1VQ8I

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq8I00
1VQLI 5GAHJ 3G6EI 3CJTB 1YITI 4IO9F 5DM7F 3CC7I 1FOYA 5JVGF 1VQMI 1FOXA 3PIPF 2ZJRF 1QA6A 3CD6I 1MMSA 4IOCF 3PIOF 2JQ7A 3J7ZI 3G4SI 1VQ4I 3DLLF 2OTJI 2ZJPF 1VQOI 1VQ5I 3G71I 1VQKI 2E36A 3CCUI 5DM6F 5GAGJ 3CF5F 3CCMI 1YJWI 3CCSI 3CCVI 1YIJI 1S72I 1VQ9I 1FOWA 3CC2I 2E35A 3CCRI 3I56I 3CMEI 1VQ7I 2K3FA 1YJNI 2OTLI 2ZJQF 3CCJI 3CCEI 3CMAI 2E34A 2H8WA 2NXNB 4IOAF 1VQ8I 1Y39A 2QEXI 3CCLI 2FOWA 1VQ6I 3CCQI 1VQNI 5GADJ 3I55I 1YHQI 1VQPI 3J7YJ 1ACIA 4UY8I 1HC8A 4V19K 2QA4I 5GAEJ 1YI2I 3CC4I 1YJ9I
chains in the Genus database with same CATH superfamily
3LMMA 5DTDA 2Q0OA 2BW3A 2BVMA 4M74A 1QQIA 2VJ5A 5DYMA 5AIQA 3DQVC 2F4OB 3FKJA 1JGSA 2MLKA 2GOMA 2G0EA 5HLGA 1DPRA 2RC4A 2L3DA 3IV5A 2O5RA 4XLNF 1RR7A 3N97A 1W4MA 3ASOH 4HA8A 4MLOA 4XSZF 2XAUA 2F2EA 2HYGD 2EINH 4BQNA 1MBJA 4IRHA 3NWTA 1P7JA 2V7FA 2IGNA 5FKLA 3ZMUA 5HNFA 3BJ6A 1LEAA 4I0BA 2DJIA 3DFGA 4M6VA 1Z0XA 5IPAA 4IVNA 4B09A 2YPRA 1B8IB 2IS4A 1HDDC 3QQAA 2FQ4A 4NUBA 3LSMA 1VQKI 2ZCWA 1IXCA 2ELKA 2DT7B 4KUMA 1KU7A 3S14J 3E6DA 1YLFA 2CWEA 2XUBA 3OIPA 3IRRA 2DMNA 4A3JJ 3CCSI 4ZZLA 4GXOA 4IL6C 2Z9OA 3CDHA 2LBFB 3HRTA 3DPTA 4KIBA 3TMOA 1LE8A 2WA0A 2XGXA 4QPQA 4F92B 5IYBJ 4BQOA 2NS0A 3HEFA 3GCMA 2EZHA 2L7ZA 3BWGA 3W6KB 1E3OC 4Y17A 2B9SA 2ID6A 2VLAA 3KETA 4LLNA 2LC2A 3C18A 5EZGA 5F1RA 1TQIA 5K7HA 3N4MA 1R4MB 1X1CA 3OWTA 4NQWB 3VDXA 2R7UA 3EYIA 1O7FA 2V6CA 1HQCA 2LFBA 1IDZA 3WHBA 4ZYDA 2E5NA 5ICCA 1QVTA 3PFIA 3CMYA 4EEFG 4CO8A 3F8NA 3H36A 4DW6A 1IN4A 3OYMA 3DCFA 3I4PA 2W7NA 3S2HJ 4C30A 4L18B 2M7AA 3DTIA 2NNYA 2ZBKA 3MKWB 2EV5A 2XGCA 1G6NA 1XSVA 5FLXK 4YFNF 3SQNA 3M1CA 4W97A 2ZXWH 3GWZA 4H4KC 2O8XA 3NQOA 2W4SA 2UXXA 1OLTA 3OS1A 2XAFA 5DS9A 3IH2A 2Q2EA 4QIWN 1LUJB 5D6EA 5GP9A 3SJMA 4BJ5C 3BLYA 4L0YB 3HOSA 2GM4A 3E5QA 3OYGA 1HBXG 2X6XA 3KYLA 4RGUA 4WXCA 1U3EM 2D45A 2HVRA 2A5YB 1XSDA 5HOOA 4RB0A 3ECOA 4RMNA 4LITA 2H1KA 2JA5J 1J2XA 4LB6B 2QUFA 2O0YA 4N9IA 2NVTJ 2G7HA 2R92J 3OIQA 1FEXA 3OYKA 4FE4A 3T8RA 3VWBA 2PLYA 5CYVA 3K1PA 1P92A 5BS6A 3OS0A 4FQGA 2QCOA 2LF7A 4BHBA 1XS9A 4HNTA 2XAJA 2BYVE 3OL4A 1IG7A 1OR7A 2A6HF 3GZNB 5M3FJ 4MTEA 3S1NJ 3HOZJ 4IRGA 2P0WA 2NRAC 5C4JJ 3HGYA 3Q9VA 1TP4A 3V8LA 5M3MJ 2BY2A 3VOEA 3EUHA 5D8KB 4CZCA 3AG4H 2HKOA 3BR2A 1O3RA 2BZTA 2HQRA 3OR1C 3ZQHA 1F5TA 4RB1A 2GIVA 2VQLA 3TQNA 3KX2A 3HTUA 3L2WA 1Y56A 1AA7A 4RBOA 5FKMA 2HXIA 4A5NA 2DMQA 2PX9A 2YUSA 2E5ZA 2COBA 1F43A 4RAGA 2DN0A 3ZCOA 1GLNA 4ABZA 2AXTC 4UXNA 4RAZA 3I9V2 1X1BA 1Y39A 4FISA 4DIQA 1SFXA 1ZTRA 2MC3A 3CCQI 2ID3A 3ZMVA 1TWHJ 4Y33A 5F1JA 3GW2A 2BHYA 4XICA 4OMZA 3K0LA 3OYIA 2GAUA 2KRHA 3BY6A 1JJ6C 3BTIA 2ME0A 4CCLA 1MMAA 4IKFA 1ERDA 4XRFA 2NVYJ 3CDLA 2COMA 4A5MA 1GT0C 1JI8A 1MW7A 3N05A 1IN6A 2LSOA 4A0ZA 5EDNA 4ZZDA 2OC6A 3SDGA 5J40A 3TDZC 3HGGA 4LG0B 4XLAA 2FEZA 3HB9A 3WTXC 2DW4A 5F0HA 2W57A 2MBFA 1FWZA 3OOUA 2M34A 2VKVA 3LSIA 3CP8A 1P9QC 4B8XA 2DBBA 4DJAA 3S3OA 1D1CA 3OSGA 1G3SA 1YITI 4KIGA 5TJJA 1JTYA 4EATA 5KHDA 3OYLA 3T5XA 1BW6A 4IXAA 4CYDA 4P1WA 2E2IJ 4D0PA 2RNJA 4BYYA 4AYBA 1I3AA 3F8FA 3DV8A 1B1BA 3L2UA 2H8RA 3NWSA 2JN6A 4LK0F 3RYPA 3HJEA 1DUXC 1FSHA 1X3ZB 1ZGJA 1FMWA 2HOTA 1LKXA 3M4OJ 2ZKZA 4E7ZA 3CTAA 2W48A 2CH0A 2PMZA 3HUGB 4M3BA 3CF2A 4PJMA 5J8CA 2DOEA 3SZTA 2FMLA 1OR7C 1QHHD 4YG2F 1FPQA 3PNVA 4B1RA 2WAQN 1HSJA 2LY2A 3TOAA 4KN7X 3EUHC 3PSIA 3HPHA 2H6BA 2OBPA 1VFCA 1ZRDA 4RM3A 5CKTA 2JVGA 1OYYA 4ZTJA 3GTQJ 3BG3A 3I58A 4OAZA 2VUMJ 2UZKA 2KIQA 3DBHB 4G6QA 3T1BA 1BIAA 1A36A 5FGMA 3OYEA 2FMYA 1ZQ3P 3PNYA 3JTGA 3K4NA 3Q3SA 2MYSA 5KNLA 2BW3B 2K5CA 2ECBA 2WB1A 3E6MA 4CZZA 4HW0A 1H89C 2M2EA 4MGRA 1ZKGA 3WTTC 5E3LA 3ABMH 4I98B 3FXMA 4CSWA 2L2OA 4CCJA 2EILH 3ELKA 2R93J 5D8LB 2ETHA 2F5FA 2MH9A 5H2FC 1W36C 1VQNI 2JA6J 1D0YA 1XGNA 2L02A 2JRMA 3GZ5A 5FD5A 5E1ZB 2X85A 4JOMA 2WWYA 2LD5A 1XB4A 3OS2A 4IHVA 5B3SH 1TNTA 3WE2A 1IZ1A 5LBQA 1UG0A 5LGTA 1SMTA 1K61A 3Q0UA 1YHQI 4D5FA 4BU2A 4YELA 5E3MA 1W36D 4Z2YA 1DP7P 1C0WA 2HEOA 3CZ6A 4E7IA 3FDYA 2M87A 2LKPA 2OAZA 3GO5A 4D5CA 3K1MA 2P5KA 2W25A 4KA4A 1PP7U 1B72B 4IEJA 1VQLI 4XBFA 5F6FA 3OL3A 5GPCA 1XG1A 2E7WA 5FFZA 4X0GA 3WHCA 2N8GA 2Y30A 1G2HA 1XGMA 4HF0A 3K4JA 2R7DA 1QGPA 4IO9F 2LOOA 3FISA 5CLSA 2KQRA 1IV8A 1TWAJ 1U5TA 4BAYA 4D1QA 1PVEA 2HS5A 4WF2A 2CUJA 4G7HF 3MAJA 2V9VA 4AIJA 2E1MC 3DPUA 1A31A 1OCTC 2AQEA 3MQ0A 1OYWA 3KIOA 1R1VA 2IS2A 3F22A 1WKMA 2BXZA 1PYVA 4LOCA 3MMYB 4DZJA 1R58A 5LHIA 4WCGA 2B63J 3G71I 3KZIC 4M9SA 3GFMA 4RGRA 4BE1A 5D4SA 2AO9A 2EIKH 1MMNA 4E7SA 2OZ6A 2CV1A 1I6XA 4L5EA 3HKZN 2AXLA 3HOWJ 4YIRX 3CUOA 2CRGA 3QOPA 4YIFA 3OOPA 3CCVI 1IN7A 1YIJI 2IBDA 1POGA 4BEHB 1T95A 4ESFA 2MD0A 2PN6A 2FJ1A 2UV1A 3FXUA 1GHCA 4XRSA 2K7LA 1MJ9A 1UELB 3MD2A 5E8IA 1DPUA 1HKTA 4CH7A 1BW5A 2Q2EB 3OYFA 3U21A 1X3WB 4PDKA 3ABTA 1J0RA 3IKVA 5B1AH 2FA5A 1ZR4A 2F5DA 5IT9Z 1ZREA 2H8WA 1NG6A 4M73A 4CUGA 4XKVA 2HFHA 4P55A 5GTHC 1F4KA 1VQ6I 2CMPA 3C2HA 4JX6A 3I0TA 2M4GA 1W5SA 1MKMA 2A3SA 1J5YA 5FO5A 5HDKA 5ICGA 2QZ8A 1RETA 2LREA 5KAIC 1E2XA 4A6DA 3M8EA 1L0OC 1WI3A 4IHWA 1BR4A 1X1DA 1LNWA 3P5JA 4ZTFA 4PJLA 2KJCA 2RN7A 5C3EJ 5BMZA 3ISPA 3K2ZA 4Y3OA 1LQ1A 4UY8I 4AIKA 2XF7A 2XSDC 3H1CA 1K4TA 2EZIA 3U1DA 3CC4I 1WRJA 4ZDPA 4L5IA 3C7JA 5BPDA 1O4XA 2ZXHA 3QYEA 3HKZA 4XRSG 2K27A 4ZJZA 5F64A 2V79A 1H9GA 1MH3A 2JMWA 2PG4A 2NVUB 1CQTA 4PGGA 1IF1A 2X51A 3DEUA 4A3EJ 3GUDA 1NTCA 3E97A 4HV6A 4HX8A 2HGCA 2XAGA 1U5TC 3AG2H 2EIMH 2GQQA 2IGOA 1SAUA 1Y8QB 3G1LA 2A61A 2L9RA 3KP5A 3ZQGA 4J19A 1T2KA 4IHYA 4FETA 5ED4A 2L7FP 3I53A 4H0EA 1FJLA 5EZHA 2KRCA 3QYBA 2RKHA 3Q5FA 4BHCA 3LFKA 4M71A 2B0LA 1RC9A 5IT9K 3S2DJ 1SFEA 3A01A 1XDUA 3HSRA 3M07A 1T56A 5B1BH 1E3PA 1S29A 1BI2A 2DMTA 2R3SA 4XK4A 2VT3A 3IP4B 2R7QA 4NC8A 2VN2A 2XDVA 3H92A 3R61A 1QZZA 2OA4A 4QPOA 2GXGA 1BI0A 1MSEC 2UXNA 4G8XA 2DA1A 1SAXA 3LA3A 4A3KJ 4R79A 2Y9YA 1MNDA 3MWMA 1VQ9I 3NEUA 1GXQA 2DA5A 1BBYA 2K85A 3D5RC 3KP2A 1Z7UA 1N75A 5JR3A 3OMYA 4CCKA 1MDMA 1ZLKA 3PL8A 1UHSA 3RQIA 3RKYA 5A2QK 3PUFA 2FBKA 3DF8A 3LWFA 4XONA 5D5UB 3L09A 4M6XA 1JT0A 1JT6A 3VYSB 2ADUA 3BPVA 2XF6A 3LA7A 4GYIA 1PUEE 2OD5A 2E34A 3GVAA 2NXNB 1YYVA 1GDTA 2FX0A 3GLXA 3L1PA 2V1UA 5CPRB 4HPQA 3U9GA 3HSEA 5AIPA 3VFZA 3IRQA 5M5WJ 5D5VB 2CSOA 1I1SA 3DWLE 2E1MB 3QPTA 1MBKA 3WGIA 5BNGA 4EJOA 2XPWA 1MBHA 4MFDA 3OYBA 1WWXA 1PUFA 1SMYF 3I55I 1KA8A 1B6AA 1IRZA 1QVUA 1HSTA 1ZGAA 3LAJA 1HOMA 5K7FA 3K4LA 3PJRA 1U9OA 4P9UA 2DMUA 1ACIA 2MW8A 4JYKA 3DU5A 3SEQA 5TRDA 4X6AJ 1KZHA 3KZZA 1IC8A 4L5JA 1Y1VJ 3RKXA 1LB2A 1BI1A 2EWNA 1J75A 1HA8A 2XB5A 1P4AA 5JFRA 4WWCA 2EK5A 3P7NA 4N9HA 2CQKA 3HRMA 2UWMA 1KQ9A 3OYNA 3ZRGA 3DBLB 4HF1A 4EGZA 1MMGA 4NC7A 1EV7A 2DPDA 4W1UA 1D0ZA 1ETWA 3ZMDA 4ENNA 5LLQA 4HDVA 1EJ9A 4G94A 1WH5A 3U2RA 2O8KA 4GO1A 3CUQA 5E8GA 3G4SI 4F55A 1GVJA 3ZMTA 1WI9A 1U9NA 2IP2A 1F1ZA 4UB6C 1IN8A 1YG2A 2NS8A 5L3EA 4PUSA 4KMUX 4PGHA 2E2HJ 1S3JA 4JQFA 2ESHA 1A35A 2DTRA 4GFBA 1AKHA 1ETQA 2EFNA 1WFXA 1MJAA 3O3KA 2MH2A 2BXYA 4PCQA 4U87A 4HLYA 1Y1WJ 4QLCU 5DM6F 5BQTA 4B3AA 3OY9A 2IA2A 5DUIA 3FF5A 1R5GA 3I71A 3H0GJ 4E70A 2MA3A 3HRSA 2KFDA 2BVLA 1MJBA 2ZFWA 1USSA 4UNOA 1TL8A 2C6YA 5HDGA 4EM1A 4AUXA 4XMYA 5HLIA 3VEPA 2JVHA 4NNJA 3TBIA 3F8BA 3HM5A 4ENJA 1XN7A 4A3CJ 1XD7A 4BBSJ 2DA6A 3CCJI 3CCEI 2QYOA 5EG0A 1SD6A 3KYDB 3GTMJ 3PO3J 5IOZA 1YRNA 2DJNA 5H20A 4KT6A 2LDUA 4Q47A 1YTYA 1MH4A 4IOAF 1TW2A 3OV8A 5HODA 3HOUJ 2KIMA 4ASNA 3AKZA 2MC4A 3UKGA 2K9MA 5GTIC 5J1UA 5FKKA 1Q1VA 4HF2A 2X6WA 1IUFA 1BN5A 5FB2A 4RGXA 5BPIA 2L4AA 3ZOBA 3K6GA 1LJ9A 1D0XA 2BGCA 1EH7A 2D5VA 5C4XJ 4BE0A 2W85A 2HPIA 4CA0A 3J7YJ 2BOLA 4RLFA 1S9HA 4V19K 1V3FA 5J4YA 1A6QA 1YX3A 3WGHA 2VOPA 4OINF 5GAEJ 3ABUA 3VODA 4XQFA 3LSJA 1K4SA 4A3DJ 1BR2A 1OFCX 5KAFC 2KKOA 3JRHA 3GFIA 1BA5A 2WY8Q 3W3CA 2R7OA 1TWCJ 2HDDA 1FTTA 2DT6A 1U2WA 2I10A 2ZMEA 1Z6TA 3RSNA 1K6OA 4S0HB 4EJUA 1Y0NA 3ERMA 2VBZA 3PIPF 1MNEA 1BC7C 4RB3C 1I6HJ 5HNHA 4KNYA 3FHZA 1JTXA 3FM3A 2WTEA 1TWGJ 1DU0A 1WJCA 1Z6RA 1G3TA 3HRUA 3PIOF 3RKQA 2HOEA 2M30A 2RAEA 4EV0A 2JQ7A 1YE9A 3J7ZI 4E7LA 3CUQC 3ZN0A 4IZZA 4E7JA 5HLHA 2LTPA 2QWWA 4P96A 4DNCA 3M8JA 2K4JA 1RZ4A 3TW7A 1TT0A 3ZQCA 3DP7A 4FHTA 1ZARA 4P5OA 2VKHA 4GGGA 4HZFA 4PFPA 4EJTA 4N4OB 2VQGA 2FOKA 5GAGJ 1YFHA 1FC3A 2XC7A 2P5LC 2Y0SN 1HKSA 1UB9A 1JHFA 2OUMA 3DLAA 2VQCA 1OKRA 3GFLA 2TRTA 3TL4X 4UUSB 1HW1A 3E5XA 2FBIA 2M5WA 4A3MJ 2H09A 4EMSA 3FMSA 4B43A 3WTSC 4JBAA 4ENMA 1UHMA 4AM3A 4U7DA 3HXLA 4G12A 3BC8A 1KYZA 1D3YA 2M8GX 5D6FA 4MEXF 1FIAA 3PNTA 5F0CA 4A2UA 3FXQA 1Y6IA 3TO6A 1FY7A 3VB2A 1M1EB 2CJJA 3G73A 2K4BA 1BI3A 5HLTA 3K7AJ 2QEXI 1QPIA 1QO0D 1XGOA 1W5CC 2DXIA 1R22A 1XDSA 3EUAA 3K9TA 4O6JA 4HG2A 2OV7A 3ROUA 5J1YA 4Q5SF 3L2QA 4IHSA 3BP8A 2X4HA 4BQQA 5D5WB 1FOKA 4GRIA 3I64A 1EKEA 1QRYA 3A01B 1KGSA 2R7SA 4LFUA 2IAIA 3KYCB 2BV6A 1QHGA 3E0JB 4RS8A 2M9HA 5HS9A 4I09A 3P9CA 2R5ZA 4LLGF 4C3JJ 1QZEA 1J09A 2LRDA 1MZBA 2VQHA 2V1DA 1E3HA 1JUPA 3QOEA 2PBIA 5EGOB 2CQ7A 4MQVA 4JK1X 2VBYA 4PJ0C 3TW6A 3J7AO 2O7OA 2O61A 2LP0A 3GMEA 3K2AA 3JTHA 1X3UA 3HIFA 2ZMEC 2ECCA 3JSPA 1FOYA 2KIUA 3IH4A 1Y0UA 4I02A 1R71A 3GBGA 2P8TA 2EZKA 2CG4A 3LAPA 2QSGX 1MDMB 1WSUA 2FRHA 2YS9A 5EJCA 4M9ZA 1B4AA 2HPMA 1T0FA 4PZJA 3C2GA 1UFMA 2PFBA 1GV2A 2WC2A 4EQQA 2ZXIA 3SZPA 3SFZA 1VQ4I 4A3FJ 1WJEA 2DAOA 4E6KG 3RIRA 2NAZA 3S93A 3D5SC 3WGGA 3LQRA 4F91B 4XKWA 2PQ8A 2X0LA 2NS7A 2D1HA 1MBFA 1ODDA 3NRVA 1W7PA 2KP6A 4MFEA 5ERIA 2K3PA 4E7HA 9ANTA 3BQZA 1TT5B 4UHTA 3BPXA 2P6TA 3IWFA 4OMYA 4GDFA 4WXHA 1HCRA 2Z1DA 3F8MA 3J80Z 3AFHA 3EDPA 1YJWI 2H6CA 3BTLA 1ZN2A 1H8AC 4OIQF 3ZQFA 1YW9A 3R60A 1ETOA 1I39A 3BJAA 3CDIA 3J81Z 2HYJA 4UVCA 5D4RA 3CMEI 4NHJA 3WODF 2PJRB 1ON2A 4BHPA 2LVSA 2QLZA 1FYKA 2RREA 2VXZA 1FZPB 1MD0A 3QAHA 1GUUA 1JUSA 1TLHB 2Y48A 4OWRB 4OIOF 2F4MB 2WBMA 4G9YA 2VJ4A 3HC7A 1TTYA 3O6BB 1HXDA 2KRFA 2QM3A 5ICFA 2FOWA 5IYDJ 2IRFG 2NOGA 4FX4A 1L3LA 5H6QA 5K5OA 2OCEA 5F08A 2OCCH 4N0BA 2CS3A 1P7IA 3KFWX 1F36A 2JSCA 2A05A 3VYUB 2MGQA 5LEKA 1W0TA 3CUQB 5ILSA 4L9NA 3TKYA 2IW5A 1G8XA 2CQQA 3F6VA 3OYCA 2XRLA 4XLEA 5IY5H 2ZNZA 1CF7A 4IHTA 3D5LA 2VIXA 3UR3C 5FLVA 1TNSA 4PSWA 1HLVA 1STZA 3IWZA 5TISC 2EV0A 2R5YA 2CFXA 3S3MA 2MFZA 1OMIA 3WTWC 2M1BA 3H35A 5EEAA 4NB5A 5JHUA 4HOBA 4R1HA 1FP2A 1V4RA 3CLOA 4IX7A 2KJBA 1UG2A 2DQRA 3J81K 1VQMI 2Z5UA 5LRRA 2LG4A 3BG5A 4ZYAA 2HXOA 2EH3A 3MCZA 3EYYA 1XMAA 3BTJA 4OIPF 1AU7A 4Q48A 1QBJA 2W24A 4AWXB 1BM9A 1T0FC 4KYWA 3LNQA 3PFYA 5FLMJ 3G1MA 2OTJI 4P9FA 2JPCA 1V5GA 3FWEA 1YRNB 4WXDA 4A3IJ 3DBRB 2WAQA 3GLLA 5E1WA 2J5OA 5DDGA 2HOSA 1HF0A 1KU2A 1Z05A 2IT0A 2I8DA 5J8FA 3V4GA 3K4CA 3WU1B 5EEHA 4DYCA 4HDUA 1LE8B 2E2JJ 2YX4A 4NC6A 2QENA 5ICEA 3BZCA 2KISA 3JR9A 2FUG2 2BEOA 2VC0A 1ZRCA 4HX7A 1P4XA 5JI6A 4LLLA 3E6BA 5L3GA 1N77A 2XF5A 1SANA 1W7PD 2X1DA 3KLNA 2JTVA 3ASNH 2VE9A 1TZLA 2A69F 2FBHA 2QVOA 2ZB9A 4UVBA 1DP3A 3PM1A 3BG7A 3BR6A 3DEWA 1KQ8A 4XR6A 5F04A 3HOVJ 2E1NA 3V7SA 4DOZA 5FJ8J 2LBFA 1W5TA 4V2GA 5HVQC 3FXJA 2LNBA 2OF7A 3ULQB 3UNGC 1HKQA 2XPUA 1G4DA 3O8GA 3GTPJ 4UUTA 3B73A 3F21A 4AIDA 1N25A 2HZDA 4MO7A 1ZH5A 4I6ZA 3A2KA 2K86A 5DEQA 3CO7C 4XKCA 1WJAA 2VXDA 3KCCA 2DYRH 3DEEA 1SD7A 5EYRA 1HW2A 4HQMA 2TDXA 4ZDLA 4C9YA 2VE8A 3V8KA 3WU0A 3RYRA 4BXFA 3L7WA 5KVRA 2ACJA 3CCYA 2HYFA 4HBLA 3BDDA 2EB7A 2QKMB 5LEJA 5J6XA 3G2BA 4RB2C 3EPZA 2GZWA 1I27A 4BDYA 2ESNA 2GBYA 2KMUA 2QQAA 2QQBA 3BCAA 4YFXF 1V5EA 3JRBA 3RTRA 3MKYB 3L9FA 3A0BC 3RPUA 2IA0A 1LDDA 3GXOA 4M6YA 4J01A 3T0YA 1K78A 1IV6A 1D5YA 1FBQA 2R7WA 3HHHA 1P4WA 1SD4A 2ZFUA 1JKPC 1ZELA 1LFBA 2UUZA 1ZYRF 4M3EA 2DK8A 4PJJA 5K5RA 1ZG1A 5DM7F 4U7BA 2YSRA 4XLCA 2QQ9A 2ZJ2A 2DQLA 1OCPA 1ZRFA 2XAHA 2HI3A 4XKBA 2FSWA 2KDOA 1WGXA 1SD5A 3RI4A 1R1TA 4B47A 5E79C 4XLFA 3PQJA 4EJWA 2E60A 3TGNA 2ZJPF 5IYCJ 4I2OA 1VQOI 1G3WA 4CHUA 2H27A 2HOAA 3HHGA 4U88A 4C3IJ 2W1OA 1ULYA 4U0WA 3GTLJ 1XPXA 2XASA 3MN2A 1K79A 1UJ8A 5L3DA 4HLXA 3V8JA 4Y52J 1V54H 2M0MA 2WY7Q 2ISYA 2LY1A 4RGSA 5D5XB 5ILVA 3CC2I 1S6LA 3MEXA 1LFUP 3IKTA 1OCRH 3DKWA 5IT3A 3AAFA 2IXSA 1E17A 1Z3YA 1BOAA 1JHHA 1S7AA 4G6DA 5DCMA 1YJNI 2JJ7A 4A3BJ 2R5ZB 1QU3A 5C44J 2EFOA 3IAS2 2QKLB 4PJNA 1HW5A 2F5EA 1TWFJ 2V4JC 2XVCA 2KZGA 1X2MA 1IW7F 1R4NB 2MLGA 3R4KA 5CVJA 3HOTA 4FTHA 3WTZA 3DKYA 2VOOA 2CW8A 3RQ4A 4IPAA 3JAMZ 3S8PA 3SHFA 1MIJA 4X1EA 1WVRA 2I5UA 1ETYA 1QPMA 4CYCA 2RQPA 3CCLI 2EFWA 1FX7A 2O9LA 2XB0X 3GYHX 1R00A 3COAC 3S15J 2HKXA 3ML6A 1TQPA 2JA8J 2LYCA 1OYIA 4XNFA 1MNMC 1RKWA 5FKOA 3GX4X 3F23A 3F0CA 1Z9CA 3CJQB 2KIFA 1X4PA 2CUEA 2E71A 1I1GA 3MVPA 2NVQJ 1YQAA 5IP7J 3BROA 3T8TA 1BL0A 2F48A 2HQNA 1FBUA 1W7PB 3K10A 4O3MA 2VI6A 4ESJA 1R6RA 4LB5A 3H5RA 1D1AA 4HAMA 3J7AY 2DFEA 1JUMA 3AL0C 1O3QA 4LG0A 1EA3A 4D9JA 2PI0A 5CQEA 1FSEA 1T39A 3CQZJ 3RPUD 2BY1A 3JRGA 1ITYA 4XOPA 2NNNA 2DA7A 3M1EA 3CP2A 4E7KA 2F5VA 3K70C 2WAFA 2JT1A 4EM2A 3IC7A 4D7MA 1MMSA 4M3GA 2IGKA 3BTCA 2B7EA 1WH7A 2XRNA 1UHWA 2ZSIB 3FBNB 3IH3A 3W2WA 1K6YA 2EFPA 4YEJA 3DLLF 3HTSB 2FXAA 3W2AA 3JAMK 4TV7A 3KP4A 3BR0A 3AG1H 3K70D 2BY0A 4HQEA 4ON0A 4OOIA 1W0UA 2K9NA 3KZYA 1JKRC 3BG6A 3FIWA 3A0HC 4CCMA 3WTVC 2E36A 1PP8F 3EQLF 2JZYA 5HS8A 2HTJA 2IS6A 3BZKA 5J3LA 3ECHA 3ZP5A 1T6SA 3QWLA 2P7VB 2LY9A 1Z91A 1SVLA 3TEDA 1ZAOA 4FASD 5IP6A 1S72I 1JE8A 2EQRA 2KPMA 2HVSA 2CFOA 2JA2A 3S2WA 1R1UA 5FKNA 1RKTA 1WJBA 1VQ7I 2GXBA 3MFKA 5DUKA 1ETKA 4BJ6C 2F6CA 3OR2C 2QBYA 2KT0A 1TQMA 1CF7B 3SFIA 3HBLA 4JP0A 4CXFA 1IN5A 1GV5A 2DODA 2FD5A 1R5ID 3LSPA 3EETA 3L2RA 2VKDA 2XGEA 4JX5A 4BBRJ 4DQ2A 4KMFA 1Y8RB 2V26A 2F4IA 2R5YB 1VTNC 1FYLA 2DT5A 2VBXA 3KLOA 1G59A 2DFIA 1BJAA 3E3VA 4B3XA 3DXJF 3L2VA 2GIZA 1Z7LA 3TO9A 1K83J 1NG7A 3QU6A 4WX9A 3SYTA 3KEQA 3DTEA 2HNHA 3PSFA 5EEGA 1XGSA 3LQQA 1F9NA 4DBRA 1BOBA 1OPCA 1UAAA 1TBXA 3JRFA 3S3NA 3TP0A 3S1MJ 1XSXA 2R7FA 1A6IA 3MZYA 4RA2A 3GEZA 4RM2A 4XL9A 5HDNA 3JRIA 2MG4A 4AVZA 2AHQA 2L9NA 4ZYHA 2JUCA 3M7GA 1YI2I 3F6OA 4GYGA 3MKZA 5FLXZ 2JA7J 3FHNA 3CESA 3L00A 1U8BA 4JX4A 1U5TB 4Z6YA 4G6TB 2NOJB 2R0QC 1MBEA 1ETXA 3SDBA 2AQFA 4CICA 1Z3XA 3CJTB 3FK7A 3LSHA 3U1KA 4BJTA 5JLWA 1IJWC 2RGVA 4C3HJ 3OYDA 1B72A 4KN4X 3BR3A 4NBQA 1YS7A 3O2PE 2CV2A 1T98A 3ABLH 2VJJA 5CQGA 4XIDA 4DYQA 2L5QA 1S7EA 2KLOA 3IUOA 1ZK8A 4AIHA 3VSKA 4G7OF 4IOCF 1RI7A 3C1DA 1IXSB 4A3LJ 3I54A 2IEKA 2L4MA 2ZSHB 3H5AA 3QYFA 4XSXF 2V9PA 3HYIA 4EM0B 3WTUC 4BY1J 2RQQA 2Y31A 4ETSA 1QNTA 1S7OA 1ON1A 4CCNA 1RR8C 3FXRA 3BR5A 2CGPA 1NH3A 5ILUA 3E5UA 3IHUA 2M8EA 2O3FA 5B5EC 3VPRA 2MD5A 3WU2C 3CCUI 5LD2C 1Q1HA 1XMKA 2M4KA 4IQJA 1XX5A 3CCMI 1EH8A 3E1SA 4ZYGA 2DA3A 2RDPA 5GPAA 3F8CA 1SVMA 4YRVA 2LF8A 4BNCA 2PMUA 3CCRI 3E7LA 1XCVA 5E18F 1E0EA 1ZGWA 1LFPA 1SVOA 2R7XA 2K3FA 3QPSA 4BEHA 1WQ2A 3G1OA 4WK8F 2ZJQF 4EGYA 3KP6A 3A4CA 3HDDA 1K78B 1D1BA 2A5WA 3FMRA 3CMAI 1YO5C 3AL0B 3JRDA 4O5VA 1AHDP 4G7ZF 3H3UA 4ZDOA 5FROA 1BR1A 2V6EA 4A6EA 4AVPA 3PUBA 2QGUA 3GTGJ 4KT5C 1ZHFA 4UV8A 3H5NA 5K5QA 2Z2SB 3PO2J 3ABKH 3LA2A 4II3A 3HOXJ 3QRFF 2K02A 2EJRA 3KPHA 4PSXA 5F27A 3WE3A 1V5FA 3OYAA 3W2VA 1IGNA 2P81A 2VB6A 2R4GA 4HX4A 3P9KA 3BG9A 1JKQC 2BBYA 3V7RA 5IP9J 4F3QA 1VQPI 2NYXA 2QQ8A 1X1AA 1DQUA 3TOBA 2ELHA 3FMQA 1LPQA 1HDPA 2L9SA 3K69A 2QA4I 1ETVA 2VC1A 2PMHA 3A1YA 3DU6A 1J7KA 4BGDA 2VPRA 3JCUC 4A3GJ 2L01A 2DI3A 3I5UA 3OYJA 2R7RA 2CW0F 4QTRA 1K7AA 3F9KA 3JREA 3BOQA 4BUPA 3B02A 5JVGF 1FOXA 3S17J 2D1VA 2W82A 5FRNA 2CQXA 3FK6A 2QSFX 5DCMB 4KICA 5HS7A 1WJ5A 2X6YA 4A93J 4R8HA 4UV9A 4AYBN 4BY7J 3D0SA 1H9TA 3S1RJ 3ZXSA 1UZCA 3ZGKA 2EPFA 2Y0SA 2Q8KA 4CYCB 1R23A 5J47A 3ESWB 4BACA 2X48A 1NK2P 3FBIB 4DYRA 2DYSH 5LHHA 1WJFA 2FNPA 2PMZN 3KE2A 1DU6A 3HPGA 2WADA 4FCYA 3CJNA 4YIIA 3FX3A 4ZC3A 2GLOA 2DTZA 3JRAA 1YOVB 1MGTA 1J59A 3QPHA 3WTYC 1LEBA 1GVDA 1RUOA 3KEOA 2OU2A 5DD8A 2EV6A 1VF9A 2X6OA 1IDYA 3O8HA 4E4HA 3PQKA 5FFXA 1VNDA 5DD4A 2M45A 3FZVA 2DFHA 3D1NI 1S5LC 1JXSA 4IJAA 2OZUA 4A0YA 1DGWY 3KP7A 4HSRA 2FE3A 4I7HA 1APLC 1P6RA 3W6VA 2WAEA 1T8IA 1LVKA 3BT9A 1PUFB 1OCZH 4M72A 2WB1N 1TW3A 1U6GA 4UB8C 2OJED 2YR2A 4S05A 2L7KA 2FQ3A 3W6JB 3KP3A 4LIVA 2HQ5A 4D7NA 5GADJ 4C2TA 2A68F 4LG3A 2Y69H 3ZQ7A 2L54A 2ZO4A 5K7ZA 2DPUA 2FF4A 3BQYA 2OQRA 1D8JA 1MSFC 2RVCA 3LFUA 4M3FA 3DKXA 3K4MA 4AU7A 1Z21A 4LGWA 1U8RA 2DO7A 1HC8A 3CLQA 1Z77A 1FIPA 1WCMJ 1TC3C 3HSFA 2PEXA 3Q0VA 4Y7NJ 4XN3A 1UMQA 4OU0A 4ITVA 2KZVA 5GAHJ 5L3FA 1ZLJA 2E7XA 4I01A 4II2A 2Z33A 4C2MJ 1ONVA 4HV5A 1I50J 5KCMA 4I0AA 2A07F 1JJ8C 3F3XA 3ZMSA 2CQNA 3DPLC 1RPWA 3BZ6A 2A6TA 3TDUC 1G3YA 4MNUA 1IRXA 5K1YA 2M3AA 2LKSA 5CJ9A 4K2EA 1D8KA 4RAFA 1J9IA 4RLQA 3RZDJ 1QA6A 2AS5F 3CD6I 5LFAA 2QBYB 3G3ZA 3ZR8X 2EA4A 3I59A 4KISA 2DFFA 5E1XA 1AKHB 2PJPA 2FNAA 5E17F 3OSFA 4DBQA 1DGRM 2D2WA 2VKEA 2E1OA 4L9JA 1R49A 3J80K 4A12A 3ZQLA 2BHZA 2HR3A 3FXOA 5E20A 3MKLA 3MZHA 3E6CC 4J00A 1IRGA 2Q1ZB 4LJZF 4PK4A 1LDKB 4I99C 4XM3A 1S8NA 1YX5A 4A69C 1OCOH 1T38A 2DLLA 1VI0A 1BC8C 2G9WA 4FX0A 4XOTA 3SEZA 2P5VA 1IO2A 1FLIA 3WG9A 2IA1A 2GWRA 1FMVA 3ONQA 2Z3YA 4IF4A 3ZN1A 1X4OA 1FOWA 3AG3H 5M5XJ 3OYHA 3S16J 4Y4RA 4L0ZB 2E35A 4F93B 1ENHA 4Q4ZF 5EG0B 2OQGA 1U78A 4LD5A 2CO5A 3BJOA 3LSRA 3L2CA 4IHXA 1W1WE 2OTLI 3H9QA 2LH9A 4DZPA 3I3LA 4CGZA 2WV1A 2M7BA 1KU9A 1B9MA 4L9TA 1MBGA 2LKXA 2TCTA 3M8FA 1B8IA 3H3VK 3CMMA 2HTSA 5M5YJ 1SC7A 2K9QA 3RCOA 1VQ8I 1IXRC 4ANJA 3HOYJ 2DOFA 3LSGA 1A04A 3JSOA 4Y15A 4BH9A 5CVUA 5LHGA 1H88C 2RNGA 3DTKA 4MQ9F 4GCVA 4RDUA 1CGPA 5TGTA 4C2UA 1FTZA 1KQ0A 1RESA 5F0FA 1FT9A 4CDGA 1FP1D 3WG7H 4B48A 1X1PA 3FXKA 5DCFA 2NVXJ 2Z16A 3CO6C 3R6SA 2XV4S 4XN0A 2G7UA 4OAYA 4M9XA 4BE2A 5IOYA 1JGGA 4MTDA 1EF4A 4U0VA 1Z1DA 3JW4A 1SFKA 3F72A 1WZ2A 4LMYA 3ZPLA 1DDNA 3A02A 2VASA 1PJRA 2A6EF 2ZMEB 2E19A 3Q0WA 4AD9A 1RUNA 3K4KA 3TO7A 2JWTA 4NQWA 3MZ8A 4BDZA 2JK3A 3V42A 4EVIA 2M0CA 4BQAA 1BIBA 5B66C 5E3OA 2IJLA 2K9LA 4ZYEA 1KYWA 2JRTA 2EZLA 2STTA 2BE5F 4B4CA 1B9NA 1KONA 2DOAA 4QSHA 2XROA 2ZJRF 1WHUA 2X1CA 5LGUA 2R7VA 1AOYA 2H94A 1VZ0A 1XC5A 1WPKA 2ZXJA 1X2NA 1ZG3A 3HL2A 2GOXB 2K40A 4UVAA 5L3CA 1VQ5I 2CYYA 1SFOJ 2O6GE 3I4NJ 1O57A 2HVQA 3B6CA 3NARA 1YW7A 3CJRB 4HEA2 3X2QH 2LR8A 2EA2A 3RJPA 2JUGA 5JVTA 4IQ4A 2LK2A 2L7MP 3M3YJ 5JLXA 1YIOA 3LSKA 1AWCA 2X1EA 2VJIA 1IRFA 2H1LA 2DDBA 4YFKF 2HU9A 1YS6A 1T08B 2EBIA 2VPLA 3RZOJ 1OCCH 2MABA 2P7CB 4F52A 1O7LA 2IVMA 2DK5A 3IAM2 2DU9A 1RRJA 3A03A 2LMDA 3TP3A 3I4MJ 5LGNA 1EH6A 1LVAA 2DMPA 2VODA 4UUSA 1Z67A 3LL7A 4UUVA 2CUZA 2Y0MA 4XRMA 1JKOC 1FYMA 2VBWA 2GA1A 4KJZA 3C2BA 2F5CA 4V2FA 5DV5A 3GTJJ 2CV0A 2IGMA 3H9GA 1X19A 2V1XA 2Y2ZA 4S04A 2WV0A 3HG9A 2W84A 2HZTA 2QSHX 1R36A 4MEYF 5A2QZ 4ENKA 2DA4A 1FBSA 1NHAA 4AC0A 4DGWB 1O3SA 5AONA 2W00A 4OIRF 4QWQA 3H0DA 2X9DA 2XAQA 2ZC2A 2DDAA 3H9JA 3VYTB 4XLHA 4FE7A 2J5PA 2DA2A 1REPC 3RKWA 3VSLA 4BKXA 4L9VA 2XIGA 4HSTA 3K1NA 3SZGA 4KITB 4KDPA 2IS1A 3ERED 2XKPA 2DCEA 3B6AA 2MSYA 4MIMA 5H6RA 1USTA 2EIJH 5CVIA 1R5HA 3KEYA 3QPLA 5FD6A 4HNVA 4IRIA 4ZH4F 3GF2A 3M9AA 1ZR2A 5J1RA 1BJZA 4BS9A 3QP5A 2P6SA 3G6EI 3BR1A 1LDJA 2VT2A 1PDNC 3EUKL 1T33A 4N4NB 2GA2A 4XORA 1H0MA 4KFCA 2LLKA 3QP6A 1WJDA 2RV8A 3NAUA 3CC7I 2YX7A 2XSJC 3ZQIA 2XKOA 2JPBA 1ORKA 2JSPA 2HWVA 3RDIA 5E3NA 5EGOA 1IAWA 1N78A 5CVVA 4U0YA 2V9KA 2KL4A 2ISZA 1YW8A 1O3TA 5EF6A 1RIOH 3JRCA 2ICWG 2IPQX 3REOA 3VYRB 1ZG5A 1SEUA 4NDLA 2O03A 1GXPA 5L3BA 6PAXA 1RNLA 2KDZA 2Y9ZA 1I3QJ 3K4BA 2R7ZJ 2HDCA 3Q9SA 2V1NA 4F7ZA 5KK1A 1IUYA 2XGDA 2R7TA 3C3WA 1V55H 3LSTA 5CVRA 3GZ6A 1XTAA 1R7JA 4HRIA 2CUFA 3GTOJ 3CF5F 3IL2A 1R9TJ 3FXLA 4M3DA 4BXXJ 2P4WA 1XMXA 2CW7A 3H3ZA 3R0JA 2EFQA 1OJLA 3QU3A 1MMDA 3I56I 4MHGA 4LIUA 3BCBA 3GTKJ 2VL8A 3GFJA 3FKIJ 1UCRA 1FNNA 5J4VA 2GXAA 2XHKA 4RAYA 1U0JA 3SXYA 2STWA 2VONA 1P2FA 3RPQA 1SFUA 2XPVA 4BXUA 1KU3A 2BY3A 2L9VA 2K9SA 2PJRA 4LK1F 4ESBA 4BL0B 2HDWA 4CCOA 5JHFA 2YU9J 3HUGA 2HQAA 3LOCA 3QODA 4XLPF 2E1CA 1B59A 5BOXA 4I76A 4A0XA 4KIFA 2FU4A 3S32A 1OISA 1QZYA 1X58A 2Y75A 3OIOA 2ZNYA 3P9IA 2YU3A 5LRSA 1NK3P 3R0AA 4PFOA 4B44A 4FT8A 3S1QJ 3I59B 4EJVA 2ELJA 2L0KA 3FM5A 1A5JA 2ME6A 3ZMZA 2Z99A 4HYEA 3V7CA 4Y13A 4HNUA 2QF7A 1OQYA 2KHMA 1I5ZA 2OPTA 2CU7A 3HZJA 3ZQQA 5FRMA 1D5VA 1XCBA 1YJ9I
chains in the Genus database with same CATH topology
1VQLI 5GAHJ 3G6EI 3CJTB 1YITI 4IO9F 5DM7F 3CC7I 1FOYA 5JVGF 1VQMI 1FOXA 3PIPF 2ZJRF 1QA6A 3CD6I 1MMSA 4IOCF 3PIOF 2JQ7A 3J7ZI 3G4SI 1VQ4I 3DLLF 2OTJI 2ZJPF 1VQOI 1VQ5I 3G71I 1VQKI 2E36A 3CCUI 5DM6F 5GAGJ 3CF5F 3CCMI 1YJWI 3CCSI 3CCVI 1YIJI 1S72I 1VQ9I 1FOWA 3CC2I 2E35A 3CCRI 3I56I 3CMEI 1VQ7I 2K3FA 1YJNI 2OTLI 2ZJQF 3CCJI 3CCEI 3CMAI 2E34A 2H8WA 2NXNB 4IOAF 1VQ8I 1Y39A 2QEXI 3CCLI 2FOWA 1VQ6I 3CCQI 1VQNI 5GADJ 3I55I 1YHQI 1VQPI 3J7YJ 1ACIA 4UY8I 1HC8A 4V19K 2QA4I 5GAEJ 1YI2I 3CC4I 1YJ9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL I;  5GAH J;  3G6E I;  3CJT B;  1YIT I;  4IO9 F;  5DM7 F;  3CC7 I;  1FOY A;  5JVG F;  1VQM I;  1FOX A;  3PIP F;  2ZJR F;  1QA6 A;  3CD6 I;  1MMS A;  4IOC F;  3PIO F;  2JQ7 A;  3J7Z I;  3G4S I;  1VQ4 I;  3DLL F;  2OTJ I;  2ZJP F;  1VQO I;  1VQ5 I;  3G71 I;  1VQK I;  2E36 A;  3CCU I;  5DM6 F;  5GAG J;  3CF5 F;  3CCM I;  1YJW I;  3CCS I;  3CCV I;  1YIJ I;  1S72 I;  1VQ9 I;  1FOW A;  3CC2 I;  2E35 A;  3CCR I;  3I56 I;  3CME I;  1VQ7 I;  2K3F A;  1YJN I;  2OTL I;  2ZJQ F;  3CCJ I;  3CCE I;  3CMA I;  2E34 A;  2H8W A;  2NXN B;  4IOA F;  1VQ8 I;  1Y39 A;  2QEX I;  3CCL I;  2FOW A;  1VQ6 I;  3CCQ I;  1VQN I;  5GAD J;  3I55 I;  1YHQ I;  1VQP I;  3J7Y J;  1ACI A;  4UY8 I;  1HC8 A;  4V19 K;  2QA4 I;  5GAE J;  1YI2 I;  3CC4 I;  1YJ9 I; 
#chains in the Genus database with same CATH topology
 3LMM A;  5DTD A;  2Q0O A;  2BW3 A;  2BVM A;  4M74 A;  1QQI A;  2VJ5 A;  5DYM A;  5AIQ A;  3DQV C;  2F4O B;  3FKJ A;  1JGS A;  2MLK A;  2GOM A;  2G0E A;  5HLG A;  1DPR A;  2RC4 A;  2L3D A;  3IV5 A;  2O5R A;  4XLN F;  1RR7 A;  3N97 A;  1W4M A;  3ASO H;  4HA8 A;  4MLO A;  4XSZ F;  2XAU A;  2F2E A;  2HYG D;  2EIN H;  4BQN A;  1MBJ A;  4IRH A;  3NWT A;  1P7J A;  2V7F A;  2IGN A;  5FKL A;  3ZMU A;  5HNF A;  3BJ6 A;  1LEA A;  4I0B A;  2DJI A;  3DFG A;  4M6V A;  1Z0X A;  5IPA A;  4IVN A;  4B09 A;  2YPR A;  1B8I B;  2IS4 A;  1HDD C;  3QQA A;  2FQ4 A;  4NUB A;  3LSM A;  1VQK I;  2ZCW A;  1IXC A;  2ELK A;  2DT7 B;  4KUM A;  1KU7 A;  3S14 J;  3E6D A;  1YLF A;  2CWE A;  2XUB A;  3OIP A;  3IRR A;  2DMN A;  4A3J J;  3CCS I;  4ZZL A;  4GXO A;  4IL6 C;  2Z9O A;  3CDH A;  2LBF B;  3HRT A;  3DPT A;  4KIB A;  3TMO A;  1LE8 A;  2WA0 A;  2XGX A;  4QPQ A;  4F92 B;  5IYB J;  4BQO A;  2NS0 A;  3HEF A;  3GCM A;  2EZH A;  2L7Z A;  3BWG A;  3W6K B;  1E3O C;  4Y17 A;  2B9S A;  2ID6 A;  2VLA A;  3KET A;  4LLN A;  2LC2 A;  3C18 A;  5EZG A;  5F1R A;  1TQI A;  5K7H A;  3N4M A;  1R4M B;  1X1C A;  3OWT A;  4NQW B;  3VDX A;  2R7U A;  3EYI A;  1O7F A;  2V6C A;  1HQC A;  2LFB A;  1IDZ A;  3WHB A;  4ZYD A;  2E5N A;  5ICC A;  1QVT A;  3PFI A;  3CMY A;  4EEF G;  4CO8 A;  3F8N A;  3H36 A;  4DW6 A;  1IN4 A;  3OYM A;  3DCF A;  3I4P A;  2W7N A;  3S2H J;  4C30 A;  4L18 B;  2M7A A;  3DTI A;  2NNY A;  2ZBK A;  3MKW B;  2EV5 A;  2XGC A;  1G6N A;  1XSV A;  5FLX K;  4YFN F;  3SQN A;  3M1C A;  4W97 A;  2ZXW H;  3GWZ A;  4H4K C;  2O8X A;  3NQO A;  2W4S A;  2UXX A;  1OLT A;  3OS1 A;  2XAF A;  5DS9 A;  3IH2 A;  2Q2E A;  4QIW N;  1LUJ B;  5D6E A;  5GP9 A;  3SJM A;  4BJ5 C;  3BLY A;  4L0Y B;  3HOS A;  2GM4 A;  3E5Q A;  3OYG A;  1HBX G;  2X6X A;  3KYL A;  4RGU A;  4WXC A;  1U3E M;  2D45 A;  2HVR A;  2A5Y B;  1XSD A;  5HOO A;  4RB0 A;  3ECO A;  4RMN A;  4LIT A;  2H1K A;  2JA5 J;  1J2X A;  4LB6 B;  2QUF A;  2O0Y A;  4N9I A;  2NVT J;  2G7H A;  2R92 J;  3OIQ A;  1FEX A;  3OYK A;  4FE4 A;  3T8R A;  3VWB A;  2PLY A;  5CYV A;  3K1P A;  1P92 A;  5BS6 A;  3OS0 A;  4FQG A;  2QCO A;  2LF7 A;  4BHB A;  1XS9 A;  4HNT A;  2XAJ A;  2BYV E;  3OL4 A;  1IG7 A;  1OR7 A;  2A6H F;  3GZN B;  5M3F J;  4MTE A;  3S1N J;  3HOZ J;  4IRG A;  2P0W A;  2NRA C;  5C4J J;  3HGY A;  3Q9V A;  1TP4 A;  3V8L A;  5M3M J;  2BY2 A;  3VOE A;  3EUH A;  5D8K B;  4CZC A;  3AG4 H;  2HKO A;  3BR2 A;  1O3R A;  2BZT A;  2HQR A;  3OR1 C;  3ZQH A;  1F5T A;  4RB1 A;  2GIV A;  2VQL A;  3TQN A;  3KX2 A;  3HTU A;  3L2W A;  1Y56 A;  1AA7 A;  4RBO A;  5FKM A;  2HXI A;  4A5N A;  2DMQ A;  2PX9 A;  2YUS A;  2E5Z A;  2COB A;  1F43 A;  4RAG A;  2DN0 A;  3ZCO A;  1GLN A;  4ABZ A;  2AXT C;  4UXN A;  4RAZ A;  3I9V 2;  1X1B A;  1Y39 A;  4FIS A;  4DIQ A;  1SFX A;  1ZTR A;  2MC3 A;  3CCQ I;  2ID3 A;  3ZMV A;  1TWH J;  4Y33 A;  5F1J A;  3GW2 A;  2BHY A;  4XIC A;  4OMZ A;  3K0L A;  3OYI A;  2GAU A;  2KRH A;  3BY6 A;  1JJ6 C;  3BTI A;  2ME0 A;  4CCL A;  1MMA A;  4IKF A;  1ERD A;  4XRF A;  2NVY J;  3CDL A;  2COM A;  4A5M A;  1GT0 C;  1JI8 A;  1MW7 A;  3N05 A;  1IN6 A;  2LSO A;  4A0Z A;  5EDN A;  4ZZD A;  2OC6 A;  3SDG A;  5J40 A;  3TDZ C;  3HGG A;  4LG0 B;  4XLA A;  2FEZ A;  3HB9 A;  3WTX C;  2DW4 A;  5F0H A;  2W57 A;  2MBF A;  1FWZ A;  3OOU A;  2M34 A;  2VKV A;  3LSI A;  3CP8 A;  1P9Q C;  4B8X A;  2DBB A;  4DJA A;  3S3O A;  1D1C A;  3OSG A;  1G3S A;  1YIT I;  4KIG A;  5TJJ A;  1JTY A;  4EAT A;  5KHD A;  3OYL A;  3T5X A;  1BW6 A;  4IXA A;  4CYD A;  4P1W A;  2E2I J;  4D0P A;  2RNJ A;  4BYY A;  4AYB A;  1I3A A;  3F8F A;  3DV8 A;  1B1B A;  3L2U A;  2H8R A;  3NWS A;  2JN6 A;  4LK0 F;  3RYP A;  3HJE A;  1DUX C;  1FSH A;  1X3Z B;  1ZGJ A;  1FMW A;  2HOT A;  1LKX A;  3M4O J;  2ZKZ A;  4E7Z A;  3CTA A;  2W48 A;  2CH0 A;  2PMZ A;  3HUG B;  4M3B A;  3CF2 A;  4PJM A;  5J8C A;  2DOE A;  3SZT A;  2FML A;  1OR7 C;  1QHH D;  4YG2 F;  1FPQ A;  3PNV A;  4B1R A;  2WAQ N;  1HSJ A;  2LY2 A;  3TOA A;  4KN7 X;  3EUH C;  3PSI A;  3HPH A;  2H6B A;  2OBP A;  1VFC A;  1ZRD A;  4RM3 A;  5CKT A;  2JVG A;  1OYY A;  4ZTJ A;  3GTQ J;  3BG3 A;  3I58 A;  4OAZ A;  2VUM J;  2UZK A;  2KIQ A;  3DBH B;  4G6Q A;  3T1B A;  1BIA A;  1A36 A;  5FGM A;  3OYE A;  2FMY A;  1ZQ3 P;  3PNY A;  3JTG A;  3K4N A;  3Q3S A;  2MYS A;  5KNL A;  2BW3 B;  2K5C A;  2ECB A;  2WB1 A;  3E6M A;  4CZZ A;  4HW0 A;  1H89 C;  2M2E A;  4MGR A;  1ZKG A;  3WTT C;  5E3L A;  3ABM H;  4I98 B;  3FXM A;  4CSW A;  2L2O A;  4CCJ A;  2EIL H;  3ELK A;  2R93 J;  5D8L B;  2ETH A;  2F5F A;  2MH9 A;  5H2F C;  1W36 C;  1VQN I;  2JA6 J;  1D0Y A;  1XGN A;  2L02 A;  2JRM A;  3GZ5 A;  5FD5 A;  5E1Z B;  2X85 A;  4JOM A;  2WWY A;  2LD5 A;  1XB4 A;  3OS2 A;  4IHV A;  5B3S H;  1TNT A;  3WE2 A;  1IZ1 A;  5LBQ A;  1UG0 A;  5LGT A;  1SMT A;  1K61 A;  3Q0U A;  1YHQ I;  4D5F A;  4BU2 A;  4YEL A;  5E3M A;  1W36 D;  4Z2Y A;  1DP7 P;  1C0W A;  2HEO A;  3CZ6 A;  4E7I A;  3FDY A;  2M87 A;  2LKP A;  2OAZ A;  3GO5 A;  4D5C A;  3K1M A;  2P5K A;  2W25 A;  4KA4 A;  1PP7 U;  1B72 B;  4IEJ A;  1VQL I;  4XBF A;  5F6F A;  3OL3 A;  5GPC A;  1XG1 A;  2E7W A;  5FFZ A;  4X0G A;  3WHC A;  2N8G A;  2Y30 A;  1G2H A;  1XGM A;  4HF0 A;  3K4J A;  2R7D A;  1QGP A;  4IO9 F;  2LOO A;  3FIS A;  5CLS A;  2KQR A;  1IV8 A;  1TWA J;  1U5T A;  4BAY A;  4D1Q A;  1PVE A;  2HS5 A;  4WF2 A;  2CUJ A;  4G7H F;  3MAJ A;  2V9V A;  4AIJ A;  2E1M C;  3DPU A;  1A31 A;  1OCT C;  2AQE A;  3MQ0 A;  1OYW A;  3KIO A;  1R1V A;  2IS2 A;  3F22 A;  1WKM A;  2BXZ A;  1PYV A;  4LOC A;  3MMY B;  4DZJ A;  1R58 A;  5LHI A;  4WCG A;  2B63 J;  3G71 I;  3KZI C;  4M9S A;  3GFM A;  4RGR A;  4BE1 A;  5D4S A;  2AO9 A;  2EIK H;  1MMN A;  4E7S A;  2OZ6 A;  2CV1 A;  1I6X A;  4L5E A;  3HKZ N;  2AXL A;  3HOW J;  4YIR X;  3CUO A;  2CRG A;  3QOP A;  4YIF A;  3OOP A;  3CCV I;  1IN7 A;  1YIJ I;  2IBD A;  1POG A;  4BEH B;  1T95 A;  4ESF A;  2MD0 A;  2PN6 A;  2FJ1 A;  2UV1 A;  3FXU A;  1GHC A;  4XRS A;  2K7L A;  1MJ9 A;  1UEL B;  3MD2 A;  5E8I A;  1DPU A;  1HKT A;  4CH7 A;  1BW5 A;  2Q2E B;  3OYF A;  3U21 A;  1X3W B;  4PDK A;  3ABT A;  1J0R A;  3IKV A;  5B1A H;  2FA5 A;  1ZR4 A;  2F5D A;  5IT9 Z;  1ZRE A;  2H8W A;  1NG6 A;  4M73 A;  4CUG A;  4XKV A;  2HFH A;  4P55 A;  5GTH C;  1F4K A;  1VQ6 I;  2CMP A;  3C2H A;  4JX6 A;  3I0T A;  2M4G A;  1W5S A;  1MKM A;  2A3S A;  1J5Y A;  5FO5 A;  5HDK A;  5ICG A;  2QZ8 A;  1RET A;  2LRE A;  5KAI C;  1E2X A;  4A6D A;  3M8E A;  1L0O C;  1WI3 A;  4IHW A;  1BR4 A;  1X1D A;  1LNW A;  3P5J A;  4ZTF A;  4PJL A;  2KJC A;  2RN7 A;  5C3E J;  5BMZ A;  3ISP A;  3K2Z A;  4Y3O A;  1LQ1 A;  4UY8 I;  4AIK A;  2XF7 A;  2XSD C;  3H1C A;  1K4T A;  2EZI A;  3U1D A;  3CC4 I;  1WRJ A;  4ZDP A;  4L5I A;  3C7J A;  5BPD A;  1O4X A;  2ZXH A;  3QYE A;  3HKZ A;  4XRS G;  2K27 A;  4ZJZ A;  5F64 A;  2V79 A;  1H9G A;  1MH3 A;  2JMW A;  2PG4 A;  2NVU B;  1CQT A;  4PGG A;  1IF1 A;  2X51 A;  3DEU A;  4A3E J;  3GUD A;  1NTC A;  3E97 A;  4HV6 A;  4HX8 A;  2HGC A;  2XAG A;  1U5T C;  3AG2 H;  2EIM H;  2GQQ A;  2IGO A;  1SAU A;  1Y8Q B;  3G1L A;  2A61 A;  2L9R A;  3KP5 A;  3ZQG A;  4J19 A;  1T2K A;  4IHY A;  4FET A;  5ED4 A;  2L7F P;  3I53 A;  4H0E A;  1FJL A;  5EZH A;  2KRC A;  3QYB A;  2RKH A;  3Q5F A;  4BHC A;  3LFK A;  4M71 A;  2B0L A;  1RC9 A;  5IT9 K;  3S2D J;  1SFE A;  3A01 A;  1XDU A;  3HSR A;  3M07 A;  1T56 A;  5B1B H;  1E3P A;  1S29 A;  1BI2 A;  2DMT A;  2R3S A;  4XK4 A;  2VT3 A;  3IP4 B;  2R7Q A;  4NC8 A;  2VN2 A;  2XDV A;  3H92 A;  3R61 A;  1QZZ A;  2OA4 A;  4QPO A;  2GXG A;  1BI0 A;  1MSE C;  2UXN A;  4G8X A;  2DA1 A;  1SAX A;  3LA3 A;  4A3K J;  4R79 A;  2Y9Y A;  1MND A;  3MWM A;  1VQ9 I;  3NEU A;  1GXQ A;  2DA5 A;  1BBY A;  2K85 A;  3D5R C;  3KP2 A;  1Z7U A;  1N75 A;  5JR3 A;  3OMY A;  4CCK A;  1MDM A;  1ZLK A;  3PL8 A;  1UHS A;  3RQI A;  3RKY A;  5A2Q K;  3PUF A;  2FBK A;  3DF8 A;  3LWF A;  4XON A;  5D5U B;  3L09 A;  4M6X A;  1JT0 A;  1JT6 A;  3VYS B;  2ADU A;  3BPV A;  2XF6 A;  3LA7 A;  4GYI A;  1PUE E;  2OD5 A;  2E34 A;  3GVA A;  2NXN B;  1YYV A;  1GDT A;  2FX0 A;  3GLX A;  3L1P A;  2V1U A;  5CPR B;  4HPQ A;  3U9G A;  3HSE A;  5AIP A;  3VFZ A;  3IRQ A;  5M5W J;  5D5V B;  2CSO A;  1I1S A;  3DWL E;  2E1M B;  3QPT A;  1MBK A;  3WGI A;  5BNG A;  4EJO A;  2XPW A;  1MBH A;  4MFD A;  3OYB A;  1WWX A;  1PUF A;  1SMY F;  3I55 I;  1KA8 A;  1B6A A;  1IRZ A;  1QVU A;  1HST A;  1ZGA A;  3LAJ A;  1HOM A;  5K7F A;  3K4L A;  3PJR A;  1U9O A;  4P9U A;  2DMU A;  1ACI A;  2MW8 A;  4JYK A;  3DU5 A;  3SEQ A;  5TRD A;  4X6A J;  1KZH A;  3KZZ A;  1IC8 A;  4L5J A;  1Y1V J;  3RKX A;  1LB2 A;  1BI1 A;  2EWN A;  1J75 A;  1HA8 A;  2XB5 A;  1P4A A;  5JFR A;  4WWC A;  2EK5 A;  3P7N A;  4N9H A;  2CQK A;  3HRM A;  2UWM A;  1KQ9 A;  3OYN A;  3ZRG A;  3DBL B;  4HF1 A;  4EGZ A;  1MMG A;  4NC7 A;  1EV7 A;  2DPD A;  4W1U A;  1D0Z A;  1ETW A;  3ZMD A;  4ENN A;  5LLQ A;  4HDV A;  1EJ9 A;  4G94 A;  1WH5 A;  3U2R A;  2O8K A;  4GO1 A;  3CUQ A;  5E8G A;  3G4S I;  4F55 A;  1GVJ A;  3ZMT A;  1WI9 A;  1U9N A;  2IP2 A;  1F1Z A;  4UB6 C;  1IN8 A;  1YG2 A;  2NS8 A;  5L3E A;  4PUS A;  4KMU X;  4PGH A;  2E2H J;  1S3J A;  4JQF A;  2ESH A;  1A35 A;  2DTR A;  4GFB A;  1AKH A;  1ETQ A;  2EFN A;  1WFX A;  1MJA A;  3O3K A;  2MH2 A;  2BXY A;  4PCQ A;  4U87 A;  4HLY A;  1Y1W J;  4QLC U;  5DM6 F;  5BQT A;  4B3A A;  3OY9 A;  2IA2 A;  5DUI A;  3FF5 A;  1R5G A;  3I71 A;  3H0G J;  4E70 A;  2MA3 A;  3HRS A;  2KFD A;  2BVL A;  1MJB A;  2ZFW A;  1USS A;  4UNO A;  1TL8 A;  2C6Y A;  5HDG A;  4EM1 A;  4AUX A;  4XMY A;  5HLI A;  3VEP A;  2JVH A;  4NNJ A;  3TBI A;  3F8B A;  3HM5 A;  4ENJ A;  1XN7 A;  4A3C J;  1XD7 A;  4BBS J;  2DA6 A;  3CCJ I;  3CCE I;  2QYO A;  5EG0 A;  1SD6 A;  3KYD B;  3GTM J;  3PO3 J;  5IOZ A;  1YRN A;  2DJN A;  5H20 A;  4KT6 A;  2LDU A;  4Q47 A;  1YTY A;  1MH4 A;  4IOA F;  1TW2 A;  3OV8 A;  5HOD A;  3HOU J;  2KIM A;  4ASN A;  3AKZ A;  2MC4 A;  3UKG A;  2K9M A;  5GTI C;  5J1U A;  5FKK A;  1Q1V A;  4HF2 A;  2X6W A;  1IUF A;  1BN5 A;  5FB2 A;  4RGX A;  5BPI A;  2L4A A;  3ZOB A;  3K6G A;  1LJ9 A;  1D0X A;  2BGC A;  1EH7 A;  2D5V A;  5C4X J;  4BE0 A;  2W85 A;  2HPI A;  4CA0 A;  3J7Y J;  2BOL A;  4RLF A;  1S9H A;  4V19 K;  1V3F A;  5J4Y A;  1A6Q A;  1YX3 A;  3WGH A;  2VOP A;  4OIN F;  5GAE J;  3ABU A;  3VOD A;  4XQF A;  3LSJ A;  1K4S A;  4A3D J;  1BR2 A;  1OFC X;  5KAF C;  2KKO A;  3JRH A;  3GFI A;  1BA5 A;  2WY8 Q;  3W3C A;  2R7O A;  1TWC J;  2HDD A;  1FTT A;  2DT6 A;  1U2W A;  2I10 A;  2ZME A;  1Z6T A;  3RSN A;  1K6O A;  4S0H B;  4EJU A;  1Y0N A;  3ERM A;  2VBZ A;  3PIP F;  1MNE A;  1BC7 C;  4RB3 C;  1I6H J;  5HNH A;  4KNY A;  3FHZ A;  1JTX A;  3FM3 A;  2WTE A;  1TWG J;  1DU0 A;  1WJC A;  1Z6R A;  1G3T A;  3HRU A;  3PIO F;  3RKQ A;  2HOE A;  2M30 A;  2RAE A;  4EV0 A;  2JQ7 A;  1YE9 A;  3J7Z I;  4E7L A;  3CUQ C;  3ZN0 A;  4IZZ A;  4E7J A;  5HLH A;  2LTP A;  2QWW A;  4P96 A;  4DNC A;  3M8J A;  2K4J A;  1RZ4 A;  3TW7 A;  1TT0 A;  3ZQC A;  3DP7 A;  4FHT A;  1ZAR A;  4P5O A;  2VKH A;  4GGG A;  4HZF A;  4PFP A;  4EJT A;  4N4O B;  2VQG A;  2FOK A;  5GAG J;  1YFH A;  1FC3 A;  2XC7 A;  2P5L C;  2Y0S N;  1HKS A;  1UB9 A;  1JHF A;  2OUM A;  3DLA A;  2VQC A;  1OKR A;  3GFL A;  2TRT A;  3TL4 X;  4UUS B;  1HW1 A;  3E5X A;  2FBI A;  2M5W A;  4A3M J;  2H09 A;  4EMS A;  3FMS A;  4B43 A;  3WTS C;  4JBA A;  4ENM A;  1UHM A;  4AM3 A;  4U7D A;  3HXL A;  4G12 A;  3BC8 A;  1KYZ A;  1D3Y A;  2M8G X;  5D6F A;  4MEX F;  1FIA A;  3PNT A;  5F0C A;  4A2U A;  3FXQ A;  1Y6I A;  3TO6 A;  1FY7 A;  3VB2 A;  1M1E B;  2CJJ A;  3G73 A;  2K4B A;  1BI3 A;  5HLT A;  3K7A J;  2QEX I;  1QPI A;  1QO0 D;  1XGO A;  1W5C C;  2DXI A;  1R22 A;  1XDS A;  3EUA A;  3K9T A;  4O6J A;  4HG2 A;  2OV7 A;  3ROU A;  5J1Y A;  4Q5S F;  3L2Q A;  4IHS A;  3BP8 A;  2X4H A;  4BQQ A;  5D5W B;  1FOK A;  4GRI A;  3I64 A;  1EKE A;  1QRY A;  3A01 B;  1KGS A;  2R7S A;  4LFU A;  2IAI A;  3KYC B;  2BV6 A;  1QHG A;  3E0J B;  4RS8 A;  2M9H A;  5HS9 A;  4I09 A;  3P9C A;  2R5Z A;  4LLG F;  4C3J J;  1QZE A;  1J09 A;  2LRD A;  1MZB A;  2VQH A;  2V1D A;  1E3H A;  1JUP A;  3QOE A;  2PBI A;  5EGO B;  2CQ7 A;  4MQV A;  4JK1 X;  2VBY A;  4PJ0 C;  3TW6 A;  3J7A O;  2O7O A;  2O61 A;  2LP0 A;  3GME A;  3K2A A;  3JTH A;  1X3U A;  3HIF A;  2ZME C;  2ECC A;  3JSP A;  1FOY A;  2KIU A;  3IH4 A;  1Y0U A;  4I02 A;  1R71 A;  3GBG A;  2P8T A;  2EZK A;  2CG4 A;  3LAP A;  2QSG X;  1MDM B;  1WSU A;  2FRH A;  2YS9 A;  5EJC A;  4M9Z A;  1B4A A;  2HPM A;  1T0F A;  4PZJ A;  3C2G A;  1UFM A;  2PFB A;  1GV2 A;  2WC2 A;  4EQQ A;  2ZXI A;  3SZP A;  3SFZ A;  1VQ4 I;  4A3F J;  1WJE A;  2DAO A;  4E6K G;  3RIR A;  2NAZ A;  3S93 A;  3D5S C;  3WGG A;  3LQR A;  4F91 B;  4XKW A;  2PQ8 A;  2X0L A;  2NS7 A;  2D1H A;  1MBF A;  1ODD A;  3NRV A;  1W7P A;  2KP6 A;  4MFE A;  5ERI A;  2K3P A;  4E7H A;  9ANT A;  3BQZ A;  1TT5 B;  4UHT A;  3BPX A;  2P6T A;  3IWF A;  4OMY A;  4GDF A;  4WXH A;  1HCR A;  2Z1D A;  3F8M A;  3J80 Z;  3AFH A;  3EDP A;  1YJW I;  2H6C A;  3BTL A;  1ZN2 A;  1H8A C;  4OIQ F;  3ZQF A;  1YW9 A;  3R60 A;  1ETO A;  1I39 A;  3BJA A;  3CDI A;  3J81 Z;  2HYJ A;  4UVC A;  5D4R A;  3CME I;  4NHJ A;  3WOD F;  2PJR B;  1ON2 A;  4BHP A;  2LVS A;  2QLZ A;  1FYK A;  2RRE A;  2VXZ A;  1FZP B;  1MD0 A;  3QAH A;  1GUU A;  1JUS A;  1TLH B;  2Y48 A;  4OWR B;  4OIO F;  2F4M B;  2WBM A;  4G9Y A;  2VJ4 A;  3HC7 A;  1TTY A;  3O6B B;  1HXD A;  2KRF A;  2QM3 A;  5ICF A;  2FOW A;  5IYD J;  2IRF G;  2NOG A;  4FX4 A;  1L3L A;  5H6Q A;  5K5O A;  2OCE A;  5F08 A;  2OCC H;  4N0B A;  2CS3 A;  1P7I A;  3KFW X;  1F36 A;  2JSC A;  2A05 A;  3VYU B;  2MGQ A;  5LEK A;  1W0T A;  3CUQ B;  5ILS A;  4L9N A;  3TKY A;  2IW5 A;  1G8X A;  2CQQ A;  3F6V A;  3OYC A;  2XRL A;  4XLE A;  5IY5 H;  2ZNZ A;  1CF7 A;  4IHT A;  3D5L A;  2VIX A;  3UR3 C;  5FLV A;  1TNS A;  4PSW A;  1HLV A;  1STZ A;  3IWZ A;  5TIS C;  2EV0 A;  2R5Y A;  2CFX A;  3S3M A;  2MFZ A;  1OMI A;  3WTW C;  2M1B A;  3H35 A;  5EEA A;  4NB5 A;  5JHU A;  4HOB A;  4R1H A;  1FP2 A;  1V4R A;  3CLO A;  4IX7 A;  2KJB A;  1UG2 A;  2DQR A;  3J81 K;  1VQM I;  2Z5U A;  5LRR A;  2LG4 A;  3BG5 A;  4ZYA A;  2HXO A;  2EH3 A;  3MCZ A;  3EYY A;  1XMA A;  3BTJ A;  4OIP F;  1AU7 A;  4Q48 A;  1QBJ A;  2W24 A;  4AWX B;  1BM9 A;  1T0F C;  4KYW A;  3LNQ A;  3PFY A;  5FLM J;  3G1M A;  2OTJ I;  4P9F A;  2JPC A;  1V5G A;  3FWE A;  1YRN B;  4WXD A;  4A3I J;  3DBR B;  2WAQ A;  3GLL A;  5E1W A;  2J5O A;  5DDG A;  2HOS A;  1HF0 A;  1KU2 A;  1Z05 A;  2IT0 A;  2I8D A;  5J8F A;  3V4G A;  3K4C A;  3WU1 B;  5EEH A;  4DYC A;  4HDU A;  1LE8 B;  2E2J J;  2YX4 A;  4NC6 A;  2QEN A;  5ICE A;  3BZC A;  2KIS A;  3JR9 A;  2FUG 2;  2BEO A;  2VC0 A;  1ZRC A;  4HX7 A;  1P4X A;  5JI6 A;  4LLL A;  3E6B A;  5L3G A;  1N77 A;  2XF5 A;  1SAN A;  1W7P D;  2X1D A;  3KLN A;  2JTV A;  3ASN H;  2VE9 A;  1TZL A;  2A69 F;  2FBH A;  2QVO A;  2ZB9 A;  4UVB A;  1DP3 A;  3PM1 A;  3BG7 A;  3BR6 A;  3DEW A;  1KQ8 A;  4XR6 A;  5F04 A;  3HOV J;  2E1N A;  3V7S A;  4DOZ A;  5FJ8 J;  2LBF A;  1W5T A;  4V2G A;  5HVQ C;  3FXJ A;  2LNB A;  2OF7 A;  3ULQ B;  3UNG C;  1HKQ A;  2XPU A;  1G4D A;  3O8G A;  3GTP J;  4UUT A;  3B73 A;  3F21 A;  4AID A;  1N25 A;  2HZD A;  4MO7 A;  1ZH5 A;  4I6Z A;  3A2K A;  2K86 A;  5DEQ A;  3CO7 C;  4XKC A;  1WJA A;  2VXD A;  3KCC A;  2DYR H;  3DEE A;  1SD7 A;  5EYR A;  1HW2 A;  4HQM A;  2TDX A;  4ZDL A;  4C9Y A;  2VE8 A;  3V8K A;  3WU0 A;  3RYR A;  4BXF A;  3L7W A;  5KVR A;  2ACJ A;  3CCY A;  2HYF A;  4HBL A;  3BDD A;  2EB7 A;  2QKM B;  5LEJ A;  5J6X A;  3G2B A;  4RB2 C;  3EPZ A;  2GZW A;  1I27 A;  4BDY A;  2ESN A;  2GBY A;  2KMU A;  2QQA A;  2QQB A;  3BCA A;  4YFX F;  1V5E A;  3JRB A;  3RTR A;  3MKY B;  3L9F A;  3A0B C;  3RPU A;  2IA0 A;  1LDD A;  3GXO A;  4M6Y A;  4J01 A;  3T0Y A;  1K78 A;  1IV6 A;  1D5Y A;  1FBQ A;  2R7W A;  3HHH A;  1P4W A;  1SD4 A;  2ZFU A;  1JKP C;  1ZEL A;  1LFB A;  2UUZ A;  1ZYR F;  4M3E A;  2DK8 A;  4PJJ A;  5K5R A;  1ZG1 A;  5DM7 F;  4U7B A;  2YSR A;  4XLC A;  2QQ9 A;  2ZJ2 A;  2DQL A;  1OCP A;  1ZRF A;  2XAH A;  2HI3 A;  4XKB A;  2FSW A;  2KDO A;  1WGX A;  1SD5 A;  3RI4 A;  1R1T A;  4B47 A;  5E79 C;  4XLF A;  3PQJ A;  4EJW A;  2E60 A;  3TGN A;  2ZJP F;  5IYC J;  4I2O A;  1VQO I;  1G3W A;  4CHU A;  2H27 A;  2HOA A;  3HHG A;  4U88 A;  4C3I J;  2W1O A;  1ULY A;  4U0W A;  3GTL J;  1XPX A;  2XAS A;  3MN2 A;  1K79 A;  1UJ8 A;  5L3D A;  4HLX A;  3V8J A;  4Y52 J;  1V54 H;  2M0M A;  2WY7 Q;  2ISY A;  2LY1 A;  4RGS A;  5D5X B;  5ILV A;  3CC2 I;  1S6L A;  3MEX A;  1LFU P;  3IKT A;  1OCR H;  3DKW A;  5IT3 A;  3AAF A;  2IXS A;  1E17 A;  1Z3Y A;  1BOA A;  1JHH A;  1S7A A;  4G6D A;  5DCM A;  1YJN I;  2JJ7 A;  4A3B J;  2R5Z B;  1QU3 A;  5C44 J;  2EFO A;  3IAS 2;  2QKL B;  4PJN A;  1HW5 A;  2F5E A;  1TWF J;  2V4J C;  2XVC A;  2KZG A;  1X2M A;  1IW7 F;  1R4N B;  2MLG A;  3R4K A;  5CVJ A;  3HOT A;  4FTH A;  3WTZ A;  3DKY A;  2VOO A;  2CW8 A;  3RQ4 A;  4IPA A;  3JAM Z;  3S8P A;  3SHF A;  1MIJ A;  4X1E A;  1WVR A;  2I5U A;  1ETY A;  1QPM A;  4CYC A;  2RQP A;  3CCL I;  2EFW A;  1FX7 A;  2O9L A;  2XB0 X;  3GYH X;  1R00 A;  3COA C;  3S15 J;  2HKX A;  3ML6 A;  1TQP A;  2JA8 J;  2LYC A;  1OYI A;  4XNF A;  1MNM C;  1RKW A;  5FKO A;  3GX4 X;  3F23 A;  3F0C A;  1Z9C A;  3CJQ B;  2KIF A;  1X4P A;  2CUE A;  2E71 A;  1I1G A;  3MVP A;  2NVQ J;  1YQA A;  5IP7 J;  3BRO A;  3T8T A;  1BL0 A;  2F48 A;  2HQN A;  1FBU A;  1W7P B;  3K10 A;  4O3M A;  2VI6 A;  4ESJ A;  1R6R A;  4LB5 A;  3H5R A;  1D1A A;  4HAM A;  3J7A Y;  2DFE A;  1JUM A;  3AL0 C;  1O3Q A;  4LG0 A;  1EA3 A;  4D9J A;  2PI0 A;  5CQE A;  1FSE A;  1T39 A;  3CQZ J;  3RPU D;  2BY1 A;  3JRG A;  1ITY A;  4XOP A;  2NNN A;  2DA7 A;  3M1E A;  3CP2 A;  4E7K A;  2F5V A;  3K70 C;  2WAF A;  2JT1 A;  4EM2 A;  3IC7 A;  4D7M A;  1MMS A;  4M3G A;  2IGK A;  3BTC A;  2B7E A;  1WH7 A;  2XRN A;  1UHW A;  2ZSI B;  3FBN B;  3IH3 A;  3W2W A;  1K6Y A;  2EFP A;  4YEJ A;  3DLL F;  3HTS B;  2FXA A;  3W2A A;  3JAM K;  4TV7 A;  3KP4 A;  3BR0 A;  3AG1 H;  3K70 D;  2BY0 A;  4HQE A;  4ON0 A;  4OOI A;  1W0U A;  2K9N A;  3KZY A;  1JKR C;  3BG6 A;  3FIW A;  3A0H C;  4CCM A;  3WTV C;  2E36 A;  1PP8 F;  3EQL F;  2JZY A;  5HS8 A;  2HTJ A;  2IS6 A;  3BZK A;  5J3L A;  3ECH A;  3ZP5 A;  1T6S A;  3QWL A;  2P7V B;  2LY9 A;  1Z91 A;  1SVL A;  3TED A;  1ZAO A;  4FAS D;  5IP6 A;  1S72 I;  1JE8 A;  2EQR A;  2KPM A;  2HVS A;  2CFO A;  2JA2 A;  3S2W A;  1R1U A;  5FKN A;  1RKT A;  1WJB A;  1VQ7 I;  2GXB A;  3MFK A;  5DUK A;  1ETK A;  4BJ6 C;  2F6C A;  3OR2 C;  2QBY A;  2KT0 A;  1TQM A;  1CF7 B;  3SFI A;  3HBL A;  4JP0 A;  4CXF A;  1IN5 A;  1GV5 A;  2DOD A;  2FD5 A;  1R5I D;  3LSP A;  3EET A;  3L2R A;  2VKD A;  2XGE A;  4JX5 A;  4BBR J;  4DQ2 A;  4KMF A;  1Y8R B;  2V26 A;  2F4I A;  2R5Y B;  1VTN C;  1FYL A;  2DT5 A;  2VBX A;  3KLO A;  1G59 A;  2DFI A;  1BJA A;  3E3V A;  4B3X A;  3DXJ F;  3L2V A;  2GIZ A;  1Z7L A;  3TO9 A;  1K83 J;  1NG7 A;  3QU6 A;  4WX9 A;  3SYT A;  3KEQ A;  3DTE A;  2HNH A;  3PSF A;  5EEG A;  1XGS A;  3LQQ A;  1F9N A;  4DBR A;  1BOB A;  1OPC A;  1UAA A;  1TBX A;  3JRF A;  3S3N A;  3TP0 A;  3S1M J;  1XSX A;  2R7F A;  1A6I A;  3MZY A;  4RA2 A;  3GEZ A;  4RM2 A;  4XL9 A;  5HDN A;  3JRI A;  2MG4 A;  4AVZ A;  2AHQ A;  2L9N A;  4ZYH A;  2JUC A;  3M7G A;  1YI2 I;  3F6O A;  4GYG A;  3MKZ A;  5FLX Z;  2JA7 J;  3FHN A;  3CES A;  3L00 A;  1U8B A;  4JX4 A;  1U5T B;  4Z6Y A;  4G6T B;  2NOJ B;  2R0Q C;  1MBE A;  1ETX A;  3SDB A;  2AQF A;  4CIC A;  1Z3X A;  3CJT B;  3FK7 A;  3LSH A;  3U1K A;  4BJT A;  5JLW A;  1IJW C;  2RGV A;  4C3H J;  3OYD A;  1B72 A;  4KN4 X;  3BR3 A;  4NBQ A;  1YS7 A;  3O2P E;  2CV2 A;  1T98 A;  3ABL H;  2VJJ A;  5CQG A;  4XID A;  4DYQ A;  2L5Q A;  1S7E A;  2KLO A;  3IUO A;  1ZK8 A;  4AIH A;  3VSK A;  4G7O F;  4IOC F;  1RI7 A;  3C1D A;  1IXS B;  4A3L J;  3I54 A;  2IEK A;  2L4M A;  2ZSH B;  3H5A A;  3QYF A;  4XSX F;  2V9P A;  3HYI A;  4EM0 B;  3WTU C;  4BY1 J;  2RQQ A;  2Y31 A;  4ETS A;  1QNT A;  1S7O A;  1ON1 A;  4CCN A;  1RR8 C;  3FXR A;  3BR5 A;  2CGP A;  1NH3 A;  5ILU A;  3E5U A;  3IHU A;  2M8E A;  2O3F A;  5B5E C;  3VPR A;  2MD5 A;  3WU2 C;  3CCU I;  5LD2 C;  1Q1H A;  1XMK A;  2M4K A;  4IQJ A;  1XX5 A;  3CCM I;  1EH8 A;  3E1S A;  4ZYG A;  2DA3 A;  2RDP A;  5GPA A;  3F8C A;  1SVM A;  4YRV A;  2LF8 A;  4BNC A;  2PMU A;  3CCR I;  3E7L A;  1XCV A;  5E18 F;  1E0E A;  1ZGW A;  1LFP A;  1SVO A;  2R7X A;  2K3F A;  3QPS A;  4BEH A;  1WQ2 A;  3G1O A;  4WK8 F;  2ZJQ F;  4EGY A;  3KP6 A;  3A4C A;  3HDD A;  1K78 B;  1D1B A;  2A5W A;  3FMR A;  3CMA I;  1YO5 C;  3AL0 B;  3JRD A;  4O5V A;  1AHD P;  4G7Z F;  3H3U A;  4ZDO A;  5FRO A;  1BR1 A;  2V6E A;  4A6E A;  4AVP A;  3PUB A;  2QGU A;  3GTG J;  4KT5 C;  1ZHF A;  4UV8 A;  3H5N A;  5K5Q A;  2Z2S B;  3PO2 J;  3ABK H;  3LA2 A;  4II3 A;  3HOX J;  3QRF F;  2K02 A;  2EJR A;  3KPH A;  4PSX A;  5F27 A;  3WE3 A;  1V5F A;  3OYA A;  3W2V A;  1IGN A;  2P81 A;  2VB6 A;  2R4G A;  4HX4 A;  3P9K A;  3BG9 A;  1JKQ C;  2BBY A;  3V7R A;  5IP9 J;  4F3Q A;  1VQP I;  2NYX A;  2QQ8 A;  1X1A A;  1DQU A;  3TOB A;  2ELH A;  3FMQ A;  1LPQ A;  1HDP A;  2L9S A;  3K69 A;  2QA4 I;  1ETV A;  2VC1 A;  2PMH A;  3A1Y A;  3DU6 A;  1J7K A;  4BGD A;  2VPR A;  3JCU C;  4A3G J;  2L01 A;  2DI3 A;  3I5U A;  3OYJ A;  2R7R A;  2CW0 F;  4QTR A;  1K7A A;  3F9K A;  3JRE A;  3BOQ A;  4BUP A;  3B02 A;  5JVG F;  1FOX A;  3S17 J;  2D1V A;  2W82 A;  5FRN A;  2CQX A;  3FK6 A;  2QSF X;  5DCM B;  4KIC A;  5HS7 A;  1WJ5 A;  2X6Y A;  4A93 J;  4R8H A;  4UV9 A;  4AYB N;  4BY7 J;  3D0S A;  1H9T A;  3S1R J;  3ZXS A;  1UZC A;  3ZGK A;  2EPF A;  2Y0S A;  2Q8K A;  4CYC B;  1R23 A;  5J47 A;  3ESW B;  4BAC A;  2X48 A;  1NK2 P;  3FBI B;  4DYR A;  2DYS H;  5LHH A;  1WJF A;  2FNP A;  2PMZ N;  3KE2 A;  1DU6 A;  3HPG A;  2WAD A;  4FCY A;  3CJN A;  4YII A;  3FX3 A;  4ZC3 A;  2GLO A;  2DTZ A;  3JRA A;  1YOV B;  1MGT A;  1J59 A;  3QPH A;  3WTY C;  1LEB A;  1GVD A;  1RUO A;  3KEO A;  2OU2 A;  5DD8 A;  2EV6 A;  1VF9 A;  2X6O A;  1IDY A;  3O8H A;  4E4H A;  3PQK A;  5FFX A;  1VND A;  5DD4 A;  2M45 A;  3FZV A;  2DFH A;  3D1N I;  1S5L C;  1JXS A;  4IJA A;  2OZU A;  4A0Y A;  1DGW Y;  3KP7 A;  4HSR A;  2FE3 A;  4I7H A;  1APL C;  1P6R A;  3W6V A;  2WAE A;  1T8I A;  1LVK A;  3BT9 A;  1PUF B;  1OCZ H;  4M72 A;  2WB1 N;  1TW3 A;  1U6G A;  4UB8 C;  2OJE D;  2YR2 A;  4S05 A;  2L7K A;  2FQ3 A;  3W6J B;  3KP3 A;  4LIV A;  2HQ5 A;  4D7N A;  5GAD J;  4C2T A;  2A68 F;  4LG3 A;  2Y69 H;  3ZQ7 A;  2L54 A;  2ZO4 A;  5K7Z A;  2DPU A;  2FF4 A;  3BQY A;  2OQR A;  1D8J A;  1MSF C;  2RVC A;  3LFU A;  4M3F A;  3DKX A;  3K4M A;  4AU7 A;  1Z21 A;  4LGW A;  1U8R A;  2DO7 A;  1HC8 A;  3CLQ A;  1Z77 A;  1FIP A;  1WCM J;  1TC3 C;  3HSF A;  2PEX A;  3Q0V A;  4Y7N J;  4XN3 A;  1UMQ A;  4OU0 A;  4ITV A;  2KZV A;  5GAH J;  5L3F A;  1ZLJ A;  2E7X A;  4I01 A;  4II2 A;  2Z33 A;  4C2M J;  1ONV A;  4HV5 A;  1I50 J;  5KCM A;  4I0A A;  2A07 F;  1JJ8 C;  3F3X A;  3ZMS A;  2CQN A;  3DPL C;  1RPW A;  3BZ6 A;  2A6T A;  3TDU C;  1G3Y A;  4MNU A;  1IRX A;  5K1Y A;  2M3A A;  2LKS A;  5CJ9 A;  4K2E A;  1D8K A;  4RAF A;  1J9I A;  4RLQ A;  3RZD J;  1QA6 A;  2AS5 F;  3CD6 I;  5LFA A;  2QBY B;  3G3Z A;  3ZR8 X;  2EA4 A;  3I59 A;  4KIS A;  2DFF A;  5E1X A;  1AKH B;  2PJP A;  2FNA A;  5E17 F;  3OSF A;  4DBQ A;  1DGR M;  2D2W A;  2VKE A;  2E1O A;  4L9J A;  1R49 A;  3J80 K;  4A12 A;  3ZQL A;  2BHZ A;  2HR3 A;  3FXO A;  5E20 A;  3MKL A;  3MZH A;  3E6C C;  4J00 A;  1IRG A;  2Q1Z B;  4LJZ F;  4PK4 A;  1LDK B;  4I99 C;  4XM3 A;  1S8N A;  1YX5 A;  4A69 C;  1OCO H;  1T38 A;  2DLL A;  1VI0 A;  1BC8 C;  2G9W A;  4FX0 A;  4XOT A;  3SEZ A;  2P5V A;  1IO2 A;  1FLI A;  3WG9 A;  2IA1 A;  2GWR A;  1FMV A;  3ONQ A;  2Z3Y A;  4IF4 A;  3ZN1 A;  1X4O A;  1FOW A;  3AG3 H;  5M5X J;  3OYH A;  3S16 J;  4Y4R A;  4L0Z B;  2E35 A;  4F93 B;  1ENH A;  4Q4Z F;  5EG0 B;  2OQG A;  1U78 A;  4LD5 A;  2CO5 A;  3BJO A;  3LSR A;  3L2C A;  4IHX A;  1W1W E;  2OTL I;  3H9Q A;  2LH9 A;  4DZP A;  3I3L A;  4CGZ A;  2WV1 A;  2M7B A;  1KU9 A;  1B9M A;  4L9T A;  1MBG A;  2LKX A;  2TCT A;  3M8F A;  1B8I A;  3H3V K;  3CMM A;  2HTS A;  5M5Y J;  1SC7 A;  2K9Q A;  3RCO A;  1VQ8 I;  1IXR C;  4ANJ A;  3HOY J;  2DOF A;  3LSG A;  1A04 A;  3JSO A;  4Y15 A;  4BH9 A;  5CVU A;  5LHG A;  1H88 C;  2RNG A;  3DTK A;  4MQ9 F;  4GCV A;  4RDU A;  1CGP A;  5TGT A;  4C2U A;  1FTZ A;  1KQ0 A;  1RES A;  5F0F A;  1FT9 A;  4CDG A;  1FP1 D;  3WG7 H;  4B48 A;  1X1P A;  3FXK A;  5DCF A;  2NVX J;  2Z16 A;  3CO6 C;  3R6S A;  2XV4 S;  4XN0 A;  2G7U A;  4OAY A;  4M9X A;  4BE2 A;  5IOY A;  1JGG A;  4MTD A;  1EF4 A;  4U0V A;  1Z1D A;  3JW4 A;  1SFK A;  3F72 A;  1WZ2 A;  4LMY A;  3ZPL A;  1DDN A;  3A02 A;  2VAS A;  1PJR A;  2A6E F;  2ZME B;  2E19 A;  3Q0W A;  4AD9 A;  1RUN A;  3K4K A;  3TO7 A;  2JWT A;  4NQW A;  3MZ8 A;  4BDZ A;  2JK3 A;  3V42 A;  4EVI A;  2M0C A;  4BQA A;  1BIB A;  5B66 C;  5E3O A;  2IJL A;  2K9L A;  4ZYE A;  1KYW A;  2JRT A;  2EZL A;  2STT A;  2BE5 F;  4B4C A;  1B9N A;  1KON A;  2DOA A;  4QSH A;  2XRO A;  2ZJR F;  1WHU A;  2X1C A;  5LGU A;  2R7V A;  1AOY A;  2H94 A;  1VZ0 A;  1XC5 A;  1WPK A;  2ZXJ A;  1X2N A;  1ZG3 A;  3HL2 A;  2GOX B;  2K40 A;  4UVA A;  5L3C A;  1VQ5 I;  2CYY A;  1SFO J;  2O6G E;  3I4N J;  1O57 A;  2HVQ A;  3B6C A;  3NAR A;  1YW7 A;  3CJR B;  4HEA 2;  3X2Q H;  2LR8 A;  2EA2 A;  3RJP A;  2JUG A;  5JVT A;  4IQ4 A;  2LK2 A;  2L7M P;  3M3Y J;  5JLX A;  1YIO A;  3LSK A;  1AWC A;  2X1E A;  2VJI A;  1IRF A;  2H1L A;  2DDB A;  4YFK F;  2HU9 A;  1YS6 A;  1T08 B;  2EBI A;  2VPL A;  3RZO J;  1OCC H;  2MAB A;  2P7C B;  4F52 A;  1O7L A;  2IVM A;  2DK5 A;  3IAM 2;  2DU9 A;  1RRJ A;  3A03 A;  2LMD A;  3TP3 A;  3I4M J;  5LGN A;  1EH6 A;  1LVA A;  2DMP A;  2VOD A;  4UUS A;  1Z67 A;  3LL7 A;  4UUV A;  2CUZ A;  2Y0M A;  4XRM A;  1JKO C;  1FYM A;  2VBW A;  2GA1 A;  4KJZ A;  3C2B A;  2F5C A;  4V2F A;  5DV5 A;  3GTJ J;  2CV0 A;  2IGM A;  3H9G A;  1X19 A;  2V1X A;  2Y2Z A;  4S04 A;  2WV0 A;  3HG9 A;  2W84 A;  2HZT A;  2QSH X;  1R36 A;  4MEY F;  5A2Q Z;  4ENK A;  2DA4 A;  1FBS A;  1NHA A;  4AC0 A;  4DGW B;  1O3S A;  5AON A;  2W00 A;  4OIR F;  4QWQ A;  3H0D A;  2X9D A;  2XAQ A;  2ZC2 A;  2DDA A;  3H9J A;  3VYT B;  4XLH A;  4FE7 A;  2J5P A;  2DA2 A;  1REP C;  3RKW A;  3VSL A;  4BKX A;  4L9V A;  2XIG A;  4HST A;  3K1N A;  3SZG A;  4KIT B;  4KDP A;  2IS1 A;  3ERE D;  2XKP A;  2DCE A;  3B6A A;  2MSY A;  4MIM A;  5H6R A;  1UST A;  2EIJ H;  5CVI A;  1R5H A;  3KEY A;  3QPL A;  5FD6 A;  4HNV A;  4IRI A;  4ZH4 F;  3GF2 A;  3M9A A;  1ZR2 A;  5J1R A;  1BJZ A;  4BS9 A;  3QP5 A;  2P6S A;  3G6E I;  3BR1 A;  1LDJ A;  2VT2 A;  1PDN C;  3EUK L;  1T33 A;  4N4N B;  2GA2 A;  4XOR A;  1H0M A;  4KFC A;  2LLK A;  3QP6 A;  1WJD A;  2RV8 A;  3NAU A;  3CC7 I;  2YX7 A;  2XSJ C;  3ZQI A;  2XKO A;  2JPB A;  1ORK A;  2JSP A;  2HWV A;  3RDI A;  5E3N A;  5EGO A;  1IAW A;  1N78 A;  5CVV A;  4U0Y A;  2V9K A;  2KL4 A;  2ISZ A;  1YW8 A;  1O3T A;  5EF6 A;  1RIO H;  3JRC A;  2ICW G;  2IPQ X;  3REO A;  3VYR B;  1ZG5 A;  1SEU A;  4NDL A;  2O03 A;  1GXP A;  5L3B A;  6PAX A;  1RNL A;  2KDZ A;  2Y9Z A;  1I3Q J;  3K4B A;  2R7Z J;  2HDC A;  3Q9S A;  2V1N A;  4F7Z A;  5KK1 A;  1IUY A;  2XGD A;  2R7T A;  3C3W A;  1V55 H;  3LST A;  5CVR A;  3GZ6 A;  1XTA A;  1R7J A;  4HRI A;  2CUF A;  3GTO J;  3CF5 F;  3IL2 A;  1R9T J;  3FXL A;  4M3D A;  4BXX J;  2P4W A;  1XMX A;  2CW7 A;  3H3Z A;  3R0J A;  2EFQ A;  1OJL A;  3QU3 A;  1MMD A;  3I56 I;  4MHG A;  4LIU A;  3BCB A;  3GTK J;  2VL8 A;  3GFJ A;  3FKI J;  1UCR A;  1FNN A;  5J4V A;  2GXA A;  2XHK A;  4RAY A;  1U0J A;  3SXY A;  2STW A;  2VON A;  1P2F A;  3RPQ A;  1SFU A;  2XPV A;  4BXU A;  1KU3 A;  2BY3 A;  2L9V A;  2K9S A;  2PJR A;  4LK1 F;  4ESB A;  4BL0 B;  2HDW A;  4CCO A;  5JHF A;  2YU9 J;  3HUG A;  2HQA A;  3LOC A;  3QOD A;  4XLP F;  2E1C A;  1B59 A;  5BOX A;  4I76 A;  4A0X A;  4KIF A;  2FU4 A;  3S32 A;  1OIS A;  1QZY A;  1X58 A;  2Y75 A;  3OIO A;  2ZNY A;  3P9I A;  2YU3 A;  5LRS A;  1NK3 P;  3R0A A;  4PFO A;  4B44 A;  4FT8 A;  3S1Q J;  3I59 B;  4EJV A;  2ELJ A;  2L0K A;  3FM5 A;  1A5J A;  2ME6 A;  3ZMZ A;  2Z99 A;  4HYE A;  3V7C A;  4Y13 A;  4HNU A;  2QF7 A;  1OQY A;  2KHM A;  1I5Z A;  2OPT A;  2CU7 A;  3HZJ A;  3ZQQ A;  5FRM A;  1D5V A;  1XCB A;  1YJ9 I; 
#chains in the Genus database with same CATH homology
 1VQL I;  5GAH J;  3G6E I;  3CJT B;  1YIT I;  4IO9 F;  5DM7 F;  3CC7 I;  1FOY A;  5JVG F;  1VQM I;  1FOX A;  3PIP F;  2ZJR F;  1QA6 A;  3CD6 I;  1MMS A;  4IOC F;  3PIO F;  2JQ7 A;  3J7Z I;  3G4S I;  1VQ4 I;  3DLL F;  2OTJ I;  2ZJP F;  1VQO I;  1VQ5 I;  3G71 I;  1VQK I;  2E36 A;  3CCU I;  5DM6 F;  5GAG J;  3CF5 F;  3CCM I;  1YJW I;  3CCS I;  3CCV I;  1YIJ I;  1S72 I;  1VQ9 I;  1FOW A;  3CC2 I;  2E35 A;  3CCR I;  3I56 I;  3CME I;  1VQ7 I;  2K3F A;  1YJN I;  2OTL I;  2ZJQ F;  3CCJ I;  3CCE I;  3CMA I;  2E34 A;  2H8W A;  2NXN B;  4IOA F;  1VQ8 I;  1Y39 A;  2QEX I;  3CCL I;  2FOW A;  1VQ6 I;  3CCQ I;  1VQN I;  5GAD J;  3I55 I;  1YHQ I;  1VQP I;  3J7Y J;  1ACI A;  4UY8 I;  1HC8 A;  4V19 K;  2QA4 I;  5GAE J;  1YI2 I;  3CC4 I;  1YJ9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...