4A3FJ

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3fJ00
2H8RA 4MFDA 2XGDA 1YRNA 2AO9A 1F36A 1MH4A 2HOTA 3S15J 1XS9A 5J1RA 4QSHA 2ECCA 5EYRA 3BR2A 1GVDA 2R7ZJ 2QF7A 5EDNA 2R92J 3MVPA 3HOWJ 3Q0UA 2VI6A 1X2NA 3IH4A 3F0CA 4XRSG 3D1NI 3JRGA 4DW6A 4M3FA 5M3MJ 5FKOA 3QQAA 2HXOA 1A6IA 2DA1A 5FKLA 4DYCA 5FKKA 1QVTA 3BTLA 1I50J 1FIAA 1P7IA 5GPCA 2LR8A 3BR6A 1AKHB 2XPWA 1ITYA 2VUMJ 2RAEA 1LFBA 1U78A 3LSJA 1CQTA 5J1YA 2N8GA 1FIPA 1WH5A 2TCTA 5F0HA 3Q0WA 5EG0A 1GV2A 2XPUA 5JLXA 3GTOJ 3BG5A 1T56A 2JN6A 5M3FJ 1MBGA 1W0TA 3BT9A 1HDDC 2M34A 1UMQA 4A3CJ 3CMYA 2ID6A 1BW5A 1PUFB 1WH7A 3JRAA 4V2FA 3WHCA 2NOGA 1LE8A 5IP9J 2DMNA 1I3QJ 1B72B 1FJLA 1QVUA 2LVSA 2NVQJ 3JRFA 4JX6A 4DZPA 4UUTA 1FTTA 2CRGA 2LKXA 3PM1A 2DA2A 3S16J 4X1EA 2B63J 4W97A 1ETWA 3BR1A 2DA6A 3BG3A 4D7MA 5F1JA 3JRCA 1NK2P 3HOVJ 4D7NA 2DMTA 4M3GA 2R5ZA 2DTZA 1MH3A 3LSPA 4Y52J 1R9TJ 2EH3A 2AHQA 2PMZN 4MIMA 3A02A 3C2BA 5J3LA 2WAQN 3HEFA 4ABZA 2M0CA 2GLOA 3PO3J 1U9OA 2XGCA 4BBRJ 2NS8A 3BTJA 1A5JA 3GTGJ 3BG9A 1YRNB 1HF0A 2XRLA 2E19A 3TP3A 3O8HA 1JKQC 1GDTA 2CUEA 4A3LJ 3FK7A 1B8IA 1DU0A 1VFCA 2VPRA 2NVXJ 2JA7J 2VKVA 2LK2A 1TWFJ 2LY9A 1S7EA 4A69C 4A3FJ 2YU9J 5E3LA 3B6AA 4A3JJ 2R93J 1JUMA 3JRDA 4BY1J 1IDYA 3HOYJ 2XPVA 4CYCA 1RETA 2M8GX 2MSYA 1RKTA 2X48A 4C3JJ 1ETYA 1JTYA 2EZIA 4A3MJ 1IG7A 4L5EA 2G0EA 2JJ7A 5EG0B 5IP7J 3H0GJ 2R5YB 3W6VA 3H3VK 2DMPA 2HI3A 3A01A 1UHSA 4DZJA 4J19A 3S1MJ 4LOCA 2ME6A 4A3GJ 3ZQIA 4V2GA 1Y1WJ 1VF9A 2DA5A 2L7FP 4C3HJ 3I4NJ 4MLOA 1U9NA 3RZOJ 1LE8B 2JWTA 1W0UA 1MBFA 3OSGA 1FTZA 3LNQA 4A93J 4UUSB 2DN0A 5IOZA 2H1KA 1RKWA 2Y2ZA 1NTCA 3RQIA 2E2IJ 2MG4A 5FLVA 3LSGA 2KT0A 2ELKA 3BR5A 5C4XJ 2E2JJ 4BXXJ 3FIWA 4Y7NJ 3BQZA 3O8GA 2FX0A 2LLKA 2LD5A 2IEKA 1MNMC 5F08A 4FCYA 1HOMA 2NVTJ 5F27A 3BR0A 2HOSA 3VPRA 2WV1A 2EQRA 3HOXJ 2O8KA 4AUXA 2K9SA 1SANA 1OFCX 4IEJA 1TWCJ 3RZDJ 3FKIJ 4A3BJ 4C2MJ 2JK3A 3GTLJ 3BR3A 5EZHA 1XC5A 1ZR4A 1B8IB 5EGOA 2L0KA 1BL0A 1XG1A 3HKZN 1MSFC 3DEWA 4IHXA 2L7MP 2VKEA 1E3OC 5E3MA 2Y31A 3LOCA 3MN2A 4MO7A 1APLC 5DS9A 2CU7A 5F0FA 4NDLA 3L1PA 4IHWA 5C3EJ 5M5XJ 2YS9A 3GTMJ 3BTIA 1K61A 3CDLA 3HGYA 2JA5J 1TWGJ 4XIDA 1ORKA 3JR9A 3G1LA 2Y30A 3IH2A 3Q3SA 5C4JJ 4EEFG 1JGGA 3S17J 1JJ8C 3A01B 3HB9A 1ETOA 4B3AA 3LSRA 1OJLA 2DA3A 2L7ZA 4DYQA 4IHVA 2ZB9A 1H89C 3ZQCA 1P7JA 5K7HA 1JKRC 1DU6A 2JMWA 5EEAA 1MBHA 2OPTA 3FISA 4GFBA 5IYCJ 2NVYJ 5IYBJ 2DMQA 2GBYA 3HOZJ 3WHBA 3GTQJ 3G1MA 2DMUA 4A3EJ 1BA5A 3TW7A 4A3KJ 3CCYA 1MSEC 3BQYA 3GTJJ 3S2HJ 1ETVA 5J1UA 3NARA 3TW6A 3OIOA 4RBOA 2E2HJ 1VNDA 1RPWA 5C44J 1PUFA 3IH3A 1IRZA 2E1OA 3HOUJ 1QRYA 1POGA 1RR7A 3HGGA 4XRMA 4A3IJ 1SFOJ 1JJ6C 3TEDA 1B72A 1MBJA 2XGEA 3OSFA 2LP0A 3S14J 4C3IJ 1VI0A 1IJWC 1GV5A 1OCTC 2K40A 5GP9A 3ZQLA 2CQQA 5EF6A 2CJJA 1K83J 1GT0C 5FKNA 2I10A 2W48A 2EZKA 1H88C 1JKPC 3A03A 3HDDA 2JA6J 1RESA 3QPSA 2DJNA 2MW8A 1OCPA 3IV5A 4XICA 2M9HA 1U8BA 2OF7A 2GM4A 1ZKGA 4I6ZA 2HYJA 3PO2J 1Y1VJ 1WGXA 4FISA 1JTXA 2CUFA 2FJ1A 2X9DA 5F04A 3UKGA 1BJZA 1ZK8A 5IOYA 2K9NA 3S1RJ 2Y0SN 5HODA 4BKXA 2QCOA 2R5ZB 1JUPA 3M4OJ 3B6CA 3GBGA 2O7OA 1Z0XA 3JREA 3ZQFA 1AU7A 1UG2A 3SFIA 4AYBN 4W1UA 2JA8J 4IHYA 2R0QC 2DA4A 4BY7J 3SDGA 5IPAA 5IYDJ 2L9RA 2FD5A 2HXIA 4JYKA 4JP0A 5E3NA 5E3OA 1I6HJ 3JRIA 2Y9ZA 1ETXA 2IBDA 2P81A 2FQ4A 1IGNA 4XK4A 1WCMJ 1HCRA 1X58A 5BNGA 3CQZJ 2R5YA 1QPIA 1JT6A 2D5VA 5M5WJ 1F43A 2WB1N 2HOAA 3HM5A 1IV6A 1ETQA 4AC0A 1ETKA 1Q1VA 4CYCB 5IP6A 1AHDP 3S2DJ 2Y9YA 4D5CA 4HNVA 4M3EA 1LFUP 3S1QJ 1TWAJ 1EF4A 1JKOC 1D5YA 3RKQA 2LFBA 4FE7A 1ZQ3P 1ENHA 3E7LA 4RDUA 2IAIA 4UUSA 4A3DJ 2NS7A 4I76A 1IC8A 1IUFA 2HQ5A 1WI3A 2XB5A 3NAUA 1Z77A 3MKLA 2ME0A 3K2AA 3OOUA 4QIWN 5FKMA 1IDZA 1AKHA 1G2HA 3ZOBA 1TWHJ 1H8AC 1HLVA 3M3YJ 3SJMA 3K7AJ 3DCFA 3BTCA 1MBKA 5EZGA 2EZHA 2EBIA 1TC3C 9ANTA 3FK6A 1MBEA 5JLWA 3JRHA 3G1OA 5DTDA 4BBSJ 3QPLA 1BW6A 1ZGWA 2MGQA 1GUUA 1ZR2A 2X6OA 2M2EA 4XRSA 4FTHA 4FE4A 5GPAA 1ZTRA 4G12A 2K9QA 5F0CA 2EZLA 4MFEA 4S0HB 4M3DA 5K7ZA 5FLMJ 1JUSA 3ZQHA 4B1RA 2TRTA 2DA7A 1O4XA 1JT0A 2ID3A 1HDPA 2O9LA 2COBA 4JX4A 1X2MA 1NK3P 5M5YJ 4B4CA 2HDDA 2ECBA 2CQXA 2LTPA 2YUSA 4M6VA 3I4MJ 3ZQGA 4DYRA 5EGOB 5FJ8J 4X6AJ 1T33A 5K7FA 1WPKA 3HBLA 3TP0A 2KDZA 4M3BA 4JX5A 3S1NJ 3GTKJ 2XSDC 3JRBA 3GTPJ 1FEXA 2XB0X 4D5FA 3Q0VA 4QTRA
chains in the Genus database with same CATH superfamily
2LY1A 3CC7I 1F43A 2XGDA 1F36A 2WWYA 4YFKF 3S32A 1QQIA 5EYRA 3J80K 1P4XA 3P9KA 1GVDA 2R7ZJ 3QOPA 5JHUA 4AVZA 2JPBA 3KZZA 2H8WA 4O5VA 4HF2A 4PJNA 1FBUA 2DA1A 5FKLA 4DYCA 4V19K 2V7FA 4CCLA 3ZGKA 2EINH 3K69A 5KNLA 2XPWA 3A2KA 4BE2A 4JOMA 3BC8A 2R7XA 4RLFA 4G8XA 3N4MA 5J1YA 4IZZA 1WH5A 4IPAA 4PZJA 4Y3OA 1EV7A 5EG0A 1FYMA 3ZMVA 3GZNB 1TW2A 5JLXA 5E8GA 3BG5A 4BXFA 5IY5H 2IA0A 2JN6A 3BG7A 5DM7F 1MBGA 5M3FJ 3K4MA 3BT9A 1HDDC 2HWVA 2M34A 3IAM2 4WK8F 1UMQA 4BU2A 2ID6A 1RZ4A 3FMRA 1VZ0A 2EV5A 5D4SA 3JRAA 1AA7A 2F5VA 2QBYA 1QVUA 3VWBA 2PEXA 3P9IA 2VC1A 4UUTA 1FTTA 1U5TB 1P92A 4MEYF 2R7WA 3RPUA 2DA2A 4N4OB 1X4PA 4F91B 5EJCA 3OYLA 2B63J 3D5LA 2CSOA 2HTJA 3BR1A 3FDYA 3HSRA 3BG3A 4D7MA 4FX4A 3IKTA 3PJRA 5TGTA 1ZGJA 5D5VB 2EH3A 5J4YA 5FRNA 3A02A 3C2BA 2BY2A 4LGWA 1VQ7I 2GLOA 2XGCA 3DPLC 4BBRJ 3LMMA 1A5JA 3MQ0A 1H9GA 3Q9VA 3HPHA 3HTUA 1SVMA 2GA1A 3BCBA 3OYGA 1BI3A 4ENNA 2M45A 3RPUD 3VYUB 3FHNA 3IL2A 1DU0A 2MC3A 3LSIA 3G2BA 1VFCA 3K4NA 3FKJA 4LMYA 2NVXJ 1ON2A 2DLLA 2ZC2A 2VKVA 2QKLB 3KETA 2RN7A 1S7EA 3CF5F 3QU3A 1IN6A 1W36D 2JT1A 4A69C 4A3FJ 2YU9J 1R58A 3WU0A 1HSJA 4A12A 1O7FA 4LLGF 1K78B 1YJWI 4BY1J 1YW8A 2H1LA 2XPVA 2I5UA 4CYCA 2MH9A 3EYIA 2IS1A 2X48A 1XMKA 1JTYA 5IT9K 4LG0A 1R1TA 2E35A 2XSJC 2OTJI 2JJ7A 1YJ9I 4HYEA 1LQ1A 2LSOA 3UNGC 3A01A 1X4OA 3J7AY 2K7LA 5FRMA 1UCRA 4B8XA 1KU3A 1OCRH 4B43A 2L7FP 3I4NJ 1U9NA 2JVGA 2K4BA 1ULYA 3GF2A 4IVNA 2QZ8A 4A93J 2IS6A 2KLOA 2DN0A 3BZKA 1RKWA 1JXSA 4E70A 4XOTA 3C2HA 4G6TB 1MDMA 1FNNA 2E2IJ 2MG4A 5D5UB 1LB2A 3S2WA 4HQMA 4UXNA 5HOOA 2DTRA 2L4AA 4PJ0C 3TDUC 3BDDA 4Q47A 1LNWA 1Y0UA 1K79A 1HQCA 3DBRB 2B7EA 2LLKA 4H4KC 1GVJA 2HDWA 2EK5A 5F08A 3HPGA 1R49A 4LB6B 3JW4A 3CCQI 5L3BA 3MMYB 3DTKA 2LYCA 3CCRI 1KYZA 4G6QA 4AUXA 2M87A 1TWCJ 2VONA 1B6AA 5L3EA 1YX5A 1T8IA 3CLOA 3F8FA 1WJAA 2WY8Q 1XC5A 2QQBA 4HNUA 1FC3A 1YW9A 1BL0A 2A6EF 2O61A 4XOPA 2VC0A 3J7ZI 5DCFA 2P6SA 2L7MP 2O6GE 4F52A 5ICEA 2HPMA 3VB2A 2Y31A 1XN7A 2XDVA 3RYRA 3K70D 2R7FA 4XM3A 3KEQA 5CLSA 1QU3A 5L3FA 3AL0C 1DPRA 1BJAA 3FF5A 5DCMB 2ZO4A 5BS6A 1FX7A 2FBHA 3CDLA 2X51A 3DPUA 4XONA 3BCAA 3ONQA 3BWGA 3Q3SA 5C4JJ 4EEFG 4BQAA 2CMPA 2MD0A 2F48A 1JGGA 3S17J 2GZWA 5L3CA 2BY3A 3ERED 2V1XA 3HB9A 1B59A 1G3YA 1T08B 5LGTA 4DYQA 4IHVA 4PGGA 4R79A 3OYHA 1H89C 3GFJA 2WBMA 2KPMA 3WU2C 3W2AA 4RGXA 1JKRC 4I2OA 4E7LA 1WJCA 4N4NB 4F7ZA 2MLKA 2X6WA 3UR3C 3GFMA 1XDSA 1D0XA 1IW7F 3IKVA 5DUIA 2GQQA 3V42A 2OCEA 2QWWA 4I7HA 4A2UA 2BGCA 2EV6A 4EJTA 4G7OF 1Z7LA 2XF5A 4OU0A 4IL6C 3ZR8X 3OL3A 3QP5A 2FA5A 2ZFUA 2JRMA 1MSEC 2FXAA 4XN0A 4A6EA 2Z33A 3WE3A 1U6GA 3GTJJ 3S2HJ 1ETVA 2M4KA 1O7LA 4Y4RA 1KZHA 2XAFA 3TW6A 3OIOA 1ODDA 1BN5A 1SAUA 3TO9A 2GOMA 1PUFA 3EQLF 3U21A 2E1OA 1EJ9A 5FD5A 2VBWA 1TT5B 4A3IJ 3E3VA 4XRMA 3OS0A 4EGYA 1SD5A 1NH3A 1B72A 3GCMA 2XIGA 2KRCA 3TOBA 1SD7A 1VI0A 4C3IJ 1MMSA 1OCTC 1R23A 3ZQLA 2CQQA 4WXCA 3KZYA 1TBXA 1E2XA 2HGCA 1SMYF 3GXOA 3RKWA 2EZKA 3M1EA 2A5WA 1VQOI 3V8KA 2QBYB 3KEOA 2M9HA 1Y39A 1MW7A 4WCGA 2GM4A 5J40A 2E71A 2ZJ2A 3PO2J 1Y1VJ 2XF6A 3A4CA 4A5MA 1WGXA 3M07A 3K1NA 3MAJA 3RIRA 4L9JA 4CYDA 4FISA 2QM3A 4UVBA 3AAFA 3E5XA 4HV6A 4GGGA 4E7JA 3SDBA 3S1RJ 4A0YA 2H09A 1SC7A 5HODA 3H3ZA 3U1KA 1Y8QB 4BKXA 2M1BA 1LUJB 3CJTB 3GFLA 3M4OJ 2GOXB 3GBGA 2PJRB 5JHFA 5ERIA 2KMUA 1DP3A 4LG3A 3ZQFA 2VOOA 1UG2A 3SFIA 4HLXA 4W1UA 2YSRA 4WXDA 4B3XA 3HSFA 1VQLI 3W6KB 2QSGX 4I09A 2FU4A 1O57A 4XRFA 3SDGA 5IPAA 2GXAA 2HXIA 4JYKA 3OMYA 4CCMA 5E3OA 4A0XA 1USTA 3GZ5A 2B9SA 4KFCA 2DDBA 2IBDA 2X85A 5TRDA 3H35A 3JAMK 1HCRA 2E5NA 2STWA 1X58A 3E6DA 2E1MC 2A68F 2EV0A 2R5YA 2Z5UA 1QPIA 1OR7A 3HM5A 1ONVA 2R7OA 3LL7A 2STTA 2R7QA 2EFWA 2E7XA 1ETKA 1EH8A 1Z3XA 2NS0A 4E6KG 2QQ8A 1XSXA 2V9KA 5DUKA 4CYCB 1IN7A 3OL4A 3S2DJ 4S04A 4HNVA 4UV8A 4LG0B 4KIGA 1TWAJ 4C2TA 3IP4B 1D5YA 3FHZA 4Q4ZF 3HXLA 2XC7A 4I99C 4XLCA 3PQKA 1ENHA 1ZQ3P 2X0LA 2LKPA 1OR7C 1RUOA 1YS7A 3J81Z 2EPFA 4BQNA 1XX5A 1QZEA 1H9TA 2XB5A 2EFNA 3MKLA 2ME0A 1IDZA 4IO9F 4O6JA 3M3YJ 1V54H 4PSWA 3OYEA 4U7DA 2VBZA 1SFEA 2EIKH 2NYXA 4E7HA 1OKRA 2EZHA 2EBIA 3SHFA 2EFOA 4M73A 1NG6A 1FZPB 2PQ8A 3G1OA 1IRXA 4MQ9F 3DEEA 5L3GA 3G71I 2BW3A 4GO1A 3WGHA 3ASOH 2MGQA 1GUUA 4RAFA 2DYSH 2DFHA 2RDPA 2QEXI 3W2VA 5E79C 4ANJA 5FGMA 4HDUA 2KZGA 5GPAA 2HS5A 1DGRM 1F1ZA 2EZLA 1IXRC 4OAZA 5K7ZA 1T38A 4B1RA 2Z99A 3KLOA 3TKYA 4MTEA 2XAJA 2LY2A 2LRDA 5CVUA 3H5RA 3V7CA 2LNBA 4LIUA 2IA1A 4P1WA 3AL0B 2NNYA 2HDDA 3BOQA 3BJAA 4CH7A 5BQTA 1SFXA 4M6VA 3I4MJ 3WTVC 5FJ8J 4RS8A 4X6AJ 1WPKA 4YFXF 3K2ZA 4BEHA 2BVMA 3HBLA 3TP0A 4EJWA 4BDYA 1RIOH 1WWXA 1ERDA 3ZMDA 1LDKB 2IT0A 2XB0X 4KMUX 3F8NA 1D3YA 4KN7X 2PLYA 3W3CA 5B5EC 4AM3A 2KQRA 2ESHA 3QRFF 5LBQA 4HEA2 3LQRA 4HF1A 5J1RA 3AG1H 4XKWA 4RAYA 4YRVA 3MVPA 3Q0UA 2OC6A 1VQKI 1G6NA 3IH4A 5LEJA 2PX9A 4DW6A 2HVSA 2RQQA 4IF4A 5HNFA 5FKOA 4XKBA 4CDGA 2LC2A 2DI3A 2WADA 4J01A 2DT7B 4Y13A 2XAHA 2VE8A 2K3PA 4PK4A 3DXJF 1ZAOA 1WKMA 4KJZA 3BTLA 1I50J 5E1WA 1FIAA 1K78A 2PMUA 1J9IA 1WJBA 4MGRA 1K7AA 1BBYA 1XGNA 1ITYA 1R1UA 3SEZA 1LFBA 1U78A 2EWNA 3LSJA 3DWLE 2IW5A 3IWZA 2TCTA 3O2PE 3Q0WA 1S9HA 4QWQA 1HA8A 4ZYAA 4WWCA 2HVRA 2XPUA 2DK8A 2R7DA 4L0YB 3KX2A 4WXHA 3LSHA 2HTSA 3G73A 4Z2YA 1S7AA 2ETHA 3BJ6A 3OY9A 4XL9A 2F6CA 1HW5A 2B0LA 4A3CJ 5D5WB 2LBFB 1H0MA 3CMYA 1BW5A 4WX9A 2AXLA 3V4GA 1OYIA 3KYLA 3K9TA 3K4BA 1PUFB 1WH7A 2Y0MA 1N75A 2NOGA 3SZGA 1I3QJ 1J2XA 1B72B 1PDNC 1X3UA 2V1NA 5LLQA 1FJLA 4OOIA 2NVQJ 1S72I 3LFKA 3F9KA 1L0OC 2L7KA 4JX6A 2NNNA 2LKXA 1XTAA 4EJOA 1B9MA 1YIJI 1WJ5A 1PP8F 3QODA 2CQ7A 3CO7C 3ZMZA 3CJRB 3KIOA 4IX7A 2DA6A 1EH6A 2WA0A 2R5ZA 1IRGA 2ESNA 1A04A 4EJUA 1MH3A 2VOPA 2ZBKA 4Y52J 2RREA 2AHQA 4MIMA 5J3LA 2M0CA 4XQFA 2DU9A 2OCCH 4CXFA 2NS8A 4XN3A 3HC7A 4HRIA 1PP7U 5JVTA 1T0FA 1YRNB 1S29A 4RGUA 3R4KA 4U0YA 2KRFA 4E7SA 2BY0A 2J5PA 3F8CA 1YX3A 1FBSA 2UXXA 3R60A 3FK7A 4CICA 4FX0A 4EJVA 3WTSC 2E1MB 3CCLI 2JA7J 4XLAA 1ZELA 1Y8RB 1TWFJ 3NEUA 4XKCA 3EDPA 1BI2A 2TDXA 4PFPA 4P9UA 1JUMA 4JQFA 4P55A 1T0FC 3M9AA 3MD2A 3VYTB 1IDYA 2DODA 2MSYA 5DCMA 5H6QA 3KP3A 1ETYA 1YQAA 3CP8A 4I0BA 2Q8KA 1W4MA 1K6YA 2ZKZA 1OLTA 4A3MJ 1IG7A 4L5EA 2R5YB 2H6CA 3H0GJ 3H3VK 2DMPA 3PNTA 2UXNA 2DO7A 3KFWX 2HYFA 3GLXA 2BEOA 4DZJA 2VODA 2P0WA 3S1MJ 2PBIA 4BE1A 2K5CA 2R7RA 2V9VA 2W00A 4CCNA 3ZQIA 2COMA 3I3LA 4DNCA 2VJ4A 3FZVA 2R4GA 1T2KA 3BROA 1BM9A 1TNSA 4PJJA 4MLOA 4MEXF 5D5XB 2X1DA 3R0AA 1W0UA 2P5VA 3MKZA 1PUEE 3C7JA 2QKMB 3OSGA 1YI2I 3RKXA 3LNQA 1OYYA 2W4SA 2FNAA 5K5OA 2AQFA 3ECOA 2H1KA 2RNJA 3LWFA 2ZJQF 3RQIA 3L2UA 2DAOA 2VJJA 4B47A 2HQRA 2GIVA 2F2EA 3LSGA 1MMDA 2KT0A 1IXCA 4P5OA 5C4XJ 4L9VA 3ZQQA 3K4JA 2E2JJ 2W25A 4BXXJ 2BYVE 3BQZA 3O8GA 1R5HA 2IVMA 4F55A 1MNMC 1D5VA 2MH2A 1IZ1A 1HOMA 2GIZA 5F27A 1MGTA 3BR0A 5HS7A 1J59A 3VPRA 2ZXWH 2WC2A 5D4RA 3HOXJ 2A5YB 2K9SA 2LKSA 3MKWB 2BW3B 3FKIJ 4HAMA 3IWFA 1WHUA 2FRHA 1ZLJA 2BE5F 2JK3A 3BR3A 5EZHA 4E7KA 5BOXA 3OOPA 1ZR4A 1TTYA 4AIJA 3QPTA 1I1SA 2GAUA 4D1QA 1BR1A 4IHXA 3DEWA 2V4JC 3FWEA 4CCOA 2VKEA 3QYFA 5KK1A 1E3OC 3LFUA 3LOCA 4MO7A 3HRSA 2P5LC 3HJEA 4XLPF 3ROUA 4AD9A 4MNUA 1QNTA 4HPQA 5C3EJ 1GXQA 2VBYA 3PIPF 2QLZA 3GMEA 2DQRA 1D8JA 1QGPA 4KIFA 4BEHB 4BE0A 3KYCB 3G1LA 2JPCA 4LK0F 5E8IA 3P7NA 1R71A 1BC8C 2PJRA 2K86A 1G3SA 1R22A 3LSRA 1OJLA 2GXGA 2QA4I 3RJPA 2HZDA 2IGKA 2ZB9A 4UNOA 1ZH5A 4II3A 2K4JA 5ILSA 3ZQCA 4FT8A 4IHTA 4HF0A 3E6CC 1FLIA 2O0YA 4IXAA 2JMWA 3N97A 2HNHA 3KEYA 2ZCWA 3TL4X 4L5IA 2V79A 5E17F 3CCMI 1S5LC 5IYBJ 4UUVA 2WTEA 4BGDA 4N9HA 4ESJA 1YFHA 1DGWY 1O3QA 3MZ8A 4DBRA 2D1HA 3R61A 6PAXA 4OIPF 3G1MA 4A3EJ 4OMYA 5GAHJ 2WAQA 3NQOA 4PGHA 3NWSA 4PSXA 3CDHA 3I56I 3BP8A 2LMDA 5J1UA 2RV8A 4XLHA 3D5SC 3NARA 2VKDA 3G4SI 2E60A 1DPUA 1VNDA 1RPWA 1ZYRF 1X1PA 2W24A 1KQ8A 3L9FA 3HRUA 3S14J 2Q0OA 1GV5A 3F23A 2K40A 2VJ5A 4YEJA 5EF6A 1D0YA 1K83J 3I58A 2F4OB 2I10A 3T8RA 1WZ2A 3AG2H 2XAGA 3QWLA 4HBLA 3OIQA 5B1BH 1WSUA 2W48A 2PI0A 3HDDA 2JA6J 1OCCH 3W2WA 3KP5A 1HKSA 5J4VA 1JHHA 1N25A 1X1CA 2MW8A 3IV5A 4HX8A 1U8BA 2OQGA 1ZKGA 2M3AA 2FEZA 3S3OA 3D5RC 3C1DA 3CCVI 2CUFA 3C3WA 5LGUA 3ULQB 3JTHA 1CF7A 3UKGA 2W1OA 4RLQA 2QUFA 3CJNA 5IOYA 4CSWA 1UHWA 5CVJA 2R5ZB 3B6CA 3IRQA 2W7NA 2Z16A 2ZJPF 3R0JA 3ZXSA 4CO8A 1E3PA 5D6FA 1ZGAA 1AU7A 2IS4A 3HG9A 4IRHA 2JA8J 3PFIA 4IHYA 2W85A 3KYDB 4CCJA 2DA4A 4BY7J 1IXSB 3OV8A 1S7OA 4Q5SF 2JSCA 5CQEA 2FD5A 1FY7A 3GZ6A 3CLQA 4HA8A 1D8KA 1SFKA 1ZN2A 2MA3A 1I6HJ 2M7AA 1TQIA 1J7KA 1IO2A 5TJJA 1ETXA 1IGNA 4XK4A 4L9NA 4KT5C 1GLNA 3WU1B 2LREA 1B4AA 2NOJB 2VXZA 1YIOA 1UG0A 1JT6A 1Z67A 1YLFA 5LRRA 3KP6A 1ETQA 5E18F 1RC9A 1HXDA 3I59B 1Q1VA 3TDZC 1KU7A 3FXUA 5IP6A 4KITB 4D5CA 2UV1A 2EA2A 3DU6A 4UY8I 1LFUP 4HDVA 2P7CB 1CGPA 1TT0A 3RKQA 3DFGA 3LAPA 4FE7A 4EQQA 2ZXJA 3DKWA 3F21A 1YG2A 1MJ9A 4UUSA 3SZTA 4A3DJ 2NS7A 4BHPA 4PDKA 5ICGA 2OUMA 3P9CA 4AIKA 4XORA 1R1VA 2HQ5A 2XVCA 4PCQA 5HDKA 5JVGF 3MZHA 1WI3A 3NAUA 5LHHA 3DTIA 2L9VA 1IN5A 2KIFA 2KIMA 5J6XA 2BBYA 1G2HA 3ZOBA 1TWHJ 5HDGA 1H8AC 3K7AJ 3DCFA 3CUQA 1C0WA 5DD4A 2H27A 3KP7A 4RGSA 1FSHA 1T98A 4ENMA 2UUZA 1FBQA 3JRHA 3QPLA 2K27A 2QQ9A 4CZCA 5ICCA 1KQ9A 1FSEA 2M2EA 2LBFA 3DEUA 4HQEA 4XRSA 1PJRA 2H6BA 2L54A 3OWTA 4BJTA 2DDAA 3BY6A 4G12A 1XDUA 4R1HA 4MFEA 5E20A 5F0CA 4S0HB 4M3DA 1PYVA 3CUQC 3EUKL 1JUSA 3KPHA 2R7UA 3D0SA 1Z21A 2ZJRF 3PNVA 1O4XA 1HDPA 4ZZLA 3DQVC 3JSPA 4JX4A 1X2MA 1XGOA 3KCCA 2CQXA 4XSXF 3ZMSA 2AS5F 3F6OA 2BHYA 1RI7A 1MNEA 3OYNA 4PUSA 2E7WA 3ABUA 3J81K 1J5YA 2XUBA 1FEXA 4OIOF 3SFZA 3Q0VA 4HSTA 1VQPI 2DOAA 2KL4A 2JZYA 4MFDA 1YRNA 4U7BA 4QSHA 1GXPA 2ECCA 3BR2A 5EDNA 4AVPA 3OYBA 1FOYA 2LG4A 3HOWJ 2VPLA 2VI6A 3RTRA 1X2NA 3ECHA 3D1NI 4ZYEA 4C30A 1VQ4I 3JRGA 5FROA 4M3FA 3E5QA 3QP6A 2X1EA 1J75A 1Z7UA 4L0ZB 2DYRH 1A6IA 1J0RA 1TL8A 4M9XA 3OYAA 1WJDA 4IJAA 5FKKA 1SVLA 2L01A 5GPCA 1O3RA 3CC2I 3BR6A 4G94A 3QYEA 1BR2A 2ZXIA 3COAC 2KZVA 2CW7A 1O3TA 1OISA 5BPIA 5LFAA 3L2VA 1BI0A 4KA4A 1G59A 1FIPA 2Q2EB 5F0HA 1GV2A 1R5ID 4ITVA 4E4HA 2EB7A 4BAYA 3OYIA 5JI6A 1ZRCA 2O03A 5HS8A 3GTOJ 2VT2A 4LITA 1G3WA 1T56A 1W0TA 4CUGA 1QHGA 2DFFA 5AIQA 2IRFG 1VQ6I 1BIAA 1HBXG 3PUBA 2MFZA 1W1WE 2CH0A 4ZYDA 4GDFA 1JGSA 2M30A 4B48A 4PFOA 5DEQA 3L2CA 2FOWA 3WHCA 5IP9J 5CJ9A 3HKZA 2Z1DA 3JRFA 5IT3A 1MD0A 3K4KA 5ILVA 5FO5A 2XRNA 2V9PA 4BH9A 2DPDA 3PM1A 2ZFWA 4Y17A 1S8NA 3PFYA 3ZPLA 3DKXA 3CCUI 5F1JA 5TISC 1NK2P 4D7NA 2DMTA 4M3GA 4S05A 3I0TA 1HKTA 3ABLH 3LSPA 1NHAA 1R9TJ 3HEFA 4D0PA 1U9OA 2F5CA 3BTJA 4RB2C 1G8XA 2RGVA 3F6VA 1XMXA 1MMGA 1CF7B 3GTGJ 3BG9A 4HV5A 2EA4A 1HF0A 2E19A 4M6YA 1P4AA 2EIMH 3PQJA 4KYWA 3O8HA 1JE8A 1JKQC 3BPVA 3C2GA 2CUZA 3HIFA 1U3EM 1W5SA 3H9GA 2MD5A 2K9LA 1X19A 2L4MA 4E7IA 4LK1F 2CQNA 2LK2A 2D2WA 2LY9A 3S15J 3WG9A 2IA2A 2AQEA 2EILH 1MMNA 1FP1D 1OQYA 3B6AA 3CCJI 4O3MA 1WVRA 5CVRA 4ESBA 4KISA 2BXYA 1TQMA 3I71A 3WTUC 2A6TA 1TQPA 2M8GX 2DCEA 4U0VA 4P9FA 1KGSA 2ZNZA 3VSLA 1QHHD 4J00A 3GO5A 2A3SA 4GXOA 4QPQA 2PG4A 2CS3A 1IRFA 1T95A 3RI4A 3RKYA 1UHSA 2IJLA 2UWMA 1FMVA 2CFXA 4J19A 3ABKH 5D8KB 3LSMA 3O3KA 4LOCA 3FMQA 2ME6A 1O3SA 1USSA 1N77A 3CUOA 2ZSIB 1UB9A 3E6BA 4XBFA 3K6GA 1Y1WJ 3FMSA 1DDNA 3HTSB 5H6RA 3M8FA 1EA3A 3CMEI 1MIJA 1LE8B 2JWTA 4HLYA 1MBFA 2BOLA 3H3UA 3LA3A 4UUSB 2V6CA 5IOZA 1FOKA 3T1BA 2KIQA 2VQCA 1X1BA 4Q48A 1Q1HA 1V55H 4BL0B 2WAEA 2ELKA 2MC4A 3H9QA 2ZSHB 3M8JA 2Y0SA 3FIWA 1A35A 3CUQB 2LD5A 2IEKA 1SMTA 2M8EA 4OIRF 2KIUA 2ACJA 4ETSA 4M9SA 2HOSA 1YO5C 3E97A 2EQRA 1LVAA 4UVCA 3PIOF 1YW7A 1SANA 4IEJA 3HOSA 3RZDJ 2KFDA 4DOZA 1SD6A 1Z05A 2CQKA 3ZMTA 2E36A 1B8IB 3LSKA 4Y33A 3RSNA 1XG1A 1UJ8A 3HKZN 5K5RA 5AIPA 3F72A 3A0BC 1MSFC 2Z9OA 4KMFA 1XMAA 1IAWA 2DT5A 4MHGA 4ZTFA 1QZYA 4PJMA 3MN2A 1YE9A 1APLC 5ICFA 5F0FA 4NDLA 4IHWA 2EFPA 1G4DA 2M0MA 5M5XJ 1V3FA 5AONA 3BTIA 1K61A 1R6RA 4IKFA 3HGYA 2JA5J 3EYYA 1A31A 1ORKA 1Y6IA 3LA2A 3JR9A 2Y30A 3IH2A 2YR2A 1ZLKA 4KT6A 1XGSA 1Z6TA 3VOEA 2G7UA 1ETOA 3LQQA 1AOYA 3ESWB 2CV0A 3CC4I 3L7WA 4KNYA 1P7JA 5B66C 5K7HA 3HRMA 2OZ6A 2PN6A 1SVOA 1MBHA 2V1UA 2OPTA 3VFZA 1I5ZA 3K0LA 5IYCJ 1ZRDA 1ACIA 3E0JB 2HDCA 3GLLA 5GTIC 3DP7A 2DMQA 1IN4A 3HOZJ 1FOXA 3GTQJ 2MABA 1D0ZA 2XF7A 4LFUA 2DMUA 4YIRX 4A3KJ 5E1XA 4YIIA 4JK1X 2HEOA 1B1BA 3I59A 1X1AA 4Y15A 3H36A 4HW0A 3MWMA 1E17A 3CO6C 1I39A 5CVIA 2K3FA 1KU2A 3C18A 3O6BB 4XLEA 1VTNC 3EUHA 2ICWG 5C44J 3IH3A 1IRZA 2IPQX 3HOUJ 2I8DA 3A0HC 5J8CA 4M72A 3M8EA 1RR7A 4NNJA 1SFOJ 1JJ6C 1ZREA 3TEDA 3ELKA 2XGEA 3CCEI 3RQ4A 1IJWC 2F4IA 3OYKA 5J8FA 3OYDA 3W6JB 3OIPA 1PVEA 2XHKA 4LLNA 1P2FA 1YYVA 2HQNA 5L3DA 1LEAA 5FKNA 2DBBA 3SZPA 1H88C 3EUHC 2IXSA 1JKPC 3BZCA 1UZCA 2XAUA 3A03A 4KUMA 3SXYA 4B44A 4QLCU 3QPSA 5A2QZ 2KJCA 1OCPA 3GUDA 4BJ6C 4XICA 2OU2A 1Y0NA 2O8XA 1R7JA 2OZUA 2JUCA 4XLFA 2ZNYA 3CP2A 5FB2A 4NUBA 1JTXA 1OYWA 2VN2A 1SFUA 1BJZA 1ZK8A 3ISPA 5CVVA 3EUAA 2FE3A 2Y0SN 1MJAA 2PJPA 4FASD 4H0EA 1DQUA 2R3SA 3FBIB 3HSEA 3DKYA 2O7OA 4UHTA 3I64A 1LEBA 3Q9SA 2W82A 3KP4A 2CGPA 2EFQA 4BUPA 2VXDA 3DTEA 2ZXHA 2R0QC 1DP7P 1IF1A 2K9MA 2VQGA 1J09A 5D6EA 2JTVA 3GFIA 1TP4A 3K1PA 3FBNB 3ML6A 3QOEA 4JP0A 4FETA 2EIJH 4HOBA 1EKEA 1WQ2A 5KVRA 3R6SA 3JRIA 2Y9ZA 2QSHX 1S6LA 3ZQ7A 4LIVA 1FP2A 5FFXA 3OYMA 4C9YA 4EM1A 2D5VA 5M5WJ 5FLXZ 2BZTA 1BOBA 5HLHA 2HOAA 1D1AA 2XKOA 4AC0A 3LSTA 2F5FA 4EM0B 4II2A 3GWZA 1P6RA 2YX7A 2Y9YA 3NWTA 4ENJA 1QA6A 1RR8C 3FM3A 2CV1A 2CW8A 3MEXA 4NC6A 2HPIA 4DJAA 4AU7A 2P5KA 4EM2A 3E7LA 3WE2A 4K2EA 3ZMUA 4R8HA 3WTZA 4I76A 1IC8A 2ADUA 1ZRFA 4N9IA 3JCUC 1A36A 3GW2A 1FPQA 3E1SA 1Z77A 3OOUA 1D1CA 3K2AA 3RPQA 4G7HF 3DV8A 3M7GA 1FYKA 2PFBA 5CKTA 3PUFA 4BQQA 3J80Z 3LA7A 2Y75A 5EZGA 1G3TA 3IC7A 1OPCA 3QU6A 2Q2EA 1TC3C 4UB6C 9ANTA 2CWEA 2QGUA 3VDXA 3FK6A 1MBEA 5JLWA 2PMZA 4A0ZA 2DPUA 4HZFA 1XSVA 5DTDA 1FWZA 4BBSJ 3V8JA 2Y69H 4U0WA 4XR6A 3DU5A 3U2RA 4UVAA 4BJ5C 3PL8A 3S93A 4DBQA 2JSPA 1W7PB 3DLAA 3BZ6A 3DBHB 4FTHA 5HDNA 4FE4A 1ZTRA 2K9QA 4RB3C 2KHMA 4KN4X 3X2QH 1W36C 2X6YA 4M9ZA 1S3JA 3ZQHA 4LJZF 3ZP5A 2OV7A 3F22A 2FMLA 4UV9A 4HX4A 1XSDA 1JT0A 4XMYA 3H0DA 2HFHA 4RB0A 4F93B 1VQ9I 2VB6A 4EMSA 2E1CA 2O9LA 1VQNI 2E34A 4B4CA 5ED4A 2LTPA 1V4RA 2YUSA 5J47A 2FUG2 2DOEA 1VQ5I 3MZYA 4OIQF 1T33A 1X1DA 4KDPA 2VQHA 1KONA 2OJED 4JX5A 5DD8A 3S1NJ 1TLHB 3JRBA 1F5TA 3GTPJ 2J5OA 1HKQA 3HOTA 3KZIC 1UFMA 4FQGA 4NC8A 2XGXA 3CJQB 5F6FA 4BNCA 2R7TA 2EJRA 1V5FA 3HUGB 2H8RA 1YS6A 1WFXA 5DDGA 4YFNF 3KP2A 2HOTA 2AO9A 3U9GA 1MH4A 2FMYA 5DM6F 3Q5FA 2QQAA 5KCMA 1XS9A 4DQ2A 2OAZA 2QF7A 1T6SA 2R92J 5GAGJ 4ON0A 2NVUB 3S3NA 3KE2A 3F0CA 4XRSG 2F5EA 1K4TA 2BV6A 4AIHA 1P4WA 2JA2A 5KHDA 5M3MJ 3QQAA 2HXOA 3IUOA 1KYWA 3V7SA 2FSWA 3J7AO 3L09A 4GYGA 2OBPA 3U1DA 1BOAA 3OS2A 1QVTA 4D9JA 2UZKA 2FNPA 1P7IA 2VL8A 2LR8A 1IN8A 1R00A 1AKHB 2MYSA 3H1CA 3A1YA 2HZTA 1KU9A 3WTYC 3JTGA 2VUMJ 2RAEA 2V1DA 4FHTA 3E6MA 3ASNH 2XASA 1ZG3A 1CQTA 2BHZA 3SEQA 2WAFA 2N8GA 2OTLI 4OMZA 1QZZA 5FD6A 2VLAA 3FXMA 2LDUA 4HSRA 3L2QA 3RCOA 5KAFC 5CPRB 1YOVB 2RKHA 4YIFA 1I1GA 2CV2A 3ABTA 2NAZA 4EVIA 4IQJA 1LDDA 4RM3A 3CTAA 2JQ7A 3TOAA 2E1NA 2CFOA 4L9TA 4V2FA 1LE8A 3FXJA 1XCVA 2DMNA 2O3FA 3K70C 5IT9Z 3J7YJ 2LVSA 2M4GA 4G7ZF 4NHJA 1KA8A 3HZJA 2P8TA 2QSFX 2JRTA 4DZPA 4NBQA 5HLTA 2CRGA 3BLYA 3MCZA 3SYTA 1FT9A 2VE9A 4RM2A 2P7VB 3S16J 3GEZA 5F1RA 3GX4X 4X1EA 4W97A 2CYYA 1ETWA 5HS9A 3OS1A 4CHUA 3CMAI 3JRCA 3HOVJ 3EETA 3VYRB 3VEPA 4DGWB 5GAEJ 2DTZA 4HNTA 1XPXA 4LLLA 2O5RA 2PMZN 3WGIA 1V5EA 2WAQN 4XSZF 1U8RA 3BJOA 3ZN1A 3H9JA 4ABZA 3REOA 5JFRA 3PO3J 3ABMH 4ZZDA 2X4HA 1F9NA 2BVLA 2XRLA 4NQWA 5JR3A 3TP3A 2HU9A 4BDZA 2LH9A 2ELHA 2L02A 1GDTA 2DK5A 2L9SA 1MMAA 1Z91A 2CUEA 3L00A 3OR2C 1JI8A 3PSIA 4MTDA 4A3LJ 2R7VA 1B8IA 3ZN0A 2VPRA 1M1EB 2CW0F 2IP2A 1SEUA 4BACA 1R4NB 2GA2A 2E5ZA 4Z6YA 2MLGA 5HLIA 5E3LA 3TO7A 4A3JJ 2R93J 3BPXA 3JRDA 3FXOA 1K6OA 3B02A 2D1VA 2P6TA 3HOYJ 2F5DA 1RETA 4RMNA 4C2UA 1RKTA 5EEGA 4C3JJ 2F4MB 1LFPA 2EZIA 4XNFA 4I02A 2G0EA 2QENA 3I53A 4PJLA 1I6XA 5E1ZB 3L2RA 2KRHA 5EG0B 5IP7J 3W6VA 2HI3A 1KQ0A 1MZBA 3TBIA 1FMWA 3I9V2 4ZC3A 5GADJ 2K02A 4DIQA 4OAYA 2C6YA 5KAIC 2VQLA 2XAQA 3WTWC 2ISYA 4A3GJ 1LKXA 1U0JA 4IRGA 4V2GA 5LHGA 1VF9A 2DA5A 4C3HJ 1X3ZB 1W5CC 3RDIA 3G6EI 4EV0A 3RZOJ 2ISZA 1ON1A 2KKOA 1FTZA 3I54A 3DPTA 3E5UA 2YX4A 1XCBA 3I4PA 4M6XA 2A05A 2VKHA 2Y2ZA 1NTCA 3JSOA 2HR3A 2OD5A 2VT3A 1XGMA 1YITI 4CGZA 2G7HA 5FLVA 1UHMA 3BR5A 4U88A 2NRAC 4Y7NJ 2VASA 1IV8A 2FX0A 5LRSA 2MBFA 4FCYA 2YU3A 4CZZA 2NVTJ 2H94A 1Z9CA 2VJIA 5BMZA 2CG4A 3WGGA 1OMIA 2WV1A 4TV7A 2VBXA 4AYBA 2O8KA 3OYJA 4LB5A 1OFCX 2HOEA 2R7SA 3WG7H 2RNGA 3TO6A 2ZMEA 4BS9A 4ASNA 4A3BJ 4C2MJ 2FBIA 4BYYA 3GTLJ 4ZH4F 3TGNA 3AKZA 5EGOA 3ERMA 2V6EA 2L0KA 3TMOA 2CO5A 2RC4A 5K5QA 1TW3A 2DT6A 4ZYGA 4L18B 4NC7A 1BR4A 2VIXA 1TNTA 2IS2A 1Y56A 5E3MA 4A6DA 4A5NA 5DS9A 3QYBA 3GVAA 2WB1A 4BHBA 3H5AA 2CU7A 3L1PA 1MJBA 1E3HA 3MKYB 5HNHA 3G3ZA 2YS9A 1QBJA 3GTMJ 2GWRA 2ZMEC 5K1YA 3IRRA 2K85A 1E0EA 1R36A 1TWGJ 4XIDA 4CCKA 1HSTA 1P9QC 1XD7A 2KP6A 3OR1C 4ZYHA 5F64A 1BIBA 2HKOA 1LDJA 1JJ8C 3A01B 4JBAA 4B3AA 4EATA 2W57A 2IGOA 2XROA 2DA3A 2L7ZA 4UB8C 1DUXC 5LGNA 2NXNB 3KLNA 2DOFA 3T8TA 2M5WA 4HX7A 3CMMA 2LOOA 5LHIA 1DU6A 5EEAA 3AFHA 1RRJA 1GHCA 5LD2C 3FISA 3SQNA 4GFBA 4U87A 3P5JA 2NVYJ 1HW2A 3BG6A 3VODA 5DV5A 2GBYA 1UAAA 2P4WA 3HHHA 3FXLA 3WHBA 3I55I 3WTTC 1BA5A 4ZTJA 3TW7A 4BXUA 2GXBA 3CCYA 5H20A 4AIDA 2A69F 2BY1A 1MDMB 2CUJA 2Z3YA 4N0BA 3BQYA 4RA2A 4EGZA 2PMHA 4L5JA 5DYMA 3K1MA 3L2WA 3K4LA 3T5XA 1BC7C 1SD4A 4RBOA 1BI1A 4RGRA 4GRIA 2E2HJ 1LVKA 1Z1DA 3CD6I 4G6DA 4IRIA 2FQ3A 1QRYA 1POGA 3HGGA 4ZJZA 3CF2A 3DBLB 1MBJA 3QPHA 3OSFA 1TZLA 2LP0A 1LPQA 1XB4A 4F92B 3H5NA 2HQAA 3JAMZ 5GP9A 4B09A 4OWRB 2X6XA 1U5TA 2LF8A 3CDIA 2CJJA 1YJNI 1GT0C 2Z2SB 3WODF 1W5TA 1NG7A 2V26A 3IHUA 2DFEA 4G9YA 4KICA 4NB5A 1SAXA 1RESA 5EEHA 2DJNA 2DFIA 1EH7A 3LAJA 4IQ4A 1VQMI 2OF7A 1WI9A 1I3AA 3F8BA 4I6ZA 2HKXA 2HYJA 3FXQA 4AWXB 3CCSI 4GYIA 4KIBA 2FJ1A 2X9DA 2Y48A 3EPZA 4F3QA 5F04A 3FXRA 1U5TC 3F3XA 3ZCOA 2K9NA 5GTHC 4RAGA 3T0YA 2A61A 3DF8A 3HHGA 1W7PA 2A07F 2QCOA 4I98B 1JUPA 4BQOA 2IGMA 1ZG1A 4ZDPA 1Z0XA 3JREA 5BPDA 1T39A 2QVOA 4XKVA 4AYBN 5FFZA 1VQ8I 2OQRA 2DJIA 4M74A 3FM5A 1WRJA 4NQWB 2QYOA 5IYDJ 2L9RA 4OINF 1STZA 5E3NA 3HRTA 5HVQC 1HW1A 2G9WA 1OCOH 2BXZA 3DLLF 1U2WA 1YTYA 3PSFA 2FF4A 2P81A 2FBKA 2FQ4A 1MKMA 1WCMJ 3IAS2 1W7PD 4IHSA 5BNGA 3CQZJ 1ZHFA 1YHQI 4ZDOA 1X3WB 1A6QA 5LEKA 2WB1N 4YG2F 3PNYA 3GYHX 4IOCF 1IV6A 1RUNA 3K4CA 2YPRA 1D1BA 4GCVA 1V5GA 4M71A 4WF2A 1REPC 3HUGA 5CQGA 2KISA 2XV4S 1R4MB 5A2QK 1AHDP 3B73A 3M1CA 3H92A 4M3EA 2L2OA 3S1QJ 3CZ6A 3N05A 1Z6RA 1EF4A 1JKOC 3I5UA 2DXIA 2LFBA 1I27A 2LF7A 4HG2A 4RDUA 2HVQA 1B9NA 4ZDLA 2IAIA 3OYFA 1IUYA 3FXKA 1IUFA 5H2FC 2KJBA 3AG3H 1HC8A 1QO0D 4I0AA 2W84A 2M7BA 4QIWN 5B1AH 5FKMA 3MFKA 2L3DA 1AKHA 3VSKA 5ILUA 3ZRGA 5D8LB 1HLVA 3SJMA 1ZARA 2HYGD 3BTCA 1MBKA 2JUGA 3F8MA 2DQLA 2OA4A 2WY7Q 4IOAF 3NRVA 2WV0A 4ESFA 2DW4A 4ENKA 3HYIA 1BW6A 3VYSB 1ZGWA 2XKPA 1R5GA 1QPMA 4QPOA 1Z3YA 2AXTC 2L9NA 4RAZA 1ZR2A 4P96A 2X6OA 1L3LA 2IGNA 1LJ9A 1OCZH 3HL2A 5FLXK 2Q1ZB 5CYVA 4I01A 1RNLA 4RB1A 5FLMJ 2ELJA 2D45A 3TQNA 5B3SH 2TRTA 2DA7A 4YELA 4X0GA 2ID3A 2RVCA 3AG4H 2COBA 1WJEA 3FX3A 1FYLA 1NK3P 4XLNF 5M5YJ 1ZG5A 2ZMEB 5HLGA 2ECBA 3V8LA 2A6HF 2JVHA 3RYPA 4BHCA 3QAHA 3ZQGA 4DYRA 5EGOB 1K4SA 1JHFA 2X1CA 4LD5A 1FOWA 5K7FA 2RQPA 2KDZA 4M3BA 1F4KA 4MQVA 3GTKJ 2L5QA 2KDOA 3V7RA 2XSDC 1N78A 1MNDA 3S8PA 4E7ZA 3OYCA 4D5FA 1AWCA 1UELB 3S3MA 3WTXC 4CA0A 1WJFA 4QTRA 3CESA 3K10A 2FOKA
chains in the Genus database with same CATH topology
2H8RA 4MFDA 2XGDA 1YRNA 2AO9A 1F36A 1MH4A 2HOTA 3S15J 1XS9A 5J1RA 4QSHA 2ECCA 5EYRA 3BR2A 1GVDA 2R7ZJ 2QF7A 5EDNA 2R92J 3MVPA 3HOWJ 3Q0UA 2VI6A 1X2NA 3IH4A 3F0CA 4XRSG 3D1NI 3JRGA 4DW6A 4M3FA 5M3MJ 5FKOA 3QQAA 2HXOA 1A6IA 2DA1A 5FKLA 4DYCA 5FKKA 1QVTA 3BTLA 1I50J 1FIAA 1P7IA 5GPCA 2LR8A 3BR6A 1AKHB 2XPWA 1ITYA 2VUMJ 2RAEA 1LFBA 1U78A 3LSJA 1CQTA 5J1YA 2N8GA 1FIPA 1WH5A 2TCTA 5F0HA 3Q0WA 5EG0A 1GV2A 2XPUA 5JLXA 3GTOJ 3BG5A 1T56A 2JN6A 5M3FJ 1MBGA 1W0TA 3BT9A 1HDDC 2M34A 1UMQA 4A3CJ 3CMYA 2ID6A 1BW5A 1PUFB 1WH7A 3JRAA 4V2FA 3WHCA 2NOGA 1LE8A 5IP9J 2DMNA 1I3QJ 1B72B 1FJLA 1QVUA 2LVSA 2NVQJ 3JRFA 4JX6A 4DZPA 4UUTA 1FTTA 2CRGA 2LKXA 3PM1A 2DA2A 3S16J 4X1EA 2B63J 4W97A 1ETWA 3BR1A 2DA6A 3BG3A 4D7MA 5F1JA 3JRCA 1NK2P 3HOVJ 4D7NA 2DMTA 4M3GA 2R5ZA 2DTZA 1MH3A 3LSPA 4Y52J 1R9TJ 2EH3A 2AHQA 2PMZN 4MIMA 3A02A 3C2BA 5J3LA 2WAQN 3HEFA 4ABZA 2M0CA 2GLOA 3PO3J 1U9OA 2XGCA 4BBRJ 2NS8A 3BTJA 1A5JA 3GTGJ 3BG9A 1YRNB 1HF0A 2XRLA 2E19A 3TP3A 3O8HA 1JKQC 1GDTA 2CUEA 4A3LJ 3FK7A 1B8IA 1DU0A 1VFCA 2VPRA 2NVXJ 2JA7J 2VKVA 2LK2A 1TWFJ 2LY9A 1S7EA 4A69C 4A3FJ 2YU9J 5E3LA 3B6AA 4A3JJ 2R93J 1JUMA 3JRDA 4BY1J 1IDYA 3HOYJ 2XPVA 4CYCA 1RETA 2M8GX 2MSYA 1RKTA 2X48A 4C3JJ 1ETYA 1JTYA 2EZIA 4A3MJ 1IG7A 4L5EA 2G0EA 2JJ7A 5EG0B 5IP7J 3H0GJ 2R5YB 3W6VA 3H3VK 2DMPA 2HI3A 3A01A 1UHSA 4DZJA 4J19A 3S1MJ 4LOCA 2ME6A 4A3GJ 3ZQIA 4V2GA 1Y1WJ 1VF9A 2DA5A 2L7FP 4C3HJ 3I4NJ 4MLOA 1U9NA 3RZOJ 1LE8B 2JWTA 1W0UA 1MBFA 3OSGA 1FTZA 3LNQA 4A93J 4UUSB 2DN0A 5IOZA 2H1KA 1RKWA 2Y2ZA 1NTCA 3RQIA 2E2IJ 2MG4A 5FLVA 3LSGA 2KT0A 2ELKA 3BR5A 5C4XJ 2E2JJ 4BXXJ 3FIWA 4Y7NJ 3BQZA 3O8GA 2FX0A 2LLKA 2LD5A 2IEKA 1MNMC 5F08A 4FCYA 1HOMA 2NVTJ 5F27A 3BR0A 2HOSA 3VPRA 2WV1A 2EQRA 3HOXJ 2O8KA 4AUXA 2K9SA 1SANA 1OFCX 4IEJA 1TWCJ 3RZDJ 3FKIJ 4A3BJ 4C2MJ 2JK3A 3GTLJ 3BR3A 5EZHA 1XC5A 1ZR4A 1B8IB 5EGOA 2L0KA 1BL0A 1XG1A 3HKZN 1MSFC 3DEWA 4IHXA 2L7MP 2VKEA 1E3OC 5E3MA 2Y31A 3LOCA 3MN2A 4MO7A 1APLC 5DS9A 2CU7A 5F0FA 4NDLA 3L1PA 4IHWA 5C3EJ 5M5XJ 2YS9A 3GTMJ 3BTIA 1K61A 3CDLA 3HGYA 2JA5J 1TWGJ 4XIDA 1ORKA 3JR9A 3G1LA 2Y30A 3IH2A 3Q3SA 5C4JJ 4EEFG 1JGGA 3S17J 1JJ8C 3A01B 3HB9A 1ETOA 4B3AA 3LSRA 1OJLA 2DA3A 2L7ZA 4DYQA 4IHVA 2ZB9A 1H89C 3ZQCA 1P7JA 5K7HA 1JKRC 1DU6A 2JMWA 5EEAA 1MBHA 2OPTA 3FISA 4GFBA 5IYCJ 2NVYJ 5IYBJ 2DMQA 2GBYA 3HOZJ 3WHBA 3GTQJ 3G1MA 2DMUA 4A3EJ 1BA5A 3TW7A 4A3KJ 3CCYA 1MSEC 3BQYA 3GTJJ 3S2HJ 1ETVA 5J1UA 3NARA 3TW6A 3OIOA 4RBOA 2E2HJ 1VNDA 1RPWA 5C44J 1PUFA 3IH3A 1IRZA 2E1OA 3HOUJ 1QRYA 1POGA 1RR7A 3HGGA 4XRMA 4A3IJ 1SFOJ 1JJ6C 3TEDA 1B72A 1MBJA 2XGEA 3OSFA 2LP0A 3S14J 4C3IJ 1VI0A 1IJWC 1GV5A 1OCTC 2K40A 5GP9A 3ZQLA 2CQQA 5EF6A 2CJJA 1K83J 1GT0C 5FKNA 2I10A 2W48A 2EZKA 1H88C 1JKPC 3A03A 3HDDA 2JA6J 1RESA 3QPSA 2DJNA 2MW8A 1OCPA 3IV5A 4XICA 2M9HA 1U8BA 2OF7A 2GM4A 1ZKGA 4I6ZA 2HYJA 3PO2J 1Y1VJ 1WGXA 4FISA 1JTXA 2CUFA 2FJ1A 2X9DA 5F04A 3UKGA 1BJZA 1ZK8A 5IOYA 2K9NA 3S1RJ 2Y0SN 5HODA 4BKXA 2QCOA 2R5ZB 1JUPA 3M4OJ 3B6CA 3GBGA 2O7OA 1Z0XA 3JREA 3ZQFA 1AU7A 1UG2A 3SFIA 4AYBN 4W1UA 2JA8J 4IHYA 2R0QC 2DA4A 4BY7J 3SDGA 5IPAA 5IYDJ 2L9RA 2FD5A 2HXIA 4JYKA 4JP0A 5E3NA 5E3OA 1I6HJ 3JRIA 2Y9ZA 1ETXA 2IBDA 2P81A 2FQ4A 1IGNA 4XK4A 1WCMJ 1HCRA 1X58A 5BNGA 3CQZJ 2R5YA 1QPIA 1JT6A 2D5VA 5M5WJ 1F43A 2WB1N 2HOAA 3HM5A 1IV6A 1ETQA 4AC0A 1ETKA 1Q1VA 4CYCB 5IP6A 1AHDP 3S2DJ 2Y9YA 4D5CA 4HNVA 4M3EA 1LFUP 3S1QJ 1TWAJ 1EF4A 1JKOC 1D5YA 3RKQA 2LFBA 4FE7A 1ZQ3P 1ENHA 3E7LA 4RDUA 2IAIA 4UUSA 4A3DJ 2NS7A 4I76A 1IC8A 1IUFA 2HQ5A 1WI3A 2XB5A 3NAUA 1Z77A 3MKLA 2ME0A 3K2AA 3OOUA 4QIWN 5FKMA 1IDZA 1AKHA 1G2HA 3ZOBA 1TWHJ 1H8AC 1HLVA 3M3YJ 3SJMA 3K7AJ 3DCFA 3BTCA 1MBKA 5EZGA 2EZHA 2EBIA 1TC3C 9ANTA 3FK6A 1MBEA 5JLWA 3JRHA 3G1OA 5DTDA 4BBSJ 3QPLA 1BW6A 1ZGWA 2MGQA 1GUUA 1ZR2A 2X6OA 2M2EA 4XRSA 4FTHA 4FE4A 5GPAA 1ZTRA 4G12A 2K9QA 5F0CA 2EZLA 4MFEA 4S0HB 4M3DA 5K7ZA 5FLMJ 1JUSA 3ZQHA 4B1RA 2TRTA 2DA7A 1O4XA 1JT0A 2ID3A 1HDPA 2O9LA 2COBA 4JX4A 1X2MA 1NK3P 5M5YJ 4B4CA 2HDDA 2ECBA 2CQXA 2LTPA 2YUSA 4M6VA 3I4MJ 3ZQGA 4DYRA 5EGOB 5FJ8J 4X6AJ 1T33A 5K7FA 1WPKA 3HBLA 3TP0A 2KDZA 4M3BA 4JX5A 3S1NJ 3GTKJ 2XSDC 3JRBA 3GTPJ 1FEXA 2XB0X 4D5FA 3Q0VA 4QTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8R A;  4MFD A;  2XGD A;  1YRN A;  2AO9 A;  1F36 A;  1MH4 A;  2HOT A;  3S15 J;  1XS9 A;  5J1R A;  4QSH A;  2ECC A;  5EYR A;  3BR2 A;  1GVD A;  2R7Z J;  2QF7 A;  5EDN A;  2R92 J;  3MVP A;  3HOW J;  3Q0U A;  2VI6 A;  1X2N A;  3IH4 A;  3F0C A;  4XRS G;  3D1N I;  3JRG A;  4DW6 A;  4M3F A;  5M3M J;  5FKO A;  3QQA A;  2HXO A;  1A6I A;  2DA1 A;  5FKL A;  4DYC A;  5FKK A;  1QVT A;  3BTL A;  1I50 J;  1FIA A;  1P7I A;  5GPC A;  2LR8 A;  3BR6 A;  1AKH B;  2XPW A;  1ITY A;  2VUM J;  2RAE A;  1LFB A;  1U78 A;  3LSJ A;  1CQT A;  5J1Y A;  2N8G A;  1FIP A;  1WH5 A;  2TCT A;  5F0H A;  3Q0W A;  5EG0 A;  1GV2 A;  2XPU A;  5JLX A;  3GTO J;  3BG5 A;  1T56 A;  2JN6 A;  5M3F J;  1MBG A;  1W0T A;  3BT9 A;  1HDD C;  2M34 A;  1UMQ A;  4A3C J;  3CMY A;  2ID6 A;  1BW5 A;  1PUF B;  1WH7 A;  3JRA A;  4V2F A;  3WHC A;  2NOG A;  1LE8 A;  5IP9 J;  2DMN A;  1I3Q J;  1B72 B;  1FJL A;  1QVU A;  2LVS A;  2NVQ J;  3JRF A;  4JX6 A;  4DZP A;  4UUT A;  1FTT A;  2CRG A;  2LKX A;  3PM1 A;  2DA2 A;  3S16 J;  4X1E A;  2B63 J;  4W97 A;  1ETW A;  3BR1 A;  2DA6 A;  3BG3 A;  4D7M A;  5F1J A;  3JRC A;  1NK2 P;  3HOV J;  4D7N A;  2DMT A;  4M3G A;  2R5Z A;  2DTZ A;  1MH3 A;  3LSP A;  4Y52 J;  1R9T J;  2EH3 A;  2AHQ A;  2PMZ N;  4MIM A;  3A02 A;  3C2B A;  5J3L A;  2WAQ N;  3HEF A;  4ABZ A;  2M0C A;  2GLO A;  3PO3 J;  1U9O A;  2XGC A;  4BBR J;  2NS8 A;  3BTJ A;  1A5J A;  3GTG J;  3BG9 A;  1YRN B;  1HF0 A;  2XRL A;  2E19 A;  3TP3 A;  3O8H A;  1JKQ C;  1GDT A;  2CUE A;  4A3L J;  3FK7 A;  1B8I A;  1DU0 A;  1VFC A;  2VPR A;  2NVX J;  2JA7 J;  2VKV A;  2LK2 A;  1TWF J;  2LY9 A;  1S7E A;  4A69 C;  4A3F J;  2YU9 J;  5E3L A;  3B6A A;  4A3J J;  2R93 J;  1JUM A;  3JRD A;  4BY1 J;  1IDY A;  3HOY J;  2XPV A;  4CYC A;  1RET A;  2M8G X;  2MSY A;  1RKT A;  2X48 A;  4C3J J;  1ETY A;  1JTY A;  2EZI A;  4A3M J;  1IG7 A;  4L5E A;  2G0E A;  2JJ7 A;  5EG0 B;  5IP7 J;  3H0G J;  2R5Y B;  3W6V A;  3H3V K;  2DMP A;  2HI3 A;  3A01 A;  1UHS A;  4DZJ A;  4J19 A;  3S1M J;  4LOC A;  2ME6 A;  4A3G J;  3ZQI A;  4V2G A;  1Y1W J;  1VF9 A;  2DA5 A;  2L7F P;  4C3H J;  3I4N J;  4MLO A;  1U9N A;  3RZO J;  1LE8 B;  2JWT A;  1W0U A;  1MBF A;  3OSG A;  1FTZ A;  3LNQ A;  4A93 J;  4UUS B;  2DN0 A;  5IOZ A;  2H1K A;  1RKW A;  2Y2Z A;  1NTC A;  3RQI A;  2E2I J;  2MG4 A;  5FLV A;  3LSG A;  2KT0 A;  2ELK A;  3BR5 A;  5C4X J;  2E2J J;  4BXX J;  3FIW A;  4Y7N J;  3BQZ A;  3O8G A;  2FX0 A;  2LLK A;  2LD5 A;  2IEK A;  1MNM C;  5F08 A;  4FCY A;  1HOM A;  2NVT J;  5F27 A;  3BR0 A;  2HOS A;  3VPR A;  2WV1 A;  2EQR A;  3HOX J;  2O8K A;  4AUX A;  2K9S A;  1SAN A;  1OFC X;  4IEJ A;  1TWC J;  3RZD J;  3FKI J;  4A3B J;  4C2M J;  2JK3 A;  3GTL J;  3BR3 A;  5EZH A;  1XC5 A;  1ZR4 A;  1B8I B;  5EGO A;  2L0K A;  1BL0 A;  1XG1 A;  3HKZ N;  1MSF C;  3DEW A;  4IHX A;  2L7M P;  2VKE A;  1E3O C;  5E3M A;  2Y31 A;  3LOC A;  3MN2 A;  4MO7 A;  1APL C;  5DS9 A;  2CU7 A;  5F0F A;  4NDL A;  3L1P A;  4IHW A;  5C3E J;  5M5X J;  2YS9 A;  3GTM J;  3BTI A;  1K61 A;  3CDL A;  3HGY A;  2JA5 J;  1TWG J;  4XID A;  1ORK A;  3JR9 A;  3G1L A;  2Y30 A;  3IH2 A;  3Q3S A;  5C4J J;  4EEF G;  1JGG A;  3S17 J;  1JJ8 C;  3A01 B;  3HB9 A;  1ETO A;  4B3A A;  3LSR A;  1OJL A;  2DA3 A;  2L7Z A;  4DYQ A;  4IHV A;  2ZB9 A;  1H89 C;  3ZQC A;  1P7J A;  5K7H A;  1JKR C;  1DU6 A;  2JMW A;  5EEA A;  1MBH A;  2OPT A;  3FIS A;  4GFB A;  5IYC J;  2NVY J;  5IYB J;  2DMQ A;  2GBY A;  3HOZ J;  3WHB A;  3GTQ J;  3G1M A;  2DMU A;  4A3E J;  1BA5 A;  3TW7 A;  4A3K J;  3CCY A;  1MSE C;  3BQY A;  3GTJ J;  3S2H J;  1ETV A;  5J1U A;  3NAR A;  3TW6 A;  3OIO A;  4RBO A;  2E2H J;  1VND A;  1RPW A;  5C44 J;  1PUF A;  3IH3 A;  1IRZ A;  2E1O A;  3HOU J;  1QRY A;  1POG A;  1RR7 A;  3HGG A;  4XRM A;  4A3I J;  1SFO J;  1JJ6 C;  3TED A;  1B72 A;  1MBJ A;  2XGE A;  3OSF A;  2LP0 A;  3S14 J;  4C3I J;  1VI0 A;  1IJW C;  1GV5 A;  1OCT C;  2K40 A;  5GP9 A;  3ZQL A;  2CQQ A;  5EF6 A;  2CJJ A;  1K83 J;  1GT0 C;  5FKN A;  2I10 A;  2W48 A;  2EZK A;  1H88 C;  1JKP C;  3A03 A;  3HDD A;  2JA6 J;  1RES A;  3QPS A;  2DJN A;  2MW8 A;  1OCP A;  3IV5 A;  4XIC A;  2M9H A;  1U8B A;  2OF7 A;  2GM4 A;  1ZKG A;  4I6Z A;  2HYJ A;  3PO2 J;  1Y1V J;  1WGX A;  4FIS A;  1JTX A;  2CUF A;  2FJ1 A;  2X9D A;  5F04 A;  3UKG A;  1BJZ A;  1ZK8 A;  5IOY A;  2K9N A;  3S1R J;  2Y0S N;  5HOD A;  4BKX A;  2QCO A;  2R5Z B;  1JUP A;  3M4O J;  3B6C A;  3GBG A;  2O7O A;  1Z0X A;  3JRE A;  3ZQF A;  1AU7 A;  1UG2 A;  3SFI A;  4AYB N;  4W1U A;  2JA8 J;  4IHY A;  2R0Q C;  2DA4 A;  4BY7 J;  3SDG A;  5IPA A;  5IYD J;  2L9R A;  2FD5 A;  2HXI A;  4JYK A;  4JP0 A;  5E3N A;  5E3O A;  1I6H J;  3JRI A;  2Y9Z A;  1ETX A;  2IBD A;  2P81 A;  2FQ4 A;  1IGN A;  4XK4 A;  1WCM J;  1HCR A;  1X58 A;  5BNG A;  3CQZ J;  2R5Y A;  1QPI A;  1JT6 A;  2D5V A;  5M5W J;  1F43 A;  2WB1 N;  2HOA A;  3HM5 A;  1IV6 A;  1ETQ A;  4AC0 A;  1ETK A;  1Q1V A;  4CYC B;  5IP6 A;  1AHD P;  3S2D J;  2Y9Y A;  4D5C A;  4HNV A;  4M3E A;  1LFU P;  3S1Q J;  1TWA J;  1EF4 A;  1JKO C;  1D5Y A;  3RKQ A;  2LFB A;  4FE7 A;  1ZQ3 P;  1ENH A;  3E7L A;  4RDU A;  2IAI A;  4UUS A;  4A3D J;  2NS7 A;  4I76 A;  1IC8 A;  1IUF A;  2HQ5 A;  1WI3 A;  2XB5 A;  3NAU A;  1Z77 A;  3MKL A;  2ME0 A;  3K2A A;  3OOU A;  4QIW N;  5FKM A;  1IDZ A;  1AKH A;  1G2H A;  3ZOB A;  1TWH J;  1H8A C;  1HLV A;  3M3Y J;  3SJM A;  3K7A J;  3DCF A;  3BTC A;  1MBK A;  5EZG A;  2EZH A;  2EBI A;  1TC3 C;  9ANT A;  3FK6 A;  1MBE A;  5JLW A;  3JRH A;  3G1O A;  5DTD A;  4BBS J;  3QPL A;  1BW6 A;  1ZGW A;  2MGQ A;  1GUU A;  1ZR2 A;  2X6O A;  2M2E A;  4XRS A;  4FTH A;  4FE4 A;  5GPA A;  1ZTR A;  4G12 A;  2K9Q A;  5F0C A;  2EZL A;  4MFE A;  4S0H B;  4M3D A;  5K7Z A;  5FLM J;  1JUS A;  3ZQH A;  4B1R A;  2TRT A;  2DA7 A;  1O4X A;  1JT0 A;  2ID3 A;  1HDP A;  2O9L A;  2COB A;  4JX4 A;  1X2M A;  1NK3 P;  5M5Y J;  4B4C A;  2HDD A;  2ECB A;  2CQX A;  2LTP A;  2YUS A;  4M6V A;  3I4M J;  3ZQG A;  4DYR A;  5EGO B;  5FJ8 J;  4X6A J;  1T33 A;  5K7F A;  1WPK A;  3HBL A;  3TP0 A;  2KDZ A;  4M3B A;  4JX5 A;  3S1N J;  3GTK J;  2XSD C;  3JRB A;  3GTP J;  1FEX A;  2XB0 X;  4D5F A;  3Q0V A;  4QTR A; 
#chains in the Genus database with same CATH topology
 2LY1 A;  3CC7 I;  1F43 A;  2XGD A;  1F36 A;  2WWY A;  4YFK F;  3S32 A;  1QQI A;  5EYR A;  3J80 K;  1P4X A;  3P9K A;  1GVD A;  2R7Z J;  3QOP A;  5JHU A;  4AVZ A;  2JPB A;  3KZZ A;  2H8W A;  4O5V A;  4HF2 A;  4PJN A;  1FBU A;  2DA1 A;  5FKL A;  4DYC A;  4V19 K;  2V7F A;  4CCL A;  3ZGK A;  2EIN H;  3K69 A;  5KNL A;  2XPW A;  3A2K A;  4BE2 A;  4JOM A;  3BC8 A;  2R7X A;  4RLF A;  4G8X A;  3N4M A;  5J1Y A;  4IZZ A;  1WH5 A;  4IPA A;  4PZJ A;  4Y3O A;  1EV7 A;  5EG0 A;  1FYM A;  3ZMV A;  3GZN B;  1TW2 A;  5JLX A;  5E8G A;  3BG5 A;  4BXF A;  5IY5 H;  2IA0 A;  2JN6 A;  3BG7 A;  5DM7 F;  1MBG A;  5M3F J;  3K4M A;  3BT9 A;  1HDD C;  2HWV A;  2M34 A;  3IAM 2;  4WK8 F;  1UMQ A;  4BU2 A;  2ID6 A;  1RZ4 A;  3FMR A;  1VZ0 A;  2EV5 A;  5D4S A;  3JRA A;  1AA7 A;  2F5V A;  2QBY A;  1QVU A;  3VWB A;  2PEX A;  3P9I A;  2VC1 A;  4UUT A;  1FTT A;  1U5T B;  1P92 A;  4MEY F;  2R7W A;  3RPU A;  2DA2 A;  4N4O B;  1X4P A;  4F91 B;  5EJC A;  3OYL A;  2B63 J;  3D5L A;  2CSO A;  2HTJ A;  3BR1 A;  3FDY A;  3HSR A;  3BG3 A;  4D7M A;  4FX4 A;  3IKT A;  3PJR A;  5TGT A;  1ZGJ A;  5D5V B;  2EH3 A;  5J4Y A;  5FRN A;  3A02 A;  3C2B A;  2BY2 A;  4LGW A;  1VQ7 I;  2GLO A;  2XGC A;  3DPL C;  4BBR J;  3LMM A;  1A5J A;  3MQ0 A;  1H9G A;  3Q9V A;  3HPH A;  3HTU A;  1SVM A;  2GA1 A;  3BCB A;  3OYG A;  1BI3 A;  4ENN A;  2M45 A;  3RPU D;  3VYU B;  3FHN A;  3IL2 A;  1DU0 A;  2MC3 A;  3LSI A;  3G2B A;  1VFC A;  3K4N A;  3FKJ A;  4LMY A;  2NVX J;  1ON2 A;  2DLL A;  2ZC2 A;  2VKV A;  2QKL B;  3KET A;  2RN7 A;  1S7E A;  3CF5 F;  3QU3 A;  1IN6 A;  1W36 D;  2JT1 A;  4A69 C;  4A3F J;  2YU9 J;  1R58 A;  3WU0 A;  1HSJ A;  4A12 A;  1O7F A;  4LLG F;  1K78 B;  1YJW I;  4BY1 J;  1YW8 A;  2H1L A;  2XPV A;  2I5U A;  4CYC A;  2MH9 A;  3EYI A;  2IS1 A;  2X48 A;  1XMK A;  1JTY A;  5IT9 K;  4LG0 A;  1R1T A;  2E35 A;  2XSJ C;  2OTJ I;  2JJ7 A;  1YJ9 I;  4HYE A;  1LQ1 A;  2LSO A;  3UNG C;  3A01 A;  1X4O A;  3J7A Y;  2K7L A;  5FRM A;  1UCR A;  4B8X A;  1KU3 A;  1OCR H;  4B43 A;  2L7F P;  3I4N J;  1U9N A;  2JVG A;  2K4B A;  1ULY A;  3GF2 A;  4IVN A;  2QZ8 A;  4A93 J;  2IS6 A;  2KLO A;  2DN0 A;  3BZK A;  1RKW A;  1JXS A;  4E70 A;  4XOT A;  3C2H A;  4G6T B;  1MDM A;  1FNN A;  2E2I J;  2MG4 A;  5D5U B;  1LB2 A;  3S2W A;  4HQM A;  4UXN A;  5HOO A;  2DTR A;  2L4A A;  4PJ0 C;  3TDU C;  3BDD A;  4Q47 A;  1LNW A;  1Y0U A;  1K79 A;  1HQC A;  3DBR B;  2B7E A;  2LLK A;  4H4K C;  1GVJ A;  2HDW A;  2EK5 A;  5F08 A;  3HPG A;  1R49 A;  4LB6 B;  3JW4 A;  3CCQ I;  5L3B A;  3MMY B;  3DTK A;  2LYC A;  3CCR I;  1KYZ A;  4G6Q A;  4AUX A;  2M87 A;  1TWC J;  2VON A;  1B6A A;  5L3E A;  1YX5 A;  1T8I A;  3CLO A;  3F8F A;  1WJA A;  2WY8 Q;  1XC5 A;  2QQB A;  4HNU A;  1FC3 A;  1YW9 A;  1BL0 A;  2A6E F;  2O61 A;  4XOP A;  2VC0 A;  3J7Z I;  5DCF A;  2P6S A;  2L7M P;  2O6G E;  4F52 A;  5ICE A;  2HPM A;  3VB2 A;  2Y31 A;  1XN7 A;  2XDV A;  3RYR A;  3K70 D;  2R7F A;  4XM3 A;  3KEQ A;  5CLS A;  1QU3 A;  5L3F A;  3AL0 C;  1DPR A;  1BJA A;  3FF5 A;  5DCM B;  2ZO4 A;  5BS6 A;  1FX7 A;  2FBH A;  3CDL A;  2X51 A;  3DPU A;  4XON A;  3BCA A;  3ONQ A;  3BWG A;  3Q3S A;  5C4J J;  4EEF G;  4BQA A;  2CMP A;  2MD0 A;  2F48 A;  1JGG A;  3S17 J;  2GZW A;  5L3C A;  2BY3 A;  3ERE D;  2V1X A;  3HB9 A;  1B59 A;  1G3Y A;  1T08 B;  5LGT A;  4DYQ A;  4IHV A;  4PGG A;  4R79 A;  3OYH A;  1H89 C;  3GFJ A;  2WBM A;  2KPM A;  3WU2 C;  3W2A A;  4RGX A;  1JKR C;  4I2O A;  4E7L A;  1WJC A;  4N4N B;  4F7Z A;  2MLK A;  2X6W A;  3UR3 C;  3GFM A;  1XDS A;  1D0X A;  1IW7 F;  3IKV A;  5DUI A;  2GQQ A;  3V42 A;  2OCE A;  2QWW A;  4I7H A;  4A2U A;  2BGC A;  2EV6 A;  4EJT A;  4G7O F;  1Z7L A;  2XF5 A;  4OU0 A;  4IL6 C;  3ZR8 X;  3OL3 A;  3QP5 A;  2FA5 A;  2ZFU A;  2JRM A;  1MSE C;  2FXA A;  4XN0 A;  4A6E A;  2Z33 A;  3WE3 A;  1U6G A;  3GTJ J;  3S2H J;  1ETV A;  2M4K A;  1O7L A;  4Y4R A;  1KZH A;  2XAF A;  3TW6 A;  3OIO A;  1ODD A;  1BN5 A;  1SAU A;  3TO9 A;  2GOM A;  1PUF A;  3EQL F;  3U21 A;  2E1O A;  1EJ9 A;  5FD5 A;  2VBW A;  1TT5 B;  4A3I J;  3E3V A;  4XRM A;  3OS0 A;  4EGY A;  1SD5 A;  1NH3 A;  1B72 A;  3GCM A;  2XIG A;  2KRC A;  3TOB A;  1SD7 A;  1VI0 A;  4C3I J;  1MMS A;  1OCT C;  1R23 A;  3ZQL A;  2CQQ A;  4WXC A;  3KZY A;  1TBX A;  1E2X A;  2HGC A;  1SMY F;  3GXO A;  3RKW A;  2EZK A;  3M1E A;  2A5W A;  1VQO I;  3V8K A;  2QBY B;  3KEO A;  2M9H A;  1Y39 A;  1MW7 A;  4WCG A;  2GM4 A;  5J40 A;  2E71 A;  2ZJ2 A;  3PO2 J;  1Y1V J;  2XF6 A;  3A4C A;  4A5M A;  1WGX A;  3M07 A;  3K1N A;  3MAJ A;  3RIR A;  4L9J A;  4CYD A;  4FIS A;  2QM3 A;  4UVB A;  3AAF A;  3E5X A;  4HV6 A;  4GGG A;  4E7J A;  3SDB A;  3S1R J;  4A0Y A;  2H09 A;  1SC7 A;  5HOD A;  3H3Z A;  3U1K A;  1Y8Q B;  4BKX A;  2M1B A;  1LUJ B;  3CJT B;  3GFL A;  3M4O J;  2GOX B;  3GBG A;  2PJR B;  5JHF A;  5ERI A;  2KMU A;  1DP3 A;  4LG3 A;  3ZQF A;  2VOO A;  1UG2 A;  3SFI A;  4HLX A;  4W1U A;  2YSR A;  4WXD A;  4B3X A;  3HSF A;  1VQL I;  3W6K B;  2QSG X;  4I09 A;  2FU4 A;  1O57 A;  4XRF A;  3SDG A;  5IPA A;  2GXA A;  2HXI A;  4JYK A;  3OMY A;  4CCM A;  5E3O A;  4A0X A;  1UST A;  3GZ5 A;  2B9S A;  4KFC A;  2DDB A;  2IBD A;  2X85 A;  5TRD A;  3H35 A;  3JAM K;  1HCR A;  2E5N A;  2STW A;  1X58 A;  3E6D A;  2E1M C;  2A68 F;  2EV0 A;  2R5Y A;  2Z5U A;  1QPI A;  1OR7 A;  3HM5 A;  1ONV A;  2R7O A;  3LL7 A;  2STT A;  2R7Q A;  2EFW A;  2E7X A;  1ETK A;  1EH8 A;  1Z3X A;  2NS0 A;  4E6K G;  2QQ8 A;  1XSX A;  2V9K A;  5DUK A;  4CYC B;  1IN7 A;  3OL4 A;  3S2D J;  4S04 A;  4HNV A;  4UV8 A;  4LG0 B;  4KIG A;  1TWA J;  4C2T A;  3IP4 B;  1D5Y A;  3FHZ A;  4Q4Z F;  3HXL A;  2XC7 A;  4I99 C;  4XLC A;  3PQK A;  1ENH A;  1ZQ3 P;  2X0L A;  2LKP A;  1OR7 C;  1RUO A;  1YS7 A;  3J81 Z;  2EPF A;  4BQN A;  1XX5 A;  1QZE A;  1H9T A;  2XB5 A;  2EFN A;  3MKL A;  2ME0 A;  1IDZ A;  4IO9 F;  4O6J A;  3M3Y J;  1V54 H;  4PSW A;  3OYE A;  4U7D A;  2VBZ A;  1SFE A;  2EIK H;  2NYX A;  4E7H A;  1OKR A;  2EZH A;  2EBI A;  3SHF A;  2EFO A;  4M73 A;  1NG6 A;  1FZP B;  2PQ8 A;  3G1O A;  1IRX A;  4MQ9 F;  3DEE A;  5L3G A;  3G71 I;  2BW3 A;  4GO1 A;  3WGH A;  3ASO H;  2MGQ A;  1GUU A;  4RAF A;  2DYS H;  2DFH A;  2RDP A;  2QEX I;  3W2V A;  5E79 C;  4ANJ A;  5FGM A;  4HDU A;  2KZG A;  5GPA A;  2HS5 A;  1DGR M;  1F1Z A;  2EZL A;  1IXR C;  4OAZ A;  5K7Z A;  1T38 A;  4B1R A;  2Z99 A;  3KLO A;  3TKY A;  4MTE A;  2XAJ A;  2LY2 A;  2LRD A;  5CVU A;  3H5R A;  3V7C A;  2LNB A;  4LIU A;  2IA1 A;  4P1W A;  3AL0 B;  2NNY A;  2HDD A;  3BOQ A;  3BJA A;  4CH7 A;  5BQT A;  1SFX A;  4M6V A;  3I4M J;  3WTV C;  5FJ8 J;  4RS8 A;  4X6A J;  1WPK A;  4YFX F;  3K2Z A;  4BEH A;  2BVM A;  3HBL A;  3TP0 A;  4EJW A;  4BDY A;  1RIO H;  1WWX A;  1ERD A;  3ZMD A;  1LDK B;  2IT0 A;  2XB0 X;  4KMU X;  3F8N A;  1D3Y A;  4KN7 X;  2PLY A;  3W3C A;  5B5E C;  4AM3 A;  2KQR A;  2ESH A;  3QRF F;  5LBQ A;  4HEA 2;  3LQR A;  4HF1 A;  5J1R A;  3AG1 H;  4XKW A;  4RAY A;  4YRV A;  3MVP A;  3Q0U A;  2OC6 A;  1VQK I;  1G6N A;  3IH4 A;  5LEJ A;  2PX9 A;  4DW6 A;  2HVS A;  2RQQ A;  4IF4 A;  5HNF A;  5FKO A;  4XKB A;  4CDG A;  2LC2 A;  2DI3 A;  2WAD A;  4J01 A;  2DT7 B;  4Y13 A;  2XAH A;  2VE8 A;  2K3P A;  4PK4 A;  3DXJ F;  1ZAO A;  1WKM A;  4KJZ A;  3BTL A;  1I50 J;  5E1W A;  1FIA A;  1K78 A;  2PMU A;  1J9I A;  1WJB A;  4MGR A;  1K7A A;  1BBY A;  1XGN A;  1ITY A;  1R1U A;  3SEZ A;  1LFB A;  1U78 A;  2EWN A;  3LSJ A;  3DWL E;  2IW5 A;  3IWZ A;  2TCT A;  3O2P E;  3Q0W A;  1S9H A;  4QWQ A;  1HA8 A;  4ZYA A;  4WWC A;  2HVR A;  2XPU A;  2DK8 A;  2R7D A;  4L0Y B;  3KX2 A;  4WXH A;  3LSH A;  2HTS A;  3G73 A;  4Z2Y A;  1S7A A;  2ETH A;  3BJ6 A;  3OY9 A;  4XL9 A;  2F6C A;  1HW5 A;  2B0L A;  4A3C J;  5D5W B;  2LBF B;  1H0M A;  3CMY A;  1BW5 A;  4WX9 A;  2AXL A;  3V4G A;  1OYI A;  3KYL A;  3K9T A;  3K4B A;  1PUF B;  1WH7 A;  2Y0M A;  1N75 A;  2NOG A;  3SZG A;  1I3Q J;  1J2X A;  1B72 B;  1PDN C;  1X3U A;  2V1N A;  5LLQ A;  1FJL A;  4OOI A;  2NVQ J;  1S72 I;  3LFK A;  3F9K A;  1L0O C;  2L7K A;  4JX6 A;  2NNN A;  2LKX A;  1XTA A;  4EJO A;  1B9M A;  1YIJ I;  1WJ5 A;  1PP8 F;  3QOD A;  2CQ7 A;  3CO7 C;  3ZMZ A;  3CJR B;  3KIO A;  4IX7 A;  2DA6 A;  1EH6 A;  2WA0 A;  2R5Z A;  1IRG A;  2ESN A;  1A04 A;  4EJU A;  1MH3 A;  2VOP A;  2ZBK A;  4Y52 J;  2RRE A;  2AHQ A;  4MIM A;  5J3L A;  2M0C A;  4XQF A;  2DU9 A;  2OCC H;  4CXF A;  2NS8 A;  4XN3 A;  3HC7 A;  4HRI A;  1PP7 U;  5JVT A;  1T0F A;  1YRN B;  1S29 A;  4RGU A;  3R4K A;  4U0Y A;  2KRF A;  4E7S A;  2BY0 A;  2J5P A;  3F8C A;  1YX3 A;  1FBS A;  2UXX A;  3R60 A;  3FK7 A;  4CIC A;  4FX0 A;  4EJV A;  3WTS C;  2E1M B;  3CCL I;  2JA7 J;  4XLA A;  1ZEL A;  1Y8R B;  1TWF J;  3NEU A;  4XKC A;  3EDP A;  1BI2 A;  2TDX A;  4PFP A;  4P9U A;  1JUM A;  4JQF A;  4P55 A;  1T0F C;  3M9A A;  3MD2 A;  3VYT B;  1IDY A;  2DOD A;  2MSY A;  5DCM A;  5H6Q A;  3KP3 A;  1ETY A;  1YQA A;  3CP8 A;  4I0B A;  2Q8K A;  1W4M A;  1K6Y A;  2ZKZ A;  1OLT A;  4A3M J;  1IG7 A;  4L5E A;  2R5Y B;  2H6C A;  3H0G J;  3H3V K;  2DMP A;  3PNT A;  2UXN A;  2DO7 A;  3KFW X;  2HYF A;  3GLX A;  2BEO A;  4DZJ A;  2VOD A;  2P0W A;  3S1M J;  2PBI A;  4BE1 A;  2K5C A;  2R7R A;  2V9V A;  2W00 A;  4CCN A;  3ZQI A;  2COM A;  3I3L A;  4DNC A;  2VJ4 A;  3FZV A;  2R4G A;  1T2K A;  3BRO A;  1BM9 A;  1TNS A;  4PJJ A;  4MLO A;  4MEX F;  5D5X B;  2X1D A;  3R0A A;  1W0U A;  2P5V A;  3MKZ A;  1PUE E;  3C7J A;  2QKM B;  3OSG A;  1YI2 I;  3RKX A;  3LNQ A;  1OYY A;  2W4S A;  2FNA A;  5K5O A;  2AQF A;  3ECO A;  2H1K A;  2RNJ A;  3LWF A;  2ZJQ F;  3RQI A;  3L2U A;  2DAO A;  2VJJ A;  4B47 A;  2HQR A;  2GIV A;  2F2E A;  3LSG A;  1MMD A;  2KT0 A;  1IXC A;  4P5O A;  5C4X J;  4L9V A;  3ZQQ A;  3K4J A;  2E2J J;  2W25 A;  4BXX J;  2BYV E;  3BQZ A;  3O8G A;  1R5H A;  2IVM A;  4F55 A;  1MNM C;  1D5V A;  2MH2 A;  1IZ1 A;  1HOM A;  2GIZ A;  5F27 A;  1MGT A;  3BR0 A;  5HS7 A;  1J59 A;  3VPR A;  2ZXW H;  2WC2 A;  5D4R A;  3HOX J;  2A5Y B;  2K9S A;  2LKS A;  3MKW B;  2BW3 B;  3FKI J;  4HAM A;  3IWF A;  1WHU A;  2FRH A;  1ZLJ A;  2BE5 F;  2JK3 A;  3BR3 A;  5EZH A;  4E7K A;  5BOX A;  3OOP A;  1ZR4 A;  1TTY A;  4AIJ A;  3QPT A;  1I1S A;  2GAU A;  4D1Q A;  1BR1 A;  4IHX A;  3DEW A;  2V4J C;  3FWE A;  4CCO A;  2VKE A;  3QYF A;  5KK1 A;  1E3O C;  3LFU A;  3LOC A;  4MO7 A;  3HRS A;  2P5L C;  3HJE A;  4XLP F;  3ROU A;  4AD9 A;  4MNU A;  1QNT A;  4HPQ A;  5C3E J;  1GXQ A;  2VBY A;  3PIP F;  2QLZ A;  3GME A;  2DQR A;  1D8J A;  1QGP A;  4KIF A;  4BEH B;  4BE0 A;  3KYC B;  3G1L A;  2JPC A;  4LK0 F;  5E8I A;  3P7N A;  1R71 A;  1BC8 C;  2PJR A;  2K86 A;  1G3S A;  1R22 A;  3LSR A;  1OJL A;  2GXG A;  2QA4 I;  3RJP A;  2HZD A;  2IGK A;  2ZB9 A;  4UNO A;  1ZH5 A;  4II3 A;  2K4J A;  5ILS A;  3ZQC A;  4FT8 A;  4IHT A;  4HF0 A;  3E6C C;  1FLI A;  2O0Y A;  4IXA A;  2JMW A;  3N97 A;  2HNH A;  3KEY A;  2ZCW A;  3TL4 X;  4L5I A;  2V79 A;  5E17 F;  3CCM I;  1S5L C;  5IYB J;  4UUV A;  2WTE A;  4BGD A;  4N9H A;  4ESJ A;  1YFH A;  1DGW Y;  1O3Q A;  3MZ8 A;  4DBR A;  2D1H A;  3R61 A;  6PAX A;  4OIP F;  3G1M A;  4A3E J;  4OMY A;  5GAH J;  2WAQ A;  3NQO A;  4PGH A;  3NWS A;  4PSX A;  3CDH A;  3I56 I;  3BP8 A;  2LMD A;  5J1U A;  2RV8 A;  4XLH A;  3D5S C;  3NAR A;  2VKD A;  3G4S I;  2E60 A;  1DPU A;  1VND A;  1RPW A;  1ZYR F;  1X1P A;  2W24 A;  1KQ8 A;  3L9F A;  3HRU A;  3S14 J;  2Q0O A;  1GV5 A;  3F23 A;  2K40 A;  2VJ5 A;  4YEJ A;  5EF6 A;  1D0Y A;  1K83 J;  3I58 A;  2F4O B;  2I10 A;  3T8R A;  1WZ2 A;  3AG2 H;  2XAG A;  3QWL A;  4HBL A;  3OIQ A;  5B1B H;  1WSU A;  2W48 A;  2PI0 A;  3HDD A;  2JA6 J;  1OCC H;  3W2W A;  3KP5 A;  1HKS A;  5J4V A;  1JHH A;  1N25 A;  1X1C A;  2MW8 A;  3IV5 A;  4HX8 A;  1U8B A;  2OQG A;  1ZKG A;  2M3A A;  2FEZ A;  3S3O A;  3D5R C;  3C1D A;  3CCV I;  2CUF A;  3C3W A;  5LGU A;  3ULQ B;  3JTH A;  1CF7 A;  3UKG A;  2W1O A;  4RLQ A;  2QUF A;  3CJN A;  5IOY A;  4CSW A;  1UHW A;  5CVJ A;  2R5Z B;  3B6C A;  3IRQ A;  2W7N A;  2Z16 A;  2ZJP F;  3R0J A;  3ZXS A;  4CO8 A;  1E3P A;  5D6F A;  1ZGA A;  1AU7 A;  2IS4 A;  3HG9 A;  4IRH A;  2JA8 J;  3PFI A;  4IHY A;  2W85 A;  3KYD B;  4CCJ A;  2DA4 A;  4BY7 J;  1IXS B;  3OV8 A;  1S7O A;  4Q5S F;  2JSC A;  5CQE A;  2FD5 A;  1FY7 A;  3GZ6 A;  3CLQ A;  4HA8 A;  1D8K A;  1SFK A;  1ZN2 A;  2MA3 A;  1I6H J;  2M7A A;  1TQI A;  1J7K A;  1IO2 A;  5TJJ A;  1ETX A;  1IGN A;  4XK4 A;  4L9N A;  4KT5 C;  1GLN A;  3WU1 B;  2LRE A;  1B4A A;  2NOJ B;  2VXZ A;  1YIO A;  1UG0 A;  1JT6 A;  1Z67 A;  1YLF A;  5LRR A;  3KP6 A;  1ETQ A;  5E18 F;  1RC9 A;  1HXD A;  3I59 B;  1Q1V A;  3TDZ C;  1KU7 A;  3FXU A;  5IP6 A;  4KIT B;  4D5C A;  2UV1 A;  2EA2 A;  3DU6 A;  4UY8 I;  1LFU P;  4HDV A;  2P7C B;  1CGP A;  1TT0 A;  3RKQ A;  3DFG A;  3LAP A;  4FE7 A;  4EQQ A;  2ZXJ A;  3DKW A;  3F21 A;  1YG2 A;  1MJ9 A;  4UUS A;  3SZT A;  4A3D J;  2NS7 A;  4BHP A;  4PDK A;  5ICG A;  2OUM A;  3P9C A;  4AIK A;  4XOR A;  1R1V A;  2HQ5 A;  2XVC A;  4PCQ A;  5HDK A;  5JVG F;  3MZH A;  1WI3 A;  3NAU A;  5LHH A;  3DTI A;  2L9V A;  1IN5 A;  2KIF A;  2KIM A;  5J6X A;  2BBY A;  1G2H A;  3ZOB A;  1TWH J;  5HDG A;  1H8A C;  3K7A J;  3DCF A;  3CUQ A;  1C0W A;  5DD4 A;  2H27 A;  3KP7 A;  4RGS A;  1FSH A;  1T98 A;  4ENM A;  2UUZ A;  1FBQ A;  3JRH A;  3QPL A;  2K27 A;  2QQ9 A;  4CZC A;  5ICC A;  1KQ9 A;  1FSE A;  2M2E A;  2LBF A;  3DEU A;  4HQE A;  4XRS A;  1PJR A;  2H6B A;  2L54 A;  3OWT A;  4BJT A;  2DDA A;  3BY6 A;  4G12 A;  1XDU A;  4R1H A;  4MFE A;  5E20 A;  5F0C A;  4S0H B;  4M3D A;  1PYV A;  3CUQ C;  3EUK L;  1JUS A;  3KPH A;  2R7U A;  3D0S A;  1Z21 A;  2ZJR F;  3PNV A;  1O4X A;  1HDP A;  4ZZL A;  3DQV C;  3JSP A;  4JX4 A;  1X2M A;  1XGO A;  3KCC A;  2CQX A;  4XSX F;  3ZMS A;  2AS5 F;  3F6O A;  2BHY A;  1RI7 A;  1MNE A;  3OYN A;  4PUS A;  2E7W A;  3ABU A;  3J81 K;  1J5Y A;  2XUB A;  1FEX A;  4OIO F;  3SFZ A;  3Q0V A;  4HST A;  1VQP I;  2DOA A;  2KL4 A;  2JZY A;  4MFD A;  1YRN A;  4U7B A;  4QSH A;  1GXP A;  2ECC A;  3BR2 A;  5EDN A;  4AVP A;  3OYB A;  1FOY A;  2LG4 A;  3HOW J;  2VPL A;  2VI6 A;  3RTR A;  1X2N A;  3ECH A;  3D1N I;  4ZYE A;  4C30 A;  1VQ4 I;  3JRG A;  5FRO A;  4M3F A;  3E5Q A;  3QP6 A;  2X1E A;  1J75 A;  1Z7U A;  4L0Z B;  2DYR H;  1A6I A;  1J0R A;  1TL8 A;  4M9X A;  3OYA A;  1WJD A;  4IJA A;  5FKK A;  1SVL A;  2L01 A;  5GPC A;  1O3R A;  3CC2 I;  3BR6 A;  4G94 A;  3QYE A;  1BR2 A;  2ZXI A;  3COA C;  2KZV A;  2CW7 A;  1O3T A;  1OIS A;  5BPI A;  5LFA A;  3L2V A;  1BI0 A;  4KA4 A;  1G59 A;  1FIP A;  2Q2E B;  5F0H A;  1GV2 A;  1R5I D;  4ITV A;  4E4H A;  2EB7 A;  4BAY A;  3OYI A;  5JI6 A;  1ZRC A;  2O03 A;  5HS8 A;  3GTO J;  2VT2 A;  4LIT A;  1G3W A;  1T56 A;  1W0T A;  4CUG A;  1QHG A;  2DFF A;  5AIQ A;  2IRF G;  1VQ6 I;  1BIA A;  1HBX G;  3PUB A;  2MFZ A;  1W1W E;  2CH0 A;  4ZYD A;  4GDF A;  1JGS A;  2M30 A;  4B48 A;  4PFO A;  5DEQ A;  3L2C A;  2FOW A;  3WHC A;  5IP9 J;  5CJ9 A;  3HKZ A;  2Z1D A;  3JRF A;  5IT3 A;  1MD0 A;  3K4K A;  5ILV A;  5FO5 A;  2XRN A;  2V9P A;  4BH9 A;  2DPD A;  3PM1 A;  2ZFW A;  4Y17 A;  1S8N A;  3PFY A;  3ZPL A;  3DKX A;  3CCU I;  5F1J A;  5TIS C;  1NK2 P;  4D7N A;  2DMT A;  4M3G A;  4S05 A;  3I0T A;  1HKT A;  3ABL H;  3LSP A;  1NHA A;  1R9T J;  3HEF A;  4D0P A;  1U9O A;  2F5C A;  3BTJ A;  4RB2 C;  1G8X A;  2RGV A;  3F6V A;  1XMX A;  1MMG A;  1CF7 B;  3GTG J;  3BG9 A;  4HV5 A;  2EA4 A;  1HF0 A;  2E19 A;  4M6Y A;  1P4A A;  2EIM H;  3PQJ A;  4KYW A;  3O8H A;  1JE8 A;  1JKQ C;  3BPV A;  3C2G A;  2CUZ A;  3HIF A;  1U3E M;  1W5S A;  3H9G A;  2MD5 A;  2K9L A;  1X19 A;  2L4M A;  4E7I A;  4LK1 F;  2CQN A;  2LK2 A;  2D2W A;  2LY9 A;  3S15 J;  3WG9 A;  2IA2 A;  2AQE A;  2EIL H;  1MMN A;  1FP1 D;  1OQY A;  3B6A A;  3CCJ I;  4O3M A;  1WVR A;  5CVR A;  4ESB A;  4KIS A;  2BXY A;  1TQM A;  3I71 A;  3WTU C;  2A6T A;  1TQP A;  2M8G X;  2DCE A;  4U0V A;  4P9F A;  1KGS A;  2ZNZ A;  3VSL A;  1QHH D;  4J00 A;  3GO5 A;  2A3S A;  4GXO A;  4QPQ A;  2PG4 A;  2CS3 A;  1IRF A;  1T95 A;  3RI4 A;  3RKY A;  1UHS A;  2IJL A;  2UWM A;  1FMV A;  2CFX A;  4J19 A;  3ABK H;  5D8K B;  3LSM A;  3O3K A;  4LOC A;  3FMQ A;  2ME6 A;  1O3S A;  1USS A;  1N77 A;  3CUO A;  2ZSI B;  1UB9 A;  3E6B A;  4XBF A;  3K6G A;  1Y1W J;  3FMS A;  1DDN A;  3HTS B;  5H6R A;  3M8F A;  1EA3 A;  3CME I;  1MIJ A;  1LE8 B;  2JWT A;  4HLY A;  1MBF A;  2BOL A;  3H3U A;  3LA3 A;  4UUS B;  2V6C A;  5IOZ A;  1FOK A;  3T1B A;  2KIQ A;  2VQC A;  1X1B A;  4Q48 A;  1Q1H A;  1V55 H;  4BL0 B;  2WAE A;  2ELK A;  2MC4 A;  3H9Q A;  2ZSH B;  3M8J A;  2Y0S A;  3FIW A;  1A35 A;  3CUQ B;  2LD5 A;  2IEK A;  1SMT A;  2M8E A;  4OIR F;  2KIU A;  2ACJ A;  4ETS A;  4M9S A;  2HOS A;  1YO5 C;  3E97 A;  2EQR A;  1LVA A;  4UVC A;  3PIO F;  1YW7 A;  1SAN A;  4IEJ A;  3HOS A;  3RZD J;  2KFD A;  4DOZ A;  1SD6 A;  1Z05 A;  2CQK A;  3ZMT A;  2E36 A;  1B8I B;  3LSK A;  4Y33 A;  3RSN A;  1XG1 A;  1UJ8 A;  3HKZ N;  5K5R A;  5AIP A;  3F72 A;  3A0B C;  1MSF C;  2Z9O A;  4KMF A;  1XMA A;  1IAW A;  2DT5 A;  4MHG A;  4ZTF A;  1QZY A;  4PJM A;  3MN2 A;  1YE9 A;  1APL C;  5ICF A;  5F0F A;  4NDL A;  4IHW A;  2EFP A;  1G4D A;  2M0M A;  5M5X J;  1V3F A;  5AON A;  3BTI A;  1K61 A;  1R6R A;  4IKF A;  3HGY A;  2JA5 J;  3EYY A;  1A31 A;  1ORK A;  1Y6I A;  3LA2 A;  3JR9 A;  2Y30 A;  3IH2 A;  2YR2 A;  1ZLK A;  4KT6 A;  1XGS A;  1Z6T A;  3VOE A;  2G7U A;  1ETO A;  3LQQ A;  1AOY A;  3ESW B;  2CV0 A;  3CC4 I;  3L7W A;  4KNY A;  1P7J A;  5B66 C;  5K7H A;  3HRM A;  2OZ6 A;  2PN6 A;  1SVO A;  1MBH A;  2V1U A;  2OPT A;  3VFZ A;  1I5Z A;  3K0L A;  5IYC J;  1ZRD A;  1ACI A;  3E0J B;  2HDC A;  3GLL A;  5GTI C;  3DP7 A;  2DMQ A;  1IN4 A;  3HOZ J;  1FOX A;  3GTQ J;  2MAB A;  1D0Z A;  2XF7 A;  4LFU A;  2DMU A;  4YIR X;  4A3K J;  5E1X A;  4YII A;  4JK1 X;  2HEO A;  1B1B A;  3I59 A;  1X1A A;  4Y15 A;  3H36 A;  4HW0 A;  3MWM A;  1E17 A;  3CO6 C;  1I39 A;  5CVI A;  2K3F A;  1KU2 A;  3C18 A;  3O6B B;  4XLE A;  1VTN C;  3EUH A;  2ICW G;  5C44 J;  3IH3 A;  1IRZ A;  2IPQ X;  3HOU J;  2I8D A;  3A0H C;  5J8C A;  4M72 A;  3M8E A;  1RR7 A;  4NNJ A;  1SFO J;  1JJ6 C;  1ZRE A;  3TED A;  3ELK A;  2XGE A;  3CCE I;  3RQ4 A;  1IJW C;  2F4I A;  3OYK A;  5J8F A;  3OYD A;  3W6J B;  3OIP A;  1PVE A;  2XHK A;  4LLN A;  1P2F A;  1YYV A;  2HQN A;  5L3D A;  1LEA A;  5FKN A;  2DBB A;  3SZP A;  1H88 C;  3EUH C;  2IXS A;  1JKP C;  3BZC A;  1UZC A;  2XAU A;  3A03 A;  4KUM A;  3SXY A;  4B44 A;  4QLC U;  3QPS A;  5A2Q Z;  2KJC A;  1OCP A;  3GUD A;  4BJ6 C;  4XIC A;  2OU2 A;  1Y0N A;  2O8X A;  1R7J A;  2OZU A;  2JUC A;  4XLF A;  2ZNY A;  3CP2 A;  5FB2 A;  4NUB A;  1JTX A;  1OYW A;  2VN2 A;  1SFU A;  1BJZ A;  1ZK8 A;  3ISP A;  5CVV A;  3EUA A;  2FE3 A;  2Y0S N;  1MJA A;  2PJP A;  4FAS D;  4H0E A;  1DQU A;  2R3S A;  3FBI B;  3HSE A;  3DKY A;  2O7O A;  4UHT A;  3I64 A;  1LEB A;  3Q9S A;  2W82 A;  3KP4 A;  2CGP A;  2EFQ A;  4BUP A;  2VXD A;  3DTE A;  2ZXH A;  2R0Q C;  1DP7 P;  1IF1 A;  2K9M A;  2VQG A;  1J09 A;  5D6E A;  2JTV A;  3GFI A;  1TP4 A;  3K1P A;  3FBN B;  3ML6 A;  3QOE A;  4JP0 A;  4FET A;  2EIJ H;  4HOB A;  1EKE A;  1WQ2 A;  5KVR A;  3R6S A;  3JRI A;  2Y9Z A;  2QSH X;  1S6L A;  3ZQ7 A;  4LIV A;  1FP2 A;  5FFX A;  3OYM A;  4C9Y A;  4EM1 A;  2D5V A;  5M5W J;  5FLX Z;  2BZT A;  1BOB A;  5HLH A;  2HOA A;  1D1A A;  2XKO A;  4AC0 A;  3LST A;  2F5F A;  4EM0 B;  4II2 A;  3GWZ A;  1P6R A;  2YX7 A;  2Y9Y A;  3NWT A;  4ENJ A;  1QA6 A;  1RR8 C;  3FM3 A;  2CV1 A;  2CW8 A;  3MEX A;  4NC6 A;  2HPI A;  4DJA A;  4AU7 A;  2P5K A;  4EM2 A;  3E7L A;  3WE2 A;  4K2E A;  3ZMU A;  4R8H A;  3WTZ A;  4I76 A;  1IC8 A;  2ADU A;  1ZRF A;  4N9I A;  3JCU C;  1A36 A;  3GW2 A;  1FPQ A;  3E1S A;  1Z77 A;  3OOU A;  1D1C A;  3K2A A;  3RPQ A;  4G7H F;  3DV8 A;  3M7G A;  1FYK A;  2PFB A;  5CKT A;  3PUF A;  4BQQ A;  3J80 Z;  3LA7 A;  2Y75 A;  5EZG A;  1G3T A;  3IC7 A;  1OPC A;  3QU6 A;  2Q2E A;  1TC3 C;  4UB6 C;  9ANT A;  2CWE A;  2QGU A;  3VDX A;  3FK6 A;  1MBE A;  5JLW A;  2PMZ A;  4A0Z A;  2DPU A;  4HZF A;  1XSV A;  5DTD A;  1FWZ A;  4BBS J;  3V8J A;  2Y69 H;  4U0W A;  4XR6 A;  3DU5 A;  3U2R A;  4UVA A;  4BJ5 C;  3PL8 A;  3S93 A;  4DBQ A;  2JSP A;  1W7P B;  3DLA A;  3BZ6 A;  3DBH B;  4FTH A;  5HDN A;  4FE4 A;  1ZTR A;  2K9Q A;  4RB3 C;  2KHM A;  4KN4 X;  3X2Q H;  1W36 C;  2X6Y A;  4M9Z A;  1S3J A;  3ZQH A;  4LJZ F;  3ZP5 A;  2OV7 A;  3F22 A;  2FML A;  4UV9 A;  4HX4 A;  1XSD A;  1JT0 A;  4XMY A;  3H0D A;  2HFH A;  4RB0 A;  4F93 B;  1VQ9 I;  2VB6 A;  4EMS A;  2E1C A;  2O9L A;  1VQN I;  2E34 A;  4B4C A;  5ED4 A;  2LTP A;  1V4R A;  2YUS A;  5J47 A;  2FUG 2;  2DOE A;  1VQ5 I;  3MZY A;  4OIQ F;  1T33 A;  1X1D A;  4KDP A;  2VQH A;  1KON A;  2OJE D;  4JX5 A;  5DD8 A;  3S1N J;  1TLH B;  3JRB A;  1F5T A;  3GTP J;  2J5O A;  1HKQ A;  3HOT A;  3KZI C;  1UFM A;  4FQG A;  4NC8 A;  2XGX A;  3CJQ B;  5F6F A;  4BNC A;  2R7T A;  2EJR A;  1V5F A;  3HUG B;  2H8R A;  1YS6 A;  1WFX A;  5DDG A;  4YFN F;  3KP2 A;  2HOT A;  2AO9 A;  3U9G A;  1MH4 A;  2FMY A;  5DM6 F;  3Q5F A;  2QQA A;  5KCM A;  1XS9 A;  4DQ2 A;  2OAZ A;  2QF7 A;  1T6S A;  2R92 J;  5GAG J;  4ON0 A;  2NVU B;  3S3N A;  3KE2 A;  3F0C A;  4XRS G;  2F5E A;  1K4T A;  2BV6 A;  4AIH A;  1P4W A;  2JA2 A;  5KHD A;  5M3M J;  3QQA A;  2HXO A;  3IUO A;  1KYW A;  3V7S A;  2FSW A;  3J7A O;  3L09 A;  4GYG A;  2OBP A;  3U1D A;  1BOA A;  3OS2 A;  1QVT A;  4D9J A;  2UZK A;  2FNP A;  1P7I A;  2VL8 A;  2LR8 A;  1IN8 A;  1R00 A;  1AKH B;  2MYS A;  3H1C A;  3A1Y A;  2HZT A;  1KU9 A;  3WTY C;  3JTG A;  2VUM J;  2RAE A;  2V1D A;  4FHT A;  3E6M A;  3ASN H;  2XAS A;  1ZG3 A;  1CQT A;  2BHZ A;  3SEQ A;  2WAF A;  2N8G A;  2OTL I;  4OMZ A;  1QZZ A;  5FD6 A;  2VLA A;  3FXM A;  2LDU A;  4HSR A;  3L2Q A;  3RCO A;  5KAF C;  5CPR B;  1YOV B;  2RKH A;  4YIF A;  1I1G A;  2CV2 A;  3ABT A;  2NAZ A;  4EVI A;  4IQJ A;  1LDD A;  4RM3 A;  3CTA A;  2JQ7 A;  3TOA A;  2E1N A;  2CFO A;  4L9T A;  4V2F A;  1LE8 A;  3FXJ A;  1XCV A;  2DMN A;  2O3F A;  3K70 C;  5IT9 Z;  3J7Y J;  2LVS A;  2M4G A;  4G7Z F;  4NHJ A;  1KA8 A;  3HZJ A;  2P8T A;  2QSF X;  2JRT A;  4DZP A;  4NBQ A;  5HLT A;  2CRG A;  3BLY A;  3MCZ A;  3SYT A;  1FT9 A;  2VE9 A;  4RM2 A;  2P7V B;  3S16 J;  3GEZ A;  5F1R A;  3GX4 X;  4X1E A;  4W97 A;  2CYY A;  1ETW A;  5HS9 A;  3OS1 A;  4CHU A;  3CMA I;  3JRC A;  3HOV J;  3EET A;  3VYR B;  3VEP A;  4DGW B;  5GAE J;  2DTZ A;  4HNT A;  1XPX A;  4LLL A;  2O5R A;  2PMZ N;  3WGI A;  1V5E A;  2WAQ N;  4XSZ F;  1U8R A;  3BJO A;  3ZN1 A;  3H9J A;  4ABZ A;  3REO A;  5JFR A;  3PO3 J;  3ABM H;  4ZZD A;  2X4H A;  1F9N A;  2BVL A;  2XRL A;  4NQW A;  5JR3 A;  3TP3 A;  2HU9 A;  4BDZ A;  2LH9 A;  2ELH A;  2L02 A;  1GDT A;  2DK5 A;  2L9S A;  1MMA A;  1Z91 A;  2CUE A;  3L00 A;  3OR2 C;  1JI8 A;  3PSI A;  4MTD A;  4A3L J;  2R7V A;  1B8I A;  3ZN0 A;  2VPR A;  1M1E B;  2CW0 F;  2IP2 A;  1SEU A;  4BAC A;  1R4N B;  2GA2 A;  2E5Z A;  4Z6Y A;  2MLG A;  5HLI A;  5E3L A;  3TO7 A;  4A3J J;  2R93 J;  3BPX A;  3JRD A;  3FXO A;  1K6O A;  3B02 A;  2D1V A;  2P6T A;  3HOY J;  2F5D A;  1RET A;  4RMN A;  4C2U A;  1RKT A;  5EEG A;  4C3J J;  2F4M B;  1LFP A;  2EZI A;  4XNF A;  4I02 A;  2G0E A;  2QEN A;  3I53 A;  4PJL A;  1I6X A;  5E1Z B;  3L2R A;  2KRH A;  5EG0 B;  5IP7 J;  3W6V A;  2HI3 A;  1KQ0 A;  1MZB A;  3TBI A;  1FMW A;  3I9V 2;  4ZC3 A;  5GAD J;  2K02 A;  4DIQ A;  4OAY A;  2C6Y A;  5KAI C;  2VQL A;  2XAQ A;  3WTW C;  2ISY A;  4A3G J;  1LKX A;  1U0J A;  4IRG A;  4V2G A;  5LHG A;  1VF9 A;  2DA5 A;  4C3H J;  1X3Z B;  1W5C C;  3RDI A;  3G6E I;  4EV0 A;  3RZO J;  2ISZ A;  1ON1 A;  2KKO A;  1FTZ A;  3I54 A;  3DPT A;  3E5U A;  2YX4 A;  1XCB A;  3I4P A;  4M6X A;  2A05 A;  2VKH A;  2Y2Z A;  1NTC A;  3JSO A;  2HR3 A;  2OD5 A;  2VT3 A;  1XGM A;  1YIT I;  4CGZ A;  2G7H A;  5FLV A;  1UHM A;  3BR5 A;  4U88 A;  2NRA C;  4Y7N J;  2VAS A;  1IV8 A;  2FX0 A;  5LRS A;  2MBF A;  4FCY A;  2YU3 A;  4CZZ A;  2NVT J;  2H94 A;  1Z9C A;  2VJI A;  5BMZ A;  2CG4 A;  3WGG A;  1OMI A;  2WV1 A;  4TV7 A;  2VBX A;  4AYB A;  2O8K A;  3OYJ A;  4LB5 A;  1OFC X;  2HOE A;  2R7S A;  3WG7 H;  2RNG A;  3TO6 A;  2ZME A;  4BS9 A;  4ASN A;  4A3B J;  4C2M J;  2FBI A;  4BYY A;  3GTL J;  4ZH4 F;  3TGN A;  3AKZ A;  5EGO A;  3ERM A;  2V6E A;  2L0K A;  3TMO A;  2CO5 A;  2RC4 A;  5K5Q A;  1TW3 A;  2DT6 A;  4ZYG A;  4L18 B;  4NC7 A;  1BR4 A;  2VIX A;  1TNT A;  2IS2 A;  1Y56 A;  5E3M A;  4A6D A;  4A5N A;  5DS9 A;  3QYB A;  3GVA A;  2WB1 A;  4BHB A;  3H5A A;  2CU7 A;  3L1P A;  1MJB A;  1E3H A;  3MKY B;  5HNH A;  3G3Z A;  2YS9 A;  1QBJ A;  3GTM J;  2GWR A;  2ZME C;  5K1Y A;  3IRR A;  2K85 A;  1E0E A;  1R36 A;  1TWG J;  4XID A;  4CCK A;  1HST A;  1P9Q C;  1XD7 A;  2KP6 A;  3OR1 C;  4ZYH A;  5F64 A;  1BIB A;  2HKO A;  1LDJ A;  1JJ8 C;  3A01 B;  4JBA A;  4B3A A;  4EAT A;  2W57 A;  2IGO A;  2XRO A;  2DA3 A;  2L7Z A;  4UB8 C;  1DUX C;  5LGN A;  2NXN B;  3KLN A;  2DOF A;  3T8T A;  2M5W A;  4HX7 A;  3CMM A;  2LOO A;  5LHI A;  1DU6 A;  5EEA A;  3AFH A;  1RRJ A;  1GHC A;  5LD2 C;  3FIS A;  3SQN A;  4GFB A;  4U87 A;  3P5J A;  2NVY J;  1HW2 A;  3BG6 A;  3VOD A;  5DV5 A;  2GBY A;  1UAA A;  2P4W A;  3HHH A;  3FXL A;  3WHB A;  3I55 I;  3WTT C;  1BA5 A;  4ZTJ A;  3TW7 A;  4BXU A;  2GXB A;  3CCY A;  5H20 A;  4AID A;  2A69 F;  2BY1 A;  1MDM B;  2CUJ A;  2Z3Y A;  4N0B A;  3BQY A;  4RA2 A;  4EGZ A;  2PMH A;  4L5J A;  5DYM A;  3K1M A;  3L2W A;  3K4L A;  3T5X A;  1BC7 C;  1SD4 A;  4RBO A;  1BI1 A;  4RGR A;  4GRI A;  2E2H J;  1LVK A;  1Z1D A;  3CD6 I;  4G6D A;  4IRI A;  2FQ3 A;  1QRY A;  1POG A;  3HGG A;  4ZJZ A;  3CF2 A;  3DBL B;  1MBJ A;  3QPH A;  3OSF A;  1TZL A;  2LP0 A;  1LPQ A;  1XB4 A;  4F92 B;  3H5N A;  2HQA A;  3JAM Z;  5GP9 A;  4B09 A;  4OWR B;  2X6X A;  1U5T A;  2LF8 A;  3CDI A;  2CJJ A;  1YJN I;  1GT0 C;  2Z2S B;  3WOD F;  1W5T A;  1NG7 A;  2V26 A;  3IHU A;  2DFE A;  4G9Y A;  4KIC A;  4NB5 A;  1SAX A;  1RES A;  5EEH A;  2DJN A;  2DFI A;  1EH7 A;  3LAJ A;  4IQ4 A;  1VQM I;  2OF7 A;  1WI9 A;  1I3A A;  3F8B A;  4I6Z A;  2HKX A;  2HYJ A;  3FXQ A;  4AWX B;  3CCS I;  4GYI A;  4KIB A;  2FJ1 A;  2X9D A;  2Y48 A;  3EPZ A;  4F3Q A;  5F04 A;  3FXR A;  1U5T C;  3F3X A;  3ZCO A;  2K9N A;  5GTH C;  4RAG A;  3T0Y A;  2A61 A;  3DF8 A;  3HHG A;  1W7P A;  2A07 F;  2QCO A;  4I98 B;  1JUP A;  4BQO A;  2IGM A;  1ZG1 A;  4ZDP A;  1Z0X A;  3JRE A;  5BPD A;  1T39 A;  2QVO A;  4XKV A;  4AYB N;  5FFZ A;  1VQ8 I;  2OQR A;  2DJI A;  4M74 A;  3FM5 A;  1WRJ A;  4NQW B;  2QYO A;  5IYD J;  2L9R A;  4OIN F;  1STZ A;  5E3N A;  3HRT A;  5HVQ C;  1HW1 A;  2G9W A;  1OCO H;  2BXZ A;  3DLL F;  1U2W A;  1YTY A;  3PSF A;  2FF4 A;  2P81 A;  2FBK A;  2FQ4 A;  1MKM A;  1WCM J;  3IAS 2;  1W7P D;  4IHS A;  5BNG A;  3CQZ J;  1ZHF A;  1YHQ I;  4ZDO A;  1X3W B;  1A6Q A;  5LEK A;  2WB1 N;  4YG2 F;  3PNY A;  3GYH X;  4IOC F;  1IV6 A;  1RUN A;  3K4C A;  2YPR A;  1D1B A;  4GCV A;  1V5G A;  4M71 A;  4WF2 A;  1REP C;  3HUG A;  5CQG A;  2KIS A;  2XV4 S;  1R4M B;  5A2Q K;  1AHD P;  3B73 A;  3M1C A;  3H92 A;  4M3E A;  2L2O A;  3S1Q J;  3CZ6 A;  3N05 A;  1Z6R A;  1EF4 A;  1JKO C;  3I5U A;  2DXI A;  2LFB A;  1I27 A;  2LF7 A;  4HG2 A;  4RDU A;  2HVQ A;  1B9N A;  4ZDL A;  2IAI A;  3OYF A;  1IUY A;  3FXK A;  1IUF A;  5H2F C;  2KJB A;  3AG3 H;  1HC8 A;  1QO0 D;  4I0A A;  2W84 A;  2M7B A;  4QIW N;  5B1A H;  5FKM A;  3MFK A;  2L3D A;  1AKH A;  3VSK A;  5ILU A;  3ZRG A;  5D8L B;  1HLV A;  3SJM A;  1ZAR A;  2HYG D;  3BTC A;  1MBK A;  2JUG A;  3F8M A;  2DQL A;  2OA4 A;  2WY7 Q;  4IOA F;  3NRV A;  2WV0 A;  4ESF A;  2DW4 A;  4ENK A;  3HYI A;  1BW6 A;  3VYS B;  1ZGW A;  2XKP A;  1R5G A;  1QPM A;  4QPO A;  1Z3Y A;  2AXT C;  2L9N A;  4RAZ A;  1ZR2 A;  4P96 A;  2X6O A;  1L3L A;  2IGN A;  1LJ9 A;  1OCZ H;  3HL2 A;  5FLX K;  2Q1Z B;  5CYV A;  4I01 A;  1RNL A;  4RB1 A;  5FLM J;  2ELJ A;  2D45 A;  3TQN A;  5B3S H;  2TRT A;  2DA7 A;  4YEL A;  4X0G A;  2ID3 A;  2RVC A;  3AG4 H;  2COB A;  1WJE A;  3FX3 A;  1FYL A;  1NK3 P;  4XLN F;  5M5Y J;  1ZG5 A;  2ZME B;  5HLG A;  2ECB A;  3V8L A;  2A6H F;  2JVH A;  3RYP A;  4BHC A;  3QAH A;  3ZQG A;  4DYR A;  5EGO B;  1K4S A;  1JHF A;  2X1C A;  4LD5 A;  1FOW A;  5K7F A;  2RQP A;  2KDZ A;  4M3B A;  1F4K A;  4MQV A;  3GTK J;  2L5Q A;  2KDO A;  3V7R A;  2XSD C;  1N78 A;  1MND A;  3S8P A;  4E7Z A;  3OYC A;  4D5F A;  1AWC A;  1UEL B;  3S3M A;  3WTX C;  4CA0 A;  1WJF A;  4QTR A;  3CES A;  3K10 A;  2FOK A; 
#chains in the Genus database with same CATH homology
 2H8R A;  4MFD A;  2XGD A;  1YRN A;  2AO9 A;  1F36 A;  1MH4 A;  2HOT A;  3S15 J;  1XS9 A;  5J1R A;  4QSH A;  2ECC A;  5EYR A;  3BR2 A;  1GVD A;  2R7Z J;  2QF7 A;  5EDN A;  2R92 J;  3MVP A;  3HOW J;  3Q0U A;  2VI6 A;  1X2N A;  3IH4 A;  3F0C A;  4XRS G;  3D1N I;  3JRG A;  4DW6 A;  4M3F A;  5M3M J;  5FKO A;  3QQA A;  2HXO A;  1A6I A;  2DA1 A;  5FKL A;  4DYC A;  5FKK A;  1QVT A;  3BTL A;  1I50 J;  1FIA A;  1P7I A;  5GPC A;  2LR8 A;  3BR6 A;  1AKH B;  2XPW A;  1ITY A;  2VUM J;  2RAE A;  1LFB A;  1U78 A;  3LSJ A;  1CQT A;  5J1Y A;  2N8G A;  1FIP A;  1WH5 A;  2TCT A;  5F0H A;  3Q0W A;  5EG0 A;  1GV2 A;  2XPU A;  5JLX A;  3GTO J;  3BG5 A;  1T56 A;  2JN6 A;  5M3F J;  1MBG A;  1W0T A;  3BT9 A;  1HDD C;  2M34 A;  1UMQ A;  4A3C J;  3CMY A;  2ID6 A;  1BW5 A;  1PUF B;  1WH7 A;  3JRA A;  4V2F A;  3WHC A;  2NOG A;  1LE8 A;  5IP9 J;  2DMN A;  1I3Q J;  1B72 B;  1FJL A;  1QVU A;  2LVS A;  2NVQ J;  3JRF A;  4JX6 A;  4DZP A;  4UUT A;  1FTT A;  2CRG A;  2LKX A;  3PM1 A;  2DA2 A;  3S16 J;  4X1E A;  2B63 J;  4W97 A;  1ETW A;  3BR1 A;  2DA6 A;  3BG3 A;  4D7M A;  5F1J A;  3JRC A;  1NK2 P;  3HOV J;  4D7N A;  2DMT A;  4M3G A;  2R5Z A;  2DTZ A;  1MH3 A;  3LSP A;  4Y52 J;  1R9T J;  2EH3 A;  2AHQ A;  2PMZ N;  4MIM A;  3A02 A;  3C2B A;  5J3L A;  2WAQ N;  3HEF A;  4ABZ A;  2M0C A;  2GLO A;  3PO3 J;  1U9O A;  2XGC A;  4BBR J;  2NS8 A;  3BTJ A;  1A5J A;  3GTG J;  3BG9 A;  1YRN B;  1HF0 A;  2XRL A;  2E19 A;  3TP3 A;  3O8H A;  1JKQ C;  1GDT A;  2CUE A;  4A3L J;  3FK7 A;  1B8I A;  1DU0 A;  1VFC A;  2VPR A;  2NVX J;  2JA7 J;  2VKV A;  2LK2 A;  1TWF J;  2LY9 A;  1S7E A;  4A69 C;  4A3F J;  2YU9 J;  5E3L A;  3B6A A;  4A3J J;  2R93 J;  1JUM A;  3JRD A;  4BY1 J;  1IDY A;  3HOY J;  2XPV A;  4CYC A;  1RET A;  2M8G X;  2MSY A;  1RKT A;  2X48 A;  4C3J J;  1ETY A;  1JTY A;  2EZI A;  4A3M J;  1IG7 A;  4L5E A;  2G0E A;  2JJ7 A;  5EG0 B;  5IP7 J;  3H0G J;  2R5Y B;  3W6V A;  3H3V K;  2DMP A;  2HI3 A;  3A01 A;  1UHS A;  4DZJ A;  4J19 A;  3S1M J;  4LOC A;  2ME6 A;  4A3G J;  3ZQI A;  4V2G A;  1Y1W J;  1VF9 A;  2DA5 A;  2L7F P;  4C3H J;  3I4N J;  4MLO A;  1U9N A;  3RZO J;  1LE8 B;  2JWT A;  1W0U A;  1MBF A;  3OSG A;  1FTZ A;  3LNQ A;  4A93 J;  4UUS B;  2DN0 A;  5IOZ A;  2H1K A;  1RKW A;  2Y2Z A;  1NTC A;  3RQI A;  2E2I J;  2MG4 A;  5FLV A;  3LSG A;  2KT0 A;  2ELK A;  3BR5 A;  5C4X J;  2E2J J;  4BXX J;  3FIW A;  4Y7N J;  3BQZ A;  3O8G A;  2FX0 A;  2LLK A;  2LD5 A;  2IEK A;  1MNM C;  5F08 A;  4FCY A;  1HOM A;  2NVT J;  5F27 A;  3BR0 A;  2HOS A;  3VPR A;  2WV1 A;  2EQR A;  3HOX J;  2O8K A;  4AUX A;  2K9S A;  1SAN A;  1OFC X;  4IEJ A;  1TWC J;  3RZD J;  3FKI J;  4A3B J;  4C2M J;  2JK3 A;  3GTL J;  3BR3 A;  5EZH A;  1XC5 A;  1ZR4 A;  1B8I B;  5EGO A;  2L0K A;  1BL0 A;  1XG1 A;  3HKZ N;  1MSF C;  3DEW A;  4IHX A;  2L7M P;  2VKE A;  1E3O C;  5E3M A;  2Y31 A;  3LOC A;  3MN2 A;  4MO7 A;  1APL C;  5DS9 A;  2CU7 A;  5F0F A;  4NDL A;  3L1P A;  4IHW A;  5C3E J;  5M5X J;  2YS9 A;  3GTM J;  3BTI A;  1K61 A;  3CDL A;  3HGY A;  2JA5 J;  1TWG J;  4XID A;  1ORK A;  3JR9 A;  3G1L A;  2Y30 A;  3IH2 A;  3Q3S A;  5C4J J;  4EEF G;  1JGG A;  3S17 J;  1JJ8 C;  3A01 B;  3HB9 A;  1ETO A;  4B3A A;  3LSR A;  1OJL A;  2DA3 A;  2L7Z A;  4DYQ A;  4IHV A;  2ZB9 A;  1H89 C;  3ZQC A;  1P7J A;  5K7H A;  1JKR C;  1DU6 A;  2JMW A;  5EEA A;  1MBH A;  2OPT A;  3FIS A;  4GFB A;  5IYC J;  2NVY J;  5IYB J;  2DMQ A;  2GBY A;  3HOZ J;  3WHB A;  3GTQ J;  3G1M A;  2DMU A;  4A3E J;  1BA5 A;  3TW7 A;  4A3K J;  3CCY A;  1MSE C;  3BQY A;  3GTJ J;  3S2H J;  1ETV A;  5J1U A;  3NAR A;  3TW6 A;  3OIO A;  4RBO A;  2E2H J;  1VND A;  1RPW A;  5C44 J;  1PUF A;  3IH3 A;  1IRZ A;  2E1O A;  3HOU J;  1QRY A;  1POG A;  1RR7 A;  3HGG A;  4XRM A;  4A3I J;  1SFO J;  1JJ6 C;  3TED A;  1B72 A;  1MBJ A;  2XGE A;  3OSF A;  2LP0 A;  3S14 J;  4C3I J;  1VI0 A;  1IJW C;  1GV5 A;  1OCT C;  2K40 A;  5GP9 A;  3ZQL A;  2CQQ A;  5EF6 A;  2CJJ A;  1K83 J;  1GT0 C;  5FKN A;  2I10 A;  2W48 A;  2EZK A;  1H88 C;  1JKP C;  3A03 A;  3HDD A;  2JA6 J;  1RES A;  3QPS A;  2DJN A;  2MW8 A;  1OCP A;  3IV5 A;  4XIC A;  2M9H A;  1U8B A;  2OF7 A;  2GM4 A;  1ZKG A;  4I6Z A;  2HYJ A;  3PO2 J;  1Y1V J;  1WGX A;  4FIS A;  1JTX A;  2CUF A;  2FJ1 A;  2X9D A;  5F04 A;  3UKG A;  1BJZ A;  1ZK8 A;  5IOY A;  2K9N A;  3S1R J;  2Y0S N;  5HOD A;  4BKX A;  2QCO A;  2R5Z B;  1JUP A;  3M4O J;  3B6C A;  3GBG A;  2O7O A;  1Z0X A;  3JRE A;  3ZQF A;  1AU7 A;  1UG2 A;  3SFI A;  4AYB N;  4W1U A;  2JA8 J;  4IHY A;  2R0Q C;  2DA4 A;  4BY7 J;  3SDG A;  5IPA A;  5IYD J;  2L9R A;  2FD5 A;  2HXI A;  4JYK A;  4JP0 A;  5E3N A;  5E3O A;  1I6H J;  3JRI A;  2Y9Z A;  1ETX A;  2IBD A;  2P81 A;  2FQ4 A;  1IGN A;  4XK4 A;  1WCM J;  1HCR A;  1X58 A;  5BNG A;  3CQZ J;  2R5Y A;  1QPI A;  1JT6 A;  2D5V A;  5M5W J;  1F43 A;  2WB1 N;  2HOA A;  3HM5 A;  1IV6 A;  1ETQ A;  4AC0 A;  1ETK A;  1Q1V A;  4CYC B;  5IP6 A;  1AHD P;  3S2D J;  2Y9Y A;  4D5C A;  4HNV A;  4M3E A;  1LFU P;  3S1Q J;  1TWA J;  1EF4 A;  1JKO C;  1D5Y A;  3RKQ A;  2LFB A;  4FE7 A;  1ZQ3 P;  1ENH A;  3E7L A;  4RDU A;  2IAI A;  4UUS A;  4A3D J;  2NS7 A;  4I76 A;  1IC8 A;  1IUF A;  2HQ5 A;  1WI3 A;  2XB5 A;  3NAU A;  1Z77 A;  3MKL A;  2ME0 A;  3K2A A;  3OOU A;  4QIW N;  5FKM A;  1IDZ A;  1AKH A;  1G2H A;  3ZOB A;  1TWH J;  1H8A C;  1HLV A;  3M3Y J;  3SJM A;  3K7A J;  3DCF A;  3BTC A;  1MBK A;  5EZG A;  2EZH A;  2EBI A;  1TC3 C;  9ANT A;  3FK6 A;  1MBE A;  5JLW A;  3JRH A;  3G1O A;  5DTD A;  4BBS J;  3QPL A;  1BW6 A;  1ZGW A;  2MGQ A;  1GUU A;  1ZR2 A;  2X6O A;  2M2E A;  4XRS A;  4FTH A;  4FE4 A;  5GPA A;  1ZTR A;  4G12 A;  2K9Q A;  5F0C A;  2EZL A;  4MFE A;  4S0H B;  4M3D A;  5K7Z A;  5FLM J;  1JUS A;  3ZQH A;  4B1R A;  2TRT A;  2DA7 A;  1O4X A;  1JT0 A;  2ID3 A;  1HDP A;  2O9L A;  2COB A;  4JX4 A;  1X2M A;  1NK3 P;  5M5Y J;  4B4C A;  2HDD A;  2ECB A;  2CQX A;  2LTP A;  2YUS A;  4M6V A;  3I4M J;  3ZQG A;  4DYR A;  5EGO B;  5FJ8 J;  4X6A J;  1T33 A;  5K7F A;  1WPK A;  3HBL A;  3TP0 A;  2KDZ A;  4M3B A;  4JX5 A;  3S1N J;  3GTK J;  2XSD C;  3JRB A;  3GTP J;  1FEX A;  2XB0 X;  4D5F A;  3Q0V A;  4QTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...