4X0GA

Structure of bsg25a binding with dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
PMVTIGPNGTEVSRISLSAINWAMTGPSITRKLLCEIFDRDTLAHHTLSGKPSPAFRDCARPSKQQLDPLKVADLVYLMTNSCDMTPREVRTAITTKCADENKMLRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Blastoderm-specific gene 25A
publication title Common and distinct DNA-binding and regulatory activities of the BEN-solo transcription factor family.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10523 BEN BEN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4x0gA00
4X0GA 4IX7A
chains in the Genus database with same CATH superfamily
2EWNA 4XNFA 3WU1B 4BGDA 2WAQN 2MSYA 3R6SA 4CYCA 2V1DA 5GPAA 3MZHA 2Z3YA 1DP3A 4O5VA 3QRFF 1ETOA 2FUG2 2CH0A 1G8XA 2L3DA 3WTWC 2P6TA 2ZC2A 2WTEA 3HTUA 2VBXA 4GYGA 5KVRA 2KKOA 2W1OA 1ITYA 1BR1A 1W7PD 1PUEE 4LMYA 3HOTA 3LSPA 2Z99A 3PNVA 2ISYA 5J1RA 4LB6B 1LEBA 1LVKA 2W57A 2YR2A 2WV0A 2OD5A 2JK3A 5M5XJ 4C2TA 3WTYC 1USSA 2R7VA 5LD2C 1IG7A 4KITB 3A02A 4ZJZA 4XKVA 4O6JA 2H09A 4PDKA 2P8TA 3BOQA 1TZLA 1BL0A 4GYIA 2FE3A 3IC7A 3REOA 5FLVA 3CLOA 5LLQA 3OYAA 4Y33A 4EGYA 2F5VA 3M1CA 3MD2A 4DNCA 2OCCH 4YEJA 5D4RA 1XGNA 2J5OA 3K4LA 4LG0A 4I98B 1MJBA 3GTPJ 1KQ0A 2DOEA 5FRMA 3F8MA 4I7HA 4OU0A 1LVAA 2DQRA 2XGEA 3VPRA 1SFOJ 1HW1A 1BIAA 2KZVA 1FOWA 2BE5F 4XLPF 3CMEI 1CF7A 1YIJI 2BZTA 5JFRA 1ENHA 2VT2A 1EV7A 4MEYF 3R0AA 2NRAC 2MD5A 4I99C 2ZO4A 4LG3A 4AYBA 5KAFC 1ZG3A 1Y1WJ 5TJJA 1ZKGA 3QU3A 3H3UA 1SEUA 2L4MA 2WV1A 4HBLA 4RM3A 2JA6J 2OZ6A 3T5XA 3ISPA 1QU3A 3ABKH 3J81K 4KT6A 2DMTA 3BG7A 1ONVA 2GIVA 1FTTA 1T56A 2HQ5A 2L9NA 4AUXA 5BPIA 1IAWA 2NOJB 4GCVA 1I27A 4EJVA 3TKYA 1ZH5A 2OU2A 2BXZA 1Z7UA 2ECCA 2P81A 1YITI 5CVJA 4XORA 1NG6A 2BW3B 2LC2A 3BZCA 2A05A 1VQOI 5E18F 1X1AA 2KMUA 3V8KA 4XN0A 5F08A 4IQJA 5D6FA 1S3JA 5ILUA 1B72A 4G9YA 3FKJA 3ZR8X 4BDYA 1SANA 1Z7LA 4PJNA 1QVUA 4V2FA 3PL8A 3PO3J 2MC4A 1ETWA 2XASA 1FSHA 2CS3A 3CCEI 3CZ6A 3GYHX 4Q47A 2E36A 5TISC 2JN6A 5DEQA 1K7AA 2GWRA 4U0VA 1FIAA 2VPRA 5D5VB 1T08B 2JJ7A 4J19A 3DTIA 4PZJA 2VODA 2FMYA 2RV8A 1IF1A 1D1AA 1WCMJ 2DK8A 3K4NA 3PNYA 3PUBA 2CQKA 1TWCJ 2NVXJ 3I55I 1YIOA 3TP0A 5KCMA 4A2UA 2ZSHB 3S16J 1OLTA 1KGSA 4ETSA 4GFBA 2JVGA 4IF4A 3TBIA 3NQOA 3M4OJ 1T2KA 2G7HA 3SDGA 3WU0A 4MQVA 1ACIA 3E1SA 3J7AY 2WY8Q 4ON0A 4M73A 4XMYA 3HGGA 3CMMA 2Z5UA 2Y30A 1VF9A 3ASOH 3V8LA 1HKSA 2JUGA 2ISZA 4P55A 4B43A 3CQZJ 5ILSA 4UVAA 3H35A 4JYKA 1X3UA 1B9NA 2BOLA 4EV0A 1IO2A 2XB5A 1YYVA 3P9CA 2ELKA 4CCNA 3CCSI 5J1UA 1ZYRF 2H6CA 4ESBA 1Y8RB 1BJZA 5FKMA 5JLWA 4V19K 2A6TA 2CO5A 2VC0A 3PFIA 4IOAF 3A01A 2QF7A 5F0CA 5CKTA 1WJAA 2HYFA 2JPBA 4J01A 2Y0MA 2GAUA 3K4KA 2D2WA 1SAXA 3GW2A 3LSKA 3GMEA 3F72A 5C3EJ 4BE1A 2LOOA 3IH4A 5EZHA 1GVDA 1OMIA 1DGWY 4BXUA 1YS7A 3SEQA 1J5YA 3OY9A 4N0BA 1TWHJ 3G71I 3G4SI 3HSFA 1HSTA 2MH2A 3FXJA 5D5WB 4E7IA 4M3DA 5B1AH 1WFXA 1GHCA 4RAGA 4IXAA 2CW7A 3VYUB 1OJLA 4NDLA 4Y4RA 5LGUA 2DW4A 1RUNA 1P4AA 3RQIA 2CWEA 4CXFA 1UCRA 1W7PA 2HKXA 1FP2A 5FB2A 4H0EA 3H5AA 3CF5F 1TT5B 2HWVA 2X0LA 2GM4A 2B63J 5C4XJ 2V9KA 1YG2A 1P4XA 4WXCA 1X4OA 4G6DA 1HKTA 1ORKA 2VI6A 1KONA 2YUSA 1FNNA 2ESNA 4RB1A 1VFCA 2EA4A 3KE2A 2BYVE 1J9IA 2XRNA 1TQMA 3FIWA 5BQTA 2VQLA 1JE8A 1G3SA 2DPDA 3WG9A 4KFCA 1FMVA 1B9MA 1VTNC 1WWXA 4M6XA 3BY6A 1U5TB 1X1CA 2LTPA 2KRCA 3O8GA 4ZTFA 4G12A 3FX3A 4AVZA 3FBIB 3MMYB 1G3TA 3TEDA 1C0WA 4ENMA 4D5CA 2STTA 2DFFA 3L2QA 3I54A 1KU7A 3TOBA 6PAXA 1WRJA 2JA7J 2FNPA 2L54A 2M8EA 1ZQ3P 3BP8A 1YE9A 5EZGA 3RYPA 4GDFA 2VXDA 2R5YB 3AL0B 3TO6A 3GTGJ 1TT0A 2KQRA 2Q1ZB 1MMNA 2K3FA 1TWFJ 3RJPA 3MFKA 1R36A 2DOFA 2F5FA 3DFGA 1D0XA 3DU6A 1JI8A 4L9VA 1J75A 2EH3A 3CDIA 2R4GA 3FK6A 3RCOA 1V5EA 1V5FA 1BN5A 3CC2I 3CF2A 4HNTA 2LKSA 1TW3A 4XICA 2VPLA 1Z0XA 5KHDA 1LFUP 4HPQA 1IUYA 1EJ9A 2FMLA 4L18B 1IV6A 1YW9A 1QNTA 4MO7A 1K79A 3VYTB 5DS9A 3IRRA 3RIRA 1QZEA 2HZDA 3CTAA 4FETA 2BHZA 2X9DA 3HXLA 4C3HJ 2KPMA 3OYHA 5J6XA 1K4TA 2F4OB 2HVQA 4ZYDA 4L9NA 2EBIA 5EGOB 2XAGA 3OYGA 4LJZF 3HEFA 4BJTA 5GAGJ 4BQAA 3S2HJ 3I59B 2MLGA 1ETXA 4HW0A 3IH3A 4IHTA 1PP8F 5ICGA 3DQVC 3J7ZI 2FXAA 4AIJA 2ZBKA 2IEKA 3H0DA 1X2NA 5DCMB 4HSTA 5HLIA 4UB8C 4AU7A 2AQFA 2MW8A 1E3HA 3WGGA 4BKXA 3B6CA 3BCBA 1MH4A 2A5YB 4Z6YA 2LKXA 1JJ8C 2Z16A 4A93J 2HGCA 4A5NA 4OIRF 2FEZA 3CCRI 3MZYA 4XRFA 2ECBA 4BS9A 3K2AA 4BACA 2COBA 3I71A 2H27A 2WAEA 1KYWA 2EV0A 2L9SA 3QODA 5IOZA 4MQ9F 4KA4A 1QZZA 2X1CA 3BJAA 4YRVA 4GRIA 4KJZA 1R4MB 1OCRH 3BG5A 3K4JA 4MEXF 2X51A 2VQHA 5CVVA 3OYDA 3VFZA 1B8IB 1SD7A 1OCPA 3MN2A 2R3SA 2JQ7A 2V9VA 2NVTJ 3BR0A 4IPAA 2P7CB 2VKEA 4BBSJ 3PIOF 3BT9A 1LE8B 5F1RA 2GIZA 2F4MB 1YRNB 2VJ5A 5HS7A 1G2HA 3EYYA 3G1OA 2E1OA 3JAMZ 3K1MA 4A6EA 1CQTA 1UHWA 1P92A 3F8FA 1KYZA 3IHUA 4CYCB 3RPQA 1TNTA 4NC6A 4YFKF 2V6CA 1A6QA 2K40A 4ZZDA 2W4SA 5JVGF 2YU9J 3R60A 1YW7A 1LKXA 1IXSB 4R8HA 3R61A 3KP6A 1I3AA 5HLHA 5HOOA 1SVMA 4ZDOA 2M4GA 1X58A 3TOAA 3AKZA 1HC8A 5L3FA 1PDNC 5FKNA 3TDUC 4YELA 2ZNZA 3KP2A 4PJLA 1A36A 2HEOA 5M3FJ 2HDCA 1D3YA 1G3YA 1IN6A 2QBYA 5DUKA 2XRLA 2W82A 2Y0SN 5FD6A 1JJ6C 1POGA 2KJBA 2IAIA 2GA1A 3B73A 3KZIC 2P7VB 4E7KA 3JRAA 3CCLI 2L7MP 4BHCA 5HNFA 1LDKB 2KIQA 4BY1J 1U6GA 4A3JJ 3MKZA 1P4WA 4YIRX 3HOVJ 3S14J 5LGNA 5IP6A 3RQ4A 2ID6A 1D0ZA 2NVQJ 1WJDA 4WXDA 5LEKA 3G2BA 4LG0B 5CVRA 4AWXB 3IRQA 1DUXC 3QPTA 3T1BA 2QKLB 1XCVA 1U0JA 2OCEA 3B6AA 3O3KA 2VL8A 3TMOA 4WCGA 3EDPA 3S1NJ 2FSWA 2VJIA 1MDMB 2Y75A 3OS1A 4U0WA 5E1XA 4G7OF 2LG4A 3DP7A 3KEYA 4FTHA 4EATA 1R1VA 1OISA 1T8IA 3H3ZA 1R5HA 1MBJA 5CQGA 1R7JA 2DA4A 3VYRB 1X4PA 3HKZA 2IA1A 5FLXZ 3L2CA 2BVLA 3WTUC 3C2BA 5LHIA 1OYWA 3J81Z 1GVJA 2FU4A 5CVIA 2B7EA 2Y31A 3FM3A 3I4PA 2KL4A 4CCJA 5E3MA 3EUKL 4DYQA 4PCQA 4WXHA 2DYRH 1FMWA 3J80Z 1H9GA 1ZLJA 1MSEC 2VASA 4QPOA 3JRIA 3ONQA 3OS2A 1JHHA 1T6SA 3L2WA 1JUPA 4AIHA 2F4IA 2BBYA 1RPWA 1S7EA 1SD6A 4E4HA 4XR6A 2O5RA 4M6VA 3OYKA 4XRSG 3NWTA 2HDDA 5D6EA 3JRGA 3DKYA 2WB1N 3HIFA 3HM5A 1H0MA 1IJWC 3I4NJ 1ERDA 1TBXA 1DP7P 4YIIA 2XAJA 1B72B 1MBGA 1RESA 4Z2YA 3ECHA 2HFHA 2K9MA 5IOYA 2E2HJ 3WGHA 1O57A 3IL2A 4HDUA 4L0ZB 4A6DA 2CQQA 4N4OB 3A0BC 3S93A 4XRMA 1DU6A 1WSUA 1IRZA 2L9VA 4D5FA 4EJUA 4IEJA 3LSJA 4NHJA 1ULYA 3LNQA 3RKYA 2A07F 3X2QH 2DA7A 3Q0VA 4XSXF 3CP2A 4V2GA 1CGPA 2V6EA 2FBIA 3H1CA 3H9QA 2VE8A 1TWAJ 4A69C 3PNTA 3W2AA 3BG3A 3KEOA 3ZQ7A 2HZTA 4HX4A 2YSRA 4MGRA 3H92A 3W2WA 2E2JJ 1WGXA 1TWGJ 3LFUA 1YFHA 4OMYA 3F8NA 4XKWA 3MQ0A 3EQLF 4DGWB 4BE2A 3KYLA 2IRFG 3BTIA 3KYCB 2ZCWA 3QOEA 1SD5A 2X6XA 2YX7A 3DV8A 2RNJA 3TDZC 2VT3A 4KT5C 4BEHA 1VQ5I 3HRSA 1OCTC 3QPSA 2EFNA 4XOTA 2KFDA 1MBEA 4RDUA 3HHHA 1W5CC 3SFZA 4N9IA 4AM3A 3H0GJ 1MZBA 1Z9CA 1DU0A 3E5UA 5EG0B 4KIFA 5FLMJ 2LY2A 3M1EA 4CUGA 3BZ6A 5F6FA 2L4AA 2JA5J 2WC2A 3HL2A 5J8CA 1QBJA 1FYMA 5J47A 3GUDA 1MNEA 3O2PE 3AG1H 5JR3A 1WJCA 4XBFA 3LA7A 3ZQGA 1VQMI 2QSFX 3KLOA 1EA3A 4ASNA 2VJ4A 1S6LA 5K5QA 1J09A 1FOYA 2KIMA 5K1YA 4LOCA 1XMAA 2OZUA 4BY7J 4OIQF 3PFYA 3JAMK 2H94A 2D1VA 2JZYA 5E20A 4YIFA 5HS8A 3G1MA 2EV6A 1IN4A 3SZTA 3RKWA 3ZN0A 3FMSA 3WTSC 3E6CC 4UVBA 2FBKA 2YPRA 3Q0UA 3N05A 1F4KA 5IT9Z 2M0CA 4CGZA 4MLOA 4F55A 2EINH 4P9UA 5J40A 1IXRC 3P9IA 4NB5A 5D5UB 3MVPA 2L0KA 4UUSA 4U87A 5FFXA 1FLIA 2MABA 4FCYA 2XHKA 3BR2A 3OL3A 2RAEA 3D1NI 2EILH 3CO7C 2ZMEA 1Z91A 3CLQA 3QU6A 1YQAA 3FM5A 3GFMA 1RR7A 1IRXA 4FQGA 1VQLI 2I5UA 2CG4A 1I50J 1R9TJ 4EM2A 2BV6A 2NYXA 1LFBA 2PMHA 4NBQA 1RUOA 2Z9OA 4U88A 2OF7A 1U3EM 2Y48A 4K2EA 3BCAA 4YFNF 3K4MA 2XSJC 3K2ZA 4LIUA 5DYMA 1FX7A 3S3NA 4KMUX 1JXSA 5F27A 4NC7A 2LBFB 5GP9A 3L09A 3IUOA 3SJMA 4ZDLA 3JRBA 3ULQB 4EMSA 4X0GA 4XN3A 2PI0A 2VOOA 1I1SA 2QUFA 2KIUA 1QQIA 1E17A 3K6GA 2O03A 3T8TA 1BBYA 2VQGA 3P7NA 4BQOA 2X6OA 1R1UA 2K3PA 5J8FA 3GTQJ 2QEXI 2NS8A 3BLYA 4X6AJ 1OCCH 1SAUA 2Y0SA 1LJ9A 4P96A 1UHMA 2BXYA 1T98A 4BNCA 2HPIA 2RNGA 1TNSA 2CW0F 1BI2A 1HKQA 3CP8A 2DLLA 1XB4A 1SFXA 3VEPA 2IGMA 3F9KA 5IPAA 5FLXK 2QQ9A 3S1MJ 3HGYA 5EDNA 2Q0OA 3OR2C 1VI0A 3QPLA 1Q1HA 3FMRA 1WI9A 2PG4A 2PQ8A 5F1JA 1NG7A 3FWEA 2MBFA 4RLFA 1P2FA 3BC8A 2G0EA 3V8JA 3L2UA 1S7AA 1FYKA 1XGSA 4HDVA 2X1DA 3J80K 1D8KA 2R7DA 2IW5A 1UJ8A 3D5SC 2K9LA 4ENNA 1HBXG 2X85A 4XSZF 4HF1A 4KUMA 4AIDA 1D5YA 5HS9A 4XOPA 5J1YA 1WKMA 3ZMSA 2VOPA 4I01A 2OTLI 5E3OA 2NAZA 5TGTA 2NNNA 2A5WA 1FOXA 4FE4A 2FF4A 4KICA 4A3BJ 3A1YA 1VQPI 1FYLA 2MLKA 4DYCA 5BOXA 4R1HA 3DEWA 4JOMA 1WPKA 2O9LA 4E70A 5CYVA 3KZYA 4QWQA 1TL8A 3RKXA 5BMZA 1MIJA 3H36A 2W25A 4XLEA 4M9ZA 2XPUA 1JGSA 4XL9A 4RB3C 2XSDC 2LREA 3JSPA 2HYJA 2LVSA 4PGGA 2H8RA 4KMFA 3ZQFA 2WBMA 4XKBA 3S17J 1X3ZB 5BNGA 2V7FA 2CV0A 2H6BA 3C2GA 1R23A 1GV2A 4RLQA 3TP3A 2X1EA 1FY7A 1ZELA 3DBHB 4DW6A 4F52A 3VODA 2DO7A 2XAUA 5EJCA 5GTHC 2B0LA 1BW6A 4JX4A 1L0OC 4BL0B 4P5OA 2Y69H 3MWMA 2M30A 4IRIA 1T33A 3IV5A 3FMQA 1AA7A 1AWCA 3HHGA 2K7LA 2O7OA 1WH7A 5DDGA 1OCZH 2XB0X 3F22A 3FXKA 1WZ2A 4GXOA 4G6TB 1GXPA 2BVMA 1W36D 1BOBA 1SVLA 1J2XA 1MMDA 4UUVA 5J4YA 4U0YA 3ZMDA 5A2QZ 3V7SA 2EK5A 4M72A 2CFOA 1F36A 3WE3A 3ZMZA 5HODA 3OYFA 1ZRDA 2H1LA 3F8CA 3OWTA 5K5OA 2HTJA 2DCEA 5DM7F 4JK1X 5LHGA 3CJQB 4ZDPA 3S1RJ 3NEUA 1XCBA 1X2MA 2CUZA 3E0JB 4L9TA 5AIPA 3ZQIA 2DJNA 2B9SA 2GBYA 3SEZA 2DA6A 2VKVA 1Y0NA 2OPTA 1ZG1A 2QSHX 2EB7A 3DTEA 3OMYA 2L02A 3ZP5A 2BY1A 4KDPA 4JBAA 1RNLA 4RBOA 1W5TA 3CUQA 1IRFA 1V54H 5KAIC 3AG3H 3GZ5A 3HOZJ 2LK2A 2CUJA 1MBFA 3EUHA 3E3VA 1PUFA 5DCFA 2Q2EA 3OOUA 4HQMA 4CA0A 2JMWA 3IAS2 2ZJRF 2NXNB 3QQAA 5GTIC 5IT9K 2IXSA 2VC1A 3SHFA 5J4VA 4RAZA 2DT6A 3JW4A 4DBRA 2F5EA 1X1DA 4LLGF 1OCOH 4A3LJ 1ZRFA 2XAQA 3PSIA 2YX4A 5ICFA 4L0YB 3FBNB 1MNMC 1SD4A 4IHYA 3DPUA 4R79A 1XSDA 1W36C 3BZKA 2UWMA 3F21A 2HI3A 3MCZA 2WAQA 4HNUA 3M7GA 4E7HA 2BHYA 3K7AJ 3LSIA 3D5LA 3RZDJ 3HTSB 4Q48A 1XD7A 2KDZA 3V7CA 5B1BH 2GQQA 5DUIA 4B44A 1G4DA 2P5LC 5L3DA 3SZGA 5F0HA 2VQCA 4IHXA 3W3CA 1AHDP 4OWRB 4OOIA 2ZJ2A 5IY5H 1O3QA 3LSHA 3JR9A 1SVOA 2LF7A 3ZMTA 1V5GA 3TO9A 1FWZA 3J7AO 2JT1A 1IN5A 1YJNI 1K78B 1U8BA 4L9JA 1I5ZA 3OIOA 4NNJA 5JI6A 4ZYHA 3OYCA 2HOEA 2G9WA 1Y0UA 3N4MA 2E60A 2HOSA 2RKHA 4NQWB 3VWBA 2PFBA 2ACJA 3KLNA 2K5CA 2X4HA 3F0CA 2R5ZB 5GADJ 3CCVI 4XLCA 2OV7A 1TC3C 1BC8C 1D8JA 5CQEA 3FZVA 4RB2C 1O3TA 3F3XA 4MIMA 2QLZA 3DEEA 2DA3A 4IOCF 3HRUA 2VB6A 3JTHA 1SMYF 1Z21A 5H6QA 2PJRB 4PK4A 3QPHA 4C2UA 4XKCA 1PYVA 1XC5A 1RR8C 4C9YA 3FDYA 2LYCA 4UXNA 4Q5SF 2IP2A 3O8HA 1JGGA 4MFEA 3BR1A 2O6GE 2EA2A 3S2DJ 3Q9VA 4L5IA 3WTVC 2X48A 1VQKI 2R7RA 2DJIA 2V26A 3DU5A 4I09A 1YX3A 3WTXC 3PJRA 3QAHA 4II2A 1I6XA 3BDDA 2PMZN 3C3WA 1IN7A 1JKQC 3HDDA 3KEQA 2UUZA 2XUBA 3WHCA 1ETKA 2OBPA 3GTMJ 3HOUJ 3S1QJ 5L3BA 2W84A 2BW3A 4EGZA 2AS5F 2DFEA 3HOSA 2PEXA 1JKOC 2NNYA 2ZXWH 2E7XA 2A69F 3I0TA 1DDNA 2LY1A 4XLNF 1NHAA 1MBKA 1LB2A 4TV7A 3CD6I 1ZK8A 1EH8A 1Z6RA 1STZA 5F64A 3L2VA 1YJWI 1IUFA 1OQYA 2ESHA 1H89C 1XTAA 3NWSA 2R7SA 2C6YA 4Y52J 1XS9A 1K83J 2VBYA 3K69A 4UV9A 4OAYA 3GLXA 1GXQA 3KP7A 2STWA 2OC6A 2QWWA 4RGUA 2IVMA 2A68F 3DBLB 3VSKA 3H9JA 1SFEA 5FFZA 3RDIA 1MH3A 5E3LA 4FASD 1VQ9I 2QVOA 4FISA 3KP4A 3VDXA 1QHHD 3GFLA 3KIOA 3P5JA 1JHFA 3CJNA 3HPHA 3FXRA 1U9NA 2COMA 4IL6C 2FBHA 4D1QA 2FX0A 2EZKA 2VN2A 4JP0A 4IHWA 4CCMA 2PX9A 5E8IA 2HKOA 1DPRA 2GOMA 2EFQA 5F04A 3KP5A 3IKVA 1VQ6I 5A2QK 3LSGA 4MHGA 4H4KC 4D7MA 2A6EF 4ZH4F 4I0BA 1WI3A 3GZNB 4PJ0C 2L7KA 2IA0A 3FXUA 1JTYA 2X6WA 2GXBA 1E0EA 5KNLA 1I1GA 2L01A 1ZGAA 2KT0A 5FD5A 4AD9A 3GTLJ 1YJ9I 3LQQA 2AXLA 2J5PA 1XPXA 5LHHA 2P5VA 4HV5A 2OUMA 1XDSA 1B59A 2FD5A 4PSWA 5CPRB 4YG2F 2WAFA 1FBSA 2BGCA 4ENKA 3F23A 4IQ4A 2TDXA 3ABLH 3SYTA 2YS9A 2V1XA 5E1ZB 2ZXHA 3LSMA 3IAM2 3RTRA 3WTZA 1OYYA 4AIKA 4RAYA 5K7ZA 2K85A 1N77A 4JX5A 3DKXA 4LLLA 3JREA 2PBIA 4P9FA 3DLLF 4ZTJA 3FXMA 3CCUI 2W85A 4QIWN 3AFHA 1T38A 4UV8A 2CMPA 1ZR4A 1ETYA 4IHVA 1HCRA 3HRTA 1G3WA 2NOGA 1XMKA 2DT5A 4IRGA 2UXXA 1JT0A 1RETA 1KU3A 3FF5A 3M3YJ 1A04A 2ELHA 1ZARA 3HZJA 2CQXA 1ZRCA 3K9TA 5CVUA 3HSRA 2DFHA 4MTDA 2ZNYA 3IWZA 3CJRB 4M74A 4S0HB 1FOKA 2W7NA 3E7LA 3LMMA 2BY2A 3I4MJ 5DV5A 1AKHA 5BPDA 3GBGA 2ZB9A 2CW8A 2CV1A 2DA1A 4ENJA 4B4CA 3WODF 2R7XA 2K9NA 4AYBN 1CF7B 3QWLA 3E97A 4RGXA 3K10A 1UB9A 2R92J 4HQEA 2RDPA 1WJEA 1WJFA 3BPXA 1QRYA 3ABMH 1R1TA 1B4AA 2LDUA 1R6RA 2M0MA 3G73A 1LUJB 3ECOA 3K1NA 5DD4A 4Y7NJ 3MKYB 2LRDA 1U5TA 3EUAA 4UB6C 2PJPA 1KA8A 1DPUA 2BEOA 1AOYA 3GXOA 4B3AA 1X1PA 2I10A 3Q0WA 1L3LA 2IGKA 4M9XA 1W5SA 2V9PA 3ML6A 2IGOA 3OIQA 4RMNA 3OOPA 1JT6A 4EJWA 3CCYA 4BH9A 1FP1D 2GLOA 1HW5A 1I6HJ 5J3LA 1T39A 1XMXA 3BTJA 1H88C 2JA2A 4OIPF 3HUGA 2MG4A 1QVTA 4CH7A 3HOYJ 1FEXA 2R5YA 1J0RA 1X1BA 2D45A 5ICCA 3PM1A 4FX0A 2ZJQF 1FJLA 4II3A 2V1NA 5GAEJ 4A3FJ 1T0FA 2XC7A 2L5QA 4J00A 2VBZA 2ELJA 3H9GA 4I2OA 2NS0A 1HW2A 1LFPA 5FROA 4BU2A 3B02A 4HAMA 3DTKA 3W2VA 4KNYA 3D5RC 4FX4A 4HOBA 2LKPA 2EZHA 5H20A 3JRHA 1QPIA 2DYSH 4LB5A 4ZYGA 1YTYA 4KIBA 1HA8A 2RC4A 1RZ4A 2P0WA 3J7YJ 3IKTA 1SFUA 4M6YA 1X3WB 1ODDA 4I6ZA 2Y9ZA 1EKEA 2K9SA 1TW2A 5K7FA 1FC3A 3WE2A 1SMTA 2DA2A 3TW6A 2E34A 5EGOA 4HLXA 1V4RA 2XKOA 3I59A 5D8LB 3F8BA 2ZSIB 2GOXB 2O8KA 4BDZA 2DDAA 3BTLA 2Z2SB 2HVRA 1KU2A 1VNDA 4F92B 3S8PA 2PMZA 2EFPA 1BI0A 3GF2A 5DCMA 3U9GA 4XQFA 1P7JA 2F5CA 2NVYJ 2VLAA 2W24A 4DJAA 4HF0A 1B1BA 3BTCA 2FRHA 2AQEA 2FQ3A 1RC9A 1MMAA 1A35A 2JVHA 4S05A 4GGGA 2EJRA 2KP6A 4OMZA 3CJTB 4E7SA 4QTRA 2X6YA 3LQRA 1VQ8I 1QGPA 1ZAOA 3A01B 3T0YA 3QP6A 2Z33A 4KIGA 1PJRA 3GWZA 5HDNA 1S8NA 2UV1A 5C44J 3G1LA 3GEZA 1GDTA 3GTOJ 2DA5A 1W4MA 3KCCA 3W6KB 3H5NA 5JHUA 1HSJA 3E5XA 3K1PA 4WX9A 1B8IA 2QSGX 1WVRA 1ZN2A 5LBQA 1PUFB 1MMSA 1D1BA 1Y39A 2Q2EB 4XM3A 4B1RA 4I02A 3PO2J 1FPQA 2R93J 4CYDA 3U21A 1ZLKA 1LE8A 1YRNA 4ZC3A 2W00A 1QO0D 2MYSA 4D7NA 3BJOA 2DPUA 5M3MJ 4BE0A 2LR8A 4HF2A 5FGMA 3V4GA 1HQCA 4O3MA 2AXTC 1BW5A 1W7PB 2JA8J 1F5TA 1BM9A 3F6VA 2L7ZA 2AHQA 4CDGA 3S3OA 1M1EB 1N75A 1UZCA 4HRIA 4UVCA 3ZQQA 2A61A 3V42A 5JVTA 1D5VA 1BC7C 3GZ6A 2MFZA 3OYIA 3JTGA 3LSTA 2XGDA 1FTZA 1OR7A 2EQRA 2R7QA 1TTYA 4CCOA 3IP4B 2LSOA 1XSVA 4I0AA 3M07A 4HV6A 3EETA 3BQYA 2F48A 3ZOBA 4ABZA 1JTXA 2EIJH 4BHBA 2M1BA 1WHUA 3PIPF 2QA4I 3RI4A 2DU9A 1S72I 3CUQC 2FOWA 2LFBA 2FJ1A 1XDUA 3EUHC 3GLLA 2CJJA 4IRHA 2Q8KA 9ANTA 3GFJA 3TQNA 1USTA 1BI3A 3W6VA 1OFCX 1GT0C 5HLTA 4A3CJ 2HQAA 4HLYA 5E17F 1S9HA 2DTZA 5CJ9A 5E79C 2XF6A 5L3GA 2JSCA 4PJMA 3U1KA 4A12A 4AC0A 2HU9A 2G7UA 3ESWB 4LK1F 2D1HA 3QP5A 3QYBA 2IGNA 3ZXSA 5AONA 3BR6A 1UMQA 4Y17A 2KDOA 4M3GA 4N4NB 2ID3A 3OYNA 4XRSA 2HXIA 4HX7A 1UG0A 3WG7H 1T95A 5M5WJ 1MDMA 2DXIA 1HF0A 2R7WA 4HA8A 5IT3A 4BUPA 1ON1A 1K6YA 1FBUA 4UHTA 1HXDA 2XIGA 1R71A 4LK0F 2JPCA 1Z6TA 3IH2A 2JSPA 2K86A 4MTEA 1H8AC 4Y3OA 5L3EA 2M9HA 2E1CA 4JQFA 2V4JC 2EIMH 2DODA 3W6JB 1PVEA 2XAFA 1F1ZA 3DLAA 3CCQI 3SQNA 4X1EA 1O3SA 5EYRA 4PJJA 3I56I 3S3MA 1F9NA 5ED4A 3HG9A 4IX7A 1A31A 1WH5A 2NVUB 5DD8A 1MMGA 2DMNA 5FKKA 3BWGA 4IJAA 2LP0A 3TGNA 1S7OA 4JX6A 4DZJA 3ZN1A 2LD5A 1Y6IA 3BROA 4A0YA 2CUEA 4M3FA 3KX2A 3O6BB 1YLFA 1MD0A 3OR1C 3KZZA 4ESFA 4S04A 4UNOA 2GA2A 2KJCA 2P6SA 2V1UA 5B66C 4LFUA 4WF2A 1QHGA 1R5GA 3RKQA 2WB1A 3L1PA 1VQ7I 4E7ZA 5DM6F 1KZHA 4F7ZA 5HDGA 1MSFC 4EVIA 1ETVA 2XVCA 3QOPA 2TRTA 1UG2A 2A3SA 3BG6A 2FNAA 2ZKZA 2ZXJA 3R4KA 4MFDA 4OIOF 2MA3A 1HOMA 3RPUD 1ON2A 3RYRA 2QZ8A 2QGUA 1UHSA 2RQQA 4BQNA 4B8XA 3JCUC 2LLKA 2K27A 2VKDA 2IT0A 2HVSA 5EEHA 4E7JA 1TQIA 2FA5A 2JRTA 3HB9A 1R00A 3OS0A 1NK3P 3OYMA 2XGXA 3CDHA 4M3EA 3CC7I 1FSEA 5DTDA 1D0YA 2ZXIA 2EIKH 2CV2A 3DBRB 2GZWA 2R7OA 4CZZA 5ILVA 2HQRA 1SFKA 5H6RA 4BQQA 3ZPLA 2XV4S 5EF6A 3K0LA 3ZQHA 2OA4A 1S5LC 4FE7A 3MZ8A 3DF8A 1EF4A 2VIXA 3CUOA 3GVAA 2XAHA 2Z1DA 2E2IJ 4KISA 2EFWA 4XLAA 1MW7A 4Y15A 2KLOA 2K4JA 2OQGA 2CRGA 1VQNI 5EG0A 3Q3SA 1JKRC 3K4BA 5GAHJ 3Q5FA 1IGNA 5IP9J 2O8XA 3A4CA 4BBRJ 1FZPB 2R7TA 3GX4X 1YO5C 4U7DA 1QA6A 3SFIA 4EM0B 4Q4ZF 2QBYB 2ICWG 4NUBA 4G7HF 4KN4X 3E6MA 3RZOJ 5L3CA 2CYYA 3EYIA 5FO5A 5K5RA 1G59A 1UELB 3ERED 1QPMA 5B5EC 2Y9YA 1E2XA 2P4WA 2BY3A 2GXAA 4PGHA 2HDWA 2JRMA 1G6NA 3NRVA 2UZKA 3BQZA 1NH3A 2DQLA 2XGCA 2HQNA 2JTVA 1SC7A 4B09A 3HPGA 1RRJA 4GO1A 2M8GX 1DQUA 1RKWA 3M8FA 3DPTA 1IDZA 3JSOA 4LD5A 1AKHB 5F0FA 4ZZLA 4A3DJ 1ZGWA 1REPC 1IXCA 5LEJA 3F6OA 3OV8A 3HKZN 3L2RA 2IJLA 1FT9A 4DZPA 3HOWJ 1LDJA 3H5RA 2M87A 3OSGA 1Y56A 5IYBJ 3ZCOA 4KYWA 3ZQCA 3TL4X 2VXZA 1Z1DA 4A5MA 2HYGD 3IWFA 3HC7A 4YFXF 4P1WA 4RS8A 1ZHFA 2D5VA 3M8JA 2F2EA 2OQRA 1HDPA 2TCTA 5C4JJ 1K4SA 2LBFA 1XGMA 3VOEA 3K4CA 4B48A 1ZREA 4B47A 2KZGA 1LEAA 5ICEA 4DIQA 2QYOA 2WWYA 1A6IA 2DFIA 3A0HC 2E71A 3DXJF 3BPVA 4EQQA 1P6RA 2E1MB 4ITVA 5GPCA 3DPLC 2BY0A 2CSOA 1U8RA 1OKRA 3E6DA 3JRDA 4RGRA 4DYRA 5FJ8J 2XPWA 2IA2A 3GTKJ 4NC8A 1E3OC 1UAAA 3ROUA 1JUSA 2KRHA 4G8XA 5CLSA 2IS1A 3OL4A 3GO5A 3WHBA 3HUGB 1IDYA 2AO9A 4HX8A 2EZIA 1WJ5A 3QYFA 2MGQA 4RA2A 1GV5A 2ME0A 3ZMVA 4EM1A 4FT8A 3SDBA 2CQ7A 1S29A 2E7WA 1Z3XA 1V3FA 1IC8A 1MJ9A 1ETQA 4D0PA 2LF8A 3VYSB 1Q1VA 3HBLA 3LA2A 4IVNA 4BXXJ 3OYLA 2ETHA 3FHZA 4CO8A 2VE9A 2RREA 2LNBA 4XIDA 3MEXA 1ZGJA 1U9OA 1KU9A 3LFKA 1XGOA 2O3FA 3Q9SA 5B3SH 5FKLA 3I53A 4PFPA 3CCJI 3A03A 4L5JA 1O3RA 3SXYA 3E5QA 4IKFA 4C2MJ 1U5TC 1Y8QB 3T8RA 1K6OA 2P5KA 1N78A 4CCKA 1PP7U 1YS6A 2E1MC 3TW7A 3LSRA 4XLFA 3NAUA 4CSWA 2M34A 2ZFUA 2I8DA 3R0JA 4A3IJ 2OAZA 1XN7A 3GCMA 4U7BA 2RQPA 1MJAA 1W1WE 2WADA 4BEHB 1Y1VJ 1E3PA 1NK2P 4HZFA 1YW8A 2PLYA 2M5WA 2W48A 4N9HA 2HNHA 3A2KA 2R7ZJ 5D5XB 2DMPA 2DI3A 1YHQI 2KRFA 3JRCA 1R4NB 4ZYEA 3CCMI 1ZR2A 3OYBA 1I39A 5D8KB 2DMUA 1WJBA 1FBQA 1X19A 2M4KA 3FXLA 1MGTA 1RKTA 2DMQA 3CC4I 3OYJA 3AL0C 1KQ9A 2DOAA 1I3QJ 2O61A 4DQ2A 2E35A 2LH9A 3RPUA 2VUMJ 4HG2A 3WU2C 4IZZA 3C2HA 3C18A 1HLVA 1T0FC 4QLCU 4XLHA 4BAYA 1EH7A 1NTCA 3OYEA 2OTJI 2L9RA 1U2WA 3L7WA 2EPFA 1IW7F 2H8WA 1MBHA 1BA5A 4CCLA 3PUFA 3DEUA 2HXOA 2MH9A 5D4SA 5FRNA 2KHMA 4UUTA 3I9V2 3HSEA 2MC3A 2L7FP 1IRGA 1YOVB 2PMUA 5HVQC 4BHPA 4G7ZF 2VONA 2CU7A 4L5EA 3C1DA 1GLNA 3LAPA 2E19A 4G6QA 5JHFA 2IPQX 3KETA 4RAFA 2JUCA 3LA3A 2CFXA 1MNDA 4LLNA 2E5NA 2CGPA 5IP7J 2ZJPF 1VQ4I 4UUSB 1D1CA 3ERMA 4QSHA 2F6CA 4HSRA 1N25A 1ZTRA 5LFAA 2QCOA 2HPMA 2ZMEB 3LOCA 3H3VK 3FXOA 1Z05A 3ABTA 3LWFA 1JUMA 4PUSA 1B6AA 5HDKA 1QZYA 1XG1A 3DKWA 4C30A 4B3XA 1F43A 1LPQA 3HOXJ 2HOAA 4PFOA 3BG9A 4FHTA 4A3KJ 3OSFA 3BJ6A 4BYYA 2KISA 3G6EI 2E5ZA 3FXQA 2XDVA 4EEFG 4A0XA 1OYIA 5EEAA 1R5ID 3CMAI 3EPZA 1P7IA 4BJ6C 2QENA 2EZLA 2FQ4A 4A0ZA 1Z67A 3WTTC 4IO9F 2DK5A 3KP3A 1TP4A 2VJJA 1TQPA 3GTJJ 2E1NA 3D0SA 5ERIA 3SZPA 3L00A 3COAC 3BR3A 1Z77A 2RN7A 5H2FC 5JLXA 4A3GJ 1O7LA 2L2OA 5FKOA 3M9AA 3DWLE 2F5DA 5LGTA 2IS6A 4C3IJ 3FKIJ 2ADUA 4C3JJ 2XF7A 2N8GA 2CUFA 1J7KA 4UY8I 4F93B 5K7HA 3S15J 3I58A 4A3EJ 3I5UA 4M71A 2OJED 3PQKA 5LRSA 2IBDA 5TRDA 3UKGA 4OINF 2ZMEC 2R0QC 1FIPA 2MD0A 5E8GA 2LY9A 3HRMA 3VB2A 3K70D 1LNWA 1YI2I 2DBBA 2JWTA 3CESA 2DT7B 4CHUA 2DDBA 4LIVA 3KPHA 4IHSA 1VZ0A 1BR2A 5BS6A 3LAJA 2XKPA 3PSFA 1K78A 2WA0A 3S2WA 4WK8F 1U78A 1HDDC 3G3ZA 3P9KA 3ASNH 1OR7C 3ELKA 5LRRA 1ZG5A 1RIOH 3LL7A 2HTSA 1MKMA 5EEGA 3MAJA 2UXNA 4MNUA 1APLC 1AU7A 3CDLA 1IV8A 4NQWA 3N97A 2XROA 2YU3A 2QQBA 5AIQA 4G94A 2M7AA 2R5ZA 4QPQA 4EJOA 3AAFA 4CZCA 2FOKA 5IYCJ 2RGVA 3ZMUA 5IYDJ 1Z3YA 2R7FA 1JKPC 3VSLA 5E1WA 3L9FA 1GUUA 1H9TA 2M7BA 3TO7A 3KYDB 3GFIA 2M3AA 1BIBA 4W1UA 4OAZA 3U1DA 4KN7X 4ANJA 5KK1A 1O4XA 3C7JA 1EH6A 2ME6A 3V7RA 4HNVA 2PJRA 1W0UA 2EV5A 3HJEA 3ZGKA 4DOZA 2QQAA 3DCFA 4DBQA 4XONA 2DTRA 3NARA 3RSNA 4EJTA 3BR5A 3FHNA 2VKHA 2QKMB 3JRFA 1YX5A 3UR3C 3FK7A 1IN8A 2V79A 2WY7Q 4HYEA 2QM3A 3PQJA 2ZFWA 3K70C 3MKLA 3WGIA 4RM2A 3I3LA 2CQNA 2K4BA 3ZRGA 4AVPA 5M5YJ 3CO6C 4HEA2 3MKWB 4ZYAA 2XF5A 3AG2H 2K02A 2VBWA 4LGWA 1RI7A 5E3NA 3FISA 2HR3A 1P9QC 1WQ2A 1KQ8A 2M2EA 2HOTA 3S32A 2H1KA 4RB0A 4M9SA 3M8EA 1BR4A 2XPVA 3HYIA 1R22A 4WWCA 2O0YA 4F91B 1LQ1A 2KIFA 4E6KG 4E7LA 1J59A 1TLHB 1DGRM 4F3QA 4ESJA 2DAOA 4BJ5C 1O7FA 3AG4H 2PN6A 4M3BA 2K9QA 2M45A 4I76A 5HLGA 1W0TA 1LDDA 2NS7A 4W97A 1IZ1A 4PSXA 5HNHA 4D9JA 3ZQLA 1K61A 4A3MJ 1BOAA 1R58A 3CUQB 2HS5A 1XX5A 3I64A 2EFOA 4CICA 2RVCA 1V55H 3ABUA 3E6BA 1BJAA 2DN0A 1R49A 1UFMA 2R7UA 1BI1A 2A6HF 2Y2ZA 3U2RA 2QQ8A 3KFWX 1OPCA 4LITA 3CMYA 1A5JA 4BXFA 3OIPA 2GXGA 1XSXA 3QYEA 4Y13A 4XK4A 2LMDA 3UNGC 2IS2A 4RGSA 2IS4A
chains in the Genus database with same CATH topology
1U0JA 4XNFA 2VKDA 2VL8A 3TMOA 2HVSA 4BGDA 4E7JA 2VJIA 3OS0A 3OS1A 3OYMA 2LG4A 3KEYA 1DP3A 4EATA 2FUG2 2CH0A 1G8XA 5CQGA 1D0YA 2DJIA 2V26A 2ZXIA 3DU5A 3VYRB 2R7RA 2CV2A 1YX3A 1X4PA 3PJRA 2R7OA 3HKZA 4II2A 2W1OA 1SFKA 2UUZA 2BVLA 1BR1A 4BQQA 2BW3A 3HOTA 3HOSA 3PNVA 2KL4A 4CCJA 3EUKL 2VIXA 1LVKA 2Z1DA 4KISA 1FMWA 2LY1A 1MW7A 4XLAA 2KLOA 2VASA 4QPOA 3ONQA 3OS2A 4C2TA 3L2WA 2R7VA 5LD2C 3L2VA 3K4BA 2F4IA 4KITB 4ZJZA 4XKVA 4E4HA 3A4CA 4XR6A 1TZLA 2O5RA 3NWSA 3OYKA 2R7TA 2R7SA 3NWTA 3OYAA 4Y33A 4NUBA 3DKYA 2F5VA 4OAYA 3M1CA 3MD2A 4YEJA 1ERDA 2OC6A 3K4LA 1G59A 1UELB 3VSKA 3H9JA 4FASD 2K9MA 5FRMA 3VDXA 1QHHD 2HDWA 2KZVA 3HPHA 4N4OB 3S93A 4D1QA 4CCMA 2GOMA 3HPGA 3CP2A 2V6EA 1DQUA 4LG3A 3LSGA 3H9QA 4H4KC 4AYBA 3DPTA 3PNTA 3W2AA 2L7KA 1E0EA 2X6WA 3W2WA 3L2RA 4RM3A 5KNLA 1QU3A 4KT6A 3LFUA 3H5RA 4XKWA 3BG7A 1Y56A 3ZCOA 4DGWB 4BE2A 3KYLA 3TL4X 2VXZA 2OUMA 3QOEA 4PSWA 2L9NA 2X6XA 3HC7A 4P1WA 5CPRB 2NOJB 3M8JA 4BEHA 2WAFA 4XORA 1NG6A 4IQ4A 2BW3B 2LBFA 4XOTA 3SYTA 2LC2A 2ZXHA 3LSMA 3IAM2 3K4CA 3RTRA 4B48A 4B47A 2KMUA 1X1AA 1N77A 4DIQA 3DKXA 4XN0A 4IQJA 4ZTJA 2E1MB 4ITVA 3FKJA 3ZR8X 4BDYA 2LY2A 4CUGA 3DPLC 3AFHA 1Z7LA 4PJNA 2CMPA 3HL2A 1MNEA 3PL8A 2MC4A 4NC8A 1WJCA 2CS3A 1UAAA 3CZ6A 2KRHA 1EA3A 2IS1A 2VJ4A 3OL4A 1J09A 3HUGB 3CJRB 1WJ5A 3QYFA 2W7NA 3LMMA 3PFYA 3SDBA 3DTIA 3GBGA 2CW8A 1Z3XA 1D1AA 2CV1A 3K4NA 2R7XA 3PNYA 3PUBA 3N05A 3VYSB 4MLOA 4F55A 5KCMA 3OYLA 2ZSHB 3K10A 1OLTA 2RREA 2JVGA 3TBIA 4U87A 1WJEA 1WJFA 3E1SA 3J7AY 2MABA 2WY8Q 1R6RA 4PFPA 3OL3A 2M0MA 4XMYA 3CMMA 4IKFA 3MKYB 2LRDA 1N78A 4CCKA 1IRXA 3EUAA 2E1MC 4XLFA 2JUGA 4CSWA 4B43A 2ZFUA 2I8DA 3H35A 4U7BA 3BCAA 2BOLA 2WADA 4BEHB 3K4MA 2XSJC 4LIUA 2IGKA 4CCNA 3S3NA 2HNHA 4RMNA 3A2KA 2IGOA 3OIQA 4NC7A 2LBFB 3IUOA 4ZDLA 2A6TA 3OYBA 4X0GA 4XN3A 5CKTA 1WJBA 1WJAA 1X19A 2M4KA 2JA2A 4J01A 3K4KA 4CH7A 3OYJA 3AL0C 2DOAA 2LH9A 3K6GA 3LSKA 1X1BA 4BE1A 2VQGA 2LOOA 4HG2A 4IZZA 4BQOA 3C2HA 2K3PA 1T0FC 4II3A 2V1NA 4XLHA 3OYEA 1DGWY 3BLYA 1SAUA 2XC7A 3OY9A 2Y0SA 3SEQA 2L5QA 4J00A 2ELJA 3H9GA 4CCLA 1LFPA 2HPIA 4E7IA 5FROA 1WFXA 2RNGA 4BU2A 3DTKA 2CW7A 3CP8A 3VYUB 3W2VA 5FRNA 4Y4RA 3D5RC 2KHMA 3I9V2 2IGMA 3F9KA 5HVQC 1HA8A 2P0WA 3OR2C 3H5AA 1GLNA 1NG7A 5JHFA 4RLFA 2V9KA 3BC8A 3L2UA 1X4OA 1MNDA 1KONA 2E5NA 2X1DA 3D5SC 1D1CA 2F6CA 2K9LA 2X85A 2GOXB 2ZSIB 4HSRA 5LFAA 2VQLA 4BDZA 2HPMA 1FMVA 2Z2SB 4XOPA 2HVRA 4F92B 3S8PA 2PMZA 5TGTA 2A5WA 4PUSA 1X1CA 4XQFA 2KRCA 4C30A 2VLAA 4ZTFA 4B3XA 4DJAA 3A1YA 4PFOA 4AVZA 3FBIB 3MMYB 2E5ZA 2AQEA 1MMAA 4JOMA 2XDVA 2JVHA 3L2QA 2KP6A 4E7SA 2X6YA 3EPZA 4XLEA 4BJ6C 1PJRA 1YE9A 4XL9A 2UV1A 2LREA 2VXDA 3AL0B 1TT0A 2KQRA 2Q1ZB 2VJJA 1MMNA 2WBMA 4XKBA 2CV0A 2V7FA 3H5NA 1D0XA 3C2GA 3DU6A 4RLQA 1JI8A 2X1EA 1ZELA 4F52A 1D1BA 2Q2EB 4XM3A 2L2OA 2XAUA 3DWLE 2R4GA 2IS6A 3RCOA 1V5EA 1V5FA 3U21A 2XF7A 3CF2A 4HNTA 4BL0B 2VPLA 4ZC3A 4F93B 4P5OA 5KHDA 2W00A 4HPQA 2MYSA 4BE0A 1AA7A 3VYTB 2HZDA 4G6TB 2MD0A 4FETA 2BVMA 1W36D 3HXLA 1BOBA 2KPMA 3K70D 3OYHA 1MMDA 3S3OA 1N75A 2DT7B 3CESA 4HRIA 4LIVA 3ZQQA 2HVQA 1VZ0A 3V42A 1BR2A 3OYGA 3PSFA 4BJTA 2WA0A 2CFOA 2MFZA 3OYFA 1OR7C 3OYIA 3OWTA 2DCEA 3DQVC 2R7QA 3CJQB 4ZDPA 3LL7A 4CCOA 3IP4B 2CUZA 3E0JB 3H0DA 4HSTA 3SEZA 4AU7A 2AQFA 3BCBA 2M7AA 2Z16A 3DTEA 3OMYA 4QPQA 4CZCA 1Z3YA 4BS9A 4BACA 3EUHC 2CUJA 2WAEA 3VSLA 2L9SA 3QODA 2M7BA 2X1CA 3OOUA 2M3AA 4CA0A 4YRVA 4GRIA 3IAS2 4KJZA 4OAZA 5HLTA 2HQAA 2IXSA 1S9HA 4ANJA 2DT6A 2PJRA 4DBRA 1X1DA 2XF6A 3K4JA 4PJMA 3ZGKA 4DOZA 4DBQA 2X51A 2VQHA 2HU9A 4XONA 3OYDA 3RSNA 3FHNA 3QYBA 2IGNA 3ZXSA 2VKHA 3PSIA 2QKMB 1YX5A 2KDOA 3UR3C 4N4NB 3OYNA 3FBNB 1UG0A 2WY7Q 1T95A 3DPUA 2DXIA 4R79A 1W36C 2UWMA 2R7WA 3K70C 4BUPA 4RM2A 3I3LA 1K6YA 2WAQA 4HNUA 2VJ5A 4E7HA 3ZRGA 4HEA2 3LSIA 3D5LA 4ZYAA 3MKWB 2JSPA 4Y3OA 2XF5A 4JQFA 2V4JC 4B44A 3SZGA 1P9QC 2VQCA 3DLAA 3W3CA 4OWRB 3S32A 4PJJA 3LSHA 3S3MA 2W4SA 1BR4A 3HG9A 1V5GA 4IX7A 1LKXA 4F91B 1MMGA 4E6KG 4E7LA 1DGRM 4F3QA 5HOOA 4BJ5C 4ZDOA 2M4GA 3AKZA 1Y6IA 4NNJA 3KX2A 3OR1C 4YELA 3OYCA 4PJLA 2E60A 4PSXA 5HNHA 4NQWB 4D9JA 3VWBA 2K5CA 2W82A 1QHGA 4XLCA 2OV7A 5CQEA 2WB1A 4E7KA 4E7ZA 5HNFA 1LDKB 2R7UA 3MKZA 3DEEA 3BG6A 2VB6A 1Z21A 4LITA 3RQ4A 2PJRB 4PK4A 1D0ZA 3RPUD 4BXFA 3OIPA 4C2UA 4XKCA 1WJDA 3QYEA 1PYVA 3G2BA 4C9YA 3FDYA 2RQQA 4BQNA 2LYCA 3UNGC 2QKLB 2IS2A 2IS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X0G A;  4IX7 A; 
#chains in the Genus database with same CATH topology
 2EWN A;  4XNF A;  3WU1 B;  4BGD A;  2WAQ N;  2MSY A;  3R6S A;  4CYC A;  2V1D A;  5GPA A;  3MZH A;  2Z3Y A;  1DP3 A;  4O5V A;  3QRF F;  1ETO A;  2FUG 2;  2CH0 A;  1G8X A;  2L3D A;  3WTW C;  2P6T A;  2ZC2 A;  2WTE A;  3HTU A;  2VBX A;  4GYG A;  5KVR A;  2KKO A;  2W1O A;  1ITY A;  1BR1 A;  1W7P D;  1PUE E;  4LMY A;  3HOT A;  3LSP A;  2Z99 A;  3PNV A;  2ISY A;  5J1R A;  4LB6 B;  1LEB A;  1LVK A;  2W57 A;  2YR2 A;  2WV0 A;  2OD5 A;  2JK3 A;  5M5X J;  4C2T A;  3WTY C;  1USS A;  2R7V A;  5LD2 C;  1IG7 A;  4KIT B;  3A02 A;  4ZJZ A;  4XKV A;  4O6J A;  2H09 A;  4PDK A;  2P8T A;  3BOQ A;  1TZL A;  1BL0 A;  4GYI A;  2FE3 A;  3IC7 A;  3REO A;  5FLV A;  3CLO A;  5LLQ A;  3OYA A;  4Y33 A;  4EGY A;  2F5V A;  3M1C A;  3MD2 A;  4DNC A;  2OCC H;  4YEJ A;  5D4R A;  1XGN A;  2J5O A;  3K4L A;  4LG0 A;  4I98 B;  1MJB A;  3GTP J;  1KQ0 A;  2DOE A;  5FRM A;  3F8M A;  4I7H A;  4OU0 A;  1LVA A;  2DQR A;  2XGE A;  3VPR A;  1SFO J;  1HW1 A;  1BIA A;  2KZV A;  1FOW A;  2BE5 F;  4XLP F;  3CME I;  1CF7 A;  1YIJ I;  2BZT A;  5JFR A;  1ENH A;  2VT2 A;  1EV7 A;  4MEY F;  3R0A A;  2NRA C;  2MD5 A;  4I99 C;  2ZO4 A;  4LG3 A;  4AYB A;  5KAF C;  1ZG3 A;  1Y1W J;  5TJJ A;  1ZKG A;  3QU3 A;  3H3U A;  1SEU A;  2L4M A;  2WV1 A;  4HBL A;  4RM3 A;  2JA6 J;  2OZ6 A;  3T5X A;  3ISP A;  1QU3 A;  3ABK H;  3J81 K;  4KT6 A;  2DMT A;  3BG7 A;  1ONV A;  2GIV A;  1FTT A;  1T56 A;  2HQ5 A;  2L9N A;  4AUX A;  5BPI A;  1IAW A;  2NOJ B;  4GCV A;  1I27 A;  4EJV A;  3TKY A;  1ZH5 A;  2OU2 A;  2BXZ A;  1Z7U A;  2ECC A;  2P81 A;  1YIT I;  5CVJ A;  4XOR A;  1NG6 A;  2BW3 B;  2LC2 A;  3BZC A;  2A05 A;  1VQO I;  5E18 F;  1X1A A;  2KMU A;  3V8K A;  4XN0 A;  5F08 A;  4IQJ A;  5D6F A;  1S3J A;  5ILU A;  1B72 A;  4G9Y A;  3FKJ A;  3ZR8 X;  4BDY A;  1SAN A;  1Z7L A;  4PJN A;  1QVU A;  4V2F A;  3PL8 A;  3PO3 J;  2MC4 A;  1ETW A;  2XAS A;  1FSH A;  2CS3 A;  3CCE I;  3CZ6 A;  3GYH X;  4Q47 A;  2E36 A;  5TIS C;  2JN6 A;  5DEQ A;  1K7A A;  2GWR A;  4U0V A;  1FIA A;  2VPR A;  5D5V B;  1T08 B;  2JJ7 A;  4J19 A;  3DTI A;  4PZJ A;  2VOD A;  2FMY A;  2RV8 A;  1IF1 A;  1D1A A;  1WCM J;  2DK8 A;  3K4N A;  3PNY A;  3PUB A;  2CQK A;  1TWC J;  2NVX J;  3I55 I;  1YIO A;  3TP0 A;  5KCM A;  4A2U A;  2ZSH B;  3S16 J;  1OLT A;  1KGS A;  4ETS A;  4GFB A;  2JVG A;  4IF4 A;  3TBI A;  3NQO A;  3M4O J;  1T2K A;  2G7H A;  3SDG A;  3WU0 A;  4MQV A;  1ACI A;  3E1S A;  3J7A Y;  2WY8 Q;  4ON0 A;  4M73 A;  4XMY A;  3HGG A;  3CMM A;  2Z5U A;  2Y30 A;  1VF9 A;  3ASO H;  3V8L A;  1HKS A;  2JUG A;  2ISZ A;  4P55 A;  4B43 A;  3CQZ J;  5ILS A;  4UVA A;  3H35 A;  4JYK A;  1X3U A;  1B9N A;  2BOL A;  4EV0 A;  1IO2 A;  2XB5 A;  1YYV A;  3P9C A;  2ELK A;  4CCN A;  3CCS I;  5J1U A;  1ZYR F;  2H6C A;  4ESB A;  1Y8R B;  1BJZ A;  5FKM A;  5JLW A;  4V19 K;  2A6T A;  2CO5 A;  2VC0 A;  3PFI A;  4IOA F;  3A01 A;  2QF7 A;  5F0C A;  5CKT A;  1WJA A;  2HYF A;  2JPB A;  4J01 A;  2Y0M A;  2GAU A;  3K4K A;  2D2W A;  1SAX A;  3GW2 A;  3LSK A;  3GME A;  3F72 A;  5C3E J;  4BE1 A;  2LOO A;  3IH4 A;  5EZH A;  1GVD A;  1OMI A;  1DGW Y;  4BXU A;  1YS7 A;  3SEQ A;  1J5Y A;  3OY9 A;  4N0B A;  1TWH J;  3G71 I;  3G4S I;  3HSF A;  1HST A;  2MH2 A;  3FXJ A;  5D5W B;  4E7I A;  4M3D A;  5B1A H;  1WFX A;  1GHC A;  4RAG A;  4IXA A;  2CW7 A;  3VYU B;  1OJL A;  4NDL A;  4Y4R A;  5LGU A;  2DW4 A;  1RUN A;  1P4A A;  3RQI A;  2CWE A;  4CXF A;  1UCR A;  1W7P A;  2HKX A;  1FP2 A;  5FB2 A;  4H0E A;  3H5A A;  3CF5 F;  1TT5 B;  2HWV A;  2X0L A;  2GM4 A;  2B63 J;  5C4X J;  2V9K A;  1YG2 A;  1P4X A;  4WXC A;  1X4O A;  4G6D A;  1HKT A;  1ORK A;  2VI6 A;  1KON A;  2YUS A;  1FNN A;  2ESN A;  4RB1 A;  1VFC A;  2EA4 A;  3KE2 A;  2BYV E;  1J9I A;  2XRN A;  1TQM A;  3FIW A;  5BQT A;  2VQL A;  1JE8 A;  1G3S A;  2DPD A;  3WG9 A;  4KFC A;  1FMV A;  1B9M A;  1VTN C;  1WWX A;  4M6X A;  3BY6 A;  1U5T B;  1X1C A;  2LTP A;  2KRC A;  3O8G A;  4ZTF A;  4G12 A;  3FX3 A;  4AVZ A;  3FBI B;  3MMY B;  1G3T A;  3TED A;  1C0W A;  4ENM A;  4D5C A;  2STT A;  2DFF A;  3L2Q A;  3I54 A;  1KU7 A;  3TOB A;  6PAX A;  1WRJ A;  2JA7 J;  2FNP A;  2L54 A;  2M8E A;  1ZQ3 P;  3BP8 A;  1YE9 A;  5EZG A;  3RYP A;  4GDF A;  2VXD A;  2R5Y B;  3AL0 B;  3TO6 A;  3GTG J;  1TT0 A;  2KQR A;  2Q1Z B;  1MMN A;  2K3F A;  1TWF J;  3RJP A;  3MFK A;  1R36 A;  2DOF A;  2F5F A;  3DFG A;  1D0X A;  3DU6 A;  1JI8 A;  4L9V A;  1J75 A;  2EH3 A;  3CDI A;  2R4G A;  3FK6 A;  3RCO A;  1V5E A;  1V5F A;  1BN5 A;  3CC2 I;  3CF2 A;  4HNT A;  2LKS A;  1TW3 A;  4XIC A;  2VPL A;  1Z0X A;  5KHD A;  1LFU P;  4HPQ A;  1IUY A;  1EJ9 A;  2FML A;  4L18 B;  1IV6 A;  1YW9 A;  1QNT A;  4MO7 A;  1K79 A;  3VYT B;  5DS9 A;  3IRR A;  3RIR A;  1QZE A;  2HZD A;  3CTA A;  4FET A;  2BHZ A;  2X9D A;  3HXL A;  4C3H J;  2KPM A;  3OYH A;  5J6X A;  1K4T A;  2F4O B;  2HVQ A;  4ZYD A;  4L9N A;  2EBI A;  5EGO B;  2XAG A;  3OYG A;  4LJZ F;  3HEF A;  4BJT A;  5GAG J;  4BQA A;  3S2H J;  3I59 B;  2MLG A;  1ETX A;  4HW0 A;  3IH3 A;  4IHT A;  1PP8 F;  5ICG A;  3DQV C;  3J7Z I;  2FXA A;  4AIJ A;  2ZBK A;  2IEK A;  3H0D A;  1X2N A;  5DCM B;  4HST A;  5HLI A;  4UB8 C;  4AU7 A;  2AQF A;  2MW8 A;  1E3H A;  3WGG A;  4BKX A;  3B6C A;  3BCB A;  1MH4 A;  2A5Y B;  4Z6Y A;  2LKX A;  1JJ8 C;  2Z16 A;  4A93 J;  2HGC A;  4A5N A;  4OIR F;  2FEZ A;  3CCR I;  3MZY A;  4XRF A;  2ECB A;  4BS9 A;  3K2A A;  4BAC A;  2COB A;  3I71 A;  2H27 A;  2WAE A;  1KYW A;  2EV0 A;  2L9S A;  3QOD A;  5IOZ A;  4MQ9 F;  4KA4 A;  1QZZ A;  2X1C A;  3BJA A;  4YRV A;  4GRI A;  4KJZ A;  1R4M B;  1OCR H;  3BG5 A;  3K4J A;  4MEX F;  2X51 A;  2VQH A;  5CVV A;  3OYD A;  3VFZ A;  1B8I B;  1SD7 A;  1OCP A;  3MN2 A;  2R3S A;  2JQ7 A;  2V9V A;  2NVT J;  3BR0 A;  4IPA A;  2P7C B;  2VKE A;  4BBS J;  3PIO F;  3BT9 A;  1LE8 B;  5F1R A;  2GIZ A;  2F4M B;  1YRN B;  2VJ5 A;  5HS7 A;  1G2H A;  3EYY A;  3G1O A;  2E1O A;  3JAM Z;  3K1M A;  4A6E A;  1CQT A;  1UHW A;  1P92 A;  3F8F A;  1KYZ A;  3IHU A;  4CYC B;  3RPQ A;  1TNT A;  4NC6 A;  4YFK F;  2V6C A;  1A6Q A;  2K40 A;  4ZZD A;  2W4S A;  5JVG F;  2YU9 J;  3R60 A;  1YW7 A;  1LKX A;  1IXS B;  4R8H A;  3R61 A;  3KP6 A;  1I3A A;  5HLH A;  5HOO A;  1SVM A;  4ZDO A;  2M4G A;  1X58 A;  3TOA A;  3AKZ A;  1HC8 A;  5L3F A;  1PDN C;  5FKN A;  3TDU C;  4YEL A;  2ZNZ A;  3KP2 A;  4PJL A;  1A36 A;  2HEO A;  5M3F J;  2HDC A;  1D3Y A;  1G3Y A;  1IN6 A;  2QBY A;  5DUK A;  2XRL A;  2W82 A;  2Y0S N;  5FD6 A;  1JJ6 C;  1POG A;  2KJB A;  2IAI A;  2GA1 A;  3B73 A;  3KZI C;  2P7V B;  4E7K A;  3JRA A;  3CCL I;  2L7M P;  4BHC A;  5HNF A;  1LDK B;  2KIQ A;  4BY1 J;  1U6G A;  4A3J J;  3MKZ A;  1P4W A;  4YIR X;  3HOV J;  3S14 J;  5LGN A;  5IP6 A;  3RQ4 A;  2ID6 A;  1D0Z A;  2NVQ J;  1WJD A;  4WXD A;  5LEK A;  3G2B A;  4LG0 B;  5CVR A;  4AWX B;  3IRQ A;  1DUX C;  3QPT A;  3T1B A;  2QKL B;  1XCV A;  1U0J A;  2OCE A;  3B6A A;  3O3K A;  2VL8 A;  3TMO A;  4WCG A;  3EDP A;  3S1N J;  2FSW A;  2VJI A;  1MDM B;  2Y75 A;  3OS1 A;  4U0W A;  5E1X A;  4G7O F;  2LG4 A;  3DP7 A;  3KEY A;  4FTH A;  4EAT A;  1R1V A;  1OIS A;  1T8I A;  3H3Z A;  1R5H A;  1MBJ A;  5CQG A;  1R7J A;  2DA4 A;  3VYR B;  1X4P A;  3HKZ A;  2IA1 A;  5FLX Z;  3L2C A;  2BVL A;  3WTU C;  3C2B A;  5LHI A;  1OYW A;  3J81 Z;  1GVJ A;  2FU4 A;  5CVI A;  2B7E A;  2Y31 A;  3FM3 A;  3I4P A;  2KL4 A;  4CCJ A;  5E3M A;  3EUK L;  4DYQ A;  4PCQ A;  4WXH A;  2DYR H;  1FMW A;  3J80 Z;  1H9G A;  1ZLJ A;  1MSE C;  2VAS A;  4QPO A;  3JRI A;  3ONQ A;  3OS2 A;  1JHH A;  1T6S A;  3L2W A;  1JUP A;  4AIH A;  2F4I A;  2BBY A;  1RPW A;  1S7E A;  1SD6 A;  4E4H A;  4XR6 A;  2O5R A;  4M6V A;  3OYK A;  4XRS G;  3NWT A;  2HDD A;  5D6E A;  3JRG A;  3DKY A;  2WB1 N;  3HIF A;  3HM5 A;  1H0M A;  1IJW C;  3I4N J;  1ERD A;  1TBX A;  1DP7 P;  4YII A;  2XAJ A;  1B72 B;  1MBG A;  1RES A;  4Z2Y A;  3ECH A;  2HFH A;  2K9M A;  5IOY A;  2E2H J;  3WGH A;  1O57 A;  3IL2 A;  4HDU A;  4L0Z B;  4A6D A;  2CQQ A;  4N4O B;  3A0B C;  3S93 A;  4XRM A;  1DU6 A;  1WSU A;  1IRZ A;  2L9V A;  4D5F A;  4EJU A;  4IEJ A;  3LSJ A;  4NHJ A;  1ULY A;  3LNQ A;  3RKY A;  2A07 F;  3X2Q H;  2DA7 A;  3Q0V A;  4XSX F;  3CP2 A;  4V2G A;  1CGP A;  2V6E A;  2FBI A;  3H1C A;  3H9Q A;  2VE8 A;  1TWA J;  4A69 C;  3PNT A;  3W2A A;  3BG3 A;  3KEO A;  3ZQ7 A;  2HZT A;  4HX4 A;  2YSR A;  4MGR A;  3H92 A;  3W2W A;  2E2J J;  1WGX A;  1TWG J;  3LFU A;  1YFH A;  4OMY A;  3F8N A;  4XKW A;  3MQ0 A;  3EQL F;  4DGW B;  4BE2 A;  3KYL A;  2IRF G;  3BTI A;  3KYC B;  2ZCW A;  3QOE A;  1SD5 A;  2X6X A;  2YX7 A;  3DV8 A;  2RNJ A;  3TDZ C;  2VT3 A;  4KT5 C;  4BEH A;  1VQ5 I;  3HRS A;  1OCT C;  3QPS A;  2EFN A;  4XOT A;  2KFD A;  1MBE A;  4RDU A;  3HHH A;  1W5C C;  3SFZ A;  4N9I A;  4AM3 A;  3H0G J;  1MZB A;  1Z9C A;  1DU0 A;  3E5U A;  5EG0 B;  4KIF A;  5FLM J;  2LY2 A;  3M1E A;  4CUG A;  3BZ6 A;  5F6F A;  2L4A A;  2JA5 J;  2WC2 A;  3HL2 A;  5J8C A;  1QBJ A;  1FYM A;  5J47 A;  3GUD A;  1MNE A;  3O2P E;  3AG1 H;  5JR3 A;  1WJC A;  4XBF A;  3LA7 A;  3ZQG A;  1VQM I;  2QSF X;  3KLO A;  1EA3 A;  4ASN A;  2VJ4 A;  1S6L A;  5K5Q A;  1J09 A;  1FOY A;  2KIM A;  5K1Y A;  4LOC A;  1XMA A;  2OZU A;  4BY7 J;  4OIQ F;  3PFY A;  3JAM K;  2H94 A;  2D1V A;  2JZY A;  5E20 A;  4YIF A;  5HS8 A;  3G1M A;  2EV6 A;  1IN4 A;  3SZT A;  3RKW A;  3ZN0 A;  3FMS A;  3WTS C;  3E6C C;  4UVB A;  2FBK A;  2YPR A;  3Q0U A;  3N05 A;  1F4K A;  5IT9 Z;  2M0C A;  4CGZ A;  4MLO A;  4F55 A;  2EIN H;  4P9U A;  5J40 A;  1IXR C;  3P9I A;  4NB5 A;  5D5U B;  3MVP A;  2L0K A;  4UUS A;  4U87 A;  5FFX A;  1FLI A;  2MAB A;  4FCY A;  2XHK A;  3BR2 A;  3OL3 A;  2RAE A;  3D1N I;  2EIL H;  3CO7 C;  2ZME A;  1Z91 A;  3CLQ A;  3QU6 A;  1YQA A;  3FM5 A;  3GFM A;  1RR7 A;  1IRX A;  4FQG A;  1VQL I;  2I5U A;  2CG4 A;  1I50 J;  1R9T J;  4EM2 A;  2BV6 A;  2NYX A;  1LFB A;  2PMH A;  4NBQ A;  1RUO A;  2Z9O A;  4U88 A;  2OF7 A;  1U3E M;  2Y48 A;  4K2E A;  3BCA A;  4YFN F;  3K4M A;  2XSJ C;  3K2Z A;  4LIU A;  5DYM A;  1FX7 A;  3S3N A;  4KMU X;  1JXS A;  5F27 A;  4NC7 A;  2LBF B;  5GP9 A;  3L09 A;  3IUO A;  3SJM A;  4ZDL A;  3JRB A;  3ULQ B;  4EMS A;  4X0G A;  4XN3 A;  2PI0 A;  2VOO A;  1I1S A;  2QUF A;  2KIU A;  1QQI A;  1E17 A;  3K6G A;  2O03 A;  3T8T A;  1BBY A;  2VQG A;  3P7N A;  4BQO A;  2X6O A;  1R1U A;  2K3P A;  5J8F A;  3GTQ J;  2QEX I;  2NS8 A;  3BLY A;  4X6A J;  1OCC H;  1SAU A;  2Y0S A;  1LJ9 A;  4P96 A;  1UHM A;  2BXY A;  1T98 A;  4BNC A;  2HPI A;  2RNG A;  1TNS A;  2CW0 F;  1BI2 A;  1HKQ A;  3CP8 A;  2DLL A;  1XB4 A;  1SFX A;  3VEP A;  2IGM A;  3F9K A;  5IPA A;  5FLX K;  2QQ9 A;  3S1M J;  3HGY A;  5EDN A;  2Q0O A;  3OR2 C;  1VI0 A;  3QPL A;  1Q1H A;  3FMR A;  1WI9 A;  2PG4 A;  2PQ8 A;  5F1J A;  1NG7 A;  3FWE A;  2MBF A;  4RLF A;  1P2F A;  3BC8 A;  2G0E A;  3V8J A;  3L2U A;  1S7A A;  1FYK A;  1XGS A;  4HDV A;  2X1D A;  3J80 K;  1D8K A;  2R7D A;  2IW5 A;  1UJ8 A;  3D5S C;  2K9L A;  4ENN A;  1HBX G;  2X85 A;  4XSZ F;  4HF1 A;  4KUM A;  4AID A;  1D5Y A;  5HS9 A;  4XOP A;  5J1Y A;  1WKM A;  3ZMS A;  2VOP A;  4I01 A;  2OTL I;  5E3O A;  2NAZ A;  5TGT A;  2NNN A;  2A5W A;  1FOX A;  4FE4 A;  2FF4 A;  4KIC A;  4A3B J;  3A1Y A;  1VQP I;  1FYL A;  2MLK A;  4DYC A;  5BOX A;  4R1H A;  3DEW A;  4JOM A;  1WPK A;  2O9L A;  4E70 A;  5CYV A;  3KZY A;  4QWQ A;  1TL8 A;  3RKX A;  5BMZ A;  1MIJ A;  3H36 A;  2W25 A;  4XLE A;  4M9Z A;  2XPU A;  1JGS A;  4XL9 A;  4RB3 C;  2XSD C;  2LRE A;  3JSP A;  2HYJ A;  2LVS A;  4PGG A;  2H8R A;  4KMF A;  3ZQF A;  2WBM A;  4XKB A;  3S17 J;  1X3Z B;  5BNG A;  2V7F A;  2CV0 A;  2H6B A;  3C2G A;  1R23 A;  1GV2 A;  4RLQ A;  3TP3 A;  2X1E A;  1FY7 A;  1ZEL A;  3DBH B;  4DW6 A;  4F52 A;  3VOD A;  2DO7 A;  2XAU A;  5EJC A;  5GTH C;  2B0L A;  1BW6 A;  4JX4 A;  1L0O C;  4BL0 B;  4P5O A;  2Y69 H;  3MWM A;  2M30 A;  4IRI A;  1T33 A;  3IV5 A;  3FMQ A;  1AA7 A;  1AWC A;  3HHG A;  2K7L A;  2O7O A;  1WH7 A;  5DDG A;  1OCZ H;  2XB0 X;  3F22 A;  3FXK A;  1WZ2 A;  4GXO A;  4G6T B;  1GXP A;  2BVM A;  1W36 D;  1BOB A;  1SVL A;  1J2X A;  1MMD A;  4UUV A;  5J4Y A;  4U0Y A;  3ZMD A;  5A2Q Z;  3V7S A;  2EK5 A;  4M72 A;  2CFO A;  1F36 A;  3WE3 A;  3ZMZ A;  5HOD A;  3OYF A;  1ZRD A;  2H1L A;  3F8C A;  3OWT A;  5K5O A;  2HTJ A;  2DCE A;  5DM7 F;  4JK1 X;  5LHG A;  3CJQ B;  4ZDP A;  3S1R J;  3NEU A;  1XCB A;  1X2M A;  2CUZ A;  3E0J B;  4L9T A;  5AIP A;  3ZQI A;  2DJN A;  2B9S A;  2GBY A;  3SEZ A;  2DA6 A;  2VKV A;  1Y0N A;  2OPT A;  1ZG1 A;  2QSH X;  2EB7 A;  3DTE A;  3OMY A;  2L02 A;  3ZP5 A;  2BY1 A;  4KDP A;  4JBA A;  1RNL A;  4RBO A;  1W5T A;  3CUQ A;  1IRF A;  1V54 H;  5KAI C;  3AG3 H;  3GZ5 A;  3HOZ J;  2LK2 A;  2CUJ A;  1MBF A;  3EUH A;  3E3V A;  1PUF A;  5DCF A;  2Q2E A;  3OOU A;  4HQM A;  4CA0 A;  2JMW A;  3IAS 2;  2ZJR F;  2NXN B;  3QQA A;  5GTI C;  5IT9 K;  2IXS A;  2VC1 A;  3SHF A;  5J4V A;  4RAZ A;  2DT6 A;  3JW4 A;  4DBR A;  2F5E A;  1X1D A;  4LLG F;  1OCO H;  4A3L J;  1ZRF A;  2XAQ A;  3PSI A;  2YX4 A;  5ICF A;  4L0Y B;  3FBN B;  1MNM C;  1SD4 A;  4IHY A;  3DPU A;  4R79 A;  1XSD A;  1W36 C;  3BZK A;  2UWM A;  3F21 A;  2HI3 A;  3MCZ A;  2WAQ A;  4HNU A;  3M7G A;  4E7H A;  2BHY A;  3K7A J;  3LSI A;  3D5L A;  3RZD J;  3HTS B;  4Q48 A;  1XD7 A;  2KDZ A;  3V7C A;  5B1B H;  2GQQ A;  5DUI A;  4B44 A;  1G4D A;  2P5L C;  5L3D A;  3SZG A;  5F0H A;  2VQC A;  4IHX A;  3W3C A;  1AHD P;  4OWR B;  4OOI A;  2ZJ2 A;  5IY5 H;  1O3Q A;  3LSH A;  3JR9 A;  1SVO A;  2LF7 A;  3ZMT A;  1V5G A;  3TO9 A;  1FWZ A;  3J7A O;  2JT1 A;  1IN5 A;  1YJN I;  1K78 B;  1U8B A;  4L9J A;  1I5Z A;  3OIO A;  4NNJ A;  5JI6 A;  4ZYH A;  3OYC A;  2HOE A;  2G9W A;  1Y0U A;  3N4M A;  2E60 A;  2HOS A;  2RKH A;  4NQW B;  3VWB A;  2PFB A;  2ACJ A;  3KLN A;  2K5C A;  2X4H A;  3F0C A;  2R5Z B;  5GAD J;  3CCV I;  4XLC A;  2OV7 A;  1TC3 C;  1BC8 C;  1D8J A;  5CQE A;  3FZV A;  4RB2 C;  1O3T A;  3F3X A;  4MIM A;  2QLZ A;  3DEE A;  2DA3 A;  4IOC F;  3HRU A;  2VB6 A;  3JTH A;  1SMY F;  1Z21 A;  5H6Q A;  2PJR B;  4PK4 A;  3QPH A;  4C2U A;  4XKC A;  1PYV A;  1XC5 A;  1RR8 C;  4C9Y A;  3FDY A;  2LYC A;  4UXN A;  4Q5S F;  2IP2 A;  3O8H A;  1JGG A;  4MFE A;  3BR1 A;  2O6G E;  2EA2 A;  3S2D J;  3Q9V A;  4L5I A;  3WTV C;  2X48 A;  1VQK I;  2R7R A;  2DJI A;  2V26 A;  3DU5 A;  4I09 A;  1YX3 A;  3WTX C;  3PJR A;  3QAH A;  4II2 A;  1I6X A;  3BDD A;  2PMZ N;  3C3W A;  1IN7 A;  1JKQ C;  3HDD A;  3KEQ A;  2UUZ A;  2XUB A;  3WHC A;  1ETK A;  2OBP A;  3GTM J;  3HOU J;  3S1Q J;  5L3B A;  2W84 A;  2BW3 A;  4EGZ A;  2AS5 F;  2DFE A;  3HOS A;  2PEX A;  1JKO C;  2NNY A;  2ZXW H;  2E7X A;  2A69 F;  3I0T A;  1DDN A;  2LY1 A;  4XLN F;  1NHA A;  1MBK A;  1LB2 A;  4TV7 A;  3CD6 I;  1ZK8 A;  1EH8 A;  1Z6R A;  1STZ A;  5F64 A;  3L2V A;  1YJW I;  1IUF A;  1OQY A;  2ESH A;  1H89 C;  1XTA A;  3NWS A;  2R7S A;  2C6Y A;  4Y52 J;  1XS9 A;  1K83 J;  2VBY A;  3K69 A;  4UV9 A;  4OAY A;  3GLX A;  1GXQ A;  3KP7 A;  2STW A;  2OC6 A;  2QWW A;  4RGU A;  2IVM A;  2A68 F;  3DBL B;  3VSK A;  3H9J A;  1SFE A;  5FFZ A;  3RDI A;  1MH3 A;  5E3L A;  4FAS D;  1VQ9 I;  2QVO A;  4FIS A;  3KP4 A;  3VDX A;  1QHH D;  3GFL A;  3KIO A;  3P5J A;  1JHF A;  3CJN A;  3HPH A;  3FXR A;  1U9N A;  2COM A;  4IL6 C;  2FBH A;  4D1Q A;  2FX0 A;  2EZK A;  2VN2 A;  4JP0 A;  4IHW A;  4CCM A;  2PX9 A;  5E8I A;  2HKO A;  1DPR A;  2GOM A;  2EFQ A;  5F04 A;  3KP5 A;  3IKV A;  1VQ6 I;  5A2Q K;  3LSG A;  4MHG A;  4H4K C;  4D7M A;  2A6E F;  4ZH4 F;  4I0B A;  1WI3 A;  3GZN B;  4PJ0 C;  2L7K A;  2IA0 A;  3FXU A;  1JTY A;  2X6W A;  2GXB A;  1E0E A;  5KNL A;  1I1G A;  2L01 A;  1ZGA A;  2KT0 A;  5FD5 A;  4AD9 A;  3GTL J;  1YJ9 I;  3LQQ A;  2AXL A;  2J5P A;  1XPX A;  5LHH A;  2P5V A;  4HV5 A;  2OUM A;  1XDS A;  1B59 A;  2FD5 A;  4PSW A;  5CPR B;  4YG2 F;  2WAF A;  1FBS A;  2BGC A;  4ENK A;  3F23 A;  4IQ4 A;  2TDX A;  3ABL H;  3SYT A;  2YS9 A;  2V1X A;  5E1Z B;  2ZXH A;  3LSM A;  3IAM 2;  3RTR A;  3WTZ A;  1OYY A;  4AIK A;  4RAY A;  5K7Z A;  2K85 A;  1N77 A;  4JX5 A;  3DKX A;  4LLL A;  3JRE A;  2PBI A;  4P9F A;  3DLL F;  4ZTJ A;  3FXM A;  3CCU I;  2W85 A;  4QIW N;  3AFH A;  1T38 A;  4UV8 A;  2CMP A;  1ZR4 A;  1ETY A;  4IHV A;  1HCR A;  3HRT A;  1G3W A;  2NOG A;  1XMK A;  2DT5 A;  4IRG A;  2UXX A;  1JT0 A;  1RET A;  1KU3 A;  3FF5 A;  3M3Y J;  1A04 A;  2ELH A;  1ZAR A;  3HZJ A;  2CQX A;  1ZRC A;  3K9T A;  5CVU A;  3HSR A;  2DFH A;  4MTD A;  2ZNY A;  3IWZ A;  3CJR B;  4M74 A;  4S0H B;  1FOK A;  2W7N A;  3E7L A;  3LMM A;  2BY2 A;  3I4M J;  5DV5 A;  1AKH A;  5BPD A;  3GBG A;  2ZB9 A;  2CW8 A;  2CV1 A;  2DA1 A;  4ENJ A;  4B4C A;  3WOD F;  2R7X A;  2K9N A;  4AYB N;  1CF7 B;  3QWL A;  3E97 A;  4RGX A;  3K10 A;  1UB9 A;  2R92 J;  4HQE A;  2RDP A;  1WJE A;  1WJF A;  3BPX A;  1QRY A;  3ABM H;  1R1T A;  1B4A A;  2LDU A;  1R6R A;  2M0M A;  3G73 A;  1LUJ B;  3ECO A;  3K1N A;  5DD4 A;  4Y7N J;  3MKY B;  2LRD A;  1U5T A;  3EUA A;  4UB6 C;  2PJP A;  1KA8 A;  1DPU A;  2BEO A;  1AOY A;  3GXO A;  4B3A A;  1X1P A;  2I10 A;  3Q0W A;  1L3L A;  2IGK A;  4M9X A;  1W5S A;  2V9P A;  3ML6 A;  2IGO A;  3OIQ A;  4RMN A;  3OOP A;  1JT6 A;  4EJW A;  3CCY A;  4BH9 A;  1FP1 D;  2GLO A;  1HW5 A;  1I6H J;  5J3L A;  1T39 A;  1XMX A;  3BTJ A;  1H88 C;  2JA2 A;  4OIP F;  3HUG A;  2MG4 A;  1QVT A;  4CH7 A;  3HOY J;  1FEX A;  2R5Y A;  1J0R A;  1X1B A;  2D45 A;  5ICC A;  3PM1 A;  4FX0 A;  2ZJQ F;  1FJL A;  4II3 A;  2V1N A;  5GAE J;  4A3F J;  1T0F A;  2XC7 A;  2L5Q A;  4J00 A;  2VBZ A;  2ELJ A;  3H9G A;  4I2O A;  2NS0 A;  1HW2 A;  1LFP A;  5FRO A;  4BU2 A;  3B02 A;  4HAM A;  3DTK A;  3W2V A;  4KNY A;  3D5R C;  4FX4 A;  4HOB A;  2LKP A;  2EZH A;  5H20 A;  3JRH A;  1QPI A;  2DYS H;  4LB5 A;  4ZYG A;  1YTY A;  4KIB A;  1HA8 A;  2RC4 A;  1RZ4 A;  2P0W A;  3J7Y J;  3IKT A;  1SFU A;  4M6Y A;  1X3W B;  1ODD A;  4I6Z A;  2Y9Z A;  1EKE A;  2K9S A;  1TW2 A;  5K7F A;  1FC3 A;  3WE2 A;  1SMT A;  2DA2 A;  3TW6 A;  2E34 A;  5EGO A;  4HLX A;  1V4R A;  2XKO A;  3I59 A;  5D8L B;  3F8B A;  2ZSI B;  2GOX B;  2O8K A;  4BDZ A;  2DDA A;  3BTL A;  2Z2S B;  2HVR A;  1KU2 A;  1VND A;  4F92 B;  3S8P A;  2PMZ A;  2EFP A;  1BI0 A;  3GF2 A;  5DCM A;  3U9G A;  4XQF A;  1P7J A;  2F5C A;  2NVY J;  2VLA A;  2W24 A;  4DJA A;  4HF0 A;  1B1B A;  3BTC A;  2FRH A;  2AQE A;  2FQ3 A;  1RC9 A;  1MMA A;  1A35 A;  2JVH A;  4S05 A;  4GGG A;  2EJR A;  2KP6 A;  4OMZ A;  3CJT B;  4E7S A;  4QTR A;  2X6Y A;  3LQR A;  1VQ8 I;  1QGP A;  1ZAO A;  3A01 B;  3T0Y A;  3QP6 A;  2Z33 A;  4KIG A;  1PJR A;  3GWZ A;  5HDN A;  1S8N A;  2UV1 A;  5C44 J;  3G1L A;  3GEZ A;  1GDT A;  3GTO J;  2DA5 A;  1W4M A;  3KCC A;  3W6K B;  3H5N A;  5JHU A;  1HSJ A;  3E5X A;  3K1P A;  4WX9 A;  1B8I A;  2QSG X;  1WVR A;  1ZN2 A;  5LBQ A;  1PUF B;  1MMS A;  1D1B A;  1Y39 A;  2Q2E B;  4XM3 A;  4B1R A;  4I02 A;  3PO2 J;  1FPQ A;  2R93 J;  4CYD A;  3U21 A;  1ZLK A;  1LE8 A;  1YRN A;  4ZC3 A;  2W00 A;  1QO0 D;  2MYS A;  4D7N A;  3BJO A;  2DPU A;  5M3M J;  4BE0 A;  2LR8 A;  4HF2 A;  5FGM A;  3V4G A;  1HQC A;  4O3M A;  2AXT C;  1BW5 A;  1W7P B;  2JA8 J;  1F5T A;  1BM9 A;  3F6V A;  2L7Z A;  2AHQ A;  4CDG A;  3S3O A;  1M1E B;  1N75 A;  1UZC A;  4HRI A;  4UVC A;  3ZQQ A;  2A61 A;  3V42 A;  5JVT A;  1D5V A;  1BC7 C;  3GZ6 A;  2MFZ A;  3OYI A;  3JTG A;  3LST A;  2XGD A;  1FTZ A;  1OR7 A;  2EQR A;  2R7Q A;  1TTY A;  4CCO A;  3IP4 B;  2LSO A;  1XSV A;  4I0A A;  3M07 A;  4HV6 A;  3EET A;  3BQY A;  2F48 A;  3ZOB A;  4ABZ A;  1JTX A;  2EIJ H;  4BHB A;  2M1B A;  1WHU A;  3PIP F;  2QA4 I;  3RI4 A;  2DU9 A;  1S72 I;  3CUQ C;  2FOW A;  2LFB A;  2FJ1 A;  1XDU A;  3EUH C;  3GLL A;  2CJJ A;  4IRH A;  2Q8K A;  9ANT A;  3GFJ A;  3TQN A;  1UST A;  1BI3 A;  3W6V A;  1OFC X;  1GT0 C;  5HLT A;  4A3C J;  2HQA A;  4HLY A;  5E17 F;  1S9H A;  2DTZ A;  5CJ9 A;  5E79 C;  2XF6 A;  5L3G A;  2JSC A;  4PJM A;  3U1K A;  4A12 A;  4AC0 A;  2HU9 A;  2G7U A;  3ESW B;  4LK1 F;  2D1H A;  3QP5 A;  3QYB A;  2IGN A;  3ZXS A;  5AON A;  3BR6 A;  1UMQ A;  4Y17 A;  2KDO A;  4M3G A;  4N4N B;  2ID3 A;  3OYN A;  4XRS A;  2HXI A;  4HX7 A;  1UG0 A;  3WG7 H;  1T95 A;  5M5W J;  1MDM A;  2DXI A;  1HF0 A;  2R7W A;  4HA8 A;  5IT3 A;  4BUP A;  1ON1 A;  1K6Y A;  1FBU A;  4UHT A;  1HXD A;  2XIG A;  1R71 A;  4LK0 F;  2JPC A;  1Z6T A;  3IH2 A;  2JSP A;  2K86 A;  4MTE A;  1H8A C;  4Y3O A;  5L3E A;  2M9H A;  2E1C A;  4JQF A;  2V4J C;  2EIM H;  2DOD A;  3W6J B;  1PVE A;  2XAF A;  1F1Z A;  3DLA A;  3CCQ I;  3SQN A;  4X1E A;  1O3S A;  5EYR A;  4PJJ A;  3I56 I;  3S3M A;  1F9N A;  5ED4 A;  3HG9 A;  4IX7 A;  1A31 A;  1WH5 A;  2NVU B;  5DD8 A;  1MMG A;  2DMN A;  5FKK A;  3BWG A;  4IJA A;  2LP0 A;  3TGN A;  1S7O A;  4JX6 A;  4DZJ A;  3ZN1 A;  2LD5 A;  1Y6I A;  3BRO A;  4A0Y A;  2CUE A;  4M3F A;  3KX2 A;  3O6B B;  1YLF A;  1MD0 A;  3OR1 C;  3KZZ A;  4ESF A;  4S04 A;  4UNO A;  2GA2 A;  2KJC A;  2P6S A;  2V1U A;  5B66 C;  4LFU A;  4WF2 A;  1QHG A;  1R5G A;  3RKQ A;  2WB1 A;  3L1P A;  1VQ7 I;  4E7Z A;  5DM6 F;  1KZH A;  4F7Z A;  5HDG A;  1MSF C;  4EVI A;  1ETV A;  2XVC A;  3QOP A;  2TRT A;  1UG2 A;  2A3S A;  3BG6 A;  2FNA A;  2ZKZ A;  2ZXJ A;  3R4K A;  4MFD A;  4OIO F;  2MA3 A;  1HOM A;  3RPU D;  1ON2 A;  3RYR A;  2QZ8 A;  2QGU A;  1UHS A;  2RQQ A;  4BQN A;  4B8X A;  3JCU C;  2LLK A;  2K27 A;  2VKD A;  2IT0 A;  2HVS A;  5EEH A;  4E7J A;  1TQI A;  2FA5 A;  2JRT A;  3HB9 A;  1R00 A;  3OS0 A;  1NK3 P;  3OYM A;  2XGX A;  3CDH A;  4M3E A;  3CC7 I;  1FSE A;  5DTD A;  1D0Y A;  2ZXI A;  2EIK H;  2CV2 A;  3DBR B;  2GZW A;  2R7O A;  4CZZ A;  5ILV A;  2HQR A;  1SFK A;  5H6R A;  4BQQ A;  3ZPL A;  2XV4 S;  5EF6 A;  3K0L A;  3ZQH A;  2OA4 A;  1S5L C;  4FE7 A;  3MZ8 A;  3DF8 A;  1EF4 A;  2VIX A;  3CUO A;  3GVA A;  2XAH A;  2Z1D A;  2E2I J;  4KIS A;  2EFW A;  4XLA A;  1MW7 A;  4Y15 A;  2KLO A;  2K4J A;  2OQG A;  2CRG A;  1VQN I;  5EG0 A;  3Q3S A;  1JKR C;  3K4B A;  5GAH J;  3Q5F A;  1IGN A;  5IP9 J;  2O8X A;  3A4C A;  4BBR J;  1FZP B;  2R7T A;  3GX4 X;  1YO5 C;  4U7D A;  1QA6 A;  3SFI A;  4EM0 B;  4Q4Z F;  2QBY B;  2ICW G;  4NUB A;  4G7H F;  4KN4 X;  3E6M A;  3RZO J;  5L3C A;  2CYY A;  3EYI A;  5FO5 A;  5K5R A;  1G59 A;  1UEL B;  3ERE D;  1QPM A;  5B5E C;  2Y9Y A;  1E2X A;  2P4W A;  2BY3 A;  2GXA A;  4PGH A;  2HDW A;  2JRM A;  1G6N A;  3NRV A;  2UZK A;  3BQZ A;  1NH3 A;  2DQL A;  2XGC A;  2HQN A;  2JTV A;  1SC7 A;  4B09 A;  3HPG A;  1RRJ A;  4GO1 A;  2M8G X;  1DQU A;  1RKW A;  3M8F A;  3DPT A;  1IDZ A;  3JSO A;  4LD5 A;  1AKH B;  5F0F A;  4ZZL A;  4A3D J;  1ZGW A;  1REP C;  1IXC A;  5LEJ A;  3F6O A;  3OV8 A;  3HKZ N;  3L2R A;  2IJL A;  1FT9 A;  4DZP A;  3HOW J;  1LDJ A;  3H5R A;  2M87 A;  3OSG A;  1Y56 A;  5IYB J;  3ZCO A;  4KYW A;  3ZQC A;  3TL4 X;  2VXZ A;  1Z1D A;  4A5M A;  2HYG D;  3IWF A;  3HC7 A;  4YFX F;  4P1W A;  4RS8 A;  1ZHF A;  2D5V A;  3M8J A;  2F2E A;  2OQR A;  1HDP A;  2TCT A;  5C4J J;  1K4S A;  2LBF A;  1XGM A;  3VOE A;  3K4C A;  4B48 A;  1ZRE A;  4B47 A;  2KZG A;  1LEA A;  5ICE A;  4DIQ A;  2QYO A;  2WWY A;  1A6I A;  2DFI A;  3A0H C;  2E71 A;  3DXJ F;  3BPV A;  4EQQ A;  1P6R A;  2E1M B;  4ITV A;  5GPC A;  3DPL C;  2BY0 A;  2CSO A;  1U8R A;  1OKR A;  3E6D A;  3JRD A;  4RGR A;  4DYR A;  5FJ8 J;  2XPW A;  2IA2 A;  3GTK J;  4NC8 A;  1E3O C;  1UAA A;  3ROU A;  1JUS A;  2KRH A;  4G8X A;  5CLS A;  2IS1 A;  3OL4 A;  3GO5 A;  3WHB A;  3HUG B;  1IDY A;  2AO9 A;  4HX8 A;  2EZI A;  1WJ5 A;  3QYF A;  2MGQ A;  4RA2 A;  1GV5 A;  2ME0 A;  3ZMV A;  4EM1 A;  4FT8 A;  3SDB A;  2CQ7 A;  1S29 A;  2E7W A;  1Z3X A;  1V3F A;  1IC8 A;  1MJ9 A;  1ETQ A;  4D0P A;  2LF8 A;  3VYS B;  1Q1V A;  3HBL A;  3LA2 A;  4IVN A;  4BXX J;  3OYL A;  2ETH A;  3FHZ A;  4CO8 A;  2VE9 A;  2RRE A;  2LNB A;  4XID A;  3MEX A;  1ZGJ A;  1U9O A;  1KU9 A;  3LFK A;  1XGO A;  2O3F A;  3Q9S A;  5B3S H;  5FKL A;  3I53 A;  4PFP A;  3CCJ I;  3A03 A;  4L5J A;  1O3R A;  3SXY A;  3E5Q A;  4IKF A;  4C2M J;  1U5T C;  1Y8Q B;  3T8R A;  1K6O A;  2P5K A;  1N78 A;  4CCK A;  1PP7 U;  1YS6 A;  2E1M C;  3TW7 A;  3LSR A;  4XLF A;  3NAU A;  4CSW A;  2M34 A;  2ZFU A;  2I8D A;  3R0J A;  4A3I J;  2OAZ A;  1XN7 A;  3GCM A;  4U7B A;  2RQP A;  1MJA A;  1W1W E;  2WAD A;  4BEH B;  1Y1V J;  1E3P A;  1NK2 P;  4HZF A;  1YW8 A;  2PLY A;  2M5W A;  2W48 A;  4N9H A;  2HNH A;  3A2K A;  2R7Z J;  5D5X B;  2DMP A;  2DI3 A;  1YHQ I;  2KRF A;  3JRC A;  1R4N B;  4ZYE A;  3CCM I;  1ZR2 A;  3OYB A;  1I39 A;  5D8K B;  2DMU A;  1WJB A;  1FBQ A;  1X19 A;  2M4K A;  3FXL A;  1MGT A;  1RKT A;  2DMQ A;  3CC4 I;  3OYJ A;  3AL0 C;  1KQ9 A;  2DOA A;  1I3Q J;  2O61 A;  4DQ2 A;  2E35 A;  2LH9 A;  3RPU A;  2VUM J;  4HG2 A;  3WU2 C;  4IZZ A;  3C2H A;  3C18 A;  1HLV A;  1T0F C;  4QLC U;  4XLH A;  4BAY A;  1EH7 A;  1NTC A;  3OYE A;  2OTJ I;  2L9R A;  1U2W A;  3L7W A;  2EPF A;  1IW7 F;  2H8W A;  1MBH A;  1BA5 A;  4CCL A;  3PUF A;  3DEU A;  2HXO A;  2MH9 A;  5D4S A;  5FRN A;  2KHM A;  4UUT A;  3I9V 2;  3HSE A;  2MC3 A;  2L7F P;  1IRG A;  1YOV B;  2PMU A;  5HVQ C;  4BHP A;  4G7Z F;  2VON A;  2CU7 A;  4L5E A;  3C1D A;  1GLN A;  3LAP A;  2E19 A;  4G6Q A;  5JHF A;  2IPQ X;  3KET A;  4RAF A;  2JUC A;  3LA3 A;  2CFX A;  1MND A;  4LLN A;  2E5N A;  2CGP A;  5IP7 J;  2ZJP F;  1VQ4 I;  4UUS B;  1D1C A;  3ERM A;  4QSH A;  2F6C A;  4HSR A;  1N25 A;  1ZTR A;  5LFA A;  2QCO A;  2HPM A;  2ZME B;  3LOC A;  3H3V K;  3FXO A;  1Z05 A;  3ABT A;  3LWF A;  1JUM A;  4PUS A;  1B6A A;  5HDK A;  1QZY A;  1XG1 A;  3DKW A;  4C30 A;  4B3X A;  1F43 A;  1LPQ A;  3HOX J;  2HOA A;  4PFO A;  3BG9 A;  4FHT A;  4A3K J;  3OSF A;  3BJ6 A;  4BYY A;  2KIS A;  3G6E I;  2E5Z A;  3FXQ A;  2XDV A;  4EEF G;  4A0X A;  1OYI A;  5EEA A;  1R5I D;  3CMA I;  3EPZ A;  1P7I A;  4BJ6 C;  2QEN A;  2EZL A;  2FQ4 A;  4A0Z A;  1Z67 A;  3WTT C;  4IO9 F;  2DK5 A;  3KP3 A;  1TP4 A;  2VJJ A;  1TQP A;  3GTJ J;  2E1N A;  3D0S A;  5ERI A;  3SZP A;  3L00 A;  3COA C;  3BR3 A;  1Z77 A;  2RN7 A;  5H2F C;  5JLX A;  4A3G J;  1O7L A;  2L2O A;  5FKO A;  3M9A A;  3DWL E;  2F5D A;  5LGT A;  2IS6 A;  4C3I J;  3FKI J;  2ADU A;  4C3J J;  2XF7 A;  2N8G A;  2CUF A;  1J7K A;  4UY8 I;  4F93 B;  5K7H A;  3S15 J;  3I58 A;  4A3E J;  3I5U A;  4M71 A;  2OJE D;  3PQK A;  5LRS A;  2IBD A;  5TRD A;  3UKG A;  4OIN F;  2ZME C;  2R0Q C;  1FIP A;  2MD0 A;  5E8G A;  2LY9 A;  3HRM A;  3VB2 A;  3K70 D;  1LNW A;  1YI2 I;  2DBB A;  2JWT A;  3CES A;  2DT7 B;  4CHU A;  2DDB A;  4LIV A;  3KPH A;  4IHS A;  1VZ0 A;  1BR2 A;  5BS6 A;  3LAJ A;  2XKP A;  3PSF A;  1K78 A;  2WA0 A;  3S2W A;  4WK8 F;  1U78 A;  1HDD C;  3G3Z A;  3P9K A;  3ASN H;  1OR7 C;  3ELK A;  5LRR A;  1ZG5 A;  1RIO H;  3LL7 A;  2HTS A;  1MKM A;  5EEG A;  3MAJ A;  2UXN A;  4MNU A;  1APL C;  1AU7 A;  3CDL A;  1IV8 A;  4NQW A;  3N97 A;  2XRO A;  2YU3 A;  2QQB A;  5AIQ A;  4G94 A;  2M7A A;  2R5Z A;  4QPQ A;  4EJO A;  3AAF A;  4CZC A;  2FOK A;  5IYC J;  2RGV A;  3ZMU A;  5IYD J;  1Z3Y A;  2R7F A;  1JKP C;  3VSL A;  5E1W A;  3L9F A;  1GUU A;  1H9T A;  2M7B A;  3TO7 A;  3KYD B;  3GFI A;  2M3A A;  1BIB A;  4W1U A;  4OAZ A;  3U1D A;  4KN7 X;  4ANJ A;  5KK1 A;  1O4X A;  3C7J A;  1EH6 A;  2ME6 A;  3V7R A;  4HNV A;  2PJR A;  1W0U A;  2EV5 A;  3HJE A;  3ZGK A;  4DOZ A;  2QQA A;  3DCF A;  4DBQ A;  4XON A;  2DTR A;  3NAR A;  3RSN A;  4EJT A;  3BR5 A;  3FHN A;  2VKH A;  2QKM B;  3JRF A;  1YX5 A;  3UR3 C;  3FK7 A;  1IN8 A;  2V79 A;  2WY7 Q;  4HYE A;  2QM3 A;  3PQJ A;  2ZFW A;  3K70 C;  3MKL A;  3WGI A;  4RM2 A;  3I3L A;  2CQN A;  2K4B A;  3ZRG A;  4AVP A;  5M5Y J;  3CO6 C;  4HEA 2;  3MKW B;  4ZYA A;  2XF5 A;  3AG2 H;  2K02 A;  2VBW A;  4LGW A;  1RI7 A;  5E3N A;  3FIS A;  2HR3 A;  1P9Q C;  1WQ2 A;  1KQ8 A;  2M2E A;  2HOT A;  3S32 A;  2H1K A;  4RB0 A;  4M9S A;  3M8E A;  1BR4 A;  2XPV A;  3HYI A;  1R22 A;  4WWC A;  2O0Y A;  4F91 B;  1LQ1 A;  2KIF A;  4E6K G;  4E7L A;  1J59 A;  1TLH B;  1DGR M;  4F3Q A;  4ESJ A;  2DAO A;  4BJ5 C;  1O7F A;  3AG4 H;  2PN6 A;  4M3B A;  2K9Q A;  2M45 A;  4I76 A;  5HLG A;  1W0T A;  1LDD A;  2NS7 A;  4W97 A;  1IZ1 A;  4PSX A;  5HNH A;  4D9J A;  3ZQL A;  1K61 A;  4A3M J;  1BOA A;  1R58 A;  3CUQ B;  2HS5 A;  1XX5 A;  3I64 A;  2EFO A;  4CIC A;  2RVC A;  1V55 H;  3ABU A;  3E6B A;  1BJA A;  2DN0 A;  1R49 A;  1UFM A;  2R7U A;  1BI1 A;  2A6H F;  2Y2Z A;  3U2R A;  2QQ8 A;  3KFW X;  1OPC A;  4LIT A;  3CMY A;  1A5J A;  4BXF A;  3OIP A;  2GXG A;  1XSX A;  3QYE A;  4Y13 A;  4XK4 A;  2LMD A;  3UNG C;  2IS2 A;  4RGS A;  2IS4 A; 
#chains in the Genus database with same CATH homology
 1U0J A;  4XNF A;  2VKD A;  2VL8 A;  3TMO A;  2HVS A;  4BGD A;  4E7J A;  2VJI A;  3OS0 A;  3OS1 A;  3OYM A;  2LG4 A;  3KEY A;  1DP3 A;  4EAT A;  2FUG 2;  2CH0 A;  1G8X A;  5CQG A;  1D0Y A;  2DJI A;  2V26 A;  2ZXI A;  3DU5 A;  3VYR B;  2R7R A;  2CV2 A;  1YX3 A;  1X4P A;  3PJR A;  2R7O A;  3HKZ A;  4II2 A;  2W1O A;  1SFK A;  2UUZ A;  2BVL A;  1BR1 A;  4BQQ A;  2BW3 A;  3HOT A;  3HOS A;  3PNV A;  2KL4 A;  4CCJ A;  3EUK L;  2VIX A;  1LVK A;  2Z1D A;  4KIS A;  1FMW A;  2LY1 A;  1MW7 A;  4XLA A;  2KLO A;  2VAS A;  4QPO A;  3ONQ A;  3OS2 A;  4C2T A;  3L2W A;  2R7V A;  5LD2 C;  3L2V A;  3K4B A;  2F4I A;  4KIT B;  4ZJZ A;  4XKV A;  4E4H A;  3A4C A;  4XR6 A;  1TZL A;  2O5R A;  3NWS A;  3OYK A;  2R7T A;  2R7S A;  3NWT A;  3OYA A;  4Y33 A;  4NUB A;  3DKY A;  2F5V A;  4OAY A;  3M1C A;  3MD2 A;  4YEJ A;  1ERD A;  2OC6 A;  3K4L A;  1G59 A;  1UEL B;  3VSK A;  3H9J A;  4FAS D;  2K9M A;  5FRM A;  3VDX A;  1QHH D;  2HDW A;  2KZV A;  3HPH A;  4N4O B;  3S93 A;  4D1Q A;  4CCM A;  2GOM A;  3HPG A;  3CP2 A;  2V6E A;  1DQU A;  4LG3 A;  3LSG A;  3H9Q A;  4H4K C;  4AYB A;  3DPT A;  3PNT A;  3W2A A;  2L7K A;  1E0E A;  2X6W A;  3W2W A;  3L2R A;  4RM3 A;  5KNL A;  1QU3 A;  4KT6 A;  3LFU A;  3H5R A;  4XKW A;  3BG7 A;  1Y56 A;  3ZCO A;  4DGW B;  4BE2 A;  3KYL A;  3TL4 X;  2VXZ A;  2OUM A;  3QOE A;  4PSW A;  2L9N A;  2X6X A;  3HC7 A;  4P1W A;  5CPR B;  2NOJ B;  3M8J A;  4BEH A;  2WAF A;  4XOR A;  1NG6 A;  4IQ4 A;  2BW3 B;  2LBF A;  4XOT A;  3SYT A;  2LC2 A;  2ZXH A;  3LSM A;  3IAM 2;  3K4C A;  3RTR A;  4B48 A;  4B47 A;  2KMU A;  1X1A A;  1N77 A;  4DIQ A;  3DKX A;  4XN0 A;  4IQJ A;  4ZTJ A;  2E1M B;  4ITV A;  3FKJ A;  3ZR8 X;  4BDY A;  2LY2 A;  4CUG A;  3DPL C;  3AFH A;  1Z7L A;  4PJN A;  2CMP A;  3HL2 A;  1MNE A;  3PL8 A;  2MC4 A;  4NC8 A;  1WJC A;  2CS3 A;  1UAA A;  3CZ6 A;  2KRH A;  1EA3 A;  2IS1 A;  2VJ4 A;  3OL4 A;  1J09 A;  3HUG B;  3CJR B;  1WJ5 A;  3QYF A;  2W7N A;  3LMM A;  3PFY A;  3SDB A;  3DTI A;  3GBG A;  2CW8 A;  1Z3X A;  1D1A A;  2CV1 A;  3K4N A;  2R7X A;  3PNY A;  3PUB A;  3N05 A;  3VYS B;  4MLO A;  4F55 A;  5KCM A;  3OYL A;  2ZSH B;  3K10 A;  1OLT A;  2RRE A;  2JVG A;  3TBI A;  4U87 A;  1WJE A;  1WJF A;  3E1S A;  3J7A Y;  2MAB A;  2WY8 Q;  1R6R A;  4PFP A;  3OL3 A;  2M0M A;  4XMY A;  3CMM A;  4IKF A;  3MKY B;  2LRD A;  1N78 A;  4CCK A;  1IRX A;  3EUA A;  2E1M C;  4XLF A;  2JUG A;  4CSW A;  4B43 A;  2ZFU A;  2I8D A;  3H35 A;  4U7B A;  3BCA A;  2BOL A;  2WAD A;  4BEH B;  3K4M A;  2XSJ C;  4LIU A;  2IGK A;  4CCN A;  3S3N A;  2HNH A;  4RMN A;  3A2K A;  2IGO A;  3OIQ A;  4NC7 A;  2LBF B;  3IUO A;  4ZDL A;  2A6T A;  3OYB A;  4X0G A;  4XN3 A;  5CKT A;  1WJB A;  1WJA A;  1X19 A;  2M4K A;  2JA2 A;  4J01 A;  3K4K A;  4CH7 A;  3OYJ A;  3AL0 C;  2DOA A;  2LH9 A;  3K6G A;  3LSK A;  1X1B A;  4BE1 A;  2VQG A;  2LOO A;  4HG2 A;  4IZZ A;  4BQO A;  3C2H A;  2K3P A;  1T0F C;  4II3 A;  2V1N A;  4XLH A;  3OYE A;  1DGW Y;  3BLY A;  1SAU A;  2XC7 A;  3OY9 A;  2Y0S A;  3SEQ A;  2L5Q A;  4J00 A;  2ELJ A;  3H9G A;  4CCL A;  1LFP A;  2HPI A;  4E7I A;  5FRO A;  1WFX A;  2RNG A;  4BU2 A;  3DTK A;  2CW7 A;  3CP8 A;  3VYU B;  3W2V A;  5FRN A;  4Y4R A;  3D5R C;  2KHM A;  3I9V 2;  2IGM A;  3F9K A;  5HVQ C;  1HA8 A;  2P0W A;  3OR2 C;  3H5A A;  1GLN A;  1NG7 A;  5JHF A;  4RLF A;  2V9K A;  3BC8 A;  3L2U A;  1X4O A;  1MND A;  1KON A;  2E5N A;  2X1D A;  3D5S C;  1D1C A;  2F6C A;  2K9L A;  2X85 A;  2GOX B;  2ZSI B;  4HSR A;  5LFA A;  2VQL A;  4BDZ A;  2HPM A;  1FMV A;  2Z2S B;  4XOP A;  2HVR A;  4F92 B;  3S8P A;  2PMZ A;  5TGT A;  2A5W A;  4PUS A;  1X1C A;  4XQF A;  2KRC A;  4C30 A;  2VLA A;  4ZTF A;  4B3X A;  4DJA A;  3A1Y A;  4PFO A;  4AVZ A;  3FBI B;  3MMY B;  2E5Z A;  2AQE A;  1MMA A;  4JOM A;  2XDV A;  2JVH A;  3L2Q A;  2KP6 A;  4E7S A;  2X6Y A;  3EPZ A;  4XLE A;  4BJ6 C;  1PJR A;  1YE9 A;  4XL9 A;  2UV1 A;  2LRE A;  2VXD A;  3AL0 B;  1TT0 A;  2KQR A;  2Q1Z B;  2VJJ A;  1MMN A;  2WBM A;  4XKB A;  2CV0 A;  2V7F A;  3H5N A;  1D0X A;  3C2G A;  3DU6 A;  4RLQ A;  1JI8 A;  2X1E A;  1ZEL A;  4F52 A;  1D1B A;  2Q2E B;  4XM3 A;  2L2O A;  2XAU A;  3DWL E;  2R4G A;  2IS6 A;  3RCO A;  1V5E A;  1V5F A;  3U21 A;  2XF7 A;  3CF2 A;  4HNT A;  4BL0 B;  2VPL A;  4ZC3 A;  4F93 B;  4P5O A;  5KHD A;  2W00 A;  4HPQ A;  2MYS A;  4BE0 A;  1AA7 A;  3VYT B;  2HZD A;  4G6T B;  2MD0 A;  4FET A;  2BVM A;  1W36 D;  3HXL A;  1BOB A;  2KPM A;  3K70 D;  3OYH A;  1MMD A;  3S3O A;  1N75 A;  2DT7 B;  3CES A;  4HRI A;  4LIV A;  3ZQQ A;  2HVQ A;  1VZ0 A;  3V42 A;  1BR2 A;  3OYG A;  3PSF A;  4BJT A;  2WA0 A;  2CFO A;  2MFZ A;  3OYF A;  1OR7 C;  3OYI A;  3OWT A;  2DCE A;  3DQV C;  2R7Q A;  3CJQ B;  4ZDP A;  3LL7 A;  4CCO A;  3IP4 B;  2CUZ A;  3E0J B;  3H0D A;  4HST A;  3SEZ A;  4AU7 A;  2AQF A;  3BCB A;  2M7A A;  2Z16 A;  3DTE A;  3OMY A;  4QPQ A;  4CZC A;  1Z3Y A;  4BS9 A;  4BAC A;  3EUH C;  2CUJ A;  2WAE A;  3VSL A;  2L9S A;  3QOD A;  2M7B A;  2X1C A;  3OOU A;  2M3A A;  4CA0 A;  4YRV A;  4GRI A;  3IAS 2;  4KJZ A;  4OAZ A;  5HLT A;  2HQA A;  2IXS A;  1S9H A;  4ANJ A;  2DT6 A;  2PJR A;  4DBR A;  1X1D A;  2XF6 A;  3K4J A;  4PJM A;  3ZGK A;  4DOZ A;  4DBQ A;  2X51 A;  2VQH A;  2HU9 A;  4XON A;  3OYD A;  3RSN A;  3FHN A;  3QYB A;  2IGN A;  3ZXS A;  2VKH A;  3PSI A;  2QKM B;  1YX5 A;  2KDO A;  3UR3 C;  4N4N B;  3OYN A;  3FBN B;  1UG0 A;  2WY7 Q;  1T95 A;  3DPU A;  2DXI A;  4R79 A;  1W36 C;  2UWM A;  2R7W A;  3K70 C;  4BUP A;  4RM2 A;  3I3L A;  1K6Y A;  2WAQ A;  4HNU A;  2VJ5 A;  4E7H A;  3ZRG A;  4HEA 2;  3LSI A;  3D5L A;  4ZYA A;  3MKW B;  2JSP A;  4Y3O A;  2XF5 A;  4JQF A;  2V4J C;  4B44 A;  3SZG A;  1P9Q C;  2VQC A;  3DLA A;  3W3C A;  4OWR B;  3S32 A;  4PJJ A;  3LSH A;  3S3M A;  2W4S A;  1BR4 A;  3HG9 A;  1V5G A;  4IX7 A;  1LKX A;  4F91 B;  1MMG A;  4E6K G;  4E7L A;  1DGR M;  4F3Q A;  5HOO A;  4BJ5 C;  4ZDO A;  2M4G A;  3AKZ A;  1Y6I A;  4NNJ A;  3KX2 A;  3OR1 C;  4YEL A;  3OYC A;  4PJL A;  2E60 A;  4PSX A;  5HNH A;  4NQW B;  4D9J A;  3VWB A;  2K5C A;  2W82 A;  1QHG A;  4XLC A;  2OV7 A;  5CQE A;  2WB1 A;  4E7K A;  4E7Z A;  5HNF A;  1LDK B;  2R7U A;  3MKZ A;  3DEE A;  3BG6 A;  2VB6 A;  1Z21 A;  4LIT A;  3RQ4 A;  2PJR B;  4PK4 A;  1D0Z A;  3RPU D;  4BXF A;  3OIP A;  4C2U A;  4XKC A;  1WJD A;  3QYE A;  1PYV A;  3G2B A;  4C9Y A;  3FDY A;  2RQQ A;  4BQN A;  2LYC A;  3UNG C;  2QKL B;  2IS2 A;  2IS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...