5D8KB

Human hsf2 dna-binding domain bound to 2-site hse dna at 1.73 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*GP*TP*TP*CP*TP*AP*GP*AP*AP*CP*C)-3')
publication title Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 25
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d8kB00
1MDMB 2P4WA 5F6FA 6PAXA 3JW4A 1USSA 2EJRA 3F6OA 1MD0A 2YX4A 2OU2A 1FT9A 1U2WA 2IA1A 3NRVA 1XMAA 3BPXA 3KP4A 1ZGAA 2LF8A 1SMTA 3F21A 3VODA 2HR3A 4UVBA 2AXLA 2XUBA 2JZYA 3GZ6A 1KU7A 2FMLA 3P9CA 2JPBA 3IHUA 2IRFG 3QPTA 3C7JA 2A5YB 4KDPA 3MEXA 4L0YB 4HLXA 2YR2A 2CFXA 1U78A 1OYYA 3GFMA 1QQIA 2DPUA 3IL2A 1IN4A 1TW2A 2XASA 3U1DA 1R36A 1QNTA 4M74A 3FZVA 1YQAA 2D2WA 2E1NA 1J5YA 3COAC 4LFUA 1SFEA 2EV5A 1FBSA 1MJ9A 3ZQ7A 1BI0A 1B4AA 2JRTA 1ULYA 3FHZA 3I59A 2XHKA 1FP2A 2VBXA 2L4MA 4M6XA 1LEBA 1QZYA 2YPRA 4ESFA 2AS5F 4KMFA 2OQRA 5EEGA 2DQRA 2P5KA 2HDCA 5E8GA 1LEAA 2VE9A 2EFPA 1XSVA 2XAHA 3CJNA 3BDDA 3TGNA 4QLCU 2K4BA 2L54A 1TQMA 3KETA 2KIMA 5HS7A 3HOSA 2CG4A 3H3UA 5IT9Z 4EM0B 1ZLKA 1S8NA 2ZO4A 1C0WA 4MHGA 2PI0A 4ZYEA 1XB4A 1BI2A 2HFHA 2VC1A 5FD5A 2RN7A 1KU3A 4ENMA 5H6QA 2F2EA 3RPUA 1OYIA 4YG2F 1ZAOA 3M8EA 3KP2A 4XSZF 4CO8A 2KKOA 3V7SA 2NNNA 3FM5A 1LVAA 4GYGA 4DNCA 4GCVA 3TDZC 3I53A 3QU3A 3IKTA 1YG2A 2B0LA 4I0BA 4KNYA 3GEZA 1K79A 4MTDA 3RKXA 3J80Z 5TJJA 3DKWA 1ZGJA 4YFKF 3P9KA 2M45A 1QBJA 5H6RA 4B09A 1G4DA 1BJAA 4KT5C 4LK1F 3E6BA 1E2XA 2DI3A 2GA1A 4G8XA 4EGZA 2Q2EA 4OINF 1LDJA 2EWNA 2FA5A 1UCRA 1R00A 3ML6A 3E5UA 3WGHA 3GLXA 1Y0UA 2EV0A 3U2RA 4RB2C 1SAXA 3F8CA 5LHIA 2FNAA 3KP5A 1XD7A 2BE5F 2FBHA 1IUYA 2YX7A 1DDNA 1XGSA 4KIBA 2F5EA 3FM3A 1IF1A 1TLHB 1WI9A 2CWEA 1J2XA 2IVMA 2JTVA 4UV9A 1JHFA 2PBIA 1FX7A 4CZZA 5DEQA 4M71A 5LHHA 1K7AA 1R58A 4IJAA 1YS7A 2ZFWA 2V79A 3WU1B 5LGTA 3RI4A 1JXSA 3HIFA 1O3TA 1WKMA 2CQKA 4UVCA 4A5MA 3TO9A 3F22A 1DUXC 1HQCA 3DEUA 3RKYA 4I98B 1ZRFA 2OBPA 2K27A 1R22A 2DTRA 1D8KA 2A6HF 2LF7A 2BBYA 2Q8KA 2EFOA 1U6GA 5CVIA 1OR7A 3RTRA 3TOBA 4LJZF 2G9WA 3V8LA 1W7PA 5D5XB 4N0BA 3K0LA 5FLXZ 2EA2A 4F7ZA 4M9XA 4GYIA 4I02A 3I0TA 3T8TA 3HRMA 3P7NA 1WSUA 3CLOA 1SFUA 2P6SA 4WX9A 1UHMA 3GXOA 4I2OA 3BJAA 5HOOA 3I54A 1S3JA 3L00A 4EJTA 2BYVE 4E70A 5CJ9A 2D45A 2MC3A 5E17F 4I09A 2O03A 4U0WA 2MD5A 5ED4A 3ZMDA 5HDNA 2DAOA 5E18F 3NQOA 5HS8A 2A69F 3WTVC 1ZREA 2W84A 1K78A 5K5QA 1U5TB 1RUNA 1YIOA 2FU4A 4ESBA 3R0AA 1FYMA 2DFIA 1J75A 2HQNA 1USTA 1SD5A 3K9TA 1WRJA 3QP5A 4G9YA 1OYWA 4AIKA 1KA8A 2VN2A 1DPRA 4EGYA 4OIOF 5CYVA 3TO6A 4A5NA 1P2FA 1FBUA 5HLGA 2PLYA 2HZTA 5BPIA 3M1EA 3HTUA 4PGGA 1KGSA 1QPMA 4BHBA 3N97A 2M87A 3GVAA 3IC7A 4UHTA 5HLHA 1FSHA 4AVPA 2A3SA 3Q5FA 2HS5A 3B02A 1TQIA 1ZG1A 3WTYC 2UWMA 3KZZA 2V1DA 1AOYA 2X0LA 2G7UA 4Z2YA 3E3VA 4XLPF 3W6KB 1CF7A 4WXCA 5FD6A 3ZPLA 3RYPA 3WE3A 2WV0A 2OZUA 4AIHA 2IPQX 1GHCA 2M5WA 3IWZA 1FSEA 1OKRA 3OOPA 2VONA 2VODA 2FRHA 2FXAA 3MWMA 3O6BB 2QYOA 4LD5A 2WTEA 2NS0A 1LB2A 1Z9CA 3M7GA 2DK8A 3V7RA 5HS9A 2ZXJA 1ZG5A 1HW2A 2UZKA 4CHUA 3V4GA 2HEOA 4NQWA 2IJLA 1I5ZA 5DUIA 3IKVA 4UVAA 3F6VA 1P6RA 2W25A 3E6CC 3D5LA 5L3DA 4KIFA 1YW9A 4KMUX 2W57A 3JSOA 1O3SA 1FOKA 2EB7A 2F5FA 3V8KA 1STZA 2FEZA 2ESNA 4ENKA 3D0SA 3L7WA 1MDMA 4WXHA 4UXNA 2KIFA 3KFWX 2MLKA 5LEJA 3I4PA 1T39A 2V1UA 3C18A 5ERIA 1BI1A 1R1TA 4GGGA 4M9ZA 5D4RA 4IRIA 1FZPB 4OOIA 4LK0F 4I01A 3KLNA 4M72A 2E1CA 2NAZA 3Q9SA 4OMYA 5K5RA 2E7XA 1TNSA 4ETSA 2V9VA 4O3MA 2FBKA 2ZKZA 1UFMA 2LNBA 4RGRA 3K2ZA 5JR3A 1QGPA 4R1HA 3CUQC 2ZJ2A 4S05A 2F5DA 4Q4ZF 2JPCA 1XSDA 4KIGA 1XMKA 2P5LC 2BV6A 2K02A 1V4RA 3LAPA 4O5VA 2RQPA 4U88A 2ISZA 4LG0B 2D1HA 1ZG3A 2ZMEB 3ZMZA 4Q47A 3HTSB 1J9IA 3ABTA 4AWXB 4RAZA 3KCCA 3CUQB 3WTWC 3Q9VA 2IA0A 1WWXA 2RNJA 2HTJA 1R1UA 5DCMB 1RUOA 3QPHA 3I5UA 1F9NA 2ELHA 1G6NA 1Z7UA 1PUEE 1LJ9A 2LDUA 1V3FA 5ILVA 3GFLA 1KYZA 3BP8A 3K69A 2PMUA 3I58A 4WF2A 1JE8A 4RS8A 2HOEA 2H94A 4BHPA 4G7OF 1T38A 5BMZA 2ESHA 1S29A 3HSFA 3WTTC 2HKXA 1XDSA 1Z1DA 4XLNF 4Q48A 1JHHA 2C6YA 2ZNZA 1TNTA 2DU9A 3J7AO 4HZFA 3DPLC 3TOAA 2A68F 5JHUA 1YW8A 4IHSA 3RIRA 5EEHA 3M9AA 5IT9K 3ZMTA 3HYIA 3BOQA 5E20A 2EFQA 2TDXA 1J59A 2QQBA 1YLFA 1W5SA 3CO7C 3HRSA 5H20A 4HOBA 2FE3A 3V8JA 1PDNC 1SD4A 1ZARA 2GWRA 5D6FA 4LGWA 2XAFA 3GWZA 1T0FA 3DP7A 1Z6TA 3HSEA 4BQAA 2FBIA 4QWQA 4EM1A 1ZLJA 1S7OA 1D8JA 2PN6A 3ZN0A 4UV8A 2Z5UA 4CYDA 4RGSA 3MZHA 4Q5SF 3KP7A 3J80K 3SZTA 4P55A 3FF5A 5ICCA 1SFXA 4YFNF 4KA4A 5CVJA 2R7DA 5DYMA 2CSOA 4U0YA 2EK5A 3GF2A 1B6AA 3FMSA 2F5CA 1MZBA 1IN8A 2RV8A 3HHHA 5HVQC 4U7BA 1SMYF 4HAMA 4BHCA 3KP3A 1RIOH 4ZZDA 3ABUA 2A6EF 4MTEA 1T6SA 4DQ2A 1R1VA 4B8XA 2E7WA 2IT0A 4TV7A 1X3UA 4HQEA 1QZZA 2DLLA 3WTUC 4EM2A 2K86A 4LB6B 2MA3A 3EYYA 5A2QK 2GZWA 2FF4A 3IRQA 4LLGF 3JTHA 5LRRA 1IN5A 4L9VA 2FSWA 1O7FA 4LLNA 2L01A 2QBYB 1XGNA 1TBXA 4G94A 3LWFA 3ZN1A 1FBQA 1XGOA 3FMRA 3MFKA 3C1DA 3GO5A 2XAGA 4LB5A 2Y0MA 5LBQA 3T5XA 4MNUA 2VBYA 5KVRA 4BYYA 3LQQA 4KYWA 3GFJA 5FFXA 1UB9A 4P9UA 4YIIA 3REOA 2WWYA 1TQPA 2Z3YA 3PFIA 4K2EA 2PEXA 2VC0A 3BY6A 1I27A 3ZMVA 4HYEA 5D5WB 5TRDA 2V6CA 5FLXK 2G7HA 3TDUC 3BJ6A 4EQQA 3ECOA 5CVRA 1YFHA 4PGHA 3EYIA 4BXUA 2H6CA 3K1NA 1F5TA 4HBLA 2Y48A 3DF8A 2STWA 4WWCA 1U5TA 1IZ1A 1I6XA 5LGNA 2GQQA 5FGMA 5LEKA 1E17A 4WK8F 3B73A 5LGUA 1KYWA 1MJBA 4UNOA 4JQFA 3RYRA 4R8HA 1R5HA 2FQ3A 1HKTA 1ZYRF 4YFXF 5D5VB 4OIPF 2OAZA 2WC2A 5AIQA 4MEYF 3S2WA 1ZHFA 4ZYGA 1P4AA 1HW1A 1GXPA 2NNYA 1HSTA 3GUDA 3I71A 2MH2A 1T2KA 4CICA 2ADUA 4HDUA 1Q1HA 1A04A 4FT8A 4A12A 2VBZA 2H6BA 2VXZA 3VB2A 5ICFA 5K1YA 1R23A 2Z9OA 2KJCA 1PP7U 3DQVC 4RB1A 1HKSA 4IXAA 4ASNA 1VTNC 5KK1A 4A0XA 5LRSA 5D4SA 1EV7A 4M9SA 4XSXF 3TO7A 1I1SA 2EFWA 3LAJA 4HF2A 3LA3A 3EETA 5JFRA 3J81Z 1R5GA 5DV5A 1ON1A 4HW0A 4NHJA 1HSJA 2BEOA 4D0PA 2XKOA 1B9MA 3F8MA 2ETHA 4A0ZA 1IW7F 2L3DA 4P5OA 4MEXF 1ZRDA 5CVUA 4HV5A 1CGPA 3JSPA 2OQGA 3SHFA 4ZZLA 1P4XA 3RJPA 2QVOA 1QO0D 1YYVA 3MAJA 2M30A 2P7VB 1O7LA 4CXFA 2VOOA 1DPUA 2UXXA 5DUKA 3SQNA 3RDIA 1HBXG 4EMSA 5DD4A 4I0AA 5BOXA 1S6LA 3I64A 1ZH5A 4Y17A 3BZ6A 1CF7B 1IN6A 4AD9A 4HA8A 2Q0OA 3R61A 2XROA 3HUGA 3CUOA 2DK5A 1HXDA 2EFNA 2QQAA 4IRGA 1BIAA 1FNNA 3KP6A 3ULQB 3NEUA 5DD8A 3K1MA 4EV0A 3ERED 1W7PD 2R7FA 2HQRA 3SZPA 3T8RA 2XVCA 1Z6RA 3ZMUA 2MBFA 5D5UB 3JAMZ 3HRTA 3FX3A 3E97A 2HWVA 3R60A 2GA2A 3HHGA 3MQ0A 2Z33A 4YIFA 4EVIA 4L18B 1G3WA 1L3LA 2ZMEA 4BNCA 4HX7A 2CYYA 3R0JA 3CUQA 4HX4A 3LA2A 1H0MA 5L3BA 1R7JA 1LDKB 5DCMA 4HF0A 4BAYA 4H0EA 4KN4X 1PP8F 4L9JA 5BQTA 5AONA 3T0YA 4RB3C 5E1ZB 1GVJA 2L4AA 4G7HF 4P9FA 4EJUA 2X4HA 3V7CA 4I7HA 4U0VA 1EH8A 1FC3A 1LDDA 4ENJA 1XCBA 1Z05A 4KFCA 2O3FA 5E8IA 1W4MA 3BPVA 3N4MA 2OZ6A 3RKWA 3W6JB 1KU9A 4ON0A 2M1BA 3DV8A 3QAHA 5L3GA 1H9TA 2RC4A 2ZBKA 1P92A 1RZ4A 4LLLA 4CGZA 2PJPA 5F1RA 4MGRA 5F64A 4A6EA 5J8FA 5CVVA 2KJBA 4RB0A 4G7ZF 3E5QA 1OPCA 4ESJA 1IN7A 2XAQA 3GZ5A 3E6DA 4ZYDA 2DBBA 2VT2A 3KEOA 2ISYA 3FWEA 4BH9A 4HLYA 2QM3A 3GYHX 2DPDA 1HKQA 1KU2A 2COMA 3KEQA 4L9TA 2MLGA 2VT3A 3MCZA 2OA4A 2O61A 4CDGA 3ELKA 3I59B 2A61A 3HRUA 4Y15A 2STTA 2CO5A 4EJVA 3KE2A 4A2UA 1RI7A 4IVNA 4L5IA 2HYFA 2P8TA 4OMZA 3G73A 3O3KA 2GIVA 4FX0A 3VOEA 1JGSA 5L3EA 1MKMA 2W85A 3F72A 4HDVA 3H3ZA 3ECHA 1O3RA 5HDGA 1SD7A 2P6TA 4KUMA 1IRGA 3HSRA 4FHTA 2EV6A 1BBYA 1XSXA 1FWZA 3QOPA 3G3ZA 2FMYA 3DFGA 2O0YA 1FYKA 1H9GA 3WGIA 3TKYA 1D3YA 2YU3A 3F8BA 1XDUA 4RGXA 4PZJA 2ACJA 3ROUA 3OV8A 2GAUA 4HF1A 2QQ9A 2A07F 1YO5C 3R6SA 1FY7A 4NB5A 3LQRA 4S04A 4WXDA 2QBYA 3EUHA 4M6YA 4IHTA 3BWGA 3L9FA 3WTZA 1FLIA 1U3EM 3WGGA 3F3XA 5ILUA 4MQVA 2PMHA 2H09A 4R79A 5JVTA 2IP2A 2K4JA 1BM9A 4OIRF 4HQMA 4LMYA 4O6JA 1ON2A 2PG4A 5A2QZ 4OU0A 4XBFA 5AIPA 1W5TA 2XAJA 3LFKA 2JT1A 3CDHA 5FO5A 1YW7A 4AIJA 5DDGA 2IW5A 2VE8A 5J8CA 4Y13A 2UXNA 1IXCA 1G3YA 1GXQA 2HYGD 4L0ZB 1SD6A 5JI6A 1ODDA 3K1PA 1UHWA 3HOTA 2KRFA 2IA2A 1P4WA 5K5OA 4PCQA 2PFBA 5BS6A 1FPQA 1KQ8A 2DW4A 2QUFA 5ICGA 3C3WA 1WQ2A 2LKPA 2XGXA 1BIBA 2XIGA 5E1XA 5ILSA 2NRAC 1BI3A 3WTXC 1IXSB 3TQNA 5IT3A 4IRHA 2J5OA 1REPC 4MQ9F 1OMIA 2DO7A 1I1GA 3O2PE 4L5JA 5L3FA 2RVCA 1ZN2A 1TW3A 3WODF 5DCFA 4G6QA 3VEPA 2QLZA 1J7KA 5LLQA 2HGCA 2K7LA 4ZH4F 1XCVA 2D1VA 2KIUA 4EJWA 2BGCA 1G3TA 1U5TC 4A6DA 3GX4X 3WG9A 4U7DA 1Z91A 4G6DA 5HLIA 2J5PA 4ENNA 4KICA 1W7PB 3DPTA 4HV6A 2W24A 3EQLF 1G3SA 5CLSA 1O57A 2P5VA 4N9IA 3M8FA 2RGVA 2L02A 3LSTA 3ZP5A 2Y75A 2JSCA 3WU0A 1YS6A 1MJAA 2GXGA 3FXUA 2FNPA 4WCGA 1BN5A 3CO6C 3KZYA 1XGMA 1HW5A 5D8KB 3IRRA 3JTGA 2NYXA 4GO1A 4JBAA 3EDPA 3F8FA 2ZNYA 2HTSA 5D8LB 2RKHA 2ZCWA 1BC8C 3QRFF 1K6OA 4L9NA 4JK1X 1K78B 3SFZA 4OIQF 3BROA 4RAYA 2V1XA 3E6MA 1IAWA 2H27A 3ISPA 3J81K 3PQKA 3IWFA 3FXRA 4M73A 1BOAA 2MH9A 4EJOA 5HDKA 2CW0F 3LA7A 3SXYA 3QU6A 3L2CA 3P9IA 1EH6A 1FP1D 3WE2A 4N9HA 5L3CA 1F4KA 2OD5A 3F8NA 1B9NA 2O8XA 1YTYA 2RDPA 2GXBA 4P96A 3VFZA 1S7AA 5D6EA 1TTYA 4PDKA 4IF4A 4FX4A 1LQ1A 3RPQA 3MZYA 1RNLA 1DP7P 2HKOA 3BJOA 1EH7A 1L0OC 2PQ8A 3KLOA 3AAFA 1KQ9A 2XV4S 2DT5A 4A0YA 5ICEA 2FOKA 1MGTA 2QWWA 1F1ZA 1NHAA 2VBWA 5J6XA 3GFIA 3PQJA 4ZYHA 2XRNA 1B59A 4XRFA 2QENA 3L09A 5BPDA 2LSOA 1U8RA 1O3QA 1T98A 2P7CB 1B1BA 3DXJF 3E5XA 1AWCA 2M8EA 3U9GA 1ZRCA 2EA4A 5FB2A 3R4KA 1LNWA 3F23A 3T1BA 2VOPA 1J0RA 1ONVA 3ZMSA 1D5VA 5E1WA 3CTAA 1XN7A 4HX8A 2CGPA 4UUVA 5FFZA 4GXOA 2Z99A 3JAMK 4KN7X 2DQLA 4RGUA 3FXQA 2O6GE 1IRFA 1FYLA 2QZ8A 1KQ0A 3FMQA 2YSRA 5LHGA 1IXRC 3QP6A 3H92A 3GW2A 3WTSC 1BC7C 2R3SA 4IPAA 4LG0A 2XKPA
chains in the Genus database with same CATH superfamily
1XTAA 4KT6A 3HUGB 1MDMB 2ME6A 1MBFA 2P4WA 4E7IA 5F6FA 2V9KA 3A4CA 5EZGA 6PAXA 3JW4A 3OS1A 1RKTA 1USSA 3HPGA 2EJRA 3F6OA 1MD0A 2YX4A 2OU2A 1FT9A 1UG2A 3OIOA 4DYCA 1GUUA 1U2WA 2IA1A 3NRVA 3HJEA 2HOTA 4AYBA 4LIVA 1XMAA 3BPXA 3KP4A 4MFEA 1ZGAA 2XGDA 2VIXA 2LF8A 1HDDC 1SMTA 2ZMEC 3F21A 3VODA 5C44J 5FKOA 1WFXA 1S72I 3JRCA 2HR3A 4UVBA 4XKBA 2AXLA 3PSFA 3ZGKA 2XUBA 1KONA 4MFDA 2JZYA 3GZ6A 3L1PA 2CUFA 1KU7A 3PO2J 3CCSI 2FMLA 3P9CA 5FRMA 2Y0SA 5DTDA 2JPBA 3KX2A 3IHUA 5HODA 2IRFG 2G0EA 1FTTA 3ASNH 3QPTA 1VFCA 3C7JA 2A5YB 4YIRX 4KDPA 1VQ6I 5B66C 3MEXA 4L0YB 4HLXA 2YR2A 1XPXA 3K6GA 2CFXA 1U78A 1OYYA 3B6AA 3GFMA 1QQIA 3AG4H 1W0UA 1V55H 3FBNB 3O8GA 1LFUP 3OS0A 2DPUA 4C30A 3IL2A 4XM3A 1IN4A 1TW2A 2A6TA 2MSYA 2XASA 2CH0A 3U1DA 1R36A 1QNTA 4M74A 3BG6A 1X1DA 1D5YA 4RM2A 4M3FA 2CQ7A 3FZVA 3ZQLA 1YQAA 2D2WA 2DMPA 2E1NA 3PNYA 5GAGJ 4LG3A 3I4MJ 1J5YA 3COAC 2VI6A 5GPCA 4LFUA 3L2QA 1SFEA 2EV5A 2VXDA 2O9LA 3H3VK 1FBSA 1TWFJ 1MJ9A 3DBLB 1AKHB 2K3PA 3ZQ7A 1BI0A 5E3MA 2LP0A 1B4AA 3NAUA 4N4OB 2IS6A 2HXOA 2JRTA 1ULYA 3CCVI 5FLMJ 3I59A 3K7AJ 2XHKA 1N75A 1PJRA 3SFIA 1MBHA 3FHZA 1FP2A 3LFUA 3W2WA 2LY1A 2DN0A 2L4MA 2VBXA 4DZPA 3LMMA 2ME0A 4M6XA 1LEBA 1QZYA 2YPRA 4ESFA 2AS5F 1BW6A 2F5VA 2Q1ZB 4AU7A 2OQRA 4KMFA 1V5GA 5EEGA 3SDBA 2M34A 2N8GA 3EUAA 4CZCA 2CV2A 1YX5A 2DQRA 2P5KA 2HDCA 5E8GA 1LEAA 3U21A 3MMYB 2DMQA 3OL3A 2VE9A 2KQRA 3IAS2 2EFPA 1ETQA 3OR1C 1PYVA 1XSVA 2GOMA 2XAHA 3OY9A 4BE2A 1Y56A 4QPOA 3CJNA 4FE7A 3BDDA 2QSGX 2GXAA 3TGNA 2PX9A 2XGEA 4F55A 4QLCU 1PUFA 2K4BA 2IGOA 2L54A 1ZELA 1TQMA 3KETA 4ZYAA 2KIMA 5HS7A 4A3BJ 1JUSA 3MKWB 2LR8A 1FJLA 3HOSA 1TWCJ 3CMEI 3KYLA 2CG4A 4Y52J 1K83J 4CCLA 3H3UA 5IT9Z 2ZSHB 4EM0B 4D5CA 1ZLKA 3PJRA 1S8NA 2ZO4A 1C0WA 2E5ZA 4MHGA 2OPTA 1W1WE 2PI0A 2JA2A 4ZYEA 3S2HJ 3G1OA 1XB4A 1BI2A 1I39A 3S3MA 2HFHA 3AL0C 2CJJA 2K5CA 2VC1A 3BLYA 5FD5A 2RN7A 5EZHA 1KU3A 4ENMA 5H6QA 2K9LA 2F2EA 3RPUA 1T0FC 1OYIA 2MC4A 4YG2F 1ZAOA 1DGWY 2H8RA 2E36A 3IH4A 3GTMJ 1MBJA 3M8EA 3KP2A 4XSZF 4CO8A 2L7MP 3CCQI 2H8WA 2KKOA 3PUBA 3J7AY 3V7SA 2NNNA 3FM5A 3FXOA 4GDFA 2WAEA 1LVAA 4GYGA 4FCYA 2K40A 4DNCA 4LITA 4LOCA 3OSGA 2ZJQF 4GCVA 2Y9YA 3TDZC 4W1UA 4XL9A 2OV7A 5F0HA 3I53A 3QU3A 3Q3SA 3IKTA 1YG2A 2B0LA 4I0BA 3JRAA 3GEZA 4KNYA 2DA5A 3AL0B 4HSRA 1JI8A 1K79A 5B1AH 4MTDA 3RKXA 3J80Z 5TJJA 3D5SC 1LPQA 2OUMA 3DKWA 2JK3A 1ZGJA 2NXNB 4A69C 1LE8B 4YFKF 2HQ5A 3P9KA 4UUSB 1TP4A 2M45A 3G1LA 1QBJA 5H6RA 4B09A 1DU0A 1G4DA 2DFHA 2OC6A 2XF6A 1VQ8I 2MD0A 1BJAA 4KT5C 4LK1F 3GTQJ 3E6BA 1E2XA 2DI3A 2QQ8A 4A3GJ 2HDWA 2GA1A 4G8XA 5KHDA 4EGZA 3FDYA 5KNLA 3HOZJ 4XN3A 5K7HA 5CQEA 2E1OA 2KISA 2Q2EA 3CDIA 4X1EA 2B63J 1XG1A 4BL0B 4OINF 2DODA 2E2IJ 1LDJA 3EUHC 2DA6A 2EWNA 2FA5A 1UCRA 1R00A 3ML6A 3E5UA 3WGHA 3GLXA 1Y0UA 2EV0A 3U2RA 4RB2C 2M7AA 1SAXA 3F8CA 1ETVA 1MIJA 5LHIA 2FNAA 3CJTB 3KP5A 3VPRA 1XD7A 2BE5F 2FBHA 3HZJA 3K4MA 1IUYA 2YX7A 4BXXJ 1DDNA 2D5VA 2OF7A 1XGSA 4KIBA 2R7ZJ 1MBEA 2F5EA 1Z77A 4JP0A 3FM3A 2HPMA 1IF1A 1TLHB 1WI9A 2DMTA 2XPWA 3I3LA 2CWEA 1VQ4I 1J2XA 2IVMA 3EUKL 2QSHX 1SVOA 2OTJI 2B9SA 2JTVA 4UV9A 4XOTA 1JHFA 2PBIA 1FX7A 2VJJA 4CZZA 5DEQA 3KPHA 4M71A 5LHHA 1K7AA 3HGYA 1R58A 4IJAA 1YS7A 1SFKA 2ZFWA 2EIMH 1X3ZB 2V79A 4QTRA 2ELKA 3WU1B 2COBA 5LGTA 4CCNA 3RI4A 1JXSA 3HIFA 1O3TA 5J1RA 2LY9A 1WKMA 2CQKA 4UVCA 4A5MA 1IO2A 2BW3A 3TO9A 3F22A 2KMUA 1I3QJ 1DUXC 3HOYJ 3LL7A 3ONQA 1FMVA 1HQCA 5J1YA 2DDAA 3S1NJ 4V19K 3DEUA 3RKYA 3ZXSA 3CQZJ 5IYBJ 3JREA 4I98B 1ZRFA 2OBPA 1UZCA 1UAAA 2K27A 2W82A 1R22A 2VJIA 1Y1VJ 2DTRA 1D8KA 1N77A 2PJRB 4D7MA 2NVXJ 5GTHC 2A6HF 2LF7A 2VJ4A 3G1MA 2BBYA 2XDVA 2Q8KA 2EFOA 1U6GA 3OYHA 1P7JA 5CVIA 2QCOA 2CW7A 5HNFA 4HNVA 2V26A 2WADA 1OR7A 2LMDA 4XKCA 2HPIA 3RTRA 3TOBA 3BQYA 4A3EJ 3K70D 4GRIA 2R7OA 4LJZF 2G9WA 1WHUA 3GTPJ 3V8LA 1W7PA 1Y1WJ 1GV2A 1HDPA 2RQQA 5D5XB 2PMZN 4N0BA 2M9HA 3K0LA 2EA2A 2VB6A 4F7ZA 5FLXZ 4M9XA 3BTLA 4GYIA 2ZC2A 2KL4A 4I02A 4ZC3A 3I0TA 3T8TA 3HRMA 3P7NA 1YJWI 3TBIA 4A3CJ 2W4SA 1WSUA 1X2NA 3CLOA 3GLLA 2HXIA 2LFBA 3WHCA 1SFUA 2P6SA 4WX9A 3OOUA 1UHMA 2JA7J 3GXOA 4I2OA 3BJAA 2BHZA 5HOOA 3I54A 4PK4A 1YIJI 1S3JA 2R7RA 3L00A 4EJTA 2BYVE 2LY2A 4E70A 4IZZA 3CC2I 5CJ9A 2D45A 2MC3A 3Q0VA 2IEKA 4I09A 5F08A 5E17F 3BR2A 2AQEA 2O03A 1RC9A 4U0WA 4BEHA 1Z67A 4BQQA 1CQTA 2MD5A 2DT6A 5ED4A 2EILH 3ZMDA 5H2FC 5HDNA 1D0XA 2DAOA 2W48A 5E18F 3NQOA 5HS8A 4CCKA 3UNGC 2A69F 4RAGA 4CSWA 3WTVC 3LSPA 4CYCB 1ZREA 2X1EA 2W84A 1K78A 2KFDA 5K5QA 1U5TB 1VI0A 3AG3H 4XORA 1RUNA 3SDGA 1YIOA 1E3PA 2FU4A 4ESBA 1K4SA 2HVQA 1K6YA 3R0AA 3JR9A 1FYMA 3ZQHA 2DFIA 4N4NB 1J75A 2HQNA 3RPUD 1D0YA 5J40A 1LFPA 1USTA 2H1KA 1SD5A 2WA0A 3K9TA 2XSDC 4ZTJA 2R7TA 1WRJA 3QP5A 4G9YA 1OYWA 3PSIA 4AIKA 4RA2A 1KA8A 2X1DA 3BTIA 2VN2A 1MW7A 1DPRA 4EGYA 4OIOF 4IHYA 3G71I 5CYVA 5FLVA 4E6KG 3JRDA 3TO6A 4A5NA 1S7EA 3GCMA 4I76A 3A0BC 2KLOA 1P2FA 1ZQ3P 1FBUA 5HLGA 2PLYA 3I4NJ 2HZTA 2CQNA 5BPIA 1MBKA 3OYJA 3M1EA 3HTUA 4XLAA 1A36A 1QVTA 3CCMI 3QYFA 4PGGA 1W5CC 1KGSA 1FEXA 1QPMA 2HYJA 1UMQA 4BHBA 3N97A 2M87A 1POGA 2F4MB 3GVAA 2L7FP 3IC7A 2QF7A 3M8JA 5M3FJ 4UHTA 1VF9A 5HLHA 1OQYA 1FSHA 4AVPA 2A3SA 3Q5FA 2HS5A 3CP2A 1QPIA 1MMGA 2EZLA 3BR5A 2KRCA 4XKVA 3B02A 1TQIA 4P1WA 2QEXI 2ZJRF 1ZG1A 2KT0A 3HKZA 4M3EA 2JQ7A 3WTYC 5GADJ 2UWMA 4XLEA 3A01B 3KZZA 2GLOA 2V1DA 1AOYA 2V4JC 2X0LA 2ZXWH 4ZDPA 3O8HA 2E2HJ 2X85A 4V2GA 2X48A 1U8BA 2G7UA 3E7LA 4Z2YA 3E3VA 4XLPF 3W6KB 2K3FA 3NWSA 1CF7A 4WXCA 3BCAA 5FD6A 3CCLI 3ZPLA 1TWAJ 2V9PA 3RYPA 3HOVJ 3WE3A 2WV0A 3DWLE 2DYRH 2OZUA 4AIHA 2IPQX 1GHCA 5EYRA 2M5WA 1Y8QB 3VYRB 1B8IB 1GLNA 3MD2A 2W7NA 3IWZA 5FKLA 1B72A 2VL8A 1FSEA 5EG0A 5J1UA 1OKRA 3OOPA 4UY8I 2VONA 1OLTA 3RCOA 2R5ZA 2VODA 4CUGA 2FRHA 2FXAA 2L7ZA 4JX5A 3PIOF 2XPUA 1TL8A 4FETA 3MWMA 3O6BB 2QYOA 4LD5A 2WTEA 2NS0A 2X6OA 5E79C 1LB2A 3GZNB 5HNHA 1Z9CA 2VKEA 3HPHA 2DK8A 3M7GA 3V7RA 2ZB9A 3HM5A 2JVHA 2ZXJA 2Y0SN 5HS9A 1ZG5A 1HW2A 2UZKA 4CHUA 3V4GA 3FK6A 1V54H 2W1OA 4DYRA 2HEOA 3RZDJ 1WZ2A 5F04A 4NQWA 1W36D 2F48A 3H36A 3QWLA 2IJLA 2E2JJ 1I5ZA 5DUIA 3IKVA 4UVAA 3FISA 2WAFA 3F6VA 1P6RA 2W25A 3E6CC 3D5LA 5L3DA 2O7OA 2Y69H 4KIFA 1YW9A 4KMUX 2W57A 3JSOA 2VKDA 4BUPA 2EB7A 1O3SA 1FOKA 2F5FA 3V8KA 1STZA 4UUTA 2NOGA 3ZRGA 3DCFA 2FEZA 2ESNA 4ENKA 3D0SA 3L7WA 1MDMA 1VQ9I 2ELJA 4I6ZA 4HG2A 4WXHA 2ECBA 4UXNA 4AVZA 2KIFA 3KFWX 2MLKA 2X6XA 5EF6A 1QZEA 5LEJA 3OYKA 2FUG2 2CS3A 2LREA 3I4PA 1Y8RB 5GP9A 1T39A 3HOWJ 2V1UA 3NWTA 2NVTJ 1GVDA 2MG4A 1XMXA 2KP6A 3C18A 3AG1H 1X58A 1BI1A 5ERIA 1R1TA 2M4GA 4CCMA 4PJJA 2X1CA 4GGGA 4M9ZA 1H8AC 4BDYA 3JRGA 5D4RA 4IRIA 4PJ0C 4PSWA 4ANJA 1TZLA 1FZPB 1RETA 2LK2A 3BR3A 4AM3A 3K4NA 4OOIA 4OAZA 1RR8C 3S3NA 4LK0F 2DYSH 4I01A 3KLNA 1GDTA 1DP3A 1I6HJ 4M72A 2E1CA 4JX6A 1Z21A 3JRIA 2NAZA 3Q9SA 4OMYA 5K5RA 4XQFA 5FKKA 2XB0X 4IL6C 2E7XA 2Y2ZA 1TNSA 4ETSA 1ZK8A 3ZR8X 3BR1A 2UV1A 5GPAA 2V9VA 4NC8A 4F92B 4O3MA 3CMYA 2FBKA 2ZKZA 1Y39A 1UFMA 1D1CA 2LNBA 4RGRA 3JRBA 3K2ZA 5JR3A 1QGPA 3W6VA 4FQGA 2KZVA 2EZKA 2JMWA 4R1HA 3CUQC 2ZJ2A 2DCEA 4M3GA 4XLHA 4S05A 2F5DA 4Q4ZF 2JPCA 5E3NA 1XSDA 4KIGA 2WBMA 2CUJA 1XMKA 2P5LC 2BV6A 2K02A 1V4RA 3LAPA 4D7NA 3FXJA 4O5VA 3CZ6A 2RQPA 1VQLI 4U88A 2ISZA 1IV6A 4LG0B 2D1HA 1ZG3A 1AKHA 1JKOC 2Z16A 3S1MJ 2ZMEB 3M4OJ 3ZMZA 1ETOA 4Q47A 3HTSB 1VNDA 2NVYJ 1J9IA 3ABTA 4AWXB 3SEQA 4RAZA 1A5JA 2ID6A 3KCCA 3CUQB 2MABA 3Q9VA 2IA0A 3WTWC 4IHXA 1WWXA 3OS2A 2DA3A 2CV1A 2HDDA 2VQCA 3LSMA 1ITYA 2HNHA 2RNJA 1O4XA 4BBSJ 5TISC 2HTJA 1R1UA 1V5EA 5DCMB 4AUXA 1RUOA 1S9HA 3QPHA 4IX7A 1FIPA 3I5UA 1F9NA 2ELHA 1IUFA 1G6NA 1Z7UA 1PUEE 1LJ9A 2LDUA 1V3FA 3ABKH 5ILVA 1IC8A 3GFLA 1KYZA 3BP8A 4RAFA 3K69A 2PMUA 3I9V2 1DQUA 5IY5H 3I58A 4WF2A 4J00A 4B3XA 2WB1N 1JE8A 4OWRB 4KJZA 3MKYB 3PO3J 2DXIA 4RS8A 1GV5A 1IGNA 1A6QA 2HOEA 2DOEA 2H94A 3DLAA 4BHPA 2M8GX 3ZQGA 4G7OF 1T38A 3K70C 2ESHA 5BMZA 3CLQA 1UG0A 2IGNA 1S29A 3HSFA 3FXLA 3ZOBA 3WTTC 1MMNA 2K9MA 2HKXA 3EPZA 3PNTA 1XDSA 1Z1DA 2L7KA 3LSHA 4XLNF 2XF7A 2BXZA 3WG7H 4Q48A 2LBFB 1JHHA 2C6YA 3IUOA 1ZTRA 2ZNZA 1E0EA 3W3CA 2RREA 3BR0A 1TNTA 2DU9A 5CPRB 3PL8A 3J7AO 4HZFA 2L2OA 1S5LC 2NVQJ 3DPLC 4PJNA 3TOAA 4XOPA 1EA3A 2A68F 3S1QJ 4PFPA 2RNGA 3IH3A 1XX5A 4JX4A 5JHUA 3OYNA 1YW8A 4IHSA 3RIRA 5EEHA 3S15J 2LD5A 1ETXA 2FX0A 3M9AA 3ZMTA 4CA0A 1WVRA 3HYIA 5IT9K 4Y7NJ 3BOQA 5E20A 1MSEC 5GTIC 1Y6IA 2OTLI 2F4IA 1VQNI 2EFQA 3H35A 2JN6A 5JLXA 2TDXA 3BZCA 3JRHA 1J59A 3OYDA 4BDZA 3GTJJ 2QQBA 4DBQA 1YJ9I 1AA7A 1YLFA 1ZR4A 1X1AA 1W5SA 4BBRJ 2VPLA 3CO7C 3HRSA 5H20A 3M3YJ 4UB8C 4HOBA 2FE3A 3V8JA 5GAHJ 1PDNC 3DBHB 1SD4A 2FOWA 1ZARA 2GWRA 5D6FA 4LGWA 2XAFA 1ZKGA 3GWZA 4F93B 5EEAA 1T0FA 1LE8A 3L2VA 3DP7A 1Z6TA 3KYDB 3DEEA 4UUSA 1ENHA 3HSEA 3P5JA 1R4NB 3RSNA 2BXYA 4BQAA 2FBIA 1APLC 4FTHA 4QWQA 4EM1A 1ZLJA 1S7OA 1D8JA 2PN6A 3M07A 3ZN0A 4UV8A 2Z5UA 4CYDA 4RGSA 3MZHA 1HCRA 4Q5SF 2IGKA 2E34A 3GTKJ 3L2RA 3KP7A 3J80K 1EJ9A 2LYCA 1IJWC 3SZTA 1BOBA 3OIPA 5J47A 2XPVA 4P55A 3FF5A 5ICCA 1WJFA 1SFXA 4YFNF 5DS9A 4KA4A 1HF0A 4XLFA 5CVJA 4IEJA 2BVLA 2ID3A 3NARA 2R7DA 2X51A 4PFOA 2HZDA 5DYMA 4E7KA 4BY1J 2CSOA 4U0YA 2EK5A 4U87A 4C3HJ 1KZHA 4MIMA 2Y30A 4QSHA 3GF2A 1B6AA 4ZDOA 4S0HB 3FMSA 2F5CA 1MZBA 1IN8A 2AQFA 2B7EA 2EZHA 2RV8A 3HHHA 5HVQC 4U7BA 3ZQIA 1VQ5I 2AHQA 1SMYF 4HAMA 4BHCA 4IQJA 3KP3A 4L5EA 1MMAA 2ZXHA 4Z6YA 4RLFA 1ZR2A 1RIOH 4ZZDA 2XC7A 3ABUA 2A6EF 4MTEA 1T6SA 4CH7A 4DQ2A 1R1VA 4B8XA 2AXTC 2E7WA 2IT0A 4TV7A 1X3UA 3S3OA 3PM1A 5LFAA 1ACIA 2JJ7A 1SANA 4HQEA 1QZZA 2DLLA 3WTUC 1WJBA 4EM2A 1FTZA 2K86A 4LB6B 2MA3A 3EYYA 2IS2A 5A2QK 2IXSA 2GZWA 2FF4A 4RMNA 3IRQA 4LLGF 3JTHA 1MNDA 2DMNA 3TW6A 2JRMA 3CESA 3M1CA 5LRRA 1NH3A 1IN5A 4L9VA 2FSWA 1O7FA 4LLNA 2WY8Q 3PUFA 2L01A 4W97A 3C2HA 3BZKA 3MN2A 4C3JJ 2QBYB 1XGNA 1OCRH 2LTPA 2ZJPF 1TBXA 4G94A 5IOZA 4B44A 3LWFA 3BG5A 2PJRA 3GTGJ 3ZN1A 3BR6A 4DOZA 1WJ5A 2IBDA 3KYCB 1FBQA 1XGOA 3FMRA 2CUEA 3MFKA 3C1DA 1IRZA 2XGCA 3K10A 1MMDA 3GO5A 3OYBA 4ZDLA 2XAGA 4LB5A 2Y0MA 1U9NA 5LBQA 1MMSA 3T5XA 2HOAA 3IH2A 3HB9A 1T95A 4MNUA 2MFZA 4D1QA 2VBYA 3CJRB 1WH7A 1BR4A 1YITI 4BXFA 5KVRA 3GTLJ 4V2FA 4BYYA 3DPUA 3K2AA 3LQQA 4KYWA 3GFJA 5FFXA 1UB9A 3VDXA 4P9UA 2XB5A 4E7JA 4YIIA 3REOA 1T08B 3DBRB 5KAFC 1W36C 4CCJA 2WWYA 2EIJH 4G6TB 1TQPA 2Z3YA 3PFIA 4K2EA 2RAEA 2PEXA 1R71A 2VC0A 2UUZA 3K4LA 3BY6A 3OYCA 3A2KA 1I27A 3ZMVA 2DA2A 4HYEA 5D5WB 1Z7LA 3VYUB 4EATA 1YJNI 5TRDA 3OIQA 2V6CA 5FLXK 2G7HA 2EPFA 3TDUC 1QVUA 3BJ6A 1WJEA 4EQQA 1OCPA 3ECOA 1JJ8C 5CVRA 4BJ6C 1YFHA 4PGHA 5HLTA 3EYIA 4BXUA 4YRVA 2H6CA 2DA4A 4YEJA 3K1NA 1F5TA 1WJCA 3KIOA 3E1SA 3OYAA 1VZ0A 5JVGF 4CYCA 3WU2C 2R7VA 1TT5B 1JUMA 3FK7A 4HBLA 2CFOA 2Y48A 2P0WA 1XS9A 2DJIA 2DTZA 3DF8A 3ABLH 3HKZN 2STWA 4WWCA 1U5TA 4Y33A 1N25A 3LSRA 1IZ1A 1I6XA 3HG9A 4XR6A 5LGNA 2GQQA 2ZFUA 2DFFA 5B3SH 1OFCX 3CCJI 1SVMA 3LSKA 3WHBA 5FGMA 5LEKA 1NK2P 1E17A 4WK8F 3B73A 4A3MJ 5LGUA 1EKEA 1KYWA 1K4TA 1MJBA 4UNOA 4JQFA 4HSTA 4JOMA 3RQIA 2OJED 1FOXA 3RYRA 1HC8A 4R8HA 1R5HA 2R5YB 2FQ3A 1HKTA 4A3JJ 1ZYRF 4YFXF 5TGTA 5D5VB 1OCOH 4DW6A 1WI3A 1IDZA 2DFEA 2K85A 4C2TA 2W00A 2DMUA 4OIPF 2R7WA 2OAZA 2JA5J 2WC2A 5AIQA 5GAEJ 4MEYF 3S2WA 2VKVA 4M3DA 1ZHFA 4ZYGA 1TC3C 1P4AA 1HW1A 1UHSA 2K9QA 5J4VA 1GXPA 2NNYA 2MGQA 2R92J 1HSTA 3GUDA 3I71A 2MH2A 1T2KA 4CICA 2ADUA 4XK4A 2VQLA 4AC0A 4FASD 4HDUA 1Q1HA 1E3OC 1A04A 3C2BA 4FT8A 4A12A 2VBZA 2H6BA 2VXZA 4BEHB 3VB2A 4A93J 2QKLB 1A35A 4GFBA 1I50J 5ICFA 5EJCA 5K1YA 1R23A 2CV0A 3FBIB 2Z9OA 3G2BA 2KJCA 1PP7U 1YHQI 1SC7A 3TL4X 2K9NA 2E19A 3DQVC 4RLQA 2M4KA 4RB1A 1HKSA 4IXAA 4B3AA 1SAUA 3U1KA 2DT7B 2EZIA 4ASNA 4BJTA 4C9YA 1VTNC 5KK1A 3TP0A 4A0XA 5LRSA 5D4SA 1EV7A 2X9DA 4DZJA 4M9SA 4A3DJ 4XSXF 2HVSA 3K4BA 3UR3C 3TO7A 1I1SA 2EFWA 1B8IA 3LAJA 4HF2A 2PMZA 3S16J 1MNEA 3LA3A 3EETA 5JFRA 2TRTA 2KHMA 3J81Z 4PJLA 5IOYA 3CCRI 1R5GA 3L2WA 4XRMA 3ERMA 4ITVA 5M3MJ 1UJ8A 4BQOA 5DV5A 2O8KA 2R4GA 2A05A 1YRNB 4A3FJ 1ON1A 2L9NA 3GTOJ 4HW0A 4NHJA 3HGGA 1HSJA 1ERDA 4PUSA 3PNVA 2BEOA 3ABMH 1AU7A 4D0PA 1Z0XA 2XKOA 5B5EC 3G4SI 1B9MA 5M5WJ 3F8MA 1WCMJ 2ETHA 4A0ZA 4AYBN 1IW7F 2L3DA 4P5OA 4E7ZA 2BY2A 1SEUA 4MEXF 3N05A 1ZRDA 4ABZA 4IHVA 5CVUA 3JCUC 2L0KA 2LKSA 4HV5A 1CGPA 3OYEA 3JSPA 3F0CA 2OQGA 3SHFA 2LG4A 3CP8A 4ZZLA 1E3HA 1P4XA 2M0MA 1F43A 3RJPA 4DBRA 2QVOA 1QO0D 1YYVA 3MAJA 4I99C 2M30A 4BE1A 2P7VB 1BR2A 1O7LA 3A1YA 4CXFA 1I3AA 2VOOA 2F6CA 2R93J 1DPUA 2UXXA 4MLOA 5DUKA 1X1PA 3SQNA 1ETKA 3RDIA 5FKNA 2ICWG 1HBXG 4EMSA 4XIDA 5DD4A 4XKWA 4I0AA 5BOXA 2BHYA 3S14J 4BKXA 1S6LA 3I64A 5JLWA 4Y17A 1ZH5A 3BZ6A 2IS4A 1CF7B 1WJDA 1IN6A 4AD9A 4HA8A 2Q0OA 1RKWA 3H5NA 1ETYA 3H5RA 3Q0UA 5EGOB 3R61A 1OJLA 2XROA 3X2QH 2E5NA 3HUGA 3CUOA 2DK5A 3A0HC 1HXDA 3K4KA 2EFNA 2I8DA 2QQAA 4IRGA 1BIAA 1FNNA 3KP6A 3LSJA 1JT6A 2HQAA 1SFOJ 3ULQB 3NEUA 5DD8A 3K1MA 1U9OA 4EV0A 3ERED 1W7PD 1R6RA 2R7FA 2HQRA 5B1BH 2V6EA 3SZPA 4FISA 3T8RA 2HI3A 2XVCA 1Z6RA 1FMWA 3ZMUA 2I5UA 2MBFA 2BY1A 1DGRM 3DEWA 5D5UB 3H9QA 1R5ID 5FROA 3JAMZ 4NQWB 3HRTA 3FX3A 3E97A 3H9JA 3I56I 2HWVA 4DGWB 3QYBA 2ECCA 3DTKA 3R60A 4BACA 2GA2A 1X4OA 2WAQA 3HHGA 4BY7J 3MQ0A 3D5RC 3L2UA 2Z33A 2NVUB 1JUPA 1MH3A 1G2HA 4YIFA 3LOCA 3ZQFA 4EVIA 1R4MB 3HBLA 1IV8A 2O5RA 4L18B 1G3WA 1RPWA 1L3LA 2ZMEA 4UB6C 4BNCA 5CKTA 4HX7A 2CYYA 3LSGA 1VQMI 3TEDA 3R0JA 3CUQA 2KZGA 4HX4A 4BE0A 2BVMA 3LA2A 4QIWN 4E7HA 2KIQA 3SJMA 1H0MA 1R9TJ 5L3BA 2EQRA 1R7JA 1LDKB 5DCMA 2DA1A 3SYTA 2DDBA 1R49A 1X2MA 3C2GA 4HF0A 4BAYA 4H0EA 1AHDP 4KN4X 1WJAA 1PP8F 4L9JA 2V7FA 5E3LA 5BQTA 5AONA 3T0YA 1HOMA 1P7IA 4RB3C 5E1ZB 2EBIA 3BC8A 4C3IJ 1GVJA 2L4AA 4P9FA 4EJUA 4G7HF 2X4HA 3CC7I 2M7BA 3GBGA 4HEA2 3V7CA 4I7HA 4U0VA 1OCZH 2Z2SB 1EH8A 5J4YA 4EEFG 1FC3A 1LDDA 4XRSA 4ENJA 4NNJA 1XCBA 1Z05A 4MO7A 4KFCA 2O3FA 1TT0A 5E8IA 1W4MA 3BPVA 1X4PA 5C3EJ 3KZIC 3N4MA 4IHWA 1A6IA 2OZ6A 2GIZA 2LBFA 3RKWA 3W6JB 4HRIA 1KU9A 4ON0A 1LVKA 3K4JA 3QOEA 4B4CA 4OAYA 2M1BA 2DJNA 3DV8A 3QAHA 5L3GA 1H9TA 1QA6A 2RC4A 2XRLA 2ZBKA 1P92A 1RZ4A 4LLLA 4CGZA 2PJPA 5F1RA 4MGRA 5F0CA 5F64A 4A6EA 4B48A 2FQ4A 5J8FA 4NC7A 5K7FA 1H89C 5CVVA 2BY0A 2KJBA 4RB0A 4G7ZF 3E5QA 1OPCA 3HOXJ 4ESJA 1IN7A 2JUGA 1RRJA 2XAQA 4HNUA 3GZ5A 2IAIA 3E6DA 3QODA 4IOCF 4ZYDA 2DBBA 2VT2A 2ZSIB 3KEOA 2ISYA 1BW5A 3FWEA 4DJAA 2DOFA 3AG2H 1LKXA 4BH9A 2KPMA 4HLYA 1GT0C 2QM3A 5DM6F 4B47A 3GYHX 2DPDA 4BS9A 2IS1A 1HKQA 1KU2A 1MH4A 2COMA 3KEQA 4XONA 2H1LA 4L9TA 3KEYA 2MLGA 2VT3A 3MCZA 2OCCH 1K61A 1LFBA 3DU5A 2OA4A 2O61A 3FKJA 4CDGA 3FXKA 3ELKA 1RR7A 1TWHJ 3I59B 3PFYA 2JVGA 2A61A 3DTIA 3HRUA 3TW7A 1IG7A 4Y15A 4HNTA 2MYSA 2STTA 4A3IJ 2L9SA 2CO5A 4EJVA 3OYFA 3KE2A 4A2UA 1RI7A 3ASOH 9ANTA 4IVNA 2QSFX 3CD6I 4L5IA 2HYFA 2P8TA 4OMZA 3G73A 4XNFA 1T56A 3O3KA 2GIVA 4FX0A 3SZGA 3VOEA 1JGSA 5L3EA 1MKMA 4ZJZA 2W85A 3F72A 3PIPF 4HDVA 2QKMB 1D0ZA 4RBOA 2KDZA 3H3ZA 3ECHA 3H1CA 1O3RA 3VWBA 5HDGA 1JJ6C 4NBQA 1J09A 1SD7A 4XRSG 1PUFB 2VPRA 2NOJB 2P6TA 3D1NI 4KUMA 1IRGA 1G8XA 5IP7J 3HSRA 4FHTA 2JSPA 2EV6A 1BBYA 1IRXA 1WPKA 2HOSA 2M3AA 2K9SA 4D9JA 1XSXA 1FWZA 3QOPA 3G3ZA 2FMYA 3DFGA 2O0YA 1FYKA 1H9GA 3WGIA 1X19A 1NG7A 3W2VA 3TKYA 1D3YA 2YU3A 3F8BA 1XDUA 4RGXA 2CU7A 4PZJA 4BU2A 2ACJA 5F0FA 3ROUA 2WB1A 2R7XA 3OV8A 1SVLA 2A5WA 2GAUA 5FJ8J 4HF1A 2QQ9A 1BJZA 2A07F 1RESA 2R7QA 1YO5C 3R6SA 4E7SA 4E7LA 1FY7A 2QGUA 4HPQA 4NB5A 4C2UA 3LQRA 1U0JA 1N78A 3IV5A 4X0GA 2BY3A 5IP9J 3VSKA 4S04A 3I55I 4PJMA 3VYTB 1YX3A 3H5AA 4WXDA 2QBYA 3EUHA 4M6YA 4IHTA 3OYIA 1EF4A 3BWGA 4B1RA 3L9FA 1OCCH 4ZTFA 3FXMA 2QA4I 2CQQA 3WTZA 1FLIA 3J7YJ 2JUCA 1D1BA 2E71A 3OYMA 1U3EM 2EIKH 5C4JJ 4J19A 2XSJC 2VUMJ 2X6WA 4RM3A 4M3BA 2BOLA 3H0GJ 1BL0A 3HEFA 2LLKA 2R7SA 3WGGA 2Y9ZA 3F3XA 1JT0A 5M5XJ 3BG3A 4MQVA 5ILUA 1Z3XA 2PMHA 1QRYA 2H09A 3MKZA 4R79A 3HL2A 1QU3A 3J7ZI 5JVTA 2IP2A 2K4JA 1BM9A 4OIRF 3LSIA 4HQMA 4LMYA 4O6JA 3DKYA 1ON2A 4D5FA 2V1NA 2GBYA 2PG4A 5A2QZ 3CMMA 2E60A 1NG6A 3Q0WA 4OU0A 2Q2EB 4XBFA 1JKPC 5AIPA 1W5TA 2XAJA 2OCEA 3LFKA 3CCUI 3DTEA 3OYGA 2JT1A 3CDHA 3E0JB 2EH3A 1OISA 3CF5F 5FO5A 2VKHA 4B43A 1YW7A 4AIJA 5DDGA 4KISA 2CRGA 2IW5A 2VE8A 5J8CA 4Y3OA 4Y13A 1G59A 2UXNA 1IXCA 1G3YA 1JGGA 3OYLA 1GXQA 2HYGD 2EINH 4L0ZB 1SD6A 5JI6A 1PVEA 4XLCA 1ODDA 3K1PA 1UHWA 3HOTA 2GM4A 2KRFA 2IA2A 1P4WA 4BJ5C 5K5OA 1HLVA 4PCQA 2PFBA 5BS6A 1FPQA 3S32A 1KQ8A 5IYCJ 2DW4A 2QUFA 5ICGA 3C3WA 1WQ2A 3FHNA 2LKPA 5F1JA 1Q1VA 1BR1A 3MVPA 1FOYA 5F27A 2XGXA 1BIBA 5FRNA 3BCBA 2NS8A 2XIGA 5E1XA 1VQPI 3S8PA 1FOWA 5ILSA 2NRAC 1BI3A 3WTXC 1IXSB 1OR7C 3TQNA 5IT3A 4IRHA 2J5OA 1REPC 2YUSA 1VQOI 4MQ9F 4NC6A 5FKMA 1OMIA 1JTXA 2DO7A 2YS9A 3A03A 1I1GA 2BW3B 1T8IA 3B6CA 1QHHD 3O2PE 1WH5A 5M5YJ 1MNMC 4DIQA 4L5JA 5L3FA 2RVCA 1D1AA 1Z3YA 3CCEI 2R5YA 1ZN2A 1TW3A 2I10A 3WODF 1ORKA 5KCMA 4XICA 2FD5A 5DCFA 4G6QA 2NS7A 3VEPA 2QLZA 1J7KA 5LLQA 2HGCA 2K7LA 5KAIC 4NDLA 4II2A 4ZH4F 1XCVA 2E35A 4IKFA 2VQHA 2D1VA 4PSXA 2KIUA 4EJWA 2BGCA 4XN0A 4H4KC 3RQ4A 1G3TA 1U5TC 1LUJB 4A6DA 2VQGA 3WG9A 4U7DA 1Z91A 2VASA 2ZXIA 4G6DA 5HLIA 3GX4X 2KRHA 4QPQA 2J5PA 4ENNA 2WY7Q 2WV1A 1W7PB 3MKLA 4KICA 3CC4I 3DPTA 3TP3A 3CJQB 4HV6A 4BQNA 2W24A 3BTJA 3EQLF 1G3SA 5CLSA 1O57A 3F9KA 2P5VA 4N9IA 3M8FA 2RGVA 1IDYA 3H0DA 4E4HA 2L02A 3LSTA 3ZP5A 2Y75A 2JSCA 3BTCA 3WU0A 1YS6A 1MJAA 3GMEA 4F52A 2GXGA 3ZCOA 3FXUA 3CF2A 2HVRA 4IQ4A 3ZQQA 4JYKA 1X3WB 2FNPA 2JA8J 4WCGA 1BN5A 3IAM2 3KZYA 3CO6C 3DKXA 1TWGJ 1XGMA 1HW5A 5D8KB 3SEZA 3IRRA 1JKRC 3JTGA 2NYXA 4GO1A 4XMYA 3W2AA 4AIDA 1F36A 3AKZA 1QHGA 3QPSA 4JBAA 5IP6A 3VYSB 3OMYA 3EDPA 4NUBA 1V5FA 3F8FA 5LD2C 4A3LJ 2ZNYA 2HTSA 2JA6J 4C2MJ 4YELA 1YE9A 3A01A 5D8LB 2RKHA 2ZCWA 5J3LA 1BC8C 2HU9A 3QRFF 1K6OA 4L9NA 1YRNA 5K7ZA 4JK1X 4M6VA 2VJ5A 1K78B 3QQAA 2JWTA 3HXLA 3RZOJ 4KITB 3SFZA 3QYEA 4OIQF 3BROA 4RAYA 1MSFC 2V1XA 3E6MA 4F3QA 1IAWA 4IO9F 5CQGA 2L5QA 2H27A 3DLLF 3ISPA 3J81K 3PQKA 3IWFA 3FXRA 1HA8A 1YOVB 4M73A 1BOAA 2MH9A 3DU6A 1W0TA 4EJOA 4Y4RA 5HDKA 2CW0F 3RKQA 2R7UA 3OR2C 1WGXA 3CCYA 2M0CA 3LA7A 3SXYA 3QU6A 3L2CA 1YI2I 3P9IA 1EH6A 1FP1D 1UELB 1BA5A 3WE2A 4N9HA 5L3CA 2CUZA 1VQKI 3AFHA 1F4KA 3S2DJ 3BG7A 2OD5A 4CCOA 3F8NA 1B9NA 4II3A 2O8XA 3HC7A 2CW8A 1YTYA 2RDPA 2WAQN 2GXBA 4P96A 1X1BA 3IP4B 2E1MC 3BT9A 3VFZA 2P81A 1S7AA 2XF5A 3H9GA 5D6EA 1TTYA 1MBGA 2DA7A 4PDKA 4IF4A 4FX4A 1LQ1A 3RPQA 3MZYA 1RNLA 1DP7P 2HKOA 4LIUA 3BJOA 4BGDA 4J01A 2X6YA 1EH7A 2DOAA 5C4XJ 1L0OC 2PQ8A 3KLOA 3AAFA 2M2EA 5EGOA 1KQ9A 2XV4S 2DT5A 4A0YA 2LH9A 1M1EB 5ICEA 3UKGA 3OSFA 5EDNA 2FOKA 1MGTA 3OL4A 1A31A 2AO9A 2QWWA 1F1ZA 1NHAA 2VBWA 1X1CA 3S1RJ 2BZTA 5J6XA 3A02A 2E1MB 1P9QC 5E3OA 3PQJA 4ZYHA 3GFIA 2LKXA 4IOAF 2XRNA 3VSLA 1B59A 2FJ1A 4XRFA 2QENA 3L09A 3TMOA 5JHFA 5BPDA 2LSOA 1H88C 1U8RA 2LC2A 3FIWA 4DYQA 1NTCA 1O3QA 4X6AJ 3G6EI 1T98A 2P7CB 1B1BA 2GOXB 3CDLA 3DXJF 2KDOA 3BQZA 3E5XA 3ESWB 3OWTA 1AWCA 4G12A 3S93A 2CMPA 2M8EA 3JRFA 1DU6A 2L9RA 2LVSA 3MZ8A 3U9GA 1ZRCA 2CQXA 2VLAA 2EA4A 2Z1DA 1B72B 5FB2A 1NK3P 3R4KA 1LNWA 5EG0B 1ZGWA 5DM7F 3F23A 3T1BA 2R5ZB 2VOPA 3FKIJ 1XC5A 2TCTA 1J0RA 1ONVA 1VQ7I 3ZMSA 2F4OB 1D5VA 2LRDA 5E1WA 3CTAA 1ETWA 1XN7A 1OCTC 4FE4A 3ZQCA 4HX8A 2CGPA 4UUVA 5FFZA 3QPLA 1FIAA 1T33A 3LNQA 4GXOA 5BNGA 4F91B 3V42A 3BG9A 2Z99A 3JAMK 2LOOA 2MW8A 4KN7X 2DQLA 2R0QC 4RGUA 3FXQA 5IPAA 1JKQC 5IYDJ 2YU9J 2O6GE 1IRFA 1FYLA 2QZ8A 4A3KJ 1KQ0A 3FMQA 2YSRA 1IXRC 5LHGA 3CMAI 3QP6A 3H92A 1JTYA 3GW2A 4RDUA 3WTSC 1BC7C 3HOUJ 2IGMA 2XAUA 1Y0NA 3S17J 2L9VA 2Y31A 2R3SA 4IPAA 3HDDA 4LG0A 3K4CA 2XKPA
chains in the Genus database with same CATH topology
1MDMB 2P4WA 5F6FA 6PAXA 3JW4A 1USSA 2EJRA 3F6OA 1MD0A 2YX4A 2OU2A 1FT9A 1U2WA 2IA1A 3NRVA 1XMAA 3BPXA 3KP4A 1ZGAA 2LF8A 1SMTA 3F21A 3VODA 2HR3A 4UVBA 2AXLA 2XUBA 2JZYA 3GZ6A 1KU7A 2FMLA 3P9CA 2JPBA 3IHUA 2IRFG 3QPTA 3C7JA 2A5YB 4KDPA 3MEXA 4L0YB 4HLXA 2YR2A 2CFXA 1U78A 1OYYA 3GFMA 1QQIA 2DPUA 3IL2A 1IN4A 1TW2A 2XASA 3U1DA 1R36A 1QNTA 4M74A 3FZVA 1YQAA 2D2WA 2E1NA 1J5YA 3COAC 4LFUA 1SFEA 2EV5A 1FBSA 1MJ9A 3ZQ7A 1BI0A 1B4AA 2JRTA 1ULYA 3FHZA 3I59A 2XHKA 1FP2A 2VBXA 2L4MA 4M6XA 1LEBA 1QZYA 2YPRA 4ESFA 2AS5F 4KMFA 2OQRA 5EEGA 2DQRA 2P5KA 2HDCA 5E8GA 1LEAA 2VE9A 2EFPA 1XSVA 2XAHA 3CJNA 3BDDA 3TGNA 4QLCU 2K4BA 2L54A 1TQMA 3KETA 2KIMA 5HS7A 3HOSA 2CG4A 3H3UA 5IT9Z 4EM0B 1ZLKA 1S8NA 2ZO4A 1C0WA 4MHGA 2PI0A 4ZYEA 1XB4A 1BI2A 2HFHA 2VC1A 5FD5A 2RN7A 1KU3A 4ENMA 5H6QA 2F2EA 3RPUA 1OYIA 4YG2F 1ZAOA 3M8EA 3KP2A 4XSZF 4CO8A 2KKOA 3V7SA 2NNNA 3FM5A 1LVAA 4GYGA 4DNCA 4GCVA 3TDZC 3I53A 3QU3A 3IKTA 1YG2A 2B0LA 4I0BA 4KNYA 3GEZA 1K79A 4MTDA 3RKXA 3J80Z 5TJJA 3DKWA 1ZGJA 4YFKF 3P9KA 2M45A 1QBJA 5H6RA 4B09A 1G4DA 1BJAA 4KT5C 4LK1F 3E6BA 1E2XA 2DI3A 2GA1A 4G8XA 4EGZA 2Q2EA 4OINF 1LDJA 2EWNA 2FA5A 1UCRA 1R00A 3ML6A 3E5UA 3WGHA 3GLXA 1Y0UA 2EV0A 3U2RA 4RB2C 1SAXA 3F8CA 5LHIA 2FNAA 3KP5A 1XD7A 2BE5F 2FBHA 1IUYA 2YX7A 1DDNA 1XGSA 4KIBA 2F5EA 3FM3A 1IF1A 1TLHB 1WI9A 2CWEA 1J2XA 2IVMA 2JTVA 4UV9A 1JHFA 2PBIA 1FX7A 4CZZA 5DEQA 4M71A 5LHHA 1K7AA 1R58A 4IJAA 1YS7A 2ZFWA 2V79A 3WU1B 5LGTA 3RI4A 1JXSA 3HIFA 1O3TA 1WKMA 2CQKA 4UVCA 4A5MA 3TO9A 3F22A 1DUXC 1HQCA 3DEUA 3RKYA 4I98B 1ZRFA 2OBPA 2K27A 1R22A 2DTRA 1D8KA 2A6HF 2LF7A 2BBYA 2Q8KA 2EFOA 1U6GA 5CVIA 1OR7A 3RTRA 3TOBA 4LJZF 2G9WA 3V8LA 1W7PA 5D5XB 4N0BA 3K0LA 5FLXZ 2EA2A 4F7ZA 4M9XA 4GYIA 4I02A 3I0TA 3T8TA 3HRMA 3P7NA 1WSUA 3CLOA 1SFUA 2P6SA 4WX9A 1UHMA 3GXOA 4I2OA 3BJAA 5HOOA 3I54A 1S3JA 3L00A 4EJTA 2BYVE 4E70A 5CJ9A 2D45A 2MC3A 5E17F 4I09A 2O03A 4U0WA 2MD5A 5ED4A 3ZMDA 5HDNA 2DAOA 5E18F 3NQOA 5HS8A 2A69F 3WTVC 1ZREA 2W84A 1K78A 5K5QA 1U5TB 1RUNA 1YIOA 2FU4A 4ESBA 3R0AA 1FYMA 2DFIA 1J75A 2HQNA 1USTA 1SD5A 3K9TA 1WRJA 3QP5A 4G9YA 1OYWA 4AIKA 1KA8A 2VN2A 1DPRA 4EGYA 4OIOF 5CYVA 3TO6A 4A5NA 1P2FA 1FBUA 5HLGA 2PLYA 2HZTA 5BPIA 3M1EA 3HTUA 4PGGA 1KGSA 1QPMA 4BHBA 3N97A 2M87A 3GVAA 3IC7A 4UHTA 5HLHA 1FSHA 4AVPA 2A3SA 3Q5FA 2HS5A 3B02A 1TQIA 1ZG1A 3WTYC 2UWMA 3KZZA 2V1DA 1AOYA 2X0LA 2G7UA 4Z2YA 3E3VA 4XLPF 3W6KB 1CF7A 4WXCA 5FD6A 3ZPLA 3RYPA 3WE3A 2WV0A 2OZUA 4AIHA 2IPQX 1GHCA 2M5WA 3IWZA 1FSEA 1OKRA 3OOPA 2VONA 2VODA 2FRHA 2FXAA 3MWMA 3O6BB 2QYOA 4LD5A 2WTEA 2NS0A 1LB2A 1Z9CA 3M7GA 2DK8A 3V7RA 5HS9A 2ZXJA 1ZG5A 1HW2A 2UZKA 4CHUA 3V4GA 2HEOA 4NQWA 2IJLA 1I5ZA 5DUIA 3IKVA 4UVAA 3F6VA 1P6RA 2W25A 3E6CC 3D5LA 5L3DA 4KIFA 1YW9A 4KMUX 2W57A 3JSOA 1O3SA 1FOKA 2EB7A 2F5FA 3V8KA 1STZA 2FEZA 2ESNA 4ENKA 3D0SA 3L7WA 1MDMA 4WXHA 4UXNA 2KIFA 3KFWX 2MLKA 5LEJA 3I4PA 1T39A 2V1UA 3C18A 5ERIA 1BI1A 1R1TA 4GGGA 4M9ZA 5D4RA 4IRIA 1FZPB 4OOIA 4LK0F 4I01A 3KLNA 4M72A 2E1CA 2NAZA 3Q9SA 4OMYA 5K5RA 2E7XA 1TNSA 4ETSA 2V9VA 4O3MA 2FBKA 2ZKZA 1UFMA 2LNBA 4RGRA 3K2ZA 5JR3A 1QGPA 4R1HA 3CUQC 2ZJ2A 4S05A 2F5DA 4Q4ZF 2JPCA 1XSDA 4KIGA 1XMKA 2P5LC 2BV6A 2K02A 1V4RA 3LAPA 4O5VA 2RQPA 4U88A 2ISZA 4LG0B 2D1HA 1ZG3A 2ZMEB 3ZMZA 4Q47A 3HTSB 1J9IA 3ABTA 4AWXB 4RAZA 3KCCA 3CUQB 3WTWC 3Q9VA 2IA0A 1WWXA 2RNJA 2HTJA 1R1UA 5DCMB 1RUOA 3QPHA 3I5UA 1F9NA 2ELHA 1G6NA 1Z7UA 1PUEE 1LJ9A 2LDUA 1V3FA 5ILVA 3GFLA 1KYZA 3BP8A 3K69A 2PMUA 3I58A 4WF2A 1JE8A 4RS8A 2HOEA 2H94A 4BHPA 4G7OF 1T38A 5BMZA 2ESHA 1S29A 3HSFA 3WTTC 2HKXA 1XDSA 1Z1DA 4XLNF 4Q48A 1JHHA 2C6YA 2ZNZA 1TNTA 2DU9A 3J7AO 4HZFA 3DPLC 3TOAA 2A68F 5JHUA 1YW8A 4IHSA 3RIRA 5EEHA 3M9AA 5IT9K 3ZMTA 3HYIA 3BOQA 5E20A 2EFQA 2TDXA 1J59A 2QQBA 1YLFA 1W5SA 3CO7C 3HRSA 5H20A 4HOBA 2FE3A 3V8JA 1PDNC 1SD4A 1ZARA 2GWRA 5D6FA 4LGWA 2XAFA 3GWZA 1T0FA 3DP7A 1Z6TA 3HSEA 4BQAA 2FBIA 4QWQA 4EM1A 1ZLJA 1S7OA 1D8JA 2PN6A 3ZN0A 4UV8A 2Z5UA 4CYDA 4RGSA 3MZHA 4Q5SF 3KP7A 3J80K 3SZTA 4P55A 3FF5A 5ICCA 1SFXA 4YFNF 4KA4A 5CVJA 2R7DA 5DYMA 2CSOA 4U0YA 2EK5A 3GF2A 1B6AA 3FMSA 2F5CA 1MZBA 1IN8A 2RV8A 3HHHA 5HVQC 4U7BA 1SMYF 4HAMA 4BHCA 3KP3A 1RIOH 4ZZDA 3ABUA 2A6EF 4MTEA 1T6SA 4DQ2A 1R1VA 4B8XA 2E7WA 2IT0A 4TV7A 1X3UA 4HQEA 1QZZA 2DLLA 3WTUC 4EM2A 2K86A 4LB6B 2MA3A 3EYYA 5A2QK 2GZWA 2FF4A 3IRQA 4LLGF 3JTHA 5LRRA 1IN5A 4L9VA 2FSWA 1O7FA 4LLNA 2L01A 2QBYB 1XGNA 1TBXA 4G94A 3LWFA 3ZN1A 1FBQA 1XGOA 3FMRA 3MFKA 3C1DA 3GO5A 2XAGA 4LB5A 2Y0MA 5LBQA 3T5XA 4MNUA 2VBYA 5KVRA 4BYYA 3LQQA 4KYWA 3GFJA 5FFXA 1UB9A 4P9UA 4YIIA 3REOA 2WWYA 1TQPA 2Z3YA 3PFIA 4K2EA 2PEXA 2VC0A 3BY6A 1I27A 3ZMVA 4HYEA 5D5WB 5TRDA 2V6CA 5FLXK 2G7HA 3TDUC 3BJ6A 4EQQA 3ECOA 5CVRA 1YFHA 4PGHA 3EYIA 4BXUA 2H6CA 3K1NA 1F5TA 4HBLA 2Y48A 3DF8A 2STWA 4WWCA 1U5TA 1IZ1A 1I6XA 5LGNA 2GQQA 5FGMA 5LEKA 1E17A 4WK8F 3B73A 5LGUA 1KYWA 1MJBA 4UNOA 4JQFA 3RYRA 4R8HA 1R5HA 2FQ3A 1HKTA 1ZYRF 4YFXF 5D5VB 4OIPF 2OAZA 2WC2A 5AIQA 4MEYF 3S2WA 1ZHFA 4ZYGA 1P4AA 1HW1A 1GXPA 2NNYA 1HSTA 3GUDA 3I71A 2MH2A 1T2KA 4CICA 2ADUA 4HDUA 1Q1HA 1A04A 4FT8A 4A12A 2VBZA 2H6BA 2VXZA 3VB2A 5ICFA 5K1YA 1R23A 2Z9OA 2KJCA 1PP7U 3DQVC 4RB1A 1HKSA 4IXAA 4ASNA 1VTNC 5KK1A 4A0XA 5LRSA 5D4SA 1EV7A 4M9SA 4XSXF 3TO7A 1I1SA 2EFWA 3LAJA 4HF2A 3LA3A 3EETA 5JFRA 3J81Z 1R5GA 5DV5A 1ON1A 4HW0A 4NHJA 1HSJA 2BEOA 4D0PA 2XKOA 1B9MA 3F8MA 2ETHA 4A0ZA 1IW7F 2L3DA 4P5OA 4MEXF 1ZRDA 5CVUA 4HV5A 1CGPA 3JSPA 2OQGA 3SHFA 4ZZLA 1P4XA 3RJPA 2QVOA 1QO0D 1YYVA 3MAJA 2M30A 2P7VB 1O7LA 4CXFA 2VOOA 1DPUA 2UXXA 5DUKA 3SQNA 3RDIA 1HBXG 4EMSA 5DD4A 4I0AA 5BOXA 1S6LA 3I64A 1ZH5A 4Y17A 3BZ6A 1CF7B 1IN6A 4AD9A 4HA8A 2Q0OA 3R61A 2XROA 3HUGA 3CUOA 2DK5A 1HXDA 2EFNA 2QQAA 4IRGA 1BIAA 1FNNA 3KP6A 3ULQB 3NEUA 5DD8A 3K1MA 4EV0A 3ERED 1W7PD 2R7FA 2HQRA 3SZPA 3T8RA 2XVCA 1Z6RA 3ZMUA 2MBFA 5D5UB 3JAMZ 3HRTA 3FX3A 3E97A 2HWVA 3R60A 2GA2A 3HHGA 3MQ0A 2Z33A 4YIFA 4EVIA 4L18B 1G3WA 1L3LA 2ZMEA 4BNCA 4HX7A 2CYYA 3R0JA 3CUQA 4HX4A 3LA2A 1H0MA 5L3BA 1R7JA 1LDKB 5DCMA 4HF0A 4BAYA 4H0EA 4KN4X 1PP8F 4L9JA 5BQTA 5AONA 3T0YA 4RB3C 5E1ZB 1GVJA 2L4AA 4G7HF 4P9FA 4EJUA 2X4HA 3V7CA 4I7HA 4U0VA 1EH8A 1FC3A 1LDDA 4ENJA 1XCBA 1Z05A 4KFCA 2O3FA 5E8IA 1W4MA 3BPVA 3N4MA 2OZ6A 3RKWA 3W6JB 1KU9A 4ON0A 2M1BA 3DV8A 3QAHA 5L3GA 1H9TA 2RC4A 2ZBKA 1P92A 1RZ4A 4LLLA 4CGZA 2PJPA 5F1RA 4MGRA 5F64A 4A6EA 5J8FA 5CVVA 2KJBA 4RB0A 4G7ZF 3E5QA 1OPCA 4ESJA 1IN7A 2XAQA 3GZ5A 3E6DA 4ZYDA 2DBBA 2VT2A 3KEOA 2ISYA 3FWEA 4BH9A 4HLYA 2QM3A 3GYHX 2DPDA 1HKQA 1KU2A 2COMA 3KEQA 4L9TA 2MLGA 2VT3A 3MCZA 2OA4A 2O61A 4CDGA 3ELKA 3I59B 2A61A 3HRUA 4Y15A 2STTA 2CO5A 4EJVA 3KE2A 4A2UA 1RI7A 4IVNA 4L5IA 2HYFA 2P8TA 4OMZA 3G73A 3O3KA 2GIVA 4FX0A 3VOEA 1JGSA 5L3EA 1MKMA 2W85A 3F72A 4HDVA 3H3ZA 3ECHA 1O3RA 5HDGA 1SD7A 2P6TA 4KUMA 1IRGA 3HSRA 4FHTA 2EV6A 1BBYA 1XSXA 1FWZA 3QOPA 3G3ZA 2FMYA 3DFGA 2O0YA 1FYKA 1H9GA 3WGIA 3TKYA 1D3YA 2YU3A 3F8BA 1XDUA 4RGXA 4PZJA 2ACJA 3ROUA 3OV8A 2GAUA 4HF1A 2QQ9A 2A07F 1YO5C 3R6SA 1FY7A 4NB5A 3LQRA 4S04A 4WXDA 2QBYA 3EUHA 4M6YA 4IHTA 3BWGA 3L9FA 3WTZA 1FLIA 1U3EM 3WGGA 3F3XA 5ILUA 4MQVA 2PMHA 2H09A 4R79A 5JVTA 2IP2A 2K4JA 1BM9A 4OIRF 4HQMA 4LMYA 4O6JA 1ON2A 2PG4A 5A2QZ 4OU0A 4XBFA 5AIPA 1W5TA 2XAJA 3LFKA 2JT1A 3CDHA 5FO5A 1YW7A 4AIJA 5DDGA 2IW5A 2VE8A 5J8CA 4Y13A 2UXNA 1IXCA 1G3YA 1GXQA 2HYGD 4L0ZB 1SD6A 5JI6A 1ODDA 3K1PA 1UHWA 3HOTA 2KRFA 2IA2A 1P4WA 5K5OA 4PCQA 2PFBA 5BS6A 1FPQA 1KQ8A 2DW4A 2QUFA 5ICGA 3C3WA 1WQ2A 2LKPA 2XGXA 1BIBA 2XIGA 5E1XA 5ILSA 2NRAC 1BI3A 3WTXC 1IXSB 3TQNA 5IT3A 4IRHA 2J5OA 1REPC 4MQ9F 1OMIA 2DO7A 1I1GA 3O2PE 4L5JA 5L3FA 2RVCA 1ZN2A 1TW3A 3WODF 5DCFA 4G6QA 3VEPA 2QLZA 1J7KA 5LLQA 2HGCA 2K7LA 4ZH4F 1XCVA 2D1VA 2KIUA 4EJWA 2BGCA 1G3TA 1U5TC 4A6DA 3GX4X 3WG9A 4U7DA 1Z91A 4G6DA 5HLIA 2J5PA 4ENNA 4KICA 1W7PB 3DPTA 4HV6A 2W24A 3EQLF 1G3SA 5CLSA 1O57A 2P5VA 4N9IA 3M8FA 2RGVA 2L02A 3LSTA 3ZP5A 2Y75A 2JSCA 3WU0A 1YS6A 1MJAA 2GXGA 3FXUA 2FNPA 4WCGA 1BN5A 3CO6C 3KZYA 1XGMA 1HW5A 5D8KB 3IRRA 3JTGA 2NYXA 4GO1A 4JBAA 3EDPA 3F8FA 2ZNYA 2HTSA 5D8LB 2RKHA 2ZCWA 1BC8C 3QRFF 1K6OA 4L9NA 4JK1X 1K78B 3SFZA 4OIQF 3BROA 4RAYA 2V1XA 3E6MA 1IAWA 2H27A 3ISPA 3J81K 3PQKA 3IWFA 3FXRA 4M73A 1BOAA 2MH9A 4EJOA 5HDKA 2CW0F 3LA7A 3SXYA 3QU6A 3L2CA 3P9IA 1EH6A 1FP1D 3WE2A 4N9HA 5L3CA 1F4KA 2OD5A 3F8NA 1B9NA 2O8XA 1YTYA 2RDPA 2GXBA 4P96A 3VFZA 1S7AA 5D6EA 1TTYA 4PDKA 4IF4A 4FX4A 1LQ1A 3RPQA 3MZYA 1RNLA 1DP7P 2HKOA 3BJOA 1EH7A 1L0OC 2PQ8A 3KLOA 3AAFA 1KQ9A 2XV4S 2DT5A 4A0YA 5ICEA 2FOKA 1MGTA 2QWWA 1F1ZA 1NHAA 2VBWA 5J6XA 3GFIA 3PQJA 4ZYHA 2XRNA 1B59A 4XRFA 2QENA 3L09A 5BPDA 2LSOA 1U8RA 1O3QA 1T98A 2P7CB 1B1BA 3DXJF 3E5XA 1AWCA 2M8EA 3U9GA 1ZRCA 2EA4A 5FB2A 3R4KA 1LNWA 3F23A 3T1BA 2VOPA 1J0RA 1ONVA 3ZMSA 1D5VA 5E1WA 3CTAA 1XN7A 4HX8A 2CGPA 4UUVA 5FFZA 4GXOA 2Z99A 3JAMK 4KN7X 2DQLA 4RGUA 3FXQA 2O6GE 1IRFA 1FYLA 2QZ8A 1KQ0A 3FMQA 2YSRA 5LHGA 1IXRC 3QP6A 3H92A 3GW2A 3WTSC 1BC7C 2R3SA 4IPAA 4LG0A 2XKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDM B;  2P4W A;  5F6F A;  6PAX A;  3JW4 A;  1USS A;  2EJR A;  3F6O A;  1MD0 A;  2YX4 A;  2OU2 A;  1FT9 A;  1U2W A;  2IA1 A;  3NRV A;  1XMA A;  3BPX A;  3KP4 A;  1ZGA A;  2LF8 A;  1SMT A;  3F21 A;  3VOD A;  2HR3 A;  4UVB A;  2AXL A;  2XUB A;  2JZY A;  3GZ6 A;  1KU7 A;  2FML A;  3P9C A;  2JPB A;  3IHU A;  2IRF G;  3QPT A;  3C7J A;  2A5Y B;  4KDP A;  3MEX A;  4L0Y B;  4HLX A;  2YR2 A;  2CFX A;  1U78 A;  1OYY A;  3GFM A;  1QQI A;  2DPU A;  3IL2 A;  1IN4 A;  1TW2 A;  2XAS A;  3U1D A;  1R36 A;  1QNT A;  4M74 A;  3FZV A;  1YQA A;  2D2W A;  2E1N A;  1J5Y A;  3COA C;  4LFU A;  1SFE A;  2EV5 A;  1FBS A;  1MJ9 A;  3ZQ7 A;  1BI0 A;  1B4A A;  2JRT A;  1ULY A;  3FHZ A;  3I59 A;  2XHK A;  1FP2 A;  2VBX A;  2L4M A;  4M6X A;  1LEB A;  1QZY A;  2YPR A;  4ESF A;  2AS5 F;  4KMF A;  2OQR A;  5EEG A;  2DQR A;  2P5K A;  2HDC A;  5E8G A;  1LEA A;  2VE9 A;  2EFP A;  1XSV A;  2XAH A;  3CJN A;  3BDD A;  3TGN A;  4QLC U;  2K4B A;  2L54 A;  1TQM A;  3KET A;  2KIM A;  5HS7 A;  3HOS A;  2CG4 A;  3H3U A;  5IT9 Z;  4EM0 B;  1ZLK A;  1S8N A;  2ZO4 A;  1C0W A;  4MHG A;  2PI0 A;  4ZYE A;  1XB4 A;  1BI2 A;  2HFH A;  2VC1 A;  5FD5 A;  2RN7 A;  1KU3 A;  4ENM A;  5H6Q A;  2F2E A;  3RPU A;  1OYI A;  4YG2 F;  1ZAO A;  3M8E A;  3KP2 A;  4XSZ F;  4CO8 A;  2KKO A;  3V7S A;  2NNN A;  3FM5 A;  1LVA A;  4GYG A;  4DNC A;  4GCV A;  3TDZ C;  3I53 A;  3QU3 A;  3IKT A;  1YG2 A;  2B0L A;  4I0B A;  4KNY A;  3GEZ A;  1K79 A;  4MTD A;  3RKX A;  3J80 Z;  5TJJ A;  3DKW A;  1ZGJ A;  4YFK F;  3P9K A;  2M45 A;  1QBJ A;  5H6R A;  4B09 A;  1G4D A;  1BJA A;  4KT5 C;  4LK1 F;  3E6B A;  1E2X A;  2DI3 A;  2GA1 A;  4G8X A;  4EGZ A;  2Q2E A;  4OIN F;  1LDJ A;  2EWN A;  2FA5 A;  1UCR A;  1R00 A;  3ML6 A;  3E5U A;  3WGH A;  3GLX A;  1Y0U A;  2EV0 A;  3U2R A;  4RB2 C;  1SAX A;  3F8C A;  5LHI A;  2FNA A;  3KP5 A;  1XD7 A;  2BE5 F;  2FBH A;  1IUY A;  2YX7 A;  1DDN A;  1XGS A;  4KIB A;  2F5E A;  3FM3 A;  1IF1 A;  1TLH B;  1WI9 A;  2CWE A;  1J2X A;  2IVM A;  2JTV A;  4UV9 A;  1JHF A;  2PBI A;  1FX7 A;  4CZZ A;  5DEQ A;  4M71 A;  5LHH A;  1K7A A;  1R58 A;  4IJA A;  1YS7 A;  2ZFW A;  2V79 A;  3WU1 B;  5LGT A;  3RI4 A;  1JXS A;  3HIF A;  1O3T A;  1WKM A;  2CQK A;  4UVC A;  4A5M A;  3TO9 A;  3F22 A;  1DUX C;  1HQC A;  3DEU A;  3RKY A;  4I98 B;  1ZRF A;  2OBP A;  2K27 A;  1R22 A;  2DTR A;  1D8K A;  2A6H F;  2LF7 A;  2BBY A;  2Q8K A;  2EFO A;  1U6G A;  5CVI A;  1OR7 A;  3RTR A;  3TOB A;  4LJZ F;  2G9W A;  3V8L A;  1W7P A;  5D5X B;  4N0B A;  3K0L A;  5FLX Z;  2EA2 A;  4F7Z A;  4M9X A;  4GYI A;  4I02 A;  3I0T A;  3T8T A;  3HRM A;  3P7N A;  1WSU A;  3CLO A;  1SFU A;  2P6S A;  4WX9 A;  1UHM A;  3GXO A;  4I2O A;  3BJA A;  5HOO A;  3I54 A;  1S3J A;  3L00 A;  4EJT A;  2BYV E;  4E70 A;  5CJ9 A;  2D45 A;  2MC3 A;  5E17 F;  4I09 A;  2O03 A;  4U0W A;  2MD5 A;  5ED4 A;  3ZMD A;  5HDN A;  2DAO A;  5E18 F;  3NQO A;  5HS8 A;  2A69 F;  3WTV C;  1ZRE A;  2W84 A;  1K78 A;  5K5Q A;  1U5T B;  1RUN A;  1YIO A;  2FU4 A;  4ESB A;  3R0A A;  1FYM A;  2DFI A;  1J75 A;  2HQN A;  1UST A;  1SD5 A;  3K9T A;  1WRJ A;  3QP5 A;  4G9Y A;  1OYW A;  4AIK A;  1KA8 A;  2VN2 A;  1DPR A;  4EGY A;  4OIO F;  5CYV A;  3TO6 A;  4A5N A;  1P2F A;  1FBU A;  5HLG A;  2PLY A;  2HZT A;  5BPI A;  3M1E A;  3HTU A;  4PGG A;  1KGS A;  1QPM A;  4BHB A;  3N97 A;  2M87 A;  3GVA A;  3IC7 A;  4UHT A;  5HLH A;  1FSH A;  4AVP A;  2A3S A;  3Q5F A;  2HS5 A;  3B02 A;  1TQI A;  1ZG1 A;  3WTY C;  2UWM A;  3KZZ A;  2V1D A;  1AOY A;  2X0L A;  2G7U A;  4Z2Y A;  3E3V A;  4XLP F;  3W6K B;  1CF7 A;  4WXC A;  5FD6 A;  3ZPL A;  3RYP A;  3WE3 A;  2WV0 A;  2OZU A;  4AIH A;  2IPQ X;  1GHC A;  2M5W A;  3IWZ A;  1FSE A;  1OKR A;  3OOP A;  2VON A;  2VOD A;  2FRH A;  2FXA A;  3MWM A;  3O6B B;  2QYO A;  4LD5 A;  2WTE A;  2NS0 A;  1LB2 A;  1Z9C A;  3M7G A;  2DK8 A;  3V7R A;  5HS9 A;  2ZXJ A;  1ZG5 A;  1HW2 A;  2UZK A;  4CHU A;  3V4G A;  2HEO A;  4NQW A;  2IJL A;  1I5Z A;  5DUI A;  3IKV A;  4UVA A;  3F6V A;  1P6R A;  2W25 A;  3E6C C;  3D5L A;  5L3D A;  4KIF A;  1YW9 A;  4KMU X;  2W57 A;  3JSO A;  1O3S A;  1FOK A;  2EB7 A;  2F5F A;  3V8K A;  1STZ A;  2FEZ A;  2ESN A;  4ENK A;  3D0S A;  3L7W A;  1MDM A;  4WXH A;  4UXN A;  2KIF A;  3KFW X;  2MLK A;  5LEJ A;  3I4P A;  1T39 A;  2V1U A;  3C18 A;  5ERI A;  1BI1 A;  1R1T A;  4GGG A;  4M9Z A;  5D4R A;  4IRI A;  1FZP B;  4OOI A;  4LK0 F;  4I01 A;  3KLN A;  4M72 A;  2E1C A;  2NAZ A;  3Q9S A;  4OMY A;  5K5R A;  2E7X A;  1TNS A;  4ETS A;  2V9V A;  4O3M A;  2FBK A;  2ZKZ A;  1UFM A;  2LNB A;  4RGR A;  3K2Z A;  5JR3 A;  1QGP A;  4R1H A;  3CUQ C;  2ZJ2 A;  4S05 A;  2F5D A;  4Q4Z F;  2JPC A;  1XSD A;  4KIG A;  1XMK A;  2P5L C;  2BV6 A;  2K02 A;  1V4R A;  3LAP A;  4O5V A;  2RQP A;  4U88 A;  2ISZ A;  4LG0 B;  2D1H A;  1ZG3 A;  2ZME B;  3ZMZ A;  4Q47 A;  3HTS B;  1J9I A;  3ABT A;  4AWX B;  4RAZ A;  3KCC A;  3CUQ B;  3WTW C;  3Q9V A;  2IA0 A;  1WWX A;  2RNJ A;  2HTJ A;  1R1U A;  5DCM B;  1RUO A;  3QPH A;  3I5U A;  1F9N A;  2ELH A;  1G6N A;  1Z7U A;  1PUE E;  1LJ9 A;  2LDU A;  1V3F A;  5ILV A;  3GFL A;  1KYZ A;  3BP8 A;  3K69 A;  2PMU A;  3I58 A;  4WF2 A;  1JE8 A;  4RS8 A;  2HOE A;  2H94 A;  4BHP A;  4G7O F;  1T38 A;  5BMZ A;  2ESH A;  1S29 A;  3HSF A;  3WTT C;  2HKX A;  1XDS A;  1Z1D A;  4XLN F;  4Q48 A;  1JHH A;  2C6Y A;  2ZNZ A;  1TNT A;  2DU9 A;  3J7A O;  4HZF A;  3DPL C;  3TOA A;  2A68 F;  5JHU A;  1YW8 A;  4IHS A;  3RIR A;  5EEH A;  3M9A A;  5IT9 K;  3ZMT A;  3HYI A;  3BOQ A;  5E20 A;  2EFQ A;  2TDX A;  1J59 A;  2QQB A;  1YLF A;  1W5S A;  3CO7 C;  3HRS A;  5H20 A;  4HOB A;  2FE3 A;  3V8J A;  1PDN C;  1SD4 A;  1ZAR A;  2GWR A;  5D6F A;  4LGW A;  2XAF A;  3GWZ A;  1T0F A;  3DP7 A;  1Z6T A;  3HSE A;  4BQA A;  2FBI A;  4QWQ A;  4EM1 A;  1ZLJ A;  1S7O A;  1D8J A;  2PN6 A;  3ZN0 A;  4UV8 A;  2Z5U A;  4CYD A;  4RGS A;  3MZH A;  4Q5S F;  3KP7 A;  3J80 K;  3SZT A;  4P55 A;  3FF5 A;  5ICC A;  1SFX A;  4YFN F;  4KA4 A;  5CVJ A;  2R7D A;  5DYM A;  2CSO A;  4U0Y A;  2EK5 A;  3GF2 A;  1B6A A;  3FMS A;  2F5C A;  1MZB A;  1IN8 A;  2RV8 A;  3HHH A;  5HVQ C;  4U7B A;  1SMY F;  4HAM A;  4BHC A;  3KP3 A;  1RIO H;  4ZZD A;  3ABU A;  2A6E F;  4MTE A;  1T6S A;  4DQ2 A;  1R1V A;  4B8X A;  2E7W A;  2IT0 A;  4TV7 A;  1X3U A;  4HQE A;  1QZZ A;  2DLL A;  3WTU C;  4EM2 A;  2K86 A;  4LB6 B;  2MA3 A;  3EYY A;  5A2Q K;  2GZW A;  2FF4 A;  3IRQ A;  4LLG F;  3JTH A;  5LRR A;  1IN5 A;  4L9V A;  2FSW A;  1O7F A;  4LLN A;  2L01 A;  2QBY B;  1XGN A;  1TBX A;  4G94 A;  3LWF A;  3ZN1 A;  1FBQ A;  1XGO A;  3FMR A;  3MFK A;  3C1D A;  3GO5 A;  2XAG A;  4LB5 A;  2Y0M A;  5LBQ A;  3T5X A;  4MNU A;  2VBY A;  5KVR A;  4BYY A;  3LQQ A;  4KYW A;  3GFJ A;  5FFX A;  1UB9 A;  4P9U A;  4YII A;  3REO A;  2WWY A;  1TQP A;  2Z3Y A;  3PFI A;  4K2E A;  2PEX A;  2VC0 A;  3BY6 A;  1I27 A;  3ZMV A;  4HYE A;  5D5W B;  5TRD A;  2V6C A;  5FLX K;  2G7H A;  3TDU C;  3BJ6 A;  4EQQ A;  3ECO A;  5CVR A;  1YFH A;  4PGH A;  3EYI A;  4BXU A;  2H6C A;  3K1N A;  1F5T A;  4HBL A;  2Y48 A;  3DF8 A;  2STW A;  4WWC A;  1U5T A;  1IZ1 A;  1I6X A;  5LGN A;  2GQQ A;  5FGM A;  5LEK A;  1E17 A;  4WK8 F;  3B73 A;  5LGU A;  1KYW A;  1MJB A;  4UNO A;  4JQF A;  3RYR A;  4R8H A;  1R5H A;  2FQ3 A;  1HKT A;  1ZYR F;  4YFX F;  5D5V B;  4OIP F;  2OAZ A;  2WC2 A;  5AIQ A;  4MEY F;  3S2W A;  1ZHF A;  4ZYG A;  1P4A A;  1HW1 A;  1GXP A;  2NNY A;  1HST A;  3GUD A;  3I71 A;  2MH2 A;  1T2K A;  4CIC A;  2ADU A;  4HDU A;  1Q1H A;  1A04 A;  4FT8 A;  4A12 A;  2VBZ A;  2H6B A;  2VXZ A;  3VB2 A;  5ICF A;  5K1Y A;  1R23 A;  2Z9O A;  2KJC A;  1PP7 U;  3DQV C;  4RB1 A;  1HKS A;  4IXA A;  4ASN A;  1VTN C;  5KK1 A;  4A0X A;  5LRS A;  5D4S A;  1EV7 A;  4M9S A;  4XSX F;  3TO7 A;  1I1S A;  2EFW A;  3LAJ A;  4HF2 A;  3LA3 A;  3EET A;  5JFR A;  3J81 Z;  1R5G A;  5DV5 A;  1ON1 A;  4HW0 A;  4NHJ A;  1HSJ A;  2BEO A;  4D0P A;  2XKO A;  1B9M A;  3F8M A;  2ETH A;  4A0Z A;  1IW7 F;  2L3D A;  4P5O A;  4MEX F;  1ZRD A;  5CVU A;  4HV5 A;  1CGP A;  3JSP A;  2OQG A;  3SHF A;  4ZZL A;  1P4X A;  3RJP A;  2QVO A;  1QO0 D;  1YYV A;  3MAJ A;  2M30 A;  2P7V B;  1O7L A;  4CXF A;  2VOO A;  1DPU A;  2UXX A;  5DUK A;  3SQN A;  3RDI A;  1HBX G;  4EMS A;  5DD4 A;  4I0A A;  5BOX A;  1S6L A;  3I64 A;  1ZH5 A;  4Y17 A;  3BZ6 A;  1CF7 B;  1IN6 A;  4AD9 A;  4HA8 A;  2Q0O A;  3R61 A;  2XRO A;  3HUG A;  3CUO A;  2DK5 A;  1HXD A;  2EFN A;  2QQA A;  4IRG A;  1BIA A;  1FNN A;  3KP6 A;  3ULQ B;  3NEU A;  5DD8 A;  3K1M A;  4EV0 A;  3ERE D;  1W7P D;  2R7F A;  2HQR A;  3SZP A;  3T8R A;  2XVC A;  1Z6R A;  3ZMU A;  2MBF A;  5D5U B;  3JAM Z;  3HRT A;  3FX3 A;  3E97 A;  2HWV A;  3R60 A;  2GA2 A;  3HHG A;  3MQ0 A;  2Z33 A;  4YIF A;  4EVI A;  4L18 B;  1G3W A;  1L3L A;  2ZME A;  4BNC A;  4HX7 A;  2CYY A;  3R0J A;  3CUQ A;  4HX4 A;  3LA2 A;  1H0M A;  5L3B A;  1R7J A;  1LDK B;  5DCM A;  4HF0 A;  4BAY A;  4H0E A;  4KN4 X;  1PP8 F;  4L9J A;  5BQT A;  5AON A;  3T0Y A;  4RB3 C;  5E1Z B;  1GVJ A;  2L4A A;  4G7H F;  4P9F A;  4EJU A;  2X4H A;  3V7C A;  4I7H A;  4U0V A;  1EH8 A;  1FC3 A;  1LDD A;  4ENJ A;  1XCB A;  1Z05 A;  4KFC A;  2O3F A;  5E8I A;  1W4M A;  3BPV A;  3N4M A;  2OZ6 A;  3RKW A;  3W6J B;  1KU9 A;  4ON0 A;  2M1B A;  3DV8 A;  3QAH A;  5L3G A;  1H9T A;  2RC4 A;  2ZBK A;  1P92 A;  1RZ4 A;  4LLL A;  4CGZ A;  2PJP A;  5F1R A;  4MGR A;  5F64 A;  4A6E A;  5J8F A;  5CVV A;  2KJB A;  4RB0 A;  4G7Z F;  3E5Q A;  1OPC A;  4ESJ A;  1IN7 A;  2XAQ A;  3GZ5 A;  3E6D A;  4ZYD A;  2DBB A;  2VT2 A;  3KEO A;  2ISY A;  3FWE A;  4BH9 A;  4HLY A;  2QM3 A;  3GYH X;  2DPD A;  1HKQ A;  1KU2 A;  2COM A;  3KEQ A;  4L9T A;  2MLG A;  2VT3 A;  3MCZ A;  2OA4 A;  2O61 A;  4CDG A;  3ELK A;  3I59 B;  2A61 A;  3HRU A;  4Y15 A;  2STT A;  2CO5 A;  4EJV A;  3KE2 A;  4A2U A;  1RI7 A;  4IVN A;  4L5I A;  2HYF A;  2P8T A;  4OMZ A;  3G73 A;  3O3K A;  2GIV A;  4FX0 A;  3VOE A;  1JGS A;  5L3E A;  1MKM A;  2W85 A;  3F72 A;  4HDV A;  3H3Z A;  3ECH A;  1O3R A;  5HDG A;  1SD7 A;  2P6T A;  4KUM A;  1IRG A;  3HSR A;  4FHT A;  2EV6 A;  1BBY A;  1XSX A;  1FWZ A;  3QOP A;  3G3Z A;  2FMY A;  3DFG A;  2O0Y A;  1FYK A;  1H9G A;  3WGI A;  3TKY A;  1D3Y A;  2YU3 A;  3F8B A;  1XDU A;  4RGX A;  4PZJ A;  2ACJ A;  3ROU A;  3OV8 A;  2GAU A;  4HF1 A;  2QQ9 A;  2A07 F;  1YO5 C;  3R6S A;  1FY7 A;  4NB5 A;  3LQR A;  4S04 A;  4WXD A;  2QBY A;  3EUH A;  4M6Y A;  4IHT A;  3BWG A;  3L9F A;  3WTZ A;  1FLI A;  1U3E M;  3WGG A;  3F3X A;  5ILU A;  4MQV A;  2PMH A;  2H09 A;  4R79 A;  5JVT A;  2IP2 A;  2K4J A;  1BM9 A;  4OIR F;  4HQM A;  4LMY A;  4O6J A;  1ON2 A;  2PG4 A;  5A2Q Z;  4OU0 A;  4XBF A;  5AIP A;  1W5T A;  2XAJ A;  3LFK A;  2JT1 A;  3CDH A;  5FO5 A;  1YW7 A;  4AIJ A;  5DDG A;  2IW5 A;  2VE8 A;  5J8C A;  4Y13 A;  2UXN A;  1IXC A;  1G3Y A;  1GXQ A;  2HYG D;  4L0Z B;  1SD6 A;  5JI6 A;  1ODD A;  3K1P A;  1UHW A;  3HOT A;  2KRF A;  2IA2 A;  1P4W A;  5K5O A;  4PCQ A;  2PFB A;  5BS6 A;  1FPQ A;  1KQ8 A;  2DW4 A;  2QUF A;  5ICG A;  3C3W A;  1WQ2 A;  2LKP A;  2XGX A;  1BIB A;  2XIG A;  5E1X A;  5ILS A;  2NRA C;  1BI3 A;  3WTX C;  1IXS B;  3TQN A;  5IT3 A;  4IRH A;  2J5O A;  1REP C;  4MQ9 F;  1OMI A;  2DO7 A;  1I1G A;  3O2P E;  4L5J A;  5L3F A;  2RVC A;  1ZN2 A;  1TW3 A;  3WOD F;  5DCF A;  4G6Q A;  3VEP A;  2QLZ A;  1J7K A;  5LLQ A;  2HGC A;  2K7L A;  4ZH4 F;  1XCV A;  2D1V A;  2KIU A;  4EJW A;  2BGC A;  1G3T A;  1U5T C;  4A6D A;  3GX4 X;  3WG9 A;  4U7D A;  1Z91 A;  4G6D A;  5HLI A;  2J5P A;  4ENN A;  4KIC A;  1W7P B;  3DPT A;  4HV6 A;  2W24 A;  3EQL F;  1G3S A;  5CLS A;  1O57 A;  2P5V A;  4N9I A;  3M8F A;  2RGV A;  2L02 A;  3LST A;  3ZP5 A;  2Y75 A;  2JSC A;  3WU0 A;  1YS6 A;  1MJA A;  2GXG A;  3FXU A;  2FNP A;  4WCG A;  1BN5 A;  3CO6 C;  3KZY A;  1XGM A;  1HW5 A;  5D8K B;  3IRR A;  3JTG A;  2NYX A;  4GO1 A;  4JBA A;  3EDP A;  3F8F A;  2ZNY A;  2HTS A;  5D8L B;  2RKH A;  2ZCW A;  1BC8 C;  3QRF F;  1K6O A;  4L9N A;  4JK1 X;  1K78 B;  3SFZ A;  4OIQ F;  3BRO A;  4RAY A;  2V1X A;  3E6M A;  1IAW A;  2H27 A;  3ISP A;  3J81 K;  3PQK A;  3IWF A;  3FXR A;  4M73 A;  1BOA A;  2MH9 A;  4EJO A;  5HDK A;  2CW0 F;  3LA7 A;  3SXY A;  3QU6 A;  3L2C A;  3P9I A;  1EH6 A;  1FP1 D;  3WE2 A;  4N9H A;  5L3C A;  1F4K A;  2OD5 A;  3F8N A;  1B9N A;  2O8X A;  1YTY A;  2RDP A;  2GXB A;  4P96 A;  3VFZ A;  1S7A A;  5D6E A;  1TTY A;  4PDK A;  4IF4 A;  4FX4 A;  1LQ1 A;  3RPQ A;  3MZY A;  1RNL A;  1DP7 P;  2HKO A;  3BJO A;  1EH7 A;  1L0O C;  2PQ8 A;  3KLO A;  3AAF A;  1KQ9 A;  2XV4 S;  2DT5 A;  4A0Y A;  5ICE A;  2FOK A;  1MGT A;  2QWW A;  1F1Z A;  1NHA A;  2VBW A;  5J6X A;  3GFI A;  3PQJ A;  4ZYH A;  2XRN A;  1B59 A;  4XRF A;  2QEN A;  3L09 A;  5BPD A;  2LSO A;  1U8R A;  1O3Q A;  1T98 A;  2P7C B;  1B1B A;  3DXJ F;  3E5X A;  1AWC A;  2M8E A;  3U9G A;  1ZRC A;  2EA4 A;  5FB2 A;  3R4K A;  1LNW A;  3F23 A;  3T1B A;  2VOP A;  1J0R A;  1ONV A;  3ZMS A;  1D5V A;  5E1W A;  3CTA A;  1XN7 A;  4HX8 A;  2CGP A;  4UUV A;  5FFZ A;  4GXO A;  2Z99 A;  3JAM K;  4KN7 X;  2DQL A;  4RGU A;  3FXQ A;  2O6G E;  1IRF A;  1FYL A;  2QZ8 A;  1KQ0 A;  3FMQ A;  2YSR A;  5LHG A;  1IXR C;  3QP6 A;  3H92 A;  3GW2 A;  3WTS C;  1BC7 C;  2R3S A;  4IPA A;  4LG0 A;  2XKP A; 
#chains in the Genus database with same CATH topology
 1XTA A;  4KT6 A;  3HUG B;  1MDM B;  2ME6 A;  1MBF A;  2P4W A;  4E7I A;  5F6F A;  2V9K A;  3A4C A;  5EZG A;  6PAX A;  3JW4 A;  3OS1 A;  1RKT A;  1USS A;  3HPG A;  2EJR A;  3F6O A;  1MD0 A;  2YX4 A;  2OU2 A;  1FT9 A;  1UG2 A;  3OIO A;  4DYC A;  1GUU A;  1U2W A;  2IA1 A;  3NRV A;  3HJE A;  2HOT A;  4AYB A;  4LIV A;  1XMA A;  3BPX A;  3KP4 A;  4MFE A;  1ZGA A;  2XGD A;  2VIX A;  2LF8 A;  1HDD C;  1SMT A;  2ZME C;  3F21 A;  3VOD A;  5C44 J;  5FKO A;  1WFX A;  1S72 I;  3JRC A;  2HR3 A;  4UVB A;  4XKB A;  2AXL A;  3PSF A;  3ZGK A;  2XUB A;  1KON A;  4MFD A;  2JZY A;  3GZ6 A;  3L1P A;  2CUF A;  1KU7 A;  3PO2 J;  3CCS I;  2FML A;  3P9C A;  5FRM A;  2Y0S A;  5DTD A;  2JPB A;  3KX2 A;  3IHU A;  5HOD A;  2IRF G;  2G0E A;  1FTT A;  3ASN H;  3QPT A;  1VFC A;  3C7J A;  2A5Y B;  4YIR X;  4KDP A;  1VQ6 I;  5B66 C;  3MEX A;  4L0Y B;  4HLX A;  2YR2 A;  1XPX A;  3K6G A;  2CFX A;  1U78 A;  1OYY A;  3B6A A;  3GFM A;  1QQI A;  3AG4 H;  1W0U A;  1V55 H;  3FBN B;  3O8G A;  1LFU P;  3OS0 A;  2DPU A;  4C30 A;  3IL2 A;  4XM3 A;  1IN4 A;  1TW2 A;  2A6T A;  2MSY A;  2XAS A;  2CH0 A;  3U1D A;  1R36 A;  1QNT A;  4M74 A;  3BG6 A;  1X1D A;  1D5Y A;  4RM2 A;  4M3F A;  2CQ7 A;  3FZV A;  3ZQL A;  1YQA A;  2D2W A;  2DMP A;  2E1N A;  3PNY A;  5GAG J;  4LG3 A;  3I4M J;  1J5Y A;  3COA C;  2VI6 A;  5GPC A;  4LFU A;  3L2Q A;  1SFE A;  2EV5 A;  2VXD A;  2O9L A;  3H3V K;  1FBS A;  1TWF J;  1MJ9 A;  3DBL B;  1AKH B;  2K3P A;  3ZQ7 A;  1BI0 A;  5E3M A;  2LP0 A;  1B4A A;  3NAU A;  4N4O B;  2IS6 A;  2HXO A;  2JRT A;  1ULY A;  3CCV I;  5FLM J;  3I59 A;  3K7A J;  2XHK A;  1N75 A;  1PJR A;  3SFI A;  1MBH A;  3FHZ A;  1FP2 A;  3LFU A;  3W2W A;  2LY1 A;  2DN0 A;  2L4M A;  2VBX A;  4DZP A;  3LMM A;  2ME0 A;  4M6X A;  1LEB A;  1QZY A;  2YPR A;  4ESF A;  2AS5 F;  1BW6 A;  2F5V A;  2Q1Z B;  4AU7 A;  2OQR A;  4KMF A;  1V5G A;  5EEG A;  3SDB A;  2M34 A;  2N8G A;  3EUA A;  4CZC A;  2CV2 A;  1YX5 A;  2DQR A;  2P5K A;  2HDC A;  5E8G A;  1LEA A;  3U21 A;  3MMY B;  2DMQ A;  3OL3 A;  2VE9 A;  2KQR A;  3IAS 2;  2EFP A;  1ETQ A;  3OR1 C;  1PYV A;  1XSV A;  2GOM A;  2XAH A;  3OY9 A;  4BE2 A;  1Y56 A;  4QPO A;  3CJN A;  4FE7 A;  3BDD A;  2QSG X;  2GXA A;  3TGN A;  2PX9 A;  2XGE A;  4F55 A;  4QLC U;  1PUF A;  2K4B A;  2IGO A;  2L54 A;  1ZEL A;  1TQM A;  3KET A;  4ZYA A;  2KIM A;  5HS7 A;  4A3B J;  1JUS A;  3MKW B;  2LR8 A;  1FJL A;  3HOS A;  1TWC J;  3CME I;  3KYL A;  2CG4 A;  4Y52 J;  1K83 J;  4CCL A;  3H3U A;  5IT9 Z;  2ZSH B;  4EM0 B;  4D5C A;  1ZLK A;  3PJR A;  1S8N A;  2ZO4 A;  1C0W A;  2E5Z A;  4MHG A;  2OPT A;  1W1W E;  2PI0 A;  2JA2 A;  4ZYE A;  3S2H J;  3G1O A;  1XB4 A;  1BI2 A;  1I39 A;  3S3M A;  2HFH A;  3AL0 C;  2CJJ A;  2K5C A;  2VC1 A;  3BLY A;  5FD5 A;  2RN7 A;  5EZH A;  1KU3 A;  4ENM A;  5H6Q A;  2K9L A;  2F2E A;  3RPU A;  1T0F C;  1OYI A;  2MC4 A;  4YG2 F;  1ZAO A;  1DGW Y;  2H8R A;  2E36 A;  3IH4 A;  3GTM J;  1MBJ A;  3M8E A;  3KP2 A;  4XSZ F;  4CO8 A;  2L7M P;  3CCQ I;  2H8W A;  2KKO A;  3PUB A;  3J7A Y;  3V7S A;  2NNN A;  3FM5 A;  3FXO A;  4GDF A;  2WAE A;  1LVA A;  4GYG A;  4FCY A;  2K40 A;  4DNC A;  4LIT A;  4LOC A;  3OSG A;  2ZJQ F;  4GCV A;  2Y9Y A;  3TDZ C;  4W1U A;  4XL9 A;  2OV7 A;  5F0H A;  3I53 A;  3QU3 A;  3Q3S A;  3IKT A;  1YG2 A;  2B0L A;  4I0B A;  3JRA A;  3GEZ A;  4KNY A;  2DA5 A;  3AL0 B;  4HSR A;  1JI8 A;  1K79 A;  5B1A H;  4MTD A;  3RKX A;  3J80 Z;  5TJJ A;  3D5S C;  1LPQ A;  2OUM A;  3DKW A;  2JK3 A;  1ZGJ A;  2NXN B;  4A69 C;  1LE8 B;  4YFK F;  2HQ5 A;  3P9K A;  4UUS B;  1TP4 A;  2M45 A;  3G1L A;  1QBJ A;  5H6R A;  4B09 A;  1DU0 A;  1G4D A;  2DFH A;  2OC6 A;  2XF6 A;  1VQ8 I;  2MD0 A;  1BJA A;  4KT5 C;  4LK1 F;  3GTQ J;  3E6B A;  1E2X A;  2DI3 A;  2QQ8 A;  4A3G J;  2HDW A;  2GA1 A;  4G8X A;  5KHD A;  4EGZ A;  3FDY A;  5KNL A;  3HOZ J;  4XN3 A;  5K7H A;  5CQE A;  2E1O A;  2KIS A;  2Q2E A;  3CDI A;  4X1E A;  2B63 J;  1XG1 A;  4BL0 B;  4OIN F;  2DOD A;  2E2I J;  1LDJ A;  3EUH C;  2DA6 A;  2EWN A;  2FA5 A;  1UCR A;  1R00 A;  3ML6 A;  3E5U A;  3WGH A;  3GLX A;  1Y0U A;  2EV0 A;  3U2R A;  4RB2 C;  2M7A A;  1SAX A;  3F8C A;  1ETV A;  1MIJ A;  5LHI A;  2FNA A;  3CJT B;  3KP5 A;  3VPR A;  1XD7 A;  2BE5 F;  2FBH A;  3HZJ A;  3K4M A;  1IUY A;  2YX7 A;  4BXX J;  1DDN A;  2D5V A;  2OF7 A;  1XGS A;  4KIB A;  2R7Z J;  1MBE A;  2F5E A;  1Z77 A;  4JP0 A;  3FM3 A;  2HPM A;  1IF1 A;  1TLH B;  1WI9 A;  2DMT A;  2XPW A;  3I3L A;  2CWE A;  1VQ4 I;  1J2X A;  2IVM A;  3EUK L;  2QSH X;  1SVO A;  2OTJ I;  2B9S A;  2JTV A;  4UV9 A;  4XOT A;  1JHF A;  2PBI A;  1FX7 A;  2VJJ A;  4CZZ A;  5DEQ A;  3KPH A;  4M71 A;  5LHH A;  1K7A A;  3HGY A;  1R58 A;  4IJA A;  1YS7 A;  1SFK A;  2ZFW A;  2EIM H;  1X3Z B;  2V79 A;  4QTR A;  2ELK A;  3WU1 B;  2COB A;  5LGT A;  4CCN A;  3RI4 A;  1JXS A;  3HIF A;  1O3T A;  5J1R A;  2LY9 A;  1WKM A;  2CQK A;  4UVC A;  4A5M A;  1IO2 A;  2BW3 A;  3TO9 A;  3F22 A;  2KMU A;  1I3Q J;  1DUX C;  3HOY J;  3LL7 A;  3ONQ A;  1FMV A;  1HQC A;  5J1Y A;  2DDA A;  3S1N J;  4V19 K;  3DEU A;  3RKY A;  3ZXS A;  3CQZ J;  5IYB J;  3JRE A;  4I98 B;  1ZRF A;  2OBP A;  1UZC A;  1UAA A;  2K27 A;  2W82 A;  1R22 A;  2VJI A;  1Y1V J;  2DTR A;  1D8K A;  1N77 A;  2PJR B;  4D7M A;  2NVX J;  5GTH C;  2A6H F;  2LF7 A;  2VJ4 A;  3G1M A;  2BBY A;  2XDV A;  2Q8K A;  2EFO A;  1U6G A;  3OYH A;  1P7J A;  5CVI A;  2QCO A;  2CW7 A;  5HNF A;  4HNV A;  2V26 A;  2WAD A;  1OR7 A;  2LMD A;  4XKC A;  2HPI A;  3RTR A;  3TOB A;  3BQY A;  4A3E J;  3K70 D;  4GRI A;  2R7O A;  4LJZ F;  2G9W A;  1WHU A;  3GTP J;  3V8L A;  1W7P A;  1Y1W J;  1GV2 A;  1HDP A;  2RQQ A;  5D5X B;  2PMZ N;  4N0B A;  2M9H A;  3K0L A;  2EA2 A;  2VB6 A;  4F7Z A;  5FLX Z;  4M9X A;  3BTL A;  4GYI A;  2ZC2 A;  2KL4 A;  4I02 A;  4ZC3 A;  3I0T A;  3T8T A;  3HRM A;  3P7N A;  1YJW I;  3TBI A;  4A3C J;  2W4S A;  1WSU A;  1X2N A;  3CLO A;  3GLL A;  2HXI A;  2LFB A;  3WHC A;  1SFU A;  2P6S A;  4WX9 A;  3OOU A;  1UHM A;  2JA7 J;  3GXO A;  4I2O A;  3BJA A;  2BHZ A;  5HOO A;  3I54 A;  4PK4 A;  1YIJ I;  1S3J A;  2R7R A;  3L00 A;  4EJT A;  2BYV E;  2LY2 A;  4E70 A;  4IZZ A;  3CC2 I;  5CJ9 A;  2D45 A;  2MC3 A;  3Q0V A;  2IEK A;  4I09 A;  5F08 A;  5E17 F;  3BR2 A;  2AQE A;  2O03 A;  1RC9 A;  4U0W A;  4BEH A;  1Z67 A;  4BQQ A;  1CQT A;  2MD5 A;  2DT6 A;  5ED4 A;  2EIL H;  3ZMD A;  5H2F C;  5HDN A;  1D0X A;  2DAO A;  2W48 A;  5E18 F;  3NQO A;  5HS8 A;  4CCK A;  3UNG C;  2A69 F;  4RAG A;  4CSW A;  3WTV C;  3LSP A;  4CYC B;  1ZRE A;  2X1E A;  2W84 A;  1K78 A;  2KFD A;  5K5Q A;  1U5T B;  1VI0 A;  3AG3 H;  4XOR A;  1RUN A;  3SDG A;  1YIO A;  1E3P A;  2FU4 A;  4ESB A;  1K4S A;  2HVQ A;  1K6Y A;  3R0A A;  3JR9 A;  1FYM A;  3ZQH A;  2DFI A;  4N4N B;  1J75 A;  2HQN A;  3RPU D;  1D0Y A;  5J40 A;  1LFP A;  1UST A;  2H1K A;  1SD5 A;  2WA0 A;  3K9T A;  2XSD C;  4ZTJ A;  2R7T A;  1WRJ A;  3QP5 A;  4G9Y A;  1OYW A;  3PSI A;  4AIK A;  4RA2 A;  1KA8 A;  2X1D A;  3BTI A;  2VN2 A;  1MW7 A;  1DPR A;  4EGY A;  4OIO F;  4IHY A;  3G71 I;  5CYV A;  5FLV A;  4E6K G;  3JRD A;  3TO6 A;  4A5N A;  1S7E A;  3GCM A;  4I76 A;  3A0B C;  2KLO A;  1P2F A;  1ZQ3 P;  1FBU A;  5HLG A;  2PLY A;  3I4N J;  2HZT A;  2CQN A;  5BPI A;  1MBK A;  3OYJ A;  3M1E A;  3HTU A;  4XLA A;  1A36 A;  1QVT A;  3CCM I;  3QYF A;  4PGG A;  1W5C C;  1KGS A;  1FEX A;  1QPM A;  2HYJ A;  1UMQ A;  4BHB A;  3N97 A;  2M87 A;  1POG A;  2F4M B;  3GVA A;  2L7F P;  3IC7 A;  2QF7 A;  3M8J A;  5M3F J;  4UHT A;  1VF9 A;  5HLH A;  1OQY A;  1FSH A;  4AVP A;  2A3S A;  3Q5F A;  2HS5 A;  3CP2 A;  1QPI A;  1MMG A;  2EZL A;  3BR5 A;  2KRC A;  4XKV A;  3B02 A;  1TQI A;  4P1W A;  2QEX I;  2ZJR F;  1ZG1 A;  2KT0 A;  3HKZ A;  4M3E A;  2JQ7 A;  3WTY C;  5GAD J;  2UWM A;  4XLE A;  3A01 B;  3KZZ A;  2GLO A;  2V1D A;  1AOY A;  2V4J C;  2X0L A;  2ZXW H;  4ZDP A;  3O8H A;  2E2H J;  2X85 A;  4V2G A;  2X48 A;  1U8B A;  2G7U A;  3E7L A;  4Z2Y A;  3E3V A;  4XLP F;  3W6K B;  2K3F A;  3NWS A;  1CF7 A;  4WXC A;  3BCA A;  5FD6 A;  3CCL I;  3ZPL A;  1TWA J;  2V9P A;  3RYP A;  3HOV J;  3WE3 A;  2WV0 A;  3DWL E;  2DYR H;  2OZU A;  4AIH A;  2IPQ X;  1GHC A;  5EYR A;  2M5W A;  1Y8Q B;  3VYR B;  1B8I B;  1GLN A;  3MD2 A;  2W7N A;  3IWZ A;  5FKL A;  1B72 A;  2VL8 A;  1FSE A;  5EG0 A;  5J1U A;  1OKR A;  3OOP A;  4UY8 I;  2VON A;  1OLT A;  3RCO A;  2R5Z A;  2VOD A;  4CUG A;  2FRH A;  2FXA A;  2L7Z A;  4JX5 A;  3PIO F;  2XPU A;  1TL8 A;  4FET A;  3MWM A;  3O6B B;  2QYO A;  4LD5 A;  2WTE A;  2NS0 A;  2X6O A;  5E79 C;  1LB2 A;  3GZN B;  5HNH A;  1Z9C A;  2VKE A;  3HPH A;  2DK8 A;  3M7G A;  3V7R A;  2ZB9 A;  3HM5 A;  2JVH A;  2ZXJ A;  2Y0S N;  5HS9 A;  1ZG5 A;  1HW2 A;  2UZK A;  4CHU A;  3V4G A;  3FK6 A;  1V54 H;  2W1O A;  4DYR A;  2HEO A;  3RZD J;  1WZ2 A;  5F04 A;  4NQW A;  1W36 D;  2F48 A;  3H36 A;  3QWL A;  2IJL A;  2E2J J;  1I5Z A;  5DUI A;  3IKV A;  4UVA A;  3FIS A;  2WAF A;  3F6V A;  1P6R A;  2W25 A;  3E6C C;  3D5L A;  5L3D A;  2O7O A;  2Y69 H;  4KIF A;  1YW9 A;  4KMU X;  2W57 A;  3JSO A;  2VKD A;  4BUP A;  2EB7 A;  1O3S A;  1FOK A;  2F5F A;  3V8K A;  1STZ A;  4UUT A;  2NOG A;  3ZRG A;  3DCF A;  2FEZ A;  2ESN A;  4ENK A;  3D0S A;  3L7W A;  1MDM A;  1VQ9 I;  2ELJ A;  4I6Z A;  4HG2 A;  4WXH A;  2ECB A;  4UXN A;  4AVZ A;  2KIF A;  3KFW X;  2MLK A;  2X6X A;  5EF6 A;  1QZE A;  5LEJ A;  3OYK A;  2FUG 2;  2CS3 A;  2LRE A;  3I4P A;  1Y8R B;  5GP9 A;  1T39 A;  3HOW J;  2V1U A;  3NWT A;  2NVT J;  1GVD A;  2MG4 A;  1XMX A;  2KP6 A;  3C18 A;  3AG1 H;  1X58 A;  1BI1 A;  5ERI A;  1R1T A;  2M4G A;  4CCM A;  4PJJ A;  2X1C A;  4GGG A;  4M9Z A;  1H8A C;  4BDY A;  3JRG A;  5D4R A;  4IRI A;  4PJ0 C;  4PSW A;  4ANJ A;  1TZL A;  1FZP B;  1RET A;  2LK2 A;  3BR3 A;  4AM3 A;  3K4N A;  4OOI A;  4OAZ A;  1RR8 C;  3S3N A;  4LK0 F;  2DYS H;  4I01 A;  3KLN A;  1GDT A;  1DP3 A;  1I6H J;  4M72 A;  2E1C A;  4JX6 A;  1Z21 A;  3JRI A;  2NAZ A;  3Q9S A;  4OMY A;  5K5R A;  4XQF A;  5FKK A;  2XB0 X;  4IL6 C;  2E7X A;  2Y2Z A;  1TNS A;  4ETS A;  1ZK8 A;  3ZR8 X;  3BR1 A;  2UV1 A;  5GPA A;  2V9V A;  4NC8 A;  4F92 B;  4O3M A;  3CMY A;  2FBK A;  2ZKZ A;  1Y39 A;  1UFM A;  1D1C A;  2LNB A;  4RGR A;  3JRB A;  3K2Z A;  5JR3 A;  1QGP A;  3W6V A;  4FQG A;  2KZV A;  2EZK A;  2JMW A;  4R1H A;  3CUQ C;  2ZJ2 A;  2DCE A;  4M3G A;  4XLH A;  4S05 A;  2F5D A;  4Q4Z F;  2JPC A;  5E3N A;  1XSD A;  4KIG A;  2WBM A;  2CUJ A;  1XMK A;  2P5L C;  2BV6 A;  2K02 A;  1V4R A;  3LAP A;  4D7N A;  3FXJ A;  4O5V A;  3CZ6 A;  2RQP A;  1VQL I;  4U88 A;  2ISZ A;  1IV6 A;  4LG0 B;  2D1H A;  1ZG3 A;  1AKH A;  1JKO C;  2Z16 A;  3S1M J;  2ZME B;  3M4O J;  3ZMZ A;  1ETO A;  4Q47 A;  3HTS B;  1VND A;  2NVY J;  1J9I A;  3ABT A;  4AWX B;  3SEQ A;  4RAZ A;  1A5J A;  2ID6 A;  3KCC A;  3CUQ B;  2MAB A;  3Q9V A;  2IA0 A;  3WTW C;  4IHX A;  1WWX A;  3OS2 A;  2DA3 A;  2CV1 A;  2HDD A;  2VQC A;  3LSM A;  1ITY A;  2HNH A;  2RNJ A;  1O4X A;  4BBS J;  5TIS C;  2HTJ A;  1R1U A;  1V5E A;  5DCM B;  4AUX A;  1RUO A;  1S9H A;  3QPH A;  4IX7 A;  1FIP A;  3I5U A;  1F9N A;  2ELH A;  1IUF A;  1G6N A;  1Z7U A;  1PUE E;  1LJ9 A;  2LDU A;  1V3F A;  3ABK H;  5ILV A;  1IC8 A;  3GFL A;  1KYZ A;  3BP8 A;  4RAF A;  3K69 A;  2PMU A;  3I9V 2;  1DQU A;  5IY5 H;  3I58 A;  4WF2 A;  4J00 A;  4B3X A;  2WB1 N;  1JE8 A;  4OWR B;  4KJZ A;  3MKY B;  3PO3 J;  2DXI A;  4RS8 A;  1GV5 A;  1IGN A;  1A6Q A;  2HOE A;  2DOE A;  2H94 A;  3DLA A;  4BHP A;  2M8G X;  3ZQG A;  4G7O F;  1T38 A;  3K70 C;  2ESH A;  5BMZ A;  3CLQ A;  1UG0 A;  2IGN A;  1S29 A;  3HSF A;  3FXL A;  3ZOB A;  3WTT C;  1MMN A;  2K9M A;  2HKX A;  3EPZ A;  3PNT A;  1XDS A;  1Z1D A;  2L7K A;  3LSH A;  4XLN F;  2XF7 A;  2BXZ A;  3WG7 H;  4Q48 A;  2LBF B;  1JHH A;  2C6Y A;  3IUO A;  1ZTR A;  2ZNZ A;  1E0E A;  3W3C A;  2RRE A;  3BR0 A;  1TNT A;  2DU9 A;  5CPR B;  3PL8 A;  3J7A O;  4HZF A;  2L2O A;  1S5L C;  2NVQ J;  3DPL C;  4PJN A;  3TOA A;  4XOP A;  1EA3 A;  2A68 F;  3S1Q J;  4PFP A;  2RNG A;  3IH3 A;  1XX5 A;  4JX4 A;  5JHU A;  3OYN A;  1YW8 A;  4IHS A;  3RIR A;  5EEH A;  3S15 J;  2LD5 A;  1ETX A;  2FX0 A;  3M9A A;  3ZMT A;  4CA0 A;  1WVR A;  3HYI A;  5IT9 K;  4Y7N J;  3BOQ A;  5E20 A;  1MSE C;  5GTI C;  1Y6I A;  2OTL I;  2F4I A;  1VQN I;  2EFQ A;  3H35 A;  2JN6 A;  5JLX A;  2TDX A;  3BZC A;  3JRH A;  1J59 A;  3OYD A;  4BDZ A;  3GTJ J;  2QQB A;  4DBQ A;  1YJ9 I;  1AA7 A;  1YLF A;  1ZR4 A;  1X1A A;  1W5S A;  4BBR J;  2VPL A;  3CO7 C;  3HRS A;  5H20 A;  3M3Y J;  4UB8 C;  4HOB A;  2FE3 A;  3V8J A;  5GAH J;  1PDN C;  3DBH B;  1SD4 A;  2FOW A;  1ZAR A;  2GWR A;  5D6F A;  4LGW A;  2XAF A;  1ZKG A;  3GWZ A;  4F93 B;  5EEA A;  1T0F A;  1LE8 A;  3L2V A;  3DP7 A;  1Z6T A;  3KYD B;  3DEE A;  4UUS A;  1ENH A;  3HSE A;  3P5J A;  1R4N B;  3RSN A;  2BXY A;  4BQA A;  2FBI A;  1APL C;  4FTH A;  4QWQ A;  4EM1 A;  1ZLJ A;  1S7O A;  1D8J A;  2PN6 A;  3M07 A;  3ZN0 A;  4UV8 A;  2Z5U A;  4CYD A;  4RGS A;  3MZH A;  1HCR A;  4Q5S F;  2IGK A;  2E34 A;  3GTK J;  3L2R A;  3KP7 A;  3J80 K;  1EJ9 A;  2LYC A;  1IJW C;  3SZT A;  1BOB A;  3OIP A;  5J47 A;  2XPV A;  4P55 A;  3FF5 A;  5ICC A;  1WJF A;  1SFX A;  4YFN F;  5DS9 A;  4KA4 A;  1HF0 A;  4XLF A;  5CVJ A;  4IEJ A;  2BVL A;  2ID3 A;  3NAR A;  2R7D A;  2X51 A;  4PFO A;  2HZD A;  5DYM A;  4E7K A;  4BY1 J;  2CSO A;  4U0Y A;  2EK5 A;  4U87 A;  4C3H J;  1KZH A;  4MIM A;  2Y30 A;  4QSH A;  3GF2 A;  1B6A A;  4ZDO A;  4S0H B;  3FMS A;  2F5C A;  1MZB A;  1IN8 A;  2AQF A;  2B7E A;  2EZH A;  2RV8 A;  3HHH A;  5HVQ C;  4U7B A;  3ZQI A;  1VQ5 I;  2AHQ A;  1SMY F;  4HAM A;  4BHC A;  4IQJ A;  3KP3 A;  4L5E A;  1MMA A;  2ZXH A;  4Z6Y A;  4RLF A;  1ZR2 A;  1RIO H;  4ZZD A;  2XC7 A;  3ABU A;  2A6E F;  4MTE A;  1T6S A;  4CH7 A;  4DQ2 A;  1R1V A;  4B8X A;  2AXT C;  2E7W A;  2IT0 A;  4TV7 A;  1X3U A;  3S3O A;  3PM1 A;  5LFA A;  1ACI A;  2JJ7 A;  1SAN A;  4HQE A;  1QZZ A;  2DLL A;  3WTU C;  1WJB A;  4EM2 A;  1FTZ A;  2K86 A;  4LB6 B;  2MA3 A;  3EYY A;  2IS2 A;  5A2Q K;  2IXS A;  2GZW A;  2FF4 A;  4RMN A;  3IRQ A;  4LLG F;  3JTH A;  1MND A;  2DMN A;  3TW6 A;  2JRM A;  3CES A;  3M1C A;  5LRR A;  1NH3 A;  1IN5 A;  4L9V A;  2FSW A;  1O7F A;  4LLN A;  2WY8 Q;  3PUF A;  2L01 A;  4W97 A;  3C2H A;  3BZK A;  3MN2 A;  4C3J J;  2QBY B;  1XGN A;  1OCR H;  2LTP A;  2ZJP F;  1TBX A;  4G94 A;  5IOZ A;  4B44 A;  3LWF A;  3BG5 A;  2PJR A;  3GTG J;  3ZN1 A;  3BR6 A;  4DOZ A;  1WJ5 A;  2IBD A;  3KYC B;  1FBQ A;  1XGO A;  3FMR A;  2CUE A;  3MFK A;  3C1D A;  1IRZ A;  2XGC A;  3K10 A;  1MMD A;  3GO5 A;  3OYB A;  4ZDL A;  2XAG A;  4LB5 A;  2Y0M A;  1U9N A;  5LBQ A;  1MMS A;  3T5X A;  2HOA A;  3IH2 A;  3HB9 A;  1T95 A;  4MNU A;  2MFZ A;  4D1Q A;  2VBY A;  3CJR B;  1WH7 A;  1BR4 A;  1YIT I;  4BXF A;  5KVR A;  3GTL J;  4V2F A;  4BYY A;  3DPU A;  3K2A A;  3LQQ A;  4KYW A;  3GFJ A;  5FFX A;  1UB9 A;  3VDX A;  4P9U A;  2XB5 A;  4E7J A;  4YII A;  3REO A;  1T08 B;  3DBR B;  5KAF C;  1W36 C;  4CCJ A;  2WWY A;  2EIJ H;  4G6T B;  1TQP A;  2Z3Y A;  3PFI A;  4K2E A;  2RAE A;  2PEX A;  1R71 A;  2VC0 A;  2UUZ A;  3K4L A;  3BY6 A;  3OYC A;  3A2K A;  1I27 A;  3ZMV A;  2DA2 A;  4HYE A;  5D5W B;  1Z7L A;  3VYU B;  4EAT A;  1YJN I;  5TRD A;  3OIQ A;  2V6C A;  5FLX K;  2G7H A;  2EPF A;  3TDU C;  1QVU A;  3BJ6 A;  1WJE A;  4EQQ A;  1OCP A;  3ECO A;  1JJ8 C;  5CVR A;  4BJ6 C;  1YFH A;  4PGH A;  5HLT A;  3EYI A;  4BXU A;  4YRV A;  2H6C A;  2DA4 A;  4YEJ A;  3K1N A;  1F5T A;  1WJC A;  3KIO A;  3E1S A;  3OYA A;  1VZ0 A;  5JVG F;  4CYC A;  3WU2 C;  2R7V A;  1TT5 B;  1JUM A;  3FK7 A;  4HBL A;  2CFO A;  2Y48 A;  2P0W A;  1XS9 A;  2DJI A;  2DTZ A;  3DF8 A;  3ABL H;  3HKZ N;  2STW A;  4WWC A;  1U5T A;  4Y33 A;  1N25 A;  3LSR A;  1IZ1 A;  1I6X A;  3HG9 A;  4XR6 A;  5LGN A;  2GQQ A;  2ZFU A;  2DFF A;  5B3S H;  1OFC X;  3CCJ I;  1SVM A;  3LSK A;  3WHB A;  5FGM A;  5LEK A;  1NK2 P;  1E17 A;  4WK8 F;  3B73 A;  4A3M J;  5LGU A;  1EKE A;  1KYW A;  1K4T A;  1MJB A;  4UNO A;  4JQF A;  4HST A;  4JOM A;  3RQI A;  2OJE D;  1FOX A;  3RYR A;  1HC8 A;  4R8H A;  1R5H A;  2R5Y B;  2FQ3 A;  1HKT A;  4A3J J;  1ZYR F;  4YFX F;  5TGT A;  5D5V B;  1OCO H;  4DW6 A;  1WI3 A;  1IDZ A;  2DFE A;  2K85 A;  4C2T A;  2W00 A;  2DMU A;  4OIP F;  2R7W A;  2OAZ A;  2JA5 J;  2WC2 A;  5AIQ A;  5GAE J;  4MEY F;  3S2W A;  2VKV A;  4M3D A;  1ZHF A;  4ZYG A;  1TC3 C;  1P4A A;  1HW1 A;  1UHS A;  2K9Q A;  5J4V A;  1GXP A;  2NNY A;  2MGQ A;  2R92 J;  1HST A;  3GUD A;  3I71 A;  2MH2 A;  1T2K A;  4CIC A;  2ADU A;  4XK4 A;  2VQL A;  4AC0 A;  4FAS D;  4HDU A;  1Q1H A;  1E3O C;  1A04 A;  3C2B A;  4FT8 A;  4A12 A;  2VBZ A;  2H6B A;  2VXZ A;  4BEH B;  3VB2 A;  4A93 J;  2QKL B;  1A35 A;  4GFB A;  1I50 J;  5ICF A;  5EJC A;  5K1Y A;  1R23 A;  2CV0 A;  3FBI B;  2Z9O A;  3G2B A;  2KJC A;  1PP7 U;  1YHQ I;  1SC7 A;  3TL4 X;  2K9N A;  2E19 A;  3DQV C;  4RLQ A;  2M4K A;  4RB1 A;  1HKS A;  4IXA A;  4B3A A;  1SAU A;  3U1K A;  2DT7 B;  2EZI A;  4ASN A;  4BJT A;  4C9Y A;  1VTN C;  5KK1 A;  3TP0 A;  4A0X A;  5LRS A;  5D4S A;  1EV7 A;  2X9D A;  4DZJ A;  4M9S A;  4A3D J;  4XSX F;  2HVS A;  3K4B A;  3UR3 C;  3TO7 A;  1I1S A;  2EFW A;  1B8I A;  3LAJ A;  4HF2 A;  2PMZ A;  3S16 J;  1MNE A;  3LA3 A;  3EET A;  5JFR A;  2TRT A;  2KHM A;  3J81 Z;  4PJL A;  5IOY A;  3CCR I;  1R5G A;  3L2W A;  4XRM A;  3ERM A;  4ITV A;  5M3M J;  1UJ8 A;  4BQO A;  5DV5 A;  2O8K A;  2R4G A;  2A05 A;  1YRN B;  4A3F J;  1ON1 A;  2L9N A;  3GTO J;  4HW0 A;  4NHJ A;  3HGG A;  1HSJ A;  1ERD A;  4PUS A;  3PNV A;  2BEO A;  3ABM H;  1AU7 A;  4D0P A;  1Z0X A;  2XKO A;  5B5E C;  3G4S I;  1B9M A;  5M5W J;  3F8M A;  1WCM J;  2ETH A;  4A0Z A;  4AYB N;  1IW7 F;  2L3D A;  4P5O A;  4E7Z A;  2BY2 A;  1SEU A;  4MEX F;  3N05 A;  1ZRD A;  4ABZ A;  4IHV A;  5CVU A;  3JCU C;  2L0K A;  2LKS A;  4HV5 A;  1CGP A;  3OYE A;  3JSP A;  3F0C A;  2OQG A;  3SHF A;  2LG4 A;  3CP8 A;  4ZZL A;  1E3H A;  1P4X A;  2M0M A;  1F43 A;  3RJP A;  4DBR A;  2QVO A;  1QO0 D;  1YYV A;  3MAJ A;  4I99 C;  2M30 A;  4BE1 A;  2P7V B;  1BR2 A;  1O7L A;  3A1Y A;  4CXF A;  1I3A A;  2VOO A;  2F6C A;  2R93 J;  1DPU A;  2UXX A;  4MLO A;  5DUK A;  1X1P A;  3SQN A;  1ETK A;  3RDI A;  5FKN A;  2ICW G;  1HBX G;  4EMS A;  4XID A;  5DD4 A;  4XKW A;  4I0A A;  5BOX A;  2BHY A;  3S14 J;  4BKX A;  1S6L A;  3I64 A;  5JLW A;  4Y17 A;  1ZH5 A;  3BZ6 A;  2IS4 A;  1CF7 B;  1WJD A;  1IN6 A;  4AD9 A;  4HA8 A;  2Q0O A;  1RKW A;  3H5N A;  1ETY A;  3H5R A;  3Q0U A;  5EGO B;  3R61 A;  1OJL A;  2XRO A;  3X2Q H;  2E5N A;  3HUG A;  3CUO A;  2DK5 A;  3A0H C;  1HXD A;  3K4K A;  2EFN A;  2I8D A;  2QQA A;  4IRG A;  1BIA A;  1FNN A;  3KP6 A;  3LSJ A;  1JT6 A;  2HQA A;  1SFO J;  3ULQ B;  3NEU A;  5DD8 A;  3K1M A;  1U9O A;  4EV0 A;  3ERE D;  1W7P D;  1R6R A;  2R7F A;  2HQR A;  5B1B H;  2V6E A;  3SZP A;  4FIS A;  3T8R A;  2HI3 A;  2XVC A;  1Z6R A;  1FMW A;  3ZMU A;  2I5U A;  2MBF A;  2BY1 A;  1DGR M;  3DEW A;  5D5U B;  3H9Q A;  1R5I D;  5FRO A;  3JAM Z;  4NQW B;  3HRT A;  3FX3 A;  3E97 A;  3H9J A;  3I56 I;  2HWV A;  4DGW B;  3QYB A;  2ECC A;  3DTK A;  3R60 A;  4BAC A;  2GA2 A;  1X4O A;  2WAQ A;  3HHG A;  4BY7 J;  3MQ0 A;  3D5R C;  3L2U A;  2Z33 A;  2NVU B;  1JUP A;  1MH3 A;  1G2H A;  4YIF A;  3LOC A;  3ZQF A;  4EVI A;  1R4M B;  3HBL A;  1IV8 A;  2O5R A;  4L18 B;  1G3W A;  1RPW A;  1L3L A;  2ZME A;  4UB6 C;  4BNC A;  5CKT A;  4HX7 A;  2CYY A;  3LSG A;  1VQM I;  3TED A;  3R0J A;  3CUQ A;  2KZG A;  4HX4 A;  4BE0 A;  2BVM A;  3LA2 A;  4QIW N;  4E7H A;  2KIQ A;  3SJM A;  1H0M A;  1R9T J;  5L3B A;  2EQR A;  1R7J A;  1LDK B;  5DCM A;  2DA1 A;  3SYT A;  2DDB A;  1R49 A;  1X2M A;  3C2G A;  4HF0 A;  4BAY A;  4H0E A;  1AHD P;  4KN4 X;  1WJA A;  1PP8 F;  4L9J A;  2V7F A;  5E3L A;  5BQT A;  5AON A;  3T0Y A;  1HOM A;  1P7I A;  4RB3 C;  5E1Z B;  2EBI A;  3BC8 A;  4C3I J;  1GVJ A;  2L4A A;  4P9F A;  4EJU A;  4G7H F;  2X4H A;  3CC7 I;  2M7B A;  3GBG A;  4HEA 2;  3V7C A;  4I7H A;  4U0V A;  1OCZ H;  2Z2S B;  1EH8 A;  5J4Y A;  4EEF G;  1FC3 A;  1LDD A;  4XRS A;  4ENJ A;  4NNJ A;  1XCB A;  1Z05 A;  4MO7 A;  4KFC A;  2O3F A;  1TT0 A;  5E8I A;  1W4M A;  3BPV A;  1X4P A;  5C3E J;  3KZI C;  3N4M A;  4IHW A;  1A6I A;  2OZ6 A;  2GIZ A;  2LBF A;  3RKW A;  3W6J B;  4HRI A;  1KU9 A;  4ON0 A;  1LVK A;  3K4J A;  3QOE A;  4B4C A;  4OAY A;  2M1B A;  2DJN A;  3DV8 A;  3QAH A;  5L3G A;  1H9T A;  1QA6 A;  2RC4 A;  2XRL A;  2ZBK A;  1P92 A;  1RZ4 A;  4LLL A;  4CGZ A;  2PJP A;  5F1R A;  4MGR A;  5F0C A;  5F64 A;  4A6E A;  4B48 A;  2FQ4 A;  5J8F A;  4NC7 A;  5K7F A;  1H89 C;  5CVV A;  2BY0 A;  2KJB A;  4RB0 A;  4G7Z F;  3E5Q A;  1OPC A;  3HOX J;  4ESJ A;  1IN7 A;  2JUG A;  1RRJ A;  2XAQ A;  4HNU A;  3GZ5 A;  2IAI A;  3E6D A;  3QOD A;  4IOC F;  4ZYD A;  2DBB A;  2VT2 A;  2ZSI B;  3KEO A;  2ISY A;  1BW5 A;  3FWE A;  4DJA A;  2DOF A;  3AG2 H;  1LKX A;  4BH9 A;  2KPM A;  4HLY A;  1GT0 C;  2QM3 A;  5DM6 F;  4B47 A;  3GYH X;  2DPD A;  4BS9 A;  2IS1 A;  1HKQ A;  1KU2 A;  1MH4 A;  2COM A;  3KEQ A;  4XON A;  2H1L A;  4L9T A;  3KEY A;  2MLG A;  2VT3 A;  3MCZ A;  2OCC H;  1K61 A;  1LFB A;  3DU5 A;  2OA4 A;  2O61 A;  3FKJ A;  4CDG A;  3FXK A;  3ELK A;  1RR7 A;  1TWH J;  3I59 B;  3PFY A;  2JVG A;  2A61 A;  3DTI A;  3HRU A;  3TW7 A;  1IG7 A;  4Y15 A;  4HNT A;  2MYS A;  2STT A;  4A3I J;  2L9S A;  2CO5 A;  4EJV A;  3OYF A;  3KE2 A;  4A2U A;  1RI7 A;  3ASO H;  9ANT A;  4IVN A;  2QSF X;  3CD6 I;  4L5I A;  2HYF A;  2P8T A;  4OMZ A;  3G73 A;  4XNF A;  1T56 A;  3O3K A;  2GIV A;  4FX0 A;  3SZG A;  3VOE A;  1JGS A;  5L3E A;  1MKM A;  4ZJZ A;  2W85 A;  3F72 A;  3PIP F;  4HDV A;  2QKM B;  1D0Z A;  4RBO A;  2KDZ A;  3H3Z A;  3ECH A;  3H1C A;  1O3R A;  3VWB A;  5HDG A;  1JJ6 C;  4NBQ A;  1J09 A;  1SD7 A;  4XRS G;  1PUF B;  2VPR A;  2NOJ B;  2P6T A;  3D1N I;  4KUM A;  1IRG A;  1G8X A;  5IP7 J;  3HSR A;  4FHT A;  2JSP A;  2EV6 A;  1BBY A;  1IRX A;  1WPK A;  2HOS A;  2M3A A;  2K9S A;  4D9J A;  1XSX A;  1FWZ A;  3QOP A;  3G3Z A;  2FMY A;  3DFG A;  2O0Y A;  1FYK A;  1H9G A;  3WGI A;  1X19 A;  1NG7 A;  3W2V A;  3TKY A;  1D3Y A;  2YU3 A;  3F8B A;  1XDU A;  4RGX A;  2CU7 A;  4PZJ A;  4BU2 A;  2ACJ A;  5F0F A;  3ROU A;  2WB1 A;  2R7X A;  3OV8 A;  1SVL A;  2A5W A;  2GAU A;  5FJ8 J;  4HF1 A;  2QQ9 A;  1BJZ A;  2A07 F;  1RES A;  2R7Q A;  1YO5 C;  3R6S A;  4E7S A;  4E7L A;  1FY7 A;  2QGU A;  4HPQ A;  4NB5 A;  4C2U A;  3LQR A;  1U0J A;  1N78 A;  3IV5 A;  4X0G A;  2BY3 A;  5IP9 J;  3VSK A;  4S04 A;  3I55 I;  4PJM A;  3VYT B;  1YX3 A;  3H5A A;  4WXD A;  2QBY A;  3EUH A;  4M6Y A;  4IHT A;  3OYI A;  1EF4 A;  3BWG A;  4B1R A;  3L9F A;  1OCC H;  4ZTF A;  3FXM A;  2QA4 I;  2CQQ A;  3WTZ A;  1FLI A;  3J7Y J;  2JUC A;  1D1B A;  2E71 A;  3OYM A;  1U3E M;  2EIK H;  5C4J J;  4J19 A;  2XSJ C;  2VUM J;  2X6W A;  4RM3 A;  4M3B A;  2BOL A;  3H0G J;  1BL0 A;  3HEF A;  2LLK A;  2R7S A;  3WGG A;  2Y9Z A;  3F3X A;  1JT0 A;  5M5X J;  3BG3 A;  4MQV A;  5ILU A;  1Z3X A;  2PMH A;  1QRY A;  2H09 A;  3MKZ A;  4R79 A;  3HL2 A;  1QU3 A;  3J7Z I;  5JVT A;  2IP2 A;  2K4J A;  1BM9 A;  4OIR F;  3LSI A;  4HQM A;  4LMY A;  4O6J A;  3DKY A;  1ON2 A;  4D5F A;  2V1N A;  2GBY A;  2PG4 A;  5A2Q Z;  3CMM A;  2E60 A;  1NG6 A;  3Q0W A;  4OU0 A;  2Q2E B;  4XBF A;  1JKP C;  5AIP A;  1W5T A;  2XAJ A;  2OCE A;  3LFK A;  3CCU I;  3DTE A;  3OYG A;  2JT1 A;  3CDH A;  3E0J B;  2EH3 A;  1OIS A;  3CF5 F;  5FO5 A;  2VKH A;  4B43 A;  1YW7 A;  4AIJ A;  5DDG A;  4KIS A;  2CRG A;  2IW5 A;  2VE8 A;  5J8C A;  4Y3O A;  4Y13 A;  1G59 A;  2UXN A;  1IXC A;  1G3Y A;  1JGG A;  3OYL A;  1GXQ A;  2HYG D;  2EIN H;  4L0Z B;  1SD6 A;  5JI6 A;  1PVE A;  4XLC A;  1ODD A;  3K1P A;  1UHW A;  3HOT A;  2GM4 A;  2KRF A;  2IA2 A;  1P4W A;  4BJ5 C;  5K5O A;  1HLV A;  4PCQ A;  2PFB A;  5BS6 A;  1FPQ A;  3S32 A;  1KQ8 A;  5IYC J;  2DW4 A;  2QUF A;  5ICG A;  3C3W A;  1WQ2 A;  3FHN A;  2LKP A;  5F1J A;  1Q1V A;  1BR1 A;  3MVP A;  1FOY A;  5F27 A;  2XGX A;  1BIB A;  5FRN A;  3BCB A;  2NS8 A;  2XIG A;  5E1X A;  1VQP I;  3S8P A;  1FOW A;  5ILS A;  2NRA C;  1BI3 A;  3WTX C;  1IXS B;  1OR7 C;  3TQN A;  5IT3 A;  4IRH A;  2J5O A;  1REP C;  2YUS A;  1VQO I;  4MQ9 F;  4NC6 A;  5FKM A;  1OMI A;  1JTX A;  2DO7 A;  2YS9 A;  3A03 A;  1I1G A;  2BW3 B;  1T8I A;  3B6C A;  1QHH D;  3O2P E;  1WH5 A;  5M5Y J;  1MNM C;  4DIQ A;  4L5J A;  5L3F A;  2RVC A;  1D1A A;  1Z3Y A;  3CCE I;  2R5Y A;  1ZN2 A;  1TW3 A;  2I10 A;  3WOD F;  1ORK A;  5KCM A;  4XIC A;  2FD5 A;  5DCF A;  4G6Q A;  2NS7 A;  3VEP A;  2QLZ A;  1J7K A;  5LLQ A;  2HGC A;  2K7L A;  5KAI C;  4NDL A;  4II2 A;  4ZH4 F;  1XCV A;  2E35 A;  4IKF A;  2VQH A;  2D1V A;  4PSX A;  2KIU A;  4EJW A;  2BGC A;  4XN0 A;  4H4K C;  3RQ4 A;  1G3T A;  1U5T C;  1LUJ B;  4A6D A;  2VQG A;  3WG9 A;  4U7D A;  1Z91 A;  2VAS A;  2ZXI A;  4G6D A;  5HLI A;  3GX4 X;  2KRH A;  4QPQ A;  2J5P A;  4ENN A;  2WY7 Q;  2WV1 A;  1W7P B;  3MKL A;  4KIC A;  3CC4 I;  3DPT A;  3TP3 A;  3CJQ B;  4HV6 A;  4BQN A;  2W24 A;  3BTJ A;  3EQL F;  1G3S A;  5CLS A;  1O57 A;  3F9K A;  2P5V A;  4N9I A;  3M8F A;  2RGV A;  1IDY A;  3H0D A;  4E4H A;  2L02 A;  3LST A;  3ZP5 A;  2Y75 A;  2JSC A;  3BTC A;  3WU0 A;  1YS6 A;  1MJA A;  3GME A;  4F52 A;  2GXG A;  3ZCO A;  3FXU A;  3CF2 A;  2HVR A;  4IQ4 A;  3ZQQ A;  4JYK A;  1X3W B;  2FNP A;  2JA8 J;  4WCG A;  1BN5 A;  3IAM 2;  3KZY A;  3CO6 C;  3DKX A;  1TWG J;  1XGM A;  1HW5 A;  5D8K B;  3SEZ A;  3IRR A;  1JKR C;  3JTG A;  2NYX A;  4GO1 A;  4XMY A;  3W2A A;  4AID A;  1F36 A;  3AKZ A;  1QHG A;  3QPS A;  4JBA A;  5IP6 A;  3VYS B;  3OMY A;  3EDP A;  4NUB A;  1V5F A;  3F8F A;  5LD2 C;  4A3L J;  2ZNY A;  2HTS A;  2JA6 J;  4C2M J;  4YEL A;  1YE9 A;  3A01 A;  5D8L B;  2RKH A;  2ZCW A;  5J3L A;  1BC8 C;  2HU9 A;  3QRF F;  1K6O A;  4L9N A;  1YRN A;  5K7Z A;  4JK1 X;  4M6V A;  2VJ5 A;  1K78 B;  3QQA A;  2JWT A;  3HXL A;  3RZO J;  4KIT B;  3SFZ A;  3QYE A;  4OIQ F;  3BRO A;  4RAY A;  1MSF C;  2V1X A;  3E6M A;  4F3Q A;  1IAW A;  4IO9 F;  5CQG A;  2L5Q A;  2H27 A;  3DLL F;  3ISP A;  3J81 K;  3PQK A;  3IWF A;  3FXR A;  1HA8 A;  1YOV B;  4M73 A;  1BOA A;  2MH9 A;  3DU6 A;  1W0T A;  4EJO A;  4Y4R A;  5HDK A;  2CW0 F;  3RKQ A;  2R7U A;  3OR2 C;  1WGX A;  3CCY A;  2M0C A;  3LA7 A;  3SXY A;  3QU6 A;  3L2C A;  1YI2 I;  3P9I A;  1EH6 A;  1FP1 D;  1UEL B;  1BA5 A;  3WE2 A;  4N9H A;  5L3C A;  2CUZ A;  1VQK I;  3AFH A;  1F4K A;  3S2D J;  3BG7 A;  2OD5 A;  4CCO A;  3F8N A;  1B9N A;  4II3 A;  2O8X A;  3HC7 A;  2CW8 A;  1YTY A;  2RDP A;  2WAQ N;  2GXB A;  4P96 A;  1X1B A;  3IP4 B;  2E1M C;  3BT9 A;  3VFZ A;  2P81 A;  1S7A A;  2XF5 A;  3H9G A;  5D6E A;  1TTY A;  1MBG A;  2DA7 A;  4PDK A;  4IF4 A;  4FX4 A;  1LQ1 A;  3RPQ A;  3MZY A;  1RNL A;  1DP7 P;  2HKO A;  4LIU A;  3BJO A;  4BGD A;  4J01 A;  2X6Y A;  1EH7 A;  2DOA A;  5C4X J;  1L0O C;  2PQ8 A;  3KLO A;  3AAF A;  2M2E A;  5EGO A;  1KQ9 A;  2XV4 S;  2DT5 A;  4A0Y A;  2LH9 A;  1M1E B;  5ICE A;  3UKG A;  3OSF A;  5EDN A;  2FOK A;  1MGT A;  3OL4 A;  1A31 A;  2AO9 A;  2QWW A;  1F1Z A;  1NHA A;  2VBW A;  1X1C A;  3S1R J;  2BZT A;  5J6X A;  3A02 A;  2E1M B;  1P9Q C;  5E3O A;  3PQJ A;  4ZYH A;  3GFI A;  2LKX A;  4IOA F;  2XRN A;  3VSL A;  1B59 A;  2FJ1 A;  4XRF A;  2QEN A;  3L09 A;  3TMO A;  5JHF A;  5BPD A;  2LSO A;  1H88 C;  1U8R A;  2LC2 A;  3FIW A;  4DYQ A;  1NTC A;  1O3Q A;  4X6A J;  3G6E I;  1T98 A;  2P7C B;  1B1B A;  2GOX B;  3CDL A;  3DXJ F;  2KDO A;  3BQZ A;  3E5X A;  3ESW B;  3OWT A;  1AWC A;  4G12 A;  3S93 A;  2CMP A;  2M8E A;  3JRF A;  1DU6 A;  2L9R A;  2LVS A;  3MZ8 A;  3U9G A;  1ZRC A;  2CQX A;  2VLA A;  2EA4 A;  2Z1D A;  1B72 B;  5FB2 A;  1NK3 P;  3R4K A;  1LNW A;  5EG0 B;  1ZGW A;  5DM7 F;  3F23 A;  3T1B A;  2R5Z B;  2VOP A;  3FKI J;  1XC5 A;  2TCT A;  1J0R A;  1ONV A;  1VQ7 I;  3ZMS A;  2F4O B;  1D5V A;  2LRD A;  5E1W A;  3CTA A;  1ETW A;  1XN7 A;  1OCT C;  4FE4 A;  3ZQC A;  4HX8 A;  2CGP A;  4UUV A;  5FFZ A;  3QPL A;  1FIA A;  1T33 A;  3LNQ A;  4GXO A;  5BNG A;  4F91 B;  3V42 A;  3BG9 A;  2Z99 A;  3JAM K;  2LOO A;  2MW8 A;  4KN7 X;  2DQL A;  2R0Q C;  4RGU A;  3FXQ A;  5IPA A;  1JKQ C;  5IYD J;  2YU9 J;  2O6G E;  1IRF A;  1FYL A;  2QZ8 A;  4A3K J;  1KQ0 A;  3FMQ A;  2YSR A;  1IXR C;  5LHG A;  3CMA I;  3QP6 A;  3H92 A;  1JTY A;  3GW2 A;  4RDU A;  3WTS C;  1BC7 C;  3HOU J;  2IGM A;  2XAU A;  1Y0N A;  3S17 J;  2L9V A;  2Y31 A;  2R3S A;  4IPA A;  3HDD A;  4LG0 A;  3K4C A;  2XKP A; 
#chains in the Genus database with same CATH homology
 1MDM B;  2P4W A;  5F6F A;  6PAX A;  3JW4 A;  1USS A;  2EJR A;  3F6O A;  1MD0 A;  2YX4 A;  2OU2 A;  1FT9 A;  1U2W A;  2IA1 A;  3NRV A;  1XMA A;  3BPX A;  3KP4 A;  1ZGA A;  2LF8 A;  1SMT A;  3F21 A;  3VOD A;  2HR3 A;  4UVB A;  2AXL A;  2XUB A;  2JZY A;  3GZ6 A;  1KU7 A;  2FML A;  3P9C A;  2JPB A;  3IHU A;  2IRF G;  3QPT A;  3C7J A;  2A5Y B;  4KDP A;  3MEX A;  4L0Y B;  4HLX A;  2YR2 A;  2CFX A;  1U78 A;  1OYY A;  3GFM A;  1QQI A;  2DPU A;  3IL2 A;  1IN4 A;  1TW2 A;  2XAS A;  3U1D A;  1R36 A;  1QNT A;  4M74 A;  3FZV A;  1YQA A;  2D2W A;  2E1N A;  1J5Y A;  3COA C;  4LFU A;  1SFE A;  2EV5 A;  1FBS A;  1MJ9 A;  3ZQ7 A;  1BI0 A;  1B4A A;  2JRT A;  1ULY A;  3FHZ A;  3I59 A;  2XHK A;  1FP2 A;  2VBX A;  2L4M A;  4M6X A;  1LEB A;  1QZY A;  2YPR A;  4ESF A;  2AS5 F;  4KMF A;  2OQR A;  5EEG A;  2DQR A;  2P5K A;  2HDC A;  5E8G A;  1LEA A;  2VE9 A;  2EFP A;  1XSV A;  2XAH A;  3CJN A;  3BDD A;  3TGN A;  4QLC U;  2K4B A;  2L54 A;  1TQM A;  3KET A;  2KIM A;  5HS7 A;  3HOS A;  2CG4 A;  3H3U A;  5IT9 Z;  4EM0 B;  1ZLK A;  1S8N A;  2ZO4 A;  1C0W A;  4MHG A;  2PI0 A;  4ZYE A;  1XB4 A;  1BI2 A;  2HFH A;  2VC1 A;  5FD5 A;  2RN7 A;  1KU3 A;  4ENM A;  5H6Q A;  2F2E A;  3RPU A;  1OYI A;  4YG2 F;  1ZAO A;  3M8E A;  3KP2 A;  4XSZ F;  4CO8 A;  2KKO A;  3V7S A;  2NNN A;  3FM5 A;  1LVA A;  4GYG A;  4DNC A;  4GCV A;  3TDZ C;  3I53 A;  3QU3 A;  3IKT A;  1YG2 A;  2B0L A;  4I0B A;  4KNY A;  3GEZ A;  1K79 A;  4MTD A;  3RKX A;  3J80 Z;  5TJJ A;  3DKW A;  1ZGJ A;  4YFK F;  3P9K A;  2M45 A;  1QBJ A;  5H6R A;  4B09 A;  1G4D A;  1BJA A;  4KT5 C;  4LK1 F;  3E6B A;  1E2X A;  2DI3 A;  2GA1 A;  4G8X A;  4EGZ A;  2Q2E A;  4OIN F;  1LDJ A;  2EWN A;  2FA5 A;  1UCR A;  1R00 A;  3ML6 A;  3E5U A;  3WGH A;  3GLX A;  1Y0U A;  2EV0 A;  3U2R A;  4RB2 C;  1SAX A;  3F8C A;  5LHI A;  2FNA A;  3KP5 A;  1XD7 A;  2BE5 F;  2FBH A;  1IUY A;  2YX7 A;  1DDN A;  1XGS A;  4KIB A;  2F5E A;  3FM3 A;  1IF1 A;  1TLH B;  1WI9 A;  2CWE A;  1J2X A;  2IVM A;  2JTV A;  4UV9 A;  1JHF A;  2PBI A;  1FX7 A;  4CZZ A;  5DEQ A;  4M71 A;  5LHH A;  1K7A A;  1R58 A;  4IJA A;  1YS7 A;  2ZFW A;  2V79 A;  3WU1 B;  5LGT A;  3RI4 A;  1JXS A;  3HIF A;  1O3T A;  1WKM A;  2CQK A;  4UVC A;  4A5M A;  3TO9 A;  3F22 A;  1DUX C;  1HQC A;  3DEU A;  3RKY A;  4I98 B;  1ZRF A;  2OBP A;  2K27 A;  1R22 A;  2DTR A;  1D8K A;  2A6H F;  2LF7 A;  2BBY A;  2Q8K A;  2EFO A;  1U6G A;  5CVI A;  1OR7 A;  3RTR A;  3TOB A;  4LJZ F;  2G9W A;  3V8L A;  1W7P A;  5D5X B;  4N0B A;  3K0L A;  5FLX Z;  2EA2 A;  4F7Z A;  4M9X A;  4GYI A;  4I02 A;  3I0T A;  3T8T A;  3HRM A;  3P7N A;  1WSU A;  3CLO A;  1SFU A;  2P6S A;  4WX9 A;  1UHM A;  3GXO A;  4I2O A;  3BJA A;  5HOO A;  3I54 A;  1S3J A;  3L00 A;  4EJT A;  2BYV E;  4E70 A;  5CJ9 A;  2D45 A;  2MC3 A;  5E17 F;  4I09 A;  2O03 A;  4U0W A;  2MD5 A;  5ED4 A;  3ZMD A;  5HDN A;  2DAO A;  5E18 F;  3NQO A;  5HS8 A;  2A69 F;  3WTV C;  1ZRE A;  2W84 A;  1K78 A;  5K5Q A;  1U5T B;  1RUN A;  1YIO A;  2FU4 A;  4ESB A;  3R0A A;  1FYM A;  2DFI A;  1J75 A;  2HQN A;  1UST A;  1SD5 A;  3K9T A;  1WRJ A;  3QP5 A;  4G9Y A;  1OYW A;  4AIK A;  1KA8 A;  2VN2 A;  1DPR A;  4EGY A;  4OIO F;  5CYV A;  3TO6 A;  4A5N A;  1P2F A;  1FBU A;  5HLG A;  2PLY A;  2HZT A;  5BPI A;  3M1E A;  3HTU A;  4PGG A;  1KGS A;  1QPM A;  4BHB A;  3N97 A;  2M87 A;  3GVA A;  3IC7 A;  4UHT A;  5HLH A;  1FSH A;  4AVP A;  2A3S A;  3Q5F A;  2HS5 A;  3B02 A;  1TQI A;  1ZG1 A;  3WTY C;  2UWM A;  3KZZ A;  2V1D A;  1AOY A;  2X0L A;  2G7U A;  4Z2Y A;  3E3V A;  4XLP F;  3W6K B;  1CF7 A;  4WXC A;  5FD6 A;  3ZPL A;  3RYP A;  3WE3 A;  2WV0 A;  2OZU A;  4AIH A;  2IPQ X;  1GHC A;  2M5W A;  3IWZ A;  1FSE A;  1OKR A;  3OOP A;  2VON A;  2VOD A;  2FRH A;  2FXA A;  3MWM A;  3O6B B;  2QYO A;  4LD5 A;  2WTE A;  2NS0 A;  1LB2 A;  1Z9C A;  3M7G A;  2DK8 A;  3V7R A;  5HS9 A;  2ZXJ A;  1ZG5 A;  1HW2 A;  2UZK A;  4CHU A;  3V4G A;  2HEO A;  4NQW A;  2IJL A;  1I5Z A;  5DUI A;  3IKV A;  4UVA A;  3F6V A;  1P6R A;  2W25 A;  3E6C C;  3D5L A;  5L3D A;  4KIF A;  1YW9 A;  4KMU X;  2W57 A;  3JSO A;  1O3S A;  1FOK A;  2EB7 A;  2F5F A;  3V8K A;  1STZ A;  2FEZ A;  2ESN A;  4ENK A;  3D0S A;  3L7W A;  1MDM A;  4WXH A;  4UXN A;  2KIF A;  3KFW X;  2MLK A;  5LEJ A;  3I4P A;  1T39 A;  2V1U A;  3C18 A;  5ERI A;  1BI1 A;  1R1T A;  4GGG A;  4M9Z A;  5D4R A;  4IRI A;  1FZP B;  4OOI A;  4LK0 F;  4I01 A;  3KLN A;  4M72 A;  2E1C A;  2NAZ A;  3Q9S A;  4OMY A;  5K5R A;  2E7X A;  1TNS A;  4ETS A;  2V9V A;  4O3M A;  2FBK A;  2ZKZ A;  1UFM A;  2LNB A;  4RGR A;  3K2Z A;  5JR3 A;  1QGP A;  4R1H A;  3CUQ C;  2ZJ2 A;  4S05 A;  2F5D A;  4Q4Z F;  2JPC A;  1XSD A;  4KIG A;  1XMK A;  2P5L C;  2BV6 A;  2K02 A;  1V4R A;  3LAP A;  4O5V A;  2RQP A;  4U88 A;  2ISZ A;  4LG0 B;  2D1H A;  1ZG3 A;  2ZME B;  3ZMZ A;  4Q47 A;  3HTS B;  1J9I A;  3ABT A;  4AWX B;  4RAZ A;  3KCC A;  3CUQ B;  3WTW C;  3Q9V A;  2IA0 A;  1WWX A;  2RNJ A;  2HTJ A;  1R1U A;  5DCM B;  1RUO A;  3QPH A;  3I5U A;  1F9N A;  2ELH A;  1G6N A;  1Z7U A;  1PUE E;  1LJ9 A;  2LDU A;  1V3F A;  5ILV A;  3GFL A;  1KYZ A;  3BP8 A;  3K69 A;  2PMU A;  3I58 A;  4WF2 A;  1JE8 A;  4RS8 A;  2HOE A;  2H94 A;  4BHP A;  4G7O F;  1T38 A;  5BMZ A;  2ESH A;  1S29 A;  3HSF A;  3WTT C;  2HKX A;  1XDS A;  1Z1D A;  4XLN F;  4Q48 A;  1JHH A;  2C6Y A;  2ZNZ A;  1TNT A;  2DU9 A;  3J7A O;  4HZF A;  3DPL C;  3TOA A;  2A68 F;  5JHU A;  1YW8 A;  4IHS A;  3RIR A;  5EEH A;  3M9A A;  5IT9 K;  3ZMT A;  3HYI A;  3BOQ A;  5E20 A;  2EFQ A;  2TDX A;  1J59 A;  2QQB A;  1YLF A;  1W5S A;  3CO7 C;  3HRS A;  5H20 A;  4HOB A;  2FE3 A;  3V8J A;  1PDN C;  1SD4 A;  1ZAR A;  2GWR A;  5D6F A;  4LGW A;  2XAF A;  3GWZ A;  1T0F A;  3DP7 A;  1Z6T A;  3HSE A;  4BQA A;  2FBI A;  4QWQ A;  4EM1 A;  1ZLJ A;  1S7O A;  1D8J A;  2PN6 A;  3ZN0 A;  4UV8 A;  2Z5U A;  4CYD A;  4RGS A;  3MZH A;  4Q5S F;  3KP7 A;  3J80 K;  3SZT A;  4P55 A;  3FF5 A;  5ICC A;  1SFX A;  4YFN F;  4KA4 A;  5CVJ A;  2R7D A;  5DYM A;  2CSO A;  4U0Y A;  2EK5 A;  3GF2 A;  1B6A A;  3FMS A;  2F5C A;  1MZB A;  1IN8 A;  2RV8 A;  3HHH A;  5HVQ C;  4U7B A;  1SMY F;  4HAM A;  4BHC A;  3KP3 A;  1RIO H;  4ZZD A;  3ABU A;  2A6E F;  4MTE A;  1T6S A;  4DQ2 A;  1R1V A;  4B8X A;  2E7W A;  2IT0 A;  4TV7 A;  1X3U A;  4HQE A;  1QZZ A;  2DLL A;  3WTU C;  4EM2 A;  2K86 A;  4LB6 B;  2MA3 A;  3EYY A;  5A2Q K;  2GZW A;  2FF4 A;  3IRQ A;  4LLG F;  3JTH A;  5LRR A;  1IN5 A;  4L9V A;  2FSW A;  1O7F A;  4LLN A;  2L01 A;  2QBY B;  1XGN A;  1TBX A;  4G94 A;  3LWF A;  3ZN1 A;  1FBQ A;  1XGO A;  3FMR A;  3MFK A;  3C1D A;  3GO5 A;  2XAG A;  4LB5 A;  2Y0M A;  5LBQ A;  3T5X A;  4MNU A;  2VBY A;  5KVR A;  4BYY A;  3LQQ A;  4KYW A;  3GFJ A;  5FFX A;  1UB9 A;  4P9U A;  4YII A;  3REO A;  2WWY A;  1TQP A;  2Z3Y A;  3PFI A;  4K2E A;  2PEX A;  2VC0 A;  3BY6 A;  1I27 A;  3ZMV A;  4HYE A;  5D5W B;  5TRD A;  2V6C A;  5FLX K;  2G7H A;  3TDU C;  3BJ6 A;  4EQQ A;  3ECO A;  5CVR A;  1YFH A;  4PGH A;  3EYI A;  4BXU A;  2H6C A;  3K1N A;  1F5T A;  4HBL A;  2Y48 A;  3DF8 A;  2STW A;  4WWC A;  1U5T A;  1IZ1 A;  1I6X A;  5LGN A;  2GQQ A;  5FGM A;  5LEK A;  1E17 A;  4WK8 F;  3B73 A;  5LGU A;  1KYW A;  1MJB A;  4UNO A;  4JQF A;  3RYR A;  4R8H A;  1R5H A;  2FQ3 A;  1HKT A;  1ZYR F;  4YFX F;  5D5V B;  4OIP F;  2OAZ A;  2WC2 A;  5AIQ A;  4MEY F;  3S2W A;  1ZHF A;  4ZYG A;  1P4A A;  1HW1 A;  1GXP A;  2NNY A;  1HST A;  3GUD A;  3I71 A;  2MH2 A;  1T2K A;  4CIC A;  2ADU A;  4HDU A;  1Q1H A;  1A04 A;  4FT8 A;  4A12 A;  2VBZ A;  2H6B A;  2VXZ A;  3VB2 A;  5ICF A;  5K1Y A;  1R23 A;  2Z9O A;  2KJC A;  1PP7 U;  3DQV C;  4RB1 A;  1HKS A;  4IXA A;  4ASN A;  1VTN C;  5KK1 A;  4A0X A;  5LRS A;  5D4S A;  1EV7 A;  4M9S A;  4XSX F;  3TO7 A;  1I1S A;  2EFW A;  3LAJ A;  4HF2 A;  3LA3 A;  3EET A;  5JFR A;  3J81 Z;  1R5G A;  5DV5 A;  1ON1 A;  4HW0 A;  4NHJ A;  1HSJ A;  2BEO A;  4D0P A;  2XKO A;  1B9M A;  3F8M A;  2ETH A;  4A0Z A;  1IW7 F;  2L3D A;  4P5O A;  4MEX F;  1ZRD A;  5CVU A;  4HV5 A;  1CGP A;  3JSP A;  2OQG A;  3SHF A;  4ZZL A;  1P4X A;  3RJP A;  2QVO A;  1QO0 D;  1YYV A;  3MAJ A;  2M30 A;  2P7V B;  1O7L A;  4CXF A;  2VOO A;  1DPU A;  2UXX A;  5DUK A;  3SQN A;  3RDI A;  1HBX G;  4EMS A;  5DD4 A;  4I0A A;  5BOX A;  1S6L A;  3I64 A;  1ZH5 A;  4Y17 A;  3BZ6 A;  1CF7 B;  1IN6 A;  4AD9 A;  4HA8 A;  2Q0O A;  3R61 A;  2XRO A;  3HUG A;  3CUO A;  2DK5 A;  1HXD A;  2EFN A;  2QQA A;  4IRG A;  1BIA A;  1FNN A;  3KP6 A;  3ULQ B;  3NEU A;  5DD8 A;  3K1M A;  4EV0 A;  3ERE D;  1W7P D;  2R7F A;  2HQR A;  3SZP A;  3T8R A;  2XVC A;  1Z6R A;  3ZMU A;  2MBF A;  5D5U B;  3JAM Z;  3HRT A;  3FX3 A;  3E97 A;  2HWV A;  3R60 A;  2GA2 A;  3HHG A;  3MQ0 A;  2Z33 A;  4YIF A;  4EVI A;  4L18 B;  1G3W A;  1L3L A;  2ZME A;  4BNC A;  4HX7 A;  2CYY A;  3R0J A;  3CUQ A;  4HX4 A;  3LA2 A;  1H0M A;  5L3B A;  1R7J A;  1LDK B;  5DCM A;  4HF0 A;  4BAY A;  4H0E A;  4KN4 X;  1PP8 F;  4L9J A;  5BQT A;  5AON A;  3T0Y A;  4RB3 C;  5E1Z B;  1GVJ A;  2L4A A;  4G7H F;  4P9F A;  4EJU A;  2X4H A;  3V7C A;  4I7H A;  4U0V A;  1EH8 A;  1FC3 A;  1LDD A;  4ENJ A;  1XCB A;  1Z05 A;  4KFC A;  2O3F A;  5E8I A;  1W4M A;  3BPV A;  3N4M A;  2OZ6 A;  3RKW A;  3W6J B;  1KU9 A;  4ON0 A;  2M1B A;  3DV8 A;  3QAH A;  5L3G A;  1H9T A;  2RC4 A;  2ZBK A;  1P92 A;  1RZ4 A;  4LLL A;  4CGZ A;  2PJP A;  5F1R A;  4MGR A;  5F64 A;  4A6E A;  5J8F A;  5CVV A;  2KJB A;  4RB0 A;  4G7Z F;  3E5Q A;  1OPC A;  4ESJ A;  1IN7 A;  2XAQ A;  3GZ5 A;  3E6D A;  4ZYD A;  2DBB A;  2VT2 A;  3KEO A;  2ISY A;  3FWE A;  4BH9 A;  4HLY A;  2QM3 A;  3GYH X;  2DPD A;  1HKQ A;  1KU2 A;  2COM A;  3KEQ A;  4L9T A;  2MLG A;  2VT3 A;  3MCZ A;  2OA4 A;  2O61 A;  4CDG A;  3ELK A;  3I59 B;  2A61 A;  3HRU A;  4Y15 A;  2STT A;  2CO5 A;  4EJV A;  3KE2 A;  4A2U A;  1RI7 A;  4IVN A;  4L5I A;  2HYF A;  2P8T A;  4OMZ A;  3G73 A;  3O3K A;  2GIV A;  4FX0 A;  3VOE A;  1JGS A;  5L3E A;  1MKM A;  2W85 A;  3F72 A;  4HDV A;  3H3Z A;  3ECH A;  1O3R A;  5HDG A;  1SD7 A;  2P6T A;  4KUM A;  1IRG A;  3HSR A;  4FHT A;  2EV6 A;  1BBY A;  1XSX A;  1FWZ A;  3QOP A;  3G3Z A;  2FMY A;  3DFG A;  2O0Y A;  1FYK A;  1H9G A;  3WGI A;  3TKY A;  1D3Y A;  2YU3 A;  3F8B A;  1XDU A;  4RGX A;  4PZJ A;  2ACJ A;  3ROU A;  3OV8 A;  2GAU A;  4HF1 A;  2QQ9 A;  2A07 F;  1YO5 C;  3R6S A;  1FY7 A;  4NB5 A;  3LQR A;  4S04 A;  4WXD A;  2QBY A;  3EUH A;  4M6Y A;  4IHT A;  3BWG A;  3L9F A;  3WTZ A;  1FLI A;  1U3E M;  3WGG A;  3F3X A;  5ILU A;  4MQV A;  2PMH A;  2H09 A;  4R79 A;  5JVT A;  2IP2 A;  2K4J A;  1BM9 A;  4OIR F;  4HQM A;  4LMY A;  4O6J A;  1ON2 A;  2PG4 A;  5A2Q Z;  4OU0 A;  4XBF A;  5AIP A;  1W5T A;  2XAJ A;  3LFK A;  2JT1 A;  3CDH A;  5FO5 A;  1YW7 A;  4AIJ A;  5DDG A;  2IW5 A;  2VE8 A;  5J8C A;  4Y13 A;  2UXN A;  1IXC A;  1G3Y A;  1GXQ A;  2HYG D;  4L0Z B;  1SD6 A;  5JI6 A;  1ODD A;  3K1P A;  1UHW A;  3HOT A;  2KRF A;  2IA2 A;  1P4W A;  5K5O A;  4PCQ A;  2PFB A;  5BS6 A;  1FPQ A;  1KQ8 A;  2DW4 A;  2QUF A;  5ICG A;  3C3W A;  1WQ2 A;  2LKP A;  2XGX A;  1BIB A;  2XIG A;  5E1X A;  5ILS A;  2NRA C;  1BI3 A;  3WTX C;  1IXS B;  3TQN A;  5IT3 A;  4IRH A;  2J5O A;  1REP C;  4MQ9 F;  1OMI A;  2DO7 A;  1I1G A;  3O2P E;  4L5J A;  5L3F A;  2RVC A;  1ZN2 A;  1TW3 A;  3WOD F;  5DCF A;  4G6Q A;  3VEP A;  2QLZ A;  1J7K A;  5LLQ A;  2HGC A;  2K7L A;  4ZH4 F;  1XCV A;  2D1V A;  2KIU A;  4EJW A;  2BGC A;  1G3T A;  1U5T C;  4A6D A;  3GX4 X;  3WG9 A;  4U7D A;  1Z91 A;  4G6D A;  5HLI A;  2J5P A;  4ENN A;  4KIC A;  1W7P B;  3DPT A;  4HV6 A;  2W24 A;  3EQL F;  1G3S A;  5CLS A;  1O57 A;  2P5V A;  4N9I A;  3M8F A;  2RGV A;  2L02 A;  3LST A;  3ZP5 A;  2Y75 A;  2JSC A;  3WU0 A;  1YS6 A;  1MJA A;  2GXG A;  3FXU A;  2FNP A;  4WCG A;  1BN5 A;  3CO6 C;  3KZY A;  1XGM A;  1HW5 A;  5D8K B;  3IRR A;  3JTG A;  2NYX A;  4GO1 A;  4JBA A;  3EDP A;  3F8F A;  2ZNY A;  2HTS A;  5D8L B;  2RKH A;  2ZCW A;  1BC8 C;  3QRF F;  1K6O A;  4L9N A;  4JK1 X;  1K78 B;  3SFZ A;  4OIQ F;  3BRO A;  4RAY A;  2V1X A;  3E6M A;  1IAW A;  2H27 A;  3ISP A;  3J81 K;  3PQK A;  3IWF A;  3FXR A;  4M73 A;  1BOA A;  2MH9 A;  4EJO A;  5HDK A;  2CW0 F;  3LA7 A;  3SXY A;  3QU6 A;  3L2C A;  3P9I A;  1EH6 A;  1FP1 D;  3WE2 A;  4N9H A;  5L3C A;  1F4K A;  2OD5 A;  3F8N A;  1B9N A;  2O8X A;  1YTY A;  2RDP A;  2GXB A;  4P96 A;  3VFZ A;  1S7A A;  5D6E A;  1TTY A;  4PDK A;  4IF4 A;  4FX4 A;  1LQ1 A;  3RPQ A;  3MZY A;  1RNL A;  1DP7 P;  2HKO A;  3BJO A;  1EH7 A;  1L0O C;  2PQ8 A;  3KLO A;  3AAF A;  1KQ9 A;  2XV4 S;  2DT5 A;  4A0Y A;  5ICE A;  2FOK A;  1MGT A;  2QWW A;  1F1Z A;  1NHA A;  2VBW A;  5J6X A;  3GFI A;  3PQJ A;  4ZYH A;  2XRN A;  1B59 A;  4XRF A;  2QEN A;  3L09 A;  5BPD A;  2LSO A;  1U8R A;  1O3Q A;  1T98 A;  2P7C B;  1B1B A;  3DXJ F;  3E5X A;  1AWC A;  2M8E A;  3U9G A;  1ZRC A;  2EA4 A;  5FB2 A;  3R4K A;  1LNW A;  3F23 A;  3T1B A;  2VOP A;  1J0R A;  1ONV A;  3ZMS A;  1D5V A;  5E1W A;  3CTA A;  1XN7 A;  4HX8 A;  2CGP A;  4UUV A;  5FFZ A;  4GXO A;  2Z99 A;  3JAM K;  4KN7 X;  2DQL A;  4RGU A;  3FXQ A;  2O6G E;  1IRF A;  1FYL A;  2QZ8 A;  1KQ0 A;  3FMQ A;  2YSR A;  5LHG A;  1IXR C;  3QP6 A;  3H92 A;  3GW2 A;  3WTS C;  1BC7 C;  2R3S A;  4IPA A;  4LG0 A;  2XKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...