4IHSA

Crystal structure of benm_dbd/catb site 1 dna complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator BenM
publication title The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators.
pubmed doi rcsb
source organism Acinetobacter sp.
molecule tags Transcription/dna
total genus 33
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ihsA00
2EK5A 2D1VA 2UWMA 5KVRA 5LEJA 5J6XA 2HDCA 2A6HF 3H92A 1TQIA 2HYGD 2W57A 1YQAA 3EYYA 1W7PB 3D0SA 2HEOA 1ODDA 1G3SA 2F2EA 1W4MA 1OYYA 1P4AA 2M30A 5K5QA 3NQOA 3F23A 3BJAA 3BWGA 3WTTC 2XAJA 3VEPA 1P92A 2A69F 2CG4A 4GYGA 2M1BA 1OYIA 2Z99A 2W84A 2L4AA 2O0YA 4ESFA 1LDKB 1I6XA 5LHHA 3K2ZA 3RYPA 4XSXF 3E5QA 3E6MA 3GXOA 2VE9A 1XMKA 2XAGA 5L3CA 1BN5A 1MDMA 4L18B 1MJ9A 3ABTA 2RQPA 1FPQA 1XD7A 2XHKA 2M87A 1U5TA 1IN7A 3GO5A 1WI9A 2FBHA 4FHTA 3BJ6A 5DUKA 4KT5C 2G7UA 3IC7A 1I1GA 1I5ZA 2DQRA 4BH9A 4BHPA 1KYWA 4DNCA 3BOQA 1XGOA 4JQFA 4JK1X 2LDUA 2IA2A 3HRMA 3JAMK 3GZ6A 3COAC 4BQAA 5D4SA 2L4MA 5BPIA 1QZZA 1HXDA 2ADUA 2LSOA 3E6BA 4UVBA 3CDHA 1BOAA 1W5TA 6PAXA 2MLGA 1XMAA 1BI1A 4HDUA 3F6VA 2D2WA 1JHHA 4U0YA 1O3TA 5HOOA 2JRTA 3T8TA 1Q1HA 3KE2A 2HS5A 1H9TA 3VOEA 3BZ6A 4M9ZA 5DV5A 4HF1A 3WTZA 4MGRA 1PP7U 1LDDA 2NRAC 2GA1A 4EV0A 5A2QK 1WRJA 3FX3A 1YLFA 2DI3A 1ZAOA 4YG2F 2CW0F 2XUBA 3TOAA 1PDNC 4B09A 2VBWA 1DDNA 1T38A 4OMZA 4A5NA 3FM5A 2PBIA 1U5TC 4RGUA 2VXZA 3RI4A 3DV8A 3GFLA 1ZRFA 2STTA 3D5LA 1FBQA 5CLSA 2PN6A 5HLHA 3I59B 2GZWA 1T98A 1SD4A 3FM3A 4Q5SF 1LQ1A 1AOYA 4M6YA 1S6LA 1V3FA 3R4KA 2PMHA 5AONA 3FF5A 3L00A 3WE2A 1LVAA 2MLKA 5FD6A 3I54A 1L0OC 1PP8F 3JTHA 2DFIA 2ZNZA 4A5MA 1UHMA 3ZN0A 3CO6C 3GVAA 5E1XA 1JE8A 2W25A 4EJOA 4KIFA 2XKPA 5H20A 3WTXC 3FMRA 4RB2C 3LAJA 4YFXF 4N0BA 5D5XB 1K6OA 1Y0UA 1J7KA 3T0YA 3SHFA 5LBQA 4F7ZA 3ZMVA 3F21A 3C18A 5IT9K 5D5WB 3TQNA 5JR3A 1UCRA 4R8HA 4E70A 4GO1A 2HR3A 4U0WA 1SD6A 2CQKA 2XROA 4HQEA 2JZYA 4I02A 2DPDA 4RB0A 4EMSA 2YX4A 2EA2A 3LA2A 3E6CC 4ENJA 2PJPA 2P5KA 1U6GA 5AIPA 3QU3A 4L0YB 5BMZA 4PCQA 3SZTA 3ECOA 4KIGA 5CJ9A 1KQ0A 4Y17A 4RGSA 2YSRA 3L7WA 4HYEA 5K5RA 4N9HA 2FMYA 2QENA 2LF8A 2PG4A 2P6SA 1TLHB 4LK1F 1LEAA 2OQGA 1KGSA 1T6SA 3MCZA 3EDPA 2KKOA 3DP7A 2ZJ2A 4ZYDA 2QLZA 2C6YA 1UHWA 5F64A 4LLGF 1R22A 4LLLA 2DQLA 2O6GE 2A3SA 5CYVA 4MEYF 4PDKA 3MEXA 1BJAA 2W24A 2ZKZA 2HYFA 3GWZA 3V4GA 2PMUA 1IW7F 2RC4A 3C7JA 3DKWA 4AD9A 3VB2A 5CVUA 3TDUC 4YIFA 1IN6A 4M9XA 2EFQA 1P2FA 3GFMA 2BEOA 2JTVA 3ABUA 4I98B 3KP4A 3SFZA 1E17A 2VONA 4S05A 3R61A 4IHSA 2XASA 4ASNA 1GVJA 2YU3A 5DEQA 4G6QA 4R79A 3K1NA 2GA2A 2RV8A 2OQRA 4HF2A 2PQ8A 2OZ6A 3I71A 1R36A 4EM0B 2HOEA 1R23A 3TKYA 3MFKA 1YO5C 3HSRA 4HX4A 4IVNA 2RKHA 4O5VA 4KUMA 1ZG1A 1ON2A 2A5YB 3HUGA 3L2CA 1IN5A 5DCMA 4OU0A 2FNPA 4XRFA 2HKOA 4CZZA 2EFWA 2RNJA 5BS6A 4U88A 4ESBA 1EH7A 4IF4A 1IXRC 1OKRA 5L3FA 2GIVA 5E18F 4Z2YA 3F8NA 1FBSA 2YR2A 1W7PA 1H0MA 4UUVA 4L5JA 2KRFA 1ZREA 4XLNF 1LJ9A 4A0ZA 2P8TA 1FT9A 1G6NA 4RAYA 3TO6A 4Y15A 3TDZC 2ZXJA 1REPC 3DQVC 3KP2A 5D8LB 4MQ9F 3N97A 3F72A 2DO7A 4M9SA 4YIIA 4IXAA 4KDPA 5FO5A 3U1DA 4EM2A 3BDDA 3NRVA 2RVCA 2BYVE 3JSOA 1R1TA 2FSWA 4RGXA 2RN7A 1XGNA 3FMSA 1EH8A 2ZO4A 2UXXA 4BHCA 3J81Z 1J0RA 1ON1A 3FXRA 4O6JA 2VT2A 2NAZA 4I2OA 2F5FA 4KYWA 2FBKA 1CF7A 5LRRA 4G9YA 3KEOA 2V9VA 4ZZDA 5E1ZB 4U7BA 4OIOF 5FFXA 1FWZA 1T39A 2GQQA 1FSEA 1J59A 2V79A 5KK1A 3GFIA 4RAZA 4ETSA 4P5OA 4MQVA 3WU0A 1USTA 2P7CB 3R0AA 5ERIA 3WGGA 1BIAA 2VODA 1MJBA 3QP5A 3QPTA 1HKQA 4HAMA 4HZFA 3TO7A 2AXLA 2O8XA 2Q0OA 5E8GA 1KU3A 2CYYA 3RPUA 1E2XA 3IRRA 4EGZA 1TW3A 3I64A 1I27A 2QUFA 3DPTA 2FF4A 1LNWA 4RB1A 3M8EA 4WX9A 5K1YA 4LB6B 2LNBA 3WG9A 1HKSA 3MZYA 4KMFA 2KJBA 2XAQA 5HDKA 2MBFA 2Y75A 1J9IA 1IRGA 2E1NA 1SD5A 4IPAA 3ZMSA 1O7LA 2DPUA 2ESNA 1G3YA 3IHUA 1FZPB 2ZNYA 1Z1DA 3LA3A 2XRNA 3R6SA 3I59A 2FOKA 1WWXA 3VFZA 3PFIA 3J80Z 3HRUA 5FLXZ 2IJLA 3V7CA 2YPRA 4ZZLA 2Q2EA 2FA5A 3Q9SA 4M74A 2FEZA 5LLQA 4M73A 2H09A 1YG2A 2K4JA 1QO0D 3M9AA 2PFBA 3CLOA 2KJCA 3LSTA 3RJPA 4OIQF 3DEUA 5D4RA 4R1HA 4G7OF 1ULYA 1HW1A 4HDVA 4IRIA 3OOPA 3CTAA 5D5UB 1RIOH 5CVIA 2OD5A 3F22A 3GFJA 1DP7P 4KN7X 2OZUA 3V8JA 1HQCA 4L0ZB 4A6EA 3L09A 1GXQA 5BQTA 2JPCA 2IA1A 1C0WA 5HS7A 4UVAA 3ZN1A 4I0AA 3L9FA 5E8IA 2A07F 4BXUA 1XGMA 4M72A 3V8LA 3R60A 2WWYA 1F5TA 2JT1A 3KP5A 3B73A 3BP8A 4EGYA 4RS8A 3BROA 1IN4A 3LFKA 2DAOA 5CVVA 1XSVA 1P4XA 2VBZA 4EQQA 3BY6A 2P5VA 1KU2A 1P6RA 2VBXA 4ENNA 1XN7A 5EEHA 2X4HA 3LAPA 3WTUC 5JHUA 2XV4S 3T1BA 4OINF 3GZ5A 1MZBA 3JW4A 4HX7A 2R7DA 1HSJA 2JPBA 3I5UA 3MZHA 3GX4X 4UVCA 1DUXC 3H3UA 4M71A 2ETHA 1D5VA 2A6EF 1J2XA 4HLXA 4AWXB 3BPXA 3MAJA 1SD7A 3O2PE 4BAYA 1QGPA 2HTJA 2VT3A 2VBYA 5JI6A 2L02A 2BGCA 2IPQX 4HF0A 2WTEA 2STWA 4G8XA 2L54A 4GCVA 1IF1A 1TW2A 1U3EM 2FQ3A 4MNUA 4L9TA 1FX7A 4HQMA 1U5TB 3ELKA 2GXBA 3S2WA 4LB5A 3K1PA 2NYXA 1FYKA 2LF7A 1DPUA 3I0TA 3N4MA 3K1MA 4CYDA 3LWFA 3E5XA 3ZPLA 1R5HA 4IJAA 4Q47A 1UFMA 4UV9A 2GWRA 3KP7A 4XSZF 1LB2A 4CXFA 4MTDA 1ZH5A 4ENKA 3FMQA 4MTEA 2XVCA 4BYYA 2BBYA 2JSCA 2HWVA 1B59A 4I01A 3Q5FA 1QBJA 2L01A 3KETA 1GXPA 3IKTA 2HTSA 1YYVA 4YFKF 4WXHA 3U9GA 4KN4X 1Z91A 2PI0A 5LHIA 1TQMA 2ISYA 4G7HF 3TOBA 2HZTA 5DDGA 3RPQA 5L3GA 4NHJA 4JBAA 2Y48A 2EJRA 2QQBA 3P9CA 3F6OA 1JGSA 2IW5A 2NNNA 1SMTA 4XLPF 3KZZA 3HTUA 1ZRDA 1ZGAA 1RZ4A 4LG0A 1B9MA 2MC3A 5J8CA 2VN2A 2KIUA 3DFGA 5LGUA 2QVOA 4LMYA 2VE8A 1YIOA 3M1EA 4P9FA 1DPRA 2VC0A 1JXSA 4ZH4F 2H6CA 5HS9A 1QPMA 1MJAA 3I4PA 5DD4A 5D5VB 2E7WA 5H6QA 2PLYA 1D3YA 2BV6A 1IZ1A 1RUNA 5F6FA 2V1XA 4EJWA 2DBBA 3RYRA 1UB9A 5F1RA 4LD5A 2DLLA 3QP6A 1YW8A 5ICFA 2QQAA 4IRHA 3HOTA 4HBLA 5E20A 4GGGA 3KLOA 1ONVA 1ZG5A 1IXSB 4WXDA 4L9JA 2XAFA 1KA8A 1G3TA 3ECHA 1R00A 3FXUA 1WSUA 3QPHA 2G7HA 2XKOA 1STZA 1T2KA 1J75A 3HYIA 1BIBA 3K69A 3PQKA 5HS8A 2QBYB 4BHBA 2E7XA 1R1UA 3G3ZA 5D6FA 2D1HA 3WODF 1ZARA 1KU9A 2ZBKA 4LJZF 5DUIA 5DYMA 4NQWA 4YFNF 2EFNA 1QNTA 1YW7A 3NEUA 1LDJA 3DXJF 4LGWA 2WV0A 3RKWA 3WTSC 1P4WA 1R7JA 1TTYA 4L5IA 3MQ0A 3HHGA 5FLXK 2J5PA 2V1DA 2EB7A 3J7AO 3IKVA 1D8KA 3HTSB 2MD5A 1QQIA 3F8FA 5L3DA 2NS0A 3CO7C 2CGPA 4I7HA 3C3WA 2WC2A 1AWCA 4ZYGA 3M7GA 4MEXF 3TGNA 1GHCA 4KMUX 1F1ZA 1JHFA 2V1UA 2FNAA 4EJVA 4P96A 3WTVC 3KLNA 3WGIA 1KQ8A 1IN8A 2EV5A 1ZGJA 2OBPA 1R1VA 5CVRA 4OMYA 4L9NA 1TBXA 5J8FA 4S04A 5ICEA 1HKTA 5DCMB 4DQ2A 3EYIA 4CDGA 2H6BA 1S29A 4AVPA 2Y0MA 3PQJA 4I0BA 3BPVA 4KA4A 2VOPA 2PEXA 3ZMDA 2EWNA 2FRHA 1KYZA 2E1CA 4EVIA 1EH6A 2ZFWA 4N9IA 3E3VA 4IHTA 3HRTA 4NB5A 4U7DA 4CHUA 3KP6A 4G94A 1SFEA 3SZPA 4FT8A 2P7VB 2L3DA 2O03A 3CUQB 2IA0A 1FP1D 5JFRA 2CWEA 3IWZA 2D45A 1CGPA 4HW0A 4BNCA 2MA3A 4WK8F 3WU1B 4QLCU 3B02A 3RDIA 1V4RA 4WF2A 1Z6TA 3RTRA 1O3RA 4U0VA 2ZMEB 1I1SA 1HBXG 1ZLKA 3HSEA 3QAHA 2Z9OA 2OAZA 1Z6RA 3EQLF 5HLIA 4GYIA 2Z5UA 2ESHA 4HA8A 1RNLA 4WCGA 1U8RA 2VOOA 5E1WA 3R0JA 1H9GA 3O3KA 4Q48A 1F4KA 1R5GA 3E97A 2HQNA 4P55A 4WXCA 1RUOA 3KEQA 2HQRA 2W85A 2BE5F 1USSA 1L3LA 4IRGA 1PUEE 2DW4A 1XCBA 1X3UA 2ZCWA 3V8KA 1G3WA 2O61A 3JSPA 1ZN2A 4LK0F 1CF7B 4AIKA 3RKYA 3P7NA 2KIMA 1ZG3A 1Z9CA 1XGSA 4KNYA 3FZVA 1D8JA 2HGCA 2F5DA 1W7PD 3SXYA 2CO5A 1U78A 3WTYC 4A12A 2MH9A 2UXNA 3KFWX 2V6CA 3KCCA 1KQ9A 4HV6A 4TV7A 4XBFA 1BI0A 2IT0A 1FP2A 1LEBA 2IP2A 4OOIA 1NHAA 1TQPA 2EFPA 2FE3A 1K78B 1O3SA 3VODA 3P9KA 1R58A 4ON0A 5FB2A 2XIGA 1IXCA 2FMLA 2Z33A 3ZMTA 3W6KB 1S3JA 1BI3A 3W6JB 2H27A 1KU7A 1ZRCA 3ZP5A 4CGZA 2OA4A 4UNOA 4FX4A 4H0EA 2M8EA 4UV8A 4ESJA 5TJJA 3RKXA 1MGTA 3F8MA 2X0LA 2NNYA 1U2WA 1FYLA 3HSFA 4EM1A 3CUOA 5DD8A 4PZJA 4A2UA 4P9UA 2MH2A 4OIRF 3M8FA 3F8CA 2Q8KA 4LLNA 3HIFA 3QRFF 2RGVA 1S8NA 5LHGA 5AIQA 1G4DA 4A6DA 5LRSA 5D6EA 2QM3A 5ILUA 3F8BA 2ACJA 5LGTA 1MDMB 3RIRA 2KIFA 3MWMA 1RI7A 3T5XA 3ZQ7A 2TDXA 2K7LA 3JAMZ 1WQ2A 1XSXA 4OIPF 2CSOA 2H94A 2QZ8A 3GW2A 5FFZA 1FSHA 1OYWA 1SFXA 1MKMA 1QZYA 3GF2A 1YFHA 2R3SA 3TO9A 1ZLJA 1XB4A 1WKMA 1SAXA 3LQRA 1BI2A 4KFCA 4ENMA 1HSTA 5BPDA 5FD5A 3ZMUA 2G9WA 5L3EA 3I53A 3LQQA 1FOKA 2QBYA 4HOBA 5ICCA 4A0XA 2QYOA 1YS6A 2DTRA 5A2QZ 1VTNC 3REOA 4UHTA 3FWEA 1BC8C 3KP3A 3QOPA 3GEZA 3EUHA 3V7RA 3P9IA 3C1DA 2DT5A 2XAHA 4A0YA 1YW9A 1IAWA 3ULQB 5CVJA 2A68F 5DCFA 4KICA 4HLYA 4HV5A 2GAUA 1O7FA 4G7ZF 4I09A 1BC7C 4AIHA 2OU2A 1XCVA 1Z7UA 1FYMA 4ZYHA 3WE3A 3E5UA 3H3ZA 3OV8A 2EV6A 4CICA 1XDUA 4KIBA 4RGRA 3I58A 2P4WA 3J81K 1SMYF 5E17F 1FNNA 1MD0A 3IL2A 3WGHA 3IWFA 4B8XA 2LKPA 1OR7A 1TNTA 1S7AA 2GXGA 4QWQA 5D8KB 2UZKA 4O3MA 1ZYRF 5FGMA 1J5YA 2XGXA 4CO8A 3E6DA 1OMIA 3SQNA 2YX7A 4MHGA 2DK5A 2HKXA 1XDSA 5IT9Z 2FBIA 1EV7A 1HW5A 4AIJA 2COMA 2Z3YA 2DU9A 3GUDA 2O3FA 1HW2A 3T8RA 3O6BB 4WWCA 5IT3A 2ELHA 2F5CA 3K0LA 4FX0A 3F3XA 4D0PA 2EFOA 4PGGA 3JTGA 2K86A 3QU6A 3V7SA 4RB3C 2B0LA 1FY7A 1YTYA 3ZMZA 5ILSA 5HVQC 3HOSA 4Q4ZF 3K9TA 1XSDA 3CUQA 3WTWC 1IRFA 3IRQA 1K79A 1O57A 3G73A 4PGHA 2P5LC 3LA7A 5HDGA 2IVMA 3GLXA 3EETA 1B1BA 5ED4A 2M45A 1TNSA 1Z05A 5K5OA 1SFUA 1FLIA 4GXOA 5ICGA 1O3QA 5ILVA 5JVTA 5HDNA 3HRSA 2HFHA 2ZMEA 2IRFG 3GYHX 3J80K 3ML6A 5BOXA 2P6TA 1FBUA 2CFXA 1IUYA 2EA4A 2QWWA 3KZYA 3Q9VA 5TRDA 1B4AA 3ROUA 1BBYA 2K02A 1S7OA 1FC3A 4EJTA 2A61A 2QQ9A 1OPCA 2K4BA 5HLGA 1ZHFA 2ISZA 2AS5F 3FXQA 1K7AA 2FU4A 4Y13A 3ISPA 3CJNA 5H6RA 4ZYEA 3BJOA 4LG0B 2VC1A 3AAFA 2R7FA 1BM9A 2FXAA 4G6DA 4M6XA 5LGNA 3DPLC 1YS7A 2EV0A 3CUQC 5EEGA 4EJUA 2F5EA 2J5OA 4HX8A 3HHHA 3U2RA 1A04A 3DF8A 2RDPA 5L3BA 4L9VA 3FHZA 1T0FA 1F9NA 4K2EA 1W5SA 3ERED 2K27A 1B9NA 5LEKA 1B6AA 2DK8A 4LFUA 4UXNA 1K78A 2M5WA
chains in the Genus database with same CATH superfamily
2EK5A 2D1VA 2UWMA 3IAM2 5KVRA 5LEJA 3FK7A 2MG4A 2E1MB 2VASA 2JA2A 1ZR2A 4QPQA 3L2VA 1ETYA 5J6XA 2HOSA 2A6HF 3H92A 2O7OA 2HDCA 3MKYB 3CCJI 3AG1H 1TQIA 3OL3A 1G59A 5E3LA 2HYGD 2W57A 4BDYA 1YQAA 3ASOH 1MMNA 4F3QA 3EYYA 5J47A 4B3AA 1W7PB 4ABZA 3D0SA 2CFOA 2HEOA 1ODDA 3TEDA 1XS9A 1G3SA 2F2EA 1W4MA 1OYYA 2W4SA 1P4AA 3J7ZI 1MNEA 3JRCA 2DFFA 4DIQA 2M30A 2R0QC 5K5QA 3NQOA 2ELKA 3F23A 3BJAA 1DU0A 3BWGA 3WTTC 2A6TA 2XAJA 4II3A 3VEPA 4D1QA 1P92A 2A69F 2CG4A 4HSTA 1BOBA 4GYGA 4JYKA 2M1BA 3LFUA 3K4MA 1OYIA 2Z99A 2W84A 2L4AA 2VKHA 2O0YA 4ESFA 1LDKB 2XB0X 1Q1VA 3KYDB 1MMDA 3JRIA 4IKFA 5H2FC 4B47A 1I6XA 2BY1A 1JUSA 2RNGA 5LHHA 1YJ9I 1BJZA 3K2ZA 5CKTA 3RYPA 4XSXF 1WJCA 1LFBA 1GVDA 3E5QA 3E6MA 2VKEA 3GXOA 2VE9A 3QWLA 4BKXA 1XMKA 5M5YJ 1T0FC 1W0TA 2XAGA 5L3CA 2LBFA 2WY7Q 1BN5A 3CP8A 1MDMA 2Y69H 4L18B 2X6YA 2DODA 3DBLB 1MJ9A 3ABTA 2RQPA 1FPQA 1XD7A 2XHKA 2DFHA 3K7AJ 2M87A 4JX4A 1U5TA 2I10A 1IN7A 3GO5A 1WI9A 1RPWA 1X2NA 2FBHA 4FHTA 3BJ6A 1K61A 5GAHJ 5DUKA 2V4JC 4KT5C 2G7UA 1DQUA 3ZQLA 3UR3C 3IC7A 1I1GA 1I5ZA 4XRSG 2DQRA 4BH9A 4BHPA 1KYWA 3BZKA 1ZELA 4CCJA 1WH7A 3G71I 4DNCA 3BOQA 1XGOA 4JQFA 4JK1X 2OJED 2LDUA 1R6RA 2IA2A 5EJCA 3HRMA 3ZQFA 5TGTA 3JAMK 3GZ6A 3COAC 4BQAA 5D4SA 1R49A 5J4VA 4FTHA 2L4MA 5BPIA 1K83J 1QZZA 1HXDA 2ADUA 2LSOA 3E6BA 4UVBA 3QPLA 3KX2A 3CDHA 4BJ6C 1BOAA 1IC8A 1W5TA 6PAXA 3HJEA 3H3VK 2MLGA 3IV5A 3OR1C 1XMAA 1P9QC 1BI1A 4HDUA 3F6VA 3BTJA 3KPHA 1I3AA 1W1WE 2D2WA 4CA0A 1JHHA 2F5VA 4RMNA 2XSDC 4U0YA 2HDWA 1WJFA 3GCMA 3PM1A 3RQIA 5HOOA 1O3TA 2JRTA 2JA7J 3T8TA 1Q1HA 3KE2A 2HS5A 1H9TA 4DW6A 5IY5H 4I99C 3VOEA 1NK2P 3BZ6A 1YJWI 3CCRI 4M9ZA 5DV5A 4HF1A 3WTZA 4MGRA 3CMEI 1PP7U 3W2AA 3MKZA 4IHYA 3HOXJ 1LDDA 2NRAC 2GA1A 3JR9A 4BY1J 4EV0A 1WJAA 5A2QK 4XKBA 2VQGA 3OIPA 1WRJA 3FX3A 1NH3A 4DZJA 1YLFA 2DI3A 1ZAOA 4YG2F 5E79C 4I76A 4PSWA 3DKYA 3NWTA 2CW0F 2DDAA 3HKZA 4BXXJ 2XUBA 3TOAA 1PDNC 4B09A 3PSFA 1SFOJ 2VBWA 4QSHA 2X1EA 5KNLA 1DDNA 1T38A 4OMZA 1WZ2A 2OTJI 4IHXA 4A5NA 1BR4A 1SVLA 2PBIA 3FM5A 1U5TC 3RCOA 2R5ZB 1N78A 2DMTA 4RGUA 2DMNA 3P5JA 1E3HA 2KHMA 2VXZA 3H0DA 3RI4A 1V55H 3DV8A 3C2HA 3MVPA 4CCKA 1AKHA 3GFLA 3LSPA 3TW6A 1ZRFA 4MO7A 3HC7A 2STTA 3D5LA 1FBQA 2XGCA 5CLSA 2PN6A 4M3BA 3I59B 5HLHA 2GZWA 1T98A 2GBYA 1SD4A 3FM3A 4Q5SF 1LQ1A 4PJMA 1AOYA 2AQFA 1S6LA 4M6YA 5BNGA 1V3FA 3R4KA 2PMHA 5AONA 2W00A 1Y56A 4XLFA 3FF5A 4JX6A 2TCTA 3L00A 2CQXA 1LVAA 2LFBA 2MLKA 3WE2A 5FD6A 2XRLA 1L0OC 3I54A 1PP8F 3JTHA 2DFIA 2JK3A 4XICA 2DA3A 2CUZA 4DGWB 2ZNZA 4A5MA 4UB8C 2B7EA 1IO2A 2DMPA 1UHMA 3ZN0A 4B48A 2LMDA 1OCPA 2BVMA 2Z1DA 1X19A 3CMAI 5EGOA 3CO6C 3GVAA 1WJEA 2IGNA 5E1XA 5CQGA 1JE8A 4HRIA 2W25A 4EJOA 4KIFA 2XKPA 4U87A 5H20A 3BR5A 4CCLA 3WTXC 2JUCA 3SYTA 3FMRA 4RB2C 3LAJA 4YFXF 4N0BA 5F0CA 5D5XB 1K6OA 2M9HA 1Y0UA 1J7KA 3T0YA 2NVQJ 3SHFA 4A3FJ 5LBQA 3W2WA 1FOWA 1LVKA 4F7ZA 3ZMVA 3F21A 3C18A 4OWRB 5D5WB 3TQNA 5JR3A 5IT9K 1UCRA 4R8HA 4E70A 4GO1A 5M3MJ 2HR3A 3B6CA 4N4NB 4BS9A 4U0WA 1SD6A 4FE7A 2CQKA 2XROA 3ZQCA 2V26A 4HQEA 2JZYA 3K4BA 4XNFA 2XF7A 4I02A 2DPDA 2EIJH 4RB0A 3I56I 3CMYA 3ZRGA 4EMSA 1VQ4I 2YX4A 3GTQJ 3OYGA 2EA2A 1IV8A 3LA2A 3E6CC 3OYAA 1GLNA 4ENJA 2PJPA 2P5KA 1U6GA 5AIPA 2WY8Q 1VQ8I 2K9MA 4BQQA 4A3IJ 1VQKI 2X1DA 2DMQA 3BG9A 3QU3A 1D1BA 5BMZA 4L0YB 4PCQA 3SZTA 3ECOA 5GAEJ 5J4YA 3SJMA 3MKWB 4KIGA 5CJ9A 1KQ0A 2GOXB 4Y17A 3SEQA 3S16J 2R7RA 4RGSA 2YSRA 3L7WA 4HYEA 5K5RA 2R5YB 4N9HA 2FMYA 2QENA 2LF8A 2PG4A 4E7HA 2E35A 2Y9ZA 2HVSA 5IP6A 1R4NB 2P6SA 1TLHB 4LK1F 1Z7LA 5J1RA 1LEAA 2OQGA 4D5FA 3C2BA 1T08B 1KGSA 1T6SA 2ZXWH 2WB1A 2XDVA 1ETKA 3MCZA 1QHHD 3EDPA 2KKOA 2R7SA 2VKVA 3DP7A 2ZJ2A 4ZYDA 2QLZA 2HI3A 2C6YA 3E1SA 3CCSI 1UHWA 2E2IJ 5F64A 4LLGF 2Z2SB 1R22A 2OV7A 4RAGA 4LLLA 2DQLA 2O6GE 2A3SA 5IYCJ 5CYVA 2IGMA 4MEYF 3W6VA 2K3PA 4PDKA 3MEXA 1BJAA 2R93J 2W24A 2ZKZA 1LE8B 2HYFA 1LUJB 3GWZA 2Z16A 3K4JA 1QVTA 3FXKA 4HEA2 2PMUA 3V4GA 1IW7F 1LFUP 2RC4A 2V7FA 4DZPA 3C7JA 3DKWA 4C3JJ 1R71A 2HYJA 4AD9A 3VB2A 3DBRB 2CUFA 1Z67A 5CVUA 3TDUC 4YIFA 4IL6C 1IN6A 4YELA 4M9XA 4XN0A 2EFQA 1P2FA 3G1OA 4A69C 3GFMA 3OS2A 2BEOA 2KL4A 1ERDA 1MBEA 2JTVA 4A3GJ 4YIRX 3ABUA 4I98B 3KP4A 1MMSA 5E3OA 4C9YA 3SFZA 1E17A 2VONA 2JMWA 2E5NA 2VIXA 4S05A 3PO2J 2IXSA 3R61A 2OUMA 2XASA 4ASNA 4IHSA 3OOUA 3SZGA 3A2KA 3BG6A 1GVJA 2YU3A 4YEJA 5DEQA 3J7AY 4G6QA 4R79A 2M4GA 2GIZA 3K1NA 2GA2A 2RV8A 2OQRA 5HODA 2CV0A 4HF2A 1TWHJ 1GV5A 2PQ8A 2OZ6A 3ABKH 5EG0A 3I71A 1R36A 4EM0B 5LD2C 1K4TA 2HOEA 1R23A 3TKYA 3MFKA 3OIOA 1YO5C 3A02A 1A5JA 3HSRA 3ABMH 3LL7A 2RQQA 4HX4A 4W1UA 5DM6F 4IVNA 2RKHA 2DJIA 4O5VA 4KUMA 1ZG1A 1ON2A 2A5YB 3HUGA 4DOZA 4BGDA 3L2CA 2H8RA 1D1CA 3OSGA 1IN5A 5DCMA 4OU0A 2BY2A 2FNPA 1D0ZA 1MNMC 4XRFA 2HKOA 4F92B 2L5QA 4CZZA 3FDYA 2EFWA 2ZXHA 3S14J 2RNJA 3IH4A 5BS6A 4U88A 2L9RA 1TWCJ 4ESBA 1EH7A 4IF4A 1AA7A 1IXRC 5EEAA 3PNTA 2O5RA 1OKRA 3BG7A 1YHQI 2LOOA 5L3FA 3HPHA 3ZOBA 2GIVA 5E18F 2R92J 4Z2YA 1Y8RB 4V2GA 2L0KA 3DLLF 1FBSA 3F8NA 4FASD 3S1QJ 2BHZA 2VPLA 2YR2A 2X6OA 1WHUA 2EIKH 3FXMA 1YITI 1ZK8A 1W7PA 1BR2A 2EZLA 1WPKA 5EDNA 1H0MA 1OISA 2CV2A 4AU7A 2V9PA 4L5JA 4UUVA 2CJJA 2KRFA 1ZREA 1GUUA 4XLNF 3O8HA 1LJ9A 1MBGA 4A0ZA 2P8TA 1FT9A 1G6NA 3H0GJ 4RAYA 3TO6A 2M0MA 4Y15A 3TDZC 3G4SI 1QU3A 2ZFUA 2ZXJA 1FTTA 1REPC 3PSIA 4RBOA 3DQVC 3KP2A 4ZC3A 4MQ9F 5D8LB 3N97A 4BEHA 3F72A 2DO7A 4M9SA 4YIIA 3SDBA 4IXAA 4DYRA 1YIJI 1DU6A 1Y6IA 4KDPA 4D7NA 3BZCA 5FO5A 3U1DA 4EM2A 3BDDA 1JKPC 1FJLA 4XIDA 1YX5A 2E5ZA 3NRVA 2RVCA 4ZJZA 3CCUI 4BL0B 2BYVE 2HQAA 3D5RC 3JSOA 4UUSA 5FRNA 1R1TA 2DA4A 2HXIA 1A6IA 2FSWA 4RGXA 3W3CA 2RN7A 1XGNA 2GXAA 3FMSA 1EH8A 4BACA 2ZO4A 3JCUC 3MZ8A 3LSRA 3RZDJ 2DXIA 2IS2A 2UXXA 2JJ7A 4BHCA 4A3KJ 4C3IJ 1W0UA 3D5SC 3J81Z 1J0RA 1ON1A 3FXRA 4NC6A 1FOYA 4O6JA 3PNVA 4E7ZA 2VT2A 1RETA 2NAZA 4I2OA 2F5FA 2E1MC 2ECBA 4KYWA 2FBKA 4A3JJ 2OTLI 2EH3A 1CF7A 5CPRB 5LRRA 4G9YA 3KEOA 2V9VA 4ZZDA 5E1ZB 5GAGJ 2VQHA 3PUFA 2CUJA 4U7BA 4OIOF 2LTPA 5FFXA 1FWZA 2HU9A 1T39A 2GQQA 3GTPJ 1ETVA 1FSEA 1J59A 2EZIA 2V79A 3GTKJ 5KK1A 3GFIA 4PSXA 4RAZA 1SANA 4ETSA 4P5OA 3I4MJ 4MQVA 2AO9A 3WU0A 4KT6A 3CD6I 3CC4I 1USTA 2P81A 2P7CB 3R0AA 5ERIA 3WGGA 1BIAA 1G8XA 1PYVA 2VODA 1MBKA 1MJBA 3S2DJ 3QP5A 3QPTA 3B6AA 3GZNB 1HKQA 3ZGKA 4HAMA 1EA3A 3WU2C 4BQNA 1D0YA 4HZFA 3TO7A 1WFXA 4ZTJA 2TRTA 2AXLA 2O8XA 3BLYA 4BQOA 1HLVA 2Q0OA 5E8GA 4AVZA 1KU3A 2CYYA 3RPUA 1E2XA 3IRRA 4PJLA 4EGZA 1TW3A 3I64A 3CF5F 5EF6A 4IOAF 2E34A 3LOCA 1I50J 3GTOJ 1I27A 2DYSH 2QUFA 3DPTA 3MKLA 2MC4A 2FF4A 1T95A 2P0WA 1LNWA 4RB1A 3M8EA 5FKMA 4WX9A 5K1YA 2DOFA 2F6CA 4GRIA 4LB6B 2LNBA 2E19A 1TT5B 3WG9A 1HKSA 2RREA 3CCVI 1H89C 3MZYA 4KMFA 1IUFA 2KJBA 2XAQA 5HDKA 2MBFA 2Y75A 3CLQA 4A3CJ 4V19K 1J9IA 3BR1A 2YU9J 1IRGA 2E1NA 1SD5A 1HCRA 2ZXIA 4IPAA 3ZMSA 2E2HJ 1O7LA 4CYCB 1M1EB 2FD5A 2DPUA 2ESNA 2KZGA 1JTYA 4GFBA 1G3YA 3IHUA 1FZPB 2LREA 2ZNYA 4L5EA 1Z1DA 3LA3A 2XRNA 3R6SA 2FQ4A 3I59A 1MBFA 2NOGA 2FOKA 2XPVA 1WWXA 3VFZA 2XPWA 3PFIA 2ZC2A 5FJ8J 3J80Z 1LPQA 3HRUA 3JRFA 5FLXZ 3FHNA 2WAFA 2IJLA 3V7CA 2YPRA 4HG2A 1WVRA 2VPRA 2K3FA 4ZZLA 2Q2EA 4NQWB 2FA5A 3Q9SA 2IS1A 1JUPA 4M74A 2FEZA 3GLLA 5LLQA 2K9SA 5C4JJ 5C4XJ 2VQLA 4KISA 4M73A 2BHYA 3LSGA 2H09A 2K9NA 1SEUA 1YG2A 2DOAA 5F04A 4IX7A 4BE1A 2K4JA 2EBIA 1QO0D 1XTAA 2CQNA 3M9AA 3ZQIA 2PFBA 4FETA 3DLAA 3L2UA 5FLMJ 1VQOI 3CLOA 2HVRA 2KJCA 2HZDA 3LSTA 3RJPA 4OIQF 4HNUA 3DEUA 5FKNA 1RC9A 5D4RA 4R1HA 4G7OF 1ULYA 1HW1A 5HLTA 4Y33A 4HDVA 4IRIA 3OOPA 3CTAA 2X48A 3TBIA 5D5UB 3OYJA 1RIOH 2KZVA 5CVIA 3W2VA 2OD5A 2QSGX 3WG7H 3F22A 3GFJA 3EPZA 2PJRA 1DP7P 1UHSA 4KN7X 2OZUA 3V8JA 2OF7A 1HQCA 1A6QA 5DTDA 2AHQA 1B8IB 4L0ZB 4A6EA 4W97A 3L09A 1GXQA 5BQTA 2E2JJ 1V5EA 5GADJ 3ZQQA 2JPCA 2IA1A 3OWTA 3AG3H 1C0WA 5E3NA 4LOCA 5HS7A 4GDFA 1IJWC 4UVAA 3HEFA 2ZJPF 2KIQA 3GBGA 3ZN1A 4I0AA 3L9FA 5E8IA 4XLEA 3SDGA 5B5EC 4BXUA 2A07F 4M3GA 1XGMA 2UV1A 2L7FP 1HA8A 5K7HA 1VZ0A 4M72A 3V8LA 3R60A 2ID6A 2RAEA 3F9KA 4YRVA 2WWYA 1F5TA 2JT1A 3OYBA 2JQ7A 3KP5A 2LH9A 3B73A 4A3LJ 3K70D 3H36A 3BP8A 2R7UA 4EGYA 4RS8A 3BROA 3M3YJ 1IN4A 1T56A 4MFEA 3LFKA 2AXTC 4F91B 1U8BA 1YRNA 2BW3A 2DAOA 3BG5A 5CVVA 4XRMA 3VYRB 1XSVA 2CW7A 2M34A 3VYTB 1P4XA 3E0JB 3A03A 2L7MP 4E7SA 3NARA 3HKZN 2VBZA 2VJJA 5F27A 4EQQA 3M1CA 1JGGA 3LSJA 3BY6A 2IGKA 2P5VA 4OAYA 2CW8A 1KU2A 1B72A 4DJAA 1P6RA 1IV6A 2VBXA 4ENNA 1XN7A 4KITB 5EEHA 4M3DA 5GP9A 4FCYA 2X4HA 2EINH 2LRDA 5K7ZA 3LAPA 2VUMJ 3WTUC 5JHUA 3VPRA 2XV4S 2V6EA 3T1BA 4OINF 3GZ5A 4PJJA 1MZBA 3L2RA 3JW4A 4HX7A 2R7DA 2KP6A 1HSJA 3CJTB 3CMMA 2JPBA 3I5UA 4XMYA 3MZHA 1I3QJ 1OCTC 3CDIA 3GX4X 4UVCA 1DUXC 2OCEA 4XLAA 4S0HB 4CH7A 2KMUA 3H3UA 1TWGJ 4M71A 4FE4A 2ETHA 1D5VA 3TP3A 1VQMI 2A6EF 1J2XA 2VB6A 4HLXA 4UY8I 2EZKA 3OYLA 4AWXB 3BPXA 1JKQC 3MAJA 1SD7A 5IP9J 3JRGA 4A3DJ 3O2PE 4ZYAA 4BAYA 1H88C 3FBNB 4G6TB 1QGPA 2F4IA 2HTJA 2VT3A 2VBYA 3ABLH 5JI6A 2JVHA 3KYLA 2L02A 3HOVJ 1ZKGA 9ANTA 2BGCA 2WADA 2ELJA 2IPQX 3AL0C 2Y9YA 4HF0A 2WTEA 2STWA 4G8XA 3RQ4A 2DCEA 1WCMJ 2L54A 2O8KA 4GCVA 1IF1A 3FKJA 1TW2A 2M0CA 4II2A 1TWAJ 2LYCA 3VDXA 1U3EM 3G1MA 5IYDJ 2FQ3A 2ZB9A 4N4OB 3PUBA 2CU7A 4MNUA 4E7IA 1POGA 4ZTFA 3QODA 5B3SH 4L9TA 1FX7A 1OQYA 3Q0VA 2DT7B 4HQMA 1U5TB 3ELKA 2GXBA 3S2WA 4D7MA 3OYFA 2DJNA 4LB5A 2DFEA 3K1PA 3OY9A 2QQ8A 2NYXA 3CJRB 1FYKA 2LF7A 1DPUA 3NAUA 3I0TA 3ZR8X 3N4MA 3K1MA 3M8JA 2V1NA 3N05A 3CZ6A 2G0EA 3CESA 4CYDA 1MMAA 3LWFA 3K4KA 3E5XA 2A5WA 3OYNA 3ZPLA 1R5HA 4IJAA 4Q47A 5K7FA 1UFMA 2OC6A 1N75A 4UV9A 3EUAA 2GWRA 3KZIC 2KPMA 3H5AA 4DYQA 3KP7A 4XSZF 2FJ1A 1LB2A 2N8GA 1QHGA 4CXFA 3CC2I 1Y1VJ 3UKGA 3A01B 4MTDA 5FROA 1ZH5A 5F08A 4ENKA 3FMQA 4MTEA 2XVCA 4H4KC 4BYYA 2BBYA 2JSCA 4AYBN 1S72I 2WB1N 1PVEA 2HWVA 1JKOC 4AYBA 4XK4A 2R7TA 1B59A 4UB6C 4I01A 4F55A 2CUEA 4X0GA 2R4GA 3Q5FA 4M6VA 2L01A 1QBJA 3KETA 1GXPA 1E0EA 2MSYA 4JP0A 3IKTA 3HM5A 2HTSA 2K5CA 1YYVA 2EQRA 1ETOA 4YFKF 4WXHA 3U9GA 5B1AH 5FKKA 1TC3C 4KN4X 1Z91A 5EZHA 2PI0A 3HZJA 1SC7A 5LHIA 1TQMA 2ISYA 3DKXA 3AKZA 4G7HF 2CMPA 3TOBA 1RRJA 2HZTA 1G2HA 2VKDA 2BXYA 4E4HA 5DDGA 2F4OB 2H1KA 3RPQA 5L3GA 2ZJQF 4NHJA 4JBAA 2Y48A 3OYEA 2EJRA 3Q3SA 4BY7J 2QQBA 3P9CA 3F6OA 1JGSA 2IW5A 2NNNA 4XLCA 3K4NA 2IAIA 3BCAA 1SMTA 5GPCA 4AIDA 3CP2A 4XLPF 3KZZA 3HTUA 1ZRDA 1ZGAA 4E6KG 1RZ4A 4X1EA 4LG0A 3OR2C 1GDTA 1B9MA 2MC3A 5J8CA 2VN2A 2KIUA 1UJ8A 3OIQA 1JI8A 3IAS2 1PUFA 3DFGA 5LGUA 2QVOA 4LMYA 3BTCA 2VE8A 1YIOA 2WA0A 3M1EA 4P9FA 1DPRA 3GTJJ 2VC0A 1JXSA 4ZH4F 2H6CA 3OMYA 2W1OA 5HS9A 3IH2A 4BJTA 5FKOA 1QPMA 1MJAA 1X58A 4NNJA 2ZSIB 1X4OA 3I4PA 2LVSA 2F4MB 5DD4A 2X9DA 4BBRJ 2QCOA 5D5VB 2B9SA 3HOUJ 4A93J 1X1DA 4BE0A 4AM3A 1WGXA 1X4PA 2BXZA 1YJNI 2E7WA 5H6QA 1UAAA 2PLYA 2WAEA 1D3YA 2BV6A 3H5NA 2LG4A 2OPTA 1IZ1A 2K85A 1TZLA 3OL4A 1N25A 3IP4B 1ACIA 2EPFA 1S9HA 2KFDA 2OCCH 1RUNA 2BVLA 4X6AJ 5F6FA 5JLWA 2V1XA 4EJWA 2DBBA 3RYRA 1I39A 1UB9A 5F1RA 4LD5A 2DLLA 3PFYA 4JX5A 3QP6A 4NBQA 1X3WB 1YW8A 3G1LA 5ICFA 2QQAA 4IRHA 4RA2A 3HOTA 4HBLA 5E20A 4GGGA 1S7EA 3KLOA 5F0FA 1A31A 2XSJC 1ONVA 3V42A 1ZG5A 2UUZA 3H1CA 3U1KA 3BCBA 1IXSB 2NVUB 4MLOA 4WXDA 5KAFC 4L9JA 2XAFA 1KA8A 2LP0A 2HXOA 1G3TA 3RZOJ 4P1WA 3ECHA 3K4LA 3OYHA 1R00A 3FXUA 2QSHX 2R7XA 1WSUA 4RLFA 3PNYA 2ECCA 3OYCA 3QPHA 3X2QH 2G7HA 2XKOA 3Q0UA 4BUPA 4CSWA 4CYCA 1U9NA 3AG2H 1STZA 3HDDA 3JREA 1T2KA 1J75A 1RR8C 2HPMA 3HYIA 1BIBA 1T33A 2W7NA 3K69A 2DT6A 2LLKA 3HXLA 3PQKA 3DEEA 5HS8A 5C3EJ 4BHBA 3DTEA 3S1RJ 2E7XA 2GM4A 1R1UA 1FEXA 2M3AA 3G3ZA 1O4XA 5J40A 1VI0A 2D1HA 5D6FA 3WODF 4C2UA 1R4MB 1X1CA 1ZARA 2VQCA 3A0HC 1KU9A 2ZBKA 4LJZF 1V5GA 1WJ5A 5DUIA 2BOLA 5DYMA 2CQ7A 2Y0SA 4I6ZA 3ZQGA 1QA6A 4NQWA 4YFNF 2DA2A 2EFNA 3HGGA 2DA7A 2XGDA 3HG9A 2DTZA 1QNTA 1QZEA 3LSMA 1YW7A 3NEUA 1LDJA 1HOMA 3DXJF 3ERMA 3I9V2 1MSEC 4LGWA 2QKLB 2WV0A 3RKWA 3WTSC 1OJLA 4PFPA 1P4WA 1R7JA 1TTYA 4L5IA 3MQ0A 1IG7A 3M4OJ 3HHGA 5FLXK 4BBSJ 1K4SA 2J5PA 1F36A 3HBLA 5GPAA 2V1DA 2EB7A 3J7AO 2MW8A 1RKTA 1P7JA 2LKSA 2VJIA 3IKVA 1NG7A 1D8KA 1E3PA 3HTSB 1JUMA 2MD5A 1QQIA 3F8FA 5L3DA 2QA4I 2NS0A 3CO7C 2I8DA 2CGPA 4IHVA 4XRSA 4I7HA 3HOWJ 3C3WA 2CH0A 2WC2A 3S3OA 1R9TJ 1BR1A 5JLXA 1AHDP 1WH5A 1UMQA 1AWCA 2XF6A 2L7ZA 2LY1A 2R7QA 3DWLE 4ZYGA 5EYRA 4Z6YA 3M7GA 4MEXF 4AC0A 1DGWY 3FXLA 1TT0A 4FISA 4KMUX 3TGNA 5J1YA 1GHCA 1VNDA 1F1ZA 1JHFA 1ENHA 2E60A 2WAQA 2V1UA 4D5CA 4NDLA 2FNAA 1D5YA 4OAZA 2NS7A 3KIOA 4EJVA 4ITVA 4P96A 3WTVC 3KLNA 5LFAA 3WGIA 4BU2A 1KQ8A 3BTLA 2Q1ZB 2H1LA 5M3FJ 1IN8A 2EV5A 2M7BA 2M8GX 4PJNA 1ZGJA 2OBPA 1IDYA 1R1VA 5CVRA 4OMYA 4L9NA 1TBXA 2PMZN 5J8FA 3DCFA 1EF4A 1BW5A 3D1NI 4EEFG 3HGYA 4S04A 2QKMB 3A4CA 3OYMA 3OSFA 4M3EA 5GTIC 5ICEA 2PMZA 1HKTA 1KONA 1MBJA 2Y2ZA 5DCMB 4DQ2A 3EYIA 4CDGA 5HNHA 3GTGJ 3CDLA 2H6BA 1S29A 2M4KA 4AVPA 2Y0MA 3PQJA 4I0BA 3BPVA 4KA4A 2VOPA 2PEXA 3FISA 3ZMDA 2EWNA 1ETQA 2FRHA 3L2WA 1KYZA 4XQFA 3L2QA 2R5ZA 2E1CA 4EVIA 3CJQB 1EH6A 1Y0NA 4FQGA 1DGRM 2ZFWA 4N9IA 2MD0A 3E3VA 4IHTA 3HRTA 4BE2A 4NB5A 4U7DA 4CHUA 3KP6A 4G94A 1SFEA 3AG4H 3G6EI 1LKXA 3EUKL 1KZHA 3SZPA 4FT8A 1ZQ3P 2P7VB 2L3DA 3FK6A 2O03A 3SFIA 3CUQB 2IA0A 4PK4A 1FP1D 5JFRA 2CWEA 3IWZA 4LIUA 2D45A 1VQPI 2BZTA 1U9OA 4QTRA 1CGPA 3GMEA 5C44J 4HW0A 1VQ9I 3CCYA 2K9QA 1GT0C 4BNCA 2CQQA 4BDZA 2MA3A 3I4NJ 1WI3A 4WK8F 3WU1B 4QLCU 3B02A 3RDIA 1V4RA 1R5ID 4WF2A 2MABA 1Z6TA 3RTRA 1XPXA 1ITYA 1O3RA 2W48A 4BJ5C 4U0VA 5J1UA 4BEHB 2X6WA 2VLAA 2ZMEB 1I1SA 2QGUA 2LKXA 1HBXG 5GTHC 1ZLKA 1HC8A 1NG6A 3HSEA 3QAHA 2Z9OA 2OAZA 3ZQHA 1Z6RA 1BL0A 4LIVA 3PJRA 3QPSA 4PUSA 3EQLF 5HLIA 4GYIA 2LD5A 4E7JA 4UUTA 1T8IA 2IS4A 2Z5UA 2ESHA 4HA8A 1RNLA 2R7WA 3K4CA 5CQEA 4WCGA 1U8RA 2VOOA 1YX3A 3S8PA 4E7KA 4RLQA 2NVYJ 3DTKA 5E1WA 1S5LC 1FIAA 3R0JA 4UUSB 3VWBA 1H9GA 2R7OA 2DYRH 3O3KA 4Y4RA 4ANJA 1MH4A 4Q48A 1F4KA 1R5GA 3E97A 2L9NA 2HQNA 2LC2A 1Z3XA 4P55A 3GTLJ 4WXCA 1RUOA 1YI2I 3KEQA 1MIJA 2HQRA 2BE5F 1Z21A 1USSA 2W85A 5FRMA 3LNQA 3MMYB 1L3LA 1SVMA 2KRHA 2K9LA 4IRGA 1PUEE 2DW4A 2QF7A 3S93A 3S3MA 1XCBA 1X3UA 4IEJA 1UELB 2ZCWA 3KEYA 3V8KA 1G3WA 2O61A 2JWTA 5F1JA 3JSPA 1ZN2A 2XPUA 4LK0F 1CF7B 1EJ9A 2W82A 4AIKA 4MIMA 4IQJA 3RKYA 4LITA 3FIWA 3P7NA 4XR6A 2KIMA 3CQZJ 1ZG3A 1ETXA 3VYSB 1Z9CA 3F0CA 1XGSA 4KNYA 3DTIA 3FZVA 3CCLI 1D8JA 2HGCA 1HDPA 1D0XA 1K6YA 2F5DA 2R5YA 1WJBA 1W7PD 3A01A 3BC8A 3CCMI 2X6XA 2WBMA 2JA6J 3SXYA 5KAIC 2CO5A 2DN0A 3TL4X 3QYFA 1U78A 3WTYC 3HB9A 3DBHB 4A12A 1XMXA 2ME0A 2MH9A 3A1YA 2UXNA 2V6CA 2GOMA 3KFWX 3OYIA 3RKQA 3KCCA 1KQ9A 4HV6A 2MFZA 1PJRA 3FBIB 2EZHA 4TV7A 4XOTA 4XBFA 1JT6A 4HNVA 1BI0A 2IT0A 1ORKA 2NVTJ 1FP2A 1LEBA 4XKVA 1H8AC 3S32A 2IP2A 4OOIA 1NHAA 3OS1A 1TQPA 2X1CA 2EFPA 2FE3A 1K78B 2A05A 1O3SA 1RR7A 2YUSA 1LE8A 3U21A 3VODA 3P9KA 1R58A 4ON0A 1FOXA 5FB2A 2XIGA 3HPGA 3JRAA 1APLC 3HL2A 1IXCA 5KHDA 2KRCA 2HDDA 1Z0XA 2FMLA 3TP0A 3PL8A 5IOYA 4D9JA 2XC7A 2IS6A 2JSPA 2Z33A 3FXJA 2AQEA 1V54H 1LFPA 4DYCA 3ZMTA 3W6KB 1S3JA 4NC8A 1BI3A 3W6JB 2H27A 1MMGA 2NXNB 2K40A 1KU7A 1MSFC 1ZRCA 4ZDOA 3ZP5A 3BTIA 4CGZA 3FXOA 2LR8A 4B3XA 3CF2A 4AUXA 2OA4A 3BT9A 4FX4A 4UNOA 4DBQA 1XC5A 4H0EA 4A3MJ 4XOPA 4Y3OA 2M8EA 2X85A 2F48A 2DA1A 4UV8A 1VFCA 2EILH 2ID3A 5TJJA 4ESJA 2FUG2 3RKXA 1MGTA 2M7AA 3F8MA 1N77A 3LSKA 4CCNA 5DS9A 2X0LA 1Y1WJ 1ZTRA 2NNYA 4KJZA 1U2WA 1FYLA 1MNDA 3PO3J 3HSFA 5F0HA 4EM1A 4C3HJ 4J00A 4IO9F 3CUOA 1GV2A 1XX5A 5DD8A 4PZJA 4A2UA 4P9UA 2MH2A 4J01A 2VI6A 4OIRF 1YE9A 4E7LA 3BQZA 2GLOA 3CC7I 1YOVB 3M8FA 2MYSA 3L1PA 2HVQA 3F8CA 2PX9A 2Q8KA 1Z77A 4LLNA 3HIFA 2Q2EB 1P7IA 3QRFF 2RGVA 1S8NA 1U0JA 5AIQA 5LHGA 1G4DA 4A6DA 5LRSA 5D6EA 2QM3A 4XM3A 1D1AA 5ILUA 2JA8J 3F8BA 2LBFB 2ACJA 5LGTA 1MDMB 3RIRA 2KIFA 1SVOA 2CRGA 3MWMA 1RI7A 3T5XA 3ZQ7A 2TDXA 3WHBA 1XG1A 3GTMJ 2VXDA 2K7LA 4B1RA 3JAMZ 1WQ2A 3QOEA 3ASNH 3DPUA 2NOJB 2VJ4A 1XSXA 2DOEA 4OIPF 1X1AA 1X2MA 2CSOA 2H94A 2QZ8A 3GW2A 2COBA 5FFZA 1ZR4A 1FSHA 3BR6A 1OYWA 3VSLA 1SFXA 1MKMA 2D5VA 5M5WJ 2NS8A 3M07A 2HOAA 3HOZJ 1QZYA 1QVUA 2ZJRF 3GF2A 1X1BA 3LMMA 1YFHA 2R3SA 1OCOH 1MH3A 3RPUD 4CUGA 3TO9A 3BG3A 1ZLJA 2PJRB 5IP7J 1XB4A 1WKMA 4Y7NJ 1SAXA 3LQRA 3IUOA 1BI2A 1SFKA 3C2GA 4PFOA 4KFCA 1VF9A 5DM7F 4ENMA 1HSTA 3S1NJ 5BPDA 2FOWA 2V9KA 1IGNA 5FD5A 2MGQA 3ZMUA 5IOZA 2G9WA 5L3EA 1VQNI 3I53A 1IDZA 3LQQA 3NWSA 4CCMA 2QBYB 1FOKA 2QBYA 2ZSHB 4HOBA 2L9SA 5ICCA 4A0XA 2QYOA 1YS6A 1MBHA 2DTRA 2IGOA 3JRDA 5A2QZ 1HF0A 2JA5J 1VTNC 1OCCH 5IPAA 3REOA 1QRYA 3H35A 4UHTA 1BW6A 3FWEA 3RSNA 1BC8C 3KP3A 2CS3A 3QOPA 2CV1A 1JJ6C 3GEZA 4XKCA 4PJ0C 3EUHA 3AL0B 3V7RA 2IEKA 3BR0A 4F93B 3P9IA 2VJ5A 1YRNB 2BW3B 3C1DA 1NTCA 1TL8A 2ME6A 1DP3A 1AU7A 2EIMH 2DT5A 5B1BH 2XAHA 5J3LA 4A0YA 3DEWA 2HOTA 1YW9A 3S3NA 3VSKA 1IAWA 3ULQB 1CQTA 5CVJA 3HOYJ 4C2TA 2A68F 5DCFA 4ZDPA 3MD2A 3ZXSA 1B72B 4IQ4A 4KICA 4HLYA 4HV5A 2GAUA 1O7FA 2KDZA 2QEXI 4G7ZF 4I09A 3ZCOA 4M3FA 4J19A 2HNHA 2M2EA 1BC7C 2KDOA 4MFDA 4AIHA 2Y31A 3DU6A 1SAUA 3FKIJ 2R7VA 2OU2A 3G2BA 3TW7A 1VQ6I 1XCVA 1Z7UA 1TP4A 3JRBA 1FYMA 1JJ8C 4ZYHA 3WE3A 3E5UA 3H3ZA 1AKHB 3OV8A 3Q0WA 2EV6A 4CICA 1XDUA 4KIBA 4RGRA 3BR3A 5TISC 1OCZH 3I58A 2P4WA 1A35A 4C2MJ 3J81K 2ICWG 5E3MA 2DA5A 1JKRC 1SMYF 5E17F 1FNNA 1MD0A 3QQAA 2BY3A 3IL2A 1TWFJ 2L9VA 3WGHA 3IWFA 2H8WA 3K2AA 4B8XA 4HSRA 2LKPA 1W36C 1JT0A 4IHWA 1OR7A 1QPIA 1TNTA 1S7AA 3S15J 1EKEA 2GXGA 4Y52J 4QWQA 3J7YJ 5D8KB 2XAUA 2UZKA 2Y30A 4O3MA 1ZYRF 5FGMA 1FMWA 1J5YA 2XGXA 4DBRA 3I3LA 4CO8A 2XB5A 5EGOB 1UG2A 3E6DA 1OMIA 3SQNA 2YX7A 4IZZA 4CCOA 4MHGA 2DK5A 2HKXA 4B43A 1XDSA 5IT9Z 5HNFA 3JRHA 3EUHC 2FBIA 4RM3A 1EV7A 2KISA 4XLHA 5EZGA 1HW5A 2XGEA 4AIJA 2COMA 2Z3YA 2DU9A 3GUDA 2O3FA 1HW2A 3T8RA 3O6BB 3UNGC 4WWCA 4XL9A 5IT3A 2ELHA 2F5CA 3K0LA 3H5RA 3SEZA 4FX0A 3F3XA 3O8GA 2HPIA 1X1PA 1A36A 3BR2A 4D0PA 2EFOA 4PGGA 2JRMA 3JTGA 1I6HJ 2IBDA 3ONQA 2B63J 2K86A 3QU6A 1FTZA 3V7SA 5IYBJ 2DDBA 4IOCF 2NVXJ 4BXFA 1UZCA 4RB3C 2KQRA 2B0LA 4RAFA 1FY7A 1YTYA 1VQLI 3ZMZA 5ILSA 5HVQC 3IH3A 3HOSA 2LK2A 2YS9A 4Q4ZF 3K9TA 1FIPA 1XSDA 4HNTA 3CUQA 3WTWC 1FMVA 1IRFA 3IRQA 1K79A 1O57A 3K10A 3G73A 4PGHA 3A0BC 3PIOF 3QYBA 1ETWA 4B44A 2XF5A 2P5LC 1J09A 2BY0A 4A3BJ 3LA7A 5HDGA 4F52A 2IVMA 2Y0SN 3GLXA 5KCMA 3EETA 1OLTA 5JHFA 1B1BA 1OFCX 5ED4A 2M45A 3K6GA 2E71A 4B4CA 4NC7A 4CZCA 1TNSA 1Z05A 5JVGF 5K5OA 1SFUA 1FLIA 3CCEI 1BA5A 2FX0A 4XN3A 1VQ5I 4XORA 4GXOA 5ICGA 3OYDA 1Z3YA 2E1OA 1O3QA 5ILVA 5JVTA 4ZDLA 5HDNA 1OR7C 3E7LA 3HRSA 2HFHA 2ZMEA 2IRFG 2WV1A 4QPOA 3GYHX 3J80K 3ML6A 1MW7A 1Y39A 5BOXA 2P6TA 1FBUA 1UG0A 2CFXA 1W5CC 1IUYA 2EA4A 4NUBA 2QWWA 2E36A 5FKLA 1ZGWA 3KZYA 4C30A 3Q9VA 2HQ5A 4EATA 3H9JA 5TRDA 1B4AA 4A3EJ 1RESA 1Y8QB 3ROUA 1BBYA 2K02A 2KLOA 5M5XJ 3S17J 1NK3P 5B66C 1IRXA 1S7OA 1FC3A 4EJTA 1WJDA 3H9QA 2JUGA 2A61A 3MN2A 2QQ9A 1OPCA 3CCQI 2K4BA 5HLGA 4HPQA 1ZHFA 2ISZA 2AS5F 3FXQA 1K7AA 2FU4A 2DMUA 4RDUA 1B8IA 2WAQN 3PIPF 4Y13A 4XONA 3ISPA 3CJNA 5H6RA 4ZYEA 1V5FA 3I55I 3BJOA 4LG0B 4QIWN 3WHCA 2VC1A 3AAFA 2R7FA 1BM9A 2FXAA 4G6DA 3ESWB 4M6XA 5LGNA 3DPLC 3DU5A 2I5UA 1PUFB 3S1MJ 1YS7A 2EV0A 2JN6A 3K70C 2O9LA 3CUQC 5EEGA 4EJUA 2R7ZJ 3VYUB 5EG0B 1X3ZB 2F5EA 2J5OA 4JOMA 1F43A 4HX8A 2VL8A 3HHHA 3U2RA 3LSHA 1A04A 2KT0A 1IRZA 3DF8A 2RDPA 5L3BA 1JTXA 4L9VA 1HDDC 2L7KA 1RKWA 3FHZA 1T0FA 4RM2A 1E3OC 4LG3A 2QSFX 1F9NA 4K2EA 1W5SA 3ERED 3HUGB 3OS0A 4V2FA 4XKWA 1OCRH 2K27A 5FLVA 2DA6A 3TMOA 1W36D 2LY2A 1B9NA 5LEKA 1B6AA 2DK8A 3OYKA 1VQ7I 2X51A 2ZMEC 4G12A 3BQYA 3AFHA 2LY9A 3S2HJ 2L2OA 2JVGA 4LFUA 3QYEA 3LSIA 4UXNA 3KYCB 1K78A 3H9GA 2M5WA
chains in the Genus database with same CATH topology
2EK5A 2D1VA 2UWMA 5KVRA 5LEJA 5J6XA 2HDCA 2A6HF 3H92A 1TQIA 2HYGD 2W57A 1YQAA 3EYYA 1W7PB 3D0SA 2HEOA 1ODDA 1G3SA 2F2EA 1W4MA 1OYYA 1P4AA 2M30A 5K5QA 3NQOA 3F23A 3BJAA 3BWGA 3WTTC 2XAJA 3VEPA 1P92A 2A69F 2CG4A 4GYGA 2M1BA 1OYIA 2Z99A 2W84A 2L4AA 2O0YA 4ESFA 1LDKB 1I6XA 5LHHA 3K2ZA 3RYPA 4XSXF 3E5QA 3E6MA 3GXOA 2VE9A 1XMKA 2XAGA 5L3CA 1BN5A 1MDMA 4L18B 1MJ9A 3ABTA 2RQPA 1FPQA 1XD7A 2XHKA 2M87A 1U5TA 1IN7A 3GO5A 1WI9A 2FBHA 4FHTA 3BJ6A 5DUKA 4KT5C 2G7UA 3IC7A 1I1GA 1I5ZA 2DQRA 4BH9A 4BHPA 1KYWA 4DNCA 3BOQA 1XGOA 4JQFA 4JK1X 2LDUA 2IA2A 3HRMA 3JAMK 3GZ6A 3COAC 4BQAA 5D4SA 2L4MA 5BPIA 1QZZA 1HXDA 2ADUA 2LSOA 3E6BA 4UVBA 3CDHA 1BOAA 1W5TA 6PAXA 2MLGA 1XMAA 1BI1A 4HDUA 3F6VA 2D2WA 1JHHA 4U0YA 1O3TA 5HOOA 2JRTA 3T8TA 1Q1HA 3KE2A 2HS5A 1H9TA 3VOEA 3BZ6A 4M9ZA 5DV5A 4HF1A 3WTZA 4MGRA 1PP7U 1LDDA 2NRAC 2GA1A 4EV0A 5A2QK 1WRJA 3FX3A 1YLFA 2DI3A 1ZAOA 4YG2F 2CW0F 2XUBA 3TOAA 1PDNC 4B09A 2VBWA 1DDNA 1T38A 4OMZA 4A5NA 3FM5A 2PBIA 1U5TC 4RGUA 2VXZA 3RI4A 3DV8A 3GFLA 1ZRFA 2STTA 3D5LA 1FBQA 5CLSA 2PN6A 5HLHA 3I59B 2GZWA 1T98A 1SD4A 3FM3A 4Q5SF 1LQ1A 1AOYA 4M6YA 1S6LA 1V3FA 3R4KA 2PMHA 5AONA 3FF5A 3L00A 3WE2A 1LVAA 2MLKA 5FD6A 3I54A 1L0OC 1PP8F 3JTHA 2DFIA 2ZNZA 4A5MA 1UHMA 3ZN0A 3CO6C 3GVAA 5E1XA 1JE8A 2W25A 4EJOA 4KIFA 2XKPA 5H20A 3WTXC 3FMRA 4RB2C 3LAJA 4YFXF 4N0BA 5D5XB 1K6OA 1Y0UA 1J7KA 3T0YA 3SHFA 5LBQA 4F7ZA 3ZMVA 3F21A 3C18A 5IT9K 5D5WB 3TQNA 5JR3A 1UCRA 4R8HA 4E70A 4GO1A 2HR3A 4U0WA 1SD6A 2CQKA 2XROA 4HQEA 2JZYA 4I02A 2DPDA 4RB0A 4EMSA 2YX4A 2EA2A 3LA2A 3E6CC 4ENJA 2PJPA 2P5KA 1U6GA 5AIPA 3QU3A 4L0YB 5BMZA 4PCQA 3SZTA 3ECOA 4KIGA 5CJ9A 1KQ0A 4Y17A 4RGSA 2YSRA 3L7WA 4HYEA 5K5RA 4N9HA 2FMYA 2QENA 2LF8A 2PG4A 2P6SA 1TLHB 4LK1F 1LEAA 2OQGA 1KGSA 1T6SA 3MCZA 3EDPA 2KKOA 3DP7A 2ZJ2A 4ZYDA 2QLZA 2C6YA 1UHWA 5F64A 4LLGF 1R22A 4LLLA 2DQLA 2O6GE 2A3SA 5CYVA 4MEYF 4PDKA 3MEXA 1BJAA 2W24A 2ZKZA 2HYFA 3GWZA 3V4GA 2PMUA 1IW7F 2RC4A 3C7JA 3DKWA 4AD9A 3VB2A 5CVUA 3TDUC 4YIFA 1IN6A 4M9XA 2EFQA 1P2FA 3GFMA 2BEOA 2JTVA 3ABUA 4I98B 3KP4A 3SFZA 1E17A 2VONA 4S05A 3R61A 4IHSA 2XASA 4ASNA 1GVJA 2YU3A 5DEQA 4G6QA 4R79A 3K1NA 2GA2A 2RV8A 2OQRA 4HF2A 2PQ8A 2OZ6A 3I71A 1R36A 4EM0B 2HOEA 1R23A 3TKYA 3MFKA 1YO5C 3HSRA 4HX4A 4IVNA 2RKHA 4O5VA 4KUMA 1ZG1A 1ON2A 2A5YB 3HUGA 3L2CA 1IN5A 5DCMA 4OU0A 2FNPA 4XRFA 2HKOA 4CZZA 2EFWA 2RNJA 5BS6A 4U88A 4ESBA 1EH7A 4IF4A 1IXRC 1OKRA 5L3FA 2GIVA 5E18F 4Z2YA 3F8NA 1FBSA 2YR2A 1W7PA 1H0MA 4UUVA 4L5JA 2KRFA 1ZREA 4XLNF 1LJ9A 4A0ZA 2P8TA 1FT9A 1G6NA 4RAYA 3TO6A 4Y15A 3TDZC 2ZXJA 1REPC 3DQVC 3KP2A 5D8LB 4MQ9F 3N97A 3F72A 2DO7A 4M9SA 4YIIA 4IXAA 4KDPA 5FO5A 3U1DA 4EM2A 3BDDA 3NRVA 2RVCA 2BYVE 3JSOA 1R1TA 2FSWA 4RGXA 2RN7A 1XGNA 3FMSA 1EH8A 2ZO4A 2UXXA 4BHCA 3J81Z 1J0RA 1ON1A 3FXRA 4O6JA 2VT2A 2NAZA 4I2OA 2F5FA 4KYWA 2FBKA 1CF7A 5LRRA 4G9YA 3KEOA 2V9VA 4ZZDA 5E1ZB 4U7BA 4OIOF 5FFXA 1FWZA 1T39A 2GQQA 1FSEA 1J59A 2V79A 5KK1A 3GFIA 4RAZA 4ETSA 4P5OA 4MQVA 3WU0A 1USTA 2P7CB 3R0AA 5ERIA 3WGGA 1BIAA 2VODA 1MJBA 3QP5A 3QPTA 1HKQA 4HAMA 4HZFA 3TO7A 2AXLA 2O8XA 2Q0OA 5E8GA 1KU3A 2CYYA 3RPUA 1E2XA 3IRRA 4EGZA 1TW3A 3I64A 1I27A 2QUFA 3DPTA 2FF4A 1LNWA 4RB1A 3M8EA 4WX9A 5K1YA 4LB6B 2LNBA 3WG9A 1HKSA 3MZYA 4KMFA 2KJBA 2XAQA 5HDKA 2MBFA 2Y75A 1J9IA 1IRGA 2E1NA 1SD5A 4IPAA 3ZMSA 1O7LA 2DPUA 2ESNA 1G3YA 3IHUA 1FZPB 2ZNYA 1Z1DA 3LA3A 2XRNA 3R6SA 3I59A 2FOKA 1WWXA 3VFZA 3PFIA 3J80Z 3HRUA 5FLXZ 2IJLA 3V7CA 2YPRA 4ZZLA 2Q2EA 2FA5A 3Q9SA 4M74A 2FEZA 5LLQA 4M73A 2H09A 1YG2A 2K4JA 1QO0D 3M9AA 2PFBA 3CLOA 2KJCA 3LSTA 3RJPA 4OIQF 3DEUA 5D4RA 4R1HA 4G7OF 1ULYA 1HW1A 4HDVA 4IRIA 3OOPA 3CTAA 5D5UB 1RIOH 5CVIA 2OD5A 3F22A 3GFJA 1DP7P 4KN7X 2OZUA 3V8JA 1HQCA 4L0ZB 4A6EA 3L09A 1GXQA 5BQTA 2JPCA 2IA1A 1C0WA 5HS7A 4UVAA 3ZN1A 4I0AA 3L9FA 5E8IA 2A07F 4BXUA 1XGMA 4M72A 3V8LA 3R60A 2WWYA 1F5TA 2JT1A 3KP5A 3B73A 3BP8A 4EGYA 4RS8A 3BROA 1IN4A 3LFKA 2DAOA 5CVVA 1XSVA 1P4XA 2VBZA 4EQQA 3BY6A 2P5VA 1KU2A 1P6RA 2VBXA 4ENNA 1XN7A 5EEHA 2X4HA 3LAPA 3WTUC 5JHUA 2XV4S 3T1BA 4OINF 3GZ5A 1MZBA 3JW4A 4HX7A 2R7DA 1HSJA 2JPBA 3I5UA 3MZHA 3GX4X 4UVCA 1DUXC 3H3UA 4M71A 2ETHA 1D5VA 2A6EF 1J2XA 4HLXA 4AWXB 3BPXA 3MAJA 1SD7A 3O2PE 4BAYA 1QGPA 2HTJA 2VT3A 2VBYA 5JI6A 2L02A 2BGCA 2IPQX 4HF0A 2WTEA 2STWA 4G8XA 2L54A 4GCVA 1IF1A 1TW2A 1U3EM 2FQ3A 4MNUA 4L9TA 1FX7A 4HQMA 1U5TB 3ELKA 2GXBA 3S2WA 4LB5A 3K1PA 2NYXA 1FYKA 2LF7A 1DPUA 3I0TA 3N4MA 3K1MA 4CYDA 3LWFA 3E5XA 3ZPLA 1R5HA 4IJAA 4Q47A 1UFMA 4UV9A 2GWRA 3KP7A 4XSZF 1LB2A 4CXFA 4MTDA 1ZH5A 4ENKA 3FMQA 4MTEA 2XVCA 4BYYA 2BBYA 2JSCA 2HWVA 1B59A 4I01A 3Q5FA 1QBJA 2L01A 3KETA 1GXPA 3IKTA 2HTSA 1YYVA 4YFKF 4WXHA 3U9GA 4KN4X 1Z91A 2PI0A 5LHIA 1TQMA 2ISYA 4G7HF 3TOBA 2HZTA 5DDGA 3RPQA 5L3GA 4NHJA 4JBAA 2Y48A 2EJRA 2QQBA 3P9CA 3F6OA 1JGSA 2IW5A 2NNNA 1SMTA 4XLPF 3KZZA 3HTUA 1ZRDA 1ZGAA 1RZ4A 4LG0A 1B9MA 2MC3A 5J8CA 2VN2A 2KIUA 3DFGA 5LGUA 2QVOA 4LMYA 2VE8A 1YIOA 3M1EA 4P9FA 1DPRA 2VC0A 1JXSA 4ZH4F 2H6CA 5HS9A 1QPMA 1MJAA 3I4PA 5DD4A 5D5VB 2E7WA 5H6QA 2PLYA 1D3YA 2BV6A 1IZ1A 1RUNA 5F6FA 2V1XA 4EJWA 2DBBA 3RYRA 1UB9A 5F1RA 4LD5A 2DLLA 3QP6A 1YW8A 5ICFA 2QQAA 4IRHA 3HOTA 4HBLA 5E20A 4GGGA 3KLOA 1ONVA 1ZG5A 1IXSB 4WXDA 4L9JA 2XAFA 1KA8A 1G3TA 3ECHA 1R00A 3FXUA 1WSUA 3QPHA 2G7HA 2XKOA 1STZA 1T2KA 1J75A 3HYIA 1BIBA 3K69A 3PQKA 5HS8A 2QBYB 4BHBA 2E7XA 1R1UA 3G3ZA 5D6FA 2D1HA 3WODF 1ZARA 1KU9A 2ZBKA 4LJZF 5DUIA 5DYMA 4NQWA 4YFNF 2EFNA 1QNTA 1YW7A 3NEUA 1LDJA 3DXJF 4LGWA 2WV0A 3RKWA 3WTSC 1P4WA 1R7JA 1TTYA 4L5IA 3MQ0A 3HHGA 5FLXK 2J5PA 2V1DA 2EB7A 3J7AO 3IKVA 1D8KA 3HTSB 2MD5A 1QQIA 3F8FA 5L3DA 2NS0A 3CO7C 2CGPA 4I7HA 3C3WA 2WC2A 1AWCA 4ZYGA 3M7GA 4MEXF 3TGNA 1GHCA 4KMUX 1F1ZA 1JHFA 2V1UA 2FNAA 4EJVA 4P96A 3WTVC 3KLNA 3WGIA 1KQ8A 1IN8A 2EV5A 1ZGJA 2OBPA 1R1VA 5CVRA 4OMYA 4L9NA 1TBXA 5J8FA 4S04A 5ICEA 1HKTA 5DCMB 4DQ2A 3EYIA 4CDGA 2H6BA 1S29A 4AVPA 2Y0MA 3PQJA 4I0BA 3BPVA 4KA4A 2VOPA 2PEXA 3ZMDA 2EWNA 2FRHA 1KYZA 2E1CA 4EVIA 1EH6A 2ZFWA 4N9IA 3E3VA 4IHTA 3HRTA 4NB5A 4U7DA 4CHUA 3KP6A 4G94A 1SFEA 3SZPA 4FT8A 2P7VB 2L3DA 2O03A 3CUQB 2IA0A 1FP1D 5JFRA 2CWEA 3IWZA 2D45A 1CGPA 4HW0A 4BNCA 2MA3A 4WK8F 3WU1B 4QLCU 3B02A 3RDIA 1V4RA 4WF2A 1Z6TA 3RTRA 1O3RA 4U0VA 2ZMEB 1I1SA 1HBXG 1ZLKA 3HSEA 3QAHA 2Z9OA 2OAZA 1Z6RA 3EQLF 5HLIA 4GYIA 2Z5UA 2ESHA 4HA8A 1RNLA 4WCGA 1U8RA 2VOOA 5E1WA 3R0JA 1H9GA 3O3KA 4Q48A 1F4KA 1R5GA 3E97A 2HQNA 4P55A 4WXCA 1RUOA 3KEQA 2HQRA 2W85A 2BE5F 1USSA 1L3LA 4IRGA 1PUEE 2DW4A 1XCBA 1X3UA 2ZCWA 3V8KA 1G3WA 2O61A 3JSPA 1ZN2A 4LK0F 1CF7B 4AIKA 3RKYA 3P7NA 2KIMA 1ZG3A 1Z9CA 1XGSA 4KNYA 3FZVA 1D8JA 2HGCA 2F5DA 1W7PD 3SXYA 2CO5A 1U78A 3WTYC 4A12A 2MH9A 2UXNA 3KFWX 2V6CA 3KCCA 1KQ9A 4HV6A 4TV7A 4XBFA 1BI0A 2IT0A 1FP2A 1LEBA 2IP2A 4OOIA 1NHAA 1TQPA 2EFPA 2FE3A 1K78B 1O3SA 3VODA 3P9KA 1R58A 4ON0A 5FB2A 2XIGA 1IXCA 2FMLA 2Z33A 3ZMTA 3W6KB 1S3JA 1BI3A 3W6JB 2H27A 1KU7A 1ZRCA 3ZP5A 4CGZA 2OA4A 4UNOA 4FX4A 4H0EA 2M8EA 4UV8A 4ESJA 5TJJA 3RKXA 1MGTA 3F8MA 2X0LA 2NNYA 1U2WA 1FYLA 3HSFA 4EM1A 3CUOA 5DD8A 4PZJA 4A2UA 4P9UA 2MH2A 4OIRF 3M8FA 3F8CA 2Q8KA 4LLNA 3HIFA 3QRFF 2RGVA 1S8NA 5LHGA 5AIQA 1G4DA 4A6DA 5LRSA 5D6EA 2QM3A 5ILUA 3F8BA 2ACJA 5LGTA 1MDMB 3RIRA 2KIFA 3MWMA 1RI7A 3T5XA 3ZQ7A 2TDXA 2K7LA 3JAMZ 1WQ2A 1XSXA 4OIPF 2CSOA 2H94A 2QZ8A 3GW2A 5FFZA 1FSHA 1OYWA 1SFXA 1MKMA 1QZYA 3GF2A 1YFHA 2R3SA 3TO9A 1ZLJA 1XB4A 1WKMA 1SAXA 3LQRA 1BI2A 4KFCA 4ENMA 1HSTA 5BPDA 5FD5A 3ZMUA 2G9WA 5L3EA 3I53A 3LQQA 1FOKA 2QBYA 4HOBA 5ICCA 4A0XA 2QYOA 1YS6A 2DTRA 5A2QZ 1VTNC 3REOA 4UHTA 3FWEA 1BC8C 3KP3A 3QOPA 3GEZA 3EUHA 3V7RA 3P9IA 3C1DA 2DT5A 2XAHA 4A0YA 1YW9A 1IAWA 3ULQB 5CVJA 2A68F 5DCFA 4KICA 4HLYA 4HV5A 2GAUA 1O7FA 4G7ZF 4I09A 1BC7C 4AIHA 2OU2A 1XCVA 1Z7UA 1FYMA 4ZYHA 3WE3A 3E5UA 3H3ZA 3OV8A 2EV6A 4CICA 1XDUA 4KIBA 4RGRA 3I58A 2P4WA 3J81K 1SMYF 5E17F 1FNNA 1MD0A 3IL2A 3WGHA 3IWFA 4B8XA 2LKPA 1OR7A 1TNTA 1S7AA 2GXGA 4QWQA 5D8KB 2UZKA 4O3MA 1ZYRF 5FGMA 1J5YA 2XGXA 4CO8A 3E6DA 1OMIA 3SQNA 2YX7A 4MHGA 2DK5A 2HKXA 1XDSA 5IT9Z 2FBIA 1EV7A 1HW5A 4AIJA 2COMA 2Z3YA 2DU9A 3GUDA 2O3FA 1HW2A 3T8RA 3O6BB 4WWCA 5IT3A 2ELHA 2F5CA 3K0LA 4FX0A 3F3XA 4D0PA 2EFOA 4PGGA 3JTGA 2K86A 3QU6A 3V7SA 4RB3C 2B0LA 1FY7A 1YTYA 3ZMZA 5ILSA 5HVQC 3HOSA 4Q4ZF 3K9TA 1XSDA 3CUQA 3WTWC 1IRFA 3IRQA 1K79A 1O57A 3G73A 4PGHA 2P5LC 3LA7A 5HDGA 2IVMA 3GLXA 3EETA 1B1BA 5ED4A 2M45A 1TNSA 1Z05A 5K5OA 1SFUA 1FLIA 4GXOA 5ICGA 1O3QA 5ILVA 5JVTA 5HDNA 3HRSA 2HFHA 2ZMEA 2IRFG 3GYHX 3J80K 3ML6A 5BOXA 2P6TA 1FBUA 2CFXA 1IUYA 2EA4A 2QWWA 3KZYA 3Q9VA 5TRDA 1B4AA 3ROUA 1BBYA 2K02A 1S7OA 1FC3A 4EJTA 2A61A 2QQ9A 1OPCA 2K4BA 5HLGA 1ZHFA 2ISZA 2AS5F 3FXQA 1K7AA 2FU4A 4Y13A 3ISPA 3CJNA 5H6RA 4ZYEA 3BJOA 4LG0B 2VC1A 3AAFA 2R7FA 1BM9A 2FXAA 4G6DA 4M6XA 5LGNA 3DPLC 1YS7A 2EV0A 3CUQC 5EEGA 4EJUA 2F5EA 2J5OA 4HX8A 3HHHA 3U2RA 1A04A 3DF8A 2RDPA 5L3BA 4L9VA 3FHZA 1T0FA 1F9NA 4K2EA 1W5SA 3ERED 2K27A 1B9NA 5LEKA 1B6AA 2DK8A 4LFUA 4UXNA 1K78A 2M5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK5 A;  2D1V A;  2UWM A;  5KVR A;  5LEJ A;  5J6X A;  2HDC A;  2A6H F;  3H92 A;  1TQI A;  2HYG D;  2W57 A;  1YQA A;  3EYY A;  1W7P B;  3D0S A;  2HEO A;  1ODD A;  1G3S A;  2F2E A;  1W4M A;  1OYY A;  1P4A A;  2M30 A;  5K5Q A;  3NQO A;  3F23 A;  3BJA A;  3BWG A;  3WTT C;  2XAJ A;  3VEP A;  1P92 A;  2A69 F;  2CG4 A;  4GYG A;  2M1B A;  1OYI A;  2Z99 A;  2W84 A;  2L4A A;  2O0Y A;  4ESF A;  1LDK B;  1I6X A;  5LHH A;  3K2Z A;  3RYP A;  4XSX F;  3E5Q A;  3E6M A;  3GXO A;  2VE9 A;  1XMK A;  2XAG A;  5L3C A;  1BN5 A;  1MDM A;  4L18 B;  1MJ9 A;  3ABT A;  2RQP A;  1FPQ A;  1XD7 A;  2XHK A;  2M87 A;  1U5T A;  1IN7 A;  3GO5 A;  1WI9 A;  2FBH A;  4FHT A;  3BJ6 A;  5DUK A;  4KT5 C;  2G7U A;  3IC7 A;  1I1G A;  1I5Z A;  2DQR A;  4BH9 A;  4BHP A;  1KYW A;  4DNC A;  3BOQ A;  1XGO A;  4JQF A;  4JK1 X;  2LDU A;  2IA2 A;  3HRM A;  3JAM K;  3GZ6 A;  3COA C;  4BQA A;  5D4S A;  2L4M A;  5BPI A;  1QZZ A;  1HXD A;  2ADU A;  2LSO A;  3E6B A;  4UVB A;  3CDH A;  1BOA A;  1W5T A;  6PAX A;  2MLG A;  1XMA A;  1BI1 A;  4HDU A;  3F6V A;  2D2W A;  1JHH A;  4U0Y A;  1O3T A;  5HOO A;  2JRT A;  3T8T A;  1Q1H A;  3KE2 A;  2HS5 A;  1H9T A;  3VOE A;  3BZ6 A;  4M9Z A;  5DV5 A;  4HF1 A;  3WTZ A;  4MGR A;  1PP7 U;  1LDD A;  2NRA C;  2GA1 A;  4EV0 A;  5A2Q K;  1WRJ A;  3FX3 A;  1YLF A;  2DI3 A;  1ZAO A;  4YG2 F;  2CW0 F;  2XUB A;  3TOA A;  1PDN C;  4B09 A;  2VBW A;  1DDN A;  1T38 A;  4OMZ A;  4A5N A;  3FM5 A;  2PBI A;  1U5T C;  4RGU A;  2VXZ A;  3RI4 A;  3DV8 A;  3GFL A;  1ZRF A;  2STT A;  3D5L A;  1FBQ A;  5CLS A;  2PN6 A;  5HLH A;  3I59 B;  2GZW A;  1T98 A;  1SD4 A;  3FM3 A;  4Q5S F;  1LQ1 A;  1AOY A;  4M6Y A;  1S6L A;  1V3F A;  3R4K A;  2PMH A;  5AON A;  3FF5 A;  3L00 A;  3WE2 A;  1LVA A;  2MLK A;  5FD6 A;  3I54 A;  1L0O C;  1PP8 F;  3JTH A;  2DFI A;  2ZNZ A;  4A5M A;  1UHM A;  3ZN0 A;  3CO6 C;  3GVA A;  5E1X A;  1JE8 A;  2W25 A;  4EJO A;  4KIF A;  2XKP A;  5H20 A;  3WTX C;  3FMR A;  4RB2 C;  3LAJ A;  4YFX F;  4N0B A;  5D5X B;  1K6O A;  1Y0U A;  1J7K A;  3T0Y A;  3SHF A;  5LBQ A;  4F7Z A;  3ZMV A;  3F21 A;  3C18 A;  5IT9 K;  5D5W B;  3TQN A;  5JR3 A;  1UCR A;  4R8H A;  4E70 A;  4GO1 A;  2HR3 A;  4U0W A;  1SD6 A;  2CQK A;  2XRO A;  4HQE A;  2JZY A;  4I02 A;  2DPD A;  4RB0 A;  4EMS A;  2YX4 A;  2EA2 A;  3LA2 A;  3E6C C;  4ENJ A;  2PJP A;  2P5K A;  1U6G A;  5AIP A;  3QU3 A;  4L0Y B;  5BMZ A;  4PCQ A;  3SZT A;  3ECO A;  4KIG A;  5CJ9 A;  1KQ0 A;  4Y17 A;  4RGS A;  2YSR A;  3L7W A;  4HYE A;  5K5R A;  4N9H A;  2FMY A;  2QEN A;  2LF8 A;  2PG4 A;  2P6S A;  1TLH B;  4LK1 F;  1LEA A;  2OQG A;  1KGS A;  1T6S A;  3MCZ A;  3EDP A;  2KKO A;  3DP7 A;  2ZJ2 A;  4ZYD A;  2QLZ A;  2C6Y A;  1UHW A;  5F64 A;  4LLG F;  1R22 A;  4LLL A;  2DQL A;  2O6G E;  2A3S A;  5CYV A;  4MEY F;  4PDK A;  3MEX A;  1BJA A;  2W24 A;  2ZKZ A;  2HYF A;  3GWZ A;  3V4G A;  2PMU A;  1IW7 F;  2RC4 A;  3C7J A;  3DKW A;  4AD9 A;  3VB2 A;  5CVU A;  3TDU C;  4YIF A;  1IN6 A;  4M9X A;  2EFQ A;  1P2F A;  3GFM A;  2BEO A;  2JTV A;  3ABU A;  4I98 B;  3KP4 A;  3SFZ A;  1E17 A;  2VON A;  4S05 A;  3R61 A;  4IHS A;  2XAS A;  4ASN A;  1GVJ A;  2YU3 A;  5DEQ A;  4G6Q A;  4R79 A;  3K1N A;  2GA2 A;  2RV8 A;  2OQR A;  4HF2 A;  2PQ8 A;  2OZ6 A;  3I71 A;  1R36 A;  4EM0 B;  2HOE A;  1R23 A;  3TKY A;  3MFK A;  1YO5 C;  3HSR A;  4HX4 A;  4IVN A;  2RKH A;  4O5V A;  4KUM A;  1ZG1 A;  1ON2 A;  2A5Y B;  3HUG A;  3L2C A;  1IN5 A;  5DCM A;  4OU0 A;  2FNP A;  4XRF A;  2HKO A;  4CZZ A;  2EFW A;  2RNJ A;  5BS6 A;  4U88 A;  4ESB A;  1EH7 A;  4IF4 A;  1IXR C;  1OKR A;  5L3F A;  2GIV A;  5E18 F;  4Z2Y A;  3F8N A;  1FBS A;  2YR2 A;  1W7P A;  1H0M A;  4UUV A;  4L5J A;  2KRF A;  1ZRE A;  4XLN F;  1LJ9 A;  4A0Z A;  2P8T A;  1FT9 A;  1G6N A;  4RAY A;  3TO6 A;  4Y15 A;  3TDZ C;  2ZXJ A;  1REP C;  3DQV C;  3KP2 A;  5D8L B;  4MQ9 F;  3N97 A;  3F72 A;  2DO7 A;  4M9S A;  4YII A;  4IXA A;  4KDP A;  5FO5 A;  3U1D A;  4EM2 A;  3BDD A;  3NRV A;  2RVC A;  2BYV E;  3JSO A;  1R1T A;  2FSW A;  4RGX A;  2RN7 A;  1XGN A;  3FMS A;  1EH8 A;  2ZO4 A;  2UXX A;  4BHC A;  3J81 Z;  1J0R A;  1ON1 A;  3FXR A;  4O6J A;  2VT2 A;  2NAZ A;  4I2O A;  2F5F A;  4KYW A;  2FBK A;  1CF7 A;  5LRR A;  4G9Y A;  3KEO A;  2V9V A;  4ZZD A;  5E1Z B;  4U7B A;  4OIO F;  5FFX A;  1FWZ A;  1T39 A;  2GQQ A;  1FSE A;  1J59 A;  2V79 A;  5KK1 A;  3GFI A;  4RAZ A;  4ETS A;  4P5O A;  4MQV A;  3WU0 A;  1UST A;  2P7C B;  3R0A A;  5ERI A;  3WGG A;  1BIA A;  2VOD A;  1MJB A;  3QP5 A;  3QPT A;  1HKQ A;  4HAM A;  4HZF A;  3TO7 A;  2AXL A;  2O8X A;  2Q0O A;  5E8G A;  1KU3 A;  2CYY A;  3RPU A;  1E2X A;  3IRR A;  4EGZ A;  1TW3 A;  3I64 A;  1I27 A;  2QUF A;  3DPT A;  2FF4 A;  1LNW A;  4RB1 A;  3M8E A;  4WX9 A;  5K1Y A;  4LB6 B;  2LNB A;  3WG9 A;  1HKS A;  3MZY A;  4KMF A;  2KJB A;  2XAQ A;  5HDK A;  2MBF A;  2Y75 A;  1J9I A;  1IRG A;  2E1N A;  1SD5 A;  4IPA A;  3ZMS A;  1O7L A;  2DPU A;  2ESN A;  1G3Y A;  3IHU A;  1FZP B;  2ZNY A;  1Z1D A;  3LA3 A;  2XRN A;  3R6S A;  3I59 A;  2FOK A;  1WWX A;  3VFZ A;  3PFI A;  3J80 Z;  3HRU A;  5FLX Z;  2IJL A;  3V7C A;  2YPR A;  4ZZL A;  2Q2E A;  2FA5 A;  3Q9S A;  4M74 A;  2FEZ A;  5LLQ A;  4M73 A;  2H09 A;  1YG2 A;  2K4J A;  1QO0 D;  3M9A A;  2PFB A;  3CLO A;  2KJC A;  3LST A;  3RJP A;  4OIQ F;  3DEU A;  5D4R A;  4R1H A;  4G7O F;  1ULY A;  1HW1 A;  4HDV A;  4IRI A;  3OOP A;  3CTA A;  5D5U B;  1RIO H;  5CVI A;  2OD5 A;  3F22 A;  3GFJ A;  1DP7 P;  4KN7 X;  2OZU A;  3V8J A;  1HQC A;  4L0Z B;  4A6E A;  3L09 A;  1GXQ A;  5BQT A;  2JPC A;  2IA1 A;  1C0W A;  5HS7 A;  4UVA A;  3ZN1 A;  4I0A A;  3L9F A;  5E8I A;  2A07 F;  4BXU A;  1XGM A;  4M72 A;  3V8L A;  3R60 A;  2WWY A;  1F5T A;  2JT1 A;  3KP5 A;  3B73 A;  3BP8 A;  4EGY A;  4RS8 A;  3BRO A;  1IN4 A;  3LFK A;  2DAO A;  5CVV A;  1XSV A;  1P4X A;  2VBZ A;  4EQQ A;  3BY6 A;  2P5V A;  1KU2 A;  1P6R A;  2VBX A;  4ENN A;  1XN7 A;  5EEH A;  2X4H A;  3LAP A;  3WTU C;  5JHU A;  2XV4 S;  3T1B A;  4OIN F;  3GZ5 A;  1MZB A;  3JW4 A;  4HX7 A;  2R7D A;  1HSJ A;  2JPB A;  3I5U A;  3MZH A;  3GX4 X;  4UVC A;  1DUX C;  3H3U A;  4M71 A;  2ETH A;  1D5V A;  2A6E F;  1J2X A;  4HLX A;  4AWX B;  3BPX A;  3MAJ A;  1SD7 A;  3O2P E;  4BAY A;  1QGP A;  2HTJ A;  2VT3 A;  2VBY A;  5JI6 A;  2L02 A;  2BGC A;  2IPQ X;  4HF0 A;  2WTE A;  2STW A;  4G8X A;  2L54 A;  4GCV A;  1IF1 A;  1TW2 A;  1U3E M;  2FQ3 A;  4MNU A;  4L9T A;  1FX7 A;  4HQM A;  1U5T B;  3ELK A;  2GXB A;  3S2W A;  4LB5 A;  3K1P A;  2NYX A;  1FYK A;  2LF7 A;  1DPU A;  3I0T A;  3N4M A;  3K1M A;  4CYD A;  3LWF A;  3E5X A;  3ZPL A;  1R5H A;  4IJA A;  4Q47 A;  1UFM A;  4UV9 A;  2GWR A;  3KP7 A;  4XSZ F;  1LB2 A;  4CXF A;  4MTD A;  1ZH5 A;  4ENK A;  3FMQ A;  4MTE A;  2XVC A;  4BYY A;  2BBY A;  2JSC A;  2HWV A;  1B59 A;  4I01 A;  3Q5F A;  1QBJ A;  2L01 A;  3KET A;  1GXP A;  3IKT A;  2HTS A;  1YYV A;  4YFK F;  4WXH A;  3U9G A;  4KN4 X;  1Z91 A;  2PI0 A;  5LHI A;  1TQM A;  2ISY A;  4G7H F;  3TOB A;  2HZT A;  5DDG A;  3RPQ A;  5L3G A;  4NHJ A;  4JBA A;  2Y48 A;  2EJR A;  2QQB A;  3P9C A;  3F6O A;  1JGS A;  2IW5 A;  2NNN A;  1SMT A;  4XLP F;  3KZZ A;  3HTU A;  1ZRD A;  1ZGA A;  1RZ4 A;  4LG0 A;  1B9M A;  2MC3 A;  5J8C A;  2VN2 A;  2KIU A;  3DFG A;  5LGU A;  2QVO A;  4LMY A;  2VE8 A;  1YIO A;  3M1E A;  4P9F A;  1DPR A;  2VC0 A;  1JXS A;  4ZH4 F;  2H6C A;  5HS9 A;  1QPM A;  1MJA A;  3I4P A;  5DD4 A;  5D5V B;  2E7W A;  5H6Q A;  2PLY A;  1D3Y A;  2BV6 A;  1IZ1 A;  1RUN A;  5F6F A;  2V1X A;  4EJW A;  2DBB A;  3RYR A;  1UB9 A;  5F1R A;  4LD5 A;  2DLL A;  3QP6 A;  1YW8 A;  5ICF A;  2QQA A;  4IRH A;  3HOT A;  4HBL A;  5E20 A;  4GGG A;  3KLO A;  1ONV A;  1ZG5 A;  1IXS B;  4WXD A;  4L9J A;  2XAF A;  1KA8 A;  1G3T A;  3ECH A;  1R00 A;  3FXU A;  1WSU A;  3QPH A;  2G7H A;  2XKO A;  1STZ A;  1T2K A;  1J75 A;  3HYI A;  1BIB A;  3K69 A;  3PQK A;  5HS8 A;  2QBY B;  4BHB A;  2E7X A;  1R1U A;  3G3Z A;  5D6F A;  2D1H A;  3WOD F;  1ZAR A;  1KU9 A;  2ZBK A;  4LJZ F;  5DUI A;  5DYM A;  4NQW A;  4YFN F;  2EFN A;  1QNT A;  1YW7 A;  3NEU A;  1LDJ A;  3DXJ F;  4LGW A;  2WV0 A;  3RKW A;  3WTS C;  1P4W A;  1R7J A;  1TTY A;  4L5I A;  3MQ0 A;  3HHG A;  5FLX K;  2J5P A;  2V1D A;  2EB7 A;  3J7A O;  3IKV A;  1D8K A;  3HTS B;  2MD5 A;  1QQI A;  3F8F A;  5L3D A;  2NS0 A;  3CO7 C;  2CGP A;  4I7H A;  3C3W A;  2WC2 A;  1AWC A;  4ZYG A;  3M7G A;  4MEX F;  3TGN A;  1GHC A;  4KMU X;  1F1Z A;  1JHF A;  2V1U A;  2FNA A;  4EJV A;  4P96 A;  3WTV C;  3KLN A;  3WGI A;  1KQ8 A;  1IN8 A;  2EV5 A;  1ZGJ A;  2OBP A;  1R1V A;  5CVR A;  4OMY A;  4L9N A;  1TBX A;  5J8F A;  4S04 A;  5ICE A;  1HKT A;  5DCM B;  4DQ2 A;  3EYI A;  4CDG A;  2H6B A;  1S29 A;  4AVP A;  2Y0M A;  3PQJ A;  4I0B A;  3BPV A;  4KA4 A;  2VOP A;  2PEX A;  3ZMD A;  2EWN A;  2FRH A;  1KYZ A;  2E1C A;  4EVI A;  1EH6 A;  2ZFW A;  4N9I A;  3E3V A;  4IHT A;  3HRT A;  4NB5 A;  4U7D A;  4CHU A;  3KP6 A;  4G94 A;  1SFE A;  3SZP A;  4FT8 A;  2P7V B;  2L3D A;  2O03 A;  3CUQ B;  2IA0 A;  1FP1 D;  5JFR A;  2CWE A;  3IWZ A;  2D45 A;  1CGP A;  4HW0 A;  4BNC A;  2MA3 A;  4WK8 F;  3WU1 B;  4QLC U;  3B02 A;  3RDI A;  1V4R A;  4WF2 A;  1Z6T A;  3RTR A;  1O3R A;  4U0V A;  2ZME B;  1I1S A;  1HBX G;  1ZLK A;  3HSE A;  3QAH A;  2Z9O A;  2OAZ A;  1Z6R A;  3EQL F;  5HLI A;  4GYI A;  2Z5U A;  2ESH A;  4HA8 A;  1RNL A;  4WCG A;  1U8R A;  2VOO A;  5E1W A;  3R0J A;  1H9G A;  3O3K A;  4Q48 A;  1F4K A;  1R5G A;  3E97 A;  2HQN A;  4P55 A;  4WXC A;  1RUO A;  3KEQ A;  2HQR A;  2W85 A;  2BE5 F;  1USS A;  1L3L A;  4IRG A;  1PUE E;  2DW4 A;  1XCB A;  1X3U A;  2ZCW A;  3V8K A;  1G3W A;  2O61 A;  3JSP A;  1ZN2 A;  4LK0 F;  1CF7 B;  4AIK A;  3RKY A;  3P7N A;  2KIM A;  1ZG3 A;  1Z9C A;  1XGS A;  4KNY A;  3FZV A;  1D8J A;  2HGC A;  2F5D A;  1W7P D;  3SXY A;  2CO5 A;  1U78 A;  3WTY C;  4A12 A;  2MH9 A;  2UXN A;  3KFW X;  2V6C A;  3KCC A;  1KQ9 A;  4HV6 A;  4TV7 A;  4XBF A;  1BI0 A;  2IT0 A;  1FP2 A;  1LEB A;  2IP2 A;  4OOI A;  1NHA A;  1TQP A;  2EFP A;  2FE3 A;  1K78 B;  1O3S A;  3VOD A;  3P9K A;  1R58 A;  4ON0 A;  5FB2 A;  2XIG A;  1IXC A;  2FML A;  2Z33 A;  3ZMT A;  3W6K B;  1S3J A;  1BI3 A;  3W6J B;  2H27 A;  1KU7 A;  1ZRC A;  3ZP5 A;  4CGZ A;  2OA4 A;  4UNO A;  4FX4 A;  4H0E A;  2M8E A;  4UV8 A;  4ESJ A;  5TJJ A;  3RKX A;  1MGT A;  3F8M A;  2X0L A;  2NNY A;  1U2W A;  1FYL A;  3HSF A;  4EM1 A;  3CUO A;  5DD8 A;  4PZJ A;  4A2U A;  4P9U A;  2MH2 A;  4OIR F;  3M8F A;  3F8C A;  2Q8K A;  4LLN A;  3HIF A;  3QRF F;  2RGV A;  1S8N A;  5LHG A;  5AIQ A;  1G4D A;  4A6D A;  5LRS A;  5D6E A;  2QM3 A;  5ILU A;  3F8B A;  2ACJ A;  5LGT A;  1MDM B;  3RIR A;  2KIF A;  3MWM A;  1RI7 A;  3T5X A;  3ZQ7 A;  2TDX A;  2K7L A;  3JAM Z;  1WQ2 A;  1XSX A;  4OIP F;  2CSO A;  2H94 A;  2QZ8 A;  3GW2 A;  5FFZ A;  1FSH A;  1OYW A;  1SFX A;  1MKM A;  1QZY A;  3GF2 A;  1YFH A;  2R3S A;  3TO9 A;  1ZLJ A;  1XB4 A;  1WKM A;  1SAX A;  3LQR A;  1BI2 A;  4KFC A;  4ENM A;  1HST A;  5BPD A;  5FD5 A;  3ZMU A;  2G9W A;  5L3E A;  3I53 A;  3LQQ A;  1FOK A;  2QBY A;  4HOB A;  5ICC A;  4A0X A;  2QYO A;  1YS6 A;  2DTR A;  5A2Q Z;  1VTN C;  3REO A;  4UHT A;  3FWE A;  1BC8 C;  3KP3 A;  3QOP A;  3GEZ A;  3EUH A;  3V7R A;  3P9I A;  3C1D A;  2DT5 A;  2XAH A;  4A0Y A;  1YW9 A;  1IAW A;  3ULQ B;  5CVJ A;  2A68 F;  5DCF A;  4KIC A;  4HLY A;  4HV5 A;  2GAU A;  1O7F A;  4G7Z F;  4I09 A;  1BC7 C;  4AIH A;  2OU2 A;  1XCV A;  1Z7U A;  1FYM A;  4ZYH A;  3WE3 A;  3E5U A;  3H3Z A;  3OV8 A;  2EV6 A;  4CIC A;  1XDU A;  4KIB A;  4RGR A;  3I58 A;  2P4W A;  3J81 K;  1SMY F;  5E17 F;  1FNN A;  1MD0 A;  3IL2 A;  3WGH A;  3IWF A;  4B8X A;  2LKP A;  1OR7 A;  1TNT A;  1S7A A;  2GXG A;  4QWQ A;  5D8K B;  2UZK A;  4O3M A;  1ZYR F;  5FGM A;  1J5Y A;  2XGX A;  4CO8 A;  3E6D A;  1OMI A;  3SQN A;  2YX7 A;  4MHG A;  2DK5 A;  2HKX A;  1XDS A;  5IT9 Z;  2FBI A;  1EV7 A;  1HW5 A;  4AIJ A;  2COM A;  2Z3Y A;  2DU9 A;  3GUD A;  2O3F A;  1HW2 A;  3T8R A;  3O6B B;  4WWC A;  5IT3 A;  2ELH A;  2F5C A;  3K0L A;  4FX0 A;  3F3X A;  4D0P A;  2EFO A;  4PGG A;  3JTG A;  2K86 A;  3QU6 A;  3V7S A;  4RB3 C;  2B0L A;  1FY7 A;  1YTY A;  3ZMZ A;  5ILS A;  5HVQ C;  3HOS A;  4Q4Z F;  3K9T A;  1XSD A;  3CUQ A;  3WTW C;  1IRF A;  3IRQ A;  1K79 A;  1O57 A;  3G73 A;  4PGH A;  2P5L C;  3LA7 A;  5HDG A;  2IVM A;  3GLX A;  3EET A;  1B1B A;  5ED4 A;  2M45 A;  1TNS A;  1Z05 A;  5K5O A;  1SFU A;  1FLI A;  4GXO A;  5ICG A;  1O3Q A;  5ILV A;  5JVT A;  5HDN A;  3HRS A;  2HFH A;  2ZME A;  2IRF G;  3GYH X;  3J80 K;  3ML6 A;  5BOX A;  2P6T A;  1FBU A;  2CFX A;  1IUY A;  2EA4 A;  2QWW A;  3KZY A;  3Q9V A;  5TRD A;  1B4A A;  3ROU A;  1BBY A;  2K02 A;  1S7O A;  1FC3 A;  4EJT A;  2A61 A;  2QQ9 A;  1OPC A;  2K4B A;  5HLG A;  1ZHF A;  2ISZ A;  2AS5 F;  3FXQ A;  1K7A A;  2FU4 A;  4Y13 A;  3ISP A;  3CJN A;  5H6R A;  4ZYE A;  3BJO A;  4LG0 B;  2VC1 A;  3AAF A;  2R7F A;  1BM9 A;  2FXA A;  4G6D A;  4M6X A;  5LGN A;  3DPL C;  1YS7 A;  2EV0 A;  3CUQ C;  5EEG A;  4EJU A;  2F5E A;  2J5O A;  4HX8 A;  3HHH A;  3U2R A;  1A04 A;  3DF8 A;  2RDP A;  5L3B A;  4L9V A;  3FHZ A;  1T0F A;  1F9N A;  4K2E A;  1W5S A;  3ERE D;  2K27 A;  1B9N A;  5LEK A;  1B6A A;  2DK8 A;  4LFU A;  4UXN A;  1K78 A;  2M5W A; 
#chains in the Genus database with same CATH topology
 2EK5 A;  2D1V A;  2UWM A;  3IAM 2;  5KVR A;  5LEJ A;  3FK7 A;  2MG4 A;  2E1M B;  2VAS A;  2JA2 A;  1ZR2 A;  4QPQ A;  3L2V A;  1ETY A;  5J6X A;  2HOS A;  2A6H F;  3H92 A;  2O7O A;  2HDC A;  3MKY B;  3CCJ I;  3AG1 H;  1TQI A;  3OL3 A;  1G59 A;  5E3L A;  2HYG D;  2W57 A;  4BDY A;  1YQA A;  3ASO H;  1MMN A;  4F3Q A;  3EYY A;  5J47 A;  4B3A A;  1W7P B;  4ABZ A;  3D0S A;  2CFO A;  2HEO A;  1ODD A;  3TED A;  1XS9 A;  1G3S A;  2F2E A;  1W4M A;  1OYY A;  2W4S A;  1P4A A;  3J7Z I;  1MNE A;  3JRC A;  2DFF A;  4DIQ A;  2M30 A;  2R0Q C;  5K5Q A;  3NQO A;  2ELK A;  3F23 A;  3BJA A;  1DU0 A;  3BWG A;  3WTT C;  2A6T A;  2XAJ A;  4II3 A;  3VEP A;  4D1Q A;  1P92 A;  2A69 F;  2CG4 A;  4HST A;  1BOB A;  4GYG A;  4JYK A;  2M1B A;  3LFU A;  3K4M A;  1OYI A;  2Z99 A;  2W84 A;  2L4A A;  2VKH A;  2O0Y A;  4ESF A;  1LDK B;  2XB0 X;  1Q1V A;  3KYD B;  1MMD A;  3JRI A;  4IKF A;  5H2F C;  4B47 A;  1I6X A;  2BY1 A;  1JUS A;  2RNG A;  5LHH A;  1YJ9 I;  1BJZ A;  3K2Z A;  5CKT A;  3RYP A;  4XSX F;  1WJC A;  1LFB A;  1GVD A;  3E5Q A;  3E6M A;  2VKE A;  3GXO A;  2VE9 A;  3QWL A;  4BKX A;  1XMK A;  5M5Y J;  1T0F C;  1W0T A;  2XAG A;  5L3C A;  2LBF A;  2WY7 Q;  1BN5 A;  3CP8 A;  1MDM A;  2Y69 H;  4L18 B;  2X6Y A;  2DOD A;  3DBL B;  1MJ9 A;  3ABT A;  2RQP A;  1FPQ A;  1XD7 A;  2XHK A;  2DFH A;  3K7A J;  2M87 A;  4JX4 A;  1U5T A;  2I10 A;  1IN7 A;  3GO5 A;  1WI9 A;  1RPW A;  1X2N A;  2FBH A;  4FHT A;  3BJ6 A;  1K61 A;  5GAH J;  5DUK A;  2V4J C;  4KT5 C;  2G7U A;  1DQU A;  3ZQL A;  3UR3 C;  3IC7 A;  1I1G A;  1I5Z A;  4XRS G;  2DQR A;  4BH9 A;  4BHP A;  1KYW A;  3BZK A;  1ZEL A;  4CCJ A;  1WH7 A;  3G71 I;  4DNC A;  3BOQ A;  1XGO A;  4JQF A;  4JK1 X;  2OJE D;  2LDU A;  1R6R A;  2IA2 A;  5EJC A;  3HRM A;  3ZQF A;  5TGT A;  3JAM K;  3GZ6 A;  3COA C;  4BQA A;  5D4S A;  1R49 A;  5J4V A;  4FTH A;  2L4M A;  5BPI A;  1K83 J;  1QZZ A;  1HXD A;  2ADU A;  2LSO A;  3E6B A;  4UVB A;  3QPL A;  3KX2 A;  3CDH A;  4BJ6 C;  1BOA A;  1IC8 A;  1W5T A;  6PAX A;  3HJE A;  3H3V K;  2MLG A;  3IV5 A;  3OR1 C;  1XMA A;  1P9Q C;  1BI1 A;  4HDU A;  3F6V A;  3BTJ A;  3KPH A;  1I3A A;  1W1W E;  2D2W A;  4CA0 A;  1JHH A;  2F5V A;  4RMN A;  2XSD C;  4U0Y A;  2HDW A;  1WJF A;  3GCM A;  3PM1 A;  3RQI A;  5HOO A;  1O3T A;  2JRT A;  2JA7 J;  3T8T A;  1Q1H A;  3KE2 A;  2HS5 A;  1H9T A;  4DW6 A;  5IY5 H;  4I99 C;  3VOE A;  1NK2 P;  3BZ6 A;  1YJW I;  3CCR I;  4M9Z A;  5DV5 A;  4HF1 A;  3WTZ A;  4MGR A;  3CME I;  1PP7 U;  3W2A A;  3MKZ A;  4IHY A;  3HOX J;  1LDD A;  2NRA C;  2GA1 A;  3JR9 A;  4BY1 J;  4EV0 A;  1WJA A;  5A2Q K;  4XKB A;  2VQG A;  3OIP A;  1WRJ A;  3FX3 A;  1NH3 A;  4DZJ A;  1YLF A;  2DI3 A;  1ZAO A;  4YG2 F;  5E79 C;  4I76 A;  4PSW A;  3DKY A;  3NWT A;  2CW0 F;  2DDA A;  3HKZ A;  4BXX J;  2XUB A;  3TOA A;  1PDN C;  4B09 A;  3PSF A;  1SFO J;  2VBW A;  4QSH A;  2X1E A;  5KNL A;  1DDN A;  1T38 A;  4OMZ A;  1WZ2 A;  2OTJ I;  4IHX A;  4A5N A;  1BR4 A;  1SVL A;  2PBI A;  3FM5 A;  1U5T C;  3RCO A;  2R5Z B;  1N78 A;  2DMT A;  4RGU A;  2DMN A;  3P5J A;  1E3H A;  2KHM A;  2VXZ A;  3H0D A;  3RI4 A;  1V55 H;  3DV8 A;  3C2H A;  3MVP A;  4CCK A;  1AKH A;  3GFL A;  3LSP A;  3TW6 A;  1ZRF A;  4MO7 A;  3HC7 A;  2STT A;  3D5L A;  1FBQ A;  2XGC A;  5CLS A;  2PN6 A;  4M3B A;  3I59 B;  5HLH A;  2GZW A;  1T98 A;  2GBY A;  1SD4 A;  3FM3 A;  4Q5S F;  1LQ1 A;  4PJM A;  1AOY A;  2AQF A;  1S6L A;  4M6Y A;  5BNG A;  1V3F A;  3R4K A;  2PMH A;  5AON A;  2W00 A;  1Y56 A;  4XLF A;  3FF5 A;  4JX6 A;  2TCT A;  3L00 A;  2CQX A;  1LVA A;  2LFB A;  2MLK A;  3WE2 A;  5FD6 A;  2XRL A;  1L0O C;  3I54 A;  1PP8 F;  3JTH A;  2DFI A;  2JK3 A;  4XIC A;  2DA3 A;  2CUZ A;  4DGW B;  2ZNZ A;  4A5M A;  4UB8 C;  2B7E A;  1IO2 A;  2DMP A;  1UHM A;  3ZN0 A;  4B48 A;  2LMD A;  1OCP A;  2BVM A;  2Z1D A;  1X19 A;  3CMA I;  5EGO A;  3CO6 C;  3GVA A;  1WJE A;  2IGN A;  5E1X A;  5CQG A;  1JE8 A;  4HRI A;  2W25 A;  4EJO A;  4KIF A;  2XKP A;  4U87 A;  5H20 A;  3BR5 A;  4CCL A;  3WTX C;  2JUC A;  3SYT A;  3FMR A;  4RB2 C;  3LAJ A;  4YFX F;  4N0B A;  5F0C A;  5D5X B;  1K6O A;  2M9H A;  1Y0U A;  1J7K A;  3T0Y A;  2NVQ J;  3SHF A;  4A3F J;  5LBQ A;  3W2W A;  1FOW A;  1LVK A;  4F7Z A;  3ZMV A;  3F21 A;  3C18 A;  4OWR B;  5D5W B;  3TQN A;  5JR3 A;  5IT9 K;  1UCR A;  4R8H A;  4E70 A;  4GO1 A;  5M3M J;  2HR3 A;  3B6C A;  4N4N B;  4BS9 A;  4U0W A;  1SD6 A;  4FE7 A;  2CQK A;  2XRO A;  3ZQC A;  2V26 A;  4HQE A;  2JZY A;  3K4B A;  4XNF A;  2XF7 A;  4I02 A;  2DPD A;  2EIJ H;  4RB0 A;  3I56 I;  3CMY A;  3ZRG A;  4EMS A;  1VQ4 I;  2YX4 A;  3GTQ J;  3OYG A;  2EA2 A;  1IV8 A;  3LA2 A;  3E6C C;  3OYA A;  1GLN A;  4ENJ A;  2PJP A;  2P5K A;  1U6G A;  5AIP A;  2WY8 Q;  1VQ8 I;  2K9M A;  4BQQ A;  4A3I J;  1VQK I;  2X1D A;  2DMQ A;  3BG9 A;  3QU3 A;  1D1B A;  5BMZ A;  4L0Y B;  4PCQ A;  3SZT A;  3ECO A;  5GAE J;  5J4Y A;  3SJM A;  3MKW B;  4KIG A;  5CJ9 A;  1KQ0 A;  2GOX B;  4Y17 A;  3SEQ A;  3S16 J;  2R7R A;  4RGS A;  2YSR A;  3L7W A;  4HYE A;  5K5R A;  2R5Y B;  4N9H A;  2FMY A;  2QEN A;  2LF8 A;  2PG4 A;  4E7H A;  2E35 A;  2Y9Z A;  2HVS A;  5IP6 A;  1R4N B;  2P6S A;  1TLH B;  4LK1 F;  1Z7L A;  5J1R A;  1LEA A;  2OQG A;  4D5F A;  3C2B A;  1T08 B;  1KGS A;  1T6S A;  2ZXW H;  2WB1 A;  2XDV A;  1ETK A;  3MCZ A;  1QHH D;  3EDP A;  2KKO A;  2R7S A;  2VKV A;  3DP7 A;  2ZJ2 A;  4ZYD A;  2QLZ A;  2HI3 A;  2C6Y A;  3E1S A;  3CCS I;  1UHW A;  2E2I J;  5F64 A;  4LLG F;  2Z2S B;  1R22 A;  2OV7 A;  4RAG A;  4LLL A;  2DQL A;  2O6G E;  2A3S A;  5IYC J;  5CYV A;  2IGM A;  4MEY F;  3W6V A;  2K3P A;  4PDK A;  3MEX A;  1BJA A;  2R93 J;  2W24 A;  2ZKZ A;  1LE8 B;  2HYF A;  1LUJ B;  3GWZ A;  2Z16 A;  3K4J A;  1QVT A;  3FXK A;  4HEA 2;  2PMU A;  3V4G A;  1IW7 F;  1LFU P;  2RC4 A;  2V7F A;  4DZP A;  3C7J A;  3DKW A;  4C3J J;  1R71 A;  2HYJ A;  4AD9 A;  3VB2 A;  3DBR B;  2CUF A;  1Z67 A;  5CVU A;  3TDU C;  4YIF A;  4IL6 C;  1IN6 A;  4YEL A;  4M9X A;  4XN0 A;  2EFQ A;  1P2F A;  3G1O A;  4A69 C;  3GFM A;  3OS2 A;  2BEO A;  2KL4 A;  1ERD A;  1MBE A;  2JTV A;  4A3G J;  4YIR X;  3ABU A;  4I98 B;  3KP4 A;  1MMS A;  5E3O A;  4C9Y A;  3SFZ A;  1E17 A;  2VON A;  2JMW A;  2E5N A;  2VIX A;  4S05 A;  3PO2 J;  2IXS A;  3R61 A;  2OUM A;  2XAS A;  4ASN A;  4IHS A;  3OOU A;  3SZG A;  3A2K A;  3BG6 A;  1GVJ A;  2YU3 A;  4YEJ A;  5DEQ A;  3J7A Y;  4G6Q A;  4R79 A;  2M4G A;  2GIZ A;  3K1N A;  2GA2 A;  2RV8 A;  2OQR A;  5HOD A;  2CV0 A;  4HF2 A;  1TWH J;  1GV5 A;  2PQ8 A;  2OZ6 A;  3ABK H;  5EG0 A;  3I71 A;  1R36 A;  4EM0 B;  5LD2 C;  1K4T A;  2HOE A;  1R23 A;  3TKY A;  3MFK A;  3OIO A;  1YO5 C;  3A02 A;  1A5J A;  3HSR A;  3ABM H;  3LL7 A;  2RQQ A;  4HX4 A;  4W1U A;  5DM6 F;  4IVN A;  2RKH A;  2DJI A;  4O5V A;  4KUM A;  1ZG1 A;  1ON2 A;  2A5Y B;  3HUG A;  4DOZ A;  4BGD A;  3L2C A;  2H8R A;  1D1C A;  3OSG A;  1IN5 A;  5DCM A;  4OU0 A;  2BY2 A;  2FNP A;  1D0Z A;  1MNM C;  4XRF A;  2HKO A;  4F92 B;  2L5Q A;  4CZZ A;  3FDY A;  2EFW A;  2ZXH A;  3S14 J;  2RNJ A;  3IH4 A;  5BS6 A;  4U88 A;  2L9R A;  1TWC J;  4ESB A;  1EH7 A;  4IF4 A;  1AA7 A;  1IXR C;  5EEA A;  3PNT A;  2O5R A;  1OKR A;  3BG7 A;  1YHQ I;  2LOO A;  5L3F A;  3HPH A;  3ZOB A;  2GIV A;  5E18 F;  2R92 J;  4Z2Y A;  1Y8R B;  4V2G A;  2L0K A;  3DLL F;  1FBS A;  3F8N A;  4FAS D;  3S1Q J;  2BHZ A;  2VPL A;  2YR2 A;  2X6O A;  1WHU A;  2EIK H;  3FXM A;  1YIT I;  1ZK8 A;  1W7P A;  1BR2 A;  2EZL A;  1WPK A;  5EDN A;  1H0M A;  1OIS A;  2CV2 A;  4AU7 A;  2V9P A;  4L5J A;  4UUV A;  2CJJ A;  2KRF A;  1ZRE A;  1GUU A;  4XLN F;  3O8H A;  1LJ9 A;  1MBG A;  4A0Z A;  2P8T A;  1FT9 A;  1G6N A;  3H0G J;  4RAY A;  3TO6 A;  2M0M A;  4Y15 A;  3TDZ C;  3G4S I;  1QU3 A;  2ZFU A;  2ZXJ A;  1FTT A;  1REP C;  3PSI A;  4RBO A;  3DQV C;  3KP2 A;  4ZC3 A;  4MQ9 F;  5D8L B;  3N97 A;  4BEH A;  3F72 A;  2DO7 A;  4M9S A;  4YII A;  3SDB A;  4IXA A;  4DYR A;  1YIJ I;  1DU6 A;  1Y6I A;  4KDP A;  4D7N A;  3BZC A;  5FO5 A;  3U1D A;  4EM2 A;  3BDD A;  1JKP C;  1FJL A;  4XID A;  1YX5 A;  2E5Z A;  3NRV A;  2RVC A;  4ZJZ A;  3CCU I;  4BL0 B;  2BYV E;  2HQA A;  3D5R C;  3JSO A;  4UUS A;  5FRN A;  1R1T A;  2DA4 A;  2HXI A;  1A6I A;  2FSW A;  4RGX A;  3W3C A;  2RN7 A;  1XGN A;  2GXA A;  3FMS A;  1EH8 A;  4BAC A;  2ZO4 A;  3JCU C;  3MZ8 A;  3LSR A;  3RZD J;  2DXI A;  2IS2 A;  2UXX A;  2JJ7 A;  4BHC A;  4A3K J;  4C3I J;  1W0U A;  3D5S C;  3J81 Z;  1J0R A;  1ON1 A;  3FXR A;  4NC6 A;  1FOY A;  4O6J A;  3PNV A;  4E7Z A;  2VT2 A;  1RET A;  2NAZ A;  4I2O A;  2F5F A;  2E1M C;  2ECB A;  4KYW A;  2FBK A;  4A3J J;  2OTL I;  2EH3 A;  1CF7 A;  5CPR B;  5LRR A;  4G9Y A;  3KEO A;  2V9V A;  4ZZD A;  5E1Z B;  5GAG J;  2VQH A;  3PUF A;  2CUJ A;  4U7B A;  4OIO F;  2LTP A;  5FFX A;  1FWZ A;  2HU9 A;  1T39 A;  2GQQ A;  3GTP J;  1ETV A;  1FSE A;  1J59 A;  2EZI A;  2V79 A;  3GTK J;  5KK1 A;  3GFI A;  4PSX A;  4RAZ A;  1SAN A;  4ETS A;  4P5O A;  3I4M J;  4MQV A;  2AO9 A;  3WU0 A;  4KT6 A;  3CD6 I;  3CC4 I;  1UST A;  2P81 A;  2P7C B;  3R0A A;  5ERI A;  3WGG A;  1BIA A;  1G8X A;  1PYV A;  2VOD A;  1MBK A;  1MJB A;  3S2D J;  3QP5 A;  3QPT A;  3B6A A;  3GZN B;  1HKQ A;  3ZGK A;  4HAM A;  1EA3 A;  3WU2 C;  4BQN A;  1D0Y A;  4HZF A;  3TO7 A;  1WFX A;  4ZTJ A;  2TRT A;  2AXL A;  2O8X A;  3BLY A;  4BQO A;  1HLV A;  2Q0O A;  5E8G A;  4AVZ A;  1KU3 A;  2CYY A;  3RPU A;  1E2X A;  3IRR A;  4PJL A;  4EGZ A;  1TW3 A;  3I64 A;  3CF5 F;  5EF6 A;  4IOA F;  2E34 A;  3LOC A;  1I50 J;  3GTO J;  1I27 A;  2DYS H;  2QUF A;  3DPT A;  3MKL A;  2MC4 A;  2FF4 A;  1T95 A;  2P0W A;  1LNW A;  4RB1 A;  3M8E A;  5FKM A;  4WX9 A;  5K1Y A;  2DOF A;  2F6C A;  4GRI A;  4LB6 B;  2LNB A;  2E19 A;  1TT5 B;  3WG9 A;  1HKS A;  2RRE A;  3CCV I;  1H89 C;  3MZY A;  4KMF A;  1IUF A;  2KJB A;  2XAQ A;  5HDK A;  2MBF A;  2Y75 A;  3CLQ A;  4A3C J;  4V19 K;  1J9I A;  3BR1 A;  2YU9 J;  1IRG A;  2E1N A;  1SD5 A;  1HCR A;  2ZXI A;  4IPA A;  3ZMS A;  2E2H J;  1O7L A;  4CYC B;  1M1E B;  2FD5 A;  2DPU A;  2ESN A;  2KZG A;  1JTY A;  4GFB A;  1G3Y A;  3IHU A;  1FZP B;  2LRE A;  2ZNY A;  4L5E A;  1Z1D A;  3LA3 A;  2XRN A;  3R6S A;  2FQ4 A;  3I59 A;  1MBF A;  2NOG A;  2FOK A;  2XPV A;  1WWX A;  3VFZ A;  2XPW A;  3PFI A;  2ZC2 A;  5FJ8 J;  3J80 Z;  1LPQ A;  3HRU A;  3JRF A;  5FLX Z;  3FHN A;  2WAF A;  2IJL A;  3V7C A;  2YPR A;  4HG2 A;  1WVR A;  2VPR A;  2K3F A;  4ZZL A;  2Q2E A;  4NQW B;  2FA5 A;  3Q9S A;  2IS1 A;  1JUP A;  4M74 A;  2FEZ A;  3GLL A;  5LLQ A;  2K9S A;  5C4J J;  5C4X J;  2VQL A;  4KIS A;  4M73 A;  2BHY A;  3LSG A;  2H09 A;  2K9N A;  1SEU A;  1YG2 A;  2DOA A;  5F04 A;  4IX7 A;  4BE1 A;  2K4J A;  2EBI A;  1QO0 D;  1XTA A;  2CQN A;  3M9A A;  3ZQI A;  2PFB A;  4FET A;  3DLA A;  3L2U A;  5FLM J;  1VQO I;  3CLO A;  2HVR A;  2KJC A;  2HZD A;  3LST A;  3RJP A;  4OIQ F;  4HNU A;  3DEU A;  5FKN A;  1RC9 A;  5D4R A;  4R1H A;  4G7O F;  1ULY A;  1HW1 A;  5HLT A;  4Y33 A;  4HDV A;  4IRI A;  3OOP A;  3CTA A;  2X48 A;  3TBI A;  5D5U B;  3OYJ A;  1RIO H;  2KZV A;  5CVI A;  3W2V A;  2OD5 A;  2QSG X;  3WG7 H;  3F22 A;  3GFJ A;  3EPZ A;  2PJR A;  1DP7 P;  1UHS A;  4KN7 X;  2OZU A;  3V8J A;  2OF7 A;  1HQC A;  1A6Q A;  5DTD A;  2AHQ A;  1B8I B;  4L0Z B;  4A6E A;  4W97 A;  3L09 A;  1GXQ A;  5BQT A;  2E2J J;  1V5E A;  5GAD J;  3ZQQ A;  2JPC A;  2IA1 A;  3OWT A;  3AG3 H;  1C0W A;  5E3N A;  4LOC A;  5HS7 A;  4GDF A;  1IJW C;  4UVA A;  3HEF A;  2ZJP F;  2KIQ A;  3GBG A;  3ZN1 A;  4I0A A;  3L9F A;  5E8I A;  4XLE A;  3SDG A;  5B5E C;  4BXU A;  2A07 F;  4M3G A;  1XGM A;  2UV1 A;  2L7F P;  1HA8 A;  5K7H A;  1VZ0 A;  4M72 A;  3V8L A;  3R60 A;  2ID6 A;  2RAE A;  3F9K A;  4YRV A;  2WWY A;  1F5T A;  2JT1 A;  3OYB A;  2JQ7 A;  3KP5 A;  2LH9 A;  3B73 A;  4A3L J;  3K70 D;  3H36 A;  3BP8 A;  2R7U A;  4EGY A;  4RS8 A;  3BRO A;  3M3Y J;  1IN4 A;  1T56 A;  4MFE A;  3LFK A;  2AXT C;  4F91 B;  1U8B A;  1YRN A;  2BW3 A;  2DAO A;  3BG5 A;  5CVV A;  4XRM A;  3VYR B;  1XSV A;  2CW7 A;  2M34 A;  3VYT B;  1P4X A;  3E0J B;  3A03 A;  2L7M P;  4E7S A;  3NAR A;  3HKZ N;  2VBZ A;  2VJJ A;  5F27 A;  4EQQ A;  3M1C A;  1JGG A;  3LSJ A;  3BY6 A;  2IGK A;  2P5V A;  4OAY A;  2CW8 A;  1KU2 A;  1B72 A;  4DJA A;  1P6R A;  1IV6 A;  2VBX A;  4ENN A;  1XN7 A;  4KIT B;  5EEH A;  4M3D A;  5GP9 A;  4FCY A;  2X4H A;  2EIN H;  2LRD A;  5K7Z A;  3LAP A;  2VUM J;  3WTU C;  5JHU A;  3VPR A;  2XV4 S;  2V6E A;  3T1B A;  4OIN F;  3GZ5 A;  4PJJ A;  1MZB A;  3L2R A;  3JW4 A;  4HX7 A;  2R7D A;  2KP6 A;  1HSJ A;  3CJT B;  3CMM A;  2JPB A;  3I5U A;  4XMY A;  3MZH A;  1I3Q J;  1OCT C;  3CDI A;  3GX4 X;  4UVC A;  1DUX C;  2OCE A;  4XLA A;  4S0H B;  4CH7 A;  2KMU A;  3H3U A;  1TWG J;  4M71 A;  4FE4 A;  2ETH A;  1D5V A;  3TP3 A;  1VQM I;  2A6E F;  1J2X A;  2VB6 A;  4HLX A;  4UY8 I;  2EZK A;  3OYL A;  4AWX B;  3BPX A;  1JKQ C;  3MAJ A;  1SD7 A;  5IP9 J;  3JRG A;  4A3D J;  3O2P E;  4ZYA A;  4BAY A;  1H88 C;  3FBN B;  4G6T B;  1QGP A;  2F4I A;  2HTJ A;  2VT3 A;  2VBY A;  3ABL H;  5JI6 A;  2JVH A;  3KYL A;  2L02 A;  3HOV J;  1ZKG A;  9ANT A;  2BGC A;  2WAD A;  2ELJ A;  2IPQ X;  3AL0 C;  2Y9Y A;  4HF0 A;  2WTE A;  2STW A;  4G8X A;  3RQ4 A;  2DCE A;  1WCM J;  2L54 A;  2O8K A;  4GCV A;  1IF1 A;  3FKJ A;  1TW2 A;  2M0C A;  4II2 A;  1TWA J;  2LYC A;  3VDX A;  1U3E M;  3G1M A;  5IYD J;  2FQ3 A;  2ZB9 A;  4N4O B;  3PUB A;  2CU7 A;  4MNU A;  4E7I A;  1POG A;  4ZTF A;  3QOD A;  5B3S H;  4L9T A;  1FX7 A;  1OQY A;  3Q0V A;  2DT7 B;  4HQM A;  1U5T B;  3ELK A;  2GXB A;  3S2W A;  4D7M A;  3OYF A;  2DJN A;  4LB5 A;  2DFE A;  3K1P A;  3OY9 A;  2QQ8 A;  2NYX A;  3CJR B;  1FYK A;  2LF7 A;  1DPU A;  3NAU A;  3I0T A;  3ZR8 X;  3N4M A;  3K1M A;  3M8J A;  2V1N A;  3N05 A;  3CZ6 A;  2G0E A;  3CES A;  4CYD A;  1MMA A;  3LWF A;  3K4K A;  3E5X A;  2A5W A;  3OYN A;  3ZPL A;  1R5H A;  4IJA A;  4Q47 A;  5K7F A;  1UFM A;  2OC6 A;  1N75 A;  4UV9 A;  3EUA A;  2GWR A;  3KZI C;  2KPM A;  3H5A A;  4DYQ A;  3KP7 A;  4XSZ F;  2FJ1 A;  1LB2 A;  2N8G A;  1QHG A;  4CXF A;  3CC2 I;  1Y1V J;  3UKG A;  3A01 B;  4MTD A;  5FRO A;  1ZH5 A;  5F08 A;  4ENK A;  3FMQ A;  4MTE A;  2XVC A;  4H4K C;  4BYY A;  2BBY A;  2JSC A;  4AYB N;  1S72 I;  2WB1 N;  1PVE A;  2HWV A;  1JKO C;  4AYB A;  4XK4 A;  2R7T A;  1B59 A;  4UB6 C;  4I01 A;  4F55 A;  2CUE A;  4X0G A;  2R4G A;  3Q5F A;  4M6V A;  2L01 A;  1QBJ A;  3KET A;  1GXP A;  1E0E A;  2MSY A;  4JP0 A;  3IKT A;  3HM5 A;  2HTS A;  2K5C A;  1YYV A;  2EQR A;  1ETO A;  4YFK F;  4WXH A;  3U9G A;  5B1A H;  5FKK A;  1TC3 C;  4KN4 X;  1Z91 A;  5EZH A;  2PI0 A;  3HZJ A;  1SC7 A;  5LHI A;  1TQM A;  2ISY A;  3DKX A;  3AKZ A;  4G7H F;  2CMP A;  3TOB A;  1RRJ A;  2HZT A;  1G2H A;  2VKD A;  2BXY A;  4E4H A;  5DDG A;  2F4O B;  2H1K A;  3RPQ A;  5L3G A;  2ZJQ F;  4NHJ A;  4JBA A;  2Y48 A;  3OYE A;  2EJR A;  3Q3S A;  4BY7 J;  2QQB A;  3P9C A;  3F6O A;  1JGS A;  2IW5 A;  2NNN A;  4XLC A;  3K4N A;  2IAI A;  3BCA A;  1SMT A;  5GPC A;  4AID A;  3CP2 A;  4XLP F;  3KZZ A;  3HTU A;  1ZRD A;  1ZGA A;  4E6K G;  1RZ4 A;  4X1E A;  4LG0 A;  3OR2 C;  1GDT A;  1B9M A;  2MC3 A;  5J8C A;  2VN2 A;  2KIU A;  1UJ8 A;  3OIQ A;  1JI8 A;  3IAS 2;  1PUF A;  3DFG A;  5LGU A;  2QVO A;  4LMY A;  3BTC A;  2VE8 A;  1YIO A;  2WA0 A;  3M1E A;  4P9F A;  1DPR A;  3GTJ J;  2VC0 A;  1JXS A;  4ZH4 F;  2H6C A;  3OMY A;  2W1O A;  5HS9 A;  3IH2 A;  4BJT A;  5FKO A;  1QPM A;  1MJA A;  1X58 A;  4NNJ A;  2ZSI B;  1X4O A;  3I4P A;  2LVS A;  2F4M B;  5DD4 A;  2X9D A;  4BBR J;  2QCO A;  5D5V B;  2B9S A;  3HOU J;  4A93 J;  1X1D A;  4BE0 A;  4AM3 A;  1WGX A;  1X4P A;  2BXZ A;  1YJN I;  2E7W A;  5H6Q A;  1UAA A;  2PLY A;  2WAE A;  1D3Y A;  2BV6 A;  3H5N A;  2LG4 A;  2OPT A;  1IZ1 A;  2K85 A;  1TZL A;  3OL4 A;  1N25 A;  3IP4 B;  1ACI A;  2EPF A;  1S9H A;  2KFD A;  2OCC H;  1RUN A;  2BVL A;  4X6A J;  5F6F A;  5JLW A;  2V1X A;  4EJW A;  2DBB A;  3RYR A;  1I39 A;  1UB9 A;  5F1R A;  4LD5 A;  2DLL A;  3PFY A;  4JX5 A;  3QP6 A;  4NBQ A;  1X3W B;  1YW8 A;  3G1L A;  5ICF A;  2QQA A;  4IRH A;  4RA2 A;  3HOT A;  4HBL A;  5E20 A;  4GGG A;  1S7E A;  3KLO A;  5F0F A;  1A31 A;  2XSJ C;  1ONV A;  3V42 A;  1ZG5 A;  2UUZ A;  3H1C A;  3U1K A;  3BCB A;  1IXS B;  2NVU B;  4MLO A;  4WXD A;  5KAF C;  4L9J A;  2XAF A;  1KA8 A;  2LP0 A;  2HXO A;  1G3T A;  3RZO J;  4P1W A;  3ECH A;  3K4L A;  3OYH A;  1R00 A;  3FXU A;  2QSH X;  2R7X A;  1WSU A;  4RLF A;  3PNY A;  2ECC A;  3OYC A;  3QPH A;  3X2Q H;  2G7H A;  2XKO A;  3Q0U A;  4BUP A;  4CSW A;  4CYC A;  1U9N A;  3AG2 H;  1STZ A;  3HDD A;  3JRE A;  1T2K A;  1J75 A;  1RR8 C;  2HPM A;  3HYI A;  1BIB A;  1T33 A;  2W7N A;  3K69 A;  2DT6 A;  2LLK A;  3HXL A;  3PQK A;  3DEE A;  5HS8 A;  5C3E J;  4BHB A;  3DTE A;  3S1R J;  2E7X A;  2GM4 A;  1R1U A;  1FEX A;  2M3A A;  3G3Z A;  1O4X A;  5J40 A;  1VI0 A;  2D1H A;  5D6F A;  3WOD F;  4C2U A;  1R4M B;  1X1C A;  1ZAR A;  2VQC A;  3A0H C;  1KU9 A;  2ZBK A;  4LJZ F;  1V5G A;  1WJ5 A;  5DUI A;  2BOL A;  5DYM A;  2CQ7 A;  2Y0S A;  4I6Z A;  3ZQG A;  1QA6 A;  4NQW A;  4YFN F;  2DA2 A;  2EFN A;  3HGG A;  2DA7 A;  2XGD A;  3HG9 A;  2DTZ A;  1QNT A;  1QZE A;  3LSM A;  1YW7 A;  3NEU A;  1LDJ A;  1HOM A;  3DXJ F;  3ERM A;  3I9V 2;  1MSE C;  4LGW A;  2QKL B;  2WV0 A;  3RKW A;  3WTS C;  1OJL A;  4PFP A;  1P4W A;  1R7J A;  1TTY A;  4L5I A;  3MQ0 A;  1IG7 A;  3M4O J;  3HHG A;  5FLX K;  4BBS J;  1K4S A;  2J5P A;  1F36 A;  3HBL A;  5GPA A;  2V1D A;  2EB7 A;  3J7A O;  2MW8 A;  1RKT A;  1P7J A;  2LKS A;  2VJI A;  3IKV A;  1NG7 A;  1D8K A;  1E3P A;  3HTS B;  1JUM A;  2MD5 A;  1QQI A;  3F8F A;  5L3D A;  2QA4 I;  2NS0 A;  3CO7 C;  2I8D A;  2CGP A;  4IHV A;  4XRS A;  4I7H A;  3HOW J;  3C3W A;  2CH0 A;  2WC2 A;  3S3O A;  1R9T J;  1BR1 A;  5JLX A;  1AHD P;  1WH5 A;  1UMQ A;  1AWC A;  2XF6 A;  2L7Z A;  2LY1 A;  2R7Q A;  3DWL E;  4ZYG A;  5EYR A;  4Z6Y A;  3M7G A;  4MEX F;  4AC0 A;  1DGW Y;  3FXL A;  1TT0 A;  4FIS A;  4KMU X;  3TGN A;  5J1Y A;  1GHC A;  1VND A;  1F1Z A;  1JHF A;  1ENH A;  2E60 A;  2WAQ A;  2V1U A;  4D5C A;  4NDL A;  2FNA A;  1D5Y A;  4OAZ A;  2NS7 A;  3KIO A;  4EJV A;  4ITV A;  4P96 A;  3WTV C;  3KLN A;  5LFA A;  3WGI A;  4BU2 A;  1KQ8 A;  3BTL A;  2Q1Z B;  2H1L A;  5M3F J;  1IN8 A;  2EV5 A;  2M7B A;  2M8G X;  4PJN A;  1ZGJ A;  2OBP A;  1IDY A;  1R1V A;  5CVR A;  4OMY A;  4L9N A;  1TBX A;  2PMZ N;  5J8F A;  3DCF A;  1EF4 A;  1BW5 A;  3D1N I;  4EEF G;  3HGY A;  4S04 A;  2QKM B;  3A4C A;  3OYM A;  3OSF A;  4M3E A;  5GTI C;  5ICE A;  2PMZ A;  1HKT A;  1KON A;  1MBJ A;  2Y2Z A;  5DCM B;  4DQ2 A;  3EYI A;  4CDG A;  5HNH A;  3GTG J;  3CDL A;  2H6B A;  1S29 A;  2M4K A;  4AVP A;  2Y0M A;  3PQJ A;  4I0B A;  3BPV A;  4KA4 A;  2VOP A;  2PEX A;  3FIS A;  3ZMD A;  2EWN A;  1ETQ A;  2FRH A;  3L2W A;  1KYZ A;  4XQF A;  3L2Q A;  2R5Z A;  2E1C A;  4EVI A;  3CJQ B;  1EH6 A;  1Y0N A;  4FQG A;  1DGR M;  2ZFW A;  4N9I A;  2MD0 A;  3E3V A;  4IHT A;  3HRT A;  4BE2 A;  4NB5 A;  4U7D A;  4CHU A;  3KP6 A;  4G94 A;  1SFE A;  3AG4 H;  3G6E I;  1LKX A;  3EUK L;  1KZH A;  3SZP A;  4FT8 A;  1ZQ3 P;  2P7V B;  2L3D A;  3FK6 A;  2O03 A;  3SFI A;  3CUQ B;  2IA0 A;  4PK4 A;  1FP1 D;  5JFR A;  2CWE A;  3IWZ A;  4LIU A;  2D45 A;  1VQP I;  2BZT A;  1U9O A;  4QTR A;  1CGP A;  3GME A;  5C44 J;  4HW0 A;  1VQ9 I;  3CCY A;  2K9Q A;  1GT0 C;  4BNC A;  2CQQ A;  4BDZ A;  2MA3 A;  3I4N J;  1WI3 A;  4WK8 F;  3WU1 B;  4QLC U;  3B02 A;  3RDI A;  1V4R A;  1R5I D;  4WF2 A;  2MAB A;  1Z6T A;  3RTR A;  1XPX A;  1ITY A;  1O3R A;  2W48 A;  4BJ5 C;  4U0V A;  5J1U A;  4BEH B;  2X6W A;  2VLA A;  2ZME B;  1I1S A;  2QGU A;  2LKX A;  1HBX G;  5GTH C;  1ZLK A;  1HC8 A;  1NG6 A;  3HSE A;  3QAH A;  2Z9O A;  2OAZ A;  3ZQH A;  1Z6R A;  1BL0 A;  4LIV A;  3PJR A;  3QPS A;  4PUS A;  3EQL F;  5HLI A;  4GYI A;  2LD5 A;  4E7J A;  4UUT A;  1T8I A;  2IS4 A;  2Z5U A;  2ESH A;  4HA8 A;  1RNL A;  2R7W A;  3K4C A;  5CQE A;  4WCG A;  1U8R A;  2VOO A;  1YX3 A;  3S8P A;  4E7K A;  4RLQ A;  2NVY J;  3DTK A;  5E1W A;  1S5L C;  1FIA A;  3R0J A;  4UUS B;  3VWB A;  1H9G A;  2R7O A;  2DYR H;  3O3K A;  4Y4R A;  4ANJ A;  1MH4 A;  4Q48 A;  1F4K A;  1R5G A;  3E97 A;  2L9N A;  2HQN A;  2LC2 A;  1Z3X A;  4P55 A;  3GTL J;  4WXC A;  1RUO A;  1YI2 I;  3KEQ A;  1MIJ A;  2HQR A;  2BE5 F;  1Z21 A;  1USS A;  2W85 A;  5FRM A;  3LNQ A;  3MMY B;  1L3L A;  1SVM A;  2KRH A;  2K9L A;  4IRG A;  1PUE E;  2DW4 A;  2QF7 A;  3S93 A;  3S3M A;  1XCB A;  1X3U A;  4IEJ A;  1UEL B;  2ZCW A;  3KEY A;  3V8K A;  1G3W A;  2O61 A;  2JWT A;  5F1J A;  3JSP A;  1ZN2 A;  2XPU A;  4LK0 F;  1CF7 B;  1EJ9 A;  2W82 A;  4AIK A;  4MIM A;  4IQJ A;  3RKY A;  4LIT A;  3FIW A;  3P7N A;  4XR6 A;  2KIM A;  3CQZ J;  1ZG3 A;  1ETX A;  3VYS B;  1Z9C A;  3F0C A;  1XGS A;  4KNY A;  3DTI A;  3FZV A;  3CCL I;  1D8J A;  2HGC A;  1HDP A;  1D0X A;  1K6Y A;  2F5D A;  2R5Y A;  1WJB A;  1W7P D;  3A01 A;  3BC8 A;  3CCM I;  2X6X A;  2WBM A;  2JA6 J;  3SXY A;  5KAI C;  2CO5 A;  2DN0 A;  3TL4 X;  3QYF A;  1U78 A;  3WTY C;  3HB9 A;  3DBH B;  4A12 A;  1XMX A;  2ME0 A;  2MH9 A;  3A1Y A;  2UXN A;  2V6C A;  2GOM A;  3KFW X;  3OYI A;  3RKQ A;  3KCC A;  1KQ9 A;  4HV6 A;  2MFZ A;  1PJR A;  3FBI B;  2EZH A;  4TV7 A;  4XOT A;  4XBF A;  1JT6 A;  4HNV A;  1BI0 A;  2IT0 A;  1ORK A;  2NVT J;  1FP2 A;  1LEB A;  4XKV A;  1H8A C;  3S32 A;  2IP2 A;  4OOI A;  1NHA A;  3OS1 A;  1TQP A;  2X1C A;  2EFP A;  2FE3 A;  1K78 B;  2A05 A;  1O3S A;  1RR7 A;  2YUS A;  1LE8 A;  3U21 A;  3VOD A;  3P9K A;  1R58 A;  4ON0 A;  1FOX A;  5FB2 A;  2XIG A;  3HPG A;  3JRA A;  1APL C;  3HL2 A;  1IXC A;  5KHD A;  2KRC A;  2HDD A;  1Z0X A;  2FML A;  3TP0 A;  3PL8 A;  5IOY A;  4D9J A;  2XC7 A;  2IS6 A;  2JSP A;  2Z33 A;  3FXJ A;  2AQE A;  1V54 H;  1LFP A;  4DYC A;  3ZMT A;  3W6K B;  1S3J A;  4NC8 A;  1BI3 A;  3W6J B;  2H27 A;  1MMG A;  2NXN B;  2K40 A;  1KU7 A;  1MSF C;  1ZRC A;  4ZDO A;  3ZP5 A;  3BTI A;  4CGZ A;  3FXO A;  2LR8 A;  4B3X A;  3CF2 A;  4AUX A;  2OA4 A;  3BT9 A;  4FX4 A;  4UNO A;  4DBQ A;  1XC5 A;  4H0E A;  4A3M J;  4XOP A;  4Y3O A;  2M8E A;  2X85 A;  2F48 A;  2DA1 A;  4UV8 A;  1VFC A;  2EIL H;  2ID3 A;  5TJJ A;  4ESJ A;  2FUG 2;  3RKX A;  1MGT A;  2M7A A;  3F8M A;  1N77 A;  3LSK A;  4CCN A;  5DS9 A;  2X0L A;  1Y1W J;  1ZTR A;  2NNY A;  4KJZ A;  1U2W A;  1FYL A;  1MND A;  3PO3 J;  3HSF A;  5F0H A;  4EM1 A;  4C3H J;  4J00 A;  4IO9 F;  3CUO A;  1GV2 A;  1XX5 A;  5DD8 A;  4PZJ A;  4A2U A;  4P9U A;  2MH2 A;  4J01 A;  2VI6 A;  4OIR F;  1YE9 A;  4E7L A;  3BQZ A;  2GLO A;  3CC7 I;  1YOV B;  3M8F A;  2MYS A;  3L1P A;  2HVQ A;  3F8C A;  2PX9 A;  2Q8K A;  1Z77 A;  4LLN A;  3HIF A;  2Q2E B;  1P7I A;  3QRF F;  2RGV A;  1S8N A;  1U0J A;  5AIQ A;  5LHG A;  1G4D A;  4A6D A;  5LRS A;  5D6E A;  2QM3 A;  4XM3 A;  1D1A A;  5ILU A;  2JA8 J;  3F8B A;  2LBF B;  2ACJ A;  5LGT A;  1MDM B;  3RIR A;  2KIF A;  1SVO A;  2CRG A;  3MWM A;  1RI7 A;  3T5X A;  3ZQ7 A;  2TDX A;  3WHB A;  1XG1 A;  3GTM J;  2VXD A;  2K7L A;  4B1R A;  3JAM Z;  1WQ2 A;  3QOE A;  3ASN H;  3DPU A;  2NOJ B;  2VJ4 A;  1XSX A;  2DOE A;  4OIP F;  1X1A A;  1X2M A;  2CSO A;  2H94 A;  2QZ8 A;  3GW2 A;  2COB A;  5FFZ A;  1ZR4 A;  1FSH A;  3BR6 A;  1OYW A;  3VSL A;  1SFX A;  1MKM A;  2D5V A;  5M5W J;  2NS8 A;  3M07 A;  2HOA A;  3HOZ J;  1QZY A;  1QVU A;  2ZJR F;  3GF2 A;  1X1B A;  3LMM A;  1YFH A;  2R3S A;  1OCO H;  1MH3 A;  3RPU D;  4CUG A;  3TO9 A;  3BG3 A;  1ZLJ A;  2PJR B;  5IP7 J;  1XB4 A;  1WKM A;  4Y7N J;  1SAX A;  3LQR A;  3IUO A;  1BI2 A;  1SFK A;  3C2G A;  4PFO A;  4KFC A;  1VF9 A;  5DM7 F;  4ENM A;  1HST A;  3S1N J;  5BPD A;  2FOW A;  2V9K A;  1IGN A;  5FD5 A;  2MGQ A;  3ZMU A;  5IOZ A;  2G9W A;  5L3E A;  1VQN I;  3I53 A;  1IDZ A;  3LQQ A;  3NWS A;  4CCM A;  2QBY B;  1FOK A;  2QBY A;  2ZSH B;  4HOB A;  2L9S A;  5ICC A;  4A0X A;  2QYO A;  1YS6 A;  1MBH A;  2DTR A;  2IGO A;  3JRD A;  5A2Q Z;  1HF0 A;  2JA5 J;  1VTN C;  1OCC H;  5IPA A;  3REO A;  1QRY A;  3H35 A;  4UHT A;  1BW6 A;  3FWE A;  3RSN A;  1BC8 C;  3KP3 A;  2CS3 A;  3QOP A;  2CV1 A;  1JJ6 C;  3GEZ A;  4XKC A;  4PJ0 C;  3EUH A;  3AL0 B;  3V7R A;  2IEK A;  3BR0 A;  4F93 B;  3P9I A;  2VJ5 A;  1YRN B;  2BW3 B;  3C1D A;  1NTC A;  1TL8 A;  2ME6 A;  1DP3 A;  1AU7 A;  2EIM H;  2DT5 A;  5B1B H;  2XAH A;  5J3L A;  4A0Y A;  3DEW A;  2HOT A;  1YW9 A;  3S3N A;  3VSK A;  1IAW A;  3ULQ B;  1CQT A;  5CVJ A;  3HOY J;  4C2T A;  2A68 F;  5DCF A;  4ZDP A;  3MD2 A;  3ZXS A;  1B72 B;  4IQ4 A;  4KIC A;  4HLY A;  4HV5 A;  2GAU A;  1O7F A;  2KDZ A;  2QEX I;  4G7Z F;  4I09 A;  3ZCO A;  4M3F A;  4J19 A;  2HNH A;  2M2E A;  1BC7 C;  2KDO A;  4MFD A;  4AIH A;  2Y31 A;  3DU6 A;  1SAU A;  3FKI J;  2R7V A;  2OU2 A;  3G2B A;  3TW7 A;  1VQ6 I;  1XCV A;  1Z7U A;  1TP4 A;  3JRB A;  1FYM A;  1JJ8 C;  4ZYH A;  3WE3 A;  3E5U A;  3H3Z A;  1AKH B;  3OV8 A;  3Q0W A;  2EV6 A;  4CIC A;  1XDU A;  4KIB A;  4RGR A;  3BR3 A;  5TIS C;  1OCZ H;  3I58 A;  2P4W A;  1A35 A;  4C2M J;  3J81 K;  2ICW G;  5E3M A;  2DA5 A;  1JKR C;  1SMY F;  5E17 F;  1FNN A;  1MD0 A;  3QQA A;  2BY3 A;  3IL2 A;  1TWF J;  2L9V A;  3WGH A;  3IWF A;  2H8W A;  3K2A A;  4B8X A;  4HSR A;  2LKP A;  1W36 C;  1JT0 A;  4IHW A;  1OR7 A;  1QPI A;  1TNT A;  1S7A A;  3S15 J;  1EKE A;  2GXG A;  4Y52 J;  4QWQ A;  3J7Y J;  5D8K B;  2XAU A;  2UZK A;  2Y30 A;  4O3M A;  1ZYR F;  5FGM A;  1FMW A;  1J5Y A;  2XGX A;  4DBR A;  3I3L A;  4CO8 A;  2XB5 A;  5EGO B;  1UG2 A;  3E6D A;  1OMI A;  3SQN A;  2YX7 A;  4IZZ A;  4CCO A;  4MHG A;  2DK5 A;  2HKX A;  4B43 A;  1XDS A;  5IT9 Z;  5HNF A;  3JRH A;  3EUH C;  2FBI A;  4RM3 A;  1EV7 A;  2KIS A;  4XLH A;  5EZG A;  1HW5 A;  2XGE A;  4AIJ A;  2COM A;  2Z3Y A;  2DU9 A;  3GUD A;  2O3F A;  1HW2 A;  3T8R A;  3O6B B;  3UNG C;  4WWC A;  4XL9 A;  5IT3 A;  2ELH A;  2F5C A;  3K0L A;  3H5R A;  3SEZ A;  4FX0 A;  3F3X A;  3O8G A;  2HPI A;  1X1P A;  1A36 A;  3BR2 A;  4D0P A;  2EFO A;  4PGG A;  2JRM A;  3JTG A;  1I6H J;  2IBD A;  3ONQ A;  2B63 J;  2K86 A;  3QU6 A;  1FTZ A;  3V7S A;  5IYB J;  2DDB A;  4IOC F;  2NVX J;  4BXF A;  1UZC A;  4RB3 C;  2KQR A;  2B0L A;  4RAF A;  1FY7 A;  1YTY A;  1VQL I;  3ZMZ A;  5ILS A;  5HVQ C;  3IH3 A;  3HOS A;  2LK2 A;  2YS9 A;  4Q4Z F;  3K9T A;  1FIP A;  1XSD A;  4HNT A;  3CUQ A;  3WTW C;  1FMV A;  1IRF A;  3IRQ A;  1K79 A;  1O57 A;  3K10 A;  3G73 A;  4PGH A;  3A0B C;  3PIO F;  3QYB A;  1ETW A;  4B44 A;  2XF5 A;  2P5L C;  1J09 A;  2BY0 A;  4A3B J;  3LA7 A;  5HDG A;  4F52 A;  2IVM A;  2Y0S N;  3GLX A;  5KCM A;  3EET A;  1OLT A;  5JHF A;  1B1B A;  1OFC X;  5ED4 A;  2M45 A;  3K6G A;  2E71 A;  4B4C A;  4NC7 A;  4CZC A;  1TNS A;  1Z05 A;  5JVG F;  5K5O A;  1SFU A;  1FLI A;  3CCE I;  1BA5 A;  2FX0 A;  4XN3 A;  1VQ5 I;  4XOR A;  4GXO A;  5ICG A;  3OYD A;  1Z3Y A;  2E1O A;  1O3Q A;  5ILV A;  5JVT A;  4ZDL A;  5HDN A;  1OR7 C;  3E7L A;  3HRS A;  2HFH A;  2ZME A;  2IRF G;  2WV1 A;  4QPO A;  3GYH X;  3J80 K;  3ML6 A;  1MW7 A;  1Y39 A;  5BOX A;  2P6T A;  1FBU A;  1UG0 A;  2CFX A;  1W5C C;  1IUY A;  2EA4 A;  4NUB A;  2QWW A;  2E36 A;  5FKL A;  1ZGW A;  3KZY A;  4C30 A;  3Q9V A;  2HQ5 A;  4EAT A;  3H9J A;  5TRD A;  1B4A A;  4A3E J;  1RES A;  1Y8Q B;  3ROU A;  1BBY A;  2K02 A;  2KLO A;  5M5X J;  3S17 J;  1NK3 P;  5B66 C;  1IRX A;  1S7O A;  1FC3 A;  4EJT A;  1WJD A;  3H9Q A;  2JUG A;  2A61 A;  3MN2 A;  2QQ9 A;  1OPC A;  3CCQ I;  2K4B A;  5HLG A;  4HPQ A;  1ZHF A;  2ISZ A;  2AS5 F;  3FXQ A;  1K7A A;  2FU4 A;  2DMU A;  4RDU A;  1B8I A;  2WAQ N;  3PIP F;  4Y13 A;  4XON A;  3ISP A;  3CJN A;  5H6R A;  4ZYE A;  1V5F A;  3I55 I;  3BJO A;  4LG0 B;  4QIW N;  3WHC A;  2VC1 A;  3AAF A;  2R7F A;  1BM9 A;  2FXA A;  4G6D A;  3ESW B;  4M6X A;  5LGN A;  3DPL C;  3DU5 A;  2I5U A;  1PUF B;  3S1M J;  1YS7 A;  2EV0 A;  2JN6 A;  3K70 C;  2O9L A;  3CUQ C;  5EEG A;  4EJU A;  2R7Z J;  3VYU B;  5EG0 B;  1X3Z B;  2F5E A;  2J5O A;  4JOM A;  1F43 A;  4HX8 A;  2VL8 A;  3HHH A;  3U2R A;  3LSH A;  1A04 A;  2KT0 A;  1IRZ A;  3DF8 A;  2RDP A;  5L3B A;  1JTX A;  4L9V A;  1HDD C;  2L7K A;  1RKW A;  3FHZ A;  1T0F A;  4RM2 A;  1E3O C;  4LG3 A;  2QSF X;  1F9N A;  4K2E A;  1W5S A;  3ERE D;  3HUG B;  3OS0 A;  4V2F A;  4XKW A;  1OCR H;  2K27 A;  5FLV A;  2DA6 A;  3TMO A;  1W36 D;  2LY2 A;  1B9N A;  5LEK A;  1B6A A;  2DK8 A;  3OYK A;  1VQ7 I;  2X51 A;  2ZME C;  4G12 A;  3BQY A;  3AFH A;  2LY9 A;  3S2H J;  2L2O A;  2JVG A;  4LFU A;  3QYE A;  3LSI A;  4UXN A;  3KYC B;  1K78 A;  3H9G A;  2M5W A; 
#chains in the Genus database with same CATH homology
 2EK5 A;  2D1V A;  2UWM A;  5KVR A;  5LEJ A;  5J6X A;  2HDC A;  2A6H F;  3H92 A;  1TQI A;  2HYG D;  2W57 A;  1YQA A;  3EYY A;  1W7P B;  3D0S A;  2HEO A;  1ODD A;  1G3S A;  2F2E A;  1W4M A;  1OYY A;  1P4A A;  2M30 A;  5K5Q A;  3NQO A;  3F23 A;  3BJA A;  3BWG A;  3WTT C;  2XAJ A;  3VEP A;  1P92 A;  2A69 F;  2CG4 A;  4GYG A;  2M1B A;  1OYI A;  2Z99 A;  2W84 A;  2L4A A;  2O0Y A;  4ESF A;  1LDK B;  1I6X A;  5LHH A;  3K2Z A;  3RYP A;  4XSX F;  3E5Q A;  3E6M A;  3GXO A;  2VE9 A;  1XMK A;  2XAG A;  5L3C A;  1BN5 A;  1MDM A;  4L18 B;  1MJ9 A;  3ABT A;  2RQP A;  1FPQ A;  1XD7 A;  2XHK A;  2M87 A;  1U5T A;  1IN7 A;  3GO5 A;  1WI9 A;  2FBH A;  4FHT A;  3BJ6 A;  5DUK A;  4KT5 C;  2G7U A;  3IC7 A;  1I1G A;  1I5Z A;  2DQR A;  4BH9 A;  4BHP A;  1KYW A;  4DNC A;  3BOQ A;  1XGO A;  4JQF A;  4JK1 X;  2LDU A;  2IA2 A;  3HRM A;  3JAM K;  3GZ6 A;  3COA C;  4BQA A;  5D4S A;  2L4M A;  5BPI A;  1QZZ A;  1HXD A;  2ADU A;  2LSO A;  3E6B A;  4UVB A;  3CDH A;  1BOA A;  1W5T A;  6PAX A;  2MLG A;  1XMA A;  1BI1 A;  4HDU A;  3F6V A;  2D2W A;  1JHH A;  4U0Y A;  1O3T A;  5HOO A;  2JRT A;  3T8T A;  1Q1H A;  3KE2 A;  2HS5 A;  1H9T A;  3VOE A;  3BZ6 A;  4M9Z A;  5DV5 A;  4HF1 A;  3WTZ A;  4MGR A;  1PP7 U;  1LDD A;  2NRA C;  2GA1 A;  4EV0 A;  5A2Q K;  1WRJ A;  3FX3 A;  1YLF A;  2DI3 A;  1ZAO A;  4YG2 F;  2CW0 F;  2XUB A;  3TOA A;  1PDN C;  4B09 A;  2VBW A;  1DDN A;  1T38 A;  4OMZ A;  4A5N A;  3FM5 A;  2PBI A;  1U5T C;  4RGU A;  2VXZ A;  3RI4 A;  3DV8 A;  3GFL A;  1ZRF A;  2STT A;  3D5L A;  1FBQ A;  5CLS A;  2PN6 A;  5HLH A;  3I59 B;  2GZW A;  1T98 A;  1SD4 A;  3FM3 A;  4Q5S F;  1LQ1 A;  1AOY A;  4M6Y A;  1S6L A;  1V3F A;  3R4K A;  2PMH A;  5AON A;  3FF5 A;  3L00 A;  3WE2 A;  1LVA A;  2MLK A;  5FD6 A;  3I54 A;  1L0O C;  1PP8 F;  3JTH A;  2DFI A;  2ZNZ A;  4A5M A;  1UHM A;  3ZN0 A;  3CO6 C;  3GVA A;  5E1X A;  1JE8 A;  2W25 A;  4EJO A;  4KIF A;  2XKP A;  5H20 A;  3WTX C;  3FMR A;  4RB2 C;  3LAJ A;  4YFX F;  4N0B A;  5D5X B;  1K6O A;  1Y0U A;  1J7K A;  3T0Y A;  3SHF A;  5LBQ A;  4F7Z A;  3ZMV A;  3F21 A;  3C18 A;  5IT9 K;  5D5W B;  3TQN A;  5JR3 A;  1UCR A;  4R8H A;  4E70 A;  4GO1 A;  2HR3 A;  4U0W A;  1SD6 A;  2CQK A;  2XRO A;  4HQE A;  2JZY A;  4I02 A;  2DPD A;  4RB0 A;  4EMS A;  2YX4 A;  2EA2 A;  3LA2 A;  3E6C C;  4ENJ A;  2PJP A;  2P5K A;  1U6G A;  5AIP A;  3QU3 A;  4L0Y B;  5BMZ A;  4PCQ A;  3SZT A;  3ECO A;  4KIG A;  5CJ9 A;  1KQ0 A;  4Y17 A;  4RGS A;  2YSR A;  3L7W A;  4HYE A;  5K5R A;  4N9H A;  2FMY A;  2QEN A;  2LF8 A;  2PG4 A;  2P6S A;  1TLH B;  4LK1 F;  1LEA A;  2OQG A;  1KGS A;  1T6S A;  3MCZ A;  3EDP A;  2KKO A;  3DP7 A;  2ZJ2 A;  4ZYD A;  2QLZ A;  2C6Y A;  1UHW A;  5F64 A;  4LLG F;  1R22 A;  4LLL A;  2DQL A;  2O6G E;  2A3S A;  5CYV A;  4MEY F;  4PDK A;  3MEX A;  1BJA A;  2W24 A;  2ZKZ A;  2HYF A;  3GWZ A;  3V4G A;  2PMU A;  1IW7 F;  2RC4 A;  3C7J A;  3DKW A;  4AD9 A;  3VB2 A;  5CVU A;  3TDU C;  4YIF A;  1IN6 A;  4M9X A;  2EFQ A;  1P2F A;  3GFM A;  2BEO A;  2JTV A;  3ABU A;  4I98 B;  3KP4 A;  3SFZ A;  1E17 A;  2VON A;  4S05 A;  3R61 A;  4IHS A;  2XAS A;  4ASN A;  1GVJ A;  2YU3 A;  5DEQ A;  4G6Q A;  4R79 A;  3K1N A;  2GA2 A;  2RV8 A;  2OQR A;  4HF2 A;  2PQ8 A;  2OZ6 A;  3I71 A;  1R36 A;  4EM0 B;  2HOE A;  1R23 A;  3TKY A;  3MFK A;  1YO5 C;  3HSR A;  4HX4 A;  4IVN A;  2RKH A;  4O5V A;  4KUM A;  1ZG1 A;  1ON2 A;  2A5Y B;  3HUG A;  3L2C A;  1IN5 A;  5DCM A;  4OU0 A;  2FNP A;  4XRF A;  2HKO A;  4CZZ A;  2EFW A;  2RNJ A;  5BS6 A;  4U88 A;  4ESB A;  1EH7 A;  4IF4 A;  1IXR C;  1OKR A;  5L3F A;  2GIV A;  5E18 F;  4Z2Y A;  3F8N A;  1FBS A;  2YR2 A;  1W7P A;  1H0M A;  4UUV A;  4L5J A;  2KRF A;  1ZRE A;  4XLN F;  1LJ9 A;  4A0Z A;  2P8T A;  1FT9 A;  1G6N A;  4RAY A;  3TO6 A;  4Y15 A;  3TDZ C;  2ZXJ A;  1REP C;  3DQV C;  3KP2 A;  5D8L B;  4MQ9 F;  3N97 A;  3F72 A;  2DO7 A;  4M9S A;  4YII A;  4IXA A;  4KDP A;  5FO5 A;  3U1D A;  4EM2 A;  3BDD A;  3NRV A;  2RVC A;  2BYV E;  3JSO A;  1R1T A;  2FSW A;  4RGX A;  2RN7 A;  1XGN A;  3FMS A;  1EH8 A;  2ZO4 A;  2UXX A;  4BHC A;  3J81 Z;  1J0R A;  1ON1 A;  3FXR A;  4O6J A;  2VT2 A;  2NAZ A;  4I2O A;  2F5F A;  4KYW A;  2FBK A;  1CF7 A;  5LRR A;  4G9Y A;  3KEO A;  2V9V A;  4ZZD A;  5E1Z B;  4U7B A;  4OIO F;  5FFX A;  1FWZ A;  1T39 A;  2GQQ A;  1FSE A;  1J59 A;  2V79 A;  5KK1 A;  3GFI A;  4RAZ A;  4ETS A;  4P5O A;  4MQV A;  3WU0 A;  1UST A;  2P7C B;  3R0A A;  5ERI A;  3WGG A;  1BIA A;  2VOD A;  1MJB A;  3QP5 A;  3QPT A;  1HKQ A;  4HAM A;  4HZF A;  3TO7 A;  2AXL A;  2O8X A;  2Q0O A;  5E8G A;  1KU3 A;  2CYY A;  3RPU A;  1E2X A;  3IRR A;  4EGZ A;  1TW3 A;  3I64 A;  1I27 A;  2QUF A;  3DPT A;  2FF4 A;  1LNW A;  4RB1 A;  3M8E A;  4WX9 A;  5K1Y A;  4LB6 B;  2LNB A;  3WG9 A;  1HKS A;  3MZY A;  4KMF A;  2KJB A;  2XAQ A;  5HDK A;  2MBF A;  2Y75 A;  1J9I A;  1IRG A;  2E1N A;  1SD5 A;  4IPA A;  3ZMS A;  1O7L A;  2DPU A;  2ESN A;  1G3Y A;  3IHU A;  1FZP B;  2ZNY A;  1Z1D A;  3LA3 A;  2XRN A;  3R6S A;  3I59 A;  2FOK A;  1WWX A;  3VFZ A;  3PFI A;  3J80 Z;  3HRU A;  5FLX Z;  2IJL A;  3V7C A;  2YPR A;  4ZZL A;  2Q2E A;  2FA5 A;  3Q9S A;  4M74 A;  2FEZ A;  5LLQ A;  4M73 A;  2H09 A;  1YG2 A;  2K4J A;  1QO0 D;  3M9A A;  2PFB A;  3CLO A;  2KJC A;  3LST A;  3RJP A;  4OIQ F;  3DEU A;  5D4R A;  4R1H A;  4G7O F;  1ULY A;  1HW1 A;  4HDV A;  4IRI A;  3OOP A;  3CTA A;  5D5U B;  1RIO H;  5CVI A;  2OD5 A;  3F22 A;  3GFJ A;  1DP7 P;  4KN7 X;  2OZU A;  3V8J A;  1HQC A;  4L0Z B;  4A6E A;  3L09 A;  1GXQ A;  5BQT A;  2JPC A;  2IA1 A;  1C0W A;  5HS7 A;  4UVA A;  3ZN1 A;  4I0A A;  3L9F A;  5E8I A;  2A07 F;  4BXU A;  1XGM A;  4M72 A;  3V8L A;  3R60 A;  2WWY A;  1F5T A;  2JT1 A;  3KP5 A;  3B73 A;  3BP8 A;  4EGY A;  4RS8 A;  3BRO A;  1IN4 A;  3LFK A;  2DAO A;  5CVV A;  1XSV A;  1P4X A;  2VBZ A;  4EQQ A;  3BY6 A;  2P5V A;  1KU2 A;  1P6R A;  2VBX A;  4ENN A;  1XN7 A;  5EEH A;  2X4H A;  3LAP A;  3WTU C;  5JHU A;  2XV4 S;  3T1B A;  4OIN F;  3GZ5 A;  1MZB A;  3JW4 A;  4HX7 A;  2R7D A;  1HSJ A;  2JPB A;  3I5U A;  3MZH A;  3GX4 X;  4UVC A;  1DUX C;  3H3U A;  4M71 A;  2ETH A;  1D5V A;  2A6E F;  1J2X A;  4HLX A;  4AWX B;  3BPX A;  3MAJ A;  1SD7 A;  3O2P E;  4BAY A;  1QGP A;  2HTJ A;  2VT3 A;  2VBY A;  5JI6 A;  2L02 A;  2BGC A;  2IPQ X;  4HF0 A;  2WTE A;  2STW A;  4G8X A;  2L54 A;  4GCV A;  1IF1 A;  1TW2 A;  1U3E M;  2FQ3 A;  4MNU A;  4L9T A;  1FX7 A;  4HQM A;  1U5T B;  3ELK A;  2GXB A;  3S2W A;  4LB5 A;  3K1P A;  2NYX A;  1FYK A;  2LF7 A;  1DPU A;  3I0T A;  3N4M A;  3K1M A;  4CYD A;  3LWF A;  3E5X A;  3ZPL A;  1R5H A;  4IJA A;  4Q47 A;  1UFM A;  4UV9 A;  2GWR A;  3KP7 A;  4XSZ F;  1LB2 A;  4CXF A;  4MTD A;  1ZH5 A;  4ENK A;  3FMQ A;  4MTE A;  2XVC A;  4BYY A;  2BBY A;  2JSC A;  2HWV A;  1B59 A;  4I01 A;  3Q5F A;  1QBJ A;  2L01 A;  3KET A;  1GXP A;  3IKT A;  2HTS A;  1YYV A;  4YFK F;  4WXH A;  3U9G A;  4KN4 X;  1Z91 A;  2PI0 A;  5LHI A;  1TQM A;  2ISY A;  4G7H F;  3TOB A;  2HZT A;  5DDG A;  3RPQ A;  5L3G A;  4NHJ A;  4JBA A;  2Y48 A;  2EJR A;  2QQB A;  3P9C A;  3F6O A;  1JGS A;  2IW5 A;  2NNN A;  1SMT A;  4XLP F;  3KZZ A;  3HTU A;  1ZRD A;  1ZGA A;  1RZ4 A;  4LG0 A;  1B9M A;  2MC3 A;  5J8C A;  2VN2 A;  2KIU A;  3DFG A;  5LGU A;  2QVO A;  4LMY A;  2VE8 A;  1YIO A;  3M1E A;  4P9F A;  1DPR A;  2VC0 A;  1JXS A;  4ZH4 F;  2H6C A;  5HS9 A;  1QPM A;  1MJA A;  3I4P A;  5DD4 A;  5D5V B;  2E7W A;  5H6Q A;  2PLY A;  1D3Y A;  2BV6 A;  1IZ1 A;  1RUN A;  5F6F A;  2V1X A;  4EJW A;  2DBB A;  3RYR A;  1UB9 A;  5F1R A;  4LD5 A;  2DLL A;  3QP6 A;  1YW8 A;  5ICF A;  2QQA A;  4IRH A;  3HOT A;  4HBL A;  5E20 A;  4GGG A;  3KLO A;  1ONV A;  1ZG5 A;  1IXS B;  4WXD A;  4L9J A;  2XAF A;  1KA8 A;  1G3T A;  3ECH A;  1R00 A;  3FXU A;  1WSU A;  3QPH A;  2G7H A;  2XKO A;  1STZ A;  1T2K A;  1J75 A;  3HYI A;  1BIB A;  3K69 A;  3PQK A;  5HS8 A;  2QBY B;  4BHB A;  2E7X A;  1R1U A;  3G3Z A;  5D6F A;  2D1H A;  3WOD F;  1ZAR A;  1KU9 A;  2ZBK A;  4LJZ F;  5DUI A;  5DYM A;  4NQW A;  4YFN F;  2EFN A;  1QNT A;  1YW7 A;  3NEU A;  1LDJ A;  3DXJ F;  4LGW A;  2WV0 A;  3RKW A;  3WTS C;  1P4W A;  1R7J A;  1TTY A;  4L5I A;  3MQ0 A;  3HHG A;  5FLX K;  2J5P A;  2V1D A;  2EB7 A;  3J7A O;  3IKV A;  1D8K A;  3HTS B;  2MD5 A;  1QQI A;  3F8F A;  5L3D A;  2NS0 A;  3CO7 C;  2CGP A;  4I7H A;  3C3W A;  2WC2 A;  1AWC A;  4ZYG A;  3M7G A;  4MEX F;  3TGN A;  1GHC A;  4KMU X;  1F1Z A;  1JHF A;  2V1U A;  2FNA A;  4EJV A;  4P96 A;  3WTV C;  3KLN A;  3WGI A;  1KQ8 A;  1IN8 A;  2EV5 A;  1ZGJ A;  2OBP A;  1R1V A;  5CVR A;  4OMY A;  4L9N A;  1TBX A;  5J8F A;  4S04 A;  5ICE A;  1HKT A;  5DCM B;  4DQ2 A;  3EYI A;  4CDG A;  2H6B A;  1S29 A;  4AVP A;  2Y0M A;  3PQJ A;  4I0B A;  3BPV A;  4KA4 A;  2VOP A;  2PEX A;  3ZMD A;  2EWN A;  2FRH A;  1KYZ A;  2E1C A;  4EVI A;  1EH6 A;  2ZFW A;  4N9I A;  3E3V A;  4IHT A;  3HRT A;  4NB5 A;  4U7D A;  4CHU A;  3KP6 A;  4G94 A;  1SFE A;  3SZP A;  4FT8 A;  2P7V B;  2L3D A;  2O03 A;  3CUQ B;  2IA0 A;  1FP1 D;  5JFR A;  2CWE A;  3IWZ A;  2D45 A;  1CGP A;  4HW0 A;  4BNC A;  2MA3 A;  4WK8 F;  3WU1 B;  4QLC U;  3B02 A;  3RDI A;  1V4R A;  4WF2 A;  1Z6T A;  3RTR A;  1O3R A;  4U0V A;  2ZME B;  1I1S A;  1HBX G;  1ZLK A;  3HSE A;  3QAH A;  2Z9O A;  2OAZ A;  1Z6R A;  3EQL F;  5HLI A;  4GYI A;  2Z5U A;  2ESH A;  4HA8 A;  1RNL A;  4WCG A;  1U8R A;  2VOO A;  5E1W A;  3R0J A;  1H9G A;  3O3K A;  4Q48 A;  1F4K A;  1R5G A;  3E97 A;  2HQN A;  4P55 A;  4WXC A;  1RUO A;  3KEQ A;  2HQR A;  2W85 A;  2BE5 F;  1USS A;  1L3L A;  4IRG A;  1PUE E;  2DW4 A;  1XCB A;  1X3U A;  2ZCW A;  3V8K A;  1G3W A;  2O61 A;  3JSP A;  1ZN2 A;  4LK0 F;  1CF7 B;  4AIK A;  3RKY A;  3P7N A;  2KIM A;  1ZG3 A;  1Z9C A;  1XGS A;  4KNY A;  3FZV A;  1D8J A;  2HGC A;  2F5D A;  1W7P D;  3SXY A;  2CO5 A;  1U78 A;  3WTY C;  4A12 A;  2MH9 A;  2UXN A;  3KFW X;  2V6C A;  3KCC A;  1KQ9 A;  4HV6 A;  4TV7 A;  4XBF A;  1BI0 A;  2IT0 A;  1FP2 A;  1LEB A;  2IP2 A;  4OOI A;  1NHA A;  1TQP A;  2EFP A;  2FE3 A;  1K78 B;  1O3S A;  3VOD A;  3P9K A;  1R58 A;  4ON0 A;  5FB2 A;  2XIG A;  1IXC A;  2FML A;  2Z33 A;  3ZMT A;  3W6K B;  1S3J A;  1BI3 A;  3W6J B;  2H27 A;  1KU7 A;  1ZRC A;  3ZP5 A;  4CGZ A;  2OA4 A;  4UNO A;  4FX4 A;  4H0E A;  2M8E A;  4UV8 A;  4ESJ A;  5TJJ A;  3RKX A;  1MGT A;  3F8M A;  2X0L A;  2NNY A;  1U2W A;  1FYL A;  3HSF A;  4EM1 A;  3CUO A;  5DD8 A;  4PZJ A;  4A2U A;  4P9U A;  2MH2 A;  4OIR F;  3M8F A;  3F8C A;  2Q8K A;  4LLN A;  3HIF A;  3QRF F;  2RGV A;  1S8N A;  5LHG A;  5AIQ A;  1G4D A;  4A6D A;  5LRS A;  5D6E A;  2QM3 A;  5ILU A;  3F8B A;  2ACJ A;  5LGT A;  1MDM B;  3RIR A;  2KIF A;  3MWM A;  1RI7 A;  3T5X A;  3ZQ7 A;  2TDX A;  2K7L A;  3JAM Z;  1WQ2 A;  1XSX A;  4OIP F;  2CSO A;  2H94 A;  2QZ8 A;  3GW2 A;  5FFZ A;  1FSH A;  1OYW A;  1SFX A;  1MKM A;  1QZY A;  3GF2 A;  1YFH A;  2R3S A;  3TO9 A;  1ZLJ A;  1XB4 A;  1WKM A;  1SAX A;  3LQR A;  1BI2 A;  4KFC A;  4ENM A;  1HST A;  5BPD A;  5FD5 A;  3ZMU A;  2G9W A;  5L3E A;  3I53 A;  3LQQ A;  1FOK A;  2QBY A;  4HOB A;  5ICC A;  4A0X A;  2QYO A;  1YS6 A;  2DTR A;  5A2Q Z;  1VTN C;  3REO A;  4UHT A;  3FWE A;  1BC8 C;  3KP3 A;  3QOP A;  3GEZ A;  3EUH A;  3V7R A;  3P9I A;  3C1D A;  2DT5 A;  2XAH A;  4A0Y A;  1YW9 A;  1IAW A;  3ULQ B;  5CVJ A;  2A68 F;  5DCF A;  4KIC A;  4HLY A;  4HV5 A;  2GAU A;  1O7F A;  4G7Z F;  4I09 A;  1BC7 C;  4AIH A;  2OU2 A;  1XCV A;  1Z7U A;  1FYM A;  4ZYH A;  3WE3 A;  3E5U A;  3H3Z A;  3OV8 A;  2EV6 A;  4CIC A;  1XDU A;  4KIB A;  4RGR A;  3I58 A;  2P4W A;  3J81 K;  1SMY F;  5E17 F;  1FNN A;  1MD0 A;  3IL2 A;  3WGH A;  3IWF A;  4B8X A;  2LKP A;  1OR7 A;  1TNT A;  1S7A A;  2GXG A;  4QWQ A;  5D8K B;  2UZK A;  4O3M A;  1ZYR F;  5FGM A;  1J5Y A;  2XGX A;  4CO8 A;  3E6D A;  1OMI A;  3SQN A;  2YX7 A;  4MHG A;  2DK5 A;  2HKX A;  1XDS A;  5IT9 Z;  2FBI A;  1EV7 A;  1HW5 A;  4AIJ A;  2COM A;  2Z3Y A;  2DU9 A;  3GUD A;  2O3F A;  1HW2 A;  3T8R A;  3O6B B;  4WWC A;  5IT3 A;  2ELH A;  2F5C A;  3K0L A;  4FX0 A;  3F3X A;  4D0P A;  2EFO A;  4PGG A;  3JTG A;  2K86 A;  3QU6 A;  3V7S A;  4RB3 C;  2B0L A;  1FY7 A;  1YTY A;  3ZMZ A;  5ILS A;  5HVQ C;  3HOS A;  4Q4Z F;  3K9T A;  1XSD A;  3CUQ A;  3WTW C;  1IRF A;  3IRQ A;  1K79 A;  1O57 A;  3G73 A;  4PGH A;  2P5L C;  3LA7 A;  5HDG A;  2IVM A;  3GLX A;  3EET A;  1B1B A;  5ED4 A;  2M45 A;  1TNS A;  1Z05 A;  5K5O A;  1SFU A;  1FLI A;  4GXO A;  5ICG A;  1O3Q A;  5ILV A;  5JVT A;  5HDN A;  3HRS A;  2HFH A;  2ZME A;  2IRF G;  3GYH X;  3J80 K;  3ML6 A;  5BOX A;  2P6T A;  1FBU A;  2CFX A;  1IUY A;  2EA4 A;  2QWW A;  3KZY A;  3Q9V A;  5TRD A;  1B4A A;  3ROU A;  1BBY A;  2K02 A;  1S7O A;  1FC3 A;  4EJT A;  2A61 A;  2QQ9 A;  1OPC A;  2K4B A;  5HLG A;  1ZHF A;  2ISZ A;  2AS5 F;  3FXQ A;  1K7A A;  2FU4 A;  4Y13 A;  3ISP A;  3CJN A;  5H6R A;  4ZYE A;  3BJO A;  4LG0 B;  2VC1 A;  3AAF A;  2R7F A;  1BM9 A;  2FXA A;  4G6D A;  4M6X A;  5LGN A;  3DPL C;  1YS7 A;  2EV0 A;  3CUQ C;  5EEG A;  4EJU A;  2F5E A;  2J5O A;  4HX8 A;  3HHH A;  3U2R A;  1A04 A;  3DF8 A;  2RDP A;  5L3B A;  4L9V A;  3FHZ A;  1T0F A;  1F9N A;  4K2E A;  1W5S A;  3ERE D;  2K27 A;  1B9N A;  5LEK A;  1B6A A;  2DK8 A;  4LFU A;  4UXN A;  1K78 A;  2M5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...