1LFBA

The x-ray structure of an atypical homeodomain present in the rat liver transcription factor lfb1(slash)hnf1 and implications for dna binding
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
RFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIVER TRANSCRIPTION FACTOR (LFB1)
publication title The X-ray structure of an atypical homeodomain present in the rat liver transcription factor LFB1/HNF1 and implications for DNA binding.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transcription regulation
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1993-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1lfbA00
2R7ZJ 1GV5A 2X9DA 3S15J 1MBKA 4V2GA 1W0UA 5F08A 2EQRA 1TWCJ 2X6OA 1OJLA 3BTJA 2YS9A 3BTLA 1ETXA 3OIOA 2MGQA 4W97A 2EZIA 4DZJA 4M3FA 4FISA 3H3VK 1Y1VJ 2YUSA 1HCRA 5EDNA 2CUFA 4IHVA 4D7MA 2DMNA 2M0CA 3B6AA 4QIWN 3BR3A 3S2DJ 5IP6A 3RKQA 5GPCA 3D1NI 5EG0A 2EBIA 4A3MJ 2O8KA 2XGEA 5F04A 1GVDA 3NARA 4XIDA 4I6ZA 2FD5A 1XC5A 2DA2A 2G0EA 1U9NA 2LY9A 1FIPA 4EEFG 2R92J 2DA7A 2DA1A 1VF9A 2EZHA 1B72A 4X1EA 3OOUA 5J1RA 4JYKA 2CQQA 2O7OA 5FKOA 3S2HJ 5E3NA 3HEFA 4UUSB 1RPWA 3BR0A 5IYDJ 2JMWA 3BG5A 5IP9J 3FK6A 3ZQIA 2R0QC 4IEJA 1APLC 3HKZN 2L7FP 5F0HA 1FEXA 4IHXA 5EF6A 1IGNA 3B6CA 4D5CA 1BL0A 2ID6A 4DW6A 1UG2A 3GTLJ 1TWAJ 4BXXJ 3IH2A 2ECCA 1FTZA 2Y2ZA 1ETVA 3GBGA 3TP0A 4IHWA 3CQZJ 2NVTJ 1W0TA 1QVUA 3ZOBA 2Y0SN 1TWFJ 2PMZN 4A3GJ 1F36A 4W1UA 1Y1WJ 1VFCA 2ZB9A 1LFUP 2TRTA 3JRFA 5IPAA 5IYCJ 2O9LA 5F0CA 1DU0A 2E1OA 2K9NA 2XGDA 1MNMC 1GV2A 2IEKA 4BKXA 3WHBA 2EZLA 3S14J 5EGOA 1T56A 3TW7A 3HOWJ 2XB5A 1SANA 3GTKJ 2RAEA 1G2HA 2DJNA 2WAQN 1JJ6C 5M5YJ 4B3AA 2NS7A 3BQYA 4M6VA 1JKRC 2HQ5A 3G1OA 2P81A 3HGYA 2K9SA 1ZGWA 3S16J 2XPWA 1H89C 4DZPA 3S17J 3JRCA 5C4XJ 3JRDA 1Q1VA 1E3OC 2LVSA 1O4XA 2EZKA 1ZTRA 1LE8A 4S0HB 1DU6A 3RZOJ 2NVYJ 4A3FJ 1AKHB 2ELKA 2LK2A 3ZQFA 4MO7A 3IH4A 5E3LA 3M4OJ 2VUMJ 5J1UA 2I10A 1ZQ3P 3PO2J 1U9OA 2MG4A 2L9RA 1F43A 2AHQA 4C3JJ 3CMYA 1WI3A 1OCPA 4XRSG 3I4MJ 2NS8A 4ABZA 4AC0A 3NAUA 1AU7A 3A01A 1XS9A 1H8AC 5J3LA 1U78A 1PUFB 2HDDA 4FCYA 2R93J 4UUTA 3SDGA 2NVXJ 3CDLA 1MBEA 1BW5A 5C4JJ 3MN2A 1D5YA 1QRYA 1WPKA 1K83J 1HDPA 2OF7A 5DS9A 3QPLA 1YRNA 2FX0A 4QTRA 1NK3P 5IOZA 3JR9A 3S1NJ 2JN6A 5J1YA 2JA6J 4A3JJ 2H1KA 1S7EA 3LNQA 2LTPA 4LOCA 4V2FA 1IG7A 4JX6A 4L5EA 3PO3J 1SFOJ 1QPIA 4CYCA 4JP0A 2XB0X 2CJJA 1LFBA 4MIMA 3UKGA 1EF4A 3WHCA 2R5ZB 2Y31A 4FE4A 2XGCA 3FK7A 1ETWA 4M3BA 2IBDA 1GUUA 5EG0B 3JREA 2WV1A 5FKNA 3GTMJ 3HOYJ 3F0CA 2XPUA 4MFDA 1WGXA 3RQIA 5GPAA 1BA5A 5M5XJ 1ZKGA 1GT0C 2ID3A 3S1QJ 4Y52J 5FKMA 1X2MA 1B72B 2ECBA 2M34A 3FISA 3QPSA 1WH7A 1ORKA 5DTDA 3S1RJ 1OCTC 3GTPJ 1Z77A 2Y9ZA 4BY7J 2L0KA 1MBHA 1BW6A 3IV5A 3W6VA 9ANTA 4M3DA 1JKQC 3Q0UA 2QCOA 4A3BJ 2NOGA 5IP7J 1VI0A 2HYJA 4B4CA 4D5FA 1B8IA 1Z0XA 3S1MJ 3C2BA 1A5JA 2NVQJ 2DMPA 2XPVA 1FJLA 4A3CJ 4BBSJ 3OSGA 4G12A 1NTCA 2FJ1A 1JKOC 5K7HA 5M5WJ 1MH4A 1HDDC 3GTJJ 3BR5A 3LSPA 1HOMA 1MSFC 3HB9A 4A3KJ 3GTOJ 4JX4A 5K7ZA 1MBFA 4BBRJ 3K2AA 3BR1A 3DEWA 2GLOA 2QF7A 1P7IA 2DA6A 3H0GJ 4NDLA 3ZQGA 3Q0VA 1H88C 3PM1A 2R5YA 3BR2A 3BR6A 2COBA 1JT0A 1RETA 3HM5A 1AHDP 2DA4A 2CU7A 2DN0A 3K7AJ 2CUEA 1MH3A 4XK4A 4RBOA 4BY1J 5BNGA 5F1JA 1IDZA 4C2MJ 2D5VA 4A3DJ 1I6HJ 2DMUA 5M3FJ 3OSFA 1JKPC 5HODA 2VI6A 3BTCA 1R9TJ 3LSGA 5M3MJ 1RKTA 2DMQA 3FKIJ 2VKVA 1JT6A 2JJ7A 4X6AJ 1BJZA 3QQAA 3BTIA 1ZR2A 1JUMA 2JWTA 3LSRA 5EZHA 4XRSA 3BQZA 5IOYA 4XRMA 4XICA 4A3EJ 1FIAA 2VKEA 1P7JA 1OFCX 4RDUA 1CQTA 1VNDA 2LD5A 3JRBA 1LE8B 1IRZA 4AUXA 4QSHA 2Y9YA 2LP0A 3HOVJ 3Q3SA 2HOAA 5EEAA 1ETKA 4DYQA 1IUFA 1I3QJ 4A93J 5E3MA 1I50J 2IAIA 2TCTA 5FKKA 2ME0A 3CCYA 2E19A 2DTZA 4MFEA 1ETOA 3MVPA 2CQXA 2B63J 1JUPA 3Q0WA 4I76A 1JGGA 2HOTA 1A6IA 2E2HJ 3A01B 3E7LA 2FQ4A 3FIWA 4B1RA 3DCFA 1IDYA 2JA5J 4UUSA 1WH5A 2R5ZA 2N8GA 1NK2P 3RZDJ 4GFBA 4HNVA 4DYRA 2WB1N 3G1LA 1YRNB 1ETQA 2XRLA 1IJWC 2JA8J 5K7FA 1JJ8C 3JRGA 1K61A 2HXIA 3ZQHA 4J19A 3BG9A 2M2EA 2KDZA 1ZK8A 3HGGA 1IV6A 4FE7A 2E2JJ 3O8GA 3TW6A 5EYRA 4AYBN 2KT0A 4M3EA 1MSEC 3A02A 5F0FA 4CYCB 1RESA 4C3HJ 1U8BA 4A69C 4DYCA 3HDDA 3GTQJ 1FTTA 2MW8A 2M8GX 2CRGA 5FKLA 1HF0A 2L7ZA 5FJ8J 1JTYA 2E2IJ 2M9HA 1JTXA 1QVTA 1RKWA 3VPRA 2MSYA 1ENHA 5F27A 5JLWA 5C3EJ 4A3LJ 1X2NA 4D7NA 3G1MA 3IH3A 3JRIA 3BG3A 2K40A 3SFIA 2K9QA 3BT9A 1GDTA 2JK3A 1IC8A 5JLXA 5GP9A 3MKLA 3HOXJ 2JA7J 4FTHA 2W48A 1T33A 2X48A 5EZGA 3HOZJ 2HI3A 5C44J 2LKXA 3I4NJ 2EH3A 1ITYA 2DA3A 1XG1A 2ME6A 2Y30A 1B8IB 5FLVA 3O8HA 1TWHJ 2AO9A 1X58A 1AKHA 2LR8A 5FLMJ 1MBGA 3L1PA 1ZR4A 4C3IJ 3JRHA 2GM4A 1ETYA 1HLVA 2L7MP 2VPRA 3HOUJ 5EGOB 2OPTA 2DA5A 2XSDC 1UMQA 3TP3A 1MBJA 1TC3C 2DMTA 1POGA 2LLKA 4Y7NJ 5E3OA 1WCMJ 3SJMA 3GTGJ 4JX5A 5IYBJ 3ZQCA 4IHYA 1UHSA 1TWGJ 2R5YB 2HXOA 3TEDA 4M3GA 4MLOA 3M3YJ 2HOSA 3A03A 1PUFA 1RR7A 3HBLA 3LOCA 3ZQLA 4A3IJ 2YU9J 3LSJA 3JRAA 1JUSA 2GBYA 2LFBA 2H8RA
chains in the Genus database with same CATH superfamily
1D1BA 1T2KA 2R7ZJ 2K86A 3QYFA 5HNHA 1K78A 2X9DA 3CUQA 3GFLA 4HX8A 4F92B 3S15J 5F08A 2EQRA 2HKXA 2CH0A 2G9WA 2BEOA 3BZCA 4Q5SF 3OYDA 4H4KC 3W2AA 4II3A 2MGQA 1IN4A 2EZIA 4G94A 4PSWA 3U9GA 5JHFA 4FISA 4OIRF 4RAZA 2YUSA 5ICEA 4E7LA 1HCRA 3H3VK 2KQRA 4D7MA 2XRNA 2DMNA 1VQPI 4MGRA 1G4DA 3S2DJ 4D0PA 2V1UA 2HYGD 3RKQA 4ON0A 5GPCA 2IJLA 4GO1A 1Z21A 3EQLF 5FFXA 1DDNA 1GVDA 3NARA 5L3EA 4P9UA 4I6ZA 3QAHA 1XDUA 2EIJH 4HRIA 2KZVA 2LBFA 4CA0A 3OYCA 1SAXA 4XMYA 1KYWA 4NBQA 2ZO4A 3P9KA 2GA1A 1B72A 4X1EA 3GZNB 3TO6A 2MFZA 4RMNA 1QU3A 3HEFA 3ULQB 3GCMA 1B1BA 3BG5A 5IP9J 1PYVA 2R0QC 3CD6I 2PQ8A 4BDZA 4XSZF 3C3WA 4YFXF 3FXRA 2KZGA 4WX9A 3Q9SA 1BI2A 2L7KA 2CYYA 3KLOA 2W24A 3ZN0A 4D5CA 4RGSA 1IGNA 4DW6A 2ZXWH 1UG2A 2V79A 4IQ4A 5HOOA 1SEUA 4IJAA 5GAEJ 3ZP5A 1N75A 4FQGA 1ETVA 2K4JA 2KLOA 1FX7A 3TP0A 3H1CA 1UZCA 4BEHA 2FQ3A 5B66C 3KP7A 3G71I 2DQRA 1NG6A 2PEXA 2VQCA 2E1NA 4LD5A 1W0TA 3QP5A 4A6DA 5HS8A 2ISYA 3K9TA 5F6FA 2BHZA 1J2XA 1WJ5A 2KIUA 2VODA 1WFXA 2QVOA 3ASNH 4HX4A 3K10A 1VFCA 5JHUA 4ZC3A 4LLLA 4OWRB 5ILSA 4C30A 2A07F 1SC7A 1EV7A 1STZA 2HR3A 3OOPA 2E7XA 2K9NA 3TOBA 4HF0A 4HBLA 4M9ZA 5EGOA 1T56A 3HOWJ 3HTUA 2XB5A 3I53A 3F8FA 5FLXK 4S04A 1JKRC 3LFKA 2DOAA 1WJDA 3HGYA 1XGNA 1VZ0A 2XPWA 2DTRA 1FNNA 1SD5A 5FO5A 2OTJI 1KU9A 3JRCA 2WBMA 3F9KA 3Q5FA 3DKWA 3K4LA 1Q1VA 3V8KA 1E3OC 4HV6A 1MMNA 2LVSA 1P6RA 4XORA 2EZKA 2P8TA 1P4XA 2OBPA 4S0HB 3RZOJ 3OV8A 1DU6A 1UELB 1GHCA 3WG7H 3EUHA 1AKHB 2CV0A 2LK2A 5AIPA 1D0ZA 2AXLA 1QGPA 1TZLA 2RGVA 4IPAA 3HTSB 1R5HA 1U2WA 2L9RA 3G4SI 1VQLI 4EGZA 2KP6A 4G9YA 2CW0F 1W1WE 4XRSG 3LAJA 1FMWA 4CCNA 1HKTA 1B59A 1XMAA 3L09A 5E1ZB 1MMDA 4IL6C 1RI7A 1XGOA 4CCMA 3IRRA 4HV5A 4UUTA 3IL2A 3SXYA 4U87A 5H6RA 5E79C 3PFIA 1AWCA 1DQUA 2ZMEA 1DGRM 1WPKA 4UVAA 5DD8A 5DS9A 4WWCA 4E70A 4BJ5C 1K78B 2PG4A 3CUQB 5FROA 1O57A 2ISZA 2O03A 2XF7A 4UVBA 3S1NJ 4PJLA 2QQ9A 2Z99A 1TLHB 3BDDA 2Z1DA 2HPMA 1IZ1A 1W5SA 5BS6A 1MIJA 3LNQA 3ZN1A 2VT3A 3AG2H 1L3LA 4ENMA 5CQEA 1IG7A 3AG4H 4AIHA 1QPIA 1OPCA 1YW9A 3PO3J 2J5OA 1BJAA 4CYCA 3OY9A 3K4CA 2L9NA 3LSTA 2UZKA 1VQ6I 1LFBA 3GF2A 2NRAC 1EF4A 2Y31A 4UHTA 1KU2A 1ETWA 1KU3A 2ZFWA 3CF5F 3HJEA 1UHMA 3QOEA 4XOTA 2G7UA 4LB6B 3K70C 4MFDA 1X1CA 3ML6A 2JSPA 2LBFB 2MABA 5GPAA 5M5XJ 3OYMA 4B09A 3PNYA 1B72B 2IT0A 1YOVB 4KA4A 5DTDA 3GTPJ 1WH7A 2M7AA 2QBYA 2ZXJA 5FD6A 2Y9ZA 4BY7J 5KVRA 3S3OA 4F3QA 2M8EA 1DP3A 2HQAA 3FXUA 2DAOA 4BQNA 3DBRB 3E97A 1JKQC 2RN7A 1K4TA 2KIMA 2OCCH 2QCOA 3KX2A 4A3BJ 2HGCA 3H5RA 1VI0A 2GIVA 1YIJI 4RA2A 2NVQJ 1FJLA 3OSGA 3TBIA 2LYCA 3WTYC 3RPQA 3V7CA 1S7AA 4TV7A 4XKBA 1HDDC 3BR5A 1KU7A 1ZG1A 2LKSA 4U0VA 4EGYA 1HXDA 5LHHA 4Y13A 3GTOJ 4JX4A 4EJWA 2HFHA 2ESNA 5K7ZA 4BBRJ 2KKOA 4BEHB 2DO7A 2GLOA 3DEUA 1P7IA 3A2KA 3H0GJ 1FLIA 5HDGA 1Z05A 3PM1A 2R5YA 2WAEA 2DDBA 3BR2A 1D3YA 2RREA 3BR6A 3S2WA 1UCRA 4XKWA 1ULYA 2OV7A 2BYVE 1W5TA 2DA4A 3DPTA 2MH9A 2EFOA 3LFUA 4PCQA 4XK4A 4RBOA 3D5RC 2QEXI 4DJAA 2CUZA 2DT7B 3O3KA 1R6RA 1JKPC 4PJMA 1HKSA 1I6XA 3OYGA 1A31A 1R9TJ 3LSGA 3P9IA 1RKTA 2DMQA 4XN3A 2M0MA 4E7HA 2ICWG 2VKVA 3EYIA 2JJ7A 4CZZA 3NWTA 2LMDA 2GXAA 2KRHA 3BTIA 3JTHA 1ZR2A 1JUMA 2W00A 4KIBA 3MAJA 3LSRA 4XNFA 3JTGA 1REPC 2Y75A 3I9V2 1QQIA 2K3PA 2CG4A 5ICCA 2STWA 4N4NB 3ZMUA 3W3CA 5ED4A 3JW4A 5D5UB 3CCRI 2X85A 2M1BA 3LA2A 1IRGA 3OWTA 3PNVA 4AUXA 4QSHA 5ERIA 4O5VA 5D5VB 2DFHA 2EV0A 4YEJA 3DQVC 3Q3SA 2NVUB 3CTAA 2D2WA 4J01A 5E3MA 1I50J 2IAIA 4EV0A 3S3MA 5FKKA 4FT8A 2V6CA 2FEZA 4FX4A 2DTZA 1ETOA 1V3FA 3SQNA 4OAYA 3S32A 2B63J 2P5LC 2FXAA 4CCOA 2DT6A 4EM0B 2K85A 1FP2A 2WB1A 4B48A 3OL3A 2JA5J 3ZPLA 4A12A 4MHGA 2AXTC 3F23A 1B4AA 3BJAA 3A0BC 3SYTA 2FU4A 5TRDA 3RZDJ 2ZMEB 3GZ6A 3AL0C 5F64A 4HNVA 3QU3A 3VODA 2Z5UA 1I3AA 1ETQA 2XRLA 4KN7X 1QA6A 5K7FA 1X19A 3LWFA 1K61A 2R7SA 4BL0B 3NWSA 3FXJA 2JVGA 3OYFA 4J19A 1LB2A 2KIFA 3DTKA 3JSPA 2GZWA 4N9IA 2WADA 3O8GA 2M4KA 1F4KA 5EYRA 2F5CA 4G7ZF 4M3EA 3DTEA 4PSXA 2X6XA 3LL7A 4PFOA 1X1DA 4M6XA 5F0FA 1ZRFA 1VQ7I 4CYCB 2IGKA 1J09A 1K7AA 2VKDA 3GTQJ 2ZJRF 4M9SA 2MW8A 5B5EC 1BOBA 5FLXZ 5BPDA 1XCBA 2L54A 3H9JA 4MTDA 3WTXC 3SHFA 1I1SA 1HF0A 3LQQA 2L7ZA 4XKVA 3FXQA 1PP7U 1JTYA 1ZYRF 2BW3A 3BG6A 2DFFA 1E0EA 3F8CA 3OS2A 1QVTA 1RKWA 1YW8A 2F4MB 2K27A 3AFHA 1ENHA 1Y39A 2Y0SA 3K0LA 4D7NA 4U0WA 5DM7F 1S5LC 3R4KA 2EILH 1T6SA 3SFIA 2QBYB 3BT9A 2XAQA 4XSXF 2VJ5A 1U3EM 3MKYB 1IC8A 3R60A 3DLAA 1OCCH 3HOXJ 4U88A 2X48A 5LFAA 5EZGA 2E5NA 3F8BA 1SD6A 1O3RA 1GVJA 3W6KB 5C44J 2LKXA 3J7ZI 2VXZA 1FSHA 1XG1A 2XGXA 1ZLJA 3F8NA 5CJ9A 5E20A 1G6NA 2QQ8A 3ZMSA 2AO9A 1XGSA 2LR8A 4ENNA 1P2FA 3FXMA 5HDNA 2F5FA 3L00A 1K6OA 1BOAA 2HZDA 3SZPA 3HOUJ 3WGHA 2R7RA 2DA5A 2VXDA 1FPQA 2LREA 1SFXA 5E3OA 3W2WA 3GTGJ 3KLNA 5IYBJ 3FBNB 3ZQCA 1UHSA 4IHYA 2XF6A 1TWGJ 2R5YB 1A6QA 2BY0A 1OCOH 1MNDA 4M71A 1I39A 3R6SA 2HOSA 5J4YA 4A3IJ 2V6EA 4CICA 4B44A 4RAGA 2ZSHB 2GBYA 3RSNA 4BNCA 1ACIA 3B02A 1G59A 2IGOA 4O3MA 2XDVA 2B7EA 1XTAA 5BPIA 1OISA 4V2GA 1R4NB 1S72I 1Z67A 1Y0UA 2X6OA 2XAJA 2YS9A 2HEOA 1YJWI 3BTLA 1F9NA 1A04A 4HEA2 4AVZA 1MNEA 3E0JB 1OCZH 2A5YB 2DT5A 2P6TA 5EDNA 2CUFA 2R7WA 2ZJ2A 3B6AA 2R4GA 1YQAA 2ZJQF 5JFRA 3TDUC 3DPLC 3HOTA 4F91B 4KITB 2LF8A 5GAHJ 2EFWA 4GDFA 1X1BA 3I54A 4KIFA 2EPFA 5EG0A 5F04A 2UXXA 2VE9A 4BXUA 1TNTA 4IF4A 2JUGA 3BC8A 1U9NA 1G3SA 2LY9A 4G6QA 3ABKH 1X3WB 2ZXIA 2DA7A 2R92J 2K9LA 2IPQX 1VF9A 4U7DA 1D1AA 3OOUA 4NNJA 1MGTA 1N78A 3ABTA 1S6LA 4D1QA 3C2GA 3K1NA 1R7JA 2MLKA 5IYDJ 3FK6A 3ZQIA 3WTZA 4RLQA 1APLC 3PUBA 5F0HA 1MJBA 4IHXA 3ELKA 1RZ4A 4BXFA 4IXAA 3BJ6A 1AOYA 2BVLA 2QYOA 4XLEA 3T0YA 3MZYA 4HPQA 2RV8A 2BXYA 1HW5A 1R5ID 1TWAJ 3DF8A 2ZJPF 3GBGA 1TTYA 3LMMA 3MEXA 2PJRA 1SD4A 3WU1B 2KPMA 4CCJA 1OMIA 3C2HA 1FSEA 4HF1A 2L02A 2K3FA 3ZOBA 4B3XA 1ZREA 2Y0SN 2F4OB 1IUYA 2A05A 4A3GJ 1JI8A 3RKYA 2QQAA 3RPUA 3HUGA 2H94A 3JRFA 1FT9A 2HU9A 1VQ9I 2QM3A 2VQHA 2BW3B 2OQGA 4XR6A 5EEHA 1DU0A 1H9TA 1MNMC 3TOAA 2NYXA 3X2QH 2IA0A 1OYWA 4IKFA 3D5LA 2DPDA 2IVMA 1Z6TA 1XX5A 2P7VB 1SFUA 3TW7A 2MLGA 2RAEA 1JJ6C 5M5YJ 3EUAA 3BQYA 1BIAA 4Y4RA 2QWWA 4CGZA 2P81A 2OAZA 2M7BA 1YJ9I 3UNGC 1V4RA 1XD7A 3IAS2 1MJAA 3K1MA 1DPUA 1BI0A 1HW1A 1ON1A 1O4XA 4LG0A 4YG2F 1ZTRA 3PFYA 3L2CA 1LE8A 3V8JA 2A68F 3ZQFA 1LFPA 3IH4A 3M4OJ 2A3SA 1SAUA 2DK8A 2VBXA 2I10A 3PO2J 1U9OA 3FXKA 3CJQB 2G7HA 2HQNA 2FMYA 2B0LA 4RGXA 4HF2A 3I4MJ 4DOZA 2NS8A 4BACA 3FXLA 4AC0A 3ZCOA 5DUIA 2JSCA 3I59A 3CCQI 1SVOA 3CMMA 4WXDA 1YLFA 1U78A 2HDDA 1X4OA 1V5EA 3CDLA 1X4PA 4OMZA 3M9AA 3IHUA 2X1DA 1D0XA 1KQ9A 2DDAA 3F3XA 2JT1A 2IA2A 3K2ZA 2E1CA 1K83J 1HDPA 2OF7A 1OR7C 3V8LA 1YRNA 2VJJA 1ZH5A 2FX0A 3JCUC 4LLNA 2LG4A 1F1ZA 5CKTA 2Y69H 4IRHA 4BE1A 3KYCB 2L5QA 4ESJA 4OMYA 4M6YA 2JUCA 1ZELA 2JN6A 3K4MA 2Z33A 2RC4A 3I0TA 3E6BA 4CSWA 2QA4I 2GAUA 2LTPA 2BZTA 3B73A 4A0XA 5JI6A 4L5EA 3HOSA 1FOYA 3FKJA 1D0YA 2XKOA 2XB0X 4JP0A 1B9MA 1JXSA 5K5OA 1YS7A 3PSIA 4MIMA 3UKGA 2CW8A 2VC0A 3FXOA 2DYSH 1HBXG 4PGHA 2R5ZB 2DODA 3RKWA 2OTLI 4FE4A 1VQNI 5BMZA 5EG0B 1GUUA 2LRDA 5LHGA 1SVMA 4AYBA 3OL4A 3CO7C 5FKNA 3RYRA 1EH7A 3GTMJ 2GOXB 4PJ0C 3HOYJ 1W5CC 1ZG3A 2HOEA 2XPUA 2YSRA 1WGXA 1ZKGA 2ID3A 2QENA 4Y52J 1X2MA 4KFCA 4UVCA 1OQYA 2ECBA 2HWVA 3MZ8A 3FISA 3DKXA 1OCTC 1HQCA 5JVTA 2IA1A 2VKHA 2VJ4A 4L0ZB 1MBHA 4DIQA 5K5QA 2QKMB 3NRVA 1RUNA 4HW0A 5KAIC 1VQ5I 3HZJA 3E6CC 2NOGA 3BPVA 5LBQA 2HYJA 1B8IA 4E7IA 4IOCF 4BBSJ 2DMPA 4MQ9F 3LAPA 1O3QA 2WWYA 4PDKA 2FJ1A 2L2OA 1IN7A 2FBHA 2QUFA 1G3TA 5K7HA 2F5VA 1B9NA 3GFIA 5DCMA 3LSPA 2XAGA 1HOMA 4F55A 3OYHA 1FYMA 2GXGA 4BE2A 2PJRB 3HRTA 3MKZA 2QF7A 2CGPA 3CCUI 4M74A 2E35A 3IWZA 1RC9A 1MZBA 5CQGA 4RAYA 3KFWX 4OIPF 1FBSA 1UB9A 4D9JA 1UAAA 4I09A 4XOPA 2C6YA 3CDHA 2P5KA 5L3BA 3HG9A 3HUGB 4HLXA 2CUEA 1MH3A 4E7ZA 2BY2A 1E3HA 5BNGA 3FMQA 3P9CA 4Q47A 5F1JA 2MH2A 3EETA 4C2MJ 4A3DJ 2K4BA 3RPUD 5M3FJ 2HZTA 2XAFA 1FP1D 3OR1C 1D8JA 2V7FA 5J8FA 3H9GA 3TQNA 1LDDA 3BP8A 2FOKA 4GRIA 4I02A 4EQQA 3BQZA 1RNLA 1ZARA 4XRMA 3CUOA 4A3EJ 4RLFA 3F21A 1T95A 2VKEA 4G7OF 1YITI 1VQ8I 5AONA 1R4MB 2K02A 4RDUA 4LG0B 3JRBA 2ZNYA 1LE8B 2F6CA 2RVCA 2Y9YA 3HOVJ 2DK5A 3ZMDA 3CF2A 4CUGA 4DYQA 5FGMA 1I3QJ 1X3ZB 4XONA 1C0WA 5IT3A 5L3GA 2ME0A 2YX7A 5D4SA 4RB2C 2A6HF 3CCYA 1X3UA 4Q4ZF 1Z91A 3RDIA 5ICGA 3MVPA 2CQXA 3C18A 3CJRB 1N25A 1A6IA 1T0FC 4IZZA 2E2HJ 3I59B 3FIWA 2XVCA 4KDPA 2M30A 1SMYF 2L9VA 4UUSA 3CUQC 4AIKA 2JQ7A 1T8IA 5KHDA 2LKPA 1BI1A 2XROA 3I56I 4DYRA 3U1KA 1YRNB 1IJWC 3CCLI 1LDJA 3JRGA 1YHQI 2KIQA 2OCEA 5A2QK 3CMAI 2LY1A 3ZQHA 4EJOA 3T8RA 3BZKA 3D0SA 3FF5A 3PQJA 3GX4X 2FOWA 5D5XB 1MDMA 3HKZA 4WXCA 3CMEI 2OU2A 4AYBN 1Z3YA 2KT0A 1MSEC 2R7DA 2KHMA 2VQLA 3A02A 3ERMA 2RDPA 2VASA 1IRFA 4Y15A 4A69C 1Z7LA 3SFZA 1D8KA 1FTTA 3FDYA 3AG1H 2M8GX 2V4JC 4XLAA 3A1YA 4HOBA 3LA3A 1IF1A 3LSIA 4IHTA 3BLYA 4GYIA 2MD5A 2M9HA 3U2RA 4ZDPA 3VPRA 3ESWB 1TNSA 4A3LJ 3L9FA 4G6TB 5DD4A 1QHHD 4RB0A 4NQWA 5E1WA 3IKTA 4LITA 4LJZF 4L18B 2IGNA 3EYYA 1TBXA 2K9QA 3GUDA 3I3LA 2PLYA 4N4OB 4R1HA 2FUG2 5HS7A 4FTHA 2W48A 3VEPA 3ZMVA 4DBQA 2JVHA 1R49A 1F5TA 2J5PA 2HI3A 4M9XA 4KMFA 1ZGJA 1ITYA 1TT5B 3M7GA 2FNPA 5CVVA 3N97A 2JRTA 1B8IB 5LRSA 3H0DA 2FBKA 3JSOA 2COMA 5HS9A 4GCVA 5FLMJ 5B3SH 1V55H 3KYLA 1ZR4A 5DCMB 3JRHA 4EJUA 4II2A 1J0RA 2GM4A 4EJVA 2L7MP 5EGOB 4UY8I 1VQ4I 1MBJA 1QHGA 3SJMA 1WCMJ 3FX3A 5CLSA 1FBUA 5LEJA 4AIJA 3IRQA 2LDUA 4E7JA 5E8GA 2OZUA 3HYIA 1E17A 2HXOA 4MLOA 3M3YJ 1PUFA 2ZFUA 3HBLA 3LOCA 3QPHA 5LRRA 3ZQLA 1TP4A 3PIPF 2YU9J 1WZ2A 2CW7A 3KP6A 3FM5A 3S8PA 4IOAF 2ZSIB 2LFBA 3E5QA 2VN2A 1S3JA 4XL9A 2PX9A 3ZMZA 2W1OA 4WF2A 3T1BA 1W0UA 2DI3A 1N77A 5BOXA 1TW2A 1R1TA 1JGSA 3ZGKA 4PUSA 2P7CB 1Y8QB 4DZJA 4M3FA 1KZHA 3EUHC 3CP8A 3DV8A 2O8XA 5J40A 4P1WA 2OUMA 1Y1VJ 1ERDA 3DPUA 3KEYA 4QIWN 3H9QA 4EATA 3F8MA 5IP6A 2Z3YA 4JQFA 1O7FA 3GLLA 4BQOA 3KP3A 3MZHA 1UFMA 4ZYAA 1KQ8A 2GQQA 1QZZA 2EBIA 3HSEA 4G6DA 2KJCA 2XGEA 2UV1A 3QYBA 4GYGA 2O8KA 2FD5A 1XC5A 2D45A 4IRGA 3CZ6A 3NEUA 4EMSA 3C7JA 2Z9OA 1Z7UA 3DBLB 1FIPA 5CVUA 3G73A 3DBHB 3KYDB 3OYJA 2DA1A 1PVEA 4E7SA 4FASD 2CV2A 2HQRA 4N9HA 5CVIA 2EZHA 3BCBA 4WCGA 2KRCA 1XDSA 2K9MA 2ZMEC 4KJZA 4B43A 5J1RA 3RYPA 2CQQA 2O7OA 1KONA 5FKOA 5E3NA 4UUSB 4BE0A 3BR0A 4ESFA 4IEJA 2JZYA 5JVGF 3HKZN 2O3FA 5EF6A 3C1DA 4A6EA 1V5FA 2H09A 3DKYA 4ZYGA 3B6CA 4FHTA 1LNWA 1FWZA 4U7BA 1K79A 2EFQA 1IAWA 4UB6C 2F5DA 2LF7A 4R8HA 4V19K 2ECCA 4S05A 3CCMI 2Y2ZA 1FTZA 1PDNC 1MDMB 1U8RA 2UWMA 2F2EA 2OQRA 1LVKA 2M5WA 4IHWA 3HPHA 1W36D 1FOXA 1YE9A 3CQZJ 1FMVA 2NVTJ 3IC7A 5D8LB 1QVUA 1TWFJ 4ZYEA 2M4GA 1D1CA 1F36A 5DDGA 4W1UA 5GTHC 1W4MA 2H27A 2OA4A 5IPAA 5IYCJ 1U5TA 4CHUA 2O9LA 5F0CA 2E1OA 1B6AA 2GIZA 6PAXA 3HPGA 3F22A 4BKXA 3WHBA 3I55I 3WODF 2EZLA 3WE2A 2V1DA 4NQWB 1NH3A 1SANA 1G2HA 1LUJB 2DJNA 2WAQN 4ENJA 2XIGA 1MJ9A 2OZ6A 4M6VA 2ETHA 2X4HA 3VOEA 5GTIC 2F4IA 2K9SA 4AIDA 1KGSA 3M8JA 3RKXA 2WA0A 3J81K 2VIXA 3ONQA 4DZPA 3S17J 1MMGA 2EWNA 2Y0MA 3I64A 3JRDA 2O61A 1IV8A 1FYKA 2LC2A 2QLZA 3I71A 2ELKA 1PUEE 4MO7A 4BU2A 3VYSB 2VUMJ 5J1UA 4Y17A 4ZYDA 4AD9A 1ZQ3P 1I5ZA 2A6TA 2VOPA 2CS3A 3OS0A 2AHQA 2DCEA 4C3JJ 1LDKB 2VQGA 3CMYA 3REOA 3BY6A 5AIQA 5E8IA 2NNYA 2WY7Q 3DWLE 4ABZA 3M8FA 1W7PA 3GFMA 3HRSA 5A2QZ 1EH6A 4XLCA 4I98B 4BH9A 3OYLA 4ZZLA 1LPQA 3MCZA 3NAUA 5BQTA 3A01A 4LK0F 4AVPA 3ISPA 4J00A 2L9SA 3L2WA 1XS9A 1GXPA 1PUFB 2ZNZA 4HSRA 4FCYA 2R93J 2NVXJ 4YIFA 5CVRA 5DYMA 1MBEA 4PK4A 1P92A 1ZRDA 4EVIA 4NHJA 3CLQA 5E17F 2DW4A 2KJBA 2PI0A 3UR3C 1JHFA 5C4JJ 2R7VA 1H0MA 1X1AA 1D5YA 2BBYA 3FHNA 4IHSA 5HLTA 1QZYA 2VJIA 3DLLF 4CZCA 1EH8A 5IOZA 1NK3P 3K4KA 4BDYA 2GA2A 5J1YA 2GOMA 4A3JJ 1PP8F 2H1KA 3KCCA 4L9NA 3TDZC 4BJ6C 3PL8A 3K4BA 2B9SA 4V2FA 3GFJA 2Q1ZB 2FBIA 4WXHA 3CDIA 4ANJA 2YPRA 2QQBA 2W84A 3E1SA 2CQNA 5D6EA 3WHCA 2V1XA 4HDUA 2XGCA 3S3NA 2ELJA 2IBDA 3JREA 1EA3A 4LMYA 5FRNA 4LG3A 3KZZA 4LIUA 1J5YA 1XGMA 1IRXA 2DQLA 4A0YA 3OS1A 3TKYA 4UNOA 5K5RA 1YW7A 3RQIA 1ONVA 2FRHA 2E5ZA 5FKMA 4I0BA 5LEKA 4IQJA 3F72A 4KN4X 3QPSA 1ORKA 3RTRA 4L9VA 2V9KA 2HNHA 1Z77A 3K69A 2VBZA 5F1RA 5CPRB 1WJFA 1P4AA 1R23A 3K4NA 1BW6A 4RB1A 1ZAOA 3DU6A 1BM9A 4RAFA 1KA8A 9ANTA 2FF4A 3HRMA 1R22A 3G3ZA 4M3DA 3Q0UA 3H92A 1VQKI 5IP7J 1LEBA 1A5JA 3WE3A 4A3CJ 2RKHA 2Z2SB 3CC2I 4G12A 3FHZA 1NTCA 1YG2A 1CF7A 1MH4A 1EKEA 3KZIC 4DQ2A 2VONA 1MSFC 3HB9A 2AQFA 1WRJA 2V9PA 2E71A 1YIOA 3K2AA 5D5WB 2AQEA 2V9VA 1BI3A 5D6FA 2DA6A 2MC4A 4NDLA 1T98A 3DXJF 4UV9A 1I27A 3Q0VA 3ZQGA 3ABMH 3CCJI 1H88C 4JOMA 2E1MB 3LQRA 4HLYA 4CCLA 4OIQF 4BGDA 1DGWY 1JT0A 5EEGA 1RETA 2VBWA 3OIQA 4HZFA 2DPUA 3HM5A 2CV1A 2CU7A 3I4PA 3G6EI 1R36A 3K7AJ 3RI4A 5J8CA 1FYLA 2CWEA 4BY1J 1KYZA 1WJBA 3HHGA 1U5TB 1WQ2A 2E36A 4E6KG 1MMSA 2DMUA 1OLTA 4CXFA 3OSFA 2WC2A 2H1LA 3ABUA 5E18F 2PBIA 1T39A 3GMEA 3F6OA 3COAC 1JT6A 3HSFA 5HLGA 3OYAA 4YIRX 1HC8A 2Q0OA 3BWGA 1RR8C 3VWBA 5FRMA 1R00A 1FY7A 4MEXF 2JWTA 4XLPF 4HDVA 1FOKA 4XRSA 4BHBA 3JAMK 1BC8C 4UXNA 4MNUA 1AA7A 4LB5A 2RNGA 1IW7F 1WHUA 3O2PE 2Z16A 2H6CA 3OYEA 1BN5A 4RS8A 4XLNF 2EINH 1P7JA 1WVRA 4UUVA 1SMTA 1XB4A 1CQTA 1WJCA 2E34A 2LD5A 1T0FA 2W25A 1IRZA 4IVNA 5EJCA 4LFUA 1RIOH 4AM3A 2FNAA 2HOAA 1WKMA 5FB2A 3AKZA 1ETKA 3QRFF 2TCTA 4HAMA 1J7KA 3OR2C 4NC7A 4XLHA 2DU9A 1VQOI 1XSDA 2E19A 2OJED 2HDCA 4MFEA 3QU6A 1W7PB 3KPHA 1JUPA 3Q0WA 4IX7A 1JGGA 4YRVA 1YJNI 1G3YA 2EFNA 1Z3XA 5DM6F 3A01B 2FQ4A 4A2UA 4B1RA 3E3VA 1IDYA 2NXNB 1W7PD 1SVLA 3DFGA 3V4GA 2BHYA 4P55A 3HHHA 3KZYA 1NK2P 5KK1A 3EDPA 3MFKA 1X1PA 2NNNA 3GZ5A 2VBYA 3KP5A 1G8XA 1GLNA 3G1LA 2JA8J 1J75A 3K4JA 3IP4B 1VQMI 2HXIA 3M1EA 4C2UA 3ZR8X 4YFNF 4P5OA 3BG9A 4BQQA 2VOOA 2M2EA 1QO0D 2VT2A 3BZ6A 4FE7A 3L7WA 5B1BH 3TW6A 4YIIA 1QBJA 2DLLA 2FE3A 4LIVA 4Z2YA 4QPQA 4HA8A 4PJJA 4C3HJ 4F7ZA 4YFKF 2P0WA 2CO5A 3M07A 2P4WA 3T5XA 3BG7A 4DYCA 2VPLA 4I7HA 3HDDA 1Y0NA 2O6GE 2M87A 3ZXSA 3QOPA 1R1UA 5FKLA 4H0EA 3ABLH 2IS6A 3J81Z 2E2IJ 3H36A 4RGRA 1NHAA 1S8NA 3KP2A 4L9JA 1JTXA 4ITVA 4RM2A 4O6JA 2MSYA 5JLWA 5F27A 5C3EJ 1OYIA 4HQEA 3GXOA 2PMZA 3G1MA 5CVJA 3OYNA 3JRIA 2HVSA 4QWQA 2K40A 2ZCWA 2BGCA 1IN6A 4C9YA 4RB3C 3KP4A 1P9QC 3VYUB 2JK3A 3LA7A 5JLXA 5KAFC 2XV4S 5GP9A 3MKLA 2JA7J 4B8XA 3DEEA 2EK5A 4UV8A 4P9FA 2RQQA 3HOZJ 3I4NJ 2EH3A 3OYIA 2Y30A 3AAFA 5HLIA 5FLVA 1DPRA 1TWHJ 4PZJA 1KQ0A 1X58A 3AG3H 3E5UA 3RIRA 1MBGA 1J9IA 1CF7B 4NB5A 5LGUA 3L1PA 2CFXA 1ETYA 1HLVA 4AU7A 2OPTA 4C2TA 2XSDC 1UMQA 3TP3A 3VSLA 2DFIA 2LLKA 1POGA 4Y7NJ 5ILUA 2D1VA 5KNLA 2JA2A 1ZG5A 4M3GA 3G2BA 4AWXB 3SEQA 1RR7A 4ENKA 1LQ1A 2W57A 3U21A 3SDBA 2EFPA 4RM3A 1JUSA 3JRAA 2H8RA 3I58A 1GV5A 1NG7A 1MKMA 3WTSC 1MBKA 4XLFA 5FFZA 5IY5H 1TWCJ 3WGGA 1OJLA 3BTJA 3SZTA 2E60A 1ETXA 3OIOA 3HRUA 4W97A 4U0YA 3H35A 1HKQA 3GO5A 1TW3A 3WG9A 4IHVA 2M0CA 3BR3A 3NQOA 4HSTA 3ZQQA 1FOWA 2XUBA 4A5MA 5J6XA 1Z1DA 3J80K 3D1NI 3CC7I 2IS1A 2R7TA 4A3MJ 2CSOA 3PQKA 4XIDA 1BR2A 3CO6C 2DA2A 2G0EA 2TDXA 3E6DA 3HIFA 5LGNA 1IXRC 1TQIA 4PFPA 1WSUA 2HDWA 5KCMA 4EEFG 5LGTA 2L4AA 4BHPA 2X0LA 1Y6IA 3KEQA 4RGUA 3GLXA 3DTIA 1BBYA 2BVMA 4JYKA 2L3DA 3HL2A 1A35A 3VYRB 3S2HJ 2WTEA 4L0YB 4OAZA 4G7HF 1RPWA 4L5JA 4ETSA 2VC1A 2JMWA 3K1PA 2V1NA 1R5GA 3GW2A 2L7FP 4XN0A 3K70D 1FEXA 4E7KA 3PSFA 3FM3A 2EA2A 5DCFA 1MW7A 3CJNA 1BL0A 2MBFA 1SFKA 2DOEA 1S9HA 2ID6A 4B47A 1FZPB 4ZDLA 2BY3A 3GTLJ 5LLQA 4E4HA 4BXXJ 3WTTC 3IH2A 4HNUA 2L4MA 4N0BA 4LLGF 1LJ9A 4XM3A 2DBBA 3U1DA 2NS0A 4NC6A 3WTVC 3L2RA 2IGMA 2FSWA 2RNJA 3WTUC 4XRFA 4Q48A 2BV6A 3Q9VA 1R58A 4OIOF 2ZKZA 4KMUX 4HYEA 1BIBA 2LOOA 2EA4A 2PMZN 5TISC 2W85A 4KNYA 1Y1WJ 4CCKA 1XMKA 2ZBKA 2ZB9A 1I1GA 1LFUP 2TRTA 2JPBA 3QYEA 1ON2A 5D8KB 3JAMZ 1E3PA 3ZQ7A 3HC7A 2WAQA 1TL8A 4FX0A 2LSOA 2XGDA 1GV2A 2IEKA 3EPZA 1O3SA 4BYYA 2IRFG 2GXBA 3MWMA 3I5UA 3L2QA 3S14J 3CCEI 1SD7A 3A4CA 2PJPA 4DNCA 3GTKJ 3WU2C 2X6YA 4B3AA 1V54H 2EIKH 2NS7A 2KMUA 1ZN2A 2I8DA 4YELA 2IS2A 2HQ5A 4PJNA 3G1OA 2EB7A 2BOLA 5J47A 1H9GA 3FWEA 1IXCA 1TQPA 2VB6A 3SZGA 2MC3A 5L3FA 4BQAA 1ZGWA 2R3SA 3S16J 1XMXA 2DJIA 4XBFA 3ZRGA 1H89C 1HW2A 4M72A 1FC3A 3R0JA 3VSKA 5C4XJ 2XHKA 3N4MA 2CMPA 4HG2A 1T08B 1IO2A 3H5NA 5GAGJ 4CO8A 2QSFX 1Z6RA 3CJTB 4CYDA 3BROA 2NVYJ 4A3FJ 3RJPA 5E3LA 5HNFA 3L2UA 2BY1A 3R0AA 1IN5A 4GGGA 2MG4A 1WJAA 4QLCU 2HVRA 1F43A 1YX3A 3MQ0A 4MQVA 1WI3A 1OCPA 5IT9K 3CESA 4HNTA 2PMUA 4M73A 2HTJA 3KIOA 1AU7A 2HS5A 2NAZA 2L01A 1H8AC 5J3LA 3WU0A 2HPIA 3OYBA 1Y56A 2DYRH 4I01A 3SDGA 4BAYA 1EJ9A 3HXLA 5J4VA 2LY2A 2IS4A 4X0GA 1BW5A 2W7NA 2RQPA 2ADUA 3ZMTA 1M1EB 3TO7A 4DGWB 4XQFA 1K6YA 3MN2A 1QRYA 4ZH4F 2X51A 2A61A 5ICFA 3QPLA 3BCAA 1WI9A 1S29A 3BJOA 4QTRA 3F6VA 3JR9A 2F48A 1USSA 2KRFA 2R7OA 3EUKL 2MA3A 5H2FC 2CFOA 2MYSA 3A0HC 2JA6J 4L9TA 2ZXHA 3AL0B 2R7XA 3W2VA 3W6JB 1S7EA 1SFEA 4CDGA 4FETA 4LOCA 2M45A 4JX6A 1SFOJ 2A69F 4EJTA 4EM1A 1U0JA 3HSRA 2CJJA 1OCRH 1L0OC 5DUKA 3FZVA 2YU3A 2BE5F 2QZ8A 3FK7A 5E1XA 3QODA 1K4SA 3P7NA 2OC6A 4M3BA 4Y3OA 1LKXA 2K7LA 2WV1A 3TMOA 3VB2A 3L2VA 3ASOH 4ZTJA 3F0CA 2Q8KA 2E7WA 4KT5C 2XKPA 3QP6A 1BA5A 4JBAA 3CCSI 1GT0C 3S1QJ 3QPTA 1XCVA 3GVAA 3T8TA 1J59A 4KYWA 1P4WA 2Q2EA 3J7AY 2M34A 3S1RJ 4G8XA 2STTA 5DEQA 3ECOA 2HVQA 4KICA 2PMHA 1YYVA 3P5JA 2L0KA 3DU5A 5K1YA 5JR3A 3IUOA 5GADJ 1ODDA 4OOIA 3V42A 1YX5A 2NOJB 2V26A 3IV5A 1T38A 3W6VA 1W36C 4ZYHA 4ZZDA 3V7RA 1FBQA 1TQMA 1O3TA 1V5GA 2JPCA 1D5VA 3RCOA 3RQ4A 2DFEA 4B4CA 1Z0XA 4D5FA 1YO5C 3S1MJ 3C2BA 3PIOF 2XPVA 1ZGAA 1UHWA 4OINF 2UXNA 2D1HA 3J7YJ 1RUOA 2W4SA 4WK8F 1JKOC 2UUZA 5M5WJ 3OMYA 3GTJJ 2CUJA 2IW5A 2IP2A 3ERED 2OD5A 4A3KJ 1XPXA 4DBRA 1MBFA 2XAUA 3K6GA 4LK1F 4BHCA 3BR1A 3DEWA 3OIPA 1TT0A 1GXQA 3MMYB 5ILVA 2CQ7A 1BC7C 1XSVA 2P5VA 1ZLKA 2COBA 2EJRA 4I99C 4MEYF 1AHDP 2A5WA 1DP7P 2DN0A 2HTSA 4JK1X 5DV5A 3WTWC 4Y33A 1IDZA 2D5VA 1I6HJ 4R79A 1E2XA 5HODA 4P96A 1WWXA 2VI6A 3BTCA 2K5CA 4ZJZA 5M3MJ 3MKWB 1Q1HA 3FKIJ 3J80Z 4X6AJ 2ESHA 1BJZA 4EM2A 3SEZA 2XC7A 4UB8C 2XASA 3QQAA 4KISA 1OR7A 4F93B 1JHHA 5EZHA 1UJ8A 3H3ZA 3N05A 5IOYA 1LEAA 4LGWA 4GXOA 4XICA 1Y8RB 3CC4I 3H3UA 3VDXA 4NC8A 1FIAA 3IKVA 1MMAA 3PUFA 3O6BB 1JE8A 2KDOA 4I2OA 1OFCX 3KE2A 1VNDA 1HSJA 2O5RA 2LP0A 2QKLB 2VLAA 2X1CA 4ZDOA 5EEAA 4XKCA 1IUFA 1PJRA 2FMLA 4A93J 2A6EF 5H20A 3FMSA 2LNBA 3IAM2 4QPOA 4I76A 2XSJC 4MTEA 2HOTA 3FMRA 2DOFA 1DUXC 3E6MA 4BJTA 3E7LA 5B1AH 1MD0A 2XAHA 3DCFA 2QSHX 5HLHA 2KL4A 2P6SA 3QWLA 1WH5A 2H6BA 2R5ZA 2EV6A 4OU0A 2H8WA 2N8GA 3WGIA 3LSHA 3VYTB 4GFBA 1HSTA 3M1CA 2WB1N 1WJEA 1OKRA 1JJ8C 3ROUA 2KISA 3GWZA 1R1VA 1G3WA 4Z6YA 2ACJA 2Y48A 2EV5A 2KFDA 4HX7A 2KDZA 2WV0A 1ZK8A 2X1EA 5FD5A 3HGGA 4KIGA 1IV6A 5TGTA 2E2JJ 2M3AA 4A5NA 3GEZA 3FBIB 2JTVA 1USTA 3BOQA 5L3DA 1UG0A 3M8EA 1RESA 3OYKA 1U8BA 2W82A 2PFBA 3PJRA 4HQMA 3MD2A 3V7SA 2BXZA 5TJJA 4IO9F 5LHIA 2DXIA 4I0AA 1LVAA 3S93A 2CRGA 1XSXA 2GWRA 2JRMA 2YX4A 2O0YA 2AS5F 5D4RA 4KUMA 5FJ8J 3LSKA 4BS9A 3D5SC 3ECHA 3VFZA 1O7LA 5LD2C 1CGPA 1X2NA 1QPMA 4F52A 1HA8A 1S7OA 2PN6A 3IH3A 3PNTA 2Q2EB 3BG3A 1Z9CA 1IN8A 2IXSA 1GDTA 1QNTA 2MD0A 1YFHA 3KEOA 2QGUA 5HVQC 4ASNA 5HDKA 1A36A 2WAFA 1T33A 5L3CA 3CP2A 3J7AO 3E5XA 3DP7A 4PGGA 4A0ZA 1VTNC 5IT9Z 3BPXA 3R61A 4NUBA 1YS6A 2DA3A 2ME6A 3TL4X 2HKOA 4CH7A 2HYFA 1YI2I 2FA5A 3O8HA 5H6QA 2WY8Q 2QSGX 3CCVI 1QZEA 1RRJA 2ELHA 1AKHA 2EIMH 3KETA 3LSMA 1YTYA 1R71A 2R7FA 1OYYA 2E1MC 4C3IJ 4BUPA 3GYHX 1ZRCA 2VPRA 1BR4A 1BR1A 2VE8A 1TC3C 2DMTA 4IRIA 2I5UA 4JX5A 2R7UA 2ZC2A 1U5TC 4L5IA 1ZHFA 3TO9A 4KT6A 3TEDA 3CLOA 3A03A 2F5EA 3IWFA 1U6GA 3LSJA 2CQKA 1XN7A 2LH9A 2XF5A 2YR2A 3H5AA 3TGNA 4ESBA 5CYVA 1IXSB 2R7QA 4ZTFA 4K2EA 2VL8A 2X6WA
chains in the Genus database with same CATH topology
2R7ZJ 1GV5A 2X9DA 3S15J 1MBKA 4V2GA 1W0UA 5F08A 2EQRA 1TWCJ 2X6OA 1OJLA 3BTJA 2YS9A 3BTLA 1ETXA 3OIOA 2MGQA 4W97A 2EZIA 4DZJA 4M3FA 4FISA 3H3VK 1Y1VJ 2YUSA 1HCRA 5EDNA 2CUFA 4IHVA 4D7MA 2DMNA 2M0CA 3B6AA 4QIWN 3BR3A 3S2DJ 5IP6A 3RKQA 5GPCA 3D1NI 5EG0A 2EBIA 4A3MJ 2O8KA 2XGEA 5F04A 1GVDA 3NARA 4XIDA 4I6ZA 2FD5A 1XC5A 2DA2A 2G0EA 1U9NA 2LY9A 1FIPA 4EEFG 2R92J 2DA7A 2DA1A 1VF9A 2EZHA 1B72A 4X1EA 3OOUA 5J1RA 4JYKA 2CQQA 2O7OA 5FKOA 3S2HJ 5E3NA 3HEFA 4UUSB 1RPWA 3BR0A 5IYDJ 2JMWA 3BG5A 5IP9J 3FK6A 3ZQIA 2R0QC 4IEJA 1APLC 3HKZN 2L7FP 5F0HA 1FEXA 4IHXA 5EF6A 1IGNA 3B6CA 4D5CA 1BL0A 2ID6A 4DW6A 1UG2A 3GTLJ 1TWAJ 4BXXJ 3IH2A 2ECCA 1FTZA 2Y2ZA 1ETVA 3GBGA 3TP0A 4IHWA 3CQZJ 2NVTJ 1W0TA 1QVUA 3ZOBA 2Y0SN 1TWFJ 2PMZN 4A3GJ 1F36A 4W1UA 1Y1WJ 1VFCA 2ZB9A 1LFUP 2TRTA 3JRFA 5IPAA 5IYCJ 2O9LA 5F0CA 1DU0A 2E1OA 2K9NA 2XGDA 1MNMC 1GV2A 2IEKA 4BKXA 3WHBA 2EZLA 3S14J 5EGOA 1T56A 3TW7A 3HOWJ 2XB5A 1SANA 3GTKJ 2RAEA 1G2HA 2DJNA 2WAQN 1JJ6C 5M5YJ 4B3AA 2NS7A 3BQYA 4M6VA 1JKRC 2HQ5A 3G1OA 2P81A 3HGYA 2K9SA 1ZGWA 3S16J 2XPWA 1H89C 4DZPA 3S17J 3JRCA 5C4XJ 3JRDA 1Q1VA 1E3OC 2LVSA 1O4XA 2EZKA 1ZTRA 1LE8A 4S0HB 1DU6A 3RZOJ 2NVYJ 4A3FJ 1AKHB 2ELKA 2LK2A 3ZQFA 4MO7A 3IH4A 5E3LA 3M4OJ 2VUMJ 5J1UA 2I10A 1ZQ3P 3PO2J 1U9OA 2MG4A 2L9RA 1F43A 2AHQA 4C3JJ 3CMYA 1WI3A 1OCPA 4XRSG 3I4MJ 2NS8A 4ABZA 4AC0A 3NAUA 1AU7A 3A01A 1XS9A 1H8AC 5J3LA 1U78A 1PUFB 2HDDA 4FCYA 2R93J 4UUTA 3SDGA 2NVXJ 3CDLA 1MBEA 1BW5A 5C4JJ 3MN2A 1D5YA 1QRYA 1WPKA 1K83J 1HDPA 2OF7A 5DS9A 3QPLA 1YRNA 2FX0A 4QTRA 1NK3P 5IOZA 3JR9A 3S1NJ 2JN6A 5J1YA 2JA6J 4A3JJ 2H1KA 1S7EA 3LNQA 2LTPA 4LOCA 4V2FA 1IG7A 4JX6A 4L5EA 3PO3J 1SFOJ 1QPIA 4CYCA 4JP0A 2XB0X 2CJJA 1LFBA 4MIMA 3UKGA 1EF4A 3WHCA 2R5ZB 2Y31A 4FE4A 2XGCA 3FK7A 1ETWA 4M3BA 2IBDA 1GUUA 5EG0B 3JREA 2WV1A 5FKNA 3GTMJ 3HOYJ 3F0CA 2XPUA 4MFDA 1WGXA 3RQIA 5GPAA 1BA5A 5M5XJ 1ZKGA 1GT0C 2ID3A 3S1QJ 4Y52J 5FKMA 1X2MA 1B72B 2ECBA 2M34A 3FISA 3QPSA 1WH7A 1ORKA 5DTDA 3S1RJ 1OCTC 3GTPJ 1Z77A 2Y9ZA 4BY7J 2L0KA 1MBHA 1BW6A 3IV5A 3W6VA 9ANTA 4M3DA 1JKQC 3Q0UA 2QCOA 4A3BJ 2NOGA 5IP7J 1VI0A 2HYJA 4B4CA 4D5FA 1B8IA 1Z0XA 3S1MJ 3C2BA 1A5JA 2NVQJ 2DMPA 2XPVA 1FJLA 4A3CJ 4BBSJ 3OSGA 4G12A 1NTCA 2FJ1A 1JKOC 5K7HA 5M5WJ 1MH4A 1HDDC 3GTJJ 3BR5A 3LSPA 1HOMA 1MSFC 3HB9A 4A3KJ 3GTOJ 4JX4A 5K7ZA 1MBFA 4BBRJ 3K2AA 3BR1A 3DEWA 2GLOA 2QF7A 1P7IA 2DA6A 3H0GJ 4NDLA 3ZQGA 3Q0VA 1H88C 3PM1A 2R5YA 3BR2A 3BR6A 2COBA 1JT0A 1RETA 3HM5A 1AHDP 2DA4A 2CU7A 2DN0A 3K7AJ 2CUEA 1MH3A 4XK4A 4RBOA 4BY1J 5BNGA 5F1JA 1IDZA 4C2MJ 2D5VA 4A3DJ 1I6HJ 2DMUA 5M3FJ 3OSFA 1JKPC 5HODA 2VI6A 3BTCA 1R9TJ 3LSGA 5M3MJ 1RKTA 2DMQA 3FKIJ 2VKVA 1JT6A 2JJ7A 4X6AJ 1BJZA 3QQAA 3BTIA 1ZR2A 1JUMA 2JWTA 3LSRA 5EZHA 4XRSA 3BQZA 5IOYA 4XRMA 4XICA 4A3EJ 1FIAA 2VKEA 1P7JA 1OFCX 4RDUA 1CQTA 1VNDA 2LD5A 3JRBA 1LE8B 1IRZA 4AUXA 4QSHA 2Y9YA 2LP0A 3HOVJ 3Q3SA 2HOAA 5EEAA 1ETKA 4DYQA 1IUFA 1I3QJ 4A93J 5E3MA 1I50J 2IAIA 2TCTA 5FKKA 2ME0A 3CCYA 2E19A 2DTZA 4MFEA 1ETOA 3MVPA 2CQXA 2B63J 1JUPA 3Q0WA 4I76A 1JGGA 2HOTA 1A6IA 2E2HJ 3A01B 3E7LA 2FQ4A 3FIWA 4B1RA 3DCFA 1IDYA 2JA5J 4UUSA 1WH5A 2R5ZA 2N8GA 1NK2P 3RZDJ 4GFBA 4HNVA 4DYRA 2WB1N 3G1LA 1YRNB 1ETQA 2XRLA 1IJWC 2JA8J 5K7FA 1JJ8C 3JRGA 1K61A 2HXIA 3ZQHA 4J19A 3BG9A 2M2EA 2KDZA 1ZK8A 3HGGA 1IV6A 4FE7A 2E2JJ 3O8GA 3TW6A 5EYRA 4AYBN 2KT0A 4M3EA 1MSEC 3A02A 5F0FA 4CYCB 1RESA 4C3HJ 1U8BA 4A69C 4DYCA 3HDDA 3GTQJ 1FTTA 2MW8A 2M8GX 2CRGA 5FKLA 1HF0A 2L7ZA 5FJ8J 1JTYA 2E2IJ 2M9HA 1JTXA 1QVTA 1RKWA 3VPRA 2MSYA 1ENHA 5F27A 5JLWA 5C3EJ 4A3LJ 1X2NA 4D7NA 3G1MA 3IH3A 3JRIA 3BG3A 2K40A 3SFIA 2K9QA 3BT9A 1GDTA 2JK3A 1IC8A 5JLXA 5GP9A 3MKLA 3HOXJ 2JA7J 4FTHA 2W48A 1T33A 2X48A 5EZGA 3HOZJ 2HI3A 5C44J 2LKXA 3I4NJ 2EH3A 1ITYA 2DA3A 1XG1A 2ME6A 2Y30A 1B8IB 5FLVA 3O8HA 1TWHJ 2AO9A 1X58A 1AKHA 2LR8A 5FLMJ 1MBGA 3L1PA 1ZR4A 4C3IJ 3JRHA 2GM4A 1ETYA 1HLVA 2L7MP 2VPRA 3HOUJ 5EGOB 2OPTA 2DA5A 2XSDC 1UMQA 3TP3A 1MBJA 1TC3C 2DMTA 1POGA 2LLKA 4Y7NJ 5E3OA 1WCMJ 3SJMA 3GTGJ 4JX5A 5IYBJ 3ZQCA 4IHYA 1UHSA 1TWGJ 2R5YB 2HXOA 3TEDA 4M3GA 4MLOA 3M3YJ 2HOSA 3A03A 1PUFA 1RR7A 3HBLA 3LOCA 3ZQLA 4A3IJ 2YU9J 3LSJA 3JRAA 1JUSA 2GBYA 2LFBA 2H8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z J;  1GV5 A;  2X9D A;  3S15 J;  1MBK A;  4V2G A;  1W0U A;  5F08 A;  2EQR A;  1TWC J;  2X6O A;  1OJL A;  3BTJ A;  2YS9 A;  3BTL A;  1ETX A;  3OIO A;  2MGQ A;  4W97 A;  2EZI A;  4DZJ A;  4M3F A;  4FIS A;  3H3V K;  1Y1V J;  2YUS A;  1HCR A;  5EDN A;  2CUF A;  4IHV A;  4D7M A;  2DMN A;  2M0C A;  3B6A A;  4QIW N;  3BR3 A;  3S2D J;  5IP6 A;  3RKQ A;  5GPC A;  3D1N I;  5EG0 A;  2EBI A;  4A3M J;  2O8K A;  2XGE A;  5F04 A;  1GVD A;  3NAR A;  4XID A;  4I6Z A;  2FD5 A;  1XC5 A;  2DA2 A;  2G0E A;  1U9N A;  2LY9 A;  1FIP A;  4EEF G;  2R92 J;  2DA7 A;  2DA1 A;  1VF9 A;  2EZH A;  1B72 A;  4X1E A;  3OOU A;  5J1R A;  4JYK A;  2CQQ A;  2O7O A;  5FKO A;  3S2H J;  5E3N A;  3HEF A;  4UUS B;  1RPW A;  3BR0 A;  5IYD J;  2JMW A;  3BG5 A;  5IP9 J;  3FK6 A;  3ZQI A;  2R0Q C;  4IEJ A;  1APL C;  3HKZ N;  2L7F P;  5F0H A;  1FEX A;  4IHX A;  5EF6 A;  1IGN A;  3B6C A;  4D5C A;  1BL0 A;  2ID6 A;  4DW6 A;  1UG2 A;  3GTL J;  1TWA J;  4BXX J;  3IH2 A;  2ECC A;  1FTZ A;  2Y2Z A;  1ETV A;  3GBG A;  3TP0 A;  4IHW A;  3CQZ J;  2NVT J;  1W0T A;  1QVU A;  3ZOB A;  2Y0S N;  1TWF J;  2PMZ N;  4A3G J;  1F36 A;  4W1U A;  1Y1W J;  1VFC A;  2ZB9 A;  1LFU P;  2TRT A;  3JRF A;  5IPA A;  5IYC J;  2O9L A;  5F0C A;  1DU0 A;  2E1O A;  2K9N A;  2XGD A;  1MNM C;  1GV2 A;  2IEK A;  4BKX A;  3WHB A;  2EZL A;  3S14 J;  5EGO A;  1T56 A;  3TW7 A;  3HOW J;  2XB5 A;  1SAN A;  3GTK J;  2RAE A;  1G2H A;  2DJN A;  2WAQ N;  1JJ6 C;  5M5Y J;  4B3A A;  2NS7 A;  3BQY A;  4M6V A;  1JKR C;  2HQ5 A;  3G1O A;  2P81 A;  3HGY A;  2K9S A;  1ZGW A;  3S16 J;  2XPW A;  1H89 C;  4DZP A;  3S17 J;  3JRC A;  5C4X J;  3JRD A;  1Q1V A;  1E3O C;  2LVS A;  1O4X A;  2EZK A;  1ZTR A;  1LE8 A;  4S0H B;  1DU6 A;  3RZO J;  2NVY J;  4A3F J;  1AKH B;  2ELK A;  2LK2 A;  3ZQF A;  4MO7 A;  3IH4 A;  5E3L A;  3M4O J;  2VUM J;  5J1U A;  2I10 A;  1ZQ3 P;  3PO2 J;  1U9O A;  2MG4 A;  2L9R A;  1F43 A;  2AHQ A;  4C3J J;  3CMY A;  1WI3 A;  1OCP A;  4XRS G;  3I4M J;  2NS8 A;  4ABZ A;  4AC0 A;  3NAU A;  1AU7 A;  3A01 A;  1XS9 A;  1H8A C;  5J3L A;  1U78 A;  1PUF B;  2HDD A;  4FCY A;  2R93 J;  4UUT A;  3SDG A;  2NVX J;  3CDL A;  1MBE A;  1BW5 A;  5C4J J;  3MN2 A;  1D5Y A;  1QRY A;  1WPK A;  1K83 J;  1HDP A;  2OF7 A;  5DS9 A;  3QPL A;  1YRN A;  2FX0 A;  4QTR A;  1NK3 P;  5IOZ A;  3JR9 A;  3S1N J;  2JN6 A;  5J1Y A;  2JA6 J;  4A3J J;  2H1K A;  1S7E A;  3LNQ A;  2LTP A;  4LOC A;  4V2F A;  1IG7 A;  4JX6 A;  4L5E A;  3PO3 J;  1SFO J;  1QPI A;  4CYC A;  4JP0 A;  2XB0 X;  2CJJ A;  1LFB A;  4MIM A;  3UKG A;  1EF4 A;  3WHC A;  2R5Z B;  2Y31 A;  4FE4 A;  2XGC A;  3FK7 A;  1ETW A;  4M3B A;  2IBD A;  1GUU A;  5EG0 B;  3JRE A;  2WV1 A;  5FKN A;  3GTM J;  3HOY J;  3F0C A;  2XPU A;  4MFD A;  1WGX A;  3RQI A;  5GPA A;  1BA5 A;  5M5X J;  1ZKG A;  1GT0 C;  2ID3 A;  3S1Q J;  4Y52 J;  5FKM A;  1X2M A;  1B72 B;  2ECB A;  2M34 A;  3FIS A;  3QPS A;  1WH7 A;  1ORK A;  5DTD A;  3S1R J;  1OCT C;  3GTP J;  1Z77 A;  2Y9Z A;  4BY7 J;  2L0K A;  1MBH A;  1BW6 A;  3IV5 A;  3W6V A;  9ANT A;  4M3D A;  1JKQ C;  3Q0U A;  2QCO A;  4A3B J;  2NOG A;  5IP7 J;  1VI0 A;  2HYJ A;  4B4C A;  4D5F A;  1B8I A;  1Z0X A;  3S1M J;  3C2B A;  1A5J A;  2NVQ J;  2DMP A;  2XPV A;  1FJL A;  4A3C J;  4BBS J;  3OSG A;  4G12 A;  1NTC A;  2FJ1 A;  1JKO C;  5K7H A;  5M5W J;  1MH4 A;  1HDD C;  3GTJ J;  3BR5 A;  3LSP A;  1HOM A;  1MSF C;  3HB9 A;  4A3K J;  3GTO J;  4JX4 A;  5K7Z A;  1MBF A;  4BBR J;  3K2A A;  3BR1 A;  3DEW A;  2GLO A;  2QF7 A;  1P7I A;  2DA6 A;  3H0G J;  4NDL A;  3ZQG A;  3Q0V A;  1H88 C;  3PM1 A;  2R5Y A;  3BR2 A;  3BR6 A;  2COB A;  1JT0 A;  1RET A;  3HM5 A;  1AHD P;  2DA4 A;  2CU7 A;  2DN0 A;  3K7A J;  2CUE A;  1MH3 A;  4XK4 A;  4RBO A;  4BY1 J;  5BNG A;  5F1J A;  1IDZ A;  4C2M J;  2D5V A;  4A3D J;  1I6H J;  2DMU A;  5M3F J;  3OSF A;  1JKP C;  5HOD A;  2VI6 A;  3BTC A;  1R9T J;  3LSG A;  5M3M J;  1RKT A;  2DMQ A;  3FKI J;  2VKV A;  1JT6 A;  2JJ7 A;  4X6A J;  1BJZ A;  3QQA A;  3BTI A;  1ZR2 A;  1JUM A;  2JWT A;  3LSR A;  5EZH A;  4XRS A;  3BQZ A;  5IOY A;  4XRM A;  4XIC A;  4A3E J;  1FIA A;  2VKE A;  1P7J A;  1OFC X;  4RDU A;  1CQT A;  1VND A;  2LD5 A;  3JRB A;  1LE8 B;  1IRZ A;  4AUX A;  4QSH A;  2Y9Y A;  2LP0 A;  3HOV J;  3Q3S A;  2HOA A;  5EEA A;  1ETK A;  4DYQ A;  1IUF A;  1I3Q J;  4A93 J;  5E3M A;  1I50 J;  2IAI A;  2TCT A;  5FKK A;  2ME0 A;  3CCY A;  2E19 A;  2DTZ A;  4MFE A;  1ETO A;  3MVP A;  2CQX A;  2B63 J;  1JUP A;  3Q0W A;  4I76 A;  1JGG A;  2HOT A;  1A6I A;  2E2H J;  3A01 B;  3E7L A;  2FQ4 A;  3FIW A;  4B1R A;  3DCF A;  1IDY A;  2JA5 J;  4UUS A;  1WH5 A;  2R5Z A;  2N8G A;  1NK2 P;  3RZD J;  4GFB A;  4HNV A;  4DYR A;  2WB1 N;  3G1L A;  1YRN B;  1ETQ A;  2XRL A;  1IJW C;  2JA8 J;  5K7F A;  1JJ8 C;  3JRG A;  1K61 A;  2HXI A;  3ZQH A;  4J19 A;  3BG9 A;  2M2E A;  2KDZ A;  1ZK8 A;  3HGG A;  1IV6 A;  4FE7 A;  2E2J J;  3O8G A;  3TW6 A;  5EYR A;  4AYB N;  2KT0 A;  4M3E A;  1MSE C;  3A02 A;  5F0F A;  4CYC B;  1RES A;  4C3H J;  1U8B A;  4A69 C;  4DYC A;  3HDD A;  3GTQ J;  1FTT A;  2MW8 A;  2M8G X;  2CRG A;  5FKL A;  1HF0 A;  2L7Z A;  5FJ8 J;  1JTY A;  2E2I J;  2M9H A;  1JTX A;  1QVT A;  1RKW A;  3VPR A;  2MSY A;  1ENH A;  5F27 A;  5JLW A;  5C3E J;  4A3L J;  1X2N A;  4D7N A;  3G1M A;  3IH3 A;  3JRI A;  3BG3 A;  2K40 A;  3SFI A;  2K9Q A;  3BT9 A;  1GDT A;  2JK3 A;  1IC8 A;  5JLX A;  5GP9 A;  3MKL A;  3HOX J;  2JA7 J;  4FTH A;  2W48 A;  1T33 A;  2X48 A;  5EZG A;  3HOZ J;  2HI3 A;  5C44 J;  2LKX A;  3I4N J;  2EH3 A;  1ITY A;  2DA3 A;  1XG1 A;  2ME6 A;  2Y30 A;  1B8I B;  5FLV A;  3O8H A;  1TWH J;  2AO9 A;  1X58 A;  1AKH A;  2LR8 A;  5FLM J;  1MBG A;  3L1P A;  1ZR4 A;  4C3I J;  3JRH A;  2GM4 A;  1ETY A;  1HLV A;  2L7M P;  2VPR A;  3HOU J;  5EGO B;  2OPT A;  2DA5 A;  2XSD C;  1UMQ A;  3TP3 A;  1MBJ A;  1TC3 C;  2DMT A;  1POG A;  2LLK A;  4Y7N J;  5E3O A;  1WCM J;  3SJM A;  3GTG J;  4JX5 A;  5IYB J;  3ZQC A;  4IHY A;  1UHS A;  1TWG J;  2R5Y B;  2HXO A;  3TED A;  4M3G A;  4MLO A;  3M3Y J;  2HOS A;  3A03 A;  1PUF A;  1RR7 A;  3HBL A;  3LOC A;  3ZQL A;  4A3I J;  2YU9 J;  3LSJ A;  3JRA A;  1JUS A;  2GBY A;  2LFB A;  2H8R A; 
#chains in the Genus database with same CATH topology
 1D1B A;  1T2K A;  2R7Z J;  2K86 A;  3QYF A;  5HNH A;  1K78 A;  2X9D A;  3CUQ A;  3GFL A;  4HX8 A;  4F92 B;  3S15 J;  5F08 A;  2EQR A;  2HKX A;  2CH0 A;  2G9W A;  2BEO A;  3BZC A;  4Q5S F;  3OYD A;  4H4K C;  3W2A A;  4II3 A;  2MGQ A;  1IN4 A;  2EZI A;  4G94 A;  4PSW A;  3U9G A;  5JHF A;  4FIS A;  4OIR F;  4RAZ A;  2YUS A;  5ICE A;  4E7L A;  1HCR A;  3H3V K;  2KQR A;  4D7M A;  2XRN A;  2DMN A;  1VQP I;  4MGR A;  1G4D A;  3S2D J;  4D0P A;  2V1U A;  2HYG D;  3RKQ A;  4ON0 A;  5GPC A;  2IJL A;  4GO1 A;  1Z21 A;  3EQL F;  5FFX A;  1DDN A;  1GVD A;  3NAR A;  5L3E A;  4P9U A;  4I6Z A;  3QAH A;  1XDU A;  2EIJ H;  4HRI A;  2KZV A;  2LBF A;  4CA0 A;  3OYC A;  1SAX A;  4XMY A;  1KYW A;  4NBQ A;  2ZO4 A;  3P9K A;  2GA1 A;  1B72 A;  4X1E A;  3GZN B;  3TO6 A;  2MFZ A;  4RMN A;  1QU3 A;  3HEF A;  3ULQ B;  3GCM A;  1B1B A;  3BG5 A;  5IP9 J;  1PYV A;  2R0Q C;  3CD6 I;  2PQ8 A;  4BDZ A;  4XSZ F;  3C3W A;  4YFX F;  3FXR A;  2KZG A;  4WX9 A;  3Q9S A;  1BI2 A;  2L7K A;  2CYY A;  3KLO A;  2W24 A;  3ZN0 A;  4D5C A;  4RGS A;  1IGN A;  4DW6 A;  2ZXW H;  1UG2 A;  2V79 A;  4IQ4 A;  5HOO A;  1SEU A;  4IJA A;  5GAE J;  3ZP5 A;  1N75 A;  4FQG A;  1ETV A;  2K4J A;  2KLO A;  1FX7 A;  3TP0 A;  3H1C A;  1UZC A;  4BEH A;  2FQ3 A;  5B66 C;  3KP7 A;  3G71 I;  2DQR A;  1NG6 A;  2PEX A;  2VQC A;  2E1N A;  4LD5 A;  1W0T A;  3QP5 A;  4A6D A;  5HS8 A;  2ISY A;  3K9T A;  5F6F A;  2BHZ A;  1J2X A;  1WJ5 A;  2KIU A;  2VOD A;  1WFX A;  2QVO A;  3ASN H;  4HX4 A;  3K10 A;  1VFC A;  5JHU A;  4ZC3 A;  4LLL A;  4OWR B;  5ILS A;  4C30 A;  2A07 F;  1SC7 A;  1EV7 A;  1STZ A;  2HR3 A;  3OOP A;  2E7X A;  2K9N A;  3TOB A;  4HF0 A;  4HBL A;  4M9Z A;  5EGO A;  1T56 A;  3HOW J;  3HTU A;  2XB5 A;  3I53 A;  3F8F A;  5FLX K;  4S04 A;  1JKR C;  3LFK A;  2DOA A;  1WJD A;  3HGY A;  1XGN A;  1VZ0 A;  2XPW A;  2DTR A;  1FNN A;  1SD5 A;  5FO5 A;  2OTJ I;  1KU9 A;  3JRC A;  2WBM A;  3F9K A;  3Q5F A;  3DKW A;  3K4L A;  1Q1V A;  3V8K A;  1E3O C;  4HV6 A;  1MMN A;  2LVS A;  1P6R A;  4XOR A;  2EZK A;  2P8T A;  1P4X A;  2OBP A;  4S0H B;  3RZO J;  3OV8 A;  1DU6 A;  1UEL B;  1GHC A;  3WG7 H;  3EUH A;  1AKH B;  2CV0 A;  2LK2 A;  5AIP A;  1D0Z A;  2AXL A;  1QGP A;  1TZL A;  2RGV A;  4IPA A;  3HTS B;  1R5H A;  1U2W A;  2L9R A;  3G4S I;  1VQL I;  4EGZ A;  2KP6 A;  4G9Y A;  2CW0 F;  1W1W E;  4XRS G;  3LAJ A;  1FMW A;  4CCN A;  1HKT A;  1B59 A;  1XMA A;  3L09 A;  5E1Z B;  1MMD A;  4IL6 C;  1RI7 A;  1XGO A;  4CCM A;  3IRR A;  4HV5 A;  4UUT A;  3IL2 A;  3SXY A;  4U87 A;  5H6R A;  5E79 C;  3PFI A;  1AWC A;  1DQU A;  2ZME A;  1DGR M;  1WPK A;  4UVA A;  5DD8 A;  5DS9 A;  4WWC A;  4E70 A;  4BJ5 C;  1K78 B;  2PG4 A;  3CUQ B;  5FRO A;  1O57 A;  2ISZ A;  2O03 A;  2XF7 A;  4UVB A;  3S1N J;  4PJL A;  2QQ9 A;  2Z99 A;  1TLH B;  3BDD A;  2Z1D A;  2HPM A;  1IZ1 A;  1W5S A;  5BS6 A;  1MIJ A;  3LNQ A;  3ZN1 A;  2VT3 A;  3AG2 H;  1L3L A;  4ENM A;  5CQE A;  1IG7 A;  3AG4 H;  4AIH A;  1QPI A;  1OPC A;  1YW9 A;  3PO3 J;  2J5O A;  1BJA A;  4CYC A;  3OY9 A;  3K4C A;  2L9N A;  3LST A;  2UZK A;  1VQ6 I;  1LFB A;  3GF2 A;  2NRA C;  1EF4 A;  2Y31 A;  4UHT A;  1KU2 A;  1ETW A;  1KU3 A;  2ZFW A;  3CF5 F;  3HJE A;  1UHM A;  3QOE A;  4XOT A;  2G7U A;  4LB6 B;  3K70 C;  4MFD A;  1X1C A;  3ML6 A;  2JSP A;  2LBF B;  2MAB A;  5GPA A;  5M5X J;  3OYM A;  4B09 A;  3PNY A;  1B72 B;  2IT0 A;  1YOV B;  4KA4 A;  5DTD A;  3GTP J;  1WH7 A;  2M7A A;  2QBY A;  2ZXJ A;  5FD6 A;  2Y9Z A;  4BY7 J;  5KVR A;  3S3O A;  4F3Q A;  2M8E A;  1DP3 A;  2HQA A;  3FXU A;  2DAO A;  4BQN A;  3DBR B;  3E97 A;  1JKQ C;  2RN7 A;  1K4T A;  2KIM A;  2OCC H;  2QCO A;  3KX2 A;  4A3B J;  2HGC A;  3H5R A;  1VI0 A;  2GIV A;  1YIJ I;  4RA2 A;  2NVQ J;  1FJL A;  3OSG A;  3TBI A;  2LYC A;  3WTY C;  3RPQ A;  3V7C A;  1S7A A;  4TV7 A;  4XKB A;  1HDD C;  3BR5 A;  1KU7 A;  1ZG1 A;  2LKS A;  4U0V A;  4EGY A;  1HXD A;  5LHH A;  4Y13 A;  3GTO J;  4JX4 A;  4EJW A;  2HFH A;  2ESN A;  5K7Z A;  4BBR J;  2KKO A;  4BEH B;  2DO7 A;  2GLO A;  3DEU A;  1P7I A;  3A2K A;  3H0G J;  1FLI A;  5HDG A;  1Z05 A;  3PM1 A;  2R5Y A;  2WAE A;  2DDB A;  3BR2 A;  1D3Y A;  2RRE A;  3BR6 A;  3S2W A;  1UCR A;  4XKW A;  1ULY A;  2OV7 A;  2BYV E;  1W5T A;  2DA4 A;  3DPT A;  2MH9 A;  2EFO A;  3LFU A;  4PCQ A;  4XK4 A;  4RBO A;  3D5R C;  2QEX I;  4DJA A;  2CUZ A;  2DT7 B;  3O3K A;  1R6R A;  1JKP C;  4PJM A;  1HKS A;  1I6X A;  3OYG A;  1A31 A;  1R9T J;  3LSG A;  3P9I A;  1RKT A;  2DMQ A;  4XN3 A;  2M0M A;  4E7H A;  2ICW G;  2VKV A;  3EYI A;  2JJ7 A;  4CZZ A;  3NWT A;  2LMD A;  2GXA A;  2KRH A;  3BTI A;  3JTH A;  1ZR2 A;  1JUM A;  2W00 A;  4KIB A;  3MAJ A;  3LSR A;  4XNF A;  3JTG A;  1REP C;  2Y75 A;  3I9V 2;  1QQI A;  2K3P A;  2CG4 A;  5ICC A;  2STW A;  4N4N B;  3ZMU A;  3W3C A;  5ED4 A;  3JW4 A;  5D5U B;  3CCR I;  2X85 A;  2M1B A;  3LA2 A;  1IRG A;  3OWT A;  3PNV A;  4AUX A;  4QSH A;  5ERI A;  4O5V A;  5D5V B;  2DFH A;  2EV0 A;  4YEJ A;  3DQV C;  3Q3S A;  2NVU B;  3CTA A;  2D2W A;  4J01 A;  5E3M A;  1I50 J;  2IAI A;  4EV0 A;  3S3M A;  5FKK A;  4FT8 A;  2V6C A;  2FEZ A;  4FX4 A;  2DTZ A;  1ETO A;  1V3F A;  3SQN A;  4OAY A;  3S32 A;  2B63 J;  2P5L C;  2FXA A;  4CCO A;  2DT6 A;  4EM0 B;  2K85 A;  1FP2 A;  2WB1 A;  4B48 A;  3OL3 A;  2JA5 J;  3ZPL A;  4A12 A;  4MHG A;  2AXT C;  3F23 A;  1B4A A;  3BJA A;  3A0B C;  3SYT A;  2FU4 A;  5TRD A;  3RZD J;  2ZME B;  3GZ6 A;  3AL0 C;  5F64 A;  4HNV A;  3QU3 A;  3VOD A;  2Z5U A;  1I3A A;  1ETQ A;  2XRL A;  4KN7 X;  1QA6 A;  5K7F A;  1X19 A;  3LWF A;  1K61 A;  2R7S A;  4BL0 B;  3NWS A;  3FXJ A;  2JVG A;  3OYF A;  4J19 A;  1LB2 A;  2KIF A;  3DTK A;  3JSP A;  2GZW A;  4N9I A;  2WAD A;  3O8G A;  2M4K A;  1F4K A;  5EYR A;  2F5C A;  4G7Z F;  4M3E A;  3DTE A;  4PSX A;  2X6X A;  3LL7 A;  4PFO A;  1X1D A;  4M6X A;  5F0F A;  1ZRF A;  1VQ7 I;  4CYC B;  2IGK A;  1J09 A;  1K7A A;  2VKD A;  3GTQ J;  2ZJR F;  4M9S A;  2MW8 A;  5B5E C;  1BOB A;  5FLX Z;  5BPD A;  1XCB A;  2L54 A;  3H9J A;  4MTD A;  3WTX C;  3SHF A;  1I1S A;  1HF0 A;  3LQQ A;  2L7Z A;  4XKV A;  3FXQ A;  1PP7 U;  1JTY A;  1ZYR F;  2BW3 A;  3BG6 A;  2DFF A;  1E0E A;  3F8C A;  3OS2 A;  1QVT A;  1RKW A;  1YW8 A;  2F4M B;  2K27 A;  3AFH A;  1ENH A;  1Y39 A;  2Y0S A;  3K0L A;  4D7N A;  4U0W A;  5DM7 F;  1S5L C;  3R4K A;  2EIL H;  1T6S A;  3SFI A;  2QBY B;  3BT9 A;  2XAQ A;  4XSX F;  2VJ5 A;  1U3E M;  3MKY B;  1IC8 A;  3R60 A;  3DLA A;  1OCC H;  3HOX J;  4U88 A;  2X48 A;  5LFA A;  5EZG A;  2E5N A;  3F8B A;  1SD6 A;  1O3R A;  1GVJ A;  3W6K B;  5C44 J;  2LKX A;  3J7Z I;  2VXZ A;  1FSH A;  1XG1 A;  2XGX A;  1ZLJ A;  3F8N A;  5CJ9 A;  5E20 A;  1G6N A;  2QQ8 A;  3ZMS A;  2AO9 A;  1XGS A;  2LR8 A;  4ENN A;  1P2F A;  3FXM A;  5HDN A;  2F5F A;  3L00 A;  1K6O A;  1BOA A;  2HZD A;  3SZP A;  3HOU J;  3WGH A;  2R7R A;  2DA5 A;  2VXD A;  1FPQ A;  2LRE A;  1SFX A;  5E3O A;  3W2W A;  3GTG J;  3KLN A;  5IYB J;  3FBN B;  3ZQC A;  1UHS A;  4IHY A;  2XF6 A;  1TWG J;  2R5Y B;  1A6Q A;  2BY0 A;  1OCO H;  1MND A;  4M71 A;  1I39 A;  3R6S A;  2HOS A;  5J4Y A;  4A3I J;  2V6E A;  4CIC A;  4B44 A;  4RAG A;  2ZSH B;  2GBY A;  3RSN A;  4BNC A;  1ACI A;  3B02 A;  1G59 A;  2IGO A;  4O3M A;  2XDV A;  2B7E A;  1XTA A;  5BPI A;  1OIS A;  4V2G A;  1R4N B;  1S72 I;  1Z67 A;  1Y0U A;  2X6O A;  2XAJ A;  2YS9 A;  2HEO A;  1YJW I;  3BTL A;  1F9N A;  1A04 A;  4HEA 2;  4AVZ A;  1MNE A;  3E0J B;  1OCZ H;  2A5Y B;  2DT5 A;  2P6T A;  5EDN A;  2CUF A;  2R7W A;  2ZJ2 A;  3B6A A;  2R4G A;  1YQA A;  2ZJQ F;  5JFR A;  3TDU C;  3DPL C;  3HOT A;  4F91 B;  4KIT B;  2LF8 A;  5GAH J;  2EFW A;  4GDF A;  1X1B A;  3I54 A;  4KIF A;  2EPF A;  5EG0 A;  5F04 A;  2UXX A;  2VE9 A;  4BXU A;  1TNT A;  4IF4 A;  2JUG A;  3BC8 A;  1U9N A;  1G3S A;  2LY9 A;  4G6Q A;  3ABK H;  1X3W B;  2ZXI A;  2DA7 A;  2R92 J;  2K9L A;  2IPQ X;  1VF9 A;  4U7D A;  1D1A A;  3OOU A;  4NNJ A;  1MGT A;  1N78 A;  3ABT A;  1S6L A;  4D1Q A;  3C2G A;  3K1N A;  1R7J A;  2MLK A;  5IYD J;  3FK6 A;  3ZQI A;  3WTZ A;  4RLQ A;  1APL C;  3PUB A;  5F0H A;  1MJB A;  4IHX A;  3ELK A;  1RZ4 A;  4BXF A;  4IXA A;  3BJ6 A;  1AOY A;  2BVL A;  2QYO A;  4XLE A;  3T0Y A;  3MZY A;  4HPQ A;  2RV8 A;  2BXY A;  1HW5 A;  1R5I D;  1TWA J;  3DF8 A;  2ZJP F;  3GBG A;  1TTY A;  3LMM A;  3MEX A;  2PJR A;  1SD4 A;  3WU1 B;  2KPM A;  4CCJ A;  1OMI A;  3C2H A;  1FSE A;  4HF1 A;  2L02 A;  2K3F A;  3ZOB A;  4B3X A;  1ZRE A;  2Y0S N;  2F4O B;  1IUY A;  2A05 A;  4A3G J;  1JI8 A;  3RKY A;  2QQA A;  3RPU A;  3HUG A;  2H94 A;  3JRF A;  1FT9 A;  2HU9 A;  1VQ9 I;  2QM3 A;  2VQH A;  2BW3 B;  2OQG A;  4XR6 A;  5EEH A;  1DU0 A;  1H9T A;  1MNM C;  3TOA A;  2NYX A;  3X2Q H;  2IA0 A;  1OYW A;  4IKF A;  3D5L A;  2DPD A;  2IVM A;  1Z6T A;  1XX5 A;  2P7V B;  1SFU A;  3TW7 A;  2MLG A;  2RAE A;  1JJ6 C;  5M5Y J;  3EUA A;  3BQY A;  1BIA A;  4Y4R A;  2QWW A;  4CGZ A;  2P81 A;  2OAZ A;  2M7B A;  1YJ9 I;  3UNG C;  1V4R A;  1XD7 A;  3IAS 2;  1MJA A;  3K1M A;  1DPU A;  1BI0 A;  1HW1 A;  1ON1 A;  1O4X A;  4LG0 A;  4YG2 F;  1ZTR A;  3PFY A;  3L2C A;  1LE8 A;  3V8J A;  2A68 F;  3ZQF A;  1LFP A;  3IH4 A;  3M4O J;  2A3S A;  1SAU A;  2DK8 A;  2VBX A;  2I10 A;  3PO2 J;  1U9O A;  3FXK A;  3CJQ B;  2G7H A;  2HQN A;  2FMY A;  2B0L A;  4RGX A;  4HF2 A;  3I4M J;  4DOZ A;  2NS8 A;  4BAC A;  3FXL A;  4AC0 A;  3ZCO A;  5DUI A;  2JSC A;  3I59 A;  3CCQ I;  1SVO A;  3CMM A;  4WXD A;  1YLF A;  1U78 A;  2HDD A;  1X4O A;  1V5E A;  3CDL A;  1X4P A;  4OMZ A;  3M9A A;  3IHU A;  2X1D A;  1D0X A;  1KQ9 A;  2DDA A;  3F3X A;  2JT1 A;  2IA2 A;  3K2Z A;  2E1C A;  1K83 J;  1HDP A;  2OF7 A;  1OR7 C;  3V8L A;  1YRN A;  2VJJ A;  1ZH5 A;  2FX0 A;  3JCU C;  4LLN A;  2LG4 A;  1F1Z A;  5CKT A;  2Y69 H;  4IRH A;  4BE1 A;  3KYC B;  2L5Q A;  4ESJ A;  4OMY A;  4M6Y A;  2JUC A;  1ZEL A;  2JN6 A;  3K4M A;  2Z33 A;  2RC4 A;  3I0T A;  3E6B A;  4CSW A;  2QA4 I;  2GAU A;  2LTP A;  2BZT A;  3B73 A;  4A0X A;  5JI6 A;  4L5E A;  3HOS A;  1FOY A;  3FKJ A;  1D0Y A;  2XKO A;  2XB0 X;  4JP0 A;  1B9M A;  1JXS A;  5K5O A;  1YS7 A;  3PSI A;  4MIM A;  3UKG A;  2CW8 A;  2VC0 A;  3FXO A;  2DYS H;  1HBX G;  4PGH A;  2R5Z B;  2DOD A;  3RKW A;  2OTL I;  4FE4 A;  1VQN I;  5BMZ A;  5EG0 B;  1GUU A;  2LRD A;  5LHG A;  1SVM A;  4AYB A;  3OL4 A;  3CO7 C;  5FKN A;  3RYR A;  1EH7 A;  3GTM J;  2GOX B;  4PJ0 C;  3HOY J;  1W5C C;  1ZG3 A;  2HOE A;  2XPU A;  2YSR A;  1WGX A;  1ZKG A;  2ID3 A;  2QEN A;  4Y52 J;  1X2M A;  4KFC A;  4UVC A;  1OQY A;  2ECB A;  2HWV A;  3MZ8 A;  3FIS A;  3DKX A;  1OCT C;  1HQC A;  5JVT A;  2IA1 A;  2VKH A;  2VJ4 A;  4L0Z B;  1MBH A;  4DIQ A;  5K5Q A;  2QKM B;  3NRV A;  1RUN A;  4HW0 A;  5KAI C;  1VQ5 I;  3HZJ A;  3E6C C;  2NOG A;  3BPV A;  5LBQ A;  2HYJ A;  1B8I A;  4E7I A;  4IOC F;  4BBS J;  2DMP A;  4MQ9 F;  3LAP A;  1O3Q A;  2WWY A;  4PDK A;  2FJ1 A;  2L2O A;  1IN7 A;  2FBH A;  2QUF A;  1G3T A;  5K7H A;  2F5V A;  1B9N A;  3GFI A;  5DCM A;  3LSP A;  2XAG A;  1HOM A;  4F55 A;  3OYH A;  1FYM A;  2GXG A;  4BE2 A;  2PJR B;  3HRT A;  3MKZ A;  2QF7 A;  2CGP A;  3CCU I;  4M74 A;  2E35 A;  3IWZ A;  1RC9 A;  1MZB A;  5CQG A;  4RAY A;  3KFW X;  4OIP F;  1FBS A;  1UB9 A;  4D9J A;  1UAA A;  4I09 A;  4XOP A;  2C6Y A;  3CDH A;  2P5K A;  5L3B A;  3HG9 A;  3HUG B;  4HLX A;  2CUE A;  1MH3 A;  4E7Z A;  2BY2 A;  1E3H A;  5BNG A;  3FMQ A;  3P9C A;  4Q47 A;  5F1J A;  2MH2 A;  3EET A;  4C2M J;  4A3D J;  2K4B A;  3RPU D;  5M3F J;  2HZT A;  2XAF A;  1FP1 D;  3OR1 C;  1D8J A;  2V7F A;  5J8F A;  3H9G A;  3TQN A;  1LDD A;  3BP8 A;  2FOK A;  4GRI A;  4I02 A;  4EQQ A;  3BQZ A;  1RNL A;  1ZAR A;  4XRM A;  3CUO A;  4A3E J;  4RLF A;  3F21 A;  1T95 A;  2VKE A;  4G7O F;  1YIT I;  1VQ8 I;  5AON A;  1R4M B;  2K02 A;  4RDU A;  4LG0 B;  3JRB A;  2ZNY A;  1LE8 B;  2F6C A;  2RVC A;  2Y9Y A;  3HOV J;  2DK5 A;  3ZMD A;  3CF2 A;  4CUG A;  4DYQ A;  5FGM A;  1I3Q J;  1X3Z B;  4XON A;  1C0W A;  5IT3 A;  5L3G A;  2ME0 A;  2YX7 A;  5D4S A;  4RB2 C;  2A6H F;  3CCY A;  1X3U A;  4Q4Z F;  1Z91 A;  3RDI A;  5ICG A;  3MVP A;  2CQX A;  3C18 A;  3CJR B;  1N25 A;  1A6I A;  1T0F C;  4IZZ A;  2E2H J;  3I59 B;  3FIW A;  2XVC A;  4KDP A;  2M30 A;  1SMY F;  2L9V A;  4UUS A;  3CUQ C;  4AIK A;  2JQ7 A;  1T8I A;  5KHD A;  2LKP A;  1BI1 A;  2XRO A;  3I56 I;  4DYR A;  3U1K A;  1YRN B;  1IJW C;  3CCL I;  1LDJ A;  3JRG A;  1YHQ I;  2KIQ A;  2OCE A;  5A2Q K;  3CMA I;  2LY1 A;  3ZQH A;  4EJO A;  3T8R A;  3BZK A;  3D0S A;  3FF5 A;  3PQJ A;  3GX4 X;  2FOW A;  5D5X B;  1MDM A;  3HKZ A;  4WXC A;  3CME I;  2OU2 A;  4AYB N;  1Z3Y A;  2KT0 A;  1MSE C;  2R7D A;  2KHM A;  2VQL A;  3A02 A;  3ERM A;  2RDP A;  2VAS A;  1IRF A;  4Y15 A;  4A69 C;  1Z7L A;  3SFZ A;  1D8K A;  1FTT A;  3FDY A;  3AG1 H;  2M8G X;  2V4J C;  4XLA A;  3A1Y A;  4HOB A;  3LA3 A;  1IF1 A;  3LSI A;  4IHT A;  3BLY A;  4GYI A;  2MD5 A;  2M9H A;  3U2R A;  4ZDP A;  3VPR A;  3ESW B;  1TNS A;  4A3L J;  3L9F A;  4G6T B;  5DD4 A;  1QHH D;  4RB0 A;  4NQW A;  5E1W A;  3IKT A;  4LIT A;  4LJZ F;  4L18 B;  2IGN A;  3EYY A;  1TBX A;  2K9Q A;  3GUD A;  3I3L A;  2PLY A;  4N4O B;  4R1H A;  2FUG 2;  5HS7 A;  4FTH A;  2W48 A;  3VEP A;  3ZMV A;  4DBQ A;  2JVH A;  1R49 A;  1F5T A;  2J5P A;  2HI3 A;  4M9X A;  4KMF A;  1ZGJ A;  1ITY A;  1TT5 B;  3M7G A;  2FNP A;  5CVV A;  3N97 A;  2JRT A;  1B8I B;  5LRS A;  3H0D A;  2FBK A;  3JSO A;  2COM A;  5HS9 A;  4GCV A;  5FLM J;  5B3S H;  1V55 H;  3KYL A;  1ZR4 A;  5DCM B;  3JRH A;  4EJU A;  4II2 A;  1J0R A;  2GM4 A;  4EJV A;  2L7M P;  5EGO B;  4UY8 I;  1VQ4 I;  1MBJ A;  1QHG A;  3SJM A;  1WCM J;  3FX3 A;  5CLS A;  1FBU A;  5LEJ A;  4AIJ A;  3IRQ A;  2LDU A;  4E7J A;  5E8G A;  2OZU A;  3HYI A;  1E17 A;  2HXO A;  4MLO A;  3M3Y J;  1PUF A;  2ZFU A;  3HBL A;  3LOC A;  3QPH A;  5LRR A;  3ZQL A;  1TP4 A;  3PIP F;  2YU9 J;  1WZ2 A;  2CW7 A;  3KP6 A;  3FM5 A;  3S8P A;  4IOA F;  2ZSI B;  2LFB A;  3E5Q A;  2VN2 A;  1S3J A;  4XL9 A;  2PX9 A;  3ZMZ A;  2W1O A;  4WF2 A;  3T1B A;  1W0U A;  2DI3 A;  1N77 A;  5BOX A;  1TW2 A;  1R1T A;  1JGS A;  3ZGK A;  4PUS A;  2P7C B;  1Y8Q B;  4DZJ A;  4M3F A;  1KZH A;  3EUH C;  3CP8 A;  3DV8 A;  2O8X A;  5J40 A;  4P1W A;  2OUM A;  1Y1V J;  1ERD A;  3DPU A;  3KEY A;  4QIW N;  3H9Q A;  4EAT A;  3F8M A;  5IP6 A;  2Z3Y A;  4JQF A;  1O7F A;  3GLL A;  4BQO A;  3KP3 A;  3MZH A;  1UFM A;  4ZYA A;  1KQ8 A;  2GQQ A;  1QZZ A;  2EBI A;  3HSE A;  4G6D A;  2KJC A;  2XGE A;  2UV1 A;  3QYB A;  4GYG A;  2O8K A;  2FD5 A;  1XC5 A;  2D45 A;  4IRG A;  3CZ6 A;  3NEU A;  4EMS A;  3C7J A;  2Z9O A;  1Z7U A;  3DBL B;  1FIP A;  5CVU A;  3G73 A;  3DBH B;  3KYD B;  3OYJ A;  2DA1 A;  1PVE A;  4E7S A;  4FAS D;  2CV2 A;  2HQR A;  4N9H A;  5CVI A;  2EZH A;  3BCB A;  4WCG A;  2KRC A;  1XDS A;  2K9M A;  2ZME C;  4KJZ A;  4B43 A;  5J1R A;  3RYP A;  2CQQ A;  2O7O A;  1KON A;  5FKO A;  5E3N A;  4UUS B;  4BE0 A;  3BR0 A;  4ESF A;  4IEJ A;  2JZY A;  5JVG F;  3HKZ N;  2O3F A;  5EF6 A;  3C1D A;  4A6E A;  1V5F A;  2H09 A;  3DKY A;  4ZYG A;  3B6C A;  4FHT A;  1LNW A;  1FWZ A;  4U7B A;  1K79 A;  2EFQ A;  1IAW A;  4UB6 C;  2F5D A;  2LF7 A;  4R8H A;  4V19 K;  2ECC A;  4S05 A;  3CCM I;  2Y2Z A;  1FTZ A;  1PDN C;  1MDM B;  1U8R A;  2UWM A;  2F2E A;  2OQR A;  1LVK A;  2M5W A;  4IHW A;  3HPH A;  1W36 D;  1FOX A;  1YE9 A;  3CQZ J;  1FMV A;  2NVT J;  3IC7 A;  5D8L B;  1QVU A;  1TWF J;  4ZYE A;  2M4G A;  1D1C A;  1F36 A;  5DDG A;  4W1U A;  5GTH C;  1W4M A;  2H27 A;  2OA4 A;  5IPA A;  5IYC J;  1U5T A;  4CHU A;  2O9L A;  5F0C A;  2E1O A;  1B6A A;  2GIZ A;  6PAX A;  3HPG A;  3F22 A;  4BKX A;  3WHB A;  3I55 I;  3WOD F;  2EZL A;  3WE2 A;  2V1D A;  4NQW B;  1NH3 A;  1SAN A;  1G2H A;  1LUJ B;  2DJN A;  2WAQ N;  4ENJ A;  2XIG A;  1MJ9 A;  2OZ6 A;  4M6V A;  2ETH A;  2X4H A;  3VOE A;  5GTI C;  2F4I A;  2K9S A;  4AID A;  1KGS A;  3M8J A;  3RKX A;  2WA0 A;  3J81 K;  2VIX A;  3ONQ A;  4DZP A;  3S17 J;  1MMG A;  2EWN A;  2Y0M A;  3I64 A;  3JRD A;  2O61 A;  1IV8 A;  1FYK A;  2LC2 A;  2QLZ A;  3I71 A;  2ELK A;  1PUE E;  4MO7 A;  4BU2 A;  3VYS B;  2VUM J;  5J1U A;  4Y17 A;  4ZYD A;  4AD9 A;  1ZQ3 P;  1I5Z A;  2A6T A;  2VOP A;  2CS3 A;  3OS0 A;  2AHQ A;  2DCE A;  4C3J J;  1LDK B;  2VQG A;  3CMY A;  3REO A;  3BY6 A;  5AIQ A;  5E8I A;  2NNY A;  2WY7 Q;  3DWL E;  4ABZ A;  3M8F A;  1W7P A;  3GFM A;  3HRS A;  5A2Q Z;  1EH6 A;  4XLC A;  4I98 B;  4BH9 A;  3OYL A;  4ZZL A;  1LPQ A;  3MCZ A;  3NAU A;  5BQT A;  3A01 A;  4LK0 F;  4AVP A;  3ISP A;  4J00 A;  2L9S A;  3L2W A;  1XS9 A;  1GXP A;  1PUF B;  2ZNZ A;  4HSR A;  4FCY A;  2R93 J;  2NVX J;  4YIF A;  5CVR A;  5DYM A;  1MBE A;  4PK4 A;  1P92 A;  1ZRD A;  4EVI A;  4NHJ A;  3CLQ A;  5E17 F;  2DW4 A;  2KJB A;  2PI0 A;  3UR3 C;  1JHF A;  5C4J J;  2R7V A;  1H0M A;  1X1A A;  1D5Y A;  2BBY A;  3FHN A;  4IHS A;  5HLT A;  1QZY A;  2VJI A;  3DLL F;  4CZC A;  1EH8 A;  5IOZ A;  1NK3 P;  3K4K A;  4BDY A;  2GA2 A;  5J1Y A;  2GOM A;  4A3J J;  1PP8 F;  2H1K A;  3KCC A;  4L9N A;  3TDZ C;  4BJ6 C;  3PL8 A;  3K4B A;  2B9S A;  4V2F A;  3GFJ A;  2Q1Z B;  2FBI A;  4WXH A;  3CDI A;  4ANJ A;  2YPR A;  2QQB A;  2W84 A;  3E1S A;  2CQN A;  5D6E A;  3WHC A;  2V1X A;  4HDU A;  2XGC A;  3S3N A;  2ELJ A;  2IBD A;  3JRE A;  1EA3 A;  4LMY A;  5FRN A;  4LG3 A;  3KZZ A;  4LIU A;  1J5Y A;  1XGM A;  1IRX A;  2DQL A;  4A0Y A;  3OS1 A;  3TKY A;  4UNO A;  5K5R A;  1YW7 A;  3RQI A;  1ONV A;  2FRH A;  2E5Z A;  5FKM A;  4I0B A;  5LEK A;  4IQJ A;  3F72 A;  4KN4 X;  3QPS A;  1ORK A;  3RTR A;  4L9V A;  2V9K A;  2HNH A;  1Z77 A;  3K69 A;  2VBZ A;  5F1R A;  5CPR B;  1WJF A;  1P4A A;  1R23 A;  3K4N A;  1BW6 A;  4RB1 A;  1ZAO A;  3DU6 A;  1BM9 A;  4RAF A;  1KA8 A;  9ANT A;  2FF4 A;  3HRM A;  1R22 A;  3G3Z A;  4M3D A;  3Q0U A;  3H92 A;  1VQK I;  5IP7 J;  1LEB A;  1A5J A;  3WE3 A;  4A3C J;  2RKH A;  2Z2S B;  3CC2 I;  4G12 A;  3FHZ A;  1NTC A;  1YG2 A;  1CF7 A;  1MH4 A;  1EKE A;  3KZI C;  4DQ2 A;  2VON A;  1MSF C;  3HB9 A;  2AQF A;  1WRJ A;  2V9P A;  2E71 A;  1YIO A;  3K2A A;  5D5W B;  2AQE A;  2V9V A;  1BI3 A;  5D6F A;  2DA6 A;  2MC4 A;  4NDL A;  1T98 A;  3DXJ F;  4UV9 A;  1I27 A;  3Q0V A;  3ZQG A;  3ABM H;  3CCJ I;  1H88 C;  4JOM A;  2E1M B;  3LQR A;  4HLY A;  4CCL A;  4OIQ F;  4BGD A;  1DGW Y;  1JT0 A;  5EEG A;  1RET A;  2VBW A;  3OIQ A;  4HZF A;  2DPU A;  3HM5 A;  2CV1 A;  2CU7 A;  3I4P A;  3G6E I;  1R36 A;  3K7A J;  3RI4 A;  5J8C A;  1FYL A;  2CWE A;  4BY1 J;  1KYZ A;  1WJB A;  3HHG A;  1U5T B;  1WQ2 A;  2E36 A;  4E6K G;  1MMS A;  2DMU A;  1OLT A;  4CXF A;  3OSF A;  2WC2 A;  2H1L A;  3ABU A;  5E18 F;  2PBI A;  1T39 A;  3GME A;  3F6O A;  3COA C;  1JT6 A;  3HSF A;  5HLG A;  3OYA A;  4YIR X;  1HC8 A;  2Q0O A;  3BWG A;  1RR8 C;  3VWB A;  5FRM A;  1R00 A;  1FY7 A;  4MEX F;  2JWT A;  4XLP F;  4HDV A;  1FOK A;  4XRS A;  4BHB A;  3JAM K;  1BC8 C;  4UXN A;  4MNU A;  1AA7 A;  4LB5 A;  2RNG A;  1IW7 F;  1WHU A;  3O2P E;  2Z16 A;  2H6C A;  3OYE A;  1BN5 A;  4RS8 A;  4XLN F;  2EIN H;  1P7J A;  1WVR A;  4UUV A;  1SMT A;  1XB4 A;  1CQT A;  1WJC A;  2E34 A;  2LD5 A;  1T0F A;  2W25 A;  1IRZ A;  4IVN A;  5EJC A;  4LFU A;  1RIO H;  4AM3 A;  2FNA A;  2HOA A;  1WKM A;  5FB2 A;  3AKZ A;  1ETK A;  3QRF F;  2TCT A;  4HAM A;  1J7K A;  3OR2 C;  4NC7 A;  4XLH A;  2DU9 A;  1VQO I;  1XSD A;  2E19 A;  2OJE D;  2HDC A;  4MFE A;  3QU6 A;  1W7P B;  3KPH A;  1JUP A;  3Q0W A;  4IX7 A;  1JGG A;  4YRV A;  1YJN I;  1G3Y A;  2EFN A;  1Z3X A;  5DM6 F;  3A01 B;  2FQ4 A;  4A2U A;  4B1R A;  3E3V A;  1IDY A;  2NXN B;  1W7P D;  1SVL A;  3DFG A;  3V4G A;  2BHY A;  4P55 A;  3HHH A;  3KZY A;  1NK2 P;  5KK1 A;  3EDP A;  3MFK A;  1X1P A;  2NNN A;  3GZ5 A;  2VBY A;  3KP5 A;  1G8X A;  1GLN A;  3G1L A;  2JA8 J;  1J75 A;  3K4J A;  3IP4 B;  1VQM I;  2HXI A;  3M1E A;  4C2U A;  3ZR8 X;  4YFN F;  4P5O A;  3BG9 A;  4BQQ A;  2VOO A;  2M2E A;  1QO0 D;  2VT2 A;  3BZ6 A;  4FE7 A;  3L7W A;  5B1B H;  3TW6 A;  4YII A;  1QBJ A;  2DLL A;  2FE3 A;  4LIV A;  4Z2Y A;  4QPQ A;  4HA8 A;  4PJJ A;  4C3H J;  4F7Z A;  4YFK F;  2P0W A;  2CO5 A;  3M07 A;  2P4W A;  3T5X A;  3BG7 A;  4DYC A;  2VPL A;  4I7H A;  3HDD A;  1Y0N A;  2O6G E;  2M87 A;  3ZXS A;  3QOP A;  1R1U A;  5FKL A;  4H0E A;  3ABL H;  2IS6 A;  3J81 Z;  2E2I J;  3H36 A;  4RGR A;  1NHA A;  1S8N A;  3KP2 A;  4L9J A;  1JTX A;  4ITV A;  4RM2 A;  4O6J A;  2MSY A;  5JLW A;  5F27 A;  5C3E J;  1OYI A;  4HQE A;  3GXO A;  2PMZ A;  3G1M A;  5CVJ A;  3OYN A;  3JRI A;  2HVS A;  4QWQ A;  2K40 A;  2ZCW A;  2BGC A;  1IN6 A;  4C9Y A;  4RB3 C;  3KP4 A;  1P9Q C;  3VYU B;  2JK3 A;  3LA7 A;  5JLX A;  5KAF C;  2XV4 S;  5GP9 A;  3MKL A;  2JA7 J;  4B8X A;  3DEE A;  2EK5 A;  4UV8 A;  4P9F A;  2RQQ A;  3HOZ J;  3I4N J;  2EH3 A;  3OYI A;  2Y30 A;  3AAF A;  5HLI A;  5FLV A;  1DPR A;  1TWH J;  4PZJ A;  1KQ0 A;  1X58 A;  3AG3 H;  3E5U A;  3RIR A;  1MBG A;  1J9I A;  1CF7 B;  4NB5 A;  5LGU A;  3L1P A;  2CFX A;  1ETY A;  1HLV A;  4AU7 A;  2OPT A;  4C2T A;  2XSD C;  1UMQ A;  3TP3 A;  3VSL A;  2DFI A;  2LLK A;  1POG A;  4Y7N J;  5ILU A;  2D1V A;  5KNL A;  2JA2 A;  1ZG5 A;  4M3G A;  3G2B A;  4AWX B;  3SEQ A;  1RR7 A;  4ENK A;  1LQ1 A;  2W57 A;  3U21 A;  3SDB A;  2EFP A;  4RM3 A;  1JUS A;  3JRA A;  2H8R A;  3I58 A;  1GV5 A;  1NG7 A;  1MKM A;  3WTS C;  1MBK A;  4XLF A;  5FFZ A;  5IY5 H;  1TWC J;  3WGG A;  1OJL A;  3BTJ A;  3SZT A;  2E60 A;  1ETX A;  3OIO A;  3HRU A;  4W97 A;  4U0Y A;  3H35 A;  1HKQ A;  3GO5 A;  1TW3 A;  3WG9 A;  4IHV A;  2M0C A;  3BR3 A;  3NQO A;  4HST A;  3ZQQ A;  1FOW A;  2XUB A;  4A5M A;  5J6X A;  1Z1D A;  3J80 K;  3D1N I;  3CC7 I;  2IS1 A;  2R7T A;  4A3M J;  2CSO A;  3PQK A;  4XID A;  1BR2 A;  3CO6 C;  2DA2 A;  2G0E A;  2TDX A;  3E6D A;  3HIF A;  5LGN A;  1IXR C;  1TQI A;  4PFP A;  1WSU A;  2HDW A;  5KCM A;  4EEF G;  5LGT A;  2L4A A;  4BHP A;  2X0L A;  1Y6I A;  3KEQ A;  4RGU A;  3GLX A;  3DTI A;  1BBY A;  2BVM A;  4JYK A;  2L3D A;  3HL2 A;  1A35 A;  3VYR B;  3S2H J;  2WTE A;  4L0Y B;  4OAZ A;  4G7H F;  1RPW A;  4L5J A;  4ETS A;  2VC1 A;  2JMW A;  3K1P A;  2V1N A;  1R5G A;  3GW2 A;  2L7F P;  4XN0 A;  3K70 D;  1FEX A;  4E7K A;  3PSF A;  3FM3 A;  2EA2 A;  5DCF A;  1MW7 A;  3CJN A;  1BL0 A;  2MBF A;  1SFK A;  2DOE A;  1S9H A;  2ID6 A;  4B47 A;  1FZP B;  4ZDL A;  2BY3 A;  3GTL J;  5LLQ A;  4E4H A;  4BXX J;  3WTT C;  3IH2 A;  4HNU A;  2L4M A;  4N0B A;  4LLG F;  1LJ9 A;  4XM3 A;  2DBB A;  3U1D A;  2NS0 A;  4NC6 A;  3WTV C;  3L2R A;  2IGM A;  2FSW A;  2RNJ A;  3WTU C;  4XRF A;  4Q48 A;  2BV6 A;  3Q9V A;  1R58 A;  4OIO F;  2ZKZ A;  4KMU X;  4HYE A;  1BIB A;  2LOO A;  2EA4 A;  2PMZ N;  5TIS C;  2W85 A;  4KNY A;  1Y1W J;  4CCK A;  1XMK A;  2ZBK A;  2ZB9 A;  1I1G A;  1LFU P;  2TRT A;  2JPB A;  3QYE A;  1ON2 A;  5D8K B;  3JAM Z;  1E3P A;  3ZQ7 A;  3HC7 A;  2WAQ A;  1TL8 A;  4FX0 A;  2LSO A;  2XGD A;  1GV2 A;  2IEK A;  3EPZ A;  1O3S A;  4BYY A;  2IRF G;  2GXB A;  3MWM A;  3I5U A;  3L2Q A;  3S14 J;  3CCE I;  1SD7 A;  3A4C A;  2PJP A;  4DNC A;  3GTK J;  3WU2 C;  2X6Y A;  4B3A A;  1V54 H;  2EIK H;  2NS7 A;  2KMU A;  1ZN2 A;  2I8D A;  4YEL A;  2IS2 A;  2HQ5 A;  4PJN A;  3G1O A;  2EB7 A;  2BOL A;  5J47 A;  1H9G A;  3FWE A;  1IXC A;  1TQP A;  2VB6 A;  3SZG A;  2MC3 A;  5L3F A;  4BQA A;  1ZGW A;  2R3S A;  3S16 J;  1XMX A;  2DJI A;  4XBF A;  3ZRG A;  1H89 C;  1HW2 A;  4M72 A;  1FC3 A;  3R0J A;  3VSK A;  5C4X J;  2XHK A;  3N4M A;  2CMP A;  4HG2 A;  1T08 B;  1IO2 A;  3H5N A;  5GAG J;  4CO8 A;  2QSF X;  1Z6R A;  3CJT B;  4CYD A;  3BRO A;  2NVY J;  4A3F J;  3RJP A;  5E3L A;  5HNF A;  3L2U A;  2BY1 A;  3R0A A;  1IN5 A;  4GGG A;  2MG4 A;  1WJA A;  4QLC U;  2HVR A;  1F43 A;  1YX3 A;  3MQ0 A;  4MQV A;  1WI3 A;  1OCP A;  5IT9 K;  3CES A;  4HNT A;  2PMU A;  4M73 A;  2HTJ A;  3KIO A;  1AU7 A;  2HS5 A;  2NAZ A;  2L01 A;  1H8A C;  5J3L A;  3WU0 A;  2HPI A;  3OYB A;  1Y56 A;  2DYR H;  4I01 A;  3SDG A;  4BAY A;  1EJ9 A;  3HXL A;  5J4V A;  2LY2 A;  2IS4 A;  4X0G A;  1BW5 A;  2W7N A;  2RQP A;  2ADU A;  3ZMT A;  1M1E B;  3TO7 A;  4DGW B;  4XQF A;  1K6Y A;  3MN2 A;  1QRY A;  4ZH4 F;  2X51 A;  2A61 A;  5ICF A;  3QPL A;  3BCA A;  1WI9 A;  1S29 A;  3BJO A;  4QTR A;  3F6V A;  3JR9 A;  2F48 A;  1USS A;  2KRF A;  2R7O A;  3EUK L;  2MA3 A;  5H2F C;  2CFO A;  2MYS A;  3A0H C;  2JA6 J;  4L9T A;  2ZXH A;  3AL0 B;  2R7X A;  3W2V A;  3W6J B;  1S7E A;  1SFE A;  4CDG A;  4FET A;  4LOC A;  2M45 A;  4JX6 A;  1SFO J;  2A69 F;  4EJT A;  4EM1 A;  1U0J A;  3HSR A;  2CJJ A;  1OCR H;  1L0O C;  5DUK A;  3FZV A;  2YU3 A;  2BE5 F;  2QZ8 A;  3FK7 A;  5E1X A;  3QOD A;  1K4S A;  3P7N A;  2OC6 A;  4M3B A;  4Y3O A;  1LKX A;  2K7L A;  2WV1 A;  3TMO A;  3VB2 A;  3L2V A;  3ASO H;  4ZTJ A;  3F0C A;  2Q8K A;  2E7W A;  4KT5 C;  2XKP A;  3QP6 A;  1BA5 A;  4JBA A;  3CCS I;  1GT0 C;  3S1Q J;  3QPT A;  1XCV A;  3GVA A;  3T8T A;  1J59 A;  4KYW A;  1P4W A;  2Q2E A;  3J7A Y;  2M34 A;  3S1R J;  4G8X A;  2STT A;  5DEQ A;  3ECO A;  2HVQ A;  4KIC A;  2PMH A;  1YYV A;  3P5J A;  2L0K A;  3DU5 A;  5K1Y A;  5JR3 A;  3IUO A;  5GAD J;  1ODD A;  4OOI A;  3V42 A;  1YX5 A;  2NOJ B;  2V26 A;  3IV5 A;  1T38 A;  3W6V A;  1W36 C;  4ZYH A;  4ZZD A;  3V7R A;  1FBQ A;  1TQM A;  1O3T A;  1V5G A;  2JPC A;  1D5V A;  3RCO A;  3RQ4 A;  2DFE A;  4B4C A;  1Z0X A;  4D5F A;  1YO5 C;  3S1M J;  3C2B A;  3PIO F;  2XPV A;  1ZGA A;  1UHW A;  4OIN F;  2UXN A;  2D1H A;  3J7Y J;  1RUO A;  2W4S A;  4WK8 F;  1JKO C;  2UUZ A;  5M5W J;  3OMY A;  3GTJ J;  2CUJ A;  2IW5 A;  2IP2 A;  3ERE D;  2OD5 A;  4A3K J;  1XPX A;  4DBR A;  1MBF A;  2XAU A;  3K6G A;  4LK1 F;  4BHC A;  3BR1 A;  3DEW A;  3OIP A;  1TT0 A;  1GXQ A;  3MMY B;  5ILV A;  2CQ7 A;  1BC7 C;  1XSV A;  2P5V A;  1ZLK A;  2COB A;  2EJR A;  4I99 C;  4MEY F;  1AHD P;  2A5W A;  1DP7 P;  2DN0 A;  2HTS A;  4JK1 X;  5DV5 A;  3WTW C;  4Y33 A;  1IDZ A;  2D5V A;  1I6H J;  4R79 A;  1E2X A;  5HOD A;  4P96 A;  1WWX A;  2VI6 A;  3BTC A;  2K5C A;  4ZJZ A;  5M3M J;  3MKW B;  1Q1H A;  3FKI J;  3J80 Z;  4X6A J;  2ESH A;  1BJZ A;  4EM2 A;  3SEZ A;  2XC7 A;  4UB8 C;  2XAS A;  3QQA A;  4KIS A;  1OR7 A;  4F93 B;  1JHH A;  5EZH A;  1UJ8 A;  3H3Z A;  3N05 A;  5IOY A;  1LEA A;  4LGW A;  4GXO A;  4XIC A;  1Y8R B;  3CC4 I;  3H3U A;  3VDX A;  4NC8 A;  1FIA A;  3IKV A;  1MMA A;  3PUF A;  3O6B B;  1JE8 A;  2KDO A;  4I2O A;  1OFC X;  3KE2 A;  1VND A;  1HSJ A;  2O5R A;  2LP0 A;  2QKL B;  2VLA A;  2X1C A;  4ZDO A;  5EEA A;  4XKC A;  1IUF A;  1PJR A;  2FML A;  4A93 J;  2A6E F;  5H20 A;  3FMS A;  2LNB A;  3IAM 2;  4QPO A;  4I76 A;  2XSJ C;  4MTE A;  2HOT A;  3FMR A;  2DOF A;  1DUX C;  3E6M A;  4BJT A;  3E7L A;  5B1A H;  1MD0 A;  2XAH A;  3DCF A;  2QSH X;  5HLH A;  2KL4 A;  2P6S A;  3QWL A;  1WH5 A;  2H6B A;  2R5Z A;  2EV6 A;  4OU0 A;  2H8W A;  2N8G A;  3WGI A;  3LSH A;  3VYT B;  4GFB A;  1HST A;  3M1C A;  2WB1 N;  1WJE A;  1OKR A;  1JJ8 C;  3ROU A;  2KIS A;  3GWZ A;  1R1V A;  1G3W A;  4Z6Y A;  2ACJ A;  2Y48 A;  2EV5 A;  2KFD A;  4HX7 A;  2KDZ A;  2WV0 A;  1ZK8 A;  2X1E A;  5FD5 A;  3HGG A;  4KIG A;  1IV6 A;  5TGT A;  2E2J J;  2M3A A;  4A5N A;  3GEZ A;  3FBI B;  2JTV A;  1UST A;  3BOQ A;  5L3D A;  1UG0 A;  3M8E A;  1RES A;  3OYK A;  1U8B A;  2W82 A;  2PFB A;  3PJR A;  4HQM A;  3MD2 A;  3V7S A;  2BXZ A;  5TJJ A;  4IO9 F;  5LHI A;  2DXI A;  4I0A A;  1LVA A;  3S93 A;  2CRG A;  1XSX A;  2GWR A;  2JRM A;  2YX4 A;  2O0Y A;  2AS5 F;  5D4R A;  4KUM A;  5FJ8 J;  3LSK A;  4BS9 A;  3D5S C;  3ECH A;  3VFZ A;  1O7L A;  5LD2 C;  1CGP A;  1X2N A;  1QPM A;  4F52 A;  1HA8 A;  1S7O A;  2PN6 A;  3IH3 A;  3PNT A;  2Q2E B;  3BG3 A;  1Z9C A;  1IN8 A;  2IXS A;  1GDT A;  1QNT A;  2MD0 A;  1YFH A;  3KEO A;  2QGU A;  5HVQ C;  4ASN A;  5HDK A;  1A36 A;  2WAF A;  1T33 A;  5L3C A;  3CP2 A;  3J7A O;  3E5X A;  3DP7 A;  4PGG A;  4A0Z A;  1VTN C;  5IT9 Z;  3BPX A;  3R61 A;  4NUB A;  1YS6 A;  2DA3 A;  2ME6 A;  3TL4 X;  2HKO A;  4CH7 A;  2HYF A;  1YI2 I;  2FA5 A;  3O8H A;  5H6Q A;  2WY8 Q;  2QSG X;  3CCV I;  1QZE A;  1RRJ A;  2ELH A;  1AKH A;  2EIM H;  3KET A;  3LSM A;  1YTY A;  1R71 A;  2R7F A;  1OYY A;  2E1M C;  4C3I J;  4BUP A;  3GYH X;  1ZRC A;  2VPR A;  1BR4 A;  1BR1 A;  2VE8 A;  1TC3 C;  2DMT A;  4IRI A;  2I5U A;  4JX5 A;  2R7U A;  2ZC2 A;  1U5T C;  4L5I A;  1ZHF A;  3TO9 A;  4KT6 A;  3TED A;  3CLO A;  3A03 A;  2F5E A;  3IWF A;  1U6G A;  3LSJ A;  2CQK A;  1XN7 A;  2LH9 A;  2XF5 A;  2YR2 A;  3H5A A;  3TGN A;  4ESB A;  5CYV A;  1IXS B;  2R7Q A;  4ZTF A;  4K2E A;  2VL8 A;  2X6W A; 
#chains in the Genus database with same CATH homology
 2R7Z J;  1GV5 A;  2X9D A;  3S15 J;  1MBK A;  4V2G A;  1W0U A;  5F08 A;  2EQR A;  1TWC J;  2X6O A;  1OJL A;  3BTJ A;  2YS9 A;  3BTL A;  1ETX A;  3OIO A;  2MGQ A;  4W97 A;  2EZI A;  4DZJ A;  4M3F A;  4FIS A;  3H3V K;  1Y1V J;  2YUS A;  1HCR A;  5EDN A;  2CUF A;  4IHV A;  4D7M A;  2DMN A;  2M0C A;  3B6A A;  4QIW N;  3BR3 A;  3S2D J;  5IP6 A;  3RKQ A;  5GPC A;  3D1N I;  5EG0 A;  2EBI A;  4A3M J;  2O8K A;  2XGE A;  5F04 A;  1GVD A;  3NAR A;  4XID A;  4I6Z A;  2FD5 A;  1XC5 A;  2DA2 A;  2G0E A;  1U9N A;  2LY9 A;  1FIP A;  4EEF G;  2R92 J;  2DA7 A;  2DA1 A;  1VF9 A;  2EZH A;  1B72 A;  4X1E A;  3OOU A;  5J1R A;  4JYK A;  2CQQ A;  2O7O A;  5FKO A;  3S2H J;  5E3N A;  3HEF A;  4UUS B;  1RPW A;  3BR0 A;  5IYD J;  2JMW A;  3BG5 A;  5IP9 J;  3FK6 A;  3ZQI A;  2R0Q C;  4IEJ A;  1APL C;  3HKZ N;  2L7F P;  5F0H A;  1FEX A;  4IHX A;  5EF6 A;  1IGN A;  3B6C A;  4D5C A;  1BL0 A;  2ID6 A;  4DW6 A;  1UG2 A;  3GTL J;  1TWA J;  4BXX J;  3IH2 A;  2ECC A;  1FTZ A;  2Y2Z A;  1ETV A;  3GBG A;  3TP0 A;  4IHW A;  3CQZ J;  2NVT J;  1W0T A;  1QVU A;  3ZOB A;  2Y0S N;  1TWF J;  2PMZ N;  4A3G J;  1F36 A;  4W1U A;  1Y1W J;  1VFC A;  2ZB9 A;  1LFU P;  2TRT A;  3JRF A;  5IPA A;  5IYC J;  2O9L A;  5F0C A;  1DU0 A;  2E1O A;  2K9N A;  2XGD A;  1MNM C;  1GV2 A;  2IEK A;  4BKX A;  3WHB A;  2EZL A;  3S14 J;  5EGO A;  1T56 A;  3TW7 A;  3HOW J;  2XB5 A;  1SAN A;  3GTK J;  2RAE A;  1G2H A;  2DJN A;  2WAQ N;  1JJ6 C;  5M5Y J;  4B3A A;  2NS7 A;  3BQY A;  4M6V A;  1JKR C;  2HQ5 A;  3G1O A;  2P81 A;  3HGY A;  2K9S A;  1ZGW A;  3S16 J;  2XPW A;  1H89 C;  4DZP A;  3S17 J;  3JRC A;  5C4X J;  3JRD A;  1Q1V A;  1E3O C;  2LVS A;  1O4X A;  2EZK A;  1ZTR A;  1LE8 A;  4S0H B;  1DU6 A;  3RZO J;  2NVY J;  4A3F J;  1AKH B;  2ELK A;  2LK2 A;  3ZQF A;  4MO7 A;  3IH4 A;  5E3L A;  3M4O J;  2VUM J;  5J1U A;  2I10 A;  1ZQ3 P;  3PO2 J;  1U9O A;  2MG4 A;  2L9R A;  1F43 A;  2AHQ A;  4C3J J;  3CMY A;  1WI3 A;  1OCP A;  4XRS G;  3I4M J;  2NS8 A;  4ABZ A;  4AC0 A;  3NAU A;  1AU7 A;  3A01 A;  1XS9 A;  1H8A C;  5J3L A;  1U78 A;  1PUF B;  2HDD A;  4FCY A;  2R93 J;  4UUT A;  3SDG A;  2NVX J;  3CDL A;  1MBE A;  1BW5 A;  5C4J J;  3MN2 A;  1D5Y A;  1QRY A;  1WPK A;  1K83 J;  1HDP A;  2OF7 A;  5DS9 A;  3QPL A;  1YRN A;  2FX0 A;  4QTR A;  1NK3 P;  5IOZ A;  3JR9 A;  3S1N J;  2JN6 A;  5J1Y A;  2JA6 J;  4A3J J;  2H1K A;  1S7E A;  3LNQ A;  2LTP A;  4LOC A;  4V2F A;  1IG7 A;  4JX6 A;  4L5E A;  3PO3 J;  1SFO J;  1QPI A;  4CYC A;  4JP0 A;  2XB0 X;  2CJJ A;  1LFB A;  4MIM A;  3UKG A;  1EF4 A;  3WHC A;  2R5Z B;  2Y31 A;  4FE4 A;  2XGC A;  3FK7 A;  1ETW A;  4M3B A;  2IBD A;  1GUU A;  5EG0 B;  3JRE A;  2WV1 A;  5FKN A;  3GTM J;  3HOY J;  3F0C A;  2XPU A;  4MFD A;  1WGX A;  3RQI A;  5GPA A;  1BA5 A;  5M5X J;  1ZKG A;  1GT0 C;  2ID3 A;  3S1Q J;  4Y52 J;  5FKM A;  1X2M A;  1B72 B;  2ECB A;  2M34 A;  3FIS A;  3QPS A;  1WH7 A;  1ORK A;  5DTD A;  3S1R J;  1OCT C;  3GTP J;  1Z77 A;  2Y9Z A;  4BY7 J;  2L0K A;  1MBH A;  1BW6 A;  3IV5 A;  3W6V A;  9ANT A;  4M3D A;  1JKQ C;  3Q0U A;  2QCO A;  4A3B J;  2NOG A;  5IP7 J;  1VI0 A;  2HYJ A;  4B4C A;  4D5F A;  1B8I A;  1Z0X A;  3S1M J;  3C2B A;  1A5J A;  2NVQ J;  2DMP A;  2XPV A;  1FJL A;  4A3C J;  4BBS J;  3OSG A;  4G12 A;  1NTC A;  2FJ1 A;  1JKO C;  5K7H A;  5M5W J;  1MH4 A;  1HDD C;  3GTJ J;  3BR5 A;  3LSP A;  1HOM A;  1MSF C;  3HB9 A;  4A3K J;  3GTO J;  4JX4 A;  5K7Z A;  1MBF A;  4BBR J;  3K2A A;  3BR1 A;  3DEW A;  2GLO A;  2QF7 A;  1P7I A;  2DA6 A;  3H0G J;  4NDL A;  3ZQG A;  3Q0V A;  1H88 C;  3PM1 A;  2R5Y A;  3BR2 A;  3BR6 A;  2COB A;  1JT0 A;  1RET A;  3HM5 A;  1AHD P;  2DA4 A;  2CU7 A;  2DN0 A;  3K7A J;  2CUE A;  1MH3 A;  4XK4 A;  4RBO A;  4BY1 J;  5BNG A;  5F1J A;  1IDZ A;  4C2M J;  2D5V A;  4A3D J;  1I6H J;  2DMU A;  5M3F J;  3OSF A;  1JKP C;  5HOD A;  2VI6 A;  3BTC A;  1R9T J;  3LSG A;  5M3M J;  1RKT A;  2DMQ A;  3FKI J;  2VKV A;  1JT6 A;  2JJ7 A;  4X6A J;  1BJZ A;  3QQA A;  3BTI A;  1ZR2 A;  1JUM A;  2JWT A;  3LSR A;  5EZH A;  4XRS A;  3BQZ A;  5IOY A;  4XRM A;  4XIC A;  4A3E J;  1FIA A;  2VKE A;  1P7J A;  1OFC X;  4RDU A;  1CQT A;  1VND A;  2LD5 A;  3JRB A;  1LE8 B;  1IRZ A;  4AUX A;  4QSH A;  2Y9Y A;  2LP0 A;  3HOV J;  3Q3S A;  2HOA A;  5EEA A;  1ETK A;  4DYQ A;  1IUF A;  1I3Q J;  4A93 J;  5E3M A;  1I50 J;  2IAI A;  2TCT A;  5FKK A;  2ME0 A;  3CCY A;  2E19 A;  2DTZ A;  4MFE A;  1ETO A;  3MVP A;  2CQX A;  2B63 J;  1JUP A;  3Q0W A;  4I76 A;  1JGG A;  2HOT A;  1A6I A;  2E2H J;  3A01 B;  3E7L A;  2FQ4 A;  3FIW A;  4B1R A;  3DCF A;  1IDY A;  2JA5 J;  4UUS A;  1WH5 A;  2R5Z A;  2N8G A;  1NK2 P;  3RZD J;  4GFB A;  4HNV A;  4DYR A;  2WB1 N;  3G1L A;  1YRN B;  1ETQ A;  2XRL A;  1IJW C;  2JA8 J;  5K7F A;  1JJ8 C;  3JRG A;  1K61 A;  2HXI A;  3ZQH A;  4J19 A;  3BG9 A;  2M2E A;  2KDZ A;  1ZK8 A;  3HGG A;  1IV6 A;  4FE7 A;  2E2J J;  3O8G A;  3TW6 A;  5EYR A;  4AYB N;  2KT0 A;  4M3E A;  1MSE C;  3A02 A;  5F0F A;  4CYC B;  1RES A;  4C3H J;  1U8B A;  4A69 C;  4DYC A;  3HDD A;  3GTQ J;  1FTT A;  2MW8 A;  2M8G X;  2CRG A;  5FKL A;  1HF0 A;  2L7Z A;  5FJ8 J;  1JTY A;  2E2I J;  2M9H A;  1JTX A;  1QVT A;  1RKW A;  3VPR A;  2MSY A;  1ENH A;  5F27 A;  5JLW A;  5C3E J;  4A3L J;  1X2N A;  4D7N A;  3G1M A;  3IH3 A;  3JRI A;  3BG3 A;  2K40 A;  3SFI A;  2K9Q A;  3BT9 A;  1GDT A;  2JK3 A;  1IC8 A;  5JLX A;  5GP9 A;  3MKL A;  3HOX J;  2JA7 J;  4FTH A;  2W48 A;  1T33 A;  2X48 A;  5EZG A;  3HOZ J;  2HI3 A;  5C44 J;  2LKX A;  3I4N J;  2EH3 A;  1ITY A;  2DA3 A;  1XG1 A;  2ME6 A;  2Y30 A;  1B8I B;  5FLV A;  3O8H A;  1TWH J;  2AO9 A;  1X58 A;  1AKH A;  2LR8 A;  5FLM J;  1MBG A;  3L1P A;  1ZR4 A;  4C3I J;  3JRH A;  2GM4 A;  1ETY A;  1HLV A;  2L7M P;  2VPR A;  3HOU J;  5EGO B;  2OPT A;  2DA5 A;  2XSD C;  1UMQ A;  3TP3 A;  1MBJ A;  1TC3 C;  2DMT A;  1POG A;  2LLK A;  4Y7N J;  5E3O A;  1WCM J;  3SJM A;  3GTG J;  4JX5 A;  5IYB J;  3ZQC A;  4IHY A;  1UHS A;  1TWG J;  2R5Y B;  2HXO A;  3TED A;  4M3G A;  4MLO A;  3M3Y J;  2HOS A;  3A03 A;  1PUF A;  1RR7 A;  3HBL A;  3LOC A;  3ZQL A;  4A3I J;  2YU9 J;  3LSJ A;  3JRA A;  1JUS A;  2GBY A;  2LFB A;  2H8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...