4A3FJ

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3fJ00
3BR5A 3M3YJ 2DA1A 1PUFA 1BJZA 3M4OJ 1O4XA 2K9QA 1GV2A 5M5WJ 4AC0A 2X48A 3H3VK 1P7IA 4XRSG 5EF6A 3JRAA 2K9NA 1SANA 3G1OA 2H1KA 5EGOA 4W97A 3HEFA 1FJLA 2M8GX 3D1NI 3BR1A 2DMNA 5M3FJ 3LNQA 1NTCA 3MN2A 5GP9A 4AUXA 1BL0A 1K83J 5EZHA 1ITYA 2XSDC 2FX0A 1JTYA 2JA6J 3S2DJ 4BY7J 3BTCA 2XGDA 1MBFA 4UUSA 3OOUA 5IOZA 2CJJA 2LY9A 2HOTA 4FE4A 1JT6A 1BA5A 3BT9A 4QSHA 1A5JA 2LFBA 1HF0A 4GFBA 5F08A 3K7AJ 3HOWJ 1G2HA 3IH2A 5J3LA 2YUSA 3S16J 3MKLA 2JWTA 2MSYA 1PUFB 1WH5A 1XG1A 1H8AC 4BBSJ 2VUMJ 1GDTA 4BKXA 1DU6A 5IPAA 3F0CA 5EDNA 1ZGWA 5C4XJ 5IYDJ 2ID6A 1NK3P 2WB1N 2DA2A 3TEDA 2OF7A 2LKXA 1ZQ3P 1VI0A 4DW6A 2JA5J 3S15J 5EGOB 1YRNA 2LP0A 5GPCA 1TWGJ 4D5FA 3PM1A 1MBGA 2DMQA 2DMTA 2ME6A 9ANTA 1ETYA 1MNMC 1TWCJ 4A3BJ 3I4MJ 3Q0VA 2IBDA 5EEAA 5DTDA 2Y9YA 4X1EA 4BBRJ 2NVQJ 1HOMA 5IOYA 4DYCA 4MFEA 1RPWA 1RKTA 3BG5A 4UUSB 2EZLA 4M6VA 2DA6A 5EYRA 1A6IA 1MH3A 5F0HA 4FTHA 2EQRA 2NS8A 3HGGA 4JP0A 1Z0XA 2L9RA 2R5ZA 3S1RJ 2O7OA 4G12A 4DYRA 3LSRA 3RZDJ 3S17J 2EZIA 4D5CA 5FKNA 2EH3A 3HB9A 3TW6A 3G1MA 1VFCA 2DMUA 4J19A 1GUUA 3BG9A 4M3GA 4BY1J 4C3JJ 1HDDC 3MVPA 1MBEA 1MSFC 3BR6A 4MO7A 2Y9ZA 1JKPC 1I6HJ 2E2JJ 1WGXA 3HOVJ 4JX5A 4I76A 5FJ8J 4ABZA 4HNVA 2CU7A 3HM5A 3K2AA 5F27A 1F43A 3S1NJ 3NARA 2COBA 3JR9A 4RDUA 2R92J 3HOUJ 4LOCA 1AHDP 4A3LJ 2FJ1A 3SDGA 4IHYA 1JJ6C 2HQ5A 2KDZA 2IEKA 4FISA 1FIAA 5E3LA 3HBLA 2XPWA 5IP7J 3QPSA 1SFOJ 1QPIA 1X58A 1JT0A 5M5XJ 2NVTJ 4IHWA 2MW8A 5IP9J 1X2MA 1I50J 2K40A 3LSPA 3FISA 2XRLA 2CUEA 1AU7A 3GTQJ 2JA7J 3OIOA 4V2FA 2R5ZB 2W48A 5M5YJ 1QVUA 3HOXJ 1Y1WJ 3OSFA 1RR7A 2M2EA 2R93J 2PMZN 2D5VA 2E2IJ 4XRSA 2LD5A 2HI3A 3H0GJ 2CQXA 2DA5A 3S14J 3ZQIA 3ZOBA 2ME0A 1IV6A 1TWHJ 3HOZJ 1BW6A 3BTLA 3GTJJ 2GLOA 3JREA 3GBGA 5JLXA 1S7EA 2ELKA 2TCTA 2MG4A 4S0HB 1TC3C 1Y1VJ 1JGGA 4CYCB 2M0CA 1IDYA 2ID3A 4A3FJ 4MFDA 2CQQA 2Y30A 3L1PA 3B6CA 2E19A 1Q1VA 4XICA 1IUFA 5K7ZA 3QPLA 5HODA 2HXOA 1HLVA 5K7HA 3A01A 2CUFA 1IDZA 1LFBA 1ETQA 2NVXJ 2N8GA 2VKEA 5C44J 2LR8A 2M9HA 4A3IJ 1WH7A 1OJLA 3E7LA 4D7NA 3RKQA 2X9DA 1MBKA 2MGQA 1JUMA 2IAIA 3FK6A 3RQIA 3JRFA 2R7ZJ 1FEXA 3Q0WA 1MBJA 1ENHA 3DEWA 4BXXJ 4Y52J 5GPAA 4A3DJ 1WI3A 1OCTC 2Y2ZA 1IGNA 2DN0A 4A3CJ 2RAEA 2OPTA 3FIWA 1TWAJ 3WHCA 3LSJA 3G1LA 3TW7A 2O8KA 1POGA 3JRHA 1APLC 3NAUA 1GT0C 5E3NA 1U8BA 1TWFJ 2NVYJ 3S1MJ 2Y31A 2R5YA 2DMPA 2XB5A 1RKWA 4QTRA 4XK4A 2L7ZA 3UKGA 3HKZN 1IRZA 1HCRA 2JK3A 1MBHA 2G0EA 1W0UA 5E3MA 2ZB9A 1U78A 2FQ4A 1JJ8C 3IH3A 3CQZJ 4DZPA 2EZHA 3A01B 4A3GJ 2JMWA 1P7JA 5C3EJ 1QRYA 1RESA 4XIDA 1JKQC 2H8RA 1BW5A 1DU0A 1ETKA 3ZQCA 1MSEC 5C4JJ 2EBIA 3ZQHA 4MLOA 1T33A 2P81A 1QVTA 4IEJA 3HOYJ 5K7FA 1YRNB 3JRGA 2KT0A 3GTMJ 3GTOJ 3BTIA 1ETXA 1VNDA 4MIMA 1R9TJ 2QCOA 2L7FP 4W1UA 4RBOA 2DTZA 4D7MA 5FKMA 2B63J 3BR3A 4AYBN 2GM4A 4FCYA 1FTZA 3HDDA 1XC5A 3GTGJ 1ORKA 1HDPA 4A3KJ 1XS9A 3FKIJ 5EG0A 2ECCA 3GTLJ 2WAQN 1OFCX 2E1OA 2JJ7A 3CMYA 3CDLA 2R0QC 4A3MJ 1JUSA 3GTKJ 1B72A 4A3JJ 3BR2A 4A69C 2HDDA 4C3HJ 3A03A 1T56A 4JYKA 4IHVA 4M3DA 1WPKA 4EEFG 2FD5A 1ZR2A 4M3FA 2LVSA 1H88C 2LK2A 1I3QJ 3PO3J 3Q0UA 3JRBA 1IJWC 2VPRA 3LSGA 4C3IJ 3TP3A 1UHSA 3ZQFA 1F36A 2L7MP 4IHXA 3BQZA 4B1RA 1ETVA 1FIPA 5DS9A 2XPVA 2XPUA 5M3MJ 3VPRA 3OSGA 5J1RA 3BR0A 5IYBJ 4UUTA 1UMQA 1AKHA 5FLMJ 1W0TA 1JKRC 2JA8J 1Z77A 3FK7A 2XGCA 1ZKGA 2LTPA 3Q3SA 2NOGA 1ETOA 2JN6A 5F0CA 1WCMJ 1U9OA 5BNGA 3SJMA 1EF4A 5EG0B 1U9NA 1LE8A 5EZGA 5JLWA 3HGYA 4C2MJ 5IYCJ 2VI6A 4L5EA 2X6OA 2HOAA 1MH4A 1B72B 3SFIA 4B3AA 3O8GA 1B8IA 4JX6A 4M3BA 2TRTA 1OCPA 3S1QJ 2M34A 3JRIA 5FKLA 2HXIA 2LLKA 1H89C 2YU9J 4NDLA 5J1UA 3IV5A 4A3EJ 3IH4A 2DA4A 2HYJA 3WHBA 3BTJA 3JRCA 1JTXA 2CRGA 5IP6A 4I6ZA 5F04A 2L0KA 3ZQGA 3LOCA 1ZTRA 5FKKA 3TP0A 3QQAA 2GBYA 1JKOC 5FLVA 2HOSA 3S2HJ 3BG3A 2ECBA 4B4CA 3ZQLA 3C2BA 1IG7A 2QF7A 3B6AA 4JX4A 2VKVA 1X2NA 2DJNA 1E3OC 1RETA 4DYQA 3O8HA 4DZJA 4M3EA 1AKHB 4XRMA 2O9LA 5E3OA 3PO2J 3JRDA 2AO9A 2NS7A 1CQTA 3CCYA 2E2HJ 3DCFA 4FE7A 5FKOA 1UG2A 2WV1A 1ZK8A 2DA7A 1LE8B 2I10A 2EZKA 4A93J 3RZOJ 2AHQA 1ETWA 1JUPA 3GTPJ 4V2GA 1K61A 1GV5A 2K9SA 1LFUP 1B8IB 1GVDA 4QIWN 3W6VA 5F1JA 5J1YA 3I4NJ 2YS9A 2Y0SN 4CYCA 1D5YA 1FTTA 4Y7NJ 1NK2P 2XGEA 1VF9A 1IC8A 5F0FA 3A02A 3BQYA 4X6AJ 1ZR4A 2R5YB 2DA3A 2XB0X
chains in the Genus database with same CATH superfamily
1W5SA 2OAZA 3HSRA 2K27A 5GAEJ 2DA1A 1SEUA 2QQBA 1SVMA 1I1GA 1TW2A 2EINH 3ABTA 5D4SA 4IVNA 2CV2A 5M5WJ 3S93A 1YX3A 1WKMA 2DAOA 2GA2A 1Z1DA 4LFUA 4CH7A 5JFRA 1MMNA 3QP5A 3R0AA 4FX4A 1EH7A 4LJZF 4UUVA 3H3VK 5LRRA 4XRSG 5JVGF 2H6BA 2F4OB 2P5VA 5EF6A 4UVCA 2KIMA 3FBNB 3DBRB 4B3XA 4ESFA 2OCCH 3ML6A 1FJLA 1W5TA 2M8GX 2LH9A 3H1CA 1GVJA 5M3FJ 3I54A 1U0JA 4PJMA 3KZYA 4MTDA 3V8JA 3LSMA 2QEXI 1P6RA 5CJ9A 2JVGA 4RS8A 1ITYA 3W6JB 2O3FA 2HQAA 3CF5F 1VTNC 4KMFA 3BTCA 2XGDA 1MBFA 3RTRA 1GLNA 2CJJA 3OYNA 2LY9A 3EYYA 4FE4A 1JT6A 2YX7A 4N4NB 2LFBA 4GFBA 3NWTA 1T8IA 3TDUC 3M07A 3GUDA 4NQWB 4QLCU 3LQRA 3GFLA 3O2PE 3I59A 1XMKA 4TV7A 3MKLA 3HL2A 1XG1A 2VT2A 4BBSJ 1YO5C 3WTXC 2VQCA 4U0WA 2A3SA 1N25A 3BP8A 3F0CA 5IPAA 3FXRA 2DW4A 3OS1A 5C4XJ 3GO5A 2RQQA 4UVBA 3HOTA 1DUXC 2ID6A 1Y8QB 1FWZA 3TEDA 2OF7A 5GAHJ 3K0LA 1ZQ3P 2Z9OA 2X6WA 1B9NA 3OR1C 2L9NA 1S3JA 2WBMA 4DW6A 3S15J 3C1DA 2G9WA 1YRNA 4PGGA 1TWGJ 5EEHA 1TNSA 1W7PB 3HRSA 1XSDA 3CTAA 3KP3A 4HF1A 2BY3A 4E6KG 2KDOA 3R60A 4A3BJ 3Q0VA 2CQNA 4AIKA 2VBZA 3I3LA 2BY0A 2W24A 2KISA 2L54A 4NC8A 4ESJA 3F23A 1R4MB 2Y9YA 5EJCA 3E5UA 3CLOA 1W36C 2KP6A 4MFEA 1OCRH 1YJWI 3DQVC 2HQNA 2ZCWA 2EZLA 4IL6C 1A35A 1FP1D 1MH3A 2MA3A 2XF5A 4CCOA 2IW5A 4FTHA 5K5RA 3UNGC 2NS8A 3KZZA 2IS6A 1T0FC 4HBLA 4F92B 1IZ1A 3WTTC 2E1MB 1IXRC 4XL9A 1AWCA 3LSRA 1K6YA 2FMLA 4HX4A 3S17J 4BXFA 3OYCA 2HNHA 1WQ2A 3H5RA 3BG6A 3WTYC 1R36A 1IRXA 1WI9A 3HB9A 4G6QA 4RGXA 1IUYA 1VFCA 1HKQA 4BE2A 2E1MC 4J19A 1EV7A 2GOMA 4XLAA 2KIQA 3QYFA 1VQ5I 2VJIA 2FBHA 1MBEA 2Q2EA 3OS0A 5J4VA 2Y9ZA 4L9VA 3FHNA 3CC4I 4DIQA 5ED4A 1T39A 3AG3H 2F2EA 4ABZA 1HA8A 3I5UA 3K2AA 1ZGJA 2K3PA 2IGOA 3H36A 4RGUA 3KZIC 3MQ0A 4LOCA 1SFXA 4A12A 5J8CA 4L9NA 1Y39A 3SDGA 3VSLA 1FIAA 4B09A 2XVCA 2XPWA 3IWZA 1ZRDA 2V7FA 3C3WA 3ZRGA 1X2MA 4JK1X 3OL3A 2A5WA 3ZMZA 2UV1A 2CUEA 1P92A 4WXHA 3GTQJ 3F22A 3FWEA 2JA7J 3OIOA 3D5RC 3CUQA 4CZCA 5FD5A 2V79A 2W48A 3HRTA 2BV6A 1BI0A 2FEZA 3HOXJ 4CCLA 1WSUA 4U87A 2M2EA 2FNAA 4BL0B 2R93J 2DFIA 1B4AA 2DYRH 4XRSA 2CQXA 1R1TA 3VEPA 5JHFA 1BJAA 2RVCA 4AYBA 3F6OA 2IS4A 3ZQIA 1USTA 3O6BB 1F4KA 1TT5B 3FXOA 1BR4A 3QWLA 1W7PD 1W36D 3GTJJ 3I58A 2AQEA 2DK8A 2GLOA 1FMWA 2HTJA 2O5RA 1VQ6I 3CCMI 2TCTA 3JAMK 2EB7A 4S0HB 1JGGA 2V1NA 1QHHD 3E0JB 2KFDA 4QPOA 1IDYA 3CJQB 2YR2A 2ZSIB 5TRDA 1BR1A 1FBUA 5H2FC 2UUZA 2Z16A 3IKVA 1IUFA 3MCZA 4FASD 5K7ZA 1RUOA 4AIHA 4BU2A 5HODA 1C0WA 4YIRX 5K7HA 3K4CA 1LFBA 1Z6RA 1ETQA 3LA7A 1YI2I 3DP7A 5C44J 2STWA 1O3SA 1Z9CA 4A3IJ 5LD2C 1FBQA 4RAYA 3SXYA 1WH7A 1OJLA 1XX5A 3E7LA 4D7NA 1MGTA 3RKQA 1XPXA 3MZYA 3DU5A 2HFHA 3HXLA 3Q0WA 4J00A 1MBJA 2FXAA 2IP2A 4L9JA 5H6QA 1WI3A 4DBRA 4HA8A 1RZ4A 2JT1A 1OCTC 4LG0B 4RB2C 2DN0A 1R5GA 3TBIA 4A3CJ 2OPTA 1TWAJ 3GFJA 3G1LA 3TW7A 4IQJA 3U1DA 1OYYA 4QPQA 3WGGA 5HDGA 3JRHA 3DPUA 3KFWX 3KX2A 4CYDA 3ASOH 4BUPA 2OZ6A 4ON0A 1L3LA 4CA0A 4UV8A 2XB5A 4C2TA 5CVUA 3UKGA 2X51A 3L2QA 5E79C 1D0YA 1T08B 1YG2A 2QM3A 3HKZN 4PFOA 1HCRA 4M71A 2JK3A 4B43A 1MBHA 1QU3A 5E3MA 4ZDOA 2JUGA 2FQ4A 4B8XA 2NYXA 2RC4A 2KZVA 1DGRM 3QOPA 3IRQA 3CQZJ 2EZHA 2JUCA 3R6SA 4XIDA 3VWBA 1JKQC 5TGTA 3T1BA 4GXOA 1KZHA 4E7KA 1PJRA 2P7VB 2VBWA 3HRMA 1FC3A 2X4HA 4LLGF 4PDKA 5HLIA 1JE8A 3BZ6A 4EM2A 1T33A 4G6TB 4IEJA 5TISC 4C30A 3VSKA 4NC6A 1HW1A 1BC8C 1R58A 1T95A 2KT0A 3BG7A 5E1ZB 1VNDA 4YFNF 1R9TJ 4W1UA 2W7NA 2KJCA 1OCZH 3K1NA 4D7MA 2B63J 5F1RA 1R1VA 3DKXA 2VPLA 5HOOA 2QZ8A 2PX9A 4A3KJ 1HDPA 4NQWA 3KP6A 2HZTA 5EG0A 3GX4X 2ECCA 1U6GA 3ZMSA 1OFCX 2O0YA 2E1OA 3CMYA 2R0QC 3PUBA 5B5EC 1B72A 4U0YA 1R7JA 4OINF 2LOOA 3BR2A 2K5CA 2VC1A 4R79A 3K4BA 3A03A 4JYKA 3ZXSA 4IHVA 1CGPA 2B0LA 4M3DA 4M73A 4ZZDA 4OMYA 3GF2A 2KPMA 2Z5UA 1E17A 2JPBA 4XKVA 5J6XA 1H88C 4GCVA 1W7PA 1ERDA 1I1SA 1IJWC 1R1UA 2R3SA 3TP3A 4C3IJ 1SMYF 2E35A 2V4JC 3RPUD 1AOYA 4B1RA 1OPCA 4IHTA 1T0FA 4XRFA 5DS9A 3EETA 3Q9SA 4ASNA 2XPUA 5BMZA 2XSJC 1UB9A 1O57A 1VQ4I 4L0YB 4A6EA 1R00A 2FNPA 1ZRFA 1UMQA 2V1DA 1W0TA 1Z77A 2FU4A 2HQRA 1ZKGA 1P4AA 1PP8F 1H0MA 3PJRA 5JHUA 2IGNA 2ZO4A 2NOGA 2V6EA 2P0WA 1V55H 4ZYGA 5DCMB 3HUGB 4RAFA 2ZJRF 4PUSA 3S2WA 2ELJA 1U9NA 2MFZA 2W25A 3KP4A 3CD6I 2BY2A 3FX3A 3KYLA 2K86A 2BY1A 1B59A 3BY6A 2VI6A 2M7BA 3SDBA 4M72A 2OQGA 1MH4A 1AA7A 3ZMVA 1OYWA 4UY8I 1JXSA 1XGOA 3FXUA 4JX6A 1FYMA 1H9TA 4M3BA 3S1QJ 2XV4S 4RGSA 3G73A 1H89C 2JPCA 4NDLA 4UHTA 1U5TB 3CP2A 3JRCA 2CRGA 2DI3A 2W85A 1LDKB 5E8IA 2J5PA 5L3CA 2BW3A 2GZWA 2X1EA 5L3EA 3QQAA 4HLXA 1IRGA 3OYDA 3CCSI 4HW0A 2BVMA 1BOBA 3S2HJ 3BG3A 1R6RA 2CH0A 1KGSA 2ECBA 3ZQLA 2JQ7A 4A6DA 5FRNA 2EJRA 3KLNA 4XSZF 4I0BA 3WTWC 2XAFA 4GGGA 1YS6A 1AKHB 4XRMA 3AAFA 2R4GA 3E5QA 2AO9A 4KICA 5LRSA 2CG4A 2NS7A 2L9SA 5CLSA 3SZTA 3PNTA 2UWMA 4YEJA 3DKYA 3F8BA 2DQRA 3V7RA 1UG2A 1A04A 4KIFA 1YJNI 1LE8B 2I10A 1BOAA 2F48A 1ETWA 1JUPA 2DTRA 2E60A 3LSKA 1USSA 4PSXA 3K4NA 3RSNA 1GVDA 1ZGAA 2VJ5A 5F1JA 1TTYA 1HKTA 3I4NJ 1D5YA 3T0YA 5FFXA 4U88A 1VF9A 3I71A 3BQYA 4X6AJ 1P2FA 5GTHC 2K9QA 4MHGA 1UAAA 2V9PA 5CPRB 5HLTA 3H92A 3M4OJ 2DCEA 1PYVA 1ZHFA 2L01A 1O4XA 2ETHA 1FOWA 1J9IA 3JTGA 1FYLA 3HPHA 3J7AO 1G3SA 2EA2A 2G7HA 2QQ9A 1P7IA 2M45A 1MJ9A 3OOPA 4M6YA 4G7OF 1SANA 2EA4A 4BQOA 4DGWB 2IT0A 3GEZA 5EGOA 5L3DA 4L5IA 1OCCH 4CUGA 2DO7A 5CYVA 1LQ1A 1LPQA 4EJTA 1YQAA 3GW2A 1T6SA 2KKOA 3ULQB 3LNQA 1P4WA 2EFPA 3HIFA 4HLYA 2OA4A 3H5AA 1K83J 5EZHA 4UB8C 1FOKA 4BE1A 4BHPA 3IRRA 2K85A 3RPUA 1G3TA 3WU0A 1ONVA 1XCVA 4UUSA 4AD9A 4P5OA 5IOZA 2HPIA 2HEOA 2HOTA 4O5VA 2GOXB 2GWRA 1BA5A 3BT9A 4QSHA 3OL4A 5JI6A 1F1ZA 3ISPA 5L3FA 3WTVC 1HF0A 3HOWJ 2ZNYA 3IL2A 3GZNB 1F9NA 3PSFA 2ACJA 1EKEA 2VJJA 3TOAA 1MJAA 2IA1A 3HSFA 5TJJA 1UG0A 2MSYA 3NEUA 1PUFB 4HEA2 1WH5A 4I02A 2VUMJ 4N0BA 3KEYA 1TNTA 4BKXA 3OS2A 1MMAA 4J01A 3CESA 1IAWA 5IYDJ 4NNJA 2JTVA 2ZXIA 4HV5A 4A0XA 3OWTA 2VJ4A 1CF7B 2LKXA 1X3ZB 1Y0UA 2EFQA 2EK5A 1XCBA 1KA8A 1QZZA 2LP0A 3F8NA 5GPCA 1EH6A 5K5QA 4E7LA 3PM1A 1MBGA 3D0SA 4Y15A 2DMTA 9ANTA 1XSVA 3EUAA 1ETYA 1MNMC 3W6KB 3RIRA 3I4MJ 1FMVA 1UZCA 2KHMA 1ON2A 2IJLA 3HG9A 5DTDA 4BBRJ 2NVQJ 5FD6A 4L9TA 1RPWA 3FM5A 2RNJA 2CGPA 1D1BA 2FF4A 5HDNA 4UB6C 4FHTA 5KAIC 2HKOA 2WV0A 3HGGA 1RC9A 3F72A 1MKMA 3AG4H 1KQ8A 3S1RJ 4AU7A 3S3OA 3RZDJ 1I6XA 2EZIA 1ZRCA 4XM3A 4D5CA 5FKNA 4EMSA 4KT5C 3TW6A 4CCJA 3M8JA 3BG9A 4R1HA 5DD4A 1KU7A 4C3JJ 1HDDC 3RCOA 4BY1J 1QQIA 3O3KA 4YELA 5H20A 3OYIA 2LKPA 2EIKH 2JZYA 2VE9A 2E2JJ 3HOVJ 4S04A 3OYGA 4I76A 1JHFA 2ZMEB 5DDGA 3HKZA 1O3TA 3HM5A 2M3AA 1S7OA 1K78A 1F43A 1R71A 4RDUA 3HOUJ 2W82A 5DYMA 4HQEA 1AHDP 4A3LJ 4NHJA 2VBYA 4IHYA 1Z7LA 2XF6A 2ZMEC 2HQ5A 2V6CA 4FISA 3MKZA 3HBLA 3GZ6A 4ZYAA 1SFOJ 3VDXA 1QPIA 3C18A 5CVRA 1W5CC 2QSFX 4IHWA 3JSOA 3J7AY 2M8EA 2VASA 1WZ2A 1I50J 3LSPA 2XRLA 2VN2A 2BXZA 4NC7A 4V2FA 2KIUA 2QA4I 2R5ZB 1QVUA 5B3SH 2XAGA 1Y1WJ 1PDNC 2E1CA 3OSFA 1FYKA 1X1PA 3CUOA 2PMZN 3GVAA 2D5VA 3X2QH 4HNTA 2DOEA 2HI3A 1BI2A 3H0GJ 3U2RA 2DA5A 2HGCA 1Y6IA 1TP4A 2DDBA 2DXIA 5L3BA 2R7WA 2XAQA 4FETA 1TWHJ 1IV6A 1BW6A 3AG1H 1ODDA 3BTLA 2M30A 4ITVA 2H27A 2ELKA 2I8DA 1VQ7I 3F8MA 1Y1VJ 2EFOA 2I5UA 4IJAA 3N4MA 3QU6A 1SVLA 1QHGA 2ID3A 2X0LA 2W4SA 4MFDA 4A3FJ 2LBFB 3QRFF 3L1PA 4LITA 2P7CB 3B6CA 2DPUA 3QPLA 2HWVA 1N78A 2Z2SB 4ZC3A 1IDZA 4EJWA 2NVXJ 2HYFA 3ZGKA 3ZQQA 2VKEA 2A68F 5HVQC 2M9HA 3IUOA 1WJCA 3SFZA 4BEHA 2WA0A 3M1EA 4DNCA 4WK8F 5HS7A 2XRNA 1MBKA 5HNFA 2MGQA 2IAIA 2R7SA 3JRFA 2R7ZJ 4Y52J 2DT7B 3I4PA 2F4IA 2DT5A 4NB5A 1X1AA 3SZPA 3WTZA 2ZJQF 5IT9Z 2CV0A 2HVSA 4HG2A 2QKLB 2DYSH 1G59A 2RN7A 4L5JA 3E5XA 3IAS2 1Y56A 3G6EI 1APLC 3NAUA 1BN5A 1S6LA 1U8BA 4Q48A 4NBQA 3EUHC 2JSCA 3ERMA 1P9QC 2XAUA 4QTRA 4XK4A 3PQKA 2L7ZA 1ZREA 5HDKA 2KQRA 3I0TA 3I55I 5J4YA 2G0EA 1W0UA 4F3QA 3DEUA 4CCMA 1UHMA 4BH9A 2ZXWH 1R22A 1ZLJA 2P5KA 2D1VA 3A01B 2JMWA 1P7JA 5C3EJ 1SD4A 4IHSA 1RESA 4KA4A 5FLXZ 3J81Z 3ZP5A 2V9KA 1X1DA 1BW5A 3VODA 3DF8A 5C4JJ 4XNFA 3I9V2 3WGHA 3GXOA 4K2EA 3KEQA 4MLOA 1TQPA 3HOYJ 1LVKA 4I99C 3JSPA 4QWQA 4D0PA 3TOBA 3V4GA 3M1CA 3QP6A 2FQ3A 2EV5A 2H6CA 3BTIA 1A36A 1MMGA 4MIMA 1IRFA 3ELKA 2QCOA 2P8TA 1DPUA 2HZDA 2DTZA 2QLZA 4Y33A 2O61A 5FKMA 1T38A 3CCEI 4FCYA 3LSIA 1FTZA 3EDPA 3HDDA 4UNOA 4XMYA 1XC5A 3GTGJ 3FBIB 1ORKA 2PMHA 3PIPF 2DFHA 1KONA 3GTLJ 4BDZA 2LDUA 2QBYB 2IXSA 3OYKA 3LA2A 3A2KA 3CDLA 4KFCA 4A3MJ 2ZC2A 4NUBA 1IN8A 5D4RA 3ZN1A 2W84A 1O7LA 1WRJA 2RGVA 4A69C 4IKFA 4PSWA 2DK5A 4OOIA 1MZBA 1YW8A 3HTSB 4OIQF 4GRIA 3TO9A 2VXDA 4IF4A 4EEFG 2FD5A 4A2UA 5KAFC 4YRVA 2RREA 3BJOA 2LG4A 3PO3J 2GAUA 3S3MA 5LEJA 1UHSA 4ZTFA 2KRHA 4H4KC 2OCEA 3OYMA 3DEEA 5FFZA 1FIPA 2MH2A 2XPVA 4KN4X 3FZVA 3BPVA 1RR8C 5M3MJ 1ZG5A 3VPRA 2DLLA 3OSGA 3VYTB 5J1RA 3DPTA 3ZMUA 1M1EB 3G4SI 4MQ9F 4UUTA 1VQ8I 1QZEA 2IGKA 3HYIA 2DQLA 2ESNA 2XGCA 2PN6A 3EUKL 2QKMB 4PFPA 2JN6A 4V19K 1EF4A 2Z1DA 5EEGA 2YU3A 4CSWA 1E2XA 2XIGA 4ZYDA 2ZFWA 2Z3YA 1VZ0A 4GYIA 4P9FA 4XSXF 4C2MJ 2L02A 4L5EA 4XLPF 2X6OA 2P6SA 5E8GA 3LA3A 4MNUA 1JHHA 2MBFA 5CQGA 2ZJPF 4H0EA 3L2UA 2UZKA 3H9JA 1HC8A 1FT9A 2TRTA 1OCPA 4KT6A 2NNNA 1PVEA 4E7HA 5FKLA 1D1CA 3W2WA 1ULYA 5CKTA 5J1UA 3IV5A 5KVRA 2DA4A 2X1CA 3WHBA 3BTJA 3H9QA 1MJBA 4GO1A 1BR2A 2NNYA 1ZTRA 4E7SA 1PP7U 5FKKA 1QA6A 5DD8A 2ZBKA 1IXCA 2GBYA 3C2GA 1WJFA 1X4PA 1BBYA 4PGHA 4AWXB 1V5GA 3T5XA 1MMSA 1IG7A 4JX4A 1SD5A 3VYRB 3HJEA 4EQQA 1E3OC 3SEZA 4LD5A 2VQHA 3JRDA 3RYRA 2HU9A 3BLYA 3E6BA 2E2HJ 2B9SA 3RKYA 2R7VA 2P6TA 2FOWA 2KMUA 4F7ZA 3P9IA 4HDVA 2Y75A 4KJZA 3ONQA 1MDMB 1SFUA 5IT9K 3RZOJ 3K1PA 2AHQA 4C9YA 1GV5A 1LFUP 1B8IB 4LB5A 1FBSA 3MAJA 2MLKA 3WE2A 3CO7C 2NXNB 3K1MA 1OYIA 2YS9A 4HDUA 2CFOA 1FTTA 3E97A 3ABKH 3A0BC 4UV9A 2R5YB 2FA5A 5HS8A 4CCNA 2BGCA 2LREA 3M3YJ 4IRHA 1TT0A 1IV8A 3L2WA 5E17F 1GV2A 4WX9A 3CMMA 1J75A 3CC2I 2L7KA 2X48A 4M9SA 1SFKA 2M4GA 5FLXK 4I2OA 3ECOA 2Y0SA 4G8XA 2K9NA 3PL8A 4HF2A 1DQUA 5B1BH 1REPC 1RUNA 3G1OA 2H1KA 2K4BA 1ZG3A 5DV5A 2A5YB 3D1NI 2IA2A 2O03A 2DMNA 3FKJA 5B66C 3L2VA 3CCRI 4HX8A 5K1YA 1KU2A 4I7HA 3MN2A 5GP9A 4AUXA 1A31A 3A1YA 3EUHA 4F55A 1G6NA 2VBXA 5IT3A 2FBIA 1O7FA 2K9LA 3P7NA 2XSDC 4DOZA 1JTYA 2Q1ZB 4FQGA 2QSHX 2JA6J 3S2DJ 4P9UA 3DLLF 1P4XA 3MMYB 5D5VB 3OOUA 2XROA 3ZCOA 3U9GA 1HXDA 1X19A 4KN7X 3CCUI 5F08A 3OYBA 1HW5A 3E6DA 2RNGA 1G2HA 4PCQA 3IH2A 4ENJA 2YUSA 4A0ZA 3S16J 4DBQA 2PMZA 4ENKA 2PLYA 2VOPA 2BXYA 2KJBA 2JWTA 1WJBA 3K70C 4BDYA 3KIOA 1J59A 2BHZA 2R7QA 1GDTA 2CQKA 2VQGA 4DJAA 1DU6A 1HSTA 2XDVA 4HV6A 3OYLA 1ZELA 4ZH4F 1ZGWA 4B44A 3LSTA 1NK3P 2FOKA 2LRDA 3DXJF 4ETSA 1Q1HA 2LKSA 2QUFA 1XGMA 4U7BA 1Z3XA 2IS2A 2STTA 4KMUX 4D5FA 4ZTJA 3L2CA 2DMQA 3P5JA 2ME6A 2HOEA 4CHUA 1TWCJ 3A4CA 3V42A 5LHHA 1VQLI 2IBDA 1U5TC 1OKRA 5EEAA 1R4NB 4HZFA 4F91B 3M8EA 4CZZA 3KYCB 4X1EA 4DYCA 3COAC 1WJEA 3BG5A 4XN0A 5EYRA 4BQNA 2A07F 4YG2F 1A6IA 5F0HA 4JP0A 5H6RA 1SC7A 2L9RA 1YIJI 4X0GA 4G12A 2ZXJA 4DYRA 4XKCA 4BE0A 2F4MB 3A0HC 3I59B 4JBAA 1X3WB 1ZAOA 4XONA 1QBJA 5ILUA 2MC3A 2CQ7A 4MTEA 2E5ZA 3N97A 2IGMA 3DU6A 2E7WA 2BVLA 5HNHA 3H3UA 1MSFC 3CDHA 2AXLA 4MO7A 1JKPC 2HDCA 4LK0F 1LB2A 3FXLA 3CJTB 4ZDPA 5FJ8J 2GIVA 2JA2A 2CU7A 1XDUA 5F27A 3S1NJ 1YYVA 2COBA 3JR9A 1A6QA 3IWFA 4ANJA 3G2BA 3ABLH 1JJ6C 2IEKA 3K70D 4IO9F 1NHAA 5E3LA 1HBXG 5CVIA 2D45A 2QQ8A 3QPSA 2D1HA 1X58A 1E0EA 3WU1B 3R61A 2NVTJ 2X85A 3TKYA 3S8PA 2K40A 2R7UA 3FISA 1RI7A 3CMEI 1R49A 1WFXA 1AU7A 1F5TA 1RRJA 2VOOA 1J0RA 3FHZA 4R8HA 5LBQA 2RQPA 5M5YJ 3OV8A 2KLOA 4RLQA 4LG0A 1RR7A 3LQQA 2E2IJ 3VFZA 2BEOA 2CW0F 4IRIA 4IRGA 3HSEA 2HKXA 3S14J 3QODA 2GXBA 2DPDA 2ME0A 4RA2A 1R5ID 3LAJA 3BC8A 4I01A 2UXNA 2VQLA 3JREA 3GBGA 5JLXA 5BPIA 3BZKA 5CVJA 1SMTA 2EILH 4IOCF 4KIBA 4JOMA 4LMYA 2AQFA 2ISYA 4CYCB 3KP2A 3PFIA 2M0CA 3B02A 4XLHA 2CQQA 2Y30A 3UR3C 2E19A 3GLXA 1U2WA 2CWEA 3LFKA 3Q5FA 2Y48A 5E18F 1LFPA 2HXOA 2OQRA 5J40A 3P9CA 2N8GA 1FSEA 5FO5A 4LIUA 1D5VA 2LR8A 2MC4A 1DP7P 1QNTA 1TQIA 3IP4B 3CZ6A 3TDZC 2WADA 1FLIA 1LKXA 2CW8A 2CYYA 1KYWA 2X9DA 4EV0A 2HVQA 2PG4A 2NAZA 1FEXA 3CUQB 1ENHA 2VIXA 5GPAA 4A3DJ 4BS9A 1ZG1A 1D1AA 3TL4X 3H5NA 1BM9A 1ZYRF 1WJDA 1S5LC 1XDSA 2QENA 4XQFA 4U0VA 2RAEA 3L00A 1IN5A 3WHCA 4A5NA 2O8KA 2E7XA 2EWNA 2CMPA 3CCLI 3CC7I 2BE5F 4WXCA 2DFEA 3OY9A 4UVAA 1GT0C 5E3NA 1D0XA 1TWFJ 3W3CA 3S1MJ 3BOQA 2L4AA 4M74A 3HHGA 2DMPA 3TGNA 1FOYA 2R5YA 1BC7C 4RGRA 1RKWA 1D8KA 3CO6C 2MH9A 3DBLB 4KNYA 2BZTA 1IRZA 3E1SA 2PQ8A 4ENMA 1YW9A 3F21A 2R7TA 2UXXA 4OAZA 1SFEA 2FSWA 3OYAA 1JJ8C 5ILSA 2Y0MA 3F6VA 4CGZA 1BI1A 3HC7A 4A3GJ 2VC0A 4ZJZA 3RPQA 3OMYA 1YIOA 2L3DA 3F8CA 2L5QA 1DU0A 4AIDA 2KIFA 3KE2A 1MD0A 4A5MA 1S29A 3HRUA 2VKDA 2EBIA 4LIVA 2MLGA 3S32A 2Q8KA 2P81A 3QYBA 3KYDB 1QVTA 3GCMA 2LMDA 3SZGA 3CF2A 5BS6A 5K7FA 2QVOA 3JRGA 4II2A 2H8WA 4UXNA 4FX0A 4Y17A 3GTOJ 3BDDA 2LY2A 1ETXA 5D6EA 3IHUA 4LK1F 2QSGX 3DTEA 1LNWA 3IAM2 4OIOF 5GADJ 1WWXA 2XASA 2H09A 2OV7A 2Z33A 2RV8A 2VLAA 4HOBA 5HS9A 2ZFUA 4YIFA 5DCMA 3HUGA 5DCFA 3SHFA 4BHBA 5HLGA 2WAQN 2A6EF 1YITI 5BPDA 2XKOA 2KRFA 3BCBA 1JUSA 3M9AA 3QYEA 4LLLA 2LYCA 4AM3A 5LGUA 4A3JJ 1RIOH 4HNUA 3DFGA 2M7AA 1ON1A 1LEAA 5D5WB 1WJAA 4XKBA 4FT8A 5KNLA 3IC7A 4C3HJ 4G6DA 3OYHA 2HDDA 2KL4A 1I39A 3ZMTA 1BIBA 4OU0A 3ROUA 2IS1A 1J7KA 3AL0B 3CCQI 1UFMA 1U5TA 1JI8A 3K2ZA 1ZR2A 3D5LA 1LDDA 1SD7A 2R7OA 5DEQA 2Z99A 5AIPA 3JRBA 1XMAA 2VPRA 3HTUA 4RB3C 1VQOI 2WTEA 3AL0C 3ZQFA 2CUJA 1F36A 3FM3A 4M9XA 3F3XA 3BQZA 2V26A 4RAZA 2OUMA 4KISA 2GXAA 4M9ZA 4OIPF 1K4SA 2NOJB 2QWWA 1EH8A 2MD5A 3G3ZA 2EFNA 6PAXA 3KETA 1GHCA 1DP3A 1EA3A 1AKHA 2DDAA 5FLMJ 2JA8J 2ADUA 1JKRC 2DFFA 3FK7A 5LHIA 1VQNI 1BI3A 2LTPA 3Q3SA 3RDIA 4N9HA 3VYUB 3E3VA 1ETOA 3N05A 5F0CA 1WCMJ 1U9OA 5BNGA 2FE3A 3FXQA 5EG0B 5AIQA 3L7WA 5L3GA 2W1OA 5F64A 3PIOF 2CUZA 3MFKA 1LE8A 1JGSA 2E71A 2WAFA 1X3UA 5IYCJ 4YFKF 2HOAA 2L9VA 2ZJ2A 1MMDA 1XB4A 2L2OA 1B72B 3SFIA 1ZLKA 4EATA 2XKPA 4HPQA 2OTLI 3L09A 2LNBA 4BJTA 1LVAA 3KPHA 1VQ9I 1T2KA 3QAHA 1OISA 1TBXA 2OJED 1J2XA 1OQYA 1HQCA 2YU9J 3IH4A 3OYFA 2HYJA 4U7DA 1JTXA 4I6ZA 1B1BA 3MKYB 3WG7H 3GMEA 4RAGA 3ZQGA 4HSTA 1N75A 3MD2A 4BHCA 1W1WE 2VODA 3RQ4A 3PUFA 4LG3A 2A6HF 5D6FA 1V4RA 1JKOC 2HDWA 4B4CA 3ABUA 2A6TA 3ZPLA 3B6AA 5LEKA 3KLOA 1R5HA 1STZA 2XAJA 3OIPA 5KHDA 1RETA 4DYQA 1BIAA 4DZJA 4M3EA 2O9LA 1IN6A 4L0ZB 1YHQI 1ZH5A 3PNVA 1EJ9A 2CV1A 3CCYA 2J5OA 5D5UB 4FE7A 2DOFA 5FKOA 3SYTA 1FNNA 2F5FA 1ZK8A 2DA7A 2EZKA 4II3A 3K6GA 2PBIA 4IX7A 1XGSA 1XN7A 2V9VA 5FROA 1XTAA 3LL7A 4RLFA 3TO7A 3GTPJ 3J7YJ 2K9SA 3KP5A 1KU3A 3OYJA 4XBFA 2X6XA 3W6VA 2P4WA 3PQJA 4BQQA 1MW7A 2QQAA 2VONA 4AVPA 1X1BA 5J1YA 2FRHA 4CYCA 3LAPA 4F93B 1NK2P 2XGEA 1IC8A 3I64A 1O3QA 3A02A 1TLHB 2OZUA 2XB0X 2DA3A 3FF5A 2FBKA 2BBYA 2NVUB 2F5DA 3BR5A 2HPMA 2OTJI 1PUFA 1BJZA 3C7JA 2ELHA 3ZR8X 3MWMA 4XR6A 3WGIA 5GTIC 2BW3B 2ISZA 3LWFA 4BYYA 3ABMH 3FXMA 1B9MA 4OMZA 4A0YA 2XC7A 4AC0A 2KRCA 4EM1A 2IPQX 2B7EA 4YIIA 3H35A 5KK1A 2XGXA 4O6JA 4PJLA 4WF2A 4XKWA 4XLEA 1CF7A 2W00A 3JRAA 3CJRB 1YLFA 1ACIA 3RJPA 3PSIA 1VQPI 1U3EM 4W97A 3HEFA 1UHWA 1XD7A 2QGUA 1YTYA 2A05A 1IN4A 3BR1A 1S7AA 1D3YA 3DPLC 4B48A 1NTCA 3DBHB 4I98B 5A2QZ 3RKXA 1E3PA 1BL0A 2FMYA 5ICGA 1YFHA 1FSHA 4RB1A 3MZHA 3NRVA 4ZDLA 4ESBA 2BOLA 2FX0A 4BY7J 3OR2C 2G7UA 4M6XA 1N77A 2M0MA 3KP7A 1OLTA 4C2UA 4KITB 2PJPA 1HW2A 1A5JA 1TL8A 3AKZA 3DLAA 3IKTA 3K7AJ 1H9GA 5J3LA 1MIJA 2PI0A 1KQ0A 2AS5F 3OYEA 4YFXF 3JW4A 1H8AC 4HYEA 1NH3A 2PJRB 1IO2A 5JVTA 3JTHA 4LB6B 5AONA 4Z2YA 1YJ9I 1IW7F 1LEBA 4RB0A 5EDNA 4P1WA 3L9FA 3EPZA 2WB1N 3GWZA 2DA2A 3FMQA 5E20A 4KUMA 1NG7A 1K6OA 1SAUA 2ZMEA 2GIZA 2VKHA 1QGPA 1VI0A 2JA5J 1D0ZA 5EGOB 4D9JA 3DKWA 2QYOA 3W2AA 1OR7C 3DV8A 3WU2C 3EQLF 3GYHX 3QPHA 1SVOA 3REOA 3T8TA 1FZPB 4I0AA 5J47A 2ZXHA 5E1WA 2VB6A 3B73A 4E7IA 5IOYA 2NRAC 1HOMA 1RKTA 4UUSB 1IXSB 4M6VA 2DA6A 3F9KA 3WTSC 1V3FA 1QO0D 2D2WA 2EQRA 3GLLA 1Z0XA 2R7RA 4P96A 3TQNA 2R5ZA 1U8RA 2O7OA 5ERIA 4ZYEA 2R7XA 3GFMA 2MYSA 4G94A 3AFHA 2R7FA 5ILVA 2E5NA 3ECHA 2EH3A 2EV0A 1Z67A 1TZLA 2GXGA 3DTIA 3KEOA 4P55A 3G1MA 3MEXA 2EIJH 2DMUA 1GUUA 5E1XA 3V8KA 4M3GA 3MVPA 2K9MA 3BR6A 2WY7Q 1I3AA 4WXDA 4Z6YA 1I6HJ 2CW7A 2HVRA 4PJNA 4MEXF 5ICFA 1WGXA 3LSHA 4JX5A 2YSRA 4HNVA 3K4MA 2LBFA 3NARA 1W4MA 1D8JA 1NG6A 3CLQA 2R92J 3TO6A 5BQTA 3RKWA 5D5XB 3Q9VA 2FJ1A 5CQEA 4OIRF 2COMA 2M5WA 2KDZA 4EJVA 4IZZA 3ZMDA 5KCMA 2JSPA 5FRMA 5IP7J 2Y69H 4XOTA 3ESWB 1JT0A 5HLHA 1V5FA 1QZYA 1Z3YA 2OU2A 3V7CA 5M5XJ 3J80Z 3J81K 4HSRA 2WC2A 5DM6F 4EGYA 4AVZA 2MW8A 5IP9J 1K4TA 1S8NA 1XMXA 3U21A 3PFYA 2ZKZA 2RDPA 1HKSA 4N4OB 1G8XA 3BJAA 5FGMA 5B1AH 2X6YA 4BQAA 5K5OA 3I56I 1RNLA 4WCGA 3F8FA 4E70A 1ZARA 3G71I 2A69F 5DM7F 2HS5A 2LD5A 1DGWY 2XUBA 3NWSA 3NQOA 2YPRA 1X1CA 2K4JA 4E7JA 2EIMH 2LF8A 4XLCA 3ZOBA 4XORA 3HOZJ 2OBPA 2NS0A 2W57A 4EGZA 2HR3A 3K9TA 2HYGD 1S7EA 2BYVE 2MG4A 1TC3C 2MD0A 2WAQA 4Q47A 1O3RA 1K78B 3FDYA 4G7HF 1DPRA 1Q1VA 4XICA 4E4HA 4DQ2A 4BJ5C 4XN3A 2ESHA 3VYSB 1HLVA 4RMNA 1XGNA 1HSJA 4EM0B 3A01A 2CUFA 2O8XA 3R0JA 5DUIA 3P9KA 1Z05A 1K7AA 2C6YA 3E6MA 4OAYA 4AIJA 2E34A 5IY5H 5F6FA 5LGNA 2LC2A 2VXZA 3H3ZA 3CJNA 2OD5A 2IVMA 1R23A 2DJIA 3CP8A 1S72I 1WHUA 2XAHA 1LDJA 3DWLE 1JUMA 3FK6A 3RQIA 2LY1A 2BHYA 3DEWA 4BXXJ 5A2QK 3K69A 4Y13A 2FUG2 2ZSHB 2WAEA 3MZ8A 2XF7A 2Y2ZA 1TW3A 1B6AA 5GAGJ 1IGNA 1I5ZA 2K7LA 3FIWA 2RKHA 3WODF 1SAXA 3CMAI 3LSJA 2F5CA 1POGA 1IF1A 3FXJA 4IXAA 2DU9A 2NVYJ 4MEYF 2Y31A 1FP2A 4CDGA 1YOVB 4G9YA 3V8LA 4HF0A 2QBYA 3H0DA 2AXTC 3BPXA 4Y3OA 1ZN2A 1J5YA 3BZCA 3K4JA 2TDXA 4ZYHA 4BACA 1DDNA 2XHKA 2ZB9A 1U78A 3W2VA 2F6CA 3SEQA 3IH3A 4HAMA 1G4DA 4DZPA 4EJUA 2GA1A 1QRYA 4GDFA 4E7ZA 4XLNF 1L0OC 2O6GE 2H8RA 2L4MA 3K4LA 3FMRA 3HPGA 4IOAF 1ETKA 4BEHB 3ZQCA 1WJ5A 1MSEC 1MNDA 1UELB 3ZQHA 2LF7A 4L18B 1V54H 4O3MA 2VT3A 4I09A 5FB2A 3J7ZI 1FPQA 2DOAA 3KCCA 1YRNB 4RM2A 1WVRA 2H94A 1X4OA 3GTMJ 1UJ8A 1Z7UA 2L7FP 4BNCA 1OCOH 4RBOA 4IQ4A 1E3HA 1YX5A 3HHHA 3HZJA 3C2HA 4XLFA 3U1KA 1Z21A 3ASNH 1LJ9A 3BR3A 4AYBN 4CICA 3MKWB 1GXPA 2GM4A 2V1UA 5J8FA 4CCKA 4MQVA 3I53A 4BAYA 1PUEE 1S9HA 1YW7A 1XS9A 2E36A 3FKIJ 3FXKA 3BROA 2CS3A 1YS7A 2JJ7A 2PJRA 2PFBA 2MABA 4CXFA 2LSOA 1XSXA 5ICEA 3GTKJ 2VL8A 2DBBA 3CDIA 3CCVI 3LMMA 1FOXA 2YX4A 4Q5SF 1OMIA 2PEXA 4KDPA 2HTSA 1T56A 1OR7A 2X1DA 4PJ0C 4JQFA 1WPKA 3WE3A 2Q2EB 3QPTA 4F52A 2ICWG 4KYWA 4M3FA 2LVSA 3BCAA 2LK2A 1I3QJ 2KZGA 3Q0UA 5D8KB 3LSGA 3RI4A 3TMOA 3RYPA 1UCRA 3SQNA 2IRFG 2L7MP 3LFUA 4IHXA 5LFAA 2VE8A 3M7GA 1ETVA 2K02A 3QOEA 3FMSA 4PZJA 5CVVA 3JCUC 4XOPA 4D1QA 4LLNA 3BR0A 2WY8Q 5IYBJ 3J80K 4HRIA 4KIGA 3BJ6A 2M87A 1KYZA 1MNEA 1GXQA 2JRMA 4Q4ZF 3WG9A 3ERED 3BWGA 1Y0NA 2GQQA 3SJMA 4HX7A 3CCJI 5LHGA 2F5VA 1TQMA 1Z6TA 4GYGA 5EZGA 1KQ9A 5JLWA 2Q0OA 3L2RA 3HGYA 4G7ZF 4BGDA 1G3WA 1MDMA 4ENNA 2M1BA 2DT6A 4PJJA 4B3AA 4EVIA 3T8RA 3O8GA 2V1XA 4MGRA 1B8IA 2K3FA 2EV6A 3CUQC 4B47A 2M34A 3JRIA 1IN7A 2HXIA 4N9IA 2LLKA 5D8LB 3DTKA 4A3EJ 5BOXA 3HOSA 2A61A 5IP6A 4RM3A 2EFWA 5F04A 1FY7A 1QPMA 2L0KA 1Z91A 3V7SA 3LOCA 1K79A 3VOEA 2WWYA 3GZ5A 4WWCA 2CO5A 5JR3A 5ICCA 2EPFA 2IA0A 3TP0A 3D5SC 2R7DA 3VB2A 2M4KA 5LGTA 5FLVA 2HOSA 3ZQ7A 3AG2H 2CSOA 3WTUC 3C2BA 2WB1A 2QF7A 3ZN0A 1FX7A 2VKVA 1X2NA 2DJNA 1J09A 4EJOA 3O8HA 3QU3A 4ZZLA 2P5LC 2F5EA 5E3OA 3PO2J 4BJ6C 2DODA 1CQTA 2ZNZA 3DCFA 1SD6A 1G3YA 1VQKI 5LLQA 2WV1A 3PNYA 3S3NA 4IPAA 3H9GA 1T98A 2H1LA 1YE9A 2JRTA 4A93J 3EYIA 1KU9A 2CFXA 3K10A 4V2GA 1K61A 1Y8RB 3E6CC 4QIWN 4HQMA 2OC6A 1I27A 2PMUA 1LUJB 4OWRB 3GFIA 3OIQA 1VQMI 5DUKA 2E1NA 2Y0SN 1V5EA 4PK4A 3R4KA 3M8FA 2JVHA 3JAMZ 3K4KA 4Y7NJ 4Y4RA 5F0FA 4BXUA 4LGWA 4CO8A 4S05A 1ZR4A
chains in the Genus database with same CATH topology
3BR5A 3M3YJ 2DA1A 1PUFA 1BJZA 3M4OJ 1O4XA 2K9QA 1GV2A 5M5WJ 4AC0A 2X48A 3H3VK 1P7IA 4XRSG 5EF6A 3JRAA 2K9NA 1SANA 3G1OA 2H1KA 5EGOA 4W97A 3HEFA 1FJLA 2M8GX 3D1NI 3BR1A 2DMNA 5M3FJ 3LNQA 1NTCA 3MN2A 5GP9A 4AUXA 1BL0A 1K83J 5EZHA 1ITYA 2XSDC 2FX0A 1JTYA 2JA6J 3S2DJ 4BY7J 3BTCA 2XGDA 1MBFA 4UUSA 3OOUA 5IOZA 2CJJA 2LY9A 2HOTA 4FE4A 1JT6A 1BA5A 3BT9A 4QSHA 1A5JA 2LFBA 1HF0A 4GFBA 5F08A 3K7AJ 3HOWJ 1G2HA 3IH2A 5J3LA 2YUSA 3S16J 3MKLA 2JWTA 2MSYA 1PUFB 1WH5A 1XG1A 1H8AC 4BBSJ 2VUMJ 1GDTA 4BKXA 1DU6A 5IPAA 3F0CA 5EDNA 1ZGWA 5C4XJ 5IYDJ 2ID6A 1NK3P 2WB1N 2DA2A 3TEDA 2OF7A 2LKXA 1ZQ3P 1VI0A 4DW6A 2JA5J 3S15J 5EGOB 1YRNA 2LP0A 5GPCA 1TWGJ 4D5FA 3PM1A 1MBGA 2DMQA 2DMTA 2ME6A 9ANTA 1ETYA 1MNMC 1TWCJ 4A3BJ 3I4MJ 3Q0VA 2IBDA 5EEAA 5DTDA 2Y9YA 4X1EA 4BBRJ 2NVQJ 1HOMA 5IOYA 4DYCA 4MFEA 1RPWA 1RKTA 3BG5A 4UUSB 2EZLA 4M6VA 2DA6A 5EYRA 1A6IA 1MH3A 5F0HA 4FTHA 2EQRA 2NS8A 3HGGA 4JP0A 1Z0XA 2L9RA 2R5ZA 3S1RJ 2O7OA 4G12A 4DYRA 3LSRA 3RZDJ 3S17J 2EZIA 4D5CA 5FKNA 2EH3A 3HB9A 3TW6A 3G1MA 1VFCA 2DMUA 4J19A 1GUUA 3BG9A 4M3GA 4BY1J 4C3JJ 1HDDC 3MVPA 1MBEA 1MSFC 3BR6A 4MO7A 2Y9ZA 1JKPC 1I6HJ 2E2JJ 1WGXA 3HOVJ 4JX5A 4I76A 5FJ8J 4ABZA 4HNVA 2CU7A 3HM5A 3K2AA 5F27A 1F43A 3S1NJ 3NARA 2COBA 3JR9A 4RDUA 2R92J 3HOUJ 4LOCA 1AHDP 4A3LJ 2FJ1A 3SDGA 4IHYA 1JJ6C 2HQ5A 2KDZA 2IEKA 4FISA 1FIAA 5E3LA 3HBLA 2XPWA 5IP7J 3QPSA 1SFOJ 1QPIA 1X58A 1JT0A 5M5XJ 2NVTJ 4IHWA 2MW8A 5IP9J 1X2MA 1I50J 2K40A 3LSPA 3FISA 2XRLA 2CUEA 1AU7A 3GTQJ 2JA7J 3OIOA 4V2FA 2R5ZB 2W48A 5M5YJ 1QVUA 3HOXJ 1Y1WJ 3OSFA 1RR7A 2M2EA 2R93J 2PMZN 2D5VA 2E2IJ 4XRSA 2LD5A 2HI3A 3H0GJ 2CQXA 2DA5A 3S14J 3ZQIA 3ZOBA 2ME0A 1IV6A 1TWHJ 3HOZJ 1BW6A 3BTLA 3GTJJ 2GLOA 3JREA 3GBGA 5JLXA 1S7EA 2ELKA 2TCTA 2MG4A 4S0HB 1TC3C 1Y1VJ 1JGGA 4CYCB 2M0CA 1IDYA 2ID3A 4A3FJ 4MFDA 2CQQA 2Y30A 3L1PA 3B6CA 2E19A 1Q1VA 4XICA 1IUFA 5K7ZA 3QPLA 5HODA 2HXOA 1HLVA 5K7HA 3A01A 2CUFA 1IDZA 1LFBA 1ETQA 2NVXJ 2N8GA 2VKEA 5C44J 2LR8A 2M9HA 4A3IJ 1WH7A 1OJLA 3E7LA 4D7NA 3RKQA 2X9DA 1MBKA 2MGQA 1JUMA 2IAIA 3FK6A 3RQIA 3JRFA 2R7ZJ 1FEXA 3Q0WA 1MBJA 1ENHA 3DEWA 4BXXJ 4Y52J 5GPAA 4A3DJ 1WI3A 1OCTC 2Y2ZA 1IGNA 2DN0A 4A3CJ 2RAEA 2OPTA 3FIWA 1TWAJ 3WHCA 3LSJA 3G1LA 3TW7A 2O8KA 1POGA 3JRHA 1APLC 3NAUA 1GT0C 5E3NA 1U8BA 1TWFJ 2NVYJ 3S1MJ 2Y31A 2R5YA 2DMPA 2XB5A 1RKWA 4QTRA 4XK4A 2L7ZA 3UKGA 3HKZN 1IRZA 1HCRA 2JK3A 1MBHA 2G0EA 1W0UA 5E3MA 2ZB9A 1U78A 2FQ4A 1JJ8C 3IH3A 3CQZJ 4DZPA 2EZHA 3A01B 4A3GJ 2JMWA 1P7JA 5C3EJ 1QRYA 1RESA 4XIDA 1JKQC 2H8RA 1BW5A 1DU0A 1ETKA 3ZQCA 1MSEC 5C4JJ 2EBIA 3ZQHA 4MLOA 1T33A 2P81A 1QVTA 4IEJA 3HOYJ 5K7FA 1YRNB 3JRGA 2KT0A 3GTMJ 3GTOJ 3BTIA 1ETXA 1VNDA 4MIMA 1R9TJ 2QCOA 2L7FP 4W1UA 4RBOA 2DTZA 4D7MA 5FKMA 2B63J 3BR3A 4AYBN 2GM4A 4FCYA 1FTZA 3HDDA 1XC5A 3GTGJ 1ORKA 1HDPA 4A3KJ 1XS9A 3FKIJ 5EG0A 2ECCA 3GTLJ 2WAQN 1OFCX 2E1OA 2JJ7A 3CMYA 3CDLA 2R0QC 4A3MJ 1JUSA 3GTKJ 1B72A 4A3JJ 3BR2A 4A69C 2HDDA 4C3HJ 3A03A 1T56A 4JYKA 4IHVA 4M3DA 1WPKA 4EEFG 2FD5A 1ZR2A 4M3FA 2LVSA 1H88C 2LK2A 1I3QJ 3PO3J 3Q0UA 3JRBA 1IJWC 2VPRA 3LSGA 4C3IJ 3TP3A 1UHSA 3ZQFA 1F36A 2L7MP 4IHXA 3BQZA 4B1RA 1ETVA 1FIPA 5DS9A 2XPVA 2XPUA 5M3MJ 3VPRA 3OSGA 5J1RA 3BR0A 5IYBJ 4UUTA 1UMQA 1AKHA 5FLMJ 1W0TA 1JKRC 2JA8J 1Z77A 3FK7A 2XGCA 1ZKGA 2LTPA 3Q3SA 2NOGA 1ETOA 2JN6A 5F0CA 1WCMJ 1U9OA 5BNGA 3SJMA 1EF4A 5EG0B 1U9NA 1LE8A 5EZGA 5JLWA 3HGYA 4C2MJ 5IYCJ 2VI6A 4L5EA 2X6OA 2HOAA 1MH4A 1B72B 3SFIA 4B3AA 3O8GA 1B8IA 4JX6A 4M3BA 2TRTA 1OCPA 3S1QJ 2M34A 3JRIA 5FKLA 2HXIA 2LLKA 1H89C 2YU9J 4NDLA 5J1UA 3IV5A 4A3EJ 3IH4A 2DA4A 2HYJA 3WHBA 3BTJA 3JRCA 1JTXA 2CRGA 5IP6A 4I6ZA 5F04A 2L0KA 3ZQGA 3LOCA 1ZTRA 5FKKA 3TP0A 3QQAA 2GBYA 1JKOC 5FLVA 2HOSA 3S2HJ 3BG3A 2ECBA 4B4CA 3ZQLA 3C2BA 1IG7A 2QF7A 3B6AA 4JX4A 2VKVA 1X2NA 2DJNA 1E3OC 1RETA 4DYQA 3O8HA 4DZJA 4M3EA 1AKHB 4XRMA 2O9LA 5E3OA 3PO2J 3JRDA 2AO9A 2NS7A 1CQTA 3CCYA 2E2HJ 3DCFA 4FE7A 5FKOA 1UG2A 2WV1A 1ZK8A 2DA7A 1LE8B 2I10A 2EZKA 4A93J 3RZOJ 2AHQA 1ETWA 1JUPA 3GTPJ 4V2GA 1K61A 1GV5A 2K9SA 1LFUP 1B8IB 1GVDA 4QIWN 3W6VA 5F1JA 5J1YA 3I4NJ 2YS9A 2Y0SN 4CYCA 1D5YA 1FTTA 4Y7NJ 1NK2P 2XGEA 1VF9A 1IC8A 5F0FA 3A02A 3BQYA 4X6AJ 1ZR4A 2R5YB 2DA3A 2XB0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR5 A;  3M3Y J;  2DA1 A;  1PUF A;  1BJZ A;  3M4O J;  1O4X A;  2K9Q A;  1GV2 A;  5M5W J;  4AC0 A;  2X48 A;  3H3V K;  1P7I A;  4XRS G;  5EF6 A;  3JRA A;  2K9N A;  1SAN A;  3G1O A;  2H1K A;  5EGO A;  4W97 A;  3HEF A;  1FJL A;  2M8G X;  3D1N I;  3BR1 A;  2DMN A;  5M3F J;  3LNQ A;  1NTC A;  3MN2 A;  5GP9 A;  4AUX A;  1BL0 A;  1K83 J;  5EZH A;  1ITY A;  2XSD C;  2FX0 A;  1JTY A;  2JA6 J;  3S2D J;  4BY7 J;  3BTC A;  2XGD A;  1MBF A;  4UUS A;  3OOU A;  5IOZ A;  2CJJ A;  2LY9 A;  2HOT A;  4FE4 A;  1JT6 A;  1BA5 A;  3BT9 A;  4QSH A;  1A5J A;  2LFB A;  1HF0 A;  4GFB A;  5F08 A;  3K7A J;  3HOW J;  1G2H A;  3IH2 A;  5J3L A;  2YUS A;  3S16 J;  3MKL A;  2JWT A;  2MSY A;  1PUF B;  1WH5 A;  1XG1 A;  1H8A C;  4BBS J;  2VUM J;  1GDT A;  4BKX A;  1DU6 A;  5IPA A;  3F0C A;  5EDN A;  1ZGW A;  5C4X J;  5IYD J;  2ID6 A;  1NK3 P;  2WB1 N;  2DA2 A;  3TED A;  2OF7 A;  2LKX A;  1ZQ3 P;  1VI0 A;  4DW6 A;  2JA5 J;  3S15 J;  5EGO B;  1YRN A;  2LP0 A;  5GPC A;  1TWG J;  4D5F A;  3PM1 A;  1MBG A;  2DMQ A;  2DMT A;  2ME6 A;  9ANT A;  1ETY A;  1MNM C;  1TWC J;  4A3B J;  3I4M J;  3Q0V A;  2IBD A;  5EEA A;  5DTD A;  2Y9Y A;  4X1E A;  4BBR J;  2NVQ J;  1HOM A;  5IOY A;  4DYC A;  4MFE A;  1RPW A;  1RKT A;  3BG5 A;  4UUS B;  2EZL A;  4M6V A;  2DA6 A;  5EYR A;  1A6I A;  1MH3 A;  5F0H A;  4FTH A;  2EQR A;  2NS8 A;  3HGG A;  4JP0 A;  1Z0X A;  2L9R A;  2R5Z A;  3S1R J;  2O7O A;  4G12 A;  4DYR A;  3LSR A;  3RZD J;  3S17 J;  2EZI A;  4D5C A;  5FKN A;  2EH3 A;  3HB9 A;  3TW6 A;  3G1M A;  1VFC A;  2DMU A;  4J19 A;  1GUU A;  3BG9 A;  4M3G A;  4BY1 J;  4C3J J;  1HDD C;  3MVP A;  1MBE A;  1MSF C;  3BR6 A;  4MO7 A;  2Y9Z A;  1JKP C;  1I6H J;  2E2J J;  1WGX A;  3HOV J;  4JX5 A;  4I76 A;  5FJ8 J;  4ABZ A;  4HNV A;  2CU7 A;  3HM5 A;  3K2A A;  5F27 A;  1F43 A;  3S1N J;  3NAR A;  2COB A;  3JR9 A;  4RDU A;  2R92 J;  3HOU J;  4LOC A;  1AHD P;  4A3L J;  2FJ1 A;  3SDG A;  4IHY A;  1JJ6 C;  2HQ5 A;  2KDZ A;  2IEK A;  4FIS A;  1FIA A;  5E3L A;  3HBL A;  2XPW A;  5IP7 J;  3QPS A;  1SFO J;  1QPI A;  1X58 A;  1JT0 A;  5M5X J;  2NVT J;  4IHW A;  2MW8 A;  5IP9 J;  1X2M A;  1I50 J;  2K40 A;  3LSP A;  3FIS A;  2XRL A;  2CUE A;  1AU7 A;  3GTQ J;  2JA7 J;  3OIO A;  4V2F A;  2R5Z B;  2W48 A;  5M5Y J;  1QVU A;  3HOX J;  1Y1W J;  3OSF A;  1RR7 A;  2M2E A;  2R93 J;  2PMZ N;  2D5V A;  2E2I J;  4XRS A;  2LD5 A;  2HI3 A;  3H0G J;  2CQX A;  2DA5 A;  3S14 J;  3ZQI A;  3ZOB A;  2ME0 A;  1IV6 A;  1TWH J;  3HOZ J;  1BW6 A;  3BTL A;  3GTJ J;  2GLO A;  3JRE A;  3GBG A;  5JLX A;  1S7E A;  2ELK A;  2TCT A;  2MG4 A;  4S0H B;  1TC3 C;  1Y1V J;  1JGG A;  4CYC B;  2M0C A;  1IDY A;  2ID3 A;  4A3F J;  4MFD A;  2CQQ A;  2Y30 A;  3L1P A;  3B6C A;  2E19 A;  1Q1V A;  4XIC A;  1IUF A;  5K7Z A;  3QPL A;  5HOD A;  2HXO A;  1HLV A;  5K7H A;  3A01 A;  2CUF A;  1IDZ A;  1LFB A;  1ETQ A;  2NVX J;  2N8G A;  2VKE A;  5C44 J;  2LR8 A;  2M9H A;  4A3I J;  1WH7 A;  1OJL A;  3E7L A;  4D7N A;  3RKQ A;  2X9D A;  1MBK A;  2MGQ A;  1JUM A;  2IAI A;  3FK6 A;  3RQI A;  3JRF A;  2R7Z J;  1FEX A;  3Q0W A;  1MBJ A;  1ENH A;  3DEW A;  4BXX J;  4Y52 J;  5GPA A;  4A3D J;  1WI3 A;  1OCT C;  2Y2Z A;  1IGN A;  2DN0 A;  4A3C J;  2RAE A;  2OPT A;  3FIW A;  1TWA J;  3WHC A;  3LSJ A;  3G1L A;  3TW7 A;  2O8K A;  1POG A;  3JRH A;  1APL C;  3NAU A;  1GT0 C;  5E3N A;  1U8B A;  1TWF J;  2NVY J;  3S1M J;  2Y31 A;  2R5Y A;  2DMP A;  2XB5 A;  1RKW A;  4QTR A;  4XK4 A;  2L7Z A;  3UKG A;  3HKZ N;  1IRZ A;  1HCR A;  2JK3 A;  1MBH A;  2G0E A;  1W0U A;  5E3M A;  2ZB9 A;  1U78 A;  2FQ4 A;  1JJ8 C;  3IH3 A;  3CQZ J;  4DZP A;  2EZH A;  3A01 B;  4A3G J;  2JMW A;  1P7J A;  5C3E J;  1QRY A;  1RES A;  4XID A;  1JKQ C;  2H8R A;  1BW5 A;  1DU0 A;  1ETK A;  3ZQC A;  1MSE C;  5C4J J;  2EBI A;  3ZQH A;  4MLO A;  1T33 A;  2P81 A;  1QVT A;  4IEJ A;  3HOY J;  5K7F A;  1YRN B;  3JRG A;  2KT0 A;  3GTM J;  3GTO J;  3BTI A;  1ETX A;  1VND A;  4MIM A;  1R9T J;  2QCO A;  2L7F P;  4W1U A;  4RBO A;  2DTZ A;  4D7M A;  5FKM A;  2B63 J;  3BR3 A;  4AYB N;  2GM4 A;  4FCY A;  1FTZ A;  3HDD A;  1XC5 A;  3GTG J;  1ORK A;  1HDP A;  4A3K J;  1XS9 A;  3FKI J;  5EG0 A;  2ECC A;  3GTL J;  2WAQ N;  1OFC X;  2E1O A;  2JJ7 A;  3CMY A;  3CDL A;  2R0Q C;  4A3M J;  1JUS A;  3GTK J;  1B72 A;  4A3J J;  3BR2 A;  4A69 C;  2HDD A;  4C3H J;  3A03 A;  1T56 A;  4JYK A;  4IHV A;  4M3D A;  1WPK A;  4EEF G;  2FD5 A;  1ZR2 A;  4M3F A;  2LVS A;  1H88 C;  2LK2 A;  1I3Q J;  3PO3 J;  3Q0U A;  3JRB A;  1IJW C;  2VPR A;  3LSG A;  4C3I J;  3TP3 A;  1UHS A;  3ZQF A;  1F36 A;  2L7M P;  4IHX A;  3BQZ A;  4B1R A;  1ETV A;  1FIP A;  5DS9 A;  2XPV A;  2XPU A;  5M3M J;  3VPR A;  3OSG A;  5J1R A;  3BR0 A;  5IYB J;  4UUT A;  1UMQ A;  1AKH A;  5FLM J;  1W0T A;  1JKR C;  2JA8 J;  1Z77 A;  3FK7 A;  2XGC A;  1ZKG A;  2LTP A;  3Q3S A;  2NOG A;  1ETO A;  2JN6 A;  5F0C A;  1WCM J;  1U9O A;  5BNG A;  3SJM A;  1EF4 A;  5EG0 B;  1U9N A;  1LE8 A;  5EZG A;  5JLW A;  3HGY A;  4C2M J;  5IYC J;  2VI6 A;  4L5E A;  2X6O A;  2HOA A;  1MH4 A;  1B72 B;  3SFI A;  4B3A A;  3O8G A;  1B8I A;  4JX6 A;  4M3B A;  2TRT A;  1OCP A;  3S1Q J;  2M34 A;  3JRI A;  5FKL A;  2HXI A;  2LLK A;  1H89 C;  2YU9 J;  4NDL A;  5J1U A;  3IV5 A;  4A3E J;  3IH4 A;  2DA4 A;  2HYJ A;  3WHB A;  3BTJ A;  3JRC A;  1JTX A;  2CRG A;  5IP6 A;  4I6Z A;  5F04 A;  2L0K A;  3ZQG A;  3LOC A;  1ZTR A;  5FKK A;  3TP0 A;  3QQA A;  2GBY A;  1JKO C;  5FLV A;  2HOS A;  3S2H J;  3BG3 A;  2ECB A;  4B4C A;  3ZQL A;  3C2B A;  1IG7 A;  2QF7 A;  3B6A A;  4JX4 A;  2VKV A;  1X2N A;  2DJN A;  1E3O C;  1RET A;  4DYQ A;  3O8H A;  4DZJ A;  4M3E A;  1AKH B;  4XRM A;  2O9L A;  5E3O A;  3PO2 J;  3JRD A;  2AO9 A;  2NS7 A;  1CQT A;  3CCY A;  2E2H J;  3DCF A;  4FE7 A;  5FKO A;  1UG2 A;  2WV1 A;  1ZK8 A;  2DA7 A;  1LE8 B;  2I10 A;  2EZK A;  4A93 J;  3RZO J;  2AHQ A;  1ETW A;  1JUP A;  3GTP J;  4V2G A;  1K61 A;  1GV5 A;  2K9S A;  1LFU P;  1B8I B;  1GVD A;  4QIW N;  3W6V A;  5F1J A;  5J1Y A;  3I4N J;  2YS9 A;  2Y0S N;  4CYC A;  1D5Y A;  1FTT A;  4Y7N J;  1NK2 P;  2XGE A;  1VF9 A;  1IC8 A;  5F0F A;  3A02 A;  3BQY A;  4X6A J;  1ZR4 A;  2R5Y B;  2DA3 A;  2XB0 X; 
#chains in the Genus database with same CATH topology
 1W5S A;  2OAZ A;  3HSR A;  2K27 A;  5GAE J;  2DA1 A;  1SEU A;  2QQB A;  1SVM A;  1I1G A;  1TW2 A;  2EIN H;  3ABT A;  5D4S A;  4IVN A;  2CV2 A;  5M5W J;  3S93 A;  1YX3 A;  1WKM A;  2DAO A;  2GA2 A;  1Z1D A;  4LFU A;  4CH7 A;  5JFR A;  1MMN A;  3QP5 A;  3R0A A;  4FX4 A;  1EH7 A;  4LJZ F;  4UUV A;  3H3V K;  5LRR A;  4XRS G;  5JVG F;  2H6B A;  2F4O B;  2P5V A;  5EF6 A;  4UVC A;  2KIM A;  3FBN B;  3DBR B;  4B3X A;  4ESF A;  2OCC H;  3ML6 A;  1FJL A;  1W5T A;  2M8G X;  2LH9 A;  3H1C A;  1GVJ A;  5M3F J;  3I54 A;  1U0J A;  4PJM A;  3KZY A;  4MTD A;  3V8J A;  3LSM A;  2QEX I;  1P6R A;  5CJ9 A;  2JVG A;  4RS8 A;  1ITY A;  3W6J B;  2O3F A;  2HQA A;  3CF5 F;  1VTN C;  4KMF A;  3BTC A;  2XGD A;  1MBF A;  3RTR A;  1GLN A;  2CJJ A;  3OYN A;  2LY9 A;  3EYY A;  4FE4 A;  1JT6 A;  2YX7 A;  4N4N B;  2LFB A;  4GFB A;  3NWT A;  1T8I A;  3TDU C;  3M07 A;  3GUD A;  4NQW B;  4QLC U;  3LQR A;  3GFL A;  3O2P E;  3I59 A;  1XMK A;  4TV7 A;  3MKL A;  3HL2 A;  1XG1 A;  2VT2 A;  4BBS J;  1YO5 C;  3WTX C;  2VQC A;  4U0W A;  2A3S A;  1N25 A;  3BP8 A;  3F0C A;  5IPA A;  3FXR A;  2DW4 A;  3OS1 A;  5C4X J;  3GO5 A;  2RQQ A;  4UVB A;  3HOT A;  1DUX C;  2ID6 A;  1Y8Q B;  1FWZ A;  3TED A;  2OF7 A;  5GAH J;  3K0L A;  1ZQ3 P;  2Z9O A;  2X6W A;  1B9N A;  3OR1 C;  2L9N A;  1S3J A;  2WBM A;  4DW6 A;  3S15 J;  3C1D A;  2G9W A;  1YRN A;  4PGG A;  1TWG J;  5EEH A;  1TNS A;  1W7P B;  3HRS A;  1XSD A;  3CTA A;  3KP3 A;  4HF1 A;  2BY3 A;  4E6K G;  2KDO A;  3R60 A;  4A3B J;  3Q0V A;  2CQN A;  4AIK A;  2VBZ A;  3I3L A;  2BY0 A;  2W24 A;  2KIS A;  2L54 A;  4NC8 A;  4ESJ A;  3F23 A;  1R4M B;  2Y9Y A;  5EJC A;  3E5U A;  3CLO A;  1W36 C;  2KP6 A;  4MFE A;  1OCR H;  1YJW I;  3DQV C;  2HQN A;  2ZCW A;  2EZL A;  4IL6 C;  1A35 A;  1FP1 D;  1MH3 A;  2MA3 A;  2XF5 A;  4CCO A;  2IW5 A;  4FTH A;  5K5R A;  3UNG C;  2NS8 A;  3KZZ A;  2IS6 A;  1T0F C;  4HBL A;  4F92 B;  1IZ1 A;  3WTT C;  2E1M B;  1IXR C;  4XL9 A;  1AWC A;  3LSR A;  1K6Y A;  2FML A;  4HX4 A;  3S17 J;  4BXF A;  3OYC A;  2HNH A;  1WQ2 A;  3H5R A;  3BG6 A;  3WTY C;  1R36 A;  1IRX A;  1WI9 A;  3HB9 A;  4G6Q A;  4RGX A;  1IUY A;  1VFC A;  1HKQ A;  4BE2 A;  2E1M C;  4J19 A;  1EV7 A;  2GOM A;  4XLA A;  2KIQ A;  3QYF A;  1VQ5 I;  2VJI A;  2FBH A;  1MBE A;  2Q2E A;  3OS0 A;  5J4V A;  2Y9Z A;  4L9V A;  3FHN A;  3CC4 I;  4DIQ A;  5ED4 A;  1T39 A;  3AG3 H;  2F2E A;  4ABZ A;  1HA8 A;  3I5U A;  3K2A A;  1ZGJ A;  2K3P A;  2IGO A;  3H36 A;  4RGU A;  3KZI C;  3MQ0 A;  4LOC A;  1SFX A;  4A12 A;  5J8C A;  4L9N A;  1Y39 A;  3SDG A;  3VSL A;  1FIA A;  4B09 A;  2XVC A;  2XPW A;  3IWZ A;  1ZRD A;  2V7F A;  3C3W A;  3ZRG A;  1X2M A;  4JK1 X;  3OL3 A;  2A5W A;  3ZMZ A;  2UV1 A;  2CUE A;  1P92 A;  4WXH A;  3GTQ J;  3F22 A;  3FWE A;  2JA7 J;  3OIO A;  3D5R C;  3CUQ A;  4CZC A;  5FD5 A;  2V79 A;  2W48 A;  3HRT A;  2BV6 A;  1BI0 A;  2FEZ A;  3HOX J;  4CCL A;  1WSU A;  4U87 A;  2M2E A;  2FNA A;  4BL0 B;  2R93 J;  2DFI A;  1B4A A;  2DYR H;  4XRS A;  2CQX A;  1R1T A;  3VEP A;  5JHF A;  1BJA A;  2RVC A;  4AYB A;  3F6O A;  2IS4 A;  3ZQI A;  1UST A;  3O6B B;  1F4K A;  1TT5 B;  3FXO A;  1BR4 A;  3QWL A;  1W7P D;  1W36 D;  3GTJ J;  3I58 A;  2AQE A;  2DK8 A;  2GLO A;  1FMW A;  2HTJ A;  2O5R A;  1VQ6 I;  3CCM I;  2TCT A;  3JAM K;  2EB7 A;  4S0H B;  1JGG A;  2V1N A;  1QHH D;  3E0J B;  2KFD A;  4QPO A;  1IDY A;  3CJQ B;  2YR2 A;  2ZSI B;  5TRD A;  1BR1 A;  1FBU A;  5H2F C;  2UUZ A;  2Z16 A;  3IKV A;  1IUF A;  3MCZ A;  4FAS D;  5K7Z A;  1RUO A;  4AIH A;  4BU2 A;  5HOD A;  1C0W A;  4YIR X;  5K7H A;  3K4C A;  1LFB A;  1Z6R A;  1ETQ A;  3LA7 A;  1YI2 I;  3DP7 A;  5C44 J;  2STW A;  1O3S A;  1Z9C A;  4A3I J;  5LD2 C;  1FBQ A;  4RAY A;  3SXY A;  1WH7 A;  1OJL A;  1XX5 A;  3E7L A;  4D7N A;  1MGT A;  3RKQ A;  1XPX A;  3MZY A;  3DU5 A;  2HFH A;  3HXL A;  3Q0W A;  4J00 A;  1MBJ A;  2FXA A;  2IP2 A;  4L9J A;  5H6Q A;  1WI3 A;  4DBR A;  4HA8 A;  1RZ4 A;  2JT1 A;  1OCT C;  4LG0 B;  4RB2 C;  2DN0 A;  1R5G A;  3TBI A;  4A3C J;  2OPT A;  1TWA J;  3GFJ A;  3G1L A;  3TW7 A;  4IQJ A;  3U1D A;  1OYY A;  4QPQ A;  3WGG A;  5HDG A;  3JRH A;  3DPU A;  3KFW X;  3KX2 A;  4CYD A;  3ASO H;  4BUP A;  2OZ6 A;  4ON0 A;  1L3L A;  4CA0 A;  4UV8 A;  2XB5 A;  4C2T A;  5CVU A;  3UKG A;  2X51 A;  3L2Q A;  5E79 C;  1D0Y A;  1T08 B;  1YG2 A;  2QM3 A;  3HKZ N;  4PFO A;  1HCR A;  4M71 A;  2JK3 A;  4B43 A;  1MBH A;  1QU3 A;  5E3M A;  4ZDO A;  2JUG A;  2FQ4 A;  4B8X A;  2NYX A;  2RC4 A;  2KZV A;  1DGR M;  3QOP A;  3IRQ A;  3CQZ J;  2EZH A;  2JUC A;  3R6S A;  4XID A;  3VWB A;  1JKQ C;  5TGT A;  3T1B A;  4GXO A;  1KZH A;  4E7K A;  1PJR A;  2P7V B;  2VBW A;  3HRM A;  1FC3 A;  2X4H A;  4LLG F;  4PDK A;  5HLI A;  1JE8 A;  3BZ6 A;  4EM2 A;  1T33 A;  4G6T B;  4IEJ A;  5TIS C;  4C30 A;  3VSK A;  4NC6 A;  1HW1 A;  1BC8 C;  1R58 A;  1T95 A;  2KT0 A;  3BG7 A;  5E1Z B;  1VND A;  4YFN F;  1R9T J;  4W1U A;  2W7N A;  2KJC A;  1OCZ H;  3K1N A;  4D7M A;  2B63 J;  5F1R A;  1R1V A;  3DKX A;  2VPL A;  5HOO A;  2QZ8 A;  2PX9 A;  4A3K J;  1HDP A;  4NQW A;  3KP6 A;  2HZT A;  5EG0 A;  3GX4 X;  2ECC A;  1U6G A;  3ZMS A;  1OFC X;  2O0Y A;  2E1O A;  3CMY A;  2R0Q C;  3PUB A;  5B5E C;  1B72 A;  4U0Y A;  1R7J A;  4OIN F;  2LOO A;  3BR2 A;  2K5C A;  2VC1 A;  4R79 A;  3K4B A;  3A03 A;  4JYK A;  3ZXS A;  4IHV A;  1CGP A;  2B0L A;  4M3D A;  4M73 A;  4ZZD A;  4OMY A;  3GF2 A;  2KPM A;  2Z5U A;  1E17 A;  2JPB A;  4XKV A;  5J6X A;  1H88 C;  4GCV A;  1W7P A;  1ERD A;  1I1S A;  1IJW C;  1R1U A;  2R3S A;  3TP3 A;  4C3I J;  1SMY F;  2E35 A;  2V4J C;  3RPU D;  1AOY A;  4B1R A;  1OPC A;  4IHT A;  1T0F A;  4XRF A;  5DS9 A;  3EET A;  3Q9S A;  4ASN A;  2XPU A;  5BMZ A;  2XSJ C;  1UB9 A;  1O57 A;  1VQ4 I;  4L0Y B;  4A6E A;  1R00 A;  2FNP A;  1ZRF A;  1UMQ A;  2V1D A;  1W0T A;  1Z77 A;  2FU4 A;  2HQR A;  1ZKG A;  1P4A A;  1PP8 F;  1H0M A;  3PJR A;  5JHU A;  2IGN A;  2ZO4 A;  2NOG A;  2V6E A;  2P0W A;  1V55 H;  4ZYG A;  5DCM B;  3HUG B;  4RAF A;  2ZJR F;  4PUS A;  3S2W A;  2ELJ A;  1U9N A;  2MFZ A;  2W25 A;  3KP4 A;  3CD6 I;  2BY2 A;  3FX3 A;  3KYL A;  2K86 A;  2BY1 A;  1B59 A;  3BY6 A;  2VI6 A;  2M7B A;  3SDB A;  4M72 A;  2OQG A;  1MH4 A;  1AA7 A;  3ZMV A;  1OYW A;  4UY8 I;  1JXS A;  1XGO A;  3FXU A;  4JX6 A;  1FYM A;  1H9T A;  4M3B A;  3S1Q J;  2XV4 S;  4RGS A;  3G73 A;  1H89 C;  2JPC A;  4NDL A;  4UHT A;  1U5T B;  3CP2 A;  3JRC A;  2CRG A;  2DI3 A;  2W85 A;  1LDK B;  5E8I A;  2J5P A;  5L3C A;  2BW3 A;  2GZW A;  2X1E A;  5L3E A;  3QQA A;  4HLX A;  1IRG A;  3OYD A;  3CCS I;  4HW0 A;  2BVM A;  1BOB A;  3S2H J;  3BG3 A;  1R6R A;  2CH0 A;  1KGS A;  2ECB A;  3ZQL A;  2JQ7 A;  4A6D A;  5FRN A;  2EJR A;  3KLN A;  4XSZ F;  4I0B A;  3WTW C;  2XAF A;  4GGG A;  1YS6 A;  1AKH B;  4XRM A;  3AAF A;  2R4G A;  3E5Q A;  2AO9 A;  4KIC A;  5LRS A;  2CG4 A;  2NS7 A;  2L9S A;  5CLS A;  3SZT A;  3PNT A;  2UWM A;  4YEJ A;  3DKY A;  3F8B A;  2DQR A;  3V7R A;  1UG2 A;  1A04 A;  4KIF A;  1YJN I;  1LE8 B;  2I10 A;  1BOA A;  2F48 A;  1ETW A;  1JUP A;  2DTR A;  2E60 A;  3LSK A;  1USS A;  4PSX A;  3K4N A;  3RSN A;  1GVD A;  1ZGA A;  2VJ5 A;  5F1J A;  1TTY A;  1HKT A;  3I4N J;  1D5Y A;  3T0Y A;  5FFX A;  4U88 A;  1VF9 A;  3I71 A;  3BQY A;  4X6A J;  1P2F A;  5GTH C;  2K9Q A;  4MHG A;  1UAA A;  2V9P A;  5CPR B;  5HLT A;  3H92 A;  3M4O J;  2DCE A;  1PYV A;  1ZHF A;  2L01 A;  1O4X A;  2ETH A;  1FOW A;  1J9I A;  3JTG A;  1FYL A;  3HPH A;  3J7A O;  1G3S A;  2EA2 A;  2G7H A;  2QQ9 A;  1P7I A;  2M45 A;  1MJ9 A;  3OOP A;  4M6Y A;  4G7O F;  1SAN A;  2EA4 A;  4BQO A;  4DGW B;  2IT0 A;  3GEZ A;  5EGO A;  5L3D A;  4L5I A;  1OCC H;  4CUG A;  2DO7 A;  5CYV A;  1LQ1 A;  1LPQ A;  4EJT A;  1YQA A;  3GW2 A;  1T6S A;  2KKO A;  3ULQ B;  3LNQ A;  1P4W A;  2EFP A;  3HIF A;  4HLY A;  2OA4 A;  3H5A A;  1K83 J;  5EZH A;  4UB8 C;  1FOK A;  4BE1 A;  4BHP A;  3IRR A;  2K85 A;  3RPU A;  1G3T A;  3WU0 A;  1ONV A;  1XCV A;  4UUS A;  4AD9 A;  4P5O A;  5IOZ A;  2HPI A;  2HEO A;  2HOT A;  4O5V A;  2GOX B;  2GWR A;  1BA5 A;  3BT9 A;  4QSH A;  3OL4 A;  5JI6 A;  1F1Z A;  3ISP A;  5L3F A;  3WTV C;  1HF0 A;  3HOW J;  2ZNY A;  3IL2 A;  3GZN B;  1F9N A;  3PSF A;  2ACJ A;  1EKE A;  2VJJ A;  3TOA A;  1MJA A;  2IA1 A;  3HSF A;  5TJJ A;  1UG0 A;  2MSY A;  3NEU A;  1PUF B;  4HEA 2;  1WH5 A;  4I02 A;  2VUM J;  4N0B A;  3KEY A;  1TNT A;  4BKX A;  3OS2 A;  1MMA A;  4J01 A;  3CES A;  1IAW A;  5IYD J;  4NNJ A;  2JTV A;  2ZXI A;  4HV5 A;  4A0X A;  3OWT A;  2VJ4 A;  1CF7 B;  2LKX A;  1X3Z B;  1Y0U A;  2EFQ A;  2EK5 A;  1XCB A;  1KA8 A;  1QZZ A;  2LP0 A;  3F8N A;  5GPC A;  1EH6 A;  5K5Q A;  4E7L A;  3PM1 A;  1MBG A;  3D0S A;  4Y15 A;  2DMT A;  9ANT A;  1XSV A;  3EUA A;  1ETY A;  1MNM C;  3W6K B;  3RIR A;  3I4M J;  1FMV A;  1UZC A;  2KHM A;  1ON2 A;  2IJL A;  3HG9 A;  5DTD A;  4BBR J;  2NVQ J;  5FD6 A;  4L9T A;  1RPW A;  3FM5 A;  2RNJ A;  2CGP A;  1D1B A;  2FF4 A;  5HDN A;  4UB6 C;  4FHT A;  5KAI C;  2HKO A;  2WV0 A;  3HGG A;  1RC9 A;  3F72 A;  1MKM A;  3AG4 H;  1KQ8 A;  3S1R J;  4AU7 A;  3S3O A;  3RZD J;  1I6X A;  2EZI A;  1ZRC A;  4XM3 A;  4D5C A;  5FKN A;  4EMS A;  4KT5 C;  3TW6 A;  4CCJ A;  3M8J A;  3BG9 A;  4R1H A;  5DD4 A;  1KU7 A;  4C3J J;  1HDD C;  3RCO A;  4BY1 J;  1QQI A;  3O3K A;  4YEL A;  5H20 A;  3OYI A;  2LKP A;  2EIK H;  2JZY A;  2VE9 A;  2E2J J;  3HOV J;  4S04 A;  3OYG A;  4I76 A;  1JHF A;  2ZME B;  5DDG A;  3HKZ A;  1O3T A;  3HM5 A;  2M3A A;  1S7O A;  1K78 A;  1F43 A;  1R71 A;  4RDU A;  3HOU J;  2W82 A;  5DYM A;  4HQE A;  1AHD P;  4A3L J;  4NHJ A;  2VBY A;  4IHY A;  1Z7L A;  2XF6 A;  2ZME C;  2HQ5 A;  2V6C A;  4FIS A;  3MKZ A;  3HBL A;  3GZ6 A;  4ZYA A;  1SFO J;  3VDX A;  1QPI A;  3C18 A;  5CVR A;  1W5C C;  2QSF X;  4IHW A;  3JSO A;  3J7A Y;  2M8E A;  2VAS A;  1WZ2 A;  1I50 J;  3LSP A;  2XRL A;  2VN2 A;  2BXZ A;  4NC7 A;  4V2F A;  2KIU A;  2QA4 I;  2R5Z B;  1QVU A;  5B3S H;  2XAG A;  1Y1W J;  1PDN C;  2E1C A;  3OSF A;  1FYK A;  1X1P A;  3CUO A;  2PMZ N;  3GVA A;  2D5V A;  3X2Q H;  4HNT A;  2DOE A;  2HI3 A;  1BI2 A;  3H0G J;  3U2R A;  2DA5 A;  2HGC A;  1Y6I A;  1TP4 A;  2DDB A;  2DXI A;  5L3B A;  2R7W A;  2XAQ A;  4FET A;  1TWH J;  1IV6 A;  1BW6 A;  3AG1 H;  1ODD A;  3BTL A;  2M30 A;  4ITV A;  2H27 A;  2ELK A;  2I8D A;  1VQ7 I;  3F8M A;  1Y1V J;  2EFO A;  2I5U A;  4IJA A;  3N4M A;  3QU6 A;  1SVL A;  1QHG A;  2ID3 A;  2X0L A;  2W4S A;  4MFD A;  4A3F J;  2LBF B;  3QRF F;  3L1P A;  4LIT A;  2P7C B;  3B6C A;  2DPU A;  3QPL A;  2HWV A;  1N78 A;  2Z2S B;  4ZC3 A;  1IDZ A;  4EJW A;  2NVX J;  2HYF A;  3ZGK A;  3ZQQ A;  2VKE A;  2A68 F;  5HVQ C;  2M9H A;  3IUO A;  1WJC A;  3SFZ A;  4BEH A;  2WA0 A;  3M1E A;  4DNC A;  4WK8 F;  5HS7 A;  2XRN A;  1MBK A;  5HNF A;  2MGQ A;  2IAI A;  2R7S A;  3JRF A;  2R7Z J;  4Y52 J;  2DT7 B;  3I4P A;  2F4I A;  2DT5 A;  4NB5 A;  1X1A A;  3SZP A;  3WTZ A;  2ZJQ F;  5IT9 Z;  2CV0 A;  2HVS A;  4HG2 A;  2QKL B;  2DYS H;  1G59 A;  2RN7 A;  4L5J A;  3E5X A;  3IAS 2;  1Y56 A;  3G6E I;  1APL C;  3NAU A;  1BN5 A;  1S6L A;  1U8B A;  4Q48 A;  4NBQ A;  3EUH C;  2JSC A;  3ERM A;  1P9Q C;  2XAU A;  4QTR A;  4XK4 A;  3PQK A;  2L7Z A;  1ZRE A;  5HDK A;  2KQR A;  3I0T A;  3I55 I;  5J4Y A;  2G0E A;  1W0U A;  4F3Q A;  3DEU A;  4CCM A;  1UHM A;  4BH9 A;  2ZXW H;  1R22 A;  1ZLJ A;  2P5K A;  2D1V A;  3A01 B;  2JMW A;  1P7J A;  5C3E J;  1SD4 A;  4IHS A;  1RES A;  4KA4 A;  5FLX Z;  3J81 Z;  3ZP5 A;  2V9K A;  1X1D A;  1BW5 A;  3VOD A;  3DF8 A;  5C4J J;  4XNF A;  3I9V 2;  3WGH A;  3GXO A;  4K2E A;  3KEQ A;  4MLO A;  1TQP A;  3HOY J;  1LVK A;  4I99 C;  3JSP A;  4QWQ A;  4D0P A;  3TOB A;  3V4G A;  3M1C A;  3QP6 A;  2FQ3 A;  2EV5 A;  2H6C A;  3BTI A;  1A36 A;  1MMG A;  4MIM A;  1IRF A;  3ELK A;  2QCO A;  2P8T A;  1DPU A;  2HZD A;  2DTZ A;  2QLZ A;  4Y33 A;  2O61 A;  5FKM A;  1T38 A;  3CCE I;  4FCY A;  3LSI A;  1FTZ A;  3EDP A;  3HDD A;  4UNO A;  4XMY A;  1XC5 A;  3GTG J;  3FBI B;  1ORK A;  2PMH A;  3PIP F;  2DFH A;  1KON A;  3GTL J;  4BDZ A;  2LDU A;  2QBY B;  2IXS A;  3OYK A;  3LA2 A;  3A2K A;  3CDL A;  4KFC A;  4A3M J;  2ZC2 A;  4NUB A;  1IN8 A;  5D4R A;  3ZN1 A;  2W84 A;  1O7L A;  1WRJ A;  2RGV A;  4A69 C;  4IKF A;  4PSW A;  2DK5 A;  4OOI A;  1MZB A;  1YW8 A;  3HTS B;  4OIQ F;  4GRI A;  3TO9 A;  2VXD A;  4IF4 A;  4EEF G;  2FD5 A;  4A2U A;  5KAF C;  4YRV A;  2RRE A;  3BJO A;  2LG4 A;  3PO3 J;  2GAU A;  3S3M A;  5LEJ A;  1UHS A;  4ZTF A;  2KRH A;  4H4K C;  2OCE A;  3OYM A;  3DEE A;  5FFZ A;  1FIP A;  2MH2 A;  2XPV A;  4KN4 X;  3FZV A;  3BPV A;  1RR8 C;  5M3M J;  1ZG5 A;  3VPR A;  2DLL A;  3OSG A;  3VYT B;  5J1R A;  3DPT A;  3ZMU A;  1M1E B;  3G4S I;  4MQ9 F;  4UUT A;  1VQ8 I;  1QZE A;  2IGK A;  3HYI A;  2DQL A;  2ESN A;  2XGC A;  2PN6 A;  3EUK L;  2QKM B;  4PFP A;  2JN6 A;  4V19 K;  1EF4 A;  2Z1D A;  5EEG A;  2YU3 A;  4CSW A;  1E2X A;  2XIG A;  4ZYD A;  2ZFW A;  2Z3Y A;  1VZ0 A;  4GYI A;  4P9F A;  4XSX F;  4C2M J;  2L02 A;  4L5E A;  4XLP F;  2X6O A;  2P6S A;  5E8G A;  3LA3 A;  4MNU A;  1JHH A;  2MBF A;  5CQG A;  2ZJP F;  4H0E A;  3L2U A;  2UZK A;  3H9J A;  1HC8 A;  1FT9 A;  2TRT A;  1OCP A;  4KT6 A;  2NNN A;  1PVE A;  4E7H A;  5FKL A;  1D1C A;  3W2W A;  1ULY A;  5CKT A;  5J1U A;  3IV5 A;  5KVR A;  2DA4 A;  2X1C A;  3WHB A;  3BTJ A;  3H9Q A;  1MJB A;  4GO1 A;  1BR2 A;  2NNY A;  1ZTR A;  4E7S A;  1PP7 U;  5FKK A;  1QA6 A;  5DD8 A;  2ZBK A;  1IXC A;  2GBY A;  3C2G A;  1WJF A;  1X4P A;  1BBY A;  4PGH A;  4AWX B;  1V5G A;  3T5X A;  1MMS A;  1IG7 A;  4JX4 A;  1SD5 A;  3VYR B;  3HJE A;  4EQQ A;  1E3O C;  3SEZ A;  4LD5 A;  2VQH A;  3JRD A;  3RYR A;  2HU9 A;  3BLY A;  3E6B A;  2E2H J;  2B9S A;  3RKY A;  2R7V A;  2P6T A;  2FOW A;  2KMU A;  4F7Z A;  3P9I A;  4HDV A;  2Y75 A;  4KJZ A;  3ONQ A;  1MDM B;  1SFU A;  5IT9 K;  3RZO J;  3K1P A;  2AHQ A;  4C9Y A;  1GV5 A;  1LFU P;  1B8I B;  4LB5 A;  1FBS A;  3MAJ A;  2MLK A;  3WE2 A;  3CO7 C;  2NXN B;  3K1M A;  1OYI A;  2YS9 A;  4HDU A;  2CFO A;  1FTT A;  3E97 A;  3ABK H;  3A0B C;  4UV9 A;  2R5Y B;  2FA5 A;  5HS8 A;  4CCN A;  2BGC A;  2LRE A;  3M3Y J;  4IRH A;  1TT0 A;  1IV8 A;  3L2W A;  5E17 F;  1GV2 A;  4WX9 A;  3CMM A;  1J75 A;  3CC2 I;  2L7K A;  2X48 A;  4M9S A;  1SFK A;  2M4G A;  5FLX K;  4I2O A;  3ECO A;  2Y0S A;  4G8X A;  2K9N A;  3PL8 A;  4HF2 A;  1DQU A;  5B1B H;  1REP C;  1RUN A;  3G1O A;  2H1K A;  2K4B A;  1ZG3 A;  5DV5 A;  2A5Y B;  3D1N I;  2IA2 A;  2O03 A;  2DMN A;  3FKJ A;  5B66 C;  3L2V A;  3CCR I;  4HX8 A;  5K1Y A;  1KU2 A;  4I7H A;  3MN2 A;  5GP9 A;  4AUX A;  1A31 A;  3A1Y A;  3EUH A;  4F55 A;  1G6N A;  2VBX A;  5IT3 A;  2FBI A;  1O7F A;  2K9L A;  3P7N A;  2XSD C;  4DOZ A;  1JTY A;  2Q1Z B;  4FQG A;  2QSH X;  2JA6 J;  3S2D J;  4P9U A;  3DLL F;  1P4X A;  3MMY B;  5D5V B;  3OOU A;  2XRO A;  3ZCO A;  3U9G A;  1HXD A;  1X19 A;  4KN7 X;  3CCU I;  5F08 A;  3OYB A;  1HW5 A;  3E6D A;  2RNG A;  1G2H A;  4PCQ A;  3IH2 A;  4ENJ A;  2YUS A;  4A0Z A;  3S16 J;  4DBQ A;  2PMZ A;  4ENK A;  2PLY A;  2VOP A;  2BXY A;  2KJB A;  2JWT A;  1WJB A;  3K70 C;  4BDY A;  3KIO A;  1J59 A;  2BHZ A;  2R7Q A;  1GDT A;  2CQK A;  2VQG A;  4DJA A;  1DU6 A;  1HST A;  2XDV A;  4HV6 A;  3OYL A;  1ZEL A;  4ZH4 F;  1ZGW A;  4B44 A;  3LST A;  1NK3 P;  2FOK A;  2LRD A;  3DXJ F;  4ETS A;  1Q1H A;  2LKS A;  2QUF A;  1XGM A;  4U7B A;  1Z3X A;  2IS2 A;  2STT A;  4KMU X;  4D5F A;  4ZTJ A;  3L2C A;  2DMQ A;  3P5J A;  2ME6 A;  2HOE A;  4CHU A;  1TWC J;  3A4C A;  3V42 A;  5LHH A;  1VQL I;  2IBD A;  1U5T C;  1OKR A;  5EEA A;  1R4N B;  4HZF A;  4F91 B;  3M8E A;  4CZZ A;  3KYC B;  4X1E A;  4DYC A;  3COA C;  1WJE A;  3BG5 A;  4XN0 A;  5EYR A;  4BQN A;  2A07 F;  4YG2 F;  1A6I A;  5F0H A;  4JP0 A;  5H6R A;  1SC7 A;  2L9R A;  1YIJ I;  4X0G A;  4G12 A;  2ZXJ A;  4DYR A;  4XKC A;  4BE0 A;  2F4M B;  3A0H C;  3I59 B;  4JBA A;  1X3W B;  1ZAO A;  4XON A;  1QBJ A;  5ILU A;  2MC3 A;  2CQ7 A;  4MTE A;  2E5Z A;  3N97 A;  2IGM A;  3DU6 A;  2E7W A;  2BVL A;  5HNH A;  3H3U A;  1MSF C;  3CDH A;  2AXL A;  4MO7 A;  1JKP C;  2HDC A;  4LK0 F;  1LB2 A;  3FXL A;  3CJT B;  4ZDP A;  5FJ8 J;  2GIV A;  2JA2 A;  2CU7 A;  1XDU A;  5F27 A;  3S1N J;  1YYV A;  2COB A;  3JR9 A;  1A6Q A;  3IWF A;  4ANJ A;  3G2B A;  3ABL H;  1JJ6 C;  2IEK A;  3K70 D;  4IO9 F;  1NHA A;  5E3L A;  1HBX G;  5CVI A;  2D45 A;  2QQ8 A;  3QPS A;  2D1H A;  1X58 A;  1E0E A;  3WU1 B;  3R61 A;  2NVT J;  2X85 A;  3TKY A;  3S8P A;  2K40 A;  2R7U A;  3FIS A;  1RI7 A;  3CME I;  1R49 A;  1WFX A;  1AU7 A;  1F5T A;  1RRJ A;  2VOO A;  1J0R A;  3FHZ A;  4R8H A;  5LBQ A;  2RQP A;  5M5Y J;  3OV8 A;  2KLO A;  4RLQ A;  4LG0 A;  1RR7 A;  3LQQ A;  2E2I J;  3VFZ A;  2BEO A;  2CW0 F;  4IRI A;  4IRG A;  3HSE A;  2HKX A;  3S14 J;  3QOD A;  2GXB A;  2DPD A;  2ME0 A;  4RA2 A;  1R5I D;  3LAJ A;  3BC8 A;  4I01 A;  2UXN A;  2VQL A;  3JRE A;  3GBG A;  5JLX A;  5BPI A;  3BZK A;  5CVJ A;  1SMT A;  2EIL H;  4IOC F;  4KIB A;  4JOM A;  4LMY A;  2AQF A;  2ISY A;  4CYC B;  3KP2 A;  3PFI A;  2M0C A;  3B02 A;  4XLH A;  2CQQ A;  2Y30 A;  3UR3 C;  2E19 A;  3GLX A;  1U2W A;  2CWE A;  3LFK A;  3Q5F A;  2Y48 A;  5E18 F;  1LFP A;  2HXO A;  2OQR A;  5J40 A;  3P9C A;  2N8G A;  1FSE A;  5FO5 A;  4LIU A;  1D5V A;  2LR8 A;  2MC4 A;  1DP7 P;  1QNT A;  1TQI A;  3IP4 B;  3CZ6 A;  3TDZ C;  2WAD A;  1FLI A;  1LKX A;  2CW8 A;  2CYY A;  1KYW A;  2X9D A;  4EV0 A;  2HVQ A;  2PG4 A;  2NAZ A;  1FEX A;  3CUQ B;  1ENH A;  2VIX A;  5GPA A;  4A3D J;  4BS9 A;  1ZG1 A;  1D1A A;  3TL4 X;  3H5N A;  1BM9 A;  1ZYR F;  1WJD A;  1S5L C;  1XDS A;  2QEN A;  4XQF A;  4U0V A;  2RAE A;  3L00 A;  1IN5 A;  3WHC A;  4A5N A;  2O8K A;  2E7X A;  2EWN A;  2CMP A;  3CCL I;  3CC7 I;  2BE5 F;  4WXC A;  2DFE A;  3OY9 A;  4UVA A;  1GT0 C;  5E3N A;  1D0X A;  1TWF J;  3W3C A;  3S1M J;  3BOQ A;  2L4A A;  4M74 A;  3HHG A;  2DMP A;  3TGN A;  1FOY A;  2R5Y A;  1BC7 C;  4RGR A;  1RKW A;  1D8K A;  3CO6 C;  2MH9 A;  3DBL B;  4KNY A;  2BZT A;  1IRZ A;  3E1S A;  2PQ8 A;  4ENM A;  1YW9 A;  3F21 A;  2R7T A;  2UXX A;  4OAZ A;  1SFE A;  2FSW A;  3OYA A;  1JJ8 C;  5ILS A;  2Y0M A;  3F6V A;  4CGZ A;  1BI1 A;  3HC7 A;  4A3G J;  2VC0 A;  4ZJZ A;  3RPQ A;  3OMY A;  1YIO A;  2L3D A;  3F8C A;  2L5Q A;  1DU0 A;  4AID A;  2KIF A;  3KE2 A;  1MD0 A;  4A5M A;  1S29 A;  3HRU A;  2VKD A;  2EBI A;  4LIV A;  2MLG A;  3S32 A;  2Q8K A;  2P81 A;  3QYB A;  3KYD B;  1QVT A;  3GCM A;  2LMD A;  3SZG A;  3CF2 A;  5BS6 A;  5K7F A;  2QVO A;  3JRG A;  4II2 A;  2H8W A;  4UXN A;  4FX0 A;  4Y17 A;  3GTO J;  3BDD A;  2LY2 A;  1ETX A;  5D6E A;  3IHU A;  4LK1 F;  2QSG X;  3DTE A;  1LNW A;  3IAM 2;  4OIO F;  5GAD J;  1WWX A;  2XAS A;  2H09 A;  2OV7 A;  2Z33 A;  2RV8 A;  2VLA A;  4HOB A;  5HS9 A;  2ZFU A;  4YIF A;  5DCM A;  3HUG A;  5DCF A;  3SHF A;  4BHB A;  5HLG A;  2WAQ N;  2A6E F;  1YIT I;  5BPD A;  2XKO A;  2KRF A;  3BCB A;  1JUS A;  3M9A A;  3QYE A;  4LLL A;  2LYC A;  4AM3 A;  5LGU A;  4A3J J;  1RIO H;  4HNU A;  3DFG A;  2M7A A;  1ON1 A;  1LEA A;  5D5W B;  1WJA A;  4XKB A;  4FT8 A;  5KNL A;  3IC7 A;  4C3H J;  4G6D A;  3OYH A;  2HDD A;  2KL4 A;  1I39 A;  3ZMT A;  1BIB A;  4OU0 A;  3ROU A;  2IS1 A;  1J7K A;  3AL0 B;  3CCQ I;  1UFM A;  1U5T A;  1JI8 A;  3K2Z A;  1ZR2 A;  3D5L A;  1LDD A;  1SD7 A;  2R7O A;  5DEQ A;  2Z99 A;  5AIP A;  3JRB A;  1XMA A;  2VPR A;  3HTU A;  4RB3 C;  1VQO I;  2WTE A;  3AL0 C;  3ZQF A;  2CUJ A;  1F36 A;  3FM3 A;  4M9X A;  3F3X A;  3BQZ A;  2V26 A;  4RAZ A;  2OUM A;  4KIS A;  2GXA A;  4M9Z A;  4OIP F;  1K4S A;  2NOJ B;  2QWW A;  1EH8 A;  2MD5 A;  3G3Z A;  2EFN A;  6PAX A;  3KET A;  1GHC A;  1DP3 A;  1EA3 A;  1AKH A;  2DDA A;  5FLM J;  2JA8 J;  2ADU A;  1JKR C;  2DFF A;  3FK7 A;  5LHI A;  1VQN I;  1BI3 A;  2LTP A;  3Q3S A;  3RDI A;  4N9H A;  3VYU B;  3E3V A;  1ETO A;  3N05 A;  5F0C A;  1WCM J;  1U9O A;  5BNG A;  2FE3 A;  3FXQ A;  5EG0 B;  5AIQ A;  3L7W A;  5L3G A;  2W1O A;  5F64 A;  3PIO F;  2CUZ A;  3MFK A;  1LE8 A;  1JGS A;  2E71 A;  2WAF A;  1X3U A;  5IYC J;  4YFK F;  2HOA A;  2L9V A;  2ZJ2 A;  1MMD A;  1XB4 A;  2L2O A;  1B72 B;  3SFI A;  1ZLK A;  4EAT A;  2XKP A;  4HPQ A;  2OTL I;  3L09 A;  2LNB A;  4BJT A;  1LVA A;  3KPH A;  1VQ9 I;  1T2K A;  3QAH A;  1OIS A;  1TBX A;  2OJE D;  1J2X A;  1OQY A;  1HQC A;  2YU9 J;  3IH4 A;  3OYF A;  2HYJ A;  4U7D A;  1JTX A;  4I6Z A;  1B1B A;  3MKY B;  3WG7 H;  3GME A;  4RAG A;  3ZQG A;  4HST A;  1N75 A;  3MD2 A;  4BHC A;  1W1W E;  2VOD A;  3RQ4 A;  3PUF A;  4LG3 A;  2A6H F;  5D6F A;  1V4R A;  1JKO C;  2HDW A;  4B4C A;  3ABU A;  2A6T A;  3ZPL A;  3B6A A;  5LEK A;  3KLO A;  1R5H A;  1STZ A;  2XAJ A;  3OIP A;  5KHD A;  1RET A;  4DYQ A;  1BIA A;  4DZJ A;  4M3E A;  2O9L A;  1IN6 A;  4L0Z B;  1YHQ I;  1ZH5 A;  3PNV A;  1EJ9 A;  2CV1 A;  3CCY A;  2J5O A;  5D5U B;  4FE7 A;  2DOF A;  5FKO A;  3SYT A;  1FNN A;  2F5F A;  1ZK8 A;  2DA7 A;  2EZK A;  4II3 A;  3K6G A;  2PBI A;  4IX7 A;  1XGS A;  1XN7 A;  2V9V A;  5FRO A;  1XTA A;  3LL7 A;  4RLF A;  3TO7 A;  3GTP J;  3J7Y J;  2K9S A;  3KP5 A;  1KU3 A;  3OYJ A;  4XBF A;  2X6X A;  3W6V A;  2P4W A;  3PQJ A;  4BQQ A;  1MW7 A;  2QQA A;  2VON A;  4AVP A;  1X1B A;  5J1Y A;  2FRH A;  4CYC A;  3LAP A;  4F93 B;  1NK2 P;  2XGE A;  1IC8 A;  3I64 A;  1O3Q A;  3A02 A;  1TLH B;  2OZU A;  2XB0 X;  2DA3 A;  3FF5 A;  2FBK A;  2BBY A;  2NVU B;  2F5D A;  3BR5 A;  2HPM A;  2OTJ I;  1PUF A;  1BJZ A;  3C7J A;  2ELH A;  3ZR8 X;  3MWM A;  4XR6 A;  3WGI A;  5GTI C;  2BW3 B;  2ISZ A;  3LWF A;  4BYY A;  3ABM H;  3FXM A;  1B9M A;  4OMZ A;  4A0Y A;  2XC7 A;  4AC0 A;  2KRC A;  4EM1 A;  2IPQ X;  2B7E A;  4YII A;  3H35 A;  5KK1 A;  2XGX A;  4O6J A;  4PJL A;  4WF2 A;  4XKW A;  4XLE A;  1CF7 A;  2W00 A;  3JRA A;  3CJR B;  1YLF A;  1ACI A;  3RJP A;  3PSI A;  1VQP I;  1U3E M;  4W97 A;  3HEF A;  1UHW A;  1XD7 A;  2QGU A;  1YTY A;  2A05 A;  1IN4 A;  3BR1 A;  1S7A A;  1D3Y A;  3DPL C;  4B48 A;  1NTC A;  3DBH B;  4I98 B;  5A2Q Z;  3RKX A;  1E3P A;  1BL0 A;  2FMY A;  5ICG A;  1YFH A;  1FSH A;  4RB1 A;  3MZH A;  3NRV A;  4ZDL A;  4ESB A;  2BOL A;  2FX0 A;  4BY7 J;  3OR2 C;  2G7U A;  4M6X A;  1N77 A;  2M0M A;  3KP7 A;  1OLT A;  4C2U A;  4KIT B;  2PJP A;  1HW2 A;  1A5J A;  1TL8 A;  3AKZ A;  3DLA A;  3IKT A;  3K7A J;  1H9G A;  5J3L A;  1MIJ A;  2PI0 A;  1KQ0 A;  2AS5 F;  3OYE A;  4YFX F;  3JW4 A;  1H8A C;  4HYE A;  1NH3 A;  2PJR B;  1IO2 A;  5JVT A;  3JTH A;  4LB6 B;  5AON A;  4Z2Y A;  1YJ9 I;  1IW7 F;  1LEB A;  4RB0 A;  5EDN A;  4P1W A;  3L9F A;  3EPZ A;  2WB1 N;  3GWZ A;  2DA2 A;  3FMQ A;  5E20 A;  4KUM A;  1NG7 A;  1K6O A;  1SAU A;  2ZME A;  2GIZ A;  2VKH A;  1QGP A;  1VI0 A;  2JA5 J;  1D0Z A;  5EGO B;  4D9J A;  3DKW A;  2QYO A;  3W2A A;  1OR7 C;  3DV8 A;  3WU2 C;  3EQL F;  3GYH X;  3QPH A;  1SVO A;  3REO A;  3T8T A;  1FZP B;  4I0A A;  5J47 A;  2ZXH A;  5E1W A;  2VB6 A;  3B73 A;  4E7I A;  5IOY A;  2NRA C;  1HOM A;  1RKT A;  4UUS B;  1IXS B;  4M6V A;  2DA6 A;  3F9K A;  3WTS C;  1V3F A;  1QO0 D;  2D2W A;  2EQR A;  3GLL A;  1Z0X A;  2R7R A;  4P96 A;  3TQN A;  2R5Z A;  1U8R A;  2O7O A;  5ERI A;  4ZYE A;  2R7X A;  3GFM A;  2MYS A;  4G94 A;  3AFH A;  2R7F A;  5ILV A;  2E5N A;  3ECH A;  2EH3 A;  2EV0 A;  1Z67 A;  1TZL A;  2GXG A;  3DTI A;  3KEO A;  4P55 A;  3G1M A;  3MEX A;  2EIJ H;  2DMU A;  1GUU A;  5E1X A;  3V8K A;  4M3G A;  3MVP A;  2K9M A;  3BR6 A;  2WY7 Q;  1I3A A;  4WXD A;  4Z6Y A;  1I6H J;  2CW7 A;  2HVR A;  4PJN A;  4MEX F;  5ICF A;  1WGX A;  3LSH A;  4JX5 A;  2YSR A;  4HNV A;  3K4M A;  2LBF A;  3NAR A;  1W4M A;  1D8J A;  1NG6 A;  3CLQ A;  2R92 J;  3TO6 A;  5BQT A;  3RKW A;  5D5X B;  3Q9V A;  2FJ1 A;  5CQE A;  4OIR F;  2COM A;  2M5W A;  2KDZ A;  4EJV A;  4IZZ A;  3ZMD A;  5KCM A;  2JSP A;  5FRM A;  5IP7 J;  2Y69 H;  4XOT A;  3ESW B;  1JT0 A;  5HLH A;  1V5F A;  1QZY A;  1Z3Y A;  2OU2 A;  3V7C A;  5M5X J;  3J80 Z;  3J81 K;  4HSR A;  2WC2 A;  5DM6 F;  4EGY A;  4AVZ A;  2MW8 A;  5IP9 J;  1K4T A;  1S8N A;  1XMX A;  3U21 A;  3PFY A;  2ZKZ A;  2RDP A;  1HKS A;  4N4O B;  1G8X A;  3BJA A;  5FGM A;  5B1A H;  2X6Y A;  4BQA A;  5K5O A;  3I56 I;  1RNL A;  4WCG A;  3F8F A;  4E70 A;  1ZAR A;  3G71 I;  2A69 F;  5DM7 F;  2HS5 A;  2LD5 A;  1DGW Y;  2XUB A;  3NWS A;  3NQO A;  2YPR A;  1X1C A;  2K4J A;  4E7J A;  2EIM H;  2LF8 A;  4XLC A;  3ZOB A;  4XOR A;  3HOZ J;  2OBP A;  2NS0 A;  2W57 A;  4EGZ A;  2HR3 A;  3K9T A;  2HYG D;  1S7E A;  2BYV E;  2MG4 A;  1TC3 C;  2MD0 A;  2WAQ A;  4Q47 A;  1O3R A;  1K78 B;  3FDY A;  4G7H F;  1DPR A;  1Q1V A;  4XIC A;  4E4H A;  4DQ2 A;  4BJ5 C;  4XN3 A;  2ESH A;  3VYS B;  1HLV A;  4RMN A;  1XGN A;  1HSJ A;  4EM0 B;  3A01 A;  2CUF A;  2O8X A;  3R0J A;  5DUI A;  3P9K A;  1Z05 A;  1K7A A;  2C6Y A;  3E6M A;  4OAY A;  4AIJ A;  2E34 A;  5IY5 H;  5F6F A;  5LGN A;  2LC2 A;  2VXZ A;  3H3Z A;  3CJN A;  2OD5 A;  2IVM A;  1R23 A;  2DJI A;  3CP8 A;  1S72 I;  1WHU A;  2XAH A;  1LDJ A;  3DWL E;  1JUM A;  3FK6 A;  3RQI A;  2LY1 A;  2BHY A;  3DEW A;  4BXX J;  5A2Q K;  3K69 A;  4Y13 A;  2FUG 2;  2ZSH B;  2WAE A;  3MZ8 A;  2XF7 A;  2Y2Z A;  1TW3 A;  1B6A A;  5GAG J;  1IGN A;  1I5Z A;  2K7L A;  3FIW A;  2RKH A;  3WOD F;  1SAX A;  3CMA I;  3LSJ A;  2F5C A;  1POG A;  1IF1 A;  3FXJ A;  4IXA A;  2DU9 A;  2NVY J;  4MEY F;  2Y31 A;  1FP2 A;  4CDG A;  1YOV B;  4G9Y A;  3V8L A;  4HF0 A;  2QBY A;  3H0D A;  2AXT C;  3BPX A;  4Y3O A;  1ZN2 A;  1J5Y A;  3BZC A;  3K4J A;  2TDX A;  4ZYH A;  4BAC A;  1DDN A;  2XHK A;  2ZB9 A;  1U78 A;  3W2V A;  2F6C A;  3SEQ A;  3IH3 A;  4HAM A;  1G4D A;  4DZP A;  4EJU A;  2GA1 A;  1QRY A;  4GDF A;  4E7Z A;  4XLN F;  1L0O C;  2O6G E;  2H8R A;  2L4M A;  3K4L A;  3FMR A;  3HPG A;  4IOA F;  1ETK A;  4BEH B;  3ZQC A;  1WJ5 A;  1MSE C;  1MND A;  1UEL B;  3ZQH A;  2LF7 A;  4L18 B;  1V54 H;  4O3M A;  2VT3 A;  4I09 A;  5FB2 A;  3J7Z I;  1FPQ A;  2DOA A;  3KCC A;  1YRN B;  4RM2 A;  1WVR A;  2H94 A;  1X4O A;  3GTM J;  1UJ8 A;  1Z7U A;  2L7F P;  4BNC A;  1OCO H;  4RBO A;  4IQ4 A;  1E3H A;  1YX5 A;  3HHH A;  3HZJ A;  3C2H A;  4XLF A;  3U1K A;  1Z21 A;  3ASN H;  1LJ9 A;  3BR3 A;  4AYB N;  4CIC A;  3MKW B;  1GXP A;  2GM4 A;  2V1U A;  5J8F A;  4CCK A;  4MQV A;  3I53 A;  4BAY A;  1PUE E;  1S9H A;  1YW7 A;  1XS9 A;  2E36 A;  3FKI J;  3FXK A;  3BRO A;  2CS3 A;  1YS7 A;  2JJ7 A;  2PJR A;  2PFB A;  2MAB A;  4CXF A;  2LSO A;  1XSX A;  5ICE A;  3GTK J;  2VL8 A;  2DBB A;  3CDI A;  3CCV I;  3LMM A;  1FOX A;  2YX4 A;  4Q5S F;  1OMI A;  2PEX A;  4KDP A;  2HTS A;  1T56 A;  1OR7 A;  2X1D A;  4PJ0 C;  4JQF A;  1WPK A;  3WE3 A;  2Q2E B;  3QPT A;  4F52 A;  2ICW G;  4KYW A;  4M3F A;  2LVS A;  3BCA A;  2LK2 A;  1I3Q J;  2KZG A;  3Q0U A;  5D8K B;  3LSG A;  3RI4 A;  3TMO A;  3RYP A;  1UCR A;  3SQN A;  2IRF G;  2L7M P;  3LFU A;  4IHX A;  5LFA A;  2VE8 A;  3M7G A;  1ETV A;  2K02 A;  3QOE A;  3FMS A;  4PZJ A;  5CVV A;  3JCU C;  4XOP A;  4D1Q A;  4LLN A;  3BR0 A;  2WY8 Q;  5IYB J;  3J80 K;  4HRI A;  4KIG A;  3BJ6 A;  2M87 A;  1KYZ A;  1MNE A;  1GXQ A;  2JRM A;  4Q4Z F;  3WG9 A;  3ERE D;  3BWG A;  1Y0N A;  2GQQ A;  3SJM A;  4HX7 A;  3CCJ I;  5LHG A;  2F5V A;  1TQM A;  1Z6T A;  4GYG A;  5EZG A;  1KQ9 A;  5JLW A;  2Q0O A;  3L2R A;  3HGY A;  4G7Z F;  4BGD A;  1G3W A;  1MDM A;  4ENN A;  2M1B A;  2DT6 A;  4PJJ A;  4B3A A;  4EVI A;  3T8R A;  3O8G A;  2V1X A;  4MGR A;  1B8I A;  2K3F A;  2EV6 A;  3CUQ C;  4B47 A;  2M34 A;  3JRI A;  1IN7 A;  2HXI A;  4N9I A;  2LLK A;  5D8L B;  3DTK A;  4A3E J;  5BOX A;  3HOS A;  2A61 A;  5IP6 A;  4RM3 A;  2EFW A;  5F04 A;  1FY7 A;  1QPM A;  2L0K A;  1Z91 A;  3V7S A;  3LOC A;  1K79 A;  3VOE A;  2WWY A;  3GZ5 A;  4WWC A;  2CO5 A;  5JR3 A;  5ICC A;  2EPF A;  2IA0 A;  3TP0 A;  3D5S C;  2R7D A;  3VB2 A;  2M4K A;  5LGT A;  5FLV A;  2HOS A;  3ZQ7 A;  3AG2 H;  2CSO A;  3WTU C;  3C2B A;  2WB1 A;  2QF7 A;  3ZN0 A;  1FX7 A;  2VKV A;  1X2N A;  2DJN A;  1J09 A;  4EJO A;  3O8H A;  3QU3 A;  4ZZL A;  2P5L C;  2F5E A;  5E3O A;  3PO2 J;  4BJ6 C;  2DOD A;  1CQT A;  2ZNZ A;  3DCF A;  1SD6 A;  1G3Y A;  1VQK I;  5LLQ A;  2WV1 A;  3PNY A;  3S3N A;  4IPA A;  3H9G A;  1T98 A;  2H1L A;  1YE9 A;  2JRT A;  4A93 J;  3EYI A;  1KU9 A;  2CFX A;  3K10 A;  4V2G A;  1K61 A;  1Y8R B;  3E6C C;  4QIW N;  4HQM A;  2OC6 A;  1I27 A;  2PMU A;  1LUJ B;  4OWR B;  3GFI A;  3OIQ A;  1VQM I;  5DUK A;  2E1N A;  2Y0S N;  1V5E A;  4PK4 A;  3R4K A;  3M8F A;  2JVH A;  3JAM Z;  3K4K A;  4Y7N J;  4Y4R A;  5F0F A;  4BXU A;  4LGW A;  4CO8 A;  4S05 A;  1ZR4 A; 
#chains in the Genus database with same CATH homology
 3BR5 A;  3M3Y J;  2DA1 A;  1PUF A;  1BJZ A;  3M4O J;  1O4X A;  2K9Q A;  1GV2 A;  5M5W J;  4AC0 A;  2X48 A;  3H3V K;  1P7I A;  4XRS G;  5EF6 A;  3JRA A;  2K9N A;  1SAN A;  3G1O A;  2H1K A;  5EGO A;  4W97 A;  3HEF A;  1FJL A;  2M8G X;  3D1N I;  3BR1 A;  2DMN A;  5M3F J;  3LNQ A;  1NTC A;  3MN2 A;  5GP9 A;  4AUX A;  1BL0 A;  1K83 J;  5EZH A;  1ITY A;  2XSD C;  2FX0 A;  1JTY A;  2JA6 J;  3S2D J;  4BY7 J;  3BTC A;  2XGD A;  1MBF A;  4UUS A;  3OOU A;  5IOZ A;  2CJJ A;  2LY9 A;  2HOT A;  4FE4 A;  1JT6 A;  1BA5 A;  3BT9 A;  4QSH A;  1A5J A;  2LFB A;  1HF0 A;  4GFB A;  5F08 A;  3K7A J;  3HOW J;  1G2H A;  3IH2 A;  5J3L A;  2YUS A;  3S16 J;  3MKL A;  2JWT A;  2MSY A;  1PUF B;  1WH5 A;  1XG1 A;  1H8A C;  4BBS J;  2VUM J;  1GDT A;  4BKX A;  1DU6 A;  5IPA A;  3F0C A;  5EDN A;  1ZGW A;  5C4X J;  5IYD J;  2ID6 A;  1NK3 P;  2WB1 N;  2DA2 A;  3TED A;  2OF7 A;  2LKX A;  1ZQ3 P;  1VI0 A;  4DW6 A;  2JA5 J;  3S15 J;  5EGO B;  1YRN A;  2LP0 A;  5GPC A;  1TWG J;  4D5F A;  3PM1 A;  1MBG A;  2DMQ A;  2DMT A;  2ME6 A;  9ANT A;  1ETY A;  1MNM C;  1TWC J;  4A3B J;  3I4M J;  3Q0V A;  2IBD A;  5EEA A;  5DTD A;  2Y9Y A;  4X1E A;  4BBR J;  2NVQ J;  1HOM A;  5IOY A;  4DYC A;  4MFE A;  1RPW A;  1RKT A;  3BG5 A;  4UUS B;  2EZL A;  4M6V A;  2DA6 A;  5EYR A;  1A6I A;  1MH3 A;  5F0H A;  4FTH A;  2EQR A;  2NS8 A;  3HGG A;  4JP0 A;  1Z0X A;  2L9R A;  2R5Z A;  3S1R J;  2O7O A;  4G12 A;  4DYR A;  3LSR A;  3RZD J;  3S17 J;  2EZI A;  4D5C A;  5FKN A;  2EH3 A;  3HB9 A;  3TW6 A;  3G1M A;  1VFC A;  2DMU A;  4J19 A;  1GUU A;  3BG9 A;  4M3G A;  4BY1 J;  4C3J J;  1HDD C;  3MVP A;  1MBE A;  1MSF C;  3BR6 A;  4MO7 A;  2Y9Z A;  1JKP C;  1I6H J;  2E2J J;  1WGX A;  3HOV J;  4JX5 A;  4I76 A;  5FJ8 J;  4ABZ A;  4HNV A;  2CU7 A;  3HM5 A;  3K2A A;  5F27 A;  1F43 A;  3S1N J;  3NAR A;  2COB A;  3JR9 A;  4RDU A;  2R92 J;  3HOU J;  4LOC A;  1AHD P;  4A3L J;  2FJ1 A;  3SDG A;  4IHY A;  1JJ6 C;  2HQ5 A;  2KDZ A;  2IEK A;  4FIS A;  1FIA A;  5E3L A;  3HBL A;  2XPW A;  5IP7 J;  3QPS A;  1SFO J;  1QPI A;  1X58 A;  1JT0 A;  5M5X J;  2NVT J;  4IHW A;  2MW8 A;  5IP9 J;  1X2M A;  1I50 J;  2K40 A;  3LSP A;  3FIS A;  2XRL A;  2CUE A;  1AU7 A;  3GTQ J;  2JA7 J;  3OIO A;  4V2F A;  2R5Z B;  2W48 A;  5M5Y J;  1QVU A;  3HOX J;  1Y1W J;  3OSF A;  1RR7 A;  2M2E A;  2R93 J;  2PMZ N;  2D5V A;  2E2I J;  4XRS A;  2LD5 A;  2HI3 A;  3H0G J;  2CQX A;  2DA5 A;  3S14 J;  3ZQI A;  3ZOB A;  2ME0 A;  1IV6 A;  1TWH J;  3HOZ J;  1BW6 A;  3BTL A;  3GTJ J;  2GLO A;  3JRE A;  3GBG A;  5JLX A;  1S7E A;  2ELK A;  2TCT A;  2MG4 A;  4S0H B;  1TC3 C;  1Y1V J;  1JGG A;  4CYC B;  2M0C A;  1IDY A;  2ID3 A;  4A3F J;  4MFD A;  2CQQ A;  2Y30 A;  3L1P A;  3B6C A;  2E19 A;  1Q1V A;  4XIC A;  1IUF A;  5K7Z A;  3QPL A;  5HOD A;  2HXO A;  1HLV A;  5K7H A;  3A01 A;  2CUF A;  1IDZ A;  1LFB A;  1ETQ A;  2NVX J;  2N8G A;  2VKE A;  5C44 J;  2LR8 A;  2M9H A;  4A3I J;  1WH7 A;  1OJL A;  3E7L A;  4D7N A;  3RKQ A;  2X9D A;  1MBK A;  2MGQ A;  1JUM A;  2IAI A;  3FK6 A;  3RQI A;  3JRF A;  2R7Z J;  1FEX A;  3Q0W A;  1MBJ A;  1ENH A;  3DEW A;  4BXX J;  4Y52 J;  5GPA A;  4A3D J;  1WI3 A;  1OCT C;  2Y2Z A;  1IGN A;  2DN0 A;  4A3C J;  2RAE A;  2OPT A;  3FIW A;  1TWA J;  3WHC A;  3LSJ A;  3G1L A;  3TW7 A;  2O8K A;  1POG A;  3JRH A;  1APL C;  3NAU A;  1GT0 C;  5E3N A;  1U8B A;  1TWF J;  2NVY J;  3S1M J;  2Y31 A;  2R5Y A;  2DMP A;  2XB5 A;  1RKW A;  4QTR A;  4XK4 A;  2L7Z A;  3UKG A;  3HKZ N;  1IRZ A;  1HCR A;  2JK3 A;  1MBH A;  2G0E A;  1W0U A;  5E3M A;  2ZB9 A;  1U78 A;  2FQ4 A;  1JJ8 C;  3IH3 A;  3CQZ J;  4DZP A;  2EZH A;  3A01 B;  4A3G J;  2JMW A;  1P7J A;  5C3E J;  1QRY A;  1RES A;  4XID A;  1JKQ C;  2H8R A;  1BW5 A;  1DU0 A;  1ETK A;  3ZQC A;  1MSE C;  5C4J J;  2EBI A;  3ZQH A;  4MLO A;  1T33 A;  2P81 A;  1QVT A;  4IEJ A;  3HOY J;  5K7F A;  1YRN B;  3JRG A;  2KT0 A;  3GTM J;  3GTO J;  3BTI A;  1ETX A;  1VND A;  4MIM A;  1R9T J;  2QCO A;  2L7F P;  4W1U A;  4RBO A;  2DTZ A;  4D7M A;  5FKM A;  2B63 J;  3BR3 A;  4AYB N;  2GM4 A;  4FCY A;  1FTZ A;  3HDD A;  1XC5 A;  3GTG J;  1ORK A;  1HDP A;  4A3K J;  1XS9 A;  3FKI J;  5EG0 A;  2ECC A;  3GTL J;  2WAQ N;  1OFC X;  2E1O A;  2JJ7 A;  3CMY A;  3CDL A;  2R0Q C;  4A3M J;  1JUS A;  3GTK J;  1B72 A;  4A3J J;  3BR2 A;  4A69 C;  2HDD A;  4C3H J;  3A03 A;  1T56 A;  4JYK A;  4IHV A;  4M3D A;  1WPK A;  4EEF G;  2FD5 A;  1ZR2 A;  4M3F A;  2LVS A;  1H88 C;  2LK2 A;  1I3Q J;  3PO3 J;  3Q0U A;  3JRB A;  1IJW C;  2VPR A;  3LSG A;  4C3I J;  3TP3 A;  1UHS A;  3ZQF A;  1F36 A;  2L7M P;  4IHX A;  3BQZ A;  4B1R A;  1ETV A;  1FIP A;  5DS9 A;  2XPV A;  2XPU A;  5M3M J;  3VPR A;  3OSG A;  5J1R A;  3BR0 A;  5IYB J;  4UUT A;  1UMQ A;  1AKH A;  5FLM J;  1W0T A;  1JKR C;  2JA8 J;  1Z77 A;  3FK7 A;  2XGC A;  1ZKG A;  2LTP A;  3Q3S A;  2NOG A;  1ETO A;  2JN6 A;  5F0C A;  1WCM J;  1U9O A;  5BNG A;  3SJM A;  1EF4 A;  5EG0 B;  1U9N A;  1LE8 A;  5EZG A;  5JLW A;  3HGY A;  4C2M J;  5IYC J;  2VI6 A;  4L5E A;  2X6O A;  2HOA A;  1MH4 A;  1B72 B;  3SFI A;  4B3A A;  3O8G A;  1B8I A;  4JX6 A;  4M3B A;  2TRT A;  1OCP A;  3S1Q J;  2M34 A;  3JRI A;  5FKL A;  2HXI A;  2LLK A;  1H89 C;  2YU9 J;  4NDL A;  5J1U A;  3IV5 A;  4A3E J;  3IH4 A;  2DA4 A;  2HYJ A;  3WHB A;  3BTJ A;  3JRC A;  1JTX A;  2CRG A;  5IP6 A;  4I6Z A;  5F04 A;  2L0K A;  3ZQG A;  3LOC A;  1ZTR A;  5FKK A;  3TP0 A;  3QQA A;  2GBY A;  1JKO C;  5FLV A;  2HOS A;  3S2H J;  3BG3 A;  2ECB A;  4B4C A;  3ZQL A;  3C2B A;  1IG7 A;  2QF7 A;  3B6A A;  4JX4 A;  2VKV A;  1X2N A;  2DJN A;  1E3O C;  1RET A;  4DYQ A;  3O8H A;  4DZJ A;  4M3E A;  1AKH B;  4XRM A;  2O9L A;  5E3O A;  3PO2 J;  3JRD A;  2AO9 A;  2NS7 A;  1CQT A;  3CCY A;  2E2H J;  3DCF A;  4FE7 A;  5FKO A;  1UG2 A;  2WV1 A;  1ZK8 A;  2DA7 A;  1LE8 B;  2I10 A;  2EZK A;  4A93 J;  3RZO J;  2AHQ A;  1ETW A;  1JUP A;  3GTP J;  4V2G A;  1K61 A;  1GV5 A;  2K9S A;  1LFU P;  1B8I B;  1GVD A;  4QIW N;  3W6V A;  5F1J A;  5J1Y A;  3I4N J;  2YS9 A;  2Y0S N;  4CYC A;  1D5Y A;  1FTT A;  4Y7N J;  1NK2 P;  2XGE A;  1VF9 A;  1IC8 A;  5F0F A;  3A02 A;  3BQY A;  4X6A J;  1ZR4 A;  2R5Y B;  2DA3 A;  2XB0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...