4X0GA

Structure of bsg25a binding with dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
PMVTIGPNGTEVSRISLSAINWAMTGPSITRKLLCEIFDRDTLAHHTLSGKPSPAFRDCARPSKQQLDPLKVADLVYLMTNSCDMTPREVRTAITTKCADENKMLRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blastoderm-specific gene 25A
publication title Common and distinct DNA-binding and regulatory activities of the BEN-solo transcription factor family.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein/dna
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10523 BEN BEN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4x0gA00
4X0GA 4IX7A
chains in the Genus database with same CATH superfamily
4M9SA 2A68F 1S29A 1XTAA 4NDLA 2MC3A 4C2UA 5E18F 2AXLA 3E6DA 1NTCA 2DBBA 1U5TC 3CC7I 2H27A 2FMLA 2D2WA 3KP2A 1V5GA 3BZ6A 1ZG1A 1RR8C 4ON0A 3GTLJ 3WTZA 4Y3OA 5K5RA 1MDMA 1ZR4A 2H6CA 3ZQIA 2ZJQF 1FTZA 1GLNA 2V26A 2KIUA 2NRAC 4HX4A 4L0YB 3RYRA 3F21A 2Z3YA 3EDPA 3FKIJ 1MGTA 5D4RA 4Q48A 1ZARA 3QYFA 5LHIA 1P6RA 2EV5A 4AU7A 1NK2P 5CVUA 5D8KB 2WAQN 1ON1A 2A6HF 3IRRA 2R7ZJ 3MWMA 4PGGA 2HXOA 3H92A 3BR5A 4ZZDA 4C9YA 3PUFA 2MBFA 4LMYA 3EUHA 3VSLA 1DP7P 2VC1A 1ZRCA 4EM1A 3FWEA 1PP8F 4HSTA 3R4KA 4IEJA 3ZMTA 4XONA 2ZJ2A 3VB2A 1QGPA 3B02A 3I71A 4WF2A 3TMOA 2GXBA 2XAQA 4M3BA 4UXNA 1LQ1A 2PEXA 4S0HB 1YTYA 2DOEA 4WCGA 2BV6A 2CQ7A 2CFOA 4XMYA 3S3OA 3K4KA 5LLQA 1BBYA 4WWCA 5L3GA 1I3AA 4YRVA 4LGWA 4XNFA 2HQNA 5HDKA 1JKPC 2OV7A 3TW7A 1JGSA 3FM3A 1F36A 3K7AJ 4XKCA 1YO5C 2EH3A 3I9V2 4ENNA 3BPXA 3CCJI 3GVAA 2Y9YA 3DPLC 2FQ3A 4ZDPA 4QWQA 3I4NJ 2JWTA 3RYPA 3F8CA 3ASOH 3CDIA 4Y13A 1X1DA 1USSA 2CUFA 4XICA 1XS9A 1ON2A 1BOBA 5J6XA 4UVAA 9ANTA 2HVRA 3CCVI 2VQGA 1KQ8A 2W85A 4OOIA 5L3FA 1QQIA 1B59A 2NNYA 1X58A 3JTHA 2XPVA 4D9JA 3PFYA 2DT5A 2M3AA 2NVYJ 3L2VA 1YIOA 4UV9A 1V55H 1O4XA 3G6EI 2X9DA 1HDDC 4U0YA 3ONQA 3CF2A 5HDNA 4G6DA 3OV8A 1OQYA 3CO7C 2LH9A 3G73A 1K4SA 1V5EA 4NQWB 5KAFC 1D1BA 4OAZA 1BR1A 2W00A 2ZFWA 1JGGA 2CWEA 2QWWA 2EINH 3E5UA 2DK8A 3ROUA 3REOA 3FZVA 2EV0A 1I1SA 3T8TA 4CH7A 3SEZA 3OIQA 4G6QA 3DLAA 1W0TA 2E2HJ 4D7NA 2HQ5A 2E34A 4KYWA 4A5NA 3B6AA 4UVCA 4KFCA 3SXYA 5LHHA 1WH5A 3IV5A 3T5XA 3F9KA 3K69A 5DM6F 1HOMA 4BKXA 3U21A 3JCUC 1S7AA 1TQMA 2DU9A 3OOPA 5FKMA 1OCOH 2LYCA 4F91B 4CZCA 2F4OB 2OD5A 1LNWA 5AIPA 2BVLA 1WJCA 3FXOA 1YHQI 2NVXJ 3QOPA 4OAYA 4ESBA 1WWXA 2VPLA 4BL0B 5GAHJ 2ELHA 2IGNA 4MGRA 1OYIA 2VL8A 2OTLI 2LRDA 3WODF 4KIGA 4OIQF 4QPOA 4A0YA 2HPMA 1TNTA 1TWAJ 3TO9A 2A6TA 3CDHA 1S5LC 3QPHA 3CJRB 1XMAA 3BG9A 4I7HA 3TOAA 4CSWA 5JVTA 1KONA 2O7OA 3W2AA 3DKWA 1UHSA 3ZPLA 2ZCWA 3E3VA 1IXRC 5FLXK 1ZK8A 3WGIA 5ILVA 2A5WA 4MEXF 1FC3A 1O57A 4A6EA 2XDVA 1RETA 2EJRA 2VBXA 3CUQB 1IN4A 2BY2A 2ZNZA 3LSTA 5DYMA 2ESHA 1YYVA 2QUFA 1H9TA 3OWTA 4IHSA 2TCTA 2H1KA 2R5YB 4FHTA 2FSWA 4DBQA 2JA6J 1VQ7I 2DQRA 3FHZA 4N9HA 3PJRA 1OR7C 4WXDA 3CDLA 3I56I 4O6JA 1P4XA 1R36A 2ZMEA 5K5QA 1FX7A 4M72A 2NAZA 3WTWC 4EMSA 1TQIA 4Z2YA 3HIFA 5F6FA 1HC8A 4NHJA 2VODA 1Q1HA 1G2HA 4UUSB 3RKWA 2RNJA 4B3AA 2KT0A 2IRFG 1MW7A 2RQQA 3LFUA 5JLWA 5C3EJ 2OQRA 4CA0A 3M3YJ 3OYKA 2VUMJ 3PQKA 4FX4A 5FROA 2WC2A 3F8BA 1L3LA 4DBRA 4XOPA 4L5JA 3MZYA 4PSWA 2E1MB 2P4WA 5DDGA 2K86A 2NOGA 1YX5A 2QF7A 3VOEA 5DD8A 1JKOC 3L9FA 4X0GA 3BJ6A 4Y7NJ 2XGXA 4BGDA 3NWTA 3ZOBA 2BW3B 3GFMA 5LBQA 3WU1B 1IZ1A 4BNCA 1D5VA 5HVQC 5DCMB 1K4TA 2DFHA 5FGMA 3S8PA 3TDZC 4HAMA 4U88A 3VDXA 1T0FA 2BBYA 3PO3J 1JKRC 2KKOA 2WY8Q 4LIVA 1QVTA 4BHCA 1JT0A 3SEQA 2IA1A 1X3ZB 4ESFA 2XHKA 3CO6C 1ZYRF 1KYWA 3QU6A 2FJ1A 2O3FA 3MFKA 1XCVA 2DA3A 3IUOA 2MYSA 3GX4X 3ERED 4YIIA 1B72B 4U7BA 1R6RA 4JQFA 1MMAA 3OYMA 1X2MA 5HS7A 3FX3A 2IT0A 1RRJA 1XG1A 4Y4RA 5K7ZA 2EFQA 1IF1A 1X4OA 1E2XA 2JUCA 5GAEJ 3OS1A 2A5YB 4RB0A 1LE8B 1I3QJ 2K40A 2HDWA 3ZQLA 2G7HA 3BTLA 5M5YJ 1Z05A 3CCUI 4I76A 2L7MP 3C1DA 1I1GA 3EPZA 2XF5A 3MKZA 1IN7A 5DM7F 2IVMA 4A2UA 2PJRB 3MD2A 1B8IA 3LA3A 4M9XA 5BMZA 1ZGWA 5J40A 1IV8A 3KEOA 2X1EA 5F1JA 3HRTA 2IGMA 1MBEA 3R0JA 2VKVA 2VE9A 4F93B 1R23A 2Y9ZA 4HSRA 2ZJPF 1IC8A 4R8HA 1G3TA 3T8RA 1ULYA 2EB7A 2LY2A 3QYEA 3I53A 5ED4A 2E7WA 1R1TA 1YS7A 1W7PB 3CMMA 4A0ZA 2R7VA 2GOMA 1D0XA 4U87A 3S32A 2F5CA 4PJMA 5F1RA 2CQKA 3IH2A 2CW8A 2IS4A 3K70C 4F52A 3PSIA 2A3SA 2L9VA 2MLKA 5B1BH 1AOYA 2FUG2 2L9SA 2VJ5A 2JA8J 4L9TA 3QOEA 1LFUP 1G4DA 4KNYA 2HTJA 3WE2A 1JKQC 1CF7B 1UMQA 1U8RA 1OFCX 2Z16A 1P2FA 4L9JA 4ZJZA 3S1QJ 5HS8A 1E17A 4RAYA 2BZTA 3HUGA 3EYIA 2HVSA 1FMWA 4GO1A 1J0RA 1SFKA 4ZZLA 1H0MA 3GZ5A 1F9NA 3A4CA 1J9IA 5D6EA 2DYSH 4MIMA 3MVPA 3OIPA 5FLXZ 1QNTA 2HR3A 1KA8A 2M8EA 2QVOA 3GFIA 2W7NA 2V7FA 3NAUA 2L4MA 1SVOA 3R60A 3ZQHA 4OINF 1RNLA 2BEOA 4K2EA 4LJZF 1FBQA 4A0XA 2IS1A 4ZYHA 4ZYEA 3LWFA 2PJPA 1OCTC 3M07A 3G1OA 1MMSA 1SD7A 3IRQA 1J5YA 2F4MB 5HNFA 1TL8A 3J80K 3MEXA 1AHDP 2EZHA 3IWFA 4HYEA 4S04A 1YJ9I 5EEHA 4E7HA 1K79A 1E0EA 5AONA 3ZRGA 2DW4A 3TKYA 5LRSA 1DPUA 2QA4I 3H5RA 4B48A 3GXOA 4AC0A 2XIGA 1XGMA 2DA7A 1MBFA 4OMYA 1X1PA 5LD2C 3V8LA 2V1UA 4FCYA 4H0EA 1YE9A 1XC5A 3HOXJ 2DA2A 1T39A 3LOCA 5LGNA 2ELJA 2LKSA 2OZUA 2K9QA 2O8XA 4ZYAA 5FKNA 2DPUA 1DQUA 1R5ID 2EA4A 3K6GA 4L5IA 1OPCA 4CYCB 2LBFB 3S14J 5K1YA 5M3MJ 3BCAA 2Z5UA 1TC3C 4MTEA 3S15J 4M6YA 1UFMA 3BTIA 1Y8RB 4B4CA 1WI9A 4KUMA 2HEOA 3H3VK 2CV2A 3GO5A 5E1WA 5E17F 1QHHD 3E6BA 2XGDA 4P96A 2KP6A 2L54A 3BJAA 1BIAA 2NXNB 3BQYA 1L0OC 3BZKA 2IP2A 4M3DA 1QA6A 3H0GJ 2E1CA 3CCRI 4DYRA 3H35A 4XK4A 4BQQA 1X2NA 4MO7A 3PNTA 1U2WA 2R93J 1Y0UA 4NQWA 2K3PA 3DKXA 2GXGA 2CQNA 4EJOA 2HDCA 3OR1C 3RKQA 3CMEI 3JRGA 1W36C 1RZ4A 2ID3A 1FWZA 2LSOA 2PBIA 4P55A 3JRBA 1VQMI 2YUSA 5CVIA 2F5DA 4FE7A 3O8HA 5BPDA 4BYYA 4AIJA 1QPIA 5D8LB 1A5JA 3OSFA 2CO5A 2R7UA 2M4GA 1EV7A 5IYBJ 5EEAA 1WJ5A 1Z7UA 4CCMA 5K7FA 1A04A 3ZMUA 1O3QA 2E1NA 2LOOA 2P81A 2ACJA 3CZ6A 1XGOA 4ITVA 3AG4H 2ICWG 1FSEA 1G59A 4A3EJ 4F7ZA 2J5PA 2K85A 5HOOA 3K1NA 3O6BB 3HG9A 4N4NB 2V6CA 4IZZA 3TO6A 1N78A 2W25A 5L3BA 3PIPF 5C4XJ 2ESNA 5GADJ 2R7RA 1X1CA 3MN2A 3HSEA 3U1KA 4PFOA 1FMVA 3Q0VA 1HW2A 3RQ4A 3HEFA 1UB9A 1IUYA 1K6OA 1I39A 4BBRJ 2GLOA 3NARA 5EYRA 3SDBA 4MFEA 3GEZA 2DJIA 2QQAA 4RLFA 5HODA 4HF2A 2PG4A 3CC2I 5J1YA 3CUQA 2JA5J 1RKTA 1D0YA 3ZP5A 2W1OA 2ID6A 3D5RC 4ENMA 4RAGA 1U0JA 5JHFA 2P5LC 2R5YA 4HQMA 1AU7A 4UB6C 1G3SA 5L3DA 4DZPA 4YIRX 3K4JA 4PZJA 2LMDA 1BI0A 3FDYA 2E5ZA 4FX0A 5DV5A 2AQFA 2LDUA 1MNMC 3L09A 3JRAA 2VT3A 4HF1A 4LG3A 3SFIA 4UUSA 2EBIA 3OYIA 4B8XA 3OYGA 3OMYA 3OYNA 1R7JA 3TW6A 3FK7A 3HRSA 4HF0A 1YRNB 2IEKA 5GAGJ 3H3ZA 3GLLA 4M74A 3C2GA 3GUDA 4LB5A 5F0FA 2BXZA 1A36A 2TRTA 1K61A 2OPTA 2MLGA 1FOWA 1QZYA 1MIJA 2KQRA 2C6YA 4DIQA 3OYAA 1N75A 2JN6A 4PK4A 1R71A 3HTUA 2BW3A 1YIJI 1R1UA 5FJ8J 3GTJJ 3V8KA 2WB1A 2K4BA 1GV2A 1S7EA 5DCMA 4UUTA 3F22A 1CGPA 1VF9A 4XKBA 4XKWA 2PI0A 5H6RA 2KMUA 1KU3A 1UELB 2YPRA 1RKWA 2V1DA 2YU3A 5E3MA 1ZKGA 3DWLE 2PLYA 2XSJC 1MJBA 2NVQJ 2G7UA 3GTGJ 3JRHA 1ZG5A 1J75A 4CYDA 2CFXA 4B09A 4W97A 4RB1A 2VE8A 5LHGA 5DUKA 1NK3P 3KIOA 2IBDA 5ICFA 3OSGA 2F48A 3OS2A 1QZEA 3KEQA 4OIRF 1X3UA 3W6JB 2DMPA 4J19A 2JA2A 3BJOA 3RPUD 3DEEA 4A3KJ 4BAYA 4QTRA 1EA3A 2K02A 3H9JA 3ERMA 1W0UA 2LKXA 3IL2A 1YITI 3HOSA 1W7PD 3PQJA 3RDIA 4DGWB 1T56A 2COMA 4RDUA 2HYGD 3BG6A 2KISA 3HOTA 3RPQA 3GWZA 3VODA 3BG3A 1ZELA 3DF8A 3HSRA 3BPVA 1YFHA 3BY6A 2PJRA 5JLXA 1SMYF 4BHBA 1JTXA 3EUHC 4DZJA 2EFWA 1V54H 3IHUA 1YW8A 2HPIA 3BR3A 1JJ8C 1IDZA 1YG2A 1HXDA 3FF5A 1HCRA 5IT3A 2BXYA 2X4HA 4CCJA 1UCRA 4HOBA 5CYVA 3KETA 2KIMA 3N4MA 2HYFA 2HDDA 1WH7A 4G7HF 1O3SA 2YS9A 1FTTA 4P9FA 3C18A 2RGVA 3JTGA 4CO8A 2WA0A 3F6OA 2A07F 2VONA 4M6XA 1RESA 2R7DA 3HRMA 2DA6A 3H1CA 1YW7A 2RAEA 3OL4A 1S9HA 1BA5A 1HKSA 3WU0A 3EYYA 1A6QA 3ABKH 4RB3C 4MEYF 1RUNA 3GTOJ 2BVMA 3VPRA 2STTA 2XROA 4YFXF 1CF7A 1XX5A 3FM5A 1Z77A 4BUPA 3ZN0A 1J2XA 3HKZA 4IKFA 1SVLA 1ZLJA 2HYJA 4BJ6C 5HNHA 1J59A 3KP7A 3L2UA 1OCZH 5DS9A 2TDXA 4L5EA 1VQ5I 1D3YA 3OYEA 2ZXJA 4FASD 4BE2A 1T8IA 2Q1ZB 2P5VA 3WG9A 1IUFA 1UJ8A 2Z2SB 5ICEA 4ESJA 3GYHX 1TBXA 2L7KA 4A6DA 2NS8A 2P7CB 3BG7A 3I58A 2FEZA 2L5QA 4EVIA 2V6EA 2FNAA 2VBZA 5D5WB 4LIUA 4D0PA 4QLCU 1XSXA 1O3TA 5E8GA 3S1MJ 1N25A 4YFKF 2DO7A 1XPXA 1GUUA 2PMHA 2PQ8A 1B9NA 4RBOA 2HXIA 4RA2A 1ZRFA 4MQVA 2Y75A 3RJPA 5C44J 2QGUA 2KZVA 1DGRM 4BJTA 5FD6A 2NS7A 1JT6A 3L2CA 1SAXA 5E3LA 5IY5H 3WE3A 4Z6YA 1U9OA 1XSDA 2ZJRF 2K9MA 4KMFA 2P0WA 2QKLB 1ETYA 3TBIA 2WADA 2NNNA 3EQLF 4BBSJ 4KIFA 1H89C 1EKEA 2HGCA 2IJLA 3GFJA 5ICCA 5B5EC 4LG0A 2ELKA 4XLEA 4A12A 1HQCA 2DI3A 2HQRA 1TLHB 2IA2A 3KPHA 2QBYA 2LBFA 1IAWA 4LITA 1Y0NA 4N9IA 1WJBA 4M9ZA 4LOCA 3FXQA 4CCLA 2RV8A 5M5XJ 4EJWA 5B3SH 3TOBA 2VC0A 5GTHC 4YEJA 4V2FA 3QPLA 3MAJA 1W5SA 3BQZA 4HX7A 1Y56A 5F27A 1CQTA 1RUOA 1IXCA 1MBHA 2R7OA 1WZ2A 3K4LA 3H3UA 3LSHA 2M0MA 4P1WA 2GA1A 4CDGA 1TQPA 2ADUA 2GAUA 2HKOA 1FYMA 5TJJA 3D5LA 3GBGA 2RC4A 2QCOA 2XVCA 3OL3A 2GIZA 3BZCA 2ME6A 1LUJB 2OUMA 4XM3A 3I59A 2X51A 4DQ2A 2A05A 3J81K 3MKWB 4LLGF 4G7OF 3EUKL 2MG4A 2DN0A 3KYLA 1LKXA 2ZMEC 1O7FA 4I98B 2JK3A 3S1RJ 3COAC 3RI4A 1MSFC 2FE3A 3QPTA 1JE8A 4JBAA 2NVUB 3V8JA 4C2TA 2V9KA 3E6CC 3K10A 3RZDJ 1PP7U 2LLKA 3E5XA 3LSMA 3EETA 1IDYA 2KJBA 1Y6IA 1OKRA 3I5UA 3NEUA 3QAHA 2ME0A 3Q9SA 3H5NA 4HW0A 2VOOA 3MQ0A 4IRGA 1AA7A 2K9SA 3D1NI 3HXLA 2XGEA 2HWVA 3ZQGA 4YFNF 3F8MA 2JRTA 1ETVA 1WCMJ 5CPRB 1TWGJ 3OYLA 3W2VA 3LQQA 1DP3A 3SHFA 4JP0A 1S3JA 2RKHA 4D7MA 2P6TA 2MFZA 3DBLB 2DMTA 1SFXA 1X1BA 3CLQA 1OYWA 2DA5A 1BR2A 2MD0A 1FYLA 3K2ZA 4LLLA 3MKYB 1T0FC 3BWGA 2DAOA 1G8XA 3GMEA 2VIXA 3ZQFA 2BHYA 1RPWA 4A3IJ 3DLLF 3W6KB 1D1AA 1Z91A 3AL0B 3P7NA 2M87A 2IXSA 3HPHA 1TZLA 3KE2A 3H5AA 4DNCA 1F43A 1PYVA 3JAMK 1A31A 5IOZA 3Q0UA 2R7XA 3B73A 1NG7A 2EIMH 2XF7A 5EEGA 4PJLA 3HYIA 4DOZA 3QODA 3JSPA 2FX0A 3DEUA 1TW3A 1OCPA 2DMNA 5IP6A 4G94A 1UG0A 3M1CA 2IS2A 2B7EA 2V79A 1I5ZA 4J00A 3LSIA 1GT0C 2E60A 2ZSIB 5AIQA 2YR2A 5EJCA 1AKHB 2HOTA 1XCBA 1JUSA 2X1DA 2QQBA 1VQLI 2L2OA 2E5NA 4D5FA 5IPAA 3WTYC 2FA5A 5IOYA 2CV0A 5EGOB 3DU6A 2ETHA 1XGSA 3BR2A 3SZPA 4XOTA 2H1LA 2DLLA 2OJED 1BIBA 3ABLH 1YI2I 2DT7B 1KU2A 1O7LA 1BI3A 4EEFG 4BACA 4DW6A 4IL6C 1QRYA 3ZMVA 2Y31A 2XC7A 2G0EA 3TDUC 3CF5F 1P7JA 2Z33A 1MMNA 2JT1A 2I10A 1T2KA 2D5VA 4M71A 1FOYA 2HFHA 1ZAOA 3ML6A 4IHWA 2L9RA 3T0YA 4HDVA 3LSPA 1VTNC 2PX9A 4IX7A 4JYKA 2ECBA 4R79A 2ZB9A 4EGZA 2OTJI 4Y52J 4IQJA 2Z99A 4WX9A 1QHGA 5GTIC 3ECOA 4DYCA 3JRCA 1MMDA 3BTCA 2QLZA 1D0ZA 3LSJA 2JZYA 2VB6A 1V3FA 1HSTA 2H8WA 3HC7A 2V9PA 3ZCOA 4ZTJA 3KCCA 3HGGA 3HTSB 1MDMB 1ZHFA 1ZG3A 2ISZA 1HKTA 2BGCA 2JPBA 2LF7A 2BY0A 2EIJH 2F5FA 3GTMJ 5ILSA 1W5CC 4E7KA 1ETOA 2R7TA 2DOFA 3FK6A 2ZNYA 2JVGA 2OC6A 3WTSC 4ASNA 1OLTA 4N4OB 2LY9A 2XSDC 3NRVA 4FTHA 1I27A 5GP9A 5E79C 3UR3C 5FFXA 4P9UA 1N77A 2GOXB 3LFKA 1GXPA 1GDTA 1U5TB 2XAFA 4I2OA 2HZDA 1K83J 1KGSA 3IKTA 3QQAA 1GXQA 1F1ZA 1PUFB 2KIFA 2CV1A 1ZN2A 2CUJA 1MSEC 2RDPA 2F4IA 3J81Z 3ZN1A 1YLFA 5DD4A 3GLXA 1IN5A 4IOAF 3E7LA 1WJFA 4GRIA 4WXCA 3F23A 5JI6A 1I50J 1VQ4I 2AXTC 1SD4A 1K78B 4ZC3A 4U0WA 5KVRA 1XN7A 3MKLA 5EDNA 2Q0OA 2UUZA 3ULQB 1HF0A 2A61A 3F8FA 3WGHA 1Z6TA 5EG0B 3FMQA 3I3LA 1Z9CA 1EH8A 4A3JJ 1EH7A 3DPUA 4NNJA 3HOWJ 2O6GE 2RREA 4I99C 2CRGA 5LEJA 4UY8I 4CCKA 2FRHA 2JRMA 3ESWB 3CC4I 2DPDA 2HU9A 3LSRA 2I5UA 4XORA 5TRDA 2LK2A 5E8IA 4NB5A 3IC7A 3QRFF 1FY7A 4D1QA 2OCCH 1R4NB 3G1LA 1Y8QB 1LB2A 2HS5A 2MH2A 2X0LA 3OYCA 2FOKA 2VOPA 4XLCA 2W82A 4XRMA 2F5VA 1IJWC 1ZRDA 4GCVA 4PJ0C 3SYTA 1F4KA 1Z3YA 2E1OA 3BTJA 2VLAA 3WTTC 3DP7A 3X2QH 2L9NA 2E19A 4LK0F 4EM2A 2PMZA 1ACIA 5J4YA 5KHDA 1T38A 3DEWA 1G3YA 2QSGX 4PCQA 5FKOA 3JAMZ 1HLVA 3M4OJ 2ZSHB 5FFZA 1YW9A 3WG7H 3WU2C 2B9SA 4A3LJ 2XASA 2PMUA 3ZMSA 3P9IA 1I6XA 3S2HJ 4HLXA 3ZXSA 1JTYA 1QU3A 1WRJA 4XSZF 2DT6A 4HZFA 1I6HJ 2LR8A 1HA8A 5B66C 1WGXA 2K3FA 3BP8A 3G71I 3A0HC 1MNEA 3S2WA 5LGTA 1MKMA 3OYHA 2NYXA 4IVNA 3VYTB 2FBHA 1IG7A 3V7SA 4ZTFA 2E2IJ 3I4MJ 2MC4A 3NQOA 4RM3A 3HOYJ 1T6SA 2M7BA 2L7FP 4II2A 4LFUA 4UHTA 5CLSA 1VQ6I 2F5EA 1JUMA 1T33A 2L0KA 3ZQ7A 5ILUA 1G6NA 1ORKA 5CKTA 4P5OA 1ERDA 3K4MA 3L2WA 4KA4A 2Y2ZA 1VQ8I 1E3HA 6PAXA 2LFBA 5DTDA 3S2DJ 3Q3SA 3CUQC 1YQAA 4M6VA 2MW8A 2OU2A 4MTDA 5J1UA 4L0ZB 3KZZA 3CJQB 2M30A 2VJ4A 5KNLA 3MCZA 5D5VB 2R7WA 1POGA 1V5FA 1LFBA 3C7JA 2R3SA 2HTSA 3H36A 4PUSA 3BROA 1IO2A 4ABZA 2VKHA 4IJAA 4XQFA 3A02A 2QZ8A 2K4JA 2JQ7A 4B1RA 1VZ0A 3C2BA 1MNDA 4RGXA 3GW2A 4LB6B 1S72I 5E3NA 4I0BA 5HLIA 5FD5A 1UHWA 4CHUA 2QEXI 1BI2A 3F0CA 1IRFA 2L4AA 3PO2J 4HRIA 2OCEA 1AWCA 2QQ8A 4E70A 2EZIA 2YU9J 3M7GA 2E1MC 2AS5F 3HDDA 1SFOJ 1KU7A 3BR1A 2VI6A 4BH9A 4E7IA 2R7SA 3KZIC 2MD5A 2VN2A 3GF2A 2EV6A 4L18B 4IQ4A 3AG2H 2VXDA 1MZBA 1IRXA 2WV0A 1ONVA 3FMSA 4EGYA 3WHBA 5IYDJ 4AYBA 4I6ZA 2R4GA 4UV8A 3DBHB 4C3HJ 3CCYA 2X6WA 2ZC2A 3OYBA 1XMXA 1XSVA 2O5RA 1SC7A 4RLQA 3FXMA 2Y0SA 3FISA 2M7AA 4AVPA 3WTVC 1NH3A 4CGZA 1LVAA 1K7AA 4LLNA 2JVHA 1FP1D 1OCRH 3IP4B 1UG2A 1E3PA 4HA8A 3E97A 3W2WA 4BQOA 3SDGA 4YIFA 3GTQJ 4IHXA 2MH9A 4KT5C 2GIVA 5BNGA 4Q4ZF 3LSGA 4Q47A 5HLGA 1VQ9I 2FXAA 4C3IJ 1XDUA 2WB1N 1Z67A 4RGUA 2DK5A 2H8RA 2O9LA 2IGOA 4AM3A 3KYDB 3RTRA 2D1HA 5CJ9A 2XUBA 1TW2A 2A69F 3J7AO 2L3DA 3K1PA 2DFFA 2E35A 1B72A 2VASA 2M4KA 3PM1A 2V1NA 2XAUA 1TWHJ 2LF8A 5HLHA 4GDFA 3GZNB 2LTPA 5J47A 2EZLA 3NWSA 4L9NA 3HHGA 1EF4A 2HOEA 5TISC 2EFPA 4ENJA 5BOXA 4PJNA 1ZQ3P 3JR9A 4EV0A 1BN5A 3M8JA 3HB9A 1LE8A 1LDDA 1B8IB 3B6CA 3A03A 2EA2A 3F8NA 1WJAA 4DYQA 1ZH5A 4AWXB 3FMRA 2XGCA 1R9TJ 4UUVA 1J7KA 1ENHA 1ZGJA 2R7FA 3P9CA 4G6TB 3KP4A 2XB5A 5A2QK 5EZHA 2AHQA 3KYCB 1FOKA 3O3KA 3QWLA 4PGHA 3DPTA 2WAFA 2PFBA 1JHHA 1JHFA 1FBSA 2DODA 2STWA 3WTXC 3VEPA 3PFIA 1FOXA 4GYGA 1GVJA 2X48A 3RPUA 2DDBA 1OMIA 5F64A 4RS8A 2CMPA 4KMUX 3HGYA 2M8GX 5CQEA 4XLAA 1FYKA 1KZHA 1W7PA 4KT6A 2CH0A 4Q5SF 1MD0A 1EH6A 1ZGAA 1V4RA 1SEUA 2WAQA 1P4WA 4E7ZA 2KRCA 2K5CA 2EQRA 1C0WA 4XLHA 2E2JJ 1QPMA 4O5VA 4MLOA 3S17J 1R4MB 4MFDA 3RQIA 4W1UA 3HUGB 1U5TA 4BQNA 2PN6A 5FLMJ 3BT9A 2FQ4A 1OCCH 5TGTA 1D1CA 2DDAA 3HOUJ 3S3NA 3ZQQA 3FXUA 2UWMA 1X4PA 1PUFA 3U2RA 2BY3A 2E71A 4I0AA 1Y1VJ 2GBYA 4RGRA 4BHPA 2X6YA 2OZ6A 3IH3A 2P6SA 2VXZA 4ANJA 4D5CA 2FBKA 3W3CA 3HKZN 1UAAA 4E7JA 2WWYA 2KDZA 5E1XA 1K78A 2LC2A 3V7CA 2GM4A 5IYCJ 4ZDLA 4I01A 1LDJA 5EG0A 2QQ9A 1BW5A 3WHCA 1F5TA 1PDNC 2QSFX 3BOQA 3KLNA 4ZYDA 1Y1WJ 2AQEA 1RR7A 1T95A 1QBJA 1BI1A 5DEQA 4X6AJ 1TTYA 2HOSA 2A6EF 5KK1A 4HV6A 4XIDA 4XRFA 2FBIA 3EUAA 2VQHA 3R61A 2JUGA 3OYFA 3E0JB 4QPQA 3RKXA 1IRZA 4YELA 4U0VA 3A01B 2CW0F 1TT5B 2M5WA 1ITYA 1JXSA 3CP8A 1VQNI 2HI3A 4A5MA 5H20A 3AKZA 1KU9A 4BEHB 4XKVA 4KDPA 1LFPA 4XLFA 4A3GJ 3SZTA 3ZQCA 2KL4A 3HM5A 4BE0A 2ZXIA 2HZTA 1R1VA 1MBGA 1MH3A 3ZGKA 4IHTA 1BW6A 3DV8A 4M3GA 3PIOF 4CYCA 1TWCJ 1YS6A 1VI0A 4EJVA 3R0AA 2VKDA 4J01A 4YG2F 1H88C 2BYVE 1FSHA 3PNYA 1IXSB 3DQVC 4OWRB 3RKYA 2VJJA 4M3EA 4AUXA 3QYBA 3GTPJ 3TQNA 3MZHA 2D1VA 4IPAA 5FLVA 4AIKA 5M5WJ 1DPRA 2K27A 2YX7A 2QSHX 5BQTA 2MSYA 1X19A 4TV7A 5EF6A 3W6VA 4FQGA 4WXHA 2XV4S 2QKMB 1FPQA 1XMKA 2WY7Q 5HLTA 3K2AA 2ZXHA 3H9QA 2XAGA 2KRHA 1MH4A 3HSFA 3K0LA 4JX4A 4Y17A 2WAEA 4AIDA 2Z1DA 1HBXG 4E6KG 3KP5A 1XD7A 1U3EM 2RN7A 4AD9A 3K4BA 4V19K 2ZKZA 1HW5A 3IH4A 3SJMA 4XSXF 1SVMA 4EATA 1WPKA 3I64A 3TEDA 4UNOA 2EPFA 3GFLA 4PSXA 3HBLA 4V2GA 2OBPA 4HNUA 1WSUA 5HS9A 2IPQX 1RI7A 4F92B 1FIPA 4JOMA 5CQGA 1VNDA 3LAPA 2V9VA 1FIAA 2W84A 2P7VB 2QENA 1B1BA 5E1ZB 1PJRA 2B63J 4KICA 5A2QZ 4IHVA 3I54A 5BPIA 5J4VA 3BG5A 2NS0A 3KP6A 3FXLA 2UXNA 4BY1J 3BCBA 5EZGA 5BS6A 4BDZA 3DTIA 1MJ9A 1T98A 2VBYA 3CLOA 2XKOA 3CCLI 2GA2A 3I4PA 3QP5A 2MA3A 4JX5A 4A69C 2O0YA 1TT0A 3F3XA 4S05A 1R49A 4OMZA 1FZPB 3UNGC 1WJEA 2FNPA 3KEYA 3J7YJ 4EQQA 2VKEA 4PDKA 2ZFUA 5K7HA 4HV5A 2JSPA 2Q2EB 3ABMH 4QIWN 3CQZJ 3DU5A 1BC8C 3ABUA 2X85A 5E20A 1ETKA 1HDPA 2K9LA 5FO5A 2ISYA 3P9KA 4G9YA 3LNQA 2XF6A 1A6IA 2HKXA 3QPSA 5FKKA 1RC9A 2CG4A 2M9HA 4OU0A 3VSKA 4NC7A 3U1DA 5M3FJ 2XB0X 4MHGA 3V7RA 1OR7A 2D45A 3GCMA 2IA0A 3HPGA 4XR6A 2E7XA 1IN6A 3DKYA 4UB8C 4XRSG 4CUGA 3TGNA 1VFCA 3K4CA 1R5HA 3BLYA 3LSKA 1FEXA 3KFWX 1YRNA 1FNNA 2DCEA 2DFIA 2RQPA 3JSOA 4LD5A 1D8JA 5CVVA 1XB4A 2X6XA 5DUIA 4U7DA 3FBNB 5B1AH 2LKPA 3PL8A 1OISA 3L2RA 5H2FC 3ZMZA 4F55A 4M73A 5JFRA 1G3WA 3O2PE 4A3FJ 1ETXA 2J5OA 1LEAA 1LPQA 1BL0A 3QU3A 4RAFA 2KZGA 4KN4X 4CICA 1B9MA 3CJTB 2EK5A 2L02A 4E4HA 1E3OC 2CS3A 5CVRA 3TL4X 2CSOA 3IAM2 2UV1A 3OYDA 1LEBA 4AIHA 2BHZA 1J09A 2X1CA 2DFEA 2M1BA 3J7ZI 1RIOH 1T08B 1BJZA 1Z7LA 1LJ9A 5IT9K 2LNBA 2R5ZB 2OF7A 3MZ8A 3N05A 2KHMA 3P5JA 2XAHA 3K1MA 3A0BC 1ETQA 1SANA 3L7WA 1Z0XA 2VQLA 3Q9VA 1UHMA 1SD5A 5HDGA 5LRRA 1HSJA 4LK1F 4NUBA 3M8FA 1PUEE 2Z9OA 1JI8A 2W48A 3CCQI 2M45A 1Z21A 4G12A 1P7IA 2HQAA 3L2QA 1TWFJ 2V1XA 2CQQA 3HOZJ 3CP2A 4GYIA 4B47A 4HX8A 1Z6RA 4GFBA 3I55I 4ZH4F 4II3A 2DMQA 1GVDA 1IW7F 3ASNH 5CVJA 4G7ZF 1SD6A 2H09A 4B44A 1SFUA 1Y39A 2G9WA 5LEKA 2YX4A 2BY1A 3FXJA 4NC6A 3IAS2 4JK1X 4ETSA 5IP9J 2CW7A 2EIKH 1TP4A 3ZR8X 1IRGA 3F72A 2R0QC 2LD5A 4B3XA 2CJJA 2XPUA 3E5QA 4RM2A 2VPRA 4RAZA 3A1YA 5J8FA 3G2BA 3K70D 4BS9A 2L01A 4HLYA 2JJ7A 2EFOA 4XLNF 3RSNA 2KJCA 4XBFA 3D0SA 4PJJA 2CYYA 4BXXJ 4XN0A 4DJAA 2EILH 2JSCA 2QM3A 2L7ZA 3HL2A 3DXJF 4MNUA 2JMWA 5LFAA 4CCNA 2LREA 3L00A 4JX6A 4HNTA 4RMNA 3VYUB 4KN7X 2AO9A 3KLOA 3LA2A 3V4GA 4L9VA 2DJNA 2ZBKA 3H9GA 3ECHA 1WVRA 2VJIA 3IKVA 4M3FA 1ZLKA 2KFDA 3DBRB 2R7QA 5JHUA 1R5GA 3JW4A 5JR3A 5E3OA 1YX3A 3HOVJ 1USTA 1U9NA 1P9QC 2QYOA 3SQNA 4HPQA 3AG3H 2ZO4A 3PNVA 1H8AC 2JTVA 4BE1A 3I0TA 5J8CA 1Q1VA 1OJLA 2R92J 2W4SA 4QSHA 2DMUA 1ETWA 1SFEA 4H4KC 3CJNA 2ECCA 2IS6A 4KITB 3VWBA 2HNHA 4HEA2 4E7LA 2Y69H 5KCMA 1ZR2A 3BR6A 1WFXA 1REPC 2DA4A 3FIWA 4ENKA 1B6AA 2GQQA 4FT8A 2P5KA 1VQPI 2DQLA 5FKLA 4IOCF 4OIOF 2IW5A 4EJUA 1WHUA 4IRHA 1BJAA 1W1WE 4O3MA 4HG2A 2E36A 2V4JC 1D5YA 2W24A 1WI3A 4HBLA 2OQGA 1S8NA 1OYYA 1UZCA 4ZDOA 3OY9A 3AG1H 3CCSI 3LMMA 1WKMA 3O8GA 3JRDA 4E7SA 4IHYA 3PSFA 3A01A 4LG0B 3D5SC 2XKPA 4Y15A 3N97A 2PMZN 3TO7A 4A3DJ 2XPWA 3LA7A 5D4SA 2WBMA 1YJNI 4BQAA 4BEHA 3JREA 3J7AY 2IGKA 5F0HA 2QBYB 1BR4A 1Z3XA 1HW1A 3CCEI 1X3WB 3V42A 5J1RA 3MMYB 2XRNA 2ZXWH 3SZGA 3C2HA 2WTEA 2MGQA 3CUOA 5ERIA 3R6SA 5ICGA 4UVBA 2FOWA 5H6QA 3CTAA 1FLIA 2P8TA 1KQ0A 3HHHA 1DUXC 4WK8F 1GV5A 1W4MA 4FE4A 1IGNA 4I02A 1W36D 4A3BJ 2KLOA 2UZKA 5F08A 3WTUC 2H94A 4KISA 1ZREA 4CZZA 4G8XA 3K9TA 2Y48A 1ODDA 4IO9F 4R1HA 1STZA 3VFZA 1LDKB 3S1NJ 3BC8A 1IV6A 3I59B 1U8BA 1XGNA 4BDYA 5IT9Z 3CMYA 3OIOA 5K5OA 2CUEA 4KIBA 2UXXA 3RCOA 2K7LA 1S6LA 1PVEA 4BXUA 3SFZA 3E1SA 3OS0A 5L3CA 5KAIC 3M8EA 2CGPA 2M0CA 3T1BA 3AFHA 3TP0A 2GWRA 3OOUA 2IAIA 3M1EA 3L1PA 4RGSA 4XN3A 2JA7J 1WQ2A 1YJWI 3AAFA 5FRMA 2Q8KA 1EJ9A 3RZOJ 2CQXA 4A93J 2N8GA 4BY7J 2VBWA 3KZYA 2NOJB 2XAJA 3GZ6A 3FHNA 1SAUA 1D8KA 2GZWA 3VYSB 4C2MJ 2WV1A 3FBIB 2FU4A 2YSRA 3OYJA 2ZMEB 1KQ9A 2EWNA 3FXRA 1YOVB 3DTKA 3VYRB 4BJ5C 4IRIA 1P4AA 3HZJA 3F6VA 3CMAI 2K9NA 1Z1DA 3KX2A 4NBQA 1JUPA 2LY1A 1K6YA 1R58A 2CUZA 3PUBA 4Y33A 5JVGF 1FBUA 4I09A 2GXAA 2F6CA 2H6BA 2RNGA 2W57A 3G3ZA 4C30A 1MBKA 4IF4A 2M2EA 1DDNA 3JRIA 4CCOA 4XRSA 1B4AA 5C4JJ 4B43A 1BM9A 3AL0C 1MMGA 3WGGA 1NHAA 3E6MA 3ZMDA 5D5UB 4HDUA 2KRFA 2OA4A 2FF4A 4EJTA 3LQRA 1XDSA 3K4NA 1A35A 1U78A 2B0LA 1IN8A 2Y0MA 4AVZA 3CCMI 4OIPF 1VQKI 2LVSA 2I8DA 3LL7A 3DCFA 3BDDA 1QZZA 2JPCA 4AYBN 2Q2EA 3BR0A 3KP3A 4HQEA 2DXIA 5IP7J 4EM0B 5J3LA 1KYZA 4A3MJ 2OAZA 4N0BA 1U6GA 3A2KA 5FB2A 1DGWY 2DTZA 4XLPF 1P92A 1FP2A 2O8KA 2Y0SN 5GPAA 3G4SI 2DOAA 5DCFA 3UKGA 3Q5FA 3DTEA 4ZYGA 4CXFA 2CU7A 1LVKA 2HVQA 3HJEA 5GPCA 2F2EA 2NVTJ 4GGGA 3H0DA 3LAJA 4KJZA 5FRNA 2BOLA 2O03A 3M9AA 3TP3A 1O3RA 5F04A 4GXOA 3RIRA 1QVUA 1W5TA 4A3CJ 3S3MA 2HOAA 3Q0WA 2DA1A 3ABTA 3S16J 2DYRH 3GTKJ 4IXAA 2X6OA 4XL9A 1M1EB 3QP6A 3HRUA 2VT2A 5LGUA 1APLC 3G1MA 5F0CA 2XRLA 2LP0A 2LG4A 1BOAA 1ZTRA 4FETA 4C3JJ 1AKHA 1VQOI 1MBJA 3OR2C 1GHCA 2Y30A 3S93A 3J80Z 3IWZA 1DU0A 1DU6A 3C3WA 4PFPA 1HKQA 1WJDA 3DFGA 2MABA 3FXKA 5EGOA 1R22A 3U9GA 1QO0D 4BU2A 5L3EA 1MJAA 5D6FA 1FJLA 2M34A 4MQ9F 2RVCA 2O61A 2DTRA 4RB2C 4X1EA 2KIQA 1X1AA 3FKJA 5D5XB 3JRFA 1SMTA 1NG6A 2EFNA 1BC7C 2EZKA 3CD6I 2KPMA 4F3QA 1H9GA 2KDOA 3ELKA 2FMYA 2FD5A 2R5ZA 1JJ6C 4HNVA 2COBA 1R00A 3CESA 4FISA 1TNSA 1S7OA 2VQCA 3ISPA 1FT9A 2BE5F 4BXFA 4NC8A
chains in the Genus database with same CATH topology
1MMDA 2WAEA 2Z1DA 4E6KG 4C2UA 2R7UA 2M4GA 3K4BA 1D0ZA 2VB6A 1WJ5A 3HC7A 4CCMA 3ZCOA 4ZTJA 4EATA 2LOOA 1V5GA 4PSXA 3CZ6A 4ITVA 4Y3OA 4E7KA 2R7TA 4HNUA 1G59A 2JVGA 2OC6A 5HOOA 1OLTA 4N4OB 3HG9A 1GLNA 4N4NB 4F92B 2V26A 4IZZA 4JOMA 5CQGA 3UR3C 1N77A 1N78A 2GOXB 2R7RA 1PJRA 3QYFA 1X1CA 2HZDA 4AU7A 4PFOA 1FMVA 3RQ4A 2CV1A 3BCBA 2CUJA 4BDZA 2F4IA 3DTIA 3SDBA 1WJFA 4C9YA 2DJIA 4GRIA 4RLFA 3VSLA 1TT0A 4HSTA 4XONA 1D0YA 4ZC3A 2W1OA 3UNGC 1WJEA 3D5RC 3KEYA 1U0JA 5JHFA 3TMOA 2UUZA 2ZFUA 2JSPA 2Q2EB 3K4JA 3DU5A 3I3LA 3FDYA 2X85A 2E5ZA 3DPUA 4NNJA 4XMYA 2CFOA 3S3OA 2RREA 3K4KA 4CCKA 2AQFA 2K9LA 2XF6A 4YRVA 2HU9A 4XORA 4LG3A 4XNFA 3OYIA 2OV7A 3VSKA 4NC7A 3OYGA 4XKCA 4D1QA 3OMYA 3OYNA 3I9V2 3HPGA 4XR6A 3DKYA 4CUGA 3OYCA 3K4CA 3BLYA 3C2GA 3DPLC 3LSKA 4XLCA 2DCEA 4ZDPA 2W82A 2F5VA 2X6XA 3FBNB 2KQRA 4DIQA 3PL8A 3OYAA 1N75A 3L2RA 3SYTA 4PK4A 1Z3YA 2VLAA 1X1DA 2BW3A 4F55A 1BOBA 2WB1A 2L9NA 2HVRA 2VQGA 2PMZA 4XKBA 4XKWA 5KHDA 4D9JA 3PFYA 4E4HA 2M3AA 2CS3A 3L2VA 2KMUA 3TL4X 3IAM2 2UV1A 1UELB 2ZSHB 3OYDA 3DWLE 1J09A 2X1CA 2XSJC 3ONQA 3CF2A 1Z7LA 3ZXSA 2LH9A 1QU3A 1V5EA 3N05A 4NQWB 2KHMA 1D1BA 2DT6A 4OAZA 1BR1A 2W00A 1HA8A 3OS2A 2VQLA 2JA2A 4NUBA 1MNEA 3RPUD 3OYHA 3DEEA 1JI8A 1EA3A 4CH7A 3SEZA 3OIQA 1Z21A 3H9JA 3DLAA 3VYTB 2HQAA 3L2QA 4ZTFA 3CP2A 3HOSA 4B47A 4DGWB 2MC4A 4RM3A 3F9KA 3BG6A 4II3A 2M7BA 3HOTA 4II2A 3U21A 1ZELA 4F91B 2LYCA 4B44A 2PJRA 4CZCA 5CKTA 4P5OA 1ERDA 3K4MA 3L2WA 2BVLA 1WJCA 4OAYA 2VPLA 4BL0B 3IAS2 2IGNA 3EUHC 2CW7A 2VL8A 2LRDA 3ZR8X 4BXFA 2HPIA 4QPOA 4B3XA 2HPMA 3CJQB 4RM2A 2VJ4A 2A6TA 4CSWA 5KNLA 3A1YA 3CJRB 3W2AA 4CCJA 3G2BA 3K70D 1KONA 4BS9A 2R7WA 1V5FA 3RSNA 4PUSA 2A5WA 4PJJA 2VKHA 2XDVA 4XQFA 4XN0A 2WA0A 4DJAA 3HL2A 3OWTA 1VZ0A 1MNDA 5LFAA 4CCNA 2LREA 3OL4A 4DBQA 4HNTA 1S9HA 3PJRA 4RMNA 3VYUB 1OR7C 2BVMA 3H9GA 4HRIA 2VJIA 2R7QA 2E1MC 4BUPA 1YX3A 3HKZA 4IKFA 4BJ6C 5HNHA 4E7IA 2R7SA 3L2UA 1MW7A 1P9QC 2RQQA 3LFUA 4HPQA 4CA0A 3PNVA 4IQ4A 3OYKA 3OYEA 4BE1A 2VXDA 4FASD 4BE2A 1IRXA 2Q1ZB 5FROA 2W4SA 2Z2SB 4AYBA 2R4GA 4DBRA 2L7KA 4H4KC 4XOPA 2IS6A 4KITB 3VWBA 4PSWA 2E1MB 2HNHA 4HEA2 4NC8A 3BG7A 4E7LA 2X6WA 5KCMA 1YX5A 2L5QA 1WFXA 3OYBA 2O5RA 4RLQA 4X0GA 2V6EA 2Y0SA 2M7AA 4LIUA 4BGDA 3NWTA 2BW3B 2JVHA 3IP4B 3W2WA 4BQOA 4HG2A 5HVQC 2V4JC 3S8PA 2KZVA 1DGRM 4BJTA 3VDXA 3LSGA 4ZDOA 2WY8Q 4LIVA 3OY9A 2K9MA 3LMMA 3SEQA 2P0WA 2QKLB 3PSFA 3TBIA 2WADA 4E7SA 3D5SC 2IGOA 3IUOA 2MYSA 3RTRA 2WBMA 4BEHA 4U7BA 3J7AY 2IGKA 1R6RA 4JQFA 4XLEA 1BR4A 1MMAA 3OYMA 1Z3XA 2VASA 2M4KA 2V1NA 2XAUA 3V42A 2LBFA 3MMYB 4LITA 3SZGA 4Y4RA 3C2HA 1WJBA 1X4OA 3NWSA 3OS1A 4CCLA 2HDWA 4PJNA 3M8JA 4YEJA 1W36D 3EPZA 1Y56A 2XF5A 2KLOA 3MKZA 2PJRB 3MD2A 4KISA 1WJAA 2R7OA 3K4LA 3LSHA 2M0MA 4P1WA 4G6TB 2X1EA 1LDKB 2IGMA 3BC8A 3D5LA 3GBGA 4BDYA 3DPTA 2WAFA 4F93B 3OL3A 2OUMA 4XM3A 2X51A 3RCOA 3MKWB 4HSRA 3EUKL 3E1SA 3OS0A 3KYLA 1LKXA 2LY2A 3QYEA 3AFHA 3OOUA 2CMPA 3CMMA 2R7VA 4XN3A 2GOMA 1D0XA 4U87A 2V9KA 4PJMA 3S32A 4C2TA 3K10A 5CQEA 4XLAA 5FRMA 2CW8A 2IS4A 4KT6A 3K70C 2CH0A 4F52A 3LSMA 3PSIA 2NOJB 3FHNA 1SAUA 1Y6IA 3VYSB 3FBIB 2WAQA 3OYJA 2FUG2 2L9SA 4E7ZA 2VJ5A 2KRCA 3QOEA 2K5CA 3DTKA 3VYRB 3H5NA 4BJ5C 4XLHA 4MLOA 3KX2A 1AA7A 2LY1A 1K6YA 2CUZA 2Z16A 3HUGB 3PUBA 4Y33A 3HXLA 4BQNA 4ZJZA 5TGTA 1D1CA 2F6CA 3S3NA 2RNGA 4C30A 3ZQQA 2HVSA 2UWMA 1X4PA 5CPRB 4CCOA 1FMWA 3OYLA 1SFKA 3W2VA 1DP3A 4B43A 3A4CA 2MFZA 2X6YA 1X1BA 3AL0C 1MMGA 3OIPA 2VXZA 2MD0A 1BR2A 4ANJA 3W3CA 1UAAA 2W7NA 4E7JA 2V7FA 3K4NA 3MKYB 1T0FC 2LC2A 4AVZA 2IS1A 4ZDLA 1G8XA 2I8DA 3LL7A 2VIXA 5HNFA 2DXIA 1D1AA 3AL0B 2IXSA 3HPHA 1TZLA 2AQEA 3H5AA 1T95A 4E7HA 1PYVA 3A2KA 1E0EA 1DGWY 3ZRGA 2R7XA 1NG7A 3H5RA 4B48A 3EUAA 2VQHA 2DOAA 2JUGA 3DTEA 2XF7A 4PJLA 3OYFA 5LD2C 3E0JB 1LVKA 2HVQA 4QPQA 4DOZA 3QODA 4YELA 1YE9A 3H0DA 2ELJA 3CP8A 4KJZA 5FRNA 2BOLA 1UG0A 3M1CA 2IS2A 3AKZA 4J00A 4BEHB 4ZYAA 3S3MA 3LSIA 4XKVA 1LFPA 4XLFA 2E60A 1DQUA 2ZSIB 3K6GA 4XL9A 2KL4A 2X1DA 4BE0A 2ZXIA 2L2OA 2E5NA 4FETA 2LG4A 2LBFB 3ZGKA 3BCAA 2CV0A 3OR2C 3DU6A 3S93A 2VKDA 4PFPA 4J01A 1WJDA 2MABA 4BU2A 2CV2A 4XOTA 1QHHD 3PNYA 2KP6A 2DT7B 3FKJA 1X1AA 3DQVC 4OWRB 4BACA 1NG6A 2XC7A 2VJJA 3H35A 3QYBA 4BQQA 1MMNA 2KPMA 4F3QA 2KDOA 3PNTA 2K3PA 3DKXA 3CESA 3OR1C 1W36C 1X19A 4IX7A 2QKMB 2VQCA 4R79A 2WY7Q 5HLTA 4IQJA 2ZXHA 3H9QA 1QHGA 2KRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X0G A;  4IX7 A; 
#chains in the Genus database with same CATH topology
 4M9S A;  2A68 F;  1S29 A;  1XTA A;  4NDL A;  2MC3 A;  4C2U A;  5E18 F;  2AXL A;  3E6D A;  1NTC A;  2DBB A;  1U5T C;  3CC7 I;  2H27 A;  2FML A;  2D2W A;  3KP2 A;  1V5G A;  3BZ6 A;  1ZG1 A;  1RR8 C;  4ON0 A;  3GTL J;  3WTZ A;  4Y3O A;  5K5R A;  1MDM A;  1ZR4 A;  2H6C A;  3ZQI A;  2ZJQ F;  1FTZ A;  1GLN A;  2V26 A;  2KIU A;  2NRA C;  4HX4 A;  4L0Y B;  3RYR A;  3F21 A;  2Z3Y A;  3EDP A;  3FKI J;  1MGT A;  5D4R A;  4Q48 A;  1ZAR A;  3QYF A;  5LHI A;  1P6R A;  2EV5 A;  4AU7 A;  1NK2 P;  5CVU A;  5D8K B;  2WAQ N;  1ON1 A;  2A6H F;  3IRR A;  2R7Z J;  3MWM A;  4PGG A;  2HXO A;  3H92 A;  3BR5 A;  4ZZD A;  4C9Y A;  3PUF A;  2MBF A;  4LMY A;  3EUH A;  3VSL A;  1DP7 P;  2VC1 A;  1ZRC A;  4EM1 A;  3FWE A;  1PP8 F;  4HST A;  3R4K A;  4IEJ A;  3ZMT A;  4XON A;  2ZJ2 A;  3VB2 A;  1QGP A;  3B02 A;  3I71 A;  4WF2 A;  3TMO A;  2GXB A;  2XAQ A;  4M3B A;  4UXN A;  1LQ1 A;  2PEX A;  4S0H B;  1YTY A;  2DOE A;  4WCG A;  2BV6 A;  2CQ7 A;  2CFO A;  4XMY A;  3S3O A;  3K4K A;  5LLQ A;  1BBY A;  4WWC A;  5L3G A;  1I3A A;  4YRV A;  4LGW A;  4XNF A;  2HQN A;  5HDK A;  1JKP C;  2OV7 A;  3TW7 A;  1JGS A;  3FM3 A;  1F36 A;  3K7A J;  4XKC A;  1YO5 C;  2EH3 A;  3I9V 2;  4ENN A;  3BPX A;  3CCJ I;  3GVA A;  2Y9Y A;  3DPL C;  2FQ3 A;  4ZDP A;  4QWQ A;  3I4N J;  2JWT A;  3RYP A;  3F8C A;  3ASO H;  3CDI A;  4Y13 A;  1X1D A;  1USS A;  2CUF A;  4XIC A;  1XS9 A;  1ON2 A;  1BOB A;  5J6X A;  4UVA A;  9ANT A;  2HVR A;  3CCV I;  2VQG A;  1KQ8 A;  2W85 A;  4OOI A;  5L3F A;  1QQI A;  1B59 A;  2NNY A;  1X58 A;  3JTH A;  2XPV A;  4D9J A;  3PFY A;  2DT5 A;  2M3A A;  2NVY J;  3L2V A;  1YIO A;  4UV9 A;  1V55 H;  1O4X A;  3G6E I;  2X9D A;  1HDD C;  4U0Y A;  3ONQ A;  3CF2 A;  5HDN A;  4G6D A;  3OV8 A;  1OQY A;  3CO7 C;  2LH9 A;  3G73 A;  1K4S A;  1V5E A;  4NQW B;  5KAF C;  1D1B A;  4OAZ A;  1BR1 A;  2W00 A;  2ZFW A;  1JGG A;  2CWE A;  2QWW A;  2EIN H;  3E5U A;  2DK8 A;  3ROU A;  3REO A;  3FZV A;  2EV0 A;  1I1S A;  3T8T A;  4CH7 A;  3SEZ A;  3OIQ A;  4G6Q A;  3DLA A;  1W0T A;  2E2H J;  4D7N A;  2HQ5 A;  2E34 A;  4KYW A;  4A5N A;  3B6A A;  4UVC A;  4KFC A;  3SXY A;  5LHH A;  1WH5 A;  3IV5 A;  3T5X A;  3F9K A;  3K69 A;  5DM6 F;  1HOM A;  4BKX A;  3U21 A;  3JCU C;  1S7A A;  1TQM A;  2DU9 A;  3OOP A;  5FKM A;  1OCO H;  2LYC A;  4F91 B;  4CZC A;  2F4O B;  2OD5 A;  1LNW A;  5AIP A;  2BVL A;  1WJC A;  3FXO A;  1YHQ I;  2NVX J;  3QOP A;  4OAY A;  4ESB A;  1WWX A;  2VPL A;  4BL0 B;  5GAH J;  2ELH A;  2IGN A;  4MGR A;  1OYI A;  2VL8 A;  2OTL I;  2LRD A;  3WOD F;  4KIG A;  4OIQ F;  4QPO A;  4A0Y A;  2HPM A;  1TNT A;  1TWA J;  3TO9 A;  2A6T A;  3CDH A;  1S5L C;  3QPH A;  3CJR B;  1XMA A;  3BG9 A;  4I7H A;  3TOA A;  4CSW A;  5JVT A;  1KON A;  2O7O A;  3W2A A;  3DKW A;  1UHS A;  3ZPL A;  2ZCW A;  3E3V A;  1IXR C;  5FLX K;  1ZK8 A;  3WGI A;  5ILV A;  2A5W A;  4MEX F;  1FC3 A;  1O57 A;  4A6E A;  2XDV A;  1RET A;  2EJR A;  2VBX A;  3CUQ B;  1IN4 A;  2BY2 A;  2ZNZ A;  3LST A;  5DYM A;  2ESH A;  1YYV A;  2QUF A;  1H9T A;  3OWT A;  4IHS A;  2TCT A;  2H1K A;  2R5Y B;  4FHT A;  2FSW A;  4DBQ A;  2JA6 J;  1VQ7 I;  2DQR A;  3FHZ A;  4N9H A;  3PJR A;  1OR7 C;  4WXD A;  3CDL A;  3I56 I;  4O6J A;  1P4X A;  1R36 A;  2ZME A;  5K5Q A;  1FX7 A;  4M72 A;  2NAZ A;  3WTW C;  4EMS A;  1TQI A;  4Z2Y A;  3HIF A;  5F6F A;  1HC8 A;  4NHJ A;  2VOD A;  1Q1H A;  1G2H A;  4UUS B;  3RKW A;  2RNJ A;  4B3A A;  2KT0 A;  2IRF G;  1MW7 A;  2RQQ A;  3LFU A;  5JLW A;  5C3E J;  2OQR A;  4CA0 A;  3M3Y J;  3OYK A;  2VUM J;  3PQK A;  4FX4 A;  5FRO A;  2WC2 A;  3F8B A;  1L3L A;  4DBR A;  4XOP A;  4L5J A;  3MZY A;  4PSW A;  2E1M B;  2P4W A;  5DDG A;  2K86 A;  2NOG A;  1YX5 A;  2QF7 A;  3VOE A;  5DD8 A;  1JKO C;  3L9F A;  4X0G A;  3BJ6 A;  4Y7N J;  2XGX A;  4BGD A;  3NWT A;  3ZOB A;  2BW3 B;  3GFM A;  5LBQ A;  3WU1 B;  1IZ1 A;  4BNC A;  1D5V A;  5HVQ C;  5DCM B;  1K4T A;  2DFH A;  5FGM A;  3S8P A;  3TDZ C;  4HAM A;  4U88 A;  3VDX A;  1T0F A;  2BBY A;  3PO3 J;  1JKR C;  2KKO A;  2WY8 Q;  4LIV A;  1QVT A;  4BHC A;  1JT0 A;  3SEQ A;  2IA1 A;  1X3Z B;  4ESF A;  2XHK A;  3CO6 C;  1ZYR F;  1KYW A;  3QU6 A;  2FJ1 A;  2O3F A;  3MFK A;  1XCV A;  2DA3 A;  3IUO A;  2MYS A;  3GX4 X;  3ERE D;  4YII A;  1B72 B;  4U7B A;  1R6R A;  4JQF A;  1MMA A;  3OYM A;  1X2M A;  5HS7 A;  3FX3 A;  2IT0 A;  1RRJ A;  1XG1 A;  4Y4R A;  5K7Z A;  2EFQ A;  1IF1 A;  1X4O A;  1E2X A;  2JUC A;  5GAE J;  3OS1 A;  2A5Y B;  4RB0 A;  1LE8 B;  1I3Q J;  2K40 A;  2HDW A;  3ZQL A;  2G7H A;  3BTL A;  5M5Y J;  1Z05 A;  3CCU I;  4I76 A;  2L7M P;  3C1D A;  1I1G A;  3EPZ A;  2XF5 A;  3MKZ A;  1IN7 A;  5DM7 F;  2IVM A;  4A2U A;  2PJR B;  3MD2 A;  1B8I A;  3LA3 A;  4M9X A;  5BMZ A;  1ZGW A;  5J40 A;  1IV8 A;  3KEO A;  2X1E A;  5F1J A;  3HRT A;  2IGM A;  1MBE A;  3R0J A;  2VKV A;  2VE9 A;  4F93 B;  1R23 A;  2Y9Z A;  4HSR A;  2ZJP F;  1IC8 A;  4R8H A;  1G3T A;  3T8R A;  1ULY A;  2EB7 A;  2LY2 A;  3QYE A;  3I53 A;  5ED4 A;  2E7W A;  1R1T A;  1YS7 A;  1W7P B;  3CMM A;  4A0Z A;  2R7V A;  2GOM A;  1D0X A;  4U87 A;  3S32 A;  2F5C A;  4PJM A;  5F1R A;  2CQK A;  3IH2 A;  2CW8 A;  2IS4 A;  3K70 C;  4F52 A;  3PSI A;  2A3S A;  2L9V A;  2MLK A;  5B1B H;  1AOY A;  2FUG 2;  2L9S A;  2VJ5 A;  2JA8 J;  4L9T A;  3QOE A;  1LFU P;  1G4D A;  4KNY A;  2HTJ A;  3WE2 A;  1JKQ C;  1CF7 B;  1UMQ A;  1U8R A;  1OFC X;  2Z16 A;  1P2F A;  4L9J A;  4ZJZ A;  3S1Q J;  5HS8 A;  1E17 A;  4RAY A;  2BZT A;  3HUG A;  3EYI A;  2HVS A;  1FMW A;  4GO1 A;  1J0R A;  1SFK A;  4ZZL A;  1H0M A;  3GZ5 A;  1F9N A;  3A4C A;  1J9I A;  5D6E A;  2DYS H;  4MIM A;  3MVP A;  3OIP A;  5FLX Z;  1QNT A;  2HR3 A;  1KA8 A;  2M8E A;  2QVO A;  3GFI A;  2W7N A;  2V7F A;  3NAU A;  2L4M A;  1SVO A;  3R60 A;  3ZQH A;  4OIN F;  1RNL A;  2BEO A;  4K2E A;  4LJZ F;  1FBQ A;  4A0X A;  2IS1 A;  4ZYH A;  4ZYE A;  3LWF A;  2PJP A;  1OCT C;  3M07 A;  3G1O A;  1MMS A;  1SD7 A;  3IRQ A;  1J5Y A;  2F4M B;  5HNF A;  1TL8 A;  3J80 K;  3MEX A;  1AHD P;  2EZH A;  3IWF A;  4HYE A;  4S04 A;  1YJ9 I;  5EEH A;  4E7H A;  1K79 A;  1E0E A;  5AON A;  3ZRG A;  2DW4 A;  3TKY A;  5LRS A;  1DPU A;  2QA4 I;  3H5R A;  4B48 A;  3GXO A;  4AC0 A;  2XIG A;  1XGM A;  2DA7 A;  1MBF A;  4OMY A;  1X1P A;  5LD2 C;  3V8L A;  2V1U A;  4FCY A;  4H0E A;  1YE9 A;  1XC5 A;  3HOX J;  2DA2 A;  1T39 A;  3LOC A;  5LGN A;  2ELJ A;  2LKS A;  2OZU A;  2K9Q A;  2O8X A;  4ZYA A;  5FKN A;  2DPU A;  1DQU A;  1R5I D;  2EA4 A;  3K6G A;  4L5I A;  1OPC A;  4CYC B;  2LBF B;  3S14 J;  5K1Y A;  5M3M J;  3BCA A;  2Z5U A;  1TC3 C;  4MTE A;  3S15 J;  4M6Y A;  1UFM A;  3BTI A;  1Y8R B;  4B4C A;  1WI9 A;  4KUM A;  2HEO A;  3H3V K;  2CV2 A;  3GO5 A;  5E1W A;  5E17 F;  1QHH D;  3E6B A;  2XGD A;  4P96 A;  2KP6 A;  2L54 A;  3BJA A;  1BIA A;  2NXN B;  3BQY A;  1L0O C;  3BZK A;  2IP2 A;  4M3D A;  1QA6 A;  3H0G J;  2E1C A;  3CCR I;  4DYR A;  3H35 A;  4XK4 A;  4BQQ A;  1X2N A;  4MO7 A;  3PNT A;  1U2W A;  2R93 J;  1Y0U A;  4NQW A;  2K3P A;  3DKX A;  2GXG A;  2CQN A;  4EJO A;  2HDC A;  3OR1 C;  3RKQ A;  3CME I;  3JRG A;  1W36 C;  1RZ4 A;  2ID3 A;  1FWZ A;  2LSO A;  2PBI A;  4P55 A;  3JRB A;  1VQM I;  2YUS A;  5CVI A;  2F5D A;  4FE7 A;  3O8H A;  5BPD A;  4BYY A;  4AIJ A;  1QPI A;  5D8L B;  1A5J A;  3OSF A;  2CO5 A;  2R7U A;  2M4G A;  1EV7 A;  5IYB J;  5EEA A;  1WJ5 A;  1Z7U A;  4CCM A;  5K7F A;  1A04 A;  3ZMU A;  1O3Q A;  2E1N A;  2LOO A;  2P81 A;  2ACJ A;  3CZ6 A;  1XGO A;  4ITV A;  3AG4 H;  2ICW G;  1FSE A;  1G59 A;  4A3E J;  4F7Z A;  2J5P A;  2K85 A;  5HOO A;  3K1N A;  3O6B B;  3HG9 A;  4N4N B;  2V6C A;  4IZZ A;  3TO6 A;  1N78 A;  2W25 A;  5L3B A;  3PIP F;  5C4X J;  2ESN A;  5GAD J;  2R7R A;  1X1C A;  3MN2 A;  3HSE A;  3U1K A;  4PFO A;  1FMV A;  3Q0V A;  1HW2 A;  3RQ4 A;  3HEF A;  1UB9 A;  1IUY A;  1K6O A;  1I39 A;  4BBR J;  2GLO A;  3NAR A;  5EYR A;  3SDB A;  4MFE A;  3GEZ A;  2DJI A;  2QQA A;  4RLF A;  5HOD A;  4HF2 A;  2PG4 A;  3CC2 I;  5J1Y A;  3CUQ A;  2JA5 J;  1RKT A;  1D0Y A;  3ZP5 A;  2W1O A;  2ID6 A;  3D5R C;  4ENM A;  4RAG A;  1U0J A;  5JHF A;  2P5L C;  2R5Y A;  4HQM A;  1AU7 A;  4UB6 C;  1G3S A;  5L3D A;  4DZP A;  4YIR X;  3K4J A;  4PZJ A;  2LMD A;  1BI0 A;  3FDY A;  2E5Z A;  4FX0 A;  5DV5 A;  2AQF A;  2LDU A;  1MNM C;  3L09 A;  3JRA A;  2VT3 A;  4HF1 A;  4LG3 A;  3SFI A;  4UUS A;  2EBI A;  3OYI A;  4B8X A;  3OYG A;  3OMY A;  3OYN A;  1R7J A;  3TW6 A;  3FK7 A;  3HRS A;  4HF0 A;  1YRN B;  2IEK A;  5GAG J;  3H3Z A;  3GLL A;  4M74 A;  3C2G A;  3GUD A;  4LB5 A;  5F0F A;  2BXZ A;  1A36 A;  2TRT A;  1K61 A;  2OPT A;  2MLG A;  1FOW A;  1QZY A;  1MIJ A;  2KQR A;  2C6Y A;  4DIQ A;  3OYA A;  1N75 A;  2JN6 A;  4PK4 A;  1R71 A;  3HTU A;  2BW3 A;  1YIJ I;  1R1U A;  5FJ8 J;  3GTJ J;  3V8K A;  2WB1 A;  2K4B A;  1GV2 A;  1S7E A;  5DCM A;  4UUT A;  3F22 A;  1CGP A;  1VF9 A;  4XKB A;  4XKW A;  2PI0 A;  5H6R A;  2KMU A;  1KU3 A;  1UEL B;  2YPR A;  1RKW A;  2V1D A;  2YU3 A;  5E3M A;  1ZKG A;  3DWL E;  2PLY A;  2XSJ C;  1MJB A;  2NVQ J;  2G7U A;  3GTG J;  3JRH A;  1ZG5 A;  1J75 A;  4CYD A;  2CFX A;  4B09 A;  4W97 A;  4RB1 A;  2VE8 A;  5LHG A;  5DUK A;  1NK3 P;  3KIO A;  2IBD A;  5ICF A;  3OSG A;  2F48 A;  3OS2 A;  1QZE A;  3KEQ A;  4OIR F;  1X3U A;  3W6J B;  2DMP A;  4J19 A;  2JA2 A;  3BJO A;  3RPU D;  3DEE A;  4A3K J;  4BAY A;  4QTR A;  1EA3 A;  2K02 A;  3H9J A;  3ERM A;  1W0U A;  2LKX A;  3IL2 A;  1YIT I;  3HOS A;  1W7P D;  3PQJ A;  3RDI A;  4DGW B;  1T56 A;  2COM A;  4RDU A;  2HYG D;  3BG6 A;  2KIS A;  3HOT A;  3RPQ A;  3GWZ A;  3VOD A;  3BG3 A;  1ZEL A;  3DF8 A;  3HSR A;  3BPV A;  1YFH A;  3BY6 A;  2PJR A;  5JLX A;  1SMY F;  4BHB A;  1JTX A;  3EUH C;  4DZJ A;  2EFW A;  1V54 H;  3IHU A;  1YW8 A;  2HPI A;  3BR3 A;  1JJ8 C;  1IDZ A;  1YG2 A;  1HXD A;  3FF5 A;  1HCR A;  5IT3 A;  2BXY A;  2X4H A;  4CCJ A;  1UCR A;  4HOB A;  5CYV A;  3KET A;  2KIM A;  3N4M A;  2HYF A;  2HDD A;  1WH7 A;  4G7H F;  1O3S A;  2YS9 A;  1FTT A;  4P9F A;  3C18 A;  2RGV A;  3JTG A;  4CO8 A;  2WA0 A;  3F6O A;  2A07 F;  2VON A;  4M6X A;  1RES A;  2R7D A;  3HRM A;  2DA6 A;  3H1C A;  1YW7 A;  2RAE A;  3OL4 A;  1S9H A;  1BA5 A;  1HKS A;  3WU0 A;  3EYY A;  1A6Q A;  3ABK H;  4RB3 C;  4MEY F;  1RUN A;  3GTO J;  2BVM A;  3VPR A;  2STT A;  2XRO A;  4YFX F;  1CF7 A;  1XX5 A;  3FM5 A;  1Z77 A;  4BUP A;  3ZN0 A;  1J2X A;  3HKZ A;  4IKF A;  1SVL A;  1ZLJ A;  2HYJ A;  4BJ6 C;  5HNH A;  1J59 A;  3KP7 A;  3L2U A;  1OCZ H;  5DS9 A;  2TDX A;  4L5E A;  1VQ5 I;  1D3Y A;  3OYE A;  2ZXJ A;  4FAS D;  4BE2 A;  1T8I A;  2Q1Z B;  2P5V A;  3WG9 A;  1IUF A;  1UJ8 A;  2Z2S B;  5ICE A;  4ESJ A;  3GYH X;  1TBX A;  2L7K A;  4A6D A;  2NS8 A;  2P7C B;  3BG7 A;  3I58 A;  2FEZ A;  2L5Q A;  4EVI A;  2V6E A;  2FNA A;  2VBZ A;  5D5W B;  4LIU A;  4D0P A;  4QLC U;  1XSX A;  1O3T A;  5E8G A;  3S1M J;  1N25 A;  4YFK F;  2DO7 A;  1XPX A;  1GUU A;  2PMH A;  2PQ8 A;  1B9N A;  4RBO A;  2HXI A;  4RA2 A;  1ZRF A;  4MQV A;  2Y75 A;  3RJP A;  5C44 J;  2QGU A;  2KZV A;  1DGR M;  4BJT A;  5FD6 A;  2NS7 A;  1JT6 A;  3L2C A;  1SAX A;  5E3L A;  5IY5 H;  3WE3 A;  4Z6Y A;  1U9O A;  1XSD A;  2ZJR F;  2K9M A;  4KMF A;  2P0W A;  2QKL B;  1ETY A;  3TBI A;  2WAD A;  2NNN A;  3EQL F;  4BBS J;  4KIF A;  1H89 C;  1EKE A;  2HGC A;  2IJL A;  3GFJ A;  5ICC A;  5B5E C;  4LG0 A;  2ELK A;  4XLE A;  4A12 A;  1HQC A;  2DI3 A;  2HQR A;  1TLH B;  2IA2 A;  3KPH A;  2QBY A;  2LBF A;  1IAW A;  4LIT A;  1Y0N A;  4N9I A;  1WJB A;  4M9Z A;  4LOC A;  3FXQ A;  4CCL A;  2RV8 A;  5M5X J;  4EJW A;  5B3S H;  3TOB A;  2VC0 A;  5GTH C;  4YEJ A;  4V2F A;  3QPL A;  3MAJ A;  1W5S A;  3BQZ A;  4HX7 A;  1Y56 A;  5F27 A;  1CQT A;  1RUO A;  1IXC A;  1MBH A;  2R7O A;  1WZ2 A;  3K4L A;  3H3U A;  3LSH A;  2M0M A;  4P1W A;  2GA1 A;  4CDG A;  1TQP A;  2ADU A;  2GAU A;  2HKO A;  1FYM A;  5TJJ A;  3D5L A;  3GBG A;  2RC4 A;  2QCO A;  2XVC A;  3OL3 A;  2GIZ A;  3BZC A;  2ME6 A;  1LUJ B;  2OUM A;  4XM3 A;  3I59 A;  2X51 A;  4DQ2 A;  2A05 A;  3J81 K;  3MKW B;  4LLG F;  4G7O F;  3EUK L;  2MG4 A;  2DN0 A;  3KYL A;  1LKX A;  2ZME C;  1O7F A;  4I98 B;  2JK3 A;  3S1R J;  3COA C;  3RI4 A;  1MSF C;  2FE3 A;  3QPT A;  1JE8 A;  4JBA A;  2NVU B;  3V8J A;  4C2T A;  2V9K A;  3E6C C;  3K10 A;  3RZD J;  1PP7 U;  2LLK A;  3E5X A;  3LSM A;  3EET A;  1IDY A;  2KJB A;  1Y6I A;  1OKR A;  3I5U A;  3NEU A;  3QAH A;  2ME0 A;  3Q9S A;  3H5N A;  4HW0 A;  2VOO A;  3MQ0 A;  4IRG A;  1AA7 A;  2K9S A;  3D1N I;  3HXL A;  2XGE A;  2HWV A;  3ZQG A;  4YFN F;  3F8M A;  2JRT A;  1ETV A;  1WCM J;  5CPR B;  1TWG J;  3OYL A;  3W2V A;  3LQQ A;  1DP3 A;  3SHF A;  4JP0 A;  1S3J A;  2RKH A;  4D7M A;  2P6T A;  2MFZ A;  3DBL B;  2DMT A;  1SFX A;  1X1B A;  3CLQ A;  1OYW A;  2DA5 A;  1BR2 A;  2MD0 A;  1FYL A;  3K2Z A;  4LLL A;  3MKY B;  1T0F C;  3BWG A;  2DAO A;  1G8X A;  3GME A;  2VIX A;  3ZQF A;  2BHY A;  1RPW A;  4A3I J;  3DLL F;  3W6K B;  1D1A A;  1Z91 A;  3AL0 B;  3P7N A;  2M87 A;  2IXS A;  3HPH A;  1TZL A;  3KE2 A;  3H5A A;  4DNC A;  1F43 A;  1PYV A;  3JAM K;  1A31 A;  5IOZ A;  3Q0U A;  2R7X A;  3B73 A;  1NG7 A;  2EIM H;  2XF7 A;  5EEG A;  4PJL A;  3HYI A;  4DOZ A;  3QOD A;  3JSP A;  2FX0 A;  3DEU A;  1TW3 A;  1OCP A;  2DMN A;  5IP6 A;  4G94 A;  1UG0 A;  3M1C A;  2IS2 A;  2B7E A;  2V79 A;  1I5Z A;  4J00 A;  3LSI A;  1GT0 C;  2E60 A;  2ZSI B;  5AIQ A;  2YR2 A;  5EJC A;  1AKH B;  2HOT A;  1XCB A;  1JUS A;  2X1D A;  2QQB A;  1VQL I;  2L2O A;  2E5N A;  4D5F A;  5IPA A;  3WTY C;  2FA5 A;  5IOY A;  2CV0 A;  5EGO B;  3DU6 A;  2ETH A;  1XGS A;  3BR2 A;  3SZP A;  4XOT A;  2H1L A;  2DLL A;  2OJE D;  1BIB A;  3ABL H;  1YI2 I;  2DT7 B;  1KU2 A;  1O7L A;  1BI3 A;  4EEF G;  4BAC A;  4DW6 A;  4IL6 C;  1QRY A;  3ZMV A;  2Y31 A;  2XC7 A;  2G0E A;  3TDU C;  3CF5 F;  1P7J A;  2Z33 A;  1MMN A;  2JT1 A;  2I10 A;  1T2K A;  2D5V A;  4M71 A;  1FOY A;  2HFH A;  1ZAO A;  3ML6 A;  4IHW A;  2L9R A;  3T0Y A;  4HDV A;  3LSP A;  1VTN C;  2PX9 A;  4IX7 A;  4JYK A;  2ECB A;  4R79 A;  2ZB9 A;  4EGZ A;  2OTJ I;  4Y52 J;  4IQJ A;  2Z99 A;  4WX9 A;  1QHG A;  5GTI C;  3ECO A;  4DYC A;  3JRC A;  1MMD A;  3BTC A;  2QLZ A;  1D0Z A;  3LSJ A;  2JZY A;  2VB6 A;  1V3F A;  1HST A;  2H8W A;  3HC7 A;  2V9P A;  3ZCO A;  4ZTJ A;  3KCC A;  3HGG A;  3HTS B;  1MDM B;  1ZHF A;  1ZG3 A;  2ISZ A;  1HKT A;  2BGC A;  2JPB A;  2LF7 A;  2BY0 A;  2EIJ H;  2F5F A;  3GTM J;  5ILS A;  1W5C C;  4E7K A;  1ETO A;  2R7T A;  2DOF A;  3FK6 A;  2ZNY A;  2JVG A;  2OC6 A;  3WTS C;  4ASN A;  1OLT A;  4N4O B;  2LY9 A;  2XSD C;  3NRV A;  4FTH A;  1I27 A;  5GP9 A;  5E79 C;  3UR3 C;  5FFX A;  4P9U A;  1N77 A;  2GOX B;  3LFK A;  1GXP A;  1GDT A;  1U5T B;  2XAF A;  4I2O A;  2HZD A;  1K83 J;  1KGS A;  3IKT A;  3QQA A;  1GXQ A;  1F1Z A;  1PUF B;  2KIF A;  2CV1 A;  1ZN2 A;  2CUJ A;  1MSE C;  2RDP A;  2F4I A;  3J81 Z;  3ZN1 A;  1YLF A;  5DD4 A;  3GLX A;  1IN5 A;  4IOA F;  3E7L A;  1WJF A;  4GRI A;  4WXC A;  3F23 A;  5JI6 A;  1I50 J;  1VQ4 I;  2AXT C;  1SD4 A;  1K78 B;  4ZC3 A;  4U0W A;  5KVR A;  1XN7 A;  3MKL A;  5EDN A;  2Q0O A;  2UUZ A;  3ULQ B;  1HF0 A;  2A61 A;  3F8F A;  3WGH A;  1Z6T A;  5EG0 B;  3FMQ A;  3I3L A;  1Z9C A;  1EH8 A;  4A3J J;  1EH7 A;  3DPU A;  4NNJ A;  3HOW J;  2O6G E;  2RRE A;  4I99 C;  2CRG A;  5LEJ A;  4UY8 I;  4CCK A;  2FRH A;  2JRM A;  3ESW B;  3CC4 I;  2DPD A;  2HU9 A;  3LSR A;  2I5U A;  4XOR A;  5TRD A;  2LK2 A;  5E8I A;  4NB5 A;  3IC7 A;  3QRF F;  1FY7 A;  4D1Q A;  2OCC H;  1R4N B;  3G1L A;  1Y8Q B;  1LB2 A;  2HS5 A;  2MH2 A;  2X0L A;  3OYC A;  2FOK A;  2VOP A;  4XLC A;  2W82 A;  4XRM A;  2F5V A;  1IJW C;  1ZRD A;  4GCV A;  4PJ0 C;  3SYT A;  1F4K A;  1Z3Y A;  2E1O A;  3BTJ A;  2VLA A;  3WTT C;  3DP7 A;  3X2Q H;  2L9N A;  2E19 A;  4LK0 F;  4EM2 A;  2PMZ A;  1ACI A;  5J4Y A;  5KHD A;  1T38 A;  3DEW A;  1G3Y A;  2QSG X;  4PCQ A;  5FKO A;  3JAM Z;  1HLV A;  3M4O J;  2ZSH B;  5FFZ A;  1YW9 A;  3WG7 H;  3WU2 C;  2B9S A;  4A3L J;  2XAS A;  2PMU A;  3ZMS A;  3P9I A;  1I6X A;  3S2H J;  4HLX A;  3ZXS A;  1JTY A;  1QU3 A;  1WRJ A;  4XSZ F;  2DT6 A;  4HZF A;  1I6H J;  2LR8 A;  1HA8 A;  5B66 C;  1WGX A;  2K3F A;  3BP8 A;  3G71 I;  3A0H C;  1MNE A;  3S2W A;  5LGT A;  1MKM A;  3OYH A;  2NYX A;  4IVN A;  3VYT B;  2FBH A;  1IG7 A;  3V7S A;  4ZTF A;  2E2I J;  3I4M J;  2MC4 A;  3NQO A;  4RM3 A;  3HOY J;  1T6S A;  2M7B A;  2L7F P;  4II2 A;  4LFU A;  4UHT A;  5CLS A;  1VQ6 I;  2F5E A;  1JUM A;  1T33 A;  2L0K A;  3ZQ7 A;  5ILU A;  1G6N A;  1ORK A;  5CKT A;  4P5O A;  1ERD A;  3K4M A;  3L2W A;  4KA4 A;  2Y2Z A;  1VQ8 I;  1E3H A;  6PAX A;  2LFB A;  5DTD A;  3S2D J;  3Q3S A;  3CUQ C;  1YQA A;  4M6V A;  2MW8 A;  2OU2 A;  4MTD A;  5J1U A;  4L0Z B;  3KZZ A;  3CJQ B;  2M30 A;  2VJ4 A;  5KNL A;  3MCZ A;  5D5V B;  2R7W A;  1POG A;  1V5F A;  1LFB A;  3C7J A;  2R3S A;  2HTS A;  3H36 A;  4PUS A;  3BRO A;  1IO2 A;  4ABZ A;  2VKH A;  4IJA A;  4XQF A;  3A02 A;  2QZ8 A;  2K4J A;  2JQ7 A;  4B1R A;  1VZ0 A;  3C2B A;  1MND A;  4RGX A;  3GW2 A;  4LB6 B;  1S72 I;  5E3N A;  4I0B A;  5HLI A;  5FD5 A;  1UHW A;  4CHU A;  2QEX I;  1BI2 A;  3F0C A;  1IRF A;  2L4A A;  3PO2 J;  4HRI A;  2OCE A;  1AWC A;  2QQ8 A;  4E70 A;  2EZI A;  2YU9 J;  3M7G A;  2E1M C;  2AS5 F;  3HDD A;  1SFO J;  1KU7 A;  3BR1 A;  2VI6 A;  4BH9 A;  4E7I A;  2R7S A;  3KZI C;  2MD5 A;  2VN2 A;  3GF2 A;  2EV6 A;  4L18 B;  4IQ4 A;  3AG2 H;  2VXD A;  1MZB A;  1IRX A;  2WV0 A;  1ONV A;  3FMS A;  4EGY A;  3WHB A;  5IYD J;  4AYB A;  4I6Z A;  2R4G A;  4UV8 A;  3DBH B;  4C3H J;  3CCY A;  2X6W A;  2ZC2 A;  3OYB A;  1XMX A;  1XSV A;  2O5R A;  1SC7 A;  4RLQ A;  3FXM A;  2Y0S A;  3FIS A;  2M7A A;  4AVP A;  3WTV C;  1NH3 A;  4CGZ A;  1LVA A;  1K7A A;  4LLN A;  2JVH A;  1FP1 D;  1OCR H;  3IP4 B;  1UG2 A;  1E3P A;  4HA8 A;  3E97 A;  3W2W A;  4BQO A;  3SDG A;  4YIF A;  3GTQ J;  4IHX A;  2MH9 A;  4KT5 C;  2GIV A;  5BNG A;  4Q4Z F;  3LSG A;  4Q47 A;  5HLG A;  1VQ9 I;  2FXA A;  4C3I J;  1XDU A;  2WB1 N;  1Z67 A;  4RGU A;  2DK5 A;  2H8R A;  2O9L A;  2IGO A;  4AM3 A;  3KYD B;  3RTR A;  2D1H A;  5CJ9 A;  2XUB A;  1TW2 A;  2A69 F;  3J7A O;  2L3D A;  3K1P A;  2DFF A;  2E35 A;  1B72 A;  2VAS A;  2M4K A;  3PM1 A;  2V1N A;  2XAU A;  1TWH J;  2LF8 A;  5HLH A;  4GDF A;  3GZN B;  2LTP A;  5J47 A;  2EZL A;  3NWS A;  4L9N A;  3HHG A;  1EF4 A;  2HOE A;  5TIS C;  2EFP A;  4ENJ A;  5BOX A;  4PJN A;  1ZQ3 P;  3JR9 A;  4EV0 A;  1BN5 A;  3M8J A;  3HB9 A;  1LE8 A;  1LDD A;  1B8I B;  3B6C A;  3A03 A;  2EA2 A;  3F8N A;  1WJA A;  4DYQ A;  1ZH5 A;  4AWX B;  3FMR A;  2XGC A;  1R9T J;  4UUV A;  1J7K A;  1ENH A;  1ZGJ A;  2R7F A;  3P9C A;  4G6T B;  3KP4 A;  2XB5 A;  5A2Q K;  5EZH A;  2AHQ A;  3KYC B;  1FOK A;  3O3K A;  3QWL A;  4PGH A;  3DPT A;  2WAF A;  2PFB A;  1JHH A;  1JHF A;  1FBS A;  2DOD A;  2STW A;  3WTX C;  3VEP A;  3PFI A;  1FOX A;  4GYG A;  1GVJ A;  2X48 A;  3RPU A;  2DDB A;  1OMI A;  5F64 A;  4RS8 A;  2CMP A;  4KMU X;  3HGY A;  2M8G X;  5CQE A;  4XLA A;  1FYK A;  1KZH A;  1W7P A;  4KT6 A;  2CH0 A;  4Q5S F;  1MD0 A;  1EH6 A;  1ZGA A;  1V4R A;  1SEU A;  2WAQ A;  1P4W A;  4E7Z A;  2KRC A;  2K5C A;  2EQR A;  1C0W A;  4XLH A;  2E2J J;  1QPM A;  4O5V A;  4MLO A;  3S17 J;  1R4M B;  4MFD A;  3RQI A;  4W1U A;  3HUG B;  1U5T A;  4BQN A;  2PN6 A;  5FLM J;  3BT9 A;  2FQ4 A;  1OCC H;  5TGT A;  1D1C A;  2DDA A;  3HOU J;  3S3N A;  3ZQQ A;  3FXU A;  2UWM A;  1X4P A;  1PUF A;  3U2R A;  2BY3 A;  2E71 A;  4I0A A;  1Y1V J;  2GBY A;  4RGR A;  4BHP A;  2X6Y A;  2OZ6 A;  3IH3 A;  2P6S A;  2VXZ A;  4ANJ A;  4D5C A;  2FBK A;  3W3C A;  3HKZ N;  1UAA A;  4E7J A;  2WWY A;  2KDZ A;  5E1X A;  1K78 A;  2LC2 A;  3V7C A;  2GM4 A;  5IYC J;  4ZDL A;  4I01 A;  1LDJ A;  5EG0 A;  2QQ9 A;  1BW5 A;  3WHC A;  1F5T A;  1PDN C;  2QSF X;  3BOQ A;  3KLN A;  4ZYD A;  1Y1W J;  2AQE A;  1RR7 A;  1T95 A;  1QBJ A;  1BI1 A;  5DEQ A;  4X6A J;  1TTY A;  2HOS A;  2A6E F;  5KK1 A;  4HV6 A;  4XID A;  4XRF A;  2FBI A;  3EUA A;  2VQH A;  3R61 A;  2JUG A;  3OYF A;  3E0J B;  4QPQ A;  3RKX A;  1IRZ A;  4YEL A;  4U0V A;  3A01 B;  2CW0 F;  1TT5 B;  2M5W A;  1ITY A;  1JXS A;  3CP8 A;  1VQN I;  2HI3 A;  4A5M A;  5H20 A;  3AKZ A;  1KU9 A;  4BEH B;  4XKV A;  4KDP A;  1LFP A;  4XLF A;  4A3G J;  3SZT A;  3ZQC A;  2KL4 A;  3HM5 A;  4BE0 A;  2ZXI A;  2HZT A;  1R1V A;  1MBG A;  1MH3 A;  3ZGK A;  4IHT A;  1BW6 A;  3DV8 A;  4M3G A;  3PIO F;  4CYC A;  1TWC J;  1YS6 A;  1VI0 A;  4EJV A;  3R0A A;  2VKD A;  4J01 A;  4YG2 F;  1H88 C;  2BYV E;  1FSH A;  3PNY A;  1IXS B;  3DQV C;  4OWR B;  3RKY A;  2VJJ A;  4M3E A;  4AUX A;  3QYB A;  3GTP J;  3TQN A;  3MZH A;  2D1V A;  4IPA A;  5FLV A;  4AIK A;  5M5W J;  1DPR A;  2K27 A;  2YX7 A;  2QSH X;  5BQT A;  2MSY A;  1X19 A;  4TV7 A;  5EF6 A;  3W6V A;  4FQG A;  4WXH A;  2XV4 S;  2QKM B;  1FPQ A;  1XMK A;  2WY7 Q;  5HLT A;  3K2A A;  2ZXH A;  3H9Q A;  2XAG A;  2KRH A;  1MH4 A;  3HSF A;  3K0L A;  4JX4 A;  4Y17 A;  2WAE A;  4AID A;  2Z1D A;  1HBX G;  4E6K G;  3KP5 A;  1XD7 A;  1U3E M;  2RN7 A;  4AD9 A;  3K4B A;  4V19 K;  2ZKZ A;  1HW5 A;  3IH4 A;  3SJM A;  4XSX F;  1SVM A;  4EAT A;  1WPK A;  3I64 A;  3TED A;  4UNO A;  2EPF A;  3GFL A;  4PSX A;  3HBL A;  4V2G A;  2OBP A;  4HNU A;  1WSU A;  5HS9 A;  2IPQ X;  1RI7 A;  4F92 B;  1FIP A;  4JOM A;  5CQG A;  1VND A;  3LAP A;  2V9V A;  1FIA A;  2W84 A;  2P7V B;  2QEN A;  1B1B A;  5E1Z B;  1PJR A;  2B63 J;  4KIC A;  5A2Q Z;  4IHV A;  3I54 A;  5BPI A;  5J4V A;  3BG5 A;  2NS0 A;  3KP6 A;  3FXL A;  2UXN A;  4BY1 J;  3BCB A;  5EZG A;  5BS6 A;  4BDZ A;  3DTI A;  1MJ9 A;  1T98 A;  2VBY A;  3CLO A;  2XKO A;  3CCL I;  2GA2 A;  3I4P A;  3QP5 A;  2MA3 A;  4JX5 A;  4A69 C;  2O0Y A;  1TT0 A;  3F3X A;  4S05 A;  1R49 A;  4OMZ A;  1FZP B;  3UNG C;  1WJE A;  2FNP A;  3KEY A;  3J7Y J;  4EQQ A;  2VKE A;  4PDK A;  2ZFU A;  5K7H A;  4HV5 A;  2JSP A;  2Q2E B;  3ABM H;  4QIW N;  3CQZ J;  3DU5 A;  1BC8 C;  3ABU A;  2X85 A;  5E20 A;  1ETK A;  1HDP A;  2K9L A;  5FO5 A;  2ISY A;  3P9K A;  4G9Y A;  3LNQ A;  2XF6 A;  1A6I A;  2HKX A;  3QPS A;  5FKK A;  1RC9 A;  2CG4 A;  2M9H A;  4OU0 A;  3VSK A;  4NC7 A;  3U1D A;  5M3F J;  2XB0 X;  4MHG A;  3V7R A;  1OR7 A;  2D45 A;  3GCM A;  2IA0 A;  3HPG A;  4XR6 A;  2E7X A;  1IN6 A;  3DKY A;  4UB8 C;  4XRS G;  4CUG A;  3TGN A;  1VFC A;  3K4C A;  1R5H A;  3BLY A;  3LSK A;  1FEX A;  3KFW X;  1YRN A;  1FNN A;  2DCE A;  2DFI A;  2RQP A;  3JSO A;  4LD5 A;  1D8J A;  5CVV A;  1XB4 A;  2X6X A;  5DUI A;  4U7D A;  3FBN B;  5B1A H;  2LKP A;  3PL8 A;  1OIS A;  3L2R A;  5H2F C;  3ZMZ A;  4F55 A;  4M73 A;  5JFR A;  1G3W A;  3O2P E;  4A3F J;  1ETX A;  2J5O A;  1LEA A;  1LPQ A;  1BL0 A;  3QU3 A;  4RAF A;  2KZG A;  4KN4 X;  4CIC A;  1B9M A;  3CJT B;  2EK5 A;  2L02 A;  4E4H A;  1E3O C;  2CS3 A;  5CVR A;  3TL4 X;  2CSO A;  3IAM 2;  2UV1 A;  3OYD A;  1LEB A;  4AIH A;  2BHZ A;  1J09 A;  2X1C A;  2DFE A;  2M1B A;  3J7Z I;  1RIO H;  1T08 B;  1BJZ A;  1Z7L A;  1LJ9 A;  5IT9 K;  2LNB A;  2R5Z B;  2OF7 A;  3MZ8 A;  3N05 A;  2KHM A;  3P5J A;  2XAH A;  3K1M A;  3A0B C;  1ETQ A;  1SAN A;  3L7W A;  1Z0X A;  2VQL A;  3Q9V A;  1UHM A;  1SD5 A;  5HDG A;  5LRR A;  1HSJ A;  4LK1 F;  4NUB A;  3M8F A;  1PUE E;  2Z9O A;  1JI8 A;  2W48 A;  3CCQ I;  2M45 A;  1Z21 A;  4G12 A;  1P7I A;  2HQA A;  3L2Q A;  1TWF J;  2V1X A;  2CQQ A;  3HOZ J;  3CP2 A;  4GYI A;  4B47 A;  4HX8 A;  1Z6R A;  4GFB A;  3I55 I;  4ZH4 F;  4II3 A;  2DMQ A;  1GVD A;  1IW7 F;  3ASN H;  5CVJ A;  4G7Z F;  1SD6 A;  2H09 A;  4B44 A;  1SFU A;  1Y39 A;  2G9W A;  5LEK A;  2YX4 A;  2BY1 A;  3FXJ A;  4NC6 A;  3IAS 2;  4JK1 X;  4ETS A;  5IP9 J;  2CW7 A;  2EIK H;  1TP4 A;  3ZR8 X;  1IRG A;  3F72 A;  2R0Q C;  2LD5 A;  4B3X A;  2CJJ A;  2XPU A;  3E5Q A;  4RM2 A;  2VPR A;  4RAZ A;  3A1Y A;  5J8F A;  3G2B A;  3K70 D;  4BS9 A;  2L01 A;  4HLY A;  2JJ7 A;  2EFO A;  4XLN F;  3RSN A;  2KJC A;  4XBF A;  3D0S A;  4PJJ A;  2CYY A;  4BXX J;  4XN0 A;  4DJA A;  2EIL H;  2JSC A;  2QM3 A;  2L7Z A;  3HL2 A;  3DXJ F;  4MNU A;  2JMW A;  5LFA A;  4CCN A;  2LRE A;  3L00 A;  4JX6 A;  4HNT A;  4RMN A;  3VYU B;  4KN7 X;  2AO9 A;  3KLO A;  3LA2 A;  3V4G A;  4L9V A;  2DJN A;  2ZBK A;  3H9G A;  3ECH A;  1WVR A;  2VJI A;  3IKV A;  4M3F A;  1ZLK A;  2KFD A;  3DBR B;  2R7Q A;  5JHU A;  1R5G A;  3JW4 A;  5JR3 A;  5E3O A;  1YX3 A;  3HOV J;  1UST A;  1U9N A;  1P9Q C;  2QYO A;  3SQN A;  4HPQ A;  3AG3 H;  2ZO4 A;  3PNV A;  1H8A C;  2JTV A;  4BE1 A;  3I0T A;  5J8C A;  1Q1V A;  1OJL A;  2R92 J;  2W4S A;  4QSH A;  2DMU A;  1ETW A;  1SFE A;  4H4K C;  3CJN A;  2ECC A;  2IS6 A;  4KIT B;  3VWB A;  2HNH A;  4HEA 2;  4E7L A;  2Y69 H;  5KCM A;  1ZR2 A;  3BR6 A;  1WFX A;  1REP C;  2DA4 A;  3FIW A;  4ENK A;  1B6A A;  2GQQ A;  4FT8 A;  2P5K A;  1VQP I;  2DQL A;  5FKL A;  4IOC F;  4OIO F;  2IW5 A;  4EJU A;  1WHU A;  4IRH A;  1BJA A;  1W1W E;  4O3M A;  4HG2 A;  2E36 A;  2V4J C;  1D5Y A;  2W24 A;  1WI3 A;  4HBL A;  2OQG A;  1S8N A;  1OYY A;  1UZC A;  4ZDO A;  3OY9 A;  3AG1 H;  3CCS I;  3LMM A;  1WKM A;  3O8G A;  3JRD A;  4E7S A;  4IHY A;  3PSF A;  3A01 A;  4LG0 B;  3D5S C;  2XKP A;  4Y15 A;  3N97 A;  2PMZ N;  3TO7 A;  4A3D J;  2XPW A;  3LA7 A;  5D4S A;  2WBM A;  1YJN I;  4BQA A;  4BEH A;  3JRE A;  3J7A Y;  2IGK A;  5F0H A;  2QBY B;  1BR4 A;  1Z3X A;  1HW1 A;  3CCE I;  1X3W B;  3V42 A;  5J1R A;  3MMY B;  2XRN A;  2ZXW H;  3SZG A;  3C2H A;  2WTE A;  2MGQ A;  3CUO A;  5ERI A;  3R6S A;  5ICG A;  4UVB A;  2FOW A;  5H6Q A;  3CTA A;  1FLI A;  2P8T A;  1KQ0 A;  3HHH A;  1DUX C;  4WK8 F;  1GV5 A;  1W4M A;  4FE4 A;  1IGN A;  4I02 A;  1W36 D;  4A3B J;  2KLO A;  2UZK A;  5F08 A;  3WTU C;  2H94 A;  4KIS A;  1ZRE A;  4CZZ A;  4G8X A;  3K9T A;  2Y48 A;  1ODD A;  4IO9 F;  4R1H A;  1STZ A;  3VFZ A;  1LDK B;  3S1N J;  3BC8 A;  1IV6 A;  3I59 B;  1U8B A;  1XGN A;  4BDY A;  5IT9 Z;  3CMY A;  3OIO A;  5K5O A;  2CUE A;  4KIB A;  2UXX A;  3RCO A;  2K7L A;  1S6L A;  1PVE A;  4BXU A;  3SFZ A;  3E1S A;  3OS0 A;  5L3C A;  5KAI C;  3M8E A;  2CGP A;  2M0C A;  3T1B A;  3AFH A;  3TP0 A;  2GWR A;  3OOU A;  2IAI A;  3M1E A;  3L1P A;  4RGS A;  4XN3 A;  2JA7 J;  1WQ2 A;  1YJW I;  3AAF A;  5FRM A;  2Q8K A;  1EJ9 A;  3RZO J;  2CQX A;  4A93 J;  2N8G A;  4BY7 J;  2VBW A;  3KZY A;  2NOJ B;  2XAJ A;  3GZ6 A;  3FHN A;  1SAU A;  1D8K A;  2GZW A;  3VYS B;  4C2M J;  2WV1 A;  3FBI B;  2FU4 A;  2YSR A;  3OYJ A;  2ZME B;  1KQ9 A;  2EWN A;  3FXR A;  1YOV B;  3DTK A;  3VYR B;  4BJ5 C;  4IRI A;  1P4A A;  3HZJ A;  3F6V A;  3CMA I;  2K9N A;  1Z1D A;  3KX2 A;  4NBQ A;  1JUP A;  2LY1 A;  1K6Y A;  1R58 A;  2CUZ A;  3PUB A;  4Y33 A;  5JVG F;  1FBU A;  4I09 A;  2GXA A;  2F6C A;  2H6B A;  2RNG A;  2W57 A;  3G3Z A;  4C30 A;  1MBK A;  4IF4 A;  2M2E A;  1DDN A;  3JRI A;  4CCO A;  4XRS A;  1B4A A;  5C4J J;  4B43 A;  1BM9 A;  3AL0 C;  1MMG A;  3WGG A;  1NHA A;  3E6M A;  3ZMD A;  5D5U B;  4HDU A;  2KRF A;  2OA4 A;  2FF4 A;  4EJT A;  3LQR A;  1XDS A;  3K4N A;  1A35 A;  1U78 A;  2B0L A;  1IN8 A;  2Y0M A;  4AVZ A;  3CCM I;  4OIP F;  1VQK I;  2LVS A;  2I8D A;  3LL7 A;  3DCF A;  3BDD A;  1QZZ A;  2JPC A;  4AYB N;  2Q2E A;  3BR0 A;  3KP3 A;  4HQE A;  2DXI A;  5IP7 J;  4EM0 B;  5J3L A;  1KYZ A;  4A3M J;  2OAZ A;  4N0B A;  1U6G A;  3A2K A;  5FB2 A;  1DGW Y;  2DTZ A;  4XLP F;  1P92 A;  1FP2 A;  2O8K A;  2Y0S N;  5GPA A;  3G4S I;  2DOA A;  5DCF A;  3UKG A;  3Q5F A;  3DTE A;  4ZYG A;  4CXF A;  2CU7 A;  1LVK A;  2HVQ A;  3HJE A;  5GPC A;  2F2E A;  2NVT J;  4GGG A;  3H0D A;  3LAJ A;  4KJZ A;  5FRN A;  2BOL A;  2O03 A;  3M9A A;  3TP3 A;  1O3R A;  5F04 A;  4GXO A;  3RIR A;  1QVU A;  1W5T A;  4A3C J;  3S3M A;  2HOA A;  3Q0W A;  2DA1 A;  3ABT A;  3S16 J;  2DYR H;  3GTK J;  4IXA A;  2X6O A;  4XL9 A;  1M1E B;  3QP6 A;  3HRU A;  2VT2 A;  5LGU A;  1APL C;  3G1M A;  5F0C A;  2XRL A;  2LP0 A;  2LG4 A;  1BOA A;  1ZTR A;  4FET A;  4C3J J;  1AKH A;  1VQO I;  1MBJ A;  3OR2 C;  1GHC A;  2Y30 A;  3S93 A;  3J80 Z;  3IWZ A;  1DU0 A;  1DU6 A;  3C3W A;  4PFP A;  1HKQ A;  1WJD A;  3DFG A;  2MAB A;  3FXK A;  5EGO A;  1R22 A;  3U9G A;  1QO0 D;  4BU2 A;  5L3E A;  1MJA A;  5D6F A;  1FJL A;  2M34 A;  4MQ9 F;  2RVC A;  2O61 A;  2DTR A;  4RB2 C;  4X1E A;  2KIQ A;  1X1A A;  3FKJ A;  5D5X B;  3JRF A;  1SMT A;  1NG6 A;  2EFN A;  1BC7 C;  2EZK A;  3CD6 I;  2KPM A;  4F3Q A;  1H9G A;  2KDO A;  3ELK A;  2FMY A;  2FD5 A;  2R5Z A;  1JJ6 C;  4HNV A;  2COB A;  1R00 A;  3CES A;  4FIS A;  1TNS A;  1S7O A;  2VQC A;  3ISP A;  1FT9 A;  2BE5 F;  4BXF A;  4NC8 A; 
#chains in the Genus database with same CATH homology
 1MMD A;  2WAE A;  2Z1D A;  4E6K G;  4C2U A;  2R7U A;  2M4G A;  3K4B A;  1D0Z A;  2VB6 A;  1WJ5 A;  3HC7 A;  4CCM A;  3ZCO A;  4ZTJ A;  4EAT A;  2LOO A;  1V5G A;  4PSX A;  3CZ6 A;  4ITV A;  4Y3O A;  4E7K A;  2R7T A;  4HNU A;  1G59 A;  2JVG A;  2OC6 A;  5HOO A;  1OLT A;  4N4O B;  3HG9 A;  1GLN A;  4N4N B;  4F92 B;  2V26 A;  4IZZ A;  4JOM A;  5CQG A;  3UR3 C;  1N77 A;  1N78 A;  2GOX B;  2R7R A;  1PJR A;  3QYF A;  1X1C A;  2HZD A;  4AU7 A;  4PFO A;  1FMV A;  3RQ4 A;  2CV1 A;  3BCB A;  2CUJ A;  4BDZ A;  2F4I A;  3DTI A;  3SDB A;  1WJF A;  4C9Y A;  2DJI A;  4GRI A;  4RLF A;  3VSL A;  1TT0 A;  4HST A;  4XON A;  1D0Y A;  4ZC3 A;  2W1O A;  3UNG C;  1WJE A;  3D5R C;  3KEY A;  1U0J A;  5JHF A;  3TMO A;  2UUZ A;  2ZFU A;  2JSP A;  2Q2E B;  3K4J A;  3DU5 A;  3I3L A;  3FDY A;  2X85 A;  2E5Z A;  3DPU A;  4NNJ A;  4XMY A;  2CFO A;  3S3O A;  2RRE A;  3K4K A;  4CCK A;  2AQF A;  2K9L A;  2XF6 A;  4YRV A;  2HU9 A;  4XOR A;  4LG3 A;  4XNF A;  3OYI A;  2OV7 A;  3VSK A;  4NC7 A;  3OYG A;  4XKC A;  4D1Q A;  3OMY A;  3OYN A;  3I9V 2;  3HPG A;  4XR6 A;  3DKY A;  4CUG A;  3OYC A;  3K4C A;  3BLY A;  3C2G A;  3DPL C;  3LSK A;  4XLC A;  2DCE A;  4ZDP A;  2W82 A;  2F5V A;  2X6X A;  3FBN B;  2KQR A;  4DIQ A;  3PL8 A;  3OYA A;  1N75 A;  3L2R A;  3SYT A;  4PK4 A;  1Z3Y A;  2VLA A;  1X1D A;  2BW3 A;  4F55 A;  1BOB A;  2WB1 A;  2L9N A;  2HVR A;  2VQG A;  2PMZ A;  4XKB A;  4XKW A;  5KHD A;  4D9J A;  3PFY A;  4E4H A;  2M3A A;  2CS3 A;  3L2V A;  2KMU A;  3TL4 X;  3IAM 2;  2UV1 A;  1UEL B;  2ZSH B;  3OYD A;  3DWL E;  1J09 A;  2X1C A;  2XSJ C;  3ONQ A;  3CF2 A;  1Z7L A;  3ZXS A;  2LH9 A;  1QU3 A;  1V5E A;  3N05 A;  4NQW B;  2KHM A;  1D1B A;  2DT6 A;  4OAZ A;  1BR1 A;  2W00 A;  1HA8 A;  3OS2 A;  2VQL A;  2JA2 A;  4NUB A;  1MNE A;  3RPU D;  3OYH A;  3DEE A;  1JI8 A;  1EA3 A;  4CH7 A;  3SEZ A;  3OIQ A;  1Z21 A;  3H9J A;  3DLA A;  3VYT B;  2HQA A;  3L2Q A;  4ZTF A;  3CP2 A;  3HOS A;  4B47 A;  4DGW B;  2MC4 A;  4RM3 A;  3F9K A;  3BG6 A;  4II3 A;  2M7B A;  3HOT A;  4II2 A;  3U21 A;  1ZEL A;  4F91 B;  2LYC A;  4B44 A;  2PJR A;  4CZC A;  5CKT A;  4P5O A;  1ERD A;  3K4M A;  3L2W A;  2BVL A;  1WJC A;  4OAY A;  2VPL A;  4BL0 B;  3IAS 2;  2IGN A;  3EUH C;  2CW7 A;  2VL8 A;  2LRD A;  3ZR8 X;  4BXF A;  2HPI A;  4QPO A;  4B3X A;  2HPM A;  3CJQ B;  4RM2 A;  2VJ4 A;  2A6T A;  4CSW A;  5KNL A;  3A1Y A;  3CJR B;  3W2A A;  4CCJ A;  3G2B A;  3K70 D;  1KON A;  4BS9 A;  2R7W A;  1V5F A;  3RSN A;  4PUS A;  2A5W A;  4PJJ A;  2VKH A;  2XDV A;  4XQF A;  4XN0 A;  2WA0 A;  4DJA A;  3HL2 A;  3OWT A;  1VZ0 A;  1MND A;  5LFA A;  4CCN A;  2LRE A;  3OL4 A;  4DBQ A;  4HNT A;  1S9H A;  3PJR A;  4RMN A;  3VYU B;  1OR7 C;  2BVM A;  3H9G A;  4HRI A;  2VJI A;  2R7Q A;  2E1M C;  4BUP A;  1YX3 A;  3HKZ A;  4IKF A;  4BJ6 C;  5HNH A;  4E7I A;  2R7S A;  3L2U A;  1MW7 A;  1P9Q C;  2RQQ A;  3LFU A;  4HPQ A;  4CA0 A;  3PNV A;  4IQ4 A;  3OYK A;  3OYE A;  4BE1 A;  2VXD A;  4FAS D;  4BE2 A;  1IRX A;  2Q1Z B;  5FRO A;  2W4S A;  2Z2S B;  4AYB A;  2R4G A;  4DBR A;  2L7K A;  4H4K C;  4XOP A;  2IS6 A;  4KIT B;  3VWB A;  4PSW A;  2E1M B;  2HNH A;  4HEA 2;  4NC8 A;  3BG7 A;  4E7L A;  2X6W A;  5KCM A;  1YX5 A;  2L5Q A;  1WFX A;  3OYB A;  2O5R A;  4RLQ A;  4X0G A;  2V6E A;  2Y0S A;  2M7A A;  4LIU A;  4BGD A;  3NWT A;  2BW3 B;  2JVH A;  3IP4 B;  3W2W A;  4BQO A;  4HG2 A;  5HVQ C;  2V4J C;  3S8P A;  2KZV A;  1DGR M;  4BJT A;  3VDX A;  3LSG A;  4ZDO A;  2WY8 Q;  4LIV A;  3OY9 A;  2K9M A;  3LMM A;  3SEQ A;  2P0W A;  2QKL B;  3PSF A;  3TBI A;  2WAD A;  4E7S A;  3D5S C;  2IGO A;  3IUO A;  2MYS A;  3RTR A;  2WBM A;  4BEH A;  4U7B A;  3J7A Y;  2IGK A;  1R6R A;  4JQF A;  4XLE A;  1BR4 A;  1MMA A;  3OYM A;  1Z3X A;  2VAS A;  2M4K A;  2V1N A;  2XAU A;  3V42 A;  2LBF A;  3MMY B;  4LIT A;  3SZG A;  4Y4R A;  3C2H A;  1WJB A;  1X4O A;  3NWS A;  3OS1 A;  4CCL A;  2HDW A;  4PJN A;  3M8J A;  4YEJ A;  1W36 D;  3EPZ A;  1Y56 A;  2XF5 A;  2KLO A;  3MKZ A;  2PJR B;  3MD2 A;  4KIS A;  1WJA A;  2R7O A;  3K4L A;  3LSH A;  2M0M A;  4P1W A;  4G6T B;  2X1E A;  1LDK B;  2IGM A;  3BC8 A;  3D5L A;  3GBG A;  4BDY A;  3DPT A;  2WAF A;  4F93 B;  3OL3 A;  2OUM A;  4XM3 A;  2X51 A;  3RCO A;  3MKW B;  4HSR A;  3EUK L;  3E1S A;  3OS0 A;  3KYL A;  1LKX A;  2LY2 A;  3QYE A;  3AFH A;  3OOU A;  2CMP A;  3CMM A;  2R7V A;  4XN3 A;  2GOM A;  1D0X A;  4U87 A;  2V9K A;  4PJM A;  3S32 A;  4C2T A;  3K10 A;  5CQE A;  4XLA A;  5FRM A;  2CW8 A;  2IS4 A;  4KT6 A;  3K70 C;  2CH0 A;  4F52 A;  3LSM A;  3PSI A;  2NOJ B;  3FHN A;  1SAU A;  1Y6I A;  3VYS B;  3FBI B;  2WAQ A;  3OYJ A;  2FUG 2;  2L9S A;  4E7Z A;  2VJ5 A;  2KRC A;  3QOE A;  2K5C A;  3DTK A;  3VYR B;  3H5N A;  4BJ5 C;  4XLH A;  4MLO A;  3KX2 A;  1AA7 A;  2LY1 A;  1K6Y A;  2CUZ A;  2Z16 A;  3HUG B;  3PUB A;  4Y33 A;  3HXL A;  4BQN A;  4ZJZ A;  5TGT A;  1D1C A;  2F6C A;  3S3N A;  2RNG A;  4C30 A;  3ZQQ A;  2HVS A;  2UWM A;  1X4P A;  5CPR B;  4CCO A;  1FMW A;  3OYL A;  1SFK A;  3W2V A;  1DP3 A;  4B43 A;  3A4C A;  2MFZ A;  2X6Y A;  1X1B A;  3AL0 C;  1MMG A;  3OIP A;  2VXZ A;  2MD0 A;  1BR2 A;  4ANJ A;  3W3C A;  1UAA A;  2W7N A;  4E7J A;  2V7F A;  3K4N A;  3MKY B;  1T0F C;  2LC2 A;  4AVZ A;  2IS1 A;  4ZDL A;  1G8X A;  2I8D A;  3LL7 A;  2VIX A;  5HNF A;  2DXI A;  1D1A A;  3AL0 B;  2IXS A;  3HPH A;  1TZL A;  2AQE A;  3H5A A;  1T95 A;  4E7H A;  1PYV A;  3A2K A;  1E0E A;  1DGW Y;  3ZRG A;  2R7X A;  1NG7 A;  3H5R A;  4B48 A;  3EUA A;  2VQH A;  2DOA A;  2JUG A;  3DTE A;  2XF7 A;  4PJL A;  3OYF A;  5LD2 C;  3E0J B;  1LVK A;  2HVQ A;  4QPQ A;  4DOZ A;  3QOD A;  4YEL A;  1YE9 A;  3H0D A;  2ELJ A;  3CP8 A;  4KJZ A;  5FRN A;  2BOL A;  1UG0 A;  3M1C A;  2IS2 A;  3AKZ A;  4J00 A;  4BEH B;  4ZYA A;  3S3M A;  3LSI A;  4XKV A;  1LFP A;  4XLF A;  2E60 A;  1DQU A;  2ZSI B;  3K6G A;  4XL9 A;  2KL4 A;  2X1D A;  4BE0 A;  2ZXI A;  2L2O A;  2E5N A;  4FET A;  2LG4 A;  2LBF B;  3ZGK A;  3BCA A;  2CV0 A;  3OR2 C;  3DU6 A;  3S93 A;  2VKD A;  4PFP A;  4J01 A;  1WJD A;  2MAB A;  4BU2 A;  2CV2 A;  4XOT A;  1QHH D;  3PNY A;  2KP6 A;  2DT7 B;  3FKJ A;  1X1A A;  3DQV C;  4OWR B;  4BAC A;  1NG6 A;  2XC7 A;  2VJJ A;  3H35 A;  3QYB A;  4BQQ A;  1MMN A;  2KPM A;  4F3Q A;  2KDO A;  3PNT A;  2K3P A;  3DKX A;  3CES A;  3OR1 C;  1W36 C;  1X19 A;  4IX7 A;  2QKM B;  2VQC A;  4R79 A;  2WY7 Q;  5HLT A;  4IQJ A;  2ZXH A;  3H9Q A;  1QHG A;  2KRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...