5F64A

Putative positive transcription regulator (sensor evgs) from shigella flexneri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
204
Chain Sequence
b'AMNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Positive transcription regulator EvgA
publication title Putative positive transcription regulator (sensor EvgS) from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Transcription regulator
total genus 81
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f64A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f64A01
5DYMA 1JYFA 2IP2A 3IHUA 5IT3A 2JRTA 1EV7A 4L0YB 4WXCA 4AVPA 5B3JA 2NAZA 4ETSA 1C0EA 4WX9A 3BPXA 3JSOA 3QLVA 4KK4A 4EJTA 1ZG5A 2KIMA 2B1JA 1R23A 4O3MA 2RJNA 1V4RA 3QLTA 3R60A 2FXAA 2OZ6A 2QZJA 4RXUA 4A6EA 1M5UA 2MBFA 2E4WA 3R0AA 5TQJA 3RYRA 2EFQA 4RXMA 1W5SA 2RDMA 4KT5C 1WWXA 2IPMA 3SZPA 1FNNA 1BVHA 1BBYA 3RYPA 2LF7A 3E6CC 1QP7A 3PFIA 2OQGA 5CNIA 3HRMA 1P92A 3WG9A 2IPNA 3KE2A 2QU7A 1R5HA 4QPJC 4W5OA 5KI6A 4RB3C 3JVDA 4ETMA 1LDDA 3LUKA 4Z4GA 2WV0A 1ZGJA 4HLXA 2VYCA 5FLXK 4WUTA 5TQ0A 2RV8A 5E1XA 2JVKA 3WTWC 3N0RA 3GX4X 2DQRA 1XD7A 4XSZF 3FZVA 5JS2A 3FMSA 3G3ZA 5KQLA 3Q9SA 5L3CA 2Z3YA 2JTVA 3RI4A 1DPUA 2LPMA 4A2UA 5LBQA 2LIVA 2X0LA 2WRZA 1MJBA 5LLQA 1TLHB 3QEMA 2FEWB 2Q8KA 1PUXA 4OLBA 3F7NA 3B2NA 4HNRA 3CS3A 3FXQA 4LZLA 2GZWA 3H75A 3IKVA 5BPIA 4PYRA 3RVOA 1GHCA 5T3YA 1PNRA 1ZGAA 3TOBA 2HR3A 1ZLKA 4HDUA 5D6FA 2MSLA 2L19A 3HZHA 1JFSA 2DK8A 2O03A 3SZTA 1Z12A 4KRFA 2FLKA 1OYIA 2WJAA 4M72A 3CFYA 2QLZA 5KQPA 3O2SB 5ABPA 1I1SA 1XMKA 3HRSA 2ZAYA 3LWFA 4CICA 3FFWA 2FNAA 4L9JA 1R36A 3HRTA 1VPWA 4MR9B 2QQAA 3QLUC 3EULA 4YLEA 2NZVG 2FMYA 4IF4A 2PMHA 3ZMZA 2COMA 3FMQA 2E4ZA 1BC7C 1ZH4A 5JNTA 1ZRFA 1KU7A 4WZZA 4E7PA 1TM2A 5DCMB 3KHTA 1ZG3A 2EV6A 3RPUA 3F8BA 5TQ2B 2EB7A 5FWYB 2Y0MA 3H6HA 1UCRA 1BA2A 5EEHA 1QMPA 4RB1A 1NXXA 5JVTA 4GYIA 2XRNA 4EM1A 4QWQA 3LOPA 1QNTA 5EEGA 2PUBA 2BV6A 3EDCA 2NNNA 5BQTA 1S7AA 4N03A 5H6QA 3DZDA 1U04A 3OQNA 2FMKA 1YMVA 2V1UA 1ZN2A 5DUIA 4FE7A 3RVMA 1ULYA 4EGSA 3ECHA 3HK2A 2DW4A 5K5RA 3BBLA 5LRSA 1DC8A 2DBBA 3O2QB 2VONA 1AWCA 5D4SA 3HRUA 5HS7A 5HSGA 5JNUA 3C7JA 3SG0A 1F4KA 3QEKA 2O3FA 3RVLA 1QKKA 4MYRA 4WXMA 2ZXJA 5TPWB 2PUEA 5BS6A 2DQLA 2LF8A 3OMXA 3R6SA 1TVMA 2BYVE 3L00A 5H6RA 1JLKA 4A0ZA 1OMIA 1ZARA 4HF0A 5AIQA 3K1PA 1I5ZA 3KP4A 2QXYA 4Z4IA 3C1DA 3WTZA 4LG0B 1D8KA 2QBYB 4MS3B 1KA8A 2F8TA 2M30A 1FBSA 2FN9A 3O1HB 5JNVA 1IIBA 2DRIA 4YWHA 1F4VA 2XDYA 1XGMA 3GFJA 3KP2A 3RVNA 2NT3A 3MFKA 4Y17A 1XCVA 2PLNA 4EVQA 3QX8A 5F1RA 5HKOA 1RUNA 1JF8A 3RPQA 1Z6RA 2GKGA 3LKBA 2ESNA 1B4AA 3VODA 2Z9OA 2R3SA 3QU6A 4YFNF 4UHKA 1ZYRF 3DV8A 3I71A 2E4VA 4P1ZA 3FMVA 4EYKA 4ENJA 2H27A 5DCLA 3CHYA 4Z4EA 5ILUA 3D5LA 1GCAA 5LGNA 2QW1A 2PFBA 3N8IA 3KEOA 1Z18A 2MYPA 2WMYA 4RK0A 3QK7A 4KDPA 3C3MA 1RZ4A 3O2PE 1SXHA 3LUAA 5ED4A 4RY9A 4PEVA 2F5DA 2W85A 2FQ3A 3KYIB 3J80Z 1U5TB 3FFTA 3I4PA 3GL9A 3KS9A 3L7WA 1JHFA 3ZPLA 4MTDA 4F12A 5BR1A 2LSOA 3REOA 3OO1A 1T39A 4HBLA 4EJWA 3CU5A 4XARA 2A07F 3Q5FA 2PJUA 2NT4A 2LNBA 2STTA 3RJPA 1FSEA 1BI2A 1HKQA 2O20A 5LHHA 4W5TA 4RZSA 4EYQA 1ZAYA 2P7CB 1E6KA 4MS1A 3OM0A 2OA4A 3BILA 2XAJA 4NV3A 2YHAA 2P5LC 1P2FA 1J56A 4TLLB 1XDUA 3KZZA 1YTUA 4N9HA 3VFZA 1CF7A 4RGXA 2W24A 4RGUA 1FSPA 1W4MA 1B00A 4RKRA 2FEPA 4LX8A 3RH0A 3L6UA 3FXRA 3NRVA 3LUFA 3N6VA 1LBHA 2RQPA 1RNLA 3HSEA 3ZN1A 2PEXA 5EWLA 2JB9A 4UVCA 2RNJA 4M88A 4IRGA 1G3YA 3EDPA 2GBPA 2ZCWA 1SD5A 2W57A 2VODA 4MS4A 2CG4A 2OZUA 4RS8A 1R8JA 2FTKE 2NUBA 5TQ0B 5HLHA 2V79A 3DLHA 1S8NA 2P4UA 1HEYA 1QZZA 4EM2A 1U2WA 1J75A 3LUCA 1DG9A 1JHZA 2LDUA 1ZHHA 1HQCA 4KN4X 2VOOA 2ID9A 2Q2EA 4G7HF 3IPCA 5C5EA 3DPTA 5K5QA 3FF5A 3ROUA 3F3XA 2UWMA 1L5ZA 5DDGA 2HEOA 4B09A 4CXFA 1MGTA 4WT7A 4OU0A 4ENMA 3JY6A 3RKXA 3QEMB 5IC5A 4TN5A 4ZZLA 1DP4A 1OXKB 2F5EA 2XAFA 1AB5A 3SHFA 3GFLA 3Q15C 4RSMA 1NXPA 1ON2A 4HDVA 2STWA 3TO5A 3UUGA 1J7KA 2YX4A 5JS1A 1JDNA 2XAHA 4OIQF 4IILA 2VT3A 3WGHA 1TNSA 4HQMA 3D8UA 1WRJA 2IOYA 1UDRA 3H5VA 1P8AA 3BY6A 2WC2A 4Q7EA 2W84A 3GWZA 4YIFA 5CNMA 1HW5A 3K2ZA 4OOIA 5FFXA 4P9UA 2VE8A 3EETA 4CYDA 4KIBA 4ZJPA 4KMRA 1JX6A 4MQEA 3W6JB 2ELHA 2FW0A 1E6LA 3CZ5A 4PE5B 4OMZA 4CDGA 1P6UA 3I42A 4XAQA 1QNLA 2F5CA 5E20A 5LRRA 1C0WA 1TQIA 3WODF 1D5WA 3IDOA 3FM5A 3K69A 3Q41A 2ZNZA 1B6AA 5FBHA 2ID7A 3MAJA 1T6SA 1PEYA 1K78A 1DZ3A 5IX8A 1MJ9A 3DLBA 3KKEA 2EFWA 2GA2A 3RVRA 3F8CA 3H6GA 3K1MA 1PUEE 3H3UA 3M8FA 1JE8A 5D8KB 5EWMA 1KRXA 3CUQC 3U9GA 1R58A 2IPAB 1BIBA 1BDHA 1TQMA 4MGRA 1C4WA 3O75A 1P4AA 3HHGA 1BC8C 1DDNA 4Z0NA 3ROTA 4N76A 2JSCA 2Q5CA 2KKOA 5D5XB 2M45A 1NXOA 4EJUA 1IN8A 3OOPA 4U88A 3E61A 3F22A 2A9RA 2HKXA 2PN6A 1KMIY 4YV7A 4BHBA 2QR3A 2VC0A 3QELA 3OQOA 4K2EA 3T8RA 3HIFA 2ZNYA 1BI0A 1YFHA 5HQJA 4OLAA 4ZH4F 2PJPA 1Y0UA 2E1NA 4MLDA 4LLGF 3WTYC 2MH2A 2JPCA 1JFVA 2GX6A 3TOAA 1SAXA 1H9TA 4F06A 4I0AA 1CEYA 1KQ0A 4P5OA 5AONA 3JTEA 4Z9AA 5KC8A 4ZYEA 4LB5A 4RKQA 5L3BA 2LBPA 3MQ4A 2OD5A 3WTUC 4MHGA 3JS5A 2PUFA 3N4MA 2KJCA 5I4CA 4UHJA 5LGTA 5BQ3A 2MLKA 2MSKA 3DPLC 4ZYHA 1IW7F 4EM0B 3M1EA 1LJUA 4KQCA 1RI7A 1T38A 1IF1A 2O6GE 3BP8A 5F6FA 3I0TA 1KQ8A 1TTYA 2JRLA 1RZRA 3QPHA 5H20A 3RIRA 4G86A 5HDNA 3KG2A 5TPZA 4IVNA 1YTYA 4RGRA 2PI0A 3CG0A 3ML6A 3RVPA 3HUUA 1FP2A 2K4BA 4BHCA 1DPRA 2J5OA 3QP5A 1R1UA 5JR3A 3H5WA 1XGSA 2PAFA 1BJAA 3CKMA 4JA2A 1RUOA 5D5UB 3G73A 3T8YA 3GFMA 2GAUA 5KQGA 4G7OF 1D5VA 2VUIB 1USIA 1SD4A 4P55A 4HV6A 3L9FA 1KU3A 3LA7A 3QP6A 3HSFA 2XKPA 4OIPF 2QVCA 4ZMSA 2FQXA 1HW1A 1XSVA 4ZZDA 3V7SA 2HPHA 3SAJA 2J5PA 1Z17A 4MPTA 1YW9A 3ZMDA 4G6QA 1Z26A 2WJWA 2L18A 1BI1A 2DTRA 3N0XA 2MC3A 4PZJA 1MVOA 2EA4A 1I6XA 3CRNA 2IA0A 1ONVA 1ZDMA 3T95A 3NEUA 3KLOA 2RC4A 3H3ZA 5DGCA 4ETNA 2G7UA 2FLWA 1Z7UA 1ABEA 1T34A 3DXJF 1DRJA 1UB9A 1LK0A 4MRMA 1QQBA 4BH9A 4AIKA 1A04A 4A5NA 3ELKA 1GUDA 5LEKA 4OG2A 3TGNA 3WU1B 2L02A 2CHEA 4MS1B 5E8GA 1PP8F 1F5TA 4GGGA 4L5IA 1DP7P 4M6YA 3A10A 1SD6A 4A0XA 2E7WA 3F23A 2E4XA 1CF7B 5TPZD 2VOPA 3J81Z 4EUKA 1IXSB 4L9NA 3Q7RA 3HUTA 5E1ZB 1FX7A 1ZRDA 3BJOA 4W5RA 1ZY2A 3IKTA 1REPC 4CZZA 1J2XA 2H6BA 4IHSA 2D1HA 1J9IA 4GCVA 1QP4A 1F51E 5EWLB 4MQ9F 1BIAA 4IMJB 5D8LB 3GBPA 3E5QA 2G9WA 2HQOA 4Q6WA 3GRCA 4WK8F 4KYWA 1G6NA 4MS4B 1QGPA 4I0BA 3ZQ7A 3ECOA 3GYBA 2HS5A 3U2RA 2ZWMA 1B1BA 3P9YA 1K6OA 4ETIA 1XN7A 5E17F 1SMTA 4R8HA 1QO0A 5IUJC 3VEPA 3MM4A 2R4QA 5LEJA 2IW5A 4HA8A 3I54A 2D1VA 2MH9A 3I5UA 4G94A 3UK0A 4EY3A 2QZ8A 4HZFA 1BI3A 4KIGA 3H92A 4DQ2A 1BDIA 3LUHA 5D4RA 4JK1X 2W42A 4I7HA 5CVIA 3HM9A 1FFWA 5CLSA 2PUGA 5ILSA 4QICA 2IVMA 4NQRA 4WWHA 5B3JC 1PEAA 2PL9A 4H60A 4DNCA 4M74A 2PQ8A 3H1FA 3QLVC 1H9CA 3ERED 2IPLA 2XROA 4YP9A 1XSXA 3OM1A 3GXOA 2CD7A 4YCSA 3GV0A 2CSOA 4KNYA 4H3KB 3TB6A 3SM9A 3MA0A 1T0FA 5DKFA 4E70A 1SMYF 4KICA 5ICEA 3WE2A 4MQEB 5FLXZ 2PUCA 1AOYA 3D02A 2M8EA 1JYEA 5LHGA 4EJVA 3DEUA 1QQAA 1E6MA 2D45A 4BQAA 3E5XA 1LDKB 3CTPA 2XVCA 2FMHA 4Q5SF 1K78B 3L2CA 4GYGA 3H5TA 1NXSA 3E3MA 5CNKA 2FA5A 3DP7A 5HLIA 1QO0D 4EGYA 1FWZA 4PGGA 3FX3A 5EWMB 3TO7A 1U6GA 3DQVC 4YIIA 4F8JA 2Z33A 1LJLA 1GVJA 3NQOA 4GXOA 4JQFA 2L01A 3KP7A 3ABTA 1D8JA 1MZBA 1DBPA 4NQWA 1FC3A 3WTXC 3JAMZ 2F8SA 2FN8A 4KZKA 1S6LA 2RKHA 1B9MA 4JAVC 2FEKA 5HS8A 1M2EA 2TMYA 4WWCA 4EV0A 5IEBA 2BGCA 3V7RA 5BRAA 5E3JA 1IN5A 3QELB 2PG4A 4R1HA 3MEXA 2QV0A 5CVVA 4Q6BA 2PBIA 3FMRA 4LK0F 2ESHA 2RJOA 3T8TA 4Z4FA 2L54A 3H5IA 1XGOA 2P6TA 4LLNA 2PLYA 4XBFA 3IP9A 1VKRA 1Q1HA 3KP6A 3H1EA 1EH7A 4N0PA 3HDGA 1Z9CA 1I3CA 1YMUA 3E6DA 4WCGA 3L09A 4JB2A 3JTGA 4LE0A 5KVRA 1NHAA 5LHIA 3ZMSA 1FOKA 3I64A 3LQQA 4L4UA 1Z2EA 4LLLA 4B8XA 3KP5A 3SQNA 3SNKA 1J0RA 5KK1A 2HTSA 3V8LA 3BRQA 1E17A 2CWDA 3HS3A 4LE2A 3LUGA 5FBKA 2P5VA 4NHJA 2QVOA 3C6QA 1KU9A 3ROFA 3I58A 2N9UA 5IBQA 2MYNA 4OINF 3K0LA 3EQZA 1GXQA 4M6XA 4OTZA 2ZBKA 1ZH5A 2DI3A 4FHTA 3O74A 4G97A 2A61A 4IRIA 3JPWA 2YR2A 1QPZA 2UZKA 3ZMVA 2NS0A 1DCKA 3B02A 1IXRC 3V8JA 2P5KA 4JB0A 1ISRA 9ABPA 1XB4A 3S99A 3F6CA 3M6MD 4CBVA 2RVCA 3VNAA 3DBIA 3ZP5A 3L49A 1BAPA 3FDFA 2NRAC 1F9NA 2WY2D 2V0NA 3MWMA 3GZ5A 4N9IA 4KFCA 4YFXF 2ZJ2A 3JSPA 3W9SA 4XASA 3OQMA 1FFSA 1LBIA 4YR7A 4PDKA 5FO5A 3GEZA 1QP0A 2VBXA 3I09A 1CGPA 3KCCA 1GLGA 4G0PA 4WXEA 1F1ZA 2ETHA 3A0RB 5DLEA 3M7GA 4MRMB 5EWJA 3VB2A 1ZVVA 5HDKA 3OLWA 4MR8A 1JXSA 4KA4A 2JBAA 2GI4A 4LFUA 4UVAA 2GXBA 4FX4A 1DBWA 5IULC 4JOQA 1EWKA 2P9HA 1FT9A 3NBMA 3IWZA 1FP1D 1NXVA 1KRWA 3GT7A 3HYIA 3IWFA 1ZH2A 4ESFA 3PQJA 3FFXA 4XFKA 4P9FA 1W7PA 1VTNC 1G4DA 4I09A 1U78A 2EK5A 5ERIA 4LK1F 2R25B 4EVIA 4YG2F 3OV8A 5L3EA 5LGUA 1QPMA 1KU2A 5ILVA 2KIFA 3FHZA 3CUQA 3F72A 4TV7A 1Z15A 2HKOA 4LJZF 1WSUA 3HHHA 1FZPB 2IA2A 4JBAA 2IKSA 2F2EA 1LNWA 4ZMRA 3LAPA 4BYYA 2IT0A 2R48A 2LP4Y 3I59A 3WGGA 1V3FA 1ZLJA 3HUGA 1WQ2A 4LGWA 3V8KA 1YK1A 3ULQB 1MB3A 3N53A 5DCFA 3GLXA 4AD9A 3WTVC 2HWVA 4G0OA 3SY8A 1ZGGA 3CLOA 1R22A 3K9TA 5FWXA 2V1XA 4U7BA 2PKXA 4U0YA 1Z05A 3BJ6A 1RXIA 2OENG 4H0EA 5IT9K 1LB2A 3MIZA 4KV7A 2K27A 4MEXF 3LSTA 2H3HA 2KYRA 3HV2A 1XWWA 2QSJA 4QLCU 4Q4ZF 4M9SA 1TLFA 1ABFA 4IRHA 4DN6A 1IZ1A 3FGZA 2A9QA 5CJ9A 4KQ9A 2PMUA 1EH8A 3RQIA 2GQQA 4HF2A 2HYGD 4NICA 5A2QZ 1NXWA 3N75A 2VUHB 3BJAA 3I53A 5E18F 4UHTA 1MD0A 2OBPA 2GWRA 1W7PD 3LFTA 5JNSA 2EFOA 4TLMB 2BGGA 4M71A 2KIUA 1R7JA 4BAYA 2ACJA 2FXIA 4L9TA 2L3DA 4Y13A 4BXUA 5JFRA 1CHNA 1L5YA 3F6VA 1USKA 1M2FA 1B59A 5CYVA 2XGXA 1MIHA 1U2PA 3I5AA 1OYYA 2DPUA 2GXGA 3O1JC 3GYHX 3WE3A 1JH9A 2EJRA 4RGSA 2V9VA 3MMNA 3DGEC 1O57A 1VLZA 1ZG1A 3KEQA 3F73A 1G3WA 4U7DA 5FGMA 1HKTA 3NHZA 3QAHA 4HOBA 2XKOA 4LE1A 4HX7A 1GUBA 1G3SA 2Z5UA 4JP1A 3RDIA 4XXHA 1NATA 4MAAA 2CO5A 1FY7A 3IPAA 2A68F 2BBYA 1XGNA 3RVQA 3URMA 4MR7A 2A5YB 3LUJA 1YS7A 3P7NA 4EVSA 2IPQX 2CYYA 6CHYA 1H9GA 3LA3A 1FSHA 2P8TA 3GA5A 4F11A 4YS6A 3E6BA 4O5VA 5F64A 4PICA 3KLNA 2Q0OA 2DK5A 1IUYA 4L9VA 1DRKA 3EYYA 2QENA 5HS9A 2EFNA 1EH6A 3BPVA 4DQDA 3SFZA 2M5WA 2HQBA 4OBBA 1B9NA 4ZYGA 3WTTC 2OQRA 5D6EA 4ASNA 2GIVA 3K4HA 3QX9A 1MAVA 2R7FA 3TD9A 2UXNA 1LEAA 2QUFA 3O1IC 5HVQC 2CWEA 4ON0A 2JPBA 3GO5A 1P6QA 1D1PA 4EVRA 4NCBA 4FX0A 4HX8A 2FBIA 3CO7C 3W6KB 3VNBA 4DADA 1UHMA 3MF4A 5FFZA 5IEJA 2EA2A 2VE9A 2FEZA 4RK1A 2FBHA 2DU9A 4N0BA 1ZRCA 4KMFA 4QYMA 3TO6A 2F5FA 7ABPA 2L2QA 3COAC 1IN6A 1WKMA 2DO7A 1L0OC 2D2WA 2HGCA 2E1CA 2RDPA 1NY5A 4OATA 4IHTA 3RVSA 3U1DA 5JNRA 2E7XA 3HJFA 3HTSB 3C97A 1RIOH 2FMFA 1ISSA 1QBJA 1JHHA 2M1ZA 2XV4S 2YU3A 3TKYA 1FYKA 3RKYA 1BM9A 3IRQA 1EFAA 1HXDA 2FMLA 4RY8A 2CHFA 3UKJA 3ABUA 1AB6A 3DKWA 1TMYA 5DD4A 1OR7A 1SFEA 2DFIA 3HOTA 4Z9BA 4N41A 4PCQA 4AIHA 4U0VA 1WETA 3GWGA 1GXPA 3BREA 2QQ9A 3F6PA 1O3RA 4W5QA 1LQ1A 4UUVA 1E2XA 5IUKC 1PDNC 2ISZA 2VBYA 4KUMA 3IRRA 4L18B 3KCNA 4XRFA 5JHUA 2ZFWA 1DC7A 5DUKA 1FYLA 2RGVA 2ADUA 1IN4A 8ABPA 4I98B 3QLUA 3EUHA 2HOEA 4G0MA 2FMIA 2M98A 4RAZA 4HV5A 2X7XA 3P9IA 6ABPA 5E8IA 2VBZA 5IUNC 1CYEA 2JZYA 2M87A 2IRFG 4UV9A 1RZRD 4G6DA 4GPAA 3MQ0A 5EWJB 1FQWA 4HNQA 4LDZA 2VT2A 1YLFA 1P4WA 2HYFA 3JPYA 4MR8B 2FE3A 2JBAB 4Y9TA 4HX4A 3V7CA 3PQKA 4OMYA 4LDAA 2FKAA 2HQRA 2A6EF 2QM3A 2X4HA 3G1WA 1Z16A 2B0LA 1VRVA 1FFGA 6PAXA 1MDMA 3KJXA 3RVKA 4R79A 2A9PA 4XSXF 4OIRF 2FOKA 1PNTA 2UXXA 1W7PB 3HDVA 2FQYA 3M8EA 1D2AA 4A12A 2CFXA 3LUDA 4OIOF 2LUOA 3FXUA 1YO5C 4U0WA 4RB0A 1JGSA 2I6FA 2XHKA 2Y75A 3OMWA 1U5TC 3MYYA 3CUQB 2VK2A 2HDCA 1E2BA 1P6RA 4Z4HA 1LVAA 1FPQA 5CNJA 3Q7SA 3TQNA 2ZO4A 5CVRA 5BMZA 1YW8A 4TMYA 2V1DA 1MB0A 3I59B 3P9KA 2XUBA 3SXYA 1JWLA 3CDHA 4I01A 3MZYA 2ZMEA 1PHRA 1P4XA 4S05A 3Q7TA 3R4KA 3GVAA 1W25A 5FWXB 4RAYA 4G0XA 3QPTA 1QZYA 5L3FA 3O6BB 3JAMK 2A6HF 3QOPA 3CNBA 3EQ2A 4CO8A 3BWGA 1YG2A 3OLZA 2JT1A 4KREA 4AWXB 2FSWA 2P7VB 4EJOA 1T2KA 5TRDA 1PP7U 4G9YA 2MD5A 3NNNA 3TMYA 3RKWA 3TDUC 4YFKF 3A0UA 4YGXB 4D6YA 5ICGA 1D3YA 5GQSA 4O5AA 1W5TA 1EHCA 1IRFA 1SFUA 2W25A 2DAOA 4A0YA 4MQFB 3TO9A 2EFPA 3DFGA 5L3DA 5KQMA 1Z2DA 4XLNF 1KGSA 2H94A 4RWEA 4RV5A 1Z1DA 4A5MA 4FB4A 5PNTA 1IRGA 1D1QA 2Y48A 2J48A 1K66A 2WTEA 2E4UA 2MYUA 3AAFA 3T6KA 2R47A 3EQLF 3R61A 1DUXC 3B73A 4RB2C 4ZPJA 3CO6C 2WWVD 4ENNA 3F8MA 1S29A 3IP5A 3IP6A 4ZYLA 3T0YA 3R0JA 2XIGA 1USSA 2BE5F 4KK3A 4WXHA 3K9CA 4RK6A 3BRSA 1ZREA 4HF1A 4RDCA 3J80K 3QRFF 3C3KA 2H0AA 4EYGA 2JVJA 3JW4A 3T1BA 2FRHA 2VN2A 4Q47A 1ZHFA 4MR7B 3HEBA 2BEOA 3JTHA 3KFWX 5HOOA 3T38A 4ML3A 1TW2A 3CLKA 4KN7X 3MZHA 4FE4A 1RXEA 2AYZA 3KP3A 1JBEA 1W9HA 1YQAA 4ESBA 5D5VB 3EGCA 1JFTA 2PUDA 1Z13A 5CHYA 4KIFA 4PGHA 3GF2A 1M5TA 1APBA 1HKSA 2ISYA 2PUAA 2A3SA 4MTEA 4G7ZF 1ZESA 3WU0A 3A3KA 5JI6A 1IXCA 4EQQA 2AXLA 4HQEA 1LEBA 4JASB 4LD5A 3IL2A 3GUDA 5DV5A 3LA2A 1IN7A 4EYOA 4MEYF 4G0ZA 2YPRA 4MNUA 2PL1A 1O7LA 3VOEA 3RVJA 4Z2YA 1ODDA 2HZTA 3DGFC 2O0YA 3FWEA 3OLYA 2P4WA 5TJJA 4GNRA 5T7BA 3CTAA 1YK0A 1QQIA 3QU3A 5CVJA 5TE9A 3TX6A 5E1WA 4KMUX 1Z6TA 1R1VA 4KPYA 1XMAA 3I45A 3NHMA 4YO7A 5D2CA 2ZKZA 3HO1A 3N0WA 5BPDA 3ZMTA 3M9XA 2TDXA 4HNSA 1IAWA 2HFHA 1TW3A 4GO1A 2L4AA 2LKPA 2V6CA 1UHWA 4G0YA 1U8RA 1HSTA 3BOQA 3K1NA 2FSPA 4QYWA 1MJAA 2JVIA 4M9ZA 3T5XA 5K1YA 2DT5A 1USGA 1G3TA 5C5CA 1K7AA 2FVYA 3NNSA 4N0QA 1Y1LA 4I02A 1U8TA 4UNOA 2K86A 3KETA 3H5LA 2HTJA 1A0OA 3GFIA 2Z99A 5JNWA 4O6JA 3F6OA 1X3UA 1ZAOA 2CQKA 4UVBA 5ICFA 1YIOA 3EYIA 3ZMUA 2O8XA 5FD6A 4W5NA 4H3HB 1OPCA 2OU2A 2KRFA 2RN7A 4HAMA 1SD7A 5HLGA 4ESJA 2QVGA 3E3VA 4P98A 2L4MA 1YS6A 2KJBA 2B4AA 4FT8A 3FM3A 2HJ9A 1S7OA 1J59A 4O1HA 4XLTA 3LFKA 1R5GA 2VC1A 3OO0A 5A2QK 4S04A 2RGYA 3LMKA 1SXIA 4IGAA 3M9AA 1HBXG 1BOAA 2AYXA 4LRQA 4F7ZA 3HCWA 4I2OA 4ZYDA 4WXDA 3ZN0A 3IP7A 4NCAA 1MDMB 4BHPA 3WGIA 2R7DA 1YW7A 1R1TA 3C3WA 2A9OA 2NZUG 4KVFA 4YRZA 2YHBA 2A69F 1URPA 4Y15A 1FLIA 1EWVA 2VXZA 5L3GA 1LJ9A 2EV5A 4D74A 4UXNA 1STZA 3DF8A 3F8FA 1TBXA 5CVUA 3O2JA 5BRJA 4L0ZB 3LKVA 1LDJA 1DJMA 1GCGA 3E6MA 2O61A 3Q9VA 1XSDA 3BZ6A 2CW0F 4LB6B 1Z91A 2FQWA 4ENKA 4IRXA 2DLLA 1OKRA 3N97A 5BOXA 1BDJA 4EGZA 2MSWA 3GBVA 2AS5F 1KYWA 1EAYA 4MLCA 1MKMA 4HYEA 3CJNA 4NB5A 2QYOA 4BNCA 2ZMEB 1XDSA 3D0SA 2OAZA 3JVIA 2FF4A 1XHEA 3J7AO 1HSJA 3KYJB 3BDDA 3MCZA 4MR9A 5KC9A 1DBQA 2EWNA 4HLYA 1U2QA 1YVUA 3HVRA 4RK5A 1OXBB 4M9XA 1U3EM 2WWYA 4A6DA 1TQPA 3E97A 1L3LA 1XHFA 2CGPA 4MQFA 1XCBA 1U0SY 3EJWA 5DCMA 1T98A 4RY0A 1TJYA 1HW2A 3HSYA 4XLPF 1ZITA 5TQ2A 4E7OA 1USTA 5FWYA 3ISPA 2P6SA 3O21A 2IYNA 4RK7A 2QQBA 1EWTA 3EAFA 1A2OA 1DCFA 2QWWA 3WTSC 1TNTA 1FBUA 1J5YA 2FNPA 4Z4CA 3NNDA 5DTEA 2C6YA 2EV0A 4WF2A 3OLVA 4MQVA 1WI9A 1Z25A 3ILYA 3M9WA 2MLGA 1FYMA 2YX7A 3KZYA 1NXTA 2XAGA 3LQRA 2FBKA 3LAJA 2JCGA 2NNYA 2K4JA 3F8NA 3O3KA 2PMCA 5J8CA 5AIPA 5IT9Z 1O3QA 4IJAA 3OLXA 1SFXA 3HXMA 2E4YA 1KYZA 5TPWA 4RU1A 4RXTA 4CHUA 3LTEA 3BROA 1FBQA 1K79A 2GA1A 2HQNA 3F21A 4O1IA 1O3TA 2IDMA 2K7LA 3P9CA 2G7HA 4G0QA 2IA1A 1I27A 5HM6A 3KTOA 1BN5A 4L85A 4MGEA 4RS3A 1JL3A 1DCMA 4Z99A 4LG0A 1ON1A 2IJLA 2QBYA 5J6XA 4D0PA 4MS3A 1H0MA 1NTRA 1ZGZA 4PZ0A 4L5JA 1R00A 5K5OA 2M1BA 5FB2A 3TDZC 1O3SA 3V4GA 3GZ6A 2XASA 3CG4A 2YSRA 3KSMA 3EODA 1K68A 3GW2A 1RPJA 3G85A 4F3TA 4IMIB 2H09A 3HSRA 1KQ9A 2MA3A 1YYVA 3H1GA 3ILHA 1S3JA 4IPAA 3E5UA 3CZCA 4UV8A 1O7FA 2K02A 5DD8A 2DPDA 3H5OA 3IC7A 3J81K 1I1GA 3C18A 2NYXA 1D4ZA 3CUOA 4Q48A 2FU4A 4IXAA 5J8FA 2L17A 5D5WB 4G8XA 4LMYA 4N47A 3HTUA 1U5TA 5DEQA 2JK1A 2VBWA 4HW0A 4M73A 2PE5A 3HOSA 3RTRA 5ICCA 1SRRA 4RK4A 2WB4A 1OYWA 1JDPA 4AIJA 2H6CA 5GOTA 5FD5A 5HDGA 1UFMA 2HSGA 4D6XA 3S2WA 5KWSA 4P96A 2MYTA 1SXGA 2XAQA 4CGZA 4EMSA
chains in the Genus database with same CATH superfamily
1JI3A 3IHUA 2CVHA 2NAZA 4KXQA 5HUHA 3JSOA 3GRKA 3G59A 2EJBA 3IDQA 4FDTA 2GEJA 3CCMI 3ZEAA 3ZVLA 2MBFA 2WQ6A 2E4WA 4GOJA 4V02A 3WIUA 5KB3A 2IOHA 1FNNA 3RYPA 3QPUA 5JADA 3E6CC 1CB0A 1FRZA 5CX1A 1P92A 1EFRD 2G17A 4W5OA 4KT6A 1RKQA 3LUKA 5FKJA 4KFRA 4GYKA 4ZEMA 2G8NA 1KE1A 1KWGA 1Z0SA 3HU3A 1FRQA 5AVYA 3ZQHA 3ABQB 3EQ7A 5DMHA 3DMRA 4FHDA 3FR8A 3F7NA 2OMKA 3LNTA 3FKSA 4CM4B 2PGAA 3H75A 4E7ZA 4BEVA 1ZLKA 4AD8A 1MO4A 2CUTA 1UXJA 1XZPA 4XWOA 4N3CA 3BGDA 2BI8A 2FLKA 1OYIA 4YYZA 1JA1A 3ADBA 5U4XA 4B2LA 2AMJA 3VC2A 1W96A 1G3MA 1V5EA 3ZX4A 5GTIC 1DJPA 2E4ZA 1GUYA 3EIFA 3AW8A 4WZZA 3TKLA 4ZCRA 3OEHA 4REQB 1TQDA 1P5RA 1UCRA 3PFHA 1KBOA 4K9QA 4GZ6A 4EM1A 2WA0A 3SQWA 5G0TA 4CL8A 5EEGA 2WSLA 1DT5A 1OHHD 4YPVA 2Q1UA 2O8CA 5NULA 1L4YA 2CQNA 5G4KB 5DTDA 2NSYA 1ULYA 4R54A 3WG7H 1GT6A 2NU9B 3EXEA 2QLBA 1U9OA 1U0JA 4RM2A 1OILA 3W2VA 3C3EA 3EWSA 1TVMA 4ZCMA 2BYVE 4NNJA 1ZARA 4GLFA 4K9OA 4IIHA 2ZSDA 4NI5A 2AOWA 2ZPUA 3EDYA 1UJ5A 3DWGA 4IMRA 1X0XA 4F71A 1S96A 4I9NA 2YXPX 1LDYA 1F4VA 2ZE8A 3EIXA 2PO7A 2VSNA 3E5MA 5CXSA 3S2EA 1SUSA 4FM9A 4ZOQI 3BR1A 2Z4SA 1G8PA 3IAHA 4Y52J 2ON6A 3FMVA 3CF2A 2EEPA 3LCCA 1ECLA 2CT8A 2QTGA 3M4XA 3MJDA 1DWPA 2O2EA 2Y2ZA 1Z18A 3HNRA 1U2EA 1ORDA 4RD6A 2AI3A 2ZS7A 4WLOA 4RY9A 2HHCA 2EGGA 1N8KA 3OICA 3FDYA 3W3CA 5KUTA 4KSCA 3DE2X 3I4PA 5DBIA 5HEKA 2QX8A 3VPAA 2A33A 3REOA 1EFUA 2I4LA 2J3KA 2VDWA 3QBVA 1UPCA 1EB8A 1Z75A 1CERA 1E0DA 1H0SA 3FPEA 1HKQA 1DKQA 1P9LA 2O20A 1QU2A 5LHHA 1GCUA 3K4JA 3MJHA 1I3OA 2WA2A 4FSHA 4M99A 5IM4F 2XAJA 2ADOA 4AKEA 1G6HA 2QA5A 1RMTA 4D0GA 1YR9A 4M0PA 1Z8DA 1TA9A 1U5BA 5JBQA 1U1EA 3RH0A 3NRVA 4C4TA 3TZ6A 1LPSA 2Y0PA 1P5HA 1Q91A 3EDPA 2PMZN 3D6NB 2VJMA 4RS8A 4ZO7A 5GAGJ 5L7TA 3ZIUA 3KT6A 1QZZA 1KI4A 5K0BA 1ULZA 4LA4A 4WI1A 4JLNA 4ALIA 3LDAA 4E5UA 3WRWA 3DE0X 2ZIXB 5F1JA 3AI7A 4Y9UA 5K5QA 3HKDB 4B09A 1Q1ZA 4CXFA 3KR9A 4ENMA 1OWLA 4FTHA 1Z29A 2QB5A 1D2GA 4M1TA 3SHFA 2Y8EA 4M1YA 3VNVA 3T7RA 1I4TD 5KYYB 2ZDQA 1M6VA 4P7GA 2WDPA 5ADWA 2VRBA 2EG5A 1RW4A 2W00A 3R0XA 2WUDA 4JJKA 3ID6C 2NUAB 1GDTA 5K3FA 4MITA 5FFXA 3AKEA 1FMWA 2A4KA 2VE8A 1K7CA 4WNYA 2YQ5A 1O87A 2FW0A 1YCDA 1PLKA 1ENZA 4D92A 1ZNQO 2JCSA 3U26A 3WL4A 5C1PA 4BNVA 2V7UA 1TYAE 3JREA 3H8JA 1WXQA 2C2XA 3ONWA 4BB0A 2VWHA 3TZEA 4MZDA 2HL6A 5KNDD 1PUEE 2VKTA 1SQ5A 3U9GA 3SC3A 4TXJA 5C7OO 2G5PA 2D7CA 3ZOKA 2ZJOA 2FZLA 3CBGA 3BXFA 3WLTA 5ALPA 2X4IA 1JP7A 2QEXI 3KQHA 1U4NA 2M7BA 2VC0A 4PLTA 4K86A 1QG0A 4BO3A 1Q5PA 3HJEA 2X58A 3LIIA 4KVAA 2R7QA 4RVOA 2Y9PB 4EI2A 5AI0A 3JD2A 2PSFA 3AU8A 2A0XA 1IQRA 1MB9A 1F9EA 4I0AA 4QVKA 1FYDA 1ADJA 2H63A 2HV9A 1Q14A 5AONA 2YU9J 4XUCA 4NCJA 1A5ZA 2Y9ZA 1D6JA 1VL8A 3LGSA 1XO1A 1L5MA 2PUFA 3FDZA 4RIGA 4RCYA 1Y1KE 3I37X 1M2JA 3TLGA 1SM4A 3VR4H 3MBKA 2W8BB 3L6BA 2OR3A 1KQ8A 3HKBA 3I9V1 4G86A 5HDNA 2X4GA 3B52X 2BHYA 3EZLA 1W75A 3OYMA 3DEYX 4R71A 1KK3A 5ES3A 5JCJA 2IZ5A 3EWAA 1OZAA 3PSHA 1Q1EA 3LYAA 1XGSA 1FRFS 1PAUA 3QKSB 3D7MA 3KBOA 4EK9A 1ZXLA 1HE8B 1XZCA 1XTTA 1DZIA 5DWQA 1HX7A 4ZZDA 3KQVA 2OQIA 3LHDA 5FRMA 4Q34A 2AFHE 1Q11A 1YRHA 4LFBB 1LFPA 1EYZA 1M2VA 3F1KA 4NU6A 2H4JA 4ND7A 4JZYA 4MJXA 3ELKA 1RJ9B 2BELA 2DULA 3TLJA 3VKHA 2NO5A 3DOCA 1F5TA 1LF5A 4HQLA 1Z9BA 2FPIA 1DP7P 3VPHA 2IGBA 5J23A 3ZJYA 2AZ4A 2SNIE 2E7WA 1CF7B 4O1MA 4DCJA 3ABZA 1K2VN 2DVMA 3AUYA 5AK6A 3GH1A 1D8TA 1FQJA 3BRCA 4YDSA 5HIMA 3N8NA 4M98A 4YNBA 4BO5A 5EWLB 2GT1A 2ZXUA 3V8MA 2G9WA 3GUUA 4WOJA 5P21A 5LN1A 4HXEB 5B64A 2WF8A 1MW8X 3N5CA 2HU8A 5LEJA 4YT4A 1JILA 2Q2EB 2D1VA 3I5UA 4G94A 2IGNA 4HN9A 4EY3A 2IS2A 1BI3A 3DE1X 3Q1KA 4L5BA 1KJWA 1Q7GA 3PR3A 4I50B 4PINA 1UOOA 4QBGB 4ARUA 2O4UX 4NQRA 3TL2A 4LXHA 4M74A 3H1FA 3AUAA 5ERGB 3OSUA 4G1CA 2F7SA 5BR7A 3GV0A 1T15A 1ISPA 4OJYA 1XTUA 4BECA 1Z0FA 2OBBA 2XVZA 5C2JB 1IBCA 2BBTA 3EVEA 5E2AA 2GN0A 1B3BA 4RQAA 1UOEA 3WMWA 5A5EA 4GYGA 1KPHA 3DKKA 1O54A 2NAPA 4DJJA 2VNKA 1P2TA 3Q6MA 2JFBA 4MCHA 3DFKA 5BV2P 3DBHB 3F8TA 3W7AA 4NQWA 3B13B 2V5AA 1CE8A 3KZMA 1D0IA 1M2EA 1XZAA 3S29A 1T3SA 1KS2A 4AYBA 5BP7A 4D45A 1OOEA 3V7RA 5BRAA 4J6FA 3DHWC 1SEVA 3U2QA 1G7CA 4ZAXA 4IHKA 3W90A 5DW3A 1RPNA 4OGGA 4AROA 2R8XA 3Q7EA 3TQHA 1II8A 4EL0A 1YT5A 1SHJA 4EENA 1UBJS 4HS9A 2PWZA 1HT1E 1M54A 3T5CA 3RODA 3P9SA 3PE6A 5G41A 4G23A 2Y4OA 1F2UB 3QPSA 1HDGO 3ZTWA 4ALJA 5KVRA 1ZMOA 2IEDA 3T5MA 3TMAA 3RSFA 3WYAA 4R1OA 3S8MA 1AGYA 2PUJA 1VQ7I 1TWHJ 3BRQA 1UZAA 3WO0A 4BVJA 4KVZA 1ZXBA 3DB2A 2JEYA 5CT9A 3ROFA 4PO3X 5F23A 2PRJA 1KVRA 2BOLA 3K0LA 1N4DA 2P1DA 2HUPA 3ZZ0A 5DNCA 2VAXA 3HUFA 5JNLA 2V9KA 2YYSA 3ZE2B 3SDBA 2OUIA 2FSHA 1EHYA 4GBED 4HZUA 3N2YA 1SVMA 3L49A 3E15A 3AFIA 1Z63A 1Z5OA 4Q7LA 1GLVA 4HWKA 2Z5GA 5JE8A 1SUIA 5D3MB 3W9SA 3RVDA 1A2BA 3ZTTA 1ZM7A 1T9GR 4RV4A 4KOEC 1KJ8A 4MR8A 1ZD8A 3WOVA 5KJ6A 1QP8A 4XWAA 3M5PA 5CUQA 4F86A 2Z3WA 1N34B 3GT7A 3UWSA 4E07A 3ASZA 4TSFA 1WBDA 2ZRHA 3G2MA 4GOOD 2JI7A 1Z06A 2R8RA 2CF6A 5IPAA 2G67A 1MMAA 3MGGA 2XZDA 2RB4A 2RG7A 4OSEA 3UA3A 3CUQA 5JJKA 3I2HA 4GUDA 3EXFA 3D1NI 1KAGA 4TXMA 2QE7A 3TEFA 2KHMA 4K81B 1ZUNA 3A4MA 4MJLA 1UOPA 1DPGA 2PKXA 2KS6A 1N3BA 3S1SA 4AZ0A 5IT9K 4HLUA 3KL4A 2W22A 1BU5A 3PFNA 4IRHA 1Z08A 2A9QA 4MVJD 3KT8A 5DXJA 2BFFA 5KJFA 1WL8A 4NICA 4G2TA 1NXWA 4TYNA 2VUHB 4L5AA 2XNCA 3ZE1B 1XEWY 3FGOA 4WKBA 3VDMA 4M71A 5IASA 3STWA 3BH0A 2EEZA 2O8VA 1PX2A 3CPJB 5BSTA 1XZIA 3CEJA 4AKGA 3VWBA 3X1DA 4ANFA 5BV1A 1NE2A 3T4UA 1L7PA 3KB1A 2ZZMA 1MENA 2C5AA 3UQZA 3AL0C 4HOBA 2XKOA 3LIPA 4IDOA 2CWWA 1F06A 2XHZA 3FUXA 1XCJA 1WZNA 3FOBA 4TRJA 3UKDA 3LUJA 1IB0A 4TV9A 4PICA 4FKZA 3SU8A 1DRKA 1H3NA 1GTL1 4DQDA 1R16A 3KJHA 4K6MA 1DAOA 5D6EA 2AC2A 4M3NA 3K10A 4FISA 1P9RA 3UAGA 5C8YF 2CVPA 5AT1A 2QSUA 3L8GA 1M1XB 1SBZA 4QJBA 1RZ3A 3ZQ4A 2DUNA 1O77A 3KQTA 4QGBA 3KZCA 5IEJA 2C0PA 4I6ZA 2PAAA 3F6RA 5LIPA 2PSHA 3U7FB 2L2QA 2V4ZA 4OATA 1I01A 1H6AA 2HGCA 4IHTA 5DM7F 1LVHA 4F8EA 1HMPA 2XVYA 3G68A 2JARA 3JRAA 2H7CA 5E3NA 4E2FA 2XJ4A 2IT1A 4E13A 4RY8A 4A0FA 3JQ6A 1AB6A 5DM0A 3PVZA 4N48A 4ZTBA 3G8YA 1Q0ZA 2IZ0A 4OA8A 1JNXX 2ECPA 3EGDB 1WETA 1BS9A 2WV1A 3GWGA 4BL5A 2Y30A 2ZUCA 1R9NA 4DMMA 2Q1XA 2QUZA 4UM9B 5LNK1 2H1FA 2F00A 4WFIA 1HE4A 1HWYA 5C8XA 1O97C 1CYEA 2M87A 4UV9A 2JBWA 3PQ8A 1P9WA 4G5QA 4D9KA 4ZRDA 4D7NA 4WN3A 2NNLD 3JPYA 4D4KA 5D84A 1CR1A 5FL3A 4GYWA 2A6EF 4PJJA 3T7TA 4CG2A 4AKIA 3KJXA 5HTKA 4UM7A 1JXOA 4JENA 1X7ZB 3K2QA 1RKTA 1E3HA 3F97A 1K7YA 4PSCA 1T56A 2HXYA 3CPSA 2V7BA 1SZDA 2VA9A 4L95C 3AWIA 3ESZA 2VSQA 4PJNA 1CJSA 5JAIA 2IW3A 4Z53A 2GEBA 1BHJA 5C35A 6NULA 1K7SN 4I3HA 4IH1A 1RTTA 4KH1A 4LG3A 2OYSA 3BMCA 3EGEA 1W25A 2O23A 3WAKA 3R09A 1JG1A 1CQJB 1Z7YA 2M9HA 5AVRA 1E20A 5IHPA 4MFEA 3N59A 2EILH 2WFZA 1KOFA 5AJZA 5EKTA 2ASVA 4CT5A 1W5FA 1IV8A 1IZZA 3MB8A 2I2XB 5ICGA 3K5WA 4BB5A 4O5AA 3P2OA 4P3XA 1YL6A 4P82A 3HXOA 4X64B 4ARBA 5EZ6B 1ZO8A 5KQMA 1C8LA 3QBJA 3C70A 1KR5A 4P5PA 1F2VA 5BVGA 3TNFA 2M32A 5EKUA 5DTQA 4XK4A 4P38A 1Q83A 2VHJA 2WZBA 2QZ4A 2HYDA 2ZOSA 5CD9A 1CY6A 3FTFA 5A0VA 1MV8A 3K9CA 4EY4A 1W85A 4QJ5A 5E7QA 1SOVA 4F3RA 2ZJ6A 3F6EX 3PI7A 3ER9A 3O3NB 4MR7B 5HLTA 1Y1PA 3N3AC 1UFOA 2BEOA 3CESA 3TIFA 3CLKA 4RFVA 2IHBA 1XKLA 2VP2A 1H1TA 3E9EA 4OHPA 3CN7A 1BA3A 5DIZA 4K6GA 1G64A 2PUDA 2C98A 1Z13A 5CHYA 1JKFA 2VQDA 1R4NA 1Y1RA 4N39A 1ETOA 4R0MA 3K9LA 3K4PA 2COEA 1DIHA 1K9VF 3ZE8A 3P27A 4CEJA 3LCJA 3BFXA 2G06A 5I7RA 4A36A 2WM3A 2V6MA 4ZZIA 4MI6A 5FI0B 2XCRB 2C9ZA 1H5NA 3TNDA 3FYUA 4ZVSA 2K87A 5ECWA 2DN0A 1D9ZA 4TUYF 4WECA 2ZKZA 1B42A 2GD6A 3ZJVA 4GO1A 5J2UB 1UKCA 1HSTA 2JGDB 5JY6A 1KH2A 1GPWB 4R8KA 5L6MB 1V3VA 3T5XA 4M86A 5IAKA 2BE9A 2DT5A 2O3JA 4LS3A 2GASA 1P39A 3ONQA 4OVKA 3EPZA 4KXXA 3BKXA 4UD6A 1IVNA 1TEXA 5A4KA 1S1MA 3PTLA 2R6FA 5JD5A 4Y7DA 2KRFA 4X1KB 3EAGA 1WEHA 3MKLA 1V9SA 3SDSA 2RGCA 2AJDA 2QF7A 4RD1A 2GXUA 1L7BA 3AEUB 3KOXA 3ETEA 2NQ8A 3GNLA 3SQOA 3NWBA 3E9CA 5LPNA 4LF4B 3C3WA 1G63A 3R6TA 1GL9B 5K6RA 4CCLA 1VZ3A 3QE2A 1MIJA 3UATA 4D74A 3FWKA 1VQ4I 4NZ9A 4L0ZB 4BYMA 4QJ4A 4AK9A 1Z6AA 2XMZA 3T3PB 4NMLA 1OFGA 2WICA 1PFKA 2AEEA 2AS5F 1RKXA 4A0HA 2FZGA 5ESWA 4C2BA 2BFDA 5ETJA 4U1RA 3LZ6A 1YMQA 2HGSA 4M21A 3L2WA 3AI3A 5LXTF 4LF6B 4MWDA 5DI9A 1XHFA 2QW8A 3ZLUA 3EJWA 5DCMA 1E2MA 4C4ZA 3Q40A 3UMMA 1Q1GA 2IDJA 2GFHA 2YWEA 4F1JA 1BROA 4FI3C 4IPTA 2VCHA 5I7EA 2QWWA 3WTSC 1XN1A 4FYYA 4ER0A 4Z4CA 3IURA 3G2LA 2XQIA 5AI4A 2EV9A 4NBQA 1NVDA 2PUWA 3BPSA 2ZRAA 2C31A 5FYDA 4L5CA 3ELDA 5B7QA 1K5PA 2QN6A 2FRXA 2AMYA 5DHAA 2Q9CA 2YV5A 5IT9Z 1B8UA 1O3QA 1KYZA 5DWDA 1YV9A 5DMXA 1O3TA 3MWKA 3P9CA 1AKEA 1C9KA 3K70B 3E1GA 1JL3A 3NDBB 1D2HA 2QBYA 1X7WA 2XA2A 3K0FA 2FZKA 4NENA 1QV7A 1HNXB 4H7KA 4RMHA 2O07A 4RZUA 5CXXA 2LD5A 1L9XA 5EJ7A 1BH6A 3HBFA 3UXMA 1U8UA 1JSZA 3RZOJ 3PX7A 2WG2A 4IXAA 4FFLA 4B3SB 4R8RA 4H27A 5H81A 2W0SA 3W2FA 3R6LA 1U7HA 3O9MA 4K87A 1YBHA 4D4JA 1GZ3A 1CR0A 4M73A 1UBCA 1VYVA 4N6OA 3KIOA 3K92A 4BZXA 3S2WA 3QFCA 3L82B 5AM5A 1ENPA 2XAQA 3FYDA 2AC4A 2CHUA 2IYZA 1W8IA 4IDAA 3NUQA 4K40A 2HA6A 4V0OA 1V4RA 1K4YA 2DYSH 3OU6A 4WZBA 4KT5C 1SCJA 3KQUA 4U9IS 3DUWA 1E5QA 1JFLA 3FPLA 3IBYA 4EARA 1YFKA 4U7FA 4EHLA 3Q6NA 2WV0A 3ZWVA 3I6BA 4H18A 2RAPA 3AGQA 5FL7D 3LSKA 3NDIA 3CCLI 4GI7A 3REQA 4XUDA 3NHLA 2NSLA 2O50A 1XZJA 1YZ3A 5J1TB 4QOJA 1CUJA 4H3VA 3PGJA 1MC8A 2IWHA 2P8SA 5ALFA 3IUJA 1RXUA 2H2GA 3CJQB 1U1DA 4Z1MA 4GR9A 2G36A 5CK5A 4HNRA 1E3OC 4M8KA 3QTTA 2DPXA 1TTHA 2QYHA 4YDHB 4J0GA 4KRFA 2AFIE 3ABOB 221PA 1VI2A 5JC1A 1SK8A 2R6GA 2ZAYA 1O5IA 3SKYA 1VPWA 2OBMA 4ZO9A 3BR2A 2CXHA 3EG5A 3MIIA 2PMHA 2F55A 2YV4A 5AO9A 1IQUA 4BXOA 4Y6QA 2MINA 4PG7A 1AZSC 3AF4A 1PQPA 4N5DA 1T2UA 1KY3A 1VL5A 3VOTA 3M9LA 2XRNA 1FTSA 3C39A 4A91A 4AECA 1B8IA 3AHFA 3BIOA 2BV6A 5K7SA 1THTA 5BQTA 4PTZA 2ZR7A 3RTEA 3OQNA 4JKIA 1L7AA 3R7WA 4FYJA 4XOTA 2W98A 3BGSA 3GARA 1DC8A 3UT6A 2MHCA 1KETA 4BCDA 1QH8B 5JNUA 1W8DA 2WYOA 2AO9A 3SLKA 3I55I 1UBSB 1V1MA 4EG7A 4RKEA 3R6SA 3CO5A 4LCJA 2FI1A 2YJGA 4HF0A 2YQZA 2OHIA 2QXYA 1H4TA 4RE6A 3FNQA 1D1TA 3DNPA 5IOYA 4EJSC 1DEHA 2Y1EA 5CT5A 5GAHJ 5E2BA 4R9NA 4I7EA 4DA9A 4JLSA 3GTJJ 3B6CA 3U80A 3ROPA 3P0FA 1DMRA 3D2AA 4YFNF 1KY4A 2BMFA 4RH0A 3H9JA 2PT7A 3PP8A 4PC6A 4FYIA 2MYPA 2PRYA 4DZJA 1OR8A 4QIWN 2B69A 3L7OA 1J7JA 1ORIA 2C1ZA 1JR3D 5J4VA 3K6SB 4LYHA 3KS9A 4BWGA 3TWOA 4HWSA 3OO1A 4XICA 4LYDA 4C1NA 2HLHA 4PAGA 3MINB 1M0SA 2OG2A 5ERXA 2YIVX 3VDRA 5JZBA 2B5VA 4UUOA 1ETYA 4EYQA 3VAAA 4BMNA 5G3YA 3CR3C 3OEED 3U3KA 1GAEO 1DXHA 4RVHA 1IULA 4RMJA 1CUFA 3U13A 4DUGA 4H1HA 2BPOA 4OQMA 3LUFA 1LBHA 1UWCA 1T13A 4FS3A 3ZN1A 3OETA 2XQJA 1YKGA 4E1VA 3OIPA 1VL6A 3HCDA 1Z0XA 2GJ4A 2VODA 3TL3A 1KXZA 4ZVRA 2OZUA 1SBHA 1P33A 1K86A 1TC3C 4N5IX 1PL8A 2R7ZJ 1DG9A 2ZJ0A 5DYGA 2DHEA 1QQ5A 3IPCA 4ZV7A 4C07A 3ROUA 1ZW6A 2OSBA 3VSAA 4HDMB 2HVSA 3SHWA 5CK4A 5B57C 3LLUA 2BMEA 1EUCA 4ZZLA 5IH3A 4R9SA 1AOXA 3ROZA 1J7KA 4DV2B 2LCQA 3AJRA 3U49A 1O8CA 3UZUA 1ODTC 4CN8A 2BZGA 4YIRX 5K7FA 4IV0A 2BEUA 2DQSA 4FBLA 4UD2A 1GZ4A 3K30A 4BKRA 4WERA 1FVFA 1BC5A 1V5GA 1UP4A 1N33B 1ZEJA 4JX6A 2FV8A 5EJ6A 2QD3A 4DFDA 1PEYA 1MFPA 3ADDA 2YMQA 3UHOA 4DMUB 5CB4B 4RVNA 3TH5A 2V7EA 3RS7A 1VFCA 2I7VA 4NXNB 1JI0A 5D00A 3DMTC 1MNMC 1UG0A 3HN7A 4N4NB 1W0KD 2JHAA 2LY1A 1QRAA 1YRNA 2PN6A 4KGZA 1O4XA 1PWYE 1U7XA 2A35A 1N2SA 4DIKA 3PB3A 4GX0A 3UFBA 4AURA 4QG3A 1KZ1A 1PR1A 1Y0UA 4QJ3A 4PZPA 1TWGJ 1T2VA 1M8JA 2JCXA 1A9XB 4KACA 3GRYA 1B6GA 1ZIXA 1JKMA 1SPBS 3AVQA 5K01A 2LBPA 2NGRA 3I05A 2YUSA 1O94A 2Z1NA 2ISCA 3NTRA 3VR2A 1JLMA 2CNWD 1M73E 2CXSA 2GEVA 5HRUA 3DTYA 2QJWA 2HIGA 2HMTA 2I80A 2OESA 4K0KB 2CUFA 4V0MA 4M1OA 1N6OA 3G8BA 1R1UA 1L4UA 3H5WA 3EGOA 3RTAA 1Q0PA 4BX3A 3UOGA 4XM3A 3ZNNA 3UMVA 3AG1H 4C7OB 2XCIA 3LA7A 4GDMA 4ZMSA 3O38A 2O2CA 2DECA 3BCBA 1Z17A 1ITZA 3FUWA 4BBAA 1N77A 3HH8A 1Z26A 2V8OA 3NP9A 1T9AA 1EFPB 1N7GA 1W581 1KSHA 1ITYA 2ZSHA 4J0CA 5TV2A 4M6WB 4QPZA 2OO5A 4TT3D 2J9GA 4A5NA 4WK4B 4LNUB 2OAP1 821PA 4RMNA 4UNQA 2BH9A 1SD6A 2YHIA 4CJXA 4GPEA 2BJHA 2ZULA 4I81A 4BLOA 5I8PA 3A3YA 2WD9A 2ZJZA 4W5RA 3EXG1 1WJAA 1F51E 2QZZA 1ZNZA 1FF9A 2MC4A 4KYWA 3FVWA 5LQCA 3VR5H 1IPFA 1QZUA 3P9YA 4U7GA 1SVWA 5LZ9A 1CNEA 1FYEA 1M83A 5IUJC 1IY9A 2Y99A 3HEMA 5E4TA 2HJSA 2OO3A 1X58A 4NFSA 3UUEA 1POWA 1GR1A 3RK4A 3O3OB 2ZRLA 3M3HA 3L4JA 2W42A 1EBBA 5HILA 1P2SA 4K2HA 2BZSA 3JQ8A 2Z4RA 4CUKA 4YAUA 1CHDA 1Z56C 1F2TA 2PL9A 3OY9A 3ERED 2QT0A 4JELA 3GW8A 3OM1A 5DXFA 1KTVA 4QUBA 2H85A 3IRVA 5TLSA 3KVVA 4ZC1A 1QK4A 3C5WP 5FHQA 3WE2A 1PU2A 4OIMA 1JQLB 3LOCA 2D45A 1QHSA 2QD2A 3C7CB 3B7PA 1UHSA 4CYCB 1MLDA 1WPKA 2XZPA 3KDPA 3AVVA 3TPZA 4PQRA 1VJDA 4KTVE 4WJLA 5JV5A 2PT5A 4EAAA 2PSSA 2HMSA 3WNVA 1WXHA 3DQVC 2JFNA 4GXOA 3L7AA 4ZZ1A 5JPCA 1FYVA 2L01A 5A6SA 2ZB2A 1F36A 2RHJA 1ZWLA 4XEUA 2QRHA 1Z2PX 1TEZA 3LWBA 2XB5A 3C15C 1KMCA 4M4SA 3HVIA 2WSIA 5K8TA 3RPUD 4QTTB 5CBKA 3KWFA 5I9IA 3RE1A 1R15A 1NFQA 4RANA 4A5OA 5HMLA 3OCZA 5KYUA 1UMCB 3CNOA 4AJKA 3I64A 1FMTA 3DMDA 2V4JC 1UT8A 3BR6A 5C7IO 4GR5A 1U81A 3GQBB 1E17A 4AT1A 3HJBA 1OB2A 4Y4RA 3H5NA 3K9BA 1ZN9A 2ID8A 2OXFA 1Z22A 3B7WA 1X1CA 4BTVA 1A31A 4M6XA 2VF8A 1SXJE 2GPAA 2XGMA 3A02A 5HF9A 5DRTA 1BX1A 3E70C 1THGA 4KE6A 1Z74A 2NUPB 2IH4A 1NMYA 3R9XB 4AUMA 1NJFA 4YFVA 4DBQA 3DBIA 5LYJB 3BZBA 1HUQA 1MBEA 4EPYA 2QA4I 1E7QA 1GQOA 4WN9B 3HFRA 1HA8A 2ZWVA 5FOSA 3I09A 3BT7A 4EKDA 2H1IA 4HGOA 2O2ZA 5MHTA 4UVAA 2JA6J 3FBGA 4Y7CA 3DR3A 1YC5A 4RFSB 3TVYA 1P62B 1KRWA 4RA6B 5L3VA 1LV8A 4WBNB 4JQCA 2ZE5A 4O2LA 1TYBE 1DBIA 1NLZA 4RSHA 2OOSA 3GMTA 4PTLA 3A3OA 2JJMA 1F60A 3QUCA 1A2QA 1QS0A 3OIWA 2CB9A 5HRCA 1U4OA 4ZD6A 1WQ1R 5IKXA 4E12A 1ZI9A 1QZTA 1VLMA 2WUVA 2IKSA 4RIFA 3K1AB 2IT0A 5L4NA 3JWIA 2LP4Y 3KYCA 2Y0DA 3RDPA 3JQBA 1MH9A 4DQUA 3E1SA 2G3YA 1AZWA 3CLOA 4NBVA 3AHDA 3MILA 1B72B 2Q5EA 1GPUA 5E6UB 4HRIA 5EUCA 1JKJB 1NBAA 4MEXF 3LSTA 4ZO8A 1SOMA 3R20A 1E3PA 1VQPI 3LDUA 5F5NA 2PKEA 1T0UA 1TLFA 3FN4A 3L8FA 3FXJA 3H9BA 3VNSA 3U7QB 5CJ9A 1T4CB 5EUMA 4RULA 1EH8A 3E9RA 4XRSG 4BRWA 4BRSA 5D3ZA 3N75A 5JS8A 3BJAA 3VX4A 1XTZA 5K20A 2ZVDA 3UHFA 3VTFA 3AV0B 2FXIA 4HLNA 4CKBA 3OPQA 5B2ZA 3TR6A 1DGWY 5JYDA 5GPAA 2A2ZA 2HLDA 2DMRA 2P62A 4LHZA 4F92B 1PYOA 2TMGA 2Z8XA 4IJVA 1Y1SA 1EDEA 1G3WA 4YAIA 2QLLA 1LW6E 3HU5A 5SYMA 4KOAA 1XGNA 4XIJA 5C4IA 1GNTA 5GIPE 4OBEA 1XS9A 2CMPA 2PKQP 5KU7A 2WJJA 2WB2A 1XAJA 4WW0A 4GSKA 5AI5A 3R3XA 4HRYA 3DZHA 2BHNA 3QX9A 3A31A 1ZCFA 2CWEA 3T3IA 3CO7C 3VSDA 1TVEA 5A3VA 5AD1A 2WIDA 1R4ZA 4B74A 3ER6A 4AWAA 1XC7A 4QEDA 1IWBB 3H5AA 4UJ5A 2GHRA 3SF8A 3B5JA 1PBTA 3Q0TA 1K0UA 3R5JA 4BXFA 8ATCA 1G3IA 5AW1A 3P9ZA 1MCZA 1NNSA 2XLCA 1J99A 2B3DA 4JCOA 3KSAC 4P0QB 2H9IA 5KX5B 3PFBA 2OG1A 3G8AA 4R69A 5K8VA 2V58A 1GXPA 2O19A 1ZCBA 1G6KA 3AKCA 3KCNA 4WLUA 3WISA 1KPIA 1KYTA 2PU7A 3QLUA 3GYGA 1WP4A 2IOFA 1G6OA 5LSAA 2HX1A 1RP7A 4HUJA 4PS1A 2JZYA 1RZRD 4CA0A 4NG4A 3FTQA 1Y98A 2IGOA 5T41A 3WA6A 2Q5HA 1YLFA 4FZRA 1PTJC 3T34A 2X4HA 4B8ZA 3KK0A 3HJRA 3VJMA 1FVXA 1I0LA 1SOWA 3G0CA 2HF2A 3W6OA 4CCJA 2QM0A 2EW1A 4UOZA 3CBQA 3KTAA 2JRMA 4F4FA 5B36A 1LVUA 4OAYA 3HJHA 2WWTA 4UUSB 3E82A 4XX0A 3RFUA 3ZV7A 3B6MA 5CNJA 3D7LA 4XLLA 1TQHA 5A2GA 3GVAA 4J9UE 5I4IA 3FAKA 2IZOA 2JGMA 5I9TA 2XF8A 3ZC3A 1Y7IA 3L2QA 4CF6A 3QOPA 4GECA 1MU0A 3SS7X 1U0RA 1Q0LA 3GP5A 1NQXA 1QVAA 4XD7D 4DM7A 1KO7A 2WNHA 2OBLA 4R0VA 4D43A 3BXEA 3N2NA 2EFEB 4UQPA 1KJQA 2B99A 4OAOA 4BDTA 1ORKA 3O8NA 1YDFA 1T4MA 1E89A 3WYNA 2A5FA 2XCSB 5BSWA 2AUNA 4IOMA 2KWIA 2O2JA 3IPLA 1KAOA 2WTEA 3BOSA 1EJBA 2CNLA 3OHMA 1GYRA 3AY7A 3X1YA 3OOHA 4NDLA 3T3EA 2WHRA 4QDTA 1UR5A 4Y1RB 1RWQA 1ZSNA 3GCZA 4ZYLA 1V54H 1WNTA 1F20A 2F9FA 2BE5F 4E31A 3G3EA 2HJHA 2Y31A 1PW5A 4RDCA 1YS2X 3C3KA 2VPXA 4JROA 1G4HA 2GAFA 1D2RA 2CJWB 1FRNA 3A6PC 2UUOA 1NRXA 1YAHA 5DX1A 3PDIB 1FUIA 4O2AA 1FBTA 3AUXA 4WNAB 4DJAA 3GF2A 1M5TA 2GK3A 3HOWJ 2WAYA 4EQQA 5K0TA 1FVHA 3LA2A 5F7OA 4MEYF 2V74B 1RRMA 3NW9A 2P2SA 3DGFC 1VSQA 3T9CA 3UWOA 1KEPA 1P1CA 1NR5A 4HQ6A 4KFSA 3ZDEA 1R1VA 2Z2SB 3AY3A 2H4XA 4V39A 4UHHA 4YO7A 1NONA 5K4AA 2QPTA 2YS9A 4BZZA 5E1MA 1HBJA 1KZYC 3M9XA 5EQTA 1IAWA 2CK3A 5IJ0A 4OWRB 1L4LA 3VPDA 5EINA 5BSHA 4CMBA 3P5JA 1GZVA 3PL5A 1Y1LA 1B7GO 1U8TA 4YI5A 1QC5A 2Z99A 2PMDA 1WPRA 5ICFA 2CQKA 1PG0A 4N0EA 1IG0A 2WYVA 4DDKA 5HLGA 3HYCA 2L4MA 1YS6A 5LOVB 2B4AA 1K9SA 1EPUA 2KSQA 3NHPA 1W5CC 2BEKA 3IP3A 2A1TS 2NPIA 3TW8B 1SAYA 2HXOA 4NH4A 2OO7A 4A27A 1C9EA 5C4JJ 4HVLA 4WK2B 2COUA 2ORED 1XX5A 3CR8A 3TEJA 2KMUA 4OMCA 3GEIA 3ZDDA 4BJ3A 3HJUA 2C59A 4UM9D 2PR7A 3UWPA 1EFHA 3FWNA 1DJQA 1KOJA 4O4LB 4CLXA 1HSZA 1XSDA 1YL7A 1PFUA 3JQQA 2PS9A 3GBVA 4LZNA 4C6HA 1H85A 1WHTB 4B79A 4QYSA 3CPEA 1VQ1A 1J4AA 3QG5A 2YZKA 3BDDA 3S68A 2PX6A 5T8KA 1DHTA 2WU1A 3LX6A 3IV6A 3U3MA 2GA9A 3ZCVA 1L3LA 3D5EA 1Z7EA 4MQFA 1EVEA 3M3PA 5LFAA 1VBFA 1K06A 4UOQA 4CIBA 2BTOA 4AS3A 3S1RJ 1RVDA 4ZCIA 1AHHA 3DFUA 2FX5A 2RIRA 1LDGA 2O4CA 1IAVA 5AK0A 1NBHA 3OEWA 2Y0SN 2JLQA 3F78A 4O2RA 3WS7A 1HDOA 3OLVA 4MUFA 1UBRS 2GILA 2GWHA 4W99A 4BC1A 4P5EA 1ID8A 1K08A 1YE8A 3HB5X 4OFXA 3KZYA 1NXTA 2VTKA 3LAJA 2JCGA 2K9SA 2RK6A 5F33A 1QKIA 5AI9A 2O1SA 2Q8NA 5EP2A 4L4ZA 3JWHA 1DCMA 1QCZA 1WXWA 1T8TA 4JC8A 2ZIZA 3LLMA 3WLAA 4TN1A 3IODA 2KBEA 5AXCA 1D1CA 2XASA 2OHXA 4L7QA 3ZBPA 5J2TF 1RPJA 2CMKA 1Z5UA 3FHJA 2I3AA 2IBTA 4X60A 1HO3A 3GLHA 2JGNA 3VU1A 3STTA 3I39X 1CDEA 2VDUE 5IOZA 3MMZA 2DA3A 2DAPA 3Q10A 1IG7A 1OUMA 3W5HA 2H7XA 4A7PA 1NYQA 3TZCA 5H9VA 3DYVA 4N47A 1FFDA 121PA 4TL7A 2QGUA 2WJIA 2ZSBA 5EZYB 3RTRA 2P4EA 3A4YA 4ZODA 4IDHA 4HB3A 5JDCA 1WXFA 2MYTA 4XEHA 3MCAA 4ND1A 2OZPA 5AW0A 2TSYB 1OTXA 3FZNA 1NU8A 1KEUA 2XBLA 5KSWB 3R60A 2QZJA 3G88A 3HZJA 1WWXA 2VPIA 1D2MA 2LF7A 2NO4A 4KQMA 3O9VA 1BMDA 3QUAA 1KAEA 1MN6A 2XRYA 5GM1A 2GHIA 4FONA 1BX3A 5BW5A 2ZROA 3GT4A 5JDIA 3TGLA 4LW8A 2DQRA 1F8YA 3IDZA 1NKVA 3G89A 2VYFA 3DHNA 1ZMBA 5JAZA 1U0FA 2DHCA 4V0KA 3ZWOA 1JQDA 2GBGA 3RWBA 3NOQA 3QPBA 1HNNA 4HT3B 4X54A 1RHJA 3FXQA 3ETCA 1AQIA 1QFXA 5HOQA 3OQ1A 5D6FA 3HZHA 1Y5LA 1JFSA 1UJ6A 4UVIA 1N0HA 5JAUA 3R3SA 1PGQA 1QRDA 1XZ8A 4Q7KA 2FNAA 1JLLB 3VO8A 2MABA 2PKQO 4LFCB 2YWDA 3H3JA 4J2TA 2QQ8A 3PT9A 4E7PA 5CT4A 2QN7A 4JFAA 4ZKDA 1UK8A 5ENVA 3NAMA 3WXMA 3OY7A 1Z5GA 2J09A 4CNQA 4U87A 1QGAA 2NNWB 3RPEA 4QWQA 1YJXA 2AFIB 2W6OA 1DIOB 4N03A 4HLQB 2V7FA 3DZDA 3EVBA 3GN2A 3R74A 1I3KA 1VRWA 1DKMA 4MKIA 3ZQGA 1U99A 2CVQA 3K6KA 4TKLA 3W4KA 2AK2A 4NNOA 2EKDA 4M87A 4Z7JA 5D4SA 1SQ0A 3E5NA 5TPWB 3OPYA 5BNFA 2I5PO 3NTUA 1GQ2A 1JLKA 4A0ZA 5HODA 1OMIA 4KHZA 1ZU5A 2M4KA 2OT3B 3UT5B 2F5VA 4Z4IA 1JG2A 4LG0B 3F1LA 4L8VA 2FN9A 2IU3A 2VLIA 3BQ9A 2WMDA 3RVNA 1U2RA 3K3PA 1WB6A 3W1VA 2JEOA 3ZNOA 5A4AA 1VE5A 4LQDA 4MGKR 3NJ4A 3HRIA 1J5EB 4V3BA 4OHUA 4D9NA 3IB3A 4ZOLB 1FOEB 5A0FA 2GBYA 2HXIA 5IP6A 3BTOA 4QQFA 3FK6A 4CR6A 1M3SA 1PKXA 3S1QJ 4MGIR 5JYCA 1RZ4A 1ZELA 3O2PE 3E9DA 2HU2A 2JIOA 4Q4JA 2FQ3A 1ZD3A 1PT7A 1E5VA 1EM8A 2Q1ZB 3GL9A 4K1LA 4CCKA 4UE6A 4EA7A 4UKDA 3N8GA 2PJUA 3PYLA 3WZMA 1X70A 5AJTA 4D9HA 4PYKA 2P3LA 4RTLA 3LQFA 1AT1A 5JOQA 4IM7A 2H8GA 3EIHA 3SJCA 1CRLA 5JLWA 2C7PA 3KZNA 4ZQBA 1WY5A 4G41A 2IQIA 4RADA 1JIUA 4IX9A 3ZDYB 1W4MA 4RKRA 2FWPA 4EPVA 3HBNA 3GU3A 4BLSA 1Y8QB 1S9HA 1G20A 3GLIB 4RHTA 1ICIA 3I1YA 3KSDO 5AW4A 1JV2B 1R8JA 2NUBA 3VUEA 1Z33A 3DB1A 4DTIA 2E5NA 2HTEA 4EM2A 1JHZA 1TO1E 4DG9A 1DEAA 4K6KA 3NOVA 4LDNA 1QLJA 4MZXA 4B40A 1I6WA 1C9NA 2EJWA 1GZSA 2J5XA 1U7DA 2BUCA 4IHYA 2C3UA 1ON2A 3T3DA 4DPKA 2XAHA 1NNLA 2XTZA 4HQMA 3LHIA 3FTEA 4OHBA 5KOJA 3A01A 1NJGA 4FDAA 3NLLA 4I55B 1Q7CA 3EZFA 3WK8A 1SKBA 3BGVA 3ZCTA 3W6JB 2WSSA 2ELHA 1U90A 1LU9A 2ATXA 3RSOA 1HT0A 3RHZA 2CDCA 2IS4A 4QPDA 2B8EA 4DV5B 4MWTA 3DT8A 4C20A 3E0XA 3ZV4A 1QB8A 4AG6A 4FMCF 5L3ZA 4GSLA 1Q77A 4B34A 1H5UA 3CZ9A 1UPXA 1N5OX 1OASA 3RAFC 2NV6A 3RSLA 1J0BA 3CUQC 3CLUC 2F8MA 1W6RA 4Z0NA 3HKEB 2C07A 3W9BA 3MTGA 3OURA 4XZ3A 5L4SA 3GK3A 4A92A 2OZEA 4AN0A 1N5LA 6YASA 3QU2A 2QR3A 1P3JA 3BWXA 5KNCH 3IJEB 4YI3A 1PD1A 1FU7A 3QGMA 2XECA 1FY2A 5LBIA 2NTNA 1U80A 3OCWA 1ZJWA 3WWCA 1X7XB 1AKUA 1BDMA 2VHWA 3PX3A 3VOBA 2JANA 4PLWA 4JUFA 4GDFA 3JRNA 1O5TA 2XNKA 3NO4A 1D0ZA 4CMGA 2RHHA 5DM2A 1MGOA 2ZAIA 1IMOA 5TR9A 2VO1A 3X2FA 2AHOA 2H0QA 1E60A 4BOYA 4HEJA 1D5VA 4B9EA 3L9FA 2NTEA 4BNXA 4LQCA 1UJMA 2W93A 4MKFA 2HPHA 2PNFA 2Q0QA 4G6QA 2L18A 1FU8A 4H6WA 4EO4A 2H4HA 1Y8RA 1IHOA 5K6AC 3KLOA 2G7UA 1XXHB 1JLRA 4G0WA 1DRJA 2R7LA 2R5ZA 4AG5A 1AQ6A 8ADHA 3W6NA 1GUDA 5LEKA 5J1RA 1XTKA 4FSDA 3GTPJ 1PO7A 4E2ZA 4NCXA 3DC2A 4YN3A 4EKNB 3A10A 1WULS 3AM4A 4XDYA 1UIMA 1XTQA 1AK2A 5I45A 2NTVA 1A7KA 4R05A 1ZM2A 3QF4A 3RBXA 2DEUA 2QUIA 2WWRA 2XGGA 1ZFNA 1PQWA 4NHEA 2Z1MA 3DF7A 2JUCA 1J9IA 5GV8A 4MQ9F 1HLVA 2A1UB 2IYFA 1D0YA 5TGTA 1CZOA 4TRRA 4YK7A 3ECOA 3ZY4A 4BV8A 5REQA 4NLLA 2MSYA 1HETA 4PHTA 1QO0A 2Q41A 5F27A 1G9TA 1KMMA 4UATA 5B6IA 1CY4A 3I4LA 1Y4DE 3CB2A 2XZTA 3IPXA 1RAIA 3OS1A 3F71A 2GJSA 3W5UA 4WWHA 5B3JC 3RT9A 2AUMA 2PQ8A 1WSAA 4XWTA 3JRXA 5GZ3A 4N40A 3RTDA 3TOSA 3AH8A 4KR7A 3B51X 3MA0A 4S1NA 1EJ6A 1MMFB 4MW4A 1E2LA 2PSDA 2CMDA 3PGMA 3PIDA 2BBWA 1G3UA 3PFKA 2W6PA 2ABWA 2QRLA 3HACA 4NXMB 4IXMA 2FMHA 1T5DX 1GNSA 4DKXA 3KXPA 4UHEA 2D62A 2AR0A 2PUHA 2PH5A 2H57A 4ZYVA 4M8SA 4JBLA 1QG4A 3D8HA 1JUPA 4QYXA 5M34A 1H1LA 4K8RB 3HMKA 4X92A 4KZKA 3B6ZA 3FPGA 1HE3A 1B9MA 4XM0A 1OZFA 4LMPA 1GNVA 1X7YB 1Y6IA 1GRNA 3OJFA 4DDWA 1W0JA 2ZKLA 4DR7B 1KY5A 1OISA 1U1IA 3FKIJ 1MIOA 3Q0IA 3T8TA 2QL7A 1T35A 3NVKI 3H5IA 1SXQA 4CFYA 3IP9A 1VKRA 2J9YB 3DZGA 5ILQA 1EH7A 4ZJYA 3HDGA 2XMCA 4FFBA 3JTGA 1L7QA 4CKCB 2JAWA 4AJOA 4A0SA 4L9RA 2GRJA 2HPVA 1OGYA 1RC9A 1JVBA 1B8NA 3SYRA 1A35A 4CEHA 2QVOA 2VRNA 4L02A 3PYXA 3IXLA 2FETA 4OTZA 1Y39A 3NV7A 1V16B 1TZMA 3DDNA 1G5RA 1I0ZA 3TUIC 3RIMA 2V7TA 1ISRA 1C3LA 4IZZA 2YWFA 2OWEA 4ZHQA 4HPJB 3F6CA 1LXCA 3KJEA 5CCDA 3TDMA 4CBVA 2LC2A 4YACA 1BAPA 4CQMA 4BJ5C 2PN1A 5H3HA 3UV3A 4YR7A 1EFKA 4JJ4A 2X86A 2X2PA 5CDUA 3RREA 3A0RB 3EHEA 2JBAA 3HL2A 4ZK6A 3N6RA 1LPAB 3IWFA 3G7UA 4Z1OA 1T1RA 1U9YA 5IDQA 3V1UA 2VJIA 4A8JB 2FSUA 1GR0A 1KZ7B 3D0KA 3M1LA 4AW9A 2RGXA 3LS2A 4EFNA 1U3DA 2FF7A 5B4UA 1P1RA 1TO6A 3BG6A 3LXXA 4ZHSA 4N8SA 4EQ6B 2Q9UA 1JAYA 4A3EJ 2ZSJA 3V8KA 4X1IB 3IUBA 4GEGA 2CW7A 2Q7XA 1JIQA 5EPOA 3QLJA 4NBLA 3W5CA 5M3FJ 2XUFA 1QHIA 1I5EA 3UK2A 1RM0A 3LDGA 1J9EA 1Z4QA 3HCAA 3TPFA 1ENHA 3H97A 3SHQA 1WVRA 4TGLA 5DHUA 3CLQA 1RWNA 5A2QZ 3I53A 4UHTA 1BFUA 1EWRA 2JA8J 5CPBA 3V4PB 3V55A 3UWMA 1MFZA 3VI3B 1VB5A 2L3DA 3AY6A 1V7CA 1OWOA 2EYQA 3L5OA 2X1DA 3LSJA 3VJLA 2UZ0A 1PGOA 1U2DC 3UB3A 3V3TA 2W2LA 1OYYA 3IUSA 3S27A 1N32B 2PZEA 1X87A 3TB4A 3DOJA 2JBHA 1MJGM 4LE1A 3I9V2 1G3SA 4CF3A 5TF4A 3LL4A 1TECE 2FPSA 1BZYA 3UJAA 4ONEA 2WM9B 1ESCA 1FSHA 1E1NA 2RB5A 1M7HA 3OE7A 4TQAA 3PJFA 3OFND 1OBCA 3JVVA 1NRIA 1K7FB 4Y6RA 2UXNA 4LGVA 3I6YA 5LUAA 3DVSX 3EF3A 4PVDA 4CH7A 1OU0A 2ME0A 5CA0B 5HDBB 2YHUA 3T3NA 4JYKA 4JLBA 3INGA 2WSYB 3WZ2A 2AEMA 1LFAA 3UIEA 1L0OC 2VJYA 2E35A 4MRSA 1QR2A 5E6RB 4E4RA 5FV7A 3P4YA 1ZLXA 1JRLA 3FXLA 2XV4S 3IRQA 1AQNA 1MC4A 3SXUB 4YTEA 3OPVA 4YRKA 3CX6A 4I2VA 1EBFA 2ZBGA 1TE2A 1B4DA 5CTAA 3FCOA 4TSRA 1AK1A 4KDEA 4L18B 5HBGA 4CLRB 4EATA 1R0ZA 3AETB 3QRWA 3RC2A 1FYLA 1IN4A 3OWOA 3FVVA 4ROTA 3RV3A 3P0RA 4RHEA 3P9IA 3FPJA 1HURA 5L3RA 1OLXA 1XKTA 1TEHA 5EWJB 1ZNYA 1XJWA 3L0OA 2JI4A 4YAGA 1FFCA 2FE3A 3AM5A 3ZWKA 3ESXA 3F6SA 4P84A 3Q6IA 3Q12A 2EIMH 2YKGA 2B35A 3H99A 1YTLA 6PAXA 1MDMA 3EGVA 3KVYA 2QGNA 1OX4A 2FOKA 4BE2A 3KJIA 3PDWA 1J23A 4B3AA 2ECKA 4CE6A 1OAKA 2LUOA 4A8PA 3HB4X 2Y75A 2JZCA 3FCCA 2BKVA 1W1WA 2B8JA 4OJNA 5FOXA 3UG6A 2ZUWA 3EE6A 2WJHA 1OLTA 3UA4A 3QVGA 5E9AA 1KVSA 3P9KA 4OYLA 2QE6A 3KCQA 2EOAA 3E03A 2XQGA 3H3FA 2ZWIA 3QPCA 3KPUA 4QGAA 5IYZB 5LZ4A 1VHDA 1L8LA 2IUFA 4V1CB 1ABBA 2RGEA 4MW5A 5E9QA 4IYRA 4IUCS 3BSWA 4TLCA 4GKJB 4G9YA 1N3IA 3K6GA 3NRJA 2ODQA 4P36A 4JGIA 1EHCA 1IRFA 4I3FA 3P8ZA 5IM4A 4FPXA 4YA6A 4TV8B 2ORVA 2XRZA 1IRGA 2V7GA 2ORWA 1KDTA 1O95A 1DUXC 1RRPA 2A14A 2OKGA 3DEHA 4DQLA 3CYFA 1MABB 2GPNA 3QVLA 2B83A 1WM1A 4PFJA 5ITZA 2E18A 5EMLA 4CIWA 3WYDA 4PLFA 2FOLA 1ZREA 1ORRA 2YJZA 1ZGCA 2RHMA 4W5WA 4XCXA 3E2PA 5B1BH 3V2IA 1D4OA 4U02A 1B0UA 1SURA 1P7JA 2AOTA 4XD2A 3A6JA 1NFFA 3H11B 3OUZA 5D5VB 2VAVA 1E61A 1ODIA 4F4HA 3EXIA 5DE3A 5BWBA 4KIFA 1NASA 2CEKA 2ID3A 2LDXA 1KAHA 3WHLA 1XA0A 2BY4A 1YB1A 4OEHA 3LQKA 1ZQ9A 2W11A 3CCQI 3OPXA 1JEQA 1T0FC 5AK4A 4MNUA 3DC7A 4CM5A 4BCCA 5BN3A 3GJZA 4MVJG 3RGGA 5TJJA 4H0FA 4C0HA 3H3XA 4GNRA 1QQTA 2AQFA 1GITA 3CTAA 2GAJA 1F17A 1YK0A 4CN9A 4PXSA 5CVJA 1V5WA 2FU5C 5TE9A 3ZW9A 4C04A 3L8EA 2NVXJ 3AEYA 3I45A 3LK6A 2XD9A 4QUGA 5BPDA 4KDRA 5AUOB 1FTTA 3ONEA 4AZSA 2OAGA 5HKAA 4E2XA 3EZ6A 3OMLA 1E66A 3K1NA 4AY2A 5FUQA 1GPH1 4M1KA 5I7AA 1VM6A 2TECE 1W36C 1K7AA 4BMXA 5JSYA 2NV0A 1FUEA 2I6TA 2GZ1A 1QAMA 3H5LA 2IGTA 2HRZA 1IK4A 1BEUB 4J03A 3I9FA 2GBCA 1ZM4A 1WSWA 2ZIGA 2JKZA 4A10A 2V3WA 2IX9A 3FM3A 3D0QA 1ETKA 3KPWA 2Q9AA 2PTGA 3EAQA 1PL7A 1KBQA 4LXUA 3NBAA 3OZEA 5AJUA 3ZJUA 1IPHA 2KX7A 5H1YA 4DLSA 1QGOA 4OKSA 1QTNA 3KUUA 5G0UA 1JKIA 1EWVA 2VXZA 1GIAA 3MUEA 1XLWA 1QIEA 4LOHA 4K9MA 3EOZA 1R66A 3RSHA 1DJMA 3CIFA 3OX3A 1E98A 3Q72A 4RC9A 3HKZA 1D6SA 4KQJA 3LWNA 1RLOA 1O4WA 1LRKA 4BNJA 2DP4E 3OZCA 4MV0A 1R6AA 1MXHA 3DEKA 3P9RA 4ZT5A 3MS7A 3L0SA 1LS1A 4XR6A 3KLPX 2CNDA 5BW4A 3TXXA 1WMEA 1TUBB 1SKUA 5GAJA 5BMVB 2XUJA 3JZFA 3DE6X 1U0SY 2QNIA 3URKA 4ZTJA 4QUKA 2HMYB 2FSVA 5L3QA 3NWJA 5TX7A 1EZ4A 2Z58A 2H18A 3QKWA 3H83A 2CFCA 1FBUA 4KQWA 3NHFA 3HWRA 3JR9A 3FBIB 1UC5B 1WUIS 5DI3A 4C30A 3L1PA 3AVWA 4Q9JA 4UMEA 1VPLA 3B1YA 2YCLA 2YOGA 4BQQA 1AKVA 3ED5A 3OZ7A 2P81A 5AIPA 2ZM6B 1FDOA 3IQDB 3PFFA 2K7LA 2WR8A 4QGSA 4S0XA 2IA1A 3L1IA 3STUA 3PPXA 1CUZA 2Q9BA 3ZX5A 4MVJF 4MVXA 1CUSA 4KXUA 4QUHA 2J07A 1PLLA 2P3OA 3ED1A 4U2KA 3K72B 2C04A 4RW0A 5H0IA 1AURA 1A9ZA 1O3SA 3LBYA 1M75A 4YJFB 5KYNA 3ZD6A 4U7TB 2EP7A 4IDQA 4IAOA 3PLAE 1W4RA 2OXEA 2ZJRF 3DT6A 5HG0A 3FJYA 3IH5A 2O2HA 2IXFA 3K9NA 3WGVA 4P33A 3TVTA 5B66C 2L17A 4P58A 4Y2PA 4QHSA 3VYSB 1K3FA 1L8AA 4AJJA 5DTJA 3JARB 5FFFA 3SX2A 3FOZA 1JJIA 5TSDA 4HW0A 1CQWA 5CDFE 2PE5A 5KVSA 1FQKA