2ACJA

Crystal structure of the b/z junction containing dna bound to z-dna binding proteins
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
53
Chain Sequence
HMEQRILKFTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a junction between B-DNA and Z-DNA reveals two extruded bases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords 5'-D(*GP*TP*CP*GP*CP*GP*CP*GP*CP*CP*AP*TP*AP*AP*AP*CP*C)-3'
total genus 11
structure length 53
sequence length 62
chains with identical sequence B, C, D
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2005-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2acjA00
1IRFA 2CFXA 2V1XA 1TNTA 3F72A 4ZYGA 1S7AA 1KU2A 4HW0A 4EM0B 1W7PA 1OMIA 3QU3A 3TO6A 1ULYA 2PMUA 3KLNA 5ICFA 5E1WA 4U7BA 2JPCA 2RKHA 4L9VA 2XAJA 4MGRA 1LB2A 5K1YA 2CO5A 5H20A 2HKOA 5D5WB 5HS7A 4YIIA 4HF2A 5CVJA 3MWMA 5HLIA 1VTNC 3LA7A 3QPHA 4LB5A 5IT3A 1FYLA 4UVBA 4GYIA 3ISPA 1R36A 2MH2A 3HSRA 5IT9K 3BROA 1F4KA 3B02A 2KJBA 1PP8F 4H0EA 4EQQA 3SQNA 1D8KA 1IXRC 4U0WA 3PFIA 3U9GA 2PQ8A 2MC3A 3BWGA 2RVCA 1LDDA 4XSXF 4Y13A 1R00A 2G7HA 5HVQC 2XGXA 4I01A 1AWCA 4NQWA 1RIOH 2K4BA 4KIGA 3Q9SA 3HOSA 3ZQ7A 3WTWC 1J9IA 3ABTA 5FLXZ 3FMRA 3KEOA 1LEBA 4EVIA 4HAMA 3SFZA 5K5OA 2KKOA 1MJ9A 1P92A 4MTEA 2Y0MA 2ZNZA 2QYOA 3KCCA 2YU3A 2M45A 2IP2A 5DUKA 2RNJA 3K1PA 1FYMA 2P7CB 4XLNF 2F5FA 1BOAA 3TQNA 2FBKA 1FSEA 4EJVA 3DFGA 5DV5A 3DXJF 3NRVA 4JBAA 2GA1A 3GFJA 3FZVA 2PMHA 3HHHA 2Z9OA 3GYHX 1XCBA 1REPC 1H0MA 2CQKA 1J5YA 2EFQA 2D1VA 2XV4S 1OYWA 1R7JA 1HBXG 2GXGA 5AIPA 3BPXA 2STWA 1YQAA 1TQMA 3CO7C 4HYEA 4IVNA 4OMZA 3E3VA 4KNYA 3RIRA 2EB7A 1W5TA 2KIMA 2CW0F 1H9TA 1O7FA 5LHHA 1XGOA 1ZREA 2F5CA 3I58A 2FBIA 3M8FA 2NNYA 2NAZA 2MBFA 2HOEA 4Q48A 3EDPA 2VT3A 2VOOA 1B59A 1E2XA 3J81K 2R3SA 2O3FA 2EFPA 5E18F 4ETSA 1K79A 5D6EA 2H94A 2PN6A 4EJTA 3CUQB 2Y48A 5EEGA 3U2RA 2V9VA 1TQIA 1W5SA 1FWZA 4Y17A 3ECHA 2VC0A 1USTA 5LEKA 3IL2A 2DPDA 3HRSA 4B09A 2VBZA 3R6SA 2PBIA 4A12A 2J5OA 3RDIA 4EJUA 3REOA 2OQRA 4CGZA 3ECOA 3V4GA 1T6SA 5E1ZB 2PEXA 1ZYRF 2CWEA 1HKTA 1ZH5A 1BJAA 5K5QA 1MD0A 2PG4A 4F7ZA 4M73A 5L3BA 4CXFA 1MDMA 2QBYA 3ZN0A 3HSFA 3ZP5A 4R8HA 4UV9A 3IKVA 3DPLC 1Z9CA 5A2QZ 2FU4A 5HLGA 3C7JA 3I64A 4GYGA 4O6JA 3M9AA 2OD5A 2UWMA 2G9WA 4XRFA 5LGNA 3BJ6A 5DCMA 3HTUA 3F8NA 1SD7A 2QUFA 5E8GA 4RGUA 1XGSA 3V8LA 1IXCA 1OPCA 2QBYB 3I54A 1ZGAA 1IUYA 2VBWA 5KVRA 1F5TA 4RGRA 2NS0A 1IN5A 1XD7A 1K78A 2DAOA 2GWRA 2L4AA 2HR3A 3K69A 4OINF 2QQ9A 1XSXA 2UXNA 3E97A 2DFIA 2RDPA 1TNSA 1LEAA 3SZPA 2BGCA 2Z5UA 4K2EA 4CDGA 2E1NA 3ABUA 3ZMSA 4XLPF 5HOOA 2OU2A 2JSCA 4ESJA 4DQ2A 2Y75A 1V4RA 4UV8A 3WTSC 4M9XA 4IRHA 3P7NA 2IW5A 2LNBA 4EGZA 5F64A 4YFXF 1YO5C 1KYWA 5D6FA 1Z6RA 4I98B 3M8EA 4Q4ZF 2WWYA 2ETHA 3F6OA 4CHUA 4ZH4F 4S05A 2P5KA 1XGMA 4LK0F 4OU0A 1WI9A 1KU3A 3CTAA 2COMA 4G6QA 1UHMA 2M8EA 2EV6A 1YS7A 1Z7UA 2DQLA 2XKOA 4XBFA 2W24A 4HLYA 5ED4A 1EH7A 2IA1A 2EA4A 2GIVA 2LSOA 1RZ4A 1IN8A 1FYKA 1B1BA 2RQPA 1ZGJA 3TGNA 1CF7B 3MZHA 3FXRA 2ISYA 1DPRA 1DUXC 3L2CA 5FD6A 1SD4A 3WE2A 2CSOA 1ZARA 4P9FA 3EQLF 4I2OA 1TW2A 2QLZA 4IJAA 2FA5A 4YFKF 1BC8C 3BOQA 4G94A 2OZ6A 4MQ9F 2ZXJA 5LGTA 3G3ZA 1YS6A 1B6AA 1JHFA 4AIHA 1MJAA 3EYIA 4A0ZA 4LLGF 4FHTA 3F21A 2Q2EA 5HDNA 4WWCA 1BIBA 2HTSA 5AIQA 3Q9VA 4RAYA 5ILSA 4HV5A 3GFMA 5DCMB 4PZJA 3DP7A 3HOTA 2YPRA 1DPUA 3RYRA 3C1DA 3U1DA 1PP7U 1BI3A 4LMYA 2XRNA 3RPUA 4ASNA 3MQ0A 3I0TA 1NHAA 2V6CA 3KP3A 5L3DA 4HX8A 1ONVA 3QPTA 5FFZA 3WGHA 1U5TC 3J7AO 3WU1B 3FXQA 1FBQA 2A69F 1P4AA 1ON2A 1GXQA 3R60A 4UVCA 2CGPA 2A61A 5CVRA 1SFUA 3P9KA 4L9TA 2DU9A 2V1DA 3JAMK 3W6KB 3DQVC 3I59A 1O57A 4WCGA 1XGNA 5CVIA 1FSHA 2QQBA 1MZBA 2EK5A 2XAQA 3AAFA 2IT0A 4LD5A 3RKXA 1MKMA 5CVUA 1ZRDA 1XCVA 1QGPA 2ACJA 2X0LA 2FBHA 1IXSB 2EFNA 2O0YA 4WX9A 1A04A 3KP5A 2EV5A 2K02A 3S2WA 1J7KA 3RYPA 2V1UA 1SFEA 4ZYDA 4AWXB 3EYYA 1S8NA 2W85A 3T8RA 1KYZA 3KP7A 1Y0UA 5FO5A 2V79A 4RB2C 4CYDA 3R4KA 2ZO4A 4L0YB 2IA0A 1I1GA 1R5HA 3I5UA 1R1UA 1U8RA 3BPVA 4RB0A 2IPQX 5H6RA 1T38A 2M5WA 5BQTA 1MJBA 2VT2A 2AXLA 4I7HA 1J59A 4RGXA 3KP6A 5E1XA 2YSRA 4IF4A 1YIOA 3NEUA 3KP2A 3O3KA 1JE8A 4N9HA 3O6BB 4ZZLA 2DLLA 2VC1A 4L5JA 2Q0OA 4M72A 3JW4A 2DBBA 3GFLA 2K27A 4OIPF 4P96A 1LNWA 1UFMA 1YFHA 1IRGA 1JXSA 3CUQC 3WE3A 1RI7A 3E5XA 2JPBA 3V8JA 3SHFA 4GXOA 1O3SA 1HXDA 3E5QA 5ICGA 5D4SA 4U0YA 2K4JA 4A6EA 1W7PB 1D8JA 4A6DA 4G8XA 3BZ6A 4I09A 4Z2YA 4OIQF 1DDNA 4G9YA 5CYVA 3IWZA 4LFUA 5TJJA 5EEHA 2LF8A 4ENJA 4GGGA 2BV6A 2HYGD 3RKWA 4OMYA 1QO0D 1I6XA 2FSWA 1TQPA 3DF8A 2IVMA 1YLFA 4FX4A 5DEQA 4FT8A 5F6FA 1B9NA 4ZYEA 3G73A 3HSEA 5JR3A 3JTHA 2P5VA 1XSVA 3C18A 1EV7A 3T5XA 5D8KB 2O61A 3TKYA 2NRAC 2F5EA 3ZMUA 3H92A 1HW1A 3FM5A 1TBXA 1XMAA 4MEYF 2YR2A 5JVTA 2R7FA 4AVPA 1P4XA 3J81Z 2MLKA 2C6YA 3LAPA 1ON1A 3L00A 2P7VB 3LSTA 2FEZA 5H6QA 3F8FA 1Z05A 2ADUA 4BQAA 1FNNA 2VBXA 5AONA 4HZFA 3F8BA 1OYYA 5L3CA 5FLXK 1G3WA 3TDZC 3BP8A 1QBJA 3KZZA 1FC3A 4HDVA 2VBYA 1GXPA 2W57A 1HKQA 2HQRA 3QP6A 4LJZF 4M6YA 4BXUA 2E7WA 2HEOA 4HLXA 1S29A 4L9JA 3LQQA 1UB9A 4LG0B 1O3RA 5A2QK 2K7LA 5LEJA 4HOBA 2O03A 5DDGA 1HQCA 3R0AA 1MDMB 1G3SA 1IN7A 1T2KA 4U7DA 3HYIA 5ILUA 4OIOF 4HF1A 3TO9A 4RB1A 2H6BA 4I0BA 3E6CC 3KEQA 3IRRA 2EV0A 4ENNA 3D0SA 2L54A 1LDJA 2CG4A 4UNOA 4MEXF 1G4DA 4KUMA 4UVAA 3L9FA 1BC7C 2HDCA 2ZFWA 1J2XA 3VODA 2P6SA 1XSDA 2OQGA 1O3QA 3MZYA 5HDGA 5DD4A 4KMUX 4EM2A 2L01A 3OV8A 1XMKA 1ZRFA 1YW8A 1GHCA 1KU9A 4HQMA 2M1BA 1G3YA 5JI6A 4PGGA 5ICCA 5F1RA 4HX7A 3KETA 3WTZA 3LA2A 3N97A 1S7OA 1D3YA 2BEOA 1SFXA 1TW3A 2ZNYA 5FD5A 1FBUA 1B9MA 3V8KA 4HDUA 3VFZA 4D0PA 4Q5SF 2EJRA 3TOBA 3IC7A 1BBYA 3JSOA 4MTDA 1IZ1A 2XHKA 2FMYA 3CDHA 6PAXA 1ZG3A 4KYWA 2XKPA 4G7OF 4KIBA 1PDNC 4M9ZA 2VE9A 4KN7X 2H09A 2UZKA 2ZMEA 1RNLA 5LHIA 2DTRA 2DW4A 5D5UB 1I5ZA 4G6DA 4GCVA 4ZZDA 3P9IA 1C0WA 5IT9Z 4GO1A 2G7UA 2QZ8A 3MAJA 4EMSA 4S04A 3GVAA 2XVCA 2HZTA 4LB6B 3WTUC 2BE5F 5CJ9A 3ZN1A 3LAJA 1U5TB 2OBPA 3LA3A 3E5UA 2A5YB 2XAFA 5DYMA 1SAXA 2DO7A 3ZMTA 3GLXA 3GZ6A 3RKYA 1KQ0A 1LDKB 1BIAA 4HV6A 2STTA 1I1SA 4IHTA 2MA3A 4YIFA 3JTGA 5J8CA 1X3UA 4HA8A 1FX7A 4KICA 1SD5A 3W6JB 1T39A 2A6HF 2FOKA 2ZKZA 2FMLA 2K86A 2TDXA 1F1ZA 1HKSA 4UUVA 1LJ9A 4A0YA 2Z33A 1T0FA 3TDUC 4I0AA 1PUEE 4PGHA 1XDUA 3ZMZA 5HS9A 2IA2A 5FB2A 3ELKA 3CJNA 3K9TA 3ZMVA 3VB2A 4U88A 3RTRA 2YX4A 1UHWA 3COAC 3PQJA 1R58A 4BNCA 3QP5A 3HRTA 4BYYA 3JSPA 4OOIA 4N9IA 4IPAA 1XDSA 3IWFA 4CICA 4M74A 1KGSA 1HSTA 1R22A 2M87A 4LLNA 3F6VA 4ESFA 1R1VA 2CYYA 3H3UA 4XSZF 3MEXA 1LQ1A 1V3FA 1ODDA 3I4PA 2HTJA 2NYXA 4MHGA 4RAZA 2E7XA 4MQVA 4AIKA 1G3TA 1JHHA 3N4MA 2PI0A 1B4AA 1QNTA 1U78A 3WGGA 2GA2A 3BJAA 3BY6A 1EH6A 2IJLA 4YG2F 4YFNF 2A07F 3QU6A 2BBYA 1Z91A 4PCQA 2L4MA 5D5VB 1WQ2A 2HGCA 1KA8A 5K5RA 3EUHA 3B73A 1TLHB 1MGTA 3WG9A 2QM3A 4P55A 4A0XA 2FF4A 2VONA 4RS8A 4G7ZF 2XAHA 1OKRA 2QWWA 4IRIA 4ENKA 2XASA 3IHUA 2LDUA 4Y15A 5BPDA 5D8LB 2GXBA 3QOPA 3HUGA 3K2ZA 5L3EA 2L3DA 2ZMEB 1S6LA 5LHGA 1IN4A 3KZYA 4WXDA 1W4MA 4NHJA 1XN7A 3GO5A 3RJPA 3WTXC 1O3TA 3E6DA 4P9UA 1FPQA 1ZG1A 1IF1A 1D5VA 1Z1DA 2VOPA 5DUIA 5D5XB 4U0VA 2D2WA 1EH8A 4R79A 3J80K 4AIJA 4AD9A 2FNAA 1FY7A 3DKWA 1KU7A 2W25A 4B8XA 3GEZA 1GVJA 2EFWA 3K0LA 2O6GE 2M30A 4BH9A 5LLQA 1Q1HA 2XROA 4L9NA 1U3EM 1YW7A 2HQNA 3L09A 2XIGA 1ZRCA 2PLYA 4N0BA 1E17A 3FHZA 3SZTA 4BHCA 4I02A 3L7WA 3ERED 1BN5A 3KE2A 1ZAOA 2H6CA 2GZWA 4LGWA 3HRMA 2IRFG 3M1EA 2Z3YA 2R7DA 2DI3A 2DK8A 5DCFA 4LLLA 4WF2A 1QQIA 1CF7A 1YG2A 4BHPA 3CUQA 4ESBA 2QENA 3F8MA 2F2EA 2ZBKA 2OZUA 4IHSA 4QWQA 2PJPA 5HS8A 5ERIA 4HQEA 5DD8A 1RUOA 3WTVC 5BS6A 2B0LA 1P6RA 2KRFA 3DV8A 3MFKA 1HSJA 5BOXA 1R5GA 3SXYA 3E6BA 1DP7P 2FQ3A 4WK8F 1K7AA 3BDDA 4O5VA 1BM9A 1FOKA 5LRRA 1ZG5A 5LGUA 3PQKA 1HW5A 2DK5A 2X4HA 1FP1D 5ICEA 5L3GA 1IW7F 3HTSB 3FF5A 1XB4A 2QQAA 3LFKA 2GAUA 3GUDA 1ZLKA 2ESHA 5J8FA 2AS5F 1R23A 2ISZA 5LRSA 3MCZA 1QZYA 3OOPA 3WTYC 2H27A 2Q8KA 4M71A 1WSUA 2EA2A 4BAYA 2MLGA 1IN6A 3I71A 4WXHA 2Z99A 4LG0A 3HRUA 1S3JA 2EFOA 4M6XA 4Q47A 1FT9A 3RI4A 1H9GA 4UXNA 1SMYF 1TTYA 4P5OA 2A68F 4QLCU 3I53A 3LWFA 3F8CA 2ELHA 4HX4A 4ZYHA 3K1MA 1HW2A 2O8XA 4KT5C 2EWNA 4TV7A 3WGIA 2HFHA 4L0ZB 3VOEA 3V7SA 1FBSA 3V7CA 1J75A 4PDKA 2JT1A 3T0YA 3FXUA 2KIUA 4M9SA 2JTVA 5E20A 4KN4X 1UCRA 1YW9A 5D4RA 1BI2A 1ZN2A 3GFIA 3FMQA 1G6NA 3V7RA 2QVOA 1Z6TA 5BMZA 2RV8A 1J0RA 3M7GA 4EV0A 3GWZA 1L3LA 4R1HA 2P5LC 3FM3A 3LQRA 2NNNA 3QAHA 3IKTA 3ULQB 3HIFA 4G7HF 3DEUA 2W84A 1FP2A 3GX4X 4RB3C 4KFCA 2HWVA 5KK1A 2WV0A 3F3XA 4EJOA 1BI0A 1I27A 3H3ZA 2HS5A 4HBLA 5HLHA 2P4WA 5J6XA 1WRJA 2L02A 1JGSA 2VODA 3ROUA 4KA4A 3BJOA 5CLSA 5JHUA 1U2WA 2F5DA 2FNPA 4MNUA 2ZJ2A 3O2PE 3T8TA 2HKXA 1U6GA 2DQRA 2RN7A 1WWXA 2HYFA 4EGYA 2YX7A 4KDPA 1W7PD 1FZPB 1LVAA 2JZYA 2RC4A 2MD5A 3TOAA 3ML6A 2PFBA 1YYVA 4LK1F 1FLIA 4EJWA 3HHGA 3R0JA 4NB5A 4OIRF 3T1BA 2BYVE 4FX0A 1BI1A 1F9NA 5HDKA 3DPTA 4CO8A 3C3WA 2OA4A 3FWEA 2FRHA 4CZZA 3KFWX 2VXZA 3IRQA 3NQOA 4L18B 1R1TA 3WU0A 2KIFA 4ON0A 2XAGA 3ZMDA 5ILVA 1L0OC 1K6OA 1SD6A 4ENMA 3ZPLA 2LF7A 2ZCWA 1RUNA 1P4WA 4KMFA 4L5IA 2RGVA 1O7LA 3F23A 2GQQA 1P2FA 2WTEA 3FMSA 1OR7A 1T98A 2JRTA 4JQFA 1ZHFA 3R61A 5FGMA 3GW2A 2FXAA 3CLOA 3VEPA 2LKPA 4RGSA 2KJCA 4JK1X 1AOYA 4WXCA 1CGPA 1YTYA 4HF0A 3GXOA 3GF2A 3TO7A 1K78B 5TRDA 3F22A 1KQ9A 4IRGA 4A5MA 2MH9A 3KP4A 2J5PA 3P9CA 2FE3A 3GZ5A 3I59B 3WTTC 3KLOA 2E1CA 4E70A 5LBQA 4KIFA 4UHTA 1WKMA 5E17F 3J80Z 2VE8A 2A6EF 2P6TA 4A5NA 5JFRA 4EM1A 1STZA 2DT5A 1USSA 2XUBA 1IAWA 1QZZA 2D1HA 3QRFF 2VN2A 3E6MA 4DNCA 3FX3A 2D45A 3D5LA 2A3SA 2WC2A 3Q5FA 2OAZA 5L3FA 4A2UA 3WODF 3EETA 1SMTA 3JAMZ 2ESNA 5CVVA 5E8IA 1KQ8A 1QPMA 2P8TA 1U5TA 3K1NA 4O3MA 1ZLJA 5FFXA 3CO6C 3RPQA 1OYIA 2UXXA 5BPIA 3CUOA 4BHBA 2DPUA 4IXAA
chains in the Genus database with same CATH superfamily
1IRFA 1ETOA 2CFXA 2PMZA 4HNUA 2V1XA 1TNTA 3F72A 2LYCA 4ZYGA 1S7AA 1KU2A 4HW0A 2VQHA 4EM0B 1W7PA 1OMIA 3QU3A 3TO6A 1JTXA 1ULYA 2PMUA 3KLNA 5ICFA 1NG6A 5E1WA 1JKOC 5IOYA 2AQEA 4U7BA 5HNHA 2O7OA 1JUPA 3K4CA 2VJ5A 2JPCA 2RKHA 4L9VA 2XAJA 4MGRA 1LB2A 3QODA 3S32A 2Z16A 5K1YA 1SC7A 2CO5A 5H20A 2LTPA 1UG0A 2HKOA 1HDPA 1IG7A 5D5WB 4C30A 1Y8RB 5HS7A 4A3FJ 1OCTC 1EKEA 4YIIA 2W00A 4UUSB 4DZPA 2DA5A 4HF2A 5CVJA 1NH3A 3MWMA 5HLIA 1VTNC 3BG5A 3LA7A 2IAIA 4JOMA 1E3HA 2DOAA 3QPHA 4BBRJ 2A5WA 5IPAA 4LB5A 2M7AA 4NDLA 5IT3A 4UVBA 1FYLA 4GYIA 3ISPA 5GTIC 2YS9A 2M0CA 1R36A 3QWLA 3HDDA 2BZTA 3QOEA 2MH2A 3FK7A 3HSRA 5IT9K 1BW6A 3OYGA 2XSJC 3LSPA 3S2HJ 3BROA 1F4KA 3L2RA 3AG4H 1IDYA 2JA2A 3G1OA 5GAGJ 3B02A 3DBLB 4IZZA 3IAS2 3GLLA 4X0GA 2KJBA 1VQ5I 1PP8F 3JR9A 2OPTA 4H0EA 4EQQA 3I55I 3SQNA 5EG0A 1D8KA 5FKMA 5B1BH 4RLQA 2DA7A 1IXRC 4U0WA 1MBKA 4NUBA 2BXZA 2NOJB 1B72B 1FIPA 1YJ9I 1RESA 3BG6A 3PFIA 3U9GA 2PQ8A 4M3EA 2MC3A 4I6ZA 2IS4A 2AHQA 2EINH 1D1AA 3A01A 3BWGA 2RVCA 1DP3A 2QSGX 1LDDA 4XSXF 3DCFA 4Y13A 1R00A 2G7HA 5HVQC 1X3WB 2ZSHB 2OCCH 5IYBJ 3CCYA 3VPRA 5EG0B 2P0WA 2XGXA 1V5EA 2AO9A 4I01A 1AWCA 1H89C 4NQWA 3DKXA 3OYBA 1ZR2A 2K4BA 1RIOH 1S9HA 3CCLI 4KIGA 2BHYA 1W5CC 3Q9SA 3J7AY 1Z77A 3HOSA 3Q0UA 2I8DA 4HEA2 3ZQ7A 4XRMA 4ITVA 3GBGA 3WTWC 5FLMJ 1IC8A 4JX5A 1J9IA 5EJCA 3ABTA 1APLC 3CQZJ 5FLXZ 3FMRA 2GOMA 4NC6A 4BU2A 3KEOA 1LEBA 4EVIA 2Y0SN 4PJLA 3OMYA 2JUGA 3PNVA 2UV1A 2NXNB 5K7HA 4HAMA 1JI8A 1X1PA 3SFZA 3OR2C 5K5OA 2KKOA 1R5ID 4I99C 1MJ9A 1P92A 3CMYA 4MTEA 2Y0MA 2ZNZA 2QYOA 3LSHA 2XSDC 3KCCA 2YU3A 1SFKA 2M45A 2IP2A 5DUKA 2RNJA 3OYNA 4X1EA 1YX5A 3K1PA 1FYMA 2O8KA 1MBJA 4XLNF 3MZ8A 2P7CB 3ZCOA 1UELB 2X1EA 2F5FA 1BOAA 2KL4A 3TQNA 2FBKA 2DN0A 3I4MJ 1X19A 1FSEA 4EJVA 3DFGA 5DV5A 1J09A 1XS9A 1IJWC 1FTZA 3KYLA 1WH7A 3JRCA 4ANJA 3DXJF 3NRVA 1XPXA 3FBIB 4JBAA 2GA1A 1GV2A 3GFJA 1MMDA 2PMHA 3FZVA 5HNFA 2V6EA 1MMAA 2K3PA 3HHHA 2Z9OA 4XN0A 2GBYA 2JWTA 3GYHX 1XCBA 1REPC 4FCYA 4DIQA 3GTJJ 2I10A 2MSYA 1H0MA 1UAAA 2CW7A 2CQKA 1J5YA 2EFQA 2D1VA 4NC7A 4YELA 2XV4S 1OYWA 1R7JA 1JJ6C 4I76A 1OCOH 1VQ7I 1HBXG 3GTOJ 2X51A 2H1LA 2GXGA 3J7ZI 3LMMA 5AIPA 3BPXA 3OIPA 2STWA 1YQAA 1TQMA 3CO7C 4HYEA 2N8GA 1R4NB 4IVNA 4OMZA 2CU7A 4F52A 2XC7A 3E3VA 4KNYA 3RIRA 2EB7A 3FXKA 1TC3C 1W5TA 2KIMA 2CW0F 1H9TA 1O7FA 1LPQA 1RC9A 3F0CA 2MABA 5LHHA 4KJZA 1MIJA 1XGOA 1ZREA 2F5CA 3I58A 2FBIA 2FD5A 3M8FA 2NNYA 2NAZA 4U87A 1Y6IA 2MBFA 2HOEA 3CF2A 5IYCJ 4D5FA 1W0UA 4Q48A 1T08B 3EDPA 3ZOBA 2VT3A 2VOOA 1B59A 1E2XA 3UNGC 3J81K 2R3SA 3A02A 3BR5A 3FXMA 1ETWA 2O3FA 3GMEA 1FIAA 2DXIA 2CV0A 4B43A 4D9JA 1K6YA 3OSGA 3BCBA 2EFPA 2E1OA 5E18F 4ETSA 1K79A 1XMXA 4J01A 1QVUA 5D6EA 2L5QA 2EZLA 3DPUA 1R6RA 2AQFA 2H94A 4XN3A 2PN6A 4Y4RA 3PFYA 3RZDJ 2DJNA 4EJTA 2KHMA 3CUQB 2R5ZB 2Y48A 3QYBA 5EEGA 5E79C 3U2RA 4RDUA 2V9VA 4BE0A 1TQIA 1W5SA 1FWZA 4Y17A 1QVTA 3K4JA 2ZSIB 3ECHA 2MFZA 2LKXA 1CQTA 3K7AJ 1T8IA 2VC0A 1USTA 5LEKA 3IL2A 3CMEI 2DPDA 3HRSA 4B09A 2VBZA 2WBMA 3R6SA 4W1UA 2M3AA 4D7NA 2M9HA 2PBIA 4A12A 2J5OA 3RDIA 4LIVA 1MBGA 3SEQA 3HOYJ 3AL0B 4EJUA 3REOA 1T56A 2O9LA 2M0MA 2AXTC 2E60A 2OQRA 4CGZA 3ECOA 3AKZA 3E1SA 3Q0VA 3V4GA 4ZTFA 1T6SA 5E1ZB 2PEXA 2VB6A 1ZYRF 4NQWB 2JVHA 2MD0A 2CWEA 1HKTA 1ZH5A 1BJAA 5K5QA 1GVDA 1MD0A 1Y0NA 2PG4A 1LE8B 1A6QA 3L1PA 4F7ZA 1OCZH 4M6VA 1HA8A 4PJNA 1XTAA 4M73A 1LFUP 5L3BA 2NVUB 4CXFA 4XICA 3B6AA 3IUOA 1MDMA 2QBYA 4EATA 4E7KA 3GZNB 3ZN0A 2DA6A 1FMWA 1BL0A 3HSFA 3FXLA 3OYCA 3ZP5A 2Y30A 4R8HA 3ZR8X 4UV9A 3E0JB 3IKVA 3D5RC 3DPLC 5IP6A 2B9SA 1Z9CA 5A2QZ 2FU4A 5HLGA 3C7JA 1FEXA 3ONQA 3BG7A 3I64A 3JRFA 4GYGA 4O6JA 3M9AA 2OD5A 3OYFA 2QCOA 2KMUA 2UWMA 2Z1DA 2OV7A 2XGCA 4XK4A 4HPQA 3H0GJ 2G9WA 5E3LA 3BQYA 4XRFA 2L9SA 5LGNA 3BJ6A 4CYCA 5K7ZA 4XKWA 5FJ8J 3G1MA 5DCMA 2EBIA 1HC8A 1VI0A 1X4PA 3HTUA 3CJQB 1ZR4A 3ZQFA 3F8NA 1SD7A 2QUFA 5E8GA 2E71A 4BJ5C 4XR6A 4IOAF 2KISA 4RGUA 1XGSA 3V8LA 3UR3C 1IXCA 1OPCA 1FOYA 2QBYB 3I54A 1T0FC 1ZGAA 1IUYA 2VBWA 5KVRA 1F5TA 3E7LA 1FMVA 1Y39A 3OL4A 2NVQJ 1N78A 4YIRX 3H3VK 1HDDC 2LD5A 3RZOJ 4RGRA 2NS0A 2IXSA 2LR8A 3DKYA 3S17J 2R7SA 1FOXA 2ZJPF 4IX7A 1IN5A 3JCUC 4EEFG 1XD7A 1K78A 3BZCA 2DAOA 4A3BJ 1G2HA 1I39A 2GWRA 3HZJA 3V42A 2OTJI 2K9MA 2L4AA 2HR3A 3K69A 1H88C 4OAYA 2FJ1A 1SFOJ 3W2AA 4OINF 4RLFA 1JUMA 2QQ9A 3NARA 1XSXA 4Z6YA 2UXNA 3E97A 2DFIA 2RDPA 1TNSA 1LEAA 3CDIA 3ZQLA 3SZPA 2VKDA 2BGCA 2KDZA 5J4VA 2Z5UA 1YOVB 2DT7B 3WG7H 3DLLF 4K2EA 4CDGA 2E1NA 2O5RA 3ABUA 3ZMSA 2KZGA 4HSTA 4UUTA 4XLPF 1X2NA 2CQXA 5HOOA 2OU2A 3AG1H 2JSCA 2X1DA 2VPRA 2Z2SB 4ESJA 2GM4A 4DQ2A 5FRMA 2Y75A 1V4RA 2DT6A 2BW3A 4UV8A 3RQIA 2R0QC 2JVGA 3DTKA 3WTSC 4M9XA 4IRHA 5F0CA 2L7MP 3P7NA 2IW5A 2LNBA 4EGZA 5EDNA 5F64A 4YFXF 1YO5C 1KYWA 5D6FA 4JX6A 1Z6RA 3LSKA 4I98B 2FX0A 3M8EA 4Q4ZF 2WWYA 2ETHA 3CMAI 4IHWA 3F6OA 3JRAA 1NTCA 4CHUA 4ZH4F 5TGTA 2BY1A 4S05A 1HLVA 2P5KA 3LSGA 1XGMA 4LK0F 1R49A 4CCOA 4OU0A 4FQGA 5E3NA 1WI9A 3HOZJ 1BJZA 1KU3A 2ELJA 3CTAA 3PUFA 1MW7A 5J1RA 2COMA 4II3A 2LFBA 4G6QA 1UHMA 2M8EA 1R71A 4RAGA 2G0EA 2EV6A 4A3CJ 1YS7A 4BQOA 5IP7J 4H4KC 3CCRI 1Z7UA 2DQLA 2XKOA 3KYCB 1JGGA 2R7OA 4DBRA 5GP9A 5E3MA 2D5VA 3CCEI 4XBFA 2W24A 4HLYA 5ED4A 3ZQQA 2RQQA 1EH7A 2IA1A 3D1NI 2EA4A 1JTYA 2GIVA 2ZXHA 3WHCA 2LSOA 1RZ4A 1IN8A 2L9VA 4E6KG 5CKTA 4OAZA 5FLVA 1Z67A 3FKJA 1FYKA 1X4OA 1B1BA 2RQPA 1ZGJA 3TGNA 1CF7B 4Y52J 3MZHA 2LK2A 5J47A 3FXRA 1A35A 2ISYA 1U9OA 4RM2A 2HDWA 1DPRA 1S72I 1DUXC 3L2CA 3CD6I 1Q1VA 5FD6A 1TP4A 1SD4A 3WE2A 2CSOA 1ZARA 4P9FA 3EQLF 4I2OA 1JT6A 1TW2A 2QLZA 4RM3A 2COBA 4IJAA 3K6GA 2FA5A 4YFKF 1BC8C 1VQ6I 1U8BA 3BOQA 3HPHA 4G94A 2ZJQF 2OZ6A 4MQ9F 2IGKA 2JSPA 2ZXJA 5LGTA 4BXXJ 3G3ZA 3IP4B 4M3DA 5C44J 4KISA 1YS6A 2WB1A 3JRDA 4BE2A 1B6AA 4D7MA 2EZKA 2KIQA 3BTLA 3SYTA 1JHFA 4DOZA 4AIHA 1DGWY 1MJAA 1T33A 3SDBA 4DZJA 3EYIA 4A0ZA 3HKZN 1FTTA 1KONA 2M8GX 4LLGF 2GOXB 4FHTA 3F21A 2Q2EA 5HDNA 3G4SI 4WWCA 5JHFA 1BIBA 2HTSA 5AIQA 2B7EA 3Q9VA 4PUSA 4RAYA 1WVRA 5ILSA 5KAIC 4HV5A 3GFMA 5DCMB 4PZJA 1O4XA 2XF7A 3DP7A 1TWAJ 3K4NA 3TP3A 3HOTA 2YPRA 3K4LA 1OFCX 1DPUA 1X3ZB 3RYRA 2CH0A 3C1DA 1QZEA 2FOWA 3U1DA 1PP7U 1BI3A 3KEYA 4LMYA 2XRNA 4LIUA 1JKQC 3RPUA 4ASNA 3MQ0A 2DOEA 1AKHB 3I0TA 1ZQ3P 2JUCA 3PIOF 1WZ2A 1NHAA 2V6CA 3OIQA 1VQMI 3KP3A 4MLOA 3DTIA 4L5EA 5L3DA 4HX8A 1ONVA 3QPTA 4XKVA 5FFZA 2JA8J 3WGHA 1U5TC 2CRGA 3J7AO 3WU1B 2QSHX 3FXQA 1FBQA 2A69F 3H5NA 1P4AA 2KRHA 1ON2A 1GXQA 3R60A 4UVCA 2CGPA 2HPIA 2A61A 5CVRA 1SFUA 3P9KA 4L9TA 2DU9A 4NBQA 2V1DA 4F55A 3W6KB 3JAMK 2L9RA 3DQVC 3EUHC 3I59A 5LFAA 1O57A 3OWTA 4WCGA 3H0DA 1XGNA 1WJBA 2E5NA 2LP0A 5CVIA 3CJTB 1FSHA 2QQBA 1MZBA 3PM1A 2EK5A 2XAQA 3AAFA 2V9KA 3ZQHA 2IT0A 2E1MC 4LD5A 3K4KA 4LOCA 3RKXA 2F4IA 1MKMA 5CVUA 1NK2P 1P9QC 4XLEA 1ZRDA 3S2DJ 4BY7J 1XCVA 1QGPA 3TW7A 2ACJA 2X0LA 2R93J 2DA3A 2FBHA 2XB5A 2X9DA 1QHHD 1IXSB 2EFNA 2O0YA 4WX9A 3ASOH 1A04A 3KP5A 2EV5A 1I3QJ 2K02A 3OIOA 2IS1A 3AG2H 1K4TA 3S2WA 1J7KA 3BQZA 2JA6J 3RYPA 2V1UA 1SFEA 3H9GA 4ZYDA 4AWXB 4AIDA 3EYYA 1S8NA 2HQAA 2W85A 3T8RA 2ME6A 4C9YA 2CV1A 5GADJ 1KYZA 1W1WE 3KP7A 1VQ8I 1ITYA 4QSHA 2K9SA 2EILH 1Y0UA 2PX9A 3M1CA 2E34A 5FO5A 2V79A 4DYRA 4RB2C 4CYDA 4G6TB 3R4KA 2ZO4A 4L0YB 3HOVJ 2E2IJ 2IA0A 1RRJA 1I1GA 1R5HA 3I5UA 1R1UA 2W7NA 5IP9J 4A3JJ 2F6CA 2LY9A 1U8RA 1GV5A 2KZVA 3Q0WA 5GPCA 3BPVA 4RB0A 3FHNA 3ZQGA 2HVQA 2IPQX 1VQOI 5H6RA 1T38A 2IGMA 2M5WA 5BQTA 5KHDA 1MJBA 1JT0A 2VT2A 2AXLA 4I7HA 1J59A 2KP6A 2E19A 4RGXA 5C4JJ 4XLCA 2DFEA 4DYQA 5CPRB 3VYSB 5BNGA 2WAQA 3KP6A 5E1XA 2DFHA 1QU3A 1Z3XA 2YSRA 4IF4A 1YIOA 3NEUA 3FIWA 3KP2A 1LUJB 4XM3A 3O3KA 3A1YA 3M07A 2EIKH 1JE8A 4FETA 4N9HA 2OUMA 3O6BB 4ZZLA 2DLLA 2ICWG 4YRVA 1WGXA 3N05A 3Q3SA 2VC1A 4L5JA 2BY3A 4E7LA 1W36D 1EJ9A 3BTIA 1P7JA 3LL7A 2HOTA 4IOCF 2R4GA 2XPVA 2Q0OA 4M72A 1DU6A 2ID6A 3JW4A 2DBBA 4Y7NJ 3GFLA 4AYBN 2K27A 4OIPF 3S15J 1WJCA 4P96A 4E7IA 1LNWA 1YIJI 4PSXA 1UFMA 1UG2A 1YFHA 2B63J 4E7SA 1V5GA 1IRGA 2VIXA 5EEAA 2XRLA 1JXSA 3CUQC 4IKFA 2DDBA 3WE3A 1RI7A 1UJ8A 3CMMA 1D5YA 3OSFA 3E5XA 1IO2A 2BVLA 2JPBA 1YI2I 3V8JA 1IUFA 1QHGA 3SHFA 4XIDA 4GXOA 3H9JA 1QA6A 1O3SA 4OWRB 1HXDA 3E5QA 5F08A 5ICGA 5D4SA 1D0XA 5J1UA 4U0YA 2K4JA 4C3IJ 3AL0C 4A6EA 4IO9F 9ANTA 1W7PB 1D8JA 4A6DA 2RNGA 2K3FA 3CCQI 2XAUA 4G8XA 3VSKA 4LG3A 1MSFC 3BZ6A 2R5YA 2ZMEC 3BR3A 4I09A 4PFOA 5B66C 4Z2YA 3I56I 1UHSA 4OIQF 1A5JA 1M1EB 2XDVA 1DDNA 4XKCA 2BVMA 5JVGF 3S3NA 5B5EC 2VJIA 3PNYA 4G9YA 2MG4A 5CYVA 1VNDA 3IWZA 4LFUA 5TJJA 3CESA 5EEHA 2LF8A 1AU7A 4M3BA 2PJRA 2PMZN 4ENJA 4GGGA 4B47A 2NVXJ 3MKWB 2BV6A 2HYGD 3RKWA 2E2HJ 2DA2A 2V4JC 1LKXA 4XLAA 4OMYA 2MW8A 5IOZA 1QO0D 1I6XA 3A03A 1IV6A 4B1RA 3BR6A 2FSWA 1TQPA 1A6IA 3DF8A 2JJ7A 4D5CA 2HOAA 2IVMA 2JA7J 4S0HB 1YLFA 4A3DJ 5DM6F 2XF6A 4IQJA 4FX4A 3TMOA 3GTQJ 2Q1ZB 4FISA 2VASA 5DEQA 4FT8A 5F6FA 2IGNA 1B9NA 4ZYEA 2EIJH 3G73A 1VQPI 3HSEA 1IV8A 5JR3A 3JTHA 2VLAA 2P5VA 1XSVA 3C18A 3BLYA 1EV7A 1Y8QB 3T5XA 5D8KB 1H8AC 4BBSJ 4G12A 2O61A 5EGOB 3ERMA 2LRDA 2M4KA 3TKYA 2NRAC 3VYUB 1MMGA 3PO2J 3PSFA 2F5EA 4NC8A 3EPZA 3ZMUA 3OS1A 3H92A 1HW1A 3LNQA 2R7UA 3HL2A 1MH4A 2HQ5A 4PJMA 4CH7A 3FM5A 3C2HA 1TBXA 5JLXA 2BOLA 1R9TJ 1XMAA 2UUZA 4XORA 3HOWJ 4MEYF 2YR2A 3DBRB 5J3LA 4BJTA 3CC7I 4BXFA 5JVTA 3DTEA 3MKLA 2R7FA 3H36A 4AVPA 1P4XA 3J81Z 4ZDLA 1TWHJ 2OF7A 3DU6A 2MLKA 2C6YA 4DYCA 3LAPA 1ON1A 2CV2A 2LVSA 3HC7A 3L00A 2P7VB 3CCMI 1D1BA 3IH2A 3LSTA 2FEZA 5H6QA 3F8FA 1Z05A 2ADUA 2ECBA 1RR8C 3VDXA 5M3MJ 4BQAA 1FNNA 2VBXA 2TRTA 5AONA 1HOMA 3KZIC 3F8BA 1OYYA 3PSIA 4HZFA 5L3CA 5FLXK 1G3WA 2RREA 5F1JA 3TDZC 3ABMH 3BP8A 3FXJA 1QBJA 3KZZA 1E0EA 1FC3A 4HDVA 1VF9A 3S3OA 2DYRH 2R7VA 2VBYA 1GXPA 2W57A 1HKQA 3UKGA 2HQRA 4A3KJ 2E5ZA 3QP6A 4N4OB 2JA5J 1JJ8C 2LY2A 2X6WA 3OOUA 4F93B 2M34A 4IHYA 4LJZF 1TWFJ 4M6YA 2CFOA 2E7WA 4BXUA 2HEOA 3BR0A 2IGOA 4HLXA 1S29A 1TZLA 2MC4A 2OCEA 4L9JA 3LQQA 4FE4A 1UB9A 4LG0B 3BT9A 1O3RA 4QPQA 2K7LA 4UB6C 5LEJA 4HOBA 5A2QK 2X6YA 2O03A 5DDGA 4XOTA 1HQCA 3R0AA 1MDMB 2Y0SA 1X2MA 1G3SA 1IN7A 2VXDA 1T2KA 4U7DA 2ZC2A 3HYIA 2EPFA 3M8JA 5ILUA 2Y9ZA 4OIOF 1PYVA 1WH5A 2WY8Q 2RAEA 3F9KA 3PUBA 5GTHC 2DDAA 3TO9A 4RB1A 4HF1A 2H6BA 2F48A 1E3OC 4I0BA 5HLTA 3E6CC 3KEQA 4DJAA 2P81A 1WJAA 3IRRA 2EV0A 3JRIA 2KFDA 4ENNA 4CA0A 1RKWA 3D0SA 4F92B 2L54A 3JRHA 1LDJA 2F4MB 4N4NB 2R7XA 2CG4A 4UNOA 3M3YJ 4MEXF 3GTGJ 1G4DA 4KUMA 4UVAA 1WFXA 3L9FA 2X6XA 1HCRA 3AFHA 1B8IB 1BC7C 2HDCA 2ZFWA 1J2XA 2NS7A 4E4HA 2VQCA 3VODA 2CS3A 2L0KA 2P6SA 5EGOA 1XSDA 2OQGA 1O3QA 1PJRA 3MZYA 5HDGA 2VJJA 5DD4A 1OISA 4KMUX 1ETYA 3WU2C 3OY9A 2HXOA 4EM2A 1D0YA 3BZKA 1LFPA 2L01A 5FKKA 3OV8A 1XMKA 1ZRFA 1YW8A 1GHCA 2CQQA 2XGEA 1KU9A 3QPLA 2M1BA 4HQMA 1G3YA 4PK4A 2L2OA 4A93J 5JI6A 2KDOA 4PGGA 5ICCA 5F1RA 4HX7A 4BS9A 3QPSA 3KETA 1N25A 3WTZA 2LBFA 2CUJA 2WAEA 1GUUA 2X85A 3LA2A 4CSWA 3S14J 2PJRB 1X1AA 4C2MJ 4QPOA 3JREA 1S7OA 3N97A 4BJ6C 5DS9A 1D3YA 2BEOA 5F27A 1SFXA 4BEHB 2EIMH 1TW3A 4BKXA 3OYDA 1G8XA 2ZNYA 3G6EI 4C2UA 1ZELA 5FD5A 3QYFA 1FBUA 1ACIA 1B9MA 2F4OB 3V8KA 4HDUA 2VPLA 5H2FC 5J40A 4MO7A 1S5LC 2QKMB 3VFZA 4D0PA 4Q5SF 2EJRA 3TOBA 4AUXA 3BR2A 3IC7A 1BBYA 3JSOA 2XPUA 3DU5A 1TT5B 4YEJA 2VQGA 4MTDA 2LBFB 1IZ1A 2XHKA 2FMYA 3CDHA 6PAXA 2WA0A 1ZG3A 3CLQA 1DQUA 4KYWA 2XKPA 4JP0A 4G7OF 4KIBA 1PDNC 1GT0C 2CJJA 4M9ZA 2VE9A 4IL6C 4KN7X 3S1QJ 2H09A 4XNFA 2UZKA 1ETQA 2ZMEA 1RNLA 1Z21A 2K85A 5LHIA 2DTRA 2DW4A 5FROA 5D5UB 1I5ZA 3CJRB 1SAUA 2ELKA 3OYKA 4G6DA 2QGUA 4PJJA 2E36A 4GCVA 3CCSI 1OCCH 1K4SA 5EZGA 4XL9A 4ZZDA 5B3SH 3P9IA 1C0WA 5IT9Z 3ZXSA 3AG3H 2G7UA 4GO1A 2VQLA 2QZ8A 3MAJA 2H1KA 1U9NA 4EMSA 4GDFA 4S04A 1VZ0A 3RQ4A 4HSRA 3PIPF 3GVAA 2W1OA 2KRCA 2IEKA 3VSLA 1OCPA 2XVCA 2HZTA 4LB6B 2BE5F 5CJ9A 3ZN1A 4ZJZA 3WTUC 3LAJA 1U5TB 2OBPA 3EUAA 1SVOA 3LA3A 3E5UA 4B3AA 3L2QA 2A5YB 2XAFA 5F0HA 1GLNA 1IRXA 3S1MJ 5DYMA 1SAXA 1W36C 3DEWA 2DO7A 3ZMTA 3GLXA 3GZ6A 2DOFA 1E3PA 3GCMA 3RKYA 3LSRA 1I50J 3GTMJ 2DYSH 1KQ0A 2WY7Q 4XLFA 1LDKB 1BIAA 4HV6A 3CCUI 2STTA 4A3LJ 1RR7A 1I1SA 4IHTA 2MA3A 4FASD 4YIFA 5J8CA 1X3UA 3JTGA 2VKVA 2V26A 5TISC 2M7BA 3JRGA 2NVYJ 4HA8A 1FX7A 2E1MB 4HG2A 4KICA 1SD5A 3W6JB 1A31A 3HJEA 1Z3YA 2QKLB 1POGA 1Z0XA 1T39A 2A6HF 4MFEA 1HF0A 2FOKA 4ABZA 2ZKZA 2FMLA 2WV1A 1OLTA 1R4MB 2K86A 3MD2A 2TDXA 3LOCA 3QQAA 1F1ZA 4IEJA 2I5UA 1HKSA 4UUVA 1LJ9A 1ZKGA 2DJIA 3HOXJ 1RKTA 4A0YA 2Z33A 3CC4I 2F5VA 1T0FA 1QRYA 3TDUC 5DTDA 3IV5A 4I0AA 4XQFA 1PUEE 3GTKJ 4B3XA 4RA2A 3KX2A 4PGHA 2DFFA 1XDUA 3K4MA 3ZMZA 3G1LA 3LSIA 4GFBA 2R5YB 2IS2A 5HS9A 2IA2A 5FB2A 3ELKA 3CJNA 3K9TA 3ZMVA 3VB2A 2DTZA 4HNTA 4U88A 4ZDPA 3RTRA 2YX4A 3MMYB 1WPKA 1UHWA 3COAC 3HPGA 3PQJA 5GPAA 1R58A 5EYRA 3WHBA 4BNCA 3QP5A 3HRTA 4BYYA 3JSPA 1UZCA 4OOIA 4N9IA 3U1KA 3G71I 2R7TA 3SEZA 4IPAA 1XDSA 3IWFA 4CICA 4HRIA 4M74A 1KGSA 1X58A 3TP0A 3VWBA 3K4BA 4AVZA 1HSTA 1R22A 2M87A 3F6VA 2M2EA 4RMNA 4XMYA 1R1VA 4ESFA 1FOWA 4LLNA 2CYYA 3H3UA 5CQEA 4XSZF 3ABKH 3MEXA 1LQ1A 1V3FA 1ODDA 3CP8A 4AU7A 3I4PA 2HTJA 4NNJA 2NYXA 4MHGA 4BQQA 4RAZA 2E7XA 1SVLA 2ZFUA 2NOGA 4LITA 2BW3B 2JMWA 2KLOA 4MQVA 4AIKA 2K40A 1G3TA 2OJED 2BXYA 1JHHA 3N4MA 1TWGJ 4KT6A 5GAHJ 2PI0A 3K2AA 1B4AA 1QNTA 2CQNA 3MKZA 3BG3A 1Y56A 4C3HJ 3D5SC 5J1YA 2ZXWH 1U78A 3WGGA 4A3MJ 2GA2A 3BJAA 2DMPA 3BY6A 1EH6A 2IJLA 1OR7C 2VL8A 4YG2F 3S1NJ 4YFNF 4A3GJ 1WHUA 2A07F 3QU6A 2BBYA 1Z91A 1YITI 5E3OA 4PCQA 4XRSG 2L4MA 1X1BA 2HDDA 5D5VB 1WQ2A 1SANA 2HGCA 2K5CA 1MMNA 4IHVA 1BOBA 1OQYA 1KA8A 5K5RA 3EUHA 2R7WA 3B73A 3K10A 2EH3A 1TLHB 1MGTA 3WG9A 2QM3A 3CCVI 3HGGA 3BTJA 4QTRA 4P55A 2Y9YA 4A0XA 2FF4A 2VONA 2K9NA 4RS8A 4G7ZF 2XAHA 1OKRA 2QWWA 4IRIA 1F36A 4B44A 2XASA 4ENKA 3HEFA 3X2QH 4BDZA 3RSNA 4BL0B 3IHUA 3OS2A 1VQNI 2LDUA 4Y15A 3PJRA 5BPDA 5D8LB 1ERDA 2GXBA 3QOPA 3HUGA 5HODA 4C2TA 3K2ZA 1KZHA 5L3EA 4C3JJ 2L3DA 2ZMEB 3RPUD 1S6LA 5FKOA 2QA4I 3OL3A 5LHGA 1IN4A 3KZYA 3LFUA 1X1DA 4WXDA 1W4MA 5FKLA 3ABLH 4NHJA 1DU0A 5F0FA 1XN7A 2H8WA 2W4SA 3BG9A 4CCLA 4CCMA 5FRNA 2EQRA 3GO5A 3RJPA 3WTXC 1O3TA 3E6DA 4DBQA 4P9UA 1OCRH 1AHDP 1FPQA 1ZG1A 1IF1A 3OYHA 1Z1DA 4ZTJA 1D5VA 2VOPA 4BE1A 3GTPJ 1V54H 3HB9A 5DUIA 1N77A 4Y33A 4U0VA 5D5XB 2D2WA 2L7FP 2MYSA 1EH8A 1K83J 3JRBA 1IGNA 4R79A 4X6AJ 3J80K 4AIJA 4AD9A 1YE9A 1FY7A 2E35A 2FNAA 1VQ4I 3DKWA 2HU9A 1Y1VJ 2NVTJ 1ZK8A 1KU7A 2W25A 4B8XA 1S7EA 3GEZA 1GVJA 3VYTB 2ZXIA 2EFWA 3K0LA 1WCMJ 3CCJI 2O6GE 3I9V2 2M30A 1YX3A 4BH9A 5LLQA 1Q1HA 4L9NA 2XROA 1YW7A 1U3EM 4BUPA 2OTLI 1B8IA 2WAFA 4XRSA 2HQNA 3DWLE 3L09A 1U0JA 2XIGA 1ZRCA 3W2VA 2PLYA 4CCNA 2BY2A 3LSMA 2HNHA 4N0BA 1E17A 3FHZA 3SZTA 4E7JA 4BHCA 4I02A 3L7WA 3ERED 1ENHA 1BN5A 2NS8A 3KE2A 1RETA 1ZAOA 2H6CA 1MNDA 2LKSA 5KAFC 3OS0A 4UY8I 1VQKI 2CW8A 2DODA 2GZWA 1JKPC 1AKHA 4LGWA 2LY1A 3HRMA 2JQ7A 3C2BA 2IRFG 3M1EA 1XX5A 2Z3YA 1AA7A 5M5XJ 2R7DA 2DI3A 5CQGA 2ZB9A 4ZC3A 2DK8A 5DCFA 4LLLA 4WF2A 1QQIA 1CF7A 1YG2A 4BHPA 3CUQA 1EF4A 1LVKA 4ESBA 2QENA 2KPMA 3SDGA 2K9LA 1K61A 4BGDA 3F8MA 2F2EA 2ZBKA 3NWSA 2OZUA 4IHSA 3NWTA 4E7HA 5F04A 2R7RA 4QWQA 2PJPA 5HS8A 3W2WA 5ERIA 1XC5A 2DA1A 4MIMA 4HQEA 5DD8A 1RUOA 3WTVC 2MGQA 5BS6A 2B0LA 5K7FA 1P6RA 2ME0A 2KRFA 3A2KA 3S1RJ 1YJWI 1I3AA 3DV8A 1ORKA 3MFKA 1HSJA 5BOXA 3FDYA 4DGWB 3C2GA 3VYRB 3H1CA 1R5GA 3SXYA 3E6BA 5IY5H 1DP7P 3P5JA 3SFIA 2DMTA 2FQ3A 2Y2ZA 2CMPA 3TW6A 4WK8F 3FISA 1K7AA 3BCAA 3BDDA 4O5VA 2EZHA 3HOUJ 1BM9A 1V5FA 3H9QA 1GDTA 5JLWA 2R7QA 1FOKA 2L7KA 5LRRA 1ZG5A 1MH3A 5LGUA 3PQKA 4XOPA 1MMSA 1DGRM 2M4GA 1HW5A 2DK5A 1PVEA 4IQ4A 2X4HA 5IYDJ 1P7IA 2JK3A 1FP1D 3CZ6A 3BTCA 5ICEA 1RPWA 2HPMA 5L3GA 1IW7F 2XPWA 3HTSB 4BY1J 2KQRA 3FF5A 1XB4A 1BR1A 2ZJRF 2QQAA 5LD2C 2HVSA 1WJDA 3LFKA 2GAUA 1A36A 3GUDA 1ZLKA 2ESHA 1I6HJ 3ZQCA 5J8FA 3I4NJ 2AS5F 1R23A 2DMNA 2X48A 3A0HC 3IAM2 3S8PA 5LRSA 2ISZA 3GTLJ 4XKBA 3MCZA 1VQLI 4AM3A 1QZYA 3OOPA 3WTYC 2H27A 4BACA 3HGYA 2Q8KA 4M71A 2ID3A 2EA2A 1WSUA 4BAYA 3BR1A 2MLGA 5KCMA 4A3EJ 1IN6A 1UMQA 3I71A 1D0ZA 3L2VA 4WXHA 2QSFX 2Z99A 3K70C 3PNTA 3FKIJ 4LG0A 3HRUA 1S3JA 1TWCJ 2LC2A 2EFOA 4BEHA 2ECCA 2CUFA 3BC8A 3DEEA 4M6XA 4Q47A 1FT9A 1PUFA 2W82A 3RI4A 5KNLA 1H9GA 4UXNA 1SMYF 3DBHB 1TTYA 1WJEA 2A68F 4P5OA 4QLCU 3I53A 3LWFA 3F8CA 1ETVA 2ELHA 3A4CA 1NK3P 2GLOA 4HX4A 4RAFA 4ZYHA 3K1MA 1HW2A 3RKQA 2O8XA 2CUZA 4KT5C 2BY0A 2EWNA 1Z7LA 4TV7A 1W0TA 3WGIA 2HFHA 4L0ZB 2V7FA 3VOEA 3V7SA 1FBSA 3V7CA 1QPIA 2FQ4A 1J75A 3KIOA 4PDKA 2JT1A 3T0YA 4CCKA 2WAQN 3FXUA 3M4OJ 3A01B 2W48A 2KIUA 4M9SA 2JTVA 2WB1N 4ZYAA 2LMDA 1X1CA 5E20A 4KN4X 2VJ4A 1MBEA 1UCRA 1YW9A 1BA5A 2CQ7A 1V55H 3HM5A 1BI2A 5D4RA 1VFCA 2X1CA 3L2UA 3B6CA 2QQ8A 1ZN2A 3GFIA 4CUGA 3HKZA 3FBNB 3U21A 2R5ZA 3FMQA 1G6NA 2FUG2 2HYJA 2QVOA 3V7RA 1Z6TA 5BMZA 2BHZA 2RV8A 1J0RA 3OYMA 3M7GA 4EV0A 2QEXI 3GWZA 1L3LA 3HUGB 4R1HA 2P5LC 4E7ZA 3EUKL 3ZRGA 3FM3A 3K70D 3LQRA 2NNNA 3QAHA 3H35A 3IKTA 3ULQB 3HIFA 2HVRA 4JX4A 2OC6A 4G7HF 3DEUA 2VKHA 2W84A 3FXOA 1FP2A 4A69C 1G59A 2Y69H 3GX4X 1MSEC 1LE8A 4RB3C 4V2FA 4KFCA 2HWVA 5KK1A 5M3FJ 2WV0A 3KPHA 4KITB 3F3XA 3ESWB 4EJOA 1BI0A 3HG9A 1SVMA 5DM7F 3CP2A 1I27A 5GAEJ 2L7ZA 3PO3J 3H3ZA 2GXAA 2HS5A 4HBLA 2JN6A 3J7YJ 5HLHA 3NAUA 2P4WA 2XGDA 5J6XA 2IBDA 4W97A 1WRJA 2L9NA 3SZGA 1MBHA 2L02A 1JGSA 5C3EJ 2VODA 3ROUA 4KA4A 3BJOA 5CLSA 1B72A 5JHUA 1OJLA 1U2WA 3OR1C 2F5DA 2DA4A 2FNPA 4DW6A 4MNUA 3ASNH 2V1NA 1YRNA 4F3QA 5M5YJ 2ZJ2A 3O2PE 3PL8A 1BR2A 3T8TA 3H5AA 4UUSA 3O8HA 2DCEA 2KT0A 2HKXA 1LFBA 1U6GA 2DQRA 2HZDA 2E2JJ 2RN7A 1WWXA 2HYFA 1JKRC 2HOSA 1TL8A 4QIWN 4EGYA 4M3FA 1WJ5A 2YX7A 4V19K 4KDPA 2JRMA 4MFDA 2LH9A 1BR4A 1W7PD 2LOOA 3ZGKA 1FZPB 2VKEA 1VQ9I 2DMUA 1LVAA 2JZYA 4A3IJ 2RC4A 2MD5A 3TOAA 4HNVA 2QF7A 3TEDA 1Y1WJ 3ML6A 2H8RA 2IS6A 2PFBA 3HXLA 3SJMA 1YYVA 4LK1F 4JYKA 2Q2EB 3TBIA 2LREA 1FLIA 4EJWA 4PJ0C 3HHGA 3R0JA 4NB5A 4OIRF 2YU9J 3ZQIA 4FTHA 1JUSA 4GRIA 4FE7A 3T1BA 2BYVE 4FX0A 1BI1A 1F9NA 5HDKA 3DPTA 1N75A 4CO8A 3C3WA 2OA4A 5C4XJ 2XF5A 1F43A 3FWEA 2A6TA 2GIZA 2FRHA 4CZZA 2LLKA 1BW5A 3KFWX 5FKNA 2VXZA 5EZHA 2VI6A 2DMQA 3NQOA 3IRQA 4L18B 1R1TA 3WU0A 1ETKA 2KIFA 4ON0A 1IDZA 2XAGA 3G2BA 3ZMDA 5ILVA 1MNMC 1L0OC 1K6OA 1SD6A 4ENMA 3ZPLA 2LF7A 2ZCWA 4M3GA 3CF5F 1PUFB 2CUEA 1RUNA 1P4WA 3OYIA 4KMFA 4L5IA 2RGVA 1O7LA 1D1CA 2GQQA 3RCOA 1P2FA 3F23A 3CC2I 2WTEA 2R7ZJ 3FMSA 1OR7A 1T98A 3IH4A 4II2A 4CCJA 4UB8C 2JRTA 4JQFA 1ZHFA 3O8GA 3R61A 5FGMA 3GW2A 2FXAA 3CLOA 3VEPA 3S16J 2LKPA 4RGSA 2A05A 4BQNA 5J4YA 2KJCA 4JK1X 2XB0X 4F91B 1IRZA 1ZGWA 3H5RA 1AOYA 3CDLA 4ZDOA 1T95A 4WXCA 3S93A 2VUMJ 1FJLA 1CGPA 1MNEA 1YTYA 2TCTA 4BDYA 2X6OA 1WJFA 4HF0A 4V2GA 4B48A 5M5WJ 1WI3A 3GXOA 1YRNB 3GF2A 3TO7A 3HBLA 1TT0A 4AYBA 1K78B 2YUSA 5TRDA 3F22A 1KQ9A 3W3CA 3OYJA 4IRGA 4A5MA 3OYEA 4J19A 5EF6A 4CZCA 4RBOA 2MH9A 3KP4A 3QYEA 4P1WA 1YHQI 2J5PA 3P9CA 3L2WA 2FE3A 3DLAA 3GZ5A 3KYDB 4B4CA 4IHXA 1NG7A 3I59B 3WTTC 3KLOA 4AC0A 2E1CA 3TL4X 4E70A 2WADA 3S3MA 5LBQA 4KIFA 4UHTA 2Y31A 1WKMA 5E17F 4Y3OA 3J80Z 4PSWA 2VE8A 1ZTRA 2K9QA 2A6EF 2P6TA 4A5NA 5JFRA 4EM1A 1STZA 2V9PA 2DT5A 1USSA 2XUBA 3FK6A 1IAWA 1QZZA 4J00A 2D1HA 3QRFF 2VN2A 1YJNI 3E6MA 3MN2A 4DNCA 3FX3A 2D45A 1XG1A 3D5LA 2A3SA 5B1AH 2WC2A 4CYCB 3Q5FA 2HI3A 2OAZA 5L3FA 3MVPA 3OYAA 3W6VA 4A2UA 3WODF 3EETA 1EA3A 1SMTA 4PFPA 3JAMZ 2R92J 2ESNA 3I3LA 3LSJA 4XLHA 5CVVA 5E8IA 2LG4A 1KQ8A 1QPMA 2P8TA 4XONA 2EZIA 3MKYB 1U5TA 3K1NA 1MBFA 4O3MA 1ETXA 1ZLJA 5FFXA 4D1QA 1OYIA 3RPQA 3CO6C 1SEUA 3IH3A 2HXIA 3A0BC 2UXXA 5BPIA 3CUOA 4BHBA 3OYLA 2DPUA 4IXAA
chains in the Genus database with same CATH topology
1IRFA 2CFXA 2V1XA 1TNTA 3F72A 4ZYGA 1S7AA 1KU2A 4HW0A 4EM0B 1W7PA 1OMIA 3QU3A 3TO6A 1ULYA 2PMUA 3KLNA 5ICFA 5E1WA 4U7BA 2JPCA 2RKHA 4L9VA 2XAJA 4MGRA 1LB2A 5K1YA 2CO5A 5H20A 2HKOA 5D5WB 5HS7A 4YIIA 4HF2A 5CVJA 3MWMA 5HLIA 1VTNC 3LA7A 3QPHA 4LB5A 5IT3A 1FYLA 4UVBA 4GYIA 3ISPA 1R36A 2MH2A 3HSRA 5IT9K 3BROA 1F4KA 3B02A 2KJBA 1PP8F 4H0EA 4EQQA 3SQNA 1D8KA 1IXRC 4U0WA 3PFIA 3U9GA 2PQ8A 2MC3A 3BWGA 2RVCA 1LDDA 4XSXF 4Y13A 1R00A 2G7HA 5HVQC 2XGXA 4I01A 1AWCA 4NQWA 1RIOH 2K4BA 4KIGA 3Q9SA 3HOSA 3ZQ7A 3WTWC 1J9IA 3ABTA 5FLXZ 3FMRA 3KEOA 1LEBA 4EVIA 4HAMA 3SFZA 5K5OA 2KKOA 1MJ9A 1P92A 4MTEA 2Y0MA 2ZNZA 2QYOA 3KCCA 2YU3A 2M45A 2IP2A 5DUKA 2RNJA 3K1PA 1FYMA 2P7CB 4XLNF 2F5FA 1BOAA 3TQNA 2FBKA 1FSEA 4EJVA 3DFGA 5DV5A 3DXJF 3NRVA 4JBAA 2GA1A 3GFJA 3FZVA 2PMHA 3HHHA 2Z9OA 3GYHX 1XCBA 1REPC 1H0MA 2CQKA 1J5YA 2EFQA 2D1VA 2XV4S 1OYWA 1R7JA 1HBXG 2GXGA 5AIPA 3BPXA 2STWA 1YQAA 1TQMA 3CO7C 4HYEA 4IVNA 4OMZA 3E3VA 4KNYA 3RIRA 2EB7A 1W5TA 2KIMA 2CW0F 1H9TA 1O7FA 5LHHA 1XGOA 1ZREA 2F5CA 3I58A 2FBIA 3M8FA 2NNYA 2NAZA 2MBFA 2HOEA 4Q48A 3EDPA 2VT3A 2VOOA 1B59A 1E2XA 3J81K 2R3SA 2O3FA 2EFPA 5E18F 4ETSA 1K79A 5D6EA 2H94A 2PN6A 4EJTA 3CUQB 2Y48A 5EEGA 3U2RA 2V9VA 1TQIA 1W5SA 1FWZA 4Y17A 3ECHA 2VC0A 1USTA 5LEKA 3IL2A 2DPDA 3HRSA 4B09A 2VBZA 3R6SA 2PBIA 4A12A 2J5OA 3RDIA 4EJUA 3REOA 2OQRA 4CGZA 3ECOA 3V4GA 1T6SA 5E1ZB 2PEXA 1ZYRF 2CWEA 1HKTA 1ZH5A 1BJAA 5K5QA 1MD0A 2PG4A 4F7ZA 4M73A 5L3BA 4CXFA 1MDMA 2QBYA 3ZN0A 3HSFA 3ZP5A 4R8HA 4UV9A 3IKVA 3DPLC 1Z9CA 5A2QZ 2FU4A 5HLGA 3C7JA 3I64A 4GYGA 4O6JA 3M9AA 2OD5A 2UWMA 2G9WA 4XRFA 5LGNA 3BJ6A 5DCMA 3HTUA 3F8NA 1SD7A 2QUFA 5E8GA 4RGUA 1XGSA 3V8LA 1IXCA 1OPCA 2QBYB 3I54A 1ZGAA 1IUYA 2VBWA 5KVRA 1F5TA 4RGRA 2NS0A 1IN5A 1XD7A 1K78A 2DAOA 2GWRA 2L4AA 2HR3A 3K69A 4OINF 2QQ9A 1XSXA 2UXNA 3E97A 2DFIA 2RDPA 1TNSA 1LEAA 3SZPA 2BGCA 2Z5UA 4K2EA 4CDGA 2E1NA 3ABUA 3ZMSA 4XLPF 5HOOA 2OU2A 2JSCA 4ESJA 4DQ2A 2Y75A 1V4RA 4UV8A 3WTSC 4M9XA 4IRHA 3P7NA 2IW5A 2LNBA 4EGZA 5F64A 4YFXF 1YO5C 1KYWA 5D6FA 1Z6RA 4I98B 3M8EA 4Q4ZF 2WWYA 2ETHA 3F6OA 4CHUA 4ZH4F 4S05A 2P5KA 1XGMA 4LK0F 4OU0A 1WI9A 1KU3A 3CTAA 2COMA 4G6QA 1UHMA 2M8EA 2EV6A 1YS7A 1Z7UA 2DQLA 2XKOA 4XBFA 2W24A 4HLYA 5ED4A 1EH7A 2IA1A 2EA4A 2GIVA 2LSOA 1RZ4A 1IN8A 1FYKA 1B1BA 2RQPA 1ZGJA 3TGNA 1CF7B 3MZHA 3FXRA 2ISYA 1DPRA 1DUXC 3L2CA 5FD6A 1SD4A 3WE2A 2CSOA 1ZARA 4P9FA 3EQLF 4I2OA 1TW2A 2QLZA 4IJAA 2FA5A 4YFKF 1BC8C 3BOQA 4G94A 2OZ6A 4MQ9F 2ZXJA 5LGTA 3G3ZA 1YS6A 1B6AA 1JHFA 4AIHA 1MJAA 3EYIA 4A0ZA 4LLGF 4FHTA 3F21A 2Q2EA 5HDNA 4WWCA 1BIBA 2HTSA 5AIQA 3Q9VA 4RAYA 5ILSA 4HV5A 3GFMA 5DCMB 4PZJA 3DP7A 3HOTA 2YPRA 1DPUA 3RYRA 3C1DA 3U1DA 1PP7U 1BI3A 4LMYA 2XRNA 3RPUA 4ASNA 3MQ0A 3I0TA 1NHAA 2V6CA 3KP3A 5L3DA 4HX8A 1ONVA 3QPTA 5FFZA 3WGHA 1U5TC 3J7AO 3WU1B 3FXQA 1FBQA 2A69F 1P4AA 1ON2A 1GXQA 3R60A 4UVCA 2CGPA 2A61A 5CVRA 1SFUA 3P9KA 4L9TA 2DU9A 2V1DA 3JAMK 3W6KB 3DQVC 3I59A 1O57A 4WCGA 1XGNA 5CVIA 1FSHA 2QQBA 1MZBA 2EK5A 2XAQA 3AAFA 2IT0A 4LD5A 3RKXA 1MKMA 5CVUA 1ZRDA 1XCVA 1QGPA 2ACJA 2X0LA 2FBHA 1IXSB 2EFNA 2O0YA 4WX9A 1A04A 3KP5A 2EV5A 2K02A 3S2WA 1J7KA 3RYPA 2V1UA 1SFEA 4ZYDA 4AWXB 3EYYA 1S8NA 2W85A 3T8RA 1KYZA 3KP7A 1Y0UA 5FO5A 2V79A 4RB2C 4CYDA 3R4KA 2ZO4A 4L0YB 2IA0A 1I1GA 1R5HA 3I5UA 1R1UA 1U8RA 3BPVA 4RB0A 2IPQX 5H6RA 1T38A 2M5WA 5BQTA 1MJBA 2VT2A 2AXLA 4I7HA 1J59A 4RGXA 3KP6A 5E1XA 2YSRA 4IF4A 1YIOA 3NEUA 3KP2A 3O3KA 1JE8A 4N9HA 3O6BB 4ZZLA 2DLLA 2VC1A 4L5JA 2Q0OA 4M72A 3JW4A 2DBBA 3GFLA 2K27A 4OIPF 4P96A 1LNWA 1UFMA 1YFHA 1IRGA 1JXSA 3CUQC 3WE3A 1RI7A 3E5XA 2JPBA 3V8JA 3SHFA 4GXOA 1O3SA 1HXDA 3E5QA 5ICGA 5D4SA 4U0YA 2K4JA 4A6EA 1W7PB 1D8JA 4A6DA 4G8XA 3BZ6A 4I09A 4Z2YA 4OIQF 1DDNA 4G9YA 5CYVA 3IWZA 4LFUA 5TJJA 5EEHA 2LF8A 4ENJA 4GGGA 2BV6A 2HYGD 3RKWA 4OMYA 1QO0D 1I6XA 2FSWA 1TQPA 3DF8A 2IVMA 1YLFA 4FX4A 5DEQA 4FT8A 5F6FA 1B9NA 4ZYEA 3G73A 3HSEA 5JR3A 3JTHA 2P5VA 1XSVA 3C18A 1EV7A 3T5XA 5D8KB 2O61A 3TKYA 2NRAC 2F5EA 3ZMUA 3H92A 1HW1A 3FM5A 1TBXA 1XMAA 4MEYF 2YR2A 5JVTA 2R7FA 4AVPA 1P4XA 3J81Z 2MLKA 2C6YA 3LAPA 1ON1A 3L00A 2P7VB 3LSTA 2FEZA 5H6QA 3F8FA 1Z05A 2ADUA 4BQAA 1FNNA 2VBXA 5AONA 4HZFA 3F8BA 1OYYA 5L3CA 5FLXK 1G3WA 3TDZC 3BP8A 1QBJA 3KZZA 1FC3A 4HDVA 2VBYA 1GXPA 2W57A 1HKQA 2HQRA 3QP6A 4LJZF 4M6YA 4BXUA 2E7WA 2HEOA 4HLXA 1S29A 4L9JA 3LQQA 1UB9A 4LG0B 1O3RA 5A2QK 2K7LA 5LEJA 4HOBA 2O03A 5DDGA 1HQCA 3R0AA 1MDMB 1G3SA 1IN7A 1T2KA 4U7DA 3HYIA 5ILUA 4OIOF 4HF1A 3TO9A 4RB1A 2H6BA 4I0BA 3E6CC 3KEQA 3IRRA 2EV0A 4ENNA 3D0SA 2L54A 1LDJA 2CG4A 4UNOA 4MEXF 1G4DA 4KUMA 4UVAA 3L9FA 1BC7C 2HDCA 2ZFWA 1J2XA 3VODA 2P6SA 1XSDA 2OQGA 1O3QA 3MZYA 5HDGA 5DD4A 4KMUX 4EM2A 2L01A 3OV8A 1XMKA 1ZRFA 1YW8A 1GHCA 1KU9A 4HQMA 2M1BA 1G3YA 5JI6A 4PGGA 5ICCA 5F1RA 4HX7A 3KETA 3WTZA 3LA2A 3N97A 1S7OA 1D3YA 2BEOA 1SFXA 1TW3A 2ZNYA 5FD5A 1FBUA 1B9MA 3V8KA 4HDUA 3VFZA 4D0PA 4Q5SF 2EJRA 3TOBA 3IC7A 1BBYA 3JSOA 4MTDA 1IZ1A 2XHKA 2FMYA 3CDHA 6PAXA 1ZG3A 4KYWA 2XKPA 4G7OF 4KIBA 1PDNC 4M9ZA 2VE9A 4KN7X 2H09A 2UZKA 2ZMEA 1RNLA 5LHIA 2DTRA 2DW4A 5D5UB 1I5ZA 4G6DA 4GCVA 4ZZDA 3P9IA 1C0WA 5IT9Z 4GO1A 2G7UA 2QZ8A 3MAJA 4EMSA 4S04A 3GVAA 2XVCA 2HZTA 4LB6B 3WTUC 2BE5F 5CJ9A 3ZN1A 3LAJA 1U5TB 2OBPA 3LA3A 3E5UA 2A5YB 2XAFA 5DYMA 1SAXA 2DO7A 3ZMTA 3GLXA 3GZ6A 3RKYA 1KQ0A 1LDKB 1BIAA 4HV6A 2STTA 1I1SA 4IHTA 2MA3A 4YIFA 3JTGA 5J8CA 1X3UA 4HA8A 1FX7A 4KICA 1SD5A 3W6JB 1T39A 2A6HF 2FOKA 2ZKZA 2FMLA 2K86A 2TDXA 1F1ZA 1HKSA 4UUVA 1LJ9A 4A0YA 2Z33A 1T0FA 3TDUC 4I0AA 1PUEE 4PGHA 1XDUA 3ZMZA 5HS9A 2IA2A 5FB2A 3ELKA 3CJNA 3K9TA 3ZMVA 3VB2A 4U88A 3RTRA 2YX4A 1UHWA 3COAC 3PQJA 1R58A 4BNCA 3QP5A 3HRTA 4BYYA 3JSPA 4OOIA 4N9IA 4IPAA 1XDSA 3IWFA 4CICA 4M74A 1KGSA 1HSTA 1R22A 2M87A 4LLNA 3F6VA 4ESFA 1R1VA 2CYYA 3H3UA 4XSZF 3MEXA 1LQ1A 1V3FA 1ODDA 3I4PA 2HTJA 2NYXA 4MHGA 4RAZA 2E7XA 4MQVA 4AIKA 1G3TA 1JHHA 3N4MA 2PI0A 1B4AA 1QNTA 1U78A 3WGGA 2GA2A 3BJAA 3BY6A 1EH6A 2IJLA 4YG2F 4YFNF 2A07F 3QU6A 2BBYA 1Z91A 4PCQA 2L4MA 5D5VB 1WQ2A 2HGCA 1KA8A 5K5RA 3EUHA 3B73A 1TLHB 1MGTA 3WG9A 2QM3A 4P55A 4A0XA 2FF4A 2VONA 4RS8A 4G7ZF 2XAHA 1OKRA 2QWWA 4IRIA 4ENKA 2XASA 3IHUA 2LDUA 4Y15A 5BPDA 5D8LB 2GXBA 3QOPA 3HUGA 3K2ZA 5L3EA 2L3DA 2ZMEB 1S6LA 5LHGA 1IN4A 3KZYA 4WXDA 1W4MA 4NHJA 1XN7A 3GO5A 3RJPA 3WTXC 1O3TA 3E6DA 4P9UA 1FPQA 1ZG1A 1IF1A 1D5VA 1Z1DA 2VOPA 5DUIA 5D5XB 4U0VA 2D2WA 1EH8A 4R79A 3J80K 4AIJA 4AD9A 2FNAA 1FY7A 3DKWA 1KU7A 2W25A 4B8XA 3GEZA 1GVJA 2EFWA 3K0LA 2O6GE 2M30A 4BH9A 5LLQA 1Q1HA 2XROA 4L9NA 1U3EM 1YW7A 2HQNA 3L09A 2XIGA 1ZRCA 2PLYA 4N0BA 1E17A 3FHZA 3SZTA 4BHCA 4I02A 3L7WA 3ERED 1BN5A 3KE2A 1ZAOA 2H6CA 2GZWA 4LGWA 3HRMA 2IRFG 3M1EA 2Z3YA 2R7DA 2DI3A 2DK8A 5DCFA 4LLLA 4WF2A 1QQIA 1CF7A 1YG2A 4BHPA 3CUQA 4ESBA 2QENA 3F8MA 2F2EA 2ZBKA 2OZUA 4IHSA 4QWQA 2PJPA 5HS8A 5ERIA 4HQEA 5DD8A 1RUOA 3WTVC 5BS6A 2B0LA 1P6RA 2KRFA 3DV8A 3MFKA 1HSJA 5BOXA 1R5GA 3SXYA 3E6BA 1DP7P 2FQ3A 4WK8F 1K7AA 3BDDA 4O5VA 1BM9A 1FOKA 5LRRA 1ZG5A 5LGUA 3PQKA 1HW5A 2DK5A 2X4HA 1FP1D 5ICEA 5L3GA 1IW7F 3HTSB 3FF5A 1XB4A 2QQAA 3LFKA 2GAUA 3GUDA 1ZLKA 2ESHA 5J8FA 2AS5F 1R23A 2ISZA 5LRSA 3MCZA 1QZYA 3OOPA 3WTYC 2H27A 2Q8KA 4M71A 1WSUA 2EA2A 4BAYA 2MLGA 1IN6A 3I71A 4WXHA 2Z99A 4LG0A 3HRUA 1S3JA 2EFOA 4M6XA 4Q47A 1FT9A 3RI4A 1H9GA 4UXNA 1SMYF 1TTYA 4P5OA 2A68F 4QLCU 3I53A 3LWFA 3F8CA 2ELHA 4HX4A 4ZYHA 3K1MA 1HW2A 2O8XA 4KT5C 2EWNA 4TV7A 3WGIA 2HFHA 4L0ZB 3VOEA 3V7SA 1FBSA 3V7CA 1J75A 4PDKA 2JT1A 3T0YA 3FXUA 2KIUA 4M9SA 2JTVA 5E20A 4KN4X 1UCRA 1YW9A 5D4RA 1BI2A 1ZN2A 3GFIA 3FMQA 1G6NA 3V7RA 2QVOA 1Z6TA 5BMZA 2RV8A 1J0RA 3M7GA 4EV0A 3GWZA 1L3LA 4R1HA 2P5LC 3FM3A 3LQRA 2NNNA 3QAHA 3IKTA 3ULQB 3HIFA 4G7HF 3DEUA 2W84A 1FP2A 3GX4X 4RB3C 4KFCA 2HWVA 5KK1A 2WV0A 3F3XA 4EJOA 1BI0A 1I27A 3H3ZA 2HS5A 4HBLA 5HLHA 2P4WA 5J6XA 1WRJA 2L02A 1JGSA 2VODA 3ROUA 4KA4A 3BJOA 5CLSA 5JHUA 1U2WA 2F5DA 2FNPA 4MNUA 2ZJ2A 3O2PE 3T8TA 2HKXA 1U6GA 2DQRA 2RN7A 1WWXA 2HYFA 4EGYA 2YX7A 4KDPA 1W7PD 1FZPB 1LVAA 2JZYA 2RC4A 2MD5A 3TOAA 3ML6A 2PFBA 1YYVA 4LK1F 1FLIA 4EJWA 3HHGA 3R0JA 4NB5A 4OIRF 3T1BA 2BYVE 4FX0A 1BI1A 1F9NA 5HDKA 3DPTA 4CO8A 3C3WA 2OA4A 3FWEA 2FRHA 4CZZA 3KFWX 2VXZA 3IRQA 3NQOA 4L18B 1R1TA 3WU0A 2KIFA 4ON0A 2XAGA 3ZMDA 5ILVA 1L0OC 1K6OA 1SD6A 4ENMA 3ZPLA 2LF7A 2ZCWA 1RUNA 1P4WA 4KMFA 4L5IA 2RGVA 1O7LA 3F23A 2GQQA 1P2FA 2WTEA 3FMSA 1OR7A 1T98A 2JRTA 4JQFA 1ZHFA 3R61A 5FGMA 3GW2A 2FXAA 3CLOA 3VEPA 2LKPA 4RGSA 2KJCA 4JK1X 1AOYA 4WXCA 1CGPA 1YTYA 4HF0A 3GXOA 3GF2A 3TO7A 1K78B 5TRDA 3F22A 1KQ9A 4IRGA 4A5MA 2MH9A 3KP4A 2J5PA 3P9CA 2FE3A 3GZ5A 3I59B 3WTTC 3KLOA 2E1CA 4E70A 5LBQA 4KIFA 4UHTA 1WKMA 5E17F 3J80Z 2VE8A 2A6EF 2P6TA 4A5NA 5JFRA 4EM1A 1STZA 2DT5A 1USSA 2XUBA 1IAWA 1QZZA 2D1HA 3QRFF 2VN2A 3E6MA 4DNCA 3FX3A 2D45A 3D5LA 2A3SA 2WC2A 3Q5FA 2OAZA 5L3FA 4A2UA 3WODF 3EETA 1SMTA 3JAMZ 2ESNA 5CVVA 5E8IA 1KQ8A 1QPMA 2P8TA 1U5TA 3K1NA 4O3MA 1ZLJA 5FFXA 3CO6C 3RPQA 1OYIA 2UXXA 5BPIA 3CUOA 4BHBA 2DPUA 4IXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRF A;  2CFX A;  2V1X A;  1TNT A;  3F72 A;  4ZYG A;  1S7A A;  1KU2 A;  4HW0 A;  4EM0 B;  1W7P A;  1OMI A;  3QU3 A;  3TO6 A;  1ULY A;  2PMU A;  3KLN A;  5ICF A;  5E1W A;  4U7B A;  2JPC A;  2RKH A;  4L9V A;  2XAJ A;  4MGR A;  1LB2 A;  5K1Y A;  2CO5 A;  5H20 A;  2HKO A;  5D5W B;  5HS7 A;  4YII A;  4HF2 A;  5CVJ A;  3MWM A;  5HLI A;  1VTN C;  3LA7 A;  3QPH A;  4LB5 A;  5IT3 A;  1FYL A;  4UVB A;  4GYI A;  3ISP A;  1R36 A;  2MH2 A;  3HSR A;  5IT9 K;  3BRO A;  1F4K A;  3B02 A;  2KJB A;  1PP8 F;  4H0E A;  4EQQ A;  3SQN A;  1D8K A;  1IXR C;  4U0W A;  3PFI A;  3U9G A;  2PQ8 A;  2MC3 A;  3BWG A;  2RVC A;  1LDD A;  4XSX F;  4Y13 A;  1R00 A;  2G7H A;  5HVQ C;  2XGX A;  4I01 A;  1AWC A;  4NQW A;  1RIO H;  2K4B A;  4KIG A;  3Q9S A;  3HOS A;  3ZQ7 A;  3WTW C;  1J9I A;  3ABT A;  5FLX Z;  3FMR A;  3KEO A;  1LEB A;  4EVI A;  4HAM A;  3SFZ A;  5K5O A;  2KKO A;  1MJ9 A;  1P92 A;  4MTE A;  2Y0M A;  2ZNZ A;  2QYO A;  3KCC A;  2YU3 A;  2M45 A;  2IP2 A;  5DUK A;  2RNJ A;  3K1P A;  1FYM A;  2P7C B;  4XLN F;  2F5F A;  1BOA A;  3TQN A;  2FBK A;  1FSE A;  4EJV A;  3DFG A;  5DV5 A;  3DXJ F;  3NRV A;  4JBA A;  2GA1 A;  3GFJ A;  3FZV A;  2PMH A;  3HHH A;  2Z9O A;  3GYH X;  1XCB A;  1REP C;  1H0M A;  2CQK A;  1J5Y A;  2EFQ A;  2D1V A;  2XV4 S;  1OYW A;  1R7J A;  1HBX G;  2GXG A;  5AIP A;  3BPX A;  2STW A;  1YQA A;  1TQM A;  3CO7 C;  4HYE A;  4IVN A;  4OMZ A;  3E3V A;  4KNY A;  3RIR A;  2EB7 A;  1W5T A;  2KIM A;  2CW0 F;  1H9T A;  1O7F A;  5LHH A;  1XGO A;  1ZRE A;  2F5C A;  3I58 A;  2FBI A;  3M8F A;  2NNY A;  2NAZ A;  2MBF A;  2HOE A;  4Q48 A;  3EDP A;  2VT3 A;  2VOO A;  1B59 A;  1E2X A;  3J81 K;  2R3S A;  2O3F A;  2EFP A;  5E18 F;  4ETS A;  1K79 A;  5D6E A;  2H94 A;  2PN6 A;  4EJT A;  3CUQ B;  2Y48 A;  5EEG A;  3U2R A;  2V9V A;  1TQI A;  1W5S A;  1FWZ A;  4Y17 A;  3ECH A;  2VC0 A;  1UST A;  5LEK A;  3IL2 A;  2DPD A;  3HRS A;  4B09 A;  2VBZ A;  3R6S A;  2PBI A;  4A12 A;  2J5O A;  3RDI A;  4EJU A;  3REO A;  2OQR A;  4CGZ A;  3ECO A;  3V4G A;  1T6S A;  5E1Z B;  2PEX A;  1ZYR F;  2CWE A;  1HKT A;  1ZH5 A;  1BJA A;  5K5Q A;  1MD0 A;  2PG4 A;  4F7Z A;  4M73 A;  5L3B A;  4CXF A;  1MDM A;  2QBY A;  3ZN0 A;  3HSF A;  3ZP5 A;  4R8H A;  4UV9 A;  3IKV A;  3DPL C;  1Z9C A;  5A2Q Z;  2FU4 A;  5HLG A;  3C7J A;  3I64 A;  4GYG A;  4O6J A;  3M9A A;  2OD5 A;  2UWM A;  2G9W A;  4XRF A;  5LGN A;  3BJ6 A;  5DCM A;  3HTU A;  3F8N A;  1SD7 A;  2QUF A;  5E8G A;  4RGU A;  1XGS A;  3V8L A;  1IXC A;  1OPC A;  2QBY B;  3I54 A;  1ZGA A;  1IUY A;  2VBW A;  5KVR A;  1F5T A;  4RGR A;  2NS0 A;  1IN5 A;  1XD7 A;  1K78 A;  2DAO A;  2GWR A;  2L4A A;  2HR3 A;  3K69 A;  4OIN F;  2QQ9 A;  1XSX A;  2UXN A;  3E97 A;  2DFI A;  2RDP A;  1TNS A;  1LEA A;  3SZP A;  2BGC A;  2Z5U A;  4K2E A;  4CDG A;  2E1N A;  3ABU A;  3ZMS A;  4XLP F;  5HOO A;  2OU2 A;  2JSC A;  4ESJ A;  4DQ2 A;  2Y75 A;  1V4R A;  4UV8 A;  3WTS C;  4M9X A;  4IRH A;  3P7N A;  2IW5 A;  2LNB A;  4EGZ A;  5F64 A;  4YFX F;  1YO5 C;  1KYW A;  5D6F A;  1Z6R A;  4I98 B;  3M8E A;  4Q4Z F;  2WWY A;  2ETH A;  3F6O A;  4CHU A;  4ZH4 F;  4S05 A;  2P5K A;  1XGM A;  4LK0 F;  4OU0 A;  1WI9 A;  1KU3 A;  3CTA A;  2COM A;  4G6Q A;  1UHM A;  2M8E A;  2EV6 A;  1YS7 A;  1Z7U A;  2DQL A;  2XKO A;  4XBF A;  2W24 A;  4HLY A;  5ED4 A;  1EH7 A;  2IA1 A;  2EA4 A;  2GIV A;  2LSO A;  1RZ4 A;  1IN8 A;  1FYK A;  1B1B A;  2RQP A;  1ZGJ A;  3TGN A;  1CF7 B;  3MZH A;  3FXR A;  2ISY A;  1DPR A;  1DUX C;  3L2C A;  5FD6 A;  1SD4 A;  3WE2 A;  2CSO A;  1ZAR A;  4P9F A;  3EQL F;  4I2O A;  1TW2 A;  2QLZ A;  4IJA A;  2FA5 A;  4YFK F;  1BC8 C;  3BOQ A;  4G94 A;  2OZ6 A;  4MQ9 F;  2ZXJ A;  5LGT A;  3G3Z A;  1YS6 A;  1B6A A;  1JHF A;  4AIH A;  1MJA A;  3EYI A;  4A0Z A;  4LLG F;  4FHT A;  3F21 A;  2Q2E A;  5HDN A;  4WWC A;  1BIB A;  2HTS A;  5AIQ A;  3Q9V A;  4RAY A;  5ILS A;  4HV5 A;  3GFM A;  5DCM B;  4PZJ A;  3DP7 A;  3HOT A;  2YPR A;  1DPU A;  3RYR A;  3C1D A;  3U1D A;  1PP7 U;  1BI3 A;  4LMY A;  2XRN A;  3RPU A;  4ASN A;  3MQ0 A;  3I0T A;  1NHA A;  2V6C A;  3KP3 A;  5L3D A;  4HX8 A;  1ONV A;  3QPT A;  5FFZ A;  3WGH A;  1U5T C;  3J7A O;  3WU1 B;  3FXQ A;  1FBQ A;  2A69 F;  1P4A A;  1ON2 A;  1GXQ A;  3R60 A;  4UVC A;  2CGP A;  2A61 A;  5CVR A;  1SFU A;  3P9K A;  4L9T A;  2DU9 A;  2V1D A;  3JAM K;  3W6K B;  3DQV C;  3I59 A;  1O57 A;  4WCG A;  1XGN A;  5CVI A;  1FSH A;  2QQB A;  1MZB A;  2EK5 A;  2XAQ A;  3AAF A;  2IT0 A;  4LD5 A;  3RKX A;  1MKM A;  5CVU A;  1ZRD A;  1XCV A;  1QGP A;  2ACJ A;  2X0L A;  2FBH A;  1IXS B;  2EFN A;  2O0Y A;  4WX9 A;  1A04 A;  3KP5 A;  2EV5 A;  2K02 A;  3S2W A;  1J7K A;  3RYP A;  2V1U A;  1SFE A;  4ZYD A;  4AWX B;  3EYY A;  1S8N A;  2W85 A;  3T8R A;  1KYZ A;  3KP7 A;  1Y0U A;  5FO5 A;  2V79 A;  4RB2 C;  4CYD A;  3R4K A;  2ZO4 A;  4L0Y B;  2IA0 A;  1I1G A;  1R5H A;  3I5U A;  1R1U A;  1U8R A;  3BPV A;  4RB0 A;  2IPQ X;  5H6R A;  1T38 A;  2M5W A;  5BQT A;  1MJB A;  2VT2 A;  2AXL A;  4I7H A;  1J59 A;  4RGX A;  3KP6 A;  5E1X A;  2YSR A;  4IF4 A;  1YIO A;  3NEU A;  3KP2 A;  3O3K A;  1JE8 A;  4N9H A;  3O6B B;  4ZZL A;  2DLL A;  2VC1 A;  4L5J A;  2Q0O A;  4M72 A;  3JW4 A;  2DBB A;  3GFL A;  2K27 A;  4OIP F;  4P96 A;  1LNW A;  1UFM A;  1YFH A;  1IRG A;  1JXS A;  3CUQ C;  3WE3 A;  1RI7 A;  3E5X A;  2JPB A;  3V8J A;  3SHF A;  4GXO A;  1O3S A;  1HXD A;  3E5Q A;  5ICG A;  5D4S A;  4U0Y A;  2K4J A;  4A6E A;  1W7P B;  1D8J A;  4A6D A;  4G8X A;  3BZ6 A;  4I09 A;  4Z2Y A;  4OIQ F;  1DDN A;  4G9Y A;  5CYV A;  3IWZ A;  4LFU A;  5TJJ A;  5EEH A;  2LF8 A;  4ENJ A;  4GGG A;  2BV6 A;  2HYG D;  3RKW A;  4OMY A;  1QO0 D;  1I6X A;  2FSW A;  1TQP A;  3DF8 A;  2IVM A;  1YLF A;  4FX4 A;  5DEQ A;  4FT8 A;  5F6F A;  1B9N A;  4ZYE A;  3G73 A;  3HSE A;  5JR3 A;  3JTH A;  2P5V A;  1XSV A;  3C18 A;  1EV7 A;  3T5X A;  5D8K B;  2O61 A;  3TKY A;  2NRA C;  2F5E A;  3ZMU A;  3H92 A;  1HW1 A;  3FM5 A;  1TBX A;  1XMA A;  4MEY F;  2YR2 A;  5JVT A;  2R7F A;  4AVP A;  1P4X A;  3J81 Z;  2MLK A;  2C6Y A;  3LAP A;  1ON1 A;  3L00 A;  2P7V B;  3LST A;  2FEZ A;  5H6Q A;  3F8F A;  1Z05 A;  2ADU A;  4BQA A;  1FNN A;  2VBX A;  5AON A;  4HZF A;  3F8B A;  1OYY A;  5L3C A;  5FLX K;  1G3W A;  3TDZ C;  3BP8 A;  1QBJ A;  3KZZ A;  1FC3 A;  4HDV A;  2VBY A;  1GXP A;  2W57 A;  1HKQ A;  2HQR A;  3QP6 A;  4LJZ F;  4M6Y A;  4BXU A;  2E7W A;  2HEO A;  4HLX A;  1S29 A;  4L9J A;  3LQQ A;  1UB9 A;  4LG0 B;  1O3R A;  5A2Q K;  2K7L A;  5LEJ A;  4HOB A;  2O03 A;  5DDG A;  1HQC A;  3R0A A;  1MDM B;  1G3S A;  1IN7 A;  1T2K A;  4U7D A;  3HYI A;  5ILU A;  4OIO F;  4HF1 A;  3TO9 A;  4RB1 A;  2H6B A;  4I0B A;  3E6C C;  3KEQ A;  3IRR A;  2EV0 A;  4ENN A;  3D0S A;  2L54 A;  1LDJ A;  2CG4 A;  4UNO A;  4MEX F;  1G4D A;  4KUM A;  4UVA A;  3L9F A;  1BC7 C;  2HDC A;  2ZFW A;  1J2X A;  3VOD A;  2P6S A;  1XSD A;  2OQG A;  1O3Q A;  3MZY A;  5HDG A;  5DD4 A;  4KMU X;  4EM2 A;  2L01 A;  3OV8 A;  1XMK A;  1ZRF A;  1YW8 A;  1GHC A;  1KU9 A;  4HQM A;  2M1B A;  1G3Y A;  5JI6 A;  4PGG A;  5ICC A;  5F1R A;  4HX7 A;  3KET A;  3WTZ A;  3LA2 A;  3N97 A;  1S7O A;  1D3Y A;  2BEO A;  1SFX A;  1TW3 A;  2ZNY A;  5FD5 A;  1FBU A;  1B9M A;  3V8K A;  4HDU A;  3VFZ A;  4D0P A;  4Q5S F;  2EJR A;  3TOB A;  3IC7 A;  1BBY A;  3JSO A;  4MTD A;  1IZ1 A;  2XHK A;  2FMY A;  3CDH A;  6PAX A;  1ZG3 A;  4KYW A;  2XKP A;  4G7O F;  4KIB A;  1PDN C;  4M9Z A;  2VE9 A;  4KN7 X;  2H09 A;  2UZK A;  2ZME A;  1RNL A;  5LHI A;  2DTR A;  2DW4 A;  5D5U B;  1I5Z A;  4G6D A;  4GCV A;  4ZZD A;  3P9I A;  1C0W A;  5IT9 Z;  4GO1 A;  2G7U A;  2QZ8 A;  3MAJ A;  4EMS A;  4S04 A;  3GVA A;  2XVC A;  2HZT A;  4LB6 B;  3WTU C;  2BE5 F;  5CJ9 A;  3ZN1 A;  3LAJ A;  1U5T B;  2OBP A;  3LA3 A;  3E5U A;  2A5Y B;  2XAF A;  5DYM A;  1SAX A;  2DO7 A;  3ZMT A;  3GLX A;  3GZ6 A;  3RKY A;  1KQ0 A;  1LDK B;  1BIA A;  4HV6 A;  2STT A;  1I1S A;  4IHT A;  2MA3 A;  4YIF A;  3JTG A;  5J8C A;  1X3U A;  4HA8 A;  1FX7 A;  4KIC A;  1SD5 A;  3W6J B;  1T39 A;  2A6H F;  2FOK A;  2ZKZ A;  2FML A;  2K86 A;  2TDX A;  1F1Z A;  1HKS A;  4UUV A;  1LJ9 A;  4A0Y A;  2Z33 A;  1T0F A;  3TDU C;  4I0A A;  1PUE E;  4PGH A;  1XDU A;  3ZMZ A;  5HS9 A;  2IA2 A;  5FB2 A;  3ELK A;  3CJN A;  3K9T A;  3ZMV A;  3VB2 A;  4U88 A;  3RTR A;  2YX4 A;  1UHW A;  3COA C;  3PQJ A;  1R58 A;  4BNC A;  3QP5 A;  3HRT A;  4BYY A;  3JSP A;  4OOI A;  4N9I A;  4IPA A;  1XDS A;  3IWF A;  4CIC A;  4M74 A;  1KGS A;  1HST A;  1R22 A;  2M87 A;  4LLN A;  3F6V A;  4ESF A;  1R1V A;  2CYY A;  3H3U A;  4XSZ F;  3MEX A;  1LQ1 A;  1V3F A;  1ODD A;  3I4P A;  2HTJ A;  2NYX A;  4MHG A;  4RAZ A;  2E7X A;  4MQV A;  4AIK A;  1G3T A;  1JHH A;  3N4M A;  2PI0 A;  1B4A A;  1QNT A;  1U78 A;  3WGG A;  2GA2 A;  3BJA A;  3BY6 A;  1EH6 A;  2IJL A;  4YG2 F;  4YFN F;  2A07 F;  3QU6 A;  2BBY A;  1Z91 A;  4PCQ A;  2L4M A;  5D5V B;  1WQ2 A;  2HGC A;  1KA8 A;  5K5R A;  3EUH A;  3B73 A;  1TLH B;  1MGT A;  3WG9 A;  2QM3 A;  4P55 A;  4A0X A;  2FF4 A;  2VON A;  4RS8 A;  4G7Z F;  2XAH A;  1OKR A;  2QWW A;  4IRI A;  4ENK A;  2XAS A;  3IHU A;  2LDU A;  4Y15 A;  5BPD A;  5D8L B;  2GXB A;  3QOP A;  3HUG A;  3K2Z A;  5L3E A;  2L3D A;  2ZME B;  1S6L A;  5LHG A;  1IN4 A;  3KZY A;  4WXD A;  1W4M A;  4NHJ A;  1XN7 A;  3GO5 A;  3RJP A;  3WTX C;  1O3T A;  3E6D A;  4P9U A;  1FPQ A;  1ZG1 A;  1IF1 A;  1D5V A;  1Z1D A;  2VOP A;  5DUI A;  5D5X B;  4U0V A;  2D2W A;  1EH8 A;  4R79 A;  3J80 K;  4AIJ A;  4AD9 A;  2FNA A;  1FY7 A;  3DKW A;  1KU7 A;  2W25 A;  4B8X A;  3GEZ A;  1GVJ A;  2EFW A;  3K0L A;  2O6G E;  2M30 A;  4BH9 A;  5LLQ A;  1Q1H A;  2XRO A;  4L9N A;  1U3E M;  1YW7 A;  2HQN A;  3L09 A;  2XIG A;  1ZRC A;  2PLY A;  4N0B A;  1E17 A;  3FHZ A;  3SZT A;  4BHC A;  4I02 A;  3L7W A;  3ERE D;  1BN5 A;  3KE2 A;  1ZAO A;  2H6C A;  2GZW A;  4LGW A;  3HRM A;  2IRF G;  3M1E A;  2Z3Y A;  2R7D A;  2DI3 A;  2DK8 A;  5DCF A;  4LLL A;  4WF2 A;  1QQI A;  1CF7 A;  1YG2 A;  4BHP A;  3CUQ A;  4ESB A;  2QEN A;  3F8M A;  2F2E A;  2ZBK A;  2OZU A;  4IHS A;  4QWQ A;  2PJP A;  5HS8 A;  5ERI A;  4HQE A;  5DD8 A;  1RUO A;  3WTV C;  5BS6 A;  2B0L A;  1P6R A;  2KRF A;  3DV8 A;  3MFK A;  1HSJ A;  5BOX A;  1R5G A;  3SXY A;  3E6B A;  1DP7 P;  2FQ3 A;  4WK8 F;  1K7A A;  3BDD A;  4O5V A;  1BM9 A;  1FOK A;  5LRR A;  1ZG5 A;  5LGU A;  3PQK A;  1HW5 A;  2DK5 A;  2X4H A;  1FP1 D;  5ICE A;  5L3G A;  1IW7 F;  3HTS B;  3FF5 A;  1XB4 A;  2QQA A;  3LFK A;  2GAU A;  3GUD A;  1ZLK A;  2ESH A;  5J8F A;  2AS5 F;  1R23 A;  2ISZ A;  5LRS A;  3MCZ A;  1QZY A;  3OOP A;  3WTY C;  2H27 A;  2Q8K A;  4M71 A;  1WSU A;  2EA2 A;  4BAY A;  2MLG A;  1IN6 A;  3I71 A;  4WXH A;  2Z99 A;  4LG0 A;  3HRU A;  1S3J A;  2EFO A;  4M6X A;  4Q47 A;  1FT9 A;  3RI4 A;  1H9G A;  4UXN A;  1SMY F;  1TTY A;  4P5O A;  2A68 F;  4QLC U;  3I53 A;  3LWF A;  3F8C A;  2ELH A;  4HX4 A;  4ZYH A;  3K1M A;  1HW2 A;  2O8X A;  4KT5 C;  2EWN A;  4TV7 A;  3WGI A;  2HFH A;  4L0Z B;  3VOE A;  3V7S A;  1FBS A;  3V7C A;  1J75 A;  4PDK A;  2JT1 A;  3T0Y A;  3FXU A;  2KIU A;  4M9S A;  2JTV A;  5E20 A;  4KN4 X;  1UCR A;  1YW9 A;  5D4R A;  1BI2 A;  1ZN2 A;  3GFI A;  3FMQ A;  1G6N A;  3V7R A;  2QVO A;  1Z6T A;  5BMZ A;  2RV8 A;  1J0R A;  3M7G A;  4EV0 A;  3GWZ A;  1L3L A;  4R1H A;  2P5L C;  3FM3 A;  3LQR A;  2NNN A;  3QAH A;  3IKT A;  3ULQ B;  3HIF A;  4G7H F;  3DEU A;  2W84 A;  1FP2 A;  3GX4 X;  4RB3 C;  4KFC A;  2HWV A;  5KK1 A;  2WV0 A;  3F3X A;  4EJO A;  1BI0 A;  1I27 A;  3H3Z A;  2HS5 A;  4HBL A;  5HLH A;  2P4W A;  5J6X A;  1WRJ A;  2L02 A;  1JGS A;  2VOD A;  3ROU A;  4KA4 A;  3BJO A;  5CLS A;  5JHU A;  1U2W A;  2F5D A;  2FNP A;  4MNU A;  2ZJ2 A;  3O2P E;  3T8T A;  2HKX A;  1U6G A;  2DQR A;  2RN7 A;  1WWX A;  2HYF A;  4EGY A;  2YX7 A;  4KDP A;  1W7P D;  1FZP B;  1LVA A;  2JZY A;  2RC4 A;  2MD5 A;  3TOA A;  3ML6 A;  2PFB A;  1YYV A;  4LK1 F;  1FLI A;  4EJW A;  3HHG A;  3R0J A;  4NB5 A;  4OIR F;  3T1B A;  2BYV E;  4FX0 A;  1BI1 A;  1F9N A;  5HDK A;  3DPT A;  4CO8 A;  3C3W A;  2OA4 A;  3FWE A;  2FRH A;  4CZZ A;  3KFW X;  2VXZ A;  3IRQ A;  3NQO A;  4L18 B;  1R1T A;  3WU0 A;  2KIF A;  4ON0 A;  2XAG A;  3ZMD A;  5ILV A;  1L0O C;  1K6O A;  1SD6 A;  4ENM A;  3ZPL A;  2LF7 A;  2ZCW A;  1RUN A;  1P4W A;  4KMF A;  4L5I A;  2RGV A;  1O7L A;  3F23 A;  2GQQ A;  1P2F A;  2WTE A;  3FMS A;  1OR7 A;  1T98 A;  2JRT A;  4JQF A;  1ZHF A;  3R61 A;  5FGM A;  3GW2 A;  2FXA A;  3CLO A;  3VEP A;  2LKP A;  4RGS A;  2KJC A;  4JK1 X;  1AOY A;  4WXC A;  1CGP A;  1YTY A;  4HF0 A;  3GXO A;  3GF2 A;  3TO7 A;  1K78 B;  5TRD A;  3F22 A;  1KQ9 A;  4IRG A;  4A5M A;  2MH9 A;  3KP4 A;  2J5P A;  3P9C A;  2FE3 A;  3GZ5 A;  3I59 B;  3WTT C;  3KLO A;  2E1C A;  4E70 A;  5LBQ A;  4KIF A;  4UHT A;  1WKM A;  5E17 F;  3J80 Z;  2VE8 A;  2A6E F;  2P6T A;  4A5N A;  5JFR A;  4EM1 A;  1STZ A;  2DT5 A;  1USS A;  2XUB A;  1IAW A;  1QZZ A;  2D1H A;  3QRF F;  2VN2 A;  3E6M A;  4DNC A;  3FX3 A;  2D45 A;  3D5L A;  2A3S A;  2WC2 A;  3Q5F A;  2OAZ A;  5L3F A;  4A2U A;  3WOD F;  3EET A;  1SMT A;  3JAM Z;  2ESN A;  5CVV A;  5E8I A;  1KQ8 A;  1QPM A;  2P8T A;  1U5T A;  3K1N A;  4O3M A;  1ZLJ A;  5FFX A;  3CO6 C;  3RPQ A;  1OYI A;  2UXX A;  5BPI A;  3CUO A;  4BHB A;  2DPU A;  4IXA A; 
#chains in the Genus database with same CATH topology
 1IRF A;  1ETO A;  2CFX A;  2PMZ A;  4HNU A;  2V1X A;  1TNT A;  3F72 A;  2LYC A;  4ZYG A;  1S7A A;  1KU2 A;  4HW0 A;  2VQH A;  4EM0 B;  1W7P A;  1OMI A;  3QU3 A;  3TO6 A;  1JTX A;  1ULY A;  2PMU A;  3KLN A;  5ICF A;  1NG6 A;  5E1W A;  1JKO C;  5IOY A;  2AQE A;  4U7B A;  5HNH A;  2O7O A;  1JUP A;  3K4C A;  2VJ5 A;  2JPC A;  2RKH A;  4L9V A;  2XAJ A;  4MGR A;  1LB2 A;  3QOD A;  3S32 A;  2Z16 A;  5K1Y A;  1SC7 A;  2CO5 A;  5H20 A;  2LTP A;  1UG0 A;  2HKO A;  1HDP A;  1IG7 A;  5D5W B;  4C30 A;  1Y8R B;  5HS7 A;  4A3F J;  1OCT C;  1EKE A;  4YII A;  2W00 A;  4UUS B;  4DZP A;  2DA5 A;  4HF2 A;  5CVJ A;  1NH3 A;  3MWM A;  5HLI A;  1VTN C;  3BG5 A;  3LA7 A;  2IAI A;  4JOM A;  1E3H A;  2DOA A;  3QPH A;  4BBR J;  2A5W A;  5IPA A;  4LB5 A;  2M7A A;  4NDL A;  5IT3 A;  4UVB A;  1FYL A;  4GYI A;  3ISP A;  5GTI C;  2YS9 A;  2M0C A;  1R36 A;  3QWL A;  3HDD A;  2BZT A;  3QOE A;  2MH2 A;  3FK7 A;  3HSR A;  5IT9 K;  1BW6 A;  3OYG A;  2XSJ C;  3LSP A;  3S2H J;  3BRO A;  1F4K A;  3L2R A;  3AG4 H;  1IDY A;  2JA2 A;  3G1O A;  5GAG J;  3B02 A;  3DBL B;  4IZZ A;  3IAS 2;  3GLL A;  4X0G A;  2KJB A;  1VQ5 I;  1PP8 F;  3JR9 A;  2OPT A;  4H0E A;  4EQQ A;  3I55 I;  3SQN A;  5EG0 A;  1D8K A;  5FKM A;  5B1B H;  4RLQ A;  2DA7 A;  1IXR C;  4U0W A;  1MBK A;  4NUB A;  2BXZ A;  2NOJ B;  1B72 B;  1FIP A;  1YJ9 I;  1RES A;  3BG6 A;  3PFI A;  3U9G A;  2PQ8 A;  4M3E A;  2MC3 A;  4I6Z A;  2IS4 A;  2AHQ A;  2EIN H;  1D1A A;  3A01 A;  3BWG A;  2RVC A;  1DP3 A;  2QSG X;  1LDD A;  4XSX F;  3DCF A;  4Y13 A;  1R00 A;  2G7H A;  5HVQ C;  1X3W B;  2ZSH B;  2OCC H;  5IYB J;  3CCY A;  3VPR A;  5EG0 B;  2P0W A;  2XGX A;  1V5E A;  2AO9 A;  4I01 A;  1AWC A;  1H89 C;  4NQW A;  3DKX A;  3OYB A;  1ZR2 A;  2K4B A;  1RIO H;  1S9H A;  3CCL I;  4KIG A;  2BHY A;  1W5C C;  3Q9S A;  3J7A Y;  1Z77 A;  3HOS A;  3Q0U A;  2I8D A;  4HEA 2;  3ZQ7 A;  4XRM A;  4ITV A;  3GBG A;  3WTW C;  5FLM J;  1IC8 A;  4JX5 A;  1J9I A;  5EJC A;  3ABT A;  1APL C;  3CQZ J;  5FLX Z;  3FMR A;  2GOM A;  4NC6 A;  4BU2 A;  3KEO A;  1LEB A;  4EVI A;  2Y0S N;  4PJL A;  3OMY A;  2JUG A;  3PNV A;  2UV1 A;  2NXN B;  5K7H A;  4HAM A;  1JI8 A;  1X1P A;  3SFZ A;  3OR2 C;  5K5O A;  2KKO A;  1R5I D;  4I99 C;  1MJ9 A;  1P92 A;  3CMY A;  4MTE A;  2Y0M A;  2ZNZ A;  2QYO A;  3LSH A;  2XSD C;  3KCC A;  2YU3 A;  1SFK A;  2M45 A;  2IP2 A;  5DUK A;  2RNJ A;  3OYN A;  4X1E A;  1YX5 A;  3K1P A;  1FYM A;  2O8K A;  1MBJ A;  4XLN F;  3MZ8 A;  2P7C B;  3ZCO A;  1UEL B;  2X1E A;  2F5F A;  1BOA A;  2KL4 A;  3TQN A;  2FBK A;  2DN0 A;  3I4M J;  1X19 A;  1FSE A;  4EJV A;  3DFG A;  5DV5 A;  1J09 A;  1XS9 A;  1IJW C;  1FTZ A;  3KYL A;  1WH7 A;  3JRC A;  4ANJ A;  3DXJ F;  3NRV A;  1XPX A;  3FBI B;  4JBA A;  2GA1 A;  1GV2 A;  3GFJ A;  1MMD A;  2PMH A;  3FZV A;  5HNF A;  2V6E A;  1MMA A;  2K3P A;  3HHH A;  2Z9O A;  4XN0 A;  2GBY A;  2JWT A;  3GYH X;  1XCB A;  1REP C;  4FCY A;  4DIQ A;  3GTJ J;  2I10 A;  2MSY A;  1H0M A;  1UAA A;  2CW7 A;  2CQK A;  1J5Y A;  2EFQ A;  2D1V A;  4NC7 A;  4YEL A;  2XV4 S;  1OYW A;  1R7J A;  1JJ6 C;  4I76 A;  1OCO H;  1VQ7 I;  1HBX G;  3GTO J;  2X51 A;  2H1L A;  2GXG A;  3J7Z I;  3LMM A;  5AIP A;  3BPX A;  3OIP A;  2STW A;  1YQA A;  1TQM A;  3CO7 C;  4HYE A;  2N8G A;  1R4N B;  4IVN A;  4OMZ A;  2CU7 A;  4F52 A;  2XC7 A;  3E3V A;  4KNY A;  3RIR A;  2EB7 A;  3FXK A;  1TC3 C;  1W5T A;  2KIM A;  2CW0 F;  1H9T A;  1O7F A;  1LPQ A;  1RC9 A;  3F0C A;  2MAB A;  5LHH A;  4KJZ A;  1MIJ A;  1XGO A;  1ZRE A;  2F5C A;  3I58 A;  2FBI A;  2FD5 A;  3M8F A;  2NNY A;  2NAZ A;  4U87 A;  1Y6I A;  2MBF A;  2HOE A;  3CF2 A;  5IYC J;  4D5F A;  1W0U A;  4Q48 A;  1T08 B;  3EDP A;  3ZOB A;  2VT3 A;  2VOO A;  1B59 A;  1E2X A;  3UNG C;  3J81 K;  2R3S A;  3A02 A;  3BR5 A;  3FXM A;  1ETW A;  2O3F A;  3GME A;  1FIA A;  2DXI A;  2CV0 A;  4B43 A;  4D9J A;  1K6Y A;  3OSG A;  3BCB A;  2EFP A;  2E1O A;  5E18 F;  4ETS A;  1K79 A;  1XMX A;  4J01 A;  1QVU A;  5D6E A;  2L5Q A;  2EZL A;  3DPU A;  1R6R A;  2AQF A;  2H94 A;  4XN3 A;  2PN6 A;  4Y4R A;  3PFY A;  3RZD J;  2DJN A;  4EJT A;  2KHM A;  3CUQ B;  2R5Z B;  2Y48 A;  3QYB A;  5EEG A;  5E79 C;  3U2R A;  4RDU A;  2V9V A;  4BE0 A;  1TQI A;  1W5S A;  1FWZ A;  4Y17 A;  1QVT A;  3K4J A;  2ZSI B;  3ECH A;  2MFZ A;  2LKX A;  1CQT A;  3K7A J;  1T8I A;  2VC0 A;  1UST A;  5LEK A;  3IL2 A;  3CME I;  2DPD A;  3HRS A;  4B09 A;  2VBZ A;  2WBM A;  3R6S A;  4W1U A;  2M3A A;  4D7N A;  2M9H A;  2PBI A;  4A12 A;  2J5O A;  3RDI A;  4LIV A;  1MBG A;  3SEQ A;  3HOY J;  3AL0 B;  4EJU A;  3REO A;  1T56 A;  2O9L A;  2M0M A;  2AXT C;  2E60 A;  2OQR A;  4CGZ A;  3ECO A;  3AKZ A;  3E1S A;  3Q0V A;  3V4G A;  4ZTF A;  1T6S A;  5E1Z B;  2PEX A;  2VB6 A;  1ZYR F;  4NQW B;  2JVH A;  2MD0 A;  2CWE A;  1HKT A;  1ZH5 A;  1BJA A;  5K5Q A;  1GVD A;  1MD0 A;  1Y0N A;  2PG4 A;  1LE8 B;  1A6Q A;  3L1P A;  4F7Z A;  1OCZ H;  4M6V A;  1HA8 A;  4PJN A;  1XTA A;  4M73 A;  1LFU P;  5L3B A;  2NVU B;  4CXF A;  4XIC A;  3B6A A;  3IUO A;  1MDM A;  2QBY A;  4EAT A;  4E7K A;  3GZN B;  3ZN0 A;  2DA6 A;  1FMW A;  1BL0 A;  3HSF A;  3FXL A;  3OYC A;  3ZP5 A;  2Y30 A;  4R8H A;  3ZR8 X;  4UV9 A;  3E0J B;  3IKV A;  3D5R C;  3DPL C;  5IP6 A;  2B9S A;  1Z9C A;  5A2Q Z;  2FU4 A;  5HLG A;  3C7J A;  1FEX A;  3ONQ A;  3BG7 A;  3I64 A;  3JRF A;  4GYG A;  4O6J A;  3M9A A;  2OD5 A;  3OYF A;  2QCO A;  2KMU A;  2UWM A;  2Z1D A;  2OV7 A;  2XGC A;  4XK4 A;  4HPQ A;  3H0G J;  2G9W A;  5E3L A;  3BQY A;  4XRF A;  2L9S A;  5LGN A;  3BJ6 A;  4CYC A;  5K7Z A;  4XKW A;  5FJ8 J;  3G1M A;  5DCM A;  2EBI A;  1HC8 A;  1VI0 A;  1X4P A;  3HTU A;  3CJQ B;  1ZR4 A;  3ZQF A;  3F8N A;  1SD7 A;  2QUF A;  5E8G A;  2E71 A;  4BJ5 C;  4XR6 A;  4IOA F;  2KIS A;  4RGU A;  1XGS A;  3V8L A;  3UR3 C;  1IXC A;  1OPC A;  1FOY A;  2QBY B;  3I54 A;  1T0F C;  1ZGA A;  1IUY A;  2VBW A;  5KVR A;  1F5T A;  3E7L A;  1FMV A;  1Y39 A;  3OL4 A;  2NVQ J;  1N78 A;  4YIR X;  3H3V K;  1HDD C;  2LD5 A;  3RZO J;  4RGR A;  2NS0 A;  2IXS A;  2LR8 A;  3DKY A;  3S17 J;  2R7S A;  1FOX A;  2ZJP F;  4IX7 A;  1IN5 A;  3JCU C;  4EEF G;  1XD7 A;  1K78 A;  3BZC A;  2DAO A;  4A3B J;  1G2H A;  1I39 A;  2GWR A;  3HZJ A;  3V42 A;  2OTJ I;  2K9M A;  2L4A A;  2HR3 A;  3K69 A;  1H88 C;  4OAY A;  2FJ1 A;  1SFO J;  3W2A A;  4OIN F;  4RLF A;  1JUM A;  2QQ9 A;  3NAR A;  1XSX A;  4Z6Y A;  2UXN A;  3E97 A;  2DFI A;  2RDP A;  1TNS A;  1LEA A;  3CDI A;  3ZQL A;  3SZP A;  2VKD A;  2BGC A;  2KDZ A;  5J4V A;  2Z5U A;  1YOV B;  2DT7 B;  3WG7 H;  3DLL F;  4K2E A;  4CDG A;  2E1N A;  2O5R A;  3ABU A;  3ZMS A;  2KZG A;  4HST A;  4UUT A;  4XLP F;  1X2N A;  2CQX A;  5HOO A;  2OU2 A;  3AG1 H;  2JSC A;  2X1D A;  2VPR A;  2Z2S B;  4ESJ A;  2GM4 A;  4DQ2 A;  5FRM A;  2Y75 A;  1V4R A;  2DT6 A;  2BW3 A;  4UV8 A;  3RQI A;  2R0Q C;  2JVG A;  3DTK A;  3WTS C;  4M9X A;  4IRH A;  5F0C A;  2L7M P;  3P7N A;  2IW5 A;  2LNB A;  4EGZ A;  5EDN A;  5F64 A;  4YFX F;  1YO5 C;  1KYW A;  5D6F A;  4JX6 A;  1Z6R A;  3LSK A;  4I98 B;  2FX0 A;  3M8E A;  4Q4Z F;  2WWY A;  2ETH A;  3CMA I;  4IHW A;  3F6O A;  3JRA A;  1NTC A;  4CHU A;  4ZH4 F;  5TGT A;  2BY1 A;  4S05 A;  1HLV A;  2P5K A;  3LSG A;  1XGM A;  4LK0 F;  1R49 A;  4CCO A;  4OU0 A;  4FQG A;  5E3N A;  1WI9 A;  3HOZ J;  1BJZ A;  1KU3 A;  2ELJ A;  3CTA A;  3PUF A;  1MW7 A;  5J1R A;  2COM A;  4II3 A;  2LFB A;  4G6Q A;  1UHM A;  2M8E A;  1R71 A;  4RAG A;  2G0E A;  2EV6 A;  4A3C J;  1YS7 A;  4BQO A;  5IP7 J;  4H4K C;  3CCR I;  1Z7U A;  2DQL A;  2XKO A;  3KYC B;  1JGG A;  2R7O A;  4DBR A;  5GP9 A;  5E3M A;  2D5V A;  3CCE I;  4XBF A;  2W24 A;  4HLY A;  5ED4 A;  3ZQQ A;  2RQQ A;  1EH7 A;  2IA1 A;  3D1N I;  2EA4 A;  1JTY A;  2GIV A;  2ZXH A;  3WHC A;  2LSO A;  1RZ4 A;  1IN8 A;  2L9V A;  4E6K G;  5CKT A;  4OAZ A;  5FLV A;  1Z67 A;  3FKJ A;  1FYK A;  1X4O A;  1B1B A;  2RQP A;  1ZGJ A;  3TGN A;  1CF7 B;  4Y52 J;  3MZH A;  2LK2 A;  5J47 A;  3FXR A;  1A35 A;  2ISY A;  1U9O A;  4RM2 A;  2HDW A;  1DPR A;  1S72 I;  1DUX C;  3L2C A;  3CD6 I;  1Q1V A;  5FD6 A;  1TP4 A;  1SD4 A;  3WE2 A;  2CSO A;  1ZAR A;  4P9F A;  3EQL F;  4I2O A;  1JT6 A;  1TW2 A;  2QLZ A;  4RM3 A;  2COB A;  4IJA A;  3K6G A;  2FA5 A;  4YFK F;  1BC8 C;  1VQ6 I;  1U8B A;  3BOQ A;  3HPH A;  4G94 A;  2ZJQ F;  2OZ6 A;  4MQ9 F;  2IGK A;  2JSP A;  2ZXJ A;  5LGT A;  4BXX J;  3G3Z A;  3IP4 B;  4M3D A;  5C44 J;  4KIS A;  1YS6 A;  2WB1 A;  3JRD A;  4BE2 A;  1B6A A;  4D7M A;  2EZK A;  2KIQ A;  3BTL A;  3SYT A;  1JHF A;  4DOZ A;  4AIH A;  1DGW Y;  1MJA A;  1T33 A;  3SDB A;  4DZJ A;  3EYI A;  4A0Z A;  3HKZ N;  1FTT A;  1KON A;  2M8G X;  4LLG F;  2GOX B;  4FHT A;  3F21 A;  2Q2E A;  5HDN A;  3G4S I;  4WWC A;  5JHF A;  1BIB A;  2HTS A;  5AIQ A;  2B7E A;  3Q9V A;  4PUS A;  4RAY A;  1WVR A;  5ILS A;  5KAI C;  4HV5 A;  3GFM A;  5DCM B;  4PZJ A;  1O4X A;  2XF7 A;  3DP7 A;  1TWA J;  3K4N A;  3TP3 A;  3HOT A;  2YPR A;  3K4L A;  1OFC X;  1DPU A;  1X3Z B;  3RYR A;  2CH0 A;  3C1D A;  1QZE A;  2FOW A;  3U1D A;  1PP7 U;  1BI3 A;  3KEY A;  4LMY A;  2XRN A;  4LIU A;  1JKQ C;  3RPU A;  4ASN A;  3MQ0 A;  2DOE A;  1AKH B;  3I0T A;  1ZQ3 P;  2JUC A;  3PIO F;  1WZ2 A;  1NHA A;  2V6C A;  3OIQ A;  1VQM I;  3KP3 A;  4MLO A;  3DTI A;  4L5E A;  5L3D A;  4HX8 A;  1ONV A;  3QPT A;  4XKV A;  5FFZ A;  2JA8 J;  3WGH A;  1U5T C;  2CRG A;  3J7A O;  3WU1 B;  2QSH X;  3FXQ A;  1FBQ A;  2A69 F;  3H5N A;  1P4A A;  2KRH A;  1ON2 A;  1GXQ A;  3R60 A;  4UVC A;  2CGP A;  2HPI A;  2A61 A;  5CVR A;  1SFU A;  3P9K A;  4L9T A;  2DU9 A;  4NBQ A;  2V1D A;  4F55 A;  3W6K B;  3JAM K;  2L9R A;  3DQV C;  3EUH C;  3I59 A;  5LFA A;  1O57 A;  3OWT A;  4WCG A;  3H0D A;  1XGN A;  1WJB A;  2E5N A;  2LP0 A;  5CVI A;  3CJT B;  1FSH A;  2QQB A;  1MZB A;  3PM1 A;  2EK5 A;  2XAQ A;  3AAF A;  2V9K A;  3ZQH A;  2IT0 A;  2E1M C;  4LD5 A;  3K4K A;  4LOC A;  3RKX A;  2F4I A;  1MKM A;  5CVU A;  1NK2 P;  1P9Q C;  4XLE A;  1ZRD A;  3S2D J;  4BY7 J;  1XCV A;  1QGP A;  3TW7 A;  2ACJ A;  2X0L A;  2R93 J;  2DA3 A;  2FBH A;  2XB5 A;  2X9D A;  1QHH D;  1IXS B;  2EFN A;  2O0Y A;  4WX9 A;  3ASO H;  1A04 A;  3KP5 A;  2EV5 A;  1I3Q J;  2K02 A;  3OIO A;  2IS1 A;  3AG2 H;  1K4T A;  3S2W A;  1J7K A;  3BQZ A;  2JA6 J;  3RYP A;  2V1U A;  1SFE A;  3H9G A;  4ZYD A;  4AWX B;  4AID A;  3EYY A;  1S8N A;  2HQA A;  2W85 A;  3T8R A;  2ME6 A;  4C9Y A;  2CV1 A;  5GAD J;  1KYZ A;  1W1W E;  3KP7 A;  1VQ8 I;  1ITY A;  4QSH A;  2K9S A;  2EIL H;  1Y0U A;  2PX9 A;  3M1C A;  2E34 A;  5FO5 A;  2V79 A;  4DYR A;  4RB2 C;  4CYD A;  4G6T B;  3R4K A;  2ZO4 A;  4L0Y B;  3HOV J;  2E2I J;  2IA0 A;  1RRJ A;  1I1G A;  1R5H A;  3I5U A;  1R1U A;  2W7N A;  5IP9 J;  4A3J J;  2F6C A;  2LY9 A;  1U8R A;  1GV5 A;  2KZV A;  3Q0W A;  5GPC A;  3BPV A;  4RB0 A;  3FHN A;  3ZQG A;  2HVQ A;  2IPQ X;  1VQO I;  5H6R A;  1T38 A;  2IGM A;  2M5W A;  5BQT A;  5KHD A;  1MJB A;  1JT0 A;  2VT2 A;  2AXL A;  4I7H A;  1J59 A;  2KP6 A;  2E19 A;  4RGX A;  5C4J J;  4XLC A;  2DFE A;  4DYQ A;  5CPR B;  3VYS B;  5BNG A;  2WAQ A;  3KP6 A;  5E1X A;  2DFH A;  1QU3 A;  1Z3X A;  2YSR A;  4IF4 A;  1YIO A;  3NEU A;  3FIW A;  3KP2 A;  1LUJ B;  4XM3 A;  3O3K A;  3A1Y A;  3M07 A;  2EIK H;  1JE8 A;  4FET A;  4N9H A;  2OUM A;  3O6B B;  4ZZL A;  2DLL A;  2ICW G;  4YRV A;  1WGX A;  3N05 A;  3Q3S A;  2VC1 A;  4L5J A;  2BY3 A;  4E7L A;  1W36 D;  1EJ9 A;  3BTI A;  1P7J A;  3LL7 A;  2HOT A;  4IOC F;  2R4G A;  2XPV A;  2Q0O A;  4M72 A;  1DU6 A;  2ID6 A;  3JW4 A;  2DBB A;  4Y7N J;  3GFL A;  4AYB N;  2K27 A;  4OIP F;  3S15 J;  1WJC A;  4P96 A;  4E7I A;  1LNW A;  1YIJ I;  4PSX A;  1UFM A;  1UG2 A;  1YFH A;  2B63 J;  4E7S A;  1V5G A;  1IRG A;  2VIX A;  5EEA A;  2XRL A;  1JXS A;  3CUQ C;  4IKF A;  2DDB A;  3WE3 A;  1RI7 A;  1UJ8 A;  3CMM A;  1D5Y A;  3OSF A;  3E5X A;  1IO2 A;  2BVL A;  2JPB A;  1YI2 I;  3V8J A;  1IUF A;  1QHG A;  3SHF A;  4XID A;  4GXO A;  3H9J A;  1QA6 A;  1O3S A;  4OWR B;  1HXD A;  3E5Q A;  5F08 A;  5ICG A;  5D4S A;  1D0X A;  5J1U A;  4U0Y A;  2K4J A;  4C3I J;  3AL0 C;  4A6E A;  4IO9 F;  9ANT A;  1W7P B;  1D8J A;  4A6D A;  2RNG A;  2K3F A;  3CCQ I;  2XAU A;  4G8X A;  3VSK A;  4LG3 A;  1MSF C;  3BZ6 A;  2R5Y A;  2ZME C;  3BR3 A;  4I09 A;  4PFO A;  5B66 C;  4Z2Y A;  3I56 I;  1UHS A;  4OIQ F;  1A5J A;  1M1E B;  2XDV A;  1DDN A;  4XKC A;  2BVM A;  5JVG F;  3S3N A;  5B5E C;  2VJI A;  3PNY A;  4G9Y A;  2MG4 A;  5CYV A;  1VND A;  3IWZ A;  4LFU A;  5TJJ A;  3CES A;  5EEH A;  2LF8 A;  1AU7 A;  4M3B A;  2PJR A;  2PMZ N;  4ENJ A;  4GGG A;  4B47 A;  2NVX J;  3MKW B;  2BV6 A;  2HYG D;  3RKW A;  2E2H J;  2DA2 A;  2V4J C;  1LKX A;  4XLA A;  4OMY A;  2MW8 A;  5IOZ A;  1QO0 D;  1I6X A;  3A03 A;  1IV6 A;  4B1R A;  3BR6 A;  2FSW A;  1TQP A;  1A6I A;  3DF8 A;  2JJ7 A;  4D5C A;  2HOA A;  2IVM A;  2JA7 J;  4S0H B;  1YLF A;  4A3D J;  5DM6 F;  2XF6 A;  4IQJ A;  4FX4 A;  3TMO A;  3GTQ J;  2Q1Z B;  4FIS A;  2VAS A;  5DEQ A;  4FT8 A;  5F6F A;  2IGN A;  1B9N A;  4ZYE A;  2EIJ H;  3G73 A;  1VQP I;  3HSE A;  1IV8 A;  5JR3 A;  3JTH A;  2VLA A;  2P5V A;  1XSV A;  3C18 A;  3BLY A;  1EV7 A;  1Y8Q B;  3T5X A;  5D8K B;  1H8A C;  4BBS J;  4G12 A;  2O61 A;  5EGO B;  3ERM A;  2LRD A;  2M4K A;  3TKY A;  2NRA C;  3VYU B;  1MMG A;  3PO2 J;  3PSF A;  2F5E A;  4NC8 A;  3EPZ A;  3ZMU A;  3OS1 A;  3H92 A;  1HW1 A;  3LNQ A;  2R7U A;  3HL2 A;  1MH4 A;  2HQ5 A;  4PJM A;  4CH7 A;  3FM5 A;  3C2H A;  1TBX A;  5JLX A;  2BOL A;  1R9T J;  1XMA A;  2UUZ A;  4XOR A;  3HOW J;  4MEY F;  2YR2 A;  3DBR B;  5J3L A;  4BJT A;  3CC7 I;  4BXF A;  5JVT A;  3DTE A;  3MKL A;  2R7F A;  3H36 A;  4AVP A;  1P4X A;  3J81 Z;  4ZDL A;  1TWH J;  2OF7 A;  3DU6 A;  2MLK A;  2C6Y A;  4DYC A;  3LAP A;  1ON1 A;  2CV2 A;  2LVS A;  3HC7 A;  3L00 A;  2P7V B;  3CCM I;  1D1B A;  3IH2 A;  3LST A;  2FEZ A;  5H6Q A;  3F8F A;  1Z05 A;  2ADU A;  2ECB A;  1RR8 C;  3VDX A;  5M3M J;  4BQA A;  1FNN A;  2VBX A;  2TRT A;  5AON A;  1HOM A;  3KZI C;  3F8B A;  1OYY A;  3PSI A;  4HZF A;  5L3C A;  5FLX K;  1G3W A;  2RRE A;  5F1J A;  3TDZ C;  3ABM H;  3BP8 A;  3FXJ A;  1QBJ A;  3KZZ A;  1E0E A;  1FC3 A;  4HDV A;  1VF9 A;  3S3O A;  2DYR H;  2R7V A;  2VBY A;  1GXP A;  2W57 A;  1HKQ A;  3UKG A;  2HQR A;  4A3K J;  2E5Z A;  3QP6 A;  4N4O B;  2JA5 J;  1JJ8 C;  2LY2 A;  2X6W A;  3OOU A;  4F93 B;  2M34 A;  4IHY A;  4LJZ F;  1TWF J;  4M6Y A;  2CFO A;  2E7W A;  4BXU A;  2HEO A;  3BR0 A;  2IGO A;  4HLX A;  1S29 A;  1TZL A;  2MC4 A;  2OCE A;  4L9J A;  3LQQ A;  4FE4 A;  1UB9 A;  4LG0 B;  3BT9 A;  1O3R A;  4QPQ A;  2K7L A;  4UB6 C;  5LEJ A;  4HOB A;  5A2Q K;  2X6Y A;  2O03 A;  5DDG A;  4XOT A;  1HQC A;  3R0A A;  1MDM B;  2Y0S A;  1X2M A;  1G3S A;  1IN7 A;  2VXD A;  1T2K A;  4U7D A;  2ZC2 A;  3HYI A;  2EPF A;  3M8J A;  5ILU A;  2Y9Z A;  4OIO F;  1PYV A;  1WH5 A;  2WY8 Q;  2RAE A;  3F9K A;  3PUB A;  5GTH C;  2DDA A;  3TO9 A;  4RB1 A;  4HF1 A;  2H6B A;  2F48 A;  1E3O C;  4I0B A;  5HLT A;  3E6C C;  3KEQ A;  4DJA A;  2P81 A;  1WJA A;  3IRR A;  2EV0 A;  3JRI A;  2KFD A;  4ENN A;  4CA0 A;  1RKW A;  3D0S A;  4F92 B;  2L54 A;  3JRH A;  1LDJ A;  2F4M B;  4N4N B;  2R7X A;  2CG4 A;  4UNO A;  3M3Y J;  4MEX F;  3GTG J;  1G4D A;  4KUM A;  4UVA A;  1WFX A;  3L9F A;  2X6X A;  1HCR A;  3AFH A;  1B8I B;  1BC7 C;  2HDC A;  2ZFW A;  1J2X A;  2NS7 A;  4E4H A;  2VQC A;  3VOD A;  2CS3 A;  2L0K A;  2P6S A;  5EGO A;  1XSD A;  2OQG A;  1O3Q A;  1PJR A;  3MZY A;  5HDG A;  2VJJ A;  5DD4 A;  1OIS A;  4KMU X;  1ETY A;  3WU2 C;  3OY9 A;  2HXO A;  4EM2 A;  1D0Y A;  3BZK A;  1LFP A;  2L01 A;  5FKK A;  3OV8 A;  1XMK A;  1ZRF A;  1YW8 A;  1GHC A;  2CQQ A;  2XGE A;  1KU9 A;  3QPL A;  2M1B A;  4HQM A;  1G3Y A;  4PK4 A;  2L2O A;  4A93 J;  5JI6 A;  2KDO A;  4PGG A;  5ICC A;  5F1R A;  4HX7 A;  4BS9 A;  3QPS A;  3KET A;  1N25 A;  3WTZ A;  2LBF A;  2CUJ A;  2WAE A;  1GUU A;  2X85 A;  3LA2 A;  4CSW A;  3S14 J;  2PJR B;  1X1A A;  4C2M J;  4QPO A;  3JRE A;  1S7O A;  3N97 A;  4BJ6 C;  5DS9 A;  1D3Y A;  2BEO A;  5F27 A;  1SFX A;  4BEH B;  2EIM H;  1TW3 A;  4BKX A;  3OYD A;  1G8X A;  2ZNY A;  3G6E I;  4C2U A;  1ZEL A;  5FD5 A;  3QYF A;  1FBU A;  1ACI A;  1B9M A;  2F4O B;  3V8K A;  4HDU A;  2VPL A;  5H2F C;  5J40 A;  4MO7 A;  1S5L C;  2QKM B;  3VFZ A;  4D0P A;  4Q5S F;  2EJR A;  3TOB A;  4AUX A;  3BR2 A;  3IC7 A;  1BBY A;  3JSO A;  2XPU A;  3DU5 A;  1TT5 B;  4YEJ A;  2VQG A;  4MTD A;  2LBF B;  1IZ1 A;  2XHK A;  2FMY A;  3CDH A;  6PAX A;  2WA0 A;  1ZG3 A;  3CLQ A;  1DQU A;  4KYW A;  2XKP A;  4JP0 A;  4G7O F;  4KIB A;  1PDN C;  1GT0 C;  2CJJ A;  4M9Z A;  2VE9 A;  4IL6 C;  4KN7 X;  3S1Q J;  2H09 A;  4XNF A;  2UZK A;  1ETQ A;  2ZME A;  1RNL A;  1Z21 A;  2K85 A;  5LHI A;  2DTR A;  2DW4 A;  5FRO A;  5D5U B;  1I5Z A;  3CJR B;  1SAU A;  2ELK A;  3OYK A;  4G6D A;  2QGU A;  4PJJ A;  2E36 A;  4GCV A;  3CCS I;  1OCC H;  1K4S A;  5EZG A;  4XL9 A;  4ZZD A;  5B3S H;  3P9I A;  1C0W A;  5IT9 Z;  3ZXS A;  3AG3 H;  2G7U A;  4GO1 A;  2VQL A;  2QZ8 A;  3MAJ A;  2H1K A;  1U9N A;  4EMS A;  4GDF A;  4S04 A;  1VZ0 A;  3RQ4 A;  4HSR A;  3PIP F;  3GVA A;  2W1O A;  2KRC A;  2IEK A;  3VSL A;  1OCP A;  2XVC A;  2HZT A;  4LB6 B;  2BE5 F;  5CJ9 A;  3ZN1 A;  4ZJZ A;  3WTU C;  3LAJ A;  1U5T B;  2OBP A;  3EUA A;  1SVO A;  3LA3 A;  3E5U A;  4B3A A;  3L2Q A;  2A5Y B;  2XAF A;  5F0H A;  1GLN A;  1IRX A;  3S1M J;  5DYM A;  1SAX A;  1W36 C;  3DEW A;  2DO7 A;  3ZMT A;  3GLX A;  3GZ6 A;  2DOF A;  1E3P A;  3GCM A;  3RKY A;  3LSR A;  1I50 J;  3GTM J;  2DYS H;  1KQ0 A;  2WY7 Q;  4XLF A;  1LDK B;  1BIA A;  4HV6 A;  3CCU I;  2STT A;  4A3L J;  1RR7 A;  1I1S A;  4IHT A;  2MA3 A;  4FAS D;  4YIF A;  5J8C A;  1X3U A;  3JTG A;  2VKV A;  2V26 A;  5TIS C;  2M7B A;  3JRG A;  2NVY J;  4HA8 A;  1FX7 A;  2E1M B;  4HG2 A;  4KIC A;  1SD5 A;  3W6J B;  1A31 A;  3HJE A;  1Z3Y A;  2QKL B;  1POG A;  1Z0X A;  1T39 A;  2A6H F;  4MFE A;  1HF0 A;  2FOK A;  4ABZ A;  2ZKZ A;  2FML A;  2WV1 A;  1OLT A;  1R4M B;  2K86 A;  3MD2 A;  2TDX A;  3LOC A;  3QQA A;  1F1Z A;  4IEJ A;  2I5U A;  1HKS A;  4UUV A;  1LJ9 A;  1ZKG A;  2DJI A;  3HOX J;  1RKT A;  4A0Y A;  2Z33 A;  3CC4 I;  2F5V A;  1T0F A;  1QRY A;  3TDU C;  5DTD A;  3IV5 A;  4I0A A;  4XQF A;  1PUE E;  3GTK J;  4B3X A;  4RA2 A;  3KX2 A;  4PGH A;  2DFF A;  1XDU A;  3K4M A;  3ZMZ A;  3G1L A;  3LSI A;  4GFB A;  2R5Y B;  2IS2 A;  5HS9 A;  2IA2 A;  5FB2 A;  3ELK A;  3CJN A;  3K9T A;  3ZMV A;  3VB2 A;  2DTZ A;  4HNT A;  4U88 A;  4ZDP A;  3RTR A;  2YX4 A;  3MMY B;  1WPK A;  1UHW A;  3COA C;  3HPG A;  3PQJ A;  5GPA A;  1R58 A;  5EYR A;  3WHB A;  4BNC A;  3QP5 A;  3HRT A;  4BYY A;  3JSP A;  1UZC A;  4OOI A;  4N9I A;  3U1K A;  3G71 I;  2R7T A;  3SEZ A;  4IPA A;  1XDS A;  3IWF A;  4CIC A;  4HRI A;  4M74 A;  1KGS A;  1X58 A;  3TP0 A;  3VWB A;  3K4B A;  4AVZ A;  1HST A;  1R22 A;  2M87 A;  3F6V A;  2M2E A;  4RMN A;  4XMY A;  1R1V A;  4ESF A;  1FOW A;  4LLN A;  2CYY A;  3H3U A;  5CQE A;  4XSZ F;  3ABK H;  3MEX A;  1LQ1 A;  1V3F A;  1ODD A;  3CP8 A;  4AU7 A;  3I4P A;  2HTJ A;  4NNJ A;  2NYX A;  4MHG A;  4BQQ A;  4RAZ A;  2E7X A;  1SVL A;  2ZFU A;  2NOG A;  4LIT A;  2BW3 B;  2JMW A;  2KLO A;  4MQV A;  4AIK A;  2K40 A;  1G3T A;  2OJE D;  2BXY A;  1JHH A;  3N4M A;  1TWG J;  4KT6 A;  5GAH J;  2PI0 A;  3K2A A;  1B4A A;  1QNT A;  2CQN A;  3MKZ A;  3BG3 A;  1Y56 A;  4C3H J;  3D5S C;  5J1Y A;  2ZXW H;  1U78 A;  3WGG A;  4A3M J;  2GA2 A;  3BJA A;  2DMP A;  3BY6 A;  1EH6 A;  2IJL A;  1OR7 C;  2VL8 A;  4YG2 F;  3S1N J;  4YFN F;  4A3G J;  1WHU A;  2A07 F;  3QU6 A;  2BBY A;  1Z91 A;  1YIT I;  5E3O A;  4PCQ A;  4XRS G;  2L4M A;  1X1B A;  2HDD A;  5D5V B;  1WQ2 A;  1SAN A;  2HGC A;  2K5C A;  1MMN A;  4IHV A;  1BOB A;  1OQY A;  1KA8 A;  5K5R A;  3EUH A;  2R7W A;  3B73 A;  3K10 A;  2EH3 A;  1TLH B;  1MGT A;  3WG9 A;  2QM3 A;  3CCV I;  3HGG A;  3BTJ A;  4QTR A;  4P55 A;  2Y9Y A;  4A0X A;  2FF4 A;  2VON A;  2K9N A;  4RS8 A;  4G7Z F;  2XAH A;  1OKR A;  2QWW A;  4IRI A;  1F36 A;  4B44 A;  2XAS A;  4ENK A;  3HEF A;  3X2Q H;  4BDZ A;  3RSN A;  4BL0 B;  3IHU A;  3OS2 A;  1VQN I;  2LDU A;  4Y15 A;  3PJR A;  5BPD A;  5D8L B;  1ERD A;  2GXB A;  3QOP A;  3HUG A;  5HOD A;  4C2T A;  3K2Z A;  1KZH A;  5L3E A;  4C3J J;  2L3D A;  2ZME B;  3RPU D;  1S6L A;  5FKO A;  2QA4 I;  3OL3 A;  5LHG A;  1IN4 A;  3KZY A;  3LFU A;  1X1D A;  4WXD A;  1W4M A;  5FKL A;  3ABL H;  4NHJ A;  1DU0 A;  5F0F A;  1XN7 A;  2H8W A;  2W4S A;  3BG9 A;  4CCL A;  4CCM A;  5FRN A;  2EQR A;  3GO5 A;  3RJP A;  3WTX C;  1O3T A;  3E6D A;  4DBQ A;  4P9U A;  1OCR H;  1AHD P;  1FPQ A;  1ZG1 A;  1IF1 A;  3OYH A;  1Z1D A;  4ZTJ A;  1D5V A;  2VOP A;  4BE1 A;  3GTP J;  1V54 H;  3HB9 A;  5DUI A;  1N77 A;  4Y33 A;  4U0V A;  5D5X B;  2D2W A;  2L7F P;  2MYS A;  1EH8 A;  1K83 J;  3JRB A;  1IGN A;  4R79 A;  4X6A J;  3J80 K;  4AIJ A;  4AD9 A;  1YE9 A;  1FY7 A;  2E35 A;  2FNA A;  1VQ4 I;  3DKW A;  2HU9 A;  1Y1V J;  2NVT J;  1ZK8 A;  1KU7 A;  2W25 A;  4B8X A;  1S7E A;  3GEZ A;  1GVJ A;  3VYT B;  2ZXI A;  2EFW A;  3K0L A;  1WCM J;  3CCJ I;  2O6G E;  3I9V 2;  2M30 A;  1YX3 A;  4BH9 A;  5LLQ A;  1Q1H A;  4L9N A;  2XRO A;  1YW7 A;  1U3E M;  4BUP A;  2OTL I;  1B8I A;  2WAF A;  4XRS A;  2HQN A;  3DWL E;  3L09 A;  1U0J A;  2XIG A;  1ZRC A;  3W2V A;  2PLY A;  4CCN A;  2BY2 A;  3LSM A;  2HNH A;  4N0B A;  1E17 A;  3FHZ A;  3SZT A;  4E7J A;  4BHC A;  4I02 A;  3L7W A;  3ERE D;  1ENH A;  1BN5 A;  2NS8 A;  3KE2 A;  1RET A;  1ZAO A;  2H6C A;  1MND A;  2LKS A;  5KAF C;  3OS0 A;  4UY8 I;  1VQK I;  2CW8 A;  2DOD A;  2GZW A;  1JKP C;  1AKH A;  4LGW A;  2LY1 A;  3HRM A;  2JQ7 A;  3C2B A;  2IRF G;  3M1E A;  1XX5 A;  2Z3Y A;  1AA7 A;  5M5X J;  2R7D A;  2DI3 A;  5CQG A;  2ZB9 A;  4ZC3 A;  2DK8 A;  5DCF A;  4LLL A;  4WF2 A;  1QQI A;  1CF7 A;  1YG2 A;  4BHP A;  3CUQ A;  1EF4 A;  1LVK A;  4ESB A;  2QEN A;  2KPM A;  3SDG A;  2K9L A;  1K61 A;  4BGD A;  3F8M A;  2F2E A;  2ZBK A;  3NWS A;  2OZU A;  4IHS A;  3NWT A;  4E7H A;  5F04 A;  2R7R A;  4QWQ A;  2PJP A;  5HS8 A;  3W2W A;  5ERI A;  1XC5 A;  2DA1 A;  4MIM A;  4HQE A;  5DD8 A;  1RUO A;  3WTV C;  2MGQ A;  5BS6 A;  2B0L A;  5K7F A;  1P6R A;  2ME0 A;  2KRF A;  3A2K A;  3S1R J;  1YJW I;  1I3A A;  3DV8 A;  1ORK A;  3MFK A;  1HSJ A;  5BOX A;  3FDY A;  4DGW B;  3C2G A;  3VYR B;  3H1C A;  1R5G A;  3SXY A;  3E6B A;  5IY5 H;  1DP7 P;  3P5J A;  3SFI A;  2DMT A;  2FQ3 A;  2Y2Z A;  2CMP A;  3TW6 A;  4WK8 F;  3FIS A;  1K7A A;  3BCA A;  3BDD A;  4O5V A;  2EZH A;  3HOU J;  1BM9 A;  1V5F A;  3H9Q A;  1GDT A;  5JLW A;  2R7Q A;  1FOK A;  2L7K A;  5LRR A;  1ZG5 A;  1MH3 A;  5LGU A;  3PQK A;  4XOP A;  1MMS A;  1DGR M;  2M4G A;  1HW5 A;  2DK5 A;  1PVE A;  4IQ4 A;  2X4H A;  5IYD J;  1P7I A;  2JK3 A;  1FP1 D;  3CZ6 A;  3BTC A;  5ICE A;  1RPW A;  2HPM A;  5L3G A;  1IW7 F;  2XPW A;  3HTS B;  4BY1 J;  2KQR A;  3FF5 A;  1XB4 A;  1BR1 A;  2ZJR F;  2QQA A;  5LD2 C;  2HVS A;  1WJD A;  3LFK A;  2GAU A;  1A36 A;  3GUD A;  1ZLK A;  2ESH A;  1I6H J;  3ZQC A;  5J8F A;  3I4N J;  2AS5 F;  1R23 A;  2DMN A;  2X48 A;  3A0H C;  3IAM 2;  3S8P A;  5LRS A;  2ISZ A;  3GTL J;  4XKB A;  3MCZ A;  1VQL I;  4AM3 A;  1QZY A;  3OOP A;  3WTY C;  2H27 A;  4BAC A;  3HGY A;  2Q8K A;  4M71 A;  2ID3 A;  2EA2 A;  1WSU A;  4BAY A;  3BR1 A;  2MLG A;  5KCM A;  4A3E J;  1IN6 A;  1UMQ A;  3I71 A;  1D0Z A;  3L2V A;  4WXH A;  2QSF X;  2Z99 A;  3K70 C;  3PNT A;  3FKI J;  4LG0 A;  3HRU A;  1S3J A;  1TWC J;  2LC2 A;  2EFO A;  4BEH A;  2ECC A;  2CUF A;  3BC8 A;  3DEE A;  4M6X A;  4Q47 A;  1FT9 A;  1PUF A;  2W82 A;  3RI4 A;  5KNL A;  1H9G A;  4UXN A;  1SMY F;  3DBH B;  1TTY A;  1WJE A;  2A68 F;  4P5O A;  4QLC U;  3I53 A;  3LWF A;  3F8C A;  1ETV A;  2ELH A;  3A4C A;  1NK3 P;  2GLO A;  4HX4 A;  4RAF A;  4ZYH A;  3K1M A;  1HW2 A;  3RKQ A;  2O8X A;  2CUZ A;  4KT5 C;  2BY0 A;  2EWN A;  1Z7L A;  4TV7 A;  1W0T A;  3WGI A;  2HFH A;  4L0Z B;  2V7F A;  3VOE A;  3V7S A;  1FBS A;  3V7C A;  1QPI A;  2FQ4 A;  1J75 A;  3KIO A;  4PDK A;  2JT1 A;  3T0Y A;  4CCK A;  2WAQ N;  3FXU A;  3M4O J;  3A01 B;  2W48 A;  2KIU A;  4M9S A;  2JTV A;  2WB1 N;  4ZYA A;  2LMD A;  1X1C A;  5E20 A;  4KN4 X;  2VJ4 A;  1MBE A;  1UCR A;  1YW9 A;  1BA5 A;  2CQ7 A;  1V55 H;  3HM5 A;  1BI2 A;  5D4R A;  1VFC A;  2X1C A;  3L2U A;  3B6C A;  2QQ8 A;  1ZN2 A;  3GFI A;  4CUG A;  3HKZ A;  3FBN B;  3U21 A;  2R5Z A;  3FMQ A;  1G6N A;  2FUG 2;  2HYJ A;  2QVO A;  3V7R A;  1Z6T A;  5BMZ A;  2BHZ A;  2RV8 A;  1J0R A;  3OYM A;  3M7G A;  4EV0 A;  2QEX I;  3GWZ A;  1L3L A;  3HUG B;  4R1H A;  2P5L C;  4E7Z A;  3EUK L;  3ZRG A;  3FM3 A;  3K70 D;  3LQR A;  2NNN A;  3QAH A;  3H35 A;  3IKT A;  3ULQ B;  3HIF A;  2HVR A;  4JX4 A;  2OC6 A;  4G7H F;  3DEU A;  2VKH A;  2W84 A;  3FXO A;  1FP2 A;  4A69 C;  1G59 A;  2Y69 H;  3GX4 X;  1MSE C;  1LE8 A;  4RB3 C;  4V2F A;  4KFC A;  2HWV A;  5KK1 A;  5M3F J;  2WV0 A;  3KPH A;  4KIT B;  3F3X A;  3ESW B;  4EJO A;  1BI0 A;  3HG9 A;  1SVM A;  5DM7 F;  3CP2 A;  1I27 A;  5GAE J;  2L7Z A;  3PO3 J;  3H3Z A;  2GXA A;  2HS5 A;  4HBL A;  2JN6 A;  3J7Y J;  5HLH A;  3NAU A;  2P4W A;  2XGD A;  5J6X A;  2IBD A;  4W97 A;  1WRJ A;  2L9N A;  3SZG A;  1MBH A;  2L02 A;  1JGS A;  5C3E J;  2VOD A;  3ROU A;  4KA4 A;  3BJO A;  5CLS A;  1B72 A;  5JHU A;  1OJL A;  1U2W A;  3OR1 C;  2F5D A;  2DA4 A;  2FNP A;  4DW6 A;  4MNU A;  3ASN H;  2V1N A;  1YRN A;  4F3Q A;  5M5Y J;  2ZJ2 A;  3O2P E;  3PL8 A;  1BR2 A;  3T8T A;  3H5A A;  4UUS A;  3O8H A;  2DCE A;  2KT0 A;  2HKX A;  1LFB A;  1U6G A;  2DQR A;  2HZD A;  2E2J J;  2RN7 A;  1WWX A;  2HYF A;  1JKR C;  2HOS A;  1TL8 A;  4QIW N;  4EGY A;  4M3F A;  1WJ5 A;  2YX7 A;  4V19 K;  4KDP A;  2JRM A;  4MFD A;  2LH9 A;  1BR4 A;  1W7P D;  2LOO A;  3ZGK A;  1FZP B;  2VKE A;  1VQ9 I;  2DMU A;  1LVA A;  2JZY A;  4A3I J;  2RC4 A;  2MD5 A;  3TOA A;  4HNV A;  2QF7 A;  3TED A;  1Y1W J;  3ML6 A;  2H8R A;  2IS6 A;  2PFB A;  3HXL A;  3SJM A;  1YYV A;  4LK1 F;  4JYK A;  2Q2E B;  3TBI A;  2LRE A;  1FLI A;  4EJW A;  4PJ0 C;  3HHG A;  3R0J A;  4NB5 A;  4OIR F;  2YU9 J;  3ZQI A;  4FTH A;  1JUS A;  4GRI A;  4FE7 A;  3T1B A;  2BYV E;  4FX0 A;  1BI1 A;  1F9N A;  5HDK A;  3DPT A;  1N75 A;  4CO8 A;  3C3W A;  2OA4 A;  5C4X J;  2XF5 A;  1F43 A;  3FWE A;  2A6T A;  2GIZ A;  2FRH A;  4CZZ A;  2LLK A;  1BW5 A;  3KFW X;  5FKN A;  2VXZ A;  5EZH A;  2VI6 A;  2DMQ A;  3NQO A;  3IRQ A;  4L18 B;  1R1T A;  3WU0 A;  1ETK A;  2KIF A;  4ON0 A;  1IDZ A;  2XAG A;  3G2B A;  3ZMD A;  5ILV A;  1MNM C;  1L0O C;  1K6O A;  1SD6 A;  4ENM A;  3ZPL A;  2LF7 A;  2ZCW A;  4M3G A;  3CF5 F;  1PUF B;  2CUE A;  1RUN A;  1P4W A;  3OYI A;  4KMF A;  4L5I A;  2RGV A;  1O7L A;  1D1C A;  2GQQ A;  3RCO A;  1P2F A;  3F23 A;  3CC2 I;  2WTE A;  2R7Z J;  3FMS A;  1OR7 A;  1T98 A;  3IH4 A;  4II2 A;  4CCJ A;  4UB8 C;  2JRT A;  4JQF A;  1ZHF A;  3O8G A;  3R61 A;  5FGM A;  3GW2 A;  2FXA A;  3CLO A;  3VEP A;  3S16 J;  2LKP A;  4RGS A;  2A05 A;  4BQN A;  5J4Y A;  2KJC A;  4JK1 X;  2XB0 X;  4F91 B;  1IRZ A;  1ZGW A;  3H5R A;  1AOY A;  3CDL A;  4ZDO A;  1T95 A;  4WXC A;  3S93 A;  2VUM J;  1FJL A;  1CGP A;  1MNE A;  1YTY A;  2TCT A;  4BDY A;  2X6O A;  1WJF A;  4HF0 A;  4V2G A;  4B48 A;  5M5W J;  1WI3 A;  3GXO A;  1YRN B;  3GF2 A;  3TO7 A;  3HBL A;  1TT0 A;  4AYB A;  1K78 B;  2YUS A;  5TRD A;  3F22 A;  1KQ9 A;  3W3C A;  3OYJ A;  4IRG A;  4A5M A;  3OYE A;  4J19 A;  5EF6 A;  4CZC A;  4RBO A;  2MH9 A;  3KP4 A;  3QYE A;  4P1W A;  1YHQ I;  2J5P A;  3P9C A;  3L2W A;  2FE3 A;  3DLA A;  3GZ5 A;  3KYD B;  4B4C A;  4IHX A;  1NG7 A;  3I59 B;  3WTT C;  3KLO A;  4AC0 A;  2E1C A;  3TL4 X;  4E70 A;  2WAD A;  3S3M A;  5LBQ A;  4KIF A;  4UHT A;  2Y31 A;  1WKM A;  5E17 F;  4Y3O A;  3J80 Z;  4PSW A;  2VE8 A;  1ZTR A;  2K9Q A;  2A6E F;  2P6T A;  4A5N A;  5JFR A;  4EM1 A;  1STZ A;  2V9P A;  2DT5 A;  1USS A;  2XUB A;  3FK6 A;  1IAW A;  1QZZ A;  4J00 A;  2D1H A;  3QRF F;  2VN2 A;  1YJN I;  3E6M A;  3MN2 A;  4DNC A;  3FX3 A;  2D45 A;  1XG1 A;  3D5L A;  2A3S A;  5B1A H;  2WC2 A;  4CYC B;  3Q5F A;  2HI3 A;  2OAZ A;  5L3F A;  3MVP A;  3OYA A;  3W6V A;  4A2U A;  3WOD F;  3EET A;  1EA3 A;  1SMT A;  4PFP A;  3JAM Z;  2R92 J;  2ESN A;  3I3L A;  3LSJ A;  4XLH A;  5CVV A;  5E8I A;  2LG4 A;  1KQ8 A;  1QPM A;  2P8T A;  4XON A;  2EZI A;  3MKY B;  1U5T A;  3K1N A;  1MBF A;  4O3M A;  1ETX A;  1ZLJ A;  5FFX A;  4D1Q A;  1OYI A;  3RPQ A;  3CO6 C;  1SEU A;  3IH3 A;  2HXI A;  3A0B C;  2UXX A;  5BPI A;  3CUO A;  4BHB A;  3OYL A;  2DPU A;  4IXA A; 
#chains in the Genus database with same CATH homology
 1IRF A;  2CFX A;  2V1X A;  1TNT A;  3F72 A;  4ZYG A;  1S7A A;  1KU2 A;  4HW0 A;  4EM0 B;  1W7P A;  1OMI A;  3QU3 A;  3TO6 A;  1ULY A;  2PMU A;  3KLN A;  5ICF A;  5E1W A;  4U7B A;  2JPC A;  2RKH A;  4L9V A;  2XAJ A;  4MGR A;  1LB2 A;  5K1Y A;  2CO5 A;  5H20 A;  2HKO A;  5D5W B;  5HS7 A;  4YII A;  4HF2 A;  5CVJ A;  3MWM A;  5HLI A;  1VTN C;  3LA7 A;  3QPH A;  4LB5 A;  5IT3 A;  1FYL A;  4UVB A;  4GYI A;  3ISP A;  1R36 A;  2MH2 A;  3HSR A;  5IT9 K;  3BRO A;  1F4K A;  3B02 A;  2KJB A;  1PP8 F;  4H0E A;  4EQQ A;  3SQN A;  1D8K A;  1IXR C;  4U0W A;  3PFI A;  3U9G A;  2PQ8 A;  2MC3 A;  3BWG A;  2RVC A;  1LDD A;  4XSX F;  4Y13 A;  1R00 A;  2G7H A;  5HVQ C;  2XGX A;  4I01 A;  1AWC A;  4NQW A;  1RIO H;  2K4B A;  4KIG A;  3Q9S A;  3HOS A;  3ZQ7 A;  3WTW C;  1J9I A;  3ABT A;  5FLX Z;  3FMR A;  3KEO A;  1LEB A;  4EVI A;  4HAM A;  3SFZ A;  5K5O A;  2KKO A;  1MJ9 A;  1P92 A;  4MTE A;  2Y0M A;  2ZNZ A;  2QYO A;  3KCC A;  2YU3 A;  2M45 A;  2IP2 A;  5DUK A;  2RNJ A;  3K1P A;  1FYM A;  2P7C B;  4XLN F;  2F5F A;  1BOA A;  3TQN A;  2FBK A;  1FSE A;  4EJV A;  3DFG A;  5DV5 A;  3DXJ F;  3NRV A;  4JBA A;  2GA1 A;  3GFJ A;  3FZV A;  2PMH A;  3HHH A;  2Z9O A;  3GYH X;  1XCB A;  1REP C;  1H0M A;  2CQK A;  1J5Y A;  2EFQ A;  2D1V A;  2XV4 S;  1OYW A;  1R7J A;  1HBX G;  2GXG A;  5AIP A;  3BPX A;  2STW A;  1YQA A;  1TQM A;  3CO7 C;  4HYE A;  4IVN A;  4OMZ A;  3E3V A;  4KNY A;  3RIR A;  2EB7 A;  1W5T A;  2KIM A;  2CW0 F;  1H9T A;  1O7F A;  5LHH A;  1XGO A;  1ZRE A;  2F5C A;  3I58 A;  2FBI A;  3M8F A;  2NNY A;  2NAZ A;  2MBF A;  2HOE A;  4Q48 A;  3EDP A;  2VT3 A;  2VOO A;  1B59 A;  1E2X A;  3J81 K;  2R3S A;  2O3F A;  2EFP A;  5E18 F;  4ETS A;  1K79 A;  5D6E A;  2H94 A;  2PN6 A;  4EJT A;  3CUQ B;  2Y48 A;  5EEG A;  3U2R A;  2V9V A;  1TQI A;  1W5S A;  1FWZ A;  4Y17 A;  3ECH A;  2VC0 A;  1UST A;  5LEK A;  3IL2 A;  2DPD A;  3HRS A;  4B09 A;  2VBZ A;  3R6S A;  2PBI A;  4A12 A;  2J5O A;  3RDI A;  4EJU A;  3REO A;  2OQR A;  4CGZ A;  3ECO A;  3V4G A;  1T6S A;  5E1Z B;  2PEX A;  1ZYR F;  2CWE A;  1HKT A;  1ZH5 A;  1BJA A;  5K5Q A;  1MD0 A;  2PG4 A;  4F7Z A;  4M73 A;  5L3B A;  4CXF A;  1MDM A;  2QBY A;  3ZN0 A;  3HSF A;  3ZP5 A;  4R8H A;  4UV9 A;  3IKV A;  3DPL C;  1Z9C A;  5A2Q Z;  2FU4 A;  5HLG A;  3C7J A;  3I64 A;  4GYG A;  4O6J A;  3M9A A;  2OD5 A;  2UWM A;  2G9W A;  4XRF A;  5LGN A;  3BJ6 A;  5DCM A;  3HTU A;  3F8N A;  1SD7 A;  2QUF A;  5E8G A;  4RGU A;  1XGS A;  3V8L A;  1IXC A;  1OPC A;  2QBY B;  3I54 A;  1ZGA A;  1IUY A;  2VBW A;  5KVR A;  1F5T A;  4RGR A;  2NS0 A;  1IN5 A;  1XD7 A;  1K78 A;  2DAO A;  2GWR A;  2L4A A;  2HR3 A;  3K69 A;  4OIN F;  2QQ9 A;  1XSX A;  2UXN A;  3E97 A;  2DFI A;  2RDP A;  1TNS A;  1LEA A;  3SZP A;  2BGC A;  2Z5U A;  4K2E A;  4CDG A;  2E1N A;  3ABU A;  3ZMS A;  4XLP F;  5HOO A;  2OU2 A;  2JSC A;  4ESJ A;  4DQ2 A;  2Y75 A;  1V4R A;  4UV8 A;  3WTS C;  4M9X A;  4IRH A;  3P7N A;  2IW5 A;  2LNB A;  4EGZ A;  5F64 A;  4YFX F;  1YO5 C;  1KYW A;  5D6F A;  1Z6R A;  4I98 B;  3M8E A;  4Q4Z F;  2WWY A;  2ETH A;  3F6O A;  4CHU A;  4ZH4 F;  4S05 A;  2P5K A;  1XGM A;  4LK0 F;  4OU0 A;  1WI9 A;  1KU3 A;  3CTA A;  2COM A;  4G6Q A;  1UHM A;  2M8E A;  2EV6 A;  1YS7 A;  1Z7U A;  2DQL A;  2XKO A;  4XBF A;  2W24 A;  4HLY A;  5ED4 A;  1EH7 A;  2IA1 A;  2EA4 A;  2GIV A;  2LSO A;  1RZ4 A;  1IN8 A;  1FYK A;  1B1B A;  2RQP A;  1ZGJ A;  3TGN A;  1CF7 B;  3MZH A;  3FXR A;  2ISY A;  1DPR A;  1DUX C;  3L2C A;  5FD6 A;  1SD4 A;  3WE2 A;  2CSO A;  1ZAR A;  4P9F A;  3EQL F;  4I2O A;  1TW2 A;  2QLZ A;  4IJA A;  2FA5 A;  4YFK F;  1BC8 C;  3BOQ A;  4G94 A;  2OZ6 A;  4MQ9 F;  2ZXJ A;  5LGT A;  3G3Z A;  1YS6 A;  1B6A A;  1JHF A;  4AIH A;  1MJA A;  3EYI A;  4A0Z A;  4LLG F;  4FHT A;  3F21 A;  2Q2E A;  5HDN A;  4WWC A;  1BIB A;  2HTS A;  5AIQ A;  3Q9V A;  4RAY A;  5ILS A;  4HV5 A;  3GFM A;  5DCM B;  4PZJ A;  3DP7 A;  3HOT A;  2YPR A;  1DPU A;  3RYR A;  3C1D A;  3U1D A;  1PP7 U;  1BI3 A;  4LMY A;  2XRN A;  3RPU A;  4ASN A;  3MQ0 A;  3I0T A;  1NHA A;  2V6C A;  3KP3 A;  5L3D A;  4HX8 A;  1ONV A;  3QPT A;  5FFZ A;  3WGH A;  1U5T C;  3J7A O;  3WU1 B;  3FXQ A;  1FBQ A;  2A69 F;  1P4A A;  1ON2 A;  1GXQ A;  3R60 A;  4UVC A;  2CGP A;  2A61 A;  5CVR A;  1SFU A;  3P9K A;  4L9T A;  2DU9 A;  2V1D A;  3JAM K;  3W6K B;  3DQV C;  3I59 A;  1O57 A;  4WCG A;  1XGN A;  5CVI A;  1FSH A;  2QQB A;  1MZB A;  2EK5 A;  2XAQ A;  3AAF A;  2IT0 A;  4LD5 A;  3RKX A;  1MKM A;  5CVU A;  1ZRD A;  1XCV A;  1QGP A;  2ACJ A;  2X0L A;  2FBH A;  1IXS B;  2EFN A;  2O0Y A;  4WX9 A;  1A04 A;  3KP5 A;  2EV5 A;  2K02 A;  3S2W A;  1J7K A;  3RYP A;  2V1U A;  1SFE A;  4ZYD A;  4AWX B;  3EYY A;  1S8N A;  2W85 A;  3T8R A;  1KYZ A;  3KP7 A;  1Y0U A;  5FO5 A;  2V79 A;  4RB2 C;  4CYD A;  3R4K A;  2ZO4 A;  4L0Y B;  2IA0 A;  1I1G A;  1R5H A;  3I5U A;  1R1U A;  1U8R A;  3BPV A;  4RB0 A;  2IPQ X;  5H6R A;  1T38 A;  2M5W A;  5BQT A;  1MJB A;  2VT2 A;  2AXL A;  4I7H A;  1J59 A;  4RGX A;  3KP6 A;  5E1X A;  2YSR A;  4IF4 A;  1YIO A;  3NEU A;  3KP2 A;  3O3K A;  1JE8 A;  4N9H A;  3O6B B;  4ZZL A;  2DLL A;  2VC1 A;  4L5J A;  2Q0O A;  4M72 A;  3JW4 A;  2DBB A;  3GFL A;  2K27 A;  4OIP F;  4P96 A;  1LNW A;  1UFM A;  1YFH A;  1IRG A;  1JXS A;  3CUQ C;  3WE3 A;  1RI7 A;  3E5X A;  2JPB A;  3V8J A;  3SHF A;  4GXO A;  1O3S A;  1HXD A;  3E5Q A;  5ICG A;  5D4S A;  4U0Y A;  2K4J A;  4A6E A;  1W7P B;  1D8J A;  4A6D A;  4G8X A;  3BZ6 A;  4I09 A;  4Z2Y A;  4OIQ F;  1DDN A;  4G9Y A;  5CYV A;  3IWZ A;  4LFU A;  5TJJ A;  5EEH A;  2LF8 A;  4ENJ A;  4GGG A;  2BV6 A;  2HYG D;  3RKW A;  4OMY A;  1QO0 D;  1I6X A;  2FSW A;  1TQP A;  3DF8 A;  2IVM A;  1YLF A;  4FX4 A;  5DEQ A;  4FT8 A;  5F6F A;  1B9N A;  4ZYE A;  3G73 A;  3HSE A;  5JR3 A;  3JTH A;  2P5V A;  1XSV A;  3C18 A;  1EV7 A;  3T5X A;  5D8K B;  2O61 A;  3TKY A;  2NRA C;  2F5E A;  3ZMU A;  3H92 A;  1HW1 A;  3FM5 A;  1TBX A;  1XMA A;  4MEY F;  2YR2 A;  5JVT A;  2R7F A;  4AVP A;  1P4X A;  3J81 Z;  2MLK A;  2C6Y A;  3LAP A;  1ON1 A;  3L00 A;  2P7V B;  3LST A;  2FEZ A;  5H6Q A;  3F8F A;  1Z05 A;  2ADU A;  4BQA A;  1FNN A;  2VBX A;  5AON A;  4HZF A;  3F8B A;  1OYY A;  5L3C A;  5FLX K;  1G3W A;  3TDZ C;  3BP8 A;  1QBJ A;  3KZZ A;  1FC3 A;  4HDV A;  2VBY A;  1GXP A;  2W57 A;  1HKQ A;  2HQR A;  3QP6 A;  4LJZ F;  4M6Y A;  4BXU A;  2E7W A;  2HEO A;  4HLX A;  1S29 A;  4L9J A;  3LQQ A;  1UB9 A;  4LG0 B;  1O3R A;  5A2Q K;  2K7L A;  5LEJ A;  4HOB A;  2O03 A;  5DDG A;  1HQC A;  3R0A A;  1MDM B;  1G3S A;  1IN7 A;  1T2K A;  4U7D A;  3HYI A;  5ILU A;  4OIO F;  4HF1 A;  3TO9 A;  4RB1 A;  2H6B A;  4I0B A;  3E6C C;  3KEQ A;  3IRR A;  2EV0 A;  4ENN A;  3D0S A;  2L54 A;  1LDJ A;  2CG4 A;  4UNO A;  4MEX F;  1G4D A;  4KUM A;  4UVA A;  3L9F A;  1BC7 C;  2HDC A;  2ZFW A;  1J2X A;  3VOD A;  2P6S A;  1XSD A;  2OQG A;  1O3Q A;  3MZY A;  5HDG A;  5DD4 A;  4KMU X;  4EM2 A;  2L01 A;  3OV8 A;  1XMK A;  1ZRF A;  1YW8 A;  1GHC A;  1KU9 A;  4HQM A;  2M1B A;  1G3Y A;  5JI6 A;  4PGG A;  5ICC A;  5F1R A;  4HX7 A;  3KET A;  3WTZ A;  3LA2 A;  3N97 A;  1S7O A;  1D3Y A;  2BEO A;  1SFX A;  1TW3 A;  2ZNY A;  5FD5 A;  1FBU A;  1B9M A;  3V8K A;  4HDU A;  3VFZ A;  4D0P A;  4Q5S F;  2EJR A;  3TOB A;  3IC7 A;  1BBY A;  3JSO A;  4MTD A;  1IZ1 A;  2XHK A;  2FMY A;  3CDH A;  6PAX A;  1ZG3 A;  4KYW A;  2XKP A;  4G7O F;  4KIB A;  1PDN C;  4M9Z A;  2VE9 A;  4KN7 X;  2H09 A;  2UZK A;  2ZME A;  1RNL A;  5LHI A;  2DTR A;  2DW4 A;  5D5U B;  1I5Z A;  4G6D A;  4GCV A;  4ZZD A;  3P9I A;  1C0W A;  5IT9 Z;  4GO1 A;  2G7U A;  2QZ8 A;  3MAJ A;  4EMS A;  4S04 A;  3GVA A;  2XVC A;  2HZT A;  4LB6 B;  3WTU C;  2BE5 F;  5CJ9 A;  3ZN1 A;  3LAJ A;  1U5T B;  2OBP A;  3LA3 A;  3E5U A;  2A5Y B;  2XAF A;  5DYM A;  1SAX A;  2DO7 A;  3ZMT A;  3GLX A;  3GZ6 A;  3RKY A;  1KQ0 A;  1LDK B;  1BIA A;  4HV6 A;  2STT A;  1I1S A;  4IHT A;  2MA3 A;  4YIF A;  3JTG A;  5J8C A;  1X3U A;  4HA8 A;  1FX7 A;  4KIC A;  1SD5 A;  3W6J B;  1T39 A;  2A6H F;  2FOK A;  2ZKZ A;  2FML A;  2K86 A;  2TDX A;  1F1Z A;  1HKS A;  4UUV A;  1LJ9 A;  4A0Y A;  2Z33 A;  1T0F A;  3TDU C;  4I0A A;  1PUE E;  4PGH A;  1XDU A;  3ZMZ A;  5HS9 A;  2IA2 A;  5FB2 A;  3ELK A;  3CJN A;  3K9T A;  3ZMV A;  3VB2 A;  4U88 A;  3RTR A;  2YX4 A;  1UHW A;  3COA C;  3PQJ A;  1R58 A;  4BNC A;  3QP5 A;  3HRT A;  4BYY A;  3JSP A;  4OOI A;  4N9I A;  4IPA A;  1XDS A;  3IWF A;  4CIC A;  4M74 A;  1KGS A;  1HST A;  1R22 A;  2M87 A;  4LLN A;  3F6V A;  4ESF A;  1R1V A;  2CYY A;  3H3U A;  4XSZ F;  3MEX A;  1LQ1 A;  1V3F A;  1ODD A;  3I4P A;  2HTJ A;  2NYX A;  4MHG A;  4RAZ A;  2E7X A;  4MQV A;  4AIK A;  1G3T A;  1JHH A;  3N4M A;  2PI0 A;  1B4A A;  1QNT A;  1U78 A;  3WGG A;  2GA2 A;  3BJA A;  3BY6 A;  1EH6 A;  2IJL A;  4YG2 F;  4YFN F;  2A07 F;  3QU6 A;  2BBY A;  1Z91 A;  4PCQ A;  2L4M A;  5D5V B;  1WQ2 A;  2HGC A;  1KA8 A;  5K5R A;  3EUH A;  3B73 A;  1TLH B;  1MGT A;  3WG9 A;  2QM3 A;  4P55 A;  4A0X A;  2FF4 A;  2VON A;  4RS8 A;  4G7Z F;  2XAH A;  1OKR A;  2QWW A;  4IRI A;  4ENK A;  2XAS A;  3IHU A;  2LDU A;  4Y15 A;  5BPD A;  5D8L B;  2GXB A;  3QOP A;  3HUG A;  3K2Z A;  5L3E A;  2L3D A;  2ZME B;  1S6L A;  5LHG A;  1IN4 A;  3KZY A;  4WXD A;  1W4M A;  4NHJ A;  1XN7 A;  3GO5 A;  3RJP A;  3WTX C;  1O3T A;  3E6D A;  4P9U A;  1FPQ A;  1ZG1 A;  1IF1 A;  1D5V A;  1Z1D A;  2VOP A;  5DUI A;  5D5X B;  4U0V A;  2D2W A;  1EH8 A;  4R79 A;  3J80 K;  4AIJ A;  4AD9 A;  2FNA A;  1FY7 A;  3DKW A;  1KU7 A;  2W25 A;  4B8X A;  3GEZ A;  1GVJ A;  2EFW A;  3K0L A;  2O6G E;  2M30 A;  4BH9 A;  5LLQ A;  1Q1H A;  2XRO A;  4L9N A;  1U3E M;  1YW7 A;  2HQN A;  3L09 A;  2XIG A;  1ZRC A;  2PLY A;  4N0B A;  1E17 A;  3FHZ A;  3SZT A;  4BHC A;  4I02 A;  3L7W A;  3ERE D;  1BN5 A;  3KE2 A;  1ZAO A;  2H6C A;  2GZW A;  4LGW A;  3HRM A;  2IRF G;  3M1E A;  2Z3Y A;  2R7D A;  2DI3 A;  2DK8 A;  5DCF A;  4LLL A;  4WF2 A;  1QQI A;  1CF7 A;  1YG2 A;  4BHP A;  3CUQ A;  4ESB A;  2QEN A;  3F8M A;  2F2E A;  2ZBK A;  2OZU A;  4IHS A;  4QWQ A;  2PJP A;  5HS8 A;  5ERI A;  4HQE A;  5DD8 A;  1RUO A;  3WTV C;  5BS6 A;  2B0L A;  1P6R A;  2KRF A;  3DV8 A;  3MFK A;  1HSJ A;  5BOX A;  1R5G A;  3SXY A;  3E6B A;  1DP7 P;  2FQ3 A;  4WK8 F;  1K7A A;  3BDD A;  4O5V A;  1BM9 A;  1FOK A;  5LRR A;  1ZG5 A;  5LGU A;  3PQK A;  1HW5 A;  2DK5 A;  2X4H A;  1FP1 D;  5ICE A;  5L3G A;  1IW7 F;  3HTS B;  3FF5 A;  1XB4 A;  2QQA A;  3LFK A;  2GAU A;  3GUD A;  1ZLK A;  2ESH A;  5J8F A;  2AS5 F;  1R23 A;  2ISZ A;  5LRS A;  3MCZ A;  1QZY A;  3OOP A;  3WTY C;  2H27 A;  2Q8K A;  4M71 A;  1WSU A;  2EA2 A;  4BAY A;  2MLG A;  1IN6 A;  3I71 A;  4WXH A;  2Z99 A;  4LG0 A;  3HRU A;  1S3J A;  2EFO A;  4M6X A;  4Q47 A;  1FT9 A;  3RI4 A;  1H9G A;  4UXN A;  1SMY F;  1TTY A;  4P5O A;  2A68 F;  4QLC U;  3I53 A;  3LWF A;  3F8C A;  2ELH A;  4HX4 A;  4ZYH A;  3K1M A;  1HW2 A;  2O8X A;  4KT5 C;  2EWN A;  4TV7 A;  3WGI A;  2HFH A;  4L0Z B;  3VOE A;  3V7S A;  1FBS A;  3V7C A;  1J75 A;  4PDK A;  2JT1 A;  3T0Y A;  3FXU A;  2KIU A;  4M9S A;  2JTV A;  5E20 A;  4KN4 X;  1UCR A;  1YW9 A;  5D4R A;  1BI2 A;  1ZN2 A;  3GFI A;  3FMQ A;  1G6N A;  3V7R A;  2QVO A;  1Z6T A;  5BMZ A;  2RV8 A;  1J0R A;  3M7G A;  4EV0 A;  3GWZ A;  1L3L A;  4R1H A;  2P5L C;  3FM3 A;  3LQR A;  2NNN A;  3QAH A;  3IKT A;  3ULQ B;  3HIF A;  4G7H F;  3DEU A;  2W84 A;  1FP2 A;  3GX4 X;  4RB3 C;  4KFC A;  2HWV A;  5KK1 A;  2WV0 A;  3F3X A;  4EJO A;  1BI0 A;  1I27 A;  3H3Z A;  2HS5 A;  4HBL A;  5HLH A;  2P4W A;  5J6X A;  1WRJ A;  2L02 A;  1JGS A;  2VOD A;  3ROU A;  4KA4 A;  3BJO A;  5CLS A;  5JHU A;  1U2W A;  2F5D A;  2FNP A;  4MNU A;  2ZJ2 A;  3O2P E;  3T8T A;  2HKX A;  1U6G A;  2DQR A;  2RN7 A;  1WWX A;  2HYF A;  4EGY A;  2YX7 A;  4KDP A;  1W7P D;  1FZP B;  1LVA A;  2JZY A;  2RC4 A;  2MD5 A;  3TOA A;  3ML6 A;  2PFB A;  1YYV A;  4LK1 F;  1FLI A;  4EJW A;  3HHG A;  3R0J A;  4NB5 A;  4OIR F;  3T1B A;  2BYV E;  4FX0 A;  1BI1 A;  1F9N A;  5HDK A;  3DPT A;  4CO8 A;  3C3W A;  2OA4 A;  3FWE A;  2FRH A;  4CZZ A;  3KFW X;  2VXZ A;  3IRQ A;  3NQO A;  4L18 B;  1R1T A;  3WU0 A;  2KIF A;  4ON0 A;  2XAG A;  3ZMD A;  5ILV A;  1L0O C;  1K6O A;  1SD6 A;  4ENM A;  3ZPL A;  2LF7 A;  2ZCW A;  1RUN A;  1P4W A;  4KMF A;  4L5I A;  2RGV A;  1O7L A;  3F23 A;  2GQQ A;  1P2F A;  2WTE A;  3FMS A;  1OR7 A;  1T98 A;  2JRT A;  4JQF A;  1ZHF A;  3R61 A;  5FGM A;  3GW2 A;  2FXA A;  3CLO A;  3VEP A;  2LKP A;  4RGS A;  2KJC A;  4JK1 X;  1AOY A;  4WXC A;  1CGP A;  1YTY A;  4HF0 A;  3GXO A;  3GF2 A;  3TO7 A;  1K78 B;  5TRD A;  3F22 A;  1KQ9 A;  4IRG A;  4A5M A;  2MH9 A;  3KP4 A;  2J5P A;  3P9C A;  2FE3 A;  3GZ5 A;  3I59 B;  3WTT C;  3KLO A;  2E1C A;  4E70 A;  5LBQ A;  4KIF A;  4UHT A;  1WKM A;  5E17 F;  3J80 Z;  2VE8 A;  2A6E F;  2P6T A;  4A5N A;  5JFR A;  4EM1 A;  1STZ A;  2DT5 A;  1USS A;  2XUB A;  1IAW A;  1QZZ A;  2D1H A;  3QRF F;  2VN2 A;  3E6M A;  4DNC A;  3FX3 A;  2D45 A;  3D5L A;  2A3S A;  2WC2 A;  3Q5F A;  2OAZ A;  5L3F A;  4A2U A;  3WOD F;  3EET A;  1SMT A;  3JAM Z;  2ESN A;  5CVV A;  5E8I A;  1KQ8 A;  1QPM A;  2P8T A;  1U5T A;  3K1N A;  4O3M A;  1ZLJ A;  5FFX A;  3CO6 C;  3RPQ A;  1OYI A;  2UXX A;  5BPI A;  3CUO A;  4BHB A;  2DPU A;  4IXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...