5F64A

Putative positive transcription regulator (sensor evgs) from shigella flexneri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
204
Chain Sequence
AMNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative positive transcription regulator (sensor EvgS) from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Transcription regulator
molecule keywords Positive transcription regulator EvgA
total genus 81
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f64A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f64A01
3H5TA 4H0EA 2DFIA 3Q41A 1QZYA 5IUKC 4RKRA 2EV5A 4AIJA 2PAFA 2HQRA 3HRSA 5JVTA 3FGZA 5B3JC 1XMAA 4M72A 4OMYA 3ELKA 1KYZA 1D4ZA 3HV2A 4IRXA 1BIAA 4D6XA 4Z4EA 4EVIA 1U6GA 5D4SA 4E70A 1FYLA 2VN2A 1IN6A 2P4UA 2PJUA 5E1ZB 3JPYA 3MF4A 3I0TA 3G1WA 4LG0A 1EWTA 3V7RA 4RGUA 2FVYA 5HDKA 2Y75A 2WJAA 1JF8A 5CVRA 1BM9A 2RNJA 1DCKA 1QO0A 3U2RA 3RVNA 3WTYC 2A3SA 1LDKB 4E7OA 3QP5A 2L54A 4PYRA 2HR3A 3FWEA 5K5QA 4MLCA 4HLYA 3E5QA 3I53A 4EYGA 1NXXA 2FMHA 2XV4S 4Z4HA 1M5TA 5JNTA 1TW3A 3MM4A 1B9MA 3O6BB 1J7KA 3CDHA 3ROFA 2LF8A 1LB2A 3HRUA 1ZGJA 4LB6B 2NNYA 2VUHB 3G85A 4R79A 1P4WA 1R22A 1EAYA 2A9PA 2VK2A 1OMIA 2MA3A 2IT0A 3FFTA 3BRQA 3HIFA 3REOA 3WTTC 2CGPA 4EMSA 2H6CA 1EH8A 2F5FA 4HW0A 1FZPB 1JE8A 4MS4A 4M73A 5D4RA 2HEOA 2A69F 3IP9A 4RXTA 2IA1A 1DCFA 1D1PA 4HNQA 3W6JB 3MCZA 4KICA 2V1UA 1GLGA 4HX7A 5DCLA 4XXHA 3W9SA 3CUQA 1S6LA 3SZTA 3IHUA 4JA2A 5IX8A 3F6VA 2CHFA 3R4KA 1FP2A 3URMA 2ID9A 3FXRA 3NNNA 2PN6A 3NNDA 4KK3A 1JHFA 4YR7A 4ZYLA 2R47A 3HDGA 1HKSA 5E3JA 2DRIA 3C1DA 2O3FA 2TDXA 1GHCA 2HQBA 1HKTA 5ED4A 2UWMA 2LKPA 4EGSA 3PQKA 4CXFA 1EWKA 3CFYA 4G86A 2I6FA 2FSWA 6ABPA 1P8AA 1ZARA 1LBIA 1KU3A 3GZ6A 4ZMRA 3CLKA 4A6DA 1TVMA 3QAHA 3GWGA 1ZAOA 4EGZA 2ETHA 5TQ2B 2WJWA 4LE2A 1K79A 4PDKA 2XVCA 5IEBA 1OYWA 4EGYA 3IP7A 5ILSA 1L5ZA 2P4WA 4ESBA 1P6UA 1E6KA 3QLTA 3DP7A 2L01A 3Q7RA 1E2XA 1FP1D 4NQWA 5LHHA 5BPIA 4RAYA 4BAYA 3CG0A 5DLEA 2QR3A 1DBPA 2FBIA 5HQJA 3UK0A 1OXBB 1ZH4A 1MD0A 3R60A 3GX4X 1YW7A 4I02A 4P9FA 1ZYRF 1TW2A 1MAVA 3H3ZA 2DQLA 4D6YA 1P4XA 4XBFA 4L85A 3HEBA 3M9WA 4PZ0A 1Z2DA 5E1WA 2P6SA 1XWWA 1TNTA 1QPZA 5TE9A 4N41A 1PHRA 3KP2A 4W5NA 1HSJA 4YIFA 1MJ9A 3J81K 2QW1A 2RVCA 3DV8A 3GZ5A 1XN7A 2JRTA 1SXGA 3DGFC 2R48A 4M9XA 3ERED 2Z33A 3TO5A 1O3QA 3OOPA 5CLSA 4RK0A 3L09A 2OZUA 2PBIA 1NXVA 3N53A 5KWSA 1PP8F 5FGMA 5KVRA 3HJFA 1BI2A 2KKOA 2UZKA 3GVAA 5H6QA 1R7JA 2HTSA 5AIQA 3H92A 3OMWA 2QUFA 1BC8C 5LLQA 3JAMK 1GXQA 4HZFA 5KQPA 4KQCA 2TMYA 3TO6A 4Y13A 5HSGA 4I2OA 5E20A 3M1EA 3E5UA 3DLHA 4Q6WA 5DCMB 3WODF 2ZXJA 2IYNA 4LLGF 4PCQA 3PQJA 8ABPA 3F6PA 2FTKE 4MR9A 1SFXA 4HV5A 2R4QA 5L3BA 2IA0A 1E6MA 2E4XA 5IUJC 2KJBA 4CDGA 4MR8B 3PFIA 1R5HA 1U0SY 2CFXA 2FN9A 2F2EA 3N8IA 2M30A 2QU7A 1EH6A 2AYXA 3KKEA 3FMRA 4TLLB 2JVJA 2IA2A 4YWHA 3F3XA 1YFHA 4NQRA 3E6BA 1JYFA 3CJNA 1ZGZA 2V1XA 4WXCA 5B3JA 2E7WA 5IBQA 3QOPA 1UFMA 2EA2A 3KP5A 4A2UA 3Q9SA 3HOTA 2L3DA 1M2FA 3L6UA 1BIBA 1YS7A 1UB9A 5D5VB 3JAMZ 2QQBA 2BEOA 3Q5FA 4ZYHA 2GKGA 3NBMA 2E1CA 4IHSA 1HKQA 2EJRA 3VB2A 3SZPA 3KEOA 3MFKA 3EQLF 1S3JA 4FHTA 4OOIA 3HOSA 3ZMUA 2ZFWA 3HSFA 3F8FA 3J80K 4I0AA 2QVGA 5HVQC 4H3KB 1YMVA 2ID7A 4LMYA 3KHTA 2XRNA 1DPRA 3FZVA 5HLGA 5TJJA 3KP6A 4Z4GA 4MRMB 1LJLA 1SMTA 2M5WA 4ZZDA 1C4WA 5CVVA 3QLUA 1J75A 1TTYA 3HO1A 1DPUA 1YW9A 1ZY2A 1WSUA 3EAFA 4O1HA 4BHPA 4WWHA 4Q6BA 3K1MA 4AD9A 1E2BA 1R8JA 3A3KA 4G97A 3ILYA 3O1IC 3F73A 1FT9A 1S8NA 2H94A 4PZJA 1AB5A 1UHMA 4HQEA 3RVMA 2RC4A 1LK0A 3MA0A 4LGWA 1WETA 4NB5A 5CJ9A 3H1GA 1RUOA 1RZ4A 1ISSA 4L9NA 3CO6C 1PUEE 4KYWA 3AAFA 1NXPA 1FYMA 5D6FA 3RTRA 5J6XA 4MQEA 2JK1A 3NQOA 3HS3A 1YIOA 1VKRA 3QX8A 4XLPF 3LSTA 4W5TA 1ABEA 2FQYA 3RPQA 1O3RA 4GPAA 1DG9A 4UHKA 4OINF 1SD5A 2QZJA 1USSA 1BDIA 3RPUA 5K5OA 4A12A 2L2QA 3RVOA 5D5UB 1D2AA 2EV6A 3GFJA 3ML6A 3OV8A 4YG2F 4MQFB 3D8UA 2RDPA 1QNTA 1XDSA 5DGCA 1GCAA 4RK7A 1TQIA 1W7PD 1U3EM 1K78A 4O5VA 4LZLA 1W5SA 2OENG 2VYCA 3F6OA 2XROA 2M45A 3CTPA 1NXWA 4MS3A 1CHNA 2O0YA 4M6XA 2J48A 3CZCA 2FBKA 1I3CA 1XHFA 5CVUA 4CO8A 2DAOA 3RYRA 1JLKA 1U2PA 3ULQB 3VNBA 3RH0A 1ODDA 5AONA 3M7GA 5FO5A 5EWJB 4RGRA 5DD8A 3KG2A 5L3CA 2ZBKA 4D0PA 2HFHA 1NATA 1WQ2A 3T0YA 1LVAA 1OPCA 3BJAA 1P6RA 3RVKA 2FW0A 1XGOA 2GXGA 2F5CA 4DN6A 5H6RA 1BBYA 3WTZA 4BHBA 1YS6A 1BA2A 2MSKA 3Q7SA 4MRMA 2LF7A 4ZYGA 2RJOA 2HSGA 1ZLJA 2Y0MA 1NY5A 2IPMA 2DBBA 3GYHX 3BZ6A 3T6KA 1QNLA 3SHFA 1J2XA 2EB7A 5E1XA 3FF5A 1UCRA 3N4MA 2GX6A 4MLDA 2DW4A 2Q5CA 3FDFA 2X4HA 2Q2EA 2IRFG 3I64A 1FBUA 1K68A 2BYVE 2HJ9A 1T98A 2K7LA 2D2WA 1Q1HA 4LB5A 4P96A 2MYUA 4RS3A 3F7NA 2HQNA 1YK0A 3I45A 2LDUA 1ZG5A 2ELHA 4KIFA 3A0RB 4ZYDA 1T0FA 2QLZA 3GFLA 4RAZA 4YIIA 1U8RA 3QK7A 4MS4B 2ZKZA 3V8JA 4XRFA 5GOTA 3IRQA 2A07F 3P9CA 2A6HF 4W5QA 2EFWA 1Z17A 4G94A 3WTUC 1YMUA 5LGUA 2WWYA 3K1NA 4YP9A 4P55A 5CVIA 2E4WA 1LDJA 5HLHA 2OA4A 3IC7A 5HS9A 2QENA 1D3YA 1FFGA 3C3MA 3HRMA 4XLTA 1Z05A 3QELA 5K5RA 1I27A 2B4AA 2NRAC 1AB6A 5BMZA 2FXAA 4DNCA 3JTGA 3BROA 4HX4A 4P5OA 3WG9A 3SAJA 1F51E 2XKOA 4HQMA 3S99A 3F21A 4IMIB 1LEAA 2IPQX 3V7SA 3I54A 2MSLA 1XB4A 1GUBA 3H5WA 3CLOA 1TLHB 1DBQA 4RK6A 2OU2A 4L5JA 4N47A 4Z2YA 2X0LA 4TV7A 4CGZA 1QQIA 2A61A 5CNIA 2FEPA 3HHGA 2M8EA 4EJWA 2YHAA 4EM1A 3TB6A 1C0EA 2NZUG 1NXSA 5PNTA 2F8TA 2FQ3A 4ENMA 3HVRA 4K2EA 1Z7UA 1BJAA 1K66A 3TOBA 1XCVA 2L17A 4RXMA 3N0RA 3ECOA 4EVQA 9ABPA 4OIOF 6PAXA 3VOEA 4UHJA 4JB2A 3EJWA 4Q4ZF 1ZLKA 2P5KA 4IRGA 2D45A 2CO5A 2DO7A 1QPMA 3GEZA 3O2SB 2E4UA 2DU9A 2GA2A 4MGRA 4G0OA 4MHGA 1L3LA 1MGTA 4S04A 2R3SA 2KRFA 2ZWMA 4Y17A 4RV5A 2IPAB 3C97A 5LEJA 3L49A 2LIVA 2GAUA 1HW1A 2FMIA 1U5TB 4RK4A 2DT5A 3CUOA 5KQMA 1J56A 3HXMA 4I01A 1FWZA 1G3SA 4CHUA 1RZRD 3H75A 5LGNA 1NXTA 1KU2A 4O1IA 4M74A 3ROUA 5TPWA 1H9GA 3G3ZA 2JZYA 1ZRCA 2Z99A 4RGXA 1ZRFA 2XUBA 5LRRA 2ZMEB 4G0MA 3OQMA 1GXPA 3JTHA 3GA5A 4LDAA 4WF2A 3DQVC 4MQEB 4NICA 4B8XA 3GO5A 4M9SA 3F72A 1TQPA 3LUAA 4MR9B 3M9AA 1I6XA 3IKVA 4U7DA 2GXBA 4UV9A 5CYVA 2QQAA 5L3GA 1DJMA 4BNCA 1MVOA 4GCVA 1W25A 2CD7A 2C6YA 3H5IA 3L9FA 4OIQF 4OLBA 2JSCA 5DV5A 1QKKA 2PL9A 4S05A 4HF1A 1HXDA 1FPQA 2EWNA 2VC0A 4PGGA 3J80Z 2HYFA 5ICEA 4I98B 5HLIA 1IXRC 1RPJA 1PNRA 1PP7U 3RVRA 1XGSA 5KQLA 2NYXA 3JSPA 2QZ8A 3HRTA 5JS1A 3EULA 1PEAA 1B6AA 1DC7A 3OMXA 1MZBA 4IJAA 1DUXC 3R61A 4LE1A 2V1DA 3DKWA 4ZPJA 5HOOA 1LDDA 2RDMA 5JNUA 2E4YA 2NNNA 4AVPA 2QXYA 2VODA 2L02A 4O6JA 1FQWA 3GRCA 3SM9A 3IKTA 1Z16A 3WGHA 1Z6TA 1FSPA 4N0BA 4MEYF 2H09A 3CNBA 5FBKA 3R0AA 1U2WA 2MLGA 4Z9BA 3TO7A 1VLZA 3KS9A 3DZDA 1X3UA 4ZJPA 2PMUA 3E5XA 4ESJA 1Z2EA 2FMKA 2WV0A 5TQ2A 2PUGA 4UNOA 1KMIY 5JHUA 2FEWB 5D5XB 3IPAA 1CEYA 2RV8A 3EDCA 4KIGA 5DUKA 3LKVA 4G6DA 1IN4A 3GBVA 2OAZA 3QU3A 5HDNA 2WMYA 3RYPA 2RN7A 3JW4A 1ZGAA 3VNAA 2ESNA 4MTDA 4EJUA 1JBEA 4KT5C 1BI0A 2LSOA 2VT3A 1QP0A 5IT3A 3KP3A 4RGSA 3KP7A 3SXYA 5TPZD 1SMYF 2XIGA 3L00A 3UUGA 2PFBA 1QQAA 4Q7EA 1T39A 3C7JA 4HF0A 1YTUA 3LUFA 3I09A 4Q47A 4Z0NA 1XGNA 1ZN2A 1JDNA 3H1EA 1SFUA 1C0WA 1ZREA 1F1ZA 3E6DA 2COMA 4HLXA 3K0LA 1W9HA 5LEKA 3DGEC 3WGIA 4EY3A 3KP4A 3A0UA 1F4KA 4ESFA 1H0MA 4KN7X 4RKQA 3HUGA 2HTJA 2ZMEA 3GT7A 3J81Z 4MS3B 2YPRA 4LK0F 3M6MD 4RXUA 2K4BA 1MB0A 2HZTA 2P5LC 5BRAA 5EWMB 2P6TA 5BOXA 5DCMA 2KYRA 4MS1A 2Z5UA 5TQ0A 1BN5A 3TO9A 3QLVC 4YFXF 5TQ0B 3Q7TA 4JK1X 1AOYA 3FHZA 4KIBA 3EUHA 3H5LA 1IAWA 5FD5A 4IXAA 2A9OA 2QVOA 3BILA 2W57A 3LOPA 1I1GA 5EWLA 3U9GA 4BXUA 3IRRA 1B1BA 3EETA 4I0BA 1Z13A 3N97A 3RJPA 5F64A 4Y9TA 5FWXA 3JPWA 4O5AA 1R5GA 4UXNA 5KC8A 5D8KB 1QQBA 4ENNA 1KQ8A 3K4HA 3KETA 1FFSA 4IF4A 2H6BA 2YR2A 1DRKA 1ZVVA 3H3UA 2V0NA 1IW7F 1I5ZA 1GCGA 5IULC 4OG2A 4ZYEA 3L7WA 4RY8A 3K2ZA 2O6GE 5BR1A 2K86A 5E17F 5HS7A 4IGAA 3N0WA 3MEXA 2MLKA 2Q0OA 3G73A 2FEKA 4KPYA 1ZAYA 3IWFA 2PQ8A 2PMHA 1O7LA 2XKPA 3S2WA 3QRFF 5E8GA 2FEZA 2VBZA 3ZN0A 3JS5A 3LUHA 1QZZA 3GUDA 2BGGA 2RGVA 2HPHA 2BBYA 1O57A 4UHTA 3HHHA 1BVHA 1XMKA 3GFIA 3RDIA 3OLWA 2IJLA 1ZDMA 1Z12A 2EFOA 3HUUA 4N0QA 2STTA 1UHWA 1BI1A 2G7HA 3K1PA 3LFTA 1YTYA 4N9IA 1D8KA 3FXQA 1SD4A 3MZYA 2RKHA 2EK5A 1ON2A 3WTVC 4MR8A 3T5XA 1TMYA 2L18A 4GXOA 3LA3A 7ABPA 1IUYA 2GA1A 4N03A 1F5TA 3I58A 5JNWA 4RB3C 2XAJA 3F8BA 3WTXC 1EHCA 4XARA 2W24A 4BYYA 1ZG1A 4PICA 4WX9A 2OQRA 1L5YA 3JY6A 3O21A 1IXCA 1JDPA 1JFSA 2PE5A 3BWGA 4ON0A 1TLFA 4JQFA 5JNVA 1VPWA 1SFEA 4G8XA 4R1HA 2FBHA 5ICFA 5A2QZ 1ON1A 3P9YA 3LAJA 3LUKA 2HKXA 4UVBA 3I59B 5BRJA 2M98A 1GVJA 3BPXA 4G0PA 3QP6A 5ABPA 1ZG3A 2FF4A 1NHAA 1P2FA 2B0LA 5BQTA 5FWXB 2IW5A 6CHYA 1YG2A 1SRRA 3R6SA 3C3WA 2KIFA 3L2CA 3LFKA 2HYGD 3TDUC 4GNRA 1O3SA 4GO1A 1S7OA 3B73A 5D8LB 3NRVA 3ABUA 3OLYA 3DLBA 3D02A 2ESHA 2XDYA 2IPNA 4QICA 2A6EF 1KRWA 2PLNA 1OR7A 1G6NA 2UXNA 2MBFA 3FM5A 2DK8A 2YX4A 1REPC 3HUTA 3LUCA 3H6GA 1IRFA 2F5DA 3H1FA 2K02A 1SD6A 4A6EA 1MJAA 2QBYB 3TGNA 1OKRA 2N9UA 2QQ9A 2R25B 3O2QB 2IVMA 3ABTA 2QYOA 4YLEA 4Q5SF 2HGCA 2IKSA 1B59A 2FOKA 3EYYA 5KI6A 1Z91A 2D1HA 5TPWB 3Q9VA 1D1QA 1QP4A 4LE0A 1FLIA 3T8RA 2STWA 5L3DA 5FB2A 1USIA 4QWQA 3NEUA 2NAZA 1DCMA 1E17A 1EFAA 1IZ1A 1R58A 3HSYA 1AWCA 5I4CA 1RZRA 2Y48A 1STZA 3TOAA 3U1DA 1PNTA 1FX7A 1W5TA 3KCNA 2H3HA 2O8XA 2M1ZA 5BQ3A 3KEQA 1ZH5A 3ROTA 1KA8A 1DP4A 1J9IA 3WE3A 1MDMA 3BJOA 3ZQ7A 4OMZA 1LJUA 2WY2D 2PUFA 2QSJA 2VOPA 3LWFA 4AIKA 1FBQA 1IN5A 2VBYA 3I4PA 2FMYA 2JRLA 1KYWA 3MWMA 4EM2A 2JTVA 1RNLA 1IF1A 4MEXF 2CHEA 2LBPA 3FFWA 4H60A 1GUDA 2A5YB 1ONVA 2P8TA 4WK8F 3CRNA 1XCBA 2L19A 1Y1LA 3FMQA 3HTUA 2JBAB 1RIOH 2H0AA 4WXDA 2JBAA 4GGGA 4GYGA 2IOYA 1D8JA 1HW5A 2ADUA 4KRFA 5J8CA 1HEYA 4OTZA 5JI6A 4O3MA 2HS5A 4UVAA 1VRVA 1WKMA 4MQ9F 2PL1A 3KJXA 3NNSA 2DPUA 2FQWA 3QLVA 4OLAA 4LD5A 2FMLA 5DEQA 2AYZA 1PUXA 4U0YA 4KN4X 4U7BA 1DRJA 3QX9A 1ZITA 1BC7C 4MGEA 4KK4A 4XAQA 2PUCA 5TPZA 3RI4A 1G3TA 3GW2A 1XSDA 1BAPA 4ML3A 4XSXF 5JS2A 3VODA 3EQZA 1ZHFA 1YYVA 3I5AA 4KDPA 2LPMA 5LBQA 3O74A 3FM3A 1XGMA 1F4VA 4L4UA 2MYPA 2KJCA 2OZ6A 2KIMA 4L5IA 2WRZA 4RB2C 2PJPA 2HWVA 1SXIA 1FOKA 1R36A 3IWZA 2LNBA 2VE9A 2P9HA 2OD5A 4JASB 4L0ZB 2GQQA 4KFCA 4OIPF 3FMVA 3ILHA 4G6QA 5CNMA 3GXOA 3T1BA 3P7NA 3GL9A 3TX6A 4HOBA 4D74A 3LTEA 1W7PA 2P5VA 3M9XA 3MAJA 4HDVA 3HCWA 3T8TA 4M9ZA 3C18A 1PEYA 3JVDA 5DCFA 4MYRA 3TDZC 1LBHA 3FFXA 1ZHHA 2B1JA 3W6KB 4MPTA 1USGA 3GBPA 2AXLA 2QBYA 4HX8A 1DZ3A 2JCGA 4ASNA 3KZZA 2Q8KA 1SD7A 3BDDA 1DC8A 4NHJA 4QYMA 1QGPA 5E8IA 4HYEA 1B4AA 1RUNA 5DYMA 3OLXA 4HF2A 1SAXA 5GQSA 2DK5A 3MZHA 2CQKA 5HM6A 1FBSA 3KYIB 3ZP5A 4LK1F 2V6CA 2E7XA 4YCSA 2DTRA 4WWCA 2EV0A 5H20A 2R7FA 3OQOA 1SXHA 2L4MA 3O2JA 2VE8A 5ICCA 1B00A 3N6VA 3TQNA 4WCGA 2FLWA 3CG4A 2X7XA 1KQ0A 1DDNA 2XHKA 3V8KA 5ILVA 4LJZF 4WUTA 4BH9A 4P1ZA 5T3YA 3O3KA 4XASA 4WXHA 2FLKA 5HDGA 3A10A 5BPDA 1JHZA 4L18B 2O03A 4RY9A 3GF2A 3KLOA 1ZRDA 5TQJA 4FX0A 3UKJA 3QEKA 2CWEA 1JX6A 1L0OC 1TM2A 4HBLA 2JPCA 4JBAA 2DQRA 3O1HB 3EQ2A 4Y15A 3LKBA 2CSOA 1U04A 3TKYA 3F6CA 3LUJA 4JB0A 1XSVA 2VT2A 3EODA 3BJ6A 3I42A 2PI0A 5FWYB 4L9JA 2EFNA 3CTAA 1USTA 4P9UA 5F1RA 3MYYA 1R23A 3OLZA 1IRGA 3QLUC 1WRJA 2XGXA 3M8EA 1BOAA 1T6SA 4RB1A 4AWXB 2LP4Y 3BY6A 3J7AO 3EDPA 1U5TA 3ISPA 5JR3A 1W4MA 1R00A 3ZMZA 5CNJA 1S29A 3WTWC 1P92A 1WI9A 4NCAA 2PMCA 1R1VA 3P9KA 1ZGGA 2PKXA 3P9IA 1DP7P 4HDUA 5DTEA 5FBHA 1APBA 2WB4A 1KQ9A 2PUEA 3F22A 3FXUA 3GWZA 2XASA 3HSRA 2XAFA 2K4JA 4N9HA 3B02A 4Q48A 1TQMA 4QLCU 2NS0A 1T38A 2E4ZA 5ERIA 1LJ9A 4ETNA 3SY8A 3QU6A 2CW0F 2OBPA 3KCCA 2FSPA 4FE7A 1K78B 3RKWA 4MR7A 1J0RA 4ZMSA 4MQVA 3DF8A 1O3TA 4F11A 3TMYA 4RDCA 1Z6RA 1LQ1A 5JNSA 1URPA 2ZNYA 1RXIA 3NHZA 1TBXA 1FSHA 4QPJC 2QWWA 4IRHA 4F06A 2RQPA 5LHIA 2F8SA 5IUNC 3NHMA 3E6MA 5EWJA 3N75A 2KIUA 4RK1A 3I59A 4EM0B 2VBXA 2VBWA 3CKMA 3O75A 1T2KA 3SFZA 3E3MA 4XFKA 4KV7A 4YO7A 1YVUA 3HDVA 4EVSA 4ETSA 4CYDA 4PGHA 2MD5A 4Z99A 3DFGA 3VFZA 4DQDA 5D6EA 1TNSA 4Z4IA 4FT8A 4H3HB 1HQCA 4YFNF 3F8MA 4OIRF 5LHGA 5HKOA 2M87A 4Z9AA 3H6HA 5KC9A 2WTEA 3LQQA 1DBWA 4WXEA 3OLVA 1CF7B 5FWYA 1QP7A 1XDUA 1H9TA 1CYEA 1V4RA 3HTSB 2W25A 3LA7A 3CS3A 4YV7A 2W84A 1LEBA 5FFZA 1A2OA 2JT1A 3C6QA 1R1UA 4RWEA 3Q15C 1YK1A 4AIHA 3SNKA 1YLFA 4P98A 2UXXA 1QO0D 3IP6A 5C5CA 2FKAA 2FXIA 4DADA 2E1NA 2CYYA 4G0QA 4XSZF 3V4GA 2MC3A 5A2QK 1ZESA 3JVIA 1Z15A 1MKMA 1EH7A 3VEPA 4G7ZF 1KU7A 2HQOA 2VOOA 1P4AA 1W7PB 1FSEA 4KMUX 3RKYA 4KZKA 3V7CA 2WWVD 2VUIB 4CBVA 2QM3A 4PE5B 1S7AA 3M8FA 3MIZA 2EFQA 3QPTA 5DD4A 3K9CA 4YGXB 1MJBA 1XHEA 1USKA 2A68F 2FN8A 4ZH4F 4U0WA 1XD7A 2OQGA 3ZMVA 3OM0A 2MYNA 3QEMA 3E6CC 2NZVG 3DPLC 5TRDA 2Z9OA 1BDJA 4HAMA 4G0YA 1Z26A 2QVCA 2XAGA 4CICA 2BE5F 3H5OA 1YO5C 2M1BA 1Z9CA 1IN8A 1FYKA 2AS5F 2NUBA 4QYWA 4EJVA 1BDHA 4A0ZA 4GYIA 3C3KA 1JHHA 1U8TA 2GI4A 2LUOA 4CZZA 3KSMA 1YW8A 5L3EA 1ISRA 3BRSA 2O61A 4HNRA 3KLNA 1Z1DA 3RVPA 1QMPA 2FNPA 5J8FA 3O1JC 4MS1B 3CUQC 2GWRA 3F23A 4N0PA 2DPDA 5EWMA 4F8JA 2R7DA 1A0OA 2MSWA 4M88A 3GFMA 4MAAA 1FNNA 4Z4CA 3CU5A 3K69A 3WE2A 4RB0A 1Z18A 4EQQA 2G7UA 3E61A 3COAC 2CWDA 3CUQB 5KK1A 2RGYA 4EJOA 4B09A 4W5RA 2O20A 3HSEA 4KNYA 5IT9K 4MTEA 1JH9A 1E6LA 4I7HA 4M6YA 4LLNA 1K6OA 4DQ2A 3KE2A 5K1YA 1OYYA 3KTOA 4YRZA 2ZAYA 2IPLA 4A0XA 3T38A 3RVJA 1V3FA 3DEUA 2CG4A 4JAVC 4OATA 4TMYA 2FQXA 4E7PA 2VXZA 3BP8A 4OBBA 1B9NA 2DLLA 3WTSC 4ETMA 2FNAA 3KFWX 2BGCA 5BS6A 3RQIA 3DBIA 1K7AA 4F7ZA 3E3VA 4LLLA 3KZYA 4UUVA 4LX8A 1JL3A 2FMFA 1IIBA 3RVLA 1RXEA 3I5UA 3RVSA 3O2PE 4IILA 2Z3YA 3JTEA 5L3FA 3HK2A 1M2EA 3CHYA 3WU0A 5FD6A 1G3WA 5DUIA 1IXSB 2YX7A 3OO1A 3FMSA 4RZSA 1ULYA 4RS8A 4LRQA 4EYQA 2MYTA 1KU9A 2L4AA 4IVNA 4M71A 4LDZA 5FFXA 1JFVA 1UDRA 4ETIA 4HV6A 4L9TA 4WXMA 4EYKA 3GV0A 3QEMB 5ICGA 3HM9A 4IMJB 3ZMTA 1U5TC 1J5YA 5CHYA 2H27A 1Z25A 2DI3A 2J5PA 2WC2A 2EFPA 2FA5A 4JOQA 3BOQA 3JSOA 4G9YA 5IT9Z 5FLXK 1ABFA 3GLXA 1NXOA 2ACJA 2XAQA 2J5OA 1XSXA 3DPTA 1PDNC 3LA2A 5ILUA 4MQFA 1KRXA 4RU1A 2XAHA 4A0YA 1FY7A 2W42A 4MR7B 4KREA 4YS6A 2F5EA 3SQNA 4TN5A 3HYIA 4I09A 3BBLA 4KUMA 4UV8A 1VTNC 4IRIA 5DDGA 2ZO4A 5CNKA 3FX3A 2YU3A 4EYOA 2QV0A 4A5MA 3OM1A 3RIRA 3IL2A 4U0VA 5D5WB 1FFWA 3QPHA 1OYIA 4KQ9A 4OU0A 4MNUA 2D1VA 1MDMB 3QELB 2IP2A 4EUKA 1NTRA 3H5VA 4N76A 5KQGA 1O7FA 2E4VA 4KMFA 3ECHA 4EV0A 2GIVA 4XLNF 1T34A 5C5EA 5EEHA 1P6QA 3I71A 3CO7C 3T8YA 4WT7A 2PUAA 3WGGA 1H9CA 5LRSA 2PUDA 3HZHA 3KYJB 5IEJA 5CVJA 1JFTA 2FRHA 3LMKA 3EGCA 1OXKB 1U78A 3N0XA 4HNSA 4IHTA 5D2CA 4EJTA 2V79A 1R1TA 4UVCA 4YFKF 4NCBA 5T7BA 5AIPA 5FLXZ 1G3YA 3MMNA 3WU1B 1D5VA 2PG4A 5JFRA 5HS8A 4L9VA 1HW2A 3D5LA 3T95A 3LQRA 1RI7A 3BPVA 1KGSA 3ZN1A 2ISZA 3OO0A 4ENJA 1U2QA 4FB4A 2ISYA 5E18F 2A9QA 2RJNA 5JNRA 2VONA 4FX4A 3E97A 3CZ5A 4G0XA 4HA8A 1WWXA 4LG0B 2YSRA 3LAPA 2BV6A 2JB9A 2JVKA 3RVQA 5EEGA 4WZZA 2W85A 1F9NA 4LFUA 1HBXG 1QBJA 3IPCA 2HOEA 1JXSA 4RK5A 4ENKA 3IDOA 2FU4A 3R0JA 4BHCA 2G9WA 2P7VB 3BREA 4JP1A 2P7CB 4A5NA 4RSMA 4RY0A 3F8CA 3ZPLA 1I1SA 4IPAA 2K27A 3D0SA 2GZWA 4L0YB 1LNWA 5LGTA 3LUGA 3ZMDA 4EVRA 4KA4A 2MH2A 2HDCA 4KVFA 1IN7A 2PEXA 2ZJ2A 4W5OA 2JPBA 1FC3A 4BQAA 2IDMA 3V8LA 1MB3A 3TD9A 4PEVA 2ZNZA 3B2NA 3EYIA 2VC1A 1D5WA 1EWVA 5DKFA 3IP5A 1BI3A 2NT3A 2FE3A 4TLMB 1JYEA 4KMRA 1ZH2A 4NV3A 3MQ4A 3MQ0A 2ZCWA 2JVIA 2EA4A 4U88A 3LUDA 1TJYA 5F6FA 1G4DA 4R8HA 4G7HF 4ZZLA 3K9TA 2A9RA 2YHBA 4Z4FA 3GYBA 3DXJF 4F12A 1A04A 5EWLB 1JWLA 1CF7A 1EV7A 1HSTA 2GBPA 1YQAA 2PUBA 2V9VA 4FE4A 2HKOA 3ZMSA 1MIHA 1M5UA 2PLYA 2NT4A 5IC5A 1CGPA 3SG0A 3RKXA 4F3TA 1Y0UA 4G0ZA 3OQNA 1J59A 4G7OF 3F8NA 2MH9A 1JGSA
chains in the Genus database with same CATH superfamily
4KE6A 4HZUA 5BORA 16PKA 2JFXA 3H5TA 3L2OB 4H0EA 2DFIA 3PYMA 4GW3A 4I1IA 4NABA 2ZATA 2XYPA 3AHEA 4O4JA 4QGHA 5IUKC 2OV6A 2PD3A 2XB5A 5BN5A 2EV5A 1TEVA 4AIJA 2HQRA 5JVTA 2O1WA 4HAOA 4BFLA 3FGZA 5IJ9A 1M72A 4OM8A 3O8BA 3V1TC 3EJ6A 4QOHA 1MDBA 3NHJA 1KYZA 1D4ZA 4ESVA 1GU1A 4RH1A 4UNIA 3S2FA 5K0JA 3TZCA 4WKPA 2WF9A 4R1MA 5K20A 5CB4B 1A9OA 3UAVA 3D1LA 3Q1LA 3CF0A 4IFTA 4CCYB 1X7YB 1LDEA 2P4UA 3WYBA 5I9IA 3MF4A 3U44A 1O96A 3DKVA 3EG9B 1QHYA 1Z3XA 3H36A 4IQ4A 3MS2A 3G1WA 4IX1A 4LG0A 2D59A 3FPEA 4Q3DA 3QXJA 1SK8A 3CRVA 3V7RA 1JHMA 1N2GA 1R5ID 1W0UA 1Q0UA 3U4HA 3A37A 2O57A 2WJAA 3T7EA 5KWIA 3VJRA 3ND8A 3DD1A 4LIUA 1PR6A 1ONPA 3FZQA 2Y0DA 3WYNA 2CDAA 4D7MA 2FG6C 1QO0A 1WPKA 2EIXA 4H35A 2QF7A 4HEJA 3T3IA 3ZKAA 5E8JA 3PRKE 5EZ5A 3H3FA 3R9XA 4M3GA 5HLTA 2EOAA 2A3SA 3V1MA 4E7OA 3ZIDA 3LECA 3THYB 4EFLA 4ESHA 4MLPA 2R8PA 3TLXA 4EY8A 2BT4A 3A9VA 3ZH2A 4JMPA 2EBUA 1OFHA 2XQIA 4MLCA 4NNPA 4EDHA 1R0CA 1U9NA 4XE5A 4EYGA 4K6GA 3QWFA 3FKJA 1LBSA 2TS1A 3RIGA 4DMFA 4YAGA 4JKIA 3SFIA 3NO4A 1B16A 4Q21A 4Z4HA 3H0GJ 3K4CA 2R5WA 4LOCA 2RBKA 2CVFA 3ZGOA 4ZYTA 2W2XA 1NPTO 1P0PA 1OB2A 2HU7A 2PZBA 5JHFA 3OF2A 2FR0A 3E5MA 3Q40A 2VJDA 1ZGJA 3LKDA 4N12A 4QHYA 1CJSA 4AZ0B 2OFOA 2NNYA 3DUFA 5EHQA 2VUHB 3VQTA 3G85A 3WGYA 4G2TA 5FJJA 2QHXA 2BFEB 5CFQA 1I5OA 1JIXA 4DBLC 3L02A 1D1CA 1E3OC 2VK2A 3IALA 1GGMA 1WXXA 2PQMA 3II6X 2IT0A 4W9NC 3UQYS 2BC9A 3QYAA 4J6FA 2CZCA 3WXMA 3PNTA 1E1NA 2AI1A 3S3OA 5KIAA 1T8UA 1HT2E 2HGZA 4PLVA 3RJTA 3K1TA 3HVJA 4B84A 3MELA 2VJQA 3H87A 5CRIA 1JE8A 1Z0SA 1DDIA 1UC8A 3BWDD 2VYVA 4MS4A 5D4RA 1FVXA 2HEOA 4LOKA 2Q3HA 3I9JA 2Q7OE 5ICSA 3IP9A 1UBKS 1UAGA 1X7GA 2JGMA 2ZVJA 4Q3EA 1OUMA 1ST2A 1UZAA 3ILSA 4RXTA 4AM3A 1L8XA 1N5KA 2W70A 3UUFA 1EXVA 4BMOB 2RNGA 4JGIA 4DG5A 4KICA 1C0LA 3K0FA 3WQSB 3CE6A 6Q21A 3CV3A 1ZRHA 3OIDA 1JKIA 4J1TA 4I3GA 5KTPA 1A3CA 3HA2A 3DPIA 4AICA 3EZ9A 5EIHA 5DCLA 4BO9A 4QLOA 2DBZA 3Q3IA 4L28A 3DEIA 2OBLA 1SC4A 3BMQB 1QC5A 2YC4C 1U28A 3Q88A 1S6LA 4U2EA 3SZTA 4P0PB 5IX8A 4TUYA 3DF9A 2CHFA 2X0IA 2QUZA 1MO4A 2R6FA 3R4KA 2CLHB 2I99A 2DDBA 3NTVA 3URMA 3W05A 5EMJA 3VR3A 3M8KA 4ZYVA 3B9RA 1P0MA 3FXRA 1CUVA 3NNDA 3NNNA 1UPCA 2REOA 3KZNA 4E7KA 1IMOA 4U2BA 1RI4A 1MPTA 3OM8A 2JN6A 5T6BA 3FN4A 4LPKA 2BCEA 5EG0A 4W1QA 5E3JA 4DR5B 2AN5A 5AW8A 3GGOA 1EFTA 3PEVA 2QSZA 1Z8NA 1TCBA 3DJFA 4RF2A 4B80A 2IGOA 2D2FA 4FWBA 4BMSA 3RADC 2BR3A 3ZX5A 2UWMA 1MC1A 4IDFA 5GIPE 3ASNH 5HFNA 2VHXA 2YBEA 4V38A 1VHWA 4Z9XA 4N7JA 3G68A 3QOYA 1U2ZA 3I23A 2C4WA 4CCOA 3TNFA 5FEMA 1EFUA 3IEVA 3NWBA 3VBCA 3AUXA 3ZHYA 3DMPA 3VR1A 1IPEA 4B46A 1I3KA 1YR9A 2PA0A 1IDZA 5AK5A 1CY1A 1P8AA 1IGNA 1L4LA 1LBIA 1KU3A 3GZ6A 4AZVA 4CI0B 3GLHE 2L2OA 1KKMA 1TVMA 2YFQA 1VE1A 4ZI5A 4KGZA 1ZAOA 4IL6C 1P75A 1FX0A 3JD1A 2PX5A 1FJ2A 2ETHA 5TQ2B 2P78A 1G0OA 3R5JA 3BDVA 3P4XA 4C7OA 2NXWA 5CFNA 2NVUA 1WSBA 2RB5A 4FQ7A 4DL9A 3KYDA 2IS1A 5FDFA 3CCRI 3QG5A 1K79A 2XVCA 2R8BA 1QGUA 1K5DA 1OYWA 4EGYA 5CK4A 1G5FA 2C9MA 1Z0KA 1VHQA 5IXJA 5FRDA 2P4WA 5A3RA 3JALB 1CQIB 2EGGA 3JASA 1P6UA 3LUBA 4OAPA 1BW5A 3LVFO 4FISA 3RQ4A 1P1BA 3F90A 4JKOA 4KSYA 4NG4A 5D85A 5B64A 1JILA 2ERCA 4R7TA 1GSAA 3NBYC 4GX5A 4LF4B 1K4MA 5B4VA 1MH1A 3DBRA 2V7QA 2IHKA 4E3ZA 5LHHA 5BPIA 1TF2A 3UA4A 4BAYA 4BMYA 2WYOA 3N2KA 5TMPA 2GOXB 3FI0A 3L6BA 4LWZA 4OXYA 1GKIA 3DEHA 4YMHA 1TE2A 3EGEA 2QR3A 4R54A 1HDOA 5KQSA 3STVA 4Y98A 2FBIA 2R84A 3NGMA 5HQJA 4URZR 1ZM3A 2WWHA 4P38A 4B4CA 3AB3A 3I2HA 4NEHB 4ZOAA 2E2HJ 5LNK1 4UM7A 2LLKA 1I1QB 3O3MB 3GX4X 3K73O 4BO5A 4W5WA 3ON5A 1JAXA 2X3UA 1ZYRF 2A1UA 4P3PA 4I9GA 4Q9AA 1I0IA 1N8NA 3AF1A 3FFAA 4WOBA 2DQLA 2OTLI 1LS1A 2LGJA 4MJ3A 4XBFA 3JR9A 2L82A 4TXJA 3HEBA 4OXXA 5EMMA 3A0BC 1KFKB 3NX4A 5E1WA 2P6SA 1K5GA 2D8AA 2ESRA 2FN7A 5FV7A 4UM9B 3N7UA 4UUBA 1RT9A 1E3TA 2P9FA 1C0KA 3KKMA 4YRNA 4N41A 1Y7HA 4XYLA 4BQSA 1GTZA 1NVTA 2ERYA 2O4CA 3C5HA 4TLCA 2V3CC 2Q3EA 1MX9A 3OP4A 2YNMC 4RYDA 3QEBZ 4YIFA 1UC9A 2RVCA 3DV8A 2Q9BA 4KDRA 4BKMA 4JVLA 4KQJA 4OHYA 4E2YA 2JRTA 4DAEA 2ZB3A 3IQEA 4MUMA 5G0TA 3ZZUA 2WYHA 3W0LB 4KR9A 4YRIA 1UPFA 4DLWA 2HMUA 4AKGA 3KQOA 2QG9A 3EGXB 4W9RA 1Q3HA 3ZGXA 3OOPA 1IJBA 3M6WA 3OOWA 5FTKA 4ZI3A 5ADHA 5I7FA 5G0UA 3RFUA 2Y1WA 2G7ZA 5G0SA 2E37A 3SJ7A 1PTKA 3BB4A 2XVYA 4KB5A 2QT1A 3K4QA 2H63A 5KWSA 3KSDO 4X6XA 5KVRA 2JIQA 1HL3A 4RGBA 3L6OO 3WY9A 3F9CA 3AKEA 1APLC 3DQZA 3GVAA 4MV6A 1QZEA 4L15A 3NR2A 1NMQA 2P62A 3I2YX 4MVJI 1J2TA 1II9A 1EVYA 1P1KA 3RUAA 1HQDA 3TEJA 3SVLA 5HZGA 4EATA 5LLQA 4A23A 2UU9B 1LPSA 2ABWA 2GAIA 2ZSUA 4H1VA 2WKSA 4IUBS 4CEHA 2QTVB 4BACA 3TAHA 3QX7A 1K7YA 3L7KA 4NV1A 1JT0A 5HSGA 5LIPA 4RBOA 5E20A 3M1EA 2DJNA 3C1OA 1X8LA 3OCZA 5CB6A 1RWPA 3E81A 5F0CA 4FKMA 4Q6WA 5DCMB 1XL1A 2R4GA 1LA2A 3IHKA 4PCQA 1ULUA 1PJAA 2PS0A 3LCMA 1QOQB 3IEUA 4HV5A 2XGGA 2IA0A 3OWHA 4FGUA 1XCGB 3WGQA 1H6CA 2IDZA 2QPAA 3UMJA 2KJBA 2RHTA 3QBJA 3RU3A 1R0BA 4ADSG 1FK8A 1Y1VJ 2FW9A 2RK6A 4MR8B 1SH7A 5ALRA 5JYEA 1XN4A 3ZDCA 2I1LA 1IOZA 3I6YA 4BBRJ 4Q3OA 2F6CA 4QU0A 3SLGA 4ALKA 5ALOA 1HSOA 1M73E 3N8IA 3PFGA 1DEKA 3SE0A 3WDSA 2M30A 1DJLA 1M5RA 4C22A 2DA4A 4GX0A 2XCRB 1UBMS 3FMRA 1WUTA 4ENRA 1JYSA 2ATCA 2FX2A 2LK2A 2IA2A 1BOOA 4YWHA 3L5KA 2PD4A 5BOSB 3PNVA 5MFZA 4NQRA 2JD1A 4C3IJ 2JAQA 3RSNA 2MSEB 5T67A 1A8IA 1SANA 3DKKA 4TYYA 1PU2A 3A25A 5ALDA 4BTEA 2ZZKA 2ZB7A 3JAWB 1E1DA 1XQYA 3QUBA 5IBQA 5FL7A 2LD5A 2Z2IA 3E23A 2RGBA 3PUWA 2GBIA 5ELLA 3D3WA 1U3FA 5E4JA 5KJ1A 4ZO4A 1QGED 1TU0A 4A2UA 1NVEA 2RIPA 2LE0A 4GVPA 4UOQA 5JO9A 1N5RA 3ROQA 4EHAA 1ZUD1 1J24A 1YS7A 3M1YA 2GA9A 2OC9A 2O7SA 2QGFA 1UWKA 4X6LA 2GGSA 3VV3A 1G20B 2C8KA 2GAJA 2Y2VA 3IMGA 2BVNA 1F8GA 2G82A 4CYMA 3Q5FA 3AM4A 3HZOA 2J9YB 2IV7A 3N2GB 1TTPB 1JEDA 4LTMA 2Z5VA 1G8SA 2QQEA 2QN1A 5HMLA 4YP6A 5BYJA 3OM9A 1N2CB 4X8HA 3H5RA 2OQVA 4XRGA 2K3PA 3E7LA 3EBOA 3SZPA 2FX0A 1W0JA 1XRNA 2A4KA 2A58A 1A77A 1N2ZA 1OBHA 1KI7A 2ZJBA 4URFA 1RP1A 2RGEA 2YHIA 4LFCB 3HOSA 1R4ZA 4TWIA 5CA1A 1H89C 4KVZA 1DINA 2OQIA 2WLSA 5IJ9B 3K1YA 4ER6A 2DPYA 2PJDA 4Y2VA 5LWQA 1Z88A 1VMKA 2UVDA 4YBRA 3HN7A 3GA0A 5AESA 1GYPA 2V58A 3G2MA 1QHHD 2QTHA 1FF9A 1Z75A 4FHDA 4B8ZA 4B8WA 1FFDA 1BC5A 3F47A 2C2WA 1YBAA 4DIMA 4C14A 1P4HA 2GZSA 4PR3A 5TJJA 4RTJA 4CIVA 2WIFA 1W34A 2AVDA 1ID1A 2Q2QA 3CN9A 4OK6A 4PPQA 1LJLA 2C20A 1A9QA 3S28A 1RXWA 2I9PA 1DGRM 5E3OA 1NN5A 3CLRD 4R8RA 5CVVA 3CSSA 4HKTA 2W6QA 3BPSA 2ZXEA 4DLPA 3N8DA 4MIMA 4LNHA 2Z2YA 1TTYA 3GTPJ 3FHLA 4K2AA 1GGHA 3WYGA 1I2AA 1IEQA 3A7DA 5IKEA 5K4HA 2JJ1D 1I5EA 3IUOA 4FYIA 4LCEA 4RNDB 3W6PA 3A1YA 4BHPA 2ZAIA 1X2EA 2I3GA 3ZEAA 4I66A 1G8YA 4JQCA 4KH1A 5B55A 1D4AA 2OG2A 4Q6BA 4IIVA 1E2BA 1GCIA 3SZUA 2VSFA 2DE0X 4G97A 4RVHA 3ICPA 3EYWA 1HI9A 3W8DA 2C29D 3ILYA 3O1IC 5ES3A 3IT2A 2F3SA 4UD6A 3EFBA 3SXPA 3OQIB 3ILVA 1AB5A 1UHMA 1AF4A 1W9MA 1LK0A 2BM0A 3CF4G 1E1RD 3RVMA 3WFJA 1VECA 2CNWD 5DOVA 3HJCA 1DEOA 4KLCA 2I03A 3V7YA 3FYUA 4OK3A 1V43A 3K2IA 2IYWA 2CV1A 2VHUA 4ND4A 4P2GA 2W8ZA 2GK4A 4FS8A 1Z56C 4ZYUA 1R37A 2PZAA 3DH0A 1RZ4A 3DL2A 4QUIA 1U9IA 3BR6A 1EE9A 2ZTLA 3DAYA 5CH3A 1QO9A 2XVMA 1WKCA 5AVOA 4AZ0A 1UXHA 2CEKA 3CO6C 4ID9A 4RIEA 2VJYA 2WT8A 3OY7A 1J7JA 3ZDEA 4FKBA 3U4QB 4FUTA 4NJMA 4B8YA 4RACA 4FR2A 3KV3O 2QWXA 3AERB 4MQEA 2RGAA 1K6JA 5F2OA 3UM9A 2P4EA 3P9ZA 3ZN2A 2ATXA 2GD0A 4U0KA 3PITA 3ZCOA 4QO8A 1F8XA 3HS3A 2WEKA 5T4EA 2ZKIA 1YIOA 1UWLA 1EJBA 5LP6C 3I4NJ 1EHYA 1RQLA 1NVGA 1ABEA 4YA6A 5DM0A 3RF7A 3A4TA 4BC0A 4EUHA 1I94B 2OTCA 2E1MB 1O3RA 4KJZA 3JD0A 2K40A 3BSWA 1T3GA 4GPAA 5HQ3B 5L3QB 4RTPA 1WOMA 3FDIA 2WB1A 4OINF 4HPWA 4ND7A 1SVNA 4I5DA 2RD2A 3ETLA 3RE1A 3EIFA 2QMHA 3RPUA 1NRJB 1J90A 2DFVA 3O4FA 4O4IB 3ESWB 4DQXA 3WICA 2A9FA 1T4BA 2R5ZB 3W6NA 4YG2F 3ML6A 3NHYA 1B73A 4TTQA 2AQEA 3E03A 1EP3B 5CJPA 3ZVNA 2RDPA 4BO6A 4RTKA 2GK7A 2XUAA 3EXEB 2RREA 5H2FC 2VZ0A 1XDSA 2VZ8A 3L40A 3K71B 2LY9A 2REXB 3ZV5A 3V7FA 1TQIA 1U3EM 1K78A 1QE0A 1W4AA 4Q3LA 3STUA 1I0LA 4CKCB 2BY3A 2Y1CA 3BAZA 3DZJA 3I2KA 1MORA 4EHJA 5CFMA 2OENG 4V0OA 3RC9A 1SNYA 1AKMA 2H8WA 1BGXT 1OI7A 3TZHA 1NXWA 3JQ8B 4HN4B 3FK7A 4IH1A 3DKRA 1P7IA 1MMFB 4PQYA 2JSPA 3QF7A 4X8MA 1S4MA 2J48A 2B8WA 3DPSA 3K94A 4ZVMA 3IDZA 1Y7PA 1EB8A 2O05A 2LR8A 4CO8A 3BKXA 1GUAA 1QU3A 3LPDA 4BNHA 4G0WA 3O83A 1U2PA 2GXAA 1QIFA 1YIJI 3IP1A 3SJUA 2R7UA 2DHCA 4O4HA 1QBKC 3M7GA 2HNKA 3RK0A 3UK6A 4K2HA 4HNUA 1G38A 2CXQA 2X15A 1FFBA 2QXUA 3EFOB 3K6SA 1HO3A 2FD5A 3BK2A 4XB1A 1E3HA 1V1RA 1YB6A 1YR2A 1E0SA 5DT2A 2CLKB 4YMTA 4B3SB 5DBOA 3MGAA 4V19K 2VPXA 3K9LA 3PT9A 4J19A 1KQ3A 3CURA 5A3JA 3ROEA 1WQ2A 2HEGA 5LN1A 3H8VA 3AW8A 1IUOA 2X4GA 4Y6QA 5DNEA 1P6RA 1E2HA 1WB6A 4QUAA 3UCXA 1HG1A 1T8TA 4IJMA 4PLFA 4PQGA 4BO7A 1XGOA 1DT3A 2F5CA 2ZBPA 2D74A 1FTQA 1QM5A 4RIHA 5E8RA 3VNQA 4BHBA 4HSTA 4ZYZA 1BA2A 1NNI1 1VSUA 3HFRA 4MB2A 2BZSA 3I3SR 3R3SA 3BCSA 5DEIA 2G07A 2LF7A 4O4LF 5AQEA 5HILA 4BLSA 1N1GA 3AEZA 4DSAA 2HOTA 1KJIA 4C6TA 2PX6A 5LLSA 1IB0A 2Y0MA 1E69A 1C41A 3GYHX 1Q1ZA 1S5PA 1MNEA 3V97A 3ZQGA 4A0RA 3T3EA 1MT3A 3VUFA 1VCIA 3WP1B 4L9AA 2JIZA 5KKCA 2AX3A 4P4GA 2IEGA 1GNLA 3N4MA 1P1IA 4B79A 4Z1OA 3HWWA 4MLDA 1F3OA 2QZ9A 1VMAA 3FDFA 3CZAA 3M4JA 2P2LA 2OGZA 2R2AA 3L1KA 5FPTA 2RHLA 2XNJA 4HSGA 3F1KA 3R7WA 4KAXA 3AXSA 1FFXB 1CRLA 1X38A 1M3SA 1GAQA 4OP1A 5IDYA 1WL8A 1OCRH 1NF3A 3DDNA 4KQXA 2P0AA 4UZSA 4XCVA 4A3SA 2ZUWA 5KCZA 1QVWA 2PYIA 4LB5A 3R5TA 4ENPA 2MYUA 3KXKA 4KBGA 1U5BA 4UUMA 3OYBA 2ZBUA 3ETDA 2I7DA 4AXBA 1XDWA 1S2GA 4RM2A 5B1SA 1EFPA 8AT1A 3D4OA 5I48A 3U7FB 4U9HS 2IS2A 1MRNA 4CQLB 3DE7X 3N74A 4LHEA 4MFDA 5J58A 2VTEA 2J67A 3AEQB 2QLZA 4Q7JB 1SURA 2BTQB 3JCUC 1VQKI 2CB0A 2GFQA 3CVUA 4G3XA 2WZDA 3GFLA 4RAZA 2YUTA 4Y7DA 5H9VA 3H4MA 3PIOF 4LGYA 3V8JA 1JVNA 3R9XB 1N3YA 1TIBA 2WVJA 5AJHA 4BGUA 3OZBA 3TMKA 4I99C 3L1HA 4I14A 4CV2A 1K8ZB 4E07A 1Z17A 4A9AA 1LFUP 3GLRA 2Z6VA 3CJRA 1MOPA 4YRMA 4D8XA 3KL4A 2B4KA 1Y98A 5JYCA 1DAIA 3HN2A 5I5GA 1X3WB 5LGUA 3CX4A 4KNWA 4EUEA 1PS0A 1I8TA 3BC8A 4DCPA 1EFRA 1LXCA 4C3VA 2XKBA 5GMOA 4CKWA 3I1IA 1E94E 1LW7A 1RD4A 5CVIA 2E4WA 1UPAA 1LDJA 2Q2WA 4GMXA 2GHIA 4C5CA 1V5IA 2X0RA 3BDAA 4EG1A 3VYTB 1AA6A 2OA4A 3IC7A 1WXGA 2EP7A 5HS9A 3D6MA 3VISA 4XWKA 4MYHA 2R44A 4KQ2A 2Z0MA 3H17A 3P2OA 5EXSA 1VSQA 1VSVA 2DWCA 3HRMA 2QTLA 4XLTA 5C4XJ 3ZKWA 1FIPA 1UBHS 5JS7A 5MDHA 4YFVA 2O3SA 4TMFA 1DADA 1ZMXA 2FE4A 3QELA 1EQAA 3D0RA 2EWMA 4A8HA 3L8YA 2QEQA 5FA8A 2GLOA 1XLTA 1XQ1A 3ECAA 3BLYA 4I4TA 5EE3A 2OCYC 5IT5A 1P2GA 2BWJA 2Q1YA 3GT3A 3IILA 4RJLA 4DMLA 1VG8A 4DNCA 1MDFA 4FTHA 2ET6A 1ONNA 4I1PA 1U3TA 2QQ5A 4BUCA 1SR8A 3SAJA 1MNDA 3MVPA 4M1ZA 4HAWA 4AKSA 2VPYA 2JA8J 1NHGA 1F51E 1GRQA 1PR2A 2AXEA 5DYGA 1Y37A 1VDMA 4R41A 3QMMA 3L6DA 3EZFA 3KTDA 3RUFA 4IMIB 1NTOA 1LEAA 5E0KB 4IUCS 5ECYA 2GEDA 2QX4A 4R1SA 4A92A 1QTRA 1G18A 1Y1KE 5F0FA 1WE2A 3I54A 5DTJA 3HDTA 4TXLA 2KRCA 4UBLA 3Q11A 4DCNA 3QFFA 3LP5A 3EW9A 2Q1XA 5LU8A 4EUNA 2ELKA 1P4GA 2C57A 4WBSA 4YK7A 2JLRA 1AZSC 5G0VA 2IODA 4L5JA 3HSKA 4IKOA 4W1PA 2FDXA 1Y48E 4N47A 3WAJA 4PF1A 4C2BA 3V80A 2PSSA 3OZFA 2RG1A 1SOUA 5I7SA 1ZAKA 1R6BX 4ZVOA 5CNIA 2EILH 1J1ZA 1DIRA 1EK2A 2M8EA 4RXMA 5DBFA 4C43A 3TB6A 5D8DA 4CF5A 4R1NA 5LQKA 5J1TB 1FS4A 2WUDA 4DNPA 5BO5A 4DM3A 2IXTA 2NZUG 1NXSA 2V6JA 5PNTA 2FQ3A 2ZREA 2VRNA 4HMQA 1L9KA 2GN6A 5HNFA 4XD7D 4ILKA 3G8DA 4NBKA 4BB6A 3TOBA 2IEIA 3AEKA 3RHFA 2PDAA 2AJBA 4PFPA 3VMFA 5CAEA 4L8YA 2VBIA 3ANYB 3GRFA 3IIIA 3THRA 4B73A 3BVPA 4F93B 2Q4OA 5KVVA 5MGNA 2YRXA 1LFPA 4RHFA 3F97A 4C4XA 3GTKJ 3QVVA 3H2ZA 3W2TA 5FPQA 4DM4A 3TIGA 3B1XA 3G2HA 3VPHA 3NOOA 1M2WA 1QONA 2H85A 5CEFA 4ES6A 1QPMA 4H1UA 4LYJA 2GD1O 4MPPA 2J6BA 1OAOC 3O2SB 1OX4B 2E4UA 2DU9A 2O2JA 3HCCA 5COBA 5BVHB 3U4IA 5IKXA 1QGUB 2BGUA 1N8SA 3KPUA 4MKZA 2YUSA 1L3LA 2ZRBA 3EZLA 3ANLA 1MGTA 2GCEA 3F6RA 4WKOA 4S04A 4HS4A 3PUFA 3ZOBA 1XVTA 4ZQGA 3L1UA 4H7IA 4E15A 3UPTA 4Y17A 2G5CA 2IY9A 4RTLA 4FBLA 4NESA 2VJCA 1OW3B 3C2GA 2LIVA 1ECFA 2UUCB 2GAUA 1PP4A 4XIGS 1RKBA 3AIOA 2R7XA 4S24A 1U5CA 1NG1A 1V2HE 1M34B 2EJUA 1AUVA 4G56A 5KOHA 1XNHA 1OBCA 3A6DA 3S17J 3FNGA 5D86A 3GU3A 5FLKA 2G5TA 4A3MJ 2H1LA 2Z2KA 3A9CA 3PKIA 4KRXA 1ZGCA 1KJQA 3H4TA 4R5MA 4JLNA 4Q02A 1J56A 2NN3C 1F06A 4QDZA 2QRGA 4XM0A 1FNBA 5KREA 3HXMA 4CHUA 4JWTA 1CVIA 1D6NA 3JRNA 4K46A 5F9HA 1TM4E 1UBFA 1FTYA 1YL5A 3HVHA 3QW4B 4RDIA 2VUSA 2GPWA 4M74A 3VM6A 3ROUA 4CQMA 4CHGA 5KINB 3L1PA 2JZYA 1GQSA 2XZOA 2Z99A 1AQ6A 2LCQA 4RW0A 4MKHA 3VC3A 1XDDA 1GHTA 3FVTA 3RYHB 1GXPA 3NBXX 1UMDA 3EOZA 4MA0A 5CUQA 2O0LA 1F4PA 3CJTA 4NZYA 3DQVC 1WDLA 4MQEB 1P2BA 4U4AA 2D5VA 5REQA 4ZYXA 3GO5A 3F72A 4RQBA 3SR0A 5MN4A 1KK1A 1Q0HA 2QCOA 1DMSA 5HP4A 1DMRA 1KZ7B 4KYTA 2G5GX 3KAQA 1PQWA 1NA5A 1Z3CA 3PFYA 1OI4A 3KHUA 4UV9A 2PKQO 4P84A 2B3TA 2FUG1 4PAQA 3H2IA 3S70A 3RRFA 4EY6A 5K0GA 2D4HA 1R74A 3H5IA 3L9FA 4OIQF 2Y77A 4EKYA 3COZA 5G2OA 5K03A 1C4XA 2ZCJA 3ORHA 1J42A 5DM7F 1TC1A 3A03A 1VL6A 2PJRA 2ALJA 2PL9A 2ZSFA 4OVKA 2GBLC 4OB6A 1KZ4A 2W6PA 1IBCA 2ATEA 3GRUA 2HSDA 4R2LA 3OP1A 2B5VA 2DFNA 3HBAA 3SXUA 2VC0A 3CESA 3J80Z 1U81A 5ECGC 3SIXA 3L3BA 1SOMA 2P6OA 3SDZA 1AA9A 1H2HA 1OZ0A 5BV8A 2QKLB 3CW9A 4W6ZA 2LCFA 2BE7A 4YP0A 2I8LA 2XZPA 3MERA 3PC8C 4OLFA 4D0NA 1PNRA 4YJFB 2WJPA 2Q6OA 1PP7U 4F3CA 1B8IA 4BFZA 2NTVA 5EJMA 4JODA 1B72A 3QE3A 4QXQA 1L4GA 3R20A 3TJRA 3JSPA 2GZRA 3JD3A 3OY9A 2X1DA 1N6KA 2AOWA 2Y99A 3GJXC 3W5AA 5KAFC 1IFXA 1KR5A 1XAJA 3IO5A 1XLVA 3P9RA 4QGFA 1T0HB 2W37A 4KPEC 3CC4I 4EI7A 2XT0A 3E48A 3PDIA 5TJ9A 5LPNA 1JTEA 1OCCH 1A76A 2W2TA 4P54A 5L53A 2WA2A 2Q21A 3R61A 5JZBA 3DKWA 2H1CA 4AF7A 2IV3A 3T99A 5ELMA 1L5NA 4B1FA 3UPDA 1WLSA 2NNNA 5CA1F 4ETWA 5EMNA 3QI2A 1PVEA 2WTBA 3D31A 1MSFC 2GXQA 3P2IA 2NXCA 2CUNA 1WDWB 2C42A 5FFFA 3MTDA 5BUSA 1NV9A 3GRCA 3SM9A 1TFUA 2ANCA 3FGOA 4Q18A 3IERA 3CVXA 1Z6TA 1BU5A 1ECGA 1KK0A 1T5DX 3K16A 4ZT4A 1EFVA 4PYQA 3LC2O 4MEYF 3GJZA 5ALIA 2P30A 1L7MA 2VSXA 3FNBA 3ZOZA 4I50B 4DIKA 4JLSA 4FMPA 4V3BA 3K6JA 1OC4A 3X1XA 4QGSA 1A5SB 3D7RA 4BP3A 2J9FA 4M0PA 3C3EA 5EUQB 3DZDA 3L7IA 4ZJPA 3E5XA 2PMUA 4AM8A 3HO8A 4IIJB 4HDNA 1WHTA 4CYCB 2V1NA 2F9LA 2CDNA 3T52A 1Z2EA 2E89A 3HR4A 4IZIA 1BMDA 3V4VB 3GC6A 4CI9A 1QU2A 4PYKA 1JZQA 1K2VN 4L57A 4KZPA 5TQ2A 4FFOA 3SMVA 4UM8B 4M89A 1E9DA 1ESNA 1IJWC 1I7PA 4TV8A 3ONWA 1YBFA 1P0QA 2AA3A 1KMIY 3UMVA 1SKMA 3AI3A 4ARUA 4UY8I 3W3AA 5G3ZA 2VQ6A 4PSKA 1XQ6A 2JIRA 4AJ2A 3CWCA 3DLIA 2RV8A 3EDCA 4RWZA 1EBFA 1T0UA 4ICIA 1P1JA 5E9WA 1NPDA 3KQLA 1YZKA 2IGMA 2L9NA 1XTTA 2IBSA 1WMSA 3BZUA 3GBVA 4M49A 2OAZA 4TL9A 3UHJA 4CKBA 3AK4A 2IEKA 1GUYA 1T3TA 1V16A 2P7IA 3BIJA 2ZSHB 5DCYA 4ZFNA 2D1YA 1MMSA 1DAOA 2ORED 4WBNF 1JPJA 4KC0A 4WLFA 1XEWY 1CNMA 3QZUA 4A8PA 1ZGAA 1NLZA 3VNAA 4UMEA 1AHDP 5HKKD 5IKPA 4IWXA 3NYQA 1I3QJ 2WPDD 2ACWA 1CLUA 1JBEA 2EZ4A 3OQ1A 3QENA 3H3XA 1HPLA 2VT3A 1GL6A 3AKDA 3KP3A 1U8BA 4RGSA 3R0XA 2QVBA 3NJ4A 5CCEA 2Z9CA 3SXYA 2ZXFA 1HLVA 1TMGE 4DG9A 2YZ7A 1SMYF 4L5BA 5A9SB 2ERXA 3CR7A 1U3CA 4JB3A 2PFBA 2W2OA 1D4FA 1TYBE 1NJ5A 1VKNA 2FWAA 5KAPA 3VSEA 1GG9A 3BZKA 4R98A 4LWQA 2UV8A 2X1HA 2JAXA 4HR7A 1CUWA 5KYVA 1BFDA 2RKOA 3N59A 1GTSA 4GLOA 4BQEA 1E89A 2L0KA 3LUFA 1RZVA 4P7GA 5DW0A 4R3WA 3BCRA 2ASEA 2FUG6 1A2BA 1HNZB 4A3LJ 2QQFA 1U3GA 3EDMA 4Q1AA 3V7UA 2G9UA 4KWTA 2DR0A 4HZGA 3ORFA 3VA7A 3CR3C 1RCTE 2I2AA 3H1EA 3F96A 5B7GA 5CBPB 1GNPA 1EVEA 4OHCA 3MD9A 3ZWCA 2P2CA 3E6DA 2WBLC 2COMA 1QANA 2ID8A 1WH5A 2JCVA 3AR5A 5AP9A 5AI5A 1MABB 3OKFA 3AG3H 3HOYJ 4RVOA 5CDFE 1JQDA 2NAFA 1FRVA 4FFDA 3DOOA 4M8NE 1AGRA 4LDJA 3IUEA 3QY9A 4AF8A 3K6RA 1SUWA 4BFWA 3DGEC 2MT9A 2CNBA 2PH1A 3WGIA 3ESDA 3HBNA 1C9NA 3JARB 4ZREA 4EY3A 2W22A 1PL8A 3KP4A 2JAHA 1QFZA 3A0UA 5CJJA 5JHGB 1O0CA 4G65A 4DYHA 4CT0A 2AOXA 2C5GA 1IZ0A 1SBIA 3R6GA 1N36B 2AFIE 4HDMA 5FUVA 5A6SB 1PJZA 3L43A 4OH7A 5HUQA 2ZMEA 1C81A 1Y6RA 3OZRA 4QBTA 3S1SA 1U2DC 1JT2A 4NVRA 5C3MA 3TGLA 1BFUA 3CT6A 4HGZA 3IUBA 1GNTA 2M6LA 3DFKA 2GPBA 4OGFA 3VOTA 2P91A 3UNXA 4PQEA 4TKLA 4MWDA 4ZGWA 2BEVB 3G59A 1MFZA 4DV4B 2P6TA 3K0CA 2R1TA 3SOPA 4EW2A 5DCMA 3PXCX 2V7PA 4MS1A 2Z5UA 2C0PA 4M1EA 2JI7A 5EJAA 2VHZA 4EBFA 1IULA 4G5SA 1KPIA 2BTOA 2YHSA 3FLAA 2EV9A 4YFXF 3GGSA 1WZCA 5ICMA 4GDFA 3Q7TA 4JK1X 3QH4A 1PW7A 3KU4A 5D7BA 3I01M 4TTPA 4LECA 3V8NA 1S2NA 3H16A 2ZIEA 2C9CA 2PGOA 4D4JA 3WNQA 1PWEA 3OCXA 2FFJA 5H9WA 3H5LA 1IAWA 2ZUTA 1QHSA 1IUKA 5FD5A 2IUYA 2X5NA 2IF0A 2QGUA 2H17A 4UXHA 3BILA 3IT0A 3U9GA 3DP9A 4YRRA 4RY2A 1DQPA 1C30B 3D5QA 3FUTA 3GK3A 1B1BA 3NONA 2XITA 5EY5B 4Z49A 3BFVA 3GPLA 2WIJA 1UMBB 4DHEA 3OX3A 1LGYA 821PA 4KMSA 4BKQA 1IZ9A 3RJPA 5F64A 1TU3A 3QSYA 2GBLA 1H22A 5IJZA 1VRWA 3A04A 4JSYA 5GIOE 3D0QA 4OL0A 5BN4B 1XC5A 3JRDA 3SWWA 4XLFA 1O3YA 3JSXA 5DGDA 1ZONA 2VDQB 3UKDA 1DX4A 4I55B 4B81A 1AK2A 4F46A 2VP3A 5AVTA 1YRLA 2YRWA 2WQZA 3DMDA 4BFVA 5DNDA 5KPDA 1KQ8A 2PO7A 4DWWA 1UOQA 4L0MA 1YB7A 3EVDA 3A1EA 4Q1BA 8LDHA 2YR2A 3IV6A 4CEIB 1DRKA 4OJTA 1G7SA 1W76A 2PK3A 3PC2A 4PXAA 1G9SA 4U00A 3ZOKA 2EZTA 4I9FA 4KEAA 4YHBA 5BQPA 1ZFNA 3DWLE 4PZCA 2DUMA 2HYIC 3ZWVA 1TKRA 5CPFA 4C7BA 2DYSH 1VDZA 5F4ZA 1YI2I 1T9AA 2DWUA 4ZYEA 1GAWA 3E15A 5GZ6A 4MP6A 4A8JA 2JANA 5IVHA 4ARCA 1DKLA 2WYIA 3JQ6A 5BR1A 3KHKA 4ZI7B 1KZYC 2K86A 4ZZ0A 4ER5A 1IAQA 4F4CA 3EWIA 2ZFUA 5HS7A 2HO4A 4QHTA 4BLOA 3A4IA 4BMXA 6YASA 2IEAA 3BFJA 4XUEA 4CMBA 1C9DB 3EXG1 1N6NA 1KJNA 4JGBA 3DNMA 3RROA 1I4LD 2XUFA 3I76A 3JXEA 1XR3A 3CKYA 3IWFA 3GF4A 2V0CA 3R09A 2PMHA 1GPJA 1O7LA 1C50A 2BMAA 3E9QA 4G4GA 4MYTA 5E9AA 2EBWA 5E8GA 2MC4A 4BWVA 3CCMI 5IJ0B 3O3NB 3L0DA 4K88A 1WOYA 1QZZA 1ZK1A 3GUDA 1F0YA 1W44A 1SXJC 2HJHA 2JI4A 1M1XB 2FQQA 2OWEA 3JQCA 4PAOA 5F1OA 5IJAA 1TM7E 2QV7A 3EYAA 3CPSA 3V2UA 4BVBA 1IJFA 1E59A 2BGJA 4GP7A 1R8QA 3SSMA 2IQ5A 3V1LA 3OQVA 1N34B 2KDOA 1E58A 1DPFA 2QX9A 3F8TA 2PUDA 3GFIA 4IQ0A 4ARZB 3RDIA 1TL7C 3CINA 3HVUA 4MB0A 1JTFA 2IXDA 3HOZJ 1SCNE 3D8BA 4Y6GB 2STTA 2VO1A 3KDPA 2JFGA 2ZAMA 3DPUA 4QPCA 2G17A 1GLVA 2HMVA 2P8JA 3PICA 3Q3CA 4X7MA 5BSEA 3QV1A 5DX0A 3HPQA 1ODCA 2EF1A 4ZDOA 3WIEA 4LF5B 4BEWA 3LFTA 7REQA 4FILA 2W6OA 2XD9A 2C7VA 3PCTA 4FSHA 4OKSA 4OSPA 1CJKC 4US1R 2DHQA 4N9IA 5EE9A 3SIPA 4EKNB 4M0DA 1XDGA 2BBOA 3KP1A 1C1XA 4UAGA 3HKBB 1RWNA 3Q0UA 1JKXA 2FR8C 2WJZB 5SICE 4M8LA 3SHTA 2R1VA 5E3NA 2YZ2A 1HE5A 5F7ZA 2FDCA 2EK5A 1NI4A 3OYAA 1GYQA 3T5XA 2L18A 2ZSIA 5JCOC 1IDOA 1XPOA 3BQ9A 4PO3X 4AY6A 7ABPA 2GA1A 2JASA 3I58A 5JSQA 1E3WB 4RB3C 2XAJA 3WTXC 1EHCA 2OHGA 2X7HA 3WGMA 1ZR2A 4KH0A 1KS9A 2Z4TA 4TQ9A 3FXLA 1FVHA 5HS6A 4N5LA 1E0DA 2HTEA 4J0JA 4AT1A 3KWJA 5CP8A 3TECE 2J45A 3MUEA 2ZCVA 1F3LA 3QU5A 4HSRA 4TMWA 3UHAA 1OLXA 1L5YA 4JHLA 4AY5A 3ECCA 3WYCA 2R7ZJ 2IFTA 4AN4A 4L9WA 3GN1A 5IYZF 2RKWA 3HUFA 1X0XA 1U0HC 1VPWA 5JAQA 4G8XA 5ALVA 5A2QZ 3V00A 1FQKA 1JSZA 2ZRPA 2R87A 5AFSA 3CUWA 5IBRA 3F67A 3OIYA 4JZKA 3BGSA 3KKQA 4G5GA 2JFYA 4OXKA 2HKXA 5IARA 5BRJA 4IIDA 4MHTA 2RONA 4JP0A 1UQTA 3FLEA 2J9ZB 4L7VA 3SM3A 2CNKA 2Q2VA 3ZDAA 3B6AA 3TLJA 1TI7A 4N5DA 1WNTA 1U9YA 4M6WB 1M6WA 3B6MA 4U7HA 1IZ7A 2B0LA 1I7DA 3I5YA 3L7JA 1VQNI 5BQTA 3IV9A 4J76A 5IWAB 1QS0A 4GBED 2E5LB 4BWYA 3FAKA 5ADWA 4I3FA 4LRWA 3CMCO 3FSJX 2KIFA 4ZJUA 1QQ5A 3L2CA 4F4JA 3TDUC 1BS2A 1DO2A 1FVOA 1HE3A 2P6NA 2B0CA 4GO1A 3D3QA 1OR7C 2UZIR 2V4JC 1BHQ1 1Y82A 1VJRA 1YBMA 2GPTA 4WJZA 3ABUA 5FT9A 4BLWA 5C9ZA 5K8UA 5FA6A 4J91A 1GVHA 4D3SA 3DOUA 2ESHA 1A1SA 1U80A 3GBGA 1XQXA 2XDYA 3LP6A 1RYNA 3LC7O 1Y4SA 2PHZA 4DV2B 2V6EA 2HPZA 2EZHA 2FPGB 3ME5A 4C1NA 1G9TA 3PUYA 3WJ2A 3ZK8A 4E1AA 1BG6A 3PVCA 1OR7A 1I36A 4JYCA 5LBUA 3GNSA 1GGEA 2UXNA 3GGJA 4JUFA 4MSUA 5IRCD 3SSAA 2W8BA 2C5AA 3KVOA 2HBYA 3HBJA 4DBRA 3TNJA 4IHJB 1D9ZA 2NQTA 2AG5A 4KN6A 3H9JA 4GQIA 2IXAA 3CNHA 1CX9B 3LUCA 4D4LA 3CQZJ 3ZY6A 2FPSA 1IRFA 3IAS2 2NTJA 5HZKA 2K02A 3TYXA 1J5EB 4JX5A 1PGQA 1SD6A 4A6EA 1M6VA 2BAGA 3PFWO 2C9ZA 3BTLA 3QTTA 1K4TA 3RC3A 5CW1A 3SJCA 4RJKA 4C5AA 3MKYB 5D1NA 2YS6A 1WGXA 2N9UA 5J2UB 4Q05A 2G1PA 2IGKA 2CB9A 1CLEA 3DULA 2ZYWX 2XCIA 4L4YA 4POAA 2YTZA 4MJ7A 5A4AA 1UXJA 1W1IA 3ESBA 4MX8A 2OESA 1Y1WJ 4TMKA 3RFFA 3ABTA 3SBOA 1T9ZA 1XTUA 2DWQA 4Q5SF 4UNSA 3AKZA 4X7BA 4YLEA 1O6FA 2ZS9A 1B59A 2FOKA 1QB7A 1M76A 1T5HX 3FDYA 2O23A 3B8HA 3MSCA 4O2BF 3C6YA 3REFA 1P91A 4LY0A 2ECCA 4YEJA 1SUBA 3DUFB 5DYTA 4UU1A 3T06B 5LP6B 1F8UA 5IM5A 1MO6A 2GCPA 3DTEA 1E2QA 2QTMA 2XMBA 4W82A 2YOHA 2G0AA 1NKSA 2PU5A 4ROTA 1R6XA 2NTYC 1WCXA 4UD2A 5FB2A 2GBGA 2NO6A 2QAGA 3RT1A 3IH5A 3TRIA 1E9CA 1UZMA 5BWOA 1A6QA 3NEUA 1K0UA 2CJJA 2NAZA 4HNTA 1PIWA 4XIDA 1E17A 1CNFA 2FY8A 2HA7A 4OIMA 4WVFA 1CP3A 2FSGA 4Y2RA 3ZDXB 2YOGA 2VQCA 4BL5A 2PTHA 1RR8C 3EDOA 3V3KA 5BMVA 2WY7Q 2I2FA 5CW2A 1A9XA 4AULA 2ATVA 2DOKA 4LGMA 5I4CA 2FW8A 4EABA 1RZRA 5F51A 2Y48A 5DI3A 2GM3A 1JQAA 2O2CA 3K4LA 1AE1A 4P2BA 2R00C 5T3UA 4D9BA 3CEHA 5A4FS 1DCTA 1I6LA 3U1DA 5I7OA 2Y05A 4GYWA 2DTZA 3KCNA 2CFSA 2GXSA 1AZLA 2H3HA 3NHRA 4JYBA 4XRRA 5I47A 4DCJA 3IULA 3MT7A 3UG7A 3L0BA 1Z73A 5JCZA 2M1ZA 3AF5A 1T0JB 1ZH5A 1HSZA 5DASA 3QVSA 5F1YA 2XLCA 1KA8A 2HXYA 1RIIA 3GFGA 4Z9FA 2V5UA 5FO1A 2O7RA 2G4CA 3BJOA 1T3ZA 2H7XA 4J1TC 1TTHA 4NXNB 5TB5A 1VKOA 2VQFB 1JU9A 5BWBA 2DQKA 4FDVA 1EWRA 4HD8A 3SHQA 3PNPA 3CCSI 2NUPB 1KOJA 2E18A 4XW2A 1FBQA 4WNIA 1WXEA 3JQDA 1IN5A 5HK8A 4J3NA 4AF6A 3O3OB 5TVGA 1CY2A 2APJA 4OYHA 2IOFA 1CQPA 1K1EA 2WIGA 4NL4H 3VHLB 3P9SA 3TB4A 1OAAA 1KYWA 1JKRC 3LX8A 5L3VA 4XUGB 3RS5A 2ZT7A 3CGGA 1JVBA 3MJVA 3TW8B 2A5YB 1JWAB 3PP8A 5I01A 4RA2A 1GRNA 1MQSA 4RGQA 3G2OA 3DG9A 1W8IA 1ORDA 2WNSA 1TKAA 4Q00A 3HOXJ 1C2YA 4CDNA 3VC1A 1LTKA 3AI7A 3IDAA 3GCWA 2Y1XA 4FZ5A 3WMFA 4TKVA 3ZWPA 3U7JA 4AROA 1G7RA 4GYGA 4NDAA 1D8JA 1VJCA 2ZIVB 5FULA 1MW8X 3PXXA 2N42A 4R16A 3NASA 4HJXA 1IHXA 1Z28A 2GYWA 3IEIA 1J33A 4NMWA 1ENHA 4QIHA 5A5EA 2W9XA 1ZC3A 1VRVA 1IZYA 1FC0A 2HMSA 1J25A 2RHDA 3RBXA 2P2DA 1SIBE 3WOVA 4MQ9F 2PL1A 5BT8A 3AMVA 5EJ6A 1QYDA 3DOEA 2I54A 2FQWA 2OUIA 4HPJB 4LD5A 4O0LA 1UT5A 1DWUA 2C1EA 4KCGA 4PR0A 2XA1A 3QBEA 2W48A 1AKVA 4YT5A 1Q5PA 3PFNA 1V11B 5HE8A 4U7BA 5EHZA 3B3FA 2PLRA 1WMEA 2VDPB 3CONA 4XAQA 2X0DA 4F7WA 4HRIA 2V98A 1SKQA 3M34A 2ODNA 3TP0A 5TPZA 2XBLA 5LYJF 1P45A 3SJZA 1RXCA 1JR3D 2IZZA 1G3TA 3IGFA 3O73A 4W5RA 3GW2A 3VR2A 3S1LA 4HUQB 3WIUA 1JW9B 1IQ0A 3LHSA 1CERA 3VODA 4JBXA 2AW3A 2PX3A 2SBTA 3BD6A 4NFLA 5JS2A 4ZI7F 5F9MA 4JI0B 3ESQA 4FGSA 2A6PA 3ROMA 4GKJB 1Y5MA 2J3JA 3I5AA 1YYVA 2AR7A 4FFWA 4KI0A 1OV6A 5D51S 5FNVF 4FYXA 1N2IA 4DCMA 3AL2A 4EW6A 5LBQA 1PQUA 3O74A 3R76A 2C7QA 2Q2EB 3FM3A 2YJTD 3JYOA 3J81k 4GOMD 3CZMA 2ZJZA 4IHKA 2PX4A 4KWIA 2VDMB 1VRCA 2UDPA 2KJCA 2J6CA 2XNHA 3G6KA 2KIMA 2M4KA 4JUBA 5BNFA 3D5EA 4L5IA 2WRZA 3ED1A 4DNFA 5C52B 4CT4B 1Y9AA 3B7GA 4PV7A 4TRMA 4JASB 2IY8A 2QTCA 1O6GA 2VK4A 3KJHA 3Q6NA 2GQQA 3CZPA 3C6XA 1CEXA 1E2NA 2ORIA 3D7LA 3FMVA 3LKZA 3W4JA 2P6RA 3AUJB 2XQFA 4I50A 5IZCA 5DCWA 3ZU4A 3P7NA 3GL9A 5JMPA 4IWNA 3PKZA 4HOBA 2FB9A 3BHNA 3NCTA 3GNQA 1P2SA 3K6GA 1X1CA 1LVGA 1K98A 1Z83A 2BW0A 1JSLA 3LTEA 4YDHB 3ZE7A 2P5VA 2ZB8A 4YPOA 2OUMA 5AXCA 3OHPA 5A4DA 1R88A 3MTIA 1PBNA 4M9ZA 3C18A 1PEYA 2UYGA 3JVDA 2KX7A 2UZ1A 5LLDA 5DCFA 4MYCA 3OE5A 5G40A 5HIKA 2QX8A 1U7XA 2XUHA 5E7MA 3VZSA 2CUFA 2JIMA 3GG9A 1ZO8A 4LMPA 1JFLA 1Y1RA 3QPCA 4ZEXA 1OZFA 1BTOA 4BB0A 1V5EA 5EESA 3CVOA 3ABSB 1GZ6A 1VLQA 3ESZA 4J9UE 2VYNA 1THMA 2HCFA 2HLNA 4EF5A 1USGA 3AOEA 4ZYYA 1EESA 2AXLA 2QBYA 5THKA 5HZMA 2KRHA 1QQ7A 4K6CA 5MGBA 3JQAA 1OF1A 4IJQA 3UQZA 2WM8A 3NKLA 4IHAA 2YCBA 1POWA 4O29A 1QV6A 3PR1A 4G5YA 4JDPA 1GG2A 3VI4B 3F6SA 4LF8B 1AKEA 4J0DA 5DFAA 1OWLA 4NHJA 4E13A 2HIAA 3TL3A 2DOFA 2I33A 2NQ2C 1U0FA 2P40A 4G0UA 4HYEA 3LYHA 3ZW8A 1X2NA 1KETA 3DHNA 5F1KA 2BY2A 3OLXA 4JI5B 4CWAA 4OQPA 3MINA 4HF2A 2ZI4A 1RMYA 1NOJA 3K9HA 4EUSA 5HK9A 3MZHA 1Y63A 2VHWA 2PCJA 4KISA 2RGNC 3ZVRA 3UJ8A 4IHWA 1XVAA 1FBSA 1C5KA 3ONFA 4HWPA 3GTOJ 1EF4A 2P9EA 2ZI6A 2CRGA 2ZPTX 3ZP5A 2XT6A 3LSJA 1NSFA 3UEOA 1LSSA 1LQUA 5JFGA 2CVPA 3GMIA 5DM1A 1NW9B 4EFKA 4TVSA 1MT0A 5C8VA 1OC2A 3WNVA 1KH1A 2HNAA 9LDTA 4JJ7A 1GZHB 4M46A 3DFZA 3DEFA 4ZHQF 1I4DD 2VE8A 2PKRA 2BHYA 2UUBB 2ZJ0A 1XCOA 3PDJA 3L7MA 3Q5GA 1O08A 4F60A 4QAJA 4BFUA 3N6VA 4TTAA 4K3VA 2B36A 2A9JA 3NC4A 1KOFA 4AZWA 4ZHSA 1P4JA 3ACCA 1CZUA 2PYDA 3KOOA 4RADA 5FEUA 3VNVA 2FLWA 3CG4A 1T2NA 2ILTA 4P83A 1KE1A 2AQKA 1W5EA 4EJFA 4LC1A 3DZKA 2WOJA 1T3HA 4WUTA 2IOQA 2FQ1A 3O3KA 2DHRA 2FWIA 4OI4A 4NOLA 4XASA 3ZXXA 2BZGA 3GVXA 5AM0A 1VIYA 1UPUA 3M3DA 1G20E 2FLKA 3SXUB 1EE2A 5M3FJ 3S2HJ 2I3BA 3H9EO 4IAOA 5F77A 1RAFA 2WHYA 1J07A 4IOJA 1UELB 4OP2A 3Q8LA 1BWPA 3IMCA 1UBEA 2LW7A 2OBFA 3S6JA 1ZRDA 3O8QA 2KT0A 3DQQA 4YONB 5BSKA 2F3QA 2GEUA 3L92A 1K7SN 2XMCA 2P9GA 3B5JA 3NYIA 1DC6A 1L0OC 1ZNWA 3JQPA 10MHA 1QVUA 1GU7A 2J3KA 1X42A 2JPCA 3BTJA 4C9YA 4BNGA 1K7XB 5KX5A 1KQOA 3B82A 4R2MA 4BV3A 1PTJA 1DFHA 3EQ2A 3G0GA 5LDHA 3PZBA 1X7ZB 5K2OA 2CYCA 2F1IA 3IKMB 5ALLA 4N0MA 4XTCS 1JG3A 1JG4A 3TKYA 1U04A 3F6CA 2GZMA 3PKJA 2RAFA 3LUJA 4JB0A 1TCAA 4MWTA 5FROA 4XL9A 2QM0A 3DLTA 1MJNA 1RI5A 1T4CB 4OHZA 4FJ1A 5FRMA 2JAWA 2VT2A 3LPLA 4G1CA 2CUKA 2CXPA 3NHSA 3I42A 4QGGA 4L9JA 5IDQA 4HLUA 4C5BA 3CTAA 2AF4C 2L42A 1N7HA 1Y33E 5AKXA 3EPPA 3K0CC 1AZTA 1XZBA 4GOND 3NQ41 4UFOA 1R15A 3VPXA 4BFXA 1VGVA 2FKNA 4BHTA 1MC4A 4EFMA 1ZCZA 5H16A 3U0BA 1RYHA 3Q87B 5JADA 3N7TA 3MD2A 4CA0A 3FPBA 3QGMA 4G4SO 1BHJA 1WXDA 2WYWA 4LJ7A 3LGXA 4BJHB 3BY6A 1G2QA 5E6RB 4K87A 2E60A 3ZCRA 2CLDX 3RHSA 3SQLA 2YJZA 4OQZA 2AOVA 4GPIB 1T6BY 3G2NA 3ZCXA 1R8SA 1H5UA 4F3KA 1BCRB 5FB3A 4C7MA 1Q0TA 1OWMA 2G0TA 1HCRA 5CNJA 1S29A 2WBMA 2Y0PA 2XF5A 4LXUA 4I19A 1WI9A 4FQGA 2WP8J 3L1VA 3UBMA 4NCAA 3AUTA 2HYJA 1J2EA 3HXPA 3P9KA 2V6BA 4WADA 4CFYA 4UVDA 3AWIA 4X41A 2Z30A 2VVTA 2KL4A 2W2LD 1VB5A 1EH5A 4IUDS 1MO2A 1V47A 4R40A 1P9OA 2VJNA 1OU4A 1TUGA 2WD7B 3Q72A 4Y1FA 3HPRA 1DP7P 2GZDA 3IMFA 4HDUA 5DTEA 4UQLA 2G0EA 4XRMA 2C7OA 1KEEB 2PSEA 1VA5A 1P3JA 5JI3E 2E5NA 5EJCA 2XQVA 3KXIA 4NE2A 2ZT5A 1E4EA 2OMKA 2OD9A 1Q22A 5IP9J 4AKEA 4MUIA 4RSHA 2ZM6B 3VHXA 3THOA 4QLCU 4BE1A 1GSHA 2C9YA 5IMBA 3WE7A 1UUFA 2O3RA 4K86A 5HKAA 1JQEA 2RGRA 4MDFA 5AKYA 1T38A