2FRHA

Crystal structure of sara, a transcription regulator from staphylococcus aureus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
b'GSHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal accessory regulator A
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 41
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2frhA00
2WWYA 3IC7A 1U3EM 3HSEA 2VOOA 1CF7A 3RJPA 3K2ZA 2DW4A 1S7OA 2JRTA 4AD9A 1QQIA 4G94A 4U0VA 1YW8A 1Z6TA 3IWZA 1USTA 1KU9A 3U9GA 2VE8A 4CDGA 3F23A 3PQKA 3VEPA 3W6KB 2RN7A 3RKYA 5BOXA 3JAMZ 5EEHA 3F6VA 4ENJA 3MZYA 3O2PE 4RAZA 2P7VB 3LWFA 5D5XB 1KYZA 4UUVA 1FT9A 2O3FA 3GO5A 1P4XA 3V4GA 4A5NA 3MWMA 4P96A 4GGGA 2XASA 2XHKA 4LFUA 1ZGAA 3LQQA 5BPIA 1W7PB 2KRFA 5D8KB 2EFOA 5CVVA 4EVIA 3WGIA 1RNLA 3HIFA 3B73A 3IRRA 2Z9OA 4A6DA 3BDDA 1QGPA 1YQAA 1G3WA 4OIRF 4OOIA 3P9IA 4RB2C 5LGTA 4KN4X 5A2QZ 5ICFA 2AS5F 3P9KA 3RPUA 5L3FA 2JTVA 4IHSA 1IN8A 2XV4S 2HZTA 4XSXF 4KIFA 3DP7A 4LK1F 2XGXA 4HOBA 1K7AA 2FOKA 4HX7A 1E2XA 2XAGA 5E17F 3S2WA 3G3ZA 2CYYA 2Y0MA 3TOAA 3DEUA 3J80K 2CFXA 4U7BA 3U2RA 4P55A 2ZNZA 3T0YA 4R79A 3ZQ7A 3C18A 1ZHFA 2VODA 4ZH4F 3QU3A 4L5JA 2V6CA 3WE2A 4MTEA 1R5GA 2RVCA 3HRMA 5H6RA 1GXPA 2K02A 3ECHA 3SZTA 3C3WA 2V79A 2CG4A 4L0YB 1C0WA 4I0AA 1K79A 5E20A 3WTXC 2HGCA 3SQNA 2PI0A 4M74A 3GF2A 2ZXJA 1B59A 1JE8A 3MFKA 5L3BA 4G9YA 1P2FA 5DD8A 2F2EA 1HKTA 2X4HA 2Z99A 4QLCU 1QPMA 3KP5A 4MGRA 1FSHA 2F5DA 3SZPA 1TW2A 3K1MA 4A0YA 1FBQA 5E1ZB 1LJ9A 2VN2A 4KICA 4EV0A 4A2UA 2HDCA 3CO7C 5A2QK 3R61A 2WTEA 2QLZA 4NB5A 4EM1A 4A0XA 3KLOA 4FHTA 4I0BA 1R00A 3LAPA 3PQJA 4YIFA 4CZZA 2NAZA 2OBPA 2VT2A 2QBYB 2A61A 3QPHA 2E1CA 4IPAA 2OU2A 2ZFWA 3TDUC 4GCVA 2BEOA 3GFIA 3IRQA 1HQCA 3KP3A 3GVAA 1YIOA 3WGHA 1IN6A 4HZFA 3LQRA 1TQMA 2PLYA 4I02A 3WE3A 3E5QA 2FMLA 2XAFA 2VBZA 4ASNA 2YSRA 3FM3A 4K2EA 4M73A 4ESBA 2M30A 1QZZA 2C6YA 4Q47A 2DQRA 4EJWA 1O3SA 1T0FA 3QPTA 5HS9A 5FO5A 1OR7A 2W57A 1XN7A 5FLXZ 3HTUA 1G3YA 2VC1A 5LEKA 2L4AA 2IJLA 1MZBA 2ISZA 2UXXA 2FU4A 3TO9A 3MCZA 4HX4A 1SMYF 4LD5A 4G7ZF 4AIHA 2EV5A 3HSRA 3P7NA 4UV9A 1ON1A 4Q5SF 2CW0F 4BHCA 3RTRA 4U0WA 1UHWA 3SHFA 5LBQA 1B9MA 3BJ6A 5EEGA 1W7PD 3F21A 3L00A 1ZH5A 4WWCA 4HLYA 1DDNA 2NYXA 5HLIA 5JI6A 5ILSA 2QQAA 3IL2A 2FEZA 3QRFF 1J59A 1XSDA 4OMZA 4RB1A 2W24A 1ZLKA 1KQ0A 3EQLF 3R0JA 4L0ZB 2OZ6A 1YW9A 2QBYA 2ESNA 4RGXA 4HV5A 3WTZA 3FZVA 5HOOA 1ZRDA 1S7AA 4KMUX 3GWZA 2OQRA 3GUDA 2FA5A 4L9VA 3DFGA 1JHFA 2ZBKA 3DQVC 3DXJF 4LLGF 4E70A 1XDSA 1KYWA 4MTDA 2L4MA 1VTNC 5FD6A 1LB2A 2ZMEB 4Q4ZF 1HXDA 4M9XA 3HYIA 3CLOA 2NNYA 5H20A 5DD4A 3HSFA 3WG9A 1BN5A 2W25A 2CGPA 1U2WA 5J8CA 2IRFG 4CICA 1X3UA 3O3KA 3F8MA 5FD5A 3WGGA 1R1TA 2VT3A 1KU7A 1EH6A 3E3VA 4IXAA 4MQVA 2DAOA 2Z5UA 2CO5A 3FXRA 3KETA 5ILUA 1U8RA 1DPUA 5DCFA 1IAWA 1R5HA 1L3LA 1SAXA 1XGNA 5FLXK 1OYIA 2DPUA 2XKPA 3C1DA 4CXFA 3KZZA 4Q48A 1E17A 2H27A 3RDIA 1V4RA 3ELKA 2HYFA 1U5TB 3RKWA 4JQFA 1FBUA 3E97A 3T8TA 1IXCA 1MKMA 3J7AO 1H9TA 4N9HA 4ZYEA 1K6OA 1Q1HA 1KU3A 3GZ6A 4L18B 4EGZA 3AAFA 4BHBA 1YW7A 4WXCA 5LGUA 4RGSA 3RPQA 5J6XA 3I58A 4IHTA 4KIBA 4DQ2A 2W84A 4HDUA 2L01A 1XGMA 1J0RA 3OV8A 3ISPA 5HLHA 4QWQA 1O57A 1Z91A 1I1SA 4I7HA 2LF7A 5LHGA 1HW2A 5TRDA 4OINF 4UNOA 5K5OA 1H9GA 4WXHA 1FYLA 1LQ1A 4HDVA 2JSCA 3ZMDA 2J5PA 4EMSA 1FX7A 5HVQC 4WF2A 2PJPA 1EH8A 5LGNA 2V1DA 2DI3A 3N97A 1RI7A 4S05A 1J2XA 3DKWA 2EK5A 3SXYA 2H6CA 4BAYA 3T5XA 4Z2YA 1STZA 2Q0OA 1UB9A 3F3XA 1P4WA 4IJAA 4LB6B 2XRNA 3J80Z 1SD7A 1R1UA 4GO1A 5BPDA 5H6QA 2V1XA 5FFXA 4N0BA 4YFKF 3E6CC 3JTHA 1ZLJA 4G8XA 2FBKA 4YG2F 2WC2A 1RUOA 1ZRFA 1TQIA 2FBIA 2VE9A 2BBYA 1EH7A 2A3SA 3SFZA 1O3QA 2J5OA 4ZZDA 2OQGA 3CTAA 4AIKA 4IRHA 2O61A 2AXLA 2B0LA 4OU0A 5IT3A 2XVCA 1XDUA 4KDPA 1U6GA 1D3YA 4RAYA 2GQQA 1TW3A 4O6JA 2Z33A 3DPLC 1A04A 2VC0A 1B6AA 5LHIA 5LHHA 1HSJA 3ABTA 4TV7A 1BJAA 1F5TA 2BV6A 4XLPF 1HW5A 2HS5A 1S3JA 1IW7F 1FYMA 3WTWC 3K9TA 4KYWA 5L3EA 2DTRA 3BP8A 1P4AA 4MHGA 3TGNA 2L54A 1I5ZA 4JBAA 2LDUA 3WU1B 1TBXA 3ZN0A 4S04A 1IRFA 5F64A 2MLKA 2DFIA 1BM9A 1HKSA 2A6HF 2V9VA 3K1PA 4ENKA 1IF1A 5BS6A 2A07F 1KGSA 3RYPA 4L9TA 3CJNA 2UWMA 4LMYA 4HF2A 3IKTA 4M72A 4B8XA 1R22A 5JFRA 3T1BA 2MD5A 4UHTA 3BZ6A 2F5CA 1XGSA 1BI3A 3M7GA 2UXNA 2R3SA 3BOQA 4PCQA 3MAJA 5HDKA 1O3TA 2ETHA 3HOSA 2DK8A 2QQBA 3MEXA 2EV6A 1S29A 2D1HA 4HA8A 2EFNA 1OMIA 5ILVA 2OAZA 3HRUA 4GXOA 1QZYA 3K69A 1J9IA 1WRJA 1I27A 2Q2EA 2OD5A 4Y15A 3FMRA 5CJ9A 3F8BA 2O6GE 2NRAC 3WTUC 4ZYGA 1R1VA 1W7PA 1PDNC 3GFLA 3ECOA 3V7RA 1IRGA 4LG0B 3M8FA 2HTSA 3Q5FA 5LLQA 2M8EA 2RKHA 5K5QA 5ICGA 3I0TA 2TDXA 4EJVA 1LDDA 1ZAOA 1AWCA 3BPVA 2XKOA 1ZG1A 2XAQA 4UVAA 3JTGA 1G3TA 1QNTA 3I53A 2HEOA 2UZKA 4R1HA 4BXUA 2RNJA 2JPBA 4YIIA 5D8LB 2QENA 4EM0B 5D5WB 1SD4A 3V8JA 4WK8F 1SMTA 1BBYA 1XB4A 3IWFA 5JVTA 2G7HA 4L5IA 2FXAA 1JXSA 2ZCWA 2XUBA 2ELHA 3B02A 5CLSA 2LF8A 3HUGA 3CUQB 4EJUA 2QVOA 2OA4A 4OIOF 3REOA 4ETSA 3D0SA 2VBXA 2PG4A 1JGSA 4NHJA 3F72A 1IN4A 3RKXA 4KMFA 2GXBA 4DNCA 2EB7A 4LLNA 1L0OC 4BYYA 1LEBA 2PMHA 2ZO4A 4KFCA 2LKPA 4G7OF 2V1UA 3GEZA 5LRRA 1J7KA 3EYYA 2H94A 2ISYA 4UXNA 4BH9A 2A68F 2DT5A 3FHZA 1D5VA 4OIPF 3D5LA 3ABUA 4HYEA 3I5UA 4MQ9F 3WTTC 2FSWA 5IT9K 2H09A 3CDHA 4CYDA 1BI1A 4WXDA 3EUHA 1Z9CA 1ZRCA 3DF8A 3C7JA 1FP2A 3KE2A 2FE3A 3NRVA 1DP7P 5HDGA 1EV7A 4AIJA 2M45A 4MEXF 4MEYF 3KCCA 2G9WA 3M8EA 3H92A 2RQPA 2X0LA 2P6TA 4FT8A 3CUQA 1SFUA 1YO5C 2RDPA 3FX3A 3FM5A 3KP2A 1PUEE 2G7UA 4R8HA 1ZN2A 1IZ1A 1W4MA 2IP2A 4BNCA 4Y13A 3QP6A 3LA3A 3BJAA 5CVIA 4LGWA 2P5KA 2ZKZA 4CO8A 1LEAA 4HX8A 4ON0A 4G6DA 2FNAA 2NNNA 3BWGA 3GLXA 5DYMA 2WV0A 2PEXA 4HAMA 2MH2A 2MH9A 2K4JA 2HKXA 3BJOA 1RZ4A 5FGMA 4LLLA 1TNTA 1UCRA 1R58A 2RV8A 1TLHB 2JPCA 4NQWA 2CSOA 2PBIA 2IA1A 4UVCA 2HYGD 1YLFA 1T2KA 5L3GA 5DV5A 1MJ9A 3L7WA 2Y75A 4I09A 4P5OA 3GXOA 3R0AA 1ZARA 2FQ3A 1R23A 3ML6A 3QAHA 1Z7UA 3N4MA 2KJCA 1S6LA 3M9AA 5J8FA 4MNUA 3BROA 5DUKA 2STTA 1NHAA 1IN5A 2YU3A 5E1WA 2ZMEA 4A12A 3VB2A 5F1RA 3V8KA 2P5VA 3KZYA 4A0ZA 2F5EA 2XAJA 4I2OA 3Q9SA 5E1XA 4XSZF 1B1BA 1OYYA 2D1VA 4N9IA 2K4BA 2FF4A 2KKOA 3F8FA 4RS8A 2MBFA 2A69F 1G6NA 2NS0A 3KFWX 4I01A 3COAC 2HKOA 1K78B 3HTSB 3K1NA 3G73A 4YFNF 2STWA 5TJJA 1P92A 4M71A 2XAHA 1J75A 4IF4A 1LNWA 5D4RA 1G3SA 2A5YB 3E5UA 1D8KA 1XMKA 1XMAA 3HRTA 2DLLA 1U5TA 2DO7A 1SD6A 3HHGA 2P4WA 3ZMVA 1QBJA 3NQOA 3P9CA 4ESJA 1TNSA 1IXRC 4PGGA 2YX4A 4RB0A 2E1NA 1BIBA 3R6SA 1ZYRF 3TO7A 1ZG5A 3JSOA 4U7DA 1BC8C 1D8JA 5E8GA 3IHUA 1BI2A 1YTYA 2L02A 3VOEA 4HLXA 2GA1A 3FMSA 4KT5C 2ACJA 3GFMA 2FNPA 1QO0D 3Q9VA 4OMYA 3WTVC 3O6BB 1MJBA 3R4KA 2W85A 4P9FA 2HFHA 3ZP5A 1PP7U 3F6OA 5K5RA 1LDKB 1YS6A 5DUIA 1Z1DA 5D6EA 1XD7A 3BPXA 2HOEA 2ZJ2A 4UVBA 1MD0A 2QQ9A 1XGOA 4BQAA 1K78A 3V8LA 2EA4A 2P6SA 2O8XA 2IA0A 2PQ8A 2EFQA 3F8NA 2RGVA 1Z05A 2D2WA 4RGRA 1O7LA 1R36A 2KIFA 3KLNA 4KUMA 2R7DA 3L09A 4EGYA 2D45A 3FXUA 4F7ZA 2O03A 1I6XA 4AWXB 2QZ8A 5CVUA 3GYHX 3PFIA 2A6EF 4Y17A 2HQNA 1HSTA 2K86A 1F9NA 1HW1A 2DBBA 1WWXA 2VBYA 1USSA 1UFMA 2GXGA 4L9JA 2RC4A 4PZJA 3ZMSA 4M9ZA 2IPQX 3HRSA 3RI4A 2JZYA 3DPTA 2GZWA 4EQQA 3R60A 5HLGA 4O5VA 4EJTA 3MZHA 2CWEA 4A6EA 3J81K 5JR3A 2KIMA 4WX9A 3WTYC 2O0YA 3I64A 5E8IA 2GIVA 2ZNYA 2VXZA 3E6DA 4U88A 3TO6A 3QP5A 4ZYHA 2EFWA 1KQ8A 2BGCA 4ENMA 1BI0A 1DUXC 3LA2A 3BY6A 3L9FA 1O7FA 4AVPA 2M1BA 3JW4A 3U1DA 2LSOA 4KA4A 1J5YA 4B09A 3JAMK 2VBWA 4YFXF 4GYIA 2GWRA 3ZPLA 4IRIA 4EJOA 4P9UA 5LRSA 5IT9Z 2QM3A 4M6XA 1FOKA 3FXQA 5ICEA 4PDKA 2QWWA 3VODA 5L3CA 4IVNA 4FX0A 3L2CA 1LDJA 2KJBA 4XRFA 2K27A 1FZPB 4M9SA 3QOPA 2YR2A 4G6QA 3I4PA 1YG2A 2FMYA 5HDNA 5ICCA 5KK1A 4WCGA 2M87A 5JHUA 3T8RA 4CHUA 1IN7A 3EETA 1REPC 4CGZA 1GXQA 1HKQA 3F8CA 2K7LA 3GW2A 3E5XA 2PN6A 4L9NA 1BOAA 4LJZF 2DU9A 3DV8A 1UHMA 1GHCA 1V3FA 2BYVE 2PFBA 1ON2A 3TKYA 4HBLA 3EYIA 4LG0A 3EDPA 1Y0UA 2KIUA 4H0EA 1HBXG 3KP7A 2FRHA 2PMUA 2DK5A 3HHHA 2HTJA 1SD5A 1CGPA 1FP1D 2HR3A 2QYOA 4I98B 1T98A 2BE5F 5AONA 3K0LA 5BQTA 2Q8KA 6PAXA 2Z3YA 3TQNA 5D4SA 2XROA 5DDGA 5D5VB 2R7FA 3M1EA 4UV8A 1FBSA 1B4AA 1T6SA 2DQLA 3FMQA 2XIGA 5K1YA 1WSUA 4OIQF 2ESHA 4HQEA 1RUNA 3JSPA 4D0PA 2EFPA 1TTYA 5D5UB 2E7XA 1FYKA 3VFZA 4GYGA 3E6BA 4HQMA 2P8TA 3WODF 2IVMA 2IA2A 3WTSC 1Z6RA 1FSEA 3H3UA 5E18F 1XSXA 2HWVA 3CUQC 5AIPA 1R7JA 5CVJA 2VONA 2YX7A 5ERIA 1TQPA 1YFHA 3OOPA 2Y48A 3ZMZA 3V7SA 1T38A 3RYRA 4RB3C 3QU6A 4KNYA 5CVRA 3CUOA 4HV6A 2CQKA 2MA3A 1I1GA 1YYVA 4O3MA 1MDMB 3KEQA 1B9NA 3I71A 3ERED 4ENNA 1WQ2A 1W5TA 5DCMB 2DPDA 1T39A 1KU2A 2M5WA 3W6JB 4BHPA 3V7CA 5FFZA 5D6FA 1H0MA 5CYVA 2E7WA 2ADUA 2P5LC 5HS8A 2F5FA 3TDZC 2OZUA 1XCVA 1ODDA 1ZG3A 2EWNA 5ED4A 3LAJA 5BMZA 3LSTA 2YPRA 1S8NA 1MJAA 3ZN1A 1FPQA 5KVRA 5FB2A 4M6YA 1XCBA 1ZREA 4ZZLA 2LNBA 3FWEA 4LK0F 1GVJA 1IUYA 1FWZA 4RGUA 3GZ5A 4KN7X 1F4KA 3NEUA 4IRGA 3ZMUA 1W5SA 3KP4A 3I54A 1WKMA 4JK1X 1KA8A 3FF5A 1F1ZA 3I59B 4KIGA 3KP6A 4G7HF 3ULQB 5F6FA 1SFEA 3F22A 1BC7C 2IW5A 1KQ9A 1CF7B 2JT1A 3IKVA 4A5MA 3CO6C 2GAUA 4HF0A 5AIQA 2L3DA 3KEOA 3LA7A 3RIRA 4HF1A 1WI9A 1MDMA 2MC3A 4FX4A 1FC3A 2HQRA 4ESFA 3ROUA 1IXSB 3GFJA 3H3ZA 1PP8F 2P7CB 3LFKA 5DCMA 1XSVA 1JHHA 3GX4X 1ONVA 3HOTA 4XBFA 1AOYA 1RIOH 2QUFA 5L3DA 4EM2A 1MGTA 2FBHA 3ZMTA 1ULYA 4PGHA 5HS7A 2GA2A 1FY7A 1YS7A 2COMA 2IT0A 1OKRA 1LVAA 1BIAA 4HW0A 1OPCA 5DEQA 2MLGA 2EV0A 4XLNF 4LB5A 3MQ0A 3TOBA 1O3RA 1DPRA 1U78A 1FLIA 1U5TC 2EA2A 1ZGJA 3J81Z 2H6BA 1G4DA 4ZYDA 1P6RA 5LEJA 1FNNA 4U0YA 2EJRA 1OYWA 3I59A 3WU0A 2VOPA 3E6MA 1SFXA
chains in the Genus database with same CATH superfamily
2W1OA 3QPLA 2ECBA 3A01B 2WWYA 1FTTA 4N4OB 3S1MJ 3IC7A 4IHXA 2IS2A 5DS9A 1U3EM 1ZK8A 3HSEA 1B72A 2VOOA 4J19A 1P9QC 3A4CA 1CF7A 3RJPA 3OYEA 3K2ZA 2DW4A 1S7OA 2JRTA 4AD9A 4BJ6C 1QQIA 4G94A 2VPRA 4U0VA 2KLOA 1YW8A 4XKWA 3K4JA 1Z6TA 2M4KA 1VQKI 3CMEI 5GAGJ 3GTMJ 4BXXJ 3IWZA 1USTA 1KU9A 3U9GA 2VE8A 4J00A 4CDGA 3F23A 3PQKA 3VEPA 2VQHA 3S1NJ 3B6CA 3W6KB 2LBFA 2RN7A 3RKYA 2NVXJ 5BOXA 3JAMZ 4BU2A 5EEHA 3TEDA 3F6VA 4CCJA 1OCTC 3HOUJ 4M3FA 4ENJA 3MZYA 3O2PE 4RAZA 2P7VB 3LWFA 3NARA 5D5XB 1KYZA 3HOWJ 1VFCA 1HF0A 4UUVA 4FISA 1FT9A 1WJEA 2O3FA 4HRIA 2FUG2 3A02A 3GO5A 1P4XA 3V4GA 2LR8A 2WADA 1CQTA 1LFUP 1JGGA 3CC4I 1JTXA 3CCRI 4A5NA 2L9SA 2ZC2A 2LMDA 3FKIJ 3MWMA 3S8PA 3DU5A 4P96A 1UMQA 4GGGA 1FOYA 2XASA 2IGOA 3FIWA 1A31A 5E3NA 3FXJA 2XHKA 4LFUA 1ZGAA 3LQQA 1WI3A 3FKJA 5BPIA 1W7PB 1D1CA 2KRFA 5D8KB 1SEUA 2F4IA 4Y52J 1S9HA 2EFOA 3IH4A 5CVVA 4EVIA 3WGIA 3CCJI 1RNLA 2MW8A 1HCRA 2W00A 3HIFA 3B73A 3IRRA 1JT6A 3LSKA 4LOCA 2E19A 2L9RA 4YRVA 4BKXA 2Z9OA 2AQFA 4A6DA 3BDDA 1QGPA 3HBLA 1Y0NA 4BS9A 1YQAA 1G3WA 3MKYB 2NVYJ 4OIRF 2NS7A 4P1WA 2QKLB 4M3DA 4OOIA 4AYBA 3P9IA 1ETYA 3E1SA 2E60A 4RB2C 1Z0XA 1OCCH 1SVOA 5LGTA 4KN4X 5A2QZ 5ICFA 3ASNH 2AS5F 3P9KA 3RPUA 5EJCA 3HG9A 5LD2C 2CH0A 3WU2C 5L3FA 2JTVA 3A01A 1JJ8C 4IHSA 1IN8A 4XONA 2DXIA 2XV4S 2HZTA 4XSXF 4Y7NJ 4CZCA 3TL4X 3JRDA 1YI2I 3VYRB 4KIFA 3DP7A 2DDBA 4XIDA 5TISC 2WAQN 4LK1F 2XGXA 3BR0A 4HOBA 1Y6IA 1K7AA 2FOKA 4HX7A 1E2XA 2BZTA 2XAGA 5E17F 1WJCA 4XORA 3ZQGA 2ME0A 3S2WA 1HOMA 3G3ZA 2CYYA 2JA2A 2Y0MA 4PSXA 3DEUA 3TOAA 5CQEA 3J80K 5F04A 2CFXA 2R7RA 3BR1A 4U7BA 3CC7I 3U2RA 2VJ4A 3OYGA 4P55A 2ZNZA 1MNDA 4A3JJ 3T0YA 4R79A 3ZQ7A 3OR2C 4DIQA 3CMMA 3C18A 3ESWB 1ZHFA 3PUBA 2VODA 4ZH4F 3KZIC 3QU3A 1MMGA 1VQNI 3NAUA 3HUGB 3SEZA 4L5JA 2V6CA 1SC7A 2KPMA 4E7ZA 3BTJA 3CCLI 3BTLA 1OCZH 3WE2A 4MTEA 2Q1ZB 2KZGA 4IQJA 1R5GA 2RVCA 3HRMA 5H6RA 1GXPA 2M2EA 4B44A 1VQ6I 3VWBA 2K02A 3ECHA 3SZTA 1U0JA 3DTIA 2HDDA 1Y1WJ 3C3WA 2V79A 2CG4A 4L0YB 1C0WA 4U87A 4I0AA 1K79A 4IHYA 3DKYA 5E20A 3LL7A 1QHHD 1POGA 3WTXC 2HGCA 1YX3A 4A3KJ 1WHUA 3SQNA 2PI0A 4MO7A 4M74A 3GF2A 2KISA 2ZXJA 3OSFA 4E7KA 3EUKL 4N4NB 1PVEA 1B59A 2Y9ZA 1JE8A 3MFKA 5L3BA 1EF4A 4G9YA 1P2FA 4XRSG 4FE4A 3S2DJ 5DD8A 2F2EA 1MMNA 2R7WA 1HKTA 2X4HA 2Z99A 4QLCU 3ZQCA 1QPMA 3JREA 3KP5A 2VB6A 4MGRA 1FSHA 2F5DA 3SZPA 3N05A 2NVTJ 1TW2A 3IAM2 3K1MA 1MSFC 4A0YA 1FBQA 3H9GA 2CS3A 3SEQA 2E1MC 3HM5A 2XGEA 5E1ZB 1LJ9A 2V9PA 2VN2A 4KICA 4EV0A 4A2UA 2HDCA 3CO7C 1YITI 5A2QK 3R61A 2WTEA 2XPWA 2QLZA 4NB5A 4KISA 4EM1A 4A0XA 3KLOA 4FHTA 4I0BA 1R00A 3LAPA 3CDLA 2VPLA 3PQJA 4YIFA 3OOUA 5J4YA 4CZZA 2NAZA 3PL8A 3BG7A 1WJBA 2LREA 2OBPA 2R7ZJ 1XG1A 2VT2A 2QBYB 2A61A 3QPHA 1E0EA 2E1CA 1T8IA 4CCOA 2W48A 3OL4A 4IPAA 4FASD 2K3FA 5JHFA 2OU2A 2ZFWA 3EPZA 3TDUC 4GCVA 2BEOA 3GFIA 3IRQA 3L2RA 2QSGX 1HQCA 2VKEA 3KP3A 4B48A 3GVAA 1YIOA 3A1YA 2GOXB 2I5UA 3WGHA 1IN6A 1J09A 1FIAA 4HZFA 1N77A 3LQRA 1TQMA 3OYAA 2PLYA 4UUTA 4I02A 3WE3A 1HDPA 4MIMA 3E5QA 2RAEA 2FMLA 2XAFA 2VBZA 4ASNA 2EZKA 2YSRA 1VF9A 3FM3A 3DCFA 4K2EA 3LSPA 2JA7J 4M73A 2IEKA 2E36A 4ESBA 2M30A 1V55H 3LSHA 1QZZA 2C6YA 4Q47A 3BQZA 2DQRA 4EJWA 3HL2A 1O3SA 1T0FA 3QPTA 1K4TA 5HS9A 5FO5A 1OR7A 2W57A 1XN7A 2L7FP 5FLXZ 1ERDA 5KNLA 4JX5A 1ZGWA 3HTUA 1VQLI 1G3YA 3OYHA 2VC1A 3PUFA 4CA0A 5LEKA 2L4AA 2IJLA 2EIKH 1MZBA 5EF6A 2EBIA 1MNEA 2KDZA 1YHQI 1H89C 4IHVA 2ISZA 2UXXA 3WG7H 1UZCA 2FU4A 3TO9A 1FEXA 2ME6A 3MCZA 4HX4A 1SMYF 4LD5A 2LK2A 5C44J 1NTCA 4G7ZF 4AIHA 2EV5A 2ICWG 3HSRA 3GMEA 2CUJA 1IRXA 3P7NA 4UV9A 3PO3J 1ON1A 4Q5SF 3CJTB 2CW0F 3X2QH 4HG2A 3RTRA 4BHCA 5JLWA 4U0WA 1UHWA 4NQWB 3A0BC 3SHFA 5LBQA 2BOLA 3HOXJ 1B9MA 3BJ6A 3DLLF 3FK7A 3ABLH 5EEGA 1W7PD 1LPQA 3KX2A 3F21A 3L00A 2ZSHB 1ZH5A 4WWCA 4HLYA 3B6AA 3FXKA 1DDNA 2NYXA 2VQLA 5HLIA 1TT5B 3CCEI 2L5QA 5JI6A 1WH7A 2QQAA 5ILSA 1K83J 1S7EA 3IL2A 2FEZA 3QRFF 1VQ4I 3CP8A 1J59A 3M8JA 2MG4A 3KYDB 1QVTA 2XGCA 2BY2A 5GAHJ 1XSDA 4OMZA 4RB1A 2W24A 2K3PA 4NC8A 1ZLKA 1KQ0A 3ZCOA 3EQLF 3R0JA 4RAGA 3VYSB 4L0ZB 2OZ6A 1YW9A 4ITVA 4JX4A 2VL8A 2QBYA 2ESNA 1ZELA 4HV5A 4RGXA 3FZVA 3WTZA 5J1YA 5HOOA 1DQUA 1S7AA 3DEWA 1ZRDA 3FXMA 3CCUI 4CYCB 1XTAA 4KMUX 2CU7A 3GWZA 4OWRB 2OQRA 2JK3A 3GUDA 2FA5A 2K85A 2DJNA 5E3MA 4L9VA 3VDXA 3DFGA 2HOTA 1JHFA 2ZBKA 3DQVC 3DXJF 4Y4RA 3RSNA 4LLGF 4E70A 1XDSA 2LTPA 4KT6A 1KYWA 4MTDA 2L4MA 3F9KA 1VTNC 2KQRA 5FD6A 3LNQA 5LFAA 1LB2A 1F36A 2ZMEB 3M3YJ 4Q4ZF 1HXDA 1Z67A 4M9XA 1R9TJ 2K9LA 4PJNA 3HYIA 3CLOA 4ZDPA 2HXOA 2NNYA 1TWFJ 3H5RA 4V2GA 5DD4A 3HSFA 5H20A 4IOCF 3WG9A 1BN5A 3ERMA 2W25A 3I9V2 4BUPA 2CGPA 1U2WA 5J8CA 4XLFA 3AFHA 1IO2A 1X19A 2EZLA 2IRFG 3BLYA 4CICA 1X3UA 3O3KA 4M3EA 3F8MA 5FD5A 3WGGA 1R1TA 2VT3A 2XGDA 1JUMA 1KU7A 1EH6A 3BG3A 1R6RA 3E3VA 3FISA 4D7MA 1N75A 1GDTA 3H3VK 2JN6A 4IXAA 4MQVA 2DAOA 5F0HA 3HPHA 2Z5UA 3GTGJ 5FKOA 2CO5A 3VSKA 3FXRA 5F0CA 3KETA 5ILUA 1U8RA 1DPUA 3JRHA 5DCFA 1IAWA 1R5HA 2R7TA 1VQ8I 2EINH 3MD2A 1L3LA 1SAXA 1XGNA 1FMWA 5FLXK 1OYIA 1JKPC 2DPUA 3C2HA 2LKSA 1G2HA 2L9VA 3CMYA 1B8IA 3OYFA 1VQPI 2XKPA 2DFFA 2XB5A 1X1AA 3C1DA 4CXFA 2FOWA 3KZZA 5B1BH 4Z6YA 4Q48A 1MH3A 3BG5A 2JVGA 1E17A 1TWAJ 3G1MA 3ABKH 4Y3OA 2H27A 3RDIA 2PMZN 1EJ9A 1V4RA 4A3LJ 1Y1VJ 2HYFA 1ETVA 3ELKA 1U5TB 2MC4A 1LKXA 3RKWA 1ETQA 4JQFA 2HI3A 2XF6A 1FBUA 3E97A 1E3HA 3T8TA 1IXCA 1MKMA 3A03A 3LFUA 3P5JA 3J7AO 1H9TA 3BTIA 4CYCA 4AYBN 1H88C 4N9HA 1Z77A 5H2FC 2LVSA 3C2BA 2I10A 4ZYEA 3D5SC 1K6OA 1Q1HA 1IDYA 1KU3A 3GZ6A 2DT6A 3H0GJ 4EGZA 3L1PA 4L18B 3AAFA 3Q0VA 4BHBA 1BR4A 1IC8A 4IEJA 3PJRA 1JI8A 1YW7A 4WXCA 1ZR2A 3UNGC 5LGUA 2R7VA 4RGSA 3GTJJ 2DOEA 3HKZN 2JUGA 3RPQA 5J6XA 5FLMJ 1D0ZA 4JYKA 3I58A 3BQYA 4IHTA 4KIBA 4DQ2A 4FCYA 3CESA 2W84A 3I4MJ 5FJ8J 2XSJC 5IP7J 4HDUA 2L01A 1XGMA 3DPUA 3BCBA 1J0RA 3OV8A 3ISPA 1I39A 4PJ0C 5HLHA 4QWQA 1O57A 4PJJA 3MKZA 4H4KC 2F5VA 1SFKA 2EZHA 1Z91A 5J4VA 1I1SA 4I7HA 2LF7A 5LHGA 1HW2A 4RBOA 1YRNB 1DP3A 5TRDA 4DZJA 9ANTA 4OINF 1MH4A 3CDIA 4UNOA 2CV0A 5K5OA 2DOAA 1X2MA 1H9GA 4WXHA 1FYLA 2M34A 1LQ1A 3ZQIA 4HDVA 2JSCA 3ZMDA 2J5PA 4DZPA 2LY9A 4CUGA 1SFOJ 3PNTA 4EMSA 2RNGA 1FX7A 2LOOA 5CKTA 5HVQC 4HPQA 1VQMI 1G59A 4WF2A 4NC6A 2Y0SN 1EH8A 2PJPA 5LGNA 2V1DA 2DI3A 4AIDA 3ZOBA 3N97A 3BT9A 3JRCA 2ZJQF 2EH3A 1TP4A 2QSHX 4DOZA 2PJRA 1RI7A 4S05A 4BQOA 3HB9A 1J2XA 1XS9A 3DKWA 2EK5A 3SXYA 2F48A 2B63J 1X1PA 2H6CA 4BAYA 3OYMA 3T5XA 2DFHA 4Z2YA 4ANJA 1STZA 2Q0OA 1UB9A 3F3XA 3LSMA 1P4WA 4IJAA 1BL0A 4LB6B 2WY7Q 2DMPA 3BC8A 3K6GA 2XRNA 3BZKA 3J80Z 1SD7A 3ZQQA 4IHWA 2FX0A 1R1UA 3AG2H 1TWHJ 2JRMA 4GO1A 1PUFB 1MMAA 5BPDA 1BOBA 5H6QA 4B3AA 2V1XA 3LSIA 2R7SA 1TL8A 5FFXA 4N0BA 4YFKF 3E6CC 3JTHA 1A35A 1ZLJA 4G8XA 2FBKA 4ABZA 4YG2F 5J1RA 4YELA 4XN0A 1MMDA 2WC2A 5FRMA 2L9NA 1RUOA 3OYCA 1TQIA 1VNDA 3LMMA 1NH3A 1ZRFA 2FBIA 3G6EI 2VE9A 1X1DA 5C3EJ 2BBYA 1EH7A 3IH3A 4E7IA 2R5ZB 1OQYA 2I8DA 3DBHB 1HLVA 2A3SA 3SFZA 3GTLJ 1O3QA 2J5OA 4ZZDA 3OYNA 2OQGA 2KT0A 3CTAA 4AIKA 1YRNA 2YS9A 4IRHA 2QCOA 3BG9A 2RREA 3AG3H 1YJWI 2E71A 2O61A 3K70C 2AXLA 1I6HJ 2B0LA 4OU0A 5IT3A 2XVCA 1XDUA 3S3MA 4IOAF 4KDPA 1U6GA 2LD5A 1D3YA 3BR3A 4RAYA 2GQQA 1TW3A 1K4SA 4AVZA 4XLCA 2Q2EB 4O6JA 2Z33A 2H1KA 3KIOA 3DPLC 1A04A 2VC0A 1B6AA 5LHIA 3PIPF 3S32A 1N78A 5LHHA 1HSJA 3ABTA 4JX6A 1WJ5A 4TV7A 3G71I 1JJ6C 1F5TA 2LYCA 4D1QA 3V42A 1X1CA 2BV6A 4XLPF 1HW5A 2HS5A 1S3JA 1A5JA 1IW7F 2X6OA 1T56A 1WJFA 3WTWC 1ETKA 1FYMA 3K9TA 1H8AC 2DMUA 2DMTA 1XMXA 2X6YA 3MKLA 4B43A 4IO9F 4KYWA 5L3EA 2DTRA 3BP8A 1P4AA 1UG2A 4MHGA 3JRBA 3S16J 2XB0X 1OFCX 2AHQA 3TGNA 4J01A 4XOTA 2L54A 2DA5A 1I5ZA 4BDZA 2VKVA 4JBAA 1ZR4A 2UUZA 2LDUA 2DA1A 3WU1B 1TBXA 2LG4A 3ZN0A 3BCAA 4S04A 1IRFA 5F64A 2CJJA 3OY9A 4BE2A 2MLKA 4XLHA 4MFEA 2DFIA 2R7QA 2DMNA 1BM9A 1WCMJ 3E7LA 1HKSA 2A6HF 2DN0A 2V9VA 3QODA 2E2HJ 2JUCA 3K4LA 4OAZA 1MSEC 1HC8A 3K1PA 2DT7B 4ENKA 4GFBA 1IF1A 2XPVA 1UG0A 3H5NA 1PUFA 5BS6A 2R93J 2A07F 3GCMA 3PFYA 1KGSA 3RYPA 1IDZA 4L9TA 3CJNA 5FROA 2UWMA 2Y2ZA 4LMYA 2XSDC 4MFDA 4HF2A 3IKTA 4M72A 3CP2A 1Z3YA 2CUFA 3FHNA 4RLQA 2DODA 5IOYA 4B8XA 2E1MB 1R22A 1W36C 1OISA 5JFRA 3T1BA 2MD5A 2X1CA 4UHTA 2OCCH 3BZ6A 5J47A 1WVRA 4QTRA 2F5CA 2RQQA 1XGSA 4CH7A 1BI3A 3M7GA 5IOZA 2UXNA 2R3SA 3BOQA 2IAIA 4PCQA 2VUMJ 1AHDP 3MAJA 5HDKA 1O3TA 2ETHA 3BZCA 2DA7A 3HOSA 1W0TA 2DK8A 2HPMA 2OCEA 2QQBA 2DA4A 3FDYA 3MEXA 3OSGA 2E2JJ 3TW6A 2EV6A 4BE1A 1S29A 2D1HA 4HA8A 2EFNA 2LRDA 2X9DA 5J3LA 1OMIA 2OAZA 5ILVA 3JR9A 3HRUA 4GXOA 1QZYA 3K69A 1J9IA 1MBFA 1WRJA 1T08B 1I27A 2Q2EA 2OD5A 3I3LA 2VIXA 3CF2A 3FMRA 4Y15A 3I4NJ 2MABA 5CJ9A 4UY8I 2R4GA 3F8BA 2O6GE 2NRAC 3WTUC 4E7SA 4ZYGA 3L2QA 1HA8A 1R1VA 2WB1A 3JRAA 1W7PA 1PDNC 2PX9A 3K4MA 2BHZA 4QPQA 3GFLA 1VI0A 3ECOA 3V7RA 4UB6C 1IRGA 3HGYA 2M7BA 3M8FA 4LG0B 4HNTA 2HTSA 4AUXA 3Q5FA 5LLQA 5EDNA 2Z1DA 2M8EA 2RKHA 5K5QA 5ICGA 4XQFA 3I0TA 3AL0C 2TDXA 4EJVA 3OYJA 1X58A 2VJ5A 1LDDA 3DTEA 1ZAOA 1AWCA 2HPIA 3BPVA 2XKOA 2HNHA 2XAQA 4UVAA 1ZG1A 4IX7A 3JTGA 1G3TA 1VZ0A 1QNTA 3I53A 5IYCJ 2HEOA 2UZKA 4R1HA 3DWLE 4BXUA 2RNJA 2JPBA 4YIIA 5D8LB 2QENA 2M9HA 4LG3A 4EM0B 5D5WB 1W0UA 1SD4A 1IUFA 2CFOA 3V8JA 2XC7A 3JRIA 4IKFA 4QIWN 2Z16A 1A6IA 3ABMH 4WK8F 4C2UA 1SMTA 1BBYA 5KAFC 1XB4A 3IV5A 2EQRA 3IWFA 3OS1A 1AKHB 3OR1C 2E2IJ 5JVTA 4BDYA 2EZIA 1IGNA 1EKEA 4LIVA 1XC5A 5B5EC 2G7HA 1YJNI 2ZXHA 3MMYB 2FXAA 4L5IA 1JXSA 2ZCWA 2XUBA 4LITA 4F92B 4DW6A 2ELHA 3B02A 4IL6C 4RMNA 5CLSA 5E79C 2Y69H 2LF8A 3GLLA 2WAFA 2CMPA 3HUGA 2V4JC 2LY2A 3CUQB 4CCKA 2HZDA 4EJUA 2QVOA 1V5GA 3MN2A 3K4NA 4A69C 2FD5A 2K9NA 3O8GA 2OA4A 4OIOF 3REOA 4ETSA 3NWSA 2CW8A 2E35A 3D0SA 2VBXA 2PG4A 3ONQA 1JGSA 4NHJA 3OS2A 3F72A 2K9QA 1IN4A 3RKXA 4KMFA 3SFIA 2GXBA 4DNCA 2EB7A 2ZFUA 4LLNA 1L0OC 4BYYA 3IH2A 1LEBA 2PMHA 2ZO4A 3D5RC 4KFCA 2H8WA 2LKPA 5DM6F 3M07A 4G7OF 2NOJB 4E7HA 2V1UA 3GEZA 1JTYA 1Z21A 3PNVA 5LRRA 4M3GA 1FTZA 5K7FA 1J7KA 3EYYA 2H94A 5FLVA 2ISYA 2TCTA 1WPKA 2IGNA 2MD0A 1T0FC 3IUOA 2CQNA 5B3SH 1WGXA 2JMWA 4M6VA 1OR7C 1P7JA 5GPCA 2JVHA 4XOPA 4UXNA 1U9OA 4BH9A 3HXLA 2A68F 1VQOI 1S72I 2DT5A 3FHZA 1D5VA 1ENHA 4OIPF 3D5LA 3ABUA 3CCQI 4HYEA 3I5UA 2LP0A 4MQ9F 4UUSB 3WTTC 5M3FJ 2BVLA 2FSWA 2R5YB 5IT9K 3KYCB 2H09A 1X2NA 2YU9J 3CDHA 4CYDA 1BI1A 1K61A 4WXDA 4NC7A 1S5LC 3EUHA 5FKKA 2DYRH 1Z9CA 2GLOA 3VYUB 2O8KA 4PJMA 4HEA2 5TGTA 1ZRCA 1Z3XA 2CRGA 3DF8A 3C7JA 4DYRA 1FP2A 3KE2A 3ZXSA 2FE3A 3NRVA 4LIUA 2W7NA 2EPFA 1I3AA 2NOGA 1DP7P 2OTJI 5HDGA 1EV7A 4AIJA 2WAQA 2EIJH 2M45A 5K7ZA 2LH9A 4MEXF 4MEYF 3KCCA 2G9WA 3M8EA 3H92A 4NBQA 2RQPA 4BGDA 2X0LA 4D5CA 2P6TA 4FT8A 3CUQA 4A3CJ 4RAFA 2HQAA 1MBJA 1SFUA 4W1UA 5IP6A 3MKWB 1LFBA 1YO5C 2RDPA 3QWLA 3FX3A 4HSTA 3LOCA 1R71A 3FM5A 3KP2A 4B47A 3DTKA 5B66C 1PUEE 1AA7A 5GPAA 2G7UA 4R8HA 1ZN2A 1IZ1A 1W4MA 3GTOJ 2IP2A 2KRCA 3CQZJ 4BNCA 4Y13A 5BNGA 2VXDA 3K4CA 3QP6A 3LA3A 2CQQA 4XRSA 1MIJA 2QA4I 3BJAA 5CVIA 3L2VA 4LGWA 2P5KA 2ZKZA 4CO8A 1LEAA 1WH5A 1SVLA 2JSPA 2Y30A 3VPRA 4HX8A 4ON0A 4G6DA 2FNAA 1WJDA 1Y56A 2NNNA 2FQ4A 3BWGA 3GLXA 5DYMA 2WV0A 2PEXA 4HAMA 2P81A 2MH2A 2MH9A 2IS4A 3K4BA 2GOMA 2K4JA 3CJQB 1BW6A 1QZEA 1DU0A 4UB8C 2HKXA 2DOFA 3BTCA 3BJOA 1RZ4A 5FGMA 4LLLA 4QSHA 1TNTA 1UCRA 4A3GJ 3G1OA 3SJMA 1R58A 3LSGA 2DMQA 2K9SA 2RV8A 3H0DA 1TLHB 3DLAA 1IG7A 3HGGA 2JPCA 2DA2A 4NQWA 2CSOA 1JUPA 1R49A 2PBIA 4BJTA 2IA1A 4UVCA 1JT0A 2HOAA 1RR8C 2HYGD 1M1EB 1YLFA 1UHSA 1T2KA 4X6AJ 1KONA 2LFBA 3A0HC 2ID3A 2WA0A 5DV5A 5L3GA 1MJ9A 3W6VA 3F0CA 3L7WA 3OYKA 2Y75A 3S2HJ 3TW7A 4I09A 2DA6A 2NVQJ 1JUSA 4P5OA 2CQXA 5F27A 3GXOA 3R0AA 5HODA 5M5WJ 1ZARA 2FQ3A 1R23A 2IBDA 3RZDJ 3TP0A 2Z2SB 1YJ9I 4OAYA 1D1AA 3WHCA 5F08A 3J7ZI 2P0WA 3ML6A 3QAHA 1Z7UA 3N4MA 2KJCA 1S6LA 3M9AA 2LY1A 2OTLI 5J8FA 4MNUA 3BROA 5DUKA 1BW5A 2OC6A 4BL0B 2STTA 1NHAA 1IN5A 4AM3A 2FJ1A 2YU3A 5E1WA 2Y31A 5KHDA 4V2FA 2COBA 5JVGF 2ZMEA 4DGWB 4A12A 1D1BA 2ZSIB 4F91B 4RLFA 3VB2A 1WZ2A 5F1RA 2HQ5A 3FBIB 4PK4A 4X1EA 3V8KA 2P5VA 2MSYA 3KZYA 1GVDA 2W82A 3BR5A 2M0MA 1ITYA 2F5EA 4A0ZA 2XAJA 4I2OA 1FOWA 3Q9SA 5E1XA 4XSZF 1B1BA 3CCSI 2IGKA 4RDUA 1V5EA 2JA8J 4ZYAA 1LE8B 1OYYA 2D1VA 2JA5J 1QHGA 3G1LA 5JLXA 4N9IA 1W1WE 2K4BA 2FF4A 4XLAA 2KKOA 4HSRA 3F8FA 2OV7A 1R5ID 4RS8A 2MBFA 2A69F 2E5ZA 1QRYA 1G6NA 2NS0A 3KFWX 3HC7A 4I01A 3COAC 2HKOA 1K78B 3HTSB 3K1NA 3G73A 1YE9A 1IJWC 4BBSJ 4YFNF 2STWA 3RZOJ 3SZGA 3AG4H 2X85A 1P92A 5TJJA 2LBFB 4M71A 2XAHA 3WHBA 2VKDA 1J75A 4YEJA 4IF4A 1WJAA 3PIOF 1LNWA 3HDDA 1K6YA 5D4RA 2NXNB 2GBYA 1G3SA 3S3NA 1SANA 2A5YB 3E5UA 1UJ8A 2V9KA 1D8KA 1XMKA 1XMAA 3CCMI 3AG1H 3HRTA 2DLLA 3TP3A 4FQGA 3C2GA 1U5TA 2BY1A 2DO7A 1R4MB 1SD6A 3HHGA 2P4WA 2ZXWH 3CZ6A 4NNJA 3ZMVA 1QBJA 4BQQA 3NQOA 3W2WA 3WU0A 3P9CA 4ESJA 1TNSA 1IXRC 4PGGA 5GP9A 2YX4A 4A3EJ 4RB0A 2V7FA 2HVQA 2KDOA 1E3PA 2VQGA 3W3CA 2E1NA 5E3LA 1SVMA 1BIBA 3RQ4A 3SYTA 1D0XA 3TBIA 3R6SA 1ZYRF 3TO7A 1ZG5A 3JSOA 5GADJ 4U7DA 1BC8C 5E8GA 3IHUA 1D8JA 1BI2A 4I99C 3DBRB 1YTYA 3MZ8A 5GTIC 2HYJA 2L02A 4PUSA 4XN3A 1ORKA 3VOEA 4HLXA 2GA1A 3FMSA 4KT5C 2ACJA 3GFMA 2FNPA 5IY5H 1OJLA 3PSFA 1GLNA 1QO0D 3Q9VA 4OMYA 3WTVC 5EEAA 2XDVA 3O6BB 3IAS2 1MJBA 4CCNA 1LE8A 3OYDA 2BVMA 2M8GX 3R4KA 2W85A 2XPUA 4P9FA 4XLEA 2HFHA 4G12A 3ZP5A 3CMAI 1PP7U 1QU3A 1RR7A 3F6OA 5K5RA 1A36A 1LDKB 1YS6A 2IGMA 5DUIA 1Z1DA 5J40A 5D6EA 3S15J 1XD7A 3GTKJ 3BPXA 2DDAA 2HOEA 2ZJ2A 4UVBA 1A6QA 4CCLA 4A3IJ 5K7HA 1DGWY 1MD0A 1I3QJ 1LFPA 2QQ9A 2E34A 4C3JJ 1XGOA 4BQAA 4JP0A 1K78A 3OIQA 3V8LA 1V5FA 2EA4A 2GIZA 2P6SA 2O8XA 2WBMA 2KFDA 1XPXA 2R7XA 2IA0A 2PQ8A 2V26A 4I6ZA 1RC9A 2EFQA 2HOSA 3NWTA 3F8NA 5HLTA 1G8XA 1R4NB 3OWTA 2RGVA 1Z05A 2D2WA 4RGRA 1O7LA 1R36A 1ETWA 2KIFA 3KLNA 4KUMA 3GZNB 2R7DA 3ZRGA 3L09A 4EGYA 2D45A 4XKCA 3FXUA 4F7ZA 2O03A 1I6XA 4AWXB 2MGQA 5FRNA 2QZ8A 2L7KA 1NG7A 4ZC3A 5CVUA 4BQNA 3GYHX 4XMYA 4XRMA 1VQ5I 3PFIA 3RQIA 1D5YA 2KRHA 3AKZA 2A6EF 2HVSA 3GBGA 4Y17A 2CQ7A 5EZGA 2HQNA 1HSTA 4MLOA 2K86A 1ETOA 1F9NA 2X1EA 1HW1A 2VJJA 1Y8QB 2O7OA 2MFZA 2NS8A 2DBBA 3MVPA 1WWXA 3PSIA 4PFOA 3AL0B 2L7ZA 1USSA 2VBYA 3KEYA 1UFMA 4PFPA 2XF5A 2GXGA 4E6KG 4A3DJ 4D5FA 1DU6A 4L9JA 2RC4A 2PMZA 3S17J 4PZJA 3RCOA 3ZMSA 3FXLA 4M9ZA 2KL4A 1JKQC 3CD6I 2IPQX 3HRSA 4RM3A 3S3OA 3RI4A 4BY7J 3M1CA 2IS6A 1GV2A 2CUZA 2JZYA 3JRGA 2VKHA 1MBGA 2A6TA 3DPTA 2JQ7A 1LUJB 2GZWA 1JKOC 4EQQA 3HEFA 3R60A 5HLGA 2CV2A 4O5VA 5M5XJ 1OCRH 4EJTA 4II2A 3MZHA 2M3AA 2CWEA 4XK4A 2K40A 4A6EA 3J81K 5JR3A 2KIMA 1APLC 4WX9A 3ZGKA 2R5ZA 3QYFA 3WTYC 2O0YA 2DCEA 3I64A 1ZTRA 3GTQJ 3BG6A 5E8IA 2GIVA 4FETA 2ZNYA 3HKZA 1EA3A 2R7OA 2VXZA 3E6DA 4U88A 3TO6A 3QP5A 4ZYHA 4ZTJA 2ECCA 2BHYA 2EFWA 3ASOH 1KQ8A 1ZQ3P 2BGCA 4ENMA 4A3FJ 1BI0A 4DBRA 2CW7A 1DUXC 3L2WA 5FKLA 4A3BJ 5B1AH 3LA2A 3G2BA 1N25A 3BY6A 3L9FA 1O7FA 4AVPA 5E3OA 3PNYA 4S0HB 2VJIA 4B3XA 2M1BA 1MNMC 3JW4A 2OPTA 3ZR8X 3U1DA 1T33A 2KP6A 2LSOA 4KA4A 4L5EA 1J5YA 1D0YA 4QPOA 4B09A 1I50J 2VLAA 3JAMK 2VBWA 4YFXF 4GYIA 2DTZA 1MBEA 2GWRA 2B9SA 3ZPLA 2VASA 4IRIA 1E3OC 2QGUA 4EJOA 1RKTA 2F4MB 2W4SA 3H1CA 1GT0C 1VQ7I 4GDFA 2R7UA 4P9UA 2OUMA 5LRSA 5IT9Z 2QM3A 2Y0SA 3K70D 4M6XA 2H8RA 3K7AJ 3SDBA 1FOKA 3FXQA 4HNUA 5ICEA 1MBHA 3CLQA 1PJRA 2TRTA 2NVUB 1VQ9I 1IV8A 4PDKA 4XICA 3OIPA 3JRFA 2QWWA 2EILH 2VI6A 3CCVI 3VODA 5L3CA 4IVNA 3DBLB 3O8HA 1TZLA 2JWTA 4FX0A 1TWGJ 3L2CA 1LDJA 2KJBA 2R92J 2QKMB 4XRFA 1OCOH 3HZJA 2K27A 1FZPB 2WAEA 4M9SA 2X48A 3J7AY 3QOPA 2YR2A 2BY0A 4G6QA 3J7YJ 2GXAA 2O9LA 3U21A 4C3IJ 3I4PA 1YG2A 2Y9YA 2FMYA 3H36A 3PM1A 5HDNA 1F43A 5ICCA 1RPWA 5KK1A 4WCGA 2M87A 3ZQHA 4E4HA 5JHUA 1X1BA 3T8RA 3PO2J 4CHUA 2E5NA 1IN7A 3EETA 1REPC 4CGZA 3OYIA 1GXQA 1HKQA 2M7AA 3F8CA 2K7LA 4PJLA 4Y33A 2F6CA 2AXTC 2WY8Q 2ZB9A 3GW2A 3E5XA 2PN6A 3KYLA 4L9NA 1BOAA 4LJZF 2DU9A 3DV8A 3A2KA 2E1OA 2QQ8A 1RKWA 5GTHC 1UHMA 1GHCA 2JA6J 3RPUD 1TWCJ 1V3FA 2BY3A 2BYVE 2PFBA 1W36D 1ON2A 2BW3B 3TKYA 1O4XA 4HBLA 4XL9A 4EATA 2XAUA 2KZVA 2L0KA 3EYIA 1W5CC 4LG0A 2M0CA 3EDPA 1Y0UA 4ZDLA 2KIUA 3OYBA 4H0EA 5CPRB 1HBXG 3S1RJ 3ZQFA 3RKQA 5F0FA 3KP7A 2FRHA 3K4KA 1YX5A 2PMUA 5J1UA 4A93J 4ZTFA 5HNFA 1TT0A 2DK5A 4F93B 1LVKA 5DM7F 5EZHA 3HHHA 2HTJA 5EGOB 1SD5A 1CGPA 1FP1D 3EUAA 2F4OB 2HR3A 2QYOA 4I98B 1U9NA 2M4GA 1NG6A 1T98A 3DU6A 2BE5F 2X6WA 5AONA 3K0LA 5BQTA 3M4OJ 2Q8KA 3K2AA 3S93A 6PAXA 2Z3YA 3Q0WA 3TQNA 5D4SA 3FK6A 2XROA 2XF7A 5DDGA 5D5VB 4XR6A 3UKGA 2R7FA 4D7NA 3M1EA 1Q1VA 2GM4A 4UV8A 3K10A 2L2OA 1FBSA 3W2VA 1B4AA 1T6SA 4M3BA 3HOVJ 1BR1A 1P7IA 2DQLA 3DKXA 3FMQA 1AKHA 2D5VA 1MMSA 2XIGA 1QPIA 5K1YA 1FMVA 1WSUA 3H9QA 2QF7A 4OIQF 4X0GA 3BR2A 1Y39A 1QA6A 2ELKA 3QPSA 2ESHA 4HQEA 1RUNA 3JSPA 2JJ7A 1HDDC 4D0PA 3OMYA 5IYDJ 4F52A 4KJZA 4BACA 2EFPA 2KHMA 1B8IB 1TTYA 5D5UB 2E7XA 3EUHC 1FYKA 2IS1A 4GRIA 3VFZA 4GYGA 3E6BA 5KCMA 4BEHB 1FIPA 2X51A 4HQMA 1XX5A 2P8TA 2A5WA 4W97A 3WODF 5FKNA 1BJZA 2IVMA 2IA2A 3E0JB 3WTSC 2HXIA 1Z6RA 2L7MP 2EIMH 1FSEA 3QYEA 3H3UA 5E18F 1XSXA 2HWVA 4DBQA 4E7LA 3LSJA 3CUQC 5EG0B 4NUBA 4XM3A 2BW3A 5AIPA 5FKMA 5IP9J 4BE0A 1OCPA 1R7JA 1GUUA 2ZJPF 5CVJA 2VONA 2YX7A 1BA5A 1RRJA 5ERIA 1TQPA 5F1JA 1YFHA 1AU7A 4BJ5C 3OOPA 2Y48A 3OYLA 3ZMZA 4YIRX 3Q0UA 3V7SA 4IZZA 1T95A 4FE7A 1T38A 5GAEJ 5C4JJ 1SAUA 3RYRA 1RESA 4RB3C 3QU6A 1V54H 4XKVA 1UAAA 2LLKA 2LKXA 4AU7A 3Q3SA 3SDGA 5EGOA 4KNYA 3GTPJ 5CVRA 3CUOA 2B7EA 4HV6A 2CQKA 3OL3A 1Y8RB 2MA3A 1I1GA 1YYVA 4O3MA 4KITB 2KMUA 2QSFX 1MDMB 3D1NI 3KEQA 2DJIA 2ZJRF 5IPAA 1B9NA 1UELB 3I55I 3I71A 3ERED 1X4OA 2ZXIA 4ENNA 1IV6A 5M3MJ 1X4PA 1WQ2A 4C2MJ 3CF5F 1W5TA 5DCMB 2K5CA 2DPDA 1T39A 1FOXA 1KU2A 2M5WA 3TMOA 3H9JA 2H1LA 3W6JB 4UUSA 4BHPA 3V7CA 2HU9A 2R5YA 4G6TB 4V19K 5FFZA 1MBKA 5D6FA 2X6XA 3G4SI 1H0MA 5CYVA 2E7WA 2YUSA 2ADUA 4ZJZA 2N8GA 2P5LC 4CCMA 4F55A 4HNVA 2V6EA 5HS8A 2F5FA 3TDZC 2OZUA 5IYBJ 5M5YJ 1ZKGA 1RETA 3QOEA 4DYCA 3BR6A 1XCVA 5HNHA 3ZQLA 1ODDA 3OS0A 1ZG3A 2EWNA 3QQAA 5ED4A 3LAJA 5BMZA 3LSTA 4XKBA 2LC2A 3W2AA 2YPRA 3HOYJ 2OJED 1S8NA 4BEHA 1MJAA 3ZN1A 1FPQA 5KVRA 2G0EA 3UR3C 5FB2A 4M6YA 1XCBA 1ZREA 1GV5A 2AQEA 4ZZLA 4ZDOA 2LNBA 3FWEA 4LK0F 1GVJA 1IUYA 1FWZA 4BY1J 4AC0A 4E7JA 2PJRB 4RGUA 3GZ5A 4KN7X 1F4KA 4XNFA 3NEUA 4IRGA 3ZMUA 4DYQA 1FJLA 1KZHA 5EG0A 1MW7A 1DGRM 2XRLA 1IRZA 2X1DA 1W5SA 3KP4A 2CV1A 2K9MA 4DJAA 3I54A 1WKMA 4JK1X 1KA8A 3FF5A 3FXOA 1F1ZA 5DTDA 3I59B 4KIGA 4A3MJ 1WFXA 3KP6A 2VQCA 1QVUA 2DA3A 2ZMEC 4G7HF 3ULQB 5F6FA 1SFEA 4CSWA 3F22A 1BC7C 2IW5A 1KQ9A 2ID6A 1B72B 5EYRA 3OIOA 4EEFG 3CCYA 4BBRJ 1CF7B 2JT1A 3IKVA 4A5MA 3CO6C 3JCUC 2GAUA 1ETXA 4HF0A 2BXYA 5AIQA 2L3DA 3S1QJ 3FBNB 3KEOA 3LA7A 2HDWA 5CQGA 2R0QC 3KPHA 3S14J 3RIRA 4RM2A 4B4CA 2QEXI 1WI9A 4HF1A 1MDMA 2MC3A 4FX4A 3DEEA 2CUEA 1FC3A 2DFEA 2HQRA 4ESFA 2AO9A 3ROUA 1OLTA 3QYBA 3VYTB 1IXSB 3GFJA 3H3ZA 4B1RA 1PP8F 2O5RA 4BXFA 1NK3P 2P7CB 2UV1A 3LFKA 5DCMA 4D9JA 1XSVA 2KIQA 1JHHA 3GX4X 1ONVA 3HOTA 3L2UA 4XBFA 2HVRA 3HPGA 1X3WB 1AOYA 1RIOH 2VOPA 2QUFA 3H35A 2BXZA 4F3QA 1YOVB 5L3DA 4II3A 2WB1N 4EM2A 4C2TA 1MGTA 2FBHA 3HOZJ 4C3HJ 3ZMTA 2MYSA 3LSRA 1ULYA 1YIJI 4PGHA 5HS7A 2GA2A 1FY7A 1ACIA 1YS7A 5C4XJ 2COMA 2IT0A 1OKRA 1LVAA 1X3ZB 1BIAA 4HW0A 1OPCA 5DEQA 2A05A 2MLGA 1Z7LA 3HJEA 2EV0A 4NDLA 4PSWA 4RA2A 1TC3C 4XLNF 1PYVA 4LB5A 3MQ0A 3CJRB 3TOBA 1O3RA 1DPRA 2IXSA 2WV1A 4FTHA 1U78A 1FLIA 1U5TC 3CC2I 2EA2A 1BR2A 5KAIC 1U8BA 1ZGJA 2DYSH 3J81Z 2H6BA 4I76A 2OF7A 1NK2P 3IP4B 1G4DA 4JOMA 4ZYDA 1P6RA 4C9YA 5LEJA 2ELJA 3U1KA 1JKRC 4IQ4A 1FNNA 4U0YA 2EJRA 1OYWA 2V1NA 1BJAA 3H5AA 3I59A 3VSLA 4C30A 3E6MA 1SFXA 3I56I
chains in the Genus database with same CATH topology
2WWYA 3IC7A 1U3EM 3HSEA 2VOOA 1CF7A 3RJPA 3K2ZA 2DW4A 1S7OA 2JRTA 4AD9A 1QQIA 4G94A 4U0VA 1YW8A 1Z6TA 3IWZA 1USTA 1KU9A 3U9GA 2VE8A 4CDGA 3F23A 3PQKA 3VEPA 3W6KB 2RN7A 3RKYA 5BOXA 3JAMZ 5EEHA 3F6VA 4ENJA 3MZYA 3O2PE 4RAZA 2P7VB 3LWFA 5D5XB 1KYZA 4UUVA 1FT9A 2O3FA 3GO5A 1P4XA 3V4GA 4A5NA 3MWMA 4P96A 4GGGA 2XASA 2XHKA 4LFUA 1ZGAA 3LQQA 5BPIA 1W7PB 2KRFA 5D8KB 2EFOA 5CVVA 4EVIA 3WGIA 1RNLA 3HIFA 3B73A 3IRRA 2Z9OA 4A6DA 3BDDA 1QGPA 1YQAA 1G3WA 4OIRF 4OOIA 3P9IA 4RB2C 5LGTA 4KN4X 5A2QZ 5ICFA 2AS5F 3P9KA 3RPUA 5L3FA 2JTVA 4IHSA 1IN8A 2XV4S 2HZTA 4XSXF 4KIFA 3DP7A 4LK1F 2XGXA 4HOBA 1K7AA 2FOKA 4HX7A 1E2XA 2XAGA 5E17F 3S2WA 3G3ZA 2CYYA 2Y0MA 3TOAA 3DEUA 3J80K 2CFXA 4U7BA 3U2RA 4P55A 2ZNZA 3T0YA 4R79A 3ZQ7A 3C18A 1ZHFA 2VODA 4ZH4F 3QU3A 4L5JA 2V6CA 3WE2A 4MTEA 1R5GA 2RVCA 3HRMA 5H6RA 1GXPA 2K02A 3ECHA 3SZTA 3C3WA 2V79A 2CG4A 4L0YB 1C0WA 4I0AA 1K79A 5E20A 3WTXC 2HGCA 3SQNA 2PI0A 4M74A 3GF2A 2ZXJA 1B59A 1JE8A 3MFKA 5L3BA 4G9YA 1P2FA 5DD8A 2F2EA 1HKTA 2X4HA 2Z99A 4QLCU 1QPMA 3KP5A 4MGRA 1FSHA 2F5DA 3SZPA 1TW2A 3K1MA 4A0YA 1FBQA 5E1ZB 1LJ9A 2VN2A 4KICA 4EV0A 4A2UA 2HDCA 3CO7C 5A2QK 3R61A 2WTEA 2QLZA 4NB5A 4EM1A 4A0XA 3KLOA 4FHTA 4I0BA 1R00A 3LAPA 3PQJA 4YIFA 4CZZA 2NAZA 2OBPA 2VT2A 2QBYB 2A61A 3QPHA 2E1CA 4IPAA 2OU2A 2ZFWA 3TDUC 4GCVA 2BEOA 3GFIA 3IRQA 1HQCA 3KP3A 3GVAA 1YIOA 3WGHA 1IN6A 4HZFA 3LQRA 1TQMA 2PLYA 4I02A 3WE3A 3E5QA 2FMLA 2XAFA 2VBZA 4ASNA 2YSRA 3FM3A 4K2EA 4M73A 4ESBA 2M30A 1QZZA 2C6YA 4Q47A 2DQRA 4EJWA 1O3SA 1T0FA 3QPTA 5HS9A 5FO5A 1OR7A 2W57A 1XN7A 5FLXZ 3HTUA 1G3YA 2VC1A 5LEKA 2L4AA 2IJLA 1MZBA 2ISZA 2UXXA 2FU4A 3TO9A 3MCZA 4HX4A 1SMYF 4LD5A 4G7ZF 4AIHA 2EV5A 3HSRA 3P7NA 4UV9A 1ON1A 4Q5SF 2CW0F 4BHCA 3RTRA 4U0WA 1UHWA 3SHFA 5LBQA 1B9MA 3BJ6A 5EEGA 1W7PD 3F21A 3L00A 1ZH5A 4WWCA 4HLYA 1DDNA 2NYXA 5HLIA 5JI6A 5ILSA 2QQAA 3IL2A 2FEZA 3QRFF 1J59A 1XSDA 4OMZA 4RB1A 2W24A 1ZLKA 1KQ0A 3EQLF 3R0JA 4L0ZB 2OZ6A 1YW9A 2QBYA 2ESNA 4RGXA 4HV5A 3WTZA 3FZVA 5HOOA 1ZRDA 1S7AA 4KMUX 3GWZA 2OQRA 3GUDA 2FA5A 4L9VA 3DFGA 1JHFA 2ZBKA 3DQVC 3DXJF 4LLGF 4E70A 1XDSA 1KYWA 4MTDA 2L4MA 1VTNC 5FD6A 1LB2A 2ZMEB 4Q4ZF 1HXDA 4M9XA 3HYIA 3CLOA 2NNYA 5H20A 5DD4A 3HSFA 3WG9A 1BN5A 2W25A 2CGPA 1U2WA 5J8CA 2IRFG 4CICA 1X3UA 3O3KA 3F8MA 5FD5A 3WGGA 1R1TA 2VT3A 1KU7A 1EH6A 3E3VA 4IXAA 4MQVA 2DAOA 2Z5UA 2CO5A 3FXRA 3KETA 5ILUA 1U8RA 1DPUA 5DCFA 1IAWA 1R5HA 1L3LA 1SAXA 1XGNA 5FLXK 1OYIA 2DPUA 2XKPA 3C1DA 4CXFA 3KZZA 4Q48A 1E17A 2H27A 3RDIA 1V4RA 3ELKA 2HYFA 1U5TB 3RKWA 4JQFA 1FBUA 3E97A 3T8TA 1IXCA 1MKMA 3J7AO 1H9TA 4N9HA 4ZYEA 1K6OA 1Q1HA 1KU3A 3GZ6A 4L18B 4EGZA 3AAFA 4BHBA 1YW7A 4WXCA 5LGUA 4RGSA 3RPQA 5J6XA 3I58A 4IHTA 4KIBA 4DQ2A 2W84A 4HDUA 2L01A 1XGMA 1J0RA 3OV8A 3ISPA 5HLHA 4QWQA 1O57A 1Z91A 1I1SA 4I7HA 2LF7A 5LHGA 1HW2A 5TRDA 4OINF 4UNOA 5K5OA 1H9GA 4WXHA 1FYLA 1LQ1A 4HDVA 2JSCA 3ZMDA 2J5PA 4EMSA 1FX7A 5HVQC 4WF2A 2PJPA 1EH8A 5LGNA 2V1DA 2DI3A 3N97A 1RI7A 4S05A 1J2XA 3DKWA 2EK5A 3SXYA 2H6CA 4BAYA 3T5XA 4Z2YA 1STZA 2Q0OA 1UB9A 3F3XA 1P4WA 4IJAA 4LB6B 2XRNA 3J80Z 1SD7A 1R1UA 4GO1A 5BPDA 5H6QA 2V1XA 5FFXA 4N0BA 4YFKF 3E6CC 3JTHA 1ZLJA 4G8XA 2FBKA 4YG2F 2WC2A 1RUOA 1ZRFA 1TQIA 2FBIA 2VE9A 2BBYA 1EH7A 2A3SA 3SFZA 1O3QA 2J5OA 4ZZDA 2OQGA 3CTAA 4AIKA 4IRHA 2O61A 2AXLA 2B0LA 4OU0A 5IT3A 2XVCA 1XDUA 4KDPA 1U6GA 1D3YA 4RAYA 2GQQA 1TW3A 4O6JA 2Z33A 3DPLC 1A04A 2VC0A 1B6AA 5LHIA 5LHHA 1HSJA 3ABTA 4TV7A 1BJAA 1F5TA 2BV6A 4XLPF 1HW5A 2HS5A 1S3JA 1IW7F 1FYMA 3WTWC 3K9TA 4KYWA 5L3EA 2DTRA 3BP8A 1P4AA 4MHGA 3TGNA 2L54A 1I5ZA 4JBAA 2LDUA 3WU1B 1TBXA 3ZN0A 4S04A 1IRFA 5F64A 2MLKA 2DFIA 1BM9A 1HKSA 2A6HF 2V9VA 3K1PA 4ENKA 1IF1A 5BS6A 2A07F 1KGSA 3RYPA 4L9TA 3CJNA 2UWMA 4LMYA 4HF2A 3IKTA 4M72A 4B8XA 1R22A 5JFRA 3T1BA 2MD5A 4UHTA 3BZ6A 2F5CA 1XGSA 1BI3A 3M7GA 2UXNA 2R3SA 3BOQA 4PCQA 3MAJA 5HDKA 1O3TA 2ETHA 3HOSA 2DK8A 2QQBA 3MEXA 2EV6A 1S29A 2D1HA 4HA8A 2EFNA 1OMIA 5ILVA 2OAZA 3HRUA 4GXOA 1QZYA 3K69A 1J9IA 1WRJA 1I27A 2Q2EA 2OD5A 4Y15A 3FMRA 5CJ9A 3F8BA 2O6GE 2NRAC 3WTUC 4ZYGA 1R1VA 1W7PA 1PDNC 3GFLA 3ECOA 3V7RA 1IRGA 4LG0B 3M8FA 2HTSA 3Q5FA 5LLQA 2M8EA 2RKHA 5K5QA 5ICGA 3I0TA 2TDXA 4EJVA 1LDDA 1ZAOA 1AWCA 3BPVA 2XKOA 1ZG1A 2XAQA 4UVAA 3JTGA 1G3TA 1QNTA 3I53A 2HEOA 2UZKA 4R1HA 4BXUA 2RNJA 2JPBA 4YIIA 5D8LB 2QENA 4EM0B 5D5WB 1SD4A 3V8JA 4WK8F 1SMTA 1BBYA 1XB4A 3IWFA 5JVTA 2G7HA 4L5IA 2FXAA 1JXSA 2ZCWA 2XUBA 2ELHA 3B02A 5CLSA 2LF8A 3HUGA 3CUQB 4EJUA 2QVOA 2OA4A 4OIOF 3REOA 4ETSA 3D0SA 2VBXA 2PG4A 1JGSA 4NHJA 3F72A 1IN4A 3RKXA 4KMFA 2GXBA 4DNCA 2EB7A 4LLNA 1L0OC 4BYYA 1LEBA 2PMHA 2ZO4A 4KFCA 2LKPA 4G7OF 2V1UA 3GEZA 5LRRA 1J7KA 3EYYA 2H94A 2ISYA 4UXNA 4BH9A 2A68F 2DT5A 3FHZA 1D5VA 4OIPF 3D5LA 3ABUA 4HYEA 3I5UA 4MQ9F 3WTTC 2FSWA 5IT9K 2H09A 3CDHA 4CYDA 1BI1A 4WXDA 3EUHA 1Z9CA 1ZRCA 3DF8A 3C7JA 1FP2A 3KE2A 2FE3A 3NRVA 1DP7P 5HDGA 1EV7A 4AIJA 2M45A 4MEXF 4MEYF 3KCCA 2G9WA 3M8EA 3H92A 2RQPA 2X0LA 2P6TA 4FT8A 3CUQA 1SFUA 1YO5C 2RDPA 3FX3A 3FM5A 3KP2A 1PUEE 2G7UA 4R8HA 1ZN2A 1IZ1A 1W4MA 2IP2A 4BNCA 4Y13A 3QP6A 3LA3A 3BJAA 5CVIA 4LGWA 2P5KA 2ZKZA 4CO8A 1LEAA 4HX8A 4ON0A 4G6DA 2FNAA 2NNNA 3BWGA 3GLXA 5DYMA 2WV0A 2PEXA 4HAMA 2MH2A 2MH9A 2K4JA 2HKXA 3BJOA 1RZ4A 5FGMA 4LLLA 1TNTA 1UCRA 1R58A 2RV8A 1TLHB 2JPCA 4NQWA 2CSOA 2PBIA 2IA1A 4UVCA 2HYGD 1YLFA 1T2KA 5L3GA 5DV5A 1MJ9A 3L7WA 2Y75A 4I09A 4P5OA 3GXOA 3R0AA 1ZARA 2FQ3A 1R23A 3ML6A 3QAHA 1Z7UA 3N4MA 2KJCA 1S6LA 3M9AA 5J8FA 4MNUA 3BROA 5DUKA 2STTA 1NHAA 1IN5A 2YU3A 5E1WA 2ZMEA 4A12A 3VB2A 5F1RA 3V8KA 2P5VA 3KZYA 4A0ZA 2F5EA 2XAJA 4I2OA 3Q9SA 5E1XA 4XSZF 1B1BA 1OYYA 2D1VA 4N9IA 2K4BA 2FF4A 2KKOA 3F8FA 4RS8A 2MBFA 2A69F 1G6NA 2NS0A 3KFWX 4I01A 3COAC 2HKOA 1K78B 3HTSB 3K1NA 3G73A 4YFNF 2STWA 5TJJA 1P92A 4M71A 2XAHA 1J75A 4IF4A 1LNWA 5D4RA 1G3SA 2A5YB 3E5UA 1D8KA 1XMKA 1XMAA 3HRTA 2DLLA 1U5TA 2DO7A 1SD6A 3HHGA 2P4WA 3ZMVA 1QBJA 3NQOA 3P9CA 4ESJA 1TNSA 1IXRC 4PGGA 2YX4A 4RB0A 2E1NA 1BIBA 3R6SA 1ZYRF 3TO7A 1ZG5A 3JSOA 4U7DA 1BC8C 1D8JA 5E8GA 3IHUA 1BI2A 1YTYA 2L02A 3VOEA 4HLXA 2GA1A 3FMSA 4KT5C 2ACJA 3GFMA 2FNPA 1QO0D 3Q9VA 4OMYA 3WTVC 3O6BB 1MJBA 3R4KA 2W85A 4P9FA 2HFHA 3ZP5A 1PP7U 3F6OA 5K5RA 1LDKB 1YS6A 5DUIA 1Z1DA 5D6EA 1XD7A 3BPXA 2HOEA 2ZJ2A 4UVBA 1MD0A 2QQ9A 1XGOA 4BQAA 1K78A 3V8LA 2EA4A 2P6SA 2O8XA 2IA0A 2PQ8A 2EFQA 3F8NA 2RGVA 1Z05A 2D2WA 4RGRA 1O7LA 1R36A 2KIFA 3KLNA 4KUMA 2R7DA 3L09A 4EGYA 2D45A 3FXUA 4F7ZA 2O03A 1I6XA 4AWXB 2QZ8A 5CVUA 3GYHX 3PFIA 2A6EF 4Y17A 2HQNA 1HSTA 2K86A 1F9NA 1HW1A 2DBBA 1WWXA 2VBYA 1USSA 1UFMA 2GXGA 4L9JA 2RC4A 4PZJA 3ZMSA 4M9ZA 2IPQX 3HRSA 3RI4A 2JZYA 3DPTA 2GZWA 4EQQA 3R60A 5HLGA 4O5VA 4EJTA 3MZHA 2CWEA 4A6EA 3J81K 5JR3A 2KIMA 4WX9A 3WTYC 2O0YA 3I64A 5E8IA 2GIVA 2ZNYA 2VXZA 3E6DA 4U88A 3TO6A 3QP5A 4ZYHA 2EFWA 1KQ8A 2BGCA 4ENMA 1BI0A 1DUXC 3LA2A 3BY6A 3L9FA 1O7FA 4AVPA 2M1BA 3JW4A 3U1DA 2LSOA 4KA4A 1J5YA 4B09A 3JAMK 2VBWA 4YFXF 4GYIA 2GWRA 3ZPLA 4IRIA 4EJOA 4P9UA 5LRSA 5IT9Z 2QM3A 4M6XA 1FOKA 3FXQA 5ICEA 4PDKA 2QWWA 3VODA 5L3CA 4IVNA 4FX0A 3L2CA 1LDJA 2KJBA 4XRFA 2K27A 1FZPB 4M9SA 3QOPA 2YR2A 4G6QA 3I4PA 1YG2A 2FMYA 5HDNA 5ICCA 5KK1A 4WCGA 2M87A 5JHUA 3T8RA 4CHUA 1IN7A 3EETA 1REPC 4CGZA 1GXQA 1HKQA 3F8CA 2K7LA 3GW2A 3E5XA 2PN6A 4L9NA 1BOAA 4LJZF 2DU9A 3DV8A 1UHMA 1GHCA 1V3FA 2BYVE 2PFBA 1ON2A 3TKYA 4HBLA 3EYIA 4LG0A 3EDPA 1Y0UA 2KIUA 4H0EA 1HBXG 3KP7A 2FRHA 2PMUA 2DK5A 3HHHA 2HTJA 1SD5A 1CGPA 1FP1D 2HR3A 2QYOA 4I98B 1T98A 2BE5F 5AONA 3K0LA 5BQTA 2Q8KA 6PAXA 2Z3YA 3TQNA 5D4SA 2XROA 5DDGA 5D5VB 2R7FA 3M1EA 4UV8A 1FBSA 1B4AA 1T6SA 2DQLA 3FMQA 2XIGA 5K1YA 1WSUA 4OIQF 2ESHA 4HQEA 1RUNA 3JSPA 4D0PA 2EFPA 1TTYA 5D5UB 2E7XA 1FYKA 3VFZA 4GYGA 3E6BA 4HQMA 2P8TA 3WODF 2IVMA 2IA2A 3WTSC 1Z6RA 1FSEA 3H3UA 5E18F 1XSXA 2HWVA 3CUQC 5AIPA 1R7JA 5CVJA 2VONA 2YX7A 5ERIA 1TQPA 1YFHA 3OOPA 2Y48A 3ZMZA 3V7SA 1T38A 3RYRA 4RB3C 3QU6A 4KNYA 5CVRA 3CUOA 4HV6A 2CQKA 2MA3A 1I1GA 1YYVA 4O3MA 1MDMB 3KEQA 1B9NA 3I71A 3ERED 4ENNA 1WQ2A 1W5TA 5DCMB 2DPDA 1T39A 1KU2A 2M5WA 3W6JB 4BHPA 3V7CA 5FFZA 5D6FA 1H0MA 5CYVA 2E7WA 2ADUA 2P5LC 5HS8A 2F5FA 3TDZC 2OZUA 1XCVA 1ODDA 1ZG3A 2EWNA 5ED4A 3LAJA 5BMZA 3LSTA 2YPRA 1S8NA 1MJAA 3ZN1A 1FPQA 5KVRA 5FB2A 4M6YA 1XCBA 1ZREA 4ZZLA 2LNBA 3FWEA 4LK0F 1GVJA 1IUYA 1FWZA 4RGUA 3GZ5A 4KN7X 1F4KA 3NEUA 4IRGA 3ZMUA 1W5SA 3KP4A 3I54A 1WKMA 4JK1X 1KA8A 3FF5A 1F1ZA 3I59B 4KIGA 3KP6A 4G7HF 3ULQB 5F6FA 1SFEA 3F22A 1BC7C 2IW5A 1KQ9A 1CF7B 2JT1A 3IKVA 4A5MA 3CO6C 2GAUA 4HF0A 5AIQA 2L3DA 3KEOA 3LA7A 3RIRA 4HF1A 1WI9A 1MDMA 2MC3A 4FX4A 1FC3A 2HQRA 4ESFA 3ROUA 1IXSB 3GFJA 3H3ZA 1PP8F 2P7CB 3LFKA 5DCMA 1XSVA 1JHHA 3GX4X 1ONVA 3HOTA 4XBFA 1AOYA 1RIOH 2QUFA 5L3DA 4EM2A 1MGTA 2FBHA 3ZMTA 1ULYA 4PGHA 5HS7A 2GA2A 1FY7A 1YS7A 2COMA 2IT0A 1OKRA 1LVAA 1BIAA 4HW0A 1OPCA 5DEQA 2MLGA 2EV0A 4XLNF 4LB5A 3MQ0A 3TOBA 1O3RA 1DPRA 1U78A 1FLIA 1U5TC 2EA2A 1ZGJA 3J81Z 2H6BA 1G4DA 4ZYDA 1P6RA 5LEJA 1FNNA 4U0YA 2EJRA 1OYWA 3I59A 3WU0A 2VOPA 3E6MA 1SFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWY A;  3IC7 A;  1U3E M;  3HSE A;  2VOO A;  1CF7 A;  3RJP A;  3K2Z A;  2DW4 A;  1S7O A;  2JRT A;  4AD9 A;  1QQI A;  4G94 A;  4U0V A;  1YW8 A;  1Z6T A;  3IWZ A;  1UST A;  1KU9 A;  3U9G A;  2VE8 A;  4CDG A;  3F23 A;  3PQK A;  3VEP A;  3W6K B;  2RN7 A;  3RKY A;  5BOX A;  3JAM Z;  5EEH A;  3F6V A;  4ENJ A;  3MZY A;  3O2P E;  4RAZ A;  2P7V B;  3LWF A;  5D5X B;  1KYZ A;  4UUV A;  1FT9 A;  2O3F A;  3GO5 A;  1P4X A;  3V4G A;  4A5N A;  3MWM A;  4P96 A;  4GGG A;  2XAS A;  2XHK A;  4LFU A;  1ZGA A;  3LQQ A;  5BPI A;  1W7P B;  2KRF A;  5D8K B;  2EFO A;  5CVV A;  4EVI A;  3WGI A;  1RNL A;  3HIF A;  3B73 A;  3IRR A;  2Z9O A;  4A6D A;  3BDD A;  1QGP A;  1YQA A;  1G3W A;  4OIR F;  4OOI A;  3P9I A;  4RB2 C;  5LGT A;  4KN4 X;  5A2Q Z;  5ICF A;  2AS5 F;  3P9K A;  3RPU A;  5L3F A;  2JTV A;  4IHS A;  1IN8 A;  2XV4 S;  2HZT A;  4XSX F;  4KIF A;  3DP7 A;  4LK1 F;  2XGX A;  4HOB A;  1K7A A;  2FOK A;  4HX7 A;  1E2X A;  2XAG A;  5E17 F;  3S2W A;  3G3Z A;  2CYY A;  2Y0M A;  3TOA A;  3DEU A;  3J80 K;  2CFX A;  4U7B A;  3U2R A;  4P55 A;  2ZNZ A;  3T0Y A;  4R79 A;  3ZQ7 A;  3C18 A;  1ZHF A;  2VOD A;  4ZH4 F;  3QU3 A;  4L5J A;  2V6C A;  3WE2 A;  4MTE A;  1R5G A;  2RVC A;  3HRM A;  5H6R A;  1GXP A;  2K02 A;  3ECH A;  3SZT A;  3C3W A;  2V79 A;  2CG4 A;  4L0Y B;  1C0W A;  4I0A A;  1K79 A;  5E20 A;  3WTX C;  2HGC A;  3SQN A;  2PI0 A;  4M74 A;  3GF2 A;  2ZXJ A;  1B59 A;  1JE8 A;  3MFK A;  5L3B A;  4G9Y A;  1P2F A;  5DD8 A;  2F2E A;  1HKT A;  2X4H A;  2Z99 A;  4QLC U;  1QPM A;  3KP5 A;  4MGR A;  1FSH A;  2F5D A;  3SZP A;  1TW2 A;  3K1M A;  4A0Y A;  1FBQ A;  5E1Z B;  1LJ9 A;  2VN2 A;  4KIC A;  4EV0 A;  4A2U A;  2HDC A;  3CO7 C;  5A2Q K;  3R61 A;  2WTE A;  2QLZ A;  4NB5 A;  4EM1 A;  4A0X A;  3KLO A;  4FHT A;  4I0B A;  1R00 A;  3LAP A;  3PQJ A;  4YIF A;  4CZZ A;  2NAZ A;  2OBP A;  2VT2 A;  2QBY B;  2A61 A;  3QPH A;  2E1C A;  4IPA A;  2OU2 A;  2ZFW A;  3TDU C;  4GCV A;  2BEO A;  3GFI A;  3IRQ A;  1HQC A;  3KP3 A;  3GVA A;  1YIO A;  3WGH A;  1IN6 A;  4HZF A;  3LQR A;  1TQM A;  2PLY A;  4I02 A;  3WE3 A;  3E5Q A;  2FML A;  2XAF A;  2VBZ A;  4ASN A;  2YSR A;  3FM3 A;  4K2E A;  4M73 A;  4ESB A;  2M30 A;  1QZZ A;  2C6Y A;  4Q47 A;  2DQR A;  4EJW A;  1O3S A;  1T0F A;  3QPT A;  5HS9 A;  5FO5 A;  1OR7 A;  2W57 A;  1XN7 A;  5FLX Z;  3HTU A;  1G3Y A;  2VC1 A;  5LEK A;  2L4A A;  2IJL A;  1MZB A;  2ISZ A;  2UXX A;  2FU4 A;  3TO9 A;  3MCZ A;  4HX4 A;  1SMY F;  4LD5 A;  4G7Z F;  4AIH A;  2EV5 A;  3HSR A;  3P7N A;  4UV9 A;  1ON1 A;  4Q5S F;  2CW0 F;  4BHC A;  3RTR A;  4U0W A;  1UHW A;  3SHF A;  5LBQ A;  1B9M A;  3BJ6 A;  5EEG A;  1W7P D;  3F21 A;  3L00 A;  1ZH5 A;  4WWC A;  4HLY A;  1DDN A;  2NYX A;  5HLI A;  5JI6 A;  5ILS A;  2QQA A;  3IL2 A;  2FEZ A;  3QRF F;  1J59 A;  1XSD A;  4OMZ A;  4RB1 A;  2W24 A;  1ZLK A;  1KQ0 A;  3EQL F;  3R0J A;  4L0Z B;  2OZ6 A;  1YW9 A;  2QBY A;  2ESN A;  4RGX A;  4HV5 A;  3WTZ A;  3FZV A;  5HOO A;  1ZRD A;  1S7A A;  4KMU X;  3GWZ A;  2OQR A;  3GUD A;  2FA5 A;  4L9V A;  3DFG A;  1JHF A;  2ZBK A;  3DQV C;  3DXJ F;  4LLG F;  4E70 A;  1XDS A;  1KYW A;  4MTD A;  2L4M A;  1VTN C;  5FD6 A;  1LB2 A;  2ZME B;  4Q4Z F;  1HXD A;  4M9X A;  3HYI A;  3CLO A;  2NNY A;  5H20 A;  5DD4 A;  3HSF A;  3WG9 A;  1BN5 A;  2W25 A;  2CGP A;  1U2W A;  5J8C A;  2IRF G;  4CIC A;  1X3U A;  3O3K A;  3F8M A;  5FD5 A;  3WGG A;  1R1T A;  2VT3 A;  1KU7 A;  1EH6 A;  3E3V A;  4IXA A;  4MQV A;  2DAO A;  2Z5U A;  2CO5 A;  3FXR A;  3KET A;  5ILU A;  1U8R A;  1DPU A;  5DCF A;  1IAW A;  1R5H A;  1L3L A;  1SAX A;  1XGN A;  5FLX K;  1OYI A;  2DPU A;  2XKP A;  3C1D A;  4CXF A;  3KZZ A;  4Q48 A;  1E17 A;  2H27 A;  3RDI A;  1V4R A;  3ELK A;  2HYF A;  1U5T B;  3RKW A;  4JQF A;  1FBU A;  3E97 A;  3T8T A;  1IXC A;  1MKM A;  3J7A O;  1H9T A;  4N9H A;  4ZYE A;  1K6O A;  1Q1H A;  1KU3 A;  3GZ6 A;  4L18 B;  4EGZ A;  3AAF A;  4BHB A;  1YW7 A;  4WXC A;  5LGU A;  4RGS A;  3RPQ A;  5J6X A;  3I58 A;  4IHT A;  4KIB A;  4DQ2 A;  2W84 A;  4HDU A;  2L01 A;  1XGM A;  1J0R A;  3OV8 A;  3ISP A;  5HLH A;  4QWQ A;  1O57 A;  1Z91 A;  1I1S A;  4I7H A;  2LF7 A;  5LHG A;  1HW2 A;  5TRD A;  4OIN F;  4UNO A;  5K5O A;  1H9G A;  4WXH A;  1FYL A;  1LQ1 A;  4HDV A;  2JSC A;  3ZMD A;  2J5P A;  4EMS A;  1FX7 A;  5HVQ C;  4WF2 A;  2PJP A;  1EH8 A;  5LGN A;  2V1D A;  2DI3 A;  3N97 A;  1RI7 A;  4S05 A;  1J2X A;  3DKW A;  2EK5 A;  3SXY A;  2H6C A;  4BAY A;  3T5X A;  4Z2Y A;  1STZ A;  2Q0O A;  1UB9 A;  3F3X A;  1P4W A;  4IJA A;  4LB6 B;  2XRN A;  3J80 Z;  1SD7 A;  1R1U A;  4GO1 A;  5BPD A;  5H6Q A;  2V1X A;  5FFX A;  4N0B A;  4YFK F;  3E6C C;  3JTH A;  1ZLJ A;  4G8X A;  2FBK A;  4YG2 F;  2WC2 A;  1RUO A;  1ZRF A;  1TQI A;  2FBI A;  2VE9 A;  2BBY A;  1EH7 A;  2A3S A;  3SFZ A;  1O3Q A;  2J5O A;  4ZZD A;  2OQG A;  3CTA A;  4AIK A;  4IRH A;  2O61 A;  2AXL A;  2B0L A;  4OU0 A;  5IT3 A;  2XVC A;  1XDU A;  4KDP A;  1U6G A;  1D3Y A;  4RAY A;  2GQQ A;  1TW3 A;  4O6J A;  2Z33 A;  3DPL C;  1A04 A;  2VC0 A;  1B6A A;  5LHI A;  5LHH A;  1HSJ A;  3ABT A;  4TV7 A;  1BJA A;  1F5T A;  2BV6 A;  4XLP F;  1HW5 A;  2HS5 A;  1S3J A;  1IW7 F;  1FYM A;  3WTW C;  3K9T A;  4KYW A;  5L3E A;  2DTR A;  3BP8 A;  1P4A A;  4MHG A;  3TGN A;  2L54 A;  1I5Z A;  4JBA A;  2LDU A;  3WU1 B;  1TBX A;  3ZN0 A;  4S04 A;  1IRF A;  5F64 A;  2MLK A;  2DFI A;  1BM9 A;  1HKS A;  2A6H F;  2V9V A;  3K1P A;  4ENK A;  1IF1 A;  5BS6 A;  2A07 F;  1KGS A;  3RYP A;  4L9T A;  3CJN A;  2UWM A;  4LMY A;  4HF2 A;  3IKT A;  4M72 A;  4B8X A;  1R22 A;  5JFR A;  3T1B A;  2MD5 A;  4UHT A;  3BZ6 A;  2F5C A;  1XGS A;  1BI3 A;  3M7G A;  2UXN A;  2R3S A;  3BOQ A;  4PCQ A;  3MAJ A;  5HDK A;  1O3T A;  2ETH A;  3HOS A;  2DK8 A;  2QQB A;  3MEX A;  2EV6 A;  1S29 A;  2D1H A;  4HA8 A;  2EFN A;  1OMI A;  5ILV A;  2OAZ A;  3HRU A;  4GXO A;  1QZY A;  3K69 A;  1J9I A;  1WRJ A;  1I27 A;  2Q2E A;  2OD5 A;  4Y15 A;  3FMR A;  5CJ9 A;  3F8B A;  2O6G E;  2NRA C;  3WTU C;  4ZYG A;  1R1V A;  1W7P A;  1PDN C;  3GFL A;  3ECO A;  3V7R A;  1IRG A;  4LG0 B;  3M8F A;  2HTS A;  3Q5F A;  5LLQ A;  2M8E A;  2RKH A;  5K5Q A;  5ICG A;  3I0T A;  2TDX A;  4EJV A;  1LDD A;  1ZAO A;  1AWC A;  3BPV A;  2XKO A;  1ZG1 A;  2XAQ A;  4UVA A;  3JTG A;  1G3T A;  1QNT A;  3I53 A;  2HEO A;  2UZK A;  4R1H A;  4BXU A;  2RNJ A;  2JPB A;  4YII A;  5D8L B;  2QEN A;  4EM0 B;  5D5W B;  1SD4 A;  3V8J A;  4WK8 F;  1SMT A;  1BBY A;  1XB4 A;  3IWF A;  5JVT A;  2G7H A;  4L5I A;  2FXA A;  1JXS A;  2ZCW A;  2XUB A;  2ELH A;  3B02 A;  5CLS A;  2LF8 A;  3HUG A;  3CUQ B;  4EJU A;  2QVO A;  2OA4 A;  4OIO F;  3REO A;  4ETS A;  3D0S A;  2VBX A;  2PG4 A;  1JGS A;  4NHJ A;  3F72 A;  1IN4 A;  3RKX A;  4KMF A;  2GXB A;  4DNC A;  2EB7 A;  4LLN A;  1L0O C;  4BYY A;  1LEB A;  2PMH A;  2ZO4 A;  4KFC A;  2LKP A;  4G7O F;  2V1U A;  3GEZ A;  5LRR A;  1J7K A;  3EYY A;  2H94 A;  2ISY A;  4UXN A;  4BH9 A;  2A68 F;  2DT5 A;  3FHZ A;  1D5V A;  4OIP F;  3D5L A;  3ABU A;  4HYE A;  3I5U A;  4MQ9 F;  3WTT C;  2FSW A;  5IT9 K;  2H09 A;  3CDH A;  4CYD A;  1BI1 A;  4WXD A;  3EUH A;  1Z9C A;  1ZRC A;  3DF8 A;  3C7J A;  1FP2 A;  3KE2 A;  2FE3 A;  3NRV A;  1DP7 P;  5HDG A;  1EV7 A;  4AIJ A;  2M45 A;  4MEX F;  4MEY F;  3KCC A;  2G9W A;  3M8E A;  3H92 A;  2RQP A;  2X0L A;  2P6T A;  4FT8 A;  3CUQ A;  1SFU A;  1YO5 C;  2RDP A;  3FX3 A;  3FM5 A;  3KP2 A;  1PUE E;  2G7U A;  4R8H A;  1ZN2 A;  1IZ1 A;  1W4M A;  2IP2 A;  4BNC A;  4Y13 A;  3QP6 A;  3LA3 A;  3BJA A;  5CVI A;  4LGW A;  2P5K A;  2ZKZ A;  4CO8 A;  1LEA A;  4HX8 A;  4ON0 A;  4G6D A;  2FNA A;  2NNN A;  3BWG A;  3GLX A;  5DYM A;  2WV0 A;  2PEX A;  4HAM A;  2MH2 A;  2MH9 A;  2K4J A;  2HKX A;  3BJO A;  1RZ4 A;  5FGM A;  4LLL A;  1TNT A;  1UCR A;  1R58 A;  2RV8 A;  1TLH B;  2JPC A;  4NQW A;  2CSO A;  2PBI A;  2IA1 A;  4UVC A;  2HYG D;  1YLF A;  1T2K A;  5L3G A;  5DV5 A;  1MJ9 A;  3L7W A;  2Y75 A;  4I09 A;  4P5O A;  3GXO A;  3R0A A;  1ZAR A;  2FQ3 A;  1R23 A;  3ML6 A;  3QAH A;  1Z7U A;  3N4M A;  2KJC A;  1S6L A;  3M9A A;  5J8F A;  4MNU A;  3BRO A;  5DUK A;  2STT A;  1NHA A;  1IN5 A;  2YU3 A;  5E1W A;  2ZME A;  4A12 A;  3VB2 A;  5F1R A;  3V8K A;  2P5V A;  3KZY A;  4A0Z A;  2F5E A;  2XAJ A;  4I2O A;  3Q9S A;  5E1X A;  4XSZ F;  1B1B A;  1OYY A;  2D1V A;  4N9I A;  2K4B A;  2FF4 A;  2KKO A;  3F8F A;  4RS8 A;  2MBF A;  2A69 F;  1G6N A;  2NS0 A;  3KFW X;  4I01 A;  3COA C;  2HKO A;  1K78 B;  3HTS B;  3K1N A;  3G73 A;  4YFN F;  2STW A;  5TJJ A;  1P92 A;  4M71 A;  2XAH A;  1J75 A;  4IF4 A;  1LNW A;  5D4R A;  1G3S A;  2A5Y B;  3E5U A;  1D8K A;  1XMK A;  1XMA A;  3HRT A;  2DLL A;  1U5T A;  2DO7 A;  1SD6 A;  3HHG A;  2P4W A;  3ZMV A;  1QBJ A;  3NQO A;  3P9C A;  4ESJ A;  1TNS A;  1IXR C;  4PGG A;  2YX4 A;  4RB0 A;  2E1N A;  1BIB A;  3R6S A;  1ZYR F;  3TO7 A;  1ZG5 A;  3JSO A;  4U7D A;  1BC8 C;  1D8J A;  5E8G A;  3IHU A;  1BI2 A;  1YTY A;  2L02 A;  3VOE A;  4HLX A;  2GA1 A;  3FMS A;  4KT5 C;  2ACJ A;  3GFM A;  2FNP A;  1QO0 D;  3Q9V A;  4OMY A;  3WTV C;  3O6B B;  1MJB A;  3R4K A;  2W85 A;  4P9F A;  2HFH A;  3ZP5 A;  1PP7 U;  3F6O A;  5K5R A;  1LDK B;  1YS6 A;  5DUI A;  1Z1D A;  5D6E A;  1XD7 A;  3BPX A;  2HOE A;  2ZJ2 A;  4UVB A;  1MD0 A;  2QQ9 A;  1XGO A;  4BQA A;  1K78 A;  3V8L A;  2EA4 A;  2P6S A;  2O8X A;  2IA0 A;  2PQ8 A;  2EFQ A;  3F8N A;  2RGV A;  1Z05 A;  2D2W A;  4RGR A;  1O7L A;  1R36 A;  2KIF A;  3KLN A;  4KUM A;  2R7D A;  3L09 A;  4EGY A;  2D45 A;  3FXU A;  4F7Z A;  2O03 A;  1I6X A;  4AWX B;  2QZ8 A;  5CVU A;  3GYH X;  3PFI A;  2A6E F;  4Y17 A;  2HQN A;  1HST A;  2K86 A;  1F9N A;  1HW1 A;  2DBB A;  1WWX A;  2VBY A;  1USS A;  1UFM A;  2GXG A;  4L9J A;  2RC4 A;  4PZJ A;  3ZMS A;  4M9Z A;  2IPQ X;  3HRS A;  3RI4 A;  2JZY A;  3DPT A;  2GZW A;  4EQQ A;  3R60 A;  5HLG A;  4O5V A;  4EJT A;  3MZH A;  2CWE A;  4A6E A;  3J81 K;  5JR3 A;  2KIM A;  4WX9 A;  3WTY C;  2O0Y A;  3I64 A;  5E8I A;  2GIV A;  2ZNY A;  2VXZ A;  3E6D A;  4U88 A;  3TO6 A;  3QP5 A;  4ZYH A;  2EFW A;  1KQ8 A;  2BGC A;  4ENM A;  1BI0 A;  1DUX C;  3LA2 A;  3BY6 A;  3L9F A;  1O7F A;  4AVP A;  2M1B A;  3JW4 A;  3U1D A;  2LSO A;  4KA4 A;  1J5Y A;  4B09 A;  3JAM K;  2VBW A;  4YFX F;  4GYI A;  2GWR A;  3ZPL A;  4IRI A;  4EJO A;  4P9U A;  5LRS A;  5IT9 Z;  2QM3 A;  4M6X A;  1FOK A;  3FXQ A;  5ICE A;  4PDK A;  2QWW A;  3VOD A;  5L3C A;  4IVN A;  4FX0 A;  3L2C A;  1LDJ A;  2KJB A;  4XRF A;  2K27 A;  1FZP B;  4M9S A;  3QOP A;  2YR2 A;  4G6Q A;  3I4P A;  1YG2 A;  2FMY A;  5HDN A;  5ICC A;  5KK1 A;  4WCG A;  2M87 A;  5JHU A;  3T8R A;  4CHU A;  1IN7 A;  3EET A;  1REP C;  4CGZ A;  1GXQ A;  1HKQ A;  3F8C A;  2K7L A;  3GW2 A;  3E5X A;  2PN6 A;  4L9N A;  1BOA A;  4LJZ F;  2DU9 A;  3DV8 A;  1UHM A;  1GHC A;  1V3F A;  2BYV E;  2PFB A;  1ON2 A;  3TKY A;  4HBL A;  3EYI A;  4LG0 A;  3EDP A;  1Y0U A;  2KIU A;  4H0E A;  1HBX G;  3KP7 A;  2FRH A;  2PMU A;  2DK5 A;  3HHH A;  2HTJ A;  1SD5 A;  1CGP A;  1FP1 D;  2HR3 A;  2QYO A;  4I98 B;  1T98 A;  2BE5 F;  5AON A;  3K0L A;  5BQT A;  2Q8K A;  6PAX A;  2Z3Y A;  3TQN A;  5D4S A;  2XRO A;  5DDG A;  5D5V B;  2R7F A;  3M1E A;  4UV8 A;  1FBS A;  1B4A A;  1T6S A;  2DQL A;  3FMQ A;  2XIG A;  5K1Y A;  1WSU A;  4OIQ F;  2ESH A;  4HQE A;  1RUN A;  3JSP A;  4D0P A;  2EFP A;  1TTY A;  5D5U B;  2E7X A;  1FYK A;  3VFZ A;  4GYG A;  3E6B A;  4HQM A;  2P8T A;  3WOD F;  2IVM A;  2IA2 A;  3WTS C;  1Z6R A;  1FSE A;  3H3U A;  5E18 F;  1XSX A;  2HWV A;  3CUQ C;  5AIP A;  1R7J A;  5CVJ A;  2VON A;  2YX7 A;  5ERI A;  1TQP A;  1YFH A;  3OOP A;  2Y48 A;  3ZMZ A;  3V7S A;  1T38 A;  3RYR A;  4RB3 C;  3QU6 A;  4KNY A;  5CVR A;  3CUO A;  4HV6 A;  2CQK A;  2MA3 A;  1I1G A;  1YYV A;  4O3M A;  1MDM B;  3KEQ A;  1B9N A;  3I71 A;  3ERE D;  4ENN A;  1WQ2 A;  1W5T A;  5DCM B;  2DPD A;  1T39 A;  1KU2 A;  2M5W A;  3W6J B;  4BHP A;  3V7C A;  5FFZ A;  5D6F A;  1H0M A;  5CYV A;  2E7W A;  2ADU A;  2P5L C;  5HS8 A;  2F5F A;  3TDZ C;  2OZU A;  1XCV A;  1ODD A;  1ZG3 A;  2EWN A;  5ED4 A;  3LAJ A;  5BMZ A;  3LST A;  2YPR A;  1S8N A;  1MJA A;  3ZN1 A;  1FPQ A;  5KVR A;  5FB2 A;  4M6Y A;  1XCB A;  1ZRE A;  4ZZL A;  2LNB A;  3FWE A;  4LK0 F;  1GVJ A;  1IUY A;  1FWZ A;  4RGU A;  3GZ5 A;  4KN7 X;  1F4K A;  3NEU A;  4IRG A;  3ZMU A;  1W5S A;  3KP4 A;  3I54 A;  1WKM A;  4JK1 X;  1KA8 A;  3FF5 A;  1F1Z A;  3I59 B;  4KIG A;  3KP6 A;  4G7H F;  3ULQ B;  5F6F A;  1SFE A;  3F22 A;  1BC7 C;  2IW5 A;  1KQ9 A;  1CF7 B;  2JT1 A;  3IKV A;  4A5M A;  3CO6 C;  2GAU A;  4HF0 A;  5AIQ A;  2L3D A;  3KEO A;  3LA7 A;  3RIR A;  4HF1 A;  1WI9 A;  1MDM A;  2MC3 A;  4FX4 A;  1FC3 A;  2HQR A;  4ESF A;  3ROU A;  1IXS B;  3GFJ A;  3H3Z A;  1PP8 F;  2P7C B;  3LFK A;  5DCM A;  1XSV A;  1JHH A;  3GX4 X;  1ONV A;  3HOT A;  4XBF A;  1AOY A;  1RIO H;  2QUF A;  5L3D A;  4EM2 A;  1MGT A;  2FBH A;  3ZMT A;  1ULY A;  4PGH A;  5HS7 A;  2GA2 A;  1FY7 A;  1YS7 A;  2COM A;  2IT0 A;  1OKR A;  1LVA A;  1BIA A;  4HW0 A;  1OPC A;  5DEQ A;  2MLG A;  2EV0 A;  4XLN F;  4LB5 A;  3MQ0 A;  3TOB A;  1O3R A;  1DPR A;  1U78 A;  1FLI A;  1U5T C;  2EA2 A;  1ZGJ A;  3J81 Z;  2H6B A;  1G4D A;  4ZYD A;  1P6R A;  5LEJ A;  1FNN A;  4U0Y A;  2EJR A;  1OYW A;  3I59 A;  3WU0 A;  2VOP A;  3E6M A;  1SFX A; 
#chains in the Genus database with same CATH topology
 2W1O A;  3QPL A;  2ECB A;  3A01 B;  2WWY A;  1FTT A;  4N4O B;  3S1M J;  3IC7 A;  4IHX A;  2IS2 A;  5DS9 A;  1U3E M;  1ZK8 A;  3HSE A;  1B72 A;  2VOO A;  4J19 A;  1P9Q C;  3A4C A;  1CF7 A;  3RJP A;  3OYE A;  3K2Z A;  2DW4 A;  1S7O A;  2JRT A;  4AD9 A;  4BJ6 C;  1QQI A;  4G94 A;  2VPR A;  4U0V A;  2KLO A;  1YW8 A;  4XKW A;  3K4J A;  1Z6T A;  2M4K A;  1VQK I;  3CME I;  5GAG J;  3GTM J;  4BXX J;  3IWZ A;  1UST A;  1KU9 A;  3U9G A;  2VE8 A;  4J00 A;  4CDG A;  3F23 A;  3PQK A;  3VEP A;  2VQH A;  3S1N J;  3B6C A;  3W6K B;  2LBF A;  2RN7 A;  3RKY A;  2NVX J;  5BOX A;  3JAM Z;  4BU2 A;  5EEH A;  3TED A;  3F6V A;  4CCJ A;  1OCT C;  3HOU J;  4M3F A;  4ENJ A;  3MZY A;  3O2P E;  4RAZ A;  2P7V B;  3LWF A;  3NAR A;  5D5X B;  1KYZ A;  3HOW J;  1VFC A;  1HF0 A;  4UUV A;  4FIS A;  1FT9 A;  1WJE A;  2O3F A;  4HRI A;  2FUG 2;  3A02 A;  3GO5 A;  1P4X A;  3V4G A;  2LR8 A;  2WAD A;  1CQT A;  1LFU P;  1JGG A;  3CC4 I;  1JTX A;  3CCR I;  4A5N A;  2L9S A;  2ZC2 A;  2LMD A;  3FKI J;  3MWM A;  3S8P A;  3DU5 A;  4P96 A;  1UMQ A;  4GGG A;  1FOY A;  2XAS A;  2IGO A;  3FIW A;  1A31 A;  5E3N A;  3FXJ A;  2XHK A;  4LFU A;  1ZGA A;  3LQQ A;  1WI3 A;  3FKJ A;  5BPI A;  1W7P B;  1D1C A;  2KRF A;  5D8K B;  1SEU A;  2F4I A;  4Y52 J;  1S9H A;  2EFO A;  3IH4 A;  5CVV A;  4EVI A;  3WGI A;  3CCJ I;  1RNL A;  2MW8 A;  1HCR A;  2W00 A;  3HIF A;  3B73 A;  3IRR A;  1JT6 A;  3LSK A;  4LOC A;  2E19 A;  2L9R A;  4YRV A;  4BKX A;  2Z9O A;  2AQF A;  4A6D A;  3BDD A;  1QGP A;  3HBL A;  1Y0N A;  4BS9 A;  1YQA A;  1G3W A;  3MKY B;  2NVY J;  4OIR F;  2NS7 A;  4P1W A;  2QKL B;  4M3D A;  4OOI A;  4AYB A;  3P9I A;  1ETY A;  3E1S A;  2E60 A;  4RB2 C;  1Z0X A;  1OCC H;  1SVO A;  5LGT A;  4KN4 X;  5A2Q Z;  5ICF A;  3ASN H;  2AS5 F;  3P9K A;  3RPU A;  5EJC A;  3HG9 A;  5LD2 C;  2CH0 A;  3WU2 C;  5L3F A;  2JTV A;  3A01 A;  1JJ8 C;  4IHS A;  1IN8 A;  4XON A;  2DXI A;  2XV4 S;  2HZT A;  4XSX F;  4Y7N J;  4CZC A;  3TL4 X;  3JRD A;  1YI2 I;  3VYR B;  4KIF A;  3DP7 A;  2DDB A;  4XID A;  5TIS C;  2WAQ N;  4LK1 F;  2XGX A;  3BR0 A;  4HOB A;  1Y6I A;  1K7A A;  2FOK A;  4HX7 A;  1E2X A;  2BZT A;  2XAG A;  5E17 F;  1WJC A;  4XOR A;  3ZQG A;  2ME0 A;  3S2W A;  1HOM A;  3G3Z A;  2CYY A;  2JA2 A;  2Y0M A;  4PSX A;  3DEU A;  3TOA A;  5CQE A;  3J80 K;  5F04 A;  2CFX A;  2R7R A;  3BR1 A;  4U7B A;  3CC7 I;  3U2R A;  2VJ4 A;  3OYG A;  4P55 A;  2ZNZ A;  1MND A;  4A3J J;  3T0Y A;  4R79 A;  3ZQ7 A;  3OR2 C;  4DIQ A;  3CMM A;  3C18 A;  3ESW B;  1ZHF A;  3PUB A;  2VOD A;  4ZH4 F;  3KZI C;  3QU3 A;  1MMG A;  1VQN I;  3NAU A;  3HUG B;  3SEZ A;  4L5J A;  2V6C A;  1SC7 A;  2KPM A;  4E7Z A;  3BTJ A;  3CCL I;  3BTL A;  1OCZ H;  3WE2 A;  4MTE A;  2Q1Z B;  2KZG A;  4IQJ A;  1R5G A;  2RVC A;  3HRM A;  5H6R A;  1GXP A;  2M2E A;  4B44 A;  1VQ6 I;  3VWB A;  2K02 A;  3ECH A;  3SZT A;  1U0J A;  3DTI A;  2HDD A;  1Y1W J;  3C3W A;  2V79 A;  2CG4 A;  4L0Y B;  1C0W A;  4U87 A;  4I0A A;  1K79 A;  4IHY A;  3DKY A;  5E20 A;  3LL7 A;  1QHH D;  1POG A;  3WTX C;  2HGC A;  1YX3 A;  4A3K J;  1WHU A;  3SQN A;  2PI0 A;  4MO7 A;  4M74 A;  3GF2 A;  2KIS A;  2ZXJ A;  3OSF A;  4E7K A;  3EUK L;  4N4N B;  1PVE A;  1B59 A;  2Y9Z A;  1JE8 A;  3MFK A;  5L3B A;  1EF4 A;  4G9Y A;  1P2F A;  4XRS G;  4FE4 A;  3S2D J;  5DD8 A;  2F2E A;  1MMN A;  2R7W A;  1HKT A;  2X4H A;  2Z99 A;  4QLC U;  3ZQC A;  1QPM A;  3JRE A;  3KP5 A;  2VB6 A;  4MGR A;  1FSH A;  2F5D A;  3SZP A;  3N05 A;  2NVT J;  1TW2 A;  3IAM 2;  3K1M A;  1MSF C;  4A0Y A;  1FBQ A;  3H9G A;  2CS3 A;  3SEQ A;  2E1M C;  3HM5 A;  2XGE A;  5E1Z B;  1LJ9 A;  2V9P A;  2VN2 A;  4KIC A;  4EV0 A;  4A2U A;  2HDC A;  3CO7 C;  1YIT I;  5A2Q K;  3R61 A;  2WTE A;  2XPW A;  2QLZ A;  4NB5 A;  4KIS A;  4EM1 A;  4A0X A;  3KLO A;  4FHT A;  4I0B A;  1R00 A;  3LAP A;  3CDL A;  2VPL A;  3PQJ A;  4YIF A;  3OOU A;  5J4Y A;  4CZZ A;  2NAZ A;  3PL8 A;  3BG7 A;  1WJB A;  2LRE A;  2OBP A;  2R7Z J;  1XG1 A;  2VT2 A;  2QBY B;  2A61 A;  3QPH A;  1E0E A;  2E1C A;  1T8I A;  4CCO A;  2W48 A;  3OL4 A;  4IPA A;  4FAS D;  2K3F A;  5JHF A;  2OU2 A;  2ZFW A;  3EPZ A;  3TDU C;  4GCV A;  2BEO A;  3GFI A;  3IRQ A;  3L2R A;  2QSG X;  1HQC A;  2VKE A;  3KP3 A;  4B48 A;  3GVA A;  1YIO A;  3A1Y A;  2GOX B;  2I5U A;  3WGH A;  1IN6 A;  1J09 A;  1FIA A;  4HZF A;  1N77 A;  3LQR A;  1TQM A;  3OYA A;  2PLY A;  4UUT A;  4I02 A;  3WE3 A;  1HDP A;  4MIM A;  3E5Q A;  2RAE A;  2FML A;  2XAF A;  2VBZ A;  4ASN A;  2EZK A;  2YSR A;  1VF9 A;  3FM3 A;  3DCF A;  4K2E A;  3LSP A;  2JA7 J;  4M73 A;  2IEK A;  2E36 A;  4ESB A;  2M30 A;  1V55 H;  3LSH A;  1QZZ A;  2C6Y A;  4Q47 A;  3BQZ A;  2DQR A;  4EJW A;  3HL2 A;  1O3S A;  1T0F A;  3QPT A;  1K4T A;  5HS9 A;  5FO5 A;  1OR7 A;  2W57 A;  1XN7 A;  2L7F P;  5FLX Z;  1ERD A;  5KNL A;  4JX5 A;  1ZGW A;  3HTU A;  1VQL I;  1G3Y A;  3OYH A;  2VC1 A;  3PUF A;  4CA0 A;  5LEK A;  2L4A A;  2IJL A;  2EIK H;  1MZB A;  5EF6 A;  2EBI A;  1MNE A;  2KDZ A;  1YHQ I;  1H89 C;  4IHV A;  2ISZ A;  2UXX A;  3WG7 H;  1UZC A;  2FU4 A;  3TO9 A;  1FEX A;  2ME6 A;  3MCZ A;  4HX4 A;  1SMY F;  4LD5 A;  2LK2 A;  5C44 J;  1NTC A;  4G7Z F;  4AIH A;  2EV5 A;  2ICW G;  3HSR A;  3GME A;  2CUJ A;  1IRX A;  3P7N A;  4UV9 A;  3PO3 J;  1ON1 A;  4Q5S F;  3CJT B;  2CW0 F;  3X2Q H;  4HG2 A;  3RTR A;  4BHC A;  5JLW A;  4U0W A;  1UHW A;  4NQW B;  3A0B C;  3SHF A;  5LBQ A;  2BOL A;  3HOX J;  1B9M A;  3BJ6 A;  3DLL F;  3FK7 A;  3ABL H;  5EEG A;  1W7P D;  1LPQ A;  3KX2 A;  3F21 A;  3L00 A;  2ZSH B;  1ZH5 A;  4WWC A;  4HLY A;  3B6A A;  3FXK A;  1DDN A;  2NYX A;  2VQL A;  5HLI A;  1TT5 B;  3CCE I;  2L5Q A;  5JI6 A;  1WH7 A;  2QQA A;  5ILS A;  1K83 J;  1S7E A;  3IL2 A;  2FEZ A;  3QRF F;  1VQ4 I;  3CP8 A;  1J59 A;  3M8J A;  2MG4 A;  3KYD B;  1QVT A;  2XGC A;  2BY2 A;  5GAH J;  1XSD A;  4OMZ A;  4RB1 A;  2W24 A;  2K3P A;  4NC8 A;  1ZLK A;  1KQ0 A;  3ZCO A;  3EQL F;  3R0J A;  4RAG A;  3VYS B;  4L0Z B;  2OZ6 A;  1YW9 A;  4ITV A;  4JX4 A;  2VL8 A;  2QBY A;  2ESN A;  1ZEL A;  4HV5 A;  4RGX A;  3FZV A;  3WTZ A;  5J1Y A;  5HOO A;  1DQU A;  1S7A A;  3DEW A;  1ZRD A;  3FXM A;  3CCU I;  4CYC B;  1XTA A;  4KMU X;  2CU7 A;  3GWZ A;  4OWR B;  2OQR A;  2JK3 A;  3GUD A;  2FA5 A;  2K85 A;  2DJN A;  5E3M A;  4L9V A;  3VDX A;  3DFG A;  2HOT A;  1JHF A;  2ZBK A;  3DQV C;  3DXJ F;  4Y4R A;  3RSN A;  4LLG F;  4E70 A;  1XDS A;  2LTP A;  4KT6 A;  1KYW A;  4MTD A;  2L4M A;  3F9K A;  1VTN C;  2KQR A;  5FD6 A;  3LNQ A;  5LFA A;  1LB2 A;  1F36 A;  2ZME B;  3M3Y J;  4Q4Z F;  1HXD A;  1Z67 A;  4M9X A;  1R9T J;  2K9L A;  4PJN A;  3HYI A;  3CLO A;  4ZDP A;  2HXO A;  2NNY A;  1TWF J;  3H5R A;  4V2G A;  5DD4 A;  3HSF A;  5H20 A;  4IOC F;  3WG9 A;  1BN5 A;  3ERM A;  2W25 A;  3I9V 2;  4BUP A;  2CGP A;  1U2W A;  5J8C A;  4XLF A;  3AFH A;  1IO2 A;  1X19 A;  2EZL A;  2IRF G;  3BLY A;  4CIC A;  1X3U A;  3O3K A;  4M3E A;  3F8M A;  5FD5 A;  3WGG A;  1R1T A;  2VT3 A;  2XGD A;  1JUM A;  1KU7 A;  1EH6 A;  3BG3 A;  1R6R A;  3E3V A;  3FIS A;  4D7M A;  1N75 A;  1GDT A;  3H3V K;  2JN6 A;  4IXA A;  4MQV A;  2DAO A;  5F0H A;  3HPH A;  2Z5U A;  3GTG J;  5FKO A;  2CO5 A;  3VSK A;  3FXR A;  5F0C A;  3KET A;  5ILU A;  1U8R A;  1DPU A;  3JRH A;  5DCF A;  1IAW A;  1R5H A;  2R7T A;  1VQ8 I;  2EIN H;  3MD2 A;  1L3L A;  1SAX A;  1XGN A;  1FMW A;  5FLX K;  1OYI A;  1JKP C;  2DPU A;  3C2H A;  2LKS A;  1G2H A;  2L9V A;  3CMY A;  1B8I A;  3OYF A;  1VQP I;  2XKP A;  2DFF A;  2XB5 A;  1X1A A;  3C1D A;  4CXF A;  2FOW A;  3KZZ A;  5B1B H;  4Z6Y A;  4Q48 A;  1MH3 A;  3BG5 A;  2JVG A;  1E17 A;  1TWA J;  3G1M A;  3ABK H;  4Y3O A;  2H27 A;  3RDI A;  2PMZ N;  1EJ9 A;  1V4R A;  4A3L J;  1Y1V J;  2HYF A;  1ETV A;  3ELK A;  1U5T B;  2MC4 A;  1LKX A;  3RKW A;  1ETQ A;  4JQF A;  2HI3 A;  2XF6 A;  1FBU A;  3E97 A;  1E3H A;  3T8T A;  1IXC A;  1MKM A;  3A03 A;  3LFU A;  3P5J A;  3J7A O;  1H9T A;  3BTI A;  4CYC A;  4AYB N;  1H88 C;  4N9H A;  1Z77 A;  5H2F C;  2LVS A;  3C2B A;  2I10 A;  4ZYE A;  3D5S C;  1K6O A;  1Q1H A;  1IDY A;  1KU3 A;  3GZ6 A;  2DT6 A;  3H0G J;  4EGZ A;  3L1P A;  4L18 B;  3AAF A;  3Q0V A;  4BHB A;  1BR4 A;  1IC8 A;  4IEJ A;  3PJR A;  1JI8 A;  1YW7 A;  4WXC A;  1ZR2 A;  3UNG C;  5LGU A;  2R7V A;  4RGS A;  3GTJ J;  2DOE A;  3HKZ N;  2JUG A;  3RPQ A;  5J6X A;  5FLM J;  1D0Z A;  4JYK A;  3I58 A;  3BQY A;  4IHT A;  4KIB A;  4DQ2 A;  4FCY A;  3CES A;  2W84 A;  3I4M J;  5FJ8 J;  2XSJ C;  5IP7 J;  4HDU A;  2L01 A;  1XGM A;  3DPU A;  3BCB A;  1J0R A;  3OV8 A;  3ISP A;  1I39 A;  4PJ0 C;  5HLH A;  4QWQ A;  1O57 A;  4PJJ A;  3MKZ A;  4H4K C;  2F5V A;  1SFK A;  2EZH A;  1Z91 A;  5J4V A;  1I1S A;  4I7H A;  2LF7 A;  5LHG A;  1HW2 A;  4RBO A;  1YRN B;  1DP3 A;  5TRD A;  4DZJ A;  9ANT A;  4OIN F;  1MH4 A;  3CDI A;  4UNO A;  2CV0 A;  5K5O A;  2DOA A;  1X2M A;  1H9G A;  4WXH A;  1FYL A;  2M34 A;  1LQ1 A;  3ZQI A;  4HDV A;  2JSC A;  3ZMD A;  2J5P A;  4DZP A;  2LY9 A;  4CUG A;  1SFO J;  3PNT A;  4EMS A;  2RNG A;  1FX7 A;  2LOO A;  5CKT A;  5HVQ C;  4HPQ A;  1VQM I;  1G59 A;  4WF2 A;  4NC6 A;  2Y0S N;  1EH8 A;  2PJP A;  5LGN A;  2V1D A;  2DI3 A;  4AID A;  3ZOB A;  3N97 A;  3BT9 A;  3JRC A;  2ZJQ F;  2EH3 A;  1TP4 A;  2QSH X;  4DOZ A;  2PJR A;  1RI7 A;  4S05 A;  4BQO A;  3HB9 A;  1J2X A;  1XS9 A;  3DKW A;  2EK5 A;  3SXY A;  2F48 A;  2B63 J;  1X1P A;  2H6C A;  4BAY A;  3OYM A;  3T5X A;  2DFH A;  4Z2Y A;  4ANJ A;  1STZ A;  2Q0O A;  1UB9 A;  3F3X A;  3LSM A;  1P4W A;  4IJA A;  1BL0 A;  4LB6 B;  2WY7 Q;  2DMP A;  3BC8 A;  3K6G A;  2XRN A;  3BZK A;  3J80 Z;  1SD7 A;  3ZQQ A;  4IHW A;  2FX0 A;  1R1U A;  3AG2 H;  1TWH J;  2JRM A;  4GO1 A;  1PUF B;  1MMA A;  5BPD A;  1BOB A;  5H6Q A;  4B3A A;  2V1X A;  3LSI A;  2R7S A;  1TL8 A;  5FFX A;  4N0B A;  4YFK F;  3E6C C;  3JTH A;  1A35 A;  1ZLJ A;  4G8X A;  2FBK A;  4ABZ A;  4YG2 F;  5J1R A;  4YEL A;  4XN0 A;  1MMD A;  2WC2 A;  5FRM A;  2L9N A;  1RUO A;  3OYC A;  1TQI A;  1VND A;  3LMM A;  1NH3 A;  1ZRF A;  2FBI A;  3G6E I;  2VE9 A;  1X1D A;  5C3E J;  2BBY A;  1EH7 A;  3IH3 A;  4E7I A;  2R5Z B;  1OQY A;  2I8D A;  3DBH B;  1HLV A;  2A3S A;  3SFZ A;  3GTL J;  1O3Q A;  2J5O A;  4ZZD A;  3OYN A;  2OQG A;  2KT0 A;  3CTA A;  4AIK A;  1YRN A;  2YS9 A;  4IRH A;  2QCO A;  3BG9 A;  2RRE A;  3AG3 H;  1YJW I;  2E71 A;  2O61 A;  3K70 C;  2AXL A;  1I6H J;  2B0L A;  4OU0 A;  5IT3 A;  2XVC A;  1XDU A;  3S3M A;  4IOA F;  4KDP A;  1U6G A;  2LD5 A;  1D3Y A;  3BR3 A;  4RAY A;  2GQQ A;  1TW3 A;  1K4S A;  4AVZ A;  4XLC A;  2Q2E B;  4O6J A;  2Z33 A;  2H1K A;  3KIO A;  3DPL C;  1A04 A;  2VC0 A;  1B6A A;  5LHI A;  3PIP F;  3S32 A;  1N78 A;  5LHH A;  1HSJ A;  3ABT A;  4JX6 A;  1WJ5 A;  4TV7 A;  3G71 I;  1JJ6 C;  1F5T A;  2LYC A;  4D1Q A;  3V42 A;  1X1C A;  2BV6 A;  4XLP F;  1HW5 A;  2HS5 A;  1S3J A;  1A5J A;  1IW7 F;  2X6O A;  1T56 A;  1WJF A;  3WTW C;  1ETK A;  1FYM A;  3K9T A;  1H8A C;  2DMU A;  2DMT A;  1XMX A;  2X6Y A;  3MKL A;  4B43 A;  4IO9 F;  4KYW A;  5L3E A;  2DTR A;  3BP8 A;  1P4A A;  1UG2 A;  4MHG A;  3JRB A;  3S16 J;  2XB0 X;  1OFC X;  2AHQ A;  3TGN A;  4J01 A;  4XOT A;  2L54 A;  2DA5 A;  1I5Z A;  4BDZ A;  2VKV A;  4JBA A;  1ZR4 A;  2UUZ A;  2LDU A;  2DA1 A;  3WU1 B;  1TBX A;  2LG4 A;  3ZN0 A;  3BCA A;  4S04 A;  1IRF A;  5F64 A;  2CJJ A;  3OY9 A;  4BE2 A;  2MLK A;  4XLH A;  4MFE A;  2DFI A;  2R7Q A;  2DMN A;  1BM9 A;  1WCM J;  3E7L A;  1HKS A;  2A6H F;  2DN0 A;  2V9V A;  3QOD A;  2E2H J;  2JUC A;  3K4L A;  4OAZ A;  1MSE C;  1HC8 A;  3K1P A;  2DT7 B;  4ENK A;  4GFB A;  1IF1 A;  2XPV A;  1UG0 A;  3H5N A;  1PUF A;  5BS6 A;  2R93 J;  2A07 F;  3GCM A;  3PFY A;  1KGS A;  3RYP A;  1IDZ A;  4L9T A;  3CJN A;  5FRO A;  2UWM A;  2Y2Z A;  4LMY A;  2XSD C;  4MFD A;  4HF2 A;  3IKT A;  4M72 A;  3CP2 A;  1Z3Y A;  2CUF A;  3FHN A;  4RLQ A;  2DOD A;  5IOY A;  4B8X A;  2E1M B;  1R22 A;  1W36 C;  1OIS A;  5JFR A;  3T1B A;  2MD5 A;  2X1C A;  4UHT A;  2OCC H;  3BZ6 A;  5J47 A;  1WVR A;  4QTR A;  2F5C A;  2RQQ A;  1XGS A;  4CH7 A;  1BI3 A;  3M7G A;  5IOZ A;  2UXN A;  2R3S A;  3BOQ A;  2IAI A;  4PCQ A;  2VUM J;  1AHD P;  3MAJ A;  5HDK A;  1O3T A;  2ETH A;  3BZC A;  2DA7 A;  3HOS A;  1W0T A;  2DK8 A;  2HPM A;  2OCE A;  2QQB A;  2DA4 A;  3FDY A;  3MEX A;  3OSG A;  2E2J J;  3TW6 A;  2EV6 A;  4BE1 A;  1S29 A;  2D1H A;  4HA8 A;  2EFN A;  2LRD A;  2X9D A;  5J3L A;  1OMI A;  2OAZ A;  5ILV A;  3JR9 A;  3HRU A;  4GXO A;  1QZY A;  3K69 A;  1J9I A;  1MBF A;  1WRJ A;  1T08 B;  1I27 A;  2Q2E A;  2OD5 A;  3I3L A;  2VIX A;  3CF2 A;  3FMR A;  4Y15 A;  3I4N J;  2MAB A;  5CJ9 A;  4UY8 I;  2R4G A;  3F8B A;  2O6G E;  2NRA C;  3WTU C;  4E7S A;  4ZYG A;  3L2Q A;  1HA8 A;  1R1V A;  2WB1 A;  3JRA A;  1W7P A;  1PDN C;  2PX9 A;  3K4M A;  2BHZ A;  4QPQ A;  3GFL A;  1VI0 A;  3ECO A;  3V7R A;  4UB6 C;  1IRG A;  3HGY A;  2M7B A;  3M8F A;  4LG0 B;  4HNT A;  2HTS A;  4AUX A;  3Q5F A;  5LLQ A;  5EDN A;  2Z1D A;  2M8E A;  2RKH A;  5K5Q A;  5ICG A;  4XQF A;  3I0T A;  3AL0 C;  2TDX A;  4EJV A;  3OYJ A;  1X58 A;  2VJ5 A;  1LDD A;  3DTE A;  1ZAO A;  1AWC A;  2HPI A;  3BPV A;  2XKO A;  2HNH A;  2XAQ A;  4UVA A;  1ZG1 A;  4IX7 A;  3JTG A;  1G3T A;  1VZ0 A;  1QNT A;  3I53 A;  5IYC J;  2HEO A;  2UZK A;  4R1H A;  3DWL E;  4BXU A;  2RNJ A;  2JPB A;  4YII A;  5D8L B;  2QEN A;  2M9H A;  4LG3 A;  4EM0 B;  5D5W B;  1W0U A;  1SD4 A;  1IUF A;  2CFO A;  3V8J A;  2XC7 A;  3JRI A;  4IKF A;  4QIW N;  2Z16 A;  1A6I A;  3ABM H;  4WK8 F;  4C2U A;  1SMT A;  1BBY A;  5KAF C;  1XB4 A;  3IV5 A;  2EQR A;  3IWF A;  3OS1 A;  1AKH B;  3OR1 C;  2E2I J;  5JVT A;  4BDY A;  2EZI A;  1IGN A;  1EKE A;  4LIV A;  1XC5 A;  5B5E C;  2G7H A;  1YJN I;  2ZXH A;  3MMY B;  2FXA A;  4L5I A;  1JXS A;  2ZCW A;  2XUB A;  4LIT A;  4F92 B;  4DW6 A;  2ELH A;  3B02 A;  4IL6 C;  4RMN A;  5CLS A;  5E79 C;  2Y69 H;  2LF8 A;  3GLL A;  2WAF A;  2CMP A;  3HUG A;  2V4J C;  2LY2 A;  3CUQ B;  4CCK A;  2HZD A;  4EJU A;  2QVO A;  1V5G A;  3MN2 A;  3K4N A;  4A69 C;  2FD5 A;  2K9N A;  3O8G A;  2OA4 A;  4OIO F;  3REO A;  4ETS A;  3NWS A;  2CW8 A;  2E35 A;  3D0S A;  2VBX A;  2PG4 A;  3ONQ A;  1JGS A;  4NHJ A;  3OS2 A;  3F72 A;  2K9Q A;  1IN4 A;  3RKX A;  4KMF A;  3SFI A;  2GXB A;  4DNC A;  2EB7 A;  2ZFU A;  4LLN A;  1L0O C;  4BYY A;  3IH2 A;  1LEB A;  2PMH A;  2ZO4 A;  3D5R C;  4KFC A;  2H8W A;  2LKP A;  5DM6 F;  3M07 A;  4G7O F;  2NOJ B;  4E7H A;  2V1U A;  3GEZ A;  1JTY A;  1Z21 A;  3PNV A;  5LRR A;  4M3G A;  1FTZ A;  5K7F A;  1J7K A;  3EYY A;  2H94 A;  5FLV A;  2ISY A;  2TCT A;  1WPK A;  2IGN A;  2MD0 A;  1T0F C;  3IUO A;  2CQN A;  5B3S H;  1WGX A;  2JMW A;  4M6V A;  1OR7 C;  1P7J A;  5GPC A;  2JVH A;  4XOP A;  4UXN A;  1U9O A;  4BH9 A;  3HXL A;  2A68 F;  1VQO I;  1S72 I;  2DT5 A;  3FHZ A;  1D5V A;  1ENH A;  4OIP F;  3D5L A;  3ABU A;  3CCQ I;  4HYE A;  3I5U A;  2LP0 A;  4MQ9 F;  4UUS B;  3WTT C;  5M3F J;  2BVL A;  2FSW A;  2R5Y B;  5IT9 K;  3KYC B;  2H09 A;  1X2N A;  2YU9 J;  3CDH A;  4CYD A;  1BI1 A;  1K61 A;  4WXD A;  4NC7 A;  1S5L C;  3EUH A;  5FKK A;  2DYR H;  1Z9C A;  2GLO A;  3VYU B;  2O8K A;  4PJM A;  4HEA 2;  5TGT A;  1ZRC A;  1Z3X A;  2CRG A;  3DF8 A;  3C7J A;  4DYR A;  1FP2 A;  3KE2 A;  3ZXS A;  2FE3 A;  3NRV A;  4LIU A;  2W7N A;  2EPF A;  1I3A A;  2NOG A;  1DP7 P;  2OTJ I;  5HDG A;  1EV7 A;  4AIJ A;  2WAQ A;  2EIJ H;  2M45 A;  5K7Z A;  2LH9 A;  4MEX F;  4MEY F;  3KCC A;  2G9W A;  3M8E A;  3H92 A;  4NBQ A;  2RQP A;  4BGD A;  2X0L A;  4D5C A;  2P6T A;  4FT8 A;  3CUQ A;  4A3C J;  4RAF A;  2HQA A;  1MBJ A;  1SFU A;  4W1U A;  5IP6 A;  3MKW B;  1LFB A;  1YO5 C;  2RDP A;  3QWL A;  3FX3 A;  4HST A;  3LOC A;  1R71 A;  3FM5 A;  3KP2 A;  4B47 A;  3DTK A;  5B66 C;  1PUE E;  1AA7 A;  5GPA A;  2G7U A;  4R8H A;  1ZN2 A;  1IZ1 A;  1W4M A;  3GTO J;  2IP2 A;  2KRC A;  3CQZ J;  4BNC A;  4Y13 A;  5BNG A;  2VXD A;  3K4C A;  3QP6 A;  3LA3 A;  2CQQ A;  4XRS A;  1MIJ A;  2QA4 I;  3BJA A;  5CVI A;  3L2V A;  4LGW A;  2P5K A;  2ZKZ A;  4CO8 A;  1LEA A;  1WH5 A;  1SVL A;  2JSP A;  2Y30 A;  3VPR A;  4HX8 A;  4ON0 A;  4G6D A;  2FNA A;  1WJD A;  1Y56 A;  2NNN A;  2FQ4 A;  3BWG A;  3GLX A;  5DYM A;  2WV0 A;  2PEX A;  4HAM A;  2P81 A;  2MH2 A;  2MH9 A;  2IS4 A;  3K4B A;  2GOM A;  2K4J A;  3CJQ B;  1BW6 A;  1QZE A;  1DU0 A;  4UB8 C;  2HKX A;  2DOF A;  3BTC A;  3BJO A;  1RZ4 A;  5FGM A;  4LLL A;  4QSH A;  1TNT A;  1UCR A;  4A3G J;  3G1O A;  3SJM A;  1R58 A;  3LSG A;  2DMQ A;  2K9S A;  2RV8 A;  3H0D A;  1TLH B;  3DLA A;  1IG7 A;  3HGG A;  2JPC A;  2DA2 A;  4NQW A;  2CSO A;  1JUP A;  1R49 A;  2PBI A;  4BJT A;  2IA1 A;  4UVC A;  1JT0 A;  2HOA A;  1RR8 C;  2HYG D;  1M1E B;  1YLF A;  1UHS A;  1T2K A;  4X6A J;  1KON A;  2LFB A;  3A0H C;  2ID3 A;  2WA0 A;  5DV5 A;  5L3G A;  1MJ9 A;  3W6V A;  3F0C A;  3L7W A;  3OYK A;  2Y75 A;  3S2H J;  3TW7 A;  4I09 A;  2DA6 A;  2NVQ J;  1JUS A;  4P5O A;  2CQX A;  5F27 A;  3GXO A;  3R0A A;  5HOD A;  5M5W J;  1ZAR A;  2FQ3 A;  1R23 A;  2IBD A;  3RZD J;  3TP0 A;  2Z2S B;  1YJ9 I;  4OAY A;  1D1A A;  3WHC A;  5F08 A;  3J7Z I;  2P0W A;  3ML6 A;  3QAH A;  1Z7U A;  3N4M A;  2KJC A;  1S6L A;  3M9A A;  2LY1 A;  2OTL I;  5J8F A;  4MNU A;  3BRO A;  5DUK A;  1BW5 A;  2OC6 A;  4BL0 B;  2STT A;  1NHA A;  1IN5 A;  4AM3 A;  2FJ1 A;  2YU3 A;  5E1W A;  2Y31 A;  5KHD A;  4V2F A;  2COB A;  5JVG F;  2ZME A;  4DGW B;  4A12 A;  1D1B A;  2ZSI B;  4F91 B;  4RLF A;  3VB2 A;  1WZ2 A;  5F1R A;  2HQ5 A;  3FBI B;  4PK4 A;  4X1E A;  3V8K A;  2P5V A;  2MSY A;  3KZY A;  1GVD A;  2W82 A;  3BR5 A;  2M0M A;  1ITY A;  2F5E A;  4A0Z A;  2XAJ A;  4I2O A;  1FOW A;  3Q9S A;  5E1X A;  4XSZ F;  1B1B A;  3CCS I;  2IGK A;  4RDU A;  1V5E A;  2JA8 J;  4ZYA A;  1LE8 B;  1OYY A;  2D1V A;  2JA5 J;  1QHG A;  3G1L A;  5JLX A;  4N9I A;  1W1W E;  2K4B A;  2FF4 A;  4XLA A;  2KKO A;  4HSR A;  3F8F A;  2OV7 A;  1R5I D;  4RS8 A;  2MBF A;  2A69 F;  2E5Z A;  1QRY A;  1G6N A;  2NS0 A;  3KFW X;  3HC7 A;  4I01 A;  3COA C;  2HKO A;  1K78 B;  3HTS B;  3K1N A;  3G73 A;  1YE9 A;  1IJW C;  4BBS J;  4YFN F;  2STW A;  3RZO J;  3SZG A;  3AG4 H;  2X85 A;  1P92 A;  5TJJ A;  2LBF B;  4M71 A;  2XAH A;  3WHB A;  2VKD A;  1J75 A;  4YEJ A;  4IF4 A;  1WJA A;  3PIO F;  1LNW A;  3HDD A;  1K6Y A;  5D4R A;  2NXN B;  2GBY A;  1G3S A;  3S3N A;  1SAN A;  2A5Y B;  3E5U A;  1UJ8 A;  2V9K A;  1D8K A;  1XMK A;  1XMA A;  3CCM I;  3AG1 H;  3HRT A;  2DLL A;  3TP3 A;  4FQG A;  3C2G A;  1U5T A;  2BY1 A;  2DO7 A;  1R4M B;  1SD6 A;  3HHG A;  2P4W A;  2ZXW H;  3CZ6 A;  4NNJ A;  3ZMV A;  1QBJ A;  4BQQ A;  3NQO A;  3W2W A;  3WU0 A;  3P9C A;  4ESJ A;  1TNS A;  1IXR C;  4PGG A;  5GP9 A;  2YX4 A;  4A3E J;  4RB0 A;  2V7F A;  2HVQ A;  2KDO A;  1E3P A;  2VQG A;  3W3C A;  2E1N A;  5E3L A;  1SVM A;  1BIB A;  3RQ4 A;  3SYT A;  1D0X A;  3TBI A;  3R6S A;  1ZYR F;  3TO7 A;  1ZG5 A;  3JSO A;  5GAD J;  4U7D A;  1BC8 C;  5E8G A;  3IHU A;  1D8J A;  1BI2 A;  4I99 C;  3DBR B;  1YTY A;  3MZ8 A;  5GTI C;  2HYJ A;  2L02 A;  4PUS A;  4XN3 A;  1ORK A;  3VOE A;  4HLX A;  2GA1 A;  3FMS A;  4KT5 C;  2ACJ A;  3GFM A;  2FNP A;  5IY5 H;  1OJL A;  3PSF A;  1GLN A;  1QO0 D;  3Q9V A;  4OMY A;  3WTV C;  5EEA A;  2XDV A;  3O6B B;  3IAS 2;  1MJB A;  4CCN A;  1LE8 A;  3OYD A;  2BVM A;  2M8G X;  3R4K A;  2W85 A;  2XPU A;  4P9F A;  4XLE A;  2HFH A;  4G12 A;  3ZP5 A;  3CMA I;  1PP7 U;  1QU3 A;  1RR7 A;  3F6O A;  5K5R A;  1A36 A;  1LDK B;  1YS6 A;  2IGM A;  5DUI A;  1Z1D A;  5J40 A;  5D6E A;  3S15 J;  1XD7 A;  3GTK J;  3BPX A;  2DDA A;  2HOE A;  2ZJ2 A;  4UVB A;  1A6Q A;  4CCL A;  4A3I J;  5K7H A;  1DGW Y;  1MD0 A;  1I3Q J;  1LFP A;  2QQ9 A;  2E34 A;  4C3J J;  1XGO A;  4BQA A;  4JP0 A;  1K78 A;  3OIQ A;  3V8L A;  1V5F A;  2EA4 A;  2GIZ A;  2P6S A;  2O8X A;  2WBM A;  2KFD A;  1XPX A;  2R7X A;  2IA0 A;  2PQ8 A;  2V26 A;  4I6Z A;  1RC9 A;  2EFQ A;  2HOS A;  3NWT A;  3F8N A;  5HLT A;  1G8X A;  1R4N B;  3OWT A;  2RGV A;  1Z05 A;  2D2W A;  4RGR A;  1O7L A;  1R36 A;  1ETW A;  2KIF A;  3KLN A;  4KUM A;  3GZN B;  2R7D A;  3ZRG A;  3L09 A;  4EGY A;  2D45 A;  4XKC A;  3FXU A;  4F7Z A;  2O03 A;  1I6X A;  4AWX B;  2MGQ A;  5FRN A;  2QZ8 A;  2L7K A;  1NG7 A;  4ZC3 A;  5CVU A;  4BQN A;  3GYH X;  4XMY A;  4XRM A;  1VQ5 I;  3PFI A;  3RQI A;  1D5Y A;  2KRH A;  3AKZ A;  2A6E F;  2HVS A;  3GBG A;  4Y17 A;  2CQ7 A;  5EZG A;  2HQN A;  1HST A;  4MLO A;  2K86 A;  1ETO A;  1F9N A;  2X1E A;  1HW1 A;  2VJJ A;  1Y8Q B;  2O7O A;  2MFZ A;  2NS8 A;  2DBB A;  3MVP A;  1WWX A;  3PSI A;  4PFO A;  3AL0 B;  2L7Z A;  1USS A;  2VBY A;  3KEY A;  1UFM A;  4PFP A;  2XF5 A;  2GXG A;  4E6K G;  4A3D J;  4D5F A;  1DU6 A;  4L9J A;  2RC4 A;  2PMZ A;  3S17 J;  4PZJ A;  3RCO A;  3ZMS A;  3FXL A;  4M9Z A;  2KL4 A;  1JKQ C;  3CD6 I;  2IPQ X;  3HRS A;  4RM3 A;  3S3O A;  3RI4 A;  4BY7 J;  3M1C A;  2IS6 A;  1GV2 A;  2CUZ A;  2JZY A;  3JRG A;  2VKH A;  1MBG A;  2A6T A;  3DPT A;  2JQ7 A;  1LUJ B;  2GZW A;  1JKO C;  4EQQ A;  3HEF A;  3R60 A;  5HLG A;  2CV2 A;  4O5V A;  5M5X J;  1OCR H;  4EJT A;  4II2 A;  3MZH A;  2M3A A;  2CWE A;  4XK4 A;  2K40 A;  4A6E A;  3J81 K;  5JR3 A;  2KIM A;  1APL C;  4WX9 A;  3ZGK A;  2R5Z A;  3QYF A;  3WTY C;  2O0Y A;  2DCE A;  3I64 A;  1ZTR A;  3GTQ J;  3BG6 A;  5E8I A;  2GIV A;  4FET A;  2ZNY A;  3HKZ A;  1EA3 A;  2R7O A;  2VXZ A;  3E6D A;  4U88 A;  3TO6 A;  3QP5 A;  4ZYH A;  4ZTJ A;  2ECC A;  2BHY A;  2EFW A;  3ASO H;  1KQ8 A;  1ZQ3 P;  2BGC A;  4ENM A;  4A3F J;  1BI0 A;  4DBR A;  2CW7 A;  1DUX C;  3L2W A;  5FKL A;  4A3B J;  5B1A H;  3LA2 A;  3G2B A;  1N25 A;  3BY6 A;  3L9F A;  1O7F A;  4AVP A;  5E3O A;  3PNY A;  4S0H B;  2VJI A;  4B3X A;  2M1B A;  1MNM C;  3JW4 A;  2OPT A;  3ZR8 X;  3U1D A;  1T33 A;  2KP6 A;  2LSO A;  4KA4 A;  4L5E A;  1J5Y A;  1D0Y A;  4QPO A;  4B09 A;  1I50 J;  2VLA A;  3JAM K;  2VBW A;  4YFX F;  4GYI A;  2DTZ A;  1MBE A;  2GWR A;  2B9S A;  3ZPL A;  2VAS A;  4IRI A;  1E3O C;  2QGU A;  4EJO A;  1RKT A;  2F4M B;  2W4S A;  3H1C A;  1GT0 C;  1VQ7 I;  4GDF A;  2R7U A;  4P9U A;  2OUM A;  5LRS A;  5IT9 Z;  2QM3 A;  2Y0S A;  3K70 D;  4M6X A;  2H8R A;  3K7A J;  3SDB A;  1FOK A;  3FXQ A;  4HNU A;  5ICE A;  1MBH A;  3CLQ A;  1PJR A;  2TRT A;  2NVU B;  1VQ9 I;  1IV8 A;  4PDK A;  4XIC A;  3OIP A;  3JRF A;  2QWW A;  2EIL H;  2VI6 A;  3CCV I;  3VOD A;  5L3C A;  4IVN A;  3DBL B;  3O8H A;  1TZL A;  2JWT A;  4FX0 A;  1TWG J;  3L2C A;  1LDJ A;  2KJB A;  2R92 J;  2QKM B;  4XRF A;  1OCO H;  3HZJ A;  2K27 A;  1FZP B;  2WAE A;  4M9S A;  2X48 A;  3J7A Y;  3QOP A;  2YR2 A;  2BY0 A;  4G6Q A;  3J7Y J;  2GXA A;  2O9L A;  3U21 A;  4C3I J;  3I4P A;  1YG2 A;  2Y9Y A;  2FMY A;  3H36 A;  3PM1 A;  5HDN A;  1F43 A;  5ICC A;  1RPW A;  5KK1 A;  4WCG A;  2M87 A;  3ZQH A;  4E4H A;  5JHU A;  1X1B A;  3T8R A;  3PO2 J;  4CHU A;  2E5N A;  1IN7 A;  3EET A;  1REP C;  4CGZ A;  3OYI A;  1GXQ A;  1HKQ A;  2M7A A;  3F8C A;  2K7L A;  4PJL A;  4Y33 A;  2F6C A;  2AXT C;  2WY8 Q;  2ZB9 A;  3GW2 A;  3E5X A;  2PN6 A;  3KYL A;  4L9N A;  1BOA A;  4LJZ F;  2DU9 A;  3DV8 A;  3A2K A;  2E1O A;  2QQ8 A;  1RKW A;  5GTH C;  1UHM A;  1GHC A;  2JA6 J;  3RPU D;  1TWC J;  1V3F A;  2BY3 A;  2BYV E;  2PFB A;  1W36 D;  1ON2 A;  2BW3 B;  3TKY A;  1O4X A;  4HBL A;  4XL9 A;  4EAT A;  2XAU A;  2KZV A;  2L0K A;  3EYI A;  1W5C C;  4LG0 A;  2M0C A;  3EDP A;  1Y0U A;  4ZDL A;  2KIU A;  3OYB A;  4H0E A;  5CPR B;  1HBX G;  3S1R J;  3ZQF A;  3RKQ A;  5F0F A;  3KP7 A;  2FRH A;  3K4K A;  1YX5 A;  2PMU A;  5J1U A;  4A93 J;  4ZTF A;  5HNF A;  1TT0 A;  2DK5 A;  4F93 B;  1LVK A;  5DM7 F;  5EZH A;  3HHH A;  2HTJ A;  5EGO B;  1SD5 A;  1CGP A;  1FP1 D;  3EUA A;  2F4O B;  2HR3 A;  2QYO A;  4I98 B;  1U9N A;  2M4G A;  1NG6 A;  1T98 A;  3DU6 A;  2BE5 F;  2X6W A;  5AON A;  3K0L A;  5BQT A;  3M4O J;  2Q8K A;  3K2A A;  3S93 A;  6PAX A;  2Z3Y A;  3Q0W A;  3TQN A;  5D4S A;  3FK6 A;  2XRO A;  2XF7 A;  5DDG A;  5D5V B;  4XR6 A;  3UKG A;  2R7F A;  4D7N A;  3M1E A;  1Q1V A;  2GM4 A;  4UV8 A;  3K10 A;  2L2O A;  1FBS A;  3W2V A;  1B4A A;  1T6S A;  4M3B A;  3HOV J;  1BR1 A;  1P7I A;  2DQL A;  3DKX A;  3FMQ A;  1AKH A;  2D5V A;  1MMS A;  2XIG A;  1QPI A;  5K1Y A;  1FMV A;  1WSU A;  3H9Q A;  2QF7 A;  4OIQ F;  4X0G A;  3BR2 A;  1Y39 A;  1QA6 A;  2ELK A;  3QPS A;  2ESH A;  4HQE A;  1RUN A;  3JSP A;  2JJ7 A;  1HDD C;  4D0P A;  3OMY A;  5IYD J;  4F52 A;  4KJZ A;  4BAC A;  2EFP A;  2KHM A;  1B8I B;  1TTY A;  5D5U B;  2E7X A;  3EUH C;  1FYK A;  2IS1 A;  4GRI A;  3VFZ A;  4GYG A;  3E6B A;  5KCM A;  4BEH B;  1FIP A;  2X51 A;  4HQM A;  1XX5 A;  2P8T A;  2A5W A;  4W97 A;  3WOD F;  5FKN A;  1BJZ A;  2IVM A;  2IA2 A;  3E0J B;  3WTS C;  2HXI A;  1Z6R A;  2L7M P;  2EIM H;  1FSE A;  3QYE A;  3H3U A;  5E18 F;  1XSX A;  2HWV A;  4DBQ A;  4E7L A;  3LSJ A;  3CUQ C;  5EG0 B;  4NUB A;  4XM3 A;  2BW3 A;  5AIP A;  5FKM A;  5IP9 J;  4BE0 A;  1OCP A;  1R7J A;  1GUU A;  2ZJP F;  5CVJ A;  2VON A;  2YX7 A;  1BA5 A;  1RRJ A;  5ERI A;  1TQP A;  5F1J A;  1YFH A;  1AU7 A;  4BJ5 C;  3OOP A;  2Y48 A;  3OYL A;  3ZMZ A;  4YIR X;  3Q0U A;  3V7S A;  4IZZ A;  1T95 A;  4FE7 A;  1T38 A;  5GAE J;  5C4J J;  1SAU A;  3RYR A;  1RES A;  4RB3 C;  3QU6 A;  1V54 H;  4XKV A;  1UAA A;  2LLK A;  2LKX A;  4AU7 A;  3Q3S A;  3SDG A;  5EGO A;  4KNY A;  3GTP J;  5CVR A;  3CUO A;  2B7E A;  4HV6 A;  2CQK A;  3OL3 A;  1Y8R B;  2MA3 A;  1I1G A;  1YYV A;  4O3M A;  4KIT B;  2KMU A;  2QSF X;  1MDM B;  3D1N I;  3KEQ A;  2DJI A;  2ZJR F;  5IPA A;  1B9N A;  1UEL B;  3I55 I;  3I71 A;  3ERE D;  1X4O A;  2ZXI A;  4ENN A;  1IV6 A;  5M3M J;  1X4P A;  1WQ2 A;  4C2M J;  3CF5 F;  1W5T A;  5DCM B;  2K5C A;  2DPD A;  1T39 A;  1FOX A;  1KU2 A;  2M5W A;  3TMO A;  3H9J A;  2H1L A;  3W6J B;  4UUS A;  4BHP A;  3V7C A;  2HU9 A;  2R5Y A;  4G6T B;  4V19 K;  5FFZ A;  1MBK A;  5D6F A;  2X6X A;  3G4S I;  1H0M A;  5CYV A;  2E7W A;  2YUS A;  2ADU A;  4ZJZ A;  2N8G A;  2P5L C;  4CCM A;  4F55 A;  4HNV A;  2V6E A;  5HS8 A;  2F5F A;  3TDZ C;  2OZU A;  5IYB J;  5M5Y J;  1ZKG A;  1RET A;  3QOE A;  4DYC A;  3BR6 A;  1XCV A;  5HNH A;  3ZQL A;  1ODD A;  3OS0 A;  1ZG3 A;  2EWN A;  3QQA A;  5ED4 A;  3LAJ A;  5BMZ A;  3LST A;  4XKB A;  2LC2 A;  3W2A A;  2YPR A;  3HOY J;  2OJE D;  1S8N A;  4BEH A;  1MJA A;  3ZN1 A;  1FPQ A;  5KVR A;  2G0E A;  3UR3 C;  5FB2 A;  4M6Y A;  1XCB A;  1ZRE A;  1GV5 A;  2AQE A;  4ZZL A;  4ZDO A;  2LNB A;  3FWE A;  4LK0 F;  1GVJ A;  1IUY A;  1FWZ A;  4BY1 J;  4AC0 A;  4E7J A;  2PJR B;  4RGU A;  3GZ5 A;  4KN7 X;  1F4K A;  4XNF A;  3NEU A;  4IRG A;  3ZMU A;  4DYQ A;  1FJL A;  1KZH A;  5EG0 A;  1MW7 A;  1DGR M;  2XRL A;  1IRZ A;  2X1D A;  1W5S A;  3KP4 A;  2CV1 A;  2K9M A;  4DJA A;  3I54 A;  1WKM A;  4JK1 X;  1KA8 A;  3FF5 A;  3FXO A;  1F1Z A;  5DTD A;  3I59 B;  4KIG A;  4A3M J;  1WFX A;  3KP6 A;  2VQC A;  1QVU A;  2DA3 A;  2ZME C;  4G7H F;  3ULQ B;  5F6F A;  1SFE A;  4CSW A;  3F22 A;  1BC7 C;  2IW5 A;  1KQ9 A;  2ID6 A;  1B72 B;  5EYR A;  3OIO A;  4EEF G;  3CCY A;  4BBR J;  1CF7 B;  2JT1 A;  3IKV A;  4A5M A;  3CO6 C;  3JCU C;  2GAU A;  1ETX A;  4HF0 A;  2BXY A;  5AIQ A;  2L3D A;  3S1Q J;  3FBN B;  3KEO A;  3LA7 A;  2HDW A;  5CQG A;  2R0Q C;  3KPH A;  3S14 J;  3RIR A;  4RM2 A;  4B4C A;  2QEX I;  1WI9 A;  4HF1 A;  1MDM A;  2MC3 A;  4FX4 A;  3DEE A;  2CUE A;  1FC3 A;  2DFE A;  2HQR A;  4ESF A;  2AO9 A;  3ROU A;  1OLT A;  3QYB A;  3VYT B;  1IXS B;  3GFJ A;  3H3Z A;  4B1R A;  1PP8 F;  2O5R A;  4BXF A;  1NK3 P;  2P7C B;  2UV1 A;  3LFK A;  5DCM A;  4D9J A;  1XSV A;  2KIQ A;  1JHH A;  3GX4 X;  1ONV A;  3HOT A;  3L2U A;  4XBF A;  2HVR A;  3HPG A;  1X3W B;  1AOY A;  1RIO H;  2VOP A;  2QUF A;  3H35 A;  2BXZ A;  4F3Q A;  1YOV B;  5L3D A;  4II3 A;  2WB1 N;  4EM2 A;  4C2T A;  1MGT A;  2FBH A;  3HOZ J;  4C3H J;  3ZMT A;  2MYS A;  3LSR A;  1ULY A;  1YIJ I;  4PGH A;  5HS7 A;  2GA2 A;  1FY7 A;  1ACI A;  1YS7 A;  5C4X J;  2COM A;  2IT0 A;  1OKR A;  1LVA A;  1X3Z B;  1BIA A;  4HW0 A;  1OPC A;  5DEQ A;  2A05 A;  2MLG A;  1Z7L A;  3HJE A;  2EV0 A;  4NDL A;  4PSW A;  4RA2 A;  1TC3 C;  4XLN F;  1PYV A;  4LB5 A;  3MQ0 A;  3CJR B;  3TOB A;  1O3R A;  1DPR A;  2IXS A;  2WV1 A;  4FTH A;  1U78 A;  1FLI A;  1U5T C;  3CC2 I;  2EA2 A;  1BR2 A;  5KAI C;  1U8B A;  1ZGJ A;  2DYS H;  3J81 Z;  2H6B A;  4I76 A;  2OF7 A;  1NK2 P;  3IP4 B;  1G4D A;  4JOM A;  4ZYD A;  1P6R A;  4C9Y A;  5LEJ A;  2ELJ A;  3U1K A;  1JKR C;  4IQ4 A;  1FNN A;  4U0Y A;  2EJR A;  1OYW A;  2V1N A;  1BJA A;  3H5A A;  3I59 A;  3VSL A;  4C30 A;  3E6M A;  1SFX A;  3I56 I; 
#chains in the Genus database with same CATH homology
 2WWY A;  3IC7 A;  1U3E M;  3HSE A;  2VOO A;  1CF7 A;  3RJP A;  3K2Z A;  2DW4 A;  1S7O A;  2JRT A;  4AD9 A;  1QQI A;  4G94 A;  4U0V A;  1YW8 A;  1Z6T A;  3IWZ A;  1UST A;  1KU9 A;  3U9G A;  2VE8 A;  4CDG A;  3F23 A;  3PQK A;  3VEP A;  3W6K B;  2RN7 A;  3RKY A;  5BOX A;  3JAM Z;  5EEH A;  3F6V A;  4ENJ A;  3MZY A;  3O2P E;  4RAZ A;  2P7V B;  3LWF A;  5D5X B;  1KYZ A;  4UUV A;  1FT9 A;  2O3F A;  3GO5 A;  1P4X A;  3V4G A;  4A5N A;  3MWM A;  4P96 A;  4GGG A;  2XAS A;  2XHK A;  4LFU A;  1ZGA A;  3LQQ A;  5BPI A;  1W7P B;  2KRF A;  5D8K B;  2EFO A;  5CVV A;  4EVI A;  3WGI A;  1RNL A;  3HIF A;  3B73 A;  3IRR A;  2Z9O A;  4A6D A;  3BDD A;  1QGP A;  1YQA A;  1G3W A;  4OIR F;  4OOI A;  3P9I A;  4RB2 C;  5LGT A;  4KN4 X;  5A2Q Z;  5ICF A;  2AS5 F;  3P9K A;  3RPU A;  5L3F A;  2JTV A;  4IHS A;  1IN8 A;  2XV4 S;  2HZT A;  4XSX F;  4KIF A;  3DP7 A;  4LK1 F;  2XGX A;  4HOB A;  1K7A A;  2FOK A;  4HX7 A;  1E2X A;  2XAG A;  5E17 F;  3S2W A;  3G3Z A;  2CYY A;  2Y0M A;  3TOA A;  3DEU A;  3J80 K;  2CFX A;  4U7B A;  3U2R A;  4P55 A;  2ZNZ A;  3T0Y A;  4R79 A;  3ZQ7 A;  3C18 A;  1ZHF A;  2VOD A;  4ZH4 F;  3QU3 A;  4L5J A;  2V6C A;  3WE2 A;  4MTE A;  1R5G A;  2RVC A;  3HRM A;  5H6R A;  1GXP A;  2K02 A;  3ECH A;  3SZT A;  3C3W A;  2V79 A;  2CG4 A;  4L0Y B;  1C0W A;  4I0A A;  1K79 A;  5E20 A;  3WTX C;  2HGC A;  3SQN A;  2PI0 A;  4M74 A;  3GF2 A;  2ZXJ A;  1B59 A;  1JE8 A;  3MFK A;  5L3B A;  4G9Y A;  1P2F A;  5DD8 A;  2F2E A;  1HKT A;  2X4H A;  2Z99 A;  4QLC U;  1QPM A;  3KP5 A;  4MGR A;  1FSH A;  2F5D A;  3SZP A;  1TW2 A;  3K1M A;  4A0Y A;  1FBQ A;  5E1Z B;  1LJ9 A;  2VN2 A;  4KIC A;  4EV0 A;  4A2U A;  2HDC A;  3CO7 C;  5A2Q K;  3R61 A;  2WTE A;  2QLZ A;  4NB5 A;  4EM1 A;  4A0X A;  3KLO A;  4FHT A;  4I0B A;  1R00 A;  3LAP A;  3PQJ A;  4YIF A;  4CZZ A;  2NAZ A;  2OBP A;  2VT2 A;  2QBY B;  2A61 A;  3QPH A;  2E1C A;  4IPA A;  2OU2 A;  2ZFW A;  3TDU C;  4GCV A;  2BEO A;  3GFI A;  3IRQ A;  1HQC A;  3KP3 A;  3GVA A;  1YIO A;  3WGH A;  1IN6 A;  4HZF A;  3LQR A;  1TQM A;  2PLY A;  4I02 A;  3WE3 A;  3E5Q A;  2FML A;  2XAF A;  2VBZ A;  4ASN A;  2YSR A;  3FM3 A;  4K2E A;  4M73 A;  4ESB A;  2M30 A;  1QZZ A;  2C6Y A;  4Q47 A;  2DQR A;  4EJW A;  1O3S A;  1T0F A;  3QPT A;  5HS9 A;  5FO5 A;  1OR7 A;  2W57 A;  1XN7 A;  5FLX Z;  3HTU A;  1G3Y A;  2VC1 A;  5LEK A;  2L4A A;  2IJL A;  1MZB A;  2ISZ A;  2UXX A;  2FU4 A;  3TO9 A;  3MCZ A;  4HX4 A;  1SMY F;  4LD5 A;  4G7Z F;  4AIH A;  2EV5 A;  3HSR A;  3P7N A;  4UV9 A;  1ON1 A;  4Q5S F;  2CW0 F;  4BHC A;  3RTR A;  4U0W A;  1UHW A;  3SHF A;  5LBQ A;  1B9M A;  3BJ6 A;  5EEG A;  1W7P D;  3F21 A;  3L00 A;  1ZH5 A;  4WWC A;  4HLY A;  1DDN A;  2NYX A;  5HLI A;  5JI6 A;  5ILS A;  2QQA A;  3IL2 A;  2FEZ A;  3QRF F;  1J59 A;  1XSD A;  4OMZ A;  4RB1 A;  2W24 A;  1ZLK A;  1KQ0 A;  3EQL F;  3R0J A;  4L0Z B;  2OZ6 A;  1YW9 A;  2QBY A;  2ESN A;  4RGX A;  4HV5 A;  3WTZ A;  3FZV A;  5HOO A;  1ZRD A;  1S7A A;  4KMU X;  3GWZ A;  2OQR A;  3GUD A;  2FA5 A;  4L9V A;  3DFG A;  1JHF A;  2ZBK A;  3DQV C;  3DXJ F;  4LLG F;  4E70 A;  1XDS A;  1KYW A;  4MTD A;  2L4M A;  1VTN C;  5FD6 A;  1LB2 A;  2ZME B;  4Q4Z F;  1HXD A;  4M9X A;  3HYI A;  3CLO A;  2NNY A;  5H20 A;  5DD4 A;  3HSF A;  3WG9 A;  1BN5 A;  2W25 A;  2CGP A;  1U2W A;  5J8C A;  2IRF G;  4CIC A;  1X3U A;  3O3K A;  3F8M A;  5FD5 A;  3WGG A;  1R1T A;  2VT3 A;  1KU7 A;  1EH6 A;  3E3V A;  4IXA A;  4MQV A;  2DAO A;  2Z5U A;  2CO5 A;  3FXR A;  3KET A;  5ILU A;  1U8R A;  1DPU A;  5DCF A;  1IAW A;  1R5H A;  1L3L A;  1SAX A;  1XGN A;  5FLX K;  1OYI A;  2DPU A;  2XKP A;  3C1D A;  4CXF A;  3KZZ A;  4Q48 A;  1E17 A;  2H27 A;  3RDI A;  1V4R A;  3ELK A;  2HYF A;  1U5T B;  3RKW A;  4JQF A;  1FBU A;  3E97 A;  3T8T A;  1IXC A;  1MKM A;  3J7A O;  1H9T A;  4N9H A;  4ZYE A;  1K6O A;  1Q1H A;  1KU3 A;  3GZ6 A;  4L18 B;  4EGZ A;  3AAF A;  4BHB A;  1YW7 A;  4WXC A;  5LGU A;  4RGS A;  3RPQ A;  5J6X A;  3I58 A;  4IHT A;  4KIB A;  4DQ2 A;  2W84 A;  4HDU A;  2L01 A;  1XGM A;  1J0R A;  3OV8 A;  3ISP A;  5HLH A;  4QWQ A;  1O57 A;  1Z91 A;  1I1S A;  4I7H A;  2LF7 A;  5LHG A;  1HW2 A;  5TRD A;  4OIN F;  4UNO A;  5K5O A;  1H9G A;  4WXH A;  1FYL A;  1LQ1 A;  4HDV A;  2JSC A;  3ZMD A;  2J5P A;  4EMS A;  1FX7 A;  5HVQ C;  4WF2 A;  2PJP A;  1EH8 A;  5LGN A;  2V1D A;  2DI3 A;  3N97 A;  1RI7 A;  4S05 A;  1J2X A;  3DKW A;  2EK5 A;  3SXY A;  2H6C A;  4BAY A;  3T5X A;  4Z2Y A;  1STZ A;  2Q0O A;  1UB9 A;  3F3X A;  1P4W A;  4IJA A;  4LB6 B;  2XRN A;  3J80 Z;  1SD7 A;  1R1U A;  4GO1 A;  5BPD A;  5H6Q A;  2V1X A;  5FFX A;  4N0B A;  4YFK F;  3E6C C;  3JTH A;  1ZLJ A;  4G8X A;  2FBK A;  4YG2 F;  2WC2 A;  1RUO A;  1ZRF A;  1TQI A;  2FBI A;  2VE9 A;  2BBY A;  1EH7 A;  2A3S A;  3SFZ A;  1O3Q A;  2J5O A;  4ZZD A;  2OQG A;  3CTA A;  4AIK A;  4IRH A;  2O61 A;  2AXL A;  2B0L A;  4OU0 A;  5IT3 A;  2XVC A;  1XDU A;  4KDP A;  1U6G A;  1D3Y A;  4RAY A;  2GQQ A;  1TW3 A;  4O6J A;  2Z33 A;  3DPL C;  1A04 A;  2VC0 A;  1B6A A;  5LHI A;  5LHH A;  1HSJ A;  3ABT A;  4TV7 A;  1BJA A;  1F5T A;  2BV6 A;  4XLP F;  1HW5 A;  2HS5 A;  1S3J A;  1IW7 F;  1FYM A;  3WTW C;  3K9T A;  4KYW A;  5L3E A;  2DTR A;  3BP8 A;  1P4A A;  4MHG A;  3TGN A;  2L54 A;  1I5Z A;  4JBA A;  2LDU A;  3WU1 B;  1TBX A;  3ZN0 A;  4S04 A;  1IRF A;  5F64 A;  2MLK A;  2DFI A;  1BM9 A;  1HKS A;  2A6H F;  2V9V A;  3K1P A;  4ENK A;  1IF1 A;  5BS6 A;  2A07 F;  1KGS A;  3RYP A;  4L9T A;  3CJN A;  2UWM A;  4LMY A;  4HF2 A;  3IKT A;  4M72 A;  4B8X A;  1R22 A;  5JFR A;  3T1B A;  2MD5 A;  4UHT A;  3BZ6 A;  2F5C A;  1XGS A;  1BI3 A;  3M7G A;  2UXN A;  2R3S A;  3BOQ A;  4PCQ A;  3MAJ A;  5HDK A;  1O3T A;  2ETH A;  3HOS A;  2DK8 A;  2QQB A;  3MEX A;  2EV6 A;  1S29 A;  2D1H A;  4HA8 A;  2EFN A;  1OMI A;  5ILV A;  2OAZ A;  3HRU A;  4GXO A;  1QZY A;  3K69 A;  1J9I A;  1WRJ A;  1I27 A;  2Q2E A;  2OD5 A;  4Y15 A;  3FMR A;  5CJ9 A;  3F8B A;  2O6G E;  2NRA C;  3WTU C;  4ZYG A;  1R1V A;  1W7P A;  1PDN C;  3GFL A;  3ECO A;  3V7R A;  1IRG A;  4LG0 B;  3M8F A;  2HTS A;  3Q5F A;  5LLQ A;  2M8E A;  2RKH A;  5K5Q A;  5ICG A;  3I0T A;  2TDX A;  4EJV A;  1LDD A;  1ZAO A;  1AWC A;  3BPV A;  2XKO A;  1ZG1 A;  2XAQ A;  4UVA A;  3JTG A;  1G3T A;  1QNT A;  3I53 A;  2HEO A;  2UZK A;  4R1H A;  4BXU A;  2RNJ A;  2JPB A;  4YII A;  5D8L B;  2QEN A;  4EM0 B;  5D5W B;  1SD4 A;  3V8J A;  4WK8 F;  1SMT A;  1BBY A;  1XB4 A;  3IWF A;  5JVT A;  2G7H A;  4L5I A;  2FXA A;  1JXS A;  2ZCW A;  2XUB A;  2ELH A;  3B02 A;  5CLS A;  2LF8 A;  3HUG A;  3CUQ B;  4EJU A;  2QVO A;  2OA4 A;  4OIO F;  3REO A;  4ETS A;  3D0S A;  2VBX A;  2PG4 A;  1JGS A;  4NHJ A;  3F72 A;  1IN4 A;  3RKX A;  4KMF A;  2GXB A;  4DNC A;  2EB7 A;  4LLN A;  1L0O C;  4BYY A;  1LEB A;  2PMH A;  2ZO4 A;  4KFC A;  2LKP A;  4G7O F;  2V1U A;  3GEZ A;  5LRR A;  1J7K A;  3EYY A;  2H94 A;  2ISY A;  4UXN A;  4BH9 A;  2A68 F;  2DT5 A;  3FHZ A;  1D5V A;  4OIP F;  3D5L A;  3ABU A;  4HYE A;  3I5U A;  4MQ9 F;  3WTT C;  2FSW A;  5IT9 K;  2H09 A;  3CDH A;  4CYD A;  1BI1 A;  4WXD A;  3EUH A;  1Z9C A;  1ZRC A;  3DF8 A;  3C7J A;  1FP2 A;  3KE2 A;  2FE3 A;  3NRV A;  1DP7 P;  5HDG A;  1EV7 A;  4AIJ A;  2M45 A;  4MEX F;  4MEY F;  3KCC A;  2G9W A;  3M8E A;  3H92 A;  2RQP A;  2X0L A;  2P6T A;  4FT8 A;  3CUQ A;  1SFU A;  1YO5 C;  2RDP A;  3FX3 A;  3FM5 A;  3KP2 A;  1PUE E;  2G7U A;  4R8H A;  1ZN2 A;  1IZ1 A;  1W4M A;  2IP2 A;  4BNC A;  4Y13 A;  3QP6 A;  3LA3 A;  3BJA A;  5CVI A;  4LGW A;  2P5K A;  2ZKZ A;  4CO8 A;  1LEA A;  4HX8 A;  4ON0 A;  4G6D A;  2FNA A;  2NNN A;  3BWG A;  3GLX A;  5DYM A;  2WV0 A;  2PEX A;  4HAM A;  2MH2 A;  2MH9 A;  2K4J A;  2HKX A;  3BJO A;  1RZ4 A;  5FGM A;  4LLL A;  1TNT A;  1UCR A;  1R58 A;  2RV8 A;  1TLH B;  2JPC A;  4NQW A;  2CSO A;  2PBI A;  2IA1 A;  4UVC A;  2HYG D;  1YLF A;  1T2K A;  5L3G A;  5DV5 A;  1MJ9 A;  3L7W A;  2Y75 A;  4I09 A;  4P5O A;  3GXO A;  3R0A A;  1ZAR A;  2FQ3 A;  1R23 A;  3ML6 A;  3QAH A;  1Z7U A;  3N4M A;  2KJC A;  1S6L A;  3M9A A;  5J8F A;  4MNU A;  3BRO A;  5DUK A;  2STT A;  1NHA A;  1IN5 A;  2YU3 A;  5E1W A;  2ZME A;  4A12 A;  3VB2 A;  5F1R A;  3V8K A;  2P5V A;  3KZY A;  4A0Z A;  2F5E A;  2XAJ A;  4I2O A;  3Q9S A;  5E1X A;  4XSZ F;  1B1B A;  1OYY A;  2D1V A;  4N9I A;  2K4B A;  2FF4 A;  2KKO A;  3F8F A;  4RS8 A;  2MBF A;  2A69 F;  1G6N A;  2NS0 A;  3KFW X;  4I01 A;  3COA C;  2HKO A;  1K78 B;  3HTS B;  3K1N A;  3G73 A;  4YFN F;  2STW A;  5TJJ A;  1P92 A;  4M71 A;  2XAH A;  1J75 A;  4IF4 A;  1LNW A;  5D4R A;  1G3S A;  2A5Y B;  3E5U A;  1D8K A;  1XMK A;  1XMA A;  3HRT A;  2DLL A;  1U5T A;  2DO7 A;  1SD6 A;  3HHG A;  2P4W A;  3ZMV A;  1QBJ A;  3NQO A;  3P9C A;  4ESJ A;  1TNS A;  1IXR C;  4PGG A;  2YX4 A;  4RB0 A;  2E1N A;  1BIB A;  3R6S A;  1ZYR F;  3TO7 A;  1ZG5 A;  3JSO A;  4U7D A;  1BC8 C;  1D8J A;  5E8G A;  3IHU A;  1BI2 A;  1YTY A;  2L02 A;  3VOE A;  4HLX A;  2GA1 A;  3FMS A;  4KT5 C;  2ACJ A;  3GFM A;  2FNP A;  1QO0 D;  3Q9V A;  4OMY A;  3WTV C;  3O6B B;  1MJB A;  3R4K A;  2W85 A;  4P9F A;  2HFH A;  3ZP5 A;  1PP7 U;  3F6O A;  5K5R A;  1LDK B;  1YS6 A;  5DUI A;  1Z1D A;  5D6E A;  1XD7 A;  3BPX A;  2HOE A;  2ZJ2 A;  4UVB A;  1MD0 A;  2QQ9 A;  1XGO A;  4BQA A;  1K78 A;  3V8L A;  2EA4 A;  2P6S A;  2O8X A;  2IA0 A;  2PQ8 A;  2EFQ A;  3F8N A;  2RGV A;  1Z05 A;  2D2W A;  4RGR A;  1O7L A;  1R36 A;  2KIF A;  3KLN A;  4KUM A;  2R7D A;  3L09 A;  4EGY A;  2D45 A;  3FXU A;  4F7Z A;  2O03 A;  1I6X A;  4AWX B;  2QZ8 A;  5CVU A;  3GYH X;  3PFI A;  2A6E F;  4Y17 A;  2HQN A;  1HST A;  2K86 A;  1F9N A;  1HW1 A;  2DBB A;  1WWX A;  2VBY A;  1USS A;  1UFM A;  2GXG A;  4L9J A;  2RC4 A;  4PZJ A;  3ZMS A;  4M9Z A;  2IPQ X;  3HRS A;  3RI4 A;  2JZY A;  3DPT A;  2GZW A;  4EQQ A;  3R60 A;  5HLG A;  4O5V A;  4EJT A;  3MZH A;  2CWE A;  4A6E A;  3J81 K;  5JR3 A;  2KIM A;  4WX9 A;  3WTY C;  2O0Y A;  3I64 A;  5E8I A;  2GIV A;  2ZNY A;  2VXZ A;  3E6D A;  4U88 A;  3TO6 A;  3QP5 A;  4ZYH A;  2EFW A;  1KQ8 A;  2BGC A;  4ENM A;  1BI0 A;  1DUX C;  3LA2 A;  3BY6 A;  3L9F A;  1O7F A;  4AVP A;  2M1B A;  3JW4 A;  3U1D A;  2LSO A;  4KA4 A;  1J5Y A;  4B09 A;  3JAM K;  2VBW A;  4YFX F;  4GYI A;  2GWR A;  3ZPL A;  4IRI A;  4EJO A;  4P9U A;  5LRS A;  5IT9 Z;  2QM3 A;  4M6X A;  1FOK A;  3FXQ A;  5ICE A;  4PDK A;  2QWW A;  3VOD A;  5L3C A;  4IVN A;  4FX0 A;  3L2C A;  1LDJ A;  2KJB A;  4XRF A;  2K27 A;  1FZP B;  4M9S A;  3QOP A;  2YR2 A;  4G6Q A;  3I4P A;  1YG2 A;  2FMY A;  5HDN A;  5ICC A;  5KK1 A;  4WCG A;  2M87 A;  5JHU A;  3T8R A;  4CHU A;  1IN7 A;  3EET A;  1REP C;  4CGZ A;  1GXQ A;  1HKQ A;  3F8C A;  2K7L A;  3GW2 A;  3E5X A;  2PN6 A;  4L9N A;  1BOA A;  4LJZ F;  2DU9 A;  3DV8 A;  1UHM A;  1GHC A;  1V3F A;  2BYV E;  2PFB A;  1ON2 A;  3TKY A;  4HBL A;  3EYI A;  4LG0 A;  3EDP A;  1Y0U A;  2KIU A;  4H0E A;  1HBX G;  3KP7 A;  2FRH A;  2PMU A;  2DK5 A;  3HHH A;  2HTJ A;  1SD5 A;  1CGP A;  1FP1 D;  2HR3 A;  2QYO A;  4I98 B;  1T98 A;  2BE5 F;  5AON A;  3K0L A;  5BQT A;  2Q8K A;  6PAX A;  2Z3Y A;  3TQN A;  5D4S A;  2XRO A;  5DDG A;  5D5V B;  2R7F A;  3M1E A;  4UV8 A;  1FBS A;  1B4A A;  1T6S A;  2DQL A;  3FMQ A;  2XIG A;  5K1Y A;  1WSU A;  4OIQ F;  2ESH A;  4HQE A;  1RUN A;  3JSP A;  4D0P A;  2EFP A;  1TTY A;  5D5U B;  2E7X A;  1FYK A;  3VFZ A;  4GYG A;  3E6B A;  4HQM A;  2P8T A;  3WOD F;  2IVM A;  2IA2 A;  3WTS C;  1Z6R A;  1FSE A;  3H3U A;  5E18 F;  1XSX A;  2HWV A;  3CUQ C;  5AIP A;  1R7J A;  5CVJ A;  2VON A;  2YX7 A;  5ERI A;  1TQP A;  1YFH A;  3OOP A;  2Y48 A;  3ZMZ A;  3V7S A;  1T38 A;  3RYR A;  4RB3 C;  3QU6 A;  4KNY A;  5CVR A;  3CUO A;  4HV6 A;  2CQK A;  2MA3 A;  1I1G A;  1YYV A;  4O3M A;  1MDM B;  3KEQ A;  1B9N A;  3I71 A;  3ERE D;  4ENN A;  1WQ2 A;  1W5T A;  5DCM B;  2DPD A;  1T39 A;  1KU2 A;  2M5W A;  3W6J B;  4BHP A;  3V7C A;  5FFZ A;  5D6F A;  1H0M A;  5CYV A;  2E7W A;  2ADU A;  2P5L C;  5HS8 A;  2F5F A;  3TDZ C;  2OZU A;  1XCV A;  1ODD A;  1ZG3 A;  2EWN A;  5ED4 A;  3LAJ A;  5BMZ A;  3LST A;  2YPR A;  1S8N A;  1MJA A;  3ZN1 A;  1FPQ A;  5KVR A;  5FB2 A;  4M6Y A;  1XCB A;  1ZRE A;  4ZZL A;  2LNB A;  3FWE A;  4LK0 F;  1GVJ A;  1IUY A;  1FWZ A;  4RGU A;  3GZ5 A;  4KN7 X;  1F4K A;  3NEU A;  4IRG A;  3ZMU A;  1W5S A;  3KP4 A;  3I54 A;  1WKM A;  4JK1 X;  1KA8 A;  3FF5 A;  1F1Z A;  3I59 B;  4KIG A;  3KP6 A;  4G7H F;  3ULQ B;  5F6F A;  1SFE A;  3F22 A;  1BC7 C;  2IW5 A;  1KQ9 A;  1CF7 B;  2JT1 A;  3IKV A;  4A5M A;  3CO6 C;  2GAU A;  4HF0 A;  5AIQ A;  2L3D A;  3KEO A;  3LA7 A;  3RIR A;  4HF1 A;  1WI9 A;  1MDM A;  2MC3 A;  4FX4 A;  1FC3 A;  2HQR A;  4ESF A;  3ROU A;  1IXS B;  3GFJ A;  3H3Z A;  1PP8 F;  2P7C B;  3LFK A;  5DCM A;  1XSV A;  1JHH A;  3GX4 X;  1ONV A;  3HOT A;  4XBF A;  1AOY A;  1RIO H;  2QUF A;  5L3D A;  4EM2 A;  1MGT A;  2FBH A;  3ZMT A;  1ULY A;  4PGH A;  5HS7 A;  2GA2 A;  1FY7 A;  1YS7 A;  2COM A;  2IT0 A;  1OKR A;  1LVA A;  1BIA A;  4HW0 A;  1OPC A;  5DEQ A;  2MLG A;  2EV0 A;  4XLN F;  4LB5 A;  3MQ0 A;  3TOB A;  1O3R A;  1DPR A;  1U78 A;  1FLI A;  1U5T C;  2EA2 A;  1ZGJ A;  3J81 Z;  2H6B A;  1G4D A;  4ZYD A;  1P6R A;  5LEJ A;  1FNN A;  4U0Y A;  2EJR A;  1OYW A;  3I59 A;  3WU0 A;  2VOP A;  3E6M A;  1SFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...