1LFBA

The x-ray structure of an atypical homeodomain present in the rat liver transcription factor lfb1(slash)hnf1 and implications for dna binding
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
RFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords LIVER TRANSCRIPTION FACTOR (LFB1)
publication title The X-ray structure of an atypical homeodomain present in the rat liver transcription factor LFB1/HNF1 and implications for DNA binding.
pubmed rcsb
source organism Rattus norvegicus
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1993-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1lfbA00
4MFDA 2JA8J 5EYRA 5F27A 5EEAA 1X2NA 1ETVA 4HNVA 3QQAA 4G12A 1BA5A 2OPTA 2L7MP 1UHSA 4A3CJ 2Y30A 1ZGWA 4C3JJ 2H1KA 3A03A 1JJ8C 3PO2J 2JMWA 1GVDA 3QPSA 1LFUP 1JGGA 1TWFJ 1ITYA 3HDDA 2JJ7A 2GLOA 2XGDA 1I6HJ 1MBFA 3PM1A 4MFEA 1I50J 3DEWA 2HXOA 5E3LA 1LE8A 2DN0A 3HM5A 5IP6A 1PUFB 3QPLA 1WGXA 3BR1A 5IYCJ 1EF4A 1DU0A 1BW5A 4BKXA 2DMQA 4A3FJ 1APLC 2CRGA 4A3IJ 1B8IA 2R5ZA 2M2EA 2MG4A 2Y31A 3HGGA 3S1MJ 3HOYJ 1MSEC 2Y0SN 3BG9A 2FX0A 4D5FA 2DA3A 4M3DA 2WAQN 1A6IA 2ZB9A 1WI3A 3GTOJ 4JP0A 3L1PA 3OSGA 1JT0A 3A02A 2EZLA 2O9LA 4UUTA 2XB5A 1X2MA 2CUFA 3ZQCA 1H88C 3BR2A 4RBOA 2YU9J 4NDLA 1B72A 3BQZA 1U9NA 3LSRA 4Y7NJ 2OF7A 3FK7A 2NVXJ 3HOVJ 3GTKJ 1GV5A 1Y1VJ 4CYCB 2R93J 2LLKA 3K7AJ 2IAIA 2DA2A 4BY7J 2NS7A 3CDLA 4A3GJ 3LNQA 3JRCA 4XRMA 1MBKA 2HOAA 4V2GA 1VI0A 2ECCA 2E19A 1O4XA 3LSJA 4V2FA 3JRDA 2ME6A 1CQTA 3K2AA 1ENHA 3HB9A 2HYJA 3O8HA 4A3EJ 2D5VA 4L5EA 1JT6A 1HOMA 3UKGA 4Y52J 2XPVA 4W97A 2VKEA 3HOWJ 3B6AA 5EF6A 1GT0C 2IEKA 1U9OA 2EZKA 1RPWA 5E3MA 3TEDA 2TRTA 1ZR2A 1RESA 5EZHA 4UUSA 1ETKA 1QRYA 2EZIA 2R5YA 2LTPA 1P7IA 2CQQA 5IOYA 1TWAJ 5IPAA 2XPUA 4M6VA 3CMYA 3NAUA 4C3HJ 4I76A 2E1OA 4M3FA 1AU7A 1MNMC 4A3BJ 2JK3A 1RKWA 5DS9A 3HOZJ 4LOCA 1QVUA 5J1UA 2LR8A 2CUEA 1ORKA 4IHYA 2L7FP 5GPAA 5EG0A 4EEFG 1WPKA 1ETQA 5EDNA 4A3DJ 2GM4A 3BG3A 1P7JA 1IDYA 4D7NA 1AKHA 2NS8A 3C2BA 2DA7A 3M3YJ 5J3LA 3D1NI 3S16J 1VFCA 5C3EJ 3PO3J 5K7FA 9ANTA 3LSGA 2M8GX 1RKTA 1XC5A 5M3FJ 4J19A 3HOUJ 2L9RA 1JKRC 3IH4A 2R7ZJ 1K61A 3S2HJ 3SJMA 1JKOC 4A3MJ 2MW8A 5EGOB 2DA6A 4XICA 1LFBA 2FQ4A 2LP0A 2H8RA 1Y1WJ 2CU7A 2DMTA 4BBRJ 4I6ZA 1JKQC 1G2HA 2JA7J 1SANA 4W1UA 2DTZA 5M5YJ 2HQ5A 2HI3A 4QTRA 2XPWA 2HOSA 3A01A 3OIOA 3Q3SA 1MBJA 3MKLA 1SFOJ 3HBLA 1W0TA 1IRZA 3G1LA 4BY1J 1WH5A 4D7MA 3I4MJ 3BTIA 2LD5A 2NVTJ 1JUPA 5F08A 4AC0A 5GPCA 4DYQA 4M3GA 5C4JJ 1JKPC 2DA1A 3OOUA 3VPRA 3S1QJ 1JUMA 1S7EA 1T56A 2X9DA 5FKMA 3S14J 1MBGA 2W48A 2B63J 2R92J 1OCPA 3ZQIA 2PMZN 1Z77A 2LK2A 4DZJA 2ELKA 4JX5A 3S1RJ 2JWTA 4XK4A 1YRNB 2JN6A 3ZQHA 2YS9A 1HCRA 2XB0X 1QPIA 1ZQ3P 4A3LJ 2ID3A 1IC8A 2O7OA 4M3EA 4DYRA 1OJLA 5BNGA 2IBDA 1IG7A 4S0HB 4MO7A 2LFBA 5EG0B 2O8KA 1UMQA 2GBYA 1U8BA 5HODA 3DCFA 2XSDC 4BXXJ 2WV1A 4JYKA 1MBEA 1XS9A 3B6CA 5FLMJ 1NK3P 1H89C 3Q0VA 3IH2A 3I4NJ 3BT9A 3FK6A 5C4XJ 2G0EA 1OFCX 2MGQA 5IOZA 3Q0UA 1ETOA 2VKVA 3W6VA 3JRGA 5EZGA 4A3JJ 2DA4A 1FTTA 3JRAA 1ETYA 1HDDC 4XIDA 5FJ8J 4GFBA 1MBHA 2XRLA 4BBSJ 1LE8B 1QVTA 3BQYA 3GBGA 2QCOA 2DA5A 4RDUA 1FEXA 4AYBN 5FKLA 2VPRA 1B8IB 2R5ZB 2EH3A 4A69C 4IEJA 2MSYA 4FE7A 4XRSG 2EZHA 1XG1A 2DJNA 4FISA 3FKIJ 4FCYA 3O8GA 1D5YA 3BR0A 1VF9A 5J1RA 5E3NA 2I10A 1OCTC 1WCMJ 1K83J 1MH4A 2E2JJ 4IHXA 2M9HA 3BR5A 2Y2ZA 3RZDJ 3GTMJ 2Y9YA 2JA6J 1FIAA 4ABZA 1RETA 4JX4A 1IGNA 1TWHJ 1NK2P 1F36A 2L7ZA 1Q1VA 3JRHA 3H3VK 2X6OA 2HXIA 4C3IJ 3JRBA 3BR6A 5C44J 3TP3A 2HOTA 5IYBJ 2DMPA 1B72B 2LY9A 1FJLA 3S1NJ 1Z0XA 4DW6A 1I3QJ 1MSFC 3BTCA 5M3MJ 4B3AA 3WHCA 2P81A 1MH3A 1JTYA 1IV6A 4A93J 2AO9A 4JX6A 2DMNA 1IUFA 4DYCA 3G1MA 1E3OC 1DU6A 2LVSA 1ETWA 2KDZA 3BTJA 2K9NA 5F0HA 3TW7A 3RKQA 3S17J 4X6AJ 5GP9A 2ME0A 1ZTRA 3F0CA 1ZR4A 1GDTA 1HDPA 2L0KA 3GTGJ 2E2IJ 1TWGJ 5JLWA 3S2DJ 5IP7J 5F0CA 2K40A 2X48A 4MIMA 5F04A 4AUXA 3ZOBA 3BR3A 1GV2A 3WHBA 1UG2A 2NOGA 1POGA 2NVQJ 2TCTA 5K7HA 3CQZJ 4FTHA 2Y9ZA 3IH3A 1WH7A 4UUSB 1F43A 5IYDJ 2XGCA 3HEFA 3TW6A 2AHQA 4MLOA 2R5YB 3GTPJ 2YUSA 5FLVA 2M0CA 5FKOA 3TP0A 1A5JA 2NVYJ 3HKZN 3Q0WA 2RAEA 3RZOJ 3FIWA 2ECBA 2FD5A 2VI6A 3GTJJ 1U78A 4QSHA 5F0FA 5JLXA 3HGYA 5EGOA 2EBIA 4A3KJ 1PUFA 4IHWA 1JUSA 4B1RA 1TC3C 3CCYA 1NTCA 3RQIA 1R9TJ 1AKHB 3GTLJ 2HDDA 3MVPA 3GTQJ 3ZQFA 4XRSA 2JA5J 2EQRA 3JREA 5M5WJ 1ETXA 5K7ZA 1GUUA 3NARA 4QIWN 1AHDP 2K9SA 4IHVA 1IDZA 1HF0A 2LKXA 3FISA 3MN2A 3HOXJ 3ZQLA 3E7LA 2XGEA 3G1OA 2CQXA 3JRIA 2E2HJ 2CJJA 2R0QC 5J1YA 3BG5A 1BJZA 1ZK8A 1TWCJ 1W0UA 3IV5A 1X58A 3BTLA 2QF7A 5IP9J 3JR9A 1JJ6C 2DMUA 2COBA 1HLVA 2VUMJ 1JTXA 1VNDA 1T33A 5FKKA 3LSPA 1IJWC 1H8AC 1ZKGA 4X1EA 1FTZA 3SFIA 2K9QA 5M5XJ 4CYCA 4DZPA 1YRNA 3ZQGA 2FJ1A 5DTDA 5FKNA 4M3BA 2N8GA 4B4CA 3A01B 3H0GJ 2WB1N 5E3OA 3OSFA 2KT0A 3M4OJ 1RR7A 1FIPA 5F1JA 1BW6A 2M34A 3LOCA 4FE4A 2ID6A 3S15J 1BL0A 3JRFA 4D5CA 3SDGA 4C2MJ
chains in the Genus database with same CATH superfamily
4BYYA 1TZLA 1SD4A 4RM3A 5EYRA 4C30A 2V6CA 5EEAA 1X2NA 1ETVA 2QLZA 3QQAA 3VYUB 1G4DA 2OPTA 2WAFA 1UHSA 2LG4A 4RB3C 1MMNA 3WTSC 3SEQA 3A03A 4RLFA 1FBSA 3PO2J 2UXXA 3QPSA 3D5SC 1CF7B 4G6TB 4UXNA 1ITYA 2XVCA 1OKRA 2E71A 4ITVA 1E0EA 2XGDA 3U2RA 3I9V2 2UXNA 3PM1A 3PUBA 2WWYA 4OINF 2M7AA 3K9TA 1QNTA 1YS7A 2V4JC 2HXOA 5E3LA 1R22A 2DN0A 2ZXHA 1WGXA 5IYCJ 2OCCH 4HYEA 4OIRF 3DBLB 2WAEA 3G4SI 2R7SA 4EGYA 4XKBA 2CRGA 4A3IJ 1B8IA 3ZMZA 4F3QA 3TBIA 2MG4A 2K4BA 3GVAA 1RC9A 2P8TA 5D4SA 3HGGA 3ZPLA 4ZDOA 3P9IA 4WCGA 1ZARA 4XN3A 3HL2A 3ZP5A 1WRJA 3DF8A 4PSWA 4AIKA 3E0JB 2CQNA 3K10A 2M4GA 1F1ZA 3Q9SA 2IGMA 1X1CA 3FXLA 4PK4A 1WI3A 1TNTA 1V5GA 4IL6C 1TL8A 3GTOJ 1T08B 3OSGA 2MFZA 4LLGF 1WJ5A 2WV0A 1UHWA 2GZWA 2Z2SB 3TO6A 2MH9A 4NUBA 2X51A 1VQ9I 3BQZA 4IPAA 2IS4A 3WU2C 3LSRA 4I0AA 4A0ZA 2RC4A 4Y7NJ 4LGWA 2DOAA 4KDPA 2NVXJ 5AONA 4B09A 1Y1VJ 2J5PA 4CYCB 1FOXA 2ZSIB 3DWLE 1YE9A 3C7JA 1XD7A 3OR1C 1J5YA 4CO8A 3BC8A 1KU7A 3L00A 3LNQA 1MBKA 3WTYC 1USSA 2ZO4A 4V2GA 2DT7B 1B9NA 2E19A 1O4XA 1KU3A 2KJCA 1WZ2A 2HTSA 3JRDA 5FD6A 1XGNA 4IX7A 3EYYA 2DPDA 3CUOA 2D5VA 5D6FA 3UKGA 3IKVA 3VDXA 1QA6A 4Y52J 4B47A 3LSMA 2WBMA 3QAHA 2F4OB 2O8XA 4M74A 4C2MJ 2W7NA 3K4MA 5EF6A 2WY8Q 1YI2I 5D8LB 1VTNC 1I27A 1AOYA 2TRTA 3KP3A 1ZR2A 1RESA 4E7SA 3I54A 4XM3A 1QRYA 2G9WA 3SDBA 3BG7A 2R5YA 3VWBA 1P7IA 2XPUA 3CMYA 5FROA 3FF5A 3NAUA 4M6YA 2XIGA 3VODA 2MA3A 1JHFA 1G3TA 2FQ3A 1BI3A 3HG9A 3QYBA 5DS9A 5CPRB 2LR8A 4PZJA 4AIJA 4DBQA 3PSIA 3KYCB 2OU2A 2ZC2A 5EDNA 5KHDA 1H9TA 1IDYA 2VL8A 1AKHA 2V1XA 2NS8A 4OAYA 4UHTA 3N05A 5E79C 1YTYA 9ANTA 2A6TA 3TO7A 5DDGA 2BYVE 4A6EA 3DTEA 4L5JA 2IJLA 2VXZA 2X6XA 2DFEA 2L9RA 2NYXA 1JKRC 2UWMA 2PN6A 1HW1A 3ABKH 5F1RA 2GOMA 3LWFA 4DOZA 3MZHA 1YJ9I 1JKOC 4BJ5C 1RUOA 4OIPF 4XLPF 4MTDA 3PFIA 5GTIC 4AVZA 1LFBA 2QEXI 4KIGA 2LMDA 3H92A 3K1MA 4BBRJ 4I6ZA 4F93B 1G2HA 1MKMA 2JA7J 1Z1DA 3KP2A 3ESWB 1LFPA 1S5LC 2G7HA 4QTRA 1SVMA 4G6DA 3CMEI 3Q3SA 4BHBA 1MBJA 1W5TA 4HQEA 4KIBA 3I4PA 2PJRB 3WTTC 2JZYA 4Q4ZF 1B9MA 2QSFX 1UG0A 1WH5A 4D7MA 3K4LA 4WWCA 2VLAA 3I4MJ 4OU0A 1JUPA 1DPUA 1A04A 5C4JJ 3OOUA 1HW2A 5LEKA 1Z3XA 3E6BA 1ZAOA 2X6WA 4I0BA 4RGSA 3S14J 3H9GA 4BJTA 3ABTA 3OR2C 3O6BB 1A31A 2QSHX 2PMZN 1IZ1A 2W85A 3EDPA 2IS6A 2LK2A 4MQVA 4ZZLA 5LGUA 3B73A 3DTIA 1YHQI 1S9HA 2BBYA 2LREA 5H6RA 3ZN0A 2Z3YA 3ISPA 1CF7A 2HQNA 1R36A 2XASA 3I59B 4NC7A 4CCNA 1UJ8A 3OYGA 2LRDA 1ZQ3P 3TGNA 3LA7A 5JVTA 1IC8A 4XOTA 3T8RA 3OYLA 3U1KA 4KN7X 4DYRA 4CCMA 2IBDA 3P9CA 2O8KA 3WGHA 2GBYA 5ICFA 3H1CA 1QU3A 3MKWB 2XSDC 5EJCA 4HDVA 5FD5A 2GA1A 5FLMJ 2ETHA 3OL3A 1H89C 3OYNA 3IH2A 3WODF 1P6RA 1W5CC 3DLAA 2VKVA 5IT9Z 3R0JA 3GWZA 3FXMA 1UELB 4E6KG 1ETYA 2WADA 1VQ4I 2OBPA 2C6YA 3BQYA 1G3YA 3GFIA 2QCOA 2DA5A 2HOEA 5FGMA 5GAHJ 1R7JA 1EH7A 2FU4A 1FEXA 3V7CA 4G7HF 4A69C 3JAMK 4FE7A 4GDFA 2EZHA 4BQNA 1XG1A 3GW2A 4RMNA 1D5YA 1D1CA 3HPGA 1VF9A 5J1RA 2I10A 1B59A 1R4MB 2HVRA 3HPHA 3MMYB 5BPDA 2Z99A 1MH4A 2EK5A 2E2JJ 1RZ4A 1QZZA 1XGSA 1XCBA 1MMDA 1RI7A 1FIAA 2EB7A 3S3MA 2B9SA 3JSOA 1ZH5A 1MJBA 1F36A 2KMUA 3E5XA 3RPQA 3JRHA 3RI4A 3DPTA 4EJWA 2X6OA 3LL7A 2VXDA 2M87A 2L9VA 1XSXA 2P4WA 4XN0A 4EJOA 1K4TA 3GX4X 1BOAA 4C3IJ 2DMPA 1B72B 2RVCA 2HKOA 2LKSA 1I3QJ 3BTCA 4UB8C 4NHJA 4DGWB 3RTRA 2H09A 3GFMA 4O6JA 4Q5SF 4HAMA 4UVCA 3SZGA 3TKYA 2ESNA 1IV6A 4F52A 2BE5F 5LRSA 1K79A 3G1MA 2Y0MA 3HUGB 3RJPA 4CCOA 4E7ZA 2DFIA 5ICEA 2BV6A 2KDZA 1MIJA 3I56I 1IN4A 3CF5F 2UV1A 3RKQA 4FX0A 1SFEA 2Y75A 1Y39A 4ETSA 4IRHA 1ZTRA 3F0CA 1ZR4A 3E1SA 3PJRA 4KMUX 5LGTA 5FB2A 2XC7A 3J7ZI 5IP7J 3DEUA 2QGUA 5F0CA 1S72I 4FASD 4FQGA 4L18B 2X48A 4MIMA 3HZJA 4DQ2A 3ZOBA 4IZZA 4BNCA 3BR3A 4KYWA 3WHBA 4GXOA 4EQQA 1POGA 5E17F 1KYZA 1DQUA 2NVQJ 3MAJA 2Y9ZA 2L9SA 1ZLJA 3IH3A 4Q48A 4HOBA 5LBQA 1F43A 5IYDJ 1R1UA 1VQLI 3TW6A 4MLOA 1XB4A 4FX4A 2J5OA 4HNTA 1OYIA 5FLVA 3TP0A 4E4HA 3P9KA 2ECBA 2FD5A 4EJTA 1T0FC 3QWLA 1UFMA 5F0FA 5JLXA 2ZXJA 4PFPA 4A3KJ 2IS1A 4IHWA 1TTYA 2H94A 2KIQA 1U8RA 1D3YA 1FMVA 3L2VA 3H3ZA 1R9TJ 1Z9CA 2EJRA 3D0SA 1ZREA 2HDDA 3MVPA 3SZPA 1BM9A 4XRSA 3NEUA 2E34A 2HTJA 2CV1A 1ETXA 3JCUC 1OCRH 4QIWN 1MGTA 2YR2A 4DIQA 2HNHA 2ZJPF 1MW7A 2PJRA 5CVRA 2LKXA 5B3SH 3JW4A 2MLKA 2H27A 2E2HJ 2CJJA 4J01A 5J1YA 3IL2A 3LAJA 1ZK8A 3WTUC 2QQ9A 1X58A 2YX7A 5LLQA 1JJ6C 3CCSI 2FBKA 1E3PA 2FE3A 1T33A 2DAOA 1H8AC 1BN5A 1FTZA 5H6QA 1GXPA 1Y56A 4KT6A 2X1CA 3GYHX 4DZPA 1D1BA 1U5TC 2PJPA 3JSPA 3ZQGA 1XDUA 2L4MA 3I59A 2N8GA 2D1HA 2WB1N 4A0XA 2HVSA 5E3OA 3OSFA 2R7QA 1SAUA 1C0WA 2KRHA 3H9JA 4BE1A 1W36C 4XLEA 1ZRDA 1BL0A 4D5CA 2LYCA 3MKZA 2K4JA 4R1HA 4E7HA 1ZRCA 2JA8J 5KNLA 2V26A 3PIPF 2A69F 2KIMA 4L5IA 4B43A 2M0MA 4HDUA 4G12A 3LSKA 1BA5A 4D9JA 3F8BA 1I5ZA 1BR2A 1ZGWA 3H36A 3OYKA 2M7BA 1OMIA 1W36D 5HNFA 4HV5A 5F6FA 4I7HA 2XAQA 5ICGA 1XMKA 2A5YB 2F48A 2LF7A 3HDDA 2JJ7A 1J2XA 2F4IA 3WG7H 1MBFA 2L54A 3WG9A 3F22A 2IA1A 1I50J 2KFDA 3VFZA 1KONA 3G6EI 5IP6A 5DUKA 1PUFB 3SXYA 4BEHB 1EF4A 3BR1A 5DM7F 2W00A 4D1QA 3EUAA 2EFQA 3HRTA 3K6GA 1DU0A 1BW5A 4M6XA 1XDSA 2ZXIA 2OZUA 4BU2A 1ZHFA 2F5CA 1L3LA 3J7AO 4EJUA 3V4GA 2RDPA 2YPRA 4F55A 2KRCA 2IGKA 3HOYJ 1MSEC 2Y0SN 2GA2A 2FX0A 5E1ZB 4D5FA 3W3CA 3KZYA 1WWXA 4C9YA 2F5VA 2F5DA 4YFNF 2DA3A 2YX4A 3P5JA 2QM3A 4PJ0C 3V8KA 1FOYA 3A02A 2EZLA 3CO6C 4E7KA 1QO0D 1ZELA 2PMHA 4RGRA 2Q8KA 3LSTA 4ANJA 4MEYF 4RBOA 3IUOA 4NDLA 2VE9A 3CCLI 1B72A 1Z7UA 2Z9OA 5K5QA 1T8IA 2OF7A 1Y8QB 5L3FA 4CZZA 5JI6A 2MC4A 4RGXA 2VKHA 4HW0A 2KIUA 2L01A 1VQNI 1MD0A 2AXLA 2R93J 4U88A 1Y6IA 4QWQA 3HUGA 2KJBA 4EGZA 4BY7J 4BE2A 3AL0B 3F72A 3GF2A 3FXJA 3CDLA 4HNUA 4XSXF 1WFXA 1UHMA 4XRMA 2HOAA 1R6RA 4YG2F 4BQAA 4L9NA 2O61A 2E5NA 3RSNA 4KN4X 4YRVA 3AG3H 2ECCA 3DKYA 3HHGA 4AIHA 4CDGA 1IN6A 2VJ4A 1AWCA 5E20A 2V7FA 2QQBA 4E7LA 3HXLA 1ENHA 2JPCA 2R7DA 3HB9A 1G3WA 4CICA 4A3EJ 1FSHA 2GOXB 4L5EA 2EFWA 5FFXA 3DV8A 4PDKA 1U5TB 2R7FA 2VKEA 4BXFA 3REOA 1U3EM 4E7IA 1IF1A 3LSIA 3B6AA 1GT0C 3GUDA 4LMYA 1YS6A 2HWVA 1VQMI 2MD0A 1RPWA 5E3MA 3TEDA 1ERDA 1E2XA 2JSCA 4KJZA 2YSRA 1ETKA 4HQMA 5D6EA 2LTPA 3HRUA 4IF4A 4M6VA 4ON0A 1RNLA 4G94A 5JVGF 5HOOA 2XROA 2RKHA 2VT2A 2E1OA 4XRFA 4U0VA 3L2QA 1RKWA 3HOZJ 4GCVA 5HVQC 3DEEA 3PSFA 4BS9A 1ORKA 1ON1A 2RGVA 3A0BC 2DT6A 1V5FA 2QVOA 4UVBA 5EG0A 4NB5A 3RKYA 4EEFG 1WPKA 2FNAA 2GM4A 4D7NA 3QPTA 2EIMH 1SC7A 2Z16A 1IAWA 3C2BA 4LG0B 3ZMDA 2BHYA 3D1NI 3CLQA 3W6JB 3S16J 5C3EJ 5K5RA 5K7FA 2IGNA 3OYHA 1RR8C 3LSGA 2MABA 3L7WA 5FLXK 1I6XA 4HSTA 4L0ZB 3FX3A 3A0HC 3RCOA 2LY1A 3ZMUA 2EA4A 3HOUJ 1V55H 3CESA 1O3QA 2R7ZJ 4EATA 4KIFA 2ISYA 3S2HJ 2DDAA 1K78B 4V19K 2PFBA 3C2HA 2MW8A 3BY6A 4HG2A 5E18F 1WSUA 2V1DA 2FQ4A 2LP0A 3JTHA 1WQ2A 1A35A 1OR7C 1Y1WJ 2CU7A 3W2WA 4A5MA 4PSXA 4BHPA 1EA3A 1LUJB 3WTWC 1XPXA 1SFUA 1JKQC 1SANA 4W1UA 4Y15A 3BROA 1DP7P 3O2PE 1JHHA 1HSJA 3E6DA 5EEGA 2HI3A 1T6SA 2WAQA 3ZR8X 2MYSA 4ENJA 3K4CA 4RM2A 3OIOA 4U0YA 2LC2A 1W0TA 1DUXC 1BR1A 3IWZA 2LD5A 1HW5A 2QZ8A 2LOOA 1X3UA 3AKZA 4M3GA 3CCQI 1JKPC 2IRFG 1Y0NA 1Z6TA 2DA1A 4BQOA 3OS0A 3S1QJ 1MMSA 2WY7Q 1YW8A 2ZMEB 5DCMB 1IRGA 4ESBA 4BDYA 1HKSA 2X9DA 4A12A 4ZYGA 2PMZA 1JE8A 3LAPA 1MBGA 3E6MA 4HV6A 3ZMTA 5HNHA 1I1GA 1EH6A 4A2UA 3C3WA 1OLTA 4II2A 4BXUA 4EV0A 4LG3A 2NNYA 4XK4A 3W2VA 4IQ4A 2JN6A 2IT0A 3RPUD 3H5AA 3OYBA 1QPIA 2E60A 2V6EA 5IT9K 4M3EA 1DDNA 4XNFA 1BC7C 1YITI 3KIOA 5BNGA 4YFXF 4BEHA 3DKWA 1B6AA 1T38A 3K1NA 2LFBA 1QBJA 1TT5B 1LKXA 3BZ6A 4JYKA 1SD5A 3B6CA 4CZCA 1X1AA 3OS1A 3H9QA 3Q0VA 2H1LA 1IXRC 2M30A 4QPOA 1D0YA 3FK6A 2IA0A 1REPC 5C4XJ 2XHKA 4H4KC 5D4RA 2MGQA 3QU6A 1XMXA 5E8GA 1ETOA 1T0FA 1SFXA 3GFLA 5DCFA 4NQWB 3JRGA 4HLYA 1T95A 5J8FA 2DA4A 3CLOA 2FMLA 1N25A 3DPLC 1OYYA 4U7BA 1ULYA 2BGCA 1UB9A 2DT5A 2A3SA 2XRLA 3E97A 3FM5A 3M07A 2OJED 2FRHA 5DEQA 3Q9VA 5KAIC 2OA4A 1QVTA 3AG4H 3GBGA 4C2TA 2CV0A 1Z05A 2P5KA 2OTLI 4LLLA 4DJAA 2NVUB 1VZ0A 2VPRA 3KFWX 4CCJA 2VODA 3BCBA 2V1NA 2R5ZB 2RNJA 1J7KA 3FBIB 2M4KA 2EH3A 2DOEA 4IEJA 2MSYA 1JGSA 2L4AA 4HA8A 3GMEA 2FXAA 1Z7LA 2BOLA 2BVMA 4Y17A 1FOWA 1WCMJ 2DYSH 1K83J 3DU6A 3EUHC 2HPIA 3V8LA 3RZDJ 2HYGD 1FP1D 3WGIA 2VB6A 1NH3A 4JX4A 1NG7A 1SAXA 1TWHJ 1NK2P 4XL9A 2L7ZA 2UUZA 1H0MA 4A5NA 2VT3A 5HLTA 5GADJ 1W5SA 2LDUA 3BR6A 2JTVA 5C44J 1TQMA 2EIJH 3P7NA 5DYMA 3I71A 4WX9A 1U5TA 3S1NJ 3TDUC 3ZCOA 2XDVA 1MSFC 4F92B 5J6XA 3WHCA 3EPZA 1P92A 1LEBA 1K6OA 4A93J 4DYCA 3PQKA 2LVSA 1MDMB 5F0HA 2X85A 2HEOA 3S17J 3E5QA 4EVIA 1L0OC 5GP9A 3OYEA 1FOKA 1A6QA 3H5NA 3I64A 3UR3C 2R7UA 1ZRFA 3CCJI 2L0KA 2BY1A 2VJ5A 4RLQA 3S32A 4AUXA 3S3OA 1SEUA 1GV2A 4LG0A 2NOGA 2ZXWH 3E3VA 3BZCA 1SMTA 3W6KB 2R3SA 5K7HA 3KP7A 4R79A 4Y3OA 4UUSB 3TMOA 2KISA 3OMYA 2HDCA 2VPLA 2YUSA 5HS9A 4UNOA 2M0CA 5FKOA 4B8XA 2E1NA 1D8KA 2RAEA 4L9TA 1T98A 2BXYA 3EUKL 4OOIA 1K78A 5HDNA 2VI6A 3NWSA 1U78A 2CFXA 3K2ZA 3UNGC 5A2QZ 3CJQB 3OYJA 3OYCA 2DCEA 4P9UA 1H9GA 2OV7A 4UV8A 3RQIA 4BH9A 3PIOF 2OTJI 3GTQJ 5J4YA 3BWGA 2BW3B 3HJEA 2EQRA 3RKXA 1XMAA 2RQPA 2NNNA 1AHDP 4EM0B 5DD4A 2CH0A 5CVVA 1HF0A 2V1UA 1DGRM 3ZQLA 2EV6A 2KLOA 2XGXA 1YG2A 3OIPA 3DBHB 4EMSA 3G1OA 4IRGA 2CO5A 3WGGA 3JRIA 3F21A 2HPMA 1UAAA 4XKVA 2GXGA 5DCMA 2KRFA 1W0UA 3OY9A 4PJLA 1DPRA 1X1BA 5ED4A 3JR9A 3PNTA 3BCAA 3GEZA 1YIJI 4AU7A 2VOPA 1QHHD 4IHSA 3IP4B 1LJ9A 1HLVA 5ICCA 1JTXA 1VNDA 1BR4A 2Q2EB 5FKKA 1R1TA 3LSPA 4MNUA 2IA2A 5D5XB 1ZKGA 1YW7A 3FXQA 4IOCF 2IPQX 3TOBA 1R49A 2FOWA 2K9QA 1EH8A 4PJJA 2WB1A 4CYCA 2DFFA 1TW2A 4M3BA 4B4CA 3A01B 1ZGJA 2ZFWA 2HYFA 5HDGA 1TBXA 2W82A 3HTSB 3M4OJ 3QP5A 1RUNA 3BOQA 4GO1A 4EM2A 2RN7A 3DKXA 3KP6A 1XGOA 1BW6A 2EWNA 2Y69H 2M34A 2X1DA 4FE4A 3OL4A 3C18A 4HRIA 3VSLA 5CVUA 4Y13A 1YO5C 2NOJB 3BPXA 3BJAA 1R5GA 1JXSA 2ZNZA 4M73A 1MMAA 2EINH 2V9KA 5ILSA 3L2CA 3ASNH 1VQ6I 2EFOA 1WJEA 3OYAA 2K9LA 4UY8I 2VQGA 2L7MP 1XX5A 2A68F 1MNEA 5E1WA 4A3CJ 4D0PA 1QZEA 4ZC3A 2RREA 4CYDA 2H1KA 4UUVA 1FWZA 4Y33A 1RRJA 1JJ8C 1S6LA 2JMWA 1HKTA 3CDHA 1LFUP 2I8DA 1JGGA 1YIOA 4NQWA 4M71A 4II3A 4WXHA 1I6HJ 2KHMA 1HSTA 3IC7A 4KUMA 3F8NA 1XSVA 3QYFA 3L2RA 3KEOA 4MFEA 3DEWA 3AG2H 3VYTB 4N4OB 4GGGA 2COMA 4H0EA 3IWFA 1IXSB 1S8NA 3QPLA 1UZCA 4A3FJ 2X4HA 3CCUI 3MQ0A 1J59A 1APLC 4AM3A 2Q1ZB 3BLYA 3KYDB 2R5ZA 1J09A 2M2EA 4BUPA 5LRRA 3LQRA 2Y31A 5L3BA 1HKQA 2CUJA 3S1MJ 2P6TA 3J80Z 1LB2A 4C2UA 2H6BA 3VYRB 3KP4A 2LBFB 2NS0A 2V79A 3FHZA 4M3DA 2XF6A 4N9HA 3CZ6A 2K27A 2DU9A 3FKJA 1GVJA 3T0YA 3U21A 3HKZA 3OV8A 3HSFA 4XLHA 2ZFUA 1OISA 3CO7C 4Y4RA 4X0GA 4UUTA 2XB5A 1X2MA 2CUFA 1OR7A 5KAFC 3BR2A 4CXFA 5K1YA 2YU9J 3NWTA 2LSOA 3QOPA 3OYMA 4K2EA 1SVLA 4FETA 2V9VA 3FK7A 4ENNA 2L2OA 1NHAA 3LA2A 3HOVJ 2FBHA 1QZYA 2LF8A 3FMRA 4Q47A 1U2WA 3GZ6A 2BXZA 2E35A 2IAIA 4NC6A 2DA2A 4G6QA 3ECOA 1BOBA 3FHNA 4IO9F 5F64A 4A3GJ 4XQFA 3ROUA 2E1MB 3JRCA 1UCRA 1P9QC 3HYIA 2DYRH 4ZTJA 2OD5A 1NG6A 3RPUA 2ESHA 1LDJA 4XBFA 1LNWA 4ZH4F 1KU9A 2ME6A 2WA0A 3H5RA 1CQTA 3AFHA 2K5CA 3AL0C 2HDWA 4RB0A 5TGTA 2F2EA 4YIIA 2ICWG 2HYJA 2RQQA 3WTZA 3LSHA 1JT6A 3J81Z 2AQFA 2XPVA 4W97A 4WXCA 2ZSHB 3ZQQA 2X0LA 2K9MA 2Z5UA 1PUEE 4NNJA 5LHHA 4HBLA 1KZHA 3HOWJ 2IEKA 3D5LA 1OPCA 2L5QA 4I99C 2QUFA 1TNSA 5EZHA 4UUSA 2XAFA 3QPHA 1G6NA 2R7WA 3KPHA 3KCCA 2EZIA 1R4NB 2DK5A 5ERIA 2AS5F 3F23A 1YJWI 1KQ0A 3HOSA 4AVPA 2CUZA 2ACJA 3T8TA 4PUSA 2QKMB 2DO7A 4I76A 3M8JA 2OUMA 3A2KA 4LD5A 1MNMC 2JK3A 3WE2A 3B02A 3FXKA 5J1UA 1RIOH 1TQPA 2CUEA 4IHYA 2HQRA 3ASOH 1R71A 2HQAA 1ZLKA 4A3DJ 1P7JA 3ELKA 3CCMI 2ZCWA 1TW3A 1FBQA 5J3LA 1F9NA 2BW3A 3WE3A 1KQ9A 2L9NA 4LK1F 3ULQB 4P1WA 2CYYA 3V8JA 3PO3J 2F6CA 1WJFA 2K02A 3ABUA 2BY2A 1SD6A 2BVLA 2HKXA 5GAEJ 2JRTA 2JRMA 2R7RA 3VSKA 2Z33A 3SYTA 5CQGA 5M3FJ 2ZJRF 1LDDA 3ZGKA 1K61A 5HS8A 3DP7A 4U87A 4RB2C 3FM3A 2ZJQF 1T39A 1Z91A 4MEXF 1V54H 2K85A 3RYRA 2DA6A 4XORA 3GFJA 4XICA 1S3JA 2Q2EA 2DQLA 3CUQC 2R7XA 3WU0A 2CV2A 4JBAA 2DMTA 1O3TA 3EUHA 4XKWA 4XOPA 1DU6A 4S05A 4KA4A 1TP4A 5M5YJ 2B7EA 2HQ5A 2CW0F 2NAZA 1XGMA 3HHHA 3CP2A 3K4BA 2HOSA 2O6GE 3A01A 1K6YA 4KICA 1HXDA 3HBLA 4YEJA 1YJNI 4KITB 3K1PA 3QOEA 4HF0A 4ZYEA 3BTIA 5E1XA 2HFHA 3LMMA 2NVTJ 3CF2A 5HLIA 4AC0A 5GPCA 4Z6YA 4I98B 2R7OA 1Y8RB 1JUMA 1T56A 2LKPA 5HDKA 3IAM2 3M1CA 3WTXC 2STWA 4I02A 2R4GA 5FKMA 1GHCA 2QENA 2W48A 1PP7U 1IW7F 1S7AA 2B63J 2R92J 2X6YA 1FSEA 1OCOH 4ZDPA 4GYIA 3F8MA 4DZJA 4WF2A 2ZMEC 4JX5A 3S1RJ 3FXRA 1V5EA 5B1AH 4YELA 2VBYA 4CH7A 4YFKF 1HCRA 2XAHA 4B3XA 4F91B 3HTUA 1HC8A 4A3LJ 3F3XA 1Z6RA 2I5UA 1XTAA 5D8KB 1OJLA 1HBXG 3FXUA 2VQHA 2HS5A 3GZ5A 4S0HB 4MO7A 3MCZA 2JPBA 3OYIA 3PQJA 3CTAA 4XKCA 1UMQA 3M7GA 1OCCH 3HC7A 3FMSA 2L7KA 3CDIA 3R60A 3ABLH 4UV9A 1FYKA 3CD6I 1MBEA 1XS9A 2A6EF 4E7JA 5B5EC 1NK3P 3CMAI 1TQIA 3BT9A 3QYEA 4G7OF 5CYVA 3K4JA 2G0EA 1WKMA 5IOZA 3OYFA 4BQQA 2PEXA 3PNVA 5ILVA 4EM1A 2ZBKA 3EETA 5EZGA 4A3JJ 1FTTA 4BL0B 1LPQA 4P96A 3M8FA 4ESJA 1D1AA 4XIDA 5FJ8J 1A36A 1MBHA 2RV8A 3ZN1A 4G8XA 3JRFA 4BBSJ 1IN7A 2A61A 1LE8B 5L3GA 5GAGJ 2DLLA 1LVKA 2PG4A 2DQRA 1YYVA 4RDUA 2W4SA 4UB6C 4AYBN 5J47A 1IN8A 4DNCA 1BIBA 2OCEA 3ZMVA 5J8CA 3I5UA 1X1PA 2BEOA 3S3NA 3K4KA 4XRSG 2MC3A 1O7FA 5IT3A 3FKIJ 1ONVA 2FA5A 3O8GA 3TL4X 2JA2A 3BR0A 1O3RA 1FYMA 3EYIA 2FOKA 3EQLF 1OCTC 1J0RA 3I58A 1R5ID 4IHXA 1FT9A 3BR5A 2Y2ZA 3GTMJ 3GZNB 2Y9YA 4GRIA 1FC3A 4ABZA 3K0LA 3BJ6A 3CC7I 5BS6A 1Q1VA 4B44A 1T2KA 2JVHA 3CUQB 1FLIA 3CJTB 3HIFA 3IKTA 2HXIA 3JRBA 1W7PD 1QPMA 5JHFA 2LY9A 3KEYA 3I55I 3W2AA 4YIRX 2VQCA 2VE8A 5M3MJ 4LJZF 3KZZA 4B3AA 2O0YA 5CLSA 4HPQA 4HSRA 4BDZA 3KP5A 2CG4A 2KKOA 3ML6A 2DMNA 1IUFA 1QGPA 2JUCA 1STZA 1ETWA 4CCKA 1G8XA 4EJVA 1IRFA 3TW7A 3ERED 4X6AJ 2HVQA 1OQYA 1BIAA 4WXDA 4OIOF 1GDTA 3PNYA 1HDPA 1HA8A 3R61A 2XAUA 3GTGJ 1QHGA 3CCRI 2E2IJ 1TWGJ 1FPQA 4L0YB 2QQ8A 2EILH 5A2QK 3A1YA 1LQ1A 2K40A 3MEXA 3COAC 3I53A 5F04A 1VQOI 2P0WA 3HSRA 5KCMA 1JI8A 1UG2A 4CUGA 2P6SA 2KIFA 3CQZJ 3SZTA 3HOTA 4FTHA 5KVRA 2HR3A 4AWXB 4ZZDA 5E8IA 4PGGA 3VEPA 3N97A 4WK8F 4ZYAA 2XGCA 1G59A 1K4SA 3NRVA 4J00A 5CQEA 3BPVA 4P5OA 1BI0A 5TJJA 3IRRA 3Q0WA 3L2WA 3FIWA 3RZOJ 4ZYDA 4LLNA 4M9XA 4BHCA 5LHGA 2TDXA 5BOXA 1PUFA 4JOMA 4IHTA 1ZG3A 3GCMA 3MWMA 3CCYA 1PVEA 5AIPA 4BE0A 1O57A 3ZQFA 2JA5J 4BGDA 5M5WJ 2XF7A 2F5FA 5K7ZA 3NARA 2HGCA 2K9SA 4M9ZA 4IHVA 1IDZA 5L3DA 5H20A 3FISA 3HOXJ 3E7LA 2CQXA 3F9KA 2XKPA 4GYGA 3RDIA 3I3LA 2R0QC 5EEHA 1ZG5A 2VQLA 1K7AA 2QKLB 2O03A 3HRSA 1ZG1A 2CW7A 1OYWA 3IV5A 4HLXA 1FYLA 1F4KA 3CCEI 2QYOA 2DODA 3BTLA 4IKFA 1MJAA 4OWRB 2COBA 1XSDA 3FBNB 1W7PB 3R6SA 4X1EA 3BJOA 3R4KA 3SFIA 3CMMA 1D8JA 2RNGA 5B1BH 2IVMA 1I1SA 4L9JA 2K3PA 3SEZA 2PX9A 1YX5A 3H0GJ 4DBRA 2FNPA 4IQJA 5HLHA 5DD8A 4XLFA 1SD7A 2KT0A 1RR7A 3CJNA 1IN5A 4HX4A 3LOCA 3DLLF 1E17A 3S93A 2ID6A 2VN2A 4LB6B 3S15J 2ZJ2A 4MFDA 3ZRGA 1YLFA 5F27A 4N0BA 5FRNA 1N75A 3F6VA 1YW9A 4HNVA 4ZTFA 3Q5FA 3FDYA 4MQ9F 1CGPA 2XKOA 2DDBA 2Y30A 2ADUA 4C3JJ 3OS2A 2LY2A 3J80K 1GVDA 2VJJA 3CC4I 2ELJA 1TWFJ 3G3ZA 4U7DA 2QA4I 1WJDA 5KK1A 3KYLA 2GLOA 2MD5A 4RGUA 2DK8A 2E7WA 4XLNF 2CGPA 4M72A 5LEJA 1I3AA 2PMUA 3K70C 3IRQA 1ZN2A 2P5VA 3RQ4A 1I39A 5L3EA 1LE8A 3HM5A 3R0AA 4A6DA 2DFHA 3K69A 2KQRA 3MZYA 3BZKA 1EJ9A 5L3CA 1M1EB 4BKXA 2VC0A 2DMQA 4F7ZA 2AXTC 2FSWA 2KP6A 4CHUA 1WJAA 2XAJA 4OAZA 2EPFA 1HQCA 4OIQF 4RA2A 3E5UA 4JQFA 5CJ9A 3K70D 3ERMA 5DV5A 2VBWA 2P7VB 5FLXZ 1X3ZB 2IW5A 3BG9A 2MBFA 2WTEA 1P4XA 1Z21A 2L3DA 5LHIA 3DFGA 2WAQN 4BACA 1BI1A 1A6IA 2ZB9A 4JP0A 3L1PA 1JT0A 2GXBA 4S04A 2GQQA 2O9LA 3C2GA 6PAXA 3CUQA 3C1DA 4PFOA 1YX3A 2GIZA 1AA7A 3TOAA 3G73A 3ZQCA 1P4WA 2GIVA 3OOPA 1H88C 4RAYA 2A07F 3DXJF 1R23A 1P4AA 2XAGA 2YU3A 2ISZA 4PJNA 1U9NA 1XCVA 3J81K 1IUYA 2EFPA 1LDKB 4MHGA 4N4NB 1U0JA 3GTKJ 1GV5A 2JVGA 3KEQA 4I09A 2LLKA 1FBUA 3K7AJ 3QODA 2FBIA 2M3AA 2HZDA 2NS7A 4ENKA 1J75A 5BQTA 1VQ8I 1D0XA 4JK1X 2LNBA 1IV8A 1QQIA 1VI0A 4AD9A 2MLGA 3AAFA 2M45A 3LSJA 1E3HA 4V2FA 2EFNA 4XSZF 1WI9A 5FRMA 1B4AA 2FMYA 3K2AA 5DM6F 3O8HA 2E1MC 2ZMEA 3WU1B 1HOMA 4IOAF 1V3FA 2XRNA 2CQKA 5BMZA 2D1VA 1OCZH 2XF5A 2DXIA 4IXAA 4O3MA 2UZKA 1KYWA 1U9OA 2EZKA 2FUG2 4B48A 5AIQA 2XSJC 2JSPA 2O5RA 2VOOA 2Y48A 4CA0A 2CSOA 2H8WA 2CQQA 2DW4A 1TWAJ 4UVAA 5IOYA 1Y0UA 5IPAA 4I2OA 4O5VA 3HRMA 3MZ8A 2ELHA 2FEZA 2HZTA 3ONQA 4C3HJ 3VB2A 1PJRA 4M3FA 1AU7A 4A3BJ 1VQPI 2JQ7A 4LOCA 1QVUA 1FY7A 2L7FP 5GPAA 3RYPA 2W84A 2Z1DA 2GXAA 3CP8A 1N78A 4YIFA 1ETQA 2NRAC 3BG3A 4MTEA 2STTA 2LH9A 2DA7A 3M3YJ 3GO5A 1KQ8A 3SQNA 3AG1H 2JUGA 1BI2A 3VYSB 4ASNA 1VFCA 1X3WB 1V4RA 2OQRA 2M8GX 3LFKA 3PFYA 5LFAA 3N4MA 1RKTA 1XC5A 3FXOA 2HU9A 4J19A 2P5LC 4LK0F 4KT5C 3IH4A 1MNDA 1YOVB 3SJMA 4A3MJ 3MKYB 5EGOB 4XONA 2JT1A 2MH2A 1W7PA 2H8RA 1VQ7I 2B0LA 2E1CA 2NXNB 1EKEA 2E7XA 1XN7A 2Y0SA 2DTZA 3DTKA 2XV4S 4FT8A 2DBBA 2L02A 2XPWA 4P55A 1LVAA 1F5TA 2VJIA 3MKLA 1SFOJ 2FF4A 4RAGA 1IRZA 3LA3A 3G1LA 3F8CA 4HX8A 4BY1J 4ZYHA 1P2FA 5F08A 4R8HA 3IHUA 3V7SA 4DYQA 2E5ZA 3LFUA 5GTHC 2DI3A 4NBQA 3VPRA 1S7EA 2ZKZA 3JTGA 3L9FA 5ILUA 1WHUA 1X4PA 4ENMA 2VIXA 1O3SA 1MJ9A 1ACIA 2VBXA 1OCPA 2EA2A 1X1DA 3ZQIA 1Z77A 4IJAA 5HLGA 1B1BA 4OMZA 2ELKA 2QBYB 3I0TA 3S2WA 2JWTA 3E6CC 1YRNB 3U9GA 3ZQHA 2YS9A 1BBYA 2DTRA 5H2FC 1DGWY 4G7ZF 2XB0X 3HSEA 3NQOA 4CSWA 4ZJZA 2ID3A 1MDMA 2O7OA 3F8FA 4MGRA 5D5WB 1YQAA 3BDDA 3MFKA 3KLOA 3DPUA 4PCQA 1IG7A 2DPUA 2K86A 1IXCA 1SMYF 1FX7A 1N77A 5EG0B 3M8EA 5LD2C 2IGOA 3BP8A 3FMQA 4A0YA 1FNNA 1U8BA 4RAZA 3RIRA 3DCFA 3IAS2 5HODA 2WV1A 4RB1A 4BXXJ 1Z3YA 1G3SA 4ESFA 3KZIC 3OYDA 3I4NJ 2O3FA 2XUBA 1ZYRF 3X2QH 2DJIA 1OFCX 5D5VB 5JHUA 3Q0UA 2ZNYA 4CCLA 2OZ6A 2EV0A 2EIKH 2F4MB 3W6VA 3V7RA 2KZVA 1D0ZA 1MZBA 3JRAA 1HDDC 4GFBA 1GXQA 1J9IA 2VASA 5CVJA 3SFZA 5D5UB 4AYBA 4NC8A 2PBIA 3FZVA 1O7LA 3MD2A 5FKLA 3PUFA 4HX7A 2DOFA 2VBZA 1B8IB 1TT0A 1PP8F 2DJNA 4FISA 4FCYA 4IRIA 1S29A 3T5XA 2KDOA 3TQNA 5E3NA 2QSGX 4LB5A 4M9SA 3U1DA 3KX2A 3BG6A 4XLAA 2M9HA 3M1EA 2JA6J 1EV7A 2OC6A 1RETA 2IP2A 1IGNA 2CWEA 2CS3A 3ZXSA 5B66C 1VQ5I 2PQ8A 2CQ7A 3H3VK 3WTVC 2W24A 1ZGAA 3CJRB 4PGHA 1IO2A 2GWRA 1PDNC 2HOTA 3TP3A 1D5VA 5IYBJ 4BJ6C 4U0WA 5K5OA 1FZPB 2BZTA 2IXSA 2IS2A 1FJLA 1Z0XA 4DW6A 2QQAA 1WJCA 2V9PA 2E36A 3JAMZ 1R58A 4HEA2 2KPMA 2BY0A 1R5HA 3PL8A 2P81A 1MH3A 1X4OA 4LIVA 1JTYA 3LQQA 1DP3A 2CW8A 1WJBA 2A5WA 2AO9A 1VQKI 3J7AY 2M1BA 2K3FA 2AQEA 4JX6A 1E3OC 5CKTA 3D5RC 2P7CB 4OMYA 3BTJA 4KMFA 2F5EA 2K9NA 1S7OA 3DBRB 3CCVI 4XR6A 3S8PA 2M8EA 2BY3A 3GXOA 4ZDLA 2ME0A 2OAZA 1R00A 1GLNA 2WC2A 1SFKA 3T1BA 5JFRA 3G2BA 2A05A 1R1VA 5JLWA 3DQVC 3KE2A 4CGZA 3S2DJ 2OQGA 4E70A 1Q1HA 3J7YJ 2D45A 4HF1A 4PJMA 4FHTA 5IY5H 4LIUA 2R7TA 3G71I 4QPQA 4P9FA 1FP2A 4G9YA 3GLXA 3CC2I 2TCTA 2R7VA 3KLNA 2EV5A 1KU2A 1WH7A 4LITA 4XMYA 3V42A 3HEFA 2AHQA 4TV7A 2H6CA 2VONA 2R5YB 5J40A 3GTPJ 1Z67A 1ON2A 3QRFF 3GLLA 4HF2A 2NVYJ 3HKZN 1A5JA 2D2WA 4IVNA 2M5WA 4N9IA 3GTJJ 4QSHA 2W1OA 3HGYA 4QLCU 3RKWA 2CFOA 5EGOA 2EBIA 3KETA 3TDZC 1USTA 2VC1A 4LFUA 1JUSA 1LEAA 4B1RA 1TC3C 1NTCA 1AKHB 3GTLJ 2KZGA 3ZMSA 5TRDA 1KA8A 3ABMH 1FMWA 1BC8C 1W1WE 4BAYA 3JREA 2K7LA 3K4NA 1GUUA 3OWTA 5FFZA 4I01A 3H35A 2CMPA 3F6OA 4KISA 2LBFA 3ZQ7A 5FO5A 1MMGA 3MN2A 2W57A 5TISC 2XGEA 3L2UA 2PLYA 2KL4A 4AIDA 2X1EA 5BPIA 5CVIA 3FWEA 3BG5A 3L09A 1BJZA 1TWCJ 1SVOA 3A4CA 1W4MA 2QF7A 5IP9J 1X19A 4Z2YA 2DMUA 1BJAA 1WVRA 2VUMJ 1IJWC 2GAUA 1IRXA 3ECHA 2G7UA 3OIQA 5HS7A 5M5XJ 1YFHA 2QBYA 5DUIA 1YRNA 2FJ1A 2VKDA 3VOEA 5DTDA 5FKNA 3H0DA 4KNYA 1ODDA 4RS8A 4L9VA 4RAFA 3QP6A 3M9AA 2PI0A 4KFCA 2Q0OA 3H3UA 3SHFA 5J4VA 3DU5A 1FIPA 2QWWA 1KGSA 3QU3A 5JR3A 5F1JA 2A6HF 1U6GA 3TO9A 1PYVA 4HZFA 4XLCA 5LGNA 1TLHB 2W25A 3SDGA 3O3KA 2BHZA
chains in the Genus database with same CATH topology
4MFDA 2JA8J 5EYRA 5F27A 5EEAA 1X2NA 1ETVA 4HNVA 3QQAA 4G12A 1BA5A 2OPTA 2L7MP 1UHSA 4A3CJ 2Y30A 1ZGWA 4C3JJ 2H1KA 3A03A 1JJ8C 3PO2J 2JMWA 1GVDA 3QPSA 1LFUP 1JGGA 1TWFJ 1ITYA 3HDDA 2JJ7A 2GLOA 2XGDA 1I6HJ 1MBFA 3PM1A 4MFEA 1I50J 3DEWA 2HXOA 5E3LA 1LE8A 2DN0A 3HM5A 5IP6A 1PUFB 3QPLA 1WGXA 3BR1A 5IYCJ 1EF4A 1DU0A 1BW5A 4BKXA 2DMQA 4A3FJ 1APLC 2CRGA 4A3IJ 1B8IA 2R5ZA 2M2EA 2MG4A 2Y31A 3HGGA 3S1MJ 3HOYJ 1MSEC 2Y0SN 3BG9A 2FX0A 4D5FA 2DA3A 4M3DA 2WAQN 1A6IA 2ZB9A 1WI3A 3GTOJ 4JP0A 3L1PA 3OSGA 1JT0A 3A02A 2EZLA 2O9LA 4UUTA 2XB5A 1X2MA 2CUFA 3ZQCA 1H88C 3BR2A 4RBOA 2YU9J 4NDLA 1B72A 3BQZA 1U9NA 3LSRA 4Y7NJ 2OF7A 3FK7A 2NVXJ 3HOVJ 3GTKJ 1GV5A 1Y1VJ 4CYCB 2R93J 2LLKA 3K7AJ 2IAIA 2DA2A 4BY7J 2NS7A 3CDLA 4A3GJ 3LNQA 3JRCA 4XRMA 1MBKA 2HOAA 4V2GA 1VI0A 2ECCA 2E19A 1O4XA 3LSJA 4V2FA 3JRDA 2ME6A 1CQTA 3K2AA 1ENHA 3HB9A 2HYJA 3O8HA 4A3EJ 2D5VA 4L5EA 1JT6A 1HOMA 3UKGA 4Y52J 2XPVA 4W97A 2VKEA 3HOWJ 3B6AA 5EF6A 1GT0C 2IEKA 1U9OA 2EZKA 1RPWA 5E3MA 3TEDA 2TRTA 1ZR2A 1RESA 5EZHA 4UUSA 1ETKA 1QRYA 2EZIA 2R5YA 2LTPA 1P7IA 2CQQA 5IOYA 1TWAJ 5IPAA 2XPUA 4M6VA 3CMYA 3NAUA 4C3HJ 4I76A 2E1OA 4M3FA 1AU7A 1MNMC 4A3BJ 2JK3A 1RKWA 5DS9A 3HOZJ 4LOCA 1QVUA 5J1UA 2LR8A 2CUEA 1ORKA 4IHYA 2L7FP 5GPAA 5EG0A 4EEFG 1WPKA 1ETQA 5EDNA 4A3DJ 2GM4A 3BG3A 1P7JA 1IDYA 4D7NA 1AKHA 2NS8A 3C2BA 2DA7A 3M3YJ 5J3LA 3D1NI 3S16J 1VFCA 5C3EJ 3PO3J 5K7FA 9ANTA 3LSGA 2M8GX 1RKTA 1XC5A 5M3FJ 4J19A 3HOUJ 2L9RA 1JKRC 3IH4A 2R7ZJ 1K61A 3S2HJ 3SJMA 1JKOC 4A3MJ 2MW8A 5EGOB 2DA6A 4XICA 1LFBA 2FQ4A 2LP0A 2H8RA 1Y1WJ 2CU7A 2DMTA 4BBRJ 4I6ZA 1JKQC 1G2HA 2JA7J 1SANA 4W1UA 2DTZA 5M5YJ 2HQ5A 2HI3A 4QTRA 2XPWA 2HOSA 3A01A 3OIOA 3Q3SA 1MBJA 3MKLA 1SFOJ 3HBLA 1W0TA 1IRZA 3G1LA 4BY1J 1WH5A 4D7MA 3I4MJ 3BTIA 2LD5A 2NVTJ 1JUPA 5F08A 4AC0A 5GPCA 4DYQA 4M3GA 5C4JJ 1JKPC 2DA1A 3OOUA 3VPRA 3S1QJ 1JUMA 1S7EA 1T56A 2X9DA 5FKMA 3S14J 1MBGA 2W48A 2B63J 2R92J 1OCPA 3ZQIA 2PMZN 1Z77A 2LK2A 4DZJA 2ELKA 4JX5A 3S1RJ 2JWTA 4XK4A 1YRNB 2JN6A 3ZQHA 2YS9A 1HCRA 2XB0X 1QPIA 1ZQ3P 4A3LJ 2ID3A 1IC8A 2O7OA 4M3EA 4DYRA 1OJLA 5BNGA 2IBDA 1IG7A 4S0HB 4MO7A 2LFBA 5EG0B 2O8KA 1UMQA 2GBYA 1U8BA 5HODA 3DCFA 2XSDC 4BXXJ 2WV1A 4JYKA 1MBEA 1XS9A 3B6CA 5FLMJ 1NK3P 1H89C 3Q0VA 3IH2A 3I4NJ 3BT9A 3FK6A 5C4XJ 2G0EA 1OFCX 2MGQA 5IOZA 3Q0UA 1ETOA 2VKVA 3W6VA 3JRGA 5EZGA 4A3JJ 2DA4A 1FTTA 3JRAA 1ETYA 1HDDC 4XIDA 5FJ8J 4GFBA 1MBHA 2XRLA 4BBSJ 1LE8B 1QVTA 3BQYA 3GBGA 2QCOA 2DA5A 4RDUA 1FEXA 4AYBN 5FKLA 2VPRA 1B8IB 2R5ZB 2EH3A 4A69C 4IEJA 2MSYA 4FE7A 4XRSG 2EZHA 1XG1A 2DJNA 4FISA 3FKIJ 4FCYA 3O8GA 1D5YA 3BR0A 1VF9A 5J1RA 5E3NA 2I10A 1OCTC 1WCMJ 1K83J 1MH4A 2E2JJ 4IHXA 2M9HA 3BR5A 2Y2ZA 3RZDJ 3GTMJ 2Y9YA 2JA6J 1FIAA 4ABZA 1RETA 4JX4A 1IGNA 1TWHJ 1NK2P 1F36A 2L7ZA 1Q1VA 3JRHA 3H3VK 2X6OA 2HXIA 4C3IJ 3JRBA 3BR6A 5C44J 3TP3A 2HOTA 5IYBJ 2DMPA 1B72B 2LY9A 1FJLA 3S1NJ 1Z0XA 4DW6A 1I3QJ 1MSFC 3BTCA 5M3MJ 4B3AA 3WHCA 2P81A 1MH3A 1JTYA 1IV6A 4A93J 2AO9A 4JX6A 2DMNA 1IUFA 4DYCA 3G1MA 1E3OC 1DU6A 2LVSA 1ETWA 2KDZA 3BTJA 2K9NA 5F0HA 3TW7A 3RKQA 3S17J 4X6AJ 5GP9A 2ME0A 1ZTRA 3F0CA 1ZR4A 1GDTA 1HDPA 2L0KA 3GTGJ 2E2IJ 1TWGJ 5JLWA 3S2DJ 5IP7J 5F0CA 2K40A 2X48A 4MIMA 5F04A 4AUXA 3ZOBA 3BR3A 1GV2A 3WHBA 1UG2A 2NOGA 1POGA 2NVQJ 2TCTA 5K7HA 3CQZJ 4FTHA 2Y9ZA 3IH3A 1WH7A 4UUSB 1F43A 5IYDJ 2XGCA 3HEFA 3TW6A 2AHQA 4MLOA 2R5YB 3GTPJ 2YUSA 5FLVA 2M0CA 5FKOA 3TP0A 1A5JA 2NVYJ 3HKZN 3Q0WA 2RAEA 3RZOJ 3FIWA 2ECBA 2FD5A 2VI6A 3GTJJ 1U78A 4QSHA 5F0FA 5JLXA 3HGYA 5EGOA 2EBIA 4A3KJ 1PUFA 4IHWA 1JUSA 4B1RA 1TC3C 3CCYA 1NTCA 3RQIA 1R9TJ 1AKHB 3GTLJ 2HDDA 3MVPA 3GTQJ 3ZQFA 4XRSA 2JA5J 2EQRA 3JREA 5M5WJ 1ETXA 5K7ZA 1GUUA 3NARA 4QIWN 1AHDP 2K9SA 4IHVA 1IDZA 1HF0A 2LKXA 3FISA 3MN2A 3HOXJ 3ZQLA 3E7LA 2XGEA 3G1OA 2CQXA 3JRIA 2E2HJ 2CJJA 2R0QC 5J1YA 3BG5A 1BJZA 1ZK8A 1TWCJ 1W0UA 3IV5A 1X58A 3BTLA 2QF7A 5IP9J 3JR9A 1JJ6C 2DMUA 2COBA 1HLVA 2VUMJ 1JTXA 1VNDA 1T33A 5FKKA 3LSPA 1IJWC 1H8AC 1ZKGA 4X1EA 1FTZA 3SFIA 2K9QA 5M5XJ 4CYCA 4DZPA 1YRNA 3ZQGA 2FJ1A 5DTDA 5FKNA 4M3BA 2N8GA 4B4CA 3A01B 3H0GJ 2WB1N 5E3OA 3OSFA 2KT0A 3M4OJ 1RR7A 1FIPA 5F1JA 1BW6A 2M34A 3LOCA 4FE4A 2ID6A 3S15J 1BL0A 3JRFA 4D5CA 3SDGA 4C2MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFD A;  2JA8 J;  5EYR A;  5F27 A;  5EEA A;  1X2N A;  1ETV A;  4HNV A;  3QQA A;  4G12 A;  1BA5 A;  2OPT A;  2L7M P;  1UHS A;  4A3C J;  2Y30 A;  1ZGW A;  4C3J J;  2H1K A;  3A03 A;  1JJ8 C;  3PO2 J;  2JMW A;  1GVD A;  3QPS A;  1LFU P;  1JGG A;  1TWF J;  1ITY A;  3HDD A;  2JJ7 A;  2GLO A;  2XGD A;  1I6H J;  1MBF A;  3PM1 A;  4MFE A;  1I50 J;  3DEW A;  2HXO A;  5E3L A;  1LE8 A;  2DN0 A;  3HM5 A;  5IP6 A;  1PUF B;  3QPL A;  1WGX A;  3BR1 A;  5IYC J;  1EF4 A;  1DU0 A;  1BW5 A;  4BKX A;  2DMQ A;  4A3F J;  1APL C;  2CRG A;  4A3I J;  1B8I A;  2R5Z A;  2M2E A;  2MG4 A;  2Y31 A;  3HGG A;  3S1M J;  3HOY J;  1MSE C;  2Y0S N;  3BG9 A;  2FX0 A;  4D5F A;  2DA3 A;  4M3D A;  2WAQ N;  1A6I A;  2ZB9 A;  1WI3 A;  3GTO J;  4JP0 A;  3L1P A;  3OSG A;  1JT0 A;  3A02 A;  2EZL A;  2O9L A;  4UUT A;  2XB5 A;  1X2M A;  2CUF A;  3ZQC A;  1H88 C;  3BR2 A;  4RBO A;  2YU9 J;  4NDL A;  1B72 A;  3BQZ A;  1U9N A;  3LSR A;  4Y7N J;  2OF7 A;  3FK7 A;  2NVX J;  3HOV J;  3GTK J;  1GV5 A;  1Y1V J;  4CYC B;  2R93 J;  2LLK A;  3K7A J;  2IAI A;  2DA2 A;  4BY7 J;  2NS7 A;  3CDL A;  4A3G J;  3LNQ A;  3JRC A;  4XRM A;  1MBK A;  2HOA A;  4V2G A;  1VI0 A;  2ECC A;  2E19 A;  1O4X A;  3LSJ A;  4V2F A;  3JRD A;  2ME6 A;  1CQT A;  3K2A A;  1ENH A;  3HB9 A;  2HYJ A;  3O8H A;  4A3E J;  2D5V A;  4L5E A;  1JT6 A;  1HOM A;  3UKG A;  4Y52 J;  2XPV A;  4W97 A;  2VKE A;  3HOW J;  3B6A A;  5EF6 A;  1GT0 C;  2IEK A;  1U9O A;  2EZK A;  1RPW A;  5E3M A;  3TED A;  2TRT A;  1ZR2 A;  1RES A;  5EZH A;  4UUS A;  1ETK A;  1QRY A;  2EZI A;  2R5Y A;  2LTP A;  1P7I A;  2CQQ A;  5IOY A;  1TWA J;  5IPA A;  2XPU A;  4M6V A;  3CMY A;  3NAU A;  4C3H J;  4I76 A;  2E1O A;  4M3F A;  1AU7 A;  1MNM C;  4A3B J;  2JK3 A;  1RKW A;  5DS9 A;  3HOZ J;  4LOC A;  1QVU A;  5J1U A;  2LR8 A;  2CUE A;  1ORK A;  4IHY A;  2L7F P;  5GPA A;  5EG0 A;  4EEF G;  1WPK A;  1ETQ A;  5EDN A;  4A3D J;  2GM4 A;  3BG3 A;  1P7J A;  1IDY A;  4D7N A;  1AKH A;  2NS8 A;  3C2B A;  2DA7 A;  3M3Y J;  5J3L A;  3D1N I;  3S16 J;  1VFC A;  5C3E J;  3PO3 J;  5K7F A;  9ANT A;  3LSG A;  2M8G X;  1RKT A;  1XC5 A;  5M3F J;  4J19 A;  3HOU J;  2L9R A;  1JKR C;  3IH4 A;  2R7Z J;  1K61 A;  3S2H J;  3SJM A;  1JKO C;  4A3M J;  2MW8 A;  5EGO B;  2DA6 A;  4XIC A;  1LFB A;  2FQ4 A;  2LP0 A;  2H8R A;  1Y1W J;  2CU7 A;  2DMT A;  4BBR J;  4I6Z A;  1JKQ C;  1G2H A;  2JA7 J;  1SAN A;  4W1U A;  2DTZ A;  5M5Y J;  2HQ5 A;  2HI3 A;  4QTR A;  2XPW A;  2HOS A;  3A01 A;  3OIO A;  3Q3S A;  1MBJ A;  3MKL A;  1SFO J;  3HBL A;  1W0T A;  1IRZ A;  3G1L A;  4BY1 J;  1WH5 A;  4D7M A;  3I4M J;  3BTI A;  2LD5 A;  2NVT J;  1JUP A;  5F08 A;  4AC0 A;  5GPC A;  4DYQ A;  4M3G A;  5C4J J;  1JKP C;  2DA1 A;  3OOU A;  3VPR A;  3S1Q J;  1JUM A;  1S7E A;  1T56 A;  2X9D A;  5FKM A;  3S14 J;  1MBG A;  2W48 A;  2B63 J;  2R92 J;  1OCP A;  3ZQI A;  2PMZ N;  1Z77 A;  2LK2 A;  4DZJ A;  2ELK A;  4JX5 A;  3S1R J;  2JWT A;  4XK4 A;  1YRN B;  2JN6 A;  3ZQH A;  2YS9 A;  1HCR A;  2XB0 X;  1QPI A;  1ZQ3 P;  4A3L J;  2ID3 A;  1IC8 A;  2O7O A;  4M3E A;  4DYR A;  1OJL A;  5BNG A;  2IBD A;  1IG7 A;  4S0H B;  4MO7 A;  2LFB A;  5EG0 B;  2O8K A;  1UMQ A;  2GBY A;  1U8B A;  5HOD A;  3DCF A;  2XSD C;  4BXX J;  2WV1 A;  4JYK A;  1MBE A;  1XS9 A;  3B6C A;  5FLM J;  1NK3 P;  1H89 C;  3Q0V A;  3IH2 A;  3I4N J;  3BT9 A;  3FK6 A;  5C4X J;  2G0E A;  1OFC X;  2MGQ A;  5IOZ A;  3Q0U A;  1ETO A;  2VKV A;  3W6V A;  3JRG A;  5EZG A;  4A3J J;  2DA4 A;  1FTT A;  3JRA A;  1ETY A;  1HDD C;  4XID A;  5FJ8 J;  4GFB A;  1MBH A;  2XRL A;  4BBS J;  1LE8 B;  1QVT A;  3BQY A;  3GBG A;  2QCO A;  2DA5 A;  4RDU A;  1FEX A;  4AYB N;  5FKL A;  2VPR A;  1B8I B;  2R5Z B;  2EH3 A;  4A69 C;  4IEJ A;  2MSY A;  4FE7 A;  4XRS G;  2EZH A;  1XG1 A;  2DJN A;  4FIS A;  3FKI J;  4FCY A;  3O8G A;  1D5Y A;  3BR0 A;  1VF9 A;  5J1R A;  5E3N A;  2I10 A;  1OCT C;  1WCM J;  1K83 J;  1MH4 A;  2E2J J;  4IHX A;  2M9H A;  3BR5 A;  2Y2Z A;  3RZD J;  3GTM J;  2Y9Y A;  2JA6 J;  1FIA A;  4ABZ A;  1RET A;  4JX4 A;  1IGN A;  1TWH J;  1NK2 P;  1F36 A;  2L7Z A;  1Q1V A;  3JRH A;  3H3V K;  2X6O A;  2HXI A;  4C3I J;  3JRB A;  3BR6 A;  5C44 J;  3TP3 A;  2HOT A;  5IYB J;  2DMP A;  1B72 B;  2LY9 A;  1FJL A;  3S1N J;  1Z0X A;  4DW6 A;  1I3Q J;  1MSF C;  3BTC A;  5M3M J;  4B3A A;  3WHC A;  2P81 A;  1MH3 A;  1JTY A;  1IV6 A;  4A93 J;  2AO9 A;  4JX6 A;  2DMN A;  1IUF A;  4DYC A;  3G1M A;  1E3O C;  1DU6 A;  2LVS A;  1ETW A;  2KDZ A;  3BTJ A;  2K9N A;  5F0H A;  3TW7 A;  3RKQ A;  3S17 J;  4X6A J;  5GP9 A;  2ME0 A;  1ZTR A;  3F0C A;  1ZR4 A;  1GDT A;  1HDP A;  2L0K A;  3GTG J;  2E2I J;  1TWG J;  5JLW A;  3S2D J;  5IP7 J;  5F0C A;  2K40 A;  2X48 A;  4MIM A;  5F04 A;  4AUX A;  3ZOB A;  3BR3 A;  1GV2 A;  3WHB A;  1UG2 A;  2NOG A;  1POG A;  2NVQ J;  2TCT A;  5K7H A;  3CQZ J;  4FTH A;  2Y9Z A;  3IH3 A;  1WH7 A;  4UUS B;  1F43 A;  5IYD J;  2XGC A;  3HEF A;  3TW6 A;  2AHQ A;  4MLO A;  2R5Y B;  3GTP J;  2YUS A;  5FLV A;  2M0C A;  5FKO A;  3TP0 A;  1A5J A;  2NVY J;  3HKZ N;  3Q0W A;  2RAE A;  3RZO J;  3FIW A;  2ECB A;  2FD5 A;  2VI6 A;  3GTJ J;  1U78 A;  4QSH A;  5F0F A;  5JLX A;  3HGY A;  5EGO A;  2EBI A;  4A3K J;  1PUF A;  4IHW A;  1JUS A;  4B1R A;  1TC3 C;  3CCY A;  1NTC A;  3RQI A;  1R9T J;  1AKH B;  3GTL J;  2HDD A;  3MVP A;  3GTQ J;  3ZQF A;  4XRS A;  2JA5 J;  2EQR A;  3JRE A;  5M5W J;  1ETX A;  5K7Z A;  1GUU A;  3NAR A;  4QIW N;  1AHD P;  2K9S A;  4IHV A;  1IDZ A;  1HF0 A;  2LKX A;  3FIS A;  3MN2 A;  3HOX J;  3ZQL A;  3E7L A;  2XGE A;  3G1O A;  2CQX A;  3JRI A;  2E2H J;  2CJJ A;  2R0Q C;  5J1Y A;  3BG5 A;  1BJZ A;  1ZK8 A;  1TWC J;  1W0U A;  3IV5 A;  1X58 A;  3BTL A;  2QF7 A;  5IP9 J;  3JR9 A;  1JJ6 C;  2DMU A;  2COB A;  1HLV A;  2VUM J;  1JTX A;  1VND A;  1T33 A;  5FKK A;  3LSP A;  1IJW C;  1H8A C;  1ZKG A;  4X1E A;  1FTZ A;  3SFI A;  2K9Q A;  5M5X J;  4CYC A;  4DZP A;  1YRN A;  3ZQG A;  2FJ1 A;  5DTD A;  5FKN A;  4M3B A;  2N8G A;  4B4C A;  3A01 B;  3H0G J;  2WB1 N;  5E3O A;  3OSF A;  2KT0 A;  3M4O J;  1RR7 A;  1FIP A;  5F1J A;  1BW6 A;  2M34 A;  3LOC A;  4FE4 A;  2ID6 A;  3S15 J;  1BL0 A;  3JRF A;  4D5C A;  3SDG A;  4C2M J; 
#chains in the Genus database with same CATH topology
 4BYY A;  1TZL A;  1SD4 A;  4RM3 A;  5EYR A;  4C30 A;  2V6C A;  5EEA A;  1X2N A;  1ETV A;  2QLZ A;  3QQA A;  3VYU B;  1G4D A;  2OPT A;  2WAF A;  1UHS A;  2LG4 A;  4RB3 C;  1MMN A;  3WTS C;  3SEQ A;  3A03 A;  4RLF A;  1FBS A;  3PO2 J;  2UXX A;  3QPS A;  3D5S C;  1CF7 B;  4G6T B;  4UXN A;  1ITY A;  2XVC A;  1OKR A;  2E71 A;  4ITV A;  1E0E A;  2XGD A;  3U2R A;  3I9V 2;  2UXN A;  3PM1 A;  3PUB A;  2WWY A;  4OIN F;  2M7A A;  3K9T A;  1QNT A;  1YS7 A;  2V4J C;  2HXO A;  5E3L A;  1R22 A;  2DN0 A;  2ZXH A;  1WGX A;  5IYC J;  2OCC H;  4HYE A;  4OIR F;  3DBL B;  2WAE A;  3G4S I;  2R7S A;  4EGY A;  4XKB A;  2CRG A;  4A3I J;  1B8I A;  3ZMZ A;  4F3Q A;  3TBI A;  2MG4 A;  2K4B A;  3GVA A;  1RC9 A;  2P8T A;  5D4S A;  3HGG A;  3ZPL A;  4ZDO A;  3P9I A;  4WCG A;  1ZAR A;  4XN3 A;  3HL2 A;  3ZP5 A;  1WRJ A;  3DF8 A;  4PSW A;  4AIK A;  3E0J B;  2CQN A;  3K10 A;  2M4G A;  1F1Z A;  3Q9S A;  2IGM A;  1X1C A;  3FXL A;  4PK4 A;  1WI3 A;  1TNT A;  1V5G A;  4IL6 C;  1TL8 A;  3GTO J;  1T08 B;  3OSG A;  2MFZ A;  4LLG F;  1WJ5 A;  2WV0 A;  1UHW A;  2GZW A;  2Z2S B;  3TO6 A;  2MH9 A;  4NUB A;  2X51 A;  1VQ9 I;  3BQZ A;  4IPA A;  2IS4 A;  3WU2 C;  3LSR A;  4I0A A;  4A0Z A;  2RC4 A;  4Y7N J;  4LGW A;  2DOA A;  4KDP A;  2NVX J;  5AON A;  4B09 A;  1Y1V J;  2J5P A;  4CYC B;  1FOX A;  2ZSI B;  3DWL E;  1YE9 A;  3C7J A;  1XD7 A;  3OR1 C;  1J5Y A;  4CO8 A;  3BC8 A;  1KU7 A;  3L00 A;  3LNQ A;  1MBK A;  3WTY C;  1USS A;  2ZO4 A;  4V2G A;  2DT7 B;  1B9N A;  2E19 A;  1O4X A;  1KU3 A;  2KJC A;  1WZ2 A;  2HTS A;  3JRD A;  5FD6 A;  1XGN A;  4IX7 A;  3EYY A;  2DPD A;  3CUO A;  2D5V A;  5D6F A;  3UKG A;  3IKV A;  3VDX A;  1QA6 A;  4Y52 J;  4B47 A;  3LSM A;  2WBM A;  3QAH A;  2F4O B;  2O8X A;  4M74 A;  4C2M J;  2W7N A;  3K4M A;  5EF6 A;  2WY8 Q;  1YI2 I;  5D8L B;  1VTN C;  1I27 A;  1AOY A;  2TRT A;  3KP3 A;  1ZR2 A;  1RES A;  4E7S A;  3I54 A;  4XM3 A;  1QRY A;  2G9W A;  3SDB A;  3BG7 A;  2R5Y A;  3VWB A;  1P7I A;  2XPU A;  3CMY A;  5FRO A;  3FF5 A;  3NAU A;  4M6Y A;  2XIG A;  3VOD A;  2MA3 A;  1JHF A;  1G3T A;  2FQ3 A;  1BI3 A;  3HG9 A;  3QYB A;  5DS9 A;  5CPR B;  2LR8 A;  4PZJ A;  4AIJ A;  4DBQ A;  3PSI A;  3KYC B;  2OU2 A;  2ZC2 A;  5EDN A;  5KHD A;  1H9T A;  1IDY A;  2VL8 A;  1AKH A;  2V1X A;  2NS8 A;  4OAY A;  4UHT A;  3N05 A;  5E79 C;  1YTY A;  9ANT A;  2A6T A;  3TO7 A;  5DDG A;  2BYV E;  4A6E A;  3DTE A;  4L5J A;  2IJL A;  2VXZ A;  2X6X A;  2DFE A;  2L9R A;  2NYX A;  1JKR C;  2UWM A;  2PN6 A;  1HW1 A;  3ABK H;  5F1R A;  2GOM A;  3LWF A;  4DOZ A;  3MZH A;  1YJ9 I;  1JKO C;  4BJ5 C;  1RUO A;  4OIP F;  4XLP F;  4MTD A;  3PFI A;  5GTI C;  4AVZ A;  1LFB A;  2QEX I;  4KIG A;  2LMD A;  3H92 A;  3K1M A;  4BBR J;  4I6Z A;  4F93 B;  1G2H A;  1MKM A;  2JA7 J;  1Z1D A;  3KP2 A;  3ESW B;  1LFP A;  1S5L C;  2G7H A;  4QTR A;  1SVM A;  4G6D A;  3CME I;  3Q3S A;  4BHB A;  1MBJ A;  1W5T A;  4HQE A;  4KIB A;  3I4P A;  2PJR B;  3WTT C;  2JZY A;  4Q4Z F;  1B9M A;  2QSF X;  1UG0 A;  1WH5 A;  4D7M A;  3K4L A;  4WWC A;  2VLA A;  3I4M J;  4OU0 A;  1JUP A;  1DPU A;  1A04 A;  5C4J J;  3OOU A;  1HW2 A;  5LEK A;  1Z3X A;  3E6B A;  1ZAO A;  2X6W A;  4I0B A;  4RGS A;  3S14 J;  3H9G A;  4BJT A;  3ABT A;  3OR2 C;  3O6B B;  1A31 A;  2QSH X;  2PMZ N;  1IZ1 A;  2W85 A;  3EDP A;  2IS6 A;  2LK2 A;  4MQV A;  4ZZL A;  5LGU A;  3B73 A;  3DTI A;  1YHQ I;  1S9H A;  2BBY A;  2LRE A;  5H6R A;  3ZN0 A;  2Z3Y A;  3ISP A;  1CF7 A;  2HQN A;  1R36 A;  2XAS A;  3I59 B;  4NC7 A;  4CCN A;  1UJ8 A;  3OYG A;  2LRD A;  1ZQ3 P;  3TGN A;  3LA7 A;  5JVT A;  1IC8 A;  4XOT A;  3T8R A;  3OYL A;  3U1K A;  4KN7 X;  4DYR A;  4CCM A;  2IBD A;  3P9C A;  2O8K A;  3WGH A;  2GBY A;  5ICF A;  3H1C A;  1QU3 A;  3MKW B;  2XSD C;  5EJC A;  4HDV A;  5FD5 A;  2GA1 A;  5FLM J;  2ETH A;  3OL3 A;  1H89 C;  3OYN A;  3IH2 A;  3WOD F;  1P6R A;  1W5C C;  3DLA A;  2VKV A;  5IT9 Z;  3R0J A;  3GWZ A;  3FXM A;  1UEL B;  4E6K G;  1ETY A;  2WAD A;  1VQ4 I;  2OBP A;  2C6Y A;  3BQY A;  1G3Y A;  3GFI A;  2QCO A;  2DA5 A;  2HOE A;  5FGM A;  5GAH J;  1R7J A;  1EH7 A;  2FU4 A;  1FEX A;  3V7C A;  4G7H F;  4A69 C;  3JAM K;  4FE7 A;  4GDF A;  2EZH A;  4BQN A;  1XG1 A;  3GW2 A;  4RMN A;  1D5Y A;  1D1C A;  3HPG A;  1VF9 A;  5J1R A;  2I10 A;  1B59 A;  1R4M B;  2HVR A;  3HPH A;  3MMY B;  5BPD A;  2Z99 A;  1MH4 A;  2EK5 A;  2E2J J;  1RZ4 A;  1QZZ A;  1XGS A;  1XCB A;  1MMD A;  1RI7 A;  1FIA A;  2EB7 A;  3S3M A;  2B9S A;  3JSO A;  1ZH5 A;  1MJB A;  1F36 A;  2KMU A;  3E5X A;  3RPQ A;  3JRH A;  3RI4 A;  3DPT A;  4EJW A;  2X6O A;  3LL7 A;  2VXD A;  2M87 A;  2L9V A;  1XSX A;  2P4W A;  4XN0 A;  4EJO A;  1K4T A;  3GX4 X;  1BOA A;  4C3I J;  2DMP A;  1B72 B;  2RVC A;  2HKO A;  2LKS A;  1I3Q J;  3BTC A;  4UB8 C;  4NHJ A;  4DGW B;  3RTR A;  2H09 A;  3GFM A;  4O6J A;  4Q5S F;  4HAM A;  4UVC A;  3SZG A;  3TKY A;  2ESN A;  1IV6 A;  4F52 A;  2BE5 F;  5LRS A;  1K79 A;  3G1M A;  2Y0M A;  3HUG B;  3RJP A;  4CCO A;  4E7Z A;  2DFI A;  5ICE A;  2BV6 A;  2KDZ A;  1MIJ A;  3I56 I;  1IN4 A;  3CF5 F;  2UV1 A;  3RKQ A;  4FX0 A;  1SFE A;  2Y75 A;  1Y39 A;  4ETS A;  4IRH A;  1ZTR A;  3F0C A;  1ZR4 A;  3E1S A;  3PJR A;  4KMU X;  5LGT A;  5FB2 A;  2XC7 A;  3J7Z I;  5IP7 J;  3DEU A;  2QGU A;  5F0C A;  1S72 I;  4FAS D;  4FQG A;  4L18 B;  2X48 A;  4MIM A;  3HZJ A;  4DQ2 A;  3ZOB A;  4IZZ A;  4BNC A;  3BR3 A;  4KYW A;  3WHB A;  4GXO A;  4EQQ A;  1POG A;  5E17 F;  1KYZ A;  1DQU A;  2NVQ J;  3MAJ A;  2Y9Z A;  2L9S A;  1ZLJ A;  3IH3 A;  4Q48 A;  4HOB A;  5LBQ A;  1F43 A;  5IYD J;  1R1U A;  1VQL I;  3TW6 A;  4MLO A;  1XB4 A;  4FX4 A;  2J5O A;  4HNT A;  1OYI A;  5FLV A;  3TP0 A;  4E4H A;  3P9K A;  2ECB A;  2FD5 A;  4EJT A;  1T0F C;  3QWL A;  1UFM A;  5F0F A;  5JLX A;  2ZXJ A;  4PFP A;  4A3K J;  2IS1 A;  4IHW A;  1TTY A;  2H94 A;  2KIQ A;  1U8R A;  1D3Y A;  1FMV A;  3L2V A;  3H3Z A;  1R9T J;  1Z9C A;  2EJR A;  3D0S A;  1ZRE A;  2HDD A;  3MVP A;  3SZP A;  1BM9 A;  4XRS A;  3NEU A;  2E34 A;  2HTJ A;  2CV1 A;  1ETX A;  3JCU C;  1OCR H;  4QIW N;  1MGT A;  2YR2 A;  4DIQ A;  2HNH A;  2ZJP F;  1MW7 A;  2PJR A;  5CVR A;  2LKX A;  5B3S H;  3JW4 A;  2MLK A;  2H27 A;  2E2H J;  2CJJ A;  4J01 A;  5J1Y A;  3IL2 A;  3LAJ A;  1ZK8 A;  3WTU C;  2QQ9 A;  1X58 A;  2YX7 A;  5LLQ A;  1JJ6 C;  3CCS I;  2FBK A;  1E3P A;  2FE3 A;  1T33 A;  2DAO A;  1H8A C;  1BN5 A;  1FTZ A;  5H6Q A;  1GXP A;  1Y56 A;  4KT6 A;  2X1C A;  3GYH X;  4DZP A;  1D1B A;  1U5T C;  2PJP A;  3JSP A;  3ZQG A;  1XDU A;  2L4M A;  3I59 A;  2N8G A;  2D1H A;  2WB1 N;  4A0X A;  2HVS A;  5E3O A;  3OSF A;  2R7Q A;  1SAU A;  1C0W A;  2KRH A;  3H9J A;  4BE1 A;  1W36 C;  4XLE A;  1ZRD A;  1BL0 A;  4D5C A;  2LYC A;  3MKZ A;  2K4J A;  4R1H A;  4E7H A;  1ZRC A;  2JA8 J;  5KNL A;  2V26 A;  3PIP F;  2A69 F;  2KIM A;  4L5I A;  4B43 A;  2M0M A;  4HDU A;  4G12 A;  3LSK A;  1BA5 A;  4D9J A;  3F8B A;  1I5Z A;  1BR2 A;  1ZGW A;  3H36 A;  3OYK A;  2M7B A;  1OMI A;  1W36 D;  5HNF A;  4HV5 A;  5F6F A;  4I7H A;  2XAQ A;  5ICG A;  1XMK A;  2A5Y B;  2F48 A;  2LF7 A;  3HDD A;  2JJ7 A;  1J2X A;  2F4I A;  3WG7 H;  1MBF A;  2L54 A;  3WG9 A;  3F22 A;  2IA1 A;  1I50 J;  2KFD A;  3VFZ A;  1KON A;  3G6E I;  5IP6 A;  5DUK A;  1PUF B;  3SXY A;  4BEH B;  1EF4 A;  3BR1 A;  5DM7 F;  2W00 A;  4D1Q A;  3EUA A;  2EFQ A;  3HRT A;  3K6G A;  1DU0 A;  1BW5 A;  4M6X A;  1XDS A;  2ZXI A;  2OZU A;  4BU2 A;  1ZHF A;  2F5C A;  1L3L A;  3J7A O;  4EJU A;  3V4G A;  2RDP A;  2YPR A;  4F55 A;  2KRC A;  2IGK A;  3HOY J;  1MSE C;  2Y0S N;  2GA2 A;  2FX0 A;  5E1Z B;  4D5F A;  3W3C A;  3KZY A;  1WWX A;  4C9Y A;  2F5V A;  2F5D A;  4YFN F;  2DA3 A;  2YX4 A;  3P5J A;  2QM3 A;  4PJ0 C;  3V8K A;  1FOY A;  3A02 A;  2EZL A;  3CO6 C;  4E7K A;  1QO0 D;  1ZEL A;  2PMH A;  4RGR A;  2Q8K A;  3LST A;  4ANJ A;  4MEY F;  4RBO A;  3IUO A;  4NDL A;  2VE9 A;  3CCL I;  1B72 A;  1Z7U A;  2Z9O A;  5K5Q A;  1T8I A;  2OF7 A;  1Y8Q B;  5L3F A;  4CZZ A;  5JI6 A;  2MC4 A;  4RGX A;  2VKH A;  4HW0 A;  2KIU A;  2L01 A;  1VQN I;  1MD0 A;  2AXL A;  2R93 J;  4U88 A;  1Y6I A;  4QWQ A;  3HUG A;  2KJB A;  4EGZ A;  4BY7 J;  4BE2 A;  3AL0 B;  3F72 A;  3GF2 A;  3FXJ A;  3CDL A;  4HNU A;  4XSX F;  1WFX A;  1UHM A;  4XRM A;  2HOA A;  1R6R A;  4YG2 F;  4BQA A;  4L9N A;  2O61 A;  2E5N A;  3RSN A;  4KN4 X;  4YRV A;  3AG3 H;  2ECC A;  3DKY A;  3HHG A;  4AIH A;  4CDG A;  1IN6 A;  2VJ4 A;  1AWC A;  5E20 A;  2V7F A;  2QQB A;  4E7L A;  3HXL A;  1ENH A;  2JPC A;  2R7D A;  3HB9 A;  1G3W A;  4CIC A;  4A3E J;  1FSH A;  2GOX B;  4L5E A;  2EFW A;  5FFX A;  3DV8 A;  4PDK A;  1U5T B;  2R7F A;  2VKE A;  4BXF A;  3REO A;  1U3E M;  4E7I A;  1IF1 A;  3LSI A;  3B6A A;  1GT0 C;  3GUD A;  4LMY A;  1YS6 A;  2HWV A;  1VQM I;  2MD0 A;  1RPW A;  5E3M A;  3TED A;  1ERD A;  1E2X A;  2JSC A;  4KJZ A;  2YSR A;  1ETK A;  4HQM A;  5D6E A;  2LTP A;  3HRU A;  4IF4 A;  4M6V A;  4ON0 A;  1RNL A;  4G94 A;  5JVG F;  5HOO A;  2XRO A;  2RKH A;  2VT2 A;  2E1O A;  4XRF A;  4U0V A;  3L2Q A;  1RKW A;  3HOZ J;  4GCV A;  5HVQ C;  3DEE A;  3PSF A;  4BS9 A;  1ORK A;  1ON1 A;  2RGV A;  3A0B C;  2DT6 A;  1V5F A;  2QVO A;  4UVB A;  5EG0 A;  4NB5 A;  3RKY A;  4EEF G;  1WPK A;  2FNA A;  2GM4 A;  4D7N A;  3QPT A;  2EIM H;  1SC7 A;  2Z16 A;  1IAW A;  3C2B A;  4LG0 B;  3ZMD A;  2BHY A;  3D1N I;  3CLQ A;  3W6J B;  3S16 J;  5C3E J;  5K5R A;  5K7F A;  2IGN A;  3OYH A;  1RR8 C;  3LSG A;  2MAB A;  3L7W A;  5FLX K;  1I6X A;  4HST A;  4L0Z B;  3FX3 A;  3A0H C;  3RCO A;  2LY1 A;  3ZMU A;  2EA4 A;  3HOU J;  1V55 H;  3CES A;  1O3Q A;  2R7Z J;  4EAT A;  4KIF A;  2ISY A;  3S2H J;  2DDA A;  1K78 B;  4V19 K;  2PFB A;  3C2H A;  2MW8 A;  3BY6 A;  4HG2 A;  5E18 F;  1WSU A;  2V1D A;  2FQ4 A;  2LP0 A;  3JTH A;  1WQ2 A;  1A35 A;  1OR7 C;  1Y1W J;  2CU7 A;  3W2W A;  4A5M A;  4PSX A;  4BHP A;  1EA3 A;  1LUJ B;  3WTW C;  1XPX A;  1SFU A;  1JKQ C;  1SAN A;  4W1U A;  4Y15 A;  3BRO A;  1DP7 P;  3O2P E;  1JHH A;  1HSJ A;  3E6D A;  5EEG A;  2HI3 A;  1T6S A;  2WAQ A;  3ZR8 X;  2MYS A;  4ENJ A;  3K4C A;  4RM2 A;  3OIO A;  4U0Y A;  2LC2 A;  1W0T A;  1DUX C;  1BR1 A;  3IWZ A;  2LD5 A;  1HW5 A;  2QZ8 A;  2LOO A;  1X3U A;  3AKZ A;  4M3G A;  3CCQ I;  1JKP C;  2IRF G;  1Y0N A;  1Z6T A;  2DA1 A;  4BQO A;  3OS0 A;  3S1Q J;  1MMS A;  2WY7 Q;  1YW8 A;  2ZME B;  5DCM B;  1IRG A;  4ESB A;  4BDY A;  1HKS A;  2X9D A;  4A12 A;  4ZYG A;  2PMZ A;  1JE8 A;  3LAP A;  1MBG A;  3E6M A;  4HV6 A;  3ZMT A;  5HNH A;  1I1G A;  1EH6 A;  4A2U A;  3C3W A;  1OLT A;  4II2 A;  4BXU A;  4EV0 A;  4LG3 A;  2NNY A;  4XK4 A;  3W2V A;  4IQ4 A;  2JN6 A;  2IT0 A;  3RPU D;  3H5A A;  3OYB A;  1QPI A;  2E60 A;  2V6E A;  5IT9 K;  4M3E A;  1DDN A;  4XNF A;  1BC7 C;  1YIT I;  3KIO A;  5BNG A;  4YFX F;  4BEH A;  3DKW A;  1B6A A;  1T38 A;  3K1N A;  2LFB A;  1QBJ A;  1TT5 B;  1LKX A;  3BZ6 A;  4JYK A;  1SD5 A;  3B6C A;  4CZC A;  1X1A A;  3OS1 A;  3H9Q A;  3Q0V A;  2H1L A;  1IXR C;  2M30 A;  4QPO A;  1D0Y A;  3FK6 A;  2IA0 A;  1REP C;  5C4X J;  2XHK A;  4H4K C;  5D4R A;  2MGQ A;  3QU6 A;  1XMX A;  5E8G A;  1ETO A;  1T0F A;  1SFX A;  3GFL A;  5DCF A;  4NQW B;  3JRG A;  4HLY A;  1T95 A;  5J8F A;  2DA4 A;  3CLO A;  2FML A;  1N25 A;  3DPL C;  1OYY A;  4U7B A;  1ULY A;  2BGC A;  1UB9 A;  2DT5 A;  2A3S A;  2XRL A;  3E97 A;  3FM5 A;  3M07 A;  2OJE D;  2FRH A;  5DEQ A;  3Q9V A;  5KAI C;  2OA4 A;  1QVT A;  3AG4 H;  3GBG A;  4C2T A;  2CV0 A;  1Z05 A;  2P5K A;  2OTL I;  4LLL A;  4DJA A;  2NVU B;  1VZ0 A;  2VPR A;  3KFW X;  4CCJ A;  2VOD A;  3BCB A;  2V1N A;  2R5Z B;  2RNJ A;  1J7K A;  3FBI B;  2M4K A;  2EH3 A;  2DOE A;  4IEJ A;  2MSY A;  1JGS A;  2L4A A;  4HA8 A;  3GME A;  2FXA A;  1Z7L A;  2BOL A;  2BVM A;  4Y17 A;  1FOW A;  1WCM J;  2DYS H;  1K83 J;  3DU6 A;  3EUH C;  2HPI A;  3V8L A;  3RZD J;  2HYG D;  1FP1 D;  3WGI A;  2VB6 A;  1NH3 A;  4JX4 A;  1NG7 A;  1SAX A;  1TWH J;  1NK2 P;  4XL9 A;  2L7Z A;  2UUZ A;  1H0M A;  4A5N A;  2VT3 A;  5HLT A;  5GAD J;  1W5S A;  2LDU A;  3BR6 A;  2JTV A;  5C44 J;  1TQM A;  2EIJ H;  3P7N A;  5DYM A;  3I71 A;  4WX9 A;  1U5T A;  3S1N J;  3TDU C;  3ZCO A;  2XDV A;  1MSF C;  4F92 B;  5J6X A;  3WHC A;  3EPZ A;  1P92 A;  1LEB A;  1K6O A;  4A93 J;  4DYC A;  3PQK A;  2LVS A;  1MDM B;  5F0H A;  2X85 A;  2HEO A;  3S17 J;  3E5Q A;  4EVI A;  1L0O C;  5GP9 A;  3OYE A;  1FOK A;  1A6Q A;  3H5N A;  3I64 A;  3UR3 C;  2R7U A;  1ZRF A;  3CCJ I;  2L0K A;  2BY1 A;  2VJ5 A;  4RLQ A;  3S32 A;  4AUX A;  3S3O A;  1SEU A;  1GV2 A;  4LG0 A;  2NOG A;  2ZXW H;  3E3V A;  3BZC A;  1SMT A;  3W6K B;  2R3S A;  5K7H A;  3KP7 A;  4R79 A;  4Y3O A;  4UUS B;  3TMO A;  2KIS A;  3OMY A;  2HDC A;  2VPL A;  2YUS A;  5HS9 A;  4UNO A;  2M0C A;  5FKO A;  4B8X A;  2E1N A;  1D8K A;  2RAE A;  4L9T A;  1T98 A;  2BXY A;  3EUK L;  4OOI A;  1K78 A;  5HDN A;  2VI6 A;  3NWS A;  1U78 A;  2CFX A;  3K2Z A;  3UNG C;  5A2Q Z;  3CJQ B;  3OYJ A;  3OYC A;  2DCE A;  4P9U A;  1H9G A;  2OV7 A;  4UV8 A;  3RQI A;  4BH9 A;  3PIO F;  2OTJ I;  3GTQ J;  5J4Y A;  3BWG A;  2BW3 B;  3HJE A;  2EQR A;  3RKX A;  1XMA A;  2RQP A;  2NNN A;  1AHD P;  4EM0 B;  5DD4 A;  2CH0 A;  5CVV A;  1HF0 A;  2V1U A;  1DGR M;  3ZQL A;  2EV6 A;  2KLO A;  2XGX A;  1YG2 A;  3OIP A;  3DBH B;  4EMS A;  3G1O A;  4IRG A;  2CO5 A;  3WGG A;  3JRI A;  3F21 A;  2HPM A;  1UAA A;  4XKV A;  2GXG A;  5DCM A;  2KRF A;  1W0U A;  3OY9 A;  4PJL A;  1DPR A;  1X1B A;  5ED4 A;  3JR9 A;  3PNT A;  3BCA A;  3GEZ A;  1YIJ I;  4AU7 A;  2VOP A;  1QHH D;  4IHS A;  3IP4 B;  1LJ9 A;  1HLV A;  5ICC A;  1JTX A;  1VND A;  1BR4 A;  2Q2E B;  5FKK A;  1R1T A;  3LSP A;  4MNU A;  2IA2 A;  5D5X B;  1ZKG A;  1YW7 A;  3FXQ A;  4IOC F;  2IPQ X;  3TOB A;  1R49 A;  2FOW A;  2K9Q A;  1EH8 A;  4PJJ A;  2WB1 A;  4CYC A;  2DFF A;  1TW2 A;  4M3B A;  4B4C A;  3A01 B;  1ZGJ A;  2ZFW A;  2HYF A;  5HDG A;  1TBX A;  2W82 A;  3HTS B;  3M4O J;  3QP5 A;  1RUN A;  3BOQ A;  4GO1 A;  4EM2 A;  2RN7 A;  3DKX A;  3KP6 A;  1XGO A;  1BW6 A;  2EWN A;  2Y69 H;  2M34 A;  2X1D A;  4FE4 A;  3OL4 A;  3C18 A;  4HRI A;  3VSL A;  5CVU A;  4Y13 A;  1YO5 C;  2NOJ B;  3BPX A;  3BJA A;  1R5G A;  1JXS A;  2ZNZ A;  4M73 A;  1MMA A;  2EIN H;  2V9K A;  5ILS A;  3L2C A;  3ASN H;  1VQ6 I;  2EFO A;  1WJE A;  3OYA A;  2K9L A;  4UY8 I;  2VQG A;  2L7M P;  1XX5 A;  2A68 F;  1MNE A;  5E1W A;  4A3C J;  4D0P A;  1QZE A;  4ZC3 A;  2RRE A;  4CYD A;  2H1K A;  4UUV A;  1FWZ A;  4Y33 A;  1RRJ A;  1JJ8 C;  1S6L A;  2JMW A;  1HKT A;  3CDH A;  1LFU P;  2I8D A;  1JGG A;  1YIO A;  4NQW A;  4M71 A;  4II3 A;  4WXH A;  1I6H J;  2KHM A;  1HST A;  3IC7 A;  4KUM A;  3F8N A;  1XSV A;  3QYF A;  3L2R A;  3KEO A;  4MFE A;  3DEW A;  3AG2 H;  3VYT B;  4N4O B;  4GGG A;  2COM A;  4H0E A;  3IWF A;  1IXS B;  1S8N A;  3QPL A;  1UZC A;  4A3F J;  2X4H A;  3CCU I;  3MQ0 A;  1J59 A;  1APL C;  4AM3 A;  2Q1Z B;  3BLY A;  3KYD B;  2R5Z A;  1J09 A;  2M2E A;  4BUP A;  5LRR A;  3LQR A;  2Y31 A;  5L3B A;  1HKQ A;  2CUJ A;  3S1M J;  2P6T A;  3J80 Z;  1LB2 A;  4C2U A;  2H6B A;  3VYR B;  3KP4 A;  2LBF B;  2NS0 A;  2V79 A;  3FHZ A;  4M3D A;  2XF6 A;  4N9H A;  3CZ6 A;  2K27 A;  2DU9 A;  3FKJ A;  1GVJ A;  3T0Y A;  3U21 A;  3HKZ A;  3OV8 A;  3HSF A;  4XLH A;  2ZFU A;  1OIS A;  3CO7 C;  4Y4R A;  4X0G A;  4UUT A;  2XB5 A;  1X2M A;  2CUF A;  1OR7 A;  5KAF C;  3BR2 A;  4CXF A;  5K1Y A;  2YU9 J;  3NWT A;  2LSO A;  3QOP A;  3OYM A;  4K2E A;  1SVL A;  4FET A;  2V9V A;  3FK7 A;  4ENN A;  2L2O A;  1NHA A;  3LA2 A;  3HOV J;  2FBH A;  1QZY A;  2LF8 A;  3FMR A;  4Q47 A;  1U2W A;  3GZ6 A;  2BXZ A;  2E35 A;  2IAI A;  4NC6 A;  2DA2 A;  4G6Q A;  3ECO A;  1BOB A;  3FHN A;  4IO9 F;  5F64 A;  4A3G J;  4XQF A;  3ROU A;  2E1M B;  3JRC A;  1UCR A;  1P9Q C;  3HYI A;  2DYR H;  4ZTJ A;  2OD5 A;  1NG6 A;  3RPU A;  2ESH A;  1LDJ A;  4XBF A;  1LNW A;  4ZH4 F;  1KU9 A;  2ME6 A;  2WA0 A;  3H5R A;  1CQT A;  3AFH A;  2K5C A;  3AL0 C;  2HDW A;  4RB0 A;  5TGT A;  2F2E A;  4YII A;  2ICW G;  2HYJ A;  2RQQ A;  3WTZ A;  3LSH A;  1JT6 A;  3J81 Z;  2AQF A;  2XPV A;  4W97 A;  4WXC A;  2ZSH B;  3ZQQ A;  2X0L A;  2K9M A;  2Z5U A;  1PUE E;  4NNJ A;  5LHH A;  4HBL A;  1KZH A;  3HOW J;  2IEK A;  3D5L A;  1OPC A;  2L5Q A;  4I99 C;  2QUF A;  1TNS A;  5EZH A;  4UUS A;  2XAF A;  3QPH A;  1G6N A;  2R7W A;  3KPH A;  3KCC A;  2EZI A;  1R4N B;  2DK5 A;  5ERI A;  2AS5 F;  3F23 A;  1YJW I;  1KQ0 A;  3HOS A;  4AVP A;  2CUZ A;  2ACJ A;  3T8T A;  4PUS A;  2QKM B;  2DO7 A;  4I76 A;  3M8J A;  2OUM A;  3A2K A;  4LD5 A;  1MNM C;  2JK3 A;  3WE2 A;  3B02 A;  3FXK A;  5J1U A;  1RIO H;  1TQP A;  2CUE A;  4IHY A;  2HQR A;  3ASO H;  1R71 A;  2HQA A;  1ZLK A;  4A3D J;  1P7J A;  3ELK A;  3CCM I;  2ZCW A;  1TW3 A;  1FBQ A;  5J3L A;  1F9N A;  2BW3 A;  3WE3 A;  1KQ9 A;  2L9N A;  4LK1 F;  3ULQ B;  4P1W A;  2CYY A;  3V8J A;  3PO3 J;  2F6C A;  1WJF A;  2K02 A;  3ABU A;  2BY2 A;  1SD6 A;  2BVL A;  2HKX A;  5GAE J;  2JRT A;  2JRM A;  2R7R A;  3VSK A;  2Z33 A;  3SYT A;  5CQG A;  5M3F J;  2ZJR F;  1LDD A;  3ZGK A;  1K61 A;  5HS8 A;  3DP7 A;  4U87 A;  4RB2 C;  3FM3 A;  2ZJQ F;  1T39 A;  1Z91 A;  4MEX F;  1V54 H;  2K85 A;  3RYR A;  2DA6 A;  4XOR A;  3GFJ A;  4XIC A;  1S3J A;  2Q2E A;  2DQL A;  3CUQ C;  2R7X A;  3WU0 A;  2CV2 A;  4JBA A;  2DMT A;  1O3T A;  3EUH A;  4XKW A;  4XOP A;  1DU6 A;  4S05 A;  4KA4 A;  1TP4 A;  5M5Y J;  2B7E A;  2HQ5 A;  2CW0 F;  2NAZ A;  1XGM A;  3HHH A;  3CP2 A;  3K4B A;  2HOS A;  2O6G E;  3A01 A;  1K6Y A;  4KIC A;  1HXD A;  3HBL A;  4YEJ A;  1YJN I;  4KIT B;  3K1P A;  3QOE A;  4HF0 A;  4ZYE A;  3BTI A;  5E1X A;  2HFH A;  3LMM A;  2NVT J;  3CF2 A;  5HLI A;  4AC0 A;  5GPC A;  4Z6Y A;  4I98 B;  2R7O A;  1Y8R B;  1JUM A;  1T56 A;  2LKP A;  5HDK A;  3IAM 2;  3M1C A;  3WTX C;  2STW A;  4I02 A;  2R4G A;  5FKM A;  1GHC A;  2QEN A;  2W48 A;  1PP7 U;  1IW7 F;  1S7A A;  2B63 J;  2R92 J;  2X6Y A;  1FSE A;  1OCO H;  4ZDP A;  4GYI A;  3F8M A;  4DZJ A;  4WF2 A;  2ZME C;  4JX5 A;  3S1R J;  3FXR A;  1V5E A;  5B1A H;  4YEL A;  2VBY A;  4CH7 A;  4YFK F;  1HCR A;  2XAH A;  4B3X A;  4F91 B;  3HTU A;  1HC8 A;  4A3L J;  3F3X A;  1Z6R A;  2I5U A;  1XTA A;  5D8K B;  1OJL A;  1HBX G;  3FXU A;  2VQH A;  2HS5 A;  3GZ5 A;  4S0H B;  4MO7 A;  3MCZ A;  2JPB A;  3OYI A;  3PQJ A;  3CTA A;  4XKC A;  1UMQ A;  3M7G A;  1OCC H;  3HC7 A;  3FMS A;  2L7K A;  3CDI A;  3R60 A;  3ABL H;  4UV9 A;  1FYK A;  3CD6 I;  1MBE A;  1XS9 A;  2A6E F;  4E7J A;  5B5E C;  1NK3 P;  3CMA I;  1TQI A;  3BT9 A;  3QYE A;  4G7O F;  5CYV A;  3K4J A;  2G0E A;  1WKM A;  5IOZ A;  3OYF A;  4BQQ A;  2PEX A;  3PNV A;  5ILV A;  4EM1 A;  2ZBK A;  3EET A;  5EZG A;  4A3J J;  1FTT A;  4BL0 B;  1LPQ A;  4P96 A;  3M8F A;  4ESJ A;  1D1A A;  4XID A;  5FJ8 J;  1A36 A;  1MBH A;  2RV8 A;  3ZN1 A;  4G8X A;  3JRF A;  4BBS J;  1IN7 A;  2A61 A;  1LE8 B;  5L3G A;  5GAG J;  2DLL A;  1LVK A;  2PG4 A;  2DQR A;  1YYV A;  4RDU A;  2W4S A;  4UB6 C;  4AYB N;  5J47 A;  1IN8 A;  4DNC A;  1BIB A;  2OCE A;  3ZMV A;  5J8C A;  3I5U A;  1X1P A;  2BEO A;  3S3N A;  3K4K A;  4XRS G;  2MC3 A;  1O7F A;  5IT3 A;  3FKI J;  1ONV A;  2FA5 A;  3O8G A;  3TL4 X;  2JA2 A;  3BR0 A;  1O3R A;  1FYM A;  3EYI A;  2FOK A;  3EQL F;  1OCT C;  1J0R A;  3I58 A;  1R5I D;  4IHX A;  1FT9 A;  3BR5 A;  2Y2Z A;  3GTM J;  3GZN B;  2Y9Y A;  4GRI A;  1FC3 A;  4ABZ A;  3K0L A;  3BJ6 A;  3CC7 I;  5BS6 A;  1Q1V A;  4B44 A;  1T2K A;  2JVH A;  3CUQ B;  1FLI A;  3CJT B;  3HIF A;  3IKT A;  2HXI A;  3JRB A;  1W7P D;  1QPM A;  5JHF A;  2LY9 A;  3KEY A;  3I55 I;  3W2A A;  4YIR X;  2VQC A;  2VE8 A;  5M3M J;  4LJZ F;  3KZZ A;  4B3A A;  2O0Y A;  5CLS A;  4HPQ A;  4HSR A;  4BDZ A;  3KP5 A;  2CG4 A;  2KKO A;  3ML6 A;  2DMN A;  1IUF A;  1QGP A;  2JUC A;  1STZ A;  1ETW A;  4CCK A;  1G8X A;  4EJV A;  1IRF A;  3TW7 A;  3ERE D;  4X6A J;  2HVQ A;  1OQY A;  1BIA A;  4WXD A;  4OIO F;  1GDT A;  3PNY A;  1HDP A;  1HA8 A;  3R61 A;  2XAU A;  3GTG J;  1QHG A;  3CCR I;  2E2I J;  1TWG J;  1FPQ A;  4L0Y B;  2QQ8 A;  2EIL H;  5A2Q K;  3A1Y A;  1LQ1 A;  2K40 A;  3MEX A;  3COA C;  3I53 A;  5F04 A;  1VQO I;  2P0W A;  3HSR A;  5KCM A;  1JI8 A;  1UG2 A;  4CUG A;  2P6S A;  2KIF A;  3CQZ J;  3SZT A;  3HOT A;  4FTH A;  5KVR A;  2HR3 A;  4AWX B;  4ZZD A;  5E8I A;  4PGG A;  3VEP A;  3N97 A;  4WK8 F;  4ZYA A;  2XGC A;  1G59 A;  1K4S A;  3NRV A;  4J00 A;  5CQE A;  3BPV A;  4P5O A;  1BI0 A;  5TJJ A;  3IRR A;  3Q0W A;  3L2W A;  3FIW A;  3RZO J;  4ZYD A;  4LLN A;  4M9X A;  4BHC A;  5LHG A;  2TDX A;  5BOX A;  1PUF A;  4JOM A;  4IHT A;  1ZG3 A;  3GCM A;  3MWM A;  3CCY A;  1PVE A;  5AIP A;  4BE0 A;  1O57 A;  3ZQF A;  2JA5 J;  4BGD A;  5M5W J;  2XF7 A;  2F5F A;  5K7Z A;  3NAR A;  2HGC A;  2K9S A;  4M9Z A;  4IHV A;  1IDZ A;  5L3D A;  5H20 A;  3FIS A;  3HOX J;  3E7L A;  2CQX A;  3F9K A;  2XKP A;  4GYG A;  3RDI A;  3I3L A;  2R0Q C;  5EEH A;  1ZG5 A;  2VQL A;  1K7A A;  2QKL B;  2O03 A;  3HRS A;  1ZG1 A;  2CW7 A;  1OYW A;  3IV5 A;  4HLX A;  1FYL A;  1F4K A;  3CCE I;  2QYO A;  2DOD A;  3BTL A;  4IKF A;  1MJA A;  4OWR B;  2COB A;  1XSD A;  3FBN B;  1W7P B;  3R6S A;  4X1E A;  3BJO A;  3R4K A;  3SFI A;  3CMM A;  1D8J A;  2RNG A;  5B1B H;  2IVM A;  1I1S A;  4L9J A;  2K3P A;  3SEZ A;  2PX9 A;  1YX5 A;  3H0G J;  4DBR A;  2FNP A;  4IQJ A;  5HLH A;  5DD8 A;  4XLF A;  1SD7 A;  2KT0 A;  1RR7 A;  3CJN A;  1IN5 A;  4HX4 A;  3LOC A;  3DLL F;  1E17 A;  3S93 A;  2ID6 A;  2VN2 A;  4LB6 B;  3S15 J;  2ZJ2 A;  4MFD A;  3ZRG A;  1YLF A;  5F27 A;  4N0B A;  5FRN A;  1N75 A;  3F6V A;  1YW9 A;  4HNV A;  4ZTF A;  3Q5F A;  3FDY A;  4MQ9 F;  1CGP A;  2XKO A;  2DDB A;  2Y30 A;  2ADU A;  4C3J J;  3OS2 A;  2LY2 A;  3J80 K;  1GVD A;  2VJJ A;  3CC4 I;  2ELJ A;  1TWF J;  3G3Z A;  4U7D A;  2QA4 I;  1WJD A;  5KK1 A;  3KYL A;  2GLO A;  2MD5 A;  4RGU A;  2DK8 A;  2E7W A;  4XLN F;  2CGP A;  4M72 A;  5LEJ A;  1I3A A;  2PMU A;  3K70 C;  3IRQ A;  1ZN2 A;  2P5V A;  3RQ4 A;  1I39 A;  5L3E A;  1LE8 A;  3HM5 A;  3R0A A;  4A6D A;  2DFH A;  3K69 A;  2KQR A;  3MZY A;  3BZK A;  1EJ9 A;  5L3C A;  1M1E B;  4BKX A;  2VC0 A;  2DMQ A;  4F7Z A;  2AXT C;  2FSW A;  2KP6 A;  4CHU A;  1WJA A;  2XAJ A;  4OAZ A;  2EPF A;  1HQC A;  4OIQ F;  4RA2 A;  3E5U A;  4JQF A;  5CJ9 A;  3K70 D;  3ERM A;  5DV5 A;  2VBW A;  2P7V B;  5FLX Z;  1X3Z B;  2IW5 A;  3BG9 A;  2MBF A;  2WTE A;  1P4X A;  1Z21 A;  2L3D A;  5LHI A;  3DFG A;  2WAQ N;  4BAC A;  1BI1 A;  1A6I A;  2ZB9 A;  4JP0 A;  3L1P A;  1JT0 A;  2GXB A;  4S04 A;  2GQQ A;  2O9L A;  3C2G A;  6PAX A;  3CUQ A;  3C1D A;  4PFO A;  1YX3 A;  2GIZ A;  1AA7 A;  3TOA A;  3G73 A;  3ZQC A;  1P4W A;  2GIV A;  3OOP A;  1H88 C;  4RAY A;  2A07 F;  3DXJ F;  1R23 A;  1P4A A;  2XAG A;  2YU3 A;  2ISZ A;  4PJN A;  1U9N A;  1XCV A;  3J81 K;  1IUY A;  2EFP A;  1LDK B;  4MHG A;  4N4N B;  1U0J A;  3GTK J;  1GV5 A;  2JVG A;  3KEQ A;  4I09 A;  2LLK A;  1FBU A;  3K7A J;  3QOD A;  2FBI A;  2M3A A;  2HZD A;  2NS7 A;  4ENK A;  1J75 A;  5BQT A;  1VQ8 I;  1D0X A;  4JK1 X;  2LNB A;  1IV8 A;  1QQI A;  1VI0 A;  4AD9 A;  2MLG A;  3AAF A;  2M45 A;  3LSJ A;  1E3H A;  4V2F A;  2EFN A;  4XSZ F;  1WI9 A;  5FRM A;  1B4A A;  2FMY A;  3K2A A;  5DM6 F;  3O8H A;  2E1M C;  2ZME A;  3WU1 B;  1HOM A;  4IOA F;  1V3F A;  2XRN A;  2CQK A;  5BMZ A;  2D1V A;  1OCZ H;  2XF5 A;  2DXI A;  4IXA A;  4O3M A;  2UZK A;  1KYW A;  1U9O A;  2EZK A;  2FUG 2;  4B48 A;  5AIQ A;  2XSJ C;  2JSP A;  2O5R A;  2VOO A;  2Y48 A;  4CA0 A;  2CSO A;  2H8W A;  2CQQ A;  2DW4 A;  1TWA J;  4UVA A;  5IOY A;  1Y0U A;  5IPA A;  4I2O A;  4O5V A;  3HRM A;  3MZ8 A;  2ELH A;  2FEZ A;  2HZT A;  3ONQ A;  4C3H J;  3VB2 A;  1PJR A;  4M3F A;  1AU7 A;  4A3B J;  1VQP I;  2JQ7 A;  4LOC A;  1QVU A;  1FY7 A;  2L7F P;  5GPA A;  3RYP A;  2W84 A;  2Z1D A;  2GXA A;  3CP8 A;  1N78 A;  4YIF A;  1ETQ A;  2NRA C;  3BG3 A;  4MTE A;  2STT A;  2LH9 A;  2DA7 A;  3M3Y J;  3GO5 A;  1KQ8 A;  3SQN A;  3AG1 H;  2JUG A;  1BI2 A;  3VYS B;  4ASN A;  1VFC A;  1X3W B;  1V4R A;  2OQR A;  2M8G X;  3LFK A;  3PFY A;  5LFA A;  3N4M A;  1RKT A;  1XC5 A;  3FXO A;  2HU9 A;  4J19 A;  2P5L C;  4LK0 F;  4KT5 C;  3IH4 A;  1MND A;  1YOV B;  3SJM A;  4A3M J;  3MKY B;  5EGO B;  4XON A;  2JT1 A;  2MH2 A;  1W7P A;  2H8R A;  1VQ7 I;  2B0L A;  2E1C A;  2NXN B;  1EKE A;  2E7X A;  1XN7 A;  2Y0S A;  2DTZ A;  3DTK A;  2XV4 S;  4FT8 A;  2DBB A;  2L02 A;  2XPW A;  4P55 A;  1LVA A;  1F5T A;  2VJI A;  3MKL A;  1SFO J;  2FF4 A;  4RAG A;  1IRZ A;  3LA3 A;  3G1L A;  3F8C A;  4HX8 A;  4BY1 J;  4ZYH A;  1P2F A;  5F08 A;  4R8H A;  3IHU A;  3V7S A;  4DYQ A;  2E5Z A;  3LFU A;  5GTH C;  2DI3 A;  4NBQ A;  3VPR A;  1S7E A;  2ZKZ A;  3JTG A;  3L9F A;  5ILU A;  1WHU A;  1X4P A;  4ENM A;  2VIX A;  1O3S A;  1MJ9 A;  1ACI A;  2VBX A;  1OCP A;  2EA2 A;  1X1D A;  3ZQI A;  1Z77 A;  4IJA A;  5HLG A;  1B1B A;  4OMZ A;  2ELK A;  2QBY B;  3I0T A;  3S2W A;  2JWT A;  3E6C C;  1YRN B;  3U9G A;  3ZQH A;  2YS9 A;  1BBY A;  2DTR A;  5H2F C;  1DGW Y;  4G7Z F;  2XB0 X;  3HSE A;  3NQO A;  4CSW A;  4ZJZ A;  2ID3 A;  1MDM A;  2O7O A;  3F8F A;  4MGR A;  5D5W B;  1YQA A;  3BDD A;  3MFK A;  3KLO A;  3DPU A;  4PCQ A;  1IG7 A;  2DPU A;  2K86 A;  1IXC A;  1SMY F;  1FX7 A;  1N77 A;  5EG0 B;  3M8E A;  5LD2 C;  2IGO A;  3BP8 A;  3FMQ A;  4A0Y A;  1FNN A;  1U8B A;  4RAZ A;  3RIR A;  3DCF A;  3IAS 2;  5HOD A;  2WV1 A;  4RB1 A;  4BXX J;  1Z3Y A;  1G3S A;  4ESF A;  3KZI C;  3OYD A;  3I4N J;  2O3F A;  2XUB A;  1ZYR F;  3X2Q H;  2DJI A;  1OFC X;  5D5V B;  5JHU A;  3Q0U A;  2ZNY A;  4CCL A;  2OZ6 A;  2EV0 A;  2EIK H;  2F4M B;  3W6V A;  3V7R A;  2KZV A;  1D0Z A;  1MZB A;  3JRA A;  1HDD C;  4GFB A;  1GXQ A;  1J9I A;  2VAS A;  5CVJ A;  3SFZ A;  5D5U B;  4AYB A;  4NC8 A;  2PBI A;  3FZV A;  1O7L A;  3MD2 A;  5FKL A;  3PUF A;  4HX7 A;  2DOF A;  2VBZ A;  1B8I B;  1TT0 A;  1PP8 F;  2DJN A;  4FIS A;  4FCY A;  4IRI A;  1S29 A;  3T5X A;  2KDO A;  3TQN A;  5E3N A;  2QSG X;  4LB5 A;  4M9S A;  3U1D A;  3KX2 A;  3BG6 A;  4XLA A;  2M9H A;  3M1E A;  2JA6 J;  1EV7 A;  2OC6 A;  1RET A;  2IP2 A;  1IGN A;  2CWE A;  2CS3 A;  3ZXS A;  5B66 C;  1VQ5 I;  2PQ8 A;  2CQ7 A;  3H3V K;  3WTV C;  2W24 A;  1ZGA A;  3CJR B;  4PGH A;  1IO2 A;  2GWR A;  1PDN C;  2HOT A;  3TP3 A;  1D5V A;  5IYB J;  4BJ6 C;  4U0W A;  5K5O A;  1FZP B;  2BZT A;  2IXS A;  2IS2 A;  1FJL A;  1Z0X A;  4DW6 A;  2QQA A;  1WJC A;  2V9P A;  2E36 A;  3JAM Z;  1R58 A;  4HEA 2;  2KPM A;  2BY0 A;  1R5H A;  3PL8 A;  2P81 A;  1MH3 A;  1X4O A;  4LIV A;  1JTY A;  3LQQ A;  1DP3 A;  2CW8 A;  1WJB A;  2A5W A;  2AO9 A;  1VQK I;  3J7A Y;  2M1B A;  2K3F A;  2AQE A;  4JX6 A;  1E3O C;  5CKT A;  3D5R C;  2P7C B;  4OMY A;  3BTJ A;  4KMF A;  2F5E A;  2K9N A;  1S7O A;  3DBR B;  3CCV I;  4XR6 A;  3S8P A;  2M8E A;  2BY3 A;  3GXO A;  4ZDL A;  2ME0 A;  2OAZ A;  1R00 A;  1GLN A;  2WC2 A;  1SFK A;  3T1B A;  5JFR A;  3G2B A;  2A05 A;  1R1V A;  5JLW A;  3DQV C;  3KE2 A;  4CGZ A;  3S2D J;  2OQG A;  4E70 A;  1Q1H A;  3J7Y J;  2D45 A;  4HF1 A;  4PJM A;  4FHT A;  5IY5 H;  4LIU A;  2R7T A;  3G71 I;  4QPQ A;  4P9F A;  1FP2 A;  4G9Y A;  3GLX A;  3CC2 I;  2TCT A;  2R7V A;  3KLN A;  2EV5 A;  1KU2 A;  1WH7 A;  4LIT A;  4XMY A;  3V42 A;  3HEF A;  2AHQ A;  4TV7 A;  2H6C A;  2VON A;  2R5Y B;  5J40 A;  3GTP J;  1Z67 A;  1ON2 A;  3QRF F;  3GLL A;  4HF2 A;  2NVY J;  3HKZ N;  1A5J A;  2D2W A;  4IVN A;  2M5W A;  4N9I A;  3GTJ J;  4QSH A;  2W1O A;  3HGY A;  4QLC U;  3RKW A;  2CFO A;  5EGO A;  2EBI A;  3KET A;  3TDZ C;  1UST A;  2VC1 A;  4LFU A;  1JUS A;  1LEA A;  4B1R A;  1TC3 C;  1NTC A;  1AKH B;  3GTL J;  2KZG A;  3ZMS A;  5TRD A;  1KA8 A;  3ABM H;  1FMW A;  1BC8 C;  1W1W E;  4BAY A;  3JRE A;  2K7L A;  3K4N A;  1GUU A;  3OWT A;  5FFZ A;  4I01 A;  3H35 A;  2CMP A;  3F6O A;  4KIS A;  2LBF A;  3ZQ7 A;  5FO5 A;  1MMG A;  3MN2 A;  2W57 A;  5TIS C;  2XGE A;  3L2U A;  2PLY A;  2KL4 A;  4AID A;  2X1E A;  5BPI A;  5CVI A;  3FWE A;  3BG5 A;  3L09 A;  1BJZ A;  1TWC J;  1SVO A;  3A4C A;  1W4M A;  2QF7 A;  5IP9 J;  1X19 A;  4Z2Y A;  2DMU A;  1BJA A;  1WVR A;  2VUM J;  1IJW C;  2GAU A;  1IRX A;  3ECH A;  2G7U A;  3OIQ A;  5HS7 A;  5M5X J;  1YFH A;  2QBY A;  5DUI A;  1YRN A;  2FJ1 A;  2VKD A;  3VOE A;  5DTD A;  5FKN A;  3H0D A;  4KNY A;  1ODD A;  4RS8 A;  4L9V A;  4RAF A;  3QP6 A;  3M9A A;  2PI0 A;  4KFC A;  2Q0O A;  3H3U A;  3SHF A;  5J4V A;  3DU5 A;  1FIP A;  2QWW A;  1KGS A;  3QU3 A;  5JR3 A;  5F1J A;  2A6H F;  1U6G A;  3TO9 A;  1PYV A;  4HZF A;  4XLC A;  5LGN A;  1TLH B;  2W25 A;  3SDG A;  3O3K A;  2BHZ A; 
#chains in the Genus database with same CATH homology
 4MFD A;  2JA8 J;  5EYR A;  5F27 A;  5EEA A;  1X2N A;  1ETV A;  4HNV A;  3QQA A;  4G12 A;  1BA5 A;  2OPT A;  2L7M P;  1UHS A;  4A3C J;  2Y30 A;  1ZGW A;  4C3J J;  2H1K A;  3A03 A;  1JJ8 C;  3PO2 J;  2JMW A;  1GVD A;  3QPS A;  1LFU P;  1JGG A;  1TWF J;  1ITY A;  3HDD A;  2JJ7 A;  2GLO A;  2XGD A;  1I6H J;  1MBF A;  3PM1 A;  4MFE A;  1I50 J;  3DEW A;  2HXO A;  5E3L A;  1LE8 A;  2DN0 A;  3HM5 A;  5IP6 A;  1PUF B;  3QPL A;  1WGX A;  3BR1 A;  5IYC J;  1EF4 A;  1DU0 A;  1BW5 A;  4BKX A;  2DMQ A;  4A3F J;  1APL C;  2CRG A;  4A3I J;  1B8I A;  2R5Z A;  2M2E A;  2MG4 A;  2Y31 A;  3HGG A;  3S1M J;  3HOY J;  1MSE C;  2Y0S N;  3BG9 A;  2FX0 A;  4D5F A;  2DA3 A;  4M3D A;  2WAQ N;  1A6I A;  2ZB9 A;  1WI3 A;  3GTO J;  4JP0 A;  3L1P A;  3OSG A;  1JT0 A;  3A02 A;  2EZL A;  2O9L A;  4UUT A;  2XB5 A;  1X2M A;  2CUF A;  3ZQC A;  1H88 C;  3BR2 A;  4RBO A;  2YU9 J;  4NDL A;  1B72 A;  3BQZ A;  1U9N A;  3LSR A;  4Y7N J;  2OF7 A;  3FK7 A;  2NVX J;  3HOV J;  3GTK J;  1GV5 A;  1Y1V J;  4CYC B;  2R93 J;  2LLK A;  3K7A J;  2IAI A;  2DA2 A;  4BY7 J;  2NS7 A;  3CDL A;  4A3G J;  3LNQ A;  3JRC A;  4XRM A;  1MBK A;  2HOA A;  4V2G A;  1VI0 A;  2ECC A;  2E19 A;  1O4X A;  3LSJ A;  4V2F A;  3JRD A;  2ME6 A;  1CQT A;  3K2A A;  1ENH A;  3HB9 A;  2HYJ A;  3O8H A;  4A3E J;  2D5V A;  4L5E A;  1JT6 A;  1HOM A;  3UKG A;  4Y52 J;  2XPV A;  4W97 A;  2VKE A;  3HOW J;  3B6A A;  5EF6 A;  1GT0 C;  2IEK A;  1U9O A;  2EZK A;  1RPW A;  5E3M A;  3TED A;  2TRT A;  1ZR2 A;  1RES A;  5EZH A;  4UUS A;  1ETK A;  1QRY A;  2EZI A;  2R5Y A;  2LTP A;  1P7I A;  2CQQ A;  5IOY A;  1TWA J;  5IPA A;  2XPU A;  4M6V A;  3CMY A;  3NAU A;  4C3H J;  4I76 A;  2E1O A;  4M3F A;  1AU7 A;  1MNM C;  4A3B J;  2JK3 A;  1RKW A;  5DS9 A;  3HOZ J;  4LOC A;  1QVU A;  5J1U A;  2LR8 A;  2CUE A;  1ORK A;  4IHY A;  2L7F P;  5GPA A;  5EG0 A;  4EEF G;  1WPK A;  1ETQ A;  5EDN A;  4A3D J;  2GM4 A;  3BG3 A;  1P7J A;  1IDY A;  4D7N A;  1AKH A;  2NS8 A;  3C2B A;  2DA7 A;  3M3Y J;  5J3L A;  3D1N I;  3S16 J;  1VFC A;  5C3E J;  3PO3 J;  5K7F A;  9ANT A;  3LSG A;  2M8G X;  1RKT A;  1XC5 A;  5M3F J;  4J19 A;  3HOU J;  2L9R A;  1JKR C;  3IH4 A;  2R7Z J;  1K61 A;  3S2H J;  3SJM A;  1JKO C;  4A3M J;  2MW8 A;  5EGO B;  2DA6 A;  4XIC A;  1LFB A;  2FQ4 A;  2LP0 A;  2H8R A;  1Y1W J;  2CU7 A;  2DMT A;  4BBR J;  4I6Z A;  1JKQ C;  1G2H A;  2JA7 J;  1SAN A;  4W1U A;  2DTZ A;  5M5Y J;  2HQ5 A;  2HI3 A;  4QTR A;  2XPW A;  2HOS A;  3A01 A;  3OIO A;  3Q3S A;  1MBJ A;  3MKL A;  1SFO J;  3HBL A;  1W0T A;  1IRZ A;  3G1L A;  4BY1 J;  1WH5 A;  4D7M A;  3I4M J;  3BTI A;  2LD5 A;  2NVT J;  1JUP A;  5F08 A;  4AC0 A;  5GPC A;  4DYQ A;  4M3G A;  5C4J J;  1JKP C;  2DA1 A;  3OOU A;  3VPR A;  3S1Q J;  1JUM A;  1S7E A;  1T56 A;  2X9D A;  5FKM A;  3S14 J;  1MBG A;  2W48 A;  2B63 J;  2R92 J;  1OCP A;  3ZQI A;  2PMZ N;  1Z77 A;  2LK2 A;  4DZJ A;  2ELK A;  4JX5 A;  3S1R J;  2JWT A;  4XK4 A;  1YRN B;  2JN6 A;  3ZQH A;  2YS9 A;  1HCR A;  2XB0 X;  1QPI A;  1ZQ3 P;  4A3L J;  2ID3 A;  1IC8 A;  2O7O A;  4M3E A;  4DYR A;  1OJL A;  5BNG A;  2IBD A;  1IG7 A;  4S0H B;  4MO7 A;  2LFB A;  5EG0 B;  2O8K A;  1UMQ A;  2GBY A;  1U8B A;  5HOD A;  3DCF A;  2XSD C;  4BXX J;  2WV1 A;  4JYK A;  1MBE A;  1XS9 A;  3B6C A;  5FLM J;  1NK3 P;  1H89 C;  3Q0V A;  3IH2 A;  3I4N J;  3BT9 A;  3FK6 A;  5C4X J;  2G0E A;  1OFC X;  2MGQ A;  5IOZ A;  3Q0U A;  1ETO A;  2VKV A;  3W6V A;  3JRG A;  5EZG A;  4A3J J;  2DA4 A;  1FTT A;  3JRA A;  1ETY A;  1HDD C;  4XID A;  5FJ8 J;  4GFB A;  1MBH A;  2XRL A;  4BBS J;  1LE8 B;  1QVT A;  3BQY A;  3GBG A;  2QCO A;  2DA5 A;  4RDU A;  1FEX A;  4AYB N;  5FKL A;  2VPR A;  1B8I B;  2R5Z B;  2EH3 A;  4A69 C;  4IEJ A;  2MSY A;  4FE7 A;  4XRS G;  2EZH A;  1XG1 A;  2DJN A;  4FIS A;  3FKI J;  4FCY A;  3O8G A;  1D5Y A;  3BR0 A;  1VF9 A;  5J1R A;  5E3N A;  2I10 A;  1OCT C;  1WCM J;  1K83 J;  1MH4 A;  2E2J J;  4IHX A;  2M9H A;  3BR5 A;  2Y2Z A;  3RZD J;  3GTM J;  2Y9Y A;  2JA6 J;  1FIA A;  4ABZ A;  1RET A;  4JX4 A;  1IGN A;  1TWH J;  1NK2 P;  1F36 A;  2L7Z A;  1Q1V A;  3JRH A;  3H3V K;  2X6O A;  2HXI A;  4C3I J;  3JRB A;  3BR6 A;  5C44 J;  3TP3 A;  2HOT A;  5IYB J;  2DMP A;  1B72 B;  2LY9 A;  1FJL A;  3S1N J;  1Z0X A;  4DW6 A;  1I3Q J;  1MSF C;  3BTC A;  5M3M J;  4B3A A;  3WHC A;  2P81 A;  1MH3 A;  1JTY A;  1IV6 A;  4A93 J;  2AO9 A;  4JX6 A;  2DMN A;  1IUF A;  4DYC A;  3G1M A;  1E3O C;  1DU6 A;  2LVS A;  1ETW A;  2KDZ A;  3BTJ A;  2K9N A;  5F0H A;  3TW7 A;  3RKQ A;  3S17 J;  4X6A J;  5GP9 A;  2ME0 A;  1ZTR A;  3F0C A;  1ZR4 A;  1GDT A;  1HDP A;  2L0K A;  3GTG J;  2E2I J;  1TWG J;  5JLW A;  3S2D J;  5IP7 J;  5F0C A;  2K40 A;  2X48 A;  4MIM A;  5F04 A;  4AUX A;  3ZOB A;  3BR3 A;  1GV2 A;  3WHB A;  1UG2 A;  2NOG A;  1POG A;  2NVQ J;  2TCT A;  5K7H A;  3CQZ J;  4FTH A;  2Y9Z A;  3IH3 A;  1WH7 A;  4UUS B;  1F43 A;  5IYD J;  2XGC A;  3HEF A;  3TW6 A;  2AHQ A;  4MLO A;  2R5Y B;  3GTP J;  2YUS A;  5FLV A;  2M0C A;  5FKO A;  3TP0 A;  1A5J A;  2NVY J;  3HKZ N;  3Q0W A;  2RAE A;  3RZO J;  3FIW A;  2ECB A;  2FD5 A;  2VI6 A;  3GTJ J;  1U78 A;  4QSH A;  5F0F A;  5JLX A;  3HGY A;  5EGO A;  2EBI A;  4A3K J;  1PUF A;  4IHW A;  1JUS A;  4B1R A;  1TC3 C;  3CCY A;  1NTC A;  3RQI A;  1R9T J;  1AKH B;  3GTL J;  2HDD A;  3MVP A;  3GTQ J;  3ZQF A;  4XRS A;  2JA5 J;  2EQR A;  3JRE A;  5M5W J;  1ETX A;  5K7Z A;  1GUU A;  3NAR A;  4QIW N;  1AHD P;  2K9S A;  4IHV A;  1IDZ A;  1HF0 A;  2LKX A;  3FIS A;  3MN2 A;  3HOX J;  3ZQL A;  3E7L A;  2XGE A;  3G1O A;  2CQX A;  3JRI A;  2E2H J;  2CJJ A;  2R0Q C;  5J1Y A;  3BG5 A;  1BJZ A;  1ZK8 A;  1TWC J;  1W0U A;  3IV5 A;  1X58 A;  3BTL A;  2QF7 A;  5IP9 J;  3JR9 A;  1JJ6 C;  2DMU A;  2COB A;  1HLV A;  2VUM J;  1JTX A;  1VND A;  1T33 A;  5FKK A;  3LSP A;  1IJW C;  1H8A C;  1ZKG A;  4X1E A;  1FTZ A;  3SFI A;  2K9Q A;  5M5X J;  4CYC A;  4DZP A;  1YRN A;  3ZQG A;  2FJ1 A;  5DTD A;  5FKN A;  4M3B A;  2N8G A;  4B4C A;  3A01 B;  3H0G J;  2WB1 N;  5E3O A;  3OSF A;  2KT0 A;  3M4O J;  1RR7 A;  1FIP A;  5F1J A;  1BW6 A;  2M34 A;  3LOC A;  4FE4 A;  2ID6 A;  3S15 J;  1BL0 A;  3JRF A;  4D5C A;  3SDG A;  4C2M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...