4A3FJ

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3fJ00
2VI6A 2DA2A 1DU0A 5F08A 1ETYA 3BTIA 1W0TA 2XGEA 3S1MJ 1HLVA 2QCOA 1JGGA 1E3OC 4XRSG 5J1UA 1K61A 1LFUP 3PO2J 4IEJA 1MBFA 2HQ5A 2WV1A 1MNMC 1ZKGA 1QVUA 1A6IA 3BTJA 5IP7J 1H8AC 4ABZA 1IC8A 2TRTA 2NS7A 1Z0XA 2HOTA 1MBEA 2JA7J 2LK2A 1HDPA 1B8IB 1UHSA 2HXIA 2MGQA 2HOSA 3PM1A 3K2AA 2LTPA 4C3IJ 2NVTJ 1CQTA 2DA4A 2DTZA 2Y0SN 1BA5A 3PO3J 3S15J 3B6AA 4A69C 1UMQA 3TP0A 2WB1N 2JN6A 3ZQCA 1DU6A 2R5ZB 3VPRA 1BW6A 2DN0A 3JRGA 1B8IA 4MLOA 4NDLA 4J19A 2H1KA 1WPKA 3G1LA 2Y2ZA 4DW6A 5M5WJ 3FKIJ 3BG3A 3JRIA 1ETXA 4LOCA 4QIWN 2DMTA 2E2IJ 1TWAJ 2XB5A 1VNDA 4D5FA 3BQYA 2E2JJ 4X6AJ 4IHYA 2XPVA 3IH2A 2FQ4A 1MBHA 3HOVJ 1BW5A 2R5ZA 5IOYA 2M0CA 1S7EA 1HOMA 5IYDJ 1IRZA 2D5VA 2TCTA 2L7MP 3E7LA 3B6CA 3BG9A 3QQAA 2IEKA 4Y7NJ 1MBKA 1U8BA 2EH3A 1WI3A 4V2GA 4V2FA 2EZLA 1X2NA 3WHCA 4UUSB 4A93J 1B72B 2IBDA 3SFIA 4XIDA 4DZJA 2PMZN 4MFEA 3L1PA 1I3QJ 4M3EA 5GP9A 3JRHA 3JRCA 3JRAA 3ZOBA 1JT0A 2EQRA 4AC0A 3S1NJ 5EYRA 1NK3P 3CQZJ 3BR3A 3GTJJ 4UUSA 1XG1A 1B72A 3BQZA 1HDDC 1WCMJ 3BR1A 1FTTA 1NTCA 4C3JJ 2EZKA 5JLWA 2XGDA 1OJLA 4DYCA 1Y1WJ 2ECCA 3RQIA 2CJJA 2ZB9A 5GPAA 2DA1A 3G1MA 4W1UA 3QPLA 3JRDA 3SJMA 3S2HJ 3BR5A 3ZQLA 4FE4A 4B3AA 1ITYA 5FKLA 4GFBA 2JA5J 1P7IA 3GTPJ 2AHQA 1QPIA 4MO7A 4QSHA 2GM4A 1X58A 4A3DJ 2OF7A 1WGXA 4JYKA 4IHXA 3OOUA 4A3FJ 2L9RA 4A3KJ 5M3FJ 1IGNA 2ID3A 5IYCJ 5F0CA 5C4XJ 1VF9A 2P81A 2KT0A 1MBGA 4JX6A 2HYJA 1OFCX 2VKEA 2XB0X 5FLMJ 1XC5A 2MSYA 4A3MJ 2FD5A 1ETOA 4HNVA 5E3MA 2LR8A 5F27A 2R93J 2XRLA 4FISA 1O4XA 2K9SA 1NK2P 3IV5A 1WH7A 2DMPA 2K40A 2I10A 3S17J 2ME6A 1RPWA 3JRFA 1GV2A 1IG7A 1GT0C 1Q1VA 1ZR2A 3A03A 1TWGJ 2M9HA 1AU7A 1A5JA 3BG5A 1G2HA 3ZQHA 3FISA 2L0KA 4A3GJ 2DJNA 1ETKA 2MG4A 3H3VK 2E2HJ 2JA8J 1XS9A 1BJZA 5C44J 1RKTA 2LP0A 4CYCB 3ZQGA 4BY7J 5J1RA 2DA7A 5M5XJ 3GTQJ 3Q0VA 4QTRA 2E19A 1TWHJ 2NVYJ 5JLXA 1OCPA 3HOXJ 3HKZN 2R5YB 5F0HA 3BTCA 4XRMA 3GTKJ 3CDLA 1ZR4A 2RAEA 2N8GA 2HOAA 4M3GA 4BBRJ 1UG2A 2XPUA 1TC3C 4BY1J 3ZQIA 3SDGA 1TWCJ 4S0HB 4CYCA 2YU9J 1POGA 3NARA 1FEXA 3TW7A 1JKPC 4AUXA 1HCRA 2COBA 5K7FA 1T33A 5EZGA 1FIPA 3O8GA 3RZDJ 1TWFJ 1APLC 2R5YA 2JJ7A 5K7ZA 3HGGA 3JRBA 3BR2A 4A3LJ 3HOYJ 3I4MJ 2LKXA 1JUMA 3O8HA 2X6OA 4A3IJ 1RKWA 3S1RJ 5E3OA 1MH3A 3I4NJ 1JT6A 2Y9YA 4FCYA 2XSDC 4UUTA 2JK3A 2NS8A 3S14J 3LOCA 1IDYA 3TW6A 2R7ZJ 1X2MA 4JP0A 4M3FA 5K7HA 4JX4A 3A01B 3LSRA 2EZHA 3M4OJ 4A3BJ 3HEFA 3IH4A 1ZGWA 2GLOA 3G1OA 3JREA 3S1QJ 1LFBA 3ZQFA 2HXOA 2Y9ZA 3CMYA 3MN2A 4M3BA 3OIOA 5GPCA 2CQQA 2Y31A 3LSGA 4Y52J 4JX5A 3A01A 2X48A 4IHVA 1IDZA 1U9OA 2M34A 1ORKA 3NAUA 2AO9A 1H89C 5BNGA 2DMNA 2GBYA 1FJLA 4A3JJ 4BXXJ 1I6HJ 3HOUJ 1FTZA 2DA5A 3H0GJ 4B4CA 4EEFG 3CCYA 5IP9J 1MSFC 1D5YA 2K9NA 5E3NA 4D7NA 2LLKA 4DYRA 4XICA 1JTXA 3TEDA 1H88C 2IAIA 3Q3SA 1GVDA 1W0UA 2ECBA 4DYQA 2DMUA 4I76A 4MIMA 2DA6A 4XRSA 1K83J 5EGOB 3LSJA 2VKVA 1GUUA 1VFCA 2CUFA 4C2MJ 2ID6A 5F04A 2K9QA 5IP6A 5EZHA 2ELKA 1JKOC 1QRYA 1U9NA 2DA3A 1AKHB 3DEWA 2FJ1A 3GTGJ 3A02A 2QF7A 5IPAA 3FK7A 1MBJA 2CQXA 2R0QC 2R92J 1QVTA 3LSPA 4C3HJ 5EGOA 1JJ6C 4M6VA 5C4JJ 3K7AJ 1PUFB 4L5EA 1HF0A 1Y1VJ 4MFDA 1YRNB 3GTOJ 5IOZA 2L7FP 1AHDP 1AKHA 1Z77A 2HI3A 1MSEC 3M3YJ 3RKQA 1LE8B 1ZTRA 2Y30A 1MH4A 2JA6J 1ETVA 3BR6A 3Q0WA 4I6ZA 1P7JA 2M8GX 3HGYA 5F1JA 4AYBN 3OSFA 4BKXA 2DMQA 1T56A 2ME0A 2MW8A 1PUFA 1ENHA 2JMWA 4M3DA 1JJ8C 1YRNA 4W97A 1GDTA 2LVSA 5J3LA 5C3EJ 1RR7A 4D5CA 1FIAA 9ANTA 5IYBJ 3HBLA 5EEAA 1LE8A 2LD5A 5F0FA 3LNQA 3UKGA 5M5YJ 2W48A 1BL0A 1SANA 3S16J 3HOZJ 3HDDA 2O9LA 1ETQA 1I50J 1EF4A 5EG0B 2O8KA 4X1EA 2B63J 1OCTC 1VI0A 5HODA 1JKRC 5FKOA 1ZK8A 1ZQ3P 2L7ZA 2EZIA 2WAQN 3HB9A 4RDUA 1F43A 1JKQC 2XPWA 3Q0UA 3QPSA 3WHBA 3HOWJ 1JUPA 3D1NI 1SFOJ 1RESA 4FE7A 2EBIA 3FK6A 3HM5A 2JWTA 1R9TJ 3S2DJ 5FKNA 3FIWA 5EG0A 5FKMA 3JR9A 2NVQJ 2G0EA 2LY9A 2CUEA 5E3LA 2H8RA 5EF6A 5FJ8J 3W6VA 4DZPA 3TP3A 1GV5A 1RETA 1U78A 4BBSJ 2LFBA 4FTHA 3GBGA 3RZOJ 2YS9A 5FLVA 3MVPA 2NOGA 4G12A 3IH3A 2VPRA 4A3CJ 2XGCA 1IV6A 5J1YA 2OPTA 2M2EA 2YUSA 2CU7A 1IJWC 2CRGA 2E1OA 2X9DA 5DTDA 5DS9A 4XK4A 4A3EJ 3GTLJ 3OSGA 3DCFA 1IUFA 1JTYA 3MKLA 5M3MJ 3BR0A 5EDNA 4B1RA 3BTLA 3BT9A 2VUMJ 4RBOA 1F36A 3GTMJ 1WH5A 2KDZA 1JUSA 2O7OA 4IHWA 2FX0A 2HDDA 5FKKA 3C2BA 4D7MA 1ETWA 3F0CA 2NVXJ
chains in the Genus database with same CATH superfamily
1SFKA 2VKDA 1J59A 2A69F 2VI6A 5BPIA 5H6RA 3I71A 1HKTA 2XGEA 3EUKL 1HLVA 2QCOA 3GF2A 1E3OC 2O6GE 4PZJA 3CUOA 4KITB 1K61A 1MKMA 3UR3C 3PO2J 2VIXA 4J01A 2L4AA 5GAEJ 4E7JA 1QVUA 3PSIA 3S93A 3W6JB 2HYFA 1K6OA 2ZJRF 4CICA 4ABZA 3I3LA 1IC8A 4XORA 2HOTA 3LA7A 4XL9A 1IN8A 3CUQB 3CC4I 4XONA 2EV5A 1R4MB 2VOPA 2HPMA 2CO5A 1CGPA 1LNWA 3TL4X 2LTPA 2FF4A 3EUHA 2EFPA 4C3IJ 1VQ8I 4ZZLA 2L9VA 1MMAA 2FXAA 2KKOA 3BG7A 1TT0A 3S15J 2KMUA 1UMQA 3FHZA 3KEYA 3ELKA 1LDJA 4HZFA 1BW6A 3ONQA 1QBJA 4LITA 1B8IA 4NC6A 2LC2A 3PQKA 1RUNA 3G1LA 2XAFA 2XVCA 2HOEA 4DW6A 4H0EA 4MTDA 2ZKZA 4PSWA 4HLYA 2L9SA 1ETXA 4LOCA 5FD5A 2FBHA 2DMTA 3H5NA 4RGUA 4QIWN 5BOXA 1A35A 2E2JJ 3GLLA 1R1TA 1SFXA 1EH8A 5JVTA 1I1SA 2LYCA 3IH2A 1O57A 3NRVA 2OZUA 4U7DA 5IOYA 2F4OB 2DFIA 1IRZA 2H1LA 2TCTA 2L7MP 3BG9A 3E7LA 4LG0B 5DV5A 2IT0A 3FXLA 4KMUX 2M87A 4LLNA 3IWZA 1YYVA 2FSWA 1D0XA 1MW7A 4A93J 1X2NA 2J5PA 3LAJA 3IUOA 2QKLB 3SFIA 2EIJH 2RQQA 5DM7F 1XGOA 4XIDA 3GXOA 3OIPA 1X4PA 4C30A 1IN7A 4ZDPA 3HPGA 1N77A 3OS0A 4M3EA 1PYVA 3FMRA 3JRAA 3RDIA 3ZOBA 3JTHA 5HDKA 1JGSA 3ZXSA 1YTYA 4AC0A 2A5YB 3SQNA 3S1NJ 4OWRB 2XASA 4A2UA 3VYSB 3CQZJ 3BR3A 2FNPA 1B6AA 4GXOA 3BQZA 3DFGA 4PGHA 3VDXA 2X6XA 1FTTA 4C3JJ 3C7JA 3ABTA 2XGDA 4MEYF 4RLFA 3U9GA 5ICCA 4DYCA 4HF2A 3RKXA 4MEXF 4HX4A 2ZB9A 4PJ0C 5GPAA 2LF8A 1WHUA 4P55A 4OIRF 4W1UA 3QPLA 2KPMA 3JRDA 3HRUA 4PSXA 3PFYA 3MQ0A 2KJCA 5LHIA 3QYFA 3CF2A 4N4OB 2JA5J 4G6TB 1P7IA 2DBBA 4LLLA 2AHQA 1TNTA 1TL8A 2O8XA 4A3DJ 3LWFA 2V4JC 2KL4A 1TP4A 3MKZA 2M5WA 4ITVA 4A3KJ 3ABLH 1T39A 2STWA 5IYCJ 2XHKA 2UXXA 3U21A 3J7AO 2KT0A 2GXAA 3D5SC 2VKEA 4BS9A 4HDUA 1ULYA 1OMIA 5HLTA 3RI4A 1IF1A 2QUFA 3ZMVA 4CSWA 4EM1A 1ETOA 5E3MA 2LG4A 1T6SA 5F27A 3OYNA 3K70C 1LPQA 2R93J 2VXDA 2WTEA 2JPBA 2K9SA 1NK2P 4C9YA 2K40A 4HQEA 2DOAA 3G3ZA 2ME6A 2W85A 1OCOH 4A0XA 1IG7A 4HNUA 3VYRB 2DTRA 4UB6C 1IW7F 1TWGJ 4HA8A 2M9HA 1AU7A 5CVIA 2JSCA 3TBIA 1ETKA 4A5MA 2E2HJ 2JA8J 1XS9A 3EPZA 1BJZA 4K2EA 3HTUA 4EQQA 4CYCB 2L54A 2ISYA 1WJAA 4BGDA 2BZTA 2M4KA 5M5XJ 3GTQJ 3CO6C 3DU6A 2E19A 2WV0A 5HDGA 5DM6F 3D0SA 1OCPA 3HKZN 2R5YB 4RB0A 3FXJA 2OV7A 3CCSI 1DPRA 1FPQA 4EJVA 2PFBA 1ZR4A 3KP6A 2XPUA 3RKWA 1U0JA 1TBXA 2IP2A 3RPQA 3SDGA 4S0HB 2QQ9A 2IA1A 1POGA 3SZGA 4ZZDA 4YRVA 4GCVA 1FEXA 3TW7A 4IHTA 2A6TA 2KIFA 1T33A 5EZGA 4N9IA 4Y15A 1TWFJ 2D1VA 4Y4RA 1H0MA 3BPXA 4QPOA 1X3WB 3HOYJ 2LH9A 3CLOA 1JUMA 2G7HA 3DKWA 1RKWA 3S1RJ 2ETHA 5E3OA 1U5TB 1X3ZB 1JT6A 2GXBA 2B0LA 4UUTA 3K70D 2NS8A 2IGNA 1S29A 3TW6A 1YHQI 2W24A 3K4JA 4HSTA 3A01B 2OD5A 4S05A 2VC1A 5B66C 4WXHA 4MQVA 3ZCOA 2OZ6A 4A3BJ 1T95A 4BAYA 2QLZA 2ACJA 3L00A 2XRNA 1LFBA 1Z9CA 5D8KB 3ZQFA 1O3RA 5ERIA 1R23A 1VZ0A 2DT5A 2D45A 2E1MC 3GWZA 2Y31A 5FROA 4Y52J 2R3SA 2V9PA 4PDKA 2UV1A 2R7SA 4R79A 3JAMZ 1IDZA 4G9YA 2ZXWH 1KA8A 2VQLA 5L3BA 3BLYA 1RZ4A 3VYTB 5FB2A 2WWYA 3KX2A 1MJAA 2EA2A 2KISA 1FTZA 2DA5A 2V9VA 3Q9SA 4EEFG 3LSKA 4LFUA 5IP9J 4HX8A 4XNFA 1J2XA 2EFNA 3WG7H 4IXAA 4D7NA 4QPQA 2KJBA 3N4MA 2AS5F 4Q5SF 2R7DA 1LKXA 2CQKA 1T0FA 2VE8A 4UB8C 1GVDA 2ECBA 3BG6A 1BIAA 5D4SA 2EK5A 1BBYA 4XRSA 1EV7A 3CD6I 1S8NA 2X85A 4PGGA 3TO6A 1JHFA 1GUUA 2JVHA 3EETA 4XLCA 3OS1A 1ODDA 3CCMI 1USTA 2M7AA 5LRSA 3H5AA 2GA1A 2FJ1A 5FRNA 4CXFA 4R1HA 4LGWA 2HVSA 3ROUA 3F8CA 2QWWA 3FK7A 3F72A 2IGMA 4L9JA 4U87A 1D5VA 1YS7A 3KP4A 4BACA 4XBFA 2LOOA 2FOWA 2KFDA 1AWCA 5LGNA 3EUAA 1YRNB 4IRIA 3RQ4A 2EIMH 1AHDP 1AKHA 5D5VB 2CV1A 2VJJA 2HI3A 1YOVB 3RKQA 1HXDA 4EM2A 4F92B 1F5TA 4YFNF 4BQOA 1JHHA 4BL0B 3TMOA 3BR6A 4U0WA 5F1JA 3MD2A 2O5RA 3G71I 3S2WA 2ME0A 2MW8A 1DGRM 1ENHA 1Z21A 3BWGA 1H9GA 2HEOA 3IRQA 1NG6A 3TOBA 2HQRA 2KIQA 5J3LA 5C3EJ 3CMMA 1U6GA 2DK8A 3CP2A 3I59B 5HS9A 1ZG5A 5EEAA 2CH0A 1LE8A 2LD5A 2JVGA 3GX4X 1I27A 1BI1A 3BDDA 1BL0A 3CMAI 3S16J 2KIUA 2RQPA 3H3UA 1I50J 1V5GA 1G4DA 3ZQ7A 5LGTA 2X0LA 3VWBA 3V8JA 4NC7A 2V6EA 3ASOH 1QZEA 2ZNYA 1ZQ3P 3FXQA 5E18F 1I6XA 3T5XA 2K27A 4NQWB 1F43A 3CLQA 2EILH 3P5JA 3OYGA 2BY3A 1Y8RB 3ECOA 5E17F 3QPSA 2M4GA 2E7WA 4P96A 2LBFA 3O6BB 2E71A 1SFOJ 3HM5A 3S3NA 3AKZA 2FNAA 3F6OA 3CJRB 1QGPA 5KAFC 3KE2A 1UCRA 2QQ8A 5FD6A 5EG0A 2NVQJ 3QPTA 3HTSB 2COMA 2G0EA 5GAHJ 2CUEA 3T8RA 1FT9A 4UV8A 5EF6A 5ILSA 3W6VA 1IZ1A 4DZPA 3V8LA 4L9TA 4WX9A 5IT9K 2IA0A 1I5ZA 4KFCA 4FTHA 3GZ5A 3RZOJ 3EQLF 3BJ6A 4G12A 2EINH 4M9SA 1R49A 4A3CJ 3GLXA 3R4KA 2IS4A 2CRGA 2HYGD 3FMSA 2NNYA 5DUKA 4G7ZF 5LHGA 3R60A 4I0BA 1KQ0A 4A3EJ 3GTLJ 3GW2A 4HV6A 1D0ZA 3OSGA 3HSEA 3MKLA 3WGIA 3SZPA 3BR0A 5EDNA 4CA0A 3ZMTA 4B1RA 5HS8A 2ZSHB 3CZ6A 3KLOA 1YIOA 2ZBKA 3BC8A 3DEEA 3OYIA 4ESBA 2A07F 4DBRA 5DCFA 2DLLA 3MKYB 2F5CA 3OR2C 2R7XA 3DPUA 4YFKF 4NB5A 3E6BA 1FOXA 1QQIA 1ZLKA 1ETWA 3NEUA 2M45A 3FMQA 2MD5A 3KP3A 2XUBA 3WTSC 1DU0A 2MBFA 1ETYA 3BTIA 3DBHB 5F08A 4DNCA 3S1MJ 4IOAF 1FYKA 2PJPA 5E20A 4XRSG 2PLYA 1F4KA 3LSMA 2Q0OA 2DCEA 1R22A 1M1EB 1MNMC 1ZHFA 5IP7J 4IQJA 3K1NA 2EFWA 3RCOA 2M3AA 1UG0A 3HIFA 2JA7J 2LK2A 3E1SA 2XAJA 4KA4A 1TZLA 4HYEA 1B8IB 4PK4A 1LEBA 3A0HC 1F1ZA 1O3QA 4CHUA 1CQTA 2DTZA 4HV5A 1W7PA 3LSIA 2DT7B 1BA5A 1ONVA 5D4RA 2ZC2A 4A69C 2WB1N 1X1DA 2DDAA 5IY5H 2PN6A 4EJWA 3JRGA 2IPQX 1Y8QB 2VBYA 3DTIA 4L9NA 4ZYGA 4MLOA 4NDLA 2CV2A 4AWXB 2H1KA 4WCGA 3J80K 2VPLA 2DO7A 1ZN2A 3ISPA 4RGSA 3FX3A 1FYMA 3DWLE 4E7ZA 1TT5B 3DEUA 4GO1A 2XB5A 3F8NA 1VNDA 3F8BA 1J7KA 4X6AJ 4IHYA 3BROA 2HR3A 1MBHA 1BW5A 3GUDA 2R5ZA 1Z1DA 2PBIA 2M0CA 1WSUA 3Q5FA 1NG7A 1G8XA 1STZA 1FSEA 2VXZA 2QQAA 2XDVA 1FP1D 2Z16A 1RIOH 4CZZA 4Y7NJ 2E1CA 2XROA 2JPCA 3L2WA 4LD5A 3I59A 2FOKA 1XMXA 1ON2A 4E7LA 4B43A 3CP8A 1D3YA 2EZLA 2KIMA 2IBDA 3L2VA 3WTVC 4UY8I 3G4SI 1EH7A 1X3UA 2L5QA 5GP9A 3JRHA 2B9SA 4KDPA 1BR1A 4A0ZA 1XMAA 1J75A 3GCMA 2GA2A 2P5VA 2VT3A 4I2OA 1KYZA 1Z91A 1DP7P 1U5TC 3CCJI 3S32A 4RAFA 2A6EF 3DPTA 4XM3A 2QQBA 1OQYA 1BC8C 5FLXZ 1BN5A 2GXGA 4ON0A 2W57A 3MAJA 1NK3P 3HYIA 3AAFA 2XAHA 3OYEA 1YJ9I 2EZKA 3ECHA 5B3SH 4M9XA 2NVXJ 5HLHA 1SVMA 1IV8A 2A68F 1K7AA 1V4RA 2RV8A 2CJJA 1YO5C 2DA1A 3EDPA 3K4LA 3G1MA 2KDOA 1SD6A 2VBZA 2W25A 2ZJ2A 3CDIA 3MZYA 1SFEA 2BW3A 3BR5A 2L7KA 3K10A 3F23A 4FE4A 1XGMA 3DTKA 1U3EM 4KICA 3FDYA 1XDSA 4MO7A 4DBQA 2GM4A 3HRTA 1WRJA 3RPUA 4OMZA 3PNYA 4JYKA 1WJFA 1X1BA 3OOUA 4TV7A 4A3FJ 1XSVA 1KU7A 2L9RA 3LMMA 1LDKB 3AFHA 2BXYA 1P9QC 4KIFA 5C4XJ 5F0CA 4P5OA 4GRIA 4EATA 2P81A 3K1PA 4JX6A 2HYJA 1OFCX 3AL0B 3OV8A 4JQFA 3IHUA 4HEA2 2PMZA 5EEGA 2XRLA 1QZZA 5HVQC 1G59A 1FSHA 1BOAA 3V7RA 1RUOA 5GTHC 1RR8C 2O0YA 4LB6B 2LY2A 1SD4A 1WH7A 2DMPA 3HXLA 1E3HA 3P7NA 2JSPA 2F4MB 1XCBA 2X51A 3IP4B 1D1BA 3RKYA 1VQ5I 1Q1VA 4KMFA 3T1BA 2A6HF 2QZ8A 4XRFA 2NNNA 2VB6A 3A03A 2ELHA 1W5CC 3WTTC 3BG5A 2BBYA 2PMUA 3FISA 4BXUA 4D9JA 4G94A 4A3GJ 3FXUA 1EKEA 1V3FA 3DBRB 3L7WA 3J81Z 1S6LA 5HLGA 4II3A 1I1GA 1O3TA 2XAUA 4BU2A 1KGSA 2LP0A 2E1NA 3F3XA 4BDZA 2NVYJ 3FF5A 3KETA 2Z2SB 1MZBA 5D5UB 2H6BA 1XTAA 2GOMA 2YX7A 3I56I 3VFZA 3E6MA 2RAEA 2HOAA 4BBRJ 2JUCA 1MMGA 1R36A 4BY1J 3HSFA 3H0DA 2OCCH 1TWCJ 3P9IA 1JE8A 4B3XA 4AUXA 1HCRA 5FO5A 2JQ7A 2FRHA 1FIPA 1APLC 4HOBA 2MLKA 1Z6TA 3IAM2 3BCAA 3JRBA 2PX9A 3QWLA 3WTZA 1TQIA 4I99C 1ZAOA 2VODA 4KNYA 3GEZA 2DYSH 2Y9YA 4PJMA 4XR6A 2XSDC 1Y39A 2R7QA 1FX7A 1I39A 2MA3A 1XD7A 2OUMA 3E5QA 2R7ZJ 2RKHA 4M3FA 3VSLA 1O7FA 5EJCA 4JX4A 5K7HA 1FNNA 2JRTA 4L9VA 1ZRCA 1UHMA 3LSRA 4OAYA 3LA2A 1ZLJA 1XMKA 3PUFA 5D6EA 1S72I 3S1QJ 1KZHA 2AQFA 2EJRA 1T8IA 3KIOA 2HXOA 3KYCB 3ZRGA 4RB1A 4EVIA 3OS2A 2QEXI 2R4GA 3MN2A 2V9KA 4G8XA 1TNSA 4UHTA 5LD2C 5HLIA 2KZVA 4JX5A 2DU9A 1MJ9A 1BIBA 5J8FA 3W3CA 2FBIA 2YPRA 2DW4A 5DD8A 4I09A 2L02A 2V1NA 4OIOF 2OCEA 5BNGA 1UZCA 2X6WA 3HUGB 4NC8A 2K02A 1FJLA 2PI0A 4XMYA 3HOUJ 1LDDA 1SEUA 3CCYA 3K4KA 1P2FA 4HG2A 1MSFC 2XF7A 2M7BA 1SVOA 5L3EA 2X4HA 3WU2C 4B47A 1YW8A 4XOTA 4JOMA 2IVMA 2W1OA 1H88C 2QGUA 3Q3SA 3AG1H 2WAEA 1J0RA 3A0BC 3BY6A 3LAPA 2KZGA 1A36A 2DMUA 3X2QH 2MYSA 5DCMA 1YW9A 4I01A 1TQMA 5JI6A 1K83J 3DLAA 2VKVA 4ENKA 3BPVA 3SHFA 2ID6A 4EJOA 3H92A 1F9NA 1QU3A 4A6DA 2ELKA 3RSNA 1QRYA 3HHHA 4BE1A 1AKHB 1IRGA 3DEWA 4M73A 4XKWA 1XCVA 4KT6A 1S3JA 3HPHA 3A02A 5TRDA 2K4JA 2R0QC 3U1KA 4BQAA 3MEXA 5CLSA 3LSPA 3MCZA 4F52A 4NBQA 1JJ6C 5C4JJ 1DUXC 4MFDA 1OYYA 4BH9A 3F8FA 1RNLA 3V4GA 1Z77A 3CCVI 2RNGA 1LE8B 5AONA 1ZTRA 1VQNI 4LIVA 2JA6J 3Q0WA 2CYYA 5HS7A 4AYBN 1Z3YA 2W82A 3OSFA 4BNCA 1PVEA 2DMQA 1K4TA 1EH6A 2XKOA 3ESWB 5BPDA 4M6YA 4B8XA 3SEZA 1VQ9I 1JJ8C 4XKCA 1UAAA 4W97A 4L5IA 2XV4S 3T8TA 3KZIC 2Z33A 3HBLA 3QAHA 3WGHA 5F0FA 2IRFG 4MGRA 3LNQA 3UKGA 2O61A 1XDUA 5M5YJ 4FT8A 2LBFB 3WU1B 3WGGA 1SANA 1H9TA 1LVAA 2MFZA 1BM9A 3HOZJ 3TOAA 4QWQA 2QVOA 5KAIC 1WJEA 5LGUA 4LK0F 5TJJA 5EG0B 2O8KA 1DGWY 3OYLA 4HX7A 2OC6A 4BHPA 5HODA 1JKRC 2PJRA 2L7ZA 5AIQA 2CW8A 3MZHA 4GDFA 1JKQC 2XPWA 3Q0UA 2AXTC 2OU2A 3EYYA 3TO9A 4HRIA 4LJZF 2A5WA 3M8EA 2ZXJA 3WHBA 2Z5UA 1KQ9A 2B7EA 3DU5A 2JWTA 5E79C 1D1CA 4M74A 3S2DJ 1K4SA 2ZNZA 1SAUA 3ERMA 5ICGA 3KP2A 5FKMA 4AVPA 2P4WA 4O3MA 1HW2A 2LY9A 3M07A 2H8RA 2DQLA 2RN7A 5FJ8J 2LNBA 2VLAA 1GV5A 1WJDA 1U78A 1KONA 3AG3H 4MNUA 3GBGA 1EA3A 2YS9A 1FMVA 1FOWA 5E1WA 3M8JA 2XGCA 1MD0A 2GOXB 3OYAA 1IV6A 3OYDA 1Z7UA 2IS2A 2OPTA 2M2EA 2YUSA 2XF6A 2CU7A 3S3MA 3C1DA 2CQNA 3ZMDA 3IKTA 2FMYA 2GQQA 2X9DA 3SFZA 1DQUA 3GFIA 4XK4A 4AIJA 1KU9A 1FBQA 1ZARA 3DCFA 1MGTA 1WI9A 3E0JB 3F9KA 4Q47A 3L2QA 1TLHB 3BT9A 2VUMJ 3F22A 1P4WA 3KP7A 2YR2A 4RBOA 3HL2A 4XOPA 3BJOA 3GTMJ 1OR7A 1JUSA 3DLLF 2HZDA 1ZRFA 3PL8A 5HDNA 1B4AA 3HUGA 2OBPA 2HDDA 4D0PA 3K9TA 2GIZA 3C2BA 3W2VA 3H35A 3LFKA 2WAQA 3N05A 3V7SA 1T2KA 1V5FA 1P92A 3FXOA 1XGSA 1LEAA 2DA2A 5JR3A 2Y69H 1MMSA 2MH2A 2RC4A 1W0TA 1W36C 1JGGA 1W7PB 3FWEA 3QU3A 1J5YA 4XLFA 3WTXC 1RRJA 2NS0A 4A6EA 4IEJA 2WV1A 3LA3A 4E70A 3HC7A 3AL0C 2ZXHA 2BGCA 3C18A 3AG2H 3BTJA 1H8AC 4C2TA 3HOSA 1P4AA 2TRTA 2NS7A 5CPRB 3K0LA 1Z0XA 1MBEA 3PNTA 1QHHD 4DIQA 4Y13A 2UUZA 2HOSA 3PM1A 1DP3A 2DXIA 3K2AA 3CMEI 3CUQC 2LREA 2DA4A 2Y0SN 3IC7A 3FHNA 4CO8A 2P0WA 3B6AA 2QM3A 4XN3A 3E3VA 1MDMA 2JN6A 2DI3A 3ZQCA 1DU6A 1UELB 2KRHA 2R5ZB 2VQHA 2ZJPF 2DN0A 5JVGF 3FM3A 3V7CA 1G6NA 3AG4H 4J19A 1U8RA 1ZH5A 4PJJA 1W5TA 3FXRA 1WPKA 1BC7C 2ZO4A 4Y3OA 1PUEE 4X0GA 4AM3A 3FKIJ 3BG3A 3JRIA 1VQMI 2Y48A 1TWAJ 3T0YA 4HNTA 4LK1F 1S7OA 2H8WA 3ABUA 3BQYA 2XPVA 3BCBA 2FQ4A 4YIFA 1FYLA 1IAWA 3K69A 2HNHA 3DBLB 1S7EA 2BY2A 2LKSA 3SXYA 2R7OA 1DDNA 2D5VA 3G2BA 3OOPA 5CVUA 1XSXA 2EFOA 2IEKA 4P9UA 2K9MA 1Z6RA 2ZMEA 3ASNH 2OA4A 1U8BA 2EH3A 1WI3A 2PQ8A 4KN7X 3K1MA 5CVVA 3TDUC 3H9QA 3WHCA 5J8CA 4BE0A 1D8KA 4XLEA 1SD5A 1W36D 3CESA 4BXFA 2NRAC 3L1PA 3I54A 1I3QJ 4ZTFA 1YG2A 4YELA 4L0YB 3JRCA 3SEQA 2EQRA 2Q8KA 4UUVA 3DPLC 3H1CA 2F5DA 1XGNA 2BW3B 3L09A 5EYRA 1R71A 2MD0A 3CCUI 3ZN1A 5GADJ 3C2HA 1HKQA 1G3TA 5E1ZB 4ENNA 3QRFF 4UUSA 2OQRA 3IL2A 1Z05A 1B72A 6PAXA 3FZVA 1IRFA 3GZNB 1A04A 4OU0A 4RA2A 3OMYA 1HDDC 1XSDA 1V55H 5DYMA 3CCEI 2EV0A 5A2QZ 1W5SA 2ECCA 4LLGF 3REOA 4Y33A 5CQGA 1Y1WJ 1Y56A 4RAZA 2WADA 1WWXA 3LFUA 1FLIA 2LSOA 2I5UA 2QSGX 3ZQLA 2FBKA 4EM0B 4JBAA 5LLQA 1OYIA 5FKLA 4GFBA 3A1YA 2P5LC 4PFOA 3DXJF 5BMZA 1VQPI 3F8MA 2CQ7A 4QSHA 1X58A 3GVAA 1UHWA 1YITI 4F91B 2QBYA 1FC3A 2NVUB 1T0FC 5J40A 4IHXA 1TW2A 2F48A 1MMNA 2VQGA 1SFUA 5M3FJ 1IGNA 2ID3A 1LFPA 4A0YA 4DGWB 3QODA 1VF9A 1E2XA 2DODA 2HGCA 1QNTA 2K3FA 2Q2EA 1MBGA 3I58A 3MFKA 1YFHA 2P5KA 4E7IA 2K9LA 2XB0X 5FLMJ 1W1WE 1XC5A 5H2FC 4IHSA 3GFMA 3R6SA 4A3MJ 2FD5A 4HF1A 2KP6A 5D6FA 4HNVA 3L2RA 2LR8A 1B9MA 2DK5A 4HPQA 3H3ZA 2DFFA 4KT5C 5AIPA 5K5OA 3P9KA 3IV5A 3D5RC 4KIBA 3S17J 4RLQA 3V8KA 1RPWA 3B02A 1GV2A 3KYDB 1ZGJA 1REPC 5ED4A 1GT0C 1FBUA 3J7AY 1ZR2A 4IOCF 1KU2A 4LIUA 3I9V2 1VTNC 3ZQHA 1G2HA 4U0YA 2KRFA 2WA0A 1G3WA 2MG4A 1R5GA 4L0ZB 3TO7A 2VBXA 4E6KG 3A2KA 5F64A 5C44J 1RKTA 4Z6YA 3MWMA 3ZMUA 3ZQGA 2YX4A 3FBNB 4BY7J 1TTYA 2DA7A 5J1RA 2F5VA 1R1UA 3JTGA 5KK1A 1TWHJ 2CFOA 2BHYA 3OR1C 2V6CA 5JLXA 2DOFA 4XLNF 2IA2A 3HRSA 2BVMA 3BTCA 4EJUA 1L3LA 1X1CA 4YG2F 3OYBA 3DV8A 1HBXG 2N8GA 4M3GA 2A61A 1UG2A 2K86A 4PJLA 3K2ZA 1TC3C 3O3KA 2R7TA 3L2CA 2YU9J 4CYDA 4F55A 3NARA 1MNDA 5L3CA 3WE2A 4U88A 4IRHA 2LF7A 3WTWC 3CTAA 2COBA 2CFXA 2BV6A 4CCNA 5D5XB 1WVRA 1SVLA 2K3PA 1SD7A 4E7KA 2JJ7A 2IGKA 3HGGA 1T38A 2Z3YA 2V26A 4OINF 3I4MJ 2LKXA 4XLPF 3FM5A 3O8HA 5CQEA 4XKBA 2E7XA 2X6OA 2BOLA 1ZGAA 1MH3A 3BOQA 3I4NJ 2HKXA 3I55I 4DQ2A 2JRMA 1SMYF 2QENA 3LOCA 2K5CA 4ZH4F 1VQKI 3S14J 3QOEA 1R6RA 5CKTA 4BDYA 4JP0A 1R4NB 5L3DA 1YX5A 3DTEA 2BHZA 3WODF 2EZHA 4MHGA 4Q4ZF 3M4OJ 3OYKA 1S9HA 1AA7A 3HEFA 3IH4A 2F5FA 1A6QA 4BEHA 3G1OA 2GLOA 2TDXA 4J00A 2HDCA 5E8GA 4G7OF 2Y9ZA 2VQCA 3CMYA 2VONA 3FXKA 4M3BA 4RM2A 3ZPLA 2HVRA 2OTLI 3J80Z 4WK8F 1Z67A 2CQQA 3LSGA 1SC7A 3HKZA 3OIQA 2XSJC 3BZKA 2HQNA 2DT6A 3VYUB 1XPXA 2DFEA 3PUBA 2OJED 3E5XA 1U9OA 3SZTA 2M34A 5CVRA 3WE3A 4NNJA 3TQNA 1ORKA 3NAUA 4KISA 2AO9A 5HNFA 4NHJA 2DDBA 2VOOA 2GBYA 5DCMB 4A3JJ 3H0GJ 4B4CA 3JCUC 5ICFA 2RDPA 4HAMA 5LEKA 1Q1HA 3CJNA 2HKOA 2FEZA 1D5YA 4RAYA 1XB4A 4H4KC 5ICEA 1WFXA 3TKYA 2LLKA 5KNLA 1YX3A 4B44A 3HJEA 1O7LA 4DYRA 4XICA 1JTXA 5B5EC 2XF5A 4HF0A 3TEDA 3PIPF 4OIQF 2HS5A 2HTJA 3JSOA 4JK1X 1N78A 4O5VA 4HLXA 4I76A 5J4YA 3VSKA 3M9AA 2DA6A 2MLGA 1WZ2A 2G7UA 3LSJA 4HDVA 1FZPB 3I4PA 2R7RA 3HOTA 4I98B 5F04A 2K9QA 4ENJA 2LMDA 4HBLA 5IP6A 2DAOA 5EZHA 1JKOC 4IF4A 2DA3A 4Q48A 3QU6A 4E4HA 3KFWX 1I3AA 2L2OA 2Z1DA 2L3DA 1R1VA 1QA6A 3GTGJ 2FE3A 2L4MA 2QF7A 5IPAA 1PP7U 2QSHX 1YW7A 1MBJA 2WBMA 2ESHA 2VT2A 5J47A 3KLNA 4QLCU 2R92J 3PNVA 1B59A 2AXLA 5EGOA 2CUZA 2XC7A 4M6VA 2H94A 4L5EA 4E7HA 5E8IA 2O03A 1FBSA 1R00A 4LG3A 4A12A 5K5QA 1Y1VJ 3E6CC 2P7CB 2ZJQF 3GTOJ 2L7FP 4F93B 2HWVA 4BJTA 3QP6A 4WF2A 2Y30A 1MH4A 2M8GX 3HGYA 4A5NA 4BKXA 3H9GA 4ENMA 3I64A 4PFPA 1WKMA 4G6QA 1PUFA 1WQ2A 2DJIA 2IGOA 1GXQA 4M3DA 3BZCA 5LFAA 1LVKA 2PJRB 2RREA 4M9ZA 3HZJA 2LVSA 1QO0D 1RR7A 2EPFA 4D5CA 1FIAA 5GAGJ 4ZYEA 4BQNA 2VKHA 9ANTA 3S3OA 3RYPA 1HSJA 3KEOA 2W48A 2O3FA 3UNGC 1ETQA 1X1AA 5ILVA 4YEJA 3ZGKA 4AIDA 1T08B 1Y0UA 2CG4A 3A4CA 3F6VA 1RC9A 2HFHA 4X1EA 1OCTC 2XAGA 3IRRA 1VI0A 3KEQA 3J7YJ 1ZK8A 3E5UA 2F2EA 4IQ4A 1YJWI 2EZIA 3HB9A 1BOBA 1LQ1A 4RDUA 3H9JA 2ESNA 3HSRA 3VB2A 1R58A 2CWEA 2M0MA 3ABKH 2CW7A 2PMHA 3I0TA 3HOWJ 4HSRA 5L3GA 4FE7A 3FK6A 1R9TJ 1P6RA 2UWMA 2WY7Q 2R7UA 2X1DA 5D5WB 4YFXF 4MQ9F 3H5RA 4IJAA 5DEQA 3JR9A 1W7PD 1Y0NA 2Y0SA 1VQLI 4KIGA 4BHBA 2ZXIA 4ETSA 1YQAA 1RETA 3WTUC 5F1RA 1R5ID 2DQRA 4IPAA 3KYLA 2W7NA 1OYWA 2BY0A 4CZCA 5FLVA 2NOGA 2RNJA 2PG4A 5H6QA 3ULQB 5BS6A 1VQ6I 5H20A 3RIRA 1UB9A 3VODA 2D1HA 4CCMA 1IJWC 5CYVA 1D8JA 4CUGA 3OYHA 1MMDA 3OYFA 4KN4X 1WJBA 5DS9A 1K78B 1ZYRF 1IUFA 1X4OA 3PIOF 2XGXA 2JUGA 3GFLA 4KUMA 3BTLA 4UXNA 3B73A 2K7LA 2GIVA 5CVJA 1WH5A 2KDZA 2O7OA 1YS6A 2BY1A 4UVBA 1YLFA 2FX0A 3NWTA 4CCJA 4XLHA 3RYRA 4CH7A 4ZTJA 4D7MA 1IXSB 2BEOA 4FX0A 3F0CA 1KU3A 1CF7A 1BJAA 3F21A 1BI0A 5FRMA 5TGTA 1E17A 1G3YA 2ICWG 2AQEA 4BUPA 3DP7A 1FY7A 4L5JA 2HDWA 5J1UA 4AIKA 1LFUP 3EUHC 1MBFA 2HQ5A 3W6KB 1MDMB 2PEXA 1ZKGA 3FXMA 3KZYA 1A6IA 1IN6A 2EA4A 3OL3A 1HDPA 2V1DA 1UHSA 2HXIA 2MGQA 1R7JA 2C6YA 4CCOA 4IO9F 2NVTJ 4D1QA 3K4MA 3PO3J 1N25A 4AIHA 2XAQA 1USSA 3VEPA 1OLTA 3TP0A 3WG9A 3CC7I 4I7HA 4C2UA 2E60A 4UVAA 3BJAA 3VPRA 4KJZA 3CUQA 4CGZA 3IWFA 1R5HA 3TDZC 4XSXF 4GGGA 3L2UA 3DKYA 1YJNI 5B1AH 2G9WA 2Y2ZA 3GFJA 4FASD 2ZMEB 5M5WJ 1WJ5A 4UVCA 3RPUD 2E2IJ 3N97A 1VQ7I 1AOYA 2F5EA 3JAMK 1FOKA 4D5FA 2CGPA 1QHGA 4IKFA 1IUYA 3GMEA 3QYEA 3HOVJ 4R8HA 5KHDA 3G73A 3CCQI 3K6GA 1HOMA 4BJ6C 2IW5A 1HC8A 5IYDJ 3DKXA 4ESFA 2E36A 1UJ8A 2Z9OA 4FQGA 3B6CA 3QQAA 5DD4A 4N0BA 1B9NA 1MBKA 3CJTB 2HU9A 3CJQB 3KPHA 2DPDA 2RVCA 3E6DA 4WXCA 4V2GA 4V2FA 4UUSB 4ZYHA 5JHUA 1B72B 2R7FA 4P1WA 4U0VA 4DZJA 2PMZN 4MFEA 3OYJA 4RB2C 2FUG2 3ZR8X 2CMPA 2H09A 3PQJA 3QYBA 2NOJB 1LUJB 1JT0A 2HVQA 3COAC 2HQAA 4HW0A 4LG0A 2MABA 1K79A 1OKRA 2WAFA 4UV9A 1IRXA 2WB1A 4UNOA 3GTJJ 1XG1A 2E35A 1JI8A 1L0OC 2OQGA 3CC2I 1HW1A 1WCMJ 3BR1A 1NTCA 1GVJA 5JLWA 4EV0A 2QBYB 1A31A 1OJLA 2KQRA 3I53A 3RQIA 4RGRA 4ZC3A 1S7AA 4CCLA 3U1DA 2FQ3A 2Q2EB 3JW4A 3SJMA 3S2HJ 4II2A 5DDGA 4I0AA 4B3AA 4PUSA 2M30A 1ITYA 3WTYC 2P6TA 4OIPF 1J9IA 1DPUA 1XN7A 3GTPJ 2YSRA 4EGZA 1QPIA 3R61A 3O2PE 2VN2A 2OF7A 4B48A 4FX4A 1WGXA 1JXSA 2DYRH 1IXCA 1ZRDA 1PDNC 2MC4A 2ZFWA 3OWTA 2E5NA 4V19K 1IO2A 3KP5A 1K78A 1KYWA 2FU4A 5LBQA 1C0WA 2MSYA 2JT1A 2LDUA 3RJPA 2F6CA 3J7ZI 3HG9A 3TGNA 4IZZA 3ZMSA 5L3FA 1SAXA 1K6YA 4FISA 1O4XA 1ERDA 2FMLA 1ON1A 1ZELA 2LKPA 2W84A 1QPMA 3NQOA 3GYHX 3LQQA 4S04A 2I10A 4M71A 1OCCH 3M7GA 3JRFA 3OYCA 3PSFA 4N4NB 1TW3A 5EEHA 4YIIA 2VBWA 2X1CA 5J6XA 2V7FA 5CJ9A 1A5JA 2NAZA 2L0KA 3NWSA 1D0YA 1U2WA 2CS3A 2DJNA 3H3VK 1HW5A 1OISA 3BP8A 5KVRA 3OL4A 4BE2A 2QA4I 1B1BA 1X1PA 4XQFA 5FGMA 1O3SA 4EGYA 2UXNA 3Q0VA 4MTEA 4QTRA 3CF5F 4G7HF 4RGXA 5IT3A 2DFHA 2HPIA 2VE9A 3HOXJ 1ACIA 1UFMA 3EYIA 2EV6A 5DUIA 5HNHA 5F0HA 4XRMA 3RTRA 3GTKJ 1BI3A 3CDLA 2P7VB 4OMYA 3S8PA 3MZ8A 2A3SA 3MKWB 3ZQIA 1MNEA 2LY1A 2NYXA 4GYIA 5A2QK 2IXSA 4CYCA 4LB5A 4IX7A 4RB3C 1V54H 2X1EA 3GO5A 1JKPC 4ZDLA 3HRMA 5K7FA 2YU3A 3O8GA 3RZDJ 2R5YA 5K7ZA 3BR2A 4A3LJ 2CSOA 1NH3A 4ESJA 4BEHB 1YE9A 4A3IJ 5GTIC 2H27A 3LQRA 4FCYA 5LHHA 5LRRA 2OTJI 2JK3A 4ANJA 1IDYA 2DPUA 2E34A 4N9HA 4WXDA 2IJLA 1X2MA 3K4BA 2L9NA 3ZP5A 3W2WA 3M1CA 1HKSA 2JTVA 1Z7LA 3LSHA 4BYYA 3U2RA 1OPCA 2ZCWA 4RS8A 3ZN0A 4YIRX 3D5LA 3PJRA 1GHCA 1ZGWA 3JREA 1YI2I 1E3PA 2R7VA 1U5TA 2R7WA 3QOPA 1EJ9A 5ILUA 2CUJA 5TISC 3OIOA 4F3QA 1X19A 2MC3A 5GPCA 2HZTA 3A01A 3QPHA 1Z3XA 2W00A 4PCQA 3CDHA 3W2AA 2Q1ZB 1W4MA 4ZJZA 2EB7A 2X48A 4FETA 4IHVA 2BYVE 2K85A 3GZ6A 1LJ9A 1YIJI 1H89C 2I8DA 2DMNA 2ADUA 3QP5A 4AU7A 1Y6IA 4CCKA 1VQOI 4BXXJ 1I6HJ 4GYGA 4B09A 5JFRA 1OR7C 4I02A 2FA5A 3ZQQA 1ZREA 2GWRA 3M8FA 2V79A 1D1AA 2K9NA 5E3NA 5LEJA 1PP8F 4DOZA 4BJ5C 3K4NA 2ZFUA 4EJTA 2UZKA 2V1XA 2MH9A 2XIGA 4KYWA 2DOEA 2IAIA 3HHGA 2QKMB 1W0UA 4DYQA 3I5UA 4MIMA 3LSTA 1N75A 2M1BA 4XN0A 1ZG1A 2IS6A 2LRDA 4Y17A 5EGOB 4M6XA 2A05A 3ML6A 2VC0A 1VFCA 1BI2A 1G3SA 2CUFA 4E7SA 4C2MJ 1QZYA 2Y75A 1GLNA 1TQPA 2KLOA 1U9NA 3FKJA 3R0AA 5IT9Z 2EIKH 2WY8Q 2L01A 4XLAA 3ABMH 4BHCA 2NXNB 1GXPA 2CQXA 4ASNA 3E97A 2W4SA 1OCZH 1QVTA 5E1XA 5FFZA 2EWNA 4C3HJ 1FOYA 3K7AJ 1PUFB 2Z99A 4BQQA 4IL6C 2P8TA 1HF0A 4IRGA 1SMTA 2GAUA 5IOZA 5JHFA 5FLXK 2QSFX 3M3YJ 1MSEC 3V42A 4EMSA 4OAZA 2KHMA 4FHTA 3IAS2 3IKVA 2GZWA 1P4XA 1ETVA 3C3WA 4P9FA 3SYTA 4I6ZA 1P7JA 1MJBA 1T56A 1ZG3A 1FMWA 4U7BA 2Y0MA 2JMWA 4RM3A 3KZZA 4M72A 1YRNA 3KCCA 4IVNA 1GDTA 1XX5A 2E5ZA 5IYBJ 5D8LB 1HA8A 4DJAA 1V5EA 2BVLA 2ZMEC 2D2WA 1HSTA 1J09A 1FWZA 1IN5A 3HDDA 3R0JA 1T98A 2O9LA 3P9CA 1PJRA 3OYMA 1HQCA 3CO7C 2ELJA 1KQ8A 2VJ5A 2ISZA 3ZMZA 1EF4A 2JA2A 4G6DA 4Z2YA 2B63J 3WU0A 4F7ZA 5FKOA 2HTSA 4AD9A 2WAQN 2VL8A 2CV0A 2EFQA 3H36A 5BQTA 2BE5F 1IN4A 3DQVC 3L9FA 1WJCA 2P6SA 2ZSIB 2BXZA 2QYOA 2JZYA 1JUPA 2OAZA 3LL7A 2H6CA 1RESA 2E1MB 2EBIA 4XKVA 3D1NI 3BZ6A 4NUBA 4RMNA 4OOIA 3MMYB 5FKNA 3FIWA 5K1YA 1RI7A 4RAGA 5J4VA 4LMYA 5E3LA 1E0EA 3OY9A 2VASA 4NQWA 2IS1A 3TP3A 4BBSJ 1IXRC 2LFBA 2VJIA 1LB2A 3MVPA 2F4IA 3K4CA 3IH3A 2VPRA 2XKPA 4AYBA 3FBIB 5KCMA 2X6YA 5B1BH 4PJNA 5J1YA 1BR2A 3J81K 3G6EI 3Q9VA 5K5RA 2VJ4A 4CDGA 4AVZA 2J5OA 2KRCA 3SDBA 3CCLI 1CF7B 2E1OA 5DTDA 4HQMA 1VQ4I 2M8EA 2RGVA 5F6FA 3CCRI 4XSZF 1JTYA 4ZYDA 5HOOA 4ZYAA 2WC2A 5M3MJ 3C2GA 1MIJA 2V1UA 2CW0F 1F36A 4IHWA 4O6JA 1FP2A 5FFXA 1NHAA 1S5LC 2K4BA 4WWCA 4L18B 3M1EA 4ZDOA 5FKKA 3PFIA 2STTA 3JSPA 3VOEA 1BR4A 1OCRH 3DF8A 3ERED
chains in the Genus database with same CATH topology
2VI6A 2DA2A 1DU0A 5F08A 1ETYA 3BTIA 1W0TA 2XGEA 3S1MJ 1HLVA 2QCOA 1JGGA 1E3OC 4XRSG 5J1UA 1K61A 1LFUP 3PO2J 4IEJA 1MBFA 2HQ5A 2WV1A 1MNMC 1ZKGA 1QVUA 1A6IA 3BTJA 5IP7J 1H8AC 4ABZA 1IC8A 2TRTA 2NS7A 1Z0XA 2HOTA 1MBEA 2JA7J 2LK2A 1HDPA 1B8IB 1UHSA 2HXIA 2MGQA 2HOSA 3PM1A 3K2AA 2LTPA 4C3IJ 2NVTJ 1CQTA 2DA4A 2DTZA 2Y0SN 1BA5A 3PO3J 3S15J 3B6AA 4A69C 1UMQA 3TP0A 2WB1N 2JN6A 3ZQCA 1DU6A 2R5ZB 3VPRA 1BW6A 2DN0A 3JRGA 1B8IA 4MLOA 4NDLA 4J19A 2H1KA 1WPKA 3G1LA 2Y2ZA 4DW6A 5M5WJ 3FKIJ 3BG3A 3JRIA 1ETXA 4LOCA 4QIWN 2DMTA 2E2IJ 1TWAJ 2XB5A 1VNDA 4D5FA 3BQYA 2E2JJ 4X6AJ 4IHYA 2XPVA 3IH2A 2FQ4A 1MBHA 3HOVJ 1BW5A 2R5ZA 5IOYA 2M0CA 1S7EA 1HOMA 5IYDJ 1IRZA 2D5VA 2TCTA 2L7MP 3E7LA 3B6CA 3BG9A 3QQAA 2IEKA 4Y7NJ 1MBKA 1U8BA 2EH3A 1WI3A 4V2GA 4V2FA 2EZLA 1X2NA 3WHCA 4UUSB 4A93J 1B72B 2IBDA 3SFIA 4XIDA 4DZJA 2PMZN 4MFEA 3L1PA 1I3QJ 4M3EA 5GP9A 3JRHA 3JRCA 3JRAA 3ZOBA 1JT0A 2EQRA 4AC0A 3S1NJ 5EYRA 1NK3P 3CQZJ 3BR3A 3GTJJ 4UUSA 1XG1A 1B72A 3BQZA 1HDDC 1WCMJ 3BR1A 1FTTA 1NTCA 4C3JJ 2EZKA 5JLWA 2XGDA 1OJLA 4DYCA 1Y1WJ 2ECCA 3RQIA 2CJJA 2ZB9A 5GPAA 2DA1A 3G1MA 4W1UA 3QPLA 3JRDA 3SJMA 3S2HJ 3BR5A 3ZQLA 4FE4A 4B3AA 1ITYA 5FKLA 4GFBA 2JA5J 1P7IA 3GTPJ 2AHQA 1QPIA 4MO7A 4QSHA 2GM4A 1X58A 4A3DJ 2OF7A 1WGXA 4JYKA 4IHXA 3OOUA 4A3FJ 2L9RA 4A3KJ 5M3FJ 1IGNA 2ID3A 5IYCJ 5F0CA 5C4XJ 1VF9A 2P81A 2KT0A 1MBGA 4JX6A 2HYJA 1OFCX 2VKEA 2XB0X 5FLMJ 1XC5A 2MSYA 4A3MJ 2FD5A 1ETOA 4HNVA 5E3MA 2LR8A 5F27A 2R93J 2XRLA 4FISA 1O4XA 2K9SA 1NK2P 3IV5A 1WH7A 2DMPA 2K40A 2I10A 3S17J 2ME6A 1RPWA 3JRFA 1GV2A 1IG7A 1GT0C 1Q1VA 1ZR2A 3A03A 1TWGJ 2M9HA 1AU7A 1A5JA 3BG5A 1G2HA 3ZQHA 3FISA 2L0KA 4A3GJ 2DJNA 1ETKA 2MG4A 3H3VK 2E2HJ 2JA8J 1XS9A 1BJZA 5C44J 1RKTA 2LP0A 4CYCB 3ZQGA 4BY7J 5J1RA 2DA7A 5M5XJ 3GTQJ 3Q0VA 4QTRA 2E19A 1TWHJ 2NVYJ 5JLXA 1OCPA 3HOXJ 3HKZN 2R5YB 5F0HA 3BTCA 4XRMA 3GTKJ 3CDLA 1ZR4A 2RAEA 2N8GA 2HOAA 4M3GA 4BBRJ 1UG2A 2XPUA 1TC3C 4BY1J 3ZQIA 3SDGA 1TWCJ 4S0HB 4CYCA 2YU9J 1POGA 3NARA 1FEXA 3TW7A 1JKPC 4AUXA 1HCRA 2COBA 5K7FA 1T33A 5EZGA 1FIPA 3O8GA 3RZDJ 1TWFJ 1APLC 2R5YA 2JJ7A 5K7ZA 3HGGA 3JRBA 3BR2A 4A3LJ 3HOYJ 3I4MJ 2LKXA 1JUMA 3O8HA 2X6OA 4A3IJ 1RKWA 3S1RJ 5E3OA 1MH3A 3I4NJ 1JT6A 2Y9YA 4FCYA 2XSDC 4UUTA 2JK3A 2NS8A 3S14J 3LOCA 1IDYA 3TW6A 2R7ZJ 1X2MA 4JP0A 4M3FA 5K7HA 4JX4A 3A01B 3LSRA 2EZHA 3M4OJ 4A3BJ 3HEFA 3IH4A 1ZGWA 2GLOA 3G1OA 3JREA 3S1QJ 1LFBA 3ZQFA 2HXOA 2Y9ZA 3CMYA 3MN2A 4M3BA 3OIOA 5GPCA 2CQQA 2Y31A 3LSGA 4Y52J 4JX5A 3A01A 2X48A 4IHVA 1IDZA 1U9OA 2M34A 1ORKA 3NAUA 2AO9A 1H89C 5BNGA 2DMNA 2GBYA 1FJLA 4A3JJ 4BXXJ 1I6HJ 3HOUJ 1FTZA 2DA5A 3H0GJ 4B4CA 4EEFG 3CCYA 5IP9J 1MSFC 1D5YA 2K9NA 5E3NA 4D7NA 2LLKA 4DYRA 4XICA 1JTXA 3TEDA 1H88C 2IAIA 3Q3SA 1GVDA 1W0UA 2ECBA 4DYQA 2DMUA 4I76A 4MIMA 2DA6A 4XRSA 1K83J 5EGOB 3LSJA 2VKVA 1GUUA 1VFCA 2CUFA 4C2MJ 2ID6A 5F04A 2K9QA 5IP6A 5EZHA 2ELKA 1JKOC 1QRYA 1U9NA 2DA3A 1AKHB 3DEWA 2FJ1A 3GTGJ 3A02A 2QF7A 5IPAA 3FK7A 1MBJA 2CQXA 2R0QC 2R92J 1QVTA 3LSPA 4C3HJ 5EGOA 1JJ6C 4M6VA 5C4JJ 3K7AJ 1PUFB 4L5EA 1HF0A 1Y1VJ 4MFDA 1YRNB 3GTOJ 5IOZA 2L7FP 1AHDP 1AKHA 1Z77A 2HI3A 1MSEC 3M3YJ 3RKQA 1LE8B 1ZTRA 2Y30A 1MH4A 2JA6J 1ETVA 3BR6A 3Q0WA 4I6ZA 1P7JA 2M8GX 3HGYA 5F1JA 4AYBN 3OSFA 4BKXA 2DMQA 1T56A 2ME0A 2MW8A 1PUFA 1ENHA 2JMWA 4M3DA 1JJ8C 1YRNA 4W97A 1GDTA 2LVSA 5J3LA 5C3EJ 1RR7A 4D5CA 1FIAA 9ANTA 5IYBJ 3HBLA 5EEAA 1LE8A 2LD5A 5F0FA 3LNQA 3UKGA 5M5YJ 2W48A 1BL0A 1SANA 3S16J 3HOZJ 3HDDA 2O9LA 1ETQA 1I50J 1EF4A 5EG0B 2O8KA 4X1EA 2B63J 1OCTC 1VI0A 5HODA 1JKRC 5FKOA 1ZK8A 1ZQ3P 2L7ZA 2EZIA 2WAQN 3HB9A 4RDUA 1F43A 1JKQC 2XPWA 3Q0UA 3QPSA 3WHBA 3HOWJ 1JUPA 3D1NI 1SFOJ 1RESA 4FE7A 2EBIA 3FK6A 3HM5A 2JWTA 1R9TJ 3S2DJ 5FKNA 3FIWA 5EG0A 5FKMA 3JR9A 2NVQJ 2G0EA 2LY9A 2CUEA 5E3LA 2H8RA 5EF6A 5FJ8J 3W6VA 4DZPA 3TP3A 1GV5A 1RETA 1U78A 4BBSJ 2LFBA 4FTHA 3GBGA 3RZOJ 2YS9A 5FLVA 3MVPA 2NOGA 4G12A 3IH3A 2VPRA 4A3CJ 2XGCA 1IV6A 5J1YA 2OPTA 2M2EA 2YUSA 2CU7A 1IJWC 2CRGA 2E1OA 2X9DA 5DTDA 5DS9A 4XK4A 4A3EJ 3GTLJ 3OSGA 3DCFA 1IUFA 1JTYA 3MKLA 5M3MJ 3BR0A 5EDNA 4B1RA 3BTLA 3BT9A 2VUMJ 4RBOA 1F36A 3GTMJ 1WH5A 2KDZA 1JUSA 2O7OA 4IHWA 2FX0A 2HDDA 5FKKA 3C2BA 4D7MA 1ETWA 3F0CA 2NVXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VI6 A;  2DA2 A;  1DU0 A;  5F08 A;  1ETY A;  3BTI A;  1W0T A;  2XGE A;  3S1M J;  1HLV A;  2QCO A;  1JGG A;  1E3O C;  4XRS G;  5J1U A;  1K61 A;  1LFU P;  3PO2 J;  4IEJ A;  1MBF A;  2HQ5 A;  2WV1 A;  1MNM C;  1ZKG A;  1QVU A;  1A6I A;  3BTJ A;  5IP7 J;  1H8A C;  4ABZ A;  1IC8 A;  2TRT A;  2NS7 A;  1Z0X A;  2HOT A;  1MBE A;  2JA7 J;  2LK2 A;  1HDP A;  1B8I B;  1UHS A;  2HXI A;  2MGQ A;  2HOS A;  3PM1 A;  3K2A A;  2LTP A;  4C3I J;  2NVT J;  1CQT A;  2DA4 A;  2DTZ A;  2Y0S N;  1BA5 A;  3PO3 J;  3S15 J;  3B6A A;  4A69 C;  1UMQ A;  3TP0 A;  2WB1 N;  2JN6 A;  3ZQC A;  1DU6 A;  2R5Z B;  3VPR A;  1BW6 A;  2DN0 A;  3JRG A;  1B8I A;  4MLO A;  4NDL A;  4J19 A;  2H1K A;  1WPK A;  3G1L A;  2Y2Z A;  4DW6 A;  5M5W J;  3FKI J;  3BG3 A;  3JRI A;  1ETX A;  4LOC A;  4QIW N;  2DMT A;  2E2I J;  1TWA J;  2XB5 A;  1VND A;  4D5F A;  3BQY A;  2E2J J;  4X6A J;  4IHY A;  2XPV A;  3IH2 A;  2FQ4 A;  1MBH A;  3HOV J;  1BW5 A;  2R5Z A;  5IOY A;  2M0C A;  1S7E A;  1HOM A;  5IYD J;  1IRZ A;  2D5V A;  2TCT A;  2L7M P;  3E7L A;  3B6C A;  3BG9 A;  3QQA A;  2IEK A;  4Y7N J;  1MBK A;  1U8B A;  2EH3 A;  1WI3 A;  4V2G A;  4V2F A;  2EZL A;  1X2N A;  3WHC A;  4UUS B;  4A93 J;  1B72 B;  2IBD A;  3SFI A;  4XID A;  4DZJ A;  2PMZ N;  4MFE A;  3L1P A;  1I3Q J;  4M3E A;  5GP9 A;  3JRH A;  3JRC A;  3JRA A;  3ZOB A;  1JT0 A;  2EQR A;  4AC0 A;  3S1N J;  5EYR A;  1NK3 P;  3CQZ J;  3BR3 A;  3GTJ J;  4UUS A;  1XG1 A;  1B72 A;  3BQZ A;  1HDD C;  1WCM J;  3BR1 A;  1FTT A;  1NTC A;  4C3J J;  2EZK A;  5JLW A;  2XGD A;  1OJL A;  4DYC A;  1Y1W J;  2ECC A;  3RQI A;  2CJJ A;  2ZB9 A;  5GPA A;  2DA1 A;  3G1M A;  4W1U A;  3QPL A;  3JRD A;  3SJM A;  3S2H J;  3BR5 A;  3ZQL A;  4FE4 A;  4B3A A;  1ITY A;  5FKL A;  4GFB A;  2JA5 J;  1P7I A;  3GTP J;  2AHQ A;  1QPI A;  4MO7 A;  4QSH A;  2GM4 A;  1X58 A;  4A3D J;  2OF7 A;  1WGX A;  4JYK A;  4IHX A;  3OOU A;  4A3F J;  2L9R A;  4A3K J;  5M3F J;  1IGN A;  2ID3 A;  5IYC J;  5F0C A;  5C4X J;  1VF9 A;  2P81 A;  2KT0 A;  1MBG A;  4JX6 A;  2HYJ A;  1OFC X;  2VKE A;  2XB0 X;  5FLM J;  1XC5 A;  2MSY A;  4A3M J;  2FD5 A;  1ETO A;  4HNV A;  5E3M A;  2LR8 A;  5F27 A;  2R93 J;  2XRL A;  4FIS A;  1O4X A;  2K9S A;  1NK2 P;  3IV5 A;  1WH7 A;  2DMP A;  2K40 A;  2I10 A;  3S17 J;  2ME6 A;  1RPW A;  3JRF A;  1GV2 A;  1IG7 A;  1GT0 C;  1Q1V A;  1ZR2 A;  3A03 A;  1TWG J;  2M9H A;  1AU7 A;  1A5J A;  3BG5 A;  1G2H A;  3ZQH A;  3FIS A;  2L0K A;  4A3G J;  2DJN A;  1ETK A;  2MG4 A;  3H3V K;  2E2H J;  2JA8 J;  1XS9 A;  1BJZ A;  5C44 J;  1RKT A;  2LP0 A;  4CYC B;  3ZQG A;  4BY7 J;  5J1R A;  2DA7 A;  5M5X J;  3GTQ J;  3Q0V A;  4QTR A;  2E19 A;  1TWH J;  2NVY J;  5JLX A;  1OCP A;  3HOX J;  3HKZ N;  2R5Y B;  5F0H A;  3BTC A;  4XRM A;  3GTK J;  3CDL A;  1ZR4 A;  2RAE A;  2N8G A;  2HOA A;  4M3G A;  4BBR J;  1UG2 A;  2XPU A;  1TC3 C;  4BY1 J;  3ZQI A;  3SDG A;  1TWC J;  4S0H B;  4CYC A;  2YU9 J;  1POG A;  3NAR A;  1FEX A;  3TW7 A;  1JKP C;  4AUX A;  1HCR A;  2COB A;  5K7F A;  1T33 A;  5EZG A;  1FIP A;  3O8G A;  3RZD J;  1TWF J;  1APL C;  2R5Y A;  2JJ7 A;  5K7Z A;  3HGG A;  3JRB A;  3BR2 A;  4A3L J;  3HOY J;  3I4M J;  2LKX A;  1JUM A;  3O8H A;  2X6O A;  4A3I J;  1RKW A;  3S1R J;  5E3O A;  1MH3 A;  3I4N J;  1JT6 A;  2Y9Y A;  4FCY A;  2XSD C;  4UUT A;  2JK3 A;  2NS8 A;  3S14 J;  3LOC A;  1IDY A;  3TW6 A;  2R7Z J;  1X2M A;  4JP0 A;  4M3F A;  5K7H A;  4JX4 A;  3A01 B;  3LSR A;  2EZH A;  3M4O J;  4A3B J;  3HEF A;  3IH4 A;  1ZGW A;  2GLO A;  3G1O A;  3JRE A;  3S1Q J;  1LFB A;  3ZQF A;  2HXO A;  2Y9Z A;  3CMY A;  3MN2 A;  4M3B A;  3OIO A;  5GPC A;  2CQQ A;  2Y31 A;  3LSG A;  4Y52 J;  4JX5 A;  3A01 A;  2X48 A;  4IHV A;  1IDZ A;  1U9O A;  2M34 A;  1ORK A;  3NAU A;  2AO9 A;  1H89 C;  5BNG A;  2DMN A;  2GBY A;  1FJL A;  4A3J J;  4BXX J;  1I6H J;  3HOU J;  1FTZ A;  2DA5 A;  3H0G J;  4B4C A;  4EEF G;  3CCY A;  5IP9 J;  1MSF C;  1D5Y A;  2K9N A;  5E3N A;  4D7N A;  2LLK A;  4DYR A;  4XIC A;  1JTX A;  3TED A;  1H88 C;  2IAI A;  3Q3S A;  1GVD A;  1W0U A;  2ECB A;  4DYQ A;  2DMU A;  4I76 A;  4MIM A;  2DA6 A;  4XRS A;  1K83 J;  5EGO B;  3LSJ A;  2VKV A;  1GUU A;  1VFC A;  2CUF A;  4C2M J;  2ID6 A;  5F04 A;  2K9Q A;  5IP6 A;  5EZH A;  2ELK A;  1JKO C;  1QRY A;  1U9N A;  2DA3 A;  1AKH B;  3DEW A;  2FJ1 A;  3GTG J;  3A02 A;  2QF7 A;  5IPA A;  3FK7 A;  1MBJ A;  2CQX A;  2R0Q C;  2R92 J;  1QVT A;  3LSP A;  4C3H J;  5EGO A;  1JJ6 C;  4M6V A;  5C4J J;  3K7A J;  1PUF B;  4L5E A;  1HF0 A;  1Y1V J;  4MFD A;  1YRN B;  3GTO J;  5IOZ A;  2L7F P;  1AHD P;  1AKH A;  1Z77 A;  2HI3 A;  1MSE C;  3M3Y J;  3RKQ A;  1LE8 B;  1ZTR A;  2Y30 A;  1MH4 A;  2JA6 J;  1ETV A;  3BR6 A;  3Q0W A;  4I6Z A;  1P7J A;  2M8G X;  3HGY A;  5F1J A;  4AYB N;  3OSF A;  4BKX A;  2DMQ A;  1T56 A;  2ME0 A;  2MW8 A;  1PUF A;  1ENH A;  2JMW A;  4M3D A;  1JJ8 C;  1YRN A;  4W97 A;  1GDT A;  2LVS A;  5J3L A;  5C3E J;  1RR7 A;  4D5C A;  1FIA A;  9ANT A;  5IYB J;  3HBL A;  5EEA A;  1LE8 A;  2LD5 A;  5F0F A;  3LNQ A;  3UKG A;  5M5Y J;  2W48 A;  1BL0 A;  1SAN A;  3S16 J;  3HOZ J;  3HDD A;  2O9L A;  1ETQ A;  1I50 J;  1EF4 A;  5EG0 B;  2O8K A;  4X1E A;  2B63 J;  1OCT C;  1VI0 A;  5HOD A;  1JKR C;  5FKO A;  1ZK8 A;  1ZQ3 P;  2L7Z A;  2EZI A;  2WAQ N;  3HB9 A;  4RDU A;  1F43 A;  1JKQ C;  2XPW A;  3Q0U A;  3QPS A;  3WHB A;  3HOW J;  1JUP A;  3D1N I;  1SFO J;  1RES A;  4FE7 A;  2EBI A;  3FK6 A;  3HM5 A;  2JWT A;  1R9T J;  3S2D J;  5FKN A;  3FIW A;  5EG0 A;  5FKM A;  3JR9 A;  2NVQ J;  2G0E A;  2LY9 A;  2CUE A;  5E3L A;  2H8R A;  5EF6 A;  5FJ8 J;  3W6V A;  4DZP A;  3TP3 A;  1GV5 A;  1RET A;  1U78 A;  4BBS J;  2LFB A;  4FTH A;  3GBG A;  3RZO J;  2YS9 A;  5FLV A;  3MVP A;  2NOG A;  4G12 A;  3IH3 A;  2VPR A;  4A3C J;  2XGC A;  1IV6 A;  5J1Y A;  2OPT A;  2M2E A;  2YUS A;  2CU7 A;  1IJW C;  2CRG A;  2E1O A;  2X9D A;  5DTD A;  5DS9 A;  4XK4 A;  4A3E J;  3GTL J;  3OSG A;  3DCF A;  1IUF A;  1JTY A;  3MKL A;  5M3M J;  3BR0 A;  5EDN A;  4B1R A;  3BTL A;  3BT9 A;  2VUM J;  4RBO A;  1F36 A;  3GTM J;  1WH5 A;  2KDZ A;  1JUS A;  2O7O A;  4IHW A;  2FX0 A;  2HDD A;  5FKK A;  3C2B A;  4D7M A;  1ETW A;  3F0C A;  2NVX J; 
#chains in the Genus database with same CATH topology
 1SFK A;  2VKD A;  1J59 A;  2A69 F;  2VI6 A;  5BPI A;  5H6R A;  3I71 A;  1HKT A;  2XGE A;  3EUK L;  1HLV A;  2QCO A;  3GF2 A;  1E3O C;  2O6G E;  4PZJ A;  3CUO A;  4KIT B;  1K61 A;  1MKM A;  3UR3 C;  3PO2 J;  2VIX A;  4J01 A;  2L4A A;  5GAE J;  4E7J A;  1QVU A;  3PSI A;  3S93 A;  3W6J B;  2HYF A;  1K6O A;  2ZJR F;  4CIC A;  4ABZ A;  3I3L A;  1IC8 A;  4XOR A;  2HOT A;  3LA7 A;  4XL9 A;  1IN8 A;  3CUQ B;  3CC4 I;  4XON A;  2EV5 A;  1R4M B;  2VOP A;  2HPM A;  2CO5 A;  1CGP A;  1LNW A;  3TL4 X;  2LTP A;  2FF4 A;  3EUH A;  2EFP A;  4C3I J;  1VQ8 I;  4ZZL A;  2L9V A;  1MMA A;  2FXA A;  2KKO A;  3BG7 A;  1TT0 A;  3S15 J;  2KMU A;  1UMQ A;  3FHZ A;  3KEY A;  3ELK A;  1LDJ A;  4HZF A;  1BW6 A;  3ONQ A;  1QBJ A;  4LIT A;  1B8I A;  4NC6 A;  2LC2 A;  3PQK A;  1RUN A;  3G1L A;  2XAF A;  2XVC A;  2HOE A;  4DW6 A;  4H0E A;  4MTD A;  2ZKZ A;  4PSW A;  4HLY A;  2L9S A;  1ETX A;  4LOC A;  5FD5 A;  2FBH A;  2DMT A;  3H5N A;  4RGU A;  4QIW N;  5BOX A;  1A35 A;  2E2J J;  3GLL A;  1R1T A;  1SFX A;  1EH8 A;  5JVT A;  1I1S A;  2LYC A;  3IH2 A;  1O57 A;  3NRV A;  2OZU A;  4U7D A;  5IOY A;  2F4O B;  2DFI A;  1IRZ A;  2H1L A;  2TCT A;  2L7M P;  3BG9 A;  3E7L A;  4LG0 B;  5DV5 A;  2IT0 A;  3FXL A;  4KMU X;  2M87 A;  4LLN A;  3IWZ A;  1YYV A;  2FSW A;  1D0X A;  1MW7 A;  4A93 J;  1X2N A;  2J5P A;  3LAJ A;  3IUO A;  2QKL B;  3SFI A;  2EIJ H;  2RQQ A;  5DM7 F;  1XGO A;  4XID A;  3GXO A;  3OIP A;  1X4P A;  4C30 A;  1IN7 A;  4ZDP A;  3HPG A;  1N77 A;  3OS0 A;  4M3E A;  1PYV A;  3FMR A;  3JRA A;  3RDI A;  3ZOB A;  3JTH A;  5HDK A;  1JGS A;  3ZXS A;  1YTY A;  4AC0 A;  2A5Y B;  3SQN A;  3S1N J;  4OWR B;  2XAS A;  4A2U A;  3VYS B;  3CQZ J;  3BR3 A;  2FNP A;  1B6A A;  4GXO A;  3BQZ A;  3DFG A;  4PGH A;  3VDX A;  2X6X A;  1FTT A;  4C3J J;  3C7J A;  3ABT A;  2XGD A;  4MEY F;  4RLF A;  3U9G A;  5ICC A;  4DYC A;  4HF2 A;  3RKX A;  4MEX F;  4HX4 A;  2ZB9 A;  4PJ0 C;  5GPA A;  2LF8 A;  1WHU A;  4P55 A;  4OIR F;  4W1U A;  3QPL A;  2KPM A;  3JRD A;  3HRU A;  4PSX A;  3PFY A;  3MQ0 A;  2KJC A;  5LHI A;  3QYF A;  3CF2 A;  4N4O B;  2JA5 J;  4G6T B;  1P7I A;  2DBB A;  4LLL A;  2AHQ A;  1TNT A;  1TL8 A;  2O8X A;  4A3D J;  3LWF A;  2V4J C;  2KL4 A;  1TP4 A;  3MKZ A;  2M5W A;  4ITV A;  4A3K J;  3ABL H;  1T39 A;  2STW A;  5IYC J;  2XHK A;  2UXX A;  3U21 A;  3J7A O;  2KT0 A;  2GXA A;  3D5S C;  2VKE A;  4BS9 A;  4HDU A;  1ULY A;  1OMI A;  5HLT A;  3RI4 A;  1IF1 A;  2QUF A;  3ZMV A;  4CSW A;  4EM1 A;  1ETO A;  5E3M A;  2LG4 A;  1T6S A;  5F27 A;  3OYN A;  3K70 C;  1LPQ A;  2R93 J;  2VXD A;  2WTE A;  2JPB A;  2K9S A;  1NK2 P;  4C9Y A;  2K40 A;  4HQE A;  2DOA A;  3G3Z A;  2ME6 A;  2W85 A;  1OCO H;  4A0X A;  1IG7 A;  4HNU A;  3VYR B;  2DTR A;  4UB6 C;  1IW7 F;  1TWG J;  4HA8 A;  2M9H A;  1AU7 A;  5CVI A;  2JSC A;  3TBI A;  1ETK A;  4A5M A;  2E2H J;  2JA8 J;  1XS9 A;  3EPZ A;  1BJZ A;  4K2E A;  3HTU A;  4EQQ A;  4CYC B;  2L54 A;  2ISY A;  1WJA A;  4BGD A;  2BZT A;  2M4K A;  5M5X J;  3GTQ J;  3CO6 C;  3DU6 A;  2E19 A;  2WV0 A;  5HDG A;  5DM6 F;  3D0S A;  1OCP A;  3HKZ N;  2R5Y B;  4RB0 A;  3FXJ A;  2OV7 A;  3CCS I;  1DPR A;  1FPQ A;  4EJV A;  2PFB A;  1ZR4 A;  3KP6 A;  2XPU A;  3RKW A;  1U0J A;  1TBX A;  2IP2 A;  3RPQ A;  3SDG A;  4S0H B;  2QQ9 A;  2IA1 A;  1POG A;  3SZG A;  4ZZD A;  4YRV A;  4GCV A;  1FEX A;  3TW7 A;  4IHT A;  2A6T A;  2KIF A;  1T33 A;  5EZG A;  4N9I A;  4Y15 A;  1TWF J;  2D1V A;  4Y4R A;  1H0M A;  3BPX A;  4QPO A;  1X3W B;  3HOY J;  2LH9 A;  3CLO A;  1JUM A;  2G7H A;  3DKW A;  1RKW A;  3S1R J;  2ETH A;  5E3O A;  1U5T B;  1X3Z B;  1JT6 A;  2GXB A;  2B0L A;  4UUT A;  3K70 D;  2NS8 A;  2IGN A;  1S29 A;  3TW6 A;  1YHQ I;  2W24 A;  3K4J A;  4HST A;  3A01 B;  2OD5 A;  4S05 A;  2VC1 A;  5B66 C;  4WXH A;  4MQV A;  3ZCO A;  2OZ6 A;  4A3B J;  1T95 A;  4BAY A;  2QLZ A;  2ACJ A;  3L00 A;  2XRN A;  1LFB A;  1Z9C A;  5D8K B;  3ZQF A;  1O3R A;  5ERI A;  1R23 A;  1VZ0 A;  2DT5 A;  2D45 A;  2E1M C;  3GWZ A;  2Y31 A;  5FRO A;  4Y52 J;  2R3S A;  2V9P A;  4PDK A;  2UV1 A;  2R7S A;  4R79 A;  3JAM Z;  1IDZ A;  4G9Y A;  2ZXW H;  1KA8 A;  2VQL A;  5L3B A;  3BLY A;  1RZ4 A;  3VYT B;  5FB2 A;  2WWY A;  3KX2 A;  1MJA A;  2EA2 A;  2KIS A;  1FTZ A;  2DA5 A;  2V9V A;  3Q9S A;  4EEF G;  3LSK A;  4LFU A;  5IP9 J;  4HX8 A;  4XNF A;  1J2X A;  2EFN A;  3WG7 H;  4IXA A;  4D7N A;  4QPQ A;  2KJB A;  3N4M A;  2AS5 F;  4Q5S F;  2R7D A;  1LKX A;  2CQK A;  1T0F A;  2VE8 A;  4UB8 C;  1GVD A;  2ECB A;  3BG6 A;  1BIA A;  5D4S A;  2EK5 A;  1BBY A;  4XRS A;  1EV7 A;  3CD6 I;  1S8N A;  2X85 A;  4PGG A;  3TO6 A;  1JHF A;  1GUU A;  2JVH A;  3EET A;  4XLC A;  3OS1 A;  1ODD A;  3CCM I;  1UST A;  2M7A A;  5LRS A;  3H5A A;  2GA1 A;  2FJ1 A;  5FRN A;  4CXF A;  4R1H A;  4LGW A;  2HVS A;  3ROU A;  3F8C A;  2QWW A;  3FK7 A;  3F72 A;  2IGM A;  4L9J A;  4U87 A;  1D5V A;  1YS7 A;  3KP4 A;  4BAC A;  4XBF A;  2LOO A;  2FOW A;  2KFD A;  1AWC A;  5LGN A;  3EUA A;  1YRN B;  4IRI A;  3RQ4 A;  2EIM H;  1AHD P;  1AKH A;  5D5V B;  2CV1 A;  2VJJ A;  2HI3 A;  1YOV B;  3RKQ A;  1HXD A;  4EM2 A;  4F92 B;  1F5T A;  4YFN F;  4BQO A;  1JHH A;  4BL0 B;  3TMO A;  3BR6 A;  4U0W A;  5F1J A;  3MD2 A;  2O5R A;  3G71 I;  3S2W A;  2ME0 A;  2MW8 A;  1DGR M;  1ENH A;  1Z21 A;  3BWG A;  1H9G A;  2HEO A;  3IRQ A;  1NG6 A;  3TOB A;  2HQR A;  2KIQ A;  5J3L A;  5C3E J;  3CMM A;  1U6G A;  2DK8 A;  3CP2 A;  3I59 B;  5HS9 A;  1ZG5 A;  5EEA A;  2CH0 A;  1LE8 A;  2LD5 A;  2JVG A;  3GX4 X;  1I27 A;  1BI1 A;  3BDD A;  1BL0 A;  3CMA I;  3S16 J;  2KIU A;  2RQP A;  3H3U A;  1I50 J;  1V5G A;  1G4D A;  3ZQ7 A;  5LGT A;  2X0L A;  3VWB A;  3V8J A;  4NC7 A;  2V6E A;  3ASO H;  1QZE A;  2ZNY A;  1ZQ3 P;  3FXQ A;  5E18 F;  1I6X A;  3T5X A;  2K27 A;  4NQW B;  1F43 A;  3CLQ A;  2EIL H;  3P5J A;  3OYG A;  2BY3 A;  1Y8R B;  3ECO A;  5E17 F;  3QPS A;  2M4G A;  2E7W A;  4P96 A;  2LBF A;  3O6B B;  2E71 A;  1SFO J;  3HM5 A;  3S3N A;  3AKZ A;  2FNA A;  3F6O A;  3CJR B;  1QGP A;  5KAF C;  3KE2 A;  1UCR A;  2QQ8 A;  5FD6 A;  5EG0 A;  2NVQ J;  3QPT A;  3HTS B;  2COM A;  2G0E A;  5GAH J;  2CUE A;  3T8R A;  1FT9 A;  4UV8 A;  5EF6 A;  5ILS A;  3W6V A;  1IZ1 A;  4DZP A;  3V8L A;  4L9T A;  4WX9 A;  5IT9 K;  2IA0 A;  1I5Z A;  4KFC A;  4FTH A;  3GZ5 A;  3RZO J;  3EQL F;  3BJ6 A;  4G12 A;  2EIN H;  4M9S A;  1R49 A;  4A3C J;  3GLX A;  3R4K A;  2IS4 A;  2CRG A;  2HYG D;  3FMS A;  2NNY A;  5DUK A;  4G7Z F;  5LHG A;  3R60 A;  4I0B A;  1KQ0 A;  4A3E J;  3GTL J;  3GW2 A;  4HV6 A;  1D0Z A;  3OSG A;  3HSE A;  3MKL A;  3WGI A;  3SZP A;  3BR0 A;  5EDN A;  4CA0 A;  3ZMT A;  4B1R A;  5HS8 A;  2ZSH B;  3CZ6 A;  3KLO A;  1YIO A;  2ZBK A;  3BC8 A;  3DEE A;  3OYI A;  4ESB A;  2A07 F;  4DBR A;  5DCF A;  2DLL A;  3MKY B;  2F5C A;  3OR2 C;  2R7X A;  3DPU A;  4YFK F;  4NB5 A;  3E6B A;  1FOX A;  1QQI A;  1ZLK A;  1ETW A;  3NEU A;  2M45 A;  3FMQ A;  2MD5 A;  3KP3 A;  2XUB A;  3WTS C;  1DU0 A;  2MBF A;  1ETY A;  3BTI A;  3DBH B;  5F08 A;  4DNC A;  3S1M J;  4IOA F;  1FYK A;  2PJP A;  5E20 A;  4XRS G;  2PLY A;  1F4K A;  3LSM A;  2Q0O A;  2DCE A;  1R22 A;  1M1E B;  1MNM C;  1ZHF A;  5IP7 J;  4IQJ A;  3K1N A;  2EFW A;  3RCO A;  2M3A A;  1UG0 A;  3HIF A;  2JA7 J;  2LK2 A;  3E1S A;  2XAJ A;  4KA4 A;  1TZL A;  4HYE A;  1B8I B;  4PK4 A;  1LEB A;  3A0H C;  1F1Z A;  1O3Q A;  4CHU A;  1CQT A;  2DTZ A;  4HV5 A;  1W7P A;  3LSI A;  2DT7 B;  1BA5 A;  1ONV A;  5D4R A;  2ZC2 A;  4A69 C;  2WB1 N;  1X1D A;  2DDA A;  5IY5 H;  2PN6 A;  4EJW A;  3JRG A;  2IPQ X;  1Y8Q B;  2VBY A;  3DTI A;  4L9N A;  4ZYG A;  4MLO A;  4NDL A;  2CV2 A;  4AWX B;  2H1K A;  4WCG A;  3J80 K;  2VPL A;  2DO7 A;  1ZN2 A;  3ISP A;  4RGS A;  3FX3 A;  1FYM A;  3DWL E;  4E7Z A;  1TT5 B;  3DEU A;  4GO1 A;  2XB5 A;  3F8N A;  1VND A;  3F8B A;  1J7K A;  4X6A J;  4IHY A;  3BRO A;  2HR3 A;  1MBH A;  1BW5 A;  3GUD A;  2R5Z A;  1Z1D A;  2PBI A;  2M0C A;  1WSU A;  3Q5F A;  1NG7 A;  1G8X A;  1STZ A;  1FSE A;  2VXZ A;  2QQA A;  2XDV A;  1FP1 D;  2Z16 A;  1RIO H;  4CZZ A;  4Y7N J;  2E1C A;  2XRO A;  2JPC A;  3L2W A;  4LD5 A;  3I59 A;  2FOK A;  1XMX A;  1ON2 A;  4E7L A;  4B43 A;  3CP8 A;  1D3Y A;  2EZL A;  2KIM A;  2IBD A;  3L2V A;  3WTV C;  4UY8 I;  3G4S I;  1EH7 A;  1X3U A;  2L5Q A;  5GP9 A;  3JRH A;  2B9S A;  4KDP A;  1BR1 A;  4A0Z A;  1XMA A;  1J75 A;  3GCM A;  2GA2 A;  2P5V A;  2VT3 A;  4I2O A;  1KYZ A;  1Z91 A;  1DP7 P;  1U5T C;  3CCJ I;  3S32 A;  4RAF A;  2A6E F;  3DPT A;  4XM3 A;  2QQB A;  1OQY A;  1BC8 C;  5FLX Z;  1BN5 A;  2GXG A;  4ON0 A;  2W57 A;  3MAJ A;  1NK3 P;  3HYI A;  3AAF A;  2XAH A;  3OYE A;  1YJ9 I;  2EZK A;  3ECH A;  5B3S H;  4M9X A;  2NVX J;  5HLH A;  1SVM A;  1IV8 A;  2A68 F;  1K7A A;  1V4R A;  2RV8 A;  2CJJ A;  1YO5 C;  2DA1 A;  3EDP A;  3K4L A;  3G1M A;  2KDO A;  1SD6 A;  2VBZ A;  2W25 A;  2ZJ2 A;  3CDI A;  3MZY A;  1SFE A;  2BW3 A;  3BR5 A;  2L7K A;  3K10 A;  3F23 A;  4FE4 A;  1XGM A;  3DTK A;  1U3E M;  4KIC A;  3FDY A;  1XDS A;  4MO7 A;  4DBQ A;  2GM4 A;  3HRT A;  1WRJ A;  3RPU A;  4OMZ A;  3PNY A;  4JYK A;  1WJF A;  1X1B A;  3OOU A;  4TV7 A;  4A3F J;  1XSV A;  1KU7 A;  2L9R A;  3LMM A;  1LDK B;  3AFH A;  2BXY A;  1P9Q C;  4KIF A;  5C4X J;  5F0C A;  4P5O A;  4GRI A;  4EAT A;  2P81 A;  3K1P A;  4JX6 A;  2HYJ A;  1OFC X;  3AL0 B;  3OV8 A;  4JQF A;  3IHU A;  4HEA 2;  2PMZ A;  5EEG A;  2XRL A;  1QZZ A;  5HVQ C;  1G59 A;  1FSH A;  1BOA A;  3V7R A;  1RUO A;  5GTH C;  1RR8 C;  2O0Y A;  4LB6 B;  2LY2 A;  1SD4 A;  1WH7 A;  2DMP A;  3HXL A;  1E3H A;  3P7N A;  2JSP A;  2F4M B;  1XCB A;  2X51 A;  3IP4 B;  1D1B A;  3RKY A;  1VQ5 I;  1Q1V A;  4KMF A;  3T1B A;  2A6H F;  2QZ8 A;  4XRF A;  2NNN A;  2VB6 A;  3A03 A;  2ELH A;  1W5C C;  3WTT C;  3BG5 A;  2BBY A;  2PMU A;  3FIS A;  4BXU A;  4D9J A;  4G94 A;  4A3G J;  3FXU A;  1EKE A;  1V3F A;  3DBR B;  3L7W A;  3J81 Z;  1S6L A;  5HLG A;  4II3 A;  1I1G A;  1O3T A;  2XAU A;  4BU2 A;  1KGS A;  2LP0 A;  2E1N A;  3F3X A;  4BDZ A;  2NVY J;  3FF5 A;  3KET A;  2Z2S B;  1MZB A;  5D5U B;  2H6B A;  1XTA A;  2GOM A;  2YX7 A;  3I56 I;  3VFZ A;  3E6M A;  2RAE A;  2HOA A;  4BBR J;  2JUC A;  1MMG A;  1R36 A;  4BY1 J;  3HSF A;  3H0D A;  2OCC H;  1TWC J;  3P9I A;  1JE8 A;  4B3X A;  4AUX A;  1HCR A;  5FO5 A;  2JQ7 A;  2FRH A;  1FIP A;  1APL C;  4HOB A;  2MLK A;  1Z6T A;  3IAM 2;  3BCA A;  3JRB A;  2PX9 A;  3QWL A;  3WTZ A;  1TQI A;  4I99 C;  1ZAO A;  2VOD A;  4KNY A;  3GEZ A;  2DYS H;  2Y9Y A;  4PJM A;  4XR6 A;  2XSD C;  1Y39 A;  2R7Q A;  1FX7 A;  1I39 A;  2MA3 A;  1XD7 A;  2OUM A;  3E5Q A;  2R7Z J;  2RKH A;  4M3F A;  3VSL A;  1O7F A;  5EJC A;  4JX4 A;  5K7H A;  1FNN A;  2JRT A;  4L9V A;  1ZRC A;  1UHM A;  3LSR A;  4OAY A;  3LA2 A;  1ZLJ A;  1XMK A;  3PUF A;  5D6E A;  1S72 I;  3S1Q J;  1KZH A;  2AQF A;  2EJR A;  1T8I A;  3KIO A;  2HXO A;  3KYC B;  3ZRG A;  4RB1 A;  4EVI A;  3OS2 A;  2QEX I;  2R4G A;  3MN2 A;  2V9K A;  4G8X A;  1TNS A;  4UHT A;  5LD2 C;  5HLI A;  2KZV A;  4JX5 A;  2DU9 A;  1MJ9 A;  1BIB A;  5J8F A;  3W3C A;  2FBI A;  2YPR A;  2DW4 A;  5DD8 A;  4I09 A;  2L02 A;  2V1N A;  4OIO F;  2OCE A;  5BNG A;  1UZC A;  2X6W A;  3HUG B;  4NC8 A;  2K02 A;  1FJL A;  2PI0 A;  4XMY A;  3HOU J;  1LDD A;  1SEU A;  3CCY A;  3K4K A;  1P2F A;  4HG2 A;  1MSF C;  2XF7 A;  2M7B A;  1SVO A;  5L3E A;  2X4H A;  3WU2 C;  4B47 A;  1YW8 A;  4XOT A;  4JOM A;  2IVM A;  2W1O A;  1H88 C;  2QGU A;  3Q3S A;  3AG1 H;  2WAE A;  1J0R A;  3A0B C;  3BY6 A;  3LAP A;  2KZG A;  1A36 A;  2DMU A;  3X2Q H;  2MYS A;  5DCM A;  1YW9 A;  4I01 A;  1TQM A;  5JI6 A;  1K83 J;  3DLA A;  2VKV A;  4ENK A;  3BPV A;  3SHF A;  2ID6 A;  4EJO A;  3H92 A;  1F9N A;  1QU3 A;  4A6D A;  2ELK A;  3RSN A;  1QRY A;  3HHH A;  4BE1 A;  1AKH B;  1IRG A;  3DEW A;  4M73 A;  4XKW A;  1XCV A;  4KT6 A;  1S3J A;  3HPH A;  3A02 A;  5TRD A;  2K4J A;  2R0Q C;  3U1K A;  4BQA A;  3MEX A;  5CLS A;  3LSP A;  3MCZ A;  4F52 A;  4NBQ A;  1JJ6 C;  5C4J J;  1DUX C;  4MFD A;  1OYY A;  4BH9 A;  3F8F A;  1RNL A;  3V4G A;  1Z77 A;  3CCV I;  2RNG A;  1LE8 B;  5AON A;  1ZTR A;  1VQN I;  4LIV A;  2JA6 J;  3Q0W A;  2CYY A;  5HS7 A;  4AYB N;  1Z3Y A;  2W82 A;  3OSF A;  4BNC A;  1PVE A;  2DMQ A;  1K4T A;  1EH6 A;  2XKO A;  3ESW B;  5BPD A;  4M6Y A;  4B8X A;  3SEZ A;  1VQ9 I;  1JJ8 C;  4XKC A;  1UAA A;  4W97 A;  4L5I A;  2XV4 S;  3T8T A;  3KZI C;  2Z33 A;  3HBL A;  3QAH A;  3WGH A;  5F0F A;  2IRF G;  4MGR A;  3LNQ A;  3UKG A;  2O61 A;  1XDU A;  5M5Y J;  4FT8 A;  2LBF B;  3WU1 B;  3WGG A;  1SAN A;  1H9T A;  1LVA A;  2MFZ A;  1BM9 A;  3HOZ J;  3TOA A;  4QWQ A;  2QVO A;  5KAI C;  1WJE A;  5LGU A;  4LK0 F;  5TJJ A;  5EG0 B;  2O8K A;  1DGW Y;  3OYL A;  4HX7 A;  2OC6 A;  4BHP A;  5HOD A;  1JKR C;  2PJR A;  2L7Z A;  5AIQ A;  2CW8 A;  3MZH A;  4GDF A;  1JKQ C;  2XPW A;  3Q0U A;  2AXT C;  2OU2 A;  3EYY A;  3TO9 A;  4HRI A;  4LJZ F;  2A5W A;  3M8E A;  2ZXJ A;  3WHB A;  2Z5U A;  1KQ9 A;  2B7E A;  3DU5 A;  2JWT A;  5E79 C;  1D1C A;  4M74 A;  3S2D J;  1K4S A;  2ZNZ A;  1SAU A;  3ERM A;  5ICG A;  3KP2 A;  5FKM A;  4AVP A;  2P4W A;  4O3M A;  1HW2 A;  2LY9 A;  3M07 A;  2H8R A;  2DQL A;  2RN7 A;  5FJ8 J;  2LNB A;  2VLA A;  1GV5 A;  1WJD A;  1U78 A;  1KON A;  3AG3 H;  4MNU A;  3GBG A;  1EA3 A;  2YS9 A;  1FMV A;  1FOW A;  5E1W A;  3M8J A;  2XGC A;  1MD0 A;  2GOX B;  3OYA A;  1IV6 A;  3OYD A;  1Z7U A;  2IS2 A;  2OPT A;  2M2E A;  2YUS A;  2XF6 A;  2CU7 A;  3S3M A;  3C1D A;  2CQN A;  3ZMD A;  3IKT A;  2FMY A;  2GQQ A;  2X9D A;  3SFZ A;  1DQU A;  3GFI A;  4XK4 A;  4AIJ A;  1KU9 A;  1FBQ A;  1ZAR A;  3DCF A;  1MGT A;  1WI9 A;  3E0J B;  3F9K A;  4Q47 A;  3L2Q A;  1TLH B;  3BT9 A;  2VUM J;  3F22 A;  1P4W A;  3KP7 A;  2YR2 A;  4RBO A;  3HL2 A;  4XOP A;  3BJO A;  3GTM J;  1OR7 A;  1JUS A;  3DLL F;  2HZD A;  1ZRF A;  3PL8 A;  5HDN A;  1B4A A;  3HUG A;  2OBP A;  2HDD A;  4D0P A;  3K9T A;  2GIZ A;  3C2B A;  3W2V A;  3H35 A;  3LFK A;  2WAQ A;  3N05 A;  3V7S A;  1T2K A;  1V5F A;  1P92 A;  3FXO A;  1XGS A;  1LEA A;  2DA2 A;  5JR3 A;  2Y69 H;  1MMS A;  2MH2 A;  2RC4 A;  1W0T A;  1W36 C;  1JGG A;  1W7P B;  3FWE A;  3QU3 A;  1J5Y A;  4XLF A;  3WTX C;  1RRJ A;  2NS0 A;  4A6E A;  4IEJ A;  2WV1 A;  3LA3 A;  4E70 A;  3HC7 A;  3AL0 C;  2ZXH A;  2BGC A;  3C18 A;  3AG2 H;  3BTJ A;  1H8A C;  4C2T A;  3HOS A;  1P4A A;  2TRT A;  2NS7 A;  5CPR B;  3K0L A;  1Z0X A;  1MBE A;  3PNT A;  1QHH D;  4DIQ A;  4Y13 A;  2UUZ A;  2HOS A;  3PM1 A;  1DP3 A;  2DXI A;  3K2A A;  3CME I;  3CUQ C;  2LRE A;  2DA4 A;  2Y0S N;  3IC7 A;  3FHN A;  4CO8 A;  2P0W A;  3B6A A;  2QM3 A;  4XN3 A;  3E3V A;  1MDM A;  2JN6 A;  2DI3 A;  3ZQC A;  1DU6 A;  1UEL B;  2KRH A;  2R5Z B;  2VQH A;  2ZJP F;  2DN0 A;  5JVG F;  3FM3 A;  3V7C A;  1G6N A;  3AG4 H;  4J19 A;  1U8R A;  1ZH5 A;  4PJJ A;  1W5T A;  3FXR A;  1WPK A;  1BC7 C;  2ZO4 A;  4Y3O A;  1PUE E;  4X0G A;  4AM3 A;  3FKI J;  3BG3 A;  3JRI A;  1VQM I;  2Y48 A;  1TWA J;  3T0Y A;  4HNT A;  4LK1 F;  1S7O A;  2H8W A;  3ABU A;  3BQY A;  2XPV A;  3BCB A;  2FQ4 A;  4YIF A;  1FYL A;  1IAW A;  3K69 A;  2HNH A;  3DBL B;  1S7E A;  2BY2 A;  2LKS A;  3SXY A;  2R7O A;  1DDN A;  2D5V A;  3G2B A;  3OOP A;  5CVU A;  1XSX A;  2EFO A;  2IEK A;  4P9U A;  2K9M A;  1Z6R A;  2ZME A;  3ASN H;  2OA4 A;  1U8B A;  2EH3 A;  1WI3 A;  2PQ8 A;  4KN7 X;  3K1M A;  5CVV A;  3TDU C;  3H9Q A;  3WHC A;  5J8C A;  4BE0 A;  1D8K A;  4XLE A;  1SD5 A;  1W36 D;  3CES A;  4BXF A;  2NRA C;  3L1P A;  3I54 A;  1I3Q J;  4ZTF A;  1YG2 A;  4YEL A;  4L0Y B;  3JRC A;  3SEQ A;  2EQR A;  2Q8K A;  4UUV A;  3DPL C;  3H1C A;  2F5D A;  1XGN A;  2BW3 B;  3L09 A;  5EYR A;  1R71 A;  2MD0 A;  3CCU I;  3ZN1 A;  5GAD J;  3C2H A;  1HKQ A;  1G3T A;  5E1Z B;  4ENN A;  3QRF F;  4UUS A;  2OQR A;  3IL2 A;  1Z05 A;  1B72 A;  6PAX A;  3FZV A;  1IRF A;  3GZN B;  1A04 A;  4OU0 A;  4RA2 A;  3OMY A;  1HDD C;  1XSD A;  1V55 H;  5DYM A;  3CCE I;  2EV0 A;  5A2Q Z;  1W5S A;  2ECC A;  4LLG F;  3REO A;  4Y33 A;  5CQG A;  1Y1W J;  1Y56 A;  4RAZ A;  2WAD A;  1WWX A;  3LFU A;  1FLI A;  2LSO A;  2I5U A;  2QSG X;  3ZQL A;  2FBK A;  4EM0 B;  4JBA A;  5LLQ A;  1OYI A;  5FKL A;  4GFB A;  3A1Y A;  2P5L C;  4PFO A;  3DXJ F;  5BMZ A;  1VQP I;  3F8M A;  2CQ7 A;  4QSH A;  1X58 A;  3GVA A;  1UHW A;  1YIT I;  4F91 B;  2QBY A;  1FC3 A;  2NVU B;  1T0F C;  5J40 A;  4IHX A;  1TW2 A;  2F48 A;  1MMN A;  2VQG A;  1SFU A;  5M3F J;  1IGN A;  2ID3 A;  1LFP A;  4A0Y A;  4DGW B;  3QOD A;  1VF9 A;  1E2X A;  2DOD A;  2HGC A;  1QNT A;  2K3F A;  2Q2E A;  1MBG A;  3I58 A;  3MFK A;  1YFH A;  2P5K A;  4E7I A;  2K9L A;  2XB0 X;  5FLM J;  1W1W E;  1XC5 A;  5H2F C;  4IHS A;  3GFM A;  3R6S A;  4A3M J;  2FD5 A;  4HF1 A;  2KP6 A;  5D6F A;  4HNV A;  3L2R A;  2LR8 A;  1B9M A;  2DK5 A;  4HPQ A;  3H3Z A;  2DFF A;  4KT5 C;  5AIP A;  5K5O A;  3P9K A;  3IV5 A;  3D5R C;  4KIB A;  3S17 J;  4RLQ A;  3V8K A;  1RPW A;  3B02 A;  1GV2 A;  3KYD B;  1ZGJ A;  1REP C;  5ED4 A;  1GT0 C;  1FBU A;  3J7A Y;  1ZR2 A;  4IOC F;  1KU2 A;  4LIU A;  3I9V 2;  1VTN C;  3ZQH A;  1G2H A;  4U0Y A;  2KRF A;  2WA0 A;  1G3W A;  2MG4 A;  1R5G A;  4L0Z B;  3TO7 A;  2VBX A;  4E6K G;  3A2K A;  5F64 A;  5C44 J;  1RKT A;  4Z6Y A;  3MWM A;  3ZMU A;  3ZQG A;  2YX4 A;  3FBN B;  4BY7 J;  1TTY A;  2DA7 A;  5J1R A;  2F5V A;  1R1U A;  3JTG A;  5KK1 A;  1TWH J;  2CFO A;  2BHY A;  3OR1 C;  2V6C A;  5JLX A;  2DOF A;  4XLN F;  2IA2 A;  3HRS A;  2BVM A;  3BTC A;  4EJU A;  1L3L A;  1X1C A;  4YG2 F;  3OYB A;  3DV8 A;  1HBX G;  2N8G A;  4M3G A;  2A61 A;  1UG2 A;  2K86 A;  4PJL A;  3K2Z A;  1TC3 C;  3O3K A;  2R7T A;  3L2C A;  2YU9 J;  4CYD A;  4F55 A;  3NAR A;  1MND A;  5L3C A;  3WE2 A;  4U88 A;  4IRH A;  2LF7 A;  3WTW C;  3CTA A;  2COB A;  2CFX A;  2BV6 A;  4CCN A;  5D5X B;  1WVR A;  1SVL A;  2K3P A;  1SD7 A;  4E7K A;  2JJ7 A;  2IGK A;  3HGG A;  1T38 A;  2Z3Y A;  2V26 A;  4OIN F;  3I4M J;  2LKX A;  4XLP F;  3FM5 A;  3O8H A;  5CQE A;  4XKB A;  2E7X A;  2X6O A;  2BOL A;  1ZGA A;  1MH3 A;  3BOQ A;  3I4N J;  2HKX A;  3I55 I;  4DQ2 A;  2JRM A;  1SMY F;  2QEN A;  3LOC A;  2K5C A;  4ZH4 F;  1VQK I;  3S14 J;  3QOE A;  1R6R A;  5CKT A;  4BDY A;  4JP0 A;  1R4N B;  5L3D A;  1YX5 A;  3DTE A;  2BHZ A;  3WOD F;  2EZH A;  4MHG A;  4Q4Z F;  3M4O J;  3OYK A;  1S9H A;  1AA7 A;  3HEF A;  3IH4 A;  2F5F A;  1A6Q A;  4BEH A;  3G1O A;  2GLO A;  2TDX A;  4J00 A;  2HDC A;  5E8G A;  4G7O F;  2Y9Z A;  2VQC A;  3CMY A;  2VON A;  3FXK A;  4M3B A;  4RM2 A;  3ZPL A;  2HVR A;  2OTL I;  3J80 Z;  4WK8 F;  1Z67 A;  2CQQ A;  3LSG A;  1SC7 A;  3HKZ A;  3OIQ A;  2XSJ C;  3BZK A;  2HQN A;  2DT6 A;  3VYU B;  1XPX A;  2DFE A;  3PUB A;  2OJE D;  3E5X A;  1U9O A;  3SZT A;  2M34 A;  5CVR A;  3WE3 A;  4NNJ A;  3TQN A;  1ORK A;  3NAU A;  4KIS A;  2AO9 A;  5HNF A;  4NHJ A;  2DDB A;  2VOO A;  2GBY A;  5DCM B;  4A3J J;  3H0G J;  4B4C A;  3JCU C;  5ICF A;  2RDP A;  4HAM A;  5LEK A;  1Q1H A;  3CJN A;  2HKO A;  2FEZ A;  1D5Y A;  4RAY A;  1XB4 A;  4H4K C;  5ICE A;  1WFX A;  3TKY A;  2LLK A;  5KNL A;  1YX3 A;  4B44 A;  3HJE A;  1O7L A;  4DYR A;  4XIC A;  1JTX A;  5B5E C;  2XF5 A;  4HF0 A;  3TED A;  3PIP F;  4OIQ F;  2HS5 A;  2HTJ A;  3JSO A;  4JK1 X;  1N78 A;  4O5V A;  4HLX A;  4I76 A;  5J4Y A;  3VSK A;  3M9A A;  2DA6 A;  2MLG A;  1WZ2 A;  2G7U A;  3LSJ A;  4HDV A;  1FZP B;  3I4P A;  2R7R A;  3HOT A;  4I98 B;  5F04 A;  2K9Q A;  4ENJ A;  2LMD A;  4HBL A;  5IP6 A;  2DAO A;  5EZH A;  1JKO C;  4IF4 A;  2DA3 A;  4Q48 A;  3QU6 A;  4E4H A;  3KFW X;  1I3A A;  2L2O A;  2Z1D A;  2L3D A;  1R1V A;  1QA6 A;  3GTG J;  2FE3 A;  2L4M A;  2QF7 A;  5IPA A;  1PP7 U;  2QSH X;  1YW7 A;  1MBJ A;  2WBM A;  2ESH A;  2VT2 A;  5J47 A;  3KLN A;  4QLC U;  2R92 J;  3PNV A;  1B59 A;  2AXL A;  5EGO A;  2CUZ A;  2XC7 A;  4M6V A;  2H94 A;  4L5E A;  4E7H A;  5E8I A;  2O03 A;  1FBS A;  1R00 A;  4LG3 A;  4A12 A;  5K5Q A;  1Y1V J;  3E6C C;  2P7C B;  2ZJQ F;  3GTO J;  2L7F P;  4F93 B;  2HWV A;  4BJT A;  3QP6 A;  4WF2 A;  2Y30 A;  1MH4 A;  2M8G X;  3HGY A;  4A5N A;  4BKX A;  3H9G A;  4ENM A;  3I64 A;  4PFP A;  1WKM A;  4G6Q A;  1PUF A;  1WQ2 A;  2DJI A;  2IGO A;  1GXQ A;  4M3D A;  3BZC A;  5LFA A;  1LVK A;  2PJR B;  2RRE A;  4M9Z A;  3HZJ A;  2LVS A;  1QO0 D;  1RR7 A;  2EPF A;  4D5C A;  1FIA A;  5GAG J;  4ZYE A;  4BQN A;  2VKH A;  9ANT A;  3S3O A;  3RYP A;  1HSJ A;  3KEO A;  2W48 A;  2O3F A;  3UNG C;  1ETQ A;  1X1A A;  5ILV A;  4YEJ A;  3ZGK A;  4AID A;  1T08 B;  1Y0U A;  2CG4 A;  3A4C A;  3F6V A;  1RC9 A;  2HFH A;  4X1E A;  1OCT C;  2XAG A;  3IRR A;  1VI0 A;  3KEQ A;  3J7Y J;  1ZK8 A;  3E5U A;  2F2E A;  4IQ4 A;  1YJW I;  2EZI A;  3HB9 A;  1BOB A;  1LQ1 A;  4RDU A;  3H9J A;  2ESN A;  3HSR A;  3VB2 A;  1R58 A;  2CWE A;  2M0M A;  3ABK H;  2CW7 A;  2PMH A;  3I0T A;  3HOW J;  4HSR A;  5L3G A;  4FE7 A;  3FK6 A;  1R9T J;  1P6R A;  2UWM A;  2WY7 Q;  2R7U A;  2X1D A;  5D5W B;  4YFX F;  4MQ9 F;  3H5R A;  4IJA A;  5DEQ A;  3JR9 A;  1W7P D;  1Y0N A;  2Y0S A;  1VQL I;  4KIG A;  4BHB A;  2ZXI A;  4ETS A;  1YQA A;  1RET A;  3WTU C;  5F1R A;  1R5I D;  2DQR A;  4IPA A;  3KYL A;  2W7N A;  1OYW A;  2BY0 A;  4CZC A;  5FLV A;  2NOG A;  2RNJ A;  2PG4 A;  5H6Q A;  3ULQ B;  5BS6 A;  1VQ6 I;  5H20 A;  3RIR A;  1UB9 A;  3VOD A;  2D1H A;  4CCM A;  1IJW C;  5CYV A;  1D8J A;  4CUG A;  3OYH A;  1MMD A;  3OYF A;  4KN4 X;  1WJB A;  5DS9 A;  1K78 B;  1ZYR F;  1IUF A;  1X4O A;  3PIO F;  2XGX A;  2JUG A;  3GFL A;  4KUM A;  3BTL A;  4UXN A;  3B73 A;  2K7L A;  2GIV A;  5CVJ A;  1WH5 A;  2KDZ A;  2O7O A;  1YS6 A;  2BY1 A;  4UVB A;  1YLF A;  2FX0 A;  3NWT A;  4CCJ A;  4XLH A;  3RYR A;  4CH7 A;  4ZTJ A;  4D7M A;  1IXS B;  2BEO A;  4FX0 A;  3F0C A;  1KU3 A;  1CF7 A;  1BJA A;  3F21 A;  1BI0 A;  5FRM A;  5TGT A;  1E17 A;  1G3Y A;  2ICW G;  2AQE A;  4BUP A;  3DP7 A;  1FY7 A;  4L5J A;  2HDW A;  5J1U A;  4AIK A;  1LFU P;  3EUH C;  1MBF A;  2HQ5 A;  3W6K B;  1MDM B;  2PEX A;  1ZKG A;  3FXM A;  3KZY A;  1A6I A;  1IN6 A;  2EA4 A;  3OL3 A;  1HDP A;  2V1D A;  1UHS A;  2HXI A;  2MGQ A;  1R7J A;  2C6Y A;  4CCO A;  4IO9 F;  2NVT J;  4D1Q A;  3K4M A;  3PO3 J;  1N25 A;  4AIH A;  2XAQ A;  1USS A;  3VEP A;  1OLT A;  3TP0 A;  3WG9 A;  3CC7 I;  4I7H A;  4C2U A;  2E60 A;  4UVA A;  3BJA A;  3VPR A;  4KJZ A;  3CUQ A;  4CGZ A;  3IWF A;  1R5H A;  3TDZ C;  4XSX F;  4GGG A;  3L2U A;  3DKY A;  1YJN I;  5B1A H;  2G9W A;  2Y2Z A;  3GFJ A;  4FAS D;  2ZME B;  5M5W J;  1WJ5 A;  4UVC A;  3RPU D;  2E2I J;  3N97 A;  1VQ7 I;  1AOY A;  2F5E A;  3JAM K;  1FOK A;  4D5F A;  2CGP A;  1QHG A;  4IKF A;  1IUY A;  3GME A;  3QYE A;  3HOV J;  4R8H A;  5KHD A;  3G73 A;  3CCQ I;  3K6G A;  1HOM A;  4BJ6 C;  2IW5 A;  1HC8 A;  5IYD J;  3DKX A;  4ESF A;  2E36 A;  1UJ8 A;  2Z9O A;  4FQG A;  3B6C A;  3QQA A;  5DD4 A;  4N0B A;  1B9N A;  1MBK A;  3CJT B;  2HU9 A;  3CJQ B;  3KPH A;  2DPD A;  2RVC A;  3E6D A;  4WXC A;  4V2G A;  4V2F A;  4UUS B;  4ZYH A;  5JHU A;  1B72 B;  2R7F A;  4P1W A;  4U0V A;  4DZJ A;  2PMZ N;  4MFE A;  3OYJ A;  4RB2 C;  2FUG 2;  3ZR8 X;  2CMP A;  2H09 A;  3PQJ A;  3QYB A;  2NOJ B;  1LUJ B;  1JT0 A;  2HVQ A;  3COA C;  2HQA A;  4HW0 A;  4LG0 A;  2MAB A;  1K79 A;  1OKR A;  2WAF A;  4UV9 A;  1IRX A;  2WB1 A;  4UNO A;  3GTJ J;  1XG1 A;  2E35 A;  1JI8 A;  1L0O C;  2OQG A;  3CC2 I;  1HW1 A;  1WCM J;  3BR1 A;  1NTC A;  1GVJ A;  5JLW A;  4EV0 A;  2QBY B;  1A31 A;  1OJL A;  2KQR A;  3I53 A;  3RQI A;  4RGR A;  4ZC3 A;  1S7A A;  4CCL A;  3U1D A;  2FQ3 A;  2Q2E B;  3JW4 A;  3SJM A;  3S2H J;  4II2 A;  5DDG A;  4I0A A;  4B3A A;  4PUS A;  2M30 A;  1ITY A;  3WTY C;  2P6T A;  4OIP F;  1J9I A;  1DPU A;  1XN7 A;  3GTP J;  2YSR A;  4EGZ A;  1QPI A;  3R61 A;  3O2P E;  2VN2 A;  2OF7 A;  4B48 A;  4FX4 A;  1WGX A;  1JXS A;  2DYR H;  1IXC A;  1ZRD A;  1PDN C;  2MC4 A;  2ZFW A;  3OWT A;  2E5N A;  4V19 K;  1IO2 A;  3KP5 A;  1K78 A;  1KYW A;  2FU4 A;  5LBQ A;  1C0W A;  2MSY A;  2JT1 A;  2LDU A;  3RJP A;  2F6C A;  3J7Z I;  3HG9 A;  3TGN A;  4IZZ A;  3ZMS A;  5L3F A;  1SAX A;  1K6Y A;  4FIS A;  1O4X A;  1ERD A;  2FML A;  1ON1 A;  1ZEL A;  2LKP A;  2W84 A;  1QPM A;  3NQO A;  3GYH X;  3LQQ A;  4S04 A;  2I10 A;  4M71 A;  1OCC H;  3M7G A;  3JRF A;  3OYC A;  3PSF A;  4N4N B;  1TW3 A;  5EEH A;  4YII A;  2VBW A;  2X1C A;  5J6X A;  2V7F A;  5CJ9 A;  1A5J A;  2NAZ A;  2L0K A;  3NWS A;  1D0Y A;  1U2W A;  2CS3 A;  2DJN A;  3H3V K;  1HW5 A;  1OIS A;  3BP8 A;  5KVR A;  3OL4 A;  4BE2 A;  2QA4 I;  1B1B A;  1X1P A;  4XQF A;  5FGM A;  1O3S A;  4EGY A;  2UXN A;  3Q0V A;  4MTE A;  4QTR A;  3CF5 F;  4G7H F;  4RGX A;  5IT3 A;  2DFH A;  2HPI A;  2VE9 A;  3HOX J;  1ACI A;  1UFM A;  3EYI A;  2EV6 A;  5DUI A;  5HNH A;  5F0H A;  4XRM A;  3RTR A;  3GTK J;  1BI3 A;  3CDL A;  2P7V B;  4OMY A;  3S8P A;  3MZ8 A;  2A3S A;  3MKW B;  3ZQI A;  1MNE A;  2LY1 A;  2NYX A;  4GYI A;  5A2Q K;  2IXS A;  4CYC A;  4LB5 A;  4IX7 A;  4RB3 C;  1V54 H;  2X1E A;  3GO5 A;  1JKP C;  4ZDL A;  3HRM A;  5K7F A;  2YU3 A;  3O8G A;  3RZD J;  2R5Y A;  5K7Z A;  3BR2 A;  4A3L J;  2CSO A;  1NH3 A;  4ESJ A;  4BEH B;  1YE9 A;  4A3I J;  5GTI C;  2H27 A;  3LQR A;  4FCY A;  5LHH A;  5LRR A;  2OTJ I;  2JK3 A;  4ANJ A;  1IDY A;  2DPU A;  2E34 A;  4N9H A;  4WXD A;  2IJL A;  1X2M A;  3K4B A;  2L9N A;  3ZP5 A;  3W2W A;  3M1C A;  1HKS A;  2JTV A;  1Z7L A;  3LSH A;  4BYY A;  3U2R A;  1OPC A;  2ZCW A;  4RS8 A;  3ZN0 A;  4YIR X;  3D5L A;  3PJR A;  1GHC A;  1ZGW A;  3JRE A;  1YI2 I;  1E3P A;  2R7V A;  1U5T A;  2R7W A;  3QOP A;  1EJ9 A;  5ILU A;  2CUJ A;  5TIS C;  3OIO A;  4F3Q A;  1X19 A;  2MC3 A;  5GPC A;  2HZT A;  3A01 A;  3QPH A;  1Z3X A;  2W00 A;  4PCQ A;  3CDH A;  3W2A A;  2Q1Z B;  1W4M A;  4ZJZ A;  2EB7 A;  2X48 A;  4FET A;  4IHV A;  2BYV E;  2K85 A;  3GZ6 A;  1LJ9 A;  1YIJ I;  1H89 C;  2I8D A;  2DMN A;  2ADU A;  3QP5 A;  4AU7 A;  1Y6I A;  4CCK A;  1VQO I;  4BXX J;  1I6H J;  4GYG A;  4B09 A;  5JFR A;  1OR7 C;  4I02 A;  2FA5 A;  3ZQQ A;  1ZRE A;  2GWR A;  3M8F A;  2V79 A;  1D1A A;  2K9N A;  5E3N A;  5LEJ A;  1PP8 F;  4DOZ A;  4BJ5 C;  3K4N A;  2ZFU A;  4EJT A;  2UZK A;  2V1X A;  2MH9 A;  2XIG A;  4KYW A;  2DOE A;  2IAI A;  3HHG A;  2QKM B;  1W0U A;  4DYQ A;  3I5U A;  4MIM A;  3LST A;  1N75 A;  2M1B A;  4XN0 A;  1ZG1 A;  2IS6 A;  2LRD A;  4Y17 A;  5EGO B;  4M6X A;  2A05 A;  3ML6 A;  2VC0 A;  1VFC A;  1BI2 A;  1G3S A;  2CUF A;  4E7S A;  4C2M J;  1QZY A;  2Y75 A;  1GLN A;  1TQP A;  2KLO A;  1U9N A;  3FKJ A;  3R0A A;  5IT9 Z;  2EIK H;  2WY8 Q;  2L01 A;  4XLA A;  3ABM H;  4BHC A;  2NXN B;  1GXP A;  2CQX A;  4ASN A;  3E97 A;  2W4S A;  1OCZ H;  1QVT A;  5E1X A;  5FFZ A;  2EWN A;  4C3H J;  1FOY A;  3K7A J;  1PUF B;  2Z99 A;  4BQQ A;  4IL6 C;  2P8T A;  1HF0 A;  4IRG A;  1SMT A;  2GAU A;  5IOZ A;  5JHF A;  5FLX K;  2QSF X;  3M3Y J;  1MSE C;  3V42 A;  4EMS A;  4OAZ A;  2KHM A;  4FHT A;  3IAS 2;  3IKV A;  2GZW A;  1P4X A;  1ETV A;  3C3W A;  4P9F A;  3SYT A;  4I6Z A;  1P7J A;  1MJB A;  1T56 A;  1ZG3 A;  1FMW A;  4U7B A;  2Y0M A;  2JMW A;  4RM3 A;  3KZZ A;  4M72 A;  1YRN A;  3KCC A;  4IVN A;  1GDT A;  1XX5 A;  2E5Z A;  5IYB J;  5D8L B;  1HA8 A;  4DJA A;  1V5E A;  2BVL A;  2ZME C;  2D2W A;  1HST A;  1J09 A;  1FWZ A;  1IN5 A;  3HDD A;  3R0J A;  1T98 A;  2O9L A;  3P9C A;  1PJR A;  3OYM A;  1HQC A;  3CO7 C;  2ELJ A;  1KQ8 A;  2VJ5 A;  2ISZ A;  3ZMZ A;  1EF4 A;  2JA2 A;  4G6D A;  4Z2Y A;  2B63 J;  3WU0 A;  4F7Z A;  5FKO A;  2HTS A;  4AD9 A;  2WAQ N;  2VL8 A;  2CV0 A;  2EFQ A;  3H36 A;  5BQT A;  2BE5 F;  1IN4 A;  3DQV C;  3L9F A;  1WJC A;  2P6S A;  2ZSI B;  2BXZ A;  2QYO A;  2JZY A;  1JUP A;  2OAZ A;  3LL7 A;  2H6C A;  1RES A;  2E1M B;  2EBI A;  4XKV A;  3D1N I;  3BZ6 A;  4NUB A;  4RMN A;  4OOI A;  3MMY B;  5FKN A;  3FIW A;  5K1Y A;  1RI7 A;  4RAG A;  5J4V A;  4LMY A;  5E3L A;  1E0E A;  3OY9 A;  2VAS A;  4NQW A;  2IS1 A;  3TP3 A;  4BBS J;  1IXR C;  2LFB A;  2VJI A;  1LB2 A;  3MVP A;  2F4I A;  3K4C A;  3IH3 A;  2VPR A;  2XKP A;  4AYB A;  3FBI B;  5KCM A;  2X6Y A;  5B1B H;  4PJN A;  5J1Y A;  1BR2 A;  3J81 K;  3G6E I;  3Q9V A;  5K5R A;  2VJ4 A;  4CDG A;  4AVZ A;  2J5O A;  2KRC A;  3SDB A;  3CCL I;  1CF7 B;  2E1O A;  5DTD A;  4HQM A;  1VQ4 I;  2M8E A;  2RGV A;  5F6F A;  3CCR I;  4XSZ F;  1JTY A;  4ZYD A;  5HOO A;  4ZYA A;  2WC2 A;  5M3M J;  3C2G A;  1MIJ A;  2V1U A;  2CW0 F;  1F36 A;  4IHW A;  4O6J A;  1FP2 A;  5FFX A;  1NHA A;  1S5L C;  2K4B A;  4WWC A;  4L18 B;  3M1E A;  4ZDO A;  5FKK A;  3PFI A;  2STT A;  3JSP A;  3VOE A;  1BR4 A;  1OCR H;  3DF8 A;  3ERE D; 
#chains in the Genus database with same CATH homology
 2VI6 A;  2DA2 A;  1DU0 A;  5F08 A;  1ETY A;  3BTI A;  1W0T A;  2XGE A;  3S1M J;  1HLV A;  2QCO A;  1JGG A;  1E3O C;  4XRS G;  5J1U A;  1K61 A;  1LFU P;  3PO2 J;  4IEJ A;  1MBF A;  2HQ5 A;  2WV1 A;  1MNM C;  1ZKG A;  1QVU A;  1A6I A;  3BTJ A;  5IP7 J;  1H8A C;  4ABZ A;  1IC8 A;  2TRT A;  2NS7 A;  1Z0X A;  2HOT A;  1MBE A;  2JA7 J;  2LK2 A;  1HDP A;  1B8I B;  1UHS A;  2HXI A;  2MGQ A;  2HOS A;  3PM1 A;  3K2A A;  2LTP A;  4C3I J;  2NVT J;  1CQT A;  2DA4 A;  2DTZ A;  2Y0S N;  1BA5 A;  3PO3 J;  3S15 J;  3B6A A;  4A69 C;  1UMQ A;  3TP0 A;  2WB1 N;  2JN6 A;  3ZQC A;  1DU6 A;  2R5Z B;  3VPR A;  1BW6 A;  2DN0 A;  3JRG A;  1B8I A;  4MLO A;  4NDL A;  4J19 A;  2H1K A;  1WPK A;  3G1L A;  2Y2Z A;  4DW6 A;  5M5W J;  3FKI J;  3BG3 A;  3JRI A;  1ETX A;  4LOC A;  4QIW N;  2DMT A;  2E2I J;  1TWA J;  2XB5 A;  1VND A;  4D5F A;  3BQY A;  2E2J J;  4X6A J;  4IHY A;  2XPV A;  3IH2 A;  2FQ4 A;  1MBH A;  3HOV J;  1BW5 A;  2R5Z A;  5IOY A;  2M0C A;  1S7E A;  1HOM A;  5IYD J;  1IRZ A;  2D5V A;  2TCT A;  2L7M P;  3E7L A;  3B6C A;  3BG9 A;  3QQA A;  2IEK A;  4Y7N J;  1MBK A;  1U8B A;  2EH3 A;  1WI3 A;  4V2G A;  4V2F A;  2EZL A;  1X2N A;  3WHC A;  4UUS B;  4A93 J;  1B72 B;  2IBD A;  3SFI A;  4XID A;  4DZJ A;  2PMZ N;  4MFE A;  3L1P A;  1I3Q J;  4M3E A;  5GP9 A;  3JRH A;  3JRC A;  3JRA A;  3ZOB A;  1JT0 A;  2EQR A;  4AC0 A;  3S1N J;  5EYR A;  1NK3 P;  3CQZ J;  3BR3 A;  3GTJ J;  4UUS A;  1XG1 A;  1B72 A;  3BQZ A;  1HDD C;  1WCM J;  3BR1 A;  1FTT A;  1NTC A;  4C3J J;  2EZK A;  5JLW A;  2XGD A;  1OJL A;  4DYC A;  1Y1W J;  2ECC A;  3RQI A;  2CJJ A;  2ZB9 A;  5GPA A;  2DA1 A;  3G1M A;  4W1U A;  3QPL A;  3JRD A;  3SJM A;  3S2H J;  3BR5 A;  3ZQL A;  4FE4 A;  4B3A A;  1ITY A;  5FKL A;  4GFB A;  2JA5 J;  1P7I A;  3GTP J;  2AHQ A;  1QPI A;  4MO7 A;  4QSH A;  2GM4 A;  1X58 A;  4A3D J;  2OF7 A;  1WGX A;  4JYK A;  4IHX A;  3OOU A;  4A3F J;  2L9R A;  4A3K J;  5M3F J;  1IGN A;  2ID3 A;  5IYC J;  5F0C A;  5C4X J;  1VF9 A;  2P81 A;  2KT0 A;  1MBG A;  4JX6 A;  2HYJ A;  1OFC X;  2VKE A;  2XB0 X;  5FLM J;  1XC5 A;  2MSY A;  4A3M J;  2FD5 A;  1ETO A;  4HNV A;  5E3M A;  2LR8 A;  5F27 A;  2R93 J;  2XRL A;  4FIS A;  1O4X A;  2K9S A;  1NK2 P;  3IV5 A;  1WH7 A;  2DMP A;  2K40 A;  2I10 A;  3S17 J;  2ME6 A;  1RPW A;  3JRF A;  1GV2 A;  1IG7 A;  1GT0 C;  1Q1V A;  1ZR2 A;  3A03 A;  1TWG J;  2M9H A;  1AU7 A;  1A5J A;  3BG5 A;  1G2H A;  3ZQH A;  3FIS A;  2L0K A;  4A3G J;  2DJN A;  1ETK A;  2MG4 A;  3H3V K;  2E2H J;  2JA8 J;  1XS9 A;  1BJZ A;  5C44 J;  1RKT A;  2LP0 A;  4CYC B;  3ZQG A;  4BY7 J;  5J1R A;  2DA7 A;  5M5X J;  3GTQ J;  3Q0V A;  4QTR A;  2E19 A;  1TWH J;  2NVY J;  5JLX A;  1OCP A;  3HOX J;  3HKZ N;  2R5Y B;  5F0H A;  3BTC A;  4XRM A;  3GTK J;  3CDL A;  1ZR4 A;  2RAE A;  2N8G A;  2HOA A;  4M3G A;  4BBR J;  1UG2 A;  2XPU A;  1TC3 C;  4BY1 J;  3ZQI A;  3SDG A;  1TWC J;  4S0H B;  4CYC A;  2YU9 J;  1POG A;  3NAR A;  1FEX A;  3TW7 A;  1JKP C;  4AUX A;  1HCR A;  2COB A;  5K7F A;  1T33 A;  5EZG A;  1FIP A;  3O8G A;  3RZD J;  1TWF J;  1APL C;  2R5Y A;  2JJ7 A;  5K7Z A;  3HGG A;  3JRB A;  3BR2 A;  4A3L J;  3HOY J;  3I4M J;  2LKX A;  1JUM A;  3O8H A;  2X6O A;  4A3I J;  1RKW A;  3S1R J;  5E3O A;  1MH3 A;  3I4N J;  1JT6 A;  2Y9Y A;  4FCY A;  2XSD C;  4UUT A;  2JK3 A;  2NS8 A;  3S14 J;  3LOC A;  1IDY A;  3TW6 A;  2R7Z J;  1X2M A;  4JP0 A;  4M3F A;  5K7H A;  4JX4 A;  3A01 B;  3LSR A;  2EZH A;  3M4O J;  4A3B J;  3HEF A;  3IH4 A;  1ZGW A;  2GLO A;  3G1O A;  3JRE A;  3S1Q J;  1LFB A;  3ZQF A;  2HXO A;  2Y9Z A;  3CMY A;  3MN2 A;  4M3B A;  3OIO A;  5GPC A;  2CQQ A;  2Y31 A;  3LSG A;  4Y52 J;  4JX5 A;  3A01 A;  2X48 A;  4IHV A;  1IDZ A;  1U9O A;  2M34 A;  1ORK A;  3NAU A;  2AO9 A;  1H89 C;  5BNG A;  2DMN A;  2GBY A;  1FJL A;  4A3J J;  4BXX J;  1I6H J;  3HOU J;  1FTZ A;  2DA5 A;  3H0G J;  4B4C A;  4EEF G;  3CCY A;  5IP9 J;  1MSF C;  1D5Y A;  2K9N A;  5E3N A;  4D7N A;  2LLK A;  4DYR A;  4XIC A;  1JTX A;  3TED A;  1H88 C;  2IAI A;  3Q3S A;  1GVD A;  1W0U A;  2ECB A;  4DYQ A;  2DMU A;  4I76 A;  4MIM A;  2DA6 A;  4XRS A;  1K83 J;  5EGO B;  3LSJ A;  2VKV A;  1GUU A;  1VFC A;  2CUF A;  4C2M J;  2ID6 A;  5F04 A;  2K9Q A;  5IP6 A;  5EZH A;  2ELK A;  1JKO C;  1QRY A;  1U9N A;  2DA3 A;  1AKH B;  3DEW A;  2FJ1 A;  3GTG J;  3A02 A;  2QF7 A;  5IPA A;  3FK7 A;  1MBJ A;  2CQX A;  2R0Q C;  2R92 J;  1QVT A;  3LSP A;  4C3H J;  5EGO A;  1JJ6 C;  4M6V A;  5C4J J;  3K7A J;  1PUF B;  4L5E A;  1HF0 A;  1Y1V J;  4MFD A;  1YRN B;  3GTO J;  5IOZ A;  2L7F P;  1AHD P;  1AKH A;  1Z77 A;  2HI3 A;  1MSE C;  3M3Y J;  3RKQ A;  1LE8 B;  1ZTR A;  2Y30 A;  1MH4 A;  2JA6 J;  1ETV A;  3BR6 A;  3Q0W A;  4I6Z A;  1P7J A;  2M8G X;  3HGY A;  5F1J A;  4AYB N;  3OSF A;  4BKX A;  2DMQ A;  1T56 A;  2ME0 A;  2MW8 A;  1PUF A;  1ENH A;  2JMW A;  4M3D A;  1JJ8 C;  1YRN A;  4W97 A;  1GDT A;  2LVS A;  5J3L A;  5C3E J;  1RR7 A;  4D5C A;  1FIA A;  9ANT A;  5IYB J;  3HBL A;  5EEA A;  1LE8 A;  2LD5 A;  5F0F A;  3LNQ A;  3UKG A;  5M5Y J;  2W48 A;  1BL0 A;  1SAN A;  3S16 J;  3HOZ J;  3HDD A;  2O9L A;  1ETQ A;  1I50 J;  1EF4 A;  5EG0 B;  2O8K A;  4X1E A;  2B63 J;  1OCT C;  1VI0 A;  5HOD A;  1JKR C;  5FKO A;  1ZK8 A;  1ZQ3 P;  2L7Z A;  2EZI A;  2WAQ N;  3HB9 A;  4RDU A;  1F43 A;  1JKQ C;  2XPW A;  3Q0U A;  3QPS A;  3WHB A;  3HOW J;  1JUP A;  3D1N I;  1SFO J;  1RES A;  4FE7 A;  2EBI A;  3FK6 A;  3HM5 A;  2JWT A;  1R9T J;  3S2D J;  5FKN A;  3FIW A;  5EG0 A;  5FKM A;  3JR9 A;  2NVQ J;  2G0E A;  2LY9 A;  2CUE A;  5E3L A;  2H8R A;  5EF6 A;  5FJ8 J;  3W6V A;  4DZP A;  3TP3 A;  1GV5 A;  1RET A;  1U78 A;  4BBS J;  2LFB A;  4FTH A;  3GBG A;  3RZO J;  2YS9 A;  5FLV A;  3MVP A;  2NOG A;  4G12 A;  3IH3 A;  2VPR A;  4A3C J;  2XGC A;  1IV6 A;  5J1Y A;  2OPT A;  2M2E A;  2YUS A;  2CU7 A;  1IJW C;  2CRG A;  2E1O A;  2X9D A;  5DTD A;  5DS9 A;  4XK4 A;  4A3E J;  3GTL J;  3OSG A;  3DCF A;  1IUF A;  1JTY A;  3MKL A;  5M3M J;  3BR0 A;  5EDN A;  4B1R A;  3BTL A;  3BT9 A;  2VUM J;  4RBO A;  1F36 A;  3GTM J;  1WH5 A;  2KDZ A;  1JUS A;  2O7O A;  4IHW A;  2FX0 A;  2HDD A;  5FKK A;  3C2B A;  4D7M A;  1ETW A;  3F0C A;  2NVX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...