2QVOA

Crystal structure of af1382 from archaeoglobus fulgidus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
RIKLLFKEKALEILMTIYYESLGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDKGQKIAQQIKSIIDIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AF1382 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein AF_1382
total genus 27
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2007-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qvoA00
3B73A 1Z7UA 2YSRA 2C6YA 1FC3A 3LA7A 2VC0A 2H09A 4S04A 3QAHA 1MKMA 4M73A 1ZRFA 2HGCA 4P9FA 5DYMA 4HX8A 3RJPA 1U8RA 3VB2A 1LDJA 2FOKA 2PN6A 2K4BA 1T38A 1FYKA 3BWGA 1Z9CA 1J9IA 5DCMB 1YIOA 5J6XA 3QOPA 3F8CA 1Z05A 1FOKA 2XV4S 3U9GA 2Q0OA 5D6EA 2WV0A 5CJ9A 2M8EA 4YIIA 1F4KA 5HS7A 1QNTA 3TKYA 1SFUA 4RGUA 1E17A 4HLXA 3LQRA 3FZVA 3T1BA 3I59B 3GVAA 5LHHA 4HW0A 1GVJA 2Z3YA 4HOBA 1GXPA 2P7VB 4KA4A 2D2WA 4QLCU 1IXCA 3V7CA 4HF1A 2PMHA 4YG2F 3FM5A 4ESJA 4N9HA 2FRHA 4M72A 4ESBA 5D4SA 2VBXA 4XSZF 3HTSB 3R6SA 4UUVA 2FNPA 4P5OA 4IHTA 1YW9A 2EWNA 1OR7A 1LB2A 1K78B 1G3WA 1S3JA 1PP8F 2IRFG 1Z91A 1GHCA 1SAXA 4R8HA 1OKRA 4EQQA 3HSFA 1BBYA 3GO5A 1DUXC 5JVTA 4YIFA 1WKMA 4KN7X 2X0LA 2P5LC 1B59A 1FBUA 2QZ8A 2JZYA 2GA1A 1YW7A 4L9NA 3GFJA 2PBIA 5AONA 1ZH5A 1T0FA 4DNCA 2M45A 5JI6A 2MD5A 5HLIA 2Q2EA 2E1CA 2NS0A 3PFIA 3M9AA 1RNLA 2M5WA 1XGNA 1STZA 3F21A 3FMSA 4Q5SF 2PG4A 2BEOA 1JGSA 3F23A 2TDXA 4M6YA 3IHUA 3GFIA 2UXNA 1ON2A 3LA3A 3I5UA 1QBJA 1FPQA 3DEUA 4D0PA 1XSXA 2DPDA 3LA2A 3R0AA 3TQNA 3COAC 1XN7A 4OMYA 4XLPF 2FNAA 3IRRA 3HUGA 4NHJA 4RB3C 1HXDA 4AD9A 4EM0B 1U6GA 4RB0A 2F5CA 2P6SA 2R7DA 4LG0A 1FT9A 1G3SA 4LG0B 5D4RA 4S05A 1P2FA 1IF1A 3M8EA 4EJOA 3MFKA 2BE5F 4LB6B 2G7UA 3Q5FA 1XSVA 1YW8A 2W84A 2AXLA 4RS8A 2FBHA 4RB1A 3OV8A 2P7CB 2ETHA 2E7XA 2XROA 1AWCA 2ESNA 3F72A 1TNTA 2EFNA 1F9NA 2RN7A 1WSUA 1QQIA 3MWMA 2HYFA 5E20A 2RVCA 2EFQA 3WTTC 3TO6A 1IW7F 1XGOA 2RDPA 2DK8A 4A0XA 4G7HF 4PDKA 3WTZA 3W6KB 3ZQ7A 2RQPA 4KT5C 3FXRA 3MCZA 1OMIA 1FBSA 1B1BA 1R5GA 4EMSA 1L0OC 2XASA 1ZAOA 3NEUA 3K2ZA 5F6FA 2FMYA 1U2WA 1CF7A 5JR3A 4Q48A 1SD6A 1ZLKA 3U1DA 5LGUA 2QENA 2RV8A 4FHTA 2YPRA 2RKHA 2QYOA 2IT0A 1UHMA 3IKVA 2RGVA 3CLOA 3GZ5A 2QQAA 3GZ6A 1S8NA 1R1VA 2XKPA 1V4RA 3C18A 5L3DA 2GAUA 1OYWA 1W4MA 5BPIA 2Y75A 2NAZA 1T2KA 1R7JA 5E8GA 4MQ9F 4MGRA 1PDNC 1G6NA 4KIBA 2WTEA 2V9VA 3NRVA 2HZTA 3KE2A 1W5SA 3WTWC 3C7JA 2EA4A 1FX7A 1ZG1A 5E1WA 3CUQC 2KIFA 1BC8C 3I58A 1D8KA 5L3GA 1SMTA 3I4PA 4GO1A 1U5TA 5FB2A 1WRJA 4KMUX 3RDIA 2P5KA 3QP6A 1ZARA 2A5YB 3FX3A 4Q47A 3ABTA 1TLHB 1S29A 3MZHA 2COMA 1XD7A 1YFHA 3DPTA 3FM3A 2AS5F 1ZGJA 2P4WA 2E7WA 3T8TA 4LB5A 1O3SA 3HRMA 1J2XA 5E17F 4R79A 3T5XA 1BC7C 2HOEA 3C3WA 4HBLA 1PUEE 4MTEA 4BQAA 1SMYF 4LGWA 3W6JB 5ILUA 2LF7A 4UVCA 2VXZA 1O7LA 4GYIA 4ON0A 4LK1F 5E8IA 4WX9A 3ML6A 1BN5A 3LWFA 1UB9A 2VT3A 2GQQA 1BI0A 2R7FA 3HYIA 1EH8A 2HDCA 5BOXA 1WQ2A 3HTUA 3E6BA 3MEXA 1XDSA 3CTAA 3KETA 1P92A 3J80K 5JFRA 1R00A 1MZBA 3H3ZA 2STTA 3HOTA 2IW5A 5H20A 3F6OA 1LNWA 3RYPA 2QUFA 1ODDA 1SFXA 2XGXA 3BROA 1FY7A 1CF7B 3HRSA 2P5VA 3KZYA 3DPLC 3TO7A 2FU4A 4LMYA 2MLGA 1XB4A 1P4XA 4P96A 3F8MA 5DEQA 2CQKA 4YFNF 5BQTA 3TO9A 2V79A 3GUDA 4I09A 3WU1B 1ZRCA 4ENNA 4OIRF 2RNJA 3DF8A 2EFOA 5HDKA 2EV6A 3U2RA 4EJTA 1BI3A 5LLQA 1IN8A 4HX4A 3WE2A 4XLNF 1UCRA 1X3UA 2HS5A 1OPCA 4EVIA 2ESHA 1RUNA 3RPQA 4PGGA 5HLGA 2EA2A 4CO8A 3E6CC 3G3ZA 4M9ZA 4RAZA 2KRFA 2FSWA 1R22A 1K79A 5BPDA 4KDPA 5BMZA 3IWFA 4FX0A 2PFBA 4FT8A 4BYYA 1JHHA 1HKSA 1SD5A 4HZFA 1I1GA 5HOOA 5IT3A 2VBWA 4PZJA 5ICFA 2JRTA 2XUBA 3S2WA 3E6DA 4Q4ZF 4YFKF 5L3CA 1ZG3A 2A07F 3GW2A 4UV8A 2IVMA 3K9TA 5DUIA 1I27A 4E70A 4IF4A 2MA3A 1H9GA 3AAFA 2V6CA 5A2QK 3KP2A 4M71A 4CHUA 2GZWA 3IRQA 1LEBA 4AWXB 1TW3A 2LDUA 2JSCA 3DKWA 3ELKA 4BH9A 2RC4A 4HDVA 2P6TA 3CO7C 3IC7A 4Y17A 2Z9OA 4NQWA 1XGSA 3REOA 4H0EA 3PQJA 2IPQX 1PP7U 4LLLA 1BI2A 3KLOA 5FD5A 4IRIA 4RGRA 5ILSA 4BAYA 3ZMUA 2FQ3A 2DTRA 3KEQA 1O7FA 4OU0A 2OD5A 2DK5A 3P7NA 4KN4X 4M9XA 5CVIA 5ICEA 1BI1A 4P55A 1H0MA 2L54A 1HKQA 2Z5UA 4JBAA 2NRAC 3I71A 3DFGA 3L09A 2JPBA 2A6HF 4KIFA 1YS6A 2ZO4A 4PGHA 5K5OA 4TV7A 2V1XA 3ZMZA 5F1RA 4HDUA 4EGYA 1TQPA 4UXNA 4XSXF 1G4DA 4YFXF 2D1HA 1OYIA 3GYHX 2GWRA 5DV5A 4Y15A 4B09A 2MLKA 4RB2C 2ZKZA 2XIGA 1CGPA 4EGZA 5DD8A 2DU9A 2W24A 4EM1A 3BY6A 5LGNA 2X4HA 3MAJA 2O6GE 2PQ8A 4ENJA 3ZMDA 3F8NA 2PJPA 1P4WA 3V4GA 4ZH4F 2QQ9A 1IXRC 3V7SA 1W7PA 4L18B 4U88A 4UHTA 4AIJA 5H6QA 2BBYA 1H9TA 3M7GA 1MJAA 1XGMA 2UWMA 3GFMA 1U5TC 4N9IA 4UV9A 5FGMA 4AIKA 2CW0F 1TW2A 3EUHA 1BOAA 2DLLA 3K1PA 5D5UB 1USSA 4P9UA 3LSTA 2DBBA 4MHGA 4I2OA 3SQNA 3ECHA 2VOOA 4WCGA 1LDDA 4M74A 3J80Z 3FHZA 2HEOA 5LRRA 2HYGD 5FFZA 3DV8A 3JTHA 2L4AA 1W7PD 1MJBA 4WXCA 3K1NA 5H6RA 1EV7A 4G7OF 3SXYA 3ERED 4L5JA 2CYYA 2MBFA 1K78A 2ZNZA 2A61A 4RGXA 1K7AA 4MEXF 1XDUA 1LDKB 3GXOA 2DW4A 3HRTA 1IN7A 2LSOA 2CGPA 2JT1A 2VONA 2FBKA 2VOPA 1REPC 2OZ6A 1R58A 3D0SA 1XCVA 2A6EF 4GYGA 2GXBA 1ZHFA 4RAYA 1ZG5A 3F6VA 3KCCA 4KMFA 1IN5A 4F7ZA 1TBXA 2L3DA 2M87A 4A2UA 2OU2A 2B0LA 1D8JA 2HKOA 2OQRA 2L4MA 3KP3A 3R61A 4IRHA 4WXHA 5DD4A 2VN2A 3V8KA 3I59A 1FWZA 3KP6A 1O57A 3CUQA 3NQOA 5EEHA 4G9YA 3WGGA 5CVUA 2EJRA 4U0VA 3L2CA 3R60A 3E5UA 4CDGA 3BOQA 1WI9A 1F1ZA 3E97A 4OIOF 1Z1DA 2WWYA 1AOYA 2M30A 1S7OA 2YR2A 3M8FA 5DCMA 2F5FA 1D5VA 1KQ8A 1L3LA 4AVPA 3JAMZ 2JPCA 3BJOA 6PAXA 2LF8A 2W57A 3F8FA 2NNYA 5AIQA 3BPXA 2Q8KA 3WTXC 3KFWX 1S6LA 3ECOA 3TGNA 2FMLA 4I7HA 1JHFA 2DT5A 4IHSA 4CZZA 1HSTA 3ZMSA 3F8BA 5CYVA 2OBPA 2XAGA 4IVNA 1HW2A 2IA2A 4ENMA 3QPTA 1FBQA 2HWVA 4G6QA 1HW1A 3GF2A 1MDMA 2HQNA 4HF2A 4ZYDA 1HW5A 3WTUC 3J81K 5K5QA 4JK1X 5DDGA 4IJAA 1O3QA 1ONVA 1ZN2A 4ZYHA 2W85A 4KICA 3ZN0A 4ZYGA 5E1XA 1NHAA 5IT9K 4KFCA 3RIRA 1R23A 3MQ0A 3D5LA 1XMKA 1USTA 2ZCWA 4U7BA 2EV0A 3O6BB 5HS8A 4A5MA 1YLFA 3BJ6A 1ZGAA 3T0YA 5HDNA 2DI3A 1TTYA 3E5QA 5FO5A 2G7HA 4CICA 1J59A 4CGZA 1B9MA 5D8KB 2ZXJA 3BZ6A 2CG4A 2CO5A 3L00A 4LLNA 4ESFA 1F5TA 1IN4A 1IUYA 4M9SA 2BYVE 3RPUA 1TNSA 3O2PE 4I01A 1MDMB 3TOBA 1Q1HA 3HHHA 3HIFA 3VEPA 4L9VA 3OOPA 3EYYA 3H3UA 3MZYA 3HOSA 2QM3A 3R0JA 2DQLA 2KIUA 1YG2A 4MEYF 4I0BA 2UZKA 3V8LA 4A12A 3I64A 4ASNA 1LQ1A 3Q9SA 4G7ZF 2JTVA 4WXDA 4G94A 4HV6A 1VTNC 4L0ZB 5KVRA 1HQCA 1KU9A 5CVRA 1J75A 1SD7A 4JQFA 1U3EM 1C0WA 4OIQF 2H6CA 3CDHA 4EJUA 2YX7A 1YYVA 1YTYA 2EK5A 1D3YA 2HKXA 3CO6C 2IJLA 2IA1A 3QU6A 3RKWA 2Z99A 2PLYA 2XAJA 4HF0A 2GXGA 1FZPB 5JHUA 5CLSA 5L3FA 2VE9A 4ENKA 3JSOA 3ZP5A 3V8JA 2LNBA 2M1BA 3QRFF 3HHGA 1YQAA 4DQ2A 2H94A 2XAFA 3GLXA 4A6EA 1LJ9A 1DPRA 3O3KA 3RYRA 3RKXA 3ZMVA 5BS6A 1DP7P 4UVBA 3WTYC 4MQVA 4U7DA 2OQGA 5TJJA 1U78A 2A69F 2GA2A 2L01A 1T98A 3RTRA 3K69A 2DQRA 1QZZA 2KKOA 3F22A 1TQIA 3FXQA 1I5ZA 2BGCA 1UFMA 4U0YA 4BXUA 2QBYB 3DP7A 3FXUA 3TOAA 2O3FA 2XAQA 3ZMTA 1KU2A 2E1NA 1Z6TA 2IP2A 2O03A 2PMUA 3EYIA 1OYYA 3E3VA 3KP5A 5FFXA 2HQRA 1RIOH 1DPUA 5J8FA 2R3SA 2PI0A 1RI7A 2Y0MA 4R1HA 1ULYA 3T8RA 5D5XB 3VFZA 5F64A 1W7PB 4KUMA 1MGTA 3M1EA 3FMQA 4HA8A 3JW4A 1LVAA 4A0ZA 3CUQB 4O6JA 3IWZA 1FP2A 4FX4A 2QQBA 3HSRA 1V3FA 4IPAA 4HLYA 4A0YA 4EV0A 1QGPA 3EDPA 2STWA 2FA5A 3EQLF 2A3SA 2F2EA 4OOIA 1BM9A 1IZ1A 4EM2A 3JTGA 1RUOA 2OZUA 1BIBA 1T39A 4Z2YA 3WGIA 2LKPA 2P8TA 2MH9A 3GEZA 5K5RA 3CUOA 4HQMA 4I02A 3K1MA 4L9JA 2EFPA 3LFKA 3BJAA 3J81Z 2O8XA 2CWEA 4L5IA 3KP4A 1IRGA 2ACJA 2WC2A 2ZNYA 4HAMA 2XVCA 2J5OA 4AIHA 3Q9VA 1Y0UA 1KYWA 5LHGA 3RKYA 2QLZA 1FSHA 2HR3A 5E18F 3LAJA 4EJWA 3WG9A 5L3EA 4GCVA 3QU3A 2ISZA 5ILVA 3P9IA 4Y13A 2XHKA 1IRFA 4OINF 1YS7A 4RGSA 1BJAA 2NYXA 5LBQA 4L9TA 1KQ0A 3WTSC 1XSDA 3IL2A 2BV6A 1WWXA 5D5VB 5HVQC 3ISPA 1KU7A 1YO5C 2HTSA 3IKTA 2ZMEA 5EEGA 4BHBA 2EV5A 4LK0F 5LEJA 5ED4A 1KYZA 1O3TA 1DDNA 2ISYA 2XRNA 5DUKA 4BNCA 3L7WA 2UXXA 2QVOA 1IN6A 3ULQB 4I98B 3VOEA 5TRDA 1ZRDA 1FYMA 1FLIA 2DFIA 2VBYA 1K6OA 4HX7A 2HFHA 2FE3A 2FEZA 2K86A 5ERIA 2OAZA 1ZLJA 4O5VA 1TQMA 2F5EA 3I53A 3I0TA 5K1YA 5HLHA 1Z6RA 2KIMA 4A6DA 3E6MA 3TDZC 4HV5A 3ROUA 4A5NA 2PEXA 4L0YB 4MTDA 1FYLA 2MC3A 3BP8A 3WGHA 1KA8A 2VT2A 5KK1A 4OMZA 4I0AA 4ZZDA 1SD4A 1IXSB 2QBYA 5L3BA 2KJCA 3SHFA 2G9WA 3PQKA 1U5TB 1J5YA 1HBXG 4UNOA 3DXJF 3K0LA 1HKTA 2V1DA 2K7LA 4KYWA 1LEAA 4MNUA 1W5TA 5FLXZ 1RZ4A 1R36A 1FNNA 5AIPA 5DCFA 4ETSA 4GGGA 5D5WB 4O3MA 5ICCA 2KJBA 4WF2A 1EH6A 1MD0A 4LLGF 1B4AA 3V7RA 2HTJA 3KLNA 4PCQA 3L9FA 4BHPA 1XCBA 3GFLA 3DQVC 5FD6A 3SZPA 5D8LB 2VC1A 3JSPA 4B8XA 2MH2A 2EFWA 4IXAA 2W25A 5J8CA 2L02A 2Y48A 4G8XA 5LHIA 1KQ9A 3C1DA 1JXSA 1J0RA 2QWWA 1R5HA 2D1VA 1JE8A 2D45A 2ADUA 1SFEA 3E5XA 3B02A 2XKOA 3TDUC 5D6FA 1ZREA 5IT9Z 2K02A 1GXQA 2FBIA 3RI4A 5LEKA 4OIPF 1FP1D 3H92A 2J5PA 2DO7A 1G3TA 2A68F 5ICGA 1J7KA 2CFXA 3WTVC 3P9KA 4GXOA 3HSEA 1QO0D 1P4AA 3WU0A 2V1UA 1FSEA 3QPHA 1KGSA 2K27A 3WE3A 1B6AA 2ELHA 1KU3A 1G3YA 1IAWA 3LQQA 3QP5A 2Z33A 4HQEA 1E2XA 2ZBKA 3BPVA 4NB5A 1S7AA 4CYDA 1O3RA 4WWCA 4UVAA 1B9NA 4ZZLA 5E1ZB 3BDDA 4KNYA 3HRUA 2ZFWA 3I54A 1I6XA 2F5DA 1BIAA 1UHWA 2ZJ2A 3GWZA 5CVVA 5LGTA 1QZYA 3GX4X 2OA4A 1MJ9A 3JAMK 4U0WA 5A2QZ 4QWQA 2EB7A 4XBFA 2XAHA 3FF5A 3N4MA 5FLXK 2NNNA 4LD5A 3R4KA 3F3XA 3LAPA 1EH7A 2K4JA 1ZYRF 4G6DA 1HSJA 1I1SA 1R1UA 2VE8A 3J7AO 5HS9A 3FWEA 1ON1A 4IRGA 2H6BA 3WODF 2DPUA 5CVJA 1T6SA 5HDGA 2DAOA 4K2EA 1XMAA 3VODA 5LRSA 4CXFA 4LFUA 2FXAA 2VODA 3SZTA 3P9CA 2YU3A 4XRFA 4LJZF 2O61A 2IA0A 2H27A 2YX4A 3KP7A 2GIVA 4KIGA 1P6RA 3CJNA 2O0YA 3SFZA 3ZPLA 1R1TA 3G73A 3ZN1A 2VBZA 3ABUA 4EJVA 4ZYEA 1QPMA 4HYEA 3N97A 4WK8F 3EETA 1A04A 4BHCA 2ZMEB 4M6XA 2CSOA 3KZZA 3KEOA 2FF4A 4N0BA 3FMRA
chains in the Genus database with same CATH superfamily
3B73A 4XQFA 1Z7UA 2YSRA 2C6YA 2PMZA 2CV0A 3OYGA 1FC3A 3LA7A 2VC0A 2H09A 2BZTA 3CCLI 4IL6C 3Q0WA 2X51A 4S04A 4DZJA 4EATA 3QAHA 5EG0A 1MKMA 4UUTA 1TC3C 1IDZA 3H36A 1IV6A 2E34A 4M73A 2XSDC 1ZRFA 2HGCA 1FOXA 1FOYA 4P9FA 2JA7J 5DYMA 2F4MB 4HX8A 3RJPA 1IC8A 4C3IJ 1U8RA 2ZJQF 3VB2A 1LDJA 1I39A 3PO2J 3SEQA 2V9PA 2FOKA 5IY5H 2PN6A 2K4BA 4MLOA 1T38A 2RNGA 1FYKA 2BY3A 3BWGA 1BR1A 1Z9CA 1J9IA 5DCMB 1H8AC 3DBRB 1YIOA 5B1AH 5J6XA 3QOPA 3F8CA 1Z05A 1OQYA 3H35A 1FOKA 2XV4S 4IHYA 3U9GA 2R7SA 2HXOA 2Q0OA 5D6EA 5C4JJ 5M5YJ 3H3VK 2WV0A 5CJ9A 2M8EA 4YIIA 1F4KA 1FOWA 5HS7A 1QNTA 3O8GA 3TKYA 4PFPA 1V55H 3G2BA 2E2JJ 5H2FC 1SFUA 4RGUA 1E17A 4HLXA 5F0FA 3LQRA 5IYDJ 4M3GA 3FZVA 3T1BA 5CKTA 3I59B 3GVAA 5EJCA 5LHHA 4HW0A 1Y1VJ 2E36A 1GVJA 5M3MJ 3OYAA 2COBA 1WJBA 2Z3YA 3P5JA 2EIJH 3OYJA 4HOBA 1GXPA 2P7VB 2F5VA 2WAEA 3G71I 4KA4A 3ZQHA 5FLVA 2D2WA 3HOYJ 4QLCU 1IXCA 3V7CA 4HF1A 2PMHA 4YG2F 2KRCA 3FM5A 1D5YA 4AM3A 4ESJA 4N9HA 3QODA 4A3GJ 2FRHA 4M72A 4ESBA 2R5ZB 5D4SA 2VBXA 2R93J 4XSZF 3HTSB 3R6SA 4BQOA 4UUVA 5FRNA 3K7AJ 2Z2SB 2FNPA 4P5OA 4IHTA 4BXFA 1X4OA 2CV1A 1YW9A 2Z1DA 2EWNA 5J3LA 1RKWA 3BC8A 2ZXHA 1OR7A 1LB2A 1K78B 1OCTC 1G3WA 1S3JA 1PP8F 2IRFG 2CW7A 4B48A 4X0GA 1VQPI 4B3AA 2E19A 1Z91A 1GHCA 2K9QA 4A3MJ 5GAEJ 1SAXA 4R8HA 5J4VA 1OKRA 4EQQA 3H9QA 3HSFA 1BBYA 3GO5A 4XLAA 1S72I 4F52A 1DUXC 4EEFG 2DMUA 5JVTA 1MNDA 3OL4A 3FXLA 4YIFA 2FX0A 1IV8A 1WKMA 4KN7X 2X0LA 2P5LC 1B59A 4N4OB 2DTZA 1FBUA 2QZ8A 2JZYA 1ORKA 2GA1A 3CMYA 1YW7A 4NC6A 4BQQA 1ZKGA 3K4BA 4L9NA 4XN0A 4HEA2 4BDZA 2M7BA 3BR5A 3GFJA 1S7EA 3OYCA 1YI2I 5F27A 3PNVA 2LFBA 1RETA 2PBIA 1VQ9I 5AONA 4BL0B 4DYCA 5J47A 5FLMJ 1ZH5A 1BW5A 1T0FA 4DNCA 2M45A 5JI6A 1IGNA 2MD5A 5HLIA 2Q2EA 4F93B 2E1CA 2K9SA 2NS0A 1G59A 3PFIA 3M9AA 1RNLA 2M5WA 2VXDA 1XGNA 1STZA 3F21A 3FMSA 4Q5SF 4AUXA 2PG4A 2BEOA 1JGSA 2WV1A 3F23A 5FROA 2TDXA 2LRDA 3K4LA 2ID3A 4M6YA 2KLOA 3IHUA 4XOTA 5GTHC 1KONA 3GFIA 3SDBA 2UXNA 3BCAA 2W7NA 3CCJI 2Y0SA 1ON2A 4JX4A 1HLVA 3LA3A 3I5UA 2MSYA 1QBJA 1FPQA 4G6TB 1IRXA 4C30A 2VPLA 3DEUA 4D0PA 1X1PA 1XSXA 2DPDA 3LA2A 3R0AA 3TQNA 3COAC 4Y7NJ 1E3OC 3U21A 3NWSA 1QPIA 5KAFC 2QKMB 5F08A 2A6TA 3EUKL 1XN7A 4OMYA 3LSGA 2M3AA 4XLPF 1UG0A 2FNAA 3IRRA 4XICA 3HUGA 4QSHA 3ZQGA 4NHJA 2JMWA 3IAM2 4RB3C 1HXDA 4AD9A 4EM0B 1JUMA 1U6GA 4RB0A 2F5CA 2AHQA 2P6SA 2OJED 2HOSA 3IV5A 2R7DA 5C4XJ 4LG0A 5DM6F 4XN3A 1FT9A 3KEYA 1G3SA 3TW7A 1TWFJ 4LIUA 4FASD 4LG0B 2VUMJ 5D4RA 4S05A 1MSEC 1P2FA 3RZDJ 1IF1A 3S1QJ 9ANTA 3M8EA 4EJOA 4IO9F 4XLHA 1WPKA 2NVUB 2QKLB 3MFKA 2O7OA 2BE5F 1NTCA 2IXSA 2R7RA 4LB6B 4CZCA 2G7UA 2P0WA 1JI8A 2WY7Q 4LITA 4OWRB 3Q5FA 1XSVA 4IHXA 5IP9J 1NK2P 1YW8A 2W84A 2DMTA 4BBRJ 2JUGA 2AXLA 2X6OA 4RS8A 2B63J 2FBHA 4RB1A 3OV8A 2P7CB 1YITI 2ETHA 2E7XA 2XPVA 1DP3A 2XROA 1AWCA 1UHSA 2ESNA 2DA7A 1WZ2A 4PJNA 3F72A 2BOLA 2H1LA 1TNTA 4M3FA 2ME6A 2EFNA 1F9NA 2RN7A 3GBGA 3X2QH 1WSUA 2E5ZA 1QQIA 2VQCA 3MWMA 5FKNA 2HYFA 2LK2A 4FCYA 2R7ZJ 5E20A 2RVCA 2EFQA 3LSHA 3WTTC 3TO6A 1IW7F 1XPXA 4XKCA 1XGOA 2RDPA 1YIJI 2DK8A 4A0XA 3MKYB 4G7HF 4A3DJ 4PDKA 3WTZA 3LSRA 1XS9A 1HC8A 3W6KB 2BW3B 3IH4A 3CMEI 3ZQ7A 2RQPA 4KT5C 4M3BA 1IUFA 3MD2A 3DEWA 3S1RJ 3FXRA 3MCZA 3QYBA 4JYKA 1OMIA 3ZXSA 1VQMI 1YJ9I 4ZDLA 2AQEA 1FBSA 1B1BA 3GTJJ 1CQTA 1R5GA 2N8GA 1LVKA 4EMSA 5J1RA 1YE9A 2XASA 1L0OC 4BBSJ 1ZAOA 3NEUA 3K2ZA 2TRTA 5F6FA 4ZYAA 4E7JA 2FMYA 3CLQA 1U2WA 3PUFA 5EG0B 1CF7A 2XAUA 5JR3A 1JKPC 1X1DA 4Q48A 3A0BC 1NK3P 5E3NA 2DCEA 1SD6A 1ZLKA 3U1DA 3ABLH 5LGUA 2QENA 1T8IA 2RV8A 4IHVA 4FHTA 2YPRA 2FOWA 2RKHA 2QYOA 2IT0A 2JJ7A 5HNFA 2LBFB 1UHMA 3IKVA 2RGVA 2CUFA 1X4PA 4C2UA 3G4SI 2RAEA 3CLOA 3GZ5A 2QQAA 3GZ6A 1S8NA 1R1VA 4QPQA 2XKPA 1V4RA 2EZIA 3C18A 5L3DA 2GAUA 5K7FA 3GTLJ 1RPWA 1JUPA 1QHGA 3H5AA 1OYWA 2AXTC 1W4MA 3HGGA 2W1OA 4D5FA 2E5NA 5BPIA 2AO9A 2Y75A 3OOUA 3C2GA 2P81A 2NAZA 2IGOA 1T2KA 1R7JA 5E8GA 1S5LC 4MQ9F 2GBYA 4MGRA 1PDNC 1G6NA 4KIBA 2NVXJ 2WTEA 2VJJA 1ETOA 2V9VA 3NRVA 1ENHA 3RKQA 2X9DA 3RZOJ 3PFYA 3QOEA 2HZTA 2EBIA 3KE2A 3KZIC 1OISA 1W5SA 3WTWC 3OYFA 2QSGX 3OIQA 3QPLA 3C7JA 4AVZA 1AA7A 2EA4A 3BT9A 1FX7A 2M7AA 4DYQA 1QHHD 4BGDA 5GP9A 2NVTJ 1ZG1A 5E1WA 3JRAA 3GTQJ 3CUQC 2KIFA 1BC8C 1X3WB 2OTLI 3IUOA 3I58A 1YHQI 2LR8A 1D8KA 2IGMA 5L3GA 1SMTA 3I4PA 3H0DA 3L2UA 4GO1A 4J00A 2DA3A 1U5TA 1X2NA 2WAQN 5FB2A 5BNGA 1H89C 1WRJA 4KMUX 3RDIA 3M8JA 2P5KA 3QP6A 4B44A 1ZARA 2A5YB 3FX3A 4Q47A 2K9LA 3ABTA 1N25A 3VYUB 2WBMA 3PM1A 4BEHB 1TT5B 1TLHB 1S29A 2AQFA 2WADA 3K4NA 3MZHA 2FQ4A 2COMA 3S15J 1WJEA 1Z67A 2E1MB 1P9QC 1XD7A 4FE4A 3DPTA 1YFHA 3FM3A 3OYEA 2AS5F 2PMZN 1ZGJA 4XLEA 2P4WA 2E7WA 3LNQA 2VKHA 4QPOA 3T8TA 1JUSA 4LB5A 2R4GA 1O3SA 2ZJPF 2DN0A 3HRMA 2LLKA 4XK4A 1J2XA 1PJRA 1VQLI 2F6CA 3DLAA 5F04A 5E17F 3GZNB 2XGDA 2HOEA 3T5XA 4D7NA 3C3WA 5B3SH 4R79A 1BC7C 2IAIA 4HBLA 3M4OJ 2X1CA 1PUEE 4MTEA 1MIJA 3Q0UA 3V42A 4DIQA 2DDBA 4IQ4A 2VKDA 4BQAA 4BXXJ 1SMYF 4LGWA 3AL0B 3W6JB 5ILUA 1R6RA 2HNHA 4RBOA 3ZQCA 2LF7A 4LIVA 4UVCA 1POGA 2YU9J 2VXZA 1O7LA 4GYIA 4ON0A 4LK1F 5E8IA 2M8GX 4WX9A 3ML6A 4GRIA 1BN5A 3LWFA 1MH3A 1UB9A 2VT3A 2CQ7A 4BE0A 2GQQA 3RQ4A 1BI0A 2R7FA 5TISC 1HOMA 3HYIA 1EH8A 4E7ZA 4IZZA 2HDCA 2HVRA 5BOXA 1WQ2A 2R7VA 1LPQA 3HTUA 1X1CA 3E6BA 3MEXA 1XDSA 3CTAA 3KETA 2CW8A 3I4NJ 1WHUA 2JA6J 1P92A 5EYRA 4XLFA 3J80K 5JFRA 1R00A 1MZBA 2L9VA 3H3ZA 4F91B 2STTA 3HOTA 2IW5A 5H20A 3F6OA 1MNEA 1LNWA 1Z21A 2NOJB 3RYPA 2QUFA 1VQ6I 4XONA 3MMYB 1U0JA 1ODDA 3G1OA 1TWGJ 2DA2A 3OIOA 3ZOBA 1SFXA 2XGXA 2ELJA 3BROA 1B8IA 1FY7A 3S2DJ 1CF7B 1DQUA 3HRSA 2P5VA 3KZYA 4GDFA 4PFOA 1W1WE 3S1MJ 3DPLC 1JKRC 2DXIA 3TO7A 2FU4A 4LMYA 3S93A 2MLGA 1XB4A 1P4XA 4P96A 3F8MA 5M5XJ 5DEQA 2CQKA 4YFNF 5BQTA 3RSNA 3DCFA 3TO9A 2V79A 2M9HA 3GUDA 4I09A 3WU1B 1W36D 1ZRCA 4GFBA 3DBHB 2UUZA 4ENNA 4OIRF 1I6HJ 1LKXA 1B72A 2IBDA 1XG1A 2H8WA 2HDWA 2R7QA 2RNJA 3DF8A 1OCZH 5IOYA 2JUCA 2EFOA 4CYCA 3FBIB 5HDKA 3CCVI 2EV6A 3U2RA 4EJTA 1BI3A 5LLQA 1IN8A 5FKOA 4HX4A 3WE2A 4XLNF 1YRNB 2QF7A 3JCUC 1UCRA 4XRSA 4IHWA 1X3UA 2HS5A 3JRHA 2XGCA 2PX9A 4YELA 3S14J 1OPCA 1X58A 4EVIA 2ESHA 3BZCA 1RUNA 3RPQA 4PGGA 3ZQIA 1UZCA 3BR6A 3W6VA 1K83J 2LVSA 3K70C 4BACA 5EEAA 5HLGA 2EA2A 4CO8A 3E6CC 3CCRI 5JVGF 3G3ZA 4M9ZA 2EQRA 4RAZA 4UB6C 2M34A 2KRFA 4XLCA 1VQOI 2FSWA 1QVUA 4X1EA 1R22A 2OF7A 2JA8J 3PL8A 5KCMA 1K79A 3JREA 2IGKA 5BPDA 4KDPA 2LTPA 2OUMA 3CCYA 3IWFA 2PFBA 4FX0A 5BMZA 4FT8A 4BYYA 1JHHA 1HKSA 2DA4A 1SD5A 4HZFA 2X6WA 1I1GA 5HOOA 1Z3YA 2ZFUA 5IT3A 2VBWA 4PZJA 4XKWA 4A3LJ 5ICFA 2JRTA 2XUBA 3S2WA 3E6DA 4Q4ZF 4YFKF 5L3CA 1ZG3A 2A07F 3HUGB 3GW2A 4UV8A 3AG3H 2IVMA 3K9TA 5DUIA 3BQYA 3QPSA 1I27A 1ZK8A 4FETA 4E70A 2OPTA 3LFUA 4E7KA 1YRNA 4IF4A 3BLYA 2EIKH 3G6EI 2MA3A 4PSWA 1SVLA 2LH9A 2ZXWH 3E0JB 2HOTA 1H9GA 3IH3A 4II2A 1I50J 2V6CA 3GCMA 3AAFA 1G2HA 1PVEA 3QYEA 5A2QK 3KP2A 3DBLB 4M71A 2PJRA 2GZWA 3IRQA 4CHUA 1LEBA 4AWXB 1WCMJ 2HU9A 1TW3A 1HDDC 2LDUA 2JSCA 3BCBA 3DKWA 3DKXA 1VQ7I 3ELKA 1YX5A 4BH9A 4KITB 2CFOA 2RC4A 4HDVA 2P6TA 3CO7C 1YX3A 2LP0A 2QCOA 2OCCH 3IC7A 4Y17A 1ZR4A 2Z9OA 4NQWA 1XGSA 1YJNI 4CYCB 4BJ5C 3CC2I 1ETKA 3REOA 5HODA 4H0EA 1O4XA 2JA2A 3PQJA 2IPQX 1PP7U 4KT6A 1B72B 4LLLA 1BI2A 1AU7A 2L0KA 3KLOA 1T56A 5FD5A 2W48A 3S17J 4IRIA 4RGRA 5ILSA 4BAYA 3ZMUA 2R7UA 2DFFA 2KISA 1SC7A 2FQ3A 1B8IB 3JR9A 2DTRA 3KEQA 1O7FA 3OMYA 1XMXA 1R4MB 4OU0A 2OD5A 2DK5A 3P7NA 3LOCA 4KN4X 2HDDA 4HNVA 4M9XA 5CVIA 5ICEA 4CSWA 1BJZA 1BI1A 4P55A 4AC0A 1H0MA 3IAS2 1TP4A 2L54A 4KISA 4PK4A 3OYMA 1HKQA 2Z5UA 4JBAA 4B1RA 2OTJI 1Y56A 2O5RA 2R5YB 2E2IJ 3KYLA 2BVMA 3F9KA 1XTAA 2NRAC 3N05A 4CCMA 3I71A 3DFGA 3AL0C 3L09A 2JPBA 4CH7A 2A6HF 4KIFA 1YS6A 3GMEA 2ZO4A 4PGHA 1R4NB 5K5OA 4TV7A 1ZR2A 4J01A 2V1XA 3ZMZA 5F1RA 1D0XA 4HDUA 4EGYA 2A5WA 1TQPA 3DPUA 4UXNA 2CUEA 4XSXF 2L9RA 3FKJA 4YFXF 1G4DA 1I3AA 3PNYA 1LE8B 2D1HA 1OYIA 2VB6A 3GYHX 2GWRA 1S9HA 5CQGA 4F55A 5DV5A 4UY8I 4NC8A 4PJ0C 4Y15A 4B09A 2MLKA 4RB2C 2ZKZA 3LSIA 2HYJA 1Y8RB 2XIGA 4L5EA 1CGPA 4EGZA 4E7HA 5DD8A 2KDOA 2DU9A 2W24A 4EM1A 3EUAA 5K7HA 2BY0A 1MH4A 2HXIA 3DTEA 4M3DA 2DA5A 3BY6A 5LGNA 4RLFA 2XRLA 2V26A 2X4HA 3MAJA 1OCCH 2E1OA 1MNMC 2O6GE 2R7XA 2PQ8A 1I3QJ 2ICWG 2GOXB 5J4YA 2DJNA 4ENJA 1ZQ3P 3ZMDA 3UKGA 3VPRA 3F8NA 3Q0VA 1P4WA 3TBIA 3V4GA 4ZH4F 2PJPA 3B6AA 1G8XA 2QQ9A 1IXRC 4AYBA 3GTOJ 4ZC3A 5IP6A 1BW6A 2M0CA 2Y69H 2R7OA 3SZGA 3SEZA 1W7PA 3V7SA 4L18B 4U88A 3CESA 4UHTA 3GTGJ 4AIJA 2EZKA 2KQRA 1LUJB 1YOVB 2BBYA 5H6QA 1H9TA 3M7GA 5FRMA 1MJAA 3U1KA 1XGMA 2LOOA 1BL0A 1N75A 2UWMA 3ABMH 3GFMA 3ASOH 1U5TC 2VASA 2F4OB 4P1WA 2KDZA 4N9IA 4UV9A 5FGMA 4AIKA 2CW0F 1TW2A 1IO2A 1BOAA 2DLLA 3EUHA 3HBLA 3K1PA 3A03A 1WJFA 4OAYA 3FK6A 5D5UB 3SDGA 1USSA 3RQIA 4P9UA 5HLTA 2XPWA 3HKZA 4MO7A 3DTKA 4QIWN 3LSTA 4DZPA 3W3CA 2DBBA 4MHGA 4I2OA 3SQNA 2BHZA 5LD2C 1VQNI 3ECHA 2VOOA 4WCGA 5FKLA 2K85A 1LDDA 4M74A 3J80Z 3FHZA 2HEOA 5LRRA 3FXMA 3HOVJ 2HYGD 1FIPA 5FFZA 2W82A 3DV8A 3MVPA 3JTHA 3OYDA 3IH2A 2MD0A 1D0ZA 1VQ4I 1TZLA 2L4AA 1W7PD 1MJBA 4WXCA 3K1NA 5H6RA 1K4SA 1EV7A 4G7OF 3SXYA 3ERED 4IEJA 4L5JA 2CYYA 3CDLA 2DOEA 3CCMI 4B3XA 1ERDA 2MBFA 3H9GA 1K78A 2ZNZA 3WG7H 1IJWC 2A61A 3VWBA 4RGXA 2K9MA 2HQ5A 4Y3OA 5FJ8J 2EH3A 3PIPF 1K7AA 3BG9A 2O9LA 4MEXF 1XDUA 3L2QA 4XIDA 1LDKB 3GXOA 3HRTA 2DW4A 2ZXIA 1IN7A 2LSOA 3HPGA 2JT1A 2CGPA 2VONA 2FBKA 2VOPA 1GV5A 4I99C 1REPC 1IDYA 2OZ6A 3J7YJ 1R58A 2JVHA 3D0SA 1XCVA 2A6EF 4GYGA 3HG9A 2GXBA 2VJIA 2CUZA 1ZHFA 4RAYA 1ZG5A 3F6VA 3KCCA 4KMFA 1IN5A 1EJ9A 2XF7A 4N4NB 4C9YA 4F7ZA 1TBXA 3CF2A 3TMOA 4DGWB 2L3DA 2L9SA 2M87A 2X6YA 2OU2A 2B0LA 4A2UA 2B9SA 1D8JA 2HKOA 2OQRA 2X1DA 1A6IA 2L4MA 3KP3A 3R61A 2MABA 4IRHA 4WXHA 4Y33A 2WAFA 3BG7A 5DD4A 1VFCA 3MKWB 2VN2A 4HSRA 3GTKJ 3V8KA 1DGWY 3I59A 4NUBA 1OCPA 2Y30A 3HOXJ 1FWZA 1MBGA 3BZKA 3KP6A 4D5CA 2CMPA 2NXNB 2R92J 1O57A 3CUQA 3NQOA 2IS2A 4DOZA 5EEHA 5KNLA 1J09A 2YS9A 4G9YA 2BVLA 3WGGA 5CVUA 1WJDA 1D0YA 3ABKH 4RA2A 3G1MA 4BJTA 2EJRA 4UUSB 1V5GA 4U0VA 2MC4A 3L2CA 3FXJA 3BR0A 2VJ4A 3SJMA 2HPIA 1VZ0A 3R60A 1OJLA 3ERMA 2EPFA 3E5UA 4CDGA 1RC9A 2DDAA 2R5ZA 2I5UA 3BOQA 5JLXA 1M1EB 3JRGA 1ITYA 1WI9A 3LSKA 1DU6A 3J7AY 4MFEA 1F1ZA 2VKEA 3E97A 3HEFA 1Y6IA 4OIOF 1Z1DA 2WWYA 2D5VA 4F3QA 1AHDP 3VSKA 4YEJA 2M4KA 1AOYA 2M30A 1ACIA 1R9TJ 3A02A 1S7OA 4PJJA 1LFUP 4I76A 2YR2A 3M8FA 3BTIA 1UG2A 4W97A 2K3FA 5DCMA 2F5FA 1D5VA 2BXZA 1KQ8A 1L3LA 4AVPA 3AG4H 2JPCA 3JAMZ 3BJOA 4J19A 6PAXA 4ZDOA 2DYSH 4BE2A 2LF8A 2I8DA 1UJ8A 2W57A 3F8FA 1P7JA 1VQ5I 1R71A 2NNYA 2GOMA 5AIQA 3BPXA 2DMPA 2Q8KA 3WTXC 3W2VA 2LY2A 4BY7J 2VQGA 3KFWX 1S6LA 2IS4A 2DMQA 3ECOA 3W2AA 3TGNA 2FMLA 4I7HA 1OCOH 1JHFA 2R7TA 2DT5A 3D5SC 1QA6A 4AIDA 3QYFA 4IHSA 4CZZA 1HSTA 3E7LA 3ZMSA 2E35A 3F8BA 3PSFA 4NBQA 5CYVA 2OBPA 1MBKA 2XAGA 2ZSHB 4IVNA 5DTDA 3ZCOA 1ETWA 3KYCB 4XKVA 1TWCJ 4BUPA 2ZJRF 1HW2A 2HQAA 2IA2A 4RM2A 4Y52J 5EZHA 1U9NA 4H4KC 5IYBJ 2W00A 3PIOF 2MYSA 4ENMA 3QPTA 1FBQA 2HWVA 3CD6I 4BJ6C 4G6QA 1HW1A 3SFIA 4BY1J 5B5EC 3K4JA 3GF2A 1A36A 2GLOA 2CJJA 1X2MA 2TCTA 1SVMA 1VF9A 1ZTRA 3BG3A 1MDMA 2WB1N 4HNTA 2HQNA 4B4CA 4HF2A 4ZYDA 1HW5A 3J81K 3WTUC 5K5QA 2VKVA 3DEEA 4JK1X 5DDGA 3VDXA 4IJAA 1O3QA 1ONVA 1ZN2A 3JRDA 2QA4I 4ZYHA 2W85A 2XSJC 2Z16A 4KICA 3ZN0A 4ZYGA 5E1XA 3OYKA 1NHAA 5IT9K 4KFCA 3RIRA 2JN6A 3Q3SA 1E0EA 3H5NA 2L9NA 4YRVA 4OAZA 1R23A 3MQ0A 3OSFA 4XM3A 3D5LA 1XMKA 4AYBN 1USTA 3OYHA 2HVSA 2ZCWA 2ZB9A 5GTIC 4U7BA 2EV0A 3O6BB 5HS8A 4HRIA 3ESWB 3TL4X 2IEKA 4A5MA 4V2GA 1YLFA 3BJ6A 1ZGAA 1UAAA 3T0YA 5HDNA 1A5JA 2DI3A 1TTYA 3E5QA 5K7ZA 5FO5A 2G7HA 3GTPJ 3EUHC 1U9OA 3GTMJ 4CICA 2CRGA 1J59A 2DOFA 4CCLA 4CGZA 1B9MA 5D8KB 1IRZA 3ZGKA 1V5FA 2ZXJA 3ZQFA 3BZ6A 5KAIC 3ZQQA 2KRHA 2CG4A 2CO5A 3L00A 2R0QC 1H88C 4ESFA 1F5TA 4LLNA 1IN4A 1DGRM 4M9SA 1IUYA 1GLNA 4G12A 2EIMH 2BYVE 2L7KA 2XPUA 3RPUA 1TNSA 3O2PE 4I01A 4FQGA 5CQEA 1MDMB 3TOBA 1Q1HA 2LMDA 3ASNH 2MW8A 3HHHA 2QSHX 3HIFA 2BY2A 3VEPA 3VYRB 4L9VA 1BA5A 4C3JJ 1SFOJ 3DTIA 3OOPA 3EYYA 3H3UA 3MZYA 2RQQA 1BOBA 4ZTFA 3HOSA 3PO3J 4XRMA 1SEUA 2QM3A 3R0JA 3MKZA 2DQLA 2KIUA 1YG2A 4MEYF 2M4GA 4I0BA 2UZKA 2KZVA 3V8LA 4RAFA 4BE1A 4A12A 1D1AA 3I64A 4ASNA 1LQ1A 1QZEA 3Q9SA 3LL7A 4G7ZF 3J7ZI 4RMNA 2JTVA 4FTHA 1WH7A 3WU2C 1A6QA 1Z7LA 1PUFA 2DFEA 1T0FC 2K5CA 4WXDA 2X85A 2IS1A 4G94A 4HV6A 4A3EJ 1VTNC 2JSPA 2KPMA 4L0ZB 4ANJA 4HNUA 3HGYA 5KVRA 1HQCA 2KIQA 1KU9A 5CVRA 2LKSA 2V7FA 3VSLA 3VYSB 5EDNA 1SD7A 3CCSI 1J75A 1UELB 3OWTA 5IP7J 2M0MA 4JQFA 4D1QA 1Y39A 1U3EM 1C0WA 4DBQA 4OIQF 2H6CA 3CDHA 4EJUA 4C2MJ 2YX7A 3F0CA 3OR2C 3CDIA 4CCNA 1YYVA 3A0HC 1YTYA 1GVDA 2EK5A 5IOZA 1D3YA 4A3IJ 1APLC 3OL3A 2HKXA 4MFDA 4UB8C 2IJLA 2IA1A 3QU6A 3RKWA 3S8PA 3CO6C 1LE8A 2Z99A 2PLYA 2WB1A 2XAJA 4CUGA 4HF0A 2GXGA 3UNGC 1JJ8C 1FZPB 5JHUA 1R5ID 5CLSA 5L3FA 2EZLA 2BXYA 3L2RA 2VE9A 4ENKA 3JSOA 5B66C 3ZP5A 2DYRH 3V8JA 2LNBA 3DU5A 5EZGA 3QWLA 3W2WA 3QQAA 2M1BA 5CPRB 4PSXA 3CJTB 5DS9A 3DWLE 3QRFF 3CQZJ 3HHGA 1LFBA 3I56I 4A93J 1YQAA 4DQ2A 2E71A 2H94A 2XAFA 2ZC2A 3GLXA 2BHYA 4JX5A 4JP0A 4A6EA 1LJ9A 1DPRA 3O3KA 1TWHJ 3JRIA 3RYRA 3RKXA 2BY1A 3ZMVA 5EGOB 4II3A 3D1NI 3SYTA 5BS6A 1X1AA 1DP7P 4UVBA 3WTYC 1JT6A 4MQVA 1ZGWA 5EF6A 2CQNA 4M3EA 4U7DA 2YUSA 3IP4B 2OQGA 2LC2A 1Y1WJ 5TJJA 2R5YA 5J1YA 4AU7A 3HB9A 1WH5A 1GDTA 1U78A 4IQJA 2E2HJ 2A69F 2GA2A 2L01A 1WJ5A 3CP8A 1T98A 3K69A 2DQRA 2QSFX 1QZZA 2ELKA 2JWTA 2KKOA 2NS7A 3RTRA 2VIXA 5JLWA 3F22A 1GT0C 2LY9A 1TQIA 1MMSA 2OC6A 3FXQA 1I5ZA 5B1BH 2BGCA 3CF5F 1ZELA 4JX6A 2CV2A 1UFMA 1AKHA 4Z6YA 4U0YA 4BXUA 2QBYB 3DP7A 3FXUA 3TOAA 2Q2EB 3OS2A 1F36A 2O3FA 3FKIJ 2XAQA 3FDYA 3ZMTA 3I9V2 1KU2A 3RPUD 5M3FJ 2E1NA 3PUBA 1Z6TA 2IP2A 3HKZN 2DODA 2O03A 2PMUA 1OR7C 2JVGA 3EYIA 1OYYA 3E3VA 3KP5A 5FFXA 2HQRA 1RIOH 2GM4A 1BR4A 2R3SA 5J8FA 1DPUA 2PI0A 2CU7A 1RI7A 2Y0MA 1X3ZB 4RAGA 4R1HA 1ULYA 2DT7B 3K4CA 3T8RA 1FTZA 5FKMA 5D5XB 1W0UA 3H1CA 1SVOA 4S0HB 4BKXA 1UMQA 3VFZA 5LFAA 5F64A 3HM5A 2KHMA 1YJWI 1W7PB 4KUMA 5E79C 4DJAA 2WY8Q 1MGTA 4C3HJ 1MMAA 3M1EA 3FMQA 4HA8A 3JW4A 1WJAA 1LVAA 4A0ZA 2ECBA 3CUQB 4RM3A 4NNJA 4O6JA 3IWZA 1FP2A 4FX4A 2NS8A 3BR1A 3AKZA 2QQBA 3HSRA 1V3FA 3OR1C 2CQXA 4HPQA 2K3PA 4IPAA 4CA0A 1TWAJ 2ECCA 4HLYA 4A0YA 4UUSA 4XL9A 4EV0A 1XC5A 1QGPA 1FEXA 3O8HA 4BQNA 3DLLF 2E60A 3EDPA 1RR7A 4ZDPA 2STWA 1NG7A 2R7WA 2FA5A 3EQLF 2A3SA 2F2EA 4OOIA 1BM9A 3S3OA 4C2TA 1IZ1A 2WA0A 4EM2A 3JTGA 1JKQC 1RUOA 2OZUA 1BIBA 3PNTA 1ETXA 3RCOA 1T39A 4IKFA 4U87A 5GPCA 4A3KJ 4Z2YA 3BTJA 4B47A 3A01B 3WGIA 1D1BA 2LKPA 1A31A 2P8TA 3HZJA 2MH9A 2E1MC 3GEZA 4RLQA 3CUOA 3TW6A 5K5RA 4HQMA 2CQQA 2MFZA 2I10A 1U8BA 4I02A 3OYIA 3OS1A 2KL4A 2EINH 3K1MA 4B43A 4L9JA 2EFPA 3LFKA 4QTRA 5C44J 3GLLA 4XR6A 4X6AJ 3BJAA 2ZSIB 2X1EA 2V1NA 2XDVA 3J81Z 4E7IA 2O8XA 4RDUA 3L2WA 1RRJA 5HNHA 2HI3A 2KZGA 3TEDA 2CWEA 2MGQA 1NH3A 4L5IA 2FUG2 3KP4A 1IRGA 2ACJA 2WC2A 2ZNYA 3BTLA 3FISA 3G1LA 4HAMA 1D1CA 1K4TA 2XVCA 2J5OA 1MW7A 4AIHA 1MSFC 1N78A 3Q9VA 1Y0UA 1KYWA 5LHGA 2XB0X 1V54H 3RKYA 1RESA 2L7ZA 2QLZA 1FIAA 1FSHA 2HR3A 5E18F 2NVQJ 3LAJA 4EJWA 3WG9A 1XX5A 3MN2A 5L3EA 4GCVA 3QU3A 3ONQA 3HJEA 2ISZA 3OS0A 1SAUA 1SANA 5ILVA 3P9IA 4Y13A 2XHKA 1IRFA 4PUSA 1RKTA 3M07A 4DBRA 4OINF 1YS7A 2FJ1A 4BDYA 1MMGA 4RGSA 2HZDA 5DM7F 1BJAA 2XB5A 3BTCA 4I6ZA 3CJQB 5M5WJ 2LKXA 2DA1A 2NYXA 1V5EA 4NDLA 5LBQA 1WGXA 4L9TA 2LD5A 2Y2ZA 5GAHJ 4DYRA 4LG3A 5KHDA 2DT6A 1KQ0A 3WTSC 1A35A 4Y4RA 1XSDA 3IL2A 2BV6A 1WWXA 5D5VB 3CC4I 3HDDA 5HVQC 3ISPA 1KU7A 1YO5C 2HTSA 3IKTA 2Y31A 1QRYA 2ZMEA 5EEGA 4BHBA 3FIWA 2EV5A 3L2VA 3ZQLA 1Y8QB 4LK0F 5LEJA 5ED4A 1KYZA 4CCKA 3HL2A 1O3TA 1DDNA 2B7EA 4BU2A 2ISYA 2XRNA 5DUKA 4BNCA 3L7WA 1VQKI 2UXXA 3HPHA 2QVOA 4M6VA 3I4MJ 4IOAF 1IN6A 1GUUA 3ULQB 2W4SA 4I98B 3VOEA 2GXAA 5TRDA 1ZRDA 1JT0A 1FYMA 1FLIA 2JK3A 2DFIA 2VBYA 1K6OA 3CZ6A 4HX7A 2HFHA 2FE3A 2LG4A 2FEZA 2K86A 5ERIA 3BR2A 2A05A 2OAZA 2H8RA 2VJ5A 4E4HA 1ZLJA 4IX7A 4O5VA 1HCRA 1TQMA 2F5EA 3I53A 3K70D 4NQWB 1MMNA 3I0TA 5K1YA 3M3YJ 3D5RC 5HLHA 1Z6RA 3KPHA 1EF4A 1PYVA 2KIMA 4LOCA 4A6DA 3E6MA 3TDZC 3A01A 3M1CA 3HXLA 4HV5A 3ROUA 4A5NA 1WJCA 1WVRA 4CCOA 2PEXA 2IS6A 4L0YB 5J1UA 4MTDA 3KIOA 2VI6A 2FD5A 2Y0SN 1FYLA 3C2BA 2MC3A 3B6CA 3BP8A 4HSTA 5FKKA 3WGHA 5JHFA 4PJMA 1KA8A 3EPZA 2PJRB 1WI3A 1BR2A 2CS3A 3KYDB 1JTXA 2VT2A 5KK1A 3CCUI 4OMZA 3PJRA 4I0AA 4ZZDA 1JTYA 1Z0XA 1X1BA 2K40A 1SD4A 3BG5A 1JJ6C 1IXSB 2QBYA 5L3BA 2KJCA 2VPRA 3SHFA 2G9WA 3PQKA 1U5TB 2NOGA 1QVTA 3S32A 2UV1A 3HOZJ 1J5YA 5E3LA 1HBXG 4UNOA 1OLTA 3DXJF 2M2EA 3K0LA 1W36C 1HKTA 2V1DA 1EKEA 2KT0A 2DA6A 5GAGJ 3CCQI 4D7MA 2K7LA 2MG4A 4KYWA 3S2HJ 1LEAA 2KP6A 5EGOA 4MNUA 3S3NA 2XC7A 1W5TA 3HOWJ 5FLXZ 1RZ4A 1R36A 3CP2A 2G0EA 3NARA 1FNNA 3FK7A 5AIPA 5DCFA 4ETSA 4GGGA 5D5WB 3LSJA 4O3MA 5ICCA 5E3MA 2KJBA 4WF2A 1FJLA 1EH6A 3CCEI 3A1YA 1MD0A 4LLGF 3OYLA 1B4AA 3V7RA 1W5CC 3CMAI 1ETVA 2VQHA 2HTJA 2JQ7A 3S16J 1R49A 1Y0NA 2VLAA 3AFHA 5F0CA 2RREA 1ETQA 3KLNA 2QEXI 3K2AA 4PCQA 2L2OA 3S3MA 3TP3A 2L7FP 3TP0A 3WHCA 3L9FA 2BW3A 2H1KA 4JOMA 4BHPA 1XCBA 1LFPA 3GFLA 3C2HA 3DQVC 5J40A 3NAUA 2X48A 3NWTA 2LYCA 5FD6A 3SZPA 2QGUA 5D8LB 2VC1A 3JSPA 4NC7A 1WFXA 4B8XA 2XF5A 4XOPA 5GADJ 2MH2A 3FBNB 2EFWA 4IXAA 2W25A 2NVYJ 5J8CA 2L02A 2Y48A 4G8XA 5LHIA 2WAQA 5GPAA 1KQ9A 3C1DA 1JXSA 1F43A 1IG7A 3H9JA 2CUJA 1J0RA 2QWWA 1R5HA 1QU3A 2D1VA 1JE8A 5IPAA 2O8KA 1MMDA 2D45A 2ADUA 1SFEA 2DMNA 2L7MP 3E5XA 4E6KG 1Q1VA 4DW6A 3B02A 2XKOA 3TDUC 4A3FJ 1ETYA 3MZ8A 5D6FA 1ZREA 5IT9Z 5TGTA 2F4IA 1NG6A 3OIPA 3WHBA 2K02A 1GXQA 1K61A 2FBIA 2CH0A 3RI4A 1FMVA 5LEKA 4OIPF 2JA5J 1FP1D 3H92A 2F48A 2J5PA 2DO7A 1G3TA 4A69C 2A68F 3LMMA 4D9JA 5ICGA 1J7KA 1EA3A 3BR3A 3DU6A 2VL8A 2CFXA 3WTVC 3P9KA 2HPMA 4GXOA 1W0TA 3HSEA 1QO0D 1P4AA 3WU0A 2Y9YA 2V1UA 1FSEA 3QPHA 1KGSA 3UR3C 2K27A 4ZTJA 3WE3A 1E3HA 2LREA 1B6AA 2ELHA 1KU3A 3FHNA 1G3YA 1IAWA 2V9KA 3LQQA 3QP5A 2Z33A 1VQ8I 4HQEA 1E2XA 4FISA 1MBJA 2ZBKA 3I3LA 3BPVA 4NB5A 1S7AA 4CYDA 1O3RA 1TT0A 3VYTB 4XMYA 4WWCA 2DJIA 3HOUJ 5F0HA 3CJRB 4UVAA 4XNFA 1B9NA 5IYCJ 4ZZLA 1OCRH 2KFDA 2IGNA 4E7LA 4ABZA 4HG2A 4W1UA 1FMWA 5E1ZB 4ZJZA 3JRCA 4E7SA 2EZHA 3BDDA 4XKBA 1K6YA 1N77A 4KNYA 2XF6A 3HRUA 3KX2A 2XGEA 2ZFWA 4XORA 3MKLA 3L1PA 3I54A 5C3EJ 1I6XA 1JGGA 2F5DA 1BIAA 1PUFB 1UHWA 2ZJ2A 2LBFA 2JRMA 3GWZA 3DKYA 3K4KA 1QZYA 5CVVA 5LGTA 3S1NJ 3GX4X 1T08B 3OY9A 4CCJA 3A2KA 2HVQA 2OA4A 1MJ9A 1OFCX 3LSMA 4U0WA 3JAMK 3OYBA 5A2QZ 4QWQA 2EB7A 4XBFA 2XAHA 3FF5A 3N4MA 1HF0A 2NNNA 5FLXK 3BQZA 4LD5A 3R4KA 3CMMA 3FXKA 1E3PA 1MBFA 1MBHA 2VQLA 3F3XA 5F1JA 3ZRGA 3LAPA 4ITVA 1EH7A 2K4JA 1ZYRF 4YIRX 4G6DA 4PJLA 1HSJA 3OYNA 2OCEA 2Y9ZA 1I1SA 1AKHB 1R1UA 2V6EA 3OSGA 2VE8A 4A3CJ 3J7AO 5HS9A 3H0GJ 3FWEA 1ON1A 4IRGA 2Q1ZB 3A4CA 4XRSG 4BEHA 2H6BA 2V4JC 4V19K 1KZHA 2LY1A 3WODF 3ZR8X 2DPUA 3JRBA 5CVJA 1T6SA 5HDGA 2DAOA 4K2EA 2OV7A 4F92B 1HDPA 1XMAA 2L5QA 4FE7A 5E3OA 1HA8A 2ZMEC 2K9NA 1X19A 3PSIA 2DFHA 3VODA 4CXFA 1VI0A 4LFUA 1T95A 2FXAA 5LRSA 3SZTA 3P9CA 2YU3A 4XRFA 2VODA 2GIZA 4V2FA 4LJZF 3FXOA 2KMUA 2IA0A 2O61A 3AG1H 2H27A 2YX4A 1VNDA 3KP7A 2GIVA 3BG6A 2ME0A 4KIGA 2QQ8A 1T33A 1P6RA 3CJNA 3H5RA 2O0YA 3SFZA 3I55I 3ZPLA 3HC7A 1R1TA 3G73A 3ZN1A 2VBZA 3ABUA 3K10A 3LSPA 1SFKA 3E1SA 4A3JJ 1GV2A 2DOAA 3K4MA 4EJVA 4MIMA 4ZYEA 1RR8C 1QPMA 4HYEA 3N97A 1Z3XA 1P7IA 3AG2H 4WK8F 3EETA 1A04A 4IOCF 4BHCA 2ZMEB 1JKOC 2HOAA 1TL8A 2EILH 4BS9A 4M6XA 2CSOA 3JRFA 4A3BJ 1FTTA 3KZZA 1Z77A 2ID6A 1MBEA 1DU0A 3KEOA 2FF4A 3CC7I 2X6XA 4N0BA 3K6GA 4KJZA 3FMRA
chains in the Genus database with same CATH topology
3B73A 1Z7UA 2YSRA 2C6YA 1FC3A 3LA7A 2VC0A 2H09A 4S04A 3QAHA 1MKMA 4M73A 1ZRFA 2HGCA 4P9FA 5DYMA 4HX8A 3RJPA 1U8RA 3VB2A 1LDJA 2FOKA 2PN6A 2K4BA 1T38A 1FYKA 3BWGA 1Z9CA 1J9IA 5DCMB 1YIOA 5J6XA 3QOPA 3F8CA 1Z05A 1FOKA 2XV4S 3U9GA 2Q0OA 5D6EA 2WV0A 5CJ9A 2M8EA 4YIIA 1F4KA 5HS7A 1QNTA 3TKYA 1SFUA 4RGUA 1E17A 4HLXA 3LQRA 3FZVA 3T1BA 3I59B 3GVAA 5LHHA 4HW0A 1GVJA 2Z3YA 4HOBA 1GXPA 2P7VB 4KA4A 2D2WA 4QLCU 1IXCA 3V7CA 4HF1A 2PMHA 4YG2F 3FM5A 4ESJA 4N9HA 2FRHA 4M72A 4ESBA 5D4SA 2VBXA 4XSZF 3HTSB 3R6SA 4UUVA 2FNPA 4P5OA 4IHTA 1YW9A 2EWNA 1OR7A 1LB2A 1K78B 1G3WA 1S3JA 1PP8F 2IRFG 1Z91A 1GHCA 1SAXA 4R8HA 1OKRA 4EQQA 3HSFA 1BBYA 3GO5A 1DUXC 5JVTA 4YIFA 1WKMA 4KN7X 2X0LA 2P5LC 1B59A 1FBUA 2QZ8A 2JZYA 2GA1A 1YW7A 4L9NA 3GFJA 2PBIA 5AONA 1ZH5A 1T0FA 4DNCA 2M45A 5JI6A 2MD5A 5HLIA 2Q2EA 2E1CA 2NS0A 3PFIA 3M9AA 1RNLA 2M5WA 1XGNA 1STZA 3F21A 3FMSA 4Q5SF 2PG4A 2BEOA 1JGSA 3F23A 2TDXA 4M6YA 3IHUA 3GFIA 2UXNA 1ON2A 3LA3A 3I5UA 1QBJA 1FPQA 3DEUA 4D0PA 1XSXA 2DPDA 3LA2A 3R0AA 3TQNA 3COAC 1XN7A 4OMYA 4XLPF 2FNAA 3IRRA 3HUGA 4NHJA 4RB3C 1HXDA 4AD9A 4EM0B 1U6GA 4RB0A 2F5CA 2P6SA 2R7DA 4LG0A 1FT9A 1G3SA 4LG0B 5D4RA 4S05A 1P2FA 1IF1A 3M8EA 4EJOA 3MFKA 2BE5F 4LB6B 2G7UA 3Q5FA 1XSVA 1YW8A 2W84A 2AXLA 4RS8A 2FBHA 4RB1A 3OV8A 2P7CB 2ETHA 2E7XA 2XROA 1AWCA 2ESNA 3F72A 1TNTA 2EFNA 1F9NA 2RN7A 1WSUA 1QQIA 3MWMA 2HYFA 5E20A 2RVCA 2EFQA 3WTTC 3TO6A 1IW7F 1XGOA 2RDPA 2DK8A 4A0XA 4G7HF 4PDKA 3WTZA 3W6KB 3ZQ7A 2RQPA 4KT5C 3FXRA 3MCZA 1OMIA 1FBSA 1B1BA 1R5GA 4EMSA 1L0OC 2XASA 1ZAOA 3NEUA 3K2ZA 5F6FA 2FMYA 1U2WA 1CF7A 5JR3A 4Q48A 1SD6A 1ZLKA 3U1DA 5LGUA 2QENA 2RV8A 4FHTA 2YPRA 2RKHA 2QYOA 2IT0A 1UHMA 3IKVA 2RGVA 3CLOA 3GZ5A 2QQAA 3GZ6A 1S8NA 1R1VA 2XKPA 1V4RA 3C18A 5L3DA 2GAUA 1OYWA 1W4MA 5BPIA 2Y75A 2NAZA 1T2KA 1R7JA 5E8GA 4MQ9F 4MGRA 1PDNC 1G6NA 4KIBA 2WTEA 2V9VA 3NRVA 2HZTA 3KE2A 1W5SA 3WTWC 3C7JA 2EA4A 1FX7A 1ZG1A 5E1WA 3CUQC 2KIFA 1BC8C 3I58A 1D8KA 5L3GA 1SMTA 3I4PA 4GO1A 1U5TA 5FB2A 1WRJA 4KMUX 3RDIA 2P5KA 3QP6A 1ZARA 2A5YB 3FX3A 4Q47A 3ABTA 1TLHB 1S29A 3MZHA 2COMA 1XD7A 1YFHA 3DPTA 3FM3A 2AS5F 1ZGJA 2P4WA 2E7WA 3T8TA 4LB5A 1O3SA 3HRMA 1J2XA 5E17F 4R79A 3T5XA 1BC7C 2HOEA 3C3WA 4HBLA 1PUEE 4MTEA 4BQAA 1SMYF 4LGWA 3W6JB 5ILUA 2LF7A 4UVCA 2VXZA 1O7LA 4GYIA 4ON0A 4LK1F 5E8IA 4WX9A 3ML6A 1BN5A 3LWFA 1UB9A 2VT3A 2GQQA 1BI0A 2R7FA 3HYIA 1EH8A 2HDCA 5BOXA 1WQ2A 3HTUA 3E6BA 3MEXA 1XDSA 3CTAA 3KETA 1P92A 3J80K 5JFRA 1R00A 1MZBA 3H3ZA 2STTA 3HOTA 2IW5A 5H20A 3F6OA 1LNWA 3RYPA 2QUFA 1ODDA 1SFXA 2XGXA 3BROA 1FY7A 1CF7B 3HRSA 2P5VA 3KZYA 3DPLC 3TO7A 2FU4A 4LMYA 2MLGA 1XB4A 1P4XA 4P96A 3F8MA 5DEQA 2CQKA 4YFNF 5BQTA 3TO9A 2V79A 3GUDA 4I09A 3WU1B 1ZRCA 4ENNA 4OIRF 2RNJA 3DF8A 2EFOA 5HDKA 2EV6A 3U2RA 4EJTA 1BI3A 5LLQA 1IN8A 4HX4A 3WE2A 4XLNF 1UCRA 1X3UA 2HS5A 1OPCA 4EVIA 2ESHA 1RUNA 3RPQA 4PGGA 5HLGA 2EA2A 4CO8A 3E6CC 3G3ZA 4M9ZA 4RAZA 2KRFA 2FSWA 1R22A 1K79A 5BPDA 4KDPA 5BMZA 3IWFA 4FX0A 2PFBA 4FT8A 4BYYA 1JHHA 1HKSA 1SD5A 4HZFA 1I1GA 5HOOA 5IT3A 2VBWA 4PZJA 5ICFA 2JRTA 2XUBA 3S2WA 3E6DA 4Q4ZF 4YFKF 5L3CA 1ZG3A 2A07F 3GW2A 4UV8A 2IVMA 3K9TA 5DUIA 1I27A 4E70A 4IF4A 2MA3A 1H9GA 3AAFA 2V6CA 5A2QK 3KP2A 4M71A 4CHUA 2GZWA 3IRQA 1LEBA 4AWXB 1TW3A 2LDUA 2JSCA 3DKWA 3ELKA 4BH9A 2RC4A 4HDVA 2P6TA 3CO7C 3IC7A 4Y17A 2Z9OA 4NQWA 1XGSA 3REOA 4H0EA 3PQJA 2IPQX 1PP7U 4LLLA 1BI2A 3KLOA 5FD5A 4IRIA 4RGRA 5ILSA 4BAYA 3ZMUA 2FQ3A 2DTRA 3KEQA 1O7FA 4OU0A 2OD5A 2DK5A 3P7NA 4KN4X 4M9XA 5CVIA 5ICEA 1BI1A 4P55A 1H0MA 2L54A 1HKQA 2Z5UA 4JBAA 2NRAC 3I71A 3DFGA 3L09A 2JPBA 2A6HF 4KIFA 1YS6A 2ZO4A 4PGHA 5K5OA 4TV7A 2V1XA 3ZMZA 5F1RA 4HDUA 4EGYA 1TQPA 4UXNA 4XSXF 1G4DA 4YFXF 2D1HA 1OYIA 3GYHX 2GWRA 5DV5A 4Y15A 4B09A 2MLKA 4RB2C 2ZKZA 2XIGA 1CGPA 4EGZA 5DD8A 2DU9A 2W24A 4EM1A 3BY6A 5LGNA 2X4HA 3MAJA 2O6GE 2PQ8A 4ENJA 3ZMDA 3F8NA 2PJPA 1P4WA 3V4GA 4ZH4F 2QQ9A 1IXRC 3V7SA 1W7PA 4L18B 4U88A 4UHTA 4AIJA 5H6QA 2BBYA 1H9TA 3M7GA 1MJAA 1XGMA 2UWMA 3GFMA 1U5TC 4N9IA 4UV9A 5FGMA 4AIKA 2CW0F 1TW2A 3EUHA 1BOAA 2DLLA 3K1PA 5D5UB 1USSA 4P9UA 3LSTA 2DBBA 4MHGA 4I2OA 3SQNA 3ECHA 2VOOA 4WCGA 1LDDA 4M74A 3J80Z 3FHZA 2HEOA 5LRRA 2HYGD 5FFZA 3DV8A 3JTHA 2L4AA 1W7PD 1MJBA 4WXCA 3K1NA 5H6RA 1EV7A 4G7OF 3SXYA 3ERED 4L5JA 2CYYA 2MBFA 1K78A 2ZNZA 2A61A 4RGXA 1K7AA 4MEXF 1XDUA 1LDKB 3GXOA 2DW4A 3HRTA 1IN7A 2LSOA 2CGPA 2JT1A 2VONA 2FBKA 2VOPA 1REPC 2OZ6A 1R58A 3D0SA 1XCVA 2A6EF 4GYGA 2GXBA 1ZHFA 4RAYA 1ZG5A 3F6VA 3KCCA 4KMFA 1IN5A 4F7ZA 1TBXA 2L3DA 2M87A 4A2UA 2OU2A 2B0LA 1D8JA 2HKOA 2OQRA 2L4MA 3KP3A 3R61A 4IRHA 4WXHA 5DD4A 2VN2A 3V8KA 3I59A 1FWZA 3KP6A 1O57A 3CUQA 3NQOA 5EEHA 4G9YA 3WGGA 5CVUA 2EJRA 4U0VA 3L2CA 3R60A 3E5UA 4CDGA 3BOQA 1WI9A 1F1ZA 3E97A 4OIOF 1Z1DA 2WWYA 1AOYA 2M30A 1S7OA 2YR2A 3M8FA 5DCMA 2F5FA 1D5VA 1KQ8A 1L3LA 4AVPA 3JAMZ 2JPCA 3BJOA 6PAXA 2LF8A 2W57A 3F8FA 2NNYA 5AIQA 3BPXA 2Q8KA 3WTXC 3KFWX 1S6LA 3ECOA 3TGNA 2FMLA 4I7HA 1JHFA 2DT5A 4IHSA 4CZZA 1HSTA 3ZMSA 3F8BA 5CYVA 2OBPA 2XAGA 4IVNA 1HW2A 2IA2A 4ENMA 3QPTA 1FBQA 2HWVA 4G6QA 1HW1A 3GF2A 1MDMA 2HQNA 4HF2A 4ZYDA 1HW5A 3WTUC 3J81K 5K5QA 4JK1X 5DDGA 4IJAA 1O3QA 1ONVA 1ZN2A 4ZYHA 2W85A 4KICA 3ZN0A 4ZYGA 5E1XA 1NHAA 5IT9K 4KFCA 3RIRA 1R23A 3MQ0A 3D5LA 1XMKA 1USTA 2ZCWA 4U7BA 2EV0A 3O6BB 5HS8A 4A5MA 1YLFA 3BJ6A 1ZGAA 3T0YA 5HDNA 2DI3A 1TTYA 3E5QA 5FO5A 2G7HA 4CICA 1J59A 4CGZA 1B9MA 5D8KB 2ZXJA 3BZ6A 2CG4A 2CO5A 3L00A 4LLNA 4ESFA 1F5TA 1IN4A 1IUYA 4M9SA 2BYVE 3RPUA 1TNSA 3O2PE 4I01A 1MDMB 3TOBA 1Q1HA 3HHHA 3HIFA 3VEPA 4L9VA 3OOPA 3EYYA 3H3UA 3MZYA 3HOSA 2QM3A 3R0JA 2DQLA 2KIUA 1YG2A 4MEYF 4I0BA 2UZKA 3V8LA 4A12A 3I64A 4ASNA 1LQ1A 3Q9SA 4G7ZF 2JTVA 4WXDA 4G94A 4HV6A 1VTNC 4L0ZB 5KVRA 1HQCA 1KU9A 5CVRA 1J75A 1SD7A 4JQFA 1U3EM 1C0WA 4OIQF 2H6CA 3CDHA 4EJUA 2YX7A 1YYVA 1YTYA 2EK5A 1D3YA 2HKXA 3CO6C 2IJLA 2IA1A 3QU6A 3RKWA 2Z99A 2PLYA 2XAJA 4HF0A 2GXGA 1FZPB 5JHUA 5CLSA 5L3FA 2VE9A 4ENKA 3JSOA 3ZP5A 3V8JA 2LNBA 2M1BA 3QRFF 3HHGA 1YQAA 4DQ2A 2H94A 2XAFA 3GLXA 4A6EA 1LJ9A 1DPRA 3O3KA 3RYRA 3RKXA 3ZMVA 5BS6A 1DP7P 4UVBA 3WTYC 4MQVA 4U7DA 2OQGA 5TJJA 1U78A 2A69F 2GA2A 2L01A 1T98A 3RTRA 3K69A 2DQRA 1QZZA 2KKOA 3F22A 1TQIA 3FXQA 1I5ZA 2BGCA 1UFMA 4U0YA 4BXUA 2QBYB 3DP7A 3FXUA 3TOAA 2O3FA 2XAQA 3ZMTA 1KU2A 2E1NA 1Z6TA 2IP2A 2O03A 2PMUA 3EYIA 1OYYA 3E3VA 3KP5A 5FFXA 2HQRA 1RIOH 1DPUA 5J8FA 2R3SA 2PI0A 1RI7A 2Y0MA 4R1HA 1ULYA 3T8RA 5D5XB 3VFZA 5F64A 1W7PB 4KUMA 1MGTA 3M1EA 3FMQA 4HA8A 3JW4A 1LVAA 4A0ZA 3CUQB 4O6JA 3IWZA 1FP2A 4FX4A 2QQBA 3HSRA 1V3FA 4IPAA 4HLYA 4A0YA 4EV0A 1QGPA 3EDPA 2STWA 2FA5A 3EQLF 2A3SA 2F2EA 4OOIA 1BM9A 1IZ1A 4EM2A 3JTGA 1RUOA 2OZUA 1BIBA 1T39A 4Z2YA 3WGIA 2LKPA 2P8TA 2MH9A 3GEZA 5K5RA 3CUOA 4HQMA 4I02A 3K1MA 4L9JA 2EFPA 3LFKA 3BJAA 3J81Z 2O8XA 2CWEA 4L5IA 3KP4A 1IRGA 2ACJA 2WC2A 2ZNYA 4HAMA 2XVCA 2J5OA 4AIHA 3Q9VA 1Y0UA 1KYWA 5LHGA 3RKYA 2QLZA 1FSHA 2HR3A 5E18F 3LAJA 4EJWA 3WG9A 5L3EA 4GCVA 3QU3A 2ISZA 5ILVA 3P9IA 4Y13A 2XHKA 1IRFA 4OINF 1YS7A 4RGSA 1BJAA 2NYXA 5LBQA 4L9TA 1KQ0A 3WTSC 1XSDA 3IL2A 2BV6A 1WWXA 5D5VB 5HVQC 3ISPA 1KU7A 1YO5C 2HTSA 3IKTA 2ZMEA 5EEGA 4BHBA 2EV5A 4LK0F 5LEJA 5ED4A 1KYZA 1O3TA 1DDNA 2ISYA 2XRNA 5DUKA 4BNCA 3L7WA 2UXXA 2QVOA 1IN6A 3ULQB 4I98B 3VOEA 5TRDA 1ZRDA 1FYMA 1FLIA 2DFIA 2VBYA 1K6OA 4HX7A 2HFHA 2FE3A 2FEZA 2K86A 5ERIA 2OAZA 1ZLJA 4O5VA 1TQMA 2F5EA 3I53A 3I0TA 5K1YA 5HLHA 1Z6RA 2KIMA 4A6DA 3E6MA 3TDZC 4HV5A 3ROUA 4A5NA 2PEXA 4L0YB 4MTDA 1FYLA 2MC3A 3BP8A 3WGHA 1KA8A 2VT2A 5KK1A 4OMZA 4I0AA 4ZZDA 1SD4A 1IXSB 2QBYA 5L3BA 2KJCA 3SHFA 2G9WA 3PQKA 1U5TB 1J5YA 1HBXG 4UNOA 3DXJF 3K0LA 1HKTA 2V1DA 2K7LA 4KYWA 1LEAA 4MNUA 1W5TA 5FLXZ 1RZ4A 1R36A 1FNNA 5AIPA 5DCFA 4ETSA 4GGGA 5D5WB 4O3MA 5ICCA 2KJBA 4WF2A 1EH6A 1MD0A 4LLGF 1B4AA 3V7RA 2HTJA 3KLNA 4PCQA 3L9FA 4BHPA 1XCBA 3GFLA 3DQVC 5FD6A 3SZPA 5D8LB 2VC1A 3JSPA 4B8XA 2MH2A 2EFWA 4IXAA 2W25A 5J8CA 2L02A 2Y48A 4G8XA 5LHIA 1KQ9A 3C1DA 1JXSA 1J0RA 2QWWA 1R5HA 2D1VA 1JE8A 2D45A 2ADUA 1SFEA 3E5XA 3B02A 2XKOA 3TDUC 5D6FA 1ZREA 5IT9Z 2K02A 1GXQA 2FBIA 3RI4A 5LEKA 4OIPF 1FP1D 3H92A 2J5PA 2DO7A 1G3TA 2A68F 5ICGA 1J7KA 2CFXA 3WTVC 3P9KA 4GXOA 3HSEA 1QO0D 1P4AA 3WU0A 2V1UA 1FSEA 3QPHA 1KGSA 2K27A 3WE3A 1B6AA 2ELHA 1KU3A 1G3YA 1IAWA 3LQQA 3QP5A 2Z33A 4HQEA 1E2XA 2ZBKA 3BPVA 4NB5A 1S7AA 4CYDA 1O3RA 4WWCA 4UVAA 1B9NA 4ZZLA 5E1ZB 3BDDA 4KNYA 3HRUA 2ZFWA 3I54A 1I6XA 2F5DA 1BIAA 1UHWA 2ZJ2A 3GWZA 5CVVA 5LGTA 1QZYA 3GX4X 2OA4A 1MJ9A 3JAMK 4U0WA 5A2QZ 4QWQA 2EB7A 4XBFA 2XAHA 3FF5A 3N4MA 5FLXK 2NNNA 4LD5A 3R4KA 3F3XA 3LAPA 1EH7A 2K4JA 1ZYRF 4G6DA 1HSJA 1I1SA 1R1UA 2VE8A 3J7AO 5HS9A 3FWEA 1ON1A 4IRGA 2H6BA 3WODF 2DPUA 5CVJA 1T6SA 5HDGA 2DAOA 4K2EA 1XMAA 3VODA 5LRSA 4CXFA 4LFUA 2FXAA 2VODA 3SZTA 3P9CA 2YU3A 4XRFA 4LJZF 2O61A 2IA0A 2H27A 2YX4A 3KP7A 2GIVA 4KIGA 1P6RA 3CJNA 2O0YA 3SFZA 3ZPLA 1R1TA 3G73A 3ZN1A 2VBZA 3ABUA 4EJVA 4ZYEA 1QPMA 4HYEA 3N97A 4WK8F 3EETA 1A04A 4BHCA 2ZMEB 4M6XA 2CSOA 3KZZA 3KEOA 2FF4A 4N0BA 3FMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B73 A;  1Z7U A;  2YSR A;  2C6Y A;  1FC3 A;  3LA7 A;  2VC0 A;  2H09 A;  4S04 A;  3QAH A;  1MKM A;  4M73 A;  1ZRF A;  2HGC A;  4P9F A;  5DYM A;  4HX8 A;  3RJP A;  1U8R A;  3VB2 A;  1LDJ A;  2FOK A;  2PN6 A;  2K4B A;  1T38 A;  1FYK A;  3BWG A;  1Z9C A;  1J9I A;  5DCM B;  1YIO A;  5J6X A;  3QOP A;  3F8C A;  1Z05 A;  1FOK A;  2XV4 S;  3U9G A;  2Q0O A;  5D6E A;  2WV0 A;  5CJ9 A;  2M8E A;  4YII A;  1F4K A;  5HS7 A;  1QNT A;  3TKY A;  1SFU A;  4RGU A;  1E17 A;  4HLX A;  3LQR A;  3FZV A;  3T1B A;  3I59 B;  3GVA A;  5LHH A;  4HW0 A;  1GVJ A;  2Z3Y A;  4HOB A;  1GXP A;  2P7V B;  4KA4 A;  2D2W A;  4QLC U;  1IXC A;  3V7C A;  4HF1 A;  2PMH A;  4YG2 F;  3FM5 A;  4ESJ A;  4N9H A;  2FRH A;  4M72 A;  4ESB A;  5D4S A;  2VBX A;  4XSZ F;  3HTS B;  3R6S A;  4UUV A;  2FNP A;  4P5O A;  4IHT A;  1YW9 A;  2EWN A;  1OR7 A;  1LB2 A;  1K78 B;  1G3W A;  1S3J A;  1PP8 F;  2IRF G;  1Z91 A;  1GHC A;  1SAX A;  4R8H A;  1OKR A;  4EQQ A;  3HSF A;  1BBY A;  3GO5 A;  1DUX C;  5JVT A;  4YIF A;  1WKM A;  4KN7 X;  2X0L A;  2P5L C;  1B59 A;  1FBU A;  2QZ8 A;  2JZY A;  2GA1 A;  1YW7 A;  4L9N A;  3GFJ A;  2PBI A;  5AON A;  1ZH5 A;  1T0F A;  4DNC A;  2M45 A;  5JI6 A;  2MD5 A;  5HLI A;  2Q2E A;  2E1C A;  2NS0 A;  3PFI A;  3M9A A;  1RNL A;  2M5W A;  1XGN A;  1STZ A;  3F21 A;  3FMS A;  4Q5S F;  2PG4 A;  2BEO A;  1JGS A;  3F23 A;  2TDX A;  4M6Y A;  3IHU A;  3GFI A;  2UXN A;  1ON2 A;  3LA3 A;  3I5U A;  1QBJ A;  1FPQ A;  3DEU A;  4D0P A;  1XSX A;  2DPD A;  3LA2 A;  3R0A A;  3TQN A;  3COA C;  1XN7 A;  4OMY A;  4XLP F;  2FNA A;  3IRR A;  3HUG A;  4NHJ A;  4RB3 C;  1HXD A;  4AD9 A;  4EM0 B;  1U6G A;  4RB0 A;  2F5C A;  2P6S A;  2R7D A;  4LG0 A;  1FT9 A;  1G3S A;  4LG0 B;  5D4R A;  4S05 A;  1P2F A;  1IF1 A;  3M8E A;  4EJO A;  3MFK A;  2BE5 F;  4LB6 B;  2G7U A;  3Q5F A;  1XSV A;  1YW8 A;  2W84 A;  2AXL A;  4RS8 A;  2FBH A;  4RB1 A;  3OV8 A;  2P7C B;  2ETH A;  2E7X A;  2XRO A;  1AWC A;  2ESN A;  3F72 A;  1TNT A;  2EFN A;  1F9N A;  2RN7 A;  1WSU A;  1QQI A;  3MWM A;  2HYF A;  5E20 A;  2RVC A;  2EFQ A;  3WTT C;  3TO6 A;  1IW7 F;  1XGO A;  2RDP A;  2DK8 A;  4A0X A;  4G7H F;  4PDK A;  3WTZ A;  3W6K B;  3ZQ7 A;  2RQP A;  4KT5 C;  3FXR A;  3MCZ A;  1OMI A;  1FBS A;  1B1B A;  1R5G A;  4EMS A;  1L0O C;  2XAS A;  1ZAO A;  3NEU A;  3K2Z A;  5F6F A;  2FMY A;  1U2W A;  1CF7 A;  5JR3 A;  4Q48 A;  1SD6 A;  1ZLK A;  3U1D A;  5LGU A;  2QEN A;  2RV8 A;  4FHT A;  2YPR A;  2RKH A;  2QYO A;  2IT0 A;  1UHM A;  3IKV A;  2RGV A;  3CLO A;  3GZ5 A;  2QQA A;  3GZ6 A;  1S8N A;  1R1V A;  2XKP A;  1V4R A;  3C18 A;  5L3D A;  2GAU A;  1OYW A;  1W4M A;  5BPI A;  2Y75 A;  2NAZ A;  1T2K A;  1R7J A;  5E8G A;  4MQ9 F;  4MGR A;  1PDN C;  1G6N A;  4KIB A;  2WTE A;  2V9V A;  3NRV A;  2HZT A;  3KE2 A;  1W5S A;  3WTW C;  3C7J A;  2EA4 A;  1FX7 A;  1ZG1 A;  5E1W A;  3CUQ C;  2KIF A;  1BC8 C;  3I58 A;  1D8K A;  5L3G A;  1SMT A;  3I4P A;  4GO1 A;  1U5T A;  5FB2 A;  1WRJ A;  4KMU X;  3RDI A;  2P5K A;  3QP6 A;  1ZAR A;  2A5Y B;  3FX3 A;  4Q47 A;  3ABT A;  1TLH B;  1S29 A;  3MZH A;  2COM A;  1XD7 A;  1YFH A;  3DPT A;  3FM3 A;  2AS5 F;  1ZGJ A;  2P4W A;  2E7W A;  3T8T A;  4LB5 A;  1O3S A;  3HRM A;  1J2X A;  5E17 F;  4R79 A;  3T5X A;  1BC7 C;  2HOE A;  3C3W A;  4HBL A;  1PUE E;  4MTE A;  4BQA A;  1SMY F;  4LGW A;  3W6J B;  5ILU A;  2LF7 A;  4UVC A;  2VXZ A;  1O7L A;  4GYI A;  4ON0 A;  4LK1 F;  5E8I A;  4WX9 A;  3ML6 A;  1BN5 A;  3LWF A;  1UB9 A;  2VT3 A;  2GQQ A;  1BI0 A;  2R7F A;  3HYI A;  1EH8 A;  2HDC A;  5BOX A;  1WQ2 A;  3HTU A;  3E6B A;  3MEX A;  1XDS A;  3CTA A;  3KET A;  1P92 A;  3J80 K;  5JFR A;  1R00 A;  1MZB A;  3H3Z A;  2STT A;  3HOT A;  2IW5 A;  5H20 A;  3F6O A;  1LNW A;  3RYP A;  2QUF A;  1ODD A;  1SFX A;  2XGX A;  3BRO A;  1FY7 A;  1CF7 B;  3HRS A;  2P5V A;  3KZY A;  3DPL C;  3TO7 A;  2FU4 A;  4LMY A;  2MLG A;  1XB4 A;  1P4X A;  4P96 A;  3F8M A;  5DEQ A;  2CQK A;  4YFN F;  5BQT A;  3TO9 A;  2V79 A;  3GUD A;  4I09 A;  3WU1 B;  1ZRC A;  4ENN A;  4OIR F;  2RNJ A;  3DF8 A;  2EFO A;  5HDK A;  2EV6 A;  3U2R A;  4EJT A;  1BI3 A;  5LLQ A;  1IN8 A;  4HX4 A;  3WE2 A;  4XLN F;  1UCR A;  1X3U A;  2HS5 A;  1OPC A;  4EVI A;  2ESH A;  1RUN A;  3RPQ A;  4PGG A;  5HLG A;  2EA2 A;  4CO8 A;  3E6C C;  3G3Z A;  4M9Z A;  4RAZ A;  2KRF A;  2FSW A;  1R22 A;  1K79 A;  5BPD A;  4KDP A;  5BMZ A;  3IWF A;  4FX0 A;  2PFB A;  4FT8 A;  4BYY A;  1JHH A;  1HKS A;  1SD5 A;  4HZF A;  1I1G A;  5HOO A;  5IT3 A;  2VBW A;  4PZJ A;  5ICF A;  2JRT A;  2XUB A;  3S2W A;  3E6D A;  4Q4Z F;  4YFK F;  5L3C A;  1ZG3 A;  2A07 F;  3GW2 A;  4UV8 A;  2IVM A;  3K9T A;  5DUI A;  1I27 A;  4E70 A;  4IF4 A;  2MA3 A;  1H9G A;  3AAF A;  2V6C A;  5A2Q K;  3KP2 A;  4M71 A;  4CHU A;  2GZW A;  3IRQ A;  1LEB A;  4AWX B;  1TW3 A;  2LDU A;  2JSC A;  3DKW A;  3ELK A;  4BH9 A;  2RC4 A;  4HDV A;  2P6T A;  3CO7 C;  3IC7 A;  4Y17 A;  2Z9O A;  4NQW A;  1XGS A;  3REO A;  4H0E A;  3PQJ A;  2IPQ X;  1PP7 U;  4LLL A;  1BI2 A;  3KLO A;  5FD5 A;  4IRI A;  4RGR A;  5ILS A;  4BAY A;  3ZMU A;  2FQ3 A;  2DTR A;  3KEQ A;  1O7F A;  4OU0 A;  2OD5 A;  2DK5 A;  3P7N A;  4KN4 X;  4M9X A;  5CVI A;  5ICE A;  1BI1 A;  4P55 A;  1H0M A;  2L54 A;  1HKQ A;  2Z5U A;  4JBA A;  2NRA C;  3I71 A;  3DFG A;  3L09 A;  2JPB A;  2A6H F;  4KIF A;  1YS6 A;  2ZO4 A;  4PGH A;  5K5O A;  4TV7 A;  2V1X A;  3ZMZ A;  5F1R A;  4HDU A;  4EGY A;  1TQP A;  4UXN A;  4XSX F;  1G4D A;  4YFX F;  2D1H A;  1OYI A;  3GYH X;  2GWR A;  5DV5 A;  4Y15 A;  4B09 A;  2MLK A;  4RB2 C;  2ZKZ A;  2XIG A;  1CGP A;  4EGZ A;  5DD8 A;  2DU9 A;  2W24 A;  4EM1 A;  3BY6 A;  5LGN A;  2X4H A;  3MAJ A;  2O6G E;  2PQ8 A;  4ENJ A;  3ZMD A;  3F8N A;  2PJP A;  1P4W A;  3V4G A;  4ZH4 F;  2QQ9 A;  1IXR C;  3V7S A;  1W7P A;  4L18 B;  4U88 A;  4UHT A;  4AIJ A;  5H6Q A;  2BBY A;  1H9T A;  3M7G A;  1MJA A;  1XGM A;  2UWM A;  3GFM A;  1U5T C;  4N9I A;  4UV9 A;  5FGM A;  4AIK A;  2CW0 F;  1TW2 A;  3EUH A;  1BOA A;  2DLL A;  3K1P A;  5D5U B;  1USS A;  4P9U A;  3LST A;  2DBB A;  4MHG A;  4I2O A;  3SQN A;  3ECH A;  2VOO A;  4WCG A;  1LDD A;  4M74 A;  3J80 Z;  3FHZ A;  2HEO A;  5LRR A;  2HYG D;  5FFZ A;  3DV8 A;  3JTH A;  2L4A A;  1W7P D;  1MJB A;  4WXC A;  3K1N A;  5H6R A;  1EV7 A;  4G7O F;  3SXY A;  3ERE D;  4L5J A;  2CYY A;  2MBF A;  1K78 A;  2ZNZ A;  2A61 A;  4RGX A;  1K7A A;  4MEX F;  1XDU A;  1LDK B;  3GXO A;  2DW4 A;  3HRT A;  1IN7 A;  2LSO A;  2CGP A;  2JT1 A;  2VON A;  2FBK A;  2VOP A;  1REP C;  2OZ6 A;  1R58 A;  3D0S A;  1XCV A;  2A6E F;  4GYG A;  2GXB A;  1ZHF A;  4RAY A;  1ZG5 A;  3F6V A;  3KCC A;  4KMF A;  1IN5 A;  4F7Z A;  1TBX A;  2L3D A;  2M87 A;  4A2U A;  2OU2 A;  2B0L A;  1D8J A;  2HKO A;  2OQR A;  2L4M A;  3KP3 A;  3R61 A;  4IRH A;  4WXH A;  5DD4 A;  2VN2 A;  3V8K A;  3I59 A;  1FWZ A;  3KP6 A;  1O57 A;  3CUQ A;  3NQO A;  5EEH A;  4G9Y A;  3WGG A;  5CVU A;  2EJR A;  4U0V A;  3L2C A;  3R60 A;  3E5U A;  4CDG A;  3BOQ A;  1WI9 A;  1F1Z A;  3E97 A;  4OIO F;  1Z1D A;  2WWY A;  1AOY A;  2M30 A;  1S7O A;  2YR2 A;  3M8F A;  5DCM A;  2F5F A;  1D5V A;  1KQ8 A;  1L3L A;  4AVP A;  3JAM Z;  2JPC A;  3BJO A;  6PAX A;  2LF8 A;  2W57 A;  3F8F A;  2NNY A;  5AIQ A;  3BPX A;  2Q8K A;  3WTX C;  3KFW X;  1S6L A;  3ECO A;  3TGN A;  2FML A;  4I7H A;  1JHF A;  2DT5 A;  4IHS A;  4CZZ A;  1HST A;  3ZMS A;  3F8B A;  5CYV A;  2OBP A;  2XAG A;  4IVN A;  1HW2 A;  2IA2 A;  4ENM A;  3QPT A;  1FBQ A;  2HWV A;  4G6Q A;  1HW1 A;  3GF2 A;  1MDM A;  2HQN A;  4HF2 A;  4ZYD A;  1HW5 A;  3WTU C;  3J81 K;  5K5Q A;  4JK1 X;  5DDG A;  4IJA A;  1O3Q A;  1ONV A;  1ZN2 A;  4ZYH A;  2W85 A;  4KIC A;  3ZN0 A;  4ZYG A;  5E1X A;  1NHA A;  5IT9 K;  4KFC A;  3RIR A;  1R23 A;  3MQ0 A;  3D5L A;  1XMK A;  1UST A;  2ZCW A;  4U7B A;  2EV0 A;  3O6B B;  5HS8 A;  4A5M A;  1YLF A;  3BJ6 A;  1ZGA A;  3T0Y A;  5HDN A;  2DI3 A;  1TTY A;  3E5Q A;  5FO5 A;  2G7H A;  4CIC A;  1J59 A;  4CGZ A;  1B9M A;  5D8K B;  2ZXJ A;  3BZ6 A;  2CG4 A;  2CO5 A;  3L00 A;  4LLN A;  4ESF A;  1F5T A;  1IN4 A;  1IUY A;  4M9S A;  2BYV E;  3RPU A;  1TNS A;  3O2P E;  4I01 A;  1MDM B;  3TOB A;  1Q1H A;  3HHH A;  3HIF A;  3VEP A;  4L9V A;  3OOP A;  3EYY A;  3H3U A;  3MZY A;  3HOS A;  2QM3 A;  3R0J A;  2DQL A;  2KIU A;  1YG2 A;  4MEY F;  4I0B A;  2UZK A;  3V8L A;  4A12 A;  3I64 A;  4ASN A;  1LQ1 A;  3Q9S A;  4G7Z F;  2JTV A;  4WXD A;  4G94 A;  4HV6 A;  1VTN C;  4L0Z B;  5KVR A;  1HQC A;  1KU9 A;  5CVR A;  1J75 A;  1SD7 A;  4JQF A;  1U3E M;  1C0W A;  4OIQ F;  2H6C A;  3CDH A;  4EJU A;  2YX7 A;  1YYV A;  1YTY A;  2EK5 A;  1D3Y A;  2HKX A;  3CO6 C;  2IJL A;  2IA1 A;  3QU6 A;  3RKW A;  2Z99 A;  2PLY A;  2XAJ A;  4HF0 A;  2GXG A;  1FZP B;  5JHU A;  5CLS A;  5L3F A;  2VE9 A;  4ENK A;  3JSO A;  3ZP5 A;  3V8J A;  2LNB A;  2M1B A;  3QRF F;  3HHG A;  1YQA A;  4DQ2 A;  2H94 A;  2XAF A;  3GLX A;  4A6E A;  1LJ9 A;  1DPR A;  3O3K A;  3RYR A;  3RKX A;  3ZMV A;  5BS6 A;  1DP7 P;  4UVB A;  3WTY C;  4MQV A;  4U7D A;  2OQG A;  5TJJ A;  1U78 A;  2A69 F;  2GA2 A;  2L01 A;  1T98 A;  3RTR A;  3K69 A;  2DQR A;  1QZZ A;  2KKO A;  3F22 A;  1TQI A;  3FXQ A;  1I5Z A;  2BGC A;  1UFM A;  4U0Y A;  4BXU A;  2QBY B;  3DP7 A;  3FXU A;  3TOA A;  2O3F A;  2XAQ A;  3ZMT A;  1KU2 A;  2E1N A;  1Z6T A;  2IP2 A;  2O03 A;  2PMU A;  3EYI A;  1OYY A;  3E3V A;  3KP5 A;  5FFX A;  2HQR A;  1RIO H;  1DPU A;  5J8F A;  2R3S A;  2PI0 A;  1RI7 A;  2Y0M A;  4R1H A;  1ULY A;  3T8R A;  5D5X B;  3VFZ A;  5F64 A;  1W7P B;  4KUM A;  1MGT A;  3M1E A;  3FMQ A;  4HA8 A;  3JW4 A;  1LVA A;  4A0Z A;  3CUQ B;  4O6J A;  3IWZ A;  1FP2 A;  4FX4 A;  2QQB A;  3HSR A;  1V3F A;  4IPA A;  4HLY A;  4A0Y A;  4EV0 A;  1QGP A;  3EDP A;  2STW A;  2FA5 A;  3EQL F;  2A3S A;  2F2E A;  4OOI A;  1BM9 A;  1IZ1 A;  4EM2 A;  3JTG A;  1RUO A;  2OZU A;  1BIB A;  1T39 A;  4Z2Y A;  3WGI A;  2LKP A;  2P8T A;  2MH9 A;  3GEZ A;  5K5R A;  3CUO A;  4HQM A;  4I02 A;  3K1M A;  4L9J A;  2EFP A;  3LFK A;  3BJA A;  3J81 Z;  2O8X A;  2CWE A;  4L5I A;  3KP4 A;  1IRG A;  2ACJ A;  2WC2 A;  2ZNY A;  4HAM A;  2XVC A;  2J5O A;  4AIH A;  3Q9V A;  1Y0U A;  1KYW A;  5LHG A;  3RKY A;  2QLZ A;  1FSH A;  2HR3 A;  5E18 F;  3LAJ A;  4EJW A;  3WG9 A;  5L3E A;  4GCV A;  3QU3 A;  2ISZ A;  5ILV A;  3P9I A;  4Y13 A;  2XHK A;  1IRF A;  4OIN F;  1YS7 A;  4RGS A;  1BJA A;  2NYX A;  5LBQ A;  4L9T A;  1KQ0 A;  3WTS C;  1XSD A;  3IL2 A;  2BV6 A;  1WWX A;  5D5V B;  5HVQ C;  3ISP A;  1KU7 A;  1YO5 C;  2HTS A;  3IKT A;  2ZME A;  5EEG A;  4BHB A;  2EV5 A;  4LK0 F;  5LEJ A;  5ED4 A;  1KYZ A;  1O3T A;  1DDN A;  2ISY A;  2XRN A;  5DUK A;  4BNC A;  3L7W A;  2UXX A;  2QVO A;  1IN6 A;  3ULQ B;  4I98 B;  3VOE A;  5TRD A;  1ZRD A;  1FYM A;  1FLI A;  2DFI A;  2VBY A;  1K6O A;  4HX7 A;  2HFH A;  2FE3 A;  2FEZ A;  2K86 A;  5ERI A;  2OAZ A;  1ZLJ A;  4O5V A;  1TQM A;  2F5E A;  3I53 A;  3I0T A;  5K1Y A;  5HLH A;  1Z6R A;  2KIM A;  4A6D A;  3E6M A;  3TDZ C;  4HV5 A;  3ROU A;  4A5N A;  2PEX A;  4L0Y B;  4MTD A;  1FYL A;  2MC3 A;  3BP8 A;  3WGH A;  1KA8 A;  2VT2 A;  5KK1 A;  4OMZ A;  4I0A A;  4ZZD A;  1SD4 A;  1IXS B;  2QBY A;  5L3B A;  2KJC A;  3SHF A;  2G9W A;  3PQK A;  1U5T B;  1J5Y A;  1HBX G;  4UNO A;  3DXJ F;  3K0L A;  1HKT A;  2V1D A;  2K7L A;  4KYW A;  1LEA A;  4MNU A;  1W5T A;  5FLX Z;  1RZ4 A;  1R36 A;  1FNN A;  5AIP A;  5DCF A;  4ETS A;  4GGG A;  5D5W B;  4O3M A;  5ICC A;  2KJB A;  4WF2 A;  1EH6 A;  1MD0 A;  4LLG F;  1B4A A;  3V7R A;  2HTJ A;  3KLN A;  4PCQ A;  3L9F A;  4BHP A;  1XCB A;  3GFL A;  3DQV C;  5FD6 A;  3SZP A;  5D8L B;  2VC1 A;  3JSP A;  4B8X A;  2MH2 A;  2EFW A;  4IXA A;  2W25 A;  5J8C A;  2L02 A;  2Y48 A;  4G8X A;  5LHI A;  1KQ9 A;  3C1D A;  1JXS A;  1J0R A;  2QWW A;  1R5H A;  2D1V A;  1JE8 A;  2D45 A;  2ADU A;  1SFE A;  3E5X A;  3B02 A;  2XKO A;  3TDU C;  5D6F A;  1ZRE A;  5IT9 Z;  2K02 A;  1GXQ A;  2FBI A;  3RI4 A;  5LEK A;  4OIP F;  1FP1 D;  3H92 A;  2J5P A;  2DO7 A;  1G3T A;  2A68 F;  5ICG A;  1J7K A;  2CFX A;  3WTV C;  3P9K A;  4GXO A;  3HSE A;  1QO0 D;  1P4A A;  3WU0 A;  2V1U A;  1FSE A;  3QPH A;  1KGS A;  2K27 A;  3WE3 A;  1B6A A;  2ELH A;  1KU3 A;  1G3Y A;  1IAW A;  3LQQ A;  3QP5 A;  2Z33 A;  4HQE A;  1E2X A;  2ZBK A;  3BPV A;  4NB5 A;  1S7A A;  4CYD A;  1O3R A;  4WWC A;  4UVA A;  1B9N A;  4ZZL A;  5E1Z B;  3BDD A;  4KNY A;  3HRU A;  2ZFW A;  3I54 A;  1I6X A;  2F5D A;  1BIA A;  1UHW A;  2ZJ2 A;  3GWZ A;  5CVV A;  5LGT A;  1QZY A;  3GX4 X;  2OA4 A;  1MJ9 A;  3JAM K;  4U0W A;  5A2Q Z;  4QWQ A;  2EB7 A;  4XBF A;  2XAH A;  3FF5 A;  3N4M A;  5FLX K;  2NNN A;  4LD5 A;  3R4K A;  3F3X A;  3LAP A;  1EH7 A;  2K4J A;  1ZYR F;  4G6D A;  1HSJ A;  1I1S A;  1R1U A;  2VE8 A;  3J7A O;  5HS9 A;  3FWE A;  1ON1 A;  4IRG A;  2H6B A;  3WOD F;  2DPU A;  5CVJ A;  1T6S A;  5HDG A;  2DAO A;  4K2E A;  1XMA A;  3VOD A;  5LRS A;  4CXF A;  4LFU A;  2FXA A;  2VOD A;  3SZT A;  3P9C A;  2YU3 A;  4XRF A;  4LJZ F;  2O61 A;  2IA0 A;  2H27 A;  2YX4 A;  3KP7 A;  2GIV A;  4KIG A;  1P6R A;  3CJN A;  2O0Y A;  3SFZ A;  3ZPL A;  1R1T A;  3G73 A;  3ZN1 A;  2VBZ A;  3ABU A;  4EJV A;  4ZYE A;  1QPM A;  4HYE A;  3N97 A;  4WK8 F;  3EET A;  1A04 A;  4BHC A;  2ZME B;  4M6X A;  2CSO A;  3KZZ A;  3KEO A;  2FF4 A;  4N0B A;  3FMR A; 
#chains in the Genus database with same CATH topology
 3B73 A;  4XQF A;  1Z7U A;  2YSR A;  2C6Y A;  2PMZ A;  2CV0 A;  3OYG A;  1FC3 A;  3LA7 A;  2VC0 A;  2H09 A;  2BZT A;  3CCL I;  4IL6 C;  3Q0W A;  2X51 A;  4S04 A;  4DZJ A;  4EAT A;  3QAH A;  5EG0 A;  1MKM A;  4UUT A;  1TC3 C;  1IDZ A;  3H36 A;  1IV6 A;  2E34 A;  4M73 A;  2XSD C;  1ZRF A;  2HGC A;  1FOX A;  1FOY A;  4P9F A;  2JA7 J;  5DYM A;  2F4M B;  4HX8 A;  3RJP A;  1IC8 A;  4C3I J;  1U8R A;  2ZJQ F;  3VB2 A;  1LDJ A;  1I39 A;  3PO2 J;  3SEQ A;  2V9P A;  2FOK A;  5IY5 H;  2PN6 A;  2K4B A;  4MLO A;  1T38 A;  2RNG A;  1FYK A;  2BY3 A;  3BWG A;  1BR1 A;  1Z9C A;  1J9I A;  5DCM B;  1H8A C;  3DBR B;  1YIO A;  5B1A H;  5J6X A;  3QOP A;  3F8C A;  1Z05 A;  1OQY A;  3H35 A;  1FOK A;  2XV4 S;  4IHY A;  3U9G A;  2R7S A;  2HXO A;  2Q0O A;  5D6E A;  5C4J J;  5M5Y J;  3H3V K;  2WV0 A;  5CJ9 A;  2M8E A;  4YII A;  1F4K A;  1FOW A;  5HS7 A;  1QNT A;  3O8G A;  3TKY A;  4PFP A;  1V55 H;  3G2B A;  2E2J J;  5H2F C;  1SFU A;  4RGU A;  1E17 A;  4HLX A;  5F0F A;  3LQR A;  5IYD J;  4M3G A;  3FZV A;  3T1B A;  5CKT A;  3I59 B;  3GVA A;  5EJC A;  5LHH A;  4HW0 A;  1Y1V J;  2E36 A;  1GVJ A;  5M3M J;  3OYA A;  2COB A;  1WJB A;  2Z3Y A;  3P5J A;  2EIJ H;  3OYJ A;  4HOB A;  1GXP A;  2P7V B;  2F5V A;  2WAE A;  3G71 I;  4KA4 A;  3ZQH A;  5FLV A;  2D2W A;  3HOY J;  4QLC U;  1IXC A;  3V7C A;  4HF1 A;  2PMH A;  4YG2 F;  2KRC A;  3FM5 A;  1D5Y A;  4AM3 A;  4ESJ A;  4N9H A;  3QOD A;  4A3G J;  2FRH A;  4M72 A;  4ESB A;  2R5Z B;  5D4S A;  2VBX A;  2R93 J;  4XSZ F;  3HTS B;  3R6S A;  4BQO A;  4UUV A;  5FRN A;  3K7A J;  2Z2S B;  2FNP A;  4P5O A;  4IHT A;  4BXF A;  1X4O A;  2CV1 A;  1YW9 A;  2Z1D A;  2EWN A;  5J3L A;  1RKW A;  3BC8 A;  2ZXH A;  1OR7 A;  1LB2 A;  1K78 B;  1OCT C;  1G3W A;  1S3J A;  1PP8 F;  2IRF G;  2CW7 A;  4B48 A;  4X0G A;  1VQP I;  4B3A A;  2E19 A;  1Z91 A;  1GHC A;  2K9Q A;  4A3M J;  5GAE J;  1SAX A;  4R8H A;  5J4V A;  1OKR A;  4EQQ A;  3H9Q A;  3HSF A;  1BBY A;  3GO5 A;  4XLA A;  1S72 I;  4F52 A;  1DUX C;  4EEF G;  2DMU A;  5JVT A;  1MND A;  3OL4 A;  3FXL A;  4YIF A;  2FX0 A;  1IV8 A;  1WKM A;  4KN7 X;  2X0L A;  2P5L C;  1B59 A;  4N4O B;  2DTZ A;  1FBU A;  2QZ8 A;  2JZY A;  1ORK A;  2GA1 A;  3CMY A;  1YW7 A;  4NC6 A;  4BQQ A;  1ZKG A;  3K4B A;  4L9N A;  4XN0 A;  4HEA 2;  4BDZ A;  2M7B A;  3BR5 A;  3GFJ A;  1S7E A;  3OYC A;  1YI2 I;  5F27 A;  3PNV A;  2LFB A;  1RET A;  2PBI A;  1VQ9 I;  5AON A;  4BL0 B;  4DYC A;  5J47 A;  5FLM J;  1ZH5 A;  1BW5 A;  1T0F A;  4DNC A;  2M45 A;  5JI6 A;  1IGN A;  2MD5 A;  5HLI A;  2Q2E A;  4F93 B;  2E1C A;  2K9S A;  2NS0 A;  1G59 A;  3PFI A;  3M9A A;  1RNL A;  2M5W A;  2VXD A;  1XGN A;  1STZ A;  3F21 A;  3FMS A;  4Q5S F;  4AUX A;  2PG4 A;  2BEO A;  1JGS A;  2WV1 A;  3F23 A;  5FRO A;  2TDX A;  2LRD A;  3K4L A;  2ID3 A;  4M6Y A;  2KLO A;  3IHU A;  4XOT A;  5GTH C;  1KON A;  3GFI A;  3SDB A;  2UXN A;  3BCA A;  2W7N A;  3CCJ I;  2Y0S A;  1ON2 A;  4JX4 A;  1HLV A;  3LA3 A;  3I5U A;  2MSY A;  1QBJ A;  1FPQ A;  4G6T B;  1IRX A;  4C30 A;  2VPL A;  3DEU A;  4D0P A;  1X1P A;  1XSX A;  2DPD A;  3LA2 A;  3R0A A;  3TQN A;  3COA C;  4Y7N J;  1E3O C;  3U21 A;  3NWS A;  1QPI A;  5KAF C;  2QKM B;  5F08 A;  2A6T A;  3EUK L;  1XN7 A;  4OMY A;  3LSG A;  2M3A A;  4XLP F;  1UG0 A;  2FNA A;  3IRR A;  4XIC A;  3HUG A;  4QSH A;  3ZQG A;  4NHJ A;  2JMW A;  3IAM 2;  4RB3 C;  1HXD A;  4AD9 A;  4EM0 B;  1JUM A;  1U6G A;  4RB0 A;  2F5C A;  2AHQ A;  2P6S A;  2OJE D;  2HOS A;  3IV5 A;  2R7D A;  5C4X J;  4LG0 A;  5DM6 F;  4XN3 A;  1FT9 A;  3KEY A;  1G3S A;  3TW7 A;  1TWF J;  4LIU A;  4FAS D;  4LG0 B;  2VUM J;  5D4R A;  4S05 A;  1MSE C;  1P2F A;  3RZD J;  1IF1 A;  3S1Q J;  9ANT A;  3M8E A;  4EJO A;  4IO9 F;  4XLH A;  1WPK A;  2NVU B;  2QKL B;  3MFK A;  2O7O A;  2BE5 F;  1NTC A;  2IXS A;  2R7R A;  4LB6 B;  4CZC A;  2G7U A;  2P0W A;  1JI8 A;  2WY7 Q;  4LIT A;  4OWR B;  3Q5F A;  1XSV A;  4IHX A;  5IP9 J;  1NK2 P;  1YW8 A;  2W84 A;  2DMT A;  4BBR J;  2JUG A;  2AXL A;  2X6O A;  4RS8 A;  2B63 J;  2FBH A;  4RB1 A;  3OV8 A;  2P7C B;  1YIT I;  2ETH A;  2E7X A;  2XPV A;  1DP3 A;  2XRO A;  1AWC A;  1UHS A;  2ESN A;  2DA7 A;  1WZ2 A;  4PJN A;  3F72 A;  2BOL A;  2H1L A;  1TNT A;  4M3F A;  2ME6 A;  2EFN A;  1F9N A;  2RN7 A;  3GBG A;  3X2Q H;  1WSU A;  2E5Z A;  1QQI A;  2VQC A;  3MWM A;  5FKN A;  2HYF A;  2LK2 A;  4FCY A;  2R7Z J;  5E20 A;  2RVC A;  2EFQ A;  3LSH A;  3WTT C;  3TO6 A;  1IW7 F;  1XPX A;  4XKC A;  1XGO A;  2RDP A;  1YIJ I;  2DK8 A;  4A0X A;  3MKY B;  4G7H F;  4A3D J;  4PDK A;  3WTZ A;  3LSR A;  1XS9 A;  1HC8 A;  3W6K B;  2BW3 B;  3IH4 A;  3CME I;  3ZQ7 A;  2RQP A;  4KT5 C;  4M3B A;  1IUF A;  3MD2 A;  3DEW A;  3S1R J;  3FXR A;  3MCZ A;  3QYB A;  4JYK A;  1OMI A;  3ZXS A;  1VQM I;  1YJ9 I;  4ZDL A;  2AQE A;  1FBS A;  1B1B A;  3GTJ J;  1CQT A;  1R5G A;  2N8G A;  1LVK A;  4EMS A;  5J1R A;  1YE9 A;  2XAS A;  1L0O C;  4BBS J;  1ZAO A;  3NEU A;  3K2Z A;  2TRT A;  5F6F A;  4ZYA A;  4E7J A;  2FMY A;  3CLQ A;  1U2W A;  3PUF A;  5EG0 B;  1CF7 A;  2XAU A;  5JR3 A;  1JKP C;  1X1D A;  4Q48 A;  3A0B C;  1NK3 P;  5E3N A;  2DCE A;  1SD6 A;  1ZLK A;  3U1D A;  3ABL H;  5LGU A;  2QEN A;  1T8I A;  2RV8 A;  4IHV A;  4FHT A;  2YPR A;  2FOW A;  2RKH A;  2QYO A;  2IT0 A;  2JJ7 A;  5HNF A;  2LBF B;  1UHM A;  3IKV A;  2RGV A;  2CUF A;  1X4P A;  4C2U A;  3G4S I;  2RAE A;  3CLO A;  3GZ5 A;  2QQA A;  3GZ6 A;  1S8N A;  1R1V A;  4QPQ A;  2XKP A;  1V4R A;  2EZI A;  3C18 A;  5L3D A;  2GAU A;  5K7F A;  3GTL J;  1RPW A;  1JUP A;  1QHG A;  3H5A A;  1OYW A;  2AXT C;  1W4M A;  3HGG A;  2W1O A;  4D5F A;  2E5N A;  5BPI A;  2AO9 A;  2Y75 A;  3OOU A;  3C2G A;  2P81 A;  2NAZ A;  2IGO A;  1T2K A;  1R7J A;  5E8G A;  1S5L C;  4MQ9 F;  2GBY A;  4MGR A;  1PDN C;  1G6N A;  4KIB A;  2NVX J;  2WTE A;  2VJJ A;  1ETO A;  2V9V A;  3NRV A;  1ENH A;  3RKQ A;  2X9D A;  3RZO J;  3PFY A;  3QOE A;  2HZT A;  2EBI A;  3KE2 A;  3KZI C;  1OIS A;  1W5S A;  3WTW C;  3OYF A;  2QSG X;  3OIQ A;  3QPL A;  3C7J A;  4AVZ A;  1AA7 A;  2EA4 A;  3BT9 A;  1FX7 A;  2M7A A;  4DYQ A;  1QHH D;  4BGD A;  5GP9 A;  2NVT J;  1ZG1 A;  5E1W A;  3JRA A;  3GTQ J;  3CUQ C;  2KIF A;  1BC8 C;  1X3W B;  2OTL I;  3IUO A;  3I58 A;  1YHQ I;  2LR8 A;  1D8K A;  2IGM A;  5L3G A;  1SMT A;  3I4P A;  3H0D A;  3L2U A;  4GO1 A;  4J00 A;  2DA3 A;  1U5T A;  1X2N A;  2WAQ N;  5FB2 A;  5BNG A;  1H89 C;  1WRJ A;  4KMU X;  3RDI A;  3M8J A;  2P5K A;  3QP6 A;  4B44 A;  1ZAR A;  2A5Y B;  3FX3 A;  4Q47 A;  2K9L A;  3ABT A;  1N25 A;  3VYU B;  2WBM A;  3PM1 A;  4BEH B;  1TT5 B;  1TLH B;  1S29 A;  2AQF A;  2WAD A;  3K4N A;  3MZH A;  2FQ4 A;  2COM A;  3S15 J;  1WJE A;  1Z67 A;  2E1M B;  1P9Q C;  1XD7 A;  4FE4 A;  3DPT A;  1YFH A;  3FM3 A;  3OYE A;  2AS5 F;  2PMZ N;  1ZGJ A;  4XLE A;  2P4W A;  2E7W A;  3LNQ A;  2VKH A;  4QPO A;  3T8T A;  1JUS A;  4LB5 A;  2R4G A;  1O3S A;  2ZJP F;  2DN0 A;  3HRM A;  2LLK A;  4XK4 A;  1J2X A;  1PJR A;  1VQL I;  2F6C A;  3DLA A;  5F04 A;  5E17 F;  3GZN B;  2XGD A;  2HOE A;  3T5X A;  4D7N A;  3C3W A;  5B3S H;  4R79 A;  1BC7 C;  2IAI A;  4HBL A;  3M4O J;  2X1C A;  1PUE E;  4MTE A;  1MIJ A;  3Q0U A;  3V42 A;  4DIQ A;  2DDB A;  4IQ4 A;  2VKD A;  4BQA A;  4BXX J;  1SMY F;  4LGW A;  3AL0 B;  3W6J B;  5ILU A;  1R6R A;  2HNH A;  4RBO A;  3ZQC A;  2LF7 A;  4LIV A;  4UVC A;  1POG A;  2YU9 J;  2VXZ A;  1O7L A;  4GYI A;  4ON0 A;  4LK1 F;  5E8I A;  2M8G X;  4WX9 A;  3ML6 A;  4GRI A;  1BN5 A;  3LWF A;  1MH3 A;  1UB9 A;  2VT3 A;  2CQ7 A;  4BE0 A;  2GQQ A;  3RQ4 A;  1BI0 A;  2R7F A;  5TIS C;  1HOM A;  3HYI A;  1EH8 A;  4E7Z A;  4IZZ A;  2HDC A;  2HVR A;  5BOX A;  1WQ2 A;  2R7V A;  1LPQ A;  3HTU A;  1X1C A;  3E6B A;  3MEX A;  1XDS A;  3CTA A;  3KET A;  2CW8 A;  3I4N J;  1WHU A;  2JA6 J;  1P92 A;  5EYR A;  4XLF A;  3J80 K;  5JFR A;  1R00 A;  1MZB A;  2L9V A;  3H3Z A;  4F91 B;  2STT A;  3HOT A;  2IW5 A;  5H20 A;  3F6O A;  1MNE A;  1LNW A;  1Z21 A;  2NOJ B;  3RYP A;  2QUF A;  1VQ6 I;  4XON A;  3MMY B;  1U0J A;  1ODD A;  3G1O A;  1TWG J;  2DA2 A;  3OIO A;  3ZOB A;  1SFX A;  2XGX A;  2ELJ A;  3BRO A;  1B8I A;  1FY7 A;  3S2D J;  1CF7 B;  1DQU A;  3HRS A;  2P5V A;  3KZY A;  4GDF A;  4PFO A;  1W1W E;  3S1M J;  3DPL C;  1JKR C;  2DXI A;  3TO7 A;  2FU4 A;  4LMY A;  3S93 A;  2MLG A;  1XB4 A;  1P4X A;  4P96 A;  3F8M A;  5M5X J;  5DEQ A;  2CQK A;  4YFN F;  5BQT A;  3RSN A;  3DCF A;  3TO9 A;  2V79 A;  2M9H A;  3GUD A;  4I09 A;  3WU1 B;  1W36 D;  1ZRC A;  4GFB A;  3DBH B;  2UUZ A;  4ENN A;  4OIR F;  1I6H J;  1LKX A;  1B72 A;  2IBD A;  1XG1 A;  2H8W A;  2HDW A;  2R7Q A;  2RNJ A;  3DF8 A;  1OCZ H;  5IOY A;  2JUC A;  2EFO A;  4CYC A;  3FBI B;  5HDK A;  3CCV I;  2EV6 A;  3U2R A;  4EJT A;  1BI3 A;  5LLQ A;  1IN8 A;  5FKO A;  4HX4 A;  3WE2 A;  4XLN F;  1YRN B;  2QF7 A;  3JCU C;  1UCR A;  4XRS A;  4IHW A;  1X3U A;  2HS5 A;  3JRH A;  2XGC A;  2PX9 A;  4YEL A;  3S14 J;  1OPC A;  1X58 A;  4EVI A;  2ESH A;  3BZC A;  1RUN A;  3RPQ A;  4PGG A;  3ZQI A;  1UZC A;  3BR6 A;  3W6V A;  1K83 J;  2LVS A;  3K70 C;  4BAC A;  5EEA A;  5HLG A;  2EA2 A;  4CO8 A;  3E6C C;  3CCR I;  5JVG F;  3G3Z A;  4M9Z A;  2EQR A;  4RAZ A;  4UB6 C;  2M34 A;  2KRF A;  4XLC A;  1VQO I;  2FSW A;  1QVU A;  4X1E A;  1R22 A;  2OF7 A;  2JA8 J;  3PL8 A;  5KCM A;  1K79 A;  3JRE A;  2IGK A;  5BPD A;  4KDP A;  2LTP A;  2OUM A;  3CCY A;  3IWF A;  2PFB A;  4FX0 A;  5BMZ A;  4FT8 A;  4BYY A;  1JHH A;  1HKS A;  2DA4 A;  1SD5 A;  4HZF A;  2X6W A;  1I1G A;  5HOO A;  1Z3Y A;  2ZFU A;  5IT3 A;  2VBW A;  4PZJ A;  4XKW A;  4A3L J;  5ICF A;  2JRT A;  2XUB A;  3S2W A;  3E6D A;  4Q4Z F;  4YFK F;  5L3C A;  1ZG3 A;  2A07 F;  3HUG B;  3GW2 A;  4UV8 A;  3AG3 H;  2IVM A;  3K9T A;  5DUI A;  3BQY A;  3QPS A;  1I27 A;  1ZK8 A;  4FET A;  4E70 A;  2OPT A;  3LFU A;  4E7K A;  1YRN A;  4IF4 A;  3BLY A;  2EIK H;  3G6E I;  2MA3 A;  4PSW A;  1SVL A;  2LH9 A;  2ZXW H;  3E0J B;  2HOT A;  1H9G A;  3IH3 A;  4II2 A;  1I50 J;  2V6C A;  3GCM A;  3AAF A;  1G2H A;  1PVE A;  3QYE A;  5A2Q K;  3KP2 A;  3DBL B;  4M71 A;  2PJR A;  2GZW A;  3IRQ A;  4CHU A;  1LEB A;  4AWX B;  1WCM J;  2HU9 A;  1TW3 A;  1HDD C;  2LDU A;  2JSC A;  3BCB A;  3DKW A;  3DKX A;  1VQ7 I;  3ELK A;  1YX5 A;  4BH9 A;  4KIT B;  2CFO A;  2RC4 A;  4HDV A;  2P6T A;  3CO7 C;  1YX3 A;  2LP0 A;  2QCO A;  2OCC H;  3IC7 A;  4Y17 A;  1ZR4 A;  2Z9O A;  4NQW A;  1XGS A;  1YJN I;  4CYC B;  4BJ5 C;  3CC2 I;  1ETK A;  3REO A;  5HOD A;  4H0E A;  1O4X A;  2JA2 A;  3PQJ A;  2IPQ X;  1PP7 U;  4KT6 A;  1B72 B;  4LLL A;  1BI2 A;  1AU7 A;  2L0K A;  3KLO A;  1T56 A;  5FD5 A;  2W48 A;  3S17 J;  4IRI A;  4RGR A;  5ILS A;  4BAY A;  3ZMU A;  2R7U A;  2DFF A;  2KIS A;  1SC7 A;  2FQ3 A;  1B8I B;  3JR9 A;  2DTR A;  3KEQ A;  1O7F A;  3OMY A;  1XMX A;  1R4M B;  4OU0 A;  2OD5 A;  2DK5 A;  3P7N A;  3LOC A;  4KN4 X;  2HDD A;  4HNV A;  4M9X A;  5CVI A;  5ICE A;  4CSW A;  1BJZ A;  1BI1 A;  4P55 A;  4AC0 A;  1H0M A;  3IAS 2;  1TP4 A;  2L54 A;  4KIS A;  4PK4 A;  3OYM A;  1HKQ A;  2Z5U A;  4JBA A;  4B1R A;  2OTJ I;  1Y56 A;  2O5R A;  2R5Y B;  2E2I J;  3KYL A;  2BVM A;  3F9K A;  1XTA A;  2NRA C;  3N05 A;  4CCM A;  3I71 A;  3DFG A;  3AL0 C;  3L09 A;  2JPB A;  4CH7 A;  2A6H F;  4KIF A;  1YS6 A;  3GME A;  2ZO4 A;  4PGH A;  1R4N B;  5K5O A;  4TV7 A;  1ZR2 A;  4J01 A;  2V1X A;  3ZMZ A;  5F1R A;  1D0X A;  4HDU A;  4EGY A;  2A5W A;  1TQP A;  3DPU A;  4UXN A;  2CUE A;  4XSX F;  2L9R A;  3FKJ A;  4YFX F;  1G4D A;  1I3A A;  3PNY A;  1LE8 B;  2D1H A;  1OYI A;  2VB6 A;  3GYH X;  2GWR A;  1S9H A;  5CQG A;  4F55 A;  5DV5 A;  4UY8 I;  4NC8 A;  4PJ0 C;  4Y15 A;  4B09 A;  2MLK A;  4RB2 C;  2ZKZ A;  3LSI A;  2HYJ A;  1Y8R B;  2XIG A;  4L5E A;  1CGP A;  4EGZ A;  4E7H A;  5DD8 A;  2KDO A;  2DU9 A;  2W24 A;  4EM1 A;  3EUA A;  5K7H A;  2BY0 A;  1MH4 A;  2HXI A;  3DTE A;  4M3D A;  2DA5 A;  3BY6 A;  5LGN A;  4RLF A;  2XRL A;  2V26 A;  2X4H A;  3MAJ A;  1OCC H;  2E1O A;  1MNM C;  2O6G E;  2R7X A;  2PQ8 A;  1I3Q J;  2ICW G;  2GOX B;  5J4Y A;  2DJN A;  4ENJ A;  1ZQ3 P;  3ZMD A;  3UKG A;  3VPR A;  3F8N A;  3Q0V A;  1P4W A;  3TBI A;  3V4G A;  4ZH4 F;  2PJP A;  3B6A A;  1G8X A;  2QQ9 A;  1IXR C;  4AYB A;  3GTO J;  4ZC3 A;  5IP6 A;  1BW6 A;  2M0C A;  2Y69 H;  2R7O A;  3SZG A;  3SEZ A;  1W7P A;  3V7S A;  4L18 B;  4U88 A;  3CES A;  4UHT A;  3GTG J;  4AIJ A;  2EZK A;  2KQR A;  1LUJ B;  1YOV B;  2BBY A;  5H6Q A;  1H9T A;  3M7G A;  5FRM A;  1MJA A;  3U1K A;  1XGM A;  2LOO A;  1BL0 A;  1N75 A;  2UWM A;  3ABM H;  3GFM A;  3ASO H;  1U5T C;  2VAS A;  2F4O B;  4P1W A;  2KDZ A;  4N9I A;  4UV9 A;  5FGM A;  4AIK A;  2CW0 F;  1TW2 A;  1IO2 A;  1BOA A;  2DLL A;  3EUH A;  3HBL A;  3K1P A;  3A03 A;  1WJF A;  4OAY A;  3FK6 A;  5D5U B;  3SDG A;  1USS A;  3RQI A;  4P9U A;  5HLT A;  2XPW A;  3HKZ A;  4MO7 A;  3DTK A;  4QIW N;  3LST A;  4DZP A;  3W3C A;  2DBB A;  4MHG A;  4I2O A;  3SQN A;  2BHZ A;  5LD2 C;  1VQN I;  3ECH A;  2VOO A;  4WCG A;  5FKL A;  2K85 A;  1LDD A;  4M74 A;  3J80 Z;  3FHZ A;  2HEO A;  5LRR A;  3FXM A;  3HOV J;  2HYG D;  1FIP A;  5FFZ A;  2W82 A;  3DV8 A;  3MVP A;  3JTH A;  3OYD A;  3IH2 A;  2MD0 A;  1D0Z A;  1VQ4 I;  1TZL A;  2L4A A;  1W7P D;  1MJB A;  4WXC A;  3K1N A;  5H6R A;  1K4S A;  1EV7 A;  4G7O F;  3SXY A;  3ERE D;  4IEJ A;  4L5J A;  2CYY A;  3CDL A;  2DOE A;  3CCM I;  4B3X A;  1ERD A;  2MBF A;  3H9G A;  1K78 A;  2ZNZ A;  3WG7 H;  1IJW C;  2A61 A;  3VWB A;  4RGX A;  2K9M A;  2HQ5 A;  4Y3O A;  5FJ8 J;  2EH3 A;  3PIP F;  1K7A A;  3BG9 A;  2O9L A;  4MEX F;  1XDU A;  3L2Q A;  4XID A;  1LDK B;  3GXO A;  3HRT A;  2DW4 A;  2ZXI A;  1IN7 A;  2LSO A;  3HPG A;  2JT1 A;  2CGP A;  2VON A;  2FBK A;  2VOP A;  1GV5 A;  4I99 C;  1REP C;  1IDY A;  2OZ6 A;  3J7Y J;  1R58 A;  2JVH A;  3D0S A;  1XCV A;  2A6E F;  4GYG A;  3HG9 A;  2GXB A;  2VJI A;  2CUZ A;  1ZHF A;  4RAY A;  1ZG5 A;  3F6V A;  3KCC A;  4KMF A;  1IN5 A;  1EJ9 A;  2XF7 A;  4N4N B;  4C9Y A;  4F7Z A;  1TBX A;  3CF2 A;  3TMO A;  4DGW B;  2L3D A;  2L9S A;  2M87 A;  2X6Y A;  2OU2 A;  2B0L A;  4A2U A;  2B9S A;  1D8J A;  2HKO A;  2OQR A;  2X1D A;  1A6I A;  2L4M A;  3KP3 A;  3R61 A;  2MAB A;  4IRH A;  4WXH A;  4Y33 A;  2WAF A;  3BG7 A;  5DD4 A;  1VFC A;  3MKW B;  2VN2 A;  4HSR A;  3GTK J;  3V8K A;  1DGW Y;  3I59 A;  4NUB A;  1OCP A;  2Y30 A;  3HOX J;  1FWZ A;  1MBG A;  3BZK A;  3KP6 A;  4D5C A;  2CMP A;  2NXN B;  2R92 J;  1O57 A;  3CUQ A;  3NQO A;  2IS2 A;  4DOZ A;  5EEH A;  5KNL A;  1J09 A;  2YS9 A;  4G9Y A;  2BVL A;  3WGG A;  5CVU A;  1WJD A;  1D0Y A;  3ABK H;  4RA2 A;  3G1M A;  4BJT A;  2EJR A;  4UUS B;  1V5G A;  4U0V A;  2MC4 A;  3L2C A;  3FXJ A;  3BR0 A;  2VJ4 A;  3SJM A;  2HPI A;  1VZ0 A;  3R60 A;  1OJL A;  3ERM A;  2EPF A;  3E5U A;  4CDG A;  1RC9 A;  2DDA A;  2R5Z A;  2I5U A;  3BOQ A;  5JLX A;  1M1E B;  3JRG A;  1ITY A;  1WI9 A;  3LSK A;  1DU6 A;  3J7A Y;  4MFE A;  1F1Z A;  2VKE A;  3E97 A;  3HEF A;  1Y6I A;  4OIO F;  1Z1D A;  2WWY A;  2D5V A;  4F3Q A;  1AHD P;  3VSK A;  4YEJ A;  2M4K A;  1AOY A;  2M30 A;  1ACI A;  1R9T J;  3A02 A;  1S7O A;  4PJJ A;  1LFU P;  4I76 A;  2YR2 A;  3M8F A;  3BTI A;  1UG2 A;  4W97 A;  2K3F A;  5DCM A;  2F5F A;  1D5V A;  2BXZ A;  1KQ8 A;  1L3L A;  4AVP A;  3AG4 H;  2JPC A;  3JAM Z;  3BJO A;  4J19 A;  6PAX A;  4ZDO A;  2DYS H;  4BE2 A;  2LF8 A;  2I8D A;  1UJ8 A;  2W57 A;  3F8F A;  1P7J A;  1VQ5 I;  1R71 A;  2NNY A;  2GOM A;  5AIQ A;  3BPX A;  2DMP A;  2Q8K A;  3WTX C;  3W2V A;  2LY2 A;  4BY7 J;  2VQG A;  3KFW X;  1S6L A;  2IS4 A;  2DMQ A;  3ECO A;  3W2A A;  3TGN A;  2FML A;  4I7H A;  1OCO H;  1JHF A;  2R7T A;  2DT5 A;  3D5S C;  1QA6 A;  4AID A;  3QYF A;  4IHS A;  4CZZ A;  1HST A;  3E7L A;  3ZMS A;  2E35 A;  3F8B A;  3PSF A;  4NBQ A;  5CYV A;  2OBP A;  1MBK A;  2XAG A;  2ZSH B;  4IVN A;  5DTD A;  3ZCO A;  1ETW A;  3KYC B;  4XKV A;  1TWC J;  4BUP A;  2ZJR F;  1HW2 A;  2HQA A;  2IA2 A;  4RM2 A;  4Y52 J;  5EZH A;  1U9N A;  4H4K C;  5IYB J;  2W00 A;  3PIO F;  2MYS A;  4ENM A;  3QPT A;  1FBQ A;  2HWV A;  3CD6 I;  4BJ6 C;  4G6Q A;  1HW1 A;  3SFI A;  4BY1 J;  5B5E C;  3K4J A;  3GF2 A;  1A36 A;  2GLO A;  2CJJ A;  1X2M A;  2TCT A;  1SVM A;  1VF9 A;  1ZTR A;  3BG3 A;  1MDM A;  2WB1 N;  4HNT A;  2HQN A;  4B4C A;  4HF2 A;  4ZYD A;  1HW5 A;  3J81 K;  3WTU C;  5K5Q A;  2VKV A;  3DEE A;  4JK1 X;  5DDG A;  3VDX A;  4IJA A;  1O3Q A;  1ONV A;  1ZN2 A;  3JRD A;  2QA4 I;  4ZYH A;  2W85 A;  2XSJ C;  2Z16 A;  4KIC A;  3ZN0 A;  4ZYG A;  5E1X A;  3OYK A;  1NHA A;  5IT9 K;  4KFC A;  3RIR A;  2JN6 A;  3Q3S A;  1E0E A;  3H5N A;  2L9N A;  4YRV A;  4OAZ A;  1R23 A;  3MQ0 A;  3OSF A;  4XM3 A;  3D5L A;  1XMK A;  4AYB N;  1UST A;  3OYH A;  2HVS A;  2ZCW A;  2ZB9 A;  5GTI C;  4U7B A;  2EV0 A;  3O6B B;  5HS8 A;  4HRI A;  3ESW B;  3TL4 X;  2IEK A;  4A5M A;  4V2G A;  1YLF A;  3BJ6 A;  1ZGA A;  1UAA A;  3T0Y A;  5HDN A;  1A5J A;  2DI3 A;  1TTY A;  3E5Q A;  5K7Z A;  5FO5 A;  2G7H A;  3GTP J;  3EUH C;  1U9O A;  3GTM J;  4CIC A;  2CRG A;  1J59 A;  2DOF A;  4CCL A;  4CGZ A;  1B9M A;  5D8K B;  1IRZ A;  3ZGK A;  1V5F A;  2ZXJ A;  3ZQF A;  3BZ6 A;  5KAI C;  3ZQQ A;  2KRH A;  2CG4 A;  2CO5 A;  3L00 A;  2R0Q C;  1H88 C;  4ESF A;  1F5T A;  4LLN A;  1IN4 A;  1DGR M;  4M9S A;  1IUY A;  1GLN A;  4G12 A;  2EIM H;  2BYV E;  2L7K A;  2XPU A;  3RPU A;  1TNS A;  3O2P E;  4I01 A;  4FQG A;  5CQE A;  1MDM B;  3TOB A;  1Q1H A;  2LMD A;  3ASN H;  2MW8 A;  3HHH A;  2QSH X;  3HIF A;  2BY2 A;  3VEP A;  3VYR B;  4L9V A;  1BA5 A;  4C3J J;  1SFO J;  3DTI A;  3OOP A;  3EYY A;  3H3U A;  3MZY A;  2RQQ A;  1BOB A;  4ZTF A;  3HOS A;  3PO3 J;  4XRM A;  1SEU A;  2QM3 A;  3R0J A;  3MKZ A;  2DQL A;  2KIU A;  1YG2 A;  4MEY F;  2M4G A;  4I0B A;  2UZK A;  2KZV A;  3V8L A;  4RAF A;  4BE1 A;  4A12 A;  1D1A A;  3I64 A;  4ASN A;  1LQ1 A;  1QZE A;  3Q9S A;  3LL7 A;  4G7Z F;  3J7Z I;  4RMN A;  2JTV A;  4FTH A;  1WH7 A;  3WU2 C;  1A6Q A;  1Z7L A;  1PUF A;  2DFE A;  1T0F C;  2K5C A;  4WXD A;  2X85 A;  2IS1 A;  4G94 A;  4HV6 A;  4A3E J;  1VTN C;  2JSP A;  2KPM A;  4L0Z B;  4ANJ A;  4HNU A;  3HGY A;  5KVR A;  1HQC A;  2KIQ A;  1KU9 A;  5CVR A;  2LKS A;  2V7F A;  3VSL A;  3VYS B;  5EDN A;  1SD7 A;  3CCS I;  1J75 A;  1UEL B;  3OWT A;  5IP7 J;  2M0M A;  4JQF A;  4D1Q A;  1Y39 A;  1U3E M;  1C0W A;  4DBQ A;  4OIQ F;  2H6C A;  3CDH A;  4EJU A;  4C2M J;  2YX7 A;  3F0C A;  3OR2 C;  3CDI A;  4CCN A;  1YYV A;  3A0H C;  1YTY A;  1GVD A;  2EK5 A;  5IOZ A;  1D3Y A;  4A3I J;  1APL C;  3OL3 A;  2HKX A;  4MFD A;  4UB8 C;  2IJL A;  2IA1 A;  3QU6 A;  3RKW A;  3S8P A;  3CO6 C;  1LE8 A;  2Z99 A;  2PLY A;  2WB1 A;  2XAJ A;  4CUG A;  4HF0 A;  2GXG A;  3UNG C;  1JJ8 C;  1FZP B;  5JHU A;  1R5I D;  5CLS A;  5L3F A;  2EZL A;  2BXY A;  3L2R A;  2VE9 A;  4ENK A;  3JSO A;  5B66 C;  3ZP5 A;  2DYR H;  3V8J A;  2LNB A;  3DU5 A;  5EZG A;  3QWL A;  3W2W A;  3QQA A;  2M1B A;  5CPR B;  4PSX A;  3CJT B;  5DS9 A;  3DWL E;  3QRF F;  3CQZ J;  3HHG A;  1LFB A;  3I56 I;  4A93 J;  1YQA A;  4DQ2 A;  2E71 A;  2H94 A;  2XAF A;  2ZC2 A;  3GLX A;  2BHY A;  4JX5 A;  4JP0 A;  4A6E A;  1LJ9 A;  1DPR A;  3O3K A;  1TWH J;  3JRI A;  3RYR A;  3RKX A;  2BY1 A;  3ZMV A;  5EGO B;  4II3 A;  3D1N I;  3SYT A;  5BS6 A;  1X1A A;  1DP7 P;  4UVB A;  3WTY C;  1JT6 A;  4MQV A;  1ZGW A;  5EF6 A;  2CQN A;  4M3E A;  4U7D A;  2YUS A;  3IP4 B;  2OQG A;  2LC2 A;  1Y1W J;  5TJJ A;  2R5Y A;  5J1Y A;  4AU7 A;  3HB9 A;  1WH5 A;  1GDT A;  1U78 A;  4IQJ A;  2E2H J;  2A69 F;  2GA2 A;  2L01 A;  1WJ5 A;  3CP8 A;  1T98 A;  3K69 A;  2DQR A;  2QSF X;  1QZZ A;  2ELK A;  2JWT A;  2KKO A;  2NS7 A;  3RTR A;  2VIX A;  5JLW A;  3F22 A;  1GT0 C;  2LY9 A;  1TQI A;  1MMS A;  2OC6 A;  3FXQ A;  1I5Z A;  5B1B H;  2BGC A;  3CF5 F;  1ZEL A;  4JX6 A;  2CV2 A;  1UFM A;  1AKH A;  4Z6Y A;  4U0Y A;  4BXU A;  2QBY B;  3DP7 A;  3FXU A;  3TOA A;  2Q2E B;  3OS2 A;  1F36 A;  2O3F A;  3FKI J;  2XAQ A;  3FDY A;  3ZMT A;  3I9V 2;  1KU2 A;  3RPU D;  5M3F J;  2E1N A;  3PUB A;  1Z6T A;  2IP2 A;  3HKZ N;  2DOD A;  2O03 A;  2PMU A;  1OR7 C;  2JVG A;  3EYI A;  1OYY A;  3E3V A;  3KP5 A;  5FFX A;  2HQR A;  1RIO H;  2GM4 A;  1BR4 A;  2R3S A;  5J8F A;  1DPU A;  2PI0 A;  2CU7 A;  1RI7 A;  2Y0M A;  1X3Z B;  4RAG A;  4R1H A;  1ULY A;  2DT7 B;  3K4C A;  3T8R A;  1FTZ A;  5FKM A;  5D5X B;  1W0U A;  3H1C A;  1SVO A;  4S0H B;  4BKX A;  1UMQ A;  3VFZ A;  5LFA A;  5F64 A;  3HM5 A;  2KHM A;  1YJW I;  1W7P B;  4KUM A;  5E79 C;  4DJA A;  2WY8 Q;  1MGT A;  4C3H J;  1MMA A;  3M1E A;  3FMQ A;  4HA8 A;  3JW4 A;  1WJA A;  1LVA A;  4A0Z A;  2ECB A;  3CUQ B;  4RM3 A;  4NNJ A;  4O6J A;  3IWZ A;  1FP2 A;  4FX4 A;  2NS8 A;  3BR1 A;  3AKZ A;  2QQB A;  3HSR A;  1V3F A;  3OR1 C;  2CQX A;  4HPQ A;  2K3P A;  4IPA A;  4CA0 A;  1TWA J;  2ECC A;  4HLY A;  4A0Y A;  4UUS A;  4XL9 A;  4EV0 A;  1XC5 A;  1QGP A;  1FEX A;  3O8H A;  4BQN A;  3DLL F;  2E60 A;  3EDP A;  1RR7 A;  4ZDP A;  2STW A;  1NG7 A;  2R7W A;  2FA5 A;  3EQL F;  2A3S A;  2F2E A;  4OOI A;  1BM9 A;  3S3O A;  4C2T A;  1IZ1 A;  2WA0 A;  4EM2 A;  3JTG A;  1JKQ C;  1RUO A;  2OZU A;  1BIB A;  3PNT A;  1ETX A;  3RCO A;  1T39 A;  4IKF A;  4U87 A;  5GPC A;  4A3K J;  4Z2Y A;  3BTJ A;  4B47 A;  3A01 B;  3WGI A;  1D1B A;  2LKP A;  1A31 A;  2P8T A;  3HZJ A;  2MH9 A;  2E1M C;  3GEZ A;  4RLQ A;  3CUO A;  3TW6 A;  5K5R A;  4HQM A;  2CQQ A;  2MFZ A;  2I10 A;  1U8B A;  4I02 A;  3OYI A;  3OS1 A;  2KL4 A;  2EIN H;  3K1M A;  4B43 A;  4L9J A;  2EFP A;  3LFK A;  4QTR A;  5C44 J;  3GLL A;  4XR6 A;  4X6A J;  3BJA A;  2ZSI B;  2X1E A;  2V1N A;  2XDV A;  3J81 Z;  4E7I A;  2O8X A;  4RDU A;  3L2W A;  1RRJ A;  5HNH A;  2HI3 A;  2KZG A;  3TED A;  2CWE A;  2MGQ A;  1NH3 A;  4L5I A;  2FUG 2;  3KP4 A;  1IRG A;  2ACJ A;  2WC2 A;  2ZNY A;  3BTL A;  3FIS A;  3G1L A;  4HAM A;  1D1C A;  1K4T A;  2XVC A;  2J5O A;  1MW7 A;  4AIH A;  1MSF C;  1N78 A;  3Q9V A;  1Y0U A;  1KYW A;  5LHG A;  2XB0 X;  1V54 H;  3RKY A;  1RES A;  2L7Z A;  2QLZ A;  1FIA A;  1FSH A;  2HR3 A;  5E18 F;  2NVQ J;  3LAJ A;  4EJW A;  3WG9 A;  1XX5 A;  3MN2 A;  5L3E A;  4GCV A;  3QU3 A;  3ONQ A;  3HJE A;  2ISZ A;  3OS0 A;  1SAU A;  1SAN A;  5ILV A;  3P9I A;  4Y13 A;  2XHK A;  1IRF A;  4PUS A;  1RKT A;  3M07 A;  4DBR A;  4OIN F;  1YS7 A;  2FJ1 A;  4BDY A;  1MMG A;  4RGS A;  2HZD A;  5DM7 F;  1BJA A;  2XB5 A;  3BTC A;  4I6Z A;  3CJQ B;  5M5W J;  2LKX A;  2DA1 A;  2NYX A;  1V5E A;  4NDL A;  5LBQ A;  1WGX A;  4L9T A;  2LD5 A;  2Y2Z A;  5GAH J;  4DYR A;  4LG3 A;  5KHD A;  2DT6 A;  1KQ0 A;  3WTS C;  1A35 A;  4Y4R A;  1XSD A;  3IL2 A;  2BV6 A;  1WWX A;  5D5V B;  3CC4 I;  3HDD A;  5HVQ C;  3ISP A;  1KU7 A;  1YO5 C;  2HTS A;  3IKT A;  2Y31 A;  1QRY A;  2ZME A;  5EEG A;  4BHB A;  3FIW A;  2EV5 A;  3L2V A;  3ZQL A;  1Y8Q B;  4LK0 F;  5LEJ A;  5ED4 A;  1KYZ A;  4CCK A;  3HL2 A;  1O3T A;  1DDN A;  2B7E A;  4BU2 A;  2ISY A;  2XRN A;  5DUK A;  4BNC A;  3L7W A;  1VQK I;  2UXX A;  3HPH A;  2QVO A;  4M6V A;  3I4M J;  4IOA F;  1IN6 A;  1GUU A;  3ULQ B;  2W4S A;  4I98 B;  3VOE A;  2GXA A;  5TRD A;  1ZRD A;  1JT0 A;  1FYM A;  1FLI A;  2JK3 A;  2DFI A;  2VBY A;  1K6O A;  3CZ6 A;  4HX7 A;  2HFH A;  2FE3 A;  2LG4 A;  2FEZ A;  2K86 A;  5ERI A;  3BR2 A;  2A05 A;  2OAZ A;  2H8R A;  2VJ5 A;  4E4H A;  1ZLJ A;  4IX7 A;  4O5V A;  1HCR A;  1TQM A;  2F5E A;  3I53 A;  3K70 D;  4NQW B;  1MMN A;  3I0T A;  5K1Y A;  3M3Y J;  3D5R C;  5HLH A;  1Z6R A;  3KPH A;  1EF4 A;  1PYV A;  2KIM A;  4LOC A;  4A6D A;  3E6M A;  3TDZ C;  3A01 A;  3M1C A;  3HXL A;  4HV5 A;  3ROU A;  4A5N A;  1WJC A;  1WVR A;  4CCO A;  2PEX A;  2IS6 A;  4L0Y B;  5J1U A;  4MTD A;  3KIO A;  2VI6 A;  2FD5 A;  2Y0S N;  1FYL A;  3C2B A;  2MC3 A;  3B6C A;  3BP8 A;  4HST A;  5FKK A;  3WGH A;  5JHF A;  4PJM A;  1KA8 A;  3EPZ A;  2PJR B;  1WI3 A;  1BR2 A;  2CS3 A;  3KYD B;  1JTX A;  2VT2 A;  5KK1 A;  3CCU I;  4OMZ A;  3PJR A;  4I0A A;  4ZZD A;  1JTY A;  1Z0X A;  1X1B A;  2K40 A;  1SD4 A;  3BG5 A;  1JJ6 C;  1IXS B;  2QBY A;  5L3B A;  2KJC A;  2VPR A;  3SHF A;  2G9W A;  3PQK A;  1U5T B;  2NOG A;  1QVT A;  3S32 A;  2UV1 A;  3HOZ J;  1J5Y A;  5E3L A;  1HBX G;  4UNO A;  1OLT A;  3DXJ F;  2M2E A;  3K0L A;  1W36 C;  1HKT A;  2V1D A;  1EKE A;  2KT0 A;  2DA6 A;  5GAG J;  3CCQ I;  4D7M A;  2K7L A;  2MG4 A;  4KYW A;  3S2H J;  1LEA A;  2KP6 A;  5EGO A;  4MNU A;  3S3N A;  2XC7 A;  1W5T A;  3HOW J;  5FLX Z;  1RZ4 A;  1R36 A;  3CP2 A;  2G0E A;  3NAR A;  1FNN A;  3FK7 A;  5AIP A;  5DCF A;  4ETS A;  4GGG A;  5D5W B;  3LSJ A;  4O3M A;  5ICC A;  5E3M A;  2KJB A;  4WF2 A;  1FJL A;  1EH6 A;  3CCE I;  3A1Y A;  1MD0 A;  4LLG F;  3OYL A;  1B4A A;  3V7R A;  1W5C C;  3CMA I;  1ETV A;  2VQH A;  2HTJ A;  2JQ7 A;  3S16 J;  1R49 A;  1Y0N A;  2VLA A;  3AFH A;  5F0C A;  2RRE A;  1ETQ A;  3KLN A;  2QEX I;  3K2A A;  4PCQ A;  2L2O A;  3S3M A;  3TP3 A;  2L7F P;  3TP0 A;  3WHC A;  3L9F A;  2BW3 A;  2H1K A;  4JOM A;  4BHP A;  1XCB A;  1LFP A;  3GFL A;  3C2H A;  3DQV C;  5J40 A;  3NAU A;  2X48 A;  3NWT A;  2LYC A;  5FD6 A;  3SZP A;  2QGU A;  5D8L B;  2VC1 A;  3JSP A;  4NC7 A;  1WFX A;  4B8X A;  2XF5 A;  4XOP A;  5GAD J;  2MH2 A;  3FBN B;  2EFW A;  4IXA A;  2W25 A;  2NVY J;  5J8C A;  2L02 A;  2Y48 A;  4G8X A;  5LHI A;  2WAQ A;  5GPA A;  1KQ9 A;  3C1D A;  1JXS A;  1F43 A;  1IG7 A;  3H9J A;  2CUJ A;  1J0R A;  2QWW A;  1R5H A;  1QU3 A;  2D1V A;  1JE8 A;  5IPA A;  2O8K A;  1MMD A;  2D45 A;  2ADU A;  1SFE A;  2DMN A;  2L7M P;  3E5X A;  4E6K G;  1Q1V A;  4DW6 A;  3B02 A;  2XKO A;  3TDU C;  4A3F J;  1ETY A;  3MZ8 A;  5D6F A;  1ZRE A;  5IT9 Z;  5TGT A;  2F4I A;  1NG6 A;  3OIP A;  3WHB A;  2K02 A;  1GXQ A;  1K61 A;  2FBI A;  2CH0 A;  3RI4 A;  1FMV A;  5LEK A;  4OIP F;  2JA5 J;  1FP1 D;  3H92 A;  2F48 A;  2J5P A;  2DO7 A;  1G3T A;  4A69 C;  2A68 F;  3LMM A;  4D9J A;  5ICG A;  1J7K A;  1EA3 A;  3BR3 A;  3DU6 A;  2VL8 A;  2CFX A;  3WTV C;  3P9K A;  2HPM A;  4GXO A;  1W0T A;  3HSE A;  1QO0 D;  1P4A A;  3WU0 A;  2Y9Y A;  2V1U A;  1FSE A;  3QPH A;  1KGS A;  3UR3 C;  2K27 A;  4ZTJ A;  3WE3 A;  1E3H A;  2LRE A;  1B6A A;  2ELH A;  1KU3 A;  3FHN A;  1G3Y A;  1IAW A;  2V9K A;  3LQQ A;  3QP5 A;  2Z33 A;  1VQ8 I;  4HQE A;  1E2X A;  4FIS A;  1MBJ A;  2ZBK A;  3I3L A;  3BPV A;  4NB5 A;  1S7A A;  4CYD A;  1O3R A;  1TT0 A;  3VYT B;  4XMY A;  4WWC A;  2DJI A;  3HOU J;  5F0H A;  3CJR B;  4UVA A;  4XNF A;  1B9N A;  5IYC J;  4ZZL A;  1OCR H;  2KFD A;  2IGN A;  4E7L A;  4ABZ A;  4HG2 A;  4W1U A;  1FMW A;  5E1Z B;  4ZJZ A;  3JRC A;  4E7S A;  2EZH A;  3BDD A;  4XKB A;  1K6Y A;  1N77 A;  4KNY A;  2XF6 A;  3HRU A;  3KX2 A;  2XGE A;  2ZFW A;  4XOR A;  3MKL A;  3L1P A;  3I54 A;  5C3E J;  1I6X A;  1JGG A;  2F5D A;  1BIA A;  1PUF B;  1UHW A;  2ZJ2 A;  2LBF A;  2JRM A;  3GWZ A;  3DKY A;  3K4K A;  1QZY A;  5CVV A;  5LGT A;  3S1N J;  3GX4 X;  1T08 B;  3OY9 A;  4CCJ A;  3A2K A;  2HVQ A;  2OA4 A;  1MJ9 A;  1OFC X;  3LSM A;  4U0W A;  3JAM K;  3OYB A;  5A2Q Z;  4QWQ A;  2EB7 A;  4XBF A;  2XAH A;  3FF5 A;  3N4M A;  1HF0 A;  2NNN A;  5FLX K;  3BQZ A;  4LD5 A;  3R4K A;  3CMM A;  3FXK A;  1E3P A;  1MBF A;  1MBH A;  2VQL A;  3F3X A;  5F1J A;  3ZRG A;  3LAP A;  4ITV A;  1EH7 A;  2K4J A;  1ZYR F;  4YIR X;  4G6D A;  4PJL A;  1HSJ A;  3OYN A;  2OCE A;  2Y9Z A;  1I1S A;  1AKH B;  1R1U A;  2V6E A;  3OSG A;  2VE8 A;  4A3C J;  3J7A O;  5HS9 A;  3H0G J;  3FWE A;  1ON1 A;  4IRG A;  2Q1Z B;  3A4C A;  4XRS G;  4BEH A;  2H6B A;  2V4J C;  4V19 K;  1KZH A;  2LY1 A;  3WOD F;  3ZR8 X;  2DPU A;  3JRB A;  5CVJ A;  1T6S A;  5HDG A;  2DAO A;  4K2E A;  2OV7 A;  4F92 B;  1HDP A;  1XMA A;  2L5Q A;  4FE7 A;  5E3O A;  1HA8 A;  2ZME C;  2K9N A;  1X19 A;  3PSI A;  2DFH A;  3VOD A;  4CXF A;  1VI0 A;  4LFU A;  1T95 A;  2FXA A;  5LRS A;  3SZT A;  3P9C A;  2YU3 A;  4XRF A;  2VOD A;  2GIZ A;  4V2F A;  4LJZ F;  3FXO A;  2KMU A;  2IA0 A;  2O61 A;  3AG1 H;  2H27 A;  2YX4 A;  1VND A;  3KP7 A;  2GIV A;  3BG6 A;  2ME0 A;  4KIG A;  2QQ8 A;  1T33 A;  1P6R A;  3CJN A;  3H5R A;  2O0Y A;  3SFZ A;  3I55 I;  3ZPL A;  3HC7 A;  1R1T A;  3G73 A;  3ZN1 A;  2VBZ A;  3ABU A;  3K10 A;  3LSP A;  1SFK A;  3E1S A;  4A3J J;  1GV2 A;  2DOA A;  3K4M A;  4EJV A;  4MIM A;  4ZYE A;  1RR8 C;  1QPM A;  4HYE A;  3N97 A;  1Z3X A;  1P7I A;  3AG2 H;  4WK8 F;  3EET A;  1A04 A;  4IOC F;  4BHC A;  2ZME B;  1JKO C;  2HOA A;  1TL8 A;  2EIL H;  4BS9 A;  4M6X A;  2CSO A;  3JRF A;  4A3B J;  1FTT A;  3KZZ A;  1Z77 A;  2ID6 A;  1MBE A;  1DU0 A;  3KEO A;  2FF4 A;  3CC7 I;  2X6X A;  4N0B A;  3K6G A;  4KJZ A;  3FMR A; 
#chains in the Genus database with same CATH homology
 3B73 A;  1Z7U A;  2YSR A;  2C6Y A;  1FC3 A;  3LA7 A;  2VC0 A;  2H09 A;  4S04 A;  3QAH A;  1MKM A;  4M73 A;  1ZRF A;  2HGC A;  4P9F A;  5DYM A;  4HX8 A;  3RJP A;  1U8R A;  3VB2 A;  1LDJ A;  2FOK A;  2PN6 A;  2K4B A;  1T38 A;  1FYK A;  3BWG A;  1Z9C A;  1J9I A;  5DCM B;  1YIO A;  5J6X A;  3QOP A;  3F8C A;  1Z05 A;  1FOK A;  2XV4 S;  3U9G A;  2Q0O A;  5D6E A;  2WV0 A;  5CJ9 A;  2M8E A;  4YII A;  1F4K A;  5HS7 A;  1QNT A;  3TKY A;  1SFU A;  4RGU A;  1E17 A;  4HLX A;  3LQR A;  3FZV A;  3T1B A;  3I59 B;  3GVA A;  5LHH A;  4HW0 A;  1GVJ A;  2Z3Y A;  4HOB A;  1GXP A;  2P7V B;  4KA4 A;  2D2W A;  4QLC U;  1IXC A;  3V7C A;  4HF1 A;  2PMH A;  4YG2 F;  3FM5 A;  4ESJ A;  4N9H A;  2FRH A;  4M72 A;  4ESB A;  5D4S A;  2VBX A;  4XSZ F;  3HTS B;  3R6S A;  4UUV A;  2FNP A;  4P5O A;  4IHT A;  1YW9 A;  2EWN A;  1OR7 A;  1LB2 A;  1K78 B;  1G3W A;  1S3J A;  1PP8 F;  2IRF G;  1Z91 A;  1GHC A;  1SAX A;  4R8H A;  1OKR A;  4EQQ A;  3HSF A;  1BBY A;  3GO5 A;  1DUX C;  5JVT A;  4YIF A;  1WKM A;  4KN7 X;  2X0L A;  2P5L C;  1B59 A;  1FBU A;  2QZ8 A;  2JZY A;  2GA1 A;  1YW7 A;  4L9N A;  3GFJ A;  2PBI A;  5AON A;  1ZH5 A;  1T0F A;  4DNC A;  2M45 A;  5JI6 A;  2MD5 A;  5HLI A;  2Q2E A;  2E1C A;  2NS0 A;  3PFI A;  3M9A A;  1RNL A;  2M5W A;  1XGN A;  1STZ A;  3F21 A;  3FMS A;  4Q5S F;  2PG4 A;  2BEO A;  1JGS A;  3F23 A;  2TDX A;  4M6Y A;  3IHU A;  3GFI A;  2UXN A;  1ON2 A;  3LA3 A;  3I5U A;  1QBJ A;  1FPQ A;  3DEU A;  4D0P A;  1XSX A;  2DPD A;  3LA2 A;  3R0A A;  3TQN A;  3COA C;  1XN7 A;  4OMY A;  4XLP F;  2FNA A;  3IRR A;  3HUG A;  4NHJ A;  4RB3 C;  1HXD A;  4AD9 A;  4EM0 B;  1U6G A;  4RB0 A;  2F5C A;  2P6S A;  2R7D A;  4LG0 A;  1FT9 A;  1G3S A;  4LG0 B;  5D4R A;  4S05 A;  1P2F A;  1IF1 A;  3M8E A;  4EJO A;  3MFK A;  2BE5 F;  4LB6 B;  2G7U A;  3Q5F A;  1XSV A;  1YW8 A;  2W84 A;  2AXL A;  4RS8 A;  2FBH A;  4RB1 A;  3OV8 A;  2P7C B;  2ETH A;  2E7X A;  2XRO A;  1AWC A;  2ESN A;  3F72 A;  1TNT A;  2EFN A;  1F9N A;  2RN7 A;  1WSU A;  1QQI A;  3MWM A;  2HYF A;  5E20 A;  2RVC A;  2EFQ A;  3WTT C;  3TO6 A;  1IW7 F;  1XGO A;  2RDP A;  2DK8 A;  4A0X A;  4G7H F;  4PDK A;  3WTZ A;  3W6K B;  3ZQ7 A;  2RQP A;  4KT5 C;  3FXR A;  3MCZ A;  1OMI A;  1FBS A;  1B1B A;  1R5G A;  4EMS A;  1L0O C;  2XAS A;  1ZAO A;  3NEU A;  3K2Z A;  5F6F A;  2FMY A;  1U2W A;  1CF7 A;  5JR3 A;  4Q48 A;  1SD6 A;  1ZLK A;  3U1D A;  5LGU A;  2QEN A;  2RV8 A;  4FHT A;  2YPR A;  2RKH A;  2QYO A;  2IT0 A;  1UHM A;  3IKV A;  2RGV A;  3CLO A;  3GZ5 A;  2QQA A;  3GZ6 A;  1S8N A;  1R1V A;  2XKP A;  1V4R A;  3C18 A;  5L3D A;  2GAU A;  1OYW A;  1W4M A;  5BPI A;  2Y75 A;  2NAZ A;  1T2K A;  1R7J A;  5E8G A;  4MQ9 F;  4MGR A;  1PDN C;  1G6N A;  4KIB A;  2WTE A;  2V9V A;  3NRV A;  2HZT A;  3KE2 A;  1W5S A;  3WTW C;  3C7J A;  2EA4 A;  1FX7 A;  1ZG1 A;  5E1W A;  3CUQ C;  2KIF A;  1BC8 C;  3I58 A;  1D8K A;  5L3G A;  1SMT A;  3I4P A;  4GO1 A;  1U5T A;  5FB2 A;  1WRJ A;  4KMU X;  3RDI A;  2P5K A;  3QP6 A;  1ZAR A;  2A5Y B;  3FX3 A;  4Q47 A;  3ABT A;  1TLH B;  1S29 A;  3MZH A;  2COM A;  1XD7 A;  1YFH A;  3DPT A;  3FM3 A;  2AS5 F;  1ZGJ A;  2P4W A;  2E7W A;  3T8T A;  4LB5 A;  1O3S A;  3HRM A;  1J2X A;  5E17 F;  4R79 A;  3T5X A;  1BC7 C;  2HOE A;  3C3W A;  4HBL A;  1PUE E;  4MTE A;  4BQA A;  1SMY F;  4LGW A;  3W6J B;  5ILU A;  2LF7 A;  4UVC A;  2VXZ A;  1O7L A;  4GYI A;  4ON0 A;  4LK1 F;  5E8I A;  4WX9 A;  3ML6 A;  1BN5 A;  3LWF A;  1UB9 A;  2VT3 A;  2GQQ A;  1BI0 A;  2R7F A;  3HYI A;  1EH8 A;  2HDC A;  5BOX A;  1WQ2 A;  3HTU A;  3E6B A;  3MEX A;  1XDS A;  3CTA A;  3KET A;  1P92 A;  3J80 K;  5JFR A;  1R00 A;  1MZB A;  3H3Z A;  2STT A;  3HOT A;  2IW5 A;  5H20 A;  3F6O A;  1LNW A;  3RYP A;  2QUF A;  1ODD A;  1SFX A;  2XGX A;  3BRO A;  1FY7 A;  1CF7 B;  3HRS A;  2P5V A;  3KZY A;  3DPL C;  3TO7 A;  2FU4 A;  4LMY A;  2MLG A;  1XB4 A;  1P4X A;  4P96 A;  3F8M A;  5DEQ A;  2CQK A;  4YFN F;  5BQT A;  3TO9 A;  2V79 A;  3GUD A;  4I09 A;  3WU1 B;  1ZRC A;  4ENN A;  4OIR F;  2RNJ A;  3DF8 A;  2EFO A;  5HDK A;  2EV6 A;  3U2R A;  4EJT A;  1BI3 A;  5LLQ A;  1IN8 A;  4HX4 A;  3WE2 A;  4XLN F;  1UCR A;  1X3U A;  2HS5 A;  1OPC A;  4EVI A;  2ESH A;  1RUN A;  3RPQ A;  4PGG A;  5HLG A;  2EA2 A;  4CO8 A;  3E6C C;  3G3Z A;  4M9Z A;  4RAZ A;  2KRF A;  2FSW A;  1R22 A;  1K79 A;  5BPD A;  4KDP A;  5BMZ A;  3IWF A;  4FX0 A;  2PFB A;  4FT8 A;  4BYY A;  1JHH A;  1HKS A;  1SD5 A;  4HZF A;  1I1G A;  5HOO A;  5IT3 A;  2VBW A;  4PZJ A;  5ICF A;  2JRT A;  2XUB A;  3S2W A;  3E6D A;  4Q4Z F;  4YFK F;  5L3C A;  1ZG3 A;  2A07 F;  3GW2 A;  4UV8 A;  2IVM A;  3K9T A;  5DUI A;  1I27 A;  4E70 A;  4IF4 A;  2MA3 A;  1H9G A;  3AAF A;  2V6C A;  5A2Q K;  3KP2 A;  4M71 A;  4CHU A;  2GZW A;  3IRQ A;  1LEB A;  4AWX B;  1TW3 A;  2LDU A;  2JSC A;  3DKW A;  3ELK A;  4BH9 A;  2RC4 A;  4HDV A;  2P6T A;  3CO7 C;  3IC7 A;  4Y17 A;  2Z9O A;  4NQW A;  1XGS A;  3REO A;  4H0E A;  3PQJ A;  2IPQ X;  1PP7 U;  4LLL A;  1BI2 A;  3KLO A;  5FD5 A;  4IRI A;  4RGR A;  5ILS A;  4BAY A;  3ZMU A;  2FQ3 A;  2DTR A;  3KEQ A;  1O7F A;  4OU0 A;  2OD5 A;  2DK5 A;  3P7N A;  4KN4 X;  4M9X A;  5CVI A;  5ICE A;  1BI1 A;  4P55 A;  1H0M A;  2L54 A;  1HKQ A;  2Z5U A;  4JBA A;  2NRA C;  3I71 A;  3DFG A;  3L09 A;  2JPB A;  2A6H F;  4KIF A;  1YS6 A;  2ZO4 A;  4PGH A;  5K5O A;  4TV7 A;  2V1X A;  3ZMZ A;  5F1R A;  4HDU A;  4EGY A;  1TQP A;  4UXN A;  4XSX F;  1G4D A;  4YFX F;  2D1H A;  1OYI A;  3GYH X;  2GWR A;  5DV5 A;  4Y15 A;  4B09 A;  2MLK A;  4RB2 C;  2ZKZ A;  2XIG A;  1CGP A;  4EGZ A;  5DD8 A;  2DU9 A;  2W24 A;  4EM1 A;  3BY6 A;  5LGN A;  2X4H A;  3MAJ A;  2O6G E;  2PQ8 A;  4ENJ A;  3ZMD A;  3F8N A;  2PJP A;  1P4W A;  3V4G A;  4ZH4 F;  2QQ9 A;  1IXR C;  3V7S A;  1W7P A;  4L18 B;  4U88 A;  4UHT A;  4AIJ A;  5H6Q A;  2BBY A;  1H9T A;  3M7G A;  1MJA A;  1XGM A;  2UWM A;  3GFM A;  1U5T C;  4N9I A;  4UV9 A;  5FGM A;  4AIK A;  2CW0 F;  1TW2 A;  3EUH A;  1BOA A;  2DLL A;  3K1P A;  5D5U B;  1USS A;  4P9U A;  3LST A;  2DBB A;  4MHG A;  4I2O A;  3SQN A;  3ECH A;  2VOO A;  4WCG A;  1LDD A;  4M74 A;  3J80 Z;  3FHZ A;  2HEO A;  5LRR A;  2HYG D;  5FFZ A;  3DV8 A;  3JTH A;  2L4A A;  1W7P D;  1MJB A;  4WXC A;  3K1N A;  5H6R A;  1EV7 A;  4G7O F;  3SXY A;  3ERE D;  4L5J A;  2CYY A;  2MBF A;  1K78 A;  2ZNZ A;  2A61 A;  4RGX A;  1K7A A;  4MEX F;  1XDU A;  1LDK B;  3GXO A;  2DW4 A;  3HRT A;  1IN7 A;  2LSO A;  2CGP A;  2JT1 A;  2VON A;  2FBK A;  2VOP A;  1REP C;  2OZ6 A;  1R58 A;  3D0S A;  1XCV A;  2A6E F;  4GYG A;  2GXB A;  1ZHF A;  4RAY A;  1ZG5 A;  3F6V A;  3KCC A;  4KMF A;  1IN5 A;  4F7Z A;  1TBX A;  2L3D A;  2M87 A;  4A2U A;  2OU2 A;  2B0L A;  1D8J A;  2HKO A;  2OQR A;  2L4M A;  3KP3 A;  3R61 A;  4IRH A;  4WXH A;  5DD4 A;  2VN2 A;  3V8K A;  3I59 A;  1FWZ A;  3KP6 A;  1O57 A;  3CUQ A;  3NQO A;  5EEH A;  4G9Y A;  3WGG A;  5CVU A;  2EJR A;  4U0V A;  3L2C A;  3R60 A;  3E5U A;  4CDG A;  3BOQ A;  1WI9 A;  1F1Z A;  3E97 A;  4OIO F;  1Z1D A;  2WWY A;  1AOY A;  2M30 A;  1S7O A;  2YR2 A;  3M8F A;  5DCM A;  2F5F A;  1D5V A;  1KQ8 A;  1L3L A;  4AVP A;  3JAM Z;  2JPC A;  3BJO A;  6PAX A;  2LF8 A;  2W57 A;  3F8F A;  2NNY A;  5AIQ A;  3BPX A;  2Q8K A;  3WTX C;  3KFW X;  1S6L A;  3ECO A;  3TGN A;  2FML A;  4I7H A;  1JHF A;  2DT5 A;  4IHS A;  4CZZ A;  1HST A;  3ZMS A;  3F8B A;  5CYV A;  2OBP A;  2XAG A;  4IVN A;  1HW2 A;  2IA2 A;  4ENM A;  3QPT A;  1FBQ A;  2HWV A;  4G6Q A;  1HW1 A;  3GF2 A;  1MDM A;  2HQN A;  4HF2 A;  4ZYD A;  1HW5 A;  3WTU C;  3J81 K;  5K5Q A;  4JK1 X;  5DDG A;  4IJA A;  1O3Q A;  1ONV A;  1ZN2 A;  4ZYH A;  2W85 A;  4KIC A;  3ZN0 A;  4ZYG A;  5E1X A;  1NHA A;  5IT9 K;  4KFC A;  3RIR A;  1R23 A;  3MQ0 A;  3D5L A;  1XMK A;  1UST A;  2ZCW A;  4U7B A;  2EV0 A;  3O6B B;  5HS8 A;  4A5M A;  1YLF A;  3BJ6 A;  1ZGA A;  3T0Y A;  5HDN A;  2DI3 A;  1TTY A;  3E5Q A;  5FO5 A;  2G7H A;  4CIC A;  1J59 A;  4CGZ A;  1B9M A;  5D8K B;  2ZXJ A;  3BZ6 A;  2CG4 A;  2CO5 A;  3L00 A;  4LLN A;  4ESF A;  1F5T A;  1IN4 A;  1IUY A;  4M9S A;  2BYV E;  3RPU A;  1TNS A;  3O2P E;  4I01 A;  1MDM B;  3TOB A;  1Q1H A;  3HHH A;  3HIF A;  3VEP A;  4L9V A;  3OOP A;  3EYY A;  3H3U A;  3MZY A;  3HOS A;  2QM3 A;  3R0J A;  2DQL A;  2KIU A;  1YG2 A;  4MEY F;  4I0B A;  2UZK A;  3V8L A;  4A12 A;  3I64 A;  4ASN A;  1LQ1 A;  3Q9S A;  4G7Z F;  2JTV A;  4WXD A;  4G94 A;  4HV6 A;  1VTN C;  4L0Z B;  5KVR A;  1HQC A;  1KU9 A;  5CVR A;  1J75 A;  1SD7 A;  4JQF A;  1U3E M;  1C0W A;  4OIQ F;  2H6C A;  3CDH A;  4EJU A;  2YX7 A;  1YYV A;  1YTY A;  2EK5 A;  1D3Y A;  2HKX A;  3CO6 C;  2IJL A;  2IA1 A;  3QU6 A;  3RKW A;  2Z99 A;  2PLY A;  2XAJ A;  4HF0 A;  2GXG A;  1FZP B;  5JHU A;  5CLS A;  5L3F A;  2VE9 A;  4ENK A;  3JSO A;  3ZP5 A;  3V8J A;  2LNB A;  2M1B A;  3QRF F;  3HHG A;  1YQA A;  4DQ2 A;  2H94 A;  2XAF A;  3GLX A;  4A6E A;  1LJ9 A;  1DPR A;  3O3K A;  3RYR A;  3RKX A;  3ZMV A;  5BS6 A;  1DP7 P;  4UVB A;  3WTY C;  4MQV A;  4U7D A;  2OQG A;  5TJJ A;  1U78 A;  2A69 F;  2GA2 A;  2L01 A;  1T98 A;  3RTR A;  3K69 A;  2DQR A;  1QZZ A;  2KKO A;  3F22 A;  1TQI A;  3FXQ A;  1I5Z A;  2BGC A;  1UFM A;  4U0Y A;  4BXU A;  2QBY B;  3DP7 A;  3FXU A;  3TOA A;  2O3F A;  2XAQ A;  3ZMT A;  1KU2 A;  2E1N A;  1Z6T A;  2IP2 A;  2O03 A;  2PMU A;  3EYI A;  1OYY A;  3E3V A;  3KP5 A;  5FFX A;  2HQR A;  1RIO H;  1DPU A;  5J8F A;  2R3S A;  2PI0 A;  1RI7 A;  2Y0M A;  4R1H A;  1ULY A;  3T8R A;  5D5X B;  3VFZ A;  5F64 A;  1W7P B;  4KUM A;  1MGT A;  3M1E A;  3FMQ A;  4HA8 A;  3JW4 A;  1LVA A;  4A0Z A;  3CUQ B;  4O6J A;  3IWZ A;  1FP2 A;  4FX4 A;  2QQB A;  3HSR A;  1V3F A;  4IPA A;  4HLY A;  4A0Y A;  4EV0 A;  1QGP A;  3EDP A;  2STW A;  2FA5 A;  3EQL F;  2A3S A;  2F2E A;  4OOI A;  1BM9 A;  1IZ1 A;  4EM2 A;  3JTG A;  1RUO A;  2OZU A;  1BIB A;  1T39 A;  4Z2Y A;  3WGI A;  2LKP A;  2P8T A;  2MH9 A;  3GEZ A;  5K5R A;  3CUO A;  4HQM A;  4I02 A;  3K1M A;  4L9J A;  2EFP A;  3LFK A;  3BJA A;  3J81 Z;  2O8X A;  2CWE A;  4L5I A;  3KP4 A;  1IRG A;  2ACJ A;  2WC2 A;  2ZNY A;  4HAM A;  2XVC A;  2J5O A;  4AIH A;  3Q9V A;  1Y0U A;  1KYW A;  5LHG A;  3RKY A;  2QLZ A;  1FSH A;  2HR3 A;  5E18 F;  3LAJ A;  4EJW A;  3WG9 A;  5L3E A;  4GCV A;  3QU3 A;  2ISZ A;  5ILV A;  3P9I A;  4Y13 A;  2XHK A;  1IRF A;  4OIN F;  1YS7 A;  4RGS A;  1BJA A;  2NYX A;  5LBQ A;  4L9T A;  1KQ0 A;  3WTS C;  1XSD A;  3IL2 A;  2BV6 A;  1WWX A;  5D5V B;  5HVQ C;  3ISP A;  1KU7 A;  1YO5 C;  2HTS A;  3IKT A;  2ZME A;  5EEG A;  4BHB A;  2EV5 A;  4LK0 F;  5LEJ A;  5ED4 A;  1KYZ A;  1O3T A;  1DDN A;  2ISY A;  2XRN A;  5DUK A;  4BNC A;  3L7W A;  2UXX A;  2QVO A;  1IN6 A;  3ULQ B;  4I98 B;  3VOE A;  5TRD A;  1ZRD A;  1FYM A;  1FLI A;  2DFI A;  2VBY A;  1K6O A;  4HX7 A;  2HFH A;  2FE3 A;  2FEZ A;  2K86 A;  5ERI A;  2OAZ A;  1ZLJ A;  4O5V A;  1TQM A;  2F5E A;  3I53 A;  3I0T A;  5K1Y A;  5HLH A;  1Z6R A;  2KIM A;  4A6D A;  3E6M A;  3TDZ C;  4HV5 A;  3ROU A;  4A5N A;  2PEX A;  4L0Y B;  4MTD A;  1FYL A;  2MC3 A;  3BP8 A;  3WGH A;  1KA8 A;  2VT2 A;  5KK1 A;  4OMZ A;  4I0A A;  4ZZD A;  1SD4 A;  1IXS B;  2QBY A;  5L3B A;  2KJC A;  3SHF A;  2G9W A;  3PQK A;  1U5T B;  1J5Y A;  1HBX G;  4UNO A;  3DXJ F;  3K0L A;  1HKT A;  2V1D A;  2K7L A;  4KYW A;  1LEA A;  4MNU A;  1W5T A;  5FLX Z;  1RZ4 A;  1R36 A;  1FNN A;  5AIP A;  5DCF A;  4ETS A;  4GGG A;  5D5W B;  4O3M A;  5ICC A;  2KJB A;  4WF2 A;  1EH6 A;  1MD0 A;  4LLG F;  1B4A A;  3V7R A;  2HTJ A;  3KLN A;  4PCQ A;  3L9F A;  4BHP A;  1XCB A;  3GFL A;  3DQV C;  5FD6 A;  3SZP A;  5D8L B;  2VC1 A;  3JSP A;  4B8X A;  2MH2 A;  2EFW A;  4IXA A;  2W25 A;  5J8C A;  2L02 A;  2Y48 A;  4G8X A;  5LHI A;  1KQ9 A;  3C1D A;  1JXS A;  1J0R A;  2QWW A;  1R5H A;  2D1V A;  1JE8 A;  2D45 A;  2ADU A;  1SFE A;  3E5X A;  3B02 A;  2XKO A;  3TDU C;  5D6F A;  1ZRE A;  5IT9 Z;  2K02 A;  1GXQ A;  2FBI A;  3RI4 A;  5LEK A;  4OIP F;  1FP1 D;  3H92 A;  2J5P A;  2DO7 A;  1G3T A;  2A68 F;  5ICG A;  1J7K A;  2CFX A;  3WTV C;  3P9K A;  4GXO A;  3HSE A;  1QO0 D;  1P4A A;  3WU0 A;  2V1U A;  1FSE A;  3QPH A;  1KGS A;  2K27 A;  3WE3 A;  1B6A A;  2ELH A;  1KU3 A;  1G3Y A;  1IAW A;  3LQQ A;  3QP5 A;  2Z33 A;  4HQE A;  1E2X A;  2ZBK A;  3BPV A;  4NB5 A;  1S7A A;  4CYD A;  1O3R A;  4WWC A;  4UVA A;  1B9N A;  4ZZL A;  5E1Z B;  3BDD A;  4KNY A;  3HRU A;  2ZFW A;  3I54 A;  1I6X A;  2F5D A;  1BIA A;  1UHW A;  2ZJ2 A;  3GWZ A;  5CVV A;  5LGT A;  1QZY A;  3GX4 X;  2OA4 A;  1MJ9 A;  3JAM K;  4U0W A;  5A2Q Z;  4QWQ A;  2EB7 A;  4XBF A;  2XAH A;  3FF5 A;  3N4M A;  5FLX K;  2NNN A;  4LD5 A;  3R4K A;  3F3X A;  3LAP A;  1EH7 A;  2K4J A;  1ZYR F;  4G6D A;  1HSJ A;  1I1S A;  1R1U A;  2VE8 A;  3J7A O;  5HS9 A;  3FWE A;  1ON1 A;  4IRG A;  2H6B A;  3WOD F;  2DPU A;  5CVJ A;  1T6S A;  5HDG A;  2DAO A;  4K2E A;  1XMA A;  3VOD A;  5LRS A;  4CXF A;  4LFU A;  2FXA A;  2VOD A;  3SZT A;  3P9C A;  2YU3 A;  4XRF A;  4LJZ F;  2O61 A;  2IA0 A;  2H27 A;  2YX4 A;  3KP7 A;  2GIV A;  4KIG A;  1P6R A;  3CJN A;  2O0Y A;  3SFZ A;  3ZPL A;  1R1T A;  3G73 A;  3ZN1 A;  2VBZ A;  3ABU A;  4EJV A;  4ZYE A;  1QPM A;  4HYE A;  3N97 A;  4WK8 F;  3EET A;  1A04 A;  4BHC A;  2ZME B;  4M6X A;  2CSO A;  3KZZ A;  3KEO A;  2FF4 A;  4N0B A;  3FMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...