5F64A

Putative positive transcription regulator (sensor evgs) from shigella flexneri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
204
Chain Sequence
AMNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Positive transcription regulator EvgA
publication title Putative positive transcription regulator (sensor EvgS) from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Transcription regulator
total genus 81
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f64A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f64A01
3QP5A 4UHTA 4P1ZA 5EWLB 4Z9AA 2ESHA 4L0ZB 3OLXA 1BDHA 3RJPA 2CHEA 3RVQA 1YQAA 3A0RB 2IVMA 3E6DA 3H3UA 4A5MA 1P6QA 4KK4A 1DPUA 1EWKA 3CUQC 1PUEE 3KP5A 2G7UA 3JY6A 2FMYA 4P5OA 3M9WA 3EULA 4MQEB 3DXJF 5TPZD 2YPRA 4IVNA 4Q48A 1ON2A 2L01A 2FMIA 3IRRA 4U0YA 2VUIB 1NXWA 3O2QB 1K78A 1BBYA 3KYIB 3RKXA 2DO7A 4EJOA 2PJUA 4KRFA 2IRFG 1Z7UA 2PLYA 1MZBA 2Z5UA 2K4JA 3B2NA 3H5WA 3V7SA 4DQDA 1DPRA 1BC7C 1U04A 2BBYA 3O6BB 1IRGA 3EGCA 3QLVC 3KLNA 2A3SA 3FMRA 3L9FA 3KFWX 1FP1D 3T8TA 4N9HA 1Z9CA 3EODA 3HHGA 2WWYA 1QP7A 4LG0A 2UZKA 2NZUG 1ZAYA 2JPBA 2DU9A 1ZDMA 1K79A 2FEZA 2IT0A 2FEKA 3FFXA 3F21A 1B59A 1B6AA 1MJAA 5E3JA 1OXBB 3F6OA 5D6EA 2PUDA 2FMLA 3HYIA 2GXGA 2B0LA 2L54A 3KLOA 3W9SA 4EGYA 4KDPA 2X7XA 4RY8A 2LUOA 1WWXA 1LEBA 2I6FA 1UHMA 1XMAA 1P6RA 5A2QZ 2HYGD 2W85A 4MNUA 4EYOA 2IOYA 4RXMA 1S3JA 3KG2A 1Z6RA 2LP4Y 3O74A 2VYCA 3S2WA 5IT3A 1FBUA 4HW0A 1YW8A 2OBPA 1PP8F 4WCGA 2E1CA 5CNMA 4JB0A 4W5QA 5JS1A 2VT2A 3I42A 3KEOA 1YIOA 3GV0A 2JRLA 3H1EA 2V1DA 3JTEA 1M2EA 5E1XA 2VODA 4DNCA 3DFGA 4G94A 2PBIA 2KJBA 3CG0A 1EH8A 2E7XA 1TQMA 5LGTA 1YYVA 1BI0A 5BR1A 3S99A 3SZPA 1ZYRF 1GXQA 4MPTA 1XCVA 5KVRA 4YP9A 5HS8A 1BDIA 3FZVA 3M1EA 2XDYA 3KP3A 4U7BA 2PMUA 4ZPJA 5JFRA 2A9PA 4Z4GA 3HTUA 3LAPA 3N0XA 3U1DA 4AD9A 1YMVA 1J56A 4WXMA 1HSTA 1ODDA 1F51E 2IPQX 3TOBA 5E20A 3CHYA 3DZDA 1H9CA 4IPAA 3WODF 4PICA 1KA8A 3HV2A 4IGAA 4EVSA 4PZJA 2FEPA 3A3KA 1S8NA 1CYEA 1VPWA 2PG4A 1O57A 1ZY2A 1X3UA 2EB7A 2QYOA 3WTZA 3QLUA 5EWJA 2NAZA 2YX7A 1FT9A 4NCAA 3IHUA 4I2OA 3MQ4A 2O0YA 3GBPA 4RAYA 1XCBA 3RYPA 1T38A 4ASNA 4ON0A 1S7OA 2AXLA 1BM9A 4Z2YA 2ZFWA 4M72A 4Q6BA 1B9NA 2DW4A 2BEOA 3Q9VA 4YLEA 5DEQA 2R48A 3V4GA 5LGUA 3L2CA 4ENJA 3WU0A 3R6SA 3T0YA 2JBAB 1LDKB 4JASB 5AIQA 3EYIA 1TBXA 3K9TA 1MIHA 2WC2A 1E2BA 2WRZA 3KYJB 4HLXA 1TMYA 1KRXA 3ML6A 2RV8A 2MYUA 3NBMA 2DT5A 1DUXC 3HEBA 3MAJA 4HLYA 1Z17A 2JVIA 2JB9A 4H60A 1ZH2A 1B00A 2W84A 4G0MA 3HOTA 2WMYA 1U8RA 4UVBA 4MEYF 3NNNA 4HX4A 4E7OA 2QENA 3RYRA 4PGHA 4K2EA 1XSXA 3WTSC 1BOAA 1YLFA 1MKMA 3TX6A 2PKXA 4G0ZA 2BGGA 2W42A 1XD7A 2VUHB 3DKWA 4R1HA 1E6LA 1L3LA 3HJFA 3V8LA 1TVMA 3GT7A 5C5EA 2Y48A 1B9MA 4N76A 1J7KA 4G0OA 5E8GA 2A5YB 2EV0A 4OIOF 3GBVA 2JVKA 5A2QK 3N4MA 3F7NA 1IN8A 3GFIA 2HKOA 3OLYA 3K1PA 4U0VA 3N0WA 5EEHA 2DQLA 4IRGA 2PL1A 2RDMA 1ZRCA 3L7WA 2QBYA 2XAQA 2FQXA 4EY3A 3F8MA 3LUFA 1SAXA 1C0WA 3SG0A 1LEAA 2V1UA 3L49A 4RDCA 3UK0A 3RI4A 4LB6B 4YIFA 4IMIB 5TPWA 1USKA 5ERIA 2UXNA 1MJ9A 1T0FA 2YU3A 5ICFA 3LUAA 2BGCA 4CGZA 3DLHA 2M1BA 4EGZA 2NNYA 2LDUA 4OATA 2RDPA 5L3GA 2L4AA 4GYIA 1P8AA 4I7HA 1ISSA 3VEPA 1NY5A 3RVPA 3LUCA 3GRCA 4CXFA 2HQBA 4NV3A 3F6VA 3I71A 4WF2A 3KS9A 2OQGA 2NYXA 3OMWA 1R22A 3LSTA 4MLCA 5TQ2A 1K7AA 3NEUA 4ENMA 1D5WA 3QK7A 3H75A 1OYYA 4ETIA 3J7AO 3E5QA 3KE2A 2XAFA 4OBBA 4Y15A 2IW5A 1MVOA 4XSZF 3DQVC 1HXDA 5GOTA 5TQ0B 1RUOA 2Q2EA 2XRNA 3MZYA 1BA2A 1D1QA 3Q7SA 2F8SA 3F8NA 4I01A 2AYXA 4ZH4F 2DBBA 5L3FA 1PHRA 4EYGA 1QP4A 1YMUA 2V1XA 4G9YA 4CO8A 4G86A 3ECOA 3D02A 2MBFA 3GUDA 2ZWMA 1QO0D 2ID9A 3HCWA 4RY9A 1JE8A 4L18B 1TNTA 2P5VA 4F11A 1RI7A 2OZ6A 1L5ZA 3IWFA 1VTNC 5BQTA 5BMZA 3JVDA 2FA5A 4L9TA 3H5OA 5JVTA 1Z2DA 3RPUA 3P9IA 1IUYA 3JSOA 4WWCA 3O1IC 3H6HA 2M45A 4A0XA 4YG2F 3GEZA 1AWCA 2JK1A 3FHZA 2EFQA 2FNAA 1T39A 3TOAA 5CVRA 3QPTA 3D8UA 8ABPA 4O5AA 1FFWA 2FBKA 2YSRA 2KRFA 4DQ2A 3EQZA 4LE2A 2PUCA 4AIKA 1U5TA 1JHHA 1QQBA 1DCMA 5TJJA 2PL9A 4RU1A 4UXNA 2KIFA 1FSHA 1RZRD 1Q1HA 2XAHA 1BAPA 2N9UA 1SMTA 2K86A 4ZYLA 3BBLA 1P4XA 1M2FA 3RVOA 3IP6A 2NRAC 3KCCA 4RGXA 2CSOA 4G0PA 4KIBA 2XHKA 3OV8A 1C4WA 2FVYA 2ZBKA 3RQIA 4OMZA 5F1RA 2KJCA 2Y0MA 4MR8B 3O1JC 2FBHA 3JAMZ 4I02A 3JS5A 5L3EA 1CF7B 1VRVA 3MIZA 4EGSA 4YO7A 2YHBA 4TLLB 1DRJA 1EWVA 1Z18A 3FMSA 3MYYA 3H5IA 1LDJA 2RGYA 5TRDA 2O03A 2HDCA 1KU7A 4G0YA 5BOXA 1XMKA 2ZCWA 1S7AA 1DG9A 5AIPA 3Q5FA 3IDOA 1YTYA 2RJOA 2DPDA 4XXHA 3H92A 2V6CA 4F12A 2MH2A 2Z99A 3TO7A 3ZPLA 1I5ZA 2ZNYA 3EETA 2FRHA 3JPWA 3O75A 5ABPA 4N03A 4XLPF 2Q8KA 3ZN1A 4RK1A 5HS7A 3K4HA 1NXVA 3CNBA 4TV7A 3QELA 3ZN0A 2IPAB 1ULYA 1YTUA 4Q6WA 1K78B 3QEMA 3MQ0A 1IN7A 5JNSA 1KU3A 2OA4A 4WXEA 2A69F 5D5WB 5CVUA 1R58A 1ZARA 2O3FA 2A07F 2RNJA 3I0TA 3JTHA 3G73A 1A0OA 4EQQA 4IRIA 1D5VA 1AB5A 1ZLKA 2R7DA 3DGFC 2IPNA 2M5WA 4LJZF 5IEJA 3WGIA 2P4WA 2OENG 1IXRC 4UUVA 2H27A 4XARA 3SXYA 2JT1A 4RGUA 4NICA 2DRIA 1JH9A 1V3FA 1QPZA 1AB6A 1KYZA 3I53A 1TJYA 2RJNA 2G9WA 3CKMA 4Z4HA 3CTPA 6PAXA 5D4RA 5TQJA 2NNNA 1XN7A 3NHMA 3WTYC 1STZA 4I0AA 4LRQA 3DV8A 5KK1A 4RB3C 3KJXA 1ZG1A 4QYMA 3HM9A 3FM5A 5J8FA 3DBIA 2FF4A 4O6JA 1PNTA 4KPYA 4OLBA 4KA4A 1YVUA 1QZYA 3ILHA 2IYNA 5CVJA 1QNTA 2R7FA 4Y17A 1QBJA 4MAAA 3T5XA 3R4KA 1R7JA 3IP5A 2P6SA 3R60A 5TPZA 2GIVA 3NRVA 2CG4A 1SXHA 1HW1A 1O7FA 5DYMA 4P98A 1T34A 1R1UA 3SNKA 3DGEC 1PEAA 1WKMA 1GVJA 5DTEA 2VBWA 2BYVE 1FWZA 4FX4A 3HRSA 5IX8A 1JL3A 5LBQA 5ICEA 4WXDA 4M6YA 3FM3A 4N41A 1FPQA 1G3YA 1R00A 4KUMA 2MSLA 3P7NA 3FGZA 1ZVVA 4ESJA 1XGNA 1U2PA 1ZHHA 3F6PA 3RVMA 4ZYDA 4YFXF 1JHZA 2GA1A 4MEXF 2QSJA 2NT4A 1O3QA 4QLCU 1U2QA 3HUUA 4HYEA 1HBXG 3JAMK 3RVRA 3CFYA 1YK1A 4LE0A 5FD6A 1ISRA 1QGPA 1XSVA 3KP4A 2OQRA 5HM6A 1Z2EA 1SD5A 4M74A 1ON1A 4HAMA 3K0LA 5EWJB 3RVKA 2O61A 4DN6A 1LVAA 3ROFA 5BS6A 1BJAA 5FWYA 4HF1A 1R5HA 2WWVD 2HEOA 1W25A 2HJ9A 3N0RA 4WT7A 3QU6A 3ULQB 5TE9A 3NQOA 4CYDA 3LUJA 2CQKA 3U9GA 4ETMA 1FQWA 4EUKA 4A2UA 1IXCA 3V8JA 3FFTA 1D1PA 5FB2A 4HV5A 4Y9TA 1APBA 1UCRA 1ZRFA 2EA2A 1IIBA 1Y1LA 1DP7P 4JBAA 1BI1A 1G4DA 1HKTA 1U8TA 5IUKC 3IP7A 5GQSA 3SM9A 4ESBA 5D5XB 2WJWA 2IPMA 4KICA 2ZKZA 4RV5A 3RVSA 5JNVA 3C6QA 4KYWA 2HQOA 2XROA 1JFVA 3CU5A 3QEKA 1NXOA 4U88A 3WU1B 4KMRA 3HSEA 3KZZA 1D2AA 5IEBA 1OYWA 2QU7A 1JDNA 3IRQA 3OO1A 4ZMRA 4IRHA 2M30A 1YS7A 1NXSA 1YW9A 3GXOA 1E6MA 2MSWA 5DCLA 1NXPA 4Z4FA 1W5TA 3QOPA 3JW4A 3W6KB 5HVQC 3ZMZA 2VXZA 3ISPA 4A5NA 3RKWA 1FFGA 5K5RA 4RAZA 4ETSA 1TNSA 2WJAA 1RIOH 2ID7A 2FKAA 1KYWA 2R3SA 4HOBA 1Z26A 1QZZA 1T6SA 5H6QA 1TQPA 5AONA 1H0MA 3GYHX 4Z0NA 4M71A 2EK5A 1BI2A 3EDPA 2QBYB 3P9CA 3P9YA 5DD8A 3E3MA 3BRSA 1NTRA 2OU2A 4LB5A 2P8TA 5DV5A 1BDJA 4EMSA 1DCKA 3HSRA 3NNDA 2PUAA 2P4UA 5TPWB 4MTEA 4UV9A 3WTVC 4H3KB 3HSYA 4KK3A 4H0EA 3W6JB 2O6GE 3E97A 2CWEA 2XV4S 1FBSA 4RSMA 3OO0A 4TN5A 3F3XA 2X0LA 3VFZA 1K68A 1RUNA 1SD6A 1SXIA 4XRFA 1I3CA 4GPAA 4W5OA 2HSGA 1ZH5A 2STTA 2QLZA 3O1HB 3WG9A 4Q5SF 5D8LB 4WK8F 2FLKA 1W7PA 4YFKF 3C7JA 3ZMTA 3BPVA 2M8EA 4RS8A 3KCNA 2VE8A 2EFWA 2PMCA 5B3JC 2ISZA 2Q5CA 2PQ8A 5TQ2B 5E1WA 3GA5A 3CUQA 3KEQA 1I1GA 1DBPA 1YS6A 2P5KA 4CZZA 2EFOA 1IAWA 3LAJA 5HS9A 2H6BA 5IBQA 1H9TA 2W57A 1IN4A 5KQMA 3N53A 1TW2A 3FXUA 4A0ZA 5DCMA 1P4WA 2R47A 1O7LA 1IN5A 2O8XA 3TMYA 1E17A 5L3CA 3OM1A 3GVAA 5D6FA 3DLBA 2ZO4A 4TMYA 2OZUA 3TO6A 1VLZA 4LX8A 3KP6A 2RQPA 2XIGA 2ZAYA 3LKBA 1NATA 3QLVA 4HBLA 1WRJA 2QV0A 4IJAA 1J75A 2DQRA 3BY6A 2GWRA 2OAZA 2F8TA 2A61A 2B1JA 1OPCA 5LEKA 2L17A 5CLSA 3O2SB 3RTRA 1IZ1A 2QVOA 1LQ1A 3QX9A 2GXBA 5KQLA 4Z4EA 1ZH4A 3G85A 3I59A 4ENKA 2A6EF 3LFTA 1RXEA 4MRMA 2FQWA 1EFAA 2K02A 4WXHA 2M87A 1RNLA 3V8KA 4CICA 5LLQA 1O3SA 1J9IA 4MR9A 4F8JA 3WGGA 3ROUA 5FGMA 3O21A 1UFMA 4KMFA 3DF8A 1ZGJA 4LZLA 1U5TB 1ZAOA 2HR3A 5HQJA 4N9IA 1D8JA 4QICA 2HTJA 5BPIA 5FD5A 4A6EA 3RVLA 3QU3A 1YFHA 2K7LA 3CRNA 5FFZA 2F5CA 3FF5A 1LBIA 4YWHA 4UNOA 2PAFA 3T95A 1TTYA 1SFUA 3FDFA 3FWEA 3UKJA 4NCBA 4N0QA 3RIRA 5FLXK 4KZKA 3GLXA 1U3EM 3MEXA 2F2EA 4OIRF 3JSPA 1KQ0A 1OR7A 5KWSA 3LKVA 4IXAA 3TDUC 3I45A 2VC0A 2K27A 4OMYA 4A6DA 5T7BA 1JBEA 3DPTA 3E5UA 2M98A 1IN6A 2W25A 3GL9A 4PYRA 1JGSA 4L0YB 2PUFA 3CG4A 3EQLF 4P9UA 2QUFA 3O3KA 5CVVA 4KMUX 3H6GA 2FN8A 2VC1A 4JA2A 3V7RA 1HEYA 3GZ6A 5LEJA 3E6MA 1USGA 2R25B 4RXUA 4EVRA 3NHZA 1FX7A 2XAGA 5HOOA 1LJLA 1USIA 5IC5A 1JXSA 1BIBA 2P6TA 2NT3A 3FMQA 4ZZDA 3BJOA 1EV7A 4ETNA 3SQNA 1XHEA 1W4MA 2E4ZA 3T8RA 3QELB 4HF0A 4P96A 1QKKA 4L9JA 3QEMB 1Z6TA 1TW3A 2A6HF 1CGPA 5D5VB 4Z4CA 3Q15C 1YO5C 4MS3A 3LA7A 1JF8A 5ILSA 1CEYA 2LNBA 4EM1A 2GBPA 4LE1A 2ESNA 5CNJA 3GW2A 1J2XA 4LFUA 4QYWA 4P55A 2AS5F 3RKYA 5HDNA 6CHYA 3F72A 3IPCA 4JB2A 5HKOA 3C3WA 5IT9Z 1OKRA 1XDSA 3K2ZA 3EDCA 3SY8A 3LTEA 2IPLA 4HX7A 3KP7A 1XSDA 4B09A 5F6FA 3CZCA 3A10A 5J6XA 4MR7A 1JHFA 1SFEA 5KI6A 1TM2A 2RN7A 4ZYEA 2P7VB 4Z9BA 5JNWA 3BRQA 2FQ3A 3MZHA 2WB4A 1BC8C 4F7ZA 3R61A 4B8XA 4RB1A 3BWGA 2YR2A 5CYVA 3ZMVA 1ZG5A 2IA2A 1SRRA 5EWMA 3BPXA 1NXTA 4MQ9F 1ZGGA 3LQRA 5K5OA 5DUKA 4LDZA 5LHIA 5HLHA 3F8BA 1HW5A 1ZGZA 3OMXA 5HLGA 1MAVA 3QPHA 1FFSA 2LF8A 4ESFA 1YG2A 4LK0F 5BPDA 5FWXA 4EJTA 2DPUA 4FE4A 2V9VA 1J5YA 2L19A 1HKQA 2VK2A 2L2QA 4ZZLA 5ILUA 4PDKA 4BXUA 3DPLC 2D1HA 2FXIA 4OTZA 3LQQA 1PEYA 1ZESA 3H1FA 4D74A 1XGOA 4HF2A 4AIJA 4AVPA 2STWA 1Z15A 4ZJPA 3EYYA 3J80K 1YK0A 2V79A 4UVCA 3EQ2A 4RB0A 1R36A 1BIAA 5E1ZB 2MYTA 1PDNC 2MD5A 2E4UA 4L5IA 1O3TA 3LWFA 2JCGA 3ILYA 1W9HA 4L9NA 4IHSA 4RGRA 3WE2A 1Z1DA 1FSPA 1DJMA 3QP6A 2W24A 4WUTA 1G3TA 2JVJA 3KTOA 2E4VA 4EM2A 2PMHA 4KFCA 2ZMEA 5H6RA 5D5UB 5KC8A 3GYBA 5H20A 5DUIA 1QMPA 4KN7X 3ZQ7A 3U2RA 5FO5A 2A9QA 3RPQA 5FWYB 4W5TA 5DCFA 1P2FA 5DGCA 4U7DA 3IP9A 4XLNF 3O2PE 5DKFA 2VE9A 5JNTA 1EH6A 1OYIA 4G97A 4N47A 2PI0A 1T98A 1QQIA 5F64A 3L09A 4LG0B 3HOSA 4JQFA 1AOYA 3T1BA 5CVIA 2CGPA 3H5LA 2GQQA 5DD4A 2CHFA 4LK1F 2VBXA 3GWZA 5LHGA 2E4WA 3LOPA 2E4XA 4LD5A 5BRJA 4AWXB 2RVCA 2FN9A 4OOIA 3GFMA 1O3RA 4PEVA 1ZGAA 3OOPA 1KQ9A 2FEWB 4HNRA 2GKGA 3E6BA 3I58A 4Q4ZF 1REPC 2ETHA 3RDIA 2G7HA 2Q0OA 3ELKA 2HWVA 2WV0A 2QQ9A 3LFKA 2ZJ2A 5E8IA 4RS3A 4G6QA 4ML3A 1KU9A 5E17F 3BZ6A 3QRFF 3CDHA 4MGEA 1QNLA 4WWHA 2QQBA 3F22A 1EWTA 4UV8A 3H5VA 2J48A 1UHWA 1SMYF 4I0BA 4LMYA 3QLUC 3DEUA 3JPYA 1NXXA 4RZSA 2D45A 5IT9K 3HDGA 1MDMA 4D6XA 3IKTA 2FU4A 3I09A 3A0UA 4ZYGA 1GCAA 1MB0A 2FXAA 2CWDA 4M6XA 3CLKA 1FP2A 1FYKA 3F8FA 4RK5A 3BILA 2FOKA 4RK6A 1EAYA 4O3MA 5HSGA 4MS1A 2GAUA 4W5RA 1H9GA 1U6GA 3BP8A 3Q7TA 4A12A 3CTAA 1P4AA 3GZ5A 4RK7A 1WI9A 4LLGF 1FC3A 1DC8A 2FSWA 1VKRA 4JP1A 1JYFA 4G7OF 1MB3A 3HUGA 1F5TA 1JLKA 4O1HA 5D2CA 3BROA 2ACJA 5LHHA 2A9OA 2IKSA 5HDKA 3KSMA 2CO5A 4KIGA 4JOQA 3N97A 1HQCA 1ABEA 1DDNA 1CHNA 4WXCA 3JTGA 3M9AA 1EH7A 1TQIA 3BREA 5LRSA 4I98B 1KGSA 2QW1A 3PQJA 3LMKA 1NHAA 1ONVA 2QVGA 5IULC 3WTTC 4OIQF 2NS0A 2HPHA 3C97A 1XB4A 4HQMA 1PNRA 5CNIA 4MQFA 2QZJA 3KHTA 1W7PB 2PUGA 1TLFA 2EJRA 3TGNA 3E61A 3GFJA 1V4RA 3HK2A 3ABUA 3D0SA 2QM3A 2FTKE 5HLIA 2PUEA 4MS4A 3WGHA 5D4SA 4JAVC 3OM0A 3O2JA 3CUQB 1F9NA 1XGSA 5ICCA 4IF4A 1U78A 2HS5A 2WTEA 1Z25A 4EVIA 2O20A 1FOKA 1KMIY 2GI4A 3VNAA 2FNPA 3F23A 2GZWA 4LLNA 1A2OA 2HOEA 3M8FA 4L5JA 1R5GA 3D5LA 5DCMB 4FX0A 3LA2A 1L0OC 2M1ZA 4NQWA 4KNYA 3K9CA 3HIFA 3DP7A 3HZHA 5JR3A 3TO5A 1KU2A 2PN6A 4WX9A 1UDRA 3KKEA 4IILA 2F5DA 3FXRA 3C3MA 4RXTA 5JNUA 3ZMSA 5DLEA 2RKHA 2PUBA 4G7HF 1K6OA 5EWLA 4OIPF 2DTRA 2LBPA 1ZITA 2IDMA 4OU0A 3OQNA 1BVHA 1URPA 4XSXF 4KQCA 3LUKA 4RK0A 2QQAA 2DK8A 3I5AA 5BRAA 4KVFA 4RKRA 3N8IA 4O1IA 2KIMA 1IXSB 1Z16A 1GXPA 4MLDA 2HFHA 3ZP5A 3RVNA 1Z05A 2L3DA 2FBIA 3OLZA 3CS3A 1G6NA 5FLXZ 1LNWA 2HGCA 2MC3A 2FSPA 3KP2A 5JNRA 4GCVA 1DBWA 5DDGA 1WSUA 1HKSA 4MQEA 3I59B 3PQKA 1JX6A 2JSCA 4DADA 1FY7A 4MRMB 1QQAA 2YX4A 1DP4A 2NZVG 2V0NA 1LJ9A 3SZTA 1ABFA 2P5LC 2BV6A 2HQNA 1F4KA 4P9FA 4LGWA 4MR9B 4YFNF 2ZNZA 3C3KA 1D8KA 3F73A 1S6LA 4YIIA 2MA3A 2YHAA 4M9ZA 2FE3A 3EUHA 4F06A 3CJNA 3KETA 3Q9SA 4KV7A 1LDDA 2HTSA 1GUDA 4XAQA 1LK0A 2BE5F 3P9KA 3QAHA 4I09A 5JHUA 2XASA 2QZ8A 2H09A 1Z91A 2VBZA 3UUGA 2LIVA 4HZFA 2EFNA 2MLGA 1U0SY 2ELHA 1B4AA 1IF1A 4IRXA 5ED4A 3ZMDA 1LB2A 2FW0A 3CLOA 4YGXB 2A68F 4H3HB 2DI3A 4L9VA 4NB5A 3IPAA 4MQVA 4BQAA 2OD5A 1K66A 5KC9A 4MHGA 3VODA 2DAOA 2FMHA 4Z4IA 1Z13A 5BQ3A 2ZXJA 3WTWC 2VOOA 4ZMSA 4S04A 4FT8A 4G6DA 1OXKB 2H94A 2PEXA 3SFZA 9ABPA 4RGSA 2JPCA 1JDPA 3TB6A 4FHTA 3MFKA 3FFWA 1ZHFA 3ABTA 1U5TC 3MF4A 2IP2A 2F5FA 4R79A 3G3ZA 2L4MA 1GCGA 2E7WA 3N6VA 4LDAA 1ZRDA 5CHYA 1W7PD 4EM0B 3TQNA 4IHTA 1GLGA 1DCFA 2QR3A 2Y75A 2AYZA 4EYKA 1DZ3A 1QP0A 4HDVA 1LBHA 4GYGA 4S05A 3F6CA 3ECHA 4BAYA 4RKQA 4G0XA 3WTUC 1U2WA 2HZTA 2D2WA 4ENNA 4MS3B 5FFXA 3R0JA 4HDUA 3OLVA 4M73A 1D4ZA 3K1MA 2TMYA 2XAJA 3MWMA 3QX8A 5IUNC 4JK1X 2HKXA 3L6UA 5LGNA 4MTDA 2R4QA 3BJAA 2HQRA 3V7CA 4HNSA 2VBYA 2IJLA 4M9XA 2H6CA 4FB4A 1IW7F 2RGVA 3MM4A 2E4YA 4YV7A 5C5CA 3C1DA 5CJ9A 2EA4A 2WY2D 4UHJA 3WE3A 4HV6A 4BH9A 1J0RA 3HXMA 3H1GA 3FX3A 3MA0A 2KIUA 3QLTA 3M9XA 3OQOA 1S29A 2DFIA 1OMIA 3MCZA 2P9HA 4MR7B 2UXXA 5LRRA 1XHFA 3GX4X 4HQEA 4G8XA 4M88A 3BOQA 2EWNA 1QPMA 4EJUA 1MD0A 2FQYA 3J80Z 3R0AA 1FYLA 1E6KA 4UVAA 1ZREA 4YR7A 2JTVA 1WETA 2FLWA 1P92A 4YRZA 5D8KB 5EWMB 2MSKA 1YW7A 2LSOA 3FXQA 3HUTA 1SD7A 2XVCA 1T2KA 4EJWA 1QO0A 4RB2C 1HSJA 2JBAA 2QVCA 4PGGA 3OQMA 1MJBA 4G0QA 1C0EA 4F3TA 1RXIA 3NNSA 1XDUA 3M6MD 5HDGA 4R8HA 5EEGA 5FWXB 2Z9OA 4OINF 4HNQA 3SAJA 3HRMA 5ICGA 4XLTA 3GO5A 1J59A 1F1ZA 5FBKA 2IA0A 3I4PA 2CD7A 5I4CA 4WZZA 2VT3A 4BHCA 4HA8A 3CUOA 4L85A 4PE5B 3HTSB 3E5XA 4Q47A 3COAC 3ROTA 3IWZA 1FSEA 3ERED 2VOPA 4CHUA 1SXGA 4BHBA 2JRTA 2XKOA 3FMVA 2P7CB 1SD4A 4OLAA 5K5QA 3LUHA 1R1VA 4EV0A 3CO6C 2PJPA 5FBHA 3T38A 2LF7A 1ZG3A 5CNKA 2A9RA 4E7PA 4D0PA 3CZ5A 1RZRA 3E6CC 2ZMEB 2EFPA 5B3JA 4G7ZF 1FYMA 1E2XA 6ABPA 2X4HA 4A0YA 3IKVA 4RY0A 1BI3A 4Z99A 3VOEA 2EV6A 2GA2A 2C6YA 2L02A 3EJWA 2H3HA 3VNBA 4NQRA 4GO1A 5J8CA 3H5TA 2JZYA 2QXYA 1Z12A 2KKOA 1R1TA 3M7GA 3J81Z 1JFSA 4BYYA 3HRTA 2ISYA 2MH9A 1DBQA 4N0BA 3I54A 4M9SA 3I5UA 3BDDA 1SFXA 4MYRA 3SHFA 3TDZC 2FMFA 3RVJA 3L00A 1FNNA 1PUXA 3TKYA 1RZ4A 1WQ2A 3T8YA 3TD9A 2J5PA 2MLKA 1FZPB 3WTXC 4KREA 1Y0UA 3K69A 3CO7C 1KQ8A 4QWQA 3OLWA 2FMKA 1D3YA 4EYQA 2E1NA 1G3WA 7ABPA 2Z33A 3B73A 3IC7A 1GUBA 5T3YA 1MDMB 3K1NA 1MGTA 4NHJA 2H0AA 4FE7A 2XGXA 2MYNA 4OG2A 4L4UA 1BN5A 3LUGA 3HRUA 3RH0A 3E3VA 4RWEA 1ZN2A 3B02A 3PFIA 2TDXA 4EJVA 2PE5A 2KYRA 2K4BA 4YS6A 2CW0F 2CYYA 4ZYHA 2MYPA 1GHCA 2DLLA 1W5SA 1G3SA 5JS2A 3HS3A 1P6UA 4BHPA 4MS1B 5TQ0A 2Z3YA 1USTA 1F4VA 4GNRA 5KQGA 1A04A 2VONA 1TLHB 1RPJA 4PZ0A 2LPMA 2ADUA 4XFKA 1I6XA 5JI6A 2NUBA 4IMJB 4QPJC 4YCSA 3LUDA 3GWGA 1DC7A 1IRFA 2RC4A 4EVQA 3VB2A 5E18F 5ILVA 4E70A 2COMA 4U0WA 1FBQA 5L3BA 2GX6A 4PCQA 1JWLA 4N0PA 1LJUA 5L3DA 3HSFA 2D1VA 4RK4A 5IUJC 2CFXA 1R8JA 3LA3A 3REOA 1JFTA 3HHHA 3Q7RA 1R23A 4Q7EA 2PLNA 3ZMUA 3JVIA 1XGMA 4O5VA 3IL2A 5K1YA 4UHKA 4MQFB 1HW2A 4KIFA 4GXOA 3C18A 2PFBA 3Q41A 4XASA 2XUBA 1M5UA 5PNTA 3URMA 3KZYA 1I1SA 3HDVA 2F5EA 3T6KA 2DK5A 4CDGA 1DRKA 4MS4B 4GGGA 4KQ9A 4BNCA 4KT5C 2UWMA 1XWWA 4W5NA 3AAFA 3EAFA 4TLMB 1M5TA 4Y13A 2XKPA 5KQPA 3HO1A 3H3ZA 4D6YA 4AIHA 2VN2A 2B4AA 4MGRA 3I64A 4HX8A 4KN4X 3HVRA 3F8CA 2L18A 2QWWA 1PP7U 1ZLJA 1USSA 1JYEA 4LLLA 3MMNA 1L5YA 1I27A 3GF2A 3G1WA 4MR8A 3BJ6A 3TO9A 2EV5A 4XBFA 1FLIA 3J81K 1CF7A 4CBVA 1KRWA 1B1BA 2J5OA 1EHCA 3M8EA 1UB9A 2IA1A 3N75A 2HYFA 2LKPA 3GFLA
chains in the Genus database with same CATH superfamily
1QHHD 3QQPA 2X0RA 3GOQA 3ZK9A 2JN6A 3U62A 3O8DA 3OLXA 4B85A 3VHRA 2HY7A 1HG0A 4C05A 3A0RB 3OQJA 3DMDA 3JQAD 1P3DA 1PUEE 2FMYA 3C16C 1U2DC 2JLXA 3BXXA 1Z62A 4EDHA 1FDUA 1ECGA 2XUFA 3N2KA 4YBZA 2C84A 1U0OC 2QRVA 4WASA 4AMZA 1IPFA 4HTAA 4W63A 2PJUA 3G9QA 4WH0A 4R9VA 2GM3A 1RM3A 3RT7A 2JAPA 1S7CA 1XU9A 1G63A 5D7BA 3LWZA 2QTGA 4J75A 3KQTA 4DTIA 1T0PA 1OZGA 3L92A 3T8TA 2JIDA 5LB2A 4OJTA 2WG1A 5BWLA 3VO1A 3G6WA 2G09A 1X3WB 3GRRA 4D9HA 5JMOA 1S2DA 3CMCO 2UUAB 3F6OA 3PJEA 5KYXA 4D7MA 1P6RA 3RZOJ 2EATA 1ZZEA 3I2FA 5ALRA 1RTKA 5IAEA 1KI2A 1Z21A 3BIJA 1FU8A 2OC9A 4QU9A 4U4AA 4UPDA 1DUIA 3KL2A 2NP6A 2W90A 3JAMA 5AW8A 2VT2A 3JTEA 2VKEA 5E1XA 1BE0A 1LDEA 5I7EA 3LCVB 2C9MA 2O2XA 3T7JA 4Z3KA 3MOSA 4D3XA 4DXHA 2PXHA 2C94A 3OEWA 4TL6A 4BFUA 3U1DA 4QELA 5A3SA 1O1YA 3KXDA 5BSMA 3JWIA 3CHYA 3DZDA 3IXQA 5HKLA 3E7WA 3EIOA 3PGA1 2PLWA 1PR9A 1QU2A 4LMAA 1N9GB 3OQIB 4CKCA 4IV0A 1THZA 2ZTVA 4FUQA 2ONJA 4YHBA 5F1JA 3BG3A 3AERB 1B9NA 2BEOA 5HCNA 3OH8A 2HR1A 1VDMA 4TWZA 1Z4IA 3VPRA 4YROA 1AHDP 3TOXA 3GP5A 1KRXA 1SKAA 1V8ZA 2YY7A 4LV6A 3LSHA 2DT5A 5JWHA 4HEA2 4MITA 3HEBA 3O8BA 1V95A 2JB9A 4Q9AA 4XD7D 3PI6A 4GZ6A 4PNEA 5FPYA 2ZBVA 3QVTA 3JZIA 1NR7A 3WP0A 2WLTA 4NG4A 1D6MA 1IBRA 2YWDA 2JGFA 4UHBA 4LZOA 1SUAA 2ZUSA 2IYSA 2GCOA 3Q87B 4YMLA 5GONF 4Q1EA 4MGHA 4X0GA 3V1NA 1VCOA 1P19A 1BXGA 4TS4A 1MJFA 2V7EA 5CG1A 2EZKA 1G21A 2XAQA 3DO8A 3O3MB 5EXTA 4OQDA 3DVAB 2BT4A 2BL4A 3C5CA 4Q39A 5GVSA 1X8KA 3BHJA 1VMAA 1QHXA 1QZEA 3C3DA 1JQDA 1JN0A 5I4IA 1NPTO 4NV1A 2WD7A 4LVOA 5JYDA 3IURA 5D8DA 4DMGA 4ZI7A 4UFPA 1S3SA 3CNEA 1Z8HA 1IM2A 4E0BA 1O8BA 1K6XA 2A14A 1GTSA 2G72A 4MROA 1NNI1 1SUDA 2XHEA 1PU2A 1U63A 2C4HA 4NDNE 3NRCA 4LOLA 3MZYA 1D1QA 5BPHA 2GDZA 3LTNC 2NVWA 4AK9A 1I2CA 2PZBA 4EYGA 4RV4A 2XPCA 4X6YA 3EEBA 3ELBA 5CA1B 3FHLA 1KP2A 1ZJJA 1VKNA 3HCWA 1S2GA 1G17A 3K71B 4F11A 4J29A 4GP6A 3ROQA 4A5SA 1RI7A 3INGA 5LQCA 5SY6A 1ABBA 1UK6A 1SHUX 1QOQB 5TMEA 3CX7A 1LUAA 4C7OB 4DHWA 3RYHA 4H6VA 2WKRA 3ZD9A 2IXBA 3OE4A 3QM1A 1G20A 2MG4A 2C82A 4D6PA 2QZ9A 1E9SA 3RFXA 4F86A 1FSHA 3WIDA 1VMEA 1XXLA 4HDNB 3RVOA 3IT2A 3PGKA 4Y6OA 3KCCA 3W4JA 5F4ZA 4EF6A 1O6ZA 1MJGA 2XHKA 2Y0MA 1Q20A 2PRJA 3O1JC 3MIZA 4BO1A 1SIOA 4B8WA 4A2WA 1EWVA 3K6GA 3GLGE 1JV2B 2RGYA 1KU7A 4CLEA 1CE8A 3AEQB 1V8OA 2XB2A 1S7AA 1K8QA 3VR0A 1T5TA 3X1YA 4XXHA 4MGYR 1GGVA 1K4KA 3E2PA 1I5ZA 1NUTA 1YRLA 4F2DA 4FR5A 2CB9A 2PMKA 4GU5A 4Y2SA 4NBSA 3RBXA 2HLPA 3DB2A 5BSGA 4XRMA 1C8VB 1K8XB 4L57A 5JDCC 4LI0A 4HH3C 3HKZN 4PPYA 2BKVA 3T9FA 2R2AA 1JFFB 5TQVA 1Z2CA 2FRVA 4HVCA 1G7SA 1KXJA 1TLTA 3U6KA 3LSIA 3B3FA 3DGFC 4RPKA 5HFNA 3D6AA 3RSNA 1G6OA 4XARA 3FXJA 4QYSA 3V4FA 1ETHA 1QPZA 1EIWA 4Q66C 4C5BA 3VZBA 3ZC3A 1ETVA 2EKBA 1GYQA 3HVUA 4O4HB 3L8MA 3REFA 2BUBA 1XTBA 4RHEA 1QZYA 2WA2A 5TT1A 3KCQA 3DDWA 1ZN9A 2VDWB 1Q0RA 2CHQA 4Z7OB 5LIRA 2D4AA 1O7FA 3DBLA 5KYYA 3VPAA 3I6ZA 3IDFA 5CW1A 2PVPA 1PHPA 5IX8A 5GWXA 4DMRA 3QXJA 1FPQA 2MSLA 1SM4A 2CB0A 2XDQA 2PK3A 4OHOA 2CMGA 3Q9UA 4Q1CA 2BTEA 2WAEA 4KN9S 2C07A 5DF1A 1WZUA 1I2DA 1V71A 4LF7B 3IUQA 4FGZA 3CBQA 4PHCA 3JRGA 1ZSNA 3A4NA 2ZWVA 4LG3A 5A06A 3BG7A 3JQGA 2F3QA 1YGPA 4PLTA 2R5YA 4BZWA 1LVAA 1BJAA 5GTIC 2VYQA 3PVZA 4LF4B 4ZCQA 5B1EA 4GX1A 1H3EA 1CU1A 1VIVA 4ROSA 10MHA 1ZBQA 4M4SA 1N7GA 5JEDA 3U4HA 3MWDA 3O03A 4Y9TA 4TPKA 3KE8A 1DRWA 4BNYA 2IPMA 3RVSA 3O8QA 5F7OA 2V7GA 5KNCA 4IQGA 2XPUA 3GGJA 3QUTA 3AUUA 1VG9B 3T12A 2G17A 4IRHA 5J58A 2M30A 4ZO9A 2JQ7A 5BRNA 1Z0IA 1Q92A 2IU6A 1CDOA 3A70A 1OILA 3O73A 4PLZA 4WLEA 1P4RA 4FGLA 2SHKA 5L3VA 2HA2A 2IEKA 2VXBA 5IMBA 4B74A 2OUIA 3L7OA 2YYAA 5G02A 2C4WA 2FKAA 4BO5A 3JSXA 4ITRC 2DA1A 1OJLA 3K6SA 3P9CA 3S1AB 4JROA 1VIMA 2HZDA 3I01M 2CLSA 2D13A 2VWHA 2H1KA 3TMOA 4MTEA 1PFWA 2K2QB 1UL1X 4JYBA 1ZUIA 4P0TA 3FOAA 5HUJA 1N8KA 4XLEA 3JALA 2AC4A 3GFBA 4W5OA 1FBTA 2M9MA 1ZH5A 1JU3A 1SKQA 3K0CA 1O89A 2A9JA 2A5GA 5IJWA 4B2PA 4Q16A 1APLC 3DZFA 3HPRA 1IC6A 2LWIA 3LY9A 3H18A 3KQOA 1WB6A 4MFEA 3PHLA 5SYNA 2BJHA 4ENRA 3NTUA 3EA0A 3OX3A 2KRCA 5J1TB 2PIDA 5CAEB 4UC0A 2BXYA 3QFCA 1YRNA 4UUTA 4A0ZA 5DCMA 3Q0IA 3IT1A 4OB8A 4LV8B 2OCCH 1FY2A 5D6FA 3D0KA 1PZXA 4JKYA 3FPJA 3N8NA 5BN4A 2JLBA 3GRKA 3WLNA 5FRDA 4FDTA 5JTTA 5H70A 2BR4A 2EU8A 1PG0A 1BZYA 3PC6A 1FVFA 1UMCB 1UPXA 3EXFB 4PJ0C 3PT5A 2WPDD 2DT7B 4OXQA 5BNIA 2G1PA 4KTVE 2FK7A 2VTKA 1UMBB 1RXEA 3OZVA 2QD5A 1NJGA 4MNTA 4RVCA 1HX7A 3JQFA 1OXMA 3ISTA 4XJXA 3KAQA 5HW0A 4C6TA 1OUMA 1L0BA 2JFWA 1I39A 1TMGE 2B63J 3RVLA 3BN3A 1DCTA 2O2HA 3FF5A 4LVUA 4JP2A 4BPBA 4Z9YA 5BWOA 2YYYA 1FTZA 4DUGA 5EVJA 1MC8A 4IDPA 3TBIA 4EFDA 2NO5A 3GU3A 5KWSA 5HTKA 2AX4A 2BISA 2W6CX 4WCDA 3ESCA 3OPYI 3SK0A 1BQ3A 1JQJC 1XFAA 2FE4A 3RKSA 5DNWA 2OVBA 3MJHA 3D2BA 3EXEA 1IY0A 4RXUA 3CZRA 4DREA 4BQEA 2NU7B 2R5NA 2Q1ZB 2QZSA 4HQRA 1H1LB 4M3FA 1EG7A 4QFBA 3FF4A 4WY2A 3M6WA 5EP1A 1Z45A 3K0KA 2QZPA 4PSWA 1U3GA 3ONEA 3HB9A 5AVXA 2BI4A 3LSMA 5JG7A 4U00A 1AMOA 1V5GA 3OOWA 3G2OA 1PJ3A 2GN6A 4M46A 1ZR2A 3UWPA 4JCCA 3TZKA 2ZJOA 4DIUA 5E0OA 3LTEA 4I4TB 1P7JA 4YRBA 4TWAA 3UCFA 4L27A 5FOUA 3DC7A 4KOAA 3O5AA 1JZQA 4Y2UA 2D0OB 2IY7A 4BU0A 1LLFA 3W3CA 3ENWA 2D00A 1SHZA 4BKOA 3B6ZA 1CUGA 2QLJA 5CYVA 3DEJA 1IBCA 5HLGA 4NXNB 2HPZA 3EZNA 3LKZA 1VG0B 4UHDA 2PX0A 2DEUA 1FTNA 3IVMA 4BXUA 1PEYA 4ATNA 3RBZA 1EVJA 1BHSA 1C1YA 1I2AA 1T1RA 1A7KA 1W19A 5FULA 4UVCA 1CWUA 4L5IA 2XDWA 1CW2B 3W5DA 4QC2A 3HU3A 2JVJA 4FJ1A 4WZBB 3RHFA 3I62A 1P1IA 2JGJA 5EHZA 1J0BA 5IN5A 4TRNA 4I5EA 1GZ5A 1UQRA 5JCJA 3WK7A 4DLAA 4OUDB 4EAAA 1L5QA 2JGDA 5F64A 4ZVUA 3PKJA 2Q41A 3H5LA 2XDAA 1MBKA 4FFBA 1XNRB 1NBMA 4RTSA 2GKGA 3TCXB 2BFFA 4KO2S 2HWVA 2Q6KA 1B41A 1NTOA 2RGGA 4F8EA 3QFHA 4ZKDA 2GO1A 2RHMA 4TYQA 4ARUA 3SZLA 1O4VA 3GAAA 4N4AA 4RZSA 3WTCA 3PCTA 1HNXB 1SKYE 1VIDA 3N7AA 2ZW9A 1Y7HA 2Z6VA 3HY4A 1GCAA 4JLUA 3K16A 3H7IA 2Q3BA 4ZDOA 1AQNA 3JQPA 5AVVA 4BC0A 2HA0A 3H36A 3Q7TA 4KACA 5KHOC 3QBVA 4OMUA 4N9QA 1PJBA 1WMAA 5DWDA 1QHEA 2CF5A 1ZUHA 5LHHA 3GW8A 1GV0A 4EJ6A 2GVDC 1ABEA 1O0CA 1ZMBA 3B6CA 4UASA 4Q1AA 3GEBA 5J1UA 2HDOA 3V33A 2VHUA 1E2GA 2LKCA 4ROTA 3LMKA 4ZU3A 3F5FA 4RGQA 5JCOA 1DBRA 1XB4A 1PNRA 3CRRA 2CV2A 5KYNA 4ARIA 3M3YJ 3EVTA 1SXPA 2PUGA 1YQDA 2OFPA 4MS4A 4C04A 3AKCA 3K4MA 3QNMA 5CLQA 1T2FA 2PKEA 2ID6A 4J1QA 1T15A 4JJFA 1CQJB 1ELOA 4ALKA 1SQSA 3KKMA 2OV4A 3F23A 3DF7A 2NTJA 4DA0A 4LDJA 4XVCA 1KZGB 1UK8A 5DBHX 2OFXA 4HTFB 2TYSB 2P65A 1DEXA 3RYTC 1DC4A 1G5IA 4RXTA 2O7OA 5DLEA 5KSOA 3ROZA 4H16A 3MWEB 4B4DA 3OQNA 2OBNA 4EZIA 4BKUA 4FTWA 5ADVA 4IDNA 2JFGA 2DK8A 2HM7A 3MAGA 1OJ7A 4OQFA 4WSOA 3A7DA 4Y2JA 1D1BA 1S2LA 4U2EA 1JT2A 3OU2A 1V8DA 2B8TA 5JNRA 3AIIA 3P9ZA 4GCVA 3BZUA 2C31A 3FUUA 4MRMB 2QUHA 2F1IA 1QQAA 5AKKA 3RIYA 3NV9A 4OSPA 1V6SA 3BKWA 4GLFA 4YFNF 1XNJA 5LC1A 3HFRA 4NCKA 2X8LA 1DJLA 1PL8A 3CZ4A 2QRKA 1VHWA 3KETA 3N5CA 5AKHA 4Z6YA 3R3HA 1JAZA 3QXGA 3GVIA 2VBZA 4PO3X 4HZFA 3BRWA 2W58A 3N3BC 1YMQA 4QAJA 4FHZA 3ZMDA 4E03A 2PWBA 5DLDA 2QRHA 6REQB 2F62A 2M6KA 4I9UA 4YRVA 3SKXA 5I7WA 1MQ8B 1ML3A 1KPHA 1V16A 1F1BA 4BYGA 4WQMA 3DC2A 4A6XA 3E5RA 1UT5A 1X8JA 3RTCA 3MFKA 5I47A 5CHYA 4LF8B 1YE3A 1LDGA 3IJ5A 3VV2A 5TMPA 5IANA 3LY8A 4HDVA 3QBJA 3RWMB 3PJGA 2CWWA 2P41A 5DT9A 1K7EB 3PNSA 2AO9A 4LJKA 5CFRA 2FF5A 1HCRA 4H1HA 1P9WA 8ATCA 4K87A 5ICMA 4AG5A 4K6MA 4A92A 1RR6A 3MM4A 5LIPA 2ZRIA 4BH9A 1ZD5A 1YA4A 1AGNA 3K32A 3DHYA 2M32A 3MA0A 2KIUA 2PA3A 3FKSA 2DFIA 4YMWA 1A9TA 4QPDA 1LPMA 3ZHQA 1ST2A 4P4SB 4JBLA 3R77A 2FR1A 1NYRA 3EPRA 3EBOA 4MVJP 2R7QA 5AI5A 3PEFA 3G1LA 2D2FA 3VH4A 2PV0A 3DAYA 3NUZA 1Z3CA 2XI4A 5JVDA 5EGSA 4PYQA 1T2KA 2VTDA 5GOZA 4Y9RA 4UM5A 5JAHA 2CQ7A 4G0QA 5GPAA 3WJ1A 2WC1A 4PG7A 4XLTA 4AYTA 2A0XA 2X8BA 4I50B 5C8DA 4PBTA 5ESRA 3AF4A 4AJJA 1Z63A 2HW8A 2GUGA 3N7UA 3DTVA 4HXYA 4BHBA 4ZAVA 1UP6A 4XJSA 4CI9A 1RYYA 4AO7A 1SD4A 3C6MA 3ROEA 2LK2A 4QXPA 3GRAA 4O2BB 1USUA 5CNKA 3A6ZA 1XO1A 2YZMA 1V11A 2W22A 4LRUA 1T0JB 3M4JA 1YCGA 2J3JA 1D1SA 5EJMA 3CN9A 3IKVA 1M8GA 3EIFA 3IAM6 3TYXA 2GA2A 1OBCA 2BFCA 1X0XA 1H42A 2FPUA 1WJAA 1YI2I 1AA6A 4K6HA 4W6QA 3PNKA 1JFSA 4FDLA 1KAEA 1SWWA 1N0HA 2H8WA 1V1MA 1PS9A 3I5UA 4FXOA 3I4NJ 3EC7A 4FDMA 2IX3A 2HUPA 1KDPA 1MJNA 3I9KA 4KEAA 2VRWA 3T8YA 2MLKA 3WTXC 3S1NJ 1X9HA 5D3MA 1M83A 4U7GA 3ORYA 4G4IA 4QWQA 4KQGA 1DBIA 4CQMA 4V0RA 1ZD3A 3AUJB 4R1QA 4KXMA 1NI4A 4N8SA 3X2QH 1A5TA 1B0ZA 4QPNA 1E3IA 3P27A 4XZ3A 3SJUA 1VXRA 1GHCA 2BFNA 4BRUA 2XUJA 1RJFA 2P0WA 1GA1A 1C9JA 3G71I 3TIXB 1A9XB 2LTAA 3FJYA 1KYQA 1VCNA 1KK1A 2G25A 4IMJB 3ANLA 5DSXA 4WKCA 2CNWA 2W8ZA 1FBQA 1I5OA 4F6RA 1MOSA 4G9EA 3AFIA 4HWKA 2FUEA 5DJ5A 4NAHA 2J5XA 2XCUA 2Y0PA 1IHOA 4S1PA 1G3MA 1ENPA 4I1OA 1S7EA 1ZCFA 1P73A 3VYVA 4CNBA 1LRLA 4R1SA 3NBZC 4Q4LA 2E87A 3A1WA 2KQUA 2HOSA 3UPTA 2OO3A 2VTBB 2PKWA 3IBGA 1VE3A 3PV0A 5CFNA 5FR2A 4CIBA 1VB3A 1E3LA 1X1SA 2Q62A 2R751 1QHIA 1PP7U 2VCHA 2CJJA 1JYEA 2FHSA 1W73A 4AMUA 1W88A 2E89A 4FFOA 3LHFA 3PE3A 3BJ6A 1ZIDA 4L50A 3PF9A 3N75A 2LKPA 1MORA 3DNMA 2Y1LA 3KIOA 4L3OA 4OH7A 4AN0A 4ASUD 1O7JA 4DLSA 1DAHA 1ZM7A 2DWQA 2EZTA 1D04A 3SXUA 4QGGA 3MCUA 1X1TA 4G09A 4NBTA 5IDWA 1Y81A 3GLTA 3G5MA 1A76A 2EFDB 3U4CA 3OCXA 3OTQA 3IUMA 5KREA 1AN0A 2H63A 2Y1KA 2YPRA 2CNLA 3HJRA 4U0YA 3SS8A 3R7BA 1UKEA 4OHFA 1IATA 2AWNA 1X86B 3SYNA 4PHTA 1N2XA 3CP8A 4N8DA 2R7KA 3CXRA 3A4YA 4V0OA 2ZYGA 2M6LA 4RVUA 2A3SA 3FMRA 1LPSA 4ZTUB 3EODA 4E6PA 4PRKA 3EDRA 4YJ2B 3DR3A 5HFJA 4L5CA 3E23A 4D0NA 4CUZA 2QN7A 1NUUA 3JVUA 2FEKA 3FOZA 4B6PA 3FFXA 1VG8A 1OU0A 4R1MA 5C4IA 3D8BA 2I6FA 2C9DA 3UAYA 2OHOA 5HGJA 1JIJA 4XOTA 4C0JA 4FEAA 2V7FA 4N5IX 3G1UA 3UCEA 1AIPA 4Y2TA 5H8WA 3QVWA 4RF4A 1FSGA 4FC7A 5IBCA 4ZRMA 4TWIA 3MBIA 5DM1A 1ZYRF 3ED1A 1OFCX 3GUYA 1BDIA 1A8QA 1S7GA 1YB5A 1E92A 2Z58A 1CZHA 4XWTA 4YALA 3LAPA 3N0XA 3HU5A 1GL7A 5K0SA 4WXMA 3LK7A 2WI8A 2GHQA 4XYEA 3DKIA 3BC8A 2HTEA 3ZGOA 3PXGA 3QWIA 4TSFA 3EG9B 2BELA 2VF2A 2QYOA 4NCAA 4DV6B 5LWQA 1NUHA 3EVNA 1EFVA 1WZ2A 3GDFA 4QUJA 2WD9A 4ON0A 3H17A 2WINI 2WA0A 1SC4A 4Z2YA 4QM6A 3QKIA 3DVQX 1ODTC 4Y2GA 1SKMA 3L6CA 1YB6A 1E2PA 4K9OA 2EX4A 1NR1A 4MWBA 3ZXYA 1C2YA 3X1ZA 1LBEA 4LJSA 4W9NA 1Z2OX 1DOHA 2QTAA 1Z17A 1IBKB 3AYXB 1YIDA 1B00A 2W84A 4G0MA 4C9BA 2XV1A 4ZFNA 4DUYB 1N36B 2RFLA 4M54A 4TZ0A 2PJDA 3D7KA 5BW6B 3D3JA 4ESHA 3U3DA 1Q6YA 5EJ8A 4G01B 1UP4A 1QV9A 3QENA 1NVKA 5ALMA 5EJ7A 2HNBA 2BY3A 2HKOA 3N0WA 1L3IA 4Q9NA 3AY7A 2JARA 3L7WA 5FUMA 3OIUA 2FQ4A 3QPWA 2CEKA 3E58A 3CVWA 3O91A 2V1UA 4M1SA 2LOOA 1J9EA 4GMGA 4WZAA 4YIFA 4BMSA 2IGBA 1Y1PA 5J3LA 4NEQA 3B8HA 2ZZMA 1TJ3A 4IDAA 3TECE 4GXNA 2UV1A 2PANA 2NUTB 3BGSA 2LDUA 1VJRA 3OS2A 4QQ8A 5HDBB 3CE6A 4GYIA 1XKLA 1PEKE 4CU2A 3F98A 3GRCA 1OPXA 1EFTA 4FFMA 4F85A 3BBPA 3UGTA 2AQIA 3BTVA 1QDUA 4N7RA 3AEKA 2VHQA 1S4QA 5HVNA 4DG8A 1K7AA 3TP3A 4X6AJ 4FZRA 1M2JA 1FFBA 3RREA 4PAOA 3KE2A 3X2EA 4M1OA 4X8OA 4Y15A 4BQPA 2Q5LA 1R7RA 1UBMS 3NRBA 3DQVC 1MZVA 1HXDA 3JREA 3PFWO 2QMEA 1W2GA 3I34X 4I01A 1MAWA 1PHRA 4HAWA 3U7EB 1XB2A 1I94B 3OCUA 2GAJA 3KYDB 4IIJF 4LKOA 4B48A 1ZUWA 1ZXBA 4X60A 5ELXA 1TNTA 3ZDDA 4NKRA 2F3PA 2V3WA 1IUFA 2B4QA 3P9IA 3Q3JB 4ESVA 2M45A 4A0XA 1UT6A 1FRNA 4ZCPA 4JJ8A 1IUPA 5CVRA 4YYEA 4G9GA 3VHLB 3F6BX 4RA6A 4N7MA 1Y1SA 4LE2A 3FNBA 3OYGA 4NZZA 3VC2A 1R9JA 4RU1A 1G60A 1C9MA 5AW9A 1YTLA 3IBYA 4HWPA 3RRFA 4NENB 2A6TA 1VA5A 4QWWA 1C4WA 4A3DJ 4FN4A 2BE9A 2YN0A 3ANXA 3B5JA 3V6LA 3C8UA 1RW4A 2YHBA 2I55A 4RTJA 3L4BA 5ITZB 2XJ4A 1G3UA 4G0YA 5BOXA 4OSOA 4Y0VA 3U21A 4CIDA 3LOUA 1UIMA 3VR5D 1LUJB 4DCNA 2JGKA 1GUZA 2ZNYA 4CETA 4CW7A 4N03A 1WIWA 1NJ8A 3TGLA 1TYBE 2WAAA 1K78B 3E5NA 3HL2A 3ZV7A 3ZZNA 1KU3A 3NC1C 2GD0A 1W35A 2F1RA 3CX3A 3S2HJ 1QYIA 3DLPX 4X1OA 5F78A 4DT1A 1WBJB 4D43A 1NPYA 2OENG 1IXRC 4NDZA 3WWOA 5IZCC 4NICA 5K6AA 2YFQA 2J3QA 1PR5A 1KJWA 1QV6A 5H81A 1X0VA 2NNNA 1F0PA 1UOOA 1A9ZA 3TPZA 3WTYC 3ZU2A 2FW8A 4C0AC 4BRWA 5CCEA 3T3GA 1JIUA 2CVFA 2I4IA 2PZMA 4XYLA 2ZGVA 2FWJA 2VBIA 1ZVKA 3E9NA 2LVSA 3K0EA 2NO7A 5IBPA 4LZWA 2BOLA 3M6AA 3MJDA 3B9QA 1DARA 3MD2A 3Q6IA 1EFCA 1KK0A 3ZW9A 4OLHA 3WGYA 1S72I 5DNVA 3MT7A 1L4NA 1ZM2A 1Z4NA 2XR1A 3PPXA 4RMJA 3DL4A 2J9YB 1U7PA 5HP4A 3TLKA 3TFQA 2E2WA 4HGQA 3OURA 2FWAA 3DPIA 3P9PA 2XODA 1FB5A 4QLCU 4LXGA 5KDOA 1Q5PA 2FZCA 4O3FA 2OTCA 2ACVA 3ORSA 3CD6I 1QGPA 2YL2A 2I3GA 2VO1A 4M74A 2XZTA 3BQMB 3OD1A 1IAVA 3EEYA 2B94A 4H7HA 4GL2A 4GSKA 5CU7A 3GNTA 3D5EA 5SY4A 1GR1A 1OWLA 3NTLA 3WB1A 4XUDA 4DDWA 5JXHA 5DMXA 4JDPA 2IGTA 1DWQA 5IYZA 3GCMA 2C3UA 2L9RA 1I10A 1DP7P 1BSVA 2XOEA 4TKMA 1HKTA 3AR6A 2QQ8A 4ESBA 3LSPA 3GT3A 3FDZA 5H1YA 1QRDA 4RV5A 2VOEA 4GF5A 4KYWA 3Q0UA 1PE0A 5K7SA 4PV7A 3Q9NA 4RO0A 1K08A 1OYWA 1QORA 5DASA 5WRFA 4YJ2F 2JGNA 2UZ1B 5D3KA 5HYVA 3WLSA 3M1IA 2QA4I 3GBSA 2EHJA 4UEQA 4DRZA 3ZMZA 1JSXA 5KKAA 3OC0A 3RKWA 2AL7A 4OYYA 1OAOA 2IHUA 1I14A 3TN7A 2QTWB 4HOBA 4JB3A 2JIRA 2GEFA 4R7GA 4M71A 5LP6B 1J0EA 4PWYA 2QBYB 3KQKA 3P5BA 3E3MA 3BRSA 4BN0A 1GGMA 4WINA 3SGLA 1OFVA 2EOAA 3U7JA 3ZDRA 1FBSA 1EINA 3FOEC 1G7CA 4XTRA 3WMGA 1J21A 2JI6A 2OORA 1I3CA 3R6TA 2HHCA 3AVXA 2STTA 2CLLB 5HF6A 1KEVA 4WL0A 2P8SA 1IB0A 4DJDC 1SEPA 1FTGA 4BASA 3ZMTA 3OKAA 2VE8A 1GGHA 2WDZA 5ED0A 5E1WA 3PT9A 5BNTA 1LWOA 4IQJA 1V55H 1G5TA 1JKJA 1S4MA 2TMKA 2YMMA 2PCLA 2K7ZA 5A7FA 4X20A 3EGXA 3EEOA 5KQMA 1TW2A 3FXUA 3CNQS 5M5BA 3H8WA 4QUIA 4X1YB 2IHBA 1XX6A 2PM8A 3FXLA 2WIGA 2VA8A 4U9IS 3V5NA 2IHZA 3V2GA 2CCKA 4TWRA 3A36A 3OZ7A 2DQRA 1W1WE 1E2JA 2NV2B 5ALQA 3OTWA 3L2QA 2B1JA 2J4CA 4J00A 2L17A 4YUYA 2BIFA 2MW8A 4ENKA 3ZBQA 3EVCA 4GNKA 4A8JC 1HDEA 1O3SA 3WGGA 1P7ZA 4D56A 3HU1A 5L7TA 2HLNA 2DA4A 1U8AA 2WQ6A 2BM0A 4CMIB 5AFSA 3Q7IA 1OOEA 3ICEA 1OLUA 4TSRA 3VPFA 3NHYA 5EE1A 3ZDFA 1OCZH 1U3EM 5IHXA 1NKSA 1HOXA 5TF4A 2IEGA 4LJ9A 1O4WA 2Q3JA 2VI5A 4GL4A 4JBNA 2MMGA 4S1TA 3QVGB 3DPSA 1VLQA 1E0AA 3H6KA 5DX8A 2GZMA 1Z83A 1A31A 3H6GA 3FNEA 5LL6P 4RH3A 4OXXA 2H4JA 4JEHA 1JUPA 2XAGA 4IBOA 1GM5A 5BV8A 4M83A 5CM9C 1XHEA 1JJ7A 1EVEA 1QKKA 1M34B 2H54A 2BGLA 4HQOA 1ISJA 3RS9A 3RT9A 1MBEA 1QH8A 4LNUB 4AZ0B 1YZNA 4I9HA 1FJXA 4E7HA 3CPSA 1DGQA 4PW0A 1W0JA 1YB1A 4L51A 1Y6QA 3D81A 1E5LA 1ZK2A 2M6SA 3FWYA 3KBBA 1FXUA 2XVZA 3AZPA 2QN3A 3LLCA 4ZN6A 1JZTA 4W1QA 1WB9A 1Z34A 3L4JA 4ARBA 1QX3A 3OT1A 2UXDB 4WJKB 1WVMA 3EPKA 1VRWA 4Q5IA 1WVRA 4PX5A 4ZEOA 2CJWA 4WZ6A 1DU6A 2QGNA 3PU6A 4GKBA 2FXIA 1N57A 1NVFA 1ZESA 1ADJA 4D74A 5EHGA 1QANA 1XGOA 2BY0A 1OLSA 5EHQA 1MMAA 4MPDA 5C2JB 3EYYA 4EA9A 1WMDA 3J80K 4KTTE 4MV5A 1PDNC 2Q4DA 4E2FA 2ENUA 3NDBB 4CTOA 3VDQA 1A4XA 2C57A 5A7GA 4KQHA 4G4SP 3TW0A 4D92A 4KFCA 3CO0S 4FNAA 1G8GA 2AD1A 5FO5A 1JECA 3RJMA 1TM1E 3B6JA 4LJLA 1YULA 4X7BA 4U7DA 5JWRA 2DLNA 1VB5A 1TU0A 3L09A 4LG0B 3NBUA 2X0JA 1SA0A 3FTQA 2HSDA 1Y48E 4DMUB 2RVCA 4ZHQF 2FK8A 5IAOA 4OOIA 1IJFA 2PX6A 3DQZA 4HNRA 3I58A 4X7RA 4HJRA 5FQNA 3GVPA 4LJYA 5K0BA 1DTEA 4DLVA 5DI3B 4B3XA 3OTGA 4JZKA 2QQBA 4Y30A 2RD2A 2P7HA 3EIEA 3DEUA 3QVUA 4LXTA 1MAUA 1NVDA 1YJ8A 2P2GA 3QWLA 3D6TB 1EA5A 1WCWA 4GKKB 1YVRA 1KQNA 2YFYA 2LBFA 3IMEA 1WUHS 2R8BA 2HX1A 1Z5VA 4HL6A 1TVEA 3ILVA 1Z73A 1ACJA 4FGSA 1A96A 4W5RA 1QIHA 3FB1A 1JRLA 2O0JA 3P0EA 5H7XA 4D41A 4KITB 1CFZA 2O2GA 3MG9A 2H7YA 2CL0X 4DV4B 2WTAA 2B83A 2CO5A 3QEBZ 4B8YA 1R2QA 3C39A 3LW8A 1C3VA 4HY3A 2R7OA 1FMCA 2FSSA 1G6Q1 3BREA 2ZB7A 1DKMA 1DNPA 3FCSB 3GMTA 4C7VA 3NKVA 3ONWA 3OIGA 1A6IA 2I7DA 1XFDA 1WCMJ 1PT8A 2X86A 4FYJA 1TO6A 3PUFA 4B2YA 1SUEA 4NR0A 3MK31 3UHFA 5FR1A 1VGRA 3B5IA 2BW0A 2F8MA 1RMYA 3K0FB 2PBRA 4RQTA 3KAKA 1K83J 3OA0A 1OV6A 7REQA 5EPOA 3PSFA 4QOIA 2CGEA 1X7YA 2P2CA 3BZWA 2HZ7A 2NXEA 3LL7A 4ND2A 3NC0C 2XB9A 3PQ4A 3CSUA 3C8MA 1DEAA 1L0OC 1CUVA 2GAAA 4JC0A 5CGQB 3HIFA 1MO3A 3UWSA 3DP7A 1COZA 2COKA 4BVJA 2O3UA 3UV6A 4BV2A 1W1UA 3SR3A 3SKYA 2EZLA 2B1RA 2JBHA 2RKHA 3UK7A 3ZWCA 2Z56A 4M0DA 3ANSA 4OU0A 2JVHA 3INYA 4RJIA 2QTNA 3S32A 3HOYJ 3VUFA 5BRAA 4EHLA 2JH3A 2Z4SA 1IXSB 4ZOAA 1SCIA 2HFHA 3ZP5A 3OLZA 3C3PA 1TJ4A 3HKDB 4UM8B 2CQQA 1DINA 2KPOA 3EXAA 2V6GA 3LX8A 3CXUA 3TW7A 4ZAZA 5ALFA 4JLPA 4NJMB 3TAHA 3C3KA 5EJ2A 1VSVA 1US8B 4YJHA 3K35A 2CXRA 3VNQA 5JW6A 1OFIA 4BE0A 5JRZA 2RK4A 4NECA 5JARA 1H69A 1N6LA 1W5FA 2HUNA 4PWZA 2V4JC 4G0WA 2XASA 3BLYA 3CLUD 1PLJA 1K88A 4C0QC 1R9MA 4B4UA 5EYRA 2VPIA 4QJIA 2FW0A 2BFBB 3NGXA 3BR1A 1JT0A 1T56A 2F1KA 3KYLA 1N0WA 2VKQA 1GRQA 4LK3A 4V3CA 1NLFA 1LSSA 2FMHA 4PGMA 4BNKA 1Q1GA 3WZ2A 1EE1A 4R1UA 2OV7A 3SFZA 4NYJQ 1JHVA 5T4EA 5CLGA 2JASA 4K1XA 3ABTA 1EM8B 5JI3E 1GCGA 3GIDA 3RS0A 2ZSUA 3BE6A 1X7WB 4KBYA 1W46A 2CC2A 2D2WA 4ENNA 1QJ4A 2G5TA 1KJIA 1NVVR 1KU0A 4JJ4A 4KR2A 2WIBA 4Y4RA 5LBUA 3PHHA 1PZMA 4MTDA 3V7CA 2H06A 1HG1A 1GILA 4FB4A 3SFVA 3ZG6A 5IC6A 3JYOA 4TM8A 3HA7A 4DBQA 4S2EA 4EJ2A 1WCIA 3L79A 4QM7A 1NBWB 2WDPA 2HI3A 3FKJA 3G0IA 4CEJA 1DKLA 3GPBA 4CM9A 1WPRA 3OCYA 3UN1A 3B9RA 1E6KA 1O94A 2TSYB 2VQ6A 2LSOA 3FXQA 2BHNA 1NT2A 1YCDA 3OLQA 2QROA 2C54A 4YJKA 1JHAA 3WLOA 3KUKA 1B6SA 3ZCSA 3CVXA 2QOEA 4MMZB 4F3KA 2AEFA 2KHMA 4WNAB 4MMXB 4FMDF 4N6NA 4E4RA 4TT8A 1BMFA 3F0TA 5F1OA 3TRIA 5CURA 5AD1A 3KL4A 2GJ8A 4J0CA 2HFJA 3VR6D 2WB1N 4CHUA 2W71A 2XWQA 2ZYAA 1H89C 3WL7A 3G79A 3OWOA 3IKJA 1R8SA 2OBXA 1T9CA 2ZXHA 2LCFA 3B6MA 2I6XA 5CPRB 4QDUA 2P40A 4RY0A 3FVQA 3W4KA 5KQRA 2C4UA 1HDGO 4GSYA 3ZD8A 1IBLB 4U0JA 5DTMA 2XXBA 2OB2A 4C22A 4AXBA 4F4CA 2OV6A 2GXUA 3WGTA 1OXXK 3FXMA 1RP1A 3VPDA 1Y1VJ 2YOHA 1DGWY 2WF5A 2YTZA 1DKQA 3TE7A 5JSFA 2VDRB 5TVGA 2BKXA 1QYVA 5JD4A 1D3YA 3BG5A 2Z2IA 1XZ8A 1G16A 3BAFA 5AKXA 3UO8B 2P69A 1L5RA 3K1NA 3M4ZA 1VI2A 3CUKA 3ICPA 2MYNA 3LYAA 4H77A 2PE5A 5F7JA 4UTVA 1K3FA 3OYEA 2BMDA 1CD5A 3RUEA 3K7EA 3A37A 3JD3A 4YJGB 2WSLA 2NTVA 121PA 2YWGA 2LPMA 3KQVA 1MV5A 1N6HA 1QVRA 2G28A 4EYEA 4PCQA 1QGOA 3MRXA 4OOFA 1XQ6A 2XTNA 2ICAA 4DLTA 2QUZA 1B0AA 3H84A 2R7SA 2PLNA 4A3BJ 4KFSA 4JJAA 4EEKA 4IJ6A 4F7DA 4JWTA 5JZ9A 4X3OA 4WLOA 1Z0FA 4LXQA 2X1MA 4AN4A 3PQ3A 4JBWA 3JQCA 1CRLA 5KVVA 4LY9A 3A1YA 4D0SA 3UMJA 1HDRA 421PA 2KLHA 5LYJF 1NYTA 4UBIA 5BN3A 1EK0A 4TKUA 2A84A 1W5AA 3FUWA 3UJHA 4K40A 4LQDA 4RD4A 1KP9A 1VCMA 3N07A 4WVFA 3L8FA 1B1BA 3UMBA 1S8AA 3GFLA 4A8PA 2H7CA 1H0SA 3WL8A 3LC1O 1JR3A 1YA8A 1MVNA 2FZWA 3FPLA 3U19A 1R9NA 3FKQA 3AHDA 2H29A 4RMGA 5IAAA 1CUZA 4H1WA 5IFLA 3H3FA 5D6OA 3PWTA 4AXXA 1DKPA 1BH6A 4QXOA 4BNIA 4EABA 4OBWA 2L01A 2GLXA 4DLKA 4QDJA 3MUOA 4QL3A 4V2IA 2AQEA 4BCBA 5AVSA 1Q22A 1T9KA 1RXYA 3QLVC 1THTA 3NAZA 4IOMA 3W5HA 3KLNA 5T67A 1TO2E 4N9HA 3AKDA 1QP7A 2NZUG 1MJGM 2JH8A 3U1VA 3OEED 5E3IA 2H31A 3KYCB 1G8FA 3E22B 3DM5A 1MJAA 1F1JA 5HJ5A 4UBLA 5B30A 5BVHB 2BXZA 2H6EA 2NV6A 4MRSA 4R31A 1KI4A 3G7NA 5A2QZ 3CONA 3HVHA 1U99A 4BPRA 3KG2A 2CXQA 3O74A 3W6OA 2AUMA 3D8SA 3LXMA 4MV4A 3IV7A 4WKBA 1YIOA 3EXIA 4JB8A 4GQIA 1YRBA 2QK4A 1K7XB 4IHQA 5L51A 3HP1A 4TMWA 2YRFA 5BR1A 1BI0A 6ADHA 4ZC8A 2H0QA 3BMNB 5JXIA 4MPTA 1XCVA 1QGZA 5HS8A 4CEHA 4INOA 1T9AA 2XZDA 4QYXA 2FV8A 2DMQA 1MCZA 5GADJ 2X9NA 1Z0KA 1HSTA 1ODDA 2X1LA 4M8NE 3MTEA 2WJZB 1KA8A 3CQZJ 1ILWA 3BTUA 3R20A 1VPWA 1AA9A 3WQHA 4XD2A 2ACEA 4XVUA 3SU8A 3F6YA 4EB0A 1Y8QA 2JHAA 1EGHA 2BM1A 1XVUA 3IUYA 4DYDA 5KCMA 4ASNA 3KQQA 1A77A 3T3NA 5I8ZA 1SUSA 1OXUA 3K4QA 4IH4A 2Q6VA 2RC5A 3L2CA 4K88A 2X0DA 1JPVA 2CV0A 3KVOA 5FFMA 4HDOB 1SHJA 2AXPA 1U1CA 4TS9A 4P0PB 1POGA 3I4CA 1KAQA 2R4TA 2P35A 3NBMA 3K5WA 4O29A 4O4IB 1T9GS 2XUDA 3G8CA 1DG3A 4GXRA 1A7JA 4HX5A 3P5JA 1I3NA 2ES4A 1B0UA 4MEYF 3QUSA 4E7OA 4JBGA 1NC1A 4I3HA 4X54A 3GLHA 2B4TO 4QWMA 3MCTA 2GHIA 3REGA 2ZTLA 3WXBA 2JSPA 2JFVA 4M37A 2XZPA 3ZI4A 4OGFA 1GZUA 4ARZA 4HRYA 2EV0A 1K4TA 1C3LA 1GY8A 4L73A 5A2QK 3N4MA 1E96A 1VIYA 1FNSA 4KUGA 2PL5A 2DQLA 2PL1A 4RLQA 2HMAA 3F8MA 1CF4A 2ZB8A 3FYTA 4XWYA 4NZYA 5C3MA 4M86A 1IUKA 2YU3A 3RK4A 3KR0A 1KWGA 4OI1A 5JLXA 3EXHA 3R6WA 4JXZA 4OATA 2RDPA 1R4ZA 5C8VA 3KJIA 3U4GA 3X1KA 4G6ZA 3RSHA 1VCIA 4M0CA 2WFAA 2CHUA 4TV9B 1JFRA 5TQ2A 2BF4A 2EQRA 3T1NA 4YVFA 2HIGA 3NWBA 3B1ZA 2ZS8A 2WFZA 2C95A 3TP0A 5H3LA 3O4JA 5B1DA 2UXCB 3O47A 4FGKA 1BQ4A 3C6ZA 4ZH4F 3VH3A 3F3MA 2ZETA 4BX0A 4J1SA 2KX7A 4FIZA 5EE3A 1NW7A 2WYOA 3D02A 1UM9A 2YHIA 4QXQA 1CS0A 2RMKA 1R12A 3PYXA 1E5TA 3FF1A 2BV3A 3WWDA 3AO0B 4DNPA 1U3VA 4TTIA 2FSGA 1Z6YA 3A4CA 2CUEA 4PYNA 3GEZA 3GJ7A 3HV0A 3P0JA 4KR0A 4P3YA 1Y8ZA 2A67A 3D8UA 2AR7A 5CA1F 1K9SA 3N59A 4I9GA 4C6RA 5C4JJ 4CG3A 1QQBA 4KBFA 5FXMA 1DSSG 1RC0A 1XD9A 1Q1HA 1E1YA 2I8CA 4Z9XA 5J2UA 4K1LA 2RGDA 4XCQA 1VRCA 3S17J 1SBZA 1FW8A 4NABA 2GESA 3JWJA 4TGLA 1MA3A 1J2EA 4CVNA 4E7JA 2CFCA 3IRVA 4V38A 3FMSA 3H5IA 5KOJB 3KBOA 1YL5A 5DYYA 2M8GX 2AKEA 1XA3A 3ZE6A 3RQSA 3ACDA 5FL7A 1W4RA 4KT6A 4DDHA 1J0AA 1U9JA 4CLRA 3LY5A 2B34A 4RKFA 4NFSA 1S1CA 5KVQA 2E1MC 3EVAA 5E1BA 2QRJA 3QOFA 5JCZA 2WKSA 1MT0A 4YRSA 2W9XA 4B3DA 1PR3A 3I0TA 4B6FA 3C4VA 1JB9A 1LS6A 1WUIS 4PQEA 5FPTA 3MSCA 4ILKA 3L07A 5IEJA 4UUSB 4RGUA 1X6VA 3TUIC 3DFIA 1X70A 2RJNA 2QRGA 4NL4H 3CTPA 3I2HA 2JI4A 3AI7A 2FP3A 1REQA 4I0AA 4X62B 3DV8A 1FFXA 3G0HA 4RCZA 2IRWA 4QYMA 1G2PA 3PRJA 1KY2A 1YZUA 3WOHA 1QBJA 1HH4A 5CLHA 2P6SA 4D4HA 2AEJA 3NRVA 1XWFA 3B7WA 4LC0A 2KZVA 1MBGA 5DYMA 3Q0VA 1T8IA 5DGIA 5SV2A 2OT3B 4O4HF 3PTZA 5DYGA 5K3OA 2OBLA 3P7NA 2QPOA 2YV1A 5GV7A 1WHUA 4FSXA 4ESJA 3EGEA 4PG8A 4MVJI 3UJ8A 3RAFC 2VSOA 3PC7A 3WICA 5KTNA 2GSDA 3HNRA 4CR6A 1J49A 4LYFA 1T36A 2IK8A 3RRZA 3EPPA 3D0QA 5CH3A 4GPD1 3H9CA 1ZELA 5FWYA 1T10A 4HF1A 1KFJB 3ZXXA 2H1WA 4D3FA 1IY2A 1VGVA 4NFHA 1WTCA 4O08A 4ETMA 1FQWA 1XGKA 4XWGA 5LMZA 3LHKA 1GL3A 2Z09A 1DDGA 4IJVA 3CH6A 3U4QA 4DNFA 3V32A 3TD6A 1BMDA 1OTHA 4XKVA 4CKWB 2VK4A 3ZWAA 4RGBA 1N25A 5JS7A 3AOGA 2WJWA 1O97C 4CGYA 1F48A 3HSEA 3F5QA 3G0OA 4NU8X 1WHTB 1X1CA 3GMDA 4TMZA 5TLSA 3K1AB 5JQGA 4D1QA 1HV8A 2AIRA 1PJAA 1C81A 1LZLA 4GGMX 1KVRA 4WBNB 4I76A 3W6KB 3QJYA 4L0DA 2XUGA 1QKIA 3DW3X 1FFGA 3GJ0A 2ZZKA 5EXSA 4C0WA 4DM3A 3ESRA 4LHXA 2ID7A 2WYVA 1P2DA 1QZZA 4B3RB 4RTMA 1V9SA 3CV3A 4IS3A 3V00A 3TF5A 4UY8I 5AW2A 2J1LA 4PNHA 3QPCA 1IY9A 4JT8A 3W6JB 2ZYIA 4CM5A 1AVTA 3OO0A 4NV0A 2YYZA 3VSAA 2H1HA 2WF7A 4EMBA 5F5XA 3SQDA 2YWBA 1NUAA 2I2XB 4RS8A 3IOCA 4WA8A 4FZJA 3Q8XB 1GT6A 4FYKA 2QJFA 8LDHA 1E2UA 5C1DA 3KEQA 2AXEA 1R6DA 4P7GA 2I3BA 3NAQA 2GFHA 2JC3A 2JIZA 4BTEA 4MKIA 4PYIA 2GK3A 5ULLA 3L7LA 3AKYA 4FW9A 4DVGA 3QUQA 3TBHA 3WZLA 1S2MA 1E17A 3TL4X 3URKA 4B76A 3GVAA 1YH3A 4MVJH 4OYLA 4R41A 4NE2A 3TO6A 4MWGA 4IYJA 4AZVA 5AR1A 1A8UA 5CYGA 3E3AA 2EIHA 3HWWA 4M1YA 4PVDA 3UYKA 4GZLA 3LSKA 3MGKA 4BAGA 5KTTA 2XTJA 3JATA 4JX6A 2GPBA 2PD6A 3VAAA 2B98A 2A6EF 2FQWA 4ZTFA 4LOKA 2K02A 4ENPA 2OCXA 2GNOA 1CF2O 2M87A 3R9IA 1RNLA 4KMFA 5C46F 2EP5A 3M4YA 3BCHA 1WL8A 3B1WA 3IV5A 4MXDA 5BPIA 4CQLA 5DIZA 3LDHA 1IOZA 2F5CA 4V0ME 1RI5A 3WNVA 2G1KA 5JZSA 3RIRA 4KZKA 4RM3A 3GLXA 3JSPA 3W2GA 2NZ8A 1OR7A 3N2ZB 3GPLA 4KQFA 4MCJA 4L6AA 2EFYA 2BUCA 4ND3A 4Q7KA 4IJWA 3D4LA 2QW8A 3GCZA 1QRTA 2KW5A 2FN8A 2VC1A 3DUWA 3E6MA 2PG3A 3K10A 1JJAA 5BN5A 4MULA 2ZG6A 2ZVJA 2P6TA 1YDMA 2XIJA 3N5KA 2UYOA 5BNFA 2Y9MB 4JY7A 3TTUA 2X8AA 4ODIA 1HOTA 3ECAA 2ZQYA 3AUSA 3TD2A 2ESNA 1ZLYA 2VA9A 5D84A 2PFGA 1MVLA 3EZFA 3GLRA 2IBSA 3BMOA 3Q98A 1ZCAA 2V4MA 1YB7A 3T7RA 3K30A 3UK6A 3QYBA 4M21A 3EOBI 1NURA 2P9YA 1U3UA 2J85A 1KJNA 2WUDA 3MBKA 3UJ7A 2Q4BA 5JNWA 1EUZA 1O87A 3KZ1E 3UAOA 1V3QE 1KHHA 1POXA 1UJ2A 2ATCA 5B57C 3BWGA 2CUFA 3VDNB 3GEIA 2VAXA 4COOA 3V7FA 1TVKA 4CLXA 2ZUTA 3CMEI 4BKPA 1UODA 3EHEA 1ZGZA 3RPUD 4D0RA 3SSAA 4DQUA 4MW4A 4I4TF 1YFKA 2GJSA 3GOHA 4TLDA 1YR2A 2F9LA 2BTOA 5KQSA 4LBYA 3TZHA 2XC7A 3RW9A 3PSHA 2IY9A 3KQLA 1E1QD 4P4UA 2EL7A 1H85A 4CT4B 1OXTA 5LNK6 3U7QA 4LEIA 1OX6A 3MS2A 5JSQA 1Q7BA 4EM2A 2ZSHB 2JNWA 1PD1A 1GPJA 2F4IA 3ZI7A 3U2RA 4S24A 1YWGO 5EG0A 4G37A 4ZQFA 1ETXA 1E3OC 2PI0A 6PFKA 1QQIA 1VQPI 1CZNA 4CKEA 4JQFA 4ZCIA 3LI2A 2R6R1 9LDTA 2H4WA 1UXHA 1KQ9A 5F73A 4DMMA 1U1EA 5TGZA 3LT4A 3HEMA 4ML3A 3ZHSA 4UAVA 1AXRA 3T61A 2W6MA 4LMYA 3I6BA 1XX5A 1MDMA 3I6YA 3BFKA 1FSFA 4JLAA 3RNOA 1U7HA 4UOZA 1N5IA 1NJ5A 4U5QA 4QUDA 2EEPA 3L7KA 3HE3A 4B4VA 1Y7TA 2GAUA 2GZ2A 3H3VK 4A12A 1ESZA 3GEGA 2LGJA 3ELUA 1DC8A 3L4KA 3IESA 1JYFA 3RVDA 1JLKA 4FASD 2ACJA 1E4VA 1OQAA 4BZZA 3PX7A 1HQCA 4POAA 1CJVC 2AJ8A 4XEHA 3I9LA 4I3FA 2YXDA 1GRVA 3PHCA 4OLFA 1RI4A 3GJZA 1RWWA 4JYZA 4O63O 2IZ6A 5THQA 1O54A 3TEFA 3DQQA 1XV5A 1W94A 1VJ0A 1M54A 4YDHB 2ORED 1Z4QA 1K6EA 3L7JA 4IG4A 3WG7H 4X6UA 3HFJA 1MXFA 2JLAA 3I56I 2E60A 4JLMA 1F9NA 4R8SA 3TDKA 2QUIA 3IEIA 2FEXA 2YBEA 4J0IA 1SC1A 5A02A 1HYGA 4L5JA 4EAQA 2KI5A 4TV8A 3CLSD 4E1AA 2WM9B 1H2EA 3FOBA 2IF2A 2JAUA 1NVTA 2BZTA 3DMRA 4OU4A 1K8YB 5K8JB 1MBZA 3NWPA 4ZQIA 1ZJZA 2DTRA 1QQ5A 4AQYB 3FTFA 1FVHA 2KIMA 1WWKA 4IINA 2J46A 2OHGA 4EF4A 3DE1X 5FLXZ 3CH5A 3DFUA 5AO9A 3CYFA 4A26A 1HT2E 3COPA 5E1MA 5TGDA 4ZALA 4D8TA 2YX4A 4IEJA 4L2IA 5AHXA 2E48A 5GAHJ 4LTNA 3DE5X 3QYPA 4JHXA 5CB8A 3VHQA 1D2CA 2LDBA 4OO3A 3EUHA 2GAIA 4BX8A 1LC3A 3CMYA 2P6OA 1J2UA 1HEIA 2GUWA 3ZDEA 2GD2A 3NH9A 1NQXA 3TZBA 1SU7A 4IY1A 3LYHA 2GPJA 5EZQA 1CX9B 4E6EA 2JGRA 3FSJX 2VRNA 4QTYA 1HT0A 3L06A 4YV0A 3CLOA 3ESZA 4B47A 1DO2A 2A35A 1KAMA 2B6NA 1Z0ZA 4Y2QA 4TYMA 4LRXA 1E3SA 3GDWA 4DEYA 2DAOA 5T8KA 1JXMA 1U2EA 4UEOA 2XQJA 2B2XA 4C14A 1QAOA 2R44A 4OM8A 4V1CB 3N6VA 5HA5A 1XF9A 2AYZA 2W82A 1J39A 4LY3A 4H0CA 2R8PA 1GQ2A 4OHRA 2GILA 4N01A 4CF4A 1OFUA 2OZEA 3BXFA 4YRGA 1L5VA 5IUNC 2PWAA 1QZXA 1JEJA 1RZVA 2VBYA 2IJLA 3HP4A 1Q7GA 1L8AA 1OZ0A 2W2TA 1Q21A 2DJ5A 5K3FA 2HJGA 4UHJA 4XN0A 4K46A 4B6GA 1UQUA 1ORTA 3ETDA 3IVXA 2WB2A 1S29A 4MR7B 4MKHA 2CMKA 3GX4X 4TQ9A 4DWVA 3R7NA 1KWKA 2FQYA 1I3OA 4Z86A 1KK2A 3OY9A 4MI1A 2UUZA 4LWQA 1TGVA 1TL7C 2EFEB 4IXDA 1GGJA 3I0NA 2WD8A 2BMAA 3PWKA 3BCSA 4HNQA 1E4EA 4ZO8A 2WFLA 4HRVA 2VDQB 3AI2A 3CLTC 4GUDA 4FBMA 3E0JB 1B8VA 3E9MA 3E15A 1A69A 4BQFA 2XF8A 4J4BA 5ERGB 3U1TA 3WWPA 5D5QA 4LRSB 5B58T 4F6LA 1WPKA 1Z4LA 2XQVA 3LUHA 5FBHA 2N47A 2PJPA 2FUG6 4DW6A 3SYMA 1JTFA 5HF9A 1DU0A 4XUCA 1GDHA 1MX3A 4I50F 2GN8A 1E9AA 2CYBA 1T43A 3AEUB 2GZ1A 2FGKA 1I7SB 1FOXA 3H5TA 2P90A 4O0MA 1KYXA 2BY2A 1EKXA 1CUIA 4D7AA 1GHTA 3P2MA 1ZNYA 4O2BF 4BDYA 1DAEA 4FVTA 1U7OA