FIS A;  1IGN A;  2E2I J;  4C3I J;  4DW6 A;  3JRE A;  1JGG A;  3HDD A;  1QVU A;  2L7M P;  3BTL A;  1MSE C;  1NK3 P;  2ECC A;  5FLV A;  1ETK A;  1JUP A;  2M34 A;  1HLV A;  1ETW A;  4BBS J;  1HOM A;  3O8G A;  2ID3 A;  3TW6 A;  9ANT A;  3FKI J;  1ZKG A;  3GTL J;  3MN2 A;  1GVD A;  3I4N J;  4I6Z A;  4FTH A;  1GV2 A;  5K7Z A;  2JN6 A;  2L7F P;  1LFB A;  1ENH A;  4J19 A;  1YRN B;  3BR0 A;  3WHC A;  3RKQ A;  1U9N A;  4W97 A;  1U9O A;  3NAR A;  5EG0 B;  4Y7N J;  2XPV A;  2VUM J;  2HOT A;  3JRA A;  2E19 A;  2XPW A;  3JRD A;  3GTQ J;  2R5Y A;  2XGE A;  1TWF J;  4FCY A;  2K9Q A;  1I50 J;  1MBG A;  1ORK A;  1LE8 A;  1Q1V A;  5M5Y J;  5IYD J;  2K9S A;  1QRY A;  3ZQI A;  2ECB A;  5FJ8 J;  3LSG A;  1HF0 A;  1VI0 A;  1O4X A;  5F0F A;  5K7H A;  3HB9 A;  5J1R A;  4A3L J;  4S0H B;  2DMP A;  3A01 A;  2Y9Z A;  3BTJ A;  3OOU A;  2VKE A;  2YU9 J;  5E3O A;  4A3K J;  5EF6 A;  2W48 A;  2TRT A;  1Y1W J;  2H8R A;  5EGO B;  1VND A;  1JTX A;  5BNG A;  3GTM J;  2K40 A;  3SDG A;  2FQ4 A;  5EEA A;  5FKO A;  1ZQ3 P;  3CQZ J;  1FTZ A;  3L1P A;  5IOY A;  3JR9 A;  4A3J J;  5JLX A;  2Y31 A;  4IHV A;  2R7Z J;  2PMZ N;  1OFC X;  2DJN A;  3JRH A;  5C4J J;  2DA6 A;  3I4M J;  3Q3S A;  2B63 J;  1T56 A;  3IV5 A;  2IEK A;  5F04 A;  2X6O A;  1MBH A;  2NVY J;  1HDP A;  3JRG A;  3BT9 A;  2COB A;  2MG4 A;  2DA1 A;  1Z77 A;  1MBE A;  4ABZ A;  3GTK J;  4RBO A;  5F1J A;  1ZR4 A;  2DN0 A;  2HYJ A;  3CCY A;  3IH3 A;  1LFU P;  1IUF A;  5C4X J;  4L5E A;  3QQA A;  2IBD A;  4NDL A;  3BTI A;  1MSF C;  1U8B A;  3GTG J;  4A3F J;  1MH4 A;  1T33 A;  3S2H J;  2M9H A;  5JLW A;  1SAN A;  4JX6 A;  2R5Z A;  1X58 A;  2R93 J;  4B3A A;  2EZL A;  2DA2 A;  4A3G J;  5DS9 A;  2JK3 A;  3BTC A;  1QPI A;  3QPL A;  3F0C A;  4AC0 A;  2CUF A;  3HGG A;  2HI3 A;  2Y30 A;  1TWA J;  2DA7 A;  2GM4 A;  1A6I A;  4BXX J;  2DA5 A;  4A93 J;  1WCM J;  5M3F J;  3HBL A;  3TW7 A;  4XRS G;  3LOC A;  2JA6 J;  2JA7 J;  4A3C J;  3VPR A;  1ETY A;  3D1N I;  4CYC B;  4M3F A;  1BA5 A;  3G1L A;  3BR2 A;  5E3N A;  2XPU A;  1UMQ A;  3DCF A;  5K7F A;  4XRS A;  4UUS A;  2LLK A;  4A3D J;  4M3G A;  4LOC A;  5J1Y A;  1ZR2 A;  5GPC A;  1TWH J;  1APL C;  1JT0 A;  2WV1 A;  5IYB J;  3S2D J;  1E3O C;  4A3B J;  2MW8 A;  2M8G X;  1RES A;  1AKH A;  4DYR A;  1XC5 A;  1OCP A;  3Q0W A;  4A3I J;  1H88 C;  1IC8 A;  5C3E J;  5FLM J;  2M0C A;  1I6H J;  2AO9 A;  1RPW A;  1GT0 C;  4AUX A;  4BY7 J;  3G1O A;  5HOD A;  2NVX J;  2ID6 A;  2DMU A;  1PUF A;  1G2H A;  4XID A;  1ETX A;  2VPR A;  3HOZ J;  1WH5 A;  2LKX A;  3B6C A;  3BR5 A;  2DA4 A;  1MBK A;  1TWC J;  2O7O A;  1QVT A;  3BG9 A;  4C2M J;  3S14 J;  3GTJ J;  3LSR A;  4XK4 A;  2NOG A;  3A02 A;  1B72 B;  3FIW A;  2TCT A;  2NVQ J;  5F0C A;  5J1U A;  3PO3 J;  3IH2 A; 
#chains in the Genus database with same CATH topology
 2YS9 A;  2B7E A;  2LMD A;  1UHM A;  2VC1 A;  5ICC A;  2GQQ A;  1MMN A;  1U5T B;  2VON A;  4MHG A;  3PNY A;  2AXL A;  1OJL A;  2QZ8 A;  4BKX A;  5CVI A;  3SEZ A;  3C3W A;  2KDZ A;  4XLN F;  2ZB9 A;  2FBI A;  4LIV A;  1XG1 A;  1VQK I;  4HZF A;  4EJV A;  4BE0 A;  2QGU A;  1QZZ A;  3ZQH A;  3UNG C;  4B43 A;  1IRF A;  5FKL A;  4IHW A;  1YS7 A;  1FP1 D;  2DFF A;  1JT6 A;  1NG6 A;  2BY3 A;  3GWZ A;  4B48 A;  1FEX A;  3ASN H;  4M9Z A;  1GV5 A;  4U88 A;  3S32 A;  2F4M B;  2VQC A;  2KT0 A;  1FLI A;  2ZBK A;  4EGY A;  1FP2 A;  3HKZ N;  1JUS A;  2G0E A;  1DPR A;  3HEF A;  2E1M C;  3DKW A;  4ZYE A;  3RI4 A;  3VDX A;  1UHS A;  3RZO J;  4KYW A;  4RM2 A;  1IN5 A;  2CQQ A;  4KJZ A;  3HRM A;  2EV5 A;  4XLP F;  1K78 A;  3F8N A;  3JRF A;  2MC4 A;  4WXD A;  3GEZ A;  3TOB A;  2ME0 A;  1W7P B;  3C18 A;  4OMZ A;  3SFZ A;  2DOF A;  2QA4 I;  3S15 J;  1S7O A;  3IKV A;  3KP4 A;  5ICG A;  1VQ8 I;  3OYK A;  1IRX A;  4GGG A;  1IRZ A;  3I59 A;  3KEQ A;  1BIB A;  5LFA A;  1LVA A;  5E79 C;  2A07 F;  2WY7 Q;  3FM3 A;  2CQK A;  1G8X A;  1TC3 C;  3ABK H;  3P9C A;  2STW A;  3DLA A;  4HNT A;  3CCE I;  1A5J A;  1TW3 A;  2CMP A;  1Z0X A;  2VQG A;  5FO5 A;  3GF2 A;  4HF2 A;  2RQQ A;  2HU9 A;  3C7J A;  2UV1 A;  3H1C A;  2ESH A;  4PDK A;  5K5Q A;  5HDK A;  1JE8 A;  1RR7 A;  4FQG A;  3HOT A;  2FX0 A;  4CZC A;  4WXC A;  3WTV C;  2JWT A;  1F9N A;  3ROU A;  5GPA A;  3WTT C;  2P7C B;  2ZJP F;  3MD2 A;  1Y8Q B;  2CU7 A;  1FPQ A;  2R7W A;  4LK0 F;  4D7M A;  3IHU A;  1T98 A;  2YU3 A;  3IRQ A;  4BY1 J;  3LSH A;  3T8T A;  1JI8 A;  4UB8 C;  4I99 C;  1BIA A;  4GO1 A;  1R1T A;  5F08 A;  5FKM A;  1OYY A;  3QYE A;  4A69 C;  3CCQ I;  2MA3 A;  2YR2 A;  3RKW A;  3DPL C;  2KIM A;  2LR8 A;  2XAS A;  2O8X A;  3VSL A;  4EM0 B;  4JYK A;  3O6B B;  4U0W A;  5FFZ A;  2E5N A;  1VQO I;  1ETO A;  3J80 K;  5HS8 A;  3S16 J;  2E1M B;  5DM6 F;  3SQN A;  1SD7 A;  2PQ8 A;  3KFW X;  3I5U A;  2NS8 A;  1ZK8 A;  3SFI A;  1WFX A;  1O3T A;  2FA5 A;  3C2B A;  1LPQ A;  5E17 F;  2RGV A;  3E97 A;  1A35 A;  3BJ6 A;  4II2 A;  2HDW A;  4M3E A;  2WWY A;  2L0K A;  1CGP A;  1CQT A;  2GXA A;  1AHD P;  1T0F C;  2HVS A;  3A2K A;  2DPU A;  3OIQ A;  1IN4 A;  3MMY B;  1XCB A;  3CP2 A;  3E5X A;  5FLX Z;  2V1U A;  2CUE A;  2FE3 A;  4LLL A;  3BR6 A;  4MTD A;  1BI3 A;  1VF9 A;  2CW7 A;  3KP7 A;  3GZ6 A;  2ELK A;  2A6H F;  4M71 A;  5FKN A;  4C3H J;  2D5V A;  2ISY A;  3GTP J;  1SAX A;  2NYX A;  2PX9 A;  4L9V A;  1K83 J;  1V54 H;  3K1M A;  3L2C A;  3PM1 A;  1SFE A;  3K4L A;  2XHK A;  1D8J A;  1GXQ A;  2OJE D;  1MJ9 A;  2E1O A;  4ZDO A;  1YTY A;  2CO5 A;  2QUF A;  4ZYA A;  4AD9 A;  4FE7 A;  4RGX A;  4IHY A;  3R6S A;  3OL4 A;  2XAU A;  5CVJ A;  3BZK A;  1VQP I;  4I7H A;  3ZXS A;  2V9P A;  4JP0 A;  1RNL A;  2HOE A;  1EH6 A;  5HDG A;  4ZTJ A;  1CF7 A;  5ICF A;  1JKR C;  3GW2 A;  3BR1 A;  1N77 A;  2L3D A;  4WCG A;  1A31 A;  3TP0 A;  2R7X A;  4G7Z F;  2P8T A;  2XV4 S;  2EWN A;  2ELJ A;  4CYC A;  3DBH B;  4KIC A;  2ZXI A;  2IXS A;  5LEK A;  3KP6 A;  1ITY A;  3GME A;  4S05 A;  3SZG A;  2P81 A;  1AKH B;  2C6Y A;  5F0H A;  2LKP A;  1OKR A;  3CLQ A;  3W6V A;  3H5N A;  3MKW B;  2ZXH A;  4LB5 A;  4YII A;  5BS6 A;  1USS A;  1PDN C;  1ERD A;  4EEF G;  5D5W B;  1HW2 A;  1KQ9 A;  1ETV A;  2HOA A;  1HW1 A;  3OR1 C;  4WF2 A;  2DBB A;  4IQ4 A;  1OYW A;  4Y52 J;  3G2B A;  4K2E A;  1NK2 P;  3HZJ A;  4IL6 C;  2XGD A;  3E0J B;  4LJZ F;  3BC8 A;  4GYI A;  1P7J A;  1I27 A;  3RPU A;  5IP7 J;  3J7Y J;  2AQF A;  4UVA A;  5E1Z B;  3N4M A;  2LRE A;  2BOL A;  1MKM A;  3SJM A;  5J3L A;  2DOD A;  2A5Y B;  1FBU A;  1JJ6 C;  5GP9 A;  1B72 A;  1YOV B;  5KHD A;  5AIQ A;  1Z7L A;  2QQB A;  3P5J A;  1YIJ I;  2DQL A;  3T1B A;  3ZMT A;  2ZME A;  1Z3Y A;  2LSO A;  5LRS A;  1DU0 A;  1MND A;  4IOA F;  1T6S A;  1LUJ B;  2EIK H;  3H5A A;  4BHC A;  5JVT A;  1BOA A;  2DTR A;  1B8I B;  1YJ9 I;  2LF7 A;  4HG2 A;  3OS2 A;  1XS9 A;  2GOX B;  4KT5 C;  1BR1 A;  4PSW A;  2IS2 A;  2Q1Z B;  2Z3Y A;  4QLC U;  5F27 A;  3P7N A;  3K4N A;  2CH0 A;  3VYS B;  3HM5 A;  3CLO A;  1E3P A;  3W3C A;  1N25 A;  4PJ0 C;  1LQ1 A;  4AU7 A;  5ERI A;  2VIX A;  2Y0S A;  4M9S A;  4Q5S F;  2QQ8 A;  2DXI A;  4ESB A;  4UHT A;  4UY8 I;  3BG6 A;  3BOQ A;  1ETK A;  4L0Y B;  2FBH A;  4E7S A;  2BHY A;  2DOE A;  4Z6Y A;  4KN4 X;  5LHI A;  1OYI A;  4G6D A;  4IQJ A;  2CYY A;  3I4N J;  5DD8 A;  3U1D A;  4LMY A;  4ENM A;  4P96 A;  3WHC A;  4CCO A;  3F3X A;  1Y8R B;  1U9O A;  3ABM H;  2NNY A;  5EG0 B;  4Y7N J;  2XPV A;  3CC7 I;  2HOT A;  3GO5 A;  2WB1 A;  4BXU A;  3WTS C;  3CUO A;  2JVG A;  3OIP A;  2R5Y A;  4M73 A;  3QAH A;  2IGM A;  2K9Q A;  3FXM A;  1ODD A;  2FSW A;  3H92 A;  4Q48 A;  4OIO F;  1WZ2 A;  4B44 A;  2HS5 A;  2BY0 A;  2E7W A;  5D6F A;  5IYD J;  1XD7 A;  5FJ8 J;  4AM3 A;  4YFN F;  2R7S A;  1R4M B;  4E70 A;  5K7H A;  1PP7 U;  3FMS A;  5CKT A;  2GWR A;  2HVR A;  1K6O A;  2Y9Z A;  3WU1 B;  5CYV A;  3BTJ A;  3OOU A;  3SDB A;  2QKM B;  3KYL A;  3L2R A;  2L4A A;  3ZMV A;  2TRT A;  1Y1W J;  5EGO B;  1J9I A;  2WAF A;  2VJJ A;  3OYB A;  3FMR A;  4PUS A;  3N97 A;  5EEA A;  1Z6T A;  4DBR A;  3R60 A;  3JR9 A;  4KN7 X;  4A3J J;  2HZT A;  5JLX A;  4IRG A;  2LH9 A;  3KPH A;  2HKO A;  2L4M A;  2EB7 A;  4ENK A;  3C2H A;  1OFC X;  2BHZ A;  3JRH A;  2Z9O A;  2EPF A;  3DEE A;  5E8I A;  3M8E A;  3EUH C;  2B63 J;  4GCV A;  3U9G A;  2F4I A;  2MH2 A;  3Q9V A;  2DT5 A;  1MBH A;  3CDI A;  4ZZD A;  4P9F A;  4DNC A;  2COB A;  3ZPL A;  1Y0N A;  3A4C A;  2KPM A;  3ECO A;  1MBE A;  2E1N A;  4IPA A;  3WTY C;  4LFU A;  3IC7 A;  3CCY A;  4Z2Y A;  1LFU P;  1IN6 A;  3BCA A;  2V9V A;  1LNW A;  3TDU C;  3CCJ I;  4ENJ A;  3K69 A;  1R36 A;  1OCO H;  5HLI A;  1WKM A;  2HYF A;  1DQU A;  2IBD A;  3BPV A;  4NQW A;  3LSI A;  2D45 A;  4Q47 A;  2VXD A;  1RUN A;  4EQQ A;  2EV0 A;  3O2P E;  4G7O F;  4PCQ A;  4ZC3 A;  4JX6 A;  4N4N B;  2R5Z A;  2JRM A;  3QYB A;  2NAZ A;  3HRT A;  3J81 Z;  3JW4 A;  3FX3 A;  2GA2 A;  3QPL A;  3RJP A;  3PSF A;  5FFX A;  2L7K A;  2RNG A;  5J4Y A;  2ZXW H;  2DA7 A;  1NG7 A;  1YIO A;  4Y15 A;  2IT0 A;  3TW7 A;  1HKT A;  2KIQ A;  3HYI A;  2JA6 J;  3VPR A;  4B09 A;  1BA5 A;  3BR2 A;  2A6E F;  2XPU A;  3DCF A;  3ZQQ A;  3F21 A;  3PFI A;  5B3S H;  2W82 A;  4OIN F;  2W57 A;  4LOC A;  1TWH J;  2LRD A;  4OWR B;  4AIK A;  5DYM A;  1R1V A;  1RES A;  4RB3 C;  1MNE A;  2XRO A;  1XC5 A;  3F72 A;  1J59 A;  1GLN A;  4BYY A;  5FLM J;  4HLY A;  1RI7 A;  2HQN A;  1I6H J;  2ZJQ F;  3ZCO A;  2VAS A;  2UZK A;  3GUD A;  5GAE J;  3PL8 A;  3G1O A;  1IF1 A;  2STT A;  3AFH A;  3FXQ A;  4MQ9 F;  1PUF A;  1LB2 A;  1G2H A;  4XID A;  1ETX A;  3K0L A;  3HOZ J;  3OV8 A;  5D4S A;  1P4A A;  3WTZ A;  2WAQ A;  2FNP A;  1NHA A;  2X0L A;  3OYC A;  4F3Q A;  3HTU A;  1TWC J;  5JVG F;  4P5O A;  1BI0 A;  4F91 B;  4BEH A;  2R7T A;  1KGS A;  1KU9 A;  2KKO A;  2NOG A;  2H09 A;  4AID A;  2TCT A;  1EA3 A;  2X51 A;  5K1Y A;  4IF4 A;  1DGR M;  5K7F A;  3F8B A;  4BDZ A;  3FXK A;  3TGN A;  2X6X A;  4V2F A;  3PO2 J;  3MQ0 A;  4RA2 A;  2EK5 A;  4HNU A;  1HDD C;  3HPH A;  4F7Z A;  4R1H A;  4BAC A;  2F48 A;  2X6W A;  2E7X A;  5FGM A;  4KMF A;  1IN7 A;  2VQH A;  3C2G A;  3JSO A;  2P7V B;  3NEU A;  3E6M A;  2ZO4 A;  2O3F A;  3TOA A;  2EV6 A;  2JRT A;  1ZG3 A;  2WAD A;  3BZ6 A;  3L2U A;  1VQN I;  2K85 A;  1R9T J;  1TQP A;  4OIQ F;  4DJA A;  5E8G A;  2Z16 A;  4A3M J;  2VL8 A;  4MLO A;  5TJJ A;  4XOR A;  3L00 A;  2Y48 A;  2B0L A;  4HDU A;  3C1D A;  3L2Q A;  4XNF A;  4OIR F;  1FOW A;  1VQ7 I;  3AL0 B;  4XLE A;  4NHJ A;  1ZEL A;  1S7E A;  1ZRE A;  1UHW A;  3I54 A;  3L09 A;  1JJ8 C;  3G4S I;  1HBX G;  3ZQC A;  3R61 A;  4CIC A;  4RDU A;  2CFO A;  2M7B A;  1LDD A;  1HQC A;  4FAS D;  3NWS A;  5DV5 A;  2FML A;  4U87 A;  2NRA C;  4CDG A;  5IOZ A;  3V42 A;  1ZAO A;  1D0X A;  3MZH A;  1I3A A;  4RLQ A;  3V4G A;  3TL4 X;  3ERE D;  4EM1 A;  1X19 A;  4A6D A;  1ACI A;  3CC2 I;  3ABT A;  2PJR B;  3KZZ A;  1XB4 A;  2EFW A;  2CV0 A;  3AG4 H;  4BQO A;  1R23 A;  1U5T C;  2R7O A;  4NC8 A;  1YRN A;  2E2H J;  2OAZ A;  2YSR A;  3LSJ A;  5EEH A;  3BWG A;  1OR7 A;  3MVP A;  3M4O J;  2AS5 F;  5DEQ A;  1G4D A;  1MMA A;  3LSP A;  1XMX A;  4RGS A;  5C44 J;  3H3U A;  4YG2 F;  1QHG A;  4BQN A;  4A3E J;  5LGN A;  2JT1 A;  1S8N A;  2X9D A;  3CP8 A;  3HHG A;  5DCF A;  3QP5 A;  2OTJ I;  1FSH A;  1P6R A;  4RAZ A;  2O9L A;  3A01 B;  1UEL B;  1MGT A;  2DK8 A;  2AHQ A;  1WRJ A;  4UUT A;  1B59 A;  1O3S A;  3LNQ A;  5HLG A;  1SVO A;  1UB9 A;  2YX7 A;  3CZ6 A;  2DTZ A;  1OCC H;  3I9V 2;  2XDV A;  2V1X A;  2XRL A;  3K2Z A;  5LBQ A;  3FXJ A;  2VJ4 A;  3HOW J;  2HQ5 A;  5GAH J;  2R7D A;  5M5X J;  4PJN A;  4QSH A;  2FMY A;  4ZTF A;  2WAQ N;  4A5M A;  3HOX J;  4F92 B;  4RGR A;  3BR3 A;  1SC7 A;  4IHT A;  2FU4 A;  2XKP A;  4G12 A;  4ANJ A;  2P0W A;  3A03 A;  3CES A;  2WC2 A;  4HPQ A;  4OAZ A;  1SD4 A;  2O8K A;  4AIJ A;  1TQM A;  4JX4 A;  1ZG5 A;  4RLF A;  3AG1 H;  2DFH A;  5J40 A;  3EDP A;  2YPR A;  2H1K A;  1TNT A;  2VQL A;  5H2F C;  4HQM A;  1WJA A;  4WXH A;  1R1U A;  4LIT A;  4BL0 B;  1VQM I;  1X1A A;  3L7W A;  5HLT A;  5A2Q Z;  1YJN I;  3F8M A;  5IPA A;  2ELH A;  2F5E A;  1J75 A;  1W0U A;  3IH4 A;  4XRF A;  5B1B H;  5TRD A;  2EZI A;  4IVN A;  1WH7 A;  1XCV A;  4W1U A;  3HPG A;  3V7R A;  1FY7 A;  4YIF A;  5EZH A;  5EZG A;  2PFB A;  2VBZ A;  4KDP A;  1B6A A;  2PI0 A;  5KCM A;  3SZP A;  2BGC A;  2IVM A;  1ZLJ A;  2FEZ A;  3FBI B;  5LGU A;  2L02 A;  1I6X A;  3KIO A;  2MSY A;  1RR8 C;  3BG7 A;  4LLG F;  1FMW A;  1ETQ A;  1QZY A;  3K4M A;  4I0A A;  4YEL A;  2NVU B;  4OAY A;  4H4K C;  2QLZ A;  4UUS B;  2VN2 A;  5LHG A;  1JHH A;  2EFP A;  4XN0 A;  3Q0U A;  4HBL A;  1IUY A;  2F5V A;  1X2N A;  5IP6 A;  2KIF A;  2E60 A;  4BJ6 C;  3W6K B;  1EJ9 A;  1XN7 A;  1R58 A;  5EYR A;  1LVK A;  4N9H A;  2W00 A;  1ZG1 A;  3BCB A;  4CCJ A;  4CA0 A;  2VKV A;  2ETH A;  2O03 A;  4R79 A;  3ZQF A;  1YX5 A;  4HA8 A;  2E5Z A;  2QEN A;  1WQ2 A;  4G6T B;  3B73 A;  4PK4 A;  2HTJ A;  4E7H A;  3MAJ A;  3KZI C;  4A5N A;  2VI6 A;  3HG9 A;  1V55 H;  3ZRG A;  2Q8K A;  4AYB A;  5B5E C;  3WHB A;  1W1W E;  2LG4 A;  1HCR A;  2VOP A;  5E3L A;  4ZJZ A;  2VJI A;  2F5D A;  2FQ3 A;  3CMM A;  2Y9Y A;  4EJT A;  4E7I A;  4C2T A;  1AOY A;  1YW7 A;  3JCU C;  3MKZ A;  4QIW N;  3KX2 A;  4E7Z A;  3ZGK A;  1SMT A;  3VOE A;  3F8F A;  2VBY A;  1QQI A;  2EH3 A;  3ZN0 A;  2PEX A;  2V4J C;  3NRV A;  1FMV A;  4AVP A;  1FJL A;  2M0M A;  4D0P A;  2CRG A;  3OL3 A;  3ZOB A;  2N8G A;  4B1R A;  2JA8 J;  2PJP A;  3TKY A;  3ERM A;  3QU3 A;  1U5T A;  3I4P A;  2ISZ A;  2RN7 A;  2YX4 A;  2FOW A;  4UUV A;  2Y75 A;  4RB2 C;  5CVR A;  1FOK A;  4FT8 A;  1Y1V J;  4WX9 A;  4NB5 A;  4ZZL A;  2M3A A;  2ZNZ A;  2OF7 A;  4YFX F;  1BW6 A;  4JX5 A;  1D5V A;  2VBW A;  2Q2E B;  2D1H A;  3RTR A;  5AIP A;  3K70 D;  3OSG A;  1WWX A;  2X48 A;  3GLX A;  4CO8 A;  1T39 A;  1IG7 A;  3JAM Z;  4H0E A;  4D5C A;  2LBF B;  2F6C A;  1D1C A;  1IGN A;  5EJC A;  4DW6 A;  3K4B A;  5DM7 F;  5LEJ A;  2EA4 A;  5GAD J;  2JVH A;  4NC6 A;  2R3S A;  1MSE C;  4MQV A;  4UNO A;  1YW8 A;  3M1E A;  2M45 A;  1Z1D A;  4RM3 A;  3ABU A;  3M7G A;  4UV9 A;  1FYM A;  4EM2 A;  5EEG A;  5KAI C;  2FF4 A;  4HF1 A;  1SD5 A;  1HLV A;  1I1S A;  3E6D A;  1MMS A;  3TW6 A;  2XAF A;  3CCM I;  1FBS A;  1XGO A;  3FKI J;  1O3Q A;  9ANT A;  1ZKG A;  1W7P A;  2DPD A;  1QHH D;  1V4R A;  1W36 D;  2XAG A;  4E7K A;  3OR2 C;  2KMU A;  3KP2 A;  1DP7 P;  1I39 A;  2L7F P;  4X0G A;  2BY2 A;  3QRF F;  2VKD A;  3V8K A;  3RKQ A;  4LIU A;  3V8J A;  2QQ9 A;  4J00 A;  3HC7 A;  3Q5F A;  1YYV A;  2E19 A;  3JRD A;  3GTQ J;  2GXB A;  1IO2 A;  4XOT A;  1OCZ H;  3P9I A;  3K1P A;  3LFK A;  1ZGJ A;  2ECB A;  3LMM A;  3IL2 A;  5E1W A;  5ILS A;  5L3E A;  2QWW A;  2ZFW A;  3HB9 A;  4A12 A;  1SEU A;  4KT6 A;  2OCE A;  4A3L J;  4S0H B;  2LY1 A;  2VPL A;  4I0B A;  1J0R A;  2YU9 J;  1MDM B;  4O3M A;  5E3O A;  2NOJ B;  5EF6 A;  4XKW A;  1JTX A;  5BNG A;  3VYR B;  3CCL I;  2F5C A;  4OOI A;  5LLQ A;  3FZV A;  3GFL A;  3H9G A;  5FRO A;  2DT6 A;  5IOY A;  2OQG A;  3RIR A;  4MNU A;  5DDG A;  3L1P A;  3I58 A;  2W84 A;  1P4W A;  3W2V A;  1MW7 A;  1Y56 A;  1FZP B;  2HDC A;  1YW9 A;  3QU6 A;  2QEX I;  1VQL I;  5IT9 Z;  4KNY A;  2DA6 A;  3HJE A;  2UUZ A;  2O0Y A;  4HV5 A;  4XL9 A;  3IV5 A;  2X6O A;  1TT5 B;  1Z7U A;  3K10 A;  2V7F A;  2Z33 A;  2HVQ A;  1HDP A;  2XF7 A;  2E36 A;  4L9N A;  4A0X A;  3JRG A;  2ZSH B;  1QNT A;  5CVV A;  1H9T A;  2DA1 A;  1Z77 A;  2OTL I;  5J8C A;  3GTK J;  5GTH C;  5F1J A;  2B9S A;  1BC7 C;  2W4S A;  3U1K A;  1D0Y A;  3IH3 A;  4DGW B;  4IO9 F;  3ZMS A;  4LG0 B;  1QA6 A;  2QYO A;  2E35 A;  1G3T A;  4L18 B;  1H9G A;  2DCE A;  3S8P A;  1R5G A;  2UXN A;  4ESF A;  3FWE A;  4L5E A;  3FKJ A;  3J7Z I;  1D1B A;  2VE8 A;  4NDL A;  1E3H A;  2VB6 A;  4MEX F;  4IJA A;  1KU7 A;  2XRN A;  1MH4 A;  1X1D A;  2IA0 A;  2R7U A;  2V26 A;  2IPQ X;  5JLW A;  3FM5 A;  3GFM A;  4O6J A;  4ZDL A;  1SAN A;  1T2K A;  2QBY B;  2R93 J;  2F4O B;  2VT3 A;  2X6Y A;  1F5T A;  2DA2 A;  4A3G J;  2UXX A;  4E4H A;  2CQ7 A;  3OOP A;  4U7B A;  4AC0 A;  2CUF A;  3HGG A;  1BBY A;  4G9Y A;  4XR6 A;  5GAG J;  3IAM 2;  3E3V A;  1WJB A;  3F9K A;  1TWA J;  4S04 A;  2GM4 A;  2BW3 B;  2EIM H;  4BGD A;  4LB6 B;  2A68 F;  3HHH A;  2JA7 J;  2VT2 A;  2RDP A;  2CW8 A;  4A3C J;  2DI3 A;  3G1L A;  1MJB A;  4XRS A;  1R6R A;  2K3F A;  2X1C A;  1QO0 D;  1HA8 A;  4OIP F;  3E1S A;  3MZY A;  5J1Y A;  5D6E A;  2Q0O A;  5GPC A;  3L2W A;  3H9J A;  5K5R A;  4A3B J;  3U21 A;  1TT0 A;  3FXL A;  5HNH A;  4CXF A;  2AQE A;  1AKH A;  5FRN A;  2CSO A;  1OCP A;  4L0Z B;  2RNJ A;  3TO9 A;  2JA2 A;  2PN6 A;  1B4A A;  3ZQ7 A;  1T8I A;  2MH9 A;  1IXS B;  5CLS A;  3TO7 A;  2K5C A;  5DCM B;  3V8L A;  3DBL B;  1R4N B;  5HDN A;  2LC2 A;  4YEJ A;  2O6G E;  1UST A;  4CH7 A;  5HOD A;  2QVO A;  3PIP F;  2NVX J;  4OMY A;  5IT3 A;  1N78 A;  2VPR A;  2LKX A;  4HF0 A;  4OU0 A;  1WSU A;  2M87 A;  2JPC A;  2LYC A;  2DA4 A;  4M6Y A;  4HYE A;  1T0F A;  5D5V B;  2L9V A;  2O7O A;  5DD4 A;  3GFJ A;  2VOO A;  2XF6 A;  4XK4 A;  3RSN A;  4ON0 A;  1YI2 I;  1G3W A;  5J1U A;  1H0M A;  2LOO A;  3DTI A;  3RPU D;  2IGN A;  4IXA A;  3ONQ A;  4HOB A;  4Y13 A;  3UR3 C;  3A0B C;  1TBX A;  2R7F A;  3HSF A;  3ABL H;  2K9L A;  3CTA A;  5IP9 J;  3M9A A;  1BC8 C;  3E6B A;  3K1N A;  2RRE A;  3V7S A;  2G7U A;  2XSJ C;  3EYI A;  3MZ8 A;  4A2U A;  2H6C A;  1QZE A;  3CF5 F;  4U0V A;  3E5U A;  4EJU A;  4HW0 A;  2GBY A;  2HGC A;  2HQR A;  4MO7 A;  2GZW A;  3HOU J;  1FC3 A;  2JMW A;  2XGX A;  1B8I A;  2DDB A;  3HUG B;  4CCK A;  2JSP A;  1TQI A;  1X4O A;  2HEO A;  4X1E A;  5ILU A;  3T0Y A;  1X3W B;  2HXI A;  3SHF A;  2I10 A;  5ED4 A;  3ASO H;  4I76 A;  1POG A;  3H3V K;  4EJO A;  1PJR A;  3GLL A;  1R00 A;  2NS7 A;  2BZT A;  3O8H A;  2Z1D A;  2GIV A;  1AA7 A;  1G3Y A;  1G59 A;  3VYU B;  2X85 A;  3J80 Z;  1UAA A;  2A05 A;  1D5Y A;  4ENN A;  2GA1 A;  4DYC A;  3G71 I;  1LJ9 A;  5HVQ C;  1WI9 A;  4MFD A;  1VFC A;  2EFO A;  3R0J A;  2CUJ A;  3KEO A;  3JRB A;  1IDY A;  1BOB A;  2E34 A;  4NUB A;  3TP3 A;  2D2W A;  2DYR H;  4ZYH A;  2HDD A;  5CQG A;  3W2W A;  2QCO A;  3MKL A;  2QQA A;  1QU3 A;  2M8E A;  5E3M A;  1KYW A;  3OMY A;  3EQL F;  4E6K G;  3EPZ A;  3RCO A;  1MBJ A;  4O5V A;  1T95 A;  3EUA A;  1YG2 A;  3PIO F;  1AU7 A;  1FWZ A;  2XAJ A;  2X4H A;  3DKY A;  4ZYD A;  1BJZ A;  4C3J J;  3JRC A;  5E20 A;  1STZ A;  2PMZ A;  1X2M A;  2BVM A;  5EG0 A;  2V1N A;  1LE8 B;  5GTI C;  4DYQ A;  2DT7 B;  1D8K A;  2RVC A;  2H8W A;  4D5F A;  3OYN A;  2OA4 A;  4JK1 X;  2YUS A;  2M4G A;  1K4S A;  2ADU A;  2K02 A;  2Y0S N;  2CV1 A;  1BI2 A;  3VFZ A;  1XMA A;  3FK7 A;  4BJT A;  3HOY J;  1BR4 A;  5KNL A;  4MGR A;  3S1N J;  1U3E M;  1OMI A;  2PLY A;  1X1P A;  1WPK A;  2LK2 A;  3L2V A;  3F8C A;  2P6T A;  4TV7 A;  4EJW A;  1I5Z A;  2EFN A;  2MGQ A;  3CDL A;  1L0O C;  1BL0 A;  3VOD A;  2JQ7 A;  2OU2 A;  3B02 A;  4FET A;  4BS9 A;  2FNA A;  2Y2Z A;  1DUX C;  1IXC A;  1K61 A;  2E1C A;  3AL0 C;  1FTZ A;  5EGO A;  1XGN A;  2QKL B;  4HX7 A;  2PG4 A;  1FIA A;  3HOV J;  4X6A J;  3U2R A;  3QPS A;  5IYC J;  4XKV A;  1YJW I;  2BYV E;  2WB1 N;  3CUQ B;  3HTS B;  3OWT A;  1SVL A;  4C30 A;  2ZJ2 A;  3K7A J;  3ZQG A;  2CG4 A;  3BJO A;  1WJC A;  1Y0U A;  4UXN A;  3HGY A;  5FKK A;  1QPM A;  3LAJ A;  1ON1 A;  2HOS A;  1BW5 A;  3CJR B;  3I71 A;  1I3Q J;  3IWZ A;  4HSR A;  4M3B A;  3RKY A;  2DYS H;  4B8X A;  5LD2 C;  1E0E A;  3KYD B;  1MH3 A;  1VZ0 A;  3KE2 A;  2V6C A;  2XB5 A;  1WJD A;  1ZH5 A;  2WBM A;  1RZ4 A;  5BOX A;  1S5L C;  1I1G A;  1IW7 F;  4ZYG A;  4WK8 F;  1QBJ A;  2JPB A;  1P9Q C;  3GYH X;  2HXO A;  4UVB A;  1MMG A;  1B1B A;  2NVT J;  5L3F A;  1JTY A;  1MBF A;  4DBQ A;  3QPT A;  3W6J B;  2G7H A;  1GVJ A;  4E7L A;  1SMY F;  3I3L A;  3K70 C;  3FHZ A;  4DZP A;  1T38 A;  1E17 A;  2KQR A;  3DTE A;  1KQ8 A;  1F36 A;  4XBF A;  2BE5 F;  4F52 A;  1BJA A;  2Z99 A;  2QF7 A;  4IHX A;  3NAU A;  4LD5 A;  1U78 A;  5LGT A;  2IJL A;  4II3 A;  2L9S A;  3PFY A;  3MWM A;  1PVE A;  3FK6 A;  1JGS A;  2DAO A;  3VSK A;  3BG3 A;  1FYK A;  4V2G A;  3K2A A;  3GX4 X;  2R7R A;  4ESJ A;  3DP7 A;  1W36 C;  2XGC A;  1P7I A;  2P5K A;  5H6R A;  3M8F A;  2ZXJ A;  2DMT A;  1MD0 A;  3CO6 C;  1FTT A;  1A36 A;  4D7N A;  2KP6 A;  3LL7 A;  1SVM A;  2CQX A;  1WI3 A;  4XON A;  3EUK L;  3WG9 A;  1Z9C A;  3TO6 A;  4M6V A;  3QOP A;  5DTD A;  4B47 A;  2JA5 J;  3EUH A;  2GAU A;  2JZY A;  4M6X A;  2CV2 A;  2K9N A;  4XSX F;  5FLX K;  3ZQL A;  3VWB A;  1W5S A;  1ZGW A;  1X1C A;  4M3D A;  1RKT A;  3RQ4 A;  1V5E A;  4I01 A;  2XSD C;  4AIH A;  1SFX A;  2CUZ A;  1X3Z B;  3S1R J;  1JHF A;  2P5V A;  2R92 J;  3R4K A;  4RAY A;  4QTR A;  3IAS 2;  1G6N A;  2NNN A;  2FD5 A;  2HFH A;  3TBI A;  3S1Q J;  4HST A;  3KZY A;  1G3S A;  3TDZ C;  2X1D A;  3JTG A;  3KP5 A;  3FIS A;  2L5Q A;  1MZB A;  5KAF C;  1Y6I A;  2H1L A;  1XX5 A;  3OYL A;  2ACJ A;  3DV8 A;  2DMQ A;  2VJ5 A;  2CJJ A;  2KJB A;  5FD5 A;  5F6F A;  5BPI A;  2L2O A;  3DPU A;  5LHH A;  1ZRC A;  1UZC A;  4NC7 A;  2KL4 A;  5K5O A;  4FE4 A;  3JTH A;  4XKC A;  1UCR A;  2GIZ A;  2JJ7 A;  2VKH A;  4RB1 A;  4JQF A;  4XIC A;  4V19 K;  2R7Q A;  2NXN B;  3S3N A;  1VQ6 I;  3IWF A;  4B4C A;  4Y17 A;  1TTY A;  2J5O A;  2E2I J;  4C3I J;  2F2E A;  3JRE A;  3BDD A;  2A61 A;  3ESW B;  3FXO A;  2G9W A;  1J2X A;  5L3B A;  3HDD A;  2XKO A;  1K78 B;  2WA0 A;  2L7M P;  2ECC A;  4U0Y A;  4BJ5 C;  3OY9 A;  5FLV A;  4U7D A;  4JOM A;  1DGW Y;  1JUP A;  2DLL A;  1ETW A;  4BBS J;  3TMO A;  3O8G A;  1HOM A;  5TGT A;  4CYD A;  2XAH A;  5ICE A;  2I8D A;  3J7A O;  1OQY A;  3I59 B;  3CCR I;  3MN2 A;  3PQJ A;  4FTH A;  1YFH A;  4IZZ A;  5ILV A;  4Q4Z F;  2XIG A;  3MEX A;  2V79 A;  5K7Z A;  2RQP A;  1TLH B;  2BY1 A;  2KLO A;  4J19 A;  3FXU A;  4XN3 A;  3WE2 A;  2PJR A;  1YO5 C;  1FX7 A;  4QWQ A;  3DU5 A;  1MIJ A;  3WOD F;  2VOD A;  4ASN A;  2ZC2 A;  1TW2 A;  3H0D A;  2XPW A;  4Y3O A;  3IP4 B;  3WGH A;  1TWF J;  3ELK A;  2Y69 H;  4XQF A;  2H94 A;  4A0Z A;  1FNN A;  2K7L A;  1IZ1 A;  3RKX A;  5F1R A;  1MBG A;  1J09 A;  4HX4 A;  2A3S A;  3JSP A;  1Q1V A;  2W85 A;  3M8J A;  5M5Y J;  4HDV A;  1QRY A;  3I64 A;  5B1A H;  3LSG A;  1HF0 A;  1VI0 A;  1O4X A;  2JUG A;  3E6C C;  5F0F A;  4XSZ F;  3PUB A;  3DKX A;  1IAW A;  3A01 A;  4MTE A;  1AWC A;  2MLG A;  4N4O B;  5CQE A;  2VKE A;  3KLO A;  3ZMD A;  3DQV C;  5D8K B;  2MD0 A;  2W48 A;  1VQ4 I;  2DW4 A;  3GTM J;  2CS3 A;  2K40 A;  2HPM A;  5FKO A;  1BM9 A;  2P5L C;  1ZQ3 P;  3CQZ J;  3GXO A;  4NBQ A;  3PQK A;  1FOX A;  2M4K A;  4BH9 A;  4JBA A;  2JUC A;  2IW5 A;  2OZU A;  1BI1 A;  1LEA A;  4AVZ A;  2M7A A;  2R4G A;  2COM A;  5C4J J;  3I4M J;  3LA3 A;  3AG3 H;  3CC4 I;  4LLN A;  1T56 A;  5KVR A;  1S6L A;  4ZH4 F;  2NVY J;  1BN5 A;  1ZAR A;  1P2F A;  4CSW A;  1U6G A;  2P4W A;  3P9K A;  1V3F A;  4ABZ A;  4RBO A;  2FBK A;  2HYJ A;  2A6T A;  1D0Z A;  2HTS A;  5HOO A;  1R22 A;  3LQR A;  1XSX A;  3WU2 C;  1IUF A;  3CJN A;  4PJJ A;  2K4B A;  5C4X J;  3H36 A;  1Z3X A;  4KUM A;  1RC9 A;  4UVC A;  3H3Z A;  3QQA A;  4I98 B;  3QP6 A;  5FRM A;  1XTA A;  1V5F A;  1RIO H;  2ZME C;  4D9J A;  1MSF C;  3GTG J;  3S2H J;  1Z21 A;  3AG2 H;  2M9H A;  3RYP A;  1B9N A;  1X58 A;  3WTX C;  3DXJ F;  3OYH A;  2WY8 Q;  1WJE A;  3BJA A;  2MD5 A;  5DS9 A;  1W5T A;  3BTC A;  1QPI A;  3F0C A;  5DUK A;  5HS7 A;  1TNS A;  3RYR A;  2JTV A;  4G7H F;  5JHU A;  1CF7 B;  3T8R A;  4BXX J;  1A6I A;  2DA5 A;  3CO7 C;  1WCM J;  1ZLK A;  2P6S A;  2W25 A;  4XRS G;  3LOC A;  4RS8 A;  1S29 A;  3K4C A;  4P9U A;  4CYC B;  2ZJR F;  5E3N A;  2DFE A;  5D8L B;  4UUS A;  4RAG A;  4FHT A;  4L5J A;  2LLK A;  3CCV I;  4A3D J;  1ZN2 A;  4XLF A;  4Y33 A;  1ZR2 A;  1APL C;  1JT0 A;  4IKF A;  3F22 A;  4GDF A;  1E3O C;  4DYR A;  3BPX A;  3Q0W A;  2KFD A;  4A3I J;  1H88 C;  4ZDP A;  5C3E J;  2DOA A;  3Q9S A;  5F64 A;  1HXD A;  4L9T A;  4N0B A;  2AO9 A;  1D3Y A;  1Q1H A;  1PUE E;  1GT0 C;  4AUX A;  1Z05 A;  4KMU X;  2CWE A;  3OYE A;  2ID6 A;  1K6Y A;  3V7C A;  1Y39 A;  1O57 A;  3AKZ A;  1WH5 A;  2XC7 A;  2W1O A;  3H9Q A;  2BXZ A;  2VBX A;  3BR5 A;  3K4J A;  1QVT A;  1WVR A;  1EV7 A;  2XAQ A;  3BG9 A;  4C2M J;  3GTJ J;  4UV8 A;  4YIR X;  2A5W A;  3NQO A;  3CJQ B;  3A02 A;  1HKS A;  3OS0 A;  1B72 B;  3FIW A;  3WU0 A;  2NVQ J;  4BDY A;  3IH2 A;  2OPT A;  4CCL A;  3IUO A;  2ZME B;  1HKQ A;  3W2A A;  1DPU A;  3BG5 A;  2EQR A;  1YLF A;  2L54 A;  3KLN A;  2XB0 X;  3GCM A;  3J81 K;  3H5R A;  2TDX A;  1B9M A;  1A04 A;  4RAF A;  3HIF A;  3WG7 H;  1ONV A;  4WWC A;  4RMN A;  2HYG D;  1GDT A;  1OIS A;  2IA2 A;  2LP0 A;  3O3K A;  3E7L A;  1MNM C;  4AYB N;  2V6E A;  4HRI A;  1MJA A;  3G73 A;  2H27 A;  1W0T A;  1RUO A;  3QOE A;  3J7A Y;  3HOS A;  2FJ1 A;  4ETS A;  3I55 I;  5KK1 A;  4J01 A;  3RPQ A;  2Q2E A;  2WV0 A;  1OCT C;  3B6A A;  2LD5 A;  1XGS A;  3I53 A;  3K6G A;  4XOP A;  2VC0 A;  2F5F A;  2LBF A;  5BPD A;  3DWL E;  1YE9 A;  4BBR J;  1HW5 A;  3HSR A;  1SFU A;  3ZP5 A;  2IS1 A;  4DQ2 A;  5J47 A;  2E2J J;  3E5Q A;  2LVS A;  3DU6 A;  3QYF A;  1FT9 A;  4BNC A;  5L3C A;  2ZKZ A;  3L9F A;  5CJ9 A;  2EZK A;  3UKG A;  3M07 A;  1OCR H;  3NWT A;  4I2O A;  1JKP C;  3ZMU A;  3GTO J;  2K9M A;  2L7Z A;  1FYL A;  4IEJ A;  2R0Q C;  4HNV A;  5LRR A;  3DBR B;  5BQT A;  2HWV A;  1REP C;  1T08 B;  1VQ5 I;  3Q0V A;  3ZN1 A;  2OUM A;  5M3M J;  3CME I;  2LNB A;  4A0Y A;  1LKX A;  4I02 A;  1W7P D;  2LY9 A;  1O7F A;  1F4K A;  1ZRD A;  2UWM A;  3ML6 A;  4XRM A;  1FIP A;  3HSE A;  2R5Y B;  1EF4 A;  3M3Y J;  4BAY A;  2KRC A;  5AON A;  1JUM A;  1EKE A;  1UJ8 A;  3QOD A;  3R0A A;  3ISP A;  4IX7 A;  1N75 A;  4EMS A;  2EFQ A;  1RRJ A;  3G6E I;  1JXS A;  3I0T A;  1GUU A;  2GLO A;  3DEW A;  2WAE A;  1ZTR A;  3RZD J;  3I56 I;  1U8R A;  4KIG A;  1S72 I;  3HL2 A;  2HQA A;  2MYS A;  2MBF A;  4IRI A;  1YS6 A;  4BQQ A;  1R49 A;  1TZL A;  1MDM A;  2FOK A;  4C9Y A;  3DF8 A;  5TIS C;  2LY2 A;  4XLH A;  2W7N A;  2MAB A;  2DU9 A;  2VXZ A;  6PAX A;  5JI6 A;  1GXP A;  3CCU I;  4YFK F;  2EBI A;  5E18 F;  4EAT A;  2QSF X;  4PZJ A;  1KA8 A;  3CJT B;  3ZR8 X;  3TED A;  2L9R A;  3T5X A;  4MEY F;  2M1B A;  3D5S C;  1LFP A;  3GVA A;  2KRH A;  4R8H A;  3JRI A;  1HC8 A;  4CGZ A;  3SYT A;  2OQR A;  5J6X A;  3LA7 A;  5HNF A;  3CMY A;  3LSM A;  4KIB A;  2RV8 A;  5D4R A;  5J8F A;  1ZRF A;  1SFO J;  4MFE A;  2IS4 A;  3S17 J;  4D1Q A;  1FBQ A;  1WHU A;  2QM3 A;  4NQW B;  2OZ6 A;  4LG0 A;  5FD6 A;  2PMU A;  1TWG J;  4G94 A;  3D5R C;  2DA3 A;  1IRG A;  2IA1 A;  2IAI A;  2R5Z B;  3BQZ A;  1KON A;  2BEO A;  5IY5 H;  1D1A A;  1LDJ A;  3OYF A;  2DDA A;  3A1Y A;  3PNT A;  3OYD A;  4F93 B;  2QBY A;  2KDO A;  4LGW A;  3OS1 A;  2LDU A;  3BQY A;  3CDH A;  2MC3 A;  1YQA A;  5M5W J;  1IJW C;  4BE1 A;  1R5I D;  3OSF A;  1TP4 A;  4ITV A;  5EDN A;  5HS9 A;  1K4T A;  1Z6R A;  4B3X A;  2BW3 A;  2ZNY A;  4KA4 A;  3GBG A;  3H0G J;  4DZJ A;  2KIS A;  4BXF A;  4M72 A;  1ULY A;  3CUQ C;  1KQ0 A;  1O3R A;  1UG2 A;  4QPO A;  4CZZ A;  4PGH A;  3S3O A;  3F23 A;  2XF5 A;  3LST A;  2CFX A;  2LTP A;  1F1Z A;  1WGX A;  4KIT B;  5BMZ A;  3OYM A;  2EZH A;  2KZV A;  3TQN A;  3QWL A;  4BHB A;  4PGG A;  3WGG A;  2H6B A;  3KYC B;  1EH7 A;  1XPX A;  2DQR A;  3EYY A;  1MMD A;  3LA2 A;  1RKW A;  5FB2 A;  2IGO A;  3RQI A;  1H89 C;  3OIO A;  3SXY A;  5D5U B;  1JKO C;  1PUF B;  3HXL A;  3PSI A;  1RET A;  1U2W A;  5DCM A;  1YX3 A;  2L01 A;  3S1M J;  1J5Y A;  3CMA I;  1UFM A;  1V5G A;  2RKH A;  1IV6 A;  4IRH A;  2IRF G;  5CVU A;  5CPR B;  3GZ5 A;  1NTC A;  3LAP A;  4BEH B;  4L5I A;  1XMK A;  3CCS I;  2ZCW A;  2IP2 A;  1OR7 C;  2K86 A;  3A0H C;  5A2Q K;  2O5R A;  2V9K A;  1S3J A;  2LFB A;  4CCM A;  4HQE A;  4KIF A;  3S3M A;  2I5U A;  2DJI A;  3FHN A;  2K3P A;  3LQQ A;  4HAM A;  4XM3 A;  3S2W A;  4P1W A;  4A6E A;  1FSE A;  4CUG A;  3BY6 A;  3OYA A;  4Y4R A;  4HV6 A;  1IV8 A;  1WJF A;  4PJL A;  2HNH A;  2FRH A;  2V1D A;  5L3D A;  2KHM A;  2Z5U A;  3GZN B;  3G1M A;  2OCC H;  2ME6 A;  4MIM A;  2EA2 A;  2QSH X;  1X4P A;  2HZD A;  2Y0M A;  2M2E A;  1JKQ C;  1R7J A;  3D0S A;  3FXR A;  1X1B A;  3F6O A;  2HR3 A;  3M1C A;  4CCN A;  1ZGA A;  2DMN A;  3SZT A;  2M30 A;  2RAE A;  3WE3 A;  3HUG A;  1F43 A;  1IDZ A;  1DP3 A;  5H6Q A;  1KU3 A;  2VE9 A;  3KET A;  3VEP A;  3FBN B;  4GYG A;  1M1E B;  2BV6 A;  4GFB A;  2GXG A;  3LWF A;  1H8A C;  1DU6 A;  4FIS A;  4XLA A;  5DUI A;  3CD6 I;  2O61 A;  4GRI A;  3FDY A;  1ZYR F;  1JGG A;  4P55 A;  3S93 A;  1Z91 A;  1QVU A;  3SEQ A;  3BTL A;  1XGM A;  4NNJ A;  1NK3 P;  3ZMZ A;  4PFO A;  3G3Z A;  3WTW C;  5L3G A;  2D1V A;  2BVL A;  2KRF A;  3OYI A;  2MLK A;  2M34 A;  2NS0 A;  2OC6 A;  1OPC A;  1XSD A;  3OYJ A;  3BRO A;  2ID3 A;  1FOY A;  3HRS A;  2HPI A;  2KJC A;  3VB2 A;  2CGP A;  1EH8 A;  1L3L A;  4BE2 A;  3GTL J;  3PJR A;  1GVD A;  2CW0 F;  2HKX A;  2IGK A;  4I6Z A;  1K7A A;  5H20 A;  1GV2 A;  1KZH A;  5J4V A;  2JN6 A;  2OD5 A;  1LFB A;  1ENH A;  3DEU A;  4LK1 F;  1YRN B;  4F55 A;  1O7L A;  4E7J A;  3BR0 A;  5JFR A;  4YRV A;  1DDN A;  1U9N A;  4W97 A;  4EV0 A;  3AAF A;  3NAR A;  2VUM J;  1TL8 A;  3JRA A;  5JHF A;  2XGE A;  1UG0 A;  2EJR A;  4IOC F;  4FCY A;  1YIT I;  1P4X A;  1IXR C;  1I50 J;  4PJM A;  3FF5 A;  1ORK A;  2IS6 A;  1LE8 A;  4N9I A;  3COA C;  1VQ9 I;  2WTE A;  4RB0 A;  4RGU A;  2K9S A;  3ZQI A;  2AXT C;  4HEA 2;  3LFU A;  3OYG A;  2VLA A;  5J1R A;  2DMP A;  4M74 A;  4XLC A;  3K9T A;  2DK5 A;  1E2X A;  1NH3 A;  4A3K J;  3WGI A;  3GFI A;  2H8R A;  3FMQ A;  1VND A;  2XVC A;  4EGZ A;  4HLX A;  4AWX B;  1S9H A;  3SDG A;  2FQ4 A;  4C2U A;  1SFK A;  2OV7 A;  4KFC A;  4G8X A;  4UB6 C;  2LF8 A;  3WTU C;  1KYZ A;  2DO7 A;  2MFZ A;  3JAM K;  2K27 A;  2PBI A;  1XDS A;  2Y31 A;  3EET A;  4IHV A;  1P92 A;  3PNV A;  2R7Z J;  2PMZ N;  2DJN A;  2KIU A;  4FX4 A;  4GXO A;  1W5C C;  3Q3S A;  4XMY A;  3CUQ A;  4I09 A;  2IEK A;  5F04 A;  4M9X A;  3BLY A;  1S7A A;  1Z67 A;  4EVI A;  3BT9 A;  1WJ5 A;  1R5H A;  2FXA A;  2MG4 A;  4BU2 A;  2EIJ H;  3REO A;  3BZC A;  2K4J A;  3KCC A;  1ZR4 A;  2DN0 A;  3N05 A;  4BUP A;  5E1X A;  2Z2S B;  1LEB A;  2L9N A;  3MCZ A;  5HLH A;  3HKZ A;  4KIS A;  2EIN H;  1IN8 A;  2ZFU A;  2JSC A;  2EIL H;  3LSK A;  2W24 A;  3BTI A;  3KEY A;  4HX8 A;  4DIQ A;  1T33 A;  4FX0 A;  4A3F J;  1QGP A;  1U8B A;  1XDU A;  2DFI A;  2E71 A;  3MFK A;  3F6V A;  1PYV A;  2ZSI B;  1BR2 A;  2ICW G;  2ESN A;  3QPH A;  5D5X B;  4B3A A;  2R7V A;  2EZL A;  3VYT B;  3ULQ B;  2JK3 A;  1ZHF A;  4IHS A;  4G6Q A;  3CF2 A;  1U0J A;  2HI3 A;  2Y30 A;  3DFG A;  2OBP A;  3RDI A;  3DPT A;  4DOZ A;  4A93 J;  5M3F J;  3HBL A;  2M5W A;  5B66 C;  4QPQ A;  1J7K A;  1ETY A;  3MKY B;  5JR3 A;  1HSJ A;  3D1N I;  1PP8 F;  4M3F A;  4CHU A;  4PFP A;  3X2Q H;  1UMQ A;  3BP8 A;  3ECH A;  2FUG 2;  2X1E A;  4M3G A;  3IKT A;  4L9J A;  1SD6 A;  3HRU A;  2BBY A;  2GOM A;  2WV1 A;  5IYB J;  3S2D J;  2MW8 A;  2A69 F;  3D5L A;  4BHP A;  2M8G X;  2KZG A;  2PMH A;  2CQN A;  3H35 A;  5IT9 K;  2LKS A;  1IC8 A;  1ON2 A;  3DTK A;  2M0C A;  1K79 A;  1RPW A;  1LDK B;  4BY7 J;  1VTN C;  3KP3 A;  1KU2 A;  3PUF A;  3IRR A;  1YHQ I;  3K4K A;  1GHC A;  2DMU A;  4PSX A;  1XSV A;  2J5P A;  1HST A;  1X3U A;  3B6C A;  1SAU A;  1R71 A;  1C0W A;  4BQA A;  1MBK A;  1W4M A;  1A6Q A;  4LG3 A;  3S14 J;  4XKB A;  3LSR A;  1OLT A;  2BXY A;  3DLL F;  2QSG X;  5F0C A;  2XUB A;  3PO3 J;  2RC4 A; 
#chains in the Genus database with same CATH homology
 2OPT A;  2YS9 A;  4V2F A;  3PO2 J;  3BG5 A;  2EQR A;  1HDD C;  2XB0 X;  5IP9 J;  1OJL A;  4BKX A;  2KDZ A;  2ZB9 A;  1XG1 A;  1GDT A;  2GBY A;  4MO7 A;  3HOU J;  2JMW A;  2LP0 A;  3E7L A;  3ZQH A;  1B8I A;  4AYB N;  1R9T J;  1MNM C;  1W0T A;  4A3M J;  5FKL A;  4IHW A;  4X1E A;  4MLO A;  2HXI A;  2FJ1 A;  1JT6 A;  2I10 A;  1FEX A;  4I76 A;  1POG A;  1GV5 A;  3H3V K;  2KT0 A;  3B6A A;  2LD5 A;  1OCT C;  3O8H A;  2NS7 A;  3HKZ N;  1JUS A;  2G0E A;  3HEF A;  4BBR J;  1UHS A;  1D5Y A;  1S7E A;  3RZO J;  4DYC A;  2CQQ A;  2LVS A;  2E2J J;  1JJ8 C;  4MFD A;  3ZQC A;  1VFC A;  4RDU A;  3JRF A;  3JRB A;  1IDY A;  2EZK A;  2ME0 A;  3TP3 A;  3UKG A;  2HDD A;  1JKP C;  5IOZ A;  3GTO J;  3S15 J;  2L7Z A;  4IEJ A;  2QCO A;  4HNV A;  2R0Q C;  3MKL A;  5E3M A;  1IRZ A;  3Q0V A;  1MBJ A;  5M3M J;  1AU7 A;  2LY9 A;  1TC3 C;  1BJZ A;  4C3J J;  3JRC A;  4XRM A;  1YRN A;  1FIP A;  2E2H J;  2R5Y B;  1EF4 A;  3M3Y J;  3LSJ A;  1A5J A;  1X2M A;  1JUM A;  3MVP A;  5EG0 A;  1Z0X A;  1LE8 B;  3M4O J;  4DYQ A;  4D5F A;  3LSP A;  2YUS A;  5C44 J;  2Y0S N;  1RR7 A;  4A3E J;  2FX0 A;  1GUU A;  2GLO A;  3FK7 A;  2X9D A;  3DEW A;  1ZTR A;  3RZD J;  3HOY J;  2JWT A;  3S1N J;  2O9L A;  3A01 B;  5GPA A;  2AHQ A;  1WPK A;  2CU7 A;  2LK2 A;  4UUT A;  3LNQ A;  4D7M A;  2MGQ A;  3CDL A;  2DTZ A;  1BL0 A;  2XRL A;  4BY1 J;  2Y2Z A;  1K61 A;  3HOW J;  2HQ5 A;  5F08 A;  5FKM A;  5EGO A;  4A69 C;  5M5X J;  4QSH A;  1FIA A;  3HOV J;  4X6A J;  2LR8 A;  2EBI A;  2WAQ N;  3QPS A;  3HOX J;  5IYC J;  4JYK A;  3TED A;  2WB1 N;  2L9R A;  3BR3 A;  1ETO A;  3S16 J;  3K7A J;  3JRI A;  4G12 A;  3ZQG A;  2NS8 A;  3A03 A;  1ZK8 A;  3SFI A;  3C2B A;  3HGY A;  5FKK A;  2O8K A;  2HOS A;  1BW5 A;  3CMY A;  4M3E A;  1I3Q J;  4M3B A;  4JX4 A;  2L0K A;  1CQT A;  1MH3 A;  1AHD P;  2XB5 A;  2H1K A;  1SFO J;  2CUE A;  4MFE A;  3BR6 A;  3S17 J;  1VF9 A;  2D5V A;  2ELK A;  4C3H J;  5FKN A;  3GTP J;  5IPA A;  1K83 J;  1TWG J;  2HXO A;  2DA3 A;  3IH4 A;  1W0U A;  2EZI A;  2IAI A;  2NVT J;  3PM1 A;  2R5Z B;  1JTY A;  1WH7 A;  4W1U A;  1MBF A;  3BQZ A;  5EZH A;  5EZG A;  2E1O A;  4FE7 A;  4DZP A;  3BQY A;  4IHY A;  1F36 A;  5M5W J;  1IJW C;  2MSY A;  3OSF A;  5EDN A;  2QF7 A;  4IHX A;  3NAU A;  4JP0 A;  1ETQ A;  1U78 A;  1JKR C;  3BR1 A;  4UUS B;  3GBG A;  3H0G J;  4DZJ A;  3FK6 A;  3TP0 A;  3Q0U A;  4CYC A;  1X2N A;  3BG3 A;  5IP6 A;  1UG2 A;  1ITY A;  4V2G A;  5EYR A;  3K2A A;  2P81 A;  2LTP A;  1WGX A;  1AKH B;  5F0H A;  2EZH A;  3W6V A;  2VKV A;  2XGC A;  1P7I A;  2DMT A;  3ZQF A;  1FTT A;  4D7N A;  4EEF G;  1RKW A;  1ETV A;  2HOA A;  3RQI A;  2CQX A;  1H89 C;  1WI3 A;  3OIO A;  1JKO C;  1PUF B;  4Y52 J;  2VI6 A;  4M6V A;  5DTD A;  2JA5 J;  1NK2 P;  1RET A;  3S1M J;  3WHB A;  2K9N A;  2XGD A;  1IV6 A;  1NTC A;  1HCR A;  3ZQL A;  5E3L A;  1ZGW A;  1P7J A;  5IP7 J;  2Y9Y A;  1RKT A;  4M3D A;  2XSD C;  2LFB A;  3SJM A;  4QIW N;  3S1R J;  5J3L A;  2R92 J;  4QTR A;  1JJ6 C;  5GP9 A;  2FD5 A;  2EH3 A;  1B72 A;  3S1Q J;  1FJL A;  2CRG A;  3ZOB A;  2N8G A;  4B1R A;  2JA8 J;  3FIS A;  3G1M A;  1DU0 A;  2ME6 A;  4MIM A;  2DMQ A;  2CJJ A;  1B8I B;  1Y1V J;  2M2E A;  1JKQ C;  1XS9 A;  2OF7 A;  1BW6 A;  4FE4 A;  4JX5 A;  5F27 A;  2DMN A;  2RAE A;  2JJ7 A;  1F43 A;  1IDZ A;  3OSG A;  4XIC A;  2X48 A;  1IG7 A;  3HM5 A;  4GFB A;  4D5C A;  4B4C A;  1H8A C;  1DU6 A;  4FIS A;  1IGN A;  2E2I J;  4C3I J;  4DW6 A;  3JRE A;  1JGG A;  3HDD A;  1QVU A;  2L7M P;  3BTL A;  1MSE C;  1NK3 P;  2ECC A;  5FLV A;  1ETK A;  1JUP A;  2M34 A;  1HLV A;  1ETW A;  4BBS J;  1HOM A;  3O8G A;  2ID3 A;  3TW6 A;  9ANT A;  3FKI J;  1ZKG A;  3GTL J;  3MN2 A;  1GVD A;  3I4N J;  4I6Z A;  4FTH A;  1GV2 A;  5K7Z A;  2JN6 A;  2L7F P;  1LFB A;  1ENH A;  4J19 A;  1YRN B;  3BR0 A;  3WHC A;  3RKQ A;  1U9N A;  4W97 A;  1U9O A;  3NAR A;  5EG0 B;  4Y7N J;  2XPV A;  2VUM J;  2HOT A;  3JRA A;  2E19 A;  2XPW A;  3JRD A;  3GTQ J;  2R5Y A;  2XGE A;  1TWF J;  4FCY A;  2K9Q A;  1I50 J;  1MBG A;  1ORK A;  1LE8 A;  1Q1V A;  5M5Y J;  5IYD J;  2K9S A;  1QRY A;  3ZQI A;  2ECB A;  5FJ8 J;  3LSG A;  1HF0 A;  1VI0 A;  1O4X A;  5F0F A;  5K7H A;  3HB9 A;  5J1R A;  4A3L J;  4S0H B;  2DMP A;  3A01 A;  2Y9Z A;  3BTJ A;  3OOU A;  2VKE A;  2YU9 J;  5E3O A;  4A3K J;  5EF6 A;  2W48 A;  2TRT A;  1Y1W J;  2H8R A;  5EGO B;  1VND A;  1JTX A;  5BNG A;  3GTM J;  2K40 A;  3SDG A;  2FQ4 A;  5EEA A;  5FKO A;  1ZQ3 P;  3CQZ J;  1FTZ A;  3L1P A;  5IOY A;  3JR9 A;  4A3J J;  5JLX A;  2Y31 A;  4IHV A;  2R7Z J;  2PMZ N;  1OFC X;  2DJN A;  3JRH A;  5C4J J;  2DA6 A;  3I4M J;  3Q3S A;  2B63 J;  1T56 A;  3IV5 A;  2IEK A;  5F04 A;  2X6O A;  1MBH A;  2NVY J;  1HDP A;  3JRG A;  3BT9 A;  2COB A;  2MG4 A;  2DA1 A;  1Z77 A;  1MBE A;  4ABZ A;  3GTK J;  4RBO A;  5F1J A;  1ZR4 A;  2DN0 A;  2HYJ A;  3CCY A;  3IH3 A;  1LFU P;  1IUF A;  5C4X J;  4L5E A;  3QQA A;  2IBD A;  4NDL A;  3BTI A;  1MSF C;  1U8B A;  3GTG J;  4A3F J;  1MH4 A;  1T33 A;  3S2H J;  2M9H A;  5JLW A;  1SAN A;  4JX6 A;  2R5Z A;  1X58 A;  2R93 J;  4B3A A;  2EZL A;  2DA2 A;  4A3G J;  5DS9 A;  2JK3 A;  3BTC A;  1QPI A;  3QPL A;  3F0C A;  4AC0 A;  2CUF A;  3HGG A;  2HI3 A;  2Y30 A;  1TWA J;  2DA7 A;  2GM4 A;  1A6I A;  4BXX J;  2DA5 A;  4A93 J;  1WCM J;  5M3F J;  3HBL A;  3TW7 A;  4XRS G;  3LOC A;  2JA6 J;  2JA7 J;  4A3C J;  3VPR A;  1ETY A;  3D1N I;  4CYC B;  4M3F A;  1BA5 A;  3G1L A;  3BR2 A;  5E3N A;  2XPU A;  1UMQ A;  3DCF A;  5K7F A;  4XRS A;  4UUS A;  2LLK A;  4A3D J;  4M3G A;  4LOC A;  5J1Y A;  1ZR2 A;  5GPC A;  1TWH J;  1APL C;  1JT0 A;  2WV1 A;  5IYB J;  3S2D J;  1E3O C;  4A3B J;  2MW8 A;  2M8G X;  1RES A;  1AKH A;  4DYR A;  1XC5 A;  1OCP A;  3Q0W A;  4A3I J;  1H88 C;  1IC8 A;  5C3E J;  5FLM J;  2M0C A;  1I6H J;  2AO9 A;  1RPW A;  1GT0 C;  4AUX A;  4BY7 J;  3G1O A;  5HOD A;  2NVX J;  2ID6 A;  2DMU A;  1PUF A;  1G2H A;  4XID A;  1ETX A;  2VPR A;  3HOZ J;  1WH5 A;  2LKX A;  3B6C A;  3BR5 A;  2DA4 A;  1MBK A;  1TWC J;  2O7O A;  1QVT A;  3BG9 A;  4C2M J;  3S14 J;  3GTJ J;  3LSR A;  4XK4 A;  2NOG A;  3A02 A;  1B72 B;  3FIW A;  2TCT A;  2NVQ J;  5F0C A;  5J1U A;  3PO3 J;  3IH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...