4X0GA

Structure of bsg25a binding with dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
b'PMVTIGPNGTEVSRISLSAINWAMTGPSITRKLLCEIFDRDTLAHHTLSGKPSPAFRDCARPSKQQLDPLKVADLVYLMTNSCDMTPREVRTAITTKCADENKMLRSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blastoderm-specific gene 25A
publication title Common and distinct DNA-binding and regulatory activities of the BEN-solo transcription factor family.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein/dna
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10523 BEN BEN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4x0gA00
4X0GA 4IX7A
chains in the Genus database with same CATH superfamily
5B1BH 4NBQA 1RC9A 3M8FA 3TEDA 2HOSA 4D9JA 1YITI 2H1KA 2PG4A 3RPUA 2PJRB 3Q5FA 2X9DA 3L1PA 2V9PA 1U9NA 2ZSIB 5FKOA 1GVDA 5H2FC 2BGCA 1P4XA 4W97A 1T2KA 3E1SA 2EV6A 3RYPA 3K4NA 3L09A 2CUJA 1FY7A 1LKXA 3DCFA 3HTSB 2JRMA 2JWTA 2QZ8A 1ZAOA 5FO5A 2L9NA 3IRQA 2EB7A 2VODA 3RZOJ 1V4RA 2ZBKA 2DAOA 2KKOA 1ETVA 2X6OA 3W6JB 2IXSA 3EUHA 2WTEA 2XHKA 2NVUB 5GADJ 3HIFA 4B47A 4C3HJ 4KIFA 3RSNA 3FM5A 4HAMA 1Y1VJ 4JP0A 3OL4A 2I5UA 2BEOA 1VQMI 4M74A 2M5WA 1UHMA 5CVJA 3A4CA 1FJLA 2L7ZA 1P7JA 1XX5A 1MNEA 2ID6A 3NARA 1EH7A 4G9YA 5EEGA 1Y56A 5L3CA 1YHQI 2RVCA 4N0BA 2VKHA 4RM3A 4F7ZA 1JJ8C 1P2FA 2O6GE 1E17A 1RR7A 2HGCA 2OA4A 1VQ8I 3LFKA 2DQLA 3OL3A 5JHUA 1VTNC 1LDKB 1R5GA 3H36A 4GRIA 3J7ZI 2LREA 3O3KA 4CGZA 3OYNA 3ZQQA 2KFDA 5HVQC 4RAZA 1P4WA 3BZCA 3TBIA 3JRDA 4UVCA 2ZJ2A 1O4XA 3S2HJ 3TO6A 3F0CA 3HKZN 1Z77A 2IT0A 1HW1A 3PNYA 2IVMA 2R3SA 3V7RA 5D6FA 4MNUA 1IG7A 2OCCH 4FETA 5DM7F 4G6TB 4B1RA 1DQUA 3ASNH 2IS4A 4CCMA 2DOFA 1WSUA 3HPGA 4OINF 2VLAA 1N25A 5E17F 1B1BA 2EFWA 1ZRCA 4XL9A 2HR3A 3HSEA 1R23A 2X4HA 4PGGA 1Z05A 3TL4X 2BE5F 3PSFA 4N9IA 4AWXB 5K7FA 4FQGA 1XGNA 5D6EA 4A3KJ 3DKXA 3K2AA 2MC4A 3M8JA 1AWCA 3JRIA 2L4MA 1BM9A 4MGRA 4HG2A 4UV8A 4M3BA 5DS9A 1WJ5A 1JXSA 3QOEA 4P55A 3ZRGA 2LY2A 1W4MA 2YU9J 1CGPA 3BP8A 4UVBA 1X3WB 3OYCA 3WGHA 1WVRA 3EUHC 1K6OA 3IL2A 4ZYDA 2BVMA 1K7AA 1R5HA 1SMTA 1YIJI 3WHBA 2AXLA 4C2UA 4UXNA 1TW2A 2R7TA 4FE4A 1GLNA 2LSOA 4GXOA 4MTDA 3HEFA 4DW6A 2PMUA 2K9SA 5TRDA 3WTUC 1FLIA 1ZR4A 2EA4A 2MLKA 3H3ZA 3ZMVA 1SFUA 1X1AA 5KVRA 4IHXA 2JA2A 4DGWB 4LK1F 5K5OA 3SZGA 3A2KA 4ZYAA 4D5CA 2XUBA 3LSPA 3I0TA 2QKMB 1OR7A 4AU7A 3GLXA 2ISZA 2XF5A 4L5EA 4Z6YA 1JGSA 2KZGA 2CJJA 2F5VA 3U21A 2EPFA 2DO7A 5F64A 3CMYA 2DMQA 4J19A 3MVPA 1HDDC 3FK6A 3PJRA 1QBJA 1KQ9A 1RR8C 5JI6A 1R6RA 3S15J 2EFQA 1X1PA 4LLLA 1OFCX 2DA2A 1ZG1A 1JJ6C 3U2RA 4C9YA 2ELJA 2Y0SN 1IN8A 2K4BA 3LQRA 5IP6A 1T08B 3T8RA 4B3AA 1V5GA 2LP0A 2YUSA 2K27A 3HRUA 1APLC 1TWHJ 1ONVA 1TZLA 1TTYA 4U88A 4DIQA 2MSYA 1USTA 2OPTA 2FX0A 1VI0A 3BCBA 3RYRA 3CP8A 1WQ2A 3MZ8A 5DM6F 3LSJA 2AS5F 3I54A 4LJZF 2RV8A 3W6KB 4F92B 5EDNA 3O2PE 2KJCA 3HOSA 1I39A 2R4GA 3CMEI 3F6OA 4KUMA 2KMUA 4Q48A 2XC7A 4PJ0C 3C2BA 2ID3A 1U6GA 2DU9A 4TV7A 5J40A 1POGA 3KP6A 2BZTA 1S9HA 1ZN2A 3WE2A 3I64A 3TDZC 3GTPJ 2R93J 5J8CA 1FP1D 2JRTA 4U7DA 4BJTA 2KIQA 4CUGA 1ETYA 1BC7C 2XROA 1R5ID 2VIXA 3L2WA 2HI3A 5LFAA 1T56A 1LUJB 1GVJA 1TLHB 2DDBA 3M1CA 5EZHA 2L5QA 2LRDA 3F8FA 3TQNA 2YPRA 4DOZA 2F5CA 3RTRA 1Z0XA 3MFKA 3K2ZA 4A5MA 4A3EJ 4LD5A 4AIDA 3COAC 1QU3A 2Q8KA 2FXAA 1E3HA 4ZDLA 3PNVA 3MKWB 1UMQA 4PFOA 3CDIA 3ESWB 3LMMA 2FA5A 2HDDA 1HC8A 4PCQA 5E1XA 3OYBA 1JKPC 4II2A 4M73A 1Y0UA 1MBGA 4JQFA 1IN4A 4Y15A 2PLYA 1B6AA 4WK8F 4KIGA 4IKFA 2EFOA 3C2HA 3BZKA 3ERMA 5BOXA 3SJMA 2VI6A 2FBHA 4AUXA 3KIOA 1O3SA 2IGKA 5JVGF 2TRTA 1ZQ3P 3DEWA 4J01A 1I6HJ 4UNOA 1GV5A 3TOAA 2EFPA 2VN2A 5F1JA 2H94A 1BR4A 2WAEA 3FIWA 4KJZA 4A93J 1CQTA 3AL0B 5IYDJ 4I2OA 3H0GJ 5HLIA 3PIPF 1OCZH 2RQPA 4IJAA 3GX4X 3KP3A 2WWYA 1VF9A 3M1EA 2QYOA 4A3BJ 1MNDA 5M3MJ 2VJIA 2HS5A 4XKBA 3KZIC 1QZYA 2FEZA 2L9SA 2ZKZA 5H20A 3N97A 2NXNB 2XF7A 3L00A 2D1VA 2V1NA 2L0KA 3QRFF 1QA6A 3FMQA 1LDJA 5TISC 1ACIA 4B44A 2P5LC 4BL0B 3CF2A 5JHFA 3OIOA 1OYWA 3EQLF 3K70D 2W48A 4ZYEA 4IRIA 3QPLA 2PFBA 2EFNA 2VT2A 2ZFWA 1IRFA 3AFHA 1KYWA 1Y8QB 3GTJJ 3TOBA 3ZGKA 4RS8A 2EV5A 4HF0A 5CJ9A 4HX7A 3QU3A 5M5WJ 2L4AA 1LPQA 2V6EA 3OYKA 1O7LA 2HTJA 4M72A 1B9NA 2BXZA 4O5VA 5J1UA 3FBNB 1TWFJ 2K86A 1YG2A 5LEJA 3HM5A 1UCRA 2K85A 2R7FA 3K4MA 3Q3SA 4D7MA 2EQRA 4EMSA 1ZKGA 1JTYA 2NYXA 1YX5A 4BY7J 3OYAA 3S1MJ 3MKYB 1VFCA 4XLPF 2GQQA 4CCLA 4DBQA 5KK1A 1I27A 5IP7J 5KHDA 4QSHA 1JHFA 2VKDA 1XSXA 5FGMA 1T8IA 3ZOBA 4BHCA 3WGIA 3GTQJ 3IKVA 1E3PA 2L54A 3C2GA 4NB5A 2A69F 1Z6RA 4M9ZA 4OMYA 2JZYA 3DWLE 1VQ9I 1D8KA 2Y0MA 3J7AY 2M9HA 5CKTA 5E18F 1ZRDA 1HOMA 3LFUA 3OOUA 1LFPA 3T8TA 3Q9SA 4LITA 3TO7A 5IT9K 2DA5A 3ECHA 3JTHA 1XMAA 1QPIA 2CQKA 1OCTC 3VDXA 4XRSG 4A3CJ 3FXQA 3H9GA 2LLKA 2XVCA 3OMYA 3WTZA 1P6RA 3HTUA 2P8TA 2R7QA 1OISA 2A3SA 3JREA 2STWA 4WWCA 2DT6A 3R60A 3ZMDA 1BOAA 1SD7A 3BG6A 4A3MJ 2PMZA 2QQBA 3ABTA 1YO5C 1T38A 5E8GA 3KEYA 1J59A 4GFBA 1ZG5A 1LEBA 3GYHX 1ZARA 2JT1A 2MGQA 5IT9Z 3WTTC 2LKSA 3E6BA 3R0JA 1GXPA 2CQ7A 4BS9A 4PSXA 2GM4A 3VEPA 3JCUC 3RI4A 2OBPA 1D0YA 1UG2A 4I0AA 4HF2A 3I4NJ 2ECBA 2XGEA 3S2DJ 1F4KA 3LQQA 3KETA 2AO9A 3JSOA 1I1GA 5J47A 4GCVA 4CO8A 1J0RA 2IJLA 5E20A 1G8XA 3F8CA 3BTIA 4CYDA 1O3QA 1FBUA 4ENKA 3K9TA 4BE1A 3CTAA 3GUDA 4MO7A 3RJPA 3CO7C 5J6XA 3RIRA 1V5EA 1U3EM 3ZMTA 3C7JA 1DUXC 1LB2A 1X1DA 1W0TA 3RPUD 4HSRA 5K5QA 1JHHA 2RGVA 5ICCA 1IV6A 2HYFA 3SFIA 5CLSA 2A07F 4HX8A 2W1OA 3UR3C 3GTGJ 2CW0F 1KQ8A 2XAQA 4A0YA 1XMKA 5HLHA 2VPRA 1UFMA 2W85A 4XONA 3PQKA 5B66C 3FBIB 2GZWA 2BV6A 2FD5A 3LA7A 4L9TA 4DYRA 3SZTA 5JVTA 1ZH5A 2GAUA 1OYYA 3KLNA 4G8XA 2BHYA 3DEUA 4BBRJ 4BU2A 1G3SA 2WC2A 3ZCOA 5HS9A 5D5WB 4BHBA 1G3TA 1HQCA 5LGUA 2P0WA 1Z3YA 4UB6C 1TBXA 5FD6A 4M3DA 3OSGA 5H6RA 4A5NA 2VJ5A 4KDPA 2EIMH 4CA0A 1JTXA 1KONA 5BQTA 2W24A 2MC3A 1DPRA 4ENJA 5L3DA 3S1NJ 3V8LA 1X3ZB 5DDGA 1OJLA 1GDTA 1NK3P 2WADA 3HL2A 3HRMA 5E8IA 5EG0A 1TW3A 2HQ5A 3I56I 1YS7A 2O7OA 1IV8A 2IEKA 5D4SA 1NTCA 3EUKL 4KITB 2ZMEA 1JT6A 5FROA 3ZP5A 2HOTA 4FCYA 3OYLA 4HLXA 4A0XA 5DUKA 5AIPA 1ETXA 3T0YA 1NHAA 1SVLA 3WG7H 3VWBA 1ON2A 2PEXA 1DU6A 5C3EJ 2IP2A 3PM1A 3LSGA 4EATA 3SQNA 1G3WA 2AXTC 1ZGWA 4BAYA 2RAEA 3HOUJ 1MMSA 4RLFA 3BPXA 3GXOA 2HQAA 4LIVA 1MMNA 3HGGA 4AVZA 3PO3J 4JOMA 5JFRA 2JUGA 1BIBA 3H3VK 4B3XA 3ZMSA 5EYRA 5TJJA 5FFXA 1EH6A 4BJ6C 2E1MC 3FXRA 4L9VA 1MNMC 3HOVJ 2QKLB 1OKRA 2O3FA 3QWLA 3F3XA 3QOPA 3HC7A 4CZCA 3PO2J 5GTIC 2P7CB 2E1MB 4OIRF 1MJAA 2X6YA 5EF6A 3M9AA 2E19A 2Y9ZA 2JVGA 4HQEA 3BG7A 2RN7A 2DMPA 1BN5A 2IGNA 1TNTA 2RREA 1YI2I 1MJ9A 3BR5A 1VQLI 3S17J 3S1QJ 5HODA 2MLGA 2A6TA 3TMOA 1PUEE 4ZDOA 1FSHA 2LG4A 1UHSA 1I50J 1DP7P 3RKXA 3RKYA 1X4PA 2CYYA 2IS6A 2NS8A 4PK4A 5LRRA 5J1YA 4IQJA 2FJ1A 1B59A 3GZ6A 2CO5A 3BLYA 4RGSA 1YX3A 4A69C 3A0HC 3EYIA 4V2FA 1WJDA 4ENNA 1XDUA 1YS6A 3WGGA 4CH7A 2CW8A 1KU3A 1R22A 2R7ZJ 2LOOA 2D1HA 1EV7A 1B9MA 2ZMEC 3CMMA 5EG0B 5KAFC 3QQAA 3IH2A 2K40A 2B63J 1MKMA 5IT3A 1XSDA 4N4NB 1IRXA 5EGOA 2I8DA 2ZMEB 3OYHA 3F9KA 1D0XA 3FXLA 3V4GA 4ABZA 1A04A 2W00A 2X0LA 3HJEA 4EJTA 1SD6A 3QPTA 1K6YA 4LGWA 3REOA 4P9FA 1H9TA 2BXYA 1HBXG 4O3MA 3SEQA 2H6BA 2E7WA 2KDOA 5BNGA 4EM0B 3Q0UA 1TWGJ 2YSRA 1X1BA 3PUFA 4RGUA 3LAPA 2P7VB 5J4YA 4BNCA 1IN5A 1VQ7I 1PUFA 4UV9A 1YW9A 2G7UA 3D5SC 1T98A 2PMZN 4XLCA 1YIOA 4LMYA 5EEHA 2KZVA 5K7HA 2HKXA 1FIPA 3DEEA 3DLLF 1QNTA 3F8BA 2HDCA 3ROUA 1DPUA 1OCCH 2XRNA 1LE8A 1H8AC 2HVSA 1UZCA 3OSFA 1X58A 1ON1A 3KYLA 1ZR2A 1FZPB 3BT9A 1K78A 1IUFA 4XSZF 2QQ8A 5L3BA 2NS0A 3DKWA 5GTHC 3PNTA 1T33A 1G4DA 1FBSA 2IW5A 4IHWA 4EV0A 2KRFA 4IHVA 4A3DJ 1XD7A 1BJAA 2HOEA 4ESJA 3TGNA 1BI0A 4S0HB 2V1UA 4M6VA 5M5YJ 2QBYA 2EA2A 4OU0A 2EZKA 1N77A 2JA7J 1MBEA 3TP3A 1STZA 5LEKA 1ZGAA 1MSFC 3WU2C 4BACA 4KN7X 4YG2F 5L3FA 3IH3A 2O9LA 1MIJA 4WX9A 2M8GX 2ME0A 3E5QA 3BC8A 3LSIA 1REPC 3ULQB 3VB2A 4EGZA 1B4AA 1MDMA 2B7EA 2QGUA 2DODA 1ZHFA 2HOAA 3F8NA 3P9IA 4GO1A 2IGOA 3CQZJ 2CFXA 1WFXA 3HOYJ 1W36D 5H6QA 4I0BA 4DYCA 1IO2A 3GMEA 4WF2A 3EYYA 4XBFA 2LBFA 4ANJA 5EGOB 3E5UA 4UUTA 1Y39A 2IA2A 3S3OA 4FTHA 1ENHA 3A0BC 1U8BA 5ILSA 2XSDC 2KP6A 5KCMA 4ZTJA 3JR9A 1U8RA 3BR3A 2BHZA 4WXDA 5CQEA 4E7SA 1A35A 4HV5A 5FRMA 5F1RA 1IF1A 3BROA 4UVAA 4A2UA 3DFGA 1PUFB 3BY6A 2RNJA 1XS9A 3O8HA 5D4RA 3UNGC 2NNYA 4BJ5C 2VC0A 4AIKA 3FISA 4OIQF 3IAS2 5AIQA 2JMWA 3K1PA 3R6SA 4IEJA 4QLCU 2NOGA 3H5AA 4OIPF 1LE8B 1T39A 2E5NA 4L5JA 4IF4A 3D0SA 1FYKA 2MD5A 1W0UA 1ZELA 5D5UB 1K78B 5FB2A 4EJOA 3VFZA 2ELHA 4E7JA 1I6XA 4IL6C 3P9CA 2LR8A 5FFZA 3OV8A 3WHCA 4BEHA 4DZPA 1A6QA 3FXMA 1HCRA 1F1ZA 1GXQA 2VB6A 1SAUA 1IAWA 1XDSA 2DT7B 5JR3A 2ELKA 1ULYA 3TDUC 2QUFA 2MYSA 4ZC3A 5E3NA 2QBYB 4BKXA 1YE9A 2YR2A 3N05A 2V7FA 4U0YA 2R7VA 3H9QA 3GZ5A 1DGRM 4HSTA 3M4OJ 1TQIA 2DOEA 3BWGA 1MMGA 2WA0A 4MHGA 3BR1A 1YFHA 1BW5A 3OYJA 3FX3A 5KNLA 3IV5A 3KEOA 4FE7A 1MDMB 4A6EA 3GO5A 4I99C 1I3AA 4BH9A 1R36A 1QRYA 1J5YA 4DNCA 4MFEA 2QSHX 4PFPA 2M4KA 3L2VA 4BXXJ 2EJRA 4G6QA 3ZR8X 2KDZA 1BR1A 3DPUA 4F55A 1SEUA 2HYJA 2R7SA 5DEQA 3FMSA 5EEAA 1XTAA 2BYVE 2GIZA 4XOPA 2FSWA 2LBFB 3GFLA 1FBQA 4RAFA 1V55H 4XKWA 1VQ6I 4PDKA 4N4OB 2JSPA 5HS8A 2LDUA 2HEOA 2GIVA 2MBFA 1D3YA 5FKKA 4WXCA 4UUSA 2XPUA 1WH7A 2MG4A 3GZNB 4OMZA 5LHHA 1D1AA 4M71A 1KU2A 4NDLA 1KU7A 2VOOA 1E3OC 1QZEA 1SFKA 1MMAA 3FF5A 4LFUA 4NQWA 3V42A 1PP7U 2FUG2 1H0MA 4XIDA 2VL8A 5HLGA 3SYTA 3CESA 1U5TC 2BY3A 2PMHA 2STTA 3KZZA 3I59A 4P9UA 2XRLA 2DJNA 1HDPA 1WI9A 1J7KA 1S7EA 4EEFG 4EM1A 4OWRB 1PYVA 5J8FA 1PVEA 2XGCA 4IHTA 5CVUA 1HSJA 2DBBA 4XLNF 2TCTA 3HRSA 3BTJA 1XC5A 4L18B 2DFEA 2HVRA 1OQYA 4AC0A 5FRNA 4N9HA 2X85A 2HZTA 4M3EA 4XRMA 4BEHB 4ESBA 1Z6TA 4X6AJ 2X1EA 2DDAA 3KZYA 4XN0A 1OYIA 3HSRA 2O8XA 3SDGA 4WXHA 4Q4ZF 4KIBA 1AU7A 1WI3A 2OZ6A 2XB0X 2VASA 1H89C 3CUQA 1S5LC 2HXIA 2HVQA 5CYVA 2AQEA 3D1NI 2E2HJ 2OQRA 1HW5A 2Q1ZB 4IOCF 1XPXA 1WHUA 4I02A 2HKOA 4F3QA 1NG6A 2X6XA 4YIFA 4L9JA 1RUOA 4IOAF 1XGMA 3KP2A 3KX2A 2DA1A 4M9SA 3Q9VA 5F0FA 1R9TJ 5B1AH 2RKHA 3SXYA 2L3DA 3E3VA 2CW7A 3F72A 3VSKA 4C2MJ 3L7WA 1HKTA 2FE3A 3CCEI 3B6AA 2QEXI 5FD5A 2LK2A 5CVIA 3E97A 2NRAC 5EZGA 4HPQA 3C1DA 1NK2P 3CUOA 1QHGA 3SZPA 2CQNA 3DTKA 3IP4B 3QP5A 4XR6A 5A2QK 2VONA 1OPCA 3RQIA 2JQ7A 2H8RA 3CCUI 1O3TA 2XAFA 4UUSB 3A03A 3EETA 4KNYA 3JRBA 2Y30A 4NUBA 1XMXA 1GUUA 2KLOA 4NQWB 3CC4I 2HU9A 5DYMA 2BVLA 1JKOC 3LA3A 9ANTA 4I6ZA 3FDYA 2Y48A 4U0VA 1RRJA 3I59B 2YX4A 2G9WA 2LD5A 2ESHA 1W1WE 1D5VA 2OTJI 2VJJA 2WAQA 4IPAA 3G3ZA 1SAXA 3I55I 3RKWA 1IUYA 4JK1X 2LNBA 5A2QZ 2JA8J 2LVSA 3EUAA 4RAYA 1BIAA 4FX0A 4LOCA 3K4JA 4RDUA 2L7KA 1ZRFA 2XAHA 2E1NA 3W3CA 2O8KA 3FM3A 3FXKA 4II3A 3CUQC 2MA3A 4JYKA 2KIUA 4E7IA 4NC8A 3HDDA 3KLOA 3LSMA 5CVVA 2LTPA 1XN7A 1S8NA 2BY1A 3CUQB 5DUIA 3J81K 3OYGA 3T5XA 1FNNA 4LLNA 2Q2EA 3CDHA 4AVPA 2IS2A 3MCZA 4Y3OA 2VQLA 4HNUA 1YJ9I 4EVIA 1IXCA 2R5ZA 1B8IA 2VBXA 4XRFA 1IXSB 4RM2A 1Z67A 1A31A 3BOQA 5HLTA 3U9GA 3NEUA 5DTDA 1TNSA 1H9GA 2OD5A 2DOAA 3KP4A 2DPDA 3WTYC 4CICA 2A6HF 3A02A 3PUBA 4QPOA 3J81Z 2XKPA 4CZZA 2XGXA 1WH5A 4LG0A 2Z99A 2K9MA 3G73A 3ECOA 3GFMA 3LSKA 2XSJC 3HPHA 2Z33A 3RDIA 4KT5C 2Z16A 3R0AA 3BTCA 5J3LA 3G2BA 4JX6A 4BQOA 4P96A 4IO9F 2M8EA 1D5YA 2Z5UA 4LB6B 3I58A 2W82A 1KYZA 1BOBA 3DU6A 5HDKA 2W25A 4YIRX 3PL8A 1B72A 2JPCA 3K1NA 3GFIA 4A3GJ 2FMYA 4HX4A 1S29A 1Z21A 3C3WA 4XKVA 2HPIA 3KFWX 4M3FA 4A3FJ 1G3YA 2IA0A 4G94A 1P4AA 2JPBA 4S04A 3CC7I 2ISYA 2G7HA 3OIQA 1KU9A 2QSFX 2RQQA 4NHJA 2JUCA 1D8JA 1RESA 4AD9A 4HDUA 3NRVA 2EWNA 2Z3YA 4I09A 2YS9A 2W57A 2M0MA 2ZXJA 1LDDA 3MKLA 3ABKH 3K10A 1LQ1A 1HLVA 2LH9A 2F4IA 3HOWJ 1FIAA 2DJIA 2LY1A 5K1YA 2K9LA 1K4SA 1FT9A 3GW2A 3NWSA 2EIJH 5EJCA 2Q2EB 1M1EB 3DPTA 1JUMA 4HW0A 3M7GA 1X1CA 2MW8A 1KQ0A 4ZZDA 2M34A 2UZKA 2A5YB 1FOWA 2R5ZB 1B8IB 4DZJA 2M1BA 3L2QA 1I5ZA 3L2UA 4XKCA 3ML6A 2FNPA 1MMDA 1XGOA 3KYCB 4BBSJ 3DXJF 3J7AO 4XM3A 3HHGA 1PP8F 2JA5J 4IQ4A 2JK3A 2R7DA 2E7XA 2KISA 5AONA 2ZNYA 1KA8A 2XAGA 5JLXA 2QA4I 4RAGA 3PIOF 4LG0B 1D1CA 2WY8Q 1FWZA 1K83J 1QQIA 3E6MA 4Q47A 3K4KA 4XSXF 2P81A 1YYVA 2QM3A 3DBLB 4E6KG 2CWEA 3E6DA 1YJWI 4ZYHA 3IUOA 5CPRB 5D8LB 2DW4A 1U0JA 1FMVA 5HNHA 2OU2A 2ZJPF 1LFUP 2CH0A 2FQ4A 4CCNA 2UUZA 5D8KB 2Z9OA 1WWXA 1B72B 1ITYA 1JI8A 3X2QH 3CJRB 4R8HA 4BY1J 4AYBN 1Q1VA 3CJTB 3RPQA 1DGWY 3ZQLA 4KA4A 3O8GA 3OS0A 3WTSC 3HUGA 2VE8A 2CU7A 4EGYA 1WPKA 1QVTA 2IGMA 3ONQA 1R58A 1SFEA 3ZMZA 1W5CC 2GLOA 5IP9J 3BG9A 3LSRA 2P6TA 1A6IA 3M8EA 1Y0NA 3FKJA 2ZSHB 3GWZA 2WB1A 3BCAA 3CDLA 1ZTRA 3BR0A 4JX4A 3QP6A 5GAGJ 1S7AA 3KPHA 4YFNF 3L2RA 2K9NA 2MABA 2HQRA 1R1UA 2V4JC 3FXJA 4BE0A 1BBYA 4C3JJ 2D5VA 4DYQA 1TQMA 1SVMA 1U9OA 1SFXA 2GXAA 3CCSI 2E35A 5E3MA 4HA8A 2XPVA 2CMPA 3BQYA 2EH3A 2H8WA 4CDGA 1RUNA 1GHCA 3LNQA 3BTLA 3LOCA 1SC7A 1IDZA 3MZYA 1FYMA 3FHZA 2VBWA 2WAQN 2CRGA 4IXAA 2E36A 1OCRH 2EV0A 2L9VA 4P5OA 3CCLI 3IAM2 3CZ6A 2FOWA 3VYTB 3H92A 4F52A 5ICEA 4XOTA 4P1WA 4G7OF 1G2HA 4XLEA 3G6EI 1R71A 3O6BB 5LD2C 1HKSA 2DCEA 2HYGD 5IPAA 1YLFA 1HKQA 1UG0A 3BDDA 1D1BA 4OAZA 5GPCA 4E7LA 3S1RJ 2LF8A 3F6VA 3SHFA 4G7ZF 4NNJA 2TDXA 2DPUA 1EA3A 2LF7A 2IBDA 4RA2A 2HZDA 2KPMA 3LL7A 1HSTA 1R1VA 4A0ZA 2PBIA 1QHHD 2DMTA 2FOKA 4I7HA 1FPQA 5ERIA 2GOMA 5KAIC 2VBZA 2B9SA 5ILVA 3I71A 2ADUA 1FTZA 1MBHA 1W7PA 3V8JA 2DA4A 3TO9A 4PUSA 3ZQGA 4MIMA 1MH3A 2MFZA 1TP4A 5L3GA 2UXXA 3ABUA 1R1TA 2GA1A 2BY0A 3FKIJ 2CV1A 4ZH4F 2LKXA 1EF4A 3HUGB 3BQZA 3G1MA 2O0YA 3ZQ7A 2ICWG 1Z9CA 2O61A 4M6YA 3H35A 5IYBJ 1X3UA 4MQ9F 3CF5F 3ZMUA 5M5XJ 4G7HF 4ITVA 1P92A 3E5XA 3K70C 1OLTA 4YEJA 5LBQA 4YFXF 2DQRA 3ZQCA 2PI0A 1GT0C 1ZK8A 2EZHA 1X2MA 1FOYA 1TQPA 2BBYA 5F0HA 1ZGJA 5FJ8J 2EZLA 4B8XA 3OYIA 4OOIA 3FXUA 4GDFA 2VQCA 1S6LA 3T1BA 4RBOA 3S14J 4B09A 1VQPI 2EZIA 2A5WA 4D7NA 4XQFA 1TWAJ 4CHUA 2GXGA 3DTIA 1VQKI 4CXFA 1SD4A 4MTEA 4QPQA 2E2IJ 3K4BA 3BJOA 1JKQC 4KYWA 3DBRB 4D5FA 3LWFA 4FX4A 5LHGA 1EH8A 5C44J 3JRHA 2IS1A 2ZNZA 4GYIA 3WTVC 2QSGX 2L01A 2M45A 4D0PA 3VYUB 1O7FA 2CUZA 1G6NA 4O6JA 4EJUA 4H4KC 2B0LA 3DLAA 2O03A 1ODDA 1AA7A 4XMYA 4XK4A 1WCMJ 2GWRA 3BJ6A 3AAFA 1TC3C 4BDZA 1J75A 1ORKA 3GBGA 3DF8A 3A01A 1W7PB 5ILUA 2QQAA 3L9FA 4GGGA 3N4MA 3I3LA 2ESNA 2Y75A 1Z1DA 1XGSA 2LY9A 3H1CA 1S72I 1TT0A 2ECCA 4LG3A 3FWEA 3CLOA 2ZB9A 2Q0OA 2YX7A 3HGYA 1UAAA 1WJBA 2R5YA 1MSEC 2GA2A 3ISPA 3LSHA 1E0EA 2KIFA 2XIGA 4IRGA 2DTRA 3K1MA 3VPRA 2F6CA 2CG4A 3G1LA 4ZDPA 3JRAA 2XGDA 1L0OC 1QPMA 4IVNA 3ABLH 2UV1A 4GYGA 3SDBA 3E7LA 4A3IJ 4BQAA 3CP2A 3ZQFA 4G6DA 3WE3A 3HOZJ 1UHWA 4W1UA 3GTOJ 4AM3A 4FASD 1A36A 2YU3A 4KICA 1R00A 2G0EA 4CYCA 4CCOA 2K02A 4ON0A 3K0LA 3G4SI 1K61A 1T6SA 1SANA 1JT0A 1YJNI 3H9JA 1YTYA 2DFIA 2W4SA 2GOXB 2K3PA 2FBIA 3BPVA 4PSWA 4ZYGA 4S05A 3D5LA 4U87A 1XCVA 3VOEA 2L7FP 2EILH 3K4LA 2M0CA 2JA6J 4Y52J 1U5TA 3PQJA 5CVRA 3JSPA 4CCKA 3EPZA 5C4JJ 1VQOI 2GXBA 1VNDA 2NAZA 3GFJA 2E1CA 2KIMA 5LRSA 4QTRA 2F4MB 2ZO4A 1HW2A 4I76A 2E5ZA 3G1OA 3HBLA 2IPQX 5CQGA 5L3EA 1W5SA 2WB1N 4E7KA 2AHQA 2GBYA 2E1OA 3KCCA 3JTGA 1RETA 4L5IA 4L0ZB 2QENA 3WODF 2DA6A 2R7WA 2D45A 1RZ4A 2VKEA 1MGTA 2OCEA 3S8PA 4XORA 1R4MB 3A01B 2M30A 2WY7Q 1F43A 2HWVA 4ETSA 2OJED 3P9KA 4KMUX 4MFDA 3TKYA 3F8MA 4A6DA 4HYEA 4BXFA 3K6GA 1PDNC 2DK5A 1F9NA 5LGNA 1R7JA 4E7HA 2DYSH 2MD0A 4XLAA 3IH4A 1RNLA 2A61A 2R5YB 1TT5B 4RB1A 1BL0A 3ZQHA 1XB4A 2F48A 3DPLC 1Q1HA 2M7AA 4BE2A 4D1QA 1KZHA 5ED4A 3NWTA 3RKQA 1N75A 1F36A 1AKHA 3LSTA 4IZZA 5C4XJ 3S3MA 3ZPLA 3GVAA 4I98B 1FOKA 3MWMA 2HNHA 4HDVA 1Z91A 4J00A 1S7OA 2X1DA 4CYCB 2W7NA 2XF6A 3BR6A 1YRNA 4V19K 3OWTA 2XB5A 1IC8A 2NVTJ 2J5PA 2P6SA 2VQHA 4HQMA 1O3RA 3HOTA 3VSLA 3QYBA 4BYYA 2PX9A 5J1RA 4RB0A 2XV4S 4LIUA 2KRCA 2K7LA 2WBMA 3MD2A 1ETQA 3FK7A 1I1SA 3ZN1A 5IOZA 1U5TB 2V6CA 2ZC2A 2VT3A 5LLQA 3OYFA 3JW4A 1WJAA 2EIKH 3AG2H 2L02A 1N78A 3IKTA 2A05A 3GTLJ 1HA8A 2LFBA 2EK5A 4MLOA 2KL4A 3TW7A 3F23A 2ZCWA 2R7RA 4XNFA 4M3GA 2ZXIA 2H27A 1DU0A 2R92J 3S16J 2CS3A 1QO0D 2OAZA 4HV6A 2F5FA 3ELKA 1SD5A 1JKRC 5E1WA 4RGXA 1MJBA 5FLMJ 3CCYA 3E0JB 2F2EA 1R4NB 1JUPA 4H0EA 3EDPA 4AYBA 4KISA 2VPLA 3TW6A 2VC1A 1QZZA 4UHTA 2ME6A 4Y7NJ 3V7SA 4L0YB 1WRJA 2F5EA 3I9V2 1ERDA 5DD4A 3HB9A 2PJPA 1YQAA 2X1CA 2J5OA 1RI7A 1IXRC 2RNGA 2E2JJ 1OR7C 1P7IA 2IRFG 1AKHB 3CCJI 2Y69H 3JRFA 2K4JA 3CJQB 2DA7A 1Y6IA 4PZJA 1KGSA 3MAJA 5K5RA 2P5VA 5FKLA 3AG4H 5FLXK 2Y9YA 4R1HA 1YRNB 1MH4A 4PJJA 2DT5A 2N8GA 2R0QC 4OIOF 2HDWA 2VQGA 3CO6C 3GCMA 3QYFA 3FMRA 1I3QJ 5IY5H 2MH2A 1UELB 1WGXA 4AIJA 3S3NA 3M07A 1IDYA 3BR2A 5TGTA 4NC6A 3Q0WA 4ENMA 3K4CA 1X4OA 5F04A 2F5DA 3KE2A 5FKNA 2K5CA 2VBYA 1IN7A 5D5VB 2V9VA 3PFIA 4RLQA 4DBRA 4R79A 3AG1H 1BI1A 3RCOA 3AL0C 4K2EA 1BC8C 5FLXZ 4M9XA 2LC2A 3B6CA 5LGTA 2RDPA 3DU5A 2NVQJ 2XAUA 1YOVB 2OF7A 1ETKA 2XDVA 3W2VA 1OCOH 2DA3A 3P7NA 4E70A 3KP7A 3OYEA 1LVKA 1J9IA 3W6VA 5GP9A 2CQXA 4UB8C 5BPIA 3WTWC 1EKEA 4U7BA 2UWMA 2DYRH 3E6CC 4A12A 4HNVA 4C2TA 1MZBA 3S32A 5HOOA 1IZ1A 2ZXWH 3MEXA 3Q0VA 4NC7A 1J2XA 1WJEA 2VUMJ 1XG1A 2KT0A 1A5JA 1LNWA 3OIPA 2K9QA 3GLLA 3HRTA 4ZTFA 4F93B 1HF0A 5GPAA 3QU6A 4Y17A 1MBFA 2M87A 4B4CA 1IGNA 1ZLJA 2DK8A 1ZREA 1ETOA 1VZ0A 3OR1C 2L2OA 4MEYF 2PQ8A 4PJLA 3I4MJ 3GTMJ 3AG3H 1V3FA 4G12A 1RIOH 2CGPA 2OUMA 2E34A 1LFBA 2DN0A 3HHHA 4PJNA 3WU0A 2V26A 2CV0A 4E7ZA 2DMNA 3JRCA 5B5EC 2FBKA 2V1DA 2HQNA 2H09A 3J80K 1CF7A 1W36C 4QWQA 3R4KA 3DTEA 3QODA 4EM2A 4HNTA 3WG9A 4PJMA 2JJ7A 1K79A 1FX7A 2RC4A 4FHTA 1SFOJ 3F21A 3CCQI 2VJ4A 4UY8I 1NG7A 5GAEJ 3VYRB 4IHYA 3DV8A 1MBJA 2QWWA 3TP0A 1LEAA 1TWCJ 3HOXJ 1NH3A 3FHNA 4L9NA 2M7BA 3WTXC 3GF2A 1G59A 1FC3A 2ZXHA 4B43A 2OTLI 3LA2A 1RKWA 5DCMA 1U78A 5DD8A 3QPHA 2CQQA 4EJVA 1J09A 3MQ0A 4Q5SF 3J80Z 4BHPA 1IRGA 2DFFA 1IRZA 3J7YJ 1FEXA 5D5XB 1C0WA 1GV2A 3ASOH 4DQ2A 6PAXA 2DXIA 3K7AJ 3GTKJ 2JSCA 1W7PD 3B02A 3QPSA 3S2WA 5HS7A 4CSWA 3RZDJ 1USSA 1AHDP 2IAIA 1R49A 1BA5A 2EBIA 4BGDA 4HLYA 1Y8RB 5F27A 1W5TA 4BDYA 1MW7A 1S3JA 2L7MP 3OY9A 2XKOA 2H1LA 3DQVC 5BMZA 4YRVA 3C18A 1OMIA 2WAFA 2X48A 5M3FJ 3PSIA 3KYDB 1BJZA 2VE9A 4UUVA 3P5JA 3BJAA 5ICGA 3WU1B 2CV2A 4OAYA 4FT8A 3I5UA 4HOBA 1XSVA 4YIIA 3W2AA 1RPWA 5E79C 5IOYA 4CCJA 3OR2C 2WV0A 4WCGA 3HZJA 1H88C 4HEA2 2KRHA 1IJWC 5HDGA 1Z3XA 1BI3A 2AQFA 5LHIA 4DJAA 1OCPA 3D5RC 3GEZA 3MMYB 2E71A 2MH9A 2CFOA 1DDNA 2V79A 5J4VA 2R7UA 4LLGF 4F91B 2X6WA 2COBA 3UKGA 2QVOA 1FYLA 3CCVI 1Z7LA 2Y2ZA 1FMWA 2XAJA 1V5FA 4QIWN 2CUEA 5JLWA 1CF7B 1YW8A 1MBKA 3CMAI 4IRHA 3OYMA 4EJWA 4E4HA 1TL8A 4KMFA 2FNAA 1VQ4I 2I10A 3I53A 2LMDA 2ETHA 2E60A 1UJ8A 4Y13A 2A68F 2FQ3A 3BG3A 4LK0F 4C3IJ 1ZG3A 4I01A 4ZJZA 4MEXF 2LKPA 3I4PA 3CCMI 2PN6A 2C6YA 1VQNI 5BS6A 3HKZA 3PFYA 3OS2A 4RMNA 2W84A 4YELA 2OZUA 5DCMB 1JE8A 3IWFA 3DBHB 2DI3A 3MKZA 3M3YJ 2JTVA 2M4GA 2COMA 3HSFA 1Z7UA 5F6FA 1JUSA 1RKTA 2BW3A 2KQRA 3A1YA 4HZFA 1T0FA 3JAMK 4BQQA 5E1ZB 4PGHA 5DCFA 2Y31A 4M6XA 3SEZA 4AIHA 1WJCA 2ZJRF 2JN6A 2DLLA 2JVHA 3H5NA 4ASNA 3NAUA 3U1DA 2NOJB 3OYDA 1ZYRF 2EINH 2NS7A 2M2EA 4BXUA 2HFHA 2F4OB 2FF4A 1FOXA 3U1KA 1ETWA 4Z2YA 2VOPA 2LYCA 2X51A 2K3FA 4C30A 3JAMZ 3DP7A 2XASA 5BPDA 3R61A 2QF7A 5FKMA 2VXDA 2CUFA 1ZLKA 1D0ZA 4XICA 2DMUA 4IX7A 4A3JJ 4RB3C 2FRHA 2Z1DA 1L3LA 3BZ6A 1WZ2A 4BQNA 2Z2SB 2HTSA 4JX5A 2KHMA 2BOLA 5HNFA 3VODA 3H0DA 1QVUA 4LB5A 2NNNA 1FTTA 2ZJQF 3KEQA 4XRSA 1IN6A 2QLZA 5HDNA 1Y1WJ 4B48A 5DV5A 3H3UA 2FMLA 4KFCA 1P9QC 5IYCJ 3OOPA 3NQOA 1AOYA 3HXLA 3ZQIA 3CLQA 3SFZA 3V7CA 3G71I 2PJRA 2ZFUA 3QAHA 4JBAA 2KJBA 1U2WA 2UXNA 5F08A 3DKYA 2WV1A 1PJRA 1V54H 4Y33A 3ABMH 1JGGA 3FZVA 1LVAA 5E3LA 1LJ9A 5B3SH 1T0FC 4U0WA 3RQ4A 2DFHA 4KT6A 3ERED 2NVYJ 3IRRA 1UB9A 1O57A 3H5RA 3AKZA 4X0GA 3HYIA 2BW3B 2V1XA 5FLVA 1T95A 3W2WA 4RB2C 2FU4A 3BG5A 3ZXSA 1IW7F 2OQGA 4ZZLA 2Y0SA 3CCRI 5K7ZA 1QGPA 1WJFA 5F0CA 2L9RA 1SMYF 1SVOA 1BI2A 2BY2A 4HRIA 3KP5A 3LAJA 1HXDA 2IA1A 4MQVA 1DP3A 2QQ9A 1EJ9A 4YFKF 4HF1A 1BW6A 2P5KA 3OS1A 5ICFA 3FXOA 1F5TA 4A3LJ 4EQQA 2QCOA 2H6CA 2CSOA 1YW7A 4FISA 5E3OA 3JRGA 2M3AA 2D2WA 3MZHA 1VQ5I 3L2CA 2R7XA 1WKMA 4XN3A 2A6EF 2R7OA 3QYEA 3VYSB 2HPMA 1X2NA 4Y4RA 4XLHA 3B73A 3ZN0A 2OV7A 1FSEA 4ESFA 2V9KA 4BUPA 4IHSA 2OC6A 3MN2A 2NVXJ 4XLFA 3IC7A 3IHUA 3K69A 5GAHJ 4HBLA 1BR2A 3V8KA 2O5RA 1FP2A 4KN4X 3S93A 1X19A 3F22A 3CD6I 2XPWA 3CJNA 3IWZA 3HG9A 2P4WA 1K4TA 4X1EA 4V2GA 2VKVA 2HXOA 2DTZA 1MD0A 1E2XA 3CC2I 2ACJA 2VXZA 1XCBA 4RGRA
chains in the Genus database with same CATH topology
3DPLC 2M7AA 4II3A 4BE2A 4D1QA 4E7IA 4D9JA 3NWTA 4NC8A 1N75A 4BU2A 4IZZA 3ZCOA 3LSMA 3S3MA 2PJRB 2P0WA 1Z3YA 2HNHA 2ZSIB 4J00A 3OYGA 2X1DA 3E1SA 2W7NA 2XF6A 3K4NA 3OWTA 2VJ5A 2CUJA 2IS2A 4CA0A 1LKXA 1KONA 4Y3OA 2VQLA 4HNUA 2VQHA 4RM2A 3HOTA 3VSLA 2L9NA 5HLTA 3QYBA 4LIUA 2KRCA 2WBMA 3MD2A 2WADA 3HL2A 2DOAA 2IXSA 3PUBA 4QPOA 4B47A 3RSNA 3OL4A 3EUKL 4KITB 3OYFA 2K9MA 1WJAA 3A4CA 3LSKA 1MNEA 2XSJC 1N78A 5FROA 3HPHA 1Y56A 1HA8A 2Z16A 3OYLA 2VKHA 4RM3A 4MLOA 2KL4A 3G2BA 4BQOA 3VWBA 2R7RA 4XNFA 2ZXIA 3LSGA 4EATA 3OL3A 2CS3A 1LDKB 2W82A 1BOBA 4GRIA 4RLFA 3DU6A 2LREA 3OYNA 2HQAA 3ZQQA 4LIVA 1MMNA 5HVQC 4AVZA 3PL8A 4JOMA 2JUGA 3TBIA 4B3XA 1Z21A 3E0JB 3PNYA 4XKVA 2HPIA 4AYBA 4KISA 2VPLA 4BJ6C 2E1MC 4FETA 4G6TB 2QKLB 3OIQA 1DQUA 2IS4A 2RQQA 4CCMA 3I9V2 1ERDA 3HC7A 3HPGA 4CZCA 2E1MB 2X1CA 2X6YA 2VLAA 2RNGA 1OR7C 2JVGA 4XL9A 3BG7A 2M0MA 3K10A 2IGNA 2LH9A 3TL4X 2F4IA 2RREA 3PSFA 3CJQB 2DJIA 1Y6IA 2LY1A 2K9LA 3DKXA 2A6TA 2MC4A 3NWSA 3M8JA 3TMOA 4ZDOA 2LG4A 2Q2EB 3DPTA 4PJJA 1X1CA 4HG2A 2HDWA 2VQGA 1WJ5A 3QYFA 3QOEA 1X4PA 3ZRGA 2IS6A 2LY2A 4PK4A 4IQJA 1UELB 3S3NA 5TGTA 3BLYA 3OYCA 1YX3A 3L2QA 3EUHC 3K4CA 3L2UA 4XKCA 2BVMA 1MMDA 1WJDA 1X4OA 4CH7A 2CW8A 4XM3A 4C2UA 2K5CA 2LOOA 4IQ4A 3CMMA 4RLQA 4R79A 4DBRA 2R7TA 1GLNA 3RCOA 3AL0C 2LC2A 4N4NB 1IRXA 1D1CA 3DU5A 2I8DA 2XAUA 2WY8Q 3F9KA 1D0XA 2XDVA 3W2VA 3OYHA 2W00A 3OYEA 1LVKA 1X1AA 1K6YA 3K4KA 2JA2A 3SEQA 2KDOA 4DGWB 4E6KG 4U7BA 2UWMA 3A2KA 3SZGA 3IUOA 5CPRB 4ZYAA 1X1BA 4C2TA 1U0JA 3S32A 5HOOA 1FMVA 4NC7A 5HNHA 2QKMB 1WJEA 4AU7A 2CH0A 4CCNA 2UUZA 3OIPA 2XF5A 3D5SC 4ZTFA 4F93B 4XLCA 2F5VA 1JI8A 3U21A 3CJRB 2KZVA 3DEEA 1DGWY 1VZ0A 3OR1C 2L2OA 3OS0A 4PJLA 3PJRA 2HVSA 1R6RA 3KYLA 3ONQA 2IGMA 2OUMA 2CV0A 4PJNA 2V26A 4E7ZA 4C9YA 2ELJA 3PNTA 3FKJA 1V5GA 2ZSHB 1W36C 2WB1A 3BCAA 3DTEA 3QODA 4HNTA 1TZLA 4DIQA 4PJMA 3L2RA 2MABA 2V4JC 3BCBA 4BE0A 3CP8A 1N77A 2VJ4A 1NG7A 3VYRB 4F92B 4BACA 3FHNA 2M7BA 3HOSA 2R4GA 3BC8A 3LSIA 1G59A 4B43A 2ZXHA 2KMUA 2CMPA 2XC7A 1J09A 4P5OA 3IAM2 3CZ6A 3VYTB 1S9HA 2IGOA 4F52A 2DXIA 1WFXA 1W36D 4XOTA 4P1WA 4BJTA 4CUGA 4XLEA 4CSWA 4ANJA 2LBFA 5LD2C 2VIXA 3L2WA 2DCEA 3S3OA 4BGDA 5LFAA 1UG0A 1D1BA 4OAZA 4E7LA 4BDYA 2KP6A 1MW7A 3M1CA 4NNJA 5KCMA 3OY9A 2L5QA 4ZTJA 2LRDA 1EA3A 4DOZA 3DQVC 2HZDA 4YRVA 3RTRA 2WAFA 4E7SA 5CQEA 2KPMA 3LL7A 3PSIA 5FRMA 1QHHD 1QU3A 2GOMA 2CV2A 4OAYA 4ZDLA 3PNVA 3MKWB 3W2AA 4PFOA 3UNGC 4BJ5C 4CCJA 3OR2C 4PUSA 3IAS2 3LMMA 4HEA2 2KRHA 2MFZA 1Z3XA 2AQFA 3OYBA 4II2A 4DJAA 3H5AA 2CV1A 2E5NA 3D5RC 3HUGB 3MMYB 4JQFA 2CFOA 1ZELA 2R7UA 4IKFA 3C2HA 4F91B 2X6WA 4E7JA 3H35A 4BEHA 1Z7LA 1FMWA 2IGKA 1V5FA 2VB6A 1SAUA 4ITVA 2DT7B 3OYMA 4E4HA 4J01A 3K70C 1OLTA 4YEJA 2MYSA 1BR4A 2WAEA 4ZC3A 4KJZA 1YE9A 2E60A 3N05A 2V7FA 3AL0B 2R7VA 3H9QA 1DGRM 4HSTA 4ZJZA 1MMGA 2WA0A 3HKZA 3OYIA 3OYJA 3PFYA 3OS2A 4RMNA 1MNDA 4YELA 2VJIA 5KNLA 4XKBA 3MKZA 2VQCA 2L9SA 2M4GA 2XF7A 2KQRA 3A1YA 2BW3A 2M4KA 2V1NA 4PFPA 3L2VA 4BQQA 3ZR8X 1BR1A 3DPUA 2A5WA 4F55A 4B44A 2R7SA 4BL0B 3SEZA 4XQFA 3CF2A 5JHFA 1WJCA 3DTIA 3K70D 4XOPA 2LBFB 2JVHA 3H5NA 4QPQA 2NOJB 4XKWA 3K4BA 3OYDA 4N4OB 2JSPA 3AFHA 2IS1A 3ZGKA 2V6EA 3OYKA 1D1AA 3VYUB 2CUZA 2LYCA 3V42A 1SFKA 1MMAA 2X51A 4C30A 4H4KC 3DLAA 3FBNB 2FUG2 1AA7A 4XMYA 3K4MA 2VL8A 3SYTA 3CESA 2VXDA 4BDZA 3OYAA 1YX5A 1D0ZA 3GBGA 3MKYB 4IX7A 3I3LA 4CCLA 4DBQA 4OWRB 1PYVA 2Z1DA 5KHDA 1TT0A 4LG3A 2VKDA 4BQNA 2Z2SB 2KHMA 2BOLA 5HNFA 1UAAA 1WJBA 3C2GA 3H0DA 3LSHA 3DWLE 2HVRA 1E0EA 3J7AY 5CKTA 5FRNA 2X85A 3LFUA 3OOUA 2F6CA 1LFPA 4BEHB 4LITA 4ZDPA 4B48A 2X1EA 4XN0A 1P9QC 3VDXA 3H9GA 3HXLA 2UV1A 3SDBA 3OMYA 2PJRA 2ZFUA 3CP2A 2R7QA 2VASA 2HVQA 2AQEA 3DKYA 2DT6A 1PJRA 4FASD 2Q1ZB 3BG6A 4Y33A 4CCOA 2PMZA 1T0FC 4F3QA 1NG6A 3KEYA 4KT6A 2X6XA 3RQ4A 3H9JA 2W4SA 3KX2A 2GOXB 2K3PA 3H5RA 4PSWA 3AKZA 4X0GA 3D5LA 2BW3B 4BS9A 4U87A 4PSXA 1T95A 2CW7A 3VSKA 3W2WA 3K4LA 3ZXSA 1D0YA 2Y0SA 1WJFA 4HPQA 4CCKA 1QHGA 3EPZA 3DTKA 3IP4B 4XR6A 4HRIA 1DP3A 1G8XA 2E5ZA 5CQGA 3OS1A 4E7KA 4NUBA 2KLOA 4NQWB 2M3AA 4BE1A 2HU9A 2R7WA 2BVLA 4XN3A 2R7XA 2R7OA 3QYEA 3VYSB 1V5EA 2HPMA 3S8PA 3FDYA 4Y4RA 4XLHA 4XORA 1X1DA 3RPUD 2WY7Q 2OV7A 4HSRA 2V9KA 4BUPA 2OC6A 4XLFA 2VJJA 2WAQA 4BXFA 1BR2A 2O5RA 3K6GA 2W1OA 3S93A 1X19A 3UR3C 4E7HA 3EUAA 2MD0A 3HG9A 4XLAA 3K4JA 2L7KA 4XONA 3FBIB 2VXZA 3W3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X0G A;  4IX7 A; 
#chains in the Genus database with same CATH topology
 5B1B H;  4NBQ A;  1RC9 A;  3M8F A;  3TED A;  2HOS A;  4D9J A;  1YIT I;  2H1K A;  2PG4 A;  3RPU A;  2PJR B;  3Q5F A;  2X9D A;  3L1P A;  2V9P A;  1U9N A;  2ZSI B;  5FKO A;  1GVD A;  5H2F C;  2BGC A;  1P4X A;  4W97 A;  1T2K A;  3E1S A;  2EV6 A;  3RYP A;  3K4N A;  3L09 A;  2CUJ A;  1FY7 A;  1LKX A;  3DCF A;  3HTS B;  2JRM A;  2JWT A;  2QZ8 A;  1ZAO A;  5FO5 A;  2L9N A;  3IRQ A;  2EB7 A;  2VOD A;  3RZO J;  1V4R A;  2ZBK A;  2DAO A;  2KKO A;  1ETV A;  2X6O A;  3W6J B;  2IXS A;  3EUH A;  2WTE A;  2XHK A;  2NVU B;  5GAD J;  3HIF A;  4B47 A;  4C3H J;  4KIF A;  3RSN A;  3FM5 A;  4HAM A;  1Y1V J;  4JP0 A;  3OL4 A;  2I5U A;  2BEO A;  1VQM I;  4M74 A;  2M5W A;  1UHM A;  5CVJ A;  3A4C A;  1FJL A;  2L7Z A;  1P7J A;  1XX5 A;  1MNE A;  2ID6 A;  3NAR A;  1EH7 A;  4G9Y A;  5EEG A;  1Y56 A;  5L3C A;  1YHQ I;  2RVC A;  4N0B A;  2VKH A;  4RM3 A;  4F7Z A;  1JJ8 C;  1P2F A;  2O6G E;  1E17 A;  1RR7 A;  2HGC A;  2OA4 A;  1VQ8 I;  3LFK A;  2DQL A;  3OL3 A;  5JHU A;  1VTN C;  1LDK B;  1R5G A;  3H36 A;  4GRI A;  3J7Z I;  2LRE A;  3O3K A;  4CGZ A;  3OYN A;  3ZQQ A;  2KFD A;  5HVQ C;  4RAZ A;  1P4W A;  3BZC A;  3TBI A;  3JRD A;  4UVC A;  2ZJ2 A;  1O4X A;  3S2H J;  3TO6 A;  3F0C A;  3HKZ N;  1Z77 A;  2IT0 A;  1HW1 A;  3PNY A;  2IVM A;  2R3S A;  3V7R A;  5D6F A;  4MNU A;  1IG7 A;  2OCC H;  4FET A;  5DM7 F;  4G6T B;  4B1R A;  1DQU A;  3ASN H;  2IS4 A;  4CCM A;  2DOF A;  1WSU A;  3HPG A;  4OIN F;  2VLA A;  1N25 A;  5E17 F;  1B1B A;  2EFW A;  1ZRC A;  4XL9 A;  2HR3 A;  3HSE A;  1R23 A;  2X4H A;  4PGG A;  1Z05 A;  3TL4 X;  2BE5 F;  3PSF A;  4N9I A;  4AWX B;  5K7F A;  4FQG A;  1XGN A;  5D6E A;  4A3K J;  3DKX A;  3K2A A;  2MC4 A;  3M8J A;  1AWC A;  3JRI A;  2L4M A;  1BM9 A;  4MGR A;  4HG2 A;  4UV8 A;  4M3B A;  5DS9 A;  1WJ5 A;  1JXS A;  3QOE A;  4P55 A;  3ZRG A;  2LY2 A;  1W4M A;  2YU9 J;  1CGP A;  3BP8 A;  4UVB A;  1X3W B;  3OYC A;  3WGH A;  1WVR A;  3EUH C;  1K6O A;  3IL2 A;  4ZYD A;  2BVM A;  1K7A A;  1R5H A;  1SMT A;  1YIJ I;  3WHB A;  2AXL A;  4C2U A;  4UXN A;  1TW2 A;  2R7T A;  4FE4 A;  1GLN A;  2LSO A;  4GXO A;  4MTD A;  3HEF A;  4DW6 A;  2PMU A;  2K9S A;  5TRD A;  3WTU C;  1FLI A;  1ZR4 A;  2EA4 A;  2MLK A;  3H3Z A;  3ZMV A;  1SFU A;  1X1A A;  5KVR A;  4IHX A;  2JA2 A;  4DGW B;  4LK1 F;  5K5O A;  3SZG A;  3A2K A;  4ZYA A;  4D5C A;  2XUB A;  3LSP A;  3I0T A;  2QKM B;  1OR7 A;  4AU7 A;  3GLX A;  2ISZ A;  2XF5 A;  4L5E A;  4Z6Y A;  1JGS A;  2KZG A;  2CJJ A;  2F5V A;  3U21 A;  2EPF A;  2DO7 A;  5F64 A;  3CMY A;  2DMQ A;  4J19 A;  3MVP A;  1HDD C;  3FK6 A;  3PJR A;  1QBJ A;  1KQ9 A;  1RR8 C;  5JI6 A;  1R6R A;  3S15 J;  2EFQ A;  1X1P A;  4LLL A;  1OFC X;  2DA2 A;  1ZG1 A;  1JJ6 C;  3U2R A;  4C9Y A;  2ELJ A;  2Y0S N;  1IN8 A;  2K4B A;  3LQR A;  5IP6 A;  1T08 B;  3T8R A;  4B3A A;  1V5G A;  2LP0 A;  2YUS A;  2K27 A;  3HRU A;  1APL C;  1TWH J;  1ONV A;  1TZL A;  1TTY A;  4U88 A;  4DIQ A;  2MSY A;  1UST A;  2OPT A;  2FX0 A;  1VI0 A;  3BCB A;  3RYR A;  3CP8 A;  1WQ2 A;  3MZ8 A;  5DM6 F;  3LSJ A;  2AS5 F;  3I54 A;  4LJZ F;  2RV8 A;  3W6K B;  4F92 B;  5EDN A;  3O2P E;  2KJC A;  3HOS A;  1I39 A;  2R4G A;  3CME I;  3F6O A;  4KUM A;  2KMU A;  4Q48 A;  2XC7 A;  4PJ0 C;  3C2B A;  2ID3 A;  1U6G A;  2DU9 A;  4TV7 A;  5J40 A;  1POG A;  3KP6 A;  2BZT A;  1S9H A;  1ZN2 A;  3WE2 A;  3I64 A;  3TDZ C;  3GTP J;  2R93 J;  5J8C A;  1FP1 D;  2JRT A;  4U7D A;  4BJT A;  2KIQ A;  4CUG A;  1ETY A;  1BC7 C;  2XRO A;  1R5I D;  2VIX A;  3L2W A;  2HI3 A;  5LFA A;  1T56 A;  1LUJ B;  1GVJ A;  1TLH B;  2DDB A;  3M1C A;  5EZH A;  2L5Q A;  2LRD A;  3F8F A;  3TQN A;  2YPR A;  4DOZ A;  2F5C A;  3RTR A;  1Z0X A;  3MFK A;  3K2Z A;  4A5M A;  4A3E J;  4LD5 A;  4AID A;  3COA C;  1QU3 A;  2Q8K A;  2FXA A;  1E3H A;  4ZDL A;  3PNV A;  3MKW B;  1UMQ A;  4PFO A;  3CDI A;  3ESW B;  3LMM A;  2FA5 A;  2HDD A;  1HC8 A;  4PCQ A;  5E1X A;  3OYB A;  1JKP C;  4II2 A;  4M73 A;  1Y0U A;  1MBG A;  4JQF A;  1IN4 A;  4Y15 A;  2PLY A;  1B6A A;  4WK8 F;  4KIG A;  4IKF A;  2EFO A;  3C2H A;  3BZK A;  3ERM A;  5BOX A;  3SJM A;  2VI6 A;  2FBH A;  4AUX A;  3KIO A;  1O3S A;  2IGK A;  5JVG F;  2TRT A;  1ZQ3 P;  3DEW A;  4J01 A;  1I6H J;  4UNO A;  1GV5 A;  3TOA A;  2EFP A;  2VN2 A;  5F1J A;  2H94 A;  1BR4 A;  2WAE A;  3FIW A;  4KJZ A;  4A93 J;  1CQT A;  3AL0 B;  5IYD J;  4I2O A;  3H0G J;  5HLI A;  3PIP F;  1OCZ H;  2RQP A;  4IJA A;  3GX4 X;  3KP3 A;  2WWY A;  1VF9 A;  3M1E A;  2QYO A;  4A3B J;  1MND A;  5M3M J;  2VJI A;  2HS5 A;  4XKB A;  3KZI C;  1QZY A;  2FEZ A;  2L9S A;  2ZKZ A;  5H20 A;  3N97 A;  2NXN B;  2XF7 A;  3L00 A;  2D1V A;  2V1N A;  2L0K A;  3QRF F;  1QA6 A;  3FMQ A;  1LDJ A;  5TIS C;  1ACI A;  4B44 A;  2P5L C;  4BL0 B;  3CF2 A;  5JHF A;  3OIO A;  1OYW A;  3EQL F;  3K70 D;  2W48 A;  4ZYE A;  4IRI A;  3QPL A;  2PFB A;  2EFN A;  2VT2 A;  2ZFW A;  1IRF A;  3AFH A;  1KYW A;  1Y8Q B;  3GTJ J;  3TOB A;  3ZGK A;  4RS8 A;  2EV5 A;  4HF0 A;  5CJ9 A;  4HX7 A;  3QU3 A;  5M5W J;  2L4A A;  1LPQ A;  2V6E A;  3OYK A;  1O7L A;  2HTJ A;  4M72 A;  1B9N A;  2BXZ A;  4O5V A;  5J1U A;  3FBN B;  1TWF J;  2K86 A;  1YG2 A;  5LEJ A;  3HM5 A;  1UCR A;  2K85 A;  2R7F A;  3K4M A;  3Q3S A;  4D7M A;  2EQR A;  4EMS A;  1ZKG A;  1JTY A;  2NYX A;  1YX5 A;  4BY7 J;  3OYA A;  3S1M J;  3MKY B;  1VFC A;  4XLP F;  2GQQ A;  4CCL A;  4DBQ A;  5KK1 A;  1I27 A;  5IP7 J;  5KHD A;  4QSH A;  1JHF A;  2VKD A;  1XSX A;  5FGM A;  1T8I A;  3ZOB A;  4BHC A;  3WGI A;  3GTQ J;  3IKV A;  1E3P A;  2L54 A;  3C2G A;  4NB5 A;  2A69 F;  1Z6R A;  4M9Z A;  4OMY A;  2JZY A;  3DWL E;  1VQ9 I;  1D8K A;  2Y0M A;  3J7A Y;  2M9H A;  5CKT A;  5E18 F;  1ZRD A;  1HOM A;  3LFU A;  3OOU A;  1LFP A;  3T8T A;  3Q9S A;  4LIT A;  3TO7 A;  5IT9 K;  2DA5 A;  3ECH A;  3JTH A;  1XMA A;  1QPI A;  2CQK A;  1OCT C;  3VDX A;  4XRS G;  4A3C J;  3FXQ A;  3H9G A;  2LLK A;  2XVC A;  3OMY A;  3WTZ A;  1P6R A;  3HTU A;  2P8T A;  2R7Q A;  1OIS A;  2A3S A;  3JRE A;  2STW A;  4WWC A;  2DT6 A;  3R60 A;  3ZMD A;  1BOA A;  1SD7 A;  3BG6 A;  4A3M J;  2PMZ A;  2QQB A;  3ABT A;  1YO5 C;  1T38 A;  5E8G A;  3KEY A;  1J59 A;  4GFB A;  1ZG5 A;  1LEB A;  3GYH X;  1ZAR A;  2JT1 A;  2MGQ A;  5IT9 Z;  3WTT C;  2LKS A;  3E6B A;  3R0J A;  1GXP A;  2CQ7 A;  4BS9 A;  4PSX A;  2GM4 A;  3VEP A;  3JCU C;  3RI4 A;  2OBP A;  1D0Y A;  1UG2 A;  4I0A A;  4HF2 A;  3I4N J;  2ECB A;  2XGE A;  3S2D J;  1F4K A;  3LQQ A;  3KET A;  2AO9 A;  3JSO A;  1I1G A;  5J47 A;  4GCV A;  4CO8 A;  1J0R A;  2IJL A;  5E20 A;  1G8X A;  3F8C A;  3BTI A;  4CYD A;  1O3Q A;  1FBU A;  4ENK A;  3K9T A;  4BE1 A;  3CTA A;  3GUD A;  4MO7 A;  3RJP A;  3CO7 C;  5J6X A;  3RIR A;  1V5E A;  1U3E M;  3ZMT A;  3C7J A;  1DUX C;  1LB2 A;  1X1D A;  1W0T A;  3RPU D;  4HSR A;  5K5Q A;  1JHH A;  2RGV A;  5ICC A;  1IV6 A;  2HYF A;  3SFI A;  5CLS A;  2A07 F;  4HX8 A;  2W1O A;  3UR3 C;  3GTG J;  2CW0 F;  1KQ8 A;  2XAQ A;  4A0Y A;  1XMK A;  5HLH A;  2VPR A;  1UFM A;  2W85 A;  4XON A;  3PQK A;  5B66 C;  3FBI B;  2GZW A;  2BV6 A;  2FD5 A;  3LA7 A;  4L9T A;  4DYR A;  3SZT A;  5JVT A;  1ZH5 A;  2GAU A;  1OYY A;  3KLN A;  4G8X A;  2BHY A;  3DEU A;  4BBR J;  4BU2 A;  1G3S A;  2WC2 A;  3ZCO A;  5HS9 A;  5D5W B;  4BHB A;  1G3T A;  1HQC A;  5LGU A;  2P0W A;  1Z3Y A;  4UB6 C;  1TBX A;  5FD6 A;  4M3D A;  3OSG A;  5H6R A;  4A5N A;  2VJ5 A;  4KDP A;  2EIM H;  4CA0 A;  1JTX A;  1KON A;  5BQT A;  2W24 A;  2MC3 A;  1DPR A;  4ENJ A;  5L3D A;  3S1N J;  3V8L A;  1X3Z B;  5DDG A;  1OJL A;  1GDT A;  1NK3 P;  2WAD A;  3HL2 A;  3HRM A;  5E8I A;  5EG0 A;  1TW3 A;  2HQ5 A;  3I56 I;  1YS7 A;  2O7O A;  1IV8 A;  2IEK A;  5D4S A;  1NTC A;  3EUK L;  4KIT B;  2ZME A;  1JT6 A;  5FRO A;  3ZP5 A;  2HOT A;  4FCY A;  3OYL A;  4HLX A;  4A0X A;  5DUK A;  5AIP A;  1ETX A;  3T0Y A;  1NHA A;  1SVL A;  3WG7 H;  3VWB A;  1ON2 A;  2PEX A;  1DU6 A;  5C3E J;  2IP2 A;  3PM1 A;  3LSG A;  4EAT A;  3SQN A;  1G3W A;  2AXT C;  1ZGW A;  4BAY A;  2RAE A;  3HOU J;  1MMS A;  4RLF A;  3BPX A;  3GXO A;  2HQA A;  4LIV A;  1MMN A;  3HGG A;  4AVZ A;  3PO3 J;  4JOM A;  5JFR A;  2JUG A;  1BIB A;  3H3V K;  4B3X A;  3ZMS A;  5EYR A;  5TJJ A;  5FFX A;  1EH6 A;  4BJ6 C;  2E1M C;  3FXR A;  4L9V A;  1MNM C;  3HOV J;  2QKL B;  1OKR A;  2O3F A;  3QWL A;  3F3X A;  3QOP A;  3HC7 A;  4CZC A;  3PO2 J;  5GTI C;  2P7C B;  2E1M B;  4OIR F;  1MJA A;  2X6Y A;  5EF6 A;  3M9A A;  2E19 A;  2Y9Z A;  2JVG A;  4HQE A;  3BG7 A;  2RN7 A;  2DMP A;  1BN5 A;  2IGN A;  1TNT A;  2RRE A;  1YI2 I;  1MJ9 A;  3BR5 A;  1VQL I;  3S17 J;  3S1Q J;  5HOD A;  2MLG A;  2A6T A;  3TMO A;  1PUE E;  4ZDO A;  1FSH A;  2LG4 A;  1UHS A;  1I50 J;  1DP7 P;  3RKX A;  3RKY A;  1X4P A;  2CYY A;  2IS6 A;  2NS8 A;  4PK4 A;  5LRR A;  5J1Y A;  4IQJ A;  2FJ1 A;  1B59 A;  3GZ6 A;  2CO5 A;  3BLY A;  4RGS A;  1YX3 A;  4A69 C;  3A0H C;  3EYI A;  4V2F A;  1WJD A;  4ENN A;  1XDU A;  1YS6 A;  3WGG A;  4CH7 A;  2CW8 A;  1KU3 A;  1R22 A;  2R7Z J;  2LOO A;  2D1H A;  1EV7 A;  1B9M A;  2ZME C;  3CMM A;  5EG0 B;  5KAF C;  3QQA A;  3IH2 A;  2K40 A;  2B63 J;  1MKM A;  5IT3 A;  1XSD A;  4N4N B;  1IRX A;  5EGO A;  2I8D A;  2ZME B;  3OYH A;  3F9K A;  1D0X A;  3FXL A;  3V4G A;  4ABZ A;  1A04 A;  2W00 A;  2X0L A;  3HJE A;  4EJT A;  1SD6 A;  3QPT A;  1K6Y A;  4LGW A;  3REO A;  4P9F A;  1H9T A;  2BXY A;  1HBX G;  4O3M A;  3SEQ A;  2H6B A;  2E7W A;  2KDO A;  5BNG A;  4EM0 B;  3Q0U A;  1TWG J;  2YSR A;  1X1B A;  3PUF A;  4RGU A;  3LAP A;  2P7V B;  5J4Y A;  4BNC A;  1IN5 A;  1VQ7 I;  1PUF A;  4UV9 A;  1YW9 A;  2G7U A;  3D5S C;  1T98 A;  2PMZ N;  4XLC A;  1YIO A;  4LMY A;  5EEH A;  2KZV A;  5K7H A;  2HKX A;  1FIP A;  3DEE A;  3DLL F;  1QNT A;  3F8B A;  2HDC A;  3ROU A;  1DPU A;  1OCC H;  2XRN A;  1LE8 A;  1H8A C;  2HVS A;  1UZC A;  3OSF A;  1X58 A;  1ON1 A;  3KYL A;  1ZR2 A;  1FZP B;  3BT9 A;  1K78 A;  1IUF A;  4XSZ F;  2QQ8 A;  5L3B A;  2NS0 A;  3DKW A;  5GTH C;  3PNT A;  1T33 A;  1G4D A;  1FBS A;  2IW5 A;  4IHW A;  4EV0 A;  2KRF A;  4IHV A;  4A3D J;  1XD7 A;  1BJA A;  2HOE A;  4ESJ A;  3TGN A;  1BI0 A;  4S0H B;  2V1U A;  4M6V A;  5M5Y J;  2QBY A;  2EA2 A;  4OU0 A;  2EZK A;  1N77 A;  2JA7 J;  1MBE A;  3TP3 A;  1STZ A;  5LEK A;  1ZGA A;  1MSF C;  3WU2 C;  4BAC A;  4KN7 X;  4YG2 F;  5L3F A;  3IH3 A;  2O9L A;  1MIJ A;  4WX9 A;  2M8G X;  2ME0 A;  3E5Q A;  3BC8 A;  3LSI A;  1REP C;  3ULQ B;  3VB2 A;  4EGZ A;  1B4A A;  1MDM A;  2B7E A;  2QGU A;  2DOD A;  1ZHF A;  2HOA A;  3F8N A;  3P9I A;  4GO1 A;  2IGO A;  3CQZ J;  2CFX A;  1WFX A;  3HOY J;  1W36 D;  5H6Q A;  4I0B A;  4DYC A;  1IO2 A;  3GME A;  4WF2 A;  3EYY A;  4XBF A;  2LBF A;  4ANJ A;  5EGO B;  3E5U A;  4UUT A;  1Y39 A;  2IA2 A;  3S3O A;  4FTH A;  1ENH A;  3A0B C;  1U8B A;  5ILS A;  2XSD C;  2KP6 A;  5KCM A;  4ZTJ A;  3JR9 A;  1U8R A;  3BR3 A;  2BHZ A;  4WXD A;  5CQE A;  4E7S A;  1A35 A;  4HV5 A;  5FRM A;  5F1R A;  1IF1 A;  3BRO A;  4UVA A;  4A2U A;  3DFG A;  1PUF B;  3BY6 A;  2RNJ A;  1XS9 A;  3O8H A;  5D4R A;  3UNG C;  2NNY A;  4BJ5 C;  2VC0 A;  4AIK A;  3FIS A;  4OIQ F;  3IAS 2;  5AIQ A;  2JMW A;  3K1P A;  3R6S A;  4IEJ A;  4QLC U;  2NOG A;  3H5A A;  4OIP F;  1LE8 B;  1T39 A;  2E5N A;  4L5J A;  4IF4 A;  3D0S A;  1FYK A;  2MD5 A;  1W0U A;  1ZEL A;  5D5U B;  1K78 B;  5FB2 A;  4EJO A;  3VFZ A;  2ELH A;  4E7J A;  1I6X A;  4IL6 C;  3P9C A;  2LR8 A;  5FFZ A;  3OV8 A;  3WHC A;  4BEH A;  4DZP A;  1A6Q A;  3FXM A;  1HCR A;  1F1Z A;  1GXQ A;  2VB6 A;  1SAU A;  1IAW A;  1XDS A;  2DT7 B;  5JR3 A;  2ELK A;  1ULY A;  3TDU C;  2QUF A;  2MYS A;  4ZC3 A;  5E3N A;  2QBY B;  4BKX A;  1YE9 A;  2YR2 A;  3N05 A;  2V7F A;  4U0Y A;  2R7V A;  3H9Q A;  3GZ5 A;  1DGR M;  4HST A;  3M4O J;  1TQI A;  2DOE A;  3BWG A;  1MMG A;  2WA0 A;  4MHG A;  3BR1 A;  1YFH A;  1BW5 A;  3OYJ A;  3FX3 A;  5KNL A;  3IV5 A;  3KEO A;  4FE7 A;  1MDM B;  4A6E A;  3GO5 A;  4I99 C;  1I3A A;  4BH9 A;  1R36 A;  1QRY A;  1J5Y A;  4DNC A;  4MFE A;  2QSH X;  4PFP A;  2M4K A;  3L2V A;  4BXX J;  2EJR A;  4G6Q A;  3ZR8 X;  2KDZ A;  1BR1 A;  3DPU A;  4F55 A;  1SEU A;  2HYJ A;  2R7S A;  5DEQ A;  3FMS A;  5EEA A;  1XTA A;  2BYV E;  2GIZ A;  4XOP A;  2FSW A;  2LBF B;  3GFL A;  1FBQ A;  4RAF A;  1V55 H;  4XKW A;  1VQ6 I;  4PDK A;  4N4O B;  2JSP A;  5HS8 A;  2LDU A;  2HEO A;  2GIV A;  2MBF A;  1D3Y A;  5FKK A;  4WXC A;  4UUS A;  2XPU A;  1WH7 A;  2MG4 A;  3GZN B;  4OMZ A;  5LHH A;  1D1A A;  4M71 A;  1KU2 A;  4NDL A;  1KU7 A;  2VOO A;  1E3O C;  1QZE A;  1SFK A;  1MMA A;  3FF5 A;  4LFU A;  4NQW A;  3V42 A;  1PP7 U;  2FUG 2;  1H0M A;  4XID A;  2VL8 A;  5HLG A;  3SYT A;  3CES A;  1U5T C;  2BY3 A;  2PMH A;  2STT A;  3KZZ A;  3I59 A;  4P9U A;  2XRL A;  2DJN A;  1HDP A;  1WI9 A;  1J7K A;  1S7E A;  4EEF G;  4EM1 A;  4OWR B;  1PYV A;  5J8F A;  1PVE A;  2XGC A;  4IHT A;  5CVU A;  1HSJ A;  2DBB A;  4XLN F;  2TCT A;  3HRS A;  3BTJ A;  1XC5 A;  4L18 B;  2DFE A;  2HVR A;  1OQY A;  4AC0 A;  5FRN A;  4N9H A;  2X85 A;  2HZT A;  4M3E A;  4XRM A;  4BEH B;  4ESB A;  1Z6T A;  4X6A J;  2X1E A;  2DDA A;  3KZY A;  4XN0 A;  1OYI A;  3HSR A;  2O8X A;  3SDG A;  4WXH A;  4Q4Z F;  4KIB A;  1AU7 A;  1WI3 A;  2OZ6 A;  2XB0 X;  2VAS A;  1H89 C;  3CUQ A;  1S5L C;  2HXI A;  2HVQ A;  5CYV A;  2AQE A;  3D1N I;  2E2H J;  2OQR A;  1HW5 A;  2Q1Z B;  4IOC F;  1XPX A;  1WHU A;  4I02 A;  2HKO A;  4F3Q A;  1NG6 A;  2X6X A;  4YIF A;  4L9J A;  1RUO A;  4IOA F;  1XGM A;  3KP2 A;  3KX2 A;  2DA1 A;  4M9S A;  3Q9V A;  5F0F A;  1R9T J;  5B1A H;  2RKH A;  3SXY A;  2L3D A;  3E3V A;  2CW7 A;  3F72 A;  3VSK A;  4C2M J;  3L7W A;  1HKT A;  2FE3 A;  3CCE I;  3B6A A;  2QEX I;  5FD5 A;  2LK2 A;  5CVI A;  3E97 A;  2NRA C;  5EZG A;  4HPQ A;  3C1D A;  1NK2 P;  3CUO A;  1QHG A;  3SZP A;  2CQN A;  3DTK A;  3IP4 B;  3QP5 A;  4XR6 A;  5A2Q K;  2VON A;  1OPC A;  3RQI A;  2JQ7 A;  2H8R A;  3CCU I;  1O3T A;  2XAF A;  4UUS B;  3A03 A;  3EET A;  4KNY A;  3JRB A;  2Y30 A;  4NUB A;  1XMX A;  1GUU A;  2KLO A;  4NQW B;  3CC4 I;  2HU9 A;  5DYM A;  2BVL A;  1JKO C;  3LA3 A;  9ANT A;  4I6Z A;  3FDY A;  2Y48 A;  4U0V A;  1RRJ A;  3I59 B;  2YX4 A;  2G9W A;  2LD5 A;  2ESH A;  1W1W E;  1D5V A;  2OTJ I;  2VJJ A;  2WAQ A;  4IPA A;  3G3Z A;  1SAX A;  3I55 I;  3RKW A;  1IUY A;  4JK1 X;  2LNB A;  5A2Q Z;  2JA8 J;  2LVS A;  3EUA A;  4RAY A;  1BIA A;  4FX0 A;  4LOC A;  3K4J A;  4RDU A;  2L7K A;  1ZRF A;  2XAH A;  2E1N A;  3W3C A;  2O8K A;  3FM3 A;  3FXK A;  4II3 A;  3CUQ C;  2MA3 A;  4JYK A;  2KIU A;  4E7I A;  4NC8 A;  3HDD A;  3KLO A;  3LSM A;  5CVV A;  2LTP A;  1XN7 A;  1S8N A;  2BY1 A;  3CUQ B;  5DUI A;  3J81 K;  3OYG A;  3T5X A;  1FNN A;  4LLN A;  2Q2E A;  3CDH A;  4AVP A;  2IS2 A;  3MCZ A;  4Y3O A;  2VQL A;  4HNU A;  1YJ9 I;  4EVI A;  1IXC A;  2R5Z A;  1B8I A;  2VBX A;  4XRF A;  1IXS B;  4RM2 A;  1Z67 A;  1A31 A;  3BOQ A;  5HLT A;  3U9G A;  3NEU A;  5DTD A;  1TNS A;  1H9G A;  2OD5 A;  2DOA A;  3KP4 A;  2DPD A;  3WTY C;  4CIC A;  2A6H F;  3A02 A;  3PUB A;  4QPO A;  3J81 Z;  2XKP A;  4CZZ A;  2XGX A;  1WH5 A;  4LG0 A;  2Z99 A;  2K9M A;  3G73 A;  3ECO A;  3GFM A;  3LSK A;  2XSJ C;  3HPH A;  2Z33 A;  3RDI A;  4KT5 C;  2Z16 A;  3R0A A;  3BTC A;  5J3L A;  3G2B A;  4JX6 A;  4BQO A;  4P96 A;  4IO9 F;  2M8E A;  1D5Y A;  2Z5U A;  4LB6 B;  3I58 A;  2W82 A;  1KYZ A;  1BOB A;  3DU6 A;  5HDK A;  2W25 A;  4YIR X;  3PL8 A;  1B72 A;  2JPC A;  3K1N A;  3GFI A;  4A3G J;  2FMY A;  4HX4 A;  1S29 A;  1Z21 A;  3C3W A;  4XKV A;  2HPI A;  3KFW X;  4M3F A;  4A3F J;  1G3Y A;  2IA0 A;  4G94 A;  1P4A A;  2JPB A;  4S04 A;  3CC7 I;  2ISY A;  2G7H A;  3OIQ A;  1KU9 A;  2QSF X;  2RQQ A;  4NHJ A;  2JUC A;  1D8J A;  1RES A;  4AD9 A;  4HDU A;  3NRV A;  2EWN A;  2Z3Y A;  4I09 A;  2YS9 A;  2W57 A;  2M0M A;  2ZXJ A;  1LDD A;  3MKL A;  3ABK H;  3K10 A;  1LQ1 A;  1HLV A;  2LH9 A;  2F4I A;  3HOW J;  1FIA A;  2DJI A;  2LY1 A;  5K1Y A;  2K9L A;  1K4S A;  1FT9 A;  3GW2 A;  3NWS A;  2EIJ H;  5EJC A;  2Q2E B;  1M1E B;  3DPT A;  1JUM A;  4HW0 A;  3M7G A;  1X1C A;  2MW8 A;  1KQ0 A;  4ZZD A;  2M34 A;  2UZK A;  2A5Y B;  1FOW A;  2R5Z B;  1B8I B;  4DZJ A;  2M1B A;  3L2Q A;  1I5Z A;  3L2U A;  4XKC A;  3ML6 A;  2FNP A;  1MMD A;  1XGO A;  3KYC B;  4BBS J;  3DXJ F;  3J7A O;  4XM3 A;  3HHG A;  1PP8 F;  2JA5 J;  4IQ4 A;  2JK3 A;  2R7D A;  2E7X A;  2KIS A;  5AON A;  2ZNY A;  1KA8 A;  2XAG A;  5JLX A;  2QA4 I;  4RAG A;  3PIO F;  4LG0 B;  1D1C A;  2WY8 Q;  1FWZ A;  1K83 J;  1QQI A;  3E6M A;  4Q47 A;  3K4K A;  4XSX F;  2P81 A;  1YYV A;  2QM3 A;  3DBL B;  4E6K G;  2CWE A;  3E6D A;  1YJW I;  4ZYH A;  3IUO A;  5CPR B;  5D8L B;  2DW4 A;  1U0J A;  1FMV A;  5HNH A;  2OU2 A;  2ZJP F;  1LFU P;  2CH0 A;  2FQ4 A;  4CCN A;  2UUZ A;  5D8K B;  2Z9O A;  1WWX A;  1B72 B;  1ITY A;  1JI8 A;  3X2Q H;  3CJR B;  4R8H A;  4BY1 J;  4AYB N;  1Q1V A;  3CJT B;  3RPQ A;  1DGW Y;  3ZQL A;  4KA4 A;  3O8G A;  3OS0 A;  3WTS C;  3HUG A;  2VE8 A;  2CU7 A;  4EGY A;  1WPK A;  1QVT A;  2IGM A;  3ONQ A;  1R58 A;  1SFE A;  3ZMZ A;  1W5C C;  2GLO A;  5IP9 J;  3BG9 A;  3LSR A;  2P6T A;  1A6I A;  3M8E A;  1Y0N A;  3FKJ A;  2ZSH B;  3GWZ A;  2WB1 A;  3BCA A;  3CDL A;  1ZTR A;  3BR0 A;  4JX4 A;  3QP6 A;  5GAG J;  1S7A A;  3KPH A;  4YFN F;  3L2R A;  2K9N A;  2MAB A;  2HQR A;  1R1U A;  2V4J C;  3FXJ A;  4BE0 A;  1BBY A;  4C3J J;  2D5V A;  4DYQ A;  1TQM A;  1SVM A;  1U9O A;  1SFX A;  2GXA A;  3CCS I;  2E35 A;  5E3M A;  4HA8 A;  2XPV A;  2CMP A;  3BQY A;  2EH3 A;  2H8W A;  4CDG A;  1RUN A;  1GHC A;  3LNQ A;  3BTL A;  3LOC A;  1SC7 A;  1IDZ A;  3MZY A;  1FYM A;  3FHZ A;  2VBW A;  2WAQ N;  2CRG A;  4IXA A;  2E36 A;  1OCR H;  2EV0 A;  2L9V A;  4P5O A;  3CCL I;  3IAM 2;  3CZ6 A;  2FOW A;  3VYT B;  3H92 A;  4F52 A;  5ICE A;  4XOT A;  4P1W A;  4G7O F;  1G2H A;  4XLE A;  3G6E I;  1R71 A;  3O6B B;  5LD2 C;  1HKS A;  2DCE A;  2HYG D;  5IPA A;  1YLF A;  1HKQ A;  1UG0 A;  3BDD A;  1D1B A;  4OAZ A;  5GPC A;  4E7L A;  3S1R J;  2LF8 A;  3F6V A;  3SHF A;  4G7Z F;  4NNJ A;  2TDX A;  2DPU A;  1EA3 A;  2LF7 A;  2IBD A;  4RA2 A;  2HZD A;  2KPM A;  3LL7 A;  1HST A;  1R1V A;  4A0Z A;  2PBI A;  1QHH D;  2DMT A;  2FOK A;  4I7H A;  1FPQ A;  5ERI A;  2GOM A;  5KAI C;  2VBZ A;  2B9S A;  5ILV A;  3I71 A;  2ADU A;  1FTZ A;  1MBH A;  1W7P A;  3V8J A;  2DA4 A;  3TO9 A;  4PUS A;  3ZQG A;  4MIM A;  1MH3 A;  2MFZ A;  1TP4 A;  5L3G A;  2UXX A;  3ABU A;  1R1T A;  2GA1 A;  2BY0 A;  3FKI J;  2CV1 A;  4ZH4 F;  2LKX A;  1EF4 A;  3HUG B;  3BQZ A;  3G1M A;  2O0Y A;  3ZQ7 A;  2ICW G;  1Z9C A;  2O61 A;  4M6Y A;  3H35 A;  5IYB J;  1X3U A;  4MQ9 F;  3CF5 F;  3ZMU A;  5M5X J;  4G7H F;  4ITV A;  1P92 A;  3E5X A;  3K70 C;  1OLT A;  4YEJ A;  5LBQ A;  4YFX F;  2DQR A;  3ZQC A;  2PI0 A;  1GT0 C;  1ZK8 A;  2EZH A;  1X2M A;  1FOY A;  1TQP A;  2BBY A;  5F0H A;  1ZGJ A;  5FJ8 J;  2EZL A;  4B8X A;  3OYI A;  4OOI A;  3FXU A;  4GDF A;  2VQC A;  1S6L A;  3T1B A;  4RBO A;  3S14 J;  4B09 A;  1VQP I;  2EZI A;  2A5W A;  4D7N A;  4XQF A;  1TWA J;  4CHU A;  2GXG A;  3DTI A;  1VQK I;  4CXF A;  1SD4 A;  4MTE A;  4QPQ A;  2E2I J;  3K4B A;  3BJO A;  1JKQ C;  4KYW A;  3DBR B;  4D5F A;  3LWF A;  4FX4 A;  5LHG A;  1EH8 A;  5C44 J;  3JRH A;  2IS1 A;  2ZNZ A;  4GYI A;  3WTV C;  2QSG X;  2L01 A;  2M45 A;  4D0P A;  3VYU B;  1O7F A;  2CUZ A;  1G6N A;  4O6J A;  4EJU A;  4H4K C;  2B0L A;  3DLA A;  2O03 A;  1ODD A;  1AA7 A;  4XMY A;  4XK4 A;  1WCM J;  2GWR A;  3BJ6 A;  3AAF A;  1TC3 C;  4BDZ A;  1J75 A;  1ORK A;  3GBG A;  3DF8 A;  3A01 A;  1W7P B;  5ILU A;  2QQA A;  3L9F A;  4GGG A;  3N4M A;  3I3L A;  2ESN A;  2Y75 A;  1Z1D A;  1XGS A;  2LY9 A;  3H1C A;  1S72 I;  1TT0 A;  2ECC A;  4LG3 A;  3FWE A;  3CLO A;  2ZB9 A;  2Q0O A;  2YX7 A;  3HGY A;  1UAA A;  1WJB A;  2R5Y A;  1MSE C;  2GA2 A;  3ISP A;  3LSH A;  1E0E A;  2KIF A;  2XIG A;  4IRG A;  2DTR A;  3K1M A;  3VPR A;  2F6C A;  2CG4 A;  3G1L A;  4ZDP A;  3JRA A;  2XGD A;  1L0O C;  1QPM A;  4IVN A;  3ABL H;  2UV1 A;  4GYG A;  3SDB A;  3E7L A;  4A3I J;  4BQA A;  3CP2 A;  3ZQF A;  4G6D A;  3WE3 A;  3HOZ J;  1UHW A;  4W1U A;  3GTO J;  4AM3 A;  4FAS D;  1A36 A;  2YU3 A;  4KIC A;  1R00 A;  2G0E A;  4CYC A;  4CCO A;  2K02 A;  4ON0 A;  3K0L A;  3G4S I;  1K61 A;  1T6S A;  1SAN A;  1JT0 A;  1YJN I;  3H9J A;  1YTY A;  2DFI A;  2W4S A;  2GOX B;  2K3P A;  2FBI A;  3BPV A;  4PSW A;  4ZYG A;  4S05 A;  3D5L A;  4U87 A;  1XCV A;  3VOE A;  2L7F P;  2EIL H;  3K4L A;  2M0C A;  2JA6 J;  4Y52 J;  1U5T A;  3PQJ A;  5CVR A;  3JSP A;  4CCK A;  3EPZ A;  5C4J J;  1VQO I;  2GXB A;  1VND A;  2NAZ A;  3GFJ A;  2E1C A;  2KIM A;  5LRS A;  4QTR A;  2F4M B;  2ZO4 A;  1HW2 A;  4I76 A;  2E5Z A;  3G1O A;  3HBL A;  2IPQ X;  5CQG A;  5L3E A;  1W5S A;  2WB1 N;  4E7K A;  2AHQ A;  2GBY A;  2E1O A;  3KCC A;  3JTG A;  1RET A;  4L5I A;  4L0Z B;  2QEN A;  3WOD F;  2DA6 A;  2R7W A;  2D45 A;  1RZ4 A;  2VKE A;  1MGT A;  2OCE A;  3S8P A;  4XOR A;  1R4M B;  3A01 B;  2M30 A;  2WY7 Q;  1F43 A;  2HWV A;  4ETS A;  2OJE D;  3P9K A;  4KMU X;  4MFD A;  3TKY A;  3F8M A;  4A6D A;  4HYE A;  4BXF A;  3K6G A;  1PDN C;  2DK5 A;  1F9N A;  5LGN A;  1R7J A;  4E7H A;  2DYS H;  2MD0 A;  4XLA A;  3IH4 A;  1RNL A;  2A61 A;  2R5Y B;  1TT5 B;  4RB1 A;  1BL0 A;  3ZQH A;  1XB4 A;  2F48 A;  3DPL C;  1Q1H A;  2M7A A;  4BE2 A;  4D1Q A;  1KZH A;  5ED4 A;  3NWT A;  3RKQ A;  1N75 A;  1F36 A;  1AKH A;  3LST A;  4IZZ A;  5C4X J;  3S3M A;  3ZPL A;  3GVA A;  4I98 B;  1FOK A;  3MWM A;  2HNH A;  4HDV A;  1Z91 A;  4J00 A;  1S7O A;  2X1D A;  4CYC B;  2W7N A;  2XF6 A;  3BR6 A;  1YRN A;  4V19 K;  3OWT A;  2XB5 A;  1IC8 A;  2NVT J;  2J5P A;  2P6S A;  2VQH A;  4HQM A;  1O3R A;  3HOT A;  3VSL A;  3QYB A;  4BYY A;  2PX9 A;  5J1R A;  4RB0 A;  2XV4 S;  4LIU A;  2KRC A;  2K7L A;  2WBM A;  3MD2 A;  1ETQ A;  3FK7 A;  1I1S A;  3ZN1 A;  5IOZ A;  1U5T B;  2V6C A;  2ZC2 A;  2VT3 A;  5LLQ A;  3OYF A;  3JW4 A;  1WJA A;  2EIK H;  3AG2 H;  2L02 A;  1N78 A;  3IKT A;  2A05 A;  3GTL J;  1HA8 A;  2LFB A;  2EK5 A;  4MLO A;  2KL4 A;  3TW7 A;  3F23 A;  2ZCW A;  2R7R A;  4XNF A;  4M3G A;  2ZXI A;  2H27 A;  1DU0 A;  2R92 J;  3S16 J;  2CS3 A;  1QO0 D;  2OAZ A;  4HV6 A;  2F5F A;  3ELK A;  1SD5 A;  1JKR C;  5E1W A;  4RGX A;  1MJB A;  5FLM J;  3CCY A;  3E0J B;  2F2E A;  1R4N B;  1JUP A;  4H0E A;  3EDP A;  4AYB A;  4KIS A;  2VPL A;  3TW6 A;  2VC1 A;  1QZZ A;  4UHT A;  2ME6 A;  4Y7N J;  3V7S A;  4L0Y B;  1WRJ A;  2F5E A;  3I9V 2;  1ERD A;  5DD4 A;  3HB9 A;  2PJP A;  1YQA A;  2X1C A;  2J5O A;  1RI7 A;  1IXR C;  2RNG A;  2E2J J;  1OR7 C;  1P7I A;  2IRF G;  1AKH B;  3CCJ I;  2Y69 H;  3JRF A;  2K4J A;  3CJQ B;  2DA7 A;  1Y6I A;  4PZJ A;  1KGS A;  3MAJ A;  5K5R A;  2P5V A;  5FKL A;  3AG4 H;  5FLX K;  2Y9Y A;  4R1H A;  1YRN B;  1MH4 A;  4PJJ A;  2DT5 A;  2N8G A;  2R0Q C;  4OIO F;  2HDW A;  2VQG A;  3CO6 C;  3GCM A;  3QYF A;  3FMR A;  1I3Q J;  5IY5 H;  2MH2 A;  1UEL B;  1WGX A;  4AIJ A;  3S3N A;  3M07 A;  1IDY A;  3BR2 A;  5TGT A;  4NC6 A;  3Q0W A;  4ENM A;  3K4C A;  1X4O A;  5F04 A;  2F5D A;  3KE2 A;  5FKN A;  2K5C A;  2VBY A;  1IN7 A;  5D5V B;  2V9V A;  3PFI A;  4RLQ A;  4DBR A;  4R79 A;  3AG1 H;  1BI1 A;  3RCO A;  3AL0 C;  4K2E A;  1BC8 C;  5FLX Z;  4M9X A;  2LC2 A;  3B6C A;  5LGT A;  2RDP A;  3DU5 A;  2NVQ J;  2XAU A;  1YOV B;  2OF7 A;  1ETK A;  2XDV A;  3W2V A;  1OCO H;  2DA3 A;  3P7N A;  4E70 A;  3KP7 A;  3OYE A;  1LVK A;  1J9I A;  3W6V A;  5GP9 A;  2CQX A;  4UB8 C;  5BPI A;  3WTW C;  1EKE A;  4U7B A;  2UWM A;  2DYR H;  3E6C C;  4A12 A;  4HNV A;  4C2T A;  1MZB A;  3S32 A;  5HOO A;  1IZ1 A;  2ZXW H;  3MEX A;  3Q0V A;  4NC7 A;  1J2X A;  1WJE A;  2VUM J;  1XG1 A;  2KT0 A;  1A5J A;  1LNW A;  3OIP A;  2K9Q A;  3GLL A;  3HRT A;  4ZTF A;  4F93 B;  1HF0 A;  5GPA A;  3QU6 A;  4Y17 A;  1MBF A;  2M87 A;  4B4C A;  1IGN A;  1ZLJ A;  2DK8 A;  1ZRE A;  1ETO A;  1VZ0 A;  3OR1 C;  2L2O A;  4MEY F;  2PQ8 A;  4PJL A;  3I4M J;  3GTM J;  3AG3 H;  1V3F A;  4G12 A;  1RIO H;  2CGP A;  2OUM A;  2E34 A;  1LFB A;  2DN0 A;  3HHH A;  4PJN A;  3WU0 A;  2V26 A;  2CV0 A;  4E7Z A;  2DMN A;  3JRC A;  5B5E C;  2FBK A;  2V1D A;  2HQN A;  2H09 A;  3J80 K;  1CF7 A;  1W36 C;  4QWQ A;  3R4K A;  3DTE A;  3QOD A;  4EM2 A;  4HNT A;  3WG9 A;  4PJM A;  2JJ7 A;  1K79 A;  1FX7 A;  2RC4 A;  4FHT A;  1SFO J;  3F21 A;  3CCQ I;  2VJ4 A;  4UY8 I;  1NG7 A;  5GAE J;  3VYR B;  4IHY A;  3DV8 A;  1MBJ A;  2QWW A;  3TP0 A;  1LEA A;  1TWC J;  3HOX J;  1NH3 A;  3FHN A;  4L9N A;  2M7B A;  3WTX C;  3GF2 A;  1G59 A;  1FC3 A;  2ZXH A;  4B43 A;  2OTL I;  3LA2 A;  1RKW A;  5DCM A;  1U78 A;  5DD8 A;  3QPH A;  2CQQ A;  4EJV A;  1J09 A;  3MQ0 A;  4Q5S F;  3J80 Z;  4BHP A;  1IRG A;  2DFF A;  1IRZ A;  3J7Y J;  1FEX A;  5D5X B;  1C0W A;  1GV2 A;  3ASO H;  4DQ2 A;  6PAX A;  2DXI A;  3K7A J;  3GTK J;  2JSC A;  1W7P D;  3B02 A;  3QPS A;  3S2W A;  5HS7 A;  4CSW A;  3RZD J;  1USS A;  1AHD P;  2IAI A;  1R49 A;  1BA5 A;  2EBI A;  4BGD A;  4HLY A;  1Y8R B;  5F27 A;  1W5T A;  4BDY A;  1MW7 A;  1S3J A;  2L7M P;  3OY9 A;  2XKO A;  2H1L A;  3DQV C;  5BMZ A;  4YRV A;  3C18 A;  1OMI A;  2WAF A;  2X48 A;  5M3F J;  3PSI A;  3KYD B;  1BJZ A;  2VE9 A;  4UUV A;  3P5J A;  3BJA A;  5ICG A;  3WU1 B;  2CV2 A;  4OAY A;  4FT8 A;  3I5U A;  4HOB A;  1XSV A;  4YII A;  3W2A A;  1RPW A;  5E79 C;  5IOY A;  4CCJ A;  3OR2 C;  2WV0 A;  4WCG A;  3HZJ A;  1H88 C;  4HEA 2;  2KRH A;  1IJW C;  5HDG A;  1Z3X A;  1BI3 A;  2AQF A;  5LHI A;  4DJA A;  1OCP A;  3D5R C;  3GEZ A;  3MMY B;  2E71 A;  2MH9 A;  2CFO A;  1DDN A;  2V79 A;  5J4V A;  2R7U A;  4LLG F;  4F91 B;  2X6W A;  2COB A;  3UKG A;  2QVO A;  1FYL A;  3CCV I;  1Z7L A;  2Y2Z A;  1FMW A;  2XAJ A;  1V5F A;  4QIW N;  2CUE A;  5JLW A;  1CF7 B;  1YW8 A;  1MBK A;  3CMA I;  4IRH A;  3OYM A;  4EJW A;  4E4H A;  1TL8 A;  4KMF A;  2FNA A;  1VQ4 I;  2I10 A;  3I53 A;  2LMD A;  2ETH A;  2E60 A;  1UJ8 A;  4Y13 A;  2A68 F;  2FQ3 A;  3BG3 A;  4LK0 F;  4C3I J;  1ZG3 A;  4I01 A;  4ZJZ A;  4MEX F;  2LKP A;  3I4P A;  3CCM I;  2PN6 A;  2C6Y A;  1VQN I;  5BS6 A;  3HKZ A;  3PFY A;  3OS2 A;  4RMN A;  2W84 A;  4YEL A;  2OZU A;  5DCM B;  1JE8 A;  3IWF A;  3DBH B;  2DI3 A;  3MKZ A;  3M3Y J;  2JTV A;  2M4G A;  2COM A;  3HSF A;  1Z7U A;  5F6F A;  1JUS A;  1RKT A;  2BW3 A;  2KQR A;  3A1Y A;  4HZF A;  1T0F A;  3JAM K;  4BQQ A;  5E1Z B;  4PGH A;  5DCF A;  2Y31 A;  4M6X A;  3SEZ A;  4AIH A;  1WJC A;  2ZJR F;  2JN6 A;  2DLL A;  2JVH A;  3H5N A;  4ASN A;  3NAU A;  3U1D A;  2NOJ B;  3OYD A;  1ZYR F;  2EIN H;  2NS7 A;  2M2E A;  4BXU A;  2HFH A;  2F4O B;  2FF4 A;  1FOX A;  3U1K A;  1ETW A;  4Z2Y A;  2VOP A;  2LYC A;  2X51 A;  2K3F A;  4C30 A;  3JAM Z;  3DP7 A;  2XAS A;  5BPD A;  3R61 A;  2QF7 A;  5FKM A;  2VXD A;  2CUF A;  1ZLK A;  1D0Z A;  4XIC A;  2DMU A;  4IX7 A;  4A3J J;  4RB3 C;  2FRH A;  2Z1D A;  1L3L A;  3BZ6 A;  1WZ2 A;  4BQN A;  2Z2S B;  2HTS A;  4JX5 A;  2KHM A;  2BOL A;  5HNF A;  3VOD A;  3H0D A;  1QVU A;  4LB5 A;  2NNN A;  1FTT A;  2ZJQ F;  3KEQ A;  4XRS A;  1IN6 A;  2QLZ A;  5HDN A;  1Y1W J;  4B48 A;  5DV5 A;  3H3U A;  2FML A;  4KFC A;  1P9Q C;  5IYC J;  3OOP A;  3NQO A;  1AOY A;  3HXL A;  3ZQI A;  3CLQ A;  3SFZ A;  3V7C A;  3G71 I;  2PJR A;  2ZFU A;  3QAH A;  4JBA A;  2KJB A;  1U2W A;  2UXN A;  5F08 A;  3DKY A;  2WV1 A;  1PJR A;  1V54 H;  4Y33 A;  3ABM H;  1JGG A;  3FZV A;  1LVA A;  5E3L A;  1LJ9 A;  5B3S H;  1T0F C;  4U0W A;  3RQ4 A;  2DFH A;  4KT6 A;  3ERE D;  2NVY J;  3IRR A;  1UB9 A;  1O57 A;  3H5R A;  3AKZ A;  4X0G A;  3HYI A;  2BW3 B;  2V1X A;  5FLV A;  1T95 A;  3W2W A;  4RB2 C;  2FU4 A;  3BG5 A;  3ZXS A;  1IW7 F;  2OQG A;  4ZZL A;  2Y0S A;  3CCR I;  5K7Z A;  1QGP A;  1WJF A;  5F0C A;  2L9R A;  1SMY F;  1SVO A;  1BI2 A;  2BY2 A;  4HRI A;  3KP5 A;  3LAJ A;  1HXD A;  2IA1 A;  4MQV A;  1DP3 A;  2QQ9 A;  1EJ9 A;  4YFK F;  4HF1 A;  1BW6 A;  2P5K A;  3OS1 A;  5ICF A;  3FXO A;  1F5T A;  4A3L J;  4EQQ A;  2QCO A;  2H6C A;  2CSO A;  1YW7 A;  4FIS A;  5E3O A;  3JRG A;  2M3A A;  2D2W A;  3MZH A;  1VQ5 I;  3L2C A;  2R7X A;  1WKM A;  4XN3 A;  2A6E F;  2R7O A;  3QYE A;  3VYS B;  2HPM A;  1X2N A;  4Y4R A;  4XLH A;  3B73 A;  3ZN0 A;  2OV7 A;  1FSE A;  4ESF A;  2V9K A;  4BUP A;  4IHS A;  2OC6 A;  3MN2 A;  2NVX J;  4XLF A;  3IC7 A;  3IHU A;  3K69 A;  5GAH J;  4HBL A;  1BR2 A;  3V8K A;  2O5R A;  1FP2 A;  4KN4 X;  3S93 A;  1X19 A;  3F22 A;  3CD6 I;  2XPW A;  3CJN A;  3IWZ A;  3HG9 A;  2P4W A;  1K4T A;  4X1E A;  4V2G A;  2VKV A;  2HXO A;  2DTZ A;  1MD0 A;  1E2X A;  3CC2 I;  2ACJ A;  2VXZ A;  1XCB A;  4RGR A; 
#chains in the Genus database with same CATH homology
 3DPL C;  2M7A A;  4II3 A;  4BE2 A;  4D1Q A;  4E7I A;  4D9J A;  3NWT A;  4NC8 A;  1N75 A;  4BU2 A;  4IZZ A;  3ZCO A;  3LSM A;  3S3M A;  2PJR B;  2P0W A;  1Z3Y A;  2HNH A;  2ZSI B;  4J00 A;  3OYG A;  2X1D A;  3E1S A;  2W7N A;  2XF6 A;  3K4N A;  3OWT A;  2VJ5 A;  2CUJ A;  2IS2 A;  4CA0 A;  1LKX A;  1KON A;  4Y3O A;  2VQL A;  4HNU A;  2VQH A;  4RM2 A;  3HOT A;  3VSL A;  2L9N A;  5HLT A;  3QYB A;  4LIU A;  2KRC A;  2WBM A;  3MD2 A;  2WAD A;  3HL2 A;  2DOA A;  2IXS A;  3PUB A;  4QPO A;  4B47 A;  3RSN A;  3OL4 A;  3EUK L;  4KIT B;  3OYF A;  2K9M A;  1WJA A;  3A4C A;  3LSK A;  1MNE A;  2XSJ C;  1N78 A;  5FRO A;  3HPH A;  1Y56 A;  1HA8 A;  2Z16 A;  3OYL A;  2VKH A;  4RM3 A;  4MLO A;  2KL4 A;  3G2B A;  4BQO A;  3VWB A;  2R7R A;  4XNF A;  2ZXI A;  3LSG A;  4EAT A;  3OL3 A;  2CS3 A;  1LDK B;  2W82 A;  1BOB A;  4GRI A;  4RLF A;  3DU6 A;  2LRE A;  3OYN A;  2HQA A;  3ZQQ A;  4LIV A;  1MMN A;  5HVQ C;  4AVZ A;  3PL8 A;  4JOM A;  2JUG A;  3TBI A;  4B3X A;  1Z21 A;  3E0J B;  3PNY A;  4XKV A;  2HPI A;  4AYB A;  4KIS A;  2VPL A;  4BJ6 C;  2E1M C;  4FET A;  4G6T B;  2QKL B;  3OIQ A;  1DQU A;  2IS4 A;  2RQQ A;  4CCM A;  3I9V 2;  1ERD A;  3HC7 A;  3HPG A;  4CZC A;  2E1M B;  2X1C A;  2X6Y A;  2VLA A;  2RNG A;  1OR7 C;  2JVG A;  4XL9 A;  3BG7 A;  2M0M A;  3K10 A;  2IGN A;  2LH9 A;  3TL4 X;  2F4I A;  2RRE A;  3PSF A;  3CJQ B;  2DJI A;  1Y6I A;  2LY1 A;  2K9L A;  3DKX A;  2A6T A;  2MC4 A;  3NWS A;  3M8J A;  3TMO A;  4ZDO A;  2LG4 A;  2Q2E B;  3DPT A;  4PJJ A;  1X1C A;  4HG2 A;  2HDW A;  2VQG A;  1WJ5 A;  3QYF A;  3QOE A;  1X4P A;  3ZRG A;  2IS6 A;  2LY2 A;  4PK4 A;  4IQJ A;  1UEL B;  3S3N A;  5TGT A;  3BLY A;  3OYC A;  1YX3 A;  3L2Q A;  3EUH C;  3K4C A;  3L2U A;  4XKC A;  2BVM A;  1MMD A;  1WJD A;  1X4O A;  4CH7 A;  2CW8 A;  4XM3 A;  4C2U A;  2K5C A;  2LOO A;  4IQ4 A;  3CMM A;  4RLQ A;  4R79 A;  4DBR A;  2R7T A;  1GLN A;  3RCO A;  3AL0 C;  2LC2 A;  4N4N B;  1IRX A;  1D1C A;  3DU5 A;  2I8D A;  2XAU A;  2WY8 Q;  3F9K A;  1D0X A;  2XDV A;  3W2V A;  3OYH A;  2W00 A;  3OYE A;  1LVK A;  1X1A A;  1K6Y A;  3K4K A;  2JA2 A;  3SEQ A;  2KDO A;  4DGW B;  4E6K G;  4U7B A;  2UWM A;  3A2K A;  3SZG A;  3IUO A;  5CPR B;  4ZYA A;  1X1B A;  4C2T A;  1U0J A;  3S32 A;  5HOO A;  1FMV A;  4NC7 A;  5HNH A;  2QKM B;  1WJE A;  4AU7 A;  2CH0 A;  4CCN A;  2UUZ A;  3OIP A;  2XF5 A;  3D5S C;  4ZTF A;  4F93 B;  4XLC A;  2F5V A;  1JI8 A;  3U21 A;  3CJR B;  2KZV A;  3DEE A;  1DGW Y;  1VZ0 A;  3OR1 C;  2L2O A;  3OS0 A;  4PJL A;  3PJR A;  2HVS A;  1R6R A;  3KYL A;  3ONQ A;  2IGM A;  2OUM A;  2CV0 A;  4PJN A;  2V26 A;  4E7Z A;  4C9Y A;  2ELJ A;  3PNT A;  3FKJ A;  1V5G A;  2ZSH B;  1W36 C;  2WB1 A;  3BCA A;  3DTE A;  3QOD A;  4HNT A;  1TZL A;  4DIQ A;  4PJM A;  3L2R A;  2MAB A;  2V4J C;  3BCB A;  4BE0 A;  3CP8 A;  1N77 A;  2VJ4 A;  1NG7 A;  3VYR B;  4F92 B;  4BAC A;  3FHN A;  2M7B A;  3HOS A;  2R4G A;  3BC8 A;  3LSI A;  1G59 A;  4B43 A;  2ZXH A;  2KMU A;  2CMP A;  2XC7 A;  1J09 A;  4P5O A;  3IAM 2;  3CZ6 A;  3VYT B;  1S9H A;  2IGO A;  4F52 A;  2DXI A;  1WFX A;  1W36 D;  4XOT A;  4P1W A;  4BJT A;  4CUG A;  4XLE A;  4CSW A;  4ANJ A;  2LBF A;  5LD2 C;  2VIX A;  3L2W A;  2DCE A;  3S3O A;  4BGD A;  5LFA A;  1UG0 A;  1D1B A;  4OAZ A;  4E7L A;  4BDY A;  2KP6 A;  1MW7 A;  3M1C A;  4NNJ A;  5KCM A;  3OY9 A;  2L5Q A;  4ZTJ A;  2LRD A;  1EA3 A;  4DOZ A;  3DQV C;  2HZD A;  4YRV A;  3RTR A;  2WAF A;  4E7S A;  5CQE A;  2KPM A;  3LL7 A;  3PSI A;  5FRM A;  1QHH D;  1QU3 A;  2GOM A;  2CV2 A;  4OAY A;  4ZDL A;  3PNV A;  3MKW B;  3W2A A;  4PFO A;  3UNG C;  4BJ5 C;  4CCJ A;  3OR2 C;  4PUS A;  3IAS 2;  3LMM A;  4HEA 2;  2KRH A;  2MFZ A;  1Z3X A;  2AQF A;  3OYB A;  4II2 A;  4DJA A;  3H5A A;  2CV1 A;  2E5N A;  3D5R C;  3HUG B;  3MMY B;  4JQF A;  2CFO A;  1ZEL A;  2R7U A;  4IKF A;  3C2H A;  4F91 B;  2X6W A;  4E7J A;  3H35 A;  4BEH A;  1Z7L A;  1FMW A;  2IGK A;  1V5F A;  2VB6 A;  1SAU A;  4ITV A;  2DT7 B;  3OYM A;  4E4H A;  4J01 A;  3K70 C;  1OLT A;  4YEJ A;  2MYS A;  1BR4 A;  2WAE A;  4ZC3 A;  4KJZ A;  1YE9 A;  2E60 A;  3N05 A;  2V7F A;  3AL0 B;  2R7V A;  3H9Q A;  1DGR M;  4HST A;  4ZJZ A;  1MMG A;  2WA0 A;  3HKZ A;  3OYI A;  3OYJ A;  3PFY A;  3OS2 A;  4RMN A;  1MND A;  4YEL A;  2VJI A;  5KNL A;  4XKB A;  3MKZ A;  2VQC A;  2L9S A;  2M4G A;  2XF7 A;  2KQR A;  3A1Y A;  2BW3 A;  2M4K A;  2V1N A;  4PFP A;  3L2V A;  4BQQ A;  3ZR8 X;  1BR1 A;  3DPU A;  2A5W A;  4F55 A;  4B44 A;  2R7S A;  4BL0 B;  3SEZ A;  4XQF A;  3CF2 A;  5JHF A;  1WJC A;  3DTI A;  3K70 D;  4XOP A;  2LBF B;  2JVH A;  3H5N A;  4QPQ A;  2NOJ B;  4XKW A;  3K4B A;  3OYD A;  4N4O B;  2JSP A;  3AFH A;  2IS1 A;  3ZGK A;  2V6E A;  3OYK A;  1D1A A;  3VYU B;  2CUZ A;  2LYC A;  3V42 A;  1SFK A;  1MMA A;  2X51 A;  4C30 A;  4H4K C;  3DLA A;  3FBN B;  2FUG 2;  1AA7 A;  4XMY A;  3K4M A;  2VL8 A;  3SYT A;  3CES A;  2VXD A;  4BDZ A;  3OYA A;  1YX5 A;  1D0Z A;  3GBG A;  3MKY B;  4IX7 A;  3I3L A;  4CCL A;  4DBQ A;  4OWR B;  1PYV A;  2Z1D A;  5KHD A;  1TT0 A;  4LG3 A;  2VKD A;  4BQN A;  2Z2S B;  2KHM A;  2BOL A;  5HNF A;  1UAA A;  1WJB A;  3C2G A;  3H0D A;  3LSH A;  3DWL E;  2HVR A;  1E0E A;  3J7A Y;  5CKT A;  5FRN A;  2X85 A;  3LFU A;  3OOU A;  2F6C A;  1LFP A;  4BEH B;  4LIT A;  4ZDP A;  4B48 A;  2X1E A;  4XN0 A;  1P9Q C;  3VDX A;  3H9G A;  3HXL A;  2UV1 A;  3SDB A;  3OMY A;  2PJR A;  2ZFU A;  3CP2 A;  2R7Q A;  2VAS A;  2HVQ A;  2AQE A;  3DKY A;  2DT6 A;  1PJR A;  4FAS D;  2Q1Z B;  3BG6 A;  4Y33 A;  4CCO A;  2PMZ A;  1T0F C;  4F3Q A;  1NG6 A;  3KEY A;  4KT6 A;  2X6X A;  3RQ4 A;  3H9J A;  2W4S A;  3KX2 A;  2GOX B;  2K3P A;  3H5R A;  4PSW A;  3AKZ A;  4X0G A;  3D5L A;  2BW3 B;  4BS9 A;  4U87 A;  4PSX A;  1T95 A;  2CW7 A;  3VSK A;  3W2W A;  3K4L A;  3ZXS A;  1D0Y A;  2Y0S A;  1WJF A;  4HPQ A;  4CCK A;  1QHG A;  3EPZ A;  3DTK A;  3IP4 B;  4XR6 A;  4HRI A;  1DP3 A;  1G8X A;  2E5Z A;  5CQG A;  3OS1 A;  4E7K A;  4NUB A;  2KLO A;  4NQW B;  2M3A A;  4BE1 A;  2HU9 A;  2R7W A;  2BVL A;  4XN3 A;  2R7X A;  2R7O A;  3QYE A;  3VYS B;  1V5E A;  2HPM A;  3S8P A;  3FDY A;  4Y4R A;  4XLH A;  4XOR A;  1X1D A;  3RPU D;  2WY7 Q;  2OV7 A;  4HSR A;  2V9K A;  4BUP A;  2OC6 A;  4XLF A;  2VJJ A;  2WAQ A;  4BXF A;  1BR2 A;  2O5R A;  3K6G A;  2W1O A;  3S93 A;  1X19 A;  3UR3 C;  4E7H A;  3EUA A;  2MD0 A;  3HG9 A;  4XLA A;  3K4J A;  2L7K A;  4XON A;  3FBI B;  2VXZ A;  3W3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...