2ACJA

Crystal structure of the b/z junction containing dna bound to z-dna binding proteins
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
53
Chain Sequence
HMEQRILKFTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a junction between B-DNA and Z-DNA reveals two extruded bases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords 5'-D(*GP*TP*CP*GP*CP*GP*CP*GP*CP*CP*AP*TP*AP*AP*AP*CP*C)-3'
total genus 11
structure length 53
sequence length 62
chains with identical sequence B, C, D
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2acjA00
2Q8KA 1O3SA 1LDJA 2KIMA 1S7OA 3I0TA 3FM3A 3KE2A 5FO5A 2HGCA 1REPC 1D8JA 2IT0A 3JAMZ 3R0AA 1CF7A 2KJBA 3E5XA 4KMFA 1HW1A 5CVRA 3HRSA 4OU0A 2ZMEA 2V9VA 4P9UA 3HHHA 5FLXZ 3WODF 1CGPA 1ZLKA 3RKWA 1EV7A 1G3TA 4A6EA 2HYFA 1O7FA 3R60A 1R00A 3JTGA 1ODDA 2MH2A 4OIPF 3BWGA 2CW0F 4EJVA 4G6QA 4HLXA 3EYIA 1IRGA 3V8JA 4ENJA 4RB2C 1L3LA 3QU3A 2VOPA 1UCRA 4UXNA 5LEJA 2GWRA 1BIBA 2FQ3A 2RQPA 3GEZA 4HQEA 1J9IA 3GZ6A 3G3ZA 2FNPA 2COMA 3KP4A 4DNCA 1U5TB 2QBYA 1FBUA 2XUBA 1LEAA 5LEKA 3CO6C 2WWYA 3Q5FA 5FD6A 1QZYA 3QP5A 4U0WA 3HYIA 2A5YB 5KVRA 2RC4A 1EH8A 1W7PA 2BBYA 2A68F 1RNLA 1XGSA 2MH9A 3RYPA 2ZFWA 4HF1A 1YW9A 4M72A 2TDXA 2FRHA 4HX7A 2WV0A 1MJ9A 4ASNA 2ZKZA 1TW2A 1NHAA 4HDUA 5AONA 3W6KB 2A61A 3MEXA 2ESNA 3KP3A 4A5NA 3TGNA 3K1NA 3F22A 1OR7A 4IF4A 5CLSA 1MDMA 4DQ2A 3F6OA 1HKQA 5EEHA 1P4XA 2DAOA 2FBKA 4LGWA 5JVTA 5FGMA 3FWEA 3JTHA 2DU9A 2DQRA 3QRFF 3GX4X 1FYLA 1GVJA 3L2CA 2FE3A 3WTTC 1BI3A 4I0BA 1FWZA 3Q9SA 2AXLA 1XCVA 3J80K 3TQNA 4WXDA 2PG4A 2H6CA 3BOQA 2Y48A 1YIOA 4R8HA 4BH9A 5IT9Z 2EFQA 3RYRA 3FX3A 2PJPA 4P96A 1U2WA 3T1BA 5E17F 3KEOA 4S05A 4RGUA 5CVJA 2KKOA 5HOOA 3WG9A 1FSEA 2PEXA 2BEOA 2EA2A 4XBFA 3EUHA 3KP6A 5DV5A 3C18A 1P4AA 1BBYA 1ONVA 3DF8A 4UV9A 4M6YA 2Z9OA 1WI9A 1A04A 1FX7A 4EGYA 4EJTA 1KA8A 4L9TA 2OQRA 2MA3A 4XRFA 3MZHA 2PN6A 3ROUA 3RI4A 1J59A 4BHCA 3FMRA 1KYWA 1JE8A 3B73A 1R5HA 1XD7A 5ICFA 3ZMZA 3HHGA 4B8XA 4AWXB 4P5OA 2YR2A 1O57A 2ISZA 4BNCA 2G7UA 1F9NA 1RUNA 1X3UA 4Y15A 4BYYA 5L3GA 5BS6A 2L02A 4HLYA 3TOBA 1TNTA 1XGNA 2A6EF 3FXRA 2UZKA 4ESBA 1YG2A 1Z05A 4ETSA 3GW2A 1R1VA 4QWQA 2OQGA 4KDPA 2IJLA 2O3FA 3AAFA 1H0MA 1LJ9A 3GXOA 5HS9A 5JHUA 2XAJA 3R6SA 2HZTA 3ERED 2UXNA 3KZZA 4ESJA 3QPTA 3HSFA 3CLOA 2PLYA 1JHHA 3C7JA 1OYWA 2PMUA 1R36A 5E1XA 2ETHA 4LK1F 4D0PA 5ERIA 2IA0A 3J80Z 6PAXA 1MDMB 4TV7A 4CHUA 2WTEA 4ZZDA 2CSOA 1I6XA 1S8NA 3DPLC 4UNOA 3HRTA 4M71A 1FLIA 3FZVA 4S04A 1K6OA 3K1PA 3WGHA 2O03A 3FXQA 1J5YA 4KFCA 5F6FA 4N9IA 2QQ9A 1W5TA 1V3FA 3ZP5A 2V1DA 2L01A 1KU2A 4OMYA 1BN5A 5H6QA 4ENNA 1BIAA 3HSRA 3VODA 2JZYA 2VONA 2X4HA 2LSOA 2LNBA 2EFOA 1BM9A 1K78A 4A12A 2A69F 1U3EM 5ILVA 4HX4A 2WC2A 1FSHA 2FU4A 2VN2A 1OPCA 2FXAA 1U5TA 2W84A 4RAZA 2P7VB 3CJNA 3T5XA 3CDHA 3HOTA 2OA4A 2XAHA 2B0LA 4P55A 4GXOA 4F7ZA 3I58A 2FMLA 4KN4X 2DLLA 4GO1A 2GZWA 3LA2A 1GHCA 3I53A 1HSJA 3W6JB 3HRMA 1SAXA 3TDUC 4O3MA 3CUQB 2RN7A 3TO7A 4AIKA 4M9SA 1YYVA 4U0VA 2YU3A 1H9TA 5J6XA 4LB5A 5HDKA 3KCCA 3KEQA 3WTUC 1GXQA 3SZPA 1IN6A 4L0ZB 2HKXA 4L9JA 4YIFA 1ZN2A 4M74A 2F5FA 3Q9VA 4CXFA 2XRNA 3WTVC 5HLIA 2HYGD 1I5ZA 3DEUA 4MQ9F 1G3YA 1J75A 4N0BA 2DT5A 1R58A 2L3DA 1G4DA 1I1GA 2M1BA 3V8LA 3F21A 2J5OA 1WQ2A 3EETA 3L7WA 2HQNA 2NNNA 5K5QA 1H9GA 4Q47A 2GIVA 5DEQA 4LLNA 3GYHX 5DUIA 4HAMA 2QENA 1K78B 1YTYA 1SFUA 1D8KA 3IWZA 2NS0A 5K5OA 2F5CA 3HSEA 3LAJA 1XGMA 3SHFA 3EQLF 1YW8A 4BHPA 2DI3A 5IT9K 1W7PD 3LFKA 4P9FA 3GFJA 3CO7C 3IWFA 3QOPA 3ZMVA 2VC0A 2VBXA 1FBSA 3E3VA 4N9HA 3E5UA 2XAFA 2CQKA 5H6RA 3GFMA 3V7RA 3H92A 2Y75A 2P7CB 3E5QA 3HTSB 2M45A 1LDKB 1R1UA 4LJZF 1P92A 4HX8A 4HDVA 1ZARA 4I2OA 1ZAOA 1T38A 2V6CA 4MEYF 2VOOA 2V1UA 1S29A 4HF0A 4LLGF 1FYKA 2HDCA 5IT3A 3WTZA 4AIJA 2KJCA 2QQBA 4U7BA 3BJOA 4QLCU 4G6DA 1I1SA 2E7XA 5H20A 1XB4A 4WX9A 4KN7X 2Z99A 4IPAA 4IJAA 3RJPA 1XSDA 2VC1A 2QVOA 2XHKA 4A2UA 4WXCA 2CO5A 3N97A 3MZYA 2ELHA 1WWXA 2IPQX 3P7NA 1W4MA 3F6VA 3GVAA 3ABUA 3O2PE 4Z2YA 5ED4A 3P9KA 4MGRA 4EQQA 1UFMA 3GLXA 5D5XB 5D8KB 3FXUA 3M8FA 4PCQA 3KP5A 2HQRA 2KIFA 2BYVE 4HA8A 4KYWA 4JQFA 3NRVA 1XDSA 2NYXA 2J5PA 2RDPA 2JTVA 2Z3YA 3LA3A 1ZH5A 4OOIA 5HDNA 4FX4A 3VOEA 4HF2A 3CUQC 2EWNA 1R5GA 1QZZA 3RTRA 4G7HF 2FMYA 4PGHA 4RGSA 4OIOF 4EMSA 4EM2A 3F8CA 3LQRA 1JGSA 2DK8A 1ZRCA 3T8RA 2BV6A 4L9VA 2JRTA 3L09A 2K4JA 4CDGA 3HOSA 2VXZA 5FFZA 1RZ4A 3BP8A 5J8CA 2A07F 3PFIA 4RGRA 1STZA 2AS5F 2PMHA 4LLLA 4AVPA 2W25A 2K4BA 5CJ9A 3BZ6A 2PBIA 3M7GA 3LAPA 3IRQA 2R7FA 4IXAA 2VE9A 5D6EA 1L0OC 3IL2A 1YS6A 2R3SA 1ZGAA 1XCBA 5BPDA 1D3YA 2E1CA 1P2FA 2V79A 4I98B 4ZYEA 3O6BB 4L9NA 3V8KA 1HKTA 5HVQC 4BHBA 1E2XA 5L3DA 1O3QA 1DUXC 2QLZA 2K86A 2CFXA 4RS8A 1LB2A 2K7LA 4PGGA 4Q48A 1DDNA 4HBLA 4YFXF 3TOAA 2W57A 3JSOA 2H94A 2CG4A 2QYOA 4I02A 4Y13A 1P6RA 2EFPA 2MD5A 4XSZF 2JSCA 1IZ1A 2P6SA 3C3WA 3QAHA 4WF2A 2FOKA 4UVBA 4ENKA 4IRIA 2EFWA 1GXPA 2BE5F 1PP7U 4K2EA 3HIFA 2M30A 4EM1A 2ZJ2A 2O61A 1AWCA 2HEOA 3DFGA 1FPQA 5K1YA 5DCMB 3KP7A 3HTUA 1SFXA 5E1WA 3L9FA 4CICA 4BXUA 1B1BA 4ZYHA 4MTEA 4Q5SF 1KU3A 2FEZA 3JAMK 2IP2A 5LGNA 1BJAA 4A0YA 5JR3A 1R22A 1XMKA 5L3FA 1HW5A 3TKYA 2IVMA 3F8FA 1QBJA 2GXBA 1ZRFA 2PFBA 4EJUA 1ZHFA 2RVCA 4FHTA 2FA5A 2ZMEB 4R79A 4CO8A 5A2QZ 1F1ZA 2EA4A 5FB2A 4AIHA 3QPHA 5HLHA 3NEUA 2M87A 2D1VA 4M73A 5LGTA 4FT8A 5CVIA 1WRJA 2ACJA 1IXCA 2NNYA 1WSUA 2FBHA 5FD5A 3J81K 1TBXA 3GUDA 4IRHA 4Y17A 4ZH4F 2YSRA 2EV6A 1U78A 4AD9A 1HW2A 1SD6A 3QP6A 4ZZLA 2R7DA 3GF2A 3MWMA 5J8FA 1BI2A 3GZ5A 5E20A 2JPBA 2D1HA 2PQ8A 3IKVA 4UUVA 4EJWA 1JXSA 4OMZA 2XKPA 2H09A 2ZCWA 3OV8A 4L5IA 1IN5A 1B9NA 2RNJA 3F23A 1YLFA 3V4GA 1B59A 1HKSA 4KIGA 2W24A 5FFXA 1HXDA 2QQAA 5HDGA 1FNNA 5DCMA 3ML6A 4WCGA 1TQIA 2DBBA 1SD7A 3ZPLA 2MLKA 2L4MA 2VBWA 2P4WA 3KZYA 4G8XA 2QZ8A 3ZMDA 1O3RA 3BJ6A 1IXSB 1IAWA 3BPVA 2CWEA 2OZUA 4G94A 3OOPA 3J81Z 1YQAA 3I59A 3H3UA 3I4PA 2GQQA 2MBFA 3ABTA 2IW5A 2XIGA 2OU2A 1QPMA 2HFHA 1U5TC 1ZG3A 5E18F 4MNUA 3EYYA 1S6LA 3RIRA 2HTSA 1J2XA 4U7DA 1O7LA 2PI0A 1PUEE 4I09A 5HS7A 5ICCA 4R1HA 2E7WA 2XROA 5D6FA 1HSTA 2QM3A 2CYYA 2VT2A 2JPCA 5ICGA 3FF5A 4KICA 1T39A 3TO9A 5DUKA 5L3CA 2HTJA 3E6DA 3CUQA 3K9TA 3K0LA 1EH7A 1USSA 2DFIA 3IRRA 3GFIA 4L18B 3RPUA 4L5JA 4UHTA 4L0YB 2ZNZA 1P4WA 2STWA 4A0ZA 3F8MA 3M8EA 3JSPA 2O6GE 5BQTA 1DPRA 3LSTA 1Y0UA 2W85A 2LKPA 2FNAA 2A6HF 4NHJA 4XLNF 2DO7A 5TRDA 4G7OF 3P9IA 1RIOH 1BI0A 2GA1A 2XAQA 2ZBKA 1RUOA 1Z6TA 4GYGA 1KYZA 3CUOA 3DXJF 3DP7A 3RDIA 1B9MA 2P6TA 5LHHA 1FT9A 1AOYA 1IN8A 1C0WA 1KQ0A 1USTA 4RB0A 4WWCA 5D5UB 2O8XA 2F5EA 4IHSA 4XSXF 4FX0A 1FYMA 3FMSA 4M9XA 3LWFA 4H0EA 3BPXA 4YFNF 5E8GA 4UVAA 2M8EA 1KGSA 2LF7A 5L3EA 3T8TA 4LG0B 3MFKA 1Z7UA 3B02A 2LF8A 1ZRDA 2K02A 2VODA 2K27A 4YIIA 2MLGA 5D8LB 2RKHA 2XKOA 1QGPA 3R4KA 4HOBA 1UHMA 3ZN1A 3WTSC 4LG0A 1JHFA 5ICEA 3ZN0A 1MKMA 5K5RA 5ILUA 4EVIA 3ECOA 3H3ZA 3E97A 1IXRC 4LFUA 4ZYGA 1E17A 3M1EA 2NRAC 1J7KA 3BROA 1T0FA 3MCZA 4HYEA 4XLPF 1YFHA 3VEPA 5FLXK 3PQKA 1WKMA 1R23A 3K1MA 1FZPB 3TO6A 4UVCA 5E8IA 1F4KA 1MJAA 3WE2A 2VBYA 3REOA 2STTA 5LRRA 2YX4A 2VE8A 1BI1A 1YO5C 2ZO4A 3G73A 4A6DA 1FP2A 3PQJA 1ON2A 1HQCA 4MEXF 2D45A 3F3XA 1BC7C 2F2EA 4OIQF 3DQVC 3SXYA 5DD8A 2ZXJA 1MJBA 4EJOA 5HS8A 4LD5A 2HOEA 1LEBA 1IRFA 2KIUA 3RPQA 5BOXA 1G3SA 4M6XA 3WTXC 1ZREA 5DDGA 1UHWA 3ISPA 3ULQB 2C6YA 2XV4S 1XSXA 4EM0B 3COAC 1V4RA 2ESHA 4O6JA 1Z6RA 3IHUA 3ZMTA 2DQLA 1ZYRF 3E6BA 3MQ0A 1MD0A 4NQWA 4IRGA 3V7CA 5BMZA 1Z1DA 3JW4A 1XMAA 3N4MA 2IA2A 3I71A 1LDDA 2H6BA 2G7HA 3K2ZA 4A5MA 1OYYA 3I64A 3BJAA 1ON1A 1TQMA 4LK0F 4RGXA 1FBQA 1IN4A 3WGGA 4ENMA 1D5VA 2E1NA 1PP8F 1OYIA 3S2WA 5LBQA 2RV8A 5A2QK 2IA1A 1DPUA 2MC3A 3KP2A 1I27A 4GGGA 1W5SA 4GYIA 2L54A 2ISYA 2DTRA 1Z91A 4G7ZF 1BOAA 3KLOA 4RB1A 2EV0A 1ZG5A 3R0JA 1RI7A 1U6GA 2O0YA 3SQNA 2OBPA 2XVCA 1VTNC 3U2RA 3RKXA 1K79A 1ZGJA 3LA7A 3IKTA 1KQ8A 5CYVA 2QBYB 2EV5A 3C1DA 5CVVA 3VB2A 2P5KA 1Z9CA 2P5VA 2DW4A 4BQAA 3E6MA 1TNSA 2GXGA 3K69A 4KMUX 2FBIA 2JT1A 2QUFA 3ZMUA 2Z5UA 4KIFA 2KRFA 4IVNA 3FM5A 3WU1B 2XGXA 2UWMA 4MHGA 2ZNYA 1IW7F 1XN7A 1SD5A 1XDUA 5AIQA 4OIRF 1FOKA 2NAZA 1BC8C 1IN7A 5D5VB 5BPIA 2CGPA 4Q4ZF 4KNYA 5HLGA 3MAJA 4WXHA 5LHIA 2DK5A 4KT5C 2GAUA 1S3JA 3FMQA 5LGUA 1J0RA 5LLQA 4HQMA 1OKRA 1F5TA 3ECHA 4ON0A 4A0XA 3WTWC 2FSWA 1PDNC 2P8TA 5JFRA 1HBXG 3ZMSA 2EJRA 2YPRA 4BAYA 3I54A 4KUMA 4LB6B 3R61A 1QO0D 2BGCA 1T98A 3J7AO 2VBZA 4KA4A 3U1DA 4JK1X 1G3WA 2GA2A 1TW3A 4MTDA 1B4AA 3CTAA 2HS5A 1SD4A 3I5UA 5F64A 3SZTA 1R1TA 3SFZA 3ELKA 3V7SA 4OINF 3VFZA 1TLHB 3DV8A 3WTYC 1G6NA 1FP1D 5D4SA 1K7AA 3KLNA 2HWVA 5F1RA 4PDKA 1KU7A 2LDUA 4ZYDA 3HRUA 4HZFA 1U8RA 1QNTA 3WU0A 2IRFG 2V1XA 4I0AA 4HV5A 3HUGA 3BDDA 2DPDA 1KU9A 2EB7A 3FHZA 4B09A 3GWZA 5D5WB 4YG2F 1ZG1A 5AIPA 2XAGA 2EFNA 1S7AA 1UB9A 3GO5A 2M5WA 2VT3A 2XASA 4LMYA 3NQOA 2OZ6A 4KIBA 1O3TA 1LVAA 2X0LA 2D2WA 2EK5A 4I01A 2G9WA 2HKOA 4I7HA 5LRSA 4GCVA 4O5VA 1TQPA 1CF7B 3D0SA 3E6CC 3WGIA 1XGOA 2OD5A 3F8NA 5KK1A 1FC3A 4RAYA 1FY7A 1SFEA 1T6SA 4E70A 2QWWA 3P9CA 5TJJA 2YX7A 4ESFA 2F5DA 4EV0A 2Z33A 4YFKF 4CYDA 1SMTA 5CVUA 4U0YA 1ZLJA 3L00A 3BY6A 3KFWX 4EGZA 3WE3A 4UV8A 2Q2EA 3D5LA 5ILSA 1YS7A 3M9AA 1MGTA 5EEGA 4G9YA 1MZBA 5E1ZB 3T0YA 1EH6A 3GFLA 5D4RA 3F72A 1OMIA 5L3BA 4HW0A 4IHTA 5DCFA 2DPUA 2HR3A 3LQQA 1XSVA 4HV6A 1DP7P 1Q1HA 3O3KA 1IUYA 2Y0MA 1LNWA 3ZQ7A 5JI6A 4PZJA 2Q0OA 1LQ1A 3QU6A 1IF1A 4U88A 4CGZA 2OAZA 4RB3C 4M9ZA 4MQVA 2UXXA 3DKWA 1YW7A 4NB5A 1SMYF 3RKYA 5DD4A 3TDZC 3U9GA 5DYMA 1QQIA 5LHGA 1T2KA 1KQ9A 3I59B 3IC7A 3EDPA 1R7JA 2ADUA 2L4AA 3F8BA 2P5LC 1B6AA 1TTYA 4JBAA 4CZZA 4WK8F 2H27A 2FF4A 3DPTA 1W7PB 3KETA 2A3SA 1ULYA 2RGVA
chains in the Genus database with same CATH superfamily
3OYFA 2Q8KA 1O3SA 3G2BA 1LDJA 5DS9A 2KIMA 1GDTA 1V5FA 1S7OA 1TT0A 3I0TA 2HVQA 3FM3A 3KE2A 1SFKA 2HGCA 5CQEA 5FO5A 3F9KA 1REPC 1D8JA 2IT0A 1WH5A 3JAMZ 2NVQJ 3KYLA 3R0AA 1CF7A 2KJBA 4AYBA 2FOWA 3E5XA 4KMFA 2X6YA 1HW1A 4ZDOA 1BR4A 2VXDA 5CVRA 3HRSA 4HNTA 3VDXA 5IYBJ 3MKZA 2HQ5A 4OU0A 1JKRC 2ZMEA 4Y52J 3FBIB 2V9VA 4P9UA 5IYDJ 5C3EJ 3HHHA 1BW6A 4B4CA 5FLXZ 3WODF 1CGPA 3HB9A 1ZLKA 3RKWA 3DLLF 1EV7A 1G3TA 2WAQA 4A6EA 2HYFA 1O7FA 3R60A 1R00A 3A2KA 2FD5A 3JTGA 1ODDA 1YJ9I 2MH2A 1VI0A 4XR6A 4OIPF 3BWGA 2CW0F 4XONA 1TZLA 4EJVA 4BU2A 3I56I 2DFHA 4G6QA 4HLXA 1IJWC 1LFPA 3EYIA 1IRGA 3V8JA 4ENJA 4RB2C 1L3LA 3QU3A 2VOPA 1UCRA 3OIQA 2OV7A 3W6VA 4UXNA 1X1BA 3GLLA 5LEJA 4YEJA 2GWRA 5M5XJ 4E7JA 1BIBA 2FQ3A 2RQPA 1MBFA 1WJBA 3GEZA 1E0EA 4HQEA 1J9IA 5FKLA 3GZ6A 2EINH 3G3ZA 3CCSI 2FNPA 2COMA 3KP4A 4DNCA 2E5ZA 1U5TB 2BY2A 1R49A 4BXFA 2QBYA 1FBUA 2VJ5A 2XUBA 3E7LA 1LEAA 5LEKA 1R5ID 3QYBA 3CC7I 3CO6C 1XX5A 5IOYA 2WWYA 3Q5FA 5FD6A 1QZYA 1X4PA 2VQLA 3Q0VA 2X6WA 3KIOA 1HA8A 4II2A 3QP5A 4U0WA 3JREA 1WVRA 4KISA 2YS9A 3HYIA 2B9SA 2A5YB 5KVRA 2RC4A 1YITI 4W97A 1EH8A 1W7PA 1HDPA 1RC9A 1UZCA 1XGSA 1RNLA 2A68F 2BBYA 2MH9A 4IX7A 3RYPA 3MKYB 2ZFWA 4HF1A 4C3IJ 2ZB9A 3K4NA 3KEYA 1YW9A 4M72A 2TDXA 4ANJA 2OUMA 1TWAJ 1ZELA 2CU7A 1YRNA 1RETA 2FRHA 3PIPF 3PM1A 4YELA 3FHNA 2QSHX 3BG9A 2CUJA 4HX7A 4EATA 2DA5A 1F43A 2WV0A 4A3JJ 1OJLA 1MJ9A 3OSGA 4ASNA 2ZKZA 1TW2A 1NHAA 2BXZA 3RKQA 4RBOA 1Z77A 4HDUA 3RQ4A 4M3GA 5AONA 3W6KB 2A61A 3MEXA 2ESNA 3KP3A 2KZVA 3WHCA 5GAGJ 3A01B 4CSWA 1R71A 1NK2P 4A5NA 2BVLA 3GTKJ 1AKHA 2ZJPF 3TGNA 3K1NA 3F22A 1ZTRA 3CLQA 1OR7A 4IF4A 4ZDPA 5CLSA 1MDMA 4DQ2A 2XF6A 3F6OA 1M1EB 1HKQA 5EEHA 1P4XA 3ABKH 3RZOJ 2HOSA 2DAOA 4NQWB 3Q3SA 1GUUA 1X1CA 2Z16A 2VKHA 3BTCA 2FBKA 4NUBA 4LGWA 2BVMA 5K7ZA 5JVTA 2LLKA 5FGMA 3FWEA 4F55A 3JTHA 1Y1WJ 2D5VA 2DU9A 5GADJ 2DQRA 1PUFB 3QRFF 3GX4X 1FYLA 2WB1N 4IOCF 4IO9F 1GVJA 3L2CA 4BGDA 2FE3A 1VZ0A 2DOEA 3WTTC 5B1AH 1LFBA 1BI3A 4I0BA 2IS4A 2IXSA 2KT0A 5K7HA 3OYJA 1FWZA 2KPMA 3Q9SA 4JYKA 1N75A 1MW7A 2AXLA 1XCVA 1RPWA 3J80K 1LPQA 3LSMA 1BR2A 3TQNA 4ZTFA 2L9NA 2LOOA 3F0CA 1TP4A 4WXDA 4D5CA 3BG6A 2PG4A 2H6CA 1BA5A 4A3DJ 3BOQA 2Y48A 3JRBA 3PO3J 1YIOA 4R8HA 4BH9A 3MMYB 3CCVI 5HNFA 2E1MB 2EFQA 5IT9Z 3RYRA 4BXXJ 3FX3A 4XLFA 1VNDA 2I10A 2PJPA 5KAFC 4P96A 1U2WA 1FMWA 3FDYA 2HDWA 2LREA 3T1BA 3KEOA 4E4HA 3CC4I 5E17F 1FIPA 1ORKA 4S05A 4RGUA 5CVJA 3SDBA 4A3EJ 2KKOA 5HOOA 3WG9A 2VJIA 3OYEA 1FSEA 3NARA 2PEXA 1ENHA 2BEOA 4MFEA 1G8XA 1LE8B 2EA2A 4XBFA 4E7SA 3EUHA 3FXOA 3KP6A 5DV5A 2QA4I 3C18A 4IHVA 3BG5A 2R4GA 2CQNA 3LMMA 2MYSA 1P4AA 1BBYA 1Z0XA 1D0XA 1FEXA 1ONVA 3DF8A 2DN0A 1YI2I 2DOAA 3ONQA 4UV9A 4M6YA 2Z9OA 1WI9A 1R4NB 1A04A 1FX7A 2CV1A 4EGYA 1MMNA 1KA8A 1VF9A 4EJTA 4L9TA 2WB1A 2OQRA 4BL0B 3DBLB 1S72I 2MA3A 4XRFA 2K9LA 3C2HA 3BCAA 2F48A 1A6IA 2WY8Q 3MZHA 2PN6A 1X2NA 3S1RJ 1X2MA 3ROUA 3RI4A 2DYSH 1J59A 2Q2EB 2F4OB 3UR3C 5BNGA 4BS9A 5J1YA 1VFCA 4BHCA 3FMRA 2ID3A 1KYWA 3OWTA 1JE8A 5J40A 2M0MA 3B73A 3G6EI 2H1LA 3GBGA 1R5HA 2KDZA 1XD7A 5ICFA 4KJZA 3ZMZA 4BBRJ 3HHGA 4M3FA 4B8XA 1Y8QB 4AWXB 3HBLA 3J7YJ 4P5OA 4XL9A 4G12A 2YR2A 2JVGA 1U9NA 2CQ7A 1O57A 3VYUB 1TC3C 3HM5A 2ISZA 5GAHJ 1WJAA 4BNCA 3S3OA 4D9JA 3SEZA 2G7UA 1F9NA 1RUNA 1X3UA 4DYCA 2QCOA 1D1CA 1QZEA 4Y15A 4BYYA 5L3GA 5BS6A 3A03A 2L02A 4HLYA 1A31A 4IHYA 1FOWA 2WADA 3HOXJ 3LSPA 3J7ZI 1EA3A 2VJJA 1A36A 3TOBA 4XMYA 4CCNA 3PUFA 4IHWA 4YRVA 1TNTA 1XGNA 2A6EF 4BE2A 2VASA 3OMYA 2M7BA 3FXRA 1APLC 2UZKA 4ESBA 1YG2A 1Z05A 2MABA 4ETSA 3GW2A 1R1VA 4QWQA 2ELKA 2OQGA 2QF7A 4BUPA 1EJ9A 5GPAA 4KDPA 4BKXA 2IJLA 3DTKA 4A3IJ 2O3FA 3AAFA 4B48A 1H0MA 3VWBA 1LJ9A 3GXOA 5HS9A 3DEWA 5JHUA 2NXNB 2XAJA 2Z1DA 4XK4A 3R6SA 3SJMA 1Y0NA 1K6YA 2HZTA 3ERED 1NK3P 2DA1A 2UXNA 3KZZA 2VIXA 4ESJA 5EZGA 3QPTA 3HSFA 1U0JA 3CLOA 2PLYA 4RLQA 1R6RA 1WZ2A 3HPGA 2F4MB 1JHHA 3C7JA 1OYWA 2PMUA 1HC8A 2DODA 2L9VA 3BLYA 4F93B 2WAQN 1R36A 2FJ1A 1GLNA 5E1XA 2MG4A 2W00A 4YIRX 2ETHA 4LK1F 1POGA 2XSJC 3EUHC 5ERIA 4D0PA 4M3DA 2IA0A 5KCMA 5C4JJ 3J80Z 3IAS2 3CCMI 6PAXA 4I99C 1MDMB 2DFFA 4HG2A 1H89C 1FIAA 2NOJB 4TV7A 3K2AA 4CHUA 2WTEA 3CP8A 2CUEA 4B47A 4DW6A 2LD5A 1JKOC 1YJNI 3EUAA 5FJ8J 4ZZDA 2CSOA 1I6XA 2EZIA 1S8NA 3DPLC 2F4IA 5FROA 1LUJB 3HRTA 4XLHA 4UNOA 4M71A 3M07A 1G59A 5TGTA 2K3FA 5EGOB 1FLIA 3FZVA 4S04A 1K6OA 3A01A 1W36D 3K1PA 2V6EA 1YE9A 3WGHA 2GM4A 2O03A 2QSGX 1Y8RB 3FXQA 1J5YA 3CCEI 4KFCA 2ECCA 2M4KA 4N9IA 5F6FA 2QQ9A 1V5GA 2HPMA 2TRTA 1W5TA 1ZR2A 4AUXA 1V3FA 3ZP5A 1JJ8C 1DU6A 2V1DA 2L01A 1KU2A 2CW8A 2BZTA 4OMYA 1BN5A 5H6QA 3TP0A 1MMGA 5K7FA 1BW5A 4ENNA 1BIAA 3HSRA 1SVMA 3VODA 2JZYA 2VONA 2R7QA 2LSOA 2X4HA 3CD6I 1RKTA 2ZXWH 1RR7A 4NNJA 2LNBA 2EFOA 1BM9A 3OS0A 2OTLI 1K78A 1V54H 3RCOA 2HYJA 4A12A 2A69F 1U3EM 1E3HA 3OS1A 5ILVA 3BQZA 3H5AA 2WC2A 4HX4A 1FSHA 4X1EA 3ZQIA 1RESA 2FU4A 2VN2A 1YIJI 3E1SA 1OPCA 2FXAA 1U5TA 1AHDP 2Y0SA 4IOAF 2W84A 4RAZA 1VQLI 3LSIA 1JTXA 2P7VB 3CJNA 1OFCX 3S32A 1QA6A 3T5XA 2XPWA 3CDHA 3HOTA 2H8RA 1F36A 2VUMJ 2RREA 2OA4A 2XAHA 4IHXA 4A3GJ 2B0LA 3FIWA 4P55A 4GXOA 4F7ZA 3I58A 2XPVA 2JN6A 3PL8A 4OAYA 2FMLA 4RM2A 1SVLA 3TW6A 2DA4A 3S2DJ 4KN4X 2DLLA 1UAAA 3DU6A 2GZWA 3LA2A 4GO1A 3GTJJ 3I53A 1GHCA 1HSJA 4BQOA 3W6JB 2X48A 3HRMA 1SAXA 2V26A 3TDUC 1MBJA 1X1DA 4O3MA 1B8IB 3CUQB 2RN7A 1WHUA 3JRCA 3O8HA 3TO7A 4X0GA 4E6KG 4M9SA 1YYVA 4AIKA 3OYHA 4U0VA 2YU3A 3MZ8A 1H9TA 5J6XA 4LB5A 2NVUB 4XICA 1DP3A 5HDKA 3KCCA 3KEQA 3WTUC 1GXQA 3SZPA 4DYQA 1IN6A 3GZNB 5DM6F 4L0ZB 1A35A 2HKXA 3RSNA 3V42A 2E2IJ 4L9JA 4YIFA 2EZHA 4XN3A 1ZN2A 4M74A 2F5FA 3NWSA 3AFHA 3Q9VA 3FKJA 4V19K 4CXFA 1FOXA 2XRNA 3WTVC 5HLIA 2HYGD 1I5ZA 5IP6A 3BZCA 1IDZA 3QOEA 3DEUA 3GTPJ 2IS6A 4MQ9F 1G3YA 3WG7H 4ZC3A 1Q1VA 4N4OB 1J75A 4N0BA 1Z21A 4IQJA 2ZXIA 3OL3A 2DT5A 1R58A 4XKWA 2L3DA 3ZQQA 1G4DA 1I1GA 2M1BA 2Z2SB 3V8LA 3F21A 1FJLA 4B3XA 2J5OA 1WQ2A 3CCUI 1G2HA 3KPHA 3EETA 1YX3A 5JLWA 3CQZJ 3L7WA 2HQNA 3AG4H 1D0ZA 2R7SA 4F91B 4Z6YA 4HNVA 1TWCJ 2NNNA 5K5QA 2HDDA 4C2TA 2R5YA 1MH4A 1H9GA 4Q47A 1P9QC 2GIVA 2HPIA 5DEQA 3VSLA 3A1YA 4LLNA 3GYHX 1EKEA 5DUIA 4A3CJ 3CDIA 2JK3A 4HAMA 2QENA 1K78B 5JHFA 1WPKA 1Z67A 2KQRA 1JT0A 4PJ0C 1YTYA 2A5WA 1SFUA 2KRCA 2LR8A 2L5QA 1D8KA 3IWZA 2NS0A 5K5OA 2F5CA 3S3NA 3HSEA 3LAJA 1XGMA 3SHFA 3EQLF 1YW8A 1I3AA 4BHPA 2DI3A 5IT9K 2FX0A 1W7PD 2V9PA 3LFKA 2VB6A 4P9FA 3GFJA 1QVUA 1WJ5A 3CO7C 2R93J 3TMOA 3K7AJ 2DDBA 3IWFA 3QOPA 3ZQFA 3ZMVA 2O9LA 1QHGA 2VC0A 4DYRA 2DMPA 2VBXA 4QIWN 5M3MJ 2VPRA 4UB6C 1O4XA 1NG7A 1FBSA 3E3VA 4N9HA 3E5UA 4C3HJ 2XAFA 2CQKA 2WA0A 1NG6A 3K70D 5H6RA 3GFMA 3V7RA 3H92A 3D5SC 2Y75A 3DWLE 2P7CB 3E5QA 3HTSB 4PFPA 2M45A 1ZGWA 3RPUD 2W48A 3JCUC 4OWRB 1LDKB 1TWHJ 2H8WA 4U87A 2Y31A 1R1UA 3D5RC 4LJZF 1P92A 4D7NA 2VQCA 4FETA 2ZJRF 5IY5H 4HX8A 3KYCB 4HDVA 1HDDC 1ZARA 4I2OA 1ZAOA 2M3AA 2X6OA 2HOTA 1T56A 1SEUA 1FMVA 1T38A 2V6CA 2XAUA 4MEYF 1SVOA 1KONA 1WJDA 3OYAA 2VOOA 2V1UA 1S29A 4HF0A 1HLVA 4PK4A 4LLGF 1SFOJ 5CQGA 1Y1VJ 1FYKA 3K4KA 3W3CA 3ERMA 5IT3A 2HDCA 3TP3A 3G1OA 3WTZA 4AIJA 2KJCA 2QQBA 2E1OA 4U7BA 3BZKA 2CJJA 3BJOA 2Y30A 4HNUA 4QLCU 4G6DA 2E1MC 4MLOA 1I1SA 1JGGA 2E7XA 5H20A 1XB4A 4WX9A 2L9RA 4FCYA 4KN7X 4BQQA 2Z99A 4IPAA 4IJAA 3RJPA 1XSDA 2E2HJ 1KZHA 2VC1A 3L2WA 5IP7J 4XM3A 4BEHA 1I6HJ 2QVOA 2XHKA 4A2UA 4PJLA 4WXCA 2CO5A 3N97A 3QPLA 3H35A 3BR2A 3CDLA 3MZYA 2ELHA 1WWXA 3M4OJ 5FKNA 2IPQX 2IGOA 3P7NA 1W4MA 3F6VA 3GVAA 3ABUA 2CRGA 3N05A 3O2PE 4Z2YA 5ED4A 3PSIA 3P9KA 2DFEA 1QRYA 2HI3A 4MGRA 4EQQA 2WBMA 1UFMA 3CF2A 3GLXA 4KITB 3RZDJ 5D5XB 3ABMH 5D8KB 2LRDA 3FXUA 3A0HC 3L1PA 3SZGA 3AG2H 3X2QH 1UJ8A 3M8FA 2CUZA 4PCQA 2DXIA 3G1MA 2OF7A 3KP5A 1MBKA 3HOVJ 2HQRA 1VQPI 3LSKA 5KNLA 2KIFA 2E60A 3W2WA 4J01A 1DQUA 2BYVE 1XMXA 4HA8A 4KYWA 2JA8J 3DCFA 4RAFA 4JQFA 2X1EA 3NRVA 3OIOA 1XDSA 2NYXA 2J5PA 2RDPA 4C2MJ 2DTZA 2UV1A 3DLAA 3IH3A 2BY1A 2VQHA 2JTVA 2Z3YA 3U1KA 3LA3A 1ZH5A 4OOIA 3FBNB 5HDNA 4FX4A 3VOEA 1X3ZB 4HF2A 3CUQC 2NOGA 1ETVA 2X85A 1SAUA 1R5GA 2EWNA 1QZZA 3BTJA 3H9QA 5DTDA 3ZGKA 3S1MJ 3RTRA 1P7JA 4G7HF 2K40A 2LTPA 5F1JA 2AQFA 3BR1A 2CFOA 2YUSA 2FMYA 3GTLJ 4PGHA 3CMYA 4RGSA 4OIOF 3K4CA 4EMSA 4XOPA 4EM2A 1PYVA 2EZKA 3F8CA 1LE8A 3LQRA 4EEFG 1MNDA 1VQ6I 5EDNA 1JGSA 3S17J 2DK8A 4NC7A 1YJWI 1ZRCA 1MSFC 3T8RA 2DYRH 2BV6A 2XPUA 3OYKA 1IC8A 2K5CA 3SEQA 4L9VA 2JRTA 3L09A 4UY8I 2CV2A 2XGCA 2K4JA 4CDGA 2DCEA 4BE0A 3HOSA 3SDGA 2VXZA 5FFZA 1RZ4A 9ANTA 1VQ4I 3BP8A 3GMEA 1ETKA 5J8CA 2A07F 3ABLH 1A5JA 3PFIA 4RGRA 4XRMA 1STZA 1LVKA 3LFUA 2AS5F 2PMHA 3I4NJ 4LLLA 1Z7LA 4AVPA 2W25A 4PFOA 2K4BA 4M6VA 5CJ9A 2Q1ZB 3E0JB 5LFAA 2AQEA 3BZ6A 4IQ4A 2PBIA 3M7GA 4E7KA 3LAPA 2IBDA 3IRQA 2R7FA 1HOMA 4IXAA 4XN0A 2VE9A 4QSHA 1R9TJ 3PIOF 5D6EA 1L0OC 2CQXA 5M3FJ 4LG3A 3DBRB 3IL2A 1YS6A 2R3SA 2R0QC 1X58A 1ZGAA 1XCBA 2R7TA 5BPDA 1D3YA 2E1CA 1P2FA 2V79A 3HKZN 1JKQC 4I98B 4ZYEA 3O6BB 4L9NA 3DKYA 3V8KA 1HKTA 5HVQC 2R7UA 3EUKL 1HCRA 4BHBA 2M8GX 1E2XA 4FQGA 5L3DA 1O3QA 1DUXC 2QLZA 1W0UA 3PNVA 2K86A 4CCJA 2CFXA 4RS8A 1LB2A 1GV2A 2K7LA 2QQ8A 4PGGA 3GTQJ 1MBHA 4Q48A 1DDNA 4HBLA 4YFXF 2QKMB 3O8GA 3TOAA 2FQ4A 2W57A 3HGYA 1IV8A 2KZGA 4XLCA 3JSOA 2R5YB 2H94A 1WGXA 2XF7A 2CG4A 2ECBA 5CPRB 3H3VK 2L9SA 1AU7A 2QYOA 4I02A 5J3LA 4Y13A 1P6RA 2EFPA 2MD5A 4XSZF 2JSCA 2RQQA 1IZ1A 3A4CA 2P6SA 2A05A 3C3WA 1JJ6C 3QAHA 2CS3A 2P81A 4WF2A 1W36C 2FOKA 4UVBA 4F3QA 4XNFA 4ZDLA 4B43A 4ENKA 1J09A 4IRIA 2EFWA 2R5ZB 1GXPA 2BE5F 3L2UA 1VQOI 1PP7U 3SFIA 2QEXI 1FTZA 4K2EA 1VQMI 3CESA 1ZK8A 2B7EA 3HIFA 3OR1C 4XKCA 3I4MJ 2M30A 4EM1A 2ZJ2A 1QU3A 2O61A 4UUTA 2Y9YA 1AWCA 2HEOA 3DFGA 3K10A 1PUFA 1FPQA 1Y56A 1NH3A 5K1YA 1UG0A 5DCMB 4E7LA 4I76A 3TW7A 3KP7A 3CCRI 2GOXB 1S5LC 2MGQA 3HTUA 4ZJZA 1SFXA 5E1WA 2XGEA 3L9FA 3HPHA 3TL4X 4CICA 4BJ6C 3AL0C 2VI6A 3FXLA 3DTIA 4BXUA 1U8BA 1ETOA 1B1BA 4ZYHA 4MTEA 4XLAA 2LP0A 4Q5SF 1KU3A 2FEZA 4UB8C 5EZHA 3JAMK 2IP2A 3QYFA 1VQ5I 1IUFA 5LGNA 4E7HA 1BJAA 4A0YA 5M5WJ 5JR3A 1R22A 1XMKA 3TBIA 1HW5A 5L3FA 3AG3H 3TKYA 2EPFA 2IVMA 3F8FA 1QBJA 4L5EA 2IGMA 2FUG2 2GXBA 1ZRFA 2VKDA 2PFBA 3L2VA 3S93A 4EJUA 1ZHFA 1CQTA 2RVCA 1FTTA 4FHTA 4JX6A 1K4SA 2EH3A 2FA5A 2ZMEB 4R79A 5IP9J 1ZKGA 4CO8A 5A2QZ 1F1ZA 2EA4A 3UNGC 5FB2A 4AIHA 3QPHA 2GXAA 5HLHA 3NEUA 2M87A 4HSTA 3GTGJ 2D1VA 3OYDA 4M73A 5LGTA 2LK2A 2COBA 4FT8A 5CVIA 1WRJA 4HRIA 3AKZA 2ACJA 1IXCA 1WJFA 5F0CA 4Y7NJ 2NNYA 1B72A 1WSUA 2FBHA 3CJQB 5FD5A 3JRIA 3J81K 1TBXA 3GUDA 2CMPA 4IRHA 4Y17A 4ZH4F 3NWTA 2YSRA 2EV6A 2TCTA 4HSRA 1SANA 3M8JA 3ZQLA 4PSXA 1SC7A 1U78A 4AD9A 4BACA 1HW2A 1ERDA 1SD6A 2DT6A 2NVXJ 3QP6A 1AA7A 2K9NA 4IKFA 1MMDA 4ZZLA 3CCQI 3U21A 1BR1A 2R7DA 3GF2A 1UMQA 3MWMA 3QWLA 1MMSA 5J8FA 1BI2A 3GZ5A 3IH4A 2JPBA 5E20A 2D1HA 5EF6A 3P5JA 2PQ8A 3IKVA 1VQ7I 5E3LA 4UUVA 4EJWA 3JRHA 3CCJI 1JXSA 3CJRB 2XKPA 4OMZA 2RAEA 4BY7J 2H09A 2ZCWA 3H1CA 3OV8A 4L5IA 4X6AJ 1IN5A 1B9NA 2RNJA 3FXMA 2KIQA 3F23A 1YLFA 3ZQCA 3V4GA 2UUZA 1ZQ3P 1B59A 4XOTA 1HKSA 3KX2A 4KIGA 3G4SI 1OCZH 2W24A 5FFXA 4XRSG 2E2JJ 2KLOA 3Q0WA 4XKVA 4BY1J 1EF4A 2M2EA 2VKVA 3BTIA 2K9QA 1HXDA 2QQAA 5HDGA 1FNNA 1OCRH 5DCMA 3ML6A 4WCGA 1TQIA 2DBBA 1SD7A 3ZPLA 3IUOA 2X6XA 5FKKA 2MLKA 2CQQA 2L4MA 2HNHA 1ZR4A 2VBWA 2R7XA 2JQ7A 3HOUJ 2LKSA 2P4WA 3KZYA 3MD2A 4DJAA 4G8XA 5F0HA 3MKWB 3HL2A 2QZ8A 3ZMDA 1O3RA 3BJ6A 2DDAA 1IXSB 2CW7A 4QPOA 3BC8A 4DIQA 5C4XJ 1IAWA 2GOMA 1MBEA 5IOZA 3BPVA 2CWEA 4P1WA 1MH3A 2OZUA 3CCYA 4G94A 3OOPA 3J81Z 1YQAA 3I59A 2IGKA 3H3UA 3I4PA 1JTYA 2GQQA 2DA2A 2LKXA 2MBFA 3CJTB 2XGDA 3ABTA 2IW5A 2XIGA 3HOZJ 2OU2A 1QPMA 2HFHA 5GAEJ 1U5TC 3QYEA 1ZG3A 5E18F 1T8IA 4Y3OA 3ZRGA 2JA7J 4MNUA 3EYYA 2KL4A 1S6LA 5J4YA 3HOWJ 5B5EC 3RIRA 1I50J 2HTSA 1J2XA 4U7DA 1O7LA 2AXTC 5JLXA 2PI0A 1PUEE 4I09A 5HS7A 5ICCA 4R1HA 2XC7A 2E7WA 3K70C 4RAGA 2XROA 3TEDA 1YOVB 5D6FA 4NBQA 1HSTA 3I9V2 2ICWG 2QM3A 2CYYA 2VT2A 3LOCA 2JPCA 5ICGA 3FF5A 4KICA 1T39A 3TO9A 5DUKA 3HOYJ 3VYSB 5L3CA 3BR3A 2HTJA 3S16J 2O7OA 3HG9A 3HGGA 1Z3YA 4FE7A 4DBRA 1TWGJ 3E6DA 1IV6A 1VQ9I 3IP4B 3CUQA 3UKGA 2V7FA 2BHYA 3K9TA 3K0LA 2MW8A 1EH7A 4UUSA 2K3PA 5FRNA 1USSA 2DFIA 2R5ZA 3IRRA 2E19A 3GFIA 4L18B 5EG0A 3OL4A 4D7MA 2AHQA 1ETYA 2QKLB 3RPUA 2ZFUA 4L5JA 2E5NA 3OOUA 3GTOJ 1N78A 4JOMA 4UHTA 2L0KA 2HQAA 4L0YB 3GTMJ 3OYIA 1TT5B 5E3OA 2ZNZA 1P4WA 4CCMA 4A0ZA 1X4OA 2BOLA 2NS8A 2STWA 3BR6A 4UUSB 5DM7F 1VQ8I 1BJZA 3F8MA 3M8EA 2DMTA 2MSYA 3JSPA 2LH9A 2X1DA 1IG7A 2O6GE 2VL8A 5BQTA 1E3PA 1XC5A 1DPRA 3LSTA 2EZLA 1JKPC 1Y0UA 4GRIA 4PJNA 4B1RA 3CC2I 1RKWA 1LKXA 2W85A 2LKPA 2FNAA 2ZSHB 3Q0UA 3OYNA 2A6HF 4NHJA 3S15J 2K85A 4XRSA 3H0DA 2HVSA 2L7ZA 4XLNF 3FISA 2DO7A 1K83J 1JUPA 1DGWY 5TRDA 4G7OF 3LSRA 3WHBA 2GIZA 3P9IA 2IAIA 2W4SA 1RIOH 3W2AA 1BI0A 2GA1A 2XAQA 2ZBKA 4AU7A 1HF0A 1RUOA 1WH7A 2M7AA 4JP0A 1MNEA 2LVSA 3JRDA 1Z6TA 3ZR8X 1IO2A 1ETXA 4GYGA 1KYZA 2CUFA 3CUOA 3DXJF 3DP7A 3RDIA 1B9MA 3ZQHA 2P6TA 5LHHA 1FT9A 2HU9A 1N77A 1AOYA 2MFZA 2EIJH 4MFDA 5F0FA 3VYRB 1IN8A 1C0WA 1KQ0A 1USTA 4AC0A 4RB0A 4WWCA 4BDZA 4NC8A 5D5UB 2O8XA 1RR8C 2MC4A 4A3KJ 2JMWA 2F5EA 4IHSA 2GLOA 4DGWB 2HVRA 2EQRA 1YRNB 4XSXF 1JI8A 4FX0A 1FYMA 3FMSA 1H88C 4M9XA 3LWFA 4H0EA 3CCLI 3BPXA 4YFNF 5E8GA 1D5YA 3I55I 2IEKA 1X1PA 2I5UA 4UVAA 1UHSA 2M8EA 4ABZA 4XQFA 4A69C 1KGSA 2LF7A 5L3EA 3T8TA 2KFDA 4LG0B 3MFKA 2OTJI 5F27A 1OCTC 2ZJQF 1Z7UA 2ELJA 3HC7A 5J1RA 5JVGF 2PJRB 4A93J 3B02A 2V4JC 5J1UA 2LF8A 3FK7A 1ZRDA 4FE4A 2K02A 3BG3A 2Y0SN 2VODA 3FKIJ 1D1AA 1ACIA 2P0WA 5IYCJ 3OS2A 5B66C 2K27A 4YIIA 2G0EA 5J4VA 2MLGA 5D8LB 2RKHA 2E34A 4AM3A 2XKOA 1QGPA 2KP6A 3CMEI 3R4KA 4HOBA 1Y39A 1UHMA 3ZN1A 3WTSC 4LG0A 1W5CC 4M3EA 2H1KA 1JHFA 1W1WE 5ICEA 1DU0A 1V5EA 3ZN0A 1MKMA 3DBHB 5K5RA 3CMAI 5ILUA 1IRZA 3K4LA 4EVIA 3ECOA 3H3ZA 2HOAA 2RNGA 2V1NA 3S1QJ 3E97A 4CCOA 1IXRC 4LFUA 5EGOA 4ZYGA 1E17A 3M1EA 1WJEA 3DKXA 2XB0X 4PJMA 2NRAC 2R92J 1J7KA 3BROA 4ZTJA 2AO9A 1T0FA 3K4JA 3MCZA 4HYEA 2HZDA 4XLEA 4XLPF 3FXJA 3OYMA 2M34A 2ME6A 1YFHA 3VEPA 2DA6A 3HJEA 5FLXK 3PQKA 2DOFA 1WKMA 3VSKA 2BY3A 4C30A 5C44J 1R23A 1V55H 3K1MA 1FZPB 4CA0A 3TO6A 2KISA 2R7RA 2VLAA 4UVCA 2XB5A 3HKZA 5E8IA 1F4KA 1MJAA 3LL7A 2JJ7A 3WE2A 3MN2A 2VBYA 5FRMA 3REOA 2XDVA 3H36A 2STTA 1I39A 3L2QA 5LRRA 2YX4A 2VE8A 4C2UA 5E3MA 2DJNA 1BI1A 1YO5C 2LY9A 2NVYJ 2LFBA 3LSHA 2ZO4A 3WU2C 2LY1A 2E35A 2Y9ZA 1IGNA 3OYLA 3IAM2 2JUCA 1OLTA 3G73A 5HNHA 4JX5A 2BW3A 4BEHB 4A6DA 1FP2A 2EBIA 3PQJA 5HODA 1ON2A 1HQCA 4MO7A 2D45A 4MEXF 3F3XA 1BC7C 3PNTA 1OQYA 3S1NJ 2F2EA 4OIQF 3DQVC 3SXYA 1PJRA 5DD8A 2L7KA 1TWFJ 1X19A 5B1BH 2ZXJA 3LSGA 1MJBA 4GFBA 4EJOA 1BOBA 3DTEA 2KMUA 4CYCA 5KAIC 5HS8A 5EJCA 2I8DA 3ZQGA 3K4BA 4LD5A 2WAEA 2HOEA 2XF5A 4BJ5C 1LEBA 2W1OA 3C2GA 1IRFA 2KIUA 3RPQA 5BOXA 2L7FP 4H4KC 1G3SA 4BQNA 4M6XA 3WTXC 3L2RA 1ZREA 3CZ6A 2OJED 5DDGA 1UHWA 3ISPA 4D1QA 3ULQB 2C6YA 3OR2C 2HXOA 2XV4S 1XSXA 4EM0B 3COAC 1V4RA 2ESHA 4O6JA 1Z6RA 3IHUA 4RA2A 3ZMTA 2DQLA 3OIPA 1ZYRF 3E6BA 1B8IA 3MQ0A 1MD0A 4XIDA 2A6TA 1WFXA 2RGVA 4NQWA 4IRGA 2L7MP 4E7ZA 4N4NB 3V7CA 5BMZA 1Z1DA 3JW4A 2VPLA 1XMAA 3N4MA 3FK6A 1D1BA 1X3WB 5EYRA 4BE1A 2IA2A 2IS2A 4JX4A 2CH0A 3I71A 3QODA 4A3LJ 1LDDA 1XTAA 4Y33A 2H6BA 2G7HA 3K2ZA 1YHQI 2PX9A 4A5MA 4DZJA 5J47A 1OYYA 3I64A 4DZPA 3BJAA 1ON1A 1TQMA 3M1CA 4LK0F 3VPRA 2PMZA 2LYCA 4RGXA 2LG4A 1FBQA 2VQGA 1IN4A 3WGGA 4ENMA 5LD2C 4BBSJ 3K6GA 2LC2A 1D5VA 2E1NA 1PP8F 1OYIA 3S2WA 5LBQA 2RV8A 5A2QK 2IA1A 1DPUA 2MC3A 3KP2A 1I27A 2BW3B 1U9OA 4GGGA 1W5SA 4RMNA 4GYIA 2L54A 2ISYA 2DTRA 1Z91A 3BR0A 4G7ZF 1YX5A 1LFUP 1DGRM 1BOAA 3ESWB 3NAUA 2LMDA 3KLOA 4RB1A 2EV0A 1ZG5A 2O5RA 3R0JA 1S7EA 3ZOBA 1RI7A 1U6GA 2O0YA 3SQNA 2OCEA 2OBPA 2XVCA 4CZCA 1VTNC 5M5YJ 2PMZN 3U2RA 1WI3A 3RKXA 1XPXA 4IL6C 2OPTA 3H5NA 3HDDA 3J7AY 1IDYA 1TL8A 1K79A 2M9HA 1ZGJA 3LA7A 3IKTA 3SYTA 1KQ8A 4GDFA 2XRLA 5CYVA 2QBYB 1P7IA 2EV5A 2L2OA 3C1DA 5CVVA 4DOZA 4W1UA 2BY0A 3VB2A 4IEJA 1JT6A 4CCKA 2P5KA 1Z9CA 3G71I 4G6TB 2ZXHA 2WAFA 1K61A 2P5VA 1UELB 2DW4A 2ME0A 2KHMA 3E6MA 4BQAA 1D0YA 4CYCB 1TNSA 4AYBN 2EILH 3OY9A 2GXGA 3K69A 5GTHC 3ASNH 4KMUX 2FBIA 4KT6A 2JT1A 2QUFA 1R4MB 4I6ZA 3BR5A 2Y2ZA 2X1CA 2X9DA 3ZMUA 2R7OA 2Z5UA 2JA2A 1W0TA 4KIFA 4CUGA 2KRFA 4IVNA 3FM5A 2O8KA 1MIJA 4PJJA 2DMQA 3GCMA 3WU1B 5FKOA 1RRJA 2XGXA 2UWMA 4MHGA 3HEFA 3C2BA 2CV0A 2DJIA 2ZNYA 1WCMJ 1FOYA 1IW7F 1XN7A 1SD5A 2ZSIB 4A3BJ 1XDUA 2DA3A 5AIQA 4OIRF 1FOKA 2NAZA 2KDOA 3CP2A 1N25A 3DEEA 3IV5A 1BC8C 5IPAA 1IN7A 5D5VB 3AL0B 5FKMA 5BPIA 1QVTA 3CMMA 2YU9J 2CGPA 3S3MA 3DPUA 4Q4ZF 1S9HA 1ETQA 2PJRA 4KNYA 1T33A 4A3FJ 2VKEA 5HLGA 3MAJA 4E7IA 2OCCH 1NTCA 1H8AC 4WXHA 5LHIA 2E71A 2DK5A 3BTLA 4KT5C 3OYBA 2GAUA 3OYCA 1S3JA 3FMQA 2ID6A 5LGUA 1AKHB 2W7NA 1J0RA 1A6QA 5LLQA 3PUBA 4HQMA 5E79C 1OKRA 4DBQA 1F5TA 1VQNI 2QSFX 3ECHA 1QPIA 2R7ZJ 4ON0A 4A0XA 3WTWC 2FSWA 3MVPA 1PDNC 1GVDA 5CKTA 2P8TA 3HZJA 5JFRA 1HBXG 3ZMSA 2JA6J 2EJRA 2YPRA 4BAYA 5TISC 3I54A 2K9SA 4KUMA 4HPQA 4LIUA 3R61A 4M3BA 4LB6B 1QO0D 2BGCA 5FLVA 1T98A 3JRAA 3J7AO 1T95A 2VBZA 3S2HJ 4KA4A 2N8GA 3U1DA 4JK1X 4NDLA 1G3WA 2XSDC 2GA2A 4IZZA 1TW3A 4Y4RA 4MTDA 2JUGA 1B4AA 4C3JJ 3CTAA 2HS5A 1OCOH 1SD4A 3BG7A 3I5UA 5F64A 3HUGB 3JRFA 1Z3XA 3SZTA 1R1TA 2ZC2A 3SFZA 4FTHA 3ELKA 2HXIA 3V7SA 2V9KA 3KZIC 4RM3A 4OINF 4XKBA 3CF5F 3VFZA 1TLHB 3H9JA 3DV8A 3WTYC 1G6NA 2WY7Q 1ETWA 3QPSA 2BHZA 1FP1D 5D4SA 2EIMH 2ZMEC 1K7AA 3KLNA 2HWVA 5F1RA 4PDKA 1KU7A 5E3NA 2LDUA 1WJCA 4D5FA 4ZYDA 3HRUA 1MSEC 4HZFA 1U8RA 3M3YJ 1QNTA 3WU0A 4A3MJ 2V1XA 4I0AA 4HV5A 2IRFG 3HUGA 3BDDA 2DPDA 2JSPA 4HEA2 1JUMA 2E36A 2Y69H 1KU9A 2EB7A 3FHZA 4B09A 4BDYA 3GWZA 4OAZA 5D5WB 3ASOH 4NC6A 3BQYA 4YG2F 3ZXSA 5H2FC 1ZG1A 5AIPA 2XAGA 2EFNA 1S7AA 4S0HB 1E3OC 1UB9A 1UG2A 3GO5A 3I3LA 5EG0B 1XS9A 3D1NI 5FLMJ 4B44A 2M5WA 1T08B 2VT3A 1MMAA 2R7VA 2XASA 4LMYA 2NS7A 1BL0A 3NQOA 2OZ6A 4KIBA 2KRHA 1XG1A 2OC6A 1O3TA 1LVAA 2X0LA 1PVEA 2D2WA 3BT9A 2EK5A 2G9WA 2X51A 4I01A 2HKOA 4AVZA 2DT7B 4BJTA 3PO2J 4I7HA 5LRSA 3QQAA 3LNQA 4LIVA 4C9YA 4J19A 1B72B 2QGUA 5GPCA 4ITVA 4GCVA 4O5VA 1TQPA 3K4MA 2M4GA 1CF7B 3D0SA 3E6CC 3WGIA 1XGOA 3FXKA 2OD5A 3B6AA 3PSFA 3W2VA 4RDUA 2DMUA 3OYGA 3F8NA 5F04A 5KK1A 1FC3A 4RAYA 3JR9A 1VQKI 4PSWA 3H9GA 3EPZA 1FY7A 1SFEA 1T6SA 4E70A 2IS1A 2QWWA 3KYDB 3P9CA 3H5RA 5TJJA 2YX7A 4ESFA 4XORA 1QHHD 2F5DA 4EV0A 3PNYA 2Z33A 3AG1H 4YFKF 2MD0A 4MIMA 4CYDA 1I3QJ 1SMTA 2DA7A 1ZLJA 5CVUA 4U0YA 2NVTJ 4LITA 3OSFA 3L00A 4CCLA 2JVHA 5GTIC 3BY6A 2M0CA 3KFWX 4EGZA 3WE3A 5GP9A 2LBFB 3MKLA 1ITYA 5KHDA 3DU5A 1X1AA 3S14J 2F5VA 4UV8A 3RQIA 4J00A 2Q2EA 4V2FA 3D5LA 4FISA 2F6CA 5ILSA 1T0FC 2JRMA 1YS7A 3M9AA 4PUSA 1JUSA 4FASD 1MGTA 3PJRA 3A02A 5EEGA 4G9YA 1MZBA 5E1ZB 3T0YA 1EH6A 3GFLA 2R7WA 5D4RA 3F72A 1OMIA 2GBYA 5L3BA 4AIDA 3B6CA 4HW0A 2LY2A 2B63J 4IHTA 5DCFA 2DPUA 4RLFA 3A0BC 2HR3A 3LQQA 1XSVA 2W82A 4HV6A 1DP7P 1Q1HA 2BXYA 1OR7C 3O3KA 1OISA 1GT0C 1IUYA 3PFYA 1GV5A 2Y0MA 1LNWA 2JWTA 3LSJA 1MNMC 3ZQ7A 5JI6A 2EIKH 1IRXA 3BCBA 4PZJA 5B3SH 2Q0OA 1LQ1A 2K9MA 5HLTA 3QU6A 4ZYAA 1IF1A 4U88A 4II3A 4CGZA 2OAZA 4M9ZA 4F52A 4RB3C 4MQVA 2UXXA 3DKWA 4QPQA 1YW7A 3S8PA 4LOCA 3HXLA 4NB5A 1OCCH 1SMYF 3RKYA 2JA5J 1OCPA 3G1LA 4V2GA 5DD4A 2DMNA 3TDZC 3U9GA 5DYMA 1QQIA 2IGNA 5LHGA 3I59B 1KQ9A 5EEAA 3IC7A 1T2KA 3EDPA 1R7JA 2LBFA 2ADUA 4F92B 1MBGA 1K4TA 2L4AA 3F8BA 2P5LC 1B6AA 1TTYA 4JBAA 4CZZA 4WK8F 2H27A 1Y6IA 5F08A 4B3AA 4QTRA 4CH7A 3ZCOA 2FF4A 3DPTA 1W7PB 3JRGA 3VYTB 2VJ4A 3KETA 3IH2A 2WV1A 2A3SA 1ULYA 3H0GJ
chains in the Genus database with same CATH topology
2Q8KA 1O3SA 1LDJA 2KIMA 1S7OA 3I0TA 3FM3A 3KE2A 5FO5A 2HGCA 1REPC 1D8JA 2IT0A 3JAMZ 3R0AA 1CF7A 2KJBA 3E5XA 4KMFA 1HW1A 5CVRA 3HRSA 4OU0A 2ZMEA 2V9VA 4P9UA 3HHHA 5FLXZ 3WODF 1CGPA 1ZLKA 3RKWA 1EV7A 1G3TA 4A6EA 2HYFA 1O7FA 3R60A 1R00A 3JTGA 1ODDA 2MH2A 4OIPF 3BWGA 2CW0F 4EJVA 4G6QA 4HLXA 3EYIA 1IRGA 3V8JA 4ENJA 4RB2C 1L3LA 3QU3A 2VOPA 1UCRA 4UXNA 5LEJA 2GWRA 1BIBA 2FQ3A 2RQPA 3GEZA 4HQEA 1J9IA 3GZ6A 3G3ZA 2FNPA 2COMA 3KP4A 4DNCA 1U5TB 2QBYA 1FBUA 2XUBA 1LEAA 5LEKA 3CO6C 2WWYA 3Q5FA 5FD6A 1QZYA 3QP5A 4U0WA 3HYIA 2A5YB 5KVRA 2RC4A 1EH8A 1W7PA 2BBYA 2A68F 1RNLA 1XGSA 2MH9A 3RYPA 2ZFWA 4HF1A 1YW9A 4M72A 2TDXA 2FRHA 4HX7A 2WV0A 1MJ9A 4ASNA 2ZKZA 1TW2A 1NHAA 4HDUA 5AONA 3W6KB 2A61A 3MEXA 2ESNA 3KP3A 4A5NA 3TGNA 3K1NA 3F22A 1OR7A 4IF4A 5CLSA 1MDMA 4DQ2A 3F6OA 1HKQA 5EEHA 1P4XA 2DAOA 2FBKA 4LGWA 5JVTA 5FGMA 3FWEA 3JTHA 2DU9A 2DQRA 3QRFF 3GX4X 1FYLA 1GVJA 3L2CA 2FE3A 3WTTC 1BI3A 4I0BA 1FWZA 3Q9SA 2AXLA 1XCVA 3J80K 3TQNA 4WXDA 2PG4A 2H6CA 3BOQA 2Y48A 1YIOA 4R8HA 4BH9A 5IT9Z 2EFQA 3RYRA 3FX3A 2PJPA 4P96A 1U2WA 3T1BA 5E17F 3KEOA 4S05A 4RGUA 5CVJA 2KKOA 5HOOA 3WG9A 1FSEA 2PEXA 2BEOA 2EA2A 4XBFA 3EUHA 3KP6A 5DV5A 3C18A 1P4AA 1BBYA 1ONVA 3DF8A 4UV9A 4M6YA 2Z9OA 1WI9A 1A04A 1FX7A 4EGYA 4EJTA 1KA8A 4L9TA 2OQRA 2MA3A 4XRFA 3MZHA 2PN6A 3ROUA 3RI4A 1J59A 4BHCA 3FMRA 1KYWA 1JE8A 3B73A 1R5HA 1XD7A 5ICFA 3ZMZA 3HHGA 4B8XA 4AWXB 4P5OA 2YR2A 1O57A 2ISZA 4BNCA 2G7UA 1F9NA 1RUNA 1X3UA 4Y15A 4BYYA 5L3GA 5BS6A 2L02A 4HLYA 3TOBA 1TNTA 1XGNA 2A6EF 3FXRA 2UZKA 4ESBA 1YG2A 1Z05A 4ETSA 3GW2A 1R1VA 4QWQA 2OQGA 4KDPA 2IJLA 2O3FA 3AAFA 1H0MA 1LJ9A 3GXOA 5HS9A 5JHUA 2XAJA 3R6SA 2HZTA 3ERED 2UXNA 3KZZA 4ESJA 3QPTA 3HSFA 3CLOA 2PLYA 1JHHA 3C7JA 1OYWA 2PMUA 1R36A 5E1XA 2ETHA 4LK1F 4D0PA 5ERIA 2IA0A 3J80Z 6PAXA 1MDMB 4TV7A 4CHUA 2WTEA 4ZZDA 2CSOA 1I6XA 1S8NA 3DPLC 4UNOA 3HRTA 4M71A 1FLIA 3FZVA 4S04A 1K6OA 3K1PA 3WGHA 2O03A 3FXQA 1J5YA 4KFCA 5F6FA 4N9IA 2QQ9A 1W5TA 1V3FA 3ZP5A 2V1DA 2L01A 1KU2A 4OMYA 1BN5A 5H6QA 4ENNA 1BIAA 3HSRA 3VODA 2JZYA 2VONA 2X4HA 2LSOA 2LNBA 2EFOA 1BM9A 1K78A 4A12A 2A69F 1U3EM 5ILVA 4HX4A 2WC2A 1FSHA 2FU4A 2VN2A 1OPCA 2FXAA 1U5TA 2W84A 4RAZA 2P7VB 3CJNA 3T5XA 3CDHA 3HOTA 2OA4A 2XAHA 2B0LA 4P55A 4GXOA 4F7ZA 3I58A 2FMLA 4KN4X 2DLLA 4GO1A 2GZWA 3LA2A 1GHCA 3I53A 1HSJA 3W6JB 3HRMA 1SAXA 3TDUC 4O3MA 3CUQB 2RN7A 3TO7A 4AIKA 4M9SA 1YYVA 4U0VA 2YU3A 1H9TA 5J6XA 4LB5A 5HDKA 3KCCA 3KEQA 3WTUC 1GXQA 3SZPA 1IN6A 4L0ZB 2HKXA 4L9JA 4YIFA 1ZN2A 4M74A 2F5FA 3Q9VA 4CXFA 2XRNA 3WTVC 5HLIA 2HYGD 1I5ZA 3DEUA 4MQ9F 1G3YA 1J75A 4N0BA 2DT5A 1R58A 2L3DA 1G4DA 1I1GA 2M1BA 3V8LA 3F21A 2J5OA 1WQ2A 3EETA 3L7WA 2HQNA 2NNNA 5K5QA 1H9GA 4Q47A 2GIVA 5DEQA 4LLNA 3GYHX 5DUIA 4HAMA 2QENA 1K78B 1YTYA 1SFUA 1D8KA 3IWZA 2NS0A 5K5OA 2F5CA 3HSEA 3LAJA 1XGMA 3SHFA 3EQLF 1YW8A 4BHPA 2DI3A 5IT9K 1W7PD 3LFKA 4P9FA 3GFJA 3CO7C 3IWFA 3QOPA 3ZMVA 2VC0A 2VBXA 1FBSA 3E3VA 4N9HA 3E5UA 2XAFA 2CQKA 5H6RA 3GFMA 3V7RA 3H92A 2Y75A 2P7CB 3E5QA 3HTSB 2M45A 1LDKB 1R1UA 4LJZF 1P92A 4HX8A 4HDVA 1ZARA 4I2OA 1ZAOA 1T38A 2V6CA 4MEYF 2VOOA 2V1UA 1S29A 4HF0A 4LLGF 1FYKA 2HDCA 5IT3A 3WTZA 4AIJA 2KJCA 2QQBA 4U7BA 3BJOA 4QLCU 4G6DA 1I1SA 2E7XA 5H20A 1XB4A 4WX9A 4KN7X 2Z99A 4IPAA 4IJAA 3RJPA 1XSDA 2VC1A 2QVOA 2XHKA 4A2UA 4WXCA 2CO5A 3N97A 3MZYA 2ELHA 1WWXA 2IPQX 3P7NA 1W4MA 3F6VA 3GVAA 3ABUA 3O2PE 4Z2YA 5ED4A 3P9KA 4MGRA 4EQQA 1UFMA 3GLXA 5D5XB 5D8KB 3FXUA 3M8FA 4PCQA 3KP5A 2HQRA 2KIFA 2BYVE 4HA8A 4KYWA 4JQFA 3NRVA 1XDSA 2NYXA 2J5PA 2RDPA 2JTVA 2Z3YA 3LA3A 1ZH5A 4OOIA 5HDNA 4FX4A 3VOEA 4HF2A 3CUQC 2EWNA 1R5GA 1QZZA 3RTRA 4G7HF 2FMYA 4PGHA 4RGSA 4OIOF 4EMSA 4EM2A 3F8CA 3LQRA 1JGSA 2DK8A 1ZRCA 3T8RA 2BV6A 4L9VA 2JRTA 3L09A 2K4JA 4CDGA 3HOSA 2VXZA 5FFZA 1RZ4A 3BP8A 5J8CA 2A07F 3PFIA 4RGRA 1STZA 2AS5F 2PMHA 4LLLA 4AVPA 2W25A 2K4BA 5CJ9A 3BZ6A 2PBIA 3M7GA 3LAPA 3IRQA 2R7FA 4IXAA 2VE9A 5D6EA 1L0OC 3IL2A 1YS6A 2R3SA 1ZGAA 1XCBA 5BPDA 1D3YA 2E1CA 1P2FA 2V79A 4I98B 4ZYEA 3O6BB 4L9NA 3V8KA 1HKTA 5HVQC 4BHBA 1E2XA 5L3DA 1O3QA 1DUXC 2QLZA 2K86A 2CFXA 4RS8A 1LB2A 2K7LA 4PGGA 4Q48A 1DDNA 4HBLA 4YFXF 3TOAA 2W57A 3JSOA 2H94A 2CG4A 2QYOA 4I02A 4Y13A 1P6RA 2EFPA 2MD5A 4XSZF 2JSCA 1IZ1A 2P6SA 3C3WA 3QAHA 4WF2A 2FOKA 4UVBA 4ENKA 4IRIA 2EFWA 1GXPA 2BE5F 1PP7U 4K2EA 3HIFA 2M30A 4EM1A 2ZJ2A 2O61A 1AWCA 2HEOA 3DFGA 1FPQA 5K1YA 5DCMB 3KP7A 3HTUA 1SFXA 5E1WA 3L9FA 4CICA 4BXUA 1B1BA 4ZYHA 4MTEA 4Q5SF 1KU3A 2FEZA 3JAMK 2IP2A 5LGNA 1BJAA 4A0YA 5JR3A 1R22A 1XMKA 5L3FA 1HW5A 3TKYA 2IVMA 3F8FA 1QBJA 2GXBA 1ZRFA 2PFBA 4EJUA 1ZHFA 2RVCA 4FHTA 2FA5A 2ZMEB 4R79A 4CO8A 5A2QZ 1F1ZA 2EA4A 5FB2A 4AIHA 3QPHA 5HLHA 3NEUA 2M87A 2D1VA 4M73A 5LGTA 4FT8A 5CVIA 1WRJA 2ACJA 1IXCA 2NNYA 1WSUA 2FBHA 5FD5A 3J81K 1TBXA 3GUDA 4IRHA 4Y17A 4ZH4F 2YSRA 2EV6A 1U78A 4AD9A 1HW2A 1SD6A 3QP6A 4ZZLA 2R7DA 3GF2A 3MWMA 5J8FA 1BI2A 3GZ5A 5E20A 2JPBA 2D1HA 2PQ8A 3IKVA 4UUVA 4EJWA 1JXSA 4OMZA 2XKPA 2H09A 2ZCWA 3OV8A 4L5IA 1IN5A 1B9NA 2RNJA 3F23A 1YLFA 3V4GA 1B59A 1HKSA 4KIGA 2W24A 5FFXA 1HXDA 2QQAA 5HDGA 1FNNA 5DCMA 3ML6A 4WCGA 1TQIA 2DBBA 1SD7A 3ZPLA 2MLKA 2L4MA 2VBWA 2P4WA 3KZYA 4G8XA 2QZ8A 3ZMDA 1O3RA 3BJ6A 1IXSB 1IAWA 3BPVA 2CWEA 2OZUA 4G94A 3OOPA 3J81Z 1YQAA 3I59A 3H3UA 3I4PA 2GQQA 2MBFA 3ABTA 2IW5A 2XIGA 2OU2A 1QPMA 2HFHA 1U5TC 1ZG3A 5E18F 4MNUA 3EYYA 1S6LA 3RIRA 2HTSA 1J2XA 4U7DA 1O7LA 2PI0A 1PUEE 4I09A 5HS7A 5ICCA 4R1HA 2E7WA 2XROA 5D6FA 1HSTA 2QM3A 2CYYA 2VT2A 2JPCA 5ICGA 3FF5A 4KICA 1T39A 3TO9A 5DUKA 5L3CA 2HTJA 3E6DA 3CUQA 3K9TA 3K0LA 1EH7A 1USSA 2DFIA 3IRRA 3GFIA 4L18B 3RPUA 4L5JA 4UHTA 4L0YB 2ZNZA 1P4WA 2STWA 4A0ZA 3F8MA 3M8EA 3JSPA 2O6GE 5BQTA 1DPRA 3LSTA 1Y0UA 2W85A 2LKPA 2FNAA 2A6HF 4NHJA 4XLNF 2DO7A 5TRDA 4G7OF 3P9IA 1RIOH 1BI0A 2GA1A 2XAQA 2ZBKA 1RUOA 1Z6TA 4GYGA 1KYZA 3CUOA 3DXJF 3DP7A 3RDIA 1B9MA 2P6TA 5LHHA 1FT9A 1AOYA 1IN8A 1C0WA 1KQ0A 1USTA 4RB0A 4WWCA 5D5UB 2O8XA 2F5EA 4IHSA 4XSXF 4FX0A 1FYMA 3FMSA 4M9XA 3LWFA 4H0EA 3BPXA 4YFNF 5E8GA 4UVAA 2M8EA 1KGSA 2LF7A 5L3EA 3T8TA 4LG0B 3MFKA 1Z7UA 3B02A 2LF8A 1ZRDA 2K02A 2VODA 2K27A 4YIIA 2MLGA 5D8LB 2RKHA 2XKOA 1QGPA 3R4KA 4HOBA 1UHMA 3ZN1A 3WTSC 4LG0A 1JHFA 5ICEA 3ZN0A 1MKMA 5K5RA 5ILUA 4EVIA 3ECOA 3H3ZA 3E97A 1IXRC 4LFUA 4ZYGA 1E17A 3M1EA 2NRAC 1J7KA 3BROA 1T0FA 3MCZA 4HYEA 4XLPF 1YFHA 3VEPA 5FLXK 3PQKA 1WKMA 1R23A 3K1MA 1FZPB 3TO6A 4UVCA 5E8IA 1F4KA 1MJAA 3WE2A 2VBYA 3REOA 2STTA 5LRRA 2YX4A 2VE8A 1BI1A 1YO5C 2ZO4A 3G73A 4A6DA 1FP2A 3PQJA 1ON2A 1HQCA 4MEXF 2D45A 3F3XA 1BC7C 2F2EA 4OIQF 3DQVC 3SXYA 5DD8A 2ZXJA 1MJBA 4EJOA 5HS8A 4LD5A 2HOEA 1LEBA 1IRFA 2KIUA 3RPQA 5BOXA 1G3SA 4M6XA 3WTXC 1ZREA 5DDGA 1UHWA 3ISPA 3ULQB 2C6YA 2XV4S 1XSXA 4EM0B 3COAC 1V4RA 2ESHA 4O6JA 1Z6RA 3IHUA 3ZMTA 2DQLA 1ZYRF 3E6BA 3MQ0A 1MD0A 4NQWA 4IRGA 3V7CA 5BMZA 1Z1DA 3JW4A 1XMAA 3N4MA 2IA2A 3I71A 1LDDA 2H6BA 2G7HA 3K2ZA 4A5MA 1OYYA 3I64A 3BJAA 1ON1A 1TQMA 4LK0F 4RGXA 1FBQA 1IN4A 3WGGA 4ENMA 1D5VA 2E1NA 1PP8F 1OYIA 3S2WA 5LBQA 2RV8A 5A2QK 2IA1A 1DPUA 2MC3A 3KP2A 1I27A 4GGGA 1W5SA 4GYIA 2L54A 2ISYA 2DTRA 1Z91A 4G7ZF 1BOAA 3KLOA 4RB1A 2EV0A 1ZG5A 3R0JA 1RI7A 1U6GA 2O0YA 3SQNA 2OBPA 2XVCA 1VTNC 3U2RA 3RKXA 1K79A 1ZGJA 3LA7A 3IKTA 1KQ8A 5CYVA 2QBYB 2EV5A 3C1DA 5CVVA 3VB2A 2P5KA 1Z9CA 2P5VA 2DW4A 4BQAA 3E6MA 1TNSA 2GXGA 3K69A 4KMUX 2FBIA 2JT1A 2QUFA 3ZMUA 2Z5UA 4KIFA 2KRFA 4IVNA 3FM5A 3WU1B 2XGXA 2UWMA 4MHGA 2ZNYA 1IW7F 1XN7A 1SD5A 1XDUA 5AIQA 4OIRF 1FOKA 2NAZA 1BC8C 1IN7A 5D5VB 5BPIA 2CGPA 4Q4ZF 4KNYA 5HLGA 3MAJA 4WXHA 5LHIA 2DK5A 4KT5C 2GAUA 1S3JA 3FMQA 5LGUA 1J0RA 5LLQA 4HQMA 1OKRA 1F5TA 3ECHA 4ON0A 4A0XA 3WTWC 2FSWA 1PDNC 2P8TA 5JFRA 1HBXG 3ZMSA 2EJRA 2YPRA 4BAYA 3I54A 4KUMA 4LB6B 3R61A 1QO0D 2BGCA 1T98A 3J7AO 2VBZA 4KA4A 3U1DA 4JK1X 1G3WA 2GA2A 1TW3A 4MTDA 1B4AA 3CTAA 2HS5A 1SD4A 3I5UA 5F64A 3SZTA 1R1TA 3SFZA 3ELKA 3V7SA 4OINF 3VFZA 1TLHB 3DV8A 3WTYC 1G6NA 1FP1D 5D4SA 1K7AA 3KLNA 2HWVA 5F1RA 4PDKA 1KU7A 2LDUA 4ZYDA 3HRUA 4HZFA 1U8RA 1QNTA 3WU0A 2IRFG 2V1XA 4I0AA 4HV5A 3HUGA 3BDDA 2DPDA 1KU9A 2EB7A 3FHZA 4B09A 3GWZA 5D5WB 4YG2F 1ZG1A 5AIPA 2XAGA 2EFNA 1S7AA 1UB9A 3GO5A 2M5WA 2VT3A 2XASA 4LMYA 3NQOA 2OZ6A 4KIBA 1O3TA 1LVAA 2X0LA 2D2WA 2EK5A 4I01A 2G9WA 2HKOA 4I7HA 5LRSA 4GCVA 4O5VA 1TQPA 1CF7B 3D0SA 3E6CC 3WGIA 1XGOA 2OD5A 3F8NA 5KK1A 1FC3A 4RAYA 1FY7A 1SFEA 1T6SA 4E70A 2QWWA 3P9CA 5TJJA 2YX7A 4ESFA 2F5DA 4EV0A 2Z33A 4YFKF 4CYDA 1SMTA 5CVUA 4U0YA 1ZLJA 3L00A 3BY6A 3KFWX 4EGZA 3WE3A 4UV8A 2Q2EA 3D5LA 5ILSA 1YS7A 3M9AA 1MGTA 5EEGA 4G9YA 1MZBA 5E1ZB 3T0YA 1EH6A 3GFLA 5D4RA 3F72A 1OMIA 5L3BA 4HW0A 4IHTA 5DCFA 2DPUA 2HR3A 3LQQA 1XSVA 4HV6A 1DP7P 1Q1HA 3O3KA 1IUYA 2Y0MA 1LNWA 3ZQ7A 5JI6A 4PZJA 2Q0OA 1LQ1A 3QU6A 1IF1A 4U88A 4CGZA 2OAZA 4RB3C 4M9ZA 4MQVA 2UXXA 3DKWA 1YW7A 4NB5A 1SMYF 3RKYA 5DD4A 3TDZC 3U9GA 5DYMA 1QQIA 5LHGA 1T2KA 1KQ9A 3I59B 3IC7A 3EDPA 1R7JA 2ADUA 2L4AA 3F8BA 2P5LC 1B6AA 1TTYA 4JBAA 4CZZA 4WK8F 2H27A 2FF4A 3DPTA 1W7PB 3KETA 2A3SA 1ULYA 2RGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8K A;  1O3S A;  1LDJ A;  2KIM A;  1S7O A;  3I0T A;  3FM3 A;  3KE2 A;  5FO5 A;  2HGC A;  1REP C;  1D8J A;  2IT0 A;  3JAM Z;  3R0A A;  1CF7 A;  2KJB A;  3E5X A;  4KMF A;  1HW1 A;  5CVR A;  3HRS A;  4OU0 A;  2ZME A;  2V9V A;  4P9U A;  3HHH A;  5FLX Z;  3WOD F;  1CGP A;  1ZLK A;  3RKW A;  1EV7 A;  1G3T A;  4A6E A;  2HYF A;  1O7F A;  3R60 A;  1R00 A;  3JTG A;  1ODD A;  2MH2 A;  4OIP F;  3BWG A;  2CW0 F;  4EJV A;  4G6Q A;  4HLX A;  3EYI A;  1IRG A;  3V8J A;  4ENJ A;  4RB2 C;  1L3L A;  3QU3 A;  2VOP A;  1UCR A;  4UXN A;  5LEJ A;  2GWR A;  1BIB A;  2FQ3 A;  2RQP A;  3GEZ A;  4HQE A;  1J9I A;  3GZ6 A;  3G3Z A;  2FNP A;  2COM A;  3KP4 A;  4DNC A;  1U5T B;  2QBY A;  1FBU A;  2XUB A;  1LEA A;  5LEK A;  3CO6 C;  2WWY A;  3Q5F A;  5FD6 A;  1QZY A;  3QP5 A;  4U0W A;  3HYI A;  2A5Y B;  5KVR A;  2RC4 A;  1EH8 A;  1W7P A;  2BBY A;  2A68 F;  1RNL A;  1XGS A;  2MH9 A;  3RYP A;  2ZFW A;  4HF1 A;  1YW9 A;  4M72 A;  2TDX A;  2FRH A;  4HX7 A;  2WV0 A;  1MJ9 A;  4ASN A;  2ZKZ A;  1TW2 A;  1NHA A;  4HDU A;  5AON A;  3W6K B;  2A61 A;  3MEX A;  2ESN A;  3KP3 A;  4A5N A;  3TGN A;  3K1N A;  3F22 A;  1OR7 A;  4IF4 A;  5CLS A;  1MDM A;  4DQ2 A;  3F6O A;  1HKQ A;  5EEH A;  1P4X A;  2DAO A;  2FBK A;  4LGW A;  5JVT A;  5FGM A;  3FWE A;  3JTH A;  2DU9 A;  2DQR A;  3QRF F;  3GX4 X;  1FYL A;  1GVJ A;  3L2C A;  2FE3 A;  3WTT C;  1BI3 A;  4I0B A;  1FWZ A;  3Q9S A;  2AXL A;  1XCV A;  3J80 K;  3TQN A;  4WXD A;  2PG4 A;  2H6C A;  3BOQ A;  2Y48 A;  1YIO A;  4R8H A;  4BH9 A;  5IT9 Z;  2EFQ A;  3RYR A;  3FX3 A;  2PJP A;  4P96 A;  1U2W A;  3T1B A;  5E17 F;  3KEO A;  4S05 A;  4RGU A;  5CVJ A;  2KKO A;  5HOO A;  3WG9 A;  1FSE A;  2PEX A;  2BEO A;  2EA2 A;  4XBF A;  3EUH A;  3KP6 A;  5DV5 A;  3C18 A;  1P4A A;  1BBY A;  1ONV A;  3DF8 A;  4UV9 A;  4M6Y A;  2Z9O A;  1WI9 A;  1A04 A;  1FX7 A;  4EGY A;  4EJT A;  1KA8 A;  4L9T A;  2OQR A;  2MA3 A;  4XRF A;  3MZH A;  2PN6 A;  3ROU A;  3RI4 A;  1J59 A;  4BHC A;  3FMR A;  1KYW A;  1JE8 A;  3B73 A;  1R5H A;  1XD7 A;  5ICF A;  3ZMZ A;  3HHG A;  4B8X A;  4AWX B;  4P5O A;  2YR2 A;  1O57 A;  2ISZ A;  4BNC A;  2G7U A;  1F9N A;  1RUN A;  1X3U A;  4Y15 A;  4BYY A;  5L3G A;  5BS6 A;  2L02 A;  4HLY A;  3TOB A;  1TNT A;  1XGN A;  2A6E F;  3FXR A;  2UZK A;  4ESB A;  1YG2 A;  1Z05 A;  4ETS A;  3GW2 A;  1R1V A;  4QWQ A;  2OQG A;  4KDP A;  2IJL A;  2O3F A;  3AAF A;  1H0M A;  1LJ9 A;  3GXO A;  5HS9 A;  5JHU A;  2XAJ A;  3R6S A;  2HZT A;  3ERE D;  2UXN A;  3KZZ A;  4ESJ A;  3QPT A;  3HSF A;  3CLO A;  2PLY A;  1JHH A;  3C7J A;  1OYW A;  2PMU A;  1R36 A;  5E1X A;  2ETH A;  4LK1 F;  4D0P A;  5ERI A;  2IA0 A;  3J80 Z;  6PAX A;  1MDM B;  4TV7 A;  4CHU A;  2WTE A;  4ZZD A;  2CSO A;  1I6X A;  1S8N A;  3DPL C;  4UNO A;  3HRT A;  4M71 A;  1FLI A;  3FZV A;  4S04 A;  1K6O A;  3K1P A;  3WGH A;  2O03 A;  3FXQ A;  1J5Y A;  4KFC A;  5F6F A;  4N9I A;  2QQ9 A;  1W5T A;  1V3F A;  3ZP5 A;  2V1D A;  2L01 A;  1KU2 A;  4OMY A;  1BN5 A;  5H6Q A;  4ENN A;  1BIA A;  3HSR A;  3VOD A;  2JZY A;  2VON A;  2X4H A;  2LSO A;  2LNB A;  2EFO A;  1BM9 A;  1K78 A;  4A12 A;  2A69 F;  1U3E M;  5ILV A;  4HX4 A;  2WC2 A;  1FSH A;  2FU4 A;  2VN2 A;  1OPC A;  2FXA A;  1U5T A;  2W84 A;  4RAZ A;  2P7V B;  3CJN A;  3T5X A;  3CDH A;  3HOT A;  2OA4 A;  2XAH A;  2B0L A;  4P55 A;  4GXO A;  4F7Z A;  3I58 A;  2FML A;  4KN4 X;  2DLL A;  4GO1 A;  2GZW A;  3LA2 A;  1GHC A;  3I53 A;  1HSJ A;  3W6J B;  3HRM A;  1SAX A;  3TDU C;  4O3M A;  3CUQ B;  2RN7 A;  3TO7 A;  4AIK A;  4M9S A;  1YYV A;  4U0V A;  2YU3 A;  1H9T A;  5J6X A;  4LB5 A;  5HDK A;  3KCC A;  3KEQ A;  3WTU C;  1GXQ A;  3SZP A;  1IN6 A;  4L0Z B;  2HKX A;  4L9J A;  4YIF A;  1ZN2 A;  4M74 A;  2F5F A;  3Q9V A;  4CXF A;  2XRN A;  3WTV C;  5HLI A;  2HYG D;  1I5Z A;  3DEU A;  4MQ9 F;  1G3Y A;  1J75 A;  4N0B A;  2DT5 A;  1R58 A;  2L3D A;  1G4D A;  1I1G A;  2M1B A;  3V8L A;  3F21 A;  2J5O A;  1WQ2 A;  3EET A;  3L7W A;  2HQN A;  2NNN A;  5K5Q A;  1H9G A;  4Q47 A;  2GIV A;  5DEQ A;  4LLN A;  3GYH X;  5DUI A;  4HAM A;  2QEN A;  1K78 B;  1YTY A;  1SFU A;  1D8K A;  3IWZ A;  2NS0 A;  5K5O A;  2F5C A;  3HSE A;  3LAJ A;  1XGM A;  3SHF A;  3EQL F;  1YW8 A;  4BHP A;  2DI3 A;  5IT9 K;  1W7P D;  3LFK A;  4P9F A;  3GFJ A;  3CO7 C;  3IWF A;  3QOP A;  3ZMV A;  2VC0 A;  2VBX A;  1FBS A;  3E3V A;  4N9H A;  3E5U A;  2XAF A;  2CQK A;  5H6R A;  3GFM A;  3V7R A;  3H92 A;  2Y75 A;  2P7C B;  3E5Q A;  3HTS B;  2M45 A;  1LDK B;  1R1U A;  4LJZ F;  1P92 A;  4HX8 A;  4HDV A;  1ZAR A;  4I2O A;  1ZAO A;  1T38 A;  2V6C A;  4MEY F;  2VOO A;  2V1U A;  1S29 A;  4HF0 A;  4LLG F;  1FYK A;  2HDC A;  5IT3 A;  3WTZ A;  4AIJ A;  2KJC A;  2QQB A;  4U7B A;  3BJO A;  4QLC U;  4G6D A;  1I1S A;  2E7X A;  5H20 A;  1XB4 A;  4WX9 A;  4KN7 X;  2Z99 A;  4IPA A;  4IJA A;  3RJP A;  1XSD A;  2VC1 A;  2QVO A;  2XHK A;  4A2U A;  4WXC A;  2CO5 A;  3N97 A;  3MZY A;  2ELH A;  1WWX A;  2IPQ X;  3P7N A;  1W4M A;  3F6V A;  3GVA A;  3ABU A;  3O2P E;  4Z2Y A;  5ED4 A;  3P9K A;  4MGR A;  4EQQ A;  1UFM A;  3GLX A;  5D5X B;  5D8K B;  3FXU A;  3M8F A;  4PCQ A;  3KP5 A;  2HQR A;  2KIF A;  2BYV E;  4HA8 A;  4KYW A;  4JQF A;  3NRV A;  1XDS A;  2NYX A;  2J5P A;  2RDP A;  2JTV A;  2Z3Y A;  3LA3 A;  1ZH5 A;  4OOI A;  5HDN A;  4FX4 A;  3VOE A;  4HF2 A;  3CUQ C;  2EWN A;  1R5G A;  1QZZ A;  3RTR A;  4G7H F;  2FMY A;  4PGH A;  4RGS A;  4OIO F;  4EMS A;  4EM2 A;  3F8C A;  3LQR A;  1JGS A;  2DK8 A;  1ZRC A;  3T8R A;  2BV6 A;  4L9V A;  2JRT A;  3L09 A;  2K4J A;  4CDG A;  3HOS A;  2VXZ A;  5FFZ A;  1RZ4 A;  3BP8 A;  5J8C A;  2A07 F;  3PFI A;  4RGR A;  1STZ A;  2AS5 F;  2PMH A;  4LLL A;  4AVP A;  2W25 A;  2K4B A;  5CJ9 A;  3BZ6 A;  2PBI A;  3M7G A;  3LAP A;  3IRQ A;  2R7F A;  4IXA A;  2VE9 A;  5D6E A;  1L0O C;  3IL2 A;  1YS6 A;  2R3S A;  1ZGA A;  1XCB A;  5BPD A;  1D3Y A;  2E1C A;  1P2F A;  2V79 A;  4I98 B;  4ZYE A;  3O6B B;  4L9N A;  3V8K A;  1HKT A;  5HVQ C;  4BHB A;  1E2X A;  5L3D A;  1O3Q A;  1DUX C;  2QLZ A;  2K86 A;  2CFX A;  4RS8 A;  1LB2 A;  2K7L A;  4PGG A;  4Q48 A;  1DDN A;  4HBL A;  4YFX F;  3TOA A;  2W57 A;  3JSO A;  2H94 A;  2CG4 A;  2QYO A;  4I02 A;  4Y13 A;  1P6R A;  2EFP A;  2MD5 A;  4XSZ F;  2JSC A;  1IZ1 A;  2P6S A;  3C3W A;  3QAH A;  4WF2 A;  2FOK A;  4UVB A;  4ENK A;  4IRI A;  2EFW A;  1GXP A;  2BE5 F;  1PP7 U;  4K2E A;  3HIF A;  2M30 A;  4EM1 A;  2ZJ2 A;  2O61 A;  1AWC A;  2HEO A;  3DFG A;  1FPQ A;  5K1Y A;  5DCM B;  3KP7 A;  3HTU A;  1SFX A;  5E1W A;  3L9F A;  4CIC A;  4BXU A;  1B1B A;  4ZYH A;  4MTE A;  4Q5S F;  1KU3 A;  2FEZ A;  3JAM K;  2IP2 A;  5LGN A;  1BJA A;  4A0Y A;  5JR3 A;  1R22 A;  1XMK A;  5L3F A;  1HW5 A;  3TKY A;  2IVM A;  3F8F A;  1QBJ A;  2GXB A;  1ZRF A;  2PFB A;  4EJU A;  1ZHF A;  2RVC A;  4FHT A;  2FA5 A;  2ZME B;  4R79 A;  4CO8 A;  5A2Q Z;  1F1Z A;  2EA4 A;  5FB2 A;  4AIH A;  3QPH A;  5HLH A;  3NEU A;  2M87 A;  2D1V A;  4M73 A;  5LGT A;  4FT8 A;  5CVI A;  1WRJ A;  2ACJ A;  1IXC A;  2NNY A;  1WSU A;  2FBH A;  5FD5 A;  3J81 K;  1TBX A;  3GUD A;  4IRH A;  4Y17 A;  4ZH4 F;  2YSR A;  2EV6 A;  1U78 A;  4AD9 A;  1HW2 A;  1SD6 A;  3QP6 A;  4ZZL A;  2R7D A;  3GF2 A;  3MWM A;  5J8F A;  1BI2 A;  3GZ5 A;  5E20 A;  2JPB A;  2D1H A;  2PQ8 A;  3IKV A;  4UUV A;  4EJW A;  1JXS A;  4OMZ A;  2XKP A;  2H09 A;  2ZCW A;  3OV8 A;  4L5I A;  1IN5 A;  1B9N A;  2RNJ A;  3F23 A;  1YLF A;  3V4G A;  1B59 A;  1HKS A;  4KIG A;  2W24 A;  5FFX A;  1HXD A;  2QQA A;  5HDG A;  1FNN A;  5DCM A;  3ML6 A;  4WCG A;  1TQI A;  2DBB A;  1SD7 A;  3ZPL A;  2MLK A;  2L4M A;  2VBW A;  2P4W A;  3KZY A;  4G8X A;  2QZ8 A;  3ZMD A;  1O3R A;  3BJ6 A;  1IXS B;  1IAW A;  3BPV A;  2CWE A;  2OZU A;  4G94 A;  3OOP A;  3J81 Z;  1YQA A;  3I59 A;  3H3U A;  3I4P A;  2GQQ A;  2MBF A;  3ABT A;  2IW5 A;  2XIG A;  2OU2 A;  1QPM A;  2HFH A;  1U5T C;  1ZG3 A;  5E18 F;  4MNU A;  3EYY A;  1S6L A;  3RIR A;  2HTS A;  1J2X A;  4U7D A;  1O7L A;  2PI0 A;  1PUE E;  4I09 A;  5HS7 A;  5ICC A;  4R1H A;  2E7W A;  2XRO A;  5D6F A;  1HST A;  2QM3 A;  2CYY A;  2VT2 A;  2JPC A;  5ICG A;  3FF5 A;  4KIC A;  1T39 A;  3TO9 A;  5DUK A;  5L3C A;  2HTJ A;  3E6D A;  3CUQ A;  3K9T A;  3K0L A;  1EH7 A;  1USS A;  2DFI A;  3IRR A;  3GFI A;  4L18 B;  3RPU A;  4L5J A;  4UHT A;  4L0Y B;  2ZNZ A;  1P4W A;  2STW A;  4A0Z A;  3F8M A;  3M8E A;  3JSP A;  2O6G E;  5BQT A;  1DPR A;  3LST A;  1Y0U A;  2W85 A;  2LKP A;  2FNA A;  2A6H F;  4NHJ A;  4XLN F;  2DO7 A;  5TRD A;  4G7O F;  3P9I A;  1RIO H;  1BI0 A;  2GA1 A;  2XAQ A;  2ZBK A;  1RUO A;  1Z6T A;  4GYG A;  1KYZ A;  3CUO A;  3DXJ F;  3DP7 A;  3RDI A;  1B9M A;  2P6T A;  5LHH A;  1FT9 A;  1AOY A;  1IN8 A;  1C0W A;  1KQ0 A;  1UST A;  4RB0 A;  4WWC A;  5D5U B;  2O8X A;  2F5E A;  4IHS A;  4XSX F;  4FX0 A;  1FYM A;  3FMS A;  4M9X A;  3LWF A;  4H0E A;  3BPX A;  4YFN F;  5E8G A;  4UVA A;  2M8E A;  1KGS A;  2LF7 A;  5L3E A;  3T8T A;  4LG0 B;  3MFK A;  1Z7U A;  3B02 A;  2LF8 A;  1ZRD A;  2K02 A;  2VOD A;  2K27 A;  4YII A;  2MLG A;  5D8L B;  2RKH A;  2XKO A;  1QGP A;  3R4K A;  4HOB A;  1UHM A;  3ZN1 A;  3WTS C;  4LG0 A;  1JHF A;  5ICE A;  3ZN0 A;  1MKM A;  5K5R A;  5ILU A;  4EVI A;  3ECO A;  3H3Z A;  3E97 A;  1IXR C;  4LFU A;  4ZYG A;  1E17 A;  3M1E A;  2NRA C;  1J7K A;  3BRO A;  1T0F A;  3MCZ A;  4HYE A;  4XLP F;  1YFH A;  3VEP A;  5FLX K;  3PQK A;  1WKM A;  1R23 A;  3K1M A;  1FZP B;  3TO6 A;  4UVC A;  5E8I A;  1F4K A;  1MJA A;  3WE2 A;  2VBY A;  3REO A;  2STT A;  5LRR A;  2YX4 A;  2VE8 A;  1BI1 A;  1YO5 C;  2ZO4 A;  3G73 A;  4A6D A;  1FP2 A;  3PQJ A;  1ON2 A;  1HQC A;  4MEX F;  2D45 A;  3F3X A;  1BC7 C;  2F2E A;  4OIQ F;  3DQV C;  3SXY A;  5DD8 A;  2ZXJ A;  1MJB A;  4EJO A;  5HS8 A;  4LD5 A;  2HOE A;  1LEB A;  1IRF A;  2KIU A;  3RPQ A;  5BOX A;  1G3S A;  4M6X A;  3WTX C;  1ZRE A;  5DDG A;  1UHW A;  3ISP A;  3ULQ B;  2C6Y A;  2XV4 S;  1XSX A;  4EM0 B;  3COA C;  1V4R A;  2ESH A;  4O6J A;  1Z6R A;  3IHU A;  3ZMT A;  2DQL A;  1ZYR F;  3E6B A;  3MQ0 A;  1MD0 A;  4NQW A;  4IRG A;  3V7C A;  5BMZ A;  1Z1D A;  3JW4 A;  1XMA A;  3N4M A;  2IA2 A;  3I71 A;  1LDD A;  2H6B A;  2G7H A;  3K2Z A;  4A5M A;  1OYY A;  3I64 A;  3BJA A;  1ON1 A;  1TQM A;  4LK0 F;  4RGX A;  1FBQ A;  1IN4 A;  3WGG A;  4ENM A;  1D5V A;  2E1N A;  1PP8 F;  1OYI A;  3S2W A;  5LBQ A;  2RV8 A;  5A2Q K;  2IA1 A;  1DPU A;  2MC3 A;  3KP2 A;  1I27 A;  4GGG A;  1W5S A;  4GYI A;  2L54 A;  2ISY A;  2DTR A;  1Z91 A;  4G7Z F;  1BOA A;  3KLO A;  4RB1 A;  2EV0 A;  1ZG5 A;  3R0J A;  1RI7 A;  1U6G A;  2O0Y A;  3SQN A;  2OBP A;  2XVC A;  1VTN C;  3U2R A;  3RKX A;  1K79 A;  1ZGJ A;  3LA7 A;  3IKT A;  1KQ8 A;  5CYV A;  2QBY B;  2EV5 A;  3C1D A;  5CVV A;  3VB2 A;  2P5K A;  1Z9C A;  2P5V A;  2DW4 A;  4BQA A;  3E6M A;  1TNS A;  2GXG A;  3K69 A;  4KMU X;  2FBI A;  2JT1 A;  2QUF A;  3ZMU A;  2Z5U A;  4KIF A;  2KRF A;  4IVN A;  3FM5 A;  3WU1 B;  2XGX A;  2UWM A;  4MHG A;  2ZNY A;  1IW7 F;  1XN7 A;  1SD5 A;  1XDU A;  5AIQ A;  4OIR F;  1FOK A;  2NAZ A;  1BC8 C;  1IN7 A;  5D5V B;  5BPI A;  2CGP A;  4Q4Z F;  4KNY A;  5HLG A;  3MAJ A;  4WXH A;  5LHI A;  2DK5 A;  4KT5 C;  2GAU A;  1S3J A;  3FMQ A;  5LGU A;  1J0R A;  5LLQ A;  4HQM A;  1OKR A;  1F5T A;  3ECH A;  4ON0 A;  4A0X A;  3WTW C;  2FSW A;  1PDN C;  2P8T A;  5JFR A;  1HBX G;  3ZMS A;  2EJR A;  2YPR A;  4BAY A;  3I54 A;  4KUM A;  4LB6 B;  3R61 A;  1QO0 D;  2BGC A;  1T98 A;  3J7A O;  2VBZ A;  4KA4 A;  3U1D A;  4JK1 X;  1G3W A;  2GA2 A;  1TW3 A;  4MTD A;  1B4A A;  3CTA A;  2HS5 A;  1SD4 A;  3I5U A;  5F64 A;  3SZT A;  1R1T A;  3SFZ A;  3ELK A;  3V7S A;  4OIN F;  3VFZ A;  1TLH B;  3DV8 A;  3WTY C;  1G6N A;  1FP1 D;  5D4S A;  1K7A A;  3KLN A;  2HWV A;  5F1R A;  4PDK A;  1KU7 A;  2LDU A;  4ZYD A;  3HRU A;  4HZF A;  1U8R A;  1QNT A;  3WU0 A;  2IRF G;  2V1X A;  4I0A A;  4HV5 A;  3HUG A;  3BDD A;  2DPD A;  1KU9 A;  2EB7 A;  3FHZ A;  4B09 A;  3GWZ A;  5D5W B;  4YG2 F;  1ZG1 A;  5AIP A;  2XAG A;  2EFN A;  1S7A A;  1UB9 A;  3GO5 A;  2M5W A;  2VT3 A;  2XAS A;  4LMY A;  3NQO A;  2OZ6 A;  4KIB A;  1O3T A;  1LVA A;  2X0L A;  2D2W A;  2EK5 A;  4I01 A;  2G9W A;  2HKO A;  4I7H A;  5LRS A;  4GCV A;  4O5V A;  1TQP A;  1CF7 B;  3D0S A;  3E6C C;  3WGI A;  1XGO A;  2OD5 A;  3F8N A;  5KK1 A;  1FC3 A;  4RAY A;  1FY7 A;  1SFE A;  1T6S A;  4E70 A;  2QWW A;  3P9C A;  5TJJ A;  2YX7 A;  4ESF A;  2F5D A;  4EV0 A;  2Z33 A;  4YFK F;  4CYD A;  1SMT A;  5CVU A;  4U0Y A;  1ZLJ A;  3L00 A;  3BY6 A;  3KFW X;  4EGZ A;  3WE3 A;  4UV8 A;  2Q2E A;  3D5L A;  5ILS A;  1YS7 A;  3M9A A;  1MGT A;  5EEG A;  4G9Y A;  1MZB A;  5E1Z B;  3T0Y A;  1EH6 A;  3GFL A;  5D4R A;  3F72 A;  1OMI A;  5L3B A;  4HW0 A;  4IHT A;  5DCF A;  2DPU A;  2HR3 A;  3LQQ A;  1XSV A;  4HV6 A;  1DP7 P;  1Q1H A;  3O3K A;  1IUY A;  2Y0M A;  1LNW A;  3ZQ7 A;  5JI6 A;  4PZJ A;  2Q0O A;  1LQ1 A;  3QU6 A;  1IF1 A;  4U88 A;  4CGZ A;  2OAZ A;  4RB3 C;  4M9Z A;  4MQV A;  2UXX A;  3DKW A;  1YW7 A;  4NB5 A;  1SMY F;  3RKY A;  5DD4 A;  3TDZ C;  3U9G A;  5DYM A;  1QQI A;  5LHG A;  1T2K A;  1KQ9 A;  3I59 B;  3IC7 A;  3EDP A;  1R7J A;  2ADU A;  2L4A A;  3F8B A;  2P5L C;  1B6A A;  1TTY A;  4JBA A;  4CZZ A;  4WK8 F;  2H27 A;  2FF4 A;  3DPT A;  1W7P B;  3KET A;  2A3S A;  1ULY A;  2RGV A; 
#chains in the Genus database with same CATH topology
 3OYF A;  2Q8K A;  1O3S A;  3G2B A;  1LDJ A;  5DS9 A;  2KIM A;  1GDT A;  1V5F A;  1S7O A;  1TT0 A;  3I0T A;  2HVQ A;  3FM3 A;  3KE2 A;  1SFK A;  2HGC A;  5CQE A;  5FO5 A;  3F9K A;  1REP C;  1D8J A;  2IT0 A;  1WH5 A;  3JAM Z;  2NVQ J;  3KYL A;  3R0A A;  1CF7 A;  2KJB A;  4AYB A;  2FOW A;  3E5X A;  4KMF A;  2X6Y A;  1HW1 A;  4ZDO A;  1BR4 A;  2VXD A;  5CVR A;  3HRS A;  4HNT A;  3VDX A;  5IYB J;  3MKZ A;  2HQ5 A;  4OU0 A;  1JKR C;  2ZME A;  4Y52 J;  3FBI B;  2V9V A;  4P9U A;  5IYD J;  5C3E J;  3HHH A;  1BW6 A;  4B4C A;  5FLX Z;  3WOD F;  1CGP A;  3HB9 A;  1ZLK A;  3RKW A;  3DLL F;  1EV7 A;  1G3T A;  2WAQ A;  4A6E A;  2HYF A;  1O7F A;  3R60 A;  1R00 A;  3A2K A;  2FD5 A;  3JTG A;  1ODD A;  1YJ9 I;  2MH2 A;  1VI0 A;  4XR6 A;  4OIP F;  3BWG A;  2CW0 F;  4XON A;  1TZL A;  4EJV A;  4BU2 A;  3I56 I;  2DFH A;  4G6Q A;  4HLX A;  1IJW C;  1LFP A;  3EYI A;  1IRG A;  3V8J A;  4ENJ A;  4RB2 C;  1L3L A;  3QU3 A;  2VOP A;  1UCR A;  3OIQ A;  2OV7 A;  3W6V A;  4UXN A;  1X1B A;  3GLL A;  5LEJ A;  4YEJ A;  2GWR A;  5M5X J;  4E7J A;  1BIB A;  2FQ3 A;  2RQP A;  1MBF A;  1WJB A;  3GEZ A;  1E0E A;  4HQE A;  1J9I A;  5FKL A;  3GZ6 A;  2EIN H;  3G3Z A;  3CCS I;  2FNP A;  2COM A;  3KP4 A;  4DNC A;  2E5Z A;  1U5T B;  2BY2 A;  1R49 A;  4BXF A;  2QBY A;  1FBU A;  2VJ5 A;  2XUB A;  3E7L A;  1LEA A;  5LEK A;  1R5I D;  3QYB A;  3CC7 I;  3CO6 C;  1XX5 A;  5IOY A;  2WWY A;  3Q5F A;  5FD6 A;  1QZY A;  1X4P A;  2VQL A;  3Q0V A;  2X6W A;  3KIO A;  1HA8 A;  4II2 A;  3QP5 A;  4U0W A;  3JRE A;  1WVR A;  4KIS A;  2YS9 A;  3HYI A;  2B9S A;  2A5Y B;  5KVR A;  2RC4 A;  1YIT I;  4W97 A;  1EH8 A;  1W7P A;  1HDP A;  1RC9 A;  1UZC A;  1XGS A;  1RNL A;  2A68 F;  2BBY A;  2MH9 A;  4IX7 A;  3RYP A;  3MKY B;  2ZFW A;  4HF1 A;  4C3I J;  2ZB9 A;  3K4N A;  3KEY A;  1YW9 A;  4M72 A;  2TDX A;  4ANJ A;  2OUM A;  1TWA J;  1ZEL A;  2CU7 A;  1YRN A;  1RET A;  2FRH A;  3PIP F;  3PM1 A;  4YEL A;  3FHN A;  2QSH X;  3BG9 A;  2CUJ A;  4HX7 A;  4EAT A;  2DA5 A;  1F43 A;  2WV0 A;  4A3J J;  1OJL A;  1MJ9 A;  3OSG A;  4ASN A;  2ZKZ A;  1TW2 A;  1NHA A;  2BXZ A;  3RKQ A;  4RBO A;  1Z77 A;  4HDU A;  3RQ4 A;  4M3G A;  5AON A;  3W6K B;  2A61 A;  3MEX A;  2ESN A;  3KP3 A;  2KZV A;  3WHC A;  5GAG J;  3A01 B;  4CSW A;  1R71 A;  1NK2 P;  4A5N A;  2BVL A;  3GTK J;  1AKH A;  2ZJP F;  3TGN A;  3K1N A;  3F22 A;  1ZTR A;  3CLQ A;  1OR7 A;  4IF4 A;  4ZDP A;  5CLS A;  1MDM A;  4DQ2 A;  2XF6 A;  3F6O A;  1M1E B;  1HKQ A;  5EEH A;  1P4X A;  3ABK H;  3RZO J;  2HOS A;  2DAO A;  4NQW B;  3Q3S A;  1GUU A;  1X1C A;  2Z16 A;  2VKH A;  3BTC A;  2FBK A;  4NUB A;  4LGW A;  2BVM A;  5K7Z A;  5JVT A;  2LLK A;  5FGM A;  3FWE A;  4F55 A;  3JTH A;  1Y1W J;  2D5V A;  2DU9 A;  5GAD J;  2DQR A;  1PUF B;  3QRF F;  3GX4 X;  1FYL A;  2WB1 N;  4IOC F;  4IO9 F;  1GVJ A;  3L2C A;  4BGD A;  2FE3 A;  1VZ0 A;  2DOE A;  3WTT C;  5B1A H;  1LFB A;  1BI3 A;  4I0B A;  2IS4 A;  2IXS A;  2KT0 A;  5K7H A;  3OYJ A;  1FWZ A;  2KPM A;  3Q9S A;  4JYK A;  1N75 A;  1MW7 A;  2AXL A;  1XCV A;  1RPW A;  3J80 K;  1LPQ A;  3LSM A;  1BR2 A;  3TQN A;  4ZTF A;  2L9N A;  2LOO A;  3F0C A;  1TP4 A;  4WXD A;  4D5C A;  3BG6 A;  2PG4 A;  2H6C A;  1BA5 A;  4A3D J;  3BOQ A;  2Y48 A;  3JRB A;  3PO3 J;  1YIO A;  4R8H A;  4BH9 A;  3MMY B;  3CCV I;  5HNF A;  2E1M B;  2EFQ A;  5IT9 Z;  3RYR A;  4BXX J;  3FX3 A;  4XLF A;  1VND A;  2I10 A;  2PJP A;  5KAF C;  4P96 A;  1U2W A;  1FMW A;  3FDY A;  2HDW A;  2LRE A;  3T1B A;  3KEO A;  4E4H A;  3CC4 I;  5E17 F;  1FIP A;  1ORK A;  4S05 A;  4RGU A;  5CVJ A;  3SDB A;  4A3E J;  2KKO A;  5HOO A;  3WG9 A;  2VJI A;  3OYE A;  1FSE A;  3NAR A;  2PEX A;  1ENH A;  2BEO A;  4MFE A;  1G8X A;  1LE8 B;  2EA2 A;  4XBF A;  4E7S A;  3EUH A;  3FXO A;  3KP6 A;  5DV5 A;  2QA4 I;  3C18 A;  4IHV A;  3BG5 A;  2R4G A;  2CQN A;  3LMM A;  2MYS A;  1P4A A;  1BBY A;  1Z0X A;  1D0X A;  1FEX A;  1ONV A;  3DF8 A;  2DN0 A;  1YI2 I;  2DOA A;  3ONQ A;  4UV9 A;  4M6Y A;  2Z9O A;  1WI9 A;  1R4N B;  1A04 A;  1FX7 A;  2CV1 A;  4EGY A;  1MMN A;  1KA8 A;  1VF9 A;  4EJT A;  4L9T A;  2WB1 A;  2OQR A;  4BL0 B;  3DBL B;  1S72 I;  2MA3 A;  4XRF A;  2K9L A;  3C2H A;  3BCA A;  2F48 A;  1A6I A;  2WY8 Q;  3MZH A;  2PN6 A;  1X2N A;  3S1R J;  1X2M A;  3ROU A;  3RI4 A;  2DYS H;  1J59 A;  2Q2E B;  2F4O B;  3UR3 C;  5BNG A;  4BS9 A;  5J1Y A;  1VFC A;  4BHC A;  3FMR A;  2ID3 A;  1KYW A;  3OWT A;  1JE8 A;  5J40 A;  2M0M A;  3B73 A;  3G6E I;  2H1L A;  3GBG A;  1R5H A;  2KDZ A;  1XD7 A;  5ICF A;  4KJZ A;  3ZMZ A;  4BBR J;  3HHG A;  4M3F A;  4B8X A;  1Y8Q B;  4AWX B;  3HBL A;  3J7Y J;  4P5O A;  4XL9 A;  4G12 A;  2YR2 A;  2JVG A;  1U9N A;  2CQ7 A;  1O57 A;  3VYU B;  1TC3 C;  3HM5 A;  2ISZ A;  5GAH J;  1WJA A;  4BNC A;  3S3O A;  4D9J A;  3SEZ A;  2G7U A;  1F9N A;  1RUN A;  1X3U A;  4DYC A;  2QCO A;  1D1C A;  1QZE A;  4Y15 A;  4BYY A;  5L3G A;  5BS6 A;  3A03 A;  2L02 A;  4HLY A;  1A31 A;  4IHY A;  1FOW A;  2WAD A;  3HOX J;  3LSP A;  3J7Z I;  1EA3 A;  2VJJ A;  1A36 A;  3TOB A;  4XMY A;  4CCN A;  3PUF A;  4IHW A;  4YRV A;  1TNT A;  1XGN A;  2A6E F;  4BE2 A;  2VAS A;  3OMY A;  2M7B A;  3FXR A;  1APL C;  2UZK A;  4ESB A;  1YG2 A;  1Z05 A;  2MAB A;  4ETS A;  3GW2 A;  1R1V A;  4QWQ A;  2ELK A;  2OQG A;  2QF7 A;  4BUP A;  1EJ9 A;  5GPA A;  4KDP A;  4BKX A;  2IJL A;  3DTK A;  4A3I J;  2O3F A;  3AAF A;  4B48 A;  1H0M A;  3VWB A;  1LJ9 A;  3GXO A;  5HS9 A;  3DEW A;  5JHU A;  2NXN B;  2XAJ A;  2Z1D A;  4XK4 A;  3R6S A;  3SJM A;  1Y0N A;  1K6Y A;  2HZT A;  3ERE D;  1NK3 P;  2DA1 A;  2UXN A;  3KZZ A;  2VIX A;  4ESJ A;  5EZG A;  3QPT A;  3HSF A;  1U0J A;  3CLO A;  2PLY A;  4RLQ A;  1R6R A;  1WZ2 A;  3HPG A;  2F4M B;  1JHH A;  3C7J A;  1OYW A;  2PMU A;  1HC8 A;  2DOD A;  2L9V A;  3BLY A;  4F93 B;  2WAQ N;  1R36 A;  2FJ1 A;  1GLN A;  5E1X A;  2MG4 A;  2W00 A;  4YIR X;  2ETH A;  4LK1 F;  1POG A;  2XSJ C;  3EUH C;  5ERI A;  4D0P A;  4M3D A;  2IA0 A;  5KCM A;  5C4J J;  3J80 Z;  3IAS 2;  3CCM I;  6PAX A;  4I99 C;  1MDM B;  2DFF A;  4HG2 A;  1H89 C;  1FIA A;  2NOJ B;  4TV7 A;  3K2A A;  4CHU A;  2WTE A;  3CP8 A;  2CUE A;  4B47 A;  4DW6 A;  2LD5 A;  1JKO C;  1YJN I;  3EUA A;  5FJ8 J;  4ZZD A;  2CSO A;  1I6X A;  2EZI A;  1S8N A;  3DPL C;  2F4I A;  5FRO A;  1LUJ B;  3HRT A;  4XLH A;  4UNO A;  4M71 A;  3M07 A;  1G59 A;  5TGT A;  2K3F A;  5EGO B;  1FLI A;  3FZV A;  4S04 A;  1K6O A;  3A01 A;  1W36 D;  3K1P A;  2V6E A;  1YE9 A;  3WGH A;  2GM4 A;  2O03 A;  2QSG X;  1Y8R B;  3FXQ A;  1J5Y A;  3CCE I;  4KFC A;  2ECC A;  2M4K A;  4N9I A;  5F6F A;  2QQ9 A;  1V5G A;  2HPM A;  2TRT A;  1W5T A;  1ZR2 A;  4AUX A;  1V3F A;  3ZP5 A;  1JJ8 C;  1DU6 A;  2V1D A;  2L01 A;  1KU2 A;  2CW8 A;  2BZT A;  4OMY A;  1BN5 A;  5H6Q A;  3TP0 A;  1MMG A;  5K7F A;  1BW5 A;  4ENN A;  1BIA A;  3HSR A;  1SVM A;  3VOD A;  2JZY A;  2VON A;  2R7Q A;  2LSO A;  2X4H A;  3CD6 I;  1RKT A;  2ZXW H;  1RR7 A;  4NNJ A;  2LNB A;  2EFO A;  1BM9 A;  3OS0 A;  2OTL I;  1K78 A;  1V54 H;  3RCO A;  2HYJ A;  4A12 A;  2A69 F;  1U3E M;  1E3H A;  3OS1 A;  5ILV A;  3BQZ A;  3H5A A;  2WC2 A;  4HX4 A;  1FSH A;  4X1E A;  3ZQI A;  1RES A;  2FU4 A;  2VN2 A;  1YIJ I;  3E1S A;  1OPC A;  2FXA A;  1U5T A;  1AHD P;  2Y0S A;  4IOA F;  2W84 A;  4RAZ A;  1VQL I;  3LSI A;  1JTX A;  2P7V B;  3CJN A;  1OFC X;  3S32 A;  1QA6 A;  3T5X A;  2XPW A;  3CDH A;  3HOT A;  2H8R A;  1F36 A;  2VUM J;  2RRE A;  2OA4 A;  2XAH A;  4IHX A;  4A3G J;  2B0L A;  3FIW A;  4P55 A;  4GXO A;  4F7Z A;  3I58 A;  2XPV A;  2JN6 A;  3PL8 A;  4OAY A;  2FML A;  4RM2 A;  1SVL A;  3TW6 A;  2DA4 A;  3S2D J;  4KN4 X;  2DLL A;  1UAA A;  3DU6 A;  2GZW A;  3LA2 A;  4GO1 A;  3GTJ J;  3I53 A;  1GHC A;  1HSJ A;  4BQO A;  3W6J B;  2X48 A;  3HRM A;  1SAX A;  2V26 A;  3TDU C;  1MBJ A;  1X1D A;  4O3M A;  1B8I B;  3CUQ B;  2RN7 A;  1WHU A;  3JRC A;  3O8H A;  3TO7 A;  4X0G A;  4E6K G;  4M9S A;  1YYV A;  4AIK A;  3OYH A;  4U0V A;  2YU3 A;  3MZ8 A;  1H9T A;  5J6X A;  4LB5 A;  2NVU B;  4XIC A;  1DP3 A;  5HDK A;  3KCC A;  3KEQ A;  3WTU C;  1GXQ A;  3SZP A;  4DYQ A;  1IN6 A;  3GZN B;  5DM6 F;  4L0Z B;  1A35 A;  2HKX A;  3RSN A;  3V42 A;  2E2I J;  4L9J A;  4YIF A;  2EZH A;  4XN3 A;  1ZN2 A;  4M74 A;  2F5F A;  3NWS A;  3AFH A;  3Q9V A;  3FKJ A;  4V19 K;  4CXF A;  1FOX A;  2XRN A;  3WTV C;  5HLI A;  2HYG D;  1I5Z A;  5IP6 A;  3BZC A;  1IDZ A;  3QOE A;  3DEU A;  3GTP J;  2IS6 A;  4MQ9 F;  1G3Y A;  3WG7 H;  4ZC3 A;  1Q1V A;  4N4O B;  1J75 A;  4N0B A;  1Z21 A;  4IQJ A;  2ZXI A;  3OL3 A;  2DT5 A;  1R58 A;  4XKW A;  2L3D A;  3ZQQ A;  1G4D A;  1I1G A;  2M1B A;  2Z2S B;  3V8L A;  3F21 A;  1FJL A;  4B3X A;  2J5O A;  1WQ2 A;  3CCU I;  1G2H A;  3KPH A;  3EET A;  1YX3 A;  5JLW A;  3CQZ J;  3L7W A;  2HQN A;  3AG4 H;  1D0Z A;  2R7S A;  4F91 B;  4Z6Y A;  4HNV A;  1TWC J;  2NNN A;  5K5Q A;  2HDD A;  4C2T A;  2R5Y A;  1MH4 A;  1H9G A;  4Q47 A;  1P9Q C;  2GIV A;  2HPI A;  5DEQ A;  3VSL A;  3A1Y A;  4LLN A;  3GYH X;  1EKE A;  5DUI A;  4A3C J;  3CDI A;  2JK3 A;  4HAM A;  2QEN A;  1K78 B;  5JHF A;  1WPK A;  1Z67 A;  2KQR A;  1JT0 A;  4PJ0 C;  1YTY A;  2A5W A;  1SFU A;  2KRC A;  2LR8 A;  2L5Q A;  1D8K A;  3IWZ A;  2NS0 A;  5K5O A;  2F5C A;  3S3N A;  3HSE A;  3LAJ A;  1XGM A;  3SHF A;  3EQL F;  1YW8 A;  1I3A A;  4BHP A;  2DI3 A;  5IT9 K;  2FX0 A;  1W7P D;  2V9P A;  3LFK A;  2VB6 A;  4P9F A;  3GFJ A;  1QVU A;  1WJ5 A;  3CO7 C;  2R93 J;  3TMO A;  3K7A J;  2DDB A;  3IWF A;  3QOP A;  3ZQF A;  3ZMV A;  2O9L A;  1QHG A;  2VC0 A;  4DYR A;  2DMP A;  2VBX A;  4QIW N;  5M3M J;  2VPR A;  4UB6 C;  1O4X A;  1NG7 A;  1FBS A;  3E3V A;  4N9H A;  3E5U A;  4C3H J;  2XAF A;  2CQK A;  2WA0 A;  1NG6 A;  3K70 D;  5H6R A;  3GFM A;  3V7R A;  3H92 A;  3D5S C;  2Y75 A;  3DWL E;  2P7C B;  3E5Q A;  3HTS B;  4PFP A;  2M45 A;  1ZGW A;  3RPU D;  2W48 A;  3JCU C;  4OWR B;  1LDK B;  1TWH J;  2H8W A;  4U87 A;  2Y31 A;  1R1U A;  3D5R C;  4LJZ F;  1P92 A;  4D7N A;  2VQC A;  4FET A;  2ZJR F;  5IY5 H;  4HX8 A;  3KYC B;  4HDV A;  1HDD C;  1ZAR A;  4I2O A;  1ZAO A;  2M3A A;  2X6O A;  2HOT A;  1T56 A;  1SEU A;  1FMV A;  1T38 A;  2V6C A;  2XAU A;  4MEY F;  1SVO A;  1KON A;  1WJD A;  3OYA A;  2VOO A;  2V1U A;  1S29 A;  4HF0 A;  1HLV A;  4PK4 A;  4LLG F;  1SFO J;  5CQG A;  1Y1V J;  1FYK A;  3K4K A;  3W3C A;  3ERM A;  5IT3 A;  2HDC A;  3TP3 A;  3G1O A;  3WTZ A;  4AIJ A;  2KJC A;  2QQB A;  2E1O A;  4U7B A;  3BZK A;  2CJJ A;  3BJO A;  2Y30 A;  4HNU A;  4QLC U;  4G6D A;  2E1M C;  4MLO A;  1I1S A;  1JGG A;  2E7X A;  5H20 A;  1XB4 A;  4WX9 A;  2L9R A;  4FCY A;  4KN7 X;  4BQQ A;  2Z99 A;  4IPA A;  4IJA A;  3RJP A;  1XSD A;  2E2H J;  1KZH A;  2VC1 A;  3L2W A;  5IP7 J;  4XM3 A;  4BEH A;  1I6H J;  2QVO A;  2XHK A;  4A2U A;  4PJL A;  4WXC A;  2CO5 A;  3N97 A;  3QPL A;  3H35 A;  3BR2 A;  3CDL A;  3MZY A;  2ELH A;  1WWX A;  3M4O J;  5FKN A;  2IPQ X;  2IGO A;  3P7N A;  1W4M A;  3F6V A;  3GVA A;  3ABU A;  2CRG A;  3N05 A;  3O2P E;  4Z2Y A;  5ED4 A;  3PSI A;  3P9K A;  2DFE A;  1QRY A;  2HI3 A;  4MGR A;  4EQQ A;  2WBM A;  1UFM A;  3CF2 A;  3GLX A;  4KIT B;  3RZD J;  5D5X B;  3ABM H;  5D8K B;  2LRD A;  3FXU A;  3A0H C;  3L1P A;  3SZG A;  3AG2 H;  3X2Q H;  1UJ8 A;  3M8F A;  2CUZ A;  4PCQ A;  2DXI A;  3G1M A;  2OF7 A;  3KP5 A;  1MBK A;  3HOV J;  2HQR A;  1VQP I;  3LSK A;  5KNL A;  2KIF A;  2E60 A;  3W2W A;  4J01 A;  1DQU A;  2BYV E;  1XMX A;  4HA8 A;  4KYW A;  2JA8 J;  3DCF A;  4RAF A;  4JQF A;  2X1E A;  3NRV A;  3OIO A;  1XDS A;  2NYX A;  2J5P A;  2RDP A;  4C2M J;  2DTZ A;  2UV1 A;  3DLA A;  3IH3 A;  2BY1 A;  2VQH A;  2JTV A;  2Z3Y A;  3U1K A;  3LA3 A;  1ZH5 A;  4OOI A;  3FBN B;  5HDN A;  4FX4 A;  3VOE A;  1X3Z B;  4HF2 A;  3CUQ C;  2NOG A;  1ETV A;  2X85 A;  1SAU A;  1R5G A;  2EWN A;  1QZZ A;  3BTJ A;  3H9Q A;  5DTD A;  3ZGK A;  3S1M J;  3RTR A;  1P7J A;  4G7H F;  2K40 A;  2LTP A;  5F1J A;  2AQF A;  3BR1 A;  2CFO A;  2YUS A;  2FMY A;  3GTL J;  4PGH A;  3CMY A;  4RGS A;  4OIO F;  3K4C A;  4EMS A;  4XOP A;  4EM2 A;  1PYV A;  2EZK A;  3F8C A;  1LE8 A;  3LQR A;  4EEF G;  1MND A;  1VQ6 I;  5EDN A;  1JGS A;  3S17 J;  2DK8 A;  4NC7 A;  1YJW I;  1ZRC A;  1MSF C;  3T8R A;  2DYR H;  2BV6 A;  2XPU A;  3OYK A;  1IC8 A;  2K5C A;  3SEQ A;  4L9V A;  2JRT A;  3L09 A;  4UY8 I;  2CV2 A;  2XGC A;  2K4J A;  4CDG A;  2DCE A;  4BE0 A;  3HOS A;  3SDG A;  2VXZ A;  5FFZ A;  1RZ4 A;  9ANT A;  1VQ4 I;  3BP8 A;  3GME A;  1ETK A;  5J8C A;  2A07 F;  3ABL H;  1A5J A;  3PFI A;  4RGR A;  4XRM A;  1STZ A;  1LVK A;  3LFU A;  2AS5 F;  2PMH A;  3I4N J;  4LLL A;  1Z7L A;  4AVP A;  2W25 A;  4PFO A;  2K4B A;  4M6V A;  5CJ9 A;  2Q1Z B;  3E0J B;  5LFA A;  2AQE A;  3BZ6 A;  4IQ4 A;  2PBI A;  3M7G A;  4E7K A;  3LAP A;  2IBD A;  3IRQ A;  2R7F A;  1HOM A;  4IXA A;  4XN0 A;  2VE9 A;  4QSH A;  1R9T J;  3PIO F;  5D6E A;  1L0O C;  2CQX A;  5M3F J;  4LG3 A;  3DBR B;  3IL2 A;  1YS6 A;  2R3S A;  2R0Q C;  1X58 A;  1ZGA A;  1XCB A;  2R7T A;  5BPD A;  1D3Y A;  2E1C A;  1P2F A;  2V79 A;  3HKZ N;  1JKQ C;  4I98 B;  4ZYE A;  3O6B B;  4L9N A;  3DKY A;  3V8K A;  1HKT A;  5HVQ C;  2R7U A;  3EUK L;  1HCR A;  4BHB A;  2M8G X;  1E2X A;  4FQG A;  5L3D A;  1O3Q A;  1DUX C;  2QLZ A;  1W0U A;  3PNV A;  2K86 A;  4CCJ A;  2CFX A;  4RS8 A;  1LB2 A;  1GV2 A;  2K7L A;  2QQ8 A;  4PGG A;  3GTQ J;  1MBH A;  4Q48 A;  1DDN A;  4HBL A;  4YFX F;  2QKM B;  3O8G A;  3TOA A;  2FQ4 A;  2W57 A;  3HGY A;  1IV8 A;  2KZG A;  4XLC A;  3JSO A;  2R5Y B;  2H94 A;  1WGX A;  2XF7 A;  2CG4 A;  2ECB A;  5CPR B;  3H3V K;  2L9S A;  1AU7 A;  2QYO A;  4I02 A;  5J3L A;  4Y13 A;  1P6R A;  2EFP A;  2MD5 A;  4XSZ F;  2JSC A;  2RQQ A;  1IZ1 A;  3A4C A;  2P6S A;  2A05 A;  3C3W A;  1JJ6 C;  3QAH A;  2CS3 A;  2P81 A;  4WF2 A;  1W36 C;  2FOK A;  4UVB A;  4F3Q A;  4XNF A;  4ZDL A;  4B43 A;  4ENK A;  1J09 A;  4IRI A;  2EFW A;  2R5Z B;  1GXP A;  2BE5 F;  3L2U A;  1VQO I;  1PP7 U;  3SFI A;  2QEX I;  1FTZ A;  4K2E A;  1VQM I;  3CES A;  1ZK8 A;  2B7E A;  3HIF A;  3OR1 C;  4XKC A;  3I4M J;  2M30 A;  4EM1 A;  2ZJ2 A;  1QU3 A;  2O61 A;  4UUT A;  2Y9Y A;  1AWC A;  2HEO A;  3DFG A;  3K10 A;  1PUF A;  1FPQ A;  1Y56 A;  1NH3 A;  5K1Y A;  1UG0 A;  5DCM B;  4E7L A;  4I76 A;  3TW7 A;  3KP7 A;  3CCR I;  2GOX B;  1S5L C;  2MGQ A;  3HTU A;  4ZJZ A;  1SFX A;  5E1W A;  2XGE A;  3L9F A;  3HPH A;  3TL4 X;  4CIC A;  4BJ6 C;  3AL0 C;  2VI6 A;  3FXL A;  3DTI A;  4BXU A;  1U8B A;  1ETO A;  1B1B A;  4ZYH A;  4MTE A;  4XLA A;  2LP0 A;  4Q5S F;  1KU3 A;  2FEZ A;  4UB8 C;  5EZH A;  3JAM K;  2IP2 A;  3QYF A;  1VQ5 I;  1IUF A;  5LGN A;  4E7H A;  1BJA A;  4A0Y A;  5M5W J;  5JR3 A;  1R22 A;  1XMK A;  3TBI A;  1HW5 A;  5L3F A;  3AG3 H;  3TKY A;  2EPF A;  2IVM A;  3F8F A;  1QBJ A;  4L5E A;  2IGM A;  2FUG 2;  2GXB A;  1ZRF A;  2VKD A;  2PFB A;  3L2V A;  3S93 A;  4EJU A;  1ZHF A;  1CQT A;  2RVC A;  1FTT A;  4FHT A;  4JX6 A;  1K4S A;  2EH3 A;  2FA5 A;  2ZME B;  4R79 A;  5IP9 J;  1ZKG A;  4CO8 A;  5A2Q Z;  1F1Z A;  2EA4 A;  3UNG C;  5FB2 A;  4AIH A;  3QPH A;  2GXA A;  5HLH A;  3NEU A;  2M87 A;  4HST A;  3GTG J;  2D1V A;  3OYD A;  4M73 A;  5LGT A;  2LK2 A;  2COB A;  4FT8 A;  5CVI A;  1WRJ A;  4HRI A;  3AKZ A;  2ACJ A;  1IXC A;  1WJF A;  5F0C A;  4Y7N J;  2NNY A;  1B72 A;  1WSU A;  2FBH A;  3CJQ B;  5FD5 A;  3JRI A;  3J81 K;  1TBX A;  3GUD A;  2CMP A;  4IRH A;  4Y17 A;  4ZH4 F;  3NWT A;  2YSR A;  2EV6 A;  2TCT A;  4HSR A;  1SAN A;  3M8J A;  3ZQL A;  4PSX A;  1SC7 A;  1U78 A;  4AD9 A;  4BAC A;  1HW2 A;  1ERD A;  1SD6 A;  2DT6 A;  2NVX J;  3QP6 A;  1AA7 A;  2K9N A;  4IKF A;  1MMD A;  4ZZL A;  3CCQ I;  3U21 A;  1BR1 A;  2R7D A;  3GF2 A;  1UMQ A;  3MWM A;  3QWL A;  1MMS A;  5J8F A;  1BI2 A;  3GZ5 A;  3IH4 A;  2JPB A;  5E20 A;  2D1H A;  5EF6 A;  3P5J A;  2PQ8 A;  3IKV A;  1VQ7 I;  5E3L A;  4UUV A;  4EJW A;  3JRH A;  3CCJ I;  1JXS A;  3CJR B;  2XKP A;  4OMZ A;  2RAE A;  4BY7 J;  2H09 A;  2ZCW A;  3H1C A;  3OV8 A;  4L5I A;  4X6A J;  1IN5 A;  1B9N A;  2RNJ A;  3FXM A;  2KIQ A;  3F23 A;  1YLF A;  3ZQC A;  3V4G A;  2UUZ A;  1ZQ3 P;  1B59 A;  4XOT A;  1HKS A;  3KX2 A;  4KIG A;  3G4S I;  1OCZ H;  2W24 A;  5FFX A;  4XRS G;  2E2J J;  2KLO A;  3Q0W A;  4XKV A;  4BY1 J;  1EF4 A;  2M2E A;  2VKV A;  3BTI A;  2K9Q A;  1HXD A;  2QQA A;  5HDG A;  1FNN A;  1OCR H;  5DCM A;  3ML6 A;  4WCG A;  1TQI A;  2DBB A;  1SD7 A;  3ZPL A;  3IUO A;  2X6X A;  5FKK A;  2MLK A;  2CQQ A;  2L4M A;  2HNH A;  1ZR4 A;  2VBW A;  2R7X A;  2JQ7 A;  3HOU J;  2LKS A;  2P4W A;  3KZY A;  3MD2 A;  4DJA A;  4G8X A;  5F0H A;  3MKW B;  3HL2 A;  2QZ8 A;  3ZMD A;  1O3R A;  3BJ6 A;  2DDA A;  1IXS B;  2CW7 A;  4QPO A;  3BC8 A;  4DIQ A;  5C4X J;  1IAW A;  2GOM A;  1MBE A;  5IOZ A;  3BPV A;  2CWE A;  4P1W A;  1MH3 A;  2OZU A;  3CCY A;  4G94 A;  3OOP A;  3J81 Z;  1YQA A;  3I59 A;  2IGK A;  3H3U A;  3I4P A;  1JTY A;  2GQQ A;  2DA2 A;  2LKX A;  2MBF A;  3CJT B;  2XGD A;  3ABT A;  2IW5 A;  2XIG A;  3HOZ J;  2OU2 A;  1QPM A;  2HFH A;  5GAE J;  1U5T C;  3QYE A;  1ZG3 A;  5E18 F;  1T8I A;  4Y3O A;  3ZRG A;  2JA7 J;  4MNU A;  3EYY A;  2KL4 A;  1S6L A;  5J4Y A;  3HOW J;  5B5E C;  3RIR A;  1I50 J;  2HTS A;  1J2X A;  4U7D A;  1O7L A;  2AXT C;  5JLX A;  2PI0 A;  1PUE E;  4I09 A;  5HS7 A;  5ICC A;  4R1H A;  2XC7 A;  2E7W A;  3K70 C;  4RAG A;  2XRO A;  3TED A;  1YOV B;  5D6F A;  4NBQ A;  1HST A;  3I9V 2;  2ICW G;  2QM3 A;  2CYY A;  2VT2 A;  3LOC A;  2JPC A;  5ICG A;  3FF5 A;  4KIC A;  1T39 A;  3TO9 A;  5DUK A;  3HOY J;  3VYS B;  5L3C A;  3BR3 A;  2HTJ A;  3S16 J;  2O7O A;  3HG9 A;  3HGG A;  1Z3Y A;  4FE7 A;  4DBR A;  1TWG J;  3E6D A;  1IV6 A;  1VQ9 I;  3IP4 B;  3CUQ A;  3UKG A;  2V7F A;  2BHY A;  3K9T A;  3K0L A;  2MW8 A;  1EH7 A;  4UUS A;  2K3P A;  5FRN A;  1USS A;  2DFI A;  2R5Z A;  3IRR A;  2E19 A;  3GFI A;  4L18 B;  5EG0 A;  3OL4 A;  4D7M A;  2AHQ A;  1ETY A;  2QKL B;  3RPU A;  2ZFU A;  4L5J A;  2E5N A;  3OOU A;  3GTO J;  1N78 A;  4JOM A;  4UHT A;  2L0K A;  2HQA A;  4L0Y B;  3GTM J;  3OYI A;  1TT5 B;  5E3O A;  2ZNZ A;  1P4W A;  4CCM A;  4A0Z A;  1X4O A;  2BOL A;  2NS8 A;  2STW A;  3BR6 A;  4UUS B;  5DM7 F;  1VQ8 I;  1BJZ A;  3F8M A;  3M8E A;  2DMT A;  2MSY A;  3JSP A;  2LH9 A;  2X1D A;  1IG7 A;  2O6G E;  2VL8 A;  5BQT A;  1E3P A;  1XC5 A;  1DPR A;  3LST A;  2EZL A;  1JKP C;  1Y0U A;  4GRI A;  4PJN A;  4B1R A;  3CC2 I;  1RKW A;  1LKX A;  2W85 A;  2LKP A;  2FNA A;  2ZSH B;  3Q0U A;  3OYN A;  2A6H F;  4NHJ A;  3S15 J;  2K85 A;  4XRS A;  3H0D A;  2HVS A;  2L7Z A;  4XLN F;  3FIS A;  2DO7 A;  1K83 J;  1JUP A;  1DGW Y;  5TRD A;  4G7O F;  3LSR A;  3WHB A;  2GIZ A;  3P9I A;  2IAI A;  2W4S A;  1RIO H;  3W2A A;  1BI0 A;  2GA1 A;  2XAQ A;  2ZBK A;  4AU7 A;  1HF0 A;  1RUO A;  1WH7 A;  2M7A A;  4JP0 A;  1MNE A;  2LVS A;  3JRD A;  1Z6T A;  3ZR8 X;  1IO2 A;  1ETX A;  4GYG A;  1KYZ A;  2CUF A;  3CUO A;  3DXJ F;  3DP7 A;  3RDI A;  1B9M A;  3ZQH A;  2P6T A;  5LHH A;  1FT9 A;  2HU9 A;  1N77 A;  1AOY A;  2MFZ A;  2EIJ H;  4MFD A;  5F0F A;  3VYR B;  1IN8 A;  1C0W A;  1KQ0 A;  1UST A;  4AC0 A;  4RB0 A;  4WWC A;  4BDZ A;  4NC8 A;  5D5U B;  2O8X A;  1RR8 C;  2MC4 A;  4A3K J;  2JMW A;  2F5E A;  4IHS A;  2GLO A;  4DGW B;  2HVR A;  2EQR A;  1YRN B;  4XSX F;  1JI8 A;  4FX0 A;  1FYM A;  3FMS A;  1H88 C;  4M9X A;  3LWF A;  4H0E A;  3CCL I;  3BPX A;  4YFN F;  5E8G A;  1D5Y A;  3I55 I;  2IEK A;  1X1P A;  2I5U A;  4UVA A;  1UHS A;  2M8E A;  4ABZ A;  4XQF A;  4A69 C;  1KGS A;  2LF7 A;  5L3E A;  3T8T A;  2KFD A;  4LG0 B;  3MFK A;  2OTJ I;  5F27 A;  1OCT C;  2ZJQ F;  1Z7U A;  2ELJ A;  3HC7 A;  5J1R A;  5JVG F;  2PJR B;  4A93 J;  3B02 A;  2V4J C;  5J1U A;  2LF8 A;  3FK7 A;  1ZRD A;  4FE4 A;  2K02 A;  3BG3 A;  2Y0S N;  2VOD A;  3FKI J;  1D1A A;  1ACI A;  2P0W A;  5IYC J;  3OS2 A;  5B66 C;  2K27 A;  4YII A;  2G0E A;  5J4V A;  2MLG A;  5D8L B;  2RKH A;  2E34 A;  4AM3 A;  2XKO A;  1QGP A;  2KP6 A;  3CME I;  3R4K A;  4HOB A;  1Y39 A;  1UHM A;  3ZN1 A;  3WTS C;  4LG0 A;  1W5C C;  4M3E A;  2H1K A;  1JHF A;  1W1W E;  5ICE A;  1DU0 A;  1V5E A;  3ZN0 A;  1MKM A;  3DBH B;  5K5R A;  3CMA I;  5ILU A;  1IRZ A;  3K4L A;  4EVI A;  3ECO A;  3H3Z A;  2HOA A;  2RNG A;  2V1N A;  3S1Q J;  3E97 A;  4CCO A;  1IXR C;  4LFU A;  5EGO A;  4ZYG A;  1E17 A;  3M1E A;  1WJE A;  3DKX A;  2XB0 X;  4PJM A;  2NRA C;  2R92 J;  1J7K A;  3BRO A;  4ZTJ A;  2AO9 A;  1T0F A;  3K4J A;  3MCZ A;  4HYE A;  2HZD A;  4XLE A;  4XLP F;  3FXJ A;  3OYM A;  2M34 A;  2ME6 A;  1YFH A;  3VEP A;  2DA6 A;  3HJE A;  5FLX K;  3PQK A;  2DOF A;  1WKM A;  3VSK A;  2BY3 A;  4C30 A;  5C44 J;  1R23 A;  1V55 H;  3K1M A;  1FZP B;  4CA0 A;  3TO6 A;  2KIS A;  2R7R A;  2VLA A;  4UVC A;  2XB5 A;  3HKZ A;  5E8I A;  1F4K A;  1MJA A;  3LL7 A;  2JJ7 A;  3WE2 A;  3MN2 A;  2VBY A;  5FRM A;  3REO A;  2XDV A;  3H36 A;  2STT A;  1I39 A;  3L2Q A;  5LRR A;  2YX4 A;  2VE8 A;  4C2U A;  5E3M A;  2DJN A;  1BI1 A;  1YO5 C;  2LY9 A;  2NVY J;  2LFB A;  3LSH A;  2ZO4 A;  3WU2 C;  2LY1 A;  2E35 A;  2Y9Z A;  1IGN A;  3OYL A;  3IAM 2;  2JUC A;  1OLT A;  3G73 A;  5HNH A;  4JX5 A;  2BW3 A;  4BEH B;  4A6D A;  1FP2 A;  2EBI A;  3PQJ A;  5HOD A;  1ON2 A;  1HQC A;  4MO7 A;  2D45 A;  4MEX F;  3F3X A;  1BC7 C;  3PNT A;  1OQY A;  3S1N J;  2F2E A;  4OIQ F;  3DQV C;  3SXY A;  1PJR A;  5DD8 A;  2L7K A;  1TWF J;  1X19 A;  5B1B H;  2ZXJ A;  3LSG A;  1MJB A;  4GFB A;  4EJO A;  1BOB A;  3DTE A;  2KMU A;  4CYC A;  5KAI C;  5HS8 A;  5EJC A;  2I8D A;  3ZQG A;  3K4B A;  4LD5 A;  2WAE A;  2HOE A;  2XF5 A;  4BJ5 C;  1LEB A;  2W1O A;  3C2G A;  1IRF A;  2KIU A;  3RPQ A;  5BOX A;  2L7F P;  4H4K C;  1G3S A;  4BQN A;  4M6X A;  3WTX C;  3L2R A;  1ZRE A;  3CZ6 A;  2OJE D;  5DDG A;  1UHW A;  3ISP A;  4D1Q A;  3ULQ B;  2C6Y A;  3OR2 C;  2HXO A;  2XV4 S;  1XSX A;  4EM0 B;  3COA C;  1V4R A;  2ESH A;  4O6J A;  1Z6R A;  3IHU A;  4RA2 A;  3ZMT A;  2DQL A;  3OIP A;  1ZYR F;  3E6B A;  1B8I A;  3MQ0 A;  1MD0 A;  4XID A;  2A6T A;  1WFX A;  2RGV A;  4NQW A;  4IRG A;  2L7M P;  4E7Z A;  4N4N B;  3V7C A;  5BMZ A;  1Z1D A;  3JW4 A;  2VPL A;  1XMA A;  3N4M A;  3FK6 A;  1D1B A;  1X3W B;  5EYR A;  4BE1 A;  2IA2 A;  2IS2 A;  4JX4 A;  2CH0 A;  3I71 A;  3QOD A;  4A3L J;  1LDD A;  1XTA A;  4Y33 A;  2H6B A;  2G7H A;  3K2Z A;  1YHQ I;  2PX9 A;  4A5M A;  4DZJ A;  5J47 A;  1OYY A;  3I64 A;  4DZP A;  3BJA A;  1ON1 A;  1TQM A;  3M1C A;  4LK0 F;  3VPR A;  2PMZ A;  2LYC A;  4RGX A;  2LG4 A;  1FBQ A;  2VQG A;  1IN4 A;  3WGG A;  4ENM A;  5LD2 C;  4BBS J;  3K6G A;  2LC2 A;  1D5V A;  2E1N A;  1PP8 F;  1OYI A;  3S2W A;  5LBQ A;  2RV8 A;  5A2Q K;  2IA1 A;  1DPU A;  2MC3 A;  3KP2 A;  1I27 A;  2BW3 B;  1U9O A;  4GGG A;  1W5S A;  4RMN A;  4GYI A;  2L54 A;  2ISY A;  2DTR A;  1Z91 A;  3BR0 A;  4G7Z F;  1YX5 A;  1LFU P;  1DGR M;  1BOA A;  3ESW B;  3NAU A;  2LMD A;  3KLO A;  4RB1 A;  2EV0 A;  1ZG5 A;  2O5R A;  3R0J A;  1S7E A;  3ZOB A;  1RI7 A;  1U6G A;  2O0Y A;  3SQN A;  2OCE A;  2OBP A;  2XVC A;  4CZC A;  1VTN C;  5M5Y J;  2PMZ N;  3U2R A;  1WI3 A;  3RKX A;  1XPX A;  4IL6 C;  2OPT A;  3H5N A;  3HDD A;  3J7A Y;  1IDY A;  1TL8 A;  1K79 A;  2M9H A;  1ZGJ A;  3LA7 A;  3IKT A;  3SYT A;  1KQ8 A;  4GDF A;  2XRL A;  5CYV A;  2QBY B;  1P7I A;  2EV5 A;  2L2O A;  3C1D A;  5CVV A;  4DOZ A;  4W1U A;  2BY0 A;  3VB2 A;  4IEJ A;  1JT6 A;  4CCK A;  2P5K A;  1Z9C A;  3G71 I;  4G6T B;  2ZXH A;  2WAF A;  1K61 A;  2P5V A;  1UEL B;  2DW4 A;  2ME0 A;  2KHM A;  3E6M A;  4BQA A;  1D0Y A;  4CYC B;  1TNS A;  4AYB N;  2EIL H;  3OY9 A;  2GXG A;  3K69 A;  5GTH C;  3ASN H;  4KMU X;  2FBI A;  4KT6 A;  2JT1 A;  2QUF A;  1R4M B;  4I6Z A;  3BR5 A;  2Y2Z A;  2X1C A;  2X9D A;  3ZMU A;  2R7O A;  2Z5U A;  2JA2 A;  1W0T A;  4KIF A;  4CUG A;  2KRF A;  4IVN A;  3FM5 A;  2O8K A;  1MIJ A;  4PJJ A;  2DMQ A;  3GCM A;  3WU1 B;  5FKO A;  1RRJ A;  2XGX A;  2UWM A;  4MHG A;  3HEF A;  3C2B A;  2CV0 A;  2DJI A;  2ZNY A;  1WCM J;  1FOY A;  1IW7 F;  1XN7 A;  1SD5 A;  2ZSI B;  4A3B J;  1XDU A;  2DA3 A;  5AIQ A;  4OIR F;  1FOK A;  2NAZ A;  2KDO A;  3CP2 A;  1N25 A;  3DEE A;  3IV5 A;  1BC8 C;  5IPA A;  1IN7 A;  5D5V B;  3AL0 B;  5FKM A;  5BPI A;  1QVT A;  3CMM A;  2YU9 J;  2CGP A;  3S3M A;  3DPU A;  4Q4Z F;  1S9H A;  1ETQ A;  2PJR A;  4KNY A;  1T33 A;  4A3F J;  2VKE A;  5HLG A;  3MAJ A;  4E7I A;  2OCC H;  1NTC A;  1H8A C;  4WXH A;  5LHI A;  2E71 A;  2DK5 A;  3BTL A;  4KT5 C;  3OYB A;  2GAU A;  3OYC A;  1S3J A;  3FMQ A;  2ID6 A;  5LGU A;  1AKH B;  2W7N A;  1J0R A;  1A6Q A;  5LLQ A;  3PUB A;  4HQM A;  5E79 C;  1OKR A;  4DBQ A;  1F5T A;  1VQN I;  2QSF X;  3ECH A;  1QPI A;  2R7Z J;  4ON0 A;  4A0X A;  3WTW C;  2FSW A;  3MVP A;  1PDN C;  1GVD A;  5CKT A;  2P8T A;  3HZJ A;  5JFR A;  1HBX G;  3ZMS A;  2JA6 J;  2EJR A;  2YPR A;  4BAY A;  5TIS C;  3I54 A;  2K9S A;  4KUM A;  4HPQ A;  4LIU A;  3R61 A;  4M3B A;  4LB6 B;  1QO0 D;  2BGC A;  5FLV A;  1T98 A;  3JRA A;  3J7A O;  1T95 A;  2VBZ A;  3S2H J;  4KA4 A;  2N8G A;  3U1D A;  4JK1 X;  4NDL A;  1G3W A;  2XSD C;  2GA2 A;  4IZZ A;  1TW3 A;  4Y4R A;  4MTD A;  2JUG A;  1B4A A;  4C3J J;  3CTA A;  2HS5 A;  1OCO H;  1SD4 A;  3BG7 A;  3I5U A;  5F64 A;  3HUG B;  3JRF A;  1Z3X A;  3SZT A;  1R1T A;  2ZC2 A;  3SFZ A;  4FTH A;  3ELK A;  2HXI A;  3V7S A;  2V9K A;  3KZI C;  4RM3 A;  4OIN F;  4XKB A;  3CF5 F;  3VFZ A;  1TLH B;  3H9J A;  3DV8 A;  3WTY C;  1G6N A;  2WY7 Q;  1ETW A;  3QPS A;  2BHZ A;  1FP1 D;  5D4S A;  2EIM H;  2ZME C;  1K7A A;  3KLN A;  2HWV A;  5F1R A;  4PDK A;  1KU7 A;  5E3N A;  2LDU A;  1WJC A;  4D5F A;  4ZYD A;  3HRU A;  1MSE C;  4HZF A;  1U8R A;  3M3Y J;  1QNT A;  3WU0 A;  4A3M J;  2V1X A;  4I0A A;  4HV5 A;  2IRF G;  3HUG A;  3BDD A;  2DPD A;  2JSP A;  4HEA 2;  1JUM A;  2E36 A;  2Y69 H;  1KU9 A;  2EB7 A;  3FHZ A;  4B09 A;  4BDY A;  3GWZ A;  4OAZ A;  5D5W B;  3ASO H;  4NC6 A;  3BQY A;  4YG2 F;  3ZXS A;  5H2F C;  1ZG1 A;  5AIP A;  2XAG A;  2EFN A;  1S7A A;  4S0H B;  1E3O C;  1UB9 A;  1UG2 A;  3GO5 A;  3I3L A;  5EG0 B;  1XS9 A;  3D1N I;  5FLM J;  4B44 A;  2M5W A;  1T08 B;  2VT3 A;  1MMA A;  2R7V A;  2XAS A;  4LMY A;  2NS7 A;  1BL0 A;  3NQO A;  2OZ6 A;  4KIB A;  2KRH A;  1XG1 A;  2OC6 A;  1O3T A;  1LVA A;  2X0L A;  1PVE A;  2D2W A;  3BT9 A;  2EK5 A;  2G9W A;  2X51 A;  4I01 A;  2HKO A;  4AVZ A;  2DT7 B;  4BJT A;  3PO2 J;  4I7H A;  5LRS A;  3QQA A;  3LNQ A;  4LIV A;  4C9Y A;  4J19 A;  1B72 B;  2QGU A;  5GPC A;  4ITV A;  4GCV A;  4O5V A;  1TQP A;  3K4M A;  2M4G A;  1CF7 B;  3D0S A;  3E6C C;  3WGI A;  1XGO A;  3FXK A;  2OD5 A;  3B6A A;  3PSF A;  3W2V A;  4RDU A;  2DMU A;  3OYG A;  3F8N A;  5F04 A;  5KK1 A;  1FC3 A;  4RAY A;  3JR9 A;  1VQK I;  4PSW A;  3H9G A;  3EPZ A;  1FY7 A;  1SFE A;  1T6S A;  4E70 A;  2IS1 A;  2QWW A;  3KYD B;  3P9C A;  3H5R A;  5TJJ A;  2YX7 A;  4ESF A;  4XOR A;  1QHH D;  2F5D A;  4EV0 A;  3PNY A;  2Z33 A;  3AG1 H;  4YFK F;  2MD0 A;  4MIM A;  4CYD A;  1I3Q J;  1SMT A;  2DA7 A;  1ZLJ A;  5CVU A;  4U0Y A;  2NVT J;  4LIT A;  3OSF A;  3L00 A;  4CCL A;  2JVH A;  5GTI C;  3BY6 A;  2M0C A;  3KFW X;  4EGZ A;  3WE3 A;  5GP9 A;  2LBF B;  3MKL A;  1ITY A;  5KHD A;  3DU5 A;  1X1A A;  3S14 J;  2F5V A;  4UV8 A;  3RQI A;  4J00 A;  2Q2E A;  4V2F A;  3D5L A;  4FIS A;  2F6C A;  5ILS A;  1T0F C;  2JRM A;  1YS7 A;  3M9A A;  4PUS A;  1JUS A;  4FAS D;  1MGT A;  3PJR A;  3A02 A;  5EEG A;  4G9Y A;  1MZB A;  5E1Z B;  3T0Y A;  1EH6 A;  3GFL A;  2R7W A;  5D4R A;  3F72 A;  1OMI A;  2GBY A;  5L3B A;  4AID A;  3B6C A;  4HW0 A;  2LY2 A;  2B63 J;  4IHT A;  5DCF A;  2DPU A;  4RLF A;  3A0B C;  2HR3 A;  3LQQ A;  1XSV A;  2W82 A;  4HV6 A;  1DP7 P;  1Q1H A;  2BXY A;  1OR7 C;  3O3K A;  1OIS A;  1GT0 C;  1IUY A;  3PFY A;  1GV5 A;  2Y0M A;  1LNW A;  2JWT A;  3LSJ A;  1MNM C;  3ZQ7 A;  5JI6 A;  2EIK H;  1IRX A;  3BCB A;  4PZJ A;  5B3S H;  2Q0O A;  1LQ1 A;  2K9M A;  5HLT A;  3QU6 A;  4ZYA A;  1IF1 A;  4U88 A;  4II3 A;  4CGZ A;  2OAZ A;  4M9Z A;  4F52 A;  4RB3 C;  4MQV A;  2UXX A;  3DKW A;  4QPQ A;  1YW7 A;  3S8P A;  4LOC A;  3HXL A;  4NB5 A;  1OCC H;  1SMY F;  3RKY A;  2JA5 J;  1OCP A;  3G1L A;  4V2G A;  5DD4 A;  2DMN A;  3TDZ C;  3U9G A;  5DYM A;  1QQI A;  2IGN A;  5LHG A;  3I59 B;  1KQ9 A;  5EEA A;  3IC7 A;  1T2K A;  3EDP A;  1R7J A;  2LBF A;  2ADU A;  4F92 B;  1MBG A;  1K4T A;  2L4A A;  3F8B A;  2P5L C;  1B6A A;  1TTY A;  4JBA A;  4CZZ A;  4WK8 F;  2H27 A;  1Y6I A;  5F08 A;  4B3A A;  4QTR A;  4CH7 A;  3ZCO A;  2FF4 A;  3DPT A;  1W7P B;  3JRG A;  3VYT B;  2VJ4 A;  3KET A;  3IH2 A;  2WV1 A;  2A3S A;  1ULY A;  3H0G J; 
#chains in the Genus database with same CATH homology
 2Q8K A;  1O3S A;  1LDJ A;  2KIM A;  1S7O A;  3I0T A;  3FM3 A;  3KE2 A;  5FO5 A;  2HGC A;  1REP C;  1D8J A;  2IT0 A;  3JAM Z;  3R0A A;  1CF7 A;  2KJB A;  3E5X A;  4KMF A;  1HW1 A;  5CVR A;  3HRS A;  4OU0 A;  2ZME A;  2V9V A;  4P9U A;  3HHH A;  5FLX Z;  3WOD F;  1CGP A;  1ZLK A;  3RKW A;  1EV7 A;  1G3T A;  4A6E A;  2HYF A;  1O7F A;  3R60 A;  1R00 A;  3JTG A;  1ODD A;  2MH2 A;  4OIP F;  3BWG A;  2CW0 F;  4EJV A;  4G6Q A;  4HLX A;  3EYI A;  1IRG A;  3V8J A;  4ENJ A;  4RB2 C;  1L3L A;  3QU3 A;  2VOP A;  1UCR A;  4UXN A;  5LEJ A;  2GWR A;  1BIB A;  2FQ3 A;  2RQP A;  3GEZ A;  4HQE A;  1J9I A;  3GZ6 A;  3G3Z A;  2FNP A;  2COM A;  3KP4 A;  4DNC A;  1U5T B;  2QBY A;  1FBU A;  2XUB A;  1LEA A;  5LEK A;  3CO6 C;  2WWY A;  3Q5F A;  5FD6 A;  1QZY A;  3QP5 A;  4U0W A;  3HYI A;  2A5Y B;  5KVR A;  2RC4 A;  1EH8 A;  1W7P A;  2BBY A;  2A68 F;  1RNL A;  1XGS A;  2MH9 A;  3RYP A;  2ZFW A;  4HF1 A;  1YW9 A;  4M72 A;  2TDX A;  2FRH A;  4HX7 A;  2WV0 A;  1MJ9 A;  4ASN A;  2ZKZ A;  1TW2 A;  1NHA A;  4HDU A;  5AON A;  3W6K B;  2A61 A;  3MEX A;  2ESN A;  3KP3 A;  4A5N A;  3TGN A;  3K1N A;  3F22 A;  1OR7 A;  4IF4 A;  5CLS A;  1MDM A;  4DQ2 A;  3F6O A;  1HKQ A;  5EEH A;  1P4X A;  2DAO A;  2FBK A;  4LGW A;  5JVT A;  5FGM A;  3FWE A;  3JTH A;  2DU9 A;  2DQR A;  3QRF F;  3GX4 X;  1FYL A;  1GVJ A;  3L2C A;  2FE3 A;  3WTT C;  1BI3 A;  4I0B A;  1FWZ A;  3Q9S A;  2AXL A;  1XCV A;  3J80 K;  3TQN A;  4WXD A;  2PG4 A;  2H6C A;  3BOQ A;  2Y48 A;  1YIO A;  4R8H A;  4BH9 A;  5IT9 Z;  2EFQ A;  3RYR A;  3FX3 A;  2PJP A;  4P96 A;  1U2W A;  3T1B A;  5E17 F;  3KEO A;  4S05 A;  4RGU A;  5CVJ A;  2KKO A;  5HOO A;  3WG9 A;  1FSE A;  2PEX A;  2BEO A;  2EA2 A;  4XBF A;  3EUH A;  3KP6 A;  5DV5 A;  3C18 A;  1P4A A;  1BBY A;  1ONV A;  3DF8 A;  4UV9 A;  4M6Y A;  2Z9O A;  1WI9 A;  1A04 A;  1FX7 A;  4EGY A;  4EJT A;  1KA8 A;  4L9T A;  2OQR A;  2MA3 A;  4XRF A;  3MZH A;  2PN6 A;  3ROU A;  3RI4 A;  1J59 A;  4BHC A;  3FMR A;  1KYW A;  1JE8 A;  3B73 A;  1R5H A;  1XD7 A;  5ICF A;  3ZMZ A;  3HHG A;  4B8X A;  4AWX B;  4P5O A;  2YR2 A;  1O57 A;  2ISZ A;  4BNC A;  2G7U A;  1F9N A;  1RUN A;  1X3U A;  4Y15 A;  4BYY A;  5L3G A;  5BS6 A;  2L02 A;  4HLY A;  3TOB A;  1TNT A;  1XGN A;  2A6E F;  3FXR A;  2UZK A;  4ESB A;  1YG2 A;  1Z05 A;  4ETS A;  3GW2 A;  1R1V A;  4QWQ A;  2OQG A;  4KDP A;  2IJL A;  2O3F A;  3AAF A;  1H0M A;  1LJ9 A;  3GXO A;  5HS9 A;  5JHU A;  2XAJ A;  3R6S A;  2HZT A;  3ERE D;  2UXN A;  3KZZ A;  4ESJ A;  3QPT A;  3HSF A;  3CLO A;  2PLY A;  1JHH A;  3C7J A;  1OYW A;  2PMU A;  1R36 A;  5E1X A;  2ETH A;  4LK1 F;  4D0P A;  5ERI A;  2IA0 A;  3J80 Z;  6PAX A;  1MDM B;  4TV7 A;  4CHU A;  2WTE A;  4ZZD A;  2CSO A;  1I6X A;  1S8N A;  3DPL C;  4UNO A;  3HRT A;  4M71 A;  1FLI A;  3FZV A;  4S04 A;  1K6O A;  3K1P A;  3WGH A;  2O03 A;  3FXQ A;  1J5Y A;  4KFC A;  5F6F A;  4N9I A;  2QQ9 A;  1W5T A;  1V3F A;  3ZP5 A;  2V1D A;  2L01 A;  1KU2 A;  4OMY A;  1BN5 A;  5H6Q A;  4ENN A;  1BIA A;  3HSR A;  3VOD A;  2JZY A;  2VON A;  2X4H A;  2LSO A;  2LNB A;  2EFO A;  1BM9 A;  1K78 A;  4A12 A;  2A69 F;  1U3E M;  5ILV A;  4HX4 A;  2WC2 A;  1FSH A;  2FU4 A;  2VN2 A;  1OPC A;  2FXA A;  1U5T A;  2W84 A;  4RAZ A;  2P7V B;  3CJN A;  3T5X A;  3CDH A;  3HOT A;  2OA4 A;  2XAH A;  2B0L A;  4P55 A;  4GXO A;  4F7Z A;  3I58 A;  2FML A;  4KN4 X;  2DLL A;  4GO1 A;  2GZW A;  3LA2 A;  1GHC A;  3I53 A;  1HSJ A;  3W6J B;  3HRM A;  1SAX A;  3TDU C;  4O3M A;  3CUQ B;  2RN7 A;  3TO7 A;  4AIK A;  4M9S A;  1YYV A;  4U0V A;  2YU3 A;  1H9T A;  5J6X A;  4LB5 A;  5HDK A;  3KCC A;  3KEQ A;  3WTU C;  1GXQ A;  3SZP A;  1IN6 A;  4L0Z B;  2HKX A;  4L9J A;  4YIF A;  1ZN2 A;  4M74 A;  2F5F A;  3Q9V A;  4CXF A;  2XRN A;  3WTV C;  5HLI A;  2HYG D;  1I5Z A;  3DEU A;  4MQ9 F;  1G3Y A;  1J75 A;  4N0B A;  2DT5 A;  1R58 A;  2L3D A;  1G4D A;  1I1G A;  2M1B A;  3V8L A;  3F21 A;  2J5O A;  1WQ2 A;  3EET A;  3L7W A;  2HQN A;  2NNN A;  5K5Q A;  1H9G A;  4Q47 A;  2GIV A;  5DEQ A;  4LLN A;  3GYH X;  5DUI A;  4HAM A;  2QEN A;  1K78 B;  1YTY A;  1SFU A;  1D8K A;  3IWZ A;  2NS0 A;  5K5O A;  2F5C A;  3HSE A;  3LAJ A;  1XGM A;  3SHF A;  3EQL F;  1YW8 A;  4BHP A;  2DI3 A;  5IT9 K;  1W7P D;  3LFK A;  4P9F A;  3GFJ A;  3CO7 C;  3IWF A;  3QOP A;  3ZMV A;  2VC0 A;  2VBX A;  1FBS A;  3E3V A;  4N9H A;  3E5U A;  2XAF A;  2CQK A;  5H6R A;  3GFM A;  3V7R A;  3H92 A;  2Y75 A;  2P7C B;  3E5Q A;  3HTS B;  2M45 A;  1LDK B;  1R1U A;  4LJZ F;  1P92 A;  4HX8 A;  4HDV A;  1ZAR A;  4I2O A;  1ZAO A;  1T38 A;  2V6C A;  4MEY F;  2VOO A;  2V1U A;  1S29 A;  4HF0 A;  4LLG F;  1FYK A;  2HDC A;  5IT3 A;  3WTZ A;  4AIJ A;  2KJC A;  2QQB A;  4U7B A;  3BJO A;  4QLC U;  4G6D A;  1I1S A;  2E7X A;  5H20 A;  1XB4 A;  4WX9 A;  4KN7 X;  2Z99 A;  4IPA A;  4IJA A;  3RJP A;  1XSD A;  2VC1 A;  2QVO A;  2XHK A;  4A2U A;  4WXC A;  2CO5 A;  3N97 A;  3MZY A;  2ELH A;  1WWX A;  2IPQ X;  3P7N A;  1W4M A;  3F6V A;  3GVA A;  3ABU A;  3O2P E;  4Z2Y A;  5ED4 A;  3P9K A;  4MGR A;  4EQQ A;  1UFM A;  3GLX A;  5D5X B;  5D8K B;  3FXU A;  3M8F A;  4PCQ A;  3KP5 A;  2HQR A;  2KIF A;  2BYV E;  4HA8 A;  4KYW A;  4JQF A;  3NRV A;  1XDS A;  2NYX A;  2J5P A;  2RDP A;  2JTV A;  2Z3Y A;  3LA3 A;  1ZH5 A;  4OOI A;  5HDN A;  4FX4 A;  3VOE A;  4HF2 A;  3CUQ C;  2EWN A;  1R5G A;  1QZZ A;  3RTR A;  4G7H F;  2FMY A;  4PGH A;  4RGS A;  4OIO F;  4EMS A;  4EM2 A;  3F8C A;  3LQR A;  1JGS A;  2DK8 A;  1ZRC A;  3T8R A;  2BV6 A;  4L9V A;  2JRT A;  3L09 A;  2K4J A;  4CDG A;  3HOS A;  2VXZ A;  5FFZ A;  1RZ4 A;  3BP8 A;  5J8C A;  2A07 F;  3PFI A;  4RGR A;  1STZ A;  2AS5 F;  2PMH A;  4LLL A;  4AVP A;  2W25 A;  2K4B A;  5CJ9 A;  3BZ6 A;  2PBI A;  3M7G A;  3LAP A;  3IRQ A;  2R7F A;  4IXA A;  2VE9 A;  5D6E A;  1L0O C;  3IL2 A;  1YS6 A;  2R3S A;  1ZGA A;  1XCB A;  5BPD A;  1D3Y A;  2E1C A;  1P2F A;  2V79 A;  4I98 B;  4ZYE A;  3O6B B;  4L9N A;  3V8K A;  1HKT A;  5HVQ C;  4BHB A;  1E2X A;  5L3D A;  1O3Q A;  1DUX C;  2QLZ A;  2K86 A;  2CFX A;  4RS8 A;  1LB2 A;  2K7L A;  4PGG A;  4Q48 A;  1DDN A;  4HBL A;  4YFX F;  3TOA A;  2W57 A;  3JSO A;  2H94 A;  2CG4 A;  2QYO A;  4I02 A;  4Y13 A;  1P6R A;  2EFP A;  2MD5 A;  4XSZ F;  2JSC A;  1IZ1 A;  2P6S A;  3C3W A;  3QAH A;  4WF2 A;  2FOK A;  4UVB A;  4ENK A;  4IRI A;  2EFW A;  1GXP A;  2BE5 F;  1PP7 U;  4K2E A;  3HIF A;  2M30 A;  4EM1 A;  2ZJ2 A;  2O61 A;  1AWC A;  2HEO A;  3DFG A;  1FPQ A;  5K1Y A;  5DCM B;  3KP7 A;  3HTU A;  1SFX A;  5E1W A;  3L9F A;  4CIC A;  4BXU A;  1B1B A;  4ZYH A;  4MTE A;  4Q5S F;  1KU3 A;  2FEZ A;  3JAM K;  2IP2 A;  5LGN A;  1BJA A;  4A0Y A;  5JR3 A;  1R22 A;  1XMK A;  5L3F A;  1HW5 A;  3TKY A;  2IVM A;  3F8F A;  1QBJ A;  2GXB A;  1ZRF A;  2PFB A;  4EJU A;  1ZHF A;  2RVC A;  4FHT A;  2FA5 A;  2ZME B;  4R79 A;  4CO8 A;  5A2Q Z;  1F1Z A;  2EA4 A;  5FB2 A;  4AIH A;  3QPH A;  5HLH A;  3NEU A;  2M87 A;  2D1V A;  4M73 A;  5LGT A;  4FT8 A;  5CVI A;  1WRJ A;  2ACJ A;  1IXC A;  2NNY A;  1WSU A;  2FBH A;  5FD5 A;  3J81 K;  1TBX A;  3GUD A;  4IRH A;  4Y17 A;  4ZH4 F;  2YSR A;  2EV6 A;  1U78 A;  4AD9 A;  1HW2 A;  1SD6 A;  3QP6 A;  4ZZL A;  2R7D A;  3GF2 A;  3MWM A;  5J8F A;  1BI2 A;  3GZ5 A;  5E20 A;  2JPB A;  2D1H A;  2PQ8 A;  3IKV A;  4UUV A;  4EJW A;  1JXS A;  4OMZ A;  2XKP A;  2H09 A;  2ZCW A;  3OV8 A;  4L5I A;  1IN5 A;  1B9N A;  2RNJ A;  3F23 A;  1YLF A;  3V4G A;  1B59 A;  1HKS A;  4KIG A;  2W24 A;  5FFX A;  1HXD A;  2QQA A;  5HDG A;  1FNN A;  5DCM A;  3ML6 A;  4WCG A;  1TQI A;  2DBB A;  1SD7 A;  3ZPL A;  2MLK A;  2L4M A;  2VBW A;  2P4W A;  3KZY A;  4G8X A;  2QZ8 A;  3ZMD A;  1O3R A;  3BJ6 A;  1IXS B;  1IAW A;  3BPV A;  2CWE A;  2OZU A;  4G94 A;  3OOP A;  3J81 Z;  1YQA A;  3I59 A;  3H3U A;  3I4P A;  2GQQ A;  2MBF A;  3ABT A;  2IW5 A;  2XIG A;  2OU2 A;  1QPM A;  2HFH A;  1U5T C;  1ZG3 A;  5E18 F;  4MNU A;  3EYY A;  1S6L A;  3RIR A;  2HTS A;  1J2X A;  4U7D A;  1O7L A;  2PI0 A;  1PUE E;  4I09 A;  5HS7 A;  5ICC A;  4R1H A;  2E7W A;  2XRO A;  5D6F A;  1HST A;  2QM3 A;  2CYY A;  2VT2 A;  2JPC A;  5ICG A;  3FF5 A;  4KIC A;  1T39 A;  3TO9 A;  5DUK A;  5L3C A;  2HTJ A;  3E6D A;  3CUQ A;  3K9T A;  3K0L A;  1EH7 A;  1USS A;  2DFI A;  3IRR A;  3GFI A;  4L18 B;  3RPU A;  4L5J A;  4UHT A;  4L0Y B;  2ZNZ A;  1P4W A;  2STW A;  4A0Z A;  3F8M A;  3M8E A;  3JSP A;  2O6G E;  5BQT A;  1DPR A;  3LST A;  1Y0U A;  2W85 A;  2LKP A;  2FNA A;  2A6H F;  4NHJ A;  4XLN F;  2DO7 A;  5TRD A;  4G7O F;  3P9I A;  1RIO H;  1BI0 A;  2GA1 A;  2XAQ A;  2ZBK A;  1RUO A;  1Z6T A;  4GYG A;  1KYZ A;  3CUO A;  3DXJ F;  3DP7 A;  3RDI A;  1B9M A;  2P6T A;  5LHH A;  1FT9 A;  1AOY A;  1IN8 A;  1C0W A;  1KQ0 A;  1UST A;  4RB0 A;  4WWC A;  5D5U B;  2O8X A;  2F5E A;  4IHS A;  4XSX F;  4FX0 A;  1FYM A;  3FMS A;  4M9X A;  3LWF A;  4H0E A;  3BPX A;  4YFN F;  5E8G A;  4UVA A;  2M8E A;  1KGS A;  2LF7 A;  5L3E A;  3T8T A;  4LG0 B;  3MFK A;  1Z7U A;  3B02 A;  2LF8 A;  1ZRD A;  2K02 A;  2VOD A;  2K27 A;  4YII A;  2MLG A;  5D8L B;  2RKH A;  2XKO A;  1QGP A;  3R4K A;  4HOB A;  1UHM A;  3ZN1 A;  3WTS C;  4LG0 A;  1JHF A;  5ICE A;  3ZN0 A;  1MKM A;  5K5R A;  5ILU A;  4EVI A;  3ECO A;  3H3Z A;  3E97 A;  1IXR C;  4LFU A;  4ZYG A;  1E17 A;  3M1E A;  2NRA C;  1J7K A;  3BRO A;  1T0F A;  3MCZ A;  4HYE A;  4XLP F;  1YFH A;  3VEP A;  5FLX K;  3PQK A;  1WKM A;  1R23 A;  3K1M A;  1FZP B;  3TO6 A;  4UVC A;  5E8I A;  1F4K A;  1MJA A;  3WE2 A;  2VBY A;  3REO A;  2STT A;  5LRR A;  2YX4 A;  2VE8 A;  1BI1 A;  1YO5 C;  2ZO4 A;  3G73 A;  4A6D A;  1FP2 A;  3PQJ A;  1ON2 A;  1HQC A;  4MEX F;  2D45 A;  3F3X A;  1BC7 C;  2F2E A;  4OIQ F;  3DQV C;  3SXY A;  5DD8 A;  2ZXJ A;  1MJB A;  4EJO A;  5HS8 A;  4LD5 A;  2HOE A;  1LEB A;  1IRF A;  2KIU A;  3RPQ A;  5BOX A;  1G3S A;  4M6X A;  3WTX C;  1ZRE A;  5DDG A;  1UHW A;  3ISP A;  3ULQ B;  2C6Y A;  2XV4 S;  1XSX A;  4EM0 B;  3COA C;  1V4R A;  2ESH A;  4O6J A;  1Z6R A;  3IHU A;  3ZMT A;  2DQL A;  1ZYR F;  3E6B A;  3MQ0 A;  1MD0 A;  4NQW A;  4IRG A;  3V7C A;  5BMZ A;  1Z1D A;  3JW4 A;  1XMA A;  3N4M A;  2IA2 A;  3I71 A;  1LDD A;  2H6B A;  2G7H A;  3K2Z A;  4A5M A;  1OYY A;  3I64 A;  3BJA A;  1ON1 A;  1TQM A;  4LK0 F;  4RGX A;  1FBQ A;  1IN4 A;  3WGG A;  4ENM A;  1D5V A;  2E1N A;  1PP8 F;  1OYI A;  3S2W A;  5LBQ A;  2RV8 A;  5A2Q K;  2IA1 A;  1DPU A;  2MC3 A;  3KP2 A;  1I27 A;  4GGG A;  1W5S A;  4GYI A;  2L54 A;  2ISY A;  2DTR A;  1Z91 A;  4G7Z F;  1BOA A;  3KLO A;  4RB1 A;  2EV0 A;  1ZG5 A;  3R0J A;  1RI7 A;  1U6G A;  2O0Y A;  3SQN A;  2OBP A;  2XVC A;  1VTN C;  3U2R A;  3RKX A;  1K79 A;  1ZGJ A;  3LA7 A;  3IKT A;  1KQ8 A;  5CYV A;  2QBY B;  2EV5 A;  3C1D A;  5CVV A;  3VB2 A;  2P5K A;  1Z9C A;  2P5V A;  2DW4 A;  4BQA A;  3E6M A;  1TNS A;  2GXG A;  3K69 A;  4KMU X;  2FBI A;  2JT1 A;  2QUF A;  3ZMU A;  2Z5U A;  4KIF A;  2KRF A;  4IVN A;  3FM5 A;  3WU1 B;  2XGX A;  2UWM A;  4MHG A;  2ZNY A;  1IW7 F;  1XN7 A;  1SD5 A;  1XDU A;  5AIQ A;  4OIR F;  1FOK A;  2NAZ A;  1BC8 C;  1IN7 A;  5D5V B;  5BPI A;  2CGP A;  4Q4Z F;  4KNY A;  5HLG A;  3MAJ A;  4WXH A;  5LHI A;  2DK5 A;  4KT5 C;  2GAU A;  1S3J A;  3FMQ A;  5LGU A;  1J0R A;  5LLQ A;  4HQM A;  1OKR A;  1F5T A;  3ECH A;  4ON0 A;  4A0X A;  3WTW C;  2FSW A;  1PDN C;  2P8T A;  5JFR A;  1HBX G;  3ZMS A;  2EJR A;  2YPR A;  4BAY A;  3I54 A;  4KUM A;  4LB6 B;  3R61 A;  1QO0 D;  2BGC A;  1T98 A;  3J7A O;  2VBZ A;  4KA4 A;  3U1D A;  4JK1 X;  1G3W A;  2GA2 A;  1TW3 A;  4MTD A;  1B4A A;  3CTA A;  2HS5 A;  1SD4 A;  3I5U A;  5F64 A;  3SZT A;  1R1T A;  3SFZ A;  3ELK A;  3V7S A;  4OIN F;  3VFZ A;  1TLH B;  3DV8 A;  3WTY C;  1G6N A;  1FP1 D;  5D4S A;  1K7A A;  3KLN A;  2HWV A;  5F1R A;  4PDK A;  1KU7 A;  2LDU A;  4ZYD A;  3HRU A;  4HZF A;  1U8R A;  1QNT A;  3WU0 A;  2IRF G;  2V1X A;  4I0A A;  4HV5 A;  3HUG A;  3BDD A;  2DPD A;  1KU9 A;  2EB7 A;  3FHZ A;  4B09 A;  3GWZ A;  5D5W B;  4YG2 F;  1ZG1 A;  5AIP A;  2XAG A;  2EFN A;  1S7A A;  1UB9 A;  3GO5 A;  2M5W A;  2VT3 A;  2XAS A;  4LMY A;  3NQO A;  2OZ6 A;  4KIB A;  1O3T A;  1LVA A;  2X0L A;  2D2W A;  2EK5 A;  4I01 A;  2G9W A;  2HKO A;  4I7H A;  5LRS A;  4GCV A;  4O5V A;  1TQP A;  1CF7 B;  3D0S A;  3E6C C;  3WGI A;  1XGO A;  2OD5 A;  3F8N A;  5KK1 A;  1FC3 A;  4RAY A;  1FY7 A;  1SFE A;  1T6S A;  4E70 A;  2QWW A;  3P9C A;  5TJJ A;  2YX7 A;  4ESF A;  2F5D A;  4EV0 A;  2Z33 A;  4YFK F;  4CYD A;  1SMT A;  5CVU A;  4U0Y A;  1ZLJ A;  3L00 A;  3BY6 A;  3KFW X;  4EGZ A;  3WE3 A;  4UV8 A;  2Q2E A;  3D5L A;  5ILS A;  1YS7 A;  3M9A A;  1MGT A;  5EEG A;  4G9Y A;  1MZB A;  5E1Z B;  3T0Y A;  1EH6 A;  3GFL A;  5D4R A;  3F72 A;  1OMI A;  5L3B A;  4HW0 A;  4IHT A;  5DCF A;  2DPU A;  2HR3 A;  3LQQ A;  1XSV A;  4HV6 A;  1DP7 P;  1Q1H A;  3O3K A;  1IUY A;  2Y0M A;  1LNW A;  3ZQ7 A;  5JI6 A;  4PZJ A;  2Q0O A;  1LQ1 A;  3QU6 A;  1IF1 A;  4U88 A;  4CGZ A;  2OAZ A;  4RB3 C;  4M9Z A;  4MQV A;  2UXX A;  3DKW A;  1YW7 A;  4NB5 A;  1SMY F;  3RKY A;  5DD4 A;  3TDZ C;  3U9G A;  5DYM A;  1QQI A;  5LHG A;  1T2K A;  1KQ9 A;  3I59 B;  3IC7 A;  3EDP A;  1R7J A;  2ADU A;  2L4A A;  3F8B A;  2P5L C;  1B6A A;  1TTY A;  4JBA A;  4CZZ A;  4WK8 F;  2H27 A;  2FF4 A;  3DPT A;  1W7P B;  3KET A;  2A3S A;  1ULY A;  2RGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...