2QVOA

Crystal structure of af1382 from archaeoglobus fulgidus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
b'RIKLLFKEKALEILMTIYYESLGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDKGQKIAQQIKSIIDIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_1382
publication title Crystal structure of AF1382 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 27
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qvoA00
3HTSB 2YR2A 2A3SA 4G6DA 1B9NA 2ISYA 2DO7A 1AWCA 5HS9A 5FLXK 1QQIA 1S7OA 4I01A 4RB2C 3R60A 1D5VA 5DUKA 2RNJA 3BWGA 1SMTA 2P8TA 3H3UA 3O6BB 4RGSA 3I64A 4CHUA 2XAJA 5FO5A 1TNTA 1ZYRF 3EQLF 4NQWA 1YFHA 4TV7A 4U0YA 3U1DA 2MLGA 4U7BA 4L9TA 2LNBA 1FP1D 4Y13A 3P9IA 2M30A 4ETSA 5EEGA 2PFBA 2GA1A 1SAXA 2FNAA 2RVCA 3R61A 1BC8C 2VC0A 1W5SA 2BEOA 3BJOA 3TO9A 3ZPLA 1HQCA 4UNOA 3VODA 5FD5A 2PBIA 1OYIA 2ZCWA 2J5PA 4HF1A 1T6SA 1EH6A 1PDNC 4Q5SF 1OR7A 5L3EA 2E1NA 5K5RA 3WODF 2IW5A 3T5XA 2IA2A 1FC3A 1R7JA 5FB2A 1WI9A 4A6EA 2K27A 2V9VA 4S04A 4IJAA 2FBHA 1T38A 1SFEA 4AVPA 2FXAA 4DNCA 1FOKA 1USTA 2QQAA 1YG2A 3E5UA 1FYKA 2LF7A 5CVIA 4G9YA 2OQRA 2Q0OA 3V8LA 3KP4A 1K6OA 2QZ8A 1A04A 1XSVA 3K0LA 1IXCA 1FLIA 2Y48A 3LQRA 1R5GA 3B73A 3QAHA 1J2XA 3FX3A 3R6SA 5HDKA 1TW2A 5D5XB 4BHBA 4AIKA 1T98A 4CO8A 2BE5F 4IXAA 5IT3A 2M45A 3TQNA 3E3VA 1YO5C 4HX4A 5ED4A 2HR3A 1WQ2A 4OU0A 1L0OC 5HS7A 2ZMEB 4EGZA 4HA8A 1SD5A 5DV5A 1JE8A 1FZPB 3IWZA 1P4XA 3N4MA 1ON1A 2G9WA 2FF4A 2L54A 1BIBA 5F1RA 2Y0MA 3E97A 3RTRA 3U2RA 1Q1HA 1UB9A 4BYYA 4CZZA 3V8KA 4Z2YA 2XAFA 1XDSA 4F7ZA 2EV6A 3Q5FA 1HSJA 3FXUA 2WTEA 3HSFA 3LA2A 3WE2A 1O3QA 2X0LA 4I09A 4KIBA 3RPQA 3RKYA 4OIQF 5ILUA 3DF8A 4JK1X 2G7HA 4A0XA 2BBYA 1UCRA 3Q9VA 4M9XA 4OMYA 5CVVA 2ZXJA 5LEJA 2BGCA 3JAMK 2O8XA 4OIRF 2X4HA 1S6LA 5E18F 3ECOA 3K69A 4HQEA 4I2OA 4KN7X 4RB1A 1BC7C 5K1YA 2P7CB 1XCVA 1O3SA 5D4RA 2GA2A 1WWXA 2XIGA 3JW4A 4MEYF 5KK1A 4ESJA 4IPAA 2DBBA 1HW2A 2B0LA 3IHUA 5CVRA 2XASA 3NRVA 2VBWA 1ZG3A 1EV7A 3RJPA 2XAQA 3SZTA 2DT5A 1O7LA 4MQVA 2VT2A 3CJNA 3FMSA 1O3TA 3ISPA 2VBYA 1T0FA 1R58A 2QBYA 2PI0A 1HW1A 2VN2A 1IN7A 3GW2A 3E6CC 4UHTA 1K78B 1MJAA 4BXUA 2OU2A 1YYVA 3FXQA 2HZTA 4GO1A 3HSRA 3WU1B 2ZO4A 5DYMA 4P55A 1DPRA 2COMA 2OQGA 1NHAA 4ENNA 1TQIA 2M87A 3CDHA 4EM0B 2YX7A 1S8NA 5LHIA 2K7LA 4GYIA 3RKXA 2IVMA 1I1GA 4EM2A 2GAUA 3C1DA 1R22A 2L3DA 2P6TA 5HVQC 4OINF 2OBPA 3QU6A 3DKWA 5AONA 1XSDA 4KN4X 2LSOA 5DUIA 5JFRA 2EK5A 2GIVA 4RGUA 1U78A 2MH2A 4A2UA 5LHHA 2XVCA 1FY7A 1LQ1A 2YPRA 4YG2F 1YW7A 1DUXC 3FXRA 2V1UA 1L3LA 2K02A 2WV0A 3WTSC 2WWYA 1MDMA 3IWFA 2FE3A 3K1PA 1XMKA 3DQVC 2MH9A 1FT9A 1U5TA 3O3KA 2H6BA 4KIFA 1KYWA 4XLPF 3I5UA 2PJPA 1Z6TA 3T1BA 1YIOA 2J5OA 1LB2A 3KZYA 1PUEE 2W57A 2DTRA 1R1TA 1KU2A 3V7CA 3WGIA 4IVNA 1PP8F 1WRJA 4CGZA 2ZKZA 2UXNA 5JR3A 1P6RA 3J80Z 3EUHA 4ENJA 2RN7A 4XLNF 2VOOA 1KYZA 2WC2A 3ROUA 4H0EA 3PFIA 1QPMA 1LNWA 2HEOA 5KVRA 3CO6C 2DFIA 1B1BA 1IXRC 4EJWA 5LLQA 1D8JA 1KQ8A 2NNNA 5AIQA 5H20A 2K86A 1IUYA 4WX9A 5EEHA 4QLCU 2IPQX 1S7AA 2V79A 3QU3A 2E7WA 4KFCA 3C7JA 3OOPA 1BM9A 2MC3A 4UV8A 1GVJA 1I5ZA 4UUVA 1HKSA 1FX7A 4PGHA 2HDCA 2DW4A 2BYVE 2FBIA 3V4GA 3ZMVA 1JGSA 3K2ZA 3B02A 1FBSA 1F4KA 4U0WA 2W84A 3CUQB 2GXGA 2ZMEA 4KA4A 1KU7A 4YFXF 3EYIA 3FWEA 4U7DA 4KNYA 1YS6A 2P6SA 3F8CA 5FFZA 2PMHA 1AOYA 1QZYA 4S05A 1OMIA 3CTAA 1ON2A 4G7OF 2DLLA 1EH7A 1OPCA 4RAYA 3J7AO 4WXCA 4N0BA 4B09A 3I71A 4WXDA 2HQNA 1J0RA 1IW7F 1J9IA 1KU9A 4M73A 4A6DA 1QO0D 1IN6A 3EYYA 2K4JA 3ZMZA 3CLOA 3F6OA 1SD7A 3C3WA 1J59A 4CXFA 4KDPA 3I59B 1B9MA 1G3TA 2ZJ2A 4LG0A 2V6CA 3HOSA 2M1BA 1U2WA 3HSEA 1DDNA 3HHGA 3Q9SA 2V1DA 1TBXA 4M74A 4R8HA 3ZMDA 4EM1A 1KU3A 2EFOA 1DP7P 1ZH5A 3JTHA 1STZA 1H9TA 4YFKF 3WGHA 4PGGA 3EDPA 5ICGA 3WTYC 1OYYA 2HYFA 4MHGA 4M71A 3HTUA 5D5VB 2IJLA 4I0BA 4HW0A 3SQNA 2FSWA 1BI3A 1MGTA 2DQRA 2QYOA 1RUOA 2RQPA 2KIMA 5FLXZ 3DFGA 4LLNA 4AIHA 2O03A 1I27A 4FHTA 2OD5A 3FMRA 5LGTA 2UWMA 3GWZA 2P5KA 2HFHA 2A61A 1FBQA 2FU4A 3ZMSA 3BJ6A 3LWFA 3SHFA 3JSPA 5HS8A 1C0WA 4Y15A 1B4AA 4MNUA 2E7XA 4M6YA 1LDKB 2P7VB 3HOTA 4WWCA 4LB5A 2HTJA 4XSXF 4KIGA 1ZG1A 1HXDA 5JHUA 3I54A 3KP2A 3L9FA 2EFQA 3LA3A 1G6NA 3F21A 4LMYA 1X3UA 4P9FA 4I0AA 4KMUX 2EWNA 5BPDA 1P2FA 4KICA 3TGNA 2STTA 1WKMA 3M7GA 1ZLJA 3C18A 2MA3A 3I58A 3WU0A 1RNLA 1Y0UA 2FNPA 2EFNA 2NNYA 2NAZA 4LLGF 5BQTA 2D1HA 2FOKA 3CUQC 3IL2A 1J5YA 3RPUA 3ZN0A 3H92A 2HKXA 3F6VA 3LQQA 3F3XA 3BROA 5HLGA 2JSCA 3P7NA 1W7PD 1XB4A 1R1UA 5ILSA 4MEXF 4BQAA 4L0YB 4Q4ZF 3TKYA 1HKQA 1TNSA 3WGGA 4CDGA 4M9ZA 3GUDA 1BI2A 1BI1A 3IC7A 2VT3A 5E1XA 3W6JB 1ZRDA 4N9IA 1YLFA 2A68F 5DD4A 4U0VA 1HSTA 3TDZC 2GQQA 4KYWA 2O3FA 1HBXG 1D3YA 4G7ZF 4LJZF 2EFPA 2ACJA 2O0YA 2O61A 2H94A 1XSXA 3J81K 4ESBA 1UFMA 1F1ZA 1GHCA 1G3WA 3GZ6A 3L7WA 1TQPA 3COAC 4RS8A 4LK1F 1QZZA 4YIIA 1R23A 1P4WA 4FX0A 1O7FA 3I4PA 1H0MA 1IZ1A 1LJ9A 3QPHA 3REOA 1ZRCA 3HRTA 1HW5A 1KQ9A 3S2WA 3IRQA 2GWRA 2A07F 5D5UB 3GVAA 2HTSA 1XGSA 2Q8KA 4IRIA 3F8MA 3RKWA 5H6RA 4EJOA 2KIFA 3VB2A 2VBZA 3BOQA 3WTUC 2STWA 5LRRA 3BP8A 2EV5A 5LRSA 2VC1A 1W7PA 3WTWC 1B59A 1ONVA 1UHMA 2GXBA 4JBAA 5JI6A 5AIPA 4EVIA 1REPC 2R7FA 3M8EA 4HF0A 4RGRA 5TRDA 2MLKA 4B8XA 4YFNF 4WK8F 3WTTC 2IRFG 4L9VA 3HYIA 3GZ5A 4M72A 3D5LA 3JSOA 2DQLA 2BV6A 3GLXA 4LD5A 1XGNA 4ZZLA 4HF2A 1J75A 2RC4A 2DPDA 3U9GA 3DEUA 2FMYA 3J81Z 4UVCA 3JAMZ 2KKOA 3R0AA 3SZPA 2P5VA 1W5TA 5HDNA 2F5FA 5HOOA 3PQKA 4RB0A 1GXQA 2AS5F 2D1VA 2CQKA 2PMUA 5J8FA 2KRFA 2H27A 3F8FA 1CGPA 3P9KA 3G3ZA 3E6DA 2GZWA 3TO6A 3F22A 3I59A 5BPIA 4HV5A 4EMSA 2L02A 4LGWA 2CW0F 1BBYA 2ZBKA 3SXYA 3GXOA 1IN5A 4HDVA 1ZHFA 2XROA 5E8IA 5DEQA 2O6GE 1FBUA 2HGCA 3TOAA 2A69F 2QVOA 1KGSA 4HAMA 5DCFA 1OKRA 4LFUA 2DI3A 3QRFF 4O3MA 2A5YB 3ECHA 1CF7B 2CFXA 1I6XA 1SD4A 2L4AA 2FQ3A 2IA0A 1ZGJA 4P5OA 2ZNYA 3CO7C 1Z91A 2XAHA 4PCQA 3WG9A 5J8CA 2DU9A 2QENA 4ENKA 1U6GA 5ERIA 4G8XA 4LB6B 2Z99A 3QP6A 3ABTA 2PLYA 4ZYEA 3HHHA 4BH9A 1JXSA 2EA4A 3DV8A 1R36A 4HBLA 3ULQB 1XDUA 4HZFA 2DAOA 3CUOA 2Y75A 3LAPA 3VOEA 5ILVA 1Z6RA 2W85A 3ZMTA 1FSEA 4G94A 4IHSA 5LBQA 2V1XA 3L2CA 2XAGA 4GYGA 5FD6A 1HKTA 4M6XA 1O3RA 2IA1A 5DCMB 2L4MA 1UHWA 2PN6A 3F23A 1E2XA 2R3SA 2LKPA 3VEPA 2EJRA 2KIUA 1V4RA 1EH8A 4A5MA 1XGMA 1XGOA 2DK5A 1V3FA 2HKOA 3KFWX 4A0ZA 2ADUA 4RGXA 5DDGA 3IKTA 2XGXA 4HLXA 5FGMA 2UZKA 1MZBA 3IRRA 1DPUA 4G7HF 3KLNA 2CG4A 3L09A 3LFKA 2QLZA 1WSUA 2LDUA 3V7RA 3HIFA 3V8JA 5FFXA 2Z5UA 2MBFA 3KP6A 4HQMA 1USSA 4OMZA 2D2WA 2G7UA 3DPLC 2M5WA 4AIJA 3RI4A 3GFJA 4FX4A 3V7SA 5L3BA 5BS6A 2A6HF 4XBFA 1XD7A 5TJJA 2PG4A 3M1EA 4ZH4F 1JHFA 5HLHA 3MWMA 3FM5A 4YIFA 3EETA 2R7DA 2YX4A 1BN5A 1KQ0A 2FA5A 2KJCA 2L01A 1SFUA 5LGNA 3MFKA 5CYVA 4A0YA 1W4MA 3N97A 3KEOA 1FPQA 5D8LB 1ZARA 3KZZA 2Q2EA 5CJ9A 2HOEA 1BI0A 1S3JA 3F8NA 1QNTA 2ZNZA 2EV0A 3QOPA 2NRAC 3M8FA 1TTYA 2VXZA 1XCBA 2HS5A 1U8RA 1F9NA 2W24A 1YTYA 5A2QK 4Y17A 1MDMB 1I1SA 5CVJA 1PP7U 4D0PA 3TO7A 2OZUA 2W25A 3MAJA 1U5TB 4BHPA 2RV8A 4ZYHA 1G3SA 1G3YA 4BHCA 2CO5A 4Q47A 5K5OA 1IF1A 4A5NA 5CLSA 2ETHA 1BOAA 1ZGAA 2AXLA 4UXNA 4HLYA 1T39A 3DXJF 5L3GA 3AAFA 4I02A 3LSTA 4EJUA 4NB5A 1IAWA 4A12A 1K78A 3WTZA 2D45A 2ISZA 2M8EA 5ICEA 5L3DA 3T8RA 1MD0A 1YW9A 1ZN2A 4QWQA 4JQFA 2QQBA 3KEQA 2IP2A 4HOBA 2TDXA 4O5VA 3DPTA 4PDKA 2EB7A 4L9NA 2ESNA 1IN4A 1FWZA 1ZLKA 4GCVA 5DD8A 4PZJA 1ULYA 1ZREA 4I7HA 3RIRA 3HUGA 3W6KB 2IT0A 2CYYA 5IT9K 4L9JA 2P5LC 3L00A 1MJBA 4KUMA 1YQAA 1FYMA 5BMZA 5D6EA 1BJAA 2H6CA 4EQQA 2A6EF 2JZYA 4N9HA 3BJAA 3BY6A 1Z9CA 4UVBA 3BDDA 3FM3A 2DPUA 5A2QZ 3KP5A 5E20A 1O57A 2OZ6A 3R0JA 4M9SA 1KA8A 3PQJA 3KETA 1XMAA 2P4WA 3F72A 4HX8A 2Z9OA 4ZZDA 1H9GA 3KCCA 1TLHB 4XSZF 1YS7A 4KMFA 5D8KB 2QM3A 3HRMA 4HYEA 1SMYF 2QWWA 4EJTA 1J7KA 1CF7A 2JPBA 2Z3YA 4RAZA 2K4BA 4P96A 4I98B 3FF5A 2JTVA 2JT1A 1SD6A 5E8GA 4NHJA 3ZMUA 4IRGA 4R1HA 3GFLA 1RIOH 4ASNA 2VODA 5LGUA 3HRSA 3QP5A 2OAZA 4WF2A 2NYXA 5D6FA 5ICFA 3RYPA 3P9CA 3GX4X 4RB3C 2XRNA 2CGPA 2EFWA 2F5CA 1IN8A 2DK8A 3MZYA 5IT9Z 5BOXA 4MQ9F 5E1ZB 2HWVA 5D4SA 2FMLA 3ML6A 1F5TA 4ESFA 1RUNA 4LG0B 3G73A 1U3EM 3NEUA 3BPVA 3ZQ7A 3O2PE 3DP7A 2NS0A 6PAXA 4AD9A 1U5TC 1IRFA 2ESHA 3BPXA 4IRHA 3T0YA 4GXOA 1R00A 4L5JA 5DCMA 2OA4A 2JPCA 4U88A 1BIAA 2VE8A 3KP3A 4EGYA 3K1MA 2YSRA 3D0SA 3K1NA 2ZFWA 5L3CA 4MGRA 4LLLA 1E17A 3GYHX 4UV9A 4DQ2A 3GEZA 3VFZA 2F2EA 2XKOA 1RZ4A 2XHKA 3F8BA 3BZ6A 5D5WB 3IKVA 2CSOA 2CWEA 3R4KA 3LAJA 4MTEA 5E17F 3MEXA 3CUQA 5LEKA 4KT5C 4Q48A 5F64A 3LA7A 3ABUA 3I53A 3RDIA 1G4DA 1JHHA 3GF2A 2FBKA 3HRUA 2PQ8A 4ZYDA 5JVTA 1LEAA 1Z1DA 4BNCA 3QPTA 3FZVA 4LK0F 4P9UA 1YW8A 1FNNA 3ELKA 3J80K 2FEZA 2ELHA 2HQRA 3MCZA 4E70A 1IRGA 4K2EA 3E6BA 4GGGA 3TDUC 2VOPA 1K7AA 1QBJA 1S29A 1TQMA 1SFXA 2Z33A 4ZYGA 3OV8A 3ZP5A 3ERED 4UVAA 2RDPA 2F5DA 4EJVA 4ENMA 2YU3A 3FHZA 2E1CA 4IHTA 3E6MA 3GFIA 4L0ZB 2VE9A 4O6JA 4WCGA 2MD5A 4OIPF 1LEBA 3JTGA 3WTXC 1Z7UA 1Z05A 5H6QA 3GFMA 4MTDA 5HDGA 5L3FA 3E5QA 1R5HA 2FRHA 4WXHA 3GO5A 4CICA 2KJBA 4L5IA 4FT8A 2HYGD 1FYLA 2VONA 4AWXB 4HDUA 2QUFA 1LDDA 3RYRA 5ICCA 3WTVC 4XRFA 3KE2A 2F5EA 3H3ZA 2LF8A 3TOBA 2PEXA 2QQ9A 1RI7A 1ZG5A 4IF4A 5CVUA 4OOIA 5F6FA 3M9AA 5LHGA 1LDJA 1QGPA 2RKHA 2H09A 1D8KA 2UXXA 3MZHA 1GXPA 5HLIA 2EA2A 1P92A 3FMQA 1FSHA 2JRTA 1TW3A 2C6YA 3E5XA 1XN7A 1ZRFA 1VTNC 1P4AA 4L18B 5J6XA 2RGVA 1ZAOA 3KLOA 1FP2A 4OIOF 1K79A 3I0TA 1OYWA 3MQ0A 4HV6A 1T2KA 3SFZA 3K9TA 3KP7A 4CYDA 1R1VA 3NQOA 3WE3A 1ODDA 1MJ9A 3ZN1A 1IXSB 1W7PB 2QBYB 4HX7A 4BAYA 2XKPA 1MKMA 5K5QA 2XUBA 1LVAA 2XV4S 1B6AA 4R79A 4ON0A 3T8TA 2VBXA 4G6QA 5E1WA 4EV0A
chains in the Genus database with same CATH superfamily
1MW7A 2JVGA 2E1OA 3HTSB 2YR2A 2A3SA 2GLOA 4G6DA 1B9NA 4FTHA 2ISYA 3DTKA 2DO7A 3ZQIA 1AWCA 1VF9A 5HS9A 2DA6A 2CS3A 5FLXK 1QQIA 1ZELA 1BL0A 2ID6A 2EZKA 1S7OA 4M3BA 4I01A 4C9YA 4J01A 4RB2C 3R60A 2ELKA 2DOAA 1D5VA 5DUKA 2RNJA 2EQRA 3PNTA 1WPKA 1VQMI 2X1CA 3BWGA 1SMTA 2P8TA 3H3UA 3SDGA 3O6BB 1B72A 3BCBA 1X58A 4RGSA 1QHHD 2DMUA 4D7MA 2HXOA 3I64A 5GTIC 4CHUA 4CCMA 2PJRA 3TEDA 2XAJA 5DTDA 5FO5A 5E3MA 1TNTA 1ZYRF 1YITI 3EQLF 4NQWA 1YFHA 1BA5A 4TV7A 4U0YA 5KAFC 2VPLA 3U1DA 2MLGA 5B1BH 2KDOA 4ABZA 4U7BA 3HOUJ 4A3DJ 4L9TA 2LNBA 3CJRB 1YHQI 1IV8A 1H88C 3OIQA 1RKTA 1FP1D 2ZJRF 1ORKA 4NC8A 5EF6A 2VKDA 4Y13A 2VB6A 3NARA 3P9IA 2JUCA 3H9JA 4XLCA 2VJIA 2M30A 1MBEA 1PVEA 2W48A 1FMVA 4FISA 1ETQA 4ETSA 2RAEA 5F1JA 5EEGA 5KAIC 2PFBA 4Y52J 2GA1A 1SAXA 1YI2I 2FNAA 2DFHA 2RVCA 1X4OA 3R61A 1BC8C 2M8GX 4PK4A 2VC0A 1W5SA 2BEOA 3BJOA 5J1YA 4DOZA 3TO9A 3ZPLA 3OYGA 3ZGKA 1HQCA 4UNOA 2R7VA 3VODA 1UELB 2PBIA 5FD5A 1OYIA 3GTJJ 2JA2A 3L1PA 2ZCWA 9ANTA 2J5PA 3OSFA 1A5JA 2KT0A 1DP3A 1PYVA 4HF1A 2DA3A 4GDFA 3OWTA 3CDLA 5IP9J 1T6SA 2KZGA 2IGKA 1EH6A 1PDNC 2A5WA 4EV0A 4Q5SF 4B48A 1OR7A 5GTHC 3I56I 2NOGA 1FOYA 5L3EA 2M9HA 2E1NA 5K5RA 3H3VK 4BDYA 4RM3A 3WODF 2IW5A 3DKXA 2BVLA 5F0CA 1W0TA 4AM3A 2IGNA 3S32A 2DDAA 1SFKA 4I99C 4BJTA 3T5XA 4ZTJA 3J7YJ 1BOBA 2IA2A 3ERMA 1FC3A 2QKLB 1R7JA 2WB1A 5FB2A 1WI9A 3KYCB 1MBFA 3DCFA 1MNMC 2MSYA 4ZDLA 2K3FA 4A6EA 1EKEA 3LL7A 3M8JA 3G4SI 3HB9A 1P7IA 2K27A 5C44J 2DDBA 2V9VA 1ACIA 4S04A 1LUJB 2KL4A 2JRMA 4IJAA 2EILH 2FBHA 4HNUA 1T38A 4DZPA 1SFEA 4X0GA 2KRCA 4AVPA 2FXAA 3P5JA 4DNCA 4GFBA 1YE9A 1FOKA 1USTA 2QQAA 1R71A 1IDYA 1YG2A 2F4OB 3FXMA 3E5UA 4XLHA 2LF7A 5CVIA 1FYKA 4G9YA 2OQRA 2Q0OA 3V8LA 3KP4A 2LY2A 1K6OA 2QZ8A 3OR2C 1A04A 5FKOA 3ZCOA 1XSVA 3K0LA 1BR1A 1IXCA 2P0WA 1FLIA 2Y48A 4BEHB 3LQRA 1NG6A 1R5GA 3B73A 2X9DA 3ZRGA 4XICA 4XN3A 3QAHA 1J2XA 1X3ZB 4RMNA 3FX3A 5GAGJ 1AA7A 3R6SA 3K4LA 5HDKA 1TW2A 1HF0A 5D5XB 4BHBA 2GOMA 3JRBA 4AIKA 4BY1J 1T98A 5EZGA 3OYFA 4CO8A 1IJWC 2BE5F 4IXAA 5IT3A 2KLOA 2M45A 3TQNA 5FKMA 3E3VA 1YO5C 1V54H 2G0EA 4HX4A 5ED4A 2HR3A 1WQ2A 3ZOBA 3MKWB 4OU0A 3S17J 5LD2C 1L0OC 5HS7A 5CQEA 1N78A 1QA6A 1ZK8A 2ZMEB 4Y33A 4EGZA 2ME6A 1PUFA 4HA8A 1SD5A 5DV5A 1JE8A 2X6WA 1P7JA 1FZPB 4D9JA 2E2JJ 3IWZA 1P4XA 3N4MA 1RR8C 3K4BA 1GVDA 4JYKA 2GXAA 3PNYA 3PSIA 1ON1A 2G9WA 2FF4A 2L54A 1BIBA 5F1RA 1MH3A 2F4IA 2CV2A 2Y0MA 4MFEA 1BR4A 5HNHA 3E97A 3RTRA 3U2RA 4GRIA 1Q1HA 2X6OA 1UB9A 4BYYA 4CCLA 2HVQA 4CZZA 2MABA 2V1NA 2L5QA 3V8KA 1EF4A 2LBFA 3BG6A 5E79C 4Z2YA 2XAFA 2VIXA 4BQQA 1MBKA 3J7AY 1XDSA 4F7ZA 2EV6A 4XKWA 2ICWG 4XLFA 3Q5FA 4BACA 4LOCA 1HSJA 1OCCH 2BY3A 3FXUA 3IAM2 3RZDJ 4BQOA 2WTEA 3HSFA 1MMDA 3LA2A 3WE2A 2DYRH 1JJ8C 1O3QA 2X0LA 3M1CA 4I09A 4HG2A 4XORA 4KIBA 3RPQA 3GCMA 3RKYA 2TCTA 2WY7Q 2LD5A 4OIQF 3PL8A 2I10A 5HNFA 5ILUA 3DF8A 4JK1X 2G7HA 1EA3A 3C2GA 5EEAA 4A0XA 2BBYA 1UCRA 2Z1DA 3Q9VA 4M9XA 4OMYA 4NNJA 3A1YA 5CVVA 1HCRA 2ZXJA 1VQPI 2L9SA 5LEJA 2BGCA 3JAMK 4XRMA 3OIPA 2O8XA 4OIRF 2X4HA 3PM1A 1S6LA 4HRIA 5E18F 1T95A 2OCEA 3ECOA 2LG4A 3K69A 2Q2EB 3BTJA 4HQEA 4E7IA 4I2OA 4B43A 4KN7X 4RB1A 1K4SA 1BC7C 4CA0A 5K1YA 2P7CB 1XCVA 4BE2A 1O3SA 3HBLA 5D4RA 2GA2A 4XIDA 1WWXA 3OR1C 5GAEJ 5IOYA 3KPHA 1FOWA 4FCYA 1F36A 1MSFC 3DU6A 4M3DA 2XIGA 3JW4A 4MEYF 4XOPA 5KK1A 4DYCA 3OYEA 3CCSI 2TRTA 4ESJA 4IPAA 3VYRB 2DBBA 2K85A 3VDXA 1HW2A 2B0LA 3IHUA 2VKVA 3CP8A 5CVRA 3SFIA 2ECCA 2XASA 4MO7A 3NRVA 2VBWA 4HNVA 2R0QC 1V5EA 2GBYA 1ZG3A 1EV7A 3LSHA 1WI3A 4BU2A 4E7JA 1BR2A 2NXNB 4UB8C 3RJPA 2XAQA 3SZTA 3BZCA 2DT5A 1O7LA 3Q0UA 4MQVA 3S14J 2VT2A 3CJNA 3FMSA 1O3TA 3ISPA 4DYQA 4CH7A 5M5YJ 2VBYA 4A69C 2HOTA 2OCCH 3I9V2 2H8WA 1T0FA 3S8PA 1ETKA 4FETA 1R58A 2QBYA 2PI0A 2XPWA 4E7LA 1HW1A 4IKFA 2VN2A 5FRNA 3QPLA 1GT0C 2DFEA 1IN7A 1KONA 1MSEC 3GW2A 3QPSA 5FRMA 2X1DA 3E6CC 4UHTA 3S1QJ 2B9SA 1K78B 1MJAA 3TW6A 4BXUA 3KYLA 3S2DJ 2OU2A 1YYVA 1UMQA 1Z0XA 3FXQA 2HZTA 4GO1A 1JUSA 3HSRA 3OMYA 2XRLA 2ZO4A 3WU1B 5DYMA 4P55A 2JJ7A 1DPRA 2COMA 4NC6A 2OQGA 1N77A 2X6XA 1W1WE 2KP6A 1NHAA 4ENNA 4BXXJ 2R7TA 2D5VA 1I39A 2DTZA 2VKEA 1TQIA 2M87A 3CDHA 1TT5B 4EM0B 2R7UA 2YX7A 1S8NA 2LY1A 5LHIA 1AHDP 2K7LA 1JT6A 1IUFA 4GYIA 3RKXA 3VYUB 4F92B 2F48A 2IVMA 1I1GA 3GMEA 3HUGB 4EM2A 1YJ9I 1FIAA 5GPAA 5F27A 3JRGA 2GAUA 1ZR2A 3C1DA 1R22A 2L3DA 2P6TA 5HVQC 4OINF 4H4KC 4CYCA 4F91B 1MMGA 2OBPA 2OTLI 3LSRA 2HDWA 4E6KG 3QU6A 2V4JC 5EZHA 3DKWA 3CMMA 5AONA 1XSDA 2L7ZA 2LSOA 2WV1A 3BR5A 4KN4X 5DUIA 3JR9A 5J3LA 5JFRA 2EK5A 1D5YA 3GTGJ 2GIVA 2QQ8A 3GTOJ 4RGUA 3HOWJ 2LY9A 2K9QA 1E3PA 1U78A 2MH2A 1I3AA 3NWSA 4MLOA 4A2UA 3S1MJ 4AYBA 4A3KJ 5LHHA 1HDPA 2XVCA 1FY7A 3HDDA 2W4SA 3MKYB 1LQ1A 2BXZA 2YPRA 5CKTA 4YG2F 3VWBA 3K4JA 1YW7A 2KIQA 1E3HA 2YU9J 4JX4A 3CMYA 3RQIA 1DUXC 3FXRA 4A3IJ 4ITVA 2Q1ZB 3N05A 4AU7A 1WJ5A 2V1UA 1L3LA 2K02A 2WV0A 4UUSB 4Z6YA 3WTSC 3LSIA 3QOEA 3CJTB 4XRSG 4Y4RA 2WWYA 1MDMA 3IWFA 2FE3A 4KT6A 3S1NJ 3K1PA 3FBNB 1XMKA 3DQVC 2MH9A 1FT9A 1SVLA 1U5TA 2LKXA 3O3KA 2H6BA 3FKIJ 4KIFA 3KIOA 1KYWA 5J1RA 4XLPF 3I5UA 3OYCA 2PJPA 4RLQA 3LMMA 1Z6TA 3T1BA 2R93J 1YIOA 2J5OA 3VYSB 1W36D 5M3FJ 1Y1VJ 3PIPF 1LB2A 3KZYA 1PUEE 2W57A 2DTRA 1R1TA 5K7FA 1KU2A 2HOSA 3LSJA 3V7CA 3WGIA 2R5YA 4I76A 4IVNA 1PP8F 3CC4I 2CW7A 4G6TB 1WRJA 4CGZA 2ZKZA 2UXNA 4ZC3A 4B1RA 3IV5A 5JR3A 2DMNA 3VSLA 4AC0A 5KHDA 1P6RA 3G2BA 3FK7A 3OS1A 3J80Z 3EUHA 3I4NJ 4ENJA 1UG2A 4D5CA 1K83J 3CCLI 2RN7A 4XLNF 1V5GA 5DM7F 1FTTA 2EIKH 2M2EA 2V26A 1RRJA 2VOOA 1KYZA 5E3LA 2WC2A 3ROUA 4FE7A 4H0EA 1IO2A 1S5LC 3PFIA 3W3CA 1QPMA 1LNWA 4D5FA 4EATA 2HEOA 3AL0B 1BJZA 2DCEA 4AUXA 5KVRA 1G59A 3CO6C 2DFIA 2RREA 3FK6A 1B1BA 1IXRC 4EJWA 5LLQA 1D8JA 2BZTA 2EIJH 1KQ8A 2OPTA 2NNNA 2E71A 5AIQA 3QQAA 5H20A 2K86A 2XDVA 1IUYA 2LR8A 3AKZA 2WY8Q 4WX9A 5EEHA 4QLCU 1RKWA 2DODA 2IPQX 3H5AA 1S7AA 1KZHA 5KNLA 1JJ6C 5EJCA 2V79A 1S72I 1OR7C 2X48A 3CZ6A 3QU3A 1APLC 2E7WA 4KFCA 1DGWY 1M1EB 4BEHA 2L7KA 3C7JA 3HC7A 4PJLA 3OOPA 1BM9A 2COBA 3HPHA 1WHUA 2MC3A 2Z2SB 4UV8A 1GVJA 1I5ZA 4UUVA 2VLAA 4PJ0C 2FQ4A 1HKSA 3IH4A 3RCOA 1FX7A 5EGOA 1TWHJ 3M3YJ 4PGHA 2HDCA 4XKVA 3A01B 3CF2A 2DW4A 3F9KA 2XF6A 3OL3A 2BOLA 2BYVE 2FBIA 3BG9A 1Z7LA 3V4GA 2W1OA 3ZMVA 1JGSA 2MC4A 3K70D 2RNGA 3BG3A 2XC7A 4I6ZA 3OYDA 1D0XA 3K2ZA 1MNDA 3PFYA 5JLXA 2O9LA 3B02A 1FBSA 3MN2A 1F4KA 4U0WA 1V5FA 4XQFA 1BW5A 4PFPA 2W84A 3K10A 3CUQB 1MBHA 3HXLA 4QPOA 2GXGA 2ZMEA 4KA4A 1KU7A 4IL6C 4YFXF 5HLTA 3EYIA 3FWEA 4OWRB 4U7DA 4KNYA 4CSWA 1YS6A 1UZCA 4A3BJ 2P6SA 3F8CA 4MIMA 5FFZA 2PMHA 1AOYA 3O8GA 1QZYA 4S05A 1OMIA 4A93J 2PMZA 3CTAA 4ZYAA 4C2TA 2R7WA 2DT7B 3FXLA 1ON2A 3PJRA 5FLVA 4G7OF 2DLLA 1MBGA 2XPUA 1VQNI 5J4VA 1EH7A 1OPCA 1R5ID 1VQ6I 4RAYA 3J7AO 4WXCA 3SJMA 4IO9F 3JRAA 5FKLA 4N0BA 4B09A 2CV1A 3I71A 3CCRI 1TZLA 3GTMJ 1YJWI 1OCRH 3H36A 2HQNA 4WXDA 1J0RA 5H2FC 1IW7F 1J9IA 1I6HJ 3ZQQA 1KU9A 3WG7H 2R7QA 4M73A 4CCNA 4A6DA 1QO0D 1IN6A 2M7AA 3EYYA 1A6IA 2LH9A 2K4JA 3ZMZA 3CLOA 2JA5J 3F6OA 2XF7A 1SD7A 3C3WA 3OYJA 4DIQA 1J59A 4CXFA 4KDPA 3I59B 1X2NA 1B9MA 3X2QH 1G3TA 3I55I 2ZJ2A 4LG0A 3JRCA 2OF7A 5IP7J 2V6CA 2EZIA 3HOSA 2M1BA 4XNFA 1U2WA 3HSEA 3K4MA 1X1PA 2YUSA 3EUKL 1SC7A 4CUGA 1DDNA 1TWGJ 3I3LA 3HHGA 4LIUA 3Q9SA 2V1DA 4BY7J 1XMXA 1UAAA 1TBXA 3FIWA 1WZ2A 4M74A 4R8HA 3CCEI 1T56A 3ZMDA 1ETOA 4EM1A 1KU3A 1WJEA 2EFOA 1QZEA 1DP7P 1ZH5A 3JTHA 1STZA 1H9TA 4YFKF 1ETWA 3WGHA 4X6AJ 1ITYA 4PGGA 3H0DA 3EDPA 5ICGA 3WTYC 1EJ9A 1OYYA 3BG5A 2HYFA 2VUMJ 4RAFA 3RPUD 3HOVJ 4MHGA 4M71A 1Y39A 2CV0A 3HTUA 5D5VB 2I8DA 2IJLA 4I0BA 4HW0A 3SQNA 2FSWA 1BI3A 4U87A 2LREA 3S3OA 1A31A 1MGTA 2DQRA 2QYOA 1RUOA 2RQPA 1HDDC 2KIMA 5FLXZ 3RQ4A 3DFGA 3BG7A 4LLNA 3ASOH 4AIHA 1K61A 4XM3A 2O03A 3D1NI 2Y9ZA 2ZXHA 1S7EA 1I27A 4FHTA 2OD5A 1GDTA 3FMRA 5LGTA 3WHCA 2UWMA 3GWZA 2P5KA 2HFHA 1J09A 2A61A 3FXOA 2DYSH 1FBQA 1WFXA 2FU4A 3ZMSA 3BTLA 3AL0C 3BJ6A 3IP4B 3LWFA 2ECBA 3SHFA 1MH4A 4OAYA 2EZLA 3ABKH 3JSPA 5HS8A 4M6VA 4BJ5C 1NK3P 1C0WA 4Y15A 3BR2A 2FX0A 3PSFA 4BQNA 1B4AA 4MNUA 3GBGA 2E7XA 5GAHJ 4AYBN 4M6YA 1LDKB 2P7VB 3HOTA 4WWCA 4LB5A 2HTJA 2NVQJ 4XSXF 4KIGA 1ZG1A 1HXDA 2HI3A 2NS7A 3KZIC 4V2GA 1VQLI 3OYMA 3OYIA 1JUPA 2IS4A 5JHUA 1QHGA 3K2AA 4E7SA 1YRNA 3I54A 3A0HC 3KP2A 3L9FA 1CQTA 1Z77A 3Q0VA 2EFQA 1QU3A 3LA3A 1G6NA 3QWLA 3F21A 4LMYA 5TISC 1X3UA 4P9FA 4I0AA 4RA2A 4KMUX 2EWNA 5BPDA 2M0MA 1P2FA 4KICA 2IAIA 3TGNA 2STTA 1WKMA 2KPMA 3HGYA 1WJAA 3M7GA 1ZLJA 4B3AA 3C18A 1IDZA 2MA3A 2VJJA 3I58A 4E7HA 3OY9A 3WU0A 2KHMA 1RNLA 2ZC2A 3IAS2 3LOCA 1Y0UA 2FNPA 2EFNA 2NNYA 2CFOA 2NAZA 4F52A 1JKOC 4LLGF 3O8HA 5BQTA 5EG0A 2XGDA 4XL9A 2CUZA 2D1HA 3UNGC 1YX3A 1X19A 2FOKA 3ZQCA 2A05A 4XONA 3CUQC 1UG0A 2JWTA 3IL2A 1J5YA 3RPUA 1VQ4I 3ZN0A 2HYJA 3H92A 5DM6F 1ZKGA 1R9TJ 3DPUA 2HKXA 3BR6A 3F6VA 3LQQA 3F3XA 3BROA 1Y8QB 4IOAF 2QF7A 1XTAA 3G1LA 5HLGA 2JSCA 4UUSA 4G12A 3P7NA 1V55H 3DBRB 2X85A 2MYSA 1W7PD 3CESA 1XB4A 1MMNA 1R1UA 3KEYA 3ZQFA 3OS2A 1SFOJ 5ILSA 4LG3A 3W2AA 4NDLA 4MEXF 1U9OA 2DT6A 1POGA 4BQAA 1MMSA 2HNHA 4L0YB 4Q4ZF 3TKYA 1HKQA 2ME0A 1IC8A 3HOXJ 1TNSA 3WGGA 4CDGA 4M9ZA 3GUDA 2KFDA 3M4OJ 3HZJA 1BI2A 1BI1A 4UB6C 2HVRA 2VJ4A 2PX9A 3HKZA 3OYLA 3IC7A 2HPMA 2VJ5A 2XSDC 2X6YA 2KQRA 1TWFJ 2VT3A 5E1XA 4ZTFA 3W6JB 3DLAA 2CUJA 4N9IA 1ZRDA 1YLFA 4D7NA 2A68F 4NBQA 3C2BA 5DD4A 4QSHA 4U0VA 2Y2ZA 2LYCA 1HSTA 3TDZC 2GQQA 4KYWA 2O3FA 1HBXG 1B72B 2JSPA 4PFOA 3S93A 1QVUA 1D3YA 4G7ZF 2HDDA 2H1LA 2QSGX 2JA6J 4LJZF 2EFPA 4QTRA 1JKPC 1S9HA 4B3XA 4F3QA 2KRHA 2ACJA 2O0YA 3S3NA 2O61A 3CCYA 1Z21A 1XSXA 2H94A 3QYFA 2AXTC 3J81K 2O7OA 2CU7A 4ESBA 5FJ8J 3U21A 1UFMA 2BY2A 1F1ZA 1NK2P 2QGUA 1GHCA 1G3WA 3GZ6A 3I4MJ 3L7WA 4Y3OA 1RPWA 1TQPA 2WA0A 5B5EC 3COAC 4LK1F 4RS8A 1FTZA 1QZZA 4YIIA 2ZXWH 3RSNA 1R23A 1P4WA 4FX0A 1O7FA 3I4PA 1H0MA 1IZ1A 1LJ9A 3QPHA 3REOA 2V7FA 3C2HA 1ZRCA 2LC2A 2ZJQF 3HRTA 1HW5A 1MMAA 1KQ9A 3S2WA 3IRQA 2GWRA 4L5EA 2A07F 2DOFA 5D5UB 3LFUA 3GVAA 2HTSA 1XGSA 2Q8KA 3HPGA 3LSPA 4IRIA 3F8MA 3RKWA 2IS1A 5H6RA 1OQYA 4EJOA 3U1KA 1OCTC 1SVOA 2KIFA 3VB2A 2VBZA 3BOQA 3WTUC 3SEQA 2DA4A 3TP0A 2JA7J 2STWA 4ZDOA 1R4MB 5LRRA 3BP8A 4IHWA 2PMZN 5B1AH 2Y0SA 4KITB 2EV5A 5LRSA 2VC1A 1W7PA 5C4XJ 4F55A 2HOAA 4DW6A 3WTWC 1B59A 1ONVA 1UHMA 2HPIA 4DJAA 1ETYA 2CUFA 2GOXB 1I3QJ 3CJQB 2GXBA 2NVXJ 4JBAA 2R5ZA 4AVZA 2O8KA 2K5CA 2JA8J 5JI6A 5AIPA 4PJJA 4EVIA 2EH3A 2OC6A 3A4CA 1REPC 1D1CA 2R7FA 3M8EA 1O4XA 2M4GA 4HF0A 4RGRA 3JRHA 5TRDA 3MD2A 1E3OC 2L9NA 3LSMA 3D5SC 2MLKA 4B8XA 4YFNF 5FKNA 3B6CA 4WK8F 3WTTC 1MNEA 2IRFG 2DA5A 4L9VA 3GTKJ 3HYIA 3GZ5A 4M72A 3DWLE 3D5LA 3GTQJ 2MG4A 5J40A 2LRDA 3JSOA 4XLEA 2DQLA 3SEZA 4QIWN 4HF2A 1IRXA 2BV6A 3GLXA 4LD5A 1XGNA 1SAUA 3QYBA 4BJ6C 4ZZLA 1J75A 2H8RA 3W6VA 2RC4A 2DPDA 3U9GA 3DEUA 2FMYA 3A02A 2HVSA 3J81Z 4UVCA 3JAMZ 2KKOA 4IQ4A 3R0AA 2LP0A 3SZPA 2GIZA 2P5VA 1W5TA 1WJBA 2FUG2 2M0CA 2L9VA 5HDNA 1HA8A 2F5FA 4JX6A 2IBDA 2CMPA 1ZR4A 5HOOA 5BNGA 2NVYJ 4RAGA 5FROA 3PQKA 4N4NB 3NAUA 4RB0A 1GXQA 4AIDA 4ZJZA 2AS5F 1SVMA 2DFFA 2D1VA 2CQKA 4A3FJ 2BVMA 3ZR8X 3S16J 2PMUA 3MMYB 5J8FA 4RBOA 2KRFA 3Q0WA 2H27A 5LFAA 3F8FA 4IX7A 1CGPA 3P9KA 4YEJA 1XPXA 3KYDB 3G3ZA 2LFBA 2NS8A 1RC9A 3E6DA 4NC7A 2GZWA 3TO6A 2DA7A 3F22A 1G2HA 2IEKA 3I59A 5BPIA 2E2IJ 1W36C 4KISA 4HV5A 4IOCF 4EMSA 2A6TA 2L02A 5GADJ 2CRGA 4LGWA 1TWAJ 2CW0F 3CMAI 3OYAA 1BBYA 2ZBKA 3SXYA 3GXOA 3JRIA 1IG7A 1IN5A 2WB1N 4HDVA 5GP9A 1ZHFA 2XROA 5E8IA 5DEQA 1PUFB 2O6GE 1FBUA 2P81A 4RLFA 2HGCA 3TOAA 2A69F 2O5RA 1KGSA 2QVOA 4HAMA 5DCFA 1OKRA 4LFUA 2DI3A 3ABMH 3QRFF 3BR1A 1AKHB 2A5YB 3ECHA 4O3MA 3ASNH 1CF7B 3SZGA 2CFXA 1I6XA 1SD4A 2L4AA 1K4TA 2FQ3A 3CMEI 2IA0A 2V6EA 1NH3A 4Y7NJ 1ZGJA 2Y31A 3PO3J 2XGEA 4P5OA 2ZNYA 4W97A 3CO7C 1Z91A 3K4KA 2XAHA 4PCQA 2X1EA 3CCUI 3A0BC 4RM2A 2K9MA 3VYTB 3WG9A 4BDZA 5J8CA 2DU9A 2QENA 4ENKA 2UUZA 1U6GA 5ERIA 4G8XA 4LB6B 1YJNI 1DU6A 1VFCA 2Z99A 1YIJI 4BXFA 1JUMA 3WU2C 4HEA2 3QP6A 5B66C 3ABTA 4IHVA 5JLWA 2PLYA 4ZYEA 3HHHA 4BH9A 3Q3SA 1VI0A 1JXSA 2R7ZJ 2EA4A 3DV8A 2GM4A 3CP2A 1R36A 3UR3C 1WCMJ 4HBLA 3ULQB 1XDUA 4HZFA 4YRVA 2DAOA 1P9QC 3CUOA 2Y75A 3DTEA 5F08A 4BS9A 2XSJC 3LAPA 3K6GA 1VQ8I 1Q1VA 2OJED 3DU5A 4E4HA 3FKJA 5FKKA 3VOEA 5ILVA 2CQXA 2IGMA 1Z6RA 5EDNA 2W85A 3ZMTA 2FD5A 1FSEA 4G94A 3BR0A 4IHSA 4PSXA 3OL4A 1E0EA 2CQ7A 2VXDA 4C3JJ 1LPQA 5LBQA 2XB0X 2V1XA 3L2CA 2HQ5A 1QRYA 2R4GA 1TT0A 1LE8B 4DZJA 2XAGA 3TMOA 2LK2A 4GYGA 5FD6A 1HKTA 4M6XA 2AO9A 1O3RA 3K70C 2IA1A 5DCMB 2L4MA 3H9QA 3CCVI 1GV2A 1UHWA 3A2KA 2PN6A 3F23A 1E2XA 1K6YA 2R3SA 2LKPA 2BY0A 3VEPA 3ZQGA 2EJRA 4JP0A 1VQKI 2EIMH 2DMPA 4C30A 2KIUA 1V4RA 4XMYA 1EH8A 1R6RA 4A5MA 1XGMA 1XGOA 2DK5A 2E35A 3HKZN 1V3FA 1X1BA 2HKOA 3OYHA 3KFWX 4A0ZA 2ADUA 2F4MB 4RGXA 5DDGA 2YS9A 3IKTA 2ELJA 2XGXA 1XC5A 1MIJA 2KDZA 4HLXA 5FGMA 1YX5A 1TP4A 2LKSA 2UZKA 3UKGA 1MZBA 3IRRA 4YIRX 2W00A 1DPUA 1F43A 4G7HF 3KLNA 2CG4A 1GV5A 1IRZA 3L09A 2JMWA 3LFKA 1OLTA 2QLZA 1H89C 4II2A 1TC3C 1WSUA 2LDUA 2E60A 4HSTA 3V7RA 3HIFA 2V9KA 2Y69H 3V8JA 5FFXA 1A36A 2Z5UA 2MBFA 1VNDA 3KP6A 1IV6A 3MKLA 4HQMA 1USSA 4OMZA 4C3HJ 2D2WA 2ZJPF 3CCMI 4B44A 2G7UA 4N4OB 1BW6A 4BE1A 3DPLC 2M5WA 4AIJA 3H5NA 3RI4A 3GFJA 1RETA 2AQFA 4FX4A 3K7AJ 3V7SA 1G8XA 2VQGA 5L3BA 3FDYA 2K9NA 3EUAA 3BCAA 1FMWA 5BS6A 2WAQA 3OOUA 2EPFA 2A6HF 4XBFA 4A3MJ 1FJLA 1LFBA 1XD7A 5TJJA 2PG4A 1FOXA 3M1EA 4ZH4F 3FBIB 3CF5F 1JHFA 5HLHA 1JKQC 3MWMA 5J4YA 4CYCB 2RQQA 2IS6A 2JVHA 3FM5A 4YIFA 3EETA 2R7DA 1MBJA 2LMDA 2YX4A 1ERDA 1T08B 1BN5A 1JI8A 1ETVA 1KQ0A 2E1MC 2FA5A 5C4JJ 2KJCA 2VQHA 2AHQA 2L01A 2WAEA 4JOMA 1SFUA 5LGNA 3MFKA 2OV7A 5CYVA 3K4NA 3IH3A 3QODA 1LFUP 4C2UA 2Y0SN 4A0YA 1W4MA 3N97A 3KEOA 1FPQA 5D8LB 2E36A 4DBQA 1ZARA 3KZZA 2Q2EA 5CJ9A 3MVPA 1H8AC 2HOEA 1BI0A 2HXIA 2E19A 1S3JA 3F8NA 1QNTA 3ZXSA 5IYDJ 2ZNZA 3BTCA 2EV0A 1RR7A 3QOPA 2NRAC 3M8FA 2M4KA 2K9SA 2K40A 1TTYA 2VXZA 1XCBA 2HS5A 1U8RA 1N25A 2XAUA 1F9NA 3CC7I 2W24A 2EBIA 2QSFX 2CH0A 4OAZA 1YTYA 5A2QK 4BBRJ 2E2HJ 3HOZJ 4Y17A 3LSKA 1Z3XA 1MDMB 4LITA 4J00A 1I1SA 5CVJA 1OCPA 1PP7U 4HNTA 4D0PA 3TO7A 5K7ZA 2OZUA 2W25A 3MAJA 1NTCA 1U5TB 3OS0A 4BHPA 4CZCA 2RV8A 5F04A 3TL4X 4FQGA 4B4CA 3GLLA 4ZYHA 1G3SA 1G3YA 4BHCA 2CO5A 2L7FP 2EINH 4Q47A 5K5OA 2PJRB 2VPRA 1IF1A 4A5NA 1SANA 5CLSA 3S3MA 2ETHA 1BOAA 1ZGAA 1LVKA 3PO2J 2AXLA 3KX2A 4UXNA 3BC8A 1JTYA 4HLYA 1OCZH 2R5YB 4V2FA 4BKXA 1LKXA 2M3AA 1T39A 3DXJF 5L3GA 3AAFA 4I02A 3LSTA 4EJUA 4NB5A 2KMUA 1XS9A 1IAWA 2ID3A 4A12A 1K78A 3WTZA 2XPVA 2MW8A 2D45A 2VKHA 3SDBA 4V19K 2ISZA 2M8EA 5ICEA 5L3DA 3T8RA 4A3CJ 2BW3B 1MD0A 1YW9A 2BHZA 2WBMA 1ZN2A 3FXJA 2FOWA 4QWQA 5E3OA 1VQOI 4JQFA 3J7ZI 1Y6IA 1Y8RB 2QQBA 3KEQA 3S2HJ 2IP2A 1R4NB 4HOBA 2TDXA 4O5VA 2CQNA 3DPTA 4PDKA 2H1KA 1X3WB 2EB7A 4L9NA 2ESNA 3AG3H 1IN4A 4XR6A 3VPRA 4DBRA 3QYEA 1FWZA 3BQZA 1ZLKA 3CD6I 4E7ZA 4GCVA 5DD8A 4CCOA 1ZTRA 3L2QA 4PZJA 5IPAA 1ULYA 1WJFA 1ZREA 4I7HA 3RIRA 3HUGA 2BHYA 3W6KB 2IT0A 2CYYA 4JX5A 2DMQA 5IT9K 4L9JA 2P5LC 1D1AA 3L00A 1MJBA 4KUMA 3AFHA 1YQAA 1U8BA 1GLNA 1FYMA 5BMZA 1B8IB 4X1EA 3EPZA 5D6EA 1BJAA 2H6CA 5M5XJ 4EQQA 1X1CA 2A6EF 2JZYA 2ZFUA 4N9HA 1QPIA 1T0FC 3BJAA 3BY6A 1Z9CA 4UVBA 3BDDA 5HODA 3FM3A 1HOMA 3CCJI 5IOZA 3CQZJ 2DPUA 1VZ0A 3ESWB 5A2QZ 3KP5A 5E20A 4BGDA 1T8IA 4IZZA 1O57A 5EGOB 4M3EA 4HSRA 2OZ6A 3R0JA 3B6AA 4M9SA 1KA8A 1Z67A 2JUGA 3PQJA 3KETA 1XMAA 2AQEA 2P4WA 1YOVB 3F72A 5M3MJ 4LIVA 4HX8A 4XOTA 4BE0A 2Z9OA 1U0JA 4ZZDA 3HGGA 1H9GA 3KCCA 1ZGWA 2DXIA 4IQJA 1OISA 2DA1A 1TLHB 4UY8I 1DQUA 4XSZF 1YS7A 4KMFA 1D1BA 3BTIA 5EYRA 2MD0A 3JREA 4KJZA 1JTXA 2HZDA 5D8KB 2LTPA 2QM3A 4A3EJ 1A35A 1VQ7I 1WH7A 3HRMA 4HYEA 1SMYF 2QWWA 1AKHA 4C3IJ 2OTJI 2CUEA 1J7KA 2L7MP 5J1UA 1CF7A 4EJTA 1OFCX 2JPBA 2IS2A 2Z3YA 4RAZA 2K4BA 4P96A 4I98B 3FF5A 3S1RJ 2JTVA 2JN6A 4XN0A 2JT1A 3CLQA 1SD6A 5E8GA 4NHJA 2CW8A 2KZVA 3ZMUA 2X51A 3OYBA 4IRGA 4R1HA 3DEWA 3GFLA 1RIOH 4ASNA 2VODA 5LGUA 3HRSA 4NQWB 4A3LJ 3QP5A 2OAZA 3OYNA 1X4PA 4XRSA 4D1QA 1DGRM 3L2RA 4WF2A 2KISA 2BXYA 2NYXA 3DBHB 5D6FA 4W1UA 2K9LA 5ICFA 3RYPA 3CCQI 2LLKA 4CCJA 3P9CA 3GX4X 4RB3C 2XRNA 2CGPA 2L9RA 2EFWA 5TGTA 2F5CA 1IN8A 2DK8A 3MZYA 5IT9Z 2CQQA 1T33A 5IP6A 4MQ9F 5BOXA 1IGNA 2W82A 2R7RA 5E1ZB 2HU9A 2HWVA 3E7LA 5D4SA 2FMLA 3ML6A 3H5RA 2MFZA 1F5TA 2WADA 4P1WA 4F93B 4ESFA 1RUNA 4LG0B 3G73A 1X1DA 3BLYA 1U3EM 3NEUA 3BPVA 3ZQ7A 4MFDA 2JQ7A 2I5UA 3DP7A 3O2PE 2NS0A 6PAXA 4AD9A 1U5TC 1IRFA 2ESHA 3BPXA 4IRHA 1Y0NA 3T0YA 1A6QA 4GXOA 1LE8A 1R00A 3W2WA 1VQ9I 2IXSA 3G1OA 4L5JA 5DCMA 3MZ8A 2OA4A 2JPCA 3PUBA 3DLLF 4U88A 1BIAA 2FJ1A 2VE8A 2QCOA 2Y30A 3GZNB 3KP3A 3K1MA 4EEFG 2YSRA 2XB5A 4EGYA 3GTLJ 3L2VA 2VQCA 3D0SA 3K1NA 2ZFWA 5L3CA 2K3PA 3OYKA 5JHFA 4MGRA 4LLLA 2R7SA 1FIPA 3A01A 1GUUA 1E17A 3GYHX 2Y9YA 4UV9A 4DQ2A 3GEZA 1SEUA 3VFZA 2F2EA 3IUOA 2XKOA 2WAQN 1RZ4A 3ABLH 2LOOA 2XHKA 3TP3A 1R49A 3EUHC 3F8BA 3NWTA 3BZ6A 4BL0B 5D5WB 2L2OA 3BQYA 1LFPA 3IKVA 2CSOA 1OJLA 2CWEA 3R4KA 3LAJA 1D0ZA 2ZSHB 4PJMA 1X2MA 4ANJA 4MTEA 3ZQHA 2DJNA 2DOEA 2E5ZA 3MEXA 3PIOF 1JT0A 5E17F 2IGOA 3CUQA 4DGWB 5LEKA 3IH2A 4KT5C 4Q48A 2XF5A 5F64A 3LA7A 3ABUA 3I53A 2UV1A 3RDIA 3JCUC 1G4DA 3WHBA 1JHHA 3GF2A 2FBKA 4RDUA 3HRUA 1UJ8A 2XGCA 3H1CA 2CJJA 4IEJA 2PQ8A 4ZYDA 5JVTA 4II3A 1LEAA 1WGXA 1XX5A 1Z1DA 3M07A 4BNCA 3QPTA 5F0FA 4FASD 1YRNB 3FZVA 4LK0F 3LNQA 3H9GA 2N8GA 4P9UA 3ZQLA 1YW8A 1FNNA 3ELKA 2VQLA 5GPCA 3K4CA 2FEZA 3J80K 3FXKA 3SYTA 2ELHA 2HQRA 3MCZA 4E70A 3JRFA 2NVTJ 5IY5H 1IRGA 1VQ5I 2L0KA 2ZXIA 3FISA 3L2WA 4K2EA 3CC2I 3E6BA 3DBLB 3GTPJ 4GGGA 3TDUC 3V42A 2VOPA 1Z3YA 2W7NA 1K7AA 1QBJA 3HL2A 1S29A 1TQMA 3G71I 1SFXA 4M3FA 2NVUB 2Z33A 1PJRA 4ZYGA 3OV8A 3G6EI 5EG0B 4HPQA 2E1MB 3AG2H 1DU0A 3ZP5A 3ERED 4UVAA 4PSWA 2RDPA 4FE4A 2F5DA 3AG4H 4EJVA 1HC8A 4DYRA 4ENMA 2YU3A 3G1MA 3FHZA 3BZKA 1X1AA 2ZMEC 2E1CA 1ETXA 2M34A 2EZHA 4IHTA 3E6MA 4M3GA 5JVGF 2VASA 3F0CA 3DEEA 2NOJB 5DS9A 5FLMJ 3GFIA 4L0ZB 1U9NA 3AG1H 3TW7A 2VE9A 4O6JA 2R92J 1ENHA 4WCGA 2MD5A 4OIPF 4UUTA 1LEBA 2BY1A 3JTGA 3WTXC 1I50J 1Z7UA 1Z05A 4ZDPA 2R7OA 3HM5A 3E1SA 5H6QA 4IHXA 4S0HB 3GFMA 5E3NA 1N75A 3ONQA 1JGGA 4E7KA 1HLVA 4MTDA 4XKBA 5HDGA 5L3FA 5IYCJ 3E5QA 1R5HA 2F6CA 2FRHA 4WXHA 2DA2A 3GO5A 4B47A 3H35A 4CICA 3H0GJ 2KJBA 4L5IA 2LBFB 2M7BA 4FT8A 4XLAA 1NG7A 2B7EA 2HYGD 1FYLA 2VONA 3HOYJ 4AWXB 4HDUA 3OSGA 2DN0A 4XK4A 2ZSIB 2QUFA 1LDDA 3HG9A 2VL8A 3RYRA 3TBIA 5ICCA 3WTVC 4XRFA 2R7XA 3KE2A 1Y1WJ 2F5EA 2LVSA 2OUMA 3RZOJ 4C2MJ 2MGQA 3H3ZA 3HEFA 2LF8A 3L2UA 1JKRC 3D5RC 3TOBA 2PEXA 5F0HA 3A03A 3JRDA 2QQ9A 4BUPA 1WJDA 3DKYA 1W0UA 1RI7A 2HQAA 1ZG5A 2E34A 4IF4A 2ZB9A 1WJCA 5CVUA 3W2VA 2B63J 1Y56A 4OOIA 5J47A 5F6FA 3M9AA 5LHGA 1WH5A 2BW3A 1LDJA 5KCMA 1QGPA 2RKHA 4XKCA 1FEXA 2H09A 1D8KA 2UXXA 1WVRA 3FHNA 3MZHA 1GXPA 3E0JB 3HJEA 5HLIA 2Z16A 4A3GJ 5M5WJ 4PUSA 1ZQ3P 2EA2A 1P92A 4QPQA 3VSKA 2V9PA 3FMQA 1FSHA 2JRTA 1TW3A 1TWCJ 3S15J 2C6YA 3E5XA 3OIOA 1XN7A 1ZRFA 3PUFA 2F5VA 1VTNC 4YELA 1P4AA 2JK3A 4L18B 5J6XA 2RGVA 1ZAOA 1RESA 3KLOA 5K7HA 2QA4I 1FP2A 4OIOF 1OCOH 1K79A 5C3EJ 3I0TA 1OYWA 4BBSJ 2DJIA 1TL8A 3MQ0A 3CDIA 4HV6A 1B8IA 4NUBA 1T2KA 4A3JJ 3SFZA 3K9TA 3KP7A 4CYDA 1R1VA 3NQOA 2QEXI 5IYBJ 1W5CC 3WE3A 1UHSA 1ODDA 5CPRB 5B3SH 1MJ9A 3ZN1A 1IXSB 4CCKA 1W7PB 2QBYB 2QSHX 3BT9A 2QKMB 2VI6A 4J19A 3LSGA 4HX7A 1D0YA 2WAFA 1QVTA 4BAYA 2XKPA 3BR3A 2R5ZB 1MKMA 5K5QA 2XUBA 5CQGA 1AU7A 1LVAA 4IHYA 2XV4S 1XG1A 2DMTA 4PJNA 1B6AA 2E5NA 4R79A 4ON0A 3PNVA 3T8TA 3MKZA 3RKQA 2VBXA 4G6QA 5E1WA 3DTIA
chains in the Genus database with same CATH topology
3HTSB 2YR2A 2A3SA 4G6DA 1B9NA 2ISYA 2DO7A 1AWCA 5HS9A 5FLXK 1QQIA 1S7OA 4I01A 4RB2C 3R60A 1D5VA 5DUKA 2RNJA 3BWGA 1SMTA 2P8TA 3H3UA 3O6BB 4RGSA 3I64A 4CHUA 2XAJA 5FO5A 1TNTA 1ZYRF 3EQLF 4NQWA 1YFHA 4TV7A 4U0YA 3U1DA 2MLGA 4U7BA 4L9TA 2LNBA 1FP1D 4Y13A 3P9IA 2M30A 4ETSA 5EEGA 2PFBA 2GA1A 1SAXA 2FNAA 2RVCA 3R61A 1BC8C 2VC0A 1W5SA 2BEOA 3BJOA 3TO9A 3ZPLA 1HQCA 4UNOA 3VODA 5FD5A 2PBIA 1OYIA 2ZCWA 2J5PA 4HF1A 1T6SA 1EH6A 1PDNC 4Q5SF 1OR7A 5L3EA 2E1NA 5K5RA 3WODF 2IW5A 3T5XA 2IA2A 1FC3A 1R7JA 5FB2A 1WI9A 4A6EA 2K27A 2V9VA 4S04A 4IJAA 2FBHA 1T38A 1SFEA 4AVPA 2FXAA 4DNCA 1FOKA 1USTA 2QQAA 1YG2A 3E5UA 1FYKA 2LF7A 5CVIA 4G9YA 2OQRA 2Q0OA 3V8LA 3KP4A 1K6OA 2QZ8A 1A04A 1XSVA 3K0LA 1IXCA 1FLIA 2Y48A 3LQRA 1R5GA 3B73A 3QAHA 1J2XA 3FX3A 3R6SA 5HDKA 1TW2A 5D5XB 4BHBA 4AIKA 1T98A 4CO8A 2BE5F 4IXAA 5IT3A 2M45A 3TQNA 3E3VA 1YO5C 4HX4A 5ED4A 2HR3A 1WQ2A 4OU0A 1L0OC 5HS7A 2ZMEB 4EGZA 4HA8A 1SD5A 5DV5A 1JE8A 1FZPB 3IWZA 1P4XA 3N4MA 1ON1A 2G9WA 2FF4A 2L54A 1BIBA 5F1RA 2Y0MA 3E97A 3RTRA 3U2RA 1Q1HA 1UB9A 4BYYA 4CZZA 3V8KA 4Z2YA 2XAFA 1XDSA 4F7ZA 2EV6A 3Q5FA 1HSJA 3FXUA 2WTEA 3HSFA 3LA2A 3WE2A 1O3QA 2X0LA 4I09A 4KIBA 3RPQA 3RKYA 4OIQF 5ILUA 3DF8A 4JK1X 2G7HA 4A0XA 2BBYA 1UCRA 3Q9VA 4M9XA 4OMYA 5CVVA 2ZXJA 5LEJA 2BGCA 3JAMK 2O8XA 4OIRF 2X4HA 1S6LA 5E18F 3ECOA 3K69A 4HQEA 4I2OA 4KN7X 4RB1A 1BC7C 5K1YA 2P7CB 1XCVA 1O3SA 5D4RA 2GA2A 1WWXA 2XIGA 3JW4A 4MEYF 5KK1A 4ESJA 4IPAA 2DBBA 1HW2A 2B0LA 3IHUA 5CVRA 2XASA 3NRVA 2VBWA 1ZG3A 1EV7A 3RJPA 2XAQA 3SZTA 2DT5A 1O7LA 4MQVA 2VT2A 3CJNA 3FMSA 1O3TA 3ISPA 2VBYA 1T0FA 1R58A 2QBYA 2PI0A 1HW1A 2VN2A 1IN7A 3GW2A 3E6CC 4UHTA 1K78B 1MJAA 4BXUA 2OU2A 1YYVA 3FXQA 2HZTA 4GO1A 3HSRA 3WU1B 2ZO4A 5DYMA 4P55A 1DPRA 2COMA 2OQGA 1NHAA 4ENNA 1TQIA 2M87A 3CDHA 4EM0B 2YX7A 1S8NA 5LHIA 2K7LA 4GYIA 3RKXA 2IVMA 1I1GA 4EM2A 2GAUA 3C1DA 1R22A 2L3DA 2P6TA 5HVQC 4OINF 2OBPA 3QU6A 3DKWA 5AONA 1XSDA 4KN4X 2LSOA 5DUIA 5JFRA 2EK5A 2GIVA 4RGUA 1U78A 2MH2A 4A2UA 5LHHA 2XVCA 1FY7A 1LQ1A 2YPRA 4YG2F 1YW7A 1DUXC 3FXRA 2V1UA 1L3LA 2K02A 2WV0A 3WTSC 2WWYA 1MDMA 3IWFA 2FE3A 3K1PA 1XMKA 3DQVC 2MH9A 1FT9A 1U5TA 3O3KA 2H6BA 4KIFA 1KYWA 4XLPF 3I5UA 2PJPA 1Z6TA 3T1BA 1YIOA 2J5OA 1LB2A 3KZYA 1PUEE 2W57A 2DTRA 1R1TA 1KU2A 3V7CA 3WGIA 4IVNA 1PP8F 1WRJA 4CGZA 2ZKZA 2UXNA 5JR3A 1P6RA 3J80Z 3EUHA 4ENJA 2RN7A 4XLNF 2VOOA 1KYZA 2WC2A 3ROUA 4H0EA 3PFIA 1QPMA 1LNWA 2HEOA 5KVRA 3CO6C 2DFIA 1B1BA 1IXRC 4EJWA 5LLQA 1D8JA 1KQ8A 2NNNA 5AIQA 5H20A 2K86A 1IUYA 4WX9A 5EEHA 4QLCU 2IPQX 1S7AA 2V79A 3QU3A 2E7WA 4KFCA 3C7JA 3OOPA 1BM9A 2MC3A 4UV8A 1GVJA 1I5ZA 4UUVA 1HKSA 1FX7A 4PGHA 2HDCA 2DW4A 2BYVE 2FBIA 3V4GA 3ZMVA 1JGSA 3K2ZA 3B02A 1FBSA 1F4KA 4U0WA 2W84A 3CUQB 2GXGA 2ZMEA 4KA4A 1KU7A 4YFXF 3EYIA 3FWEA 4U7DA 4KNYA 1YS6A 2P6SA 3F8CA 5FFZA 2PMHA 1AOYA 1QZYA 4S05A 1OMIA 3CTAA 1ON2A 4G7OF 2DLLA 1EH7A 1OPCA 4RAYA 3J7AO 4WXCA 4N0BA 4B09A 3I71A 4WXDA 2HQNA 1J0RA 1IW7F 1J9IA 1KU9A 4M73A 4A6DA 1QO0D 1IN6A 3EYYA 2K4JA 3ZMZA 3CLOA 3F6OA 1SD7A 3C3WA 1J59A 4CXFA 4KDPA 3I59B 1B9MA 1G3TA 2ZJ2A 4LG0A 2V6CA 3HOSA 2M1BA 1U2WA 3HSEA 1DDNA 3HHGA 3Q9SA 2V1DA 1TBXA 4M74A 4R8HA 3ZMDA 4EM1A 1KU3A 2EFOA 1DP7P 1ZH5A 3JTHA 1STZA 1H9TA 4YFKF 3WGHA 4PGGA 3EDPA 5ICGA 3WTYC 1OYYA 2HYFA 4MHGA 4M71A 3HTUA 5D5VB 2IJLA 4I0BA 4HW0A 3SQNA 2FSWA 1BI3A 1MGTA 2DQRA 2QYOA 1RUOA 2RQPA 2KIMA 5FLXZ 3DFGA 4LLNA 4AIHA 2O03A 1I27A 4FHTA 2OD5A 3FMRA 5LGTA 2UWMA 3GWZA 2P5KA 2HFHA 2A61A 1FBQA 2FU4A 3ZMSA 3BJ6A 3LWFA 3SHFA 3JSPA 5HS8A 1C0WA 4Y15A 1B4AA 4MNUA 2E7XA 4M6YA 1LDKB 2P7VB 3HOTA 4WWCA 4LB5A 2HTJA 4XSXF 4KIGA 1ZG1A 1HXDA 5JHUA 3I54A 3KP2A 3L9FA 2EFQA 3LA3A 1G6NA 3F21A 4LMYA 1X3UA 4P9FA 4I0AA 4KMUX 2EWNA 5BPDA 1P2FA 4KICA 3TGNA 2STTA 1WKMA 3M7GA 1ZLJA 3C18A 2MA3A 3I58A 3WU0A 1RNLA 1Y0UA 2FNPA 2EFNA 2NNYA 2NAZA 4LLGF 5BQTA 2D1HA 2FOKA 3CUQC 3IL2A 1J5YA 3RPUA 3ZN0A 3H92A 2HKXA 3F6VA 3LQQA 3F3XA 3BROA 5HLGA 2JSCA 3P7NA 1W7PD 1XB4A 1R1UA 5ILSA 4MEXF 4BQAA 4L0YB 4Q4ZF 3TKYA 1HKQA 1TNSA 3WGGA 4CDGA 4M9ZA 3GUDA 1BI2A 1BI1A 3IC7A 2VT3A 5E1XA 3W6JB 1ZRDA 4N9IA 1YLFA 2A68F 5DD4A 4U0VA 1HSTA 3TDZC 2GQQA 4KYWA 2O3FA 1HBXG 1D3YA 4G7ZF 4LJZF 2EFPA 2ACJA 2O0YA 2O61A 2H94A 1XSXA 3J81K 4ESBA 1UFMA 1F1ZA 1GHCA 1G3WA 3GZ6A 3L7WA 1TQPA 3COAC 4RS8A 4LK1F 1QZZA 4YIIA 1R23A 1P4WA 4FX0A 1O7FA 3I4PA 1H0MA 1IZ1A 1LJ9A 3QPHA 3REOA 1ZRCA 3HRTA 1HW5A 1KQ9A 3S2WA 3IRQA 2GWRA 2A07F 5D5UB 3GVAA 2HTSA 1XGSA 2Q8KA 4IRIA 3F8MA 3RKWA 5H6RA 4EJOA 2KIFA 3VB2A 2VBZA 3BOQA 3WTUC 2STWA 5LRRA 3BP8A 2EV5A 5LRSA 2VC1A 1W7PA 3WTWC 1B59A 1ONVA 1UHMA 2GXBA 4JBAA 5JI6A 5AIPA 4EVIA 1REPC 2R7FA 3M8EA 4HF0A 4RGRA 5TRDA 2MLKA 4B8XA 4YFNF 4WK8F 3WTTC 2IRFG 4L9VA 3HYIA 3GZ5A 4M72A 3D5LA 3JSOA 2DQLA 2BV6A 3GLXA 4LD5A 1XGNA 4ZZLA 4HF2A 1J75A 2RC4A 2DPDA 3U9GA 3DEUA 2FMYA 3J81Z 4UVCA 3JAMZ 2KKOA 3R0AA 3SZPA 2P5VA 1W5TA 5HDNA 2F5FA 5HOOA 3PQKA 4RB0A 1GXQA 2AS5F 2D1VA 2CQKA 2PMUA 5J8FA 2KRFA 2H27A 3F8FA 1CGPA 3P9KA 3G3ZA 3E6DA 2GZWA 3TO6A 3F22A 3I59A 5BPIA 4HV5A 4EMSA 2L02A 4LGWA 2CW0F 1BBYA 2ZBKA 3SXYA 3GXOA 1IN5A 4HDVA 1ZHFA 2XROA 5E8IA 5DEQA 2O6GE 1FBUA 2HGCA 3TOAA 2A69F 2QVOA 1KGSA 4HAMA 5DCFA 1OKRA 4LFUA 2DI3A 3QRFF 4O3MA 2A5YB 3ECHA 1CF7B 2CFXA 1I6XA 1SD4A 2L4AA 2FQ3A 2IA0A 1ZGJA 4P5OA 2ZNYA 3CO7C 1Z91A 2XAHA 4PCQA 3WG9A 5J8CA 2DU9A 2QENA 4ENKA 1U6GA 5ERIA 4G8XA 4LB6B 2Z99A 3QP6A 3ABTA 2PLYA 4ZYEA 3HHHA 4BH9A 1JXSA 2EA4A 3DV8A 1R36A 4HBLA 3ULQB 1XDUA 4HZFA 2DAOA 3CUOA 2Y75A 3LAPA 3VOEA 5ILVA 1Z6RA 2W85A 3ZMTA 1FSEA 4G94A 4IHSA 5LBQA 2V1XA 3L2CA 2XAGA 4GYGA 5FD6A 1HKTA 4M6XA 1O3RA 2IA1A 5DCMB 2L4MA 1UHWA 2PN6A 3F23A 1E2XA 2R3SA 2LKPA 3VEPA 2EJRA 2KIUA 1V4RA 1EH8A 4A5MA 1XGMA 1XGOA 2DK5A 1V3FA 2HKOA 3KFWX 4A0ZA 2ADUA 4RGXA 5DDGA 3IKTA 2XGXA 4HLXA 5FGMA 2UZKA 1MZBA 3IRRA 1DPUA 4G7HF 3KLNA 2CG4A 3L09A 3LFKA 2QLZA 1WSUA 2LDUA 3V7RA 3HIFA 3V8JA 5FFXA 2Z5UA 2MBFA 3KP6A 4HQMA 1USSA 4OMZA 2D2WA 2G7UA 3DPLC 2M5WA 4AIJA 3RI4A 3GFJA 4FX4A 3V7SA 5L3BA 5BS6A 2A6HF 4XBFA 1XD7A 5TJJA 2PG4A 3M1EA 4ZH4F 1JHFA 5HLHA 3MWMA 3FM5A 4YIFA 3EETA 2R7DA 2YX4A 1BN5A 1KQ0A 2FA5A 2KJCA 2L01A 1SFUA 5LGNA 3MFKA 5CYVA 4A0YA 1W4MA 3N97A 3KEOA 1FPQA 5D8LB 1ZARA 3KZZA 2Q2EA 5CJ9A 2HOEA 1BI0A 1S3JA 3F8NA 1QNTA 2ZNZA 2EV0A 3QOPA 2NRAC 3M8FA 1TTYA 2VXZA 1XCBA 2HS5A 1U8RA 1F9NA 2W24A 1YTYA 5A2QK 4Y17A 1MDMB 1I1SA 5CVJA 1PP7U 4D0PA 3TO7A 2OZUA 2W25A 3MAJA 1U5TB 4BHPA 2RV8A 4ZYHA 1G3SA 1G3YA 4BHCA 2CO5A 4Q47A 5K5OA 1IF1A 4A5NA 5CLSA 2ETHA 1BOAA 1ZGAA 2AXLA 4UXNA 4HLYA 1T39A 3DXJF 5L3GA 3AAFA 4I02A 3LSTA 4EJUA 4NB5A 1IAWA 4A12A 1K78A 3WTZA 2D45A 2ISZA 2M8EA 5ICEA 5L3DA 3T8RA 1MD0A 1YW9A 1ZN2A 4QWQA 4JQFA 2QQBA 3KEQA 2IP2A 4HOBA 2TDXA 4O5VA 3DPTA 4PDKA 2EB7A 4L9NA 2ESNA 1IN4A 1FWZA 1ZLKA 4GCVA 5DD8A 4PZJA 1ULYA 1ZREA 4I7HA 3RIRA 3HUGA 3W6KB 2IT0A 2CYYA 5IT9K 4L9JA 2P5LC 3L00A 1MJBA 4KUMA 1YQAA 1FYMA 5BMZA 5D6EA 1BJAA 2H6CA 4EQQA 2A6EF 2JZYA 4N9HA 3BJAA 3BY6A 1Z9CA 4UVBA 3BDDA 3FM3A 2DPUA 5A2QZ 3KP5A 5E20A 1O57A 2OZ6A 3R0JA 4M9SA 1KA8A 3PQJA 3KETA 1XMAA 2P4WA 3F72A 4HX8A 2Z9OA 4ZZDA 1H9GA 3KCCA 1TLHB 4XSZF 1YS7A 4KMFA 5D8KB 2QM3A 3HRMA 4HYEA 1SMYF 2QWWA 4EJTA 1J7KA 1CF7A 2JPBA 2Z3YA 4RAZA 2K4BA 4P96A 4I98B 3FF5A 2JTVA 2JT1A 1SD6A 5E8GA 4NHJA 3ZMUA 4IRGA 4R1HA 3GFLA 1RIOH 4ASNA 2VODA 5LGUA 3HRSA 3QP5A 2OAZA 4WF2A 2NYXA 5D6FA 5ICFA 3RYPA 3P9CA 3GX4X 4RB3C 2XRNA 2CGPA 2EFWA 2F5CA 1IN8A 2DK8A 3MZYA 5IT9Z 5BOXA 4MQ9F 5E1ZB 2HWVA 5D4SA 2FMLA 3ML6A 1F5TA 4ESFA 1RUNA 4LG0B 3G73A 1U3EM 3NEUA 3BPVA 3ZQ7A 3O2PE 3DP7A 2NS0A 6PAXA 4AD9A 1U5TC 1IRFA 2ESHA 3BPXA 4IRHA 3T0YA 4GXOA 1R00A 4L5JA 5DCMA 2OA4A 2JPCA 4U88A 1BIAA 2VE8A 3KP3A 4EGYA 3K1MA 2YSRA 3D0SA 3K1NA 2ZFWA 5L3CA 4MGRA 4LLLA 1E17A 3GYHX 4UV9A 4DQ2A 3GEZA 3VFZA 2F2EA 2XKOA 1RZ4A 2XHKA 3F8BA 3BZ6A 5D5WB 3IKVA 2CSOA 2CWEA 3R4KA 3LAJA 4MTEA 5E17F 3MEXA 3CUQA 5LEKA 4KT5C 4Q48A 5F64A 3LA7A 3ABUA 3I53A 3RDIA 1G4DA 1JHHA 3GF2A 2FBKA 3HRUA 2PQ8A 4ZYDA 5JVTA 1LEAA 1Z1DA 4BNCA 3QPTA 3FZVA 4LK0F 4P9UA 1YW8A 1FNNA 3ELKA 3J80K 2FEZA 2ELHA 2HQRA 3MCZA 4E70A 1IRGA 4K2EA 3E6BA 4GGGA 3TDUC 2VOPA 1K7AA 1QBJA 1S29A 1TQMA 1SFXA 2Z33A 4ZYGA 3OV8A 3ZP5A 3ERED 4UVAA 2RDPA 2F5DA 4EJVA 4ENMA 2YU3A 3FHZA 2E1CA 4IHTA 3E6MA 3GFIA 4L0ZB 2VE9A 4O6JA 4WCGA 2MD5A 4OIPF 1LEBA 3JTGA 3WTXC 1Z7UA 1Z05A 5H6QA 3GFMA 4MTDA 5HDGA 5L3FA 3E5QA 1R5HA 2FRHA 4WXHA 3GO5A 4CICA 2KJBA 4L5IA 4FT8A 2HYGD 1FYLA 2VONA 4AWXB 4HDUA 2QUFA 1LDDA 3RYRA 5ICCA 3WTVC 4XRFA 3KE2A 2F5EA 3H3ZA 2LF8A 3TOBA 2PEXA 2QQ9A 1RI7A 1ZG5A 4IF4A 5CVUA 4OOIA 5F6FA 3M9AA 5LHGA 1LDJA 1QGPA 2RKHA 2H09A 1D8KA 2UXXA 3MZHA 1GXPA 5HLIA 2EA2A 1P92A 3FMQA 1FSHA 2JRTA 1TW3A 2C6YA 3E5XA 1XN7A 1ZRFA 1VTNC 1P4AA 4L18B 5J6XA 2RGVA 1ZAOA 3KLOA 1FP2A 4OIOF 1K79A 3I0TA 1OYWA 3MQ0A 4HV6A 1T2KA 3SFZA 3K9TA 3KP7A 4CYDA 1R1VA 3NQOA 3WE3A 1ODDA 1MJ9A 3ZN1A 1IXSB 1W7PB 2QBYB 4HX7A 4BAYA 2XKPA 1MKMA 5K5QA 2XUBA 1LVAA 2XV4S 1B6AA 4R79A 4ON0A 3T8TA 2VBXA 4G6QA 5E1WA 4EV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTS B;  2YR2 A;  2A3S A;  4G6D A;  1B9N A;  2ISY A;  2DO7 A;  1AWC A;  5HS9 A;  5FLX K;  1QQI A;  1S7O A;  4I01 A;  4RB2 C;  3R60 A;  1D5V A;  5DUK A;  2RNJ A;  3BWG A;  1SMT A;  2P8T A;  3H3U A;  3O6B B;  4RGS A;  3I64 A;  4CHU A;  2XAJ A;  5FO5 A;  1TNT A;  1ZYR F;  3EQL F;  4NQW A;  1YFH A;  4TV7 A;  4U0Y A;  3U1D A;  2MLG A;  4U7B A;  4L9T A;  2LNB A;  1FP1 D;  4Y13 A;  3P9I A;  2M30 A;  4ETS A;  5EEG A;  2PFB A;  2GA1 A;  1SAX A;  2FNA A;  2RVC A;  3R61 A;  1BC8 C;  2VC0 A;  1W5S A;  2BEO A;  3BJO A;  3TO9 A;  3ZPL A;  1HQC A;  4UNO A;  3VOD A;  5FD5 A;  2PBI A;  1OYI A;  2ZCW A;  2J5P A;  4HF1 A;  1T6S A;  1EH6 A;  1PDN C;  4Q5S F;  1OR7 A;  5L3E A;  2E1N A;  5K5R A;  3WOD F;  2IW5 A;  3T5X A;  2IA2 A;  1FC3 A;  1R7J A;  5FB2 A;  1WI9 A;  4A6E A;  2K27 A;  2V9V A;  4S04 A;  4IJA A;  2FBH A;  1T38 A;  1SFE A;  4AVP A;  2FXA A;  4DNC A;  1FOK A;  1UST A;  2QQA A;  1YG2 A;  3E5U A;  1FYK A;  2LF7 A;  5CVI A;  4G9Y A;  2OQR A;  2Q0O A;  3V8L A;  3KP4 A;  1K6O A;  2QZ8 A;  1A04 A;  1XSV A;  3K0L A;  1IXC A;  1FLI A;  2Y48 A;  3LQR A;  1R5G A;  3B73 A;  3QAH A;  1J2X A;  3FX3 A;  3R6S A;  5HDK A;  1TW2 A;  5D5X B;  4BHB A;  4AIK A;  1T98 A;  4CO8 A;  2BE5 F;  4IXA A;  5IT3 A;  2M45 A;  3TQN A;  3E3V A;  1YO5 C;  4HX4 A;  5ED4 A;  2HR3 A;  1WQ2 A;  4OU0 A;  1L0O C;  5HS7 A;  2ZME B;  4EGZ A;  4HA8 A;  1SD5 A;  5DV5 A;  1JE8 A;  1FZP B;  3IWZ A;  1P4X A;  3N4M A;  1ON1 A;  2G9W A;  2FF4 A;  2L54 A;  1BIB A;  5F1R A;  2Y0M A;  3E97 A;  3RTR A;  3U2R A;  1Q1H A;  1UB9 A;  4BYY A;  4CZZ A;  3V8K A;  4Z2Y A;  2XAF A;  1XDS A;  4F7Z A;  2EV6 A;  3Q5F A;  1HSJ A;  3FXU A;  2WTE A;  3HSF A;  3LA2 A;  3WE2 A;  1O3Q A;  2X0L A;  4I09 A;  4KIB A;  3RPQ A;  3RKY A;  4OIQ F;  5ILU A;  3DF8 A;  4JK1 X;  2G7H A;  4A0X A;  2BBY A;  1UCR A;  3Q9V A;  4M9X A;  4OMY A;  5CVV A;  2ZXJ A;  5LEJ A;  2BGC A;  3JAM K;  2O8X A;  4OIR F;  2X4H A;  1S6L A;  5E18 F;  3ECO A;  3K69 A;  4HQE A;  4I2O A;  4KN7 X;  4RB1 A;  1BC7 C;  5K1Y A;  2P7C B;  1XCV A;  1O3S A;  5D4R A;  2GA2 A;  1WWX A;  2XIG A;  3JW4 A;  4MEY F;  5KK1 A;  4ESJ A;  4IPA A;  2DBB A;  1HW2 A;  2B0L A;  3IHU A;  5CVR A;  2XAS A;  3NRV A;  2VBW A;  1ZG3 A;  1EV7 A;  3RJP A;  2XAQ A;  3SZT A;  2DT5 A;  1O7L A;  4MQV A;  2VT2 A;  3CJN A;  3FMS A;  1O3T A;  3ISP A;  2VBY A;  1T0F A;  1R58 A;  2QBY A;  2PI0 A;  1HW1 A;  2VN2 A;  1IN7 A;  3GW2 A;  3E6C C;  4UHT A;  1K78 B;  1MJA A;  4BXU A;  2OU2 A;  1YYV A;  3FXQ A;  2HZT A;  4GO1 A;  3HSR A;  3WU1 B;  2ZO4 A;  5DYM A;  4P55 A;  1DPR A;  2COM A;  2OQG A;  1NHA A;  4ENN A;  1TQI A;  2M87 A;  3CDH A;  4EM0 B;  2YX7 A;  1S8N A;  5LHI A;  2K7L A;  4GYI A;  3RKX A;  2IVM A;  1I1G A;  4EM2 A;  2GAU A;  3C1D A;  1R22 A;  2L3D A;  2P6T A;  5HVQ C;  4OIN F;  2OBP A;  3QU6 A;  3DKW A;  5AON A;  1XSD A;  4KN4 X;  2LSO A;  5DUI A;  5JFR A;  2EK5 A;  2GIV A;  4RGU A;  1U78 A;  2MH2 A;  4A2U A;  5LHH A;  2XVC A;  1FY7 A;  1LQ1 A;  2YPR A;  4YG2 F;  1YW7 A;  1DUX C;  3FXR A;  2V1U A;  1L3L A;  2K02 A;  2WV0 A;  3WTS C;  2WWY A;  1MDM A;  3IWF A;  2FE3 A;  3K1P A;  1XMK A;  3DQV C;  2MH9 A;  1FT9 A;  1U5T A;  3O3K A;  2H6B A;  4KIF A;  1KYW A;  4XLP F;  3I5U A;  2PJP A;  1Z6T A;  3T1B A;  1YIO A;  2J5O A;  1LB2 A;  3KZY A;  1PUE E;  2W57 A;  2DTR A;  1R1T A;  1KU2 A;  3V7C A;  3WGI A;  4IVN A;  1PP8 F;  1WRJ A;  4CGZ A;  2ZKZ A;  2UXN A;  5JR3 A;  1P6R A;  3J80 Z;  3EUH A;  4ENJ A;  2RN7 A;  4XLN F;  2VOO A;  1KYZ A;  2WC2 A;  3ROU A;  4H0E A;  3PFI A;  1QPM A;  1LNW A;  2HEO A;  5KVR A;  3CO6 C;  2DFI A;  1B1B A;  1IXR C;  4EJW A;  5LLQ A;  1D8J A;  1KQ8 A;  2NNN A;  5AIQ A;  5H20 A;  2K86 A;  1IUY A;  4WX9 A;  5EEH A;  4QLC U;  2IPQ X;  1S7A A;  2V79 A;  3QU3 A;  2E7W A;  4KFC A;  3C7J A;  3OOP A;  1BM9 A;  2MC3 A;  4UV8 A;  1GVJ A;  1I5Z A;  4UUV A;  1HKS A;  1FX7 A;  4PGH A;  2HDC A;  2DW4 A;  2BYV E;  2FBI A;  3V4G A;  3ZMV A;  1JGS A;  3K2Z A;  3B02 A;  1FBS A;  1F4K A;  4U0W A;  2W84 A;  3CUQ B;  2GXG A;  2ZME A;  4KA4 A;  1KU7 A;  4YFX F;  3EYI A;  3FWE A;  4U7D A;  4KNY A;  1YS6 A;  2P6S A;  3F8C A;  5FFZ A;  2PMH A;  1AOY A;  1QZY A;  4S05 A;  1OMI A;  3CTA A;  1ON2 A;  4G7O F;  2DLL A;  1EH7 A;  1OPC A;  4RAY A;  3J7A O;  4WXC A;  4N0B A;  4B09 A;  3I71 A;  4WXD A;  2HQN A;  1J0R A;  1IW7 F;  1J9I A;  1KU9 A;  4M73 A;  4A6D A;  1QO0 D;  1IN6 A;  3EYY A;  2K4J A;  3ZMZ A;  3CLO A;  3F6O A;  1SD7 A;  3C3W A;  1J59 A;  4CXF A;  4KDP A;  3I59 B;  1B9M A;  1G3T A;  2ZJ2 A;  4LG0 A;  2V6C A;  3HOS A;  2M1B A;  1U2W A;  3HSE A;  1DDN A;  3HHG A;  3Q9S A;  2V1D A;  1TBX A;  4M74 A;  4R8H A;  3ZMD A;  4EM1 A;  1KU3 A;  2EFO A;  1DP7 P;  1ZH5 A;  3JTH A;  1STZ A;  1H9T A;  4YFK F;  3WGH A;  4PGG A;  3EDP A;  5ICG A;  3WTY C;  1OYY A;  2HYF A;  4MHG A;  4M71 A;  3HTU A;  5D5V B;  2IJL A;  4I0B A;  4HW0 A;  3SQN A;  2FSW A;  1BI3 A;  1MGT A;  2DQR A;  2QYO A;  1RUO A;  2RQP A;  2KIM A;  5FLX Z;  3DFG A;  4LLN A;  4AIH A;  2O03 A;  1I27 A;  4FHT A;  2OD5 A;  3FMR A;  5LGT A;  2UWM A;  3GWZ A;  2P5K A;  2HFH A;  2A61 A;  1FBQ A;  2FU4 A;  3ZMS A;  3BJ6 A;  3LWF A;  3SHF A;  3JSP A;  5HS8 A;  1C0W A;  4Y15 A;  1B4A A;  4MNU A;  2E7X A;  4M6Y A;  1LDK B;  2P7V B;  3HOT A;  4WWC A;  4LB5 A;  2HTJ A;  4XSX F;  4KIG A;  1ZG1 A;  1HXD A;  5JHU A;  3I54 A;  3KP2 A;  3L9F A;  2EFQ A;  3LA3 A;  1G6N A;  3F21 A;  4LMY A;  1X3U A;  4P9F A;  4I0A A;  4KMU X;  2EWN A;  5BPD A;  1P2F A;  4KIC A;  3TGN A;  2STT A;  1WKM A;  3M7G A;  1ZLJ A;  3C18 A;  2MA3 A;  3I58 A;  3WU0 A;  1RNL A;  1Y0U A;  2FNP A;  2EFN A;  2NNY A;  2NAZ A;  4LLG F;  5BQT A;  2D1H A;  2FOK A;  3CUQ C;  3IL2 A;  1J5Y A;  3RPU A;  3ZN0 A;  3H92 A;  2HKX A;  3F6V A;  3LQQ A;  3F3X A;  3BRO A;  5HLG A;  2JSC A;  3P7N A;  1W7P D;  1XB4 A;  1R1U A;  5ILS A;  4MEX F;  4BQA A;  4L0Y B;  4Q4Z F;  3TKY A;  1HKQ A;  1TNS A;  3WGG A;  4CDG A;  4M9Z A;  3GUD A;  1BI2 A;  1BI1 A;  3IC7 A;  2VT3 A;  5E1X A;  3W6J B;  1ZRD A;  4N9I A;  1YLF A;  2A68 F;  5DD4 A;  4U0V A;  1HST A;  3TDZ C;  2GQQ A;  4KYW A;  2O3F A;  1HBX G;  1D3Y A;  4G7Z F;  4LJZ F;  2EFP A;  2ACJ A;  2O0Y A;  2O61 A;  2H94 A;  1XSX A;  3J81 K;  4ESB A;  1UFM A;  1F1Z A;  1GHC A;  1G3W A;  3GZ6 A;  3L7W A;  1TQP A;  3COA C;  4RS8 A;  4LK1 F;  1QZZ A;  4YII A;  1R23 A;  1P4W A;  4FX0 A;  1O7F A;  3I4P A;  1H0M A;  1IZ1 A;  1LJ9 A;  3QPH A;  3REO A;  1ZRC A;  3HRT A;  1HW5 A;  1KQ9 A;  3S2W A;  3IRQ A;  2GWR A;  2A07 F;  5D5U B;  3GVA A;  2HTS A;  1XGS A;  2Q8K A;  4IRI A;  3F8M A;  3RKW A;  5H6R A;  4EJO A;  2KIF A;  3VB2 A;  2VBZ A;  3BOQ A;  3WTU C;  2STW A;  5LRR A;  3BP8 A;  2EV5 A;  5LRS A;  2VC1 A;  1W7P A;  3WTW C;  1B59 A;  1ONV A;  1UHM A;  2GXB A;  4JBA A;  5JI6 A;  5AIP A;  4EVI A;  1REP C;  2R7F A;  3M8E A;  4HF0 A;  4RGR A;  5TRD A;  2MLK A;  4B8X A;  4YFN F;  4WK8 F;  3WTT C;  2IRF G;  4L9V A;  3HYI A;  3GZ5 A;  4M72 A;  3D5L A;  3JSO A;  2DQL A;  2BV6 A;  3GLX A;  4LD5 A;  1XGN A;  4ZZL A;  4HF2 A;  1J75 A;  2RC4 A;  2DPD A;  3U9G A;  3DEU A;  2FMY A;  3J81 Z;  4UVC A;  3JAM Z;  2KKO A;  3R0A A;  3SZP A;  2P5V A;  1W5T A;  5HDN A;  2F5F A;  5HOO A;  3PQK A;  4RB0 A;  1GXQ A;  2AS5 F;  2D1V A;  2CQK A;  2PMU A;  5J8F A;  2KRF A;  2H27 A;  3F8F A;  1CGP A;  3P9K A;  3G3Z A;  3E6D A;  2GZW A;  3TO6 A;  3F22 A;  3I59 A;  5BPI A;  4HV5 A;  4EMS A;  2L02 A;  4LGW A;  2CW0 F;  1BBY A;  2ZBK A;  3SXY A;  3GXO A;  1IN5 A;  4HDV A;  1ZHF A;  2XRO A;  5E8I A;  5DEQ A;  2O6G E;  1FBU A;  2HGC A;  3TOA A;  2A69 F;  2QVO A;  1KGS A;  4HAM A;  5DCF A;  1OKR A;  4LFU A;  2DI3 A;  3QRF F;  4O3M A;  2A5Y B;  3ECH A;  1CF7 B;  2CFX A;  1I6X A;  1SD4 A;  2L4A A;  2FQ3 A;  2IA0 A;  1ZGJ A;  4P5O A;  2ZNY A;  3CO7 C;  1Z91 A;  2XAH A;  4PCQ A;  3WG9 A;  5J8C A;  2DU9 A;  2QEN A;  4ENK A;  1U6G A;  5ERI A;  4G8X A;  4LB6 B;  2Z99 A;  3QP6 A;  3ABT A;  2PLY A;  4ZYE A;  3HHH A;  4BH9 A;  1JXS A;  2EA4 A;  3DV8 A;  1R36 A;  4HBL A;  3ULQ B;  1XDU A;  4HZF A;  2DAO A;  3CUO A;  2Y75 A;  3LAP A;  3VOE A;  5ILV A;  1Z6R A;  2W85 A;  3ZMT A;  1FSE A;  4G94 A;  4IHS A;  5LBQ A;  2V1X A;  3L2C A;  2XAG A;  4GYG A;  5FD6 A;  1HKT A;  4M6X A;  1O3R A;  2IA1 A;  5DCM B;  2L4M A;  1UHW A;  2PN6 A;  3F23 A;  1E2X A;  2R3S A;  2LKP A;  3VEP A;  2EJR A;  2KIU A;  1V4R A;  1EH8 A;  4A5M A;  1XGM A;  1XGO A;  2DK5 A;  1V3F A;  2HKO A;  3KFW X;  4A0Z A;  2ADU A;  4RGX A;  5DDG A;  3IKT A;  2XGX A;  4HLX A;  5FGM A;  2UZK A;  1MZB A;  3IRR A;  1DPU A;  4G7H F;  3KLN A;  2CG4 A;  3L09 A;  3LFK A;  2QLZ A;  1WSU A;  2LDU A;  3V7R A;  3HIF A;  3V8J A;  5FFX A;  2Z5U A;  2MBF A;  3KP6 A;  4HQM A;  1USS A;  4OMZ A;  2D2W A;  2G7U A;  3DPL C;  2M5W A;  4AIJ A;  3RI4 A;  3GFJ A;  4FX4 A;  3V7S A;  5L3B A;  5BS6 A;  2A6H F;  4XBF A;  1XD7 A;  5TJJ A;  2PG4 A;  3M1E A;  4ZH4 F;  1JHF A;  5HLH A;  3MWM A;  3FM5 A;  4YIF A;  3EET A;  2R7D A;  2YX4 A;  1BN5 A;  1KQ0 A;  2FA5 A;  2KJC A;  2L01 A;  1SFU A;  5LGN A;  3MFK A;  5CYV A;  4A0Y A;  1W4M A;  3N97 A;  3KEO A;  1FPQ A;  5D8L B;  1ZAR A;  3KZZ A;  2Q2E A;  5CJ9 A;  2HOE A;  1BI0 A;  1S3J A;  3F8N A;  1QNT A;  2ZNZ A;  2EV0 A;  3QOP A;  2NRA C;  3M8F A;  1TTY A;  2VXZ A;  1XCB A;  2HS5 A;  1U8R A;  1F9N A;  2W24 A;  1YTY A;  5A2Q K;  4Y17 A;  1MDM B;  1I1S A;  5CVJ A;  1PP7 U;  4D0P A;  3TO7 A;  2OZU A;  2W25 A;  3MAJ A;  1U5T B;  4BHP A;  2RV8 A;  4ZYH A;  1G3S A;  1G3Y A;  4BHC A;  2CO5 A;  4Q47 A;  5K5O A;  1IF1 A;  4A5N A;  5CLS A;  2ETH A;  1BOA A;  1ZGA A;  2AXL A;  4UXN A;  4HLY A;  1T39 A;  3DXJ F;  5L3G A;  3AAF A;  4I02 A;  3LST A;  4EJU A;  4NB5 A;  1IAW A;  4A12 A;  1K78 A;  3WTZ A;  2D45 A;  2ISZ A;  2M8E A;  5ICE A;  5L3D A;  3T8R A;  1MD0 A;  1YW9 A;  1ZN2 A;  4QWQ A;  4JQF A;  2QQB A;  3KEQ A;  2IP2 A;  4HOB A;  2TDX A;  4O5V A;  3DPT A;  4PDK A;  2EB7 A;  4L9N A;  2ESN A;  1IN4 A;  1FWZ A;  1ZLK A;  4GCV A;  5DD8 A;  4PZJ A;  1ULY A;  1ZRE A;  4I7H A;  3RIR A;  3HUG A;  3W6K B;  2IT0 A;  2CYY A;  5IT9 K;  4L9J A;  2P5L C;  3L00 A;  1MJB A;  4KUM A;  1YQA A;  1FYM A;  5BMZ A;  5D6E A;  1BJA A;  2H6C A;  4EQQ A;  2A6E F;  2JZY A;  4N9H A;  3BJA A;  3BY6 A;  1Z9C A;  4UVB A;  3BDD A;  3FM3 A;  2DPU A;  5A2Q Z;  3KP5 A;  5E20 A;  1O57 A;  2OZ6 A;  3R0J A;  4M9S A;  1KA8 A;  3PQJ A;  3KET A;  1XMA A;  2P4W A;  3F72 A;  4HX8 A;  2Z9O A;  4ZZD A;  1H9G A;  3KCC A;  1TLH B;  4XSZ F;  1YS7 A;  4KMF A;  5D8K B;  2QM3 A;  3HRM A;  4HYE A;  1SMY F;  2QWW A;  4EJT A;  1J7K A;  1CF7 A;  2JPB A;  2Z3Y A;  4RAZ A;  2K4B A;  4P96 A;  4I98 B;  3FF5 A;  2JTV A;  2JT1 A;  1SD6 A;  5E8G A;  4NHJ A;  3ZMU A;  4IRG A;  4R1H A;  3GFL A;  1RIO H;  4ASN A;  2VOD A;  5LGU A;  3HRS A;  3QP5 A;  2OAZ A;  4WF2 A;  2NYX A;  5D6F A;  5ICF A;  3RYP A;  3P9C A;  3GX4 X;  4RB3 C;  2XRN A;  2CGP A;  2EFW A;  2F5C A;  1IN8 A;  2DK8 A;  3MZY A;  5IT9 Z;  5BOX A;  4MQ9 F;  5E1Z B;  2HWV A;  5D4S A;  2FML A;  3ML6 A;  1F5T A;  4ESF A;  1RUN A;  4LG0 B;  3G73 A;  1U3E M;  3NEU A;  3BPV A;  3ZQ7 A;  3O2P E;  3DP7 A;  2NS0 A;  6PAX A;  4AD9 A;  1U5T C;  1IRF A;  2ESH A;  3BPX A;  4IRH A;  3T0Y A;  4GXO A;  1R00 A;  4L5J A;  5DCM A;  2OA4 A;  2JPC A;  4U88 A;  1BIA A;  2VE8 A;  3KP3 A;  4EGY A;  3K1M A;  2YSR A;  3D0S A;  3K1N A;  2ZFW A;  5L3C A;  4MGR A;  4LLL A;  1E17 A;  3GYH X;  4UV9 A;  4DQ2 A;  3GEZ A;  3VFZ A;  2F2E A;  2XKO A;  1RZ4 A;  2XHK A;  3F8B A;  3BZ6 A;  5D5W B;  3IKV A;  2CSO A;  2CWE A;  3R4K A;  3LAJ A;  4MTE A;  5E17 F;  3MEX A;  3CUQ A;  5LEK A;  4KT5 C;  4Q48 A;  5F64 A;  3LA7 A;  3ABU A;  3I53 A;  3RDI A;  1G4D A;  1JHH A;  3GF2 A;  2FBK A;  3HRU A;  2PQ8 A;  4ZYD A;  5JVT A;  1LEA A;  1Z1D A;  4BNC A;  3QPT A;  3FZV A;  4LK0 F;  4P9U A;  1YW8 A;  1FNN A;  3ELK A;  3J80 K;  2FEZ A;  2ELH A;  2HQR A;  3MCZ A;  4E70 A;  1IRG A;  4K2E A;  3E6B A;  4GGG A;  3TDU C;  2VOP A;  1K7A A;  1QBJ A;  1S29 A;  1TQM A;  1SFX A;  2Z33 A;  4ZYG A;  3OV8 A;  3ZP5 A;  3ERE D;  4UVA A;  2RDP A;  2F5D A;  4EJV A;  4ENM A;  2YU3 A;  3FHZ A;  2E1C A;  4IHT A;  3E6M A;  3GFI A;  4L0Z B;  2VE9 A;  4O6J A;  4WCG A;  2MD5 A;  4OIP F;  1LEB A;  3JTG A;  3WTX C;  1Z7U A;  1Z05 A;  5H6Q A;  3GFM A;  4MTD A;  5HDG A;  5L3F A;  3E5Q A;  1R5H A;  2FRH A;  4WXH A;  3GO5 A;  4CIC A;  2KJB A;  4L5I A;  4FT8 A;  2HYG D;  1FYL A;  2VON A;  4AWX B;  4HDU A;  2QUF A;  1LDD A;  3RYR A;  5ICC A;  3WTV C;  4XRF A;  3KE2 A;  2F5E A;  3H3Z A;  2LF8 A;  3TOB A;  2PEX A;  2QQ9 A;  1RI7 A;  1ZG5 A;  4IF4 A;  5CVU A;  4OOI A;  5F6F A;  3M9A A;  5LHG A;  1LDJ A;  1QGP A;  2RKH A;  2H09 A;  1D8K A;  2UXX A;  3MZH A;  1GXP A;  5HLI A;  2EA2 A;  1P92 A;  3FMQ A;  1FSH A;  2JRT A;  1TW3 A;  2C6Y A;  3E5X A;  1XN7 A;  1ZRF A;  1VTN C;  1P4A A;  4L18 B;  5J6X A;  2RGV A;  1ZAO A;  3KLO A;  1FP2 A;  4OIO F;  1K79 A;  3I0T A;  1OYW A;  3MQ0 A;  4HV6 A;  1T2K A;  3SFZ A;  3K9T A;  3KP7 A;  4CYD A;  1R1V A;  3NQO A;  3WE3 A;  1ODD A;  1MJ9 A;  3ZN1 A;  1IXS B;  1W7P B;  2QBY B;  4HX7 A;  4BAY A;  2XKP A;  1MKM A;  5K5Q A;  2XUB A;  1LVA A;  2XV4 S;  1B6A A;  4R79 A;  4ON0 A;  3T8T A;  2VBX A;  4G6Q A;  5E1W A;  4EV0 A; 
#chains in the Genus database with same CATH topology
 1MW7 A;  2JVG A;  2E1O A;  3HTS B;  2YR2 A;  2A3S A;  2GLO A;  4G6D A;  1B9N A;  4FTH A;  2ISY A;  3DTK A;  2DO7 A;  3ZQI A;  1AWC A;  1VF9 A;  5HS9 A;  2DA6 A;  2CS3 A;  5FLX K;  1QQI A;  1ZEL A;  1BL0 A;  2ID6 A;  2EZK A;  1S7O A;  4M3B A;  4I01 A;  4C9Y A;  4J01 A;  4RB2 C;  3R60 A;  2ELK A;  2DOA A;  1D5V A;  5DUK A;  2RNJ A;  2EQR A;  3PNT A;  1WPK A;  1VQM I;  2X1C A;  3BWG A;  1SMT A;  2P8T A;  3H3U A;  3SDG A;  3O6B B;  1B72 A;  3BCB A;  1X58 A;  4RGS A;  1QHH D;  2DMU A;  4D7M A;  2HXO A;  3I64 A;  5GTI C;  4CHU A;  4CCM A;  2PJR A;  3TED A;  2XAJ A;  5DTD A;  5FO5 A;  5E3M A;  1TNT A;  1ZYR F;  1YIT I;  3EQL F;  4NQW A;  1YFH A;  1BA5 A;  4TV7 A;  4U0Y A;  5KAF C;  2VPL A;  3U1D A;  2MLG A;  5B1B H;  2KDO A;  4ABZ A;  4U7B A;  3HOU J;  4A3D J;  4L9T A;  2LNB A;  3CJR B;  1YHQ I;  1IV8 A;  1H88 C;  3OIQ A;  1RKT A;  1FP1 D;  2ZJR F;  1ORK A;  4NC8 A;  5EF6 A;  2VKD A;  4Y13 A;  2VB6 A;  3NAR A;  3P9I A;  2JUC A;  3H9J A;  4XLC A;  2VJI A;  2M30 A;  1MBE A;  1PVE A;  2W48 A;  1FMV A;  4FIS A;  1ETQ A;  4ETS A;  2RAE A;  5F1J A;  5EEG A;  5KAI C;  2PFB A;  4Y52 J;  2GA1 A;  1SAX A;  1YI2 I;  2FNA A;  2DFH A;  2RVC A;  1X4O A;  3R61 A;  1BC8 C;  2M8G X;  4PK4 A;  2VC0 A;  1W5S A;  2BEO A;  3BJO A;  5J1Y A;  4DOZ A;  3TO9 A;  3ZPL A;  3OYG A;  3ZGK A;  1HQC A;  4UNO A;  2R7V A;  3VOD A;  1UEL B;  2PBI A;  5FD5 A;  1OYI A;  3GTJ J;  2JA2 A;  3L1P A;  2ZCW A;  9ANT A;  2J5P A;  3OSF A;  1A5J A;  2KT0 A;  1DP3 A;  1PYV A;  4HF1 A;  2DA3 A;  4GDF A;  3OWT A;  3CDL A;  5IP9 J;  1T6S A;  2KZG A;  2IGK A;  1EH6 A;  1PDN C;  2A5W A;  4EV0 A;  4Q5S F;  4B48 A;  1OR7 A;  5GTH C;  3I56 I;  2NOG A;  1FOY A;  5L3E A;  2M9H A;  2E1N A;  5K5R A;  3H3V K;  4BDY A;  4RM3 A;  3WOD F;  2IW5 A;  3DKX A;  2BVL A;  5F0C A;  1W0T A;  4AM3 A;  2IGN A;  3S32 A;  2DDA A;  1SFK A;  4I99 C;  4BJT A;  3T5X A;  4ZTJ A;  3J7Y J;  1BOB A;  2IA2 A;  3ERM A;  1FC3 A;  2QKL B;  1R7J A;  2WB1 A;  5FB2 A;  1WI9 A;  3KYC B;  1MBF A;  3DCF A;  1MNM C;  2MSY A;  4ZDL A;  2K3F A;  4A6E A;  1EKE A;  3LL7 A;  3M8J A;  3G4S I;  3HB9 A;  1P7I A;  2K27 A;  5C44 J;  2DDB A;  2V9V A;  1ACI A;  4S04 A;  1LUJ B;  2KL4 A;  2JRM A;  4IJA A;  2EIL H;  2FBH A;  4HNU A;  1T38 A;  4DZP A;  1SFE A;  4X0G A;  2KRC A;  4AVP A;  2FXA A;  3P5J A;  4DNC A;  4GFB A;  1YE9 A;  1FOK A;  1UST A;  2QQA A;  1R71 A;  1IDY A;  1YG2 A;  2F4O B;  3FXM A;  3E5U A;  4XLH A;  2LF7 A;  5CVI A;  1FYK A;  4G9Y A;  2OQR A;  2Q0O A;  3V8L A;  3KP4 A;  2LY2 A;  1K6O A;  2QZ8 A;  3OR2 C;  1A04 A;  5FKO A;  3ZCO A;  1XSV A;  3K0L A;  1BR1 A;  1IXC A;  2P0W A;  1FLI A;  2Y48 A;  4BEH B;  3LQR A;  1NG6 A;  1R5G A;  3B73 A;  2X9D A;  3ZRG A;  4XIC A;  4XN3 A;  3QAH A;  1J2X A;  1X3Z B;  4RMN A;  3FX3 A;  5GAG J;  1AA7 A;  3R6S A;  3K4L A;  5HDK A;  1TW2 A;  1HF0 A;  5D5X B;  4BHB A;  2GOM A;  3JRB A;  4AIK A;  4BY1 J;  1T98 A;  5EZG A;  3OYF A;  4CO8 A;  1IJW C;  2BE5 F;  4IXA A;  5IT3 A;  2KLO A;  2M45 A;  3TQN A;  5FKM A;  3E3V A;  1YO5 C;  1V54 H;  2G0E A;  4HX4 A;  5ED4 A;  2HR3 A;  1WQ2 A;  3ZOB A;  3MKW B;  4OU0 A;  3S17 J;  5LD2 C;  1L0O C;  5HS7 A;  5CQE A;  1N78 A;  1QA6 A;  1ZK8 A;  2ZME B;  4Y33 A;  4EGZ A;  2ME6 A;  1PUF A;  4HA8 A;  1SD5 A;  5DV5 A;  1JE8 A;  2X6W A;  1P7J A;  1FZP B;  4D9J A;  2E2J J;  3IWZ A;  1P4X A;  3N4M A;  1RR8 C;  3K4B A;  1GVD A;  4JYK A;  2GXA A;  3PNY A;  3PSI A;  1ON1 A;  2G9W A;  2FF4 A;  2L54 A;  1BIB A;  5F1R A;  1MH3 A;  2F4I A;  2CV2 A;  2Y0M A;  4MFE A;  1BR4 A;  5HNH A;  3E97 A;  3RTR A;  3U2R A;  4GRI A;  1Q1H A;  2X6O A;  1UB9 A;  4BYY A;  4CCL A;  2HVQ A;  4CZZ A;  2MAB A;  2V1N A;  2L5Q A;  3V8K A;  1EF4 A;  2LBF A;  3BG6 A;  5E79 C;  4Z2Y A;  2XAF A;  2VIX A;  4BQQ A;  1MBK A;  3J7A Y;  1XDS A;  4F7Z A;  2EV6 A;  4XKW A;  2ICW G;  4XLF A;  3Q5F A;  4BAC A;  4LOC A;  1HSJ A;  1OCC H;  2BY3 A;  3FXU A;  3IAM 2;  3RZD J;  4BQO A;  2WTE A;  3HSF A;  1MMD A;  3LA2 A;  3WE2 A;  2DYR H;  1JJ8 C;  1O3Q A;  2X0L A;  3M1C A;  4I09 A;  4HG2 A;  4XOR A;  4KIB A;  3RPQ A;  3GCM A;  3RKY A;  2TCT A;  2WY7 Q;  2LD5 A;  4OIQ F;  3PL8 A;  2I10 A;  5HNF A;  5ILU A;  3DF8 A;  4JK1 X;  2G7H A;  1EA3 A;  3C2G A;  5EEA A;  4A0X A;  2BBY A;  1UCR A;  2Z1D A;  3Q9V A;  4M9X A;  4OMY A;  4NNJ A;  3A1Y A;  5CVV A;  1HCR A;  2ZXJ A;  1VQP I;  2L9S A;  5LEJ A;  2BGC A;  3JAM K;  4XRM A;  3OIP A;  2O8X A;  4OIR F;  2X4H A;  3PM1 A;  1S6L A;  4HRI A;  5E18 F;  1T95 A;  2OCE A;  3ECO A;  2LG4 A;  3K69 A;  2Q2E B;  3BTJ A;  4HQE A;  4E7I A;  4I2O A;  4B43 A;  4KN7 X;  4RB1 A;  1K4S A;  1BC7 C;  4CA0 A;  5K1Y A;  2P7C B;  1XCV A;  4BE2 A;  1O3S A;  3HBL A;  5D4R A;  2GA2 A;  4XID A;  1WWX A;  3OR1 C;  5GAE J;  5IOY A;  3KPH A;  1FOW A;  4FCY A;  1F36 A;  1MSF C;  3DU6 A;  4M3D A;  2XIG A;  3JW4 A;  4MEY F;  4XOP A;  5KK1 A;  4DYC A;  3OYE A;  3CCS I;  2TRT A;  4ESJ A;  4IPA A;  3VYR B;  2DBB A;  2K85 A;  3VDX A;  1HW2 A;  2B0L A;  3IHU A;  2VKV A;  3CP8 A;  5CVR A;  3SFI A;  2ECC A;  2XAS A;  4MO7 A;  3NRV A;  2VBW A;  4HNV A;  2R0Q C;  1V5E A;  2GBY A;  1ZG3 A;  1EV7 A;  3LSH A;  1WI3 A;  4BU2 A;  4E7J A;  1BR2 A;  2NXN B;  4UB8 C;  3RJP A;  2XAQ A;  3SZT A;  3BZC A;  2DT5 A;  1O7L A;  3Q0U A;  4MQV A;  3S14 J;  2VT2 A;  3CJN A;  3FMS A;  1O3T A;  3ISP A;  4DYQ A;  4CH7 A;  5M5Y J;  2VBY A;  4A69 C;  2HOT A;  2OCC H;  3I9V 2;  2H8W A;  1T0F A;  3S8P A;  1ETK A;  4FET A;  1R58 A;  2QBY A;  2PI0 A;  2XPW A;  4E7L A;  1HW1 A;  4IKF A;  2VN2 A;  5FRN A;  3QPL A;  1GT0 C;  2DFE A;  1IN7 A;  1KON A;  1MSE C;  3GW2 A;  3QPS A;  5FRM A;  2X1D A;  3E6C C;  4UHT A;  3S1Q J;  2B9S A;  1K78 B;  1MJA A;  3TW6 A;  4BXU A;  3KYL A;  3S2D J;  2OU2 A;  1YYV A;  1UMQ A;  1Z0X A;  3FXQ A;  2HZT A;  4GO1 A;  1JUS A;  3HSR A;  3OMY A;  2XRL A;  2ZO4 A;  3WU1 B;  5DYM A;  4P55 A;  2JJ7 A;  1DPR A;  2COM A;  4NC6 A;  2OQG A;  1N77 A;  2X6X A;  1W1W E;  2KP6 A;  1NHA A;  4ENN A;  4BXX J;  2R7T A;  2D5V A;  1I39 A;  2DTZ A;  2VKE A;  1TQI A;  2M87 A;  3CDH A;  1TT5 B;  4EM0 B;  2R7U A;  2YX7 A;  1S8N A;  2LY1 A;  5LHI A;  1AHD P;  2K7L A;  1JT6 A;  1IUF A;  4GYI A;  3RKX A;  3VYU B;  4F92 B;  2F48 A;  2IVM A;  1I1G A;  3GME A;  3HUG B;  4EM2 A;  1YJ9 I;  1FIA A;  5GPA A;  5F27 A;  3JRG A;  2GAU A;  1ZR2 A;  3C1D A;  1R22 A;  2L3D A;  2P6T A;  5HVQ C;  4OIN F;  4H4K C;  4CYC A;  4F91 B;  1MMG A;  2OBP A;  2OTL I;  3LSR A;  2HDW A;  4E6K G;  3QU6 A;  2V4J C;  5EZH A;  3DKW A;  3CMM A;  5AON A;  1XSD A;  2L7Z A;  2LSO A;  2WV1 A;  3BR5 A;  4KN4 X;  5DUI A;  3JR9 A;  5J3L A;  5JFR A;  2EK5 A;  1D5Y A;  3GTG J;  2GIV A;  2QQ8 A;  3GTO J;  4RGU A;  3HOW J;  2LY9 A;  2K9Q A;  1E3P A;  1U78 A;  2MH2 A;  1I3A A;  3NWS A;  4MLO A;  4A2U A;  3S1M J;  4AYB A;  4A3K J;  5LHH A;  1HDP A;  2XVC A;  1FY7 A;  3HDD A;  2W4S A;  3MKY B;  1LQ1 A;  2BXZ A;  2YPR A;  5CKT A;  4YG2 F;  3VWB A;  3K4J A;  1YW7 A;  2KIQ A;  1E3H A;  2YU9 J;  4JX4 A;  3CMY A;  3RQI A;  1DUX C;  3FXR A;  4A3I J;  4ITV A;  2Q1Z B;  3N05 A;  4AU7 A;  1WJ5 A;  2V1U A;  1L3L A;  2K02 A;  2WV0 A;  4UUS B;  4Z6Y A;  3WTS C;  3LSI A;  3QOE A;  3CJT B;  4XRS G;  4Y4R A;  2WWY A;  1MDM A;  3IWF A;  2FE3 A;  4KT6 A;  3S1N J;  3K1P A;  3FBN B;  1XMK A;  3DQV C;  2MH9 A;  1FT9 A;  1SVL A;  1U5T A;  2LKX A;  3O3K A;  2H6B A;  3FKI J;  4KIF A;  3KIO A;  1KYW A;  5J1R A;  4XLP F;  3I5U A;  3OYC A;  2PJP A;  4RLQ A;  3LMM A;  1Z6T A;  3T1B A;  2R93 J;  1YIO A;  2J5O A;  3VYS B;  1W36 D;  5M3F J;  1Y1V J;  3PIP F;  1LB2 A;  3KZY A;  1PUE E;  2W57 A;  2DTR A;  1R1T A;  5K7F A;  1KU2 A;  2HOS A;  3LSJ A;  3V7C A;  3WGI A;  2R5Y A;  4I76 A;  4IVN A;  1PP8 F;  3CC4 I;  2CW7 A;  4G6T B;  1WRJ A;  4CGZ A;  2ZKZ A;  2UXN A;  4ZC3 A;  4B1R A;  3IV5 A;  5JR3 A;  2DMN A;  3VSL A;  4AC0 A;  5KHD A;  1P6R A;  3G2B A;  3FK7 A;  3OS1 A;  3J80 Z;  3EUH A;  3I4N J;  4ENJ A;  1UG2 A;  4D5C A;  1K83 J;  3CCL I;  2RN7 A;  4XLN F;  1V5G A;  5DM7 F;  1FTT A;  2EIK H;  2M2E A;  2V26 A;  1RRJ A;  2VOO A;  1KYZ A;  5E3L A;  2WC2 A;  3ROU A;  4FE7 A;  4H0E A;  1IO2 A;  1S5L C;  3PFI A;  3W3C A;  1QPM A;  1LNW A;  4D5F A;  4EAT A;  2HEO A;  3AL0 B;  1BJZ A;  2DCE A;  4AUX A;  5KVR A;  1G59 A;  3CO6 C;  2DFI A;  2RRE A;  3FK6 A;  1B1B A;  1IXR C;  4EJW A;  5LLQ A;  1D8J A;  2BZT A;  2EIJ H;  1KQ8 A;  2OPT A;  2NNN A;  2E71 A;  5AIQ A;  3QQA A;  5H20 A;  2K86 A;  2XDV A;  1IUY A;  2LR8 A;  3AKZ A;  2WY8 Q;  4WX9 A;  5EEH A;  4QLC U;  1RKW A;  2DOD A;  2IPQ X;  3H5A A;  1S7A A;  1KZH A;  5KNL A;  1JJ6 C;  5EJC A;  2V79 A;  1S72 I;  1OR7 C;  2X48 A;  3CZ6 A;  3QU3 A;  1APL C;  2E7W A;  4KFC A;  1DGW Y;  1M1E B;  4BEH A;  2L7K A;  3C7J A;  3HC7 A;  4PJL A;  3OOP A;  1BM9 A;  2COB A;  3HPH A;  1WHU A;  2MC3 A;  2Z2S B;  4UV8 A;  1GVJ A;  1I5Z A;  4UUV A;  2VLA A;  4PJ0 C;  2FQ4 A;  1HKS A;  3IH4 A;  3RCO A;  1FX7 A;  5EGO A;  1TWH J;  3M3Y J;  4PGH A;  2HDC A;  4XKV A;  3A01 B;  3CF2 A;  2DW4 A;  3F9K A;  2XF6 A;  3OL3 A;  2BOL A;  2BYV E;  2FBI A;  3BG9 A;  1Z7L A;  3V4G A;  2W1O A;  3ZMV A;  1JGS A;  2MC4 A;  3K70 D;  2RNG A;  3BG3 A;  2XC7 A;  4I6Z A;  3OYD A;  1D0X A;  3K2Z A;  1MND A;  3PFY A;  5JLX A;  2O9L A;  3B02 A;  1FBS A;  3MN2 A;  1F4K A;  4U0W A;  1V5F A;  4XQF A;  1BW5 A;  4PFP A;  2W84 A;  3K10 A;  3CUQ B;  1MBH A;  3HXL A;  4QPO A;  2GXG A;  2ZME A;  4KA4 A;  1KU7 A;  4IL6 C;  4YFX F;  5HLT A;  3EYI A;  3FWE A;  4OWR B;  4U7D A;  4KNY A;  4CSW A;  1YS6 A;  1UZC A;  4A3B J;  2P6S A;  3F8C A;  4MIM A;  5FFZ A;  2PMH A;  1AOY A;  3O8G A;  1QZY A;  4S05 A;  1OMI A;  4A93 J;  2PMZ A;  3CTA A;  4ZYA A;  4C2T A;  2R7W A;  2DT7 B;  3FXL A;  1ON2 A;  3PJR A;  5FLV A;  4G7O F;  2DLL A;  1MBG A;  2XPU A;  1VQN I;  5J4V A;  1EH7 A;  1OPC A;  1R5I D;  1VQ6 I;  4RAY A;  3J7A O;  4WXC A;  3SJM A;  4IO9 F;  3JRA A;  5FKL A;  4N0B A;  4B09 A;  2CV1 A;  3I71 A;  3CCR I;  1TZL A;  3GTM J;  1YJW I;  1OCR H;  3H36 A;  2HQN A;  4WXD A;  1J0R A;  5H2F C;  1IW7 F;  1J9I A;  1I6H J;  3ZQQ A;  1KU9 A;  3WG7 H;  2R7Q A;  4M73 A;  4CCN A;  4A6D A;  1QO0 D;  1IN6 A;  2M7A A;  3EYY A;  1A6I A;  2LH9 A;  2K4J A;  3ZMZ A;  3CLO A;  2JA5 J;  3F6O A;  2XF7 A;  1SD7 A;  3C3W A;  3OYJ A;  4DIQ A;  1J59 A;  4CXF A;  4KDP A;  3I59 B;  1X2N A;  1B9M A;  3X2Q H;  1G3T A;  3I55 I;  2ZJ2 A;  4LG0 A;  3JRC A;  2OF7 A;  5IP7 J;  2V6C A;  2EZI A;  3HOS A;  2M1B A;  4XNF A;  1U2W A;  3HSE A;  3K4M A;  1X1P A;  2YUS A;  3EUK L;  1SC7 A;  4CUG A;  1DDN A;  1TWG J;  3I3L A;  3HHG A;  4LIU A;  3Q9S A;  2V1D A;  4BY7 J;  1XMX A;  1UAA A;  1TBX A;  3FIW A;  1WZ2 A;  4M74 A;  4R8H A;  3CCE I;  1T56 A;  3ZMD A;  1ETO A;  4EM1 A;  1KU3 A;  1WJE A;  2EFO A;  1QZE A;  1DP7 P;  1ZH5 A;  3JTH A;  1STZ A;  1H9T A;  4YFK F;  1ETW A;  3WGH A;  4X6A J;  1ITY A;  4PGG A;  3H0D A;  3EDP A;  5ICG A;  3WTY C;  1EJ9 A;  1OYY A;  3BG5 A;  2HYF A;  2VUM J;  4RAF A;  3RPU D;  3HOV J;  4MHG A;  4M71 A;  1Y39 A;  2CV0 A;  3HTU A;  5D5V B;  2I8D A;  2IJL A;  4I0B A;  4HW0 A;  3SQN A;  2FSW A;  1BI3 A;  4U87 A;  2LRE A;  3S3O A;  1A31 A;  1MGT A;  2DQR A;  2QYO A;  1RUO A;  2RQP A;  1HDD C;  2KIM A;  5FLX Z;  3RQ4 A;  3DFG A;  3BG7 A;  4LLN A;  3ASO H;  4AIH A;  1K61 A;  4XM3 A;  2O03 A;  3D1N I;  2Y9Z A;  2ZXH A;  1S7E A;  1I27 A;  4FHT A;  2OD5 A;  1GDT A;  3FMR A;  5LGT A;  3WHC A;  2UWM A;  3GWZ A;  2P5K A;  2HFH A;  1J09 A;  2A61 A;  3FXO A;  2DYS H;  1FBQ A;  1WFX A;  2FU4 A;  3ZMS A;  3BTL A;  3AL0 C;  3BJ6 A;  3IP4 B;  3LWF A;  2ECB A;  3SHF A;  1MH4 A;  4OAY A;  2EZL A;  3ABK H;  3JSP A;  5HS8 A;  4M6V A;  4BJ5 C;  1NK3 P;  1C0W A;  4Y15 A;  3BR2 A;  2FX0 A;  3PSF A;  4BQN A;  1B4A A;  4MNU A;  3GBG A;  2E7X A;  5GAH J;  4AYB N;  4M6Y A;  1LDK B;  2P7V B;  3HOT A;  4WWC A;  4LB5 A;  2HTJ A;  2NVQ J;  4XSX F;  4KIG A;  1ZG1 A;  1HXD A;  2HI3 A;  2NS7 A;  3KZI C;  4V2G A;  1VQL I;  3OYM A;  3OYI A;  1JUP A;  2IS4 A;  5JHU A;  1QHG A;  3K2A A;  4E7S A;  1YRN A;  3I54 A;  3A0H C;  3KP2 A;  3L9F A;  1CQT A;  1Z77 A;  3Q0V A;  2EFQ A;  1QU3 A;  3LA3 A;  1G6N A;  3QWL A;  3F21 A;  4LMY A;  5TIS C;  1X3U A;  4P9F A;  4I0A A;  4RA2 A;  4KMU X;  2EWN A;  5BPD A;  2M0M A;  1P2F A;  4KIC A;  2IAI A;  3TGN A;  2STT A;  1WKM A;  2KPM A;  3HGY A;  1WJA A;  3M7G A;  1ZLJ A;  4B3A A;  3C18 A;  1IDZ A;  2MA3 A;  2VJJ A;  3I58 A;  4E7H A;  3OY9 A;  3WU0 A;  2KHM A;  1RNL A;  2ZC2 A;  3IAS 2;  3LOC A;  1Y0U A;  2FNP A;  2EFN A;  2NNY A;  2CFO A;  2NAZ A;  4F52 A;  1JKO C;  4LLG F;  3O8H A;  5BQT A;  5EG0 A;  2XGD A;  4XL9 A;  2CUZ A;  2D1H A;  3UNG C;  1YX3 A;  1X19 A;  2FOK A;  3ZQC A;  2A05 A;  4XON A;  3CUQ C;  1UG0 A;  2JWT A;  3IL2 A;  1J5Y A;  3RPU A;  1VQ4 I;  3ZN0 A;  2HYJ A;  3H92 A;  5DM6 F;  1ZKG A;  1R9T J;  3DPU A;  2HKX A;  3BR6 A;  3F6V A;  3LQQ A;  3F3X A;  3BRO A;  1Y8Q B;  4IOA F;  2QF7 A;  1XTA A;  3G1L A;  5HLG A;  2JSC A;  4UUS A;  4G12 A;  3P7N A;  1V55 H;  3DBR B;  2X85 A;  2MYS A;  1W7P D;  3CES A;  1XB4 A;  1MMN A;  1R1U A;  3KEY A;  3ZQF A;  3OS2 A;  1SFO J;  5ILS A;  4LG3 A;  3W2A A;  4NDL A;  4MEX F;  1U9O A;  2DT6 A;  1POG A;  4BQA A;  1MMS A;  2HNH A;  4L0Y B;  4Q4Z F;  3TKY A;  1HKQ A;  2ME0 A;  1IC8 A;  3HOX J;  1TNS A;  3WGG A;  4CDG A;  4M9Z A;  3GUD A;  2KFD A;  3M4O J;  3HZJ A;  1BI2 A;  1BI1 A;  4UB6 C;  2HVR A;  2VJ4 A;  2PX9 A;  3HKZ A;  3OYL A;  3IC7 A;  2HPM A;  2VJ5 A;  2XSD C;  2X6Y A;  2KQR A;  1TWF J;  2VT3 A;  5E1X A;  4ZTF A;  3W6J B;  3DLA A;  2CUJ A;  4N9I A;  1ZRD A;  1YLF A;  4D7N A;  2A68 F;  4NBQ A;  3C2B A;  5DD4 A;  4QSH A;  4U0V A;  2Y2Z A;  2LYC A;  1HST A;  3TDZ C;  2GQQ A;  4KYW A;  2O3F A;  1HBX G;  1B72 B;  2JSP A;  4PFO A;  3S93 A;  1QVU A;  1D3Y A;  4G7Z F;  2HDD A;  2H1L A;  2QSG X;  2JA6 J;  4LJZ F;  2EFP A;  4QTR A;  1JKP C;  1S9H A;  4B3X A;  4F3Q A;  2KRH A;  2ACJ A;  2O0Y A;  3S3N A;  2O61 A;  3CCY A;  1Z21 A;  1XSX A;  2H94 A;  3QYF A;  2AXT C;  3J81 K;  2O7O A;  2CU7 A;  4ESB A;  5FJ8 J;  3U21 A;  1UFM A;  2BY2 A;  1F1Z A;  1NK2 P;  2QGU A;  1GHC A;  1G3W A;  3GZ6 A;  3I4M J;  3L7W A;  4Y3O A;  1RPW A;  1TQP A;  2WA0 A;  5B5E C;  3COA C;  4LK1 F;  4RS8 A;  1FTZ A;  1QZZ A;  4YII A;  2ZXW H;  3RSN A;  1R23 A;  1P4W A;  4FX0 A;  1O7F A;  3I4P A;  1H0M A;  1IZ1 A;  1LJ9 A;  3QPH A;  3REO A;  2V7F A;  3C2H A;  1ZRC A;  2LC2 A;  2ZJQ F;  3HRT A;  1HW5 A;  1MMA A;  1KQ9 A;  3S2W A;  3IRQ A;  2GWR A;  4L5E A;  2A07 F;  2DOF A;  5D5U B;  3LFU A;  3GVA A;  2HTS A;  1XGS A;  2Q8K A;  3HPG A;  3LSP A;  4IRI A;  3F8M A;  3RKW A;  2IS1 A;  5H6R A;  1OQY A;  4EJO A;  3U1K A;  1OCT C;  1SVO A;  2KIF A;  3VB2 A;  2VBZ A;  3BOQ A;  3WTU C;  3SEQ A;  2DA4 A;  3TP0 A;  2JA7 J;  2STW A;  4ZDO A;  1R4M B;  5LRR A;  3BP8 A;  4IHW A;  2PMZ N;  5B1A H;  2Y0S A;  4KIT B;  2EV5 A;  5LRS A;  2VC1 A;  1W7P A;  5C4X J;  4F55 A;  2HOA A;  4DW6 A;  3WTW C;  1B59 A;  1ONV A;  1UHM A;  2HPI A;  4DJA A;  1ETY A;  2CUF A;  2GOX B;  1I3Q J;  3CJQ B;  2GXB A;  2NVX J;  4JBA A;  2R5Z A;  4AVZ A;  2O8K A;  2K5C A;  2JA8 J;  5JI6 A;  5AIP A;  4PJJ A;  4EVI A;  2EH3 A;  2OC6 A;  3A4C A;  1REP C;  1D1C A;  2R7F A;  3M8E A;  1O4X A;  2M4G A;  4HF0 A;  4RGR A;  3JRH A;  5TRD A;  3MD2 A;  1E3O C;  2L9N A;  3LSM A;  3D5S C;  2MLK A;  4B8X A;  4YFN F;  5FKN A;  3B6C A;  4WK8 F;  3WTT C;  1MNE A;  2IRF G;  2DA5 A;  4L9V A;  3GTK J;  3HYI A;  3GZ5 A;  4M72 A;  3DWL E;  3D5L A;  3GTQ J;  2MG4 A;  5J40 A;  2LRD A;  3JSO A;  4XLE A;  2DQL A;  3SEZ A;  4QIW N;  4HF2 A;  1IRX A;  2BV6 A;  3GLX A;  4LD5 A;  1XGN A;  1SAU A;  3QYB A;  4BJ6 C;  4ZZL A;  1J75 A;  2H8R A;  3W6V A;  2RC4 A;  2DPD A;  3U9G A;  3DEU A;  2FMY A;  3A02 A;  2HVS A;  3J81 Z;  4UVC A;  3JAM Z;  2KKO A;  4IQ4 A;  3R0A A;  2LP0 A;  3SZP A;  2GIZ A;  2P5V A;  1W5T A;  1WJB A;  2FUG 2;  2M0C A;  2L9V A;  5HDN A;  1HA8 A;  2F5F A;  4JX6 A;  2IBD A;  2CMP A;  1ZR4 A;  5HOO A;  5BNG A;  2NVY J;  4RAG A;  5FRO A;  3PQK A;  4N4N B;  3NAU A;  4RB0 A;  1GXQ A;  4AID A;  4ZJZ A;  2AS5 F;  1SVM A;  2DFF A;  2D1V A;  2CQK A;  4A3F J;  2BVM A;  3ZR8 X;  3S16 J;  2PMU A;  3MMY B;  5J8F A;  4RBO A;  2KRF A;  3Q0W A;  2H27 A;  5LFA A;  3F8F A;  4IX7 A;  1CGP A;  3P9K A;  4YEJ A;  1XPX A;  3KYD B;  3G3Z A;  2LFB A;  2NS8 A;  1RC9 A;  3E6D A;  4NC7 A;  2GZW A;  3TO6 A;  2DA7 A;  3F22 A;  1G2H A;  2IEK A;  3I59 A;  5BPI A;  2E2I J;  1W36 C;  4KIS A;  4HV5 A;  4IOC F;  4EMS A;  2A6T A;  2L02 A;  5GAD J;  2CRG A;  4LGW A;  1TWA J;  2CW0 F;  3CMA I;  3OYA A;  1BBY A;  2ZBK A;  3SXY A;  3GXO A;  3JRI A;  1IG7 A;  1IN5 A;  2WB1 N;  4HDV A;  5GP9 A;  1ZHF A;  2XRO A;  5E8I A;  5DEQ A;  1PUF B;  2O6G E;  1FBU A;  2P81 A;  4RLF A;  2HGC A;  3TOA A;  2A69 F;  2O5R A;  1KGS A;  2QVO A;  4HAM A;  5DCF A;  1OKR A;  4LFU A;  2DI3 A;  3ABM H;  3QRF F;  3BR1 A;  1AKH B;  2A5Y B;  3ECH A;  4O3M A;  3ASN H;  1CF7 B;  3SZG A;  2CFX A;  1I6X A;  1SD4 A;  2L4A A;  1K4T A;  2FQ3 A;  3CME I;  2IA0 A;  2V6E A;  1NH3 A;  4Y7N J;  1ZGJ A;  2Y31 A;  3PO3 J;  2XGE A;  4P5O A;  2ZNY A;  4W97 A;  3CO7 C;  1Z91 A;  3K4K A;  2XAH A;  4PCQ A;  2X1E A;  3CCU I;  3A0B C;  4RM2 A;  2K9M A;  3VYT B;  3WG9 A;  4BDZ A;  5J8C A;  2DU9 A;  2QEN A;  4ENK A;  2UUZ A;  1U6G A;  5ERI A;  4G8X A;  4LB6 B;  1YJN I;  1DU6 A;  1VFC A;  2Z99 A;  1YIJ I;  4BXF A;  1JUM A;  3WU2 C;  4HEA 2;  3QP6 A;  5B66 C;  3ABT A;  4IHV A;  5JLW A;  2PLY A;  4ZYE A;  3HHH A;  4BH9 A;  3Q3S A;  1VI0 A;  1JXS A;  2R7Z J;  2EA4 A;  3DV8 A;  2GM4 A;  3CP2 A;  1R36 A;  3UR3 C;  1WCM J;  4HBL A;  3ULQ B;  1XDU A;  4HZF A;  4YRV A;  2DAO A;  1P9Q C;  3CUO A;  2Y75 A;  3DTE A;  5F08 A;  4BS9 A;  2XSJ C;  3LAP A;  3K6G A;  1VQ8 I;  1Q1V A;  2OJE D;  3DU5 A;  4E4H A;  3FKJ A;  5FKK A;  3VOE A;  5ILV A;  2CQX A;  2IGM A;  1Z6R A;  5EDN A;  2W85 A;  3ZMT A;  2FD5 A;  1FSE A;  4G94 A;  3BR0 A;  4IHS A;  4PSX A;  3OL4 A;  1E0E A;  2CQ7 A;  2VXD A;  4C3J J;  1LPQ A;  5LBQ A;  2XB0 X;  2V1X A;  3L2C A;  2HQ5 A;  1QRY A;  2R4G A;  1TT0 A;  1LE8 B;  4DZJ A;  2XAG A;  3TMO A;  2LK2 A;  4GYG A;  5FD6 A;  1HKT A;  4M6X A;  2AO9 A;  1O3R A;  3K70 C;  2IA1 A;  5DCM B;  2L4M A;  3H9Q A;  3CCV I;  1GV2 A;  1UHW A;  3A2K A;  2PN6 A;  3F23 A;  1E2X A;  1K6Y A;  2R3S A;  2LKP A;  2BY0 A;  3VEP A;  3ZQG A;  2EJR A;  4JP0 A;  1VQK I;  2EIM H;  2DMP A;  4C30 A;  2KIU A;  1V4R A;  4XMY A;  1EH8 A;  1R6R A;  4A5M A;  1XGM A;  1XGO A;  2DK5 A;  2E35 A;  3HKZ N;  1V3F A;  1X1B A;  2HKO A;  3OYH A;  3KFW X;  4A0Z A;  2ADU A;  2F4M B;  4RGX A;  5DDG A;  2YS9 A;  3IKT A;  2ELJ A;  2XGX A;  1XC5 A;  1MIJ A;  2KDZ A;  4HLX A;  5FGM A;  1YX5 A;  1TP4 A;  2LKS A;  2UZK A;  3UKG A;  1MZB A;  3IRR A;  4YIR X;  2W00 A;  1DPU A;  1F43 A;  4G7H F;  3KLN A;  2CG4 A;  1GV5 A;  1IRZ A;  3L09 A;  2JMW A;  3LFK A;  1OLT A;  2QLZ A;  1H89 C;  4II2 A;  1TC3 C;  1WSU A;  2LDU A;  2E60 A;  4HST A;  3V7R A;  3HIF A;  2V9K A;  2Y69 H;  3V8J A;  5FFX A;  1A36 A;  2Z5U A;  2MBF A;  1VND A;  3KP6 A;  1IV6 A;  3MKL A;  4HQM A;  1USS A;  4OMZ A;  4C3H J;  2D2W A;  2ZJP F;  3CCM I;  4B44 A;  2G7U A;  4N4O B;  1BW6 A;  4BE1 A;  3DPL C;  2M5W A;  4AIJ A;  3H5N A;  3RI4 A;  3GFJ A;  1RET A;  2AQF A;  4FX4 A;  3K7A J;  3V7S A;  1G8X A;  2VQG A;  5L3B A;  3FDY A;  2K9N A;  3EUA A;  3BCA A;  1FMW A;  5BS6 A;  2WAQ A;  3OOU A;  2EPF A;  2A6H F;  4XBF A;  4A3M J;  1FJL A;  1LFB A;  1XD7 A;  5TJJ A;  2PG4 A;  1FOX A;  3M1E A;  4ZH4 F;  3FBI B;  3CF5 F;  1JHF A;  5HLH A;  1JKQ C;  3MWM A;  5J4Y A;  4CYC B;  2RQQ A;  2IS6 A;  2JVH A;  3FM5 A;  4YIF A;  3EET A;  2R7D A;  1MBJ A;  2LMD A;  2YX4 A;  1ERD A;  1T08 B;  1BN5 A;  1JI8 A;  1ETV A;  1KQ0 A;  2E1M C;  2FA5 A;  5C4J J;  2KJC A;  2VQH A;  2AHQ A;  2L01 A;  2WAE A;  4JOM A;  1SFU A;  5LGN A;  3MFK A;  2OV7 A;  5CYV A;  3K4N A;  3IH3 A;  3QOD A;  1LFU P;  4C2U A;  2Y0S N;  4A0Y A;  1W4M A;  3N97 A;  3KEO A;  1FPQ A;  5D8L B;  2E36 A;  4DBQ A;  1ZAR A;  3KZZ A;  2Q2E A;  5CJ9 A;  3MVP A;  1H8A C;  2HOE A;  1BI0 A;  2HXI A;  2E19 A;  1S3J A;  3F8N A;  1QNT A;  3ZXS A;  5IYD J;  2ZNZ A;  3BTC A;  2EV0 A;  1RR7 A;  3QOP A;  2NRA C;  3M8F A;  2M4K A;  2K9S A;  2K40 A;  1TTY A;  2VXZ A;  1XCB A;  2HS5 A;  1U8R A;  1N25 A;  2XAU A;  1F9N A;  3CC7 I;  2W24 A;  2EBI A;  2QSF X;  2CH0 A;  4OAZ A;  1YTY A;  5A2Q K;  4BBR J;  2E2H J;  3HOZ J;  4Y17 A;  3LSK A;  1Z3X A;  1MDM B;  4LIT A;  4J00 A;  1I1S A;  5CVJ A;  1OCP A;  1PP7 U;  4HNT A;  4D0P A;  3TO7 A;  5K7Z A;  2OZU A;  2W25 A;  3MAJ A;  1NTC A;  1U5T B;  3OS0 A;  4BHP A;  4CZC A;  2RV8 A;  5F04 A;  3TL4 X;  4FQG A;  4B4C A;  3GLL A;  4ZYH A;  1G3S A;  1G3Y A;  4BHC A;  2CO5 A;  2L7F P;  2EIN H;  4Q47 A;  5K5O A;  2PJR B;  2VPR A;  1IF1 A;  4A5N A;  1SAN A;  5CLS A;  3S3M A;  2ETH A;  1BOA A;  1ZGA A;  1LVK A;  3PO2 J;  2AXL A;  3KX2 A;  4UXN A;  3BC8 A;  1JTY A;  4HLY A;  1OCZ H;  2R5Y B;  4V2F A;  4BKX A;  1LKX A;  2M3A A;  1T39 A;  3DXJ F;  5L3G A;  3AAF A;  4I02 A;  3LST A;  4EJU A;  4NB5 A;  2KMU A;  1XS9 A;  1IAW A;  2ID3 A;  4A12 A;  1K78 A;  3WTZ A;  2XPV A;  2MW8 A;  2D45 A;  2VKH A;  3SDB A;  4V19 K;  2ISZ A;  2M8E A;  5ICE A;  5L3D A;  3T8R A;  4A3C J;  2BW3 B;  1MD0 A;  1YW9 A;  2BHZ A;  2WBM A;  1ZN2 A;  3FXJ A;  2FOW A;  4QWQ A;  5E3O A;  1VQO I;  4JQF A;  3J7Z I;  1Y6I A;  1Y8R B;  2QQB A;  3KEQ A;  3S2H J;  2IP2 A;  1R4N B;  4HOB A;  2TDX A;  4O5V A;  2CQN A;  3DPT A;  4PDK A;  2H1K A;  1X3W B;  2EB7 A;  4L9N A;  2ESN A;  3AG3 H;  1IN4 A;  4XR6 A;  3VPR A;  4DBR A;  3QYE A;  1FWZ A;  3BQZ A;  1ZLK A;  3CD6 I;  4E7Z A;  4GCV A;  5DD8 A;  4CCO A;  1ZTR A;  3L2Q A;  4PZJ A;  5IPA A;  1ULY A;  1WJF A;  1ZRE A;  4I7H A;  3RIR A;  3HUG A;  2BHY A;  3W6K B;  2IT0 A;  2CYY A;  4JX5 A;  2DMQ A;  5IT9 K;  4L9J A;  2P5L C;  1D1A A;  3L00 A;  1MJB A;  4KUM A;  3AFH A;  1YQA A;  1U8B A;  1GLN A;  1FYM A;  5BMZ A;  1B8I B;  4X1E A;  3EPZ A;  5D6E A;  1BJA A;  2H6C A;  5M5X J;  4EQQ A;  1X1C A;  2A6E F;  2JZY A;  2ZFU A;  4N9H A;  1QPI A;  1T0F C;  3BJA A;  3BY6 A;  1Z9C A;  4UVB A;  3BDD A;  5HOD A;  3FM3 A;  1HOM A;  3CCJ I;  5IOZ A;  3CQZ J;  2DPU A;  1VZ0 A;  3ESW B;  5A2Q Z;  3KP5 A;  5E20 A;  4BGD A;  1T8I A;  4IZZ A;  1O57 A;  5EGO B;  4M3E A;  4HSR A;  2OZ6 A;  3R0J A;  3B6A A;  4M9S A;  1KA8 A;  1Z67 A;  2JUG A;  3PQJ A;  3KET A;  1XMA A;  2AQE A;  2P4W A;  1YOV B;  3F72 A;  5M3M J;  4LIV A;  4HX8 A;  4XOT A;  4BE0 A;  2Z9O A;  1U0J A;  4ZZD A;  3HGG A;  1H9G A;  3KCC A;  1ZGW A;  2DXI A;  4IQJ A;  1OIS A;  2DA1 A;  1TLH B;  4UY8 I;  1DQU A;  4XSZ F;  1YS7 A;  4KMF A;  1D1B A;  3BTI A;  5EYR A;  2MD0 A;  3JRE A;  4KJZ A;  1JTX A;  2HZD A;  5D8K B;  2LTP A;  2QM3 A;  4A3E J;  1A35 A;  1VQ7 I;  1WH7 A;  3HRM A;  4HYE A;  1SMY F;  2QWW A;  1AKH A;  4C3I J;  2OTJ I;  2CUE A;  1J7K A;  2L7M P;  5J1U A;  1CF7 A;  4EJT A;  1OFC X;  2JPB A;  2IS2 A;  2Z3Y A;  4RAZ A;  2K4B A;  4P96 A;  4I98 B;  3FF5 A;  3S1R J;  2JTV A;  2JN6 A;  4XN0 A;  2JT1 A;  3CLQ A;  1SD6 A;  5E8G A;  4NHJ A;  2CW8 A;  2KZV A;  3ZMU A;  2X51 A;  3OYB A;  4IRG A;  4R1H A;  3DEW A;  3GFL A;  1RIO H;  4ASN A;  2VOD A;  5LGU A;  3HRS A;  4NQW B;  4A3L J;  3QP5 A;  2OAZ A;  3OYN A;  1X4P A;  4XRS A;  4D1Q A;  1DGR M;  3L2R A;  4WF2 A;  2KIS A;  2BXY A;  2NYX A;  3DBH B;  5D6F A;  4W1U A;  2K9L A;  5ICF A;  3RYP A;  3CCQ I;  2LLK A;  4CCJ A;  3P9C A;  3GX4 X;  4RB3 C;  2XRN A;  2CGP A;  2L9R A;  2EFW A;  5TGT A;  2F5C A;  1IN8 A;  2DK8 A;  3MZY A;  5IT9 Z;  2CQQ A;  1T33 A;  5IP6 A;  4MQ9 F;  5BOX A;  1IGN A;  2W82 A;  2R7R A;  5E1Z B;  2HU9 A;  2HWV A;  3E7L A;  5D4S A;  2FML A;  3ML6 A;  3H5R A;  2MFZ A;  1F5T A;  2WAD A;  4P1W A;  4F93 B;  4ESF A;  1RUN A;  4LG0 B;  3G73 A;  1X1D A;  3BLY A;  1U3E M;  3NEU A;  3BPV A;  3ZQ7 A;  4MFD A;  2JQ7 A;  2I5U A;  3DP7 A;  3O2P E;  2NS0 A;  6PAX A;  4AD9 A;  1U5T C;  1IRF A;  2ESH A;  3BPX A;  4IRH A;  1Y0N A;  3T0Y A;  1A6Q A;  4GXO A;  1LE8 A;  1R00 A;  3W2W A;  1VQ9 I;  2IXS A;  3G1O A;  4L5J A;  5DCM A;  3MZ8 A;  2OA4 A;  2JPC A;  3PUB A;  3DLL F;  4U88 A;  1BIA A;  2FJ1 A;  2VE8 A;  2QCO A;  2Y30 A;  3GZN B;  3KP3 A;  3K1M A;  4EEF G;  2YSR A;  2XB5 A;  4EGY A;  3GTL J;  3L2V A;  2VQC A;  3D0S A;  3K1N A;  2ZFW A;  5L3C A;  2K3P A;  3OYK A;  5JHF A;  4MGR A;  4LLL A;  2R7S A;  1FIP A;  3A01 A;  1GUU A;  1E17 A;  3GYH X;  2Y9Y A;  4UV9 A;  4DQ2 A;  3GEZ A;  1SEU A;  3VFZ A;  2F2E A;  3IUO A;  2XKO A;  2WAQ N;  1RZ4 A;  3ABL H;  2LOO A;  2XHK A;  3TP3 A;  1R49 A;  3EUH C;  3F8B A;  3NWT A;  3BZ6 A;  4BL0 B;  5D5W B;  2L2O A;  3BQY A;  1LFP A;  3IKV A;  2CSO A;  1OJL A;  2CWE A;  3R4K A;  3LAJ A;  1D0Z A;  2ZSH B;  4PJM A;  1X2M A;  4ANJ A;  4MTE A;  3ZQH A;  2DJN A;  2DOE A;  2E5Z A;  3MEX A;  3PIO F;  1JT0 A;  5E17 F;  2IGO A;  3CUQ A;  4DGW B;  5LEK A;  3IH2 A;  4KT5 C;  4Q48 A;  2XF5 A;  5F64 A;  3LA7 A;  3ABU A;  3I53 A;  2UV1 A;  3RDI A;  3JCU C;  1G4D A;  3WHB A;  1JHH A;  3GF2 A;  2FBK A;  4RDU A;  3HRU A;  1UJ8 A;  2XGC A;  3H1C A;  2CJJ A;  4IEJ A;  2PQ8 A;  4ZYD A;  5JVT A;  4II3 A;  1LEA A;  1WGX A;  1XX5 A;  1Z1D A;  3M07 A;  4BNC A;  3QPT A;  5F0F A;  4FAS D;  1YRN B;  3FZV A;  4LK0 F;  3LNQ A;  3H9G A;  2N8G A;  4P9U A;  3ZQL A;  1YW8 A;  1FNN A;  3ELK A;  2VQL A;  5GPC A;  3K4C A;  2FEZ A;  3J80 K;  3FXK A;  3SYT A;  2ELH A;  2HQR A;  3MCZ A;  4E70 A;  3JRF A;  2NVT J;  5IY5 H;  1IRG A;  1VQ5 I;  2L0K A;  2ZXI A;  3FIS A;  3L2W A;  4K2E A;  3CC2 I;  3E6B A;  3DBL B;  3GTP J;  4GGG A;  3TDU C;  3V42 A;  2VOP A;  1Z3Y A;  2W7N A;  1K7A A;  1QBJ A;  3HL2 A;  1S29 A;  1TQM A;  3G71 I;  1SFX A;  4M3F A;  2NVU B;  2Z33 A;  1PJR A;  4ZYG A;  3OV8 A;  3G6E I;  5EG0 B;  4HPQ A;  2E1M B;  3AG2 H;  1DU0 A;  3ZP5 A;  3ERE D;  4UVA A;  4PSW A;  2RDP A;  4FE4 A;  2F5D A;  3AG4 H;  4EJV A;  1HC8 A;  4DYR A;  4ENM A;  2YU3 A;  3G1M A;  3FHZ A;  3BZK A;  1X1A A;  2ZME C;  2E1C A;  1ETX A;  2M34 A;  2EZH A;  4IHT A;  3E6M A;  4M3G A;  5JVG F;  2VAS A;  3F0C A;  3DEE A;  2NOJ B;  5DS9 A;  5FLM J;  3GFI A;  4L0Z B;  1U9N A;  3AG1 H;  3TW7 A;  2VE9 A;  4O6J A;  2R92 J;  1ENH A;  4WCG A;  2MD5 A;  4OIP F;  4UUT A;  1LEB A;  2BY1 A;  3JTG A;  3WTX C;  1I50 J;  1Z7U A;  1Z05 A;  4ZDP A;  2R7O A;  3HM5 A;  3E1S A;  5H6Q A;  4IHX A;  4S0H B;  3GFM A;  5E3N A;  1N75 A;  3ONQ A;  1JGG A;  4E7K A;  1HLV A;  4MTD A;  4XKB A;  5HDG A;  5L3F A;  5IYC J;  3E5Q A;  1R5H A;  2F6C A;  2FRH A;  4WXH A;  2DA2 A;  3GO5 A;  4B47 A;  3H35 A;  4CIC A;  3H0G J;  2KJB A;  4L5I A;  2LBF B;  2M7B A;  4FT8 A;  4XLA A;  1NG7 A;  2B7E A;  2HYG D;  1FYL A;  2VON A;  3HOY J;  4AWX B;  4HDU A;  3OSG A;  2DN0 A;  4XK4 A;  2ZSI B;  2QUF A;  1LDD A;  3HG9 A;  2VL8 A;  3RYR A;  3TBI A;  5ICC A;  3WTV C;  4XRF A;  2R7X A;  3KE2 A;  1Y1W J;  2F5E A;  2LVS A;  2OUM A;  3RZO J;  4C2M J;  2MGQ A;  3H3Z A;  3HEF A;  2LF8 A;  3L2U A;  1JKR C;  3D5R C;  3TOB A;  2PEX A;  5F0H A;  3A03 A;  3JRD A;  2QQ9 A;  4BUP A;  1WJD A;  3DKY A;  1W0U A;  1RI7 A;  2HQA A;  1ZG5 A;  2E34 A;  4IF4 A;  2ZB9 A;  1WJC A;  5CVU A;  3W2V A;  2B63 J;  1Y56 A;  4OOI A;  5J47 A;  5F6F A;  3M9A A;  5LHG A;  1WH5 A;  2BW3 A;  1LDJ A;  5KCM A;  1QGP A;  2RKH A;  4XKC A;  1FEX A;  2H09 A;  1D8K A;  2UXX A;  1WVR A;  3FHN A;  3MZH A;  1GXP A;  3E0J B;  3HJE A;  5HLI A;  2Z16 A;  4A3G J;  5M5W J;  4PUS A;  1ZQ3 P;  2EA2 A;  1P92 A;  4QPQ A;  3VSK A;  2V9P A;  3FMQ A;  1FSH A;  2JRT A;  1TW3 A;  1TWC J;  3S15 J;  2C6Y A;  3E5X A;  3OIO A;  1XN7 A;  1ZRF A;  3PUF A;  2F5V A;  1VTN C;  4YEL A;  1P4A A;  2JK3 A;  4L18 B;  5J6X A;  2RGV A;  1ZAO A;  1RES A;  3KLO A;  5K7H A;  2QA4 I;  1FP2 A;  4OIO F;  1OCO H;  1K79 A;  5C3E J;  3I0T A;  1OYW A;  4BBS J;  2DJI A;  1TL8 A;  3MQ0 A;  3CDI A;  4HV6 A;  1B8I A;  4NUB A;  1T2K A;  4A3J J;  3SFZ A;  3K9T A;  3KP7 A;  4CYD A;  1R1V A;  3NQO A;  2QEX I;  5IYB J;  1W5C C;  3WE3 A;  1UHS A;  1ODD A;  5CPR B;  5B3S H;  1MJ9 A;  3ZN1 A;  1IXS B;  4CCK A;  1W7P B;  2QBY B;  2QSH X;  3BT9 A;  2QKM B;  2VI6 A;  4J19 A;  3LSG A;  4HX7 A;  1D0Y A;  2WAF A;  1QVT A;  4BAY A;  2XKP A;  3BR3 A;  2R5Z B;  1MKM A;  5K5Q A;  2XUB A;  5CQG A;  1AU7 A;  1LVA A;  4IHY A;  2XV4 S;  1XG1 A;  2DMT A;  4PJN A;  1B6A A;  2E5N A;  4R79 A;  4ON0 A;  3PNV A;  3T8T A;  3MKZ A;  3RKQ A;  2VBX A;  4G6Q A;  5E1W A;  3DTI A; 
#chains in the Genus database with same CATH homology
 3HTS B;  2YR2 A;  2A3S A;  4G6D A;  1B9N A;  2ISY A;  2DO7 A;  1AWC A;  5HS9 A;  5FLX K;  1QQI A;  1S7O A;  4I01 A;  4RB2 C;  3R60 A;  1D5V A;  5DUK A;  2RNJ A;  3BWG A;  1SMT A;  2P8T A;  3H3U A;  3O6B B;  4RGS A;  3I64 A;  4CHU A;  2XAJ A;  5FO5 A;  1TNT A;  1ZYR F;  3EQL F;  4NQW A;  1YFH A;  4TV7 A;  4U0Y A;  3U1D A;  2MLG A;  4U7B A;  4L9T A;  2LNB A;  1FP1 D;  4Y13 A;  3P9I A;  2M30 A;  4ETS A;  5EEG A;  2PFB A;  2GA1 A;  1SAX A;  2FNA A;  2RVC A;  3R61 A;  1BC8 C;  2VC0 A;  1W5S A;  2BEO A;  3BJO A;  3TO9 A;  3ZPL A;  1HQC A;  4UNO A;  3VOD A;  5FD5 A;  2PBI A;  1OYI A;  2ZCW A;  2J5P A;  4HF1 A;  1T6S A;  1EH6 A;  1PDN C;  4Q5S F;  1OR7 A;  5L3E A;  2E1N A;  5K5R A;  3WOD F;  2IW5 A;  3T5X A;  2IA2 A;  1FC3 A;  1R7J A;  5FB2 A;  1WI9 A;  4A6E A;  2K27 A;  2V9V A;  4S04 A;  4IJA A;  2FBH A;  1T38 A;  1SFE A;  4AVP A;  2FXA A;  4DNC A;  1FOK A;  1UST A;  2QQA A;  1YG2 A;  3E5U A;  1FYK A;  2LF7 A;  5CVI A;  4G9Y A;  2OQR A;  2Q0O A;  3V8L A;  3KP4 A;  1K6O A;  2QZ8 A;  1A04 A;  1XSV A;  3K0L A;  1IXC A;  1FLI A;  2Y48 A;  3LQR A;  1R5G A;  3B73 A;  3QAH A;  1J2X A;  3FX3 A;  3R6S A;  5HDK A;  1TW2 A;  5D5X B;  4BHB A;  4AIK A;  1T98 A;  4CO8 A;  2BE5 F;  4IXA A;  5IT3 A;  2M45 A;  3TQN A;  3E3V A;  1YO5 C;  4HX4 A;  5ED4 A;  2HR3 A;  1WQ2 A;  4OU0 A;  1L0O C;  5HS7 A;  2ZME B;  4EGZ A;  4HA8 A;  1SD5 A;  5DV5 A;  1JE8 A;  1FZP B;  3IWZ A;  1P4X A;  3N4M A;  1ON1 A;  2G9W A;  2FF4 A;  2L54 A;  1BIB A;  5F1R A;  2Y0M A;  3E97 A;  3RTR A;  3U2R A;  1Q1H A;  1UB9 A;  4BYY A;  4CZZ A;  3V8K A;  4Z2Y A;  2XAF A;  1XDS A;  4F7Z A;  2EV6 A;  3Q5F A;  1HSJ A;  3FXU A;  2WTE A;  3HSF A;  3LA2 A;  3WE2 A;  1O3Q A;  2X0L A;  4I09 A;  4KIB A;  3RPQ A;  3RKY A;  4OIQ F;  5ILU A;  3DF8 A;  4JK1 X;  2G7H A;  4A0X A;  2BBY A;  1UCR A;  3Q9V A;  4M9X A;  4OMY A;  5CVV A;  2ZXJ A;  5LEJ A;  2BGC A;  3JAM K;  2O8X A;  4OIR F;  2X4H A;  1S6L A;  5E18 F;  3ECO A;  3K69 A;  4HQE A;  4I2O A;  4KN7 X;  4RB1 A;  1BC7 C;  5K1Y A;  2P7C B;  1XCV A;  1O3S A;  5D4R A;  2GA2 A;  1WWX A;  2XIG A;  3JW4 A;  4MEY F;  5KK1 A;  4ESJ A;  4IPA A;  2DBB A;  1HW2 A;  2B0L A;  3IHU A;  5CVR A;  2XAS A;  3NRV A;  2VBW A;  1ZG3 A;  1EV7 A;  3RJP A;  2XAQ A;  3SZT A;  2DT5 A;  1O7L A;  4MQV A;  2VT2 A;  3CJN A;  3FMS A;  1O3T A;  3ISP A;  2VBY A;  1T0F A;  1R58 A;  2QBY A;  2PI0 A;  1HW1 A;  2VN2 A;  1IN7 A;  3GW2 A;  3E6C C;  4UHT A;  1K78 B;  1MJA A;  4BXU A;  2OU2 A;  1YYV A;  3FXQ A;  2HZT A;  4GO1 A;  3HSR A;  3WU1 B;  2ZO4 A;  5DYM A;  4P55 A;  1DPR A;  2COM A;  2OQG A;  1NHA A;  4ENN A;  1TQI A;  2M87 A;  3CDH A;  4EM0 B;  2YX7 A;  1S8N A;  5LHI A;  2K7L A;  4GYI A;  3RKX A;  2IVM A;  1I1G A;  4EM2 A;  2GAU A;  3C1D A;  1R22 A;  2L3D A;  2P6T A;  5HVQ C;  4OIN F;  2OBP A;  3QU6 A;  3DKW A;  5AON A;  1XSD A;  4KN4 X;  2LSO A;  5DUI A;  5JFR A;  2EK5 A;  2GIV A;  4RGU A;  1U78 A;  2MH2 A;  4A2U A;  5LHH A;  2XVC A;  1FY7 A;  1LQ1 A;  2YPR A;  4YG2 F;  1YW7 A;  1DUX C;  3FXR A;  2V1U A;  1L3L A;  2K02 A;  2WV0 A;  3WTS C;  2WWY A;  1MDM A;  3IWF A;  2FE3 A;  3K1P A;  1XMK A;  3DQV C;  2MH9 A;  1FT9 A;  1U5T A;  3O3K A;  2H6B A;  4KIF A;  1KYW A;  4XLP F;  3I5U A;  2PJP A;  1Z6T A;  3T1B A;  1YIO A;  2J5O A;  1LB2 A;  3KZY A;  1PUE E;  2W57 A;  2DTR A;  1R1T A;  1KU2 A;  3V7C A;  3WGI A;  4IVN A;  1PP8 F;  1WRJ A;  4CGZ A;  2ZKZ A;  2UXN A;  5JR3 A;  1P6R A;  3J80 Z;  3EUH A;  4ENJ A;  2RN7 A;  4XLN F;  2VOO A;  1KYZ A;  2WC2 A;  3ROU A;  4H0E A;  3PFI A;  1QPM A;  1LNW A;  2HEO A;  5KVR A;  3CO6 C;  2DFI A;  1B1B A;  1IXR C;  4EJW A;  5LLQ A;  1D8J A;  1KQ8 A;  2NNN A;  5AIQ A;  5H20 A;  2K86 A;  1IUY A;  4WX9 A;  5EEH A;  4QLC U;  2IPQ X;  1S7A A;  2V79 A;  3QU3 A;  2E7W A;  4KFC A;  3C7J A;  3OOP A;  1BM9 A;  2MC3 A;  4UV8 A;  1GVJ A;  1I5Z A;  4UUV A;  1HKS A;  1FX7 A;  4PGH A;  2HDC A;  2DW4 A;  2BYV E;  2FBI A;  3V4G A;  3ZMV A;  1JGS A;  3K2Z A;  3B02 A;  1FBS A;  1F4K A;  4U0W A;  2W84 A;  3CUQ B;  2GXG A;  2ZME A;  4KA4 A;  1KU7 A;  4YFX F;  3EYI A;  3FWE A;  4U7D A;  4KNY A;  1YS6 A;  2P6S A;  3F8C A;  5FFZ A;  2PMH A;  1AOY A;  1QZY A;  4S05 A;  1OMI A;  3CTA A;  1ON2 A;  4G7O F;  2DLL A;  1EH7 A;  1OPC A;  4RAY A;  3J7A O;  4WXC A;  4N0B A;  4B09 A;  3I71 A;  4WXD A;  2HQN A;  1J0R A;  1IW7 F;  1J9I A;  1KU9 A;  4M73 A;  4A6D A;  1QO0 D;  1IN6 A;  3EYY A;  2K4J A;  3ZMZ A;  3CLO A;  3F6O A;  1SD7 A;  3C3W A;  1J59 A;  4CXF A;  4KDP A;  3I59 B;  1B9M A;  1G3T A;  2ZJ2 A;  4LG0 A;  2V6C A;  3HOS A;  2M1B A;  1U2W A;  3HSE A;  1DDN A;  3HHG A;  3Q9S A;  2V1D A;  1TBX A;  4M74 A;  4R8H A;  3ZMD A;  4EM1 A;  1KU3 A;  2EFO A;  1DP7 P;  1ZH5 A;  3JTH A;  1STZ A;  1H9T A;  4YFK F;  3WGH A;  4PGG A;  3EDP A;  5ICG A;  3WTY C;  1OYY A;  2HYF A;  4MHG A;  4M71 A;  3HTU A;  5D5V B;  2IJL A;  4I0B A;  4HW0 A;  3SQN A;  2FSW A;  1BI3 A;  1MGT A;  2DQR A;  2QYO A;  1RUO A;  2RQP A;  2KIM A;  5FLX Z;  3DFG A;  4LLN A;  4AIH A;  2O03 A;  1I27 A;  4FHT A;  2OD5 A;  3FMR A;  5LGT A;  2UWM A;  3GWZ A;  2P5K A;  2HFH A;  2A61 A;  1FBQ A;  2FU4 A;  3ZMS A;  3BJ6 A;  3LWF A;  3SHF A;  3JSP A;  5HS8 A;  1C0W A;  4Y15 A;  1B4A A;  4MNU A;  2E7X A;  4M6Y A;  1LDK B;  2P7V B;  3HOT A;  4WWC A;  4LB5 A;  2HTJ A;  4XSX F;  4KIG A;  1ZG1 A;  1HXD A;  5JHU A;  3I54 A;  3KP2 A;  3L9F A;  2EFQ A;  3LA3 A;  1G6N A;  3F21 A;  4LMY A;  1X3U A;  4P9F A;  4I0A A;  4KMU X;  2EWN A;  5BPD A;  1P2F A;  4KIC A;  3TGN A;  2STT A;  1WKM A;  3M7G A;  1ZLJ A;  3C18 A;  2MA3 A;  3I58 A;  3WU0 A;  1RNL A;  1Y0U A;  2FNP A;  2EFN A;  2NNY A;  2NAZ A;  4LLG F;  5BQT A;  2D1H A;  2FOK A;  3CUQ C;  3IL2 A;  1J5Y A;  3RPU A;  3ZN0 A;  3H92 A;  2HKX A;  3F6V A;  3LQQ A;  3F3X A;  3BRO A;  5HLG A;  2JSC A;  3P7N A;  1W7P D;  1XB4 A;  1R1U A;  5ILS A;  4MEX F;  4BQA A;  4L0Y B;  4Q4Z F;  3TKY A;  1HKQ A;  1TNS A;  3WGG A;  4CDG A;  4M9Z A;  3GUD A;  1BI2 A;  1BI1 A;  3IC7 A;  2VT3 A;  5E1X A;  3W6J B;  1ZRD A;  4N9I A;  1YLF A;  2A68 F;  5DD4 A;  4U0V A;  1HST A;  3TDZ C;  2GQQ A;  4KYW A;  2O3F A;  1HBX G;  1D3Y A;  4G7Z F;  4LJZ F;  2EFP A;  2ACJ A;  2O0Y A;  2O61 A;  2H94 A;  1XSX A;  3J81 K;  4ESB A;  1UFM A;  1F1Z A;  1GHC A;  1G3W A;  3GZ6 A;  3L7W A;  1TQP A;  3COA C;  4RS8 A;  4LK1 F;  1QZZ A;  4YII A;  1R23 A;  1P4W A;  4FX0 A;  1O7F A;  3I4P A;  1H0M A;  1IZ1 A;  1LJ9 A;  3QPH A;  3REO A;  1ZRC A;  3HRT A;  1HW5 A;  1KQ9 A;  3S2W A;  3IRQ A;  2GWR A;  2A07 F;  5D5U B;  3GVA A;  2HTS A;  1XGS A;  2Q8K A;  4IRI A;  3F8M A;  3RKW A;  5H6R A;  4EJO A;  2KIF A;  3VB2 A;  2VBZ A;  3BOQ A;  3WTU C;  2STW A;  5LRR A;  3BP8 A;  2EV5 A;  5LRS A;  2VC1 A;  1W7P A;  3WTW C;  1B59 A;  1ONV A;  1UHM A;  2GXB A;  4JBA A;  5JI6 A;  5AIP A;  4EVI A;  1REP C;  2R7F A;  3M8E A;  4HF0 A;  4RGR A;  5TRD A;  2MLK A;  4B8X A;  4YFN F;  4WK8 F;  3WTT C;  2IRF G;  4L9V A;  3HYI A;  3GZ5 A;  4M72 A;  3D5L A;  3JSO A;  2DQL A;  2BV6 A;  3GLX A;  4LD5 A;  1XGN A;  4ZZL A;  4HF2 A;  1J75 A;  2RC4 A;  2DPD A;  3U9G A;  3DEU A;  2FMY A;  3J81 Z;  4UVC A;  3JAM Z;  2KKO A;  3R0A A;  3SZP A;  2P5V A;  1W5T A;  5HDN A;  2F5F A;  5HOO A;  3PQK A;  4RB0 A;  1GXQ A;  2AS5 F;  2D1V A;  2CQK A;  2PMU A;  5J8F A;  2KRF A;  2H27 A;  3F8F A;  1CGP A;  3P9K A;  3G3Z A;  3E6D A;  2GZW A;  3TO6 A;  3F22 A;  3I59 A;  5BPI A;  4HV5 A;  4EMS A;  2L02 A;  4LGW A;  2CW0 F;  1BBY A;  2ZBK A;  3SXY A;  3GXO A;  1IN5 A;  4HDV A;  1ZHF A;  2XRO A;  5E8I A;  5DEQ A;  2O6G E;  1FBU A;  2HGC A;  3TOA A;  2A69 F;  2QVO A;  1KGS A;  4HAM A;  5DCF A;  1OKR A;  4LFU A;  2DI3 A;  3QRF F;  4O3M A;  2A5Y B;  3ECH A;  1CF7 B;  2CFX A;  1I6X A;  1SD4 A;  2L4A A;  2FQ3 A;  2IA0 A;  1ZGJ A;  4P5O A;  2ZNY A;  3CO7 C;  1Z91 A;  2XAH A;  4PCQ A;  3WG9 A;  5J8C A;  2DU9 A;  2QEN A;  4ENK A;  1U6G A;  5ERI A;  4G8X A;  4LB6 B;  2Z99 A;  3QP6 A;  3ABT A;  2PLY A;  4ZYE A;  3HHH A;  4BH9 A;  1JXS A;  2EA4 A;  3DV8 A;  1R36 A;  4HBL A;  3ULQ B;  1XDU A;  4HZF A;  2DAO A;  3CUO A;  2Y75 A;  3LAP A;  3VOE A;  5ILV A;  1Z6R A;  2W85 A;  3ZMT A;  1FSE A;  4G94 A;  4IHS A;  5LBQ A;  2V1X A;  3L2C A;  2XAG A;  4GYG A;  5FD6 A;  1HKT A;  4M6X A;  1O3R A;  2IA1 A;  5DCM B;  2L4M A;  1UHW A;  2PN6 A;  3F23 A;  1E2X A;  2R3S A;  2LKP A;  3VEP A;  2EJR A;  2KIU A;  1V4R A;  1EH8 A;  4A5M A;  1XGM A;  1XGO A;  2DK5 A;  1V3F A;  2HKO A;  3KFW X;  4A0Z A;  2ADU A;  4RGX A;  5DDG A;  3IKT A;  2XGX A;  4HLX A;  5FGM A;  2UZK A;  1MZB A;  3IRR A;  1DPU A;  4G7H F;  3KLN A;  2CG4 A;  3L09 A;  3LFK A;  2QLZ A;  1WSU A;  2LDU A;  3V7R A;  3HIF A;  3V8J A;  5FFX A;  2Z5U A;  2MBF A;  3KP6 A;  4HQM A;  1USS A;  4OMZ A;  2D2W A;  2G7U A;  3DPL C;  2M5W A;  4AIJ A;  3RI4 A;  3GFJ A;  4FX4 A;  3V7S A;  5L3B A;  5BS6 A;  2A6H F;  4XBF A;  1XD7 A;  5TJJ A;  2PG4 A;  3M1E A;  4ZH4 F;  1JHF A;  5HLH A;  3MWM A;  3FM5 A;  4YIF A;  3EET A;  2R7D A;  2YX4 A;  1BN5 A;  1KQ0 A;  2FA5 A;  2KJC A;  2L01 A;  1SFU A;  5LGN A;  3MFK A;  5CYV A;  4A0Y A;  1W4M A;  3N97 A;  3KEO A;  1FPQ A;  5D8L B;  1ZAR A;  3KZZ A;  2Q2E A;  5CJ9 A;  2HOE A;  1BI0 A;  1S3J A;  3F8N A;  1QNT A;  2ZNZ A;  2EV0 A;  3QOP A;  2NRA C;  3M8F A;  1TTY A;  2VXZ A;  1XCB A;  2HS5 A;  1U8R A;  1F9N A;  2W24 A;  1YTY A;  5A2Q K;  4Y17 A;  1MDM B;  1I1S A;  5CVJ A;  1PP7 U;  4D0P A;  3TO7 A;  2OZU A;  2W25 A;  3MAJ A;  1U5T B;  4BHP A;  2RV8 A;  4ZYH A;  1G3S A;  1G3Y A;  4BHC A;  2CO5 A;  4Q47 A;  5K5O A;  1IF1 A;  4A5N A;  5CLS A;  2ETH A;  1BOA A;  1ZGA A;  2AXL A;  4UXN A;  4HLY A;  1T39 A;  3DXJ F;  5L3G A;  3AAF A;  4I02 A;  3LST A;  4EJU A;  4NB5 A;  1IAW A;  4A12 A;  1K78 A;  3WTZ A;  2D45 A;  2ISZ A;  2M8E A;  5ICE A;  5L3D A;  3T8R A;  1MD0 A;  1YW9 A;  1ZN2 A;  4QWQ A;  4JQF A;  2QQB A;  3KEQ A;  2IP2 A;  4HOB A;  2TDX A;  4O5V A;  3DPT A;  4PDK A;  2EB7 A;  4L9N A;  2ESN A;  1IN4 A;  1FWZ A;  1ZLK A;  4GCV A;  5DD8 A;  4PZJ A;  1ULY A;  1ZRE A;  4I7H A;  3RIR A;  3HUG A;  3W6K B;  2IT0 A;  2CYY A;  5IT9 K;  4L9J A;  2P5L C;  3L00 A;  1MJB A;  4KUM A;  1YQA A;  1FYM A;  5BMZ A;  5D6E A;  1BJA A;  2H6C A;  4EQQ A;  2A6E F;  2JZY A;  4N9H A;  3BJA A;  3BY6 A;  1Z9C A;  4UVB A;  3BDD A;  3FM3 A;  2DPU A;  5A2Q Z;  3KP5 A;  5E20 A;  1O57 A;  2OZ6 A;  3R0J A;  4M9S A;  1KA8 A;  3PQJ A;  3KET A;  1XMA A;  2P4W A;  3F72 A;  4HX8 A;  2Z9O A;  4ZZD A;  1H9G A;  3KCC A;  1TLH B;  4XSZ F;  1YS7 A;  4KMF A;  5D8K B;  2QM3 A;  3HRM A;  4HYE A;  1SMY F;  2QWW A;  4EJT A;  1J7K A;  1CF7 A;  2JPB A;  2Z3Y A;  4RAZ A;  2K4B A;  4P96 A;  4I98 B;  3FF5 A;  2JTV A;  2JT1 A;  1SD6 A;  5E8G A;  4NHJ A;  3ZMU A;  4IRG A;  4R1H A;  3GFL A;  1RIO H;  4ASN A;  2VOD A;  5LGU A;  3HRS A;  3QP5 A;  2OAZ A;  4WF2 A;  2NYX A;  5D6F A;  5ICF A;  3RYP A;  3P9C A;  3GX4 X;  4RB3 C;  2XRN A;  2CGP A;  2EFW A;  2F5C A;  1IN8 A;  2DK8 A;  3MZY A;  5IT9 Z;  5BOX A;  4MQ9 F;  5E1Z B;  2HWV A;  5D4S A;  2FML A;  3ML6 A;  1F5T A;  4ESF A;  1RUN A;  4LG0 B;  3G73 A;  1U3E M;  3NEU A;  3BPV A;  3ZQ7 A;  3O2P E;  3DP7 A;  2NS0 A;  6PAX A;  4AD9 A;  1U5T C;  1IRF A;  2ESH A;  3BPX A;  4IRH A;  3T0Y A;  4GXO A;  1R00 A;  4L5J A;  5DCM A;  2OA4 A;  2JPC A;  4U88 A;  1BIA A;  2VE8 A;  3KP3 A;  4EGY A;  3K1M A;  2YSR A;  3D0S A;  3K1N A;  2ZFW A;  5L3C A;  4MGR A;  4LLL A;  1E17 A;  3GYH X;  4UV9 A;  4DQ2 A;  3GEZ A;  3VFZ A;  2F2E A;  2XKO A;  1RZ4 A;  2XHK A;  3F8B A;  3BZ6 A;  5D5W B;  3IKV A;  2CSO A;  2CWE A;  3R4K A;  3LAJ A;  4MTE A;  5E17 F;  3MEX A;  3CUQ A;  5LEK A;  4KT5 C;  4Q48 A;  5F64 A;  3LA7 A;  3ABU A;  3I53 A;  3RDI A;  1G4D A;  1JHH A;  3GF2 A;  2FBK A;  3HRU A;  2PQ8 A;  4ZYD A;  5JVT A;  1LEA A;  1Z1D A;  4BNC A;  3QPT A;  3FZV A;  4LK0 F;  4P9U A;  1YW8 A;  1FNN A;  3ELK A;  3J80 K;  2FEZ A;  2ELH A;  2HQR A;  3MCZ A;  4E70 A;  1IRG A;  4K2E A;  3E6B A;  4GGG A;  3TDU C;  2VOP A;  1K7A A;  1QBJ A;  1S29 A;  1TQM A;  1SFX A;  2Z33 A;  4ZYG A;  3OV8 A;  3ZP5 A;  3ERE D;  4UVA A;  2RDP A;  2F5D A;  4EJV A;  4ENM A;  2YU3 A;  3FHZ A;  2E1C A;  4IHT A;  3E6M A;  3GFI A;  4L0Z B;  2VE9 A;  4O6J A;  4WCG A;  2MD5 A;  4OIP F;  1LEB A;  3JTG A;  3WTX C;  1Z7U A;  1Z05 A;  5H6Q A;  3GFM A;  4MTD A;  5HDG A;  5L3F A;  3E5Q A;  1R5H A;  2FRH A;  4WXH A;  3GO5 A;  4CIC A;  2KJB A;  4L5I A;  4FT8 A;  2HYG D;  1FYL A;  2VON A;  4AWX B;  4HDU A;  2QUF A;  1LDD A;  3RYR A;  5ICC A;  3WTV C;  4XRF A;  3KE2 A;  2F5E A;  3H3Z A;  2LF8 A;  3TOB A;  2PEX A;  2QQ9 A;  1RI7 A;  1ZG5 A;  4IF4 A;  5CVU A;  4OOI A;  5F6F A;  3M9A A;  5LHG A;  1LDJ A;  1QGP A;  2RKH A;  2H09 A;  1D8K A;  2UXX A;  3MZH A;  1GXP A;  5HLI A;  2EA2 A;  1P92 A;  3FMQ A;  1FSH A;  2JRT A;  1TW3 A;  2C6Y A;  3E5X A;  1XN7 A;  1ZRF A;  1VTN C;  1P4A A;  4L18 B;  5J6X A;  2RGV A;  1ZAO A;  3KLO A;  1FP2 A;  4OIO F;  1K79 A;  3I0T A;  1OYW A;  3MQ0 A;  4HV6 A;  1T2K A;  3SFZ A;  3K9T A;  3KP7 A;  4CYD A;  1R1V A;  3NQO A;  3WE3 A;  1ODD A;  1MJ9 A;  3ZN1 A;  1IXS B;  1W7P B;  2QBY B;  4HX7 A;  4BAY A;  2XKP A;  1MKM A;  5K5Q A;  2XUB A;  1LVA A;  2XV4 S;  1B6A A;  4R79 A;  4ON0 A;  3T8T A;  2VBX A;  4G6Q A;  5E1W A;  4EV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...