2FRHA

Crystal structure of sara, a transcription regulator from staphylococcus aureus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
GSHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal accessory regulator A
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 41
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2frhA00
1KU3A 4BHBA 1FSHA 2OZ6A 2VXZA 3B02A 1VTNC 2PMHA 4KT5C 3WU1B 3DFGA 3IRQA 4M9SA 1FZPB 1RUNA 2XGXA 1D3YA 5K5OA 3BDDA 4YFXF 1DDNA 1XCVA 3GZ6A 1J0RA 2HWVA 3ZMDA 2Y75A 2BEOA 2GXGA 5J8FA 3GUDA 5IT9Z 4R79A 3GFIA 4N0BA 1SD5A 3HIFA 3H3UA 2Y48A 4M9ZA 5D4SA 4DNCA 2QQBA 1R1TA 1R58A 1U5TA 2KIFA 1KYWA 5ERIA 1HSJA 1QZYA 1K7AA 5LRSA 2FQ3A 1V4RA 5F1RA 1TNSA 1FT9A 1J59A 3TKYA 2AXLA 4OMYA 1QQIA 4UNOA 4O6JA 4I2OA 2TDXA 3GX4X 1MKMA 1J75A 2ZFWA 3IWZA 3FZVA 2PN6A 3L2CA 1SAXA 1G6NA 2R7DA 1PUEE 5ILUA 5FLXZ 4JK1X 3G73A 4WWCA 1OR7A 3L9FA 1W5TA 4IPAA 2FMLA 2MC3A 2XAGA 5ICEA 4HA8A 3P7NA 2QBYB 5FGMA 4N9HA 2XRNA 3H92A 4Q48A 1MGTA 3C3WA 5IT9K 1JHHA 1XSDA 3EUHA 4I0BA 2KJCA 1YLFA 2DFIA 2ZNZA 3E5UA 2QQ9A 2XVCA 5ED4A 2Z9OA 4Q47A 1LEAA 1IF1A 2ESHA 3FX3A 3D0SA 2YSRA 3ABTA 2OAZA 2LSOA 1MDMB 4AWXB 2EA2A 1FP1D 1LDKB 2VONA 1XSXA 3GVAA 5ICCA 4MTDA 2ACJA 2FA5A 1FY7A 2ISZA 2O8XA 2HS5A 5DUIA 1MZBA 2D1HA 5BQTA 2GA1A 1IXRC 4I01A 3KP2A 1R23A 2ELHA 4HDUA 4O5VA 5D8LB 2ZBKA 1EV7A 4NB5A 5LGNA 5L3FA 2BV6A 1O7LA 4L9JA 5LEJA 1NHAA 4L9TA 4A5MA 4HYEA 5LHGA 2DTRA 4LLNA 2HYGD 4KIGA 3C18A 5FLXK 3ZN1A 1USTA 4K2EA 1XCBA 3ULQB 3MAJA 4CGZA 1HW2A 3K0LA 3K1NA 1DUXC 1STZA 2ZMEA 2DLLA 4D0PA 2OU2A 5EEHA 4OIPF 3U2RA 5JFRA 3E97A 5HOOA 5DCFA 3WTXC 4ASNA 3HYIA 4BQAA 1ODDA 1U2WA 4ESBA 1TNTA 4S04A 2EV6A 2OA4A 3S2WA 1HXDA 1WRJA 2ZJ2A 4MNUA 4XSZF 4NQWA 1IN8A 3HRTA 3WE2A 2YU3A 4YIFA 2BE5F 2A3SA 1FBSA 4A5NA 3BZ6A 1RUOA 2PI0A 4HX8A 5LHIA 4G9YA 2ISYA 4BAYA 3JAMZ 3ZMTA 1O57A 1TQIA 2CG4A 3WGHA 3CDHA 4JBAA 5BS6A 4MEYF 2EFPA 1U5TB 4WK8F 2YR2A 1TQMA 4O3MA 1U78A 2DW4A 2RV8A 1BC7C 3K69A 3TDUC 2K86A 2L02A 1I27A 2COMA 1PP7U 2D2WA 4UVCA 1XSVA 4M71A 4CXFA 1IN6A 3E6MA 1C0WA 3OV8A 2F2EA 3TOBA 4HQEA 3AAFA 4DQ2A 4XBFA 5HDKA 2V6CA 2K4BA 2QENA 1S7AA 5J6XA 2KIUA 2E7XA 2XAJA 3F8CA 4HQMA 4MQ9F 4LMYA 2VOOA 4HDVA 3V8JA 3P9KA 1ZGAA 4RGRA 3R61A 2GAUA 2C6YA 4M73A 3DQVC 1KGSA 5LGTA 1HW5A 4ENMA 5DCMB 1YYVA 3JAMK 4RB2C 1U8RA 1G3WA 4U0YA 1H0MA 4EV0A 2VODA 4KMUX 2VC1A 5A2QK 3KLNA 5FFZA 3R4KA 3SHFA 2LDUA 2EFNA 3RYRA 3WTSC 1SMTA 3FXRA 2PMUA 3HRMA 3HUGA 3I59A 4JQFA 1IXSB 3O6BB 5CYVA 2QLZA 3IRRA 2NS0A 2BBYA 3MEXA 1LNWA 5JVTA 2QBYA 3GEZA 2FEZA 1K78B 2JPCA 1YS6A 3GFLA 4IRGA 3RYPA 2F5DA 1KQ8A 4XLPF 4KYWA 4HX4A 2MLGA 2O03A 3N4MA 5TJJA 3QP6A 2XKPA 3R6SA 1FC3A 2M87A 1Z91A 4CZZA 1MDMA 1R36A 3IL2A 2IA2A 4KMFA 1IRGA 4M6YA 4PDKA 3F3XA 1E2XA 3JTHA 1Z6RA 2CYYA 5ICFA 3MQ0A 4KNYA 1WQ2A 1R5GA 1S29A 2Z33A 2HGCA 2MH2A 2ZO4A 4ZZLA 5LEKA 1U3EM 1BIBA 2ZMEB 3DP7A 4FHTA 2EJRA 4A0YA 3HHHA 4YFKF 1P92A 4ZYDA 5E20A 5DEQA 4L0ZB 1GHCA 4G94A 4G7OF 3ZMZA 3RTRA 1HBXG 3BP8A 4G8XA 1SFXA 4ESFA 3BPVA 5JR3A 2VBWA 1LJ9A 4UV8A 3GO5A 1QO0D 2V1XA 3I58A 1BN5A 2CGPA 1AWCA 4LD5A 4P9FA 2RKHA 3I0TA 4LK1F 5E18F 1R7JA 2E1NA 3KETA 2J5OA 2A61A 3U9GA 2XKOA 3SFZA 3RPQA 5EEGA 1J9IA 1S3JA 1IZ1A 2OQGA 3TGNA 1I5ZA 2P4WA 1HKQA 1SD4A 1ULYA 5D6EA 3LQRA 4IHSA 2AS5F 3M9AA 1R5HA 1Q1HA 4KICA 3NEUA 4RB3C 1LDDA 1KA8A 4MTEA 5CVUA 2D45A 1IN7A 4IJAA 2B0LA 1J5YA 4M9XA 5CLSA 3M1EA 4P96A 3I53A 4HLYA 4XLNF 2H09A 2XV4S 2DQLA 4ETSA 2FXAA 3FM3A 1YFHA 1IN4A 2JZYA 3WTVC 1S7OA 3EETA 5HDGA 3REOA 2DK5A 3E6BA 2OZUA 2STTA 1O3RA 1ZH5A 3EYYA 1TW3A 2VBXA 5TRDA 1DP7P 3V7SA 2GIVA 2L4MA 2IP2A 3K2ZA 3WODF 5LHHA 1UHMA 1ZLJA 4HV5A 3LAPA 1L0OC 3F22A 1LDJA 1JXSA 3I59B 5HLGA 1F4KA 5HDNA 5KVRA 4IXAA 4RAYA 2W24A 1ZG5A 4RB0A 3RPUA 4UUVA 2DO7A 3KP5A 2XASA 1T38A 2RDPA 4L9NA 4PCQA 1ZLKA 4LG0A 2M8EA 1B4AA 1V3FA 4HX7A 3HSRA 4RS8A 2X4HA 5DCMA 3R60A 5DD8A 2HZTA 2OD5A 2IT0A 1EH6A 3I64A 2K02A 2CW0F 2VE8A 2F5CA 2HFHA 1CF7A 1G3SA 4P55A 2NAZA 4R8HA 2EWNA 4B09A 5L3CA 5BMZA 1OYWA 1WI9A 3TO6A 3F6VA 4U7DA 4L9VA 1SFUA 5BPIA 2GXBA 3MWMA 3MZYA 1K78A 1BC8C 2DAOA 4L5JA 1J2XA 1EH7A 2HKOA 1T0FA 3O2PE 2CSOA 3DPLC 1Z6TA 3T5XA 4ZYGA 1BBYA 2IA1A 4A2UA 2ZKZA 1QGPA 2L01A 3O3KA 2DPUA 3RKYA 3GW2A 3F8BA 1FP2A 1ZAOA 2FNPA 1ZG1A 4EJWA 2A68F 1O3QA 2Q0OA 1K79A 1BI2A 3HOTA 2G7UA 3EDPA 1D8KA 3WE3A 2W57A 2HKXA 2H94A 3GYHX 1QNTA 1HSTA 2CFXA 3PFIA 2HOEA 1SD7A 3G3ZA 1O7FA 3IKVA 4BHPA 1BOAA 1X3UA 3RJPA 3CO7C 2LNBA 3QPHA 4KN4X 1TQPA 2VE9A 2NYXA 3KP4A 3SQNA 1R00A 4LLLA 4WF2A 2IJLA 4I7HA 4GO1A 2P7VB 3BPXA 5LGUA 2VT3A 3GFMA 3WTYC 4Q4ZF 4CHUA 3LQQA 5CVJA 1S6LA 2K7LA 4ENJA 3PQJA 5J8CA 3C7JA 3WTZA 3J7AO 4F7ZA 4IHTA 3HTSB 3VFZA 2QUFA 2PEXA 2XHKA 1CGPA 2O6GE 4XSXF 3SZPA 1OPCA 3Q5FA 4EJVA 1FX7A 2P5LC 3F8FA 4A0XA 5JI6A 1KU9A 2K27A 1P2FA 3DEUA 4KDPA 2W85A 2FOKA 1S8NA 1OMIA 3JTGA 1ZG3A 3F21A 2XUBA 3M7GA 2DBBA 5AIPA 3MCZA 1RIOH 5FD6A 2EA4A 2IA0A 5FB2A 5E1ZB 1YG2A 2ZNYA 2EFWA 4Z2YA 4CO8A 3KP7A 1T2KA 4BYYA 1T39A 3FF5A 3QP5A 4KN7X 4UV9A 1FBQA 4U0WA 3ABUA 2VT2A 1H9GA 1ZRCA 2BGCA 1FWZA 1FYLA 5JHUA 2E7WA 5F64A 4EGZA 4E70A 1PP8F 3SZTA 5K5RA 5FO5A 1XDUA 3KP6A 3KEOA 4QLCU 1D8JA 2H6CA 3F6OA 3KZZA 5DUKA 4G7HF 4OIQF 2VC0A 3F8MA 3I71A 2KIMA 4U7BA 3LWFA 2Z3YA 2EFOA 2HYFA 4LG0B 1W5SA 3GWZA 1RZ4A 2FMYA 5DYMA 5L3BA 3E3VA 5FD5A 2P5KA 3V7CA 3L00A 1ZRFA 3QU3A 4EJOA 2DK8A 5CVRA 3EQLF 1DPUA 1CF7B 5AONA 2RN7A 2K4JA 2ESNA 3GLXA 1H9TA 2RVCA 4AD9A 1REPC 3HSFA 3ZPLA 1G3TA 4OIOF 1Y0UA 3P9IA 3IKTA 4L0YB 4LLGF 3WGGA 2P6TA 5LRRA 4YFNF 4P9UA 2G9WA 2V9VA 2P6SA 1SD6A 3U1DA 1BJAA 1XGSA 2P7CB 5DD4A 2RNJA 1ZN2A 3ML6A 3C1DA 4PZJA 2ETHA 3ZMVA 5HS7A 2G7HA 1J7KA 1KQ9A 3KP3A 3EYIA 2RC4A 3J80Z 1IN5A 1KYZA 3CUQC 3QOPA 3LFKA 2HEOA 4WXCA 4G6DA 3WTUC 2WV0A 2PFBA 3R0AA 2ADUA 2Q8KA 4IF4A 2QZ8A 4HBLA 4KIFA 4AVPA 3ZQ7A 4EQQA 4GXOA 1XD7A 3PQKA 3TQNA 3GZ5A 1OYIA 1P4WA 5IT3A 3JSPA 4U88A 1E17A 3ROUA 1JE8A 1P4XA 1W7PD 3DV8A 3KFWX 4EM0B 2GA2A 1XGMA 2NNNA 1BI0A 2QWWA 3CJNA 1USSA 4RGXA 4HV6A 4AIKA 2EV0A 2FE3A 3Q9VA 4OU0A 4Y15A 3BOQA 3WU0A 1HQCA 3RI4A 1ZRDA 3LA3A 3HRSA 1FYKA 5E17F 1TBXA 4ZYEA 2A5YB 5E1WA 1EH8A 1I6XA 5D6FA 2FNAA 3FMSA 2EFQA 3FMRA 5HS8A 3LAJA 3RKXA 3CTAA 5DDGA 4RGSA 1BI3A 4U0VA 1YS7A 5F6FA 1XGOA 2KKOA 3I4PA 3J80K 3LA2A 3VB2A 3FXQA 1A04A 3BJ6A 2W25A 3CUQA 2PG4A 4LGWA 1FBUA 4WCGA 2J5PA 4LFUA 3RKWA 2YX7A 1Z9CA 1YW9A 4BHCA 4S05A 5BPDA 2F5FA 5KK1A 4NHJA 2ZXJA 2O61A 4LB5A 1MD0A 2P5VA 5E8GA 1Z7UA 4M72A 1G3YA 3HSEA 5HLHA 3N97A 4UHTA 3HTUA 4WXHA 1FYMA 1UHWA 3WTWC 3DXJF 2QVOA 1ZREA 4CYDA 2FF4A 3JW4A 3T8RA 2UXXA 3K1MA 1T98A 3QAHA 6PAXA 5K1YA 2W84A 1MJAA 3TO9A 1YW8A 2H6BA 2HQRA 4PGHA 2Z5UA 1FOKA 4EJUA 4HOBA 4YG2F 2DI3A 3DKWA 3IC7A 1W7PB 2CWEA 3VODA 4IRIA 2LF7A 2R3SA 3BJOA 4LJZF 1B9NA 5D5UB 1GXPA 1XN7A 3E6CC 3L7WA 4KIBA 4OIRF 1UB9A 4FT8A 3GF2A 4KA4A 2VOPA 4ZH4F 3RDIA 5HVQC 4HF1A 3ERED 2MD5A 3HOSA 2A07F 3R0JA 5D5WB 2PBIA 1B59A 4OINF 1G4DA 3ECHA 2XAQA 4YIIA 3H3ZA 1RNLA 1ZYRF 1BIAA 1IXCA 1GXQA 2Q2EA 4RGUA 4WXDA 1YQAA 5ILSA 4UVBA 3WTTC 4A6DA 2A6HF 4EGYA 2FBHA 1IW7F 4EJTA 1YIOA 3W6JB 2PQ8A 1TLHB 3FMQA 4RB1A 2PJPA 2VBZA 4LK0F 5AIQA 2F5EA 1BI1A 3NRVA 1TTYA 2M5WA 1MJBA 1DPRA 1ON1A 2GZWA 4HZFA 2JPBA 2MA3A 2KJBA 1O3TA 2L4AA 3LA7A 4GYGA 2CO5A 4BNCA 3BJAA 2DU9A 3KZYA 1IAWA 2V79A 1ZARA 2RQPA 3I5UA 5HS9A 4HF0A 2MLKA 1R22A 1U6GA 5CVIA 1JHFA 2JSCA 3VOEA 1B1BA 2IVMA 2O0YA 3DPTA 3FM5A 4HLXA 1FPQA 1GVJA 3LSTA 1XGNA 1AOYA 3E6DA 4BH9A 4HF2A 3F23A 3K1PA 3COAC 4MGRA 4TV7A 2L3DA 4GCVA 5LLQA 2XAFA 1FLIA 1ZHFA 1BM9A 1ON2A 2UXNA 3IHUA 2UWMA 3I54A 2R7FA 3WGIA 1LQ1A 1I1GA 2E1CA 1F5TA 4UVAA 4FX4A 3CUQB 2XIGA 5FFXA 2EV5A 1TW2A 3QPTA 3QRFF 2FBIA 4EM2A 4XRFA 3MFKA 4Y17A 1IRFA 4IRHA 2IW5A 4ON0A 1KQ0A 2M30A 4Q5SF 3F8NA 2M1BA 5DV5A 1W4MA 4ZYHA 4AIJA 1KU2A 1D5VA 1B9MA 1K6OA 2QYOA 1ZGJA 1RI7A 1IUYA 3V4GA 3P9CA 5A2QZ 2VN2A 2FSWA 1SMYF 4A6EA 3KLOA 2HTSA 3TO7A 5E8IA 5ICGA 2MH9A 5L3GA 4L18B 2CQKA 2OBPA 1XB4A 2D1VA 4FX0A 1P4AA 2RGVA 2M45A 3ZP5A 4HAMA 2WWYA 2YX4A 3BWGA 4G7ZF 3M8EA 4I0AA 1ONVA 2YPRA 5CVVA 1XMAA 2V1DA 2EB7A 1YTYA 2KRFA 4ENNA 2H27A 4AIHA 2OQRA 4GYIA 4QWQA 1HKSA 3JSOA 2GQQA 2A69F 1YW7A 3V7RA 2FBKA 3M8FA 1JGSA 4B8XA 2IPQX 1SFEA 3HHGA 2NNYA 3J81Z 5LBQA 4ENKA 4I98B 2JT1A 1P6RA 1F1ZA 2HR3A 5H20A 3BY6A 3SXYA 1L3LA 4L5IA 4ZZDA 3CLOA 1W7PA 5CJ9A 4G6QA 2DQRA 2DPDA 2Y0MA 1XDSA 4H0EA 4OOIA 2JTVA 2WC2A 5E1XA 4I02A 4UXNA 2L54A 5L3EA 3RIRA 2PLYA 4IVNA 2GWRA 3V8KA 1WKMA 2FRHA 2QQAA 1FNNA 2XAHA 4HW0A 1KU7A 3T0YA 4MEXF 4KUMA 2A6EF 4A12A 4Y13A 1FSEA 3MZHA 2HQNA 1Z1DA 1I1SA 5H6RA 2O3FA 1R1UA 1HW1A 2DT5A 1HKTA 4CDGA 4I09A 5D5XB 4EM1A 1R1VA 1WWXA 1T6SA 2XROA 1MJ9A 2WTEA 3VEPA 3ZMSA 3T1BA 3ZMUA 3L09A 3CUOA 1QPMA 2LF8A 5K5QA 3Q9SA 3D5LA 4MHGA 4LB6B 2X0LA 3J81K 3GFJA 1XMKA 1QZZA 3F72A 2IRFG 2HDCA 3ELKA 3K9TA 1WSUA 1PDNC 1QBJA 2HTJA 3KE2A 2BYVE 2JRTA 4N9IA 4ESJA 3QU6A 5H6QA 1O3SA 2FU4A 3FHZA 3KCCA 3IWFA 3V8LA 3BROA 1LVAA 3E5QA 4BXUA 1LB2A 1U5TC 3CO6C 2P8TA 3NQOA 4GGGA 1B6AA 5D5VB 2VBYA 2NRAC 5L3DA 5BOXA 2UZKA 4M74A 4WX9A 3WG9A 2STWA 3HRUA 1OKRA 4MQVA 1YO5C 3ECOA 5D4RA 4R1HA 4OMZA 3ZN0A 1UFMA 4KFCA 3GXOA 3B73A 3TDZC 2LKPA 3FWEA 3T8TA 3OOPA 4CICA 1OYYA 4EVIA 2Z99A 4RAZA 1UCRA 2ZCWA 5HLIA 3W6KB 1F9NA 4M6XA 4A0ZA 1Z05A 3DF8A 3FXUA 4P5OA 2V1UA 4PGGA 5D8KB 3TOAA 3E5XA 4EMSA 2EK5A 2QM3A 3ISPA 2MBFA 1LEBA 5ILVA 3KEQA
chains in the Genus database with same CATH superfamily
1KU3A 4BHBA 3L1PA 1UG2A 2OZ6A 2VXZA 1FSHA 3B02A 1VTNC 2PMHA 4KT5C 2DA4A 2IGOA 4BY7J 2LY2A 3CDLA 4AC0A 3WU1B 3DFGA 3IRQA 1Y6IA 4M9SA 1WJDA 2XGXA 1FZPB 1RUNA 4PSWA 1WGXA 1D3YA 1MH3A 5K5OA 3BDDA 1I39A 1Z7LA 4YFXF 4E7LA 1DDNA 2MW8A 1XCVA 2NVYJ 1VQLI 2DODA 4UUSA 3GZ6A 1K4TA 1J0RA 1T08B 2HWVA 5IOZA 3ZMDA 2Y75A 2BEOA 2GXGA 5J8FA 3GUDA 2XAUA 4XOTA 3H9QA 3O8GA 5IT9Z 3M4OJ 1X3ZB 4R79A 4FQGA 2WY7Q 3G4SI 2M4KA 2Y69H 4BBRJ 3LSIA 1AKHA 2JMWA 2ELJA 5IP6A 1JJ6C 3GFIA 4N0BA 4DJAA 1SD5A 3HIFA 3H3UA 2Y48A 1RKWA 1J09A 4QSHA 4FISA 4M9ZA 5D4SA 4B43A 4DNCA 5EYRA 2QQBA 1R1TA 1R58A 3ASOH 2ZC2A 1U5TA 2KIFA 3FK6A 1KYWA 2YUSA 5E3LA 5ERIA 3F0CA 1HSJA 1QZYA 2MFZA 1K7AA 3OYDA 4A3EJ 2JJ7A 5DM6F 4HG2A 4D7NA 3I9V2 5LRSA 2FQ3A 1TWFJ 1V4RA 2W48A 1TNSA 5F1RA 3A01B 3CCQI 4I76A 3JRFA 3PIOF 4DGWB 3RZDJ 1YJ9I 1FT9A 1J59A 3TKYA 1AU7A 3I4MJ 1OCRH 2AXLA 2CQNA 1T0FC 4OMYA 2DA7A 1QQIA 2OCEA 3MMYB 3ONQA 4FTHA 4UNOA 4O6JA 1QVTA 4I2OA 2TDXA 3GX4X 1ZK8A 1MKMA 1J75A 3A0BC 3J7ZI 4XLFA 3DPUA 2VUMJ 2ZFWA 3IWZA 4M6VA 1RESA 2V4JC 3W3CA 3GTLJ 1LFUP 3FZVA 2PN6A 2JUGA 3L2CA 3HL2A 1MBFA 1SAXA 4BS9A 2EBIA 1QHHD 1NH3A 1BW6A 1U9OA 3BQYA 1G6NA 3VWBA 5TGTA 2L7ZA 2DA5A 1FOWA 1WH5A 2R7DA 1PUEE 5ILUA 1K4SA 5FLXZ 3HUGB 4JK1X 4NC6A 4XMYA 3G73A 4WWCA 4P1WA 4BE0A 1OR7A 1BR4A 3HBLA 3L9FA 3ZGKA 1W5TA 2R5ZB 4AM3A 4IX7A 3PNYA 4IPAA 2FMLA 2MC3A 2XAGA 2A05A 5ICEA 4HA8A 3P7NA 4CH7A 2QBYB 5FGMA 3IV5A 2E60A 4N9HA 2XRNA 2ZMEC 3H92A 4Q48A 1XS9A 3CCRI 1PYVA 3S93A 2COBA 1MGTA 3JRAA 3C3WA 5IT9K 2L9RA 1JHHA 1XSDA 3EUHA 3BCBA 2KJCA 1OCCH 1WCMJ 4I0BA 4W97A 2WV1A 1YLFA 2VKHA 2DFIA 2ZNZA 3VPRA 3FXLA 3E5UA 2QQ9A 2XVCA 5ED4A 2Z9OA 4Q47A 2WBMA 2IXSA 2BZTA 4CYCB 1YE9A 2W1OA 1LEAA 4D5CA 1IF1A 1UAAA 1JKQC 2ESHA 3SZGA 2BXYA 3CCVI 3CDIA 3G1MA 5JLWA 3MN2A 3FX3A 4BJ6C 3A03A 3D0SA 3KYLA 4BDZA 3UKGA 2YSRA 4C3JJ 3HB9A 5E3NA 3ABTA 2ID3A 2OAZA 3Q0VA 1G2HA 2LSOA 1MDMB 4HNUA 1ZGWA 4AWXB 1MMSA 2EA2A 3FIWA 1FP1D 3W2WA 1LDKB 1OJLA 2VONA 1X3WB 1XSXA 3GVAA 5ICCA 4MTDA 1JTYA 2ACJA 1SVLA 2FA5A 1FY7A 2R7TA 2ISZA 2L9SA 4XKBA 4AU7A 2O8XA 2HS5A 5DUIA 1E3PA 1MZBA 4RDUA 3TBIA 2D1HA 1MBKA 3CCJI 5BQTA 3Q3SA 2XGEA 2LBFA 2GA1A 3BTCA 1Z77A 4CCLA 2NVXJ 2OTLI 5F04A 1A31A 1IXRC 4I01A 3KP2A 1R23A 2ELHA 4HDUA 1VI0A 4O5VA 5D8LB 1WJEA 3PM1A 4DW6A 5GPCA 3FBIB 4RAFA 3OL3A 2R5YA 4NNJA 3CF2A 4B44A 2ZBKA 1EV7A 4NB5A 5LGNA 5L3FA 2BV6A 5B1BH 1O7LA 4L9JA 5LEJA 2B7EA 3CLQA 1NHAA 4L9TA 4A5MA 4AVZA 4HYEA 5LHGA 2VKDA 1DU0A 2DTRA 2CV2A 4LLNA 2HYGD 4KIGA 3C18A 2KRHA 2IAIA 5FLXK 3ZN1A 1OFCX 1USTA 2V26A 4K2EA 1PVEA 2BVLA 3BC8A 2JRMA 1OISA 1XCBA 3ULQB 3BZKA 3MAJA 1A35A 4CGZA 2BVMA 3RPUD 1HW2A 3MKLA 3K0LA 3DKXA 3K1NA 5F0CA 2EILH 5J4YA 1DUXC 1STZA 5HODA 2ZMEA 3OYFA 4A3DJ 2DLLA 2KMUA 2PX9A 4D0PA 2OU2A 2EINH 5EEHA 3S3MA 4MFEA 4OIPF 4JX6A 3U2RA 5JFRA 5EEAA 3E97A 2CH0A 5HOOA 2H1LA 2EIKH 3H35A 5DCFA 3WTXC 4XICA 4ASNA 2DMTA 5E3MA 2ZFUA 2OPTA 4L5EA 3VYRB 3DBLB 3HC7A 3GCMA 3HYIA 4BQAA 1ODDA 1U2WA 1SAUA 4PK4A 4UUTA 2R7OA 4ESBA 1TNTA 3OYAA 4BKXA 4S04A 3CC4I 2WAQN 1BR1A 2EV6A 2OA4A 3S2WA 1HXDA 1WRJA 2ZJ2A 4MNUA 1RR7A 4OWRB 4XSZF 3C2GA 2OF7A 4NQWA 3MKZA 1IN8A 2ELKA 1VQ5I 3GTKJ 3HRTA 3WE2A 3D1NI 3CJTB 2YU3A 4YIFA 2V6EA 5FKLA 2BE5F 1LFBA 2A3SA 1FBSA 1I50J 2X51A 4A5NA 3BZ6A 3K4NA 2AQEA 2X6YA 1RUOA 2PI0A 4HX8A 3ZXSA 5LHIA 4G9YA 2ISYA 4BAYA 3JAMZ 2NVTJ 1ACIA 3IAS2 3ZMTA 1O57A 1TQIA 2CG4A 2DOFA 3KEYA 3WGHA 2X6XA 1EJ9A 1AKHB 3BTLA 3CDHA 5HNHA 4JBAA 2R92J 3LSHA 3HJEA 5BS6A 5J1RA 4MEYF 4RM3A 4Z6YA 3K70C 4IOCF 1LVKA 4DYRA 2EFPA 3LSGA 3JRGA 4II3A 3CD6I 2HOAA 2CQ7A 3DEWA 1ZR2A 1U5TB 2BXZA 4WK8F 2YR2A 1TQMA 4O3MA 2W82A 1U78A 1P9QC 4PJJA 2DW4A 1TL8A 3DBRB 2L7MP 2LC2A 2RV8A 1BC7C 1A6IA 3K69A 3S1QJ 4A3LJ 2Y9YA 3TDUC 1WJBA 2CQXA 3K7AJ 1V5FA 2K86A 2QKMB 2DFHA 2L02A 1I27A 2AQFA 2E5ZA 2COMA 1R5ID 2VIXA 1PP7U 2XPWA 2D2WA 4UVCA 1R4NB 1XSVA 4M71A 4CUGA 3LFUA 4CXFA 4XR6A 1IN6A 1XC5A 2DMNA 3E6MA 5IY5H 2XB5A 1C0WA 2UV1A 2DYRH 3OV8A 2DJIA 2F2EA 4CCMA 4FETA 3MZ8A 2R7QA 2DA2A 3TOBA 1WPKA 4N4OB 4KT6A 4HQEA 3OWTA 3AAFA 4DQ2A 3OL4A 3LSPA 4XBFA 5HDKA 4EEFG 3A2KA 3ABLH 3PUFA 3GBGA 3DLLF 3LL7A 4JYKA 1ERDA 2ID6A 2V6CA 2K4BA 1Y39A 2BY0A 3NWSA 2QENA 1S7AA 5J6XA 2KIUA 3PJRA 3KYDB 2E7XA 1JTXA 2XAJA 3F8CA 3A01A 4GFBA 2X85A 2XF6A 4HQMA 4MQ9F 4LMYA 2VOOA 5FRNA 4HDVA 3V8JA 3P9KA 1ZGAA 4RGRA 1W0UA 3R61A 1WH7A 3PSIA 3HOVJ 2GAUA 3HOUJ 1D1AA 3CC7I 1MW7A 2C6YA 4M73A 1OCPA 3DQVC 1KGSA 5LGTA 3RQ4A 1HW5A 5GPAA 1XPXA 5DCMB 4ENMA 1YYVA 3JAMK 4RB2C 2M2EA 1U8RA 1G3WA 1YX3A 4U0YA 1MNMC 1H0MA 4EV0A 4F93B 2VODA 4KMUX 2VC1A 5A2QK 3KLNA 3PO2J 4BU2A 4ITVA 5FFZA 3R4KA 1JKPC 4H4KC 1FIPA 3SHFA 2LDUA 2EFNA 3RYRA 2EZLA 1SMTA 4YELA 3WTSC 2CW7A 3FXRA 2PMUA 3HRMA 3S1MJ 1Y8RB 2AO9A 3H9JA 3HUGA 1DGRM 1D0XA 1QHGA 2OUMA 2XGCA 3CQZJ 3I59A 4JQFA 2IS6A 3FXKA 1IXSB 3O6BB 5CYVA 2QLZA 3IRRA 3ZQHA 4A3MJ 3B6CA 2NS0A 2BBYA 2VJIA 3MEXA 4BXXJ 1LNWA 3QYFA 2DT7B 3CP2A 2WAQA 1Y8QB 5JVTA 2QBYA 3KZIC 3DLAA 2HU9A 2HXIA 3GEZA 2FEZA 2K9LA 3H9GA 1K78B 2KP6A 2JPCA 1YS6A 4DBRA 4OAYA 3GFLA 4IRGA 4PJLA 3DU6A 5EGOB 3RYPA 2F5DA 1SFOJ 5FKOA 1KQ8A 1YJNI 3IH3A 4XLPF 3L2QA 2RREA 2LBFB 4KYWA 4F92B 2DFFA 4HX4A 3OOUA 2MLGA 4CYCA 2O03A 3DTIA 2DA1A 3N4MA 5TJJA 4ZDLA 3QP6A 4Y4RA 4RM2A 1NK2P 1OCTC 3BR0A 2LKSA 2XKPA 1S9HA 3CF5F 2V1NA 3GMEA 3R6SA 1FC3A 3OYKA 2M87A 3L2WA 1Z91A 1BW5A 1BL0A 1TWGJ 3AFHA 5TISC 2GOMA 3Q0WA 4CZZA 1MDMA 5M5YJ 1W0TA 1R36A 3IL2A 2ZSIB 4ABZA 2IA2A 3W2AA 4KMFA 1IRGA 3PL8A 1S7EA 4M6YA 1Z3XA 4PDKA 1WZ2A 3F3XA 1E2XA 4C2MJ 3JTHA 1Z6RA 1NTCA 3LSJA 2CYYA 5ICFA 3MQ0A 4KNYA 1WQ2A 5F0HA 1R5GA 2BW3B 1S29A 4HPQA 3BQZA 2Z33A 2HGCA 4J01A 2HXOA 2MH2A 2ZO4A 2P0WA 2RAEA 2LTPA 4XORA 5J1UA 4ZZLA 3VDXA 5LEKA 3JRBA 1U3EM 4LOCA 3F9KA 2VQGA 3ABKH 1BIBA 2ZMEB 3DP7A 4C3IJ 4FHTA 2IEKA 2EJRA 4YRVA 3AG3H 4IO9F 4RBOA 3ZQLA 2I10A 4A0YA 3HHHA 2Y9ZA 4YFKF 1P92A 4ZYDA 5E20A 2K85A 5DEQA 1S72I 4NDLA 4L0ZB 1K61A 1GHCA 3OYEA 3WHCA 4G94A 1R4MB 2V9PA 5K7FA 3K70D 4G7OF 4Y33A 3ZMZA 2IS2A 2ZJPF 2DA6A 3RTRA 3HOXJ 1HBXG 3BP8A 4G8XA 2R93J 1SFXA 3ZQCA 2QCOA 4HNVA 3E0JB 4ESFA 3BPVA 5JR3A 5CQGA 2ZJRF 2VBWA 1LJ9A 4UV8A 3GO5A 1QO0D 3P5JA 2V1XA 2WA0A 3I58A 1U9NA 1WVRA 1BN5A 2CGPA 1AWCA 4KISA 4LD5A 2XSJC 4P9FA 2RKHA 3I0TA 3K4CA 1YOVB 4LK1F 5E18F 1MSEC 1S5LC 1R7JA 2E1NA 5FROA 3KETA 2J5OA 2A61A 2HVRA 2FQ4A 3U9GA 1I6HJ 2H1KA 4XLAA 5HNFA 1LE8A 1TP4A 5KAFC 3W2VA 1IC8A 2XKOA 1YHQI 3H36A 2EZIA 2F4OB 2Y2ZA 3SFZA 3RPQA 5EEGA 1J9IA 1S3JA 1IZ1A 1WJ5A 2OQGA 1MMAA 3TGNA 2R7WA 5IYCJ 2QSFX 1HCRA 4X6AJ 3MD2A 1X2NA 4UY8I 1I5ZA 2YU9J 1HLVA 2P4WA 1HKQA 1SD4A 1ULYA 5D6EA 2K9NA 3Q0UA 5E3OA 3LQRA 3S1RJ 4IHSA 1FTZA 2E36A 2AS5F 3M9AA 3CC2I 1R5HA 1Q1HA 4KICA 3NEUA 2E1OA 5JLXA 4RB3C 1LDDA 1KA8A 1UJ8A 4II2A 2CS3A 3HGGA 4MTEA 1T8IA 5CVUA 1FMVA 2D45A 1IN7A 3OYBA 4ZC3A 4IJAA 2B0LA 3DTEA 3K4JA 1J5YA 4M9XA 5CLSA 3M1EA 3PIPF 5M5XJ 4P96A 3PUBA 3I53A 3JRIA 4HLYA 4I99C 4XLNF 2H09A 2AXTC 2XV4S 3ZCOA 2DQLA 1MMDA 3DTKA 4ETSA 2FXAA 3FM3A 3LSRA 1IN4A 1YFHA 3HOWJ 4A3BJ 1MBJA 2JZYA 3WTVC 3IP4B 1S7OA 1AA7A 3FKIJ 3S1NJ 3EETA 2LP0A 2E2IJ 3E7LA 5HDGA 1UG0A 2MABA 3REOA 3UR3C 2DK5A 3E6BA 2OZUA 3HPGA 4Y7NJ 3OS0A 3CZ6A 3OYMA 4XOPA 2DXIA 2STTA 1O3RA 1VNDA 3K2AA 1ZH5A 3EYYA 4BQOA 1TW3A 2VBXA 3HZJA 5TRDA 3OY9A 1SANA 3VYSB 2M8GX 2OCCH 3RKQA 2V9KA 2GXAA 1DP7P 3V7SA 2GIVA 3I55I 4BQNA 2VKEA 1OCZH 2L4MA 2IP2A 3K2ZA 3WODF 5LHHA 3CCYA 3LSKA 1UHMA 1ZLJA 2X1DA 2WAFA 4HV5A 4CA0A 3LAPA 1L0OC 1RETA 3F22A 2JN6A 3HDDA 1P7IA 1LDJA 2GIZA 3IUOA 3VSKA 1JXSA 1VQOI 3I59B 5HLGA 1F4KA 3OS1A 1ZKGA 5HDNA 5KVRA 4KITB 4IXAA 4RAYA 2W24A 5GAHJ 4XRSA 4X0GA 1ETVA 2DMQA 1JKRC 2X1EA 3OYLA 1JT0A 1ZG5A 4RB0A 2E35A 3RPUA 4UUVA 2DO7A 3KP5A 3HOZJ 2XASA 4B3AA 3GTGJ 1U0JA 1T38A 2RDPA 4L9NA 4PCQA 1ZLKA 1Y1VJ 2M8EA 4LG0A 1FJLA 1IDZA 2Y31A 1B4AA 1V3FA 4HX7A 3HSRA 2LRDA 4QTRA 1H88C 4JX5A 3A0HC 2X4HA 4RS8A 5DCMA 1X2MA 3R60A 1HDDC 5DD8A 2HZTA 2JVGA 2XGDA 4IZZA 1X19A 2I5UA 2E19A 3SDBA 2OD5A 2IT0A 2MG4A 1EH6A 3I64A 1HA8A 2K02A 3LMMA 2TRTA 2CW0F 3AL0C 2VE8A 2F5CA 2HFHA 1CF7A 3OIOA 1SVMA 1G3SA 4P55A 1BA5A 2NAZA 1T56A 4Y3OA 2W00A 3C2HA 3N05A 4R8HA 1TT5B 2EWNA 4B09A 3S17J 5L3CA 3HGYA 5BMZA 1OYWA 5IYDJ 1WI9A 4LIUA 3TO6A 3F6VA 4U7DA 4L9VA 1SFUA 5BPIA 3CJQB 2GXBA 3PNVA 1NK3P 3MWMA 3MZYA 4W1UA 3A1YA 1K78A 2LY9A 3BG3A 2ME0A 1BC8C 1G8XA 2DAOA 4L5JA 4LITA 1J2XA 5EJCA 1TZLA 5EGOA 1EH7A 4BDYA 2HKOA 1RR8C 4BQQA 1VQ8I 1T0FA 3O2PE 2CSOA 4HEA2 3DPLC 1Z6TA 1LPQA 3T5XA 4ZYGA 1BBYA 3S3OA 2IA1A 5F27A 1X1DA 4A2UA 2ZKZA 1XG1A 3VSLA 4OAZA 5JHFA 1QGPA 1IG7A 4BEHB 2L01A 4CCOA 3BCAA 2FX0A 3O3KA 2DPUA 1UHSA 3RKYA 3GW2A 3F8BA 2Z16A 1FP2A 1ZAOA 2FNPA 4RAGA 4EJWA 1ZG1A 2A68F 1O3QA 1G59A 2Q0OA 3FDYA 1K79A 4AYBN 4CCKA 3SYTA 4IHYA 1BI2A 3B6AA 1OLTA 2EQRA 2JK3A 3HOTA 1X58A 3CCEI 1A5JA 2G7UA 1LKXA 4XKWA 3EDPA 3QOEA 1D8KA 4M3GA 5GP9A 3OYGA 3WE3A 1SVOA 4XRMA 2W57A 3M07A 2HKXA 4PJMA 2H94A 2BW3A 3GYHX 1QNTA 2IS4A 1HSTA 2CFXA 2K9QA 3PFIA 2HOEA 5FKMA 1SD7A 2CU7A 3G3ZA 1O7FA 1MBEA 3IKVA 3L2RA 4BHPA 1DQUA 1YRNA 3H5NA 1BOAA 1MH4A 3G1OA 4KJZA 1X3UA 3RJPA 2BHZA 4HSRA 2VASA 3CO7C 1FIAA 2LNBA 4DZPA 3QPHA 4KN4X 1TQPA 2VLAA 2A5WA 3FK7A 2VE9A 2NYXA 3KP4A 3SQNA 2X9DA 1MBGA 3OR1C 2QEXI 1LE8B 1R00A 4LLLA 3GTPJ 3HM5A 2DT6A 3ZQFA 4WF2A 2IJLA 5FLMJ 4I7HA 5J1YA 4GO1A 2P7VB 3BPXA 3W6VA 4PUSA 4LIVA 5LGUA 2VT3A 3GFMA 4CCNA 3WTYC 3X2QH 1B72B 4Q4ZF 4CHUA 1ZR4A 1NG7A 3LQQA 5CVJA 2KLOA 1WFXA 2L2OA 1S6LA 2X48A 3TW7A 4G12A 1Z67A 1JJ8C 1TC3C 2K7LA 4B47A 4XLCA 4BE2A 4ENJA 3PQJA 5J8CA 3C7JA 1HF0A 3GTJJ 3WTZA 3DWLE 3J7AO 1QA6A 2ECCA 4F7ZA 4IHTA 5CKTA 3HTSB 3VFZA 3K10A 4BL0B 2MC4A 2PEXA 2QUFA 2XHKA 4NBQA 3HKZN 1WJCA 1CGPA 2O6GE 2HYJA 4QIWN 5IP9J 4XSXF 3SZPA 5J4VA 1OPCA 4XN3A 1T33A 2DOEA 4IL6C 3Q5FA 4EJVA 3O8HA 1FX7A 2I8DA 1MNEA 3S8PA 2P5LC 3F8FA 4GRIA 4A0XA 2K9MA 5JI6A 1KU9A 3PNTA 4B1RA 3BR5A 2K27A 1MSFC 1P2FA 1JUMA 5M3FJ 1Q1VA 3DEUA 2W85A 4KDPA 1EKEA 2FOKA 1S8NA 1OMIA 3HXLA 3JTGA 1ZG3A 3F21A 2XUBA 3M7GA 2DBBA 3KX2A 3MCZA 3BT9A 5AIPA 1RIOH 1B8IB 2LG4A 5FD6A 3TEDA 2EA4A 2IA0A 4UB6C 5FB2A 2ZXWH 2LMDA 5E1ZB 3IAM2 4S0HB 1YG2A 2ZNYA 2EFWA 4Z2YA 4JX4A 3JR9A 4C3HJ 4CO8A 3OMYA 3KP7A 5E79C 4B48A 4DOZA 1VFCA 2OC6A 1T2KA 4BYYA 2XF5A 1T39A 3FF5A 3QP5A 4KN7X 4UV9A 2ZJQF 1FBQA 4U0WA 1X1PA 1FMWA 3ABUA 2VT2A 1H9GA 1ZRCA 2BGCA 1FWZA 2QA4I 3S15J 1FYLA 2ZXIA 4BUPA 5JHUA 2E7WA 5F64A 4EGZA 4FE4A 2KPMA 4E70A 2XPVA 1PP8F 3SZTA 3HG9A 5K5RA 5FO5A 4IHVA 2CJJA 2HDDA 2JA8J 1XDUA 3KP6A 3KEOA 4DIQA 4N4NB 3FXJA 4QLCU 1D8JA 2H6CA 2NOJB 3F6OA 3KZZA 5DUKA 4AYBA 4G7HF 2HNHA 3CCSI 5KAIC 2HVSA 2WY8Q 2E34A 1VQPI 4OIQF 2VC0A 3BG6A 3CMEI 3F8MA 3I71A 2KIMA 3TP3A 4U7BA 2HPMA 3LWFA 2VI6A 2Z3YA 2EFOA 2HYFA 2R7UA 4LG0B 1W5SA 1ITYA 3GWZA 1RZ4A 2FMYA 5DYMA 2IGNA 1E3OC 4MIMA 5L3BA 1Z21A 4F55A 3K4LA 3E3VA 5FD5A 5BNGA 2P5KA 4E7HA 3V7CA 3L00A 1ZRFA 3CMMA 3ZRGA 3QU3A 4EJOA 2QKLB 2QGUA 1IDYA 1N25A 4E7SA 2F4MB 2DK8A 3BZCA 5CVRA 3H0DA 3EQLF 3OS2A 1DPUA 1CF7B 3FKJA 2Q2EB 2JQ7A 5AONA 2RN7A 2F4IA 2K4JA 2ESNA 1YI2I 1TWHJ 5FKKA 3GLXA 1H9TA 4E7IA 2NXNB 2RVCA 4M3DA 2HI3A 3G71I 3BG5A 4AD9A 4F91B 2JA2A 1REPC 1GDTA 1P7JA 5B5EC 1MMNA 3HSFA 3ZPLA 2LOOA 4QPOA 1G3TA 3OYNA 4OIOF 1MIJA 1Y0UA 3P9IA 4PFOA 3IKTA 4L0YB 1FTTA 4LLGF 5KCMA 2LKXA 3WGGA 2P6TA 5LRRA 4YFNF 2HOTA 4P9UA 2G9WA 2V9VA 2K5CA 1VQMI 2VJ5A 2PJRA 2VXDA 1WHUA 2P6SA 1SD6A 3U1DA 1BJAA 1XGSA 1Y1WJ 2P7CB 5DD4A 2XDVA 2RNJA 1ZN2A 3ML6A 3HKZA 3C1DA 2EIMH 4PZJA 2ETHA 1GVDA 3AG1H 5IYBJ 3ZMVA 5HS7A 2X6OA 2G7HA 2CV0A 1J7KA 4DYCA 3JRCA 4A3JJ 4I6ZA 1EA3A 1KQ9A 3BR1A 3KP3A 2RC4A 2NVUB 3EYIA 1E0EA 3J80Z 2K3FA 2KL4A 3BR6A 1DP3A 4AUXA 2DCEA 1IN5A 1KYZA 3CUQC 3QOPA 4BACA 3LFKA 2DYSH 2HEOA 4WXCA 2DTZA 2KT0A 2L9NA 4G6DA 3WTUC 2ECBA 2WV0A 2PFBA 3BR3A 3CP8A 3R0AA 2ADUA 2Q8KA 4IF4A 4A3KJ 2QZ8A 1YRNB 3VYTB 4HBLA 4KIFA 5EF6A 4AVPA 3ZQ7A 4EQQA 2LVSA 4GXOA 4BEHA 5KHDA 1XD7A 4CSWA 3PQKA 3TQNA 3GZ5A 2JA7J 1OYIA 1P4WA 5IT3A 3JSPA 4U88A 1E17A 2WAEA 3ROUA 3KYCB 3JRDA 1P4XA 2HVQA 1JE8A 5DS9A 3BR2A 3VYUB 1W7PD 2VJJA 3K6GA 3DV8A 3L2VA 3CCUI 3KFWX 4EM0B 4B3XA 2GA2A 4ZJZA 2LD5A 4MO7A 3TW6A 2CUEA 1IUFA 1XGMA 4BGDA 3NWTA 2NNNA 1BI0A 2CFOA 3DEEA 3ZR8X 2LLKA 2QWWA 3CJNA 3CCLI 1USSA 4RGXA 4HV6A 1A36A 9ANTA 4AIKA 5JVGF 2EV0A 2HQAA 2FE3A 3OR2C 3Q9VA 4MFDA 4OU0A 3G1LA 4Y15A 1VQ4I 3BOQA 3WU0A 1HQCA 5DM7F 3FHNA 3CMAI 3RI4A 3LA3A 1ZRDA 3ZOBA 3AKZA 1YX5A 3HRSA 1FYKA 3FISA 5E17F 4M3FA 1TBXA 1ETOA 4ZYEA 2A5YB 4M3BA 2KISA 2GLOA 1H8AC 5E1WA 4NC8A 1IGNA 3E1SA 3TL4X 1EH8A 3DKYA 3OIQA 1WJFA 2H8WA 4YEJA 2VPLA 1I6XA 3IH2A 5D6FA 2FNAA 2R4GA 1ETWA 1R6RA 2EFQA 3FMSA 3FMRA 5HS8A 4C2TA 4NUBA 3LAJA 2E2JJ 4XKVA 1D1BA 3RKXA 3CTAA 5DDGA 4RGSA 4RMNA 1BI3A 4U0VA 1YS7A 4X1EA 1QPIA 4BJ5C 5F6FA 1XGOA 1W36C 2EZHA 1B72A 2KKOA 2VPRA 3I4PA 3J80K 4V2GA 3LA2A 3BTJA 2K9SA 3VB2A 2BY1A 3FXQA 1A04A 2PMZN 1RRJA 4A3GJ 3BJ6A 4IQJA 2W25A 3CUQA 2PG4A 4LGWA 3D5RC 4A93J 2O5RA 1FBUA 1VZ0A 4WCGA 2E1MC 2J5PA 1OR7C 2Z2SB 4LFUA 3ZQIA 3OSGA 2OTJI 3RKWA 2YX7A 5LFAA 1Z9CA 1YW9A 3EUAA 2F5VA 4BHCA 1XMXA 4S05A 4G6TB 1WI3A 1FOXA 3OYCA 2FUG2 3SFIA 1I3AA 5BPDA 1VQ6I 2F5FA 1POGA 3QWLA 3ERMA 5KK1A 1VQ9I 2ZXJA 1ZTRA 3EUHC 4NHJA 2O61A 2IS1A 3SDGA 4NC7A 4LB5A 1MD0A 2P5VA 5E8GA 2XRLA 3H1CA 5EZHA 1Z7UA 1ETXA 4C9YA 1ETQA 4BY1J 2CQQA 4M72A 1B8IA 1G3YA 3HSEA 3QODA 3WU2C 2KFDA 5HLHA 2CUJA 1OQYA 3N97A 4UHTA 1WJAA 3HTUA 4WXHA 3I3LA 1FYMA 1UHWA 4E7KA 3WTWC 3DXJF 3K4MA 4JP0A 2QVOA 1ZREA 4IHWA 2KZGA 4CYDA 5H2FC 2FF4A 2RQQA 2LY1A 3JW4A 3T8RA 2UXXA 4JOMA 3K1MA 2FJ1A 1T98A 3QAHA 6PAXA 1TWCJ 5K1YA 2W84A 1MJAA 3TO9A 5C3EJ 1QZEA 3LSMA 2ME6A 4F52A 1YW8A 2H6BA 2HQRA 4PGHA 2Z5UA 1FOKA 4EJUA 4HOBA 4YG2F 2DI3A 3DKWA 3IC7A 2V7FA 1W7PB 3RQIA 5C44J 2CWEA 3V42A 1BOBA 1H89C 3VODA 4IRIA 5F08A 2LFBA 2M4GA 1BR2A 1LFPA 3G6EI 5F0FA 5M5WJ 2LF7A 2R7RA 2G0EA 3FBNB 1FEXA 4CZCA 5J3LA 2R3SA 3BJOA 4C2UA 4LJZF 1B9NA 4XONA 2EPFA 1ZELA 5EG0A 4IOAF 5D5UB 3UNGC 1SEUA 1GXPA 1V5EA 4PSXA 1XN7A 2DDBA 3E6CC 1PUFA 3L7WA 3I4NJ 3BTIA 2M0CA 4KIBA 4OIRF 1UB9A 2XF7A 1KONA 4FT8A 4D1QA 4DZJA 1DGWY 4XK4A 2Y30A 3GF2A 4KA4A 2VOPA 4ZH4F 2VQHA 3RDIA 5HVQC 3RCOA 4E7JA 2DMUA 4XKCA 2EIJH 4HF1A 3ERED 2MD5A 4U87A 3HOSA 1UELB 2A07F 3R0JA 2KQRA 2O8KA 5F1JA 5D5WB 4FCYA 2GBYA 2PBIA 1B59A 4OINF 2PJRB 1G4DA 2E5NA 2HDWA 3ECHA 2XAQA 4ZDOA 2EH3A 4YIIA 4ZYAA 3H3ZA 3H3VK 1RNLA 1ZYRF 2QF7A 1BIAA 1IXCA 1GXQA 2Q2EA 4RGUA 1IJWC 2Q1ZB 4WXDA 5K7HA 4EATA 2AHQA 2K3PA 1YQAA 3TMOA 4FE7A 5ILSA 1YIJI 4ZTJA 1X1AA 2MYSA 3CJRB 4B4CA 4UVBA 3WTTC 4A6DA 2A6HF 2BY3A 1I3QJ 2CUZA 3H5RA 4EGYA 2FBHA 1IW7F 5C4JJ 1DU6A 2DN0A 1X4OA 1U8BA 4EJTA 1Y56A 5EZGA 3OIPA 1YIOA 4A3CJ 1JKOC 1MNDA 3W6JB 2PQ8A 1TLHB 4XN0A 3FMQA 2PMZA 4RB1A 2PJPA 2E71A 3D5SC 2VBZA 4FASD 4LK0F 5AIQA 2F5EA 1BI1A 2ZSHB 1X1CA 1Z0XA 4PFPA 3NRVA 1TTYA 5J40A 1D0ZA 1KZHA 3I56I 2M5WA 1MJBA 1IRZA 1DPRA 4J19A 1F43A 1ON1A 2GZWA 4RLFA 3MKYB 1SC7A 1JI8A 4HZFA 4IEJA 3ESWB 1GT0C 2QQ8A 2JPBA 2MA3A 2KJBA 1O3TA 2L4AA 1X1BA 3LA7A 4GYGA 2CO5A 4BNCA 4RA2A 3BJAA 2DU9A 3KZYA 1IAWA 2V79A 1ZARA 2IBDA 3QPLA 4MLOA 2RQPA 3I5UA 1ZQ3P 4AIDA 3GTOJ 5HS9A 4D7MA 4IKFA 2LR8A 4HF0A 2MLKA 4E4HA 1R22A 5HLTA 2R7XA 3K4KA 1W36D 1JUPA 1U6GA 5CVIA 1JHFA 5GAGJ 3QPSA 4E7ZA 2JSCA 3DBHB 3VOEA 5GTHC 4Y52J 1B1BA 5EDNA 3GZNB 4J00A 2IVMA 1VF9A 2O0YA 2OJED 3DPTA 2VB6A 3FM5A 4HLXA 2RNGA 1BJZA 3U1KA 3ZQQA 3SEQA 4XLEA 1FPQA 2KZVA 3S2DJ 1GVJA 3LSTA 1XGNA 1AOYA 3E6DA 2F6CA 2L5QA 2GOXB 4BH9A 4HF2A 3OSFA 3F23A 4E6KG 3K1PA 3COAC 4MGRA 3LNQA 1OCOH 2LH9A 4TV7A 2GM4A 2L3DA 3PSFA 2B63J 2DFEA 4GCVA 1R71A 5LLQA 2XAFA 1R9TJ 2ZB9A 2CV1A 1FLIA 1ZHFA 1BM9A 1ON2A 2UXNA 3IHUA 4M3EA 2UWMA 2UUZA 3I54A 2R7FA 3WGIA 3PFYA 2L7KA 1LQ1A 2BOLA 1I1GA 2CMPA 5FLVA 1ETYA 2E1CA 2VQCA 1F5TA 5IPAA 4UVAA 4FX4A 3CUQB 2HZDA 2XIGA 5FFXA 2EV5A 1TW2A 1D0YA 1E3HA 3QPTA 2MSYA 3QRFF 2FBIA 1JGGA 4EM2A 2FD5A 4XRFA 3ASNH 3MFKA 1GUUA 4Y17A 1IRFA 4IRHA 2IW5A 4ON0A 2W7NA 3OYHA 4GDFA 1KQ0A 2M30A 3S2HJ 1GLNA 3QQAA 2VJ4A 3WHBA 4Q5SF 3F8NA 2JA5J 2M1BA 1IV6A 1VQ7I 4UUSB 2VL8A 1MBHA 5DV5A 2NVQJ 1QVUA 1W4MA 2WB1N 4ZYHA 4AIJA 1KU2A 1D5VA 1B9MA 4IQ4A 2QYOA 1K6OA 3NARA 2HOSA 1ZGJA 1RI7A 1IUYA 1HDPA 3V4GA 3P9CA 5A2QZ 2XSDC 2VN2A 4XRSG 2FSWA 1SMYF 4A6EA 4XL9A 2KRCA 3KLOA 4BBSJ 1W1WE 2HTSA 1TWAJ 2JSPA 2TCTA 3TO7A 3LOCA 5E8IA 2DA3A 5ICGA 2X1CA 1IV8A 2MH9A 5L3GA 5K7ZA 4L18B 3U21A 3JCUC 2CQKA 2OBPA 1XB4A 1HC8A 2D1VA 1SFKA 5IOYA 1VQNI 2R7ZJ 1W5CC 2XPUA 4FX0A 1P4AA 2RGVA 2M45A 3ZP5A 1V54H 4HAMA 3MKWB 2HQ5A 4HSTA 1O4XA 2WWYA 2YX4A 3BWGA 4G7ZF 3M8EA 4I0AA 1ONVA 2YPRA 5CVVA 2DOAA 1M1EB 1XMAA 1X4PA 2V1DA 2EB7A 3EUKL 1YTYA 2KRFA 4ENNA 1F36A 3CCMI 2H27A 5J47A 4C30A 4AIHA 3HOYJ 2OV7A 5EG0B 1T95A 2OQRA 4V2FA 4GYIA 4QWQA 1HKSA 5IP7J 3A02A 3M1CA 3KPHA 3JSOA 2GQQA 2A69F 1PUFB 1YW7A 3M8JA 3BG7A 3V7RA 2BY2A 2FBKA 3M8FA 2L7FP 1JGSA 4B8XA 2IPQX 3S16J 3WG7H 1SFEA 1K83J 1K6YA 3HHGA 2NNYA 2WADA 3J81Z 2N8GA 2YS9A 5LBQA 4ENKA 2CUFA 4I98B 2JT1A 1P6RA 3GTMJ 1IO2A 1F1ZA 2KHMA 4BJTA 3JRHA 5GADJ 2HR3A 4ZDPA 5H20A 3BY6A 4XNFA 3SXYA 2E1MB 2FOWA 1JUSA 1L3LA 2X6WA 1UZCA 4L5IA 4ZZDA 3CLOA 3K4BA 2BHYA 1W7PA 3G2BA 5CJ9A 4G6QA 2DQRA 2DPDA 3JREA 4RLQA 3EPZA 1RC9A 2Y0MA 1XDSA 1APLC 5CPRB 4H0EA 2R7VA 3A4CA 4OOIA 2JTVA 2WC2A 1V5GA 5E1XA 1AHDP 1ETKA 4I02A 4UXNA 2L54A 5L3EA 3RIRA 3ABMH 2IGKA 2Y0SN 2W4SA 2O7OA 2M0MA 4IVNA 2PLYA 2GWRA 3V8KA 2JUCA 4D9JA 5GAEJ 4HNTA 1WKMA 2FRHA 4A3IJ 2QQAA 4D5FA 3HPHA 1FNNA 2XAHA 4F3QA 4HW0A 3RSNA 1KU7A 3QYBA 2VKVA 1Y0NA 3T0YA 2QSGX 4MEXF 4CCJA 4XM3A 4KUMA 5B66C 2A6EF 4A12A 2DMPA 4Y13A 4ZTFA 2B9SA 1FSEA 2R5ZA 1V55H 2LK2A 1ENHA 4XQFA 5DTDA 3MZHA 3S3NA 2LYCA 1YJWI 2HQNA 2CW8A 1Z1DA 1I1SA 4XIDA 5H6RA 2ZXHA 2JWTA 2O3FA 1R1UA 1HW1A 2DT5A 1Z3YA 1IRXA 1HKTA 4CDGA 3S32A 4DYQA 3PO3J 3L2UA 4I09A 5D5XB 2M7BA 5FRMA 1GV5A 4V19K 3C2BA 4BXFA 2M7AA 4EM1A 2XC7A 3GTQJ 3J7AY 1XTAA 1R1VA 3TP0A 1WWXA 1ORKA 1T6SA 2XROA 2K40A 2WB1A 4DBQA 1A6QA 2O9LA 1MJ9A 2WTEA 5B1AH 2KDZA 3VEPA 3ZMSA 3T1BA 3ZMUA 2MGQA 3L09A 1RPWA 3CUOA 2H8RA 1QPMA 2LF8A 3GLLA 2R5YB 1N78A 5K5QA 3CMYA 5B3SH 3Q9SA 5CQEA 3D5LA 1VQKI 2NOGA 4MHGA 2DJNA 1D1CA 3CESA 4LB6B 2X0LA 3J81K 1N77A 3GFJA 1XMKA 1QZZA 3H0GJ 3ZQGA 2NS8A 1NG6A 3F72A 3AG4H 2IRFG 1QU3A 2HDCA 3ELKA 2Z1DA 3DU5A 3DCFA 2D5VA 3BLYA 3K9TA 2NS7A 2F48A 5M3MJ 1WSUA 1PDNC 1JT6A 5FKNA 2DDAA 1YITI 1TT0A 4IHXA 1QBJA 2E2HJ 1HOMA 1CQTA 1LUJB 2HTJA 3KE2A 5KNLA 1N75A 2BYVE 2JRTA 4N9IA 1GV2A 3AL0B 2R0QC 3QU6A 5H6QA 2HPIA 4ESJA 1O3SA 2R7SA 2FU4A 3FHZA 3KCCA 2P81A 3IWFA 3H5AA 4HRIA 3V8LA 3OYIA 2KIQA 2A6TA 3BROA 1LVAA 2MD0A 3E5QA 4BXUA 1LB2A 1MMGA 3AG2H 1U5TC 3CO6C 1EF4A 2M3AA 2JVHA 2P8TA 3NQOA 3RZOJ 2XB0X 4GGGA 4A69C 1B6AA 3SJMA 2QSHX 5D5VB 3S14J 2L0KA 2VBYA 5C4XJ 2ICWG 3BG9A 2NRAC 5L3DA 3MVPA 3QYEA 2M9HA 2CRGA 5BOXA 2UZKA 4M74A 4WX9A 4LG3A 1RKTA 3HRUA 3WG9A 4ANJA 2STWA 1OKRA 1FOYA 4NQWB 4MQVA 1YO5C 4PJ0C 3ECOA 3NAUA 5D4RA 4R1HA 4OMZA 3FXMA 2LREA 1UMQA 3ZN0A 4YIRX 3M3YJ 1UFMA 3SEZA 4KFCA 2M34A 3GXOA 4UB8C 4XLHA 3B73A 3TDZC 2IGMA 2LKPA 3FWEA 3T8TA 5LD2C 2L9VA 3OOPA 4A3FJ 2JA6J 4CICA 5GTIC 1OYYA 4EVIA 2Z99A 2KDOA 3J7YJ 4RAZA 1UCRA 3HEFA 3KIOA 1QRYA 2Y0SA 4BE1A 3FXOA 1R49A 2ZCWA 5HLIA 1PJRA 3OYJA 3W6KB 1F9NA 2VQLA 4M6XA 4A0ZA 1Z05A 4PJNA 3DF8A 3FXUA 4P5OA 2V1UA 4PGGA 5D8KB 3TOAA 2EZKA 1D5YA 1XX5A 3E5XA 4QPQA 4EMSA 2EK5A 2QM3A 3ISPA 2MBFA 3IH4A 1LEBA 5FJ8J 5ILVA 3KEQA
chains in the Genus database with same CATH topology
1KU3A 4BHBA 1FSHA 2OZ6A 2VXZA 3B02A 1VTNC 2PMHA 4KT5C 3WU1B 3DFGA 3IRQA 4M9SA 1FZPB 1RUNA 2XGXA 1D3YA 5K5OA 3BDDA 4YFXF 1DDNA 1XCVA 3GZ6A 1J0RA 2HWVA 3ZMDA 2Y75A 2BEOA 2GXGA 5J8FA 3GUDA 5IT9Z 4R79A 3GFIA 4N0BA 1SD5A 3HIFA 3H3UA 2Y48A 4M9ZA 5D4SA 4DNCA 2QQBA 1R1TA 1R58A 1U5TA 2KIFA 1KYWA 5ERIA 1HSJA 1QZYA 1K7AA 5LRSA 2FQ3A 1V4RA 5F1RA 1TNSA 1FT9A 1J59A 3TKYA 2AXLA 4OMYA 1QQIA 4UNOA 4O6JA 4I2OA 2TDXA 3GX4X 1MKMA 1J75A 2ZFWA 3IWZA 3FZVA 2PN6A 3L2CA 1SAXA 1G6NA 2R7DA 1PUEE 5ILUA 5FLXZ 4JK1X 3G73A 4WWCA 1OR7A 3L9FA 1W5TA 4IPAA 2FMLA 2MC3A 2XAGA 5ICEA 4HA8A 3P7NA 2QBYB 5FGMA 4N9HA 2XRNA 3H92A 4Q48A 1MGTA 3C3WA 5IT9K 1JHHA 1XSDA 3EUHA 4I0BA 2KJCA 1YLFA 2DFIA 2ZNZA 3E5UA 2QQ9A 2XVCA 5ED4A 2Z9OA 4Q47A 1LEAA 1IF1A 2ESHA 3FX3A 3D0SA 2YSRA 3ABTA 2OAZA 2LSOA 1MDMB 4AWXB 2EA2A 1FP1D 1LDKB 2VONA 1XSXA 3GVAA 5ICCA 4MTDA 2ACJA 2FA5A 1FY7A 2ISZA 2O8XA 2HS5A 5DUIA 1MZBA 2D1HA 5BQTA 2GA1A 1IXRC 4I01A 3KP2A 1R23A 2ELHA 4HDUA 4O5VA 5D8LB 2ZBKA 1EV7A 4NB5A 5LGNA 5L3FA 2BV6A 1O7LA 4L9JA 5LEJA 1NHAA 4L9TA 4A5MA 4HYEA 5LHGA 2DTRA 4LLNA 2HYGD 4KIGA 3C18A 5FLXK 3ZN1A 1USTA 4K2EA 1XCBA 3ULQB 3MAJA 4CGZA 1HW2A 3K0LA 3K1NA 1DUXC 1STZA 2ZMEA 2DLLA 4D0PA 2OU2A 5EEHA 4OIPF 3U2RA 5JFRA 3E97A 5HOOA 5DCFA 3WTXC 4ASNA 3HYIA 4BQAA 1ODDA 1U2WA 4ESBA 1TNTA 4S04A 2EV6A 2OA4A 3S2WA 1HXDA 1WRJA 2ZJ2A 4MNUA 4XSZF 4NQWA 1IN8A 3HRTA 3WE2A 2YU3A 4YIFA 2BE5F 2A3SA 1FBSA 4A5NA 3BZ6A 1RUOA 2PI0A 4HX8A 5LHIA 4G9YA 2ISYA 4BAYA 3JAMZ 3ZMTA 1O57A 1TQIA 2CG4A 3WGHA 3CDHA 4JBAA 5BS6A 4MEYF 2EFPA 1U5TB 4WK8F 2YR2A 1TQMA 4O3MA 1U78A 2DW4A 2RV8A 1BC7C 3K69A 3TDUC 2K86A 2L02A 1I27A 2COMA 1PP7U 2D2WA 4UVCA 1XSVA 4M71A 4CXFA 1IN6A 3E6MA 1C0WA 3OV8A 2F2EA 3TOBA 4HQEA 3AAFA 4DQ2A 4XBFA 5HDKA 2V6CA 2K4BA 2QENA 1S7AA 5J6XA 2KIUA 2E7XA 2XAJA 3F8CA 4HQMA 4MQ9F 4LMYA 2VOOA 4HDVA 3V8JA 3P9KA 1ZGAA 4RGRA 3R61A 2GAUA 2C6YA 4M73A 3DQVC 1KGSA 5LGTA 1HW5A 4ENMA 5DCMB 1YYVA 3JAMK 4RB2C 1U8RA 1G3WA 4U0YA 1H0MA 4EV0A 2VODA 4KMUX 2VC1A 5A2QK 3KLNA 5FFZA 3R4KA 3SHFA 2LDUA 2EFNA 3RYRA 3WTSC 1SMTA 3FXRA 2PMUA 3HRMA 3HUGA 3I59A 4JQFA 1IXSB 3O6BB 5CYVA 2QLZA 3IRRA 2NS0A 2BBYA 3MEXA 1LNWA 5JVTA 2QBYA 3GEZA 2FEZA 1K78B 2JPCA 1YS6A 3GFLA 4IRGA 3RYPA 2F5DA 1KQ8A 4XLPF 4KYWA 4HX4A 2MLGA 2O03A 3N4MA 5TJJA 3QP6A 2XKPA 3R6SA 1FC3A 2M87A 1Z91A 4CZZA 1MDMA 1R36A 3IL2A 2IA2A 4KMFA 1IRGA 4M6YA 4PDKA 3F3XA 1E2XA 3JTHA 1Z6RA 2CYYA 5ICFA 3MQ0A 4KNYA 1WQ2A 1R5GA 1S29A 2Z33A 2HGCA 2MH2A 2ZO4A 4ZZLA 5LEKA 1U3EM 1BIBA 2ZMEB 3DP7A 4FHTA 2EJRA 4A0YA 3HHHA 4YFKF 1P92A 4ZYDA 5E20A 5DEQA 4L0ZB 1GHCA 4G94A 4G7OF 3ZMZA 3RTRA 1HBXG 3BP8A 4G8XA 1SFXA 4ESFA 3BPVA 5JR3A 2VBWA 1LJ9A 4UV8A 3GO5A 1QO0D 2V1XA 3I58A 1BN5A 2CGPA 1AWCA 4LD5A 4P9FA 2RKHA 3I0TA 4LK1F 5E18F 1R7JA 2E1NA 3KETA 2J5OA 2A61A 3U9GA 2XKOA 3SFZA 3RPQA 5EEGA 1J9IA 1S3JA 1IZ1A 2OQGA 3TGNA 1I5ZA 2P4WA 1HKQA 1SD4A 1ULYA 5D6EA 3LQRA 4IHSA 2AS5F 3M9AA 1R5HA 1Q1HA 4KICA 3NEUA 4RB3C 1LDDA 1KA8A 4MTEA 5CVUA 2D45A 1IN7A 4IJAA 2B0LA 1J5YA 4M9XA 5CLSA 3M1EA 4P96A 3I53A 4HLYA 4XLNF 2H09A 2XV4S 2DQLA 4ETSA 2FXAA 3FM3A 1YFHA 1IN4A 2JZYA 3WTVC 1S7OA 3EETA 5HDGA 3REOA 2DK5A 3E6BA 2OZUA 2STTA 1O3RA 1ZH5A 3EYYA 1TW3A 2VBXA 5TRDA 1DP7P 3V7SA 2GIVA 2L4MA 2IP2A 3K2ZA 3WODF 5LHHA 1UHMA 1ZLJA 4HV5A 3LAPA 1L0OC 3F22A 1LDJA 1JXSA 3I59B 5HLGA 1F4KA 5HDNA 5KVRA 4IXAA 4RAYA 2W24A 1ZG5A 4RB0A 3RPUA 4UUVA 2DO7A 3KP5A 2XASA 1T38A 2RDPA 4L9NA 4PCQA 1ZLKA 4LG0A 2M8EA 1B4AA 1V3FA 4HX7A 3HSRA 4RS8A 2X4HA 5DCMA 3R60A 5DD8A 2HZTA 2OD5A 2IT0A 1EH6A 3I64A 2K02A 2CW0F 2VE8A 2F5CA 2HFHA 1CF7A 1G3SA 4P55A 2NAZA 4R8HA 2EWNA 4B09A 5L3CA 5BMZA 1OYWA 1WI9A 3TO6A 3F6VA 4U7DA 4L9VA 1SFUA 5BPIA 2GXBA 3MWMA 3MZYA 1K78A 1BC8C 2DAOA 4L5JA 1J2XA 1EH7A 2HKOA 1T0FA 3O2PE 2CSOA 3DPLC 1Z6TA 3T5XA 4ZYGA 1BBYA 2IA1A 4A2UA 2ZKZA 1QGPA 2L01A 3O3KA 2DPUA 3RKYA 3GW2A 3F8BA 1FP2A 1ZAOA 2FNPA 1ZG1A 4EJWA 2A68F 1O3QA 2Q0OA 1K79A 1BI2A 3HOTA 2G7UA 3EDPA 1D8KA 3WE3A 2W57A 2HKXA 2H94A 3GYHX 1QNTA 1HSTA 2CFXA 3PFIA 2HOEA 1SD7A 3G3ZA 1O7FA 3IKVA 4BHPA 1BOAA 1X3UA 3RJPA 3CO7C 2LNBA 3QPHA 4KN4X 1TQPA 2VE9A 2NYXA 3KP4A 3SQNA 1R00A 4LLLA 4WF2A 2IJLA 4I7HA 4GO1A 2P7VB 3BPXA 5LGUA 2VT3A 3GFMA 3WTYC 4Q4ZF 4CHUA 3LQQA 5CVJA 1S6LA 2K7LA 4ENJA 3PQJA 5J8CA 3C7JA 3WTZA 3J7AO 4F7ZA 4IHTA 3HTSB 3VFZA 2QUFA 2PEXA 2XHKA 1CGPA 2O6GE 4XSXF 3SZPA 1OPCA 3Q5FA 4EJVA 1FX7A 2P5LC 3F8FA 4A0XA 5JI6A 1KU9A 2K27A 1P2FA 3DEUA 4KDPA 2W85A 2FOKA 1S8NA 1OMIA 3JTGA 1ZG3A 3F21A 2XUBA 3M7GA 2DBBA 5AIPA 3MCZA 1RIOH 5FD6A 2EA4A 2IA0A 5FB2A 5E1ZB 1YG2A 2ZNYA 2EFWA 4Z2YA 4CO8A 3KP7A 1T2KA 4BYYA 1T39A 3FF5A 3QP5A 4KN7X 4UV9A 1FBQA 4U0WA 3ABUA 2VT2A 1H9GA 1ZRCA 2BGCA 1FWZA 1FYLA 5JHUA 2E7WA 5F64A 4EGZA 4E70A 1PP8F 3SZTA 5K5RA 5FO5A 1XDUA 3KP6A 3KEOA 4QLCU 1D8JA 2H6CA 3F6OA 3KZZA 5DUKA 4G7HF 4OIQF 2VC0A 3F8MA 3I71A 2KIMA 4U7BA 3LWFA 2Z3YA 2EFOA 2HYFA 4LG0B 1W5SA 3GWZA 1RZ4A 2FMYA 5DYMA 5L3BA 3E3VA 5FD5A 2P5KA 3V7CA 3L00A 1ZRFA 3QU3A 4EJOA 2DK8A 5CVRA 3EQLF 1DPUA 1CF7B 5AONA 2RN7A 2K4JA 2ESNA 3GLXA 1H9TA 2RVCA 4AD9A 1REPC 3HSFA 3ZPLA 1G3TA 4OIOF 1Y0UA 3P9IA 3IKTA 4L0YB 4LLGF 3WGGA 2P6TA 5LRRA 4YFNF 4P9UA 2G9WA 2V9VA 2P6SA 1SD6A 3U1DA 1BJAA 1XGSA 2P7CB 5DD4A 2RNJA 1ZN2A 3ML6A 3C1DA 4PZJA 2ETHA 3ZMVA 5HS7A 2G7HA 1J7KA 1KQ9A 3KP3A 3EYIA 2RC4A 3J80Z 1IN5A 1KYZA 3CUQC 3QOPA 3LFKA 2HEOA 4WXCA 4G6DA 3WTUC 2WV0A 2PFBA 3R0AA 2ADUA 2Q8KA 4IF4A 2QZ8A 4HBLA 4KIFA 4AVPA 3ZQ7A 4EQQA 4GXOA 1XD7A 3PQKA 3TQNA 3GZ5A 1OYIA 1P4WA 5IT3A 3JSPA 4U88A 1E17A 3ROUA 1JE8A 1P4XA 1W7PD 3DV8A 3KFWX 4EM0B 2GA2A 1XGMA 2NNNA 1BI0A 2QWWA 3CJNA 1USSA 4RGXA 4HV6A 4AIKA 2EV0A 2FE3A 3Q9VA 4OU0A 4Y15A 3BOQA 3WU0A 1HQCA 3RI4A 1ZRDA 3LA3A 3HRSA 1FYKA 5E17F 1TBXA 4ZYEA 2A5YB 5E1WA 1EH8A 1I6XA 5D6FA 2FNAA 3FMSA 2EFQA 3FMRA 5HS8A 3LAJA 3RKXA 3CTAA 5DDGA 4RGSA 1BI3A 4U0VA 1YS7A 5F6FA 1XGOA 2KKOA 3I4PA 3J80K 3LA2A 3VB2A 3FXQA 1A04A 3BJ6A 2W25A 3CUQA 2PG4A 4LGWA 1FBUA 4WCGA 2J5PA 4LFUA 3RKWA 2YX7A 1Z9CA 1YW9A 4BHCA 4S05A 5BPDA 2F5FA 5KK1A 4NHJA 2ZXJA 2O61A 4LB5A 1MD0A 2P5VA 5E8GA 1Z7UA 4M72A 1G3YA 3HSEA 5HLHA 3N97A 4UHTA 3HTUA 4WXHA 1FYMA 1UHWA 3WTWC 3DXJF 2QVOA 1ZREA 4CYDA 2FF4A 3JW4A 3T8RA 2UXXA 3K1MA 1T98A 3QAHA 6PAXA 5K1YA 2W84A 1MJAA 3TO9A 1YW8A 2H6BA 2HQRA 4PGHA 2Z5UA 1FOKA 4EJUA 4HOBA 4YG2F 2DI3A 3DKWA 3IC7A 1W7PB 2CWEA 3VODA 4IRIA 2LF7A 2R3SA 3BJOA 4LJZF 1B9NA 5D5UB 1GXPA 1XN7A 3E6CC 3L7WA 4KIBA 4OIRF 1UB9A 4FT8A 3GF2A 4KA4A 2VOPA 4ZH4F 3RDIA 5HVQC 4HF1A 3ERED 2MD5A 3HOSA 2A07F 3R0JA 5D5WB 2PBIA 1B59A 4OINF 1G4DA 3ECHA 2XAQA 4YIIA 3H3ZA 1RNLA 1ZYRF 1BIAA 1IXCA 1GXQA 2Q2EA 4RGUA 4WXDA 1YQAA 5ILSA 4UVBA 3WTTC 4A6DA 2A6HF 4EGYA 2FBHA 1IW7F 4EJTA 1YIOA 3W6JB 2PQ8A 1TLHB 3FMQA 4RB1A 2PJPA 2VBZA 4LK0F 5AIQA 2F5EA 1BI1A 3NRVA 1TTYA 2M5WA 1MJBA 1DPRA 1ON1A 2GZWA 4HZFA 2JPBA 2MA3A 2KJBA 1O3TA 2L4AA 3LA7A 4GYGA 2CO5A 4BNCA 3BJAA 2DU9A 3KZYA 1IAWA 2V79A 1ZARA 2RQPA 3I5UA 5HS9A 4HF0A 2MLKA 1R22A 1U6GA 5CVIA 1JHFA 2JSCA 3VOEA 1B1BA 2IVMA 2O0YA 3DPTA 3FM5A 4HLXA 1FPQA 1GVJA 3LSTA 1XGNA 1AOYA 3E6DA 4BH9A 4HF2A 3F23A 3K1PA 3COAC 4MGRA 4TV7A 2L3DA 4GCVA 5LLQA 2XAFA 1FLIA 1ZHFA 1BM9A 1ON2A 2UXNA 3IHUA 2UWMA 3I54A 2R7FA 3WGIA 1LQ1A 1I1GA 2E1CA 1F5TA 4UVAA 4FX4A 3CUQB 2XIGA 5FFXA 2EV5A 1TW2A 3QPTA 3QRFF 2FBIA 4EM2A 4XRFA 3MFKA 4Y17A 1IRFA 4IRHA 2IW5A 4ON0A 1KQ0A 2M30A 4Q5SF 3F8NA 2M1BA 5DV5A 1W4MA 4ZYHA 4AIJA 1KU2A 1D5VA 1B9MA 1K6OA 2QYOA 1ZGJA 1RI7A 1IUYA 3V4GA 3P9CA 5A2QZ 2VN2A 2FSWA 1SMYF 4A6EA 3KLOA 2HTSA 3TO7A 5E8IA 5ICGA 2MH9A 5L3GA 4L18B 2CQKA 2OBPA 1XB4A 2D1VA 4FX0A 1P4AA 2RGVA 2M45A 3ZP5A 4HAMA 2WWYA 2YX4A 3BWGA 4G7ZF 3M8EA 4I0AA 1ONVA 2YPRA 5CVVA 1XMAA 2V1DA 2EB7A 1YTYA 2KRFA 4ENNA 2H27A 4AIHA 2OQRA 4GYIA 4QWQA 1HKSA 3JSOA 2GQQA 2A69F 1YW7A 3V7RA 2FBKA 3M8FA 1JGSA 4B8XA 2IPQX 1SFEA 3HHGA 2NNYA 3J81Z 5LBQA 4ENKA 4I98B 2JT1A 1P6RA 1F1ZA 2HR3A 5H20A 3BY6A 3SXYA 1L3LA 4L5IA 4ZZDA 3CLOA 1W7PA 5CJ9A 4G6QA 2DQRA 2DPDA 2Y0MA 1XDSA 4H0EA 4OOIA 2JTVA 2WC2A 5E1XA 4I02A 4UXNA 2L54A 5L3EA 3RIRA 2PLYA 4IVNA 2GWRA 3V8KA 1WKMA 2FRHA 2QQAA 1FNNA 2XAHA 4HW0A 1KU7A 3T0YA 4MEXF 4KUMA 2A6EF 4A12A 4Y13A 1FSEA 3MZHA 2HQNA 1Z1DA 1I1SA 5H6RA 2O3FA 1R1UA 1HW1A 2DT5A 1HKTA 4CDGA 4I09A 5D5XB 4EM1A 1R1VA 1WWXA 1T6SA 2XROA 1MJ9A 2WTEA 3VEPA 3ZMSA 3T1BA 3ZMUA 3L09A 3CUOA 1QPMA 2LF8A 5K5QA 3Q9SA 3D5LA 4MHGA 4LB6B 2X0LA 3J81K 3GFJA 1XMKA 1QZZA 3F72A 2IRFG 2HDCA 3ELKA 3K9TA 1WSUA 1PDNC 1QBJA 2HTJA 3KE2A 2BYVE 2JRTA 4N9IA 4ESJA 3QU6A 5H6QA 1O3SA 2FU4A 3FHZA 3KCCA 3IWFA 3V8LA 3BROA 1LVAA 3E5QA 4BXUA 1LB2A 1U5TC 3CO6C 2P8TA 3NQOA 4GGGA 1B6AA 5D5VB 2VBYA 2NRAC 5L3DA 5BOXA 2UZKA 4M74A 4WX9A 3WG9A 2STWA 3HRUA 1OKRA 4MQVA 1YO5C 3ECOA 5D4RA 4R1HA 4OMZA 3ZN0A 1UFMA 4KFCA 3GXOA 3B73A 3TDZC 2LKPA 3FWEA 3T8TA 3OOPA 4CICA 1OYYA 4EVIA 2Z99A 4RAZA 1UCRA 2ZCWA 5HLIA 3W6KB 1F9NA 4M6XA 4A0ZA 1Z05A 3DF8A 3FXUA 4P5OA 2V1UA 4PGGA 5D8KB 3TOAA 3E5XA 4EMSA 2EK5A 2QM3A 3ISPA 2MBFA 1LEBA 5ILVA 3KEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU3 A;  4BHB A;  1FSH A;  2OZ6 A;  2VXZ A;  3B02 A;  1VTN C;  2PMH A;  4KT5 C;  3WU1 B;  3DFG A;  3IRQ A;  4M9S A;  1FZP B;  1RUN A;  2XGX A;  1D3Y A;  5K5O A;  3BDD A;  4YFX F;  1DDN A;  1XCV A;  3GZ6 A;  1J0R A;  2HWV A;  3ZMD A;  2Y75 A;  2BEO A;  2GXG A;  5J8F A;  3GUD A;  5IT9 Z;  4R79 A;  3GFI A;  4N0B A;  1SD5 A;  3HIF A;  3H3U A;  2Y48 A;  4M9Z A;  5D4S A;  4DNC A;  2QQB A;  1R1T A;  1R58 A;  1U5T A;  2KIF A;  1KYW A;  5ERI A;  1HSJ A;  1QZY A;  1K7A A;  5LRS A;  2FQ3 A;  1V4R A;  5F1R A;  1TNS A;  1FT9 A;  1J59 A;  3TKY A;  2AXL A;  4OMY A;  1QQI A;  4UNO A;  4O6J A;  4I2O A;  2TDX A;  3GX4 X;  1MKM A;  1J75 A;  2ZFW A;  3IWZ A;  3FZV A;  2PN6 A;  3L2C A;  1SAX A;  1G6N A;  2R7D A;  1PUE E;  5ILU A;  5FLX Z;  4JK1 X;  3G73 A;  4WWC A;  1OR7 A;  3L9F A;  1W5T A;  4IPA A;  2FML A;  2MC3 A;  2XAG A;  5ICE A;  4HA8 A;  3P7N A;  2QBY B;  5FGM A;  4N9H A;  2XRN A;  3H92 A;  4Q48 A;  1MGT A;  3C3W A;  5IT9 K;  1JHH A;  1XSD A;  3EUH A;  4I0B A;  2KJC A;  1YLF A;  2DFI A;  2ZNZ A;  3E5U A;  2QQ9 A;  2XVC A;  5ED4 A;  2Z9O A;  4Q47 A;  1LEA A;  1IF1 A;  2ESH A;  3FX3 A;  3D0S A;  2YSR A;  3ABT A;  2OAZ A;  2LSO A;  1MDM B;  4AWX B;  2EA2 A;  1FP1 D;  1LDK B;  2VON A;  1XSX A;  3GVA A;  5ICC A;  4MTD A;  2ACJ A;  2FA5 A;  1FY7 A;  2ISZ A;  2O8X A;  2HS5 A;  5DUI A;  1MZB A;  2D1H A;  5BQT A;  2GA1 A;  1IXR C;  4I01 A;  3KP2 A;  1R23 A;  2ELH A;  4HDU A;  4O5V A;  5D8L B;  2ZBK A;  1EV7 A;  4NB5 A;  5LGN A;  5L3F A;  2BV6 A;  1O7L A;  4L9J A;  5LEJ A;  1NHA A;  4L9T A;  4A5M A;  4HYE A;  5LHG A;  2DTR A;  4LLN A;  2HYG D;  4KIG A;  3C18 A;  5FLX K;  3ZN1 A;  1UST A;  4K2E A;  1XCB A;  3ULQ B;  3MAJ A;  4CGZ A;  1HW2 A;  3K0L A;  3K1N A;  1DUX C;  1STZ A;  2ZME A;  2DLL A;  4D0P A;  2OU2 A;  5EEH A;  4OIP F;  3U2R A;  5JFR A;  3E97 A;  5HOO A;  5DCF A;  3WTX C;  4ASN A;  3HYI A;  4BQA A;  1ODD A;  1U2W A;  4ESB A;  1TNT A;  4S04 A;  2EV6 A;  2OA4 A;  3S2W A;  1HXD A;  1WRJ A;  2ZJ2 A;  4MNU A;  4XSZ F;  4NQW A;  1IN8 A;  3HRT A;  3WE2 A;  2YU3 A;  4YIF A;  2BE5 F;  2A3S A;  1FBS A;  4A5N A;  3BZ6 A;  1RUO A;  2PI0 A;  4HX8 A;  5LHI A;  4G9Y A;  2ISY A;  4BAY A;  3JAM Z;  3ZMT A;  1O57 A;  1TQI A;  2CG4 A;  3WGH A;  3CDH A;  4JBA A;  5BS6 A;  4MEY F;  2EFP A;  1U5T B;  4WK8 F;  2YR2 A;  1TQM A;  4O3M A;  1U78 A;  2DW4 A;  2RV8 A;  1BC7 C;  3K69 A;  3TDU C;  2K86 A;  2L02 A;  1I27 A;  2COM A;  1PP7 U;  2D2W A;  4UVC A;  1XSV A;  4M71 A;  4CXF A;  1IN6 A;  3E6M A;  1C0W A;  3OV8 A;  2F2E A;  3TOB A;  4HQE A;  3AAF A;  4DQ2 A;  4XBF A;  5HDK A;  2V6C A;  2K4B A;  2QEN A;  1S7A A;  5J6X A;  2KIU A;  2E7X A;  2XAJ A;  3F8C A;  4HQM A;  4MQ9 F;  4LMY A;  2VOO A;  4HDV A;  3V8J A;  3P9K A;  1ZGA A;  4RGR A;  3R61 A;  2GAU A;  2C6Y A;  4M73 A;  3DQV C;  1KGS A;  5LGT A;  1HW5 A;  4ENM A;  5DCM B;  1YYV A;  3JAM K;  4RB2 C;  1U8R A;  1G3W A;  4U0Y A;  1H0M A;  4EV0 A;  2VOD A;  4KMU X;  2VC1 A;  5A2Q K;  3KLN A;  5FFZ A;  3R4K A;  3SHF A;  2LDU A;  2EFN A;  3RYR A;  3WTS C;  1SMT A;  3FXR A;  2PMU A;  3HRM A;  3HUG A;  3I59 A;  4JQF A;  1IXS B;  3O6B B;  5CYV A;  2QLZ A;  3IRR A;  2NS0 A;  2BBY A;  3MEX A;  1LNW A;  5JVT A;  2QBY A;  3GEZ A;  2FEZ A;  1K78 B;  2JPC A;  1YS6 A;  3GFL A;  4IRG A;  3RYP A;  2F5D A;  1KQ8 A;  4XLP F;  4KYW A;  4HX4 A;  2MLG A;  2O03 A;  3N4M A;  5TJJ A;  3QP6 A;  2XKP A;  3R6S A;  1FC3 A;  2M87 A;  1Z91 A;  4CZZ A;  1MDM A;  1R36 A;  3IL2 A;  2IA2 A;  4KMF A;  1IRG A;  4M6Y A;  4PDK A;  3F3X A;  1E2X A;  3JTH A;  1Z6R A;  2CYY A;  5ICF A;  3MQ0 A;  4KNY A;  1WQ2 A;  1R5G A;  1S29 A;  2Z33 A;  2HGC A;  2MH2 A;  2ZO4 A;  4ZZL A;  5LEK A;  1U3E M;  1BIB A;  2ZME B;  3DP7 A;  4FHT A;  2EJR A;  4A0Y A;  3HHH A;  4YFK F;  1P92 A;  4ZYD A;  5E20 A;  5DEQ A;  4L0Z B;  1GHC A;  4G94 A;  4G7O F;  3ZMZ A;  3RTR A;  1HBX G;  3BP8 A;  4G8X A;  1SFX A;  4ESF A;  3BPV A;  5JR3 A;  2VBW A;  1LJ9 A;  4UV8 A;  3GO5 A;  1QO0 D;  2V1X A;  3I58 A;  1BN5 A;  2CGP A;  1AWC A;  4LD5 A;  4P9F A;  2RKH A;  3I0T A;  4LK1 F;  5E18 F;  1R7J A;  2E1N A;  3KET A;  2J5O A;  2A61 A;  3U9G A;  2XKO A;  3SFZ A;  3RPQ A;  5EEG A;  1J9I A;  1S3J A;  1IZ1 A;  2OQG A;  3TGN A;  1I5Z A;  2P4W A;  1HKQ A;  1SD4 A;  1ULY A;  5D6E A;  3LQR A;  4IHS A;  2AS5 F;  3M9A A;  1R5H A;  1Q1H A;  4KIC A;  3NEU A;  4RB3 C;  1LDD A;  1KA8 A;  4MTE A;  5CVU A;  2D45 A;  1IN7 A;  4IJA A;  2B0L A;  1J5Y A;  4M9X A;  5CLS A;  3M1E A;  4P96 A;  3I53 A;  4HLY A;  4XLN F;  2H09 A;  2XV4 S;  2DQL A;  4ETS A;  2FXA A;  3FM3 A;  1YFH A;  1IN4 A;  2JZY A;  3WTV C;  1S7O A;  3EET A;  5HDG A;  3REO A;  2DK5 A;  3E6B A;  2OZU A;  2STT A;  1O3R A;  1ZH5 A;  3EYY A;  1TW3 A;  2VBX A;  5TRD A;  1DP7 P;  3V7S A;  2GIV A;  2L4M A;  2IP2 A;  3K2Z A;  3WOD F;  5LHH A;  1UHM A;  1ZLJ A;  4HV5 A;  3LAP A;  1L0O C;  3F22 A;  1LDJ A;  1JXS A;  3I59 B;  5HLG A;  1F4K A;  5HDN A;  5KVR A;  4IXA A;  4RAY A;  2W24 A;  1ZG5 A;  4RB0 A;  3RPU A;  4UUV A;  2DO7 A;  3KP5 A;  2XAS A;  1T38 A;  2RDP A;  4L9N A;  4PCQ A;  1ZLK A;  4LG0 A;  2M8E A;  1B4A A;  1V3F A;  4HX7 A;  3HSR A;  4RS8 A;  2X4H A;  5DCM A;  3R60 A;  5DD8 A;  2HZT A;  2OD5 A;  2IT0 A;  1EH6 A;  3I64 A;  2K02 A;  2CW0 F;  2VE8 A;  2F5C A;  2HFH A;  1CF7 A;  1G3S A;  4P55 A;  2NAZ A;  4R8H A;  2EWN A;  4B09 A;  5L3C A;  5BMZ A;  1OYW A;  1WI9 A;  3TO6 A;  3F6V A;  4U7D A;  4L9V A;  1SFU A;  5BPI A;  2GXB A;  3MWM A;  3MZY A;  1K78 A;  1BC8 C;  2DAO A;  4L5J A;  1J2X A;  1EH7 A;  2HKO A;  1T0F A;  3O2P E;  2CSO A;  3DPL C;  1Z6T A;  3T5X A;  4ZYG A;  1BBY A;  2IA1 A;  4A2U A;  2ZKZ A;  1QGP A;  2L01 A;  3O3K A;  2DPU A;  3RKY A;  3GW2 A;  3F8B A;  1FP2 A;  1ZAO A;  2FNP A;  1ZG1 A;  4EJW A;  2A68 F;  1O3Q A;  2Q0O A;  1K79 A;  1BI2 A;  3HOT A;  2G7U A;  3EDP A;  1D8K A;  3WE3 A;  2W57 A;  2HKX A;  2H94 A;  3GYH X;  1QNT A;  1HST A;  2CFX A;  3PFI A;  2HOE A;  1SD7 A;  3G3Z A;  1O7F A;  3IKV A;  4BHP A;  1BOA A;  1X3U A;  3RJP A;  3CO7 C;  2LNB A;  3QPH A;  4KN4 X;  1TQP A;  2VE9 A;  2NYX A;  3KP4 A;  3SQN A;  1R00 A;  4LLL A;  4WF2 A;  2IJL A;  4I7H A;  4GO1 A;  2P7V B;  3BPX A;  5LGU A;  2VT3 A;  3GFM A;  3WTY C;  4Q4Z F;  4CHU A;  3LQQ A;  5CVJ A;  1S6L A;  2K7L A;  4ENJ A;  3PQJ A;  5J8C A;  3C7J A;  3WTZ A;  3J7A O;  4F7Z A;  4IHT A;  3HTS B;  3VFZ A;  2QUF A;  2PEX A;  2XHK A;  1CGP A;  2O6G E;  4XSX F;  3SZP A;  1OPC A;  3Q5F A;  4EJV A;  1FX7 A;  2P5L C;  3F8F A;  4A0X A;  5JI6 A;  1KU9 A;  2K27 A;  1P2F A;  3DEU A;  4KDP A;  2W85 A;  2FOK A;  1S8N A;  1OMI A;  3JTG A;  1ZG3 A;  3F21 A;  2XUB A;  3M7G A;  2DBB A;  5AIP A;  3MCZ A;  1RIO H;  5FD6 A;  2EA4 A;  2IA0 A;  5FB2 A;  5E1Z B;  1YG2 A;  2ZNY A;  2EFW A;  4Z2Y A;  4CO8 A;  3KP7 A;  1T2K A;  4BYY A;  1T39 A;  3FF5 A;  3QP5 A;  4KN7 X;  4UV9 A;  1FBQ A;  4U0W A;  3ABU A;  2VT2 A;  1H9G A;  1ZRC A;  2BGC A;  1FWZ A;  1FYL A;  5JHU A;  2E7W A;  5F64 A;  4EGZ A;  4E70 A;  1PP8 F;  3SZT A;  5K5R A;  5FO5 A;  1XDU A;  3KP6 A;  3KEO A;  4QLC U;  1D8J A;  2H6C A;  3F6O A;  3KZZ A;  5DUK A;  4G7H F;  4OIQ F;  2VC0 A;  3F8M A;  3I71 A;  2KIM A;  4U7B A;  3LWF A;  2Z3Y A;  2EFO A;  2HYF A;  4LG0 B;  1W5S A;  3GWZ A;  1RZ4 A;  2FMY A;  5DYM A;  5L3B A;  3E3V A;  5FD5 A;  2P5K A;  3V7C A;  3L00 A;  1ZRF A;  3QU3 A;  4EJO A;  2DK8 A;  5CVR A;  3EQL F;  1DPU A;  1CF7 B;  5AON A;  2RN7 A;  2K4J A;  2ESN A;  3GLX A;  1H9T A;  2RVC A;  4AD9 A;  1REP C;  3HSF A;  3ZPL A;  1G3T A;  4OIO F;  1Y0U A;  3P9I A;  3IKT A;  4L0Y B;  4LLG F;  3WGG A;  2P6T A;  5LRR A;  4YFN F;  4P9U A;  2G9W A;  2V9V A;  2P6S A;  1SD6 A;  3U1D A;  1BJA A;  1XGS A;  2P7C B;  5DD4 A;  2RNJ A;  1ZN2 A;  3ML6 A;  3C1D A;  4PZJ A;  2ETH A;  3ZMV A;  5HS7 A;  2G7H A;  1J7K A;  1KQ9 A;  3KP3 A;  3EYI A;  2RC4 A;  3J80 Z;  1IN5 A;  1KYZ A;  3CUQ C;  3QOP A;  3LFK A;  2HEO A;  4WXC A;  4G6D A;  3WTU C;  2WV0 A;  2PFB A;  3R0A A;  2ADU A;  2Q8K A;  4IF4 A;  2QZ8 A;  4HBL A;  4KIF A;  4AVP A;  3ZQ7 A;  4EQQ A;  4GXO A;  1XD7 A;  3PQK A;  3TQN A;  3GZ5 A;  1OYI A;  1P4W A;  5IT3 A;  3JSP A;  4U88 A;  1E17 A;  3ROU A;  1JE8 A;  1P4X A;  1W7P D;  3DV8 A;  3KFW X;  4EM0 B;  2GA2 A;  1XGM A;  2NNN A;  1BI0 A;  2QWW A;  3CJN A;  1USS A;  4RGX A;  4HV6 A;  4AIK A;  2EV0 A;  2FE3 A;  3Q9V A;  4OU0 A;  4Y15 A;  3BOQ A;  3WU0 A;  1HQC A;  3RI4 A;  1ZRD A;  3LA3 A;  3HRS A;  1FYK A;  5E17 F;  1TBX A;  4ZYE A;  2A5Y B;  5E1W A;  1EH8 A;  1I6X A;  5D6F A;  2FNA A;  3FMS A;  2EFQ A;  3FMR A;  5HS8 A;  3LAJ A;  3RKX A;  3CTA A;  5DDG A;  4RGS A;  1BI3 A;  4U0V A;  1YS7 A;  5F6F A;  1XGO A;  2KKO A;  3I4P A;  3J80 K;  3LA2 A;  3VB2 A;  3FXQ A;  1A04 A;  3BJ6 A;  2W25 A;  3CUQ A;  2PG4 A;  4LGW A;  1FBU A;  4WCG A;  2J5P A;  4LFU A;  3RKW A;  2YX7 A;  1Z9C A;  1YW9 A;  4BHC A;  4S05 A;  5BPD A;  2F5F A;  5KK1 A;  4NHJ A;  2ZXJ A;  2O61 A;  4LB5 A;  1MD0 A;  2P5V A;  5E8G A;  1Z7U A;  4M72 A;  1G3Y A;  3HSE A;  5HLH A;  3N97 A;  4UHT A;  3HTU A;  4WXH A;  1FYM A;  1UHW A;  3WTW C;  3DXJ F;  2QVO A;  1ZRE A;  4CYD A;  2FF4 A;  3JW4 A;  3T8R A;  2UXX A;  3K1M A;  1T98 A;  3QAH A;  6PAX A;  5K1Y A;  2W84 A;  1MJA A;  3TO9 A;  1YW8 A;  2H6B A;  2HQR A;  4PGH A;  2Z5U A;  1FOK A;  4EJU A;  4HOB A;  4YG2 F;  2DI3 A;  3DKW A;  3IC7 A;  1W7P B;  2CWE A;  3VOD A;  4IRI A;  2LF7 A;  2R3S A;  3BJO A;  4LJZ F;  1B9N A;  5D5U B;  1GXP A;  1XN7 A;  3E6C C;  3L7W A;  4KIB A;  4OIR F;  1UB9 A;  4FT8 A;  3GF2 A;  4KA4 A;  2VOP A;  4ZH4 F;  3RDI A;  5HVQ C;  4HF1 A;  3ERE D;  2MD5 A;  3HOS A;  2A07 F;  3R0J A;  5D5W B;  2PBI A;  1B59 A;  4OIN F;  1G4D A;  3ECH A;  2XAQ A;  4YII A;  3H3Z A;  1RNL A;  1ZYR F;  1BIA A;  1IXC A;  1GXQ A;  2Q2E A;  4RGU A;  4WXD A;  1YQA A;  5ILS A;  4UVB A;  3WTT C;  4A6D A;  2A6H F;  4EGY A;  2FBH A;  1IW7 F;  4EJT A;  1YIO A;  3W6J B;  2PQ8 A;  1TLH B;  3FMQ A;  4RB1 A;  2PJP A;  2VBZ A;  4LK0 F;  5AIQ A;  2F5E A;  1BI1 A;  3NRV A;  1TTY A;  2M5W A;  1MJB A;  1DPR A;  1ON1 A;  2GZW A;  4HZF A;  2JPB A;  2MA3 A;  2KJB A;  1O3T A;  2L4A A;  3LA7 A;  4GYG A;  2CO5 A;  4BNC A;  3BJA A;  2DU9 A;  3KZY A;  1IAW A;  2V79 A;  1ZAR A;  2RQP A;  3I5U A;  5HS9 A;  4HF0 A;  2MLK A;  1R22 A;  1U6G A;  5CVI A;  1JHF A;  2JSC A;  3VOE A;  1B1B A;  2IVM A;  2O0Y A;  3DPT A;  3FM5 A;  4HLX A;  1FPQ A;  1GVJ A;  3LST A;  1XGN A;  1AOY A;  3E6D A;  4BH9 A;  4HF2 A;  3F23 A;  3K1P A;  3COA C;  4MGR A;  4TV7 A;  2L3D A;  4GCV A;  5LLQ A;  2XAF A;  1FLI A;  1ZHF A;  1BM9 A;  1ON2 A;  2UXN A;  3IHU A;  2UWM A;  3I54 A;  2R7F A;  3WGI A;  1LQ1 A;  1I1G A;  2E1C A;  1F5T A;  4UVA A;  4FX4 A;  3CUQ B;  2XIG A;  5FFX A;  2EV5 A;  1TW2 A;  3QPT A;  3QRF F;  2FBI A;  4EM2 A;  4XRF A;  3MFK A;  4Y17 A;  1IRF A;  4IRH A;  2IW5 A;  4ON0 A;  1KQ0 A;  2M30 A;  4Q5S F;  3F8N A;  2M1B A;  5DV5 A;  1W4M A;  4ZYH A;  4AIJ A;  1KU2 A;  1D5V A;  1B9M A;  1K6O A;  2QYO A;  1ZGJ A;  1RI7 A;  1IUY A;  3V4G A;  3P9C A;  5A2Q Z;  2VN2 A;  2FSW A;  1SMY F;  4A6E A;  3KLO A;  2HTS A;  3TO7 A;  5E8I A;  5ICG A;  2MH9 A;  5L3G A;  4L18 B;  2CQK A;  2OBP A;  1XB4 A;  2D1V A;  4FX0 A;  1P4A A;  2RGV A;  2M45 A;  3ZP5 A;  4HAM A;  2WWY A;  2YX4 A;  3BWG A;  4G7Z F;  3M8E A;  4I0A A;  1ONV A;  2YPR A;  5CVV A;  1XMA A;  2V1D A;  2EB7 A;  1YTY A;  2KRF A;  4ENN A;  2H27 A;  4AIH A;  2OQR A;  4GYI A;  4QWQ A;  1HKS A;  3JSO A;  2GQQ A;  2A69 F;  1YW7 A;  3V7R A;  2FBK A;  3M8F A;  1JGS A;  4B8X A;  2IPQ X;  1SFE A;  3HHG A;  2NNY A;  3J81 Z;  5LBQ A;  4ENK A;  4I98 B;  2JT1 A;  1P6R A;  1F1Z A;  2HR3 A;  5H20 A;  3BY6 A;  3SXY A;  1L3L A;  4L5I A;  4ZZD A;  3CLO A;  1W7P A;  5CJ9 A;  4G6Q A;  2DQR A;  2DPD A;  2Y0M A;  1XDS A;  4H0E A;  4OOI A;  2JTV A;  2WC2 A;  5E1X A;  4I02 A;  4UXN A;  2L54 A;  5L3E A;  3RIR A;  2PLY A;  4IVN A;  2GWR A;  3V8K A;  1WKM A;  2FRH A;  2QQA A;  1FNN A;  2XAH A;  4HW0 A;  1KU7 A;  3T0Y A;  4MEX F;  4KUM A;  2A6E F;  4A12 A;  4Y13 A;  1FSE A;  3MZH A;  2HQN A;  1Z1D A;  1I1S A;  5H6R A;  2O3F A;  1R1U A;  1HW1 A;  2DT5 A;  1HKT A;  4CDG A;  4I09 A;  5D5X B;  4EM1 A;  1R1V A;  1WWX A;  1T6S A;  2XRO A;  1MJ9 A;  2WTE A;  3VEP A;  3ZMS A;  3T1B A;  3ZMU A;  3L09 A;  3CUO A;  1QPM A;  2LF8 A;  5K5Q A;  3Q9S A;  3D5L A;  4MHG A;  4LB6 B;  2X0L A;  3J81 K;  3GFJ A;  1XMK A;  1QZZ A;  3F72 A;  2IRF G;  2HDC A;  3ELK A;  3K9T A;  1WSU A;  1PDN C;  1QBJ A;  2HTJ A;  3KE2 A;  2BYV E;  2JRT A;  4N9I A;  4ESJ A;  3QU6 A;  5H6Q A;  1O3S A;  2FU4 A;  3FHZ A;  3KCC A;  3IWF A;  3V8L A;  3BRO A;  1LVA A;  3E5Q A;  4BXU A;  1LB2 A;  1U5T C;  3CO6 C;  2P8T A;  3NQO A;  4GGG A;  1B6A A;  5D5V B;  2VBY A;  2NRA C;  5L3D A;  5BOX A;  2UZK A;  4M74 A;  4WX9 A;  3WG9 A;  2STW A;  3HRU A;  1OKR A;  4MQV A;  1YO5 C;  3ECO A;  5D4R A;  4R1H A;  4OMZ A;  3ZN0 A;  1UFM A;  4KFC A;  3GXO A;  3B73 A;  3TDZ C;  2LKP A;  3FWE A;  3T8T A;  3OOP A;  4CIC A;  1OYY A;  4EVI A;  2Z99 A;  4RAZ A;  1UCR A;  2ZCW A;  5HLI A;  3W6K B;  1F9N A;  4M6X A;  4A0Z A;  1Z05 A;  3DF8 A;  3FXU A;  4P5O A;  2V1U A;  4PGG A;  5D8K B;  3TOA A;  3E5X A;  4EMS A;  2EK5 A;  2QM3 A;  3ISP A;  2MBF A;  1LEB A;  5ILV A;  3KEQ A; 
#chains in the Genus database with same CATH topology
 1KU3 A;  4BHB A;  3L1P A;  1UG2 A;  2OZ6 A;  2VXZ A;  1FSH A;  3B02 A;  1VTN C;  2PMH A;  4KT5 C;  2DA4 A;  2IGO A;  4BY7 J;  2LY2 A;  3CDL A;  4AC0 A;  3WU1 B;  3DFG A;  3IRQ A;  1Y6I A;  4M9S A;  1WJD A;  2XGX A;  1FZP B;  1RUN A;  4PSW A;  1WGX A;  1D3Y A;  1MH3 A;  5K5O A;  3BDD A;  1I39 A;  1Z7L A;  4YFX F;  4E7L A;  1DDN A;  2MW8 A;  1XCV A;  2NVY J;  1VQL I;  2DOD A;  4UUS A;  3GZ6 A;  1K4T A;  1J0R A;  1T08 B;  2HWV A;  5IOZ A;  3ZMD A;  2Y75 A;  2BEO A;  2GXG A;  5J8F A;  3GUD A;  2XAU A;  4XOT A;  3H9Q A;  3O8G A;  5IT9 Z;  3M4O J;  1X3Z B;  4R79 A;  4FQG A;  2WY7 Q;  3G4S I;  2M4K A;  2Y69 H;  4BBR J;  3LSI A;  1AKH A;  2JMW A;  2ELJ A;  5IP6 A;  1JJ6 C;  3GFI A;  4N0B A;  4DJA A;  1SD5 A;  3HIF A;  3H3U A;  2Y48 A;  1RKW A;  1J09 A;  4QSH A;  4FIS A;  4M9Z A;  5D4S A;  4B43 A;  4DNC A;  5EYR A;  2QQB A;  1R1T A;  1R58 A;  3ASO H;  2ZC2 A;  1U5T A;  2KIF A;  3FK6 A;  1KYW A;  2YUS A;  5E3L A;  5ERI A;  3F0C A;  1HSJ A;  1QZY A;  2MFZ A;  1K7A A;  3OYD A;  4A3E J;  2JJ7 A;  5DM6 F;  4HG2 A;  4D7N A;  3I9V 2;  5LRS A;  2FQ3 A;  1TWF J;  1V4R A;  2W48 A;  1TNS A;  5F1R A;  3A01 B;  3CCQ I;  4I76 A;  3JRF A;  3PIO F;  4DGW B;  3RZD J;  1YJ9 I;  1FT9 A;  1J59 A;  3TKY A;  1AU7 A;  3I4M J;  1OCR H;  2AXL A;  2CQN A;  1T0F C;  4OMY A;  2DA7 A;  1QQI A;  2OCE A;  3MMY B;  3ONQ A;  4FTH A;  4UNO A;  4O6J A;  1QVT A;  4I2O A;  2TDX A;  3GX4 X;  1ZK8 A;  1MKM A;  1J75 A;  3A0B C;  3J7Z I;  4XLF A;  3DPU A;  2VUM J;  2ZFW A;  3IWZ A;  4M6V A;  1RES A;  2V4J C;  3W3C A;  3GTL J;  1LFU P;  3FZV A;  2PN6 A;  2JUG A;  3L2C A;  3HL2 A;  1MBF A;  1SAX A;  4BS9 A;  2EBI A;  1QHH D;  1NH3 A;  1BW6 A;  1U9O A;  3BQY A;  1G6N A;  3VWB A;  5TGT A;  2L7Z A;  2DA5 A;  1FOW A;  1WH5 A;  2R7D A;  1PUE E;  5ILU A;  1K4S A;  5FLX Z;  3HUG B;  4JK1 X;  4NC6 A;  4XMY A;  3G73 A;  4WWC A;  4P1W A;  4BE0 A;  1OR7 A;  1BR4 A;  3HBL A;  3L9F A;  3ZGK A;  1W5T A;  2R5Z B;  4AM3 A;  4IX7 A;  3PNY A;  4IPA A;  2FML A;  2MC3 A;  2XAG A;  2A05 A;  5ICE A;  4HA8 A;  3P7N A;  4CH7 A;  2QBY B;  5FGM A;  3IV5 A;  2E60 A;  4N9H A;  2XRN A;  2ZME C;  3H92 A;  4Q48 A;  1XS9 A;  3CCR I;  1PYV A;  3S93 A;  2COB A;  1MGT A;  3JRA A;  3C3W A;  5IT9 K;  2L9R A;  1JHH A;  1XSD A;  3EUH A;  3BCB A;  2KJC A;  1OCC H;  1WCM J;  4I0B A;  4W97 A;  2WV1 A;  1YLF A;  2VKH A;  2DFI A;  2ZNZ A;  3VPR A;  3FXL A;  3E5U A;  2QQ9 A;  2XVC A;  5ED4 A;  2Z9O A;  4Q47 A;  2WBM A;  2IXS A;  2BZT A;  4CYC B;  1YE9 A;  2W1O A;  1LEA A;  4D5C A;  1IF1 A;  1UAA A;  1JKQ C;  2ESH A;  3SZG A;  2BXY A;  3CCV I;  3CDI A;  3G1M A;  5JLW A;  3MN2 A;  3FX3 A;  4BJ6 C;  3A03 A;  3D0S A;  3KYL A;  4BDZ A;  3UKG A;  2YSR A;  4C3J J;  3HB9 A;  5E3N A;  3ABT A;  2ID3 A;  2OAZ A;  3Q0V A;  1G2H A;  2LSO A;  1MDM B;  4HNU A;  1ZGW A;  4AWX B;  1MMS A;  2EA2 A;  3FIW A;  1FP1 D;  3W2W A;  1LDK B;  1OJL A;  2VON A;  1X3W B;  1XSX A;  3GVA A;  5ICC A;  4MTD A;  1JTY A;  2ACJ A;  1SVL A;  2FA5 A;  1FY7 A;  2R7T A;  2ISZ A;  2L9S A;  4XKB A;  4AU7 A;  2O8X A;  2HS5 A;  5DUI A;  1E3P A;  1MZB A;  4RDU A;  3TBI A;  2D1H A;  1MBK A;  3CCJ I;  5BQT A;  3Q3S A;  2XGE A;  2LBF A;  2GA1 A;  3BTC A;  1Z77 A;  4CCL A;  2NVX J;  2OTL I;  5F04 A;  1A31 A;  1IXR C;  4I01 A;  3KP2 A;  1R23 A;  2ELH A;  4HDU A;  1VI0 A;  4O5V A;  5D8L B;  1WJE A;  3PM1 A;  4DW6 A;  5GPC A;  3FBI B;  4RAF A;  3OL3 A;  2R5Y A;  4NNJ A;  3CF2 A;  4B44 A;  2ZBK A;  1EV7 A;  4NB5 A;  5LGN A;  5L3F A;  2BV6 A;  5B1B H;  1O7L A;  4L9J A;  5LEJ A;  2B7E A;  3CLQ A;  1NHA A;  4L9T A;  4A5M A;  4AVZ A;  4HYE A;  5LHG A;  2VKD A;  1DU0 A;  2DTR A;  2CV2 A;  4LLN A;  2HYG D;  4KIG A;  3C18 A;  2KRH A;  2IAI A;  5FLX K;  3ZN1 A;  1OFC X;  1UST A;  2V26 A;  4K2E A;  1PVE A;  2BVL A;  3BC8 A;  2JRM A;  1OIS A;  1XCB A;  3ULQ B;  3BZK A;  3MAJ A;  1A35 A;  4CGZ A;  2BVM A;  3RPU D;  1HW2 A;  3MKL A;  3K0L A;  3DKX A;  3K1N A;  5F0C A;  2EIL H;  5J4Y A;  1DUX C;  1STZ A;  5HOD A;  2ZME A;  3OYF A;  4A3D J;  2DLL A;  2KMU A;  2PX9 A;  4D0P A;  2OU2 A;  2EIN H;  5EEH A;  3S3M A;  4MFE A;  4OIP F;  4JX6 A;  3U2R A;  5JFR A;  5EEA A;  3E97 A;  2CH0 A;  5HOO A;  2H1L A;  2EIK H;  3H35 A;  5DCF A;  3WTX C;  4XIC A;  4ASN A;  2DMT A;  5E3M A;  2ZFU A;  2OPT A;  4L5E A;  3VYR B;  3DBL B;  3HC7 A;  3GCM A;  3HYI A;  4BQA A;  1ODD A;  1U2W A;  1SAU A;  4PK4 A;  4UUT A;  2R7O A;  4ESB A;  1TNT A;  3OYA A;  4BKX A;  4S04 A;  3CC4 I;  2WAQ N;  1BR1 A;  2EV6 A;  2OA4 A;  3S2W A;  1HXD A;  1WRJ A;  2ZJ2 A;  4MNU A;  1RR7 A;  4OWR B;  4XSZ F;  3C2G A;  2OF7 A;  4NQW A;  3MKZ A;  1IN8 A;  2ELK A;  1VQ5 I;  3GTK J;  3HRT A;  3WE2 A;  3D1N I;  3CJT B;  2YU3 A;  4YIF A;  2V6E A;  5FKL A;  2BE5 F;  1LFB A;  2A3S A;  1FBS A;  1I50 J;  2X51 A;  4A5N A;  3BZ6 A;  3K4N A;  2AQE A;  2X6Y A;  1RUO A;  2PI0 A;  4HX8 A;  3ZXS A;  5LHI A;  4G9Y A;  2ISY A;  4BAY A;  3JAM Z;  2NVT J;  1ACI A;  3IAS 2;  3ZMT A;  1O57 A;  1TQI A;  2CG4 A;  2DOF A;  3KEY A;  3WGH A;  2X6X A;  1EJ9 A;  1AKH B;  3BTL A;  3CDH A;  5HNH A;  4JBA A;  2R92 J;  3LSH A;  3HJE A;  5BS6 A;  5J1R A;  4MEY F;  4RM3 A;  4Z6Y A;  3K70 C;  4IOC F;  1LVK A;  4DYR A;  2EFP A;  3LSG A;  3JRG A;  4II3 A;  3CD6 I;  2HOA A;  2CQ7 A;  3DEW A;  1ZR2 A;  1U5T B;  2BXZ A;  4WK8 F;  2YR2 A;  1TQM A;  4O3M A;  2W82 A;  1U78 A;  1P9Q C;  4PJJ A;  2DW4 A;  1TL8 A;  3DBR B;  2L7M P;  2LC2 A;  2RV8 A;  1BC7 C;  1A6I A;  3K69 A;  3S1Q J;  4A3L J;  2Y9Y A;  3TDU C;  1WJB A;  2CQX A;  3K7A J;  1V5F A;  2K86 A;  2QKM B;  2DFH A;  2L02 A;  1I27 A;  2AQF A;  2E5Z A;  2COM A;  1R5I D;  2VIX A;  1PP7 U;  2XPW A;  2D2W A;  4UVC A;  1R4N B;  1XSV A;  4M71 A;  4CUG A;  3LFU A;  4CXF A;  4XR6 A;  1IN6 A;  1XC5 A;  2DMN A;  3E6M A;  5IY5 H;  2XB5 A;  1C0W A;  2UV1 A;  2DYR H;  3OV8 A;  2DJI A;  2F2E A;  4CCM A;  4FET A;  3MZ8 A;  2R7Q A;  2DA2 A;  3TOB A;  1WPK A;  4N4O B;  4KT6 A;  4HQE A;  3OWT A;  3AAF A;  4DQ2 A;  3OL4 A;  3LSP A;  4XBF A;  5HDK A;  4EEF G;  3A2K A;  3ABL H;  3PUF A;  3GBG A;  3DLL F;  3LL7 A;  4JYK A;  1ERD A;  2ID6 A;  2V6C A;  2K4B A;  1Y39 A;  2BY0 A;  3NWS A;  2QEN A;  1S7A A;  5J6X A;  2KIU A;  3PJR A;  3KYD B;  2E7X A;  1JTX A;  2XAJ A;  3F8C A;  3A01 A;  4GFB A;  2X85 A;  2XF6 A;  4HQM A;  4MQ9 F;  4LMY A;  2VOO A;  5FRN A;  4HDV A;  3V8J A;  3P9K A;  1ZGA A;  4RGR A;  1W0U A;  3R61 A;  1WH7 A;  3PSI A;  3HOV J;  2GAU A;  3HOU J;  1D1A A;  3CC7 I;  1MW7 A;  2C6Y A;  4M73 A;  1OCP A;  3DQV C;  1KGS A;  5LGT A;  3RQ4 A;  1HW5 A;  5GPA A;  1XPX A;  5DCM B;  4ENM A;  1YYV A;  3JAM K;  4RB2 C;  2M2E A;  1U8R A;  1G3W A;  1YX3 A;  4U0Y A;  1MNM C;  1H0M A;  4EV0 A;  4F93 B;  2VOD A;  4KMU X;  2VC1 A;  5A2Q K;  3KLN A;  3PO2 J;  4BU2 A;  4ITV A;  5FFZ A;  3R4K A;  1JKP C;  4H4K C;  1FIP A;  3SHF A;  2LDU A;  2EFN A;  3RYR A;  2EZL A;  1SMT A;  4YEL A;  3WTS C;  2CW7 A;  3FXR A;  2PMU A;  3HRM A;  3S1M J;  1Y8R B;  2AO9 A;  3H9J A;  3HUG A;  1DGR M;  1D0X A;  1QHG A;  2OUM A;  2XGC A;  3CQZ J;  3I59 A;  4JQF A;  2IS6 A;  3FXK A;  1IXS B;  3O6B B;  5CYV A;  2QLZ A;  3IRR A;  3ZQH A;  4A3M J;  3B6C A;  2NS0 A;  2BBY A;  2VJI A;  3MEX A;  4BXX J;  1LNW A;  3QYF A;  2DT7 B;  3CP2 A;  2WAQ A;  1Y8Q B;  5JVT A;  2QBY A;  3KZI C;  3DLA A;  2HU9 A;  2HXI A;  3GEZ A;  2FEZ A;  2K9L A;  3H9G A;  1K78 B;  2KP6 A;  2JPC A;  1YS6 A;  4DBR A;  4OAY A;  3GFL A;  4IRG A;  4PJL A;  3DU6 A;  5EGO B;  3RYP A;  2F5D A;  1SFO J;  5FKO A;  1KQ8 A;  1YJN I;  3IH3 A;  4XLP F;  3L2Q A;  2RRE A;  2LBF B;  4KYW A;  4F92 B;  2DFF A;  4HX4 A;  3OOU A;  2MLG A;  4CYC A;  2O03 A;  3DTI A;  2DA1 A;  3N4M A;  5TJJ A;  4ZDL A;  3QP6 A;  4Y4R A;  4RM2 A;  1NK2 P;  1OCT C;  3BR0 A;  2LKS A;  2XKP A;  1S9H A;  3CF5 F;  2V1N A;  3GME A;  3R6S A;  1FC3 A;  3OYK A;  2M87 A;  3L2W A;  1Z91 A;  1BW5 A;  1BL0 A;  1TWG J;  3AFH A;  5TIS C;  2GOM A;  3Q0W A;  4CZZ A;  1MDM A;  5M5Y J;  1W0T A;  1R36 A;  3IL2 A;  2ZSI B;  4ABZ A;  2IA2 A;  3W2A A;  4KMF A;  1IRG A;  3PL8 A;  1S7E A;  4M6Y A;  1Z3X A;  4PDK A;  1WZ2 A;  3F3X A;  1E2X A;  4C2M J;  3JTH A;  1Z6R A;  1NTC A;  3LSJ A;  2CYY A;  5ICF A;  3MQ0 A;  4KNY A;  1WQ2 A;  5F0H A;  1R5G A;  2BW3 B;  1S29 A;  4HPQ A;  3BQZ A;  2Z33 A;  2HGC A;  4J01 A;  2HXO A;  2MH2 A;  2ZO4 A;  2P0W A;  2RAE A;  2LTP A;  4XOR A;  5J1U A;  4ZZL A;  3VDX A;  5LEK A;  3JRB A;  1U3E M;  4LOC A;  3F9K A;  2VQG A;  3ABK H;  1BIB A;  2ZME B;  3DP7 A;  4C3I J;  4FHT A;  2IEK A;  2EJR A;  4YRV A;  3AG3 H;  4IO9 F;  4RBO A;  3ZQL A;  2I10 A;  4A0Y A;  3HHH A;  2Y9Z A;  4YFK F;  1P92 A;  4ZYD A;  5E20 A;  2K85 A;  5DEQ A;  1S72 I;  4NDL A;  4L0Z B;  1K61 A;  1GHC A;  3OYE A;  3WHC A;  4G94 A;  1R4M B;  2V9P A;  5K7F A;  3K70 D;  4G7O F;  4Y33 A;  3ZMZ A;  2IS2 A;  2ZJP F;  2DA6 A;  3RTR A;  3HOX J;  1HBX G;  3BP8 A;  4G8X A;  2R93 J;  1SFX A;  3ZQC A;  2QCO A;  4HNV A;  3E0J B;  4ESF A;  3BPV A;  5JR3 A;  5CQG A;  2ZJR F;  2VBW A;  1LJ9 A;  4UV8 A;  3GO5 A;  1QO0 D;  3P5J A;  2V1X A;  2WA0 A;  3I58 A;  1U9N A;  1WVR A;  1BN5 A;  2CGP A;  1AWC A;  4KIS A;  4LD5 A;  2XSJ C;  4P9F A;  2RKH A;  3I0T A;  3K4C A;  1YOV B;  4LK1 F;  5E18 F;  1MSE C;  1S5L C;  1R7J A;  2E1N A;  5FRO A;  3KET A;  2J5O A;  2A61 A;  2HVR A;  2FQ4 A;  3U9G A;  1I6H J;  2H1K A;  4XLA A;  5HNF A;  1LE8 A;  1TP4 A;  5KAF C;  3W2V A;  1IC8 A;  2XKO A;  1YHQ I;  3H36 A;  2EZI A;  2F4O B;  2Y2Z A;  3SFZ A;  3RPQ A;  5EEG A;  1J9I A;  1S3J A;  1IZ1 A;  1WJ5 A;  2OQG A;  1MMA A;  3TGN A;  2R7W A;  5IYC J;  2QSF X;  1HCR A;  4X6A J;  3MD2 A;  1X2N A;  4UY8 I;  1I5Z A;  2YU9 J;  1HLV A;  2P4W A;  1HKQ A;  1SD4 A;  1ULY A;  5D6E A;  2K9N A;  3Q0U A;  5E3O A;  3LQR A;  3S1R J;  4IHS A;  1FTZ A;  2E36 A;  2AS5 F;  3M9A A;  3CC2 I;  1R5H A;  1Q1H A;  4KIC A;  3NEU A;  2E1O A;  5JLX A;  4RB3 C;  1LDD A;  1KA8 A;  1UJ8 A;  4II2 A;  2CS3 A;  3HGG A;  4MTE A;  1T8I A;  5CVU A;  1FMV A;  2D45 A;  1IN7 A;  3OYB A;  4ZC3 A;  4IJA A;  2B0L A;  3DTE A;  3K4J A;  1J5Y A;  4M9X A;  5CLS A;  3M1E A;  3PIP F;  5M5X J;  4P96 A;  3PUB A;  3I53 A;  3JRI A;  4HLY A;  4I99 C;  4XLN F;  2H09 A;  2AXT C;  2XV4 S;  3ZCO A;  2DQL A;  1MMD A;  3DTK A;  4ETS A;  2FXA A;  3FM3 A;  3LSR A;  1IN4 A;  1YFH A;  3HOW J;  4A3B J;  1MBJ A;  2JZY A;  3WTV C;  3IP4 B;  1S7O A;  1AA7 A;  3FKI J;  3S1N J;  3EET A;  2LP0 A;  2E2I J;  3E7L A;  5HDG A;  1UG0 A;  2MAB A;  3REO A;  3UR3 C;  2DK5 A;  3E6B A;  2OZU A;  3HPG A;  4Y7N J;  3OS0 A;  3CZ6 A;  3OYM A;  4XOP A;  2DXI A;  2STT A;  1O3R A;  1VND A;  3K2A A;  1ZH5 A;  3EYY A;  4BQO A;  1TW3 A;  2VBX A;  3HZJ A;  5TRD A;  3OY9 A;  1SAN A;  3VYS B;  2M8G X;  2OCC H;  3RKQ A;  2V9K A;  2GXA A;  1DP7 P;  3V7S A;  2GIV A;  3I55 I;  4BQN A;  2VKE A;  1OCZ H;  2L4M A;  2IP2 A;  3K2Z A;  3WOD F;  5LHH A;  3CCY A;  3LSK A;  1UHM A;  1ZLJ A;  2X1D A;  2WAF A;  4HV5 A;  4CA0 A;  3LAP A;  1L0O C;  1RET A;  3F22 A;  2JN6 A;  3HDD A;  1P7I A;  1LDJ A;  2GIZ A;  3IUO A;  3VSK A;  1JXS A;  1VQO I;  3I59 B;  5HLG A;  1F4K A;  3OS1 A;  1ZKG A;  5HDN A;  5KVR A;  4KIT B;  4IXA A;  4RAY A;  2W24 A;  5GAH J;  4XRS A;  4X0G A;  1ETV A;  2DMQ A;  1JKR C;  2X1E A;  3OYL A;  1JT0 A;  1ZG5 A;  4RB0 A;  2E35 A;  3RPU A;  4UUV A;  2DO7 A;  3KP5 A;  3HOZ J;  2XAS A;  4B3A A;  3GTG J;  1U0J A;  1T38 A;  2RDP A;  4L9N A;  4PCQ A;  1ZLK A;  1Y1V J;  2M8E A;  4LG0 A;  1FJL A;  1IDZ A;  2Y31 A;  1B4A A;  1V3F A;  4HX7 A;  3HSR A;  2LRD A;  4QTR A;  1H88 C;  4JX5 A;  3A0H C;  2X4H A;  4RS8 A;  5DCM A;  1X2M A;  3R60 A;  1HDD C;  5DD8 A;  2HZT A;  2JVG A;  2XGD A;  4IZZ A;  1X19 A;  2I5U A;  2E19 A;  3SDB A;  2OD5 A;  2IT0 A;  2MG4 A;  1EH6 A;  3I64 A;  1HA8 A;  2K02 A;  3LMM A;  2TRT A;  2CW0 F;  3AL0 C;  2VE8 A;  2F5C A;  2HFH A;  1CF7 A;  3OIO A;  1SVM A;  1G3S A;  4P55 A;  1BA5 A;  2NAZ A;  1T56 A;  4Y3O A;  2W00 A;  3C2H A;  3N05 A;  4R8H A;  1TT5 B;  2EWN A;  4B09 A;  3S17 J;  5L3C A;  3HGY A;  5BMZ A;  1OYW A;  5IYD J;  1WI9 A;  4LIU A;  3TO6 A;  3F6V A;  4U7D A;  4L9V A;  1SFU A;  5BPI A;  3CJQ B;  2GXB A;  3PNV A;  1NK3 P;  3MWM A;  3MZY A;  4W1U A;  3A1Y A;  1K78 A;  2LY9 A;  3BG3 A;  2ME0 A;  1BC8 C;  1G8X A;  2DAO A;  4L5J A;  4LIT A;  1J2X A;  5EJC A;  1TZL A;  5EGO A;  1EH7 A;  4BDY A;  2HKO A;  1RR8 C;  4BQQ A;  1VQ8 I;  1T0F A;  3O2P E;  2CSO A;  4HEA 2;  3DPL C;  1Z6T A;  1LPQ A;  3T5X A;  4ZYG A;  1BBY A;  3S3O A;  2IA1 A;  5F27 A;  1X1D A;  4A2U A;  2ZKZ A;  1XG1 A;  3VSL A;  4OAZ A;  5JHF A;  1QGP A;  1IG7 A;  4BEH B;  2L01 A;  4CCO A;  3BCA A;  2FX0 A;  3O3K A;  2DPU A;  1UHS A;  3RKY A;  3GW2 A;  3F8B A;  2Z16 A;  1FP2 A;  1ZAO A;  2FNP A;  4RAG A;  4EJW A;  1ZG1 A;  2A68 F;  1O3Q A;  1G59 A;  2Q0O A;  3FDY A;  1K79 A;  4AYB N;  4CCK A;  3SYT A;  4IHY A;  1BI2 A;  3B6A A;  1OLT A;  2EQR A;  2JK3 A;  3HOT A;  1X58 A;  3CCE I;  1A5J A;  2G7U A;  1LKX A;  4XKW A;  3EDP A;  3QOE A;  1D8K A;  4M3G A;  5GP9 A;  3OYG A;  3WE3 A;  1SVO A;  4XRM A;  2W57 A;  3M07 A;  2HKX A;  4PJM A;  2H94 A;  2BW3 A;  3GYH X;  1QNT A;  2IS4 A;  1HST A;  2CFX A;  2K9Q A;  3PFI A;  2HOE A;  5FKM A;  1SD7 A;  2CU7 A;  3G3Z A;  1O7F A;  1MBE A;  3IKV A;  3L2R A;  4BHP A;  1DQU A;  1YRN A;  3H5N A;  1BOA A;  1MH4 A;  3G1O A;  4KJZ A;  1X3U A;  3RJP A;  2BHZ A;  4HSR A;  2VAS A;  3CO7 C;  1FIA A;  2LNB A;  4DZP A;  3QPH A;  4KN4 X;  1TQP A;  2VLA A;  2A5W A;  3FK7 A;  2VE9 A;  2NYX A;  3KP4 A;  3SQN A;  2X9D A;  1MBG A;  3OR1 C;  2QEX I;  1LE8 B;  1R00 A;  4LLL A;  3GTP J;  3HM5 A;  2DT6 A;  3ZQF A;  4WF2 A;  2IJL A;  5FLM J;  4I7H A;  5J1Y A;  4GO1 A;  2P7V B;  3BPX A;  3W6V A;  4PUS A;  4LIV A;  5LGU A;  2VT3 A;  3GFM A;  4CCN A;  3WTY C;  3X2Q H;  1B72 B;  4Q4Z F;  4CHU A;  1ZR4 A;  1NG7 A;  3LQQ A;  5CVJ A;  2KLO A;  1WFX A;  2L2O A;  1S6L A;  2X48 A;  3TW7 A;  4G12 A;  1Z67 A;  1JJ8 C;  1TC3 C;  2K7L A;  4B47 A;  4XLC A;  4BE2 A;  4ENJ A;  3PQJ A;  5J8C A;  3C7J A;  1HF0 A;  3GTJ J;  3WTZ A;  3DWL E;  3J7A O;  1QA6 A;  2ECC A;  4F7Z A;  4IHT A;  5CKT A;  3HTS B;  3VFZ A;  3K10 A;  4BL0 B;  2MC4 A;  2PEX A;  2QUF A;  2XHK A;  4NBQ A;  3HKZ N;  1WJC A;  1CGP A;  2O6G E;  2HYJ A;  4QIW N;  5IP9 J;  4XSX F;  3SZP A;  5J4V A;  1OPC A;  4XN3 A;  1T33 A;  2DOE A;  4IL6 C;  3Q5F A;  4EJV A;  3O8H A;  1FX7 A;  2I8D A;  1MNE A;  3S8P A;  2P5L C;  3F8F A;  4GRI A;  4A0X A;  2K9M A;  5JI6 A;  1KU9 A;  3PNT A;  4B1R A;  3BR5 A;  2K27 A;  1MSF C;  1P2F A;  1JUM A;  5M3F J;  1Q1V A;  3DEU A;  2W85 A;  4KDP A;  1EKE A;  2FOK A;  1S8N A;  1OMI A;  3HXL A;  3JTG A;  1ZG3 A;  3F21 A;  2XUB A;  3M7G A;  2DBB A;  3KX2 A;  3MCZ A;  3BT9 A;  5AIP A;  1RIO H;  1B8I B;  2LG4 A;  5FD6 A;  3TED A;  2EA4 A;  2IA0 A;  4UB6 C;  5FB2 A;  2ZXW H;  2LMD A;  5E1Z B;  3IAM 2;  4S0H B;  1YG2 A;  2ZNY A;  2EFW A;  4Z2Y A;  4JX4 A;  3JR9 A;  4C3H J;  4CO8 A;  3OMY A;  3KP7 A;  5E79 C;  4B48 A;  4DOZ A;  1VFC A;  2OC6 A;  1T2K A;  4BYY A;  2XF5 A;  1T39 A;  3FF5 A;  3QP5 A;  4KN7 X;  4UV9 A;  2ZJQ F;  1FBQ A;  4U0W A;  1X1P A;  1FMW A;  3ABU A;  2VT2 A;  1H9G A;  1ZRC A;  2BGC A;  1FWZ A;  2QA4 I;  3S15 J;  1FYL A;  2ZXI A;  4BUP A;  5JHU A;  2E7W A;  5F64 A;  4EGZ A;  4FE4 A;  2KPM A;  4E70 A;  2XPV A;  1PP8 F;  3SZT A;  3HG9 A;  5K5R A;  5FO5 A;  4IHV A;  2CJJ A;  2HDD A;  2JA8 J;  1XDU A;  3KP6 A;  3KEO A;  4DIQ A;  4N4N B;  3FXJ A;  4QLC U;  1D8J A;  2H6C A;  2NOJ B;  3F6O A;  3KZZ A;  5DUK A;  4AYB A;  4G7H F;  2HNH A;  3CCS I;  5KAI C;  2HVS A;  2WY8 Q;  2E34 A;  1VQP I;  4OIQ F;  2VC0 A;  3BG6 A;  3CME I;  3F8M A;  3I71 A;  2KIM A;  3TP3 A;  4U7B A;  2HPM A;  3LWF A;  2VI6 A;  2Z3Y A;  2EFO A;  2HYF A;  2R7U A;  4LG0 B;  1W5S A;  1ITY A;  3GWZ A;  1RZ4 A;  2FMY A;  5DYM A;  2IGN A;  1E3O C;  4MIM A;  5L3B A;  1Z21 A;  4F55 A;  3K4L A;  3E3V A;  5FD5 A;  5BNG A;  2P5K A;  4E7H A;  3V7C A;  3L00 A;  1ZRF A;  3CMM A;  3ZRG A;  3QU3 A;  4EJO A;  2QKL B;  2QGU A;  1IDY A;  1N25 A;  4E7S A;  2F4M B;  2DK8 A;  3BZC A;  5CVR A;  3H0D A;  3EQL F;  3OS2 A;  1DPU A;  1CF7 B;  3FKJ A;  2Q2E B;  2JQ7 A;  5AON A;  2RN7 A;  2F4I A;  2K4J A;  2ESN A;  1YI2 I;  1TWH J;  5FKK A;  3GLX A;  1H9T A;  4E7I A;  2NXN B;  2RVC A;  4M3D A;  2HI3 A;  3G71 I;  3BG5 A;  4AD9 A;  4F91 B;  2JA2 A;  1REP C;  1GDT A;  1P7J A;  5B5E C;  1MMN A;  3HSF A;  3ZPL A;  2LOO A;  4QPO A;  1G3T A;  3OYN A;  4OIO F;  1MIJ A;  1Y0U A;  3P9I A;  4PFO A;  3IKT A;  4L0Y B;  1FTT A;  4LLG F;  5KCM A;  2LKX A;  3WGG A;  2P6T A;  5LRR A;  4YFN F;  2HOT A;  4P9U A;  2G9W A;  2V9V A;  2K5C A;  1VQM I;  2VJ5 A;  2PJR A;  2VXD A;  1WHU A;  2P6S A;  1SD6 A;  3U1D A;  1BJA A;  1XGS A;  1Y1W J;  2P7C B;  5DD4 A;  2XDV A;  2RNJ A;  1ZN2 A;  3ML6 A;  3HKZ A;  3C1D A;  2EIM H;  4PZJ A;  2ETH A;  1GVD A;  3AG1 H;  5IYB J;  3ZMV A;  5HS7 A;  2X6O A;  2G7H A;  2CV0 A;  1J7K A;  4DYC A;  3JRC A;  4A3J J;  4I6Z A;  1EA3 A;  1KQ9 A;  3BR1 A;  3KP3 A;  2RC4 A;  2NVU B;  3EYI A;  1E0E A;  3J80 Z;  2K3F A;  2KL4 A;  3BR6 A;  1DP3 A;  4AUX A;  2DCE A;  1IN5 A;  1KYZ A;  3CUQ C;  3QOP A;  4BAC A;  3LFK A;  2DYS H;  2HEO A;  4WXC A;  2DTZ A;  2KT0 A;  2L9N A;  4G6D A;  3WTU C;  2ECB A;  2WV0 A;  2PFB A;  3BR3 A;  3CP8 A;  3R0A A;  2ADU A;  2Q8K A;  4IF4 A;  4A3K J;  2QZ8 A;  1YRN B;  3VYT B;  4HBL A;  4KIF A;  5EF6 A;  4AVP A;  3ZQ7 A;  4EQQ A;  2LVS A;  4GXO A;  4BEH A;  5KHD A;  1XD7 A;  4CSW A;  3PQK A;  3TQN A;  3GZ5 A;  2JA7 J;  1OYI A;  1P4W A;  5IT3 A;  3JSP A;  4U88 A;  1E17 A;  2WAE A;  3ROU A;  3KYC B;  3JRD A;  1P4X A;  2HVQ A;  1JE8 A;  5DS9 A;  3BR2 A;  3VYU B;  1W7P D;  2VJJ A;  3K6G A;  3DV8 A;  3L2V A;  3CCU I;  3KFW X;  4EM0 B;  4B3X A;  2GA2 A;  4ZJZ A;  2LD5 A;  4MO7 A;  3TW6 A;  2CUE A;  1IUF A;  1XGM A;  4BGD A;  3NWT A;  2NNN A;  1BI0 A;  2CFO A;  3DEE A;  3ZR8 X;  2LLK A;  2QWW A;  3CJN A;  3CCL I;  1USS A;  4RGX A;  4HV6 A;  1A36 A;  9ANT A;  4AIK A;  5JVG F;  2EV0 A;  2HQA A;  2FE3 A;  3OR2 C;  3Q9V A;  4MFD A;  4OU0 A;  3G1L A;  4Y15 A;  1VQ4 I;  3BOQ A;  3WU0 A;  1HQC A;  5DM7 F;  3FHN A;  3CMA I;  3RI4 A;  3LA3 A;  1ZRD A;  3ZOB A;  3AKZ A;  1YX5 A;  3HRS A;  1FYK A;  3FIS A;  5E17 F;  4M3F A;  1TBX A;  1ETO A;  4ZYE A;  2A5Y B;  4M3B A;  2KIS A;  2GLO A;  1H8A C;  5E1W A;  4NC8 A;  1IGN A;  3E1S A;  3TL4 X;  1EH8 A;  3DKY A;  3OIQ A;  1WJF A;  2H8W A;  4YEJ A;  2VPL A;  1I6X A;  3IH2 A;  5D6F A;  2FNA A;  2R4G A;  1ETW A;  1R6R A;  2EFQ A;  3FMS A;  3FMR A;  5HS8 A;  4C2T A;  4NUB A;  3LAJ A;  2E2J J;  4XKV A;  1D1B A;  3RKX A;  3CTA A;  5DDG A;  4RGS A;  4RMN A;  1BI3 A;  4U0V A;  1YS7 A;  4X1E A;  1QPI A;  4BJ5 C;  5F6F A;  1XGO A;  1W36 C;  2EZH A;  1B72 A;  2KKO A;  2VPR A;  3I4P A;  3J80 K;  4V2G A;  3LA2 A;  3BTJ A;  2K9S A;  3VB2 A;  2BY1 A;  3FXQ A;  1A04 A;  2PMZ N;  1RRJ A;  4A3G J;  3BJ6 A;  4IQJ A;  2W25 A;  3CUQ A;  2PG4 A;  4LGW A;  3D5R C;  4A93 J;  2O5R A;  1FBU A;  1VZ0 A;  4WCG A;  2E1M C;  2J5P A;  1OR7 C;  2Z2S B;  4LFU A;  3ZQI A;  3OSG A;  2OTJ I;  3RKW A;  2YX7 A;  5LFA A;  1Z9C A;  1YW9 A;  3EUA A;  2F5V A;  4BHC A;  1XMX A;  4S05 A;  4G6T B;  1WI3 A;  1FOX A;  3OYC A;  2FUG 2;  3SFI A;  1I3A A;  5BPD A;  1VQ6 I;  2F5F A;  1POG A;  3QWL A;  3ERM A;  5KK1 A;  1VQ9 I;  2ZXJ A;  1ZTR A;  3EUH C;  4NHJ A;  2O61 A;  2IS1 A;  3SDG A;  4NC7 A;  4LB5 A;  1MD0 A;  2P5V A;  5E8G A;  2XRL A;  3H1C A;  5EZH A;  1Z7U A;  1ETX A;  4C9Y A;  1ETQ A;  4BY1 J;  2CQQ A;  4M72 A;  1B8I A;  1G3Y A;  3HSE A;  3QOD A;  3WU2 C;  2KFD A;  5HLH A;  2CUJ A;  1OQY A;  3N97 A;  4UHT A;  1WJA A;  3HTU A;  4WXH A;  3I3L A;  1FYM A;  1UHW A;  4E7K A;  3WTW C;  3DXJ F;  3K4M A;  4JP0 A;  2QVO A;  1ZRE A;  4IHW A;  2KZG A;  4CYD A;  5H2F C;  2FF4 A;  2RQQ A;  2LY1 A;  3JW4 A;  3T8R A;  2UXX A;  4JOM A;  3K1M A;  2FJ1 A;  1T98 A;  3QAH A;  6PAX A;  1TWC J;  5K1Y A;  2W84 A;  1MJA A;  3TO9 A;  5C3E J;  1QZE A;  3LSM A;  2ME6 A;  4F52 A;  1YW8 A;  2H6B A;  2HQR A;  4PGH A;  2Z5U A;  1FOK A;  4EJU A;  4HOB A;  4YG2 F;  2DI3 A;  3DKW A;  3IC7 A;  2V7F A;  1W7P B;  3RQI A;  5C44 J;  2CWE A;  3V42 A;  1BOB A;  1H89 C;  3VOD A;  4IRI A;  5F08 A;  2LFB A;  2M4G A;  1BR2 A;  1LFP A;  3G6E I;  5F0F A;  5M5W J;  2LF7 A;  2R7R A;  2G0E A;  3FBN B;  1FEX A;  4CZC A;  5J3L A;  2R3S A;  3BJO A;  4C2U A;  4LJZ F;  1B9N A;  4XON A;  2EPF A;  1ZEL A;  5EG0 A;  4IOA F;  5D5U B;  3UNG C;  1SEU A;  1GXP A;  1V5E A;  4PSX A;  1XN7 A;  2DDB A;  3E6C C;  1PUF A;  3L7W A;  3I4N J;  3BTI A;  2M0C A;  4KIB A;  4OIR F;  1UB9 A;  2XF7 A;  1KON A;  4FT8 A;  4D1Q A;  4DZJ A;  1DGW Y;  4XK4 A;  2Y30 A;  3GF2 A;  4KA4 A;  2VOP A;  4ZH4 F;  2VQH A;  3RDI A;  5HVQ C;  3RCO A;  4E7J A;  2DMU A;  4XKC A;  2EIJ H;  4HF1 A;  3ERE D;  2MD5 A;  4U87 A;  3HOS A;  1UEL B;  2A07 F;  3R0J A;  2KQR A;  2O8K A;  5F1J A;  5D5W B;  4FCY A;  2GBY A;  2PBI A;  1B59 A;  4OIN F;  2PJR B;  1G4D A;  2E5N A;  2HDW A;  3ECH A;  2XAQ A;  4ZDO A;  2EH3 A;  4YII A;  4ZYA A;  3H3Z A;  3H3V K;  1RNL A;  1ZYR F;  2QF7 A;  1BIA A;  1IXC A;  1GXQ A;  2Q2E A;  4RGU A;  1IJW C;  2Q1Z B;  4WXD A;  5K7H A;  4EAT A;  2AHQ A;  2K3P A;  1YQA A;  3TMO A;  4FE7 A;  5ILS A;  1YIJ I;  4ZTJ A;  1X1A A;  2MYS A;  3CJR B;  4B4C A;  4UVB A;  3WTT C;  4A6D A;  2A6H F;  2BY3 A;  1I3Q J;  2CUZ A;  3H5R A;  4EGY A;  2FBH A;  1IW7 F;  5C4J J;  1DU6 A;  2DN0 A;  1X4O A;  1U8B A;  4EJT A;  1Y56 A;  5EZG A;  3OIP A;  1YIO A;  4A3C J;  1JKO C;  1MND A;  3W6J B;  2PQ8 A;  1TLH B;  4XN0 A;  3FMQ A;  2PMZ A;  4RB1 A;  2PJP A;  2E71 A;  3D5S C;  2VBZ A;  4FAS D;  4LK0 F;  5AIQ A;  2F5E A;  1BI1 A;  2ZSH B;  1X1C A;  1Z0X A;  4PFP A;  3NRV A;  1TTY A;  5J40 A;  1D0Z A;  1KZH A;  3I56 I;  2M5W A;  1MJB A;  1IRZ A;  1DPR A;  4J19 A;  1F43 A;  1ON1 A;  2GZW A;  4RLF A;  3MKY B;  1SC7 A;  1JI8 A;  4HZF A;  4IEJ A;  3ESW B;  1GT0 C;  2QQ8 A;  2JPB A;  2MA3 A;  2KJB A;  1O3T A;  2L4A A;  1X1B A;  3LA7 A;  4GYG A;  2CO5 A;  4BNC A;  4RA2 A;  3BJA A;  2DU9 A;  3KZY A;  1IAW A;  2V79 A;  1ZAR A;  2IBD A;  3QPL A;  4MLO A;  2RQP A;  3I5U A;  1ZQ3 P;  4AID A;  3GTO J;  5HS9 A;  4D7M A;  4IKF A;  2LR8 A;  4HF0 A;  2MLK A;  4E4H A;  1R22 A;  5HLT A;  2R7X A;  3K4K A;  1W36 D;  1JUP A;  1U6G A;  5CVI A;  1JHF A;  5GAG J;  3QPS A;  4E7Z A;  2JSC A;  3DBH B;  3VOE A;  5GTH C;  4Y52 J;  1B1B A;  5EDN A;  3GZN B;  4J00 A;  2IVM A;  1VF9 A;  2O0Y A;  2OJE D;  3DPT A;  2VB6 A;  3FM5 A;  4HLX A;  2RNG A;  1BJZ A;  3U1K A;  3ZQQ A;  3SEQ A;  4XLE A;  1FPQ A;  2KZV A;  3S2D J;  1GVJ A;  3LST A;  1XGN A;  1AOY A;  3E6D A;  2F6C A;  2L5Q A;  2GOX B;  4BH9 A;  4HF2 A;  3OSF A;  3F23 A;  4E6K G;  3K1P A;  3COA C;  4MGR A;  3LNQ A;  1OCO H;  2LH9 A;  4TV7 A;  2GM4 A;  2L3D A;  3PSF A;  2B63 J;  2DFE A;  4GCV A;  1R71 A;  5LLQ A;  2XAF A;  1R9T J;  2ZB9 A;  2CV1 A;  1FLI A;  1ZHF A;  1BM9 A;  1ON2 A;  2UXN A;  3IHU A;  4M3E A;  2UWM A;  2UUZ A;  3I54 A;  2R7F A;  3WGI A;  3PFY A;  2L7K A;  1LQ1 A;  2BOL A;  1I1G A;  2CMP A;  5FLV A;  1ETY A;  2E1C A;  2VQC A;  1F5T A;  5IPA A;  4UVA A;  4FX4 A;  3CUQ B;  2HZD A;  2XIG A;  5FFX A;  2EV5 A;  1TW2 A;  1D0Y A;  1E3H A;  3QPT A;  2MSY A;  3QRF F;  2FBI A;  1JGG A;  4EM2 A;  2FD5 A;  4XRF A;  3ASN H;  3MFK A;  1GUU A;  4Y17 A;  1IRF A;  4IRH A;  2IW5 A;  4ON0 A;  2W7N A;  3OYH A;  4GDF A;  1KQ0 A;  2M30 A;  3S2H J;  1GLN A;  3QQA A;  2VJ4 A;  3WHB A;  4Q5S F;  3F8N A;  2JA5 J;  2M1B A;  1IV6 A;  1VQ7 I;  4UUS B;  2VL8 A;  1MBH A;  5DV5 A;  2NVQ J;  1QVU A;  1W4M A;  2WB1 N;  4ZYH A;  4AIJ A;  1KU2 A;  1D5V A;  1B9M A;  4IQ4 A;  2QYO A;  1K6O A;  3NAR A;  2HOS A;  1ZGJ A;  1RI7 A;  1IUY A;  1HDP A;  3V4G A;  3P9C A;  5A2Q Z;  2XSD C;  2VN2 A;  4XRS G;  2FSW A;  1SMY F;  4A6E A;  4XL9 A;  2KRC A;  3KLO A;  4BBS J;  1W1W E;  2HTS A;  1TWA J;  2JSP A;  2TCT A;  3TO7 A;  3LOC A;  5E8I A;  2DA3 A;  5ICG A;  2X1C A;  1IV8 A;  2MH9 A;  5L3G A;  5K7Z A;  4L18 B;  3U21 A;  3JCU C;  2CQK A;  2OBP A;  1XB4 A;  1HC8 A;  2D1V A;  1SFK A;  5IOY A;  1VQN I;  2R7Z J;  1W5C C;  2XPU A;  4FX0 A;  1P4A A;  2RGV A;  2M45 A;  3ZP5 A;  1V54 H;  4HAM A;  3MKW B;  2HQ5 A;  4HST A;  1O4X A;  2WWY A;  2YX4 A;  3BWG A;  4G7Z F;  3M8E A;  4I0A A;  1ONV A;  2YPR A;  5CVV A;  2DOA A;  1M1E B;  1XMA A;  1X4P A;  2V1D A;  2EB7 A;  3EUK L;  1YTY A;  2KRF A;  4ENN A;  1F36 A;  3CCM I;  2H27 A;  5J47 A;  4C30 A;  4AIH A;  3HOY J;  2OV7 A;  5EG0 B;  1T95 A;  2OQR A;  4V2F A;  4GYI A;  4QWQ A;  1HKS A;  5IP7 J;  3A02 A;  3M1C A;  3KPH A;  3JSO A;  2GQQ A;  2A69 F;  1PUF B;  1YW7 A;  3M8J A;  3BG7 A;  3V7R A;  2BY2 A;  2FBK A;  3M8F A;  2L7F P;  1JGS A;  4B8X A;  2IPQ X;  3S16 J;  3WG7 H;  1SFE A;  1K83 J;  1K6Y A;  3HHG A;  2NNY A;  2WAD A;  3J81 Z;  2N8G A;  2YS9 A;  5LBQ A;  4ENK A;  2CUF A;  4I98 B;  2JT1 A;  1P6R A;  3GTM J;  1IO2 A;  1F1Z A;  2KHM A;  4BJT A;  3JRH A;  5GAD J;  2HR3 A;  4ZDP A;  5H20 A;  3BY6 A;  4XNF A;  3SXY A;  2E1M B;  2FOW A;  1JUS A;  1L3L A;  2X6W A;  1UZC A;  4L5I A;  4ZZD A;  3CLO A;  3K4B A;  2BHY A;  1W7P A;  3G2B A;  5CJ9 A;  4G6Q A;  2DQR A;  2DPD A;  3JRE A;  4RLQ A;  3EPZ A;  1RC9 A;  2Y0M A;  1XDS A;  1APL C;  5CPR B;  4H0E A;  2R7V A;  3A4C A;  4OOI A;  2JTV A;  2WC2 A;  1V5G A;  5E1X A;  1AHD P;  1ETK A;  4I02 A;  4UXN A;  2L54 A;  5L3E A;  3RIR A;  3ABM H;  2IGK A;  2Y0S N;  2W4S A;  2O7O A;  2M0M A;  4IVN A;  2PLY A;  2GWR A;  3V8K A;  2JUC A;  4D9J A;  5GAE J;  4HNT A;  1WKM A;  2FRH A;  4A3I J;  2QQA A;  4D5F A;  3HPH A;  1FNN A;  2XAH A;  4F3Q A;  4HW0 A;  3RSN A;  1KU7 A;  3QYB A;  2VKV A;  1Y0N A;  3T0Y A;  2QSG X;  4MEX F;  4CCJ A;  4XM3 A;  4KUM A;  5B66 C;  2A6E F;  4A12 A;  2DMP A;  4Y13 A;  4ZTF A;  2B9S A;  1FSE A;  2R5Z A;  1V55 H;  2LK2 A;  1ENH A;  4XQF A;  5DTD A;  3MZH A;  3S3N A;  2LYC A;  1YJW I;  2HQN A;  2CW8 A;  1Z1D A;  1I1S A;  4XID A;  5H6R A;  2ZXH A;  2JWT A;  2O3F A;  1R1U A;  1HW1 A;  2DT5 A;  1Z3Y A;  1IRX A;  1HKT A;  4CDG A;  3S32 A;  4DYQ A;  3PO3 J;  3L2U A;  4I09 A;  5D5X B;  2M7B A;  5FRM A;  1GV5 A;  4V19 K;  3C2B A;  4BXF A;  2M7A A;  4EM1 A;  2XC7 A;  3GTQ J;  3J7A Y;  1XTA A;  1R1V A;  3TP0 A;  1WWX A;  1ORK A;  1T6S A;  2XRO A;  2K40 A;  2WB1 A;  4DBQ A;  1A6Q A;  2O9L A;  1MJ9 A;  2WTE A;  5B1A H;  2KDZ A;  3VEP A;  3ZMS A;  3T1B A;  3ZMU A;  2MGQ A;  3L09 A;  1RPW A;  3CUO A;  2H8R A;  1QPM A;  2LF8 A;  3GLL A;  2R5Y B;  1N78 A;  5K5Q A;  3CMY A;  5B3S H;  3Q9S A;  5CQE A;  3D5L A;  1VQK I;  2NOG A;  4MHG A;  2DJN A;  1D1C A;  3CES A;  4LB6 B;  2X0L A;  3J81 K;  1N77 A;  3GFJ A;  1XMK A;  1QZZ A;  3H0G J;  3ZQG A;  2NS8 A;  1NG6 A;  3F72 A;  3AG4 H;  2IRF G;  1QU3 A;  2HDC A;  3ELK A;  2Z1D A;  3DU5 A;  3DCF A;  2D5V A;  3BLY A;  3K9T A;  2NS7 A;  2F48 A;  5M3M J;  1WSU A;  1PDN C;  1JT6 A;  5FKN A;  2DDA A;  1YIT I;  1TT0 A;  4IHX A;  1QBJ A;  2E2H J;  1HOM A;  1CQT A;  1LUJ B;  2HTJ A;  3KE2 A;  5KNL A;  1N75 A;  2BYV E;  2JRT A;  4N9I A;  1GV2 A;  3AL0 B;  2R0Q C;  3QU6 A;  5H6Q A;  2HPI A;  4ESJ A;  1O3S A;  2R7S A;  2FU4 A;  3FHZ A;  3KCC A;  2P81 A;  3IWF A;  3H5A A;  4HRI A;  3V8L A;  3OYI A;  2KIQ A;  2A6T A;  3BRO A;  1LVA A;  2MD0 A;  3E5Q A;  4BXU A;  1LB2 A;  1MMG A;  3AG2 H;  1U5T C;  3CO6 C;  1EF4 A;  2M3A A;  2JVH A;  2P8T A;  3NQO A;  3RZO J;  2XB0 X;  4GGG A;  4A69 C;  1B6A A;  3SJM A;  2QSH X;  5D5V B;  3S14 J;  2L0K A;  2VBY A;  5C4X J;  2ICW G;  3BG9 A;  2NRA C;  5L3D A;  3MVP A;  3QYE A;  2M9H A;  2CRG A;  5BOX A;  2UZK A;  4M74 A;  4WX9 A;  4LG3 A;  1RKT A;  3HRU A;  3WG9 A;  4ANJ A;  2STW A;  1OKR A;  1FOY A;  4NQW B;  4MQV A;  1YO5 C;  4PJ0 C;  3ECO A;  3NAU A;  5D4R A;  4R1H A;  4OMZ A;  3FXM A;  2LRE A;  1UMQ A;  3ZN0 A;  4YIR X;  3M3Y J;  1UFM A;  3SEZ A;  4KFC A;  2M34 A;  3GXO A;  4UB8 C;  4XLH A;  3B73 A;  3TDZ C;  2IGM A;  2LKP A;  3FWE A;  3T8T A;  5LD2 C;  2L9V A;  3OOP A;  4A3F J;  2JA6 J;  4CIC A;  5GTI C;  1OYY A;  4EVI A;  2Z99 A;  2KDO A;  3J7Y J;  4RAZ A;  1UCR A;  3HEF A;  3KIO A;  1QRY A;  2Y0S A;  4BE1 A;  3FXO A;  1R49 A;  2ZCW A;  5HLI A;  1PJR A;  3OYJ A;  3W6K B;  1F9N A;  2VQL A;  4M6X A;  4A0Z A;  1Z05 A;  4PJN A;  3DF8 A;  3FXU A;  4P5O A;  2V1U A;  4PGG A;  5D8K B;  3TOA A;  2EZK A;  1D5Y A;  1XX5 A;  3E5X A;  4QPQ A;  4EMS A;  2EK5 A;  2QM3 A;  3ISP A;  2MBF A;  3IH4 A;  1LEB A;  5FJ8 J;  5ILV A;  3KEQ A; 
#chains in the Genus database with same CATH homology
 1KU3 A;  4BHB A;  1FSH A;  2OZ6 A;  2VXZ A;  3B02 A;  1VTN C;  2PMH A;  4KT5 C;  3WU1 B;  3DFG A;  3IRQ A;  4M9S A;  1FZP B;  1RUN A;  2XGX A;  1D3Y A;  5K5O A;  3BDD A;  4YFX F;  1DDN A;  1XCV A;  3GZ6 A;  1J0R A;  2HWV A;  3ZMD A;  2Y75 A;  2BEO A;  2GXG A;  5J8F A;  3GUD A;  5IT9 Z;  4R79 A;  3GFI A;  4N0B A;  1SD5 A;  3HIF A;  3H3U A;  2Y48 A;  4M9Z A;  5D4S A;  4DNC A;  2QQB A;  1R1T A;  1R58 A;  1U5T A;  2KIF A;  1KYW A;  5ERI A;  1HSJ A;  1QZY A;  1K7A A;  5LRS A;  2FQ3 A;  1V4R A;  5F1R A;  1TNS A;  1FT9 A;  1J59 A;  3TKY A;  2AXL A;  4OMY A;  1QQI A;  4UNO A;  4O6J A;  4I2O A;  2TDX A;  3GX4 X;  1MKM A;  1J75 A;  2ZFW A;  3IWZ A;  3FZV A;  2PN6 A;  3L2C A;  1SAX A;  1G6N A;  2R7D A;  1PUE E;  5ILU A;  5FLX Z;  4JK1 X;  3G73 A;  4WWC A;  1OR7 A;  3L9F A;  1W5T A;  4IPA A;  2FML A;  2MC3 A;  2XAG A;  5ICE A;  4HA8 A;  3P7N A;  2QBY B;  5FGM A;  4N9H A;  2XRN A;  3H92 A;  4Q48 A;  1MGT A;  3C3W A;  5IT9 K;  1JHH A;  1XSD A;  3EUH A;  4I0B A;  2KJC A;  1YLF A;  2DFI A;  2ZNZ A;  3E5U A;  2QQ9 A;  2XVC A;  5ED4 A;  2Z9O A;  4Q47 A;  1LEA A;  1IF1 A;  2ESH A;  3FX3 A;  3D0S A;  2YSR A;  3ABT A;  2OAZ A;  2LSO A;  1MDM B;  4AWX B;  2EA2 A;  1FP1 D;  1LDK B;  2VON A;  1XSX A;  3GVA A;  5ICC A;  4MTD A;  2ACJ A;  2FA5 A;  1FY7 A;  2ISZ A;  2O8X A;  2HS5 A;  5DUI A;  1MZB A;  2D1H A;  5BQT A;  2GA1 A;  1IXR C;  4I01 A;  3KP2 A;  1R23 A;  2ELH A;  4HDU A;  4O5V A;  5D8L B;  2ZBK A;  1EV7 A;  4NB5 A;  5LGN A;  5L3F A;  2BV6 A;  1O7L A;  4L9J A;  5LEJ A;  1NHA A;  4L9T A;  4A5M A;  4HYE A;  5LHG A;  2DTR A;  4LLN A;  2HYG D;  4KIG A;  3C18 A;  5FLX K;  3ZN1 A;  1UST A;  4K2E A;  1XCB A;  3ULQ B;  3MAJ A;  4CGZ A;  1HW2 A;  3K0L A;  3K1N A;  1DUX C;  1STZ A;  2ZME A;  2DLL A;  4D0P A;  2OU2 A;  5EEH A;  4OIP F;  3U2R A;  5JFR A;  3E97 A;  5HOO A;  5DCF A;  3WTX C;  4ASN A;  3HYI A;  4BQA A;  1ODD A;  1U2W A;  4ESB A;  1TNT A;  4S04 A;  2EV6 A;  2OA4 A;  3S2W A;  1HXD A;  1WRJ A;  2ZJ2 A;  4MNU A;  4XSZ F;  4NQW A;  1IN8 A;  3HRT A;  3WE2 A;  2YU3 A;  4YIF A;  2BE5 F;  2A3S A;  1FBS A;  4A5N A;  3BZ6 A;  1RUO A;  2PI0 A;  4HX8 A;  5LHI A;  4G9Y A;  2ISY A;  4BAY A;  3JAM Z;  3ZMT A;  1O57 A;  1TQI A;  2CG4 A;  3WGH A;  3CDH A;  4JBA A;  5BS6 A;  4MEY F;  2EFP A;  1U5T B;  4WK8 F;  2YR2 A;  1TQM A;  4O3M A;  1U78 A;  2DW4 A;  2RV8 A;  1BC7 C;  3K69 A;  3TDU C;  2K86 A;  2L02 A;  1I27 A;  2COM A;  1PP7 U;  2D2W A;  4UVC A;  1XSV A;  4M71 A;  4CXF A;  1IN6 A;  3E6M A;  1C0W A;  3OV8 A;  2F2E A;  3TOB A;  4HQE A;  3AAF A;  4DQ2 A;  4XBF A;  5HDK A;  2V6C A;  2K4B A;  2QEN A;  1S7A A;  5J6X A;  2KIU A;  2E7X A;  2XAJ A;  3F8C A;  4HQM A;  4MQ9 F;  4LMY A;  2VOO A;  4HDV A;  3V8J A;  3P9K A;  1ZGA A;  4RGR A;  3R61 A;  2GAU A;  2C6Y A;  4M73 A;  3DQV C;  1KGS A;  5LGT A;  1HW5 A;  4ENM A;  5DCM B;  1YYV A;  3JAM K;  4RB2 C;  1U8R A;  1G3W A;  4U0Y A;  1H0M A;  4EV0 A;  2VOD A;  4KMU X;  2VC1 A;  5A2Q K;  3KLN A;  5FFZ A;  3R4K A;  3SHF A;  2LDU A;  2EFN A;  3RYR A;  3WTS C;  1SMT A;  3FXR A;  2PMU A;  3HRM A;  3HUG A;  3I59 A;  4JQF A;  1IXS B;  3O6B B;  5CYV A;  2QLZ A;  3IRR A;  2NS0 A;  2BBY A;  3MEX A;  1LNW A;  5JVT A;  2QBY A;  3GEZ A;  2FEZ A;  1K78 B;  2JPC A;  1YS6 A;  3GFL A;  4IRG A;  3RYP A;  2F5D A;  1KQ8 A;  4XLP F;  4KYW A;  4HX4 A;  2MLG A;  2O03 A;  3N4M A;  5TJJ A;  3QP6 A;  2XKP A;  3R6S A;  1FC3 A;  2M87 A;  1Z91 A;  4CZZ A;  1MDM A;  1R36 A;  3IL2 A;  2IA2 A;  4KMF A;  1IRG A;  4M6Y A;  4PDK A;  3F3X A;  1E2X A;  3JTH A;  1Z6R A;  2CYY A;  5ICF A;  3MQ0 A;  4KNY A;  1WQ2 A;  1R5G A;  1S29 A;  2Z33 A;  2HGC A;  2MH2 A;  2ZO4 A;  4ZZL A;  5LEK A;  1U3E M;  1BIB A;  2ZME B;  3DP7 A;  4FHT A;  2EJR A;  4A0Y A;  3HHH A;  4YFK F;  1P92 A;  4ZYD A;  5E20 A;  5DEQ A;  4L0Z B;  1GHC A;  4G94 A;  4G7O F;  3ZMZ A;  3RTR A;  1HBX G;  3BP8 A;  4G8X A;  1SFX A;  4ESF A;  3BPV A;  5JR3 A;  2VBW A;  1LJ9 A;  4UV8 A;  3GO5 A;  1QO0 D;  2V1X A;  3I58 A;  1BN5 A;  2CGP A;  1AWC A;  4LD5 A;  4P9F A;  2RKH A;  3I0T A;  4LK1 F;  5E18 F;  1R7J A;  2E1N A;  3KET A;  2J5O A;  2A61 A;  3U9G A;  2XKO A;  3SFZ A;  3RPQ A;  5EEG A;  1J9I A;  1S3J A;  1IZ1 A;  2OQG A;  3TGN A;  1I5Z A;  2P4W A;  1HKQ A;  1SD4 A;  1ULY A;  5D6E A;  3LQR A;  4IHS A;  2AS5 F;  3M9A A;  1R5H A;  1Q1H A;  4KIC A;  3NEU A;  4RB3 C;  1LDD A;  1KA8 A;  4MTE A;  5CVU A;  2D45 A;  1IN7 A;  4IJA A;  2B0L A;  1J5Y A;  4M9X A;  5CLS A;  3M1E A;  4P96 A;  3I53 A;  4HLY A;  4XLN F;  2H09 A;  2XV4 S;  2DQL A;  4ETS A;  2FXA A;  3FM3 A;  1YFH A;  1IN4 A;  2JZY A;  3WTV C;  1S7O A;  3EET A;  5HDG A;  3REO A;  2DK5 A;  3E6B A;  2OZU A;  2STT A;  1O3R A;  1ZH5 A;  3EYY A;  1TW3 A;  2VBX A;  5TRD A;  1DP7 P;  3V7S A;  2GIV A;  2L4M A;  2IP2 A;  3K2Z A;  3WOD F;  5LHH A;  1UHM A;  1ZLJ A;  4HV5 A;  3LAP A;  1L0O C;  3F22 A;  1LDJ A;  1JXS A;  3I59 B;  5HLG A;  1F4K A;  5HDN A;  5KVR A;  4IXA A;  4RAY A;  2W24 A;  1ZG5 A;  4RB0 A;  3RPU A;  4UUV A;  2DO7 A;  3KP5 A;  2XAS A;  1T38 A;  2RDP A;  4L9N A;  4PCQ A;  1ZLK A;  4LG0 A;  2M8E A;  1B4A A;  1V3F A;  4HX7 A;  3HSR A;  4RS8 A;  2X4H A;  5DCM A;  3R60 A;  5DD8 A;  2HZT A;  2OD5 A;  2IT0 A;  1EH6 A;  3I64 A;  2K02 A;  2CW0 F;  2VE8 A;  2F5C A;  2HFH A;  1CF7 A;  1G3S A;  4P55 A;  2NAZ A;  4R8H A;  2EWN A;  4B09 A;  5L3C A;  5BMZ A;  1OYW A;  1WI9 A;  3TO6 A;  3F6V A;  4U7D A;  4L9V A;  1SFU A;  5BPI A;  2GXB A;  3MWM A;  3MZY A;  1K78 A;  1BC8 C;  2DAO A;  4L5J A;  1J2X A;  1EH7 A;  2HKO A;  1T0F A;  3O2P E;  2CSO A;  3DPL C;  1Z6T A;  3T5X A;  4ZYG A;  1BBY A;  2IA1 A;  4A2U A;  2ZKZ A;  1QGP A;  2L01 A;  3O3K A;  2DPU A;  3RKY A;  3GW2 A;  3F8B A;  1FP2 A;  1ZAO A;  2FNP A;  1ZG1 A;  4EJW A;  2A68 F;  1O3Q A;  2Q0O A;  1K79 A;  1BI2 A;  3HOT A;  2G7U A;  3EDP A;  1D8K A;  3WE3 A;  2W57 A;  2HKX A;  2H94 A;  3GYH X;  1QNT A;  1HST A;  2CFX A;  3PFI A;  2HOE A;  1SD7 A;  3G3Z A;  1O7F A;  3IKV A;  4BHP A;  1BOA A;  1X3U A;  3RJP A;  3CO7 C;  2LNB A;  3QPH A;  4KN4 X;  1TQP A;  2VE9 A;  2NYX A;  3KP4 A;  3SQN A;  1R00 A;  4LLL A;  4WF2 A;  2IJL A;  4I7H A;  4GO1 A;  2P7V B;  3BPX A;  5LGU A;  2VT3 A;  3GFM A;  3WTY C;  4Q4Z F;  4CHU A;  3LQQ A;  5CVJ A;  1S6L A;  2K7L A;  4ENJ A;  3PQJ A;  5J8C A;  3C7J A;  3WTZ A;  3J7A O;  4F7Z A;  4IHT A;  3HTS B;  3VFZ A;  2QUF A;  2PEX A;  2XHK A;  1CGP A;  2O6G E;  4XSX F;  3SZP A;  1OPC A;  3Q5F A;  4EJV A;  1FX7 A;  2P5L C;  3F8F A;  4A0X A;  5JI6 A;  1KU9 A;  2K27 A;  1P2F A;  3DEU A;  4KDP A;  2W85 A;  2FOK A;  1S8N A;  1OMI A;  3JTG A;  1ZG3 A;  3F21 A;  2XUB A;  3M7G A;  2DBB A;  5AIP A;  3MCZ A;  1RIO H;  5FD6 A;  2EA4 A;  2IA0 A;  5FB2 A;  5E1Z B;  1YG2 A;  2ZNY A;  2EFW A;  4Z2Y A;  4CO8 A;  3KP7 A;  1T2K A;  4BYY A;  1T39 A;  3FF5 A;  3QP5 A;  4KN7 X;  4UV9 A;  1FBQ A;  4U0W A;  3ABU A;  2VT2 A;  1H9G A;  1ZRC A;  2BGC A;  1FWZ A;  1FYL A;  5JHU A;  2E7W A;  5F64 A;  4EGZ A;  4E70 A;  1PP8 F;  3SZT A;  5K5R A;  5FO5 A;  1XDU A;  3KP6 A;  3KEO A;  4QLC U;  1D8J A;  2H6C A;  3F6O A;  3KZZ A;  5DUK A;  4G7H F;  4OIQ F;  2VC0 A;  3F8M A;  3I71 A;  2KIM A;  4U7B A;  3LWF A;  2Z3Y A;  2EFO A;  2HYF A;  4LG0 B;  1W5S A;  3GWZ A;  1RZ4 A;  2FMY A;  5DYM A;  5L3B A;  3E3V A;  5FD5 A;  2P5K A;  3V7C A;  3L00 A;  1ZRF A;  3QU3 A;  4EJO A;  2DK8 A;  5CVR A;  3EQL F;  1DPU A;  1CF7 B;  5AON A;  2RN7 A;  2K4J A;  2ESN A;  3GLX A;  1H9T A;  2RVC A;  4AD9 A;  1REP C;  3HSF A;  3ZPL A;  1G3T A;  4OIO F;  1Y0U A;  3P9I A;  3IKT A;  4L0Y B;  4LLG F;  3WGG A;  2P6T A;  5LRR A;  4YFN F;  4P9U A;  2G9W A;  2V9V A;  2P6S A;  1SD6 A;  3U1D A;  1BJA A;  1XGS A;  2P7C B;  5DD4 A;  2RNJ A;  1ZN2 A;  3ML6 A;  3C1D A;  4PZJ A;  2ETH A;  3ZMV A;  5HS7 A;  2G7H A;  1J7K A;  1KQ9 A;  3KP3 A;  3EYI A;  2RC4 A;  3J80 Z;  1IN5 A;  1KYZ A;  3CUQ C;  3QOP A;  3LFK A;  2HEO A;  4WXC A;  4G6D A;  3WTU C;  2WV0 A;  2PFB A;  3R0A A;  2ADU A;  2Q8K A;  4IF4 A;  2QZ8 A;  4HBL A;  4KIF A;  4AVP A;  3ZQ7 A;  4EQQ A;  4GXO A;  1XD7 A;  3PQK A;  3TQN A;  3GZ5 A;  1OYI A;  1P4W A;  5IT3 A;  3JSP A;  4U88 A;  1E17 A;  3ROU A;  1JE8 A;  1P4X A;  1W7P D;  3DV8 A;  3KFW X;  4EM0 B;  2GA2 A;  1XGM A;  2NNN A;  1BI0 A;  2QWW A;  3CJN A;  1USS A;  4RGX A;  4HV6 A;  4AIK A;  2EV0 A;  2FE3 A;  3Q9V A;  4OU0 A;  4Y15 A;  3BOQ A;  3WU0 A;  1HQC A;  3RI4 A;  1ZRD A;  3LA3 A;  3HRS A;  1FYK A;  5E17 F;  1TBX A;  4ZYE A;  2A5Y B;  5E1W A;  1EH8 A;  1I6X A;  5D6F A;  2FNA A;  3FMS A;  2EFQ A;  3FMR A;  5HS8 A;  3LAJ A;  3RKX A;  3CTA A;  5DDG A;  4RGS A;  1BI3 A;  4U0V A;  1YS7 A;  5F6F A;  1XGO A;  2KKO A;  3I4P A;  3J80 K;  3LA2 A;  3VB2 A;  3FXQ A;  1A04 A;  3BJ6 A;  2W25 A;  3CUQ A;  2PG4 A;  4LGW A;  1FBU A;  4WCG A;  2J5P A;  4LFU A;  3RKW A;  2YX7 A;  1Z9C A;  1YW9 A;  4BHC A;  4S05 A;  5BPD A;  2F5F A;  5KK1 A;  4NHJ A;  2ZXJ A;  2O61 A;  4LB5 A;  1MD0 A;  2P5V A;  5E8G A;  1Z7U A;  4M72 A;  1G3Y A;  3HSE A;  5HLH A;  3N97 A;  4UHT A;  3HTU A;  4WXH A;  1FYM A;  1UHW A;  3WTW C;  3DXJ F;  2QVO A;  1ZRE A;  4CYD A;  2FF4 A;  3JW4 A;  3T8R A;  2UXX A;  3K1M A;  1T98 A;  3QAH A;  6PAX A;  5K1Y A;  2W84 A;  1MJA A;  3TO9 A;  1YW8 A;  2H6B A;  2HQR A;  4PGH A;  2Z5U A;  1FOK A;  4EJU A;  4HOB A;  4YG2 F;  2DI3 A;  3DKW A;  3IC7 A;  1W7P B;  2CWE A;  3VOD A;  4IRI A;  2LF7 A;  2R3S A;  3BJO A;  4LJZ F;  1B9N A;  5D5U B;  1GXP A;  1XN7 A;  3E6C C;  3L7W A;  4KIB A;  4OIR F;  1UB9 A;  4FT8 A;  3GF2 A;  4KA4 A;  2VOP A;  4ZH4 F;  3RDI A;  5HVQ C;  4HF1 A;  3ERE D;  2MD5 A;  3HOS A;  2A07 F;  3R0J A;  5D5W B;  2PBI A;  1B59 A;  4OIN F;  1G4D A;  3ECH A;  2XAQ A;  4YII A;  3H3Z A;  1RNL A;  1ZYR F;  1BIA A;  1IXC A;  1GXQ A;  2Q2E A;  4RGU A;  4WXD A;  1YQA A;  5ILS A;  4UVB A;  3WTT C;  4A6D A;  2A6H F;  4EGY A;  2FBH A;  1IW7 F;  4EJT A;  1YIO A;  3W6J B;  2PQ8 A;  1TLH B;  3FMQ A;  4RB1 A;  2PJP A;  2VBZ A;  4LK0 F;  5AIQ A;  2F5E A;  1BI1 A;  3NRV A;  1TTY A;  2M5W A;  1MJB A;  1DPR A;  1ON1 A;  2GZW A;  4HZF A;  2JPB A;  2MA3 A;  2KJB A;  1O3T A;  2L4A A;  3LA7 A;  4GYG A;  2CO5 A;  4BNC A;  3BJA A;  2DU9 A;  3KZY A;  1IAW A;  2V79 A;  1ZAR A;  2RQP A;  3I5U A;  5HS9 A;  4HF0 A;  2MLK A;  1R22 A;  1U6G A;  5CVI A;  1JHF A;  2JSC A;  3VOE A;  1B1B A;  2IVM A;  2O0Y A;  3DPT A;  3FM5 A;  4HLX A;  1FPQ A;  1GVJ A;  3LST A;  1XGN A;  1AOY A;  3E6D A;  4BH9 A;  4HF2 A;  3F23 A;  3K1P A;  3COA C;  4MGR A;  4TV7 A;  2L3D A;  4GCV A;  5LLQ A;  2XAF A;  1FLI A;  1ZHF A;  1BM9 A;  1ON2 A;  2UXN A;  3IHU A;  2UWM A;  3I54 A;  2R7F A;  3WGI A;  1LQ1 A;  1I1G A;  2E1C A;  1F5T A;  4UVA A;  4FX4 A;  3CUQ B;  2XIG A;  5FFX A;  2EV5 A;  1TW2 A;  3QPT A;  3QRF F;  2FBI A;  4EM2 A;  4XRF A;  3MFK A;  4Y17 A;  1IRF A;  4IRH A;  2IW5 A;  4ON0 A;  1KQ0 A;  2M30 A;  4Q5S F;  3F8N A;  2M1B A;  5DV5 A;  1W4M A;  4ZYH A;  4AIJ A;  1KU2 A;  1D5V A;  1B9M A;  1K6O A;  2QYO A;  1ZGJ A;  1RI7 A;  1IUY A;  3V4G A;  3P9C A;  5A2Q Z;  2VN2 A;  2FSW A;  1SMY F;  4A6E A;  3KLO A;  2HTS A;  3TO7 A;  5E8I A;  5ICG A;  2MH9 A;  5L3G A;  4L18 B;  2CQK A;  2OBP A;  1XB4 A;  2D1V A;  4FX0 A;  1P4A A;  2RGV A;  2M45 A;  3ZP5 A;  4HAM A;  2WWY A;  2YX4 A;  3BWG A;  4G7Z F;  3M8E A;  4I0A A;  1ONV A;  2YPR A;  5CVV A;  1XMA A;  2V1D A;  2EB7 A;  1YTY A;  2KRF A;  4ENN A;  2H27 A;  4AIH A;  2OQR A;  4GYI A;  4QWQ A;  1HKS A;  3JSO A;  2GQQ A;  2A69 F;  1YW7 A;  3V7R A;  2FBK A;  3M8F A;  1JGS A;  4B8X A;  2IPQ X;  1SFE A;  3HHG A;  2NNY A;  3J81 Z;  5LBQ A;  4ENK A;  4I98 B;  2JT1 A;  1P6R A;  1F1Z A;  2HR3 A;  5H20 A;  3BY6 A;  3SXY A;  1L3L A;  4L5I A;  4ZZD A;  3CLO A;  1W7P A;  5CJ9 A;  4G6Q A;  2DQR A;  2DPD A;  2Y0M A;  1XDS A;  4H0E A;  4OOI A;  2JTV A;  2WC2 A;  5E1X A;  4I02 A;  4UXN A;  2L54 A;  5L3E A;  3RIR A;  2PLY A;  4IVN A;  2GWR A;  3V8K A;  1WKM A;  2FRH A;  2QQA A;  1FNN A;  2XAH A;  4HW0 A;  1KU7 A;  3T0Y A;  4MEX F;  4KUM A;  2A6E F;  4A12 A;  4Y13 A;  1FSE A;  3MZH A;  2HQN A;  1Z1D A;  1I1S A;  5H6R A;  2O3F A;  1R1U A;  1HW1 A;  2DT5 A;  1HKT A;  4CDG A;  4I09 A;  5D5X B;  4EM1 A;  1R1V A;  1WWX A;  1T6S A;  2XRO A;  1MJ9 A;  2WTE A;  3VEP A;  3ZMS A;  3T1B A;  3ZMU A;  3L09 A;  3CUO A;  1QPM A;  2LF8 A;  5K5Q A;  3Q9S A;  3D5L A;  4MHG A;  4LB6 B;  2X0L A;  3J81 K;  3GFJ A;  1XMK A;  1QZZ A;  3F72 A;  2IRF G;  2HDC A;  3ELK A;  3K9T A;  1WSU A;  1PDN C;  1QBJ A;  2HTJ A;  3KE2 A;  2BYV E;  2JRT A;  4N9I A;  4ESJ A;  3QU6 A;  5H6Q A;  1O3S A;  2FU4 A;  3FHZ A;  3KCC A;  3IWF A;  3V8L A;  3BRO A;  1LVA A;  3E5Q A;  4BXU A;  1LB2 A;  1U5T C;  3CO6 C;  2P8T A;  3NQO A;  4GGG A;  1B6A A;  5D5V B;  2VBY A;  2NRA C;  5L3D A;  5BOX A;  2UZK A;  4M74 A;  4WX9 A;  3WG9 A;  2STW A;  3HRU A;  1OKR A;  4MQV A;  1YO5 C;  3ECO A;  5D4R A;  4R1H A;  4OMZ A;  3ZN0 A;  1UFM A;  4KFC A;  3GXO A;  3B73 A;  3TDZ C;  2LKP A;  3FWE A;  3T8T A;  3OOP A;  4CIC A;  1OYY A;  4EVI A;  2Z99 A;  4RAZ A;  1UCR A;  2ZCW A;  5HLI A;  3W6K B;  1F9N A;  4M6X A;  4A0Z A;  1Z05 A;  3DF8 A;  3FXU A;  4P5O A;  2V1U A;  4PGG A;  5D8K B;  3TOA A;  3E5X A;  4EMS A;  2EK5 A;  2QM3 A;  3ISP A;  2MBF A;  1LEB A;  5ILV A;  3KEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...