5F64A

Putative positive transcription regulator (sensor evgs) from shigella flexneri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
204
Chain Sequence
AMNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative positive transcription regulator (sensor EvgS) from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Transcription regulator
molecule keywords Positive transcription regulator EvgA
total genus 81
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f64A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f64A01
4KIGA 2DK8A 3MZYA 1B6AA 4PICA 2FN9A 3QU6A 4Q4ZF 4H60A 5FFXA 2JRTA 3CDHA 2A9PA 3PQJA 5AIPA 2Q0OA 4U7DA 2G9WA 1U5TA 2PMHA 4UHKA 2GI4A 2FQWA 1IF1A 1CHNA 2GBPA 2PUFA 3IP7A 3JVIA 2ZO4A 3ML6A 3EYIA 2O20A 2QQAA 4UVBA 4ZPJA 3I54A 5HDNA 1ZLJA 3O2PE 1S7OA 3EDCA 1BDJA 4O3MA 4KZKA 1EV7A 1JE8A 1LVAA 4Z4CA 1J0RA 5DD4A 4WX9A 4AIKA 4EJWA 4GNRA 4LLGF 1NY5A 2COMA 3CKMA 2PI0A 4PZ0A 2L17A 3H92A 2OU2A 3D02A 4PEVA 1SD5A 4N03A 5EWMB 2ID9A 5F6FA 2K4BA 3EJWA 4LD5A 3OLXA 5CLSA 4RB2C 2NT3A 3VNBA 3LFKA 5D5UB 2KJBA 4HLXA 4JOQA 3TDUC 2ZCWA 1L5YA 1BIAA 2DFIA 1MD0A 1YIOA 3K2ZA 3MYYA 4O5VA 5ILUA 3JS5A 2K02A 3BP8A 3DBIA 2EV5A 3DFGA 2HTJA 5FWYB 2WTEA 5LRRA 1DBPA 3KP4A 3FMQA 3M8EA 5ICGA 4YS6A 1ON2A 1P4AA 5TQ2B 3GYHX 2OZUA 3R0JA 3K1PA 4KRFA 3F6OA 2QWWA 4HX4A 3GLXA 2XVCA 4P55A 3NQOA 3SZPA 4Y15A 4N0BA 1STZA 2FBKA 3KTOA 3HJFA 1MZBA 5ILSA 2F5CA 1BC8C 2EWNA 1I5ZA 3H1GA 2Y0MA 2V1XA 2E1NA 3LQRA 1I3CA 4KQ9A 3C18A 4MNUA 4WXHA 2IA2A 1EH8A 3GRCA 4MS4B 4LGWA 3RVJA 4G0PA 3GL9A 1JL3A 4W5OA 2E4WA 2DW4A 3HRMA 1QQIA 4EM1A 4RXTA 4U0WA 1XB4A 1KMIY 4KQCA 2DQLA 5LBQA 4G7ZF 1Z9CA 5F64A 3ULQB 4IJAA 1ZYRF 3OV8A 1USGA 2YHAA 1R00A 3M9XA 3TMYA 2FEKA 3CS3A 4MEXF 3ZMVA 2NZVG 5J8CA 2QVOA 3J81Z 2L01A 5HQJA 3I59B 3A0UA 1R1UA 2CG4A 2HOEA 1DDNA 4ASNA 3GYBA 3N4MA 2ZBKA 1YW8A 3LKBA 2R4QA 3BROA 3V4GA 1U5TC 4MR7B 4G0ZA 1EWTA 3H1EA 2A9RA 3QAHA 5D8LB 1LDKB 3HDGA 3SNKA 5D6FA 4OATA 2F5FA 5HSGA 2A6EF 4XFKA 1BN5A 3NNNA 4FHTA 4UV8A 5HKOA 2PLNA 1FNNA 3TQNA 1XHEA 4YGXB 2QQ9A 3WGHA 4KN7X 1Z25A 4PGGA 4MR9A 5D2CA 1PP7U 2ISYA 2ZNYA 3T8TA 3T5XA 1T39A 5DGCA 2PN6A 2STTA 4M72A 5FWXB 3V7RA 4XRFA 4ENMA 1GHCA 4KK3A 4RY0A 1FPQA 2VBWA 1PUEE 1XD7A 3DZDA 4EJTA 3HEBA 1E17A 1Y0UA 1BIBA 5BQ3A 9ABPA 5CYVA 1U3EM 1MJBA 2E4YA 3GUDA 1XSVA 1QP7A 3ZMUA 2ZFWA 1FZPB 4L18B 2MYTA 2EFQA 2OA4A 1USIA 2YU3A 1OR7A 5A2QZ 4D0PA 2QUFA 1GUDA 3DXJF 4OMYA 4KIFA 4N9HA 3P7NA 1U2QA 2J48A 5ABPA 3F72A 4MQFB 2YX4A 5DDGA 1U8RA 1K6OA 1D8KA 1R22A 1ZG3A 1FP1D 1MDMA 3E5UA 1GUBA 3AAFA 1FBUA 3K1MA 1FX7A 3V7SA 2UXNA 3T0YA 4E70A 4CO8A 1QNLA 3JPYA 3DQVC 5LGUA 3FHZA 2A07F 8ABPA 3ROFA 2RKHA 1ZVVA 2X7XA 5FBKA 1GXPA 2LBPA 3F8NA 3LSTA 1ZRFA 4CBVA 2FMLA 4G86A 3VB2A 3I42A 1XGOA 4ETSA 1ZY2A 1I1SA 3RQIA 2QZJA 4LG0A 1KU2A 4ENJA 2GX6A 3QLVC 1NXSA 4CZZA 1BI1A 4MRMB 2WY2D 3KFWX 5IBQA 1Z6TA 4H3KB 1LB2A 3O2JA 2BGCA 1F51E 5FWYA 2MC3A 4EGYA 1Z05A 3FDFA 1XCBA 2VXZA 2FOKA 4JK1X 4DNCA 1H9GA 3LA2A 2W57A 4G0XA 5JR3A 3MZHA 3KE2A 3RKYA 4G7OF 2VYCA 1IRGA 3KP3A 1FFSA 1MJAA 1LBHA 1E6LA 4HLYA 2VOOA 4G0YA 1O7FA 2IVMA 1R58A 2FEPA 4MGEA 3H3UA 2L19A 2D2WA 3G3ZA 4ZYDA 5TQ0A 3WTWC 4TLLB 3W6JB 3COAC 1Z12A 3S2WA 4JAVC 3I64A 4MS4A 2IYNA 4A0ZA 3NRVA 2E1CA 2LUOA 1RZRD 4MLCA 4PDKA 1P4XA 1PP8F 3BPXA 2WB4A 1ZRCA 4ZZLA 2M1ZA 2XAJA 3F8CA 3QX9A 2ADUA 1QP4A 4IF4A 4G97A 3MEXA 3EODA 1RPJA 4XXHA 1DCKA 1SXIA 1D5VA 4Z99A 5BPIA 5EEGA 4BHPA 1O7LA 1ZH5A 4F06A 2XHKA 3LUKA 2W42A 4WZZA 4LB6B 4A6EA 4RZSA 3EGCA 4EYQA 4A12A 5HDKA 2MLGA 5JHUA 4NCAA 1Z6RA 4WK8F 5IT9K 5HS7A 3O6BB 2ETHA 2EK5A 4P5OA 5CVJA 1JHHA 3WU1B 2VK2A 4BNCA 3F8FA 3KEOA 3SXYA 1QQBA 4JBAA 1FBQA 1QZYA 2D1VA 2RQPA 3JTEA 2PQ8A 2DBBA 1DG9A 2M98A 1T6SA 4HQEA 3DLHA 2QENA 3ZMTA 2YR2A 4IRIA 1IW7F 3N0XA 1JYFA 2PLYA 2L18A 3E61A 4IMJB 1KU3A 3VFZA 3N8IA 1Y1LA 5H6RA 1SXHA 5EWJB 5BRJA 1ONVA 1SRRA 1FBSA 2PUBA 1KA8A 1V3FA 2CW0F 2FLWA 2FXIA 4MYRA 3LKVA 4U0VA 5IX8A 1S29A 3R4KA 4MQ9F 3J7AO 3LMKA 2HFHA 4M6XA 1BAPA 3E3VA 2IRFG 2O6GE 5DEQA 3D8UA 3DGFC 4RS8A 2IA1A 5FGMA 4KNYA 4G6DA 3EQLF 4RK1A 3Q5FA 3F6PA 4EVQA 3FMSA 3L49A 4Y9TA 1MJ9A 3HSFA 2Q5CA 4N41A 1FP2A 1HXDA 3K1NA 2Z5UA 2CHFA 3WGIA 5DUKA 2LIVA 1B9MA 2VC1A 3ISPA 4KMUX 1OYWA 4ZYEA 5HOOA 5LHIA 3LUJA 5LLQA 2L2QA 4Z9BA 3DEUA 3KYJB 4D6XA 3TD9A 3LUHA 4ZH4F 1CF7B 3DV8A 3I5UA 3WODF 2VBXA 2Z9OA 2A69F 5FBHA 4IRGA 5FLXK 1HKSA 2AYZA 2MA3A 1F5TA 4M73A 1Z18A 2WMYA 4AVPA 5EWJA 5IUKC 4L4UA 2JVIA 2XV4S 4YFNF 1YLFA 3CO7C 4BH9A 4M9XA 4RAYA 2V0NA 2FSPA 2HQOA 3GO5A 4D6YA 1ULYA 3HXMA 3NNSA 2HKXA 2K27A 2XAFA 4Q47A 4MS3A 2ZMEB 1JDNA 1BI3A 1BI2A 3C3WA 2KKOA 1K66A 3OM1A 2QYOA 4UV9A 2FQXA 3HOTA 4MR7A 1KQ9A 5D6EA 3JAMZ 1FYKA 2PE5A 2IOYA 2PL9A 3QX8A 4G0QA 3T38A 1F9NA 3BZ6A 2DT5A 3GFJA 5E1XA 5FD5A 4OOIA 2FNPA 2PMCA 4HYEA 1RXEA 4M71A 2V6CA 1WETA 4KIBA 2IJLA 1YVUA 4XARA 2KIUA 5LEJA 4H0EA 4FX4A 4HDVA 1E6MA 3U9GA 3QLUC 1XWWA 4L5IA 3RVKA 3NNDA 3QRFF 2QXYA 5IT9Z 2YX7A 3TGNA 3H5LA 1T38A 4RGSA 1YS6A 2W85A 2WV0A 4HDUA 4HAMA 3UUGA 1ZGJA 1ZN2A 2CGPA 4DN6A 3VOEA 4A6DA 3FMRA 3VNAA 1CF7A 1B59A 3HHGA 1URPA 1YMVA 1CYEA 2IPLA 3HZHA 4EJVA 4L0ZB 3KP6A 3QEMB 2JBAB 7ABPA 3Q7RA 5K5QA 3LUDA 4CYDA 3GXOA 4XASA 1QNTA 1GCGA 3Q9VA 1Z2DA 5H6QA 5BRAA 3JTGA 1RI7A 1ZLKA 4LB5A 1LDJA 2PAFA 3H5VA 1B4AA 2QR3A 2JSCA 4TMYA 4MR8A 1NXWA 5CNIA 1PDNC 4GCVA 4Q7EA 2DTRA 4RK5A 1ZG1A 3GVAA 3TKYA 4RU1A 2K7LA 4B8XA 4FE7A 1HKQA 2BV6A 4ZMRA 1S3JA 3M6MD 4N0QA 2P6TA 4FB4A 4ZYLA 3EDPA 3E5XA 1D5WA 1BVHA 4LG0B 1BJAA 3O75A 5FFZA 2IDMA 5E3JA 1G6NA 2TDXA 5AIQA 1OXKB 2QLZA 2GZWA 5BOXA 2HR3A 4G0MA 3UKJA 4LX8A 3G73A 2VODA 4RB0A 1OPCA 4JQFA 5KWSA 2IPNA 4R79A 2M1BA 4Y17A 5IC5A 3TDZC 1TQPA 4HNRA 2M8EA 3FXQA 2HGCA 1J59A 3WU0A 1O3RA 3E97A 3W9SA 2L4AA 1EH7A 1IUYA 2R7DA 4ETMA 4UHJA 4RGUA 4WXCA 4TV7A 3G85A 2V9VA 1DJMA 4ENNA 2XKOA 3RYPA 1ZH2A 1VTNC 5GQSA 3L9FA 5LHGA 4UVAA 1R7JA 3F3XA 2A3SA 4G8XA 5DTEA 1DZ3A 1G3YA 1TLFA 2FQYA 3MQ4A 4MHGA 3GV0A 3I4PA 3MMNA 2QV0A 3MM4A 4MS1A 1QPZA 3TO5A 5TPWA 3OMXA 5K5RA 4KK4A 1EHCA 4TLMB 1HW5A 3GWZA 2BE5F 1XSDA 3ECHA 3WTYC 2HQBA 4EGSA 4N76A 3LQQA 2ACJA 1SD6A 3IPAA 1JH9A 4MS3B 4WT7A 4CXFA 2F8TA 1PEAA 1GLGA 5T3YA 3LA7A 3W6KB 5E18F 1SMYF 3GEZA 3H1FA 1QBJA 3CUQC 3GW2A 4HNSA 2PG4A 1USSA 4P1ZA 5TQ0B 4YO7A 4KA4A 5JNTA 1ZGZA 5L3DA 3KCCA 3HCWA 2ZAYA 3RVMA 3HOSA 2B4AA 1U0SY 1USKA 2PUCA 2UWMA 3SG0A 3RIRA 2P5LC 1OKRA 3RDIA 1AB6A 1IAWA 3HRTA 4NHJA 1U2PA 3SM9A 1U04A 1M5TA 4HF0A 1K68A 1G3SA 4M88A 3V7CA 4MQEB 3O74A 4HF1A 2QQBA 1T2KA 3RPUA 5IUJC 4Z2YA 2HDCA 4A0XA 1I1GA 4KMRA 2V1UA 1KU9A 2W84A 3I58A 1ZARA 3HK2A 3QPHA 1YTYA 1ISRA 1R36A 2D45A 3OLWA 4R1HA 3RI4A 3EUHA 5ICEA 3RJPA 3IL2A 4EY3A 3L2CA 1XGMA 4IPAA 4PCQA 2YSRA 3IWFA 1TNSA 3LFTA 5JNUA 1W5TA 3L7WA 4YFKF 4M9ZA 2RJNA 1I27A 1W7PB 1UCRA 3R61A 2Z3YA 1IN8A 2CHEA 5CHYA 4U0YA 2VBZA 1TQMA 3CU5A 2W25A 3C7JA 3TO7A 1QO0D 5J6XA 4WCGA 3T8RA 1MDMB 1OMIA 4BAYA 3R60A 3E6CC 1HW1A 2A61A 4RWEA 1DPUA 4EM0B 4U7BA 1TLHB 3WE3A 2PL1A 3GFMA 4RS3A 2EFNA 2EA2A 3JVDA 1QQAA 3HSRA 2FMKA 1IXRC 4PZJA 2DO7A 1U5TB 1EAYA 3MWMA 5CNMA 3K69A 4IXAA 4F3TA 2KJCA 4UVCA 5E8GA 3FM5A 1DP7P 4ZYHA 4B09A 4LDZA 1LJLA 3C3KA 3H6GA 2E4ZA 3F6CA 2O61A 3RYRA 4O1IA 1TQIA 1RZ4A 2RC4A 1R8JA 2FNAA 2OENG 1FC3A 1IN7A 3MAJA 1F4KA 5IT3A 2IPAB 3CLOA 1A2OA 2KRFA 1ABEA 3OO0A 5D4RA 4UXNA 2NT4A 3H6HA 4ZYGA 3M7GA 2F8SA 2JVKA 1LNWA 4Z4FA 5KQGA 2LSOA 1P4WA 3C6QA 3ZMZA 4IHTA 4L9NA 1QZZA 3IPCA 1GXQA 3I5AA 1DRKA 5JNRA 4N9IA 2WJAA 2GXBA 3FX3A 5A2QK 2H6CA 2H6BA 4QYWA 3BJ6A 3CUQB 1MAVA 5JI6A 3P9IA 4W5NA 3I71A 1KGSA 5D5VB 4BQAA 1JGSA 2M30A 3WTUC 1W9HA 4IRHA 2HEOA 4P96A 3O1IC 3I59A 1FFWA 3IDOA 5B3JC 1MVOA 2F5EA 2FMHA 4OG2A 1JDPA 4M9SA 5CNJA 2QZ8A 1D1QA 4WXMA 3U1DA 3HS3A 3GWGA 1O3QA 3EETA 3TOAA 4FX0A 1USTA 2EB7A 4BHBA 5KC8A 2CYYA 4JB2A 3TO6A 4XSXF 1WSUA 1YS7A 3IKTA 3LTEA 3ZPLA 4ZZDA 4FE4A 2C6YA 3HM9A 2MSLA 2FRHA 2DI3A 2VC0A 2DAOA 3JAMK 1TVMA 4WWCA 4WUTA 5CJ9A 1QO0A 3L00A 4YG2F 1C0EA 5CVIA 3FFXA 2RJOA 4O5AA 1MKMA 3F21A 4F12A 1KRWA 4KYWA 1KQ8A 4RK4A 4HX8A 3PQKA 1SMTA 3HDVA 1NXTA 3OM0A 1JFVA 2ISZA 5BQTA 1HBXG 3BDDA 3KSMA 5LRSA 4IHSA 3QOPA 1BA2A 3O3KA 4AIHA 2B1JA 4LE0A 2EV6A 2CO5A 4L9JA 1XDUA 1HEYA 1VLZA 2RGYA 2XIGA 1Q1HA 1JFTA 2FSWA 4A0YA 4EYOA 1QKKA 3H75A 3IWZA 2FQ3A 4EM2A 1Z2EA 3A10A 3MIZA 3QELB 5L3BA 3T8YA 2JT1A 4HX7A 1DP4A 1AB5A 2J5PA 4KPYA 1WRJA 4I0BA 3QEMA 2RVCA 1C4WA 4I98B 3Q9SA 2IA0A 2DU9A 5JNVA 2JPBA 1FLIA 4E7PA 2CQKA 5CVVA 1YFHA 4F8JA 4I01A 3N75A 2K86A 4P9FA 2P7VB 2XRNA 4KMFA 2GKGA 4O6JA 4HV5A 3FXUA 1DPRA 1O3TA 5C5EA 4JASB 4IVNA 2M87A 1J56A 1SFXA 4G94A 5L3CA 4MTDA 1UFMA 2MD5A 1SFUA 3CUOA 2PUAA 1A04A 2ESHA 2FEWB 4ETNA 1MB3A 5HS8A 4CICA 4HBLA 3GA5A 2PUDA 2FF4A 3BRQA 4I0AA 1FFGA 4GPAA 2K4JA 2IW5A 1KU7A 2PJPA 3N53A 5D5XB 3MCZA 1ISSA 3I45A 3GT7A 5HLHA 2B0LA 2A68F 5HVQC 4L5JA 3ZQ7A 4P9UA 2HSGA 4RSMA 4Z0NA 3O2SB 4MLDA 4GO1A 1YTUA 3VODA 5GOTA 5D5WB 4RDCA 1WI9A 2ID7A 1IN4A 2A9OA 4L0YB 4EGZA 3FGZA 2FMIA 2CSOA 1REPC 4JB0A 1NATA 2P4WA 1TMYA 1ZAYA 5PNTA 1RUNA 4RY8A 4I7HA 1SD7A 4EMSA 4MTEA 1UHWA 3QELA 1P2FA 4EJOA 4N47A 2JZYA 4LMYA 5CNKA 5JS1A 2VOPA 3WGGA 1U78A 2FXAA 4G0OA 4IILA 1Z1DA 1FT9A 1F4VA 2MSKA 2Y75A 3JPWA 4MQVA 1YW9A 1EH6A 1C0WA 4QYMA 6ABPA 3T6KA 3IRRA 2CFXA 5K1YA 3TB6A 4GXOA 3QLVA 5TPZD 1LQ1A 4KDPA 4O1HA 1Z7UA 1K78A 1W4MA 3D0SA 4RXMA 4G9YA 1XMKA 1ZH4A 4HW0A 3NHZA 4Y13A 2P7CB 3D5LA 3JW4A 2FVYA 3LAJA 3GFIA 4P98A 2EFWA 1ZGGA 3ROTA 3GZ6A 2VT2A 2STWA 5J8FA 1TJYA 3OMWA 3HRUA 2X0LA 2WWVD 3REOA 3CG0A 3S99A 5KK1A 3KLOA 1YK1A 2VE8A 1FYMA 2NRAC 1IN5A 3LA3A 1D8JA 4RKRA 5I4CA 2YPRA 3GBVA 3ELKA 3RVNA 3E6BA 1ZG5A 2IT0A 3HO1A 1U8TA 1X3UA 1YG2A 2XAHA 1AWCA 2P4UA 3O1HB 4UHTA 3RH0A 3WG9A 2R3SA 3GX4X 2VE9A 3N97A 4Z4IA 2XAQA 3ZN0A 2FE3A 5HDGA 4MGRA 3FFWA 3N6VA 5DD8A 2LDUA 1BOAA 3F7NA 2XAGA 3CJNA 1XGSA 5B3JA 5JVTA 3ROUA 4BYYA 1M5UA 5DCMA 2QVCA 2QVGA 3RTRA 4MRMA 1R5GA 1TNTA 3OLYA 2QBYB 4MPTA 5FO5A 3SHFA 5ICCA 1ZAOA 1IZ1A 5JNSA 1ZHFA 5D8KB 3CG4A 3KP7A 2V1DA 5LGTA 2G7HA 1OXBB 1G4DA 3P9KA 2O03A 4XLNF 5K5OA 2Y48A 1NXXA 4LRQA 3HV2A 3UK0A 2F5DA 2RGVA 3OLVA 3KETA 5FD6A 1LJUA 4L9VA 3OQMA 3CHYA 1G3TA 1FSHA 2Z33A 3WTVC 1K7AA 4Q48A 1NXOA 2R25B 3QLTA 4FT8A 1DCFA 3L6UA 3B73A 6PAXA 3IKVA 1PNRA 1GCAA 1PNTA 4ZMSA 4DQ2A 5BPDA 5F1RA 3RVSA 4Z4GA 2HS5A 4MR8B 3CNBA 2M5WA 3MA0A 4LK1F 1NTRA 4GYGA 4CHUA 1L0OC 2Z99A 2KIMA 3FMVA 4EQQA 2FU4A 4Z4EA 1F1ZA 2MH2A 1WKMA 1J5YA 1DC8A 1TBXA 3C97A 6CHYA 3BY6A 2UZKA 2ZWMA 2H27A 1B1BA 1OYIA 2CWEA 5ERIA 1W25A 2H0AA 4LK0F 5EWLA 3WE2A 4A5MA 3GFLA 3ERED 1UB9A 4GGGA 4KV7A 4HQMA 4LLLA 3F6VA 4EYKA 2DPUA 5ILVA 2A9QA 3R0AA 1E2BA 1SAXA 3F8MA 3E5QA 2QBYA 2P9HA 3BBLA 2EV0A 3A0RB 5E1ZB 2LP4Y 1FQWA 1O57A 1Z91A 3WTSC 3K9CA 4YLEA 2HZTA 1H0MA 1KYWA 2JK1A 1J2XA 3SFZA 2VT3A 3F73A 3SY8A 4YCSA 3KG2A 2NS0A 3EQ2A 5DLEA 3DKWA 3IRQA 4AIJA 4EVRA 1LK0A 3OQOA 3B02A 2VUHB 1R1TA 3HSEA 5HLGA 3HTUA 5BR1A 1JHFA 1RIOH 1IXSB 4HZFA 3O2QB 4Q5SF 4YRZA 1CEYA 1H9CA 1DC7A 4I02A 2AS5F 2UXXA 5BMZA 2OZ6A 1TTYA 3K0LA 2IPMA 1XSXA 4QICA 4YP9A 3JTHA 4PE5B 1Z15A 4AWXB 2MYPA 1ZREA 5LHHA 3H3ZA 4HV6A 3ECOA 3H5TA 2JVJA 4S04A 3LWFA 4LE2A 1AOYA 4MR9B 4Z4HA 4OIPF 2DPDA 3MFKA 3K9TA 2P6SA 2GA2A 3BWGA 2IPQX 1HSTA 1H9TA 1RZRA 5DUIA 2J5OA 3QP6A 1FWZA 1JBEA 1Z17A 5CVUA 4MAAA 4ESFA 3HUUA 4WXDA 1J75A 1YK0A 4EVSA 2V79A 4KICA 2VUIB 2KIFA 3RKWA 2TMYA 1G3WA 4OINF 3CZ5A 4XSZF 4AD9A 1LEAA 1P8AA 1L3LA 3NHMA 3IP9A 3CZCA 1D4ZA 4HA8A 3TO9A 1R5HA 4WF2A 1P92A 1SXGA 2MH9A 1T34A 4CGZA 1ZITA 4QWQA 2LKPA 3Q7SA 1NHAA 4W5TA 2HYGD 1P6QA 3P9CA 3ILHA 2VONA 1E2XA 1XHFA 4Z9AA 1ZRDA 3P9YA 4IGAA 3KKEA 1NXVA 4W5RA 4LE1A 1B00A 1T0FA 4PYRA 5LEKA 4NV3A 1Z26A 3H5WA 4NCBA 3GBPA 4I09A 3HTSB 1RUOA 4YR7A 3J81K 5DCMB 3BRSA 4KN4X 2NNYA 3EYYA 3LUAA 3BOQA 4DQDA 2ZXJA 4EJUA 3IHUA 5EEHA 3I09A 3DP7A 2ELHA 2VN2A 1DBWA 4RKQA 1VKRA 2F2EA 2A6HF 2W24A 3KS9A 5DCFA 3RVPA 2BGGA 3QK7A 1L5ZA 2L3DA 4MS1B 3JSOA 4TN5A 4IMIB 4CDGA 4RB1A 2GXGA 2HYFA 5L3FA 4NQWA 2ZMEA 1FOKA 3RKXA 4XBFA 1I6XA 2AXLA 2LF8A 2O3FA 1E6KA 2BYVE 2JBAA 4KVFA 5HM6A 1VRVA 2HTSA 1GVJA 3FWEA 3WTZA 2RDPA 4NQRA 2O0YA 5FLXZ 3KP5A 4A2UA 1SD4A 1YQAA 2XROA 1IN6A 1BDHA 3M8FA 4WWHA 3ZP5A 2E4XA 2XDYA 1CGPA 2FN8A 4GYIA 1BC7C 2JTVA 4PGHA 1TW3A 2OQGA 4RB3C 5KQMA 1HKTA 4L85A 4HF2A 5E20A 4RGRA 1XN7A 1APBA 4LZLA 2GIVA 3T1BA 4NB5A 2MSWA 4XLTA 1JWLA 2G7UA 3V8JA 1LBIA 4YIFA 2WC2A 1HW2A 1KYZA 3IP6A 1XDSA 4IRXA 3H5OA 2WRZA 5L3EA 4BXUA 3URMA 3CRNA 4XAQA 3NBMA 1J9IA 4Q6BA 3J80K 2ZJ2A 2H09A 5D4SA 4BHCA 4RAZA 3KP2A 3ZN1A 3BILA 5T7BA 4RGXA 4OU0A 2JPCA 3DPLC 2LF7A 2CD7A 2O8XA 3DPTA 1W7PD 5H20A 5HLIA 2NNNA 1QMPA 3RVQA 1JHZA 5TJJA 4OIQF 1DUXC 5AONA 1DRJA 1YW7A 2ZNZA 3O21A 2H94A 5E8IA 2E7XA 1SFEA 3C3MA 4KT5C 3M1EA 1W7PA 4OLAA 4F7ZA 2M45A 4G7HF 5IEJA 4JA2A 1JXSA 3EQZA 2PUGA 2AYXA 3HHHA 2RN7A 2DRIA 1YMUA 4W5QA 4LLNA 2OQRA 1PEYA 1FSPA 5TQJA 1S8NA 1ZDMA 1HQCA 5IULC 5BS6A 3C1DA 4EYGA 5KQLA 1P6RA 4MEYF 3N0WA 4XLPF 1FY7A 3RVLA 2HWVA 3A3KA 2EJRA 3SAJA 2EFOA 5JFRA 1Z16A 5LGNA 5KC9A 5HS9A 2FMFA 4G6QA 4OLBA 3DGEC 2E7WA 4YFXF 1XCVA 1QPMA 3TOBA 4OIRF 4KFCA 3J80Z 1EFAA 4RK7A 2JRLA 3K4HA 3QLUA 4RY9A 4ETIA 1LJ9A 2FBHA 3CUQA 2FKAA 1KQ0A 2XKPA 4M74A 3HRSA 2QM3A 3CTPA 1A0OA 2D1HA 3BPVA 3E3MA 2IP2A 2OD5A 3PFIA 1UDRA 4KUMA 2FTKE 5DKFA 1QP0A 1JFSA 5KQPA 1ZHHA 2KYRA 3H5IA 4RK0A 4OIOF 1S6LA 1S7AA 1FYLA 2E4UA 3KHTA 2JCGA 3M9WA 2PEXA 4ML3A 1K78B 3OO1A 3O1JC 3CTAA 1JLKA 5IUNC 2P5VA 1M2FA 2P5KA 1WQ2A 4MQFA 4ON0A 3FXRA 1ODDA 4YIIA 1ON1A 2NYXA 3ABUA 2EFPA 3KZZA 4S05A 3FM3A 2FA5A 2GWRA 2ZKZA 3DF8A 1K79A 2WJWA 4UUVA 3ZMSA 4ESBA 4OBBA 4RV5A 3KYIB 3OQNA 3V8LA 5KI6A 5JS2A 5DCLA 3EAFA 1XMAA 3RVOA 2IKSA 1BI0A 1PUXA 1MGTA 2OBPA 1TM2A 3I0TA 1JX6A 4OTZA 2HKOA 1R1VA 1YO5C 1W5SA 3KLNA 3VEPA 2E4VA 5ED4A 2PBIA 2NZUG 3B2NA 3F23A 4H3HB 4JP1A 1FSEA 3QU3A 3LUCA 5FWXA 1JF8A 3SZTA 4ESJA 4L9TA 3V8KA 4YWHA 3Q41A 3BJAA 4RXUA 2L54A 5TE9A 1T98A 1MB0A 3OLZA 1O3SA 4WXEA 2WWYA 3F8BA 3G1WA 1BM9A 2GAUA 3IC7A 2VBYA 4RK6A 4HOBA 5TRDA 3HSYA 5E1WA 3Q7TA 4E7OA 2MLKA 2GA1A 3HYIA 1R23A 2HQRA 1U2WA 2YHBA 3QEKA 3OOPA 4OMZA 1LEBA 2MYNA 3CFYA 1WWXA 3I53A 1IIBA 1BDIA 2DQRA 2QSJA 4QPJC 5L3GA 2L4MA 1P6UA 5C5CA 2R48A 1MIHA 1Z13A 2FMYA 3DLBA 3F22A 4HNQA 5CVRA 2BEOA 2LNBA 3EULA 1D3YA 1TW2A 4F11A 5DYMA 4ENKA 1J7KA 3HUTA 3WTTC 2HJ9A 3LUGA 1QGPA 3FZVA 5KVRA 3GF2A 1DBQA 1RXIA 3Q15C 2L02A 5E17F 3KJXA 3BJOA 2MBFA 1XGNA 3QP5A 3QPTA 3ILYA 2Q2EA 5FB2A 3E6DA 5TPZA 5EWMA 1D2AA 3LAPA 2PKXA 3HUGA 3CO6C 4LDAA 1JYEA 4U88A 1M2EA 1RNLA 5EWLB 4K2EA 1D1PA 2BBYA 3GZ5A 1UHMA 2NAZA 2RNJA 5ICFA 2QU7A 2MYUA 2P8TA 2R7FA 4QLCU 2HPHA 3R6SA 1PHRA 4DADA 4N0PA 1ABFA 2FEZA 3E6MA 1YYVA 3LUFA 2PMUA 1B9NA 2JB9A 1IXCA 3IP5A 3RPQA 5TPWB 2PFBA 4KREA 2FLKA 4MQEA 4YV7A 1DCMA 3FFTA 3ABTA 3M9AA 3KCNA 2NUBA 2N9UA 3LOPA 4D74A 5JNWA 3HVRA 1LDDA 3N0RA 3WTXC 1HSJA 4EVIA 2FBIA 3SQNA 2QW1A 2RV8A 1NXPA 5IEBA 1V4RA 2PJUA 3NEUA 1KRXA 2Q8KA 2OAZA 2I6FA 4I2OA 1ZESA 3RVRA 2X4HA 2HQNA 2LPMA 5DV5A 2EA4A 3KZYA 1IRFA 2H3HA 1OYYA 2XASA 4LJZF 4A5NA 3MF4A 3JSPA 1BBYA 2A5YB 1EWVA 2ESNA 2CWDA 3KEQA 2PUEA 1U6GA 4EUKA 3HIFA 4LFUA 2R47A 4NICA 3ZMDA 3FF5A 2DLLA 4UNOA 2RDMA 3U2RA 3JY6A 3T95A 2XUBA 2FW0A 3L09A 4EV0A 3MQ0A 1ZGAA 4Q6WA 5TQ2A 3TX6A 1VPWA 2DK5A 1EWKA 3CLKA 2GQQA 4R8HA 4ZJPA 3BREA 2XGXA 4M6YA
chains in the Genus database with same CATH superfamily
1O96B 3CSSA 2E1MC 4U3JB 2AG1A 2W6IA 3WJAA 5BMVA 1MJFA 1SIOA 4ACBA 3FPLA 4V0KA 2I7DA 3HVIA 1B6AA 3ZCPA 2LTPA 5HJEA 2EFEB 1QS0B 1XC7A 2FN9A 2A5LA 4X9XA 1EU1A 3CB4A 3KKQA 3PQJA 2VZ0A 1UBLS 3QPCA 1U5TA 4P92A 1KSHA 2VBIA 2VNHA 4PO3X 3WY9A 1WY5A 1JJ8C 1E1DA 2FQWA 4DYVA 1IF1A 3ZDQA 1CHNA 1EG7A 4O2BA 3Q3SA 2KL4A 3A28A 3P97A 4RDHA 5GGXA 4OGFA 3RTBA 3IP7A 4AUKA 2PUFA 3DEYX 4RWZA 3EYIA 5LP6C 2HH9A 2V9PA 4WRRA 4IJVA 4DZZA 2FR1A 2VQEB 1E96A 1Z4MA 2WV9A 3R44A 1IVYA 4MYUA 5T3UA 3MGGA 3W2FA 2I54A 2VP0A 1ETYA 3ZOBA 5J1RA 1U7ZA 1VQ9I 1IEQA 4QHTA 3LO5A 2OXEA 5IAJA 2EG9A 4LCBA 4RGBA 1TEXA 4JYPA 3UAOA 1H0KA 5HDNA 2COBA 1Z35A 2EFCB 2YN2A 2Z2XA 3K35A 4M7OA 4QFMA 4YN3A 5LKRA 4NBLA 2A7QA 1EM6A 3Q6NA 3WHKA 5C3EJ 1I13A 1A9ZA 2K5UA 4KZKA 1ZYUA 4XVCA 2Q2OA 3PIPF 3HY6A 2QMOA 1PG0A 4I4TB 3DE4X 3JQAA 2CNNA 4M1WA 2W58A 1EKEA 4Z4CA 4EA9A 2RC6A 5KU7A 1IXZA 2ZJBA 1Z0JA 2A0XA 3SQOA 2CWWA 3HP4A 1NY5A 1FP7A 3AYXB 3DCNA 3HA5A 1E2KA 3T7IA 2OU2A 1DKUA 3RKQA 5E1BA 3WGQA 1Q0TA 3S17J 2V7FA 2AIRA 2JLRA 5AM5A 5EE1A 3F8TA 3ITEA 5EXSA 5EZYB 5GJCA 1XZ8A 1BCSA 2W2OA 3RS7A 4AMVA 3ZOZA 4B7UA 2OUKA 3KEGA 3T1VA 5AOAA 1JLLB 4KN8A 1NN3A 1RMQA 3KKZA 5AD1A 3EJWA 3Q11A 4LD5A 1CPYA 1N7GA 1NLUA 2R5WA 3GP3A 4RB2C 2YWRA 5B53A 2DHRA 1G291 4C6TB 1T5HX 2CLSA 2OWEA 4MUYA 4C4RA 1R2QA 2KJBA 2WHQA 2Y69H 4HLXA 1UK9A 3C3DA 4EPWA 4EY6A 4RSGA 4CMGA 2VF4X 1SBIA 4HNTA 2EYUA 2CV1A 2HOTA 3F67A 1U2RA 5FPSA 1KHTA 4F3KA 3ER9A 1MBZA 3PRYA 1HZZA 5DGDA 1WHSB 4Q02A 4Q1BA 1CR4A 3TLMA 4P8RA 2WFLA 3D3EA 1PCXA 4FFMA 3WHLA 4ZK6A 2FWBA 1HR0B 1P75A 2PTGA 3Q3GE 4P4NA 5EHXA 2OZPA 4AF7A 1E62A 3DXZA 3U62A 1ZGBA 5DNEA 1DBPA 2QW0X 3GH1A 4BVBA 4YMTA 2Z1NA 3K8OE 3KE9A 3M2PA 3A2LA 1YQDA 4MTCA 3PR3A 3PGJA 4ESVA 1XCMA 2R7XA 4JI7B 1H66A 1SC6A 2ODPA 2GT1A 4N5DA 4B84A 4FQ5A 4IS3A 4TXMA 4TYWA 5JXIA 3K1PA 1NU6A 2UYQA 5F04A 4EPTA 3UG7A 4IOKA 3F6OA 2YIJA 3PE6A 4OVKA 4QQRA 1XNQB 4KRFA 3U4CA 1EFCA 2D2FA 5LLDA 4O4LF 4IHVA 3TL6A 1RLTA 2X2EA 2YIDA 5FRDA 4IMJB 4QXQA 2WF6A 3GLXA 3OWTA 1OE0A 1SK8A 2VDNB 5E6SA 5BY2A 3DZIA 3OJCA 1T1RA 1ZI9A 3MJEA 5AHXA 4FGUA 4D99A 4Y15A 3OYGA 1RYMA 2P81A 1H65A 2GK7A 3K9HA 4TV9B 5DTJA 3SDZA 2FBKA 4DCJA 1IBSA 4JHLA 4ZOLA 4XRMA 2I6GA 5ILSA 1U9OA 1FS5A 2VHZA 4Y2VA 5B55A 2IH2A 1W93A 1FYDA 4JLPA 1ADBA 1IWOA 5HODA 4FQ8A 2C5HA 4HRVA 1I3CA 4ZU1X 4MNUA 3OOHA 2VJYA 3ETCA 1BEEA 3PQ2A 2RB5A 4MS4B 4Q4HA 2OCYC 5DVZA 3INYA 4E12A 1EFTA 4W5OA 2D06A 3JRDA 2E85A 4LEIA 1E3HA 5DLPA 4K6CA 2ZS9A 4G1BA 5EOVA 1MO2A 1MPXA 1QQIA 4IJMA 3TVTA 3V7WA 2LW7A 4S24A 4U0WA 4BCDA 5JD6A 4KQCA 4I3FA 4X92A 5JNLA 5LBQA 2VKDA 3QXHA 3NDPA 3DEFA 2ODBA 1E2PA 2QLBA 4C06A 2X8BA 1SXJA 1A8IA 1KP3A 3ULQB 3HEFA 1ZK0A 1NLYA 4L07A 1AO0A 3OV8A 1X15A 3FN4A 4CTOA 3LPLA 3NCHA 2JFGA 4GBED 5CT6A 3UR3C 1NVGA 3IXMA 2FEKA 3E7WA 1J5EB 1PGJA 1HDZA 1O0CA 1V9CA 2F1HA 1YMQA 2V59A 4HVAA 3GUCA 2AQEA 1O08A 3SBEA 3L1JA 5J8CA 1TADA 3J81Z 2L01A 2DSTA 3CX6A 3I59B 3RNOA 1DQYA 3GUZA 3WNDA 2WF9A 3YASA 2VK1A 4JXKA 3UAYA 1L9XA 1XV5A 2EJTA 2VQFB 1ZLYA 1DDNA 2PD3A 3D64A 5CUQA 2O2JA 4BIIA 1LPAB 2O0JA 1AKYA 3LKBA 2BR5A 5H16A 1G3MA 2PWZA 1Y3CE 3T94A 1FVXA 5AXAA 1M1NB 3EGEA 1FRZA 1KIFA 5JCOA 2WZCA 4AIIA 1X80A 3UUEA 4MR7B 4QPNA 4MOWA 3DLCA 4YJGA 2Z3VA 4YHBA 3U9TA 4XCQA 1WUKS 3ISTA 4G8BA 5YASA 2XBMA 2A9RA 4MI1A 1HV8A 1SVSA 1VZ2A 1GIAA 3NH6A 4NPCA 3EIQA 4OATA 2F5FA 4IDDA 3DVLA 3KAQA 5G02A 2H8GA 4HAZA 3C5WP 2X6WA 1V8DA 5HKBA 1BN5A 1DXQA 4IXTA 2AUNA 1UPUA 2MCFA 1MFZA 1BVYF 2JIRA 3C2HA 3CO5A 4JP5A 5BWNA 4TN1A 5HKOA 4TZKA 2PLNA 2Q50A 1V4NA 4X61A 1EXMA 1UEIA 2V5AA 3NJ4A 4AP9A 1R74A 1ID8A 3BWYA 3OPVA 3TTWA 1M0WA 4J0GA 3BCBA 1TJ4A 1KKUA 1YS9A 4ZYTA 2GFIA 1HXHA 2DP4E 2ZNYA 1WXGA 4JMLA 1RZUA 2EKQA 3I39X 4IHKA 4QAQA 5HMMA 3GEHA 2YVAA 3ROPA 1BOFA 4BGDA 3A4NA 4RTLA 2PN6A 3ZY4A 1KVQA 2NV2B 4AZSA 5JH7F 1VI6A 1XDBA 1ICIA 3CO0S 5DBHX 3G2OA 2Z09A 1IL0A 1Y6JA 3AOEA 5ISMA 5HDBB 1BXKA 2V97A 3JD4A 2C84A 4B9AA 1FPQA 4F8EA 3CMMA 4KSYA 4N49A 1PUEE 1JWAB 4X54A 1XD7A 2K9LA 4FP9A 1NE2A 4EJTA 4HS9A 1IY2A 4X0EA 4FILA 1LFBA 5FEMA 1DKLA 3K6SA 1BIBA 3ZK9A 5IMSA 3E03A 4ESHA 1WJAA 1QHSA 2QDKA 9ABPA 4CCJA 2DTDA 2Y0SA 5CYVA 4CM8A 4EHJA 3L4KA 2RK3A 4CM1A 1U3EM 2BKAA 2E4YA 1XWIA 2ZIXA 3C8HA 4KI7A 2IGMA 1KZ4A 1XSVA 1JSLA 4XD7D 1EK6A 5FLMJ 4KCGA 3AB3A 3H8WA 5PGMA 1F8XA 3T7JA 5AM0A 5KTYA 2P6RA 2EFQA 1ZL0A 2ZLBA 4UNNA 3QXJA 5J4YA 3GJXC 3OJOA 5A2QZ 5JG7A 3KQOA 2ZWOA 4B3CA 5LIPA 1MNMC 4HXYA 4O59O 4TTVA 4CEJA 1OZAA 3EVAA 4JFAA 2IYTA 3MERA 3DXJF 2OA0A 4F55A 2NTJA 4Q34A 2ELKA 4KIFA 2YWDA 1E69A 3EASA 3ILVA 2VHTA 2X1LA 1U2QA 2J48A 4KXNA 3MFQA 4RCVA 5ABPA 5EJIA 5DHAA 4J90A 2YX4A 1U8RA 1TAGA 3FNQA 5J1SB 5JAQA 1R22A 1QH1A 2XCIA 2NVBA 1C0IA 2QN7A 4DLKA 3KQUA 3WLIA 2BY1A 1SEVA 1R50A 3V7SA 1O6BA 2AK3A 4AY3A 2K9SA 3QI7A 4BYGA 4DZRA 3Q6MA 3NYWA 2H16A 2RGBA 3NWEA 3MS4A 2IF0A 2VWPA 2ZTLA 3I55I 3DKXA 2BFMA 2NYRA 3OIVA 2GARA 6LDHA 4DOZA 2FE4A 1DO8A 3EVTA 1EINA 4P2GA 4TQ9A 4F3CA 4GZ5A 4FKBA 2CQ7A 4GXQA 4LJAA 1P7CA 4Y2XA 4LWPA 4UCFA 1QRTA 3LSTA 1DKQA 1KMMA 3AERA 3QPUA 1E2LA 5FOXA 4CBVA 5J3LA 4ZN6A 2B8WA 4QBKA 3BMNA 2C7OA 4PJNA 3M6AA 3EYWA 4ETSA 5C18A 1G98A 1HE4A 3E5NA 1RXUA 5FLEX 3RQIA 1ZY2A 1P31A 4HKTA 2PSJA 4ZEOA 5JROA 1EB8A 1NAHA 4FZVA 1GFZA 3ETEA 1CZOA 1JVNA 3NC1C 4UASA 4I3HA 3BMCB 4D0GA 4MMXB 2PKQP 3TDKA 3CW2A 3H9JA 4ENJA 4JVNA 1N25A 1I2MA 2ISQA 3IBCA 3T9DA 3QLVC 4B40A 1NXSA 1GXSB 5KMGB 3BTVA 4TRNA 5EXTA 5CLFA 3A2NA 5DPMA 3TRFA 5KPJA 4LTMA 3WNVA 3NXSA 2QYTA 1SU7A 3VH4A 1R0BA 1BL0A 4N7MA 5F35A 3E81A 1Q5PA 3RWOA 1NVBA 1Z6TA 2C0PA 2HWWA 3JVVA 4MKHA 4JX6A 2G4CA 3BIFA 3SJ7A 4AUNA 1KK3A 2BGCA 2P3SA 5A4IS 5IP7J 3QPWA 1NNI1 4GWLA 1NY6A 3GVPA 2PV0A 4HYTA 1XQ9A 4GLFA 2ZZKA 3JRFA 1A7UA 3PXAA 4ZGWA 3TL2A 3URKA 5C7OO 1S8AA 2HU7A 4WZBE 5HVNA 2YYAA 5DISB 3BR6A 3R7NA 4NF2A 2JZNA 1H9GA 1PL0A 2W57A 4LPKA 1JJVA 4PRZA 5I51A 5JR3A 4LVNA 3MZHA 2E55A 4WD3A 4G7OF 2IHUA 4CM9A 2E34A 1EDOA 4GZ3A 4WINA 1Z4PX 3LWDA 4UUSA 1IMJA 1OISA 2WAOA 5H82A 4IJWA 1E6LA 2CLLB 2Q27A 2WB1N 4F6RA 2PGIA 2B4QA 1L7NA 3KQYA 3QVJA 3IR5A 2W8BA 2BYTA 4EY7A 1XFAA 4C7VA 3FOBA 2IVMA 2PSSA 4BNDB 4F3RA 3LK7A 2G1PA 2H5EA 4CLDA 4XKVA 1JTEA 1OC2A 3B12A 3PLNA 3LG2A 4ZYDA 1J8DA 1BOBA 1E2IA 1BE0A 5TQ0A 4YUWA 2Q0HA 4CKWB 4GH5A 1MBGA 3AM4A 1JR4A 5F0CA 3LC2O 3T3EA 4DIEA 3S2WA 4JAVC 2YOFA 2AOTB 3ZD7A 3PDCA 3D0QA 1OSNA 5F27A 2IYNA 2R79A 2EWMA 3SK0A 5ECGC 3WYNA 2E1CA 1Q0RA 1N9GB 3IEKA 4FC7A 4XLEA 2GFQA 2C3MA 2JFOA 2VNAA 2V5UA 1D2HA 4CM7A 4F2PA 4WCFA 5D3ZA 3ELYA 4IZOA 2BBTA 2O1WA 3H9CA 3GMDA 7MHTA 3GD7A 5EF6A 1SZPA 3AI2A 2FMXA 1NC1A 2Y1FA 4C89A 1LK5A 2XAJA 1WUTA 2P9ZA 2WQ6A 4U9IS 1Z62A 4DWOA 3B85A 3FRHA 2A92A 2ZVJA 3L7KA 4RMIA 5ERGB 1FIUA 1ISGA 3EODA 2JS7A 4M8SA 1H2WA 4HWTA 1JAZA 2CD9A 1OFUX 2DYKA 2V7UA 3QUBA 3ZWWA 5A5DA 4L4XA 1E2MA 1RPJA 1TF5A 3FNHA 4A2CA 1DCKA 3WV5A 3GP5A 1SXIA 1D5VA 2JN6A 1RRFA 2PGOA 5BPIA 2ZJ7A 4HDRA 1BMQA 1EFVB 4BHPA 4DQ0A 5AI5A 2PGXA 3N2NA 3HWX1 4CIYA 1O7LA 4XJVA 1V7ZA 2CMKA 2XHKA 3LMMA 3LUKA 2ZS8A 5JLJA 1WW8A 4LB6B 4R54A 3NWPA 3FWPA 4A6EA 4NYMQ 4WZZA 4ZT2A 5FI0B 4BLSA 4ZCTA 4YP5A 3HRHA 2Q1XA 4EYQA 2MLGA 5JHUA 1NF9A 3D8NA 2NMVA 5TXGA 3S0JA 3EOAI 3KK0A 2Y0CA 1NPDA 4AZTA 3QFHA 3UJNA 2PT5A 2RGAA 2W6JA 5DYIA 3DLIA 3I6ZA 5BSMA 3UMYA 1US8A 1JEYA 2WAYA 2ETHA 2WAAA 5HLTA 4RJ2A 5KB3A 2C4VA 2D4HA 2W70A 1ZRSA 1BE8A 3KEOA 2WJ3A 2H65A 3G2NA 1QQBA 4A3LJ 1M10A 4FN4A 2HK8A 4LWQA 4MCHA 3ZWYA 4BASA 2COUA 2CW5A 3OKCA 2G9UA 3B3AA 3HYCA 2D1VA 2Z2KA 3ITKA 2BMFA 3OZFA 4JEUA 2FPWA 3OYJA 3L1IA 2GFHA 2XE8A 2XVYA 4G63A 2X3FA 1UIRA 1XO1A 3VVCA 1XNJA 3N2KA 1D0YA 2O59A 3S2HJ 5LMNB 1T6SA 4BL5A 4HQEA 3S3OA 4DR4B 4V03A 4LY9A 4RZUA 2VXDA 1KJ8A 3EEIA 4B4DA 4W1RA 1PBNA 1PFQA 4R84A 5EFOA 2NZYA 3CLRC 3BF7A 3DMTA 1G63A 2XUIA 3O4IA 4XLZA 3RSQA 4DYQA 3ZWDA 1TJPB 1EHYA 4C4TA 2DCUA 3IBFA 5TMDA 4DAEA 4X85A 3U4HA 1NBMD 4FNGA 2HNAA 3SDBA 1SRRA 3AV0B 2ODQA 1PTJC 4BJ3A 4BBJA 2YN4A 5C8YA 3P7MA 2NS8A 1PUFB 1OI4A 3LKVA 3HJUA 5KOHB 1U2TA 3IALA 1QVWA 1M74A 4HWKA 1N0VC 5HF9A 3ICWA 3J7AO 4Q03A 3LMKA 3CLVA 3VV3A 4QQKA 1RHMA 3O6VA 5DM6F 3ILSA 1CF4A 3DBHA 1BJRE 2QI9C 4TV8A 2I33A 3O95A 3PUIA 3SHVA 2ORYA 4AB1A 1E1MA 1PZHA 4RS4A 4MO2A 3J7AC 2F3QA 3D8UA 4I99A 4DWVA 1JHAA 2CF5A 2KQRA 3T5GA 2O8NA 1DKMA 3S27A 5E6RA 1ZCFA 3RGGA 1A69A 4C76A 2J0EA 4Y9SA 4AKTA 4RS8A 2UU9B 3LCCA 5FGMA 4QFDA 3KXLA 4Y67A 3EQLF 3QU4A 1BS9A 4RK1A 3Q5FA 1UBCA 3IT2A 4EVQA 2AR9A 3QLEA 3LT5A 1DC4A 1KKLA 2X6TA 4LXUA 4Y9TA 5FL3A 3ONQA 5LC1A 4YY3B 3K15A 2X4LA 3IP1A 3KC2A 3L8CA 2Q9CA 4CMJA 3K8YA 4U9HS 1Z75A 3GF4A 3UMVA 2CQXA 1CBUA 1AOXA 4E5KA 1I2ZA 2FJUA 3TLXA 5KX5F 1X7YA 3BB4A 3LCUA 2C1XA 1WVGA 1FNCA 1QP8A 3FKQA 5CLJA 1B9MA 1MQ8B 4B6PA 5FA8A 2W6QA 2X1CA 1OYWA 4ZYEA 4KN5A 2BMVA 3D3KA 2VKHA 2Q3FA 3KYJB 1U81A 4PG7A 1HCRA 3GJ4A 3V4OA 4D6XA 2O5EA 5KCMA 2DKOA 3MXTA 2DUJA 3ZZ1A 3MQ2A 3HZZA 4ZH4F 1CF7B 1NN0A 1NVVR 1UMBB 1YRBA 3O8QB 3PEWA 2VBXA 1THTA 1U1FA 3C43A 2FMUA 3OFVA 5FBHA 4WOBA 4M98A 4GS5A 3FZQA 5JSHA 3A6GA 1VYUA 3RFVA 3IAEA 4B4VA 4M73A 3ZK8A 1YS2X 3L2OB 3MBKA 1CYDA 4AVPA 3PNLA 5EWJA 3WNQA 3OZEA 1Z67A 3ZU4A 1QHHD 2Y30A 1F4LA 1PKEA 1OC4A 3O8NA 4LJ4A 5B1BH 1VSUA 2QY6A 3L6CA 4EJ6A 2I1WA 1MXFA 2F1JA 3U9SA 5F78A 2XODA 3G0GA 3RFXA 5H4GA 1CJCA 3CO7C 3KQLA 2E71A 2V0NA 3VDMA 1KO7A 4GM1A 5AT1A 3GO5A 1WI3A 3S5JA 2H5LA 1Z88A 1PVDA 5DTIA 4CCYA 1ULYA 3G17A 3DPUA 2O50A 4MI9A 4IH9A 3RBVA 2XAFA 3A04A 4RAFA 3H86A 4MS3A 2AN1A 5A71A 5TS2A 1ZD9A 5K09A 1CP3A 2Q3EA 2ZUBA 4MWBA 3AKEA 3NW9A 3PWZA 1LPQA 1BI2A 4JSYA 1D4OA 3IH3A 2AI1A 2JA6J 2J8ZA 4H6XA 1J9ZA 3OE1A 4BMZA 4YAIA 4MNTA 1KJJA 2CL0X 2HRQA 3LU1A 1KQ9A 2WTBA 3HN7A 4LJ6A 3GXBA 2R93J 4G36A 1DDOA 2J59A 4MVYA 4U5QA 1L7DA 5H70A 4X5OA 1U4OA 5LBTA 3B6CA 1RJEA 3KZCA 4G0UA 4C22A 3VNVA 3EWSA 2FWAA 1QGZA 1ISIA 3GQBA 1L4YA 3T38A 4C9BA 1F9NA 3BZ6A 1S8FA 1THGA 2OBNA 2DT5A 3FSJX 2DM6A 4J01A 1U3FA 4QXPA 4E51A 2PMCA 2YZGA 4HYEA 2X8JB 2HYDA 3B60A 2NVOA 3PGXA 1JALA 4LGCA 5K3DA 3ZWBA 4ALMA 4B8YA 4F4HA 4TXHA 2YFQA 4KIBA 1FNSA 1W85B 2PCLA 3EY9A 3MW8A 3UPDA 4CYCB 1PHPA 4BFCA 2DFDA 2I7VA 5J2TA 4DR2B 4H0EA 1Q1AA 1GA1A 2B2CA 2R2AA 4BFLA 1HDPA 1N1MA 2HCBA 3B70A 3GJYA 3VYRB 1JIVA 1X3SA 2FUEA 2JD2A 1YRNB 4RZIA 2L42A 4UMDA 3RVKA 5K05A 3S3TA 5ECYA 1A7AA 3HFRA 4B35A 1YQ9A 3OD1A 5IT9Z 1D9XA 1KI1A 1NURA 4MIEA 5CT5A 2G9QA 3TRJA 3ULKA 2YIMA 4AJ4A 2ET6A 4URHA 1A2KC 1DX4A 2QGZA 1EXNA 1I36A 3VSLA 1ZGJA 1PJZA 1X7ZB 3UM9A 1HUQA 4CH7A 1V7PC 2AC2A 1CDDA 3D81A 5BO5A 5KNBH 1UC5B 1FMTA 4A6DA 1OI3A 1L7PA 1QRDA 1X74A 2GZMA 2HBRA 1OTHA 1W5BA 1STOA 1GTVA 1GSHA 2BFFB 3H99A 2VS1A 3F9CA 2LDBA 1JQEA 2QYHA 5CDUA 4E7ZA 5A4KA 1TT5B 1MO4A 1N6KA 4QJIA 2WWHA 4FEAA 1XQVA 1R9JA 2FJ0A 1EP2B 1Y1RA 4BQRA 1QQ6A 5TR9A 1CYEA 5AR1A 1C7EA 2JD0A 4EJVA 1NFRA 3NVAA 1XZNA 3IDSA 4I8IA 2OBBA 2WFAA 1JP7A 3LUDA 4M9UA 1G3IA 4ZC3A 2O3JA 5GV7A 1T2EA 1GQYA 1GGHA 1H8ED 2Q5EA 4B75A 5HZHA 2K9QA 4KXWA 3B1YA 3ZWNA 4C4YA 5BQFA 3OUUA 4MQ6A 3VJRA 1RC9A 1THMA 3UW3A 2HVSA 3NHAA 4S0XA 1AUVA 4YMIA 3WZLA 3H5VA 3R6DA 1AO3A 1EJ9A 1H93A 2PQ6A 2JLWA 2FPPA 1O95D 1B4AA 2H57A 1J42A 2JSCA 2CYCA 2XVXA 1WZ2A 4H4CA 3F6SA 2L9NA 2J6IA 4Q7EA 2EZIA 5KJEA 3TD2A 4CF5A 2AMVA 4QJBA 5HQ3A 2JFQA 4LJ8A 4K9PA 1OU0A 4GPD1 4RK5A 1U65A 4UTPA 1ZU5A 2O8BA 4EB6B 1YA8A 1QCDA 5F7XA 4K6GA 1F14A 4JQOA 4M1MA 3TKYA 4OFWA 2D6FA 3HCNA 1XU9A 4B8XA 1RR7A 1X7GA 1M34E 1B0PA 1OOEA 1RKBA 1FZQA 2H5IA 2OYSA 4GIBA 1NOKA 4XVHA 4ZXFA 1KWGA 4F1JA 1K3UB 1W36B 2BV6A 3AEUB 5BR4A 2R7AA 3ICCA 1U1IA 2ZSEA 3R40A 4FB4A 2VR1A 5EAIA 3HV0A 5F9FA 4IR7A 4QUEA 3ZZMA 5CT8A 1W1UA 3OIPA 4LG0B 3DWEX 3NKVA 1ZGWA 3O75A 3UJAA 2C29D 5J4HA 3KSUA 5BT9A 4RTRA 3H2GA 3LHIA 3ZH2A 4KXMA 1X2BA 5TARA 4QTXA 2QLZA 2ZRJA 1P2BA 4GPBA 4IQ0A 2HR3A 4MUNA 4NEHB 4TUYB 4G0MA 3V2GA 2BUAA 3KAPA 4F56A 5HRAA 3G73A 1N9ZA 1DJOA 4WJLA 4RA9A 2XOXA 3ERMA 4XR4A 3HMKA 5C44J 3OD5A 1NLMA 4R79A 3AF0A 1YZHA 1LZKA 5FPPA 1EJ2A 2QUBA 4XR9A 4KH1A 5KSPA 2WQ7A 5SY6A 2VK4A 3RGWS 4WNIA 1TQPA 3HFSA 4HNRA 4KKXB 1P1KA 3SJBA 4B4OA 3ZDAA 5GPAA 3FXQA 2AVDA 2VPPA 2J08A 2W6CX 3I8OA 1O3RA 3ITDA 4NBSA 5GVRA 4ZCQA 5FX2A 1JJBA 3W9SA 4RH3A 3E70C 2XZLA 3I34X 3F47A 4ZPXA 1RE0A 1X42A 1IDN1 2IBDA 2R7VA 2QNIA 5E3MA 1J9GA 3EZNA 3HB7A 1ECGA 3JALA 3R77A 4D98A 4ZZ3A 2MOKA 3J80A 4LZOA 3G85A 1EIZA 3U3JA 2ADMA 2GYYA 4XRSA 4PN3A 2QU8A 2XKOA 1BRTA 4CLRA 5K0FA 1J39A 3IEVA 2KDZA 2EKDA 3T15A 1AJEA 2CFTA 2A2ZA 1CP2A 1FDUA 4O2RA 5LHGA 3FSEA 3F3XA 5BOVA 4B3JA 4EW2A 3NHFA 3LP6A 3UC5A 2VKEA 5DTEA 5KYVA 1TLFA 2JZCA 4R05A 4B3MB 4PK4A 1YONA 4S12A 1XTUA 1AKEA 5KJ6A 3I4PA 4EJMA 1JT9A 2V6MA 2C94A 3L07A 1LI7A 1U6JA 3AVVA 4O2BB 3OSUA 3Q7IA 4A36A 5AHOA 3FMGA 1WB6A 4ZGBA 1T3GA 2NXJA 3F7TA 5TPWA 1N5OX 4YPVA 1X3ZB 1ZD3A 1UZLA 3ASVA 4GBMA 4INJA 5E6RB 5BV1A 1KQFA 3G49A 4C3HJ 1M1YE 1EHCA 1KFBB 4D5EA 3C3BA 1HW5A 3GWZA 2GCPA 1Y80A 5CB6A 1OIVA 3LDHA 1XEWX 3UOGA 5CDTA 1A36A 1H85A 1FIPA 3ECHA 2OO5A 4PZDA 3TINA 1E3OC 1RAIA 4FGZA 4HQRA 4EGSA 1VFCA 2F43B 5HP4A 2D00A 5KAMA 1NBEA 4BP9A 3OIOA 2UYYA 4JC8A 5K5EA 3FXOA 4ZTZB 2JCXA 3VH1A 1FSFA 4E3WA 1JH9A 2J3KA 5FUBA 1R0LA 4I99C 3SR4A 1SZJG 1GLGA 1U0FA 1W49A 3QE2A 3OH8A 5CA1A 3FDZB 2GXUA 3OIWA 1AXGA 4I55B 3W4JA 4MA0A 2PR2A 2Q99A 2VRNA 2IDJA 1KGDA 1SUCA 5DXFA 4C7OA 3KWLA 5EJEA 2WAQA 5E18F 5BYBA 3H1FA 5JS7A 4CRWB 4C7XA 4M60A 4ZANA 3PC6A 4BTLA 4DV5B 1USSA 4K8OA 1AGXA 1YUBA 2ZR9A 1WFXA 4KGDA 4MW9A 5IC6A 3J7AY 4B6EA 4E5PA 1JLMA 1Y3IA 1ACIA 1YBMA 3DV9A 1ZGZA 2J0SA 2GASA 3RREA 1XRNA 2ALJA 2LV8A 3BTLA 2ZAYA 4ZQBA 1DSSG 5ITZB 4QGGA 4ZJUA 5J43A 3T7DA 5KDDA 5CYGA 2AN3A 1FXWF 4TM7A 1USKA 3FXMA 1M0EA 1Y3AA 3HP1A 4QECA 3W9YA 3RIRA 3D1NI 1JBKA 2O9JA 2FSHA 2P5LC 4V19K 2Y77A 2ZRPA 1Y4UA 5L4SA 1PR2A 2XMDA 2EZUA 4AJOA 3RDIA 2VPLA 1GOTA 2AMLA 4EJ0A 4M3FA 3SM9A 4BEBA 1ULUA 2WUDA 3DMNA 4PYMA 4G9EA 2IXEA 2Q3HA 4HF0A 1K68A 1E64A 2QPTA 4OUDA 4UEWA 1G4AE 2H51A 1ORKA 2Y9YA 4DW8A 3OIDA 3F5MA 2FI1A 2ZETA 4MQEB 4ZAXA 3RJMA 5CEJA 5KWJA 3SZRA 1Y8ZA 2QQBA 2DA3A 2GPTA 4HVLA 2EIKH 1IAQA 1KVUA 1R6AA 3ANLA 2Q8QA 1TTHA 4PQYA 3UJ6A 4KUGA 1R3UA 1I1GA 2M3AA 1L5FA 3PFYA 2FN4A 4Z8YA 4B3BA 3D0OA 2G1AA 1C9YA 2PS0A 3HVUA 3E7FA 1W9MA 5HJ5A 2Q6KA 1BQ3A 4FCWA 1N6RA 1MZPA 1E7WA 2RH8A 4M1KA 1CR6A 4ADSG 3BL6A 1M1ZA 2YFKA 4DVGA 3RPUD 1BDBA 3ZQKA 4CG1A 1D2NA 4FFBA 3UT0A 2GN2A 4FJ0A 3G9ZA 4FBLA 1OXUA 4DA9A 2FPKA 5LQUA 5HRUA 3D7MA 2WTNA 3G6KA 1FTGA 4GUDA 2P2LA 4O4HA 1F5SA 1FDTA 4YAOA 1W2WB 4FLFA 4ILKA 2FOIA 4PG6A 5FTWA 4RMNA 2PA0A 3UKDA 4BFWA 3WGVA 1F2UA 1XGMA 4EY3A 1HMYA 1ZMTA 2DOKA 3RRBA 1J2RA 1MF7A 3I2YX 4YAWA 4IIVA 3SS8A 2XPCA 4CEIB 4L2IB 4FTHA 3R7LA 2YRXA 4UTNA 2BEKA 2VYQA 1W7PB 2ZTHA 1UH5A 3UO8B 3MTBA 3WGMA 1UJMA 3NBAA 3ZQGA 3IDZA 2ZFUA 5SZHB 3IP8A 1OH5A 1C8LA 3QM1A 4XJSA 2FY8A 4P3YA 5DK6A 3FJYA 3UK2A 1Y1PA 1IM2A 4NBTA 4GP7A 3C0KA 1QCZA 2K87A 1FJXA 3T8RA 1J1UA 5AW3A 1JDJA 4BE1A 1NH3A 1CU1A 1R5BA 3HDQA 5C0OE 4CU5A 3GLIE 1UXKA 5B4VA 2A61A 2R5FA 4RWEA 2LCQA 1RYEA 3IT0A 3SEFA 3ZXXA 4E5DA 3PXGA 1NNEA 4L8VA 3ZWQA 1EGMB 1TLHB 1VJTA 4DQXA 3IXQA 3GT4A 1EXDA 1RR6A 4HEA6 3B48A 3WE3A 5SYAA 3SZ3A 1BEZA 3K4PA 1ZKMA 3ET5A 3QPVA 1L4BA 3KD3A 4C4PA 1Q0LA 2VXOA 1YVDA 1GYRA 2FMKA 3D1JA 3FR8A 1R37A 3AW8A 3ASNH 3LBAA 4M37A 3UAZA 2DBYA 3WK8A 3K2EA 3RV4A 4BLTA 1R66A 1F1JA 1SOVA 1B8UA 3Q8LA 4WFIA 3K69A 3DT9A 3OYKA 1E3WA 2CDBA 2WD7B 2Y0PA 3LV8A 2HNHA 4KYVA 3FKSD 3H8SA 3FM5A 4JVSB 1E18A 1GRVA 4M86A 1YCHA 1ZSNA 4H0NA 3VUEA 1DP7P 2IXTA 4B2IA 9ATCA 4GLOA 2M7AA 4YP0A 5IC4A 2PUTA 1RWXA 3W5VA 2RHDA 2WK1A 3O8GA 3F6CA 2G80A 3DS8A 1NJ8A 4MA4A 3NG1A 3E0QA 4G1MB 4PLTA 3O31A 3QQAA 1V25A 1RZ4A 3JQ9C 2YWXA 3TIFA 3WL3A 1RFLA 3ESWB 3KTFA 1JPNA 5KJFA 4XB1A 3TTXA 2IPAB 4FGJA 3DOUA 2YV3A 4PZLA 1XVAA 3OT1A 4NG4A 1L7QA 3U7EB 3LRTA 3DR5A 3QEAZ 2ZJPF 2GSWA 2JCBA 4IDEA 3AL0C 4HVCA 1ABEA 5D4RA 1T0UA 3OEED 4WY8A 1KBQA 2CMGA 3K0FA 2QKLB 3H6HA 4QQFA 4CF6A 1V45E 4GYKA 1ISPA 4D9KA 3BSYA 2Z5VA 2ZJ0A 1DWUA 2PZJA 3AT1A 3BHNA 4W63A 1GT6A 1PZXA 5AMXA 1PR0A 4JC5A 1Y5NA 2XRMA 3I5AA 1PWHA 1DRKA 3CP8A 4N9IA 3VX3A 2YY6A 1U7TA 4I55F 5TX7A 3X44A 1YDWA 2M8GX 4TMFA 2IU0A 4NV1A 2M34A 3FX3A 1Q84A 2H6CA 1HO3A 1XB2A 1XEXB 2AFVA 4IFTA 1WCYA 2JD1A 2W6JD 3FHOA 4S0ZA 4O4IA 3OYMA 4KMMA 5FULA 3R75A 4BNVA 5KREA 1N7JA 5JXJA 1EE2A 4BVJA 3P9IA 3VC3A 1R9MA 1RQXA 1DEAA 3SQWA 1D03A 3M1LA 1XCOA 1KGSA 3ZDFA 3WTUC 2M30A 1W9HA 2R7RA 3NDIA 1OH6A 4JBGA 5GINE 4GGOA 2XBUA 4ZAGA 3I59A 1HDDC 5FRNA 2OHGA 3THXA 4LOIA 1GRRA 2FG7C 4B3DA 3T3DA 5IH7A 1SVWA 1N2IA 2OCEA 3LX4A 4R9NA 2IHTA 3DXXA 4U2GA 2H59A 4YDSA 5DTQA 2NN3C 4OG2A 2QP3A 3B51X 3UBMA 1DDIA 5AW4A 2I91A 5ALDA 5JAMA 1ZNZA 2Y05A 3HJGA 2QZ8A 3WHBA 3SHQA 3U7QB 2WF8A 1TZLA 3A6LA 4TRRA 1OUMA 2YTZA 4H4DA 2C9BA 5A3SA 4KDCA 2NW6A 3WL6A 4AG3A 1U0JA 5BVHB 5K0CA 3ZV7A 4X6AJ 2J3QA 2ZULA 3GWGA 3PX2A 4R81A 2DFHA 1CJTC 3EETA 2XLBA 2WT4A 1OKKD 2G5TA 4M89A 4NBNA 3DEAA 2J3MA 1Y8RA 3KKLA 1CUYA 1S2NA 2XYVA 2AQIA 3RHZA 4F38A 4UOEA 4Z54A 4HWRA 5BMOA 2DJIA 4E7SA 4Q66C 5HKAA 1YS7A 1E3TA 4KBGA 1F3LA 4NONA 3ZPLA 1ENZA 3I4NJ 3A06A 4QTUB 1SWVA 1T33A 1JDBB 2FRHA 1C7ZA 3ZGNA 4GLLA 3CCBA 2VC0A 4Q39A 1XNRB 4AKIA 1BIFA 13PKA 4DNXA 4W9NA 2QRVA 3AERB 2CV0A 3PFNA 5DHFA 1H6DA 4YJFA 1PW5A 1JHPA 1N6LA 2ZK7A 3A3PA 2F1OA 3VTKA 5CVIA 3UT6A 1Z9BA 3L5KA 3FFXA 4LDPA 3SMQA 5HG0A 2RJOA 4O5AA 5TS3A 4JUIA 1DAPA 4WKPA 5REQA 4A3FJ 2D2XA 1TYDE 4QOJA 3VR1A 3VU9A 3IKJA 4ACAA 4ZOLB 1C9DB 3CH7A 3KQTA 2H3EA 3TI7A 4UNIA 3AKYA 3OU2A 4IXWA 3UKOA 5H8WA 3LECA 4LYAA 1SMTA 3HDVA 1PD0A 3WRWA 1WPKA 1H1LA 3PTZA 3QKIA 2WM9B 4UBMA 5LZ4A 2PMFA 5AP9A 2BI4A 3THWB 3LT4A 4BV2A 5CCXA 1OAAA 1LUAA 5EN4A 1LJ8A 2JJ1A 1GT0C 2ZJOA 3EYAA 3KSMA 5LRSA 1U5AA 3N58A 4IHSA 1BA2A 4OQLA 1F17A 2B1JA 2ZIAA 3HJCA 4MV1A 1SKUA 3EE6A 1DAHA 2EV6A 1O6FA 2QPAA 2VT7A 3P2JA 4LE0A 2OMEA 1TUEA 1D0XA 2QN3A 3ZGOA 2DULA 4CMEA 4DEYA 1W87A 1HEYA 4IIEA 4NFSA 5FHRA 4CDMA 1VHJA 1ZKDA 1XI2A 3GEMA 4XOIA 3D6UA 2FSWA 1EWYA 3AU9A 4X97A 1UMCB 5AUNB 4C07A 2IOFK 4HEJA 1PQWA 1QKKA 4EYOA 4IRMA 5J47A 1C50A 1FY2A 4IO9F 3E1KA 1VQLI 2MR6A 2GRJA 4MITA 1E9VA 3PQ3A 4G4GA 1C5KA 1QIDA 1J09A 3W2EA 3P8ZA 5CFLA 1ZJYA 1T8SA 3BH0A 4KL8S 1DAEA 3R3JA 4TXJA 1YACA 3ZHXA 1IIRA 1F60A 1UANA 3Q87B 3S2SA 1EUCB 4C1BA 2ZYHA 2YHUA 4ZQHA 5CITA 1RS0A 3Q3IA 4KPYA 1WRJA 2CVOA 2R5NA 4YMUA 1N1EA 1ZW6A 3LAWA 4L76A 5K7ZA 1MH9A 1N3IA 5ITZA 4MHOA 1WBBA 1ORHA 3CLQA 1FTQA 2PX5A 2RVCA 2G0TA 1C4WA 3VU9B 2ZBFA 5JTUA 5J1TB 1KSGA 1PJSA 2CLCX 4I2NA 2QQEA 3C6KA 1ZOIA 2DU9A 1P9WA 1ZK2A 2XMBA 3D2CA 4MUAA 1MW9X 1FLIA 4E15A 4HGNA 2A1TS 4ZI7A 5JBQA 2CQKA 1DLIA 2IE0A 3EFOB 5B2ZA 4EF4A 3ZY6A 5J9FA 1DUVG 5BN4A 3F4KA 3S1AA 4DC1A 1FSZA 2BM0A 2RK6A 3BCSA 1T8IA 1D04A 1Y1SA 1Y6QA 4P9FA 2AE1A 2BGMA 4GVXA 1FLDA 2E6UX 4L57A 4S1VA 4KMFA 3DFUA 4B5KA 4D3XA 3VXKA 2BXYA 3V8QA 3FXUA 4Q9KA 2CT8A 1SZCA 1H6CA 2R4UA 3WICA 1DPRA 2H1HA 2V4MA 4KR3A 4JASB 1GL6A 1UC9A 3OQVA 3TZQA 4X84A 1JKRC 1P0MA 2NYAA 5FR2A 3D9QX 3CBGA 1X0VA 4BLUA 3LXXA 1VQ6I 3N87A 1BJZA 1ZWLA 2Q21A 4K81B 4XEHA 1XLUA 4MW2A 4HQNA 4HZIA 3GT3A 1X1EA 2ZBEA 2MD5A 4FI3F 3HBMA 4WNAB 1SFUA 4JGGA 3CUOA 3IQDB 4IAOA 2V03A 1R6XA 2FEWB 4ETNA 4QVIA 2YWHA 3RBXA 3S32A 3SYLA 1TC3C 2SBTA 3CH6A 4XUGB 4C6SA 5HS8A 4NSNA 1NAIA 1OFIA 1Q19A 2CVHA 3M6WA 3P9NA 2YYYA 4JLVA 4G07A 4JN6B 4QJ4A 3QMPA 2I3AA 4RABA 4DG9A 1ZJZA 1G6KA 3QVGA 5DB4A 5DLYA 3UAWA 1W88B 1CERA 2PUDA 2HUPA 2VI5A 3NBFA 4R3UC 3S1LA 4L5YA 4MW0A 1DL5A 4ZTBA 2FF4A 1DJMA 3FCAA 1RU3A 4G4SO 1CVLA 1ZMOA 3L0SA 1K7SN 3H4VA 2EWVA 1JKJA 3PQDA 2P78A 3HL4A 1ELOA 1MG5A 1RI5A 4GPAA 4I4NA 2OEPA 2KDOA 3ESQA 2AR7A 4LYJA 1L5WA 4CQMA 2PV7A 1G6OA 5KMGA 5KNCD 1A9XB 3DT6A 1FE8A 3PEUA 1HZZC 2JMWA 5CYFA 3WDSA 5I4IA 1UZNA 1LF5A 1XS9A 2PX0A 4BKQA 1OHHA 4BX3A 1EP9A 3GEDA 2E1PA 3WBJA 5EVCA 3WX0A 1VSTA 2IUYA 4DJAA 3CWCA 1L5MA 3I45A 4BEVA 4YEDA 1JA0A 2B0LA 5HYVA 1P1CA 2B8TA 4PQGA 4P9UA 1GFSA 1ORTA 1E8NA 2YJ6A 5FTNA 2PM8A 3VR6A 3ERCA 2P0WA 2ATCA 3O2SB 1P77A 4HDOB 2QAGB 4KDFA 2HA5A 4TPKA 4BUJA 2PHZA 1W0JD 1RC8A 4XRSG 5COBA 1XQ6A 2IQIA 4IV8A 1U2SA 2PLWA 4QKQA 1UFQA 4RDCA 2WSMA 1WI9A 3ZQHA 2FSIA 3A6EA 3D6NB 4TUYA 4L0YB 1N6PA 5E2BA 4PNEA 2Z5LA 2CUNA 1JQAA 3OE4A 1J07A 1SQ6A 4NFHA 4NOLA 1JDVA 2FMIA 4XWYA 5DYWA 2Q3CA 1Q16A 1M2WA 3BIWA 4KFTA 2N8GA 1NATA 1TMYA 1UWKA 2WM3A 3ZWMA 3BOSA 4BMCA 1R6BX 4A1FA 3W3CA 1SOWA 5AOBA 4RY8A 1NG7A 4TKLA 5DMHA 4P6VF 2QK4A 2IYYA 1ZO8A 3L0CA 2R8EA 1G2OA 3ASUA 3VU8A 4AG5A 2VCYA 4EPXA 1KYTA 1UHWA 5E0KB 3WRYA 2FP4B 1SHTX 2OVFA 2XDAA 1P2FA 1O87A 1GPJA 3F0TA 1V5FA 1CZHA 2QSFX 2WPNA 1PWZA 3P94A 2QN2A 1UBUS 1II8A 3UTDA 2R92J 2C57A 4NQWB 1CK4A 2PS9A 1Z7EA 3WGGA 1U78A 2FXAA 2FSVA 1Z1DA 1FT9A 1UOEA 1YIDA 2R8YA 2Y76A 1F4VA 2YMQA 3HZOA 4KPGA 1XXHE 4L3VA 2MSKA 2ZXWH 1H1DA 3JPWA 3BMQB 3N7AA 2YU9J 4Y2QA 1SXJE 3E2PA 1YW9A 3PGLA 4N0EA 4QUAA 4KWCA 3O8CA 6ABPA 4JJKA 1VG1A 2YIVX 4JITA 5I8PA 2BFPA 3TB6A 2D5IA 4I6ZA 3JD3A 2WFZA 3VDQA 1NULA 1TQ6A 3F2VA 1JTYA 4KDPA 4XFJA 1TWCJ 1G5IA 3COPA 3DNMA 1ETKA 3PQ6A 2RARA 2ZUVA 3H0DA 4KQIA 4CKBA 4RXMA 2H07A 1XMKA 2V3WA 4XWOA 1T2DA 2Z8ZA 2VPWA 3HCRA 4A6PA 2O2SA 3ZYZA 4FKZA 4DJTA 2H9YA 3NHZA 3KEFA 2P7CB 1XD2A 1JR3E 3D5LA 3JW4A 3JZDA 1NW8A 4ZEXA 4QPQA 5EVJA 3WB0A 1WLSA 3DW1X 3WLOA 3OS0A 1ZGGA 4CTJA 3B7GA 4RHCA 3GZ6A 4QVKA 3F6BX 4RZ3A 1HDCA 2WEKA 3ESCA 1TJYA 3M1AA 1RM4A 2X0LA 3TPCA 1OVMA 5KOJA 2WWVD 1ITZA 5IYCJ 4JUBA 1YRHA 4O08A 1QIGA 4DRXA 2XB0X 3T7EA 5CA1B 1X94A 4KRXA 3PT9A 2A1IA 1LC3A 2F4OB 3NP7A 5IYZB 3I76A 2XMRA 3PKZA 3GFRA 4UULA 1FBTA 2GDZA 1CNMA 3KLOA 2P4HX 2G08A 2Y68A 3Q3EA 4G5OA 3RC2A 3LHDA 1T5IA 4D56A 2NRAC 1DAFA 3R5XA 1QG6A 2H2HA 3BD7A 1NQVA 3ZK7A 2YNMA 4MGYR 5EJMA 3R2JA 2Z9BA 3TQRA 3ZV6A 1F36A 3ELKA 1JIUA 1PJQA 3OPNA 3HO1A 3WKAA 2B94A 5DN6D 4OI0A 4CKYA 3AF3A 3A9TA 4YK7A 3BL5A 2XAHA 1E3SA 2O7QA 2P4UA 4PGMA 1ZRMA 4UHTA 3IB6A 1NPYA 2I5PO 2O0HA 3OQBA 3N97A 4PQEA 3TZLA 1U0NA 5FOQA 4HLCA 1HKUA 2D59A 1RIIA 1EEHA 1WF6A 4OYYA 4JCCA 4XJXA 3G2MA 3S44A 4OREX 3KOZA 3QNWA 1LPOA 2LDUA 5KKAA 4GM0A 4M1SA 2QTRA 1QDUA 3F7NA 4OSOA 1UMCA 4YQZA 1JKPC 1Q14A 2XNJA 3FOWA 4NAUA 2QGUA 3HB0A 4OJKA 3EH1A 1NZJA 4WK2B 3SYKA 4BFVA 2WSSD 2KJQA 3GRAA 3QE4A 2F1KA 3LYLA 3CJNA 1NC3A 2OGSA 2V6BA 3UOAB 4D0LB 4DHEA 3QH4A 3RJTA 3JAKB 4BCCA 1FP6A 4GOMD 4M0KA 3A32A 1IHYA 3HUFA 5M3MJ 4S1TA 3ROUA 1A8QA 1EUDB 1QFXA 4I9UA 1Z0DA 1B16A 4JBNA 4QSMA 3LFUA 3HVJA 3DE3X 1EJ0A 2P65A 2VF5X 4OHZA 1JUPA 3TRIA 1TF7A 3G89A 3VDRA 3PNBA 2ZYRA 3P9PA 1Z6PA 2LYCA 1SBQA 4RHFA 3ZDDA 5HCUA 4MPTA 4E14A 2OV4A 3BWEA 1R4ZA 4ZCMA 3EGIA 3H7AA 3H19A 1B6RA 1T6BY 1KYYA 4ZV9A 3KBBA 1D7OA 1V7CA 4R83A 5JNSA 1ZHFA 1CULC 4Q1CA 2ZKIA 3CG4A 4B4CA 1ODJA 4RHUA 1R6UA 1KKMA 1CW2B 1VLVA 3U48A 4Z1OA 1DAOA 3ZXIA 3P9KA 3OSGA 4XLNF 4R1UA 4CR7A 5AFSA 3R9WA 4D7MA 1QHYA 2ENWA 3A1YA 2IYPA 4LRQA 5DCWA 5H02A 3ZIUA 1N2CB 2YWJA 3K92A 4GQBA 1ZNQO 3CLTD 4PNHA 4KPUB 4UCQA 5EJ9A 1X2NA 1LJUA 3GLGB 2WIJA 4L9VA 3IIEA 4YH1A 5ALEA 3HYNA 2BW0A 1LS1A 4Z51A 3NM5A 4O4LA 1FQOA 2G9ZA 2JCVA 1T2UA 3RASA 1AHPA 4YO8A 4YRLA 1KC3A 3KJFA 4ZU6X 4BFTA 3EMVA 3MK31 1XZMA 4Q48A 4QJ5A 1M8GA 4CMHA 4XLCA 3GJQA 4HNAB 4FT8A 3F1LA 3N8KA 3N8HA 3B73A 4D0SA 4I5FA 2IH5A 3IKVA 2CKMA 1I7LA 2YBEA 3UYLA 5A0TA 3O83A 2B82A 2QWXA 3R7WB 4Z7JA 1DU0A 5B7PA 3NWJA 1K89A 4KQKA 1T9DA 4H27A 3QVGB 5BNIA 3OCZA 4UD2A 4BKOA 5IG2A 3IUJA 1I2DA 3H17A 4N12A 1JJ7A 4KX3A 4C2TA 2LY9A 8GPBA 1UDAA 4LK1F 1KZ1A 2QD4A 3I1IA 4KYUA 4UXHA 3TLBA 4DLTA 3C3AA 3FMVA 1L0OC 1PFKA 2KIMA 5A9SB 4DKXA 3ICQB 1NI5A 3VHQA 2Y92A 3SZMA 2DKNA 3NVDA 4H7JA 2WZQA 1KR2A 3C97A 4WY2A 2K3FA 2UZKA 2P11A 2ZWMA 4JZYA 4D1YA 4V24A 4W97A 2B3DA 1TUBB 4EP1A 4NBWA 5C4IA 1NOJA 1Z34A 3G1MA 3BGSA 5A7FA 2CWEA 2WWTA 4BE2A 4XORA 2NSLA 1OLXB 4GL2A 2GPWA 2VRCA 3IVXA 3MOIA 4A5MA 3GFLA 3ERED 4IIDA 5EWLA 1QFJA 1UB9A 2CJYA 4QU0A 5C4GB 1P9QC 4RTNA 4IJ5A 2OTLI 1JKIA 1MP0A 1TK3A 1ZIPA 3WGYA 1L9KA 3PIIA 1S2MA 4HSTA 1CIJA 1HRKA 1N9GA 2RHGB 2DWUA 3KB1A 4M3DA 3L43A 3PFCA 4OY3A 3U2QA 4B7ZA 5K8IA 5LWQA 3KJEA 3VU1A 4BNGA 3HDDA 2CNBA 3CCYA 4LBVA 3R0AA 4D92A 16PKA 1OLXA 2SICE 1A8PA 1G8GA 4IZIA 4OKIA 1SAXA 1ISMA 2V7TA 4C21A 5E4TA 3RRZA 2O8KA 4RPJA 3BBLA 1I3QJ 4O29A 3ZDZB 3GHYA 3VMMA 5E1ZB 1RLJA 3FYHA 5B36A 1FQWA 4IWNA 2NAPA 3KJGA 2E1MB 4IFBA 2W9XA 3WTSC 1NASA 3ZVMA 4UUSB 2H2WA 3OBBA 5MGBA 2NPIA 3T7CA 3GDWA 1REQA 1GFIA 1J2XA 1XPOA 1XTAA 3USCS 3SFZA 2C8JA 3DA8A 5JD3A 2PKWA 1NW7A 3OEHA 5HZKA 4F91B 1E3EA 2ZS7A 3DAGA 2M1XA 1G64A 3TQHA 5AW6A 1RP1A 2NUAB 1ZMBA 3KG2A 1ST2A 2QD1A 1IXKA 4KAXA 1LWOA 4EUSA 1ABBA 4YT2A 2G28A 5DFAA 3IRQA 3PL5A 4DA8A 2ZUTA 3I32A 5AXDA 4AZ0A 5JMWA 2GGSA 4DQVA 3B02A 4DSZA 5K8LA 1QIEA 1R1TA 4RLFA 1Z83A 2H9AA 3HSEA 2YZ7A 3C24A 2ME0A 2RKBA 2R8PA 1TK2A 3BGWA 3HTUA 3DHWC 4D4LA 3QWBA 3HC7A 1HLFA 1DQSA 3BTIA 2YHSA 4C6TA 4ZT6A 1RIOH 1TTQB 1PQUA 1UZMA 1LE8B 1CY1A 1X86B 2CKDA 4Q5SF 4XX1A 4C01A 4DLRA 2H85A 4EGCB 1H9CA 4ZAWA 1Z33A 1I10A 3Q10A 4MRNA 4I02A 2O7RA 3BZWA 3FFBA 2AS5F 1ZFNA 2UXXA 5BMZA 2WHRA 2OL4A 2OZ6A 4PYKA 4XUDA 4YCDA 3K0LA 3PO3J 2WTMA 3Q6IA 3RRJA 1XCPA 2J07A 4L6IA 1XZAA 4ABYA 5CFPA 5AKZA 3LRPA 3JTHA 2B99A 3QJGA 1D1TA 1WCMJ 3FMPB 4H7HA 4RA9B 4UUNA 3H3ZA 1VQ8I 3NBUA 3ZD8A 4Q3AA 4DXAA 5K8VA 3KPUA 2Q3BA 2DMUA 1P1BA 4S04A 5M5WJ 1JIIA 1JLRA 4PFQA 4W8OA 2EARA 2LKCA 5GAJA 3UG6A 3WQBA 2VPQA 2XB8A 4E31A 1HF3A 2OD7A 2Y0BA 2YWEA 3CZRA 4MFDA 5JS8A 4EF6A 1ULTA 2DPDA 4WLEA 2RBGA 4GE3A 2IZ1A 4IDNA 2XTMA 4YJFB 3WRXA 1DEHA 2EJWA 2TECE 3UMMA 1HOTA 1BX3A 1ZUNB 1FYFA 2VL7A 4R7ZA 3EFEA 3IV7A 3KWFA 4IHWA 1BFDA 2XB5A 5B1HA 1Y3FE 4GYYA 3B9RA 5TC4A 3O47A 4WXDA 5G4KB 1E1QA 1ECCA 2CMDA 1W4AA 3ES9A 3LSRA 1V3QE 3QVMA 1R49A 2ZI6A 1BMTA 4I2VA 4KAAA 4FYWA 3OEWA 3QKWA 5CDHA 5GZ1A 2KHMA 2RAVA 1XR3A 1VKOA 4KC0A 1CQZA 4ES6A 2B69A 2H4JA 2KIFA 1VPVA 2B4KA 4LQ4A 5JDIC 5EPUA 4DUZB 2C8LA 2Z57A 4BY7J 3QP9A 4LHXA 4A3SA 5BQPA 2CUKA 4QXAA 3QI2A 1ENYA 1M0SA 1WV0A 2HHCA 2EQAA 2Q3LA 3UJBA 5JQWA 2C03A 1T3LA 4XSZF 2GESA 4UPVA 4WEOA 3JQQA 2I3BA 1IDOA 2IBTA 1SA0A 3VR3A 2WAFA 2AX4A 3UWDA 1LEAA 2WZDA 5JXWA