2QVOA

Crystal structure of af1382 from archaeoglobus fulgidus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
RIKLLFKEKALEILMTIYYESLGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDKGQKIAQQIKSIIDIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AF_1382
publication title Crystal structure of AF1382 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
total genus 27
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qvoA00
3GW2A 1D8KA 3VODA 1ZREA 1ODDA 5JVTA 2GA1A 1R5GA 4BNCA 3ZPLA 1REPC 3GF2A 5DCMA 2EJRA 2UWMA 2E7XA 4M72A 2PN6A 1U5TA 6PAXA 3J81Z 1IW7F 2NYXA 3GWZA 1SD5A 3C18A 2JTVA 1TQPA 3PFIA 3GFIA 3N97A 5E1WA 1KU2A 1KYWA 4P9UA 1IRGA 4L0ZB 1B6AA 2QQAA 2GA2A 3WTSC 3T1BA 2CWEA 3BZ6A 3CO6C 3O6BB 4L5JA 2COMA 4L9VA 3ZMSA 5D5UB 2A5YB 4M74A 1RNLA 2FEZA 1AOYA 4WWCA 5HLHA 3HOTA 2NNNA 2FMYA 1IN6A 4KICA 1FP2A 5D4SA 5HLIA 1HW5A 4EV0A 4JK1X 3ERED 1R5HA 1YW9A 3BOQA 3FX3A 2P6SA 4RB0A 4EJVA 2XHKA 3GZ5A 2ZMEA 2EFOA 1HW1A 3TO7A 2O0YA 1IN4A 2NRAC 2Y48A 1G6NA 4OIRF 1USSA 4RS8A 5E8IA 3JAMZ 2KIMA 3FXQA 1SFEA 2IA0A 1L3LA 1OYIA 3ZQ7A 4D0PA 3HUGA 3WTZA 2XKOA 1F9NA 1H9GA 2GZWA 3FF5A 1YQAA 3V8KA 2KIUA 2YR2A 1I1SA 3D0SA 3NEUA 4U88A 1FYMA 3I54A 2FBHA 2W84A 2MH9A 4UV8A 2DPUA 2UZKA 1T6SA 4UHTA 3IKVA 3N4MA 4HDUA 3QOPA 3IWFA 4ETSA 2L3DA 3F8MA 2BE5F 3GYHX 5CLSA 4BHCA 2HYGD 4ENNA 2F5FA 2G9WA 2XAQA 5AIPA 4WF2A 4G94A 2YU3A 2X0LA 5H6QA 5E1XA 3V7CA 4O3MA 3FM5A 1WWXA 4AIHA 4Y15A 2EV6A 2K86A 3ML6A 1U3EM 5AONA 4OU0A 4Q5SF 4N9HA 1B1BA 2EV0A 5DCMB 3I4PA 2L01A 2M30A 3FMSA 4AIKA 3I53A 2ESHA 4JBAA 2XGXA 2O61A 1U5TB 2F5EA 1T38A 2MLKA 2STWA 1Q1HA 3Q9SA 1PP8F 1CGPA 3IL2A 2E1CA 2JSCA 2R3SA 4L5IA 1BIAA 1BC7C 1J75A 2PG4A 1DP7P 5FFXA 4WXCA 1GXPA 4A0ZA 5L3DA 2VBZA 3CLOA 4OOIA 3R60A 3WODF 3HSFA 3I64A 1ON1A 4I7HA 1Y0UA 2KIFA 4HV6A 4Q47A 1W7PD 4L18B 4PCQA 2VE9A 4ZYHA 2ZNZA 2W85A 3L00A 4RGUA 4RGRA 4GXOA 4YIIA 1Z05A 1TW3A 4RGSA 3CUQA 4LG0A 4OIPF 2OQRA 1W5SA 2Z5UA 5F1RA 3CUOA 4U0YA 1T0FA 5ICFA 1BC8C 5ILUA 5DCFA 1FNNA 2ZMEB 2ZCWA 4G9YA 1S3JA 1BI2A 4LFUA 3IC7A 4OMYA 4I0AA 3ISPA 5F6FA 5ILSA 4I01A 4HW0A 3Q9VA 4GYGA 4HX8A 3ZMDA 1ONVA 1IAWA 1Z7UA 3DKWA 3F3XA 4EQQA 2J5OA 2BBYA 3V7RA 3FMQA 3C3WA 1P2FA 4M71A 4WXHA 4IXAA 5CVJA 3EQLF 4OINF 2DK8A 4HZFA 5J6XA 2CYYA 2OAZA 5DUIA 2Y0MA 1ZARA 3Q5FA 2QZ8A 1WRJA 3JTGA 3RKWA 1FBSA 1MJ9A 2RKHA 3F6OA 2OU2A 1SMTA 3RPQA 1LEBA 2H6BA 2BYVE 2DQRA 3CTAA 5J8FA 4KMUX 4G7OF 1BOAA 3WGGA 2RVCA 3H3UA 2FRHA 2WC2A 1PDNC 3E97A 4HLXA 2DK5A 2HQNA 4KT5C 3JW4A 4IF4A 1NHAA 2V1DA 4YFKF 5K5RA 1KQ0A 2JPCA 4P96A 2BEOA 3V8LA 2TDXA 2ELHA 2ZKZA 3NQOA 2KRFA 1SAXA 4YFXF 4MGRA 1MDMA 1J7KA 5CVUA 1JHFA 3FWEA 5D5XB 4R1HA 4HBLA 3KZYA 4LB5A 4WCGA 1MJAA 5L3EA 1J0RA 2K27A 3VB2A 4IVNA 3LA3A 2FXAA 3GZ6A 2QWWA 3LAPA 3T5XA 4NHJA 5FD5A 1F4KA 1E17A 1IUYA 5BPDA 1ZG3A 5CJ9A 4I0BA 4F7ZA 3F8BA 1O7FA 2KKOA 1UB9A 1Z6RA 3OV8A 2GXGA 2QBYB 3GO5A 3L7WA 2ESNA 2IP2A 2HOEA 2A69F 4UNOA 5LLQA 1JHHA 3J81K 4BHPA 2A3SA 4JQFA 4S04A 4ENJA 3SQNA 1P4WA 3WTVC 4N0BA 3MEXA 1Z9CA 4EJWA 2Y75A 1TLHB 2HGCA 4HLYA 2BV6A 4EM1A 4ESFA 3V4GA 1BIBA 2OD5A 3KP3A 4ZZLA 3D5LA 5L3FA 4MQVA 3IRRA 1XGOA 1ZG5A 1GHCA 2HKXA 4EVIA 3RYRA 1ZAOA 4IJAA 2QUFA 3HIFA 1PUEE 2K4JA 1ON2A 4KMFA 4A12A 4A5MA 1G3TA 1SFXA 4LJZF 1O3TA 4XSZF 3KP2A 2XASA 1G4DA 1YLFA 4H0EA 2M87A 3B73A 3M8EA 3IRQA 3DP7A 5J8CA 1SD6A 1WQ2A 2X4HA 5E17F 2FF4A 4LLGF 1EV7A 1P6RA 2G7HA 5ERIA 3E6CC 2EA2A 5L3GA 5AIQA 4NB5A 1XGSA 4CO8A 2P5LC 3FM3A 1R1VA 5LHIA 1SD7A 3P9IA 2QLZA 2Z9OA 3DV8A 4KN7X 2OZ6A 3FMRA 5FFZA 2W57A 2O6GE 4HF0A 4A6DA 1TW2A 1K7AA 1J59A 1D5VA 2FE3A 1ZGAA 1MDMB 4GO1A 3MWMA 2ACJA 1K79A 3K1NA 1HW2A 4KDPA 5ICCA 4KUMA 4FX0A 4LLNA 4U0VA 1G3SA 3J80Z 5D5VB 2EK5A 1LEAA 5HVQC 1TQIA 3MZHA 1O7LA 1IXCA 2FMLA 2GIVA 2H27A 4L9TA 3F6VA 2DFIA 2VBXA 1V3FA 2QYOA 3O2PE 2B0LA 5LHGA 3REOA 2MH2A 2EWNA 1J9IA 1ZLKA 4ZYGA 1FYKA 5LHHA 2UXXA 3QP6A 2C6YA 2E7WA 2K4BA 4GCVA 2R7FA 2E1NA 3E6BA 4Y13A 3V8JA 3K69A 2Q2EA 4I09A 4XLNF 3I71A 3HRUA 4A2UA 2CGPA 1LVAA 3K2ZA 1DDNA 5KK1A 1SD4A 3BJOA 2LNBA 5EEHA 4U7BA 4CYDA 3I58A 2V79A 3GFMA 1XB4A 4IHSA 5L3BA 2O03A 2EFQA 1XMAA 1SMYF 3KE2A 2IVMA 4IPAA 2HYFA 3W6JB 5LEKA 3E3VA 3KP6A 5D8KB 1VTNC 1LQ1A 4QWQA 3H3ZA 4FX4A 5JI6A 2XUBA 4ASNA 3MFKA 5DV5A 2HFHA 5EEGA 2Q0OA 1K78B 1I5ZA 2MBFA 1IN8A 4KFCA 1BM9A 2XROA 1YO5C 3E6DA 1BI1A 2H6CA 4EMSA 1Z6TA 2PFBA 1YG2A 1LDJA 4BXUA 3LA7A 3TQNA 2LDUA 1AWCA 4PGGA 3G3ZA 4K2EA 2IRFG 4CDGA 2P8TA 1J2XA 4CXFA 3S2WA 1UFMA 3CDHA 3IHUA 5DEQA 4S05A 3O3KA 3ZMUA 1IXSB 1W7PB 3QU3A 5HLGA 1IXRC 3F8CA 1TQMA 5HDGA 1XDSA 3DF8A 1TBXA 3SZPA 2PBIA 1KQ8A 1YFHA 3ZMVA 3BPVA 2OA4A 2ZBKA 1KGSA 2MLGA 3R0JA 4CICA 4L0YB 1B9NA 1DPRA 3ELKA 2KJBA 1P4AA 2W25A 3WTWC 2GQQA 2D1VA 2D2WA 2V1XA 2ZFWA 2YX4A 1YYVA 4ZYDA 4Q48A 1H9TA 1X3UA 4CHUA 4L9JA 3HYIA 4MQ9F 2HZTA 2YX7A 1KQ9A 4HYEA 2FNAA 1BJAA 3RIRA 1I1GA 1IN5A 3IWZA 2ISZA 1HSJA 5CVVA 4KA4A 2KJCA 1ZH5A 1RUOA 1U8RA 1ZGJA 1YW7A 4ESBA 4GYIA 4UV9A 5K1YA 1U5TC 4IRHA 2ZNYA 2D45A 3DEUA 5CYVA 3QAHA 2L4AA 2DT5A 2VN2A 2ZXJA 4DNCA 5A2QZ 3U1DA 1I27A 1CF7A 2R7DA 1V4RA 5E20A 3VFZA 2HTJA 3TOAA 2HTSA 3SFZA 4EJOA 4YFNF 2XAFA 1H0MA 1IZ1A 1FY7A 2IT0A 1HQCA 2W24A 3RI4A 3E5QA 4RB2C 2OZUA 5CVIA 5HS7A 4M9SA 2WV0A 5TJJA 1FYLA 4B09A 2EFWA 2M8EA 4M6YA 1GXQA 2LF7A 5LBQA 3E5UA 1XD7A 2QM3A 2DU9A 3PQJA 3R6SA 4G7ZF 1G3YA 2L54A 1MJBA 1MD0A 2QVOA 2YPRA 5FB2A 4O6JA 2P6TA 1ZRFA 4HA8A 2ZO4A 3KCCA 1FP1D 5BMZA 2NNYA 2CG4A 3ABTA 1ULYA 5LEJA 4EGYA 1XMKA 3WU1B 2XKPA 2FSWA 5ILVA 1ZYRF 5D8LB 3QPTA 3ZMTA 5HOOA 4LK1F 5FGMA 3I5UA 2M1BA 4XRFA 3P7NA 1QO0D 4EM0B 3VEPA 3EUHA 3GX4X 3MCZA 5JR3A 5KVRA 2JZYA 2NS0A 1YW8A 3DPLC 4BH9A 2M45A 3WG9A 1HKQA 2HS5A 4WXDA 2M5WA 4OIQF 4A0YA 4WK8F 3BPXA 1KU7A 2AXLA 3TGNA 1EH8A 1O3RA 2EFPA 3GFJA 4R8HA 3HRMA 4MNUA 3HTUA 2VXZA 3GEZA 3WE2A 3EYYA 3KFWX 2HWVA 3TO9A 2VOPA 5LGNA 4A6EA 3JTHA 2HQRA 4ENMA 4Z2YA 3C7JA 3L09A 2XAGA 1QGPA 3QU6A 5DUKA 2DO7A 3BWGA 1TNTA 1YIOA 3FHZA 3QRFF 2D1HA 1ZRDA 1E2XA 2HR3A 1FBUA 3CUQB 4LG0B 2XIGA 4LB6B 3ECHA 2FA5A 3ROUA 5LGTA 2YSRA 1KU9A 2XAHA 3B02A 3SZTA 4Q4ZF 3SXYA 5E8GA 3BDDA 1XSXA 5TRDA 3FZVA 4UVBA 3V7SA 2IA2A 1U2WA 4RGXA 1QQIA 3KETA 5JFRA 2A68F 1FC3A 3VOEA 2DTRA 4YIFA 1UHMA 1FSHA 3KLOA 2HDCA 1J5YA 2HKOA 4BQAA 4RAZA 3M7GA 3U9GA 4HOBA 2PJPA 3M9AA 1FPQA 1FSEA 4ZYEA 2PQ8A 4NQWA 4XLPF 2P4WA 1O3QA 2Q8KA 1ZHFA 1R1UA 4LD5A 3P9CA 4EJTA 2CW0F 2FU4A 2Z3YA 4MEXF 1XGNA 4KIBA 4LMYA 1I6XA 3K1PA 1JXSA 2VONA 4LGWA 5LGUA 3LWFA 1EH7A 1RZ4A 2ADUA 3BY6A 1QZYA 2JPBA 2P5KA 5DD4A 2EB7A 1O3SA 3JAMK 4ESJA 1LB2A 3F8NA 4ZZDA 2VODA 1IF1A 4GGGA 4BYYA 3R0AA 2A6EF 1B9MA 2GAUA 1SFUA 1YS6A 3BJAA 4KYWA 5DD8A 1ZRCA 2RDPA 3OOPA 5ICEA 3PQKA 3P9KA 4FHTA 4G8XA 2GXBA 3WGHA 3ZP5A 2EFNA 4WX9A 3RYPA 1LNWA 5LRSA 1LDKB 4AWXB 5FLXZ 1XGMA 2ZJ2A 2PI0A 4EJUA 2RNJA 2PMUA 1BBYA 2J5PA 3QP5A 1R7JA 3CJNA 5IT9Z 2XAJA 5K5OA 1XN7A 4AD9A 1W5TA 1IRFA 3ZN1A 1XSDA 3HTSB 3C1DA 1S29A 4U0WA 2Z99A 3K1MA 5DYMA 4RB1A 2Z33A 2STTA 4HQEA 1FWZA 3FXRA 4O5VA 5D4RA 2WTEA 2PEXA 1O57A 3E5XA 3HRTA 3T8RA 2F2EA 5FO5A 4KN4X 3RTRA 1OPCA 2JRTA 4M6XA 1UCRA 1BN5A 2EA4A 1D8JA 3F22A 2VBWA 1FT9A 2DLLA 3KZZA 3KEOA 4UUVA 2BGCA 2QENA 2DW4A 1R58A 4XSXF 2OQGA 5A2QK 2FQ3A 1MGTA 3LQRA 2GWRA 1YTYA 3BROA 2F5DA 2VT2A 3I59A 2UXNA 1F1ZA 4HX4A 3LQQA 2K02A 1RUNA 2MC3A 3I0TA 5ICGA 4G7HF 4HF1A 2ISYA 4MTDA 3LAJA 3BP8A 2G7UA 1XCVA 1R1TA 1FZPB 4A5NA 4M73A 3HSRA 1WSUA 1HBXG 4CGZA 2PMHA 2DAOA 1U78A 2V9VA 1R23A 4I02A 1ZLJA 1LJ9A 2IJLA 3ECOA 3HHHA 3F8FA 1OYYA 4IRIA 2IPQX 3KP4A 2PLYA 4P9FA 2FBKA 1TTYA 1L0OC 2L02A 5CVRA 3WU0A 5L3CA 2EV5A 2RV8A 4RB3C 2F5CA 3GFLA 1D3YA 3G73A 1XSVA 3BJ6A 2XVCA 3WTUC 1R22A 3HRSA 1WKMA 4E70A 3ZMZA 1Z1DA 2VT3A 3DFGA 1OKRA 3TDZC 3F72A 1T2KA 3RJPA 2DI3A 1BI3A 3F23A 4HQMA 5D5WB 1MZBA 4TV7A 1Z91A 4UXNA 4MHGA 2XRNA 4ZH4F 4KIGA 3R4KA 4U7DA 1TNSA 2V6CA 3U2RA 1A04A 1K6OA 4ON0A 3WE3A 2H94A 1S7OA 3KEQA 3W6KB 2WWYA 2QBYA 3M1EA 1FBQA 2RGVA 3TOBA 4R79A 4I98B 3GUDA 3WTXC 3WTYC 2A6HF 1XCBA 2CQKA 5IT3A 4AIJA 3NRVA 5K5QA 1S8NA 5BOXA 3DQVC 2CSOA 4EGZA 4CZZA 3JSOA 3H92A 2FNPA 4OMZA 1JE8A 1WI9A 2DQLA 1KA8A 4KIFA 5BS6A 2NAZA 3I59B 3MAJA 3WTTC 4HX7A 3HOSA 1G3WA 2L4MA 1T39A 3FXUA 1HXDA 4FT8A 3L2CA 3IKTA 1U6GA 1W4MA 1USTA 3LFKA 2HEOA 2A07F 1C0WA 5F64A 4ENKA 1DUXC 1OMIA 2FOKA 3RKXA 1KYZA 4DQ2A 5HS9A 3L9FA 5BQTA 4EM2A 3COAC 5D6FA 5H6RA 4KNYA 4UVAA 4A0XA 1FX7A 5HDKA 2VOOA 3HSEA 1JGSA 1R36A 2DBBA 4B8XA 3TDUC 2RC4A 1MKMA 2MA3A 2VE8A 3M8FA 2P7VB 3DXJF 2CO5A 2VBYA 4HDVA 2RN7A 1R00A 1GVJA 1XDUA 3K0LA 3AAFA 1B4AA 4YG2F 2MD5A 4IRGA 3KP5A 5H20A 2ETHA 3RDIA 4BAYA 2XV4S 4PGHA 3EYIA 1FLIA 3SHFA 5JHUA 3RKYA 1HKTA 5LRRA 3TO6A 3J7AO 4MEYF 3ULQB 1QPMA 1P92A 1FOKA 2QQ9A 2P7CB 1UHWA 5E1ZB 4XBFA 1QZZA 5FD6A 1BI0A 5FLXK 1YS7A 1LDDA 4I2OA 3T0YA 3J80K 4OIOF 1CF7B 4UVCA 4N9IA 3ZN0A 1B59A 3EETA 4HF2A 4G6QA 2RQPA 1PP7U 5IT9K 5HS8A 3F21A 1S7AA 4M9XA 1HKSA 3E6MA 3MZYA 1OYWA 1HSTA 3DPTA 3LA2A 3QPHA 5E18F 1QNTA 1F5TA 4QLCU 3CUQC 4IHTA 2IA1A 2JT1A 3MQ0A 4M9ZA 2AS5F 1T98A 1IN7A 4PDKA 3KP7A 2H09A 2CFXA 1OR7A 1ZG1A 3ABUA 2LKPA 3T8TA 2OBPA 3GLXA 3JSPA 3GVAA 4HAMA 1S6LA 3HHGA 3TKYA 4HV5A 2VC1A 1QBJA 4P55A 5ED4A 3RPUA 2DPDA 4L9NA 1P4XA 3EDPA 4AVPA 2V1UA 2VC0A 3WGIA 3R61A 5D6EA 4MTEA 4PZJA 3LSTA 1K78A 1RIOH 2K7LA 4RAYA 4G6DA 3CO7C 2QQBA 1DPUA 3GXOA 4LK0F 2LSOA 4BHBA 4P5OA 5BPIA 5HDNA 1KU3A 2IW5A 2P5VA 3KLNA 2A61A 4Y17A 1STZA 2O3FA 2O8XA 1ZN2A 3K9TA 2LF8A 2FBIA 4LLLA 1RI7A 5DDGA 1EH6A 1W7PA
chains in the Genus database with same CATH superfamily
3GW2A 4HNTA 1D8KA 3VODA 3CLQA 2JUGA 1ZREA 4M3BA 1ODDA 5JVTA 2GA1A 1R5GA 5JLWA 4BNCA 3ZPLA 3FIWA 1N78A 2JRMA 2KT0A 2V9PA 3M07A 1REPC 1ZK8A 1BR1A 1BR2A 2EJRA 3GF2A 5DCMA 2E60A 2UWMA 1Z77A 2E7XA 1N77A 4M72A 1I6HJ 3OYLA 3FXMA 2PN6A 1U5TA 4F52A 3NWSA 1Z67A 2R5ZB 6PAXA 2CUFA 4XKVA 3J81Z 1IW7F 4BJTA 2KISA 1T33A 3HOUJ 2NYXA 3GWZA 1SD5A 2Z2SB 3C18A 1SEUA 1RETA 1FJLA 1HDDC 1D1CA 2JTVA 4BJ5C 1QPIA 1TQPA 3PFIA 1IV6A 3GFIA 5KNLA 1QU3A 1LUJB 3N97A 4X1EA 4ITVA 5E1WA 1X1AA 4RLQA 5DM7F 1X58A 3A02A 1KU2A 1KYWA 3Q0WA 4P9UA 1IRGA 2HPIA 3FKIJ 2W48A 3DLLF 4L0ZB 1B6AA 2QQAA 4MLOA 3L2RA 2KPMA 2DMQA 2GA2A 3HEFA 1OCOH 3WTSC 1FEXA 3T1BA 2CWEA 3BZ6A 1TWFJ 3CO6C 1H88C 3O6BB 2OV7A 4L5JA 4Y52J 3K2AA 2COMA 4L9VA 3ZMSA 4E4HA 2OTLI 3BLYA 5D5UB 2A5YB 4M74A 1RNLA 2FEZA 2V6EA 1AOYA 1LFPA 4WWCA 3PIOF 5HLHA 4PSXA 2NNNA 3HOTA 2FMYA 1IN6A 3FXKA 4KICA 1FP2A 3SFIA 1NK2P 5D4SA 5HLIA 1HW5A 4EV0A 4JK1X 3ERED 1R5HA 1YW9A 2BHYA 3BOQA 3FX3A 2P6SA 4RB0A 4IKFA 3OYAA 3PSFA 4BUPA 3FDYA 1VQ9I 4EJVA 2XHKA 3GZ5A 2ZMEA 2EFOA 1HW1A 2DA5A 4CSWA 3H9GA 2EILH 4XLFA 5J47A 3TO7A 5FJ8J 4YRVA 2O0YA 4IHXA 1IN4A 2NRAC 5JHFA 2E1OA 4F93B 2Y48A 1G6NA 4OIRF 1USSA 2O7OA 2K3PA 2F6CA 3AG4H 2CW8A 4IHVA 4RS8A 2Y9ZA 1JI8A 5E8IA 2ECCA 3JAMZ 2DDAA 2KIMA 3FXQA 1SFEA 1RKTA 2IA0A 3HKZA 1L3LA 1OYIA 2DODA 3ZQ7A 3CCEI 2JK3A 4D0PA 3HUGA 1B8IB 3W3CA 1MSFC 3OS2A 2R7TA 3WTZA 2XKOA 1F9NA 1H9GA 2GZWA 4A3EJ 3FF5A 1YQAA 3F9KA 5J1UA 3MD2A 3V8KA 2KIUA 2YR2A 3IH3A 3D0SA 5F04A 1I1SA 3NEUA 4E7KA 4U88A 1PVEA 3WG7H 1FYMA 3OL3A 1YI2I 3I54A 2WY7Q 2HXIA 4GRIA 2FBHA 1ETWA 4BJ6C 2W84A 1E3HA 4CZCA 3OL4A 2MH9A 2JVGA 4UV8A 3OYEA 4Y7NJ 2DPUA 3OYJA 2UZKA 1T6SA 5E3LA 4UHTA 2AHQA 3IKVA 3N4MA 4HDUA 3QOPA 3IWFA 3OS1A 3TP0A 3K6GA 3FBIB 4ETSA 2L3DA 3F8MA 3S3MA 2X1EA 2BE5F 2R4GA 2M4KA 3I3LA 5CLSA 2HYGD 4ZC3A 3VSLA 4BHCA 3OYBA 3GYHX 2F5FA 4ENNA 2G9WA 2XAQA 1YRNA 1Q1VA 2QSHX 1D0ZA 3PM1A 3JRIA 2M7BA 2LP0A 4IHYA 3DTKA 4WF2A 4G94A 5AIPA 5DM6F 2YU3A 2X0LA 3CP8A 5H6QA 5E1XA 3V7CA 3Q0UA 4O3MA 3FM5A 4FETA 1WWXA 5DTDA 1ETQA 4D7NA 4AIHA 4Y15A 3CMEI 2WB1A 4DYRA 2JQ7A 1W5CC 2EV6A 2K86A 3ML6A 3LSIA 1U3EM 5AONA 4OU0A 3BTIA 4Q5SF 4N9HA 1B1BA 2EV0A 5DCMB 3IH2A 2LYCA 3I4PA 3A0BC 2L01A 2M30A 2V9KA 1BR4A 2W00A 3FMSA 4AIKA 3I53A 2ESHA 4JBAA 3SYTA 2XGXA 2O61A 1U5TB 2F5EA 1T38A 2MLKA 2E1MB 1NH3A 4IQ4A 3RZOJ 2STWA 1Q1HA 3Q9SA 2RAEA 1PP8F 2Y31A 3RPUD 4Y3OA 3MMYB 5KAIC 2EZKA 3CC7I 1ZELA 2DA4A 1WGXA 3K4BA 2DMTA 3JRBA 2LOOA 1CGPA 3IL2A 2E1CA 4XR6A 3K4LA 3FISA 2JSCA 1LVKA 1Y6IA 3MKLA 2R3SA 2CRGA 2EPFA 4L5IA 1BIAA 4DJAA 1BC7C 1J75A 2PG4A 2W7NA 2R5YA 4AYBN 1DP7P 5FFXA 4WXCA 1GXPA 2E2IJ 4A0ZA 5L3DA 2VBZA 3CLOA 4QSHA 2FOWA 2BY3A 2PMZN 1WJAA 4H4KC 4JX6A 3R60A 4OOIA 4JX5A 3WODF 3OIPA 3HSFA 1OCCH 3TL4X 3QQAA 3I64A 3KZIC 5J1YA 1ON1A 4I7HA 3OYIA 1Y0UA 2CV2A 4PFPA 2DYRH 2KIFA 1TP4A 4HV6A 3BG6A 5K7ZA 4Q47A 1W7PD 4XRSA 3OSGA 3CCJI 1ITYA 4L18B 4PCQA 2VE9A 1X19A 4ZYHA 5KHDA 2ZNZA 1HDPA 2W85A 3L00A 4E7JA 4RGUA 4RGRA 4GXOA 4YIIA 2IS4A 1Z05A 1TW3A 2Y0SA 4RGSA 1WCMJ 3CUQA 2CQQA 4LG0A 4OIPF 2OQRA 1W5SA 2VKVA 2Z5UA 4BBRJ 3CUOA 3KX2A 4MFEA 5F1RA 4U0YA 1T0FA 4B47A 5ICFA 2WV1A 3BQYA 4XLHA 1UZCA 5ILUA 1BC8C 1ZR4A 5DCFA 5IOYA 1UG0A 1G59A 1FNNA 1AHDP 2ZMEB 1MBGA 3I56I 2ZCWA 1K61A 3HOXJ 2UV1A 2OC6A 4G9YA 4X0GA 3CCSI 4XL9A 1S3JA 1BI2A 4LFUA 3IC7A 4OMYA 2CQ7A 3JRGA 4A3KJ 4I0AA 2LY2A 1XMXA 3A1YA 1WJ5A 2EZIA 1RESA 3BT9A 3ISPA 5F6FA 3DKYA 5ILSA 4BS9A 3ONQA 2DFHA 4I01A 4HW0A 3Q9VA 3GMEA 4GYGA 4HX8A 1P9QC 3ZMDA 1ONVA 4BE1A 1IAWA 1Z7UA 2VJIA 3HUGB 3DKWA 1JUPA 1MW7A 3F3XA 4C3JJ 4EQQA 2J5OA 2BBYA 2I8DA 3V7RA 3FMQA 3PO2J 1GT0C 4Z6YA 1VQ5I 1IRZA 1WFXA 3C3WA 1P2FA 3MKWB 4M71A 3LSJA 4WXHA 3M4OJ 2DOAA 1WH7A 4IXAA 1XG1A 4JYKA 1X3ZB 3BR3A 5CVJA 3EQLF 2OJED 4OINF 3MKZA 3BTCA 3JRFA 1MMDA 2DK8A 4HZFA 4ZTJA 2VUMJ 5J6XA 4II3A 2CYYA 4A3CJ 2XB0X 2OAZA 5DUIA 2Y0MA 4FE4A 1ZARA 2WY8Q 3Q5FA 2QZ8A 1WRJA 3JTGA 1MSEC 3RKWA 1FBSA 5K7HA 1BL0A 1MJ9A 2P81A 2RKHA 3DU6A 4XLCA 2X1CA 1V5FA 3F6OA 2OU2A 1SMTA 2DYSH 3RPQA 1LEBA 1ACIA 2H6BA 3F0CA 1OCTC 1YRNB 3CZ6A 2JMWA 2BYVE 5EEAA 3CESA 1PYVA 1OISA 1Y56A 2DQRA 3PIPF 3CTAA 5J8FA 1MH3A 4KMUX 4G7OF 5FKOA 1BOAA 1SANA 5IYDJ 4E7IA 3WGGA 1NTCA 1VNDA 2X6XA 4Y4RA 2RVCA 1LKXA 2CMPA 2NXNB 1QRYA 1Z21A 2M0CA 3H3UA 4YIRX 2L7KA 2FRHA 2WC2A 1K4TA 2BVLA 2R93J 3S1RJ 4PJJA 1PDNC 2FD5A 2VPRA 3E97A 4HLXA 2DK5A 2HQNA 4KT5C 1R6RA 3JW4A 4IF4A 3HL2A 3CC2I 1NHAA 1P7JA 4B4CA 2V1DA 3G71I 2BY1A 2VKEA 3BZCA 3KYDB 3VDXA 4YFKF 5K5RA 3E0JB 1KQ0A 2JPCA 4P96A 2ZJRF 2BEOA 3V8LA 2GXAA 2Z16A 2VQLA 4KT6A 2TDXA 1U9NA 2ELHA 2ZKZA 3NQOA 2KRFA 1SAXA 4YFXF 4MGRA 5TISC 3AG1H 1MDMA 1J7KA 1VQMI 3CC4I 5CVUA 1JHFA 3FWEA 4XOPA 5D5XB 2NVQJ 4M3DA 2XPVA 4R1HA 4HBLA 3KZYA 3RCOA 4LB5A 2FX0A 5E79C 4WCGA 1MJAA 5L3EA 1WI3A 2VB6A 1J0RA 4A3LJ 2KZVA 2K27A 3VB2A 4IVNA 3LA3A 2FXAA 3GZ6A 4BDZA 3W2AA 1A6IA 2QWWA 4V19K 2CH0A 3LAPA 3S1MJ 1V5EA 4II2A 3T5XA 4NHJA 5FD5A 1F4KA 3TW7A 1ETXA 1WH5A 3H36A 4KJZA 4JX4A 1E17A 1IUYA 4BE0A 5BPDA 1RC9A 1ZG3A 5CJ9A 3OIQA 2VQCA 2TCTA 4I0BA 1RR7A 2EIJH 4F7ZA 3F8BA 1O7FA 3OIOA 2KKOA 2ZSHB 1UB9A 1Z6RA 1IRXA 3OV8A 3LMMA 2ZFUA 3ASNH 3GTPJ 4QTRA 2GXGA 2QBYB 3GO5A 3S2DJ 3L7WA 2ESNA 4UB6C 2IP2A 2HOEA 2A69F 3B6CA 4F92B 5EG0B 2X6WA 2HVSA 1GLNA 4UNOA 5LLQA 1JHHA 3H1CA 3I55I 3GTLJ 1ORKA 2LKSA 1FMWA 3J81K 3L2QA 4BHPA 2IAIA 2A3SA 1Z3YA 4JQFA 4S04A 3K4KA 4CCJA 4ENJA 3SQNA 4G6TB 4LG3A 2LREA 3ABLH 2KRCA 1P4WA 3WTVC 4QPOA 2Y30A 4N0BA 3A0HC 2DA7A 3MEXA 1Z9CA 4EJWA 2Y75A 1Z7LA 3OYFA 4AVZA 1TLHB 2HGCA 4HLYA 5HNFA 2BV6A 3SDBA 2K9QA 4EM1A 4S0HB 4ESFA 3IUOA 1H8AC 1RR8C 1UAAA 4GFBA 2AQEA 5F08A 3V4GA 1BIBA 2OD5A 3KP3A 4I99C 1JKOC 3W6VA 2FUG2 4ZZLA 3D5LA 5FRNA 2E34A 5L3FA 1V54H 4Y33A 4MQVA 1TC3C 3IRRA 1XGOA 4XOTA 1ZG5A 1GHCA 4XKWA 4RAGA 2HKXA 1U8BA 4EVIA 2ECBA 4PJNA 2K40A 2HOSA 1EJ9A 3RYRA 2VL8A 1ZAOA 2HDWA 1IO2A 2F5VA 4IJAA 3OYGA 2QUFA 2ME6A 3HIFA 1PUEE 1JTXA 3S32A 2K4JA 1ON2A 4KMFA 4A12A 4A5MA 1G3TA 3MZ8A 1SFXA 4IHWA 2VKDA 3DBRB 4LJZF 5EDNA 1O3TA 3QYBA 1D1BA 3KP2A 4XSZF 3OYCA 2E5NA 2XASA 4B48A 4BQNA 1G4DA 2O9LA 3LSGA 3BTJA 1YLFA 3PFYA 2ZJPF 4H0EA 3ZQFA 2M87A 3VWBA 3B73A 3M8EA 1AU7A 3IRQA 3OMYA 5EGOB 3DP7A 5J8CA 1SD6A 5GAGJ 1IDZA 1WQ2A 1XTAA 3BG9A 2X4HA 3LSRA 2DOEA 3H5NA 3PSIA 5E17F 4IQJA 1X1BA 2FF4A 4LLGF 4BQQA 2ICWG 1EV7A 2A6TA 1P6RA 4JOMA 2G7HA 5ERIA 5FROA 3E6CC 2EA2A 2X1DA 5AIQA 4NB5A 5L3GA 1XGSA 4CO8A 2P5LC 3FM3A 1R1VA 1N75A 2V1NA 5F0FA 1FIAA 1MBKA 5LHIA 4RDUA 2VIXA 1SD7A 3P9IA 2QLZA 2Z9OA 3DV8A 3SEZA 4PSWA 2K9NA 2LVSA 2VQHA 1V55H 3JREA 1ZGWA 2MG4A 3BQZA 4KN7X 4J01A 2OZ6A 5LFAA 4IEJA 3DBLB 3FMRA 1JJ6C 5FFZA 2W57A 3LSPA 2O6GE 2M8GX 2CS3A 4HF0A 4A6DA 2WAQN 1TW2A 3H0DA 1K7AA 3P5JA 1J59A 1D5VA 2HU9A 3GLLA 3DLAA 4ZDOA 2FE3A 4XNFA 3WHCA 1ZGAA 1MDMB 4GO1A 2PJRA 2HVQA 3MWMA 2ACJA 4ZJZA 1K79A 1WZ2A 3K1NA 3CP2A 1HW2A 1MNEA 4KDPA 3EUHC 5ICCA 3ZQQA 3DTEA 3ERMA 2IBDA 4KUMA 2EIKH 2K5CA 2KQRA 1YHQI 5EF6A 2R0QC 4CCMA 4FX0A 4LLNA 2RREA 4U0VA 5EJCA 1G3SA 2VLAA 2VI6A 4XK4A 3J80Z 1PUFA 3CCVI 5D5VB 4IZZA 2EK5A 4QIWN 1LEAA 5HVQC 2JA7J 1TQIA 1UMQA 3MZHA 1O7LA 1WJCA 4XN3A 1X3WB 1YE9A 3PL8A 1IG7A 5IP9J 1IXCA 4EATA 2FMLA 4FTHA 2GIVA 3ZQLA 2H27A 4L9TA 3F6VA 2QKLB 2VBXA 2DFIA 3AFHA 1V3FA 2QYOA 3S93A 3O2PE 3LOCA 2B0LA 5LHGA 3K4JA 4XICA 4BU2A 3REOA 3BR5A 2MH2A 2EWNA 3H9JA 2F48A 1SVMA 3CJQB 4HG2A 1J9IA 1OCRH 3C2GA 1IUFA 1ZLKA 4ZYGA 1FYKA 4DBQA 5LHHA 3ZXSA 2UXXA 3QP6A 2C6YA 2HYJA 1J09A 5E3NA 2E7WA 1HC8A 4LITA 2K4BA 2LBFA 3IP4B 1JGGA 4GCVA 2R7FA 2E1NA 3E6BA 4BKXA 3OYNA 4Y13A 3KEYA 3V8JA 3K69A 2Q2EA 4I09A 4XLNF 3QODA 3I71A 2BOLA 2XSJC 3HRUA 1W1WE 3CCYA 2I5UA 4A2UA 2CGPA 4A3JJ 3VYRB 3DPUA 4C3IJ 1LVAA 1LPQA 3K2ZA 1DDNA 1VQ8I 5KK1A 2KDOA 1RRJA 3W2WA 1SD4A 1WVRA 2WAEA 2XF5A 3BJOA 3QWLA 4C30A 1DGWY 2LNBA 5EEHA 4U7BA 3J7ZI 2LKXA 4CYDA 3I58A 2W82A 2V79A 3H5RA 1SC7A 4ABZA 3GFMA 3BR1A 1XB4A 2VJ5A 3VYTB 3TEDA 3QPLA 2XAUA 2DOFA 1XX5A 3HM5A 4IHSA 4CCKA 4RMNA 5L3BA 2O03A 4I76A 5JVGF 2EFQA 1XMAA 2CJJA 1FOXA 1SMYF 4HSRA 3KE2A 2IVMA 4IPAA 4E7LA 2HYFA 3W6JB 5LEKA 3E3VA 5EZHA 4CYCA 2W1OA 3KP6A 5D8KB 1VTNC 2JA5J 1LQ1A 2EBIA 4QWQA 3H3ZA 4FX4A 4PFOA 5JI6A 2LR8A 1OCPA 3CF2A 1B72B 2XUBA 4PJMA 2YUSA 1MBEA 4ASNA 3CF5F 4CCLA 2X6YA 3HJEA 5GPCA 3MFKA 2ZXHA 4NBQA 1YJ9I 2NVYJ 2EQRA 5DV5A 2W4SA 2OCCH 2HFHA 2XPUA 5EEGA 3E1SA 2Q0OA 1K78B 2IEKA 1I5ZA 2L7ZA 3IAM2 4BEHB 2MBFA 1IN8A 4KFCA 1BM9A 2XROA 1YO5C 3BG5A 3E6DA 4IO9F 1UHSA 1BI1A 2G0EA 2H6CA 4EMSA 1Z6TA 2PFBA 1YG2A 2K85A 1LDJA 1LE8B 4BXUA 3LA7A 4DYCA 1H89C 4IL6C 2R7SA 3TQNA 2LDUA 2X6OA 2LH9A 1AWCA 4PGGA 2JA6J 4BY7J 3G3ZA 2E36A 1R5ID 4K2EA 2IRFG 4CDGA 2P8TA 5J40A 2CUEA 1J2XA 1ZTRA 2V4JC 1XC5A 2NS8A 4DYQA 5H2FC 4CXFA 2VJJA 3S2WA 1ETOA 1JJ8C 3ZQIA 1UFMA 3CDHA 3IHUA 5DEQA 4S05A 3O3KA 3ZMUA 3CJTB 1IXSB 3OYHA 1W7PB 3QU3A 5HLGA 1IXRC 4C2MJ 3ZQHA 1HLVA 2AXTC 3IH4A 3F8CA 3S2HJ 1TQMA 2QQ8A 5HDGA 1V5GA 1XDSA 2M9HA 3DF8A 2LFBA 2QF7A 1TBXA 1SFOJ 3AG2H 2HPMA 2R7QA 3SZPA 3K70C 4A3GJ 2PBIA 2LC2A 4NNJA 3CCRI 1KQ8A 1YFHA 3ZMVA 3BPVA 3FXJA 2OA4A 2ZBKA 1DGRM 1KGSA 2MLGA 3R0JA 4CICA 4L0YB 2ELKA 3UNGC 3K10A 1B9NA 1DPRA 3LL7A 2DFFA 3ELKA 2KJBA 1P4AA 2W25A 3WTWC 3VYSB 3G6EI 1MBJA 1IC8A 3I4NJ 2CW7A 2GQQA 4BL0B 2D1VA 3DWLE 2D2WA 2V1XA 2VQGA 3RQIA 3AL0B 2E5ZA 2GOMA 2ZFWA 2YX4A 4A3FJ 1YYVA 2VXDA 4ZYDA 3D1NI 4Q48A 2OPTA 1ERDA 2ZXIA 1H9TA 1X3UA 4B43A 4CHUA 4L9JA 3HYIA 4MQ9F 2HZTA 2B63J 2YX7A 4BXFA 3A01A 1KQ9A 4HYEA 3W2VA 4XRSG 3S15J 2FNAA 4A3BJ 1BJAA 2XPWA 2H1LA 2HI3A 3RIRA 1I1GA 1WJBA 1IN5A 3IWZA 3HPHA 1YX3A 2ISZA 1HSJA 5CVVA 4KA4A 1W0TA 2KJCA 1ZH5A 1RUOA 1U8RA 1ZGJA 4XKBA 1YW7A 4ESBA 3QOEA 4GYIA 4UV9A 2L9NA 4XRMA 5K1YA 1HA8A 1U5TC 4IOAF 1SVOA 2ZNYA 4IRHA 2D45A 3G1MA 2E1MC 2RQQA 2V26A 2KP6A 3DEUA 5CYVA 3QAHA 2DT6A 2L9SA 3FK7A 3L2VA 3HOWJ 2NVXJ 2OF7A 3WU2C 4W97A 1SAUA 2L4AA 2DT5A 2VN2A 1JTYA 2M34A 3OYMA 2DA6A 2ZXJA 4DNCA 1T95A 2WAFA 3HKZN 5A2QZ 4G12A 3U1DA 3BG3A 1I27A 4XLAA 5EYRA 3NAUA 3M3YJ 1CF7A 3HC7A 3CJRB 4MO7A 1WJDA 1KONA 4PJ0C 1MBHA 2FJ1A 2R7DA 1AKHA 1ZQ3P 1V4RA 5M5WJ 2MABA 5E20A 3VFZA 2HQAA 2HTJA 1Y8QB 4L5EA 2KFDA 3TOAA 2EINH 2HTSA 4XLEA 3SFZA 4EJOA 4DBRA 4YFNF 2GIZA 3D5SC 2YS9A 2ELJA 2XAFA 1VQ7I 2JA8J 1H0MA 2ZSIB 3H35A 3VYUB 2IGOA 2IGMA 4NC6A 1IZ1A 1FY7A 2IT0A 1HQCA 2W24A 2ZC2A 3DEWA 2QSFX 3RI4A 3E5QA 5CKTA 4RB2C 2OZUA 5CVIA 5HS7A 3K4MA 3TP3A 4M9SA 2WV0A 2LK2A 3K4NA 5TJJA 2R7OA 1FYLA 4B09A 2EFWA 2M8EA 4M6YA 4XMYA 4AC0A 1GXQA 2LF7A 2E2JJ 5LBQA 5CQEA 3E5UA 1XD7A 1W36C 2L5QA 1OFCX 5E3OA 3PUBA 2QM3A 3CDLA 2DU9A 3PQJA 2HOTA 2WB1N 3R6SA 4G7ZF 3HDDA 3J7YJ 1G3YA 2L54A 1MJBA 1BJZA 1MD0A 2NS7A 4MFDA 2QVOA 2YPRA 2ZMEC 5FB2A 2DN0A 4BXXJ 4O6JA 3H5AA 2P6TA 4BGDA 1FOYA 2Y69H 1ZRFA 1JT6A 4HA8A 2ZO4A 3KCCA 1FP1D 5BMZA 2XC7A 2NNYA 4CCOA 2CG4A 3ABTA 4UB8C 4M3FA 1ULYA 1E3OC 5LEJA 1HCRA 1K6YA 4EGYA 2ZB9A 1XMKA 2ZXWH 1VQLI 3S14J 3WU1B 2XKPA 3DEEA 3E7LA 2GM4A 2FSWA 5ILVA 1ZYRF 2Z1DA 5D8LB 3BC8A 3QPTA 3ZMTA 3OSFA 1JKRC 5HOOA 1X4OA 2H1KA 4LK1F 1BW6A 1VQPI 1R4NB 1YX5A 5FGMA 3I5UA 2M1BA 4XRFA 2KRHA 3P7NA 5FKKA 1QO0D 2CV1A 4EM0B 4DW6A 3VEPA 3EUHA 1QZEA 1XPXA 3GX4X 2OUMA 3MCZA 4FISA 5JR3A 3J7AY 5KVRA 1E3PA 2JZYA 2L0KA 2NS0A 3B6AA 1YW8A 1YIJI 1S72I 3TW6A 3M1CA 1BW5A 4YEJA 1Y0NA 3DPLC 4BH9A 1GDTA 2M45A 3WG9A 4DGWB 4UUSA 1HKQA 2HS5A 1NK3P 2LMDA 4WXDA 2NVTJ 2M5WA 2LRDA 1K83J 3HPGA 1Z3XA 4OIQF 4A0YA 3L2WA 4WK8F 2R5YB 3GTMJ 3BPXA 1KU7A 2AXLA 3GTJJ 3NARA 3TGNA 4AM3A 1EH8A 3C2HA 1O3RA 2EFPA 3A01B 2KMUA 3GFJA 4U87A 4R8HA 2MC4A 3HRMA 4CA0A 4MNUA 1X1DA 3HTUA 1JUMA 2L9RA 2VXZA 3GEZA 3WE2A 3EYYA 1GVDA 1EF4A 3KFWX 2HWVA 3TO9A 5FLVA 2VOPA 5LGNA 3FKJA 4HPQA 4A6EA 2IS1A 1VQ4I 5M5YJ 2BW3A 2Y9YA 3JTHA 5J3LA 5HODA 2HQRA 4ENMA 2DA1A 4Z2YA 3NWTA 3C7JA 2F4IA 3L09A 2XAGA 1QGPA 3QU6A 2NOGA 5GTHC 5DUKA 2DO7A 3BWGA 3TMOA 1TNTA 1YIOA 3FHZA 3HZJA 3G2BA 1PJRA 2ZJQF 3QRFF 2D1HA 4BBSJ 1ZRDA 1E2XA 2HR3A 1FBUA 2WAQA 3CUQB 4LG0B 2XIGA 3UR3C 5GTIC 4LB6B 3ECHA 3N05A 2FA5A 3H3VK 3ROUA 5LGTA 2GOXB 2YSRA 1KU9A 2XAHA 3B02A 1OCZH 3SZTA 3ZQCA 1DU6A 2QGUA 2P0WA 3ABMH 3SXYA 4Q4ZF 1ZR2A 2NVUB 5BNGA 5E8GA 3CCQI 4IX7A 3BDDA 1WJEA 1MBFA 3D5RC 1MH4A 1XSXA 1YJWI 5TRDA 3FZVA 4UVBA 3HOZJ 3V7SA 2IA2A 4M3GA 1G8XA 1U2WA 3BZKA 1MNDA 3TBIA 4RGXA 2JJ7A 1QQIA 1T56A 1TT5B 1VZ0A 3KETA 2PX9A 5JFRA 1SFKA 2A68F 1FC3A 1DP3A 1WHUA 3EUAA 3JR9A 2KZGA 2DTRA 3VOEA 4YIFA 1UHMA 4UUTA 3IV5A 1FSHA 3KLOA 4NUBA 4RBOA 2HDCA 3Q0VA 4ZDPA 2XRLA 2JA2A 1J5YA 2HKOA 4HNUA 4BQAA 2IS6A 4RAZA 1VQNI 2BXZA 3M7GA 4FE7A 3U9GA 4HOBA 1GV5A 4KITB 4RM2A 4XN0A 2PJPA 2LG4A 3BCBA 1AA7A 4J19A 2YU9J 3M9AA 1FPQA 1FSEA 4ZYEA 1FIPA 2PQ8A 4NQWA 2LY1A 4XLPF 2P4WA 1O3QA 2Q8KA 3C2BA 1ZHFA 1R1UA 4LD5A 5B5EC 3G4SI 3P9CA 4EJTA 2UUZA 2CW0F 3ZGKA 1R49A 2DMPA 2FU4A 2Z3YA 3BTLA 1R9TJ 4MEXF 1XGNA 4NDLA 3OOUA 2OTJI 4KIBA 4LMYA 1I6XA 3K1PA 4AIDA 3BG7A 1JXSA 2VONA 2JN6A 4LGWA 5LGUA 3LWFA 1EH7A 3A4CA 1RZ4A 2ADUA 1BOBA 2MFZA 3CCLI 5EZGA 3BY6A 4KISA 1QZYA 2JSPA 1WJFA 3X2QH 4HSTA 3DU5A 2JPBA 2P5KA 2AQFA 2BXYA 5DD4A 2EB7A 1O3SA 3JAMK 4ESJA 1LB2A 1IJWC 4W1UA 3F8NA 4M3EA 1GV2A 4ZZDA 2VODA 3A2KA 1IF1A 4GGGA 4D7MA 1A31A 4BYYA 3R0AA 4FCYA 2A6EF 1B9MA 3OR1C 1I3QJ 1MNMC 2GAUA 1SFUA 3CCMI 2L7FP 4AU7A 1YS6A 3BJAA 1EKEA 3HBLA 4KYWA 5DD8A 3U21A 1ZRCA 2RDPA 4UUSB 3OOPA 5ICEA 3PQKA 3P9KA 4FHTA 3I4MJ 1MMGA 4G8XA 1R4MB 2GXBA 3WGHA 3A03A 2NOJB 1D5YA 3ZP5A 2EFNA 2ID6A 4WX9A 3RYPA 1TWGJ 2RNGA 1LNWA 4F55A 5LRSA 1P7IA 1MIJA 5M3MJ 1LDKB 4D5CA 2LLKA 3KYCB 4PJLA 4AWXB 5FLXZ 2H8RA 1XGMA 2ZJ2A 3SDGA 2PI0A 1VQ6I 3JRCA 3OWTA 4EJUA 2RNJA 3UKGA 2PMUA 3V42A 3S1NJ 1BBYA 2BW3B 2J5PA 3QP5A 4A69C 1R7JA 3EUKL 9ANTA 3WHBA 4E7ZA 3CJNA 3LSHA 3VSKA 2CQNA 4FASD 4NC7A 3CMAI 2A5WA 5IT9Z 3HGYA 2HXOA 2XAJA 5K5OA 1XN7A 4AD9A 1W5TA 1A35A 1VF9A 1BA5A 1LFUP 5B1BH 3GCMA 3ZCOA 1IRFA 3OR2C 3ZN1A 1XSDA 3HTSB 3C1DA 1QVUA 4D9JA 1S29A 4U0WA 2Z99A 2M2EA 4ANJA 3K1MA 2Y2ZA 2M3AA 5J1RA 5DYMA 2HQ5A 4RB1A 1IDYA 2M7AA 2Z33A 5KCMA 1POGA 2STTA 4HQEA 1FWZA 2KLOA 5M3FJ 3FXRA 4O5VA 4V2GA 2QEXI 3FXOA 5D4RA 2WTEA 3H0GJ 1I3AA 4NC8A 2PEXA 1O57A 3E5XA 2KIQA 3HRTA 4LIUA 2XF7A 3T8RA 2F2EA 5FO5A 4KN4X 2IS2A 3RTRA 1OPCA 2JRTA 4XORA 2EIMH 4M6XA 1UCRA 1OQYA 4AYBA 1BN5A 3G1LA 2EA4A 3K4CA 3GBGA 1Y1WJ 2DMUA 1YOVB 1D8JA 2E19A 2PMZA 3F22A 2MGQA 2VBWA 2M0MA 1FT9A 4I6ZA 1KZHA 2DLLA 3FK6A 3KZZA 3BR2A 5C4XJ 3KEOA 5C4JJ 1R71A 2DMNA 2B9SA 3MKYB 3SEQA 2F4OB 4UUVA 1O4XA 4NQWB 2BGCA 2QENA 4DZJA 4F91B 1F43A 2E35A 3CCUI 2DW4A 1R58A 4XSXF 3L1PA 2KL4A 2OQGA 2A05A 5A2QK 4A3DJ 2FQ3A 4IOCF 1MGTA 3LQRA 3OY9A 1T08B 4QPQA 2GWRA 1YTYA 3BROA 4V2FA 3JRHA 2R7RA 2F5DA 1RPWA 2VT2A 3RQ4A 3O8GA 3I59A 2UXNA 4OWRB 2VPLA 2DA2A 5F0HA 1F1ZA 4HX4A 2Q1ZB 2HOAA 3RZDJ 3LQQA 1Y39A 2K02A 2XGDA 1RUNA 2N8GA 2MC3A 3I0TA 5F0CA 4CUGA 5ICGA 4G7HF 4HF1A 2ISYA 2CV0A 4MTDA 3LAJA 4HEA2 3BP8A 2G7UA 1VFCA 2TRTA 1XCVA 1OR7C 1G2HA 1R1TA 1FZPB 1TWHJ 4A5NA 4M73A 1TWAJ 2EH3A 3HSRA 1WSUA 1JUSA 1TL8A 2XGCA 5IP6A 1HBXG 1QHHD 4CGZA 2PMHA 2DAOA 1LFBA 1U78A 2V9VA 1R23A 4E7HA 4I02A 1YJNI 2GLOA 4ZTFA 4ZDLA 1ZLJA 1FTZA 1LJ9A 2IJLA 3ECOA 3HHHA 3CDIA 3F8FA 4A93J 2EZLA 1OYYA 4IRIA 2IPQX 3KP4A 2PLYA 4P9FA 2FBKA 1TTYA 3RKQA 4FQGA 1APLC 2PJRB 3S17J 1L0OC 2L02A 5CVRA 4HRIA 3WU0A 2ME0A 1MMSA 3AKZA 5L3CA 3EPZA 2LY9A 2EV5A 2RV8A 5E3MA 5FLMJ 2QA4I 1U0JA 5C3EJ 4RB3C 2F5CA 5IOZA 3GFLA 1D3YA 1ENHA 3G73A 1XSVA 5CQGA 3BJ6A 4BDYA 1PUFB 2XVCA 2KDZA 3WTUC 4XONA 1R22A 3HRSA 4MIMA 1WKMA 4LOCA 4E70A 3ZMZA 3VPRA 1Z0XA 1Z1DA 2VT3A 3DFGA 1OKRA 3TDZC 2BHZA 3F72A 1T2KA 3RJPA 3KYLA 3GTQJ 4RA2A 2DI3A 3JRDA 1BI3A 1N25A 4BY1J 4D1QA 3F23A 4HQMA 3K70D 5D5WB 1MZBA 5FKMA 4TV7A 1I50J 5FRMA 5C44J 2R7UA 1A5JA 1NG6A 1Z91A 5TGTA 2CUJA 4UXNA 4MHGA 2XRNA 4XQFA 3KPHA 3PJRA 2LBFB 4ZH4F 2DA3A 4KIGA 2XDVA 3R4KA 5M5XJ 4U7DA 1TNSA 4B3XA 2Q2EB 2V6CA 2HZDA 3U2RA 1D0YA 1A04A 1K6OA 2L7MP 1EA3A 4ON0A 3WE3A 2H94A 3ZOBA 2O8KA 3AL0C 2CQXA 1S7OA 3KEQA 2X85A 5FKLA 2FQ4A 1QA6A 3W6KB 2WWYA 3PNTA 2QBYA 3M1EA 1FBQA 2RGVA 3TOBA 4D5FA 4R79A 3HOVJ 4I98B 1IGNA 5EG0A 4JP0A 1OLTA 3GUDA 3WTXC 2XGEA 3WTYC 1DU0A 1D0XA 2CUZA 4CH7A 4B44A 2A6HF 3OYKA 1XCBA 2BY2A 4GDFA 2CQKA 3JCUC 5IT3A 3NRVA 4AIJA 4ZYAA 1S8NA 5K5QA 5BOXA 1X4PA 3DQVC 3S1QJ 3FXLA 4F3QA 1ETYA 2CSOA 3DBHB 4J00A 4EGZA 4CZZA 4CYCB 3HGGA 3LFUA 3JSOA 4X6AJ 3H92A 2FNPA 4OMZA 4A3MJ 1X2NA 4YELA 1JE8A 3CD6I 3K7AJ 1U9OA 1NG7A 2E2HJ 1WI9A 2DQLA 2EZHA 2HVRA 1KA8A 4M6VA 4E6KG 2LD5A 3LNQA 4KIFA 5BS6A 1SVLA 1FTTA 2NAZA 5IYCJ 3I59B 3MAJA 3WTTC 5F27A 3OYDA 4EEFG 5F1JA 4HX7A 2X9DA 4C3HJ 2E71A 3HOSA 3GTOJ 4N4OB 2OCEA 2K9MA 1WPKA 1VQOI 5B66C 1X2MA 1YITI 1G3WA 2JUCA 2L4MA 2R92J 3PUFA 5HNHA 1T39A 3PNYA 3MN2A 4BE2A 3RSNA 2BZTA 3FXUA 1HXDA 3JRAA 5DS9A 2MW8A 4FT8A 3Q3SA 2DJNA 3L2CA 5KAFC 3IKTA 1U6GA 3PO3J 1W4MA 1USTA 4BQOA 2VJ4A 3LFKA 4DZPA 1X1CA 2HEOA 5HLTA 2A07F 2ID3A 4XKCA 1IV8A 2DJIA 2M4GA 1C0WA 3CMYA 3BR0A 3HB9A 5F64A 1M1EB 5IYBJ 2QSGX 5EGOA 1RKWA 4ENKA 1Y8RB 2JVHA 1OMIA 2JWTA 5JLXA 4HNVA 1W36D 2FOKA 1DUXC 3RKXA 2DDBA 1KYZA 4DQ2A 4PK4A 2K9SA 4RLFA 3S8PA 5HS9A 3L9FA 2XF6A 5BQTA 4EM2A 3COAC 5D6FA 5H6RA 4KNYA 1E0EA 3FHNA 4UVAA 1UG2A 4A0XA 1FX7A 2VASA 5HDKA 2VOOA 3HSEA 3S16J 1JT0A 4DOZA 1JGSA 1R36A 2DBBA 5CPRB 3CQZJ 1MMAA 2BY0A 4B8XA 1A36A 3TDUC 4DIQA 1F36A 2RC4A 1MKMA 2WBMA 1HF0A 1X1PA 2D5VA 2MA3A 2VE8A 2XB5A 5IP7J 3M8FA 5GAHJ 5J4VA 2DFEA 3LSKA 1ETVA 2P7VB 3DXJF 2CO5A 2DT7B 3GZNB 3SJMA 1JKPC 1QVTA 2VBYA 2WA0A 4AUXA 4HDVA 2RN7A 1JKQC 1R00A 1GVJA 1TT0A 1XDUA 1VI0A 3K0LA 2B7EA 3AAFA 2K3FA 1B4AA 1ETKA 4YG2F 2Y0SN 2R7XA 4N4NB 2MD5A 4IRGA 3KP5A 5H20A 2ETHA 3RDIA 4OAZA 4BAYA 2XV4S 4PGHA 3ZQGA 5GP9A 3EYIA 3ASOH 1FLIA 1MMNA 2F4MB 3SHFA 5JHUA 4RAFA 3RKYA 3DCFA 2IGKA 1HOMA 1HKTA 2MSYA 5LRRA 2R5ZA 5GAEJ 3TO6A 3J7AO 4CCNA 4MEYF 3ULQB 1QPMA 2R7VA 2WADA 1P92A 3LSMA 1FOKA 2QQ9A 3BCAA 1FOWA 3QYEA 2MD0A 2P7CB 4C2TA 1UHWA 3HG9A 5E1ZB 3S3NA 4XBFA 1QZZA 1GUUA 2H8WA 5B1AH 5FD6A 1BI0A 5FLXK 1YS7A 4OAYA 4B3AA 1LDDA 4I2OA 3T0YA 3J80K 4OIOF 4C9YA 1CF7B 4UVCA 1DQUA 1XS9A 3OS0A 1AKHB 1ZKGA 4N9IA 3ZN0A 1B59A 3EETA 3FBNB 1UJ8A 1VQKI 4HF2A 1UELB 4E7SA 2I10A 5B3SH 3IAS2 4G6QA 3SZGA 2RQPA 3PNVA 1PP7U 3GTKJ 5IT9K 5HS8A 2IXSA 2AO9A 3AG3H 4LIVA 3DTIA 3F21A 1S7AA 4M9XA 1HKSA 2LTPA 3E6MA 3MZYA 4XM3A 1OYWA 1Y1VJ 1HSTA 1OJLA 2O5RA 3DPTA 2L9VA 3LA2A 3QPHA 5E18F 5K7FA 3ABKH 3DKXA 2VKHA 1FMVA 5J4YA 2CFOA 1QNTA 3ZRGA 1F5TA 4QLCU 3QPSA 1A6QA 3CUQC 3L2UA 4IHTA 2MYSA 2IA1A 3MVPA 2KHMA 4PUSA 2JT1A 3MQ0A 3QYFA 5FKNA 1T0FC 2DCEA 3HOYJ 4M9ZA 2AS5F 3M8JA 2HDDA 1T98A 1IN7A 1S9HA 4PDKA 3KP7A 2CU7A 2H09A 1S5LC 2CFXA 1T8IA 3KIOA 2IGNA 1OR7A 1ZG1A 3ABUA 2LKPA 5IY5H 3T8TA 1TZLA 2DTZA 1W0UA 2OBPA 5GADJ 3GLXA 4B1RA 3JSPA 2GBYA 3GVAA 2L2OA 4HAMA 1S6LA 1TWCJ 4RM3A 1K4SA 4C2UA 3HHGA 2X48A 3TKYA 4HV5A 2VC1A 1B8IA 3BR6A 1B72A 1QBJA 2BVMA 4XIDA 4P55A 5ED4A 3RPUA 2DPDA 4L9NA 2COBA 3O8HA 1P4XA 3EDPA 4AVPA 2V1UA 2HNHA 2VC0A 3WGIA 4A3IJ 3R61A 5D6EA 4MTEA 3ZR8X 4PZJA 3LSTA 1K78A 1RIOH 4BEHA 2K7LA 1QHGA 4BACA 4UY8I 4RAYA 4G6DA 2K9LA 3CO7C 2QQBA 2QKMB 1DPUA 3GXOA 4LK0F 2LSOA 4P5OA 4BHBA 1LE8A 5BPIA 1I39A 5HDNA 1KU3A 3CMMA 2IW5A 1CQTA 2X51A 2R7WA 5GPAA 5IPAA 2P5VA 3H9QA 3KLNA 2XSDC 2QCOA 2A61A 3I9V2 4Y17A 1STZA 2O3FA 2O8XA 1ZN2A 3K9TA 3S3OA 3GTGJ 2LF8A 2V7FA 2FBIA 4LLLA 3ESWB 1S7EA 1RI7A 4P1WA 2DXIA 5DDGA 1D1AA 1EH6A 2R7ZJ 1W7PA 3G1OA 3HXLA 3U1KA 5LD2C
chains in the Genus database with same CATH topology
3GW2A 1D8KA 3VODA 1ZREA 1ODDA 5JVTA 2GA1A 1R5GA 4BNCA 3ZPLA 1REPC 3GF2A 5DCMA 2EJRA 2UWMA 2E7XA 4M72A 2PN6A 1U5TA 6PAXA 3J81Z 1IW7F 2NYXA 3GWZA 1SD5A 3C18A 2JTVA 1TQPA 3PFIA 3GFIA 3N97A 5E1WA 1KU2A 1KYWA 4P9UA 1IRGA 4L0ZB 1B6AA 2QQAA 2GA2A 3WTSC 3T1BA 2CWEA 3BZ6A 3CO6C 3O6BB 4L5JA 2COMA 4L9VA 3ZMSA 5D5UB 2A5YB 4M74A 1RNLA 2FEZA 1AOYA 4WWCA 5HLHA 3HOTA 2NNNA 2FMYA 1IN6A 4KICA 1FP2A 5D4SA 5HLIA 1HW5A 4EV0A 4JK1X 3ERED 1R5HA 1YW9A 3BOQA 3FX3A 2P6SA 4RB0A 4EJVA 2XHKA 3GZ5A 2ZMEA 2EFOA 1HW1A 3TO7A 2O0YA 1IN4A 2NRAC 2Y48A 1G6NA 4OIRF 1USSA 4RS8A 5E8IA 3JAMZ 2KIMA 3FXQA 1SFEA 2IA0A 1L3LA 1OYIA 3ZQ7A 4D0PA 3HUGA 3WTZA 2XKOA 1F9NA 1H9GA 2GZWA 3FF5A 1YQAA 3V8KA 2KIUA 2YR2A 1I1SA 3D0SA 3NEUA 4U88A 1FYMA 3I54A 2FBHA 2W84A 2MH9A 4UV8A 2DPUA 2UZKA 1T6SA 4UHTA 3IKVA 3N4MA 4HDUA 3QOPA 3IWFA 4ETSA 2L3DA 3F8MA 2BE5F 3GYHX 5CLSA 4BHCA 2HYGD 4ENNA 2F5FA 2G9WA 2XAQA 5AIPA 4WF2A 4G94A 2YU3A 2X0LA 5H6QA 5E1XA 3V7CA 4O3MA 3FM5A 1WWXA 4AIHA 4Y15A 2EV6A 2K86A 3ML6A 1U3EM 5AONA 4OU0A 4Q5SF 4N9HA 1B1BA 2EV0A 5DCMB 3I4PA 2L01A 2M30A 3FMSA 4AIKA 3I53A 2ESHA 4JBAA 2XGXA 2O61A 1U5TB 2F5EA 1T38A 2MLKA 2STWA 1Q1HA 3Q9SA 1PP8F 1CGPA 3IL2A 2E1CA 2JSCA 2R3SA 4L5IA 1BIAA 1BC7C 1J75A 2PG4A 1DP7P 5FFXA 4WXCA 1GXPA 4A0ZA 5L3DA 2VBZA 3CLOA 4OOIA 3R60A 3WODF 3HSFA 3I64A 1ON1A 4I7HA 1Y0UA 2KIFA 4HV6A 4Q47A 1W7PD 4L18B 4PCQA 2VE9A 4ZYHA 2ZNZA 2W85A 3L00A 4RGUA 4RGRA 4GXOA 4YIIA 1Z05A 1TW3A 4RGSA 3CUQA 4LG0A 4OIPF 2OQRA 1W5SA 2Z5UA 5F1RA 3CUOA 4U0YA 1T0FA 5ICFA 1BC8C 5ILUA 5DCFA 1FNNA 2ZMEB 2ZCWA 4G9YA 1S3JA 1BI2A 4LFUA 3IC7A 4OMYA 4I0AA 3ISPA 5F6FA 5ILSA 4I01A 4HW0A 3Q9VA 4GYGA 4HX8A 3ZMDA 1ONVA 1IAWA 1Z7UA 3DKWA 3F3XA 4EQQA 2J5OA 2BBYA 3V7RA 3FMQA 3C3WA 1P2FA 4M71A 4WXHA 4IXAA 5CVJA 3EQLF 4OINF 2DK8A 4HZFA 5J6XA 2CYYA 2OAZA 5DUIA 2Y0MA 1ZARA 3Q5FA 2QZ8A 1WRJA 3JTGA 3RKWA 1FBSA 1MJ9A 2RKHA 3F6OA 2OU2A 1SMTA 3RPQA 1LEBA 2H6BA 2BYVE 2DQRA 3CTAA 5J8FA 4KMUX 4G7OF 1BOAA 3WGGA 2RVCA 3H3UA 2FRHA 2WC2A 1PDNC 3E97A 4HLXA 2DK5A 2HQNA 4KT5C 3JW4A 4IF4A 1NHAA 2V1DA 4YFKF 5K5RA 1KQ0A 2JPCA 4P96A 2BEOA 3V8LA 2TDXA 2ELHA 2ZKZA 3NQOA 2KRFA 1SAXA 4YFXF 4MGRA 1MDMA 1J7KA 5CVUA 1JHFA 3FWEA 5D5XB 4R1HA 4HBLA 3KZYA 4LB5A 4WCGA 1MJAA 5L3EA 1J0RA 2K27A 3VB2A 4IVNA 3LA3A 2FXAA 3GZ6A 2QWWA 3LAPA 3T5XA 4NHJA 5FD5A 1F4KA 1E17A 1IUYA 5BPDA 1ZG3A 5CJ9A 4I0BA 4F7ZA 3F8BA 1O7FA 2KKOA 1UB9A 1Z6RA 3OV8A 2GXGA 2QBYB 3GO5A 3L7WA 2ESNA 2IP2A 2HOEA 2A69F 4UNOA 5LLQA 1JHHA 3J81K 4BHPA 2A3SA 4JQFA 4S04A 4ENJA 3SQNA 1P4WA 3WTVC 4N0BA 3MEXA 1Z9CA 4EJWA 2Y75A 1TLHB 2HGCA 4HLYA 2BV6A 4EM1A 4ESFA 3V4GA 1BIBA 2OD5A 3KP3A 4ZZLA 3D5LA 5L3FA 4MQVA 3IRRA 1XGOA 1ZG5A 1GHCA 2HKXA 4EVIA 3RYRA 1ZAOA 4IJAA 2QUFA 3HIFA 1PUEE 2K4JA 1ON2A 4KMFA 4A12A 4A5MA 1G3TA 1SFXA 4LJZF 1O3TA 4XSZF 3KP2A 2XASA 1G4DA 1YLFA 4H0EA 2M87A 3B73A 3M8EA 3IRQA 3DP7A 5J8CA 1SD6A 1WQ2A 2X4HA 5E17F 2FF4A 4LLGF 1EV7A 1P6RA 2G7HA 5ERIA 3E6CC 2EA2A 5L3GA 5AIQA 4NB5A 1XGSA 4CO8A 2P5LC 3FM3A 1R1VA 5LHIA 1SD7A 3P9IA 2QLZA 2Z9OA 3DV8A 4KN7X 2OZ6A 3FMRA 5FFZA 2W57A 2O6GE 4HF0A 4A6DA 1TW2A 1K7AA 1J59A 1D5VA 2FE3A 1ZGAA 1MDMB 4GO1A 3MWMA 2ACJA 1K79A 3K1NA 1HW2A 4KDPA 5ICCA 4KUMA 4FX0A 4LLNA 4U0VA 1G3SA 3J80Z 5D5VB 2EK5A 1LEAA 5HVQC 1TQIA 3MZHA 1O7LA 1IXCA 2FMLA 2GIVA 2H27A 4L9TA 3F6VA 2DFIA 2VBXA 1V3FA 2QYOA 3O2PE 2B0LA 5LHGA 3REOA 2MH2A 2EWNA 1J9IA 1ZLKA 4ZYGA 1FYKA 5LHHA 2UXXA 3QP6A 2C6YA 2E7WA 2K4BA 4GCVA 2R7FA 2E1NA 3E6BA 4Y13A 3V8JA 3K69A 2Q2EA 4I09A 4XLNF 3I71A 3HRUA 4A2UA 2CGPA 1LVAA 3K2ZA 1DDNA 5KK1A 1SD4A 3BJOA 2LNBA 5EEHA 4U7BA 4CYDA 3I58A 2V79A 3GFMA 1XB4A 4IHSA 5L3BA 2O03A 2EFQA 1XMAA 1SMYF 3KE2A 2IVMA 4IPAA 2HYFA 3W6JB 5LEKA 3E3VA 3KP6A 5D8KB 1VTNC 1LQ1A 4QWQA 3H3ZA 4FX4A 5JI6A 2XUBA 4ASNA 3MFKA 5DV5A 2HFHA 5EEGA 2Q0OA 1K78B 1I5ZA 2MBFA 1IN8A 4KFCA 1BM9A 2XROA 1YO5C 3E6DA 1BI1A 2H6CA 4EMSA 1Z6TA 2PFBA 1YG2A 1LDJA 4BXUA 3LA7A 3TQNA 2LDUA 1AWCA 4PGGA 3G3ZA 4K2EA 2IRFG 4CDGA 2P8TA 1J2XA 4CXFA 3S2WA 1UFMA 3CDHA 3IHUA 5DEQA 4S05A 3O3KA 3ZMUA 1IXSB 1W7PB 3QU3A 5HLGA 1IXRC 3F8CA 1TQMA 5HDGA 1XDSA 3DF8A 1TBXA 3SZPA 2PBIA 1KQ8A 1YFHA 3ZMVA 3BPVA 2OA4A 2ZBKA 1KGSA 2MLGA 3R0JA 4CICA 4L0YB 1B9NA 1DPRA 3ELKA 2KJBA 1P4AA 2W25A 3WTWC 2GQQA 2D1VA 2D2WA 2V1XA 2ZFWA 2YX4A 1YYVA 4ZYDA 4Q48A 1H9TA 1X3UA 4CHUA 4L9JA 3HYIA 4MQ9F 2HZTA 2YX7A 1KQ9A 4HYEA 2FNAA 1BJAA 3RIRA 1I1GA 1IN5A 3IWZA 2ISZA 1HSJA 5CVVA 4KA4A 2KJCA 1ZH5A 1RUOA 1U8RA 1ZGJA 1YW7A 4ESBA 4GYIA 4UV9A 5K1YA 1U5TC 4IRHA 2ZNYA 2D45A 3DEUA 5CYVA 3QAHA 2L4AA 2DT5A 2VN2A 2ZXJA 4DNCA 5A2QZ 3U1DA 1I27A 1CF7A 2R7DA 1V4RA 5E20A 3VFZA 2HTJA 3TOAA 2HTSA 3SFZA 4EJOA 4YFNF 2XAFA 1H0MA 1IZ1A 1FY7A 2IT0A 1HQCA 2W24A 3RI4A 3E5QA 4RB2C 2OZUA 5CVIA 5HS7A 4M9SA 2WV0A 5TJJA 1FYLA 4B09A 2EFWA 2M8EA 4M6YA 1GXQA 2LF7A 5LBQA 3E5UA 1XD7A 2QM3A 2DU9A 3PQJA 3R6SA 4G7ZF 1G3YA 2L54A 1MJBA 1MD0A 2QVOA 2YPRA 5FB2A 4O6JA 2P6TA 1ZRFA 4HA8A 2ZO4A 3KCCA 1FP1D 5BMZA 2NNYA 2CG4A 3ABTA 1ULYA 5LEJA 4EGYA 1XMKA 3WU1B 2XKPA 2FSWA 5ILVA 1ZYRF 5D8LB 3QPTA 3ZMTA 5HOOA 4LK1F 5FGMA 3I5UA 2M1BA 4XRFA 3P7NA 1QO0D 4EM0B 3VEPA 3EUHA 3GX4X 3MCZA 5JR3A 5KVRA 2JZYA 2NS0A 1YW8A 3DPLC 4BH9A 2M45A 3WG9A 1HKQA 2HS5A 4WXDA 2M5WA 4OIQF 4A0YA 4WK8F 3BPXA 1KU7A 2AXLA 3TGNA 1EH8A 1O3RA 2EFPA 3GFJA 4R8HA 3HRMA 4MNUA 3HTUA 2VXZA 3GEZA 3WE2A 3EYYA 3KFWX 2HWVA 3TO9A 2VOPA 5LGNA 4A6EA 3JTHA 2HQRA 4ENMA 4Z2YA 3C7JA 3L09A 2XAGA 1QGPA 3QU6A 5DUKA 2DO7A 3BWGA 1TNTA 1YIOA 3FHZA 3QRFF 2D1HA 1ZRDA 1E2XA 2HR3A 1FBUA 3CUQB 4LG0B 2XIGA 4LB6B 3ECHA 2FA5A 3ROUA 5LGTA 2YSRA 1KU9A 2XAHA 3B02A 3SZTA 4Q4ZF 3SXYA 5E8GA 3BDDA 1XSXA 5TRDA 3FZVA 4UVBA 3V7SA 2IA2A 1U2WA 4RGXA 1QQIA 3KETA 5JFRA 2A68F 1FC3A 3VOEA 2DTRA 4YIFA 1UHMA 1FSHA 3KLOA 2HDCA 1J5YA 2HKOA 4BQAA 4RAZA 3M7GA 3U9GA 4HOBA 2PJPA 3M9AA 1FPQA 1FSEA 4ZYEA 2PQ8A 4NQWA 4XLPF 2P4WA 1O3QA 2Q8KA 1ZHFA 1R1UA 4LD5A 3P9CA 4EJTA 2CW0F 2FU4A 2Z3YA 4MEXF 1XGNA 4KIBA 4LMYA 1I6XA 3K1PA 1JXSA 2VONA 4LGWA 5LGUA 3LWFA 1EH7A 1RZ4A 2ADUA 3BY6A 1QZYA 2JPBA 2P5KA 5DD4A 2EB7A 1O3SA 3JAMK 4ESJA 1LB2A 3F8NA 4ZZDA 2VODA 1IF1A 4GGGA 4BYYA 3R0AA 2A6EF 1B9MA 2GAUA 1SFUA 1YS6A 3BJAA 4KYWA 5DD8A 1ZRCA 2RDPA 3OOPA 5ICEA 3PQKA 3P9KA 4FHTA 4G8XA 2GXBA 3WGHA 3ZP5A 2EFNA 4WX9A 3RYPA 1LNWA 5LRSA 1LDKB 4AWXB 5FLXZ 1XGMA 2ZJ2A 2PI0A 4EJUA 2RNJA 2PMUA 1BBYA 2J5PA 3QP5A 1R7JA 3CJNA 5IT9Z 2XAJA 5K5OA 1XN7A 4AD9A 1W5TA 1IRFA 3ZN1A 1XSDA 3HTSB 3C1DA 1S29A 4U0WA 2Z99A 3K1MA 5DYMA 4RB1A 2Z33A 2STTA 4HQEA 1FWZA 3FXRA 4O5VA 5D4RA 2WTEA 2PEXA 1O57A 3E5XA 3HRTA 3T8RA 2F2EA 5FO5A 4KN4X 3RTRA 1OPCA 2JRTA 4M6XA 1UCRA 1BN5A 2EA4A 1D8JA 3F22A 2VBWA 1FT9A 2DLLA 3KZZA 3KEOA 4UUVA 2BGCA 2QENA 2DW4A 1R58A 4XSXF 2OQGA 5A2QK 2FQ3A 1MGTA 3LQRA 2GWRA 1YTYA 3BROA 2F5DA 2VT2A 3I59A 2UXNA 1F1ZA 4HX4A 3LQQA 2K02A 1RUNA 2MC3A 3I0TA 5ICGA 4G7HF 4HF1A 2ISYA 4MTDA 3LAJA 3BP8A 2G7UA 1XCVA 1R1TA 1FZPB 4A5NA 4M73A 3HSRA 1WSUA 1HBXG 4CGZA 2PMHA 2DAOA 1U78A 2V9VA 1R23A 4I02A 1ZLJA 1LJ9A 2IJLA 3ECOA 3HHHA 3F8FA 1OYYA 4IRIA 2IPQX 3KP4A 2PLYA 4P9FA 2FBKA 1TTYA 1L0OC 2L02A 5CVRA 3WU0A 5L3CA 2EV5A 2RV8A 4RB3C 2F5CA 3GFLA 1D3YA 3G73A 1XSVA 3BJ6A 2XVCA 3WTUC 1R22A 3HRSA 1WKMA 4E70A 3ZMZA 1Z1DA 2VT3A 3DFGA 1OKRA 3TDZC 3F72A 1T2KA 3RJPA 2DI3A 1BI3A 3F23A 4HQMA 5D5WB 1MZBA 4TV7A 1Z91A 4UXNA 4MHGA 2XRNA 4ZH4F 4KIGA 3R4KA 4U7DA 1TNSA 2V6CA 3U2RA 1A04A 1K6OA 4ON0A 3WE3A 2H94A 1S7OA 3KEQA 3W6KB 2WWYA 2QBYA 3M1EA 1FBQA 2RGVA 3TOBA 4R79A 4I98B 3GUDA 3WTXC 3WTYC 2A6HF 1XCBA 2CQKA 5IT3A 4AIJA 3NRVA 5K5QA 1S8NA 5BOXA 3DQVC 2CSOA 4EGZA 4CZZA 3JSOA 3H92A 2FNPA 4OMZA 1JE8A 1WI9A 2DQLA 1KA8A 4KIFA 5BS6A 2NAZA 3I59B 3MAJA 3WTTC 4HX7A 3HOSA 1G3WA 2L4MA 1T39A 3FXUA 1HXDA 4FT8A 3L2CA 3IKTA 1U6GA 1W4MA 1USTA 3LFKA 2HEOA 2A07F 1C0WA 5F64A 4ENKA 1DUXC 1OMIA 2FOKA 3RKXA 1KYZA 4DQ2A 5HS9A 3L9FA 5BQTA 4EM2A 3COAC 5D6FA 5H6RA 4KNYA 4UVAA 4A0XA 1FX7A 5HDKA 2VOOA 3HSEA 1JGSA 1R36A 2DBBA 4B8XA 3TDUC 2RC4A 1MKMA 2MA3A 2VE8A 3M8FA 2P7VB 3DXJF 2CO5A 2VBYA 4HDVA 2RN7A 1R00A 1GVJA 1XDUA 3K0LA 3AAFA 1B4AA 4YG2F 2MD5A 4IRGA 3KP5A 5H20A 2ETHA 3RDIA 4BAYA 2XV4S 4PGHA 3EYIA 1FLIA 3SHFA 5JHUA 3RKYA 1HKTA 5LRRA 3TO6A 3J7AO 4MEYF 3ULQB 1QPMA 1P92A 1FOKA 2QQ9A 2P7CB 1UHWA 5E1ZB 4XBFA 1QZZA 5FD6A 1BI0A 5FLXK 1YS7A 1LDDA 4I2OA 3T0YA 3J80K 4OIOF 1CF7B 4UVCA 4N9IA 3ZN0A 1B59A 3EETA 4HF2A 4G6QA 2RQPA 1PP7U 5IT9K 5HS8A 3F21A 1S7AA 4M9XA 1HKSA 3E6MA 3MZYA 1OYWA 1HSTA 3DPTA 3LA2A 3QPHA 5E18F 1QNTA 1F5TA 4QLCU 3CUQC 4IHTA 2IA1A 2JT1A 3MQ0A 4M9ZA 2AS5F 1T98A 1IN7A 4PDKA 3KP7A 2H09A 2CFXA 1OR7A 1ZG1A 3ABUA 2LKPA 3T8TA 2OBPA 3GLXA 3JSPA 3GVAA 4HAMA 1S6LA 3HHGA 3TKYA 4HV5A 2VC1A 1QBJA 4P55A 5ED4A 3RPUA 2DPDA 4L9NA 1P4XA 3EDPA 4AVPA 2V1UA 2VC0A 3WGIA 3R61A 5D6EA 4MTEA 4PZJA 3LSTA 1K78A 1RIOH 2K7LA 4RAYA 4G6DA 3CO7C 2QQBA 1DPUA 3GXOA 4LK0F 2LSOA 4BHBA 4P5OA 5BPIA 5HDNA 1KU3A 2IW5A 2P5VA 3KLNA 2A61A 4Y17A 1STZA 2O3FA 2O8XA 1ZN2A 3K9TA 2LF8A 2FBIA 4LLLA 1RI7A 5DDGA 1EH6A 1W7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GW2 A;  1D8K A;  3VOD A;  1ZRE A;  1ODD A;  5JVT A;  2GA1 A;  1R5G A;  4BNC A;  3ZPL A;  1REP C;  3GF2 A;  5DCM A;  2EJR A;  2UWM A;  2E7X A;  4M72 A;  2PN6 A;  1U5T A;  6PAX A;  3J81 Z;  1IW7 F;  2NYX A;  3GWZ A;  1SD5 A;  3C18 A;  2JTV A;  1TQP A;  3PFI A;  3GFI A;  3N97 A;  5E1W A;  1KU2 A;  1KYW A;  4P9U A;  1IRG A;  4L0Z B;  1B6A A;  2QQA A;  2GA2 A;  3WTS C;  3T1B A;  2CWE A;  3BZ6 A;  3CO6 C;  3O6B B;  4L5J A;  2COM A;  4L9V A;  3ZMS A;  5D5U B;  2A5Y B;  4M74 A;  1RNL A;  2FEZ A;  1AOY A;  4WWC A;  5HLH A;  3HOT A;  2NNN A;  2FMY A;  1IN6 A;  4KIC A;  1FP2 A;  5D4S A;  5HLI A;  1HW5 A;  4EV0 A;  4JK1 X;  3ERE D;  1R5H A;  1YW9 A;  3BOQ A;  3FX3 A;  2P6S A;  4RB0 A;  4EJV A;  2XHK A;  3GZ5 A;  2ZME A;  2EFO A;  1HW1 A;  3TO7 A;  2O0Y A;  1IN4 A;  2NRA C;  2Y48 A;  1G6N A;  4OIR F;  1USS A;  4RS8 A;  5E8I A;  3JAM Z;  2KIM A;  3FXQ A;  1SFE A;  2IA0 A;  1L3L A;  1OYI A;  3ZQ7 A;  4D0P A;  3HUG A;  3WTZ A;  2XKO A;  1F9N A;  1H9G A;  2GZW A;  3FF5 A;  1YQA A;  3V8K A;  2KIU A;  2YR2 A;  1I1S A;  3D0S A;  3NEU A;  4U88 A;  1FYM A;  3I54 A;  2FBH A;  2W84 A;  2MH9 A;  4UV8 A;  2DPU A;  2UZK A;  1T6S A;  4UHT A;  3IKV A;  3N4M A;  4HDU A;  3QOP A;  3IWF A;  4ETS A;  2L3D A;  3F8M A;  2BE5 F;  3GYH X;  5CLS A;  4BHC A;  2HYG D;  4ENN A;  2F5F A;  2G9W A;  2XAQ A;  5AIP A;  4WF2 A;  4G94 A;  2YU3 A;  2X0L A;  5H6Q A;  5E1X A;  3V7C A;  4O3M A;  3FM5 A;  1WWX A;  4AIH A;  4Y15 A;  2EV6 A;  2K86 A;  3ML6 A;  1U3E M;  5AON A;  4OU0 A;  4Q5S F;  4N9H A;  1B1B A;  2EV0 A;  5DCM B;  3I4P A;  2L01 A;  2M30 A;  3FMS A;  4AIK A;  3I53 A;  2ESH A;  4JBA A;  2XGX A;  2O61 A;  1U5T B;  2F5E A;  1T38 A;  2MLK A;  2STW A;  1Q1H A;  3Q9S A;  1PP8 F;  1CGP A;  3IL2 A;  2E1C A;  2JSC A;  2R3S A;  4L5I A;  1BIA A;  1BC7 C;  1J75 A;  2PG4 A;  1DP7 P;  5FFX A;  4WXC A;  1GXP A;  4A0Z A;  5L3D A;  2VBZ A;  3CLO A;  4OOI A;  3R60 A;  3WOD F;  3HSF A;  3I64 A;  1ON1 A;  4I7H A;  1Y0U A;  2KIF A;  4HV6 A;  4Q47 A;  1W7P D;  4L18 B;  4PCQ A;  2VE9 A;  4ZYH A;  2ZNZ A;  2W85 A;  3L00 A;  4RGU A;  4RGR A;  4GXO A;  4YII A;  1Z05 A;  1TW3 A;  4RGS A;  3CUQ A;  4LG0 A;  4OIP F;  2OQR A;  1W5S A;  2Z5U A;  5F1R A;  3CUO A;  4U0Y A;  1T0F A;  5ICF A;  1BC8 C;  5ILU A;  5DCF A;  1FNN A;  2ZME B;  2ZCW A;  4G9Y A;  1S3J A;  1BI2 A;  4LFU A;  3IC7 A;  4OMY A;  4I0A A;  3ISP A;  5F6F A;  5ILS A;  4I01 A;  4HW0 A;  3Q9V A;  4GYG A;  4HX8 A;  3ZMD A;  1ONV A;  1IAW A;  1Z7U A;  3DKW A;  3F3X A;  4EQQ A;  2J5O A;  2BBY A;  3V7R A;  3FMQ A;  3C3W A;  1P2F A;  4M71 A;  4WXH A;  4IXA A;  5CVJ A;  3EQL F;  4OIN F;  2DK8 A;  4HZF A;  5J6X A;  2CYY A;  2OAZ A;  5DUI A;  2Y0M A;  1ZAR A;  3Q5F A;  2QZ8 A;  1WRJ A;  3JTG A;  3RKW A;  1FBS A;  1MJ9 A;  2RKH A;  3F6O A;  2OU2 A;  1SMT A;  3RPQ A;  1LEB A;  2H6B A;  2BYV E;  2DQR A;  3CTA A;  5J8F A;  4KMU X;  4G7O F;  1BOA A;  3WGG A;  2RVC A;  3H3U A;  2FRH A;  2WC2 A;  1PDN C;  3E97 A;  4HLX A;  2DK5 A;  2HQN A;  4KT5 C;  3JW4 A;  4IF4 A;  1NHA A;  2V1D A;  4YFK F;  5K5R A;  1KQ0 A;  2JPC A;  4P96 A;  2BEO A;  3V8L A;  2TDX A;  2ELH A;  2ZKZ A;  3NQO A;  2KRF A;  1SAX A;  4YFX F;  4MGR A;  1MDM A;  1J7K A;  5CVU A;  1JHF A;  3FWE A;  5D5X B;  4R1H A;  4HBL A;  3KZY A;  4LB5 A;  4WCG A;  1MJA A;  5L3E A;  1J0R A;  2K27 A;  3VB2 A;  4IVN A;  3LA3 A;  2FXA A;  3GZ6 A;  2QWW A;  3LAP A;  3T5X A;  4NHJ A;  5FD5 A;  1F4K A;  1E17 A;  1IUY A;  5BPD A;  1ZG3 A;  5CJ9 A;  4I0B A;  4F7Z A;  3F8B A;  1O7F A;  2KKO A;  1UB9 A;  1Z6R A;  3OV8 A;  2GXG A;  2QBY B;  3GO5 A;  3L7W A;  2ESN A;  2IP2 A;  2HOE A;  2A69 F;  4UNO A;  5LLQ A;  1JHH A;  3J81 K;  4BHP A;  2A3S A;  4JQF A;  4S04 A;  4ENJ A;  3SQN A;  1P4W A;  3WTV C;  4N0B A;  3MEX A;  1Z9C A;  4EJW A;  2Y75 A;  1TLH B;  2HGC A;  4HLY A;  2BV6 A;  4EM1 A;  4ESF A;  3V4G A;  1BIB A;  2OD5 A;  3KP3 A;  4ZZL A;  3D5L A;  5L3F A;  4MQV A;  3IRR A;  1XGO A;  1ZG5 A;  1GHC A;  2HKX A;  4EVI A;  3RYR A;  1ZAO A;  4IJA A;  2QUF A;  3HIF A;  1PUE E;  2K4J A;  1ON2 A;  4KMF A;  4A12 A;  4A5M A;  1G3T A;  1SFX A;  4LJZ F;  1O3T A;  4XSZ F;  3KP2 A;  2XAS A;  1G4D A;  1YLF A;  4H0E A;  2M87 A;  3B73 A;  3M8E A;  3IRQ A;  3DP7 A;  5J8C A;  1SD6 A;  1WQ2 A;  2X4H A;  5E17 F;  2FF4 A;  4LLG F;  1EV7 A;  1P6R A;  2G7H A;  5ERI A;  3E6C C;  2EA2 A;  5L3G A;  5AIQ A;  4NB5 A;  1XGS A;  4CO8 A;  2P5L C;  3FM3 A;  1R1V A;  5LHI A;  1SD7 A;  3P9I A;  2QLZ A;  2Z9O A;  3DV8 A;  4KN7 X;  2OZ6 A;  3FMR A;  5FFZ A;  2W57 A;  2O6G E;  4HF0 A;  4A6D A;  1TW2 A;  1K7A A;  1J59 A;  1D5V A;  2FE3 A;  1ZGA A;  1MDM B;  4GO1 A;  3MWM A;  2ACJ A;  1K79 A;  3K1N A;  1HW2 A;  4KDP A;  5ICC A;  4KUM A;  4FX0 A;  4LLN A;  4U0V A;  1G3S A;  3J80 Z;  5D5V B;  2EK5 A;  1LEA A;  5HVQ C;  1TQI A;  3MZH A;  1O7L A;  1IXC A;  2FML A;  2GIV A;  2H27 A;  4L9T A;  3F6V A;  2DFI A;  2VBX A;  1V3F A;  2QYO A;  3O2P E;  2B0L A;  5LHG A;  3REO A;  2MH2 A;  2EWN A;  1J9I A;  1ZLK A;  4ZYG A;  1FYK A;  5LHH A;  2UXX A;  3QP6 A;  2C6Y A;  2E7W A;  2K4B A;  4GCV A;  2R7F A;  2E1N A;  3E6B A;  4Y13 A;  3V8J A;  3K69 A;  2Q2E A;  4I09 A;  4XLN F;  3I71 A;  3HRU A;  4A2U A;  2CGP A;  1LVA A;  3K2Z A;  1DDN A;  5KK1 A;  1SD4 A;  3BJO A;  2LNB A;  5EEH A;  4U7B A;  4CYD A;  3I58 A;  2V79 A;  3GFM A;  1XB4 A;  4IHS A;  5L3B A;  2O03 A;  2EFQ A;  1XMA A;  1SMY F;  3KE2 A;  2IVM A;  4IPA A;  2HYF A;  3W6J B;  5LEK A;  3E3V A;  3KP6 A;  5D8K B;  1VTN C;  1LQ1 A;  4QWQ A;  3H3Z A;  4FX4 A;  5JI6 A;  2XUB A;  4ASN A;  3MFK A;  5DV5 A;  2HFH A;  5EEG A;  2Q0O A;  1K78 B;  1I5Z A;  2MBF A;  1IN8 A;  4KFC A;  1BM9 A;  2XRO A;  1YO5 C;  3E6D A;  1BI1 A;  2H6C A;  4EMS A;  1Z6T A;  2PFB A;  1YG2 A;  1LDJ A;  4BXU A;  3LA7 A;  3TQN A;  2LDU A;  1AWC A;  4PGG A;  3G3Z A;  4K2E A;  2IRF G;  4CDG A;  2P8T A;  1J2X A;  4CXF A;  3S2W A;  1UFM A;  3CDH A;  3IHU A;  5DEQ A;  4S05 A;  3O3K A;  3ZMU A;  1IXS B;  1W7P B;  3QU3 A;  5HLG A;  1IXR C;  3F8C A;  1TQM A;  5HDG A;  1XDS A;  3DF8 A;  1TBX A;  3SZP A;  2PBI A;  1KQ8 A;  1YFH A;  3ZMV A;  3BPV A;  2OA4 A;  2ZBK A;  1KGS A;  2MLG A;  3R0J A;  4CIC A;  4L0Y B;  1B9N A;  1DPR A;  3ELK A;  2KJB A;  1P4A A;  2W25 A;  3WTW C;  2GQQ A;  2D1V A;  2D2W A;  2V1X A;  2ZFW A;  2YX4 A;  1YYV A;  4ZYD A;  4Q48 A;  1H9T A;  1X3U A;  4CHU A;  4L9J A;  3HYI A;  4MQ9 F;  2HZT A;  2YX7 A;  1KQ9 A;  4HYE A;  2FNA A;  1BJA A;  3RIR A;  1I1G A;  1IN5 A;  3IWZ A;  2ISZ A;  1HSJ A;  5CVV A;  4KA4 A;  2KJC A;  1ZH5 A;  1RUO A;  1U8R A;  1ZGJ A;  1YW7 A;  4ESB A;  4GYI A;  4UV9 A;  5K1Y A;  1U5T C;  4IRH A;  2ZNY A;  2D45 A;  3DEU A;  5CYV A;  3QAH A;  2L4A A;  2DT5 A;  2VN2 A;  2ZXJ A;  4DNC A;  5A2Q Z;  3U1D A;  1I27 A;  1CF7 A;  2R7D A;  1V4R A;  5E20 A;  3VFZ A;  2HTJ A;  3TOA A;  2HTS A;  3SFZ A;  4EJO A;  4YFN F;  2XAF A;  1H0M A;  1IZ1 A;  1FY7 A;  2IT0 A;  1HQC A;  2W24 A;  3RI4 A;  3E5Q A;  4RB2 C;  2OZU A;  5CVI A;  5HS7 A;  4M9S A;  2WV0 A;  5TJJ A;  1FYL A;  4B09 A;  2EFW A;  2M8E A;  4M6Y A;  1GXQ A;  2LF7 A;  5LBQ A;  3E5U A;  1XD7 A;  2QM3 A;  2DU9 A;  3PQJ A;  3R6S A;  4G7Z F;  1G3Y A;  2L54 A;  1MJB A;  1MD0 A;  2QVO A;  2YPR A;  5FB2 A;  4O6J A;  2P6T A;  1ZRF A;  4HA8 A;  2ZO4 A;  3KCC A;  1FP1 D;  5BMZ A;  2NNY A;  2CG4 A;  3ABT A;  1ULY A;  5LEJ A;  4EGY A;  1XMK A;  3WU1 B;  2XKP A;  2FSW A;  5ILV A;  1ZYR F;  5D8L B;  3QPT A;  3ZMT A;  5HOO A;  4LK1 F;  5FGM A;  3I5U A;  2M1B A;  4XRF A;  3P7N A;  1QO0 D;  4EM0 B;  3VEP A;  3EUH A;  3GX4 X;  3MCZ A;  5JR3 A;  5KVR A;  2JZY A;  2NS0 A;  1YW8 A;  3DPL C;  4BH9 A;  2M45 A;  3WG9 A;  1HKQ A;  2HS5 A;  4WXD A;  2M5W A;  4OIQ F;  4A0Y A;  4WK8 F;  3BPX A;  1KU7 A;  2AXL A;  3TGN A;  1EH8 A;  1O3R A;  2EFP A;  3GFJ A;  4R8H A;  3HRM A;  4MNU A;  3HTU A;  2VXZ A;  3GEZ A;  3WE2 A;  3EYY A;  3KFW X;  2HWV A;  3TO9 A;  2VOP A;  5LGN A;  4A6E A;  3JTH A;  2HQR A;  4ENM A;  4Z2Y A;  3C7J A;  3L09 A;  2XAG A;  1QGP A;  3QU6 A;  5DUK A;  2DO7 A;  3BWG A;  1TNT A;  1YIO A;  3FHZ A;  3QRF F;  2D1H A;  1ZRD A;  1E2X A;  2HR3 A;  1FBU A;  3CUQ B;  4LG0 B;  2XIG A;  4LB6 B;  3ECH A;  2FA5 A;  3ROU A;  5LGT A;  2YSR A;  1KU9 A;  2XAH A;  3B02 A;  3SZT A;  4Q4Z F;  3SXY A;  5E8G A;  3BDD A;  1XSX A;  5TRD A;  3FZV A;  4UVB A;  3V7S A;  2IA2 A;  1U2W A;  4RGX A;  1QQI A;  3KET A;  5JFR A;  2A68 F;  1FC3 A;  3VOE A;  2DTR A;  4YIF A;  1UHM A;  1FSH A;  3KLO A;  2HDC A;  1J5Y A;  2HKO A;  4BQA A;  4RAZ A;  3M7G A;  3U9G A;  4HOB A;  2PJP A;  3M9A A;  1FPQ A;  1FSE A;  4ZYE A;  2PQ8 A;  4NQW A;  4XLP F;  2P4W A;  1O3Q A;  2Q8K A;  1ZHF A;  1R1U A;  4LD5 A;  3P9C A;  4EJT A;  2CW0 F;  2FU4 A;  2Z3Y A;  4MEX F;  1XGN A;  4KIB A;  4LMY A;  1I6X A;  3K1P A;  1JXS A;  2VON A;  4LGW A;  5LGU A;  3LWF A;  1EH7 A;  1RZ4 A;  2ADU A;  3BY6 A;  1QZY A;  2JPB A;  2P5K A;  5DD4 A;  2EB7 A;  1O3S A;  3JAM K;  4ESJ A;  1LB2 A;  3F8N A;  4ZZD A;  2VOD A;  1IF1 A;  4GGG A;  4BYY A;  3R0A A;  2A6E F;  1B9M A;  2GAU A;  1SFU A;  1YS6 A;  3BJA A;  4KYW A;  5DD8 A;  1ZRC A;  2RDP A;  3OOP A;  5ICE A;  3PQK A;  3P9K A;  4FHT A;  4G8X A;  2GXB A;  3WGH A;  3ZP5 A;  2EFN A;  4WX9 A;  3RYP A;  1LNW A;  5LRS A;  1LDK B;  4AWX B;  5FLX Z;  1XGM A;  2ZJ2 A;  2PI0 A;  4EJU A;  2RNJ A;  2PMU A;  1BBY A;  2J5P A;  3QP5 A;  1R7J A;  3CJN A;  5IT9 Z;  2XAJ A;  5K5O A;  1XN7 A;  4AD9 A;  1W5T A;  1IRF A;  3ZN1 A;  1XSD A;  3HTS B;  3C1D A;  1S29 A;  4U0W A;  2Z99 A;  3K1M A;  5DYM A;  4RB1 A;  2Z33 A;  2STT A;  4HQE A;  1FWZ A;  3FXR A;  4O5V A;  5D4R A;  2WTE A;  2PEX A;  1O57 A;  3E5X A;  3HRT A;  3T8R A;  2F2E A;  5FO5 A;  4KN4 X;  3RTR A;  1OPC A;  2JRT A;  4M6X A;  1UCR A;  1BN5 A;  2EA4 A;  1D8J A;  3F22 A;  2VBW A;  1FT9 A;  2DLL A;  3KZZ A;  3KEO A;  4UUV A;  2BGC A;  2QEN A;  2DW4 A;  1R58 A;  4XSX F;  2OQG A;  5A2Q K;  2FQ3 A;  1MGT A;  3LQR A;  2GWR A;  1YTY A;  3BRO A;  2F5D A;  2VT2 A;  3I59 A;  2UXN A;  1F1Z A;  4HX4 A;  3LQQ A;  2K02 A;  1RUN A;  2MC3 A;  3I0T A;  5ICG A;  4G7H F;  4HF1 A;  2ISY A;  4MTD A;  3LAJ A;  3BP8 A;  2G7U A;  1XCV A;  1R1T A;  1FZP B;  4A5N A;  4M73 A;  3HSR A;  1WSU A;  1HBX G;  4CGZ A;  2PMH A;  2DAO A;  1U78 A;  2V9V A;  1R23 A;  4I02 A;  1ZLJ A;  1LJ9 A;  2IJL A;  3ECO A;  3HHH A;  3F8F A;  1OYY A;  4IRI A;  2IPQ X;  3KP4 A;  2PLY A;  4P9F A;  2FBK A;  1TTY A;  1L0O C;  2L02 A;  5CVR A;  3WU0 A;  5L3C A;  2EV5 A;  2RV8 A;  4RB3 C;  2F5C A;  3GFL A;  1D3Y A;  3G73 A;  1XSV A;  3BJ6 A;  2XVC A;  3WTU C;  1R22 A;  3HRS A;  1WKM A;  4E70 A;  3ZMZ A;  1Z1D A;  2VT3 A;  3DFG A;  1OKR A;  3TDZ C;  3F72 A;  1T2K A;  3RJP A;  2DI3 A;  1BI3 A;  3F23 A;  4HQM A;  5D5W B;  1MZB A;  4TV7 A;  1Z91 A;  4UXN A;  4MHG A;  2XRN A;  4ZH4 F;  4KIG A;  3R4K A;  4U7D A;  1TNS A;  2V6C A;  3U2R A;  1A04 A;  1K6O A;  4ON0 A;  3WE3 A;  2H94 A;  1S7O A;  3KEQ A;  3W6K B;  2WWY A;  2QBY A;  3M1E A;  1FBQ A;  2RGV A;  3TOB A;  4R79 A;  4I98 B;  3GUD A;  3WTX C;  3WTY C;  2A6H F;  1XCB A;  2CQK A;  5IT3 A;  4AIJ A;  3NRV A;  5K5Q A;  1S8N A;  5BOX A;  3DQV C;  2CSO A;  4EGZ A;  4CZZ A;  3JSO A;  3H92 A;  2FNP A;  4OMZ A;  1JE8 A;  1WI9 A;  2DQL A;  1KA8 A;  4KIF A;  5BS6 A;  2NAZ A;  3I59 B;  3MAJ A;  3WTT C;  4HX7 A;  3HOS A;  1G3W A;  2L4M A;  1T39 A;  3FXU A;  1HXD A;  4FT8 A;  3L2C A;  3IKT A;  1U6G A;  1W4M A;  1UST A;  3LFK A;  2HEO A;  2A07 F;  1C0W A;  5F64 A;  4ENK A;  1DUX C;  1OMI A;  2FOK A;  3RKX A;  1KYZ A;  4DQ2 A;  5HS9 A;  3L9F A;  5BQT A;  4EM2 A;  3COA C;  5D6F A;  5H6R A;  4KNY A;  4UVA A;  4A0X A;  1FX7 A;  5HDK A;  2VOO A;  3HSE A;  1JGS A;  1R36 A;  2DBB A;  4B8X A;  3TDU C;  2RC4 A;  1MKM A;  2MA3 A;  2VE8 A;  3M8F A;  2P7V B;  3DXJ F;  2CO5 A;  2VBY A;  4HDV A;  2RN7 A;  1R00 A;  1GVJ A;  1XDU A;  3K0L A;  3AAF A;  1B4A A;  4YG2 F;  2MD5 A;  4IRG A;  3KP5 A;  5H20 A;  2ETH A;  3RDI A;  4BAY A;  2XV4 S;  4PGH A;  3EYI A;  1FLI A;  3SHF A;  5JHU A;  3RKY A;  1HKT A;  5LRR A;  3TO6 A;  3J7A O;  4MEY F;  3ULQ B;  1QPM A;  1P92 A;  1FOK A;  2QQ9 A;  2P7C B;  1UHW A;  5E1Z B;  4XBF A;  1QZZ A;  5FD6 A;  1BI0 A;  5FLX K;  1YS7 A;  1LDD A;  4I2O A;  3T0Y A;  3J80 K;  4OIO F;  1CF7 B;  4UVC A;  4N9I A;  3ZN0 A;  1B59 A;  3EET A;  4HF2 A;  4G6Q A;  2RQP A;  1PP7 U;  5IT9 K;  5HS8 A;  3F21 A;  1S7A A;  4M9X A;  1HKS A;  3E6M A;  3MZY A;  1OYW A;  1HST A;  3DPT A;  3LA2 A;  3QPH A;  5E18 F;  1QNT A;  1F5T A;  4QLC U;  3CUQ C;  4IHT A;  2IA1 A;  2JT1 A;  3MQ0 A;  4M9Z A;  2AS5 F;  1T98 A;  1IN7 A;  4PDK A;  3KP7 A;  2H09 A;  2CFX A;  1OR7 A;  1ZG1 A;  3ABU A;  2LKP A;  3T8T A;  2OBP A;  3GLX A;  3JSP A;  3GVA A;  4HAM A;  1S6L A;  3HHG A;  3TKY A;  4HV5 A;  2VC1 A;  1QBJ A;  4P55 A;  5ED4 A;  3RPU A;  2DPD A;  4L9N A;  1P4X A;  3EDP A;  4AVP A;  2V1U A;  2VC0 A;  3WGI A;  3R61 A;  5D6E A;  4MTE A;  4PZJ A;  3LST A;  1K78 A;  1RIO H;  2K7L A;  4RAY A;  4G6D A;  3CO7 C;  2QQB A;  1DPU A;  3GXO A;  4LK0 F;  2LSO A;  4BHB A;  4P5O A;  5BPI A;  5HDN A;  1KU3 A;  2IW5 A;  2P5V A;  3KLN A;  2A61 A;  4Y17 A;  1STZ A;  2O3F A;  2O8X A;  1ZN2 A;  3K9T A;  2LF8 A;  2FBI A;  4LLL A;  1RI7 A;  5DDG A;  1EH6 A;  1W7P A; 
#chains in the Genus database with same CATH topology
 3GW2 A;  4HNT A;  1D8K A;  3VOD A;  3CLQ A;  2JUG A;  1ZRE A;  4M3B A;  1ODD A;  5JVT A;  2GA1 A;  1R5G A;  5JLW A;  4BNC A;  3ZPL A;  3FIW A;  1N78 A;  2JRM A;  2KT0 A;  2V9P A;  3M07 A;  1REP C;  1ZK8 A;  1BR1 A;  1BR2 A;  2EJR A;  3GF2 A;  5DCM A;  2E60 A;  2UWM A;  1Z77 A;  2E7X A;  1N77 A;  4M72 A;  1I6H J;  3OYL A;  3FXM A;  2PN6 A;  1U5T A;  4F52 A;  3NWS A;  1Z67 A;  2R5Z B;  6PAX A;  2CUF A;  4XKV A;  3J81 Z;  1IW7 F;  4BJT A;  2KIS A;  1T33 A;  3HOU J;  2NYX A;  3GWZ A;  1SD5 A;  2Z2S B;  3C18 A;  1SEU A;  1RET A;  1FJL A;  1HDD C;  1D1C A;  2JTV A;  4BJ5 C;  1QPI A;  1TQP A;  3PFI A;  1IV6 A;  3GFI A;  5KNL A;  1QU3 A;  1LUJ B;  3N97 A;  4X1E A;  4ITV A;  5E1W A;  1X1A A;  4RLQ A;  5DM7 F;  1X58 A;  3A02 A;  1KU2 A;  1KYW A;  3Q0W A;  4P9U A;  1IRG A;  2HPI A;  3FKI J;  2W48 A;  3DLL F;  4L0Z B;  1B6A A;  2QQA A;  4MLO A;  3L2R A;  2KPM A;  2DMQ A;  2GA2 A;  3HEF A;  1OCO H;  3WTS C;  1FEX A;  3T1B A;  2CWE A;  3BZ6 A;  1TWF J;  3CO6 C;  1H88 C;  3O6B B;  2OV7 A;  4L5J A;  4Y52 J;  3K2A A;  2COM A;  4L9V A;  3ZMS A;  4E4H A;  2OTL I;  3BLY A;  5D5U B;  2A5Y B;  4M74 A;  1RNL A;  2FEZ A;  2V6E A;  1AOY A;  1LFP A;  4WWC A;  3PIO F;  5HLH A;  4PSX A;  2NNN A;  3HOT A;  2FMY A;  1IN6 A;  3FXK A;  4KIC A;  1FP2 A;  3SFI A;  1NK2 P;  5D4S A;  5HLI A;  1HW5 A;  4EV0 A;  4JK1 X;  3ERE D;  1R5H A;  1YW9 A;  2BHY A;  3BOQ A;  3FX3 A;  2P6S A;  4RB0 A;  4IKF A;  3OYA A;  3PSF A;  4BUP A;  3FDY A;  1VQ9 I;  4EJV A;  2XHK A;  3GZ5 A;  2ZME A;  2EFO A;  1HW1 A;  2DA5 A;  4CSW A;  3H9G A;  2EIL H;  4XLF A;  5J47 A;  3TO7 A;  5FJ8 J;  4YRV A;  2O0Y A;  4IHX A;  1IN4 A;  2NRA C;  5JHF A;  2E1O A;  4F93 B;  2Y48 A;  1G6N A;  4OIR F;  1USS A;  2O7O A;  2K3P A;  2F6C A;  3AG4 H;  2CW8 A;  4IHV A;  4RS8 A;  2Y9Z A;  1JI8 A;  5E8I A;  2ECC A;  3JAM Z;  2DDA A;  2KIM A;  3FXQ A;  1SFE A;  1RKT A;  2IA0 A;  3HKZ A;  1L3L A;  1OYI A;  2DOD A;  3ZQ7 A;  3CCE I;  2JK3 A;  4D0P A;  3HUG A;  1B8I B;  3W3C A;  1MSF C;  3OS2 A;  2R7T A;  3WTZ A;  2XKO A;  1F9N A;  1H9G A;  2GZW A;  4A3E J;  3FF5 A;  1YQA A;  3F9K A;  5J1U A;  3MD2 A;  3V8K A;  2KIU A;  2YR2 A;  3IH3 A;  3D0S A;  5F04 A;  1I1S A;  3NEU A;  4E7K A;  4U88 A;  1PVE A;  3WG7 H;  1FYM A;  3OL3 A;  1YI2 I;  3I54 A;  2WY7 Q;  2HXI A;  4GRI A;  2FBH A;  1ETW A;  4BJ6 C;  2W84 A;  1E3H A;  4CZC A;  3OL4 A;  2MH9 A;  2JVG A;  4UV8 A;  3OYE A;  4Y7N J;  2DPU A;  3OYJ A;  2UZK A;  1T6S A;  5E3L A;  4UHT A;  2AHQ A;  3IKV A;  3N4M A;  4HDU A;  3QOP A;  3IWF A;  3OS1 A;  3TP0 A;  3K6G A;  3FBI B;  4ETS A;  2L3D A;  3F8M A;  3S3M A;  2X1E A;  2BE5 F;  2R4G A;  2M4K A;  3I3L A;  5CLS A;  2HYG D;  4ZC3 A;  3VSL A;  4BHC A;  3OYB A;  3GYH X;  2F5F A;  4ENN A;  2G9W A;  2XAQ A;  1YRN A;  1Q1V A;  2QSH X;  1D0Z A;  3PM1 A;  3JRI A;  2M7B A;  2LP0 A;  4IHY A;  3DTK A;  4WF2 A;  4G94 A;  5AIP A;  5DM6 F;  2YU3 A;  2X0L A;  3CP8 A;  5H6Q A;  5E1X A;  3V7C A;  3Q0U A;  4O3M A;  3FM5 A;  4FET A;  1WWX A;  5DTD A;  1ETQ A;  4D7N A;  4AIH A;  4Y15 A;  3CME I;  2WB1 A;  4DYR A;  2JQ7 A;  1W5C C;  2EV6 A;  2K86 A;  3ML6 A;  3LSI A;  1U3E M;  5AON A;  4OU0 A;  3BTI A;  4Q5S F;  4N9H A;  1B1B A;  2EV0 A;  5DCM B;  3IH2 A;  2LYC A;  3I4P A;  3A0B C;  2L01 A;  2M30 A;  2V9K A;  1BR4 A;  2W00 A;  3FMS A;  4AIK A;  3I53 A;  2ESH A;  4JBA A;  3SYT A;  2XGX A;  2O61 A;  1U5T B;  2F5E A;  1T38 A;  2MLK A;  2E1M B;  1NH3 A;  4IQ4 A;  3RZO J;  2STW A;  1Q1H A;  3Q9S A;  2RAE A;  1PP8 F;  2Y31 A;  3RPU D;  4Y3O A;  3MMY B;  5KAI C;  2EZK A;  3CC7 I;  1ZEL A;  2DA4 A;  1WGX A;  3K4B A;  2DMT A;  3JRB A;  2LOO A;  1CGP A;  3IL2 A;  2E1C A;  4XR6 A;  3K4L A;  3FIS A;  2JSC A;  1LVK A;  1Y6I A;  3MKL A;  2R3S A;  2CRG A;  2EPF A;  4L5I A;  1BIA A;  4DJA A;  1BC7 C;  1J75 A;  2PG4 A;  2W7N A;  2R5Y A;  4AYB N;  1DP7 P;  5FFX A;  4WXC A;  1GXP A;  2E2I J;  4A0Z A;  5L3D A;  2VBZ A;  3CLO A;  4QSH A;  2FOW A;  2BY3 A;  2PMZ N;  1WJA A;  4H4K C;  4JX6 A;  3R60 A;  4OOI A;  4JX5 A;  3WOD F;  3OIP A;  3HSF A;  1OCC H;  3TL4 X;  3QQA A;  3I64 A;  3KZI C;  5J1Y A;  1ON1 A;  4I7H A;  3OYI A;  1Y0U A;  2CV2 A;  4PFP A;  2DYR H;  2KIF A;  1TP4 A;  4HV6 A;  3BG6 A;  5K7Z A;  4Q47 A;  1W7P D;  4XRS A;  3OSG A;  3CCJ I;  1ITY A;  4L18 B;  4PCQ A;  2VE9 A;  1X19 A;  4ZYH A;  5KHD A;  2ZNZ A;  1HDP A;  2W85 A;  3L00 A;  4E7J A;  4RGU A;  4RGR A;  4GXO A;  4YII A;  2IS4 A;  1Z05 A;  1TW3 A;  2Y0S A;  4RGS A;  1WCM J;  3CUQ A;  2CQQ A;  4LG0 A;  4OIP F;  2OQR A;  1W5S A;  2VKV A;  2Z5U A;  4BBR J;  3CUO A;  3KX2 A;  4MFE A;  5F1R A;  4U0Y A;  1T0F A;  4B47 A;  5ICF A;  2WV1 A;  3BQY A;  4XLH A;  1UZC A;  5ILU A;  1BC8 C;  1ZR4 A;  5DCF A;  5IOY A;  1UG0 A;  1G59 A;  1FNN A;  1AHD P;  2ZME B;  1MBG A;  3I56 I;  2ZCW A;  1K61 A;  3HOX J;  2UV1 A;  2OC6 A;  4G9Y A;  4X0G A;  3CCS I;  4XL9 A;  1S3J A;  1BI2 A;  4LFU A;  3IC7 A;  4OMY A;  2CQ7 A;  3JRG A;  4A3K J;  4I0A A;  2LY2 A;  1XMX A;  3A1Y A;  1WJ5 A;  2EZI A;  1RES A;  3BT9 A;  3ISP A;  5F6F A;  3DKY A;  5ILS A;  4BS9 A;  3ONQ A;  2DFH A;  4I01 A;  4HW0 A;  3Q9V A;  3GME A;  4GYG A;  4HX8 A;  1P9Q C;  3ZMD A;  1ONV A;  4BE1 A;  1IAW A;  1Z7U A;  2VJI A;  3HUG B;  3DKW A;  1JUP A;  1MW7 A;  3F3X A;  4C3J J;  4EQQ A;  2J5O A;  2BBY A;  2I8D A;  3V7R A;  3FMQ A;  3PO2 J;  1GT0 C;  4Z6Y A;  1VQ5 I;  1IRZ A;  1WFX A;  3C3W A;  1P2F A;  3MKW B;  4M71 A;  3LSJ A;  4WXH A;  3M4O J;  2DOA A;  1WH7 A;  4IXA A;  1XG1 A;  4JYK A;  1X3Z B;  3BR3 A;  5CVJ A;  3EQL F;  2OJE D;  4OIN F;  3MKZ A;  3BTC A;  3JRF A;  1MMD A;  2DK8 A;  4HZF A;  4ZTJ A;  2VUM J;  5J6X A;  4II3 A;  2CYY A;  4A3C J;  2XB0 X;  2OAZ A;  5DUI A;  2Y0M A;  4FE4 A;  1ZAR A;  2WY8 Q;  3Q5F A;  2QZ8 A;  1WRJ A;  3JTG A;  1MSE C;  3RKW A;  1FBS A;  5K7H A;  1BL0 A;  1MJ9 A;  2P81 A;  2RKH A;  3DU6 A;  4XLC A;  2X1C A;  1V5F A;  3F6O A;  2OU2 A;  1SMT A;  2DYS H;  3RPQ A;  1LEB A;  1ACI A;  2H6B A;  3F0C A;  1OCT C;  1YRN B;  3CZ6 A;  2JMW A;  2BYV E;  5EEA A;  3CES A;  1PYV A;  1OIS A;  1Y56 A;  2DQR A;  3PIP F;  3CTA A;  5J8F A;  1MH3 A;  4KMU X;  4G7O F;  5FKO A;  1BOA A;  1SAN A;  5IYD J;  4E7I A;  3WGG A;  1NTC A;  1VND A;  2X6X A;  4Y4R A;  2RVC A;  1LKX A;  2CMP A;  2NXN B;  1QRY A;  1Z21 A;  2M0C A;  3H3U A;  4YIR X;  2L7K A;  2FRH A;  2WC2 A;  1K4T A;  2BVL A;  2R93 J;  3S1R J;  4PJJ A;  1PDN C;  2FD5 A;  2VPR A;  3E97 A;  4HLX A;  2DK5 A;  2HQN A;  4KT5 C;  1R6R A;  3JW4 A;  4IF4 A;  3HL2 A;  3CC2 I;  1NHA A;  1P7J A;  4B4C A;  2V1D A;  3G71 I;  2BY1 A;  2VKE A;  3BZC A;  3KYD B;  3VDX A;  4YFK F;  5K5R A;  3E0J B;  1KQ0 A;  2JPC A;  4P96 A;  2ZJR F;  2BEO A;  3V8L A;  2GXA A;  2Z16 A;  2VQL A;  4KT6 A;  2TDX A;  1U9N A;  2ELH A;  2ZKZ A;  3NQO A;  2KRF A;  1SAX A;  4YFX F;  4MGR A;  5TIS C;  3AG1 H;  1MDM A;  1J7K A;  1VQM I;  3CC4 I;  5CVU A;  1JHF A;  3FWE A;  4XOP A;  5D5X B;  2NVQ J;  4M3D A;  2XPV A;  4R1H A;  4HBL A;  3KZY A;  3RCO A;  4LB5 A;  2FX0 A;  5E79 C;  4WCG A;  1MJA A;  5L3E A;  1WI3 A;  2VB6 A;  1J0R A;  4A3L J;  2KZV A;  2K27 A;  3VB2 A;  4IVN A;  3LA3 A;  2FXA A;  3GZ6 A;  4BDZ A;  3W2A A;  1A6I A;  2QWW A;  4V19 K;  2CH0 A;  3LAP A;  3S1M J;  1V5E A;  4II2 A;  3T5X A;  4NHJ A;  5FD5 A;  1F4K A;  3TW7 A;  1ETX A;  1WH5 A;  3H36 A;  4KJZ A;  4JX4 A;  1E17 A;  1IUY A;  4BE0 A;  5BPD A;  1RC9 A;  1ZG3 A;  5CJ9 A;  3OIQ A;  2VQC A;  2TCT A;  4I0B A;  1RR7 A;  2EIJ H;  4F7Z A;  3F8B A;  1O7F A;  3OIO A;  2KKO A;  2ZSH B;  1UB9 A;  1Z6R A;  1IRX A;  3OV8 A;  3LMM A;  2ZFU A;  3ASN H;  3GTP J;  4QTR A;  2GXG A;  2QBY B;  3GO5 A;  3S2D J;  3L7W A;  2ESN A;  4UB6 C;  2IP2 A;  2HOE A;  2A69 F;  3B6C A;  4F92 B;  5EG0 B;  2X6W A;  2HVS A;  1GLN A;  4UNO A;  5LLQ A;  1JHH A;  3H1C A;  3I55 I;  3GTL J;  1ORK A;  2LKS A;  1FMW A;  3J81 K;  3L2Q A;  4BHP A;  2IAI A;  2A3S A;  1Z3Y A;  4JQF A;  4S04 A;  3K4K A;  4CCJ A;  4ENJ A;  3SQN A;  4G6T B;  4LG3 A;  2LRE A;  3ABL H;  2KRC A;  1P4W A;  3WTV C;  4QPO A;  2Y30 A;  4N0B A;  3A0H C;  2DA7 A;  3MEX A;  1Z9C A;  4EJW A;  2Y75 A;  1Z7L A;  3OYF A;  4AVZ A;  1TLH B;  2HGC A;  4HLY A;  5HNF A;  2BV6 A;  3SDB A;  2K9Q A;  4EM1 A;  4S0H B;  4ESF A;  3IUO A;  1H8A C;  1RR8 C;  1UAA A;  4GFB A;  2AQE A;  5F08 A;  3V4G A;  1BIB A;  2OD5 A;  3KP3 A;  4I99 C;  1JKO C;  3W6V A;  2FUG 2;  4ZZL A;  3D5L A;  5FRN A;  2E34 A;  5L3F A;  1V54 H;  4Y33 A;  4MQV A;  1TC3 C;  3IRR A;  1XGO A;  4XOT A;  1ZG5 A;  1GHC A;  4XKW A;  4RAG A;  2HKX A;  1U8B A;  4EVI A;  2ECB A;  4PJN A;  2K40 A;  2HOS A;  1EJ9 A;  3RYR A;  2VL8 A;  1ZAO A;  2HDW A;  1IO2 A;  2F5V A;  4IJA A;  3OYG A;  2QUF A;  2ME6 A;  3HIF A;  1PUE E;  1JTX A;  3S32 A;  2K4J A;  1ON2 A;  4KMF A;  4A12 A;  4A5M A;  1G3T A;  3MZ8 A;  1SFX A;  4IHW A;  2VKD A;  3DBR B;  4LJZ F;  5EDN A;  1O3T A;  3QYB A;  1D1B A;  3KP2 A;  4XSZ F;  3OYC A;  2E5N A;  2XAS A;  4B48 A;  4BQN A;  1G4D A;  2O9L A;  3LSG A;  3BTJ A;  1YLF A;  3PFY A;  2ZJP F;  4H0E A;  3ZQF A;  2M87 A;  3VWB A;  3B73 A;  3M8E A;  1AU7 A;  3IRQ A;  3OMY A;  5EGO B;  3DP7 A;  5J8C A;  1SD6 A;  5GAG J;  1IDZ A;  1WQ2 A;  1XTA A;  3BG9 A;  2X4H A;  3LSR A;  2DOE A;  3H5N A;  3PSI A;  5E17 F;  4IQJ A;  1X1B A;  2FF4 A;  4LLG F;  4BQQ A;  2ICW G;  1EV7 A;  2A6T A;  1P6R A;  4JOM A;  2G7H A;  5ERI A;  5FRO A;  3E6C C;  2EA2 A;  2X1D A;  5AIQ A;  4NB5 A;  5L3G A;  1XGS A;  4CO8 A;  2P5L C;  3FM3 A;  1R1V A;  1N75 A;  2V1N A;  5F0F A;  1FIA A;  1MBK A;  5LHI A;  4RDU A;  2VIX A;  1SD7 A;  3P9I A;  2QLZ A;  2Z9O A;  3DV8 A;  3SEZ A;  4PSW A;  2K9N A;  2LVS A;  2VQH A;  1V55 H;  3JRE A;  1ZGW A;  2MG4 A;  3BQZ A;  4KN7 X;  4J01 A;  2OZ6 A;  5LFA A;  4IEJ A;  3DBL B;  3FMR A;  1JJ6 C;  5FFZ A;  2W57 A;  3LSP A;  2O6G E;  2M8G X;  2CS3 A;  4HF0 A;  4A6D A;  2WAQ N;  1TW2 A;  3H0D A;  1K7A A;  3P5J A;  1J59 A;  1D5V A;  2HU9 A;  3GLL A;  3DLA A;  4ZDO A;  2FE3 A;  4XNF A;  3WHC A;  1ZGA A;  1MDM B;  4GO1 A;  2PJR A;  2HVQ A;  3MWM A;  2ACJ A;  4ZJZ A;  1K79 A;  1WZ2 A;  3K1N A;  3CP2 A;  1HW2 A;  1MNE A;  4KDP A;  3EUH C;  5ICC A;  3ZQQ A;  3DTE A;  3ERM A;  2IBD A;  4KUM A;  2EIK H;  2K5C A;  2KQR A;  1YHQ I;  5EF6 A;  2R0Q C;  4CCM A;  4FX0 A;  4LLN A;  2RRE A;  4U0V A;  5EJC A;  1G3S A;  2VLA A;  2VI6 A;  4XK4 A;  3J80 Z;  1PUF A;  3CCV I;  5D5V B;  4IZZ A;  2EK5 A;  4QIW N;  1LEA A;  5HVQ C;  2JA7 J;  1TQI A;  1UMQ A;  3MZH A;  1O7L A;  1WJC A;  4XN3 A;  1X3W B;  1YE9 A;  3PL8 A;  1IG7 A;  5IP9 J;  1IXC A;  4EAT A;  2FML A;  4FTH A;  2GIV A;  3ZQL A;  2H27 A;  4L9T A;  3F6V A;  2QKL B;  2VBX A;  2DFI A;  3AFH A;  1V3F A;  2QYO A;  3S93 A;  3O2P E;  3LOC A;  2B0L A;  5LHG A;  3K4J A;  4XIC A;  4BU2 A;  3REO A;  3BR5 A;  2MH2 A;  2EWN A;  3H9J A;  2F48 A;  1SVM A;  3CJQ B;  4HG2 A;  1J9I A;  1OCR H;  3C2G A;  1IUF A;  1ZLK A;  4ZYG A;  1FYK A;  4DBQ A;  5LHH A;  3ZXS A;  2UXX A;  3QP6 A;  2C6Y A;  2HYJ A;  1J09 A;  5E3N A;  2E7W A;  1HC8 A;  4LIT A;  2K4B A;  2LBF A;  3IP4 B;  1JGG A;  4GCV A;  2R7F A;  2E1N A;  3E6B A;  4BKX A;  3OYN A;  4Y13 A;  3KEY A;  3V8J A;  3K69 A;  2Q2E A;  4I09 A;  4XLN F;  3QOD A;  3I71 A;  2BOL A;  2XSJ C;  3HRU A;  1W1W E;  3CCY A;  2I5U A;  4A2U A;  2CGP A;  4A3J J;  3VYR B;  3DPU A;  4C3I J;  1LVA A;  1LPQ A;  3K2Z A;  1DDN A;  1VQ8 I;  5KK1 A;  2KDO A;  1RRJ A;  3W2W A;  1SD4 A;  1WVR A;  2WAE A;  2XF5 A;  3BJO A;  3QWL A;  4C30 A;  1DGW Y;  2LNB A;  5EEH A;  4U7B A;  3J7Z I;  2LKX A;  4CYD A;  3I58 A;  2W82 A;  2V79 A;  3H5R A;  1SC7 A;  4ABZ A;  3GFM A;  3BR1 A;  1XB4 A;  2VJ5 A;  3VYT B;  3TED A;  3QPL A;  2XAU A;  2DOF A;  1XX5 A;  3HM5 A;  4IHS A;  4CCK A;  4RMN A;  5L3B A;  2O03 A;  4I76 A;  5JVG F;  2EFQ A;  1XMA A;  2CJJ A;  1FOX A;  1SMY F;  4HSR A;  3KE2 A;  2IVM A;  4IPA A;  4E7L A;  2HYF A;  3W6J B;  5LEK A;  3E3V A;  5EZH A;  4CYC A;  2W1O A;  3KP6 A;  5D8K B;  1VTN C;  2JA5 J;  1LQ1 A;  2EBI A;  4QWQ A;  3H3Z A;  4FX4 A;  4PFO A;  5JI6 A;  2LR8 A;  1OCP A;  3CF2 A;  1B72 B;  2XUB A;  4PJM A;  2YUS A;  1MBE A;  4ASN A;  3CF5 F;  4CCL A;  2X6Y A;  3HJE A;  5GPC A;  3MFK A;  2ZXH A;  4NBQ A;  1YJ9 I;  2NVY J;  2EQR A;  5DV5 A;  2W4S A;  2OCC H;  2HFH A;  2XPU A;  5EEG A;  3E1S A;  2Q0O A;  1K78 B;  2IEK A;  1I5Z A;  2L7Z A;  3IAM 2;  4BEH B;  2MBF A;  1IN8 A;  4KFC A;  1BM9 A;  2XRO A;  1YO5 C;  3BG5 A;  3E6D A;  4IO9 F;  1UHS A;  1BI1 A;  2G0E A;  2H6C A;  4EMS A;  1Z6T A;  2PFB A;  1YG2 A;  2K85 A;  1LDJ A;  1LE8 B;  4BXU A;  3LA7 A;  4DYC A;  1H89 C;  4IL6 C;  2R7S A;  3TQN A;  2LDU A;  2X6O A;  2LH9 A;  1AWC A;  4PGG A;  2JA6 J;  4BY7 J;  3G3Z A;  2E36 A;  1R5I D;  4K2E A;  2IRF G;  4CDG A;  2P8T A;  5J40 A;  2CUE A;  1J2X A;  1ZTR A;  2V4J C;  1XC5 A;  2NS8 A;  4DYQ A;  5H2F C;  4CXF A;  2VJJ A;  3S2W A;  1ETO A;  1JJ8 C;  3ZQI A;  1UFM A;  3CDH A;  3IHU A;  5DEQ A;  4S05 A;  3O3K A;  3ZMU A;  3CJT B;  1IXS B;  3OYH A;  1W7P B;  3QU3 A;  5HLG A;  1IXR C;  4C2M J;  3ZQH A;  1HLV A;  2AXT C;  3IH4 A;  3F8C A;  3S2H J;  1TQM A;  2QQ8 A;  5HDG A;  1V5G A;  1XDS A;  2M9H A;  3DF8 A;  2LFB A;  2QF7 A;  1TBX A;  1SFO J;  3AG2 H;  2HPM A;  2R7Q A;  3SZP A;  3K70 C;  4A3G J;  2PBI A;  2LC2 A;  4NNJ A;  3CCR I;  1KQ8 A;  1YFH A;  3ZMV A;  3BPV A;  3FXJ A;  2OA4 A;  2ZBK A;  1DGR M;  1KGS A;  2MLG A;  3R0J A;  4CIC A;  4L0Y B;  2ELK A;  3UNG C;  3K10 A;  1B9N A;  1DPR A;  3LL7 A;  2DFF A;  3ELK A;  2KJB A;  1P4A A;  2W25 A;  3WTW C;  3VYS B;  3G6E I;  1MBJ A;  1IC8 A;  3I4N J;  2CW7 A;  2GQQ A;  4BL0 B;  2D1V A;  3DWL E;  2D2W A;  2V1X A;  2VQG A;  3RQI A;  3AL0 B;  2E5Z A;  2GOM A;  2ZFW A;  2YX4 A;  4A3F J;  1YYV A;  2VXD A;  4ZYD A;  3D1N I;  4Q48 A;  2OPT A;  1ERD A;  2ZXI A;  1H9T A;  1X3U A;  4B43 A;  4CHU A;  4L9J A;  3HYI A;  4MQ9 F;  2HZT A;  2B63 J;  2YX7 A;  4BXF A;  3A01 A;  1KQ9 A;  4HYE A;  3W2V A;  4XRS G;  3S15 J;  2FNA A;  4A3B J;  1BJA A;  2XPW A;  2H1L A;  2HI3 A;  3RIR A;  1I1G A;  1WJB A;  1IN5 A;  3IWZ A;  3HPH A;  1YX3 A;  2ISZ A;  1HSJ A;  5CVV A;  4KA4 A;  1W0T A;  2KJC A;  1ZH5 A;  1RUO A;  1U8R A;  1ZGJ A;  4XKB A;  1YW7 A;  4ESB A;  3QOE A;  4GYI A;  4UV9 A;  2L9N A;  4XRM A;  5K1Y A;  1HA8 A;  1U5T C;  4IOA F;  1SVO A;  2ZNY A;  4IRH A;  2D45 A;  3G1M A;  2E1M C;  2RQQ A;  2V26 A;  2KP6 A;  3DEU A;  5CYV A;  3QAH A;  2DT6 A;  2L9S A;  3FK7 A;  3L2V A;  3HOW J;  2NVX J;  2OF7 A;  3WU2 C;  4W97 A;  1SAU A;  2L4A A;  2DT5 A;  2VN2 A;  1JTY A;  2M34 A;  3OYM A;  2DA6 A;  2ZXJ A;  4DNC A;  1T95 A;  2WAF A;  3HKZ N;  5A2Q Z;  4G12 A;  3U1D A;  3BG3 A;  1I27 A;  4XLA A;  5EYR A;  3NAU A;  3M3Y J;  1CF7 A;  3HC7 A;  3CJR B;  4MO7 A;  1WJD A;  1KON A;  4PJ0 C;  1MBH A;  2FJ1 A;  2R7D A;  1AKH A;  1ZQ3 P;  1V4R A;  5M5W J;  2MAB A;  5E20 A;  3VFZ A;  2HQA A;  2HTJ A;  1Y8Q B;  4L5E A;  2KFD A;  3TOA A;  2EIN H;  2HTS A;  4XLE A;  3SFZ A;  4EJO A;  4DBR A;  4YFN F;  2GIZ A;  3D5S C;  2YS9 A;  2ELJ A;  2XAF A;  1VQ7 I;  2JA8 J;  1H0M A;  2ZSI B;  3H35 A;  3VYU B;  2IGO A;  2IGM A;  4NC6 A;  1IZ1 A;  1FY7 A;  2IT0 A;  1HQC A;  2W24 A;  2ZC2 A;  3DEW A;  2QSF X;  3RI4 A;  3E5Q A;  5CKT A;  4RB2 C;  2OZU A;  5CVI A;  5HS7 A;  3K4M A;  3TP3 A;  4M9S A;  2WV0 A;  2LK2 A;  3K4N A;  5TJJ A;  2R7O A;  1FYL A;  4B09 A;  2EFW A;  2M8E A;  4M6Y A;  4XMY A;  4AC0 A;  1GXQ A;  2LF7 A;  2E2J J;  5LBQ A;  5CQE A;  3E5U A;  1XD7 A;  1W36 C;  2L5Q A;  1OFC X;  5E3O A;  3PUB A;  2QM3 A;  3CDL A;  2DU9 A;  3PQJ A;  2HOT A;  2WB1 N;  3R6S A;  4G7Z F;  3HDD A;  3J7Y J;  1G3Y A;  2L54 A;  1MJB A;  1BJZ A;  1MD0 A;  2NS7 A;  4MFD A;  2QVO A;  2YPR A;  2ZME C;  5FB2 A;  2DN0 A;  4BXX J;  4O6J A;  3H5A A;  2P6T A;  4BGD A;  1FOY A;  2Y69 H;  1ZRF A;  1JT6 A;  4HA8 A;  2ZO4 A;  3KCC A;  1FP1 D;  5BMZ A;  2XC7 A;  2NNY A;  4CCO A;  2CG4 A;  3ABT A;  4UB8 C;  4M3F A;  1ULY A;  1E3O C;  5LEJ A;  1HCR A;  1K6Y A;  4EGY A;  2ZB9 A;  1XMK A;  2ZXW H;  1VQL I;  3S14 J;  3WU1 B;  2XKP A;  3DEE A;  3E7L A;  2GM4 A;  2FSW A;  5ILV A;  1ZYR F;  2Z1D A;  5D8L B;  3BC8 A;  3QPT A;  3ZMT A;  3OSF A;  1JKR C;  5HOO A;  1X4O A;  2H1K A;  4LK1 F;  1BW6 A;  1VQP I;  1R4N B;  1YX5 A;  5FGM A;  3I5U A;  2M1B A;  4XRF A;  2KRH A;  3P7N A;  5FKK A;  1QO0 D;  2CV1 A;  4EM0 B;  4DW6 A;  3VEP A;  3EUH A;  1QZE A;  1XPX A;  3GX4 X;  2OUM A;  3MCZ A;  4FIS A;  5JR3 A;  3J7A Y;  5KVR A;  1E3P A;  2JZY A;  2L0K A;  2NS0 A;  3B6A A;  1YW8 A;  1YIJ I;  1S72 I;  3TW6 A;  3M1C A;  1BW5 A;  4YEJ A;  1Y0N A;  3DPL C;  4BH9 A;  1GDT A;  2M45 A;  3WG9 A;  4DGW B;  4UUS A;  1HKQ A;  2HS5 A;  1NK3 P;  2LMD A;  4WXD A;  2NVT J;  2M5W A;  2LRD A;  1K83 J;  3HPG A;  1Z3X A;  4OIQ F;  4A0Y A;  3L2W A;  4WK8 F;  2R5Y B;  3GTM J;  3BPX A;  1KU7 A;  2AXL A;  3GTJ J;  3NAR A;  3TGN A;  4AM3 A;  1EH8 A;  3C2H A;  1O3R A;  2EFP A;  3A01 B;  2KMU A;  3GFJ A;  4U87 A;  4R8H A;  2MC4 A;  3HRM A;  4CA0 A;  4MNU A;  1X1D A;  3HTU A;  1JUM A;  2L9R A;  2VXZ A;  3GEZ A;  3WE2 A;  3EYY A;  1GVD A;  1EF4 A;  3KFW X;  2HWV A;  3TO9 A;  5FLV A;  2VOP A;  5LGN A;  3FKJ A;  4HPQ A;  4A6E A;  2IS1 A;  1VQ4 I;  5M5Y J;  2BW3 A;  2Y9Y A;  3JTH A;  5J3L A;  5HOD A;  2HQR A;  4ENM A;  2DA1 A;  4Z2Y A;  3NWT A;  3C7J A;  2F4I A;  3L09 A;  2XAG A;  1QGP A;  3QU6 A;  2NOG A;  5GTH C;  5DUK A;  2DO7 A;  3BWG A;  3TMO A;  1TNT A;  1YIO A;  3FHZ A;  3HZJ A;  3G2B A;  1PJR A;  2ZJQ F;  3QRF F;  2D1H A;  4BBS J;  1ZRD A;  1E2X A;  2HR3 A;  1FBU A;  2WAQ A;  3CUQ B;  4LG0 B;  2XIG A;  3UR3 C;  5GTI C;  4LB6 B;  3ECH A;  3N05 A;  2FA5 A;  3H3V K;  3ROU A;  5LGT A;  2GOX B;  2YSR A;  1KU9 A;  2XAH A;  3B02 A;  1OCZ H;  3SZT A;  3ZQC A;  1DU6 A;  2QGU A;  2P0W A;  3ABM H;  3SXY A;  4Q4Z F;  1ZR2 A;  2NVU B;  5BNG A;  5E8G A;  3CCQ I;  4IX7 A;  3BDD A;  1WJE A;  1MBF A;  3D5R C;  1MH4 A;  1XSX A;  1YJW I;  5TRD A;  3FZV A;  4UVB A;  3HOZ J;  3V7S A;  2IA2 A;  4M3G A;  1G8X A;  1U2W A;  3BZK A;  1MND A;  3TBI A;  4RGX A;  2JJ7 A;  1QQI A;  1T56 A;  1TT5 B;  1VZ0 A;  3KET A;  2PX9 A;  5JFR A;  1SFK A;  2A68 F;  1FC3 A;  1DP3 A;  1WHU A;  3EUA A;  3JR9 A;  2KZG A;  2DTR A;  3VOE A;  4YIF A;  1UHM A;  4UUT A;  3IV5 A;  1FSH A;  3KLO A;  4NUB A;  4RBO A;  2HDC A;  3Q0V A;  4ZDP A;  2XRL A;  2JA2 A;  1J5Y A;  2HKO A;  4HNU A;  4BQA A;  2IS6 A;  4RAZ A;  1VQN I;  2BXZ A;  3M7G A;  4FE7 A;  3U9G A;  4HOB A;  1GV5 A;  4KIT B;  4RM2 A;  4XN0 A;  2PJP A;  2LG4 A;  3BCB A;  1AA7 A;  4J19 A;  2YU9 J;  3M9A A;  1FPQ A;  1FSE A;  4ZYE A;  1FIP A;  2PQ8 A;  4NQW A;  2LY1 A;  4XLP F;  2P4W A;  1O3Q A;  2Q8K A;  3C2B A;  1ZHF A;  1R1U A;  4LD5 A;  5B5E C;  3G4S I;  3P9C A;  4EJT A;  2UUZ A;  2CW0 F;  3ZGK A;  1R49 A;  2DMP A;  2FU4 A;  2Z3Y A;  3BTL A;  1R9T J;  4MEX F;  1XGN A;  4NDL A;  3OOU A;  2OTJ I;  4KIB A;  4LMY A;  1I6X A;  3K1P A;  4AID A;  3BG7 A;  1JXS A;  2VON A;  2JN6 A;  4LGW A;  5LGU A;  3LWF A;  1EH7 A;  3A4C A;  1RZ4 A;  2ADU A;  1BOB A;  2MFZ A;  3CCL I;  5EZG A;  3BY6 A;  4KIS A;  1QZY A;  2JSP A;  1WJF A;  3X2Q H;  4HST A;  3DU5 A;  2JPB A;  2P5K A;  2AQF A;  2BXY A;  5DD4 A;  2EB7 A;  1O3S A;  3JAM K;  4ESJ A;  1LB2 A;  1IJW C;  4W1U A;  3F8N A;  4M3E A;  1GV2 A;  4ZZD A;  2VOD A;  3A2K A;  1IF1 A;  4GGG A;  4D7M A;  1A31 A;  4BYY A;  3R0A A;  4FCY A;  2A6E F;  1B9M A;  3OR1 C;  1I3Q J;  1MNM C;  2GAU A;  1SFU A;  3CCM I;  2L7F P;  4AU7 A;  1YS6 A;  3BJA A;  1EKE A;  3HBL A;  4KYW A;  5DD8 A;  3U21 A;  1ZRC A;  2RDP A;  4UUS B;  3OOP A;  5ICE A;  3PQK A;  3P9K A;  4FHT A;  3I4M J;  1MMG A;  4G8X A;  1R4M B;  2GXB A;  3WGH A;  3A03 A;  2NOJ B;  1D5Y A;  3ZP5 A;  2EFN A;  2ID6 A;  4WX9 A;  3RYP A;  1TWG J;  2RNG A;  1LNW A;  4F55 A;  5LRS A;  1P7I A;  1MIJ A;  5M3M J;  1LDK B;  4D5C A;  2LLK A;  3KYC B;  4PJL A;  4AWX B;  5FLX Z;  2H8R A;  1XGM A;  2ZJ2 A;  3SDG A;  2PI0 A;  1VQ6 I;  3JRC A;  3OWT A;  4EJU A;  2RNJ A;  3UKG A;  2PMU A;  3V42 A;  3S1N J;  1BBY A;  2BW3 B;  2J5P A;  3QP5 A;  4A69 C;  1R7J A;  3EUK L;  9ANT A;  3WHB A;  4E7Z A;  3CJN A;  3LSH A;  3VSK A;  2CQN A;  4FAS D;  4NC7 A;  3CMA I;  2A5W A;  5IT9 Z;  3HGY A;  2HXO A;  2XAJ A;  5K5O A;  1XN7 A;  4AD9 A;  1W5T A;  1A35 A;  1VF9 A;  1BA5 A;  1LFU P;  5B1B H;  3GCM A;  3ZCO A;  1IRF A;  3OR2 C;  3ZN1 A;  1XSD A;  3HTS B;  3C1D A;  1QVU A;  4D9J A;  1S29 A;  4U0W A;  2Z99 A;  2M2E A;  4ANJ A;  3K1M A;  2Y2Z A;  2M3A A;  5J1R A;  5DYM A;  2HQ5 A;  4RB1 A;  1IDY A;  2M7A A;  2Z33 A;  5KCM A;  1POG A;  2STT A;  4HQE A;  1FWZ A;  2KLO A;  5M3F J;  3FXR A;  4O5V A;  4V2G A;  2QEX I;  3FXO A;  5D4R A;  2WTE A;  3H0G J;  1I3A A;  4NC8 A;  2PEX A;  1O57 A;  3E5X A;  2KIQ A;  3HRT A;  4LIU A;  2XF7 A;  3T8R A;  2F2E A;  5FO5 A;  4KN4 X;  2IS2 A;  3RTR A;  1OPC A;  2JRT A;  4XOR A;  2EIM H;  4M6X A;  1UCR A;  1OQY A;  4AYB A;  1BN5 A;  3G1L A;  2EA4 A;  3K4C A;  3GBG A;  1Y1W J;  2DMU A;  1YOV B;  1D8J A;  2E19 A;  2PMZ A;  3F22 A;  2MGQ A;  2VBW A;  2M0M A;  1FT9 A;  4I6Z A;  1KZH A;  2DLL A;  3FK6 A;  3KZZ A;  3BR2 A;  5C4X J;  3KEO A;  5C4J J;  1R71 A;  2DMN A;  2B9S A;  3MKY B;  3SEQ A;  2F4O B;  4UUV A;  1O4X A;  4NQW B;  2BGC A;  2QEN A;  4DZJ A;  4F91 B;  1F43 A;  2E35 A;  3CCU I;  2DW4 A;  1R58 A;  4XSX F;  3L1P A;  2KL4 A;  2OQG A;  2A05 A;  5A2Q K;  4A3D J;  2FQ3 A;  4IOC F;  1MGT A;  3LQR A;  3OY9 A;  1T08 B;  4QPQ A;  2GWR A;  1YTY A;  3BRO A;  4V2F A;  3JRH A;  2R7R A;  2F5D A;  1RPW A;  2VT2 A;  3RQ4 A;  3O8G A;  3I59 A;  2UXN A;  4OWR B;  2VPL A;  2DA2 A;  5F0H A;  1F1Z A;  4HX4 A;  2Q1Z B;  2HOA A;  3RZD J;  3LQQ A;  1Y39 A;  2K02 A;  2XGD A;  1RUN A;  2N8G A;  2MC3 A;  3I0T A;  5F0C A;  4CUG A;  5ICG A;  4G7H F;  4HF1 A;  2ISY A;  2CV0 A;  4MTD A;  3LAJ A;  4HEA 2;  3BP8 A;  2G7U A;  1VFC A;  2TRT A;  1XCV A;  1OR7 C;  1G2H A;  1R1T A;  1FZP B;  1TWH J;  4A5N A;  4M73 A;  1TWA J;  2EH3 A;  3HSR A;  1WSU A;  1JUS A;  1TL8 A;  2XGC A;  5IP6 A;  1HBX G;  1QHH D;  4CGZ A;  2PMH A;  2DAO A;  1LFB A;  1U78 A;  2V9V A;  1R23 A;  4E7H A;  4I02 A;  1YJN I;  2GLO A;  4ZTF A;  4ZDL A;  1ZLJ A;  1FTZ A;  1LJ9 A;  2IJL A;  3ECO A;  3HHH A;  3CDI A;  3F8F A;  4A93 J;  2EZL A;  1OYY A;  4IRI A;  2IPQ X;  3KP4 A;  2PLY A;  4P9F A;  2FBK A;  1TTY A;  3RKQ A;  4FQG A;  1APL C;  2PJR B;  3S17 J;  1L0O C;  2L02 A;  5CVR A;  4HRI A;  3WU0 A;  2ME0 A;  1MMS A;  3AKZ A;  5L3C A;  3EPZ A;  2LY9 A;  2EV5 A;  2RV8 A;  5E3M A;  5FLM J;  2QA4 I;  1U0J A;  5C3E J;  4RB3 C;  2F5C A;  5IOZ A;  3GFL A;  1D3Y A;  1ENH A;  3G73 A;  1XSV A;  5CQG A;  3BJ6 A;  4BDY A;  1PUF B;  2XVC A;  2KDZ A;  3WTU C;  4XON A;  1R22 A;  3HRS A;  4MIM A;  1WKM A;  4LOC A;  4E70 A;  3ZMZ A;  3VPR A;  1Z0X A;  1Z1D A;  2VT3 A;  3DFG A;  1OKR A;  3TDZ C;  2BHZ A;  3F72 A;  1T2K A;  3RJP A;  3KYL A;  3GTQ J;  4RA2 A;  2DI3 A;  3JRD A;  1BI3 A;  1N25 A;  4BY1 J;  4D1Q A;  3F23 A;  4HQM A;  3K70 D;  5D5W B;  1MZB A;  5FKM A;  4TV7 A;  1I50 J;  5FRM A;  5C44 J;  2R7U A;  1A5J A;  1NG6 A;  1Z91 A;  5TGT A;  2CUJ A;  4UXN A;  4MHG A;  2XRN A;  4XQF A;  3KPH A;  3PJR A;  2LBF B;  4ZH4 F;  2DA3 A;  4KIG A;  2XDV A;  3R4K A;  5M5X J;  4U7D A;  1TNS A;  4B3X A;  2Q2E B;  2V6C A;  2HZD A;  3U2R A;  1D0Y A;  1A04 A;  1K6O A;  2L7M P;  1EA3 A;  4ON0 A;  3WE3 A;  2H94 A;  3ZOB A;  2O8K A;  3AL0 C;  2CQX A;  1S7O A;  3KEQ A;  2X85 A;  5FKL A;  2FQ4 A;  1QA6 A;  3W6K B;  2WWY A;  3PNT A;  2QBY A;  3M1E A;  1FBQ A;  2RGV A;  3TOB A;  4D5F A;  4R79 A;  3HOV J;  4I98 B;  1IGN A;  5EG0 A;  4JP0 A;  1OLT A;  3GUD A;  3WTX C;  2XGE A;  3WTY C;  1DU0 A;  1D0X A;  2CUZ A;  4CH7 A;  4B44 A;  2A6H F;  3OYK A;  1XCB A;  2BY2 A;  4GDF A;  2CQK A;  3JCU C;  5IT3 A;  3NRV A;  4AIJ A;  4ZYA A;  1S8N A;  5K5Q A;  5BOX A;  1X4P A;  3DQV C;  3S1Q J;  3FXL A;  4F3Q A;  1ETY A;  2CSO A;  3DBH B;  4J00 A;  4EGZ A;  4CZZ A;  4CYC B;  3HGG A;  3LFU A;  3JSO A;  4X6A J;  3H92 A;  2FNP A;  4OMZ A;  4A3M J;  1X2N A;  4YEL A;  1JE8 A;  3CD6 I;  3K7A J;  1U9O A;  1NG7 A;  2E2H J;  1WI9 A;  2DQL A;  2EZH A;  2HVR A;  1KA8 A;  4M6V A;  4E6K G;  2LD5 A;  3LNQ A;  4KIF A;  5BS6 A;  1SVL A;  1FTT A;  2NAZ A;  5IYC J;  3I59 B;  3MAJ A;  3WTT C;  5F27 A;  3OYD A;  4EEF G;  5F1J A;  4HX7 A;  2X9D A;  4C3H J;  2E71 A;  3HOS A;  3GTO J;  4N4O B;  2OCE A;  2K9M A;  1WPK A;  1VQO I;  5B66 C;  1X2M A;  1YIT I;  1G3W A;  2JUC A;  2L4M A;  2R92 J;  3PUF A;  5HNH A;  1T39 A;  3PNY A;  3MN2 A;  4BE2 A;  3RSN A;  2BZT A;  3FXU A;  1HXD A;  3JRA A;  5DS9 A;  2MW8 A;  4FT8 A;  3Q3S A;  2DJN A;  3L2C A;  5KAF C;  3IKT A;  1U6G A;  3PO3 J;  1W4M A;  1UST A;  4BQO A;  2VJ4 A;  3LFK A;  4DZP A;  1X1C A;  2HEO A;  5HLT A;  2A07 F;  2ID3 A;  4XKC A;  1IV8 A;  2DJI A;  2M4G A;  1C0W A;  3CMY A;  3BR0 A;  3HB9 A;  5F64 A;  1M1E B;  5IYB J;  2QSG X;  5EGO A;  1RKW A;  4ENK A;  1Y8R B;  2JVH A;  1OMI A;  2JWT A;  5JLX A;  4HNV A;  1W36 D;  2FOK A;  1DUX C;  3RKX A;  2DDB A;  1KYZ A;  4DQ2 A;  4PK4 A;  2K9S A;  4RLF A;  3S8P A;  5HS9 A;  3L9F A;  2XF6 A;  5BQT A;  4EM2 A;  3COA C;  5D6F A;  5H6R A;  4KNY A;  1E0E A;  3FHN A;  4UVA A;  1UG2 A;  4A0X A;  1FX7 A;  2VAS A;  5HDK A;  2VOO A;  3HSE A;  3S16 J;  1JT0 A;  4DOZ A;  1JGS A;  1R36 A;  2DBB A;  5CPR B;  3CQZ J;  1MMA A;  2BY0 A;  4B8X A;  1A36 A;  3TDU C;  4DIQ A;  1F36 A;  2RC4 A;  1MKM A;  2WBM A;  1HF0 A;  1X1P A;  2D5V A;  2MA3 A;  2VE8 A;  2XB5 A;  5IP7 J;  3M8F A;  5GAH J;  5J4V A;  2DFE A;  3LSK A;  1ETV A;  2P7V B;  3DXJ F;  2CO5 A;  2DT7 B;  3GZN B;  3SJM A;  1JKP C;  1QVT A;  2VBY A;  2WA0 A;  4AUX A;  4HDV A;  2RN7 A;  1JKQ C;  1R00 A;  1GVJ A;  1TT0 A;  1XDU A;  1VI0 A;  3K0L A;  2B7E A;  3AAF A;  2K3F A;  1B4A A;  1ETK A;  4YG2 F;  2Y0S N;  2R7X A;  4N4N B;  2MD5 A;  4IRG A;  3KP5 A;  5H20 A;  2ETH A;  3RDI A;  4OAZ A;  4BAY A;  2XV4 S;  4PGH A;  3ZQG A;  5GP9 A;  3EYI A;  3ASO H;  1FLI A;  1MMN A;  2F4M B;  3SHF A;  5JHU A;  4RAF A;  3RKY A;  3DCF A;  2IGK A;  1HOM A;  1HKT A;  2MSY A;  5LRR A;  2R5Z A;  5GAE J;  3TO6 A;  3J7A O;  4CCN A;  4MEY F;  3ULQ B;  1QPM A;  2R7V A;  2WAD A;  1P92 A;  3LSM A;  1FOK A;  2QQ9 A;  3BCA A;  1FOW A;  3QYE A;  2MD0 A;  2P7C B;  4C2T A;  1UHW A;  3HG9 A;  5E1Z B;  3S3N A;  4XBF A;  1QZZ A;  1GUU A;  2H8W A;  5B1A H;  5FD6 A;  1BI0 A;  5FLX K;  1YS7 A;  4OAY A;  4B3A A;  1LDD A;  4I2O A;  3T0Y A;  3J80 K;  4OIO F;  4C9Y A;  1CF7 B;  4UVC A;  1DQU A;  1XS9 A;  3OS0 A;  1AKH B;  1ZKG A;  4N9I A;  3ZN0 A;  1B59 A;  3EET A;  3FBN B;  1UJ8 A;  1VQK I;  4HF2 A;  1UEL B;  4E7S A;  2I10 A;  5B3S H;  3IAS 2;  4G6Q A;  3SZG A;  2RQP A;  3PNV A;  1PP7 U;  3GTK J;  5IT9 K;  5HS8 A;  2IXS A;  2AO9 A;  3AG3 H;  4LIV A;  3DTI A;  3F21 A;  1S7A A;  4M9X A;  1HKS A;  2LTP A;  3E6M A;  3MZY A;  4XM3 A;  1OYW A;  1Y1V J;  1HST A;  1OJL A;  2O5R A;  3DPT A;  2L9V A;  3LA2 A;  3QPH A;  5E18 F;  5K7F A;  3ABK H;  3DKX A;  2VKH A;  1FMV A;  5J4Y A;  2CFO A;  1QNT A;  3ZRG A;  1F5T A;  4QLC U;  3QPS A;  1A6Q A;  3CUQ C;  3L2U A;  4IHT A;  2MYS A;  2IA1 A;  3MVP A;  2KHM A;  4PUS A;  2JT1 A;  3MQ0 A;  3QYF A;  5FKN A;  1T0F C;  2DCE A;  3HOY J;  4M9Z A;  2AS5 F;  3M8J A;  2HDD A;  1T98 A;  1IN7 A;  1S9H A;  4PDK A;  3KP7 A;  2CU7 A;  2H09 A;  1S5L C;  2CFX A;  1T8I A;  3KIO A;  2IGN A;  1OR7 A;  1ZG1 A;  3ABU A;  2LKP A;  5IY5 H;  3T8T A;  1TZL A;  2DTZ A;  1W0U A;  2OBP A;  5GAD J;  3GLX A;  4B1R A;  3JSP A;  2GBY A;  3GVA A;  2L2O A;  4HAM A;  1S6L A;  1TWC J;  4RM3 A;  1K4S A;  4C2U A;  3HHG A;  2X48 A;  3TKY A;  4HV5 A;  2VC1 A;  1B8I A;  3BR6 A;  1B72 A;  1QBJ A;  2BVM A;  4XID A;  4P55 A;  5ED4 A;  3RPU A;  2DPD A;  4L9N A;  2COB A;  3O8H A;  1P4X A;  3EDP A;  4AVP A;  2V1U A;  2HNH A;  2VC0 A;  3WGI A;  4A3I J;  3R61 A;  5D6E A;  4MTE A;  3ZR8 X;  4PZJ A;  3LST A;  1K78 A;  1RIO H;  4BEH A;  2K7L A;  1QHG A;  4BAC A;  4UY8 I;  4RAY A;  4G6D A;  2K9L A;  3CO7 C;  2QQB A;  2QKM B;  1DPU A;  3GXO A;  4LK0 F;  2LSO A;  4P5O A;  4BHB A;  1LE8 A;  5BPI A;  1I39 A;  5HDN A;  1KU3 A;  3CMM A;  2IW5 A;  1CQT A;  2X51 A;  2R7W A;  5GPA A;  5IPA A;  2P5V A;  3H9Q A;  3KLN A;  2XSD C;  2QCO A;  2A61 A;  3I9V 2;  4Y17 A;  1STZ A;  2O3F A;  2O8X A;  1ZN2 A;  3K9T A;  3S3O A;  3GTG J;  2LF8 A;  2V7F A;  2FBI A;  4LLL A;  3ESW B;  1S7E A;  1RI7 A;  4P1W A;  2DXI A;  5DDG A;  1D1A A;  1EH6 A;  2R7Z J;  1W7P A;  3G1O A;  3HXL A;  3U1K A;  5LD2 C; 
#chains in the Genus database with same CATH homology
 3GW2 A;  1D8K A;  3VOD A;  1ZRE A;  1ODD A;  5JVT A;  2GA1 A;  1R5G A;  4BNC A;  3ZPL A;  1REP C;  3GF2 A;  5DCM A;  2EJR A;  2UWM A;  2E7X A;  4M72 A;  2PN6 A;  1U5T A;  6PAX A;  3J81 Z;  1IW7 F;  2NYX A;  3GWZ A;  1SD5 A;  3C18 A;  2JTV A;  1TQP A;  3PFI A;  3GFI A;  3N97 A;  5E1W A;  1KU2 A;  1KYW A;  4P9U A;  1IRG A;  4L0Z B;  1B6A A;  2QQA A;  2GA2 A;  3WTS C;  3T1B A;  2CWE A;  3BZ6 A;  3CO6 C;  3O6B B;  4L5J A;  2COM A;  4L9V A;  3ZMS A;  5D5U B;  2A5Y B;  4M74 A;  1RNL A;  2FEZ A;  1AOY A;  4WWC A;  5HLH A;  3HOT A;  2NNN A;  2FMY A;  1IN6 A;  4KIC A;  1FP2 A;  5D4S A;  5HLI A;  1HW5 A;  4EV0 A;  4JK1 X;  3ERE D;  1R5H A;  1YW9 A;  3BOQ A;  3FX3 A;  2P6S A;  4RB0 A;  4EJV A;  2XHK A;  3GZ5 A;  2ZME A;  2EFO A;  1HW1 A;  3TO7 A;  2O0Y A;  1IN4 A;  2NRA C;  2Y48 A;  1G6N A;  4OIR F;  1USS A;  4RS8 A;  5E8I A;  3JAM Z;  2KIM A;  3FXQ A;  1SFE A;  2IA0 A;  1L3L A;  1OYI A;  3ZQ7 A;  4D0P A;  3HUG A;  3WTZ A;  2XKO A;  1F9N A;  1H9G A;  2GZW A;  3FF5 A;  1YQA A;  3V8K A;  2KIU A;  2YR2 A;  1I1S A;  3D0S A;  3NEU A;  4U88 A;  1FYM A;  3I54 A;  2FBH A;  2W84 A;  2MH9 A;  4UV8 A;  2DPU A;  2UZK A;  1T6S A;  4UHT A;  3IKV A;  3N4M A;  4HDU A;  3QOP A;  3IWF A;  4ETS A;  2L3D A;  3F8M A;  2BE5 F;  3GYH X;  5CLS A;  4BHC A;  2HYG D;  4ENN A;  2F5F A;  2G9W A;  2XAQ A;  5AIP A;  4WF2 A;  4G94 A;  2YU3 A;  2X0L A;  5H6Q A;  5E1X A;  3V7C A;  4O3M A;  3FM5 A;  1WWX A;  4AIH A;  4Y15 A;  2EV6 A;  2K86 A;  3ML6 A;  1U3E M;  5AON A;  4OU0 A;  4Q5S F;  4N9H A;  1B1B A;  2EV0 A;  5DCM B;  3I4P A;  2L01 A;  2M30 A;  3FMS A;  4AIK A;  3I53 A;  2ESH A;  4JBA A;  2XGX A;  2O61 A;  1U5T B;  2F5E A;  1T38 A;  2MLK A;  2STW A;  1Q1H A;  3Q9S A;  1PP8 F;  1CGP A;  3IL2 A;  2E1C A;  2JSC A;  2R3S A;  4L5I A;  1BIA A;  1BC7 C;  1J75 A;  2PG4 A;  1DP7 P;  5FFX A;  4WXC A;  1GXP A;  4A0Z A;  5L3D A;  2VBZ A;  3CLO A;  4OOI A;  3R60 A;  3WOD F;  3HSF A;  3I64 A;  1ON1 A;  4I7H A;  1Y0U A;  2KIF A;  4HV6 A;  4Q47 A;  1W7P D;  4L18 B;  4PCQ A;  2VE9 A;  4ZYH A;  2ZNZ A;  2W85 A;  3L00 A;  4RGU A;  4RGR A;  4GXO A;  4YII A;  1Z05 A;  1TW3 A;  4RGS A;  3CUQ A;  4LG0 A;  4OIP F;  2OQR A;  1W5S A;  2Z5U A;  5F1R A;  3CUO A;  4U0Y A;  1T0F A;  5ICF A;  1BC8 C;  5ILU A;  5DCF A;  1FNN A;  2ZME B;  2ZCW A;  4G9Y A;  1S3J A;  1BI2 A;  4LFU A;  3IC7 A;  4OMY A;  4I0A A;  3ISP A;  5F6F A;  5ILS A;  4I01 A;  4HW0 A;  3Q9V A;  4GYG A;  4HX8 A;  3ZMD A;  1ONV A;  1IAW A;  1Z7U A;  3DKW A;  3F3X A;  4EQQ A;  2J5O A;  2BBY A;  3V7R A;  3FMQ A;  3C3W A;  1P2F A;  4M71 A;  4WXH A;  4IXA A;  5CVJ A;  3EQL F;  4OIN F;  2DK8 A;  4HZF A;  5J6X A;  2CYY A;  2OAZ A;  5DUI A;  2Y0M A;  1ZAR A;  3Q5F A;  2QZ8 A;  1WRJ A;  3JTG A;  3RKW A;  1FBS A;  1MJ9 A;  2RKH A;  3F6O A;  2OU2 A;  1SMT A;  3RPQ A;  1LEB A;  2H6B A;  2BYV E;  2DQR A;  3CTA A;  5J8F A;  4KMU X;  4G7O F;  1BOA A;  3WGG A;  2RVC A;  3H3U A;  2FRH A;  2WC2 A;  1PDN C;  3E97 A;  4HLX A;  2DK5 A;  2HQN A;  4KT5 C;  3JW4 A;  4IF4 A;  1NHA A;  2V1D A;  4YFK F;  5K5R A;  1KQ0 A;  2JPC A;  4P96 A;  2BEO A;  3V8L A;  2TDX A;  2ELH A;  2ZKZ A;  3NQO A;  2KRF A;  1SAX A;  4YFX F;  4MGR A;  1MDM A;  1J7K A;  5CVU A;  1JHF A;  3FWE A;  5D5X B;  4R1H A;  4HBL A;  3KZY A;  4LB5 A;  4WCG A;  1MJA A;  5L3E A;  1J0R A;  2K27 A;  3VB2 A;  4IVN A;  3LA3 A;  2FXA A;  3GZ6 A;  2QWW A;  3LAP A;  3T5X A;  4NHJ A;  5FD5 A;  1F4K A;  1E17 A;  1IUY A;  5BPD A;  1ZG3 A;  5CJ9 A;  4I0B A;  4F7Z A;  3F8B A;  1O7F A;  2KKO A;  1UB9 A;  1Z6R A;  3OV8 A;  2GXG A;  2QBY B;  3GO5 A;  3L7W A;  2ESN A;  2IP2 A;  2HOE A;  2A69 F;  4UNO A;  5LLQ A;  1JHH A;  3J81 K;  4BHP A;  2A3S A;  4JQF A;  4S04 A;  4ENJ A;  3SQN A;  1P4W A;  3WTV C;  4N0B A;  3MEX A;  1Z9C A;  4EJW A;  2Y75 A;  1TLH B;  2HGC A;  4HLY A;  2BV6 A;  4EM1 A;  4ESF A;  3V4G A;  1BIB A;  2OD5 A;  3KP3 A;  4ZZL A;  3D5L A;  5L3F A;  4MQV A;  3IRR A;  1XGO A;  1ZG5 A;  1GHC A;  2HKX A;  4EVI A;  3RYR A;  1ZAO A;  4IJA A;  2QUF A;  3HIF A;  1PUE E;  2K4J A;  1ON2 A;  4KMF A;  4A12 A;  4A5M A;  1G3T A;  1SFX A;  4LJZ F;  1O3T A;  4XSZ F;  3KP2 A;  2XAS A;  1G4D A;  1YLF A;  4H0E A;  2M87 A;  3B73 A;  3M8E A;  3IRQ A;  3DP7 A;  5J8C A;  1SD6 A;  1WQ2 A;  2X4H A;  5E17 F;  2FF4 A;  4LLG F;  1EV7 A;  1P6R A;  2G7H A;  5ERI A;  3E6C C;  2EA2 A;  5L3G A;  5AIQ A;  4NB5 A;  1XGS A;  4CO8 A;  2P5L C;  3FM3 A;  1R1V A;  5LHI A;  1SD7 A;  3P9I A;  2QLZ A;  2Z9O A;  3DV8 A;  4KN7 X;  2OZ6 A;  3FMR A;  5FFZ A;  2W57 A;  2O6G E;  4HF0 A;  4A6D A;  1TW2 A;  1K7A A;  1J59 A;  1D5V A;  2FE3 A;  1ZGA A;  1MDM B;  4GO1 A;  3MWM A;  2ACJ A;  1K79 A;  3K1N A;  1HW2 A;  4KDP A;  5ICC A;  4KUM A;  4FX0 A;  4LLN A;  4U0V A;  1G3S A;  3J80 Z;  5D5V B;  2EK5 A;  1LEA A;  5HVQ C;  1TQI A;  3MZH A;  1O7L A;  1IXC A;  2FML A;  2GIV A;  2H27 A;  4L9T A;  3F6V A;  2DFI A;  2VBX A;  1V3F A;  2QYO A;  3O2P E;  2B0L A;  5LHG A;  3REO A;  2MH2 A;  2EWN A;  1J9I A;  1ZLK A;  4ZYG A;  1FYK A;  5LHH A;  2UXX A;  3QP6 A;  2C6Y A;  2E7W A;  2K4B A;  4GCV A;  2R7F A;  2E1N A;  3E6B A;  4Y13 A;  3V8J A;  3K69 A;  2Q2E A;  4I09 A;  4XLN F;  3I71 A;  3HRU A;  4A2U A;  2CGP A;  1LVA A;  3K2Z A;  1DDN A;  5KK1 A;  1SD4 A;  3BJO A;  2LNB A;  5EEH A;  4U7B A;  4CYD A;  3I58 A;  2V79 A;  3GFM A;  1XB4 A;  4IHS A;  5L3B A;  2O03 A;  2EFQ A;  1XMA A;  1SMY F;  3KE2 A;  2IVM A;  4IPA A;  2HYF A;  3W6J B;  5LEK A;  3E3V A;  3KP6 A;  5D8K B;  1VTN C;  1LQ1 A;  4QWQ A;  3H3Z A;  4FX4 A;  5JI6 A;  2XUB A;  4ASN A;  3MFK A;  5DV5 A;  2HFH A;  5EEG A;  2Q0O A;  1K78 B;  1I5Z A;  2MBF A;  1IN8 A;  4KFC A;  1BM9 A;  2XRO A;  1YO5 C;  3E6D A;  1BI1 A;  2H6C A;  4EMS A;  1Z6T A;  2PFB A;  1YG2 A;  1LDJ A;  4BXU A;  3LA7 A;  3TQN A;  2LDU A;  1AWC A;  4PGG A;  3G3Z A;  4K2E A;  2IRF G;  4CDG A;  2P8T A;  1J2X A;  4CXF A;  3S2W A;  1UFM A;  3CDH A;  3IHU A;  5DEQ A;  4S05 A;  3O3K A;  3ZMU A;  1IXS B;  1W7P B;  3QU3 A;  5HLG A;  1IXR C;  3F8C A;  1TQM A;  5HDG A;  1XDS A;  3DF8 A;  1TBX A;  3SZP A;  2PBI A;  1KQ8 A;  1YFH A;  3ZMV A;  3BPV A;  2OA4 A;  2ZBK A;  1KGS A;  2MLG A;  3R0J A;  4CIC A;  4L0Y B;  1B9N A;  1DPR A;  3ELK A;  2KJB A;  1P4A A;  2W25 A;  3WTW C;  2GQQ A;  2D1V A;  2D2W A;  2V1X A;  2ZFW A;  2YX4 A;  1YYV A;  4ZYD A;  4Q48 A;  1H9T A;  1X3U A;  4CHU A;  4L9J A;  3HYI A;  4MQ9 F;  2HZT A;  2YX7 A;  1KQ9 A;  4HYE A;  2FNA A;  1BJA A;  3RIR A;  1I1G A;  1IN5 A;  3IWZ A;  2ISZ A;  1HSJ A;  5CVV A;  4KA4 A;  2KJC A;  1ZH5 A;  1RUO A;  1U8R A;  1ZGJ A;  1YW7 A;  4ESB A;  4GYI A;  4UV9 A;  5K1Y A;  1U5T C;  4IRH A;  2ZNY A;  2D45 A;  3DEU A;  5CYV A;  3QAH A;  2L4A A;  2DT5 A;  2VN2 A;  2ZXJ A;  4DNC A;  5A2Q Z;  3U1D A;  1I27 A;  1CF7 A;  2R7D A;  1V4R A;  5E20 A;  3VFZ A;  2HTJ A;  3TOA A;  2HTS A;  3SFZ A;  4EJO A;  4YFN F;  2XAF A;  1H0M A;  1IZ1 A;  1FY7 A;  2IT0 A;  1HQC A;  2W24 A;  3RI4 A;  3E5Q A;  4RB2 C;  2OZU A;  5CVI A;  5HS7 A;  4M9S A;  2WV0 A;  5TJJ A;  1FYL A;  4B09 A;  2EFW A;  2M8E A;  4M6Y A;  1GXQ A;  2LF7 A;  5LBQ A;  3E5U A;  1XD7 A;  2QM3 A;  2DU9 A;  3PQJ A;  3R6S A;  4G7Z F;  1G3Y A;  2L54 A;  1MJB A;  1MD0 A;  2QVO A;  2YPR A;  5FB2 A;  4O6J A;  2P6T A;  1ZRF A;  4HA8 A;  2ZO4 A;  3KCC A;  1FP1 D;  5BMZ A;  2NNY A;  2CG4 A;  3ABT A;  1ULY A;  5LEJ A;  4EGY A;  1XMK A;  3WU1 B;  2XKP A;  2FSW A;  5ILV A;  1ZYR F;  5D8L B;  3QPT A;  3ZMT A;  5HOO A;  4LK1 F;  5FGM A;  3I5U A;  2M1B A;  4XRF A;  3P7N A;  1QO0 D;  4EM0 B;  3VEP A;  3EUH A;  3GX4 X;  3MCZ A;  5JR3 A;  5KVR A;  2JZY A;  2NS0 A;  1YW8 A;  3DPL C;  4BH9 A;  2M45 A;  3WG9 A;  1HKQ A;  2HS5 A;  4WXD A;  2M5W A;  4OIQ F;  4A0Y A;  4WK8 F;  3BPX A;  1KU7 A;  2AXL A;  3TGN A;  1EH8 A;  1O3R A;  2EFP A;  3GFJ A;  4R8H A;  3HRM A;  4MNU A;  3HTU A;  2VXZ A;  3GEZ A;  3WE2 A;  3EYY A;  3KFW X;  2HWV A;  3TO9 A;  2VOP A;  5LGN A;  4A6E A;  3JTH A;  2HQR A;  4ENM A;  4Z2Y A;  3C7J A;  3L09 A;  2XAG A;  1QGP A;  3QU6 A;  5DUK A;  2DO7 A;  3BWG A;  1TNT A;  1YIO A;  3FHZ A;  3QRF F;  2D1H A;  1ZRD A;  1E2X A;  2HR3 A;  1FBU A;  3CUQ B;  4LG0 B;  2XIG A;  4LB6 B;  3ECH A;  2FA5 A;  3ROU A;  5LGT A;  2YSR A;  1KU9 A;  2XAH A;  3B02 A;  3SZT A;  4Q4Z F;  3SXY A;  5E8G A;  3BDD A;  1XSX A;  5TRD A;  3FZV A;  4UVB A;  3V7S A;  2IA2 A;  1U2W A;  4RGX A;  1QQI A;  3KET A;  5JFR A;  2A68 F;  1FC3 A;  3VOE A;  2DTR A;  4YIF A;  1UHM A;  1FSH A;  3KLO A;  2HDC A;  1J5Y A;  2HKO A;  4BQA A;  4RAZ A;  3M7G A;  3U9G A;  4HOB A;  2PJP A;  3M9A A;  1FPQ A;  1FSE A;  4ZYE A;  2PQ8 A;  4NQW A;  4XLP F;  2P4W A;  1O3Q A;  2Q8K A;  1ZHF A;  1R1U A;  4LD5 A;  3P9C A;  4EJT A;  2CW0 F;  2FU4 A;  2Z3Y A;  4MEX F;  1XGN A;  4KIB A;  4LMY A;  1I6X A;  3K1P A;  1JXS A;  2VON A;  4LGW A;  5LGU A;  3LWF A;  1EH7 A;  1RZ4 A;  2ADU A;  3BY6 A;  1QZY A;  2JPB A;  2P5K A;  5DD4 A;  2EB7 A;  1O3S A;  3JAM K;  4ESJ A;  1LB2 A;  3F8N A;  4ZZD A;  2VOD A;  1IF1 A;  4GGG A;  4BYY A;  3R0A A;  2A6E F;  1B9M A;  2GAU A;  1SFU A;  1YS6 A;  3BJA A;  4KYW A;  5DD8 A;  1ZRC A;  2RDP A;  3OOP A;  5ICE A;  3PQK A;  3P9K A;  4FHT A;  4G8X A;  2GXB A;  3WGH A;  3ZP5 A;  2EFN A;  4WX9 A;  3RYP A;  1LNW A;  5LRS A;  1LDK B;  4AWX B;  5FLX Z;  1XGM A;  2ZJ2 A;  2PI0 A;  4EJU A;  2RNJ A;  2PMU A;  1BBY A;  2J5P A;  3QP5 A;  1R7J A;  3CJN A;  5IT9 Z;  2XAJ A;  5K5O A;  1XN7 A;  4AD9 A;  1W5T A;  1IRF A;  3ZN1 A;  1XSD A;  3HTS B;  3C1D A;  1S29 A;  4U0W A;  2Z99 A;  3K1M A;  5DYM A;  4RB1 A;  2Z33 A;  2STT A;  4HQE A;  1FWZ A;  3FXR A;  4O5V A;  5D4R A;  2WTE A;  2PEX A;  1O57 A;  3E5X A;  3HRT A;  3T8R A;  2F2E A;  5FO5 A;  4KN4 X;  3RTR A;  1OPC A;  2JRT A;  4M6X A;  1UCR A;  1BN5 A;  2EA4 A;  1D8J A;  3F22 A;  2VBW A;  1FT9 A;  2DLL A;  3KZZ A;  3KEO A;  4UUV A;  2BGC A;  2QEN A;  2DW4 A;  1R58 A;  4XSX F;  2OQG A;  5A2Q K;  2FQ3 A;  1MGT A;  3LQR A;  2GWR A;  1YTY A;  3BRO A;  2F5D A;  2VT2 A;  3I59 A;  2UXN A;  1F1Z A;  4HX4 A;  3LQQ A;  2K02 A;  1RUN A;  2MC3 A;  3I0T A;  5ICG A;  4G7H F;  4HF1 A;  2ISY A;  4MTD A;  3LAJ A;  3BP8 A;  2G7U A;  1XCV A;  1R1T A;  1FZP B;  4A5N A;  4M73 A;  3HSR A;  1WSU A;  1HBX G;  4CGZ A;  2PMH A;  2DAO A;  1U78 A;  2V9V A;  1R23 A;  4I02 A;  1ZLJ A;  1LJ9 A;  2IJL A;  3ECO A;  3HHH A;  3F8F A;  1OYY A;  4IRI A;  2IPQ X;  3KP4 A;  2PLY A;  4P9F A;  2FBK A;  1TTY A;  1L0O C;  2L02 A;  5CVR A;  3WU0 A;  5L3C A;  2EV5 A;  2RV8 A;  4RB3 C;  2F5C A;  3GFL A;  1D3Y A;  3G73 A;  1XSV A;  3BJ6 A;  2XVC A;  3WTU C;  1R22 A;  3HRS A;  1WKM A;  4E70 A;  3ZMZ A;  1Z1D A;  2VT3 A;  3DFG A;  1OKR A;  3TDZ C;  3F72 A;  1T2K A;  3RJP A;  2DI3 A;  1BI3 A;  3F23 A;  4HQM A;  5D5W B;  1MZB A;  4TV7 A;  1Z91 A;  4UXN A;  4MHG A;  2XRN A;  4ZH4 F;  4KIG A;  3R4K A;  4U7D A;  1TNS A;  2V6C A;  3U2R A;  1A04 A;  1K6O A;  4ON0 A;  3WE3 A;  2H94 A;  1S7O A;  3KEQ A;  3W6K B;  2WWY A;  2QBY A;  3M1E A;  1FBQ A;  2RGV A;  3TOB A;  4R79 A;  4I98 B;  3GUD A;  3WTX C;  3WTY C;  2A6H F;  1XCB A;  2CQK A;  5IT3 A;  4AIJ A;  3NRV A;  5K5Q A;  1S8N A;  5BOX A;  3DQV C;  2CSO A;  4EGZ A;  4CZZ A;  3JSO A;  3H92 A;  2FNP A;  4OMZ A;  1JE8 A;  1WI9 A;  2DQL A;  1KA8 A;  4KIF A;  5BS6 A;  2NAZ A;  3I59 B;  3MAJ A;  3WTT C;  4HX7 A;  3HOS A;  1G3W A;  2L4M A;  1T39 A;  3FXU A;  1HXD A;  4FT8 A;  3L2C A;  3IKT A;  1U6G A;  1W4M A;  1UST A;  3LFK A;  2HEO A;  2A07 F;  1C0W A;  5F64 A;  4ENK A;  1DUX C;  1OMI A;  2FOK A;  3RKX A;  1KYZ A;  4DQ2 A;  5HS9 A;  3L9F A;  5BQT A;  4EM2 A;  3COA C;  5D6F A;  5H6R A;  4KNY A;  4UVA A;  4A0X A;  1FX7 A;  5HDK A;  2VOO A;  3HSE A;  1JGS A;  1R36 A;  2DBB A;  4B8X A;  3TDU C;  2RC4 A;  1MKM A;  2MA3 A;  2VE8 A;  3M8F A;  2P7V B;  3DXJ F;  2CO5 A;  2VBY A;  4HDV A;  2RN7 A;  1R00 A;  1GVJ A;  1XDU A;  3K0L A;  3AAF A;  1B4A A;  4YG2 F;  2MD5 A;  4IRG A;  3KP5 A;  5H20 A;  2ETH A;  3RDI A;  4BAY A;  2XV4 S;  4PGH A;  3EYI A;  1FLI A;  3SHF A;  5JHU A;  3RKY A;  1HKT A;  5LRR A;  3TO6 A;  3J7A O;  4MEY F;  3ULQ B;  1QPM A;  1P92 A;  1FOK A;  2QQ9 A;  2P7C B;  1UHW A;  5E1Z B;  4XBF A;  1QZZ A;  5FD6 A;  1BI0 A;  5FLX K;  1YS7 A;  1LDD A;  4I2O A;  3T0Y A;  3J80 K;  4OIO F;  1CF7 B;  4UVC A;  4N9I A;  3ZN0 A;  1B59 A;  3EET A;  4HF2 A;  4G6Q A;  2RQP A;  1PP7 U;  5IT9 K;  5HS8 A;  3F21 A;  1S7A A;  4M9X A;  1HKS A;  3E6M A;  3MZY A;  1OYW A;  1HST A;  3DPT A;  3LA2 A;  3QPH A;  5E18 F;  1QNT A;  1F5T A;  4QLC U;  3CUQ C;  4IHT A;  2IA1 A;  2JT1 A;  3MQ0 A;  4M9Z A;  2AS5 F;  1T98 A;  1IN7 A;  4PDK A;  3KP7 A;  2H09 A;  2CFX A;  1OR7 A;  1ZG1 A;  3ABU A;  2LKP A;  3T8T A;  2OBP A;  3GLX A;  3JSP A;  3GVA A;  4HAM A;  1S6L A;  3HHG A;  3TKY A;  4HV5 A;  2VC1 A;  1QBJ A;  4P55 A;  5ED4 A;  3RPU A;  2DPD A;  4L9N A;  1P4X A;  3EDP A;  4AVP A;  2V1U A;  2VC0 A;  3WGI A;  3R61 A;  5D6E A;  4MTE A;  4PZJ A;  3LST A;  1K78 A;  1RIO H;  2K7L A;  4RAY A;  4G6D A;  3CO7 C;  2QQB A;  1DPU A;  3GXO A;  4LK0 F;  2LSO A;  4BHB A;  4P5O A;  5BPI A;  5HDN A;  1KU3 A;  2IW5 A;  2P5V A;  3KLN A;  2A61 A;  4Y17 A;  1STZ A;  2O3F A;  2O8X A;  1ZN2 A;  3K9T A;  2LF8 A;  2FBI A;  4LLL A;  1RI7 A;  5DDG A;  1EH6 A;  1W7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...