2FRHA

Crystal structure of sara, a transcription regulator from staphylococcus aureus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
GSHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Staphylococcal accessory regulator A
total genus 41
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2frhA00
3F72A 1TNTA 2HYFA 4IHSA 5E1ZB 2HOEA 2HS5A 1IN8A 5TRDA 1P2FA 3C3WA 2W57A 2F5FA 3J80K 2LF8A 2O6GE 5D5WB 1T98A 4M9ZA 1SD5A 1W7PA 2LSOA 1R7JA 1O7FA 5E1XA 2DTRA 1UFMA 2XROA 2BYVE 2L54A 3N4MA 4EJVA 3GUDA 1JHHA 5LHGA 2DO7A 5LHHA 5FFXA 1FC3A 2DK8A 3WTUC 2XAFA 2OAZA 4OIRF 5LEJA 4E70A 2M30A 1FOKA 2ZXJA 4Q47A 1MDMB 4G94A 4N0BA 5FLXZ 1SMTA 3IL2A 4KYWA 3R0JA 1O57A 2FBHA 1ZLKA 1F4KA 2ZJ2A 4XSZF 2VBXA 4EGZA 1ZLJA 4KA4A 2K4JA 3G3ZA 1F1ZA 1USSA 4ON0A 3TKYA 2EFPA 2EWNA 2FSWA 4M72A 4HQEA 4OU0A 2DLLA 3NRVA 3ELKA 3SZPA 4AIHA 3E6DA 4IHTA 1U5TB 3LSTA 3Q9VA 5IT9Z 4P55A 3KP7A 5LGNA 4GGGA 4XBFA 1P92A 3BPXA 1U2WA 3VODA 1OMIA 5BPIA 2VXZA 1OYYA 3COAC 5BPDA 2IA1A 4L5JA 1RNLA 1FBUA 3RKYA 2VT2A 4N9IA 2ELHA 4CHUA 4BQAA 4YFXF 1FY7A 3E3VA 1T38A 4CXFA 5JHUA 1OKRA 1J75A 1HQCA 3R61A 3LA7A 5DUIA 4I02A 2V1XA 2G7HA 4LD5A 1JE8A 5DYMA 2RVCA 3GFIA 2QZ8A 1YQAA 5CJ9A 4D0PA 5CYVA 1FBSA 4UNOA 2OZUA 1R00A 3Q5FA 1IRFA 3U9GA 4LGWA 3RYRA 2LF7A 1XB4A 1KYZA 3I59B 3ROUA 1HSJA 1SD7A 5K5RA 1Z91A 2DPDA 1IF1A 2DU9A 2GA1A 3RYPA 4ZYDA 1FYLA 4A6EA 1XGNA 2PQ8A 2CFXA 3KP5A 1U6GA 5HLIA 1ONVA 2Q2EA 1IRGA 4KMFA 1U5TC 4JBAA 2BEOA 3R4KA 4HDUA 1DUXC 3T0YA 2UWMA 2QQAA 5DD4A 4A5MA 1KQ9A 3GLXA 5L3CA 2MC3A 3I59A 1K78B 1E17A 1QNTA 4WXHA 3O3KA 4HA8A 5JVTA 3DXJF 4ZH4F 1WWXA 4AWXB 3KE2A 4HOBA 2XGXA 1T39A 5ILSA 4G7HF 1WRJA 1V3FA 1GXPA 5JI6A 4XLNF 1XMKA 1DPUA 2J5OA 2XKPA 2KJCA 4RGRA 2XAHA 4Y13A 4AVPA 1ZRDA 2P4WA 2F5DA 4IF4A 3GZ5A 3PQKA 1QO0D 2F5CA 4UXNA 4ZYGA 4IRIA 3V7RA 1BBYA 4JQFA 4Q4ZF 4A6DA 1IZ1A 3LFKA 1DPRA 1YTYA 3KLNA 2P6SA 2F5EA 1BIAA 5LLQA 3K9TA 3R0AA 3TO6A 3I71A 3ZQ7A 5KVRA 1Z6TA 1GHCA 3E97A 2K02A 3REOA 1QPMA 1HW2A 3MZYA 4M9XA 3M1EA 4O3MA 2FBKA 4HYEA 4EJWA 4O6JA 1FBQA 2JPCA 1ZRFA 3I5UA 1LDDA 3ABTA 3ZPLA 3JW4A 3BJOA 4F7ZA 3V7SA 2MLGA 5HDGA 1YS7A 2CSOA 5AIPA 3CUQC 5FO5A 2WV0A 2PMUA 2O8XA 2CW0F 4TV7A 3HYIA 2ACJA 3BOQA 1K79A 1QBJA 3E5XA 3IRRA 1OYWA 5D4SA 4EM0B 1R23A 5JR3A 2DT5A 4R1HA 4I09A 4BXUA 2QENA 3TDZC 2EFWA 1V4RA 1BN5A 1DP7P 3LQRA 2HYGD 1JGSA 1KU9A 1KYWA 3CUQA 1Y0UA 5J8FA 4ETSA 3EETA 5CLSA 2ZMEA 5HLGA 1ZAOA 5K1YA 3GFMA 1FZPB 2L01A 2V9VA 2BBYA 1PP7U 3HSFA 1FPQA 1G3TA 3QP5A 4PGGA 5HS9A 1S8NA 3RPUA 1YW7A 3EQLF 4LLNA 3KZZA 3U2RA 1IXSB 3MWMA 2CYYA 2W25A 3V8KA 5L3EA 2P7CB 2PJPA 3VEPA 4RB2C 3E6CC 4Q5SF 4HX7A 2BE5F 4A2UA 1ULYA 4UV8A 1FNNA 4CYDA 2IP2A 1U5TA 4M6YA 2RN7A 2IT0A 3M7GA 5DDGA 2DQLA 4LG0B 1RI7A 1EH7A 3B02A 3F21A 4MTDA 5HVQC 4WF2A 5KK1A 4YG2F 2EA2A 2GA2A 3DPTA 5ICEA 2ZBKA 3O2PE 3WTSC 3JTGA 4ENJA 3IKTA 4M73A 3V4GA 4NQWA 3FHZA 4PGHA 3QU6A 1J0RA 2OD5A 3GYHX 4LB6B 2HZTA 2P5KA 3TDUC 2Z33A 2NS0A 1S7AA 2ESHA 4BHPA 5LGUA 4RGXA 3IKVA 2FBIA 1STZA 5LRSA 1EH6A 1C0WA 4H0EA 2A6HF 3ULQB 2EJRA 4EV0A 2A07F 1QZYA 4PDKA 4U0VA 1UB9A 2A6EF 1ZRCA 2QBYB 3BY6A 4HX8A 2A69F 2JZYA 3ZN0A 1FT9A 3G73A 3GXOA 2QUFA 1ZG1A 3GVAA 3WE3A 3TQNA 1LNWA 2O3FA 4Q48A 3WGHA 3QOPA 2Y0MA 1BOAA 5E8IA 3V8JA 2VC0A 2RGVA 3WTVC 1W5SA 2RV8A 3I64A 3ML6A 3LAJA 4KN4X 1B4AA 2P5VA 5E1WA 3ISPA 3C1DA 5ILVA 4L0ZB 3F6OA 5LBQA 3D0SA 4YFKF 1FP1D 3J80Z 1FYMA 2L4MA 1BI0A 1FYKA 5DD8A 1PP8F 1XMAA 4WWCA 4FX4A 3W6KB 5ICFA 4KFCA 1FSHA 1D3YA 3WTYC 1TQMA 2QWWA 5D8LB 3T8RA 3RI4A 3K1NA 4EJOA 3WTTC 1IXCA 5D8KB 3E5UA 1OYIA 1XSDA 3MEXA 3PFIA 1IN5A 5HDNA 3RKXA 2DW4A 1YW9A 3CUOA 1G3YA 2KJBA 5FLXK 5CVJA 2NNYA 2GXGA 3FXUA 1TBXA 5BMZA 4KDPA 4GXOA 1D8KA 1LJ9A 4ENKA 1BC8C 1KQ8A 4EVIA 4CGZA 2ESNA 3P7NA 4BHCA 3I54A 3Q9SA 2QBYA 5TJJA 2WWYA 1IW7F 1B6AA 3RIRA 2P7VB 2Y48A 1YLFA 5D6FA 2YU3A 3ERED 1TW2A 2E1CA 1QZZA 3ABUA 3BPVA 4L9VA 3WTWC 2YX4A 2HQRA 4ZZLA 2EB7A 3NEUA 2ZNYA 1T2KA 1BI2A 1B9MA 3CDHA 4MEYF 2F2EA 4JK1X 2HDCA 2XV4S 2VE9A 2RDPA 3FMQA 2STTA 5FB2A 4Y17A 3HRSA 4OMYA 3EYYA 2DK5A 3HOTA 2FMLA 3FWEA 1Z05A 2XUBA 2Q8KA 4A0YA 5J8CA 3CUQB 1MDMA 4CO8A 3VOEA 2NAZA 2EK5A 3FMSA 2EFNA 1ZG5A 4ESBA 3D5LA 4OOIA 5L3DA 2YR2A 1ZN2A 3IWFA 2HEOA 3MQ0A 3K1PA 1R58A 2YX7A 3KETA 1USTA 1HW5A 3HRUA 2RC4A 2JTVA 2EV6A 1IUYA 3L09A 5F64A 4UHTA 4LG0A 1DDNA 2STWA 1HSTA 3M8EA 2OBPA 4HV5A 4MGRA 3P9IA 2O61A 4LLGF 3IHUA 3KLOA 1UCRA 2HKOA 2MBFA 5JFRA 4WX9A 4I01A 5DCFA 3F3XA 4U7BA 2KIMA 3VFZA 4EQQA 2P8TA 3KP6A 2OQRA 2B0LA 1MJ9A 1LDKB 2ZFWA 2O0YA 1R36A 2KIUA 5F1RA 2V1UA 3K2ZA 2FA5A 2ZMEB 5BQTA 5E8GA 1VTNC 5AONA 1JXSA 3M8FA 3KEOA 1G3WA 5H6RA 3F8FA 3GWZA 4HAMA 2R7DA 3GO5A 4HDVA 1AOYA 4GYGA 4DQ2A 2HTSA 3DV8A 3HRMA 3R6SA 4KNYA 3SHFA 4I0BA 1Q1HA 5E20A 3F8CA 3L7WA 4ENMA 3LA3A 3MZHA 2M5WA 4KICA 2QQBA 2Z3YA 2COMA 3EUHA 2K27A 2EFOA 3FXQA 5D4RA 3HSRA 3F8MA 1T0FA 3V7CA 1EH8A 2ISYA 1ZGJA 3GEZA 5FD5A 1FP2A 3L9FA 2Z9OA 3JAMK 2XAQA 1P4AA 2H6CA 2EA4A 2LKPA 3BP8A 2VODA 4LK1F 2A5YB 2QYOA 1B1BA 3RJPA 2RQPA 1D5VA 1ZHFA 1W5TA 2XVCA 5LEKA 3C7JA 2V1DA 3W6JB 3RTRA 4OIPF 1HW1A 1R1TA 2UXNA 4UVBA 3I0TA 1YS6A 3CO6C 3RPQA 4ZYEA 5J6XA 4M71A 3WU0A 3GFJA 1UHWA 3WGGA 3QP6A 1FX7A 1QGPA 1RUNA 4MNUA 1BI3A 1K6OA 4RB0A 5HS8A 1RUOA 1BC7C 2K7LA 5EEHA 3E5QA 2FNAA 1L3LA 5DCMB 4L0YB 1BM9A 2HKXA 3F8NA 4AIKA 4A12A 4L9JA 3JAMZ 1ODDA 3DEUA 2XASA 4CZZA 3WTZA 3T1BA 2IPQX 2KKOA 2WTEA 3KFWX 5D5XB 1WI9A 1KU7A 2XAJA 4HX4A 4I2OA 4BHBA 2FOKA 2PMHA 3FF5A 4LLLA 1XSXA 2VBYA 4OIOF 1FWZA 2ZCWA 2EFQA 4KT5C 3H3ZA 2MA3A 4LFUA 3OOPA 2E7XA 1K78A 5L3GA 3H92A 2QQ9A 3K0LA 4EJTA 1JHFA 3ECOA 3GW2A 3QRFF 4XSXF 1ZH5A 2H94A 3NQOA 2PEXA 3HHGA 3E6BA 1BJAA 1WKMA 1W7PD 4IPAA 5D5VB 4KIGA 1H0MA 2R7FA 4M9SA 3P9KA 2YSRA 3FMRA 3CLOA 4RAZA 4HBLA 1G4DA 2AS5F 2JPBA 3MAJA 4OMZA 4MEXF 5HLHA 1L0OC 4ESJA 1S7OA 4WK8F 5CVRA 3HUGA 2NYXA 3KP4A 1MD0A 1XD7A 3P9CA 2QVOA 4FT8A 3WGIA 1EV7A 1U78A 1I1GA 3BWGA 2W84A 2DQRA 1I5ZA 2V6CA 2AXLA 2W85A 2V79A 4P96A 2PFBA 4EM2A 1K7AA 4KN7X 2FEZA 3K1MA 2M1BA 3WE2A 2FNPA 2HQNA 3L00A 1QQIA 4G6DA 3R60A 2W24A 2VBWA 4GCVA 2VOOA 2D2WA 4KIBA 3F8BA 3I58A 1J2XA 4RB1A 4M6XA 2CO5A 2DI3A 4OINF 1SD6A 2NRAC 5E18F 4P5OA 2UZKA 4G9YA 2WC2A 4IJAA 2M45A 2JRTA 2ZNZA 4I98B 2LDUA 1TTYA 3BJAA 3BDDA 4B8XA 5D6EA 4PZJA 1IN7A 4FHTA 4G6QA 3TO9A 2HTJA 2O03A 3MFKA 3WU1B 4A5NA 4M74A 2OU2A 1CGPA 4S04A 5CVIA 4XLPF 4HV6A 2JT1A 4BAYA 3ECHA 2DBBA 5IT3A 4EGYA 1YIOA 1FLIA 4IXAA 3F22A 4RGUA 1W7PB 4MQ9F 2Z5UA 2HR3A 2GQQA 5DCMA 3QPHA 4DNCA 3DFGA 4PCQA 1SAXA 4HQMA 1X3UA 3CJNA 3QU3A 3ZMUA 1TNSA 4O5VA 2FU4A 4Y15A 3LA2A 1ZYRF 4G7ZF 2XHKA 2HGCA 4HLYA 3DF8A 1SD4A 3FM3A 1I1SA 4ENNA 4U0WA 1SFXA 3FZVA 4R79A 1J7KA 2M87A 2PN6A 1HKTA 3DPLC 4CICA 3U1DA 2YPRA 2P6TA 1TLHB 2OQGA 4S05A 5E17F 3DQVC 3HOSA 1O7LA 4NHJA 3V8LA 2MH9A 4KMUX 3S2WA 4BNCA 4L18B 4AIJA 1CF7A 2C6YA 2KIFA 1MJAA 3TOBA 1P4XA 3OV8A 3T8TA 1I27A 3H3UA 1U8RA 3SZTA 2MH2A 1SMYF 5H6QA 4QWQA 2FF4A 2FXAA 2EV0A 2IW5A 3J7AO 1MZBA 5ERIA 2BGCA 2RKHA 3O6BB 1Z6RA 3RKWA 1IXRC 1F9NA 2QLZA 2D45A 4EMSA 5CVVA 2XKOA 1MJBA 3TO7A 2H09A 1S6LA 2E1NA 1TW3A 1Z9CA 1O3RA 3KCCA 4MQVA 1AWCA 3J81K 3I4PA 1ON2A 1J59A 2L02A 3HRTA 1XSVA 2FQ3A 3GZ6A 2G7UA 3HTUA 4IRGA 3SFZA 2GWRA 2PG4A 4EM1A 2J5PA 2DFIA 2CGPA 2OA4A 1FSEA 5F6FA 1LEBA 2QM3A 4I7HA 5FFZA 3ZMDA 3FX3A 1S29A 3LQQA 3QAHA 2LNBA 3LAPA 1RZ4A 6PAXA 1YYVA 2VE8A 4L9NA 1BI1A 4P9FA 4UVCA 2CG4A 2R3SA 3J81Z 5LGTA 3IWZA 1IN6A 2E7WA 1O3QA 4L9TA 5EEGA 2VONA 3CTAA 5LHIA 2GIVA 3HSEA 2MLKA 4RB3C 3GFLA 3EYIA 5DV5A 3PQJA 5HOOA 4WXCA 4AD9A 1W4MA 3C18A 2OZ6A 3GX4X 5H20A 1B59A 4HF2A 4G7OF 3LWFA 2D1HA 4GO1A 2NNNA 1GVJA 4A0ZA 5FGMA 4UV9A 4R8HA 1TQIA 1XCVA 2XRNA 2VC1A 2K4BA 5A2QZ 1ZGAA 1SFEA 2ADUA 4ESFA 3ZMVA 1OR7A 2CQKA 2L4AA 3KZYA 2X0LA 1XCBA 4KIFA 3L2CA 4I0AA 2DPUA 1YG2A 1H9TA 3F23A 2ZO4A 5A2QK 3BROA 1CF7B 3WG9A 3I53A 3IC7A 2H6BA 4YIIA 1KGSA 5HS7A 3QPTA 4B09A 3N97A 4HF1A 2KRFA 5ICGA 3M9AA 3ZMSA 1S3JA 2IA2A 4MHGA 4KUMA 2VBZA 3HTSB 2MD5A 2VN2A 4XRFA 2A68F 2VOPA 3KEQA 3TOAA 1TQPA 1D8JA 4L5IA 4QLCU 2A61A 2ETHA 3ZN1A 1HXDA 3KP3A 4RGSA 2ISZA 4LK0F 3VB2A 2Z99A 4P9UA 1P6RA 4UVAA 4IVNA 4FX0A 4MTEA 4RS8A 3DP7A 2L3DA 3FXRA 2HWVA 3F6VA 1E2XA 2XAGA 1I6XA 3RDIA 3T5XA 4EJUA 3BJ6A 1HBXG 1ZG3A 2CWEA 2DAOA 3MCZA 1R22A 4WXDA 4WCGA 4NB5A 1R5HA 2FE3A 2IJLA 1MKMA 2G9WA 3BZ6A 1T6SA 4GYIA 1Z7UA 2FRHA 4CDGA 2GXBA 3WODF 3KP2A 5BOXA 3K69A 2EV5A 3HIFA 2PBIA 1G6NA 2ZKZA 2X4HA 3B73A 3JSOA 4A0XA 1ON1A 4BH9A 3SXYA 2BV6A 4U7DA 1F5TA 1YW8A 5D5UB 1H9GA 1NHAA 1R5GA 1HKQA 5DEQA 2A3SA 5DUKA 5ILUA 4IRHA 2HFHA 1KU2A 5IT9K 5CVUA 5K5OA 5BS6A 3SQNA 4LB5A 4HLXA 3E6MA 3WTXC 1IAWA 4ASNA 5AIQA 5LRRA 1R1UA 2GZWA 4YIFA 1RIOH 3JTHA 4K2EA 1UHMA 1IN4A 3ZMZA 5ED4A 4ZYHA 2TDXA 5HDKA 1XDUA 5L3BA 4G8XA 1KU3A 3DKWA 3CO7C 1XDSA 1OPCA 2D1VA 4RAYA 1YO5C 3TGNA 4YFNF 3FM5A 3AAFA 1WSUA 1ZREA 1BIBA 1U3EM 2IVMA 2FMYA 1LDJA 1GXQA 1A04A 2VT3A 2PI0A 1KA8A 1B9NA 1XN7A 4ZZDA 2IA0A 1XGOA 2Y75A 3GF2A 1WQ2A 4HW0A 2M8EA 4N9HA 3ZMTA 4LMYA 3JSPA 1J9IA 1O3SA 1LB2A 2PLYA 5L3FA 4OIQF 1XGSA 1YFHA 1G3SA 2JSCA 3EDPA 2IRFG 1LQ1A 4U0YA 1LVAA 2GAUA 1Z1DA 1R1VA 4HF0A 1KQ0A 4HZFA 5FD6A 3IRQA 1P4WA 2RNJA 1XGMA 2K86A 1HKSA 2XIGA 4BYYA 1PUEE 4UUVA 1LEAA 1ZARA 3HHHA 1O3TA 5ICCA 4U88A 5K5QA 1PDNC 3ZP5A 2Q0OA 2UXXA 2P5LC 2H27A 1MGTA 1SFUA 4Z2YA 4LJZF 1REPC 1J5YA
chains in the Genus database with same CATH superfamily
2X48A 5FRMA 3F72A 1FTZA 1TNTA 2HYFA 4IHSA 2DOEA 3HOUJ 5E1ZB 4BXFA 2HOEA 2HS5A 1IN8A 5TRDA 4MIMA 1P2FA 3C3WA 1B8IA 2W57A 5B1AH 2M4KA 1LKXA 2F5FA 3J80K 1AHDP 2LF8A 1LFUP 2O7OA 2O6GE 5D5WB 1T98A 2DFFA 2M34A 1VQMI 4U87A 1X1BA 2XPWA 4M9ZA 1SD5A 3QYEA 1TT5B 1W7PA 3DPUA 1YITI 4Y33A 3VPRA 3CMAI 2Q1ZB 2LSOA 3CJQB 1R7JA 1O7FA 4ITVA 5E1XA 2DTRA 1UFMA 2XROA 3S3OA 2BYVE 5E3LA 2L54A 3CJRB 5BNGA 3HPGA 2L2OA 2W1OA 2WBMA 4CUGA 3KYLA 3N4MA 4EJVA 1JGGA 2CU7A 4PJJA 3GUDA 1JHHA 5J3LA 5LHGA 2RQQA 4Y7NJ 2DO7A 3CCEI 2XF5A 5LHHA 5FFXA 1FC3A 2DK8A 3WTUC 2XAFA 2OAZA 3FXMA 4OIRF 1IV6A 5LEJA 4E70A 2FUG2 4CCNA 1WVRA 2M30A 1FOKA 2ZXJA 4Q47A 4KT6A 1MDMB 4XICA 1B72B 3K4LA 4G94A 4N0BA 2XRLA 5FLXZ 1SMTA 5KCMA 3IL2A 4KYWA 2DMUA 3R0JA 1O57A 2FBHA 4BE0A 2HVSA 3GCMA 1OLTA 1F4KA 1ZLKA 3IH4A 4AIDA 2ZJ2A 4UB6C 1Y6IA 1VQ8I 4XSZF 4LG3A 2VBXA 4EGZA 1D1CA 1ZLJA 4KA4A 1FIAA 2FJ1A 3BT9A 2K4JA 3G3ZA 4JOMA 2V9KA 1F1ZA 3ZQLA 1VQ4I 1USSA 1JUSA 4ON0A 3TKYA 2EFPA 2EWNA 2FSWA 5CQGA 1TC3C 3G1MA 4M72A 1W5CC 4XL9A 4OU0A 2DLLA 4HQEA 3GTKJ 3NRVA 3SZGA 1UELB 3ELKA 3I4MJ 3SZPA 3TP0A 1MH4A 1I3QJ 4AIHA 3E6DA 4IHTA 1U5TB 3LSTA 3Q9VA 5IT9Z 4P55A 4CZCA 3KP7A 2R5YA 5LGNA 3CC4I 4DYCA 4GGGA 4XBFA 1P92A 1ZK8A 1K4SA 3BPXA 3JRAA 1U2WA 3Q0VA 3VODA 1OMIA 5BPIA 1QHGA 2VXZA 1OYYA 2JA7J 4G6TB 1X1DA 3COAC 2QSFX 5BPDA 2IA1A 2MGQA 4L5JA 3M4OJ 1RNLA 1FBUA 2IXSA 2A6TA 3RKYA 2VT2A 1TT0A 4N9IA 5EGOA 2ELHA 4CHUA 5CKTA 3FBNB 4BQAA 2KISA 2EIMH 4YFXF 3GTLJ 2EBIA 2DTZA 3WHCA 2QKLB 2CQXA 1FY7A 3W2WA 3E3VA 1GV2A 1T38A 1OFCX 4CXFA 5JHUA 1OKRA 1J75A 1IUFA 1HQCA 2DJNA 4A3FJ 3R61A 2ZC2A 1G59A 2MG4A 3LA7A 2OPTA 5DUIA 2VI6A 3CP2A 4I02A 1WJEA 2V1XA 2G7HA 4I99C 4LD5A 2VIXA 1MW7A 1JE8A 3AFHA 5DYMA 3JRBA 2RVCA 4XKVA 1VI0A 2KL4A 4EATA 3GFIA 2AQEA 2QZ8A 1YQAA 5CJ9A 1WJ5A 4D0PA 5CYVA 1FBSA 1AU7A 2OZUA 4UNOA 1R00A 3OL4A 1EKEA 3H0GJ 2H8WA 2NXNB 4H4KC 1IRFA 3U9GA 2WY8Q 3BLYA 4LGWA 3RYRA 4A3EJ 3S1NJ 3NARA 2LF7A 3S14J 1XB4A 1KYZA 3I59B 5M5WJ 3ROUA 1HSJA 3G71I 1SD7A 3QOEA 2GIZA 2IEKA 5K5RA 1Z91A 1JKPC 2DPDA 1IF1A 4PJNA 2OCCH 2BHYA 2X6WA 2BVMA 2DU9A 1XX5A 2JA8J 4B3XA 2GA1A 3RYPA 4ZYDA 1FYLA 2ID3A 4A69C 4BUPA 4A6EA 1XGNA 4PUSA 2PQ8A 3JRIA 2CFXA 3KP5A 1U6GA 4AC0A 5HLIA 2CMPA 1ONVA 2Q2EA 1IRGA 2MC4A 1X2MA 3BQZA 4KMFA 3KPHA 1U5TC 3KX2A 4C3JJ 3W2AA 5J4YA 2BW3A 4JBAA 2BEOA 3R4KA 4HDUA 1DUXC 3DTKA 4HNVA 3T0YA 2UWMA 2QQAA 4LOCA 3DLLF 3HB9A 5DD4A 3JR9A 2R93J 2MYSA 4A5MA 1KQ9A 3GLXA 3PSFA 4IOAF 5L3CA 2MC3A 1SAUA 3I59A 5EDNA 3K4MA 3A2KA 4UB8C 3GTOJ 3M07A 1K78B 3W6VA 5FLVA 1E17A 1QNTA 4WXHA 3O3KA 2HU9A 4HA8A 1X4OA 5JVTA 4E7SA 3GTQJ 1ETVA 3DXJF 1Y39A 2VQCA 4ZH4F 4F93B 1WWXA 2XB5A 1YI2I 4AWXB 3KE2A 4HOBA 4J00A 2XGXA 1T39A 5ILSA 4G7HF 3H0DA 2H8RA 1WRJA 3CCYA 4C9YA 4PJLA 1V3FA 2OC6A 4E7JA 3QWLA 2E19A 3OIQA 1RESA 5JI6A 1GVDA 1GXPA 2PJRA 4XLNF 3JCUC 1XMKA 4PJMA 4XK4A 2QA4I 1DPUA 2J5OA 4XMYA 2LC2A 2XKPA 1D0XA 2KJCA 4BDYA 3BCAA 4RGRA 3CCRI 2XAHA 4M3EA 4Y13A 3HBLA 3OYDA 4AVPA 1R71A 2F48A 1ZRDA 2YU9J 2P4WA 2IS2A 2PJRB 3NWSA 2F5DA 2P81A 3GZ5A 4IF4A 3S3MA 2R7OA 2BZTA 3PQKA 2PX9A 2UUZA 4A3CJ 5KAFC 3OYHA 1QO0D 2F5CA 2K9NA 3V42A 4ABZA 4Z6YA 5IYCJ 2MFZA 4UXNA 2NOGA 4F52A 4ZYGA 5F1JA 4C2UA 3LSHA 4KJZA 4IRIA 1UJ8A 3V7RA 3GBGA 1BBYA 4JQFA 5TISC 4Q4ZF 4A6DA 2DA6A 1IZ1A 3LFKA 3BTLA 1BA5A 1DPRA 3HKZN 3ZCOA 1YTYA 2DT6A 1MSFC 3KLNA 2P6SA 3S8PA 2F5EA 1G2HA 5J4VA 4NQWB 4PFOA 3CCMI 3Q5FA 1BIAA 2DA5A 1QVUA 5LLQA 2JQ7A 3K9TA 3R0AA 2M3AA 3TO6A 2R7XA 2LY9A 1ENHA 5IP7J 3I71A 2KPMA 2E2IJ 5GP9A 1U8BA 4RA2A 1U9OA 2R5ZB 3ZQ7A 5J1UA 1XTAA 2IGOA 5KVRA 1Z6TA 3FXOA 3HC7A 1TZLA 4XQFA 3E97A 1GHCA 2B63J 2K02A 2NVUB 1QPMA 4FETA 3REOA 1HW2A 4F91B 5KHDA 2KQRA 3MZYA 5GAGJ 3LSGA 3CCVI 4M9XA 3M1EA 2XGCA 4O3MA 2RREA 2JN6A 2FBKA 2K9LA 3I56I 5IOZA 3CMMA 1HA8A 4HYEA 2Z16A 4BY7J 4KITB 4EJWA 2ZJQF 3S2HJ 4O6JA 2W7NA 1FBQA 4QIWN 5K7ZA 2JPCA 1IC8A 1ZRFA 3I5UA 4XKCA 3BCBA 1K83J 5M5XJ 1LDDA 3ABTA 4L5EA 5K7FA 4QTRA 3ZPLA 3JW4A 1ZTRA 3BJOA 3SYTA 4F7ZA 1ETWA 1V5FA 4E7HA 3V7SA 2MLGA 5HDGA 1YS7A 1E0EA 1H88C 4X6AJ 3L2VA 2CSOA 5AIPA 1H8AC 2KHMA 2Y31A 3CUQC 3OYIA 5FO5A 2WV0A 2PMUA 2O8XA 2CW0F 4TV7A 3HYIA 1PUFB 3CJTB 3LOCA 2ACJA 3BOQA 1K79A 3OR1C 1QBJA 3CF2A 3E5XA 3IRRA 2LOOA 1OYWA 2VKDA 5D4SA 4EM0B 1R23A 4BDZA 1VZ0A 5JR3A 2DT5A 4R1HA 1FOXA 4I09A 4BXUA 2QENA 1Y8QB 2NVQJ 3TDZC 2EFWA 1W0TA 1V4RA 1BN5A 4BQOA 1U0JA 1DP7P 1MMNA 3LQRA 2HYGD 4BKXA 1MMSA 1P7IA 1JGSA 1KU9A 1KYWA 2E1OA 4ZTFA 2RAEA 3CUQA 4CCKA 1Z3YA 1Y0UA 5J8FA 3OYKA 4ETSA 3EETA 5CLSA 2ZMEA 1FOWA 5HLGA 1ZAOA 5K1YA 3S32A 3GFMA 1FZPB 5HNFA 2L01A 3HDDA 2V9VA 2BBYA 3RPUD 1PP7U 3HSFA 1FPQA 3BR6A 3ZQFA 2HQ5A 3CF5F 1VQ6I 3K10A 1JT6A 4YELA 3FXKA 5EG0B 1G3TA 1D0ZA 3K70D 3QP5A 4PGGA 5HS9A 1S8NA 3RPUA 1MMDA 1YW7A 4F55A 1YOVB 3EQLF 4LLNA 2E2JJ 2W82A 3KZZA 3G2BA 2IBDA 3U2RA 1IXSB 4A3BJ 3MWMA 1T95A 2UV1A 3FKJA 2CYYA 2W25A 4BBSJ 4DZPA 3IUOA 2FQ4A 3V8KA 5L3EA 2P7CB 2Y9ZA 3PIOF 1VQKI 2PJPA 3VEPA 3KEYA 1MBFA 4RB2C 3E6CC 3HOXJ 3OYEA 4Q5SF 4HX7A 2BE5F 4A2UA 3BG5A 1ULYA 2JVGA 5F08A 4UV8A 1FNNA 4CYDA 2IP2A 1U5TA 4M6YA 3J7YJ 3RSNA 2JRMA 2RN7A 1N78A 2IT0A 3M7GA 5DDGA 1LFPA 3FHNA 4A3DJ 1ETQA 1X58A 2JA2A 1NTCA 2DQLA 2JUGA 4LG0B 1RI7A 1EH7A 3B02A 3F21A 3BR0A 2R5ZA 1MNMC 5EEAA 4MTDA 5HVQC 5IYBJ 4WF2A 2ZJRF 1S7EA 2IGMA 5KK1A 2LYCA 1GLNA 4B1RA 5GADJ 4YG2F 3OY9A 2EA2A 2GA2A 2K3FA 3DPTA 2X51A 3LNQA 5ICEA 2ZBKA 5IYDJ 1T8IA 3O2PE 4AU7A 3WTSC 2NVXJ 3JTGA 2WAEA 4ENJA 3G1LA 3IKTA 4M73A 3V4GA 3PNVA 4NQWA 3FHZA 4PGHA 3BZKA 3QU6A 1J0RA 2OD5A 3GYHX 3S2DJ 4LB6B 1SEUA 1D5YA 2QQ8A 1FTTA 2HZTA 2P5KA 3TDUC 2Z33A 2Q2EB 2NS0A 4W1UA 1S7AA 1XPXA 2ESHA 4BHPA 5LGUA 1N75A 2DOFA 4ZJZA 4RGXA 3IKVA 1YJWI 1EA3A 4LITA 2FBIA 1STZA 4QSHA 5LRSA 3ESWB 1EH6A 1OCRH 5LFAA 1C0WA 4H0EA 2A6HF 3ULQB 2EJRA 4EV0A 1JJ6C 2HDDA 3KYCB 1QZYA 2A07F 1I6HJ 4PDKA 3QODA 4U0VA 1UB9A 3PIPF 1VQNI 1S5LC 4B48A 3I3LA 2A6EF 4DBRA 1ZRCA 1WZ2A 2QBYB 3SJMA 3BY6A 3CMYA 3H3VK 1SC7A 4HX8A 2DN0A 5B5EC 2A69F 2JZYA 3ZN0A 1FT9A 2X85A 3GXOA 3G73A 2VL8A 2QUFA 4BGDA 3GVAA 3WE3A 2KFDA 3LMMA 1ZG1A 3TQNA 2LY2A 1LNWA 4IQ4A 1NK2P 2O3FA 3MKLA 4Q48A 1XG1A 3WGHA 3QOPA 2BXYA 5C3EJ 2Y0MA 1BOAA 5E8IA 1MIJA 2LTPA 3SEZA 2KRHA 3V8JA 2VC0A 2RGVA 1GV5A 3WTVC 2R7VA 3WG7H 2XPVA 1W5SA 2RV8A 3I64A 1AA7A 2NVYJ 2VPRA 3VDXA 4JP0A 1FIPA 3ML6A 3LAJA 2ICWG 4KN4X 4FISA 1IDYA 1SVLA 1B4AA 3CCQI 2P5VA 3OWTA 2HPIA 3ISPA 5E1WA 3C1DA 3G4SI 4NBQA 5ILVA 4L0ZB 3F6OA 5LBQA 2E2HJ 1LFBA 3D0SA 4YFKF 2KIQA 4A3MJ 5E3NA 2ZXHA 1FP1D 4DJAA 2VQLA 4II2A 3J80Z 1OJLA 2GLOA 1FYMA 2L4MA 1BI0A 1FYKA 5DD8A 1Z67A 3MN2A 4BS9A 2QSGX 1PP8F 1XMAA 4WWCA 4FX4A 3W6KB 3KZIC 4AYBA 4YEJA 5IY5H 2DT7B 2L7MP 2I8DA 3PM1A 5ICFA 2V9PA 1JKOC 5M5YJ 4KFCA 1FSHA 1LE8B 2X1CA 1ACIA 1D3YA 3WTYC 5F0CA 2M9HA 1TQMA 2QWWA 2A05A 3OSGA 5LD2C 4DYQA 5D8LB 3T8RA 3RI4A 5KNLA 3K1NA 4AM3A 2DMPA 4EJOA 1T56A 2DMNA 3KIOA 3WTTC 1QU3A 2Y69H 1G8XA 1IXCA 3U1KA 4A3GJ 5D8KB 3E5UA 1Z7LA 1OYIA 2IS6A 4XORA 1XSDA 3MEXA 2Y0SA 3PFIA 1IN5A 1EJ9A 5HDNA 1X1AA 3RKXA 2DW4A 5J1RA 2K85A 1YW9A 3FISA 3CUOA 1G3YA 2KJBA 1B72A 3LSPA 5FLXK 5CVJA 1FEXA 3BTIA 2NNYA 4CCLA 2GXGA 1SFKA 3FXUA 4NDLA 3I55I 3ABMH 5H2FC 1TBXA 5BMZA 1MBGA 4KDPA 4GXOA 4F3QA 2OJED 1D8KA 4B47A 1LJ9A 2JMWA 2BW3B 4ENKA 1BC8C 3IV5A 1KQ8A 4EVIA 1Z77A 2H1LA 3D5SC 4CGZA 3HG9A 2ESNA 1AKHA 3P7NA 4BHCA 3OIOA 4E7ZA 2CQ7A 1MNEA 4J19A 5HODA 3I54A 3Q9SA 2QBYA 5TJJA 3PO2J 2DJIA 3S1QJ 2WWYA 1IW7F 1MBKA 1FJLA 1B6AA 3BR2A 3RIRA 2P7VB 2Y48A 4JYKA 2E1MC 1YLFA 2TCTA 5D6FA 2YU3A 2DA2A 3ERED 1TW2A 4BJTA 2E1CA 2R4GA 4HEA2 1QZZA 1QA6A 2TRTA 3S93A 3ABUA 2WB1N 3IH2A 4LIVA 1QHHD 3BPVA 4L9VA 2W4SA 3WTWC 2YX4A 2HQRA 4ZZLA 3FXJA 2IS1A 3OSFA 2EB7A 3NEUA 2ZNYA 3D1NI 1T2KA 1BI2A 1B9MA 3CDHA 2K5CA 3HGGA 3HOZJ 2ZXIA 4MEYF 2F2EA 4JK1X 2HDCA 2XV4S 2VE9A 2RDPA 3FMQA 2STTA 1AKHB 2B7EA 5FB2A 2PMZN 1PVEA 1DGRM 4ZDPA 4Y17A 3HRSA 4XLEA 4OMYA 2L7ZA 3EYYA 4E7IA 2DK5A 3FXLA 2H1KA 3H35A 4AYBN 3NWTA 2EIJH 3HOTA 5IPAA 2FMLA 4PSWA 3FWEA 2R0QC 1Z05A 2XUBA 2Q8KA 3H36A 1V5EA 5CQEA 4A0YA 5J8CA 3CUQB 1ETYA 2OCEA 2QEXI 1MDMA 5CPRB 4CO8A 3A01B 1QRYA 3VOEA 2CJJA 2NAZA 2EK5A 3OS2A 3FMSA 2Y30A 2EFNA 1ZG5A 5IP9J 1IGNA 4BU2A 3E0JB 2V4JC 4ESBA 3D5LA 4OOIA 4PJ0C 5L3DA 5M3MJ 2BVLA 2K40A 2YR2A 1ZN2A 3OYGA 3JREA 1JJ8C 3IWFA 1BOBA 2HEOA 3MQ0A 4FCYA 2DDBA 3K1PA 3LL7A 1R58A 2MD0A 5JLXA 1YJNI 4BQNA 2YX7A 2OV7A 2WAQA 3KETA 1USTA 1HW5A 2EILH 2CUJA 3HRUA 5FKKA 2O5RA 1X2NA 2HNHA 2NS8A 3LSIA 2RC4A 2JTVA 1Z3XA 2LRDA 3BR5A 2EV6A 3OYAA 1IUYA 4OAZA 3L09A 5F64A 1HDPA 2BOLA 3ERMA 4UHTA 4LG0A 1DDNA 1TL8A 2Y9YA 3J7ZI 2F4IA 4S0HB 2XC7A 2KDZA 1PYVA 2STWA 1HSTA 3M8EA 1XS9A 2CFOA 2OBPA 1ZGWA 2LREA 2F6CA 2GBYA 4HV5A 5GPAA 4MGRA 3P9IA 2O61A 2F5VA 1CQTA 3ZXSA 3PNTA 4LLGF 3NAUA 1WFXA 3AKZA 3IHUA 3KLOA 1UCRA 2HKOA 2MBFA 5JFRA 3WU2C 4WX9A 4I01A 5DCFA 2OTJI 1RKWA 3F3XA 4U7BA 4IKFA 5K7HA 2KIMA 2HI3A 3VFZA 1A6QA 4EQQA 2P8TA 3KP6A 3RZDJ 2JA5J 3BG3A 3OL3A 3BG6A 4FE7A 3S3NA 1I50J 2OQRA 2ZFUA 2B0LA 4DBQA 4XLAA 2X1DA 2L9RA 3X2QH 1MJ9A 1R9TJ 1LDKB 3BG9A 4HNTA 2ZFWA 2O0YA 2W48A 1E3HA 1R36A 2KIUA 5F1RA 2X6XA 2L7KA 3Q0WA 2V1UA 4CH7A 3K2ZA 3QYFA 3OMYA 2FA5A 1TWFJ 3W2VA 2ZMEB 5BQTA 5E8GA 1VTNC 2CH0A 5AONA 1JXSA 3M8FA 3U21A 3KEOA 4A93J 1PJRA 1G3WA 4PK4A 1LVKA 3N05A 3HEFA 5H6RA 4D9JA 4EEFG 3CESA 4B3AA 4C2MJ 3F8FA 5HNHA 2E71A 4FASD 3EUHC 1UZCA 3GWZA 4HAMA 5C4XJ 2R7DA 3GO5A 4HDVA 1AOYA 4GYGA 3ZQCA 4DQ2A 4QPOA 2HTSA 3ONQA 1NK3P 4M3DA 5E3MA 3DV8A 2E5NA 2VQHA 3HRMA 3R6SA 2FD5A 4JX6A 2WV1A 2M2EA 5C4JJ 4KNYA 2AHQA 3SHFA 4I0BA 1Q1HA 5E20A 1X1PA 1OCPA 1KONA 3F8CA 3L7WA 2JUCA 4HSTA 2DDAA 4ENMA 1TWHJ 2GM4A 4CCMA 3LA3A 3MZHA 3K4CA 2M5WA 2L5QA 3OYCA 2IS4A 2RNGA 5FKNA 5IP6A 1MSEC 2DA3A 4KICA 2QQBA 5C44J 3GTJJ 1DU0A 1WJDA 2Z3YA 1VFCA 5DM6F 1J09A 4FTHA 3A0BC 2GXAA 2COMA 3EUHA 2K27A 2EFOA 4M3GA 4IOCF 3FXQA 5D4RA 3HSRA 2O9LA 3L2WA 3F8MA 1T0FA 1GT0C 1YHQI 1WHUA 2JVHA 2X9DA 3V7CA 4IHXA 1I39A 3CLQA 2BY1A 1Y8RB 3K70C 1EH8A 2ISYA 2LD5A 1ZGJA 3GEZA 1S72I 5FD5A 1FP2A 3L9FA 2QF7A 3JAMK 1WCMJ 2XAQA 3PNYA 2Z9OA 2LMDA 2R7SA 3OYFA 1F43A 3UKGA 1P4AA 3JRFA 4XKBA 2H6CA 1D0YA 3S1RJ 2EA4A 2LKPA 3BP8A 2VODA 4LK1F 2A5YB 1IG7A 4I76A 2QYOA 4HRIA 1B1BA 4BXXJ 2VPLA 1HDDC 3RJPA 2JA6J 2RQPA 2AQFA 1PUFA 1D5VA 1WJCA 1ZHFA 1W5TA 2XPUA 2XVCA 3M3YJ 4BACA 2LH9A 2OTLI 2K9MA 5LEKA 3C7JA 2V1DA 3W6JB 3RTRA 4OIPF 1HW1A 1R1TA 2UXNA 4D5CA 4UVBA 2Y2ZA 2D5VA 3I0TA 1YS6A 4RM2A 3CO6C 3RPQA 4ZYEA 4E4HA 1V5GA 5J6XA 5JLWA 4OAYA 1OCOH 4M71A 3WU0A 1ITYA 1WI3A 3GFJA 1UHWA 3WGGA 4IHYA 5GTHC 3QP6A 1N77A 1FX7A 1BJZA 3QYBA 1QGPA 1JUPA 1RUNA 2QKMB 4MNUA 1BI3A 1K6OA 2ZSIB 4RB0A 1VQ9I 5HS8A 2P0WA 1MBEA 1RUOA 1BC7C 2K7LA 5EEHA 3E5QA 1RPWA 4BJ6C 3ABKH 2FNAA 2CUEA 2IAIA 2X6OA 1L3LA 5DCMB 4L0YB 1BM9A 2HKXA 3LSKA 1BW5A 3H1CA 2L9VA 3ZQHA 3F8NA 4AIKA 4A12A 4L9JA 4M3BA 3JAMZ 1YIJI 1ODDA 1WGXA 1ZKGA 3PSIA 3DEUA 2XASA 2V26A 2VASA 4CZZA 3WTZA 2ZSHB 1GDTA 3T1BA 3OYMA 2IPQX 2KKOA 3IP4B 2QCOA 2WTEA 1BL0A 5GAHJ 2HQAA 3IAS2 3KFWX 1KZHA 5D5XB 4DGWB 1WI9A 1H89C 1KU7A 4XLHA 4HPQA 3OYNA 2XAJA 4HX4A 3K2AA 1RR7A 4I2OA 4BHBA 2FOKA 1ETXA 2PMHA 3FF5A 2ME6A 4LLLA 2KRCA 1XSXA 2VBYA 4IEJA 4OIOF 1FOYA 1FWZA 2LFBA 2ZCWA 2EFQA 4KT5C 4C3IJ 3AL0C 1DGWY 3H3ZA 2MA3A 2QSHX 4LFUA 3OOPA 1YRNB 2E7XA 4BEHB 1K78A 5L3GA 1ZELA 3H92A 1WJFA 2QQ9A 3K0LA 3MKZA 4EJTA 1JHFA 3ECOA 3GW2A 3HKZA 1P7JA 3QRFF 2OF7A 4XSXF 3VYRB 1ZH5A 3FIWA 3MVPA 3HPHA 2H94A 3NQOA 2PEXA 2K9SA 3HHGA 2EZKA 3G6EI 3E6BA 2R7UA 1BJAA 1WKMA 1W7PD 2VKVA 4IPAA 5D5VB 4KIGA 1X19A 1H0MA 2R7FA 4M9SA 2PMZA 3P9KA 4HNUA 3FMRA 2DOAA 2YSRA 2IGNA 3CLOA 1Y1WJ 4QPQA 3PL8A 4XNFA 4RAZA 4HBLA 4V19K 1G4DA 3GTMJ 2AS5F 3L2RA 2JPBA 2XSDC 3MAJA 1NG6A 4OMZA 4MEXF 5HLHA 3GZNB 3BG7A 1L0OC 4ESJA 2BY2A 1S7OA 2DYRH 4WK8F 5CVRA 2B9SA 1POGA 3HUGA 3H9QA 4RBOA 4PFPA 3UR3C 2NYXA 3KP4A 3DEWA 1MD0A 3C2HA 1XD7A 3P9CA 2QVOA 4FT8A 1VQ7I 1YX3A 2CW8A 3WGIA 2GOMA 1EV7A 4RAFA 1U78A 4XIDA 1I1GA 4ANJA 3BWGA 3F9KA 3A01A 4D7MA 1NG7A 2W84A 4KISA 4W97A 2HYJA 3LSMA 2DQRA 1I5ZA 2V6CA 3PUBA 2AXLA 2W85A 4ZC3A 2V79A 3EPZA 4P96A 1D1AA 2PFBA 4EM2A 1K7AA 5FROA 5GTIC 4KN7X 2FEZA 2EH3A 3K1MA 2M1BA 3WE2A 2FNPA 2KMUA 2HQNA 3L00A 1QQIA 4G6DA 3R60A 2W24A 3M8JA 5IOYA 3S1MJ 2VBWA 2M0CA 1IJWC 4GCVA 1MBJA 2VOOA 2D2WA 4KIBA 3LFUA 3HGYA 1Y0NA 3F8BA 1BR1A 3I58A 4M3FA 1J2XA 5EG0A 4RB1A 5F04A 1RETA 2VJ4A 1A36A 4M6XA 4ZDLA 2CO5A 1ZR4A 3OOUA 2DI3A 4V2GA 3CCLI 1O4XA 3FK6A 1GUUA 4OINF 1SD6A 2NRAC 2Z2SB 4P5OA 5E18F 3OS0A 3E7LA 4BQQA 2UZKA 4G9YA 2WC2A 4IJAA 4ZDOA 2M45A 2JRTA 2ZNZA 3VWBA 2AXTC 4BJ5C 5EGOB 4I98B 2WAQN 2ZJPF 2LDUA 2K3PA 1TTYA 3BJAA 3BDDA 5D6EA 1R5ID 1T33A 4PZJA 4XRSG 1IN7A 4FHTA 3SDGA 4B8XA 4G6QA 3HL2A 3TO9A 2VJJA 2HTJA 1Y56A 2O03A 3MFKA 3WU1B 1RC9A 4A5NA 4M74A 2HOSA 3HZJA 2WY7Q 2OU2A 1CGPA 3HUGB 4IHVA 4S04A 3I9V2 4RMNA 2VKHA 3DCFA 2XF7A 5CVIA 4XLPF 4HV6A 2JT1A 2BXZA 2KZVA 4BAYA 2DMQA 5M3FJ 4N4NB 2M0MA 3ECHA 3ZOBA 2DBBA 5IT3A 4EGYA 1YIOA 1R4MB 1ETOA 1BR2A 1FLIA 4IXAA 1LPQA 3F22A 5DS9A 5HLTA 5FJ8J 3JRCA 1R49A 2JJ7A 4RGUA 2R7RA 3AG3H 2EZHA 2MSYA 1W7PB 2DYSH 4MQ9F 2YUSA 2Z5UA 2HR3A 5EZGA 2GQQA 5DCMA 3QPHA 4DNCA 3FK7A 2ELKA 2KT0A 3DFGA 4PCQA 1SAXA 4HQMA 2LG4A 2BY3A 3BR3A 1X3UA 3CJNA 4BE1A 5B66C 2HDWA 3QU3A 1TP4A 1TNSA 3ZMUA 3JRDA 4RLQA 4C2TA 4O5VA 3DU6A 2FU4A 4Y15A 3LA2A 1ZYRF 4G7ZF 2XHKA 2QGUA 3ZQGA 3C2GA 2HGCA 3RCOA 1VQLI 4HLYA 3DF8A 1HC8A 1D1BA 1UHSA 2EQRA 1SD4A 3H5RA 3FM3A 3ZR8X 1I1SA 4ENNA 4U0WA 3DU5A 2M7AA 1ETKA 1SFXA 3FZVA 1W36D 4R79A 5GPCA 1J7KA 2M87A 2PN6A 3BC8A 1HKTA 3DPLC 4CICA 2ME0A 2ZXWH 3U1DA 2YPRA 2P6TA 1TLHB 3DBHB 3ZRGA 2OQGA 4S05A 3TMOA 4RM3A 5E17F 3DQVC 3HOSA 4Y3OA 1MNDA 1O7LA 4NHJA 3V8LA 3H5NA 2XAUA 4XOPA 3CC7I 2MH9A 4KMUX 3S2WA 4C3HJ 3OIPA 1VQPI 9ANTA 4BNCA 2EIKH 4L18B 5J40A 1K61A 4AIJA 1CF7A 2R7ZJ 2C6YA 1F36A 2KIFA 2V1NA 4CSWA 1MJAA 5FKOA 3MMYB 3TOBA 4ZYAA 1U9NA 2LKSA 2E36A 3HJEA 2JSPA 1P4XA 3OV8A 3KYDB 3L1PA 4DYRA 4XLFA 3T8TA 2A5WA 4E7KA 1I27A 1UMQA 3H3UA 1U8RA 2CQQA 3MKYB 3SZTA 2MH2A 3DBLB 1SMYF 4YIRX 5H6QA 2E60A 4QWQA 1A5JA 2FF4A 4XR6A 1VQOI 2FXAA 2EINH 2EV0A 2IW5A 3BR1A 1RKTA 3ZQQA 3J7AO 1MZBA 5ERIA 2BGCA 4G12A 1FMWA 2RKHA 3O6BB 1Z6RA 4CCOA 3RKWA 1F9NA 1IXRC 2QLZA 2D45A 2O8KA 4EMSA 3QPSA 5CVVA 4CCJA 2XKOA 1HF0A 1MJBA 4IO9F 1UG0A 3TO7A 1P9QC 2H09A 1S6LA 3A02A 3S16J 5FKMA 2LY1A 1S9HA 2E1NA 1TW3A 5KAIC 2DA7A 3S15J 2HVQA 1Z9CA 3TL4X 1O3RA 1IRZA 3KCCA 4MQVA 3K6GA 4XLCA 2DFEA 2HXIA 3J81K 1AWCA 3I4PA 3GTGJ 4DOZA 3PO3J 1ON2A 3MKWB 4XRMA 1J59A 4I6ZA 4XN3A 4MO7A 4UY8I 1ORKA 2L02A 1BW6A 3HRTA 2M8GX 1XSVA 2FQ3A 3GZ6A 2G7UA 2JWTA 3HTUA 4IRGA 3SFZA 2GWRA 2NOJB 1JTXA 4AUXA 2PG4A 4EM1A 1NH3A 1SANA 3TW6A 2J5PA 2LBFB 1YE9A 4IX7A 2DFIA 2CGPA 2OA4A 1FSEA 3I4NJ 2DODA 2LKXA 5F6FA 1X3WB 1TWAJ 3CZ6A 4DZJA 4CYCB 2CUFA 1LEBA 2QM3A 4I7HA 5FFZA 1IRXA 3ZMDA 3A0HC 3FX3A 4B43A 2CS3A 3IH3A 1S29A 3LQQA 3QAHA 1RRJA 1WJBA 1OCZH 5J1YA 2LNBA 3LAPA 1RZ4A 6PAXA 1YYVA 3J7AY 1OQYA 3RZOJ 3WHBA 2VE8A 3B6AA 2L0KA 4L9NA 1BI1A 3A1YA 3SDBA 3M1CA 2W00A 4P9FA 4UVCA 2CG4A 2R3SA 2KP6A 3J81Z 1SFOJ 1DU6A 2AO9A 5LGTA 2VKEA 2L9SA 3IWZA 1IN6A 2E7WA 2VLAA 1YJ9I 1O3QA 3FDYA 4A3JJ 4L9TA 1X4PA 2M4GA 5FKLA 5EEGA 5F0FA 2VONA 3H9JA 3CTAA 3AG2H 5LHIA 1A6IA 4AVZA 2GIVA 3HSEA 1WH5A 2MLKA 2XGEA 4RB3C 3CCSI 1WJAA 2KDOA 3GFLA 4XN0A 3S17J 2CW7A 2HPMA 3EYIA 4M6VA 1UAAA 5DV5A 2FOWA 3PQJA 5HOOA 3AG4H 4WXCA 3K4NA 4AD9A 1T0FC 1W4MA 3C18A 1DQUA 2CQNA 2OZ6A 2I5UA 1JI8A 3GX4X 2XGDA 3AG1H 4LIUA 1A35A 2F4MB 1EF4A 5H20A 1B59A 1JUMA 4HF2A 4G7OF 3LWFA 2D1HA 2VQGA 1N25A 3DBRB 3CP8A 2F4OB 2WAFA 2NNNA 4GO1A 4NC8A 4D7NA 2EZIA 4XONA 3ABLH 1GVJA 4A0ZA 5FGMA 3RQIA 1W1WE 4UV9A 3PJRA 4R8HA 5E3OA 1TQIA 4OWRB 1XCVA 2WADA 3C2BA 4IL6C 3IAM2 4X1EA 2XRNA 1WPKA 5F27A 2VC1A 2K4BA 3H9GA 5A2QZ 3HOWJ 3VYSB 1ZGAA 3CC2I 1SFEA 2ADUA 2R5YB 4ESFA 3ZMVA 3UNGC 1Z21A 1OR7A 2CV1A 4BEHA 2VUMJ 1W0UA 3DKYA 4BE2A 2CQKA 2L4AA 3FBIB 3KZYA 4P1WA 3ZQIA 2IGKA 2LR8A 3G1OA 2E34A 2X0LA 3E1SA 4A3KJ 3A03A 1XCBA 1TWCJ 3VSKA 2I10A 4KIFA 3VSLA 3L2CA 4I0AA 1ERDA 2DPUA 1LUJB 2YS9A 4N4OB 1YG2A 2DFHA 3O8HA 3H5AA 1H9TA 3F23A 2ZO4A 5A2QK 1Q1VA 4X0GA 4IQJA 2E5ZA 4FQGA 1MMAA 3ASOH 2LBFA 2ZB9A 3BROA 1CF7B 3WG9A 3I53A 1APLC 3K4BA 1QPIA 2Z1DA 3IC7A 2E35A 4BY1J 2VXDA 2H6BA 4J01A 4YIIA 2WB1A 1KGSA 5HS7A 3QPTA 4B09A 3N97A 4V2FA 1RR8C 4HF1A 3RKQA 2ELJA 2KRFA 5ICGA 3M9AA 3ZMSA 4NNJA 2COBA 2NS7A 1S3JA 2IA2A 3BTCA 4MHGA 4KUMA 5EF6A 3ZGKA 2VBZA 1IO2A 3BQYA 2ID6A 1ZR2A 1MBHA 3HTSB 2MD5A 5GAEJ 2VN2A 1XMXA 2LVSA 4B44A 4XRFA 2A68F 2VOPA 2V7FA 3CCUI 5FLMJ 2DMTA 4BL0B 3KEQA 2HVRA 3TOAA 1TQPA 3K4JA 2DCEA 5JVGF 4L5IA 1D8JA 4QLCU 2R7QA 2A61A 2ETHA 4NC6A 3ZN1A 4YRVA 1HXDA 3QPLA 2DXIA 3KP3A 4RGSA 3O8GA 2L9NA 3Q0UA 2ISZA 4LK0F 3VB2A 2R7TA 1X1CA 2LK2A 2XF6A 2HXOA 2Z99A 3CMEI 2MABA 4P9UA 2M7BA 1B8IB 1V55H 1P6RA 3DTIA 4UVAA 4IVNA 1MH3A 2DA4A 3EUKL 4NUBA 4D1QA 3CDLA 4FX0A 4MTEA 3JRGA 4JX4A 2L7FP 4JX5A 4RS8A 1OCCH 3HOYJ 3DP7A 1WH7A 3ASNH 2L3DA 3FXRA 2HWVA 2LP0A 1W36C 2CV2A 2XDVA 2ZMEC 3F6VA 1E2XA 2XAGA 1I6XA 3RDIA 3BZCA 3CD6I 4HSRA 1JTYA 3A4CA 3GLLA 3CDIA 3T5XA 4EJUA 4UUSA 2BY0A 3L2QA 4E7LA 3EUAA 3BJ6A 1HBXG 2V6EA 4NC7A 3BTJA 1ZG3A 4GRIA 2CWEA 1QVTA 1SVOA 2DAOA 3MCZA 2X6YA 3HXLA 1R22A 4WXDA 4WCGA 4NB5A 3TW7A 3QQAA 1R5HA 3L2UA 2FE3A 2Y0SN 2IJLA 1MKMA 2G9WA 3BZ6A 2E1MB 1T6SA 4GYIA 4RLFA 1Z7UA 2CV0A 2FRHA 4CDGA 1HLVA 2GXBA 3WODF 2GOXB 3KP2A 5BOXA 3LSRA 3K69A 2EV5A 3HIFA 2PBIA 1G6NA 5DM7F 4CA0A 2VJ5A 2ZKZA 2X4HA 3B73A 3JSOA 1JKQC 4A0XA 1M1EB 2BHZA 5JHFA 4FE4A 1ON1A 4BH9A 3SEQA 3OS1A 5EJCA 3SXYA 2BV6A 4U7DA 4A3LJ 2HOTA 1F5TA 1YW8A 4II3A 5D5UB 2WA0A 2CUZA 1QZEA 1H9GA 1YRNA 1NHAA 1I3AA 1TWGJ 1V54H 2CRGA 4BBRJ 3PFYA 1R5GA 1HKQA 5DEQA 4IHWA 2A3SA 5DUKA 1BR4A 1VQ5I 5ILUA 2LLKA 1XC5A 4IRHA 2HFHA 1KU2A 2OUMA 5IT9K 5CVUA 5K5OA 3GTPJ 5BS6A 3OR2C 3SQNA 4LB5A 1Z0XA 4MFEA 4HLXA 3CCJI 1MMGA 3E6MA 4DW6A 3WTXC 1IAWA 4ASNA 5AIQA 5LRRA 4XRSA 3P5JA 1R1UA 2GZWA 3VYTB 2XSJC 2EPFA 3CQZJ 4YIFA 3JRHA 1RIOH 3JTHA 4GDFA 3MD2A 4K2EA 3DKXA 1UHMA 1IN4A 1VNDA 1X3ZB 3ZMZA 5ED4A 5EZHA 4E6KG 4ZYHA 2TDXA 5HDKA 3TEDA 3HM5A 3OYJA 1XDUA 5L3BA 4G8XA 1KU3A 3DKWA 3CO7C 1XDSA 1OPCA 2D1VA 4RAYA 1YO5C 3TP3A 3TGNA 3Q3SA 4YFNF 4PSXA 4HG2A 3FM5A 3AAFA 4C30A 1WSUA 1ZREA 1BIBA 2R92J 1R4NB 2ECCA 4XM3A 1U3EM 2IVMA 2FMYA 1LDJA 4D5FA 3DTEA 1K4TA 1GXQA 2VJIA 4RDUA 1A04A 2VT3A 2PI0A 1KA8A 4MFDA 4UUTA 1B9NA 1XN7A 2HOAA 4ZZDA 2ECBA 1R6RA 2IA0A 4ZTJA 1XGOA 2KZGA 3F0CA 4RAGA 2Y75A 3GF2A 1WQ2A 2KLOA 1A31A 2X1EA 1DP3A 4HW0A 3DWLE 1E3PA 3OYLA 2M8EA 4N9HA 4CYCA 1Y1VJ 1HOMA 3ZMTA 4LMYA 3JSPA 2N8GA 1ZQ3P 2K9QA 1J9IA 1O3SA 1LB2A 4Y52J 2PLYA 2HZDA 5L3FA 4OIQF 1XGSA 3PUFA 3W3CA 1OISA 1YFHA 3K4KA 1G3SA 2JSCA 5FRNA 2DA1A 5EYRA 3EDPA 3K7AJ 2MW8A 2IRFG 5B1BH 1LQ1A 4F92B 3HOVJ 4U0YA 1LVAA 3DEEA 3RQ4A 1JKRC 1LE8A 5J47A 2GAUA 1Z1DA 1R1VA 3GMEA 3AL0B 4HF0A 2EZLA 5TGTA 5E79C 1HCRA 4XKWA 1KQ0A 4HZFA 5FD6A 3IRQA 1P4WA 4A3IJ 4IZZA 2RNJA 1XGMA 2R7WA 3LSJA 1OR7C 2K86A 1HKSA 2XIGA 2VB6A 4BYYA 1IV8A 1T08B 1K6YA 4DIQA 2XB0X 1PUEE 4UUVA 1LEAA 1ZARA 1YX5A 3B6CA 4Y4RA 3HHHA 1IDZA 3FKIJ 1O3TA 5ICCA 4U88A 1VF9A 5K5QA 1PDNC 5DTDA 3MZ8A 4B4CA 1JT0A 4UUSB 3VYUB 3ZP5A 3OYBA 4GFBA 2Q0OA 2UXXA 3DLAA 4XOTA 2P5LC 2G0EA 2H27A 1MGTA 5F0HA 2JK3A 1SFUA 4Z2YA 3D5RC 4LJZF 3TBIA 1E3OC 1OCTC 5B3SH 2FX0A 1REPC 1FMVA 1SVMA 4MLOA 2NVTJ 1J5YA 3SFIA 1UG2A
chains in the Genus database with same CATH topology
3F72A 1TNTA 2HYFA 4IHSA 5E1ZB 2HOEA 2HS5A 1IN8A 5TRDA 1P2FA 3C3WA 2W57A 2F5FA 3J80K 2LF8A 2O6GE 5D5WB 1T98A 4M9ZA 1SD5A 1W7PA 2LSOA 1R7JA 1O7FA 5E1XA 2DTRA 1UFMA 2XROA 2BYVE 2L54A 3N4MA 4EJVA 3GUDA 1JHHA 5LHGA 2DO7A 5LHHA 5FFXA 1FC3A 2DK8A 3WTUC 2XAFA 2OAZA 4OIRF 5LEJA 4E70A 2M30A 1FOKA 2ZXJA 4Q47A 1MDMB 4G94A 4N0BA 5FLXZ 1SMTA 3IL2A 4KYWA 3R0JA 1O57A 2FBHA 1ZLKA 1F4KA 2ZJ2A 4XSZF 2VBXA 4EGZA 1ZLJA 4KA4A 2K4JA 3G3ZA 1F1ZA 1USSA 4ON0A 3TKYA 2EFPA 2EWNA 2FSWA 4M72A 4HQEA 4OU0A 2DLLA 3NRVA 3ELKA 3SZPA 4AIHA 3E6DA 4IHTA 1U5TB 3LSTA 3Q9VA 5IT9Z 4P55A 3KP7A 5LGNA 4GGGA 4XBFA 1P92A 3BPXA 1U2WA 3VODA 1OMIA 5BPIA 2VXZA 1OYYA 3COAC 5BPDA 2IA1A 4L5JA 1RNLA 1FBUA 3RKYA 2VT2A 4N9IA 2ELHA 4CHUA 4BQAA 4YFXF 1FY7A 3E3VA 1T38A 4CXFA 5JHUA 1OKRA 1J75A 1HQCA 3R61A 3LA7A 5DUIA 4I02A 2V1XA 2G7HA 4LD5A 1JE8A 5DYMA 2RVCA 3GFIA 2QZ8A 1YQAA 5CJ9A 4D0PA 5CYVA 1FBSA 4UNOA 2OZUA 1R00A 3Q5FA 1IRFA 3U9GA 4LGWA 3RYRA 2LF7A 1XB4A 1KYZA 3I59B 3ROUA 1HSJA 1SD7A 5K5RA 1Z91A 2DPDA 1IF1A 2DU9A 2GA1A 3RYPA 4ZYDA 1FYLA 4A6EA 1XGNA 2PQ8A 2CFXA 3KP5A 1U6GA 5HLIA 1ONVA 2Q2EA 1IRGA 4KMFA 1U5TC 4JBAA 2BEOA 3R4KA 4HDUA 1DUXC 3T0YA 2UWMA 2QQAA 5DD4A 4A5MA 1KQ9A 3GLXA 5L3CA 2MC3A 3I59A 1K78B 1E17A 1QNTA 4WXHA 3O3KA 4HA8A 5JVTA 3DXJF 4ZH4F 1WWXA 4AWXB 3KE2A 4HOBA 2XGXA 1T39A 5ILSA 4G7HF 1WRJA 1V3FA 1GXPA 5JI6A 4XLNF 1XMKA 1DPUA 2J5OA 2XKPA 2KJCA 4RGRA 2XAHA 4Y13A 4AVPA 1ZRDA 2P4WA 2F5DA 4IF4A 3GZ5A 3PQKA 1QO0D 2F5CA 4UXNA 4ZYGA 4IRIA 3V7RA 1BBYA 4JQFA 4Q4ZF 4A6DA 1IZ1A 3LFKA 1DPRA 1YTYA 3KLNA 2P6SA 2F5EA 1BIAA 5LLQA 3K9TA 3R0AA 3TO6A 3I71A 3ZQ7A 5KVRA 1Z6TA 1GHCA 3E97A 2K02A 3REOA 1QPMA 1HW2A 3MZYA 4M9XA 3M1EA 4O3MA 2FBKA 4HYEA 4EJWA 4O6JA 1FBQA 2JPCA 1ZRFA 3I5UA 1LDDA 3ABTA 3ZPLA 3JW4A 3BJOA 4F7ZA 3V7SA 2MLGA 5HDGA 1YS7A 2CSOA 5AIPA 3CUQC 5FO5A 2WV0A 2PMUA 2O8XA 2CW0F 4TV7A 3HYIA 2ACJA 3BOQA 1K79A 1QBJA 3E5XA 3IRRA 1OYWA 5D4SA 4EM0B 1R23A 5JR3A 2DT5A 4R1HA 4I09A 4BXUA 2QENA 3TDZC 2EFWA 1V4RA 1BN5A 1DP7P 3LQRA 2HYGD 1JGSA 1KU9A 1KYWA 3CUQA 1Y0UA 5J8FA 4ETSA 3EETA 5CLSA 2ZMEA 5HLGA 1ZAOA 5K1YA 3GFMA 1FZPB 2L01A 2V9VA 2BBYA 1PP7U 3HSFA 1FPQA 1G3TA 3QP5A 4PGGA 5HS9A 1S8NA 3RPUA 1YW7A 3EQLF 4LLNA 3KZZA 3U2RA 1IXSB 3MWMA 2CYYA 2W25A 3V8KA 5L3EA 2P7CB 2PJPA 3VEPA 4RB2C 3E6CC 4Q5SF 4HX7A 2BE5F 4A2UA 1ULYA 4UV8A 1FNNA 4CYDA 2IP2A 1U5TA 4M6YA 2RN7A 2IT0A 3M7GA 5DDGA 2DQLA 4LG0B 1RI7A 1EH7A 3B02A 3F21A 4MTDA 5HVQC 4WF2A 5KK1A 4YG2F 2EA2A 2GA2A 3DPTA 5ICEA 2ZBKA 3O2PE 3WTSC 3JTGA 4ENJA 3IKTA 4M73A 3V4GA 4NQWA 3FHZA 4PGHA 3QU6A 1J0RA 2OD5A 3GYHX 4LB6B 2HZTA 2P5KA 3TDUC 2Z33A 2NS0A 1S7AA 2ESHA 4BHPA 5LGUA 4RGXA 3IKVA 2FBIA 1STZA 5LRSA 1EH6A 1C0WA 4H0EA 2A6HF 3ULQB 2EJRA 4EV0A 2A07F 1QZYA 4PDKA 4U0VA 1UB9A 2A6EF 1ZRCA 2QBYB 3BY6A 4HX8A 2A69F 2JZYA 3ZN0A 1FT9A 3G73A 3GXOA 2QUFA 1ZG1A 3GVAA 3WE3A 3TQNA 1LNWA 2O3FA 4Q48A 3WGHA 3QOPA 2Y0MA 1BOAA 5E8IA 3V8JA 2VC0A 2RGVA 3WTVC 1W5SA 2RV8A 3I64A 3ML6A 3LAJA 4KN4X 1B4AA 2P5VA 5E1WA 3ISPA 3C1DA 5ILVA 4L0ZB 3F6OA 5LBQA 3D0SA 4YFKF 1FP1D 3J80Z 1FYMA 2L4MA 1BI0A 1FYKA 5DD8A 1PP8F 1XMAA 4WWCA 4FX4A 3W6KB 5ICFA 4KFCA 1FSHA 1D3YA 3WTYC 1TQMA 2QWWA 5D8LB 3T8RA 3RI4A 3K1NA 4EJOA 3WTTC 1IXCA 5D8KB 3E5UA 1OYIA 1XSDA 3MEXA 3PFIA 1IN5A 5HDNA 3RKXA 2DW4A 1YW9A 3CUOA 1G3YA 2KJBA 5FLXK 5CVJA 2NNYA 2GXGA 3FXUA 1TBXA 5BMZA 4KDPA 4GXOA 1D8KA 1LJ9A 4ENKA 1BC8C 1KQ8A 4EVIA 4CGZA 2ESNA 3P7NA 4BHCA 3I54A 3Q9SA 2QBYA 5TJJA 2WWYA 1IW7F 1B6AA 3RIRA 2P7VB 2Y48A 1YLFA 5D6FA 2YU3A 3ERED 1TW2A 2E1CA 1QZZA 3ABUA 3BPVA 4L9VA 3WTWC 2YX4A 2HQRA 4ZZLA 2EB7A 3NEUA 2ZNYA 1T2KA 1BI2A 1B9MA 3CDHA 4MEYF 2F2EA 4JK1X 2HDCA 2XV4S 2VE9A 2RDPA 3FMQA 2STTA 5FB2A 4Y17A 3HRSA 4OMYA 3EYYA 2DK5A 3HOTA 2FMLA 3FWEA 1Z05A 2XUBA 2Q8KA 4A0YA 5J8CA 3CUQB 1MDMA 4CO8A 3VOEA 2NAZA 2EK5A 3FMSA 2EFNA 1ZG5A 4ESBA 3D5LA 4OOIA 5L3DA 2YR2A 1ZN2A 3IWFA 2HEOA 3MQ0A 3K1PA 1R58A 2YX7A 3KETA 1USTA 1HW5A 3HRUA 2RC4A 2JTVA 2EV6A 1IUYA 3L09A 5F64A 4UHTA 4LG0A 1DDNA 2STWA 1HSTA 3M8EA 2OBPA 4HV5A 4MGRA 3P9IA 2O61A 4LLGF 3IHUA 3KLOA 1UCRA 2HKOA 2MBFA 5JFRA 4WX9A 4I01A 5DCFA 3F3XA 4U7BA 2KIMA 3VFZA 4EQQA 2P8TA 3KP6A 2OQRA 2B0LA 1MJ9A 1LDKB 2ZFWA 2O0YA 1R36A 2KIUA 5F1RA 2V1UA 3K2ZA 2FA5A 2ZMEB 5BQTA 5E8GA 1VTNC 5AONA 1JXSA 3M8FA 3KEOA 1G3WA 5H6RA 3F8FA 3GWZA 4HAMA 2R7DA 3GO5A 4HDVA 1AOYA 4GYGA 4DQ2A 2HTSA 3DV8A 3HRMA 3R6SA 4KNYA 3SHFA 4I0BA 1Q1HA 5E20A 3F8CA 3L7WA 4ENMA 3LA3A 3MZHA 2M5WA 4KICA 2QQBA 2Z3YA 2COMA 3EUHA 2K27A 2EFOA 3FXQA 5D4RA 3HSRA 3F8MA 1T0FA 3V7CA 1EH8A 2ISYA 1ZGJA 3GEZA 5FD5A 1FP2A 3L9FA 2Z9OA 3JAMK 2XAQA 1P4AA 2H6CA 2EA4A 2LKPA 3BP8A 2VODA 4LK1F 2A5YB 2QYOA 1B1BA 3RJPA 2RQPA 1D5VA 1ZHFA 1W5TA 2XVCA 5LEKA 3C7JA 2V1DA 3W6JB 3RTRA 4OIPF 1HW1A 1R1TA 2UXNA 4UVBA 3I0TA 1YS6A 3CO6C 3RPQA 4ZYEA 5J6XA 4M71A 3WU0A 3GFJA 1UHWA 3WGGA 3QP6A 1FX7A 1QGPA 1RUNA 4MNUA 1BI3A 1K6OA 4RB0A 5HS8A 1RUOA 1BC7C 2K7LA 5EEHA 3E5QA 2FNAA 1L3LA 5DCMB 4L0YB 1BM9A 2HKXA 3F8NA 4AIKA 4A12A 4L9JA 3JAMZ 1ODDA 3DEUA 2XASA 4CZZA 3WTZA 3T1BA 2IPQX 2KKOA 2WTEA 3KFWX 5D5XB 1WI9A 1KU7A 2XAJA 4HX4A 4I2OA 4BHBA 2FOKA 2PMHA 3FF5A 4LLLA 1XSXA 2VBYA 4OIOF 1FWZA 2ZCWA 2EFQA 4KT5C 3H3ZA 2MA3A 4LFUA 3OOPA 2E7XA 1K78A 5L3GA 3H92A 2QQ9A 3K0LA 4EJTA 1JHFA 3ECOA 3GW2A 3QRFF 4XSXF 1ZH5A 2H94A 3NQOA 2PEXA 3HHGA 3E6BA 1BJAA 1WKMA 1W7PD 4IPAA 5D5VB 4KIGA 1H0MA 2R7FA 4M9SA 3P9KA 2YSRA 3FMRA 3CLOA 4RAZA 4HBLA 1G4DA 2AS5F 2JPBA 3MAJA 4OMZA 4MEXF 5HLHA 1L0OC 4ESJA 1S7OA 4WK8F 5CVRA 3HUGA 2NYXA 3KP4A 1MD0A 1XD7A 3P9CA 2QVOA 4FT8A 3WGIA 1EV7A 1U78A 1I1GA 3BWGA 2W84A 2DQRA 1I5ZA 2V6CA 2AXLA 2W85A 2V79A 4P96A 2PFBA 4EM2A 1K7AA 4KN7X 2FEZA 3K1MA 2M1BA 3WE2A 2FNPA 2HQNA 3L00A 1QQIA 4G6DA 3R60A 2W24A 2VBWA 4GCVA 2VOOA 2D2WA 4KIBA 3F8BA 3I58A 1J2XA 4RB1A 4M6XA 2CO5A 2DI3A 4OINF 1SD6A 2NRAC 5E18F 4P5OA 2UZKA 4G9YA 2WC2A 4IJAA 2M45A 2JRTA 2ZNZA 4I98B 2LDUA 1TTYA 3BJAA 3BDDA 4B8XA 5D6EA 4PZJA 1IN7A 4FHTA 4G6QA 3TO9A 2HTJA 2O03A 3MFKA 3WU1B 4A5NA 4M74A 2OU2A 1CGPA 4S04A 5CVIA 4XLPF 4HV6A 2JT1A 4BAYA 3ECHA 2DBBA 5IT3A 4EGYA 1YIOA 1FLIA 4IXAA 3F22A 4RGUA 1W7PB 4MQ9F 2Z5UA 2HR3A 2GQQA 5DCMA 3QPHA 4DNCA 3DFGA 4PCQA 1SAXA 4HQMA 1X3UA 3CJNA 3QU3A 3ZMUA 1TNSA 4O5VA 2FU4A 4Y15A 3LA2A 1ZYRF 4G7ZF 2XHKA 2HGCA 4HLYA 3DF8A 1SD4A 3FM3A 1I1SA 4ENNA 4U0WA 1SFXA 3FZVA 4R79A 1J7KA 2M87A 2PN6A 1HKTA 3DPLC 4CICA 3U1DA 2YPRA 2P6TA 1TLHB 2OQGA 4S05A 5E17F 3DQVC 3HOSA 1O7LA 4NHJA 3V8LA 2MH9A 4KMUX 3S2WA 4BNCA 4L18B 4AIJA 1CF7A 2C6YA 2KIFA 1MJAA 3TOBA 1P4XA 3OV8A 3T8TA 1I27A 3H3UA 1U8RA 3SZTA 2MH2A 1SMYF 5H6QA 4QWQA 2FF4A 2FXAA 2EV0A 2IW5A 3J7AO 1MZBA 5ERIA 2BGCA 2RKHA 3O6BB 1Z6RA 3RKWA 1IXRC 1F9NA 2QLZA 2D45A 4EMSA 5CVVA 2XKOA 1MJBA 3TO7A 2H09A 1S6LA 2E1NA 1TW3A 1Z9CA 1O3RA 3KCCA 4MQVA 1AWCA 3J81K 3I4PA 1ON2A 1J59A 2L02A 3HRTA 1XSVA 2FQ3A 3GZ6A 2G7UA 3HTUA 4IRGA 3SFZA 2GWRA 2PG4A 4EM1A 2J5PA 2DFIA 2CGPA 2OA4A 1FSEA 5F6FA 1LEBA 2QM3A 4I7HA 5FFZA 3ZMDA 3FX3A 1S29A 3LQQA 3QAHA 2LNBA 3LAPA 1RZ4A 6PAXA 1YYVA 2VE8A 4L9NA 1BI1A 4P9FA 4UVCA 2CG4A 2R3SA 3J81Z 5LGTA 3IWZA 1IN6A 2E7WA 1O3QA 4L9TA 5EEGA 2VONA 3CTAA 5LHIA 2GIVA 3HSEA 2MLKA 4RB3C 3GFLA 3EYIA 5DV5A 3PQJA 5HOOA 4WXCA 4AD9A 1W4MA 3C18A 2OZ6A 3GX4X 5H20A 1B59A 4HF2A 4G7OF 3LWFA 2D1HA 4GO1A 2NNNA 1GVJA 4A0ZA 5FGMA 4UV9A 4R8HA 1TQIA 1XCVA 2XRNA 2VC1A 2K4BA 5A2QZ 1ZGAA 1SFEA 2ADUA 4ESFA 3ZMVA 1OR7A 2CQKA 2L4AA 3KZYA 2X0LA 1XCBA 4KIFA 3L2CA 4I0AA 2DPUA 1YG2A 1H9TA 3F23A 2ZO4A 5A2QK 3BROA 1CF7B 3WG9A 3I53A 3IC7A 2H6BA 4YIIA 1KGSA 5HS7A 3QPTA 4B09A 3N97A 4HF1A 2KRFA 5ICGA 3M9AA 3ZMSA 1S3JA 2IA2A 4MHGA 4KUMA 2VBZA 3HTSB 2MD5A 2VN2A 4XRFA 2A68F 2VOPA 3KEQA 3TOAA 1TQPA 1D8JA 4L5IA 4QLCU 2A61A 2ETHA 3ZN1A 1HXDA 3KP3A 4RGSA 2ISZA 4LK0F 3VB2A 2Z99A 4P9UA 1P6RA 4UVAA 4IVNA 4FX0A 4MTEA 4RS8A 3DP7A 2L3DA 3FXRA 2HWVA 3F6VA 1E2XA 2XAGA 1I6XA 3RDIA 3T5XA 4EJUA 3BJ6A 1HBXG 1ZG3A 2CWEA 2DAOA 3MCZA 1R22A 4WXDA 4WCGA 4NB5A 1R5HA 2FE3A 2IJLA 1MKMA 2G9WA 3BZ6A 1T6SA 4GYIA 1Z7UA 2FRHA 4CDGA 2GXBA 3WODF 3KP2A 5BOXA 3K69A 2EV5A 3HIFA 2PBIA 1G6NA 2ZKZA 2X4HA 3B73A 3JSOA 4A0XA 1ON1A 4BH9A 3SXYA 2BV6A 4U7DA 1F5TA 1YW8A 5D5UB 1H9GA 1NHAA 1R5GA 1HKQA 5DEQA 2A3SA 5DUKA 5ILUA 4IRHA 2HFHA 1KU2A 5IT9K 5CVUA 5K5OA 5BS6A 3SQNA 4LB5A 4HLXA 3E6MA 3WTXC 1IAWA 4ASNA 5AIQA 5LRRA 1R1UA 2GZWA 4YIFA 1RIOH 3JTHA 4K2EA 1UHMA 1IN4A 3ZMZA 5ED4A 4ZYHA 2TDXA 5HDKA 1XDUA 5L3BA 4G8XA 1KU3A 3DKWA 3CO7C 1XDSA 1OPCA 2D1VA 4RAYA 1YO5C 3TGNA 4YFNF 3FM5A 3AAFA 1WSUA 1ZREA 1BIBA 1U3EM 2IVMA 2FMYA 1LDJA 1GXQA 1A04A 2VT3A 2PI0A 1KA8A 1B9NA 1XN7A 4ZZDA 2IA0A 1XGOA 2Y75A 3GF2A 1WQ2A 4HW0A 2M8EA 4N9HA 3ZMTA 4LMYA 3JSPA 1J9IA 1O3SA 1LB2A 2PLYA 5L3FA 4OIQF 1XGSA 1YFHA 1G3SA 2JSCA 3EDPA 2IRFG 1LQ1A 4U0YA 1LVAA 2GAUA 1Z1DA 1R1VA 4HF0A 1KQ0A 4HZFA 5FD6A 3IRQA 1P4WA 2RNJA 1XGMA 2K86A 1HKSA 2XIGA 4BYYA 1PUEE 4UUVA 1LEAA 1ZARA 3HHHA 1O3TA 5ICCA 4U88A 5K5QA 1PDNC 3ZP5A 2Q0OA 2UXXA 2P5LC 2H27A 1MGTA 1SFUA 4Z2YA 4LJZF 1REPC 1J5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F72 A;  1TNT A;  2HYF A;  4IHS A;  5E1Z B;  2HOE A;  2HS5 A;  1IN8 A;  5TRD A;  1P2F A;  3C3W A;  2W57 A;  2F5F A;  3J80 K;  2LF8 A;  2O6G E;  5D5W B;  1T98 A;  4M9Z A;  1SD5 A;  1W7P A;  2LSO A;  1R7J A;  1O7F A;  5E1X A;  2DTR A;  1UFM A;  2XRO A;  2BYV E;  2L54 A;  3N4M A;  4EJV A;  3GUD A;  1JHH A;  5LHG A;  2DO7 A;  5LHH A;  5FFX A;  1FC3 A;  2DK8 A;  3WTU C;  2XAF A;  2OAZ A;  4OIR F;  5LEJ A;  4E70 A;  2M30 A;  1FOK A;  2ZXJ A;  4Q47 A;  1MDM B;  4G94 A;  4N0B A;  5FLX Z;  1SMT A;  3IL2 A;  4KYW A;  3R0J A;  1O57 A;  2FBH A;  1ZLK A;  1F4K A;  2ZJ2 A;  4XSZ F;  2VBX A;  4EGZ A;  1ZLJ A;  4KA4 A;  2K4J A;  3G3Z A;  1F1Z A;  1USS A;  4ON0 A;  3TKY A;  2EFP A;  2EWN A;  2FSW A;  4M72 A;  4HQE A;  4OU0 A;  2DLL A;  3NRV A;  3ELK A;  3SZP A;  4AIH A;  3E6D A;  4IHT A;  1U5T B;  3LST A;  3Q9V A;  5IT9 Z;  4P55 A;  3KP7 A;  5LGN A;  4GGG A;  4XBF A;  1P92 A;  3BPX A;  1U2W A;  3VOD A;  1OMI A;  5BPI A;  2VXZ A;  1OYY A;  3COA C;  5BPD A;  2IA1 A;  4L5J A;  1RNL A;  1FBU A;  3RKY A;  2VT2 A;  4N9I A;  2ELH A;  4CHU A;  4BQA A;  4YFX F;  1FY7 A;  3E3V A;  1T38 A;  4CXF A;  5JHU A;  1OKR A;  1J75 A;  1HQC A;  3R61 A;  3LA7 A;  5DUI A;  4I02 A;  2V1X A;  2G7H A;  4LD5 A;  1JE8 A;  5DYM A;  2RVC A;  3GFI A;  2QZ8 A;  1YQA A;  5CJ9 A;  4D0P A;  5CYV A;  1FBS A;  4UNO A;  2OZU A;  1R00 A;  3Q5F A;  1IRF A;  3U9G A;  4LGW A;  3RYR A;  2LF7 A;  1XB4 A;  1KYZ A;  3I59 B;  3ROU A;  1HSJ A;  1SD7 A;  5K5R A;  1Z91 A;  2DPD A;  1IF1 A;  2DU9 A;  2GA1 A;  3RYP A;  4ZYD A;  1FYL A;  4A6E A;  1XGN A;  2PQ8 A;  2CFX A;  3KP5 A;  1U6G A;  5HLI A;  1ONV A;  2Q2E A;  1IRG A;  4KMF A;  1U5T C;  4JBA A;  2BEO A;  3R4K A;  4HDU A;  1DUX C;  3T0Y A;  2UWM A;  2QQA A;  5DD4 A;  4A5M A;  1KQ9 A;  3GLX A;  5L3C A;  2MC3 A;  3I59 A;  1K78 B;  1E17 A;  1QNT A;  4WXH A;  3O3K A;  4HA8 A;  5JVT A;  3DXJ F;  4ZH4 F;  1WWX A;  4AWX B;  3KE2 A;  4HOB A;  2XGX A;  1T39 A;  5ILS A;  4G7H F;  1WRJ A;  1V3F A;  1GXP A;  5JI6 A;  4XLN F;  1XMK A;  1DPU A;  2J5O A;  2XKP A;  2KJC A;  4RGR A;  2XAH A;  4Y13 A;  4AVP A;  1ZRD A;  2P4W A;  2F5D A;  4IF4 A;  3GZ5 A;  3PQK A;  1QO0 D;  2F5C A;  4UXN A;  4ZYG A;  4IRI A;  3V7R A;  1BBY A;  4JQF A;  4Q4Z F;  4A6D A;  1IZ1 A;  3LFK A;  1DPR A;  1YTY A;  3KLN A;  2P6S A;  2F5E A;  1BIA A;  5LLQ A;  3K9T A;  3R0A A;  3TO6 A;  3I71 A;  3ZQ7 A;  5KVR A;  1Z6T A;  1GHC A;  3E97 A;  2K02 A;  3REO A;  1QPM A;  1HW2 A;  3MZY A;  4M9X A;  3M1E A;  4O3M A;  2FBK A;  4HYE A;  4EJW A;  4O6J A;  1FBQ A;  2JPC A;  1ZRF A;  3I5U A;  1LDD A;  3ABT A;  3ZPL A;  3JW4 A;  3BJO A;  4F7Z A;  3V7S A;  2MLG A;  5HDG A;  1YS7 A;  2CSO A;  5AIP A;  3CUQ C;  5FO5 A;  2WV0 A;  2PMU A;  2O8X A;  2CW0 F;  4TV7 A;  3HYI A;  2ACJ A;  3BOQ A;  1K79 A;  1QBJ A;  3E5X A;  3IRR A;  1OYW A;  5D4S A;  4EM0 B;  1R23 A;  5JR3 A;  2DT5 A;  4R1H A;  4I09 A;  4BXU A;  2QEN A;  3TDZ C;  2EFW A;  1V4R A;  1BN5 A;  1DP7 P;  3LQR A;  2HYG D;  1JGS A;  1KU9 A;  1KYW A;  3CUQ A;  1Y0U A;  5J8F A;  4ETS A;  3EET A;  5CLS A;  2ZME A;  5HLG A;  1ZAO A;  5K1Y A;  3GFM A;  1FZP B;  2L01 A;  2V9V A;  2BBY A;  1PP7 U;  3HSF A;  1FPQ A;  1G3T A;  3QP5 A;  4PGG A;  5HS9 A;  1S8N A;  3RPU A;  1YW7 A;  3EQL F;  4LLN A;  3KZZ A;  3U2R A;  1IXS B;  3MWM A;  2CYY A;  2W25 A;  3V8K A;  5L3E A;  2P7C B;  2PJP A;  3VEP A;  4RB2 C;  3E6C C;  4Q5S F;  4HX7 A;  2BE5 F;  4A2U A;  1ULY A;  4UV8 A;  1FNN A;  4CYD A;  2IP2 A;  1U5T A;  4M6Y A;  2RN7 A;  2IT0 A;  3M7G A;  5DDG A;  2DQL A;  4LG0 B;  1RI7 A;  1EH7 A;  3B02 A;  3F21 A;  4MTD A;  5HVQ C;  4WF2 A;  5KK1 A;  4YG2 F;  2EA2 A;  2GA2 A;  3DPT A;  5ICE A;  2ZBK A;  3O2P E;  3WTS C;  3JTG A;  4ENJ A;  3IKT A;  4M73 A;  3V4G A;  4NQW A;  3FHZ A;  4PGH A;  3QU6 A;  1J0R A;  2OD5 A;  3GYH X;  4LB6 B;  2HZT A;  2P5K A;  3TDU C;  2Z33 A;  2NS0 A;  1S7A A;  2ESH A;  4BHP A;  5LGU A;  4RGX A;  3IKV A;  2FBI A;  1STZ A;  5LRS A;  1EH6 A;  1C0W A;  4H0E A;  2A6H F;  3ULQ B;  2EJR A;  4EV0 A;  2A07 F;  1QZY A;  4PDK A;  4U0V A;  1UB9 A;  2A6E F;  1ZRC A;  2QBY B;  3BY6 A;  4HX8 A;  2A69 F;  2JZY A;  3ZN0 A;  1FT9 A;  3G73 A;  3GXO A;  2QUF A;  1ZG1 A;  3GVA A;  3WE3 A;  3TQN A;  1LNW A;  2O3F A;  4Q48 A;  3WGH A;  3QOP A;  2Y0M A;  1BOA A;  5E8I A;  3V8J A;  2VC0 A;  2RGV A;  3WTV C;  1W5S A;  2RV8 A;  3I64 A;  3ML6 A;  3LAJ A;  4KN4 X;  1B4A A;  2P5V A;  5E1W A;  3ISP A;  3C1D A;  5ILV A;  4L0Z B;  3F6O A;  5LBQ A;  3D0S A;  4YFK F;  1FP1 D;  3J80 Z;  1FYM A;  2L4M A;  1BI0 A;  1FYK A;  5DD8 A;  1PP8 F;  1XMA A;  4WWC A;  4FX4 A;  3W6K B;  5ICF A;  4KFC A;  1FSH A;  1D3Y A;  3WTY C;  1TQM A;  2QWW A;  5D8L B;  3T8R A;  3RI4 A;  3K1N A;  4EJO A;  3WTT C;  1IXC A;  5D8K B;  3E5U A;  1OYI A;  1XSD A;  3MEX A;  3PFI A;  1IN5 A;  5HDN A;  3RKX A;  2DW4 A;  1YW9 A;  3CUO A;  1G3Y A;  2KJB A;  5FLX K;  5CVJ A;  2NNY A;  2GXG A;  3FXU A;  1TBX A;  5BMZ A;  4KDP A;  4GXO A;  1D8K A;  1LJ9 A;  4ENK A;  1BC8 C;  1KQ8 A;  4EVI A;  4CGZ A;  2ESN A;  3P7N A;  4BHC A;  3I54 A;  3Q9S A;  2QBY A;  5TJJ A;  2WWY A;  1IW7 F;  1B6A A;  3RIR A;  2P7V B;  2Y48 A;  1YLF A;  5D6F A;  2YU3 A;  3ERE D;  1TW2 A;  2E1C A;  1QZZ A;  3ABU A;  3BPV A;  4L9V A;  3WTW C;  2YX4 A;  2HQR A;  4ZZL A;  2EB7 A;  3NEU A;  2ZNY A;  1T2K A;  1BI2 A;  1B9M A;  3CDH A;  4MEY F;  2F2E A;  4JK1 X;  2HDC A;  2XV4 S;  2VE9 A;  2RDP A;  3FMQ A;  2STT A;  5FB2 A;  4Y17 A;  3HRS A;  4OMY A;  3EYY A;  2DK5 A;  3HOT A;  2FML A;  3FWE A;  1Z05 A;  2XUB A;  2Q8K A;  4A0Y A;  5J8C A;  3CUQ B;  1MDM A;  4CO8 A;  3VOE A;  2NAZ A;  2EK5 A;  3FMS A;  2EFN A;  1ZG5 A;  4ESB A;  3D5L A;  4OOI A;  5L3D A;  2YR2 A;  1ZN2 A;  3IWF A;  2HEO A;  3MQ0 A;  3K1P A;  1R58 A;  2YX7 A;  3KET A;  1UST A;  1HW5 A;  3HRU A;  2RC4 A;  2JTV A;  2EV6 A;  1IUY A;  3L09 A;  5F64 A;  4UHT A;  4LG0 A;  1DDN A;  2STW A;  1HST A;  3M8E A;  2OBP A;  4HV5 A;  4MGR A;  3P9I A;  2O61 A;  4LLG F;  3IHU A;  3KLO A;  1UCR A;  2HKO A;  2MBF A;  5JFR A;  4WX9 A;  4I01 A;  5DCF A;  3F3X A;  4U7B A;  2KIM A;  3VFZ A;  4EQQ A;  2P8T A;  3KP6 A;  2OQR A;  2B0L A;  1MJ9 A;  1LDK B;  2ZFW A;  2O0Y A;  1R36 A;  2KIU A;  5F1R A;  2V1U A;  3K2Z A;  2FA5 A;  2ZME B;  5BQT A;  5E8G A;  1VTN C;  5AON A;  1JXS A;  3M8F A;  3KEO A;  1G3W A;  5H6R A;  3F8F A;  3GWZ A;  4HAM A;  2R7D A;  3GO5 A;  4HDV A;  1AOY A;  4GYG A;  4DQ2 A;  2HTS A;  3DV8 A;  3HRM A;  3R6S A;  4KNY A;  3SHF A;  4I0B A;  1Q1H A;  5E20 A;  3F8C A;  3L7W A;  4ENM A;  3LA3 A;  3MZH A;  2M5W A;  4KIC A;  2QQB A;  2Z3Y A;  2COM A;  3EUH A;  2K27 A;  2EFO A;  3FXQ A;  5D4R A;  3HSR A;  3F8M A;  1T0F A;  3V7C A;  1EH8 A;  2ISY A;  1ZGJ A;  3GEZ A;  5FD5 A;  1FP2 A;  3L9F A;  2Z9O A;  3JAM K;  2XAQ A;  1P4A A;  2H6C A;  2EA4 A;  2LKP A;  3BP8 A;  2VOD A;  4LK1 F;  2A5Y B;  2QYO A;  1B1B A;  3RJP A;  2RQP A;  1D5V A;  1ZHF A;  1W5T A;  2XVC A;  5LEK A;  3C7J A;  2V1D A;  3W6J B;  3RTR A;  4OIP F;  1HW1 A;  1R1T A;  2UXN A;  4UVB A;  3I0T A;  1YS6 A;  3CO6 C;  3RPQ A;  4ZYE A;  5J6X A;  4M71 A;  3WU0 A;  3GFJ A;  1UHW A;  3WGG A;  3QP6 A;  1FX7 A;  1QGP A;  1RUN A;  4MNU A;  1BI3 A;  1K6O A;  4RB0 A;  5HS8 A;  1RUO A;  1BC7 C;  2K7L A;  5EEH A;  3E5Q A;  2FNA A;  1L3L A;  5DCM B;  4L0Y B;  1BM9 A;  2HKX A;  3F8N A;  4AIK A;  4A12 A;  4L9J A;  3JAM Z;  1ODD A;  3DEU A;  2XAS A;  4CZZ A;  3WTZ A;  3T1B A;  2IPQ X;  2KKO A;  2WTE A;  3KFW X;  5D5X B;  1WI9 A;  1KU7 A;  2XAJ A;  4HX4 A;  4I2O A;  4BHB A;  2FOK A;  2PMH A;  3FF5 A;  4LLL A;  1XSX A;  2VBY A;  4OIO F;  1FWZ A;  2ZCW A;  2EFQ A;  4KT5 C;  3H3Z A;  2MA3 A;  4LFU A;  3OOP A;  2E7X A;  1K78 A;  5L3G A;  3H92 A;  2QQ9 A;  3K0L A;  4EJT A;  1JHF A;  3ECO A;  3GW2 A;  3QRF F;  4XSX F;  1ZH5 A;  2H94 A;  3NQO A;  2PEX A;  3HHG A;  3E6B A;  1BJA A;  1WKM A;  1W7P D;  4IPA A;  5D5V B;  4KIG A;  1H0M A;  2R7F A;  4M9S A;  3P9K A;  2YSR A;  3FMR A;  3CLO A;  4RAZ A;  4HBL A;  1G4D A;  2AS5 F;  2JPB A;  3MAJ A;  4OMZ A;  4MEX F;  5HLH A;  1L0O C;  4ESJ A;  1S7O A;  4WK8 F;  5CVR A;  3HUG A;  2NYX A;  3KP4 A;  1MD0 A;  1XD7 A;  3P9C A;  2QVO A;  4FT8 A;  3WGI A;  1EV7 A;  1U78 A;  1I1G A;  3BWG A;  2W84 A;  2DQR A;  1I5Z A;  2V6C A;  2AXL A;  2W85 A;  2V79 A;  4P96 A;  2PFB A;  4EM2 A;  1K7A A;  4KN7 X;  2FEZ A;  3K1M A;  2M1B A;  3WE2 A;  2FNP A;  2HQN A;  3L00 A;  1QQI A;  4G6D A;  3R60 A;  2W24 A;  2VBW A;  4GCV A;  2VOO A;  2D2W A;  4KIB A;  3F8B A;  3I58 A;  1J2X A;  4RB1 A;  4M6X A;  2CO5 A;  2DI3 A;  4OIN F;  1SD6 A;  2NRA C;  5E18 F;  4P5O A;  2UZK A;  4G9Y A;  2WC2 A;  4IJA A;  2M45 A;  2JRT A;  2ZNZ A;  4I98 B;  2LDU A;  1TTY A;  3BJA A;  3BDD A;  4B8X A;  5D6E A;  4PZJ A;  1IN7 A;  4FHT A;  4G6Q A;  3TO9 A;  2HTJ A;  2O03 A;  3MFK A;  3WU1 B;  4A5N A;  4M74 A;  2OU2 A;  1CGP A;  4S04 A;  5CVI A;  4XLP F;  4HV6 A;  2JT1 A;  4BAY A;  3ECH A;  2DBB A;  5IT3 A;  4EGY A;  1YIO A;  1FLI A;  4IXA A;  3F22 A;  4RGU A;  1W7P B;  4MQ9 F;  2Z5U A;  2HR3 A;  2GQQ A;  5DCM A;  3QPH A;  4DNC A;  3DFG A;  4PCQ A;  1SAX A;  4HQM A;  1X3U A;  3CJN A;  3QU3 A;  3ZMU A;  1TNS A;  4O5V A;  2FU4 A;  4Y15 A;  3LA2 A;  1ZYR F;  4G7Z F;  2XHK A;  2HGC A;  4HLY A;  3DF8 A;  1SD4 A;  3FM3 A;  1I1S A;  4ENN A;  4U0W A;  1SFX A;  3FZV A;  4R79 A;  1J7K A;  2M87 A;  2PN6 A;  1HKT A;  3DPL C;  4CIC A;  3U1D A;  2YPR A;  2P6T A;  1TLH B;  2OQG A;  4S05 A;  5E17 F;  3DQV C;  3HOS A;  1O7L A;  4NHJ A;  3V8L A;  2MH9 A;  4KMU X;  3S2W A;  4BNC A;  4L18 B;  4AIJ A;  1CF7 A;  2C6Y A;  2KIF A;  1MJA A;  3TOB A;  1P4X A;  3OV8 A;  3T8T A;  1I27 A;  3H3U A;  1U8R A;  3SZT A;  2MH2 A;  1SMY F;  5H6Q A;  4QWQ A;  2FF4 A;  2FXA A;  2EV0 A;  2IW5 A;  3J7A O;  1MZB A;  5ERI A;  2BGC A;  2RKH A;  3O6B B;  1Z6R A;  3RKW A;  1IXR C;  1F9N A;  2QLZ A;  2D45 A;  4EMS A;  5CVV A;  2XKO A;  1MJB A;  3TO7 A;  2H09 A;  1S6L A;  2E1N A;  1TW3 A;  1Z9C A;  1O3R A;  3KCC A;  4MQV A;  1AWC A;  3J81 K;  3I4P A;  1ON2 A;  1J59 A;  2L02 A;  3HRT A;  1XSV A;  2FQ3 A;  3GZ6 A;  2G7U A;  3HTU A;  4IRG A;  3SFZ A;  2GWR A;  2PG4 A;  4EM1 A;  2J5P A;  2DFI A;  2CGP A;  2OA4 A;  1FSE A;  5F6F A;  1LEB A;  2QM3 A;  4I7H A;  5FFZ A;  3ZMD A;  3FX3 A;  1S29 A;  3LQQ A;  3QAH A;  2LNB A;  3LAP A;  1RZ4 A;  6PAX A;  1YYV A;  2VE8 A;  4L9N A;  1BI1 A;  4P9F A;  4UVC A;  2CG4 A;  2R3S A;  3J81 Z;  5LGT A;  3IWZ A;  1IN6 A;  2E7W A;  1O3Q A;  4L9T A;  5EEG A;  2VON A;  3CTA A;  5LHI A;  2GIV A;  3HSE A;  2MLK A;  4RB3 C;  3GFL A;  3EYI A;  5DV5 A;  3PQJ A;  5HOO A;  4WXC A;  4AD9 A;  1W4M A;  3C18 A;  2OZ6 A;  3GX4 X;  5H20 A;  1B59 A;  4HF2 A;  4G7O F;  3LWF A;  2D1H A;  4GO1 A;  2NNN A;  1GVJ A;  4A0Z A;  5FGM A;  4UV9 A;  4R8H A;  1TQI A;  1XCV A;  2XRN A;  2VC1 A;  2K4B A;  5A2Q Z;  1ZGA A;  1SFE A;  2ADU A;  4ESF A;  3ZMV A;  1OR7 A;  2CQK A;  2L4A A;  3KZY A;  2X0L A;  1XCB A;  4KIF A;  3L2C A;  4I0A A;  2DPU A;  1YG2 A;  1H9T A;  3F23 A;  2ZO4 A;  5A2Q K;  3BRO A;  1CF7 B;  3WG9 A;  3I53 A;  3IC7 A;  2H6B A;  4YII A;  1KGS A;  5HS7 A;  3QPT A;  4B09 A;  3N97 A;  4HF1 A;  2KRF A;  5ICG A;  3M9A A;  3ZMS A;  1S3J A;  2IA2 A;  4MHG A;  4KUM A;  2VBZ A;  3HTS B;  2MD5 A;  2VN2 A;  4XRF A;  2A68 F;  2VOP A;  3KEQ A;  3TOA A;  1TQP A;  1D8J A;  4L5I A;  4QLC U;  2A61 A;  2ETH A;  3ZN1 A;  1HXD A;  3KP3 A;  4RGS A;  2ISZ A;  4LK0 F;  3VB2 A;  2Z99 A;  4P9U A;  1P6R A;  4UVA A;  4IVN A;  4FX0 A;  4MTE A;  4RS8 A;  3DP7 A;  2L3D A;  3FXR A;  2HWV A;  3F6V A;  1E2X A;  2XAG A;  1I6X A;  3RDI A;  3T5X A;  4EJU A;  3BJ6 A;  1HBX G;  1ZG3 A;  2CWE A;  2DAO A;  3MCZ A;  1R22 A;  4WXD A;  4WCG A;  4NB5 A;  1R5H A;  2FE3 A;  2IJL A;  1MKM A;  2G9W A;  3BZ6 A;  1T6S A;  4GYI A;  1Z7U A;  2FRH A;  4CDG A;  2GXB A;  3WOD F;  3KP2 A;  5BOX A;  3K69 A;  2EV5 A;  3HIF A;  2PBI A;  1G6N A;  2ZKZ A;  2X4H A;  3B73 A;  3JSO A;  4A0X A;  1ON1 A;  4BH9 A;  3SXY A;  2BV6 A;  4U7D A;  1F5T A;  1YW8 A;  5D5U B;  1H9G A;  1NHA A;  1R5G A;  1HKQ A;  5DEQ A;  2A3S A;  5DUK A;  5ILU A;  4IRH A;  2HFH A;  1KU2 A;  5IT9 K;  5CVU A;  5K5O A;  5BS6 A;  3SQN A;  4LB5 A;  4HLX A;  3E6M A;  3WTX C;  1IAW A;  4ASN A;  5AIQ A;  5LRR A;  1R1U A;  2GZW A;  4YIF A;  1RIO H;  3JTH A;  4K2E A;  1UHM A;  1IN4 A;  3ZMZ A;  5ED4 A;  4ZYH A;  2TDX A;  5HDK A;  1XDU A;  5L3B A;  4G8X A;  1KU3 A;  3DKW A;  3CO7 C;  1XDS A;  1OPC A;  2D1V A;  4RAY A;  1YO5 C;  3TGN A;  4YFN F;  3FM5 A;  3AAF A;  1WSU A;  1ZRE A;  1BIB A;  1U3E M;  2IVM A;  2FMY A;  1LDJ A;  1GXQ A;  1A04 A;  2VT3 A;  2PI0 A;  1KA8 A;  1B9N A;  1XN7 A;  4ZZD A;  2IA0 A;  1XGO A;  2Y75 A;  3GF2 A;  1WQ2 A;  4HW0 A;  2M8E A;  4N9H A;  3ZMT A;  4LMY A;  3JSP A;  1J9I A;  1O3S A;  1LB2 A;  2PLY A;  5L3F A;  4OIQ F;  1XGS A;  1YFH A;  1G3S A;  2JSC A;  3EDP A;  2IRF G;  1LQ1 A;  4U0Y A;  1LVA A;  2GAU A;  1Z1D A;  1R1V A;  4HF0 A;  1KQ0 A;  4HZF A;  5FD6 A;  3IRQ A;  1P4W A;  2RNJ A;  1XGM A;  2K86 A;  1HKS A;  2XIG A;  4BYY A;  1PUE E;  4UUV A;  1LEA A;  1ZAR A;  3HHH A;  1O3T A;  5ICC A;  4U88 A;  5K5Q A;  1PDN C;  3ZP5 A;  2Q0O A;  2UXX A;  2P5L C;  2H27 A;  1MGT A;  1SFU A;  4Z2Y A;  4LJZ F;  1REP C;  1J5Y A; 
#chains in the Genus database with same CATH topology
 2X48 A;  5FRM A;  3F72 A;  1FTZ A;  1TNT A;  2HYF A;  4IHS A;  2DOE A;  3HOU J;  5E1Z B;  4BXF A;  2HOE A;  2HS5 A;  1IN8 A;  5TRD A;  4MIM A;  1P2F A;  3C3W A;  1B8I A;  2W57 A;  5B1A H;  2M4K A;  1LKX A;  2F5F A;  3J80 K;  1AHD P;  2LF8 A;  1LFU P;  2O7O A;  2O6G E;  5D5W B;  1T98 A;  2DFF A;  2M34 A;  1VQM I;  4U87 A;  1X1B A;  2XPW A;  4M9Z A;  1SD5 A;  3QYE A;  1TT5 B;  1W7P A;  3DPU A;  1YIT I;  4Y33 A;  3VPR A;  3CMA I;  2Q1Z B;  2LSO A;  3CJQ B;  1R7J A;  1O7F A;  4ITV A;  5E1X A;  2DTR A;  1UFM A;  2XRO A;  3S3O A;  2BYV E;  5E3L A;  2L54 A;  3CJR B;  5BNG A;  3HPG A;  2L2O A;  2W1O A;  2WBM A;  4CUG A;  3KYL A;  3N4M A;  4EJV A;  1JGG A;  2CU7 A;  4PJJ A;  3GUD A;  1JHH A;  5J3L A;  5LHG A;  2RQQ A;  4Y7N J;  2DO7 A;  3CCE I;  2XF5 A;  5LHH A;  5FFX A;  1FC3 A;  2DK8 A;  3WTU C;  2XAF A;  2OAZ A;  3FXM A;  4OIR F;  1IV6 A;  5LEJ A;  4E70 A;  2FUG 2;  4CCN A;  1WVR A;  2M30 A;  1FOK A;  2ZXJ A;  4Q47 A;  4KT6 A;  1MDM B;  4XIC A;  1B72 B;  3K4L A;  4G94 A;  4N0B A;  2XRL A;  5FLX Z;  1SMT A;  5KCM A;  3IL2 A;  4KYW A;  2DMU A;  3R0J A;  1O57 A;  2FBH A;  4BE0 A;  2HVS A;  3GCM A;  1OLT A;  1F4K A;  1ZLK A;  3IH4 A;  4AID A;  2ZJ2 A;  4UB6 C;  1Y6I A;  1VQ8 I;  4XSZ F;  4LG3 A;  2VBX A;  4EGZ A;  1D1C A;  1ZLJ A;  4KA4 A;  1FIA A;  2FJ1 A;  3BT9 A;  2K4J A;  3G3Z A;  4JOM A;  2V9K A;  1F1Z A;  3ZQL A;  1VQ4 I;  1USS A;  1JUS A;  4ON0 A;  3TKY A;  2EFP A;  2EWN A;  2FSW A;  5CQG A;  1TC3 C;  3G1M A;  4M72 A;  1W5C C;  4XL9 A;  4OU0 A;  2DLL A;  4HQE A;  3GTK J;  3NRV A;  3SZG A;  1UEL B;  3ELK A;  3I4M J;  3SZP A;  3TP0 A;  1MH4 A;  1I3Q J;  4AIH A;  3E6D A;  4IHT A;  1U5T B;  3LST A;  3Q9V A;  5IT9 Z;  4P55 A;  4CZC A;  3KP7 A;  2R5Y A;  5LGN A;  3CC4 I;  4DYC A;  4GGG A;  4XBF A;  1P92 A;  1ZK8 A;  1K4S A;  3BPX A;  3JRA A;  1U2W A;  3Q0V A;  3VOD A;  1OMI A;  5BPI A;  1QHG A;  2VXZ A;  1OYY A;  2JA7 J;  4G6T B;  1X1D A;  3COA C;  2QSF X;  5BPD A;  2IA1 A;  2MGQ A;  4L5J A;  3M4O J;  1RNL A;  1FBU A;  2IXS A;  2A6T A;  3RKY A;  2VT2 A;  1TT0 A;  4N9I A;  5EGO A;  2ELH A;  4CHU A;  5CKT A;  3FBN B;  4BQA A;  2KIS A;  2EIM H;  4YFX F;  3GTL J;  2EBI A;  2DTZ A;  3WHC A;  2QKL B;  2CQX A;  1FY7 A;  3W2W A;  3E3V A;  1GV2 A;  1T38 A;  1OFC X;  4CXF A;  5JHU A;  1OKR A;  1J75 A;  1IUF A;  1HQC A;  2DJN A;  4A3F J;  3R61 A;  2ZC2 A;  1G59 A;  2MG4 A;  3LA7 A;  2OPT A;  5DUI A;  2VI6 A;  3CP2 A;  4I02 A;  1WJE A;  2V1X A;  2G7H A;  4I99 C;  4LD5 A;  2VIX A;  1MW7 A;  1JE8 A;  3AFH A;  5DYM A;  3JRB A;  2RVC A;  4XKV A;  1VI0 A;  2KL4 A;  4EAT A;  3GFI A;  2AQE A;  2QZ8 A;  1YQA A;  5CJ9 A;  1WJ5 A;  4D0P A;  5CYV A;  1FBS A;  1AU7 A;  2OZU A;  4UNO A;  1R00 A;  3OL4 A;  1EKE A;  3H0G J;  2H8W A;  2NXN B;  4H4K C;  1IRF A;  3U9G A;  2WY8 Q;  3BLY A;  4LGW A;  3RYR A;  4A3E J;  3S1N J;  3NAR A;  2LF7 A;  3S14 J;  1XB4 A;  1KYZ A;  3I59 B;  5M5W J;  3ROU A;  1HSJ A;  3G71 I;  1SD7 A;  3QOE A;  2GIZ A;  2IEK A;  5K5R A;  1Z91 A;  1JKP C;  2DPD A;  1IF1 A;  4PJN A;  2OCC H;  2BHY A;  2X6W A;  2BVM A;  2DU9 A;  1XX5 A;  2JA8 J;  4B3X A;  2GA1 A;  3RYP A;  4ZYD A;  1FYL A;  2ID3 A;  4A69 C;  4BUP A;  4A6E A;  1XGN A;  4PUS A;  2PQ8 A;  3JRI A;  2CFX A;  3KP5 A;  1U6G A;  4AC0 A;  5HLI A;  2CMP A;  1ONV A;  2Q2E A;  1IRG A;  2MC4 A;  1X2M A;  3BQZ A;  4KMF A;  3KPH A;  1U5T C;  3KX2 A;  4C3J J;  3W2A A;  5J4Y A;  2BW3 A;  4JBA A;  2BEO A;  3R4K A;  4HDU A;  1DUX C;  3DTK A;  4HNV A;  3T0Y A;  2UWM A;  2QQA A;  4LOC A;  3DLL F;  3HB9 A;  5DD4 A;  3JR9 A;  2R93 J;  2MYS A;  4A5M A;  1KQ9 A;  3GLX A;  3PSF A;  4IOA F;  5L3C A;  2MC3 A;  1SAU A;  3I59 A;  5EDN A;  3K4M A;  3A2K A;  4UB8 C;  3GTO J;  3M07 A;  1K78 B;  3W6V A;  5FLV A;  1E17 A;  1QNT A;  4WXH A;  3O3K A;  2HU9 A;  4HA8 A;  1X4O A;  5JVT A;  4E7S A;  3GTQ J;  1ETV A;  3DXJ F;  1Y39 A;  2VQC A;  4ZH4 F;  4F93 B;  1WWX A;  2XB5 A;  1YI2 I;  4AWX B;  3KE2 A;  4HOB A;  4J00 A;  2XGX A;  1T39 A;  5ILS A;  4G7H F;  3H0D A;  2H8R A;  1WRJ A;  3CCY A;  4C9Y A;  4PJL A;  1V3F A;  2OC6 A;  4E7J A;  3QWL A;  2E19 A;  3OIQ A;  1RES A;  5JI6 A;  1GVD A;  1GXP A;  2PJR A;  4XLN F;  3JCU C;  1XMK A;  4PJM A;  4XK4 A;  2QA4 I;  1DPU A;  2J5O A;  4XMY A;  2LC2 A;  2XKP A;  1D0X A;  2KJC A;  4BDY A;  3BCA A;  4RGR A;  3CCR I;  2XAH A;  4M3E A;  4Y13 A;  3HBL A;  3OYD A;  4AVP A;  1R71 A;  2F48 A;  1ZRD A;  2YU9 J;  2P4W A;  2IS2 A;  2PJR B;  3NWS A;  2F5D A;  2P81 A;  3GZ5 A;  4IF4 A;  3S3M A;  2R7O A;  2BZT A;  3PQK A;  2PX9 A;  2UUZ A;  4A3C J;  5KAF C;  3OYH A;  1QO0 D;  2F5C A;  2K9N A;  3V42 A;  4ABZ A;  4Z6Y A;  5IYC J;  2MFZ A;  4UXN A;  2NOG A;  4F52 A;  4ZYG A;  5F1J A;  4C2U A;  3LSH A;  4KJZ A;  4IRI A;  1UJ8 A;  3V7R A;  3GBG A;  1BBY A;  4JQF A;  5TIS C;  4Q4Z F;  4A6D A;  2DA6 A;  1IZ1 A;  3LFK A;  3BTL A;  1BA5 A;  1DPR A;  3HKZ N;  3ZCO A;  1YTY A;  2DT6 A;  1MSF C;  3KLN A;  2P6S A;  3S8P A;  2F5E A;  1G2H A;  5J4V A;  4NQW B;  4PFO A;  3CCM I;  3Q5F A;  1BIA A;  2DA5 A;  1QVU A;  5LLQ A;  2JQ7 A;  3K9T A;  3R0A A;  2M3A A;  3TO6 A;  2R7X A;  2LY9 A;  1ENH A;  5IP7 J;  3I71 A;  2KPM A;  2E2I J;  5GP9 A;  1U8B A;  4RA2 A;  1U9O A;  2R5Z B;  3ZQ7 A;  5J1U A;  1XTA A;  2IGO A;  5KVR A;  1Z6T A;  3FXO A;  3HC7 A;  1TZL A;  4XQF A;  3E97 A;  1GHC A;  2B63 J;  2K02 A;  2NVU B;  1QPM A;  4FET A;  3REO A;  1HW2 A;  4F91 B;  5KHD A;  2KQR A;  3MZY A;  5GAG J;  3LSG A;  3CCV I;  4M9X A;  3M1E A;  2XGC A;  4O3M A;  2RRE A;  2JN6 A;  2FBK A;  2K9L A;  3I56 I;  5IOZ A;  3CMM A;  1HA8 A;  4HYE A;  2Z16 A;  4BY7 J;  4KIT B;  4EJW A;  2ZJQ F;  3S2H J;  4O6J A;  2W7N A;  1FBQ A;  4QIW N;  5K7Z A;  2JPC A;  1IC8 A;  1ZRF A;  3I5U A;  4XKC A;  3BCB A;  1K83 J;  5M5X J;  1LDD A;  3ABT A;  4L5E A;  5K7F A;  4QTR A;  3ZPL A;  3JW4 A;  1ZTR A;  3BJO A;  3SYT A;  4F7Z A;  1ETW A;  1V5F A;  4E7H A;  3V7S A;  2MLG A;  5HDG A;  1YS7 A;  1E0E A;  1H88 C;  4X6A J;  3L2V A;  2CSO A;  5AIP A;  1H8A C;  2KHM A;  2Y31 A;  3CUQ C;  3OYI A;  5FO5 A;  2WV0 A;  2PMU A;  2O8X A;  2CW0 F;  4TV7 A;  3HYI A;  1PUF B;  3CJT B;  3LOC A;  2ACJ A;  3BOQ A;  1K79 A;  3OR1 C;  1QBJ A;  3CF2 A;  3E5X A;  3IRR A;  2LOO A;  1OYW A;  2VKD A;  5D4S A;  4EM0 B;  1R23 A;  4BDZ A;  1VZ0 A;  5JR3 A;  2DT5 A;  4R1H A;  1FOX A;  4I09 A;  4BXU A;  2QEN A;  1Y8Q B;  2NVQ J;  3TDZ C;  2EFW A;  1W0T A;  1V4R A;  1BN5 A;  4BQO A;  1U0J A;  1DP7 P;  1MMN A;  3LQR A;  2HYG D;  4BKX A;  1MMS A;  1P7I A;  1JGS A;  1KU9 A;  1KYW A;  2E1O A;  4ZTF A;  2RAE A;  3CUQ A;  4CCK A;  1Z3Y A;  1Y0U A;  5J8F A;  3OYK A;  4ETS A;  3EET A;  5CLS A;  2ZME A;  1FOW A;  5HLG A;  1ZAO A;  5K1Y A;  3S32 A;  3GFM A;  1FZP B;  5HNF A;  2L01 A;  3HDD A;  2V9V A;  2BBY A;  3RPU D;  1PP7 U;  3HSF A;  1FPQ A;  3BR6 A;  3ZQF A;  2HQ5 A;  3CF5 F;  1VQ6 I;  3K10 A;  1JT6 A;  4YEL A;  3FXK A;  5EG0 B;  1G3T A;  1D0Z A;  3K70 D;  3QP5 A;  4PGG A;  5HS9 A;  1S8N A;  3RPU A;  1MMD A;  1YW7 A;  4F55 A;  1YOV B;  3EQL F;  4LLN A;  2E2J J;  2W82 A;  3KZZ A;  3G2B A;  2IBD A;  3U2R A;  1IXS B;  4A3B J;  3MWM A;  1T95 A;  2UV1 A;  3FKJ A;  2CYY A;  2W25 A;  4BBS J;  4DZP A;  3IUO A;  2FQ4 A;  3V8K A;  5L3E A;  2P7C B;  2Y9Z A;  3PIO F;  1VQK I;  2PJP A;  3VEP A;  3KEY A;  1MBF A;  4RB2 C;  3E6C C;  3HOX J;  3OYE A;  4Q5S F;  4HX7 A;  2BE5 F;  4A2U A;  3BG5 A;  1ULY A;  2JVG A;  5F08 A;  4UV8 A;  1FNN A;  4CYD A;  2IP2 A;  1U5T A;  4M6Y A;  3J7Y J;  3RSN A;  2JRM A;  2RN7 A;  1N78 A;  2IT0 A;  3M7G A;  5DDG A;  1LFP A;  3FHN A;  4A3D J;  1ETQ A;  1X58 A;  2JA2 A;  1NTC A;  2DQL A;  2JUG A;  4LG0 B;  1RI7 A;  1EH7 A;  3B02 A;  3F21 A;  3BR0 A;  2R5Z A;  1MNM C;  5EEA A;  4MTD A;  5HVQ C;  5IYB J;  4WF2 A;  2ZJR F;  1S7E A;  2IGM A;  5KK1 A;  2LYC A;  1GLN A;  4B1R A;  5GAD J;  4YG2 F;  3OY9 A;  2EA2 A;  2GA2 A;  2K3F A;  3DPT A;  2X51 A;  3LNQ A;  5ICE A;  2ZBK A;  5IYD J;  1T8I A;  3O2P E;  4AU7 A;  3WTS C;  2NVX J;  3JTG A;  2WAE A;  4ENJ A;  3G1L A;  3IKT A;  4M73 A;  3V4G A;  3PNV A;  4NQW A;  3FHZ A;  4PGH A;  3BZK A;  3QU6 A;  1J0R A;  2OD5 A;  3GYH X;  3S2D J;  4LB6 B;  1SEU A;  1D5Y A;  2QQ8 A;  1FTT A;  2HZT A;  2P5K A;  3TDU C;  2Z33 A;  2Q2E B;  2NS0 A;  4W1U A;  1S7A A;  1XPX A;  2ESH A;  4BHP A;  5LGU A;  1N75 A;  2DOF A;  4ZJZ A;  4RGX A;  3IKV A;  1YJW I;  1EA3 A;  4LIT A;  2FBI A;  1STZ A;  4QSH A;  5LRS A;  3ESW B;  1EH6 A;  1OCR H;  5LFA A;  1C0W A;  4H0E A;  2A6H F;  3ULQ B;  2EJR A;  4EV0 A;  1JJ6 C;  2HDD A;  3KYC B;  1QZY A;  2A07 F;  1I6H J;  4PDK A;  3QOD A;  4U0V A;  1UB9 A;  3PIP F;  1VQN I;  1S5L C;  4B48 A;  3I3L A;  2A6E F;  4DBR A;  1ZRC A;  1WZ2 A;  2QBY B;  3SJM A;  3BY6 A;  3CMY A;  3H3V K;  1SC7 A;  4HX8 A;  2DN0 A;  5B5E C;  2A69 F;  2JZY A;  3ZN0 A;  1FT9 A;  2X85 A;  3GXO A;  3G73 A;  2VL8 A;  2QUF A;  4BGD A;  3GVA A;  3WE3 A;  2KFD A;  3LMM A;  1ZG1 A;  3TQN A;  2LY2 A;  1LNW A;  4IQ4 A;  1NK2 P;  2O3F A;  3MKL A;  4Q48 A;  1XG1 A;  3WGH A;  3QOP A;  2BXY A;  5C3E J;  2Y0M A;  1BOA A;  5E8I A;  1MIJ A;  2LTP A;  3SEZ A;  2KRH A;  3V8J A;  2VC0 A;  2RGV A;  1GV5 A;  3WTV C;  2R7V A;  3WG7 H;  2XPV A;  1W5S A;  2RV8 A;  3I64 A;  1AA7 A;  2NVY J;  2VPR A;  3VDX A;  4JP0 A;  1FIP A;  3ML6 A;  3LAJ A;  2ICW G;  4KN4 X;  4FIS A;  1IDY A;  1SVL A;  1B4A A;  3CCQ I;  2P5V A;  3OWT A;  2HPI A;  3ISP A;  5E1W A;  3C1D A;  3G4S I;  4NBQ A;  5ILV A;  4L0Z B;  3F6O A;  5LBQ A;  2E2H J;  1LFB A;  3D0S A;  4YFK F;  2KIQ A;  4A3M J;  5E3N A;  2ZXH A;  1FP1 D;  4DJA A;  2VQL A;  4II2 A;  3J80 Z;  1OJL A;  2GLO A;  1FYM A;  2L4M A;  1BI0 A;  1FYK A;  5DD8 A;  1Z67 A;  3MN2 A;  4BS9 A;  2QSG X;  1PP8 F;  1XMA A;  4WWC A;  4FX4 A;  3W6K B;  3KZI C;  4AYB A;  4YEJ A;  5IY5 H;  2DT7 B;  2L7M P;  2I8D A;  3PM1 A;  5ICF A;  2V9P A;  1JKO C;  5M5Y J;  4KFC A;  1FSH A;  1LE8 B;  2X1C A;  1ACI A;  1D3Y A;  3WTY C;  5F0C A;  2M9H A;  1TQM A;  2QWW A;  2A05 A;  3OSG A;  5LD2 C;  4DYQ A;  5D8L B;  3T8R A;  3RI4 A;  5KNL A;  3K1N A;  4AM3 A;  2DMP A;  4EJO A;  1T56 A;  2DMN A;  3KIO A;  3WTT C;  1QU3 A;  2Y69 H;  1G8X A;  1IXC A;  3U1K A;  4A3G J;  5D8K B;  3E5U A;  1Z7L A;  1OYI A;  2IS6 A;  4XOR A;  1XSD A;  3MEX A;  2Y0S A;  3PFI A;  1IN5 A;  1EJ9 A;  5HDN A;  1X1A A;  3RKX A;  2DW4 A;  5J1R A;  2K85 A;  1YW9 A;  3FIS A;  3CUO A;  1G3Y A;  2KJB A;  1B72 A;  3LSP A;  5FLX K;  5CVJ A;  1FEX A;  3BTI A;  2NNY A;  4CCL A;  2GXG A;  1SFK A;  3FXU A;  4NDL A;  3I55 I;  3ABM H;  5H2F C;  1TBX A;  5BMZ A;  1MBG A;  4KDP A;  4GXO A;  4F3Q A;  2OJE D;  1D8K A;  4B47 A;  1LJ9 A;  2JMW A;  2BW3 B;  4ENK A;  1BC8 C;  3IV5 A;  1KQ8 A;  4EVI A;  1Z77 A;  2H1L A;  3D5S C;  4CGZ A;  3HG9 A;  2ESN A;  1AKH A;  3P7N A;  4BHC A;  3OIO A;  4E7Z A;  2CQ7 A;  1MNE A;  4J19 A;  5HOD A;  3I54 A;  3Q9S A;  2QBY A;  5TJJ A;  3PO2 J;  2DJI A;  3S1Q J;  2WWY A;  1IW7 F;  1MBK A;  1FJL A;  1B6A A;  3BR2 A;  3RIR A;  2P7V B;  2Y48 A;  4JYK A;  2E1M C;  1YLF A;  2TCT A;  5D6F A;  2YU3 A;  2DA2 A;  3ERE D;  1TW2 A;  4BJT A;  2E1C A;  2R4G A;  4HEA 2;  1QZZ A;  1QA6 A;  2TRT A;  3S93 A;  3ABU A;  2WB1 N;  3IH2 A;  4LIV A;  1QHH D;  3BPV A;  4L9V A;  2W4S A;  3WTW C;  2YX4 A;  2HQR A;  4ZZL A;  3FXJ A;  2IS1 A;  3OSF A;  2EB7 A;  3NEU A;  2ZNY A;  3D1N I;  1T2K A;  1BI2 A;  1B9M A;  3CDH A;  2K5C A;  3HGG A;  3HOZ J;  2ZXI A;  4MEY F;  2F2E A;  4JK1 X;  2HDC A;  2XV4 S;  2VE9 A;  2RDP A;  3FMQ A;  2STT A;  1AKH B;  2B7E A;  5FB2 A;  2PMZ N;  1PVE A;  1DGR M;  4ZDP A;  4Y17 A;  3HRS A;  4XLE A;  4OMY A;  2L7Z A;  3EYY A;  4E7I A;  2DK5 A;  3FXL A;  2H1K A;  3H35 A;  4AYB N;  3NWT A;  2EIJ H;  3HOT A;  5IPA A;  2FML A;  4PSW A;  3FWE A;  2R0Q C;  1Z05 A;  2XUB A;  2Q8K A;  3H36 A;  1V5E A;  5CQE A;  4A0Y A;  5J8C A;  3CUQ B;  1ETY A;  2OCE A;  2QEX I;  1MDM A;  5CPR B;  4CO8 A;  3A01 B;  1QRY A;  3VOE A;  2CJJ A;  2NAZ A;  2EK5 A;  3OS2 A;  3FMS A;  2Y30 A;  2EFN A;  1ZG5 A;  5IP9 J;  1IGN A;  4BU2 A;  3E0J B;  2V4J C;  4ESB A;  3D5L A;  4OOI A;  4PJ0 C;  5L3D A;  5M3M J;  2BVL A;  2K40 A;  2YR2 A;  1ZN2 A;  3OYG A;  3JRE A;  1JJ8 C;  3IWF A;  1BOB A;  2HEO A;  3MQ0 A;  4FCY A;  2DDB A;  3K1P A;  3LL7 A;  1R58 A;  2MD0 A;  5JLX A;  1YJN I;  4BQN A;  2YX7 A;  2OV7 A;  2WAQ A;  3KET A;  1UST A;  1HW5 A;  2EIL H;  2CUJ A;  3HRU A;  5FKK A;  2O5R A;  1X2N A;  2HNH A;  2NS8 A;  3LSI A;  2RC4 A;  2JTV A;  1Z3X A;  2LRD A;  3BR5 A;  2EV6 A;  3OYA A;  1IUY A;  4OAZ A;  3L09 A;  5F64 A;  1HDP A;  2BOL A;  3ERM A;  4UHT A;  4LG0 A;  1DDN A;  1TL8 A;  2Y9Y A;  3J7Z I;  2F4I A;  4S0H B;  2XC7 A;  2KDZ A;  1PYV A;  2STW A;  1HST A;  3M8E A;  1XS9 A;  2CFO A;  2OBP A;  1ZGW A;  2LRE A;  2F6C A;  2GBY A;  4HV5 A;  5GPA A;  4MGR A;  3P9I A;  2O61 A;  2F5V A;  1CQT A;  3ZXS A;  3PNT A;  4LLG F;  3NAU A;  1WFX A;  3AKZ A;  3IHU A;  3KLO A;  1UCR A;  2HKO A;  2MBF A;  5JFR A;  3WU2 C;  4WX9 A;  4I01 A;  5DCF A;  2OTJ I;  1RKW A;  3F3X A;  4U7B A;  4IKF A;  5K7H A;  2KIM A;  2HI3 A;  3VFZ A;  1A6Q A;  4EQQ A;  2P8T A;  3KP6 A;  3RZD J;  2JA5 J;  3BG3 A;  3OL3 A;  3BG6 A;  4FE7 A;  3S3N A;  1I50 J;  2OQR A;  2ZFU A;  2B0L A;  4DBQ A;  4XLA A;  2X1D A;  2L9R A;  3X2Q H;  1MJ9 A;  1R9T J;  1LDK B;  3BG9 A;  4HNT A;  2ZFW A;  2O0Y A;  2W48 A;  1E3H A;  1R36 A;  2KIU A;  5F1R A;  2X6X A;  2L7K A;  3Q0W A;  2V1U A;  4CH7 A;  3K2Z A;  3QYF A;  3OMY A;  2FA5 A;  1TWF J;  3W2V A;  2ZME B;  5BQT A;  5E8G A;  1VTN C;  2CH0 A;  5AON A;  1JXS A;  3M8F A;  3U21 A;  3KEO A;  4A93 J;  1PJR A;  1G3W A;  4PK4 A;  1LVK A;  3N05 A;  3HEF A;  5H6R A;  4D9J A;  4EEF G;  3CES A;  4B3A A;  4C2M J;  3F8F A;  5HNH A;  2E71 A;  4FAS D;  3EUH C;  1UZC A;  3GWZ A;  4HAM A;  5C4X J;  2R7D A;  3GO5 A;  4HDV A;  1AOY A;  4GYG A;  3ZQC A;  4DQ2 A;  4QPO A;  2HTS A;  3ONQ A;  1NK3 P;  4M3D A;  5E3M A;  3DV8 A;  2E5N A;  2VQH A;  3HRM A;  3R6S A;  2FD5 A;  4JX6 A;  2WV1 A;  2M2E A;  5C4J J;  4KNY A;  2AHQ A;  3SHF A;  4I0B A;  1Q1H A;  5E20 A;  1X1P A;  1OCP A;  1KON A;  3F8C A;  3L7W A;  2JUC A;  4HST A;  2DDA A;  4ENM A;  1TWH J;  2GM4 A;  4CCM A;  3LA3 A;  3MZH A;  3K4C A;  2M5W A;  2L5Q A;  3OYC A;  2IS4 A;  2RNG A;  5FKN A;  5IP6 A;  1MSE C;  2DA3 A;  4KIC A;  2QQB A;  5C44 J;  3GTJ J;  1DU0 A;  1WJD A;  2Z3Y A;  1VFC A;  5DM6 F;  1J09 A;  4FTH A;  3A0B C;  2GXA A;  2COM A;  3EUH A;  2K27 A;  2EFO A;  4M3G A;  4IOC F;  3FXQ A;  5D4R A;  3HSR A;  2O9L A;  3L2W A;  3F8M A;  1T0F A;  1GT0 C;  1YHQ I;  1WHU A;  2JVH A;  2X9D A;  3V7C A;  4IHX A;  1I39 A;  3CLQ A;  2BY1 A;  1Y8R B;  3K70 C;  1EH8 A;  2ISY A;  2LD5 A;  1ZGJ A;  3GEZ A;  1S72 I;  5FD5 A;  1FP2 A;  3L9F A;  2QF7 A;  3JAM K;  1WCM J;  2XAQ A;  3PNY A;  2Z9O A;  2LMD A;  2R7S A;  3OYF A;  1F43 A;  3UKG A;  1P4A A;  3JRF A;  4XKB A;  2H6C A;  1D0Y A;  3S1R J;  2EA4 A;  2LKP A;  3BP8 A;  2VOD A;  4LK1 F;  2A5Y B;  1IG7 A;  4I76 A;  2QYO A;  4HRI A;  1B1B A;  4BXX J;  2VPL A;  1HDD C;  3RJP A;  2JA6 J;  2RQP A;  2AQF A;  1PUF A;  1D5V A;  1WJC A;  1ZHF A;  1W5T A;  2XPU A;  2XVC A;  3M3Y J;  4BAC A;  2LH9 A;  2OTL I;  2K9M A;  5LEK A;  3C7J A;  2V1D A;  3W6J B;  3RTR A;  4OIP F;  1HW1 A;  1R1T A;  2UXN A;  4D5C A;  4UVB A;  2Y2Z A;  2D5V A;  3I0T A;  1YS6 A;  4RM2 A;  3CO6 C;  3RPQ A;  4ZYE A;  4E4H A;  1V5G A;  5J6X A;  5JLW A;  4OAY A;  1OCO H;  4M71 A;  3WU0 A;  1ITY A;  1WI3 A;  3GFJ A;  1UHW A;  3WGG A;  4IHY A;  5GTH C;  3QP6 A;  1N77 A;  1FX7 A;  1BJZ A;  3QYB A;  1QGP A;  1JUP A;  1RUN A;  2QKM B;  4MNU A;  1BI3 A;  1K6O A;  2ZSI B;  4RB0 A;  1VQ9 I;  5HS8 A;  2P0W A;  1MBE A;  1RUO A;  1BC7 C;  2K7L A;  5EEH A;  3E5Q A;  1RPW A;  4BJ6 C;  3ABK H;  2FNA A;  2CUE A;  2IAI A;  2X6O A;  1L3L A;  5DCM B;  4L0Y B;  1BM9 A;  2HKX A;  3LSK A;  1BW5 A;  3H1C A;  2L9V A;  3ZQH A;  3F8N A;  4AIK A;  4A12 A;  4L9J A;  4M3B A;  3JAM Z;  1YIJ I;  1ODD A;  1WGX A;  1ZKG A;  3PSI A;  3DEU A;  2XAS A;  2V26 A;  2VAS A;  4CZZ A;  3WTZ A;  2ZSH B;  1GDT A;  3T1B A;  3OYM A;  2IPQ X;  2KKO A;  3IP4 B;  2QCO A;  2WTE A;  1BL0 A;  5GAH J;  2HQA A;  3IAS 2;  3KFW X;  1KZH A;  5D5X B;  4DGW B;  1WI9 A;  1H89 C;  1KU7 A;  4XLH A;  4HPQ A;  3OYN A;  2XAJ A;  4HX4 A;  3K2A A;  1RR7 A;  4I2O A;  4BHB A;  2FOK A;  1ETX A;  2PMH A;  3FF5 A;  2ME6 A;  4LLL A;  2KRC A;  1XSX A;  2VBY A;  4IEJ A;  4OIO F;  1FOY A;  1FWZ A;  2LFB A;  2ZCW A;  2EFQ A;  4KT5 C;  4C3I J;  3AL0 C;  1DGW Y;  3H3Z A;  2MA3 A;  2QSH X;  4LFU A;  3OOP A;  1YRN B;  2E7X A;  4BEH B;  1K78 A;  5L3G A;  1ZEL A;  3H92 A;  1WJF A;  2QQ9 A;  3K0L A;  3MKZ A;  4EJT A;  1JHF A;  3ECO A;  3GW2 A;  3HKZ A;  1P7J A;  3QRF F;  2OF7 A;  4XSX F;  3VYR B;  1ZH5 A;  3FIW A;  3MVP A;  3HPH A;  2H94 A;  3NQO A;  2PEX A;  2K9S A;  3HHG A;  2EZK A;  3G6E I;  3E6B A;  2R7U A;  1BJA A;  1WKM A;  1W7P D;  2VKV A;  4IPA A;  5D5V B;  4KIG A;  1X19 A;  1H0M A;  2R7F A;  4M9S A;  2PMZ A;  3P9K A;  4HNU A;  3FMR A;  2DOA A;  2YSR A;  2IGN A;  3CLO A;  1Y1W J;  4QPQ A;  3PL8 A;  4XNF A;  4RAZ A;  4HBL A;  4V19 K;  1G4D A;  3GTM J;  2AS5 F;  3L2R A;  2JPB A;  2XSD C;  3MAJ A;  1NG6 A;  4OMZ A;  4MEX F;  5HLH A;  3GZN B;  3BG7 A;  1L0O C;  4ESJ A;  2BY2 A;  1S7O A;  2DYR H;  4WK8 F;  5CVR A;  2B9S A;  1POG A;  3HUG A;  3H9Q A;  4RBO A;  4PFP A;  3UR3 C;  2NYX A;  3KP4 A;  3DEW A;  1MD0 A;  3C2H A;  1XD7 A;  3P9C A;  2QVO A;  4FT8 A;  1VQ7 I;  1YX3 A;  2CW8 A;  3WGI A;  2GOM A;  1EV7 A;  4RAF A;  1U78 A;  4XID A;  1I1G A;  4ANJ A;  3BWG A;  3F9K A;  3A01 A;  4D7M A;  1NG7 A;  2W84 A;  4KIS A;  4W97 A;  2HYJ A;  3LSM A;  2DQR A;  1I5Z A;  2V6C A;  3PUB A;  2AXL A;  2W85 A;  4ZC3 A;  2V79 A;  3EPZ A;  4P96 A;  1D1A A;  2PFB A;  4EM2 A;  1K7A A;  5FRO A;  5GTI C;  4KN7 X;  2FEZ A;  2EH3 A;  3K1M A;  2M1B A;  3WE2 A;  2FNP A;  2KMU A;  2HQN A;  3L00 A;  1QQI A;  4G6D A;  3R60 A;  2W24 A;  3M8J A;  5IOY A;  3S1M J;  2VBW A;  2M0C A;  1IJW C;  4GCV A;  1MBJ A;  2VOO A;  2D2W A;  4KIB A;  3LFU A;  3HGY A;  1Y0N A;  3F8B A;  1BR1 A;  3I58 A;  4M3F A;  1J2X A;  5EG0 A;  4RB1 A;  5F04 A;  1RET A;  2VJ4 A;  1A36 A;  4M6X A;  4ZDL A;  2CO5 A;  1ZR4 A;  3OOU A;  2DI3 A;  4V2G A;  3CCL I;  1O4X A;  3FK6 A;  1GUU A;  4OIN F;  1SD6 A;  2NRA C;  2Z2S B;  4P5O A;  5E18 F;  3OS0 A;  3E7L A;  4BQQ A;  2UZK A;  4G9Y A;  2WC2 A;  4IJA A;  4ZDO A;  2M45 A;  2JRT A;  2ZNZ A;  3VWB A;  2AXT C;  4BJ5 C;  5EGO B;  4I98 B;  2WAQ N;  2ZJP F;  2LDU A;  2K3P A;  1TTY A;  3BJA A;  3BDD A;  5D6E A;  1R5I D;  1T33 A;  4PZJ A;  4XRS G;  1IN7 A;  4FHT A;  3SDG A;  4B8X A;  4G6Q A;  3HL2 A;  3TO9 A;  2VJJ A;  2HTJ A;  1Y56 A;  2O03 A;  3MFK A;  3WU1 B;  1RC9 A;  4A5N A;  4M74 A;  2HOS A;  3HZJ A;  2WY7 Q;  2OU2 A;  1CGP A;  3HUG B;  4IHV A;  4S04 A;  3I9V 2;  4RMN A;  2VKH A;  3DCF A;  2XF7 A;  5CVI A;  4XLP F;  4HV6 A;  2JT1 A;  2BXZ A;  2KZV A;  4BAY A;  2DMQ A;  5M3F J;  4N4N B;  2M0M A;  3ECH A;  3ZOB A;  2DBB A;  5IT3 A;  4EGY A;  1YIO A;  1R4M B;  1ETO A;  1BR2 A;  1FLI A;  4IXA A;  1LPQ A;  3F22 A;  5DS9 A;  5HLT A;  5FJ8 J;  3JRC A;  1R49 A;  2JJ7 A;  4RGU A;  2R7R A;  3AG3 H;  2EZH A;  2MSY A;  1W7P B;  2DYS H;  4MQ9 F;  2YUS A;  2Z5U A;  2HR3 A;  5EZG A;  2GQQ A;  5DCM A;  3QPH A;  4DNC A;  3FK7 A;  2ELK A;  2KT0 A;  3DFG A;  4PCQ A;  1SAX A;  4HQM A;  2LG4 A;  2BY3 A;  3BR3 A;  1X3U A;  3CJN A;  4BE1 A;  5B66 C;  2HDW A;  3QU3 A;  1TP4 A;  1TNS A;  3ZMU A;  3JRD A;  4RLQ A;  4C2T A;  4O5V A;  3DU6 A;  2FU4 A;  4Y15 A;  3LA2 A;  1ZYR F;  4G7Z F;  2XHK A;  2QGU A;  3ZQG A;  3C2G A;  2HGC A;  3RCO A;  1VQL I;  4HLY A;  3DF8 A;  1HC8 A;  1D1B A;  1UHS A;  2EQR A;  1SD4 A;  3H5R A;  3FM3 A;  3ZR8 X;  1I1S A;  4ENN A;  4U0W A;  3DU5 A;  2M7A A;  1ETK A;  1SFX A;  3FZV A;  1W36 D;  4R79 A;  5GPC A;  1J7K A;  2M87 A;  2PN6 A;  3BC8 A;  1HKT A;  3DPL C;  4CIC A;  2ME0 A;  2ZXW H;  3U1D A;  2YPR A;  2P6T A;  1TLH B;  3DBH B;  3ZRG A;  2OQG A;  4S05 A;  3TMO A;  4RM3 A;  5E17 F;  3DQV C;  3HOS A;  4Y3O A;  1MND A;  1O7L A;  4NHJ A;  3V8L A;  3H5N A;  2XAU A;  4XOP A;  3CC7 I;  2MH9 A;  4KMU X;  3S2W A;  4C3H J;  3OIP A;  1VQP I;  9ANT A;  4BNC A;  2EIK H;  4L18 B;  5J40 A;  1K61 A;  4AIJ A;  1CF7 A;  2R7Z J;  2C6Y A;  1F36 A;  2KIF A;  2V1N A;  4CSW A;  1MJA A;  5FKO A;  3MMY B;  3TOB A;  4ZYA A;  1U9N A;  2LKS A;  2E36 A;  3HJE A;  2JSP A;  1P4X A;  3OV8 A;  3KYD B;  3L1P A;  4DYR A;  4XLF A;  3T8T A;  2A5W A;  4E7K A;  1I27 A;  1UMQ A;  3H3U A;  1U8R A;  2CQQ A;  3MKY B;  3SZT A;  2MH2 A;  3DBL B;  1SMY F;  4YIR X;  5H6Q A;  2E60 A;  4QWQ A;  1A5J A;  2FF4 A;  4XR6 A;  1VQO I;  2FXA A;  2EIN H;  2EV0 A;  2IW5 A;  3BR1 A;  1RKT A;  3ZQQ A;  3J7A O;  1MZB A;  5ERI A;  2BGC A;  4G12 A;  1FMW A;  2RKH A;  3O6B B;  1Z6R A;  4CCO A;  3RKW A;  1F9N A;  1IXR C;  2QLZ A;  2D45 A;  2O8K A;  4EMS A;  3QPS A;  5CVV A;  4CCJ A;  2XKO A;  1HF0 A;  1MJB A;  4IO9 F;  1UG0 A;  3TO7 A;  1P9Q C;  2H09 A;  1S6L A;  3A02 A;  3S16 J;  5FKM A;  2LY1 A;  1S9H A;  2E1N A;  1TW3 A;  5KAI C;  2DA7 A;  3S15 J;  2HVQ A;  1Z9C A;  3TL4 X;  1O3R A;  1IRZ A;  3KCC A;  4MQV A;  3K6G A;  4XLC A;  2DFE A;  2HXI A;  3J81 K;  1AWC A;  3I4P A;  3GTG J;  4DOZ A;  3PO3 J;  1ON2 A;  3MKW B;  4XRM A;  1J59 A;  4I6Z A;  4XN3 A;  4MO7 A;  4UY8 I;  1ORK A;  2L02 A;  1BW6 A;  3HRT A;  2M8G X;  1XSV A;  2FQ3 A;  3GZ6 A;  2G7U A;  2JWT A;  3HTU A;  4IRG A;  3SFZ A;  2GWR A;  2NOJ B;  1JTX A;  4AUX A;  2PG4 A;  4EM1 A;  1NH3 A;  1SAN A;  3TW6 A;  2J5P A;  2LBF B;  1YE9 A;  4IX7 A;  2DFI A;  2CGP A;  2OA4 A;  1FSE A;  3I4N J;  2DOD A;  2LKX A;  5F6F A;  1X3W B;  1TWA J;  3CZ6 A;  4DZJ A;  4CYC B;  2CUF A;  1LEB A;  2QM3 A;  4I7H A;  5FFZ A;  1IRX A;  3ZMD A;  3A0H C;  3FX3 A;  4B43 A;  2CS3 A;  3IH3 A;  1S29 A;  3LQQ A;  3QAH A;  1RRJ A;  1WJB A;  1OCZ H;  5J1Y A;  2LNB A;  3LAP A;  1RZ4 A;  6PAX A;  1YYV A;  3J7A Y;  1OQY A;  3RZO J;  3WHB A;  2VE8 A;  3B6A A;  2L0K A;  4L9N A;  1BI1 A;  3A1Y A;  3SDB A;  3M1C A;  2W00 A;  4P9F A;  4UVC A;  2CG4 A;  2R3S A;  2KP6 A;  3J81 Z;  1SFO J;  1DU6 A;  2AO9 A;  5LGT A;  2VKE A;  2L9S A;  3IWZ A;  1IN6 A;  2E7W A;  2VLA A;  1YJ9 I;  1O3Q A;  3FDY A;  4A3J J;  4L9T A;  1X4P A;  2M4G A;  5FKL A;  5EEG A;  5F0F A;  2VON A;  3H9J A;  3CTA A;  3AG2 H;  5LHI A;  1A6I A;  4AVZ A;  2GIV A;  3HSE A;  1WH5 A;  2MLK A;  2XGE A;  4RB3 C;  3CCS I;  1WJA A;  2KDO A;  3GFL A;  4XN0 A;  3S17 J;  2CW7 A;  2HPM A;  3EYI A;  4M6V A;  1UAA A;  5DV5 A;  2FOW A;  3PQJ A;  5HOO A;  3AG4 H;  4WXC A;  3K4N A;  4AD9 A;  1T0F C;  1W4M A;  3C18 A;  1DQU A;  2CQN A;  2OZ6 A;  2I5U A;  1JI8 A;  3GX4 X;  2XGD A;  3AG1 H;  4LIU A;  1A35 A;  2F4M B;  1EF4 A;  5H20 A;  1B59 A;  1JUM A;  4HF2 A;  4G7O F;  3LWF A;  2D1H A;  2VQG A;  1N25 A;  3DBR B;  3CP8 A;  2F4O B;  2WAF A;  2NNN A;  4GO1 A;  4NC8 A;  4D7N A;  2EZI A;  4XON A;  3ABL H;  1GVJ A;  4A0Z A;  5FGM A;  3RQI A;  1W1W E;  4UV9 A;  3PJR A;  4R8H A;  5E3O A;  1TQI A;  4OWR B;  1XCV A;  2WAD A;  3C2B A;  4IL6 C;  3IAM 2;  4X1E A;  2XRN A;  1WPK A;  5F27 A;  2VC1 A;  2K4B A;  3H9G A;  5A2Q Z;  3HOW J;  3VYS B;  1ZGA A;  3CC2 I;  1SFE A;  2ADU A;  2R5Y B;  4ESF A;  3ZMV A;  3UNG C;  1Z21 A;  1OR7 A;  2CV1 A;  4BEH A;  2VUM J;  1W0U A;  3DKY A;  4BE2 A;  2CQK A;  2L4A A;  3FBI B;  3KZY A;  4P1W A;  3ZQI A;  2IGK A;  2LR8 A;  3G1O A;  2E34 A;  2X0L A;  3E1S A;  4A3K J;  3A03 A;  1XCB A;  1TWC J;  3VSK A;  2I10 A;  4KIF A;  3VSL A;  3L2C A;  4I0A A;  1ERD A;  2DPU A;  1LUJ B;  2YS9 A;  4N4O B;  1YG2 A;  2DFH A;  3O8H A;  3H5A A;  1H9T A;  3F23 A;  2ZO4 A;  5A2Q K;  1Q1V A;  4X0G A;  4IQJ A;  2E5Z A;  4FQG A;  1MMA A;  3ASO H;  2LBF A;  2ZB9 A;  3BRO A;  1CF7 B;  3WG9 A;  3I53 A;  1APL C;  3K4B A;  1QPI A;  2Z1D A;  3IC7 A;  2E35 A;  4BY1 J;  2VXD A;  2H6B A;  4J01 A;  4YII A;  2WB1 A;  1KGS A;  5HS7 A;  3QPT A;  4B09 A;  3N97 A;  4V2F A;  1RR8 C;  4HF1 A;  3RKQ A;  2ELJ A;  2KRF A;  5ICG A;  3M9A A;  3ZMS A;  4NNJ A;  2COB A;  2NS7 A;  1S3J A;  2IA2 A;  3BTC A;  4MHG A;  4KUM A;  5EF6 A;  3ZGK A;  2VBZ A;  1IO2 A;  3BQY A;  2ID6 A;  1ZR2 A;  1MBH A;  3HTS B;  2MD5 A;  5GAE J;  2VN2 A;  1XMX A;  2LVS A;  4B44 A;  4XRF A;  2A68 F;  2VOP A;  2V7F A;  3CCU I;  5FLM J;  2DMT A;  4BL0 B;  3KEQ A;  2HVR A;  3TOA A;  1TQP A;  3K4J A;  2DCE A;  5JVG F;  4L5I A;  1D8J A;  4QLC U;  2R7Q A;  2A61 A;  2ETH A;  4NC6 A;  3ZN1 A;  4YRV A;  1HXD A;  3QPL A;  2DXI A;  3KP3 A;  4RGS A;  3O8G A;  2L9N A;  3Q0U A;  2ISZ A;  4LK0 F;  3VB2 A;  2R7T A;  1X1C A;  2LK2 A;  2XF6 A;  2HXO A;  2Z99 A;  3CME I;  2MAB A;  4P9U A;  2M7B A;  1B8I B;  1V55 H;  1P6R A;  3DTI A;  4UVA A;  4IVN A;  1MH3 A;  2DA4 A;  3EUK L;  4NUB A;  4D1Q A;  3CDL A;  4FX0 A;  4MTE A;  3JRG A;  4JX4 A;  2L7F P;  4JX5 A;  4RS8 A;  1OCC H;  3HOY J;  3DP7 A;  1WH7 A;  3ASN H;  2L3D A;  3FXR A;  2HWV A;  2LP0 A;  1W36 C;  2CV2 A;  2XDV A;  2ZME C;  3F6V A;  1E2X A;  2XAG A;  1I6X A;  3RDI A;  3BZC A;  3CD6 I;  4HSR A;  1JTY A;  3A4C A;  3GLL A;  3CDI A;  3T5X A;  4EJU A;  4UUS A;  2BY0 A;  3L2Q A;  4E7L A;  3EUA A;  3BJ6 A;  1HBX G;  2V6E A;  4NC7 A;  3BTJ A;  1ZG3 A;  4GRI A;  2CWE A;  1QVT A;  1SVO A;  2DAO A;  3MCZ A;  2X6Y A;  3HXL A;  1R22 A;  4WXD A;  4WCG A;  4NB5 A;  3TW7 A;  3QQA A;  1R5H A;  3L2U A;  2FE3 A;  2Y0S N;  2IJL A;  1MKM A;  2G9W A;  3BZ6 A;  2E1M B;  1T6S A;  4GYI A;  4RLF A;  1Z7U A;  2CV0 A;  2FRH A;  4CDG A;  1HLV A;  2GXB A;  3WOD F;  2GOX B;  3KP2 A;  5BOX A;  3LSR A;  3K69 A;  2EV5 A;  3HIF A;  2PBI A;  1G6N A;  5DM7 F;  4CA0 A;  2VJ5 A;  2ZKZ A;  2X4H A;  3B73 A;  3JSO A;  1JKQ C;  4A0X A;  1M1E B;  2BHZ A;  5JHF A;  4FE4 A;  1ON1 A;  4BH9 A;  3SEQ A;  3OS1 A;  5EJC A;  3SXY A;  2BV6 A;  4U7D A;  4A3L J;  2HOT A;  1F5T A;  1YW8 A;  4II3 A;  5D5U B;  2WA0 A;  2CUZ A;  1QZE A;  1H9G A;  1YRN A;  1NHA A;  1I3A A;  1TWG J;  1V54 H;  2CRG A;  4BBR J;  3PFY A;  1R5G A;  1HKQ A;  5DEQ A;  4IHW A;  2A3S A;  5DUK A;  1BR4 A;  1VQ5 I;  5ILU A;  2LLK A;  1XC5 A;  4IRH A;  2HFH A;  1KU2 A;  2OUM A;  5IT9 K;  5CVU A;  5K5O A;  3GTP J;  5BS6 A;  3OR2 C;  3SQN A;  4LB5 A;  1Z0X A;  4MFE A;  4HLX A;  3CCJ I;  1MMG A;  3E6M A;  4DW6 A;  3WTX C;  1IAW A;  4ASN A;  5AIQ A;  5LRR A;  4XRS A;  3P5J A;  1R1U A;  2GZW A;  3VYT B;  2XSJ C;  2EPF A;  3CQZ J;  4YIF A;  3JRH A;  1RIO H;  3JTH A;  4GDF A;  3MD2 A;  4K2E A;  3DKX A;  1UHM A;  1IN4 A;  1VND A;  1X3Z B;  3ZMZ A;  5ED4 A;  5EZH A;  4E6K G;  4ZYH A;  2TDX A;  5HDK A;  3TED A;  3HM5 A;  3OYJ A;  1XDU A;  5L3B A;  4G8X A;  1KU3 A;  3DKW A;  3CO7 C;  1XDS A;  1OPC A;  2D1V A;  4RAY A;  1YO5 C;  3TP3 A;  3TGN A;  3Q3S A;  4YFN F;  4PSX A;  4HG2 A;  3FM5 A;  3AAF A;  4C30 A;  1WSU A;  1ZRE A;  1BIB A;  2R92 J;  1R4N B;  2ECC A;  4XM3 A;  1U3E M;  2IVM A;  2FMY A;  1LDJ A;  4D5F A;  3DTE A;  1K4T A;  1GXQ A;  2VJI A;  4RDU A;  1A04 A;  2VT3 A;  2PI0 A;  1KA8 A;  4MFD A;  4UUT A;  1B9N A;  1XN7 A;  2HOA A;  4ZZD A;  2ECB A;  1R6R A;  2IA0 A;  4ZTJ A;  1XGO A;  2KZG A;  3F0C A;  4RAG A;  2Y75 A;  3GF2 A;  1WQ2 A;  2KLO A;  1A31 A;  2X1E A;  1DP3 A;  4HW0 A;  3DWL E;  1E3P A;  3OYL A;  2M8E A;  4N9H A;  4CYC A;  1Y1V J;  1HOM A;  3ZMT A;  4LMY A;  3JSP A;  2N8G A;  1ZQ3 P;  2K9Q A;  1J9I A;  1O3S A;  1LB2 A;  4Y52 J;  2PLY A;  2HZD A;  5L3F A;  4OIQ F;  1XGS A;  3PUF A;  3W3C A;  1OIS A;  1YFH A;  3K4K A;  1G3S A;  2JSC A;  5FRN A;  2DA1 A;  5EYR A;  3EDP A;  3K7A J;  2MW8 A;  2IRF G;  5B1B H;  1LQ1 A;  4F92 B;  3HOV J;  4U0Y A;  1LVA A;  3DEE A;  3RQ4 A;  1JKR C;  1LE8 A;  5J47 A;  2GAU A;  1Z1D A;  1R1V A;  3GME A;  3AL0 B;  4HF0 A;  2EZL A;  5TGT A;  5E79 C;  1HCR A;  4XKW A;  1KQ0 A;  4HZF A;  5FD6 A;  3IRQ A;  1P4W A;  4A3I J;  4IZZ A;  2RNJ A;  1XGM A;  2R7W A;  3LSJ A;  1OR7 C;  2K86 A;  1HKS A;  2XIG A;  2VB6 A;  4BYY A;  1IV8 A;  1T08 B;  1K6Y A;  4DIQ A;  2XB0 X;  1PUE E;  4UUV A;  1LEA A;  1ZAR A;  1YX5 A;  3B6C A;  4Y4R A;  3HHH A;  1IDZ A;  3FKI J;  1O3T A;  5ICC A;  4U88 A;  1VF9 A;  5K5Q A;  1PDN C;  5DTD A;  3MZ8 A;  4B4C A;  1JT0 A;  4UUS B;  3VYU B;  3ZP5 A;  3OYB A;  4GFB A;  2Q0O A;  2UXX A;  3DLA A;  4XOT A;  2P5L C;  2G0E A;  2H27 A;  1MGT A;  5F0H A;  2JK3 A;  1SFU A;  4Z2Y A;  3D5R C;  4LJZ F;  3TBI A;  1E3O C;  1OCT C;  5B3S H;  2FX0 A;  1REP C;  1FMV A;  1SVM A;  4MLO A;  2NVT J;  1J5Y A;  3SFI A;  1UG2 A; 
#chains in the Genus database with same CATH homology
 3F72 A;  1TNT A;  2HYF A;  4IHS A;  5E1Z B;  2HOE A;  2HS5 A;  1IN8 A;  5TRD A;  1P2F A;  3C3W A;  2W57 A;  2F5F A;  3J80 K;  2LF8 A;  2O6G E;  5D5W B;  1T98 A;  4M9Z A;  1SD5 A;  1W7P A;  2LSO A;  1R7J A;  1O7F A;  5E1X A;  2DTR A;  1UFM A;  2XRO A;  2BYV E;  2L54 A;  3N4M A;  4EJV A;  3GUD A;  1JHH A;  5LHG A;  2DO7 A;  5LHH A;  5FFX A;  1FC3 A;  2DK8 A;  3WTU C;  2XAF A;  2OAZ A;  4OIR F;  5LEJ A;  4E70 A;  2M30 A;  1FOK A;  2ZXJ A;  4Q47 A;  1MDM B;  4G94 A;  4N0B A;  5FLX Z;  1SMT A;  3IL2 A;  4KYW A;  3R0J A;  1O57 A;  2FBH A;  1ZLK A;  1F4K A;  2ZJ2 A;  4XSZ F;  2VBX A;  4EGZ A;  1ZLJ A;  4KA4 A;  2K4J A;  3G3Z A;  1F1Z A;  1USS A;  4ON0 A;  3TKY A;  2EFP A;  2EWN A;  2FSW A;  4M72 A;  4HQE A;  4OU0 A;  2DLL A;  3NRV A;  3ELK A;  3SZP A;  4AIH A;  3E6D A;  4IHT A;  1U5T B;  3LST A;  3Q9V A;  5IT9 Z;  4P55 A;  3KP7 A;  5LGN A;  4GGG A;  4XBF A;  1P92 A;  3BPX A;  1U2W A;  3VOD A;  1OMI A;  5BPI A;  2VXZ A;  1OYY A;  3COA C;  5BPD A;  2IA1 A;  4L5J A;  1RNL A;  1FBU A;  3RKY A;  2VT2 A;  4N9I A;  2ELH A;  4CHU A;  4BQA A;  4YFX F;  1FY7 A;  3E3V A;  1T38 A;  4CXF A;  5JHU A;  1OKR A;  1J75 A;  1HQC A;  3R61 A;  3LA7 A;  5DUI A;  4I02 A;  2V1X A;  2G7H A;  4LD5 A;  1JE8 A;  5DYM A;  2RVC A;  3GFI A;  2QZ8 A;  1YQA A;  5CJ9 A;  4D0P A;  5CYV A;  1FBS A;  4UNO A;  2OZU A;  1R00 A;  3Q5F A;  1IRF A;  3U9G A;  4LGW A;  3RYR A;  2LF7 A;  1XB4 A;  1KYZ A;  3I59 B;  3ROU A;  1HSJ A;  1SD7 A;  5K5R A;  1Z91 A;  2DPD A;  1IF1 A;  2DU9 A;  2GA1 A;  3RYP A;  4ZYD A;  1FYL A;  4A6E A;  1XGN A;  2PQ8 A;  2CFX A;  3KP5 A;  1U6G A;  5HLI A;  1ONV A;  2Q2E A;  1IRG A;  4KMF A;  1U5T C;  4JBA A;  2BEO A;  3R4K A;  4HDU A;  1DUX C;  3T0Y A;  2UWM A;  2QQA A;  5DD4 A;  4A5M A;  1KQ9 A;  3GLX A;  5L3C A;  2MC3 A;  3I59 A;  1K78 B;  1E17 A;  1QNT A;  4WXH A;  3O3K A;  4HA8 A;  5JVT A;  3DXJ F;  4ZH4 F;  1WWX A;  4AWX B;  3KE2 A;  4HOB A;  2XGX A;  1T39 A;  5ILS A;  4G7H F;  1WRJ A;  1V3F A;  1GXP A;  5JI6 A;  4XLN F;  1XMK A;  1DPU A;  2J5O A;  2XKP A;  2KJC A;  4RGR A;  2XAH A;  4Y13 A;  4AVP A;  1ZRD A;  2P4W A;  2F5D A;  4IF4 A;  3GZ5 A;  3PQK A;  1QO0 D;  2F5C A;  4UXN A;  4ZYG A;  4IRI A;  3V7R A;  1BBY A;  4JQF A;  4Q4Z F;  4A6D A;  1IZ1 A;  3LFK A;  1DPR A;  1YTY A;  3KLN A;  2P6S A;  2F5E A;  1BIA A;  5LLQ A;  3K9T A;  3R0A A;  3TO6 A;  3I71 A;  3ZQ7 A;  5KVR A;  1Z6T A;  1GHC A;  3E97 A;  2K02 A;  3REO A;  1QPM A;  1HW2 A;  3MZY A;  4M9X A;  3M1E A;  4O3M A;  2FBK A;  4HYE A;  4EJW A;  4O6J A;  1FBQ A;  2JPC A;  1ZRF A;  3I5U A;  1LDD A;  3ABT A;  3ZPL A;  3JW4 A;  3BJO A;  4F7Z A;  3V7S A;  2MLG A;  5HDG A;  1YS7 A;  2CSO A;  5AIP A;  3CUQ C;  5FO5 A;  2WV0 A;  2PMU A;  2O8X A;  2CW0 F;  4TV7 A;  3HYI A;  2ACJ A;  3BOQ A;  1K79 A;  1QBJ A;  3E5X A;  3IRR A;  1OYW A;  5D4S A;  4EM0 B;  1R23 A;  5JR3 A;  2DT5 A;  4R1H A;  4I09 A;  4BXU A;  2QEN A;  3TDZ C;  2EFW A;  1V4R A;  1BN5 A;  1DP7 P;  3LQR A;  2HYG D;  1JGS A;  1KU9 A;  1KYW A;  3CUQ A;  1Y0U A;  5J8F A;  4ETS A;  3EET A;  5CLS A;  2ZME A;  5HLG A;  1ZAO A;  5K1Y A;  3GFM A;  1FZP B;  2L01 A;  2V9V A;  2BBY A;  1PP7 U;  3HSF A;  1FPQ A;  1G3T A;  3QP5 A;  4PGG A;  5HS9 A;  1S8N A;  3RPU A;  1YW7 A;  3EQL F;  4LLN A;  3KZZ A;  3U2R A;  1IXS B;  3MWM A;  2CYY A;  2W25 A;  3V8K A;  5L3E A;  2P7C B;  2PJP A;  3VEP A;  4RB2 C;  3E6C C;  4Q5S F;  4HX7 A;  2BE5 F;  4A2U A;  1ULY A;  4UV8 A;  1FNN A;  4CYD A;  2IP2 A;  1U5T A;  4M6Y A;  2RN7 A;  2IT0 A;  3M7G A;  5DDG A;  2DQL A;  4LG0 B;  1RI7 A;  1EH7 A;  3B02 A;  3F21 A;  4MTD A;  5HVQ C;  4WF2 A;  5KK1 A;  4YG2 F;  2EA2 A;  2GA2 A;  3DPT A;  5ICE A;  2ZBK A;  3O2P E;  3WTS C;  3JTG A;  4ENJ A;  3IKT A;  4M73 A;  3V4G A;  4NQW A;  3FHZ A;  4PGH A;  3QU6 A;  1J0R A;  2OD5 A;  3GYH X;  4LB6 B;  2HZT A;  2P5K A;  3TDU C;  2Z33 A;  2NS0 A;  1S7A A;  2ESH A;  4BHP A;  5LGU A;  4RGX A;  3IKV A;  2FBI A;  1STZ A;  5LRS A;  1EH6 A;  1C0W A;  4H0E A;  2A6H F;  3ULQ B;  2EJR A;  4EV0 A;  2A07 F;  1QZY A;  4PDK A;  4U0V A;  1UB9 A;  2A6E F;  1ZRC A;  2QBY B;  3BY6 A;  4HX8 A;  2A69 F;  2JZY A;  3ZN0 A;  1FT9 A;  3G73 A;  3GXO A;  2QUF A;  1ZG1 A;  3GVA A;  3WE3 A;  3TQN A;  1LNW A;  2O3F A;  4Q48 A;  3WGH A;  3QOP A;  2Y0M A;  1BOA A;  5E8I A;  3V8J A;  2VC0 A;  2RGV A;  3WTV C;  1W5S A;  2RV8 A;  3I64 A;  3ML6 A;  3LAJ A;  4KN4 X;  1B4A A;  2P5V A;  5E1W A;  3ISP A;  3C1D A;  5ILV A;  4L0Z B;  3F6O A;  5LBQ A;  3D0S A;  4YFK F;  1FP1 D;  3J80 Z;  1FYM A;  2L4M A;  1BI0 A;  1FYK A;  5DD8 A;  1PP8 F;  1XMA A;  4WWC A;  4FX4 A;  3W6K B;  5ICF A;  4KFC A;  1FSH A;  1D3Y A;  3WTY C;  1TQM A;  2QWW A;  5D8L B;  3T8R A;  3RI4 A;  3K1N A;  4EJO A;  3WTT C;  1IXC A;  5D8K B;  3E5U A;  1OYI A;  1XSD A;  3MEX A;  3PFI A;  1IN5 A;  5HDN A;  3RKX A;  2DW4 A;  1YW9 A;  3CUO A;  1G3Y A;  2KJB A;  5FLX K;  5CVJ A;  2NNY A;  2GXG A;  3FXU A;  1TBX A;  5BMZ A;  4KDP A;  4GXO A;  1D8K A;  1LJ9 A;  4ENK A;  1BC8 C;  1KQ8 A;  4EVI A;  4CGZ A;  2ESN A;  3P7N A;  4BHC A;  3I54 A;  3Q9S A;  2QBY A;  5TJJ A;  2WWY A;  1IW7 F;  1B6A A;  3RIR A;  2P7V B;  2Y48 A;  1YLF A;  5D6F A;  2YU3 A;  3ERE D;  1TW2 A;  2E1C A;  1QZZ A;  3ABU A;  3BPV A;  4L9V A;  3WTW C;  2YX4 A;  2HQR A;  4ZZL A;  2EB7 A;  3NEU A;  2ZNY A;  1T2K A;  1BI2 A;  1B9M A;  3CDH A;  4MEY F;  2F2E A;  4JK1 X;  2HDC A;  2XV4 S;  2VE9 A;  2RDP A;  3FMQ A;  2STT A;  5FB2 A;  4Y17 A;  3HRS A;  4OMY A;  3EYY A;  2DK5 A;  3HOT A;  2FML A;  3FWE A;  1Z05 A;  2XUB A;  2Q8K A;  4A0Y A;  5J8C A;  3CUQ B;  1MDM A;  4CO8 A;  3VOE A;  2NAZ A;  2EK5 A;  3FMS A;  2EFN A;  1ZG5 A;  4ESB A;  3D5L A;  4OOI A;  5L3D A;  2YR2 A;  1ZN2 A;  3IWF A;  2HEO A;  3MQ0 A;  3K1P A;  1R58 A;  2YX7 A;  3KET A;  1UST A;  1HW5 A;  3HRU A;  2RC4 A;  2JTV A;  2EV6 A;  1IUY A;  3L09 A;  5F64 A;  4UHT A;  4LG0 A;  1DDN A;  2STW A;  1HST A;  3M8E A;  2OBP A;  4HV5 A;  4MGR A;  3P9I A;  2O61 A;  4LLG F;  3IHU A;  3KLO A;  1UCR A;  2HKO A;  2MBF A;  5JFR A;  4WX9 A;  4I01 A;  5DCF A;  3F3X A;  4U7B A;  2KIM A;  3VFZ A;  4EQQ A;  2P8T A;  3KP6 A;  2OQR A;  2B0L A;  1MJ9 A;  1LDK B;  2ZFW A;  2O0Y A;  1R36 A;  2KIU A;  5F1R A;  2V1U A;  3K2Z A;  2FA5 A;  2ZME B;  5BQT A;  5E8G A;  1VTN C;  5AON A;  1JXS A;  3M8F A;  3KEO A;  1G3W A;  5H6R A;  3F8F A;  3GWZ A;  4HAM A;  2R7D A;  3GO5 A;  4HDV A;  1AOY A;  4GYG A;  4DQ2 A;  2HTS A;  3DV8 A;  3HRM A;  3R6S A;  4KNY A;  3SHF A;  4I0B A;  1Q1H A;  5E20 A;  3F8C A;  3L7W A;  4ENM A;  3LA3 A;  3MZH A;  2M5W A;  4KIC A;  2QQB A;  2Z3Y A;  2COM A;  3EUH A;  2K27 A;  2EFO A;  3FXQ A;  5D4R A;  3HSR A;  3F8M A;  1T0F A;  3V7C A;  1EH8 A;  2ISY A;  1ZGJ A;  3GEZ A;  5FD5 A;  1FP2 A;  3L9F A;  2Z9O A;  3JAM K;  2XAQ A;  1P4A A;  2H6C A;  2EA4 A;  2LKP A;  3BP8 A;  2VOD A;  4LK1 F;  2A5Y B;  2QYO A;  1B1B A;  3RJP A;  2RQP A;  1D5V A;  1ZHF A;  1W5T A;  2XVC A;  5LEK A;  3C7J A;  2V1D A;  3W6J B;  3RTR A;  4OIP F;  1HW1 A;  1R1T A;  2UXN A;  4UVB A;  3I0T A;  1YS6 A;  3CO6 C;  3RPQ A;  4ZYE A;  5J6X A;  4M71 A;  3WU0 A;  3GFJ A;  1UHW A;  3WGG A;  3QP6 A;  1FX7 A;  1QGP A;  1RUN A;  4MNU A;  1BI3 A;  1K6O A;  4RB0 A;  5HS8 A;  1RUO A;  1BC7 C;  2K7L A;  5EEH A;  3E5Q A;  2FNA A;  1L3L A;  5DCM B;  4L0Y B;  1BM9 A;  2HKX A;  3F8N A;  4AIK A;  4A12 A;  4L9J A;  3JAM Z;  1ODD A;  3DEU A;  2XAS A;  4CZZ A;  3WTZ A;  3T1B A;  2IPQ X;  2KKO A;  2WTE A;  3KFW X;  5D5X B;  1WI9 A;  1KU7 A;  2XAJ A;  4HX4 A;  4I2O A;  4BHB A;  2FOK A;  2PMH A;  3FF5 A;  4LLL A;  1XSX A;  2VBY A;  4OIO F;  1FWZ A;  2ZCW A;  2EFQ A;  4KT5 C;  3H3Z A;  2MA3 A;  4LFU A;  3OOP A;  2E7X A;  1K78 A;  5L3G A;  3H92 A;  2QQ9 A;  3K0L A;  4EJT A;  1JHF A;  3ECO A;  3GW2 A;  3QRF F;  4XSX F;  1ZH5 A;  2H94 A;  3NQO A;  2PEX A;  3HHG A;  3E6B A;  1BJA A;  1WKM A;  1W7P D;  4IPA A;  5D5V B;  4KIG A;  1H0M A;  2R7F A;  4M9S A;  3P9K A;  2YSR A;  3FMR A;  3CLO A;  4RAZ A;  4HBL A;  1G4D A;  2AS5 F;  2JPB A;  3MAJ A;  4OMZ A;  4MEX F;  5HLH A;  1L0O C;  4ESJ A;  1S7O A;  4WK8 F;  5CVR A;  3HUG A;  2NYX A;  3KP4 A;  1MD0 A;  1XD7 A;  3P9C A;  2QVO A;  4FT8 A;  3WGI A;  1EV7 A;  1U78 A;  1I1G A;  3BWG A;  2W84 A;  2DQR A;  1I5Z A;  2V6C A;  2AXL A;  2W85 A;  2V79 A;  4P96 A;  2PFB A;  4EM2 A;  1K7A A;  4KN7 X;  2FEZ A;  3K1M A;  2M1B A;  3WE2 A;  2FNP A;  2HQN A;  3L00 A;  1QQI A;  4G6D A;  3R60 A;  2W24 A;  2VBW A;  4GCV A;  2VOO A;  2D2W A;  4KIB A;  3F8B A;  3I58 A;  1J2X A;  4RB1 A;  4M6X A;  2CO5 A;  2DI3 A;  4OIN F;  1SD6 A;  2NRA C;  5E18 F;  4P5O A;  2UZK A;  4G9Y A;  2WC2 A;  4IJA A;  2M45 A;  2JRT A;  2ZNZ A;  4I98 B;  2LDU A;  1TTY A;  3BJA A;  3BDD A;  4B8X A;  5D6E A;  4PZJ A;  1IN7 A;  4FHT A;  4G6Q A;  3TO9 A;  2HTJ A;  2O03 A;  3MFK A;  3WU1 B;  4A5N A;  4M74 A;  2OU2 A;  1CGP A;  4S04 A;  5CVI A;  4XLP F;  4HV6 A;  2JT1 A;  4BAY A;  3ECH A;  2DBB A;  5IT3 A;  4EGY A;  1YIO A;  1FLI A;  4IXA A;  3F22 A;  4RGU A;  1W7P B;  4MQ9 F;  2Z5U A;  2HR3 A;  2GQQ A;  5DCM A;  3QPH A;  4DNC A;  3DFG A;  4PCQ A;  1SAX A;  4HQM A;  1X3U A;  3CJN A;  3QU3 A;  3ZMU A;  1TNS A;  4O5V A;  2FU4 A;  4Y15 A;  3LA2 A;  1ZYR F;  4G7Z F;  2XHK A;  2HGC A;  4HLY A;  3DF8 A;  1SD4 A;  3FM3 A;  1I1S A;  4ENN A;  4U0W A;  1SFX A;  3FZV A;  4R79 A;  1J7K A;  2M87 A;  2PN6 A;  1HKT A;  3DPL C;  4CIC A;  3U1D A;  2YPR A;  2P6T A;  1TLH B;  2OQG A;  4S05 A;  5E17 F;  3DQV C;  3HOS A;  1O7L A;  4NHJ A;  3V8L A;  2MH9 A;  4KMU X;  3S2W A;  4BNC A;  4L18 B;  4AIJ A;  1CF7 A;  2C6Y A;  2KIF A;  1MJA A;  3TOB A;  1P4X A;  3OV8 A;  3T8T A;  1I27 A;  3H3U A;  1U8R A;  3SZT A;  2MH2 A;  1SMY F;  5H6Q A;  4QWQ A;  2FF4 A;  2FXA A;  2EV0 A;  2IW5 A;  3J7A O;  1MZB A;  5ERI A;  2BGC A;  2RKH A;  3O6B B;  1Z6R A;  3RKW A;  1IXR C;  1F9N A;  2QLZ A;  2D45 A;  4EMS A;  5CVV A;  2XKO A;  1MJB A;  3TO7 A;  2H09 A;  1S6L A;  2E1N A;  1TW3 A;  1Z9C A;  1O3R A;  3KCC A;  4MQV A;  1AWC A;  3J81 K;  3I4P A;  1ON2 A;  1J59 A;  2L02 A;  3HRT A;  1XSV A;  2FQ3 A;  3GZ6 A;  2G7U A;  3HTU A;  4IRG A;  3SFZ A;  2GWR A;  2PG4 A;  4EM1 A;  2J5P A;  2DFI A;  2CGP A;  2OA4 A;  1FSE A;  5F6F A;  1LEB A;  2QM3 A;  4I7H A;  5FFZ A;  3ZMD A;  3FX3 A;  1S29 A;  3LQQ A;  3QAH A;  2LNB A;  3LAP A;  1RZ4 A;  6PAX A;  1YYV A;  2VE8 A;  4L9N A;  1BI1 A;  4P9F A;  4UVC A;  2CG4 A;  2R3S A;  3J81 Z;  5LGT A;  3IWZ A;  1IN6 A;  2E7W A;  1O3Q A;  4L9T A;  5EEG A;  2VON A;  3CTA A;  5LHI A;  2GIV A;  3HSE A;  2MLK A;  4RB3 C;  3GFL A;  3EYI A;  5DV5 A;  3PQJ A;  5HOO A;  4WXC A;  4AD9 A;  1W4M A;  3C18 A;  2OZ6 A;  3GX4 X;  5H20 A;  1B59 A;  4HF2 A;  4G7O F;  3LWF A;  2D1H A;  4GO1 A;  2NNN A;  1GVJ A;  4A0Z A;  5FGM A;  4UV9 A;  4R8H A;  1TQI A;  1XCV A;  2XRN A;  2VC1 A;  2K4B A;  5A2Q Z;  1ZGA A;  1SFE A;  2ADU A;  4ESF A;  3ZMV A;  1OR7 A;  2CQK A;  2L4A A;  3KZY A;  2X0L A;  1XCB A;  4KIF A;  3L2C A;  4I0A A;  2DPU A;  1YG2 A;  1H9T A;  3F23 A;  2ZO4 A;  5A2Q K;  3BRO A;  1CF7 B;  3WG9 A;  3I53 A;  3IC7 A;  2H6B A;  4YII A;  1KGS A;  5HS7 A;  3QPT A;  4B09 A;  3N97 A;  4HF1 A;  2KRF A;  5ICG A;  3M9A A;  3ZMS A;  1S3J A;  2IA2 A;  4MHG A;  4KUM A;  2VBZ A;  3HTS B;  2MD5 A;  2VN2 A;  4XRF A;  2A68 F;  2VOP A;  3KEQ A;  3TOA A;  1TQP A;  1D8J A;  4L5I A;  4QLC U;  2A61 A;  2ETH A;  3ZN1 A;  1HXD A;  3KP3 A;  4RGS A;  2ISZ A;  4LK0 F;  3VB2 A;  2Z99 A;  4P9U A;  1P6R A;  4UVA A;  4IVN A;  4FX0 A;  4MTE A;  4RS8 A;  3DP7 A;  2L3D A;  3FXR A;  2HWV A;  3F6V A;  1E2X A;  2XAG A;  1I6X A;  3RDI A;  3T5X A;  4EJU A;  3BJ6 A;  1HBX G;  1ZG3 A;  2CWE A;  2DAO A;  3MCZ A;  1R22 A;  4WXD A;  4WCG A;  4NB5 A;  1R5H A;  2FE3 A;  2IJL A;  1MKM A;  2G9W A;  3BZ6 A;  1T6S A;  4GYI A;  1Z7U A;  2FRH A;  4CDG A;  2GXB A;  3WOD F;  3KP2 A;  5BOX A;  3K69 A;  2EV5 A;  3HIF A;  2PBI A;  1G6N A;  2ZKZ A;  2X4H A;  3B73 A;  3JSO A;  4A0X A;  1ON1 A;  4BH9 A;  3SXY A;  2BV6 A;  4U7D A;  1F5T A;  1YW8 A;  5D5U B;  1H9G A;  1NHA A;  1R5G A;  1HKQ A;  5DEQ A;  2A3S A;  5DUK A;  5ILU A;  4IRH A;  2HFH A;  1KU2 A;  5IT9 K;  5CVU A;  5K5O A;  5BS6 A;  3SQN A;  4LB5 A;  4HLX A;  3E6M A;  3WTX C;  1IAW A;  4ASN A;  5AIQ A;  5LRR A;  1R1U A;  2GZW A;  4YIF A;  1RIO H;  3JTH A;  4K2E A;  1UHM A;  1IN4 A;  3ZMZ A;  5ED4 A;  4ZYH A;  2TDX A;  5HDK A;  1XDU A;  5L3B A;  4G8X A;  1KU3 A;  3DKW A;  3CO7 C;  1XDS A;  1OPC A;  2D1V A;  4RAY A;  1YO5 C;  3TGN A;  4YFN F;  3FM5 A;  3AAF A;  1WSU A;  1ZRE A;  1BIB A;  1U3E M;  2IVM A;  2FMY A;  1LDJ A;  1GXQ A;  1A04 A;  2VT3 A;  2PI0 A;  1KA8 A;  1B9N A;  1XN7 A;  4ZZD A;  2IA0 A;  1XGO A;  2Y75 A;  3GF2 A;  1WQ2 A;  4HW0 A;  2M8E A;  4N9H A;  3ZMT A;  4LMY A;  3JSP A;  1J9I A;  1O3S A;  1LB2 A;  2PLY A;  5L3F A;  4OIQ F;  1XGS A;  1YFH A;  1G3S A;  2JSC A;  3EDP A;  2IRF G;  1LQ1 A;  4U0Y A;  1LVA A;  2GAU A;  1Z1D A;  1R1V A;  4HF0 A;  1KQ0 A;  4HZF A;  5FD6 A;  3IRQ A;  1P4W A;  2RNJ A;  1XGM A;  2K86 A;  1HKS A;  2XIG A;  4BYY A;  1PUE E;  4UUV A;  1LEA A;  1ZAR A;  3HHH A;  1O3T A;  5ICC A;  4U88 A;  5K5Q A;  1PDN C;  3ZP5 A;  2Q0O A;  2UXX A;  2P5L C;  2H27 A;  1MGT A;  1SFU A;  4Z2Y A;  4LJZ F;  1REP C;  1J5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...