5F64A

Putative positive transcription regulator (sensor evgs) from shigella flexneri
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
204
Chain Sequence
AMNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Positive transcription regulator EvgA
publication title Putative positive transcription regulator (sensor EvgS) from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
total genus 81
structure length 204
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5f64A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f64A01
4E70A 4RDCA 4Z2YA 1UCRA 2PMCA 4YIIA 5B3JC 5JNWA 1F1ZA 2FVYA 4EYQA 1WKMA 3RVQA 2IPQX 1B59A 1MJAA 4A0XA 4EUKA 1O7FA 3RJPA 5JVTA 2QVGA 4RK4A 4ZH4F 5BR1A 3DPTA 3L09A 5DEQA 3VFZA 4IHSA 3W6JB 4RK1A 4MR7B 3IHUA 2RQPA 1G3YA 4RB1A 2R48A 4KRFA 5L3FA 3IRQA 4D74A 2PLNA 3HIFA 2DFIA 3SXYA 1F4VA 1MGTA 4MGRA 1F5TA 1MIHA 4LMYA 3EQLF 2NT4A 1D2AA 4EGSA 3VNBA 4WXCA 3GLXA 3JAMZ 4W5RA 4HZFA 2E1CA 2ACJA 2PMUA 5GQSA 2O03A 5L3BA 1ZGJA 3TMYA 3HSEA 3J81Z 3E3MA 1XHEA 3K9TA 2MYNA 5L3CA 4RXUA 4PEVA 1KU3A 5ILVA 2KIUA 2ETHA 1BIAA 3OQNA 1JDNA 1JXSA 4H3HB 8ABPA 3W6KB 1RPJA 3JVDA 4Q6BA 3BJ6A 2FMYA 1TQPA 3MQ4A 2H27A 2RDMA 4Z4IA 3EYYA 5HDNA 5JNUA 3RVSA 3I71A 1KGSA 3E6CC 2JB9A 5K1YA 3QRFF 3GT7A 1DDNA 4WUTA 5KC8A 2FW0A 3Q15C 4JAVC 4YFKF 3KCNA 4MS1B 5A2QZ 4BQAA 1F51E 2W85A 3PFIA 3H5IA 5JS2A 1CF7A 2QW1A 4HF1A 1K68A 2H3HA 3WODF 5IUKC 2E4WA 2J48A 4N9IA 3TDZC 4DQDA 3JY6A 3FMRA 2XGXA 3KP3A 2CO5A 4HDVA 2ZCWA 2GAUA 2FXAA 2XVCA 3N97A 1H9TA 5JNTA 2ZNZA 2EFNA 2GZWA 1FFWA 4WZZA 2B4AA 1SD4A 5TPZD 1Z17A 2K86A 4R79A 4ESJA 3E5QA 3F3XA 1TBXA 5CVUA 3KJXA 4XLPF 4R1HA 2YHAA 1G3SA 1E2BA 3E61A 2PUGA 2O61A 4F11A 4G7ZF 3V8KA 4W5TA 3ILHA 4LZLA 3M8EA 3GVAA 5BPIA 3G85A 2DW4A 2ZMEB 3VNAA 1PEYA 3FFWA 1ON2A 2FA5A 1YW7A 3BRSA 3GEZA 2HDCA 4MRMB 2EFPA 1ON1A 3OLZA 3RVRA 3IL2A 4HLYA 1O57A 2JBAA 1RZRD 5TJJA 4U0VA 4WXDA 2ADUA 4N41A 2K02A 5E3JA 1JFTA 4BXUA 3WU1B 2K4JA 4XLTA 5JR3A 1USIA 4IRXA 3HRMA 1LDDA 4IRGA 3EDCA 5PNTA 2H0AA 1Z2DA 2VBZA 6ABPA 5HVQC 1YO5C 4RGUA 4LG0B 3I09A 1USTA 5CYVA 1UDRA 4YIFA 1MDMB 4A5NA 1KU7A 4KQ9A 2FEPA 3CG0A 3T8YA 4WXHA 1L5YA 3KKEA 4MS3A 3T95A 4EQQA 3MZYA 1Z12A 4XLNF 4MR8B 4JB0A 2LF8A 4ETNA 4F8JA 5D5XB 2FBKA 2KJCA 3FM5A 1MJ9A 1YG2A 4N03A 2M8EA 1NHAA 4RKRA 1DJMA 4D0PA 2GA2A 1Y1LA 2XROA 4MQFB 4FT8A 3KTOA 1IW7F 3ZN0A 2OD5A 5JNSA 1EHCA 2UZKA 5E8GA 1ZRDA 2VOPA 5FFZA 4CDGA 4IRHA 5DDGA 1FZPB 2F8SA 1KYWA 1LVAA 3E3VA 4P1ZA 1FP1D 1RI7A 2QZ8A 2RC4A 1SXHA 1R22A 4M71A 4ENKA 4YFXF 4QYWA 2ZBKA 3U9GA 1AOYA 2RGVA 3HUTA 4GYGA 3GFLA 1Z13A 2ZWMA 1ZDMA 2CWDA 2L19A 1J59A 2P7CB 2N9UA 1PUXA 4MLDA 3AAFA 1QNLA 4OATA 4AIJA 2HPHA 3ZMTA 1ZHHA 4KK3A 1Z7UA 4Y9TA 3EODA 3TO5A 5KQLA 4HV5A 3RI4A 4M6XA 2EA2A 4Q6WA 4KN4X 4HBLA 3SY8A 3DKWA 4A0YA 4EJVA 1QNTA 1U5TB 3R0AA 3GFIA 3G1WA 3OM1A 5K5QA 2V6CA 2OZ6A 1MB3A 2KIMA 1K78A 2EJRA 4KYWA 1GXPA 3MIZA 4HX7A 2BYVE 1P92A 4L5IA 4RWEA 4XRFA 2MSLA 1LBIA 4LX8A 5FLXK 1PNRA 2V1UA 3KG2A 2QUFA 3KFWX 3JSPA 4TLLB 1L5ZA 1XGOA 2FF4A 3JPWA 1VRVA 1D8KA 4YR7A 5TQJA 3BDDA 1FBQA 1P6RA 1TLFA 4ASNA 3CTAA 2Q0OA 1QQAA 1LK0A 1SXIA 3RVKA 3FFTA 4UHJA 1YMUA 3HRTA 1D1PA 1SD5A 1ISRA 3WGGA 3E6MA 1QO0A 3BREA 2WTEA 2ZNYA 1RUNA 5ICGA 1LBHA 5EWLA 1R23A 3F6OA 2OZUA 2LP4Y 4OLAA 4LE0A 4L85A 4DN6A 2IOYA 3N75A 1OYYA 4FB4A 2WY2D 3BJAA 3K1PA 2L3DA 2I6FA 4OINF 3TDUC 1ZGGA 2EK5A 1LB2A 2QWWA 1DUXC 4EM0B 1W7PA 3F21A 3E5XA 1JFVA 5ED4A 3IPAA 3KZZA 4O1IA 2XDYA 5IC5A 1U2QA 4BHCA 2PJUA 1OPCA 2HQNA 4MR9B 3CUQB 2IYNA 2IA2A 3OMXA 1R8JA 2R47A 2IA0A 1H0MA 2WJWA 1U5TC 3K1NA 4NCBA 2HQBA 5JHUA 3J80Z 4L0ZB 4KUMA 2E4VA 4P55A 1FFSA 1E6KA 3CNBA 1M2FA 5BOXA 3HHHA 5EWJA 2KRFA 1BI1A 1RXEA 1DRJA 1C0EA 2KIFA 1AB6A 2H6BA 1KA8A 3MQ0A 3LSTA 3A10A 3NNSA 2XKPA 1Z6RA 3QOPA 4PE5B 3FDFA 3T1BA 4UVBA 3HEBA 1IN6A 1LEAA 2OA4A 3HSRA 4OIRF 2Y0MA 1XN7A 2JRLA 4UNOA 3LFKA 2PUBA 3I45A 3GYHX 1LJLA 4IXAA 1QP7A 1ZAYA 2MLKA 3FXRA 4UV9A 4RU1A 3DP7A 1USKA 5GOTA 3HM9A 3R61A 2P9HA 4Z4FA 4Z9BA 3URMA 2JT1A 4XFKA 2NZUG 1ZRCA 3CZCA 1NXOA 4ZYDA 1LDJA 5KVRA 4U88A 4EV0A 1QPMA 1M2EA 4KFCA 3GL9A 2P7VB 3WTSC 3QEMA 1LJUA 5LLQA 1FPQA 4KVFA 2WMYA 1QP4A 4E7OA 1XGMA 5HLGA 1DRKA 2VBXA 1D5WA 4N9HA 5E17F 1EFAA 4O3MA 5HS9A 2OENG 7ABPA 1C4WA 4O5VA 1FSEA 3GBPA 4MQEA 2V79A 4MTEA 2VT2A 4NV3A 1E2XA 1ZRFA 1VKRA 3ERED 2EV0A 2VK2A 1LQ1A 3H3UA 3LUFA 4UVCA 1DC7A 3CUQC 2V9VA 5E18F 3ZP5A 3N8IA 3DLHA 2MH2A 1WSUA 5IUNC 3SFZA 2DPUA 4G97A 2VOOA 1G4DA 3WGIA 5D2CA 3T6KA 5IT3A 3LMKA 3N0XA 1PHRA 1HW5A 4JB2A 1A04A 1LJ9A 1T2KA 1PUEE 1DBQA 2R3SA 3HO1A 1NATA 2HKXA 3JTEA 3ECOA 1FYLA 5BS6A 5HSGA 1MVOA 2GXGA 2PL9A 3FM3A 3N4MA 3HHGA 4M73A 5BPDA 3EQZA 2G7UA 1E6MA 3A0UA 1IN5A 2QQBA 4G0XA 3SNKA 4M9ZA 1Z91A 3V4GA 1KRXA 4RGRA 3GBVA 4RY0A 4TLMB 3OLXA 3HTSB 4N76A 4GPAA 1HKTA 4NHJA 4ETIA 1XCBA 4KK4A 3LA2A 4WCGA 2L2QA 2VXZA 3D8UA 3SZTA 1YTUA 2XV4S 4OTZA 3K9CA 1ULYA 3IWFA 4LFUA 3GZ6A 2W84A 1GLGA 3LTEA 1FYMA 3MWMA 3QPHA 4L9NA 1W5SA 3M9XA 4EYKA 3JW4A 2LIVA 3SZPA 4F06A 1EV7A 3SQNA 4M72A 1I1SA 2KKOA 3TB6A 2PJPA 2O20A 2XRNA 3GA5A 2MD5A 1JDPA 1RZRA 5DTEA 3I4PA 5L3DA 2FEWB 2XAFA 2ZXJA 4ESFA 4F3TA 2VE9A 1O3SA 3IP7A 2DT5A 1IRFA 2R7DA 1TTYA 4HF2A 1WI9A 5KQPA 2QXYA 3KHTA 2E4XA 2L4MA 4I09A 3H6GA 1IN7A 5TRDA 1JE8A 2IPMA 1MKMA 4U0YA 3DF8A 2F2EA 3QX9A 2L17A 2FLKA 4MEYF 3GYBA 4WWHA 3F6PA 3LUJA 3FXQA 3RH0A 2D1VA 1K79A 1W9HA 1G6NA 1JYEA 3KS9A 1Z6TA 2L02A 3Q5FA 3T0YA 4YO7A 2DQRA 1Z16A 3QP5A 5TQ2B 4RB2C 1OXBB 1BA2A 1W7PB 3QLUC 2Q2EA 1M5TA 5EEHA 2LF7A 3DQVC 3CKMA 5ERIA 4FE7A 5J8FA 5FWXA 4ZYLA 2OQRA 1P4AA 3LFTA 1T6SA 2ZO4A 4OIPF 3ZMUA 3O2QB 3WTTC 5F1RA 2NAZA 1DBWA 1GCGA 1ZGAA 4EYGA 2JK1A 3BP8A 1R5GA 2JZYA 3I42A 3ZPLA 1D1QA 5EWMA 3MMNA 3EDPA 2EV6A 4EJOA 2MYPA 4I02A 1Z9CA 4YFNF 5EWJB 4PGHA 3TOBA 5F6FA 1EAYA 4AD9A 4NCAA 2E7WA 3LUKA 1CHNA 1TVMA 4Z4CA 4Q5SF 3J80K 3LUGA 4HV6A 2DBBA 2FNPA 1HKQA 5FO5A 1O3RA 3WTXC 3FFXA 3HV2A 4ETMA 3ISPA 1ZLJA 2E7XA 2FN9A 4G8XA 1ZAOA 5ABPA 5I4CA 3C1DA 1IXCA 2ISYA 4TV7A 3WU0A 3DV8A 1DPRA 3K0LA 3P9IA 5HKOA 1A2OA 4NICA 1NXVA 1UB9A 3O74A 3HVRA 2FQWA 1U2WA 2V0NA 2R7FA 4IGAA 5KQMA 5DCMA 3CO6C 3GZ5A 2X7XA 5FLXZ 1YK1A 1BBYA 2XASA 3GW2A 1NXSA 3H1GA 3ZMZA 1B9MA 2FOKA 2PLYA 4M6YA 4NQWA 1EWKA 4U7BA 5IUJC 2O3FA 2MSWA 4KA4A 2HQRA 1EWTA 1HBXG 1YS6A 1YYVA 1W25A 3C3KA 1LDKB 4XXHA 1AB5A 4HA8A 5TPWA 3RQIA 2EFOA 4UHKA 2A5YB 3GF2A 2M1ZA 2P6TA 1DCFA 3E97A 1J75A 1ZN2A 1QBJA 3L2CA 4N0PA 2A6HF 1IIBA 2YX4A 3CO7C 2BEOA 1XDUA 2A9RA 5F64A 4LK1F 1JHZA 2H94A 2A68F 1Z2EA 1EH8A 1IUYA 1MZBA 4LJZF 2DO7A 3K4HA 3M1EA 4YCSA 4HYEA 4IPAA 3CJNA 5CHYA 2BBYA 2F5CA 4RB0A 1XSDA 1ZH4A 2JTVA 4A6EA 3U1DA 1ZYRF 2L18A 4Q4ZF 2NZVG 2EFQA 3ZQ7A 3F8MA 4QYMA 5L3EA 4IF4A 3UUGA 1Q1HA 4H3KB 3M6MD 4Q48A 1R1VA 4P9UA 4O6JA 1RUOA 3RKWA 3QU3A 4LLLA 3ROTA 2P5KA 5AIQA 3O1HB 5L3GA 2A9QA 3IP9A 2H09A 2G9WA 4ZZLA 1WRJA 4IVNA 3V8LA 4HQEA 1G3WA 4TMYA 2DLLA 2COMA 2JVKA 2FMFA 2M1BA 1R7JA 4P96A 1KYZA 1BC7C 4UHTA 1JFSA 1KQ0A 3K69A 5DCFA 5E1WA 4JP1A 3RPQA 3TD9A 3RVMA 3LWFA 2GBPA 3LKBA 1BOAA 3I59B 3BRQA 5TQ0B 1TLHB 4JOQA 4F7ZA 2HYGD 1ZG5A 3QLVC 4WXEA 4CBVA 3R0JA 4HLXA 2ISZA 2CHEA 2E4UA 3M7GA 5HLHA 4QICA 3RTRA 1K6OA 3O6BB 3IPCA 1QQBA 2XUBA 4ZJPA 3L9FA 2QZJA 1FQWA 2QQAA 4NQRA 3N0WA 2GXBA 5C5EA 5HS8A 2QQ9A 1ZG3A 2VT3A 4LLGF 3CTPA 2HYFA 2XAHA 1J2XA 4M88A 3H3ZA 4RAZA 3NHZA 1FY7A 1QZYA 4BH9A 4I2OA 3TQNA 4PCQA 1FNNA 5LEKA 3GX4X 3F8FA 2GI4A 2Z99A 3P9YA 4KICA 3EAFA 4KMUX 1FBSA 2VUIB 4WX9A 4QPJC 3HCWA 4JA2A 4EVRA 3F6CA 2FKAA 4YRZA 4FX4A 2FXIA 4ZZDA 4DNCA 4ZYHA 3H92A 3ULQB 3QEKA 4MYRA 2IJLA 3IP5A 2KJBA 4G94A 4LE2A 1JHHA 2HGCA 4M74A 2RNJA 4RSMA 5D6EA 4YV7A 5IEBA 1TNTA 4EJWA 1L0OC 5KC9A 4EGZA 1NXXA 4CGZA 2PBIA 1U2PA 2WWVD 1R1UA 1GHCA 2LKPA 5D8LB 3Q7SA 4L4UA 4B09A 3CRNA 2LPMA 3K1MA 1SFEA 3T8TA 3HUUA 2XIGA 2PQ8A 1O7LA 1U78A 1RIOH 1F4KA 3KLNA 2L54A 5AONA 3O21A 3C7JA 4IILA 1Z15A 3QELA 4PGGA 1ZLKA 2MSKA 3WTZA 1HW1A 3QLUA 4XBFA 2ESNA 3CUOA 4UXNA 1WETA 1BDJA 1IXRC 4GO1A 4UUVA 4YS6A 2EWNA 5B3JA 2A69F 1OXKB 5H20A 1I1GA 3HUGA 1BIBA 3TO9A 2CW0F 1IZ1A 4MAAA 2FBHA 4MS4A 2QBYA 4HQMA 1DP4A 3Q9SA 4MPTA 4KNYA 1KRWA 2W57A 2P8TA 2LDUA 3ROUA 1KU2A 4I01A 4HNSA 1SFUA 2K7LA 1DG9A 1O3QA 2VBYA 1I27A 3V7RA 5FWYA 1CF7B 3L7WA 5LEJA 1DBPA 3CS3A 2QLZA 2CWEA 2VC0A 3K2ZA 4B8XA 3F22A 4GXOA 2Z5UA 1QQIA 1ZARA 4Z9AA 3CLOA 4Z4EA 2W42A 6CHYA 1R58A 5DCLA 3HOTA 3OOPA 3DGEC 4DADA 5D8KB 4HAMA 1ZY2A 2V1XA 3BOQA 1YK0A 1BC8C 3E6BA 5T7BA 5HLIA 4EMSA 3IKTA 2V1DA 1U0SY 3I58A 3C3MA 1CGPA 2LBPA 2H6CA 3GWGA 2HS5A 4G7OF 2WV0A 2FEKA 3IDOA 3WTUC 2M98A 3FMVA 2A9OA 3F8BA 1YFHA 3ROFA 2XHKA 4EYOA 1DZ3A 5DD4A 2AXLA 1H9CA 1XGSA 4OMZA 5IT9K 3HRSA 1B4AA 1EH7A 3F72A 4HDUA 1XSVA 4UV8A 1UFMA 2QENA 3VB2A 1ZH2A 3PQKA 5CVJA 3FX3A 2HZTA 1CEYA 2STWA 4G9YA 1FX7A 1VLZA 1SD7A 3QLTA 4BHPA 4GGGA 3CFYA 5LHGA 3HDVA 2JBAB 3KYIB 3ZMDA 3EETA 4CZZA 1XHFA 2BE5F 2PUAA 3L49A 5D5UB 2ZAYA 5LRSA 2EFWA 2JPCA 3I5AA 4H60A 2L4AA 5HS7A 5CNJA 1BI3A 1SFXA 1TMYA 2HTJA 3O1IC 1S6LA 2O8XA 5DUIA 5K5OA 4I0AA 3EGCA 2YU3A 6PAXA 4LGWA 1BVHA 3HDGA 2CD7A 4XASA 4QWQA 4LK0F 1I3CA 5CVRA 3LUHA 1FBUA 3COAC 1ABFA 1QZZA 2FMKA 4MS3B 1JHFA 3E5UA 3P9CA 2PFBA 2GA1A 4G6DA 4M9SA 5CJ9A 1BI2A 4RXMA 3RKYA 1TW2A 9ABPA 1JYFA 4BHBA 3OM0A 3QU6A 3FMSA 1B9NA 4OMYA 5T3YA 5E20A 3H1EA 1P4XA 3REOA 3F8CA 2E4YA 5JNRA 1I6XA 2Y48A 1R36A 5TE9A 4MQVA 1USGA 3P7NA 1FWZA 4EY3A 3B73A 3IWZA 3HK2A 1REPC 4L9VA 4TN5A 1UHMA 1D4ZA 3HZHA 4OBBA 3ECHA 1B1BA 3F23A 4MS1A 5BMZA 1Z26A 1LNWA 2R25B 2NS0A 2FEZA 2Q5CA 1J9IA 4YWHA 3RDIA 2E1NA 1QPZA 4KPYA 5JNVA 1SMYF 1OYIA 1ZH5A 1HEYA 3OMWA 3WE2A 3RVJA 3F8NA 1BM9A 5LGTA 1MD0A 4RGXA 4G0OA 3KLOA 2QV0A 1R1TA 4N47A 2F5EA 2QVCA 3QAHA 3QELB 2MBFA 3KCCA 1DP7P 4RK7A 5D4SA 4D6YA 2ZKZA 2VONA 4ZYGA 1DPUA 4LD5A 4AWXB 3RVNA 3DEUA 4PICA 1JLKA 4JQFA 3T5XA 4RY9A 1K78B 1U8TA 3O75A 3CDHA 2HJ9A 2VYCA 4YP9A 2WJAA 1MB0A 1R5HA 4P9FA 1YVUA 4ML3A 4XSXF 3I5UA 4S04A 2E4ZA 1WQ2A 3EULA 4MS4B 3QX8A 1D5VA 3MFKA 1Z1DA 4HX8A 5LGNA 5FD5A 1DCKA 4ENNA 2RJOA 3GFJA 1NY5A 3O2PE 5H6RA 1FFGA 1HKSA 2CFXA 2GWRA 2ZMEA 2B1JA 4L0YB 2A9PA 1XD7A 5DV5A 1GVJA 4FX0A 2A3SA 1LEBA 2QYOA 1ZREA 1YW8A 4RZSA 2K27A 3NNNA 4K2EA 4LDAA 3TGNA 2DU9A 4EVQA 1A0OA 2CGPA 5EWLB 3S2WA 5LRRA 1UHWA 1Z05A 2JRTA 2PAFA 2HKOA 3EUHA 1JH9A 1OYWA 4HOBA 3LA7A 2HEOA 1XGNA 1YIOA 5HDGA 1W4MA 2DQLA 4MEXF 1IN4A 1URPA 5BRAA 4IMJB 4O1HA 1U04A 1Z25A 5E1ZB 3KSMA 4AIKA 4Q47A 4LG0A 2JCGA 4Z99A 1EH6A 2DK8A 2FE3A 3MEXA 1MDMA 3QPTA 1E17A 1ZVVA 4M9XA 5K5RA 2RV8A 1C0WA 4EVIA 4EM1A 3OQOA 1ISSA 1MAVA 2VC1A 1YMVA 1CYEA 4MQ9F 3E6DA 3H5WA 1WWXA 4JBAA 4ZMSA 2UXXA 2D45A 4MR8A 2IRFG 2PE5A 2NNYA 2O6GE 2IPLA 3NRVA 5HOOA 3KP7A 3LAJA 5KI6A 3Q7RA 3RKXA 3FZVA 4Z4HA 5IX8A 3S99A 4MQFA 3SHFA 1Y0UA 3IRRA 5KK1A 1V4RA 3N0RA 1TJYA 3FHZA 3JS5A 2J5OA 1XSXA 4I98B 2F5FA 2WC2A 2FTKE 3RYPA 3JVIA 1P8AA 1YQAA 4A12A 4G0YA 1YW9A 2YSRA 5DLEA 2YHBA 3NQOA 5CVIA 5LBQA 2IPAB 3F7NA 2XAQA 3CU5A 5CVVA 3KEQA 2KYRA 1FT9A 2FQYA 4IJAA 4ENMA 4HW0A 1HSJA 3R60A 4WT7A 3QEMB 1XWWA 4ON0A 3QK7A 5HQJA 2AS5F 3HSYA 3BILA 3LUAA 2PUEA 4KIFA 2EA4A 3T8RA 3BPVA 1S29A 2QU7A 4PZJA 2NRAC 3I0TA 3KYJB 4DQ2A 3O3KA 1TQIA 1TW3A 1YLFA 4WWCA 4MQEB 3LQQA 4AVPA 4ENJA 3FF5A 5KWSA 4MLCA 3V7CA 4A5MA 2FLWA 2GQQA 1U5TA 4CYDA 4OU0A 3TO6A 2MYUA 4LLNA 2HFHA 3SG0A 2FSWA 3DGFC 3GV0A 2YR2A 4ETSA 1FYKA 4OG2A 4RB3C 2PEXA 1HSTA 1D8JA 4GNRA 2DAOA 3RVOA 3UK0A 2VODA 3IC7A 5C5CA 3CZ5A 3ELKA 4MNUA 3H1FA 4LE1A 3BJOA 1BDHA 3G3ZA 3V8JA 3R6SA 4KV7A 4JK1X 4FE4A 1RXIA 1PNTA 4GCVA 2RN7A 3TOAA 5BQ3A 2J5PA 2GX6A 3JPYA 2RGYA 3WTWC 3N6VA 3MYYA 3PQJA 3KETA 5IT9Z 3MM4A 3T38A 2TMYA 2WRZA 1VTNC 4EVSA 3ZMSA 3LA3A 2A61A 4G6QA 2A6EF 4LDZA 1APBA 4N0QA 3LUDA 3LOPA 4Y17A 4LB5A 5BQTA 2NYXA 5EEGA 1M5UA 4EJTA 3WG9A 4G7HF 1S7AA 3CLKA 5IEJA 1IXSB 2JVIA 3WTVC 4ZYEA 3Q7TA 4F12A 1YTYA 3IKVA 3UKJA 4WF2A 4YGXB 3B2NA 1T98A 2FNAA 1U3EM 2UWMA 4S05A 4CHUA 4MR9A 3CUQA 1D3YA 5ICFA 3KZYA 3CG4A 1NXTA 1NXWA 2MLGA 3DPLC 1HW2A 1JL3A 5JS1A 4BAYA 1YS7A 5D6FA 1RZ4A 1KMIY 1U6GA 3ABTA 3Q41A 1GCAA 3ZN1A 4KN7X 3WE3A 2HOEA 4A6DA 5CNMA 4N0BA 1BAPA 2VUHB 1PEAA 4OLBA 1XMKA 2O0YA 4XARA 5D5VB 1GUBA 2OU2A 5J8CA 2ESHA 2Z9OA 3OO1A 3Q9VA 2HQOA 2WWYA 2IVMA 5DYMA 1FLIA 1FOKA 5ILSA 3GWZA 3A3KA 2A07F 3O1JC 5FWXB 1V3FA 1JGSA 3FMQA 3CHYA 4HNRA 3MZHA 1OR7A 4G0ZA 2QR3A 3TO7A 1R00A 3EJWA 2DI3A 2ELHA 2G7HA 3GRCA 2CG4A 1OKRA 2HR3A 2P5VA 3I64A 5EWMB 2MC3A 2LNBA 3TX6A 5DGCA 1P4WA 1EWVA 4A0ZA 1BN5A 1S8NA 3FXUA 2W24A 1KU9A 4LB6B 1NXPA 4KMRA 4KDPA 1S7OA 4L18B 3RVLA 2XKOA 3MAJA 5BRJA 3I53A 2XAJA 2ID7A 2MA3A 4P98A 4MGEA 2RDPA 1XCVA 3BBLA 2LSOA 4E7PA 2VN2A 1ZGZA 3M9AA 1JX6A 1ZG1A 1PDNC 2IW5A 4PYRA 2IT0A 2NNNA 1T34A 2ZFWA 1PP7U 2QM3A 2TDXA 3DZDA 3OLWA 4IHTA 4CO8A 3C6QA 2YX7A 2M30A 3R4KA 3BY6A 2PKXA 5DCMB 5DD8A 3KP2A 3OO0A 1XB4A 2WB4A 2FBIA 3M9WA 1SRRA 4G0QA 3OV8A 5ICCA 2GKGA 4KIGA 2BGGA 2IKSA 2DPDA 4IRIA 4HNQA 2Y75A 1QP0A 5E1XA 2IPNA 1K66A 3HSFA 2BGCA 4JASB 2BV6A 3V7SA 5FGMA 2Z3YA 4QLCU 3H5OA 3F73A 3JAMK 5TPWB 4Y13A 2W25A 4RK0A 2FSPA 4W5NA 3N53A 1SD6A 1KQ9A 3C3WA 3GFMA 5CNKA 2PUDA 4AIHA 3MF4A 3B02A 1P2FA 3J81K 1P6QA 4W5QA 3C97A 2F8TA 2PMHA 1I5ZA 3D5LA 5DKFA 4KQCA 2JPBA 2VE8A 3OLYA 4MTDA 3ABUA 2RJNA 1SXGA 5FFXA 2HTSA 2B0LA 1ODDA 5ICEA 5D4RA 4RAYA 2OAZA 3L6UA 3KE2A 1JF8A 5JFRA 5D5WB 4Z0NA 4LRQA 3HS3A 2EB7A 3KP6A 2AYXA 4W5OA 1FC3A 4RKQA 1X3UA 1USSA 3BPXA 4KIBA 1DCMA 4G0PA 4HX4A 2PG4A 2HSGA 3NBMA 3WTYC 3H5VA 2AYZA 5A2QK 1ZHFA 3GO5A 4Y15A 4EJUA 4XAQA 1MJBA 2FMIA 4D6XA 3W9SA 3OLVA 1IAWA 3KP5A 1QKKA 2FQ3A 5TQ2A 1NTRA 2FMHA 1BI0A 2M45A 1HXDA 5H6QA 4L5JA 2CQKA 4CXFA 2MH9A 4OIQF 3G73A 4ZPJA 5LGUA 1O3TA 3P9KA 5KQGA 1FSHA 1JWLA 1ZITA 3QP6A 5FBHA 2D1HA 3JSOA 2PI0A 1SMTA 3BZ6A 1G3TA 3GUDA 2JVJA 3ZMVA 1STZA 4MR7A 3LAPA 2P4WA 4RGSA 3H6HA 4EM2A 3LUCA 3I54A 3RYRA 3HTUA 3J7AO 3OQMA 1J7KA 5IULC 4YLEA 4GYIA 5ILUA 4HF0A 4I0BA 4PDKA 1KQ8A 5CLSA 3VODA 2FMLA 3RVPA 3NEUA 3H5LA 2R4QA 1TQMA 2ZJ2A 3MA0A 4Q7EA 1T38A 3HOSA 2HWVA 2PL1A 5DUKA 3NNDA 2FQXA 1IF1A 3BROA 2IA1A 4NB5A 5FD6A 1T39A 2NT3A 4A2UA 4RXTA 2DK5A 3EYIA 5J6XA 3BWGA 4RS3A 5HM6A 4FHTA 1J0RA 4U7DA 2STTA 2RVCA 3RPUA 2QVOA 1W5TA 5HDKA 3ILYA 1IN8A 2PN6A 3VEPA 4IMIB 5LHHA 1OMIA 1QMPA 3WGHA 5E8IA 2Q8KA 4BYYA 3SM9A 4L9TA 3DLBA 2EV5A 1B6AA 3HJFA 1F9NA 3KP4A 2C6YA 3L00A 4KT5C 4Z4GA 2RKHA 2K4BA 5JI6A 2M87A 5FB2A 1FSPA 3SAJA 3DBIA 3M8FA 2X0LA 3HRUA 2MYTA 4I7HA 3D0SA 2NUBA 3A0RB 1ZESA 4L9JA 2P5LC 4WK8F 4BNCA 3D02A 4O5AA 3C18A 1B00A 3H75A 2IDMA 3QLVA 2GIVA 3EQ2A 2P4UA 5AIPA 1U8RA 2CSOA 3KEOA 1QGPA 2XAGA 1DC8A 3LKVA 3DFGA 4OIOF 1PP8F 1AWCA 3FGZA 5CNIA 1JBEA 3O2JA 3TKYA 1E6LA 4RK5A 4UVAA 2L01A 3O2SB 1GUDA 5TPZA 1SAXA 2FRHA 2ID9A 3HYIA 1T0FA 2X4HA 4YG2F 2QBYB 4RY8A 1Z18A 2D2WA 2CYYA 1ONVA 4PZ0A 4R8HA 5FBKA 1VPWA 5IBQA 4EGYA 3GXOA 3VOEA 4H0EA 5FWYB 1H9GA 3LQRA 3U2RA 2PUFA 2P6SA 4MRMA 4WXMA 2QSJA 1HQCA 4CICA 1XMAA 2LUOA 1RNLA 1P6UA 2DRIA 4RK6A 4RV5A 3ML6A 3DXJF 3MCZA 2VBWA 1BDIA 4ZMRA 2YPRA 2OQGA 3F6VA 1TNSA 3H5TA 4U0WA 1ABEA 2M5WA 4P5OA 1BJAA 4KZKA 2UXNA 4KMFA 1TM2A 1XDSA 4OOIA 1K7AA 3FWEA 1S3JA 4KREA 1QO0D 3I59A 4MHGA 1FP2A 2FN8A 5TQ0A 2FU4A 4XSZF 3NHMA 3IP6A 1GXQA 5LHIA 2F5DA 3JTHA 3RIRA 4ESBA 3JTGA 1L3LA 4G86A 1J56A 3HXMA 2Z33A 2DTRA 4G0MA 2JSCA 4RS8A 1IRGA 2CHFA 1W7PD 2PUCA 1J5YA 2IP2A 2OBPA
chains in the Genus database with same CATH superfamily
1YAHA 3C45A 1Z0FA 2R1VA 3ZCOA 5C7YA 3DKVA 3BR6A 4YIIA 2ZSAA 1XI2A 2EH3A 2EGHA 3E8SA 2FVYA 4HDOB 2OZKA 4XQEA 2AX3A 3BHNA 1L5GB 2VFAA 5KSYA 2C7QA 2VSQA 4PN3A 2WU0A 4TUYB 4RF3A 2WKPA 4UEOA 2DFIA 1K8ZB 4LI0A 4TQUS 4MGRA 3WX0A 5HWSA 1R0WA 3B53X 1L4NA 2IIBA 3CESA 1A82A 1H4TA 1ZGJA 1Y48E 2QRJA 2GKSA 2LDBA 3OOJA 1G6OA 3Q3VA 3QMMA 1UZUA 3DL0A 1CIJA 1FP6A 5JH7B 1PL7A 4YCDA 4LYFA 4RHUA 3GN1A 1KI9A 4NTZA 1GAWA 3EYYA 4GSLA 5LYJF 1U0RA 1NJGA 5B12A 4XQCA 1YJCA 2PVCA 4X71A 3IQIX 1XVTA 3KZNA 4BQAA 1F51E 1J42A 1WHSB 3Q8KA 3WODF 4I3FA 3HA5A 4LZWA 1IOWA 4OSOA 3VR4H 1S2GA 2FDCA 2UXBB 1LBSA 2FZVA 2VZ8A 3FDIA 4AD8A 2EFNA 1IHUA 3S1MJ 2H5LA 2LBFA 1KP9A 1MOZA 4GSKA 2JGMA 1SVIA 3DYVA 3E5QA 2H06A 2V98A 4WECA 3UMJA 1LFUP 5AW2A 1G2HA 3GVAA 2G4VA 2FA5A 1ON1A 4B6OA 2HZDA 4UBNA 4N7BA 3CNEA 4CLEA 1E4VA 3CZ6A 5E3JA 2ZI9A 3U7RA 2I1VB 2F8LA 4IRXA 3HBJA 1DWPA 4IRGA 3CC2I 2ZWOA 5DP1A 3AJAA 2JW5A 2X1MA 2JLBA 5AK5A 2CMFA 1USTA 1JALA 4QBFA 2M4KA 3TUJC 3OKCA 3EXFB 4BNXA 3ZRGA 4EQQA 1U1IA 4DV6B 3JREA 4MR8B 1IK4A 2GD0A 1AUOA 3FM5A 3LIPA 4N0DA 1AC5A 5GTIC 1WCIA 1GQFA 1IEVA 3R9XB 2JJ2D 4XIIA 1QK4A 1KONA 1BEUB 4XVUA 1OROA 4MW2A 2HI3A 2PTHA 3KXLA 3HV0A 4BNDB 4GX1A 3BTLA 3H7AA 4P1ZA 3H19A 4KO2S 1JDZA 3AEKB 4HWPA 4XORA 5LKRA 1HQKA 2P7CB 4R1QA 1IBLB 5HPYB 4MLDA 1MUUA 5FULA 4ZFNA 1W8IA 5AKIA 3V7UA 1WM1A 4OXRA 4GYYA 5FB3A 2HRRA 2O5VA 4Y9TA 1FMCA 3K5WA 4XEUA 4CEJA 3NT2A 3T5TA 1VHTA 2HLPA 4AJEA 1OBFO 4LK2A 3CX7A 3G1WA 2X2OA 2AQFA 1QORA 2RGWA 1K78A 4XX0A 3MIZA 2I78A 1GN9A 2WA2A 1H8EA 5T4BA 1XXLA 2WNIA 2BYVE 1VYUA 4Q4LA 2V1UA 1YS1X 3KFWX 4PX9A 4ZQIA 1QVUA 3UK2A 2VZ9A 1QO0A 4TXHA 5BYKA 4NZ9A 3VGJA 2XOEA 1LTQA 1G1AA 3VR3D 1Q1ZA 1TEHA 3OWOA 4XYMA 1D2NA 1QLWA 2BONA 2ATCA 3WMRA 3IPAA 2BTQB 4EITA 5B30A 4FOOA 1C1YA 3VVBA 2WOOA 3EZ2A 4KUHA 1MO4A 4ZIRA 1FOWA 4ZOLB 2CVHA 4MUAA 4E14A 1KERA 3GJYA 3WSTA 4RKEA 2JLAA 3K09A 5ALPA 1DTWB 1P3JA 4WV3A 1FOXA 1LEAA 3BCBA 1WKBA 2BW3A 2XBUA 1QP7A 4IXAA 4JGGA 4PY2A 4TL7A 3L06A 3O4GA 2J5BA 4KFCA 3F7TA 2QTVB 4YYZA 5C3EJ 4ZVRA 4KVFA 4RVGA 2J3MA 3RRMA 1KEUA 3QVGA 2M1XA 2BSQA 3I73A 2FWJA 4DY6A 1YDWA 2H2AA 5JPDA 3LXMA 4B7ZA 1RHUA 1IBMB 3TNJA 3I9KA 1IV8A 3CJTB 4GR5A 2EJCA 5CT5A 2JJYA 3O8QB 3NGXA 1H0HA 5HKKA 5ALDA 4X8OA 2QOEA 3MVEA 3LMKA 4GAEA 3B6AA 1QS0A 3FE2A 3IQGX 4QL3A 5IH3A 5DPMA 1QHYA 3AVOA 4GZLA 1UOEA 3R09A 4OQQA 4PZPA 2LFBA 3CP8A 2BH9A 1I7NA 3JXEA 2EVWX 3IERA 4QODA 4TYMA 2SICE 3L1JA 2QP9X 1ULYA 4I4LA 1Q57A 1PL6A 1ZCAA 3R9IA 2H54A 5ALKA 1DQUA 2E48A 4F06A 4XPIB 4M3BA 2PJPA 4QPDA 4E7HA 2MD5A 2LNDA 3EWAA 1O94A 2EGGA 4F2HA 4XLLA 4BQIA 5ENVA 2JFUA 5JASA 1APLC 1GDTA 1E1QD 3PSIA 1DJLA 1W2HA 4B80A 4PJLA 1S4QA 5DGXA 3S7TA 2VJKA 4EPTA 1Z7BA 1Z16A 5GADJ 1UMBB 1BA2A 2FVXA 3TTSA 3KZXA 4L9AA 2RG7A 3BHJA 2FG6C 4JODA 2WU1A 3CQZJ 1JLHA 5LUBA 3LV8A 3A3NA 4UEWA 2POQX 3JRAA 3I42A 4U6SA 2QKYA 5HF9A 4DYHA 3H0CA 4EJOA 4QU8A 4I6GA 2ORED 4JVLA 5HZGA 3GMTA 5IASA 3COVA 4GRAA 3L05A 1XMPA 3PENA 2ZIAA 4FQ8A 5FO5A 4XQFA 4M0MA 2JAOA 2GEUA 3MWLA 2Z6VA 3K8OE 5ABPA 5DM70 1OBCA 1NJ1A 4YRAA 1JKMA 2PGOA 3DV8A 3IJRA 4NSNA 4IKFA 2W9XA 3HBNA 3IAS1 4QAJA 4FB5A 3BK1A 5B5EC 2FXVA 1R71A 3OD1A 1FFCA 4UREA 4HA8A 1OGJA 3OYDA 1DCFA 3MJTA 1WXIA 3K71B 3PWTA 2Y31A 3P0IA 1T4BA 1QRRA 2PO5A 3NBZC 3SI7A 1Z2EA 4KU4A 1Z3YA 2DO7A 3CJNA 4MINA 1WJBA 1UWCA 3D8SA 2VHTA 4EP1A 2NX2A 4I9NA 2HRQA 4WJLA 5AW8A 1Q1HA 1RQXA 1TOAA 1YZHA 2M6LA 3IAXA 1QRSA 1II0A 2H4XA 1NR7A 3JASB 1MC5A 2FUG2 3BSYA 5LXTB 5FA5A 1JVNA 5J2UB 4R9SA 1CUHA 3CD6I 4RFSB 4L2IB 3FXOA 2XB2A 5D85A 2P91A 1WXDA 3SQLA 3PCRB 3I8SA 3QNWA 4DS3A 1O58A 1BEZA 1AA6A 5B1HA 1JE1A 3PNQA 3BL8A 1SC1A 2WU4A 2A5JA 3VDQA 2H0QA 1G2OA 3QLVC 5FOSA 4HLXA 3LWNA 2XPWA 2OQIA 3EUAA 3HBMA 1CG6A 2XUBA 4ZJPA 1FQWA 1TVCA 2BFNA 5HS8A 4Z7OB 3SLRA 1U7TA 1E2FA 1ZUNB 4X65B 2GI4A 3GJTA 4QPPA 2VUIB 1FBSA 4UUBA 3BQ9A 3HCWA 2Z08A 3HY6A 4F4CA 1TZKA 3DZCA 1F8YA 5AK6A 3O9MA 2FEOA 3VC2A 3IEPA 4TKVB 2KBFA 3VPAA 4JUDX 4OHCA 3U3XA 2Q5EA 1JG4A 4IS3A 5IKXA 4GDFA 3DMRA 2AE1A 1SFEA 3G68A 3LL7A 1B42A 4WN9B 4MWEA 3FNBA 1PNQA 2R1ZA 4DDUA 4IILA 4QBIA 2R7QA 4OJTA 2LRDA 3GJ4A 3T4EA 2GEFA 3DFIA 4FX5A 3WHKA 5DX8A 4UXNA 1LA2A 1WETA 4DWWA 3LQKA 1G5HA 2XAUA 5T6BA 1MABB 1HF3A 2NNWB 3Q9SA 2G06A 8GPBA 3QH4A 2HTFA 1ETXA 1RM0A 3CISA 5DI9A 3OZSA 3ZE6A 1E9VA 1JDTA 2DA7A 1ZUWA 4AYBA 4MO2A 2VJOA 4AIIA 2WV0A 2R97A 2VJBA 3OJEA 4NS4A 5FR2A 2ZIGA 1KEVA 1E3OC 5JSZA 2QX8A 5IM4A 2JSPA 3C3BA 1M1YB 2C3MA 3BWMA 4H0NA 2RGCA 1U1DA 4G9YA 1COWD 3PFNA 1QUEA 5FJJA 1JJ6C 4MCHA 2Q3FA 1RLIA 3RYIA 3UJNA 4CZZA 2G83A 2PUAA 1VJRA 5F27A 4JT8A 1HL3A 1U5BB 3RE1A 1QYRA 2L4AA 1OQYA 1QFXA 1JSZA 2JH3A 4ZDPA 2ANBA 5DUIA 2X6XA 3PIPF 2CD7A 1QB7A 2XUDA 2TCTA 4N3NA 4W8GA 1IBKB 3P9CA 2Q3HA 1QZXA 1BI2A 3DR3A 4G89A 2WIBA 1GUUA 4BHBA 4MB0A 3V2HA 2UXDB 1D2HA 4NUBA 1WVIA 1SELA 1L7AA 3G3EA 5E20A 2OAQ1 4RVNA 3REOA 5J2TA 3AR4A 4LJRA 2OV4A 5CU7A 4D96A 2Z43A 2GGSA 5CCEA 4DMHA 2CXSA 2FP4A 4TRMA 2YL2A 5AVKA 4QNRA 2Q41A 1PNVA 4MVJM 3PNVA 3IDAA 1X70A 4UC0A 3EBOA 1KPHA 4YV1A 4D9IA 2FEZA 2VLIA 5LYYA 3UXEA 4AN1A 2ZB9A 4TOIA 4NRDA 2E1MB 3C2HA 2VHZA 3G2OA 3LXUX 2O54A 2ID6A 1NG7A 2Y6VA 2W6ID 4BVFA 5A5DA 4BLVA 1JB9A 4P4SA 2WJAA 3HC7A 4P9FA 5EJEA 4ND7A 2VJCA 2H9AA 4XSXF 2OHFA 2H1RA 1UBFA 4QGGA 5JW6A 4L4RA 5K4HA 3CCRI 2OO3A 2Y93A 1LFBA 4LNAA 2ZRKA 4DOMA 1K3TA 3R6GA 1THTA 3HR8A 3S81A 3W7BA 2HOSA 2XR1A 1IL0A 2CW5A 1YH3A 4MEXF 1IN4A 3IE0A 3LVBA 2WZCA 3BT7A 4ER3A 4E4YA 3EE6A 4C22A 2XSDC 1UJ5A 3UMCA 5T67A 2Y0SA 4RTOA 3E5RA 1WXXA 1CUSA 1QR6A 2VC2B 2IRFG 2Y92A 4M7OA 3ZK9A 3HFGA 2WHXA 2Z8XA 1XD2A 3LQ4A 2OILA 4AZ0B 1HGXA 1V4RA 5FUWA 2FOWA 5K3FA 2DFKB 3CO0S 3M4XA 3IP3A 2FG5A 2XSZA 1J6UA 4EMTA 1UELB 3IALA 2QQ0A 3HYTA 1V95A 4NV1A 1CR6A 2HF9A 3QEMB 5KYXA 1MB4A 5LYJB 3BF8A 4NKRA 1W36B 1U2ZA 3JQAD 3RZOJ 4PZJA 4PAQA 2ILVA 1OV6A 1TW3A 3LQQA 3L7NA 2A86A 2I7XA 4BVKA 1XK7A 2MYUA 1CFJA 1ITZA 3SG0A 5AHOA 4PYNA 1HNWB 4EA8A 2GSWA 1ZD1A 2JFBA 3H1FA 4E15A 2ZRNA 3V8MA 1ID1A 1GAXA 1CUUA 1WSWA 1G20B 1L6RA 3DDCA 4F2GA 3C24A 3RTBA 3E05A 1PR4A 3U48A 4PFSA 1O9HA 2VWGA 1V0JA 1GPMA 4IPTA 4JYCA 2P9BA 2HPVA 3FJ1A 3LUDA 1G2PA 2NYXA 5EEGA 4MWCA 3UAGA 4MCJA 4OKIA 4HGZA 3HU1A 4KPFC 3IMGA 1C9JA 2HV9A 2QQ5A 3UWDA 4M0KA 5G4KA 3FTNA 1ZM4A 1CQZA 3L6DA 1U1FA 1ERDA 3NVDA 4S05A 4CHUA 2AUTA 4CVNA 3KZYA 5DHUA 4AS2A 3DPLC 1YQWA 2JFOA 2PN1A 3G2JA 5ILGA 5HKBA 4OYHA 1A35A 1FMJA 1U99A 1BAPA 5P21A 2PZEA 4U0KA 3DF9A 2X15A 2F90A 2X19A 1XQWA 4PRKA 4ARIA 2SBTA 3O1JC 3ELYA 4HDSA 1TAGA 3SOZA 1NYQA 2QPOA 3GY0A 1BJKA 1DKPA 2VAXA 2H7XA 3TE7A 1M75A 1LXCA 3NDJA 1II8A 1OKRA 4NC9A 2A84A 4QOGA 3NLLA 2MC3A 3E3LA 2X8AA 4YRGA 1B8PA 2Y30A 1XZMA 2WQ6A 4KDPA 3VDMA 2ID7A 3TKAA 3KUUA 4JH0A 2VDRB 1EWRA 2XYGA 3AFHA 3GHHA 1SXJC 3SXUB 3WLIA 4ZT3A 4TQGA 4FDAA 1K3FA 1H1TA 1PP7U 2I4OA 5JHGB 2AN5A 5F12A 1RAAA 3DFZA 3WTCA 2VSOA 3JD3A 5IU6A 1VCNA 5JG7A 2GKGA 2ZJ8A 5IMSA 4S12A 4IHYA 1T35A 3RBXA 3WL8A 2ZBFA 4P3XA 4OQPA 3E1KA 4QLCU 1KMHB 3F73A 1LI7A 2V8BA 1X3SA 2QSFX 3T52A 5F52A 3N53A 3A05A 5LIPA 2BI4A 1TYCA 2QG4A 3I01M 2QP3A 1E79D 1US8B 1WV0A 4KQMA 1E2KA 2F8TA 2X58A 3ZOBA 4DANA 2X8BA 2OEPA 3HVHA 2VE8A 3ABUA 1RBYA 2ONZA 4NPCA 3THXB 2EFHB 1ODDA 5ER6A 2FSSA 2VJAA 4E5KA 4Z0NA 4PHCA 4QUDA 5CX1B 1NMQA 2W4QA 1DCMA 3UANA 2PKQP 2XUAA 5BSEA 4BNWA 4R1PA 4Y15A 4EY4A 1QIGA 4YUYA 2FMXA 3L04A 5DNVA 1DINA 4LN1A 4E21A 4S1OA 3RUPA 3CX3A 4BQFA 4L5JA 3HKBB 5IN5A 3ZKAA 3HKEA 1DIOB 2VBIA 2I76A 1UZMA 4XMYA 2VXDA 2PI0A 5G2OA 1PR0A 4X1IA 4EM2A 1SUWA 2VDNB 2GLOA 3RYRA 3HP7A 3PXAA 1N6LA 3KBOA 4Q18A 4EBFA 4I0BA 4PDKA 4HWOA 5CLSA 3JQ6A 2HWXA 2FMLA 2ENWA 3DEKA 5ELXA 3EVNA 1OTHA 4Q3LA 4R9UC 2JA1A 4WJKB 4Z3OA 2PU7A 5AHWA 5JTTA 3STVA 3L9WA 3H0DA 4KLNA 4FHTA 4JBGA 1G66A 3GTMJ 1Y1QA 3F90A 3ILYA 5JSUA 3WLOA 1OMIA 1YJWI 5ALWA 1MBKA 2ZYIA 2ZJ7A 3OIFA 3AI1A 2A0XA 4C0SA 4NMXB 1YHNA 4DXAA 2IGTA 4C04A 1MH9A 2X0LA 5TLSA 4I7HA 2W4MA 3UO8B 3MOGA 2YJNA 4BNCA 4HAWA 3V1YA 1T2EA 1D0IA 2HU5A 2CDRA 3A1TA 3PGA1 5KYUB 2Q1YA 4AURA 3RFVA 1PR3A 2H2WA 3G0DA 3EXG2 3UJPA 3NBQA 2BM0A 4R81A 3RG8A 1R7RA 2X7HA 2ZREA 4L02A 2HU7A 2C82A 1G19A 3R3SA 1CVRA 4RK5A 1YR7A 1SXJE 3SSMA 1UR5A 1RI5A 2ZJAA 2LE0A 3I6YA 1IE3A 3TCNA 2QTZA 3WWOA 1LCIA 3L7MA 4KPUA 1MIJA 2JARA 3UJ9A 2UUZA 1FTGA 4B32A 2CMDA 1CJSA 1OXMA 1GTJ1 2DMPA 1H9GA 5J4VA 3A8TA 5LA6F 5DEIA 5EUMA 2DERA 2CW8A 5KWJA 1YZFA 1CY7A 2C07A 3UV3A 1P6UA 2ZS8A 1PT6A 1NVXQ 4IL6C 1TNSA 1ABEA 2NVUB 2R85A 1XPRA 5HS6A 3OOHA 3IHTA 4ZTBA 5TV2A 1IK6A 4R1LA 2O2XA 1G4UR 1LFAA 2F5DA 2KI5A 4BO6A 5IF3A 2CFTA 3L0DA 3BGOS 1MJNA 4L16A 1YJQA 3ZE7A 1N75A 2M3AA 1PZXA 1YHYA 3DQQA 4Z2YA 3KX2A 2X40A 3NVMB 1EVEA 2JASA 1UJ6A 1ZEJA 4R0NA 4BBRJ 4YUVA 3K0CA 2UUCB 4NXMB 4BNDA 3L0CA 1NLYA 2X5JO 3CKLA 2C7GA 3UV7A 5ITSA 3GLLA 1J21A 3AEKA 4IJMA 2PLNA 5D3MB 5JU6A 5FQOA 3RS7A 3GLXA 3KTAA 3MFYA 3RARA 1VQ9I 1SIUA 1KWKA 4KN6A 1E1RD 1IXZA 1D4FA 3PIOF 1V8DA 2VQHA 2DSNA 3E3MA 3RSFA 1H2WA 1D0XA 5L3SA 3OQNA 1UBNA 4WQMA 4A10A 4LY3A 2YZMA 1C9MA 1DJNA 3DTNA 2ZRLA 4QUJA 4P33A 4WNYA 3IBTA 1B93A 1AKNA 2JFZA 4L95C 1Y3FE 5CYFA 3U7HB 5JNUA 4QXOA 3S2ZA 1KGSA 1ITYA 1OYVA 3CEJA 1IVYA 1FOYA 2ECQA 5ER9A 5EL0A 2Y4NA 1UP6A 4NNOA 4CKEA 5TRTA 1K5GA 4UOZA 5JV5A 1CB0A 5K7FA 1Z0DA 1NNEA 1XB2A 2MIIA 3IDQA 1KY3A 3GJXC 2IWRA 2PBLA 2ZRCA 4WZZA 4AJ4A 4IEFB 4MKRA 3CT6A 2K86A 3JAMA 4KGZA 5FNVA 2ZT7A 1WCWA 1N7IA 4UFOA 5FPSA 2X6RA 3DOIA 2R5WA 2PT7A 2OBBA 1HRDA 3E61A 2IY8A 4G7ZF 4EM6A 3VSBA 4GKKB 5F0HA 2VDUE 1G9SA 3L01A 2HDCA 1A69A 4NFHA 2VA8A 3U4MA 4I9FA 5TJJA 2HYDA 5F7XA 5GM2A 7REQB 3WU1B 5EHGA 1USIA 4ZEOA 2RQQA 4V0QA 4F4UA 4A9AA 1YO5C 3L8HA 2VH1A 3ANLA 1Y6QA 1MDMB 4TSFD 1G17A 2P40A 3GTPJ 3KKEA 4RABA 1A4XA 4RTMA 2VQ6A 2LF8A 3GGJA 4ND8B 4BWVA 4X1KA 4RKRA 3UWSA 1JXMA 3LA6A 3GDHA 3H9GA 2EQBA 2NUAB 4YEDA 4EB8A 1CY1A 3CUKA 2P3OA 2C98A 4BS9A 2ZBKA 2C61A 3ABSB 2P9YA 4DDTA 3ASYA 1ZDMA 4DIBA 2OGWA 1QMGA 3LUBA 3L8ZA 4WIAA 1ZSNA 2HPHA 5A02A 3HTXA 4KK3A 3LH5A 2FJ1A 3EODA 4V2GA 4BE1A 3FMPB 3TO5A 4OX9B 2XMGA 4ESVA 4IYRA 3DKWA 4A0YA 3R0AA 4MUJA 3GFIA 2CKMA 1DX9A 4WERA 1P7IA 2YQ4A 2O1XA 3ZWCA 5CB4F 2X1LA 2XTMA 2GPBA 4JD5A 3CMEI 5HQTA 3K5HA 3PIRA 4KGDA 4UE6A 1ZGCA 2YBDA 4PONA 3ZD9A 3EZYA 3PLAE 5BMVF 3KG2A 3JSPA 4LTMA 1PWXA 2QDKA 3JCUC 3F1LA 1NQAO 1NSFA 1U7XA 1GTMA 1TMGE 3FCXA 3F8WA 4PS1A 4V3BA 4TRRA 2MFZA 3BREA 1R88A 2QMUA 4DVJA 4ZP1A 3K9GA 4B71A 4LFBB 2XCLA 2OZUA 4I5FA 3O26A 1G8KA 3AG3H 4BY1J 2G9NA 4B40A 4DN6A 2WY2D 1Z0IA 1UKVY 4OINF 5D1HA 1Q44A 1OIXA 1GUFA 2RB4A 3GIDA 2G40A 2ILTA 3UAXA 2ONCA 2I29A 2XDYA 4RLQA 2HQNA 3I5XA 4R05A 3CUQB 1TAHA 1TM4E 2G72A 2WJWA 1V4NA 3TWOA 3K1NA 4NCBA 4IV8A 2D1TA 1XX6A 1FFSA 2GKOA 1W19A 3S5UA 4CCJA 3LVQE 1Y63A 1L1FA 4F92B 3PGKA 3DKXA 1DC6A 2X5XA 3BGDA 2PZAA 4YREA 3NIGB 4UBJA 1E8DA 2GS9A 3RHTA 3GNQA 3CCMI 3RJ5A 2HJWA 2OCXA 5AUQA 2EU8A 3NO4A 1NR5A 5GOTA 1ODKA 1E3PA 1V5FA 1B6TA 1IY8A 4O29A 1IB0A 5KDOA 5KHOC 1ETYA 1ZK0A 2YXDA 1WQ3A 3TLZA 4D9JA 3OR2C 1FCJA 1QRUA 4PK4A 3K0AA 1FPQA 1PSZA 5CDFE 3TTYA 2B99A 1JFRA 4JFRA 2JAHA 4O5VA 2DBZA 4MQEA 2VT2A 1SU4A 4HSRA 2FPMA 3ZP5A 2G67A 4CMIB 4O2AB 3QIAA 2FRVA 2QTGA 4RZ3A 3AINA 5L53A 3GLUA 5IT3A 2NM0A 2OUIA 4REQB 4TRNA 4JB2A 4DIMA 1NATA 4DRZA 5JAHA 4D8XA 2GXGA 1H8HA 4JB3A 3FM3A 5BPDA 1IJWC 1YNOA 1UM9A 1BYIA 3RFTA 1XL0A 3D59A 5KX5F 1VKJA 4NE2A 3FSEA 2PKWA 3JASA 3WO1A 2H1KA 2NO7A 2GAIA 4ZKDA 4FBMA 4GI1A 4OTZA 4PZCA 3K9CA 1H8ED 1O95D 3C7KA 3DA8A 2O8BB 5J2UA 1DWOA 3V8EA 3TW4A 1OH6A 1W1WA 4JOBA 4L2IA 1KE2A 1EV7A 4CKZA 1TZLA 1U90A 2KKOA 4AK9A 1EJ2A 1Z0AA 3EZXA 4F3TA 4ESFA 4MK4A 5KAPA 3JQCA 5KTMA 1ZGWA 3MZ8A 5AI5A 2QSHX 3RLIA 2WUGA 1IN7A 2VXYA 3FWNA 5KHDA 1B2LA 3W90A 3L7YA 4PZYA 4EMBA 1BJTA 3X1DA 1K3UB 3C7CB 3QLUC 4PNZA 3NOQA 1G18A 4QQKA 3ZJYA 1IDOA 1K83J 2OESA 4GHWA 1O6BA 3VHQA 1VL8A 1R5GA 2HQSA 2YWRA 5JNLA 4HB0A 5ITWA 2OTJI 2QA4I 2WD9A 1T6XA 1EAYA 2QJFA 2FPKA 2P90A 3ABZA 2DBBA 3ZW8A 3MS2A 1O3RA 2RHLA 1WPRA 1G4AE 5EZSA 3WZLA 4WN9A 2WB1A 1DTEA 3C2GA 2FOXA 4TV7A 2O2ZA 3P9IA 3KHKA 1OAAA 2FOLA 2XYRA 2L9SA 2X6YA 1GT6A 1DIRA 2N42A 2X9VA 1COZA 3AWDA 4AMBA 1ZX1A 4OGLA 4JZYA 3ZDZB 4FFNA 3H9BA 1W0TA 5IJ0A 3EIQA 4NQWA 5SY4A 1XMIA 1VMDA 4IJ5A 4AJIA 2HQRA 1XP8A 2GNPA 2QMOA 4HXGA 3C3KA 2I03A 1ZN2A 3OOYA 1I4WA 1IIBA 5HKKD 4H4DA 3MMSA 1V8OA 2GB4A 1MZBA 1DTSA 4HBGA 4GPZA 3M9LA 4YT8A 3HRIA 5DJ5A 4BGVA 5I4BA 1KEKA 3JD1A 4C20A 3TQTA 4NOJA 1N2HA 2EFJA 4Q48A 2Q2NA 2JLWA 1YA6A 1MZPA 3NDPA 3A4CA 2O14A 1R37A 2MR6A 5K99A 2A94A 2B7LA 2N1BA 2HLHA 2Z4RA 1A9OA 2GDZA 3R2JA 2FPWA 4MV6A 5DHTA 3GP8A 4IAOA 1BCSA 3ED5A 3FZQA 3J7TA 1ESEA 4MWGA 4F91B 3L0IB 2O57A 2MW8A 3QFTA 4XLZA 4MIYA 5JCJA 5JYEA 3CZ9A 1M1EB 3AFOA 4XD7A 2I2AA 2Y2UA 3LDFA 2GLXA 2IW3A 3EK2A 1R0SA 3MKWB 3QOXA 1RZUA 1DDGA 2QUZA 4JYBA 4TN1A 3VH4A 3NHZA 2HDDA 1K8QA 3QUCA 3SWWA 4FFMA 1T1RA 1XG1A 3NS7A 2WW8A 1RPNA 3P9YA 1PJ2A 1IUKA 4EVRA 3U6BA 5IZCC 2B5OA 1F8FA 2WAXA 3A58B 3AEYA 4KR2A 4DNFA 2H4WA 4M74A 5ALGA 2I6QA 4HVAA 3MQFA 3T5BA 1X7WA 3VDNB 2ONKA 2BZSA 4PQRA 3BQMB 3DC7A 2RHCA 2R6FA 2PLRA 2WYHA 4YIKA 2OCDA 5BWNA 2COEA 2JJ1D 4TLAA 4LA4A 5HRCA 3C7JA 2PX2A 2GM9A 1XTJA 4HAIA 4D9FA 1OLOA 3S93A 2ESNA 5JROA 4V39A 1DT3A 1RZVA 3FETA 1T1EA 4C1NA 4CFYA 2DQSA 3EMVA 1EE9A 3R6DA 3N8KA 1J39A 2ZUCA 1KDPA 4KYUA 4JZKA 2XDQB 4KNYA 1SC9A 4H7IA 1JQBA 2O6LA 2JRCA 2MSYA 1SFUA 4R8SA 2LY2A 2WVAA 3ULKA 4UBOA 3K2ZA 3M82A 4WZBE 4JYZA 5F4ZA 2QU8A 4Q3BA 1XPXA 5K01A 5EJ6A 4BL0B 1U94A 1BXZA 2ZUWA 3C8DA 3LL4A 3TB4A 1L7BA 2VR1A 1U2DC 1EJ0A 2CLKB 2WICA 2HS5A 3HH8A 4XDGA 3M5CA 4WZAB 3UC5A 3WTUC 4EAQA 3OFND 3DYBA 1T9DA 1A5BB 4K87A 4MYCA 3OSZA 2AXLA 2ZI4A 2WDPA 1Y7PA 2QL5A 3OP4A 1DFGA 1YJXA 2VWPA 4XR9A 4BHPA 3ONWA 2C4MA 3A01B 2CVFA 4MKHA 1AGRA 4AZ0A 1DIAA 3SS7X 5DF1A 1Z2AA 4YYEA 3GLIE 2Z2JA 1XPOA 3K3PA 1RRFA 5TEWA 3OF3A 4I0AA 1AA7A 3EGCA 3G4SI 5K4AA 1BVHA 1UFVA 1PSDA 5CVRA 3FVQA 4DA7A 1KOGA 3LY8A 2FWMX 2ONJA 5AI4A 2GA1A 4RDIA 1KU6A 3AC0A 4D0RA 1ONOA 3BD6A 3ZWAA 2GSDA 3F8CA 3I37X 1TWAJ 2HF2A 2R86A 4DM7A 3HY3A 1E1DA 3LP5A 4RDXA 4J6FA 2VG8A 1QSGA 1VG9B 4DNOA 1NRWA 3S8EA 3GLGE 1QOZA 1RCFA 1VPLA 1GY8A 2R25B 1CDOA 1NVWQ 4B43A 3MJDA 2QTFA 3U7EB 3DBVO 3MYRA 1L1QA 1SUSA 1TUEA 3ZI4A 5LA6B 3S55A 1WD5A 1OIWA 4D42A 3Q88A 3NARA 3RVNA 2HUPA 5AFSA 5CLFA 4HLCA 2JIOA 9LDBA 3MTJA 5FADA 3B6EA 4PW0A 1IY0A 1X1QA 2F4VB 3MHTA 2D7JA 4KPGA 4GLFA 2A92A 2PSDA 1FFGA 1JU4A 4IDPA 1RYDA 4FX0A 4NZZA 3C1OA 4HVTA 4JSYA 3PQEA 1J70A 2PX0A 1Z05A 4JNCA 4ALLA 2ZM5A 1K7SN 1BS2A 5IDWA 2C31A 4B3SB 3VSAA 1YZVA 3OEYA 2P4QA 5LP6F 2DQLA 1RR8C 3ON5A 4A2QA 2LK2A 5TJHA 1BHO1 5J4KA 2NUTB 4ESHA 3F9KA 3HM5A 1J4AA 1RXUA 3QPTA 3W04A 3ZBUA 1YZQA 1QF6A 4PPYA 4NF2A 3TLJA 3L9XA 3PI6A 3TMOA 3LX5A 4N39A 2O6GE 1OI2A 4GD3Q 2L2OA 2XYVA 2YW9A 1VLJA 5FORA 3LHFA 4IM7A 4MRVA 5I7WA 1D04A 1U98A 4I98B 1QK5A 1WEHA 2BEUA 1SQ0A 1E32A 1MEOA 1DGQA 3ZU2A 2PX4A 3KEQA 2KYRA 2Q0SA 4C7MA 3LW7A 4ENMA 2FUG6 3P9QA 1R2QA 3SHTA 1RJFA 3ZBQA 4I9UA 1Z9BA 4BACA 1EG7A 5HQJA 2VJYA 3LUAA 1KU0A 3AVUA 1UANA 1BWRA 2GAJA 3W06A 1YLFA 4HKTA 5ALYA 5AW6A 4UW9A 2GXSA 3V7CA 5C31A 3Q2KA 3UTCA 1M0TA 1XTZA 2I10A 1DAHA 3IT0A 4URHA 4GOOD 1GNTA 3OYFA 5LVAA 3AHCA 2HXSA 4OL0A 2UYCA 4OG2A 1VI5A 2PEXA 3CURA 3IC7A 3G2NA 1S01A 1QDLB 5DP2A 1ZU4A 5J1UA 1HORA 1K27A 3FWPA 4MKXA 2FUNB 1A8HA 3FX2A 3BTCA 3MYYA 4KTVE 5K0CA 5JD3A 4FCWA 2ZQ5A 1FPMA 1SVMA 3BX1A 5JXGA 5J1SB 3B1KA 1OHHD 4P0TA 1EVQA 1JPUA 5BV0A 3EA4A 2L82A 4WBNF 2XIQA 1JBQA 3UIEA 4DRYA 1JIKA 4BGEA 3B6CA 2Z1MA 5A4MS 3BE4A 2KPOA 1FDSA 3PHHA 5KNBA 1T24A 1ZI8A 3SXJA 2R7LA 3GT3A 5EJ5A 4IOAF 1XEXB 2MLGA 1VXOA 3EVEA 1KMIY 3AEQA 1X1EA 1Q77A 1WKCA 1DKOA 1XXHB 3F3YA 1TZMA 1OCOH 5CNMA 1GARA 1PEAA 5E9QA 4BV2A 2RCYA 1R4AA 4FW9A 5HFJA 1SGWA 3R7SA 4TYYA 5GP9A 2FA9A 3BD8A 1X74A 3DKPA 4G4GA 2QRKA 3GJZA 3WLNA 5K0SA 2CL0X 1LBQA 2J59A 3JAWB 1WW3A 4MUEA 3U4DA 5JMWA 3GLSA 4MQBA 4OPMA 4AL4A 3FXUA 4XI9A 3L7LA 1WHUA 3TH5A 3RVLA 3PKJA 4L18B 3CUTA 3MTQA 1KDRA 5EMNA 1OFUX 1PLJA 1JAXA 4GI3A 1RWMA 3ABIA 3DVLA 3IDFA 2IT0A 1ISJA 5FRNA 2P2NA 5KSOA 3RK1A 3V9AA 5CB4B 3W3AA 1N6HA 4GNKA 2CFCA 4L72A 4DLPA 5I47A 3LP8A 5BMVB 2YC4C 2G4CA 3HP1A 3LDAA 4HQ0A 1IY1A 3BIOA 5CD1A 5LOVA 3D6AA 3HSFA 1TLTA 2BGCA 2ZJRF 3V7SA 2QXUA 2YVKA 3FVVA 4ZEVA 3GLHB 3VR6H 3U1TA 1KQ9A 3BH0A 4JR2A 3R7DA 1RKTA 4F2DA 4FP9A 4I1OA 1WSAA 2X23A 5TXGA 2E5ZA 5EZYA 3K4QA 3TQHA 1AHDP 4LF7B 3KEMA 1ATZA 4YRDA 4TSRA 2IEAA 1EGMB 2O06A 4DQ0A 4ZDLA 3K92A 2X85A 1OX4B 3NTUA 2KMLA 3HS3A 2CLHB 2VPPA 1X3UA 1TIBA 3EFOA 1U31A 2HT1A 2LGJA 2IYXA 4DSNA 1E4EB 4YMUA 4KAAA 1YZUA 4HK4A 1C3OB 3U3RA 3UHPA 1NTRA 1P17A 4TMZA 2CC2A 1GZ5A 1CRQA 4GMDA 2R1TB 4CIXA 2BF7A 4A3DJ 2XGOA 4RFVA 3GDWA 1YKSA 4DLZA 5D86A 2HJSA 5K8TA 1GVDA 1EIWA 2AQ8A 2HU9A 1E99A 3T7KA 5TVGA 2FPRA 3KLBA 3K2EA 3N7TA 4CCSA 1BOBA 5IULC 3IRUA 5D3MA 1NW8A 2JRMA 4UNPA 5G02A 5E0KB 4JJAA 3MA0A 3OJXA 1EUZA 2HRZA 3JYHA 1RI1A 3NNDA 1TZ2A 1WU7A 4JGIA 2XF7A 2WF9A 2BVNA 5BO5A 2VF4X 4DABA 1OLSA 4JXXA 3THOA 2HSDA 3B51X 2OVBA 2DBRA 5CFZA 1QHHA 4BO2A 4MW1A 1BWQA 1UZCA 1W30A 1W87A 5J43A 1C3EA 3STWA 4LQDA 3T1QA 2GASA 1JA9A 2HLDD 2OV8A 3LNQA 3EN0A 2OOSA 5PGMA 2LREA 3RWMB 3SAJA 2W6NA 3IUBA 5KX5B 4CCKA 1RHMA 3AV0B 5FPKA 3Q0EA 5CAEA 1J5PA 3QBEA 1Z5PA 1VBKA 2GIVA 3HP4A 4YGYA 5E8JA 5JXWA 1EBUA 2R0QC 4LK3A 3U7JA 2GARA 1PP8F 1UMCB 3LQ1A 2GCPA 3R5SA 1KI2A 2JVHA 3V8BA 3DVQX 4TS4A 4H9GA 5E1BA 1NF3A 1R6XA 2E2WA 2D2WA 3KPUA 5FBKA 1IAQA 1T9AA 2PZKA 4HGYA 3L7JA 1XMAA 2DECA 3G9ZA 1VC2A 1SVLA 3FCSB 3MD0A 2A4KA 2G1UA 1Q16A 2CB9A 1V16B 1ZR4A 2PNFA 4OOIA 2ZBPA 1M7BA 3AP2A 3QFCA 3QYPA 5HP4A 5KYGA 3DJYA 4UXJA 1G5IA 1PKXA 2FN3A 4JYMA 3W5HA 4J49A 4TWIA 3LC1O 1J56A 3PR1A 4ZVUA 4ZCLA 1LPAB 5BN4B 3VR1A 4G2TA 5HQ3A 1RR7A 2XXAB 1EINA 2CNOA 1GT91 4J3NA 4RF2A 3EIWA 1I4TD 5JNWA 3VU9B 2EIKH 3RVQA 3EPHA 4RSRA 2NPOA 4BJTA 3N6XA 1KYYA 2ACKA 4N49A 1Q7EA 2NUAA 3K2BA 3V4SA 4CL2A 2BZTA 5E79C 3LO5A 5AXAA 2CYCA 1YE9A 4ZWNA 1ORKA 4XCQA 1S6YA 5E95A 2O2JA 3ADPA 5BSTA 1QGDA 4W5RA 5REQA 4JCCA 3G9QA 3OJFA 4BU1A 1HA3A 1NZDA 3IHWA 4NEQA 3ZE9A 4AP5A 3VNRA 2OXFA 4Q4AA 3MWKA 1PUFA 5DNYB 2KIUA 3EEQA 2BEWA 3O8HA 4QPCA 1CQWA 2HK9A 3KQNA 4YUWA 2DA2A 2XWQA 4AF6A 3O4IA 2X9DA 3S8PA 2CJYA 4YRBA 5GZ3A 2GT1A 1WP9A 2C2WA 3PCXA 2VJPA 3H5IA 3AG2H 1B23P 3DBOB 2H3HA 1VL6A 4RD6A 1XFDA 3M33A 4OB7A 2C9DA 4IDCA 1UZNA 4X60A 2Q0XA 4BFLA 5KHLB 2XTAA 1RYBA 2FX5A 4S1WA 3QA3E 1ZP6A 2GZWA 2IF0A 3MOIA 1GTVA 2C5FA 3B8HA 1V1RA 3GGSA 4NWIA 4BVHA 1QBKC 4Q1VA 4R79A 1CQTA 5AVQA 4PVCA 1ZICA 1TVKA 1KYTA 4R1HA 2PUGA 4JUAA 4E5NA 2FN4A 4YT4A 5BPIA 2VTBA 4KWCA 3UAZA 5B7NA 5SICE 3AKEA 2JBWA 1T26A 4ZZ2A 4OYLA 3RVRA 6GPBA 1USUA 1WBBA 1J9EA 1X1AA 4LRXA 2QN2A 1QM5A 2H5IA 3EXHB 4DZPA 1T3ZA 3U09A 1DE0A 4J4BA 3TS1A 4J2TA 4BUJA 1L7OA 2YIMA 3PHIA 4GP6A 5CDGA 3ICEA 4C0LA 2QRPA 4KYTA 4QELA 4AIDA 2IIVA 1JSRA 4OMCA 3EIUA 4JBXA 3NJ8A 3ZWWA 1EFVA 3CCFA 5BRNA 1KDZA 4ETNA 5D6NA 3T94A 1A6QA 4MUIA 1U1CA 1JEAA 1Y1LA 4FT8A 1GNQA 2OD5A 2XT6A 2I7TA 1RC8A 4IRHA 5IDVA 1SZJG 4X61A 3W9YA 1FP1D 4C6TA 1NM5A 2BFFB 5IARA 1ND6A 3GPLA 1J59A 4A0SA 5C3MA 3WAJA 5ALSA 3A6PC 3AF0A 3CCBA 1RQRA 1WMAA 2OXRA 4OB6A 3EUHC 1FDOA 2FDXA 2CF5A 2IT1A 1WHTB 2AJCA 4LBVA 2L69A 2QMYA 4H6WA 1QWSA 2Q2QA 3EEBA 1F1JA 3IESA 2QRNA 3ZBTA 3UGJA 3LRXA 2DA3A 1EH5A 3LYAA 4NCKA 3ZY3A 3EFHA 1SUEA 1C5KA 3S3NA 1U7ZA 4IUDS 3D6UA 2ZVQX 2IYYA 2ZJYA 2BOLA 1O08A 4JVMA 4QGHA 2FF4A 1E9RA 4KR7A 1VRVA 1D8KA 2R5YB 1NMXA 5AQ1A 3KQHA 1YS2X 3S2UA 2Q0OA 1G3UA 3N2KB 2WSMA 5LN1A 3H8WA 4MCAA 2W7NA 1VPVA 1YCHA 1SBYA 4D3DA 3K2AA 3MCWA 2EX0A 2VF5X 2BW0A 3QUSA 5DCUA 4ENSA 2GK3A 1GQOA 2GYVA 1WI3A 2FP3A 3F8TA 2B37A 4MR9B 1JNXX 3ZW7A 3ZOZA 1K6YA 4DSAA 4L0ZB 4KUMA 2F1IA 4FD2A 1IHPA 3OF5A 1ML3A 3ZTWA 4PC1A 3RC3A 1MFPA 2QXTA 3PFKA 4OIRF 4UNOA 3LFKA 1UWLA 3NHWA 1LNSA 2C5SA 1Z6YA 2C04A 1WB6A 1JLRA 1PAUA 5LWHA 4R41A 3MMXA 4FGSA 2W70A 1LDJA 1I1NA 2G1AA 1CBUA 1M2EA 2NVYJ 3ZNOA 2L0XA 2YJTD 2XRZA 3V1NA 2DCMA 4D6PA 1R4NA 2CLLB 4G63A 1XGMA 5HLGA 1OFGA 1MT3A 5CVEA 1NHGA 4UPDA 3RGWS 2NWQA 3SJAA 4CM4A 3OZGA 3IURA 1DAEA 1A7AA 1G38A 3NWPA 4RLFA 1VCIA 2IFTA 2IXAA 4Q4DA 1PDOA 1TLLA 3BOSA 7AT1A 1G8AA 1G4DA 3WYDA 4M6WB 3SMQA 2NO4A 2ME6A 4E46A 1HW5A 1A04A 4UJ5A 3M34A 5CH3A 5I8ZA 3BTUA 4NJMA 4DA8A 5FA6A 3TP0A 4B33A 3EASA 4C0HA 1WMSA 4D3ZA 4H6VA 2B9SA 3HCEA 1VL5A 1X8XA 1YA4A 2O50A 1KETA 3N87A 4O2AF 3UAOA 1HFJA 4NU5A 4W9NA 4N4AA 3L7KA 5K0FA 1RJEA 1B8IA 2JI9A 1XRQA 3W5VA 2G0AA 4RESA 1XCGB 1GLGA 3V7NA 3G2LA 2GTIA 1RPZA 4JP5A 1Q7RA 2P78A 5LP6B 5FX2A 2G04A 3VYTB 2LIVA 1FFXB 1PL0A 1WAMA 1PWHA 2FEWB 3RRXA 2XAFA 4PHTA 5IRCD 4DA6A 2BVLA 2E4XA 4QD3A 3U44B 2IEIA 4G09A 3EGXB 2ZJ4A 3RKUA 4MEYF 1Z8DA 1NBIA 2YJ6A 1J7JA 1W9HA 1QONA 2LRHA 1Z6TA 2XGGA 3Q3SA 2J45A 2AFHE 1RE1A 4RTKA 5FWXA 4D80A 1T6SA 2C0PA 1F0KA 1VQ7I 3AEXA 4G6TB 3ESBA 1T5SA 2Y1OA 1OAKA 1P60A 2OO5C 4PXAA 4N9QA 2GVNA 2X0NA 2JZYA 4HPWA 3ZPLA 3PDUA 1KI6B 3WYCA 2AXPA 2EAUA 2ZR8A 4BVEA 1RYFA 4KQGA 4YFNF 4MJLA 3RS3A 1DOAA 3AB3A 4HI0E 4YI3A 1K2WA 3AFMA 3LUKA 1ZU5A 1JI8A 1I8TA 3RG2A 1HNXB 3EFBA 3L6RA 2FNPA 1HKQA 2BDEA 1P9OA 4I1UA 4NENB 2RAVA 1IXCA 3RD5A 3IAS2 3P1JA 1UBHS 1V39A 4NICA 3OPMA 2G36A 1R4MB 2H08A 3A27A 3F9CA 1TIPA 1M8GA 3FF4A 3AONB 4XTRA 4N5HX 2PUHA 1AB5A 5KINB 4JJFA 2XGDA 3EZ9A 1ENZA 1G6Q1 4M0CA 2BEOA 1I6LA 1OD6A 1OE0A 2QB5A 3EC1A 3I72A 4C30A 1U0LA 1U9JA 1FSFA 1QA6A 4WBNB 2REQA 5CHYA 3KZKA 5HIAA 4X6YA 1ZYRF 3F8MA 1GA1A 1I6KA 5L3EA 3MJCA 3AG1H 2B6HA 3VHXB 3RHSA 1BVUA 4WZAA 2Q3DA 4LWPA 4R8LA 2CUNA 3DOHA 5FOXA 2CUZA 1PZHA 3ROTA 1CF2O 3HN6A 4O59O 5AIQA 1J8FA 4CM3A 4A27A 4QO7A 3GUYA 1EWYA 4B2PA 4BQEA 2RKBA 4QAQA 4IVPA 2QGNA 1XMQB 1P7CA 3D7RA 4HQFA 1BC7C 4UHTA 3ZXSA 3K69A 3TIIA 1CJUC 2F67A 2C77A 1BRTA 1I1HA 4U2BA 1JJAA 2L9RA 1M34A 4DUGD 1AGNA 2Y3IA 2VBGA 4BZPA 2E4UA 1PP4A 3PUKA 4BO0A 4ZDKA 2ZT6A 3UWKA 3NDBB 4QEZA 3FNHA 1U0GA 5DISB 3RLFA 3ZZTA 2I3AA 4GR4A 4L0MA 4I55F 5EC8A 5DV9A 1J2XA 4YASA 2JMWA 4R3WA 4KE9A 4MRPA 3SX2A 4EY6A 2NU7A 3WC4A 1ZMTA 3WZMA 1GV2A 4I5GA 4G94A 3WK7A 2RNJA 4JBYA 4LNHA 5AR1A 3QYJA 5K8CA 2SCUB 3B1YA 4MUKA 4R1UA 4TLDA 5B4UA 4TTJA 4FZRA 2CQ7A 1NBME 1CQXA 4G1EB 4CKCA 1ZIPA 3NIWA 1E7SA 2DTEA 5EMJA 2NZJA 3AR9A 3QG1A 4U7TB 4CM7A 5FAKA 4MAAA 2YOGA 3ES9A 2HSWA 1MSEC 3G49A 4UD6A 3CWZA 2QX9A 5I9IA 4BCCA 3PKIA 4LF4B 3KAQA 1J99A 4U9UA 4C78A 1DL5A 4PJJA 2VYVD 4ZEXA 1X0XA 4PX3A 4UVIA 5T7BA 3G23A 3DQPA 1JZSA 4IRMA 1PZNA 4KH1A 5B2EA 2OCCH 1QAQA 1UT8A 3Q3IA 1YFHA 2AW3A 3ZUPA 5KTKA 2IGOA 2YQ5A 5IT9K 4HDUA 1HPLA 2GAAA 3B6IA 1ZH2A 1AV6A 2STWA 3RV4A 4HF7A 5AJUA 4QLBA 2DM6A 2VF8A 1G5RA 5C4JJ 1A2QA 5HBRA 3GDGA 3A6EA 5JPIA 1E58A 3E5NA 3JSAA 2PEYA 1K61A 1HE1C 1JTXA 3L49A 5D5UB 4CHGA 3I3LA 4H60A 4MQUA 5JCJD 4DMFA 4DB2A 4JJKA 4TUYA 3B1ZA 3DE6X 2WTXA 4KNVA 1KIAA 2AB0A 1RRKA 2P2GA 1WCV1 5A4DA 4PS0A 1N3BA 1Q22A 2PKYX 4FGKA 3N2ZB 3H0GJ 4RBNA 5FTKA 3FMSA 1G6HA 1B14A 4KB5A 1XNJA 2RHRA 3RU7A 4HC4A 4M1ZA 4LGYA 3FPSA 3KB1A 1L3BA 1UM8A 4RVFA 4Y6GB 5JNRA 2FCRA 5DYIA 3HGYA 5JH7A 2VKEA 1BKYA 5CIWA 3I83A 3ONDA 5AKJA 4LBWA 3DB2A 4A3BJ 3ZIDA 2EP8A 2Z2KA 5GVSA 2O52A 4ABYA 3MJRA 4YP7A 4HD8A 4DXHA 3UFBA 3KOMA 1WHSA 1J33A 4N40A 4BJ6A 3CUVA 5H70A 4OYRA 3WGUA 2OC9A 3IVMA 1MD0A 1L5LA 1R1TA 4DLBA 4KKXB 5B58C 4RK7A 5D4SA 2EARA 2UZIR 3RNOA 3F2VA 1ZVKA 4PICA 3W5UA 3CRQA 4XVQA 3VYSB 1JTVA 2OF7A 7MDHA 4IDOA 2FZWA 4E7ZA 4HX5A 4XSGA 1I50J 3V8NA 3CN9A 3VOTA 2K85A 4D4GA 2CHGA 2CFXA 2GWRA 2A9PA 4PSKA 3E7LA 3OIWA 4EDHA 1PYOA 3U39A 3IXLA 1OW3B 1ZM2A 1U5CA 4H17A 1YA8A 4K2EA 3ADOA 4TLCA 2IZ0A 4X6XA 1A0OA 4EVQA 3EF3A 3AVVA 1MNDA 5A3SA 3SVLA 3BFPA 1YJ5A 3ETCA 2HF7A 3DV0B 3LQYA 3RC9A 3I62A 3T1TA 1U04A 1KSGA 2HHLA 3D8BA 2ZWVA 4TKZA 5AD1A 2LTPA 1E60A 1MMSA 4Z8YA 3G0BA 3EXFA 3JAWA 2FZEA 1BMDA 3COYA 3JRIA 3OR1C 4MI1A 4YCLA 2PHZA 4MR8A 3IR6A 2OHHA 5JCZA 2XUQA 4V0OA 2X13A 3R9XA 5SZKB 4FSDA 2GO7A 3SHFA 5DI3B 2AR7A 3CLRD 2OLEA 5BSRA 3RUEA 5B58T 5I5EA 2YHBA 4KHPB 5CVIA 1KC3A 4RD3A 2XAQA 1UBOS 3RIEA 5DYGA 5LL6P 3ZVNA 3RPEA 3RWOA 2EYQA 3PSAA 4CETA 2HK7A 4LDPA 3NHPA 2Q6IA 3SVTA 5CJJA 4IWYA 3BMQB 2HIAA 1I5RA 2GCGA 1SXPA 2ZULA 3TO6A 3IT2A 4HY3A 4QYTA 5B3SH 4FWBA 1LFDB 1SC3A 2VCHA 4RB3C 3VUEA 1CJMA 1CUBA 1CR4A 3AJRA 5E3IA 1Q84A 2VQDA 5D84A 4YRNA 3QI7A 4Q7LA 3GROA 3FWYA 1YV9A 4ENQA 2WIJA 4FUQA 4K26A 4H08A 4BKPA 2FWBA 2GLTA 3W1EA 3TOAA 3RUDA 3ZE8A 2F1HA 3TLYA 4RD2A 1LDEA 2AN4A 3C0KA 5IT9Z 3ABQB 4HMPA 2WRZA 2JI8A 1TT5B 3LA3A 2A61A 1H4SA 4QBTA 5FPPA 3QVKA 3T3PB 3UVEA 1E4EA 4WOCA 1P0CA 4JB8A 3PFWO 2C5BA 3IQHX 3V4FA 4PU0A 5ELMA 1TKBA 1DKLA 4ZT5A 2BTQA 3NT4A 3TUIC 2XITA 5EPUA 5JJLA 4LJLA 5K8IA 2HXGA 3NOXA 1O5TA 3BEDA 2I22A 4G65A 4ZOLA 2BHRA 1P62B 3Q41A 4RO0A 3IUEA 3CINA 1HKUA 5JXHA 1DTWA 4OLBA 3K9LA 1ESMA 1DHRA 1W4RA 3AIIA 2XRLA 3SQDA 4JC4A 3P9RA 2HK6A 1H2HA 2QR3A 4XA8A 2QTVA 3CR3C 3DR5A 3K9BA 2AC7A 3VZRA 1F14A 1S8NA 2RD2A 3GEDA 3RRJA 2XAJA 4RMHA 3A4IA 3BL5A 1UJ8A 3EA5A 4XYGA 4B3IA 1XAJA 4Q4JB 4XQ0A 3CJTA 5KX5A 1XZQA 3OU6A 1PT5A 4WDQA 3O8QA 3M9AA 2AMLA 5G3ZA 4J1NA 2WWRA 4EHIA 3SKVA 4P4TA 2GRAA 2XGCA 1J49A 3C4JA 3FPGA 1G16A 1YB1A 2M30A 4JL8A 1K4MA 2ZEJA 1ETOA 2TECE 2EZIA 3KKQA 4MARA 4F9EA 2DHDA 2DPDA 4K9MA 4KDRA 3WNQA 1JAHA 3RKQA 1JIXA 4JASB 4L9RA 5AI8A 2LZ0A 4AN4A 1JHRA 1PGJA 1AUXA 3IR5A 1NC3A 2YRXA 1FIUA 2WDZA 1FJHA 3C1AA 2VA9A 1JUSA 4A3KJ 2HMTA 2IGNA 4GWKA 1E7WA 5E9JA 3S0JA 1PR9A 5DKFA 4EFNA 3MGGA 1GEEA 4PHHA 5CXXA 4XPIA 5B1YA 4GKJB 3P27A 1C9YA 3WKDA 3SM3A 1LPPA 2BD0A 1BD4A 4KPEC 2OK8A 1I2CA 3KPYA 1ESNA 2G0EA 3BXXA 3FUVA 1A1VA 5LNK1 4D81A 2PG4A 4EMUA 3ZOKA 4ZT2A 3TCXB 1ZWKA 2PSFA 1IAWA 1IU9A 5LQNA 1QKKA 1UMBA 5EE1A 5IWCA 4K6KA 2BAGA 5DN9A 4LKRA 2BY1A 2Z5GA 3WLAA 1Z6QA 4N8DA 3VU9A 3DOJA 4L8LA 3ZN2A 2JFHA 4F46A 2P3LA 3N5CA 4ND5A 2JVJA 3RAPR 2ZI7A 1F0PA 4FIZA 1UK8A 3HTUA 4IHKA 4MJ3A 5ILUA 2ZJPF 2F3TA 3H5LA 3D3JA 1N9KA 1SZPA 3KJEA 1CY6A 5THXA 4DR5B 2QRZA 3QW4B 3WNDA 4A2UA 3PGVA 3K8QA 4JELA 1RAIA 5EKUA 1S2IA 3WDKA 5HDKA 1NUSA 1NW4A 2XZLA 4IX1A 1U1GA 1UBCA 3G88A 4BYYA 1IRZA