1VQ8I

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq8I00
1FOXA 1VQ6I 4IO9F 2H8WA 1VQNI 3CCSI 3G6EI 1VQLI 2JQ7A 3CCUI 2ZJPF 1YJNI 2NXNB 3CCQI 4IOCF 5GAEJ 1VQ4I 2QA4I 1FOYA 3I55I 2E34A 2QEXI 2ZJRF 5DM7F 1VQ9I 5GAGJ 5JVGF 3CCVI 3CCMI 2OTJI 1S72I 3CCJI 5DM6F 1VQPI 1YI2I 1VQ8I 1VQ5I 4IOAF 1YJ9I 3CC7I 2ZJQF 1VQKI 2E36A 2OTLI 3CC2I 1HC8A 3G71I 3CF5F 4UY8I 3CC4I 3CJTB 1MMSA 3CD6I 5GADJ 3CMAI 3PIPF 3J7ZI 3DLLF 1YITI 1VQ7I 2K3FA 3CMEI 1YHQI 4V19K 1YIJI 2E35A 5GAHJ 3J7YJ 3I56I 1FOWA 2FOWA 1VQOI 3CCRI 1VQMI 3G4SI 1Y39A 1QA6A 3CCEI 1YJWI 3CCLI 1ACIA 3PIOF
chains in the Genus database with same CATH superfamily
2WWYA 1SD5A 4IHXA 1KA8A 3OL3A 1GVJA 2W48A 3JRDA 1X2NA 3HBLA 4MLOA 4CXFA 1VQ4I 1YLFA 1EF4A 2XAFA 2VL8A 1LFUP 5JLXA 3ZMVA 5L3GA 1BI3A 1ORKA 3CJTB 3M8EA 1FP1D 2R7ZJ 3SEQA 4I2OA 1OCCH 3QP5A 3M1CA 4BEHA 2OCEA 3K69A 2ZXJA 4CH7A 1OCOH 4I01A 2DA5A 3B02A 1D0YA 3AG4H 1D8JA 1DP3A 2V1NA 3LSHA 4C2UA 2BYVE 1HOMA 3DTKA 2KIUA 5DV5A 3OYNA 1D3YA 2V79A 1DPRA 1MKMA 1WFXA 1NG6A 5FB2A 2DT5A 4FETA 3H9GA 5CVUA 1QZZA 2HQRA 3CJQB 4HF1A 2OQGA 4C3HJ 3GZ6A 4J19A 1D0ZA 1EA3A 1YIOA 3FIWA 2DN0A 3ML6A 4L9TA 4PGHA 1Y1WJ 4ESJA 4I6ZA 4E7KA 4BHCA 1R9TJ 3LWFA 4N0BA 1BR4A 2MSYA 2NXNB 1LEAA 3JSOA 1JUPA 3ZQFA 2UZKA 1BI2A 4ZTJA 1GT0C 1DUXC 2F2EA 5JI6A 1ETOA 4OINF 2IBDA 3F72A 1N25A 4HX7A 2A6TA 5IP9J 3ERMA 3NARA 1HW2A 1K78B 4UV8A 1MMAA 3HOWJ 4XL9A 4KT6A 4DW6A 5A2QZ 1A5JA 1HW5A 1IJWC 2CQXA 3ELKA 2A5WA 4XRFA 1IXSB 3HHGA 5IYBJ 2YS9A 1U0JA 1U2WA 3L2UA 4HBLA 3KLNA 1Q1VA 3HXLA 3OYLA 1JT6A 3T5XA 2KMUA 3ERED 1SMTA 4DNCA 1MMDA 1RNLA 5CYVA 3RIRA 2E19A 4NBQA 2HTJA 2W25A 4A3JJ 4I99C 1P4AA 1A36A 3HEFA 2R7TA 4B1RA 5KVRA 4HV5A 4U88A 2ZMEB 1K4TA 3ZQCA 4DGWB 3GTPJ 2MH2A 3J7AY 2X4HA 3KP5A 2VQHA 1SFUA 3GF2A 2STWA 3CCQI 2HKOA 1B72B 1P6RA 1JGGA 1FSHA 4AU7A 1X3WB 3GW2A 2AQFA 1V4RA 1XGNA 2QZ8A 1BC8C 2PMHA 2CJJA 3S16J 4XN0A 2VOPA 2IA0A 2GWRA 4XNFA 4V19K 2V9KA 2O8KA 2ISYA 4U87A 4IRGA 3I5UA 1AA7A 3CUQC 3P7NA 5EEGA 4XONA 3ZR8X 4R1HA 2VJ4A 4BH9A 4BQQA 4ENKA 4MEXF 4G7OF 1WJCA 4M3BA 1U5TC 3I4PA 2CS3A 3DKXA 4M74A 3PFYA 1R36A 5HNFA 3K4LA 1Z67A 1TLHB 1JKPC 3JRGA 1GXPA 3PNTA 4LG0B 1BM9A 3I4MJ 2R7SA 1MZBA 2LNBA 2R7OA 5J1YA 1BW6A 5JR3A 3K10A 3HKZN 3W6JB 1ONVA 3WTSC 4WX9A 3IKVA 3LSJA 3RQIA 2OQRA 3F9KA 3HOYJ 1ACIA 2DT7B 3A4CA 4I76A 2DAOA 3HG9A 5HLIA 3GXOA 1ZG3A 2LD5A 5FLXZ 2V26A 4WF2A 3MKWB 1UHSA 1VQ9I 1Z05A 2OV7A 3CCVI 2JA8J 2KIMA 3JRHA 4UVAA 4HSTA 3BTJA 4Y4RA 1HXDA 1J59A 3GTQJ 1JXSA 1W4MA 4NC7A 3BOQA 2EZLA 4BQOA 5KAIC 4KITB 1MDMB 2Y75A 2DFFA 4EGZA 2G7HA 2UXNA 1AKHB 3BP8A 3HOVJ 3S3NA 1WI3A 2BXYA 4BS9A 1FMWA 3OS0A 4D7NA 4XBFA 4CZCA 1W7PD 1IDZA 1HSTA 4RGXA 2WC2A 3HB9A 3KZIC 5J4VA 4RMNA 4OWRB 1P2FA 4L5JA 1K7AA 3IH3A 1TZLA 2E1CA 3JTHA 3TP3A 5KCMA 2M45A 2KFDA 3DP7A 4CGZA 2HTSA 2VI6A 2N8GA 3DPTA 3TBIA 4BHPA 2FEZA 2E2HJ 3KZZA 3ASOH 4HF2A 1I6XA 1JJ6C 4FASD 5GAHJ 3W2AA 3EPZA 2YX4A 1WRJA 3F3XA 1G2HA 1D1AA 2WB1N 5D6FA 4RM3A 5F64A 4F91B 4A93J 2EB7A 3MCZA 2E1MC 4JP0A 4U0VA 3IRQA 3NWTA 1ETQA 3NAUA 1U6GA 3FMSA 3TO7A 1HW1A 2HQAA 5K5QA 1XSVA 4F3QA 1XSDA 4JOMA 5DCMA 3MMYB 2DK8A 3CUQB 3LFKA 2A6EF 2XAGA 5F0CA 2ZNYA 3QU3A 2NNYA 5D4RA 3PO2J 4V2FA 1MGTA 3FM3A 4IJAA 4KN7X 1IV6A 4LJZF 1UMQA 1QVTA 2MC4A 2IXSA 1QHGA 2JVGA 2OA4A 1P7IA 5F1RA 4LITA 4L9NA 2EIMH 1WJ5A 2R93J 1G3WA 1TWFJ 5E3OA 2KJCA 4H4KC 3E97A 1W5TA 2ZBKA 4A3LJ 3C2GA 2KZGA 2E2IJ 3KYDB 3GFMA 4ITVA 3S32A 4PUSA 1YQAA 2RVCA 3OYGA 4EJUA 4HG2A 3LMMA 4E7SA 2PJRB 3RZDJ 4NUBA 3HSRA 3BZCA 1RR8C 1T56A 4S05A 2H6BA 2M87A 3FHNA 2JRMA 4AYBA 5FLXK 1HLVA 4UUSB 3BTLA 3SZGA 4XMYA 1KQ8A 1D8KA 3HC7A 2P6SA 3K70C 2IRFG 3QYBA 4M72A 4XLEA 3SFIA 1VQ5I 5HS9A 3ZMZA 4OMZA 2M7BA 4S04A 5J8FA 4UUTA 5HDNA 2DA6A 4FTHA 2EBIA 4GGGA 5EF6A 3FMRA 1BI0A 2GQQA 3I59A 4AM3A 2XRLA 2X6OA 4U0YA 2X1EA 2CWEA 2DJNA 1QO0D 4YIRX 2DXIA 3HRUA 2BGCA 1JUMA 1OCZH 4HZFA 4CSWA 4XLPF 3Q9VA 1GVDA 5LGUA 3HPGA 5DUKA 3IL2A 4HLYA 2DOFA 1RIOH 3ZQ7A 1ZG1A 2CYYA 2KL4A 1ETYA 1KU3A 1U9OA 5HLTA 1O3TA 2B9SA 2JVHA 3HOSA 3L2WA 1JTXA 4ZYEA 2ID6A 4ZYHA 1EH7A 3HSEA 1WKMA 2FMLA 4WXDA 2XB5A 3F8BA 1KYZA 4XK4A 4P5OA 3OYBA 4RBOA 2L7ZA 1JKRC 2IGNA 1E2XA 1FOXA 3BG5A 2DMPA 1X1BA 2LBFA 5FROA 2JQ7A 2ELJA 3T8RA 3Q5FA 2F4IA 1FLIA 4FE4A 1N77A 2QSHX 4D0PA 2IGOA 2QA4I 4N9HA 1IAWA 4N4OB 3WTXC 2P0WA 3HGGA 1F1ZA 4E4HA 1G3TA 5ED4A 1H8AC 1BA5A 1MMNA 5FLVA 1HSJA 2CUEA 4GO1A 3REOA 4M6VA 1YW7A 2DA7A 1JGSA 3V8JA 1OR7A 4KFCA 1SD4A 3Q9SA 2DA3A 4WK8F 1ZN2A 4L9VA 4A3DJ 2D45A 1APLC 3ZQIA 2WV1A 4B48A 2ZFWA 1WCMJ 1ON1A 1JKQC 2AO9A 5M5YJ 3KIOA 4Y33A 4GCVA 4BUPA 1YO5C 2VKHA 4HNTA 2E5NA 2VXDA 1ODDA 2KRCA 2M3AA 1J9IA 2EJRA 3OOUA 4EJOA 3DFGA 4KICA 2ZJQF 4HLXA 1FWZA 2L7MP 3UNGC 2E7XA 1RI7A 3K70D 4KMFA 1B59A 2M0CA 3J7YJ 1SC7A 3SHFA 2M8EA 3MAJA 2QGUA 4BDZA 5IT9Z 3MQ0A 2PMZA 4RGUA 4PJ0C 2JJ7A 3OV8A 4DYQA 3OS2A 4M9XA 3QAHA 2VUMJ 2LY9A 2UXXA 1WSUA 1YW9A 3PSFA 4BJ6C 1BN5A 4M6XA 3LL7A 4HQMA 3QOEA 3K4KA 3IHUA 4XORA 1FMVA 1J0RA 2HWVA 2TCTA 5FKKA 1KQ9A 3SDBA 4N9IA 3K9TA 4B3AA 3HOXJ 1S8NA 4NQWB 2NVQJ 3PSIA 1E3PA 5J3LA 4BKXA 4A3KJ 1FZPB 2RNGA 2R3SA 3K4CA 3IRRA 4N4NB 5C44J 2J5PA 4AVZA 1A31A 2GXBA 4HF0A 4Y13A 1FYKA 3I58A 1RZ4A 2IEKA 3ESWB 4BXUA 4XN3A 1IF1A 3VB2A 2ZXIA 1OPCA 2ZNZA 1LB2A 1ZARA 4BJTA 1V54H 3JTGA 2E36A 4ZH4F 2MA3A 4M73A 2JPBA 2LG4A 4RGSA 5J8CA 5LFAA 2IT0A 2B63J 1FSEA 1VQ7I 1MMSA 4CICA 4BNCA 3OIPA 2QBYA 2UWMA 5CPRB 3F23A 2H27A 2ZXHA 4E6KG 5BQTA 5BS6A 2K40A 4H0EA 2EFOA 5GP9A 1A04A 2IPQX 1N75A 1JUSA 3HJEA 4MQVA 1L3LA 4ON0A 3TDUC 2XF5A 3OOPA 3FBIB 3V4GA 1Z0XA 3WG9A 1ETVA 1YJ9I 4QTRA 3KFWX 1BOAA 3BJOA 2BW3A 1Z6RA 1ZR4A 3CTAA 3GLXA 3OYCA 3DF8A 4IHWA 3KEYA 1GV5A 3JRIA 3ABMH 2R7XA 4ZTFA 2NVXJ 3KYLA 1LQ1A 4M9ZA 4M6YA 5IY5H 3VYRB 1QZEA 1ETWA 3D5RC 1FBUA 4BYYA 1E17A 2K9LA 3QODA 1UHWA 1QU3A 4J00A 1RPWA 3TGNA 4QIWN 3R0AA 2DYSH 5IOZA 2ECBA 5IYCJ 3GYHX 1MBEA 3CDIA 2LF7A 2TDXA 3R0JA 2B0LA 3ZQLA 2CUZA 2JUGA 3PQKA 3FXQA 4WWCA 3LQRA 4OU0A 2Z33A 4A5MA 2L0KA 2AXTC 4YEJA 3VSLA 1STZA 5F0HA 2QLZA 2EA4A 2AXLA 5BNGA 3Q3SA 3HSFA 4WXCA 1O7LA 3HHHA 1KZHA 2XGEA 5JFRA 1SFXA 3KEQA 1AU7A 1T0FA 3L9FA 1J75A 2OTLI 1MJ9A 4A0YA 4P9UA 2LP0A 5B3SH 2CUJA 2Q0OA 3C2HA 4D1QA 2EV0A 2X6WA 1U5TB 3CDHA 3CDLA 4A6DA 4LLNA 2X1CA 2W85A 5F1JA 3N4MA 2ZSIB 2BY3A 2FX0A 2PMZN 2KP6A 2VBXA 3W6KB 2STTA 2X9DA 3CP2A 1FX7A 2CH0A 3B6AA 5FKLA 2P6TA 3BCAA 5TGTA 3VYSB 3AG3H 1LDJA 2BEOA 3OIQA 3ZMSA 4MTDA 1Z77A 5HDKA 3VWBA 1IDYA 4KN4X 1MH4A 2R0QC 2L9RA 1D5VA 4HW0A 4XRMA 1ITYA 2EK5A 1UFMA 4ZZDA 1EH6A 5FKOA 2XSDC 1FC3A 2JRTA 5J1UA 5D5UB 2XROA 5CVJA 3BWGA 1A6QA 5LHGA 3CCLI 2OAZA 3NRVA 3OMYA 2M8GX 1ZQ3P 4XOPA 4M9SA 1IXCA 4BJ5C 3MD2A 2DI3A 1OJLA 3KX2A 2A5YB 4IL6C 2DQLA 2HYJA 3IKTA 1G59A 4BE0A 4RM2A 1A6IA 3RKQA 4MO7A 3KP6A 2HYFA 3ZP5A 4MNUA 1YITI 4BGDA 2L2OA 3GX4X 4RAFA 2W24A 2XIGA 2XUBA 3V8LA 3NWSA 1OISA 3HKZA 3WGHA 3BG7A 2VE8A 3DKYA 3K4NA 4BEHB 2CG4A 3CUQA 4R8HA 2P5LC 3BG6A 5FKMA 4C3IJ 2ACJA 5EEHA 1ZK8A 1X3ZB 3B6CA 4PK4A 2MW8A 4RS8A 1SEUA 3DKWA 1R23A 2UUZA 4L0YB 3NQOA 3I0TA 1IC8A 3FF5A 4HEA2 2R7UA 2L4MA 5IT9K 2WV0A 4C30A 3LSIA 2DPDA 4UV9A 2ID3A 2AHQA 3CO7C 1FBSA 2MFZA 2R7DA 4Y15A 3M9AA 3S93A 3JAMK 4LD5A 3EUHA 3CMYA 5FJ8J 4Q4ZF 4IKFA 1R6RA 2A61A 2G9WA 3QYFA 3J81Z 1YYVA 5EZGA 2P5KA 1JT0A 3QOPA 2VBYA 1BJZA 2QQ9A 5CVVA 4B47A 5LRRA 2L7FP 2HGCA 1WVRA 1ZGJA 1G3YA 1H88C 3GBGA 1K79A 2Y69H 3ECHA 2AS5F 4MHGA 1R5GA 4C2TA 4G6QA 4LGWA 3HOZJ 4A0ZA 1UB9A 1WH5A 3H35A 2BVLA 4CO8A 4DIQA 2RN7A 3U1KA 2WAQN 2DK5A 2F5CA 2MC3A 1I39A 2XSJC 5FD5A 2CO5A 4I0BA 4LIVA 2LVSA 4A3GJ 1XGSA 3BZ6A 3DBLB 4RAZA 3JRCA 2VT2A 2WTEA 5FRNA 4BACA 4A12A 1W5CC 5LBQA 3CCYA 1USTA 2PFBA 4JBAA 1TT0A 5HS7A 2H09A 3M7GA 3H0GJ 4RB2C 1EJ9A 2M4GA 1NTCA 4Y17A 4UVBA 1I3QJ 2HYGD 1F9NA 2JT1A 1GXQA 1IGNA 1AOYA 3RSNA 4BXXJ 5C3EJ 2FRHA 1MSEC 3MKYB 1P92A 4BY1J 5FO5A 2DMTA 3CD6I 1PVEA 3K1MA 2W57A 3A03A 4M3FA 4DBRA 1HBXG 4B44A 2L01A 1FOWA 3GFLA 2M9HA 3J80K 4PCQA 4QPOA 1BIBA 1Z7LA 3R61A 3LSMA 3IWFA 2P81A 2LTPA 4LB6B 4YFKF 1I3AA 2NS7A 1TL8A 2V6EA 4ZYAA 2E34A 1LPQA 1KGSA 3VOEA 1BOBA 4NB5A 3RDIA 1ZG5A 2KRFA 4G7ZF 3E0JB 2ISZA 2EINH 1EV7A 4XKBA 3Q0VA 4FX0A 5JHUA 2PJRA 1IRGA 4IPAA 4GRIA 2FD5A 4NC6A 5K5RA 1O3RA 3G2BA 1HCRA 3LFUA 4HNVA 2VONA 4M3DA 4ZDPA 3JRAA 3IAM2 2K86A 4M3EA 4BL0B 3MZYA 1USSA 3LSRA 3C3WA 4IHSA 3G6EI 1IRFA 2BOLA 3ONQA 2F48A 4MFDA 2XVCA 3NEUA 1LJ9A 3FM5A 1BIAA 4PJLA 4BQNA 5JVGF 2HU9A 3OY9A 3RQ4A 2EH3A 3TW7A 4B8XA 1RKWA 4AWXB 2DQRA 3KCCA 2KPMA 4D7MA 4FQGA 3QWLA 4GFBA 3CMAI 3BPVA 4IEJA 2BV6A 2VB6A 2G7UA 1J7KA 2BW3B 3F6VA 2MABA 1CQTA 3BR6A 1RETA 2OC6A 1U8BA 2E1OA 3K2ZA 2IGMA 2H1KA 2I5UA 4XLAA 3ABUA 2O0YA 4R79A 2A07F 1OYYA 3LA7A 3TQNA 2KHMA 2XPWA 4KIFA 1T08B 5K5OA 2HVSA 3PO3J 3BLYA 3F22A 9ANTA 1OQYA 4IHVA 1S72I 3FXMA 3V8KA 5LHHA 1IXRC 4BQAA 1SVMA 1REPC 1MJBA 3ABLH 2EIJH 5L3DA 5GTHC 2PJPA 3JREA 3F0CA 5EYRA 3G4SI 1RESA 4O6JA 2ZFUA 3O3KA 4PJJA 3VDXA 3W2WA 2QVOA 3MZHA 1JJ8C 2DPUA 2ZJPF 2ESHA 2PMUA 2M2EA 1OCPA 2L5QA 1YX3A 2A6HF 4XM3A 3B73A 1IN7A 1TC3C 1YX5A 2FJ1A 1Y0UA 4W1UA 4ENJA 1B4AA 2Y9YA 5HS8A 3TKYA 1MDMA 3LSTA 3TEDA 4CA0A 4G9YA 1TTYA 1ZAOA 3PNYA 2A69F 4FE7A 4B4CA 4QLCU 1RRJA 2YPRA 1LVAA 3M1EA 3HTSB 2KLOA 2VT3A 1Y1VJ 4KUMA 2HPMA 2EQRA 2Y0SN 2PI0A 4UB8C 4XRSG 3ZGKA 4ENNA 4A3MJ 4IF4A 5E18F 3H5NA 3CUOA 2VKVA 3I4NJ 3BG9A 1XC5A 1VQKI 3E5UA 1V55H 3P5JA 1HKSA 2IJLA 1AWCA 2VBWA 3J7ZI 2P7CB 1IW7F 3P9KA 2YU3A 3VODA 2M34A 3W3CA 3RI4A 1JE8A 1F4KA 3JRFA 3H3ZA 2ELHA 3K1PA 2RQPA 3A02A 3OS1A 1XMAA 4DBQA 5ILUA 2KIQA 3S2WA 4ESBA 4TV7A 1O3QA 2EFNA 2P7VB 1B8IA 4G8XA 3MN2A 5E17F 3PFIA 1YRNA 3A1YA 1R1TA 4RB0A 2R5YB 4XSZF 3K7AJ 3J81K 1IUYA 2LREA 2NVYJ 3BJ6A 2FSWA 1YW8A 2ZSHB 5E1ZB 3KE2A 2I8DA 5K1YA 4A3FJ 4PDKA 1G8XA 1B6AA 4ZC3A 1SFEA 2IW5A 3ZRGA 3MZ8A 4IHYA 5DDGA 1IN5A 1WZ2A 1DP7P 3VPRA 5LEKA 3HL2A 2HPIA 1B72A 5DM7F 3BR2A 4EM1A 1OFCX 3S8PA 2LY2A 2HOSA 2ZKZA 6PAXA 3GUDA 3VYTB 2YR2A 4S0HB 1T95A 1JHHA 3DLLF 4HAMA 2KISA 4CCJA 3SFZA 2FMYA 3L00A 3AL0C 3RYPA 5LGNA 3CCEI 3I64A 1QRYA 5D5VB 1H9GA 5FFZA 5EDNA 1GHCA 1SFOJ 3E6DA 1IZ1A 4OAYA 3JRBA 5L3BA 2NOGA 5KHDA 2O5RA 3BROA 4NHJA 2KKOA 2ZJ2A 4JX6A 4CCOA 3V7CA 1X19A 5E8GA 1T8IA 4E70A 2LKSA 3ZN0A 2V4JC 1G6NA 2PEXA 2CW7A 2DW4A 2LY1A 5J4YA 1WH7A 1XN7A 3GVAA 4EEFG 4ZDLA 2F5FA 4D9JA 2EFWA 2LR8A 3BT9A 5C4JJ 2JMWA 2CQNA 4XKCA 5AIQA 1D1BA 2HVRA 2WAQA 2XPUA 2FF4A 4XLCA 4YG2F 1UZCA 4LG3A 2LOOA 3DTIA 4NC8A 3DTEA 1GUUA 5D6EA 4CCKA 3H3UA 2HKXA 2GOMA 2JA7J 1DGWY 2ZB9A 2ME6A 1RC9A 1BR1A 1XB4A 1MSFC 4LLGF 4I02A 2XHKA 2R5ZA 3H5RA 4X6AJ 2GOXB 2R7WA 3WHBA 1OLTA 1O3SA 3S15J 2P4WA 3AG1H 3SDGA 1OYWA 2HNHA 1YJWI 4II3A 1FNNA 2CU7A 2XGDA 1R5ID 2G0EA 2IS4A 4A3EJ 4DZPA 3BCBA 1XMKA 4PSWA 1P7JA 3C1DA 1T98A 3I53A 3IAS2 5EG0A 1JI8A 3DEWA 5FRMA 1K6OA 4CCMA 3CCMI 3MKZA 1JHFA 2BBYA 5CVRA 5HVQC 3ZOBA 4PSXA 4G6DA 3ZMDA 5D4SA 3ZCOA 1FY7A 1UCRA 1X2MA 4KJZA 2Z5UA 3HOTA 1LDKB 2KRHA 5E1WA 1PYVA 3GTOJ 1R1UA 2DODA 3S17J 5L3EA 4F52A 2PN6A 2WADA 2F5VA 2LDUA 4KISA 4DZJA 1PUEE 3GLLA 2COBA 2VQCA 5ILSA 5DD4A 3HTUA 2FNPA 3LQQA 2D5VA 2ECCA 5HLGA 2VJ5A 2CUFA 2WY8Q 4GYIA 1UHMA 3ABTA 3W2VA 2RNJA 5JVTA 2GIVA 2V7FA 1X1DA 4CUGA 3FXKA 3VFZA 2W82A 1X4PA 4EMSA 4IX7A 2V1XA 4A3BJ 4UUVA 1MD0A 3CC7I 1R49A 1X1CA 1LNWA 3BC8A 2LKXA 3WHCA 1J2XA 5FLMJ 3FKJA 3PJRA 2DDAA 1ETKA 3GTLJ 2R7FA 1FYLA 3BPXA 4BY7J 2EZKA 4G6TB 2VLAA 4LMYA 1F43A 1TQMA 3K0LA 3SZPA 3L2CA 4FX4A 2DOAA 1R1VA 1MMGA 3TO9A 5GAGJ 2QYOA 3CCJI 1S3JA 5CLSA 1Y8QB 2FQ3A 5ICFA 2Q2EB 3DU5A 2X51A 1H0MA 5B66C 3CJNA 1K6YA 4GYGA 2XAJA 4HDUA 2R7VA 1HKQA 2JA6J 2DYRH 2XAHA 3CCRI 1DQUA 4XIDA 2HZDA 2NRAC 2A3SA 3FK7A 2HI3A 1E3HA 2CW8A 5CJ9A 3ZQHA 4IO9F 1E3OC 3QPTA 5LD2C 2VQLA 2JWTA 5EEAA 1WJBA 2DOEA 2CV0A 2GXAA 5FD6A 2DJIA 3VYUB 3S1MJ 2BHZA 4GXOA 1PUFB 1A35A 3KP3A 3OYHA 1TNSA 4B3XA 4IOAF 4X1EA 3DEEA 3G73A 1I6HJ 2DMNA 3QYEA 4XICA 2L3DA 1KU2A 3FXUA 4BE2A 1X3UA 2X0LA 1G3SA 3RZOJ 1T38A 2QSFX 1HKTA 3I56I 2CSOA 2NS0A 2A05A 2E2JJ 1XPXA 1QNTA 1QPIA 4LK0F 2HOTA 5BPIA 3ZXSA 2DTZA 3L2VA 1SVOA 2CV1A 1BL0A 2W7NA 2DU9A 2JN6A 3DU6A 4I0AA 3S1NJ 1NK2P 1ZLKA 2GZWA 2L9SA 5AONA 3H1CA 2XC7A 4DJAA 3CF5F 1DPUA 1I5ZA 2VASA 2K3FA 5LHIA 3TO6A 3ULQB 5HODA 3HRSA 1YE9A 4AIDA 3EYYA 4A0XA 4XLHA 3TMOA 1T2KA 4ZYDA 3GTKJ 4X0GA 1FPQA 2COMA 3PM1A 1B9MA 2NNNA 4HRIA 1L0OC 4IRIA 3QQAA 3CLQA 3WTVC 5TRDA 1XMXA 3F8FA 2DFHA 1P9QC 2FQ4A 3L7WA 2ZJRF 3RCOA 1I27A 3TDZC 3WGGA 1S9HA 3C7JA 4NNJA 3KPHA 3GFIA 2Y9ZA 1KONA 3FBNB 1OR7C 3S3OA 3KP7A 2VOOA 2GIZA 2VKEA 2QBYB 5ICCA 2VJIA 3K4JA 3F21A 5F08A 2E60A 2NS8A 3OR2C 4M3GA 2JA2A 2LYCA 2X6XA 5BMZA 4AYBN 5LLQA 4I7HA 4KT5C 2MG4A 4RB3C 1B9NA 4B09A 4D5FA 2H8WA 2XPVA 3PL8A 3TL4X 3GZNB 5DTDA 4Q5SF 3UKGA 1TT5B 2O8XA 5TJJA 3FXLA 3GTMJ 3BDDA 4U0WA 1U78A 2VXZA 3GZ5A 3L2QA 5FFXA 1DU6A 3IV5A 1LE8B 1QZYA 1RUOA 2CQQA 2QQ8A 3RPUA 1T6SA 3E6CC 1W36C 2YX7A 4KIGA 1Q1HA 2CQ7A 1VQOI 1BW5A 2O3FA 2H6CA 1CGPA 2M4KA 2XB0X 4L5EA 4PFPA 4C2MJ 2EA2A 1UAAA 4EJVA 3OYKA 1R00A 4A6EA 3WU1B 5M3FJ 3ZMTA 5J47A 2RV8A 5AIPA 1LE8A 3R4KA 4XKWA 5LEJA 3CC2I 2RGVA 4I09A 3OYEA 1NG7A 1W1WE 2DA2A 3LA3A 2ZMEC 5H6RA 3WU0A 2LLKA 1Z91A 3IP4B 4HX4A 4RAGA 1SAUA 5IT3A 3PQJA 1QA6A 1Z1DA 3CF2A 2D1VA 2DLLA 2MYSA 2DTRA 3BZKA 1WHUA 3ECOA 1LKXA 4UVCA 5DS9A 1MBJA 2WB1A 4MTEA 3CCSI 1ERDA 1HA8A 5E3MA 1XGOA 5HNHA 3K6GA 5BPDA 1S5LC 2X48A 3VEPA 3F8NA 4XLNF 4ABZA 2XGCA 2XKPA 3OWTA 1IV8A 1SVLA 2XAQA 3CP8A 5IOYA 3H0DA 1R71A 1AHDP 3AFHA 3G71I 2P5VA 3K4MA 2H8RA 1TWAJ 2L9VA 1P4WA 1YHQI 1CF7B 3DLAA 5F27A 1YIJI 4ENMA 4KNYA 5IPAA 1Z9CA 3DPUA 1BJAA 3HUGB 2E7WA 1W5SA 3CZ6A 3U2RA 3O6BB 4M71A 4AUXA 2PLYA 2ELKA 5J6XA 3LNQA 5M5XJ 3DBRB 4K2EA 4BE1A 2IVMA 3BG3A 3MWMA 2M5WA 1DU0A 5GAEJ 3I3LA 1MNMC 3G1OA 4IVNA 5DUIA 5E1XA 2XDVA 1ZGWA 4G12A 2M7AA 2EILH 3RJPA 4XOTA 1VNDA 2FUG2 2FE3A 2RREA 5GTIC 5M3MJ 3CC4I 1ZYRF 5B5EC 2Y0SA 3ZQQA 5K7FA 2JUCA 1WWXA 4UUSA 3CMEI 3CO6C 2RAEA 3WG7H 4OMYA 3ROUA 5F0FA 5ICGA 5E3NA 2O61A 4DYCA 1ZLJA 3GTJJ 3S14J 1XX5A 3D0SA 2DT6A 2QF7A 4ZYGA 2CQKA 2O9LA 3DQVC 1PP8F 3CESA 3DEUA 3WTUC 1N78A 1IRXA 5J40A 4ZDOA 4P1WA 2W84A 2E71A 5DEQA 4RDUA 2LKPA 4L9JA 4XSXF 5CQEA 1HC8A 2R7RA 1MIJA 2E1MB 5HLHA 1MNDA 3E3VA 5KNLA 1YRNB 4W97A 3HGYA 4F92B 1LFPA 3TW6A 3ZPLA 3RKXA 4BHBA 2L02A 2V9VA 1TQPA 4P96A 2FXAA 2B7EA 2QM3A 3SYTA 2VN2A 4BDYA 1BC7C 3Q0WA 1X4OA 2EFPA 3BR1A 2Q2EA 1ZRFA 3KP4A 4A69C 4EJTA 1WJAA 5K7ZA 1R4MB 4OIQF 4CCNA 1WJFA 5F04A 3J80Z 3LAJA 2YSRA 1Z3YA 1R58A 2LMDA 2VBZA 5A2QK 2FOKA 3ABKH 2QKMB 5KK1A 4Y7NJ 2WAFA 3OSGA 1I1GA 3FWEA 2BHYA 4BAYA 4PZJA 3I55I 3BR3A 4F55A 1XGMA 4ETSA 2MD0A 3S2HJ 3T0YA 3U21A 3BTCA 3BQYA 2OD5A 1FIPA 2BZTA 2K3PA 1I1SA 4II2A 1WJEA 3A0BC 4J01A 1T33A 3E7LA 3WE2A 4C9YA 3LAPA 3G1LA 2OBPA 3M8FA 4AIKA 3EETA 3GEZA 2FBIA 4XQFA 2XF6A 3OL4A 5DCMB 3OYIA 2W00A 2HZTA 2LRDA 1AKHA 2VPRA 3FXJA 3L09A 3P9CA 5IP7J 2GBYA 4IOCF 5BOXA 2D2WA 4JX5A 4L5IA 2HOAA 2VPLA 1T39A 3BQZA 2KDOA 1Y0NA 2OF7A 2EWNA 4IRHA 2V9PA 5DCFA 5DD8A 1YS7A 4EQQA 3G1MA 2ME0A 3LSKA 1UG2A 2LFBA 2Z1DA 1EKEA 3DBHB 3E1SA 3RKYA 1S29A 2GM4A 2C6YA 2Z99A 1JTYA 2X85A 3WGIA 3IH4A 1K83J 3WTYC 2BY2A 4HA8A 2QKLB 4MEYF 4AD9A 4UXNA 2JSPA 2R92J 2R5ZB 2MBFA 2R4GA 2Y31A 2VODA 3WU2C 3A2KA 2M1BA 3GFJA 2VIXA 4LG0A 4BXFA 1PUFA 3V42A 2QQBA 3N97A 3M4OJ 2CRGA 4FISA 3E6MA 4HX8A 4FHTA 1IO2A 3AL0B 2MLGA 2ZC2A 1P4XA 3J7AO 1BI1A 4NQWA 1IN6A 3KETA 2FOWA 3GTGJ 2X1DA 3QPSA 1GDTA 1KYWA 1XD7A 4Y52J 3BJAA 4XKVA 2RKHA 1DDNA 2EPFA 1IN4A 4OIOF 4B43A 1QBJA 2PG4A 2K27A 1M1EB 2EFQA 2QEXI 2HDWA 4YFXF 2K7LA 2Y2ZA 1HQCA 2K02A 4PJNA 2H1LA 4FCYA 2MLKA 3L1PA 2IS1A 2IP2A 4IZZA 2VC0A 4BBRJ 2LF8A 1OCRH 5D8LB 1O57A 1UJ8A 4XRSA 2DFIA 4O5VA 2XAUA 2LBFB 3HYIA 1TW2A 2WY7Q 4OAZA 2P8TA 3SJMA 3M3YJ 3LSGA 4GDFA 3G3ZA 2PX9A 3KP2A 3SQNA 4BBSJ 5CKTA 1VFCA 2FBKA 3L2RA 1XG1A 2TRTA 1VI0A 1KU7A 1Z3XA 2ZO4A 3BTIA 1POGA 3QRFF 5EJCA 4CDGA 3O2PE 3FX3A 1Y56A 4YIIA 4DOZA 1H9TA 2CFOA 3H9JA 1S7OA 2XRNA 4MFEA 1J09A 3I9V2 4PGGA 2OCCH 1QQIA 1WQ2A 4ZZLA 4KA4A 2DDBA 4LLLA 5M5WJ 4HV6A 1W0UA 1O7FA 3PNVA 2PBIA 2O03A 4FT8A 3ZN1A 2K9SA 4CCLA 3V7RA 4QWQA 2DA4A 1XS9A 1FEXA 2R5YA 1CF7A 2DCEA 2LH9A 1SAXA 1IG7A 3RKWA 1XCVA 2WA0A 3GMEA 2HQNA 1VQPI 1MH3A 5L3FA 1R5HA 2NVUB 2RDPA 3MVPA 5E20A 4UY8I 3DWLE 2F4MB 2FA5A 3OYAA 2BY0A 4HDVA 5GADJ 5JHFA 4XR6A 4CYCA 2FBHA 2QSGX 3MEXA 2CGPA 1XDUA 1XDSA 2OU2A 2XF7A 1E0EA 3PIOF 3F8MA 5DYMA 4F93B 2HDCA 3E6BA 1EH8A 2Q8KA 3HPHA 1YOVB 3D1NI 3P9IA 4YIFA 1I50J 3S3MA 2Z9OA 1TNTA 3PUBA 1HDPA 2K9MA 2OTJI 1VQ8I 2NAZA 3SZTA 4EATA 1OCTC 1ZR2A 4YRVA 1ON2A 4UNOA 1WJDA 3BR5A 3KLOA 3T8TA 2CMPA 2Y30A 2W4SA 2QQAA 4KYWA 1U3EM 2HXOA 3IH2A 2HFHA 1YS6A 3GWZA 3F8CA 2NVTJ 1SD6A 2HR3A 1PP7U 3X2QH 4PFOA 5C4XJ 3OIOA 3FZVA 1X1AA 2ESNA 3EQLF 1ETXA 3HRTA 4E7LA 4O3MA 1XCBA 2PQ8A 4IXAA 2GA2A 2HQ5A 2QWWA 2H94A 3C18A 4HNUA 2CW0F 2QCOA 4QSHA 4A3CJ 2EIKH 3A01A 2L54A 3JAMZ 3FKIJ 4MIMA 3H9QA 4EM2A 3HIFA 3ISPA 4EVIA 3S2DJ 3HDDA 1QPMA 1GV2A 2XGXA 1VQMI 2BVMA 2I10A 2HDDA 4JYKA 1BR2A 1VQ6I 1TWGJ 1LEBA 3DCFA 1T0FC 4E7JA 5HDGA 2GLOA 3S1RJ 1U9NA 2IA2A 5B1AH 2VE9A 5TISC 3AKZA 1W7PA 3FISA 2VQGA 1Z6TA 3JR9A 1H89C 2J5OA 1YFHA 5IYDJ 4LIUA 1W36D 5GPAA 3HRMA 3PUFA 3OYFA 4JX4A 3OYJA 2OJED 4V2GA 1FBQA 3JCUC 3MKLA 2OZUA 2A68F 1U8RA 3C2BA 1C0WA 4EV0A 2LK2A 3ASNH 1MBFA 2L4AA 2IS6A 3EUAA 3DV8A 3CCUI 1W0TA 3GO5A 4PJMA 5ICEA 2DMUA 5E3LA 2L7KA 1FTZA 3D5LA 3AAFA 3CMMA 3H5AA 1MW7A 3I71A 4U7BA 2KIFA 1V5EA 1R22A 1IRZA 2K9QA 1FYMA 3BY6A 1OYIA 3COAC 2OPTA 1TW3A 2MH9A 2AQEA 3KYCB 4CYCB 3S1QJ 3Q0UA 1D5YA 5J1RA 3VSKA 2X6YA 3O8HA 3QU6A 1XSXA 2NYXA 3D5SC 2Z3YA 4OOIA 2DMQA 2GAUA 3CQZJ 4MGRA 1YJNI 5B1BH 1ZTRA 3K1NA 3R60A 2MD5A 5LRSA 2JA5J 4UB6C 4EJWA 4U7DA 4AVPA 3DPLC 4IQJA 3CLOA 1F36A 5FKNA 2Z16A 4LK1F 1RUNA 1TP4A 1U5TA 1TWCJ 2LC2A 3BR0A 5CVIA 4OIPF 1B1BA 1FP2A 1PJRA 3RYRA 1R7JA 3E5XA 3O8GA 1ZRCA 2HOEA 2KT0A 2EV5A 4A2UA 1QVUA 2K4BA 1FOYA 3WTZA 3K4BA 2BE5F 2E1NA 2V1UA 4RLQA 4XLFA 3JSPA 1UG0A 5GPCA 2HXIA 3CJRB 2JTVA 3N05A 1QGPA 1XTAA 2VJJA 5E79C 4OIRF 1FOKA 5D5XB 2KQRA 4L0ZB 1KU9A 3IWZA 3FMQA 4KIBA 3K2AA 3SXYA 4HQEA 1VTNC 2MGQA 3QP6A 1SMYF 2JZYA 5K7HA 4RB1A 4L18B 1QHHD 4AIHA 1Y39A 4ESFA 2ZCWA 1YG2A 2WAEA 3H92A 4D5CA 2ZMEA 4HSRA 1VQNI 1K4SA 4DYRA 1X1PA 3IC7A 1MBGA 4YELA 2Y48A 4MQ9F 4EM0B 3H36A 3WE3A 2OZ6A 4Q47A 1R4NB 4CHUA 5EGOA 4LB5A 3W6VA 1MNEA 3DXJF 2Q1ZB 1HDDC 1RKTA 4E7HA 1FTTA 4E7ZA 5E8IA 2W1OA 1MBHA 4HYEA 4P9FA 5D8KB 1OKRA 1V5FA 2CFXA 2E35A 1ZH5A 3GCMA 2NOJB 1SD7A 1ZGAA 2XKOA 3H3VK 2F6CA 3QPHA 4ZJZA 2JSCA 2E5ZA 5HOOA 1PDNC 4QPQA 3ZMUA 1S7EA 1TBXA 3IUOA 1SFKA 3OSFA 1VZ0A 3ZQGA 3E5QA 3KEOA 2WBMA 2GXGA 2K9NA 1YTYA 5EGOB 2IS2A 1W7PB 1NK3P 4RAYA 3WODF 4AC0A 2ETHA 4RGRA 3A0HC 4KDPA 2F5DA 1D1CA 1J5YA 4BU2A 1V3FA 2IGKA 2BXZA 3RTRA 1LDDA 1WI9A 1RR7A 4KMUX 5ERIA 5L3CA 5KAFC 2DBBA 1ULYA 2YU9J 1GLNA 1ZHFA 4Z6YA 2KDZA 3U9GA 4ASNA 1LUJB 1G4DA 4RLFA 5D5WB 3EYIA 4LFUA 2R7QA 3RPUD 2FNAA 5H2FC 4EGYA 1D0XA 5CQGA 2L9NA 4UHTA 3U1DA 1HF0A 2EZIA 5IP6A 1TWHJ 5LGTA 4E7IA 3A01B 3MFKA 2ADUA 1FIAA 5EZHA 3WTTC 1NH3A 1Y6IA 3HM5A 1V5GA 4HPQA 2V6CA 2D1HA 1K78A 1S6LA 2K4JA 4CYDA 5JLWA 3OYDA 4JK1X 1JKOC 1UELB 3FK6A 1Z7UA 2O6GE 2KJBA 1WGXA 3FXOA 3SEZA 4A3IJ 4ANJA 1KQ0A 4NDLA 1VQLI 2ICWG 2KZVA 4C3JJ 2DO7A 1LVKA 1K61A 3RPQA 4A5NA 1IUFA 5EG0B 2EZHA 2BY1A 2HVQA 3HZJA 4WCGA 3FHZA 2VKDA 3QPLA 2K85A 4I98B 1YI2I 1NHAA 2Z2SB 3M8JA 1VF9A 5ILVA 1X58A 1WPKA 5FGMA 4JQFA 3OYMA 3LOCA 3OR1C 4Q48A 3PIPF 2DFEA 2M0MA 2UV1A 3WTWC 3TOBA 2HS5A 1IN8A 1ENHA 1MBKA 4Y3OA 1O4XA 4LOCA 4G94A 3LSPA 2DA1A 2XV4S 1BBYA 2GA1A 4RA2A 2VC1A 3TP0A 1SANA 2IA1A 3EUKL 2XASA 2F5EA 1FJLA 2EV6A 2HEOA 3AG2H 4IHTA 2ZXWH 3T1BA 2IAIA 1LFBA 3LA2A 1Z21A 2JPCA 1ZKGA 1TQIA 3F6OA 2QUFA 3JW4A 5H6QA 1FT9A 3HUGA 4DQ2A 1DGRM 1S7AA 2FU4A 4HOBA 4CZZA 4F7ZA 2Y0MA 3M07A 3I59B 2YUSA 4Z2YA 1OMIA 4AIJA 2M30A 2F4OB 4G7HF 2RQQA 3I54A 3HOUJ 2QENA 3R6SA 2O7OA 4P55A 4WXHA 1ZELA 1B8IB 5DM6F 1F5TA 2RC4A 4YFNF 3KZYA 3EDPA 3UR3C 3FDYA 3FXRA 5F6FA 5H20A 1ZREA 2OUMA 3TOAA 1Y8RB 3EUHC 4IQ4A 1MJAA 2JK3A 1ZRDA 2K5CA 2CV2A 2V1DA 3V7SA 2LSOA
chains in the Genus database with same CATH topology
1FOXA 1VQ6I 4IO9F 2H8WA 1VQNI 3CCSI 3G6EI 1VQLI 2JQ7A 3CCUI 2ZJPF 1YJNI 2NXNB 3CCQI 4IOCF 5GAEJ 1VQ4I 2QA4I 1FOYA 3I55I 2E34A 2QEXI 2ZJRF 5DM7F 1VQ9I 5GAGJ 5JVGF 3CCVI 3CCMI 2OTJI 1S72I 3CCJI 5DM6F 1VQPI 1YI2I 1VQ8I 1VQ5I 4IOAF 1YJ9I 3CC7I 2ZJQF 1VQKI 2E36A 2OTLI 3CC2I 1HC8A 3G71I 3CF5F 4UY8I 3CC4I 3CJTB 1MMSA 3CD6I 5GADJ 3CMAI 3PIPF 3J7ZI 3DLLF 1YITI 1VQ7I 2K3FA 3CMEI 1YHQI 4V19K 1YIJI 2E35A 5GAHJ 3J7YJ 3I56I 1FOWA 2FOWA 1VQOI 3CCRI 1VQMI 3G4SI 1Y39A 1QA6A 3CCEI 1YJWI 3CCLI 1ACIA 3PIOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOX A;  1VQ6 I;  4IO9 F;  2H8W A;  1VQN I;  3CCS I;  3G6E I;  1VQL I;  2JQ7 A;  3CCU I;  2ZJP F;  1YJN I;  2NXN B;  3CCQ I;  4IOC F;  5GAE J;  1VQ4 I;  2QA4 I;  1FOY A;  3I55 I;  2E34 A;  2QEX I;  2ZJR F;  5DM7 F;  1VQ9 I;  5GAG J;  5JVG F;  3CCV I;  3CCM I;  2OTJ I;  1S72 I;  3CCJ I;  5DM6 F;  1VQP I;  1YI2 I;  1VQ8 I;  1VQ5 I;  4IOA F;  1YJ9 I;  3CC7 I;  2ZJQ F;  1VQK I;  2E36 A;  2OTL I;  3CC2 I;  1HC8 A;  3G71 I;  3CF5 F;  4UY8 I;  3CC4 I;  3CJT B;  1MMS A;  3CD6 I;  5GAD J;  3CMA I;  3PIP F;  3J7Z I;  3DLL F;  1YIT I;  1VQ7 I;  2K3F A;  3CME I;  1YHQ I;  4V19 K;  1YIJ I;  2E35 A;  5GAH J;  3J7Y J;  3I56 I;  1FOW A;  2FOW A;  1VQO I;  3CCR I;  1VQM I;  3G4S I;  1Y39 A;  1QA6 A;  3CCE I;  1YJW I;  3CCL I;  1ACI A;  3PIO F; 
#chains in the Genus database with same CATH topology
 2WWY A;  1SD5 A;  4IHX A;  1KA8 A;  3OL3 A;  1GVJ A;  2W48 A;  3JRD A;  1X2N A;  3HBL A;  4MLO A;  4CXF A;  1VQ4 I;  1YLF A;  1EF4 A;  2XAF A;  2VL8 A;  1LFU P;  5JLX A;  3ZMV A;  5L3G A;  1BI3 A;  1ORK A;  3CJT B;  3M8E A;  1FP1 D;  2R7Z J;  3SEQ A;  4I2O A;  1OCC H;  3QP5 A;  3M1C A;  4BEH A;  2OCE A;  3K69 A;  2ZXJ A;  4CH7 A;  1OCO H;  4I01 A;  2DA5 A;  3B02 A;  1D0Y A;  3AG4 H;  1D8J A;  1DP3 A;  2V1N A;  3LSH A;  4C2U A;  2BYV E;  1HOM A;  3DTK A;  2KIU A;  5DV5 A;  3OYN A;  1D3Y A;  2V79 A;  1DPR A;  1MKM A;  1WFX A;  1NG6 A;  5FB2 A;  2DT5 A;  4FET A;  3H9G A;  5CVU A;  1QZZ A;  2HQR A;  3CJQ B;  4HF1 A;  2OQG A;  4C3H J;  3GZ6 A;  4J19 A;  1D0Z A;  1EA3 A;  1YIO A;  3FIW A;  2DN0 A;  3ML6 A;  4L9T A;  4PGH A;  1Y1W J;  4ESJ A;  4I6Z A;  4E7K A;  4BHC A;  1R9T J;  3LWF A;  4N0B A;  1BR4 A;  2MSY A;  2NXN B;  1LEA A;  3JSO A;  1JUP A;  3ZQF A;  2UZK A;  1BI2 A;  4ZTJ A;  1GT0 C;  1DUX C;  2F2E A;  5JI6 A;  1ETO A;  4OIN F;  2IBD A;  3F72 A;  1N25 A;  4HX7 A;  2A6T A;  5IP9 J;  3ERM A;  3NAR A;  1HW2 A;  1K78 B;  4UV8 A;  1MMA A;  3HOW J;  4XL9 A;  4KT6 A;  4DW6 A;  5A2Q Z;  1A5J A;  1HW5 A;  1IJW C;  2CQX A;  3ELK A;  2A5W A;  4XRF A;  1IXS B;  3HHG A;  5IYB J;  2YS9 A;  1U0J A;  1U2W A;  3L2U A;  4HBL A;  3KLN A;  1Q1V A;  3HXL A;  3OYL A;  1JT6 A;  3T5X A;  2KMU A;  3ERE D;  1SMT A;  4DNC A;  1MMD A;  1RNL A;  5CYV A;  3RIR A;  2E19 A;  4NBQ A;  2HTJ A;  2W25 A;  4A3J J;  4I99 C;  1P4A A;  1A36 A;  3HEF A;  2R7T A;  4B1R A;  5KVR A;  4HV5 A;  4U88 A;  2ZME B;  1K4T A;  3ZQC A;  4DGW B;  3GTP J;  2MH2 A;  3J7A Y;  2X4H A;  3KP5 A;  2VQH A;  1SFU A;  3GF2 A;  2STW A;  3CCQ I;  2HKO A;  1B72 B;  1P6R A;  1JGG A;  1FSH A;  4AU7 A;  1X3W B;  3GW2 A;  2AQF A;  1V4R A;  1XGN A;  2QZ8 A;  1BC8 C;  2PMH A;  2CJJ A;  3S16 J;  4XN0 A;  2VOP A;  2IA0 A;  2GWR A;  4XNF A;  4V19 K;  2V9K A;  2O8K A;  2ISY A;  4U87 A;  4IRG A;  3I5U A;  1AA7 A;  3CUQ C;  3P7N A;  5EEG A;  4XON A;  3ZR8 X;  4R1H A;  2VJ4 A;  4BH9 A;  4BQQ A;  4ENK A;  4MEX F;  4G7O F;  1WJC A;  4M3B A;  1U5T C;  3I4P A;  2CS3 A;  3DKX A;  4M74 A;  3PFY A;  1R36 A;  5HNF A;  3K4L A;  1Z67 A;  1TLH B;  1JKP C;  3JRG A;  1GXP A;  3PNT A;  4LG0 B;  1BM9 A;  3I4M J;  2R7S A;  1MZB A;  2LNB A;  2R7O A;  5J1Y A;  1BW6 A;  5JR3 A;  3K10 A;  3HKZ N;  3W6J B;  1ONV A;  3WTS C;  4WX9 A;  3IKV A;  3LSJ A;  3RQI A;  2OQR A;  3F9K A;  3HOY J;  1ACI A;  2DT7 B;  3A4C A;  4I76 A;  2DAO A;  3HG9 A;  5HLI A;  3GXO A;  1ZG3 A;  2LD5 A;  5FLX Z;  2V26 A;  4WF2 A;  3MKW B;  1UHS A;  1VQ9 I;  1Z05 A;  2OV7 A;  3CCV I;  2JA8 J;  2KIM A;  3JRH A;  4UVA A;  4HST A;  3BTJ A;  4Y4R A;  1HXD A;  1J59 A;  3GTQ J;  1JXS A;  1W4M A;  4NC7 A;  3BOQ A;  2EZL A;  4BQO A;  5KAI C;  4KIT B;  1MDM B;  2Y75 A;  2DFF A;  4EGZ A;  2G7H A;  2UXN A;  1AKH B;  3BP8 A;  3HOV J;  3S3N A;  1WI3 A;  2BXY A;  4BS9 A;  1FMW A;  3OS0 A;  4D7N A;  4XBF A;  4CZC A;  1W7P D;  1IDZ A;  1HST A;  4RGX A;  2WC2 A;  3HB9 A;  3KZI C;  5J4V A;  4RMN A;  4OWR B;  1P2F A;  4L5J A;  1K7A A;  3IH3 A;  1TZL A;  2E1C A;  3JTH A;  3TP3 A;  5KCM A;  2M45 A;  2KFD A;  3DP7 A;  4CGZ A;  2HTS A;  2VI6 A;  2N8G A;  3DPT A;  3TBI A;  4BHP A;  2FEZ A;  2E2H J;  3KZZ A;  3ASO H;  4HF2 A;  1I6X A;  1JJ6 C;  4FAS D;  5GAH J;  3W2A A;  3EPZ A;  2YX4 A;  1WRJ A;  3F3X A;  1G2H A;  1D1A A;  2WB1 N;  5D6F A;  4RM3 A;  5F64 A;  4F91 B;  4A93 J;  2EB7 A;  3MCZ A;  2E1M C;  4JP0 A;  4U0V A;  3IRQ A;  3NWT A;  1ETQ A;  3NAU A;  1U6G A;  3FMS A;  3TO7 A;  1HW1 A;  2HQA A;  5K5Q A;  1XSV A;  4F3Q A;  1XSD A;  4JOM A;  5DCM A;  3MMY B;  2DK8 A;  3CUQ B;  3LFK A;  2A6E F;  2XAG A;  5F0C A;  2ZNY A;  3QU3 A;  2NNY A;  5D4R A;  3PO2 J;  4V2F A;  1MGT A;  3FM3 A;  4IJA A;  4KN7 X;  1IV6 A;  4LJZ F;  1UMQ A;  1QVT A;  2MC4 A;  2IXS A;  1QHG A;  2JVG A;  2OA4 A;  1P7I A;  5F1R A;  4LIT A;  4L9N A;  2EIM H;  1WJ5 A;  2R93 J;  1G3W A;  1TWF J;  5E3O A;  2KJC A;  4H4K C;  3E97 A;  1W5T A;  2ZBK A;  4A3L J;  3C2G A;  2KZG A;  2E2I J;  3KYD B;  3GFM A;  4ITV A;  3S32 A;  4PUS A;  1YQA A;  2RVC A;  3OYG A;  4EJU A;  4HG2 A;  3LMM A;  4E7S A;  2PJR B;  3RZD J;  4NUB A;  3HSR A;  3BZC A;  1RR8 C;  1T56 A;  4S05 A;  2H6B A;  2M87 A;  3FHN A;  2JRM A;  4AYB A;  5FLX K;  1HLV A;  4UUS B;  3BTL A;  3SZG A;  4XMY A;  1KQ8 A;  1D8K A;  3HC7 A;  2P6S A;  3K70 C;  2IRF G;  3QYB A;  4M72 A;  4XLE A;  3SFI A;  1VQ5 I;  5HS9 A;  3ZMZ A;  4OMZ A;  2M7B A;  4S04 A;  5J8F A;  4UUT A;  5HDN A;  2DA6 A;  4FTH A;  2EBI A;  4GGG A;  5EF6 A;  3FMR A;  1BI0 A;  2GQQ A;  3I59 A;  4AM3 A;  2XRL A;  2X6O A;  4U0Y A;  2X1E A;  2CWE A;  2DJN A;  1QO0 D;  4YIR X;  2DXI A;  3HRU A;  2BGC A;  1JUM A;  1OCZ H;  4HZF A;  4CSW A;  4XLP F;  3Q9V A;  1GVD A;  5LGU A;  3HPG A;  5DUK A;  3IL2 A;  4HLY A;  2DOF A;  1RIO H;  3ZQ7 A;  1ZG1 A;  2CYY A;  2KL4 A;  1ETY A;  1KU3 A;  1U9O A;  5HLT A;  1O3T A;  2B9S A;  2JVH A;  3HOS A;  3L2W A;  1JTX A;  4ZYE A;  2ID6 A;  4ZYH A;  1EH7 A;  3HSE A;  1WKM A;  2FML A;  4WXD A;  2XB5 A;  3F8B A;  1KYZ A;  4XK4 A;  4P5O A;  3OYB A;  4RBO A;  2L7Z A;  1JKR C;  2IGN A;  1E2X A;  1FOX A;  3BG5 A;  2DMP A;  1X1B A;  2LBF A;  5FRO A;  2JQ7 A;  2ELJ A;  3T8R A;  3Q5F A;  2F4I A;  1FLI A;  4FE4 A;  1N77 A;  2QSH X;  4D0P A;  2IGO A;  2QA4 I;  4N9H A;  1IAW A;  4N4O B;  3WTX C;  2P0W A;  3HGG A;  1F1Z A;  4E4H A;  1G3T A;  5ED4 A;  1H8A C;  1BA5 A;  1MMN A;  5FLV A;  1HSJ A;  2CUE A;  4GO1 A;  3REO A;  4M6V A;  1YW7 A;  2DA7 A;  1JGS A;  3V8J A;  1OR7 A;  4KFC A;  1SD4 A;  3Q9S A;  2DA3 A;  4WK8 F;  1ZN2 A;  4L9V A;  4A3D J;  2D45 A;  1APL C;  3ZQI A;  2WV1 A;  4B48 A;  2ZFW A;  1WCM J;  1ON1 A;  1JKQ C;  2AO9 A;  5M5Y J;  3KIO A;  4Y33 A;  4GCV A;  4BUP A;  1YO5 C;  2VKH A;  4HNT A;  2E5N A;  2VXD A;  1ODD A;  2KRC A;  2M3A A;  1J9I A;  2EJR A;  3OOU A;  4EJO A;  3DFG A;  4KIC A;  2ZJQ F;  4HLX A;  1FWZ A;  2L7M P;  3UNG C;  2E7X A;  1RI7 A;  3K70 D;  4KMF A;  1B59 A;  2M0C A;  3J7Y J;  1SC7 A;  3SHF A;  2M8E A;  3MAJ A;  2QGU A;  4BDZ A;  5IT9 Z;  3MQ0 A;  2PMZ A;  4RGU A;  4PJ0 C;  2JJ7 A;  3OV8 A;  4DYQ A;  3OS2 A;  4M9X A;  3QAH A;  2VUM J;  2LY9 A;  2UXX A;  1WSU A;  1YW9 A;  3PSF A;  4BJ6 C;  1BN5 A;  4M6X A;  3LL7 A;  4HQM A;  3QOE A;  3K4K A;  3IHU A;  4XOR A;  1FMV A;  1J0R A;  2HWV A;  2TCT A;  5FKK A;  1KQ9 A;  3SDB A;  4N9I A;  3K9T A;  4B3A A;  3HOX J;  1S8N A;  4NQW B;  2NVQ J;  3PSI A;  1E3P A;  5J3L A;  4BKX A;  4A3K J;  1FZP B;  2RNG A;  2R3S A;  3K4C A;  3IRR A;  4N4N B;  5C44 J;  2J5P A;  4AVZ A;  1A31 A;  2GXB A;  4HF0 A;  4Y13 A;  1FYK A;  3I58 A;  1RZ4 A;  2IEK A;  3ESW B;  4BXU A;  4XN3 A;  1IF1 A;  3VB2 A;  2ZXI A;  1OPC A;  2ZNZ A;  1LB2 A;  1ZAR A;  4BJT A;  1V54 H;  3JTG A;  2E36 A;  4ZH4 F;  2MA3 A;  4M73 A;  2JPB A;  2LG4 A;  4RGS A;  5J8C A;  5LFA A;  2IT0 A;  2B63 J;  1FSE A;  1VQ7 I;  1MMS A;  4CIC A;  4BNC A;  3OIP A;  2QBY A;  2UWM A;  5CPR B;  3F23 A;  2H27 A;  2ZXH A;  4E6K G;  5BQT A;  5BS6 A;  2K40 A;  4H0E A;  2EFO A;  5GP9 A;  1A04 A;  2IPQ X;  1N75 A;  1JUS A;  3HJE A;  4MQV A;  1L3L A;  4ON0 A;  3TDU C;  2XF5 A;  3OOP A;  3FBI B;  3V4G A;  1Z0X A;  3WG9 A;  1ETV A;  1YJ9 I;  4QTR A;  3KFW X;  1BOA A;  3BJO A;  2BW3 A;  1Z6R A;  1ZR4 A;  3CTA A;  3GLX A;  3OYC A;  3DF8 A;  4IHW A;  3KEY A;  1GV5 A;  3JRI A;  3ABM H;  2R7X A;  4ZTF A;  2NVX J;  3KYL A;  1LQ1 A;  4M9Z A;  4M6Y A;  5IY5 H;  3VYR B;  1QZE A;  1ETW A;  3D5R C;  1FBU A;  4BYY A;  1E17 A;  2K9L A;  3QOD A;  1UHW A;  1QU3 A;  4J00 A;  1RPW A;  3TGN A;  4QIW N;  3R0A A;  2DYS H;  5IOZ A;  2ECB A;  5IYC J;  3GYH X;  1MBE A;  3CDI A;  2LF7 A;  2TDX A;  3R0J A;  2B0L A;  3ZQL A;  2CUZ A;  2JUG A;  3PQK A;  3FXQ A;  4WWC A;  3LQR A;  4OU0 A;  2Z33 A;  4A5M A;  2L0K A;  2AXT C;  4YEJ A;  3VSL A;  1STZ A;  5F0H A;  2QLZ A;  2EA4 A;  2AXL A;  5BNG A;  3Q3S A;  3HSF A;  4WXC A;  1O7L A;  3HHH A;  1KZH A;  2XGE A;  5JFR A;  1SFX A;  3KEQ A;  1AU7 A;  1T0F A;  3L9F A;  1J75 A;  2OTL I;  1MJ9 A;  4A0Y A;  4P9U A;  2LP0 A;  5B3S H;  2CUJ A;  2Q0O A;  3C2H A;  4D1Q A;  2EV0 A;  2X6W A;  1U5T B;  3CDH A;  3CDL A;  4A6D A;  4LLN A;  2X1C A;  2W85 A;  5F1J A;  3N4M A;  2ZSI B;  2BY3 A;  2FX0 A;  2PMZ N;  2KP6 A;  2VBX A;  3W6K B;  2STT A;  2X9D A;  3CP2 A;  1FX7 A;  2CH0 A;  3B6A A;  5FKL A;  2P6T A;  3BCA A;  5TGT A;  3VYS B;  3AG3 H;  1LDJ A;  2BEO A;  3OIQ A;  3ZMS A;  4MTD A;  1Z77 A;  5HDK A;  3VWB A;  1IDY A;  4KN4 X;  1MH4 A;  2R0Q C;  2L9R A;  1D5V A;  4HW0 A;  4XRM A;  1ITY A;  2EK5 A;  1UFM A;  4ZZD A;  1EH6 A;  5FKO A;  2XSD C;  1FC3 A;  2JRT A;  5J1U A;  5D5U B;  2XRO A;  5CVJ A;  3BWG A;  1A6Q A;  5LHG A;  3CCL I;  2OAZ A;  3NRV A;  3OMY A;  2M8G X;  1ZQ3 P;  4XOP A;  4M9S A;  1IXC A;  4BJ5 C;  3MD2 A;  2DI3 A;  1OJL A;  3KX2 A;  2A5Y B;  4IL6 C;  2DQL A;  2HYJ A;  3IKT A;  1G59 A;  4BE0 A;  4RM2 A;  1A6I A;  3RKQ A;  4MO7 A;  3KP6 A;  2HYF A;  3ZP5 A;  4MNU A;  1YIT I;  4BGD A;  2L2O A;  3GX4 X;  4RAF A;  2W24 A;  2XIG A;  2XUB A;  3V8L A;  3NWS A;  1OIS A;  3HKZ A;  3WGH A;  3BG7 A;  2VE8 A;  3DKY A;  3K4N A;  4BEH B;  2CG4 A;  3CUQ A;  4R8H A;  2P5L C;  3BG6 A;  5FKM A;  4C3I J;  2ACJ A;  5EEH A;  1ZK8 A;  1X3Z B;  3B6C A;  4PK4 A;  2MW8 A;  4RS8 A;  1SEU A;  3DKW A;  1R23 A;  2UUZ A;  4L0Y B;  3NQO A;  3I0T A;  1IC8 A;  3FF5 A;  4HEA 2;  2R7U A;  2L4M A;  5IT9 K;  2WV0 A;  4C30 A;  3LSI A;  2DPD A;  4UV9 A;  2ID3 A;  2AHQ A;  3CO7 C;  1FBS A;  2MFZ A;  2R7D A;  4Y15 A;  3M9A A;  3S93 A;  3JAM K;  4LD5 A;  3EUH A;  3CMY A;  5FJ8 J;  4Q4Z F;  4IKF A;  1R6R A;  2A61 A;  2G9W A;  3QYF A;  3J81 Z;  1YYV A;  5EZG A;  2P5K A;  1JT0 A;  3QOP A;  2VBY A;  1BJZ A;  2QQ9 A;  5CVV A;  4B47 A;  5LRR A;  2L7F P;  2HGC A;  1WVR A;  1ZGJ A;  1G3Y A;  1H88 C;  3GBG A;  1K79 A;  2Y69 H;  3ECH A;  2AS5 F;  4MHG A;  1R5G A;  4C2T A;  4G6Q A;  4LGW A;  3HOZ J;  4A0Z A;  1UB9 A;  1WH5 A;  3H35 A;  2BVL A;  4CO8 A;  4DIQ A;  2RN7 A;  3U1K A;  2WAQ N;  2DK5 A;  2F5C A;  2MC3 A;  1I39 A;  2XSJ C;  5FD5 A;  2CO5 A;  4I0B A;  4LIV A;  2LVS A;  4A3G J;  1XGS A;  3BZ6 A;  3DBL B;  4RAZ A;  3JRC A;  2VT2 A;  2WTE A;  5FRN A;  4BAC A;  4A12 A;  1W5C C;  5LBQ A;  3CCY A;  1UST A;  2PFB A;  4JBA A;  1TT0 A;  5HS7 A;  2H09 A;  3M7G A;  3H0G J;  4RB2 C;  1EJ9 A;  2M4G A;  1NTC A;  4Y17 A;  4UVB A;  1I3Q J;  2HYG D;  1F9N A;  2JT1 A;  1GXQ A;  1IGN A;  1AOY A;  3RSN A;  4BXX J;  5C3E J;  2FRH A;  1MSE C;  3MKY B;  1P92 A;  4BY1 J;  5FO5 A;  2DMT A;  3CD6 I;  1PVE A;  3K1M A;  2W57 A;  3A03 A;  4M3F A;  4DBR A;  1HBX G;  4B44 A;  2L01 A;  1FOW A;  3GFL A;  2M9H A;  3J80 K;  4PCQ A;  4QPO A;  1BIB A;  1Z7L A;  3R61 A;  3LSM A;  3IWF A;  2P81 A;  2LTP A;  4LB6 B;  4YFK F;  1I3A A;  2NS7 A;  1TL8 A;  2V6E A;  4ZYA A;  2E34 A;  1LPQ A;  1KGS A;  3VOE A;  1BOB A;  4NB5 A;  3RDI A;  1ZG5 A;  2KRF A;  4G7Z F;  3E0J B;  2ISZ A;  2EIN H;  1EV7 A;  4XKB A;  3Q0V A;  4FX0 A;  5JHU A;  2PJR A;  1IRG A;  4IPA A;  4GRI A;  2FD5 A;  4NC6 A;  5K5R A;  1O3R A;  3G2B A;  1HCR A;  3LFU A;  4HNV A;  2VON A;  4M3D A;  4ZDP A;  3JRA A;  3IAM 2;  2K86 A;  4M3E A;  4BL0 B;  3MZY A;  1USS A;  3LSR A;  3C3W A;  4IHS A;  3G6E I;  1IRF A;  2BOL A;  3ONQ A;  2F48 A;  4MFD A;  2XVC A;  3NEU A;  1LJ9 A;  3FM5 A;  1BIA A;  4PJL A;  4BQN A;  5JVG F;  2HU9 A;  3OY9 A;  3RQ4 A;  2EH3 A;  3TW7 A;  4B8X A;  1RKW A;  4AWX B;  2DQR A;  3KCC A;  2KPM A;  4D7M A;  4FQG A;  3QWL A;  4GFB A;  3CMA I;  3BPV A;  4IEJ A;  2BV6 A;  2VB6 A;  2G7U A;  1J7K A;  2BW3 B;  3F6V A;  2MAB A;  1CQT A;  3BR6 A;  1RET A;  2OC6 A;  1U8B A;  2E1O A;  3K2Z A;  2IGM A;  2H1K A;  2I5U A;  4XLA A;  3ABU A;  2O0Y A;  4R79 A;  2A07 F;  1OYY A;  3LA7 A;  3TQN A;  2KHM A;  2XPW A;  4KIF A;  1T08 B;  5K5O A;  2HVS A;  3PO3 J;  3BLY A;  3F22 A;  9ANT A;  1OQY A;  4IHV A;  1S72 I;  3FXM A;  3V8K A;  5LHH A;  1IXR C;  4BQA A;  1SVM A;  1REP C;  1MJB A;  3ABL H;  2EIJ H;  5L3D A;  5GTH C;  2PJP A;  3JRE A;  3F0C A;  5EYR A;  3G4S I;  1RES A;  4O6J A;  2ZFU A;  3O3K A;  4PJJ A;  3VDX A;  3W2W A;  2QVO A;  3MZH A;  1JJ8 C;  2DPU A;  2ZJP F;  2ESH A;  2PMU A;  2M2E A;  1OCP A;  2L5Q A;  1YX3 A;  2A6H F;  4XM3 A;  3B73 A;  1IN7 A;  1TC3 C;  1YX5 A;  2FJ1 A;  1Y0U A;  4W1U A;  4ENJ A;  1B4A A;  2Y9Y A;  5HS8 A;  3TKY A;  1MDM A;  3LST A;  3TED A;  4CA0 A;  4G9Y A;  1TTY A;  1ZAO A;  3PNY A;  2A69 F;  4FE7 A;  4B4C A;  4QLC U;  1RRJ A;  2YPR A;  1LVA A;  3M1E A;  3HTS B;  2KLO A;  2VT3 A;  1Y1V J;  4KUM A;  2HPM A;  2EQR A;  2Y0S N;  2PI0 A;  4UB8 C;  4XRS G;  3ZGK A;  4ENN A;  4A3M J;  4IF4 A;  5E18 F;  3H5N A;  3CUO A;  2VKV A;  3I4N J;  3BG9 A;  1XC5 A;  1VQK I;  3E5U A;  1V55 H;  3P5J A;  1HKS A;  2IJL A;  1AWC A;  2VBW A;  3J7Z I;  2P7C B;  1IW7 F;  3P9K A;  2YU3 A;  3VOD A;  2M34 A;  3W3C A;  3RI4 A;  1JE8 A;  1F4K A;  3JRF A;  3H3Z A;  2ELH A;  3K1P A;  2RQP A;  3A02 A;  3OS1 A;  1XMA A;  4DBQ A;  5ILU A;  2KIQ A;  3S2W A;  4ESB A;  4TV7 A;  1O3Q A;  2EFN A;  2P7V B;  1B8I A;  4G8X A;  3MN2 A;  5E17 F;  3PFI A;  1YRN A;  3A1Y A;  1R1T A;  4RB0 A;  2R5Y B;  4XSZ F;  3K7A J;  3J81 K;  1IUY A;  2LRE A;  2NVY J;  3BJ6 A;  2FSW A;  1YW8 A;  2ZSH B;  5E1Z B;  3KE2 A;  2I8D A;  5K1Y A;  4A3F J;  4PDK A;  1G8X A;  1B6A A;  4ZC3 A;  1SFE A;  2IW5 A;  3ZRG A;  3MZ8 A;  4IHY A;  5DDG A;  1IN5 A;  1WZ2 A;  1DP7 P;  3VPR A;  5LEK A;  3HL2 A;  2HPI A;  1B72 A;  5DM7 F;  3BR2 A;  4EM1 A;  1OFC X;  3S8P A;  2LY2 A;  2HOS A;  2ZKZ A;  6PAX A;  3GUD A;  3VYT B;  2YR2 A;  4S0H B;  1T95 A;  1JHH A;  3DLL F;  4HAM A;  2KIS A;  4CCJ A;  3SFZ A;  2FMY A;  3L00 A;  3AL0 C;  3RYP A;  5LGN A;  3CCE I;  3I64 A;  1QRY A;  5D5V B;  1H9G A;  5FFZ A;  5EDN A;  1GHC A;  1SFO J;  3E6D A;  1IZ1 A;  4OAY A;  3JRB A;  5L3B A;  2NOG A;  5KHD A;  2O5R A;  3BRO A;  4NHJ A;  2KKO A;  2ZJ2 A;  4JX6 A;  4CCO A;  3V7C A;  1X19 A;  5E8G A;  1T8I A;  4E70 A;  2LKS A;  3ZN0 A;  2V4J C;  1G6N A;  2PEX A;  2CW7 A;  2DW4 A;  2LY1 A;  5J4Y A;  1WH7 A;  1XN7 A;  3GVA A;  4EEF G;  4ZDL A;  2F5F A;  4D9J A;  2EFW A;  2LR8 A;  3BT9 A;  5C4J J;  2JMW A;  2CQN A;  4XKC A;  5AIQ A;  1D1B A;  2HVR A;  2WAQ A;  2XPU A;  2FF4 A;  4XLC A;  4YG2 F;  1UZC A;  4LG3 A;  2LOO A;  3DTI A;  4NC8 A;  3DTE A;  1GUU A;  5D6E A;  4CCK A;  3H3U A;  2HKX A;  2GOM A;  2JA7 J;  1DGW Y;  2ZB9 A;  2ME6 A;  1RC9 A;  1BR1 A;  1XB4 A;  1MSF C;  4LLG F;  4I02 A;  2XHK A;  2R5Z A;  3H5R A;  4X6A J;  2GOX B;  2R7W A;  3WHB A;  1OLT A;  1O3S A;  3S15 J;  2P4W A;  3AG1 H;  3SDG A;  1OYW A;  2HNH A;  1YJW I;  4II3 A;  1FNN A;  2CU7 A;  2XGD A;  1R5I D;  2G0E A;  2IS4 A;  4A3E J;  4DZP A;  3BCB A;  1XMK A;  4PSW A;  1P7J A;  3C1D A;  1T98 A;  3I53 A;  3IAS 2;  5EG0 A;  1JI8 A;  3DEW A;  5FRM A;  1K6O A;  4CCM A;  3CCM I;  3MKZ A;  1JHF A;  2BBY A;  5CVR A;  5HVQ C;  3ZOB A;  4PSX A;  4G6D A;  3ZMD A;  5D4S A;  3ZCO A;  1FY7 A;  1UCR A;  1X2M A;  4KJZ A;  2Z5U A;  3HOT A;  1LDK B;  2KRH A;  5E1W A;  1PYV A;  3GTO J;  1R1U A;  2DOD A;  3S17 J;  5L3E A;  4F52 A;  2PN6 A;  2WAD A;  2F5V A;  2LDU A;  4KIS A;  4DZJ A;  1PUE E;  3GLL A;  2COB A;  2VQC A;  5ILS A;  5DD4 A;  3HTU A;  2FNP A;  3LQQ A;  2D5V A;  2ECC A;  5HLG A;  2VJ5 A;  2CUF A;  2WY8 Q;  4GYI A;  1UHM A;  3ABT A;  3W2V A;  2RNJ A;  5JVT A;  2GIV A;  2V7F A;  1X1D A;  4CUG A;  3FXK A;  3VFZ A;  2W82 A;  1X4P A;  4EMS A;  4IX7 A;  2V1X A;  4A3B J;  4UUV A;  1MD0 A;  3CC7 I;  1R49 A;  1X1C A;  1LNW A;  3BC8 A;  2LKX A;  3WHC A;  1J2X A;  5FLM J;  3FKJ A;  3PJR A;  2DDA A;  1ETK A;  3GTL J;  2R7F A;  1FYL A;  3BPX A;  4BY7 J;  2EZK A;  4G6T B;  2VLA A;  4LMY A;  1F43 A;  1TQM A;  3K0L A;  3SZP A;  3L2C A;  4FX4 A;  2DOA A;  1R1V A;  1MMG A;  3TO9 A;  5GAG J;  2QYO A;  3CCJ I;  1S3J A;  5CLS A;  1Y8Q B;  2FQ3 A;  5ICF A;  2Q2E B;  3DU5 A;  2X51 A;  1H0M A;  5B66 C;  3CJN A;  1K6Y A;  4GYG A;  2XAJ A;  4HDU A;  2R7V A;  1HKQ A;  2JA6 J;  2DYR H;  2XAH A;  3CCR I;  1DQU A;  4XID A;  2HZD A;  2NRA C;  2A3S A;  3FK7 A;  2HI3 A;  1E3H A;  2CW8 A;  5CJ9 A;  3ZQH A;  4IO9 F;  1E3O C;  3QPT A;  5LD2 C;  2VQL A;  2JWT A;  5EEA A;  1WJB A;  2DOE A;  2CV0 A;  2GXA A;  5FD6 A;  2DJI A;  3VYU B;  3S1M J;  2BHZ A;  4GXO A;  1PUF B;  1A35 A;  3KP3 A;  3OYH A;  1TNS A;  4B3X A;  4IOA F;  4X1E A;  3DEE A;  3G73 A;  1I6H J;  2DMN A;  3QYE A;  4XIC A;  2L3D A;  1KU2 A;  3FXU A;  4BE2 A;  1X3U A;  2X0L A;  1G3S A;  3RZO J;  1T38 A;  2QSF X;  1HKT A;  3I56 I;  2CSO A;  2NS0 A;  2A05 A;  2E2J J;  1XPX A;  1QNT A;  1QPI A;  4LK0 F;  2HOT A;  5BPI A;  3ZXS A;  2DTZ A;  3L2V A;  1SVO A;  2CV1 A;  1BL0 A;  2W7N A;  2DU9 A;  2JN6 A;  3DU6 A;  4I0A A;  3S1N J;  1NK2 P;  1ZLK A;  2GZW A;  2L9S A;  5AON A;  3H1C A;  2XC7 A;  4DJA A;  3CF5 F;  1DPU A;  1I5Z A;  2VAS A;  2K3F A;  5LHI A;  3TO6 A;  3ULQ B;  5HOD A;  3HRS A;  1YE9 A;  4AID A;  3EYY A;  4A0X A;  4XLH A;  3TMO A;  1T2K A;  4ZYD A;  3GTK J;  4X0G A;  1FPQ A;  2COM A;  3PM1 A;  1B9M A;  2NNN A;  4HRI A;  1L0O C;  4IRI A;  3QQA A;  3CLQ A;  3WTV C;  5TRD A;  1XMX A;  3F8F A;  2DFH A;  1P9Q C;  2FQ4 A;  3L7W A;  2ZJR F;  3RCO A;  1I27 A;  3TDZ C;  3WGG A;  1S9H A;  3C7J A;  4NNJ A;  3KPH A;  3GFI A;  2Y9Z A;  1KON A;  3FBN B;  1OR7 C;  3S3O A;  3KP7 A;  2VOO A;  2GIZ A;  2VKE A;  2QBY B;  5ICC A;  2VJI A;  3K4J A;  3F21 A;  5F08 A;  2E60 A;  2NS8 A;  3OR2 C;  4M3G A;  2JA2 A;  2LYC A;  2X6X A;  5BMZ A;  4AYB N;  5LLQ A;  4I7H A;  4KT5 C;  2MG4 A;  4RB3 C;  1B9N A;  4B09 A;  4D5F A;  2H8W A;  2XPV A;  3PL8 A;  3TL4 X;  3GZN B;  5DTD A;  4Q5S F;  3UKG A;  1TT5 B;  2O8X A;  5TJJ A;  3FXL A;  3GTM J;  3BDD A;  4U0W A;  1U78 A;  2VXZ A;  3GZ5 A;  3L2Q A;  5FFX A;  1DU6 A;  3IV5 A;  1LE8 B;  1QZY A;  1RUO A;  2CQQ A;  2QQ8 A;  3RPU A;  1T6S A;  3E6C C;  1W36 C;  2YX7 A;  4KIG A;  1Q1H A;  2CQ7 A;  1VQO I;  1BW5 A;  2O3F A;  2H6C A;  1CGP A;  2M4K A;  2XB0 X;  4L5E A;  4PFP A;  4C2M J;  2EA2 A;  1UAA A;  4EJV A;  3OYK A;  1R00 A;  4A6E A;  3WU1 B;  5M3F J;  3ZMT A;  5J47 A;  2RV8 A;  5AIP A;  1LE8 A;  3R4K A;  4XKW A;  5LEJ A;  3CC2 I;  2RGV A;  4I09 A;  3OYE A;  1NG7 A;  1W1W E;  2DA2 A;  3LA3 A;  2ZME C;  5H6R A;  3WU0 A;  2LLK A;  1Z91 A;  3IP4 B;  4HX4 A;  4RAG A;  1SAU A;  5IT3 A;  3PQJ A;  1QA6 A;  1Z1D A;  3CF2 A;  2D1V A;  2DLL A;  2MYS A;  2DTR A;  3BZK A;  1WHU A;  3ECO A;  1LKX A;  4UVC A;  5DS9 A;  1MBJ A;  2WB1 A;  4MTE A;  3CCS I;  1ERD A;  1HA8 A;  5E3M A;  1XGO A;  5HNH A;  3K6G A;  5BPD A;  1S5L C;  2X48 A;  3VEP A;  3F8N A;  4XLN F;  4ABZ A;  2XGC A;  2XKP A;  3OWT A;  1IV8 A;  1SVL A;  2XAQ A;  3CP8 A;  5IOY A;  3H0D A;  1R71 A;  1AHD P;  3AFH A;  3G71 I;  2P5V A;  3K4M A;  2H8R A;  1TWA J;  2L9V A;  1P4W A;  1YHQ I;  1CF7 B;  3DLA A;  5F27 A;  1YIJ I;  4ENM A;  4KNY A;  5IPA A;  1Z9C A;  3DPU A;  1BJA A;  3HUG B;  2E7W A;  1W5S A;  3CZ6 A;  3U2R A;  3O6B B;  4M71 A;  4AUX A;  2PLY A;  2ELK A;  5J6X A;  3LNQ A;  5M5X J;  3DBR B;  4K2E A;  4BE1 A;  2IVM A;  3BG3 A;  3MWM A;  2M5W A;  1DU0 A;  5GAE J;  3I3L A;  1MNM C;  3G1O A;  4IVN A;  5DUI A;  5E1X A;  2XDV A;  1ZGW A;  4G12 A;  2M7A A;  2EIL H;  3RJP A;  4XOT A;  1VND A;  2FUG 2;  2FE3 A;  2RRE A;  5GTI C;  5M3M J;  3CC4 I;  1ZYR F;  5B5E C;  2Y0S A;  3ZQQ A;  5K7F A;  2JUC A;  1WWX A;  4UUS A;  3CME I;  3CO6 C;  2RAE A;  3WG7 H;  4OMY A;  3ROU A;  5F0F A;  5ICG A;  5E3N A;  2O61 A;  4DYC A;  1ZLJ A;  3GTJ J;  3S14 J;  1XX5 A;  3D0S A;  2DT6 A;  2QF7 A;  4ZYG A;  2CQK A;  2O9L A;  3DQV C;  1PP8 F;  3CES A;  3DEU A;  3WTU C;  1N78 A;  1IRX A;  5J40 A;  4ZDO A;  4P1W A;  2W84 A;  2E71 A;  5DEQ A;  4RDU A;  2LKP A;  4L9J A;  4XSX F;  5CQE A;  1HC8 A;  2R7R A;  1MIJ A;  2E1M B;  5HLH A;  1MND A;  3E3V A;  5KNL A;  1YRN B;  4W97 A;  3HGY A;  4F92 B;  1LFP A;  3TW6 A;  3ZPL A;  3RKX A;  4BHB A;  2L02 A;  2V9V A;  1TQP A;  4P96 A;  2FXA A;  2B7E A;  2QM3 A;  3SYT A;  2VN2 A;  4BDY A;  1BC7 C;  3Q0W A;  1X4O A;  2EFP A;  3BR1 A;  2Q2E A;  1ZRF A;  3KP4 A;  4A69 C;  4EJT A;  1WJA A;  5K7Z A;  1R4M B;  4OIQ F;  4CCN A;  1WJF A;  5F04 A;  3J80 Z;  3LAJ A;  2YSR A;  1Z3Y A;  1R58 A;  2LMD A;  2VBZ A;  5A2Q K;  2FOK A;  3ABK H;  2QKM B;  5KK1 A;  4Y7N J;  2WAF A;  3OSG A;  1I1G A;  3FWE A;  2BHY A;  4BAY A;  4PZJ A;  3I55 I;  3BR3 A;  4F55 A;  1XGM A;  4ETS A;  2MD0 A;  3S2H J;  3T0Y A;  3U21 A;  3BTC A;  3BQY A;  2OD5 A;  1FIP A;  2BZT A;  2K3P A;  1I1S A;  4II2 A;  1WJE A;  3A0B C;  4J01 A;  1T33 A;  3E7L A;  3WE2 A;  4C9Y A;  3LAP A;  3G1L A;  2OBP A;  3M8F A;  4AIK A;  3EET A;  3GEZ A;  2FBI A;  4XQF A;  2XF6 A;  3OL4 A;  5DCM B;  3OYI A;  2W00 A;  2HZT A;  2LRD A;  1AKH A;  2VPR A;  3FXJ A;  3L09 A;  3P9C A;  5IP7 J;  2GBY A;  4IOC F;  5BOX A;  2D2W A;  4JX5 A;  4L5I A;  2HOA A;  2VPL A;  1T39 A;  3BQZ A;  2KDO A;  1Y0N A;  2OF7 A;  2EWN A;  4IRH A;  2V9P A;  5DCF A;  5DD8 A;  1YS7 A;  4EQQ A;  3G1M A;  2ME0 A;  3LSK A;  1UG2 A;  2LFB A;  2Z1D A;  1EKE A;  3DBH B;  3E1S A;  3RKY A;  1S29 A;  2GM4 A;  2C6Y A;  2Z99 A;  1JTY A;  2X85 A;  3WGI A;  3IH4 A;  1K83 J;  3WTY C;  2BY2 A;  4HA8 A;  2QKL B;  4MEY F;  4AD9 A;  4UXN A;  2JSP A;  2R92 J;  2R5Z B;  2MBF A;  2R4G A;  2Y31 A;  2VOD A;  3WU2 C;  3A2K A;  2M1B A;  3GFJ A;  2VIX A;  4LG0 A;  4BXF A;  1PUF A;  3V42 A;  2QQB A;  3N97 A;  3M4O J;  2CRG A;  4FIS A;  3E6M A;  4HX8 A;  4FHT A;  1IO2 A;  3AL0 B;  2MLG A;  2ZC2 A;  1P4X A;  3J7A O;  1BI1 A;  4NQW A;  1IN6 A;  3KET A;  2FOW A;  3GTG J;  2X1D A;  3QPS A;  1GDT A;  1KYW A;  1XD7 A;  4Y52 J;  3BJA A;  4XKV A;  2RKH A;  1DDN A;  2EPF A;  1IN4 A;  4OIO F;  4B43 A;  1QBJ A;  2PG4 A;  2K27 A;  1M1E B;  2EFQ A;  2QEX I;  2HDW A;  4YFX F;  2K7L A;  2Y2Z A;  1HQC A;  2K02 A;  4PJN A;  2H1L A;  4FCY A;  2MLK A;  3L1P A;  2IS1 A;  2IP2 A;  4IZZ A;  2VC0 A;  4BBR J;  2LF8 A;  1OCR H;  5D8L B;  1O57 A;  1UJ8 A;  4XRS A;  2DFI A;  4O5V A;  2XAU A;  2LBF B;  3HYI A;  1TW2 A;  2WY7 Q;  4OAZ A;  2P8T A;  3SJM A;  3M3Y J;  3LSG A;  4GDF A;  3G3Z A;  2PX9 A;  3KP2 A;  3SQN A;  4BBS J;  5CKT A;  1VFC A;  2FBK A;  3L2R A;  1XG1 A;  2TRT A;  1VI0 A;  1KU7 A;  1Z3X A;  2ZO4 A;  3BTI A;  1POG A;  3QRF F;  5EJC A;  4CDG A;  3O2P E;  3FX3 A;  1Y56 A;  4YII A;  4DOZ A;  1H9T A;  2CFO A;  3H9J A;  1S7O A;  2XRN A;  4MFE A;  1J09 A;  3I9V 2;  4PGG A;  2OCC H;  1QQI A;  1WQ2 A;  4ZZL A;  4KA4 A;  2DDB A;  4LLL A;  5M5W J;  4HV6 A;  1W0U A;  1O7F A;  3PNV A;  2PBI A;  2O03 A;  4FT8 A;  3ZN1 A;  2K9S A;  4CCL A;  3V7R A;  4QWQ A;  2DA4 A;  1XS9 A;  1FEX A;  2R5Y A;  1CF7 A;  2DCE A;  2LH9 A;  1SAX A;  1IG7 A;  3RKW A;  1XCV A;  2WA0 A;  3GME A;  2HQN A;  1VQP I;  1MH3 A;  5L3F A;  1R5H A;  2NVU B;  2RDP A;  3MVP A;  5E20 A;  4UY8 I;  3DWL E;  2F4M B;  2FA5 A;  3OYA A;  2BY0 A;  4HDV A;  5GAD J;  5JHF A;  4XR6 A;  4CYC A;  2FBH A;  2QSG X;  3MEX A;  2CGP A;  1XDU A;  1XDS A;  2OU2 A;  2XF7 A;  1E0E A;  3PIO F;  3F8M A;  5DYM A;  4F93 B;  2HDC A;  3E6B A;  1EH8 A;  2Q8K A;  3HPH A;  1YOV B;  3D1N I;  3P9I A;  4YIF A;  1I50 J;  3S3M A;  2Z9O A;  1TNT A;  3PUB A;  1HDP A;  2K9M A;  2OTJ I;  1VQ8 I;  2NAZ A;  3SZT A;  4EAT A;  1OCT C;  1ZR2 A;  4YRV A;  1ON2 A;  4UNO A;  1WJD A;  3BR5 A;  3KLO A;  3T8T A;  2CMP A;  2Y30 A;  2W4S A;  2QQA A;  4KYW A;  1U3E M;  2HXO A;  3IH2 A;  2HFH A;  1YS6 A;  3GWZ A;  3F8C A;  2NVT J;  1SD6 A;  2HR3 A;  1PP7 U;  3X2Q H;  4PFO A;  5C4X J;  3OIO A;  3FZV A;  1X1A A;  2ESN A;  3EQL F;  1ETX A;  3HRT A;  4E7L A;  4O3M A;  1XCB A;  2PQ8 A;  4IXA A;  2GA2 A;  2HQ5 A;  2QWW A;  2H94 A;  3C18 A;  4HNU A;  2CW0 F;  2QCO A;  4QSH A;  4A3C J;  2EIK H;  3A01 A;  2L54 A;  3JAM Z;  3FKI J;  4MIM A;  3H9Q A;  4EM2 A;  3HIF A;  3ISP A;  4EVI A;  3S2D J;  3HDD A;  1QPM A;  1GV2 A;  2XGX A;  1VQM I;  2BVM A;  2I10 A;  2HDD A;  4JYK A;  1BR2 A;  1VQ6 I;  1TWG J;  1LEB A;  3DCF A;  1T0F C;  4E7J A;  5HDG A;  2GLO A;  3S1R J;  1U9N A;  2IA2 A;  5B1A H;  2VE9 A;  5TIS C;  3AKZ A;  1W7P A;  3FIS A;  2VQG A;  1Z6T A;  3JR9 A;  1H89 C;  2J5O A;  1YFH A;  5IYD J;  4LIU A;  1W36 D;  5GPA A;  3HRM A;  3PUF A;  3OYF A;  4JX4 A;  3OYJ A;  2OJE D;  4V2G A;  1FBQ A;  3JCU C;  3MKL A;  2OZU A;  2A68 F;  1U8R A;  3C2B A;  1C0W A;  4EV0 A;  2LK2 A;  3ASN H;  1MBF A;  2L4A A;  2IS6 A;  3EUA A;  3DV8 A;  3CCU I;  1W0T A;  3GO5 A;  4PJM A;  5ICE A;  2DMU A;  5E3L A;  2L7K A;  1FTZ A;  3D5L A;  3AAF A;  3CMM A;  3H5A A;  1MW7 A;  3I71 A;  4U7B A;  2KIF A;  1V5E A;  1R22 A;  1IRZ A;  2K9Q A;  1FYM A;  3BY6 A;  1OYI A;  3COA C;  2OPT A;  1TW3 A;  2MH9 A;  2AQE A;  3KYC B;  4CYC B;  3S1Q J;  3Q0U A;  1D5Y A;  5J1R A;  3VSK A;  2X6Y A;  3O8H A;  3QU6 A;  1XSX A;  2NYX A;  3D5S C;  2Z3Y A;  4OOI A;  2DMQ A;  2GAU A;  3CQZ J;  4MGR A;  1YJN I;  5B1B H;  1ZTR A;  3K1N A;  3R60 A;  2MD5 A;  5LRS A;  2JA5 J;  4UB6 C;  4EJW A;  4U7D A;  4AVP A;  3DPL C;  4IQJ A;  3CLO A;  1F36 A;  5FKN A;  2Z16 A;  4LK1 F;  1RUN A;  1TP4 A;  1U5T A;  1TWC J;  2LC2 A;  3BR0 A;  5CVI A;  4OIP F;  1B1B A;  1FP2 A;  1PJR A;  3RYR A;  1R7J A;  3E5X A;  3O8G A;  1ZRC A;  2HOE A;  2KT0 A;  2EV5 A;  4A2U A;  1QVU A;  2K4B A;  1FOY A;  3WTZ A;  3K4B A;  2BE5 F;  2E1N A;  2V1U A;  4RLQ A;  4XLF A;  3JSP A;  1UG0 A;  5GPC A;  2HXI A;  3CJR B;  2JTV A;  3N05 A;  1QGP A;  1XTA A;  2VJJ A;  5E79 C;  4OIR F;  1FOK A;  5D5X B;  2KQR A;  4L0Z B;  1KU9 A;  3IWZ A;  3FMQ A;  4KIB A;  3K2A A;  3SXY A;  4HQE A;  1VTN C;  2MGQ A;  3QP6 A;  1SMY F;  2JZY A;  5K7H A;  4RB1 A;  4L18 B;  1QHH D;  4AIH A;  1Y39 A;  4ESF A;  2ZCW A;  1YG2 A;  2WAE A;  3H92 A;  4D5C A;  2ZME A;  4HSR A;  1VQN I;  1K4S A;  4DYR A;  1X1P A;  3IC7 A;  1MBG A;  4YEL A;  2Y48 A;  4MQ9 F;  4EM0 B;  3H36 A;  3WE3 A;  2OZ6 A;  4Q47 A;  1R4N B;  4CHU A;  5EGO A;  4LB5 A;  3W6V A;  1MNE A;  3DXJ F;  2Q1Z B;  1HDD C;  1RKT A;  4E7H A;  1FTT A;  4E7Z A;  5E8I A;  2W1O A;  1MBH A;  4HYE A;  4P9F A;  5D8K B;  1OKR A;  1V5F A;  2CFX A;  2E35 A;  1ZH5 A;  3GCM A;  2NOJ B;  1SD7 A;  1ZGA A;  2XKO A;  3H3V K;  2F6C A;  3QPH A;  4ZJZ A;  2JSC A;  2E5Z A;  5HOO A;  1PDN C;  4QPQ A;  3ZMU A;  1S7E A;  1TBX A;  3IUO A;  1SFK A;  3OSF A;  1VZ0 A;  3ZQG A;  3E5Q A;  3KEO A;  2WBM A;  2GXG A;  2K9N A;  1YTY A;  5EGO B;  2IS2 A;  1W7P B;  1NK3 P;  4RAY A;  3WOD F;  4AC0 A;  2ETH A;  4RGR A;  3A0H C;  4KDP A;  2F5D A;  1D1C A;  1J5Y A;  4BU2 A;  1V3F A;  2IGK A;  2BXZ A;  3RTR A;  1LDD A;  1WI9 A;  1RR7 A;  4KMU X;  5ERI A;  5L3C A;  5KAF C;  2DBB A;  1ULY A;  2YU9 J;  1GLN A;  1ZHF A;  4Z6Y A;  2KDZ A;  3U9G A;  4ASN A;  1LUJ B;  1G4D A;  4RLF A;  5D5W B;  3EYI A;  4LFU A;  2R7Q A;  3RPU D;  2FNA A;  5H2F C;  4EGY A;  1D0X A;  5CQG A;  2L9N A;  4UHT A;  3U1D A;  1HF0 A;  2EZI A;  5IP6 A;  1TWH J;  5LGT A;  4E7I A;  3A01 B;  3MFK A;  2ADU A;  1FIA A;  5EZH A;  3WTT C;  1NH3 A;  1Y6I A;  3HM5 A;  1V5G A;  4HPQ A;  2V6C A;  2D1H A;  1K78 A;  1S6L A;  2K4J A;  4CYD A;  5JLW A;  3OYD A;  4JK1 X;  1JKO C;  1UEL B;  3FK6 A;  1Z7U A;  2O6G E;  2KJB A;  1WGX A;  3FXO A;  3SEZ A;  4A3I J;  4ANJ A;  1KQ0 A;  4NDL A;  1VQL I;  2ICW G;  2KZV A;  4C3J J;  2DO7 A;  1LVK A;  1K61 A;  3RPQ A;  4A5N A;  1IUF A;  5EG0 B;  2EZH A;  2BY1 A;  2HVQ A;  3HZJ A;  4WCG A;  3FHZ A;  2VKD A;  3QPL A;  2K85 A;  4I98 B;  1YI2 I;  1NHA A;  2Z2S B;  3M8J A;  1VF9 A;  5ILV A;  1X58 A;  1WPK A;  5FGM A;  4JQF A;  3OYM A;  3LOC A;  3OR1 C;  4Q48 A;  3PIP F;  2DFE A;  2M0M A;  2UV1 A;  3WTW C;  3TOB A;  2HS5 A;  1IN8 A;  1ENH A;  1MBK A;  4Y3O A;  1O4X A;  4LOC A;  4G94 A;  3LSP A;  2DA1 A;  2XV4 S;  1BBY A;  2GA1 A;  4RA2 A;  2VC1 A;  3TP0 A;  1SAN A;  2IA1 A;  3EUK L;  2XAS A;  2F5E A;  1FJL A;  2EV6 A;  2HEO A;  3AG2 H;  4IHT A;  2ZXW H;  3T1B A;  2IAI A;  1LFB A;  3LA2 A;  1Z21 A;  2JPC A;  1ZKG A;  1TQI A;  3F6O A;  2QUF A;  3JW4 A;  5H6Q A;  1FT9 A;  3HUG A;  4DQ2 A;  1DGR M;  1S7A A;  2FU4 A;  4HOB A;  4CZZ A;  4F7Z A;  2Y0M A;  3M07 A;  3I59 B;  2YUS A;  4Z2Y A;  1OMI A;  4AIJ A;  2M30 A;  2F4O B;  4G7H F;  2RQQ A;  3I54 A;  3HOU J;  2QEN A;  3R6S A;  2O7O A;  4P55 A;  4WXH A;  1ZEL A;  1B8I B;  5DM6 F;  1F5T A;  2RC4 A;  4YFN F;  3KZY A;  3EDP A;  3UR3 C;  3FDY A;  3FXR A;  5F6F A;  5H20 A;  1ZRE A;  2OUM A;  3TOA A;  1Y8R B;  3EUH C;  4IQ4 A;  1MJA A;  2JK3 A;  1ZRD A;  2K5C A;  2CV2 A;  2V1D A;  3V7S A;  2LSO A; 
#chains in the Genus database with same CATH homology
 1FOX A;  1VQ6 I;  4IO9 F;  2H8W A;  1VQN I;  3CCS I;  3G6E I;  1VQL I;  2JQ7 A;  3CCU I;  2ZJP F;  1YJN I;  2NXN B;  3CCQ I;  4IOC F;  5GAE J;  1VQ4 I;  2QA4 I;  1FOY A;  3I55 I;  2E34 A;  2QEX I;  2ZJR F;  5DM7 F;  1VQ9 I;  5GAG J;  5JVG F;  3CCV I;  3CCM I;  2OTJ I;  1S72 I;  3CCJ I;  5DM6 F;  1VQP I;  1YI2 I;  1VQ8 I;  1VQ5 I;  4IOA F;  1YJ9 I;  3CC7 I;  2ZJQ F;  1VQK I;  2E36 A;  2OTL I;  3CC2 I;  1HC8 A;  3G71 I;  3CF5 F;  4UY8 I;  3CC4 I;  3CJT B;  1MMS A;  3CD6 I;  5GAD J;  3CMA I;  3PIP F;  3J7Z I;  3DLL F;  1YIT I;  1VQ7 I;  2K3F A;  3CME I;  1YHQ I;  4V19 K;  1YIJ I;  2E35 A;  5GAH J;  3J7Y J;  3I56 I;  1FOW A;  2FOW A;  1VQO I;  3CCR I;  1VQM I;  3G4S I;  1Y39 A;  1QA6 A;  3CCE I;  1YJW I;  3CCL I;  1ACI A;  3PIO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...