4X0GA

Structure of bsg25a binding with dna
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
PMVTIGPNGTEVSRISLSAINWAMTGPSITRKLLCEIFDRDTLAHHTLSGKPSPAFRDCARPSKQQLDPLKVADLVYLMTNSCDMTPREVRTAITTKCADENKMLRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blastoderm-specific gene 25A
publication title Common and distinct DNA-binding and regulatory activities of the BEN-solo transcription factor family.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein/dna
total genus 31
structure length 108
sequence length 108
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10523 BEN BEN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4x0gA00
4IX7A 4X0GA
chains in the Genus database with same CATH superfamily
4R8HA 1M1EB 2RDPA 1VQ4I 3L9FA 4BXUA 3EYIA 1TQMA 2OPTA 4R79A 2ZMEC 4L9JA 2CH0A 2W25A 1U2WA 1AKHB 2EJRA 3D5SC 3WTVC 3HTSB 4H0EA 4QPQA 4ZYHA 3ZQLA 2AXLA 1EH8A 2XKPA 3U9GA 3DTEA 3I59B 4M3BA 3ZQGA 1K7AA 2HU9A 2ZCWA 3CUQA 3LNQA 3S14J 2Q2EA 3LSKA 1MDMA 1MNMC 1K78B 4ENKA 2RNGA 2IA0A 3OYBA 3OIOA 4LLNA 1TQPA 3BQZA 3LQQA 1O3RA 3EUHC 4HPQA 4IL6C 5D4SA 4Q5SF 2GIZA 5IYDJ 1QVUA 3FWEA 2XRLA 1XG1A 3I53A 3PQKA 1RR8C 2NS8A 3I64A 3HOWJ 5GTHC 5M5WJ 3BTJA 3I54A 1A6IA 3S8PA 1TNTA 2O0YA 3GYHX 3LSIA 3JRDA 2IGNA 3JRIA 2E1NA 1FBUA 3E3VA 2KKOA 2B63J 2HOSA 2JA5J 3CCMI 4A69C 3GLXA 1H8AC 2WBMA 5LHHA 4YFXF 1QNTA 4BEHA 4ENNA 3Q9VA 4IHXA 3P5JA 4FX4A 4M72A 2JA8J 1TT0A 1BIBA 5H6RA 4M71A 3TMOA 3SFIA 3HM5A 2IJLA 2UV1A 2LR8A 4KT6A 1T2KA 2CW8A 2Y48A 2OBPA 2R7UA 1T38A 2EV6A 3HOZJ 1G3YA 2DODA 4BHCA 3IWFA 4MGRA 4E6KG 4EM0B 3DBLB 1JT6A 2KJCA 1YFHA 1T0FC 2ZNZA 4HSTA 2R7VA 3QYFA 3S32A 3CC7I 1Y39A 1VQLI 2A07F 3WU2C 2V7FA 4HV5A 3OV8A 3G2BA 4NC6A 4BQQA 2IA2A 3V8JA 4E4HA 3ERED 1LVKA 3VFZA 3LAJA 2EPFA 2DFFA 1A04A 2EIKH 2IPQX 5JHUA 4B43A 3K2ZA 1RIOH 3C18A 2CUEA 4KICA 1WQ2A 2R0QC 1ETKA 1XPXA 2VBXA 1WZ2A 3P9IA 5IY5H 2DDAA 4AVZA 4MHGA 5LEKA 2WC2A 2Q8KA 2M2EA 1PDNC 4A3FJ 3DKWA 2A69F 4Y33A 4UNOA 1TZLA 1YITI 1ACIA 3IP4B 3UKGA 3K1PA 4PJJA 2W48A 1UHWA 3K0LA 2XGCA 1O3TA 4XKBA 1HKSA 4BNCA 1FSEA 1VQMI 3HOYJ 3V42A 2VJJA 5EF6A 4RAZA 1OCZH 3C2GA 4HEA2 1R1TA 2CFXA 1FBQA 2W84A 1ZYRF 2P81A 4UVBA 4IHWA 1BC8C 2E2HJ 3OWTA 2QCOA 5IOYA 3FXQA 3H35A 3NEUA 1UZCA 3NARA 1D1AA 5F1RA 3LSMA 1QVTA 3LA2A 2RN7A 3SYTA 2QGUA 3LSTA 3IKVA 3ABMH 3CP2A 1KA8A 2ECBA 5ILSA 1N25A 4UUVA 1TWAJ 1TWFJ 5FLVA 3O8GA 2R7RA 5CYVA 3DPUA 3NRVA 1PUFB 2VKHA 3ULQB 1K61A 4A93J 2L5QA 2LFBA 4LB5A 2CW0F 2KFDA 1VTNC 4F7ZA 2VIXA 2CO5A 2DFHA 2IS2A 2PMUA 3GO5A 4I0BA 2VOOA 3CC4I 1Y0UA 2LREA 2Y9ZA 2FF4A 3S16J 4LK1F 3F3XA 4QPOA 4RAFA 3OS0A 2A05A 1GUUA 1D8KA 2LTPA 5EGOB 4IQJA 2FXAA 3LFKA 1UJ8A 4LB6B 2BXYA 4DNCA 2K86A 1FC3A 3GFMA 4NC7A 2V9PA 1JHFA 3LOCA 1N78A 3BG5A 2L7KA 2MH2A 4GYGA 4HX4A 4E7ZA 4GRIA 3QPHA 3ZPLA 2IRFG 4FQGA 2GQQA 2HOEA 4B09A 3CCVI 2EZKA 4H4KC 4LG0B 4PK4A 5HLGA 2JSPA 1KQ0A 2PQ8A 3ZP5A 1HSTA 4MO7A 4B48A 2VJ4A 3GFLA 5EEGA 4A0ZA 4XL9A 1OYIA 1HXDA 1ZARA 3F8FA 5E79C 3CMAI 2KIUA 2PMZA 3RZOJ 4IF4A 2MD5A 3P9CA 1T39A 4DJAA 4ZDPA 3VOEA 2KIQA 2KZGA 4KT5C 3TP0A 4CICA 4E7KA 2NOJB 1O4XA 2DT5A 2EA2A 3DLAA 2PLYA 1Z7LA 2KJBA 5DS9A 2KISA 2DQRA 1KONA 3RKQA 3SZTA 3QYEA 4EV0A 3BROA 1TW2A 2FBIA 1VQNI 3S1QJ 5C44J 4QLCU 1A5JA 5LEJA 1CQTA 4Q4ZF 1YJWI 5KCMA 4NUBA 3CLOA 3J7ZI 3FM3A 2FOWA 2IVMA 3W6JB 3DEUA 3CF5F 2V4JC 2LBFA 4HNVA 2LLKA 4RDUA 3DEEA 3K9TA 2F4OB 1B72B 2WADA 3F23A 2BEOA 2EH3A 2PG4A 1X3WB 2E7XA 3PNTA 3KZZA 3BZCA 5EJCA 2DMUA 2IGKA 4MFDA 5H6QA 3TOBA 3C2HA 3HBLA 3LSGA 5KK1A 2DFEA 3LQRA 5FROA 2VOPA 4NB5A 4G8XA 4CO8A 2YU3A 2NVQJ 3F21A 3GEZA 5HODA 2AQFA 2E19A 2X48A 4A6EA 4D7MA 1YW8A 4ZTJA 1BW6A 1H88C 4B1RA 4A0YA 1R36A 4AIJA 4EM1A 3S17J 4B3XA 2Z16A 2LNBA 3KEYA 1Y6IA 4UVAA 5EDNA 2HKOA 3MKYB 1YJNI 3G1OA 4I76A 4GXOA 3DTKA 3CO7C 3JRCA 3CCQI 1BL0A 1W7PA 3QOEA 3HTUA 1UHMA 1ETVA 4MFEA 1I50J 5GADJ 1GVDA 4RBOA 3HRMA 2JN6A 4X1EA 3ZMVA 1ZH5A 5D5UB 1SEUA 3W2WA 1K4TA 4RLFA 2GXGA 2HEOA 5J4YA 1FNNA 2V79A 3CJQB 2B7EA 1XDSA 2NXNB 3U2RA 3BJOA 1Z0XA 4IHYA 2R4GA 2CRGA 3R6SA 1XCBA 3BR2A 4OOIA 2F5FA 4N0BA 3VODA 4PFOA 1UAAA 2RGVA 2XVCA 1W4MA 1QO0D 1WI9A 2ISZA 1L0OC 3A0BC 2E1OA 3KYCB 2KIFA 3LWFA 1XN7A 2EZIA 5M5XJ 2P8TA 3KEQA 4WX9A 3SHFA 3BPVA 3HOVJ 2DK5A 4AWXB 2BOLA 1P6RA 4BXFA 1LJ9A 3PM1A 4AIKA 4BY7J 4ZYEA 4KIGA 1X1PA 4HOBA 3IUOA 1DP3A 4QIWN 1MNEA 1U9OA 2ME6A 1R6RA 1R5GA 2M4GA 5LGTA 4XLHA 3S2HJ 1XMKA 1MW7A 1R58A 2P6SA 4P96A 3HOTA 3GX4X 4N4NB 1KQ9A 2K9SA 4MQVA 5EG0A 3BTIA 5LHIA 1JE8A 1D5VA 4XLEA 3GWZA 5HLTA 5LGNA 4V19K 1OYYA 3WODF 5CPRB 1W0TA 5DV5A 2FBKA 4HYEA 3KZIC 5LLQA 2LH9A 4XKWA 2XKOA 2Y0MA 4XORA 4EVIA 5BOXA 2EFQA 3E1SA 4HBLA 1AKHA 2M0CA 2KMUA 1D5YA 3LL7A 1ETQA 2XB0X 3A02A 2KRCA 1R1VA 3HDDA 3WHBA 1UCRA 1VI0A 3DQVC 3CMEI 2OCCH 2X6WA 4OIRF 2DQLA 1A36A 2E7WA 3REOA 3A0HC 1ZGWA 3ERMA 2XDVA 3F72A 1K78A 2M0MA 3QU6A 3QRFF 2DMQA 4M3FA 4KUMA 5DM7F 3OY9A 2PX9A 1JJ8C 3MAJA 1R7JA 1RNLA 3EUAA 1F1ZA 1KGSA 3ZOBA 3Q5FA 1NG7A 4WWCA 3HHGA 2CV0A 1AHDP 3VYSB 2Z3YA 4L9TA 4CCLA 1ZRFA 3ZMZA 1G3SA 3MVPA 4PUSA 5TJJA 1XB4A 1LKXA 1FYLA 3S1NJ 2VASA 2MGQA 5GP9A 3OYGA 1UELB 2IGMA 1ZRDA 4XOPA 5HS9A 3G3ZA 4B47A 4JYKA 1XS9A 2WV0A 3M9AA 3ELKA 1KQ8A 1MBGA 2RAEA 2V1XA 1J59A 3WGGA 3WG7H 2L54A 5JVGF 4C2UA 2ELJA 3FKIJ 1FIPA 4HAMA 3EDPA 1Z05A 2FNAA 2UWMA 3TP3A 5CJ9A 3IV5A 5M3FJ 1RC9A 3OYIA 4BE0A 2QM3A 4HQMA 2V9VA 1QPMA 2K85A 4HNUA 3JRHA 2OC6A 3S2DJ 2GZWA 2UXNA 3ZN1A 4U7DA 5ICCA 1U5TC 5KHDA 3P9KA 1JTXA 4YRVA 4M74A 3BDDA 3BR5A 3IAM2 2QF7A 1IN5A 3G1MA 3K7AJ 4YELA 4Y4RA 5IP9J 5E1ZB 1WI3A 4N4OB 1EKEA 1X1CA 2K4BA 1IV6A 2HZTA 4RGXA 5F04A 2CS3A 1LQ1A 3Q3SA 2DBBA 3WHCA 2FBHA 5F0FA 5HOOA 2FEZA 1T8IA 4ZYAA 3BCBA 3Q9SA 5FFZA 1YRNB 1ZQ3P 1U78A 3I5UA 4WF2A 3HUGB 4ITVA 4U87A 2XF5A 2Y31A 1MH4A 4TV7A 3J7AY 3M7GA 4FASD 4GYIA 5M5YJ 2VPLA 1O3SA 3A1YA 1UFMA 3K4LA 4CSWA 2VQLA 4UXNA 2CUFA 3BG6A 3IH3A 5HDGA 1NG6A 1X58A 1ENHA 2D1VA 4JK1X 5K5RA 1HSJA 4C3HJ 4RB1A 1DGWY 3K1MA 1XCVA 2ZFUA 4DOZA 4L0YB 1FP2A 1X19A 1REPC 5DD8A 2F5EA 2HDDA 4O5VA 2QYOA 1YIJI 2JJ7A 1UMQA 1ZR2A 4DIQA 2VPRA 3ISPA 1S9HA 5B1AH 4EEFG 4HF1A 3WTZA 4XMYA 5J1UA 1AOYA 1X4OA 3TO7A 5IT3A 4RGSA 2XIGA 2Z1DA 4FT8A 4DBRA 3JRAA 5CLSA 1U3EM 1WGXA 1K79A 5HLHA 1I27A 1I6HJ 4XSXF 1SFKA 4S05A 4BU2A 3WTSC 2L0KA 3GW2A 1DGRM 1OCRH 4M9ZA 5D5XB 1LDKB 3PUFA 2M8EA 3VSLA 4OMYA 1MKMA 1R22A 2ME0A 4L9NA 2W57A 5B3SH 2CW7A 3H3ZA 3K6GA 4IHVA 4M73A 3RZDJ 4YG2F 2KRFA 2DW4A 3WTUC 5L3FA 1OLTA 2FRHA 2XF7A 2ZBKA 3K4BA 3GTJJ 3KYDB 3ECHA 4XLPF 4KIBA 2DYSH 4ZZLA 3GFIA 3HKZA 4UHTA 5BPDA 4RB0A 3I3LA 2G7HA 1G4DA 3AG3H 5IOZA 2DA7A 1PP8F 3TO6A 1E3PA 3IWZA 3ROUA 4NBQA 1HDPA 3UNGC 2XC7A 3CCJI 3M8JA 4HNTA 2LY1A 4XLCA 2DPDA 2R92J 4HDVA 3E6MA 4N9HA 4YFNF 1QQIA 1WVRA 3ASOH 2OQGA 3S1RJ 2EFPA 2M34A 2PI0A 2E60A 3CJNA 3PL8A 5F0CA 3W6VA 2M87A 2VXZA 2CU7A 2OQRA 2R93J 3MD2A 2HZDA 4A5NA 3WGHA 2OAZA 2I8DA 5TISC 1QA6A 1D1BA 5ERIA 3ESWB 3BR1A 1U8RA 1W7PD 3DKYA 2OJED 1TP4A 2K3PA 5H2FC 1IDZA 1WJFA 3MKLA 2I5UA 3PFYA 3Q0UA 1GXPA 3F0CA 3DBRB 2IS6A 3I71A 3PIOF 2XGXA 2ZSHB 2ZJ2A 2HWVA 4HX8A 5GTIC 2NS7A 3AL0C 3A01B 2XAFA 4RM2A 1PYVA 2HXOA 5TRDA 2Y2ZA 3QU3A 4A3CJ 1LFBA 2H8RA 3HSRA 4A3KJ 3QWLA 1W5CC 2V9KA 1Z1DA 3V4GA 4I02A 1ITYA 2GBYA 3SEZA 3VYTB 4B8XA 1FZPB 2FA5A 2L4MA 4C3IJ 3P7NA 1B72A 1CF7B 1GXQA 3QP6A 2HTSA 3U1DA 1T33A 5DM6F 2KDOA 1FY7A 2H6CA 2M45A 3R4KA 1RETA 3QAHA 3OYJA 3K4MA 1I39A 4MTDA 1I6XA 3PSFA 3WE2A 3V7SA 2XAUA 3BCAA 4IOCF 2BW3B 2DTRA 3F8NA 2ZJPF 2A68F 5DUKA 3T8RA 4ESFA 4IJAA 1F5TA 2ZMEA 2E2IJ 2GOXB 4PJLA 2HQNA 2HS5A 1JUSA 4IOAF 5ICGA 4RAYA 1HLVA 3OYAA 4E7LA 2HFHA 3KEOA 2JMWA 5K7FA 1YLFA 2J5PA 5E8IA 3EYYA 5JI6A 1RUOA 1E3HA 2IGOA 4J19A 2BE5F 1YX5A 2IBDA 2D5VA 2E36A 1Z7UA 3OYDA 1IRFA 1B9MA 1J75A 2L2OA 2NS0A 2VBZA 4BUPA 4MLOA 2MC3A 2LF8A 3EUHA 4C3JJ 1TC3C 2TRTA 3RQIA 1TTYA 3ML6A 5LRRA 5IP7J 2DTZA 2VQHA 3D5RC 1WRJA 3QPLA 3T5XA 4AIHA 5FJ8J 1MJ9A 9ANTA 3EPZA 1DU0A 1U9NA 1OPCA 1TWGJ 4ZDLA 1OR7A 2VE8A 3T0YA 1R71A 1HW5A 1FTZA 2QLZA 3FM5A 3ZQQA 1D1CA 3KX2A 4CDGA 1ZTRA 3PJRA 2BGCA 1XSDA 4PDKA 4EMSA 1FT9A 3H3UA 1Q1HA 3FKJA 3C2BA 4J00A 4LGWA 3EQLF 2YUSA 3OSGA 1LFUP 2COBA 4UB6C 5EEHA 1AU7A 3DU6A 1Z6RA 4D5FA 5IYCJ 4XNFA 4LLGF 4A3GJ 4L5IA 5TGTA 2VE9A 3BZ6A 3ZGKA 3OYNA 1U5TB 4RGRA 4Y13A 3H0DA 1WSUA 1ETOA 1IV8A 1XMAA 2R5ZB 5HVQC 3I58A 5B5EC 2NVXJ 2GXBA 3DLLF 4ZH4F 2EFNA 5E3LA 2JQ7A 1TW3A 3B6CA 1QZYA 1POGA 4BJTA 4XIDA 5B1BH 2VUMJ 2ZKZA 1IDYA 4JP0A 1Y56A 4JOMA 1SFOJ 3ZN0A 2DCEA 3IRRA 1WCMJ 3K70C 3PFIA 2CQXA 3C7JA 3M1CA 4KITB 4AC0A 3CJTB 3BP8A 2IS4A 2LYCA 2W82A 2A5YB 1IN6A 4V2GA 4Y3OA 2OTLI 3OSFA 3WE3A 4U7BA 2O3FA 1H0MA 2EZLA 2E1MB 3KP5A 2EB7A 5F27A 2BHZA 3DF8A 2PMHA 1J5YA 2FOKA 5D4RA 2XAQA 5FLXZ 4W1UA 1ZR4A 4CCJA 4WXHA 2FD5A 3B02A 5C4JJ 2WV1A 2YX4A 3CCSI 2I10A 1D3YA 1V55H 4G9YA 2ECCA 2V6CA 3BJ6A 3M07A 3RDIA 3TW7A 2M8GX 3LA7A 1FLIA 2CG4A 3CCRI 1LE8A 2ZJRF 2K9LA 1KZHA 2ZXHA 2VONA 1BIAA 1ZN2A 4HLYA 3JW4A 1TWCJ 3C1DA 1TT5B 4IQ4A 4U88A 1MSEC 1GLNA 4CUGA 2O9LA 3HRTA 4Q47A 4XK4A 2BV6A 2DDBA 4ETSA 2IS1A 3HZJA 1G2HA 1QGPA 1NK3P 5FB2A 1S72I 2IEKA 3TQNA 4GFBA 1HW1A 2OA4A 2HYGD 3PNVA 3R0AA 3JRGA 2WY8Q 1ERDA 2YU9J 5BNGA 4JBAA 3SZPA 3E0JB 5FKMA 4AVPA 4PCQA 4FE4A 1LPQA 1APLC 2VODA 1UG2A 4D5CA 1RRJA 1W0UA 4ASNA 5FO5A 4DW6A 2AO9A 1OCTC 3TGNA 1IN8A 3AKZA 3BZKA 3OIQA 2DMNA 3PNYA 3OYEA 2DJNA 5DYMA 4BHPA 2OZUA 5LHGA 3LFUA 1S7OA 1JGSA 1PJRA 5JFRA 1T98A 3V8KA 3WTYC 4IKFA 1WPKA 2XUBA 4BJ6C 3M8FA 4WK8F 5DDGA 1JUPA 1V5GA 1ZLJA 1I3QJ 3H5AA 5FLXK 5DCMB 2UZKA 3CD6I 2L7FP 2LDUA 4II3A 5J8FA 3J81K 2Y30A 3ABUA 2JUCA 2ID6A 1VQ8I 2JWTA 3IKTA 1YE9A 1WJAA 4NQWA 2LY2A 1HF0A 1YRNA 3EETA 2MSYA 2DA1A 2FX0A 2F4MB 2MG4A 1SD6A 4OIPF 2DOAA 2GOMA 5EEAA 2VT3A 3HEFA 3TL4X 5D5WB 1XSVA 3MQ0A 1IN4A 1QHHD 2X6XA 1SFUA 2MC4A 4HV6A 4IHSA 1PVEA 2B0LA 2H1KA 2P6TA 4YIFA 3BOQA 1XMXA 1NH3A 4M9XA 4P9UA 1WFXA 3K10A 2MFZA 2MBFA 1ZHFA 4CYDA 2A5WA 1MMNA 3VYRB 1OCPA 2ZSIB 3ABTA 3ZQHA 1JJ6C 3MN2A 3AL0B 3LAPA 3BG3A 4KNYA 3RJPA 5GAEJ 2IW5A 4OIQF 3BLYA 3J7YJ 2DPUA 2LC2A 4EJTA 3V7RA 1MDMB 1R1UA 4C2MJ 2OZ6A 1P7JA 5FKNA 4LIVA 1YS7A 3A4CA 4BL0B 4BQOA 3W3CA 1JKQC 2EBIA 5FRNA 1JKRC 3J80Z 1TNSA 3FZVA 3RKWA 4HF2A 1BJAA 2QBYA 5CVRA 5K5QA 4AM3A 3D0SA 1UB9A 1MSFC 2KHMA 5E3NA 2DN0A 3BPXA 5AIQA 4F3QA 2CYYA 2FMYA 3GTKJ 4LD5A 1V54H 4Y7NJ 4CH7A 2W1OA 2ZO4A 3PQJA 3DXJF 4PZJA 1LDDA 2Y69H 4HF0A 3KFWX 1ZGJA 1Y1WJ 2ACJA 2HTJA 5BPIA 3KP4A 4L0ZB 1YYVA 3K4CA 1AA7A 4F92B 2VQCA 3HSEA 2AHQA 4FTHA 2EILH 1XX5A 3RKXA 1JXSA 2L7ZA 5K5OA 1YTYA 3R61A 2CV1A 3GF2A 3ZQFA 4XKVA 4BEHB 4XRSA 1RZ4A 1FOWA 2EFWA 2Z99A 2J5OA 5L3GA 4IX7A 2CSOA 1B1BA 2G0EA 1LEBA 5JLXA 4IEJA 4BBRJ 3HYIA 5E8GA 3ASNH 2O61A 2QQAA 3ZMSA 3HJEA 1Q1VA 3DV8A 2EIJH 2AS5F 2W24A 2KT0A 1I1SA 3LSJA 2VL8A 1LVAA 4W97A 3CQZJ 4HZFA 2M4KA 1RESA 3GTOJ 2WAQA 4BQAA 2O03A 3L09A 4EGZA 3BG7A 2Z2SB 3DFGA 1JGGA 4ESJA 4DGWB 3H1CA 4J01A 4EGYA 3JCUC 1X3UA 1BR4A 1HCRA 2YX7A 2QSHX 1HA8A 3ZRGA 4FHTA 3J80K 3H36A 3FISA 2LVSA 3CLQA 5D8LB 1DPUA 4G7HF 3V7CA 1N77A 3KETA 3OOPA 5HS7A 3T8TA 3A01A 3GZ6A 3VPRA 1LDJA 3IHUA 3KP3A 5CVJA 1OFCX 5K7HA 2RVCA 2YR2A 4DYRA 4FX0A 5EZGA 4F52A 2X4HA 4KN4X 1MBHA 3CCYA 4MIMA 3HHHA 4E7JA 4ENJA 2XGDA 1IXRC 3G6EI 3ECOA 1P4XA 3OR1C 2JVGA 2Y0SN 3I59A 3E5UA 3A2KA 3NQOA 5E1XA 2HDWA 1ZG3A 2RKHA 4KYWA 1CF7A 4P5OA 5J8CA 1JHHA 1ONVA 3A03A 3HOUJ 2FMLA 3GUDA 1OMIA 1DPRA 2CMPA 3FXOA 1XGSA 3S93A 4DZPA 2KIMA 2IA1A 1QZEA 1QZZA 2ZFWA 5GAHJ 4A3MJ 1WJ5A 4A12A 4O3MA 2ID3A 5B66C 2MYSA 4GO1A 1BI0A 1E2XA 1R4MB 1MBEA 3OR2C 4PJMA 1ULYA 2K5CA 4CA0A 4Y52J 4EQQA 3ZQCA 2JRMA 2HVQA 4XQFA 4Z6YA 1IC8A 3CF2A 5KVRA 2O7OA 2JPCA 2ZXIA 4OAYA 3CDHA 4C30A 3ZR8X 2VC0A 4RB2C 3M3YJ 5E17F 1ODDA 4L5EA 2NNNA 3BC8A 4M3EA 1F4KA 5LBQA 2R7SA 4IVNA 4XRSG 1W5TA 1A6QA 1EV7A 4PGGA 2X0LA 2X1DA 4Y17A 3F22A 1ZK8A 2QVOA 3F8MA 4QTRA 4I99C 4BY1J 3G73A 1MBKA 5JR3A 3TDZC 2CUJA 2L9SA 1ZG1A 2FE3A 2M5WA 2LRDA 4U0WA 2L7MP 1IRXA 3FIWA 4XKCA 1YI2I 2K7LA 4E7HA 4LG3A 2F4IA 1S29A 2A6HF 2EWNA 2H8WA 2FUG2 4UV9A 5ILVA 3H3VK 1YS6A 2HR3A 2FSWA 2R3SA 2X51A 2FQ3A 2XGEA 2BVMA 4L18B 3JRFA 2QENA 5F08A 2XAJA 2DA3A 2A61A 3M8EA 4JX6A 4LITA 3F8CA 2O8XA 4BYYA 1YQAA 2P7VB 3RI4A 5D8KB 4FETA 1IXCA 1EA3A 2GAUA 2OCEA 5E3OA 2JUGA 4Q48A 2K02A 4BJ5C 1OYWA 1KU7A 2QKLB 4IZZA 1VQ9I 5IYBJ 5C4XJ 1ZRCA 2NVUB 3HRUA 3V8LA 2HNHA 3OL4A 3L2QA 2Z5UA 5L3EA 1SC7A 2FJ1A 3BQYA 1U5TA 1YG2A 1SAXA 2MLGA 3S1MJ 1K83J 1KU3A 2E1MC 3WG9A 1FSHA 2Y9YA 1R23A 1I5ZA 3S3MA 1V4RA 4C9YA 4BQNA 3Q0VA 1FYMA 1W5SA 2DOFA 4G6QA 3H9GA 2DI3A 2Q0OA 1SVLA 1ZKGA 3W6KB 3AG4H 5CKTA 1MMGA 3L2CA 1Y0NA 4OAZA 2VT2A 3HOSA 2E35A 3LA3A 4JX4A 4YIRX 4KDPA 2QWWA 2GA1A 3F6OA 4XRMA 1FEXA 3F6VA 1NHAA 4WXCA 3QODA 1Z9CA 4KA4A 2L01A 3S3NA 1VQPI 1FTTA 4DYCA 2K9NA 3K69A 1BR1A 1V5EA 3E5QA 1OKRA 1FOYA 4YIIA 3S3OA 1RR7A 2DXIA 1JI8A 1B8IB 1D8JA 1PUFA 1G3TA 1D0ZA 1BI3A 2L02A 4XLFA 2GLOA 5F1JA 4G12A 2LG4A 4O6JA 2QQBA 4CYCB 4AD9A 4HLXA 5DTDA 3E97A 3FBIB 1MD0A 3X2QH 1FP1D 2EV5A 3DTIA 2RV8A 2P5KA 5ICEA 2R7DA 4ESBA 4HG2A 2RNJA 5FKLA 2XPVA 4N9IA 4RLQA 5J1RA 5EGOA 3I56I 2NVTJ 5CVVA 1B4AA 5HS8A 1MMDA 2V26A 4LJZF 4B44A 3WTWC 2BY3A 1P7IA 2H1LA 1Z6TA 3F8BA 1E0EA 3UR3C 2HVSA 4BKXA 3FBNB 3HGGA 1EJ9A 3MEXA 2VXDA 4BAYA 1XGNA 3HSFA 3N05A 5DEQA 1T95A 4ZYDA 5J1YA 2H09A 4UUTA 4LG0A 3MKZA 1V5FA 5FD6A 3COAC 3PO2J 2CQ7A 2W85A 2IP2A 1H9TA 3JREA 2QA4I 1O7FA 3DPTA 1ETXA 3FMRA 4DZJA 2HGCA 1STZA 3MZYA 3OMYA 1A31A 4ZZDA 2VKEA 1ZGAA 4OIOF 3MKWB 2W4SA 5K1YA 4FE7A 3ZCOA 3PO3J 2BXZA 2M9HA 1R5ID 2XV4S 3O8HA 1GV2A 2ELKA 2HI3A 4M6VA 2YSRA 1VQOI 4X0GA 2HDCA 4BE2A 1SFXA 1USTA 1YHQI 2JZYA 3CZ6A 1KYZA 1ZG5A 1J7KA 2ZNYA 4UUSB 2MW8A 5DCMA 2OD5A 1MBFA 2ISYA 2XAHA 3L1PA 3BR3A 4I2OA 3RQ4A 3TBIA 4MEXF 4ABZA 4BHBA 4LK0F 1IZ1A 2WB1N 2KDZA 3FXRA 2DMPA 1DU6A 3I55I 4G94A 2MD0A 3CUQC 5BQTA 4E7SA 2L9NA 3LSPA 3E6BA 2XSDC 5EG0B 4XR6A 3IAS2 1F36A 4KISA 2E5NA 1BOBA 2NYXA 1Z3XA 4M6YA 3W2VA 3D1NI 1KU2A 2R7FA 2XPWA 1S6LA 1PUEE 2STTA 3WU1B 2B9SA 1I1GA 3HPHA 1FX7A 1SFEA 2KQRA 2IXSA 2H27A 3K4JA 1VQ7I 2X85A 4LOCA 2CFOA 3RPQA 1YIOA 5KAIC 5IT9Z 2LD5A 4PGHA 2VBYA 1SANA 1G8XA 2XAGA 4LIUA 2BYVE 4PSWA 3OYLA 3JR9A 1TL8A 2G9WA 3AFHA 3OIPA 1X2NA 2VB6A 3JTHA 4P55A 2MA3A 1XTAA 2K9QA 1FBSA 4ZC3A 2TCTA 1GT0C 2HKXA 4DQ2A 4RAGA 3RPUA 1OCOH 3J7AO 2CJJA 4I01A 2W7NA 1IJWC 3E5XA 3FXUA 3TOAA 1FWZA 4A3EJ 4A0XA 2E1CA 3TW6A 4KJZA 4BDYA 2QUFA 3SQNA 2PN6A 5D5VB 2EZHA 1OR7C 1D0YA 1XDUA 2XRNA 3GVAA 3JSPA 1RUNA 1J09A 3CDLA 5FGMA 2BY2A 3CMMA 3QPTA 2L9VA 3KP2A 3SJMA 3IRQA 1VQ5I 2VN2A 1Z77A 4G7OF 2UUZA 3MWMA 5L3DA 5M3MJ 4A3IJ 3B73A 2LKPA 1IG7A 2EA4A 2HOTA 3ZXSA 1Y8RB 2JA7J 1VF9A 1K4SA 3CJRB 5F6FA 4EATA 2P5VA 3VEPA 2VLAA 3CCLI 5LD2C 1IUYA 3KP6A 2A6TA 4G6TB 4OMZA 3CUOA 4IRGA 3I4NJ 1TQIA 1HW2A 3MCZA 4EJUA 1K6YA 5IT9K 2YS9A 3O2PE 2HOAA 3R0JA 3DWLE 5EZHA 5J3LA 2PJPA 4U0YA 2JA2A 2DA4A 1J0RA 1T0FA 2K27A 3GZNB 4OINF 1P4AA 1G6NA 1Y1VJ 3O3KA 1XSXA 4II2A 5F0HA 4WCGA 2P4WA 5JHFA 4IO9F 2DFIA 4CZCA 3FXJA 2UXXA 3KE2A 4LFUA 2X1EA 1EH6A 2WA0A 3H5NA 3GTPJ 2VQGA 5IPAA 2YPRA 1IAWA 4E70A 4AIDA 1F9NA 2STWA 4BGDA 1LB2A 1FJLA 3RIRA 2NOGA 1P2FA 4D1QA 2BBYA 1B6AA 3Q0WA 5E18F 1NTCA 3HKZN 4M3DA 2FNPA 3L00A 3CMYA 1GV5A 3NAUA 4UV8A 2ZC2A 4IRIA 4RMNA 2QSGX 2XB5A 4E7IA 2V1UA 3CDIA 1MBJA 3L2UA 3HOXJ 3GTMJ 3T1BA 1DP7P 3CO6C 1BR2A 4XICA 1SD7A 1FMVA 3GTGJ 4HA8A 1D0XA 4XLAA 3DBHB 3TKYA 5GPCA 2DU9A 2XSJC 3J81Z 2HPMA 1VZ0A 3KPHA 1W36C 5ICFA 1DQUA 3I4MJ 2JPBA 4JQFA 1SD4A 3K4KA 4OU0A 1FYKA 5K7ZA 4CCOA 3OYMA 1IN7A 4PFPA 2HQAA 2WAFA 2OU2A 2CGPA 1DDNA 1GVJA 2LF7A 2D1HA 1XD7A 4XM3A 5D6EA 4RB3C 4FCYA 2QKMB 2GWRA 4AYBN 2HVRA 3U21A 2KLOA 1A35A 2DA6A 2HXIA 1VQKI 5CVUA 2CWEA 3IL2A 2R7WA 5KNLA 3OYCA 2VBWA 1VFCA 3VYUB 5C3EJ 2L3DA 2F5VA 4S0HB 1W1WE 3KP7A 1HC8A 2MABA 1O7LA 1IUFA 2EIMH 4Y15A 4RGUA 1OQYA 1IO2A 2DT6A 1T6SA 3N97A 3HC7A 4BXXJ 2CQKA 3LSRA 2Z33A 2V1DA 4GCVA 4PJNA 3TDUC 3FK7A 1MH3A 1SVOA 2BVLA 3QYBA 3L7WA 4LLLA 1I3AA 3IH4A 2Y0SA 3R60A 3OYFA 1WH7A 3CESA 1BW5A 1WJCA 1QBJA 1J2XA 3CCEI 4BACA 1PP7U 1P9QC 5FD5A 3EUKL 4JX5A 3L2VA 2P5LC 1HKQA 2F48A 4I6ZA 1OISA 1ZAOA 2K3FA 2NRAC 3DP7A 5DUIA 4ZJZA 3AG1H 3RSNA 2E2JJ 3SZGA 4DYQA 4G7ZF 3GZ5A 4M6XA 3HG9A 1K6OA 2BHYA 3M1EA 2ZB9A 3DKXA 3SEQA 4EJVA 3L2WA 2R5YB 3K1NA 1H89C 3FMSA 4I09A 1MIJA 2ADUA 3HUGA 3KIOA 2H94A 4MEYF 4CGZA 2PJRB 3HL2A 1HKTA 3FX3A 4X6AJ 1S7AA 3QP5A 3PIPF 2XROA 2EFOA 5FKKA 4FISA 4XBFA 2WY7Q 2FQ4A 2ETHA 2V6EA 1XGMA 3KLOA 1YW7A 2VKVA 1GDTA 3LSHA 1JUMA 1IGNA 2QQ9A 4L5JA 2H6BA 1QRYA 2R7OA 2BY0A 1JT0A 3QOPA 3QPSA 2LP0A 2X6OA 2RREA 4A3BJ 1MMAA 3ZQIA 3NWSA 3W2AA 1R5HA 2LKSA 3HXLA 2GXAA 4YFKF 3RKYA 4K2EA 3KCCA 4EJOA 4A3JJ 2MH9A 3WTTC 3CUQB 2HQ5A 2Q2EB 1QHGA 4BS9A 5FLMJ 5HDKA 1RKWA 3FHNA 1B8IA 4G6DA 1BM9A 1SMYF 2OV7A 4CYCA 5DCFA 3O6BB 4AU7A 5DD4A 1ZREA 2JK3A 2JTVA 4CCNA 1TBXA 2ZMEB 3WTXC 1ETWA 3FXLA 2RQQA 1WH5A 4U0VA 2ZJQF 3TO9A 2DAOA 4S04A 2CV2A 2N8GA 1MGTA 4RS8A 3JSOA 3MFKA 1X1AA 2DT7B 1RPWA 4D7NA 5LFAA 3OYKA 3H0GJ 2P7CB 2GM4A 3ZQ7A 3BY6A 1Z3YA 2L4AA 4B4CA 2G7UA 2VC1A 1B59A 2R7TA 1LEAA 4XSZF 2C6YA 3LMMA 2OUMA 4A3LJ 1MNDA 2ICWG 2ESNA 3E6DA 2DLLA 2LMDA 1H9GA 1EF4A 3I0TA 4QWQA 1Z91A 5BMZA 4I7HA 4ZTFA 3BTCA 3H9JA 1BC7C 2DMTA 1BI1A 1WKMA 2TDXA 3RTRA 1GHCA 2EK5A 3VDXA 3RPUD 2HYFA 4CHUA 1HQCA 1R49A 3E6CC 5CQEA 2NVYJ 2R7QA 3NWTA 4NDLA 3OL3A 3HIFA 3S15J 2NAZA 3GBGA 1MJBA 1T08B 2XF6A 2ZXWH 4UUSA 1L3LA 5CQGA 2Q1ZB 3BR6A 1USSA 1G3WA 2X9DA 3HB9A 4HX7A 2WWYA 1R00A 3U1KA 5EYRA 2EINH 3GFJA 3OS1A 2ZXJA 2JT1A 3BG9A 3SXYA 1LFPA 2WAEA 4P1WA 2KRHA 5E3MA 1SD5A 3ZMUA 5HNFA 4I98B 4I0AA 3JAMZ 2JSCA 5IP6A 1JKOC 3ONQA 1WJDA 1ON1A 1S3JA 4HRIA 1U6GA 2FU4A 3DEWA 4ENMA 1Z21A 3ABLH 2VI6A 2DA5A 3SFZA 1VQ6I 2EV0A 3GCMA 2DA2A 2EQRA 2QZ8A 3GTQJ 2O5RA 4MTEA 3H9QA 3G71I 2PFBA 4KIFA 4D0PA 5LRSA 2O6GE 3GLLA 3DPLC 1V3FA 1G59A 4CCKA 2CUZA 3I4PA 3K4NA 2JVHA 3GTLJ 1MMSA 4A3DJ 1RKTA 2P0WA 2BW3A 1U8BA 5HNHA 6PAXA 2GA2A 5A2QZ 4BBSJ 1ZLKA 5J6XA 5J47A 2AXTC 2PMZN 1Z67A 4A6DA 2V1NA 2CQNA 1SVMA 3FXMA 2KPMA 5AONA 1HDDC 2PEXA 4F55A 2A3SA 3ZMDA 1Y8QB 1FOKA 4R1HA 2Z9OA 1QU3A 4XONA 1BN5A 5CVIA 2M3AA 2MLKA 3BTLA 2DO7A 3HGYA 3ZMTA 4PJ0C 3FF5A 2BY1A 3RYPA 3VWBA 2A6EF 4XRFA 1FOXA 1OCCH 1QPIA 2F2EA 1F43A 3WGIA 1X2MA 4GGGA 1ZELA 4BE1A 3BR0A 3BT9A 1S8NA 1LE8B 2VKDA 1X1DA 3GMEA 3TEDA 4BDZA 4KFCA 2WB1A 3JTGA 1T56A 4ZDOA 1MZBA 1R4NB 4F91B 3JAMK 1HOMA 2COMA 2F6CA 4HW0A 2Y75A 4OWRB 5JLWA 1O3QA 3MZ8A 5FKOA 1ORKA 5JVTA 4KN7X 3QQAA 5E1WA 2KL4A 3FDYA 3FK6A 4XN3A 2KP6A 3N4MA 3FXKA 3K70D 2IAIA 2E71A 1UHSA 2JA6J 2HYJA 1ON2A 2GIVA 3RYRA 3CCUI 5LGUA 3MMYB 3FHZA 4HQEA 5BS6A 4D9JA 4M9SA 4V2FA 5A2QK 4XN0A 5L3CA 1IRZA 1O57A 3AG2H 2OF7A 4ZYGA 3CC2I 4IHTA 4LMYA 4XLNF 4KMUX 1E17A 2RQPA 2M7BA 1FPQA 3SDBA 1WJEA 4WXDA 3CTAA 3IC7A 4B3AA 1BI2A 3IH2A 5KAFC 2NNYA 2BZTA 3BJAA 2XASA 3JRBA 3G4SI 3L2RA 2D2WA 3WU0A 2R5ZA 2D45A 4HSRA 3D5LA 2AQEA 3DCFA 4IPAA 4RA2A 5F64A 1WJBA 1BBYA 5AIPA 3KZYA 5J40A 1W36D 1HBXG 4KMFA 4L9VA 2K40A 1J9IA 3K2AA 1RI7A 4BH9A 2DK8A 3KYLA 4A2UA 1S7EA 4NQWB 1SMTA 1X3ZB 1TLHB 2DJIA 1XC5A 4IRHA 3OYHA 3M4OJ 3S2WA 2X1CA 4UVCA 1IF1A 3HRSA 4UB8C 2LSOA 1JTYA 2W00A 1WHUA 3AAFA 2LBFB 5J4VA 4M3GA 5D6FA 1EH7A 1YO5C 1JKPC 1UG0A 4C2TA 2RC4A 4DBQA 1TWHJ 3FMQA 2F5CA 4GDFA 2XHKA 2LOOA 3H5RA 1YJ9I 4CCMA 1DUXC 4NC8A 2M1BA 2DOEA 2VJ5A 2M30A 2R7XA 3HPGA 3KLNA 4HDUA 2WAQN 1S5LC 2HPIA 4PSXA 2K4JA 1IRGA 4NNJA 2L9RA 1LNWA 3CP8A 2IT0A 2QQ8A 1SAUA 1WWXA 1P4WA 4Z2YA 2F5DA 2O8KA 1KYWA 3H92A 5E20A 2OTJI 1MJAA 2XPUA 2QEXI 2PBIA 4RM3A 2ELHA 1R9TJ 2QBYB 3BWGA 5GPAA 4ON0A 3OS2A 2JRTA 1AWCA 1X4PA 1FMWA 2WTEA 2X6YA 1U0JA 5FFXA 1W7PB 4ANJA 3E7LA 1IW7F 5HLIA 1C0WA 4EM2A 1B9NA 4P9FA 1NK2P 5HDNA 1X1BA 1YOVB 2ESHA 3PUBA 4YEJA 5L3BA 3OOUA 2R7ZJ 4CXFA 1IXSB 2VJIA 4MNUA 2LKXA 1YX3A 1VNDA 5FRMA 4IXAA 1P92A 5ED4A 2LK2A 1LUJB 2DYRH 1BA5A 4A5MA 1XGOA 5ILUA 4XOTA 2LY9A 2M7AA 1CGPA 5GAGJ 1FIAA 2K9MA 4UY8I 4QSHA 1E3OC 3PSIA 3SDGA 1OJLA 3DU5A 3C3WA 3G1LA 2R5YA 1ETYA 3ABKH 5H20A 3VB2A 4CZZA 1YW9A 2E34A 1KU9A 4AUXA 1BJZA 3RCOA 3I9V2 1BOAA 2PJRA 4F93B 2HQRA 3B6AA 2CQQA 2E5ZA 3F9KA 2QSFX 4EJWA 4NHJA 3GXOA 4MQ9F 1N75A 4AYBA 3VSKA 3MZHA 2KZVA
chains in the Genus database with same CATH topology
2HPMA 1VZ0A 4Y4RA 1W36C 3K4CA 1AA7A 4F92B 2VQCA 1DQUA 4N4OB 4JQFA 3K4KA 4R79A 1X1CA 2CV1A 2CH0A 4XKVA 4BEHB 4CCOA 3OYMA 4PFPA 2HQAA 2WAFA 3D5SC 2CS3A 4QPQA 4XM3A 4IX7A 2QKMB 2HVRA 3DTEA 2KLOA 3U21A 5HOOA 2HU9A 4ZYAA 3BCBA 2R7WA 3LSKA 5KNLA 3HUGB 4ITVA 4U87A 3OYCA 2XF5A 2RNGA 3VYUB 3OYBA 3J7AY 4FASD 2VPLA 2F5VA 2VL8A 2MABA 3A1YA 3K4LA 4CSWA 2VQLA 3EUHC 3BG6A 2M4KA 4HPQA 1NG6A 2WAQA 2DT6A 3HC7A 1DGWY 3BG7A 2ZFUA 2Z2SB 4PJNA 4DOZA 4DGWB 4J01A 2BVLA 3QYBA 1X19A 1BR4A 1HA8A 3S8PA 3ZRGA 2Y0SA 3LSIA 2IGNA 3OYFA 4DIQA 1N77A 1S9HA 3CESA 1WJCA 4BACA 1P9QC 2WBMA 4XMYA 3EUKL 3L2VA 1X4OA 4BEHA 2Z1DA 4F52A 1TT0A 4DBRA 4E7JA 4ZJZA 3OR1C 3RSNA 2JVGA 3TMOA 3SZGA 3A2KA 2UV1A 4KT6A 2CW8A 2HDWA 3HG9A 1SFKA 2R7UA 3DKXA 3SEQA 4BU2A 3L2WA 4P5OA 1DGRM 2CMPA 4E6KG 3S93A 3HL2A 2PJRB 1LDKB 3VSLA 1WJ5A 1T0FC 2CW7A 2MYSA 2WY7Q 3K6GA 3QYFA 4HSTA 3S32A 2R7VA 3OR2C 4PJMA 2V6EA 2K5CA 2V7FA 4CA0A 1OLTA 2XF7A 3G2BA 3K4BA 3LSHA 4BQQA 2HVQA 4XQFA 2R7OA 3CF2A 4E4HA 3HKZA 1LVKA 4C30A 2ZXIA 4OAYA 3ZR8X 3I3LA 3BC8A 2RREA 1MMAA 2R7SA 4B43A 3NWSA 3W2AA 3HXLA 3UNGC 2X1DA 4AVZA 2XC7A 3M8JA 4HNTA 4Y33A 2LY1A 1TZLA 1QHGA 2Q2EB 4XLCA 4BS9A 3IP4B 3FHNA 2CUJA 4PJJA 2L9SA 2LRDA 2OV7A 4XKBA 2E60A 3PL8A 1IRXA 2VXZA 4XKCA 3V42A 4E7HA 2VJJA 4AU7A 4LG3A 2F4IA 3C2GA 3MD2A 2HZDA 2FUG2 4CCNA 4HEA2 2I8DA 1D1BA 2RQQA 2X51A 3DKYA 2K3PA 3OWTA 1WJFA 2BVMA 3H35A 3PFYA 2CV2A 1D1AA 3LSMA 2IS6A 1X1AA 2ZSHB 2DT7B 4LITA 5LFAA 3OYKA 3AL0C 3SYTA 4FETA 1EA3A 1Z3YA 2JUGA 3CP2A 4RM2A 4BJ5C 2R7TA 1PYVA 3LMMA 2OUMA 1MNDA 2QKLB 2V9KA 4IZZA 2R7RA 2HNHA 3OL4A 3L2QA 3DPUA 2VKHA 3SEZA 3VYTB 2L5QA 4ZTFA 3H9JA 2VIXA 2IS2A 2KDOA 2E1MC 3OYJA 3S3MA 4C9YA 3K4MA 3RTRA 2LREA 4BQNA 4QPOA 3PSFA 2XAUA 3BCAA 3H9GA 3VDXA 3OS0A 2BW3B 3RPUD 5CKTA 1MMGA 4IQJA 5CQEA 2R7QA 4OAZA 3HOSA 2GOXB 4PJLA 3NWTA 3OL3A 4NC7A 3OYAA 3GBGA 4E7LA 2XF6A 1N78A 2L7KA 4E7ZA 4GRIA 2Q1ZB 5CQGA 3QODA 3OS1A 3S3NA 2IGOA 1YX5A 1LFPA 2WAEA 3OYDA 4H4KC 4PK4A 4P1WA 2L2OA 2KRHA 1BR1A 2JSPA 1V5EA 5HNFA 3S3OA 4BUPA 4MLOA 3ONQA 2DXIA 4B48A 1WJDA 2VJ4A 1JI8A 4HRIA 4XL9A 1D0ZA 1Z21A 4XLFA 2LG4A 2PMZA 2VQHA 3D5RC 3FBIB 3EPZA 2O5RA 4DJAA 3DTIA 4ZDPA 3H9QA 2KZVA 4ZDLA 3DPLC 1G59A 4CCKA 4E7KA 2NOJB 2CUZA 3K4NA 2JVHA 4HG2A 3ZQQA 1D1CA 3DLAA 2P0WA 2BW3A 3KX2A 5HNHA 1Z7LA 4RLQA 3PJRA 1MMDA 2V26A 4B44A 2V1NA 1KONA 3QYEA 2KPMA 1E0EA 3UR3C 4F55A 3FKJA 2HVSA 4J00A 3FBNB 2VXDA 1QU3A 4XONA 5KCMA 2M3AA 4NUBA 3DU6A 3N05A 1T95A 4XNFA 2V4JC 2LBFA 3MKZA 1V5FA 3DEEA 5TGTA 3VWBA 2WADA 3ZGKA 3OYNA 3H0DA 3DPTA 3PNTA 3OMYA 5HVQC 1ZELA 4BE1A 3MKWB 2IGKA 2W4SA 3C2HA 2VKDA 3LSGA 3ZCOA 5FROA 1X1DA 4BDZA 4BJTA 2WB1A 1Y56A 4ZDOA 4JOMA 4F91B 2DCEA 2F6CA 4X0GA 4BE2A 2AQFA 3K70C 4ZTJA 3CZ6A 4KITB 3M1CA 4OWRB 2IS4A 2LYCA 2W82A 4B3XA 2Z16A 4Y3OA 3KEYA 2KL4A 1Y6IA 3FDYA 4XN3A 3RQ4A 2KP6A 3TBIA 4U7BA 3MKYB 3K70D 2E1MB 3DTKA 2MD0A 3MMYB 4E7SA 2L9NA 3QOEA 4D9JA 4XN0A 4XR6A 3IAS2 4CCJA 4KISA 2E5NA 2M7BA 3SDBA 1WJEA 1BOBA 1Z3XA 3W2VA 3W2WA 3L2RA 4RLFA 4HSRA 3D5LA 2AQEA 3CJQB 3HPHA 1WJBA 2K9LA 2KQRA 2IXSA 2ZXHA 2R4GA 1W36D 3K4JA 2X85A 2CFOA 4IQ4A 4PFOA 1UAAA 3KYLA 4LIUA 1G8XA 4PSWA 1GLNA 4CUGA 3OYLA 4NQWB 3AFHA 2DJIA 3OYHA 2IS1A 3OIPA 2VB6A 2X1CA 4ZC3A 2BOLA 4BXFA 2W00A 3PNVA 2LBFB 2WY8Q 3IUOA 1DP3A 1MNEA 1ERDA 2W7NA 1R6RA 1UG0A 2M4GA 4C2TA 3E0JB 4XLHA 4DBQA 1MW7A 4KJZA 4BDYA 3HOTA 2LOOA 4N4NB 3H5RA 4CCMA 1OR7C 1D0YA 4NC8A 3AKZA 4XLEA 3OIQA 2VJ5A 3OYEA 3PNYA 5HLTA 2R7XA 5CPRB 3HPGA 3LFUA 1J09A 2HPIA 1PJRA 2LH9A 4PSXA 4XKWA 3CMMA 4XORA 4NNJA 3CP8A 4IKFA 3E1SA 4BJ6C 2KMUA 3LL7A 1SAUA 1V5GA 2KRCA 3H5AA 2UUZA 4II3A 3DQVC 2X6WA 3ZXSA 4RM3A 3CJRB 1YE9A 1WJAA 2XDVA 2LY2A 4EATA 3OS2A 1X4PA 1FMWA 2M0MA 2X6YA 1U0JA 3OY9A 2VLAA 5LD2C 4ANJA 2A6TA 4G6TB 2DOAA 2GOMA 3EUAA 3TL4X 1QHHD 2X6XA 2MC4A 1K6YA 1NG7A 1X1BA 2CV0A 3VYSB 3DWLE 4CCLA 4PUSA 2JA2A 3PUBA 1LKXA 4YEJA 2VASA 3OOUA 3OYGA 1UELB 1WFXA 2IGMA 3K10A 2VJIA 2MFZA 1YX3A 2A5WA 4XOPA 1MMNA 3VYRB 4B47A 4II2A 2ZSIB 3AL0B 5JHFA 5FRMA 4CZCA 2X1EA 2WA0A 3H5NA 2VQGA 4C2UA 2ELJA 3BLYA 4BGDA 2LC2A 4XOTA 2M7AA 4D1QA 2K9MA 4LIVA 3A4CA 4BL0B 4BQOA 3W3CA 5FRNA 2UWMA 3PSIA 3DU5A 3OYIA 4BE0A 4HNUA 4RMNA 4E7IA 2OC6A 2KHMA 3L2UA 4F3QA 3RCOA 3I9V2 2PJRA 4F93B 1BR2A 4CH7A 2W1OA 5KHDA 1FMVA 2E5ZA 3F9KA 4YRVA 1D0XA 4XLAA 4AYBA 1N75A 3IAM2 3VSKA 4YELA 2XSJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IX7 A;  4X0G A; 
#chains in the Genus database with same CATH topology
 4R8H A;  1M1E B;  2RDP A;  1VQ4 I;  3L9F A;  4BXU A;  3EYI A;  1TQM A;  2OPT A;  4R79 A;  2ZME C;  4L9J A;  2CH0 A;  2W25 A;  1U2W A;  1AKH B;  2EJR A;  3D5S C;  3WTV C;  3HTS B;  4H0E A;  4QPQ A;  4ZYH A;  3ZQL A;  2AXL A;  1EH8 A;  2XKP A;  3U9G A;  3DTE A;  3I59 B;  4M3B A;  3ZQG A;  1K7A A;  2HU9 A;  2ZCW A;  3CUQ A;  3LNQ A;  3S14 J;  2Q2E A;  3LSK A;  1MDM A;  1MNM C;  1K78 B;  4ENK A;  2RNG A;  2IA0 A;  3OYB A;  3OIO A;  4LLN A;  1TQP A;  3BQZ A;  3LQQ A;  1O3R A;  3EUH C;  4HPQ A;  4IL6 C;  5D4S A;  4Q5S F;  2GIZ A;  5IYD J;  1QVU A;  3FWE A;  2XRL A;  1XG1 A;  3I53 A;  3PQK A;  1RR8 C;  2NS8 A;  3I64 A;  3HOW J;  5GTH C;  5M5W J;  3BTJ A;  3I54 A;  1A6I A;  3S8P A;  1TNT A;  2O0Y A;  3GYH X;  3LSI A;  3JRD A;  2IGN A;  3JRI A;  2E1N A;  1FBU A;  3E3V A;  2KKO A;  2B63 J;  2HOS A;  2JA5 J;  3CCM I;  4A69 C;  3GLX A;  1H8A C;  2WBM A;  5LHH A;  4YFX F;  1QNT A;  4BEH A;  4ENN A;  3Q9V A;  4IHX A;  3P5J A;  4FX4 A;  4M72 A;  2JA8 J;  1TT0 A;  1BIB A;  5H6R A;  4M71 A;  3TMO A;  3SFI A;  3HM5 A;  2IJL A;  2UV1 A;  2LR8 A;  4KT6 A;  1T2K A;  2CW8 A;  2Y48 A;  2OBP A;  2R7U A;  1T38 A;  2EV6 A;  3HOZ J;  1G3Y A;  2DOD A;  4BHC A;  3IWF A;  4MGR A;  4E6K G;  4EM0 B;  3DBL B;  1JT6 A;  2KJC A;  1YFH A;  1T0F C;  2ZNZ A;  4HST A;  2R7V A;  3QYF A;  3S32 A;  3CC7 I;  1Y39 A;  1VQL I;  2A07 F;  3WU2 C;  2V7F A;  4HV5 A;  3OV8 A;  3G2B A;  4NC6 A;  4BQQ A;  2IA2 A;  3V8J A;  4E4H A;  3ERE D;  1LVK A;  3VFZ A;  3LAJ A;  2EPF A;  2DFF A;  1A04 A;  2EIK H;  2IPQ X;  5JHU A;  4B43 A;  3K2Z A;  1RIO H;  3C18 A;  2CUE A;  4KIC A;  1WQ2 A;  2R0Q C;  1ETK A;  1XPX A;  2VBX A;  1WZ2 A;  3P9I A;  5IY5 H;  2DDA A;  4AVZ A;  4MHG A;  5LEK A;  2WC2 A;  2Q8K A;  2M2E A;  1PDN C;  4A3F J;  3DKW A;  2A69 F;  4Y33 A;  4UNO A;  1TZL A;  1YIT I;  1ACI A;  3IP4 B;  3UKG A;  3K1P A;  4PJJ A;  2W48 A;  1UHW A;  3K0L A;  2XGC A;  1O3T A;  4XKB A;  1HKS A;  4BNC A;  1FSE A;  1VQM I;  3HOY J;  3V42 A;  2VJJ A;  5EF6 A;  4RAZ A;  1OCZ H;  3C2G A;  4HEA 2;  1R1T A;  2CFX A;  1FBQ A;  2W84 A;  1ZYR F;  2P81 A;  4UVB A;  4IHW A;  1BC8 C;  2E2H J;  3OWT A;  2QCO A;  5IOY A;  3FXQ A;  3H35 A;  3NEU A;  1UZC A;  3NAR A;  1D1A A;  5F1R A;  3LSM A;  1QVT A;  3LA2 A;  2RN7 A;  3SYT A;  2QGU A;  3LST A;  3IKV A;  3ABM H;  3CP2 A;  1KA8 A;  2ECB A;  5ILS A;  1N25 A;  4UUV A;  1TWA J;  1TWF J;  5FLV A;  3O8G A;  2R7R A;  5CYV A;  3DPU A;  3NRV A;  1PUF B;  2VKH A;  3ULQ B;  1K61 A;  4A93 J;  2L5Q A;  2LFB A;  4LB5 A;  2CW0 F;  2KFD A;  1VTN C;  4F7Z A;  2VIX A;  2CO5 A;  2DFH A;  2IS2 A;  2PMU A;  3GO5 A;  4I0B A;  2VOO A;  3CC4 I;  1Y0U A;  2LRE A;  2Y9Z A;  2FF4 A;  3S16 J;  4LK1 F;  3F3X A;  4QPO A;  4RAF A;  3OS0 A;  2A05 A;  1GUU A;  1D8K A;  2LTP A;  5EGO B;  4IQJ A;  2FXA A;  3LFK A;  1UJ8 A;  4LB6 B;  2BXY A;  4DNC A;  2K86 A;  1FC3 A;  3GFM A;  4NC7 A;  2V9P A;  1JHF A;  3LOC A;  1N78 A;  3BG5 A;  2L7K A;  2MH2 A;  4GYG A;  4HX4 A;  4E7Z A;  4GRI A;  3QPH A;  3ZPL A;  2IRF G;  4FQG A;  2GQQ A;  2HOE A;  4B09 A;  3CCV I;  2EZK A;  4H4K C;  4LG0 B;  4PK4 A;  5HLG A;  2JSP A;  1KQ0 A;  2PQ8 A;  3ZP5 A;  1HST A;  4MO7 A;  4B48 A;  2VJ4 A;  3GFL A;  5EEG A;  4A0Z A;  4XL9 A;  1OYI A;  1HXD A;  1ZAR A;  3F8F A;  5E79 C;  3CMA I;  2KIU A;  2PMZ A;  3RZO J;  4IF4 A;  2MD5 A;  3P9C A;  1T39 A;  4DJA A;  4ZDP A;  3VOE A;  2KIQ A;  2KZG A;  4KT5 C;  3TP0 A;  4CIC A;  4E7K A;  2NOJ B;  1O4X A;  2DT5 A;  2EA2 A;  3DLA A;  2PLY A;  1Z7L A;  2KJB A;  5DS9 A;  2KIS A;  2DQR A;  1KON A;  3RKQ A;  3SZT A;  3QYE A;  4EV0 A;  3BRO A;  1TW2 A;  2FBI A;  1VQN I;  3S1Q J;  5C44 J;  4QLC U;  1A5J A;  5LEJ A;  1CQT A;  4Q4Z F;  1YJW I;  5KCM A;  4NUB A;  3CLO A;  3J7Z I;  3FM3 A;  2FOW A;  2IVM A;  3W6J B;  3DEU A;  3CF5 F;  2V4J C;  2LBF A;  4HNV A;  2LLK A;  4RDU A;  3DEE A;  3K9T A;  2F4O B;  1B72 B;  2WAD A;  3F23 A;  2BEO A;  2EH3 A;  2PG4 A;  1X3W B;  2E7X A;  3PNT A;  3KZZ A;  3BZC A;  5EJC A;  2DMU A;  2IGK A;  4MFD A;  5H6Q A;  3TOB A;  3C2H A;  3HBL A;  3LSG A;  5KK1 A;  2DFE A;  3LQR A;  5FRO A;  2VOP A;  4NB5 A;  4G8X A;  4CO8 A;  2YU3 A;  2NVQ J;  3F21 A;  3GEZ A;  5HOD A;  2AQF A;  2E19 A;  2X48 A;  4A6E A;  4D7M A;  1YW8 A;  4ZTJ A;  1BW6 A;  1H88 C;  4B1R A;  4A0Y A;  1R36 A;  4AIJ A;  4EM1 A;  3S17 J;  4B3X A;  2Z16 A;  2LNB A;  3KEY A;  1Y6I A;  4UVA A;  5EDN A;  2HKO A;  3MKY B;  1YJN I;  3G1O A;  4I76 A;  4GXO A;  3DTK A;  3CO7 C;  3JRC A;  3CCQ I;  1BL0 A;  1W7P A;  3QOE A;  3HTU A;  1UHM A;  1ETV A;  4MFE A;  1I50 J;  5GAD J;  1GVD A;  4RBO A;  3HRM A;  2JN6 A;  4X1E A;  3ZMV A;  1ZH5 A;  5D5U B;  1SEU A;  3W2W A;  1K4T A;  4RLF A;  2GXG A;  2HEO A;  5J4Y A;  1FNN A;  2V79 A;  3CJQ B;  2B7E A;  1XDS A;  2NXN B;  3U2R A;  3BJO A;  1Z0X A;  4IHY A;  2R4G A;  2CRG A;  3R6S A;  1XCB A;  3BR2 A;  4OOI A;  2F5F A;  4N0B A;  3VOD A;  4PFO A;  1UAA A;  2RGV A;  2XVC A;  1W4M A;  1QO0 D;  1WI9 A;  2ISZ A;  1L0O C;  3A0B C;  2E1O A;  3KYC B;  2KIF A;  3LWF A;  1XN7 A;  2EZI A;  5M5X J;  2P8T A;  3KEQ A;  4WX9 A;  3SHF A;  3BPV A;  3HOV J;  2DK5 A;  4AWX B;  2BOL A;  1P6R A;  4BXF A;  1LJ9 A;  3PM1 A;  4AIK A;  4BY7 J;  4ZYE A;  4KIG A;  1X1P A;  4HOB A;  3IUO A;  1DP3 A;  4QIW N;  1MNE A;  1U9O A;  2ME6 A;  1R6R A;  1R5G A;  2M4G A;  5LGT A;  4XLH A;  3S2H J;  1XMK A;  1MW7 A;  1R58 A;  2P6S A;  4P96 A;  3HOT A;  3GX4 X;  4N4N B;  1KQ9 A;  2K9S A;  4MQV A;  5EG0 A;  3BTI A;  5LHI A;  1JE8 A;  1D5V A;  4XLE A;  3GWZ A;  5HLT A;  5LGN A;  4V19 K;  1OYY A;  3WOD F;  5CPR B;  1W0T A;  5DV5 A;  2FBK A;  4HYE A;  3KZI C;  5LLQ A;  2LH9 A;  4XKW A;  2XKO A;  2Y0M A;  4XOR A;  4EVI A;  5BOX A;  2EFQ A;  3E1S A;  4HBL A;  1AKH A;  2M0C A;  2KMU A;  1D5Y A;  3LL7 A;  1ETQ A;  2XB0 X;  3A02 A;  2KRC A;  1R1V A;  3HDD A;  3WHB A;  1UCR A;  1VI0 A;  3DQV C;  3CME I;  2OCC H;  2X6W A;  4OIR F;  2DQL A;  1A36 A;  2E7W A;  3REO A;  3A0H C;  1ZGW A;  3ERM A;  2XDV A;  3F72 A;  1K78 A;  2M0M A;  3QU6 A;  3QRF F;  2DMQ A;  4M3F A;  4KUM A;  5DM7 F;  3OY9 A;  2PX9 A;  1JJ8 C;  3MAJ A;  1R7J A;  1RNL A;  3EUA A;  1F1Z A;  1KGS A;  3ZOB A;  3Q5F A;  1NG7 A;  4WWC A;  3HHG A;  2CV0 A;  1AHD P;  3VYS B;  2Z3Y A;  4L9T A;  4CCL A;  1ZRF A;  3ZMZ A;  1G3S A;  3MVP A;  4PUS A;  5TJJ A;  1XB4 A;  1LKX A;  1FYL A;  3S1N J;  2VAS A;  2MGQ A;  5GP9 A;  3OYG A;  1UEL B;  2IGM A;  1ZRD A;  4XOP A;  5HS9 A;  3G3Z A;  4B47 A;  4JYK A;  1XS9 A;  2WV0 A;  3M9A A;  3ELK A;  1KQ8 A;  1MBG A;  2RAE A;  2V1X A;  1J59 A;  3WGG A;  3WG7 H;  2L54 A;  5JVG F;  4C2U A;  2ELJ A;  3FKI J;  1FIP A;  4HAM A;  3EDP A;  1Z05 A;  2FNA A;  2UWM A;  3TP3 A;  5CJ9 A;  3IV5 A;  5M3F J;  1RC9 A;  3OYI A;  4BE0 A;  2QM3 A;  4HQM A;  2V9V A;  1QPM A;  2K85 A;  4HNU A;  3JRH A;  2OC6 A;  3S2D J;  2GZW A;  2UXN A;  3ZN1 A;  4U7D A;  5ICC A;  1U5T C;  5KHD A;  3P9K A;  1JTX A;  4YRV A;  4M74 A;  3BDD A;  3BR5 A;  3IAM 2;  2QF7 A;  1IN5 A;  3G1M A;  3K7A J;  4YEL A;  4Y4R A;  5IP9 J;  5E1Z B;  1WI3 A;  4N4O B;  1EKE A;  1X1C A;  2K4B A;  1IV6 A;  2HZT A;  4RGX A;  5F04 A;  2CS3 A;  1LQ1 A;  3Q3S A;  2DBB A;  3WHC A;  2FBH A;  5F0F A;  5HOO A;  2FEZ A;  1T8I A;  4ZYA A;  3BCB A;  3Q9S A;  5FFZ A;  1YRN B;  1ZQ3 P;  1U78 A;  3I5U A;  4WF2 A;  3HUG B;  4ITV A;  4U87 A;  2XF5 A;  2Y31 A;  1MH4 A;  4TV7 A;  3J7A Y;  3M7G A;  4FAS D;  4GYI A;  5M5Y J;  2VPL A;  1O3S A;  3A1Y A;  1UFM A;  3K4L A;  4CSW A;  2VQL A;  4UXN A;  2CUF A;  3BG6 A;  3IH3 A;  5HDG A;  1NG6 A;  1X58 A;  1ENH A;  2D1V A;  4JK1 X;  5K5R A;  1HSJ A;  4C3H J;  4RB1 A;  1DGW Y;  3K1M A;  1XCV A;  2ZFU A;  4DOZ A;  4L0Y B;  1FP2 A;  1X19 A;  1REP C;  5DD8 A;  2F5E A;  2HDD A;  4O5V A;  2QYO A;  1YIJ I;  2JJ7 A;  1UMQ A;  1ZR2 A;  4DIQ A;  2VPR A;  3ISP A;  1S9H A;  5B1A H;  4EEF G;  4HF1 A;  3WTZ A;  4XMY A;  5J1U A;  1AOY A;  1X4O A;  3TO7 A;  5IT3 A;  4RGS A;  2XIG A;  2Z1D A;  4FT8 A;  4DBR A;  3JRA A;  5CLS A;  1U3E M;  1WGX A;  1K79 A;  5HLH A;  1I27 A;  1I6H J;  4XSX F;  1SFK A;  4S05 A;  4BU2 A;  3WTS C;  2L0K A;  3GW2 A;  1DGR M;  1OCR H;  4M9Z A;  5D5X B;  1LDK B;  3PUF A;  2M8E A;  3VSL A;  4OMY A;  1MKM A;  1R22 A;  2ME0 A;  4L9N A;  2W57 A;  5B3S H;  2CW7 A;  3H3Z A;  3K6G A;  4IHV A;  4M73 A;  3RZD J;  4YG2 F;  2KRF A;  2DW4 A;  3WTU C;  5L3F A;  1OLT A;  2FRH A;  2XF7 A;  2ZBK A;  3K4B A;  3GTJ J;  3KYD B;  3ECH A;  4XLP F;  4KIB A;  2DYS H;  4ZZL A;  3GFI A;  3HKZ A;  4UHT A;  5BPD A;  4RB0 A;  3I3L A;  2G7H A;  1G4D A;  3AG3 H;  5IOZ A;  2DA7 A;  1PP8 F;  3TO6 A;  1E3P A;  3IWZ A;  3ROU A;  4NBQ A;  1HDP A;  3UNG C;  2XC7 A;  3CCJ I;  3M8J A;  4HNT A;  2LY1 A;  4XLC A;  2DPD A;  2R92 J;  4HDV A;  3E6M A;  4N9H A;  4YFN F;  1QQI A;  1WVR A;  3ASO H;  2OQG A;  3S1R J;  2EFP A;  2M34 A;  2PI0 A;  2E60 A;  3CJN A;  3PL8 A;  5F0C A;  3W6V A;  2M87 A;  2VXZ A;  2CU7 A;  2OQR A;  2R93 J;  3MD2 A;  2HZD A;  4A5N A;  3WGH A;  2OAZ A;  2I8D A;  5TIS C;  1QA6 A;  1D1B A;  5ERI A;  3ESW B;  3BR1 A;  1U8R A;  1W7P D;  3DKY A;  2OJE D;  1TP4 A;  2K3P A;  5H2F C;  1IDZ A;  1WJF A;  3MKL A;  2I5U A;  3PFY A;  3Q0U A;  1GXP A;  3F0C A;  3DBR B;  2IS6 A;  3I71 A;  3PIO F;  2XGX A;  2ZSH B;  2ZJ2 A;  2HWV A;  4HX8 A;  5GTI C;  2NS7 A;  3AL0 C;  3A01 B;  2XAF A;  4RM2 A;  1PYV A;  2HXO A;  5TRD A;  2Y2Z A;  3QU3 A;  4A3C J;  1LFB A;  2H8R A;  3HSR A;  4A3K J;  3QWL A;  1W5C C;  2V9K A;  1Z1D A;  3V4G A;  4I02 A;  1ITY A;  2GBY A;  3SEZ A;  3VYT B;  4B8X A;  1FZP B;  2FA5 A;  2L4M A;  4C3I J;  3P7N A;  1B72 A;  1CF7 B;  1GXQ A;  3QP6 A;  2HTS A;  3U1D A;  1T33 A;  5DM6 F;  2KDO A;  1FY7 A;  2H6C A;  2M45 A;  3R4K A;  1RET A;  3QAH A;  3OYJ A;  3K4M A;  1I39 A;  4MTD A;  1I6X A;  3PSF A;  3WE2 A;  3V7S A;  2XAU A;  3BCA A;  4IOC F;  2BW3 B;  2DTR A;  3F8N A;  2ZJP F;  2A68 F;  5DUK A;  3T8R A;  4ESF A;  4IJA A;  1F5T A;  2ZME A;  2E2I J;  2GOX B;  4PJL A;  2HQN A;  2HS5 A;  1JUS A;  4IOA F;  5ICG A;  4RAY A;  1HLV A;  3OYA A;  4E7L A;  2HFH A;  3KEO A;  2JMW A;  5K7F A;  1YLF A;  2J5P A;  5E8I A;  3EYY A;  5JI6 A;  1RUO A;  1E3H A;  2IGO A;  4J19 A;  2BE5 F;  1YX5 A;  2IBD A;  2D5V A;  2E36 A;  1Z7U A;  3OYD A;  1IRF A;  1B9M A;  1J75 A;  2L2O A;  2NS0 A;  2VBZ A;  4BUP A;  4MLO A;  2MC3 A;  2LF8 A;  3EUH A;  4C3J J;  1TC3 C;  2TRT A;  3RQI A;  1TTY A;  3ML6 A;  5LRR A;  5IP7 J;  2DTZ A;  2VQH A;  3D5R C;  1WRJ A;  3QPL A;  3T5X A;  4AIH A;  5FJ8 J;  1MJ9 A;  9ANT A;  3EPZ A;  1DU0 A;  1U9N A;  1OPC A;  1TWG J;  4ZDL A;  1OR7 A;  2VE8 A;  3T0Y A;  1R71 A;  1HW5 A;  1FTZ A;  2QLZ A;  3FM5 A;  3ZQQ A;  1D1C A;  3KX2 A;  4CDG A;  1ZTR A;  3PJR A;  2BGC A;  1XSD A;  4PDK A;  4EMS A;  1FT9 A;  3H3U A;  1Q1H A;  3FKJ A;  3C2B A;  4J00 A;  4LGW A;  3EQL F;  2YUS A;  3OSG A;  1LFU P;  2COB A;  4UB6 C;  5EEH A;  1AU7 A;  3DU6 A;  1Z6R A;  4D5F A;  5IYC J;  4XNF A;  4LLG F;  4A3G J;  4L5I A;  5TGT A;  2VE9 A;  3BZ6 A;  3ZGK A;  3OYN A;  1U5T B;  4RGR A;  4Y13 A;  3H0D A;  1WSU A;  1ETO A;  1IV8 A;  1XMA A;  2R5Z B;  5HVQ C;  3I58 A;  5B5E C;  2NVX J;  2GXB A;  3DLL F;  4ZH4 F;  2EFN A;  5E3L A;  2JQ7 A;  1TW3 A;  3B6C A;  1QZY A;  1POG A;  4BJT A;  4XID A;  5B1B H;  2VUM J;  2ZKZ A;  1IDY A;  4JP0 A;  1Y56 A;  4JOM A;  1SFO J;  3ZN0 A;  2DCE A;  3IRR A;  1WCM J;  3K70 C;  3PFI A;  2CQX A;  3C7J A;  3M1C A;  4KIT B;  4AC0 A;  3CJT B;  3BP8 A;  2IS4 A;  2LYC A;  2W82 A;  2A5Y B;  1IN6 A;  4V2G A;  4Y3O A;  2OTL I;  3OSF A;  3WE3 A;  4U7B A;  2O3F A;  1H0M A;  2EZL A;  2E1M B;  3KP5 A;  2EB7 A;  5F27 A;  2BHZ A;  3DF8 A;  2PMH A;  1J5Y A;  2FOK A;  5D4R A;  2XAQ A;  5FLX Z;  4W1U A;  1ZR4 A;  4CCJ A;  4WXH A;  2FD5 A;  3B02 A;  5C4J J;  2WV1 A;  2YX4 A;  3CCS I;  2I10 A;  1D3Y A;  1V55 H;  4G9Y A;  2ECC A;  2V6C A;  3BJ6 A;  3M07 A;  3RDI A;  3TW7 A;  2M8G X;  3LA7 A;  1FLI A;  2CG4 A;  3CCR I;  1LE8 A;  2ZJR F;  2K9L A;  1KZH A;  2ZXH A;  2VON A;  1BIA A;  1ZN2 A;  4HLY A;  3JW4 A;  1TWC J;  3C1D A;  1TT5 B;  4IQ4 A;  4U88 A;  1MSE C;  1GLN A;  4CUG A;  2O9L A;  3HRT A;  4Q47 A;  4XK4 A;  2BV6 A;  2DDB A;  4ETS A;  2IS1 A;  3HZJ A;  1G2H A;  1QGP A;  1NK3 P;  5FB2 A;  1S72 I;  2IEK A;  3TQN A;  4GFB A;  1HW1 A;  2OA4 A;  2HYG D;  3PNV A;  3R0A A;  3JRG A;  2WY8 Q;  1ERD A;  2YU9 J;  5BNG A;  4JBA A;  3SZP A;  3E0J B;  5FKM A;  4AVP A;  4PCQ A;  4FE4 A;  1LPQ A;  1APL C;  2VOD A;  1UG2 A;  4D5C A;  1RRJ A;  1W0U A;  4ASN A;  5FO5 A;  4DW6 A;  2AO9 A;  1OCT C;  3TGN A;  1IN8 A;  3AKZ A;  3BZK A;  3OIQ A;  2DMN A;  3PNY A;  3OYE A;  2DJN A;  5DYM A;  4BHP A;  2OZU A;  5LHG A;  3LFU A;  1S7O A;  1JGS A;  1PJR A;  5JFR A;  1T98 A;  3V8K A;  3WTY C;  4IKF A;  1WPK A;  2XUB A;  4BJ6 C;  3M8F A;  4WK8 F;  5DDG A;  1JUP A;  1V5G A;  1ZLJ A;  1I3Q J;  3H5A A;  5FLX K;  5DCM B;  2UZK A;  3CD6 I;  2L7F P;  2LDU A;  4II3 A;  5J8F A;  3J81 K;  2Y30 A;  3ABU A;  2JUC A;  2ID6 A;  1VQ8 I;  2JWT A;  3IKT A;  1YE9 A;  1WJA A;  4NQW A;  2LY2 A;  1HF0 A;  1YRN A;  3EET A;  2MSY A;  2DA1 A;  2FX0 A;  2F4M B;  2MG4 A;  1SD6 A;  4OIP F;  2DOA A;  2GOM A;  5EEA A;  2VT3 A;  3HEF A;  3TL4 X;  5D5W B;  1XSV A;  3MQ0 A;  1IN4 A;  1QHH D;  2X6X A;  1SFU A;  2MC4 A;  4HV6 A;  4IHS A;  1PVE A;  2B0L A;  2H1K A;  2P6T A;  4YIF A;  3BOQ A;  1XMX A;  1NH3 A;  4M9X A;  4P9U A;  1WFX A;  3K10 A;  2MFZ A;  2MBF A;  1ZHF A;  4CYD A;  2A5W A;  1MMN A;  3VYR B;  1OCP A;  2ZSI B;  3ABT A;  3ZQH A;  1JJ6 C;  3MN2 A;  3AL0 B;  3LAP A;  3BG3 A;  4KNY A;  3RJP A;  5GAE J;  2IW5 A;  4OIQ F;  3BLY A;  3J7Y J;  2DPU A;  2LC2 A;  4EJT A;  3V7R A;  1MDM B;  1R1U A;  4C2M J;  2OZ6 A;  1P7J A;  5FKN A;  4LIV A;  1YS7 A;  3A4C A;  4BL0 B;  4BQO A;  3W3C A;  1JKQ C;  2EBI A;  5FRN A;  1JKR C;  3J80 Z;  1TNS A;  3FZV A;  3RKW A;  4HF2 A;  1BJA A;  2QBY A;  5CVR A;  5K5Q A;  4AM3 A;  3D0S A;  1UB9 A;  1MSF C;  2KHM A;  5E3N A;  2DN0 A;  3BPX A;  5AIQ A;  4F3Q A;  2CYY A;  2FMY A;  3GTK J;  4LD5 A;  1V54 H;  4Y7N J;  4CH7 A;  2W1O A;  2ZO4 A;  3PQJ A;  3DXJ F;  4PZJ A;  1LDD A;  2Y69 H;  4HF0 A;  3KFW X;  1ZGJ A;  1Y1W J;  2ACJ A;  2HTJ A;  5BPI A;  3KP4 A;  4L0Z B;  1YYV A;  3K4C A;  1AA7 A;  4F92 B;  2VQC A;  3HSE A;  2AHQ A;  4FTH A;  2EIL H;  1XX5 A;  3RKX A;  1JXS A;  2L7Z A;  5K5O A;  1YTY A;  3R61 A;  2CV1 A;  3GF2 A;  3ZQF A;  4XKV A;  4BEH B;  4XRS A;  1RZ4 A;  1FOW A;  2EFW A;  2Z99 A;  2J5O A;  5L3G A;  4IX7 A;  2CSO A;  1B1B A;  2G0E A;  1LEB A;  5JLX A;  4IEJ A;  4BBR J;  3HYI A;  5E8G A;  3ASN H;  2O61 A;  2QQA A;  3ZMS A;  3HJE A;  1Q1V A;  3DV8 A;  2EIJ H;  2AS5 F;  2W24 A;  2KT0 A;  1I1S A;  3LSJ A;  2VL8 A;  1LVA A;  4W97 A;  3CQZ J;  4HZF A;  2M4K A;  1RES A;  3GTO J;  2WAQ A;  4BQA A;  2O03 A;  3L09 A;  4EGZ A;  3BG7 A;  2Z2S B;  3DFG A;  1JGG A;  4ESJ A;  4DGW B;  3H1C A;  4J01 A;  4EGY A;  3JCU C;  1X3U A;  1BR4 A;  1HCR A;  2YX7 A;  2QSH X;  1HA8 A;  3ZRG A;  4FHT A;  3J80 K;  3H36 A;  3FIS A;  2LVS A;  3CLQ A;  5D8L B;  1DPU A;  4G7H F;  3V7C A;  1N77 A;  3KET A;  3OOP A;  5HS7 A;  3T8T A;  3A01 A;  3GZ6 A;  3VPR A;  1LDJ A;  3IHU A;  3KP3 A;  5CVJ A;  1OFC X;  5K7H A;  2RVC A;  2YR2 A;  4DYR A;  4FX0 A;  5EZG A;  4F52 A;  2X4H A;  4KN4 X;  1MBH A;  3CCY A;  4MIM A;  3HHH A;  4E7J A;  4ENJ A;  2XGD A;  1IXR C;  3G6E I;  3ECO A;  1P4X A;  3OR1 C;  2JVG A;  2Y0S N;  3I59 A;  3E5U A;  3A2K A;  3NQO A;  5E1X A;  2HDW A;  1ZG3 A;  2RKH A;  4KYW A;  1CF7 A;  4P5O A;  5J8C A;  1JHH A;  1ONV A;  3A03 A;  3HOU J;  2FML A;  3GUD A;  1OMI A;  1DPR A;  2CMP A;  3FXO A;  1XGS A;  3S93 A;  4DZP A;  2KIM A;  2IA1 A;  1QZE A;  1QZZ A;  2ZFW A;  5GAH J;  4A3M J;  1WJ5 A;  4A12 A;  4O3M A;  2ID3 A;  5B66 C;  2MYS A;  4GO1 A;  1BI0 A;  1E2X A;  1R4M B;  1MBE A;  3OR2 C;  4PJM A;  1ULY A;  2K5C A;  4CA0 A;  4Y52 J;  4EQQ A;  3ZQC A;  2JRM A;  2HVQ A;  4XQF A;  4Z6Y A;  1IC8 A;  3CF2 A;  5KVR A;  2O7O A;  2JPC A;  2ZXI A;  4OAY A;  3CDH A;  4C30 A;  3ZR8 X;  2VC0 A;  4RB2 C;  3M3Y J;  5E17 F;  1ODD A;  4L5E A;  2NNN A;  3BC8 A;  4M3E A;  1F4K A;  5LBQ A;  2R7S A;  4IVN A;  4XRS G;  1W5T A;  1A6Q A;  1EV7 A;  4PGG A;  2X0L A;  2X1D A;  4Y17 A;  3F22 A;  1ZK8 A;  2QVO A;  3F8M A;  4QTR A;  4I99 C;  4BY1 J;  3G73 A;  1MBK A;  5JR3 A;  3TDZ C;  2CUJ A;  2L9S A;  1ZG1 A;  2FE3 A;  2M5W A;  2LRD A;  4U0W A;  2L7M P;  1IRX A;  3FIW A;  4XKC A;  1YI2 I;  2K7L A;  4E7H A;  4LG3 A;  2F4I A;  1S29 A;  2A6H F;  2EWN A;  2H8W A;  2FUG 2;  4UV9 A;  5ILV A;  3H3V K;  1YS6 A;  2HR3 A;  2FSW A;  2R3S A;  2X51 A;  2FQ3 A;  2XGE A;  2BVM A;  4L18 B;  3JRF A;  2QEN A;  5F08 A;  2XAJ A;  2DA3 A;  2A61 A;  3M8E A;  4JX6 A;  4LIT A;  3F8C A;  2O8X A;  4BYY A;  1YQA A;  2P7V B;  3RI4 A;  5D8K B;  4FET A;  1IXC A;  1EA3 A;  2GAU A;  2OCE A;  5E3O A;  2JUG A;  4Q48 A;  2K02 A;  4BJ5 C;  1OYW A;  1KU7 A;  2QKL B;  4IZZ A;  1VQ9 I;  5IYB J;  5C4X J;  1ZRC A;  2NVU B;  3HRU A;  3V8L A;  2HNH A;  3OL4 A;  3L2Q A;  2Z5U A;  5L3E A;  1SC7 A;  2FJ1 A;  3BQY A;  1U5T A;  1YG2 A;  1SAX A;  2MLG A;  3S1M J;  1K83 J;  1KU3 A;  2E1M C;  3WG9 A;  1FSH A;  2Y9Y A;  1R23 A;  1I5Z A;  3S3M A;  1V4R A;  4C9Y A;  4BQN A;  3Q0V A;  1FYM A;  1W5S A;  2DOF A;  4G6Q A;  3H9G A;  2DI3 A;  2Q0O A;  1SVL A;  1ZKG A;  3W6K B;  3AG4 H;  5CKT A;  1MMG A;  3L2C A;  1Y0N A;  4OAZ A;  2VT2 A;  3HOS A;  2E35 A;  3LA3 A;  4JX4 A;  4YIR X;  4KDP A;  2QWW A;  2GA1 A;  3F6O A;  4XRM A;  1FEX A;  3F6V A;  1NHA A;  4WXC A;  3QOD A;  1Z9C A;  4KA4 A;  2L01 A;  3S3N A;  1VQP I;  1FTT A;  4DYC A;  2K9N A;  3K69 A;  1BR1 A;  1V5E A;  3E5Q A;  1OKR A;  1FOY A;  4YII A;  3S3O A;  1RR7 A;  2DXI A;  1JI8 A;  1B8I B;  1D8J A;  1PUF A;  1G3T A;  1D0Z A;  1BI3 A;  2L02 A;  4XLF A;  2GLO A;  5F1J A;  4G12 A;  2LG4 A;  4O6J A;  2QQB A;  4CYC B;  4AD9 A;  4HLX A;  5DTD A;  3E97 A;  3FBI B;  1MD0 A;  3X2Q H;  1FP1 D;  2EV5 A;  3DTI A;  2RV8 A;  2P5K A;  5ICE A;  2R7D A;  4ESB A;  4HG2 A;  2RNJ A;  5FKL A;  2XPV A;  4N9I A;  4RLQ A;  5J1R A;  5EGO A;  3I56 I;  2NVT J;  5CVV A;  1B4A A;  5HS8 A;  1MMD A;  2V26 A;  4LJZ F;  4B44 A;  3WTW C;  2BY3 A;  1P7I A;  2H1L A;  1Z6T A;  3F8B A;  1E0E A;  3UR3 C;  2HVS A;  4BKX A;  3FBN B;  3HGG A;  1EJ9 A;  3MEX A;  2VXD A;  4BAY A;  1XGN A;  3HSF A;  3N05 A;  5DEQ A;  1T95 A;  4ZYD A;  5J1Y A;  2H09 A;  4UUT A;  4LG0 A;  3MKZ A;  1V5F A;  5FD6 A;  3COA C;  3PO2 J;  2CQ7 A;  2W85 A;  2IP2 A;  1H9T A;  3JRE A;  2QA4 I;  1O7F A;  3DPT A;  1ETX A;  3FMR A;  4DZJ A;  2HGC A;  1STZ A;  3MZY A;  3OMY A;  1A31 A;  4ZZD A;  2VKE A;  1ZGA A;  4OIO F;  3MKW B;  2W4S A;  5K1Y A;  4FE7 A;  3ZCO A;  3PO3 J;  2BXZ A;  2M9H A;  1R5I D;  2XV4 S;  3O8H A;  1GV2 A;  2ELK A;  2HI3 A;  4M6V A;  2YSR A;  1VQO I;  4X0G A;  2HDC A;  4BE2 A;  1SFX A;  1UST A;  1YHQ I;  2JZY A;  3CZ6 A;  1KYZ A;  1ZG5 A;  1J7K A;  2ZNY A;  4UUS B;  2MW8 A;  5DCM A;  2OD5 A;  1MBF A;  2ISY A;  2XAH A;  3L1P A;  3BR3 A;  4I2O A;  3RQ4 A;  3TBI A;  4MEX F;  4ABZ A;  4BHB A;  4LK0 F;  1IZ1 A;  2WB1 N;  2KDZ A;  3FXR A;  2DMP A;  1DU6 A;  3I55 I;  4G94 A;  2MD0 A;  3CUQ C;  5BQT A;  4E7S A;  2L9N A;  3LSP A;  3E6B A;  2XSD C;  5EG0 B;  4XR6 A;  3IAS 2;  1F36 A;  4KIS A;  2E5N A;  1BOB A;  2NYX A;  1Z3X A;  4M6Y A;  3W2V A;  3D1N I;  1KU2 A;  2R7F A;  2XPW A;  1S6L A;  1PUE E;  2STT A;  3WU1 B;  2B9S A;  1I1G A;  3HPH A;  1FX7 A;  1SFE A;  2KQR A;  2IXS A;  2H27 A;  3K4J A;  1VQ7 I;  2X85 A;  4LOC A;  2CFO A;  3RPQ A;  1YIO A;  5KAI C;  5IT9 Z;  2LD5 A;  4PGH A;  2VBY A;  1SAN A;  1G8X A;  2XAG A;  4LIU A;  2BYV E;  4PSW A;  3OYL A;  3JR9 A;  1TL8 A;  2G9W A;  3AFH A;  3OIP A;  1X2N A;  2VB6 A;  3JTH A;  4P55 A;  2MA3 A;  1XTA A;  2K9Q A;  1FBS A;  4ZC3 A;  2TCT A;  1GT0 C;  2HKX A;  4DQ2 A;  4RAG A;  3RPU A;  1OCO H;  3J7A O;  2CJJ A;  4I01 A;  2W7N A;  1IJW C;  3E5X A;  3FXU A;  3TOA A;  1FWZ A;  4A3E J;  4A0X A;  2E1C A;  3TW6 A;  4KJZ A;  4BDY A;  2QUF A;  3SQN A;  2PN6 A;  5D5V B;  2EZH A;  1OR7 C;  1D0Y A;  1XDU A;  2XRN A;  3GVA A;  3JSP A;  1RUN A;  1J09 A;  3CDL A;  5FGM A;  2BY2 A;  3CMM A;  3QPT A;  2L9V A;  3KP2 A;  3SJM A;  3IRQ A;  1VQ5 I;  2VN2 A;  1Z77 A;  4G7O F;  2UUZ A;  3MWM A;  5L3D A;  5M3M J;  4A3I J;  3B73 A;  2LKP A;  1IG7 A;  2EA4 A;  2HOT A;  3ZXS A;  1Y8R B;  2JA7 J;  1VF9 A;  1K4S A;  3CJR B;  5F6F A;  4EAT A;  2P5V A;  3VEP A;  2VLA A;  3CCL I;  5LD2 C;  1IUY A;  3KP6 A;  2A6T A;  4G6T B;  4OMZ A;  3CUO A;  4IRG A;  3I4N J;  1TQI A;  1HW2 A;  3MCZ A;  4EJU A;  1K6Y A;  5IT9 K;  2YS9 A;  3O2P E;  2HOA A;  3R0J A;  3DWL E;  5EZH A;  5J3L A;  2PJP A;  4U0Y A;  2JA2 A;  2DA4 A;  1J0R A;  1T0F A;  2K27 A;  3GZN B;  4OIN F;  1P4A A;  1G6N A;  1Y1V J;  3O3K A;  1XSX A;  4II2 A;  5F0H A;  4WCG A;  2P4W A;  5JHF A;  4IO9 F;  2DFI A;  4CZC A;  3FXJ A;  2UXX A;  3KE2 A;  4LFU A;  2X1E A;  1EH6 A;  2WA0 A;  3H5N A;  3GTP J;  2VQG A;  5IPA A;  2YPR A;  1IAW A;  4E70 A;  4AID A;  1F9N A;  2STW A;  4BGD A;  1LB2 A;  1FJL A;  3RIR A;  2NOG A;  1P2F A;  4D1Q A;  2BBY A;  1B6A A;  3Q0W A;  5E18 F;  1NTC A;  3HKZ N;  4M3D A;  2FNP A;  3L00 A;  3CMY A;  1GV5 A;  3NAU A;  4UV8 A;  2ZC2 A;  4IRI A;  4RMN A;  2QSG X;  2XB5 A;  4E7I A;  2V1U A;  3CDI A;  1MBJ A;  3L2U A;  3HOX J;  3GTM J;  3T1B A;  1DP7 P;  3CO6 C;  1BR2 A;  4XIC A;  1SD7 A;  1FMV A;  3GTG J;  4HA8 A;  1D0X A;  4XLA A;  3DBH B;  3TKY A;  5GPC A;  2DU9 A;  2XSJ C;  3J81 Z;  2HPM A;  1VZ0 A;  3KPH A;  1W36 C;  5ICF A;  1DQU A;  3I4M J;  2JPB A;  4JQF A;  1SD4 A;  3K4K A;  4OU0 A;  1FYK A;  5K7Z A;  4CCO A;  3OYM A;  1IN7 A;  4PFP A;  2HQA A;  2WAF A;  2OU2 A;  2CGP A;  1DDN A;  1GVJ A;  2LF7 A;  2D1H A;  1XD7 A;  4XM3 A;  5D6E A;  4RB3 C;  4FCY A;  2QKM B;  2GWR A;  4AYB N;  2HVR A;  3U21 A;  2KLO A;  1A35 A;  2DA6 A;  2HXI A;  1VQK I;  5CVU A;  2CWE A;  3IL2 A;  2R7W A;  5KNL A;  3OYC A;  2VBW A;  1VFC A;  3VYU B;  5C3E J;  2L3D A;  2F5V A;  4S0H B;  1W1W E;  3KP7 A;  1HC8 A;  2MAB A;  1O7L A;  1IUF A;  2EIM H;  4Y15 A;  4RGU A;  1OQY A;  1IO2 A;  2DT6 A;  1T6S A;  3N97 A;  3HC7 A;  4BXX J;  2CQK A;  3LSR A;  2Z33 A;  2V1D A;  4GCV A;  4PJN A;  3TDU C;  3FK7 A;  1MH3 A;  1SVO A;  2BVL A;  3QYB A;  3L7W A;  4LLL A;  1I3A A;  3IH4 A;  2Y0S A;  3R60 A;  3OYF A;  1WH7 A;  3CES A;  1BW5 A;  1WJC A;  1QBJ A;  1J2X A;  3CCE I;  4BAC A;  1PP7 U;  1P9Q C;  5FD5 A;  3EUK L;  4JX5 A;  3L2V A;  2P5L C;  1HKQ A;  2F48 A;  4I6Z A;  1OIS A;  1ZAO A;  2K3F A;  2NRA C;  3DP7 A;  5DUI A;  4ZJZ A;  3AG1 H;  3RSN A;  2E2J J;  3SZG A;  4DYQ A;  4G7Z F;  3GZ5 A;  4M6X A;  3HG9 A;  1K6O A;  2BHY A;  3M1E A;  2ZB9 A;  3DKX A;  3SEQ A;  4EJV A;  3L2W A;  2R5Y B;  3K1N A;  1H89 C;  3FMS A;  4I09 A;  1MIJ A;  2ADU A;  3HUG A;  3KIO A;  2H94 A;  4MEY F;  4CGZ A;  2PJR B;  3HL2 A;  1HKT A;  3FX3 A;  4X6A J;  1S7A A;  3QP5 A;  3PIP F;  2XRO A;  2EFO A;  5FKK A;  4FIS A;  4XBF A;  2WY7 Q;  2FQ4 A;  2ETH A;  2V6E A;  1XGM A;  3KLO A;  1YW7 A;  2VKV A;  1GDT A;  3LSH A;  1JUM A;  1IGN A;  2QQ9 A;  4L5J A;  2H6B A;  1QRY A;  2R7O A;  2BY0 A;  1JT0 A;  3QOP A;  3QPS A;  2LP0 A;  2X6O A;  2RRE A;  4A3B J;  1MMA A;  3ZQI A;  3NWS A;  3W2A A;  1R5H A;  2LKS A;  3HXL A;  2GXA A;  4YFK F;  3RKY A;  4K2E A;  3KCC A;  4EJO A;  4A3J J;  2MH9 A;  3WTT C;  3CUQ B;  2HQ5 A;  2Q2E B;  1QHG A;  4BS9 A;  5FLM J;  5HDK A;  1RKW A;  3FHN A;  1B8I A;  4G6D A;  1BM9 A;  1SMY F;  2OV7 A;  4CYC A;  5DCF A;  3O6B B;  4AU7 A;  5DD4 A;  1ZRE A;  2JK3 A;  2JTV A;  4CCN A;  1TBX A;  2ZME B;  3WTX C;  1ETW A;  3FXL A;  2RQQ A;  1WH5 A;  4U0V A;  2ZJQ F;  3TO9 A;  2DAO A;  4S04 A;  2CV2 A;  2N8G A;  1MGT A;  4RS8 A;  3JSO A;  3MFK A;  1X1A A;  2DT7 B;  1RPW A;  4D7N A;  5LFA A;  3OYK A;  3H0G J;  2P7C B;  2GM4 A;  3ZQ7 A;  3BY6 A;  1Z3Y A;  2L4A A;  4B4C A;  2G7U A;  2VC1 A;  1B59 A;  2R7T A;  1LEA A;  4XSZ F;  2C6Y A;  3LMM A;  2OUM A;  4A3L J;  1MND A;  2ICW G;  2ESN A;  3E6D A;  2DLL A;  2LMD A;  1H9G A;  1EF4 A;  3I0T A;  4QWQ A;  1Z91 A;  5BMZ A;  4I7H A;  4ZTF A;  3BTC A;  3H9J A;  1BC7 C;  2DMT A;  1BI1 A;  1WKM A;  2TDX A;  3RTR A;  1GHC A;  2EK5 A;  3VDX A;  3RPU D;  2HYF A;  4CHU A;  1HQC A;  1R49 A;  3E6C C;  5CQE A;  2NVY J;  2R7Q A;  3NWT A;  4NDL A;  3OL3 A;  3HIF A;  3S15 J;  2NAZ A;  3GBG A;  1MJB A;  1T08 B;  2XF6 A;  2ZXW H;  4UUS A;  1L3L A;  5CQG A;  2Q1Z B;  3BR6 A;  1USS A;  1G3W A;  2X9D A;  3HB9 A;  4HX7 A;  2WWY A;  1R00 A;  3U1K A;  5EYR A;  2EIN H;  3GFJ A;  3OS1 A;  2ZXJ A;  2JT1 A;  3BG9 A;  3SXY A;  1LFP A;  2WAE A;  4P1W A;  2KRH A;  5E3M A;  1SD5 A;  3ZMU A;  5HNF A;  4I98 B;  4I0A A;  3JAM Z;  2JSC A;  5IP6 A;  1JKO C;  3ONQ A;  1WJD A;  1ON1 A;  1S3J A;  4HRI A;  1U6G A;  2FU4 A;  3DEW A;  4ENM A;  1Z21 A;  3ABL H;  2VI6 A;  2DA5 A;  3SFZ A;  1VQ6 I;  2EV0 A;  3GCM A;  2DA2 A;  2EQR A;  2QZ8 A;  3GTQ J;  2O5R A;  4MTE A;  3H9Q A;  3G71 I;  2PFB A;  4KIF A;  4D0P A;  5LRS A;  2O6G E;  3GLL A;  3DPL C;  1V3F A;  1G59 A;  4CCK A;  2CUZ A;  3I4P A;  3K4N A;  2JVH A;  3GTL J;  1MMS A;  4A3D J;  1RKT A;  2P0W A;  2BW3 A;  1U8B A;  5HNH A;  6PAX A;  2GA2 A;  5A2Q Z;  4BBS J;  1ZLK A;  5J6X A;  5J47 A;  2AXT C;  2PMZ N;  1Z67 A;  4A6D A;  2V1N A;  2CQN A;  1SVM A;  3FXM A;  2KPM A;  5AON A;  1HDD C;  2PEX A;  4F55 A;  2A3S A;  3ZMD A;  1Y8Q B;  1FOK A;  4R1H A;  2Z9O A;  1QU3 A;  4XON A;  1BN5 A;  5CVI A;  2M3A A;  2MLK A;  3BTL A;  2DO7 A;  3HGY A;  3ZMT A;  4PJ0 C;  3FF5 A;  2BY1 A;  3RYP A;  3VWB A;  2A6E F;  4XRF A;  1FOX A;  1OCC H;  1QPI A;  2F2E A;  1F43 A;  3WGI A;  1X2M A;  4GGG A;  1ZEL A;  4BE1 A;  3BR0 A;  3BT9 A;  1S8N A;  1LE8 B;  2VKD A;  1X1D A;  3GME A;  3TED A;  4BDZ A;  4KFC A;  2WB1 A;  3JTG A;  1T56 A;  4ZDO A;  1MZB A;  1R4N B;  4F91 B;  3JAM K;  1HOM A;  2COM A;  2F6C A;  4HW0 A;  2Y75 A;  4OWR B;  5JLW A;  1O3Q A;  3MZ8 A;  5FKO A;  1ORK A;  5JVT A;  4KN7 X;  3QQA A;  5E1W A;  2KL4 A;  3FDY A;  3FK6 A;  4XN3 A;  2KP6 A;  3N4M A;  3FXK A;  3K70 D;  2IAI A;  2E71 A;  1UHS A;  2JA6 J;  2HYJ A;  1ON2 A;  2GIV A;  3RYR A;  3CCU I;  5LGU A;  3MMY B;  3FHZ A;  4HQE A;  5BS6 A;  4D9J A;  4M9S A;  4V2F A;  5A2Q K;  4XN0 A;  5L3C A;  1IRZ A;  1O57 A;  3AG2 H;  2OF7 A;  4ZYG A;  3CC2 I;  4IHT A;  4LMY A;  4XLN F;  4KMU X;  1E17 A;  2RQP A;  2M7B A;  1FPQ A;  3SDB A;  1WJE A;  4WXD A;  3CTA A;  3IC7 A;  4B3A A;  1BI2 A;  3IH2 A;  5KAF C;  2NNY A;  2BZT A;  3BJA A;  2XAS A;  3JRB A;  3G4S I;  3L2R A;  2D2W A;  3WU0 A;  2R5Z A;  2D45 A;  4HSR A;  3D5L A;  2AQE A;  3DCF A;  4IPA A;  4RA2 A;  5F64 A;  1WJB A;  1BBY A;  5AIP A;  3KZY A;  5J40 A;  1W36 D;  1HBX G;  4KMF A;  4L9V A;  2K40 A;  1J9I A;  3K2A A;  1RI7 A;  4BH9 A;  2DK8 A;  3KYL A;  4A2U A;  1S7E A;  4NQW B;  1SMT A;  1X3Z B;  1TLH B;  2DJI A;  1XC5 A;  4IRH A;  3OYH A;  3M4O J;  3S2W A;  2X1C A;  4UVC A;  1IF1 A;  3HRS A;  4UB8 C;  2LSO A;  1JTY A;  2W00 A;  1WHU A;  3AAF A;  2LBF B;  5J4V A;  4M3G A;  5D6F A;  1EH7 A;  1YO5 C;  1JKP C;  1UG0 A;  4C2T A;  2RC4 A;  4DBQ A;  1TWH J;  3FMQ A;  2F5C A;  4GDF A;  2XHK A;  2LOO A;  3H5R A;  1YJ9 I;  4CCM A;  1DUX C;  4NC8 A;  2M1B A;  2DOE A;  2VJ5 A;  2M30 A;  2R7X A;  3HPG A;  3KLN A;  4HDU A;  2WAQ N;  1S5L C;  2HPI A;  4PSX A;  2K4J A;  1IRG A;  4NNJ A;  2L9R A;  1LNW A;  3CP8 A;  2IT0 A;  2QQ8 A;  1SAU A;  1WWX A;  1P4W A;  4Z2Y A;  2F5D A;  2O8K A;  1KYW A;  3H92 A;  5E20 A;  2OTJ I;  1MJA A;  2XPU A;  2QEX I;  2PBI A;  4RM3 A;  2ELH A;  1R9T J;  2QBY B;  3BWG A;  5GPA A;  4ON0 A;  3OS2 A;  2JRT A;  1AWC A;  1X4P A;  1FMW A;  2WTE A;  2X6Y A;  1U0J A;  5FFX A;  1W7P B;  4ANJ A;  3E7L A;  1IW7 F;  5HLI A;  1C0W A;  4EM2 A;  1B9N A;  4P9F A;  1NK2 P;  5HDN A;  1X1B A;  1YOV B;  2ESH A;  3PUB A;  4YEJ A;  5L3B A;  3OOU A;  2R7Z J;  4CXF A;  1IXS B;  2VJI A;  4MNU A;  2LKX A;  1YX3 A;  1VND A;  5FRM A;  4IXA A;  1P92 A;  5ED4 A;  2LK2 A;  1LUJ B;  2DYR H;  1BA5 A;  4A5M A;  1XGO A;  5ILU A;  4XOT A;  2LY9 A;  2M7A A;  1CGP A;  5GAG J;  1FIA A;  2K9M A;  4UY8 I;  4QSH A;  1E3O C;  3PSI A;  3SDG A;  1OJL A;  3DU5 A;  3C3W A;  3G1L A;  2R5Y A;  1ETY A;  3ABK H;  5H20 A;  3VB2 A;  4CZZ A;  1YW9 A;  2E34 A;  1KU9 A;  4AUX A;  1BJZ A;  3RCO A;  3I9V 2;  1BOA A;  2PJR A;  4F93 B;  2HQR A;  3B6A A;  2CQQ A;  2E5Z A;  3F9K A;  2QSF X;  4EJW A;  4NHJ A;  3GXO A;  4MQ9 F;  1N75 A;  4AYB A;  3VSK A;  3MZH A;  2KZV A; 
#chains in the Genus database with same CATH homology
 2HPM A;  1VZ0 A;  4Y4R A;  1W36 C;  3K4C A;  1AA7 A;  4F92 B;  2VQC A;  1DQU A;  4N4O B;  4JQF A;  3K4K A;  4R79 A;  1X1C A;  2CV1 A;  2CH0 A;  4XKV A;  4BEH B;  4CCO A;  3OYM A;  4PFP A;  2HQA A;  2WAF A;  3D5S C;  2CS3 A;  4QPQ A;  4XM3 A;  4IX7 A;  2QKM B;  2HVR A;  3DTE A;  2KLO A;  3U21 A;  5HOO A;  2HU9 A;  4ZYA A;  3BCB A;  2R7W A;  3LSK A;  5KNL A;  3HUG B;  4ITV A;  4U87 A;  3OYC A;  2XF5 A;  2RNG A;  3VYU B;  3OYB A;  3J7A Y;  4FAS D;  2VPL A;  2F5V A;  2VL8 A;  2MAB A;  3A1Y A;  3K4L A;  4CSW A;  2VQL A;  3EUH C;  3BG6 A;  2M4K A;  4HPQ A;  1NG6 A;  2WAQ A;  2DT6 A;  3HC7 A;  1DGW Y;  3BG7 A;  2ZFU A;  2Z2S B;  4PJN A;  4DOZ A;  4DGW B;  4J01 A;  2BVL A;  3QYB A;  1X19 A;  1BR4 A;  1HA8 A;  3S8P A;  3ZRG A;  2Y0S A;  3LSI A;  2IGN A;  3OYF A;  4DIQ A;  1N77 A;  1S9H A;  3CES A;  1WJC A;  4BAC A;  1P9Q C;  2WBM A;  4XMY A;  3EUK L;  3L2V A;  1X4O A;  4BEH A;  2Z1D A;  4F52 A;  1TT0 A;  4DBR A;  4E7J A;  4ZJZ A;  3OR1 C;  3RSN A;  2JVG A;  3TMO A;  3SZG A;  3A2K A;  2UV1 A;  4KT6 A;  2CW8 A;  2HDW A;  3HG9 A;  1SFK A;  2R7U A;  3DKX A;  3SEQ A;  4BU2 A;  3L2W A;  4P5O A;  1DGR M;  2CMP A;  4E6K G;  3S93 A;  3HL2 A;  2PJR B;  1LDK B;  3VSL A;  1WJ5 A;  1T0F C;  2CW7 A;  2MYS A;  2WY7 Q;  3K6G A;  3QYF A;  4HST A;  3S32 A;  2R7V A;  3OR2 C;  4PJM A;  2V6E A;  2K5C A;  2V7F A;  4CA0 A;  1OLT A;  2XF7 A;  3G2B A;  3K4B A;  3LSH A;  4BQQ A;  2HVQ A;  4XQF A;  2R7O A;  3CF2 A;  4E4H A;  3HKZ A;  1LVK A;  4C30 A;  2ZXI A;  4OAY A;  3ZR8 X;  3I3L A;  3BC8 A;  2RRE A;  1MMA A;  2R7S A;  4B43 A;  3NWS A;  3W2A A;  3HXL A;  3UNG C;  2X1D A;  4AVZ A;  2XC7 A;  3M8J A;  4HNT A;  4Y33 A;  2LY1 A;  1TZL A;  1QHG A;  2Q2E B;  4XLC A;  4BS9 A;  3IP4 B;  3FHN A;  2CUJ A;  4PJJ A;  2L9S A;  2LRD A;  2OV7 A;  4XKB A;  2E60 A;  3PL8 A;  1IRX A;  2VXZ A;  4XKC A;  3V42 A;  4E7H A;  2VJJ A;  4AU7 A;  4LG3 A;  2F4I A;  3C2G A;  3MD2 A;  2HZD A;  2FUG 2;  4CCN A;  4HEA 2;  2I8D A;  1D1B A;  2RQQ A;  2X51 A;  3DKY A;  2K3P A;  3OWT A;  1WJF A;  2BVM A;  3H35 A;  3PFY A;  2CV2 A;  1D1A A;  3LSM A;  2IS6 A;  1X1A A;  2ZSH B;  2DT7 B;  4LIT A;  5LFA A;  3OYK A;  3AL0 C;  3SYT A;  4FET A;  1EA3 A;  1Z3Y A;  2JUG A;  3CP2 A;  4RM2 A;  4BJ5 C;  2R7T A;  1PYV A;  3LMM A;  2OUM A;  1MND A;  2QKL B;  2V9K A;  4IZZ A;  2R7R A;  2HNH A;  3OL4 A;  3L2Q A;  3DPU A;  2VKH A;  3SEZ A;  3VYT B;  2L5Q A;  4ZTF A;  3H9J A;  2VIX A;  2IS2 A;  2KDO A;  2E1M C;  3OYJ A;  3S3M A;  4C9Y A;  3K4M A;  3RTR A;  2LRE A;  4BQN A;  4QPO A;  3PSF A;  2XAU A;  3BCA A;  3H9G A;  3VDX A;  3OS0 A;  2BW3 B;  3RPU D;  5CKT A;  1MMG A;  4IQJ A;  5CQE A;  2R7Q A;  4OAZ A;  3HOS A;  2GOX B;  4PJL A;  3NWT A;  3OL3 A;  4NC7 A;  3OYA A;  3GBG A;  4E7L A;  2XF6 A;  1N78 A;  2L7K A;  4E7Z A;  4GRI A;  2Q1Z B;  5CQG A;  3QOD A;  3OS1 A;  3S3N A;  2IGO A;  1YX5 A;  1LFP A;  2WAE A;  3OYD A;  4H4K C;  4PK4 A;  4P1W A;  2L2O A;  2KRH A;  1BR1 A;  2JSP A;  1V5E A;  5HNF A;  3S3O A;  4BUP A;  4MLO A;  3ONQ A;  2DXI A;  4B48 A;  1WJD A;  2VJ4 A;  1JI8 A;  4HRI A;  4XL9 A;  1D0Z A;  1Z21 A;  4XLF A;  2LG4 A;  2PMZ A;  2VQH A;  3D5R C;  3FBI B;  3EPZ A;  2O5R A;  4DJA A;  3DTI A;  4ZDP A;  3H9Q A;  2KZV A;  4ZDL A;  3DPL C;  1G59 A;  4CCK A;  4E7K A;  2NOJ B;  2CUZ A;  3K4N A;  2JVH A;  4HG2 A;  3ZQQ A;  1D1C A;  3DLA A;  2P0W A;  2BW3 A;  3KX2 A;  5HNH A;  1Z7L A;  4RLQ A;  3PJR A;  1MMD A;  2V26 A;  4B44 A;  2V1N A;  1KON A;  3QYE A;  2KPM A;  1E0E A;  3UR3 C;  4F55 A;  3FKJ A;  2HVS A;  4J00 A;  3FBN B;  2VXD A;  1QU3 A;  4XON A;  5KCM A;  2M3A A;  4NUB A;  3DU6 A;  3N05 A;  1T95 A;  4XNF A;  2V4J C;  2LBF A;  3MKZ A;  1V5F A;  3DEE A;  5TGT A;  3VWB A;  2WAD A;  3ZGK A;  3OYN A;  3H0D A;  3DPT A;  3PNT A;  3OMY A;  5HVQ C;  1ZEL A;  4BE1 A;  3MKW B;  2IGK A;  2W4S A;  3C2H A;  2VKD A;  3LSG A;  3ZCO A;  5FRO A;  1X1D A;  4BDZ A;  4BJT A;  2WB1 A;  1Y56 A;  4ZDO A;  4JOM A;  4F91 B;  2DCE A;  2F6C A;  4X0G A;  4BE2 A;  2AQF A;  3K70 C;  4ZTJ A;  3CZ6 A;  4KIT B;  3M1C A;  4OWR B;  2IS4 A;  2LYC A;  2W82 A;  4B3X A;  2Z16 A;  4Y3O A;  3KEY A;  2KL4 A;  1Y6I A;  3FDY A;  4XN3 A;  3RQ4 A;  2KP6 A;  3TBI A;  4U7B A;  3MKY B;  3K70 D;  2E1M B;  3DTK A;  2MD0 A;  3MMY B;  4E7S A;  2L9N A;  3QOE A;  4D9J A;  4XN0 A;  4XR6 A;  3IAS 2;  4CCJ A;  4KIS A;  2E5N A;  2M7B A;  3SDB A;  1WJE A;  1BOB A;  1Z3X A;  3W2V A;  3W2W A;  3L2R A;  4RLF A;  4HSR A;  3D5L A;  2AQE A;  3CJQ B;  3HPH A;  1WJB A;  2K9L A;  2KQR A;  2IXS A;  2ZXH A;  2R4G A;  1W36 D;  3K4J A;  2X85 A;  2CFO A;  4IQ4 A;  4PFO A;  1UAA A;  3KYL A;  4LIU A;  1G8X A;  4PSW A;  1GLN A;  4CUG A;  3OYL A;  4NQW B;  3AFH A;  2DJI A;  3OYH A;  2IS1 A;  3OIP A;  2VB6 A;  2X1C A;  4ZC3 A;  2BOL A;  4BXF A;  2W00 A;  3PNV A;  2LBF B;  2WY8 Q;  3IUO A;  1DP3 A;  1MNE A;  1ERD A;  2W7N A;  1R6R A;  1UG0 A;  2M4G A;  4C2T A;  3E0J B;  4XLH A;  4DBQ A;  1MW7 A;  4KJZ A;  4BDY A;  3HOT A;  2LOO A;  4N4N B;  3H5R A;  4CCM A;  1OR7 C;  1D0Y A;  4NC8 A;  3AKZ A;  4XLE A;  3OIQ A;  2VJ5 A;  3OYE A;  3PNY A;  5HLT A;  2R7X A;  5CPR B;  3HPG A;  3LFU A;  1J09 A;  2HPI A;  1PJR A;  2LH9 A;  4PSX A;  4XKW A;  3CMM A;  4XOR A;  4NNJ A;  3CP8 A;  4IKF A;  3E1S A;  4BJ6 C;  2KMU A;  3LL7 A;  1SAU A;  1V5G A;  2KRC A;  3H5A A;  2UUZ A;  4II3 A;  3DQV C;  2X6W A;  3ZXS A;  4RM3 A;  3CJR B;  1YE9 A;  1WJA A;  2XDV A;  2LY2 A;  4EAT A;  3OS2 A;  1X4P A;  1FMW A;  2M0M A;  2X6Y A;  1U0J A;  3OY9 A;  2VLA A;  5LD2 C;  4ANJ A;  2A6T A;  4G6T B;  2DOA A;  2GOM A;  3EUA A;  3TL4 X;  1QHH D;  2X6X A;  2MC4 A;  1K6Y A;  1NG7 A;  1X1B A;  2CV0 A;  3VYS B;  3DWL E;  4CCL A;  4PUS A;  2JA2 A;  3PUB A;  1LKX A;  4YEJ A;  2VAS A;  3OOU A;  3OYG A;  1UEL B;  1WFX A;  2IGM A;  3K10 A;  2VJI A;  2MFZ A;  1YX3 A;  2A5W A;  4XOP A;  1MMN A;  3VYR B;  4B47 A;  4II2 A;  2ZSI B;  3AL0 B;  5JHF A;  5FRM A;  4CZC A;  2X1E A;  2WA0 A;  3H5N A;  2VQG A;  4C2U A;  2ELJ A;  3BLY A;  4BGD A;  2LC2 A;  4XOT A;  2M7A A;  4D1Q A;  2K9M A;  4LIV A;  3A4C A;  4BL0 B;  4BQO A;  3W3C A;  5FRN A;  2UWM A;  3PSI A;  3DU5 A;  3OYI A;  4BE0 A;  4HNU A;  4RMN A;  4E7I A;  2OC6 A;  2KHM A;  3L2U A;  4F3Q A;  3RCO A;  3I9V 2;  2PJR A;  4F93 B;  1BR2 A;  4CH7 A;  2W1O A;  5KHD A;  1FMV A;  2E5Z A;  3F9K A;  4YRV A;  1D0X A;  4XLA A;  4AYB A;  1N75 A;  3IAM 2;  3VSK A;  4YEL A;  2XSJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...