1VQ8I

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq8I00
3PIPF 1FOXA 3CCLI 2ZJQF 3G71I 3CCMI 3CC2I 2K3FA 1S72I 3G6EI 3CCRI 3CMEI 5JVGF 5DM7F 5GADJ 4IOAF 3J7ZI 1YIJI 1YJWI 3J7YJ 2NXNB 3CCSI 1YJ9I 3DLLF 5GAEJ 1YITI 1YJNI 1VQ8I 3CCEI 2JQ7A 1VQLI 3PIOF 2OTLI 1VQ7I 4V19K 5GAHJ 5DM6F 1QA6A 1VQPI 1VQKI 2OTJI 2ZJRF 5GAGJ 1ACIA 1YI2I 2E35A 1VQNI 3CCJI 3CCUI 3CC4I 3CC7I 4IOCF 3CCQI 4UY8I 2QEXI 4IO9F 2E36A 3CF5F 1FOWA 3CJTB 1Y39A 1VQ4I 1VQOI 2H8WA 1VQMI 1FOYA 2FOWA 1MMSA 1VQ9I 3I56I 1HC8A 2ZJPF 2E34A 1YHQI 3CD6I 3CCVI 2QA4I 3G4SI 1VQ6I 3I55I 1VQ5I 3CMAI
chains in the Genus database with same CATH superfamily
5E3NA 1I3QJ 2TCTA 2V26A 2K9MA 4OU0A 4KIBA 3OV8A 4WF2A 1AKHA 2IVMA 1YOVB 2XPVA 4HV5A 5K5QA 3G3ZA 3JAMZ 1XMAA 4HV6A 1ETYA 4BL0B 2VQHA 1STZA 3IRQA 2CW8A 2EIJH 1SFOJ 1R6RA 1MDMB 2PN6A 1USTA 2ZSIB 5DCMA 1RC9A 4G7HF 3CJQB 4AVPA 3MD2A 5HDNA 1JXSA 3BZCA 5LGUA 4LB5A 5D4RA 1A35A 1OKRA 1W1WE 2PMUA 5DYMA 4P9UA 1QQIA 1JJ8C 2VKEA 5HLHA 1QPMA 4WXHA 2BY3A 4ZYEA 1RPWA 3M8JA 3ZMZA 5H6QA 3J7YJ 3NARA 2VKHA 3HOYJ 4XKWA 3JSOA 3BZKA 2EPFA 5EYRA 1QRYA 2A6TA 2KJBA 4N4OB 1POGA 3OR2C 4B3AA 3CUQA 2BY0A 5CQGA 3NQOA 5BOXA 1X1PA 4QLCU 4LK0F 4RGUA 4BQOA 1T2KA 1OYWA 1BR1A 3ZMVA 4MEXF 2OTLI 2YUSA 2QQ8A 2GXAA 2EV0A 2DYRH 4LLGF 1VQPI 4M3GA 2YX4A 2KIFA 3DLAA 4RB0A 2ETHA 3ZQ7A 3D0SA 3T1BA 1BR2A 2IP2A 2M34A 3F8MA 4J00A 4HQEA 3LQRA 2LDUA 4FCYA 2FX0A 4V2FA 3I4MJ 1ZN2A 1S8NA 3FMQA 2IGOA 2KIMA 3BZ6A 4N4NB 1W5SA 4A3EJ 5E8IA 2B63J 3OYCA 2DI3A 3I9V2 1MBFA 3FISA 3FXJA 4EQQA 3MZ8A 4OAYA 1Y8RB 5FKKA 2IS1A 3BR2A 3GO5A 5C3EJ 3DWLE 4L9JA 3S2DJ 1P7JA 2LOOA 1OR7A 1S9HA 2LSOA 5F27A 4BJ5C 1VQ9I 2EK5A 5DUKA 2ZJPF 2EZKA 1TWFJ 3G73A 3HC7A 2NS8A 3E6BA 3S8PA 1R5ID 2BEOA 1K4TA 3HOWJ 1F43A 3O8GA 1MGTA 2VJJA 4D9JA 2DK8A 2DCEA 1S5LC 5F04A 4HF1A 2EIMH 5TISC 3V8LA 3CP8A 2L4AA 1TNTA 4AIDA 3IP4B 1FX7A 3A0BC 3P9CA 1VFCA 2R7OA 2CJJA 1YTYA 3AAFA 2Q2EB 4S04A 2V1XA 4DBQA 1OCPA 2R7QA 3K4LA 1J75A 2AQEA 5CKTA 4Y33A 4M9ZA 2E7XA 3KEOA 2NVXJ 1OCRH 2E1MC 5ICFA 5EEGA 1SFEA 2E2HJ 3OIOA 2Y9ZA 1YQAA 2L7KA 2FJ1A 2V1UA 3S1NJ 2W1OA 3FK7A 2OZ6A 4YFNF 1R58A 1P9QC 3CDHA 1I6HJ 1NG7A 2F4OB 2P5VA 3OS2A 3TEDA 2ZMEB 3HZJA 1Z67A 2FXAA 1XGOA 2L9VA 3GFMA 1R4MB 2NOGA 3ECHA 2VC0A 3QWLA 4WXCA 2AHQA 1R9TJ 2W48A 1AHDP 4HG2A 2K7LA 2ZBKA 3KZZA 3ZGKA 2M0MA 3RKWA 2HEOA 3KYCB 2A69F 2AQFA 4S0HB 4RB2C 4BE0A 1MBHA 4LIVA 2F4MB 4DYRA 1FOKA 1E0EA 1YO5C 3WTYC 2ISYA 3V7CA 5GAHJ 1APLC 2CQKA 3SYTA 2Y9YA 4B44A 3MMYB 4ENNA 1ETVA 1NHAA 3HB9A 5J8CA 3S16J 3FK6A 2J5OA 2OTJI 2M4GA 4OMYA 1TT5B 3K4MA 2LK2A 5HODA 3LOCA 2DBBA 4IZZA 2M7AA 4ANJA 1SAUA 2RNJA 3OYKA 1NTCA 1ZKGA 2XRNA 2ID6A 4ITVA 1ORKA 3QQAA 3S2WA 2X1EA 1YS7A 1B8IA 2LNBA 4IRGA 4GYIA 1NG6A 2R5ZB 3IH3A 3MEXA 3HTSB 4XLNF 2K86A 3GUDA 5IT3A 2R5YB 2W4SA 1XS9A 2ZXHA 2K85A 1HKQA 3GX4X 4YIFA 2R7TA 2A68F 3BP8A 1OISA 1UG2A 2VBYA 3QAHA 4O3MA 1QNTA 4R79A 2IW5A 3MAJA 2F6CA 1MMSA 1ITYA 1SEUA 1FSEA 4BJTA 2XGXA 2XKOA 4BJ6C 3GZ6A 2QSHX 4XORA 2M0CA 2O7OA 4GYGA 1ZELA 4M72A 2DW4A 4NQWA 1REPC 2OUMA 1VNDA 3B02A 5JI6A 3TBIA 1USSA 4MFEA 4RS8A 2K02A 4XR6A 1P92A 5ICEA 4RB3C 3C7JA 3JREA 3LSPA 3ASNH 3CD6I 3G4SI 3B73A 1B6AA 2TRTA 4HLXA 4BBSJ 2NRAC 1JKPC 4JK1X 2LY2A 1LVKA 3KFWX 2CQQA 1I50J 4CCOA 1JTXA 3CTAA 3HUGA 5JLXA 4RAYA 3QP5A 4C3HJ 2XF6A 4KIFA 2Z5UA 2ISZA 2E5ZA 2CGPA 3WGGA 3CCYA 4E6KG 4IRHA 4J01A 2Y31A 2KZVA 1G3YA 2GOMA 5L3CA 3F23A 5CQEA 5HVQC 2Q8KA 5FLXK 5DV5A 1I1GA 2H94A 1D0YA 2DOEA 2EZIA 2DFHA 5B1AH 5EG0A 1E3OC 4ENMA 1KQ0A 1W36D 4RA2A 5ICCA 2R7ZJ 3H5AA 3ZOBA 3OYEA 4ASNA 3I59B 2O8KA 1KQ8A 1Z9CA 3DKYA 2OJED 2CV0A 2HKXA 3GTOJ 4PJJA 3PQJA 1BN5A 2R4GA 1I3AA 4XM3A 1A31A 2KMUA 2XGCA 2BVMA 2ME6A 1HLVA 3GZNB 2JQ7A 4M3DA 4UB8C 2MLGA 3QOEA 4CZCA 4MEYF 2K9QA 1S3JA 5FGMA 4GDFA 3JRGA 4BY1J 1JUSA 2HFHA 2O3FA 1T38A 2DMNA 5F0HA 5LEKA 1U3EM 4CO8A 3JCUC 3R6SA 1K78B 2F5VA 2QENA 3VSLA 2AXLA 5FB2A 1JGGA 2XASA 2H8RA 2IT0A 4GGGA 3EYYA 3I71A 2AO9A 1CF7B 1QBJA 1XSVA 3CCQI 3FHNA 3KP4A 4MLOA 1BC7C 3KX2A 1ZR2A 1MH3A 4BYYA 4B47A 1QHHD 4BY7J 2XROA 3CZ6A 5BS6A 3OS1A 2WB1A 2CV1A 4W1UA 3S3OA 4XIDA 2F5DA 3FMSA 1B4AA 4A0YA 3R60A 3C3WA 4PFOA 5KAFC 4ZYDA 1AKHB 3A03A 1BA5A 2HZTA 2RQQA 1WJ5A 3S1RJ 1A36A 3A4CA 2XF5A 1HC8A 2KIUA 3TQNA 2JPCA 3OR1C 5DCMB 4M3FA 4BKXA 1QO0D 1WJCA 3HIFA 1FBUA 4YELA 2VONA 4XLEA 3ERMA 3KYLA 3K4BA 2FSWA 3GF2A 4BEHA 5ICGA 3WGIA 2GXGA 2V6EA 3WTTC 2OZUA 2XSDC 3H3UA 3FM3A 2R0QC 5L3GA 2COMA 1F36A 1OLTA 4PUSA 4IVNA 4LG0A 4KMFA 4OOIA 3PIPF 4HF0A 3OL3A 5ERIA 4CDGA 1PJRA 3DEEA 4D1QA 3CC2I 1Y0NA 2EH3A 3AL0B 4DJAA 3H35A 1IV6A 5EZHA 1ZARA 4Q4ZF 3ZMUA 5LFAA 4NB5A 1XDSA 3TKYA 4UXNA 2K40A 4KDPA 2RQPA 3BCBA 1YJWI 2ESHA 1T0FC 2NNNA 2R92J 4C2MJ 2QWWA 5F1RA 2GOXB 2GA2A 1HQCA 3GEZA 2JA6J 1X4OA 4HRIA 4ABZA 2LC2A 4XRSA 4UV9A 1A6IA 4YG2F 2E71A 3HXLA 2QKLB 4H0EA 4EJVA 2MGQA 2L9NA 5DM6F 3H0GJ 1KONA 2L7MP 2KDZA 3ERED 3JW4A 3K4NA 1WQ2A 3K9TA 2E5NA 2MC3A 4YRVA 4EJWA 3HGYA 2XAQA 3BG5A 3I53A 3BJAA 1MMNA 2MW8A 2E35A 2R7VA 1GUUA 2BYVE 1LDKB 4UUSA 1VQNI 1FNNA 3CCJI 3ZPLA 2DMPA 2BGCA 2XPWA 2GLOA 4BXUA 5E79C 2V1NA 2L3DA 2CMPA 1IRGA 5D8KB 1P4XA 2QEXI 5K7FA 3JRIA 5H6RA 3V4GA 2DA5A 3BT9A 1HBXG 1RI7A 1LNWA 3PQKA 3DPLC 2KFDA 3D5RC 1O3SA 2NVUB 1HCRA 1BC8C 1TQPA 4O6JA 1LDDA 1YW7A 3I58A 1GV2A 3E6DA 4D0PA 3OYFA 3AG4H 3Q0WA 4BQQA 2VL8A 1J7KA 2H09A 5FLMJ 2WAFA 2PMZA 3DFGA 3ZQQA 1IDYA 4LB6B 3QOPA 3OY9A 3RQIA 3ZRGA 3VYSB 5JFRA 3E6MA 4FX0A 3PO3J 3MKWB 2JRTA 3TL4X 3KPHA 2W25A 1X1CA 4RGRA 3IC7A 3JTGA 1MKMA 1ZG3A 4FHTA 2WV0A 5J40A 2W00A 1UFMA 3Q5FA 4IRIA 1ETQA 2E1OA 1Y6IA 1U8RA 1OCZH 3AG3H 3NRVA 2DAOA 1HOMA 4UV8A 3IHUA 2DOFA 4F92B 2HXOA 3V8JA 2WY8Q 2R7FA 4IHTA 2KRCA 3FF5A 2BHYA 5FLXZ 1KGSA 1T08B 1SFXA 1XMKA 2HOEA 2BZTA 5FD6A 1SD7A 2GZWA 3OMYA 3CCSI 1RIOH 4AC0A 1EKEA 1S6LA 4G6QA 3QP6A 3WHBA 2JZYA 3K1MA 4LGWA 1Z6RA 2FEZA 1YITI 1B8IB 1CGPA 1GT0C 3SFIA 2H1LA 5D5XB 1TQIA 3PIOF 3QYEA 4CXFA 1MSEC 3D1NI 2NOJB 1QA6A 2LR8A 4XLFA 1YLFA 1WH5A 2R7SA 2P81A 3Q9SA 1J59A 3HPHA 4I76A 4XSZF 2BY2A 2H6CA 2PG4A 1IRXA 3COAC 5AIQA 1PUEE 3QPSA 3JRHA 1D8JA 1ZR4A 1R1TA 2FBKA 4N9HA 1GDTA 1IN4A 2FMLA 3GFIA 4NQWB 2EFQA 3R61A 1OJLA 2GXBA 3EYIA 4UNOA 3WODF 1IUYA 4IO9F 2H1KA 4A3IJ 5KNLA 3H9QA 2O03A 5E1XA 3TO6A 1L0OC 4HAMA 3OYGA 1D8KA 1FTTA 5EEAA 3ECOA 1QZEA 4CA0A 1JUMA 3HUGB 2OU2A 1ONVA 1OYIA 1W4MA 5JHFA 4A12A 2QGUA 1LB2A 3I56I 2P8TA 1TWCJ 2KRHA 2GWRA 2J5PA 3U9GA 4HLYA 1H88C 4JOMA 1Q1HA 1F5TA 4DYQA 5FFZA 4G7ZF 2CQXA 1JHHA 2R7WA 3AG2H 5C4XJ 3BR3A 4KT6A 2DU9A 1HW1A 4E7HA 1FLIA 3BG7A 4I7HA 5EG0B 3CMAI 4QPOA 4OIRF 3LSMA 5M5XJ 1P4AA 2WY7Q 2YU3A 3BTJA 2JTVA 3E6CC 4ESJA 1B9NA 4RDUA 3L00A 3S3MA 1T56A 1WGXA 2PJRA 2BE5F 4JQFA 4ZDOA 5LRRA 2DTRA 3GFJA 4HSRA 1H9GA 1KYWA 3Q0VA 4YEJA 3CCMI 3RI4A 2CSOA 1TWAJ 2DA6A 3FM5A 1MIJA 2M87A 3ELKA 4TV7A 2NVYJ 4U0WA 1MD0A 3V42A 3TW7A 3L7WA 3F21A 2HTSA 3WHCA 4F52A 2KKOA 4BDYA 3QPHA 3WG9A 1ZHFA 2QLZA 2DA7A 4PJMA 5JHUA 2X1DA 5D5UB 1H9TA 1MMAA 4R1HA 2GQQA 3H9JA 1Z0XA 1XGSA 3CUQC 2A07F 4ENJA 3SJMA 4CCNA 1HDDC 3R4KA 3BG9A 4DZPA 3OYNA 1X1AA 3R0JA 3EUHC 4K2EA 3DU6A 1JKRC 2B0LA 3V8KA 3P9KA 1TNSA 4XN0A 5BNGA 4NHJA 1VQ7I 1DPRA 1P4WA 2RVCA 2YPRA 5CLSA 2LF7A 2TDXA 1NH3A 3RYRA 4RAZA 2NS7A 2XRLA 2Y2ZA 4E7SA 3MCZA 1R36A 1U2WA 1NK2P 5GAGJ 3TO9A 1N77A 4V2GA 2PMHA 2XAUA 4M6XA 1D1BA 1GVDA 4U7BA 2DLLA 3PL8A 3OYBA 3FHZA 1CQTA 3ABUA 3C2GA 1DU0A 5J1YA 1F9NA 1BI3A 2NS0A 3I4PA 4XRSG 1MZBA 1XX5A 3CCUI 3KE2A 2P5KA 1KU2A 4B43A 3S14J 1JJ6C 4Y17A 1SVLA 3S15J 3IH2A 3RTRA 1LFUP 2L2OA 3FKIJ 4I98B 5GTHC 3BR1A 4BEHB 1J09A 3DF8A 4IHXA 2HOSA 2OAZA 2VPRA 3IKTA 1RR8C 1H8AC 1FOYA 3CLOA 3P7NA 3I4NJ 1XDUA 2A5YB 1I39A 2KIQA 2IBDA 1L3LA 2Q0OA 4LG0B 1DQUA 4A5NA 3M4OJ 3GFLA 5F08A 3K70C 5FRNA 1BL0A 3RZDJ 1SD5A 3OIPA 2DOAA 4ZZDA 2JN6A 2V4JC 3KP6A 2DDBA 3CJNA 1SVMA 1XCVA 2HVRA 2CRGA 2Z33A 3TOAA 5BQTA 4BU2A 1ZRDA 2DN0A 3K1NA 4XMYA 1ZRCA 2DA3A 2PJPA 1M1EB 3F6VA 1BJAA 1KU3A 2MD5A 1O7LA 2VBXA 3KLNA 2DQLA 3KYDB 4IHVA 4G8XA 4QSHA 4BS9A 3SFZA 4N9IA 4CICA 4NC8A 1Y56A 4BHCA 2M45A 1HDPA 2DMTA 2ZXJA 2HQAA 3BY6A 3N4MA 3GTQJ 4MQ9F 3M8EA 4AIKA 3FX3A 1D1AA 2CYYA 2VBWA 4U88A 2UWMA 2DXIA 4EM2A 1IN5A 5DM7F 1LJ9A 3IV5A 2VB6A 2F2EA 2D5VA 1D0ZA 1EH7A 4DIQA 2OPTA 3RKYA 3DEUA 5HNHA 3JRDA 1FWZA 1XTAA 2YS9A 3HOZJ 3L2CA 3LSIA 1FY7A 3VODA 2P6SA 3H92A 1N25A 2RN7A 3KP3A 4UUSB 1ETXA 4CUGA 1C0WA 3T8RA 2K3PA 2HGCA 2VXZA 2F5CA 5K5RA 2DPUA 1OCOH 2MABA 3A02A 1YE9A 2VE9A 4UB6C 4ZDPA 4HF2A 4KFCA 2IGNA 3C2HA 1F1ZA 3RJPA 3KP2A 3PNYA 1SFUA 1O3QA 4EVIA 1R4NB 1WRJA 1PVEA 2ZXWH 3HL2A 2AS5F 5L3BA 4KITB 2EZHA 3KP5A 2CS3A 2FE3A 1TBXA 3MKLA 3ML6A 2OA4A 2OQRA 5LRSA 1YI2I 3CLQA 3K1PA 3ZP5A 1GV5A 2DT5A 3VWBA 3PUBA 1RETA 4PSWA 1LFBA 3CUOA 2CUJA 3G2BA 3DBLB 4E7ZA 3K4JA 4D7NA 2E60A 3ZQGA 1PP8F 3DTEA 1FIPA 2HOAA 3ZMTA 1J5YA 4ON0A 2E36A 3FXUA 1HXDA 2FOKA 5KVRA 5LGTA 5KK1A 2EFNA 1WVRA 2E7WA 3PSFA 2Y48A 3AG1H 1J0RA 4FTHA 3IKVA 5E20A 3OYIA 2M30A 4HDUA 4PGHA 3KEYA 3X2QH 3J80K 4GFBA 1DDNA 3S32A 5HS8A 1IG7A 5CVIA 4HX7A 1H0MA 4HX8A 2VLAA 2Z3YA 4WWCA 3OOUA 1GHCA 3ZQLA 3OSGA 4M9SA 3DKWA 1Y0UA 2XAJA 5K5OA 4ESBA 2MH2A 3VSKA 4QIWN 2WBMA 1IUFA 1BOAA 5FJ8J 1X58A 5K7ZA 3QPTA 3RZOJ 3DPUA 2HDWA 2V6CA 3JSPA 3HHGA 4B48A 1MNMC 4KMUX 3GLLA 1P7IA 4LOCA 3OYHA 2KRFA 2WWYA 2VQGA 1QPIA 1Z91A 1UJ8A 2ZJQF 1U5TC 2DTZA 1LVAA 1S7EA 4BAYA 2KHMA 4AIHA 3DEWA 3LSJA 2CFXA 1JT0A 2LD5A 2L7ZA 3B6AA 1YX5A 1TL8A 3IAS2 5CPRB 4BHBA 3NWTA 2ESNA 2Y0MA 1EH6A 4YFXF 1AOYA 4B4CA 4IHWA 2W24A 1V5EA 3VOEA 5J1UA 5F1JA 5CVUA 4XN3A 2GBYA 5E8GA 2CUEA 2HYJA 2VE8A 4M9XA 3VFZA 5IYDJ 5DD8A 1Y1VJ 2ZB9A 3W2VA 1MNDA 3FDYA 3KEQA 3CCEI 3JRFA 1JE8A 2DJIA 2KJCA 2O9LA 1DGWY 2IA2A 1XGNA 3H1CA 2UXXA 4UVAA 3LA3A 2BVLA 3K10A 4HBLA 3WU0A 1OFCX 1OMIA 3HRTA 2IS2A 4EV0A 3SZTA 2L01A 1FMWA 1PDNC 4HQMA 1XG1A 1XD7A 3PO2J 5LLQA 3GTKJ 2D45A 1ZLKA 4U0YA 3HOTA 4HOBA 2HDCA 4EM0B 4RAGA 2Y30A 1IJWC 9ANTA 3GTJJ 1YG2A 4X0GA 4XOPA 4ZYAA 1FOWA 2EBIA 5HS7A 4IQJA 3SEZA 4ZYHA 1X3UA 2KPMA 3CMMA 2JA5J 4X6AJ 5HLGA 2G7HA 3CO6C 1DPUA 4Y4RA 1R23A 4CH7A 3F8BA 4QPQA 1R71A 2PJRB 3JR9A 4LLNA 3ABTA 1ETKA 3WU1B 2DPDA 2G0EA 5FKMA 2EIKH 3BCAA 4ZTJA 1BW5A 1KZHA 2ZC2A 2EINH 4G12A 1U0JA 2XF7A 2ZNYA 1IO2A 2LY9A 2EA4A 2VT3A 2LP0A 3IWZA 2A6EF 4UUVA 4OIPF 5EEHA 2QCOA 3OL4A 1RNLA 1JT6A 1G59A 2A61A 2YX7A 4ETSA 1HA8A 3RIRA 3N05A 3DQVC 2XAFA 1TWGJ 1X3WB 1JTYA 5F6FA 4HA8A 2K9LA 4LFUA 2O0YA 3BPVA 4WK8F 3I3LA 4PGGA 2D2WA 2VBZA 2M8GX 1Y1WJ 4JP0A 2K27A 3EQLF 4UVBA 5IP9J 3GVAA 5B5EC 4ZYGA 2LMDA 3L2RA 1G3TA 5GADJ 3DPTA 2G7UA 1JHFA 3J7ZI 5J4YA 2V9KA 4L9TA 1HF0A 2JVGA 5CJ9A 1IRFA 1MMDA 1YIOA 1BIBA 5FRMA 1D1CA 1O57A 1LQ1A 4XK4A 2F5FA 2P6TA 1R49A 2L9SA 4AUXA 4XLHA 5E1WA 5C44J 3ZQFA 5DDGA 4IX7A 2LF8A 2PLYA 2OC6A 4L0YB 2LFBA 2IGMA 3T0YA 3W2AA 2JRMA 3BOQA 3EPZA 1FP1D 3V7RA 4ZTFA 2ZJRF 1SMTA 4RM2A 5TJJA 2R7UA 4M6VA 1ACIA 2CH0A 4CCMA 1OCCH 4M3BA 3HRUA 5J4VA 3HSFA 4HNTA 2FNPA 1ZTRA 5IT9Z 1AA7A 3G1OA 1ON2A 4BGDA 1DP3A 6PAXA 2EILH 2QKMB 4XNFA 3VYRB 3ABMH 4AM3A 1UHWA 1G6NA 4LMYA 4EATA 2DMUA 1D0XA 3D5SC 2EFWA 5DS9A 3GTLJ 2IAIA 3PNTA 1UMQA 3BDDA 2VKDA 3ULQB 4XKCA 2ZMEC 5IYCJ 2H8WA 2HZDA 4MGRA 4IL6C 4G7OF 5LHIA 2FD5A 1RUOA 1YS6A 4RGSA 3BQYA 2ADUA 4BXXJ 3BG3A 1B59A 1Q1VA 3M7GA 2B9SA 5HS9A 3E7LA 2L9RA 3J80Z 2M4KA 1EH8A 2IS6A 4FX4A 3HEFA 2KL4A 3CQZJ 5KCMA 4EJOA 2X51A 2K4BA 5B3SH 2P5LC 1R1UA 4AYBN 2QM3A 3F8CA 4P96A 2L0KA 2MA3A 5LGNA 3DTKA 2ME0A 2PI0A 1X2MA 1FYMA 5J1RA 3W6JB 4F7ZA 3EDPA 1FPQA 2HWVA 4A93J 1E2XA 4RGXA 3MZHA 3AFHA 2VXDA 4L9NA 3HRMA 3M9AA 2IA1A 3G71I 1VZ0A 4II2A 3OOPA 4BBRJ 1IAWA 2BOLA 5D4SA 4NDLA 3J81K 2IJLA 3CMEI 3E3VA 2MBFA 2XUBA 2Z1DA 2VOPA 2H6BA 4YIIA 1IW7F 3Q3SA 3M3YJ 2XPUA 4L5JA 5DTDA 1HSTA 2CU7A 3P9IA 4M6YA 3L2WA 2ICWG 4LJZF 3ZXSA 2OD5A 2R7RA 3LSTA 1ZK8A 1MH4A 5JVTA 2UZKA 2MG4A 2MFZA 3FXLA 4CYCB 2XDVA 1ON1A 3BLYA 5IP6A 2MC4A 3HSRA 2XC7A 2FA5A 2M2EA 3FKJA 1TZLA 1YJNI 5HLTA 1PYVA 1FBQA 4XLAA 4LG3A 5ILVA 5CVVA 4HNUA 2HQNA 3H9GA 2A05A 5E17F 2M8EA 3IH4A 3VB2A 4EMSA 4DBRA 2VPLA 2FF4A 1IRZA 2VC1A 2VIXA 4PJLA 4DGWB 2CW7A 3RKXA 2VN2A 2L54A 1D3YA 3FBIB 4Y3OA 1S7AA 4QWQA 3W6VA 3F8NA 3CC4I 1I1SA 1JUPA 2CW0F 4IOCF 5DD4A 3CC7I 2EZLA 2ID3A 3MZYA 1DUXC 1PUFB 2EA2A 4G94A 3G1MA 1P2FA 2E1MB 2W57A 4PJNA 2HXIA 3RSNA 3SDGA 3KIOA 1OQYA 1X4PA 1VQ4I 4RBOA 1X19A 3V7SA 5IY5H 4B1RA 3CF2A 3OYMA 2DDAA 2RNGA 3SQNA 1RKWA 5B1BH 2HKOA 2BHZA 4KICA 2KQRA 4A6EA 4KISA 4JYKA 1T6SA 1SFKA 4KN7X 5GP9A 4A6DA 2QSFX 4C30A 4I01A 1YHQI 2QQBA 1WSUA 3D5LA 2EB7A 1ZG5A 3CCVI 4A69C 3MN2A 4B8XA 5GPCA 5LEJA 3K6GA 4I09A 2L7FP 1XSXA 3L9FA 5IP7J 3WU2C 4CHUA 1WFXA 4XICA 2BXYA 2NYXA 3C2BA 3QODA 1IN6A 3F72A 2DK5A 2CQNA 2E2JJ 1I6XA 2VASA 1IGNA 1LUJB 3LMMA 3VYTB 3L1PA 3CCLI 2E19A 1R22A 3BR0A 2OV7A 4AVZA 2IPQX 4L9VA 4CSWA 2JVHA 2V7FA 1W7PD 3OYAA 4HSTA 5D5WB 5E1ZB 4EJUA 4RAFA 4E7IA 3CDLA 1FTZA 2EV6A 2K9NA 4IOAF 1FBSA 1FP2A 4XBFA 1YIJI 2V1DA 3DU5A 2WADA 1RZ4A 1B72A 4AIJA 2XVCA 3DCFA 1FYKA 1TP4A 1Z3XA 1TQMA 1TC3C 2Z2SB 2X85A 1ZAOA 1ZYRF 2I8DA 1E3PA 2JSPA 2Y75A 4XKVA 1WHUA 1WI3A 2XAHA 1LEAA 2VI6A 5C4JJ 3ZMSA 3K70D 4NBQA 3GTMJ 4JX4A 2H27A 3EUAA 4I0AA 3C1DA 1FMVA 3EETA 4KJZA 1QGPA 4CCKA 4XL9A 3SEQA 2KLOA 4C3JJ 5EDNA 3OWTA 4L5EA 3PFIA 3TDZC 3WGHA 3K4CA 4B3XA 2JT1A 4BUPA 4ZJZA 3N97A 3W6KB 4U7DA 1N78A 4LK1F 1LEBA 3AL0C 5HDGA 2QQAA 1FYLA 1WZ2A 3HSEA 3HJEA 4KT5C 4MIMA 5EZGA 5J8FA 1SANA 2F4IA 1FSHA 3PNVA 4IXAA 4UY8I 2YSRA 1J2XA 3TP0A 1UHSA 1UZCA 1BM9A 5D8LB 3MVPA 4IQ4A 1FIAA 2COBA 2LKSA 5KHDA 4NC7A 4L5IA 1IXCA 4FASD 1LDJA 4A2UA 4OINF 1WJAA 2FQ3A 2W85A 3OIQA 2EQRA 1W0UA 1FZPB 5E3OA 1R00A 1QZZA 2ZNZA 1JI8A 5F0FA 4Q5SF 2FOWA 1TT0A 5DCFA 4XLPF 2HYGD 2LRDA 4HDVA 4A3DJ 1V3FA 4NC6A 3A01A 2DFEA 3S3NA 2HPMA 1I5ZA 1PP7U 3HKZN 4W97A 3SZGA 2CUFA 1O7FA 3VPRA 1ZQ3P 2FUG2 4GRIA 1KQ9A 2EV5A 2EJRA 3K2ZA 3WE2A 1XMXA 1YW8A 1NK3P 2QVOA 2YR2A 5FKOA 1QZYA 3BJ6A 3ZN1A 1FT9A 1BIAA 1U9NA 2A6HF 1TLHB 4A3MJ 1OR7C 1WKMA 4WXDA 2A3SA 4XRFA 3CDIA 3DV8A 2MH9A 3RPQA 2GM4A 2JA2A 1TW2A 2O5RA 4HW0A 1Z1DA 1U8BA 5IOYA 4EJTA 1HSJA 1G3SA 1T95A 3E5QA 4LD5A 1ZH5A 2EWNA 1GVJA 2Y0SN 3PM1A 4ZH4F 3G6EI 2RAEA 1BBYA 5ILUA 1O4XA 2JUCA 1WJFA 3EUHA 5JVGF 3TOBA 4UUTA 3J7AY 2R3SA 4XOTA 1V5FA 1FJLA 1DGRM 2DFFA 1G2HA 3BTIA 3J81Z 1R5HA 3ONQA 3F9KA 4WX9A 1GXQA 1LE8A 3M1CA 1YFHA 2NXNB 2KP6A 5FLVA 4MTDA 4D5CA 2E1CA 3LA7A 4XSXF 2ZFWA 3GBGA 2VUMJ 3SDBA 2QF7A 5EF6A 4M74A 3QRFF 1ZGWA 3KP7A 5FD5A 5HNFA 1EJ9A 1MMGA 3HHHA 4EEFG 4ZC3A 1W7PA 2RV8A 1KU7A 2K9SA 3ROUA 3MQ0A 3HPGA 2WA0A 4PZJA 2RC4A 2STTA 2ZXIA 4X1EA 3AKZA 3BTLA 4F55A 1T8IA 5EJCA 1UG0A 2O8XA 4C9YA 3DP7A 1S7OA 4FT8A 1RRJA 3S1QJ 1MBGA 3LNQA 1MJBA 2C6YA 3C18A 4XLCA 2X0LA 1BI1A 4I02A 1ERDA 3TP3A 2JWTA 2X6OA 1DP7P 3CF5F 4JX5A 1MBKA 1TTYA 1MJ9A 2CV2A 3T8TA 2W82A 3LSKA 4RLFA 5A2QK 5IT9K 1MNEA 2HNHA 1JKOC 1SVOA 3VYUB 4DW6A 4DQ2A 2CUZA 2DODA 5TRDA 2O6GE 1G8XA 2XAGA 4IF4A 3RPUD 4DNCA 4CYCA 2WAQN 1K61A 2PX9A 2IGKA 2HQRA 1EA3A 1QU3A 2XGDA 3DBHB 2ECBA 4PSXA 2CFOA 4MTEA 3IUOA 2V9VA 1K4SA 2LBFA 2XKPA 3VEPA 2XGEA 1WPKA 3NWSA 3WTSC 1Z3YA 5IOZA 4E7JA 4L18B 1YRNA 4I6ZA 1B1BA 4EGZA 1UHMA 2K4JA 1KU9A 2MYSA 2BV6A 2UV1A 1ETWA 3WE3A 2HU9A 2BW3A 4UVCA 5KAIC 4E4HA 1ZG1A 1W5CC 3DBRB 4HYEA 3CO7C 3PUFA 3FWEA 5GTIC 2HVSA 4IKFA 2LG4A 1TWHJ 2WTEA 2A5WA 3LQQA 3F3XA 2M7BA 4MQVA 1PUFA 1RUNA 1FC3A 2FBIA 1XSDA 1WH7A 4I0BA 2PEXA 1Z7UA 5K1YA 3ESWB 4J19A 2KT0A 1IXRC 2DA1A 3OYJA 4KNYA 1K6OA 1I27A 5CVJA 5F64A 5M3MJ 2GIZA 2M3AA 2X9DA 3VDXA 3L09A 1D5YA 3O3KA 1IN7A 5J6XA 2HS5A 2NVTJ 1G3WA 3BJOA 5M5YJ 3I64A 4HNVA 3GXOA 4A3KJ 3TW6A 3TGNA 2IXSA 1KA8A 2X6XA 2XHKA 4I2OA 1D5VA 3WTVC 3WG7H 3HBLA 1IF1A 2B7EA 2Q1ZB 4OMZA 2WAEA 2HR3A 3M8FA 5DUIA 1VQKI 2X48A 2FNAA 1A5JA 4CZZA 3E97A 4KYWA 2DA4A 3F8FA 1IN8A 3U1KA 4R8HA 2YU9J 2FBHA 4AU7A 1R5GA 2GAUA 1LKXA 2E2IJ 3ZQCA 2JK3A 1HKTA 2P7VB 2ELJA 3EUKL 1MSFC 1T98A 4PDKA 2ZO4A 2LYCA 5FKLA 2QBYA 1WJDA 4S05A 3MFKA 1IV8A 4FISA 1A6QA 3Q9VA 3LL7A 4MHGA 5L3FA 3LFUA 3RYPA 2BY1A 3BTCA 5D6FA 2L02A 2JA8J 2BXZA 4CCLA 5JR3A 2W7NA 3J7AO 1YW9A 2P0WA 3KZYA 2QSGX 4C2UA 3CMYA 4P55A 2HOTA 2R7XA 4UHTA 4DZJA 5FO5A 3QU6A 4EM1A 3HDDA 3H5RA 1U5TA 1H89C 3PFYA 2X4HA 4U0VA 2LVSA 1LPQA 1QHGA 2XB5A 1ETOA 3DXJF 3A1YA 4Z2YA 4Y15A 3FIWA 3NEUA 4QTRA 1VQ6I 2CQ7A 3RDIA 4CCJA 3I55I 3F0CA 1HW2A 4AYBA 3HGGA 3LSGA 4KA4A 4A3BJ 1Z6TA 3QYBA 1O3RA 5E3LA 4BXFA 4P1WA 2M1BA 1B72B 3CESA 3UNGC 3GYHX 1R7JA 1ENHA 1U6GA 3RPUA 4DOZA 4BQAA 3A0HC 2GIVA 3GZ5A 3WTUC 3GMEA 4A5MA 4C2TA 3BR5A 2OF7A 4AD9A 1R1VA 5LHGA 3HOVJ 1Z05A 4WCGA 1QVUA 1T39A 1SD6A 2VKVA 1AWCA 4FETA 3ZR8X 1AU7A 1XN7A 4KUMA 5EGOA 2HQ5A 4IEJA 2HDDA 4FQGA 5D5VB 1VF9A 3U2RA 4OAZA 1UCRA 1E17A 5FKNA 3BROA 3M1EA 2JSCA 2K5CA 1A04A 1MDMA 3LAPA 4IHYA 4N0BA 4FE7A 3KCCA 2D1VA 4OWRB 3RQ4A 5B66C 1U78A 2MD0A 2G9WA 4E7KA 1IZ1A 2O61A 5HDKA 4OIOF 3K0LA 2VOOA 2OCCH 1UAAA 4BE1A 1VQ8I 1VQLI 1JKQC 2X6YA 1ZREA 4M71A 1GXPA 2XSJC 1V4RA 2EFOA 3ZCOA 3OYDA 1F4KA 2HVQA 4GXOA 2D1HA 5GPAA 3G1LA 3HRSA 4KN4X 2ZKZA 5L3DA 4BE2A 4Q48A 3A01B 2NNYA 2FU4A 2UUZA 1WI9A 2WC2A 1BOBA 3IAM2 1YX3A 2FMYA 3DKXA 2XB0X 3Q0UA 2QYOA 4A3LJ 2STWA 2X6WA 3ISPA 5L3EA 3LAJA 2IS4A 2KZGA 4II3A 3GW2A 4DYCA 1OPCA 4ZZLA 1W36C 5M5WJ 1KYZA 4LLLA 3CJTB 3WTXC 1Y39A 1VQOI 2IEKA 1VQMI 1Z21A 2F5EA 4IJAA 2DMQA 5FFXA 2OBPA 5BMZA 1ODDA 3FBNB 3O6BB 2DT7B 2IA0A 4PFPA 4U87A 5A2QZ 3A2KA 4HPQA 3RCOA 3LSRA 2LY1A 2ACJA 4BACA 2E34A 4OIQF 3CUQB 5LD2C 2M9HA 5E18F 4XRMA 1V55H 3REOA 2V9PA 4JBAA 3HOXJ 1LFPA 2ZJ2A 3K4KA 1BW6A 5LBQA 4G6DA 2QA4I 2VJ5A 4A0ZA 4E7LA 2JPBA 2OCEA 3JAMK 3SXYA 2QUFA 4MFDA 3E5UA 1IXSB 1ZRFA 1V5GA 4G9YA 4H4KC 4YFKF 4NUBA 1LE8B 5FROA 3IRRA 1O3TA 4F93B 1ZGAA 4F91B 3UKGA 3GLXA 4L0ZB 1EF4A 3BC8A 3S17J 2XV4S 1ZLJA 2K3FA 3HG9A 2PFBA 5JLWA 3WTWC 4EGYA 3S1MJ 2I5UA 3CCRI 4A3GJ 1W7PB 1MW7A 3ABKH 4BNCA 1EV7A 1W5TA 1G4DA 4PCQA 3SZPA 3JRAA 4Y13A 2GA1A 3M07A 5BPDA 1X1DA 2N8GA 4YIRX 2E1NA 3F6OA 1UELB 4ESFA 3ABLH 2Q2EA 1HKSA 1YYVA 1HW5A 3I5UA 1WWXA 3DLLF 4NNJA 2AXTC 1T0FA 4XQFA 3GWZA 2X1CA 3GCMA 3HOUJ 2VQLA 5GAEJ 3OSFA 5TGTA 4Z6YA 4ENKA 2LKXA 2EFPA 4BDZA 2ELHA 4A3FJ 3W2WA 2RKHA 4V19K 3JRCA 3U1DA 1VI0A 2DO7A 5BPIA 4M3EA 4P9FA 1QVTA 1IC8A 2UXNA 1XPXA 2ZMEA 3LSHA 3L2VA 2RGVA 3MWMA 3T5XA 1K83J 3DTIA 1V54H 3QPLA 3ZQIA 3PJRA 3GTPJ 2DFIA 2CO5A 2RREA 2ZFUA 2PQ8A 3CJRB 4A3JJ 2VJIA 1VTNC 2JA7J 2V79A 4CGZA 3P5JA 2R7DA 3FXKA 1W0TA 2ZSHB 2WV1A 3GTGJ 2WB1N 2VJ4A 1DU6A 3QYFA 1BI0A 2LBFB 1B9MA 4G6TB 4AWXB 4Q47A 2R93J 3JRBA 2PBIA 5H2FC 2VQCA 1YRNB 3KZIC 3K2AA 3UR3C 4MNUA 5CYVA 1RESA 1Y8QB 2BW3B 3FXRA 2HTJA 1S29A 2L5QA 3H0DA 5HLIA 5IPAA 2NVQJ 3BWGA 3O2PE 4C3IJ 3FXQA 3QU3A 1BI2A 3KLOA 1K6YA 3ZN0A 4RM3A 3HKZA 4HEA2 4MO7A 5EGOB 2R5ZA 1BR4A 1WJEA 2ZCWA 4LITA 3HM5A 2R5YA 3E0JB 2MSYA 2F48A 2QQ9A 3KETA 3HOSA 4A3CJ 4IPAA 1VQ5I 1OCTC 3B6CA 2FQ4A 4RLQA 2JMWA 2VT2A 2DA2A 3NAUA 4FE4A 4LIUA 2DJNA 5J47A 3BG6A 1GLNA 2LKPA 1BJZA 2Z99A 1SAXA 4RMNA 1FOXA 2NAZA 3LA2A 1TW3A 2DQRA 4CYDA 4BHPA 4HZFA 3WTZA 1S72I 3FXMA 3K7AJ 2OQGA 3I0TA 3U21A 3JTHA 2BBYA 3E5XA 2Y0SA 1UB9A 3LFKA 3FXOA 4XONA 2P4WA 2W84A 5AONA 1SC7A 1SD4A 2RDPA 1ZGJA 4I99C 3IL2A 2Z16A 4Y7NJ 3LWFA 3H3ZA 1T33A 3FZVA 3HTUA 3S93A 3K69A 1YJ9I 1WJBA 2CG4A 2JUGA 5D6EA 1E3HA 1MBEA 4HX4A 1SMYF 4RB1A 4P5OA 2LREA 4F3QA 1U9OA 1XB4A 5E3MA 2QBYB 3BPXA 1P6RA 2LTPA 3E1SA 1N75A 1RR7A 2JJ7A 4A0XA 1XCBA 3R0AA 3IWFA 1XGMA 2HYFA 2FRHA 3L2UA 3H36A 2XIGA 4GCVA 5ILSA 3W3CA 3PSIA 3OS0A 3I59A 1Z77A 2LH9A 3ASOH 5DEQA 1XC5A 2ECCA 5F0CA 1JGSA 2HI3A 2MLKA 3BR6A 3FMRA 3O8HA 2IRFG 1FEXA 4Y52J 5J3LA 1U5TB 2HPIA 4JX6A 3BQZA 4O5VA 4BH9A 5H20A 4PK4A 4D5FA 2I10A 5K7HA 5HOOA 3S2HJ 1J9IA 4XKBA 1OYYA 1K7AA 3HYIA 2KDOA 4ZDLA 4B09A 5LHHA 2KISA 2ELKA 1X2NA 2L4MA 4BQNA 4KIGA 3ZMDA 4PJ0C 3ZQHA 3L2QA 4M73A 4D7MA 3F22A 1K78A 1ULYA 5AIPA 2LLKA 2PMZN 4IHSA 1MBJA 1WCMJ 3CP2A 3I54A 1X1BA 3SHFA 2QZ8A 1X3ZB 1MJAA 2DT6A 2Y69H 1Z7LA 4GO1A 1RKTA 3H5NA 5ED4A 3RKQA 1CF7A 2VODA 3MKZA 3TMOA 5IYBJ 5M3FJ 2WAQA 2Z9OA 3TDUC 2CWEA 2DYSH 1K79A 5CVRA 3MKYB 3H3VK 1IDZA 4E70A 3TO7A 3OYLA 2M5WA 2P7CB
chains in the Genus database with same CATH topology
3PIPF 1FOXA 3CCLI 2ZJQF 3G71I 3CCMI 3CC2I 2K3FA 1S72I 3G6EI 3CCRI 3CMEI 5JVGF 5DM7F 5GADJ 4IOAF 3J7ZI 1YIJI 1YJWI 3J7YJ 2NXNB 3CCSI 1YJ9I 3DLLF 5GAEJ 1YITI 1YJNI 1VQ8I 3CCEI 2JQ7A 1VQLI 3PIOF 2OTLI 1VQ7I 4V19K 5GAHJ 5DM6F 1QA6A 1VQPI 1VQKI 2OTJI 2ZJRF 5GAGJ 1ACIA 1YI2I 2E35A 1VQNI 3CCJI 3CCUI 3CC4I 3CC7I 4IOCF 3CCQI 4UY8I 2QEXI 4IO9F 2E36A 3CF5F 1FOWA 3CJTB 1Y39A 1VQ4I 1VQOI 2H8WA 1VQMI 1FOYA 2FOWA 1MMSA 1VQ9I 3I56I 1HC8A 2ZJPF 2E34A 1YHQI 3CD6I 3CCVI 2QA4I 3G4SI 1VQ6I 3I55I 1VQ5I 3CMAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP F;  1FOX A;  3CCL I;  2ZJQ F;  3G71 I;  3CCM I;  3CC2 I;  2K3F A;  1S72 I;  3G6E I;  3CCR I;  3CME I;  5JVG F;  5DM7 F;  5GAD J;  4IOA F;  3J7Z I;  1YIJ I;  1YJW I;  3J7Y J;  2NXN B;  3CCS I;  1YJ9 I;  3DLL F;  5GAE J;  1YIT I;  1YJN I;  1VQ8 I;  3CCE I;  2JQ7 A;  1VQL I;  3PIO F;  2OTL I;  1VQ7 I;  4V19 K;  5GAH J;  5DM6 F;  1QA6 A;  1VQP I;  1VQK I;  2OTJ I;  2ZJR F;  5GAG J;  1ACI A;  1YI2 I;  2E35 A;  1VQN I;  3CCJ I;  3CCU I;  3CC4 I;  3CC7 I;  4IOC F;  3CCQ I;  4UY8 I;  2QEX I;  4IO9 F;  2E36 A;  3CF5 F;  1FOW A;  3CJT B;  1Y39 A;  1VQ4 I;  1VQO I;  2H8W A;  1VQM I;  1FOY A;  2FOW A;  1MMS A;  1VQ9 I;  3I56 I;  1HC8 A;  2ZJP F;  2E34 A;  1YHQ I;  3CD6 I;  3CCV I;  2QA4 I;  3G4S I;  1VQ6 I;  3I55 I;  1VQ5 I;  3CMA I; 
#chains in the Genus database with same CATH topology
 5E3N A;  1I3Q J;  2TCT A;  2V26 A;  2K9M A;  4OU0 A;  4KIB A;  3OV8 A;  4WF2 A;  1AKH A;  2IVM A;  1YOV B;  2XPV A;  4HV5 A;  5K5Q A;  3G3Z A;  3JAM Z;  1XMA A;  4HV6 A;  1ETY A;  4BL0 B;  2VQH A;  1STZ A;  3IRQ A;  2CW8 A;  2EIJ H;  1SFO J;  1R6R A;  1MDM B;  2PN6 A;  1UST A;  2ZSI B;  5DCM A;  1RC9 A;  4G7H F;  3CJQ B;  4AVP A;  3MD2 A;  5HDN A;  1JXS A;  3BZC A;  5LGU A;  4LB5 A;  5D4R A;  1A35 A;  1OKR A;  1W1W E;  2PMU A;  5DYM A;  4P9U A;  1QQI A;  1JJ8 C;  2VKE A;  5HLH A;  1QPM A;  4WXH A;  2BY3 A;  4ZYE A;  1RPW A;  3M8J A;  3ZMZ A;  5H6Q A;  3J7Y J;  3NAR A;  2VKH A;  3HOY J;  4XKW A;  3JSO A;  3BZK A;  2EPF A;  5EYR A;  1QRY A;  2A6T A;  2KJB A;  4N4O B;  1POG A;  3OR2 C;  4B3A A;  3CUQ A;  2BY0 A;  5CQG A;  3NQO A;  5BOX A;  1X1P A;  4QLC U;  4LK0 F;  4RGU A;  4BQO A;  1T2K A;  1OYW A;  1BR1 A;  3ZMV A;  4MEX F;  2OTL I;  2YUS A;  2QQ8 A;  2GXA A;  2EV0 A;  2DYR H;  4LLG F;  1VQP I;  4M3G A;  2YX4 A;  2KIF A;  3DLA A;  4RB0 A;  2ETH A;  3ZQ7 A;  3D0S A;  3T1B A;  1BR2 A;  2IP2 A;  2M34 A;  3F8M A;  4J00 A;  4HQE A;  3LQR A;  2LDU A;  4FCY A;  2FX0 A;  4V2F A;  3I4M J;  1ZN2 A;  1S8N A;  3FMQ A;  2IGO A;  2KIM A;  3BZ6 A;  4N4N B;  1W5S A;  4A3E J;  5E8I A;  2B63 J;  3OYC A;  2DI3 A;  3I9V 2;  1MBF A;  3FIS A;  3FXJ A;  4EQQ A;  3MZ8 A;  4OAY A;  1Y8R B;  5FKK A;  2IS1 A;  3BR2 A;  3GO5 A;  5C3E J;  3DWL E;  4L9J A;  3S2D J;  1P7J A;  2LOO A;  1OR7 A;  1S9H A;  2LSO A;  5F27 A;  4BJ5 C;  1VQ9 I;  2EK5 A;  5DUK A;  2ZJP F;  2EZK A;  1TWF J;  3G73 A;  3HC7 A;  2NS8 A;  3E6B A;  3S8P A;  1R5I D;  2BEO A;  1K4T A;  3HOW J;  1F43 A;  3O8G A;  1MGT A;  2VJJ A;  4D9J A;  2DK8 A;  2DCE A;  1S5L C;  5F04 A;  4HF1 A;  2EIM H;  5TIS C;  3V8L A;  3CP8 A;  2L4A A;  1TNT A;  4AID A;  3IP4 B;  1FX7 A;  3A0B C;  3P9C A;  1VFC A;  2R7O A;  2CJJ A;  1YTY A;  3AAF A;  2Q2E B;  4S04 A;  2V1X A;  4DBQ A;  1OCP A;  2R7Q A;  3K4L A;  1J75 A;  2AQE A;  5CKT A;  4Y33 A;  4M9Z A;  2E7X A;  3KEO A;  2NVX J;  1OCR H;  2E1M C;  5ICF A;  5EEG A;  1SFE A;  2E2H J;  3OIO A;  2Y9Z A;  1YQA A;  2L7K A;  2FJ1 A;  2V1U A;  3S1N J;  2W1O A;  3FK7 A;  2OZ6 A;  4YFN F;  1R58 A;  1P9Q C;  3CDH A;  1I6H J;  1NG7 A;  2F4O B;  2P5V A;  3OS2 A;  3TED A;  2ZME B;  3HZJ A;  1Z67 A;  2FXA A;  1XGO A;  2L9V A;  3GFM A;  1R4M B;  2NOG A;  3ECH A;  2VC0 A;  3QWL A;  4WXC A;  2AHQ A;  1R9T J;  2W48 A;  1AHD P;  4HG2 A;  2K7L A;  2ZBK A;  3KZZ A;  3ZGK A;  2M0M A;  3RKW A;  2HEO A;  3KYC B;  2A69 F;  2AQF A;  4S0H B;  4RB2 C;  4BE0 A;  1MBH A;  4LIV A;  2F4M B;  4DYR A;  1FOK A;  1E0E A;  1YO5 C;  3WTY C;  2ISY A;  3V7C A;  5GAH J;  1APL C;  2CQK A;  3SYT A;  2Y9Y A;  4B44 A;  3MMY B;  4ENN A;  1ETV A;  1NHA A;  3HB9 A;  5J8C A;  3S16 J;  3FK6 A;  2J5O A;  2OTJ I;  2M4G A;  4OMY A;  1TT5 B;  3K4M A;  2LK2 A;  5HOD A;  3LOC A;  2DBB A;  4IZZ A;  2M7A A;  4ANJ A;  1SAU A;  2RNJ A;  3OYK A;  1NTC A;  1ZKG A;  2XRN A;  2ID6 A;  4ITV A;  1ORK A;  3QQA A;  3S2W A;  2X1E A;  1YS7 A;  1B8I A;  2LNB A;  4IRG A;  4GYI A;  1NG6 A;  2R5Z B;  3IH3 A;  3MEX A;  3HTS B;  4XLN F;  2K86 A;  3GUD A;  5IT3 A;  2R5Y B;  2W4S A;  1XS9 A;  2ZXH A;  2K85 A;  1HKQ A;  3GX4 X;  4YIF A;  2R7T A;  2A68 F;  3BP8 A;  1OIS A;  1UG2 A;  2VBY A;  3QAH A;  4O3M A;  1QNT A;  4R79 A;  2IW5 A;  3MAJ A;  2F6C A;  1MMS A;  1ITY A;  1SEU A;  1FSE A;  4BJT A;  2XGX A;  2XKO A;  4BJ6 C;  3GZ6 A;  2QSH X;  4XOR A;  2M0C A;  2O7O A;  4GYG A;  1ZEL A;  4M72 A;  2DW4 A;  4NQW A;  1REP C;  2OUM A;  1VND A;  3B02 A;  5JI6 A;  3TBI A;  1USS A;  4MFE A;  4RS8 A;  2K02 A;  4XR6 A;  1P92 A;  5ICE A;  4RB3 C;  3C7J A;  3JRE A;  3LSP A;  3ASN H;  3CD6 I;  3G4S I;  3B73 A;  1B6A A;  2TRT A;  4HLX A;  4BBS J;  2NRA C;  1JKP C;  4JK1 X;  2LY2 A;  1LVK A;  3KFW X;  2CQQ A;  1I50 J;  4CCO A;  1JTX A;  3CTA A;  3HUG A;  5JLX A;  4RAY A;  3QP5 A;  4C3H J;  2XF6 A;  4KIF A;  2Z5U A;  2ISZ A;  2E5Z A;  2CGP A;  3WGG A;  3CCY A;  4E6K G;  4IRH A;  4J01 A;  2Y31 A;  2KZV A;  1G3Y A;  2GOM A;  5L3C A;  3F23 A;  5CQE A;  5HVQ C;  2Q8K A;  5FLX K;  5DV5 A;  1I1G A;  2H94 A;  1D0Y A;  2DOE A;  2EZI A;  2DFH A;  5B1A H;  5EG0 A;  1E3O C;  4ENM A;  1KQ0 A;  1W36 D;  4RA2 A;  5ICC A;  2R7Z J;  3H5A A;  3ZOB A;  3OYE A;  4ASN A;  3I59 B;  2O8K A;  1KQ8 A;  1Z9C A;  3DKY A;  2OJE D;  2CV0 A;  2HKX A;  3GTO J;  4PJJ A;  3PQJ A;  1BN5 A;  2R4G A;  1I3A A;  4XM3 A;  1A31 A;  2KMU A;  2XGC A;  2BVM A;  2ME6 A;  1HLV A;  3GZN B;  2JQ7 A;  4M3D A;  4UB8 C;  2MLG A;  3QOE A;  4CZC A;  4MEY F;  2K9Q A;  1S3J A;  5FGM A;  4GDF A;  3JRG A;  4BY1 J;  1JUS A;  2HFH A;  2O3F A;  1T38 A;  2DMN A;  5F0H A;  5LEK A;  1U3E M;  4CO8 A;  3JCU C;  3R6S A;  1K78 B;  2F5V A;  2QEN A;  3VSL A;  2AXL A;  5FB2 A;  1JGG A;  2XAS A;  2H8R A;  2IT0 A;  4GGG A;  3EYY A;  3I71 A;  2AO9 A;  1CF7 B;  1QBJ A;  1XSV A;  3CCQ I;  3FHN A;  3KP4 A;  4MLO A;  1BC7 C;  3KX2 A;  1ZR2 A;  1MH3 A;  4BYY A;  4B47 A;  1QHH D;  4BY7 J;  2XRO A;  3CZ6 A;  5BS6 A;  3OS1 A;  2WB1 A;  2CV1 A;  4W1U A;  3S3O A;  4XID A;  2F5D A;  3FMS A;  1B4A A;  4A0Y A;  3R60 A;  3C3W A;  4PFO A;  5KAF C;  4ZYD A;  1AKH B;  3A03 A;  1BA5 A;  2HZT A;  2RQQ A;  1WJ5 A;  3S1R J;  1A36 A;  3A4C A;  2XF5 A;  1HC8 A;  2KIU A;  3TQN A;  2JPC A;  3OR1 C;  5DCM B;  4M3F A;  4BKX A;  1QO0 D;  1WJC A;  3HIF A;  1FBU A;  4YEL A;  2VON A;  4XLE A;  3ERM A;  3KYL A;  3K4B A;  2FSW A;  3GF2 A;  4BEH A;  5ICG A;  3WGI A;  2GXG A;  2V6E A;  3WTT C;  2OZU A;  2XSD C;  3H3U A;  3FM3 A;  2R0Q C;  5L3G A;  2COM A;  1F36 A;  1OLT A;  4PUS A;  4IVN A;  4LG0 A;  4KMF A;  4OOI A;  3PIP F;  4HF0 A;  3OL3 A;  5ERI A;  4CDG A;  1PJR A;  3DEE A;  4D1Q A;  3CC2 I;  1Y0N A;  2EH3 A;  3AL0 B;  4DJA A;  3H35 A;  1IV6 A;  5EZH A;  1ZAR A;  4Q4Z F;  3ZMU A;  5LFA A;  4NB5 A;  1XDS A;  3TKY A;  4UXN A;  2K40 A;  4KDP A;  2RQP A;  3BCB A;  1YJW I;  2ESH A;  1T0F C;  2NNN A;  2R92 J;  4C2M J;  2QWW A;  5F1R A;  2GOX B;  2GA2 A;  1HQC A;  3GEZ A;  2JA6 J;  1X4O A;  4HRI A;  4ABZ A;  2LC2 A;  4XRS A;  4UV9 A;  1A6I A;  4YG2 F;  2E71 A;  3HXL A;  2QKL B;  4H0E A;  4EJV A;  2MGQ A;  2L9N A;  5DM6 F;  3H0G J;  1KON A;  2L7M P;  2KDZ A;  3ERE D;  3JW4 A;  3K4N A;  1WQ2 A;  3K9T A;  2E5N A;  2MC3 A;  4YRV A;  4EJW A;  3HGY A;  2XAQ A;  3BG5 A;  3I53 A;  3BJA A;  1MMN A;  2MW8 A;  2E35 A;  2R7V A;  1GUU A;  2BYV E;  1LDK B;  4UUS A;  1VQN I;  1FNN A;  3CCJ I;  3ZPL A;  2DMP A;  2BGC A;  2XPW A;  2GLO A;  4BXU A;  5E79 C;  2V1N A;  2L3D A;  2CMP A;  1IRG A;  5D8K B;  1P4X A;  2QEX I;  5K7F A;  3JRI A;  5H6R A;  3V4G A;  2DA5 A;  3BT9 A;  1HBX G;  1RI7 A;  1LNW A;  3PQK A;  3DPL C;  2KFD A;  3D5R C;  1O3S A;  2NVU B;  1HCR A;  1BC8 C;  1TQP A;  4O6J A;  1LDD A;  1YW7 A;  3I58 A;  1GV2 A;  3E6D A;  4D0P A;  3OYF A;  3AG4 H;  3Q0W A;  4BQQ A;  2VL8 A;  1J7K A;  2H09 A;  5FLM J;  2WAF A;  2PMZ A;  3DFG A;  3ZQQ A;  1IDY A;  4LB6 B;  3QOP A;  3OY9 A;  3RQI A;  3ZRG A;  3VYS B;  5JFR A;  3E6M A;  4FX0 A;  3PO3 J;  3MKW B;  2JRT A;  3TL4 X;  3KPH A;  2W25 A;  1X1C A;  4RGR A;  3IC7 A;  3JTG A;  1MKM A;  1ZG3 A;  4FHT A;  2WV0 A;  5J40 A;  2W00 A;  1UFM A;  3Q5F A;  4IRI A;  1ETQ A;  2E1O A;  1Y6I A;  1U8R A;  1OCZ H;  3AG3 H;  3NRV A;  2DAO A;  1HOM A;  4UV8 A;  3IHU A;  2DOF A;  4F92 B;  2HXO A;  3V8J A;  2WY8 Q;  2R7F A;  4IHT A;  2KRC A;  3FF5 A;  2BHY A;  5FLX Z;  1KGS A;  1T08 B;  1SFX A;  1XMK A;  2HOE A;  2BZT A;  5FD6 A;  1SD7 A;  2GZW A;  3OMY A;  3CCS I;  1RIO H;  4AC0 A;  1EKE A;  1S6L A;  4G6Q A;  3QP6 A;  3WHB A;  2JZY A;  3K1M A;  4LGW A;  1Z6R A;  2FEZ A;  1YIT I;  1B8I B;  1CGP A;  1GT0 C;  3SFI A;  2H1L A;  5D5X B;  1TQI A;  3PIO F;  3QYE A;  4CXF A;  1MSE C;  3D1N I;  2NOJ B;  1QA6 A;  2LR8 A;  4XLF A;  1YLF A;  1WH5 A;  2R7S A;  2P81 A;  3Q9S A;  1J59 A;  3HPH A;  4I76 A;  4XSZ F;  2BY2 A;  2H6C A;  2PG4 A;  1IRX A;  3COA C;  5AIQ A;  1PUE E;  3QPS A;  3JRH A;  1D8J A;  1ZR4 A;  1R1T A;  2FBK A;  4N9H A;  1GDT A;  1IN4 A;  2FML A;  3GFI A;  4NQW B;  2EFQ A;  3R61 A;  1OJL A;  2GXB A;  3EYI A;  4UNO A;  3WOD F;  1IUY A;  4IO9 F;  2H1K A;  4A3I J;  5KNL A;  3H9Q A;  2O03 A;  5E1X A;  3TO6 A;  1L0O C;  4HAM A;  3OYG A;  1D8K A;  1FTT A;  5EEA A;  3ECO A;  1QZE A;  4CA0 A;  1JUM A;  3HUG B;  2OU2 A;  1ONV A;  1OYI A;  1W4M A;  5JHF A;  4A12 A;  2QGU A;  1LB2 A;  3I56 I;  2P8T A;  1TWC J;  2KRH A;  2GWR A;  2J5P A;  3U9G A;  4HLY A;  1H88 C;  4JOM A;  1Q1H A;  1F5T A;  4DYQ A;  5FFZ A;  4G7Z F;  2CQX A;  1JHH A;  2R7W A;  3AG2 H;  5C4X J;  3BR3 A;  4KT6 A;  2DU9 A;  1HW1 A;  4E7H A;  1FLI A;  3BG7 A;  4I7H A;  5EG0 B;  3CMA I;  4QPO A;  4OIR F;  3LSM A;  5M5X J;  1P4A A;  2WY7 Q;  2YU3 A;  3BTJ A;  2JTV A;  3E6C C;  4ESJ A;  1B9N A;  4RDU A;  3L00 A;  3S3M A;  1T56 A;  1WGX A;  2PJR A;  2BE5 F;  4JQF A;  4ZDO A;  5LRR A;  2DTR A;  3GFJ A;  4HSR A;  1H9G A;  1KYW A;  3Q0V A;  4YEJ A;  3CCM I;  3RI4 A;  2CSO A;  1TWA J;  2DA6 A;  3FM5 A;  1MIJ A;  2M87 A;  3ELK A;  4TV7 A;  2NVY J;  4U0W A;  1MD0 A;  3V42 A;  3TW7 A;  3L7W A;  3F21 A;  2HTS A;  3WHC A;  4F52 A;  2KKO A;  4BDY A;  3QPH A;  3WG9 A;  1ZHF A;  2QLZ A;  2DA7 A;  4PJM A;  5JHU A;  2X1D A;  5D5U B;  1H9T A;  1MMA A;  4R1H A;  2GQQ A;  3H9J A;  1Z0X A;  1XGS A;  3CUQ C;  2A07 F;  4ENJ A;  3SJM A;  4CCN A;  1HDD C;  3R4K A;  3BG9 A;  4DZP A;  3OYN A;  1X1A A;  3R0J A;  3EUH C;  4K2E A;  3DU6 A;  1JKR C;  2B0L A;  3V8K A;  3P9K A;  1TNS A;  4XN0 A;  5BNG A;  4NHJ A;  1VQ7 I;  1DPR A;  1P4W A;  2RVC A;  2YPR A;  5CLS A;  2LF7 A;  2TDX A;  1NH3 A;  3RYR A;  4RAZ A;  2NS7 A;  2XRL A;  2Y2Z A;  4E7S A;  3MCZ A;  1R36 A;  1U2W A;  1NK2 P;  5GAG J;  3TO9 A;  1N77 A;  4V2G A;  2PMH A;  2XAU A;  4M6X A;  1D1B A;  1GVD A;  4U7B A;  2DLL A;  3PL8 A;  3OYB A;  3FHZ A;  1CQT A;  3ABU A;  3C2G A;  1DU0 A;  5J1Y A;  1F9N A;  1BI3 A;  2NS0 A;  3I4P A;  4XRS G;  1MZB A;  1XX5 A;  3CCU I;  3KE2 A;  2P5K A;  1KU2 A;  4B43 A;  3S14 J;  1JJ6 C;  4Y17 A;  1SVL A;  3S15 J;  3IH2 A;  3RTR A;  1LFU P;  2L2O A;  3FKI J;  4I98 B;  5GTH C;  3BR1 A;  4BEH B;  1J09 A;  3DF8 A;  4IHX A;  2HOS A;  2OAZ A;  2VPR A;  3IKT A;  1RR8 C;  1H8A C;  1FOY A;  3CLO A;  3P7N A;  3I4N J;  1XDU A;  2A5Y B;  1I39 A;  2KIQ A;  2IBD A;  1L3L A;  2Q0O A;  4LG0 B;  1DQU A;  4A5N A;  3M4O J;  3GFL A;  5F08 A;  3K70 C;  5FRN A;  1BL0 A;  3RZD J;  1SD5 A;  3OIP A;  2DOA A;  4ZZD A;  2JN6 A;  2V4J C;  3KP6 A;  2DDB A;  3CJN A;  1SVM A;  1XCV A;  2HVR A;  2CRG A;  2Z33 A;  3TOA A;  5BQT A;  4BU2 A;  1ZRD A;  2DN0 A;  3K1N A;  4XMY A;  1ZRC A;  2DA3 A;  2PJP A;  1M1E B;  3F6V A;  1BJA A;  1KU3 A;  2MD5 A;  1O7L A;  2VBX A;  3KLN A;  2DQL A;  3KYD B;  4IHV A;  4G8X A;  4QSH A;  4BS9 A;  3SFZ A;  4N9I A;  4CIC A;  4NC8 A;  1Y56 A;  4BHC A;  2M45 A;  1HDP A;  2DMT A;  2ZXJ A;  2HQA A;  3BY6 A;  3N4M A;  3GTQ J;  4MQ9 F;  3M8E A;  4AIK A;  3FX3 A;  1D1A A;  2CYY A;  2VBW A;  4U88 A;  2UWM A;  2DXI A;  4EM2 A;  1IN5 A;  5DM7 F;  1LJ9 A;  3IV5 A;  2VB6 A;  2F2E A;  2D5V A;  1D0Z A;  1EH7 A;  4DIQ A;  2OPT A;  3RKY A;  3DEU A;  5HNH A;  3JRD A;  1FWZ A;  1XTA A;  2YS9 A;  3HOZ J;  3L2C A;  3LSI A;  1FY7 A;  3VOD A;  2P6S A;  3H92 A;  1N25 A;  2RN7 A;  3KP3 A;  4UUS B;  1ETX A;  4CUG A;  1C0W A;  3T8R A;  2K3P A;  2HGC A;  2VXZ A;  2F5C A;  5K5R A;  2DPU A;  1OCO H;  2MAB A;  3A02 A;  1YE9 A;  2VE9 A;  4UB6 C;  4ZDP A;  4HF2 A;  4KFC A;  2IGN A;  3C2H A;  1F1Z A;  3RJP A;  3KP2 A;  3PNY A;  1SFU A;  1O3Q A;  4EVI A;  1R4N B;  1WRJ A;  1PVE A;  2ZXW H;  3HL2 A;  2AS5 F;  5L3B A;  4KIT B;  2EZH A;  3KP5 A;  2CS3 A;  2FE3 A;  1TBX A;  3MKL A;  3ML6 A;  2OA4 A;  2OQR A;  5LRS A;  1YI2 I;  3CLQ A;  3K1P A;  3ZP5 A;  1GV5 A;  2DT5 A;  3VWB A;  3PUB A;  1RET A;  4PSW A;  1LFB A;  3CUO A;  2CUJ A;  3G2B A;  3DBL B;  4E7Z A;  3K4J A;  4D7N A;  2E60 A;  3ZQG A;  1PP8 F;  3DTE A;  1FIP A;  2HOA A;  3ZMT A;  1J5Y A;  4ON0 A;  2E36 A;  3FXU A;  1HXD A;  2FOK A;  5KVR A;  5LGT A;  5KK1 A;  2EFN A;  1WVR A;  2E7W A;  3PSF A;  2Y48 A;  3AG1 H;  1J0R A;  4FTH A;  3IKV A;  5E20 A;  3OYI A;  2M30 A;  4HDU A;  4PGH A;  3KEY A;  3X2Q H;  3J80 K;  4GFB A;  1DDN A;  3S32 A;  5HS8 A;  1IG7 A;  5CVI A;  4HX7 A;  1H0M A;  4HX8 A;  2VLA A;  2Z3Y A;  4WWC A;  3OOU A;  1GHC A;  3ZQL A;  3OSG A;  4M9S A;  3DKW A;  1Y0U A;  2XAJ A;  5K5O A;  4ESB A;  2MH2 A;  3VSK A;  4QIW N;  2WBM A;  1IUF A;  1BOA A;  5FJ8 J;  1X58 A;  5K7Z A;  3QPT A;  3RZO J;  3DPU A;  2HDW A;  2V6C A;  3JSP A;  3HHG A;  4B48 A;  1MNM C;  4KMU X;  3GLL A;  1P7I A;  4LOC A;  3OYH A;  2KRF A;  2WWY A;  2VQG A;  1QPI A;  1Z91 A;  1UJ8 A;  2ZJQ F;  1U5T C;  2DTZ A;  1LVA A;  1S7E A;  4BAY A;  2KHM A;  4AIH A;  3DEW A;  3LSJ A;  2CFX A;  1JT0 A;  2LD5 A;  2L7Z A;  3B6A A;  1YX5 A;  1TL8 A;  3IAS 2;  5CPR B;  4BHB A;  3NWT A;  2ESN A;  2Y0M A;  1EH6 A;  4YFX F;  1AOY A;  4B4C A;  4IHW A;  2W24 A;  1V5E A;  3VOE A;  5J1U A;  5F1J A;  5CVU A;  4XN3 A;  2GBY A;  5E8G A;  2CUE A;  2HYJ A;  2VE8 A;  4M9X A;  3VFZ A;  5IYD J;  5DD8 A;  1Y1V J;  2ZB9 A;  3W2V A;  1MND A;  3FDY A;  3KEQ A;  3CCE I;  3JRF A;  1JE8 A;  2DJI A;  2KJC A;  2O9L A;  1DGW Y;  2IA2 A;  1XGN A;  3H1C A;  2UXX A;  4UVA A;  3LA3 A;  2BVL A;  3K10 A;  4HBL A;  3WU0 A;  1OFC X;  1OMI A;  3HRT A;  2IS2 A;  4EV0 A;  3SZT A;  2L01 A;  1FMW A;  1PDN C;  4HQM A;  1XG1 A;  1XD7 A;  3PO2 J;  5LLQ A;  3GTK J;  2D45 A;  1ZLK A;  4U0Y A;  3HOT A;  4HOB A;  2HDC A;  4EM0 B;  4RAG A;  2Y30 A;  1IJW C;  9ANT A;  3GTJ J;  1YG2 A;  4X0G A;  4XOP A;  4ZYA A;  1FOW A;  2EBI A;  5HS7 A;  4IQJ A;  3SEZ A;  4ZYH A;  1X3U A;  2KPM A;  3CMM A;  2JA5 J;  4X6A J;  5HLG A;  2G7H A;  3CO6 C;  1DPU A;  4Y4R A;  1R23 A;  4CH7 A;  3F8B A;  4QPQ A;  1R71 A;  2PJR B;  3JR9 A;  4LLN A;  3ABT A;  1ETK A;  3WU1 B;  2DPD A;  2G0E A;  5FKM A;  2EIK H;  3BCA A;  4ZTJ A;  1BW5 A;  1KZH A;  2ZC2 A;  2EIN H;  4G12 A;  1U0J A;  2XF7 A;  2ZNY A;  1IO2 A;  2LY9 A;  2EA4 A;  2VT3 A;  2LP0 A;  3IWZ A;  2A6E F;  4UUV A;  4OIP F;  5EEH A;  2QCO A;  3OL4 A;  1RNL A;  1JT6 A;  1G59 A;  2A61 A;  2YX7 A;  4ETS A;  1HA8 A;  3RIR A;  3N05 A;  3DQV C;  2XAF A;  1TWG J;  1X3W B;  1JTY A;  5F6F A;  4HA8 A;  2K9L A;  4LFU A;  2O0Y A;  3BPV A;  4WK8 F;  3I3L A;  4PGG A;  2D2W A;  2VBZ A;  2M8G X;  1Y1W J;  4JP0 A;  2K27 A;  3EQL F;  4UVB A;  5IP9 J;  3GVA A;  5B5E C;  4ZYG A;  2LMD A;  3L2R A;  1G3T A;  5GAD J;  3DPT A;  2G7U A;  1JHF A;  3J7Z I;  5J4Y A;  2V9K A;  4L9T A;  1HF0 A;  2JVG A;  5CJ9 A;  1IRF A;  1MMD A;  1YIO A;  1BIB A;  5FRM A;  1D1C A;  1O57 A;  1LQ1 A;  4XK4 A;  2F5F A;  2P6T A;  1R49 A;  2L9S A;  4AUX A;  4XLH A;  5E1W A;  5C44 J;  3ZQF A;  5DDG A;  4IX7 A;  2LF8 A;  2PLY A;  2OC6 A;  4L0Y B;  2LFB A;  2IGM A;  3T0Y A;  3W2A A;  2JRM A;  3BOQ A;  3EPZ A;  1FP1 D;  3V7R A;  4ZTF A;  2ZJR F;  1SMT A;  4RM2 A;  5TJJ A;  2R7U A;  4M6V A;  1ACI A;  2CH0 A;  4CCM A;  1OCC H;  4M3B A;  3HRU A;  5J4V A;  3HSF A;  4HNT A;  2FNP A;  1ZTR A;  5IT9 Z;  1AA7 A;  3G1O A;  1ON2 A;  4BGD A;  1DP3 A;  6PAX A;  2EIL H;  2QKM B;  4XNF A;  3VYR B;  3ABM H;  4AM3 A;  1UHW A;  1G6N A;  4LMY A;  4EAT A;  2DMU A;  1D0X A;  3D5S C;  2EFW A;  5DS9 A;  3GTL J;  2IAI A;  3PNT A;  1UMQ A;  3BDD A;  2VKD A;  3ULQ B;  4XKC A;  2ZME C;  5IYC J;  2H8W A;  2HZD A;  4MGR A;  4IL6 C;  4G7O F;  5LHI A;  2FD5 A;  1RUO A;  1YS6 A;  4RGS A;  3BQY A;  2ADU A;  4BXX J;  3BG3 A;  1B59 A;  1Q1V A;  3M7G A;  2B9S A;  5HS9 A;  3E7L A;  2L9R A;  3J80 Z;  2M4K A;  1EH8 A;  2IS6 A;  4FX4 A;  3HEF A;  2KL4 A;  3CQZ J;  5KCM A;  4EJO A;  2X51 A;  2K4B A;  5B3S H;  2P5L C;  1R1U A;  4AYB N;  2QM3 A;  3F8C A;  4P96 A;  2L0K A;  2MA3 A;  5LGN A;  3DTK A;  2ME0 A;  2PI0 A;  1X2M A;  1FYM A;  5J1R A;  3W6J B;  4F7Z A;  3EDP A;  1FPQ A;  2HWV A;  4A93 J;  1E2X A;  4RGX A;  3MZH A;  3AFH A;  2VXD A;  4L9N A;  3HRM A;  3M9A A;  2IA1 A;  3G71 I;  1VZ0 A;  4II2 A;  3OOP A;  4BBR J;  1IAW A;  2BOL A;  5D4S A;  4NDL A;  3J81 K;  2IJL A;  3CME I;  3E3V A;  2MBF A;  2XUB A;  2Z1D A;  2VOP A;  2H6B A;  4YII A;  1IW7 F;  3Q3S A;  3M3Y J;  2XPU A;  4L5J A;  5DTD A;  1HST A;  2CU7 A;  3P9I A;  4M6Y A;  3L2W A;  2ICW G;  4LJZ F;  3ZXS A;  2OD5 A;  2R7R A;  3LST A;  1ZK8 A;  1MH4 A;  5JVT A;  2UZK A;  2MG4 A;  2MFZ A;  3FXL A;  4CYC B;  2XDV A;  1ON1 A;  3BLY A;  5IP6 A;  2MC4 A;  3HSR A;  2XC7 A;  2FA5 A;  2M2E A;  3FKJ A;  1TZL A;  1YJN I;  5HLT A;  1PYV A;  1FBQ A;  4XLA A;  4LG3 A;  5ILV A;  5CVV A;  4HNU A;  2HQN A;  3H9G A;  2A05 A;  5E17 F;  2M8E A;  3IH4 A;  3VB2 A;  4EMS A;  4DBR A;  2VPL A;  2FF4 A;  1IRZ A;  2VC1 A;  2VIX A;  4PJL A;  4DGW B;  2CW7 A;  3RKX A;  2VN2 A;  2L54 A;  1D3Y A;  3FBI B;  4Y3O A;  1S7A A;  4QWQ A;  3W6V A;  3F8N A;  3CC4 I;  1I1S A;  1JUP A;  2CW0 F;  4IOC F;  5DD4 A;  3CC7 I;  2EZL A;  2ID3 A;  3MZY A;  1DUX C;  1PUF B;  2EA2 A;  4G94 A;  3G1M A;  1P2F A;  2E1M B;  2W57 A;  4PJN A;  2HXI A;  3RSN A;  3SDG A;  3KIO A;  1OQY A;  1X4P A;  1VQ4 I;  4RBO A;  1X19 A;  3V7S A;  5IY5 H;  4B1R A;  3CF2 A;  3OYM A;  2DDA A;  2RNG A;  3SQN A;  1RKW A;  5B1B H;  2HKO A;  2BHZ A;  4KIC A;  2KQR A;  4A6E A;  4KIS A;  4JYK A;  1T6S A;  1SFK A;  4KN7 X;  5GP9 A;  4A6D A;  2QSF X;  4C30 A;  4I01 A;  1YHQ I;  2QQB A;  1WSU A;  3D5L A;  2EB7 A;  1ZG5 A;  3CCV I;  4A69 C;  3MN2 A;  4B8X A;  5GPC A;  5LEJ A;  3K6G A;  4I09 A;  2L7F P;  1XSX A;  3L9F A;  5IP7 J;  3WU2 C;  4CHU A;  1WFX A;  4XIC A;  2BXY A;  2NYX A;  3C2B A;  3QOD A;  1IN6 A;  3F72 A;  2DK5 A;  2CQN A;  2E2J J;  1I6X A;  2VAS A;  1IGN A;  1LUJ B;  3LMM A;  3VYT B;  3L1P A;  3CCL I;  2E19 A;  1R22 A;  3BR0 A;  2OV7 A;  4AVZ A;  2IPQ X;  4L9V A;  4CSW A;  2JVH A;  2V7F A;  1W7P D;  3OYA A;  4HST A;  5D5W B;  5E1Z B;  4EJU A;  4RAF A;  4E7I A;  3CDL A;  1FTZ A;  2EV6 A;  2K9N A;  4IOA F;  1FBS A;  1FP2 A;  4XBF A;  1YIJ I;  2V1D A;  3DU5 A;  2WAD A;  1RZ4 A;  1B72 A;  4AIJ A;  2XVC A;  3DCF A;  1FYK A;  1TP4 A;  1Z3X A;  1TQM A;  1TC3 C;  2Z2S B;  2X85 A;  1ZAO A;  1ZYR F;  2I8D A;  1E3P A;  2JSP A;  2Y75 A;  4XKV A;  1WHU A;  1WI3 A;  2XAH A;  1LEA A;  2VI6 A;  5C4J J;  3ZMS A;  3K70 D;  4NBQ A;  3GTM J;  4JX4 A;  2H27 A;  3EUA A;  4I0A A;  3C1D A;  1FMV A;  3EET A;  4KJZ A;  1QGP A;  4CCK A;  4XL9 A;  3SEQ A;  2KLO A;  4C3J J;  5EDN A;  3OWT A;  4L5E A;  3PFI A;  3TDZ C;  3WGH A;  3K4C A;  4B3X A;  2JT1 A;  4BUP A;  4ZJZ A;  3N97 A;  3W6K B;  4U7D A;  1N78 A;  4LK1 F;  1LEB A;  3AL0 C;  5HDG A;  2QQA A;  1FYL A;  1WZ2 A;  3HSE A;  3HJE A;  4KT5 C;  4MIM A;  5EZG A;  5J8F A;  1SAN A;  2F4I A;  1FSH A;  3PNV A;  4IXA A;  4UY8 I;  2YSR A;  1J2X A;  3TP0 A;  1UHS A;  1UZC A;  1BM9 A;  5D8L B;  3MVP A;  4IQ4 A;  1FIA A;  2COB A;  2LKS A;  5KHD A;  4NC7 A;  4L5I A;  1IXC A;  4FAS D;  1LDJ A;  4A2U A;  4OIN F;  1WJA A;  2FQ3 A;  2W85 A;  3OIQ A;  2EQR A;  1W0U A;  1FZP B;  5E3O A;  1R00 A;  1QZZ A;  2ZNZ A;  1JI8 A;  5F0F A;  4Q5S F;  2FOW A;  1TT0 A;  5DCF A;  4XLP F;  2HYG D;  2LRD A;  4HDV A;  4A3D J;  1V3F A;  4NC6 A;  3A01 A;  2DFE A;  3S3N A;  2HPM A;  1I5Z A;  1PP7 U;  3HKZ N;  4W97 A;  3SZG A;  2CUF A;  1O7F A;  3VPR A;  1ZQ3 P;  2FUG 2;  4GRI A;  1KQ9 A;  2EV5 A;  2EJR A;  3K2Z A;  3WE2 A;  1XMX A;  1YW8 A;  1NK3 P;  2QVO A;  2YR2 A;  5FKO A;  1QZY A;  3BJ6 A;  3ZN1 A;  1FT9 A;  1BIA A;  1U9N A;  2A6H F;  1TLH B;  4A3M J;  1OR7 C;  1WKM A;  4WXD A;  2A3S A;  4XRF A;  3CDI A;  3DV8 A;  2MH9 A;  3RPQ A;  2GM4 A;  2JA2 A;  1TW2 A;  2O5R A;  4HW0 A;  1Z1D A;  1U8B A;  5IOY A;  4EJT A;  1HSJ A;  1G3S A;  1T95 A;  3E5Q A;  4LD5 A;  1ZH5 A;  2EWN A;  1GVJ A;  2Y0S N;  3PM1 A;  4ZH4 F;  3G6E I;  2RAE A;  1BBY A;  5ILU A;  1O4X A;  2JUC A;  1WJF A;  3EUH A;  5JVG F;  3TOB A;  4UUT A;  3J7A Y;  2R3S A;  4XOT A;  1V5F A;  1FJL A;  1DGR M;  2DFF A;  1G2H A;  3BTI A;  3J81 Z;  1R5H A;  3ONQ A;  3F9K A;  4WX9 A;  1GXQ A;  1LE8 A;  3M1C A;  1YFH A;  2NXN B;  2KP6 A;  5FLV A;  4MTD A;  4D5C A;  2E1C A;  3LA7 A;  4XSX F;  2ZFW A;  3GBG A;  2VUM J;  3SDB A;  2QF7 A;  5EF6 A;  4M74 A;  3QRF F;  1ZGW A;  3KP7 A;  5FD5 A;  5HNF A;  1EJ9 A;  1MMG A;  3HHH A;  4EEF G;  4ZC3 A;  1W7P A;  2RV8 A;  1KU7 A;  2K9S A;  3ROU A;  3MQ0 A;  3HPG A;  2WA0 A;  4PZJ A;  2RC4 A;  2STT A;  2ZXI A;  4X1E A;  3AKZ A;  3BTL A;  4F55 A;  1T8I A;  5EJC A;  1UG0 A;  2O8X A;  4C9Y A;  3DP7 A;  1S7O A;  4FT8 A;  1RRJ A;  3S1Q J;  1MBG A;  3LNQ A;  1MJB A;  2C6Y A;  3C18 A;  4XLC A;  2X0L A;  1BI1 A;  4I02 A;  1ERD A;  3TP3 A;  2JWT A;  2X6O A;  1DP7 P;  3CF5 F;  4JX5 A;  1MBK A;  1TTY A;  1MJ9 A;  2CV2 A;  3T8T A;  2W82 A;  3LSK A;  4RLF A;  5A2Q K;  5IT9 K;  1MNE A;  2HNH A;  1JKO C;  1SVO A;  3VYU B;  4DW6 A;  4DQ2 A;  2CUZ A;  2DOD A;  5TRD A;  2O6G E;  1G8X A;  2XAG A;  4IF4 A;  3RPU D;  4DNC A;  4CYC A;  2WAQ N;  1K61 A;  2PX9 A;  2IGK A;  2HQR A;  1EA3 A;  1QU3 A;  2XGD A;  3DBH B;  2ECB A;  4PSX A;  2CFO A;  4MTE A;  3IUO A;  2V9V A;  1K4S A;  2LBF A;  2XKP A;  3VEP A;  2XGE A;  1WPK A;  3NWS A;  3WTS C;  1Z3Y A;  5IOZ A;  4E7J A;  4L18 B;  1YRN A;  4I6Z A;  1B1B A;  4EGZ A;  1UHM A;  2K4J A;  1KU9 A;  2MYS A;  2BV6 A;  2UV1 A;  1ETW A;  3WE3 A;  2HU9 A;  2BW3 A;  4UVC A;  5KAI C;  4E4H A;  1ZG1 A;  1W5C C;  3DBR B;  4HYE A;  3CO7 C;  3PUF A;  3FWE A;  5GTI C;  2HVS A;  4IKF A;  2LG4 A;  1TWH J;  2WTE A;  2A5W A;  3LQQ A;  3F3X A;  2M7B A;  4MQV A;  1PUF A;  1RUN A;  1FC3 A;  2FBI A;  1XSD A;  1WH7 A;  4I0B A;  2PEX A;  1Z7U A;  5K1Y A;  3ESW B;  4J19 A;  2KT0 A;  1IXR C;  2DA1 A;  3OYJ A;  4KNY A;  1K6O A;  1I27 A;  5CVJ A;  5F64 A;  5M3M J;  2GIZ A;  2M3A A;  2X9D A;  3VDX A;  3L09 A;  1D5Y A;  3O3K A;  1IN7 A;  5J6X A;  2HS5 A;  2NVT J;  1G3W A;  3BJO A;  5M5Y J;  3I64 A;  4HNV A;  3GXO A;  4A3K J;  3TW6 A;  3TGN A;  2IXS A;  1KA8 A;  2X6X A;  2XHK A;  4I2O A;  1D5V A;  3WTV C;  3WG7 H;  3HBL A;  1IF1 A;  2B7E A;  2Q1Z B;  4OMZ A;  2WAE A;  2HR3 A;  3M8F A;  5DUI A;  1VQK I;  2X48 A;  2FNA A;  1A5J A;  4CZZ A;  3E97 A;  4KYW A;  2DA4 A;  3F8F A;  1IN8 A;  3U1K A;  4R8H A;  2YU9 J;  2FBH A;  4AU7 A;  1R5G A;  2GAU A;  1LKX A;  2E2I J;  3ZQC A;  2JK3 A;  1HKT A;  2P7V B;  2ELJ A;  3EUK L;  1MSF C;  1T98 A;  4PDK A;  2ZO4 A;  2LYC A;  5FKL A;  2QBY A;  1WJD A;  4S05 A;  3MFK A;  1IV8 A;  4FIS A;  1A6Q A;  3Q9V A;  3LL7 A;  4MHG A;  5L3F A;  3LFU A;  3RYP A;  2BY1 A;  3BTC A;  5D6F A;  2L02 A;  2JA8 J;  2BXZ A;  4CCL A;  5JR3 A;  2W7N A;  3J7A O;  1YW9 A;  2P0W A;  3KZY A;  2QSG X;  4C2U A;  3CMY A;  4P55 A;  2HOT A;  2R7X A;  4UHT A;  4DZJ A;  5FO5 A;  3QU6 A;  4EM1 A;  3HDD A;  3H5R A;  1U5T A;  1H89 C;  3PFY A;  2X4H A;  4U0V A;  2LVS A;  1LPQ A;  1QHG A;  2XB5 A;  1ETO A;  3DXJ F;  3A1Y A;  4Z2Y A;  4Y15 A;  3FIW A;  3NEU A;  4QTR A;  1VQ6 I;  2CQ7 A;  3RDI A;  4CCJ A;  3I55 I;  3F0C A;  1HW2 A;  4AYB A;  3HGG A;  3LSG A;  4KA4 A;  4A3B J;  1Z6T A;  3QYB A;  1O3R A;  5E3L A;  4BXF A;  4P1W A;  2M1B A;  1B72 B;  3CES A;  3UNG C;  3GYH X;  1R7J A;  1ENH A;  1U6G A;  3RPU A;  4DOZ A;  4BQA A;  3A0H C;  2GIV A;  3GZ5 A;  3WTU C;  3GME A;  4A5M A;  4C2T A;  3BR5 A;  2OF7 A;  4AD9 A;  1R1V A;  5LHG A;  3HOV J;  1Z05 A;  4WCG A;  1QVU A;  1T39 A;  1SD6 A;  2VKV A;  1AWC A;  4FET A;  3ZR8 X;  1AU7 A;  1XN7 A;  4KUM A;  5EGO A;  2HQ5 A;  4IEJ A;  2HDD A;  4FQG A;  5D5V B;  1VF9 A;  3U2R A;  4OAZ A;  1UCR A;  1E17 A;  5FKN A;  3BRO A;  3M1E A;  2JSC A;  2K5C A;  1A04 A;  1MDM A;  3LAP A;  4IHY A;  4N0B A;  4FE7 A;  3KCC A;  2D1V A;  4OWR B;  3RQ4 A;  5B66 C;  1U78 A;  2MD0 A;  2G9W A;  4E7K A;  1IZ1 A;  2O61 A;  5HDK A;  4OIO F;  3K0L A;  2VOO A;  2OCC H;  1UAA A;  4BE1 A;  1VQ8 I;  1VQL I;  1JKQ C;  2X6Y A;  1ZRE A;  4M71 A;  1GXP A;  2XSJ C;  1V4R A;  2EFO A;  3ZCO A;  3OYD A;  1F4K A;  2HVQ A;  4GXO A;  2D1H A;  5GPA A;  3G1L A;  3HRS A;  4KN4 X;  2ZKZ A;  5L3D A;  4BE2 A;  4Q48 A;  3A01 B;  2NNY A;  2FU4 A;  2UUZ A;  1WI9 A;  2WC2 A;  1BOB A;  3IAM 2;  1YX3 A;  2FMY A;  3DKX A;  2XB0 X;  3Q0U A;  2QYO A;  4A3L J;  2STW A;  2X6W A;  3ISP A;  5L3E A;  3LAJ A;  2IS4 A;  2KZG A;  4II3 A;  3GW2 A;  4DYC A;  1OPC A;  4ZZL A;  1W36 C;  5M5W J;  1KYZ A;  4LLL A;  3CJT B;  3WTX C;  1Y39 A;  1VQO I;  2IEK A;  1VQM I;  1Z21 A;  2F5E A;  4IJA A;  2DMQ A;  5FFX A;  2OBP A;  5BMZ A;  1ODD A;  3FBN B;  3O6B B;  2DT7 B;  2IA0 A;  4PFP A;  4U87 A;  5A2Q Z;  3A2K A;  4HPQ A;  3RCO A;  3LSR A;  2LY1 A;  2ACJ A;  4BAC A;  2E34 A;  4OIQ F;  3CUQ B;  5LD2 C;  2M9H A;  5E18 F;  4XRM A;  1V55 H;  3REO A;  2V9P A;  4JBA A;  3HOX J;  1LFP A;  2ZJ2 A;  3K4K A;  1BW6 A;  5LBQ A;  4G6D A;  2QA4 I;  2VJ5 A;  4A0Z A;  4E7L A;  2JPB A;  2OCE A;  3JAM K;  3SXY A;  2QUF A;  4MFD A;  3E5U A;  1IXS B;  1ZRF A;  1V5G A;  4G9Y A;  4H4K C;  4YFK F;  4NUB A;  1LE8 B;  5FRO A;  3IRR A;  1O3T A;  4F93 B;  1ZGA A;  4F91 B;  3UKG A;  3GLX A;  4L0Z B;  1EF4 A;  3BC8 A;  3S17 J;  2XV4 S;  1ZLJ A;  2K3F A;  3HG9 A;  2PFB A;  5JLW A;  3WTW C;  4EGY A;  3S1M J;  2I5U A;  3CCR I;  4A3G J;  1W7P B;  1MW7 A;  3ABK H;  4BNC A;  1EV7 A;  1W5T A;  1G4D A;  4PCQ A;  3SZP A;  3JRA A;  4Y13 A;  2GA1 A;  3M07 A;  5BPD A;  1X1D A;  2N8G A;  4YIR X;  2E1N A;  3F6O A;  1UEL B;  4ESF A;  3ABL H;  2Q2E A;  1HKS A;  1YYV A;  1HW5 A;  3I5U A;  1WWX A;  3DLL F;  4NNJ A;  2AXT C;  1T0F A;  4XQF A;  3GWZ A;  2X1C A;  3GCM A;  3HOU J;  2VQL A;  5GAE J;  3OSF A;  5TGT A;  4Z6Y A;  4ENK A;  2LKX A;  2EFP A;  4BDZ A;  2ELH A;  4A3F J;  3W2W A;  2RKH A;  4V19 K;  3JRC A;  3U1D A;  1VI0 A;  2DO7 A;  5BPI A;  4M3E A;  4P9F A;  1QVT A;  1IC8 A;  2UXN A;  1XPX A;  2ZME A;  3LSH A;  3L2V A;  2RGV A;  3MWM A;  3T5X A;  1K83 J;  3DTI A;  1V54 H;  3QPL A;  3ZQI A;  3PJR A;  3GTP J;  2DFI A;  2CO5 A;  2RRE A;  2ZFU A;  2PQ8 A;  3CJR B;  4A3J J;  2VJI A;  1VTN C;  2JA7 J;  2V79 A;  4CGZ A;  3P5J A;  2R7D A;  3FXK A;  1W0T A;  2ZSH B;  2WV1 A;  3GTG J;  2WB1 N;  2VJ4 A;  1DU6 A;  3QYF A;  1BI0 A;  2LBF B;  1B9M A;  4G6T B;  4AWX B;  4Q47 A;  2R93 J;  3JRB A;  2PBI A;  5H2F C;  2VQC A;  1YRN B;  3KZI C;  3K2A A;  3UR3 C;  4MNU A;  5CYV A;  1RES A;  1Y8Q B;  2BW3 B;  3FXR A;  2HTJ A;  1S29 A;  2L5Q A;  3H0D A;  5HLI A;  5IPA A;  2NVQ J;  3BWG A;  3O2P E;  4C3I J;  3FXQ A;  3QU3 A;  1BI2 A;  3KLO A;  1K6Y A;  3ZN0 A;  4RM3 A;  3HKZ A;  4HEA 2;  4MO7 A;  5EGO B;  2R5Z A;  1BR4 A;  1WJE A;  2ZCW A;  4LIT A;  3HM5 A;  2R5Y A;  3E0J B;  2MSY A;  2F48 A;  2QQ9 A;  3KET A;  3HOS A;  4A3C J;  4IPA A;  1VQ5 I;  1OCT C;  3B6C A;  2FQ4 A;  4RLQ A;  2JMW A;  2VT2 A;  2DA2 A;  3NAU A;  4FE4 A;  4LIU A;  2DJN A;  5J47 A;  3BG6 A;  1GLN A;  2LKP A;  1BJZ A;  2Z99 A;  1SAX A;  4RMN A;  1FOX A;  2NAZ A;  3LA2 A;  1TW3 A;  2DQR A;  4CYD A;  4BHP A;  4HZF A;  3WTZ A;  1S72 I;  3FXM A;  3K7A J;  2OQG A;  3I0T A;  3U21 A;  3JTH A;  2BBY A;  3E5X A;  2Y0S A;  1UB9 A;  3LFK A;  3FXO A;  4XON A;  2P4W A;  2W84 A;  5AON A;  1SC7 A;  1SD4 A;  2RDP A;  1ZGJ A;  4I99 C;  3IL2 A;  2Z16 A;  4Y7N J;  3LWF A;  3H3Z A;  1T33 A;  3FZV A;  3HTU A;  3S93 A;  3K69 A;  1YJ9 I;  1WJB A;  2CG4 A;  2JUG A;  5D6E A;  1E3H A;  1MBE A;  4HX4 A;  1SMY F;  4RB1 A;  4P5O A;  2LRE A;  4F3Q A;  1U9O A;  1XB4 A;  5E3M A;  2QBY B;  3BPX A;  1P6R A;  2LTP A;  3E1S A;  1N75 A;  1RR7 A;  2JJ7 A;  4A0X A;  1XCB A;  3R0A A;  3IWF A;  1XGM A;  2HYF A;  2FRH A;  3L2U A;  3H36 A;  2XIG A;  4GCV A;  5ILS A;  3W3C A;  3PSI A;  3OS0 A;  3I59 A;  1Z77 A;  2LH9 A;  3ASO H;  5DEQ A;  1XC5 A;  2ECC A;  5F0C A;  1JGS A;  2HI3 A;  2MLK A;  3BR6 A;  3FMR A;  3O8H A;  2IRF G;  1FEX A;  4Y52 J;  5J3L A;  1U5T B;  2HPI A;  4JX6 A;  3BQZ A;  4O5V A;  4BH9 A;  5H20 A;  4PK4 A;  4D5F A;  2I10 A;  5K7H A;  5HOO A;  3S2H J;  1J9I A;  4XKB A;  1OYY A;  1K7A A;  3HYI A;  2KDO A;  4ZDL A;  4B09 A;  5LHH A;  2KIS A;  2ELK A;  1X2N A;  2L4M A;  4BQN A;  4KIG A;  3ZMD A;  4PJ0 C;  3ZQH A;  3L2Q A;  4M73 A;  4D7M A;  3F22 A;  1K78 A;  1ULY A;  5AIP A;  2LLK A;  2PMZ N;  4IHS A;  1MBJ A;  1WCM J;  3CP2 A;  3I54 A;  1X1B A;  3SHF A;  2QZ8 A;  1X3Z B;  1MJA A;  2DT6 A;  2Y69 H;  1Z7L A;  4GO1 A;  1RKT A;  3H5N A;  5ED4 A;  3RKQ A;  1CF7 A;  2VOD A;  3MKZ A;  3TMO A;  5IYB J;  5M3F J;  2WAQ A;  2Z9O A;  3TDU C;  2CWE A;  2DYS H;  1K79 A;  5CVR A;  3MKY B;  3H3V K;  1IDZ A;  4E70 A;  3TO7 A;  3OYL A;  2M5W A;  2P7C B; 
#chains in the Genus database with same CATH homology
 3PIP F;  1FOX A;  3CCL I;  2ZJQ F;  3G71 I;  3CCM I;  3CC2 I;  2K3F A;  1S72 I;  3G6E I;  3CCR I;  3CME I;  5JVG F;  5DM7 F;  5GAD J;  4IOA F;  3J7Z I;  1YIJ I;  1YJW I;  3J7Y J;  2NXN B;  3CCS I;  1YJ9 I;  3DLL F;  5GAE J;  1YIT I;  1YJN I;  1VQ8 I;  3CCE I;  2JQ7 A;  1VQL I;  3PIO F;  2OTL I;  1VQ7 I;  4V19 K;  5GAH J;  5DM6 F;  1QA6 A;  1VQP I;  1VQK I;  2OTJ I;  2ZJR F;  5GAG J;  1ACI A;  1YI2 I;  2E35 A;  1VQN I;  3CCJ I;  3CCU I;  3CC4 I;  3CC7 I;  4IOC F;  3CCQ I;  4UY8 I;  2QEX I;  4IO9 F;  2E36 A;  3CF5 F;  1FOW A;  3CJT B;  1Y39 A;  1VQ4 I;  1VQO I;  2H8W A;  1VQM I;  1FOY A;  2FOW A;  1MMS A;  1VQ9 I;  3I56 I;  1HC8 A;  2ZJP F;  2E34 A;  1YHQ I;  3CD6 I;  3CCV I;  2QA4 I;  3G4S I;  1VQ6 I;  3I55 I;  1VQ5 I;  3CMA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...