1VQ8I

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq8I00
1VQPI 3G4SI 3CCVI 1FOWA 5JVGF 2ZJQF 4IOAF 1FOXA 3CCUI 1YJWI 2H8WA 2ZJRF 2ZJPF 1FOYA 1YJNI 1Y39A 1VQ8I 5GADJ 3G6EI 2JQ7A 3J7ZI 2E36A 1YIJI 1YI2I 3DLLF 3CC7I 2E35A 3CCQI 1MMSA 2OTJI 3CJTB 3CCRI 2K3FA 1YJ9I 3CMAI 2QA4I 3I56I 1VQ4I 1VQOI 5DM6F 3CMEI 2E34A 3CCSI 3CC4I 1S72I 4V19K 3CCLI 4IOCF 5GAGJ 1VQKI 3CCJI 2NXNB 1ACIA 1VQMI 5GAHJ 5DM7F 1VQ7I 3CCMI 4IO9F 3CF5F 1HC8A 2QEXI 1VQLI 1YITI 1VQ6I 2FOWA 3PIPF 3J7YJ 3CC2I 3I55I 4UY8I 3CD6I 3PIOF 1YHQI 1VQNI 5GAEJ 3G71I 1QA6A 2OTLI 1VQ9I 1VQ5I 3CCEI
chains in the Genus database with same CATH superfamily
2CMPA 3GTMJ 1BJZA 3HGYA 1SFUA 3ZGKA 5AIQA 2AHQA 3LFUA 2VE8A 4AIHA 1MDMB 1RR8C 2XKOA 2KIMA 2ZJQF 1KYWA 1JKQC 2Z99A 2B7EA 4XKVA 1HW2A 2L7FP 4XSXF 2BXZA 4DQ2A 3A1YA 3FDYA 3HTUA 2F5DA 3LMMA 2FQ4A 3BLYA 2HPIA 1SD4A 3G1LA 2F6CA 2WWYA 1Y39A 1EJ9A 3CO7C 5M3MJ 3TMOA 2WY8Q 1F5TA 1W36D 2IXSA 4QPOA 2R4GA 4B8XA 5M5YJ 4X6AJ 2O9LA 1GHCA 4BXXJ 3G2BA 3IV5A 3EUAA 1T0FA 5L3EA 2V9PA 3PUBA 3GLXA 2D5VA 2STTA 2ZMEC 2NVXJ 4G94A 4N4NB 2UXXA 3SJMA 2OQGA 2JA7J 1S7AA 1YRNB 4HW0A 1HCRA 3OMYA 2H94A 3RI4A 2VKVA 1J0RA 1R1VA 3K4MA 1ENHA 3WTYC 1LJ9A 3K4NA 3PJRA 2R7ZJ 2K86A 3V8KA 1RETA 4O3MA 2EZLA 4V2GA 5DEQA 2VQCA 1LKXA 4E7ZA 1HKTA 1B8IA 3ZR8X 2M87A 2LMDA 2PN6A 1W5CC 2DA6A 4ZC3A 3ABUA 3BWGA 5HNFA 1R1UA 3R6SA 3S93A 1JE8A 2BHYA 1R9TJ 2A61A 4B47A 1SAXA 5E20A 3Q9SA 5TISC 3ABMH 2FBHA 3KETA 2R5YA 2PLYA 2IGNA 2M3AA 3U21A 2XV4S 2HXIA 2QLZA 4EJVA 3KX2A 1MBHA 3QWLA 3HXLA 1YYVA 2VI6A 3L2UA 1FP1D 2COMA 1HQCA 2DXIA 4IX7A 1KGSA 1AOYA 4TV7A 4RMNA 4BJ6C 1ZELA 1G2HA 1VF9A 2V79A 3PL8A 1F1ZA 2L3DA 3NQOA 1W0UA 1CF7A 3HOTA 3GFJA 3C2GA 1XGSA 4YRVA 2B63J 1P6RA 2LNBA 2RV8A 4GRIA 1RIOH 4EGZA 2MBFA 3TDUC 1LUJB 2LR8A 5LRSA 2OTLI 1TW3A 1X3ZB 3CJNA 3BCAA 2MYSA 4BS9A 3ZMSA 1POGA 2FBIA 2DFIA 3J81Z 1MMDA 3TW7A 2OU2A 1B1BA 1N25A 4HA8A 3OYCA 1ZN2A 4LK1F 2R5ZB 4F92B 2HS5A 1G3SA 4CCOA 3DEUA 4BE2A 2EV6A 3BTCA 3CESA 4BEHA 3BG5A 4IKFA 4LLLA 1U0JA 1IN8A 4ZDOA 1USTA 2LRDA 2ZJRF 2IRFG 4IHWA 4UUSB 3EUKL 1H0MA 2GIVA 2NOGA 5IT3A 4NHJA 3C7JA 3MKWB 1IN6A 4MQ9F 3KYDB 2ESHA 2NYXA 5F6FA 4BKXA 4LLNA 2Y31A 2HTJA 4WXHA 3E6CC 2EIJH 3VYSB 3FXQA 4EQQA 4EM2A 3CC7I 5L3BA 3AG3H 3MZYA 4EJUA 3WE3A 4KJZA 4DIQA 2LP0A 3VPRA 5K5QA 4M9ZA 4II2A 5LHIA 1V3FA 2BY0A 1TQIA 4M3FA 3FIWA 2E1MB 1Y8QB 4HV5A 1WJBA 2X4HA 2D2WA 4JX6A 4B43A 5K5OA 1QPMA 2DMUA 2FOKA 4XRSG 3CUOA 2W4SA 4FT8A 2OZUA 3CMEI 4KIGA 1WZ2A 3K1NA 3L00A 4ZZDA 1TTYA 2PMUA 4AC0A 2AXTC 2STWA 2EA4A 4AYBA 2CQ7A 3PNYA 1DU6A 4RA2A 2DYRH 1IRFA 1UFMA 1Z1DA 3CUQC 1ZG3A 3Q3SA 4DJAA 4YIFA 4QLCU 2KMUA 5EG0B 2XF5A 4PFPA 1U5TA 4A3KJ 4A3DJ 3FF5A 5D4RA 2ZMEB 5CVIA 5L3FA 3OYJA 2NOJB 4ZDLA 3QU3A 5IPAA 4II3A 3CCMI 2XRLA 4NQWA 1T38A 5LEJA 2PJRA 2DFHA 2DMPA 3GZNB 3BJOA 1BIBA 4CH7A 3K4BA 1FSHA 4OMZA 3O2PE 1LB2A 2DTZA 2W84A 2EB7A 1IGNA 2IA1A 2BVMA 3R61A 2FSWA 3TP0A 2LY2A 2COBA 1JUSA 1W7PB 1XDUA 1X1CA 2IA0A 3M07A 1PUFA 4Y17A 4BE0A 1Z7LA 3AFHA 2B0LA 5E8IA 4A3CJ 4MGRA 3CMYA 1LDDA 2QWWA 4HDUA 4ITVA 3DEWA 1EA3A 3RQ4A 5HDNA 4A3GJ 1CQTA 2KDOA 3FISA 3QPHA 4XLAA 2LDUA 2HDWA 1MSFC 3GW2A 3WE2A 1T56A 3GYHX 4BQNA 1VQ5I 1GLNA 3PQJA 3MMYB 2DK5A 5FD6A 1R1TA 4OINF 2XF7A 5D5UB 5D6EA 2HZDA 2J5OA 2K85A 4KUMA 3FK6A 3FWEA 5GTIC 2AQFA 3BC8A 4A12A 3V8LA 2IPQX 4RLQA 3GTQJ 2A05A 3PUFA 5B5EC 4XIDA 5FLXK 2MABA 1TT5B 4IRIA 3CP2A 2BYVE 3T0YA 1Z6RA 3I4NJ 2ECBA 1JTYA 3OSGA 4C2UA 5E17F 3I71A 1Z21A 1B9NA 1OR7A 2RNJA 5LRRA 3WGIA 1YJNI 3L1PA 3OYFA 4Y52J 3BPVA 2F5VA 3E6MA 1H9TA 1E17A 3WU0A 5E18F 1H8AC 4HX7A 2M4KA 5B1BH 2Z33A 5HLIA 5D5XB 1N77A 2DU9A 1F4KA 2PFBA 2IGKA 1XGOA 2E19A 2JK3A 4GFBA 3OL4A 1D5VA 4Y15A 2VPLA 3KP2A 3IH4A 4ZYAA 1P9QC 1QQIA 4BL0B 1D0ZA 4FX0A 3H9GA 4CHUA 3B6CA 1TNSA 5EYRA 3F23A 3T8TA 3PO2J 2DK8A 1ZKGA 1E3PA 2VKEA 1SFEA 3GWZA 3I64A 3ZCOA 2ZXWH 4IHYA 4HG2A 4EM0B 2EFWA 2WB1A 4J00A 1QHGA 5ICFA 5TGTA 1FPQA 4DW6A 3NARA 4P96A 4I09A 6PAXA 3H0GJ 1MNEA 3CDLA 2DDBA 3ULQB 4BY7J 3K69A 2FMLA 3AL0C 1LFBA 1K61A 3W2AA 4ENJA 2ME0A 4IHVA 3B02A 1BBYA 1OYIA 4H4KC 4GGGA 3OOUA 1QZZA 3LSRA 3HJEA 3MWMA 3KP5A 2EILH 3LSHA 1KA8A 3LNQA 3C2HA 3OYKA 1O3RA 3J7AY 1R4NB 3MN2A 3H0DA 3RKQA 3GFMA 3DFGA 2DAOA 5IOYA 5ILUA 1D3YA 1O7FA 3F6OA 4IQJA 1R36A 4KYWA 3CUQB 1O4XA 2L01A 4Y13A 2IS6A 3KLNA 5E1WA 3VSLA 4PJJA 4IRHA 5IOZA 1VTNC 5EZHA 2RQQA 4DZJA 1F43A 3SXYA 1UHSA 2ISYA 1MBFA 2QSGX 5DTDA 2VN2A 1R6RA 3G4SI 3GTKJ 2HQNA 4PK4A 4I0BA 3C1DA 5CVJA 2HDCA 1LVKA 3ZPLA 4G6DA 2PEXA 4UV9A 4O5VA 3JRCA 2V9VA 3JAMK 3K1PA 1TL8A 3ERMA 3TO9A 2JUCA 1YJWI 2H8WA 4FHTA 2L4AA 4G6TB 2G7UA 2NNYA 1D1BA 4IHSA 3JRIA 3DPTA 2QSHX 2H27A 3W6VA 2ADUA 2F4IA 1MBGA 5DCMA 2O5RA 3OS2A 3F8MA 2V1UA 2GBYA 4HEA2 2XKPA 4PZJA 3RKYA 1YW8A 2JVGA 4E7JA 2MLGA 1ETWA 3BZCA 1Y0NA 1DP3A 2VIXA 4EJTA 1FLIA 3MEXA 1E3HA 3KFWX 1YIJI 2DTRA 5E8GA 1SD5A 3W2VA 3A01A 1G3WA 3I3LA 3BTIA 2DMNA 2E35A 2WB1N 2PJPA 2EJRA 2Q2EA 1Q1HA 5B1AH 4OWRB 1AKHA 2Y30A 5H6RA 4I2OA 2NS7A 1P2FA 2CJJA 2RNGA 4XSZF 3ZN1A 2EZIA 3S3OA 4JBAA 4PJLA 2VLAA 3G1OA 2R7OA 3P9KA 4E7LA 2MC3A 3JRBA 2QA4I 5K7ZA 4A3BJ 3I56I 4XICA 2JA8J 4BQOA 4ZZLA 2R92J 4YFKF 2KL4A 1WKMA 2P7VB 3I9V2 2IS4A 3QP5A 1XG1A 3H3ZA 3BQYA 1ZREA 2V9KA 1MBKA 3JCUC 2PG4A 3BJ6A 5GPAA 2DOAA 1PVEA 5BQTA 2EQRA 1UMQA 2M5WA 1PP8F 1TWGJ 3E5UA 1K83J 5EEGA 5FKNA 3FHZA 4S05A 1SANA 1D1CA 4HOBA 1IF1A 3O3KA 5DM7F 3HRTA 3WTZA 3Q5FA 3BG7A 1WH7A 4M3DA 1K7AA 4DYCA 2KJBA 3OR1C 4L9NA 3MKZA 1K78A 2DJNA 2EV0A 2O03A 3LSJA 2OCEA 5HVQC 1V54H 4OAZA 1NK3P 3RIRA 2GM4A 3E5QA 1MIJA 5A2QZ 1B4AA 1OYYA 4XLEA 1V4RA 5TJJA 2XAJA 2PMHA 5J4YA 2MH2A 1W0TA 2LY1A 1ZQ3P 3IH3A 1Z3XA 2R7WA 1QA6A 1FEXA 2DMQA 4IHXA 2K9QA 4U7DA 2M9HA 3S14J 4OIQF 1MMNA 3JSOA 3AL0B 4AUXA 4HLYA 3W6JB 5F1RA 2X0LA 2VBZA 4ENMA 5HS7A 3LQQA 5E1ZB 2MFZA 2CUEA 4IOAF 3IHUA 4B44A 4A6DA 3S32A 1EKEA 4X0GA 4A3LJ 5LLQA 2NVTJ 4DNCA 4ETSA 1OCPA 3EUHC 2PI0A 3BPXA 3DWLE 3WGHA 1SD6A 2DBBA 2YPRA 1DP7P 3LL7A 1HKQA 2HNHA 5DV5A 5GADJ 4DOZA 2NVQJ 1QHHD 2ZSHB 2IA2A 3ZP5A 2QCOA 4UVCA 5F0FA 4N9IA 2BV6A 5D8LB 4HF2A 1VFCA 3TKYA 2DFEA 4E70A 1UJ8A 1YI2I 5GPCA 3BR1A 4UUTA 2FQ3A 3F6VA 1YOVB 3EPZA 4RS8A 3DLAA 2ISZA 1MMSA 1ZR4A 4O6JA 3TO7A 2OQRA 3C18A 3BR0A 1OCTC 3HEFA 4HPQA 2IAIA 5HLHA 4BNCA 2VXDA 4Z6YA 2YUSA 1TLHB 2OJED 1YJ9I 3DF8A 5B66C 5E3OA 1XD7A 3QYBA 4J19A 3FXJA 2L9SA 1DGRM 3K6GA 4Z2YA 5F64A 1O7LA 3IP4B 1IN7A 4PGGA 4Q48A 4G8XA 3DBHB 5FB2A 4A3IJ 5IY5H 1MH4A 3GVAA 5H6QA 2UZKA 4BY1J 4RGUA 2LY9A 4M3GA 5HS9A 1OCRH 1ZARA 3BP8A 1HW5A 4IOCF 3T1BA 5J1RA 2OCCH 2X9DA 3WTSC 3OY9A 2F4MB 3JTHA 1USSA 4M9SA 4M71A 1FBQA 3X2QH 2B9SA 3W6KB 1VQMI 4UB8C 2DOFA 5GAHJ 1FYKA 1CGPA 4L0ZB 2YSRA 1M1EB 2DLLA 1TC3C 2HGCA 5JVTA 3IKVA 1QO0D 3H35A 5EDNA 4J01A 3HOZJ 3KZYA 1RRJA 3VSKA 3OIQA 3CJRB 2HKXA 4OIRF 4XLNF 2P8TA 3LSMA 3ISPA 2Z5UA 2EFNA 3ZQ7A 2W00A 1G4DA 2JWTA 4IF4A 3HTSB 3HBLA 1KU2A 3BCBA 2FE3A 3ZMZA 1X1DA 1X3WB 4EMSA 2O0YA 2F2EA 4XMYA 3PNVA 4YELA 1G3YA 1J75A 4DYQA 2FUG2 4RAGA 4OAYA 2VT2A 1I50J 2KHMA 2KIUA 4AM3A 3TDZC 4AU7A 1WCMJ 5J47A 3FXLA 3I54A 4Q4ZF 1OCZH 3HIFA 1ZLKA 2WAQA 4MFDA 1JJ8C 3GEZA 3DU5A 3ECHA 1ETOA 1FOXA 3ZMVA 1C0WA 2XGDA 1OFCX 3I59A 4KT5C 1L0OC 1U8BA 1JT6A 3BTLA 1EF4A 3OYMA 3BR3A 2MGQA 2HOAA 4ESBA 3DPLC 4CCNA 3BTJA 4BHCA 5HOOA 3WHBA 3GTPJ 2VT3A 3L2CA 3CQZJ 4MNUA 2O7OA 3UKGA 1FJLA 2NS8A 3GMEA 2HVSA 2VQHA 1Y8RB 4EJOA 2BOLA 2E36A 3KIOA 5IP7J 2R3SA 3UR3C 2VJJA 4GDFA 1BW5A 1RESA 1W7PA 4CZZA 4L5EA 5F08A 2ZXHA 4FE4A 2YU3A 3H92A 3QPSA 4XLHA 4OIPF 2JT1A 2MLKA 1X4OA 1Z0XA 4LG0B 4ASNA 2RC4A 3PSIA 1YS7A 2E1MC 4CCMA 1ZRCA 2E2IJ 2OTJI 2ZBKA 2L02A 1MMGA 2L5QA 3K10A 1R23A 3N97A 3BG9A 4YFXF 3RZDJ 3TL4X 2Y9ZA 4QPQA 2KQRA 2BXYA 1ZGAA 5DUIA 3K70C 1ON2A 1Z7UA 2M1BA 3HDDA 3CCSI 3C3WA 1SVMA 3BJAA 3CC4I 2GWRA 1YG2A 5EEHA 1LDKB 4ZYDA 3K9TA 1WGXA 1WJCA 3R60A 5GAGJ 2X1CA 5HNHA 2ME6A 4HDVA 2ZJ2A 4PSXA 2M2EA 2Y48A 2ID3A 3IWFA 2HQAA 3OYHA 1XC5A 2F5CA 3SQNA 4JX5A 4F93B 3RKXA 4M73A 4B3XA 1WPKA 3GX4X 3C2BA 2KRHA 2MC4A 2X85A 2Y69H 3TOAA 2E2JJ 4D5FA 3QRFF 3OWTA 2HI3A 1JXSA 1IZ1A 2LLKA 3L2QA 3TBIA 5LGTA 2OUMA 2V1NA 1G6NA 4I6ZA 2MG4A 1K6YA 1MBJA 2DJIA 3H36A 4A5NA 1A31A 3DU6A 1U2WA 3FM5A 4M6VA 2LBFB 1IV6A 4WCGA 1JGGA 1IG7A 2JSPA 1XMAA 5CLSA 2DFFA 2UV1A 3TO6A 2FNAA 3ZRGA 3PNTA 2IGOA 2CFXA 3JRAA 2EFQA 4A0XA 1RNLA 2JMWA 4ENKA 1AWCA 1QZYA 3O6BB 1A35A 1T08B 2CRGA 1DGWY 5AONA 4R1HA 1E2XA 2X6YA 2RREA 3DV8A 2K9NA 2ELJA 2UWMA 4PJ0C 5FKOA 3RQIA 3OYNA 3OYAA 1BC7C 1U9NA 1V5GA 1K4SA 2QENA 4U87A 3WTXC 2G9WA 4L18B 2M7AA 1OPCA 5FRMA 4DGWB 5F0CA 4PCQA 5E3LA 1I6XA 1OQYA 3S16J 1PJRA 1D8KA 5JR3A 2BVLA 1ZRDA 1JT0A 2WV0A 4BXUA 3FM3A 3DEEA 4L5JA 2WBMA 2IGMA 4GO1A 1Y1WJ 3FMQA 2OV7A 2CW0F 1W1WE 2MA3A 4A3FJ 4DZPA 4XN3A 2W82A 4E4HA 4YEJA 3T8RA 1WI3A 2XPWA 5LHHA 3GLLA 3ML6A 5E3NA 2RQPA 2CFOA 5FJ8J 4C3HJ 3CP8A 1GUUA 5H20A 1MJBA 5LGNA 1NHAA 1IDYA 3K4KA 3CUQA 2CV1A 1G8XA 4CA0A 2VJ4A 4LK0F 2OC6A 3D5SC 1XMKA 4LD5A 4D9JA 3DKWA 3A2KA 2CSOA 2DMTA 3M8JA 3WU1B 2VKHA 1LFUP 1HBXG 3S1MJ 4G9YA 2MH9A 5DM6F 2C6YA 2WAEA 2DA3A 3ZQQA 1GT0C 3MVPA 1LPQA 3WODF 4RLFA 4M74A 3FKJA 2HOEA 1FIPA 2VBWA 2LKPA 2DA7A 2V1XA 2D1HA 3FX3A 3OYBA 3J80K 5J40A 1BOAA 2JUGA 1MH3A 2KP6A 3HRSA 3BQZA 3M9AA 2HQRA 3JRFA 3ASNH 4LLGF 5AIPA 2DODA 4H0EA 2O61A 1UG2A 5KHDA 4G7HF 2E60A 3K4LA 1HC8A 3J81K 2A5YB 4XONA 2QEXI 4M72A 3KP4A 3S1RJ 3DXJF 2FF4A 4CCKA 1VQ6I 3F21A 5DS9A 1HSTA 2OA4A 4BDYA 5BOXA 2XROA 3FXUA 1U9OA 2QKLB 3CO6C 5LD2C 4PJNA 2GXGA 2LC2A 3LSKA 3HG9A 3KEYA 3MKLA 5HLTA 1BW6A 1IAWA 3BZ6A 3HUGB 4RB1A 2CWEA 2O8XA 1EH7A 1YW7A 4C30A 1JI8A 3WHCA 1U3EM 2M8EA 1APLC 4LOCA 2QQ9A 2VC1A 3LOCA 3VYUB 4U0WA 2QQAA 1YQAA 2JTVA 1A04A 2X6WA 4AVZA 2F5EA 2L7KA 4NNJA 2L7MP 2RVCA 3G73A 3HSEA 1Y6IA 4NB5A 1QPIA 4XLFA 4A6EA 3CCUI 2K9MA 1RUNA 3HM5A 3U9GA 4KIBA 1F9NA 3IKTA 5FLXZ 1BC8C 2CV0A 1ZR2A 2WTEA 2DYSH 5IYCJ 3FXOA 2Z2SB 2RDPA 5CJ9A 2PQ8A 2KFDA 4NBQA 5FROA 4MTDA 2Y9YA 3ZQFA 2DO7A 2X51A 5F27A 3Q9VA 4ZDPA 2QGUA 4A3MJ 4WXCA 3H5NA 4ON0A 1PYVA 1U6GA 3D0SA 3GTJJ 2EFPA 2GA1A 3BG3A 4UXNA 4BU2A 4B4CA 4C9YA 2ZFUA 2BY2A 4HNTA 3CLOA 4GCVA 1YIOA 5J3LA 2VOPA 2ZSIB 2V4JC 2K4JA 2LH9A 3SYTA 4MEXF 1S8NA 2CH0A 3KLOA 3A03A 2H1LA 3R4KA 4CYDA 5LBQA 1DU0A 3SHFA 3WG9A 3MQ0A 4F52A 1ETQA 2BEOA 4AYBN 1WJFA 3E7LA 1VQKI 4BH9A 1BI0A 1OMIA 3HGGA 4RGSA 3TGNA 4HRIA 1IXCA 4QTRA 3RPUA 2W24A 4ZTJA 3N4MA 2DQLA 1P7IA 2XPVA 4D7NA 1Z77A 2HOTA 3E0JB 2R7RA 5JLXA 3RJPA 1FP2A 4IEJA 4M9XA 3A0HC 3OSFA 1E3OC 1X1PA 3HOWJ 1VQLI 3KP3A 1HW1A 1ZGJA 2DT6A 2QF7A 2LTPA 4QIWN 3EYIA 3FBNB 4MFEA 2VONA 1TT0A 2XGCA 1QBJA 1N75A 1XGMA 3PIPF 4KISA 4PDKA 3J7YJ 5D4SA 3HRUA 3F8CA 5KCMA 3S2HJ 1KONA 4WF2A 1MNDA 3OYLA 5IT9K 2VBXA 3VB2A 4NDLA 2L9VA 3OOPA 4BDZA 3CF5F 2KPMA 1SEUA 4ZH4F 3M1CA 2Z9OA 1OLTA 1OYWA 5C3EJ 1DQUA 1TZLA 2XPUA 3ZMUA 4GYGA 4XQFA 3EDPA 1AHDP 3FK7A 1XCVA 3HOXJ 2R7VA 4I98B 1OKRA 3OYDA 3JAMZ 4HLXA 3QPLA 3H1CA 3U1DA 3RKWA 5BMZA 4RBOA 1KQ8A 5FKKA 4W97A 2KZGA 4C3IJ 2R7TA 2ZJPF 2QM3A 1R00A 2FMYA 4AIJA 1DPUA 4A0ZA 3QPTA 2NVUB 2ZNZA 2EH3A 3WGGA 2QQ8A 4U7BA 3G6EI 9ANTA 4JYKA 2LD5A 3R0JA 4CXFA 2VOOA 4G7OF 3BG6A 2NVYJ 3DLLF 4XOPA 1B9MA 4A69C 4D0PA 4R79A 2XSJC 2GOMA 2LFBA 1E0EA 4P55A 2GQQA 4DYRA 3P9IA 4PUSA 2GXBA 4UVBA 3SDGA 4ABZA 5K5RA 3F8FA 2G7HA 3AAFA 2JSCA 2PMZA 3GUDA 1GVDA 1H89C 1I3AA 2E7WA 2E71A 2QYOA 1WHUA 2I8DA 3V7CA 2JRTA 2CQXA 3ZQHA 2XSDC 4FTHA 1IDZA 2Y0MA 3QU6A 3ROUA 1S6LA 4HZFA 1ZGWA 1WWXA 1S29A 3DTIA 1TWCJ 2JPCA 2XUBA 4P5OA 2CW7A 3F0CA 4I01A 1LEBA 1ETVA 2LOOA 1IRGA 3L9FA 3D1NI 4S0HB 3WTUC 1KZHA 4A93J 1ACIA 3NAUA 2QZ8A 2CYYA 2Y2ZA 2A6HF 5J8FA 1LE8B 2I5UA 2D1VA 3FKIJ 4AVPA 1X1AA 4MLOA 1JHHA 4F3QA 2EIKH 5EEAA 3JTGA 1IJWC 1F36A 2EV5A 3IAM2 3S2DJ 2E2HJ 4XM3A 2ECCA 4RAYA 5DCFA 1RR7A 2NRAC 1GV2A 2X6OA 2GOXB 3I4PA 2W7NA 1QGPA 5K7HA 2FJ1A 3LAJA 1MDMA 1ONVA 1RC9A 1KU7A 1NTCA 2GA2A 4OU0A 5L3GA 1JTXA 5FLMJ 4LG0A 4A2UA 1NH3A 1GXPA 1FBUA 1T95A 1H9GA 4P9FA 1FYMA 3COAC 1T33A 1Y0UA 1BR2A 2DT5A 2QVOA 4AIKA 2YR2A 1ETYA 4NQWB 4N9HA 2PJRB 3EUHA 3K1MA 1S7OA 4ANJA 2JVHA 2A69F 1O3SA 3CCEI 4FQGA 3T5XA 4DBRA 5HS8A 1W36C 3K4CA 2KLOA 3RYRA 4PGHA 5JVGF 4LG3A 3WTTC 4QSHA 1HOMA 3ABKH 1XB4A 3DCFA 2HEOA 2ZXIA 1GV5A 4ESFA 4U88A 4NUBA 3I58A 4KMUX 1WQ2A 2R7XA 5FO5A 4A5MA 4IJAA 1H88C 3UNGC 2PMZN 3PFIA 4G6QA 4CCJA 1YRNA 5J6XA 2EPFA 2ETHA 4D7MA 1QU3A 4UB6C 2TCTA 3J7ZI 2IBDA 3LA3A 4HQEA 4HYEA 3JRHA 4M6YA 2ICWG 3QOEA 3SEZA 5KAFC 5L3CA 2LK2A 2XF6A 3B6AA 3V7SA 2JA6J 2NNNA 3DP7A 1HF0A 3V8JA 4WWCA 1X3UA 1QVTA 3IL2A 2JPBA 2K9LA 5FFZA 4I02A 3VEPA 4EVIA 4YIRX 1JHFA 3J7AO 3E6DA 4MO7A 4WXDA 1RI7A 3ABTA 3MFKA 3S1QJ 2FD5A 4FE7A 1FC3A 3LQRA 2QBYB 3O8HA 3HOVJ 4EM1A 4FX4A 1HKSA 1SFKA 2NAZA 3S2WA 3WU2C 2X1EA 4IZZA 2IS2A 3OV8A 4XNFA 3TW6A 3W3CA 1TW2A 2LREA 3EQLF 1VQ7I 1JKOC 3OIPA 5K7FA 2HWVA 3LSGA 2HQ5A 1BI3A 3CLQA 3S8PA 3MZ8A 3FBIB 1PP7U 4PFOA 1STZA 1IV8A 5CKTA 3L2RA 5EGOB 4KA4A 2M0MA 5CVUA 1B72B 2HTSA 3HHGA 2R5ZA 4CYCB 2N8GA 1D1AA 1UELB 3F8NA 4D1QA 4HAMA 2Z16A 2CW8A 3BOQA 1FYLA 3GTOJ 4XRSA 2XRNA 4UUSA 4V2FA 2XVCA 2M7BA 3HL2A 2F48A 1VQ9I 1I6HJ 1TQMA 1MKMA 3OR2C 4XKCA 1SC7A 1ON1A 5BPIA 4L9JA 3KP6A 3RPUD 4Y7NJ 2CG4A 2WC2A 3MKYB 4E7HA 4CGZA 3ABLH 2HYGD 2D45A 1ZYRF 2GIZA 1A36A 4M3EA 2P81A 1HLVA 4BHPA 2LYCA 1X2MA 4IQ4A 4XKBA 4JX4A 3WTVC 2VXZA 2QKMB 1AA7A 4XLPF 4LMYA 2FNPA 1MSEC 5ICEA 2V7FA 3M8FA 2L7ZA 3LWFA 2W1OA 5IP9J 1NG7A 1BN5A 3AKZA 1QZEA 5EG0A 4HSRA 2V6EA 1WH5A 4CICA 4AWXB 1TWFJ 5B3SH 3HUGA 3I0TA 2R7FA 2P6SA 3QQAA 5DCMB 2E1CA 1IRZA 2UXNA 4KICA 2VUMJ 1W4MA 2ZMEA 2BW3B 5LHGA 3I53A 4A3JJ 3GZ6A 2ELKA 1SFXA 1V55H 1R71A 3KYCB 4OMYA 4KN7X 3M1EA 4IPAA 1SVLA 1W5SA 3FXKA 5EJCA 4NC6A 4RB0A 1S72I 1TNTA 2DOEA 2EZHA 2E1OA 4R8HA 5E79C 2YX4A 2O3FA 1U78A 3U1KA 2EA2A 3I5UA 3VOEA 2L9RA 2XAHA 4EGYA 2NXNB 1TWHJ 5DUKA 5CVRA 5BPDA 4DBQA 1IXSB 1Y56A 1I39A 2EZKA 1UB9A 5GP9A 2HFHA 1TBXA 1EH8A 3RYPA 3WG7H 4E7IA 4HNUA 5IYDJ 1O3QA 3GO5A 2IP2A 2CU7A 3DTEA 4RAFA 3IAS2 1YS6A 2FU4A 3VDXA 2K7LA 2R7QA 2Q0OA 3HOSA 3L7WA 3BROA 3CC2I 2PX9A 4HNVA 2HVRA 3CD6I 1J7KA 1MJAA 3JW4A 2Z3YA 3P7NA 1O3TA 1UHWA 2RAEA 3A0BC 1Z9CA 1XSDA 1YTYA 1K78B 5DYMA 4I76A 4IHTA 2IT0A 1ERDA 2M0CA 1ZG1A 3PQKA 3F22A 3ZQCA 3CCVI 1FWZA 4BGDA 3K2ZA 2KIFA 3R0AA 3ZMDA 3FXMA 2AO9A 2WAQN 2VQLA 5HDGA 3JRDA 1MBEA 2RN7A 3VWBA 2P5VA 4LJZF 2W48A 4MTEA 2VPRA 1P4AA 4LITA 1EV7A 1LVAA 1TQPA 3HB9A 4BYYA 4JQFA 3FXRA 5KNLA 3ZOBA 5EZGA 5ED4A 2JQ7A 1YX3A 4EJWA 4MIMA 4E7SA 1OCCH 1LFPA 2KJCA 4CDGA 1ETKA 4NC7A 2OZ6A 1XS9A 1WJAA 4BAYA 5D5WB 2ZB9A 4WK8F 3AG4H 2JJ7A 1RPWA 3IH2A 3REOA 2AS5F 1O57A 2Q1ZB 3H3UA 4FCYA 4Y33A 3G1MA 3AG2H 3A02A 3W2WA 5CVVA 2L0KA 4AD9A 3H5RA 1QRYA 3H5AA 5LGUA 4BACA 3ZQLA 4UUVA 1BR4A 3KE2A 1XN7A 1FBSA 2VODA 4UV8A 1YX5A 1XTAA 1UAAA 1OJLA 5EF6A 4C3JJ 3DPUA 1R5ID 4LIUA 4K2EA 5M3FJ 1K4TA 5CQEA 2XAUA 2DCEA 1FTTA 1WJEA 2WAFA 2Y75A 3HC7A 1T0FC 2ZFWA 2FEZA 4BE1A 1I5ZA 1R7JA 3D5RC 5C44J 1ZTRA 1REPC 3J80Z 3HPGA 1J09A 2A68F 3ESWB 1XDSA 4BJTA 5BNGA 3IRQA 3CCJI 2P5LC 1WSUA 2H09A 2KT0A 1GXQA 2ZC2A 1ORKA 4RB3C 1JUMA 1R5HA 3S1NJ 2XHKA 3QYFA 5JHFA 1KQ0A 1JKPC 4G12A 4S04A 3M8EA 2P5KA 2ZNYA 3NRVA 4IVNA 2CUJA 1WRJA 4ENNA 4BBSJ 3SZPA 2EIMH 1JJ6C 4CO8A 3ZQGA 3E6BA 5FGMA 4X1EA 3OYEA 2Y0SA 1YO5C 2LKXA 2JRMA 3I55I 3P5JA 1WVRA 2E5NA 3U2RA 3PSFA 2YS9A 3GCMA 3L2WA 5GAEJ 3F3XA 3TP3A 2A6EF 1X1BA 1QNTA 1V5EA 2VQGA 2P7CB 4LB6B 1P4WA 5D6FA 2DA1A 3QAHA 1FSEA 1XCBA 2DI3A 2DT7B 4MQVA 2CV2A 1SAUA 3ASOH 3FMRA 1KU3A 4XR6A 3ECOA 2CUFA 1I1GA 3KEOA 5JFRA 2HYJA 1D0YA 4GYIA 3IUOA 4GXOA 2CQKA 1A5JA 2VASA 2ZXJA 2BY3A 4ZTFA 3DBLB 5LEKA 1Q1VA 3LA7A 1S3JA 2I10A 1LE8A 4N4OB 1NK2P 3HSRA 3GZ5A 2OD5A 2ZKZA 4IL6C 1T8IA 1VQ8I 2YX7A 1UG0A 1G3TA 4U0VA 3HHHA 3SZGA 4UVAA 1I1SA 4EATA 2VJIA 3DBRB 5TRDA 1IO2A 3ZN0A 4B3AA 1GVJA 4YFNF 1X19A 4CUGA 3I59B 2WV1A 1RKWA 5FLVA 1Y1VJ 3TQNA 4RM2A 3KCCA 4KIFA 3CJTB 2HKOA 2OPTA 3VYTB 5FFXA 1BM9A 2XB5A 1J59A 4RDUA 4XK4A 2HYFA 3F9KA 1MGTA 3GFIA 5M5XJ 3V7RA 1Z3YA 4EEFG 4XLCA 5LFAA 4HQMA 4OOIA 2KRCA 1P92A 1DPRA 1NG6A 5D5VB 3CCLI 4UNOA 1FZPB 5KK1A 4D5CA 3TEDA 3I4MJ 1WI9A 1ITYA 4CSWA 2Y0SN 2H6BA 1ZG5A 3GF2A 2WY7Q 5JHUA 2K9SA 2R7DA 2HU9A 2K40A 2A5WA 2VL8A 3K70D 1BL0A 2EK5A 3KEQA 4KMFA 3RCOA 4W1UA 1YITI 2V26A 3JR9A 2IVMA 2K4BA 2LSOA 3SFZA 1U5TC 1YLFA 3AG1H 1ZHFA 3OL3A 2EBIA 1BI1A 2XAFA 1IC8A 4IRGA 1G59A 4FETA 4LGWA 1PUEE 4AIDA 2DDAA 4ZJZA 3CJQB 2QSFX 4HV6A 3L2VA 4Y4RA 5L3DA 4UY8I 4N0BA 1U8RA 1VNDA 3DKXA 3OYIA 3G71I 1YE9A 3Q0UA 2PBIA 3JSPA 1W5TA 4P9UA 4RAZA 3EYYA 2AQEA 5IT9Z 2K3PA 2Q8KA 1SMTA 3IRRA 2TDXA 1VQPI 1W7PD 2HR3A 2LG4A 4NC8A 5DD8A 4E6KG 1SVOA 5ICCA 1X2NA 4LIVA 2KZVA 5ILSA 1XMXA 2K27A 5HLGA 3LA2A 1B8IB 2M30A 1MMAA 4YIIA 5J1UA 3GBGA 2CGPA 1ZLJA 3VYRB 2QBYA 1R49A 2JA5J 2BBYA 5JLWA 5FKLA 2R5YB 2LF8A 1AU7A 1FMWA 2W85A 5ERIA 3P9CA 1FOYA 4KN4X 5J1YA 5D8KB 2KIQA 3RPQA 2MD5A 3TOBA 2R93J 2FA5A 3LAPA 4BJ5C 2R7UA 1T39A 1ODDA 2DQRA 3M3YJ 3F72A 4RM3A 4Q47A 4Q5SF 4JOMA 3LSTA 4XN0A 5EGOA 3MD2A 1CF7B 1B72A 2VC0A 2W57A 4ZYGA 2O8KA 2LKSA 2XC7A 4KDPA 1KU9A 5E1XA 4CYCA 2CUZA 3SFIA 2P6TA 1OR7C 1DDNA 3PO3J 1FMVA 2L4MA 2ZCWA 3M4OJ 2HOSA 3HRMA 2LVSA 3CMAI 3BZKA 5DD4A 1T98A 2JA2A 1X4PA 2OBPA 3E3VA 1SD7A 1FT9A 3S17J 3CDHA 1UHMA 4MHGA 4XBFA 1XPXA 3S15J 4XORA 3FHNA 1R5GA 2FRHA 1HA8A 4JP0A 1S5LC 2VBYA 2HVQA 3S3MA 5IYBJ 4BEHB 5JI6A 4V19K 4EV0A 1FTZA 1T6SA 4L5IA 3QODA 4FASD 3N05A 4F91B 2R7SA 3E5XA 1YW9A 3V4GA 1V5FA 3K2AA 2NS0A 1BA5A 3DKYA 3K7AJ 4RGXA 4M3BA 2EWNA 5IP6A 2VE9A 2RGVA 3CZ6A 4C2MJ 1XX5A 3RDIA 2A07F 1LEAA 2F5FA 2Z1DA 4KT6A 4WX9A 2KISA 1FOKA 4L0YB 2BGCA 3HPHA 5KAIC 2XGEA 1IN5A 4ZYEA 3KPHA 1VQNI 2ACJA 1UZCA 2DA5A 3ERED 3SDBA 2H1KA 1J9IA 1IN4A 3LSPA 1IUFA 2IEKA 2BW3A 2YU9J 2V1DA 3NEUA 5K1YA 4XKWA 4RB2C 4HBLA 5F04A 1XSXA 3CCYA 3H9QA 2KKOA 3E97A 1X58A 1TWAJ 2MSYA 4B48A 1FOWA 3QP6A 2XASA 2FXAA 2IJLA 2BHZA 5HODA 2K02A 1A6IA 1U5TB 4L9VA 2V6CA 3OS0A 2X6XA 3M7GA 2EINH 2ESNA 1FX7A 2RKHA 1Z6TA 3BY6A 2XAQA 3ONQA 3RTRA 3S3NA 2XB0X 1MZBA 2KDZA 2KRFA 3GFLA 3HOYJ 4IXAA 3BR2A 4P1WA 3BT9A 1SFOJ 1PDNC 4XRFA 1GDTA 1KYZA 4HSTA 3CMMA 3GTLJ 5BS6A 2ID6A 3KYLA 1HSJA 2E7XA 3DTKA 3Q0VA 2E1NA 4CZCA 1RKTA 1D5YA 4HX4A 5J4VA 4CCLA 4I7HA 1PUFB 1N78A 2L2OA 2GXAA 3KZZA 3JREA 1OISA 1WFXA 1LDJA 2HZTA 4B09A 2L54A 1SMYF 3BR6A 1BI2A 3CCRI 1Z05A 2VKDA 4BQQA 3LFKA 1RZ4A 2H6CA 2E5ZA 3VFZA 4XOTA 1OCOH 2L9NA 1VQ4I 1J2XA 3CDIA 2H8RA 2FX0A 3QYEA 2E34A 2LF7A 4I99C 2XGXA 3HZJA 4UHTA 5DDGA 1XSVA 2BE5F 4G7ZF 1HDDC 4RGRA 3H9JA 4JK1X 3VODA 2LBFA 4BQAA 2J5PA 3BR5A 4F7ZA 1QVUA 3O8GA 3MAJA 2P0WA 2A6TA 2K5CA 4HX8A 1XGNA 3HKZA 2CS3A 3FZVA 3IC7A 4PJMA 1LQ1A 1JUPA 2CO5A 2F4OB 2FOWA 3V42A 3CTAA 4FISA 2WA0A 3ZQIA 1Z91A 5A2QK 3Q0WA 5CPRB 4I0AA 1S9HA 1HXDA 1YFHA 3B73A 1ZRFA 4M6XA 3H3VK 3FMSA 1HDPA 3KP7A 2HPMA 3G3ZA 3PIOF 1L3LA 5H2FC 1P7JA 1IRXA 4B1RA 2M45A 4KFCA 3QOPA 1KQ9A 1WJ5A 3F8BA 1R58A 2OAZA 3GXOA 2BZTA 2FBKA 1D0XA 4ZYHA 1DUXC 1S7EA 1EH6A 1Z67A 3OYGA 2DPUA 2GLOA 3L09A 3SEQA 3IWZA 2O6GE 1ZAOA 3EETA 4KITB 4MEYF 2TRTA 2IS1A 3ELKA 4XL9A 1A6QA 2R0QC 5C4XJ 3KZIC 2BY1A 5F1JA 2VB6A 3K4JA 3RSNA 5J8CA 1WJDA 5C4JJ 2DW4A 3OS1A 5HDKA 1FIAA 4PSWA 2DA2A 3HSFA 2DPDA 2XIGA 1FNNA 1JKRC 3K0LA 2CQQA 5GTHC 2UUZA 5ICGA 4L9TA 5CYVA 1I27A 4LFUA 2XAGA 2MW8A 3HYIA 3PFYA 4QWQA 4A0YA 5ILVA 4HF1A 1FY7A 2ELHA 3WTWC 2X1DA 1ETXA 2VJ5A 1BOBA 4LB5A 3LSIA 1IXRC 1B59A 3CCQI 1I3QJ 1ZH5A 1K79A 2GZWA 5KVRA 1MJ9A 1ULYA 2IW5A 2K3FA 5FRNA 4BBRJ 1MNMC 2QUFA 1VZ0A 3SZTA 3MCZA 3HKZN 2ZO4A 1VQOI 5CQGA 2AXLA 2DA4A 5FD5A 1JGSA 2WADA 4OIOF 2X48A 2A3SA 2M34A 4BHBA 4BUPA 4U0YA 3JRGA 2CQNA 1R22A 3GTGJ 1D8JA 5E3MA 1T2KA 1IW7F 1MD0A 1UCRA 5FKMA 1BR1A 2DN0A 4XRMA 3NWSA 3MZHA 2GAUA 4F55A 4A3EJ 4IO9F 2W25A 3ZXSA 3D5LA 4ESJA 3A4CA 1ZK8A 4YG2F 3NWTA 3OIOA 3HOUJ 1MW7A 1P4XA 4KNYA 3CF2A 3E1SA 4C2TA 3DQVC 2EFOA 2MD0A 4E7KA 1LNWA 2OF7A 1B6AA 1VI0A 3A01B 1K6OA 4BXFA 3RZOJ 2Q2EB 1BIAA 2P4WA 1AKHB 1IUYA 1TP4A 2HXOA 2G0EA 4Y3OA 5F0HA 2JZYA 1YHQI 2HDDA 4HF0A 3BDDA 5M5WJ 2JN6A 2XDVA 3PM1A 3ZMTA 1R4MB 2M4GA 1J5YA 2M8GX 2QQBA 1RUOA 1BJAA
chains in the Genus database with same CATH topology
1VQPI 3G4SI 3CCVI 1FOWA 5JVGF 2ZJQF 4IOAF 1FOXA 3CCUI 1YJWI 2H8WA 2ZJRF 2ZJPF 1FOYA 1YJNI 1Y39A 1VQ8I 5GADJ 3G6EI 2JQ7A 3J7ZI 2E36A 1YIJI 1YI2I 3DLLF 3CC7I 2E35A 3CCQI 1MMSA 2OTJI 3CJTB 3CCRI 2K3FA 1YJ9I 3CMAI 2QA4I 3I56I 1VQ4I 1VQOI 5DM6F 3CMEI 2E34A 3CCSI 3CC4I 1S72I 4V19K 3CCLI 4IOCF 5GAGJ 1VQKI 3CCJI 2NXNB 1ACIA 1VQMI 5GAHJ 5DM7F 1VQ7I 3CCMI 4IO9F 3CF5F 1HC8A 2QEXI 1VQLI 1YITI 1VQ6I 2FOWA 3PIPF 3J7YJ 3CC2I 3I55I 4UY8I 3CD6I 3PIOF 1YHQI 1VQNI 5GAEJ 3G71I 1QA6A 2OTLI 1VQ9I 1VQ5I 3CCEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP I;  3G4S I;  3CCV I;  1FOW A;  5JVG F;  2ZJQ F;  4IOA F;  1FOX A;  3CCU I;  1YJW I;  2H8W A;  2ZJR F;  2ZJP F;  1FOY A;  1YJN I;  1Y39 A;  1VQ8 I;  5GAD J;  3G6E I;  2JQ7 A;  3J7Z I;  2E36 A;  1YIJ I;  1YI2 I;  3DLL F;  3CC7 I;  2E35 A;  3CCQ I;  1MMS A;  2OTJ I;  3CJT B;  3CCR I;  2K3F A;  1YJ9 I;  3CMA I;  2QA4 I;  3I56 I;  1VQ4 I;  1VQO I;  5DM6 F;  3CME I;  2E34 A;  3CCS I;  3CC4 I;  1S72 I;  4V19 K;  3CCL I;  4IOC F;  5GAG J;  1VQK I;  3CCJ I;  2NXN B;  1ACI A;  1VQM I;  5GAH J;  5DM7 F;  1VQ7 I;  3CCM I;  4IO9 F;  3CF5 F;  1HC8 A;  2QEX I;  1VQL I;  1YIT I;  1VQ6 I;  2FOW A;  3PIP F;  3J7Y J;  3CC2 I;  3I55 I;  4UY8 I;  3CD6 I;  3PIO F;  1YHQ I;  1VQN I;  5GAE J;  3G71 I;  1QA6 A;  2OTL I;  1VQ9 I;  1VQ5 I;  3CCE I; 
#chains in the Genus database with same CATH topology
 2CMP A;  3GTM J;  1BJZ A;  3HGY A;  1SFU A;  3ZGK A;  5AIQ A;  2AHQ A;  3LFU A;  2VE8 A;  4AIH A;  1MDM B;  1RR8 C;  2XKO A;  2KIM A;  2ZJQ F;  1KYW A;  1JKQ C;  2Z99 A;  2B7E A;  4XKV A;  1HW2 A;  2L7F P;  4XSX F;  2BXZ A;  4DQ2 A;  3A1Y A;  3FDY A;  3HTU A;  2F5D A;  3LMM A;  2FQ4 A;  3BLY A;  2HPI A;  1SD4 A;  3G1L A;  2F6C A;  2WWY A;  1Y39 A;  1EJ9 A;  3CO7 C;  5M3M J;  3TMO A;  2WY8 Q;  1F5T A;  1W36 D;  2IXS A;  4QPO A;  2R4G A;  4B8X A;  5M5Y J;  4X6A J;  2O9L A;  1GHC A;  4BXX J;  3G2B A;  3IV5 A;  3EUA A;  1T0F A;  5L3E A;  2V9P A;  3PUB A;  3GLX A;  2D5V A;  2STT A;  2ZME C;  2NVX J;  4G94 A;  4N4N B;  2UXX A;  3SJM A;  2OQG A;  2JA7 J;  1S7A A;  1YRN B;  4HW0 A;  1HCR A;  3OMY A;  2H94 A;  3RI4 A;  2VKV A;  1J0R A;  1R1V A;  3K4M A;  1ENH A;  3WTY C;  1LJ9 A;  3K4N A;  3PJR A;  2R7Z J;  2K86 A;  3V8K A;  1RET A;  4O3M A;  2EZL A;  4V2G A;  5DEQ A;  2VQC A;  1LKX A;  4E7Z A;  1HKT A;  1B8I A;  3ZR8 X;  2M87 A;  2LMD A;  2PN6 A;  1W5C C;  2DA6 A;  4ZC3 A;  3ABU A;  3BWG A;  5HNF A;  1R1U A;  3R6S A;  3S93 A;  1JE8 A;  2BHY A;  1R9T J;  2A61 A;  4B47 A;  1SAX A;  5E20 A;  3Q9S A;  5TIS C;  3ABM H;  2FBH A;  3KET A;  2R5Y A;  2PLY A;  2IGN A;  2M3A A;  3U21 A;  2XV4 S;  2HXI A;  2QLZ A;  4EJV A;  3KX2 A;  1MBH A;  3QWL A;  3HXL A;  1YYV A;  2VI6 A;  3L2U A;  1FP1 D;  2COM A;  1HQC A;  2DXI A;  4IX7 A;  1KGS A;  1AOY A;  4TV7 A;  4RMN A;  4BJ6 C;  1ZEL A;  1G2H A;  1VF9 A;  2V79 A;  3PL8 A;  1F1Z A;  2L3D A;  3NQO A;  1W0U A;  1CF7 A;  3HOT A;  3GFJ A;  3C2G A;  1XGS A;  4YRV A;  2B63 J;  1P6R A;  2LNB A;  2RV8 A;  4GRI A;  1RIO H;  4EGZ A;  2MBF A;  3TDU C;  1LUJ B;  2LR8 A;  5LRS A;  2OTL I;  1TW3 A;  1X3Z B;  3CJN A;  3BCA A;  2MYS A;  4BS9 A;  3ZMS A;  1POG A;  2FBI A;  2DFI A;  3J81 Z;  1MMD A;  3TW7 A;  2OU2 A;  1B1B A;  1N25 A;  4HA8 A;  3OYC A;  1ZN2 A;  4LK1 F;  2R5Z B;  4F92 B;  2HS5 A;  1G3S A;  4CCO A;  3DEU A;  4BE2 A;  2EV6 A;  3BTC A;  3CES A;  4BEH A;  3BG5 A;  4IKF A;  4LLL A;  1U0J A;  1IN8 A;  4ZDO A;  1UST A;  2LRD A;  2ZJR F;  2IRF G;  4IHW A;  4UUS B;  3EUK L;  1H0M A;  2GIV A;  2NOG A;  5IT3 A;  4NHJ A;  3C7J A;  3MKW B;  1IN6 A;  4MQ9 F;  3KYD B;  2ESH A;  2NYX A;  5F6F A;  4BKX A;  4LLN A;  2Y31 A;  2HTJ A;  4WXH A;  3E6C C;  2EIJ H;  3VYS B;  3FXQ A;  4EQQ A;  4EM2 A;  3CC7 I;  5L3B A;  3AG3 H;  3MZY A;  4EJU A;  3WE3 A;  4KJZ A;  4DIQ A;  2LP0 A;  3VPR A;  5K5Q A;  4M9Z A;  4II2 A;  5LHI A;  1V3F A;  2BY0 A;  1TQI A;  4M3F A;  3FIW A;  2E1M B;  1Y8Q B;  4HV5 A;  1WJB A;  2X4H A;  2D2W A;  4JX6 A;  4B43 A;  5K5O A;  1QPM A;  2DMU A;  2FOK A;  4XRS G;  3CUO A;  2W4S A;  4FT8 A;  2OZU A;  3CME I;  4KIG A;  1WZ2 A;  3K1N A;  3L00 A;  4ZZD A;  1TTY A;  2PMU A;  4AC0 A;  2AXT C;  2STW A;  2EA4 A;  4AYB A;  2CQ7 A;  3PNY A;  1DU6 A;  4RA2 A;  2DYR H;  1IRF A;  1UFM A;  1Z1D A;  3CUQ C;  1ZG3 A;  3Q3S A;  4DJA A;  4YIF A;  4QLC U;  2KMU A;  5EG0 B;  2XF5 A;  4PFP A;  1U5T A;  4A3K J;  4A3D J;  3FF5 A;  5D4R A;  2ZME B;  5CVI A;  5L3F A;  3OYJ A;  2NOJ B;  4ZDL A;  3QU3 A;  5IPA A;  4II3 A;  3CCM I;  2XRL A;  4NQW A;  1T38 A;  5LEJ A;  2PJR A;  2DFH A;  2DMP A;  3GZN B;  3BJO A;  1BIB A;  4CH7 A;  3K4B A;  1FSH A;  4OMZ A;  3O2P E;  1LB2 A;  2DTZ A;  2W84 A;  2EB7 A;  1IGN A;  2IA1 A;  2BVM A;  3R61 A;  2FSW A;  3TP0 A;  2LY2 A;  2COB A;  1JUS A;  1W7P B;  1XDU A;  1X1C A;  2IA0 A;  3M07 A;  1PUF A;  4Y17 A;  4BE0 A;  1Z7L A;  3AFH A;  2B0L A;  5E8I A;  4A3C J;  4MGR A;  3CMY A;  1LDD A;  2QWW A;  4HDU A;  4ITV A;  3DEW A;  1EA3 A;  3RQ4 A;  5HDN A;  4A3G J;  1CQT A;  2KDO A;  3FIS A;  3QPH A;  4XLA A;  2LDU A;  2HDW A;  1MSF C;  3GW2 A;  3WE2 A;  1T56 A;  3GYH X;  4BQN A;  1VQ5 I;  1GLN A;  3PQJ A;  3MMY B;  2DK5 A;  5FD6 A;  1R1T A;  4OIN F;  2XF7 A;  5D5U B;  5D6E A;  2HZD A;  2J5O A;  2K85 A;  4KUM A;  3FK6 A;  3FWE A;  5GTI C;  2AQF A;  3BC8 A;  4A12 A;  3V8L A;  2IPQ X;  4RLQ A;  3GTQ J;  2A05 A;  3PUF A;  5B5E C;  4XID A;  5FLX K;  2MAB A;  1TT5 B;  4IRI A;  3CP2 A;  2BYV E;  3T0Y A;  1Z6R A;  3I4N J;  2ECB A;  1JTY A;  3OSG A;  4C2U A;  5E17 F;  3I71 A;  1Z21 A;  1B9N A;  1OR7 A;  2RNJ A;  5LRR A;  3WGI A;  1YJN I;  3L1P A;  3OYF A;  4Y52 J;  3BPV A;  2F5V A;  3E6M A;  1H9T A;  1E17 A;  3WU0 A;  5E18 F;  1H8A C;  4HX7 A;  2M4K A;  5B1B H;  2Z33 A;  5HLI A;  5D5X B;  1N77 A;  2DU9 A;  1F4K A;  2PFB A;  2IGK A;  1XGO A;  2E19 A;  2JK3 A;  4GFB A;  3OL4 A;  1D5V A;  4Y15 A;  2VPL A;  3KP2 A;  3IH4 A;  4ZYA A;  1P9Q C;  1QQI A;  4BL0 B;  1D0Z A;  4FX0 A;  3H9G A;  4CHU A;  3B6C A;  1TNS A;  5EYR A;  3F23 A;  3T8T A;  3PO2 J;  2DK8 A;  1ZKG A;  1E3P A;  2VKE A;  1SFE A;  3GWZ A;  3I64 A;  3ZCO A;  2ZXW H;  4IHY A;  4HG2 A;  4EM0 B;  2EFW A;  2WB1 A;  4J00 A;  1QHG A;  5ICF A;  5TGT A;  1FPQ A;  4DW6 A;  3NAR A;  4P96 A;  4I09 A;  6PAX A;  3H0G J;  1MNE A;  3CDL A;  2DDB A;  3ULQ B;  4BY7 J;  3K69 A;  2FML A;  3AL0 C;  1LFB A;  1K61 A;  3W2A A;  4ENJ A;  2ME0 A;  4IHV A;  3B02 A;  1BBY A;  1OYI A;  4H4K C;  4GGG A;  3OOU A;  1QZZ A;  3LSR A;  3HJE A;  3MWM A;  3KP5 A;  2EIL H;  3LSH A;  1KA8 A;  3LNQ A;  3C2H A;  3OYK A;  1O3R A;  3J7A Y;  1R4N B;  3MN2 A;  3H0D A;  3RKQ A;  3GFM A;  3DFG A;  2DAO A;  5IOY A;  5ILU A;  1D3Y A;  1O7F A;  3F6O A;  4IQJ A;  1R36 A;  4KYW A;  3CUQ B;  1O4X A;  2L01 A;  4Y13 A;  2IS6 A;  3KLN A;  5E1W A;  3VSL A;  4PJJ A;  4IRH A;  5IOZ A;  1VTN C;  5EZH A;  2RQQ A;  4DZJ A;  1F43 A;  3SXY A;  1UHS A;  2ISY A;  1MBF A;  2QSG X;  5DTD A;  2VN2 A;  1R6R A;  3G4S I;  3GTK J;  2HQN A;  4PK4 A;  4I0B A;  3C1D A;  5CVJ A;  2HDC A;  1LVK A;  3ZPL A;  4G6D A;  2PEX A;  4UV9 A;  4O5V A;  3JRC A;  2V9V A;  3JAM K;  3K1P A;  1TL8 A;  3ERM A;  3TO9 A;  2JUC A;  1YJW I;  2H8W A;  4FHT A;  2L4A A;  4G6T B;  2G7U A;  2NNY A;  1D1B A;  4IHS A;  3JRI A;  3DPT A;  2QSH X;  2H27 A;  3W6V A;  2ADU A;  2F4I A;  1MBG A;  5DCM A;  2O5R A;  3OS2 A;  3F8M A;  2V1U A;  2GBY A;  4HEA 2;  2XKP A;  4PZJ A;  3RKY A;  1YW8 A;  2JVG A;  4E7J A;  2MLG A;  1ETW A;  3BZC A;  1Y0N A;  1DP3 A;  2VIX A;  4EJT A;  1FLI A;  3MEX A;  1E3H A;  3KFW X;  1YIJ I;  2DTR A;  5E8G A;  1SD5 A;  3W2V A;  3A01 A;  1G3W A;  3I3L A;  3BTI A;  2DMN A;  2E35 A;  2WB1 N;  2PJP A;  2EJR A;  2Q2E A;  1Q1H A;  5B1A H;  4OWR B;  1AKH A;  2Y30 A;  5H6R A;  4I2O A;  2NS7 A;  1P2F A;  2CJJ A;  2RNG A;  4XSZ F;  3ZN1 A;  2EZI A;  3S3O A;  4JBA A;  4PJL A;  2VLA A;  3G1O A;  2R7O A;  3P9K A;  4E7L A;  2MC3 A;  3JRB A;  2QA4 I;  5K7Z A;  4A3B J;  3I56 I;  4XIC A;  2JA8 J;  4BQO A;  4ZZL A;  2R92 J;  4YFK F;  2KL4 A;  1WKM A;  2P7V B;  3I9V 2;  2IS4 A;  3QP5 A;  1XG1 A;  3H3Z A;  3BQY A;  1ZRE A;  2V9K A;  1MBK A;  3JCU C;  2PG4 A;  3BJ6 A;  5GPA A;  2DOA A;  1PVE A;  5BQT A;  2EQR A;  1UMQ A;  2M5W A;  1PP8 F;  1TWG J;  3E5U A;  1K83 J;  5EEG A;  5FKN A;  3FHZ A;  4S05 A;  1SAN A;  1D1C A;  4HOB A;  1IF1 A;  3O3K A;  5DM7 F;  3HRT A;  3WTZ A;  3Q5F A;  3BG7 A;  1WH7 A;  4M3D A;  1K7A A;  4DYC A;  2KJB A;  3OR1 C;  4L9N A;  3MKZ A;  1K78 A;  2DJN A;  2EV0 A;  2O03 A;  3LSJ A;  2OCE A;  5HVQ C;  1V54 H;  4OAZ A;  1NK3 P;  3RIR A;  2GM4 A;  3E5Q A;  1MIJ A;  5A2Q Z;  1B4A A;  1OYY A;  4XLE A;  1V4R A;  5TJJ A;  2XAJ A;  2PMH A;  5J4Y A;  2MH2 A;  1W0T A;  2LY1 A;  1ZQ3 P;  3IH3 A;  1Z3X A;  2R7W A;  1QA6 A;  1FEX A;  2DMQ A;  4IHX A;  2K9Q A;  4U7D A;  2M9H A;  3S14 J;  4OIQ F;  1MMN A;  3JSO A;  3AL0 B;  4AUX A;  4HLY A;  3W6J B;  5F1R A;  2X0L A;  2VBZ A;  4ENM A;  5HS7 A;  3LQQ A;  5E1Z B;  2MFZ A;  2CUE A;  4IOA F;  3IHU A;  4B44 A;  4A6D A;  3S32 A;  1EKE A;  4X0G A;  4A3L J;  5LLQ A;  2NVT J;  4DNC A;  4ETS A;  1OCP A;  3EUH C;  2PI0 A;  3BPX A;  3DWL E;  3WGH A;  1SD6 A;  2DBB A;  2YPR A;  1DP7 P;  3LL7 A;  1HKQ A;  2HNH A;  5DV5 A;  5GAD J;  4DOZ A;  2NVQ J;  1QHH D;  2ZSH B;  2IA2 A;  3ZP5 A;  2QCO A;  4UVC A;  5F0F A;  4N9I A;  2BV6 A;  5D8L B;  4HF2 A;  1VFC A;  3TKY A;  2DFE A;  4E70 A;  1UJ8 A;  1YI2 I;  5GPC A;  3BR1 A;  4UUT A;  2FQ3 A;  3F6V A;  1YOV B;  3EPZ A;  4RS8 A;  3DLA A;  2ISZ A;  1MMS A;  1ZR4 A;  4O6J A;  3TO7 A;  2OQR A;  3C18 A;  3BR0 A;  1OCT C;  3HEF A;  4HPQ A;  2IAI A;  5HLH A;  4BNC A;  2VXD A;  4Z6Y A;  2YUS A;  1TLH B;  2OJE D;  1YJ9 I;  3DF8 A;  5B66 C;  5E3O A;  1XD7 A;  3QYB A;  4J19 A;  3FXJ A;  2L9S A;  1DGR M;  3K6G A;  4Z2Y A;  5F64 A;  1O7L A;  3IP4 B;  1IN7 A;  4PGG A;  4Q48 A;  4G8X A;  3DBH B;  5FB2 A;  4A3I J;  5IY5 H;  1MH4 A;  3GVA A;  5H6Q A;  2UZK A;  4BY1 J;  4RGU A;  2LY9 A;  4M3G A;  5HS9 A;  1OCR H;  1ZAR A;  3BP8 A;  1HW5 A;  4IOC F;  3T1B A;  5J1R A;  2OCC H;  2X9D A;  3WTS C;  3OY9 A;  2F4M B;  3JTH A;  1USS A;  4M9S A;  4M71 A;  1FBQ A;  3X2Q H;  2B9S A;  3W6K B;  1VQM I;  4UB8 C;  2DOF A;  5GAH J;  1FYK A;  1CGP A;  4L0Z B;  2YSR A;  1M1E B;  2DLL A;  1TC3 C;  2HGC A;  5JVT A;  3IKV A;  1QO0 D;  3H35 A;  5EDN A;  4J01 A;  3HOZ J;  3KZY A;  1RRJ A;  3VSK A;  3OIQ A;  3CJR B;  2HKX A;  4OIR F;  4XLN F;  2P8T A;  3LSM A;  3ISP A;  2Z5U A;  2EFN A;  3ZQ7 A;  2W00 A;  1G4D A;  2JWT A;  4IF4 A;  3HTS B;  3HBL A;  1KU2 A;  3BCB A;  2FE3 A;  3ZMZ A;  1X1D A;  1X3W B;  4EMS A;  2O0Y A;  2F2E A;  4XMY A;  3PNV A;  4YEL A;  1G3Y A;  1J75 A;  4DYQ A;  2FUG 2;  4RAG A;  4OAY A;  2VT2 A;  1I50 J;  2KHM A;  2KIU A;  4AM3 A;  3TDZ C;  4AU7 A;  1WCM J;  5J47 A;  3FXL A;  3I54 A;  4Q4Z F;  1OCZ H;  3HIF A;  1ZLK A;  2WAQ A;  4MFD A;  1JJ8 C;  3GEZ A;  3DU5 A;  3ECH A;  1ETO A;  1FOX A;  3ZMV A;  1C0W A;  2XGD A;  1OFC X;  3I59 A;  4KT5 C;  1L0O C;  1U8B A;  1JT6 A;  3BTL A;  1EF4 A;  3OYM A;  3BR3 A;  2MGQ A;  2HOA A;  4ESB A;  3DPL C;  4CCN A;  3BTJ A;  4BHC A;  5HOO A;  3WHB A;  3GTP J;  2VT3 A;  3L2C A;  3CQZ J;  4MNU A;  2O7O A;  3UKG A;  1FJL A;  2NS8 A;  3GME A;  2HVS A;  2VQH A;  1Y8R B;  4EJO A;  2BOL A;  2E36 A;  3KIO A;  5IP7 J;  2R3S A;  3UR3 C;  2VJJ A;  4GDF A;  1BW5 A;  1RES A;  1W7P A;  4CZZ A;  4L5E A;  5F08 A;  2ZXH A;  4FE4 A;  2YU3 A;  3H92 A;  3QPS A;  4XLH A;  4OIP F;  2JT1 A;  2MLK A;  1X4O A;  1Z0X A;  4LG0 B;  4ASN A;  2RC4 A;  3PSI A;  1YS7 A;  2E1M C;  4CCM A;  1ZRC A;  2E2I J;  2OTJ I;  2ZBK A;  2L02 A;  1MMG A;  2L5Q A;  3K10 A;  1R23 A;  3N97 A;  3BG9 A;  4YFX F;  3RZD J;  3TL4 X;  2Y9Z A;  4QPQ A;  2KQR A;  2BXY A;  1ZGA A;  5DUI A;  3K70 C;  1ON2 A;  1Z7U A;  2M1B A;  3HDD A;  3CCS I;  3C3W A;  1SVM A;  3BJA A;  3CC4 I;  2GWR A;  1YG2 A;  5EEH A;  1LDK B;  4ZYD A;  3K9T A;  1WGX A;  1WJC A;  3R60 A;  5GAG J;  2X1C A;  5HNH A;  2ME6 A;  4HDV A;  2ZJ2 A;  4PSX A;  2M2E A;  2Y48 A;  2ID3 A;  3IWF A;  2HQA A;  3OYH A;  1XC5 A;  2F5C A;  3SQN A;  4JX5 A;  4F93 B;  3RKX A;  4M73 A;  4B3X A;  1WPK A;  3GX4 X;  3C2B A;  2KRH A;  2MC4 A;  2X85 A;  2Y69 H;  3TOA A;  2E2J J;  4D5F A;  3QRF F;  3OWT A;  2HI3 A;  1JXS A;  1IZ1 A;  2LLK A;  3L2Q A;  3TBI A;  5LGT A;  2OUM A;  2V1N A;  1G6N A;  4I6Z A;  2MG4 A;  1K6Y A;  1MBJ A;  2DJI A;  3H36 A;  4A5N A;  1A31 A;  3DU6 A;  1U2W A;  3FM5 A;  4M6V A;  2LBF B;  1IV6 A;  4WCG A;  1JGG A;  1IG7 A;  2JSP A;  1XMA A;  5CLS A;  2DFF A;  2UV1 A;  3TO6 A;  2FNA A;  3ZRG A;  3PNT A;  2IGO A;  2CFX A;  3JRA A;  2EFQ A;  4A0X A;  1RNL A;  2JMW A;  4ENK A;  1AWC A;  1QZY A;  3O6B B;  1A35 A;  1T08 B;  2CRG A;  1DGW Y;  5AON A;  4R1H A;  1E2X A;  2X6Y A;  2RRE A;  3DV8 A;  2K9N A;  2ELJ A;  2UWM A;  4PJ0 C;  5FKO A;  3RQI A;  3OYN A;  3OYA A;  1BC7 C;  1U9N A;  1V5G A;  1K4S A;  2QEN A;  4U87 A;  3WTX C;  2G9W A;  4L18 B;  2M7A A;  1OPC A;  5FRM A;  4DGW B;  5F0C A;  4PCQ A;  5E3L A;  1I6X A;  1OQY A;  3S16 J;  1PJR A;  1D8K A;  5JR3 A;  2BVL A;  1ZRD A;  1JT0 A;  2WV0 A;  4BXU A;  3FM3 A;  3DEE A;  4L5J A;  2WBM A;  2IGM A;  4GO1 A;  1Y1W J;  3FMQ A;  2OV7 A;  2CW0 F;  1W1W E;  2MA3 A;  4A3F J;  4DZP A;  4XN3 A;  2W82 A;  4E4H A;  4YEJ A;  3T8R A;  1WI3 A;  2XPW A;  5LHH A;  3GLL A;  3ML6 A;  5E3N A;  2RQP A;  2CFO A;  5FJ8 J;  4C3H J;  3CP8 A;  1GUU A;  5H20 A;  1MJB A;  5LGN A;  1NHA A;  1IDY A;  3K4K A;  3CUQ A;  2CV1 A;  1G8X A;  4CA0 A;  2VJ4 A;  4LK0 F;  2OC6 A;  3D5S C;  1XMK A;  4LD5 A;  4D9J A;  3DKW A;  3A2K A;  2CSO A;  2DMT A;  3M8J A;  3WU1 B;  2VKH A;  1LFU P;  1HBX G;  3S1M J;  4G9Y A;  2MH9 A;  5DM6 F;  2C6Y A;  2WAE A;  2DA3 A;  3ZQQ A;  1GT0 C;  3MVP A;  1LPQ A;  3WOD F;  4RLF A;  4M74 A;  3FKJ A;  2HOE A;  1FIP A;  2VBW A;  2LKP A;  2DA7 A;  2V1X A;  2D1H A;  3FX3 A;  3OYB A;  3J80 K;  5J40 A;  1BOA A;  2JUG A;  1MH3 A;  2KP6 A;  3HRS A;  3BQZ A;  3M9A A;  2HQR A;  3JRF A;  3ASN H;  4LLG F;  5AIP A;  2DOD A;  4H0E A;  2O61 A;  1UG2 A;  5KHD A;  4G7H F;  2E60 A;  3K4L A;  1HC8 A;  3J81 K;  2A5Y B;  4XON A;  2QEX I;  4M72 A;  3KP4 A;  3S1R J;  3DXJ F;  2FF4 A;  4CCK A;  1VQ6 I;  3F21 A;  5DS9 A;  1HST A;  2OA4 A;  4BDY A;  5BOX A;  2XRO A;  3FXU A;  1U9O A;  2QKL B;  3CO6 C;  5LD2 C;  4PJN A;  2GXG A;  2LC2 A;  3LSK A;  3HG9 A;  3KEY A;  3MKL A;  5HLT A;  1BW6 A;  1IAW A;  3BZ6 A;  3HUG B;  4RB1 A;  2CWE A;  2O8X A;  1EH7 A;  1YW7 A;  4C30 A;  1JI8 A;  3WHC A;  1U3E M;  2M8E A;  1APL C;  4LOC A;  2QQ9 A;  2VC1 A;  3LOC A;  3VYU B;  4U0W A;  2QQA A;  1YQA A;  2JTV A;  1A04 A;  2X6W A;  4AVZ A;  2F5E A;  2L7K A;  4NNJ A;  2L7M P;  2RVC A;  3G73 A;  3HSE A;  1Y6I A;  4NB5 A;  1QPI A;  4XLF A;  4A6E A;  3CCU I;  2K9M A;  1RUN A;  3HM5 A;  3U9G A;  4KIB A;  1F9N A;  3IKT A;  5FLX Z;  1BC8 C;  2CV0 A;  1ZR2 A;  2WTE A;  2DYS H;  5IYC J;  3FXO A;  2Z2S B;  2RDP A;  5CJ9 A;  2PQ8 A;  2KFD A;  4NBQ A;  5FRO A;  4MTD A;  2Y9Y A;  3ZQF A;  2DO7 A;  2X51 A;  5F27 A;  3Q9V A;  4ZDP A;  2QGU A;  4A3M J;  4WXC A;  3H5N A;  4ON0 A;  1PYV A;  1U6G A;  3D0S A;  3GTJ J;  2EFP A;  2GA1 A;  3BG3 A;  4UXN A;  4BU2 A;  4B4C A;  4C9Y A;  2ZFU A;  2BY2 A;  4HNT A;  3CLO A;  4GCV A;  1YIO A;  5J3L A;  2VOP A;  2ZSI B;  2V4J C;  2K4J A;  2LH9 A;  3SYT A;  4MEX F;  1S8N A;  2CH0 A;  3KLO A;  3A03 A;  2H1L A;  3R4K A;  4CYD A;  5LBQ A;  1DU0 A;  3SHF A;  3WG9 A;  3MQ0 A;  4F52 A;  1ETQ A;  2BEO A;  4AYB N;  1WJF A;  3E7L A;  1VQK I;  4BH9 A;  1BI0 A;  1OMI A;  3HGG A;  4RGS A;  3TGN A;  4HRI A;  1IXC A;  4QTR A;  3RPU A;  2W24 A;  4ZTJ A;  3N4M A;  2DQL A;  1P7I A;  2XPV A;  4D7N A;  1Z77 A;  2HOT A;  3E0J B;  2R7R A;  5JLX A;  3RJP A;  1FP2 A;  4IEJ A;  4M9X A;  3A0H C;  3OSF A;  1E3O C;  1X1P A;  3HOW J;  1VQL I;  3KP3 A;  1HW1 A;  1ZGJ A;  2DT6 A;  2QF7 A;  2LTP A;  4QIW N;  3EYI A;  3FBN B;  4MFE A;  2VON A;  1TT0 A;  2XGC A;  1QBJ A;  1N75 A;  1XGM A;  3PIP F;  4KIS A;  4PDK A;  3J7Y J;  5D4S A;  3HRU A;  3F8C A;  5KCM A;  3S2H J;  1KON A;  4WF2 A;  1MND A;  3OYL A;  5IT9 K;  2VBX A;  3VB2 A;  4NDL A;  2L9V A;  3OOP A;  4BDZ A;  3CF5 F;  2KPM A;  1SEU A;  4ZH4 F;  3M1C A;  2Z9O A;  1OLT A;  1OYW A;  5C3E J;  1DQU A;  1TZL A;  2XPU A;  3ZMU A;  4GYG A;  4XQF A;  3EDP A;  1AHD P;  3FK7 A;  1XCV A;  3HOX J;  2R7V A;  4I98 B;  1OKR A;  3OYD A;  3JAM Z;  4HLX A;  3QPL A;  3H1C A;  3U1D A;  3RKW A;  5BMZ A;  4RBO A;  1KQ8 A;  5FKK A;  4W97 A;  2KZG A;  4C3I J;  2R7T A;  2ZJP F;  2QM3 A;  1R00 A;  2FMY A;  4AIJ A;  1DPU A;  4A0Z A;  3QPT A;  2NVU B;  2ZNZ A;  2EH3 A;  3WGG A;  2QQ8 A;  4U7B A;  3G6E I;  9ANT A;  4JYK A;  2LD5 A;  3R0J A;  4CXF A;  2VOO A;  4G7O F;  3BG6 A;  2NVY J;  3DLL F;  4XOP A;  1B9M A;  4A69 C;  4D0P A;  4R79 A;  2XSJ C;  2GOM A;  2LFB A;  1E0E A;  4P55 A;  2GQQ A;  4DYR A;  3P9I A;  4PUS A;  2GXB A;  4UVB A;  3SDG A;  4ABZ A;  5K5R A;  3F8F A;  2G7H A;  3AAF A;  2JSC A;  2PMZ A;  3GUD A;  1GVD A;  1H89 C;  1I3A A;  2E7W A;  2E71 A;  2QYO A;  1WHU A;  2I8D A;  3V7C A;  2JRT A;  2CQX A;  3ZQH A;  2XSD C;  4FTH A;  1IDZ A;  2Y0M A;  3QU6 A;  3ROU A;  1S6L A;  4HZF A;  1ZGW A;  1WWX A;  1S29 A;  3DTI A;  1TWC J;  2JPC A;  2XUB A;  4P5O A;  2CW7 A;  3F0C A;  4I01 A;  1LEB A;  1ETV A;  2LOO A;  1IRG A;  3L9F A;  3D1N I;  4S0H B;  3WTU C;  1KZH A;  4A93 J;  1ACI A;  3NAU A;  2QZ8 A;  2CYY A;  2Y2Z A;  2A6H F;  5J8F A;  1LE8 B;  2I5U A;  2D1V A;  3FKI J;  4AVP A;  1X1A A;  4MLO A;  1JHH A;  4F3Q A;  2EIK H;  5EEA A;  3JTG A;  1IJW C;  1F36 A;  2EV5 A;  3IAM 2;  3S2D J;  2E2H J;  4XM3 A;  2ECC A;  4RAY A;  5DCF A;  1RR7 A;  2NRA C;  1GV2 A;  2X6O A;  2GOX B;  3I4P A;  2W7N A;  1QGP A;  5K7H A;  2FJ1 A;  3LAJ A;  1MDM A;  1ONV A;  1RC9 A;  1KU7 A;  1NTC A;  2GA2 A;  4OU0 A;  5L3G A;  1JTX A;  5FLM J;  4LG0 A;  4A2U A;  1NH3 A;  1GXP A;  1FBU A;  1T95 A;  1H9G A;  4P9F A;  1FYM A;  3COA C;  1T33 A;  1Y0U A;  1BR2 A;  2DT5 A;  2QVO A;  4AIK A;  2YR2 A;  1ETY A;  4NQW B;  4N9H A;  2PJR B;  3EUH A;  3K1M A;  1S7O A;  4ANJ A;  2JVH A;  2A69 F;  1O3S A;  3CCE I;  4FQG A;  3T5X A;  4DBR A;  5HS8 A;  1W36 C;  3K4C A;  2KLO A;  3RYR A;  4PGH A;  5JVG F;  4LG3 A;  3WTT C;  4QSH A;  1HOM A;  3ABK H;  1XB4 A;  3DCF A;  2HEO A;  2ZXI A;  1GV5 A;  4ESF A;  4U88 A;  4NUB A;  3I58 A;  4KMU X;  1WQ2 A;  2R7X A;  5FO5 A;  4A5M A;  4IJA A;  1H88 C;  3UNG C;  2PMZ N;  3PFI A;  4G6Q A;  4CCJ A;  1YRN A;  5J6X A;  2EPF A;  2ETH A;  4D7M A;  1QU3 A;  4UB6 C;  2TCT A;  3J7Z I;  2IBD A;  3LA3 A;  4HQE A;  4HYE A;  3JRH A;  4M6Y A;  2ICW G;  3QOE A;  3SEZ A;  5KAF C;  5L3C A;  2LK2 A;  2XF6 A;  3B6A A;  3V7S A;  2JA6 J;  2NNN A;  3DP7 A;  1HF0 A;  3V8J A;  4WWC A;  1X3U A;  1QVT A;  3IL2 A;  2JPB A;  2K9L A;  5FFZ A;  4I02 A;  3VEP A;  4EVI A;  4YIR X;  1JHF A;  3J7A O;  3E6D A;  4MO7 A;  4WXD A;  1RI7 A;  3ABT A;  3MFK A;  3S1Q J;  2FD5 A;  4FE7 A;  1FC3 A;  3LQR A;  2QBY B;  3O8H A;  3HOV J;  4EM1 A;  4FX4 A;  1HKS A;  1SFK A;  2NAZ A;  3S2W A;  3WU2 C;  2X1E A;  4IZZ A;  2IS2 A;  3OV8 A;  4XNF A;  3TW6 A;  3W3C A;  1TW2 A;  2LRE A;  3EQL F;  1VQ7 I;  1JKO C;  3OIP A;  5K7F A;  2HWV A;  3LSG A;  2HQ5 A;  1BI3 A;  3CLQ A;  3S8P A;  3MZ8 A;  3FBI B;  1PP7 U;  4PFO A;  1STZ A;  1IV8 A;  5CKT A;  3L2R A;  5EGO B;  4KA4 A;  2M0M A;  5CVU A;  1B72 B;  2HTS A;  3HHG A;  2R5Z A;  4CYC B;  2N8G A;  1D1A A;  1UEL B;  3F8N A;  4D1Q A;  4HAM A;  2Z16 A;  2CW8 A;  3BOQ A;  1FYL A;  3GTO J;  4XRS A;  2XRN A;  4UUS A;  4V2F A;  2XVC A;  2M7B A;  3HL2 A;  2F48 A;  1VQ9 I;  1I6H J;  1TQM A;  1MKM A;  3OR2 C;  4XKC A;  1SC7 A;  1ON1 A;  5BPI A;  4L9J A;  3KP6 A;  3RPU D;  4Y7N J;  2CG4 A;  2WC2 A;  3MKY B;  4E7H A;  4CGZ A;  3ABL H;  2HYG D;  2D45 A;  1ZYR F;  2GIZ A;  1A36 A;  4M3E A;  2P81 A;  1HLV A;  4BHP A;  2LYC A;  1X2M A;  4IQ4 A;  4XKB A;  4JX4 A;  3WTV C;  2VXZ A;  2QKM B;  1AA7 A;  4XLP F;  4LMY A;  2FNP A;  1MSE C;  5ICE A;  2V7F A;  3M8F A;  2L7Z A;  3LWF A;  2W1O A;  5IP9 J;  1NG7 A;  1BN5 A;  3AKZ A;  1QZE A;  5EG0 A;  4HSR A;  2V6E A;  1WH5 A;  4CIC A;  4AWX B;  1TWF J;  5B3S H;  3HUG A;  3I0T A;  2R7F A;  2P6S A;  3QQA A;  5DCM B;  2E1C A;  1IRZ A;  2UXN A;  4KIC A;  2VUM J;  1W4M A;  2ZME A;  2BW3 B;  5LHG A;  3I53 A;  4A3J J;  3GZ6 A;  2ELK A;  1SFX A;  1V55 H;  1R71 A;  3KYC B;  4OMY A;  4KN7 X;  3M1E A;  4IPA A;  1SVL A;  1W5S A;  3FXK A;  5EJC A;  4NC6 A;  4RB0 A;  1S72 I;  1TNT A;  2DOE A;  2EZH A;  2E1O A;  4R8H A;  5E79 C;  2YX4 A;  2O3F A;  1U78 A;  3U1K A;  2EA2 A;  3I5U A;  3VOE A;  2L9R A;  2XAH A;  4EGY A;  2NXN B;  1TWH J;  5DUK A;  5CVR A;  5BPD A;  4DBQ A;  1IXS B;  1Y56 A;  1I39 A;  2EZK A;  1UB9 A;  5GP9 A;  2HFH A;  1TBX A;  1EH8 A;  3RYP A;  3WG7 H;  4E7I A;  4HNU A;  5IYD J;  1O3Q A;  3GO5 A;  2IP2 A;  2CU7 A;  3DTE A;  4RAF A;  3IAS 2;  1YS6 A;  2FU4 A;  3VDX A;  2K7L A;  2R7Q A;  2Q0O A;  3HOS A;  3L7W A;  3BRO A;  3CC2 I;  2PX9 A;  4HNV A;  2HVR A;  3CD6 I;  1J7K A;  1MJA A;  3JW4 A;  2Z3Y A;  3P7N A;  1O3T A;  1UHW A;  2RAE A;  3A0B C;  1Z9C A;  1XSD A;  1YTY A;  1K78 B;  5DYM A;  4I76 A;  4IHT A;  2IT0 A;  1ERD A;  2M0C A;  1ZG1 A;  3PQK A;  3F22 A;  3ZQC A;  3CCV I;  1FWZ A;  4BGD A;  3K2Z A;  2KIF A;  3R0A A;  3ZMD A;  3FXM A;  2AO9 A;  2WAQ N;  2VQL A;  5HDG A;  3JRD A;  1MBE A;  2RN7 A;  3VWB A;  2P5V A;  4LJZ F;  2W48 A;  4MTE A;  2VPR A;  1P4A A;  4LIT A;  1EV7 A;  1LVA A;  1TQP A;  3HB9 A;  4BYY A;  4JQF A;  3FXR A;  5KNL A;  3ZOB A;  5EZG A;  5ED4 A;  2JQ7 A;  1YX3 A;  4EJW A;  4MIM A;  4E7S A;  1OCC H;  1LFP A;  2KJC A;  4CDG A;  1ETK A;  4NC7 A;  2OZ6 A;  1XS9 A;  1WJA A;  4BAY A;  5D5W B;  2ZB9 A;  4WK8 F;  3AG4 H;  2JJ7 A;  1RPW A;  3IH2 A;  3REO A;  2AS5 F;  1O57 A;  2Q1Z B;  3H3U A;  4FCY A;  4Y33 A;  3G1M A;  3AG2 H;  3A02 A;  3W2W A;  5CVV A;  2L0K A;  4AD9 A;  3H5R A;  1QRY A;  3H5A A;  5LGU A;  4BAC A;  3ZQL A;  4UUV A;  1BR4 A;  3KE2 A;  1XN7 A;  1FBS A;  2VOD A;  4UV8 A;  1YX5 A;  1XTA A;  1UAA A;  1OJL A;  5EF6 A;  4C3J J;  3DPU A;  1R5I D;  4LIU A;  4K2E A;  5M3F J;  1K4T A;  5CQE A;  2XAU A;  2DCE A;  1FTT A;  1WJE A;  2WAF A;  2Y75 A;  3HC7 A;  1T0F C;  2ZFW A;  2FEZ A;  4BE1 A;  1I5Z A;  1R7J A;  3D5R C;  5C44 J;  1ZTR A;  1REP C;  3J80 Z;  3HPG A;  1J09 A;  2A68 F;  3ESW B;  1XDS A;  4BJT A;  5BNG A;  3IRQ A;  3CCJ I;  2P5L C;  1WSU A;  2H09 A;  2KT0 A;  1GXQ A;  2ZC2 A;  1ORK A;  4RB3 C;  1JUM A;  1R5H A;  3S1N J;  2XHK A;  3QYF A;  5JHF A;  1KQ0 A;  1JKP C;  4G12 A;  4S04 A;  3M8E A;  2P5K A;  2ZNY A;  3NRV A;  4IVN A;  2CUJ A;  1WRJ A;  4ENN A;  4BBS J;  3SZP A;  2EIM H;  1JJ6 C;  4CO8 A;  3ZQG A;  3E6B A;  5FGM A;  4X1E A;  3OYE A;  2Y0S A;  1YO5 C;  2LKX A;  2JRM A;  3I55 I;  3P5J A;  1WVR A;  2E5N A;  3U2R A;  3PSF A;  2YS9 A;  3GCM A;  3L2W A;  5GAE J;  3F3X A;  3TP3 A;  2A6E F;  1X1B A;  1QNT A;  1V5E A;  2VQG A;  2P7C B;  4LB6 B;  1P4W A;  5D6F A;  2DA1 A;  3QAH A;  1FSE A;  1XCB A;  2DI3 A;  2DT7 B;  4MQV A;  2CV2 A;  1SAU A;  3ASO H;  3FMR A;  1KU3 A;  4XR6 A;  3ECO A;  2CUF A;  1I1G A;  3KEO A;  5JFR A;  2HYJ A;  1D0Y A;  4GYI A;  3IUO A;  4GXO A;  2CQK A;  1A5J A;  2VAS A;  2ZXJ A;  2BY3 A;  4ZTF A;  3DBL B;  5LEK A;  1Q1V A;  3LA7 A;  1S3J A;  2I10 A;  1LE8 A;  4N4O B;  1NK2 P;  3HSR A;  3GZ5 A;  2OD5 A;  2ZKZ A;  4IL6 C;  1T8I A;  1VQ8 I;  2YX7 A;  1UG0 A;  1G3T A;  4U0V A;  3HHH A;  3SZG A;  4UVA A;  1I1S A;  4EAT A;  2VJI A;  3DBR B;  5TRD A;  1IO2 A;  3ZN0 A;  4B3A A;  1GVJ A;  4YFN F;  1X19 A;  4CUG A;  3I59 B;  2WV1 A;  1RKW A;  5FLV A;  1Y1V J;  3TQN A;  4RM2 A;  3KCC A;  4KIF A;  3CJT B;  2HKO A;  2OPT A;  3VYT B;  5FFX A;  1BM9 A;  2XB5 A;  1J59 A;  4RDU A;  4XK4 A;  2HYF A;  3F9K A;  1MGT A;  3GFI A;  5M5X J;  3V7R A;  1Z3Y A;  4EEF G;  4XLC A;  5LFA A;  4HQM A;  4OOI A;  2KRC A;  1P92 A;  1DPR A;  1NG6 A;  5D5V B;  3CCL I;  4UNO A;  1FZP B;  5KK1 A;  4D5C A;  3TED A;  3I4M J;  1WI9 A;  1ITY A;  4CSW A;  2Y0S N;  2H6B A;  1ZG5 A;  3GF2 A;  2WY7 Q;  5JHU A;  2K9S A;  2R7D A;  2HU9 A;  2K40 A;  2A5W A;  2VL8 A;  3K70 D;  1BL0 A;  2EK5 A;  3KEQ A;  4KMF A;  3RCO A;  4W1U A;  1YIT I;  2V26 A;  3JR9 A;  2IVM A;  2K4B A;  2LSO A;  3SFZ A;  1U5T C;  1YLF A;  3AG1 H;  1ZHF A;  3OL3 A;  2EBI A;  1BI1 A;  2XAF A;  1IC8 A;  4IRG A;  1G59 A;  4FET A;  4LGW A;  1PUE E;  4AID A;  2DDA A;  4ZJZ A;  3CJQ B;  2QSF X;  4HV6 A;  3L2V A;  4Y4R A;  5L3D A;  4UY8 I;  4N0B A;  1U8R A;  1VND A;  3DKX A;  3OYI A;  3G71 I;  1YE9 A;  3Q0U A;  2PBI A;  3JSP A;  1W5T A;  4P9U A;  4RAZ A;  3EYY A;  2AQE A;  5IT9 Z;  2K3P A;  2Q8K A;  1SMT A;  3IRR A;  2TDX A;  1VQP I;  1W7P D;  2HR3 A;  2LG4 A;  4NC8 A;  5DD8 A;  4E6K G;  1SVO A;  5ICC A;  1X2N A;  4LIV A;  2KZV A;  5ILS A;  1XMX A;  2K27 A;  5HLG A;  3LA2 A;  1B8I B;  2M30 A;  1MMA A;  4YII A;  5J1U A;  3GBG A;  2CGP A;  1ZLJ A;  3VYR B;  2QBY A;  1R49 A;  2JA5 J;  2BBY A;  5JLW A;  5FKL A;  2R5Y B;  2LF8 A;  1AU7 A;  1FMW A;  2W85 A;  5ERI A;  3P9C A;  1FOY A;  4KN4 X;  5J1Y A;  5D8K B;  2KIQ A;  3RPQ A;  2MD5 A;  3TOB A;  2R93 J;  2FA5 A;  3LAP A;  4BJ5 C;  2R7U A;  1T39 A;  1ODD A;  2DQR A;  3M3Y J;  3F72 A;  4RM3 A;  4Q47 A;  4Q5S F;  4JOM A;  3LST A;  4XN0 A;  5EGO A;  3MD2 A;  1CF7 B;  1B72 A;  2VC0 A;  2W57 A;  4ZYG A;  2O8K A;  2LKS A;  2XC7 A;  4KDP A;  1KU9 A;  5E1X A;  4CYC A;  2CUZ A;  3SFI A;  2P6T A;  1OR7 C;  1DDN A;  3PO3 J;  1FMV A;  2L4M A;  2ZCW A;  3M4O J;  2HOS A;  3HRM A;  2LVS A;  3CMA I;  3BZK A;  5DD4 A;  1T98 A;  2JA2 A;  1X4P A;  2OBP A;  3E3V A;  1SD7 A;  1FT9 A;  3S17 J;  3CDH A;  1UHM A;  4MHG A;  4XBF A;  1XPX A;  3S15 J;  4XOR A;  3FHN A;  1R5G A;  2FRH A;  1HA8 A;  4JP0 A;  1S5L C;  2VBY A;  2HVQ A;  3S3M A;  5IYB J;  4BEH B;  5JI6 A;  4V19 K;  4EV0 A;  1FTZ A;  1T6S A;  4L5I A;  3QOD A;  4FAS D;  3N05 A;  4F91 B;  2R7S A;  3E5X A;  1YW9 A;  3V4G A;  1V5F A;  3K2A A;  2NS0 A;  1BA5 A;  3DKY A;  3K7A J;  4RGX A;  4M3B A;  2EWN A;  5IP6 A;  2VE9 A;  2RGV A;  3CZ6 A;  4C2M J;  1XX5 A;  3RDI A;  2A07 F;  1LEA A;  2F5F A;  2Z1D A;  4KT6 A;  4WX9 A;  2KIS A;  1FOK A;  4L0Y B;  2BGC A;  3HPH A;  5KAI C;  2XGE A;  1IN5 A;  4ZYE A;  3KPH A;  1VQN I;  2ACJ A;  1UZC A;  2DA5 A;  3ERE D;  3SDB A;  2H1K A;  1J9I A;  1IN4 A;  3LSP A;  1IUF A;  2IEK A;  2BW3 A;  2YU9 J;  2V1D A;  3NEU A;  5K1Y A;  4XKW A;  4RB2 C;  4HBL A;  5F04 A;  1XSX A;  3CCY A;  3H9Q A;  2KKO A;  3E97 A;  1X58 A;  1TWA J;  2MSY A;  4B48 A;  1FOW A;  3QP6 A;  2XAS A;  2FXA A;  2IJL A;  2BHZ A;  5HOD A;  2K02 A;  1A6I A;  1U5T B;  4L9V A;  2V6C A;  3OS0 A;  2X6X A;  3M7G A;  2EIN H;  2ESN A;  1FX7 A;  2RKH A;  1Z6T A;  3BY6 A;  2XAQ A;  3ONQ A;  3RTR A;  3S3N A;  2XB0 X;  1MZB A;  2KDZ A;  2KRF A;  3GFL A;  3HOY J;  4IXA A;  3BR2 A;  4P1W A;  3BT9 A;  1SFO J;  1PDN C;  4XRF A;  1GDT A;  1KYZ A;  4HST A;  3CMM A;  3GTL J;  5BS6 A;  2ID6 A;  3KYL A;  1HSJ A;  2E7X A;  3DTK A;  3Q0V A;  2E1N A;  4CZC A;  1RKT A;  1D5Y A;  4HX4 A;  5J4V A;  4CCL A;  4I7H A;  1PUF B;  1N78 A;  2L2O A;  2GXA A;  3KZZ A;  3JRE A;  1OIS A;  1WFX A;  1LDJ A;  2HZT A;  4B09 A;  2L54 A;  1SMY F;  3BR6 A;  1BI2 A;  3CCR I;  1Z05 A;  2VKD A;  4BQQ A;  3LFK A;  1RZ4 A;  2H6C A;  2E5Z A;  3VFZ A;  4XOT A;  1OCO H;  2L9N A;  1VQ4 I;  1J2X A;  3CDI A;  2H8R A;  2FX0 A;  3QYE A;  2E34 A;  2LF7 A;  4I99 C;  2XGX A;  3HZJ A;  4UHT A;  5DDG A;  1XSV A;  2BE5 F;  4G7Z F;  1HDD C;  4RGR A;  3H9J A;  4JK1 X;  3VOD A;  2LBF A;  4BQA A;  2J5P A;  3BR5 A;  4F7Z A;  1QVU A;  3O8G A;  3MAJ A;  2P0W A;  2A6T A;  2K5C A;  4HX8 A;  1XGN A;  3HKZ A;  2CS3 A;  3FZV A;  3IC7 A;  4PJM A;  1LQ1 A;  1JUP A;  2CO5 A;  2F4O B;  2FOW A;  3V42 A;  3CTA A;  4FIS A;  2WA0 A;  3ZQI A;  1Z91 A;  5A2Q K;  3Q0W A;  5CPR B;  4I0A A;  1S9H A;  1HXD A;  1YFH A;  3B73 A;  1ZRF A;  4M6X A;  3H3V K;  3FMS A;  1HDP A;  3KP7 A;  2HPM A;  3G3Z A;  3PIO F;  1L3L A;  5H2F C;  1P7J A;  1IRX A;  4B1R A;  2M45 A;  4KFC A;  3QOP A;  1KQ9 A;  1WJ5 A;  3F8B A;  1R58 A;  2OAZ A;  3GXO A;  2BZT A;  2FBK A;  1D0X A;  4ZYH A;  1DUX C;  1S7E A;  1EH6 A;  1Z67 A;  3OYG A;  2DPU A;  2GLO A;  3L09 A;  3SEQ A;  3IWZ A;  2O6G E;  1ZAO A;  3EET A;  4KIT B;  4MEY F;  2TRT A;  2IS1 A;  3ELK A;  4XL9 A;  1A6Q A;  2R0Q C;  5C4X J;  3KZI C;  2BY1 A;  5F1J A;  2VB6 A;  3K4J A;  3RSN A;  5J8C A;  1WJD A;  5C4J J;  2DW4 A;  3OS1 A;  5HDK A;  1FIA A;  4PSW A;  2DA2 A;  3HSF A;  2DPD A;  2XIG A;  1FNN A;  1JKR C;  3K0L A;  2CQQ A;  5GTH C;  2UUZ A;  5ICG A;  4L9T A;  5CYV A;  1I27 A;  4LFU A;  2XAG A;  2MW8 A;  3HYI A;  3PFY A;  4QWQ A;  4A0Y A;  5ILV A;  4HF1 A;  1FY7 A;  2ELH A;  3WTW C;  2X1D A;  1ETX A;  2VJ5 A;  1BOB A;  4LB5 A;  3LSI A;  1IXR C;  1B59 A;  3CCQ I;  1I3Q J;  1ZH5 A;  1K79 A;  2GZW A;  5KVR A;  1MJ9 A;  1ULY A;  2IW5 A;  2K3F A;  5FRN A;  4BBR J;  1MNM C;  2QUF A;  1VZ0 A;  3SZT A;  3MCZ A;  3HKZ N;  2ZO4 A;  1VQO I;  5CQG A;  2AXL A;  2DA4 A;  5FD5 A;  1JGS A;  2WAD A;  4OIO F;  2X48 A;  2A3S A;  2M34 A;  4BHB A;  4BUP A;  4U0Y A;  3JRG A;  2CQN A;  1R22 A;  3GTG J;  1D8J A;  5E3M A;  1T2K A;  1IW7 F;  1MD0 A;  1UCR A;  5FKM A;  1BR1 A;  2DN0 A;  4XRM A;  3NWS A;  3MZH A;  2GAU A;  4F55 A;  4A3E J;  4IO9 F;  2W25 A;  3ZXS A;  3D5L A;  4ESJ A;  3A4C A;  1ZK8 A;  4YG2 F;  3NWT A;  3OIO A;  3HOU J;  1MW7 A;  1P4X A;  4KNY A;  3CF2 A;  3E1S A;  4C2T A;  3DQV C;  2EFO A;  2MD0 A;  4E7K A;  1LNW A;  2OF7 A;  1B6A A;  1VI0 A;  3A01 B;  1K6O A;  4BXF A;  3RZO J;  2Q2E B;  1BIA A;  2P4W A;  1AKH B;  1IUY A;  1TP4 A;  2HXO A;  2G0E A;  4Y3O A;  5F0H A;  2JZY A;  1YHQ I;  2HDD A;  4HF0 A;  3BDD A;  5M5W J;  2JN6 A;  2XDV A;  3PM1 A;  3ZMT A;  1R4M B;  2M4G A;  1J5Y A;  2M8G X;  2QQB A;  1RUO A;  1BJA A; 
#chains in the Genus database with same CATH homology
 1VQP I;  3G4S I;  3CCV I;  1FOW A;  5JVG F;  2ZJQ F;  4IOA F;  1FOX A;  3CCU I;  1YJW I;  2H8W A;  2ZJR F;  2ZJP F;  1FOY A;  1YJN I;  1Y39 A;  1VQ8 I;  5GAD J;  3G6E I;  2JQ7 A;  3J7Z I;  2E36 A;  1YIJ I;  1YI2 I;  3DLL F;  3CC7 I;  2E35 A;  3CCQ I;  1MMS A;  2OTJ I;  3CJT B;  3CCR I;  2K3F A;  1YJ9 I;  3CMA I;  2QA4 I;  3I56 I;  1VQ4 I;  1VQO I;  5DM6 F;  3CME I;  2E34 A;  3CCS I;  3CC4 I;  1S72 I;  4V19 K;  3CCL I;  4IOC F;  5GAG J;  1VQK I;  3CCJ I;  2NXN B;  1ACI A;  1VQM I;  5GAH J;  5DM7 F;  1VQ7 I;  3CCM I;  4IO9 F;  3CF5 F;  1HC8 A;  2QEX I;  1VQL I;  1YIT I;  1VQ6 I;  2FOW A;  3PIP F;  3J7Y J;  3CC2 I;  3I55 I;  4UY8 I;  3CD6 I;  3PIO F;  1YHQ I;  1VQN I;  5GAE J;  3G71 I;  1QA6 A;  2OTL I;  1VQ9 I;  1VQ5 I;  3CCE I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...