2QVOA

Crystal structure of af1382 from archaeoglobus fulgidus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
RIKLLFKEKALEILMTIYYESLGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDKGQKIAQQIKSIIDIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_1382
publication title Crystal structure of AF1382 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 27
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qvoA00
4RAYA 1BN5A 5KVRA 3H3ZA 4BHCA 3Q5FA 1U5TA 1XGOA 2KIFA 4YFXF 4AWXB 3KLNA 1OYWA 2HTJA 2FE3A 3SZTA 4KA4A 4MEYF 2W84A 4HLYA 4RS8A 2QBYA 3EETA 1B6AA 3H92A 2FEZA 4KT5C 5TJJA 5J8FA 1JGSA 5DUKA 1J75A 1ZG1A 3JSPA 2YU3A 4UV8A 1PP7U 4L9TA 5E1XA 5FFXA 3L2CA 2LNBA 3VEPA 3HTUA 2EFNA 1FPQA 2HEOA 2XVCA 2LSOA 4NHJA 4G94A 5E1ZB 1OR7A 1JHHA 3TOBA 3O3KA 2E1CA 1D8KA 3EYIA 3ZMUA 1TBXA 1YW9A 3B73A 3GFLA 4A12A 2H09A 4AVPA 1ONVA 5F64A 4KDPA 2OZ6A 2A6HF 2VBWA 1R5GA 3V8KA 2P7CB 1ZG5A 1BM9A 5KK1A 2XV4S 2ZJ2A 1YIOA 2XKOA 5HDGA 2XAHA 1SD7A 5E20A 5D8KB 3I5UA 1J9IA 3SQNA 1Z6RA 3HRTA 3I59A 5E8IA 3LA7A 3BOQA 2VT3A 1Z9CA 1U6GA 3KP6A 2BEOA 2ZFWA 1Q1HA 2STTA 4EJOA 3K1MA 4M6YA 3BP8A 3QU3A 2NRAC 5ILSA 3L09A 3BJ6A 3KEOA 1R22A 4CO8A 1KU9A 3CUQA 4RB0A 2WC2A 5DD8A 3QP5A 2HKXA 5JFRA 1AWCA 1ZYRF 4RB1A 3DF8A 1HQCA 1OYIA 3TOAA 3MZHA 2VODA 3F72A 4GCVA 5LRSA 1K6OA 1XMAA 2DQRA 3M8FA 3R0JA 2XAGA 3EDPA 3R60A 3JTGA 2RDPA 2CO5A 5HLHA 1S8NA 4M9ZA 2EJRA 3QOPA 3ZMDA 3C3WA 2X0LA 5IT9K 2IA1A 4L0YB 3FXRA 1O3TA 2O6GE 5DUIA 1YYVA 3PQKA 1DDNA 1DP7P 1XDSA 4ON0A 4HDVA 2FMLA 1IN8A 2MBFA 4U0WA 4HLXA 4MGRA 3GXOA 4I98B 5FO5A 3AAFA 1F1ZA 2PG4A 2DPUA 1I27A 4ZYGA 2ZBKA 1Z05A 5D6FA 5ICEA 1IF1A 1XGNA 3DFGA 1FBUA 4BHPA 4Q48A 1OPCA 5JI6A 2IPQX 2ACJA 2ZNZA 2W85A 2PLYA 2K4BA 1HXDA 2FNAA 4A6DA 2ZMEB 3LSTA 2RN7A 4N9IA 4Z2YA 1QQIA 2HZTA 1ZRCA 4D0PA 3M1EA 3GF2A 4BXUA 5CJ9A 3RKWA 3IKVA 4LK1F 3QP6A 4LLNA 2D1VA 1PDNC 5FFZA 3RYRA 1F4KA 2IJLA 3WTXC 2VOOA 1OMIA 4IF4A 2R7FA 3Q9SA 5ED4A 5HS7A 5FD6A 1ZGJA 2XROA 2HQNA 4ZZLA 4I0AA 1TNSA 2VT2A 4LB5A 1LEBA 3TO9A 3V7RA 3ERED 4GXOA 2HR3A 3FMSA 2VOPA 1IN5A 2CGPA 3L00A 3L9FA 4OIOF 1EH7A 3IC7A 4RGXA 3W6JB 1XCVA 1FSEA 2A5YB 1LJ9A 1YG2A 3VODA 1RIOH 1LQ1A 5K5RA 1STZA 2V6CA 1SMTA 4P9FA 5BPIA 1IW7F 4ESJA 1SFEA 2BYVE 4HZFA 4RB2C 3RPUA 5A2QZ 4PCQA 4CGZA 1KQ9A 2FSWA 4IRIA 3K1NA 4CYDA 2RKHA 5AONA 3RPQA 3KP2A 2XASA 1ZGAA 2L01A 1JE8A 3IRRA 2D1HA 2XHKA 2P5KA 2QUFA 4OIPF 1QGPA 1FNNA 1WSUA 3R6SA 4QLCU 5ICGA 4DNCA 3MFKA 3V8JA 3WE3A 4IXAA 1OKRA 1EH6A 4M9SA 3LWFA 3SXYA 4LG0B 2FMYA 3F8FA 5LBQA 2WTEA 2LF8A 2L54A 4G6DA 2R3SA 3ZN1A 3I71A 2CQKA 2RNJA 2DK5A 2GXBA 3CO6C 4EV0A 2M5WA 2F5FA 1B4AA 5E1WA 1FX7A 2LF7A 4OMYA 2DW4A 4Y15A 2OU2A 3RI4A 3KEQA 3FHZA 2QYOA 2ISZA 1WKMA 5J8CA 2A6EF 4A0XA 1XSDA 3P9IA 3FMQA 1BOAA 4EGZA 3V7SA 1SD5A 3F6VA 2R7DA 4G7HF 4UVBA 1IRFA 1LDDA 4OIQF 3FM5A 1H9GA 1W7PD 4HAMA 5DDGA 1G4DA 4LLGF 2XRNA 2J5OA 3S2WA 1XGSA 3SHFA 2K86A 4ENKA 5D5UB 3E6BA 5LEKA 2HWVA 4L9JA 5HDNA 4U7DA 2X4HA 1CF7B 3WU1B 1ZARA 1LDJA 4MNUA 3RYPA 5HOOA 2MC3A 2G9WA 3F23A 2A61A 1IRGA 2QM3A 2P8TA 4I02A 3TGNA 4XSXF 5BS6A 3GFJA 2FNPA 4XLNF 4A0ZA 4S05A 2JPBA 1B59A 1SD6A 2EA4A 5JVTA 1Z7UA 3KLOA 3SFZA 4ZYHA 3P7NA 3EQLF 3DXJF 3B02A 4WF2A 2KJBA 4GYGA 2H94A 3COAC 2HQRA 1UCRA 2XAJA 4MTEA 4Y13A 5LRRA 1J5YA 5DYMA 4HX8A 2GWRA 2MLKA 2ZMEA 5CLSA 1ZH5A 2W25A 2VN2A 4DQ2A 3J81K 1TNTA 1KU2A 1ZLJA 3BROA 4GO1A 2DTRA 4LD5A 4R8HA 1H9TA 2CSOA 3BPVA 4ENMA 3I53A 1BIBA 3HSEA 3NEUA 4EJTA 2VONA 2UZKA 3G73A 2QVOA 3RIRA 5LEJA 1FT9A 1XSVA 1ZRDA 4L5IA 2O61A 2COMA 2QZ8A 3P9KA 1DPUA 1KQ8A 2Q2EA 1R23A 1FWZA 3MAJA 1Z91A 4WX9A 4P96A 3QPHA 4A0YA 2E7XA 4HQEA 2M8EA 1R36A 3TDUC 4GYIA 1BC7C 2QQAA 4BNCA 1ULYA 3BJOA 2EFOA 2H6CA 5FB2A 2PJPA 4EGYA 3MWMA 4RGUA 1USTA 5CVRA 3KETA 1I1GA 4UV9A 1YS6A 4IHSA 1Z6TA 2CFXA 1J59A 2P5VA 5LGTA 1FY7A 3GZ5A 5H20A 5DCMB 3CJNA 5IT9Z 1FP1D 2ETHA 3ULQB 1HW1A 1MD0A 3ECOA 4Y17A 2VC1A 2HYGD 4OU0A 3M9AA 1BI0A 4ETSA 4RB3C 1T0FA 4BQAA 3LFKA 2TDXA 3FX3A 1FOKA 3LA3A 4LGWA 5ILVA 5AIPA 2RVCA 4R1HA 2FBIA 2H27A 5BMZA 1YW8A 4LG0A 3MCZA 2CYYA 3KP4A 1T6SA 4FX4A 4AD9A 2QQ9A 3P9CA 1MJAA 4WCGA 1UHWA 1U3EM 1RUNA 4OMZA 2PEXA 3E5QA 1BBYA 3Q9VA 4CICA 1A04A 4HF1A 2G7UA 4LLLA 3CUOA 3E3VA 1BI1A 1IAWA 2RC4A 3D5LA 1O3QA 3LAPA 1AOYA 2KKOA 3E97A 4CHUA 2HKOA 1KYWA 4HYEA 2P5LC 4ZH4F 3C1DA 2HDCA 3FXUA 5HVQC 3I58A 2OD5A 3WTWC 3TQNA 4KN7X 5LGNA 1UHMA 4MEXF 5ICFA 3LA2A 5BOXA 1LVAA 4JQFA 5K5QA 2GIVA 3QU6A 4MHGA 2VBYA 4ESFA 3FMRA 3K2ZA 2O0YA 4PGHA 2JZYA 3HHGA 4EM0B 3ABTA 4WXCA 1XDUA 1YW7A 2ZNYA 1BI2A 1TW2A 3FXQA 1CF7A 1O7FA 1HKSA 5D4SA 2IW5A 3IWFA 1MDMB 5FLXK 5E8GA 3DP7A 3KE2A 5CVUA 4CXFA 1IN4A 5FD5A 4KFCA 4L18B 1W5SA 3VB2A 2M45A 4KN4X 4L0ZB 2FRHA 2VC0A 3LAJA 2HTSA 4XSZF 2CWEA 4XBFA 1T38A 2PI0A 2NNYA 2XIGA 2HGCA 5L3CA 3ZMTA 2EFPA 3EYYA 1Y0UA 4M72A 2JRTA 3IWZA 3BY6A 1GXPA 2YX4A 1IN7A 2H6BA 5HS9A 3QPTA 1WRJA 2W57A 3ZQ7A 2J5PA 2V79A 5ICCA 1V3FA 2ELHA 2VBZA 3J80K 2VBXA 2M30A 1KYZA 2MLGA 4KNYA 2PQ8A 3HOTA 5E18F 3GO5A 2LDUA 2OQRA 2FF4A 2LKPA 1DUXC 1G3TA 1QNTA 3J7AO 1XD7A 3FF5A 4MQVA 3T0YA 2F5CA 3GX4X 3K9TA 3GEZA 1SMYF 3WTSC 2FA5A 2Z99A 4EQQA 3ZPLA 4LK0F 4U7BA 1D8JA 2QWWA 1B9NA 2YSRA 3ROUA 3GLXA 4TV7A 1R1VA 1BJAA 2ESNA 1MJ9A 4JBAA 4A2UA 4KYWA 3G3ZA 1E2XA 4M6XA 1P4WA 2CW0F 2F5DA 3FM3A 2JSCA 1ZG3A 4KMUX 1XN7A 2MH9A 4HF0A 3OV8A 3TO7A 3E5XA 3CUQC 4AIJA 2KJCA 4KIFA 4MQ9F 5DCMA 3NQOA 2BV6A 4YFNF 3F8CA 3E5UA 2MD5A 3KFWX 3WTUC 1T39A 2JT1A 3CO7C 2K4JA 1YS7A 5EEHA 2EFWA 2IA2A 4A6EA 4BHBA 4IHTA 5D4RA 1VTNC 1S3JA 1KU7A 2DPDA 3LQQA 5BQTA 2EK5A 5IT3A 2V1DA 4K2EA 5DEQA 3TKYA 3JAMK 1B9MA 4FX0A 2DO7A 1FSHA 2CG4A 4YIFA 2P6TA 2OZUA 1K78B 1O57A 1L3LA 1HSJA 2Z9OA 1HSTA 1EV7A 2DT5A 1FZPB 2IP2A 2MA3A 3RKXA 4Q5SF 1X3UA 3J81Z 3REOA 2Q8KA 1UFMA 2KIUA 3I54A 4IJAA 2ZXJA 2ZCWA 5JR3A 4O6JA 2XAQA 1TQMA 4BYYA 2FU4A 5CVJA 1J0RA 2PMHA 2JTVA 2BE5F 4WWCA 1PP8F 1W4MA 4FHTA 2P7VB 4HX4A 2UXXA 3DQVC 3SZPA 1YO5C 3ECHA 5LHHA 3E6CC 2EB7A 3DPLC 4IPAA 3LQRA 1JHFA 2HFHA 4HV5A 4YG2F 4I7HA 1TLHB 2EV0A 3IRQA 1JXSA 3WTYC 3K0LA 3KP3A 3K1PA 1G6NA 4U88A 2B0LA 1P4AA 4BH9A 1MDMA 1I5ZA 2EV5A 2M87A 4I01A 2L02A 4HA8A 2GA1A 4ENNA 3JW4A 2EWNA 2DU9A 2L4AA 2HOEA 5AIQA 3O2PE 1J7KA 4AIHA 2O03A 2A69F 2L3DA 4ZYEA 1YLFA 2V1XA 3ELKA 1R1UA 5LLQA 2O3FA 5ILUA 4A5NA 2DFIA 3T5XA 4LFUA 1OYYA 4ASNA 4LJZF 4EMSA 4WXDA 1SD4A 1ODDA 1XMKA 3K69A 1HBXG 3W6KB 5D5WB 4G9YA 3KP7A 3ML6A 2Y0MA 4I2OA 2ESHA 5LHIA 1ZLKA 3ISPA 1KA8A 4HOBA 3VFZA 2K7LA 5TRDA 5HDKA 2BGCA 3U9GA 3GZ6A 4OINF 4G8XA 2M1BA 5HLGA 3O6BB 3ZMVA 2QLZA 3N97A 5D8LB 1ZREA 1RNLA 4F7ZA 4B8XA 3PQJA 4HBLA 4M71A 2A68F 2ZO4A 2NNNA 1TQPA 2EV6A 2Z5UA 3WODF 1TTYA 3L7WA 2STWA 2Y75A 3T1BA 4NB5A 1WI9A 5J6XA 3IHUA 4O3MA 1QPMA 2EFQA 2WWYA 2RV8A 3ZMZA 1LDKB 3V7CA 3C7JA 1GXQA 3WG9A 5LGUA 5CVVA 1W7PB 5L3BA 1V4RA 2WV0A 3TDZC 2XGXA 1FLIA 2NYXA 4S04A 1ON2A 2ISYA 4HF2A 5FLXZ 4ZYDA 2JPCA 4I0BA 1U2WA 1L0OC 5L3GA 4YIIA 2HYFA 3DPTA 2NS0A 5H6QA 2V1UA 1ZN2A 2YPRA 2GAUA 4M9XA 2YR2A 2RGVA 2MH2A 3C18A 4LB6B 4EVIA 3DV8A 3E6DA 1O3RA 3QAHA 4M74A 1YTYA 1R00A 1PUEE 1IXSB 1FBSA 2IVMA 1W5TA 1P92A 1XGMA 2OQGA 3HRMA 4PDKA 3HRUA 1IUYA 2EA2A 1MJBA 1EH8A 1K78A 3F3XA 2PN6A 4P9UA 4XLPF 3MZYA 3HHHA 1D3YA 3D0SA 1U8RA 2IRFG 1KGSA 4QWQA 4UNOA 1FBQA 1R1TA 3J80Z 3WTZA 4L9VA 3HTSB 1FYLA 3ZP5A 2XUBA 2FBHA 2FBKA 5K1YA 2BBYA 1GHCA 4L9NA 4U0YA 3WE2A 2YX7A 2DQLA 3PFIA 3RJPA 4EM2A 5HS8A 2Z3YA 1R5HA 3FWEA 4KMFA 2FOKA 3HSRA 3R61A 3HUGA 1G3SA 4HW0A 4UVAA 4UUVA 2A07F 1ZRFA 1S29A 1MZBA 4KIBA 3OOPA 4HV6A 3GFMA 4NQWA 1F5TA 1XB4A 2P4WA 4XRFA 1FC3A 4RGRA 3CLOA 1USSA 4I09A 2HS5A 2QENA 2V9VA 3KCCA 2A3SA 1YQAA 2F5EA 3R4KA 4A5MA 3U1DA 4N9HA 3RDIA 1U5TC 4M73A 1CGPA 1ZAOA 1T2KA 1HKQA 2XAFA 4IVNA 1WQ2A 1KQ0A 3N4MA 1FYMA 2P6SA 1SFUA 1TW3A 5D5XB 3V4GA 3EUHA 3F6OA 1S6LA 2DBBA 3GVAA 5L3FA 4G7ZF 1TQIA 1FYKA 2GQQA 1U78A 4H0EA 1P4XA 2IT0A 4ENJA 4G6QA 1Z1DA 2G7HA 1UB9A 1ZHFA 3CDHA 1I1SA 3HIFA 4JK1X 5L3DA 1RI7A 1KU3A 1MKMA 2OAZA 5BPDA 1REPC 4HX7A 3HYIA 1IN6A 3JAMZ 1IXCA 3WGHA 1HW2A 2Q0OA 3I4PA 4CZZA 1QO0D 1R7JA 2W24A 1IXRC 3MEXA 6PAXA 1G3WA 1ON1A 5CVIA 3BWGA 1HW5A 2D2WA 4EM1A 1R58A 5D5VB 1U5TB 4EJVA 4G7OF 4Q4ZF 3WTVC 4RAZA 2GZWA 1P6RA 3RTRA 1LB2A 1K79A 4ZZDA 3BZ6A 3GYHX 2F2EA 1NHAA 2QBYB 3GWZA 3E6MA 4PZJA 2GXGA 4ESBA 1WWXA 2PFBA 3I0TA 3DKWA 2AXLA 1RZ4A 3BJAA 3BPXA 1QBJA 4R79A 1K7AA 3IKTA 1XSXA 3WGGA 5K5OA 3I64A 4HDUA 3WGIA 2KRFA 1QZZA 2QQBA 1IZ1A 1W7PA 3VOEA 1HKTA 2L4MA 1YFHA 2IA0A 2ZKZA 2DI3A 3HOSA 3M8EA 3V8LA 2DLLA 2VE9A 1G3YA 3U2RA 4E70A 3R0AA 1LEAA 1O3SA 2GA2A 4IRGA 3I59B 1QZYA 2C6YA 3GW2A 5L3EA 1S7AA 1O7LA 4Q47A 2UWMA 4BAYA 4MTDA 1P2FA 3CUQB 2OA4A 5LHGA 3H3UA 3CTAA 5DD4A 2D45A 3HSFA 2AS5F 4KICA 2KIMA 2K02A 3DEUA 2O8XA 4N0BA 2FQ3A 3F8BA 5F6FA 4EJUA 3TO6A 5E17F 2DK8A 3HRSA 1XCBA 3RKYA 4OOIA 1H0MA 4OIRF 4PGGA 3BDDA 4RGSA 3NRVA 2NAZA 4WXHA 4EJWA 4P55A 5DCFA 3KZYA 2FXAA 2PBIA 4UXNA 4WK8F 1T98A 4YFKF 4KUMA 2VE8A 3KP5A 2OBPA 2K27A 3WU0A 5A2QK 3F8NA 1BC8C 4U0VA 3MQ0A 4LMYA 5FGMA 3ZMSA 3ABUA 1I6XA 2E1NA 5HLIA 1F9NA 1LNWA 2DAOA 2Z33A 4P5OA 1GVJA 3JSOA 1SAXA 3WTTC 5CYVA 4GGGA 1RUOA 3M7GA 1SFXA 1BIAA 4FT8A 3T8TA 4HQMA 1BI3A 3JTHA 4UVCA 3F22A 2Y48A 4IRHA 4UHTA 3IL2A 4KIGA 5JHUA 4AIKA 1MGTA 1B1BA 3T8RA 2VXZA 2RQPA 5H6RA 2XKPA 3QRFF 2E7WA 4CDGA 1J2XA 5DV5A 2ADUA 3ZN0A 1S7OA 3GUDA 3KZZA 4L5JA 5D6EA 1D5VA 1C0WA 4B09A 5EEGA 2UXNA 3F21A 5ERIA 3FZVA 3F8MA 1FP2A 2PMUA 5F1RA 1DPRA 4O5VA 3GFIA 1E17A
chains in the Genus database with same CATH superfamily
4RAYA 5GTHC 4CYCB 1BN5A 3G1OA 2IS2A 2XGDA 3BLYA 5KVRA 3H3ZA 4BHCA 3Q5FA 3HC7A 4OAYA 1ZELA 1U5TA 1XGOA 2KIFA 4YFXF 4AWXB 5IP9J 3RCOA 3KLNA 3S3MA 1T8IA 5E3MA 3W2AA 1OYWA 2HTJA 2VXDA 3K2AA 5EG0A 2FE3A 3V42A 3GCMA 3SZTA 1ACIA 4KA4A 4MEYF 2W84A 4HLYA 2F4OB 1OCTC 4RS8A 2LY9A 2QBYA 3EETA 1SAUA 1B6AA 3H92A 2FEZA 4KT5C 5TJJA 3VSKA 1ITYA 2R7XA 5J8FA 3IAS2 1WGXA 2H1LA 1JGSA 5DUKA 1VQOI 4CCNA 1J75A 1ZG1A 3JSPA 2YU3A 4UV8A 1PP7U 3PSIA 4L9TA 2VJJA 5E1XA 5FFXA 3L2CA 2LNBA 3VEPA 3HTUA 2EFNA 1FPQA 1VI0A 1BL0A 2HEOA 2XVCA 3SZGA 2LSOA 4NHJA 2IS6A 3W2VA 4G94A 5E1ZB 1OR7A 4P1WA 1DU0A 4DYRA 1JHHA 1QVUA 3TOBA 2EPFA 3O3KA 3K70D 2E1CA 1ZR4A 2VPRA 1D8KA 4CCOA 3EYIA 4XMYA 3ZMUA 1TBXA 1YW9A 3B73A 3GFLA 4A12A 2H09A 4AVPA 2X51A 5C4XJ 1ONVA 3QPLA 1NK2P 5F64A 2VPLA 2A6TA 4QSHA 5M5WJ 4KDPA 1EA3A 5HLTA 2OZ6A 1Y0NA 2A6HF 2F4IA 2VBWA 3FHNA 2V9KA 1KZHA 1R5GA 3DCFA 3LNQA 3V8KA 2RNGA 2CMPA 3PIOF 2P7CB 1ZG5A 4C9YA 2IGOA 2KL4A 1BM9A 5KK1A 2XV4S 2ZJ2A 2H8RA 3SDGA 1YIOA 2XKOA 5HDGA 2XAHA 1XG1A 1SD7A 3CCMI 3IH3A 3CESA 5E20A 5D8KB 3I5UA 1J9IA 3WHBA 3BQZA 2KISA 3SQNA 1Z6RA 3HRTA 3I59A 5E8IA 2W1OA 3LA7A 3S1MJ 3BOQA 2VT3A 4IHYA 1MBJA 2VQGA 2M4GA 1Z9CA 3FISA 1U6GA 2DA7A 3KP6A 2WV1A 4I6ZA 2BEOA 2ZFWA 4ZJZA 1Q1HA 2STTA 4EJOA 4S0HB 1FMVA 1R4MB 3K1MA 2NVQJ 4FQGA 4M6YA 3BP8A 3QU3A 3U21A 5ILSA 2NRAC 4GFBA 3L09A 3BJ6A 5F27A 3KEOA 4AM3A 2E5NA 3FK6A 1PUFB 1R22A 4CO8A 1KU9A 3CUQA 3UNGC 4IQ4A 3K4MA 2QSFX 1BW6A 4RB0A 1JUMA 3HOZJ 1LKXA 2WC2A 5DD8A 3HOWJ 1TT5B 3HKZA 3QP5A 2TCTA 4PFOA 2DFEA 2X6OA 1ORKA 4BJ6C 2E2HJ 1FTZA 3H5RA 2HKXA 3QYBA 5JFRA 1AWCA 2JA5J 1MBHA 1K61A 1JGGA 1ZYRF 4RB1A 3DF8A 1HQCA 2LP0A 1OYIA 3TOAA 3MZHA 2VODA 1OFCX 4ZYAA 3F72A 2ZXWH 4GCVA 4KISA 5LRSA 1YI2I 4B44A 4XK4A 1K6OA 1XMAA 4B48A 2DQRA 3M8FA 3KYLA 3VYRB 3R0JA 2XAGA 1VQ8I 2VIXA 2W00A 2DA5A 3EDPA 3D5SC 5FKLA 1SFOJ 3R60A 5BNGA 3F0CA 3L1PA 3ZOBA 3K4LA 1IC8A 3FXLA 2CJJA 4C3IJ 3JTGA 3A01B 3VYUB 3K70C 2E60A 3Q0VA 2RDPA 2CO5A 5HLHA 1R4NB 4DZPA 1S8NA 4M9ZA 2EJRA 1W0UA 2ZMEC 1H89C 2L7ZA 1IG7A 1JT6A 3QOPA 5JLXA 3C3WA 4BY7J 2X0LA 3ZMDA 5IT9K 3F9KA 2IA1A 4NC6A 4L0YB 3FXRA 3MVPA 3H9QA 1O3TA 2KHMA 1JJ8C 2PX9A 2O6GE 5DUIA 1YYVA 3OSGA 4GDFA 3PQKA 3OR1C 3DTEA 3I3LA 3OYGA 1DDNA 1DP7P 3LL7A 4CUGA 1PVEA 1XDSA 5GAHJ 1ERDA 3IH2A 1U9OA 3CMMA 4ON0A 4HDVA 2KT0A 2FMLA 1IN8A 3HB9A 3S1QJ 2MBFA 2E1MC 4U0WA 4HLXA 4XIDA 4MGRA 4LG3A 3GXOA 3HG9A 3HOVJ 2VQCA 2HNHA 4PSXA 3FXJA 2JK3A 5IPAA 4I98B 5FO5A 4Y3OA 3AAFA 1F1ZA 2PG4A 2DPUA 5IOYA 1P9QC 2NVUB 1I27A 4ZYGA 2ZBKA 4E7JA 1FOXA 1Z05A 5D6FA 5ICEA 1IF1A 1XGNA 3DFGA 1FBUA 2NVXJ 3N05A 2LD5A 4BHPA 1SVLA 4Q48A 2ZXHA 3WHCA 1OPCA 2OV7A 1OLTA 1NG7A 5JI6A 2IPQX 5C3EJ 3FKIJ 2ACJA 4MFDA 3C2GA 2ZNZA 2W85A 4A3IJ 2PLYA 2K4BA 1AKHB 1HXDA 4BDYA 2FNAA 3BCAA 2ZMEB 3LSTA 4A6DA 2XB5A 1HCRA 2DJIA 1X3ZB 3BG5A 2RN7A 4N9IA 4Z2YA 1QQIA 2HZTA 1ZRCA 2BY1A 4D0PA 4XICA 3M1EA 4OAZA 4A3GJ 4E7LA 3GF2A 2JQ7A 2WAQN 4BXUA 5CJ9A 4HNUA 2NVYJ 4BQQA 3RKWA 3IKVA 2EQRA 1OISA 4LK1F 1HLVA 3QP6A 4LLNA 5JLWA 2D1VA 1PDNC 3LSRA 5FFZA 3RYRA 5FLMJ 4ZTJA 1F4KA 2IJLA 4A3MJ 3L2RA 3WTXC 4B47A 4C30A 2VOOA 1E0EA 1OMIA 4LITA 1QVTA 4IF4A 5KCMA 2R7FA 3HOYJ 3Q9SA 5ED4A 2LK2A 2XGCA 5HS7A 5FD6A 1ZGJA 3J7YJ 2XROA 2HQNA 3GTJJ 5IP7J 3PSFA 4CYCA 4ZZLA 1T0FC 4I0AA 1TNSA 2EZIA 2VT2A 4LB5A 1LEBA 3JREA 3TO9A 1ETVA 1RKTA 2Q2EB 3V7RA 3ERED 3JRHA 4GXOA 5KAFC 2HR3A 3FMSA 2VOPA 1IN5A 2CGPA 3L00A 3L9FA 4OIOF 2LKSA 3G71I 1EH7A 5TISC 3IC7A 3ZQCA 1LUJB 4RGXA 1EKEA 1DQUA 3W6JB 2BY0A 1XCVA 1QRYA 1FSEA 2A5YB 5M5YJ 1LE8B 2R7VA 1LJ9A 3OYHA 1YG2A 2BVLA 5F0CA 1ZR2A 3VODA 4F91B 1RIOH 3S2DJ 1LQ1A 2CQXA 1STZA 5K5RA 2V6CA 1SMTA 4P9FA 2ZSIB 5BPIA 4OWRB 2VKEA 1IW7F 2OPTA 4ESJA 3AL0B 1A31A 3DWLE 2Z1DA 2KZGA 1SFEA 3FDYA 2BYVE 2WY7Q 3CCVI 4A3EJ 1CQTA 2FD5A 2Y0SA 1U0JA 1LFUP 3G1MA 4LIVA 4M3GA 2X9DA 2DA3A 2HU9A 4GRIA 4HZFA 4BXFA 4RB2C 3RPUA 5A2QZ 2ME0A 1AHDP 2Q1ZB 4PCQA 4CGZA 1KQ9A 1X1CA 3S1NJ 2FSWA 4YELA 3BG6A 4IRIA 3K1NA 4CYDA 2RKHA 1VQ7I 1WI3A 3TW7A 5AONA 3RPQA 3KP2A 2XASA 1ZGAA 2L01A 1JE8A 3IRRA 2D1HA 2XHKA 3Q3SA 1MSFC 2P5KA 2QUFA 2QF7A 5E3LA 4OIPF 2CW8A 1QGPA 2YU9J 3JRBA 2AQEA 3A02A 1FNNA 2W82A 4NUBA 4D5CA 1WSUA 3R6SA 4LOCA 3E7LA 4QLCU 5ICGA 1A6IA 3H35A 4DNCA 3C2HA 5J1RA 3MFKA 2NS7A 3V8JA 4XM3A 4IXAA 1OKRA 3WE3A 1GV2A 2BY2A 2EBIA 1EH6A 4XLAA 4M9SA 3FKJA 3LWFA 3SXYA 4LG0B 2FMYA 3F8FA 4QPOA 3C2BA 5LBQA 3OOUA 2WTEA 2LF8A 3BTIA 1MNDA 2L54A 1WHUA 1MSEC 4UUSB 5GP9A 3ZQFA 4G6DA 3AG4H 3WU2C 4D5FA 2DA1A 3DBHB 2F6CA 2R3SA 3ZN1A 3HOUJ 2AHQA 3ZXSA 2DFFA 3I71A 4XNFA 2CQKA 2RNJA 4BQOA 1VQ4I 2R7OA 2JSPA 5M3MJ 2DK5A 1S9HA 2GOMA 4BE0A 1TWAJ 2Z2SB 5J4VA 2GXBA 3CO6C 4EV0A 2M5WA 2F5FA 1PUFA 2QSHX 1B4AA 5E1WA 1FX7A 2LF7A 4OMYA 3GMEA 2DW4A 4Y15A 2FX0A 3S14J 2OU2A 4DYQA 2DTZA 1ETOA 3RI4A 1OJLA 4IOCF 3KEQA 3FHZA 2DT6A 2QYOA 3CD6I 2ISZA 1WKMA 5J8CA 1PYVA 1X4OA 2IEKA 4CCKA 2A6EF 4A0XA 1XSDA 3P9IA 3FMQA 5E3OA 2PMZN 3JRAA 5B1BH 1F43A 1H88C 3CLQA 1BOAA 1V5GA 4EGZA 2H8WA 4IEJA 3V7SA 5B3SH 1SD5A 4F52A 4HSRA 3F6VA 1QA6A 4IHWA 2X6YA 1JTYA 5KNLA 2R7DA 4IL6C 1LFPA 2MYSA 4G7HF 4UVBA 1IRFA 3Q0WA 1LDDA 4OIQF 3FM5A 1BOBA 5HNFA 2BXYA 1H9GA 3BG7A 2CU7A 1W7PD 4HAMA 5DDGA 3A01A 1G4DA 3OL3A 4LLGF 5EDNA 1Z77A 3ONQA 2XRNA 1D1AA 2J5OA 1XGSA 3S2WA 2K86A 3SHFA 4EATA 3CDLA 1YHQI 2AQFA 2Y9ZA 1KONA 4ENKA 5D5UB 2OCCH 3E6BA 2K9MA 5LEKA 2HWVA 1Z3YA 4L9JA 5HDNA 4U7DA 2JA7J 2X4HA 1CF7B 2KDOA 3H3VK 2OC6A 3WU1B 1ZARA 2CQQA 1LDJA 5HNHA 4MNUA 2O5RA 3RYPA 4PJMA 5HOOA 2MC3A 3FK7A 3JR9A 4DOZA 2G9WA 1DP3A 3F23A 2A61A 1MNMC 4BDZA 4AIDA 1IRGA 2QM3A 1XS9A 2IXSA 4BE2A 2P8TA 4I02A 3TGNA 3OYMA 3GTKJ 2KDZA 1X4PA 4XSXF 4DYCA 5BS6A 3GFJA 1Y6IA 1D1BA 2FNPA 3LOCA 2L2OA 4XLNF 4A0ZA 4C3HJ 4S05A 2JPBA 1I39A 1B59A 2ELJA 1SD6A 4RLQA 3L2QA 2E34A 2EA4A 2TRTA 4H4KC 5JVTA 1Z7UA 2IGNA 3KLOA 3SFZA 4ZYHA 2JUGA 2DOAA 3RZOJ 3ZQQA 3DEWA 3P7NA 3EQLF 3DXJF 3J7ZI 3CCSI 1D1CA 2HXOA 3B02A 4WF2A 2ZJQF 2KJBA 2LG4A 4GYGA 2EINH 1EJ9A 2H94A 3COAC 2HQRA 1UCRA 2XAJA 4M3FA 4MTEA 4Y13A 3LMMA 2DCEA 5LRRA 2RQQA 3DTIA 4RBOA 1J5YA 2V7FA 5DYMA 4HX8A 2GWRA 2MLKA 1IV8A 1AKHA 2VJIA 2Y30A 2ZMEA 5CLSA 1ZH5A 2V4JC 5E3NA 2FOWA 2XF6A 1Y8QB 2W25A 2VN2A 4DQ2A 3J81K 4Z6YA 1TNTA 3TP0A 2XB0X 1NG6A 2XPWA 4CA0A 1KU2A 1ZLJA 2ELKA 3BROA 4GO1A 2DTRA 4LD5A 4R8HA 1H9TA 2CSOA 4AUXA 3BPVA 1YOVB 4ENMA 3I53A 1BIBA 3HSEA 2OUMA 3NEUA 1W5CC 4EJTA 2VONA 1DGWY 1A6QA 2UZKA 3G73A 3DU6A 2QVOA 3RIRA 2BW3B 3AG1H 5LEJA 3DPUA 4F3QA 4CCLA 1FT9A 1XSVA 3VYSB 1ZRDA 4L5IA 3GTMJ 2HOAA 4XN0A 4DW6A 1VF9A 4BJ5C 4XQFA 2O61A 2COMA 2QA4I 2QZ8A 1V54H 1ZK8A 2ZB9A 1H8AC 3P9KA 1DPUA 1KQ8A 4U87A 2WB1A 1W0TA 2Q2EA 1R23A 1D0XA 1FWZA 2L9VA 3MAJA 2Z16A 1Z91A 4E6KG 2JMWA 2K9SA 2LY1A 3RQ4A 4WX9A 5M3FJ 4P96A 3JRDA 2HOTA 4B43A 3QPHA 4A0YA 2E7XA 4FETA 4FASD 3HKZN 4HQEA 3CP2A 4BACA 2M8EA 1R36A 2MC4A 3TDUC 4GYIA 1Z21A 1BC7C 2QQAA 4BNCA 2XAUA 1ULYA 3BJOA 1LE8A 2EFOA 2H6CA 5FB2A 2PJPA 3MWMA 4RGUA 4EGYA 1USTA 5CVRA 5B5EC 3UR3C 5GTIC 2LFBA 3KETA 1I1GA 4UV9A 4ZDPA 3PL8A 3OYBA 1YS6A 4IHSA 1Z6TA 3PNYA 2CFXA 3JRCA 1OCZH 3CP8A 2GOXB 1J59A 2JVGA 2ZSHB 2P5VA 4B1RA 5LGTA 1FY7A 3GZ5A 4XKCA 4PFPA 5H20A 2DMNA 5DCMB 3CJNA 1JKOC 5IT9Z 1FP1D 1X1PA 2ETHA 1N77A 3ULQB 1HW1A 1MD0A 3QWLA 2K3FA 3ECOA 2R7ZJ 2R7WA 3PNVA 2MW8A 2VQLA 4ZTFA 4Y17A 2V1NA 2BHZA 2VC1A 2BXZA 2HYGD 4OU0A 1N25A 2L7MP 3BG3A 3M9AA 4XLEA 1BI0A 1FIAA 3MKZA 4ETSA 3M8JA 1T0FA 3KZIC 4RB3C 4BQAA 2VI6A 2M4KA 3LFKA 2TDXA 1R71A 3FX3A 2HDWA 1FOKA 5J3LA 3PNTA 3LA3A 4Y4RA 4LGWA 5ILVA 2VASA 5AIPA 2RVCA 4R1HA 3BTLA 2FBIA 2KRHA 5BMZA 1YW8A 2XRLA 2H27A 4LG0A 3MCZA 2CYYA 3KP4A 1T6SA 4FX4A 1YRNB 3U1KA 2Y9YA 4AD9A 1K6YA 2QQ9A 4UUSA 3W3CA 3SFIA 3P9CA 1MJAA 5HODA 4WCGA 3S32A 1UHWA 2E5ZA 2HXIA 2IS1A 5EZHA 2X6XA 1U3EM 1RUNA 4OMZA 1B72B 2PEXA 3E5QA 2R0QC 4MFEA 1BBYA 2GLOA 3Q9VA 4CICA 1A04A 3H1CA 4A3CJ 4HF1A 3S3NA 1OCPA 2G7UA 3K4JA 4HNVA 4LLLA 3CUOA 1ETWA 3E3VA 3AKZA 1BI1A 1FOYA 3QPSA 3LSHA 1IAWA 2EH3A 3IV5A 2RC4A 3D5LA 3MKLA 1O3QA 2CQNA 1YJ9I 5F04A 2NOJB 3LAPA 1BR1A 1AOYA 3BTJA 3J7AY 4PJLA 2KKOA 2VLAA 3E97A 2WY8Q 4CHUA 1WJFA 2M7AA 2HKOA 1KYWA 4HYEA 4ZH4F 2P5LC 2LREA 2BVMA 3C1DA 2HDCA 4F93B 2HQ5A 3FXUA 5HVQC 1UHSA 3I58A 2OD5A 4XR6A 3Q0UA 1K4SA 5KHDA 3WTWC 3TQNA 2HOSA 4KN7X 5LGNA 1UHMA 5EYRA 2DDBA 2JA6J 4MEXF 5ICFA 3ZCOA 3G4SI 1J09A 5J40A 3LA2A 2L0KA 4I76A 3D5RC 5BOXA 3FBIB 3E1SA 3B6AA 5IY5H 1LVAA 4JQFA 5K5QA 2HDDA 3BR2A 2GIVA 3QU6A 4MHGA 2KLOA 2VBYA 4ESFA 3D1NI 1X1DA 3FMRA 3K2ZA 2O0YA 1MW7A 3KPHA 1K4TA 4PGHA 2JZYA 3HHGA 5E79C 4EM0B 3ABTA 4WXCA 3DLLF 4Y52J 3S8PA 1XDUA 1YW7A 1I3QJ 2ZNYA 1BI2A 4XLFA 1TW2A 1RESA 2EIKH 1WFXA 2LBFB 2JA8J 3FXQA 5J1YA 1CF7A 5FROA 1O7FA 1HKSA 5D4SA 2IW5A 3IWFA 1MDMB 2YUSA 2R7UA 5FLXK 5E8GA 3DP7A 1OCOH 4ZC3A 3KE2A 5CVUA 4CXFA 5DS9A 5FRNA 1IN4A 5FD5A 1R49A 4A3JJ 4KFCA 4L18B 3ABLH 3DLAA 1XC5A 4DZJA 3M3YJ 1W5SA 3VB2A 1VFCA 2M45A 4XN3A 4KN4X 1ZGWA 3KEYA 4L0ZB 2FRHA 2VC0A 3LAJA 2HTSA 2LTPA 4DBRA 3SEQA 4XSZF 3PJRA 1JT0A 2CWEA 4XBFA 1YIJI 4JX5A 1T38A 2PI0A 2NNYA 3HBLA 4XLCA 3VSLA 1WH7A 3DBRB 4BBRJ 2XIGA 2HGCA 5CQGA 5L3CA 3ZMTA 3ABMH 4CCJA 2RREA 2EFPA 2JJ7A 3EYYA 1Y0UA 4M72A 5C44J 1BJZA 2JRTA 3IWZA 3CCEI 4E7HA 4XOTA 3BY6A 4XOPA 1GXPA 2KZVA 2YX4A 1IN7A 5DTDA 4C3JJ 1IO2A 2H6BA 5HS9A 3QPTA 3VYTB 2RAEA 1WRJA 2W57A 4AYBN 3BR1A 3ASNH 3ZQ7A 2J5PA 2V79A 5ICCA 2QCOA 1G8XA 1V3FA 2ELHA 1IJWC 2VBZA 1P7JA 2OJED 3CQZJ 4PJNA 1JI8A 3CJQB 3J80K 1B8IB 2VBXA 3L2WA 2M30A 4BS9A 1JJ6C 1KYZA 4E7ZA 3QYEA 4II2A 2X85A 4UB6C 2MLGA 2E1MB 4G6TB 4KNYA 2PQ8A 3K4NA 4FISA 2MSYA 2V26A 3HOTA 5LFAA 4G12A 5E18F 2H1KA 3GO5A 1JUPA 2LDUA 2OQRA 3S17J 4HRIA 3MZ8A 2FF4A 2E1OA 2LKPA 1DUXC 4D7NA 1G3TA 2LYCA 2BW3A 1QNTA 5H2FC 3J7AO 1EF4A 2D5VA 1XD7A 1Z0XA 3FF5A 4MO7A 4MQVA 3T0YA 2F5CA 3GX4X 4M3BA 3K9TA 3NAUA 1RC9A 3GEZA 4D1QA 4PJ0C 1SMYF 4JP0A 1G2HA 3WTSC 2FA5A 2V6EA 2Z99A 4EQQA 3ZPLA 4LK0F 3K7AJ 2ZJRF 3OS0A 4U7BA 1D8JA 2QWWA 1B9NA 2YSRA 3ROUA 3GLXA 4TV7A 3SYTA 5FJ8J 1FTTA 1R1VA 1BJAA 2ESNA 4UY8I 1N78A 3ZR8X 2E35A 1X3WB 1MJ9A 4JBAA 2F5VA 4A2UA 1Z7LA 4KYWA 3BR3A 3TEDA 2MG4A 3G3ZA 1E2XA 3MMYB 4M6XA 1P4WA 2Y31A 4J00A 2L5QA 4BGDA 3CMAI 4HSTA 2CW0F 2VL8A 2F5DA 2KMUA 4XRSG 3FM3A 3A03A 1VQPI 2JSCA 3IH4A 3X2QH 1ZG3A 4KMUX 1AU7A 1XN7A 4KITB 1TC3C 2MH9A 2R92J 2HI3A 2K40A 4HF0A 3OV8A 3TO7A 3E5XA 2NS8A 3CUQC 4M3DA 1GT0C 4AIJA 3HZJA 2M9HA 2OCEA 2KJCA 4KIFA 1HOMA 4MQ9F 5DCMA 2I10A 5FKNA 2CUEA 2EZKA 3NQOA 4Y33A 4PK4A 3M4OJ 1JKQC 2BV6A 3KYDB 4YFNF 4N4NB 2G0EA 3F8CA 1TWHJ 3E5UA 2MD5A 3G2BA 3KFWX 4XONA 3QODA 4YEJA 3PM1A 3WTUC 4C2TA 3GTGJ 1T39A 2JT1A 3CO7C 2K4JA 2LY2A 4RM3A 1YS7A 4AVZA 2KPMA 5EEHA 2EFWA 4ABZA 3AFHA 4BE1A 2R93J 4IOAF 1ZKGA 2IA2A 4A6EA 4BHBA 1ZQ3P 4IHTA 3JRGA 3S93A 2WAQA 5D4RA 3OYIA 5EEAA 1VTNC 1S3JA 1KU7A 2DPDA 3LQQA 5BQTA 2EK5A 5IT3A 1Y1VJ 2CW7A 2V1DA 4K2EA 3K4KA 5DEQA 3RSNA 3TKYA 2W7NA 2JWTA 4ANJA 1YRNA 3JAMK 3BTCA 1B9MA 4BUPA 4A69C 4FX0A 1HA8A 1FOWA 2DO7A 1FSHA 2CG4A 3OIOA 4YIFA 2ZJPF 3DBLB 2P6TA 2B7EA 3OYAA 4HPQA 2OZUA 1B72A 4J19A 1K78B 1O57A 2F4MB 1L3LA 1YE9A 1HSJA 2Z9OA 2XC7A 1HSTA 1VZ0A 1EV7A 4A3LJ 2DT5A 4XLHA 1MMAA 4D9JA 2IP2A 3MKYB 3E0JB 1FZPB 1ETXA 2MA3A 1A35A 3RKXA 4Q5SF 3BT9A 3BQYA 2WBMA 2AO9A 5EGOB 1Y39A 2XF7A 1QHGA 5F0HA 2KFDA 4X0GA 2ECCA 1X3UA 3J81Z 3REOA 2K9NA 2R7QA 4L5EA 3A0BC 2Q8KA 2R5ZB 1UFMA 2KIUA 3H0GJ 1T08B 4HG2A 3I54A 2B9SA 4IJAA 3SDBA 2ZXJA 2DXIA 3PO2J 2ZCWA 2ID3A 1FIPA 1S7EA 2HVRA 5JR3A 1F36A 4RAGA 1R5ID 2XGEA 2ICWG 2JN6A 2DOFA 2L9RA 4O6JA 2XAQA 4NBQA 4V19K 1TQMA 4BYYA 4UUTA 3W6VA 3EUHC 2VUMJ 2FU4A 5CVJA 2EILH 1J0RA 2PMHA 2JTVA 2BE5F 4WWCA 3B6CA 4N4OB 1PP8F 1W4MA 1ZTRA 3FXOA 3HUGB 1D0ZA 4FHTA 2P7VB 4HX4A 4KJZA 2UXXA 5GPAA 3DQVC 3ZQLA 3SZPA 1YO5C 3ECHA 5LHHA 3E6CC 2EB7A 3DPLC 3LSKA 4IPAA 3LQRA 1VQ6I 3OYFA 3CDIA 3HL2A 1JHFA 2HFHA 4HV5A 4YG2F 4I7HA 4NQWB 1TLHB 3HXLA 2EV0A 2EZHA 4QTRA 2BHYA 2CS3A 3IRQA 1JXSA 1GUUA 3WTYC 1MH4A 3GTPJ 2DYSH 3K0LA 3KP3A 3OR2C 2LLKA 3K1PA 3KIOA 5IP6A 1G6NA 4U88A 2B0LA 4IX7A 2LBFA 1P4AA 4BH9A 2N8GA 3FBNB 1NK3P 1MDMA 4BQNA 1I5ZA 4XL9A 2WA0A 2EV5A 1MMGA 2M87A 4M3EA 3HGYA 1FJLA 4I01A 2L02A 4BEHB 1TP4A 2F48A 2XPUA 1IDYA 4HA8A 2GA1A 4PUSA 3OS1A 2M0CA 4ENNA 3IUOA 3JW4A 2EWNA 4FTHA 2DU9A 2CFOA 2L4AA 3ZGKA 2HOEA 2BZTA 2NOGA 3HPGA 1YITI 2X48A 5AIQA 3O2PE 5FKOA 3VWBA 1J7KA 1R9TJ 4AIHA 2O03A 1OQYA 1QHHD 2A69F 2CUZA 2L3DA 4ZYEA 3W2WA 1YLFA 4DIQA 2V1XA 3ELKA 3S1RJ 1R1UA 1MMDA 5LLQA 2O3FA 3CMEI 2R4GA 4B3AA 1RR8C 4E7KA 5ILUA 5EF6A 3OYKA 1UAAA 4CSWA 2W48A 3ASOH 4A5NA 1XTAA 2DFIA 2DMUA 3T5XA 4LFUA 1OYYA 4ASNA 2ZFUA 4LJZF 3PO3J 4EMSA 2B63J 4WXDA 1SD4A 1ODDA 1XMKA 3H5NA 3K69A 1HBXG 3W6KB 5D5WB 3CC7I 2EIJH 3KP7A 4G9YA 3NARA 3HDDA 3ML6A 2MGQA 2Y0MA 3OS2A 2HZDA 1G59A 4I2OA 2IS4A 2ESHA 5LHIA 1ZLKA 4E7IA 1B8IA 1UZCA 2PMZA 4LIUA 3ISPA 3KX2A 5EZGA 1KA8A 2NVTJ 1RPWA 2CH0A 4HOBA 2MABA 3OIQA 1SEUA 1XPXA 2IGKA 3VFZA 2K7LA 1TL8A 4IHVA 3TP3A 4BKXA 5TRDA 4II3A 5HDKA 5JVGF 5IYBJ 1MBEA 5IOZA 2BGCA 3U9GA 3GZ6A 4OINF 4G8XA 2M1BA 2KP6A 5HLGA 1O4XA 3O6BB 4IQJA 1SANA 2E36A 3ZMVA 2QLZA 1Y1WJ 3MKWB 3N97A 5J1UA 5D8LB 1ZREA 3CC4I 1RNLA 1RR7A 3RKQA 2QSGX 1K83J 5FKKA 2CV0A 2KRCA 4BBSJ 4V2GA 3UKGA 3IAM2 4RM2A 1A5JA 3OYJA 4F7ZA 4B8XA 1MMNA 3PQJA 4HBLA 4M71A 2A68F 4XORA 2ZO4A 2LKXA 1Y8RB 2NNNA 1HDPA 2HYJA 1TQPA 2EV6A 3MN2A 4C2UA 1VQLI 4RMNA 1LPQA 2Z5UA 3WODF 4XRSA 1TTYA 3L7WA 2CQ7A 4MIMA 2QKLB 1VQKI 2STWA 2Y75A 4HNTA 3T1BA 4NB5A 1WI9A 5J6XA 3IHUA 3OY9A 2L7KA 4ITVA 4O3MA 1QPMA 1UG2A 3SEZA 1GVDA 2FUG2 2DN0A 4F55A 1IGNA 1X2NA 2EFQA 2WWYA 3TBIA 2RV8A 3MD2A 3ZMZA 2R5YB 1LDKB 4W1UA 1DU6A 2Y2ZA 1SFKA 2VJ4A 3V7CA 3C7JA 2ME6A 1GXQA 3WG9A 5LGUA 5CVVA 3H36A 3OWTA 1W7PB 5L3BA 2COBA 2MD0A 1V4RA 2WV0A 3TDZC 2O8KA 2FQ4A 1VQ9I 2W4SA 2XGXA 3G1LA 1FLIA 2NYXA 4S04A 2WADA 1ON2A 2ZC2A 1VNDA 2DA6A 2ISYA 4HF2A 1HF0A 5FLXZ 4ZYDA 1IDZA 2JPCA 2I5UA 4YRVA 4I0BA 1U2WA 1L0OC 1W36D 2XSJC 5L3GA 4YIIA 2HYFA 4W97A 2PJRB 3DPTA 2NS0A 2E2IJ 3FXMA 1IUFA 5H6QA 5K7ZA 2V1UA 2UV1A 1RETA 1ZN2A 2YPRA 1GLNA 1Z67A 3K6GA 3TMOA 3PUFA 2GAUA 4M9XA 2YR2A 4A3BJ 1IV6A 3S3OA 2RGVA 2DFHA 4YIRX 2MH2A 1TWFJ 3C18A 4LB6B 3ZRGA 2X1EA 3CCQI 3LSMA 1I6HJ 4EVIA 1SC7A 3DV8A 2DA4A 3E6DA 2ECBA 4XRMA 4D7MA 1O3RA 3ESWB 3QAHA 2GM4A 4M74A 4BXXJ 1YTYA 1NTCA 1R00A 1LVKA 1PUEE 1IXSB 1A36A 3I9V2 1FBSA 1SVOA 2IVMA 2VKVA 2VB6A 1W5TA 3BZCA 1P92A 1XGMA 2K9LA 2A05A 2OQGA 1D5YA 2DMQA 3HRMA 1VQNI 4PDKA 3HRUA 4FCYA 1IUYA 2EA2A 1MJBA 1EH8A 1K78A 1FMWA 3F3XA 4IKFA 2PN6A 3L2VA 1MIJA 5CQEA 2JA2A 1ETYA 4P9UA 4XLPF 3O8HA 1BW5A 1V55H 1T33A 3MZYA 3ABKH 3CCYA 1MBGA 3HHHA 1D3YA 3D0SA 1U8RA 3O8GA 4QPQA 2IRFG 1KGSA 3QYFA 5K7FA 5EGOA 3OYNA 4QWQA 4UNOA 3A2KA 3I4NJ 1QU3A 3BR0A 1FBQA 1R1TA 3J80Z 2IGMA 2Y69H 3WTZA 1XMXA 5F0FA 4L9VA 2R5ZA 3GTOJ 4NC7A 3HTSB 2I8DA 1FYLA 2WAFA 2XUBA 1X58A 3ZP5A 2FBHA 2FBKA 3ZQHA 5K1YA 2BBYA 5J47A 1GHCA 4L9NA 3A0HC 4U0YA 3WE2A 2YX7A 2DQLA 3PFIA 1M1EB 4HEA2 4IHXA 4NDLA 3RJPA 4EM2A 5HS8A 2GXAA 2Z3YA 1W1WE 1IRXA 1Q1VA 1R5HA 3FWEA 4KMFA 1WJAA 1QZEA 2KQRA 2FOKA 3LSGA 2JUCA 9ANTA 3HSRA 1DGRM 1PJRA 3R61A 1U8BA 3HPHA 1WJDA 3HUGA 3CCRI 1G3SA 4HW0A 4UVAA 4XKBA 1X2MA 3QQAA 3OYDA 4UUVA 3OSFA 2A07F 1ZRFA 1S29A 2K9QA 1MZBA 2DT7B 3NWTA 1V5EA 4KIBA 2XF5A 3A1YA 3OOPA 4HV6A 3L2UA 3GFMA 4NQWA 1F5TA 5GAEJ 1XB4A 2P4WA 4XRFA 1FC3A 2CUJA 3A4CA 2R7RA 3LFUA 4RGRA 3CLOA 2M34A 1JUSA 1U9NA 1USSA 4I09A 4F92B 1W36C 2E2JJ 2HS5A 2CRGA 2QENA 2V9VA 3KCCA 2EIMH 4AC0A 2A3SA 1YQAA 2F5EA 3JCUC 1WJCA 2IAIA 2L9SA 4E4HA 3R4KA 1MBKA 3RQIA 5GPCA 4BEHA 4A5MA 3U1DA 1E3HA 2NXNB 3AG3H 1NH3A 4N9HA 1POGA 3H0DA 3RDIA 1V5FA 1U5TC 4M73A 2Y0SN 2GBYA 1YX5A 2DDAA 1CGPA 1ZAOA 2K3PA 3GZNB 5FRMA 2OTJI 1T2KA 1HKQA 3G6EI 2XAFA 4IVNA 1WQ2A 1X1BA 1KQ0A 3HOXJ 3FXKA 1UG0A 3N4MA 1S72I 1WH5A 2DMTA 4JX6A 1FYMA 2XDVA 1T56A 2P6SA 1SFUA 4NC8A 1TW3A 4CZCA 2DYRH 5D5XB 3LSPA 3V4GA 1MNEA 3EUHA 3F6OA 5F08A 1S6LA 2DBBA 3GVAA 3DKXA 5L3FA 4G7ZF 2VJ5A 1TQIA 1FYKA 1RRJA 2CV2A 2GQQA 3S2HJ 4PSWA 1U78A 4BJTA 4H0EA 4EEFG 1P4XA 2IT0A 4BY1J 4ENJA 2L9NA 2P0WA 4G6QA 1Z1DA 2G7HA 1UB9A 1ZHFA 3CDHA 1I1SA 3HIFA 4JK1X 5L3DA 1VQ5I 1RI7A 3AL0C 1OR7C 1KU3A 1Z3XA 2XPVA 1MKMA 3I56I 2OAZA 1TWGJ 2WAEA 5BPDA 1REPC 4HX7A 3EUAA 2LMDA 4BL0B 3HYIA 4QIWN 1IN6A 4X6AJ 3JAMZ 2DODA 3IP4B 1IXCA 2OTLI 3WGHA 1HW2A 3TW6A 2Q0OA 3I4PA 4CZZA 4DGWB 1QO0D 1R7JA 2W24A 1IXRC 3DEEA 3MEXA 6PAXA 4A3KJ 1S5LC 4A3DJ 2M3AA 1I50J 1G3WA 1ON1A 2HVQA 2QKMB 5LD2C 5CVIA 3BWGA 1HW5A 2D2WA 4AU7A 3P5JA 4EM1A 2R7TA 1R58A 5D5VB 1ETQA 1E3PA 1U5TB 2M7BA 4EJVA 4G7OF 2X1DA 4Q4ZF 3WTVC 4RAZA 1RKWA 2GZWA 1P6RA 2FJ1A 5CKTA 2M2EA 5EG0B 3M1CA 4XKVA 3RTRA 4Y7NJ 1LB2A 1K79A 1R6RA 4ZZDA 2DA2A 3ZQGA 3BZ6A 2CV1A 3GYHX 2F2EA 1NHAA 2QBYB 3OYLA 4M6VA 1E3OC 3GWZA 3E6MA 3AG2H 4PZJA 4X1EA 2GXGA 2O9LA 4ESBA 1WWXA 2PFBA 4IZZA 3I0TA 4V2FA 4DJAA 3DKWA 3CCLI 4DBQA 2QGUA 3HM5A 2AXLA 1RZ4A 3BJAA 3BPXA 3DU5A 4A93J 1BR4A 1ENHA 1N75A 4R79A 4BU2A 1K7AA 3IKTA 1QBJA 1X1AA 1HDDC 3PIPF 1XSXA 3WGGA 5K5OA 3I64A 4HDUA 3S16J 2BOLA 3WGIA 2KRFA 2R5YA 4JX4A 5GADJ 3K4CA 1MBFA 3WG7H 4E7SA 1XX5A 5C4JJ 1QZZA 2QQBA 1IZ1A 2R7SA 1JKRC 3I55I 1W7PA 3VOEA 1HKTA 1WJBA 2L4MA 2LR8A 1TWCJ 1YFHA 2IA0A 3HEFA 1OCRH 5B66C 2ZKZA 3EPZA 1AA7A 5GAGJ 2DI3A 1UJ8A 1X19A 3CMYA 1WCMJ 1MMSA 1HC8A 1T95A 3NWSA 5J4YA 3HOSA 3HJEA 3M8EA 2M0MA 2UUZA 4AYBA 1BA5A 3V8LA 2DLLA 2VE9A 1G3YA 2LH9A 3U2RA 1WPKA 4E70A 4ZDOA 2PJRA 3R0AA 1LEAA 3TL4X 3SJMA 2A5WA 2GA2A 4IRGA 1O3SA 3I59B 3BZKA 2LOOA 2ZXIA 1QZYA 2C6YA 3EUKL 4J01A 3BCBA 3ERMA 2EZLA 2ID6A 3GW2A 3H5AA 3BC8A 4JOMA 1SVMA 2E19A 2K85A 5L3EA 4NNJA 1S7AA 3PFYA 1O7LA 2DMPA 4Q47A 4C2MJ 2UWMA 4BAYA 4MTDA 3QOEA 1P2FA 3GTQJ 5JHFA 3CC2I 3CUQB 1Y56A 2OA4A 5LHGA 4RDUA 3H3UA 3CTAA 5DD4A 2D45A 3OYEA 1LFBA 1OCCH 2E71A 3HSFA 2V9PA 4UB8C 2AS5F 4KICA 1WVRA 2KIMA 2LC2A 2K02A 3CF2A 2LRDA 3JRFA 3DEUA 2O8XA 4N0BA 2FQ3A 2YS9A 3F8BA 4MLOA 5F6FA 4EJUA 3TO6A 5E17F 2DK8A 3CJRB 5TGTA 5DM7F 1IRZA 4RAFA 3HRSA 1XCBA 3RKYA 4OOIA 3CF5F 1H0MA 3HGGA 4OIRF 4PGGA 3BDDA 4RGSA 4B4CA 3ZQIA 3DKYA 3NRVA 3RPUD 3S15J 2NAZA 2X1CA 3CZ6A 3CCJI 4WXHA 3CCUI 4EJWA 1UMQA 2JRMA 2QEXI 3BR5A 4P55A 5DCFA 3KZYA 2FXAA 2PBIA 4UXNA 3BR6A 4WK8F 2BY3A 1QPIA 1T98A 4YFKF 4KUMA 1UELB 2VE8A 4A3FJ 3OMYA 3H9JA 2VKHA 3KP5A 2OBPA 1WJEA 2K27A 3WU0A 5A2QK 3F8NA 2HPMA 1P7IA 1BC8C 4U0VA 3MQ0A 4LMYA 5FGMA 2O7OA 2DJNA 3ZMSA 2WB1N 5B1AH 4XKWA 1JKPC 2HQAA 3ABUA 1I6XA 2E1NA 3VPRA 4CCMA 5HLIA 2LVSA 4RLFA 4JYKA 1F9NA 3OL4A 1JTXA 5EJCA 3GTLJ 1TZLA 1LNWA 3M07A 2XSDC 2HVSA 2DAOA 2M8GX 2Z33A 4P5OA 1GVJA 1WZ2A 3JSOA 1SAXA 5FLVA 5KAIC 3WTTC 2CUFA 1APLC 2GIZA 5CYVA 4GGGA 1RUOA 3M7GA 1SFXA 2IBDA 4CH7A 1BIAA 4I99C 3OYCA 4B3XA 5FKMA 4FE7A 4FT8A 3T8TA 4HQMA 3JRIA 1BI3A 3KYCB 3JTHA 4UVCA 5DM6F 2VQHA 3GBGA 2VKDA 2X6WA 4PJJA 1D0YA 3F22A 2Y48A 3DTKA 4IRHA 4UHTA 3K10A 3IL2A 4KIGA 5JHUA 2P81A 5F1JA 2QQ8A 4AIKA 1BR2A 5K7HA 4ZDLA 1MGTA 1B1BA 1TT0A 2K5CA 1I3AA 1WJ5A 3T8RA 2MFZA 2HPIA 1FEXA 1GDTA 5IYCJ 2VXZA 2RQPA 5IYDJ 5H6RA 2XKPA 3QRFF 3RZDJ 2JVHA 4IO9F 3H9GA 2E7WA 4CDGA 2L7FP 1J2XA 1YX3A 3I4MJ 5DV5A 2ADUA 1YJNI 1YJWI 3ZN0A 2KIQA 5CPRB 2DOEA 3VDXA 1S7OA 3GUDA 3KZZA 4L5JA 5D6EA 4FE4A 1D5VA 1C0WA 4B09A 3LSJA 3PUBA 5EEGA 2UXNA 3F21A 5ERIA 2OF7A 3K4BA 3GLLA 1ETKA 3FIWA 1MH3A 3FZVA 4KT6A 3F8MA 5M5XJ 1FP2A 2PMUA 5F1RA 1GV5A 3BG9A 3OIPA 1DPRA 4RA2A 1VQMI 4O5VA 2AXTC 3GFIA 3LSIA 1E17A 3CJTB
chains in the Genus database with same CATH topology
4RAYA 1BN5A 5KVRA 3H3ZA 4BHCA 3Q5FA 1U5TA 1XGOA 2KIFA 4YFXF 4AWXB 3KLNA 1OYWA 2HTJA 2FE3A 3SZTA 4KA4A 4MEYF 2W84A 4HLYA 4RS8A 2QBYA 3EETA 1B6AA 3H92A 2FEZA 4KT5C 5TJJA 5J8FA 1JGSA 5DUKA 1J75A 1ZG1A 3JSPA 2YU3A 4UV8A 1PP7U 4L9TA 5E1XA 5FFXA 3L2CA 2LNBA 3VEPA 3HTUA 2EFNA 1FPQA 2HEOA 2XVCA 2LSOA 4NHJA 4G94A 5E1ZB 1OR7A 1JHHA 3TOBA 3O3KA 2E1CA 1D8KA 3EYIA 3ZMUA 1TBXA 1YW9A 3B73A 3GFLA 4A12A 2H09A 4AVPA 1ONVA 5F64A 4KDPA 2OZ6A 2A6HF 2VBWA 1R5GA 3V8KA 2P7CB 1ZG5A 1BM9A 5KK1A 2XV4S 2ZJ2A 1YIOA 2XKOA 5HDGA 2XAHA 1SD7A 5E20A 5D8KB 3I5UA 1J9IA 3SQNA 1Z6RA 3HRTA 3I59A 5E8IA 3LA7A 3BOQA 2VT3A 1Z9CA 1U6GA 3KP6A 2BEOA 2ZFWA 1Q1HA 2STTA 4EJOA 3K1MA 4M6YA 3BP8A 3QU3A 2NRAC 5ILSA 3L09A 3BJ6A 3KEOA 1R22A 4CO8A 1KU9A 3CUQA 4RB0A 2WC2A 5DD8A 3QP5A 2HKXA 5JFRA 1AWCA 1ZYRF 4RB1A 3DF8A 1HQCA 1OYIA 3TOAA 3MZHA 2VODA 3F72A 4GCVA 5LRSA 1K6OA 1XMAA 2DQRA 3M8FA 3R0JA 2XAGA 3EDPA 3R60A 3JTGA 2RDPA 2CO5A 5HLHA 1S8NA 4M9ZA 2EJRA 3QOPA 3ZMDA 3C3WA 2X0LA 5IT9K 2IA1A 4L0YB 3FXRA 1O3TA 2O6GE 5DUIA 1YYVA 3PQKA 1DDNA 1DP7P 1XDSA 4ON0A 4HDVA 2FMLA 1IN8A 2MBFA 4U0WA 4HLXA 4MGRA 3GXOA 4I98B 5FO5A 3AAFA 1F1ZA 2PG4A 2DPUA 1I27A 4ZYGA 2ZBKA 1Z05A 5D6FA 5ICEA 1IF1A 1XGNA 3DFGA 1FBUA 4BHPA 4Q48A 1OPCA 5JI6A 2IPQX 2ACJA 2ZNZA 2W85A 2PLYA 2K4BA 1HXDA 2FNAA 4A6DA 2ZMEB 3LSTA 2RN7A 4N9IA 4Z2YA 1QQIA 2HZTA 1ZRCA 4D0PA 3M1EA 3GF2A 4BXUA 5CJ9A 3RKWA 3IKVA 4LK1F 3QP6A 4LLNA 2D1VA 1PDNC 5FFZA 3RYRA 1F4KA 2IJLA 3WTXC 2VOOA 1OMIA 4IF4A 2R7FA 3Q9SA 5ED4A 5HS7A 5FD6A 1ZGJA 2XROA 2HQNA 4ZZLA 4I0AA 1TNSA 2VT2A 4LB5A 1LEBA 3TO9A 3V7RA 3ERED 4GXOA 2HR3A 3FMSA 2VOPA 1IN5A 2CGPA 3L00A 3L9FA 4OIOF 1EH7A 3IC7A 4RGXA 3W6JB 1XCVA 1FSEA 2A5YB 1LJ9A 1YG2A 3VODA 1RIOH 1LQ1A 5K5RA 1STZA 2V6CA 1SMTA 4P9FA 5BPIA 1IW7F 4ESJA 1SFEA 2BYVE 4HZFA 4RB2C 3RPUA 5A2QZ 4PCQA 4CGZA 1KQ9A 2FSWA 4IRIA 3K1NA 4CYDA 2RKHA 5AONA 3RPQA 3KP2A 2XASA 1ZGAA 2L01A 1JE8A 3IRRA 2D1HA 2XHKA 2P5KA 2QUFA 4OIPF 1QGPA 1FNNA 1WSUA 3R6SA 4QLCU 5ICGA 4DNCA 3MFKA 3V8JA 3WE3A 4IXAA 1OKRA 1EH6A 4M9SA 3LWFA 3SXYA 4LG0B 2FMYA 3F8FA 5LBQA 2WTEA 2LF8A 2L54A 4G6DA 2R3SA 3ZN1A 3I71A 2CQKA 2RNJA 2DK5A 2GXBA 3CO6C 4EV0A 2M5WA 2F5FA 1B4AA 5E1WA 1FX7A 2LF7A 4OMYA 2DW4A 4Y15A 2OU2A 3RI4A 3KEQA 3FHZA 2QYOA 2ISZA 1WKMA 5J8CA 2A6EF 4A0XA 1XSDA 3P9IA 3FMQA 1BOAA 4EGZA 3V7SA 1SD5A 3F6VA 2R7DA 4G7HF 4UVBA 1IRFA 1LDDA 4OIQF 3FM5A 1H9GA 1W7PD 4HAMA 5DDGA 1G4DA 4LLGF 2XRNA 2J5OA 3S2WA 1XGSA 3SHFA 2K86A 4ENKA 5D5UB 3E6BA 5LEKA 2HWVA 4L9JA 5HDNA 4U7DA 2X4HA 1CF7B 3WU1B 1ZARA 1LDJA 4MNUA 3RYPA 5HOOA 2MC3A 2G9WA 3F23A 2A61A 1IRGA 2QM3A 2P8TA 4I02A 3TGNA 4XSXF 5BS6A 3GFJA 2FNPA 4XLNF 4A0ZA 4S05A 2JPBA 1B59A 1SD6A 2EA4A 5JVTA 1Z7UA 3KLOA 3SFZA 4ZYHA 3P7NA 3EQLF 3DXJF 3B02A 4WF2A 2KJBA 4GYGA 2H94A 3COAC 2HQRA 1UCRA 2XAJA 4MTEA 4Y13A 5LRRA 1J5YA 5DYMA 4HX8A 2GWRA 2MLKA 2ZMEA 5CLSA 1ZH5A 2W25A 2VN2A 4DQ2A 3J81K 1TNTA 1KU2A 1ZLJA 3BROA 4GO1A 2DTRA 4LD5A 4R8HA 1H9TA 2CSOA 3BPVA 4ENMA 3I53A 1BIBA 3HSEA 3NEUA 4EJTA 2VONA 2UZKA 3G73A 2QVOA 3RIRA 5LEJA 1FT9A 1XSVA 1ZRDA 4L5IA 2O61A 2COMA 2QZ8A 3P9KA 1DPUA 1KQ8A 2Q2EA 1R23A 1FWZA 3MAJA 1Z91A 4WX9A 4P96A 3QPHA 4A0YA 2E7XA 4HQEA 2M8EA 1R36A 3TDUC 4GYIA 1BC7C 2QQAA 4BNCA 1ULYA 3BJOA 2EFOA 2H6CA 5FB2A 2PJPA 4EGYA 3MWMA 4RGUA 1USTA 5CVRA 3KETA 1I1GA 4UV9A 1YS6A 4IHSA 1Z6TA 2CFXA 1J59A 2P5VA 5LGTA 1FY7A 3GZ5A 5H20A 5DCMB 3CJNA 5IT9Z 1FP1D 2ETHA 3ULQB 1HW1A 1MD0A 3ECOA 4Y17A 2VC1A 2HYGD 4OU0A 3M9AA 1BI0A 4ETSA 4RB3C 1T0FA 4BQAA 3LFKA 2TDXA 3FX3A 1FOKA 3LA3A 4LGWA 5ILVA 5AIPA 2RVCA 4R1HA 2FBIA 2H27A 5BMZA 1YW8A 4LG0A 3MCZA 2CYYA 3KP4A 1T6SA 4FX4A 4AD9A 2QQ9A 3P9CA 1MJAA 4WCGA 1UHWA 1U3EM 1RUNA 4OMZA 2PEXA 3E5QA 1BBYA 3Q9VA 4CICA 1A04A 4HF1A 2G7UA 4LLLA 3CUOA 3E3VA 1BI1A 1IAWA 2RC4A 3D5LA 1O3QA 3LAPA 1AOYA 2KKOA 3E97A 4CHUA 2HKOA 1KYWA 4HYEA 2P5LC 4ZH4F 3C1DA 2HDCA 3FXUA 5HVQC 3I58A 2OD5A 3WTWC 3TQNA 4KN7X 5LGNA 1UHMA 4MEXF 5ICFA 3LA2A 5BOXA 1LVAA 4JQFA 5K5QA 2GIVA 3QU6A 4MHGA 2VBYA 4ESFA 3FMRA 3K2ZA 2O0YA 4PGHA 2JZYA 3HHGA 4EM0B 3ABTA 4WXCA 1XDUA 1YW7A 2ZNYA 1BI2A 1TW2A 3FXQA 1CF7A 1O7FA 1HKSA 5D4SA 2IW5A 3IWFA 1MDMB 5FLXK 5E8GA 3DP7A 3KE2A 5CVUA 4CXFA 1IN4A 5FD5A 4KFCA 4L18B 1W5SA 3VB2A 2M45A 4KN4X 4L0ZB 2FRHA 2VC0A 3LAJA 2HTSA 4XSZF 2CWEA 4XBFA 1T38A 2PI0A 2NNYA 2XIGA 2HGCA 5L3CA 3ZMTA 2EFPA 3EYYA 1Y0UA 4M72A 2JRTA 3IWZA 3BY6A 1GXPA 2YX4A 1IN7A 2H6BA 5HS9A 3QPTA 1WRJA 2W57A 3ZQ7A 2J5PA 2V79A 5ICCA 1V3FA 2ELHA 2VBZA 3J80K 2VBXA 2M30A 1KYZA 2MLGA 4KNYA 2PQ8A 3HOTA 5E18F 3GO5A 2LDUA 2OQRA 2FF4A 2LKPA 1DUXC 1G3TA 1QNTA 3J7AO 1XD7A 3FF5A 4MQVA 3T0YA 2F5CA 3GX4X 3K9TA 3GEZA 1SMYF 3WTSC 2FA5A 2Z99A 4EQQA 3ZPLA 4LK0F 4U7BA 1D8JA 2QWWA 1B9NA 2YSRA 3ROUA 3GLXA 4TV7A 1R1VA 1BJAA 2ESNA 1MJ9A 4JBAA 4A2UA 4KYWA 3G3ZA 1E2XA 4M6XA 1P4WA 2CW0F 2F5DA 3FM3A 2JSCA 1ZG3A 4KMUX 1XN7A 2MH9A 4HF0A 3OV8A 3TO7A 3E5XA 3CUQC 4AIJA 2KJCA 4KIFA 4MQ9F 5DCMA 3NQOA 2BV6A 4YFNF 3F8CA 3E5UA 2MD5A 3KFWX 3WTUC 1T39A 2JT1A 3CO7C 2K4JA 1YS7A 5EEHA 2EFWA 2IA2A 4A6EA 4BHBA 4IHTA 5D4RA 1VTNC 1S3JA 1KU7A 2DPDA 3LQQA 5BQTA 2EK5A 5IT3A 2V1DA 4K2EA 5DEQA 3TKYA 3JAMK 1B9MA 4FX0A 2DO7A 1FSHA 2CG4A 4YIFA 2P6TA 2OZUA 1K78B 1O57A 1L3LA 1HSJA 2Z9OA 1HSTA 1EV7A 2DT5A 1FZPB 2IP2A 2MA3A 3RKXA 4Q5SF 1X3UA 3J81Z 3REOA 2Q8KA 1UFMA 2KIUA 3I54A 4IJAA 2ZXJA 2ZCWA 5JR3A 4O6JA 2XAQA 1TQMA 4BYYA 2FU4A 5CVJA 1J0RA 2PMHA 2JTVA 2BE5F 4WWCA 1PP8F 1W4MA 4FHTA 2P7VB 4HX4A 2UXXA 3DQVC 3SZPA 1YO5C 3ECHA 5LHHA 3E6CC 2EB7A 3DPLC 4IPAA 3LQRA 1JHFA 2HFHA 4HV5A 4YG2F 4I7HA 1TLHB 2EV0A 3IRQA 1JXSA 3WTYC 3K0LA 3KP3A 3K1PA 1G6NA 4U88A 2B0LA 1P4AA 4BH9A 1MDMA 1I5ZA 2EV5A 2M87A 4I01A 2L02A 4HA8A 2GA1A 4ENNA 3JW4A 2EWNA 2DU9A 2L4AA 2HOEA 5AIQA 3O2PE 1J7KA 4AIHA 2O03A 2A69F 2L3DA 4ZYEA 1YLFA 2V1XA 3ELKA 1R1UA 5LLQA 2O3FA 5ILUA 4A5NA 2DFIA 3T5XA 4LFUA 1OYYA 4ASNA 4LJZF 4EMSA 4WXDA 1SD4A 1ODDA 1XMKA 3K69A 1HBXG 3W6KB 5D5WB 4G9YA 3KP7A 3ML6A 2Y0MA 4I2OA 2ESHA 5LHIA 1ZLKA 3ISPA 1KA8A 4HOBA 3VFZA 2K7LA 5TRDA 5HDKA 2BGCA 3U9GA 3GZ6A 4OINF 4G8XA 2M1BA 5HLGA 3O6BB 3ZMVA 2QLZA 3N97A 5D8LB 1ZREA 1RNLA 4F7ZA 4B8XA 3PQJA 4HBLA 4M71A 2A68F 2ZO4A 2NNNA 1TQPA 2EV6A 2Z5UA 3WODF 1TTYA 3L7WA 2STWA 2Y75A 3T1BA 4NB5A 1WI9A 5J6XA 3IHUA 4O3MA 1QPMA 2EFQA 2WWYA 2RV8A 3ZMZA 1LDKB 3V7CA 3C7JA 1GXQA 3WG9A 5LGUA 5CVVA 1W7PB 5L3BA 1V4RA 2WV0A 3TDZC 2XGXA 1FLIA 2NYXA 4S04A 1ON2A 2ISYA 4HF2A 5FLXZ 4ZYDA 2JPCA 4I0BA 1U2WA 1L0OC 5L3GA 4YIIA 2HYFA 3DPTA 2NS0A 5H6QA 2V1UA 1ZN2A 2YPRA 2GAUA 4M9XA 2YR2A 2RGVA 2MH2A 3C18A 4LB6B 4EVIA 3DV8A 3E6DA 1O3RA 3QAHA 4M74A 1YTYA 1R00A 1PUEE 1IXSB 1FBSA 2IVMA 1W5TA 1P92A 1XGMA 2OQGA 3HRMA 4PDKA 3HRUA 1IUYA 2EA2A 1MJBA 1EH8A 1K78A 3F3XA 2PN6A 4P9UA 4XLPF 3MZYA 3HHHA 1D3YA 3D0SA 1U8RA 2IRFG 1KGSA 4QWQA 4UNOA 1FBQA 1R1TA 3J80Z 3WTZA 4L9VA 3HTSB 1FYLA 3ZP5A 2XUBA 2FBHA 2FBKA 5K1YA 2BBYA 1GHCA 4L9NA 4U0YA 3WE2A 2YX7A 2DQLA 3PFIA 3RJPA 4EM2A 5HS8A 2Z3YA 1R5HA 3FWEA 4KMFA 2FOKA 3HSRA 3R61A 3HUGA 1G3SA 4HW0A 4UVAA 4UUVA 2A07F 1ZRFA 1S29A 1MZBA 4KIBA 3OOPA 4HV6A 3GFMA 4NQWA 1F5TA 1XB4A 2P4WA 4XRFA 1FC3A 4RGRA 3CLOA 1USSA 4I09A 2HS5A 2QENA 2V9VA 3KCCA 2A3SA 1YQAA 2F5EA 3R4KA 4A5MA 3U1DA 4N9HA 3RDIA 1U5TC 4M73A 1CGPA 1ZAOA 1T2KA 1HKQA 2XAFA 4IVNA 1WQ2A 1KQ0A 3N4MA 1FYMA 2P6SA 1SFUA 1TW3A 5D5XB 3V4GA 3EUHA 3F6OA 1S6LA 2DBBA 3GVAA 5L3FA 4G7ZF 1TQIA 1FYKA 2GQQA 1U78A 4H0EA 1P4XA 2IT0A 4ENJA 4G6QA 1Z1DA 2G7HA 1UB9A 1ZHFA 3CDHA 1I1SA 3HIFA 4JK1X 5L3DA 1RI7A 1KU3A 1MKMA 2OAZA 5BPDA 1REPC 4HX7A 3HYIA 1IN6A 3JAMZ 1IXCA 3WGHA 1HW2A 2Q0OA 3I4PA 4CZZA 1QO0D 1R7JA 2W24A 1IXRC 3MEXA 6PAXA 1G3WA 1ON1A 5CVIA 3BWGA 1HW5A 2D2WA 4EM1A 1R58A 5D5VB 1U5TB 4EJVA 4G7OF 4Q4ZF 3WTVC 4RAZA 2GZWA 1P6RA 3RTRA 1LB2A 1K79A 4ZZDA 3BZ6A 3GYHX 2F2EA 1NHAA 2QBYB 3GWZA 3E6MA 4PZJA 2GXGA 4ESBA 1WWXA 2PFBA 3I0TA 3DKWA 2AXLA 1RZ4A 3BJAA 3BPXA 1QBJA 4R79A 1K7AA 3IKTA 1XSXA 3WGGA 5K5OA 3I64A 4HDUA 3WGIA 2KRFA 1QZZA 2QQBA 1IZ1A 1W7PA 3VOEA 1HKTA 2L4MA 1YFHA 2IA0A 2ZKZA 2DI3A 3HOSA 3M8EA 3V8LA 2DLLA 2VE9A 1G3YA 3U2RA 4E70A 3R0AA 1LEAA 1O3SA 2GA2A 4IRGA 3I59B 1QZYA 2C6YA 3GW2A 5L3EA 1S7AA 1O7LA 4Q47A 2UWMA 4BAYA 4MTDA 1P2FA 3CUQB 2OA4A 5LHGA 3H3UA 3CTAA 5DD4A 2D45A 3HSFA 2AS5F 4KICA 2KIMA 2K02A 3DEUA 2O8XA 4N0BA 2FQ3A 3F8BA 5F6FA 4EJUA 3TO6A 5E17F 2DK8A 3HRSA 1XCBA 3RKYA 4OOIA 1H0MA 4OIRF 4PGGA 3BDDA 4RGSA 3NRVA 2NAZA 4WXHA 4EJWA 4P55A 5DCFA 3KZYA 2FXAA 2PBIA 4UXNA 4WK8F 1T98A 4YFKF 4KUMA 2VE8A 3KP5A 2OBPA 2K27A 3WU0A 5A2QK 3F8NA 1BC8C 4U0VA 3MQ0A 4LMYA 5FGMA 3ZMSA 3ABUA 1I6XA 2E1NA 5HLIA 1F9NA 1LNWA 2DAOA 2Z33A 4P5OA 1GVJA 3JSOA 1SAXA 3WTTC 5CYVA 4GGGA 1RUOA 3M7GA 1SFXA 1BIAA 4FT8A 3T8TA 4HQMA 1BI3A 3JTHA 4UVCA 3F22A 2Y48A 4IRHA 4UHTA 3IL2A 4KIGA 5JHUA 4AIKA 1MGTA 1B1BA 3T8RA 2VXZA 2RQPA 5H6RA 2XKPA 3QRFF 2E7WA 4CDGA 1J2XA 5DV5A 2ADUA 3ZN0A 1S7OA 3GUDA 3KZZA 4L5JA 5D6EA 1D5VA 1C0WA 4B09A 5EEGA 2UXNA 3F21A 5ERIA 3FZVA 3F8MA 1FP2A 2PMUA 5F1RA 1DPRA 4O5VA 3GFIA 1E17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAY A;  1BN5 A;  5KVR A;  3H3Z A;  4BHC A;  3Q5F A;  1U5T A;  1XGO A;  2KIF A;  4YFX F;  4AWX B;  3KLN A;  1OYW A;  2HTJ A;  2FE3 A;  3SZT A;  4KA4 A;  4MEY F;  2W84 A;  4HLY A;  4RS8 A;  2QBY A;  3EET A;  1B6A A;  3H92 A;  2FEZ A;  4KT5 C;  5TJJ A;  5J8F A;  1JGS A;  5DUK A;  1J75 A;  1ZG1 A;  3JSP A;  2YU3 A;  4UV8 A;  1PP7 U;  4L9T A;  5E1X A;  5FFX A;  3L2C A;  2LNB A;  3VEP A;  3HTU A;  2EFN A;  1FPQ A;  2HEO A;  2XVC A;  2LSO A;  4NHJ A;  4G94 A;  5E1Z B;  1OR7 A;  1JHH A;  3TOB A;  3O3K A;  2E1C A;  1D8K A;  3EYI A;  3ZMU A;  1TBX A;  1YW9 A;  3B73 A;  3GFL A;  4A12 A;  2H09 A;  4AVP A;  1ONV A;  5F64 A;  4KDP A;  2OZ6 A;  2A6H F;  2VBW A;  1R5G A;  3V8K A;  2P7C B;  1ZG5 A;  1BM9 A;  5KK1 A;  2XV4 S;  2ZJ2 A;  1YIO A;  2XKO A;  5HDG A;  2XAH A;  1SD7 A;  5E20 A;  5D8K B;  3I5U A;  1J9I A;  3SQN A;  1Z6R A;  3HRT A;  3I59 A;  5E8I A;  3LA7 A;  3BOQ A;  2VT3 A;  1Z9C A;  1U6G A;  3KP6 A;  2BEO A;  2ZFW A;  1Q1H A;  2STT A;  4EJO A;  3K1M A;  4M6Y A;  3BP8 A;  3QU3 A;  2NRA C;  5ILS A;  3L09 A;  3BJ6 A;  3KEO A;  1R22 A;  4CO8 A;  1KU9 A;  3CUQ A;  4RB0 A;  2WC2 A;  5DD8 A;  3QP5 A;  2HKX A;  5JFR A;  1AWC A;  1ZYR F;  4RB1 A;  3DF8 A;  1HQC A;  1OYI A;  3TOA A;  3MZH A;  2VOD A;  3F72 A;  4GCV A;  5LRS A;  1K6O A;  1XMA A;  2DQR A;  3M8F A;  3R0J A;  2XAG A;  3EDP A;  3R60 A;  3JTG A;  2RDP A;  2CO5 A;  5HLH A;  1S8N A;  4M9Z A;  2EJR A;  3QOP A;  3ZMD A;  3C3W A;  2X0L A;  5IT9 K;  2IA1 A;  4L0Y B;  3FXR A;  1O3T A;  2O6G E;  5DUI A;  1YYV A;  3PQK A;  1DDN A;  1DP7 P;  1XDS A;  4ON0 A;  4HDV A;  2FML A;  1IN8 A;  2MBF A;  4U0W A;  4HLX A;  4MGR A;  3GXO A;  4I98 B;  5FO5 A;  3AAF A;  1F1Z A;  2PG4 A;  2DPU A;  1I27 A;  4ZYG A;  2ZBK A;  1Z05 A;  5D6F A;  5ICE A;  1IF1 A;  1XGN A;  3DFG A;  1FBU A;  4BHP A;  4Q48 A;  1OPC A;  5JI6 A;  2IPQ X;  2ACJ A;  2ZNZ A;  2W85 A;  2PLY A;  2K4B A;  1HXD A;  2FNA A;  4A6D A;  2ZME B;  3LST A;  2RN7 A;  4N9I A;  4Z2Y A;  1QQI A;  2HZT A;  1ZRC A;  4D0P A;  3M1E A;  3GF2 A;  4BXU A;  5CJ9 A;  3RKW A;  3IKV A;  4LK1 F;  3QP6 A;  4LLN A;  2D1V A;  1PDN C;  5FFZ A;  3RYR A;  1F4K A;  2IJL A;  3WTX C;  2VOO A;  1OMI A;  4IF4 A;  2R7F A;  3Q9S A;  5ED4 A;  5HS7 A;  5FD6 A;  1ZGJ A;  2XRO A;  2HQN A;  4ZZL A;  4I0A A;  1TNS A;  2VT2 A;  4LB5 A;  1LEB A;  3TO9 A;  3V7R A;  3ERE D;  4GXO A;  2HR3 A;  3FMS A;  2VOP A;  1IN5 A;  2CGP A;  3L00 A;  3L9F A;  4OIO F;  1EH7 A;  3IC7 A;  4RGX A;  3W6J B;  1XCV A;  1FSE A;  2A5Y B;  1LJ9 A;  1YG2 A;  3VOD A;  1RIO H;  1LQ1 A;  5K5R A;  1STZ A;  2V6C A;  1SMT A;  4P9F A;  5BPI A;  1IW7 F;  4ESJ A;  1SFE A;  2BYV E;  4HZF A;  4RB2 C;  3RPU A;  5A2Q Z;  4PCQ A;  4CGZ A;  1KQ9 A;  2FSW A;  4IRI A;  3K1N A;  4CYD A;  2RKH A;  5AON A;  3RPQ A;  3KP2 A;  2XAS A;  1ZGA A;  2L01 A;  1JE8 A;  3IRR A;  2D1H A;  2XHK A;  2P5K A;  2QUF A;  4OIP F;  1QGP A;  1FNN A;  1WSU A;  3R6S A;  4QLC U;  5ICG A;  4DNC A;  3MFK A;  3V8J A;  3WE3 A;  4IXA A;  1OKR A;  1EH6 A;  4M9S A;  3LWF A;  3SXY A;  4LG0 B;  2FMY A;  3F8F A;  5LBQ A;  2WTE A;  2LF8 A;  2L54 A;  4G6D A;  2R3S A;  3ZN1 A;  3I71 A;  2CQK A;  2RNJ A;  2DK5 A;  2GXB A;  3CO6 C;  4EV0 A;  2M5W A;  2F5F A;  1B4A A;  5E1W A;  1FX7 A;  2LF7 A;  4OMY A;  2DW4 A;  4Y15 A;  2OU2 A;  3RI4 A;  3KEQ A;  3FHZ A;  2QYO A;  2ISZ A;  1WKM A;  5J8C A;  2A6E F;  4A0X A;  1XSD A;  3P9I A;  3FMQ A;  1BOA A;  4EGZ A;  3V7S A;  1SD5 A;  3F6V A;  2R7D A;  4G7H F;  4UVB A;  1IRF A;  1LDD A;  4OIQ F;  3FM5 A;  1H9G A;  1W7P D;  4HAM A;  5DDG A;  1G4D A;  4LLG F;  2XRN A;  2J5O A;  3S2W A;  1XGS A;  3SHF A;  2K86 A;  4ENK A;  5D5U B;  3E6B A;  5LEK A;  2HWV A;  4L9J A;  5HDN A;  4U7D A;  2X4H A;  1CF7 B;  3WU1 B;  1ZAR A;  1LDJ A;  4MNU A;  3RYP A;  5HOO A;  2MC3 A;  2G9W A;  3F23 A;  2A61 A;  1IRG A;  2QM3 A;  2P8T A;  4I02 A;  3TGN A;  4XSX F;  5BS6 A;  3GFJ A;  2FNP A;  4XLN F;  4A0Z A;  4S05 A;  2JPB A;  1B59 A;  1SD6 A;  2EA4 A;  5JVT A;  1Z7U A;  3KLO A;  3SFZ A;  4ZYH A;  3P7N A;  3EQL F;  3DXJ F;  3B02 A;  4WF2 A;  2KJB A;  4GYG A;  2H94 A;  3COA C;  2HQR A;  1UCR A;  2XAJ A;  4MTE A;  4Y13 A;  5LRR A;  1J5Y A;  5DYM A;  4HX8 A;  2GWR A;  2MLK A;  2ZME A;  5CLS A;  1ZH5 A;  2W25 A;  2VN2 A;  4DQ2 A;  3J81 K;  1TNT A;  1KU2 A;  1ZLJ A;  3BRO A;  4GO1 A;  2DTR A;  4LD5 A;  4R8H A;  1H9T A;  2CSO A;  3BPV A;  4ENM A;  3I53 A;  1BIB A;  3HSE A;  3NEU A;  4EJT A;  2VON A;  2UZK A;  3G73 A;  2QVO A;  3RIR A;  5LEJ A;  1FT9 A;  1XSV A;  1ZRD A;  4L5I A;  2O61 A;  2COM A;  2QZ8 A;  3P9K A;  1DPU A;  1KQ8 A;  2Q2E A;  1R23 A;  1FWZ A;  3MAJ A;  1Z91 A;  4WX9 A;  4P96 A;  3QPH A;  4A0Y A;  2E7X A;  4HQE A;  2M8E A;  1R36 A;  3TDU C;  4GYI A;  1BC7 C;  2QQA A;  4BNC A;  1ULY A;  3BJO A;  2EFO A;  2H6C A;  5FB2 A;  2PJP A;  4EGY A;  3MWM A;  4RGU A;  1UST A;  5CVR A;  3KET A;  1I1G A;  4UV9 A;  1YS6 A;  4IHS A;  1Z6T A;  2CFX A;  1J59 A;  2P5V A;  5LGT A;  1FY7 A;  3GZ5 A;  5H20 A;  5DCM B;  3CJN A;  5IT9 Z;  1FP1 D;  2ETH A;  3ULQ B;  1HW1 A;  1MD0 A;  3ECO A;  4Y17 A;  2VC1 A;  2HYG D;  4OU0 A;  3M9A A;  1BI0 A;  4ETS A;  4RB3 C;  1T0F A;  4BQA A;  3LFK A;  2TDX A;  3FX3 A;  1FOK A;  3LA3 A;  4LGW A;  5ILV A;  5AIP A;  2RVC A;  4R1H A;  2FBI A;  2H27 A;  5BMZ A;  1YW8 A;  4LG0 A;  3MCZ A;  2CYY A;  3KP4 A;  1T6S A;  4FX4 A;  4AD9 A;  2QQ9 A;  3P9C A;  1MJA A;  4WCG A;  1UHW A;  1U3E M;  1RUN A;  4OMZ A;  2PEX A;  3E5Q A;  1BBY A;  3Q9V A;  4CIC A;  1A04 A;  4HF1 A;  2G7U A;  4LLL A;  3CUO A;  3E3V A;  1BI1 A;  1IAW A;  2RC4 A;  3D5L A;  1O3Q A;  3LAP A;  1AOY A;  2KKO A;  3E97 A;  4CHU A;  2HKO A;  1KYW A;  4HYE A;  2P5L C;  4ZH4 F;  3C1D A;  2HDC A;  3FXU A;  5HVQ C;  3I58 A;  2OD5 A;  3WTW C;  3TQN A;  4KN7 X;  5LGN A;  1UHM A;  4MEX F;  5ICF A;  3LA2 A;  5BOX A;  1LVA A;  4JQF A;  5K5Q A;  2GIV A;  3QU6 A;  4MHG A;  2VBY A;  4ESF A;  3FMR A;  3K2Z A;  2O0Y A;  4PGH A;  2JZY A;  3HHG A;  4EM0 B;  3ABT A;  4WXC A;  1XDU A;  1YW7 A;  2ZNY A;  1BI2 A;  1TW2 A;  3FXQ A;  1CF7 A;  1O7F A;  1HKS A;  5D4S A;  2IW5 A;  3IWF A;  1MDM B;  5FLX K;  5E8G A;  3DP7 A;  3KE2 A;  5CVU A;  4CXF A;  1IN4 A;  5FD5 A;  4KFC A;  4L18 B;  1W5S A;  3VB2 A;  2M45 A;  4KN4 X;  4L0Z B;  2FRH A;  2VC0 A;  3LAJ A;  2HTS A;  4XSZ F;  2CWE A;  4XBF A;  1T38 A;  2PI0 A;  2NNY A;  2XIG A;  2HGC A;  5L3C A;  3ZMT A;  2EFP A;  3EYY A;  1Y0U A;  4M72 A;  2JRT A;  3IWZ A;  3BY6 A;  1GXP A;  2YX4 A;  1IN7 A;  2H6B A;  5HS9 A;  3QPT A;  1WRJ A;  2W57 A;  3ZQ7 A;  2J5P A;  2V79 A;  5ICC A;  1V3F A;  2ELH A;  2VBZ A;  3J80 K;  2VBX A;  2M30 A;  1KYZ A;  2MLG A;  4KNY A;  2PQ8 A;  3HOT A;  5E18 F;  3GO5 A;  2LDU A;  2OQR A;  2FF4 A;  2LKP A;  1DUX C;  1G3T A;  1QNT A;  3J7A O;  1XD7 A;  3FF5 A;  4MQV A;  3T0Y A;  2F5C A;  3GX4 X;  3K9T A;  3GEZ A;  1SMY F;  3WTS C;  2FA5 A;  2Z99 A;  4EQQ A;  3ZPL A;  4LK0 F;  4U7B A;  1D8J A;  2QWW A;  1B9N A;  2YSR A;  3ROU A;  3GLX A;  4TV7 A;  1R1V A;  1BJA A;  2ESN A;  1MJ9 A;  4JBA A;  4A2U A;  4KYW A;  3G3Z A;  1E2X A;  4M6X A;  1P4W A;  2CW0 F;  2F5D A;  3FM3 A;  2JSC A;  1ZG3 A;  4KMU X;  1XN7 A;  2MH9 A;  4HF0 A;  3OV8 A;  3TO7 A;  3E5X A;  3CUQ C;  4AIJ A;  2KJC A;  4KIF A;  4MQ9 F;  5DCM A;  3NQO A;  2BV6 A;  4YFN F;  3F8C A;  3E5U A;  2MD5 A;  3KFW X;  3WTU C;  1T39 A;  2JT1 A;  3CO7 C;  2K4J A;  1YS7 A;  5EEH A;  2EFW A;  2IA2 A;  4A6E A;  4BHB A;  4IHT A;  5D4R A;  1VTN C;  1S3J A;  1KU7 A;  2DPD A;  3LQQ A;  5BQT A;  2EK5 A;  5IT3 A;  2V1D A;  4K2E A;  5DEQ A;  3TKY A;  3JAM K;  1B9M A;  4FX0 A;  2DO7 A;  1FSH A;  2CG4 A;  4YIF A;  2P6T A;  2OZU A;  1K78 B;  1O57 A;  1L3L A;  1HSJ A;  2Z9O A;  1HST A;  1EV7 A;  2DT5 A;  1FZP B;  2IP2 A;  2MA3 A;  3RKX A;  4Q5S F;  1X3U A;  3J81 Z;  3REO A;  2Q8K A;  1UFM A;  2KIU A;  3I54 A;  4IJA A;  2ZXJ A;  2ZCW A;  5JR3 A;  4O6J A;  2XAQ A;  1TQM A;  4BYY A;  2FU4 A;  5CVJ A;  1J0R A;  2PMH A;  2JTV A;  2BE5 F;  4WWC A;  1PP8 F;  1W4M A;  4FHT A;  2P7V B;  4HX4 A;  2UXX A;  3DQV C;  3SZP A;  1YO5 C;  3ECH A;  5LHH A;  3E6C C;  2EB7 A;  3DPL C;  4IPA A;  3LQR A;  1JHF A;  2HFH A;  4HV5 A;  4YG2 F;  4I7H A;  1TLH B;  2EV0 A;  3IRQ A;  1JXS A;  3WTY C;  3K0L A;  3KP3 A;  3K1P A;  1G6N A;  4U88 A;  2B0L A;  1P4A A;  4BH9 A;  1MDM A;  1I5Z A;  2EV5 A;  2M87 A;  4I01 A;  2L02 A;  4HA8 A;  2GA1 A;  4ENN A;  3JW4 A;  2EWN A;  2DU9 A;  2L4A A;  2HOE A;  5AIQ A;  3O2P E;  1J7K A;  4AIH A;  2O03 A;  2A69 F;  2L3D A;  4ZYE A;  1YLF A;  2V1X A;  3ELK A;  1R1U A;  5LLQ A;  2O3F A;  5ILU A;  4A5N A;  2DFI A;  3T5X A;  4LFU A;  1OYY A;  4ASN A;  4LJZ F;  4EMS A;  4WXD A;  1SD4 A;  1ODD A;  1XMK A;  3K69 A;  1HBX G;  3W6K B;  5D5W B;  4G9Y A;  3KP7 A;  3ML6 A;  2Y0M A;  4I2O A;  2ESH A;  5LHI A;  1ZLK A;  3ISP A;  1KA8 A;  4HOB A;  3VFZ A;  2K7L A;  5TRD A;  5HDK A;  2BGC A;  3U9G A;  3GZ6 A;  4OIN F;  4G8X A;  2M1B A;  5HLG A;  3O6B B;  3ZMV A;  2QLZ A;  3N97 A;  5D8L B;  1ZRE A;  1RNL A;  4F7Z A;  4B8X A;  3PQJ A;  4HBL A;  4M71 A;  2A68 F;  2ZO4 A;  2NNN A;  1TQP A;  2EV6 A;  2Z5U A;  3WOD F;  1TTY A;  3L7W A;  2STW A;  2Y75 A;  3T1B A;  4NB5 A;  1WI9 A;  5J6X A;  3IHU A;  4O3M A;  1QPM A;  2EFQ A;  2WWY A;  2RV8 A;  3ZMZ A;  1LDK B;  3V7C A;  3C7J A;  1GXQ A;  3WG9 A;  5LGU A;  5CVV A;  1W7P B;  5L3B A;  1V4R A;  2WV0 A;  3TDZ C;  2XGX A;  1FLI A;  2NYX A;  4S04 A;  1ON2 A;  2ISY A;  4HF2 A;  5FLX Z;  4ZYD A;  2JPC A;  4I0B A;  1U2W A;  1L0O C;  5L3G A;  4YII A;  2HYF A;  3DPT A;  2NS0 A;  5H6Q A;  2V1U A;  1ZN2 A;  2YPR A;  2GAU A;  4M9X A;  2YR2 A;  2RGV A;  2MH2 A;  3C18 A;  4LB6 B;  4EVI A;  3DV8 A;  3E6D A;  1O3R A;  3QAH A;  4M74 A;  1YTY A;  1R00 A;  1PUE E;  1IXS B;  1FBS A;  2IVM A;  1W5T A;  1P92 A;  1XGM A;  2OQG A;  3HRM A;  4PDK A;  3HRU A;  1IUY A;  2EA2 A;  1MJB A;  1EH8 A;  1K78 A;  3F3X A;  2PN6 A;  4P9U A;  4XLP F;  3MZY A;  3HHH A;  1D3Y A;  3D0S A;  1U8R A;  2IRF G;  1KGS A;  4QWQ A;  4UNO A;  1FBQ A;  1R1T A;  3J80 Z;  3WTZ A;  4L9V A;  3HTS B;  1FYL A;  3ZP5 A;  2XUB A;  2FBH A;  2FBK A;  5K1Y A;  2BBY A;  1GHC A;  4L9N A;  4U0Y A;  3WE2 A;  2YX7 A;  2DQL A;  3PFI A;  3RJP A;  4EM2 A;  5HS8 A;  2Z3Y A;  1R5H A;  3FWE A;  4KMF A;  2FOK A;  3HSR A;  3R61 A;  3HUG A;  1G3S A;  4HW0 A;  4UVA A;  4UUV A;  2A07 F;  1ZRF A;  1S29 A;  1MZB A;  4KIB A;  3OOP A;  4HV6 A;  3GFM A;  4NQW A;  1F5T A;  1XB4 A;  2P4W A;  4XRF A;  1FC3 A;  4RGR A;  3CLO A;  1USS A;  4I09 A;  2HS5 A;  2QEN A;  2V9V A;  3KCC A;  2A3S A;  1YQA A;  2F5E A;  3R4K A;  4A5M A;  3U1D A;  4N9H A;  3RDI A;  1U5T C;  4M73 A;  1CGP A;  1ZAO A;  1T2K A;  1HKQ A;  2XAF A;  4IVN A;  1WQ2 A;  1KQ0 A;  3N4M A;  1FYM A;  2P6S A;  1SFU A;  1TW3 A;  5D5X B;  3V4G A;  3EUH A;  3F6O A;  1S6L A;  2DBB A;  3GVA A;  5L3F A;  4G7Z F;  1TQI A;  1FYK A;  2GQQ A;  1U78 A;  4H0E A;  1P4X A;  2IT0 A;  4ENJ A;  4G6Q A;  1Z1D A;  2G7H A;  1UB9 A;  1ZHF A;  3CDH A;  1I1S A;  3HIF A;  4JK1 X;  5L3D A;  1RI7 A;  1KU3 A;  1MKM A;  2OAZ A;  5BPD A;  1REP C;  4HX7 A;  3HYI A;  1IN6 A;  3JAM Z;  1IXC A;  3WGH A;  1HW2 A;  2Q0O A;  3I4P A;  4CZZ A;  1QO0 D;  1R7J A;  2W24 A;  1IXR C;  3MEX A;  6PAX A;  1G3W A;  1ON1 A;  5CVI A;  3BWG A;  1HW5 A;  2D2W A;  4EM1 A;  1R58 A;  5D5V B;  1U5T B;  4EJV A;  4G7O F;  4Q4Z F;  3WTV C;  4RAZ A;  2GZW A;  1P6R A;  3RTR A;  1LB2 A;  1K79 A;  4ZZD A;  3BZ6 A;  3GYH X;  2F2E A;  1NHA A;  2QBY B;  3GWZ A;  3E6M A;  4PZJ A;  2GXG A;  4ESB A;  1WWX A;  2PFB A;  3I0T A;  3DKW A;  2AXL A;  1RZ4 A;  3BJA A;  3BPX A;  1QBJ A;  4R79 A;  1K7A A;  3IKT A;  1XSX A;  3WGG A;  5K5O A;  3I64 A;  4HDU A;  3WGI A;  2KRF A;  1QZZ A;  2QQB A;  1IZ1 A;  1W7P A;  3VOE A;  1HKT A;  2L4M A;  1YFH A;  2IA0 A;  2ZKZ A;  2DI3 A;  3HOS A;  3M8E A;  3V8L A;  2DLL A;  2VE9 A;  1G3Y A;  3U2R A;  4E70 A;  3R0A A;  1LEA A;  1O3S A;  2GA2 A;  4IRG A;  3I59 B;  1QZY A;  2C6Y A;  3GW2 A;  5L3E A;  1S7A A;  1O7L A;  4Q47 A;  2UWM A;  4BAY A;  4MTD A;  1P2F A;  3CUQ B;  2OA4 A;  5LHG A;  3H3U A;  3CTA A;  5DD4 A;  2D45 A;  3HSF A;  2AS5 F;  4KIC A;  2KIM A;  2K02 A;  3DEU A;  2O8X A;  4N0B A;  2FQ3 A;  3F8B A;  5F6F A;  4EJU A;  3TO6 A;  5E17 F;  2DK8 A;  3HRS A;  1XCB A;  3RKY A;  4OOI A;  1H0M A;  4OIR F;  4PGG A;  3BDD A;  4RGS A;  3NRV A;  2NAZ A;  4WXH A;  4EJW A;  4P55 A;  5DCF A;  3KZY A;  2FXA A;  2PBI A;  4UXN A;  4WK8 F;  1T98 A;  4YFK F;  4KUM A;  2VE8 A;  3KP5 A;  2OBP A;  2K27 A;  3WU0 A;  5A2Q K;  3F8N A;  1BC8 C;  4U0V A;  3MQ0 A;  4LMY A;  5FGM A;  3ZMS A;  3ABU A;  1I6X A;  2E1N A;  5HLI A;  1F9N A;  1LNW A;  2DAO A;  2Z33 A;  4P5O A;  1GVJ A;  3JSO A;  1SAX A;  3WTT C;  5CYV A;  4GGG A;  1RUO A;  3M7G A;  1SFX A;  1BIA A;  4FT8 A;  3T8T A;  4HQM A;  1BI3 A;  3JTH A;  4UVC A;  3F22 A;  2Y48 A;  4IRH A;  4UHT A;  3IL2 A;  4KIG A;  5JHU A;  4AIK A;  1MGT A;  1B1B A;  3T8R A;  2VXZ A;  2RQP A;  5H6R A;  2XKP A;  3QRF F;  2E7W A;  4CDG A;  1J2X A;  5DV5 A;  2ADU A;  3ZN0 A;  1S7O A;  3GUD A;  3KZZ A;  4L5J A;  5D6E A;  1D5V A;  1C0W A;  4B09 A;  5EEG A;  2UXN A;  3F21 A;  5ERI A;  3FZV A;  3F8M A;  1FP2 A;  2PMU A;  5F1R A;  1DPR A;  4O5V A;  3GFI A;  1E17 A; 
#chains in the Genus database with same CATH topology
 4RAY A;  5GTH C;  4CYC B;  1BN5 A;  3G1O A;  2IS2 A;  2XGD A;  3BLY A;  5KVR A;  3H3Z A;  4BHC A;  3Q5F A;  3HC7 A;  4OAY A;  1ZEL A;  1U5T A;  1XGO A;  2KIF A;  4YFX F;  4AWX B;  5IP9 J;  3RCO A;  3KLN A;  3S3M A;  1T8I A;  5E3M A;  3W2A A;  1OYW A;  2HTJ A;  2VXD A;  3K2A A;  5EG0 A;  2FE3 A;  3V42 A;  3GCM A;  3SZT A;  1ACI A;  4KA4 A;  4MEY F;  2W84 A;  4HLY A;  2F4O B;  1OCT C;  4RS8 A;  2LY9 A;  2QBY A;  3EET A;  1SAU A;  1B6A A;  3H92 A;  2FEZ A;  4KT5 C;  5TJJ A;  3VSK A;  1ITY A;  2R7X A;  5J8F A;  3IAS 2;  1WGX A;  2H1L A;  1JGS A;  5DUK A;  1VQO I;  4CCN A;  1J75 A;  1ZG1 A;  3JSP A;  2YU3 A;  4UV8 A;  1PP7 U;  3PSI A;  4L9T A;  2VJJ A;  5E1X A;  5FFX A;  3L2C A;  2LNB A;  3VEP A;  3HTU A;  2EFN A;  1FPQ A;  1VI0 A;  1BL0 A;  2HEO A;  2XVC A;  3SZG A;  2LSO A;  4NHJ A;  2IS6 A;  3W2V A;  4G94 A;  5E1Z B;  1OR7 A;  4P1W A;  1DU0 A;  4DYR A;  1JHH A;  1QVU A;  3TOB A;  2EPF A;  3O3K A;  3K70 D;  2E1C A;  1ZR4 A;  2VPR A;  1D8K A;  4CCO A;  3EYI A;  4XMY A;  3ZMU A;  1TBX A;  1YW9 A;  3B73 A;  3GFL A;  4A12 A;  2H09 A;  4AVP A;  2X51 A;  5C4X J;  1ONV A;  3QPL A;  1NK2 P;  5F64 A;  2VPL A;  2A6T A;  4QSH A;  5M5W J;  4KDP A;  1EA3 A;  5HLT A;  2OZ6 A;  1Y0N A;  2A6H F;  2F4I A;  2VBW A;  3FHN A;  2V9K A;  1KZH A;  1R5G A;  3DCF A;  3LNQ A;  3V8K A;  2RNG A;  2CMP A;  3PIO F;  2P7C B;  1ZG5 A;  4C9Y A;  2IGO A;  2KL4 A;  1BM9 A;  5KK1 A;  2XV4 S;  2ZJ2 A;  2H8R A;  3SDG A;  1YIO A;  2XKO A;  5HDG A;  2XAH A;  1XG1 A;  1SD7 A;  3CCM I;  3IH3 A;  3CES A;  5E20 A;  5D8K B;  3I5U A;  1J9I A;  3WHB A;  3BQZ A;  2KIS A;  3SQN A;  1Z6R A;  3HRT A;  3I59 A;  5E8I A;  2W1O A;  3LA7 A;  3S1M J;  3BOQ A;  2VT3 A;  4IHY A;  1MBJ A;  2VQG A;  2M4G A;  1Z9C A;  3FIS A;  1U6G A;  2DA7 A;  3KP6 A;  2WV1 A;  4I6Z A;  2BEO A;  2ZFW A;  4ZJZ A;  1Q1H A;  2STT A;  4EJO A;  4S0H B;  1FMV A;  1R4M B;  3K1M A;  2NVQ J;  4FQG A;  4M6Y A;  3BP8 A;  3QU3 A;  3U21 A;  5ILS A;  2NRA C;  4GFB A;  3L09 A;  3BJ6 A;  5F27 A;  3KEO A;  4AM3 A;  2E5N A;  3FK6 A;  1PUF B;  1R22 A;  4CO8 A;  1KU9 A;  3CUQ A;  3UNG C;  4IQ4 A;  3K4M A;  2QSF X;  1BW6 A;  4RB0 A;  1JUM A;  3HOZ J;  1LKX A;  2WC2 A;  5DD8 A;  3HOW J;  1TT5 B;  3HKZ A;  3QP5 A;  2TCT A;  4PFO A;  2DFE A;  2X6O A;  1ORK A;  4BJ6 C;  2E2H J;  1FTZ A;  3H5R A;  2HKX A;  3QYB A;  5JFR A;  1AWC A;  2JA5 J;  1MBH A;  1K61 A;  1JGG A;  1ZYR F;  4RB1 A;  3DF8 A;  1HQC A;  2LP0 A;  1OYI A;  3TOA A;  3MZH A;  2VOD A;  1OFC X;  4ZYA A;  3F72 A;  2ZXW H;  4GCV A;  4KIS A;  5LRS A;  1YI2 I;  4B44 A;  4XK4 A;  1K6O A;  1XMA A;  4B48 A;  2DQR A;  3M8F A;  3KYL A;  3VYR B;  3R0J A;  2XAG A;  1VQ8 I;  2VIX A;  2W00 A;  2DA5 A;  3EDP A;  3D5S C;  5FKL A;  1SFO J;  3R60 A;  5BNG A;  3F0C A;  3L1P A;  3ZOB A;  3K4L A;  1IC8 A;  3FXL A;  2CJJ A;  4C3I J;  3JTG A;  3A01 B;  3VYU B;  3K70 C;  2E60 A;  3Q0V A;  2RDP A;  2CO5 A;  5HLH A;  1R4N B;  4DZP A;  1S8N A;  4M9Z A;  2EJR A;  1W0U A;  2ZME C;  1H89 C;  2L7Z A;  1IG7 A;  1JT6 A;  3QOP A;  5JLX A;  3C3W A;  4BY7 J;  2X0L A;  3ZMD A;  5IT9 K;  3F9K A;  2IA1 A;  4NC6 A;  4L0Y B;  3FXR A;  3MVP A;  3H9Q A;  1O3T A;  2KHM A;  1JJ8 C;  2PX9 A;  2O6G E;  5DUI A;  1YYV A;  3OSG A;  4GDF A;  3PQK A;  3OR1 C;  3DTE A;  3I3L A;  3OYG A;  1DDN A;  1DP7 P;  3LL7 A;  4CUG A;  1PVE A;  1XDS A;  5GAH J;  1ERD A;  3IH2 A;  1U9O A;  3CMM A;  4ON0 A;  4HDV A;  2KT0 A;  2FML A;  1IN8 A;  3HB9 A;  3S1Q J;  2MBF A;  2E1M C;  4U0W A;  4HLX A;  4XID A;  4MGR A;  4LG3 A;  3GXO A;  3HG9 A;  3HOV J;  2VQC A;  2HNH A;  4PSX A;  3FXJ A;  2JK3 A;  5IPA A;  4I98 B;  5FO5 A;  4Y3O A;  3AAF A;  1F1Z A;  2PG4 A;  2DPU A;  5IOY A;  1P9Q C;  2NVU B;  1I27 A;  4ZYG A;  2ZBK A;  4E7J A;  1FOX A;  1Z05 A;  5D6F A;  5ICE A;  1IF1 A;  1XGN A;  3DFG A;  1FBU A;  2NVX J;  3N05 A;  2LD5 A;  4BHP A;  1SVL A;  4Q48 A;  2ZXH A;  3WHC A;  1OPC A;  2OV7 A;  1OLT A;  1NG7 A;  5JI6 A;  2IPQ X;  5C3E J;  3FKI J;  2ACJ A;  4MFD A;  3C2G A;  2ZNZ A;  2W85 A;  4A3I J;  2PLY A;  2K4B A;  1AKH B;  1HXD A;  4BDY A;  2FNA A;  3BCA A;  2ZME B;  3LST A;  4A6D A;  2XB5 A;  1HCR A;  2DJI A;  1X3Z B;  3BG5 A;  2RN7 A;  4N9I A;  4Z2Y A;  1QQI A;  2HZT A;  1ZRC A;  2BY1 A;  4D0P A;  4XIC A;  3M1E A;  4OAZ A;  4A3G J;  4E7L A;  3GF2 A;  2JQ7 A;  2WAQ N;  4BXU A;  5CJ9 A;  4HNU A;  2NVY J;  4BQQ A;  3RKW A;  3IKV A;  2EQR A;  1OIS A;  4LK1 F;  1HLV A;  3QP6 A;  4LLN A;  5JLW A;  2D1V A;  1PDN C;  3LSR A;  5FFZ A;  3RYR A;  5FLM J;  4ZTJ A;  1F4K A;  2IJL A;  4A3M J;  3L2R A;  3WTX C;  4B47 A;  4C30 A;  2VOO A;  1E0E A;  1OMI A;  4LIT A;  1QVT A;  4IF4 A;  5KCM A;  2R7F A;  3HOY J;  3Q9S A;  5ED4 A;  2LK2 A;  2XGC A;  5HS7 A;  5FD6 A;  1ZGJ A;  3J7Y J;  2XRO A;  2HQN A;  3GTJ J;  5IP7 J;  3PSF A;  4CYC A;  4ZZL A;  1T0F C;  4I0A A;  1TNS A;  2EZI A;  2VT2 A;  4LB5 A;  1LEB A;  3JRE A;  3TO9 A;  1ETV A;  1RKT A;  2Q2E B;  3V7R A;  3ERE D;  3JRH A;  4GXO A;  5KAF C;  2HR3 A;  3FMS A;  2VOP A;  1IN5 A;  2CGP A;  3L00 A;  3L9F A;  4OIO F;  2LKS A;  3G71 I;  1EH7 A;  5TIS C;  3IC7 A;  3ZQC A;  1LUJ B;  4RGX A;  1EKE A;  1DQU A;  3W6J B;  2BY0 A;  1XCV A;  1QRY A;  1FSE A;  2A5Y B;  5M5Y J;  1LE8 B;  2R7V A;  1LJ9 A;  3OYH A;  1YG2 A;  2BVL A;  5F0C A;  1ZR2 A;  3VOD A;  4F91 B;  1RIO H;  3S2D J;  1LQ1 A;  2CQX A;  1STZ A;  5K5R A;  2V6C A;  1SMT A;  4P9F A;  2ZSI B;  5BPI A;  4OWR B;  2VKE A;  1IW7 F;  2OPT A;  4ESJ A;  3AL0 B;  1A31 A;  3DWL E;  2Z1D A;  2KZG A;  1SFE A;  3FDY A;  2BYV E;  2WY7 Q;  3CCV I;  4A3E J;  1CQT A;  2FD5 A;  2Y0S A;  1U0J A;  1LFU P;  3G1M A;  4LIV A;  4M3G A;  2X9D A;  2DA3 A;  2HU9 A;  4GRI A;  4HZF A;  4BXF A;  4RB2 C;  3RPU A;  5A2Q Z;  2ME0 A;  1AHD P;  2Q1Z B;  4PCQ A;  4CGZ A;  1KQ9 A;  1X1C A;  3S1N J;  2FSW A;  4YEL A;  3BG6 A;  4IRI A;  3K1N A;  4CYD A;  2RKH A;  1VQ7 I;  1WI3 A;  3TW7 A;  5AON A;  3RPQ A;  3KP2 A;  2XAS A;  1ZGA A;  2L01 A;  1JE8 A;  3IRR A;  2D1H A;  2XHK A;  3Q3S A;  1MSF C;  2P5K A;  2QUF A;  2QF7 A;  5E3L A;  4OIP F;  2CW8 A;  1QGP A;  2YU9 J;  3JRB A;  2AQE A;  3A02 A;  1FNN A;  2W82 A;  4NUB A;  4D5C A;  1WSU A;  3R6S A;  4LOC A;  3E7L A;  4QLC U;  5ICG A;  1A6I A;  3H35 A;  4DNC A;  3C2H A;  5J1R A;  3MFK A;  2NS7 A;  3V8J A;  4XM3 A;  4IXA A;  1OKR A;  3WE3 A;  1GV2 A;  2BY2 A;  2EBI A;  1EH6 A;  4XLA A;  4M9S A;  3FKJ A;  3LWF A;  3SXY A;  4LG0 B;  2FMY A;  3F8F A;  4QPO A;  3C2B A;  5LBQ A;  3OOU A;  2WTE A;  2LF8 A;  3BTI A;  1MND A;  2L54 A;  1WHU A;  1MSE C;  4UUS B;  5GP9 A;  3ZQF A;  4G6D A;  3AG4 H;  3WU2 C;  4D5F A;  2DA1 A;  3DBH B;  2F6C A;  2R3S A;  3ZN1 A;  3HOU J;  2AHQ A;  3ZXS A;  2DFF A;  3I71 A;  4XNF A;  2CQK A;  2RNJ A;  4BQO A;  1VQ4 I;  2R7O A;  2JSP A;  5M3M J;  2DK5 A;  1S9H A;  2GOM A;  4BE0 A;  1TWA J;  2Z2S B;  5J4V A;  2GXB A;  3CO6 C;  4EV0 A;  2M5W A;  2F5F A;  1PUF A;  2QSH X;  1B4A A;  5E1W A;  1FX7 A;  2LF7 A;  4OMY A;  3GME A;  2DW4 A;  4Y15 A;  2FX0 A;  3S14 J;  2OU2 A;  4DYQ A;  2DTZ A;  1ETO A;  3RI4 A;  1OJL A;  4IOC F;  3KEQ A;  3FHZ A;  2DT6 A;  2QYO A;  3CD6 I;  2ISZ A;  1WKM A;  5J8C A;  1PYV A;  1X4O A;  2IEK A;  4CCK A;  2A6E F;  4A0X A;  1XSD A;  3P9I A;  3FMQ A;  5E3O A;  2PMZ N;  3JRA A;  5B1B H;  1F43 A;  1H88 C;  3CLQ A;  1BOA A;  1V5G A;  4EGZ A;  2H8W A;  4IEJ A;  3V7S A;  5B3S H;  1SD5 A;  4F52 A;  4HSR A;  3F6V A;  1QA6 A;  4IHW A;  2X6Y A;  1JTY A;  5KNL A;  2R7D A;  4IL6 C;  1LFP A;  2MYS A;  4G7H F;  4UVB A;  1IRF A;  3Q0W A;  1LDD A;  4OIQ F;  3FM5 A;  1BOB A;  5HNF A;  2BXY A;  1H9G A;  3BG7 A;  2CU7 A;  1W7P D;  4HAM A;  5DDG A;  3A01 A;  1G4D A;  3OL3 A;  4LLG F;  5EDN A;  1Z77 A;  3ONQ A;  2XRN A;  1D1A A;  2J5O A;  1XGS A;  3S2W A;  2K86 A;  3SHF A;  4EAT A;  3CDL A;  1YHQ I;  2AQF A;  2Y9Z A;  1KON A;  4ENK A;  5D5U B;  2OCC H;  3E6B A;  2K9M A;  5LEK A;  2HWV A;  1Z3Y A;  4L9J A;  5HDN A;  4U7D A;  2JA7 J;  2X4H A;  1CF7 B;  2KDO A;  3H3V K;  2OC6 A;  3WU1 B;  1ZAR A;  2CQQ A;  1LDJ A;  5HNH A;  4MNU A;  2O5R A;  3RYP A;  4PJM A;  5HOO A;  2MC3 A;  3FK7 A;  3JR9 A;  4DOZ A;  2G9W A;  1DP3 A;  3F23 A;  2A61 A;  1MNM C;  4BDZ A;  4AID A;  1IRG A;  2QM3 A;  1XS9 A;  2IXS A;  4BE2 A;  2P8T A;  4I02 A;  3TGN A;  3OYM A;  3GTK J;  2KDZ A;  1X4P A;  4XSX F;  4DYC A;  5BS6 A;  3GFJ A;  1Y6I A;  1D1B A;  2FNP A;  3LOC A;  2L2O A;  4XLN F;  4A0Z A;  4C3H J;  4S05 A;  2JPB A;  1I39 A;  1B59 A;  2ELJ A;  1SD6 A;  4RLQ A;  3L2Q A;  2E34 A;  2EA4 A;  2TRT A;  4H4K C;  5JVT A;  1Z7U A;  2IGN A;  3KLO A;  3SFZ A;  4ZYH A;  2JUG A;  2DOA A;  3RZO J;  3ZQQ A;  3DEW A;  3P7N A;  3EQL F;  3DXJ F;  3J7Z I;  3CCS I;  1D1C A;  2HXO A;  3B02 A;  4WF2 A;  2ZJQ F;  2KJB A;  2LG4 A;  4GYG A;  2EIN H;  1EJ9 A;  2H94 A;  3COA C;  2HQR A;  1UCR A;  2XAJ A;  4M3F A;  4MTE A;  4Y13 A;  3LMM A;  2DCE A;  5LRR A;  2RQQ A;  3DTI A;  4RBO A;  1J5Y A;  2V7F A;  5DYM A;  4HX8 A;  2GWR A;  2MLK A;  1IV8 A;  1AKH A;  2VJI A;  2Y30 A;  2ZME A;  5CLS A;  1ZH5 A;  2V4J C;  5E3N A;  2FOW A;  2XF6 A;  1Y8Q B;  2W25 A;  2VN2 A;  4DQ2 A;  3J81 K;  4Z6Y A;  1TNT A;  3TP0 A;  2XB0 X;  1NG6 A;  2XPW A;  4CA0 A;  1KU2 A;  1ZLJ A;  2ELK A;  3BRO A;  4GO1 A;  2DTR A;  4LD5 A;  4R8H A;  1H9T A;  2CSO A;  4AUX A;  3BPV A;  1YOV B;  4ENM A;  3I53 A;  1BIB A;  3HSE A;  2OUM A;  3NEU A;  1W5C C;  4EJT A;  2VON A;  1DGW Y;  1A6Q A;  2UZK A;  3G73 A;  3DU6 A;  2QVO A;  3RIR A;  2BW3 B;  3AG1 H;  5LEJ A;  3DPU A;  4F3Q A;  4CCL A;  1FT9 A;  1XSV A;  3VYS B;  1ZRD A;  4L5I A;  3GTM J;  2HOA A;  4XN0 A;  4DW6 A;  1VF9 A;  4BJ5 C;  4XQF A;  2O61 A;  2COM A;  2QA4 I;  2QZ8 A;  1V54 H;  1ZK8 A;  2ZB9 A;  1H8A C;  3P9K A;  1DPU A;  1KQ8 A;  4U87 A;  2WB1 A;  1W0T A;  2Q2E A;  1R23 A;  1D0X A;  1FWZ A;  2L9V A;  3MAJ A;  2Z16 A;  1Z91 A;  4E6K G;  2JMW A;  2K9S A;  2LY1 A;  3RQ4 A;  4WX9 A;  5M3F J;  4P96 A;  3JRD A;  2HOT A;  4B43 A;  3QPH A;  4A0Y A;  2E7X A;  4FET A;  4FAS D;  3HKZ N;  4HQE A;  3CP2 A;  4BAC A;  2M8E A;  1R36 A;  2MC4 A;  3TDU C;  4GYI A;  1Z21 A;  1BC7 C;  2QQA A;  4BNC A;  2XAU A;  1ULY A;  3BJO A;  1LE8 A;  2EFO A;  2H6C A;  5FB2 A;  2PJP A;  3MWM A;  4RGU A;  4EGY A;  1UST A;  5CVR A;  5B5E C;  3UR3 C;  5GTI C;  2LFB A;  3KET A;  1I1G A;  4UV9 A;  4ZDP A;  3PL8 A;  3OYB A;  1YS6 A;  4IHS A;  1Z6T A;  3PNY A;  2CFX A;  3JRC A;  1OCZ H;  3CP8 A;  2GOX B;  1J59 A;  2JVG A;  2ZSH B;  2P5V A;  4B1R A;  5LGT A;  1FY7 A;  3GZ5 A;  4XKC A;  4PFP A;  5H20 A;  2DMN A;  5DCM B;  3CJN A;  1JKO C;  5IT9 Z;  1FP1 D;  1X1P A;  2ETH A;  1N77 A;  3ULQ B;  1HW1 A;  1MD0 A;  3QWL A;  2K3F A;  3ECO A;  2R7Z J;  2R7W A;  3PNV A;  2MW8 A;  2VQL A;  4ZTF A;  4Y17 A;  2V1N A;  2BHZ A;  2VC1 A;  2BXZ A;  2HYG D;  4OU0 A;  1N25 A;  2L7M P;  3BG3 A;  3M9A A;  4XLE A;  1BI0 A;  1FIA A;  3MKZ A;  4ETS A;  3M8J A;  1T0F A;  3KZI C;  4RB3 C;  4BQA A;  2VI6 A;  2M4K A;  3LFK A;  2TDX A;  1R71 A;  3FX3 A;  2HDW A;  1FOK A;  5J3L A;  3PNT A;  3LA3 A;  4Y4R A;  4LGW A;  5ILV A;  2VAS A;  5AIP A;  2RVC A;  4R1H A;  3BTL A;  2FBI A;  2KRH A;  5BMZ A;  1YW8 A;  2XRL A;  2H27 A;  4LG0 A;  3MCZ A;  2CYY A;  3KP4 A;  1T6S A;  4FX4 A;  1YRN B;  3U1K A;  2Y9Y A;  4AD9 A;  1K6Y A;  2QQ9 A;  4UUS A;  3W3C A;  3SFI A;  3P9C A;  1MJA A;  5HOD A;  4WCG A;  3S32 A;  1UHW A;  2E5Z A;  2HXI A;  2IS1 A;  5EZH A;  2X6X A;  1U3E M;  1RUN A;  4OMZ A;  1B72 B;  2PEX A;  3E5Q A;  2R0Q C;  4MFE A;  1BBY A;  2GLO A;  3Q9V A;  4CIC A;  1A04 A;  3H1C A;  4A3C J;  4HF1 A;  3S3N A;  1OCP A;  2G7U A;  3K4J A;  4HNV A;  4LLL A;  3CUO A;  1ETW A;  3E3V A;  3AKZ A;  1BI1 A;  1FOY A;  3QPS A;  3LSH A;  1IAW A;  2EH3 A;  3IV5 A;  2RC4 A;  3D5L A;  3MKL A;  1O3Q A;  2CQN A;  1YJ9 I;  5F04 A;  2NOJ B;  3LAP A;  1BR1 A;  1AOY A;  3BTJ A;  3J7A Y;  4PJL A;  2KKO A;  2VLA A;  3E97 A;  2WY8 Q;  4CHU A;  1WJF A;  2M7A A;  2HKO A;  1KYW A;  4HYE A;  4ZH4 F;  2P5L C;  2LRE A;  2BVM A;  3C1D A;  2HDC A;  4F93 B;  2HQ5 A;  3FXU A;  5HVQ C;  1UHS A;  3I58 A;  2OD5 A;  4XR6 A;  3Q0U A;  1K4S A;  5KHD A;  3WTW C;  3TQN A;  2HOS A;  4KN7 X;  5LGN A;  1UHM A;  5EYR A;  2DDB A;  2JA6 J;  4MEX F;  5ICF A;  3ZCO A;  3G4S I;  1J09 A;  5J40 A;  3LA2 A;  2L0K A;  4I76 A;  3D5R C;  5BOX A;  3FBI B;  3E1S A;  3B6A A;  5IY5 H;  1LVA A;  4JQF A;  5K5Q A;  2HDD A;  3BR2 A;  2GIV A;  3QU6 A;  4MHG A;  2KLO A;  2VBY A;  4ESF A;  3D1N I;  1X1D A;  3FMR A;  3K2Z A;  2O0Y A;  1MW7 A;  3KPH A;  1K4T A;  4PGH A;  2JZY A;  3HHG A;  5E79 C;  4EM0 B;  3ABT A;  4WXC A;  3DLL F;  4Y52 J;  3S8P A;  1XDU A;  1YW7 A;  1I3Q J;  2ZNY A;  1BI2 A;  4XLF A;  1TW2 A;  1RES A;  2EIK H;  1WFX A;  2LBF B;  2JA8 J;  3FXQ A;  5J1Y A;  1CF7 A;  5FRO A;  1O7F A;  1HKS A;  5D4S A;  2IW5 A;  3IWF A;  1MDM B;  2YUS A;  2R7U A;  5FLX K;  5E8G A;  3DP7 A;  1OCO H;  4ZC3 A;  3KE2 A;  5CVU A;  4CXF A;  5DS9 A;  5FRN A;  1IN4 A;  5FD5 A;  1R49 A;  4A3J J;  4KFC A;  4L18 B;  3ABL H;  3DLA A;  1XC5 A;  4DZJ A;  3M3Y J;  1W5S A;  3VB2 A;  1VFC A;  2M45 A;  4XN3 A;  4KN4 X;  1ZGW A;  3KEY A;  4L0Z B;  2FRH A;  2VC0 A;  3LAJ A;  2HTS A;  2LTP A;  4DBR A;  3SEQ A;  4XSZ F;  3PJR A;  1JT0 A;  2CWE A;  4XBF A;  1YIJ I;  4JX5 A;  1T38 A;  2PI0 A;  2NNY A;  3HBL A;  4XLC A;  3VSL A;  1WH7 A;  3DBR B;  4BBR J;  2XIG A;  2HGC A;  5CQG A;  5L3C A;  3ZMT A;  3ABM H;  4CCJ A;  2RRE A;  2EFP A;  2JJ7 A;  3EYY A;  1Y0U A;  4M72 A;  5C44 J;  1BJZ A;  2JRT A;  3IWZ A;  3CCE I;  4E7H A;  4XOT A;  3BY6 A;  4XOP A;  1GXP A;  2KZV A;  2YX4 A;  1IN7 A;  5DTD A;  4C3J J;  1IO2 A;  2H6B A;  5HS9 A;  3QPT A;  3VYT B;  2RAE A;  1WRJ A;  2W57 A;  4AYB N;  3BR1 A;  3ASN H;  3ZQ7 A;  2J5P A;  2V79 A;  5ICC A;  2QCO A;  1G8X A;  1V3F A;  2ELH A;  1IJW C;  2VBZ A;  1P7J A;  2OJE D;  3CQZ J;  4PJN A;  1JI8 A;  3CJQ B;  3J80 K;  1B8I B;  2VBX A;  3L2W A;  2M30 A;  4BS9 A;  1JJ6 C;  1KYZ A;  4E7Z A;  3QYE A;  4II2 A;  2X85 A;  4UB6 C;  2MLG A;  2E1M B;  4G6T B;  4KNY A;  2PQ8 A;  3K4N A;  4FIS A;  2MSY A;  2V26 A;  3HOT A;  5LFA A;  4G12 A;  5E18 F;  2H1K A;  3GO5 A;  1JUP A;  2LDU A;  2OQR A;  3S17 J;  4HRI A;  3MZ8 A;  2FF4 A;  2E1O A;  2LKP A;  1DUX C;  4D7N A;  1G3T A;  2LYC A;  2BW3 A;  1QNT A;  5H2F C;  3J7A O;  1EF4 A;  2D5V A;  1XD7 A;  1Z0X A;  3FF5 A;  4MO7 A;  4MQV A;  3T0Y A;  2F5C A;  3GX4 X;  4M3B A;  3K9T A;  3NAU A;  1RC9 A;  3GEZ A;  4D1Q A;  4PJ0 C;  1SMY F;  4JP0 A;  1G2H A;  3WTS C;  2FA5 A;  2V6E A;  2Z99 A;  4EQQ A;  3ZPL A;  4LK0 F;  3K7A J;  2ZJR F;  3OS0 A;  4U7B A;  1D8J A;  2QWW A;  1B9N A;  2YSR A;  3ROU A;  3GLX A;  4TV7 A;  3SYT A;  5FJ8 J;  1FTT A;  1R1V A;  1BJA A;  2ESN A;  4UY8 I;  1N78 A;  3ZR8 X;  2E35 A;  1X3W B;  1MJ9 A;  4JBA A;  2F5V A;  4A2U A;  1Z7L A;  4KYW A;  3BR3 A;  3TED A;  2MG4 A;  3G3Z A;  1E2X A;  3MMY B;  4M6X A;  1P4W A;  2Y31 A;  4J00 A;  2L5Q A;  4BGD A;  3CMA I;  4HST A;  2CW0 F;  2VL8 A;  2F5D A;  2KMU A;  4XRS G;  3FM3 A;  3A03 A;  1VQP I;  2JSC A;  3IH4 A;  3X2Q H;  1ZG3 A;  4KMU X;  1AU7 A;  1XN7 A;  4KIT B;  1TC3 C;  2MH9 A;  2R92 J;  2HI3 A;  2K40 A;  4HF0 A;  3OV8 A;  3TO7 A;  3E5X A;  2NS8 A;  3CUQ C;  4M3D A;  1GT0 C;  4AIJ A;  3HZJ A;  2M9H A;  2OCE A;  2KJC A;  4KIF A;  1HOM A;  4MQ9 F;  5DCM A;  2I10 A;  5FKN A;  2CUE A;  2EZK A;  3NQO A;  4Y33 A;  4PK4 A;  3M4O J;  1JKQ C;  2BV6 A;  3KYD B;  4YFN F;  4N4N B;  2G0E A;  3F8C A;  1TWH J;  3E5U A;  2MD5 A;  3G2B A;  3KFW X;  4XON A;  3QOD A;  4YEJ A;  3PM1 A;  3WTU C;  4C2T A;  3GTG J;  1T39 A;  2JT1 A;  3CO7 C;  2K4J A;  2LY2 A;  4RM3 A;  1YS7 A;  4AVZ A;  2KPM A;  5EEH A;  2EFW A;  4ABZ A;  3AFH A;  4BE1 A;  2R93 J;  4IOA F;  1ZKG A;  2IA2 A;  4A6E A;  4BHB A;  1ZQ3 P;  4IHT A;  3JRG A;  3S93 A;  2WAQ A;  5D4R A;  3OYI A;  5EEA A;  1VTN C;  1S3J A;  1KU7 A;  2DPD A;  3LQQ A;  5BQT A;  2EK5 A;  5IT3 A;  1Y1V J;  2CW7 A;  2V1D A;  4K2E A;  3K4K A;  5DEQ A;  3RSN A;  3TKY A;  2W7N A;  2JWT A;  4ANJ A;  1YRN A;  3JAM K;  3BTC A;  1B9M A;  4BUP A;  4A69 C;  4FX0 A;  1HA8 A;  1FOW A;  2DO7 A;  1FSH A;  2CG4 A;  3OIO A;  4YIF A;  2ZJP F;  3DBL B;  2P6T A;  2B7E A;  3OYA A;  4HPQ A;  2OZU A;  1B72 A;  4J19 A;  1K78 B;  1O57 A;  2F4M B;  1L3L A;  1YE9 A;  1HSJ A;  2Z9O A;  2XC7 A;  1HST A;  1VZ0 A;  1EV7 A;  4A3L J;  2DT5 A;  4XLH A;  1MMA A;  4D9J A;  2IP2 A;  3MKY B;  3E0J B;  1FZP B;  1ETX A;  2MA3 A;  1A35 A;  3RKX A;  4Q5S F;  3BT9 A;  3BQY A;  2WBM A;  2AO9 A;  5EGO B;  1Y39 A;  2XF7 A;  1QHG A;  5F0H A;  2KFD A;  4X0G A;  2ECC A;  1X3U A;  3J81 Z;  3REO A;  2K9N A;  2R7Q A;  4L5E A;  3A0B C;  2Q8K A;  2R5Z B;  1UFM A;  2KIU A;  3H0G J;  1T08 B;  4HG2 A;  3I54 A;  2B9S A;  4IJA A;  3SDB A;  2ZXJ A;  2DXI A;  3PO2 J;  2ZCW A;  2ID3 A;  1FIP A;  1S7E A;  2HVR A;  5JR3 A;  1F36 A;  4RAG A;  1R5I D;  2XGE A;  2ICW G;  2JN6 A;  2DOF A;  2L9R A;  4O6J A;  2XAQ A;  4NBQ A;  4V19 K;  1TQM A;  4BYY A;  4UUT A;  3W6V A;  3EUH C;  2VUM J;  2FU4 A;  5CVJ A;  2EIL H;  1J0R A;  2PMH A;  2JTV A;  2BE5 F;  4WWC A;  3B6C A;  4N4O B;  1PP8 F;  1W4M A;  1ZTR A;  3FXO A;  3HUG B;  1D0Z A;  4FHT A;  2P7V B;  4HX4 A;  4KJZ A;  2UXX A;  5GPA A;  3DQV C;  3ZQL A;  3SZP A;  1YO5 C;  3ECH A;  5LHH A;  3E6C C;  2EB7 A;  3DPL C;  3LSK A;  4IPA A;  3LQR A;  1VQ6 I;  3OYF A;  3CDI A;  3HL2 A;  1JHF A;  2HFH A;  4HV5 A;  4YG2 F;  4I7H A;  4NQW B;  1TLH B;  3HXL A;  2EV0 A;  2EZH A;  4QTR A;  2BHY A;  2CS3 A;  3IRQ A;  1JXS A;  1GUU A;  3WTY C;  1MH4 A;  3GTP J;  2DYS H;  3K0L A;  3KP3 A;  3OR2 C;  2LLK A;  3K1P A;  3KIO A;  5IP6 A;  1G6N A;  4U88 A;  2B0L A;  4IX7 A;  2LBF A;  1P4A A;  4BH9 A;  2N8G A;  3FBN B;  1NK3 P;  1MDM A;  4BQN A;  1I5Z A;  4XL9 A;  2WA0 A;  2EV5 A;  1MMG A;  2M87 A;  4M3E A;  3HGY A;  1FJL A;  4I01 A;  2L02 A;  4BEH B;  1TP4 A;  2F48 A;  2XPU A;  1IDY A;  4HA8 A;  2GA1 A;  4PUS A;  3OS1 A;  2M0C A;  4ENN A;  3IUO A;  3JW4 A;  2EWN A;  4FTH A;  2DU9 A;  2CFO A;  2L4A A;  3ZGK A;  2HOE A;  2BZT A;  2NOG A;  3HPG A;  1YIT I;  2X48 A;  5AIQ A;  3O2P E;  5FKO A;  3VWB A;  1J7K A;  1R9T J;  4AIH A;  2O03 A;  1OQY A;  1QHH D;  2A69 F;  2CUZ A;  2L3D A;  4ZYE A;  3W2W A;  1YLF A;  4DIQ A;  2V1X A;  3ELK A;  3S1R J;  1R1U A;  1MMD A;  5LLQ A;  2O3F A;  3CME I;  2R4G A;  4B3A A;  1RR8 C;  4E7K A;  5ILU A;  5EF6 A;  3OYK A;  1UAA A;  4CSW A;  2W48 A;  3ASO H;  4A5N A;  1XTA A;  2DFI A;  2DMU A;  3T5X A;  4LFU A;  1OYY A;  4ASN A;  2ZFU A;  4LJZ F;  3PO3 J;  4EMS A;  2B63 J;  4WXD A;  1SD4 A;  1ODD A;  1XMK A;  3H5N A;  3K69 A;  1HBX G;  3W6K B;  5D5W B;  3CC7 I;  2EIJ H;  3KP7 A;  4G9Y A;  3NAR A;  3HDD A;  3ML6 A;  2MGQ A;  2Y0M A;  3OS2 A;  2HZD A;  1G59 A;  4I2O A;  2IS4 A;  2ESH A;  5LHI A;  1ZLK A;  4E7I A;  1B8I A;  1UZC A;  2PMZ A;  4LIU A;  3ISP A;  3KX2 A;  5EZG A;  1KA8 A;  2NVT J;  1RPW A;  2CH0 A;  4HOB A;  2MAB A;  3OIQ A;  1SEU A;  1XPX A;  2IGK A;  3VFZ A;  2K7L A;  1TL8 A;  4IHV A;  3TP3 A;  4BKX A;  5TRD A;  4II3 A;  5HDK A;  5JVG F;  5IYB J;  1MBE A;  5IOZ A;  2BGC A;  3U9G A;  3GZ6 A;  4OIN F;  4G8X A;  2M1B A;  2KP6 A;  5HLG A;  1O4X A;  3O6B B;  4IQJ A;  1SAN A;  2E36 A;  3ZMV A;  2QLZ A;  1Y1W J;  3MKW B;  3N97 A;  5J1U A;  5D8L B;  1ZRE A;  3CC4 I;  1RNL A;  1RR7 A;  3RKQ A;  2QSG X;  1K83 J;  5FKK A;  2CV0 A;  2KRC A;  4BBS J;  4V2G A;  3UKG A;  3IAM 2;  4RM2 A;  1A5J A;  3OYJ A;  4F7Z A;  4B8X A;  1MMN A;  3PQJ A;  4HBL A;  4M71 A;  2A68 F;  4XOR A;  2ZO4 A;  2LKX A;  1Y8R B;  2NNN A;  1HDP A;  2HYJ A;  1TQP A;  2EV6 A;  3MN2 A;  4C2U A;  1VQL I;  4RMN A;  1LPQ A;  2Z5U A;  3WOD F;  4XRS A;  1TTY A;  3L7W A;  2CQ7 A;  4MIM A;  2QKL B;  1VQK I;  2STW A;  2Y75 A;  4HNT A;  3T1B A;  4NB5 A;  1WI9 A;  5J6X A;  3IHU A;  3OY9 A;  2L7K A;  4ITV A;  4O3M A;  1QPM A;  1UG2 A;  3SEZ A;  1GVD A;  2FUG 2;  2DN0 A;  4F55 A;  1IGN A;  1X2N A;  2EFQ A;  2WWY A;  3TBI A;  2RV8 A;  3MD2 A;  3ZMZ A;  2R5Y B;  1LDK B;  4W1U A;  1DU6 A;  2Y2Z A;  1SFK A;  2VJ4 A;  3V7C A;  3C7J A;  2ME6 A;  1GXQ A;  3WG9 A;  5LGU A;  5CVV A;  3H36 A;  3OWT A;  1W7P B;  5L3B A;  2COB A;  2MD0 A;  1V4R A;  2WV0 A;  3TDZ C;  2O8K A;  2FQ4 A;  1VQ9 I;  2W4S A;  2XGX A;  3G1L A;  1FLI A;  2NYX A;  4S04 A;  2WAD A;  1ON2 A;  2ZC2 A;  1VND A;  2DA6 A;  2ISY A;  4HF2 A;  1HF0 A;  5FLX Z;  4ZYD A;  1IDZ A;  2JPC A;  2I5U A;  4YRV A;  4I0B A;  1U2W A;  1L0O C;  1W36 D;  2XSJ C;  5L3G A;  4YII A;  2HYF A;  4W97 A;  2PJR B;  3DPT A;  2NS0 A;  2E2I J;  3FXM A;  1IUF A;  5H6Q A;  5K7Z A;  2V1U A;  2UV1 A;  1RET A;  1ZN2 A;  2YPR A;  1GLN A;  1Z67 A;  3K6G A;  3TMO A;  3PUF A;  2GAU A;  4M9X A;  2YR2 A;  4A3B J;  1IV6 A;  3S3O A;  2RGV A;  2DFH A;  4YIR X;  2MH2 A;  1TWF J;  3C18 A;  4LB6 B;  3ZRG A;  2X1E A;  3CCQ I;  3LSM A;  1I6H J;  4EVI A;  1SC7 A;  3DV8 A;  2DA4 A;  3E6D A;  2ECB A;  4XRM A;  4D7M A;  1O3R A;  3ESW B;  3QAH A;  2GM4 A;  4M74 A;  4BXX J;  1YTY A;  1NTC A;  1R00 A;  1LVK A;  1PUE E;  1IXS B;  1A36 A;  3I9V 2;  1FBS A;  1SVO A;  2IVM A;  2VKV A;  2VB6 A;  1W5T A;  3BZC A;  1P92 A;  1XGM A;  2K9L A;  2A05 A;  2OQG A;  1D5Y A;  2DMQ A;  3HRM A;  1VQN I;  4PDK A;  3HRU A;  4FCY A;  1IUY A;  2EA2 A;  1MJB A;  1EH8 A;  1K78 A;  1FMW A;  3F3X A;  4IKF A;  2PN6 A;  3L2V A;  1MIJ A;  5CQE A;  2JA2 A;  1ETY A;  4P9U A;  4XLP F;  3O8H A;  1BW5 A;  1V55 H;  1T33 A;  3MZY A;  3ABK H;  3CCY A;  1MBG A;  3HHH A;  1D3Y A;  3D0S A;  1U8R A;  3O8G A;  4QPQ A;  2IRF G;  1KGS A;  3QYF A;  5K7F A;  5EGO A;  3OYN A;  4QWQ A;  4UNO A;  3A2K A;  3I4N J;  1QU3 A;  3BR0 A;  1FBQ A;  1R1T A;  3J80 Z;  2IGM A;  2Y69 H;  3WTZ A;  1XMX A;  5F0F A;  4L9V A;  2R5Z A;  3GTO J;  4NC7 A;  3HTS B;  2I8D A;  1FYL A;  2WAF A;  2XUB A;  1X58 A;  3ZP5 A;  2FBH A;  2FBK A;  3ZQH A;  5K1Y A;  2BBY A;  5J47 A;  1GHC A;  4L9N A;  3A0H C;  4U0Y A;  3WE2 A;  2YX7 A;  2DQL A;  3PFI A;  1M1E B;  4HEA 2;  4IHX A;  4NDL A;  3RJP A;  4EM2 A;  5HS8 A;  2GXA A;  2Z3Y A;  1W1W E;  1IRX A;  1Q1V A;  1R5H A;  3FWE A;  4KMF A;  1WJA A;  1QZE A;  2KQR A;  2FOK A;  3LSG A;  2JUC A;  9ANT A;  3HSR A;  1DGR M;  1PJR A;  3R61 A;  1U8B A;  3HPH A;  1WJD A;  3HUG A;  3CCR I;  1G3S A;  4HW0 A;  4UVA A;  4XKB A;  1X2M A;  3QQA A;  3OYD A;  4UUV A;  3OSF A;  2A07 F;  1ZRF A;  1S29 A;  2K9Q A;  1MZB A;  2DT7 B;  3NWT A;  1V5E A;  4KIB A;  2XF5 A;  3A1Y A;  3OOP A;  4HV6 A;  3L2U A;  3GFM A;  4NQW A;  1F5T A;  5GAE J;  1XB4 A;  2P4W A;  4XRF A;  1FC3 A;  2CUJ A;  3A4C A;  2R7R A;  3LFU A;  4RGR A;  3CLO A;  2M34 A;  1JUS A;  1U9N A;  1USS A;  4I09 A;  4F92 B;  1W36 C;  2E2J J;  2HS5 A;  2CRG A;  2QEN A;  2V9V A;  3KCC A;  2EIM H;  4AC0 A;  2A3S A;  1YQA A;  2F5E A;  3JCU C;  1WJC A;  2IAI A;  2L9S A;  4E4H A;  3R4K A;  1MBK A;  3RQI A;  5GPC A;  4BEH A;  4A5M A;  3U1D A;  1E3H A;  2NXN B;  3AG3 H;  1NH3 A;  4N9H A;  1POG A;  3H0D A;  3RDI A;  1V5F A;  1U5T C;  4M73 A;  2Y0S N;  2GBY A;  1YX5 A;  2DDA A;  1CGP A;  1ZAO A;  2K3P A;  3GZN B;  5FRM A;  2OTJ I;  1T2K A;  1HKQ A;  3G6E I;  2XAF A;  4IVN A;  1WQ2 A;  1X1B A;  1KQ0 A;  3HOX J;  3FXK A;  1UG0 A;  3N4M A;  1S72 I;  1WH5 A;  2DMT A;  4JX6 A;  1FYM A;  2XDV A;  1T56 A;  2P6S A;  1SFU A;  4NC8 A;  1TW3 A;  4CZC A;  2DYR H;  5D5X B;  3LSP A;  3V4G A;  1MNE A;  3EUH A;  3F6O A;  5F08 A;  1S6L A;  2DBB A;  3GVA A;  3DKX A;  5L3F A;  4G7Z F;  2VJ5 A;  1TQI A;  1FYK A;  1RRJ A;  2CV2 A;  2GQQ A;  3S2H J;  4PSW A;  1U78 A;  4BJT A;  4H0E A;  4EEF G;  1P4X A;  2IT0 A;  4BY1 J;  4ENJ A;  2L9N A;  2P0W A;  4G6Q A;  1Z1D A;  2G7H A;  1UB9 A;  1ZHF A;  3CDH A;  1I1S A;  3HIF A;  4JK1 X;  5L3D A;  1VQ5 I;  1RI7 A;  3AL0 C;  1OR7 C;  1KU3 A;  1Z3X A;  2XPV A;  1MKM A;  3I56 I;  2OAZ A;  1TWG J;  2WAE A;  5BPD A;  1REP C;  4HX7 A;  3EUA A;  2LMD A;  4BL0 B;  3HYI A;  4QIW N;  1IN6 A;  4X6A J;  3JAM Z;  2DOD A;  3IP4 B;  1IXC A;  2OTL I;  3WGH A;  1HW2 A;  3TW6 A;  2Q0O A;  3I4P A;  4CZZ A;  4DGW B;  1QO0 D;  1R7J A;  2W24 A;  1IXR C;  3DEE A;  3MEX A;  6PAX A;  4A3K J;  1S5L C;  4A3D J;  2M3A A;  1I50 J;  1G3W A;  1ON1 A;  2HVQ A;  2QKM B;  5LD2 C;  5CVI A;  3BWG A;  1HW5 A;  2D2W A;  4AU7 A;  3P5J A;  4EM1 A;  2R7T A;  1R58 A;  5D5V B;  1ETQ A;  1E3P A;  1U5T B;  2M7B A;  4EJV A;  4G7O F;  2X1D A;  4Q4Z F;  3WTV C;  4RAZ A;  1RKW A;  2GZW A;  1P6R A;  2FJ1 A;  5CKT A;  2M2E A;  5EG0 B;  3M1C A;  4XKV A;  3RTR A;  4Y7N J;  1LB2 A;  1K79 A;  1R6R A;  4ZZD A;  2DA2 A;  3ZQG A;  3BZ6 A;  2CV1 A;  3GYH X;  2F2E A;  1NHA A;  2QBY B;  3OYL A;  4M6V A;  1E3O C;  3GWZ A;  3E6M A;  3AG2 H;  4PZJ A;  4X1E A;  2GXG A;  2O9L A;  4ESB A;  1WWX A;  2PFB A;  4IZZ A;  3I0T A;  4V2F A;  4DJA A;  3DKW A;  3CCL I;  4DBQ A;  2QGU A;  3HM5 A;  2AXL A;  1RZ4 A;  3BJA A;  3BPX A;  3DU5 A;  4A93 J;  1BR4 A;  1ENH A;  1N75 A;  4R79 A;  4BU2 A;  1K7A A;  3IKT A;  1QBJ A;  1X1A A;  1HDD C;  3PIP F;  1XSX A;  3WGG A;  5K5O A;  3I64 A;  4HDU A;  3S16 J;  2BOL A;  3WGI A;  2KRF A;  2R5Y A;  4JX4 A;  5GAD J;  3K4C A;  1MBF A;  3WG7 H;  4E7S A;  1XX5 A;  5C4J J;  1QZZ A;  2QQB A;  1IZ1 A;  2R7S A;  1JKR C;  3I55 I;  1W7P A;  3VOE A;  1HKT A;  1WJB A;  2L4M A;  2LR8 A;  1TWC J;  1YFH A;  2IA0 A;  3HEF A;  1OCR H;  5B66 C;  2ZKZ A;  3EPZ A;  1AA7 A;  5GAG J;  2DI3 A;  1UJ8 A;  1X19 A;  3CMY A;  1WCM J;  1MMS A;  1HC8 A;  1T95 A;  3NWS A;  5J4Y A;  3HOS A;  3HJE A;  3M8E A;  2M0M A;  2UUZ A;  4AYB A;  1BA5 A;  3V8L A;  2DLL A;  2VE9 A;  1G3Y A;  2LH9 A;  3U2R A;  1WPK A;  4E70 A;  4ZDO A;  2PJR A;  3R0A A;  1LEA A;  3TL4 X;  3SJM A;  2A5W A;  2GA2 A;  4IRG A;  1O3S A;  3I59 B;  3BZK A;  2LOO A;  2ZXI A;  1QZY A;  2C6Y A;  3EUK L;  4J01 A;  3BCB A;  3ERM A;  2EZL A;  2ID6 A;  3GW2 A;  3H5A A;  3BC8 A;  4JOM A;  1SVM A;  2E19 A;  2K85 A;  5L3E A;  4NNJ A;  1S7A A;  3PFY A;  1O7L A;  2DMP A;  4Q47 A;  4C2M J;  2UWM A;  4BAY A;  4MTD A;  3QOE A;  1P2F A;  3GTQ J;  5JHF A;  3CC2 I;  3CUQ B;  1Y56 A;  2OA4 A;  5LHG A;  4RDU A;  3H3U A;  3CTA A;  5DD4 A;  2D45 A;  3OYE A;  1LFB A;  1OCC H;  2E71 A;  3HSF A;  2V9P A;  4UB8 C;  2AS5 F;  4KIC A;  1WVR A;  2KIM A;  2LC2 A;  2K02 A;  3CF2 A;  2LRD A;  3JRF A;  3DEU A;  2O8X A;  4N0B A;  2FQ3 A;  2YS9 A;  3F8B A;  4MLO A;  5F6F A;  4EJU A;  3TO6 A;  5E17 F;  2DK8 A;  3CJR B;  5TGT A;  5DM7 F;  1IRZ A;  4RAF A;  3HRS A;  1XCB A;  3RKY A;  4OOI A;  3CF5 F;  1H0M A;  3HGG A;  4OIR F;  4PGG A;  3BDD A;  4RGS A;  4B4C A;  3ZQI A;  3DKY A;  3NRV A;  3RPU D;  3S15 J;  2NAZ A;  2X1C A;  3CZ6 A;  3CCJ I;  4WXH A;  3CCU I;  4EJW A;  1UMQ A;  2JRM A;  2QEX I;  3BR5 A;  4P55 A;  5DCF A;  3KZY A;  2FXA A;  2PBI A;  4UXN A;  3BR6 A;  4WK8 F;  2BY3 A;  1QPI A;  1T98 A;  4YFK F;  4KUM A;  1UEL B;  2VE8 A;  4A3F J;  3OMY A;  3H9J A;  2VKH A;  3KP5 A;  2OBP A;  1WJE A;  2K27 A;  3WU0 A;  5A2Q K;  3F8N A;  2HPM A;  1P7I A;  1BC8 C;  4U0V A;  3MQ0 A;  4LMY A;  5FGM A;  2O7O A;  2DJN A;  3ZMS A;  2WB1 N;  5B1A H;  4XKW A;  1JKP C;  2HQA A;  3ABU A;  1I6X A;  2E1N A;  3VPR A;  4CCM A;  5HLI A;  2LVS A;  4RLF A;  4JYK A;  1F9N A;  3OL4 A;  1JTX A;  5EJC A;  3GTL J;  1TZL A;  1LNW A;  3M07 A;  2XSD C;  2HVS A;  2DAO A;  2M8G X;  2Z33 A;  4P5O A;  1GVJ A;  1WZ2 A;  3JSO A;  1SAX A;  5FLV A;  5KAI C;  3WTT C;  2CUF A;  1APL C;  2GIZ A;  5CYV A;  4GGG A;  1RUO A;  3M7G A;  1SFX A;  2IBD A;  4CH7 A;  1BIA A;  4I99 C;  3OYC A;  4B3X A;  5FKM A;  4FE7 A;  4FT8 A;  3T8T A;  4HQM A;  3JRI A;  1BI3 A;  3KYC B;  3JTH A;  4UVC A;  5DM6 F;  2VQH A;  3GBG A;  2VKD A;  2X6W A;  4PJJ A;  1D0Y A;  3F22 A;  2Y48 A;  3DTK A;  4IRH A;  4UHT A;  3K10 A;  3IL2 A;  4KIG A;  5JHU A;  2P81 A;  5F1J A;  2QQ8 A;  4AIK A;  1BR2 A;  5K7H A;  4ZDL A;  1MGT A;  1B1B A;  1TT0 A;  2K5C A;  1I3A A;  1WJ5 A;  3T8R A;  2MFZ A;  2HPI A;  1FEX A;  1GDT A;  5IYC J;  2VXZ A;  2RQP A;  5IYD J;  5H6R A;  2XKP A;  3QRF F;  3RZD J;  2JVH A;  4IO9 F;  3H9G A;  2E7W A;  4CDG A;  2L7F P;  1J2X A;  1YX3 A;  3I4M J;  5DV5 A;  2ADU A;  1YJN I;  1YJW I;  3ZN0 A;  2KIQ A;  5CPR B;  2DOE A;  3VDX A;  1S7O A;  3GUD A;  3KZZ A;  4L5J A;  5D6E A;  4FE4 A;  1D5V A;  1C0W A;  4B09 A;  3LSJ A;  3PUB A;  5EEG A;  2UXN A;  3F21 A;  5ERI A;  2OF7 A;  3K4B A;  3GLL A;  1ETK A;  3FIW A;  1MH3 A;  3FZV A;  4KT6 A;  3F8M A;  5M5X J;  1FP2 A;  2PMU A;  5F1R A;  1GV5 A;  3BG9 A;  3OIP A;  1DPR A;  4RA2 A;  1VQM I;  4O5V A;  2AXT C;  3GFI A;  3LSI A;  1E17 A;  3CJT B; 
#chains in the Genus database with same CATH homology
 4RAY A;  1BN5 A;  5KVR A;  3H3Z A;  4BHC A;  3Q5F A;  1U5T A;  1XGO A;  2KIF A;  4YFX F;  4AWX B;  3KLN A;  1OYW A;  2HTJ A;  2FE3 A;  3SZT A;  4KA4 A;  4MEY F;  2W84 A;  4HLY A;  4RS8 A;  2QBY A;  3EET A;  1B6A A;  3H92 A;  2FEZ A;  4KT5 C;  5TJJ A;  5J8F A;  1JGS A;  5DUK A;  1J75 A;  1ZG1 A;  3JSP A;  2YU3 A;  4UV8 A;  1PP7 U;  4L9T A;  5E1X A;  5FFX A;  3L2C A;  2LNB A;  3VEP A;  3HTU A;  2EFN A;  1FPQ A;  2HEO A;  2XVC A;  2LSO A;  4NHJ A;  4G94 A;  5E1Z B;  1OR7 A;  1JHH A;  3TOB A;  3O3K A;  2E1C A;  1D8K A;  3EYI A;  3ZMU A;  1TBX A;  1YW9 A;  3B73 A;  3GFL A;  4A12 A;  2H09 A;  4AVP A;  1ONV A;  5F64 A;  4KDP A;  2OZ6 A;  2A6H F;  2VBW A;  1R5G A;  3V8K A;  2P7C B;  1ZG5 A;  1BM9 A;  5KK1 A;  2XV4 S;  2ZJ2 A;  1YIO A;  2XKO A;  5HDG A;  2XAH A;  1SD7 A;  5E20 A;  5D8K B;  3I5U A;  1J9I A;  3SQN A;  1Z6R A;  3HRT A;  3I59 A;  5E8I A;  3LA7 A;  3BOQ A;  2VT3 A;  1Z9C A;  1U6G A;  3KP6 A;  2BEO A;  2ZFW A;  1Q1H A;  2STT A;  4EJO A;  3K1M A;  4M6Y A;  3BP8 A;  3QU3 A;  2NRA C;  5ILS A;  3L09 A;  3BJ6 A;  3KEO A;  1R22 A;  4CO8 A;  1KU9 A;  3CUQ A;  4RB0 A;  2WC2 A;  5DD8 A;  3QP5 A;  2HKX A;  5JFR A;  1AWC A;  1ZYR F;  4RB1 A;  3DF8 A;  1HQC A;  1OYI A;  3TOA A;  3MZH A;  2VOD A;  3F72 A;  4GCV A;  5LRS A;  1K6O A;  1XMA A;  2DQR A;  3M8F A;  3R0J A;  2XAG A;  3EDP A;  3R60 A;  3JTG A;  2RDP A;  2CO5 A;  5HLH A;  1S8N A;  4M9Z A;  2EJR A;  3QOP A;  3ZMD A;  3C3W A;  2X0L A;  5IT9 K;  2IA1 A;  4L0Y B;  3FXR A;  1O3T A;  2O6G E;  5DUI A;  1YYV A;  3PQK A;  1DDN A;  1DP7 P;  1XDS A;  4ON0 A;  4HDV A;  2FML A;  1IN8 A;  2MBF A;  4U0W A;  4HLX A;  4MGR A;  3GXO A;  4I98 B;  5FO5 A;  3AAF A;  1F1Z A;  2PG4 A;  2DPU A;  1I27 A;  4ZYG A;  2ZBK A;  1Z05 A;  5D6F A;  5ICE A;  1IF1 A;  1XGN A;  3DFG A;  1FBU A;  4BHP A;  4Q48 A;  1OPC A;  5JI6 A;  2IPQ X;  2ACJ A;  2ZNZ A;  2W85 A;  2PLY A;  2K4B A;  1HXD A;  2FNA A;  4A6D A;  2ZME B;  3LST A;  2RN7 A;  4N9I A;  4Z2Y A;  1QQI A;  2HZT A;  1ZRC A;  4D0P A;  3M1E A;  3GF2 A;  4BXU A;  5CJ9 A;  3RKW A;  3IKV A;  4LK1 F;  3QP6 A;  4LLN A;  2D1V A;  1PDN C;  5FFZ A;  3RYR A;  1F4K A;  2IJL A;  3WTX C;  2VOO A;  1OMI A;  4IF4 A;  2R7F A;  3Q9S A;  5ED4 A;  5HS7 A;  5FD6 A;  1ZGJ A;  2XRO A;  2HQN A;  4ZZL A;  4I0A A;  1TNS A;  2VT2 A;  4LB5 A;  1LEB A;  3TO9 A;  3V7R A;  3ERE D;  4GXO A;  2HR3 A;  3FMS A;  2VOP A;  1IN5 A;  2CGP A;  3L00 A;  3L9F A;  4OIO F;  1EH7 A;  3IC7 A;  4RGX A;  3W6J B;  1XCV A;  1FSE A;  2A5Y B;  1LJ9 A;  1YG2 A;  3VOD A;  1RIO H;  1LQ1 A;  5K5R A;  1STZ A;  2V6C A;  1SMT A;  4P9F A;  5BPI A;  1IW7 F;  4ESJ A;  1SFE A;  2BYV E;  4HZF A;  4RB2 C;  3RPU A;  5A2Q Z;  4PCQ A;  4CGZ A;  1KQ9 A;  2FSW A;  4IRI A;  3K1N A;  4CYD A;  2RKH A;  5AON A;  3RPQ A;  3KP2 A;  2XAS A;  1ZGA A;  2L01 A;  1JE8 A;  3IRR A;  2D1H A;  2XHK A;  2P5K A;  2QUF A;  4OIP F;  1QGP A;  1FNN A;  1WSU A;  3R6S A;  4QLC U;  5ICG A;  4DNC A;  3MFK A;  3V8J A;  3WE3 A;  4IXA A;  1OKR A;  1EH6 A;  4M9S A;  3LWF A;  3SXY A;  4LG0 B;  2FMY A;  3F8F A;  5LBQ A;  2WTE A;  2LF8 A;  2L54 A;  4G6D A;  2R3S A;  3ZN1 A;  3I71 A;  2CQK A;  2RNJ A;  2DK5 A;  2GXB A;  3CO6 C;  4EV0 A;  2M5W A;  2F5F A;  1B4A A;  5E1W A;  1FX7 A;  2LF7 A;  4OMY A;  2DW4 A;  4Y15 A;  2OU2 A;  3RI4 A;  3KEQ A;  3FHZ A;  2QYO A;  2ISZ A;  1WKM A;  5J8C A;  2A6E F;  4A0X A;  1XSD A;  3P9I A;  3FMQ A;  1BOA A;  4EGZ A;  3V7S A;  1SD5 A;  3F6V A;  2R7D A;  4G7H F;  4UVB A;  1IRF A;  1LDD A;  4OIQ F;  3FM5 A;  1H9G A;  1W7P D;  4HAM A;  5DDG A;  1G4D A;  4LLG F;  2XRN A;  2J5O A;  3S2W A;  1XGS A;  3SHF A;  2K86 A;  4ENK A;  5D5U B;  3E6B A;  5LEK A;  2HWV A;  4L9J A;  5HDN A;  4U7D A;  2X4H A;  1CF7 B;  3WU1 B;  1ZAR A;  1LDJ A;  4MNU A;  3RYP A;  5HOO A;  2MC3 A;  2G9W A;  3F23 A;  2A61 A;  1IRG A;  2QM3 A;  2P8T A;  4I02 A;  3TGN A;  4XSX F;  5BS6 A;  3GFJ A;  2FNP A;  4XLN F;  4A0Z A;  4S05 A;  2JPB A;  1B59 A;  1SD6 A;  2EA4 A;  5JVT A;  1Z7U A;  3KLO A;  3SFZ A;  4ZYH A;  3P7N A;  3EQL F;  3DXJ F;  3B02 A;  4WF2 A;  2KJB A;  4GYG A;  2H94 A;  3COA C;  2HQR A;  1UCR A;  2XAJ A;  4MTE A;  4Y13 A;  5LRR A;  1J5Y A;  5DYM A;  4HX8 A;  2GWR A;  2MLK A;  2ZME A;  5CLS A;  1ZH5 A;  2W25 A;  2VN2 A;  4DQ2 A;  3J81 K;  1TNT A;  1KU2 A;  1ZLJ A;  3BRO A;  4GO1 A;  2DTR A;  4LD5 A;  4R8H A;  1H9T A;  2CSO A;  3BPV A;  4ENM A;  3I53 A;  1BIB A;  3HSE A;  3NEU A;  4EJT A;  2VON A;  2UZK A;  3G73 A;  2QVO A;  3RIR A;  5LEJ A;  1FT9 A;  1XSV A;  1ZRD A;  4L5I A;  2O61 A;  2COM A;  2QZ8 A;  3P9K A;  1DPU A;  1KQ8 A;  2Q2E A;  1R23 A;  1FWZ A;  3MAJ A;  1Z91 A;  4WX9 A;  4P96 A;  3QPH A;  4A0Y A;  2E7X A;  4HQE A;  2M8E A;  1R36 A;  3TDU C;  4GYI A;  1BC7 C;  2QQA A;  4BNC A;  1ULY A;  3BJO A;  2EFO A;  2H6C A;  5FB2 A;  2PJP A;  4EGY A;  3MWM A;  4RGU A;  1UST A;  5CVR A;  3KET A;  1I1G A;  4UV9 A;  1YS6 A;  4IHS A;  1Z6T A;  2CFX A;  1J59 A;  2P5V A;  5LGT A;  1FY7 A;  3GZ5 A;  5H20 A;  5DCM B;  3CJN A;  5IT9 Z;  1FP1 D;  2ETH A;  3ULQ B;  1HW1 A;  1MD0 A;  3ECO A;  4Y17 A;  2VC1 A;  2HYG D;  4OU0 A;  3M9A A;  1BI0 A;  4ETS A;  4RB3 C;  1T0F A;  4BQA A;  3LFK A;  2TDX A;  3FX3 A;  1FOK A;  3LA3 A;  4LGW A;  5ILV A;  5AIP A;  2RVC A;  4R1H A;  2FBI A;  2H27 A;  5BMZ A;  1YW8 A;  4LG0 A;  3MCZ A;  2CYY A;  3KP4 A;  1T6S A;  4FX4 A;  4AD9 A;  2QQ9 A;  3P9C A;  1MJA A;  4WCG A;  1UHW A;  1U3E M;  1RUN A;  4OMZ A;  2PEX A;  3E5Q A;  1BBY A;  3Q9V A;  4CIC A;  1A04 A;  4HF1 A;  2G7U A;  4LLL A;  3CUO A;  3E3V A;  1BI1 A;  1IAW A;  2RC4 A;  3D5L A;  1O3Q A;  3LAP A;  1AOY A;  2KKO A;  3E97 A;  4CHU A;  2HKO A;  1KYW A;  4HYE A;  2P5L C;  4ZH4 F;  3C1D A;  2HDC A;  3FXU A;  5HVQ C;  3I58 A;  2OD5 A;  3WTW C;  3TQN A;  4KN7 X;  5LGN A;  1UHM A;  4MEX F;  5ICF A;  3LA2 A;  5BOX A;  1LVA A;  4JQF A;  5K5Q A;  2GIV A;  3QU6 A;  4MHG A;  2VBY A;  4ESF A;  3FMR A;  3K2Z A;  2O0Y A;  4PGH A;  2JZY A;  3HHG A;  4EM0 B;  3ABT A;  4WXC A;  1XDU A;  1YW7 A;  2ZNY A;  1BI2 A;  1TW2 A;  3FXQ A;  1CF7 A;  1O7F A;  1HKS A;  5D4S A;  2IW5 A;  3IWF A;  1MDM B;  5FLX K;  5E8G A;  3DP7 A;  3KE2 A;  5CVU A;  4CXF A;  1IN4 A;  5FD5 A;  4KFC A;  4L18 B;  1W5S A;  3VB2 A;  2M45 A;  4KN4 X;  4L0Z B;  2FRH A;  2VC0 A;  3LAJ A;  2HTS A;  4XSZ F;  2CWE A;  4XBF A;  1T38 A;  2PI0 A;  2NNY A;  2XIG A;  2HGC A;  5L3C A;  3ZMT A;  2EFP A;  3EYY A;  1Y0U A;  4M72 A;  2JRT A;  3IWZ A;  3BY6 A;  1GXP A;  2YX4 A;  1IN7 A;  2H6B A;  5HS9 A;  3QPT A;  1WRJ A;  2W57 A;  3ZQ7 A;  2J5P A;  2V79 A;  5ICC A;  1V3F A;  2ELH A;  2VBZ A;  3J80 K;  2VBX A;  2M30 A;  1KYZ A;  2MLG A;  4KNY A;  2PQ8 A;  3HOT A;  5E18 F;  3GO5 A;  2LDU A;  2OQR A;  2FF4 A;  2LKP A;  1DUX C;  1G3T A;  1QNT A;  3J7A O;  1XD7 A;  3FF5 A;  4MQV A;  3T0Y A;  2F5C A;  3GX4 X;  3K9T A;  3GEZ A;  1SMY F;  3WTS C;  2FA5 A;  2Z99 A;  4EQQ A;  3ZPL A;  4LK0 F;  4U7B A;  1D8J A;  2QWW A;  1B9N A;  2YSR A;  3ROU A;  3GLX A;  4TV7 A;  1R1V A;  1BJA A;  2ESN A;  1MJ9 A;  4JBA A;  4A2U A;  4KYW A;  3G3Z A;  1E2X A;  4M6X A;  1P4W A;  2CW0 F;  2F5D A;  3FM3 A;  2JSC A;  1ZG3 A;  4KMU X;  1XN7 A;  2MH9 A;  4HF0 A;  3OV8 A;  3TO7 A;  3E5X A;  3CUQ C;  4AIJ A;  2KJC A;  4KIF A;  4MQ9 F;  5DCM A;  3NQO A;  2BV6 A;  4YFN F;  3F8C A;  3E5U A;  2MD5 A;  3KFW X;  3WTU C;  1T39 A;  2JT1 A;  3CO7 C;  2K4J A;  1YS7 A;  5EEH A;  2EFW A;  2IA2 A;  4A6E A;  4BHB A;  4IHT A;  5D4R A;  1VTN C;  1S3J A;  1KU7 A;  2DPD A;  3LQQ A;  5BQT A;  2EK5 A;  5IT3 A;  2V1D A;  4K2E A;  5DEQ A;  3TKY A;  3JAM K;  1B9M A;  4FX0 A;  2DO7 A;  1FSH A;  2CG4 A;  4YIF A;  2P6T A;  2OZU A;  1K78 B;  1O57 A;  1L3L A;  1HSJ A;  2Z9O A;  1HST A;  1EV7 A;  2DT5 A;  1FZP B;  2IP2 A;  2MA3 A;  3RKX A;  4Q5S F;  1X3U A;  3J81 Z;  3REO A;  2Q8K A;  1UFM A;  2KIU A;  3I54 A;  4IJA A;  2ZXJ A;  2ZCW A;  5JR3 A;  4O6J A;  2XAQ A;  1TQM A;  4BYY A;  2FU4 A;  5CVJ A;  1J0R A;  2PMH A;  2JTV A;  2BE5 F;  4WWC A;  1PP8 F;  1W4M A;  4FHT A;  2P7V B;  4HX4 A;  2UXX A;  3DQV C;  3SZP A;  1YO5 C;  3ECH A;  5LHH A;  3E6C C;  2EB7 A;  3DPL C;  4IPA A;  3LQR A;  1JHF A;  2HFH A;  4HV5 A;  4YG2 F;  4I7H A;  1TLH B;  2EV0 A;  3IRQ A;  1JXS A;  3WTY C;  3K0L A;  3KP3 A;  3K1P A;  1G6N A;  4U88 A;  2B0L A;  1P4A A;  4BH9 A;  1MDM A;  1I5Z A;  2EV5 A;  2M87 A;  4I01 A;  2L02 A;  4HA8 A;  2GA1 A;  4ENN A;  3JW4 A;  2EWN A;  2DU9 A;  2L4A A;  2HOE A;  5AIQ A;  3O2P E;  1J7K A;  4AIH A;  2O03 A;  2A69 F;  2L3D A;  4ZYE A;  1YLF A;  2V1X A;  3ELK A;  1R1U A;  5LLQ A;  2O3F A;  5ILU A;  4A5N A;  2DFI A;  3T5X A;  4LFU A;  1OYY A;  4ASN A;  4LJZ F;  4EMS A;  4WXD A;  1SD4 A;  1ODD A;  1XMK A;  3K69 A;  1HBX G;  3W6K B;  5D5W B;  4G9Y A;  3KP7 A;  3ML6 A;  2Y0M A;  4I2O A;  2ESH A;  5LHI A;  1ZLK A;  3ISP A;  1KA8 A;  4HOB A;  3VFZ A;  2K7L A;  5TRD A;  5HDK A;  2BGC A;  3U9G A;  3GZ6 A;  4OIN F;  4G8X A;  2M1B A;  5HLG A;  3O6B B;  3ZMV A;  2QLZ A;  3N97 A;  5D8L B;  1ZRE A;  1RNL A;  4F7Z A;  4B8X A;  3PQJ A;  4HBL A;  4M71 A;  2A68 F;  2ZO4 A;  2NNN A;  1TQP A;  2EV6 A;  2Z5U A;  3WOD F;  1TTY A;  3L7W A;  2STW A;  2Y75 A;  3T1B A;  4NB5 A;  1WI9 A;  5J6X A;  3IHU A;  4O3M A;  1QPM A;  2EFQ A;  2WWY A;  2RV8 A;  3ZMZ A;  1LDK B;  3V7C A;  3C7J A;  1GXQ A;  3WG9 A;  5LGU A;  5CVV A;  1W7P B;  5L3B A;  1V4R A;  2WV0 A;  3TDZ C;  2XGX A;  1FLI A;  2NYX A;  4S04 A;  1ON2 A;  2ISY A;  4HF2 A;  5FLX Z;  4ZYD A;  2JPC A;  4I0B A;  1U2W A;  1L0O C;  5L3G A;  4YII A;  2HYF A;  3DPT A;  2NS0 A;  5H6Q A;  2V1U A;  1ZN2 A;  2YPR A;  2GAU A;  4M9X A;  2YR2 A;  2RGV A;  2MH2 A;  3C18 A;  4LB6 B;  4EVI A;  3DV8 A;  3E6D A;  1O3R A;  3QAH A;  4M74 A;  1YTY A;  1R00 A;  1PUE E;  1IXS B;  1FBS A;  2IVM A;  1W5T A;  1P92 A;  1XGM A;  2OQG A;  3HRM A;  4PDK A;  3HRU A;  1IUY A;  2EA2 A;  1MJB A;  1EH8 A;  1K78 A;  3F3X A;  2PN6 A;  4P9U A;  4XLP F;  3MZY A;  3HHH A;  1D3Y A;  3D0S A;  1U8R A;  2IRF G;  1KGS A;  4QWQ A;  4UNO A;  1FBQ A;  1R1T A;  3J80 Z;  3WTZ A;  4L9V A;  3HTS B;  1FYL A;  3ZP5 A;  2XUB A;  2FBH A;  2FBK A;  5K1Y A;  2BBY A;  1GHC A;  4L9N A;  4U0Y A;  3WE2 A;  2YX7 A;  2DQL A;  3PFI A;  3RJP A;  4EM2 A;  5HS8 A;  2Z3Y A;  1R5H A;  3FWE A;  4KMF A;  2FOK A;  3HSR A;  3R61 A;  3HUG A;  1G3S A;  4HW0 A;  4UVA A;  4UUV A;  2A07 F;  1ZRF A;  1S29 A;  1MZB A;  4KIB A;  3OOP A;  4HV6 A;  3GFM A;  4NQW A;  1F5T A;  1XB4 A;  2P4W A;  4XRF A;  1FC3 A;  4RGR A;  3CLO A;  1USS A;  4I09 A;  2HS5 A;  2QEN A;  2V9V A;  3KCC A;  2A3S A;  1YQA A;  2F5E A;  3R4K A;  4A5M A;  3U1D A;  4N9H A;  3RDI A;  1U5T C;  4M73 A;  1CGP A;  1ZAO A;  1T2K A;  1HKQ A;  2XAF A;  4IVN A;  1WQ2 A;  1KQ0 A;  3N4M A;  1FYM A;  2P6S A;  1SFU A;  1TW3 A;  5D5X B;  3V4G A;  3EUH A;  3F6O A;  1S6L A;  2DBB A;  3GVA A;  5L3F A;  4G7Z F;  1TQI A;  1FYK A;  2GQQ A;  1U78 A;  4H0E A;  1P4X A;  2IT0 A;  4ENJ A;  4G6Q A;  1Z1D A;  2G7H A;  1UB9 A;  1ZHF A;  3CDH A;  1I1S A;  3HIF A;  4JK1 X;  5L3D A;  1RI7 A;  1KU3 A;  1MKM A;  2OAZ A;  5BPD A;  1REP C;  4HX7 A;  3HYI A;  1IN6 A;  3JAM Z;  1IXC A;  3WGH A;  1HW2 A;  2Q0O A;  3I4P A;  4CZZ A;  1QO0 D;  1R7J A;  2W24 A;  1IXR C;  3MEX A;  6PAX A;  1G3W A;  1ON1 A;  5CVI A;  3BWG A;  1HW5 A;  2D2W A;  4EM1 A;  1R58 A;  5D5V B;  1U5T B;  4EJV A;  4G7O F;  4Q4Z F;  3WTV C;  4RAZ A;  2GZW A;  1P6R A;  3RTR A;  1LB2 A;  1K79 A;  4ZZD A;  3BZ6 A;  3GYH X;  2F2E A;  1NHA A;  2QBY B;  3GWZ A;  3E6M A;  4PZJ A;  2GXG A;  4ESB A;  1WWX A;  2PFB A;  3I0T A;  3DKW A;  2AXL A;  1RZ4 A;  3BJA A;  3BPX A;  1QBJ A;  4R79 A;  1K7A A;  3IKT A;  1XSX A;  3WGG A;  5K5O A;  3I64 A;  4HDU A;  3WGI A;  2KRF A;  1QZZ A;  2QQB A;  1IZ1 A;  1W7P A;  3VOE A;  1HKT A;  2L4M A;  1YFH A;  2IA0 A;  2ZKZ A;  2DI3 A;  3HOS A;  3M8E A;  3V8L A;  2DLL A;  2VE9 A;  1G3Y A;  3U2R A;  4E70 A;  3R0A A;  1LEA A;  1O3S A;  2GA2 A;  4IRG A;  3I59 B;  1QZY A;  2C6Y A;  3GW2 A;  5L3E A;  1S7A A;  1O7L A;  4Q47 A;  2UWM A;  4BAY A;  4MTD A;  1P2F A;  3CUQ B;  2OA4 A;  5LHG A;  3H3U A;  3CTA A;  5DD4 A;  2D45 A;  3HSF A;  2AS5 F;  4KIC A;  2KIM A;  2K02 A;  3DEU A;  2O8X A;  4N0B A;  2FQ3 A;  3F8B A;  5F6F A;  4EJU A;  3TO6 A;  5E17 F;  2DK8 A;  3HRS A;  1XCB A;  3RKY A;  4OOI A;  1H0M A;  4OIR F;  4PGG A;  3BDD A;  4RGS A;  3NRV A;  2NAZ A;  4WXH A;  4EJW A;  4P55 A;  5DCF A;  3KZY A;  2FXA A;  2PBI A;  4UXN A;  4WK8 F;  1T98 A;  4YFK F;  4KUM A;  2VE8 A;  3KP5 A;  2OBP A;  2K27 A;  3WU0 A;  5A2Q K;  3F8N A;  1BC8 C;  4U0V A;  3MQ0 A;  4LMY A;  5FGM A;  3ZMS A;  3ABU A;  1I6X A;  2E1N A;  5HLI A;  1F9N A;  1LNW A;  2DAO A;  2Z33 A;  4P5O A;  1GVJ A;  3JSO A;  1SAX A;  3WTT C;  5CYV A;  4GGG A;  1RUO A;  3M7G A;  1SFX A;  1BIA A;  4FT8 A;  3T8T A;  4HQM A;  1BI3 A;  3JTH A;  4UVC A;  3F22 A;  2Y48 A;  4IRH A;  4UHT A;  3IL2 A;  4KIG A;  5JHU A;  4AIK A;  1MGT A;  1B1B A;  3T8R A;  2VXZ A;  2RQP A;  5H6R A;  2XKP A;  3QRF F;  2E7W A;  4CDG A;  1J2X A;  5DV5 A;  2ADU A;  3ZN0 A;  1S7O A;  3GUD A;  3KZZ A;  4L5J A;  5D6E A;  1D5V A;  1C0W A;  4B09 A;  5EEG A;  2UXN A;  3F21 A;  5ERI A;  3FZV A;  3F8M A;  1FP2 A;  2PMU A;  5F1R A;  1DPR A;  4O5V A;  3GFI A;  1E17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...