4A3FJ

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3fJ00
2FQ4A 1VFCA 1MBGA 1RKTA 2K40A 2LVSA 5J1YA 1HF0A 2DA6A 4BBSJ 1A5JA 2YU9J 1GV2A 2XGEA 1X2NA 4XICA 3M4OJ 3W6VA 1U9NA 3WHBA 4BY7J 5EZHA 1IG7A 4A3BJ 5EYRA 2DA4A 1IGNA 3Q0VA 2XGDA 3PO3J 4W97A 4C3HJ 2EZKA 3K2AA 2XPVA 4A3LJ 1W0TA 2CUEA 2EZIA 3SDGA 4BBRJ 3BG5A 4DZJA 4FISA 1POGA 4JP0A 2IBDA 2MGQA 3QQAA 4RDUA 2R5ZB 3O8GA 5M3MJ 3OSGA 1F36A 1MH3A 1FTTA 1MSEC 2JJ7A 4AC0A 4A3IJ 2PMZN 1I3QJ 2D5VA 4B4CA 2K9NA 2COBA 3BR5A 2W48A 2DA7A 2E1OA 3SJMA 3B6AA 1OFCX 2EZHA 2OPTA 1ZR4A 1XG1A 1JKPC 3MVPA 3JRGA 2QF7A 2HQ5A 2TCTA 3BR1A 5K7FA 1ITYA 2VUMJ 1AHDP 4DZPA 3TP0A 1ORKA 4FE7A 1B72A 4M3BA 1EF4A 3GTMJ 1IDYA 1MBKA 2EH3A 1ETYA 2CQXA 3ZQLA 2HXOA 1JKOC 1OCPA 2MG4A 3BQYA 3CCYA 2H8RA 2XB0X 1NK2P 3BR0A 1SFOJ 1FJLA 1G2HA 4A3GJ 1U78A 1F43A 3B6CA 1MSFC 2R5YB 1GT0C 1ETKA 3JRFA 1JTXA 4G12A 4L5EA 1U9OA 3C2BA 5EF6A 5F0CA 3HB9A 5J1UA 3BG3A 1H8AC 1T33A 2CUFA 1NK3P 3HOUJ 3ZQCA 3FIWA 3JRHA 2DA2A 5DTDA 2CRGA 2ME6A 2M34A 2Y30A 2IAIA 1LE8B 1JUPA 5JLWA 4XRSA 2LFBA 3BR3A 2DJNA 5C3EJ 5E3NA 5E3OA 1WH5A 5EDNA 3S1MJ 2LY9A 5FKOA 3HOVJ 5J1RA 3RKQA 4QTRA 1HDPA 1QVTA 1WPKA 4BXXJ 2Y0SN 3S1NJ 1QRYA 1MH4A 3S15J 2DTZA 4DYQA 3FK7A 2R5YA 2DA5A 2FD5A 1YRNB 3CDLA 2KDZA 4A3MJ 5K7HA 1AU7A 4MLOA 2Y31A 3GTQJ 1IC8A 1JJ8C 4LOCA 3MKLA 5C4JJ 3QPLA 4XRSG 4IHXA 5GPAA 4GFBA 2XRLA 2NS8A 3GTPJ 3M3YJ 3GTGJ 4B3AA 4UUSA 3GTJJ 3HM5A 1NTCA 2P81A 5F08A 4Y7NJ 4QSHA 4I6ZA 3BR6A 1VF9A 2DA1A 1Z77A 1BW5A 5K7ZA 5JLXA 3S2DJ 1TC3C 4CYCA 1AKHB 1APLC 1TWCJ 2LP0A 3VPRA 2JMWA 4M3EA 5EZGA 1P7IA 3LOCA 5EEAA 4J19A 1YRNA 2ID3A 2VKEA 3HOZJ 2KT0A 4IHVA 1ZK8A 5C44J 4IEJA 2DMNA 3PO2J 2VKVA 1PUFA 4HNVA 1LFUP 2CU7A 3JRBA 2X6OA 5EG0B 1RPWA 2JA8J 1ETXA 4MIMA 3I4MJ 3UKGA 4EEFG 1IV6A 2L0KA 3HKZN 4A3JJ 2DN0A 1QPIA 5EGOB 2X9DA 2L7ZA 2EZLA 4JX5A 3GBGA 3TEDA 4X6AJ 5GPCA 4RBOA 4DYRA 1I50J 4I76A 5FJ8J 2R5ZA 4A93J 4FE4A 2YUSA 3BTLA 2XB5A 1WGXA 2Y9YA 2HOSA 1ZGWA 1WI3A 1OJLA 1P7JA 1HLVA 2K9SA 3TP3A 1MBFA 4S0HB 2VPRA 4D7NA 1W0UA 3SFIA 1HOMA 5EGOA 2LK2A 5E3LA 2GLOA 5M5YJ 3ZQFA 4XIDA 2NVQJ 3RZOJ 1IDZA 2L7MP 1JGGA 1AKHA 3HOYJ 1TWHJ 2MW8A 3S2HJ 4C3JJ 3OSFA 2WAQN 1Z0XA 2DMTA 1DU0A 1UG2A 1HDDC 3JRAA 1BA5A 2JA6J 3BTCA 1SANA 4DYCA 3LNQA 2N8GA 2EBIA 1VNDA 2DMPA 3OOUA 3QPSA 1RKWA 1JUSA 1E3OC 3IH2A 4M3FA 9ANTA 4JX6A 4A3EJ 3FKIJ 4M6VA 1ZR2A 2FJ1A 1UHSA 2LTPA 2TRTA 3ZOBA 5EG0A 1JJ6C 3JRDA 2GBYA 3TW7A 3JR9A 2LKXA 2MSYA 1JKRC 2L7FP 2M0CA 1X58A 2ECCA 1ZKGA 2H1KA 5IOZA 3BQZA 3IH3A 5F1JA 3BG9A 2E2JJ 3ZQGA 5M5WJ 3G1OA 5M5XJ 2XSDC 3LSPA 2DMQA 5IP9J 1A6IA 4A3KJ 3G1MA 4A3FJ 4MFDA 2O9LA 4M3DA 1I6HJ 1RESA 2Y2ZA 1ETWA 1H89C 3F0CA 5IOYA 3S1QJ 1K83J 1BJZA 2Y9ZA 2RAEA 3FK6A 5DS9A 5IYBJ 4D7MA 2JA5J 4Y52J 4XRMA 1R9TJ 1JT0A 1O4XA 1MBEA 3L1PA 2VI6A 3HGGA 3D1NI 3TW6A 2XPWA 3A01B 3BR2A 3PM1A 4AUXA 2M2EA 3ZQIA 1K61A 2LR8A 3Q0UA 4AYBN 1H88C 2JWTA 1HCRA 3LSJA 1Y1WJ 2HI3A 1JKQC 2ID6A 3S16J 3HEFA 3H3VK 1Y1VJ 2LD5A 2R7ZJ 1WCMJ 3CQZJ 5M3FJ 2ECBA 4ABZA 2EQRA 2R0QC 3GTKJ 4W1UA 2QCOA 5J3LA 3JRCA 1JUMA 1BW6A 2CJJA 1QVUA 3Q3SA 3G1LA 1ENHA 1PUFB 4X1EA 1RETA 2O7OA 3Q0WA 3I4NJ 3MN2A 1DU6A 2GM4A 3ZQHA 1TWAJ 3JREA 1TWFJ 3NARA 2XGCA 4QIWN 2HYJA 4CYCB 3FISA 4MO7A 1XC5A 5IPAA 2HDDA 3HOWJ 1MNMC 4C3IJ 1MBHA 1U8BA 5FKLA 2HOTA 4XK4A 1GVDA 1RR7A 4NDLA 2M8GX 3JRIA 4B1RA 5F27A 3RQIA 1OCTC 4UUSB 2E2HJ 1IJWC 2L9RA 5IYDJ 3IH4A 3BTIA 1GDTA 2G0EA 5IP7J 4FCYA 2YS9A 2AHQA 5C4XJ 2HOAA 5E3MA 3GTOJ 3DCFA 3O8HA 4M3GA 1CQTA 1BL0A 1ETOA 5IYCJ 1B8IB 3GTLJ 4JYKA 1FIPA 1XS9A 5FKNA 2LLKA 3K7AJ 1TWGJ 3LSGA 2K9QA 2XPUA 2R93J 1D5YA 1FTZA 5BNGA 2E2IJ 4V2GA 5GP9A 1S7EA 1B72B 4MFEA 2R92J 4BKXA 1GV5A 5IP6A 5F04A 1JT6A 3BTJA 3S17J 2M9HA 3DEWA 4V2FA 4A3DJ 2CQQA 4IHWA 1LE8A 3LSRA 5F0HA 5FLVA 1LFBA 3H0GJ 2X48A 5FKKA 3RZDJ 2O8KA 2FX0A 2JN6A 1B8IA 2OF7A 4DW6A 4D5FA 4BY1J 1Q1VA 2E19A 1FIAA 2ZB9A 2JA7J 2NOGA 2HXIA 3S1RJ 5FLMJ 1GUUA 2WB1N 4JX4A 2ELKA 1ZTRA 5FKMA 3HOXJ 1WH7A 2WV1A 2AO9A 4D5CA 2NS7A 4A69C 1ETVA 3BT9A 3NAUA 3HDDA 3OIOA 4A3CJ 2B63J 2ME0A 2DA3A 4FTHA 1IUFA 2JK3A 4UUTA 3A01A 2IEKA 1IRZA 1T56A 3WHCA 3HGYA 5HODA 2NVYJ 2I10A 1X2MA 1MBJA 1UMQA 1FEXA 1ETQA 1JTYA 1VI0A 3A02A 2DMUA 3IV5A 2NVTJ 3HBLA 3CMYA 4C2MJ 4IHYA 3A03A 5F0FA 3S14J 3E7LA 1ZQ3P 2NVXJ
chains in the Genus database with same CATH superfamily
3K9TA 4HX7A 2W57A 1MBGA 1XB4A 3G2BA 3RKYA 4DGWB 3H36A 3VODA 3OS1A 3L2RA 3W6VA 1U9NA 3C1DA 4BY7J 5HNHA 1R5ID 1P4AA 1TQPA 1IAWA 1Y0UA 4P96A 3E6BA 3OYMA 1XDSA 1V4RA 2EZKA 1VQ9I 4A3LJ 1W0TA 2CUEA 2OBPA 3FXMA 2P5VA 4Q47A 3SDGA 2V9KA 1FOWA 4XKWA 2O8XA 2P5KA 2W7NA 5J6XA 3PIOF 2F5CA 2Y69H 2MGQA 2R5ZB 3DWLE 4RDUA 4BE2A 4ZZLA 1YLFA 5HVQC 4IOCF 4KT5C 5HLIA 3OS2A 2R7RA 4A0YA 1F36A 2DPUA 4QWQA 2PJPA 4NQWA 2E36A 2W82A 3K69A 3KEQA 3AG3H 4PJLA 1MSEC 4N4OB 2ISZA 5FFZA 3WU1B 2LSOA 3EQLF 5TJJA 3GUDA 3H3UA 1VQ8I 4MTEA 2M1BA 4XSXF 2ZXHA 3GFIA 1OFCX 2M45A 2OZUA 2HTJA 1UZCA 1FNNA 4CCOA 1CF7A 1TT5B 5L3CA 1U8RA 2DLLA 2LKPA 3GFLA 1VQKI 1I1GA 3AG2H 3R4KA 1KYZA 2FBIA 5JVTA 5BOXA 1BM9A 1Z05A 1AHDP 1NHAA 3SFZA 2ZJPF 2WTEA 4M3BA 3GTMJ 2C6YA 2R7OA 1QHGA 3I55I 2W84A 4LD5A 4EJTA 3PQKA 2CQXA 1SMTA 2HXOA 2MG4A 3K1MA 2E5ZA 4RAYA 3CCYA 2VKDA 1X4PA 3RPQA 1SVOA 3P9CA 4CDGA 3NQOA 2CW0F 3I5UA 3SEQA 2LKSA 1MSFC 2R5YB 2V1UA 1PP7U 2W4SA 4LLLA 5B3SH 3RKXA 3JRFA 1DUXC 2PEXA 4U7DA 1U9OA 3C2BA 4L5EA 1YJWI 1UAAA 3HB9A 1A36A 1HA8A 3TKYA 5ILVA 1H8AC 4WXHA 2EJRA 3RJPA 1SD5A 1DP3A 2CV0A 1R4MB 5JHUA 2WWYA 3WE3A 5TRDA 4XLNF 3D5RC 3CCRI 2V1DA 2EB7A 4CCMA 5DCFA 4R79A 3IRQA 2DJNA 4PK4A 5C3EJ 4ZZDA 4Z2YA 5EDNA 2LY9A 5FKOA 5J1RA 1UG0A 3F6OA 4D9JA 2Y0SN 3LQQA 5CKTA 3PNTA 2QZ8A 2VN2A 2DTZA 2DA5A 1FOYA 2O6GE 1AU7A 2Y31A 3GTQJ 1IC8A 2Z1DA 1JJ8C 4IX7A 3OIPA 4AVZA 3VEPA 5CVIA 1R4NB 4LB5A 2FNAA 1FP2A 4ENMA 2XRLA 2EPFA 4PGGA 4B3AA 2XUBA 4EJUA 2R7DA 1D1CA 1NTCA 5DM7F 3AKZA 2P81A 3I71A 5F08A 4I6ZA 3BR6A 2QLZA 4XKCA 3W2WA 5JLXA 3CCLI 3V4GA 5HOOA 1R1UA 4CYCA 4DBQA 2QUFA 2FSWA 2FBHA 5F1RA 2BY2A 1YQAA 5ED4A 3DPTA 2VOPA 1P7IA 2ACJA 1FLIA 3MZ8A 4J19A 1YRNA 2ID3A 5GAHJ 2VKEA 5LEKA 4IHVA 1ZK8A 2DMNA 1FMWA 3PO2J 1ZHFA 5DUIA 1G3TA 2JT1A 3MCZA 3ERMA 5LGNA 2DO7A 1GLNA 2JA8J 1X3WB 3F3XA 2JZYA 4MIMA 2ZC2A 4EEFG 1P2FA 3LA2A 1R22A 3UKGA 2QENA 2W24A 3HKZN 2R4GA 1GHCA 1QPIA 2ZKZA 3W6KB 5EGOB 2X9DA 3OYHA 3GXOA 2L7ZA 4B47A 3HG9A 1IZ1A 1WJDA 2ZO4A 4A5MA 4RBOA 4A6DA 4EM0B 2K3PA 3TOBA 2JTVA 2XAFA 1HQCA 2WB1A 5FJ8J 1CGPA 1UB9A 3G3ZA 1FBQA 1HC8A 3A4CA 2Z5UA 1M1EB 1KGSA 4IL6C 3M9AA 5L3BA 1WI3A 1P7JA 3LA3A 2Y0SA 5E8GA 1U5TC 3H5AA 3WTXC 2WV0A 1MBFA 2QSFX 3K4LA 2P8TA 1D8JA 4UNOA 1W0UA 3KP7A 4O5VA 4GGGA 2EFOA 4BJTA 3ZCOA 5BPIA 3M8EA 2K4JA 1BN5A 1TTYA 2DK8A 5L3GA 2RREA 1AKHA 3OL4A 3SZGA 4H0EA 3S2HJ 2MW8A 1KU3A 1T39A 4IRHA 2EFQA 2OQRA 2WAQN 4KMUX 4N9HA 4Y15A 2H6CA 2KQRA 3NEUA 3RPUA 1I6XA 3GZ6A 1BA5A 3BTCA 3HSFA 1SANA 2X6YA 4I01A 3JAMK 3LNQA 1VNDA 3QPSA 3OOUA 3G73A 1QNTA 2M8EA 2XC7A 1EH7A 1JUSA 3IH2A 4F93B 4GYGA 3VYTB 4A3EJ 1WJAA 4UXNA 2ZMEC 4I02A 1SD4A 5HDNA 2FJ1A 3J80Z 1UHSA 4DJAA 2VLAA 3JRDA 2HQNA 1FSHA 1YG2A 3JR9A 2LKXA 3FMSA 3FX3A 2VOOA 3EUAA 4EM1A 2H1KA 3GO5A 5IOZA 3BQZA 3HXLA 3CO6C 2E7XA 5F1JA 1FYMA 2XRNA 2BBYA 5GAEJ 1A6IA 1S7OA 2XIGA 1IRXA 3CF2A 4IZZA 5LHHA 4E7JA 2CWEA 1W36D 2Y2ZA 5JVGF 4NQWB 1FP1D 3BG6A 1ETWA 4RM2A 3F0CA 5JHFA 1MJ9A 5IT9Z 4HV6A 1JHHA 2Y9ZA 2ZFWA 2QSHX 2JA5J 3RQ4A 2E1MB 4CUGA 3TGNA 2COMA 1O4XA 2M30A 4ZH4F 3R60A 1ZGJA 1IRGA 4L9JA 3BR2A 3D0SA 4PJJA 4GO1A 4WX9A 3DP7A 3LSKA 2M2EA 3DU5A 2Q2EA 1D8KA 1H88C 4PFPA 1LPQA 1HCRA 1OYWA 2A6HF 1XSVA 1V3FA 2GAUA 2F5VA 4PJ0C 3LSMA 1EV7A 2G7UA 1WCMJ 2EQRA 4R1HA 1I5ZA 2R0QC 1IN8A 2QCOA 2F48A 1BW6A 1P6RA 1QVUA 2O5RA 5FLXZ 3MZYA 1D0XA 4X1EA 2XSJC 2ZJRF 2TDXA 2WADA 2ZJ2A 1Z6RA 2DAOA 3ASNH 3BCBA 4I98B 4XOPA 3VYRB 5IY5H 3DLLF 5KVRA 4OAYA 3CJTB 4R8HA 1TWFJ 3W3CA 3NARA 2XGCA 1XX5A 4QIWN 3BJOA 3FISA 1D1BA 1R5HA 3I9V2 3I56I 3OYLA 2VKHA 1J59A 4G6DA 4HSTA 3HOWJ 5IT9K 3CTAA 3HSEA 3OR1C 5FKLA 1H9GA 1V54H 4B44A 4HX4A 1RR7A 1J7KA 4HDUA 2HNHA 4NDLA 1W7PD 3M7GA 1IXSB 3LWFA 1K7AA 4BJ5C 1FPQA 1YX5A 4BQNA 4RGXA 1F9NA 4KJZA 3H1CA 3J80K 3J81Z 5E79C 5IYDJ 5DCMA 4A6EA 2QQAA 4MNUA 2A69F 3LAPA 2OTLI 4FCYA 3I58A 4M74A 3DCFA 4HAMA 4ZDOA 4A2UA 1TNTA 3KP2A 2ZSHB 2K7LA 1X3ZB 1N77A 1B8IB 2R7XA 4XN0A 1TWGJ 2K9QA 2FOKA 1FTZA 1G8XA 1VQOI 3FXOA 2EV0A 4KDPA 1OCOH 3DV8A 4CCLA 4BKXA 4XRFA 4KIFA 2X6WA 3CZ6A 1PJRA 3CUQC 2DT6A 2M9HA 2PX9A 4AVPA 2DPDA 1FWZA 3AFHA 4IQ4A 3I0TA 1LE8A 4IHWA 4L9TA 1XGSA 3QYBA 1AWCA 5AONA 2E71A 1KONA 1S3JA 3H0GJ 1EH8A 2CQ7A 3OYAA 2D2WA 2FX0A 4ZC3A 1C0WA 1B1BA 1U2WA 2PQ8A 3LSHA 4DW6A 1Q1VA 2ZB9A 1BOAA 2RQQA 4HOBA 5FLMJ 1GUUA 3BZCA 4JX4A 5FKMA 2LNBA 5KHDA 3MWMA 2NYXA 1TL8A 1XMKA 2ESNA 2NS7A 1X1DA 3CUOA 5HLTA 4A69C 1ULYA 2XAGA 3NAUA 3EYYA 4K2EA 1JE8A 1WJBA 2KJBA 3WTSC 2YPRA 2IEKA 2ZMEA 2CV2A 1IRZA 1T56A 4PSXA 3P9IA 3Q9VA 1O57A 1S72I 1ETQA 3DBRB 1JTYA 1VI0A 2HWVA 4UVCA 4RAFA 1WKMA 3E6CC 4BDZA 3IV5A 3WTUC 2QQBA 3CMYA 4IHYA 2H8WA 2Z2SB 3S14J 2Q8KA 4BXUA 1IF1A 1MW7A 3F9KA 2PMHA 1Z91A 1VFCA 2QWWA 4BBSJ 2M7BA 4ON0A 4HZFA 3F22A 3QU3A 2XGEA 3KYCB 3OYNA 1D3YA 5B66C 4ZYGA 5TISC 4HV5A 4XSZF 4N9IA 2MFZA 4A3BJ 4OIRF 3GEZA 3BG7A 2ETHA 3R0AA 3V8JA 2WAEA 3DEEA 2DA4A 3DPUA 5K1YA 1IGNA 3Q0VA 2VPLA 2XGDA 3IP4B 1USTA 1U5TB 2KDOA 4LJZF 3PO3J 4W97A 3FWEA 2IW5A 5E18F 2FF4A 1VQ4I 3K2AA 1MKMA 4EJVA 4IF4A 5ILUA 1K78A 2V7FA 3K4BA 4CCKA 3GFMA 3ZMUA 3BG5A 4YRVA 1T98A 3K0LA 3BPXA 4FISA 5E1WA 1XGOA 2IBDA 3QQAA 5LD2C 2FA5A 2VL8A 1YITI 3FDYA 1SAUA 3DKYA 1SC7A 3BOQA 1S5LC 3ECHA 3FMQA 4L9NA 2O03A 1FTTA 1G3YA 3CUQA 4NC6A 5EEHA 3VFZA 1O7FA 2PI0A 4OMYA 2JJ7A 4A3IJ 3LQRA 1I3QJ 2D5VA 1RUOA 3BR5A 3C18A 3CJNA 3H92A 5HDGA 1IO2A 2A68F 3REOA 3B6AA 3FM3A 1K6OA 1R00A 2BW3A 1ZR4A 3W6JB 1XG1A 1JKPC 1ODDA 2X1CA 4LITA 2CW8A 1B6AA 3CJRB 1OLTA 2M4KA 2QKLB 1U0JA 4HNTA 3DXJF 2QF7A 2EIKH 3IL2A 5AIQA 4M71A 3CJQB 1WJFA 3TDUC 1VQMI 4EMSA 1YW8A 1O3QA 5CVUA 2CV1A 2VBXA 1ORKA 1RNLA 2X4HA 2DYRH 1B72A 3OYCA 4GXOA 4HX8A 2EA4A 3TBIA 5KAFC 1Z9CA 1QGPA 3TL4X 3C7JA 2EH3A 3ZQLA 3HTUA 4ESJA 1MIJA 3ZPLA 3BP8A 3E97A 4ENJA 2H8RA 3QYEA 2ISYA 2XB0X 3NWTA 1NK2P 1WVRA 1D5VA 3T8RA 1FJLA 1G2HA 1IRFA 1O3RA 3AL0B 3MKWB 1F43A 3B6CA 3HIFA 3IKTA 2K85A 2Q1ZB 4M9ZA 3FXQA 1XSXA 3BLYA 1JTXA 3CC4I 1YO5C 1I39A 1LDKB 5H6RA 1I3AA 2CH0A 5HS9A 5D8KB 3E0JB 2Z16A 1IXRC 3MQ0A 1UFMA 1N25A 3ZQCA 2WAQA 2DA2A 3U9GA 4X0GA 4PZJA 3WTYC 1OPCA 1QQIA 1W7PB 4C2TA 2M34A 3FXKA 1GXQA 2NXNB 1YS6A 2HZDA 3E6MA 1OKRA 1HKTA 4CZCA 1HSTA 2K27A 5LGUA 2BW3B 4A12A 1MDMA 2V4JC 3S1NJ 1QRYA 2CQNA 1D1AA 2ZXIA 3MEXA 4DYQA 2R5YA 1TW3A 4I0BA 2KDZA 4A3MJ 2NOJB 1TLHB 2BEOA 1WQ2A 2ZCWA 3NRVA 1OMIA 3M1CA 5J40A 4I7HA 5E8IA 3WTVC 2E7WA 4GFBA 3VDXA 2CFXA 2B7EA 4UVAA 3GTGJ 2BHYA 3PQJA 4EV0A 1ZRFA 1WRJA 3FXRA 2E1MC 4XMYA 4QSHA 2GXBA 1VF9A 1Z77A 1BW5A 1YTYA 2IPQX 2L54A 5K7ZA 4HG2A 2ZSIB 4EVIA 1AKHB 1YFHA 4HSRA 5L3FA 4BE0A 3VB2A 2ESHA 3ABMH 2VODA 3U21A 5EZGA 1Y39A 2QVOA 1X19A 3KE2A 3T8TA 2KT0A 5C44J 4J01A 4IEJA 1OCRH 3WODF 1P4WA 4CO8A 4HNVA 4RB2C 1LFUP 4RS8A 3IAS2 2ZNYA 1P92A 1ZG1A 1OCCH 1ETXA 1OYIA 1TQIA 3B73A 5A2QZ 3CCVI 3ESWB 2OTJI 2OV7A 2ZNZA 3JCUC 4RM3A 3JSPA 2EZLA 1G59A 2V79A 3GBGA 1RC9A 3TEDA 4L0ZB 2KZVA 2JVHA 4X6AJ 4HNUA 2MABA 4BE1A 3CCUI 2HDCA 3N97A 1VQ6I 3RPUD 2XVCA 3DKWA 3K1PA 2JVGA 3S93A 3V8KA 2XB5A 1VQ5I 2CUZA 1BR4A 4AYBA 2HDWA 1QZZA 3FM5A 3IWZA 2KIUA 4IKFA 2UWMA 1T08B 3FBNB 2D1HA 4UB6C 4KYWA 3SHFA 4S0HB 3PNYA 2VPRA 3OS0A 3EETA 4D7NA 2XF5A 5CVVA 4ASNA 3X2QH 5EGOA 5E3LA 1MMAA 3OOPA 1SFKA 2BXYA 2BHZA 2IXSA 3ZGKA 3PJRA 4DNCA 3TDZC 4XIDA 3RZOJ 2KL4A 4LGWA 4I2OA 3CDIA 4E7ZA 1JGGA 1BIAA 4A0ZA 1TWHJ 4D0PA 2RC4A 5ICEA 3OSFA 4XL9A 1WI9A 4PGHA 2DMTA 3ZMVA 4KUMA 1UG2A 2VT2A 1QHHD 1LJ9A 2QGUA 1YS7A 1E3OC 4M3FA 4G7ZF 3U1DA 4RA2A 5E1ZB 3HUGB 1ZR2A 1F5TA 1K4TA 3ZOBA 2JPCA 2KIMA 4XKVA 4P9FA 1T0FA 1PUEE 2LREA 2P6TA 2HFHA 4P55A 2Z99A 3DEUA 4Q5SF 2GBYA 2DU9A 2WY8Q 3TW7A 3LL7A 5JFRA 3LSIA 2L7FP 1JKRC 1FBSA 3SYTA 2GZWA 2W85A 4RGRA 2MA3A 3FZVA 3KLOA 5B1BH 4XLCA 5FD5A 5IP9J 2ELJA 4M3DA 4WXDA 2QQ9A 4YG2F 1I6HJ 3HRSA 4NC8A 4AIHA 4B48A 1KA8A 2X1EA 1Z3YA 4Y33A 2RAEA 3FK6A 2BV6A 1W7PA 4BHCA 1X3UA 4XRMA 1W5TA 3OY9A 1JT0A 5K5OA 2VQLA 3HGGA 2XPWA 3GX4X 3A01B 3GW2A 2FXAA 1SFEA 5TGTA 4Z6YA 1J75A 4FX0A 4XR6A 2LR8A 2JWTA 2W25A 2EIMH 2MH9A 2P6SA 3LSJA 5D5WB 1WSUA 4P9UA 2IRFG 2A5YB 2ID6A 3IUOA 5LFAA 1XDUA 4IHSA 5AIPA 2L3DA 1SVLA 1X1CA 2KHMA 3S16J 3F72A 3FXUA 1BI1A 1R1VA 1XTAA 3ULQB 4W1UA 3OR2C 1ZRCA 5J3LA 1NG6A 3JRCA 1JUMA 2CJJA 4U88A 3QODA 3MZHA 3Q3SA 3G1LA 3AAFA 3KYLA 3H9JA 2V9PA 1XCVA 4II3A 3RIRA 3E5UA 2RGVA 2M5WA 1V5FA 2BXZA 4KN7X 2O7OA 3Q0WA 4ENKA 3JAMZ 3I4NJ 2GM4A 1JXSA 1D0ZA 4F7ZA 1TWAJ 5FB2A 3JREA 2X1DA 2V1NA 3S3MA 5BQTA 3SEZA 2RV8A 3ZMSA 2BY3A 4CYCB 3AL0C 5FGMA 4MO7A 2LC2A 2XAUA 2ZXJA 3IKVA 4N4NB 4QPQA 4XQFA 5IPAA 2R7UA 1ACIA 1MJBA 1U8BA 4XBFA 4XK4A 1LNWA 4EJWA 5H20A 2M8GX 2HTSA 2CGPA 3P9KA 4OIPF 5E17F 1OCTC 2STTA 4XONA 2VC1A 3HL2A 2AS5F 1D0YA 1I27A 2L9RA 5D5UB 1QPMA 4LK0F 3G4SI 3I53A 1E3PA 1TBXA 1KQ0A 2M0MA 1OCZH 3BTIA 2G0EA 4B43A 3HTSB 2AHQA 2PJRA 1JGSA 5C4XJ 5E3MA 1MD0A 3H35A 4WK8F 3O8HA 4E7IA 3HYIA 2XASA 4M9XA 3TQNA 2ZBKA 5IYCJ 1SEUA 2B9SA 2UZKA 4ZYAA 1FIPA 1XS9A 1ON2A 5FKNA 3LSGA 3K7AJ 4XORA 3CCEI 4L0YB 2R7SA 4B8XA 3M1EA 1T38A 3RI4A 3FKJA 2R93J 1D5YA 3EUKL 4O6JA 4V2GA 5GP9A 1VQ7I 1HXDA 1B72B 2KMUA 5FFXA 1TNSA 5F04A 1ZLJA 3HUGA 5ICFA 3BTJA 3CO7C 3O3KA 5IT3A 4KNYA 3T5XA 2CQQA 5HNFA 2R7FA 2L2OA 3QAHA 4NNJA 1RI7A 5FLVA 4S05A 3WU2C 1A04A 5FKKA 3RZDJ 2O8KA 5ERIA 2JN6A 4HA8A 2M87A 3BPVA 3ROUA 1Z1DA 3OYDA 3TO7A 2OF7A 2W1OA 4BQOA 4Q48A 4XOTA 3KP6A 2JSCA 3V42A 2WB1N 3WTWC 3LFKA 2R7WA 2ELKA 1FZPB 2WV1A 1YX3A 3HOTA 2V6EA 3WE2A 2DA3A 4FTHA 1DDNA 1ZREA 3KP5A 3EPZA 5CQGA 4MTDA 3DPLC 3HGYA 3RSNA 4OWRB 2I10A 4CGZA 5DCMB 2VT3A 1MBJA 4RLQA 3VSLA 2RQPA 4FHTA 2IS4A 3R6SA 3A02A 2DMUA 4BQQA 3HBLA 2Z33A 4C2MJ 4LB6B 1YE9A 3AG1H 3E7LA 4U0VA 3J7ZI 1R49A 2HVRA 2FQ3A 4F3QA 3EUHC 1HW1A 5CPRB 1KZHA 1IN5A 2H09A 1RKTA 2K40A 2DA6A 1LVAA 4H4KC 1X2NA 1BI2A 3COAC 3VOEA 1YHQI 1H0MA 2AQEA 2IGOA 3W2AA 5EYRA 3B02A 1SD7A 2IS6A 1DGWY 3KPHA 2H94A 3MFKA 4C3HJ 1XD7A 4BHBA 4HF0A 2XPVA 2DQLA 3D5SC 2EZIA 4HYEA 3HSRA 4OAZA 4DIQA 2PLYA 3G6EI 3JSOA 4BNCA 1E17A 2Y48A 3I64A 4J00A 3GLXA 2QQ8A 3O8GA 2VE9A 3IWFA 3RYPA 3QU6A 5M3MJ 4KIGA 4Y3OA 4JOMA 1MMDA 4EJOA 1ZH5A 4CA0A 1ZAOA 2IJLA 4RLFA 5L3DA 1W5CC 2L01A 1S8NA 3I59A 2PMZN 4BXFA 1IV8A 2W48A 4UV8A 5GAGJ 1BIBA 2E1OA 2X0LA 4PDKA 3MD2A 1MNEA 2EZHA 4EGYA 2WY7Q 4ZTFA 3CMAI 3BZKA 3F8CA 2MC4A 2HQ5A 1O7LA 2L7KA 2V6CA 1VQLI 3BR1A 1VQNI 2CYYA 2RVCA 2IS2A 4S04A 2UV1A 1HKQA 1FYKA 2P7CB 3ASOH 2NNYA 3ABTA 2GA2A 3K4JA 5E20A 1XMAA 3MMYB 4LFUA 4DZPA 3TP0A 3E1SA 1TZLA 1EJ9A 4FE7A 2IP2A 4UHTA 3E5XA 2DDAA 1LFPA 1MBKA 3L2WA 4BGDA 4HDVA 1ETYA 1SD6A 1JKOC 4NBQA 3BQYA 2XKPA 1DP7P 2R7VA 4HRIA 4PUSA 2STWA 1YIOA 1SFOJ 4WXCA 2E1CA 2KIQA 2VJ5A 3OIQA 4A3GJ 5CYVA 4AM3A 1GT0C 1GVJA 3FXLA 2Z3YA 1ETKA 4ZJZA 2H1LA 3MKZA 3K6GA 3C2HA 4GCVA 5F0CA 4RMNA 5J1UA 1VZ0A 5CVRA 3BCAA 3WGIA 5K5QA 3T0YA 2CUFA 2BOLA 3UR3C 3QP5A 3FIWA 3HJEA 3CC7I 1E3HA 1NG7A 2CRGA 2ME6A 3ZN1A 3ABUA 4HBLA 2FE3A 3GFJA 4OU0A 3PUFA 4KN4X 1MMGA 2Y30A 1R36A 1RIOH 1LE8B 2V26A 2MC3A 4XRSA 4ZDPA 1T8IA 4UUVA 3KYDB 3KP4A 4U0WA 2E35A 3GCMA 4BEHB 4Q4ZF 3SQNA 4MGRA 1V5EA 1HDPA 1QVTA 4BXXJ 1WHUA 1CF7B 2FD5A 2QYOA 3CDLA 1N78A 4MLOA 1V5GA 5J8FA 4CYDA 3SDBA 1W1WE 3CP8A 3L2VA 2A5WA 4IQJA 1Z7LA 4LOCA 3A1YA 3MKLA 3QPLA 3VWBA 1Y0NA 4XRSG 4EATA 2WA0A 3LSTA 5GPAA 4IHXA 3DFGA 2NS8A 3OYIA 3GTPJ 3M3YJ 4CCNA 4UUSA 5B5EC 1A31A 3GTJJ 2EK5A 2CFOA 1IN6A 2LBFA 4E70A 3WTTC 4M6YA 3K10A 1HBXG 2GA1A 2GXGA 2BE5F 3ZRGA 1E2XA 3F23A 2K9LA 4XLAA 1ZRDA 1W5SA 1X1PA 3IHUA 3V7CA 3ZR8X 1DQUA 5DV5A 2IA2A 5D4SA 2LP0A 4I99C 1IXCA 5HLHA 2JMWA 4M3EA 4UB8C 2DCEA 3FMRA 3LOCA 5FROA 3ZQQA 1KU2A 3CP2A 4RB3C 3NWSA 2IGMA 4LG0B 4IRIA 3KZYA 2HVQA 1J0RA 1QO0D 4QPOA 4XLFA 4ESFA 3FF5A 3WG7H 2OCCH 1XGMA 4M9SA 2AQFA 5EG0B 5FRMA 2ZFUA 1IN7A 5D6EA 1O3TA 2KFDA 2L5QA 3I4MJ 2L0KA 1U3EM 2KJCA 2DN0A 3HHGA 2QBYB 2XF6A 4G9YA 4JX5A 4G8XA 1FC3A 2DFHA 2JRMA 2VQGA 4RAZA 4A5NA 1TP4A 3M8JA 1I50J 2ADUA 3DQVC 4G94A 3OYFA 3LAJA 4E6KG 1BJAA 2R5ZA 2YUSA 3BTLA 4F92B 1WGXA 2J5PA 3RTRA 2DODA 3H9QA 5HLGA 1ZGWA 1ERDA 1T2KA 1HLVA 4YEJA 4PFOA 3DTIA 1HOMA 1BOBA 3U1KA 3H0DA 1B59A 2GOXB 4P5OA 3BZ6A 5M5YJ 4CSWA 3ZQFA 4YFNF 1Z67A 1IDZA 1F4KA 2HYFA 2L7MP 1IN4A 1L3LA 2W00A 2OCEA 4JK1X 3HOYJ 2L4AA 1YW7A 2E60A 1UHMA 1SFXA 1Z0XA 2PMUA 4CH7A 3CD6I 5ICCA 4CXFA 3JRAA 1HDDC 2ELHA 2N8GA 2IGNA 2EBIA 4IPAA 1RKWA 2VASA 3CCMI 5F6FA 1BR1A 3QOEA 3DKXA 1A6QA 1WWXA 1NH3A 2KRFA 2D45A 2FU4A 3M07A 2TRTA 5LEJA 2JPBA 1BI3A 4NC7A 1T6SA 1BC8C 1Y8QB 2MSYA 5H6QA 1MNDA 2CUJA 2CMPA 1X58A 1ZKGA 4BUPA 4O3MA 3IH3A 3RCOA 3DLAA 2XDVA 3BG9A 4BAYA 4XKBA 4Y4RA 4WWCA 5M5WJ 2E2JJ 2O61A 3G1OA 2A05A 2KKOA 5M5XJ 2XSDC 4A3KJ 5JI6A 1XSDA 3G1MA 3F8FA 2O9LA 1G6NA 1HW2A 3ZMZA 1SAXA 2XROA 3L2UA 1AOYA 3E5QA 4KT6A 1LB2A 1K83J 3PFYA 1KQ9A 4BS9A 5LHGA 1BJZA 1B9NA 2LDUA 4D7MA 4Y52J 2FEZA 3WU0A 2OZ6A 4OIQF 4KICA 1OYYA 1MBEA 4F52A 2VI6A 4FETA 3L1PA 2QEXI 6PAXA 1R58A 2YX4A 1K78B 1OISA 3IC7A 3OMYA 3ZXSA 1TQMA 1BR2A 4UV9A 3R0JA 1X1AA 3ZQIA 2NS0A 2VIXA 2R3SA 3Q0UA 5FD6A 3K70D 1Y1WJ 5HS8A 1JKQC 3RYRA 2VQHA 1YIJI 1KQ8A 4GDFA 2F4IA 2A6TA 1AA7A 2LD5A 2CG4A 2HZTA 2R7ZJ 3GTKJ 2ECBA 2VQCA 3FXJA 4LLGF 2DW4A 2VXZA 2HKXA 1LUJB 3BY6A 5EJCA 3O6BB 2I5UA 1ONVA 1FBUA 3W2VA 3L09A 1RETA 2F5FA 3ISPA 3L00A 3HPHA 3MN2A 3O2PE 1L0OC 1FOKA 3ZQHA 4YIIA 2X6XA 2VXDA 1FSEA 2DYSH 1MGTA 2JA2A 4HW0A 2XF7A 3UNGC 4UY8I 1SMYF 1XC5A 1FOXA 2MD0A 1FMVA 2UXXA 3HZJA 4C3IJ 2HOTA 5BPDA 2IVMA 4LG3A 3S8PA 3ZP5A 2DBBA 3JRIA 3BC8A 3H3ZA 1XN7A 4UUSB 3HKZA 1R5GA 2X51A 4PSWA 1RUNA 2E2HJ 3J7YJ 1IJWC 1R7JA 3CMMA 4Y17A 3QOPA 2XV4S 1HKSA 3IH4A 4U87A 1UCRA 4RAGA 1B9MA 4CCJA 5IP7J 3E6DA 3ZN0A 2HOAA 2XHKA 4M3GA 1CQTA 3R61A 3OYBA 2HVSA 2L9SA 1ETOA 1Z3XA 1KU7A 1LEAA 3GTLJ 4JYKA 4IOAF 2IGKA 3CCQI 3H5RA 1VQPI 2JQ7A 2XPUA 1EKEA 2NVUB 3GWZA 2LF7A 3GZ5A 5BNGA 2E2IJ 2OD5A 4HLXA 2RKHA 4ZYHA 2K4BA 1YYVA 3CMEI 1JT6A 3N4MA 4BQAA 1YW9A 1WFXA 2HKOA 4L9VA 3DEWA 4E7SA 4P1WA 4V2FA 4A3DJ 4XN3A 3A2KA 1PVEA 4KFCA 3LSRA 2OJED 5B1AH 2F4OB 1PDNC 1E0EA 1LFBA 2X48A 2QBYA 2JRTA 4DBRA 1JHFA 4NHJA 4KIBA 1XCBA 2LOOA 4UVBA 1LVKA 4L5IA 4D5FA 4BY1J 2A61A 1FIAA 2E19A 3BROA 5KNLA 2JA7J 3S1RJ 4CHUA 4PCQA 4A0XA 4N0BA 4CICA 1OQYA 1ZTRA 3TO9A 3HOXJ 2RNJA 3SXYA 2K5CA 1BI0A 2AO9A 3MKYB 1S6LA 1S9HA 5ICGA 2HQRA 1QZEA 4TV7A 2K02A 2E34A 3HDDA 3OIOA 4A3CJ 5H2FC 2IS1A 3H5NA 4UUTA 4YFKF 3A01A 1KU9A 4FQGA 2FBKA 1UELB 2XAQA 1S29A 1I1SA 5HODA 2GXAA 1REPC 2NVYJ 3LFUA 2K3FA 1UMQA 1FEXA 1ZYRF 2HGCA 2M7AA 3A03A 3K1NA 3C2GA 3P7NA 2Q0OA 5CVJA 4WCGA 4ZYDA 4FX4A 1YJ9I 2NVXJ 3T1BA 4OINF 2FQ4A 3F8NA 2LVSA 2DOEA 1HF0A 3A0HC 5J1YA 1A5JA 2YU9J 1GV2A 4WF2A 1UHWA 3CCSI 4IO9F 4XICA 1YOVB 3M4OJ 1S7AA 2VBYA 3WHBA 5EEGA 5J8CA 5A2QK 5EZHA 1IG7A 1BC7C 1ZLKA 2FRHA 4I09A 2KZGA 1DGRM 3V7RA 4G6QA 4NUBA 4AU7A 2JUCA 2LG4A 1J5YA 5LGTA 3TMOA 3AG4H 5BS6A 2NRAC 3IAM2 4BBRJ 3DTEA 4M72A 3QP6A 3SZPA 1FY7A 4DZJA 4ZTJA 3K4CA 1POGA 2BVMA 4HF2A 4RB1A 2O3FA 4JP0A 4ENNA 2HPIA 2RNGA 3BJAA 2F4MB 4MHGA 3OSGA 2EV5A 4AD9A 1MH3A 2VBWA 3KCCA 4AC0A 2QA4I 4D1QA 4B4CA 4B09A 2F6CA 2K9NA 2COBA 3WG9A 5GADJ 2DA7A 4LIVA 3SJMA 1A35A 2P5LC 5DYMA 2OPTA 2LMDA 2AXTC 3J81K 2F5DA 3MVPA 1HW5A 3JRGA 2HS5A 3ELKA 1MMSA 3KEYA 2OA4A 3BJ6A 3K4MA 2MLKA 2TCTA 5K7FA 3EYIA 1ITYA 1LDDA 2DT5A 2QKMB 5LRRA 4G7OF 1G3WA 2VUMJ 2WAFA 4Y13A 5FO5A 4FASD 2KPMA 4LK1F 2BY1A 2DK5A 4FT8A 1EF4A 3HC7A 1U5TA 4ITVA 4DQ2A 1IDYA 2L02A 5KCMA 1ZN2A 3ERED 1IW7F 2PBIA 3VSKA 1OCPA 1U6GA 3ABLH 1YJNI 1Y6IA 3BR0A 1U78A 3QPTA 1YI2I 2BY0A 3KFWX 2FUG2 3L2CA 1P9QC 2VE8A 3CESA 4HLYA 4G12A 5EF6A 1GXPA 1VTNC 3CC2I 4KITB 3EDPA 3BG3A 1H9TA 1O3SA 3ZMTA 1T33A 4RGSA 5D5VB 1NK3P 4HF1A 3HOUJ 3U2RA 1Y8RB 2VC0A 3C3WA 2YU3A 3JRHA 3KIOA 2L9NA 3KLNA 5DTDA 3DBLB 4IRGA 2D1VA 2PG4A 2L9VA 2F5EA 2OUMA 2IAIA 1PYVA 1JUPA 5JLWA 5KAIC 2LFBA 3Q5FA 3BR3A 2CS3A 3P5JA 5E3NA 4G6TB 5E3OA 1P4XA 2MBFA 1WH5A 3S1MJ 2LBFB 1QU3A 5GTIC 3HOVJ 2GQQA 3RKQA 4QTRA 3ONQA 1WPKA 1MH4A 4RGUA 3S15J 3FK7A 1ZG3A 4F91B 3OYEA 1Z6TA 1Z21A 1YRNB 3PSFA 4IVNA 5K7HA 3KETA 3EUHA 3CDHA 3ML6A 3PL8A 3BWGA 2L4MA 3HHHA 5C4JJ 2R7TA 1MMNA 3D5LA 5CLSA 5J4YA 1WZ2A 4EQQA 1R23A 3TO6A 2Y75A 1F1ZA 1R71A 2WBMA 1ZELA 3HM5A 4OOIA 4C9YA 5J47A 3F21A 5D6FA 2JUGA 1LQ1A 5D5XB 3WTZA 2HR3A 1DPRA 2XAHA 4Y7NJ 2DA1A 2KLOA 1J2XA 4BH9A 3K70C 3S2DJ 1TC3C 3I54A 1WJCA 3OV8A 2YR2A 2R7QA 4MEYF 2V1XA 3S3OA 1APLC 1TWCJ 3VPRA 1XGNA 3DF8A 2JSPA 5EEAA 4IHTA 4EM2A 3HOZJ 1G3SA 2A3SA 1TT0A 2DOFA 1FYLA 2NAZA 2EILH 2DQRA 1HSJA 4II2A 1K4SA 3RKWA 2VKVA 1PUFA 2CU7A 3JRBA 1W36C 2X6OA 2EFNA 1RPWA 3GVAA 1IV6A 4QLCU 4M6XA 4A3JJ 2DOAA 4HQMA 2MLGA 2E5NA 4DOZA 2LF8A 3KZIC 5ILSA 2I8DA 4BACA 5GPCA 3PFIA 4DYRA 2FOWA 4I76A 3FBIB 4A93J 4FE4A 4EGZA 4GRIA 1WJEA 4BJ6C 4G7HF 2DI3A 2MH2A 3HRUA 4HEA2 3CLOA 4C30A 2Y9YA 3L7WA 2HOSA 5LHIA 1OJLA 2K9SA 3KX2A 4AIDA 5DM6F 4XLEA 2GWRA 3TP3A 1J09A 5DD4A 3GZNB 1UJ8A 5DDGA 2CW7A 4U7BA 3SFIA 4OIOF 2VJJA 2LK2A 2P7VB 3F8MA 4KA4A 2GLOA 4PJMA 4PJNA 3BDDA 2UXNA 1T0FC 3HRTA 2DJIA 2P0WA 3DTKA 3KP3A 2NVQJ 1IUYA 2RN7A 1OR7C 3I4PA 3CCJI 2EFWA 1DPUA 2KRHA 2HU9A 5LRSA 3HOSA 2VB6A 4C3JJ 2VBZA 2BGCA 1DU0A 3GF2A 1RR8C 1JI8A 2JA6J 4L18B 1QZYA 3VYUB 1BBYA 4DYCA 2E1NA 4ZYEA 2DMPA 2DDBA 2MYSA 3ZMDA 1G4DA 3PSIA 5CQEA 2XKOA 9ANTA 4JX6A 3SZTA 3MAJA 1T95A 4XM3A 3FKIJ 1LKXA 1V55H 4M6VA 1RZ4A 5GTHC 1N75A 2LTPA 5EG0A 4LMYA 2LY2A 4BDYA 1JJ6C 1MZBA 4HQEA 2A6EF 2GIZA 2GIVA 2VJIA 4B3XA 2XAJA 4IXAA 4XLPF 3HRMA 2M0CA 2ECCA 3OWTA 2ZXWH 4HPQA 3F6VA 4AIJA 2HYGD 2KIFA 3ZQGA 4XNFA 1SVMA 3LSPA 4A3FJ 1FX7A 2DMQA 4MFDA 2BYVE 1X4OA 4AIKA 1RESA 2M4GA 3CF5F 2Z9OA 1R6RA 2LH9A 3E3VA 1H89C 1QBJA 5E1XA 4F55A 3V8LA 3CUQB 5IOYA 3S1QJ 1FT9A 3S2WA 5DS9A 5IYBJ 4BL0B 2YSRA 1ZARA 2NNNA 1R9TJ 3D1NI 4JBAA 2G7HA 3TW6A 2PFBA 2ZMEB 5DEQA 3OL3A 3JTHA 4CZZA 3TOAA 1KYWA 3ZQ7A 4AWXB 3PM1A 2BZTA 4AUXA 4E4HA 3N05A 4M73A 5F64A 2DT7B 2H6BA 5HS7A 4BYYA 4ZDLA 1K61A 4AYBN 3I3LA 2QSGX 3OYGA 2HI3A 2K86A 4YIRX 2DTRA 2OQGA 1RRJA 4KISA 2X85A 4YIFA 2VJ4A 2ZJQF 2OC6A 3HEFA 4YELA 3H3VK 1Y1VJ 5FRNA 1Z7UA 3KZZA 3CQZJ 5M3FJ 4ABZA 2HQAA 4IJAA 1TW2A 2OU2A 2VONA 3I59B 3J7AY 4U0YA 4LG0A 4E7KA 1Q1HA 1EH6A 2HOEA 2HPMA 5FLXK 2FMLA 4BU2A 1ENHA 1PUFB 3PIPF 4ETSA 2ICWG 2O0YA 4MEXF 1EA3A 3RDIA 3H9GA 3J7AO 3HPGA 1DU6A 3A0BC 2CO5A 1MDMB 1Y56A 2M3AA 2LY1A 3QRFF 1OR7A 3K4NA 3GYHX 2HYJA 4RB0A 2WC2A 2DFIA 2UUZA 2DFFA 2A07F 2HDDA 2V9VA 2KP6A 3PNVA 3FHZA 1MNMC 2IA0A 1MBHA 2LYCA 2H27A 2B0LA 2EV6A 1GVDA 4GYIA 3WGHA 5L3EA 4MQVA 3PUBA 2KISA 4B1RA 5J4VA 5F27A 2EIJH 3RQIA 3GLLA 4I0AA 2AXLA 1ON1A 2EA2A 3OYJA 1MJAA 2MD5A 5HDKA 2CSOA 3V7SA 2Y0MA 3CLQA 2BVLA 3WGGA 3Q9SA 2IA1A 2J5OA 3M8FA 1GDTA 2Q2EB 2YS9A 5DD8A 1W4MA 3G71I 3GTOJ 3KEOA 3S3NA 1BL0A 1ZGAA 5JR3A 2F2EA 1R1TA 2DXIA 4NB5A 2YX7A 4ESBA 3ECOA 2LLKA 2K9MA 4YFXF 2QM3A 4BHPA 1S7EA 4V19K 4MFEA 2R92J 3F8BA 1GV5A 5IP6A 3S32A 3IRRA 3QPHA 2RDPA 5LBQA 3S17J 3QYFA 2EFPA 4E7HA 5KK1A 1PP8F 2DFEA 2HEOA 1USSA 5F0HA 1X1BA 1WJ5A 1XPXA 2PJRB 2P4WA 1K79A 2EINH 5BMZA 2PMZA 3DBHB 4ANJA 3ABKH 1B8IA 3JW4A 4XLHA 1XMXA 5D4RA 3DU6A 4MQ9F 2LRDA 2OAZA 2CQKA 2NOGA 2HXIA 3OYKA 3K4KA 4LIUA 2GOMA 5CJ9A 2PN6A 1K6YA 1WH7A 4D5CA 2KRCA 3GMEA 4L5JA 4LLNA 1ETVA 1J9IA 3BT9A 2EWNA 3LA7A 3FHNA 3LMMA 4OMZA 3QWLA 1LDJA 5LLQA 2B63J 2ME0A 1ZG5A 1IUFA 2JK3A 1LEBA 2FMYA 1STZA 4BEHA 2G9WA 5DUKA 3WHCA 4KMFA 2FNPA 1SFUA 5D8LB 3JTGA 3K2ZA 1QA6A 1X2MA 3L9FA 4JQFA 3L2QA 2NVTJ 2IT0A 1B4AA 2XGXA 5F0FA 3VYSB 4E7LA 1ZQ3P 4C2UA 5K5RA
chains in the Genus database with same CATH topology
2FQ4A 1VFCA 1MBGA 1RKTA 2K40A 2LVSA 5J1YA 1HF0A 2DA6A 4BBSJ 1A5JA 2YU9J 1GV2A 2XGEA 1X2NA 4XICA 3M4OJ 3W6VA 1U9NA 3WHBA 4BY7J 5EZHA 1IG7A 4A3BJ 5EYRA 2DA4A 1IGNA 3Q0VA 2XGDA 3PO3J 4W97A 4C3HJ 2EZKA 3K2AA 2XPVA 4A3LJ 1W0TA 2CUEA 2EZIA 3SDGA 4BBRJ 3BG5A 4DZJA 4FISA 1POGA 4JP0A 2IBDA 2MGQA 3QQAA 4RDUA 2R5ZB 3O8GA 5M3MJ 3OSGA 1F36A 1MH3A 1FTTA 1MSEC 2JJ7A 4AC0A 4A3IJ 2PMZN 1I3QJ 2D5VA 4B4CA 2K9NA 2COBA 3BR5A 2W48A 2DA7A 2E1OA 3SJMA 3B6AA 1OFCX 2EZHA 2OPTA 1ZR4A 1XG1A 1JKPC 3MVPA 3JRGA 2QF7A 2HQ5A 2TCTA 3BR1A 5K7FA 1ITYA 2VUMJ 1AHDP 4DZPA 3TP0A 1ORKA 4FE7A 1B72A 4M3BA 1EF4A 3GTMJ 1IDYA 1MBKA 2EH3A 1ETYA 2CQXA 3ZQLA 2HXOA 1JKOC 1OCPA 2MG4A 3BQYA 3CCYA 2H8RA 2XB0X 1NK2P 3BR0A 1SFOJ 1FJLA 1G2HA 4A3GJ 1U78A 1F43A 3B6CA 1MSFC 2R5YB 1GT0C 1ETKA 3JRFA 1JTXA 4G12A 4L5EA 1U9OA 3C2BA 5EF6A 5F0CA 3HB9A 5J1UA 3BG3A 1H8AC 1T33A 2CUFA 1NK3P 3HOUJ 3ZQCA 3FIWA 3JRHA 2DA2A 5DTDA 2CRGA 2ME6A 2M34A 2Y30A 2IAIA 1LE8B 1JUPA 5JLWA 4XRSA 2LFBA 3BR3A 2DJNA 5C3EJ 5E3NA 5E3OA 1WH5A 5EDNA 3S1MJ 2LY9A 5FKOA 3HOVJ 5J1RA 3RKQA 4QTRA 1HDPA 1QVTA 1WPKA 4BXXJ 2Y0SN 3S1NJ 1QRYA 1MH4A 3S15J 2DTZA 4DYQA 3FK7A 2R5YA 2DA5A 2FD5A 1YRNB 3CDLA 2KDZA 4A3MJ 5K7HA 1AU7A 4MLOA 2Y31A 3GTQJ 1IC8A 1JJ8C 4LOCA 3MKLA 5C4JJ 3QPLA 4XRSG 4IHXA 5GPAA 4GFBA 2XRLA 2NS8A 3GTPJ 3M3YJ 3GTGJ 4B3AA 4UUSA 3GTJJ 3HM5A 1NTCA 2P81A 5F08A 4Y7NJ 4QSHA 4I6ZA 3BR6A 1VF9A 2DA1A 1Z77A 1BW5A 5K7ZA 5JLXA 3S2DJ 1TC3C 4CYCA 1AKHB 1APLC 1TWCJ 2LP0A 3VPRA 2JMWA 4M3EA 5EZGA 1P7IA 3LOCA 5EEAA 4J19A 1YRNA 2ID3A 2VKEA 3HOZJ 2KT0A 4IHVA 1ZK8A 5C44J 4IEJA 2DMNA 3PO2J 2VKVA 1PUFA 4HNVA 1LFUP 2CU7A 3JRBA 2X6OA 5EG0B 1RPWA 2JA8J 1ETXA 4MIMA 3I4MJ 3UKGA 4EEFG 1IV6A 2L0KA 3HKZN 4A3JJ 2DN0A 1QPIA 5EGOB 2X9DA 2L7ZA 2EZLA 4JX5A 3GBGA 3TEDA 4X6AJ 5GPCA 4RBOA 4DYRA 1I50J 4I76A 5FJ8J 2R5ZA 4A93J 4FE4A 2YUSA 3BTLA 2XB5A 1WGXA 2Y9YA 2HOSA 1ZGWA 1WI3A 1OJLA 1P7JA 1HLVA 2K9SA 3TP3A 1MBFA 4S0HB 2VPRA 4D7NA 1W0UA 3SFIA 1HOMA 5EGOA 2LK2A 5E3LA 2GLOA 5M5YJ 3ZQFA 4XIDA 2NVQJ 3RZOJ 1IDZA 2L7MP 1JGGA 1AKHA 3HOYJ 1TWHJ 2MW8A 3S2HJ 4C3JJ 3OSFA 2WAQN 1Z0XA 2DMTA 1DU0A 1UG2A 1HDDC 3JRAA 1BA5A 2JA6J 3BTCA 1SANA 4DYCA 3LNQA 2N8GA 2EBIA 1VNDA 2DMPA 3OOUA 3QPSA 1RKWA 1JUSA 1E3OC 3IH2A 4M3FA 9ANTA 4JX6A 4A3EJ 3FKIJ 4M6VA 1ZR2A 2FJ1A 1UHSA 2LTPA 2TRTA 3ZOBA 5EG0A 1JJ6C 3JRDA 2GBYA 3TW7A 3JR9A 2LKXA 2MSYA 1JKRC 2L7FP 2M0CA 1X58A 2ECCA 1ZKGA 2H1KA 5IOZA 3BQZA 3IH3A 5F1JA 3BG9A 2E2JJ 3ZQGA 5M5WJ 3G1OA 5M5XJ 2XSDC 3LSPA 2DMQA 5IP9J 1A6IA 4A3KJ 3G1MA 4A3FJ 4MFDA 2O9LA 4M3DA 1I6HJ 1RESA 2Y2ZA 1ETWA 1H89C 3F0CA 5IOYA 3S1QJ 1K83J 1BJZA 2Y9ZA 2RAEA 3FK6A 5DS9A 5IYBJ 4D7MA 2JA5J 4Y52J 4XRMA 1R9TJ 1JT0A 1O4XA 1MBEA 3L1PA 2VI6A 3HGGA 3D1NI 3TW6A 2XPWA 3A01B 3BR2A 3PM1A 4AUXA 2M2EA 3ZQIA 1K61A 2LR8A 3Q0UA 4AYBN 1H88C 2JWTA 1HCRA 3LSJA 1Y1WJ 2HI3A 1JKQC 2ID6A 3S16J 3HEFA 3H3VK 1Y1VJ 2LD5A 2R7ZJ 1WCMJ 3CQZJ 5M3FJ 2ECBA 4ABZA 2EQRA 2R0QC 3GTKJ 4W1UA 2QCOA 5J3LA 3JRCA 1JUMA 1BW6A 2CJJA 1QVUA 3Q3SA 3G1LA 1ENHA 1PUFB 4X1EA 1RETA 2O7OA 3Q0WA 3I4NJ 3MN2A 1DU6A 2GM4A 3ZQHA 1TWAJ 3JREA 1TWFJ 3NARA 2XGCA 4QIWN 2HYJA 4CYCB 3FISA 4MO7A 1XC5A 5IPAA 2HDDA 3HOWJ 1MNMC 4C3IJ 1MBHA 1U8BA 5FKLA 2HOTA 4XK4A 1GVDA 1RR7A 4NDLA 2M8GX 3JRIA 4B1RA 5F27A 3RQIA 1OCTC 4UUSB 2E2HJ 1IJWC 2L9RA 5IYDJ 3IH4A 3BTIA 1GDTA 2G0EA 5IP7J 4FCYA 2YS9A 2AHQA 5C4XJ 2HOAA 5E3MA 3GTOJ 3DCFA 3O8HA 4M3GA 1CQTA 1BL0A 1ETOA 5IYCJ 1B8IB 3GTLJ 4JYKA 1FIPA 1XS9A 5FKNA 2LLKA 3K7AJ 1TWGJ 3LSGA 2K9QA 2XPUA 2R93J 1D5YA 1FTZA 5BNGA 2E2IJ 4V2GA 5GP9A 1S7EA 1B72B 4MFEA 2R92J 4BKXA 1GV5A 5IP6A 5F04A 1JT6A 3BTJA 3S17J 2M9HA 3DEWA 4V2FA 4A3DJ 2CQQA 4IHWA 1LE8A 3LSRA 5F0HA 5FLVA 1LFBA 3H0GJ 2X48A 5FKKA 3RZDJ 2O8KA 2FX0A 2JN6A 1B8IA 2OF7A 4DW6A 4D5FA 4BY1J 1Q1VA 2E19A 1FIAA 2ZB9A 2JA7J 2NOGA 2HXIA 3S1RJ 5FLMJ 1GUUA 2WB1N 4JX4A 2ELKA 1ZTRA 5FKMA 3HOXJ 1WH7A 2WV1A 2AO9A 4D5CA 2NS7A 4A69C 1ETVA 3BT9A 3NAUA 3HDDA 3OIOA 4A3CJ 2B63J 2ME0A 2DA3A 4FTHA 1IUFA 2JK3A 4UUTA 3A01A 2IEKA 1IRZA 1T56A 3WHCA 3HGYA 5HODA 2NVYJ 2I10A 1X2MA 1MBJA 1UMQA 1FEXA 1ETQA 1JTYA 1VI0A 3A02A 2DMUA 3IV5A 2NVTJ 3HBLA 3CMYA 4C2MJ 4IHYA 3A03A 5F0FA 3S14J 3E7LA 1ZQ3P 2NVXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ4 A;  1VFC A;  1MBG A;  1RKT A;  2K40 A;  2LVS A;  5J1Y A;  1HF0 A;  2DA6 A;  4BBS J;  1A5J A;  2YU9 J;  1GV2 A;  2XGE A;  1X2N A;  4XIC A;  3M4O J;  3W6V A;  1U9N A;  3WHB A;  4BY7 J;  5EZH A;  1IG7 A;  4A3B J;  5EYR A;  2DA4 A;  1IGN A;  3Q0V A;  2XGD A;  3PO3 J;  4W97 A;  4C3H J;  2EZK A;  3K2A A;  2XPV A;  4A3L J;  1W0T A;  2CUE A;  2EZI A;  3SDG A;  4BBR J;  3BG5 A;  4DZJ A;  4FIS A;  1POG A;  4JP0 A;  2IBD A;  2MGQ A;  3QQA A;  4RDU A;  2R5Z B;  3O8G A;  5M3M J;  3OSG A;  1F36 A;  1MH3 A;  1FTT A;  1MSE C;  2JJ7 A;  4AC0 A;  4A3I J;  2PMZ N;  1I3Q J;  2D5V A;  4B4C A;  2K9N A;  2COB A;  3BR5 A;  2W48 A;  2DA7 A;  2E1O A;  3SJM A;  3B6A A;  1OFC X;  2EZH A;  2OPT A;  1ZR4 A;  1XG1 A;  1JKP C;  3MVP A;  3JRG A;  2QF7 A;  2HQ5 A;  2TCT A;  3BR1 A;  5K7F A;  1ITY A;  2VUM J;  1AHD P;  4DZP A;  3TP0 A;  1ORK A;  4FE7 A;  1B72 A;  4M3B A;  1EF4 A;  3GTM J;  1IDY A;  1MBK A;  2EH3 A;  1ETY A;  2CQX A;  3ZQL A;  2HXO A;  1JKO C;  1OCP A;  2MG4 A;  3BQY A;  3CCY A;  2H8R A;  2XB0 X;  1NK2 P;  3BR0 A;  1SFO J;  1FJL A;  1G2H A;  4A3G J;  1U78 A;  1F43 A;  3B6C A;  1MSF C;  2R5Y B;  1GT0 C;  1ETK A;  3JRF A;  1JTX A;  4G12 A;  4L5E A;  1U9O A;  3C2B A;  5EF6 A;  5F0C A;  3HB9 A;  5J1U A;  3BG3 A;  1H8A C;  1T33 A;  2CUF A;  1NK3 P;  3HOU J;  3ZQC A;  3FIW A;  3JRH A;  2DA2 A;  5DTD A;  2CRG A;  2ME6 A;  2M34 A;  2Y30 A;  2IAI A;  1LE8 B;  1JUP A;  5JLW A;  4XRS A;  2LFB A;  3BR3 A;  2DJN A;  5C3E J;  5E3N A;  5E3O A;  1WH5 A;  5EDN A;  3S1M J;  2LY9 A;  5FKO A;  3HOV J;  5J1R A;  3RKQ A;  4QTR A;  1HDP A;  1QVT A;  1WPK A;  4BXX J;  2Y0S N;  3S1N J;  1QRY A;  1MH4 A;  3S15 J;  2DTZ A;  4DYQ A;  3FK7 A;  2R5Y A;  2DA5 A;  2FD5 A;  1YRN B;  3CDL A;  2KDZ A;  4A3M J;  5K7H A;  1AU7 A;  4MLO A;  2Y31 A;  3GTQ J;  1IC8 A;  1JJ8 C;  4LOC A;  3MKL A;  5C4J J;  3QPL A;  4XRS G;  4IHX A;  5GPA A;  4GFB A;  2XRL A;  2NS8 A;  3GTP J;  3M3Y J;  3GTG J;  4B3A A;  4UUS A;  3GTJ J;  3HM5 A;  1NTC A;  2P81 A;  5F08 A;  4Y7N J;  4QSH A;  4I6Z A;  3BR6 A;  1VF9 A;  2DA1 A;  1Z77 A;  1BW5 A;  5K7Z A;  5JLX A;  3S2D J;  1TC3 C;  4CYC A;  1AKH B;  1APL C;  1TWC J;  2LP0 A;  3VPR A;  2JMW A;  4M3E A;  5EZG A;  1P7I A;  3LOC A;  5EEA A;  4J19 A;  1YRN A;  2ID3 A;  2VKE A;  3HOZ J;  2KT0 A;  4IHV A;  1ZK8 A;  5C44 J;  4IEJ A;  2DMN A;  3PO2 J;  2VKV A;  1PUF A;  4HNV A;  1LFU P;  2CU7 A;  3JRB A;  2X6O A;  5EG0 B;  1RPW A;  2JA8 J;  1ETX A;  4MIM A;  3I4M J;  3UKG A;  4EEF G;  1IV6 A;  2L0K A;  3HKZ N;  4A3J J;  2DN0 A;  1QPI A;  5EGO B;  2X9D A;  2L7Z A;  2EZL A;  4JX5 A;  3GBG A;  3TED A;  4X6A J;  5GPC A;  4RBO A;  4DYR A;  1I50 J;  4I76 A;  5FJ8 J;  2R5Z A;  4A93 J;  4FE4 A;  2YUS A;  3BTL A;  2XB5 A;  1WGX A;  2Y9Y A;  2HOS A;  1ZGW A;  1WI3 A;  1OJL A;  1P7J A;  1HLV A;  2K9S A;  3TP3 A;  1MBF A;  4S0H B;  2VPR A;  4D7N A;  1W0U A;  3SFI A;  1HOM A;  5EGO A;  2LK2 A;  5E3L A;  2GLO A;  5M5Y J;  3ZQF A;  4XID A;  2NVQ J;  3RZO J;  1IDZ A;  2L7M P;  1JGG A;  1AKH A;  3HOY J;  1TWH J;  2MW8 A;  3S2H J;  4C3J J;  3OSF A;  2WAQ N;  1Z0X A;  2DMT A;  1DU0 A;  1UG2 A;  1HDD C;  3JRA A;  1BA5 A;  2JA6 J;  3BTC A;  1SAN A;  4DYC A;  3LNQ A;  2N8G A;  2EBI A;  1VND A;  2DMP A;  3OOU A;  3QPS A;  1RKW A;  1JUS A;  1E3O C;  3IH2 A;  4M3F A;  9ANT A;  4JX6 A;  4A3E J;  3FKI J;  4M6V A;  1ZR2 A;  2FJ1 A;  1UHS A;  2LTP A;  2TRT A;  3ZOB A;  5EG0 A;  1JJ6 C;  3JRD A;  2GBY A;  3TW7 A;  3JR9 A;  2LKX A;  2MSY A;  1JKR C;  2L7F P;  2M0C A;  1X58 A;  2ECC A;  1ZKG A;  2H1K A;  5IOZ A;  3BQZ A;  3IH3 A;  5F1J A;  3BG9 A;  2E2J J;  3ZQG A;  5M5W J;  3G1O A;  5M5X J;  2XSD C;  3LSP A;  2DMQ A;  5IP9 J;  1A6I A;  4A3K J;  3G1M A;  4A3F J;  4MFD A;  2O9L A;  4M3D A;  1I6H J;  1RES A;  2Y2Z A;  1ETW A;  1H89 C;  3F0C A;  5IOY A;  3S1Q J;  1K83 J;  1BJZ A;  2Y9Z A;  2RAE A;  3FK6 A;  5DS9 A;  5IYB J;  4D7M A;  2JA5 J;  4Y52 J;  4XRM A;  1R9T J;  1JT0 A;  1O4X A;  1MBE A;  3L1P A;  2VI6 A;  3HGG A;  3D1N I;  3TW6 A;  2XPW A;  3A01 B;  3BR2 A;  3PM1 A;  4AUX A;  2M2E A;  3ZQI A;  1K61 A;  2LR8 A;  3Q0U A;  4AYB N;  1H88 C;  2JWT A;  1HCR A;  3LSJ A;  1Y1W J;  2HI3 A;  1JKQ C;  2ID6 A;  3S16 J;  3HEF A;  3H3V K;  1Y1V J;  2LD5 A;  2R7Z J;  1WCM J;  3CQZ J;  5M3F J;  2ECB A;  4ABZ A;  2EQR A;  2R0Q C;  3GTK J;  4W1U A;  2QCO A;  5J3L A;  3JRC A;  1JUM A;  1BW6 A;  2CJJ A;  1QVU A;  3Q3S A;  3G1L A;  1ENH A;  1PUF B;  4X1E A;  1RET A;  2O7O A;  3Q0W A;  3I4N J;  3MN2 A;  1DU6 A;  2GM4 A;  3ZQH A;  1TWA J;  3JRE A;  1TWF J;  3NAR A;  2XGC A;  4QIW N;  2HYJ A;  4CYC B;  3FIS A;  4MO7 A;  1XC5 A;  5IPA A;  2HDD A;  3HOW J;  1MNM C;  4C3I J;  1MBH A;  1U8B A;  5FKL A;  2HOT A;  4XK4 A;  1GVD A;  1RR7 A;  4NDL A;  2M8G X;  3JRI A;  4B1R A;  5F27 A;  3RQI A;  1OCT C;  4UUS B;  2E2H J;  1IJW C;  2L9R A;  5IYD J;  3IH4 A;  3BTI A;  1GDT A;  2G0E A;  5IP7 J;  4FCY A;  2YS9 A;  2AHQ A;  5C4X J;  2HOA A;  5E3M A;  3GTO J;  3DCF A;  3O8H A;  4M3G A;  1CQT A;  1BL0 A;  1ETO A;  5IYC J;  1B8I B;  3GTL J;  4JYK A;  1FIP A;  1XS9 A;  5FKN A;  2LLK A;  3K7A J;  1TWG J;  3LSG A;  2K9Q A;  2XPU A;  2R93 J;  1D5Y A;  1FTZ A;  5BNG A;  2E2I J;  4V2G A;  5GP9 A;  1S7E A;  1B72 B;  4MFE A;  2R92 J;  4BKX A;  1GV5 A;  5IP6 A;  5F04 A;  1JT6 A;  3BTJ A;  3S17 J;  2M9H A;  3DEW A;  4V2F A;  4A3D J;  2CQQ A;  4IHW A;  1LE8 A;  3LSR A;  5F0H A;  5FLV A;  1LFB A;  3H0G J;  2X48 A;  5FKK A;  3RZD J;  2O8K A;  2FX0 A;  2JN6 A;  1B8I A;  2OF7 A;  4DW6 A;  4D5F A;  4BY1 J;  1Q1V A;  2E19 A;  1FIA A;  2ZB9 A;  2JA7 J;  2NOG A;  2HXI A;  3S1R J;  5FLM J;  1GUU A;  2WB1 N;  4JX4 A;  2ELK A;  1ZTR A;  5FKM A;  3HOX J;  1WH7 A;  2WV1 A;  2AO9 A;  4D5C A;  2NS7 A;  4A69 C;  1ETV A;  3BT9 A;  3NAU A;  3HDD A;  3OIO A;  4A3C J;  2B63 J;  2ME0 A;  2DA3 A;  4FTH A;  1IUF A;  2JK3 A;  4UUT A;  3A01 A;  2IEK A;  1IRZ A;  1T56 A;  3WHC A;  3HGY A;  5HOD A;  2NVY J;  2I10 A;  1X2M A;  1MBJ A;  1UMQ A;  1FEX A;  1ETQ A;  1JTY A;  1VI0 A;  3A02 A;  2DMU A;  3IV5 A;  2NVT J;  3HBL A;  3CMY A;  4C2M J;  4IHY A;  3A03 A;  5F0F A;  3S14 J;  3E7L A;  1ZQ3 P;  2NVX J; 
#chains in the Genus database with same CATH topology
 3K9T A;  4HX7 A;  2W57 A;  1MBG A;  1XB4 A;  3G2B A;  3RKY A;  4DGW B;  3H36 A;  3VOD A;  3OS1 A;  3L2R A;  3W6V A;  1U9N A;  3C1D A;  4BY7 J;  5HNH A;  1R5I D;  1P4A A;  1TQP A;  1IAW A;  1Y0U A;  4P96 A;  3E6B A;  3OYM A;  1XDS A;  1V4R A;  2EZK A;  1VQ9 I;  4A3L J;  1W0T A;  2CUE A;  2OBP A;  3FXM A;  2P5V A;  4Q47 A;  3SDG A;  2V9K A;  1FOW A;  4XKW A;  2O8X A;  2P5K A;  2W7N A;  5J6X A;  3PIO F;  2F5C A;  2Y69 H;  2MGQ A;  2R5Z B;  3DWL E;  4RDU A;  4BE2 A;  4ZZL A;  1YLF A;  5HVQ C;  4IOC F;  4KT5 C;  5HLI A;  3OS2 A;  2R7R A;  4A0Y A;  1F36 A;  2DPU A;  4QWQ A;  2PJP A;  4NQW A;  2E36 A;  2W82 A;  3K69 A;  3KEQ A;  3AG3 H;  4PJL A;  1MSE C;  4N4O B;  2ISZ A;  5FFZ A;  3WU1 B;  2LSO A;  3EQL F;  5TJJ A;  3GUD A;  3H3U A;  1VQ8 I;  4MTE A;  2M1B A;  4XSX F;  2ZXH A;  3GFI A;  1OFC X;  2M45 A;  2OZU A;  2HTJ A;  1UZC A;  1FNN A;  4CCO A;  1CF7 A;  1TT5 B;  5L3C A;  1U8R A;  2DLL A;  2LKP A;  3GFL A;  1VQK I;  1I1G A;  3AG2 H;  3R4K A;  1KYZ A;  2FBI A;  5JVT A;  5BOX A;  1BM9 A;  1Z05 A;  1AHD P;  1NHA A;  3SFZ A;  2ZJP F;  2WTE A;  4M3B A;  3GTM J;  2C6Y A;  2R7O A;  1QHG A;  3I55 I;  2W84 A;  4LD5 A;  4EJT A;  3PQK A;  2CQX A;  1SMT A;  2HXO A;  2MG4 A;  3K1M A;  2E5Z A;  4RAY A;  3CCY A;  2VKD A;  1X4P A;  3RPQ A;  1SVO A;  3P9C A;  4CDG A;  3NQO A;  2CW0 F;  3I5U A;  3SEQ A;  2LKS A;  1MSF C;  2R5Y B;  2V1U A;  1PP7 U;  2W4S A;  4LLL A;  5B3S H;  3RKX A;  3JRF A;  1DUX C;  2PEX A;  4U7D A;  1U9O A;  3C2B A;  4L5E A;  1YJW I;  1UAA A;  3HB9 A;  1A36 A;  1HA8 A;  3TKY A;  5ILV A;  1H8A C;  4WXH A;  2EJR A;  3RJP A;  1SD5 A;  1DP3 A;  2CV0 A;  1R4M B;  5JHU A;  2WWY A;  3WE3 A;  5TRD A;  4XLN F;  3D5R C;  3CCR I;  2V1D A;  2EB7 A;  4CCM A;  5DCF A;  4R79 A;  3IRQ A;  2DJN A;  4PK4 A;  5C3E J;  4ZZD A;  4Z2Y A;  5EDN A;  2LY9 A;  5FKO A;  5J1R A;  1UG0 A;  3F6O A;  4D9J A;  2Y0S N;  3LQQ A;  5CKT A;  3PNT A;  2QZ8 A;  2VN2 A;  2DTZ A;  2DA5 A;  1FOY A;  2O6G E;  1AU7 A;  2Y31 A;  3GTQ J;  1IC8 A;  2Z1D A;  1JJ8 C;  4IX7 A;  3OIP A;  4AVZ A;  3VEP A;  5CVI A;  1R4N B;  4LB5 A;  2FNA A;  1FP2 A;  4ENM A;  2XRL A;  2EPF A;  4PGG A;  4B3A A;  2XUB A;  4EJU A;  2R7D A;  1D1C A;  1NTC A;  5DM7 F;  3AKZ A;  2P81 A;  3I71 A;  5F08 A;  4I6Z A;  3BR6 A;  2QLZ A;  4XKC A;  3W2W A;  5JLX A;  3CCL I;  3V4G A;  5HOO A;  1R1U A;  4CYC A;  4DBQ A;  2QUF A;  2FSW A;  2FBH A;  5F1R A;  2BY2 A;  1YQA A;  5ED4 A;  3DPT A;  2VOP A;  1P7I A;  2ACJ A;  1FLI A;  3MZ8 A;  4J19 A;  1YRN A;  2ID3 A;  5GAH J;  2VKE A;  5LEK A;  4IHV A;  1ZK8 A;  2DMN A;  1FMW A;  3PO2 J;  1ZHF A;  5DUI A;  1G3T A;  2JT1 A;  3MCZ A;  3ERM A;  5LGN A;  2DO7 A;  1GLN A;  2JA8 J;  1X3W B;  3F3X A;  2JZY A;  4MIM A;  2ZC2 A;  4EEF G;  1P2F A;  3LA2 A;  1R22 A;  3UKG A;  2QEN A;  2W24 A;  3HKZ N;  2R4G A;  1GHC A;  1QPI A;  2ZKZ A;  3W6K B;  5EGO B;  2X9D A;  3OYH A;  3GXO A;  2L7Z A;  4B47 A;  3HG9 A;  1IZ1 A;  1WJD A;  2ZO4 A;  4A5M A;  4RBO A;  4A6D A;  4EM0 B;  2K3P A;  3TOB A;  2JTV A;  2XAF A;  1HQC A;  2WB1 A;  5FJ8 J;  1CGP A;  1UB9 A;  3G3Z A;  1FBQ A;  1HC8 A;  3A4C A;  2Z5U A;  1M1E B;  1KGS A;  4IL6 C;  3M9A A;  5L3B A;  1WI3 A;  1P7J A;  3LA3 A;  2Y0S A;  5E8G A;  1U5T C;  3H5A A;  3WTX C;  2WV0 A;  1MBF A;  2QSF X;  3K4L A;  2P8T A;  1D8J A;  4UNO A;  1W0U A;  3KP7 A;  4O5V A;  4GGG A;  2EFO A;  4BJT A;  3ZCO A;  5BPI A;  3M8E A;  2K4J A;  1BN5 A;  1TTY A;  2DK8 A;  5L3G A;  2RRE A;  1AKH A;  3OL4 A;  3SZG A;  4H0E A;  3S2H J;  2MW8 A;  1KU3 A;  1T39 A;  4IRH A;  2EFQ A;  2OQR A;  2WAQ N;  4KMU X;  4N9H A;  4Y15 A;  2H6C A;  2KQR A;  3NEU A;  3RPU A;  1I6X A;  3GZ6 A;  1BA5 A;  3BTC A;  3HSF A;  1SAN A;  2X6Y A;  4I01 A;  3JAM K;  3LNQ A;  1VND A;  3QPS A;  3OOU A;  3G73 A;  1QNT A;  2M8E A;  2XC7 A;  1EH7 A;  1JUS A;  3IH2 A;  4F93 B;  4GYG A;  3VYT B;  4A3E J;  1WJA A;  4UXN A;  2ZME C;  4I02 A;  1SD4 A;  5HDN A;  2FJ1 A;  3J80 Z;  1UHS A;  4DJA A;  2VLA A;  3JRD A;  2HQN A;  1FSH A;  1YG2 A;  3JR9 A;  2LKX A;  3FMS A;  3FX3 A;  2VOO A;  3EUA A;  4EM1 A;  2H1K A;  3GO5 A;  5IOZ A;  3BQZ A;  3HXL A;  3CO6 C;  2E7X A;  5F1J A;  1FYM A;  2XRN A;  2BBY A;  5GAE J;  1A6I A;  1S7O A;  2XIG A;  1IRX A;  3CF2 A;  4IZZ A;  5LHH A;  4E7J A;  2CWE A;  1W36 D;  2Y2Z A;  5JVG F;  4NQW B;  1FP1 D;  3BG6 A;  1ETW A;  4RM2 A;  3F0C A;  5JHF A;  1MJ9 A;  5IT9 Z;  4HV6 A;  1JHH A;  2Y9Z A;  2ZFW A;  2QSH X;  2JA5 J;  3RQ4 A;  2E1M B;  4CUG A;  3TGN A;  2COM A;  1O4X A;  2M30 A;  4ZH4 F;  3R60 A;  1ZGJ A;  1IRG A;  4L9J A;  3BR2 A;  3D0S A;  4PJJ A;  4GO1 A;  4WX9 A;  3DP7 A;  3LSK A;  2M2E A;  3DU5 A;  2Q2E A;  1D8K A;  1H88 C;  4PFP A;  1LPQ A;  1HCR A;  1OYW A;  2A6H F;  1XSV A;  1V3F A;  2GAU A;  2F5V A;  4PJ0 C;  3LSM A;  1EV7 A;  2G7U A;  1WCM J;  2EQR A;  4R1H A;  1I5Z A;  2R0Q C;  1IN8 A;  2QCO A;  2F48 A;  1BW6 A;  1P6R A;  1QVU A;  2O5R A;  5FLX Z;  3MZY A;  1D0X A;  4X1E A;  2XSJ C;  2ZJR F;  2TDX A;  2WAD A;  2ZJ2 A;  1Z6R A;  2DAO A;  3ASN H;  3BCB A;  4I98 B;  4XOP A;  3VYR B;  5IY5 H;  3DLL F;  5KVR A;  4OAY A;  3CJT B;  4R8H A;  1TWF J;  3W3C A;  3NAR A;  2XGC A;  1XX5 A;  4QIW N;  3BJO A;  3FIS A;  1D1B A;  1R5H A;  3I9V 2;  3I56 I;  3OYL A;  2VKH A;  1J59 A;  4G6D A;  4HST A;  3HOW J;  5IT9 K;  3CTA A;  3HSE A;  3OR1 C;  5FKL A;  1H9G A;  1V54 H;  4B44 A;  4HX4 A;  1RR7 A;  1J7K A;  4HDU A;  2HNH A;  4NDL A;  1W7P D;  3M7G A;  1IXS B;  3LWF A;  1K7A A;  4BJ5 C;  1FPQ A;  1YX5 A;  4BQN A;  4RGX A;  1F9N A;  4KJZ A;  3H1C A;  3J80 K;  3J81 Z;  5E79 C;  5IYD J;  5DCM A;  4A6E A;  2QQA A;  4MNU A;  2A69 F;  3LAP A;  2OTL I;  4FCY A;  3I58 A;  4M74 A;  3DCF A;  4HAM A;  4ZDO A;  4A2U A;  1TNT A;  3KP2 A;  2ZSH B;  2K7L A;  1X3Z B;  1N77 A;  1B8I B;  2R7X A;  4XN0 A;  1TWG J;  2K9Q A;  2FOK A;  1FTZ A;  1G8X A;  1VQO I;  3FXO A;  2EV0 A;  4KDP A;  1OCO H;  3DV8 A;  4CCL A;  4BKX A;  4XRF A;  4KIF A;  2X6W A;  3CZ6 A;  1PJR A;  3CUQ C;  2DT6 A;  2M9H A;  2PX9 A;  4AVP A;  2DPD A;  1FWZ A;  3AFH A;  4IQ4 A;  3I0T A;  1LE8 A;  4IHW A;  4L9T A;  1XGS A;  3QYB A;  1AWC A;  5AON A;  2E71 A;  1KON A;  1S3J A;  3H0G J;  1EH8 A;  2CQ7 A;  3OYA A;  2D2W A;  2FX0 A;  4ZC3 A;  1C0W A;  1B1B A;  1U2W A;  2PQ8 A;  3LSH A;  4DW6 A;  1Q1V A;  2ZB9 A;  1BOA A;  2RQQ A;  4HOB A;  5FLM J;  1GUU A;  3BZC A;  4JX4 A;  5FKM A;  2LNB A;  5KHD A;  3MWM A;  2NYX A;  1TL8 A;  1XMK A;  2ESN A;  2NS7 A;  1X1D A;  3CUO A;  5HLT A;  4A69 C;  1ULY A;  2XAG A;  3NAU A;  3EYY A;  4K2E A;  1JE8 A;  1WJB A;  2KJB A;  3WTS C;  2YPR A;  2IEK A;  2ZME A;  2CV2 A;  1IRZ A;  1T56 A;  4PSX A;  3P9I A;  3Q9V A;  1O57 A;  1S72 I;  1ETQ A;  3DBR B;  1JTY A;  1VI0 A;  2HWV A;  4UVC A;  4RAF A;  1WKM A;  3E6C C;  4BDZ A;  3IV5 A;  3WTU C;  2QQB A;  3CMY A;  4IHY A;  2H8W A;  2Z2S B;  3S14 J;  2Q8K A;  4BXU A;  1IF1 A;  1MW7 A;  3F9K A;  2PMH A;  1Z91 A;  1VFC A;  2QWW A;  4BBS J;  2M7B A;  4ON0 A;  4HZF A;  3F22 A;  3QU3 A;  2XGE A;  3KYC B;  3OYN A;  1D3Y A;  5B66 C;  4ZYG A;  5TIS C;  4HV5 A;  4XSZ F;  4N9I A;  2MFZ A;  4A3B J;  4OIR F;  3GEZ A;  3BG7 A;  2ETH A;  3R0A A;  3V8J A;  2WAE A;  3DEE A;  2DA4 A;  3DPU A;  5K1Y A;  1IGN A;  3Q0V A;  2VPL A;  2XGD A;  3IP4 B;  1UST A;  1U5T B;  2KDO A;  4LJZ F;  3PO3 J;  4W97 A;  3FWE A;  2IW5 A;  5E18 F;  2FF4 A;  1VQ4 I;  3K2A A;  1MKM A;  4EJV A;  4IF4 A;  5ILU A;  1K78 A;  2V7F A;  3K4B A;  4CCK A;  3GFM A;  3ZMU A;  3BG5 A;  4YRV A;  1T98 A;  3K0L A;  3BPX A;  4FIS A;  5E1W A;  1XGO A;  2IBD A;  3QQA A;  5LD2 C;  2FA5 A;  2VL8 A;  1YIT I;  3FDY A;  1SAU A;  3DKY A;  1SC7 A;  3BOQ A;  1S5L C;  3ECH A;  3FMQ A;  4L9N A;  2O03 A;  1FTT A;  1G3Y A;  3CUQ A;  4NC6 A;  5EEH A;  3VFZ A;  1O7F A;  2PI0 A;  4OMY A;  2JJ7 A;  4A3I J;  3LQR A;  1I3Q J;  2D5V A;  1RUO A;  3BR5 A;  3C18 A;  3CJN A;  3H92 A;  5HDG A;  1IO2 A;  2A68 F;  3REO A;  3B6A A;  3FM3 A;  1K6O A;  1R00 A;  2BW3 A;  1ZR4 A;  3W6J B;  1XG1 A;  1JKP C;  1ODD A;  2X1C A;  4LIT A;  2CW8 A;  1B6A A;  3CJR B;  1OLT A;  2M4K A;  2QKL B;  1U0J A;  4HNT A;  3DXJ F;  2QF7 A;  2EIK H;  3IL2 A;  5AIQ A;  4M71 A;  3CJQ B;  1WJF A;  3TDU C;  1VQM I;  4EMS A;  1YW8 A;  1O3Q A;  5CVU A;  2CV1 A;  2VBX A;  1ORK A;  1RNL A;  2X4H A;  2DYR H;  1B72 A;  3OYC A;  4GXO A;  4HX8 A;  2EA4 A;  3TBI A;  5KAF C;  1Z9C A;  1QGP A;  3TL4 X;  3C7J A;  2EH3 A;  3ZQL A;  3HTU A;  4ESJ A;  1MIJ A;  3ZPL A;  3BP8 A;  3E97 A;  4ENJ A;  2H8R A;  3QYE A;  2ISY A;  2XB0 X;  3NWT A;  1NK2 P;  1WVR A;  1D5V A;  3T8R A;  1FJL A;  1G2H A;  1IRF A;  1O3R A;  3AL0 B;  3MKW B;  1F43 A;  3B6C A;  3HIF A;  3IKT A;  2K85 A;  2Q1Z B;  4M9Z A;  3FXQ A;  1XSX A;  3BLY A;  1JTX A;  3CC4 I;  1YO5 C;  1I39 A;  1LDK B;  5H6R A;  1I3A A;  2CH0 A;  5HS9 A;  5D8K B;  3E0J B;  2Z16 A;  1IXR C;  3MQ0 A;  1UFM A;  1N25 A;  3ZQC A;  2WAQ A;  2DA2 A;  3U9G A;  4X0G A;  4PZJ A;  3WTY C;  1OPC A;  1QQI A;  1W7P B;  4C2T A;  2M34 A;  3FXK A;  1GXQ A;  2NXN B;  1YS6 A;  2HZD A;  3E6M A;  1OKR A;  1HKT A;  4CZC A;  1HST A;  2K27 A;  5LGU A;  2BW3 B;  4A12 A;  1MDM A;  2V4J C;  3S1N J;  1QRY A;  2CQN A;  1D1A A;  2ZXI A;  3MEX A;  4DYQ A;  2R5Y A;  1TW3 A;  4I0B A;  2KDZ A;  4A3M J;  2NOJ B;  1TLH B;  2BEO A;  1WQ2 A;  2ZCW A;  3NRV A;  1OMI A;  3M1C A;  5J40 A;  4I7H A;  5E8I A;  3WTV C;  2E7W A;  4GFB A;  3VDX A;  2CFX A;  2B7E A;  4UVA A;  3GTG J;  2BHY A;  3PQJ A;  4EV0 A;  1ZRF A;  1WRJ A;  3FXR A;  2E1M C;  4XMY A;  4QSH A;  2GXB A;  1VF9 A;  1Z77 A;  1BW5 A;  1YTY A;  2IPQ X;  2L54 A;  5K7Z A;  4HG2 A;  2ZSI B;  4EVI A;  1AKH B;  1YFH A;  4HSR A;  5L3F A;  4BE0 A;  3VB2 A;  2ESH A;  3ABM H;  2VOD A;  3U21 A;  5EZG A;  1Y39 A;  2QVO A;  1X19 A;  3KE2 A;  3T8T A;  2KT0 A;  5C44 J;  4J01 A;  4IEJ A;  1OCR H;  3WOD F;  1P4W A;  4CO8 A;  4HNV A;  4RB2 C;  1LFU P;  4RS8 A;  3IAS 2;  2ZNY A;  1P92 A;  1ZG1 A;  1OCC H;  1ETX A;  1OYI A;  1TQI A;  3B73 A;  5A2Q Z;  3CCV I;  3ESW B;  2OTJ I;  2OV7 A;  2ZNZ A;  3JCU C;  4RM3 A;  3JSP A;  2EZL A;  1G59 A;  2V79 A;  3GBG A;  1RC9 A;  3TED A;  4L0Z B;  2KZV A;  2JVH A;  4X6A J;  4HNU A;  2MAB A;  4BE1 A;  3CCU I;  2HDC A;  3N97 A;  1VQ6 I;  3RPU D;  2XVC A;  3DKW A;  3K1P A;  2JVG A;  3S93 A;  3V8K A;  2XB5 A;  1VQ5 I;  2CUZ A;  1BR4 A;  4AYB A;  2HDW A;  1QZZ A;  3FM5 A;  3IWZ A;  2KIU A;  4IKF A;  2UWM A;  1T08 B;  3FBN B;  2D1H A;  4UB6 C;  4KYW A;  3SHF A;  4S0H B;  3PNY A;  2VPR A;  3OS0 A;  3EET A;  4D7N A;  2XF5 A;  5CVV A;  4ASN A;  3X2Q H;  5EGO A;  5E3L A;  1MMA A;  3OOP A;  1SFK A;  2BXY A;  2BHZ A;  2IXS A;  3ZGK A;  3PJR A;  4DNC A;  3TDZ C;  4XID A;  3RZO J;  2KL4 A;  4LGW A;  4I2O A;  3CDI A;  4E7Z A;  1JGG A;  1BIA A;  4A0Z A;  1TWH J;  4D0P A;  2RC4 A;  5ICE A;  3OSF A;  4XL9 A;  1WI9 A;  4PGH A;  2DMT A;  3ZMV A;  4KUM A;  1UG2 A;  2VT2 A;  1QHH D;  1LJ9 A;  2QGU A;  1YS7 A;  1E3O C;  4M3F A;  4G7Z F;  3U1D A;  4RA2 A;  5E1Z B;  3HUG B;  1ZR2 A;  1F5T A;  1K4T A;  3ZOB A;  2JPC A;  2KIM A;  4XKV A;  4P9F A;  1T0F A;  1PUE E;  2LRE A;  2P6T A;  2HFH A;  4P55 A;  2Z99 A;  3DEU A;  4Q5S F;  2GBY A;  2DU9 A;  2WY8 Q;  3TW7 A;  3LL7 A;  5JFR A;  3LSI A;  2L7F P;  1JKR C;  1FBS A;  3SYT A;  2GZW A;  2W85 A;  4RGR A;  2MA3 A;  3FZV A;  3KLO A;  5B1B H;  4XLC A;  5FD5 A;  5IP9 J;  2ELJ A;  4M3D A;  4WXD A;  2QQ9 A;  4YG2 F;  1I6H J;  3HRS A;  4NC8 A;  4AIH A;  4B48 A;  1KA8 A;  2X1E A;  1Z3Y A;  4Y33 A;  2RAE A;  3FK6 A;  2BV6 A;  1W7P A;  4BHC A;  1X3U A;  4XRM A;  1W5T A;  3OY9 A;  1JT0 A;  5K5O A;  2VQL A;  3HGG A;  2XPW A;  3GX4 X;  3A01 B;  3GW2 A;  2FXA A;  1SFE A;  5TGT A;  4Z6Y A;  1J75 A;  4FX0 A;  4XR6 A;  2LR8 A;  2JWT A;  2W25 A;  2EIM H;  2MH9 A;  2P6S A;  3LSJ A;  5D5W B;  1WSU A;  4P9U A;  2IRF G;  2A5Y B;  2ID6 A;  3IUO A;  5LFA A;  1XDU A;  4IHS A;  5AIP A;  2L3D A;  1SVL A;  1X1C A;  2KHM A;  3S16 J;  3F72 A;  3FXU A;  1BI1 A;  1R1V A;  1XTA A;  3ULQ B;  4W1U A;  3OR2 C;  1ZRC A;  5J3L A;  1NG6 A;  3JRC A;  1JUM A;  2CJJ A;  4U88 A;  3QOD A;  3MZH A;  3Q3S A;  3G1L A;  3AAF A;  3KYL A;  3H9J A;  2V9P A;  1XCV A;  4II3 A;  3RIR A;  3E5U A;  2RGV A;  2M5W A;  1V5F A;  2BXZ A;  4KN7 X;  2O7O A;  3Q0W A;  4ENK A;  3JAM Z;  3I4N J;  2GM4 A;  1JXS A;  1D0Z A;  4F7Z A;  1TWA J;  5FB2 A;  3JRE A;  2X1D A;  2V1N A;  3S3M A;  5BQT A;  3SEZ A;  2RV8 A;  3ZMS A;  2BY3 A;  4CYC B;  3AL0 C;  5FGM A;  4MO7 A;  2LC2 A;  2XAU A;  2ZXJ A;  3IKV A;  4N4N B;  4QPQ A;  4XQF A;  5IPA A;  2R7U A;  1ACI A;  1MJB A;  1U8B A;  4XBF A;  4XK4 A;  1LNW A;  4EJW A;  5H20 A;  2M8G X;  2HTS A;  2CGP A;  3P9K A;  4OIP F;  5E17 F;  1OCT C;  2STT A;  4XON A;  2VC1 A;  3HL2 A;  2AS5 F;  1D0Y A;  1I27 A;  2L9R A;  5D5U B;  1QPM A;  4LK0 F;  3G4S I;  3I53 A;  1E3P A;  1TBX A;  1KQ0 A;  2M0M A;  1OCZ H;  3BTI A;  2G0E A;  4B43 A;  3HTS B;  2AHQ A;  2PJR A;  1JGS A;  5C4X J;  5E3M A;  1MD0 A;  3H35 A;  4WK8 F;  3O8H A;  4E7I A;  3HYI A;  2XAS A;  4M9X A;  3TQN A;  2ZBK A;  5IYC J;  1SEU A;  2B9S A;  2UZK A;  4ZYA A;  1FIP A;  1XS9 A;  1ON2 A;  5FKN A;  3LSG A;  3K7A J;  4XOR A;  3CCE I;  4L0Y B;  2R7S A;  4B8X A;  3M1E A;  1T38 A;  3RI4 A;  3FKJ A;  2R93 J;  1D5Y A;  3EUK L;  4O6J A;  4V2G A;  5GP9 A;  1VQ7 I;  1HXD A;  1B72 B;  2KMU A;  5FFX A;  1TNS A;  5F04 A;  1ZLJ A;  3HUG A;  5ICF A;  3BTJ A;  3CO7 C;  3O3K A;  5IT3 A;  4KNY A;  3T5X A;  2CQQ A;  5HNF A;  2R7F A;  2L2O A;  3QAH A;  4NNJ A;  1RI7 A;  5FLV A;  4S05 A;  3WU2 C;  1A04 A;  5FKK A;  3RZD J;  2O8K A;  5ERI A;  2JN6 A;  4HA8 A;  2M87 A;  3BPV A;  3ROU A;  1Z1D A;  3OYD A;  3TO7 A;  2OF7 A;  2W1O A;  4BQO A;  4Q48 A;  4XOT A;  3KP6 A;  2JSC A;  3V42 A;  2WB1 N;  3WTW C;  3LFK A;  2R7W A;  2ELK A;  1FZP B;  2WV1 A;  1YX3 A;  3HOT A;  2V6E A;  3WE2 A;  2DA3 A;  4FTH A;  1DDN A;  1ZRE A;  3KP5 A;  3EPZ A;  5CQG A;  4MTD A;  3DPL C;  3HGY A;  3RSN A;  4OWR B;  2I10 A;  4CGZ A;  5DCM B;  2VT3 A;  1MBJ A;  4RLQ A;  3VSL A;  2RQP A;  4FHT A;  2IS4 A;  3R6S A;  3A02 A;  2DMU A;  4BQQ A;  3HBL A;  2Z33 A;  4C2M J;  4LB6 B;  1YE9 A;  3AG1 H;  3E7L A;  4U0V A;  3J7Z I;  1R49 A;  2HVR A;  2FQ3 A;  4F3Q A;  3EUH C;  1HW1 A;  5CPR B;  1KZH A;  1IN5 A;  2H09 A;  1RKT A;  2K40 A;  2DA6 A;  1LVA A;  4H4K C;  1X2N A;  1BI2 A;  3COA C;  3VOE A;  1YHQ I;  1H0M A;  2AQE A;  2IGO A;  3W2A A;  5EYR A;  3B02 A;  1SD7 A;  2IS6 A;  1DGW Y;  3KPH A;  2H94 A;  3MFK A;  4C3H J;  1XD7 A;  4BHB A;  4HF0 A;  2XPV A;  2DQL A;  3D5S C;  2EZI A;  4HYE A;  3HSR A;  4OAZ A;  4DIQ A;  2PLY A;  3G6E I;  3JSO A;  4BNC A;  1E17 A;  2Y48 A;  3I64 A;  4J00 A;  3GLX A;  2QQ8 A;  3O8G A;  2VE9 A;  3IWF A;  3RYP A;  3QU6 A;  5M3M J;  4KIG A;  4Y3O A;  4JOM A;  1MMD A;  4EJO A;  1ZH5 A;  4CA0 A;  1ZAO A;  2IJL A;  4RLF A;  5L3D A;  1W5C C;  2L01 A;  1S8N A;  3I59 A;  2PMZ N;  4BXF A;  1IV8 A;  2W48 A;  4UV8 A;  5GAG J;  1BIB A;  2E1O A;  2X0L A;  4PDK A;  3MD2 A;  1MNE A;  2EZH A;  4EGY A;  2WY7 Q;  4ZTF A;  3CMA I;  3BZK A;  3F8C A;  2MC4 A;  2HQ5 A;  1O7L A;  2L7K A;  2V6C A;  1VQL I;  3BR1 A;  1VQN I;  2CYY A;  2RVC A;  2IS2 A;  4S04 A;  2UV1 A;  1HKQ A;  1FYK A;  2P7C B;  3ASO H;  2NNY A;  3ABT A;  2GA2 A;  3K4J A;  5E20 A;  1XMA A;  3MMY B;  4LFU A;  4DZP A;  3TP0 A;  3E1S A;  1TZL A;  1EJ9 A;  4FE7 A;  2IP2 A;  4UHT A;  3E5X A;  2DDA A;  1LFP A;  1MBK A;  3L2W A;  4BGD A;  4HDV A;  1ETY A;  1SD6 A;  1JKO C;  4NBQ A;  3BQY A;  2XKP A;  1DP7 P;  2R7V A;  4HRI A;  4PUS A;  2STW A;  1YIO A;  1SFO J;  4WXC A;  2E1C A;  2KIQ A;  2VJ5 A;  3OIQ A;  4A3G J;  5CYV A;  4AM3 A;  1GT0 C;  1GVJ A;  3FXL A;  2Z3Y A;  1ETK A;  4ZJZ A;  2H1L A;  3MKZ A;  3K6G A;  3C2H A;  4GCV A;  5F0C A;  4RMN A;  5J1U A;  1VZ0 A;  5CVR A;  3BCA A;  3WGI A;  5K5Q A;  3T0Y A;  2CUF A;  2BOL A;  3UR3 C;  3QP5 A;  3FIW A;  3HJE A;  3CC7 I;  1E3H A;  1NG7 A;  2CRG A;  2ME6 A;  3ZN1 A;  3ABU A;  4HBL A;  2FE3 A;  3GFJ A;  4OU0 A;  3PUF A;  4KN4 X;  1MMG A;  2Y30 A;  1R36 A;  1RIO H;  1LE8 B;  2V26 A;  2MC3 A;  4XRS A;  4ZDP A;  1T8I A;  4UUV A;  3KYD B;  3KP4 A;  4U0W A;  2E35 A;  3GCM A;  4BEH B;  4Q4Z F;  3SQN A;  4MGR A;  1V5E A;  1HDP A;  1QVT A;  4BXX J;  1WHU A;  1CF7 B;  2FD5 A;  2QYO A;  3CDL A;  1N78 A;  4MLO A;  1V5G A;  5J8F A;  4CYD A;  3SDB A;  1W1W E;  3CP8 A;  3L2V A;  2A5W A;  4IQJ A;  1Z7L A;  4LOC A;  3A1Y A;  3MKL A;  3QPL A;  3VWB A;  1Y0N A;  4XRS G;  4EAT A;  2WA0 A;  3LST A;  5GPA A;  4IHX A;  3DFG A;  2NS8 A;  3OYI A;  3GTP J;  3M3Y J;  4CCN A;  4UUS A;  5B5E C;  1A31 A;  3GTJ J;  2EK5 A;  2CFO A;  1IN6 A;  2LBF A;  4E70 A;  3WTT C;  4M6Y A;  3K10 A;  1HBX G;  2GA1 A;  2GXG A;  2BE5 F;  3ZRG A;  1E2X A;  3F23 A;  2K9L A;  4XLA A;  1ZRD A;  1W5S A;  1X1P A;  3IHU A;  3V7C A;  3ZR8 X;  1DQU A;  5DV5 A;  2IA2 A;  5D4S A;  2LP0 A;  4I99 C;  1IXC A;  5HLH A;  2JMW A;  4M3E A;  4UB8 C;  2DCE A;  3FMR A;  3LOC A;  5FRO A;  3ZQQ A;  1KU2 A;  3CP2 A;  4RB3 C;  3NWS A;  2IGM A;  4LG0 B;  4IRI A;  3KZY A;  2HVQ A;  1J0R A;  1QO0 D;  4QPO A;  4XLF A;  4ESF A;  3FF5 A;  3WG7 H;  2OCC H;  1XGM A;  4M9S A;  2AQF A;  5EG0 B;  5FRM A;  2ZFU A;  1IN7 A;  5D6E A;  1O3T A;  2KFD A;  2L5Q A;  3I4M J;  2L0K A;  1U3E M;  2KJC A;  2DN0 A;  3HHG A;  2QBY B;  2XF6 A;  4G9Y A;  4JX5 A;  4G8X A;  1FC3 A;  2DFH A;  2JRM A;  2VQG A;  4RAZ A;  4A5N A;  1TP4 A;  3M8J A;  1I50 J;  2ADU A;  3DQV C;  4G94 A;  3OYF A;  3LAJ A;  4E6K G;  1BJA A;  2R5Z A;  2YUS A;  3BTL A;  4F92 B;  1WGX A;  2J5P A;  3RTR A;  2DOD A;  3H9Q A;  5HLG A;  1ZGW A;  1ERD A;  1T2K A;  1HLV A;  4YEJ A;  4PFO A;  3DTI A;  1HOM A;  1BOB A;  3U1K A;  3H0D A;  1B59 A;  2GOX B;  4P5O A;  3BZ6 A;  5M5Y J;  4CSW A;  3ZQF A;  4YFN F;  1Z67 A;  1IDZ A;  1F4K A;  2HYF A;  2L7M P;  1IN4 A;  1L3L A;  2W00 A;  2OCE A;  4JK1 X;  3HOY J;  2L4A A;  1YW7 A;  2E60 A;  1UHM A;  1SFX A;  1Z0X A;  2PMU A;  4CH7 A;  3CD6 I;  5ICC A;  4CXF A;  3JRA A;  1HDD C;  2ELH A;  2N8G A;  2IGN A;  2EBI A;  4IPA A;  1RKW A;  2VAS A;  3CCM I;  5F6F A;  1BR1 A;  3QOE A;  3DKX A;  1A6Q A;  1WWX A;  1NH3 A;  2KRF A;  2D45 A;  2FU4 A;  3M07 A;  2TRT A;  5LEJ A;  2JPB A;  1BI3 A;  4NC7 A;  1T6S A;  1BC8 C;  1Y8Q B;  2MSY A;  5H6Q A;  1MND A;  2CUJ A;  2CMP A;  1X58 A;  1ZKG A;  4BUP A;  4O3M A;  3IH3 A;  3RCO A;  3DLA A;  2XDV A;  3BG9 A;  4BAY A;  4XKB A;  4Y4R A;  4WWC A;  5M5W J;  2E2J J;  2O61 A;  3G1O A;  2A05 A;  2KKO A;  5M5X J;  2XSD C;  4A3K J;  5JI6 A;  1XSD A;  3G1M A;  3F8F A;  2O9L A;  1G6N A;  1HW2 A;  3ZMZ A;  1SAX A;  2XRO A;  3L2U A;  1AOY A;  3E5Q A;  4KT6 A;  1LB2 A;  1K83 J;  3PFY A;  1KQ9 A;  4BS9 A;  5LHG A;  1BJZ A;  1B9N A;  2LDU A;  4D7M A;  4Y52 J;  2FEZ A;  3WU0 A;  2OZ6 A;  4OIQ F;  4KIC A;  1OYY A;  1MBE A;  4F52 A;  2VI6 A;  4FET A;  3L1P A;  2QEX I;  6PAX A;  1R58 A;  2YX4 A;  1K78 B;  1OIS A;  3IC7 A;  3OMY A;  3ZXS A;  1TQM A;  1BR2 A;  4UV9 A;  3R0J A;  1X1A A;  3ZQI A;  2NS0 A;  2VIX A;  2R3S A;  3Q0U A;  5FD6 A;  3K70 D;  1Y1W J;  5HS8 A;  1JKQ C;  3RYR A;  2VQH A;  1YIJ I;  1KQ8 A;  4GDF A;  2F4I A;  2A6T A;  1AA7 A;  2LD5 A;  2CG4 A;  2HZT A;  2R7Z J;  3GTK J;  2ECB A;  2VQC A;  3FXJ A;  4LLG F;  2DW4 A;  2VXZ A;  2HKX A;  1LUJ B;  3BY6 A;  5EJC A;  3O6B B;  2I5U A;  1ONV A;  1FBU A;  3W2V A;  3L09 A;  1RET A;  2F5F A;  3ISP A;  3L00 A;  3HPH A;  3MN2 A;  3O2P E;  1L0O C;  1FOK A;  3ZQH A;  4YII A;  2X6X A;  2VXD A;  1FSE A;  2DYS H;  1MGT A;  2JA2 A;  4HW0 A;  2XF7 A;  3UNG C;  4UY8 I;  1SMY F;  1XC5 A;  1FOX A;  2MD0 A;  1FMV A;  2UXX A;  3HZJ A;  4C3I J;  2HOT A;  5BPD A;  2IVM A;  4LG3 A;  3S8P A;  3ZP5 A;  2DBB A;  3JRI A;  3BC8 A;  3H3Z A;  1XN7 A;  4UUS B;  3HKZ A;  1R5G A;  2X51 A;  4PSW A;  1RUN A;  2E2H J;  3J7Y J;  1IJW C;  1R7J A;  3CMM A;  4Y17 A;  3QOP A;  2XV4 S;  1HKS A;  3IH4 A;  4U87 A;  1UCR A;  4RAG A;  1B9M A;  4CCJ A;  5IP7 J;  3E6D A;  3ZN0 A;  2HOA A;  2XHK A;  4M3G A;  1CQT A;  3R61 A;  3OYB A;  2HVS A;  2L9S A;  1ETO A;  1Z3X A;  1KU7 A;  1LEA A;  3GTL J;  4JYK A;  4IOA F;  2IGK A;  3CCQ I;  3H5R A;  1VQP I;  2JQ7 A;  2XPU A;  1EKE A;  2NVU B;  3GWZ A;  2LF7 A;  3GZ5 A;  5BNG A;  2E2I J;  2OD5 A;  4HLX A;  2RKH A;  4ZYH A;  2K4B A;  1YYV A;  3CME I;  1JT6 A;  3N4M A;  4BQA A;  1YW9 A;  1WFX A;  2HKO A;  4L9V A;  3DEW A;  4E7S A;  4P1W A;  4V2F A;  4A3D J;  4XN3 A;  3A2K A;  1PVE A;  4KFC A;  3LSR A;  2OJE D;  5B1A H;  2F4O B;  1PDN C;  1E0E A;  1LFB A;  2X48 A;  2QBY A;  2JRT A;  4DBR A;  1JHF A;  4NHJ A;  4KIB A;  1XCB A;  2LOO A;  4UVB A;  1LVK A;  4L5I A;  4D5F A;  4BY1 J;  2A61 A;  1FIA A;  2E19 A;  3BRO A;  5KNL A;  2JA7 J;  3S1R J;  4CHU A;  4PCQ A;  4A0X A;  4N0B A;  4CIC A;  1OQY A;  1ZTR A;  3TO9 A;  3HOX J;  2RNJ A;  3SXY A;  2K5C A;  1BI0 A;  2AO9 A;  3MKY B;  1S6L A;  1S9H A;  5ICG A;  2HQR A;  1QZE A;  4TV7 A;  2K02 A;  2E34 A;  3HDD A;  3OIO A;  4A3C J;  5H2F C;  2IS1 A;  3H5N A;  4UUT A;  4YFK F;  3A01 A;  1KU9 A;  4FQG A;  2FBK A;  1UEL B;  2XAQ A;  1S29 A;  1I1S A;  5HOD A;  2GXA A;  1REP C;  2NVY J;  3LFU A;  2K3F A;  1UMQ A;  1FEX A;  1ZYR F;  2HGC A;  2M7A A;  3A03 A;  3K1N A;  3C2G A;  3P7N A;  2Q0O A;  5CVJ A;  4WCG A;  4ZYD A;  4FX4 A;  1YJ9 I;  2NVX J;  3T1B A;  4OIN F;  2FQ4 A;  3F8N A;  2LVS A;  2DOE A;  1HF0 A;  3A0H C;  5J1Y A;  1A5J A;  2YU9 J;  1GV2 A;  4WF2 A;  1UHW A;  3CCS I;  4IO9 F;  4XIC A;  1YOV B;  3M4O J;  1S7A A;  2VBY A;  3WHB A;  5EEG A;  5J8C A;  5A2Q K;  5EZH A;  1IG7 A;  1BC7 C;  1ZLK A;  2FRH A;  4I09 A;  2KZG A;  1DGR M;  3V7R A;  4G6Q A;  4NUB A;  4AU7 A;  2JUC A;  2LG4 A;  1J5Y A;  5LGT A;  3TMO A;  3AG4 H;  5BS6 A;  2NRA C;  3IAM 2;  4BBR J;  3DTE A;  4M72 A;  3QP6 A;  3SZP A;  1FY7 A;  4DZJ A;  4ZTJ A;  3K4C A;  1POG A;  2BVM A;  4HF2 A;  4RB1 A;  2O3F A;  4JP0 A;  4ENN A;  2HPI A;  2RNG A;  3BJA A;  2F4M B;  4MHG A;  3OSG A;  2EV5 A;  4AD9 A;  1MH3 A;  2VBW A;  3KCC A;  4AC0 A;  2QA4 I;  4D1Q A;  4B4C A;  4B09 A;  2F6C A;  2K9N A;  2COB A;  3WG9 A;  5GAD J;  2DA7 A;  4LIV A;  3SJM A;  1A35 A;  2P5L C;  5DYM A;  2OPT A;  2LMD A;  2AXT C;  3J81 K;  2F5D A;  3MVP A;  1HW5 A;  3JRG A;  2HS5 A;  3ELK A;  1MMS A;  3KEY A;  2OA4 A;  3BJ6 A;  3K4M A;  2MLK A;  2TCT A;  5K7F A;  3EYI A;  1ITY A;  1LDD A;  2DT5 A;  2QKM B;  5LRR A;  4G7O F;  1G3W A;  2VUM J;  2WAF A;  4Y13 A;  5FO5 A;  4FAS D;  2KPM A;  4LK1 F;  2BY1 A;  2DK5 A;  4FT8 A;  1EF4 A;  3HC7 A;  1U5T A;  4ITV A;  4DQ2 A;  1IDY A;  2L02 A;  5KCM A;  1ZN2 A;  3ERE D;  1IW7 F;  2PBI A;  3VSK A;  1OCP A;  1U6G A;  3ABL H;  1YJN I;  1Y6I A;  3BR0 A;  1U78 A;  3QPT A;  1YI2 I;  2BY0 A;  3KFW X;  2FUG 2;  3L2C A;  1P9Q C;  2VE8 A;  3CES A;  4HLY A;  4G12 A;  5EF6 A;  1GXP A;  1VTN C;  3CC2 I;  4KIT B;  3EDP A;  3BG3 A;  1H9T A;  1O3S A;  3ZMT A;  1T33 A;  4RGS A;  5D5V B;  1NK3 P;  4HF1 A;  3HOU J;  3U2R A;  1Y8R B;  2VC0 A;  3C3W A;  2YU3 A;  3JRH A;  3KIO A;  2L9N A;  3KLN A;  5DTD A;  3DBL B;  4IRG A;  2D1V A;  2PG4 A;  2L9V A;  2F5E A;  2OUM A;  2IAI A;  1PYV A;  1JUP A;  5JLW A;  5KAI C;  2LFB A;  3Q5F A;  3BR3 A;  2CS3 A;  3P5J A;  5E3N A;  4G6T B;  5E3O A;  1P4X A;  2MBF A;  1WH5 A;  3S1M J;  2LBF B;  1QU3 A;  5GTI C;  3HOV J;  2GQQ A;  3RKQ A;  4QTR A;  3ONQ A;  1WPK A;  1MH4 A;  4RGU A;  3S15 J;  3FK7 A;  1ZG3 A;  4F91 B;  3OYE A;  1Z6T A;  1Z21 A;  1YRN B;  3PSF A;  4IVN A;  5K7H A;  3KET A;  3EUH A;  3CDH A;  3ML6 A;  3PL8 A;  3BWG A;  2L4M A;  3HHH A;  5C4J J;  2R7T A;  1MMN A;  3D5L A;  5CLS A;  5J4Y A;  1WZ2 A;  4EQQ A;  1R23 A;  3TO6 A;  2Y75 A;  1F1Z A;  1R71 A;  2WBM A;  1ZEL A;  3HM5 A;  4OOI A;  4C9Y A;  5J47 A;  3F21 A;  5D6F A;  2JUG A;  1LQ1 A;  5D5X B;  3WTZ A;  2HR3 A;  1DPR A;  2XAH A;  4Y7N J;  2DA1 A;  2KLO A;  1J2X A;  4BH9 A;  3K70 C;  3S2D J;  1TC3 C;  3I54 A;  1WJC A;  3OV8 A;  2YR2 A;  2R7Q A;  4MEY F;  2V1X A;  3S3O A;  1APL C;  1TWC J;  3VPR A;  1XGN A;  3DF8 A;  2JSP A;  5EEA A;  4IHT A;  4EM2 A;  3HOZ J;  1G3S A;  2A3S A;  1TT0 A;  2DOF A;  1FYL A;  2NAZ A;  2EIL H;  2DQR A;  1HSJ A;  4II2 A;  1K4S A;  3RKW A;  2VKV A;  1PUF A;  2CU7 A;  3JRB A;  1W36 C;  2X6O A;  2EFN A;  1RPW A;  3GVA A;  1IV6 A;  4QLC U;  4M6X A;  4A3J J;  2DOA A;  4HQM A;  2MLG A;  2E5N A;  4DOZ A;  2LF8 A;  3KZI C;  5ILS A;  2I8D A;  4BAC A;  5GPC A;  3PFI A;  4DYR A;  2FOW A;  4I76 A;  3FBI B;  4A93 J;  4FE4 A;  4EGZ A;  4GRI A;  1WJE A;  4BJ6 C;  4G7H F;  2DI3 A;  2MH2 A;  3HRU A;  4HEA 2;  3CLO A;  4C30 A;  2Y9Y A;  3L7W A;  2HOS A;  5LHI A;  1OJL A;  2K9S A;  3KX2 A;  4AID A;  5DM6 F;  4XLE A;  2GWR A;  3TP3 A;  1J09 A;  5DD4 A;  3GZN B;  1UJ8 A;  5DDG A;  2CW7 A;  4U7B A;  3SFI A;  4OIO F;  2VJJ A;  2LK2 A;  2P7V B;  3F8M A;  4KA4 A;  2GLO A;  4PJM A;  4PJN A;  3BDD A;  2UXN A;  1T0F C;  3HRT A;  2DJI A;  2P0W A;  3DTK A;  3KP3 A;  2NVQ J;  1IUY A;  2RN7 A;  1OR7 C;  3I4P A;  3CCJ I;  2EFW A;  1DPU A;  2KRH A;  2HU9 A;  5LRS A;  3HOS A;  2VB6 A;  4C3J J;  2VBZ A;  2BGC A;  1DU0 A;  3GF2 A;  1RR8 C;  1JI8 A;  2JA6 J;  4L18 B;  1QZY A;  3VYU B;  1BBY A;  4DYC A;  2E1N A;  4ZYE A;  2DMP A;  2DDB A;  2MYS A;  3ZMD A;  1G4D A;  3PSI A;  5CQE A;  2XKO A;  9ANT A;  4JX6 A;  3SZT A;  3MAJ A;  1T95 A;  4XM3 A;  3FKI J;  1LKX A;  1V55 H;  4M6V A;  1RZ4 A;  5GTH C;  1N75 A;  2LTP A;  5EG0 A;  4LMY A;  2LY2 A;  4BDY A;  1JJ6 C;  1MZB A;  4HQE A;  2A6E F;  2GIZ A;  2GIV A;  2VJI A;  4B3X A;  2XAJ A;  4IXA A;  4XLP F;  3HRM A;  2M0C A;  2ECC A;  3OWT A;  2ZXW H;  4HPQ A;  3F6V A;  4AIJ A;  2HYG D;  2KIF A;  3ZQG A;  4XNF A;  1SVM A;  3LSP A;  4A3F J;  1FX7 A;  2DMQ A;  4MFD A;  2BYV E;  1X4O A;  4AIK A;  1RES A;  2M4G A;  3CF5 F;  2Z9O A;  1R6R A;  2LH9 A;  3E3V A;  1H89 C;  1QBJ A;  5E1X A;  4F55 A;  3V8L A;  3CUQ B;  5IOY A;  3S1Q J;  1FT9 A;  3S2W A;  5DS9 A;  5IYB J;  4BL0 B;  2YSR A;  1ZAR A;  2NNN A;  1R9T J;  3D1N I;  4JBA A;  2G7H A;  3TW6 A;  2PFB A;  2ZME B;  5DEQ A;  3OL3 A;  3JTH A;  4CZZ A;  3TOA A;  1KYW A;  3ZQ7 A;  4AWX B;  3PM1 A;  2BZT A;  4AUX A;  4E4H A;  3N05 A;  4M73 A;  5F64 A;  2DT7 B;  2H6B A;  5HS7 A;  4BYY A;  4ZDL A;  1K61 A;  4AYB N;  3I3L A;  2QSG X;  3OYG A;  2HI3 A;  2K86 A;  4YIR X;  2DTR A;  2OQG A;  1RRJ A;  4KIS A;  2X85 A;  4YIF A;  2VJ4 A;  2ZJQ F;  2OC6 A;  3HEF A;  4YEL A;  3H3V K;  1Y1V J;  5FRN A;  1Z7U A;  3KZZ A;  3CQZ J;  5M3F J;  4ABZ A;  2HQA A;  4IJA A;  1TW2 A;  2OU2 A;  2VON A;  3I59 B;  3J7A Y;  4U0Y A;  4LG0 A;  4E7K A;  1Q1H A;  1EH6 A;  2HOE A;  2HPM A;  5FLX K;  2FML A;  4BU2 A;  1ENH A;  1PUF B;  3PIP F;  4ETS A;  2ICW G;  2O0Y A;  4MEX F;  1EA3 A;  3RDI A;  3H9G A;  3J7A O;  3HPG A;  1DU6 A;  3A0B C;  2CO5 A;  1MDM B;  1Y56 A;  2M3A A;  2LY1 A;  3QRF F;  1OR7 A;  3K4N A;  3GYH X;  2HYJ A;  4RB0 A;  2WC2 A;  2DFI A;  2UUZ A;  2DFF A;  2A07 F;  2HDD A;  2V9V A;  2KP6 A;  3PNV A;  3FHZ A;  1MNM C;  2IA0 A;  1MBH A;  2LYC A;  2H27 A;  2B0L A;  2EV6 A;  1GVD A;  4GYI A;  3WGH A;  5L3E A;  4MQV A;  3PUB A;  2KIS A;  4B1R A;  5J4V A;  5F27 A;  2EIJ H;  3RQI A;  3GLL A;  4I0A A;  2AXL A;  1ON1 A;  2EA2 A;  3OYJ A;  1MJA A;  2MD5 A;  5HDK A;  2CSO A;  3V7S A;  2Y0M A;  3CLQ A;  2BVL A;  3WGG A;  3Q9S A;  2IA1 A;  2J5O A;  3M8F A;  1GDT A;  2Q2E B;  2YS9 A;  5DD8 A;  1W4M A;  3G71 I;  3GTO J;  3KEO A;  3S3N A;  1BL0 A;  1ZGA A;  5JR3 A;  2F2E A;  1R1T A;  2DXI A;  4NB5 A;  2YX7 A;  4ESB A;  3ECO A;  2LLK A;  2K9M A;  4YFX F;  2QM3 A;  4BHP A;  1S7E A;  4V19 K;  4MFE A;  2R92 J;  3F8B A;  1GV5 A;  5IP6 A;  3S32 A;  3IRR A;  3QPH A;  2RDP A;  5LBQ A;  3S17 J;  3QYF A;  2EFP A;  4E7H A;  5KK1 A;  1PP8 F;  2DFE A;  2HEO A;  1USS A;  5F0H A;  1X1B A;  1WJ5 A;  1XPX A;  2PJR B;  2P4W A;  1K79 A;  2EIN H;  5BMZ A;  2PMZ A;  3DBH B;  4ANJ A;  3ABK H;  1B8I A;  3JW4 A;  4XLH A;  1XMX A;  5D4R A;  3DU6 A;  4MQ9 F;  2LRD A;  2OAZ A;  2CQK A;  2NOG A;  2HXI A;  3OYK A;  3K4K A;  4LIU A;  2GOM A;  5CJ9 A;  2PN6 A;  1K6Y A;  1WH7 A;  4D5C A;  2KRC A;  3GME A;  4L5J A;  4LLN A;  1ETV A;  1J9I A;  3BT9 A;  2EWN A;  3LA7 A;  3FHN A;  3LMM A;  4OMZ A;  3QWL A;  1LDJ A;  5LLQ A;  2B63 J;  2ME0 A;  1ZG5 A;  1IUF A;  2JK3 A;  1LEB A;  2FMY A;  1STZ A;  4BEH A;  2G9W A;  5DUK A;  3WHC A;  4KMF A;  2FNP A;  1SFU A;  5D8L B;  3JTG A;  3K2Z A;  1QA6 A;  1X2M A;  3L9F A;  4JQF A;  3L2Q A;  2NVT J;  2IT0 A;  1B4A A;  2XGX A;  5F0F A;  3VYS B;  4E7L A;  1ZQ3 P;  4C2U A;  5K5R A; 
#chains in the Genus database with same CATH homology
 2FQ4 A;  1VFC A;  1MBG A;  1RKT A;  2K40 A;  2LVS A;  5J1Y A;  1HF0 A;  2DA6 A;  4BBS J;  1A5J A;  2YU9 J;  1GV2 A;  2XGE A;  1X2N A;  4XIC A;  3M4O J;  3W6V A;  1U9N A;  3WHB A;  4BY7 J;  5EZH A;  1IG7 A;  4A3B J;  5EYR A;  2DA4 A;  1IGN A;  3Q0V A;  2XGD A;  3PO3 J;  4W97 A;  4C3H J;  2EZK A;  3K2A A;  2XPV A;  4A3L J;  1W0T A;  2CUE A;  2EZI A;  3SDG A;  4BBR J;  3BG5 A;  4DZJ A;  4FIS A;  1POG A;  4JP0 A;  2IBD A;  2MGQ A;  3QQA A;  4RDU A;  2R5Z B;  3O8G A;  5M3M J;  3OSG A;  1F36 A;  1MH3 A;  1FTT A;  1MSE C;  2JJ7 A;  4AC0 A;  4A3I J;  2PMZ N;  1I3Q J;  2D5V A;  4B4C A;  2K9N A;  2COB A;  3BR5 A;  2W48 A;  2DA7 A;  2E1O A;  3SJM A;  3B6A A;  1OFC X;  2EZH A;  2OPT A;  1ZR4 A;  1XG1 A;  1JKP C;  3MVP A;  3JRG A;  2QF7 A;  2HQ5 A;  2TCT A;  3BR1 A;  5K7F A;  1ITY A;  2VUM J;  1AHD P;  4DZP A;  3TP0 A;  1ORK A;  4FE7 A;  1B72 A;  4M3B A;  1EF4 A;  3GTM J;  1IDY A;  1MBK A;  2EH3 A;  1ETY A;  2CQX A;  3ZQL A;  2HXO A;  1JKO C;  1OCP A;  2MG4 A;  3BQY A;  3CCY A;  2H8R A;  2XB0 X;  1NK2 P;  3BR0 A;  1SFO J;  1FJL A;  1G2H A;  4A3G J;  1U78 A;  1F43 A;  3B6C A;  1MSF C;  2R5Y B;  1GT0 C;  1ETK A;  3JRF A;  1JTX A;  4G12 A;  4L5E A;  1U9O A;  3C2B A;  5EF6 A;  5F0C A;  3HB9 A;  5J1U A;  3BG3 A;  1H8A C;  1T33 A;  2CUF A;  1NK3 P;  3HOU J;  3ZQC A;  3FIW A;  3JRH A;  2DA2 A;  5DTD A;  2CRG A;  2ME6 A;  2M34 A;  2Y30 A;  2IAI A;  1LE8 B;  1JUP A;  5JLW A;  4XRS A;  2LFB A;  3BR3 A;  2DJN A;  5C3E J;  5E3N A;  5E3O A;  1WH5 A;  5EDN A;  3S1M J;  2LY9 A;  5FKO A;  3HOV J;  5J1R A;  3RKQ A;  4QTR A;  1HDP A;  1QVT A;  1WPK A;  4BXX J;  2Y0S N;  3S1N J;  1QRY A;  1MH4 A;  3S15 J;  2DTZ A;  4DYQ A;  3FK7 A;  2R5Y A;  2DA5 A;  2FD5 A;  1YRN B;  3CDL A;  2KDZ A;  4A3M J;  5K7H A;  1AU7 A;  4MLO A;  2Y31 A;  3GTQ J;  1IC8 A;  1JJ8 C;  4LOC A;  3MKL A;  5C4J J;  3QPL A;  4XRS G;  4IHX A;  5GPA A;  4GFB A;  2XRL A;  2NS8 A;  3GTP J;  3M3Y J;  3GTG J;  4B3A A;  4UUS A;  3GTJ J;  3HM5 A;  1NTC A;  2P81 A;  5F08 A;  4Y7N J;  4QSH A;  4I6Z A;  3BR6 A;  1VF9 A;  2DA1 A;  1Z77 A;  1BW5 A;  5K7Z A;  5JLX A;  3S2D J;  1TC3 C;  4CYC A;  1AKH B;  1APL C;  1TWC J;  2LP0 A;  3VPR A;  2JMW A;  4M3E A;  5EZG A;  1P7I A;  3LOC A;  5EEA A;  4J19 A;  1YRN A;  2ID3 A;  2VKE A;  3HOZ J;  2KT0 A;  4IHV A;  1ZK8 A;  5C44 J;  4IEJ A;  2DMN A;  3PO2 J;  2VKV A;  1PUF A;  4HNV A;  1LFU P;  2CU7 A;  3JRB A;  2X6O A;  5EG0 B;  1RPW A;  2JA8 J;  1ETX A;  4MIM A;  3I4M J;  3UKG A;  4EEF G;  1IV6 A;  2L0K A;  3HKZ N;  4A3J J;  2DN0 A;  1QPI A;  5EGO B;  2X9D A;  2L7Z A;  2EZL A;  4JX5 A;  3GBG A;  3TED A;  4X6A J;  5GPC A;  4RBO A;  4DYR A;  1I50 J;  4I76 A;  5FJ8 J;  2R5Z A;  4A93 J;  4FE4 A;  2YUS A;  3BTL A;  2XB5 A;  1WGX A;  2Y9Y A;  2HOS A;  1ZGW A;  1WI3 A;  1OJL A;  1P7J A;  1HLV A;  2K9S A;  3TP3 A;  1MBF A;  4S0H B;  2VPR A;  4D7N A;  1W0U A;  3SFI A;  1HOM A;  5EGO A;  2LK2 A;  5E3L A;  2GLO A;  5M5Y J;  3ZQF A;  4XID A;  2NVQ J;  3RZO J;  1IDZ A;  2L7M P;  1JGG A;  1AKH A;  3HOY J;  1TWH J;  2MW8 A;  3S2H J;  4C3J J;  3OSF A;  2WAQ N;  1Z0X A;  2DMT A;  1DU0 A;  1UG2 A;  1HDD C;  3JRA A;  1BA5 A;  2JA6 J;  3BTC A;  1SAN A;  4DYC A;  3LNQ A;  2N8G A;  2EBI A;  1VND A;  2DMP A;  3OOU A;  3QPS A;  1RKW A;  1JUS A;  1E3O C;  3IH2 A;  4M3F A;  9ANT A;  4JX6 A;  4A3E J;  3FKI J;  4M6V A;  1ZR2 A;  2FJ1 A;  1UHS A;  2LTP A;  2TRT A;  3ZOB A;  5EG0 A;  1JJ6 C;  3JRD A;  2GBY A;  3TW7 A;  3JR9 A;  2LKX A;  2MSY A;  1JKR C;  2L7F P;  2M0C A;  1X58 A;  2ECC A;  1ZKG A;  2H1K A;  5IOZ A;  3BQZ A;  3IH3 A;  5F1J A;  3BG9 A;  2E2J J;  3ZQG A;  5M5W J;  3G1O A;  5M5X J;  2XSD C;  3LSP A;  2DMQ A;  5IP9 J;  1A6I A;  4A3K J;  3G1M A;  4A3F J;  4MFD A;  2O9L A;  4M3D A;  1I6H J;  1RES A;  2Y2Z A;  1ETW A;  1H89 C;  3F0C A;  5IOY A;  3S1Q J;  1K83 J;  1BJZ A;  2Y9Z A;  2RAE A;  3FK6 A;  5DS9 A;  5IYB J;  4D7M A;  2JA5 J;  4Y52 J;  4XRM A;  1R9T J;  1JT0 A;  1O4X A;  1MBE A;  3L1P A;  2VI6 A;  3HGG A;  3D1N I;  3TW6 A;  2XPW A;  3A01 B;  3BR2 A;  3PM1 A;  4AUX A;  2M2E A;  3ZQI A;  1K61 A;  2LR8 A;  3Q0U A;  4AYB N;  1H88 C;  2JWT A;  1HCR A;  3LSJ A;  1Y1W J;  2HI3 A;  1JKQ C;  2ID6 A;  3S16 J;  3HEF A;  3H3V K;  1Y1V J;  2LD5 A;  2R7Z J;  1WCM J;  3CQZ J;  5M3F J;  2ECB A;  4ABZ A;  2EQR A;  2R0Q C;  3GTK J;  4W1U A;  2QCO A;  5J3L A;  3JRC A;  1JUM A;  1BW6 A;  2CJJ A;  1QVU A;  3Q3S A;  3G1L A;  1ENH A;  1PUF B;  4X1E A;  1RET A;  2O7O A;  3Q0W A;  3I4N J;  3MN2 A;  1DU6 A;  2GM4 A;  3ZQH A;  1TWA J;  3JRE A;  1TWF J;  3NAR A;  2XGC A;  4QIW N;  2HYJ A;  4CYC B;  3FIS A;  4MO7 A;  1XC5 A;  5IPA A;  2HDD A;  3HOW J;  1MNM C;  4C3I J;  1MBH A;  1U8B A;  5FKL A;  2HOT A;  4XK4 A;  1GVD A;  1RR7 A;  4NDL A;  2M8G X;  3JRI A;  4B1R A;  5F27 A;  3RQI A;  1OCT C;  4UUS B;  2E2H J;  1IJW C;  2L9R A;  5IYD J;  3IH4 A;  3BTI A;  1GDT A;  2G0E A;  5IP7 J;  4FCY A;  2YS9 A;  2AHQ A;  5C4X J;  2HOA A;  5E3M A;  3GTO J;  3DCF A;  3O8H A;  4M3G A;  1CQT A;  1BL0 A;  1ETO A;  5IYC J;  1B8I B;  3GTL J;  4JYK A;  1FIP A;  1XS9 A;  5FKN A;  2LLK A;  3K7A J;  1TWG J;  3LSG A;  2K9Q A;  2XPU A;  2R93 J;  1D5Y A;  1FTZ A;  5BNG A;  2E2I J;  4V2G A;  5GP9 A;  1S7E A;  1B72 B;  4MFE A;  2R92 J;  4BKX A;  1GV5 A;  5IP6 A;  5F04 A;  1JT6 A;  3BTJ A;  3S17 J;  2M9H A;  3DEW A;  4V2F A;  4A3D J;  2CQQ A;  4IHW A;  1LE8 A;  3LSR A;  5F0H A;  5FLV A;  1LFB A;  3H0G J;  2X48 A;  5FKK A;  3RZD J;  2O8K A;  2FX0 A;  2JN6 A;  1B8I A;  2OF7 A;  4DW6 A;  4D5F A;  4BY1 J;  1Q1V A;  2E19 A;  1FIA A;  2ZB9 A;  2JA7 J;  2NOG A;  2HXI A;  3S1R J;  5FLM J;  1GUU A;  2WB1 N;  4JX4 A;  2ELK A;  1ZTR A;  5FKM A;  3HOX J;  1WH7 A;  2WV1 A;  2AO9 A;  4D5C A;  2NS7 A;  4A69 C;  1ETV A;  3BT9 A;  3NAU A;  3HDD A;  3OIO A;  4A3C J;  2B63 J;  2ME0 A;  2DA3 A;  4FTH A;  1IUF A;  2JK3 A;  4UUT A;  3A01 A;  2IEK A;  1IRZ A;  1T56 A;  3WHC A;  3HGY A;  5HOD A;  2NVY J;  2I10 A;  1X2M A;  1MBJ A;  1UMQ A;  1FEX A;  1ETQ A;  1JTY A;  1VI0 A;  3A02 A;  2DMU A;  3IV5 A;  2NVT J;  3HBL A;  3CMY A;  4C2M J;  4IHY A;  3A03 A;  5F0F A;  3S14 J;  3E7L A;  1ZQ3 P;  2NVX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...