5D8KB

Human hsf2 dna-binding domain bound to 2-site hse dna at 1.73 angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*GP*TP*TP*CP*TP*AP*GP*AP*AP*CP*C)-3')
publication title Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2015-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d8kB00
1W5TA 1TBXA 5L3BA 2HTSA 1L3LA 4NQWA 4QWQA 2K4JA 5ICEA 1ZRDA 3T1BA 2ZKZA 3RYRA 2A61A 1BOAA 3VEPA 3LAJA 5AONA 3F8BA 4KFCA 2KJCA 1T2KA 5L3EA 2QUFA 5CYVA 3FM5A 5DCMA 4P9FA 2P6TA 4CO8A 5LHHA 4JBAA 2IPQX 4O3MA 5E8GA 5L3FA 4LB6B 3ZMDA 3N97A 2FOKA 4YG2F 4KIBA 4DQ2A 4BYYA 3CJNA 2H94A 1T0FA 1F4KA 3VFZA 2FA5A 3AAFA 1HQCA 1FWZA 1GXPA 2DLLA 1FBQA 3FX3A 2C6YA 2IA0A 1RZ4A 3C1DA 2YSRA 2XVCA 3ISPA 5TJJA 1CF7B 2V9VA 4RGSA 1IZ1A 1ODDA 2HOEA 2PBIA 2MLGA 4EMSA 3TO6A 4EJOA 4EM2A 3HRTA 1L0OC 1Q1HA 1Z05A 1TQIA 5IT9Z 4XLNF 2IP2A 3QOPA 1JE8A 4I98B 5J8FA 2RDPA 4OOIA 3MEXA 2VBWA 3I54A 2RVCA 2AS5F 2CFXA 5D5VB 3P7NA 4LMYA 3R4KA 1FOKA 2GA2A 1ON1A 3F72A 2L02A 5DCFA 1RNLA 1O3SA 4G6QA 3TGNA 1A04A 5FLXZ 4M9XA 1ULYA 2VC1A 5TRDA 1G6NA 2GXGA 1CF7A 1R00A 3KZYA 2PJPA 3EDPA 2VT3A 1QO0D 3WTVC 2A68F 2H6CA 5DUKA 2XROA 2UZKA 2PEXA 4N0BA 3HRUA 4BH9A 3KP7A 3DEUA 4FHTA 1O57A 2UXXA 3G3ZA 1FP1D 2H09A 3TOAA 3TDZC 2L54A 5K5RA 2H6BA 3I58A 4G7HF 3DKWA 1V3FA 3PFIA 2X4HA 1MJ9A 3R60A 4U0YA 4HQMA 5CVRA 1E2XA 1I27A 3K0LA 1QZYA 1DUXC 2B0LA 4MQ9F 3TQNA 2KIUA 1J2XA 5E1XA 2QBYA 1ZREA 3SFZA 1FT9A 3BJ6A 3ECHA 3WE2A 3QAHA 3V8JA 3GW2A 3VODA 1I1SA 4BHPA 4L9VA 1LDKB 1YW9A 1VTNC 3SHFA 4EQQA 3HTSB 3DF8A 5FFZA 4HF0A 4TV7A 2P7CB 4HW0A 4UUVA 3FMQA 3ABUA 5BPDA 2YR2A 4KN7X 1H9GA 1IXRC 3DP7A 4F7ZA 1C0WA 2ELHA 3U9GA 2PQ8A 1R36A 2BEOA 3P9IA 3K69A 2XAFA 2CWEA 1XMKA 1SMYF 3GYHX 3ZPLA 4U7DA 2O6GE 3FHZA 3N4MA 4Y15A 2V1UA 1UFMA 1G3YA 5DYMA 3MQ0A 3KEQA 1ZRFA 3TO9A 4UV8A 2QZ8A 3U1DA 4HX4A 4M6XA 4IVNA 2Z99A 3B73A 4PZJA 4U0VA 3E6DA 3TOBA 2A6HF 2HTJA 1K6OA 4KUMA 2Z3YA 1IW7F 3ZP5A 1XDSA 3KLNA 3LAPA 1KU7A 2BBYA 3HSEA 3DPLC 2FNPA 1IF1A 5BMZA 4AVPA 1UHMA 1IRGA 3R0JA 3WGGA 2STWA 5DD8A 1R5HA 3BWGA 2G7HA 1BI2A 1H0MA 2CG4A 3WU1B 5HDKA 4P96A 1HXDA 2TDXA 1S3JA 3QP6A 4WK8F 4L0YB 4CYDA 1B4AA 3LWFA 3EETA 3GZ6A 3FXQA 1YW8A 4LGWA 1YTYA 2NNNA 1U5TB 2YPRA 2FMLA 1O3RA 1Z7UA 1OR7A 2D45A 3LSTA 1IXSB 4H0EA 2IVMA 4IHTA 4UVAA 4G9YA 3RKWA 2XAJA 5ERIA 3WTUC 3NRVA 4YFXF 5LGNA 4YIIA 3DPTA 2ZBKA 2HDCA 3HHHA 1K78B 2OA4A 1LVAA 1RUOA 4L18B 2IJLA 1SAXA 2Q8KA 3R0AA 5D6EA 2O3FA 4UV9A 4PGGA 4OIPF 4UXNA 1B9NA 1XMAA 4I0AA 4L0ZB 1HKSA 2ZNYA 5F6FA 4ZH4F 4KICA 2WC2A 4BAYA 1WWXA 1R1VA 1D8JA 4Y17A 1BIAA 4D0PA 4CXFA 4G7OF 2FBHA 5CLSA 1MGTA 3GEZA 3FM3A 1HSJA 2F2EA 2HGCA 4M72A 2ESHA 3HOTA 4M71A 3QU6A 2K27A 2WWYA 1Z6TA 1K78A 3GUDA 3GO5A 2OU2A 1S7OA 2EK5A 5LHGA 2XASA 1R1TA 4MEYF 1XD7A 2ADUA 2RNJA 6PAXA 1U3EM 1SD6A 1YIOA 4KT5C 1EV7A 2ISYA 1D3YA 1LDJA 2FSWA 2ZCWA 3LA3A 1TQMA 1HKQA 4KN4X 2HQRA 3M1EA 1ZAOA 5E1ZB 4RB0A 4LG0B 2OQGA 5LGTA 4HOBA 3WG9A 2Q0OA 5AIPA 4MQVA 1W7PB 5JFRA 1XSXA 2GAUA 3KP2A 2OAZA 5FFXA 1BBYA 3M7GA 3J81Z 1KYWA 1B59A 3E97A 4A0YA 3RIRA 1HW1A 2QENA 3CUQB 3K1PA 1CGPA 1OYIA 2D1HA 3J80K 3CO7C 3WTYC 4XLPF 3BROA 1BI0A 2PFBA 2VOPA 3TDUC 2EB7A 5D5UB 3E5XA 3E6BA 1STZA 2HQNA 2VE8A 2ZMEB 2EWNA 4L5JA 3F8MA 2XRNA 2ETHA 3BY6A 3BOQA 3KFWX 2W84A 5D6FA 3L2CA 3KZZA 1F5TA 4KDPA 2E7WA 3I59B 1AWCA 3ZMTA 1ZGAA 4U88A 5FD6A 2HKOA 3ERED 1ZRCA 2F5CA 5HS7A 2WV0A 5E1WA 4GO1A 3O2PE 2V6CA 1YG2A 2L4MA 3IL2A 2A6EF 3JSPA 1Y0UA 3KCCA 3GX4X 1ZG5A 3KLOA 1YS6A 3IRRA 4RS8A 3WODF 3NEUA 3NQOA 3PQJA 3KP4A 4ZYGA 4P5OA 2F5DA 3GZ5A 1LDDA 1P2FA 1LB2A 2JT1A 2GZWA 3FXRA 1FSEA 5J6XA 4HV5A 5H6QA 4IRIA 5LLQA 2DO7A 4B09A 3L00A 1I6XA 2H27A 1BC8C 2Y75A 1P4WA 3ZMZA 1SMTA 4PCQA 1PDNC 3WTSC 4OMYA 2HYFA 4ZZDA 4HF1A 4JQFA 2LNBA 4AIJA 5K1YA 2HEOA 3Q9VA 5H6RA 4P55A 2P4WA 3O6BB 2E1NA 4HF2A 3ECOA 2XUBA 4YIFA 4ZYHA 4ZYEA 2BGCA 3GVAA 1MJAA 3C7JA 3ZMSA 2XHKA 3FXUA 1GXQA 4S05A 2O8XA 2M30A 2DTRA 3B02A 3HHGA 1Z9CA 5ILVA 1HSTA 3L09A 5ILUA 2P7VB 2MA3A 4ENJA 4Q4ZF 2PMUA 3ABTA 3GFLA 1O3QA 1T39A 2XAGA 3IWFA 4ZYDA 3BPVA 1XSDA 1XCBA 4HX8A 4R1HA 3DXJF 3JW4A 3V8KA 3IKTA 3KETA 3IHUA 4WWCA 1XGNA 4O5VA 2PG4A 4LK1F 4HZFA 4WXDA 1S7AA 2DQRA 1TW3A 2CO5A 4A2UA 5E8IA 1P4XA 3HSFA 4OU0A 4GYIA 1U2WA 1G3SA 2VXZA 1BI3A 1BI1A 2L4AA 1FP2A 2A69F 2NAZA 2STTA 4I09A 3C3WA 2FEZA 3MCZA 4M9SA 1ZHFA 3RPUA 1UB9A 3V8LA 4G8XA 1LJ9A 3HRSA 3JTGA 1IAWA 4IJAA 4O6JA 1J75A 1G3WA 2J5OA 4GXOA 1D8KA 4ON0A 2BV6A 3W6KB 4HBLA 4BQAA 1J5YA 3F22A 5F64A 1YW7A 1KYZA 5FO5A 3COAC 3JSOA 4MNUA 1P4AA 1KQ0A 4KNYA 2LF8A 4EGZA 2JPBA 2KKOA 2VBXA 1B1BA 3WTWC 3F8FA 4LFUA 3ZN1A 1BM9A 1DPRA 3LQRA 2DPDA 2EFQA 2HS5A 1FNNA 4RB3C 2NNYA 3CUOA 3K1MA 4MGRA 5FGMA 2XAQA 2OZUA 4EJUA 5CVVA 5JVTA 1FSHA 1BIBA 2DK5A 1MDMB 1J59A 2FMYA 2RGVA 2A5YB 3HTUA 2M5WA 4Z2YA 1D5VA 4YFNF 2EV0A 4N9IA 3L7WA 1PUEE 3E6CC 4XBFA 1YYVA 3SZPA 3T0YA 2XAHA 2EFPA 1TW2A 2CYYA 2VBYA 2VONA 5L3CA 3MWMA 2FRHA 2MC3A 4A0XA 2DW4A 4EM0B 2YX7A 2XIGA 2EFWA 3IRQA 1ZARA 3HSRA 3WTTC 5JR3A 1IXCA 1JXSA 2P5KA 2EFOA 4M73A 4IPAA 2M8EA 3M9AA 2Q2EA 3T5XA 4HA8A 1E17A 4U7BA 2Z9OA 5CVUA 3VB2A 1RIOH 4MTDA 2P8TA 1IRFA 2VBZA 1U5TC 2ZXJA 2F5FA 1XN7A 5HDGA 1QBJA 1ZGJA 3SQNA 5IT9K 1GVJA 2A07F 1I1GA 1ZLKA 2IA1A 3BZ6A 4Q5SF 3G73A 1SFEA 2E1CA 2XKOA 5LBQA 4AIHA 3ELKA 1TLHB 1LEAA 5ICCA 1HBXG 5FLXK 2D2WA 5HS9A 3L9FA 3DQVC 3LA7A 4FX0A 1R22A 2M87A 2O0YA 3R6SA 3R61A 3E3VA 5ICGA 1ZG1A 2CSOA 5KVRA 4QLCU 1BJAA 1P6RA 1U5TA 1IN7A 3W6JB 1FZPB 5DDGA 1JHFA 1G3TA 2UWMA 1REPC 2DPUA 2P5LC 3FWEA 2MD5A 3OOPA 5E18F 1YQAA 2GQQA 1PP7U 2ESNA 4FT8A 4E70A 5HOOA 4AWXB 4HLYA 1YLFA 4L5IA 4YFKF 3M8EA 1HW2A 4EM1A 1EH7A 3EUHA 1T6SA 4LK0F 1TTYA 1MZBA 4G7ZF 2K02A 3MZYA 2PLYA 1LQ1A 3C18A 3MAJA 2CQKA 4A6DA 1T38A 2FF4A 1LEBA 1O3TA 1GHCA 1X3UA 4PDKA 1H9TA 2VC0A 2O03A 1KU2A 3I4PA 2KIMA 2YX4A 2RV8A 4AD9A 1QGPA 1F9NA 2M1BA 2VT2A 1FX7A 3GFMA 3K1NA 1KA8A 3H3ZA 1WSUA 4GGGA 3RYPA 4A5NA 3GWZA 3CUQC 4EGYA 3HOSA 4EV0A 4HLXA 2FBIA 2GWRA 5L3DA 1IN5A 2ISZA 4CHUA 1HW5A 4OIRF 4K2EA 3GXOA 2HFHA 3BPXA 1U8RA 2MH9A 3HRMA 2IRFG 4LG0A 2VN2A 2COMA 2J5PA 4S04A 1IN4A 3RPQA 1J0RA 3IWZA 4HDVA 1DPUA 2WTEA 1W7PA 1O7LA 4P9UA 5DCMB 3GLXA 3KEOA 3FMRA 4ENMA 3PQKA 1R23A 2OQRA 2FQ3A 1JHHA 2DU9A 2L3DA 3ULQB 4ENNA 1OYWA 1OYYA 2DT5A 4KIGA 5ICFA 3CUQA 4HDUA 5HDNA 3JAMZ 1IN6A 1FY7A 3I5UA 1ZH5A 1F1ZA 4L9NA 4DNCA 2KJBA 3QP5A 2EV6A 2PI0A 3DFGA 1RI7A 3GFIA 3MFKA 2RN7A 2DBBA 1HKTA 3P9KA 4RB2C 5LEKA 3F21A 2ZMEA 2QYOA 2F5EA 4IRGA 3ZMUA 3KP5A 4ESFA 2MLKA 3I59A 2IA2A 1Z1DA 3TKYA 1OKRA 4PGHA 5H20A 4MHGA 2QQ9A 2EFNA 2LF7A 3DV8A 3EQLF 1MJBA 3Q5FA 5CVJA 3SZTA 2HKXA 5KK1A 1IUYA 2K86A 4Y13A 3SXYA 2CGPA 4KMUX 3RJPA 1WQ2A 3K2ZA 3ROUA 1EH8A 2HWVA 3QU3A 1G4DA 4G94A 3TO7A 1V4RA 4RGXA 1O7FA 2K4BA 2EV5A 3WGIA 3ZQ7A 5K5QA 4FX4A 3E5QA 2KRFA 4EJWA 2L01A 5ED4A 1WKMA 2ZFWA 1KQ8A 3RKXA 5HLGA 3LFKA 1FYKA 2FNAA 2V79A 1AOYA 1QQIA 4ZZLA 5AIQA 1XSVA 1FBUA 3P9CA 2DK8A 4CDGA 4RB1A 1ZLJA 2JRTA 2IT0A 5D5WB 2R7FA 1QNTA 4G6DA 2UXNA 4CZZA 5JHUA 4AIKA 2LSOA 1B9MA 2QBYB 2XV4S 2K7LA 3H92A 4I01A 2LDUA 5A2QZ 3I0TA 2VODA 2PN6A 1JGSA 5D4RA 4RAYA 3ZN0A 1SD7A 2HYGD 2XGXA 3WTXC 4WXCA 3QPTA 2NS0A 3J81K 3GF2A 4I02A 1SD5A 3BJOA 1U78A 1XGOA 1UCRA 1TQPA 3OV8A 5E17F 1FBSA 2QM3A 2OBPA 3EYIA 1T98A 4KIFA 5JI6A 1J7KA 1R5GA 1FPQA 2W25A 3ZMVA 1DP7P 1R7JA 4OMZA 1R1UA 3ML6A 5D4SA 5LEJA 1KU9A 3KE2A 2HR3A 1S6LA 3D0SA 2GXBA 5E20A 3IKVA 2A3SA 4UVBA 4IHSA 2W57A 1W5SA 2KIFA 3WU0A 3KP3A 3RTRA 1W7PD 3BJAA 4Q48A 3RDIA 3F6OA 2MBFA 3CO6C 4HYEA 1WI9A 1KGSA 2BYVE 4UVCA 5HVQC 4L9TA 2O61A 2JTVA 1XGSA 2X0LA 2W24A 1BN5A 3JAMK 1Z6RA 5BPIA 5FD5A 3U2RA 4M6YA 4CGZA 1FYMA 3F6VA 1IN8A 4XSXF 2HZTA 1ZG3A 1K79A 2QVOA 1OPCA 4ASNA 3K9TA 4HQEA 2OZ6A 2NRAC 4XSZF 4M74A 5BQTA 5F1RA 4R79A 3J80Z 3T8TA 1SD4A 1W4MA 1EH6A 3F23A 1MKMA 4WXHA 5J8CA 2GA1A 2DQLA 1XB4A 1MDMA 4HAMA 3I71A 1KQ9A 1ZYRF 2E7XA 2FE3A 2MH2A 1SFUA 3V4GA 4NHJA 2D1VA 3BDDA 3WGHA 4N9HA 3H3UA 4LLNA 1FC3A 2EJRA 2YU3A 4UHTA 1R58A 4RGRA 1PP8F 4ENKA 1YO5C 5FB2A 3KP6A 3Q9SA 3IC7A 5BS6A 4A5MA 3FZVA 5IT3A 4RAZA 5ILSA 1FYLA 1K7AA 3F8NA 2PMHA 5DD4A 3HIFA 1UHWA 5LRRA 1OMIA 1QZZA 5D8KB 1I5ZA 2GIVA 2XKPA 3EYYA 4BHBA 4OINF 3BP8A 1J9IA 2VOOA 3LA2A 5LRSA 4EVIA 2V1DA 3RKYA 1YFHA 4EJVA 2V1XA 5D5XB 2DAOA 4GYGA 2AXLA 4I7HA 3V7CA 4A12A 2RQPA 4IRHA 3HUGA 4ESJA 3QRFF 3T8RA 4HV6A 2P5VA 3CLOA 1RUNA 1TNSA 2Z5UA 4CICA 2LKPA 4GCVA 3MZHA 5A2QK 3E5UA 1NHAA 2G7UA 3V7SA 3F8CA 3F3XA 1XGMA 2ZO4A 1KU3A 3REOA 4EJTA 1TNTA 2QQBA 4ETSA 4OIQF 4LLLA 1P92A 2ACJA 2JPCA 5EEHA 5HLHA 2RKHA 4JK1X 5D8LB 5DV5A 4BXUA 2DFIA 3M8FA 4L9JA 2BE5F 2DI3A 2QLZA 1ZN2A 4KMFA 4LLGF 3O3KA 1XDUA 2QWWA 3VOEA 1BC7C 3CDHA 3I53A 2IW5A 3V7RA 4LB5A 4WF2A 4NB5A 4UNOA 3WTZA 4BHCA 3LQQA 5DEQA 4IXAA 3J7AO 4R8HA 4RGUA 5K5OA 4ESBA 5EEGA 2EA2A 1B6AA 5HLIA 5BOXA 4M9ZA 1WRJA 2P6SA 2JZYA 4U0WA 1ONVA 2R7DA 5CJ9A 4BNCA 1Z91A 4HX7A 4LJZF 1USSA 3JTHA 3RI4A 2FBKA 1MD0A 4KYWA 3HYIA 5LHIA 1QPMA 1XCVA 4A6EA 2FXAA 3S2WA 4WCGA 2Y0MA 2R3SA 2OD5A 3E6MA 5DUIA 1FLIA 3QPHA 4B8XA 4MEXF 2ZNZA 5HS8A 1U6GA 4I2OA 4IF4A 2VE9A 4LD5A 4Q47A 3I64A 2M45A 3WE3A 2W85A 2FU4A 4OIOF 1DDNA 5LGUA 4XRFA 4MTEA 2RC4A 2EA4A 1USTA 4KA4A 3FMSA 5L3GA 3GFJA 2QQAA 4WX9A 4I0BA 1S29A 2ZJ2A 3D5LA 2JSCA 1S8NA 4A0ZA 2G9WA 1SFXA 2NYXA 2Y48A 1YS7A 2Z33A 1LNWA 3CTAA 5CVIA 3FF5A 1ON2A 2CW0F
chains in the Genus database with same CATH superfamily
4XN0A 1W5TA 4CUGA 1TBXA 5L3BA 2HTSA 1L3LA 4NQWA 3HG9A 3VYUB 4HNUA 4QWQA 2K4JA 5ICEA 1ZRDA 1ERDA 3T1BA 3E0JB 5FKKA 2ZKZA 4CA0A 3RYRA 2A61A 1BOAA 1JGGA 3S15J 3VEPA 4ZJZA 4NDLA 3LAJA 2DOEA 5AONA 3F8BA 4KFCA 2KJCA 3JRCA 1T2KA 5F0HA 5L3EA 4PFPA 2QUFA 3LSKA 2O7OA 1GDTA 5CYVA 3FM5A 3ZQQA 1T8IA 5DCMA 1WPKA 2LOOA 3BR3A 4P9FA 2P6TA 4CO8A 5LHHA 4J01A 2BOLA 1D1CA 3SEQA 3ASNH 4JBAA 1IRXA 2IPQX 2L7MP 1ZR2A 4O3MA 5E8GA 5L3FA 4LB6B 3ERMA 3ZMDA 1Z67A 3N97A 3CC7I 2KLOA 4QTRA 2FOKA 4YG2F 1A31A 1R4NB 4KIBA 4DQ2A 2LH9A 4BYYA 2LLKA 3CQZJ 5F08A 1OFCX 3CJNA 2E1MC 3A0HC 2H94A 3OYGA 1T0FA 1F4KA 4XRSA 1MBEA 2EBIA 3H0GJ 3VFZA 2FA5A 4HG2A 3AAFA 2DFHA 2HQ5A 1NH3A 2XGDA 1HQCA 1FWZA 1GXPA 2DLLA 1FBQA 1ZR4A 1E0EA 4GRIA 1GT0C 4IO9F 3W2WA 2PJRB 3FX3A 5IPAA 2C6YA 1IC8A 2IA0A 1RZ4A 3C1DA 2YSRA 2CQNA 3ABLH 2XVCA 3CD6I 3ISPA 5TJJA 1CF7B 2V9VA 1Z3YA 4RGSA 1IZ1A 3RQ4A 3AG3H 1ODDA 2MFZA 2HOEA 4HNVA 2PBIA 2E71A 3BTIA 2MLGA 4EMSA 3TO6A 1M1EB 5HODA 1R49A 4EJOA 1B72A 3H9JA 4UUSB 1E3OC 4EM2A 2H8WA 2E60A 3HRTA 4QIWN 1L0OC 1GV2A 1Q1HA 2X1CA 1Z05A 1TQIA 5IT9Z 4XLNF 5K7ZA 4IKFA 2IP2A 3QOPA 1JE8A 4I98B 5J8FA 4PSWA 2HYJA 3PUBA 2RDPA 4H4KC 5HNHA 4OOIA 3MEXA 1BW6A 2VBWA 3L2QA 1AU7A 2CV0A 1WJEA 3I54A 2RVCA 2AS5F 2XGEA 2CFXA 2WB1A 5D5VB 3P7NA 1VQLI 2DT7B 4LMYA 4PJMA 2QCOA 3R4KA 3PNYA 1FOKA 2GA2A 1HCRA 1ON1A 3F72A 3S8PA 2L02A 5DCFA 1RNLA 3JR9A 1O3SA 4G6QA 3TGNA 1A04A 1W0UA 1WH5A 5FLXZ 1IDYA 1Y0NA 4CCLA 4M9XA 1JTXA 1ULYA 2RNGA 2VC1A 3MKZA 5TRDA 5KCMA 4RMNA 2RQQA 1G6NA 2GXGA 1CF7A 1R00A 3KZYA 2PJPA 3EDPA 2LR8A 2XF6A 2OTLI 2VT3A 1MNMC 1DU6A 5FKOA 2LBFB 5CQGA 3H5RA 1QO0D 3WTVC 2A05A 2A68F 2H6CA 5DUKA 2VKHA 2XROA 2UZKA 2W00A 4AC0A 5C4JJ 1YOVB 2PEXA 3DLAA 4XN3A 4N0BA 3AG4H 3PFYA 1VQ9I 2VQCA 3AFHA 3HRUA 4BH9A 4AYBA 2ZXWH 3KX2A 1MBKA 3KP7A 3DEUA 3G6EI 4FHTA 1O57A 2UXXA 2GBYA 3G3ZA 1FP1D 2M7AA 2BW3B 2VUMJ 2H09A 2CW8A 1PUFA 1ORKA 3ZGKA 3TOAA 4B47A 3TDZC 2L54A 5K5RA 3FKJA 2H6BA 1JJ8C 2ZSHB 3I58A 4G7HF 1I6HJ 3DKWA 1V3FA 3PFIA 2IGOA 2X4HA 1MJ9A 1FMVA 3R60A 4U0YA 4HQMA 2M4GA 5CVRA 2BVMA 4CH7A 5FKLA 1MBGA 1E2XA 2CFOA 3S32A 3VWBA 1I27A 1SANA 4XLCA 3K0LA 1QZYA 1DUXC 3DKYA 2B0LA 4MQ9F 3TQNA 1W36C 1R4MB 2KIUA 2MC4A 2YUSA 1J2XA 4D7MA 4RLQA 3FDYA 5E1XA 1ETWA 5FROA 2QBYA 3ZQFA 1ZREA 1JUMA 3K70C 3CCEI 2LBFA 2XGCA 2OPTA 3SFZA 5DS9A 1FT9A 3BJ6A 3ECHA 3WE2A 3QAHA 2V7FA 2B63J 2ME6A 3SYTA 3V8JA 3GW2A 1FMWA 1U0JA 4I76A 3VODA 4BHPA 2VPLA 1I1SA 5CQEA 4L9VA 1LDKB 1NK3P 2VQLA 2B9SA 1YW9A 1VTNC 3BZCA 1QHGA 3SHFA 4EQQA 3HTSB 3DF8A 3DTIA 4E7KA 1BA5A 5FFZA 2AQFA 1TWFJ 3HPHA 4HF0A 4HW0A 4TV7A 2DT6A 2P7CB 4UUVA 3FMQA 3ABUA 5BPDA 2YR2A 4A3EJ 2W82A 4KN7X 1H9GA 4C3HJ 1IXRC 1E3HA 5M5XJ 4BY1J 3DP7A 4F7ZA 3GTKJ 1C0WA 2ELHA 3U9GA 2PQ8A 1R36A 2BEOA 3P9IA 2XPVA 3GMEA 2HI3A 2VASA 3K69A 4MIMA 4C2TA 2XAFA 2CWEA 1XMKA 1YJWI 1SMYF 2FD5A 2NVUB 3GYHX 1LFBA 2DMPA 3ZPLA 3CDLA 3GTQJ 3HKZA 4B44A 4ITVA 2GLOA 4U7DA 2O6GE 2B7EA 1X2MA 3FHZA 3N4MA 2QSHX 4Y15A 2Q2EB 2JA7J 2V1UA 4AUXA 1UFMA 2LFBA 1G3YA 5DYMA 3MQ0A 3KEQA 1ZRFA 4DW6A 3TO9A 4UV8A 2QZ8A 1TWAJ 3U1DA 4HX4A 4M6XA 5C3EJ 4IVNA 1HA8A 3IP4B 2Z99A 2VKEA 3B73A 4PZJA 4U0VA 3E6DA 2A6HF 2HTJA 3TOBA 1K6OA 2P0WA 5E3LA 4KUMA 2EH3A 2Z3YA 1IW7F 1OR7C 3CMEI 3ZP5A 2F4IA 3HGYA 5EG0A 1S9HA 1XDSA 3FXLA 1YITI 3KLNA 3LAPA 1KU7A 2BBYA 1NG7A 3HSEA 4DYQA 4C9YA 3DPLC 2FNPA 2R7XA 1IF1A 5BMZA 1EJ9A 2H1LA 3A0BC 9ANTA 4AVPA 2IXSA 1UHMA 3I55I 4XM3A 4UB6C 1JTYA 4IX7A 2R0QC 3RQIA 3BCBA 4BE2A 3OYLA 3R0JA 1IRGA 3WGGA 3BR5A 5HLTA 5DD8A 1R5HA 2STWA 3BWGA 2G7HA 5IOYA 1IUFA 1BI2A 4DJAA 2X6XA 1H0MA 2DOFA 2CG4A 2DA6A 2ICWG 3WU1B 5HDKA 4V19K 4P96A 1HXDA 2TDXA 2CV2A 1S3JA 3QP6A 2E36A 5FLVA 4WK8F 2BHZA 4L0YB 5KAIC 4CYDA 3S1MJ 4BKXA 1Z0XA 2FJ1A 4I6ZA 3HC7A 3BG6A 4A3CJ 2HU9A 2RREA 3GTMJ 4XLHA 2CQQA 1B4AA 3ZQLA 3LWFA 3EETA 2NS8A 4DYCA 3GZ6A 2VIXA 1YW8A 3FXQA 1OJLA 4LGWA 2M8GX 2NNNA 1YTYA 1U5TB 1MIJA 1G8XA 5LD2C 4Z6YA 2YPRA 2FMLA 1O3RA 2OC6A 1MW7A 1YI2I 4YELA 1Z7UA 3AL0C 4W97A 3SZGA 1OR7A 2D45A 3LSTA 2QEXI 1IXSB 4H0EA 2I8DA 5JVGF 4B1RA 2OUMA 1DGWY 2IVMA 4IHTA 4UVAA 1HLVA 3H35A 4G9YA 3RKWA 1P9QC 2XAJA 5ERIA 3F9KA 3WTUC 3NRVA 2L7KA 2WADA 4YFXF 5LGNA 4AU7A 2E5ZA 4YIIA 1FIPA 2HNHA 3DPTA 2ZBKA 3DPUA 2XSDC 2HDCA 4PSXA 2CUEA 3HHHA 1K78B 2FX0A 2OA4A 1LVAA 2VL8A 3JRDA 4FETA 1RUOA 3BG5A 4L18B 2IJLA 1SAXA 3IH2A 1LUJB 2Q8KA 4MO7A 3R0AA 1LVKA 5D6EA 4II2A 1ETOA 2KFDA 2O3FA 4UV9A 4PGGA 3Q0UA 4OIPF 4UXNA 1B9NA 4J19A 1XMAA 4I0AA 4L0ZB 2VQHA 1HKSA 2ZNYA 5F6FA 3PL8A 4KICA 4ZH4F 4A3MJ 2WC2A 3M4OJ 4BAYA 1WWXA 1R1VA 1D8JA 4JX5A 4Y17A 3LL7A 2JA2A 1BIAA 4D0PA 1SVLA 4XK4A 4CXFA 2M0MA 5CPRB 4G7OF 1VQPI 5JHFA 2FBHA 1RRJA 5CLSA 1MGTA 1K4SA 3AG1H 3GEZA 5JLWA 2HXOA 4JP0A 3OYKA 3X2QH 5F1JA 3FM3A 1HSJA 3DWLE 2K9NA 2F2EA 2HGCA 4M72A 2ESHA 5JLXA 3HOTA 4M71A 3QU6A 2Y0SA 2IAIA 2K27A 5J3LA 2WWYA 1Z6TA 2DN0A 3BCAA 4HPQA 2D5VA 1K78A 3GUDA 3D5SC 3GO5A 1FJLA 2CU7A 2OU2A 4XIDA 2GOXB 2JRMA 1S7OA 3DKXA 4FTHA 2EK5A 2EIJH 2X6OA 4C2UA 1LKXA 5LHGA 2TCTA 2XASA 2DFFA 2XF5A 3CCVI 1R1TA 1D0XA 3VYTB 4MEYF 1XD7A 4IQJA 3VDXA 2ADUA 1WVRA 1ETVA 2P81A 2RNJA 1U3EM 6PAXA 1SD6A 3K4LA 3RPUD 1YIOA 4KT5C 4PUSA 1EV7A 2ISYA 1D3YA 3BT9A 4FASD 2NVYJ 3CC2I 1LDJA 2AXTC 1GUUA 2ZJPF 2FSWA 3CCYA 4YEJA 2ZCWA 5KNLA 3LA3A 1TQMA 1HKQA 2DCEA 5B3SH 3CP8A 4KN4X 4PJ0C 3SJMA 2HVSA 1E3PA 2M0CA 5KAFC 2GM4A 2STTA 2DDAA 2HQRA 4FISA 2R7VA 2L0KA 3M1EA 3CF5F 1UJ8A 3N05A 1ZAOA 4CYCB 2KMUA 5E1ZB 1FEXA 2LYCA 4QPOA 4RB0A 4LG0B 2R92J 2OQGA 3DEWA 4M6VA 5LGTA 4HOBA 3WG9A 2Q0OA 3LSRA 1HOMA 2LMDA 5EJCA 3O8GA 1JKOC 1ETKA 1VF9A 5AIPA 4MQVA 3S2HJ 4BGDA 1JT0A 1W7PB 4IOCF 2ECCA 5JFRA 1XSXA 1FIAA 2EZLA 1WH7A 3S3NA 4MFDA 3H1CA 2JSPA 3K6GA 2GAUA 2E34A 1T33A 2XSJC 3KP2A 3GTGJ 2OAZA 5FFXA 2EZKA 1JKQC 1BBYA 3KEYA 3M7GA 2BY0A 1OLTA 3J81Z 2QQ8A 2VJ4A 4XRMA 2HPIA 1KYWA 1B59A 1U8BA 4NC8A 3E97A 4A0YA 3RIRA 5IP6A 5GPCA 1HW1A 3KYLA 2QENA 2ECBA 3A4CA 3CUQB 4B3XA 3SFIA 1LPQA 3K1PA 1W36D 2WAQA 1CGPA 1WJDA 3L2VA 1OYIA 2D1HA 3J80K 1YHQI 3CCJI 3CO7C 3DCFA 3WTYC 1TL8A 1TT0A 4XLPF 1LE8B 3BROA 1BI0A 2PFBA 2VOPA 3IV5A 3TDUC 4BL0B 2EB7A 1MMNA 5D5UB 3E5XA 3E6BA 2QA4I 1TP4A 1STZA 2HQNA 5GTIC 2VE8A 4IEJA 2ZMEB 2EWNA 3KYDB 4L5JA 5J40A 3GTJJ 3F8MA 1OCOH 2XRNA 3LSPA 1N75A 4OWRB 2ETHA 3BY6A 2CUFA 2EPFA 5IP7J 4YRVA 2IS1A 3BOQA 3BQYA 3KFWX 2JN6A 2W84A 4RM2A 3VYRB 5EDNA 4JYKA 5D6FA 3L2CA 3KZZA 1VQOI 3OS2A 1F5TA 1QPIA 4A3DJ 4KDPA 2E7WA 4B43A 3I59B 3VYSB 5E3MA 1AWCA 4PJJA 3ZMTA 1JKPC 1KONA 1ZGAA 2DODA 3IAS2 2K9QA 4U88A 1V5FA 5FD6A 2HKOA 3FK7A 3ERED 2ZXIA 1ZRCA 2F5CA 5HS7A 3OS0A 2IBDA 3J7ZI 4A3JJ 2JMWA 5E3OA 2YU9J 2XB0X 2VPRA 2WV0A 5E1WA 4XKVA 2CS3A 2FQ4A 4GO1A 3O2PE 1TT5B 2V6CA 1YG2A 2L4MA 3IL2A 1MSEC 2A6EF 1UZCA 4RAFA 3JSPA 1Y0UA 3KCCA 3GX4X 1ZG5A 1ZTRA 3KLOA 1YS6A 2LD5A 4LIVA 3IRRA 4RS8A 3WODF 3NEUA 2VXDA 4G6TB 3JCUC 4KITB 3C2GA 3NQOA 3PQJA 3KP4A 4ZYGA 1NG6A 4P5OA 2K85A 3JRBA 2F5DA 3GZ5A 2OV7A 1ZELA 4LIUA 3S1RJ 1LDDA 1P2FA 3KPHA 1LB2A 2JT1A 2GZWA 3FXRA 1FSEA 3TEDA 4ZC3A 4CCNA 5J6XA 5CKTA 3C2BA 2DMQA 1X4PA 2HDWA 4HV5A 2KRHA 5H6QA 1Y6IA 4IRIA 1N77A 1GVDA 5LLQA 3GTPJ 2DO7A 3L00A 1TWCJ 1I6XA 4JOMA 4B09A 1YIJI 1XS9A 2H27A 4PFOA 1BC8C 2IS2A 4BQQA 2Y75A 1P4WA 3ZMZA 4NNJA 1SMTA 4PCQA 1ZK8A 1Q1VA 2L7ZA 1PDNC 2K40A 2R5ZB 1DGRM 3WTSC 1K6YA 4OMYA 4BXXJ 2HYFA 4ZZDA 4X0GA 2WY8Q 3K10A 4HF1A 4JQFA 4HEA2 2LNBA 2Y31A 1XTAA 2KDZA 4AIJA 1D1BA 2W4SA 5K1YA 1JKRC 4E4HA 3PJRA 1SAUA 2HEOA 3G1LA 3Q9VA 5K7HA 3H9QA 5H6RA 4P55A 2P4WA 2EZIA 5E3NA 1JUPA 3O6BB 3PM1A 2E1NA 4HF2A 3ECOA 2XUBA 4YIFA 4ZYHA 4ZYEA 4F93B 3OYHA 2BGCA 3GVAA 1MJAA 3C7JA 3ZMSA 5F0CA 2XHKA 4XLEA 3FXUA 1GXQA 5M5YJ 4S05A 2O8XA 2M30A 2GXAA 2DTRA 2VJ5A 1H8AC 3B02A 1I39A 2E35A 2W7NA 3HHGA 2Y9ZA 5IP9J 1Z9CA 5ILVA 3HOVJ 3D1NI 1HSTA 2M9HA 3L09A 5ILUA 2P7VB 2MA3A 4ENJA 4Q4ZF 2PMUA 2PJRA 3HOWJ 2WAEA 3ABTA 3OIQA 3LNQA 3GFLA 3CJRB 1O3QA 1T39A 2XAGA 3IWFA 4ZYDA 5BNGA 2NS7A 3BPVA 1XSDA 4V2GA 1XCBA 4BE0A 4XLAA 4HX8A 2L9SA 3DXJF 4R1HA 3JW4A 2LTPA 3V8KA 3S16J 3IKTA 1WJBA 2LY2A 2JWTA 4UUSA 3KETA 4GFBA 3IHUA 1OCPA 4WWCA 3JRHA 1G59A 3IUOA 3CC4I 3K4KA 3QYBA 1XGNA 1MH4A 4O5VA 2PG4A 4JX4A 4LK1F 4HZFA 4WXDA 3BLYA 2TRTA 1S7AA 2DQRA 1TW3A 2CO5A 2F4MB 2G0EA 4A2UA 5E8IA 1P4XA 3HSFA 4OU0A 2MSYA 1YRNB 4GYIA 1D5YA 3Q3SA 5FKNA 2JA6J 1U2WA 3A02A 4BBRJ 1G3SA 2VXZA 1BI3A 1A36A 4BJTA 3RCOA 1BI1A 4DBRA 2L4AA 5GAGJ 3PO2J 3IH3A 1FP2A 2A69F 2NAZA 3B6CA 3OSFA 1Z21A 1A6IA 2DA3A 2KZVA 1U9NA 1WJAA 1T95A 3C3WA 4I09A 2FEZA 2X9DA 3HL2A 3K4BA 3MCZA 4M9SA 1ZHFA 1Z3XA 2K3PA 3RPUA 1UB9A 3V8LA 2HVRA 2MYSA 2VJJA 4G8XA 1N78A 1VI0A 1LJ9A 2L7FP 3OYIA 1MNDA 3HRSA 3JTGA 1IAWA 2LK2A 1FTTA 4IJAA 2LREA 1GV5A 3ESWB 4O6JA 5GADJ 5M3MJ 3OSGA 1J75A 2XC7A 3HOYJ 1G3WA 2J5OA 4GXOA 1D8KA 3V42A 4ON0A 1RKWA 2BV6A 3W6KB 1A5JA 4HBLA 4BQAA 3OY9A 1J5YA 3F22A 5F64A 1YW7A 1KYZA 3H36A 5FO5A 4XOPA 1WCMJ 3ONQA 3QPLA 3OYNA 2BW3A 3COAC 3JSOA 4MNUA 1P4AA 1KQ0A 4M3EA 4LG3A 1X2NA 4KNYA 4ANJA 2LF8A 4EGZA 4BU2A 4ZYAA 1SC7A 1CQTA 2JPBA 2KKOA 2VBXA 3GLLA 1B1BA 2XDVA 3WTWC 3F8FA 3S17J 1Y8QB 4LFUA 3ZN1A 5B5EC 1BM9A 2DJIA 1MNEA 2NXNB 1DPRA 2XPUA 4F52A 3LQRA 3NWSA 2DPDA 2EFQA 2HS5A 2GOMA 4D5CA 1FNNA 4FE7A 4RB3C 2NNYA 3OYCA 3CUOA 3K1MA 4MGRA 5FGMA 2XAQA 2OZUA 4PK4A 2E2IJ 1QHHD 1Z7LA 4EJUA 5CVVA 5JVTA 3G4SI 3EUKL 5EEAA 1FSHA 3RZDJ 1WFXA 1BIBA 1X3WB 2IGKA 3J7YJ 5C44J 4N4OB 2DK5A 1MDMB 3KIOA 4HSTA 1J59A 2FMYA 2RGVA 1DQUA 1RESA 2A5YB 1Y56A 3HTUA 2O5RA 4EATA 4IZZA 2M5WA 4BE1A 2EINH 4Y52J 4Z2YA 1D5VA 4YFNF 2EV0A 2VQGA 3H5NA 2HDDA 2EILH 4N9IA 3L7WA 1PUEE 2E2HJ 3E6CC 1I3QJ 1PYVA 1YYVA 4XBFA 5DM6F 2PMZN 3SZPA 1R6RA 3SDGA 3T0YA 2XAHA 2EFPA 3TP3A 3OMYA 3BTLA 1TW2A 1S7EA 2CYYA 2VBYA 2VONA 2E5NA 2ZC2A 1I50J 3EUAA 2DMTA 1TWHJ 4ZTJA 3WG7H 4IOAF 2O9LA 2F6CA 3OYEA 5L3CA 3MWMA 1F36A 1XG1A 2FRHA 2MC3A 4A0XA 1WZ2A 1XX5A 2DW4A 4EM0B 2YX7A 4B3AA 3W2VA 5EGOB 2MW8A 1ETQA 2XIGA 2EFWA 1H88C 1D1AA 3IRQA 1XC5A 1ZARA 3HSRA 3WTTC 3BTCA 5JR3A 1IXCA 3BG9A 2EZHA 1JXSA 5J47A 2P5KA 2EFOA 1VQ8I 3BC8A 4M73A 4LOCA 4IPAA 2H1KA 4I99C 2M8EA 3M9AA 2Q2EA 4ZDLA 1K4TA 3T5XA 4AM3A 1AHDP 4HA8A 4AVZA 1E17A 4DIQA 1RETA 4U7BA 2Z9OA 5CVUA 1X1AA 2CQ7A 1OCZH 3VB2A 1RIOH 4MTDA 2P8TA 3JRGA 1IRFA 2F4OB 1MMGA 4C3JJ 2VBZA 3LSJA 1U5TC 2ZXJA 2F5FA 1V54H 2OJED 2L5QA 1XN7A 5HDGA 1QBJA 4LITA 1MBHA 1ZGJA 3SQNA 5IT9K 1A35A 1GVJA 2A07F 1AKHB 1I1GA 1MBJA 1ZLKA 2MABA 1EA3A 2IA1A 3BZ6A 4Q5SF 3G73A 1SFEA 1S72I 2E1CA 3L2WA 3CCLI 2XKOA 3JRFA 1X1BA 2Z2SB 4XONA 2NVXJ 2KQRA 2V26A 3MKLA 3OR1C 2IS6A 5LBQA 1S5LC 3K2AA 3OYMA 4AIHA 3ELKA 1TLHB 3AG2H 3OL3A 3IH4A 1BJZA 4FE4A 1LEAA 5ICCA 1HBXG 5FLXK 1UMQA 2D2WA 5HS9A 4PJNA 3L9FA 4BY7J 1IDZA 3DQVC 3EUHC 3LA7A 5J1UA 4FX0A 1WI3A 1R22A 2M87A 2O0YA 2VI6A 3F0CA 3R6SA 1TWGJ 2HVQA 3R61A 3E3VA 3LFUA 5ICGA 2CSOA 4PJLA 1ZG1A 5KVRA 1B8IB 2Y2ZA 4QLCU 3S1QJ 3GTOJ 1IV6A 1QU3A 2X48A 1BJAA 1P6RA 2L9RA 4BJ6C 5EZGA 1U5TA 1IN7A 2ID3A 4XNFA 3W6JB 2ZSIB 3HZJA 3IAM2 1P7IA 2JK3A 1FZPB 5DDGA 4D1QA 1JHFA 1G3TA 4RBOA 2PX9A 2UWMA 2HOSA 1REPC 5IYCJ 2DPUA 3MKWB 3U21A 2P5LC 4BUPA 1V5GA 3A2KA 3FWEA 3K4CA 4D5FA 2MD5A 2R7TA 2R5YB 1MMDA 3FKIJ 2WY7Q 1JT6A 5IY5H 4U87A 3OOPA 2VJIA 5E18F 2M4KA 2JUGA 1YQAA 1TZLA 3BG3A 2GQQA 3Q0WA 2LP0A 1PP7U 2ESNA 4FT8A 4E70A 4XORA 5HOOA 4AWXB 1X4OA 2Y69H 1QZEA 4BQOA 4HLYA 1YLFA 2V9PA 2R93J 1U9OA 3BZKA 3ZXSA 4MLOA 4A3IJ 4E7ZA 2KRCA 4L5IA 4C30A 1BOBA 4YFKF 3M8EA 1HW2A 4EM1A 2IGMA 1EH7A 4UY8I 2WB1N 4OAZA 1B8IA 3EUHA 2DA2A 1T6SA 2R4GA 1TTYA 4LK0F 2GIZA 5IYDJ 1MZBA 4UUTA 4G7ZF 3QODA 2E19A 2K02A 3MZYA 2PLYA 1LQ1A 3H3VK 3C18A 3MAJA 2CQKA 2L9VA 2L9NA 4A6DA 3A01B 2ID6A 2KHMA 3G71I 1T38A 2FF4A 3C2HA 1LEBA 1O3TA 4B48A 3G2BA 3MKYB 1GHCA 1X3UA 3D5RC 4PDKA 1H9TA 1HC8A 4V2FA 3OYBA 1NTCA 2VC0A 2X85A 4DGWB 2O03A 1KU2A 1FOXA 2LC2A 3OYDA 3PSIA 3Q0VA 2K9LA 3I4PA 5GAEJ 3DTKA 5J1RA 5FRMA 1D0YA 5IOZA 2KIMA 2CW7A 2YX4A 4XOTA 4DBQA 4XKWA 4XL9A 2RV8A 4AD9A 1QGPA 1F9NA 2M1BA 2VT2A 2V9KA 4DOZA 4AYBN 1FX7A 3I9V2 3PO3J 3GFMA 4IHVA 2CV1A 3OL4A 1IRZA 3K1NA 1KA8A 1Z77A 1H89C 3H3ZA 3ZQHA 1WSUA 4GGGA 3OIPA 2M3AA 1IJWC 1FOYA 3RYPA 1RPWA 3ZRGA 4E6KG 2IGNA 1SEUA 1TC3C 4A5NA 3GWZA 3CUQC 5F27A 4EGYA 3HOSA 3MN2A 2LKXA 3HOZJ 4EV0A 1W5CC 2DA1A 2V1NA 5B66C 2AO9A 4HLXA 4XMYA 2FBIA 2GWRA 5L3DA 1IN5A 1XPXA 2ISZA 2X51A 4CHUA 1HW5A 1SFKA 4M3DA 4OIRF 2NVQJ 3EPZA 4ZTFA 4K2EA 3GXOA 2EIMH 2HFHA 3NWTA 3BPXA 3M07A 4D9JA 1DP3A 4NQWB 1U8RA 4CYCA 2MH9A 3HRMA 2IRFG 2JVHA 2OCCH 4LG0A 4RAGA 3UNGC 1N25A 2VN2A 2COMA 2J5PA 2ZMEC 4S04A 1IN4A 2BVLA 2BXZA 3RPQA 3DU5A 1JUSA 1J0RA 5GTHC 3IWZA 4HDVA 1BR4A 2K5CA 1DPUA 2WTEA 1W7PA 3FBIB 2FOWA 2JUCA 1O7LA 4P9UA 3LSHA 1X1CA 2BZTA 5DCMB 3GLXA 3KEOA 4ABZA 3FMRA 1W1WE 4ENMA 4DYRA 3PQKA 3PNVA 3LOCA 1R23A 2OQRA 2DOAA 1XMXA 3ABMH 2FQ3A 4ZDOA 1JHHA 1IG7A 3HXLA 1UG2A 2DU9A 2L3DA 3CJQB 3ULQB 3TMOA 4ENNA 1OYWA 1OYYA 2DT5A 1MMAA 4KIGA 1YJ9I 4A3GJ 5ICFA 3W2AA 3CUQA 4HDUA 3MMYB 5HDNA 3JAMZ 1IN6A 1VFCA 4XQFA 1FY7A 1V5EA 3I5UA 5M3FJ 1ZH5A 3HKZN 1F1ZA 3OOUA 4L9NA 3DBRB 4EEFG 1LE8A 4DNCA 2KJBA 3QP5A 4A3KJ 1FTZA 2EV6A 2R7OA 3CCRI 3HOXJ 2PI0A 1PVEA 2N8GA 3DFGA 1RI7A 3GFIA 3MFKA 2QSFX 5F0FA 2RN7A 2QKLB 2DBBA 1HKTA 4CCJA 2KP6A 3P9KA 3QQAA 4RB2C 5LEKA 3DTEA 3F21A 2ZMEA 2MD0A 2QYOA 2F5EA 3OYFA 4IRGA 3ZMUA 4C2MJ 3KP5A 2W48A 1W0TA 2XRLA 4Y7NJ 4ESFA 2Y9YA 3RZOJ 2MLKA 3JRAA 3W6VA 2O8KA 3I59A 1B72B 2IA2A 1UHSA 3KYCB 1Z1DA 3PIOF 3TKYA 2WAFA 1UG0A 1ZKGA 1OKRA 4PGHA 5H20A 3ZCOA 5F04A 1EKEA 4MHGA 5EF6A 1T08B 2QQ9A 2EFNA 2MG4A 4HNTA 2DMUA 2LF7A 3DV8A 3EQLF 2F5VA 1MJBA 3HGGA 1VQ7I 1O4XA 3Q5FA 3TBIA 4L5EA 5CVJA 4XICA 3SZTA 1MMSA 4IL6C 3I4NJ 2HKXA 1IO2A 4D7NA 5HNFA 5KK1A 1R5ID 1IUYA 4II3A 2E1MB 2K86A 4RM3A 1WJFA 4Y13A 3SXYA 2R7ZJ 1QA6A 2CGPA 4KMUX 1MSFC 4OAYA 2Y30A 3RJPA 2X6YA 4KT6A 1MBFA 3S2DJ 4QSHA 1WQ2A 3K2ZA 3ROUA 1EH8A 2HWVA 3DU6A 3QU3A 1G4DA 3E7LA 2ZJQF 2KL4A 3H0DA 4G94A 3TO7A 1YE9A 1V4RA 3HJEA 2K9MA 4RGXA 1O7FA 2K4BA 2JA8J 2EV5A 3TW6A 3H5AA 3WGIA 2R7WA 3ZQ7A 5K5QA 1AA7A 1YX3A 3E5QA 4FX4A 1VQ4I 1X3ZB 2KRFA 4EJWA 3HPGA 4M3BA 2L01A 1X1DA 4MFEA 3JREA 5ED4A 3LSMA 2IEKA 1WKMA 3H9GA 2ZFWA 1KQ8A 3GBGA 3RKXA 5HLGA 2WA0A 2HZDA 4C3IJ 3CMMA 5B1AH 3G1MA 4KJZA 1G2HA 4FQGA 1PUFB 3ASOH 3LFKA 1FYKA 3S93A 1OCCH 1HF0A 2FNAA 2V79A 3LMMA 2R5ZA 3HOUJ 2KISA 1AOYA 1QQIA 4ZZLA 4RA2A 5AIQA 1XSVA 5E79C 1FBUA 2Z16A 1WHUA 3P9CA 4E7HA 4CCMA 2X6WA 2DK8A 4CDGA 4RB1A 1ZLJA 2JRTA 2IT0A 1X58A 5D5WB 2R7FA 4HSRA 3GTLJ 3BR0A 1GLNA 1QNTA 3QYFA 2CUJA 3ZOBA 3BTJA 4Y33A 4G6DA 2KDOA 2UXNA 3CP2A 3SEZA 2XPWA 4A69C 2ZB9A 3HEFA 4CZZA 4FCYA 1OISA 5JHUA 4CCOA 4AIKA 2LSOA 1B9MA 2RAEA 2QBYB 2XV4S 2K7LA 3H92A 4B4CA 3QWLA 1LFPA 4I01A 2LDUA 3PUFA 5A2QZ 3PSFA 3I0TA 2VODA 1PJRA 2PN6A 2KZGA 1JGSA 5D4RA 4RAYA 3ZN0A 1SD7A 2M7BA 2KIQA 1Y39A 1NK2P 2HYGD 2XGXA 3WTXC 3CESA 2R7QA 3P5JA 2BY1A 4WXCA 3QPTA 5IYBJ 3FXMA 1I3AA 4M3GA 2VB6A 2NS0A 5GPAA 3GF2A 3J81K 4I02A 3CLQA 1SD5A 1WJ5A 2QF7A 1ZGWA 1IV8A 3BJOA 2Y0SN 5J1YA 4BEHB 5DM7F 1U78A 1ETYA 1XGOA 1UCRA 1TQPA 1P7JA 3OV8A 4G12A 5K7FA 5E17F 2F48A 1FBSA 2QM3A 2OBPA 3DLLF 3L2RA 3A03A 1DU0A 3EYIA 3CCMI 2DMNA 3K4MA 5C4XJ 3JRIA 2HOAA 3S3OA 1R71A 4F3QA 3LSIA 3OWTA 1T98A 2Q1ZB 4KIFA 5JI6A 2OTJI 3ABKH 1J7KA 2K3FA 2EQRA 5FLMJ 2UV1A 3FISA 5FRNA 1R5GA 4IHXA 1FPQA 2W25A 3ZMVA 1K61A 1DP7P 1R7JA 3VPRA 4OMZA 1R1UA 3ML6A 3WU2C 4IQ4A 5D4SA 2WV1A 5LEJA 2AQEA 1KU9A 3KE2A 2HR3A 1S6LA 3D0SA 2GXBA 5E20A 1Y1VJ 3IKVA 2A3SA 2COBA 4UVBA 1YRNA 1J09A 3FBNB 1BR1A 4Y3OA 4IHSA 1ACIA 4IHWA 1K83J 2W57A 1W5SA 2KIFA 3MZ8A 3WU0A 2DDBA 2M34A 3KP3A 3RTRA 1W7PD 3BJAA 1ENHA 4Q48A 3RDIA 3CMAI 2FUG2 3F6OA 2ELKA 3I56I 2VKVA 2MBFA 1Y1WJ 3CO6C 4HYEA 1WI9A 1KGSA 2BYVE 4UVCA 5EG0B 5HVQC 1ITYA 4BEHA 1JJ6C 4KISA 1OCTC 4L9TA 1JI8A 2O61A 4GDFA 2JTVA 1XGSA 2X0LA 2W24A 1BN5A 1BR2A 3JAMK 2DA5A 3BR2A 3L2UA 5TISC 3FK6A 1Z6RA 3FIWA 5BPIA 2DA4A 5FD5A 4YIRX 5J4YA 3SDBA 4M6YA 3U2RA 2ZJRF 4BBSJ 4CGZA 5GP9A 1FYMA 3F6VA 1YX5A 4NC6A 4A93J 1Y8RB 1IN8A 3PIPF 4XSXF 2HZTA 1APLC 3BG7A 1ZG3A 2LY9A 1K79A 2QVOA 1OPCA 2E1OA 3K9TA 4ASNA 4HQEA 2OZ6A 2NRAC 4XSZF 3CJTB 3HDDA 2R7UA 4M74A 1LFUP 3CCQI 4IHYA 3S1NJ 4AIDA 5BQTA 2WAQN 3HB9A 2QSGX 2ZFUA 3ZQCA 2XAUA 1MH3A 2DTZA 5F1RA 4BACA 4A3FJ 3GCMA 3KZIC 4R79A 5DTDA 3J80Z 2UUZA 3T8TA 4E7IA 1SD4A 1W4MA 3K4NA 3TL4X 1EH6A 2XF7A 4N4NB 1MKMA 4WXHA 3F23A 5J8CA 2GA1A 3QYEA 1SFOJ 1UAAA 2DQLA 1XB4A 3S3MA 1MDMA 3CMYA 1BL0A 4HAMA 2M2EA 3I71A 1IGNA 1KQ9A 1ZYRF 4XKCA 1VZ0A 2E7XA 2FE3A 2ELJA 2JJ7A 2MH2A 1SFUA 4Y4RA 3V4GA 4NHJA 4P1WA 2D1VA 3BDDA 3WGHA 4N9HA 1T56A 4F55A 3H3UA 3NARA 3U1KA 4LLNA 2Z1DA 1FC3A 1RC9A 2EJRA 2VKDA 2YU3A 4NBQA 4BXFA 4NC7A 4UHTA 3HUGB 4DZJA 1R58A 1OQYA 1OCRH 4RGRA 1PP8F 2HOTA 2HQAA 3O8HA 4ENKA 1YO5C 2JA5J 5FB2A 4X6AJ 3KP6A 3Q9SA 3IC7A 1SVOA 5BS6A 4A5MA 1VQMI 5EYRA 5FJ8J 3FZVA 5IT3A 2WBMA 4RAZA 2NOJB 5ILSA 1FYLA 1K7AA 1RR8C 3F8NA 2PMHA 5DD4A 3G1OA 3HIFA 2R7RA 2V6EA 1VNDA 1UHWA 5LRRA 5EGOA 1OMIA 4QPQA 1QZZA 5D8KB 1I5ZA 2LKSA 2GIVA 1RKTA 2XKPA 2W1OA 3HM5A 5TGTA 3EYYA 2LY1A 4BHBA 5GAHJ 4OINF 3BP8A 3DEEA 3UKGA 3RKQA 2VOOA 1J9IA 3LA2A 1UELB 5LRSA 3MVPA 4EVIA 4BQNA 1VQ5I 4CSWA 2V1DA 2ME0A 3FXJA 3MD2A 3AL0B 3RKYA 1YFHA 2CH0A 4EJVA 2V1XA 1WGXA 3ZR8X 5D5XB 2DAOA 3UR3C 4GYGA 2AXLA 4I7HA 3V7CA 4A12A 2RQPA 4IRHA 3HUGA 4ESJA 3QRFF 3T8RA 4HV6A 2P5VA 3CLOA 4RDUA 2I5UA 1RUNA 2BY2A 2BHYA 4BDZA 1TNSA 2Z5UA 4CZCA 3FXOA 4CICA 2R7SA 2DXIA 1V55H 4XLFA 3M3YJ 2LKPA 4GCVA 3CCUI 1AKHA 3MZHA 1WJCA 5A2QK 3E5UA 1NHAA 2A6TA 2G7UA 2V4JC 3V7SA 3B6AA 2HPMA 3M1CA 1D0ZA 3F8CA 3F3XA 1XGMA 2ZO4A 4BJ5C 1HDPA 3OYAA 4DZPA 1KU3A 3VSKA 3REOA 4EJTA 2E2JJ 1QRYA 1TNTA 2CJJA 2QQBA 4ETSA 4F92B 4LLLA 4OIQF 2K9SA 1P92A 2ACJA 2LG4A 4XKBA 2JPCA 5EEHA 5HLHA 2RKHA 5M5WJ 4JK1X 1F43A 1POGA 5D8LB 5DV5A 4BXUA 2DFIA 3DBLB 3M8FA 2BXYA 3S14J 4L9JA 4S0HB 3ZQGA 3M8JA 5EZHA 1ETXA 2BE5F 2DI3A 2QLZA 1ZN2A 4KMFA 3TP0A 4LLGF 3O3KA 4ZDPA 2DJNA 1FOWA 1XDUA 2QWWA 4XRSG 3VOEA 1BC7C 3CDHA 3I53A 2IW5A 3V7RA 3DBHB 3CDIA 3BR6A 4LB5A 4E7SA 3BR1A 4WF2A 3K4JA 2KT0A 4NB5A 1EF4A 4UNOA 4J00A 3WTZA 4BHCA 3W3CA 3LQQA 5DEQA 5J4VA 3L1PA 2X1EA 4IXAA 2NOGA 3J7AO 2DA7A 4R8HA 4RGUA 5K5OA 4ESBA 5EEGA 2EA2A 4X1EA 2DFEA 1B6AA 5HLIA 2R5YA 2JQ7A 2MGQA 2CRGA 1HDDC 5BOXA 4M9ZA 3WHCA 1WRJA 1QVUA 2P6SA 1X19A 2JZYA 1R9TJ 2AHQA 3I4MJ 4U0WA 4BDYA 4W1UA 2CMPA 4F91B 4RLFA 4XR6A 1ONVA 1SVMA 2LVSA 2I10A 2R7DA 2ZXHA 4CCKA 3CF2A 2DYSH 4JX6A 5CJ9A 4BNCA 3LSGA 3J7AY 1Z91A 4HX7A 4LJZF 1USSA 2L2OA 3ZQIA 4HRIA 3JTHA 3RI4A 1QVTA 2FBKA 1MD0A 4M3FA 4KYWA 3HYIA 2A5WA 5LHIA 2X1DA 1QPMA 2OCEA 2JVGA 1XCVA 4A6EA 4BS9A 2FXAA 1YJNI 3S2WA 4WCGA 2Y0MA 2R3SA 2EIKH 3QOEA 3OIOA 2OD5A 3GZNB 3A01A 2QKMB 3RSNA 3E6MA 1X1PA 5DUIA 3CCSI 3QPHA 1FLIA 4E7JA 4B8XA 3OS1A 3QPSA 4UB8C 4MEXF 1BW5A 1ZQ3P 2CUZA 2ZNZA 5HS8A 1U6GA 1KZHA 4I2OA 4IF4A 2VE9A 4LD5A 4Q47A 1A6QA 2QGUA 2PMZA 2HXIA 3K7AJ 3I64A 2M45A 3WE3A 2NVTJ 2W85A 2FU4A 2OF7A 3PNTA 2IS4A 3I3LA 5H2FC 4OIOF 2KPMA 2CQXA 5FKMA 1VQNI 4A3BJ 3HBLA 5LGUA 1DDNA 3VSLA 2DYRH 2YS9A 3E1SA 4XRFA 4MTEA 2RC4A 1VQKI 2EA4A 4A3LJ 3FXKA 1USTA 3AKZA 3K70D 4KA4A 3FMSA 5L3GA 3GFJA 2QQAA 3CZ6A 4WX9A 4I0BA 5B1BH 4NUBA 5LFAA 2H8RA 1S29A 2ZJ2A 3D5LA 3NAUA 2JSCA 1S8NA 3TW7A 4A0ZA 2G9WA 3FHNA 3WHBA 2VLAA 3A1YA 3BQZA 2LRDA 3OR2C 1SFXA 2NYXA 2Y48A 1YS7A 2Z33A 1LNWA 3OYJA 3CTAA 1VQ6I 5KHDA 5CVIA 1RR7A 3FF5A 1ON2A 1T0FC 2BY3A 2CW0F 4E7LA 2XB5A
chains in the Genus database with same CATH topology
1W5TA 1TBXA 5L3BA 2HTSA 1L3LA 4NQWA 4QWQA 2K4JA 5ICEA 1ZRDA 3T1BA 2ZKZA 3RYRA 2A61A 1BOAA 3VEPA 3LAJA 5AONA 3F8BA 4KFCA 2KJCA 1T2KA 5L3EA 2QUFA 5CYVA 3FM5A 5DCMA 4P9FA 2P6TA 4CO8A 5LHHA 4JBAA 2IPQX 4O3MA 5E8GA 5L3FA 4LB6B 3ZMDA 3N97A 2FOKA 4YG2F 4KIBA 4DQ2A 4BYYA 3CJNA 2H94A 1T0FA 1F4KA 3VFZA 2FA5A 3AAFA 1HQCA 1FWZA 1GXPA 2DLLA 1FBQA 3FX3A 2C6YA 2IA0A 1RZ4A 3C1DA 2YSRA 2XVCA 3ISPA 5TJJA 1CF7B 2V9VA 4RGSA 1IZ1A 1ODDA 2HOEA 2PBIA 2MLGA 4EMSA 3TO6A 4EJOA 4EM2A 3HRTA 1L0OC 1Q1HA 1Z05A 1TQIA 5IT9Z 4XLNF 2IP2A 3QOPA 1JE8A 4I98B 5J8FA 2RDPA 4OOIA 3MEXA 2VBWA 3I54A 2RVCA 2AS5F 2CFXA 5D5VB 3P7NA 4LMYA 3R4KA 1FOKA 2GA2A 1ON1A 3F72A 2L02A 5DCFA 1RNLA 1O3SA 4G6QA 3TGNA 1A04A 5FLXZ 4M9XA 1ULYA 2VC1A 5TRDA 1G6NA 2GXGA 1CF7A 1R00A 3KZYA 2PJPA 3EDPA 2VT3A 1QO0D 3WTVC 2A68F 2H6CA 5DUKA 2XROA 2UZKA 2PEXA 4N0BA 3HRUA 4BH9A 3KP7A 3DEUA 4FHTA 1O57A 2UXXA 3G3ZA 1FP1D 2H09A 3TOAA 3TDZC 2L54A 5K5RA 2H6BA 3I58A 4G7HF 3DKWA 1V3FA 3PFIA 2X4HA 1MJ9A 3R60A 4U0YA 4HQMA 5CVRA 1E2XA 1I27A 3K0LA 1QZYA 1DUXC 2B0LA 4MQ9F 3TQNA 2KIUA 1J2XA 5E1XA 2QBYA 1ZREA 3SFZA 1FT9A 3BJ6A 3ECHA 3WE2A 3QAHA 3V8JA 3GW2A 3VODA 1I1SA 4BHPA 4L9VA 1LDKB 1YW9A 1VTNC 3SHFA 4EQQA 3HTSB 3DF8A 5FFZA 4HF0A 4TV7A 2P7CB 4HW0A 4UUVA 3FMQA 3ABUA 5BPDA 2YR2A 4KN7X 1H9GA 1IXRC 3DP7A 4F7ZA 1C0WA 2ELHA 3U9GA 2PQ8A 1R36A 2BEOA 3P9IA 3K69A 2XAFA 2CWEA 1XMKA 1SMYF 3GYHX 3ZPLA 4U7DA 2O6GE 3FHZA 3N4MA 4Y15A 2V1UA 1UFMA 1G3YA 5DYMA 3MQ0A 3KEQA 1ZRFA 3TO9A 4UV8A 2QZ8A 3U1DA 4HX4A 4M6XA 4IVNA 2Z99A 3B73A 4PZJA 4U0VA 3E6DA 3TOBA 2A6HF 2HTJA 1K6OA 4KUMA 2Z3YA 1IW7F 3ZP5A 1XDSA 3KLNA 3LAPA 1KU7A 2BBYA 3HSEA 3DPLC 2FNPA 1IF1A 5BMZA 4AVPA 1UHMA 1IRGA 3R0JA 3WGGA 2STWA 5DD8A 1R5HA 3BWGA 2G7HA 1BI2A 1H0MA 2CG4A 3WU1B 5HDKA 4P96A 1HXDA 2TDXA 1S3JA 3QP6A 4WK8F 4L0YB 4CYDA 1B4AA 3LWFA 3EETA 3GZ6A 3FXQA 1YW8A 4LGWA 1YTYA 2NNNA 1U5TB 2YPRA 2FMLA 1O3RA 1Z7UA 1OR7A 2D45A 3LSTA 1IXSB 4H0EA 2IVMA 4IHTA 4UVAA 4G9YA 3RKWA 2XAJA 5ERIA 3WTUC 3NRVA 4YFXF 5LGNA 4YIIA 3DPTA 2ZBKA 2HDCA 3HHHA 1K78B 2OA4A 1LVAA 1RUOA 4L18B 2IJLA 1SAXA 2Q8KA 3R0AA 5D6EA 2O3FA 4UV9A 4PGGA 4OIPF 4UXNA 1B9NA 1XMAA 4I0AA 4L0ZB 1HKSA 2ZNYA 5F6FA 4ZH4F 4KICA 2WC2A 4BAYA 1WWXA 1R1VA 1D8JA 4Y17A 1BIAA 4D0PA 4CXFA 4G7OF 2FBHA 5CLSA 1MGTA 3GEZA 3FM3A 1HSJA 2F2EA 2HGCA 4M72A 2ESHA 3HOTA 4M71A 3QU6A 2K27A 2WWYA 1Z6TA 1K78A 3GUDA 3GO5A 2OU2A 1S7OA 2EK5A 5LHGA 2XASA 1R1TA 4MEYF 1XD7A 2ADUA 2RNJA 6PAXA 1U3EM 1SD6A 1YIOA 4KT5C 1EV7A 2ISYA 1D3YA 1LDJA 2FSWA 2ZCWA 3LA3A 1TQMA 1HKQA 4KN4X 2HQRA 3M1EA 1ZAOA 5E1ZB 4RB0A 4LG0B 2OQGA 5LGTA 4HOBA 3WG9A 2Q0OA 5AIPA 4MQVA 1W7PB 5JFRA 1XSXA 2GAUA 3KP2A 2OAZA 5FFXA 1BBYA 3M7GA 3J81Z 1KYWA 1B59A 3E97A 4A0YA 3RIRA 1HW1A 2QENA 3CUQB 3K1PA 1CGPA 1OYIA 2D1HA 3J80K 3CO7C 3WTYC 4XLPF 3BROA 1BI0A 2PFBA 2VOPA 3TDUC 2EB7A 5D5UB 3E5XA 3E6BA 1STZA 2HQNA 2VE8A 2ZMEB 2EWNA 4L5JA 3F8MA 2XRNA 2ETHA 3BY6A 3BOQA 3KFWX 2W84A 5D6FA 3L2CA 3KZZA 1F5TA 4KDPA 2E7WA 3I59B 1AWCA 3ZMTA 1ZGAA 4U88A 5FD6A 2HKOA 3ERED 1ZRCA 2F5CA 5HS7A 2WV0A 5E1WA 4GO1A 3O2PE 2V6CA 1YG2A 2L4MA 3IL2A 2A6EF 3JSPA 1Y0UA 3KCCA 3GX4X 1ZG5A 3KLOA 1YS6A 3IRRA 4RS8A 3WODF 3NEUA 3NQOA 3PQJA 3KP4A 4ZYGA 4P5OA 2F5DA 3GZ5A 1LDDA 1P2FA 1LB2A 2JT1A 2GZWA 3FXRA 1FSEA 5J6XA 4HV5A 5H6QA 4IRIA 5LLQA 2DO7A 4B09A 3L00A 1I6XA 2H27A 1BC8C 2Y75A 1P4WA 3ZMZA 1SMTA 4PCQA 1PDNC 3WTSC 4OMYA 2HYFA 4ZZDA 4HF1A 4JQFA 2LNBA 4AIJA 5K1YA 2HEOA 3Q9VA 5H6RA 4P55A 2P4WA 3O6BB 2E1NA 4HF2A 3ECOA 2XUBA 4YIFA 4ZYHA 4ZYEA 2BGCA 3GVAA 1MJAA 3C7JA 3ZMSA 2XHKA 3FXUA 1GXQA 4S05A 2O8XA 2M30A 2DTRA 3B02A 3HHGA 1Z9CA 5ILVA 1HSTA 3L09A 5ILUA 2P7VB 2MA3A 4ENJA 4Q4ZF 2PMUA 3ABTA 3GFLA 1O3QA 1T39A 2XAGA 3IWFA 4ZYDA 3BPVA 1XSDA 1XCBA 4HX8A 4R1HA 3DXJF 3JW4A 3V8KA 3IKTA 3KETA 3IHUA 4WWCA 1XGNA 4O5VA 2PG4A 4LK1F 4HZFA 4WXDA 1S7AA 2DQRA 1TW3A 2CO5A 4A2UA 5E8IA 1P4XA 3HSFA 4OU0A 4GYIA 1U2WA 1G3SA 2VXZA 1BI3A 1BI1A 2L4AA 1FP2A 2A69F 2NAZA 2STTA 4I09A 3C3WA 2FEZA 3MCZA 4M9SA 1ZHFA 3RPUA 1UB9A 3V8LA 4G8XA 1LJ9A 3HRSA 3JTGA 1IAWA 4IJAA 4O6JA 1J75A 1G3WA 2J5OA 4GXOA 1D8KA 4ON0A 2BV6A 3W6KB 4HBLA 4BQAA 1J5YA 3F22A 5F64A 1YW7A 1KYZA 5FO5A 3COAC 3JSOA 4MNUA 1P4AA 1KQ0A 4KNYA 2LF8A 4EGZA 2JPBA 2KKOA 2VBXA 1B1BA 3WTWC 3F8FA 4LFUA 3ZN1A 1BM9A 1DPRA 3LQRA 2DPDA 2EFQA 2HS5A 1FNNA 4RB3C 2NNYA 3CUOA 3K1MA 4MGRA 5FGMA 2XAQA 2OZUA 4EJUA 5CVVA 5JVTA 1FSHA 1BIBA 2DK5A 1MDMB 1J59A 2FMYA 2RGVA 2A5YB 3HTUA 2M5WA 4Z2YA 1D5VA 4YFNF 2EV0A 4N9IA 3L7WA 1PUEE 3E6CC 4XBFA 1YYVA 3SZPA 3T0YA 2XAHA 2EFPA 1TW2A 2CYYA 2VBYA 2VONA 5L3CA 3MWMA 2FRHA 2MC3A 4A0XA 2DW4A 4EM0B 2YX7A 2XIGA 2EFWA 3IRQA 1ZARA 3HSRA 3WTTC 5JR3A 1IXCA 1JXSA 2P5KA 2EFOA 4M73A 4IPAA 2M8EA 3M9AA 2Q2EA 3T5XA 4HA8A 1E17A 4U7BA 2Z9OA 5CVUA 3VB2A 1RIOH 4MTDA 2P8TA 1IRFA 2VBZA 1U5TC 2ZXJA 2F5FA 1XN7A 5HDGA 1QBJA 1ZGJA 3SQNA 5IT9K 1GVJA 2A07F 1I1GA 1ZLKA 2IA1A 3BZ6A 4Q5SF 3G73A 1SFEA 2E1CA 2XKOA 5LBQA 4AIHA 3ELKA 1TLHB 1LEAA 5ICCA 1HBXG 5FLXK 2D2WA 5HS9A 3L9FA 3DQVC 3LA7A 4FX0A 1R22A 2M87A 2O0YA 3R6SA 3R61A 3E3VA 5ICGA 1ZG1A 2CSOA 5KVRA 4QLCU 1BJAA 1P6RA 1U5TA 1IN7A 3W6JB 1FZPB 5DDGA 1JHFA 1G3TA 2UWMA 1REPC 2DPUA 2P5LC 3FWEA 2MD5A 3OOPA 5E18F 1YQAA 2GQQA 1PP7U 2ESNA 4FT8A 4E70A 5HOOA 4AWXB 4HLYA 1YLFA 4L5IA 4YFKF 3M8EA 1HW2A 4EM1A 1EH7A 3EUHA 1T6SA 4LK0F 1TTYA 1MZBA 4G7ZF 2K02A 3MZYA 2PLYA 1LQ1A 3C18A 3MAJA 2CQKA 4A6DA 1T38A 2FF4A 1LEBA 1O3TA 1GHCA 1X3UA 4PDKA 1H9TA 2VC0A 2O03A 1KU2A 3I4PA 2KIMA 2YX4A 2RV8A 4AD9A 1QGPA 1F9NA 2M1BA 2VT2A 1FX7A 3GFMA 3K1NA 1KA8A 3H3ZA 1WSUA 4GGGA 3RYPA 4A5NA 3GWZA 3CUQC 4EGYA 3HOSA 4EV0A 4HLXA 2FBIA 2GWRA 5L3DA 1IN5A 2ISZA 4CHUA 1HW5A 4OIRF 4K2EA 3GXOA 2HFHA 3BPXA 1U8RA 2MH9A 3HRMA 2IRFG 4LG0A 2VN2A 2COMA 2J5PA 4S04A 1IN4A 3RPQA 1J0RA 3IWZA 4HDVA 1DPUA 2WTEA 1W7PA 1O7LA 4P9UA 5DCMB 3GLXA 3KEOA 3FMRA 4ENMA 3PQKA 1R23A 2OQRA 2FQ3A 1JHHA 2DU9A 2L3DA 3ULQB 4ENNA 1OYWA 1OYYA 2DT5A 4KIGA 5ICFA 3CUQA 4HDUA 5HDNA 3JAMZ 1IN6A 1FY7A 3I5UA 1ZH5A 1F1ZA 4L9NA 4DNCA 2KJBA 3QP5A 2EV6A 2PI0A 3DFGA 1RI7A 3GFIA 3MFKA 2RN7A 2DBBA 1HKTA 3P9KA 4RB2C 5LEKA 3F21A 2ZMEA 2QYOA 2F5EA 4IRGA 3ZMUA 3KP5A 4ESFA 2MLKA 3I59A 2IA2A 1Z1DA 3TKYA 1OKRA 4PGHA 5H20A 4MHGA 2QQ9A 2EFNA 2LF7A 3DV8A 3EQLF 1MJBA 3Q5FA 5CVJA 3SZTA 2HKXA 5KK1A 1IUYA 2K86A 4Y13A 3SXYA 2CGPA 4KMUX 3RJPA 1WQ2A 3K2ZA 3ROUA 1EH8A 2HWVA 3QU3A 1G4DA 4G94A 3TO7A 1V4RA 4RGXA 1O7FA 2K4BA 2EV5A 3WGIA 3ZQ7A 5K5QA 4FX4A 3E5QA 2KRFA 4EJWA 2L01A 5ED4A 1WKMA 2ZFWA 1KQ8A 3RKXA 5HLGA 3LFKA 1FYKA 2FNAA 2V79A 1AOYA 1QQIA 4ZZLA 5AIQA 1XSVA 1FBUA 3P9CA 2DK8A 4CDGA 4RB1A 1ZLJA 2JRTA 2IT0A 5D5WB 2R7FA 1QNTA 4G6DA 2UXNA 4CZZA 5JHUA 4AIKA 2LSOA 1B9MA 2QBYB 2XV4S 2K7LA 3H92A 4I01A 2LDUA 5A2QZ 3I0TA 2VODA 2PN6A 1JGSA 5D4RA 4RAYA 3ZN0A 1SD7A 2HYGD 2XGXA 3WTXC 4WXCA 3QPTA 2NS0A 3J81K 3GF2A 4I02A 1SD5A 3BJOA 1U78A 1XGOA 1UCRA 1TQPA 3OV8A 5E17F 1FBSA 2QM3A 2OBPA 3EYIA 1T98A 4KIFA 5JI6A 1J7KA 1R5GA 1FPQA 2W25A 3ZMVA 1DP7P 1R7JA 4OMZA 1R1UA 3ML6A 5D4SA 5LEJA 1KU9A 3KE2A 2HR3A 1S6LA 3D0SA 2GXBA 5E20A 3IKVA 2A3SA 4UVBA 4IHSA 2W57A 1W5SA 2KIFA 3WU0A 3KP3A 3RTRA 1W7PD 3BJAA 4Q48A 3RDIA 3F6OA 2MBFA 3CO6C 4HYEA 1WI9A 1KGSA 2BYVE 4UVCA 5HVQC 4L9TA 2O61A 2JTVA 1XGSA 2X0LA 2W24A 1BN5A 3JAMK 1Z6RA 5BPIA 5FD5A 3U2RA 4M6YA 4CGZA 1FYMA 3F6VA 1IN8A 4XSXF 2HZTA 1ZG3A 1K79A 2QVOA 1OPCA 4ASNA 3K9TA 4HQEA 2OZ6A 2NRAC 4XSZF 4M74A 5BQTA 5F1RA 4R79A 3J80Z 3T8TA 1SD4A 1W4MA 1EH6A 3F23A 1MKMA 4WXHA 5J8CA 2GA1A 2DQLA 1XB4A 1MDMA 4HAMA 3I71A 1KQ9A 1ZYRF 2E7XA 2FE3A 2MH2A 1SFUA 3V4GA 4NHJA 2D1VA 3BDDA 3WGHA 4N9HA 3H3UA 4LLNA 1FC3A 2EJRA 2YU3A 4UHTA 1R58A 4RGRA 1PP8F 4ENKA 1YO5C 5FB2A 3KP6A 3Q9SA 3IC7A 5BS6A 4A5MA 3FZVA 5IT3A 4RAZA 5ILSA 1FYLA 1K7AA 3F8NA 2PMHA 5DD4A 3HIFA 1UHWA 5LRRA 1OMIA 1QZZA 5D8KB 1I5ZA 2GIVA 2XKPA 3EYYA 4BHBA 4OINF 3BP8A 1J9IA 2VOOA 3LA2A 5LRSA 4EVIA 2V1DA 3RKYA 1YFHA 4EJVA 2V1XA 5D5XB 2DAOA 4GYGA 2AXLA 4I7HA 3V7CA 4A12A 2RQPA 4IRHA 3HUGA 4ESJA 3QRFF 3T8RA 4HV6A 2P5VA 3CLOA 1RUNA 1TNSA 2Z5UA 4CICA 2LKPA 4GCVA 3MZHA 5A2QK 3E5UA 1NHAA 2G7UA 3V7SA 3F8CA 3F3XA 1XGMA 2ZO4A 1KU3A 3REOA 4EJTA 1TNTA 2QQBA 4ETSA 4OIQF 4LLLA 1P92A 2ACJA 2JPCA 5EEHA 5HLHA 2RKHA 4JK1X 5D8LB 5DV5A 4BXUA 2DFIA 3M8FA 4L9JA 2BE5F 2DI3A 2QLZA 1ZN2A 4KMFA 4LLGF 3O3KA 1XDUA 2QWWA 3VOEA 1BC7C 3CDHA 3I53A 2IW5A 3V7RA 4LB5A 4WF2A 4NB5A 4UNOA 3WTZA 4BHCA 3LQQA 5DEQA 4IXAA 3J7AO 4R8HA 4RGUA 5K5OA 4ESBA 5EEGA 2EA2A 1B6AA 5HLIA 5BOXA 4M9ZA 1WRJA 2P6SA 2JZYA 4U0WA 1ONVA 2R7DA 5CJ9A 4BNCA 1Z91A 4HX7A 4LJZF 1USSA 3JTHA 3RI4A 2FBKA 1MD0A 4KYWA 3HYIA 5LHIA 1QPMA 1XCVA 4A6EA 2FXAA 3S2WA 4WCGA 2Y0MA 2R3SA 2OD5A 3E6MA 5DUIA 1FLIA 3QPHA 4B8XA 4MEXF 2ZNZA 5HS8A 1U6GA 4I2OA 4IF4A 2VE9A 4LD5A 4Q47A 3I64A 2M45A 3WE3A 2W85A 2FU4A 4OIOF 1DDNA 5LGUA 4XRFA 4MTEA 2RC4A 2EA4A 1USTA 4KA4A 3FMSA 5L3GA 3GFJA 2QQAA 4WX9A 4I0BA 1S29A 2ZJ2A 3D5LA 2JSCA 1S8NA 4A0ZA 2G9WA 1SFXA 2NYXA 2Y48A 1YS7A 2Z33A 1LNWA 3CTAA 5CVIA 3FF5A 1ON2A 2CW0F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5T A;  1TBX A;  5L3B A;  2HTS A;  1L3L A;  4NQW A;  4QWQ A;  2K4J A;  5ICE A;  1ZRD A;  3T1B A;  2ZKZ A;  3RYR A;  2A61 A;  1BOA A;  3VEP A;  3LAJ A;  5AON A;  3F8B A;  4KFC A;  2KJC A;  1T2K A;  5L3E A;  2QUF A;  5CYV A;  3FM5 A;  5DCM A;  4P9F A;  2P6T A;  4CO8 A;  5LHH A;  4JBA A;  2IPQ X;  4O3M A;  5E8G A;  5L3F A;  4LB6 B;  3ZMD A;  3N97 A;  2FOK A;  4YG2 F;  4KIB A;  4DQ2 A;  4BYY A;  3CJN A;  2H94 A;  1T0F A;  1F4K A;  3VFZ A;  2FA5 A;  3AAF A;  1HQC A;  1FWZ A;  1GXP A;  2DLL A;  1FBQ A;  3FX3 A;  2C6Y A;  2IA0 A;  1RZ4 A;  3C1D A;  2YSR A;  2XVC A;  3ISP A;  5TJJ A;  1CF7 B;  2V9V A;  4RGS A;  1IZ1 A;  1ODD A;  2HOE A;  2PBI A;  2MLG A;  4EMS A;  3TO6 A;  4EJO A;  4EM2 A;  3HRT A;  1L0O C;  1Q1H A;  1Z05 A;  1TQI A;  5IT9 Z;  4XLN F;  2IP2 A;  3QOP A;  1JE8 A;  4I98 B;  5J8F A;  2RDP A;  4OOI A;  3MEX A;  2VBW A;  3I54 A;  2RVC A;  2AS5 F;  2CFX A;  5D5V B;  3P7N A;  4LMY A;  3R4K A;  1FOK A;  2GA2 A;  1ON1 A;  3F72 A;  2L02 A;  5DCF A;  1RNL A;  1O3S A;  4G6Q A;  3TGN A;  1A04 A;  5FLX Z;  4M9X A;  1ULY A;  2VC1 A;  5TRD A;  1G6N A;  2GXG A;  1CF7 A;  1R00 A;  3KZY A;  2PJP A;  3EDP A;  2VT3 A;  1QO0 D;  3WTV C;  2A68 F;  2H6C A;  5DUK A;  2XRO A;  2UZK A;  2PEX A;  4N0B A;  3HRU A;  4BH9 A;  3KP7 A;  3DEU A;  4FHT A;  1O57 A;  2UXX A;  3G3Z A;  1FP1 D;  2H09 A;  3TOA A;  3TDZ C;  2L54 A;  5K5R A;  2H6B A;  3I58 A;  4G7H F;  3DKW A;  1V3F A;  3PFI A;  2X4H A;  1MJ9 A;  3R60 A;  4U0Y A;  4HQM A;  5CVR A;  1E2X A;  1I27 A;  3K0L A;  1QZY A;  1DUX C;  2B0L A;  4MQ9 F;  3TQN A;  2KIU A;  1J2X A;  5E1X A;  2QBY A;  1ZRE A;  3SFZ A;  1FT9 A;  3BJ6 A;  3ECH A;  3WE2 A;  3QAH A;  3V8J A;  3GW2 A;  3VOD A;  1I1S A;  4BHP A;  4L9V A;  1LDK B;  1YW9 A;  1VTN C;  3SHF A;  4EQQ A;  3HTS B;  3DF8 A;  5FFZ A;  4HF0 A;  4TV7 A;  2P7C B;  4HW0 A;  4UUV A;  3FMQ A;  3ABU A;  5BPD A;  2YR2 A;  4KN7 X;  1H9G A;  1IXR C;  3DP7 A;  4F7Z A;  1C0W A;  2ELH A;  3U9G A;  2PQ8 A;  1R36 A;  2BEO A;  3P9I A;  3K69 A;  2XAF A;  2CWE A;  1XMK A;  1SMY F;  3GYH X;  3ZPL A;  4U7D A;  2O6G E;  3FHZ A;  3N4M A;  4Y15 A;  2V1U A;  1UFM A;  1G3Y A;  5DYM A;  3MQ0 A;  3KEQ A;  1ZRF A;  3TO9 A;  4UV8 A;  2QZ8 A;  3U1D A;  4HX4 A;  4M6X A;  4IVN A;  2Z99 A;  3B73 A;  4PZJ A;  4U0V A;  3E6D A;  3TOB A;  2A6H F;  2HTJ A;  1K6O A;  4KUM A;  2Z3Y A;  1IW7 F;  3ZP5 A;  1XDS A;  3KLN A;  3LAP A;  1KU7 A;  2BBY A;  3HSE A;  3DPL C;  2FNP A;  1IF1 A;  5BMZ A;  4AVP A;  1UHM A;  1IRG A;  3R0J A;  3WGG A;  2STW A;  5DD8 A;  1R5H A;  3BWG A;  2G7H A;  1BI2 A;  1H0M A;  2CG4 A;  3WU1 B;  5HDK A;  4P96 A;  1HXD A;  2TDX A;  1S3J A;  3QP6 A;  4WK8 F;  4L0Y B;  4CYD A;  1B4A A;  3LWF A;  3EET A;  3GZ6 A;  3FXQ A;  1YW8 A;  4LGW A;  1YTY A;  2NNN A;  1U5T B;  2YPR A;  2FML A;  1O3R A;  1Z7U A;  1OR7 A;  2D45 A;  3LST A;  1IXS B;  4H0E A;  2IVM A;  4IHT A;  4UVA A;  4G9Y A;  3RKW A;  2XAJ A;  5ERI A;  3WTU C;  3NRV A;  4YFX F;  5LGN A;  4YII A;  3DPT A;  2ZBK A;  2HDC A;  3HHH A;  1K78 B;  2OA4 A;  1LVA A;  1RUO A;  4L18 B;  2IJL A;  1SAX A;  2Q8K A;  3R0A A;  5D6E A;  2O3F A;  4UV9 A;  4PGG A;  4OIP F;  4UXN A;  1B9N A;  1XMA A;  4I0A A;  4L0Z B;  1HKS A;  2ZNY A;  5F6F A;  4ZH4 F;  4KIC A;  2WC2 A;  4BAY A;  1WWX A;  1R1V A;  1D8J A;  4Y17 A;  1BIA A;  4D0P A;  4CXF A;  4G7O F;  2FBH A;  5CLS A;  1MGT A;  3GEZ A;  3FM3 A;  1HSJ A;  2F2E A;  2HGC A;  4M72 A;  2ESH A;  3HOT A;  4M71 A;  3QU6 A;  2K27 A;  2WWY A;  1Z6T A;  1K78 A;  3GUD A;  3GO5 A;  2OU2 A;  1S7O A;  2EK5 A;  5LHG A;  2XAS A;  1R1T A;  4MEY F;  1XD7 A;  2ADU A;  2RNJ A;  6PAX A;  1U3E M;  1SD6 A;  1YIO A;  4KT5 C;  1EV7 A;  2ISY A;  1D3Y A;  1LDJ A;  2FSW A;  2ZCW A;  3LA3 A;  1TQM A;  1HKQ A;  4KN4 X;  2HQR A;  3M1E A;  1ZAO A;  5E1Z B;  4RB0 A;  4LG0 B;  2OQG A;  5LGT A;  4HOB A;  3WG9 A;  2Q0O A;  5AIP A;  4MQV A;  1W7P B;  5JFR A;  1XSX A;  2GAU A;  3KP2 A;  2OAZ A;  5FFX A;  1BBY A;  3M7G A;  3J81 Z;  1KYW A;  1B59 A;  3E97 A;  4A0Y A;  3RIR A;  1HW1 A;  2QEN A;  3CUQ B;  3K1P A;  1CGP A;  1OYI A;  2D1H A;  3J80 K;  3CO7 C;  3WTY C;  4XLP F;  3BRO A;  1BI0 A;  2PFB A;  2VOP A;  3TDU C;  2EB7 A;  5D5U B;  3E5X A;  3E6B A;  1STZ A;  2HQN A;  2VE8 A;  2ZME B;  2EWN A;  4L5J A;  3F8M A;  2XRN A;  2ETH A;  3BY6 A;  3BOQ A;  3KFW X;  2W84 A;  5D6F A;  3L2C A;  3KZZ A;  1F5T A;  4KDP A;  2E7W A;  3I59 B;  1AWC A;  3ZMT A;  1ZGA A;  4U88 A;  5FD6 A;  2HKO A;  3ERE D;  1ZRC A;  2F5C A;  5HS7 A;  2WV0 A;  5E1W A;  4GO1 A;  3O2P E;  2V6C A;  1YG2 A;  2L4M A;  3IL2 A;  2A6E F;  3JSP A;  1Y0U A;  3KCC A;  3GX4 X;  1ZG5 A;  3KLO A;  1YS6 A;  3IRR A;  4RS8 A;  3WOD F;  3NEU A;  3NQO A;  3PQJ A;  3KP4 A;  4ZYG A;  4P5O A;  2F5D A;  3GZ5 A;  1LDD A;  1P2F A;  1LB2 A;  2JT1 A;  2GZW A;  3FXR A;  1FSE A;  5J6X A;  4HV5 A;  5H6Q A;  4IRI A;  5LLQ A;  2DO7 A;  4B09 A;  3L00 A;  1I6X A;  2H27 A;  1BC8 C;  2Y75 A;  1P4W A;  3ZMZ A;  1SMT A;  4PCQ A;  1PDN C;  3WTS C;  4OMY A;  2HYF A;  4ZZD A;  4HF1 A;  4JQF A;  2LNB A;  4AIJ A;  5K1Y A;  2HEO A;  3Q9V A;  5H6R A;  4P55 A;  2P4W A;  3O6B B;  2E1N A;  4HF2 A;  3ECO A;  2XUB A;  4YIF A;  4ZYH A;  4ZYE A;  2BGC A;  3GVA A;  1MJA A;  3C7J A;  3ZMS A;  2XHK A;  3FXU A;  1GXQ A;  4S05 A;  2O8X A;  2M30 A;  2DTR A;  3B02 A;  3HHG A;  1Z9C A;  5ILV A;  1HST A;  3L09 A;  5ILU A;  2P7V B;  2MA3 A;  4ENJ A;  4Q4Z F;  2PMU A;  3ABT A;  3GFL A;  1O3Q A;  1T39 A;  2XAG A;  3IWF A;  4ZYD A;  3BPV A;  1XSD A;  1XCB A;  4HX8 A;  4R1H A;  3DXJ F;  3JW4 A;  3V8K A;  3IKT A;  3KET A;  3IHU A;  4WWC A;  1XGN A;  4O5V A;  2PG4 A;  4LK1 F;  4HZF A;  4WXD A;  1S7A A;  2DQR A;  1TW3 A;  2CO5 A;  4A2U A;  5E8I A;  1P4X A;  3HSF A;  4OU0 A;  4GYI A;  1U2W A;  1G3S A;  2VXZ A;  1BI3 A;  1BI1 A;  2L4A A;  1FP2 A;  2A69 F;  2NAZ A;  2STT A;  4I09 A;  3C3W A;  2FEZ A;  3MCZ A;  4M9S A;  1ZHF A;  3RPU A;  1UB9 A;  3V8L A;  4G8X A;  1LJ9 A;  3HRS A;  3JTG A;  1IAW A;  4IJA A;  4O6J A;  1J75 A;  1G3W A;  2J5O A;  4GXO A;  1D8K A;  4ON0 A;  2BV6 A;  3W6K B;  4HBL A;  4BQA A;  1J5Y A;  3F22 A;  5F64 A;  1YW7 A;  1KYZ A;  5FO5 A;  3COA C;  3JSO A;  4MNU A;  1P4A A;  1KQ0 A;  4KNY A;  2LF8 A;  4EGZ A;  2JPB A;  2KKO A;  2VBX A;  1B1B A;  3WTW C;  3F8F A;  4LFU A;  3ZN1 A;  1BM9 A;  1DPR A;  3LQR A;  2DPD A;  2EFQ A;  2HS5 A;  1FNN A;  4RB3 C;  2NNY A;  3CUO A;  3K1M A;  4MGR A;  5FGM A;  2XAQ A;  2OZU A;  4EJU A;  5CVV A;  5JVT A;  1FSH A;  1BIB A;  2DK5 A;  1MDM B;  1J59 A;  2FMY A;  2RGV A;  2A5Y B;  3HTU A;  2M5W A;  4Z2Y A;  1D5V A;  4YFN F;  2EV0 A;  4N9I A;  3L7W A;  1PUE E;  3E6C C;  4XBF A;  1YYV A;  3SZP A;  3T0Y A;  2XAH A;  2EFP A;  1TW2 A;  2CYY A;  2VBY A;  2VON A;  5L3C A;  3MWM A;  2FRH A;  2MC3 A;  4A0X A;  2DW4 A;  4EM0 B;  2YX7 A;  2XIG A;  2EFW A;  3IRQ A;  1ZAR A;  3HSR A;  3WTT C;  5JR3 A;  1IXC A;  1JXS A;  2P5K A;  2EFO A;  4M73 A;  4IPA A;  2M8E A;  3M9A A;  2Q2E A;  3T5X A;  4HA8 A;  1E17 A;  4U7B A;  2Z9O A;  5CVU A;  3VB2 A;  1RIO H;  4MTD A;  2P8T A;  1IRF A;  2VBZ A;  1U5T C;  2ZXJ A;  2F5F A;  1XN7 A;  5HDG A;  1QBJ A;  1ZGJ A;  3SQN A;  5IT9 K;  1GVJ A;  2A07 F;  1I1G A;  1ZLK A;  2IA1 A;  3BZ6 A;  4Q5S F;  3G73 A;  1SFE A;  2E1C A;  2XKO A;  5LBQ A;  4AIH A;  3ELK A;  1TLH B;  1LEA A;  5ICC A;  1HBX G;  5FLX K;  2D2W A;  5HS9 A;  3L9F A;  3DQV C;  3LA7 A;  4FX0 A;  1R22 A;  2M87 A;  2O0Y A;  3R6S A;  3R61 A;  3E3V A;  5ICG A;  1ZG1 A;  2CSO A;  5KVR A;  4QLC U;  1BJA A;  1P6R A;  1U5T A;  1IN7 A;  3W6J B;  1FZP B;  5DDG A;  1JHF A;  1G3T A;  2UWM A;  1REP C;  2DPU A;  2P5L C;  3FWE A;  2MD5 A;  3OOP A;  5E18 F;  1YQA A;  2GQQ A;  1PP7 U;  2ESN A;  4FT8 A;  4E70 A;  5HOO A;  4AWX B;  4HLY A;  1YLF A;  4L5I A;  4YFK F;  3M8E A;  1HW2 A;  4EM1 A;  1EH7 A;  3EUH A;  1T6S A;  4LK0 F;  1TTY A;  1MZB A;  4G7Z F;  2K02 A;  3MZY A;  2PLY A;  1LQ1 A;  3C18 A;  3MAJ A;  2CQK A;  4A6D A;  1T38 A;  2FF4 A;  1LEB A;  1O3T A;  1GHC A;  1X3U A;  4PDK A;  1H9T A;  2VC0 A;  2O03 A;  1KU2 A;  3I4P A;  2KIM A;  2YX4 A;  2RV8 A;  4AD9 A;  1QGP A;  1F9N A;  2M1B A;  2VT2 A;  1FX7 A;  3GFM A;  3K1N A;  1KA8 A;  3H3Z A;  1WSU A;  4GGG A;  3RYP A;  4A5N A;  3GWZ A;  3CUQ C;  4EGY A;  3HOS A;  4EV0 A;  4HLX A;  2FBI A;  2GWR A;  5L3D A;  1IN5 A;  2ISZ A;  4CHU A;  1HW5 A;  4OIR F;  4K2E A;  3GXO A;  2HFH A;  3BPX A;  1U8R A;  2MH9 A;  3HRM A;  2IRF G;  4LG0 A;  2VN2 A;  2COM A;  2J5P A;  4S04 A;  1IN4 A;  3RPQ A;  1J0R A;  3IWZ A;  4HDV A;  1DPU A;  2WTE A;  1W7P A;  1O7L A;  4P9U A;  5DCM B;  3GLX A;  3KEO A;  3FMR A;  4ENM A;  3PQK A;  1R23 A;  2OQR A;  2FQ3 A;  1JHH A;  2DU9 A;  2L3D A;  3ULQ B;  4ENN A;  1OYW A;  1OYY A;  2DT5 A;  4KIG A;  5ICF A;  3CUQ A;  4HDU A;  5HDN A;  3JAM Z;  1IN6 A;  1FY7 A;  3I5U A;  1ZH5 A;  1F1Z A;  4L9N A;  4DNC A;  2KJB A;  3QP5 A;  2EV6 A;  2PI0 A;  3DFG A;  1RI7 A;  3GFI A;  3MFK A;  2RN7 A;  2DBB A;  1HKT A;  3P9K A;  4RB2 C;  5LEK A;  3F21 A;  2ZME A;  2QYO A;  2F5E A;  4IRG A;  3ZMU A;  3KP5 A;  4ESF A;  2MLK A;  3I59 A;  2IA2 A;  1Z1D A;  3TKY A;  1OKR A;  4PGH A;  5H20 A;  4MHG A;  2QQ9 A;  2EFN A;  2LF7 A;  3DV8 A;  3EQL F;  1MJB A;  3Q5F A;  5CVJ A;  3SZT A;  2HKX A;  5KK1 A;  1IUY A;  2K86 A;  4Y13 A;  3SXY A;  2CGP A;  4KMU X;  3RJP A;  1WQ2 A;  3K2Z A;  3ROU A;  1EH8 A;  2HWV A;  3QU3 A;  1G4D A;  4G94 A;  3TO7 A;  1V4R A;  4RGX A;  1O7F A;  2K4B A;  2EV5 A;  3WGI A;  3ZQ7 A;  5K5Q A;  4FX4 A;  3E5Q A;  2KRF A;  4EJW A;  2L01 A;  5ED4 A;  1WKM A;  2ZFW A;  1KQ8 A;  3RKX A;  5HLG A;  3LFK A;  1FYK A;  2FNA A;  2V79 A;  1AOY A;  1QQI A;  4ZZL A;  5AIQ A;  1XSV A;  1FBU A;  3P9C A;  2DK8 A;  4CDG A;  4RB1 A;  1ZLJ A;  2JRT A;  2IT0 A;  5D5W B;  2R7F A;  1QNT A;  4G6D A;  2UXN A;  4CZZ A;  5JHU A;  4AIK A;  2LSO A;  1B9M A;  2QBY B;  2XV4 S;  2K7L A;  3H92 A;  4I01 A;  2LDU A;  5A2Q Z;  3I0T A;  2VOD A;  2PN6 A;  1JGS A;  5D4R A;  4RAY A;  3ZN0 A;  1SD7 A;  2HYG D;  2XGX A;  3WTX C;  4WXC A;  3QPT A;  2NS0 A;  3J81 K;  3GF2 A;  4I02 A;  1SD5 A;  3BJO A;  1U78 A;  1XGO A;  1UCR A;  1TQP A;  3OV8 A;  5E17 F;  1FBS A;  2QM3 A;  2OBP A;  3EYI A;  1T98 A;  4KIF A;  5JI6 A;  1J7K A;  1R5G A;  1FPQ A;  2W25 A;  3ZMV A;  1DP7 P;  1R7J A;  4OMZ A;  1R1U A;  3ML6 A;  5D4S A;  5LEJ A;  1KU9 A;  3KE2 A;  2HR3 A;  1S6L A;  3D0S A;  2GXB A;  5E20 A;  3IKV A;  2A3S A;  4UVB A;  4IHS A;  2W57 A;  1W5S A;  2KIF A;  3WU0 A;  3KP3 A;  3RTR A;  1W7P D;  3BJA A;  4Q48 A;  3RDI A;  3F6O A;  2MBF A;  3CO6 C;  4HYE A;  1WI9 A;  1KGS A;  2BYV E;  4UVC A;  5HVQ C;  4L9T A;  2O61 A;  2JTV A;  1XGS A;  2X0L A;  2W24 A;  1BN5 A;  3JAM K;  1Z6R A;  5BPI A;  5FD5 A;  3U2R A;  4M6Y A;  4CGZ A;  1FYM A;  3F6V A;  1IN8 A;  4XSX F;  2HZT A;  1ZG3 A;  1K79 A;  2QVO A;  1OPC A;  4ASN A;  3K9T A;  4HQE A;  2OZ6 A;  2NRA C;  4XSZ F;  4M74 A;  5BQT A;  5F1R A;  4R79 A;  3J80 Z;  3T8T A;  1SD4 A;  1W4M A;  1EH6 A;  3F23 A;  1MKM A;  4WXH A;  5J8C A;  2GA1 A;  2DQL A;  1XB4 A;  1MDM A;  4HAM A;  3I71 A;  1KQ9 A;  1ZYR F;  2E7X A;  2FE3 A;  2MH2 A;  1SFU A;  3V4G A;  4NHJ A;  2D1V A;  3BDD A;  3WGH A;  4N9H A;  3H3U A;  4LLN A;  1FC3 A;  2EJR A;  2YU3 A;  4UHT A;  1R58 A;  4RGR A;  1PP8 F;  4ENK A;  1YO5 C;  5FB2 A;  3KP6 A;  3Q9S A;  3IC7 A;  5BS6 A;  4A5M A;  3FZV A;  5IT3 A;  4RAZ A;  5ILS A;  1FYL A;  1K7A A;  3F8N A;  2PMH A;  5DD4 A;  3HIF A;  1UHW A;  5LRR A;  1OMI A;  1QZZ A;  5D8K B;  1I5Z A;  2GIV A;  2XKP A;  3EYY A;  4BHB A;  4OIN F;  3BP8 A;  1J9I A;  2VOO A;  3LA2 A;  5LRS A;  4EVI A;  2V1D A;  3RKY A;  1YFH A;  4EJV A;  2V1X A;  5D5X B;  2DAO A;  4GYG A;  2AXL A;  4I7H A;  3V7C A;  4A12 A;  2RQP A;  4IRH A;  3HUG A;  4ESJ A;  3QRF F;  3T8R A;  4HV6 A;  2P5V A;  3CLO A;  1RUN A;  1TNS A;  2Z5U A;  4CIC A;  2LKP A;  4GCV A;  3MZH A;  5A2Q K;  3E5U A;  1NHA A;  2G7U A;  3V7S A;  3F8C A;  3F3X A;  1XGM A;  2ZO4 A;  1KU3 A;  3REO A;  4EJT A;  1TNT A;  2QQB A;  4ETS A;  4OIQ F;  4LLL A;  1P92 A;  2ACJ A;  2JPC A;  5EEH A;  5HLH A;  2RKH A;  4JK1 X;  5D8L B;  5DV5 A;  4BXU A;  2DFI A;  3M8F A;  4L9J A;  2BE5 F;  2DI3 A;  2QLZ A;  1ZN2 A;  4KMF A;  4LLG F;  3O3K A;  1XDU A;  2QWW A;  3VOE A;  1BC7 C;  3CDH A;  3I53 A;  2IW5 A;  3V7R A;  4LB5 A;  4WF2 A;  4NB5 A;  4UNO A;  3WTZ A;  4BHC A;  3LQQ A;  5DEQ A;  4IXA A;  3J7A O;  4R8H A;  4RGU A;  5K5O A;  4ESB A;  5EEG A;  2EA2 A;  1B6A A;  5HLI A;  5BOX A;  4M9Z A;  1WRJ A;  2P6S A;  2JZY A;  4U0W A;  1ONV A;  2R7D A;  5CJ9 A;  4BNC A;  1Z91 A;  4HX7 A;  4LJZ F;  1USS A;  3JTH A;  3RI4 A;  2FBK A;  1MD0 A;  4KYW A;  3HYI A;  5LHI A;  1QPM A;  1XCV A;  4A6E A;  2FXA A;  3S2W A;  4WCG A;  2Y0M A;  2R3S A;  2OD5 A;  3E6M A;  5DUI A;  1FLI A;  3QPH A;  4B8X A;  4MEX F;  2ZNZ A;  5HS8 A;  1U6G A;  4I2O A;  4IF4 A;  2VE9 A;  4LD5 A;  4Q47 A;  3I64 A;  2M45 A;  3WE3 A;  2W85 A;  2FU4 A;  4OIO F;  1DDN A;  5LGU A;  4XRF A;  4MTE A;  2RC4 A;  2EA4 A;  1UST A;  4KA4 A;  3FMS A;  5L3G A;  3GFJ A;  2QQA A;  4WX9 A;  4I0B A;  1S29 A;  2ZJ2 A;  3D5L A;  2JSC A;  1S8N A;  4A0Z A;  2G9W A;  1SFX A;  2NYX A;  2Y48 A;  1YS7 A;  2Z33 A;  1LNW A;  3CTA A;  5CVI A;  3FF5 A;  1ON2 A;  2CW0 F; 
#chains in the Genus database with same CATH topology
 4XN0 A;  1W5T A;  4CUG A;  1TBX A;  5L3B A;  2HTS A;  1L3L A;  4NQW A;  3HG9 A;  3VYU B;  4HNU A;  4QWQ A;  2K4J A;  5ICE A;  1ZRD A;  1ERD A;  3T1B A;  3E0J B;  5FKK A;  2ZKZ A;  4CA0 A;  3RYR A;  2A61 A;  1BOA A;  1JGG A;  3S15 J;  3VEP A;  4ZJZ A;  4NDL A;  3LAJ A;  2DOE A;  5AON A;  3F8B A;  4KFC A;  2KJC A;  3JRC A;  1T2K A;  5F0H A;  5L3E A;  4PFP A;  2QUF A;  3LSK A;  2O7O A;  1GDT A;  5CYV A;  3FM5 A;  3ZQQ A;  1T8I A;  5DCM A;  1WPK A;  2LOO A;  3BR3 A;  4P9F A;  2P6T A;  4CO8 A;  5LHH A;  4J01 A;  2BOL A;  1D1C A;  3SEQ A;  3ASN H;  4JBA A;  1IRX A;  2IPQ X;  2L7M P;  1ZR2 A;  4O3M A;  5E8G A;  5L3F A;  4LB6 B;  3ERM A;  3ZMD A;  1Z67 A;  3N97 A;  3CC7 I;  2KLO A;  4QTR A;  2FOK A;  4YG2 F;  1A31 A;  1R4N B;  4KIB A;  4DQ2 A;  2LH9 A;  4BYY A;  2LLK A;  3CQZ J;  5F08 A;  1OFC X;  3CJN A;  2E1M C;  3A0H C;  2H94 A;  3OYG A;  1T0F A;  1F4K A;  4XRS A;  1MBE A;  2EBI A;  3H0G J;  3VFZ A;  2FA5 A;  4HG2 A;  3AAF A;  2DFH A;  2HQ5 A;  1NH3 A;  2XGD A;  1HQC A;  1FWZ A;  1GXP A;  2DLL A;  1FBQ A;  1ZR4 A;  1E0E A;  4GRI A;  1GT0 C;  4IO9 F;  3W2W A;  2PJR B;  3FX3 A;  5IPA A;  2C6Y A;  1IC8 A;  2IA0 A;  1RZ4 A;  3C1D A;  2YSR A;  2CQN A;  3ABL H;  2XVC A;  3CD6 I;  3ISP A;  5TJJ A;  1CF7 B;  2V9V A;  1Z3Y A;  4RGS A;  1IZ1 A;  3RQ4 A;  3AG3 H;  1ODD A;  2MFZ A;  2HOE A;  4HNV A;  2PBI A;  2E71 A;  3BTI A;  2MLG A;  4EMS A;  3TO6 A;  1M1E B;  5HOD A;  1R49 A;  4EJO A;  1B72 A;  3H9J A;  4UUS B;  1E3O C;  4EM2 A;  2H8W A;  2E60 A;  3HRT A;  4QIW N;  1L0O C;  1GV2 A;  1Q1H A;  2X1C A;  1Z05 A;  1TQI A;  5IT9 Z;  4XLN F;  5K7Z A;  4IKF A;  2IP2 A;  3QOP A;  1JE8 A;  4I98 B;  5J8F A;  4PSW A;  2HYJ A;  3PUB A;  2RDP A;  4H4K C;  5HNH A;  4OOI A;  3MEX A;  1BW6 A;  2VBW A;  3L2Q A;  1AU7 A;  2CV0 A;  1WJE A;  3I54 A;  2RVC A;  2AS5 F;  2XGE A;  2CFX A;  2WB1 A;  5D5V B;  3P7N A;  1VQL I;  2DT7 B;  4LMY A;  4PJM A;  2QCO A;  3R4K A;  3PNY A;  1FOK A;  2GA2 A;  1HCR A;  1ON1 A;  3F72 A;  3S8P A;  2L02 A;  5DCF A;  1RNL A;  3JR9 A;  1O3S A;  4G6Q A;  3TGN A;  1A04 A;  1W0U A;  1WH5 A;  5FLX Z;  1IDY A;  1Y0N A;  4CCL A;  4M9X A;  1JTX A;  1ULY A;  2RNG A;  2VC1 A;  3MKZ A;  5TRD A;  5KCM A;  4RMN A;  2RQQ A;  1G6N A;  2GXG A;  1CF7 A;  1R00 A;  3KZY A;  2PJP A;  3EDP A;  2LR8 A;  2XF6 A;  2OTL I;  2VT3 A;  1MNM C;  1DU6 A;  5FKO A;  2LBF B;  5CQG A;  3H5R A;  1QO0 D;  3WTV C;  2A05 A;  2A68 F;  2H6C A;  5DUK A;  2VKH A;  2XRO A;  2UZK A;  2W00 A;  4AC0 A;  5C4J J;  1YOV B;  2PEX A;  3DLA A;  4XN3 A;  4N0B A;  3AG4 H;  3PFY A;  1VQ9 I;  2VQC A;  3AFH A;  3HRU A;  4BH9 A;  4AYB A;  2ZXW H;  3KX2 A;  1MBK A;  3KP7 A;  3DEU A;  3G6E I;  4FHT A;  1O57 A;  2UXX A;  2GBY A;  3G3Z A;  1FP1 D;  2M7A A;  2BW3 B;  2VUM J;  2H09 A;  2CW8 A;  1PUF A;  1ORK A;  3ZGK A;  3TOA A;  4B47 A;  3TDZ C;  2L54 A;  5K5R A;  3FKJ A;  2H6B A;  1JJ8 C;  2ZSH B;  3I58 A;  4G7H F;  1I6H J;  3DKW A;  1V3F A;  3PFI A;  2IGO A;  2X4H A;  1MJ9 A;  1FMV A;  3R60 A;  4U0Y A;  4HQM A;  2M4G A;  5CVR A;  2BVM A;  4CH7 A;  5FKL A;  1MBG A;  1E2X A;  2CFO A;  3S32 A;  3VWB A;  1I27 A;  1SAN A;  4XLC A;  3K0L A;  1QZY A;  1DUX C;  3DKY A;  2B0L A;  4MQ9 F;  3TQN A;  1W36 C;  1R4M B;  2KIU A;  2MC4 A;  2YUS A;  1J2X A;  4D7M A;  4RLQ A;  3FDY A;  5E1X A;  1ETW A;  5FRO A;  2QBY A;  3ZQF A;  1ZRE A;  1JUM A;  3K70 C;  3CCE I;  2LBF A;  2XGC A;  2OPT A;  3SFZ A;  5DS9 A;  1FT9 A;  3BJ6 A;  3ECH A;  3WE2 A;  3QAH A;  2V7F A;  2B63 J;  2ME6 A;  3SYT A;  3V8J A;  3GW2 A;  1FMW A;  1U0J A;  4I76 A;  3VOD A;  4BHP A;  2VPL A;  1I1S A;  5CQE A;  4L9V A;  1LDK B;  1NK3 P;  2VQL A;  2B9S A;  1YW9 A;  1VTN C;  3BZC A;  1QHG A;  3SHF A;  4EQQ A;  3HTS B;  3DF8 A;  3DTI A;  4E7K A;  1BA5 A;  5FFZ A;  2AQF A;  1TWF J;  3HPH A;  4HF0 A;  4HW0 A;  4TV7 A;  2DT6 A;  2P7C B;  4UUV A;  3FMQ A;  3ABU A;  5BPD A;  2YR2 A;  4A3E J;  2W82 A;  4KN7 X;  1H9G A;  4C3H J;  1IXR C;  1E3H A;  5M5X J;  4BY1 J;  3DP7 A;  4F7Z A;  3GTK J;  1C0W A;  2ELH A;  3U9G A;  2PQ8 A;  1R36 A;  2BEO A;  3P9I A;  2XPV A;  3GME A;  2HI3 A;  2VAS A;  3K69 A;  4MIM A;  4C2T A;  2XAF A;  2CWE A;  1XMK A;  1YJW I;  1SMY F;  2FD5 A;  2NVU B;  3GYH X;  1LFB A;  2DMP A;  3ZPL A;  3CDL A;  3GTQ J;  3HKZ A;  4B44 A;  4ITV A;  2GLO A;  4U7D A;  2O6G E;  2B7E A;  1X2M A;  3FHZ A;  3N4M A;  2QSH X;  4Y15 A;  2Q2E B;  2JA7 J;  2V1U A;  4AUX A;  1UFM A;  2LFB A;  1G3Y A;  5DYM A;  3MQ0 A;  3KEQ A;  1ZRF A;  4DW6 A;  3TO9 A;  4UV8 A;  2QZ8 A;  1TWA J;  3U1D A;  4HX4 A;  4M6X A;  5C3E J;  4IVN A;  1HA8 A;  3IP4 B;  2Z99 A;  2VKE A;  3B73 A;  4PZJ A;  4U0V A;  3E6D A;  2A6H F;  2HTJ A;  3TOB A;  1K6O A;  2P0W A;  5E3L A;  4KUM A;  2EH3 A;  2Z3Y A;  1IW7 F;  1OR7 C;  3CME I;  3ZP5 A;  2F4I A;  3HGY A;  5EG0 A;  1S9H A;  1XDS A;  3FXL A;  1YIT I;  3KLN A;  3LAP A;  1KU7 A;  2BBY A;  1NG7 A;  3HSE A;  4DYQ A;  4C9Y A;  3DPL C;  2FNP A;  2R7X A;  1IF1 A;  5BMZ A;  1EJ9 A;  2H1L A;  3A0B C;  9ANT A;  4AVP A;  2IXS A;  1UHM A;  3I55 I;  4XM3 A;  4UB6 C;  1JTY A;  4IX7 A;  2R0Q C;  3RQI A;  3BCB A;  4BE2 A;  3OYL A;  3R0J A;  1IRG A;  3WGG A;  3BR5 A;  5HLT A;  5DD8 A;  1R5H A;  2STW A;  3BWG A;  2G7H A;  5IOY A;  1IUF A;  1BI2 A;  4DJA A;  2X6X A;  1H0M A;  2DOF A;  2CG4 A;  2DA6 A;  2ICW G;  3WU1 B;  5HDK A;  4V19 K;  4P96 A;  1HXD A;  2TDX A;  2CV2 A;  1S3J A;  3QP6 A;  2E36 A;  5FLV A;  4WK8 F;  2BHZ A;  4L0Y B;  5KAI C;  4CYD A;  3S1M J;  4BKX A;  1Z0X A;  2FJ1 A;  4I6Z A;  3HC7 A;  3BG6 A;  4A3C J;  2HU9 A;  2RRE A;  3GTM J;  4XLH A;  2CQQ A;  1B4A A;  3ZQL A;  3LWF A;  3EET A;  2NS8 A;  4DYC A;  3GZ6 A;  2VIX A;  1YW8 A;  3FXQ A;  1OJL A;  4LGW A;  2M8G X;  2NNN A;  1YTY A;  1U5T B;  1MIJ A;  1G8X A;  5LD2 C;  4Z6Y A;  2YPR A;  2FML A;  1O3R A;  2OC6 A;  1MW7 A;  1YI2 I;  4YEL A;  1Z7U A;  3AL0 C;  4W97 A;  3SZG A;  1OR7 A;  2D45 A;  3LST A;  2QEX I;  1IXS B;  4H0E A;  2I8D A;  5JVG F;  4B1R A;  2OUM A;  1DGW Y;  2IVM A;  4IHT A;  4UVA A;  1HLV A;  3H35 A;  4G9Y A;  3RKW A;  1P9Q C;  2XAJ A;  5ERI A;  3F9K A;  3WTU C;  3NRV A;  2L7K A;  2WAD A;  4YFX F;  5LGN A;  4AU7 A;  2E5Z A;  4YII A;  1FIP A;  2HNH A;  3DPT A;  2ZBK A;  3DPU A;  2XSD C;  2HDC A;  4PSX A;  2CUE A;  3HHH A;  1K78 B;  2FX0 A;  2OA4 A;  1LVA A;  2VL8 A;  3JRD A;  4FET A;  1RUO A;  3BG5 A;  4L18 B;  2IJL A;  1SAX A;  3IH2 A;  1LUJ B;  2Q8K A;  4MO7 A;  3R0A A;  1LVK A;  5D6E A;  4II2 A;  1ETO A;  2KFD A;  2O3F A;  4UV9 A;  4PGG A;  3Q0U A;  4OIP F;  4UXN A;  1B9N A;  4J19 A;  1XMA A;  4I0A A;  4L0Z B;  2VQH A;  1HKS A;  2ZNY A;  5F6F A;  3PL8 A;  4KIC A;  4ZH4 F;  4A3M J;  2WC2 A;  3M4O J;  4BAY A;  1WWX A;  1R1V A;  1D8J A;  4JX5 A;  4Y17 A;  3LL7 A;  2JA2 A;  1BIA A;  4D0P A;  1SVL A;  4XK4 A;  4CXF A;  2M0M A;  5CPR B;  4G7O F;  1VQP I;  5JHF A;  2FBH A;  1RRJ A;  5CLS A;  1MGT A;  1K4S A;  3AG1 H;  3GEZ A;  5JLW A;  2HXO A;  4JP0 A;  3OYK A;  3X2Q H;  5F1J A;  3FM3 A;  1HSJ A;  3DWL E;  2K9N A;  2F2E A;  2HGC A;  4M72 A;  2ESH A;  5JLX A;  3HOT A;  4M71 A;  3QU6 A;  2Y0S A;  2IAI A;  2K27 A;  5J3L A;  2WWY A;  1Z6T A;  2DN0 A;  3BCA A;  4HPQ A;  2D5V A;  1K78 A;  3GUD A;  3D5S C;  3GO5 A;  1FJL A;  2CU7 A;  2OU2 A;  4XID A;  2GOX B;  2JRM A;  1S7O A;  3DKX A;  4FTH A;  2EK5 A;  2EIJ H;  2X6O A;  4C2U A;  1LKX A;  5LHG A;  2TCT A;  2XAS A;  2DFF A;  2XF5 A;  3CCV I;  1R1T A;  1D0X A;  3VYT B;  4MEY F;  1XD7 A;  4IQJ A;  3VDX A;  2ADU A;  1WVR A;  1ETV A;  2P81 A;  2RNJ A;  1U3E M;  6PAX A;  1SD6 A;  3K4L A;  3RPU D;  1YIO A;  4KT5 C;  4PUS A;  1EV7 A;  2ISY A;  1D3Y A;  3BT9 A;  4FAS D;  2NVY J;  3CC2 I;  1LDJ A;  2AXT C;  1GUU A;  2ZJP F;  2FSW A;  3CCY A;  4YEJ A;  2ZCW A;  5KNL A;  3LA3 A;  1TQM A;  1HKQ A;  2DCE A;  5B3S H;  3CP8 A;  4KN4 X;  4PJ0 C;  3SJM A;  2HVS A;  1E3P A;  2M0C A;  5KAF C;  2GM4 A;  2STT A;  2DDA A;  2HQR A;  4FIS A;  2R7V A;  2L0K A;  3M1E A;  3CF5 F;  1UJ8 A;  3N05 A;  1ZAO A;  4CYC B;  2KMU A;  5E1Z B;  1FEX A;  2LYC A;  4QPO A;  4RB0 A;  4LG0 B;  2R92 J;  2OQG A;  3DEW A;  4M6V A;  5LGT A;  4HOB A;  3WG9 A;  2Q0O A;  3LSR A;  1HOM A;  2LMD A;  5EJC A;  3O8G A;  1JKO C;  1ETK A;  1VF9 A;  5AIP A;  4MQV A;  3S2H J;  4BGD A;  1JT0 A;  1W7P B;  4IOC F;  2ECC A;  5JFR A;  1XSX A;  1FIA A;  2EZL A;  1WH7 A;  3S3N A;  4MFD A;  3H1C A;  2JSP A;  3K6G A;  2GAU A;  2E34 A;  1T33 A;  2XSJ C;  3KP2 A;  3GTG J;  2OAZ A;  5FFX A;  2EZK A;  1JKQ C;  1BBY A;  3KEY A;  3M7G A;  2BY0 A;  1OLT A;  3J81 Z;  2QQ8 A;  2VJ4 A;  4XRM A;  2HPI A;  1KYW A;  1B59 A;  1U8B A;  4NC8 A;  3E97 A;  4A0Y A;  3RIR A;  5IP6 A;  5GPC A;  1HW1 A;  3KYL A;  2QEN A;  2ECB A;  3A4C A;  3CUQ B;  4B3X A;  3SFI A;  1LPQ A;  3K1P A;  1W36 D;  2WAQ A;  1CGP A;  1WJD A;  3L2V A;  1OYI A;  2D1H A;  3J80 K;  1YHQ I;  3CCJ I;  3CO7 C;  3DCF A;  3WTY C;  1TL8 A;  1TT0 A;  4XLP F;  1LE8 B;  3BRO A;  1BI0 A;  2PFB A;  2VOP A;  3IV5 A;  3TDU C;  4BL0 B;  2EB7 A;  1MMN A;  5D5U B;  3E5X A;  3E6B A;  2QA4 I;  1TP4 A;  1STZ A;  2HQN A;  5GTI C;  2VE8 A;  4IEJ A;  2ZME B;  2EWN A;  3KYD B;  4L5J A;  5J40 A;  3GTJ J;  3F8M A;  1OCO H;  2XRN A;  3LSP A;  1N75 A;  4OWR B;  2ETH A;  3BY6 A;  2CUF A;  2EPF A;  5IP7 J;  4YRV A;  2IS1 A;  3BOQ A;  3BQY A;  3KFW X;  2JN6 A;  2W84 A;  4RM2 A;  3VYR B;  5EDN A;  4JYK A;  5D6F A;  3L2C A;  3KZZ A;  1VQO I;  3OS2 A;  1F5T A;  1QPI A;  4A3D J;  4KDP A;  2E7W A;  4B43 A;  3I59 B;  3VYS B;  5E3M A;  1AWC A;  4PJJ A;  3ZMT A;  1JKP C;  1KON A;  1ZGA A;  2DOD A;  3IAS 2;  2K9Q A;  4U88 A;  1V5F A;  5FD6 A;  2HKO A;  3FK7 A;  3ERE D;  2ZXI A;  1ZRC A;  2F5C A;  5HS7 A;  3OS0 A;  2IBD A;  3J7Z I;  4A3J J;  2JMW A;  5E3O A;  2YU9 J;  2XB0 X;  2VPR A;  2WV0 A;  5E1W A;  4XKV A;  2CS3 A;  2FQ4 A;  4GO1 A;  3O2P E;  1TT5 B;  2V6C A;  1YG2 A;  2L4M A;  3IL2 A;  1MSE C;  2A6E F;  1UZC A;  4RAF A;  3JSP A;  1Y0U A;  3KCC A;  3GX4 X;  1ZG5 A;  1ZTR A;  3KLO A;  1YS6 A;  2LD5 A;  4LIV A;  3IRR A;  4RS8 A;  3WOD F;  3NEU A;  2VXD A;  4G6T B;  3JCU C;  4KIT B;  3C2G A;  3NQO A;  3PQJ A;  3KP4 A;  4ZYG A;  1NG6 A;  4P5O A;  2K85 A;  3JRB A;  2F5D A;  3GZ5 A;  2OV7 A;  1ZEL A;  4LIU A;  3S1R J;  1LDD A;  1P2F A;  3KPH A;  1LB2 A;  2JT1 A;  2GZW A;  3FXR A;  1FSE A;  3TED A;  4ZC3 A;  4CCN A;  5J6X A;  5CKT A;  3C2B A;  2DMQ A;  1X4P A;  2HDW A;  4HV5 A;  2KRH A;  5H6Q A;  1Y6I A;  4IRI A;  1N77 A;  1GVD A;  5LLQ A;  3GTP J;  2DO7 A;  3L00 A;  1TWC J;  1I6X A;  4JOM A;  4B09 A;  1YIJ I;  1XS9 A;  2H27 A;  4PFO A;  1BC8 C;  2IS2 A;  4BQQ A;  2Y75 A;  1P4W A;  3ZMZ A;  4NNJ A;  1SMT A;  4PCQ A;  1ZK8 A;  1Q1V A;  2L7Z A;  1PDN C;  2K40 A;  2R5Z B;  1DGR M;  3WTS C;  1K6Y A;  4OMY A;  4BXX J;  2HYF A;  4ZZD A;  4X0G A;  2WY8 Q;  3K10 A;  4HF1 A;  4JQF A;  4HEA 2;  2LNB A;  2Y31 A;  1XTA A;  2KDZ A;  4AIJ A;  1D1B A;  2W4S A;  5K1Y A;  1JKR C;  4E4H A;  3PJR A;  1SAU A;  2HEO A;  3G1L A;  3Q9V A;  5K7H A;  3H9Q A;  5H6R A;  4P55 A;  2P4W A;  2EZI A;  5E3N A;  1JUP A;  3O6B B;  3PM1 A;  2E1N A;  4HF2 A;  3ECO A;  2XUB A;  4YIF A;  4ZYH A;  4ZYE A;  4F93 B;  3OYH A;  2BGC A;  3GVA A;  1MJA A;  3C7J A;  3ZMS A;  5F0C A;  2XHK A;  4XLE A;  3FXU A;  1GXQ A;  5M5Y J;  4S05 A;  2O8X A;  2M30 A;  2GXA A;  2DTR A;  2VJ5 A;  1H8A C;  3B02 A;  1I39 A;  2E35 A;  2W7N A;  3HHG A;  2Y9Z A;  5IP9 J;  1Z9C A;  5ILV A;  3HOV J;  3D1N I;  1HST A;  2M9H A;  3L09 A;  5ILU A;  2P7V B;  2MA3 A;  4ENJ A;  4Q4Z F;  2PMU A;  2PJR A;  3HOW J;  2WAE A;  3ABT A;  3OIQ A;  3LNQ A;  3GFL A;  3CJR B;  1O3Q A;  1T39 A;  2XAG A;  3IWF A;  4ZYD A;  5BNG A;  2NS7 A;  3BPV A;  1XSD A;  4V2G A;  1XCB A;  4BE0 A;  4XLA A;  4HX8 A;  2L9S A;  3DXJ F;  4R1H A;  3JW4 A;  2LTP A;  3V8K A;  3S16 J;  3IKT A;  1WJB A;  2LY2 A;  2JWT A;  4UUS A;  3KET A;  4GFB A;  3IHU A;  1OCP A;  4WWC A;  3JRH A;  1G59 A;  3IUO A;  3CC4 I;  3K4K A;  3QYB A;  1XGN A;  1MH4 A;  4O5V A;  2PG4 A;  4JX4 A;  4LK1 F;  4HZF A;  4WXD A;  3BLY A;  2TRT A;  1S7A A;  2DQR A;  1TW3 A;  2CO5 A;  2F4M B;  2G0E A;  4A2U A;  5E8I A;  1P4X A;  3HSF A;  4OU0 A;  2MSY A;  1YRN B;  4GYI A;  1D5Y A;  3Q3S A;  5FKN A;  2JA6 J;  1U2W A;  3A02 A;  4BBR J;  1G3S A;  2VXZ A;  1BI3 A;  1A36 A;  4BJT A;  3RCO A;  1BI1 A;  4DBR A;  2L4A A;  5GAG J;  3PO2 J;  3IH3 A;  1FP2 A;  2A69 F;  2NAZ A;  3B6C A;  3OSF A;  1Z21 A;  1A6I A;  2DA3 A;  2KZV A;  1U9N A;  1WJA A;  1T95 A;  3C3W A;  4I09 A;  2FEZ A;  2X9D A;  3HL2 A;  3K4B A;  3MCZ A;  4M9S A;  1ZHF A;  1Z3X A;  2K3P A;  3RPU A;  1UB9 A;  3V8L A;  2HVR A;  2MYS A;  2VJJ A;  4G8X A;  1N78 A;  1VI0 A;  1LJ9 A;  2L7F P;  3OYI A;  1MND A;  3HRS A;  3JTG A;  1IAW A;  2LK2 A;  1FTT A;  4IJA A;  2LRE A;  1GV5 A;  3ESW B;  4O6J A;  5GAD J;  5M3M J;  3OSG A;  1J75 A;  2XC7 A;  3HOY J;  1G3W A;  2J5O A;  4GXO A;  1D8K A;  3V42 A;  4ON0 A;  1RKW A;  2BV6 A;  3W6K B;  1A5J A;  4HBL A;  4BQA A;  3OY9 A;  1J5Y A;  3F22 A;  5F64 A;  1YW7 A;  1KYZ A;  3H36 A;  5FO5 A;  4XOP A;  1WCM J;  3ONQ A;  3QPL A;  3OYN A;  2BW3 A;  3COA C;  3JSO A;  4MNU A;  1P4A A;  1KQ0 A;  4M3E A;  4LG3 A;  1X2N A;  4KNY A;  4ANJ A;  2LF8 A;  4EGZ A;  4BU2 A;  4ZYA A;  1SC7 A;  1CQT A;  2JPB A;  2KKO A;  2VBX A;  3GLL A;  1B1B A;  2XDV A;  3WTW C;  3F8F A;  3S17 J;  1Y8Q B;  4LFU A;  3ZN1 A;  5B5E C;  1BM9 A;  2DJI A;  1MNE A;  2NXN B;  1DPR A;  2XPU A;  4F52 A;  3LQR A;  3NWS A;  2DPD A;  2EFQ A;  2HS5 A;  2GOM A;  4D5C A;  1FNN A;  4FE7 A;  4RB3 C;  2NNY A;  3OYC A;  3CUO A;  3K1M A;  4MGR A;  5FGM A;  2XAQ A;  2OZU A;  4PK4 A;  2E2I J;  1QHH D;  1Z7L A;  4EJU A;  5CVV A;  5JVT A;  3G4S I;  3EUK L;  5EEA A;  1FSH A;  3RZD J;  1WFX A;  1BIB A;  1X3W B;  2IGK A;  3J7Y J;  5C44 J;  4N4O B;  2DK5 A;  1MDM B;  3KIO A;  4HST A;  1J59 A;  2FMY A;  2RGV A;  1DQU A;  1RES A;  2A5Y B;  1Y56 A;  3HTU A;  2O5R A;  4EAT A;  4IZZ A;  2M5W A;  4BE1 A;  2EIN H;  4Y52 J;  4Z2Y A;  1D5V A;  4YFN F;  2EV0 A;  2VQG A;  3H5N A;  2HDD A;  2EIL H;  4N9I A;  3L7W A;  1PUE E;  2E2H J;  3E6C C;  1I3Q J;  1PYV A;  1YYV A;  4XBF A;  5DM6 F;  2PMZ N;  3SZP A;  1R6R A;  3SDG A;  3T0Y A;  2XAH A;  2EFP A;  3TP3 A;  3OMY A;  3BTL A;  1TW2 A;  1S7E A;  2CYY A;  2VBY A;  2VON A;  2E5N A;  2ZC2 A;  1I50 J;  3EUA A;  2DMT A;  1TWH J;  4ZTJ A;  3WG7 H;  4IOA F;  2O9L A;  2F6C A;  3OYE A;  5L3C A;  3MWM A;  1F36 A;  1XG1 A;  2FRH A;  2MC3 A;  4A0X A;  1WZ2 A;  1XX5 A;  2DW4 A;  4EM0 B;  2YX7 A;  4B3A A;  3W2V A;  5EGO B;  2MW8 A;  1ETQ A;  2XIG A;  2EFW A;  1H88 C;  1D1A A;  3IRQ A;  1XC5 A;  1ZAR A;  3HSR A;  3WTT C;  3BTC A;  5JR3 A;  1IXC A;  3BG9 A;  2EZH A;  1JXS A;  5J47 A;  2P5K A;  2EFO A;  1VQ8 I;  3BC8 A;  4M73 A;  4LOC A;  4IPA A;  2H1K A;  4I99 C;  2M8E A;  3M9A A;  2Q2E A;  4ZDL A;  1K4T A;  3T5X A;  4AM3 A;  1AHD P;  4HA8 A;  4AVZ A;  1E17 A;  4DIQ A;  1RET A;  4U7B A;  2Z9O A;  5CVU A;  1X1A A;  2CQ7 A;  1OCZ H;  3VB2 A;  1RIO H;  4MTD A;  2P8T A;  3JRG A;  1IRF A;  2F4O B;  1MMG A;  4C3J J;  2VBZ A;  3LSJ A;  1U5T C;  2ZXJ A;  2F5F A;  1V54 H;  2OJE D;  2L5Q A;  1XN7 A;  5HDG A;  1QBJ A;  4LIT A;  1MBH A;  1ZGJ A;  3SQN A;  5IT9 K;  1A35 A;  1GVJ A;  2A07 F;  1AKH B;  1I1G A;  1MBJ A;  1ZLK A;  2MAB A;  1EA3 A;  2IA1 A;  3BZ6 A;  4Q5S F;  3G73 A;  1SFE A;  1S72 I;  2E1C A;  3L2W A;  3CCL I;  2XKO A;  3JRF A;  1X1B A;  2Z2S B;  4XON A;  2NVX J;  2KQR A;  2V26 A;  3MKL A;  3OR1 C;  2IS6 A;  5LBQ A;  1S5L C;  3K2A A;  3OYM A;  4AIH A;  3ELK A;  1TLH B;  3AG2 H;  3OL3 A;  3IH4 A;  1BJZ A;  4FE4 A;  1LEA A;  5ICC A;  1HBX G;  5FLX K;  1UMQ A;  2D2W A;  5HS9 A;  4PJN A;  3L9F A;  4BY7 J;  1IDZ A;  3DQV C;  3EUH C;  3LA7 A;  5J1U A;  4FX0 A;  1WI3 A;  1R22 A;  2M87 A;  2O0Y A;  2VI6 A;  3F0C A;  3R6S A;  1TWG J;  2HVQ A;  3R61 A;  3E3V A;  3LFU A;  5ICG A;  2CSO A;  4PJL A;  1ZG1 A;  5KVR A;  1B8I B;  2Y2Z A;  4QLC U;  3S1Q J;  3GTO J;  1IV6 A;  1QU3 A;  2X48 A;  1BJA A;  1P6R A;  2L9R A;  4BJ6 C;  5EZG A;  1U5T A;  1IN7 A;  2ID3 A;  4XNF A;  3W6J B;  2ZSI B;  3HZJ A;  3IAM 2;  1P7I A;  2JK3 A;  1FZP B;  5DDG A;  4D1Q A;  1JHF A;  1G3T A;  4RBO A;  2PX9 A;  2UWM A;  2HOS A;  1REP C;  5IYC J;  2DPU A;  3MKW B;  3U21 A;  2P5L C;  4BUP A;  1V5G A;  3A2K A;  3FWE A;  3K4C A;  4D5F A;  2MD5 A;  2R7T A;  2R5Y B;  1MMD A;  3FKI J;  2WY7 Q;  1JT6 A;  5IY5 H;  4U87 A;  3OOP A;  2VJI A;  5E18 F;  2M4K A;  2JUG A;  1YQA A;  1TZL A;  3BG3 A;  2GQQ A;  3Q0W A;  2LP0 A;  1PP7 U;  2ESN A;  4FT8 A;  4E70 A;  4XOR A;  5HOO A;  4AWX B;  1X4O A;  2Y69 H;  1QZE A;  4BQO A;  4HLY A;  1YLF A;  2V9P A;  2R93 J;  1U9O A;  3BZK A;  3ZXS A;  4MLO A;  4A3I J;  4E7Z A;  2KRC A;  4L5I A;  4C30 A;  1BOB A;  4YFK F;  3M8E A;  1HW2 A;  4EM1 A;  2IGM A;  1EH7 A;  4UY8 I;  2WB1 N;  4OAZ A;  1B8I A;  3EUH A;  2DA2 A;  1T6S A;  2R4G A;  1TTY A;  4LK0 F;  2GIZ A;  5IYD J;  1MZB A;  4UUT A;  4G7Z F;  3QOD A;  2E19 A;  2K02 A;  3MZY A;  2PLY A;  1LQ1 A;  3H3V K;  3C18 A;  3MAJ A;  2CQK A;  2L9V A;  2L9N A;  4A6D A;  3A01 B;  2ID6 A;  2KHM A;  3G71 I;  1T38 A;  2FF4 A;  3C2H A;  1LEB A;  1O3T A;  4B48 A;  3G2B A;  3MKY B;  1GHC A;  1X3U A;  3D5R C;  4PDK A;  1H9T A;  1HC8 A;  4V2F A;  3OYB A;  1NTC A;  2VC0 A;  2X85 A;  4DGW B;  2O03 A;  1KU2 A;  1FOX A;  2LC2 A;  3OYD A;  3PSI A;  3Q0V A;  2K9L A;  3I4P A;  5GAE J;  3DTK A;  5J1R A;  5FRM A;  1D0Y A;  5IOZ A;  2KIM A;  2CW7 A;  2YX4 A;  4XOT A;  4DBQ A;  4XKW A;  4XL9 A;  2RV8 A;  4AD9 A;  1QGP A;  1F9N A;  2M1B A;  2VT2 A;  2V9K A;  4DOZ A;  4AYB N;  1FX7 A;  3I9V 2;  3PO3 J;  3GFM A;  4IHV A;  2CV1 A;  3OL4 A;  1IRZ A;  3K1N A;  1KA8 A;  1Z77 A;  1H89 C;  3H3Z A;  3ZQH A;  1WSU A;  4GGG A;  3OIP A;  2M3A A;  1IJW C;  1FOY A;  3RYP A;  1RPW A;  3ZRG A;  4E6K G;  2IGN A;  1SEU A;  1TC3 C;  4A5N A;  3GWZ A;  3CUQ C;  5F27 A;  4EGY A;  3HOS A;  3MN2 A;  2LKX A;  3HOZ J;  4EV0 A;  1W5C C;  2DA1 A;  2V1N A;  5B66 C;  2AO9 A;  4HLX A;  4XMY A;  2FBI A;  2GWR A;  5L3D A;  1IN5 A;  1XPX A;  2ISZ A;  2X51 A;  4CHU A;  1HW5 A;  1SFK A;  4M3D A;  4OIR F;  2NVQ J;  3EPZ A;  4ZTF A;  4K2E A;  3GXO A;  2EIM H;  2HFH A;  3NWT A;  3BPX A;  3M07 A;  4D9J A;  1DP3 A;  4NQW B;  1U8R A;  4CYC A;  2MH9 A;  3HRM A;  2IRF G;  2JVH A;  2OCC H;  4LG0 A;  4RAG A;  3UNG C;  1N25 A;  2VN2 A;  2COM A;  2J5P A;  2ZME C;  4S04 A;  1IN4 A;  2BVL A;  2BXZ A;  3RPQ A;  3DU5 A;  1JUS A;  1J0R A;  5GTH C;  3IWZ A;  4HDV A;  1BR4 A;  2K5C A;  1DPU A;  2WTE A;  1W7P A;  3FBI B;  2FOW A;  2JUC A;  1O7L A;  4P9U A;  3LSH A;  1X1C A;  2BZT A;  5DCM B;  3GLX A;  3KEO A;  4ABZ A;  3FMR A;  1W1W E;  4ENM A;  4DYR A;  3PQK A;  3PNV A;  3LOC A;  1R23 A;  2OQR A;  2DOA A;  1XMX A;  3ABM H;  2FQ3 A;  4ZDO A;  1JHH A;  1IG7 A;  3HXL A;  1UG2 A;  2DU9 A;  2L3D A;  3CJQ B;  3ULQ B;  3TMO A;  4ENN A;  1OYW A;  1OYY A;  2DT5 A;  1MMA A;  4KIG A;  1YJ9 I;  4A3G J;  5ICF A;  3W2A A;  3CUQ A;  4HDU A;  3MMY B;  5HDN A;  3JAM Z;  1IN6 A;  1VFC A;  4XQF A;  1FY7 A;  1V5E A;  3I5U A;  5M3F J;  1ZH5 A;  3HKZ N;  1F1Z A;  3OOU A;  4L9N A;  3DBR B;  4EEF G;  1LE8 A;  4DNC A;  2KJB A;  3QP5 A;  4A3K J;  1FTZ A;  2EV6 A;  2R7O A;  3CCR I;  3HOX J;  2PI0 A;  1PVE A;  2N8G A;  3DFG A;  1RI7 A;  3GFI A;  3MFK A;  2QSF X;  5F0F A;  2RN7 A;  2QKL B;  2DBB A;  1HKT A;  4CCJ A;  2KP6 A;  3P9K A;  3QQA A;  4RB2 C;  5LEK A;  3DTE A;  3F21 A;  2ZME A;  2MD0 A;  2QYO A;  2F5E A;  3OYF A;  4IRG A;  3ZMU A;  4C2M J;  3KP5 A;  2W48 A;  1W0T A;  2XRL A;  4Y7N J;  4ESF A;  2Y9Y A;  3RZO J;  2MLK A;  3JRA A;  3W6V A;  2O8K A;  3I59 A;  1B72 B;  2IA2 A;  1UHS A;  3KYC B;  1Z1D A;  3PIO F;  3TKY A;  2WAF A;  1UG0 A;  1ZKG A;  1OKR A;  4PGH A;  5H20 A;  3ZCO A;  5F04 A;  1EKE A;  4MHG A;  5EF6 A;  1T08 B;  2QQ9 A;  2EFN A;  2MG4 A;  4HNT A;  2DMU A;  2LF7 A;  3DV8 A;  3EQL F;  2F5V A;  1MJB A;  3HGG A;  1VQ7 I;  1O4X A;  3Q5F A;  3TBI A;  4L5E A;  5CVJ A;  4XIC A;  3SZT A;  1MMS A;  4IL6 C;  3I4N J;  2HKX A;  1IO2 A;  4D7N A;  5HNF A;  5KK1 A;  1R5I D;  1IUY A;  4II3 A;  2E1M B;  2K86 A;  4RM3 A;  1WJF A;  4Y13 A;  3SXY A;  2R7Z J;  1QA6 A;  2CGP A;  4KMU X;  1MSF C;  4OAY A;  2Y30 A;  3RJP A;  2X6Y A;  4KT6 A;  1MBF A;  3S2D J;  4QSH A;  1WQ2 A;  3K2Z A;  3ROU A;  1EH8 A;  2HWV A;  3DU6 A;  3QU3 A;  1G4D A;  3E7L A;  2ZJQ F;  2KL4 A;  3H0D A;  4G94 A;  3TO7 A;  1YE9 A;  1V4R A;  3HJE A;  2K9M A;  4RGX A;  1O7F A;  2K4B A;  2JA8 J;  2EV5 A;  3TW6 A;  3H5A A;  3WGI A;  2R7W A;  3ZQ7 A;  5K5Q A;  1AA7 A;  1YX3 A;  3E5Q A;  4FX4 A;  1VQ4 I;  1X3Z B;  2KRF A;  4EJW A;  3HPG A;  4M3B A;  2L01 A;  1X1D A;  4MFE A;  3JRE A;  5ED4 A;  3LSM A;  2IEK A;  1WKM A;  3H9G A;  2ZFW A;  1KQ8 A;  3GBG A;  3RKX A;  5HLG A;  2WA0 A;  2HZD A;  4C3I J;  3CMM A;  5B1A H;  3G1M A;  4KJZ A;  1G2H A;  4FQG A;  1PUF B;  3ASO H;  3LFK A;  1FYK A;  3S93 A;  1OCC H;  1HF0 A;  2FNA A;  2V79 A;  3LMM A;  2R5Z A;  3HOU J;  2KIS A;  1AOY A;  1QQI A;  4ZZL A;  4RA2 A;  5AIQ A;  1XSV A;  5E79 C;  1FBU A;  2Z16 A;  1WHU A;  3P9C A;  4E7H A;  4CCM A;  2X6W A;  2DK8 A;  4CDG A;  4RB1 A;  1ZLJ A;  2JRT A;  2IT0 A;  1X58 A;  5D5W B;  2R7F A;  4HSR A;  3GTL J;  3BR0 A;  1GLN A;  1QNT A;  3QYF A;  2CUJ A;  3ZOB A;  3BTJ A;  4Y33 A;  4G6D A;  2KDO A;  2UXN A;  3CP2 A;  3SEZ A;  2XPW A;  4A69 C;  2ZB9 A;  3HEF A;  4CZZ A;  4FCY A;  1OIS A;  5JHU A;  4CCO A;  4AIK A;  2LSO A;  1B9M A;  2RAE A;  2QBY B;  2XV4 S;  2K7L A;  3H92 A;  4B4C A;  3QWL A;  1LFP A;  4I01 A;  2LDU A;  3PUF A;  5A2Q Z;  3PSF A;  3I0T A;  2VOD A;  1PJR A;  2PN6 A;  2KZG A;  1JGS A;  5D4R A;  4RAY A;  3ZN0 A;  1SD7 A;  2M7B A;  2KIQ A;  1Y39 A;  1NK2 P;  2HYG D;  2XGX A;  3WTX C;  3CES A;  2R7Q A;  3P5J A;  2BY1 A;  4WXC A;  3QPT A;  5IYB J;  3FXM A;  1I3A A;  4M3G A;  2VB6 A;  2NS0 A;  5GPA A;  3GF2 A;  3J81 K;  4I02 A;  3CLQ A;  1SD5 A;  1WJ5 A;  2QF7 A;  1ZGW A;  1IV8 A;  3BJO A;  2Y0S N;  5J1Y A;  4BEH B;  5DM7 F;  1U78 A;  1ETY A;  1XGO A;  1UCR A;  1TQP A;  1P7J A;  3OV8 A;  4G12 A;  5K7F A;  5E17 F;  2F48 A;  1FBS A;  2QM3 A;  2OBP A;  3DLL F;  3L2R A;  3A03 A;  1DU0 A;  3EYI A;  3CCM I;  2DMN A;  3K4M A;  5C4X J;  3JRI A;  2HOA A;  3S3O A;  1R71 A;  4F3Q A;  3LSI A;  3OWT A;  1T98 A;  2Q1Z B;  4KIF A;  5JI6 A;  2OTJ I;  3ABK H;  1J7K A;  2K3F A;  2EQR A;  5FLM J;  2UV1 A;  3FIS A;  5FRN A;  1R5G A;  4IHX A;  1FPQ A;  2W25 A;  3ZMV A;  1K61 A;  1DP7 P;  1R7J A;  3VPR A;  4OMZ A;  1R1U A;  3ML6 A;  3WU2 C;  4IQ4 A;  5D4S A;  2WV1 A;  5LEJ A;  2AQE A;  1KU9 A;  3KE2 A;  2HR3 A;  1S6L A;  3D0S A;  2GXB A;  5E20 A;  1Y1V J;  3IKV A;  2A3S A;  2COB A;  4UVB A;  1YRN A;  1J09 A;  3FBN B;  1BR1 A;  4Y3O A;  4IHS A;  1ACI A;  4IHW A;  1K83 J;  2W57 A;  1W5S A;  2KIF A;  3MZ8 A;  3WU0 A;  2DDB A;  2M34 A;  3KP3 A;  3RTR A;  1W7P D;  3BJA A;  1ENH A;  4Q48 A;  3RDI A;  3CMA I;  2FUG 2;  3F6O A;  2ELK A;  3I56 I;  2VKV A;  2MBF A;  1Y1W J;  3CO6 C;  4HYE A;  1WI9 A;  1KGS A;  2BYV E;  4UVC A;  5EG0 B;  5HVQ C;  1ITY A;  4BEH A;  1JJ6 C;  4KIS A;  1OCT C;  4L9T A;  1JI8 A;  2O61 A;  4GDF A;  2JTV A;  1XGS A;  2X0L A;  2W24 A;  1BN5 A;  1BR2 A;  3JAM K;  2DA5 A;  3BR2 A;  3L2U A;  5TIS C;  3FK6 A;  1Z6R A;  3FIW A;  5BPI A;  2DA4 A;  5FD5 A;  4YIR X;  5J4Y A;  3SDB A;  4M6Y A;  3U2R A;  2ZJR F;  4BBS J;  4CGZ A;  5GP9 A;  1FYM A;  3F6V A;  1YX5 A;  4NC6 A;  4A93 J;  1Y8R B;  1IN8 A;  3PIP F;  4XSX F;  2HZT A;  1APL C;  3BG7 A;  1ZG3 A;  2LY9 A;  1K79 A;  2QVO A;  1OPC A;  2E1O A;  3K9T A;  4ASN A;  4HQE A;  2OZ6 A;  2NRA C;  4XSZ F;  3CJT B;  3HDD A;  2R7U A;  4M74 A;  1LFU P;  3CCQ I;  4IHY A;  3S1N J;  4AID A;  5BQT A;  2WAQ N;  3HB9 A;  2QSG X;  2ZFU A;  3ZQC A;  2XAU A;  1MH3 A;  2DTZ A;  5F1R A;  4BAC A;  4A3F J;  3GCM A;  3KZI C;  4R79 A;  5DTD A;  3J80 Z;  2UUZ A;  3T8T A;  4E7I A;  1SD4 A;  1W4M A;  3K4N A;  3TL4 X;  1EH6 A;  2XF7 A;  4N4N B;  1MKM A;  4WXH A;  3F23 A;  5J8C A;  2GA1 A;  3QYE A;  1SFO J;  1UAA A;  2DQL A;  1XB4 A;  3S3M A;  1MDM A;  3CMY A;  1BL0 A;  4HAM A;  2M2E A;  3I71 A;  1IGN A;  1KQ9 A;  1ZYR F;  4XKC A;  1VZ0 A;  2E7X A;  2FE3 A;  2ELJ A;  2JJ7 A;  2MH2 A;  1SFU A;  4Y4R A;  3V4G A;  4NHJ A;  4P1W A;  2D1V A;  3BDD A;  3WGH A;  4N9H A;  1T56 A;  4F55 A;  3H3U A;  3NAR A;  3U1K A;  4LLN A;  2Z1D A;  1FC3 A;  1RC9 A;  2EJR A;  2VKD A;  2YU3 A;  4NBQ A;  4BXF A;  4NC7 A;  4UHT A;  3HUG B;  4DZJ A;  1R58 A;  1OQY A;  1OCR H;  4RGR A;  1PP8 F;  2HOT A;  2HQA A;  3O8H A;  4ENK A;  1YO5 C;  2JA5 J;  5FB2 A;  4X6A J;  3KP6 A;  3Q9S A;  3IC7 A;  1SVO A;  5BS6 A;  4A5M A;  1VQM I;  5EYR A;  5FJ8 J;  3FZV A;  5IT3 A;  2WBM A;  4RAZ A;  2NOJ B;  5ILS A;  1FYL A;  1K7A A;  1RR8 C;  3F8N A;  2PMH A;  5DD4 A;  3G1O A;  3HIF A;  2R7R A;  2V6E A;  1VND A;  1UHW A;  5LRR A;  5EGO A;  1OMI A;  4QPQ A;  1QZZ A;  5D8K B;  1I5Z A;  2LKS A;  2GIV A;  1RKT A;  2XKP A;  2W1O A;  3HM5 A;  5TGT A;  3EYY A;  2LY1 A;  4BHB A;  5GAH J;  4OIN F;  3BP8 A;  3DEE A;  3UKG A;  3RKQ A;  2VOO A;  1J9I A;  3LA2 A;  1UEL B;  5LRS A;  3MVP A;  4EVI A;  4BQN A;  1VQ5 I;  4CSW A;  2V1D A;  2ME0 A;  3FXJ A;  3MD2 A;  3AL0 B;  3RKY A;  1YFH A;  2CH0 A;  4EJV A;  2V1X A;  1WGX A;  3ZR8 X;  5D5X B;  2DAO A;  3UR3 C;  4GYG A;  2AXL A;  4I7H A;  3V7C A;  4A12 A;  2RQP A;  4IRH A;  3HUG A;  4ESJ A;  3QRF F;  3T8R A;  4HV6 A;  2P5V A;  3CLO A;  4RDU A;  2I5U A;  1RUN A;  2BY2 A;  2BHY A;  4BDZ A;  1TNS A;  2Z5U A;  4CZC A;  3FXO A;  4CIC A;  2R7S A;  2DXI A;  1V55 H;  4XLF A;  3M3Y J;  2LKP A;  4GCV A;  3CCU I;  1AKH A;  3MZH A;  1WJC A;  5A2Q K;  3E5U A;  1NHA A;  2A6T A;  2G7U A;  2V4J C;  3V7S A;  3B6A A;  2HPM A;  3M1C A;  1D0Z A;  3F8C A;  3F3X A;  1XGM A;  2ZO4 A;  4BJ5 C;  1HDP A;  3OYA A;  4DZP A;  1KU3 A;  3VSK A;  3REO A;  4EJT A;  2E2J J;  1QRY A;  1TNT A;  2CJJ A;  2QQB A;  4ETS A;  4F92 B;  4LLL A;  4OIQ F;  2K9S A;  1P92 A;  2ACJ A;  2LG4 A;  4XKB A;  2JPC A;  5EEH A;  5HLH A;  2RKH A;  5M5W J;  4JK1 X;  1F43 A;  1POG A;  5D8L B;  5DV5 A;  4BXU A;  2DFI A;  3DBL B;  3M8F A;  2BXY A;  3S14 J;  4L9J A;  4S0H B;  3ZQG A;  3M8J A;  5EZH A;  1ETX A;  2BE5 F;  2DI3 A;  2QLZ A;  1ZN2 A;  4KMF A;  3TP0 A;  4LLG F;  3O3K A;  4ZDP A;  2DJN A;  1FOW A;  1XDU A;  2QWW A;  4XRS G;  3VOE A;  1BC7 C;  3CDH A;  3I53 A;  2IW5 A;  3V7R A;  3DBH B;  3CDI A;  3BR6 A;  4LB5 A;  4E7S A;  3BR1 A;  4WF2 A;  3K4J A;  2KT0 A;  4NB5 A;  1EF4 A;  4UNO A;  4J00 A;  3WTZ A;  4BHC A;  3W3C A;  3LQQ A;  5DEQ A;  5J4V A;  3L1P A;  2X1E A;  4IXA A;  2NOG A;  3J7A O;  2DA7 A;  4R8H A;  4RGU A;  5K5O A;  4ESB A;  5EEG A;  2EA2 A;  4X1E A;  2DFE A;  1B6A A;  5HLI A;  2R5Y A;  2JQ7 A;  2MGQ A;  2CRG A;  1HDD C;  5BOX A;  4M9Z A;  3WHC A;  1WRJ A;  1QVU A;  2P6S A;  1X19 A;  2JZY A;  1R9T J;  2AHQ A;  3I4M J;  4U0W A;  4BDY A;  4W1U A;  2CMP A;  4F91 B;  4RLF A;  4XR6 A;  1ONV A;  1SVM A;  2LVS A;  2I10 A;  2R7D A;  2ZXH A;  4CCK A;  3CF2 A;  2DYS H;  4JX6 A;  5CJ9 A;  4BNC A;  3LSG A;  3J7A Y;  1Z91 A;  4HX7 A;  4LJZ F;  1USS A;  2L2O A;  3ZQI A;  4HRI A;  3JTH A;  3RI4 A;  1QVT A;  2FBK A;  1MD0 A;  4M3F A;  4KYW A;  3HYI A;  2A5W A;  5LHI A;  2X1D A;  1QPM A;  2OCE A;  2JVG A;  1XCV A;  4A6E A;  4BS9 A;  2FXA A;  1YJN I;  3S2W A;  4WCG A;  2Y0M A;  2R3S A;  2EIK H;  3QOE A;  3OIO A;  2OD5 A;  3GZN B;  3A01 A;  2QKM B;  3RSN A;  3E6M A;  1X1P A;  5DUI A;  3CCS I;  3QPH A;  1FLI A;  4E7J A;  4B8X A;  3OS1 A;  3QPS A;  4UB8 C;  4MEX F;  1BW5 A;  1ZQ3 P;  2CUZ A;  2ZNZ A;  5HS8 A;  1U6G A;  1KZH A;  4I2O A;  4IF4 A;  2VE9 A;  4LD5 A;  4Q47 A;  1A6Q A;  2QGU A;  2PMZ A;  2HXI A;  3K7A J;  3I64 A;  2M45 A;  3WE3 A;  2NVT J;  2W85 A;  2FU4 A;  2OF7 A;  3PNT A;  2IS4 A;  3I3L A;  5H2F C;  4OIO F;  2KPM A;  2CQX A;  5FKM A;  1VQN I;  4A3B J;  3HBL A;  5LGU A;  1DDN A;  3VSL A;  2DYR H;  2YS9 A;  3E1S A;  4XRF A;  4MTE A;  2RC4 A;  1VQK I;  2EA4 A;  4A3L J;  3FXK A;  1UST A;  3AKZ A;  3K70 D;  4KA4 A;  3FMS A;  5L3G A;  3GFJ A;  2QQA A;  3CZ6 A;  4WX9 A;  4I0B A;  5B1B H;  4NUB A;  5LFA A;  2H8R A;  1S29 A;  2ZJ2 A;  3D5L A;  3NAU A;  2JSC A;  1S8N A;  3TW7 A;  4A0Z A;  2G9W A;  3FHN A;  3WHB A;  2VLA A;  3A1Y A;  3BQZ A;  2LRD A;  3OR2 C;  1SFX A;  2NYX A;  2Y48 A;  1YS7 A;  2Z33 A;  1LNW A;  3OYJ A;  3CTA A;  1VQ6 I;  5KHD A;  5CVI A;  1RR7 A;  3FF5 A;  1ON2 A;  1T0F C;  2BY3 A;  2CW0 F;  4E7L A;  2XB5 A; 
#chains in the Genus database with same CATH homology
 1W5T A;  1TBX A;  5L3B A;  2HTS A;  1L3L A;  4NQW A;  4QWQ A;  2K4J A;  5ICE A;  1ZRD A;  3T1B A;  2ZKZ A;  3RYR A;  2A61 A;  1BOA A;  3VEP A;  3LAJ A;  5AON A;  3F8B A;  4KFC A;  2KJC A;  1T2K A;  5L3E A;  2QUF A;  5CYV A;  3FM5 A;  5DCM A;  4P9F A;  2P6T A;  4CO8 A;  5LHH A;  4JBA A;  2IPQ X;  4O3M A;  5E8G A;  5L3F A;  4LB6 B;  3ZMD A;  3N97 A;  2FOK A;  4YG2 F;  4KIB A;  4DQ2 A;  4BYY A;  3CJN A;  2H94 A;  1T0F A;  1F4K A;  3VFZ A;  2FA5 A;  3AAF A;  1HQC A;  1FWZ A;  1GXP A;  2DLL A;  1FBQ A;  3FX3 A;  2C6Y A;  2IA0 A;  1RZ4 A;  3C1D A;  2YSR A;  2XVC A;  3ISP A;  5TJJ A;  1CF7 B;  2V9V A;  4RGS A;  1IZ1 A;  1ODD A;  2HOE A;  2PBI A;  2MLG A;  4EMS A;  3TO6 A;  4EJO A;  4EM2 A;  3HRT A;  1L0O C;  1Q1H A;  1Z05 A;  1TQI A;  5IT9 Z;  4XLN F;  2IP2 A;  3QOP A;  1JE8 A;  4I98 B;  5J8F A;  2RDP A;  4OOI A;  3MEX A;  2VBW A;  3I54 A;  2RVC A;  2AS5 F;  2CFX A;  5D5V B;  3P7N A;  4LMY A;  3R4K A;  1FOK A;  2GA2 A;  1ON1 A;  3F72 A;  2L02 A;  5DCF A;  1RNL A;  1O3S A;  4G6Q A;  3TGN A;  1A04 A;  5FLX Z;  4M9X A;  1ULY A;  2VC1 A;  5TRD A;  1G6N A;  2GXG A;  1CF7 A;  1R00 A;  3KZY A;  2PJP A;  3EDP A;  2VT3 A;  1QO0 D;  3WTV C;  2A68 F;  2H6C A;  5DUK A;  2XRO A;  2UZK A;  2PEX A;  4N0B A;  3HRU A;  4BH9 A;  3KP7 A;  3DEU A;  4FHT A;  1O57 A;  2UXX A;  3G3Z A;  1FP1 D;  2H09 A;  3TOA A;  3TDZ C;  2L54 A;  5K5R A;  2H6B A;  3I58 A;  4G7H F;  3DKW A;  1V3F A;  3PFI A;  2X4H A;  1MJ9 A;  3R60 A;  4U0Y A;  4HQM A;  5CVR A;  1E2X A;  1I27 A;  3K0L A;  1QZY A;  1DUX C;  2B0L A;  4MQ9 F;  3TQN A;  2KIU A;  1J2X A;  5E1X A;  2QBY A;  1ZRE A;  3SFZ A;  1FT9 A;  3BJ6 A;  3ECH A;  3WE2 A;  3QAH A;  3V8J A;  3GW2 A;  3VOD A;  1I1S A;  4BHP A;  4L9V A;  1LDK B;  1YW9 A;  1VTN C;  3SHF A;  4EQQ A;  3HTS B;  3DF8 A;  5FFZ A;  4HF0 A;  4TV7 A;  2P7C B;  4HW0 A;  4UUV A;  3FMQ A;  3ABU A;  5BPD A;  2YR2 A;  4KN7 X;  1H9G A;  1IXR C;  3DP7 A;  4F7Z A;  1C0W A;  2ELH A;  3U9G A;  2PQ8 A;  1R36 A;  2BEO A;  3P9I A;  3K69 A;  2XAF A;  2CWE A;  1XMK A;  1SMY F;  3GYH X;  3ZPL A;  4U7D A;  2O6G E;  3FHZ A;  3N4M A;  4Y15 A;  2V1U A;  1UFM A;  1G3Y A;  5DYM A;  3MQ0 A;  3KEQ A;  1ZRF A;  3TO9 A;  4UV8 A;  2QZ8 A;  3U1D A;  4HX4 A;  4M6X A;  4IVN A;  2Z99 A;  3B73 A;  4PZJ A;  4U0V A;  3E6D A;  3TOB A;  2A6H F;  2HTJ A;  1K6O A;  4KUM A;  2Z3Y A;  1IW7 F;  3ZP5 A;  1XDS A;  3KLN A;  3LAP A;  1KU7 A;  2BBY A;  3HSE A;  3DPL C;  2FNP A;  1IF1 A;  5BMZ A;  4AVP A;  1UHM A;  1IRG A;  3R0J A;  3WGG A;  2STW A;  5DD8 A;  1R5H A;  3BWG A;  2G7H A;  1BI2 A;  1H0M A;  2CG4 A;  3WU1 B;  5HDK A;  4P96 A;  1HXD A;  2TDX A;  1S3J A;  3QP6 A;  4WK8 F;  4L0Y B;  4CYD A;  1B4A A;  3LWF A;  3EET A;  3GZ6 A;  3FXQ A;  1YW8 A;  4LGW A;  1YTY A;  2NNN A;  1U5T B;  2YPR A;  2FML A;  1O3R A;  1Z7U A;  1OR7 A;  2D45 A;  3LST A;  1IXS B;  4H0E A;  2IVM A;  4IHT A;  4UVA A;  4G9Y A;  3RKW A;  2XAJ A;  5ERI A;  3WTU C;  3NRV A;  4YFX F;  5LGN A;  4YII A;  3DPT A;  2ZBK A;  2HDC A;  3HHH A;  1K78 B;  2OA4 A;  1LVA A;  1RUO A;  4L18 B;  2IJL A;  1SAX A;  2Q8K A;  3R0A A;  5D6E A;  2O3F A;  4UV9 A;  4PGG A;  4OIP F;  4UXN A;  1B9N A;  1XMA A;  4I0A A;  4L0Z B;  1HKS A;  2ZNY A;  5F6F A;  4ZH4 F;  4KIC A;  2WC2 A;  4BAY A;  1WWX A;  1R1V A;  1D8J A;  4Y17 A;  1BIA A;  4D0P A;  4CXF A;  4G7O F;  2FBH A;  5CLS A;  1MGT A;  3GEZ A;  3FM3 A;  1HSJ A;  2F2E A;  2HGC A;  4M72 A;  2ESH A;  3HOT A;  4M71 A;  3QU6 A;  2K27 A;  2WWY A;  1Z6T A;  1K78 A;  3GUD A;  3GO5 A;  2OU2 A;  1S7O A;  2EK5 A;  5LHG A;  2XAS A;  1R1T A;  4MEY F;  1XD7 A;  2ADU A;  2RNJ A;  6PAX A;  1U3E M;  1SD6 A;  1YIO A;  4KT5 C;  1EV7 A;  2ISY A;  1D3Y A;  1LDJ A;  2FSW A;  2ZCW A;  3LA3 A;  1TQM A;  1HKQ A;  4KN4 X;  2HQR A;  3M1E A;  1ZAO A;  5E1Z B;  4RB0 A;  4LG0 B;  2OQG A;  5LGT A;  4HOB A;  3WG9 A;  2Q0O A;  5AIP A;  4MQV A;  1W7P B;  5JFR A;  1XSX A;  2GAU A;  3KP2 A;  2OAZ A;  5FFX A;  1BBY A;  3M7G A;  3J81 Z;  1KYW A;  1B59 A;  3E97 A;  4A0Y A;  3RIR A;  1HW1 A;  2QEN A;  3CUQ B;  3K1P A;  1CGP A;  1OYI A;  2D1H A;  3J80 K;  3CO7 C;  3WTY C;  4XLP F;  3BRO A;  1BI0 A;  2PFB A;  2VOP A;  3TDU C;  2EB7 A;  5D5U B;  3E5X A;  3E6B A;  1STZ A;  2HQN A;  2VE8 A;  2ZME B;  2EWN A;  4L5J A;  3F8M A;  2XRN A;  2ETH A;  3BY6 A;  3BOQ A;  3KFW X;  2W84 A;  5D6F A;  3L2C A;  3KZZ A;  1F5T A;  4KDP A;  2E7W A;  3I59 B;  1AWC A;  3ZMT A;  1ZGA A;  4U88 A;  5FD6 A;  2HKO A;  3ERE D;  1ZRC A;  2F5C A;  5HS7 A;  2WV0 A;  5E1W A;  4GO1 A;  3O2P E;  2V6C A;  1YG2 A;  2L4M A;  3IL2 A;  2A6E F;  3JSP A;  1Y0U A;  3KCC A;  3GX4 X;  1ZG5 A;  3KLO A;  1YS6 A;  3IRR A;  4RS8 A;  3WOD F;  3NEU A;  3NQO A;  3PQJ A;  3KP4 A;  4ZYG A;  4P5O A;  2F5D A;  3GZ5 A;  1LDD A;  1P2F A;  1LB2 A;  2JT1 A;  2GZW A;  3FXR A;  1FSE A;  5J6X A;  4HV5 A;  5H6Q A;  4IRI A;  5LLQ A;  2DO7 A;  4B09 A;  3L00 A;  1I6X A;  2H27 A;  1BC8 C;  2Y75 A;  1P4W A;  3ZMZ A;  1SMT A;  4PCQ A;  1PDN C;  3WTS C;  4OMY A;  2HYF A;  4ZZD A;  4HF1 A;  4JQF A;  2LNB A;  4AIJ A;  5K1Y A;  2HEO A;  3Q9V A;  5H6R A;  4P55 A;  2P4W A;  3O6B B;  2E1N A;  4HF2 A;  3ECO A;  2XUB A;  4YIF A;  4ZYH A;  4ZYE A;  2BGC A;  3GVA A;  1MJA A;  3C7J A;  3ZMS A;  2XHK A;  3FXU A;  1GXQ A;  4S05 A;  2O8X A;  2M30 A;  2DTR A;  3B02 A;  3HHG A;  1Z9C A;  5ILV A;  1HST A;  3L09 A;  5ILU A;  2P7V B;  2MA3 A;  4ENJ A;  4Q4Z F;  2PMU A;  3ABT A;  3GFL A;  1O3Q A;  1T39 A;  2XAG A;  3IWF A;  4ZYD A;  3BPV A;  1XSD A;  1XCB A;  4HX8 A;  4R1H A;  3DXJ F;  3JW4 A;  3V8K A;  3IKT A;  3KET A;  3IHU A;  4WWC A;  1XGN A;  4O5V A;  2PG4 A;  4LK1 F;  4HZF A;  4WXD A;  1S7A A;  2DQR A;  1TW3 A;  2CO5 A;  4A2U A;  5E8I A;  1P4X A;  3HSF A;  4OU0 A;  4GYI A;  1U2W A;  1G3S A;  2VXZ A;  1BI3 A;  1BI1 A;  2L4A A;  1FP2 A;  2A69 F;  2NAZ A;  2STT A;  4I09 A;  3C3W A;  2FEZ A;  3MCZ A;  4M9S A;  1ZHF A;  3RPU A;  1UB9 A;  3V8L A;  4G8X A;  1LJ9 A;  3HRS A;  3JTG A;  1IAW A;  4IJA A;  4O6J A;  1J75 A;  1G3W A;  2J5O A;  4GXO A;  1D8K A;  4ON0 A;  2BV6 A;  3W6K B;  4HBL A;  4BQA A;  1J5Y A;  3F22 A;  5F64 A;  1YW7 A;  1KYZ A;  5FO5 A;  3COA C;  3JSO A;  4MNU A;  1P4A A;  1KQ0 A;  4KNY A;  2LF8 A;  4EGZ A;  2JPB A;  2KKO A;  2VBX A;  1B1B A;  3WTW C;  3F8F A;  4LFU A;  3ZN1 A;  1BM9 A;  1DPR A;  3LQR A;  2DPD A;  2EFQ A;  2HS5 A;  1FNN A;  4RB3 C;  2NNY A;  3CUO A;  3K1M A;  4MGR A;  5FGM A;  2XAQ A;  2OZU A;  4EJU A;  5CVV A;  5JVT A;  1FSH A;  1BIB A;  2DK5 A;  1MDM B;  1J59 A;  2FMY A;  2RGV A;  2A5Y B;  3HTU A;  2M5W A;  4Z2Y A;  1D5V A;  4YFN F;  2EV0 A;  4N9I A;  3L7W A;  1PUE E;  3E6C C;  4XBF A;  1YYV A;  3SZP A;  3T0Y A;  2XAH A;  2EFP A;  1TW2 A;  2CYY A;  2VBY A;  2VON A;  5L3C A;  3MWM A;  2FRH A;  2MC3 A;  4A0X A;  2DW4 A;  4EM0 B;  2YX7 A;  2XIG A;  2EFW A;  3IRQ A;  1ZAR A;  3HSR A;  3WTT C;  5JR3 A;  1IXC A;  1JXS A;  2P5K A;  2EFO A;  4M73 A;  4IPA A;  2M8E A;  3M9A A;  2Q2E A;  3T5X A;  4HA8 A;  1E17 A;  4U7B A;  2Z9O A;  5CVU A;  3VB2 A;  1RIO H;  4MTD A;  2P8T A;  1IRF A;  2VBZ A;  1U5T C;  2ZXJ A;  2F5F A;  1XN7 A;  5HDG A;  1QBJ A;  1ZGJ A;  3SQN A;  5IT9 K;  1GVJ A;  2A07 F;  1I1G A;  1ZLK A;  2IA1 A;  3BZ6 A;  4Q5S F;  3G73 A;  1SFE A;  2E1C A;  2XKO A;  5LBQ A;  4AIH A;  3ELK A;  1TLH B;  1LEA A;  5ICC A;  1HBX G;  5FLX K;  2D2W A;  5HS9 A;  3L9F A;  3DQV C;  3LA7 A;  4FX0 A;  1R22 A;  2M87 A;  2O0Y A;  3R6S A;  3R61 A;  3E3V A;  5ICG A;  1ZG1 A;  2CSO A;  5KVR A;  4QLC U;  1BJA A;  1P6R A;  1U5T A;  1IN7 A;  3W6J B;  1FZP B;  5DDG A;  1JHF A;  1G3T A;  2UWM A;  1REP C;  2DPU A;  2P5L C;  3FWE A;  2MD5 A;  3OOP A;  5E18 F;  1YQA A;  2GQQ A;  1PP7 U;  2ESN A;  4FT8 A;  4E70 A;  5HOO A;  4AWX B;  4HLY A;  1YLF A;  4L5I A;  4YFK F;  3M8E A;  1HW2 A;  4EM1 A;  1EH7 A;  3EUH A;  1T6S A;  4LK0 F;  1TTY A;  1MZB A;  4G7Z F;  2K02 A;  3MZY A;  2PLY A;  1LQ1 A;  3C18 A;  3MAJ A;  2CQK A;  4A6D A;  1T38 A;  2FF4 A;  1LEB A;  1O3T A;  1GHC A;  1X3U A;  4PDK A;  1H9T A;  2VC0 A;  2O03 A;  1KU2 A;  3I4P A;  2KIM A;  2YX4 A;  2RV8 A;  4AD9 A;  1QGP A;  1F9N A;  2M1B A;  2VT2 A;  1FX7 A;  3GFM A;  3K1N A;  1KA8 A;  3H3Z A;  1WSU A;  4GGG A;  3RYP A;  4A5N A;  3GWZ A;  3CUQ C;  4EGY A;  3HOS A;  4EV0 A;  4HLX A;  2FBI A;  2GWR A;  5L3D A;  1IN5 A;  2ISZ A;  4CHU A;  1HW5 A;  4OIR F;  4K2E A;  3GXO A;  2HFH A;  3BPX A;  1U8R A;  2MH9 A;  3HRM A;  2IRF G;  4LG0 A;  2VN2 A;  2COM A;  2J5P A;  4S04 A;  1IN4 A;  3RPQ A;  1J0R A;  3IWZ A;  4HDV A;  1DPU A;  2WTE A;  1W7P A;  1O7L A;  4P9U A;  5DCM B;  3GLX A;  3KEO A;  3FMR A;  4ENM A;  3PQK A;  1R23 A;  2OQR A;  2FQ3 A;  1JHH A;  2DU9 A;  2L3D A;  3ULQ B;  4ENN A;  1OYW A;  1OYY A;  2DT5 A;  4KIG A;  5ICF A;  3CUQ A;  4HDU A;  5HDN A;  3JAM Z;  1IN6 A;  1FY7 A;  3I5U A;  1ZH5 A;  1F1Z A;  4L9N A;  4DNC A;  2KJB A;  3QP5 A;  2EV6 A;  2PI0 A;  3DFG A;  1RI7 A;  3GFI A;  3MFK A;  2RN7 A;  2DBB A;  1HKT A;  3P9K A;  4RB2 C;  5LEK A;  3F21 A;  2ZME A;  2QYO A;  2F5E A;  4IRG A;  3ZMU A;  3KP5 A;  4ESF A;  2MLK A;  3I59 A;  2IA2 A;  1Z1D A;  3TKY A;  1OKR A;  4PGH A;  5H20 A;  4MHG A;  2QQ9 A;  2EFN A;  2LF7 A;  3DV8 A;  3EQL F;  1MJB A;  3Q5F A;  5CVJ A;  3SZT A;  2HKX A;  5KK1 A;  1IUY A;  2K86 A;  4Y13 A;  3SXY A;  2CGP A;  4KMU X;  3RJP A;  1WQ2 A;  3K2Z A;  3ROU A;  1EH8 A;  2HWV A;  3QU3 A;  1G4D A;  4G94 A;  3TO7 A;  1V4R A;  4RGX A;  1O7F A;  2K4B A;  2EV5 A;  3WGI A;  3ZQ7 A;  5K5Q A;  4FX4 A;  3E5Q A;  2KRF A;  4EJW A;  2L01 A;  5ED4 A;  1WKM A;  2ZFW A;  1KQ8 A;  3RKX A;  5HLG A;  3LFK A;  1FYK A;  2FNA A;  2V79 A;  1AOY A;  1QQI A;  4ZZL A;  5AIQ A;  1XSV A;  1FBU A;  3P9C A;  2DK8 A;  4CDG A;  4RB1 A;  1ZLJ A;  2JRT A;  2IT0 A;  5D5W B;  2R7F A;  1QNT A;  4G6D A;  2UXN A;  4CZZ A;  5JHU A;  4AIK A;  2LSO A;  1B9M A;  2QBY B;  2XV4 S;  2K7L A;  3H92 A;  4I01 A;  2LDU A;  5A2Q Z;  3I0T A;  2VOD A;  2PN6 A;  1JGS A;  5D4R A;  4RAY A;  3ZN0 A;  1SD7 A;  2HYG D;  2XGX A;  3WTX C;  4WXC A;  3QPT A;  2NS0 A;  3J81 K;  3GF2 A;  4I02 A;  1SD5 A;  3BJO A;  1U78 A;  1XGO A;  1UCR A;  1TQP A;  3OV8 A;  5E17 F;  1FBS A;  2QM3 A;  2OBP A;  3EYI A;  1T98 A;  4KIF A;  5JI6 A;  1J7K A;  1R5G A;  1FPQ A;  2W25 A;  3ZMV A;  1DP7 P;  1R7J A;  4OMZ A;  1R1U A;  3ML6 A;  5D4S A;  5LEJ A;  1KU9 A;  3KE2 A;  2HR3 A;  1S6L A;  3D0S A;  2GXB A;  5E20 A;  3IKV A;  2A3S A;  4UVB A;  4IHS A;  2W57 A;  1W5S A;  2KIF A;  3WU0 A;  3KP3 A;  3RTR A;  1W7P D;  3BJA A;  4Q48 A;  3RDI A;  3F6O A;  2MBF A;  3CO6 C;  4HYE A;  1WI9 A;  1KGS A;  2BYV E;  4UVC A;  5HVQ C;  4L9T A;  2O61 A;  2JTV A;  1XGS A;  2X0L A;  2W24 A;  1BN5 A;  3JAM K;  1Z6R A;  5BPI A;  5FD5 A;  3U2R A;  4M6Y A;  4CGZ A;  1FYM A;  3F6V A;  1IN8 A;  4XSX F;  2HZT A;  1ZG3 A;  1K79 A;  2QVO A;  1OPC A;  4ASN A;  3K9T A;  4HQE A;  2OZ6 A;  2NRA C;  4XSZ F;  4M74 A;  5BQT A;  5F1R A;  4R79 A;  3J80 Z;  3T8T A;  1SD4 A;  1W4M A;  1EH6 A;  3F23 A;  1MKM A;  4WXH A;  5J8C A;  2GA1 A;  2DQL A;  1XB4 A;  1MDM A;  4HAM A;  3I71 A;  1KQ9 A;  1ZYR F;  2E7X A;  2FE3 A;  2MH2 A;  1SFU A;  3V4G A;  4NHJ A;  2D1V A;  3BDD A;  3WGH A;  4N9H A;  3H3U A;  4LLN A;  1FC3 A;  2EJR A;  2YU3 A;  4UHT A;  1R58 A;  4RGR A;  1PP8 F;  4ENK A;  1YO5 C;  5FB2 A;  3KP6 A;  3Q9S A;  3IC7 A;  5BS6 A;  4A5M A;  3FZV A;  5IT3 A;  4RAZ A;  5ILS A;  1FYL A;  1K7A A;  3F8N A;  2PMH A;  5DD4 A;  3HIF A;  1UHW A;  5LRR A;  1OMI A;  1QZZ A;  5D8K B;  1I5Z A;  2GIV A;  2XKP A;  3EYY A;  4BHB A;  4OIN F;  3BP8 A;  1J9I A;  2VOO A;  3LA2 A;  5LRS A;  4EVI A;  2V1D A;  3RKY A;  1YFH A;  4EJV A;  2V1X A;  5D5X B;  2DAO A;  4GYG A;  2AXL A;  4I7H A;  3V7C A;  4A12 A;  2RQP A;  4IRH A;  3HUG A;  4ESJ A;  3QRF F;  3T8R A;  4HV6 A;  2P5V A;  3CLO A;  1RUN A;  1TNS A;  2Z5U A;  4CIC A;  2LKP A;  4GCV A;  3MZH A;  5A2Q K;  3E5U A;  1NHA A;  2G7U A;  3V7S A;  3F8C A;  3F3X A;  1XGM A;  2ZO4 A;  1KU3 A;  3REO A;  4EJT A;  1TNT A;  2QQB A;  4ETS A;  4OIQ F;  4LLL A;  1P92 A;  2ACJ A;  2JPC A;  5EEH A;  5HLH A;  2RKH A;  4JK1 X;  5D8L B;  5DV5 A;  4BXU A;  2DFI A;  3M8F A;  4L9J A;  2BE5 F;  2DI3 A;  2QLZ A;  1ZN2 A;  4KMF A;  4LLG F;  3O3K A;  1XDU A;  2QWW A;  3VOE A;  1BC7 C;  3CDH A;  3I53 A;  2IW5 A;  3V7R A;  4LB5 A;  4WF2 A;  4NB5 A;  4UNO A;  3WTZ A;  4BHC A;  3LQQ A;  5DEQ A;  4IXA A;  3J7A O;  4R8H A;  4RGU A;  5K5O A;  4ESB A;  5EEG A;  2EA2 A;  1B6A A;  5HLI A;  5BOX A;  4M9Z A;  1WRJ A;  2P6S A;  2JZY A;  4U0W A;  1ONV A;  2R7D A;  5CJ9 A;  4BNC A;  1Z91 A;  4HX7 A;  4LJZ F;  1USS A;  3JTH A;  3RI4 A;  2FBK A;  1MD0 A;  4KYW A;  3HYI A;  5LHI A;  1QPM A;  1XCV A;  4A6E A;  2FXA A;  3S2W A;  4WCG A;  2Y0M A;  2R3S A;  2OD5 A;  3E6M A;  5DUI A;  1FLI A;  3QPH A;  4B8X A;  4MEX F;  2ZNZ A;  5HS8 A;  1U6G A;  4I2O A;  4IF4 A;  2VE9 A;  4LD5 A;  4Q47 A;  3I64 A;  2M45 A;  3WE3 A;  2W85 A;  2FU4 A;  4OIO F;  1DDN A;  5LGU A;  4XRF A;  4MTE A;  2RC4 A;  2EA4 A;  1UST A;  4KA4 A;  3FMS A;  5L3G A;  3GFJ A;  2QQA A;  4WX9 A;  4I0B A;  1S29 A;  2ZJ2 A;  3D5L A;  2JSC A;  1S8N A;  4A0Z A;  2G9W A;  1SFX A;  2NYX A;  2Y48 A;  1YS7 A;  2Z33 A;  1LNW A;  3CTA A;  5CVI A;  3FF5 A;  1ON2 A;  2CW0 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...