2FRHA

Crystal structure of sara, a transcription regulator from staphylococcus aureus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
GSHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Staphylococcal accessory regulator A
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 41
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2frhA00
1HSJA 3R6SA 1ZRCA 1FC3A 2MC3A 4A5MA 3J7AO 1ZAOA 2DW4A 2JPCA 3M8EA 1ZARA 2PFBA 2VE9A 3RKWA 3HRSA 4AD9A 3WTTC 1J5YA 1I5ZA 2ESHA 3O2PE 2CO5A 1SMTA 4RB1A 2Y75A 4Y15A 3ZMUA 3KFWX 4R79A 1WSUA 4ENKA 2PBIA 3C18A 3RYPA 1IZ1A 1Q1HA 4BYYA 3FXRA 5HOOA 4U0VA 4HDVA 2FSWA 3D0SA 3J80Z 3DEUA 2XIGA 3QU6A 1DP7P 2A6HF 2MH2A 1KQ0A 1U5TA 1SD4A 4ENJA 1BC7C 3FF5A 2RVCA 4Q5SF 4OIPF 1XSXA 1FZPB 3IKTA 1PDNC 4NHJA 1XGSA 3PQKA 5BPDA 5CLSA 1S7OA 1YO5C 3BJAA 2D1HA 1IXCA 1P92A 1XD7A 4KN7X 4RB3C 3T8TA 2STTA 2EFOA 3WTWC 2PLYA 4ETSA 3P9CA 3CO6C 4KIBA 2A68F 4HLYA 3TKYA 1USTA 1USSA 3MCZA 3QAHA 1RUNA 1R00A 3F8CA 4HZFA 1G3TA 3L9FA 2Q0OA 3GF2A 1P4WA 2NNNA 5DEQA 4LMYA 1T38A 1R1VA 3MZYA 1KYWA 2IA2A 1P2FA 3GFJA 2E7WA 3WODF 4I2OA 2JT1A 1ULYA 1XGOA 2FBHA 4PDKA 3L00A 2K4JA 4P55A 2BYVE 2FU4A 4OMYA 4U0WA 4ZYEA 2EWNA 5LHGA 3FM3A 1OYYA 3R4KA 4RAYA 3BPVA 4HF2A 3RKYA 3F8BA 3RTRA 5JHUA 1U78A 2ESNA 1G6NA 4HW0A 2IA1A 2XASA 3GWZA 2E1NA 1A04A 4MGRA 4IHTA 3CDHA 1O3RA 3M7GA 4S04A 4QLCU 4I0BA 1HKQA 1DPUA 3I71A 1FP1D 1XMAA 3E6MA 3E5UA 1K78B 3LSTA 1B9MA 2FBKA 2OU2A 4OIQF 1W7PB 2J5OA 2A07F 3R61A 4EJWA 1HKTA 1BOAA 2A5YB 2STWA 2GQQA 1YQAA 3FMQA 1BN5A 2UZKA 3LWFA 5L3BA 3L7WA 4M6XA 2FF4A 3JSPA 3WTUC 2YU3A 3VFZA 2V1UA 3IWFA 1G4DA 1HKSA 2M87A 5F64A 2VC1A 3NQOA 2CG4A 3TDUC 4A2UA 1X3UA 3ELKA 4MEXF 3EYYA 2R3SA 1SMYF 3ZMDA 2M30A 4UXNA 4XSZF 4LB6B 5DCFA 4G94A 4CO8A 2GXGA 4YFNF 2DPUA 3DF8A 1J59A 4MTDA 3K1NA 1XDUA 3GO5A 1U2WA 4N9HA 2Q2EA 4G6QA 3WGGA 2FEZA 1EH6A 1ZG1A 4KNYA 3F6VA 5E1XA 2W57A 5FFZA 2EV5A 2B0LA 4WK8F 1HW1A 4HLXA 4L5IA 1SFEA 2DK8A 2DO7A 3KEQA 2ELHA 2GXBA 4LG0B 5EEHA 1QZZA 3SXYA 1FT9A 2YR2A 4CGZA 3HSFA 3F6OA 4AIJA 4WXCA 4EJUA 2CGPA 3EETA 5TJJA 3M8FA 1GXQA 2DQLA 3ECOA 2EFWA 4CHUA 4EJTA 1Z1DA 3FZVA 4I98B 5CVJA 2IVMA 1R22A 4M72A 5D8KB 4M73A 1KGSA 4KT5C 3RPQA 3F72A 2FXAA 1XDSA 3HUGA 3EYIA 5D5VB 1DUXC 2FNAA 1FNNA 2X0LA 1ZN2A 2F5DA 3ECHA 5FO5A 1U3EM 3BROA 1IN7A 3ABUA 1D8KA 1P4AA 2A69F 3P9KA 4KDPA 4ZH4F 5ICEA 1RUOA 1O3QA 3GXOA 1LQ1A 2IPQX 5K5OA 4EVIA 2CYYA 3QP5A 4UV8A 2DK5A 3WG9A 3C7JA 4L9VA 4HX8A 1R1UA 2XAHA 1W7PA 2P5KA 1GXPA 4N9IA 2FQ3A 5ILSA 2W24A 3ISPA 1OPCA 4UV9A 1F4KA 4BHBA 1HXDA 3U2RA 1ZLJA 4A6EA 2OD5A 4OU0A 2HS5A 2ZBKA 3L2CA 2ZXJA 2VT3A 5FFXA 3R0JA 1JHHA 1H9GA 5D4RA 4G7ZF 3HRUA 2EV0A 5H20A 4A6DA 1RZ4A 4OMZA 4GGGA 3P7NA 4HBLA 3CJNA 3KZZA 3E6BA 1ZLKA 4KYWA 3KLOA 2NNYA 2HKOA 2GA2A 4LLGF 3KETA 3FXQA 5J8CA 2MH9A 5BPIA 3CUQC 2OAZA 2NYXA 1OKRA 1T6SA 4PCQA 1MD0A 5LRRA 1S3JA 3B02A 3QU3A 3T0YA 4GYIA 1YTYA 4NB5A 3M9AA 2RC4A 2E7XA 1UCRA 1EV7A 4BXUA 4A0XA 4YIIA 1ODDA 2MBFA 3GLXA 3MQ0A 4RB0A 4LG0A 1FYLA 3J81K 1ZYRF 3NEUA 5HLIA 4KFCA 4A5NA 4P9UA 2W25A 2LSOA 3KP5A 2JTVA 1R7JA 2VBWA 2IP2A 3LQQA 3CTAA 4OIOF 2PN6A 4WX9A 3K9TA 3DQVC 5ERIA 2RN7A 1K7AA 4MQ9F 2IW5A 2BEOA 3IKVA 2K86A 4IXAA 2PG4A 3FX3A 2XKPA 2G9WA 2HKXA 1YW7A 4FT8A 3KE2A 3F8MA 3O3KA 5DUIA 3GX4X 1GVJA 4HAMA 1RIOH 3L09A 1YLFA 4MTEA 3WTXC 3D5LA 1Z91A 4G6DA 1KA8A 1AWCA 1PP8F 4Q48A 5E17F 3TO6A 2O03A 2QQ9A 1LJ9A 3DXJF 2RQPA 1YG2A 5A2QZ 2P7VB 3WGHA 4N0BA 5HLGA 4G7OF 3I4PA 4JK1X 1FSHA 3KP3A 3QRFF 4M9SA 3SQNA 3KP6A 2P8TA 4ESBA 3KCCA 2WTEA 1IAWA 5CYVA 2VOOA 1IRGA 1CF7B 1OMIA 3I0TA 1R5GA 2XAFA 5A2QK 1IF1A 1TW2A 2XGXA 2L3DA 5E1WA 1MKMA 5D5WB 4WWCA 4L0YB 4HV6A 1ZRDA 2DQRA 4BHCA 1E17A 1BM9A 2AXLA 1FOKA 3HHHA 3AAFA 2ZNYA 3FHZA 2QQAA 4L5JA 2LDUA 1IRFA 5CVRA 2Q8KA 2GZWA 3U9GA 5ED4A 4EGZA 2O61A 2W84A 5E18F 1JE8A 4RGRA 4CICA 1BC8C 2O0YA 2M1BA 2NAZA 1HQCA 1W7PD 4IRGA 4R1HA 4WXDA 1TQMA 1G3YA 5HS7A 1ONVA 3LAJA 5F1RA 5K1YA 5HDKA 2HR3A 2GWRA 2F5EA 2LKPA 1D8JA 5DD4A 1YYVA 3HYIA 2HDCA 4OIRF 3RDIA 2V1XA 3P9IA 3GZ6A 4KMFA 1YS6A 3PFIA 5LGTA 1UHWA 5L3GA 5FGMA 1NHAA 3VEPA 4LB5A 4O3MA 4I0AA 1YW8A 2QWWA 3E97A 4ZZDA 1I6XA 1LDKB 4EGYA 1JHFA 1QNTA 4EJOA 2ETHA 1ON2A 5ICGA 1LDDA 2O3FA 2V1DA 3HOSA 2ADUA 3ZMTA 3TO9A 2OZ6A 1KU2A 2FMYA 4JBAA 3IRQA 1Z7UA 1B1BA 3KP4A 4ENMA 1K79A 3HSRA 2KIUA 1O3TA 4BAYA 5HS9A 3V8LA 4MEYF 2VXZA 5HLHA 4BH9A 3SHFA 2H09A 3HIFA 2NRAC 3WGIA 4U0YA 1TNTA 3Q9VA 3E5QA 2K02A 5HDNA 2UXXA 2PI0A 4BHPA 4KICA 1CF7A 5HDGA 3ML6A 4P96A 2EFPA 4E70A 5J6XA 1TNSA 5KK1A 2RDPA 1O3SA 4P9FA 5LEKA 2JPBA 4K2EA 5IT9K 1UHMA 1L0OC 2ZCWA 1KU9A 3BP8A 1LEAA 4S05A 2HQNA 2ZO4A 3H3UA 3I53A 3Q9SA 3W6KB 2W85A 3SZPA 3FMSA 1H0MA 3KEOA 1QZYA 3M1EA 1REPC 3MAJA 5EEGA 4M71A 3WTZA 2DAOA 2R7FA 5DD8A 1DDNA 1IN8A 2G7UA 3K1PA 4G8XA 2BE5F 1FYMA 2UXNA 2EFNA 4P5OA 1LB2A 1IXSB 1MZBA 3WU1B 1FLIA 3RJPA 5ILVA 1BIBA 1P6RA 4EM2A 3TOBA 2YX4A 4JQFA 4HDUA 2XKOA 3S2WA 3WE3A 2DT5A 1KQ8A 1OYIA 1ZRFA 3OOPA 3GW2A 2ZMEB 4LD5A 4XSXF 2XV4S 5LLQA 3GFIA 2XRNA 1D5VA 2QQBA 2ISZA 5F6FA 1OR7A 4UVBA 1SD6A 2J5PA 2VT2A 5LHIA 4IJAA 2FBIA 2CWEA 3E6DA 2BGCA 5DCMB 5FLXK 1ZH5A 2HTSA 4GYGA 1J7KA 2VBZA 2L4AA 1T0FA 2H27A 1HW5A 3IRRA 3V7CA 1W5SA 2CFXA 3RIRA 3REOA 1XN7A 4GCVA 1Z6RA 2E1CA 3LFKA 2QVOA 2A61A 1J9IA 4UVCA 3GUDA 2DLLA 3GFMA 5AIPA 1T98A 3BDDA 1BIAA 4L9NA 2H94A 2QM3A 2VBXA 2PEXA 2HOEA 3FWEA 2XROA 5E8IA 5DYMA 4PGGA 5CVUA 3G73A 1MJAA 1U6GA 4CZZA 1FX7A 1KU3A 3FM5A 1G3WA 1ZHFA 1XMKA 2Z3YA 5JFRA 2G7HA 2WC2A 3NRVA 5AONA 2WWYA 1KU7A 3V8JA 1VTNC 3HRMA 4RB2C 2OA4A 1TTYA 4R8HA 3FXUA 5ILUA 3ZQ7A 5BS6A 1MDMB 2XAGA 1WRJA 3HSEA 2RKHA 1XCVA 3CUOA 2QYOA 3F8FA 2VC0A 2KRFA 4M74A 2TDXA 3C3WA 4OINF 4H0EA 5BMZA 4LJZF 4U7BA 1QBJA 4XRFA 1ZGAA 2MD5A 3CUQB 2ISYA 3RPUA 2QBYB 1OYWA 2H6BA 2OBPA 4I09A 3F3XA 1IXRC 1TW3A 2HWVA 1SAXA 5CJ9A 4Z2YA 5ICFA 3J81Z 2ZNZA 2KJBA 4B09A 1IN6A 3JAMK 2F5FA 3RI4A 2R7DA 3H92A 1KQ9A 2LF8A 1BI0A 1D3YA 1JGSA 2ZMEA 3DFGA 4U7DA 3PQJA 3GYHX 3R0AA 3ZN1A 3KZYA 2CW0F 5LEJA 1J75A 1U5TC 2D45A 4LFUA 4A0ZA 1ZGJA 2XAJA 5DCMA 3COAC 2NS0A 4EV0A 2D1VA 1W4MA 2IJLA 3JSOA 3WTSC 3GFLA 4L9JA 1ZG5A 2PJPA 2MA3A 2Y0MA 3BY6A 3V7SA 2Z5UA 5DDGA 3MEXA 2OZUA 4EM1A 4L0ZB 2HGCA 3RYRA 3TQNA 3HRTA 1B9NA 2GIVA 2L4MA 3ZN0A 3IC7A 1V3FA 5ICCA 2YPRA 2F2EA 1J0RA 3E5XA 1Z9CA 3VOEA 4BNCA 4AIHA 4KIGA 3ZPLA 1B59A 3O6BB 2IT0A 5CVIA 2PMHA 1WQ2A 1RI7A 2V79A 2ZKZA 1T2KA 1TQPA 3I54A 4ESJA 1P4XA 2GAUA 5TRDA 1FBUA 5K5RA 4UHTA 3QPTA 2K27A 3I59B 1MDMA 4ENNA 2P7CB 4XLPF 4ON0A 1T39A 2HQRA 4GXOA 4B8XA 5L3FA 2EB7A 1QO0D 1R58A 1IW7F 2MLKA 1I27A 3HHGA 4ESFA 3CUQA 1SFXA 3T8RA 1FP2A 2QBYA 4DNCA 3JW4A 4LGWA 3QPHA 2FE3A 4WCGA 2L02A 5LHHA 3W6JB 1R1TA 5HS8A 4CDGA 1TQIA 5JI6A 1U8RA 1YIOA 2YX7A 1K6OA 3BJ6A 2IA0A 1FPQA 1O7LA 1HSTA 3SZTA 4HQEA 4RGUA 1O7FA 2OQGA 1H9TA 5KVRA 4FX4A 4TV7A 2O6GE 5BQTA 1TLHB 3ULQB 4RS8A 5JVTA 2HZTA 1FBQA 1CGPA 1XCBA 3BWGA 3LA2A 5FB2A 1SFUA 5H6RA 4AWXB 2F5CA 2UWMA 4WXHA 1F1ZA 1PP7U 4L18B 2EA2A 2QUFA 4IVNA 4BQAA 3J80K 2P6TA 5DV5A 1LVAA 1ZG3A 1ZREA 3MFKA 2JSCA 4IPAA 2FA5A 2M8EA 1DPRA 3ROUA 4A0YA 1TBXA 3U1DA 3H3ZA 2A3SA 1AOYA 2DU9A 3V8KA 4HX7A 3IL2A 1S29A 4M6YA 2Z33A 3N4MA 2JRTA 5K5QA 4U88A 2HYFA 2OQRA 2EV6A 2M5WA 2IRFG 5E1ZB 3ZMSA 1IN4A 4HOBA 4LK0F 1Z05A 3CO7C 1EH7A 2V9VA 2FMLA 3B73A 1XB4A 5L3DA 3V4GA 1YS7A 1V4RA 2YSRA 3KLNA 1SD7A 3GZ5A 2L01A 3DKWA 1J2XA 2CSOA 3DPLC 3LA7A 4Q4ZF 4EQQA 1Z6TA 3I5UA 2L54A 4LLLA 3TGNA 5IT9Z 1B6AA 3LAPA 4M9XA 4IF4A 3I59A 2EFQA 1MGTA 2MLGA 3WE2A 4AIKA 3JTGA 2RGVA 3DP7A 2Y48A 1ON1A 4ZZLA 1FY7A 2FRHA 2FOKA 2VOPA 1SD5A 2WV0A 5D4SA 5LBQA 5LRSA 1MJ9A 5HVQC 4M9ZA 4RAZA 2COMA 5D6EA 1WWXA 1S6LA 5FD5A 3WTYC 1WI9A 4O5VA 4PGHA 4Y17A 5L3EA 5E8GA 4XBFA 3K1MA 5LGNA 4RGSA 2ZFWA 4KUMA 4DQ2A 3VB2A 1XGMA 4UUVA 2VE8A 2D2WA 3EDPA 1BI3A 2KKOA 1E2XA 4Y13A 1LEBA 2QLZA 1FWZA 4I02A 3E6CC 3V7RA 1IN5A 3ZMZA 2K4BA 1R5HA 1YW9A 2LNBA 4HV5A 1BI2A 3K69A 2HEOA 2GA1A 4MHGA 2CQKA 4KMUX 4YFKF 4MQVA 4HA8A 3LA3A 1HW2A 5FD6A 4F7ZA 2PQ8A 3HTUA 5FLXZ 1HBXG 6PAXA 4NQWA 1F5TA 5DUKA 4MNUA 5AIQA 4OOIA 1FSEA 2P5LC 2KIFA 4YG2F 5BOXA 1I1GA 4IHSA 3GEZA 1QQIA 4CYDA 1B4AA 2AS5F 3OV8A 3VODA 5JR3A 4LK1F 2DBBA 3R60A 3HOTA 3C1DA 2VBYA 1LNWA 4G9YA 1QPMA 4UNOA 3WTVC 4RGXA 3RKXA 1BJAA 4XLNF 2HTJA 3LQRA 3BPXA 2EJRA 2DI3A 3G3ZA 4LLNA 1BI1A 4HF1A 2M45A 3IWZA 3I58A 1BBYA 5J8FA 4HF0A 1S7AA 2KIMA 4HYEA 3K0LA 1STZA 1JXSA 1XSVA 2K7LA 2BV6A 1UB9A 3N97A 1FYKA 4HX4A 1S8NA 3T5XA 1I1SA 2ZJ2A 4YIFA 2C6YA 1G3SA 2XUBA 3HTSB 2A6EF 1WKMA 3DPTA 3EQLF 1K78A 1R36A 4ASNA 2BBYA 4UVAA 2VODA 3ZP5A 3F22A 3Q5FA 2Z9OA 4D0PA 3FMRA 3K2ZA 2HYGD 3CLOA 4I01A 3JAMZ 3WU0A 2P5VA 5E20A 4Q47A 2O8XA 3F23A 3E3VA 2V6CA 2X4HA 3F8NA 3BJOA 1RNLA 1EH8A 4A12A 4EJVA 1PUEE 1YFHA 3BOQA 3F21A 2JZYA 1UFMA 4QWQA 3TO7A 3EUHA 4KIFA 3GVAA 5D6FA 3QOPA 3JTHA 4G7HF 3QP6A 1R23A 1GHCA 2P6SA 2VN2A 2EA4A 3SFZA 4YFXF 3ABTA 3T1BA 3I64A 4KN4X 5D5UB 1U5TB 4CXFA 4ZYGA 5D5XB 1Y0UA 4IRHA 1FBSA 1MJBA 4AVPA 3TDZC 3BZ6A 3TOAA 2P4WA 2HFHA 1IUYA 3DV8A 2VONA 4WF2A 1C0WA 1F9NA 4FHTA 2RNJA 2XVCA 4EM0B 5H6QA 5LGUA 4FX0A 4I7HA 2DFIA 2RV8A 5CVVA 4ZYHA 1QGPA 2ACJA 2LF7A 2XAQA 1KYZA 1O57A 4HQMA 5L3CA 4ZYDA 1L3LA 4L9TA 2KJCA 1XSDA 2DTRA 2QZ8A 2PMUA 3IHUA 3KP7A 4O6JA 5IT3A 5D8LB 4KA4A 4PZJA 3KP2A 4EMSA 4GO1A 1XGNA 4IRIA 3MWMA 2FNPA 2DPDA 2XHKA 3ZMVA 2H6CA 3MZHA 2EK5A 1W5TA 2QENA 1LDJA 3ERED 2Z99A
chains in the Genus database with same CATH superfamily
4Y33A 1HSJA 4PFOA 3R6SA 1ZRCA 1FC3A 2MC3A 4DBRA 4YIRX 4A5MA 2OC6A 3J7AO 1ZAOA 2DW4A 4XM3A 2JPCA 2DA4A 3M8EA 4BXFA 1ZARA 2PFBA 3DEEA 2VE9A 3RKWA 3ZCOA 1YIJI 1H8AC 2R5YA 1YRNA 1GVDA 3HRSA 4AD9A 3WTTC 1J5YA 3H5AA 1I5ZA 4BBRJ 5EGOB 2X48A 3OYGA 3FXOA 2XB5A 2X6XA 4KITB 3OYMA 1Y1VJ 1VNDA 2ECCA 2ESHA 2QQ8A 2CO5A 1SMTA 2EBIA 3O2PE 1MNMC 3DKXA 2HVSA 4RB1A 1XX5A 4E7LA 2Y75A 3U1KA 1LKXA 3ABKH 4Y15A 3KFWX 3ZMUA 4CCLA 2L2OA 4R79A 3OL3A 2W7NA 1WSUA 4ENKA 2PBIA 1DQUA 4F55A 5IYBJ 3QOEA 1VQ9I 3BG6A 3ABMH 3C18A 3RQIA 3RYPA 1IZ1A 3LSIA 3CQZJ 5K7FA 1WJEA 1VQKI 2VI6A 3OR1C 3FISA 1Q1HA 1OCPA 4BYYA 2R7UA 3FXRA 4NC6A 5HOOA 4U0VA 4BE0A 4HDVA 2FSWA 1OISA 3D0SA 3J80Z 3DEUA 2XIGA 3QU6A 2E35A 3OS0A 2H1KA 1DP7P 2A6HF 2MH2A 1KQ0A 1U5TA 1ETOA 1SD4A 2ID3A 3IP4B 3VPRA 1OJLA 2R7ZJ 4ENJA 1BC7C 2PJRB 3FF5A 3HPGA 1Y0NA 2RVCA 3S32A 1W0UA 4Q5SF 4PSWA 2Y2ZA 4OIPF 1XSXA 1WJBA 2MC4A 1FZPB 5TGTA 3HOWJ 1DGRM 3IKTA 1PDNC 1XPXA 2M7BA 2E2HJ 3L2RA 2HDDA 4NHJA 1XGSA 3PQKA 2LLKA 4A3FJ 2YUSA 5BPDA 2M8GX 2LREA 2X6WA 1IC8A 5CLSA 1S7OA 1ETWA 1YO5C 3Q0VA 3BJAA 3OYAA 3K4NA 3MVPA 2EZHA 3HKZN 2D1HA 1MSFC 1IXCA 1P92A 1XD7A 4IQ4A 4KN7X 3T8TA 4RB3C 2STTA 2EFOA 1OCTC 3WTWC 3SZGA 2PLYA 4ETSA 3P9CA 3CO6C 4KIBA 3SEZA 2Q2EB 2A68F 2VJIA 2X1EA 4HLYA 3TKYA 1USTA 1USSA 2Y9ZA 3MCZA 3QAHA 1RUNA 1R00A 3F8CA 4HZFA 1G3TA 3L9FA 1W0TA 2Q0OA 3GF2A 2ELJA 1P4WA 3CDIA 4G6TB 1LFPA 2IBDA 2NNNA 5DEQA 4LMYA 3ZOBA 1T38A 1R1VA 3MZYA 1BR2A 3W2AA 1S72I 2LKSA 2QKLB 1R6RA 1KYWA 2IA2A 1P2FA 3GFJA 2E7WA 1ERDA 2NS8A 3WODF 4I2OA 2JT1A 1ULYA 2RAEA 1XGOA 2FBHA 1XG1A 4PDKA 1D0ZA 2CU7A 3L00A 2K4JA 1OR7C 4OAZA 2ID6A 2HYJA 1KZHA 4P55A 2BYVE 2DFEA 1WI3A 3W2VA 2FQ4A 2FU4A 2M9HA 1RRJA 2DYSH 4OMYA 5KNLA 4U0WA 2VASA 5EJCA 4ZYEA 2EWNA 5LHGA 1S5LC 3FM3A 1XC5A 1OYYA 3R4KA 1P7JA 4RAYA 2BHZA 4V2FA 3ABLH 3BPVA 4HF2A 2VJ4A 3RKYA 3F8BA 2KL4A 2KZGA 4I76A 3RTRA 1T0FC 2DA2A 5EG0B 3HUGB 5B1AH 5JHUA 5LFAA 1U78A 2R7XA 3LNQA 2ESNA 2R7WA 1G6NA 4HW0A 2IA1A 2XASA 1FMWA 3GWZA 2E1NA 4YEJA 1A04A 5B3SH 1WVRA 5DTDA 4MGRA 4IHTA 3CDHA 4QSHA 3M7GA 1O3RA 1TWCJ 2L9VA 4S04A 4QLCU 4IZZA 2Y0SN 1HKQA 4I0BA 3S1NJ 1DPUA 3I71A 4ZTJA 3A4CA 1N77A 3BTCA 1FP1D 2XPUA 1XMAA 2HQ5A 3DBLB 3E6MA 3E5UA 4BJ5C 2LD5A 5EGOA 2NS7A 1K78B 3JRBA 3LSTA 5B66C 4FISA 4OWRB 1B9MA 1K83J 1IDYA 2FBKA 2DMQA 1MH3A 2OU2A 2Z2SB 4OIQF 1BR1A 1W7PB 2BHYA 2J5OA 2MD0A 2IGNA 3OSGA 2A07F 3R61A 1XTAA 4EJWA 1Y6IA 2NVQJ 1BOAA 1HKTA 2MYSA 1V5GA 2A5YB 2STWA 2GQQA 1YQAA 5IOYA 3FMQA 1U8BA 2DA7A 1YOVB 2BOLA 1BN5A 3NWSA 2UZKA 4GFBA 1Z3YA 3LWFA 3VDXA 5L3BA 3K10A 3L7WA 4M6XA 4IHXA 2OCCH 2ZC2A 2FF4A 2HOSA 3JSPA 1RPWA 1PUFB 3WTUC 2YU3A 1JUSA 5FKKA 2EPFA 3VFZA 5CKTA 2V1UA 1RKTA 4PJNA 3SJMA 1JUMA 3IWFA 4PJJA 1G4DA 1HKSA 1I6HJ 2M87A 5F64A 2VC1A 3NQOA 4UB6C 4HNTA 5M5YJ 2CG4A 3MZ8A 3S93A 4I99C 2HQAA 2DFFA 3TDUC 4BU2A 4A2UA 1HLVA 2PJRA 3GTPJ 3CC2I 2KP6A 1X3UA 3ELKA 1RETA 4IHWA 1OFCX 2VKVA 1IV6A 4MEXF 2DOAA 3EYYA 1FOWA 2R3SA 3OOUA 3MD2A 1SMYF 1JTXA 2CW7A 2CUJA 3ZMDA 2WY8Q 2DMTA 2M30A 2EZKA 4UXNA 4XSZF 1MMSA 4LB6B 5DCFA 4G94A 4CO8A 2CQXA 2GXGA 4YFNF 4RLQA 5GP9A 2DPUA 3DF8A 4E7JA 4MTDA 1J59A 1TP4A 4M3DA 3K1NA 1XDUA 3GO5A 2R93J 3DLLF 4CUGA 1U2WA 1R4NB 3OR2C 4N9HA 3O8HA 2Q2EA 4G6QA 3WGGA 2FEZA 3H35A 1GUUA 1EH6A 1ZG1A 3I56I 4KNYA 3F6VA 4XLCA 5E1XA 2W57A 5FFZA 2LY1A 3TP3A 2EV5A 2B0LA 2BVMA 2O5RA 4WK8F 5F0HA 1A5JA 1HW1A 1K6YA 4HLXA 4L5IA 1SFEA 1JTYA 2DK8A 2DO7A 3KEQA 2ELHA 2GXBA 4LG0B 5EEHA 3ZQCA 1QZZA 2CUFA 3SXYA 1R49A 1FT9A 1WGXA 2YR2A 2ZMEC 4CGZA 3HSFA 3F6OA 4AYBA 4AIJA 3TBIA 2CUZA 4WXCA 4EJUA 2VIXA 2CGPA 3EETA 5C44J 4D9JA 5TJJA 3M8FA 1GXQA 2DQLA 3ECOA 2EFWA 4CHUA 1UZCA 5FRNA 4EJTA 1Z1DA 3FZVA 4Z6YA 4I98B 5CVJA 4B43A 2CUEA 2IVMA 2JSPA 1R22A 4M72A 5D8KB 3NARA 3RSNA 2ZXWH 1TT0A 2DFHA 2ELKA 4M73A 1WJDA 4CCJA 1KGSA 4KT5C 3QYBA 3RPQA 9ANTA 3F72A 1WFXA 1NH3A 2KZVA 2FXAA 2LP0A 1XDSA 3X2QH 4BEHB 1WJAA 4S0HB 1MH4A 5EG0A 3HUGA 3HC7A 3EYIA 2M4GA 5D5VB 3KYCB 1IV8A 5J1UA 4J00A 1DUXC 2FNAA 1FNNA 1MNEA 2VKHA 2X0LA 1X2MA 1ZN2A 2F5DA 3ECHA 5FO5A 1R9TJ 5GTIC 1U3EM 1APLC 3JRFA 2KDOA 1PYVA 3BROA 1IN7A 1LFUP 1YX5A 4FETA 3ZQQA 3LSHA 2AQEA 4E7SA 2K9QA 4ZC3A 3ABUA 1D8KA 1P4AA 1QHHD 2A69F 3P9KA 4KDPA 4ZH4F 5ICEA 1XS9A 1RUOA 1U0JA 5M3FJ 1O3QA 3GXOA 1V5EA 1LQ1A 2IPQX 4A3JJ 2LK2A 4EVIA 5IP6A 5K5OA 3HZJA 2CYYA 3QP5A 4UV8A 2E34A 1E0EA 2DK5A 2K9SA 3WG9A 2LVSA 3C7JA 4L9VA 5CPRB 4HX8A 4HRIA 1R1UA 2EIKH 2MABA 2XAHA 3ZXSA 1W7PA 2LC2A 2P5KA 2L7ZA 1GXPA 4IKFA 4N9IA 2HU9A 2FQ3A 2CH0A 5ILSA 2W24A 3A2KA 3ISPA 1E3HA 1OPCA 4UV9A 2IS6A 1F4KA 4BHBA 1HXDA 3U2RA 1ZLJA 2R7SA 4A6EA 3HGYA 3S16J 2MG4A 1T33A 4D7MA 1VQ4I 1JT6A 3H1CA 2OD5A 4DJAA 4OU0A 2GOXB 2R5YB 1YRNB 3FXMA 2WAQN 4MFEA 2HS5A 3A02A 3M8JA 3H9QA 2ZBKA 3L2CA 2R7TA 2ZXJA 2VT3A 1PUFA 5FFXA 2JK3A 4MO7A 3R0JA 1JHHA 1H9GA 4ZDLA 2P81A 2HZDA 3S1QJ 2I5UA 1RC9A 5D4RA 3GTOJ 4XOPA 3CJRB 4XRSG 4G7ZF 4XOTA 2CQQA 3HRUA 5FLMJ 2EV0A 1Z0XA 5H20A 2DCEA 3ZRGA 4A6DA 2DYRH 1RZ4A 4OMZA 1ETYA 4GGGA 1YJNI 3BTLA 3P7NA 4HBLA 4GDFA 3CJNA 3KZZA 1DU0A 3D5SC 3E6BA 3S15J 1ZLKA 4KYWA 3KLOA 2NVYJ 4DYRA 2NNYA 2HKOA 2X9DA 2GA2A 3BCAA 4LLGF 2HNHA 3KETA 2ZXHA 3FXQA 5J8CA 2MH9A 5BPIA 3CUQC 5CQGA 1YJ9I 2OAZA 2NYXA 2BY0A 2DMNA 1OKRA 1T6SA 5K7ZA 3CF5F 2NXNB 1MD0A 4PCQA 4FE7A 2JA5J 2DT6A 5LRRA 1S3JA 3B02A 3PUBA 2W1OA 3QU3A 2X1DA 3HDDA 3T0YA 4GYIA 4CCOA 1YTYA 2IS2A 4NB5A 3M9AA 3WHCA 2Y9YA 2RC4A 4DOZA 2EH3A 2EIJH 2E7XA 1UCRA 1EV7A 4BXUA 4A0XA 3M1CA 1MW7A 4YIIA 1ODDA 2MBFA 3GLXA 3MQ0A 4JOMA 4E6KG 2X6OA 4LITA 4RB0A 3EPZA 4LG0A 1I3QJ 1FYLA 4E4HA 3J81K 1ZYRF 4H4KC 3CD6I 2E5NA 3H3VK 3NEUA 5HLIA 4IO9F 4KFCA 1JKRC 2V4JC 4A5NA 4F91B 4F92B 2CV2A 3OYLA 4P9UA 2W25A 2LSOA 3KP5A 2JTVA 1R7JA 4M6VA 4Y52J 2VBWA 2L9NA 2ECBA 2IP2A 3LQQA 1QHGA 3CTAA 4OIOF 2PN6A 3BR6A 2F4MB 2BZTA 1BW6A 4WX9A 3K9TA 3DQVC 1WJCA 5ERIA 2A05A 2COBA 3ZQIA 1BL0A 2EIMH 2RN7A 3AG1H 3JCUC 1K7AA 1QRYA 1X3WB 1FOYA 2O7OA 2VJ5A 2IW5A 4MQ9F 2BEOA 3VSLA 5E3LA 2RREA 3OY9A 4D1QA 1ZKGA 3KYDB 3IKVA 5IOZA 1B72B 3KPHA 2HXIA 1MMAA 4BEHA 2K86A 4IXAA 3DTEA 2PG4A 3FX3A 2XKPA 4CYCB 2E1MB 2G9WA 2HKXA 2B9SA 1YI2I 2QCOA 3EUAA 3MKYB 1SANA 1YW7A 4FT8A 1UMQA 3KE2A 1VI0A 1OCRH 3CMEI 3J7ZI 3F8MA 4ZDOA 3O3KA 5DUIA 3GX4X 1GVJA 4HAMA 2JRMA 1RIOH 3L09A 1YLFA 3Q0UA 4C3JJ 3GTLJ 4LOCA 4MTEA 3WTXC 3TP0A 1JI8A 3D5LA 4CH7A 1Z91A 4G6DA 1KA8A 2Z16A 2W48A 3HOZJ 1AWCA 1R4MB 2ZB9A 1PP8F 4Q48A 5E17F 3TO6A 2O03A 3OYKA 4XMYA 2QQ9A 1LJ9A 2DJIA 1NG6A 4CCNA 3DXJF 2RQPA 1YG2A 3F9KA 5A2QZ 3DBHB 2P7VB 1I39A 1IGNA 3DWLE 1YE9A 3WGHA 4N0BA 5HLGA 3CZ6A 2FJ1A 3DTIA 4G7OF 5LD2C 3KEYA 3I4PA 3MKLA 5F0FA 2I8DA 4JK1X 4BQNA 1FSHA 3KP3A 2VQLA 3QRFF 2IGKA 4M9SA 3SQNA 2W00A 2DMUA 3KP6A 2P8TA 4ESBA 5J4YA 2KDZA 3KCCA 2WTEA 5BNGA 1IAWA 4XKWA 2BY2A 2MSYA 4PJMA 5CYVA 1NTCA 2VOOA 3S3OA 1V5FA 1IRGA 4YELA 1CF7B 4N4NB 3K2AA 1OMIA 3I0TA 3BG9A 1A36A 1R5GA 2XAFA 5A2QK 2JMWA 1IF1A 2WV1A 2ZXIA 1IDZA 1E3PA 1TW2A 3V42A 2XGXA 2L3DA 4XORA 5E1WA 2M4KA 4IOCF 3SDBA 1MBEA 3I3LA 4C3IJ 3GLLA 1R71A 1MKMA 4FQGA 2PMZN 2VL8A 3A0BC 3IH2A 5D5WB 1M1EB 4WWCA 1X1BA 1X19A 4L0YB 4HV6A 1ZRDA 2DQRA 1MBJA 3CF2A 4BHCA 4RLFA 1E17A 1BM9A 3K6GA 2XF7A 4XLHA 3RZDJ 3ONQA 2AXLA 1HDPA 3DKYA 1FOKA 3HHHA 3I4NJ 2VQCA 3AAFA 2ZNYA 3N05A 3FHZA 2QQAA 1I50J 1DU6A 2K9LA 2CFOA 3PUFA 4HG2A 4L5JA 2LDUA 1IRFA 5CVRA 1T08B 3HEFA 2Q8KA 3JRAA 2GZWA 2R7OA 3U9GA 3A01B 1F43A 2AQFA 5ED4A 4EGZA 2O61A 3FBIB 2V26A 4MLOA 5F0CA 2W84A 5E18F 1JE8A 4RGRA 4CICA 1BC8C 2R7VA 1D0XA 4ZYAA 4XONA 2O0YA 2M1BA 2NAZA 1HQCA 1W7PD 4IRGA 4R1HA 3TW7A 4A3CJ 1TWHJ 3U21A 4IHVA 1NK2P 4WXDA 1TQMA 1TWFJ 1G3YA 5HS7A 1ONVA 3LAJA 3DCFA 1X1CA 5F1RA 5K1YA 5HDKA 2V1NA 3CCSI 2HR3A 5EEAA 2GWRA 4AU7A 2F5EA 2LKPA 1D8JA 3FHNA 3G1OA 5DD4A 1IO2A 1YYVA 3HYIA 4E7ZA 2HDCA 4OIRF 3PJRA 2WADA 2NVUB 3CCEI 3RDIA 2V1XA 3P9IA 2F48A 5GADJ 3GZ6A 4BJTA 3A03A 4XLAA 4KMFA 1YS6A 1X4OA 3PFIA 2KFDA 5LGTA 5FKNA 1UHWA 5L3GA 4JYKA 2YS9A 1NHAA 5FGMA 3VEPA 1JJ8C 1H88C 3LOCA 1ORKA 1B72A 4LB5A 4O3MA 4I0AA 1MBFA 1YW8A 2QWWA 3E97A 5KCMA 4ZZDA 4YRVA 3HB9A 1I6XA 1LDKB 2M0MA 3RPUD 4CYCA 3M4OJ 2QSHX 2EQRA 4EGYA 1IRXA 3VYRB 4J19A 3JRCA 1JHFA 3O8GA 4FASD 4RAGA 1KONA 1X58A 1OLTA 1TL8A 1QNTA 4D5CA 4EJOA 1WHUA 2ETHA 3PIOF 1E3OC 1ON2A 5ICGA 1ENHA 1LDDA 2I10A 2O3FA 2V1DA 3HOSA 3B6AA 2HI3A 3BR0A 2ADUA 3ZMTA 2L5QA 3TO9A 2OZ6A 5JHFA 2OJED 1KU2A 4XIDA 2GOMA 1WCMJ 2FMYA 4CCMA 4JBAA 1IUFA 3IRQA 1Z7UA 3HL2A 4AUXA 5IY5H 1B1BA 3DPUA 3KP4A 2IXSA 4ENMA 1K79A 3HSRA 3CP2A 4CZCA 2KIUA 3HOVJ 1O3TA 4BAYA 1X2NA 5HS9A 3V8LA 1Q1VA 4MEYF 5M5XJ 2VXZA 5HLHA 4NC8A 4BH9A 3SHFA 2H09A 3HIFA 2NRAC 3WGIA 4U0YA 1TNTA 4ANJA 3Q9VA 4JP0A 3BQZA 3E5QA 1D0YA 3KIOA 2AXTC 1X1DA 4XLFA 2K02A 5HDNA 3MKZA 2UXXA 5HNFA 2VUMJ 2PI0A 3OIQA 1BA5A 3FKIJ 5J40A 4BHPA 4KICA 1CF7A 5HDGA 2PX9A 1DP3A 3ML6A 1VQOI 1SFOJ 4P96A 4BQOA 2EFPA 2N8GA 3A1YA 4XN0A 4E70A 1LUJB 5J6XA 2LY9A 1TNSA 5KK1A 4M3EA 5J47A 2RDPA 1AU7A 4UY8I 3A0HC 1O3SA 4P9FA 1FIAA 3BZKA 5LEKA 2JPBA 4K2EA 5IT9K 4ZJZA 1UHMA 2AHQA 4X0GA 1L0OC 2ZCWA 1KU9A 3BP8A 4BE2A 1LEAA 4RAFA 5J1RA 4S05A 2L7MP 3HBLA 2HQNA 2HDWA 2M34A 2ZO4A 4RDUA 1SC7A 3I4MJ 3H3UA 3I53A 3Q9SA 1Y39A 3F0CA 3S17J 5E3NA 1UAAA 3W6KB 3E0JB 2W85A 3SZPA 4LIUA 1YHQI 3FMSA 1Z3XA 3FXJA 1T8IA 3S3NA 1QVTA 2XSJC 1H0MA 3D1NI 1UG0A 3A01A 3G6EI 1EKEA 3GCMA 3K4JA 3KEOA 2FOWA 2A5WA 4AC0A 1QZYA 3M1EA 1REPC 2HXOA 3RQ4A 3MAJA 5EEGA 2VPLA 4M71A 2H8WA 1Z21A 3WTZA 3H5NA 3C2HA 4J01A 2DAOA 2R7FA 5DD8A 1DDNA 2X1CA 1G8XA 2MGQA 1IN8A 2JWTA 2GM4A 4XRMA 2G7UA 3PNVA 2EINH 5GPAA 4BJ6C 3GZNB 3L2WA 1W36C 3K1PA 4G8XA 2DOEA 2BE5F 1FYMA 2BXZA 3OIOA 2UXNA 2EFNA 4P5OA 1LB2A 2XGDA 1J09A 4RM2A 1IXSB 1MZBA 3EUHC 3WU1B 1FLIA 3BG5A 2H1LA 3RJPA 5ILVA 1N75A 1BIBA 4XL9A 1P6RA 2M0CA 4EM2A 3TOBA 2YX4A 4JQFA 4HDUA 2XKOA 4M3GA 3S2WA 3D5RC 2DT5A 3WE3A 1KQ8A 1OYIA 1W5CC 1VQNI 1ZRFA 3OOPA 3BQYA 3GW2A 1V54H 2ZMEB 4LD5A 4XSXF 2RQQA 3PL8A 4IHYA 2XV4S 5LLQA 4A3EJ 2GLOA 5DM7F 3GFIA 2XRNA 1D5VA 2F5VA 2QQBA 2ISZA 5TISC 1WZ2A 4RMNA 3S8PA 3CCQI 1K4TA 5F6FA 1A35A 1OR7A 2HVQA 3BC8A 4ABZA 2LR8A 4I6ZA 3ERMA 4UVBA 5FLVA 2RNGA 1SD6A 2GXAA 2J5PA 2VT2A 2ME0A 2X85A 5LHIA 4IJAA 3FK7A 2FBIA 2CWEA 3E6DA 5HLTA 2BGCA 5DCMB 3L1PA 5FLXK 1ZH5A 2HTSA 2HPIA 4GYGA 2KHMA 5GTHC 3CCVI 2BY1A 1J7KA 3OS1A 2VBZA 3AKZA 2L4AA 1T56A 4AM3A 5FKLA 4Y3OA 1T0FA 2H27A 1HW5A 3IRRA 3V7CA 1W5SA 4ITVA 3HGGA 2CFXA 3GMEA 3RIRA 4UB8C 3L2UA 3S2HJ 3REOA 1IJWC 1XN7A 4GCVA 4E7IA 1TT5B 1Z6RA 2E1CA 5M3MJ 3OL4A 1N25A 2QEXI 3LFKA 3LSMA 3ZQHA 2QVOA 1JT0A 3HOUJ 1P7IA 1TZLA 4QIWN 1Z77A 1X3ZB 3UR3C 2XC7A 3OYIA 2A61A 1J9IA 1A31A 3PSIA 1FEXA 4UVCA 3GUDA 3VSKA 2DLLA 3GFMA 4PFPA 5AIPA 1T98A 3BDDA 1BIAA 3LSKA 4L9NA 4N4OB 2H94A 2HOAA 2QM3A 2VBXA 2PEXA 1YITI 2HOEA 3FWEA 2XROA 2WY7Q 3HPHA 5E8IA 5DYMA 3CC7I 5EZGA 3OIPA 1SVMA 4XNFA 4PGGA 3OYFA 5CVUA 2DA5A 3G73A 1MJAA 1U6GA 3AL0C 4C30A 2JA2A 4CZZA 1FX7A 3VWBA 4IL6C 2DN0A 2JJ7A 4AVZA 2GIZA 5KHDA 1ACIA 1K61A 1KU3A 1GV2A 3ASNH 3K4LA 4PSXA 3FM5A 1G3WA 3DU5A 2ZSHB 2JA7J 3G1LA 5C3EJ 1ZHFA 1VQ6I 1XMKA 2Z3YA 5JFRA 2G7HA 3GTGJ 2WC2A 3IAS2 3SFIA 3NRVA 1X1PA 5AONA 2M2EA 2WWYA 1KU7A 3V8JA 1VTNC 3HRMA 3AFHA 4RB2C 2OA4A 4A93J 3G2BA 1Y1WJ 1TTYA 4R8HA 2VJJA 3FXUA 5ILUA 3ZQ7A 5BS6A 3L2QA 4D5FA 1MDMB 1P9QC 1JGGA 1GLNA 3FK6A 2XAGA 5J1YA 1WRJA 3HSEA 2R0QC 2E2JJ 3BZCA 1YX3A 2QA4I 2RKHA 1XCVA 3CUOA 2QYOA 1VZ0A 3F8FA 4C9YA 2VC0A 2KRFA 1FJLA 4DYCA 3HG9A 2CW8A 2KT0A 4M74A 2TDXA 3C3WA 4OINF 1PVEA 4CA0A 4H0EA 5BMZA 4LJZF 4F52A 4BL0B 1VQLI 2CQ7A 2WB1N 4U7BA 1QBJA 4XRFA 3PFYA 1IG7A 1QPIA 1ZGAA 2E60A 2MD5A 3CUQB 2ISYA 3RPUA 5J3LA 2DT7B 3G1MA 2QBYB 2IS1A 1MMNA 1OYWA 3DLAA 2L7KA 2H6BA 2OBPA 4I09A 3F3XA 1IXRC 1TW3A 2HWVA 3DBRB 1SAXA 4AYBN 4KJZA 5CJ9A 4Z2YA 5ICFA 3J81Z 1MIJA 2ZNZA 3GTMJ 2KJBA 3W3CA 4B09A 1IN6A 3MKWB 3JAMK 1W1WE 2JN6A 3DU6A 5FKOA 2F5FA 1LVKA 3RI4A 1SVLA 2R7DA 3H92A 2LRDA 1Z7LA 1KQ9A 2LF8A 1BI0A 1T95A 1VQ7I 1TWGJ 3SYTA 1D3YA 1VFCA 2NOGA 1FIPA 2MFZA 2XDVA 1JGSA 1WPKA 4II3A 2ZMEA 3DFGA 4Y7NJ 2DODA 3PO2J 4U7DA 3PQJA 3GYHX 3R0AA 5GAHJ 3RCOA 3ZN1A 4XICA 3KZYA 2CW0F 1MMGA 4BKXA 5LEJA 1DGWY 1J75A 1U5TC 3Q0WA 2VXDA 4HNVA 2D45A 4LFUA 4A0ZA 4ZDPA 3W2WA 1ZGJA 2XAJA 5DCMA 3COAC 2KRHA 2NS0A 4EV0A 4CCKA 2D1VA 1W4MA 1HC8A 2IJLA 1Y56A 3JSOA 3WTSC 3CMAI 1RR7A 5F27A 2CS3A 3GFLA 4L9JA 5JVGF 1ZG5A 2PJPA 1GT0C 2MA3A 3JRIA 1BR4A 4PK4A 4B3XA 2Y0MA 3BY6A 4JX4A 4RA2A 3QPSA 5IP7J 3V7SA 2Z5UA 5DDGA 3MEXA 2OZUA 2E19A 4EM1A 3CDLA 4HEA2 4L0ZB 2HGCA 3RYRA 3TQNA 3HRTA 1B9NA 2GIVA 2L4MA 3ZN0A 2ZFUA 3OYJA 1S9HA 4BDZA 3IC7A 2V7FA 1MBHA 1V3FA 2VQGA 5ICCA 3PO3J 2YPRA 2F2EA 3OYHA 2DJNA 5F1JA 2CRGA 1J0RA 1WJ5A 3E5XA 1Z9CA 4NNJA 3VOEA 3IH3A 1ZR4A 4XLEA 4Y4RA 4BNCA 4AIHA 4KIGA 4XRSA 3ZPLA 1B59A 4II2A 3O6BB 2IT0A 5CVIA 3HKZA 1ETVA 1N78A 2PMHA 4C2TA 1U9OA 1WQ2A 1RI7A 2V79A 3BCBA 2ZKZA 4BXXJ 1SAUA 3FIWA 4NC7A 1T2KA 4HSRA 1TQPA 3I54A 4ESJA 1P4XA 3VYTB 1MBGA 2OUMA 2DTZA 3OYDA 2QSGX 1SEUA 3CC4I 2GAUA 5TRDA 3B6CA 1BOBA 1FBUA 5K5RA 3TEDA 3BTJA 4UHTA 2ME6A 4AIDA 3GBGA 5EZHA 1JKPC 3AG4H 4IOAF 5H2FC 1WH7A 3QPTA 2K27A 1OQYA 3IAM2 3I59B 3EUKL 1MDMA 2B63J 5F04A 4ENNA 4QPQA 2P7CB 5KAFC 3C2GA 4XLPF 4ON0A 1T39A 2KIQA 3HXLA 2HQRA 4GXOA 2E71A 3SEQA 4B8XA 5L3FA 2A6TA 2EB7A 1VQPI 1QO0D 2LMDA 2K3PA 1MBKA 1R58A 1IW7F 3BT9A 2MLKA 1I27A 3HHGA 4ESFA 3JREA 3CUQA 4B1RA 1F36A 1SFXA 3T8RA 2CV1A 1FP2A 2QBYA 4DNCA 1OCOH 3FBNB 3JW4A 4LGWA 1QA6A 3QPHA 2FE3A 4NDLA 4WCGA 2L02A 1LE8B 5LHHA 3W6JB 1R1TA 5HS8A 5KAIC 4CDGA 1ETQA 1TQIA 5JI6A 1V55H 2ICWG 1U8RA 1YIOA 1K4SA 3IH4A 2KRCA 2D5VA 1FMVA 4XKVA 2LY2A 2NVXJ 3RKQA 2YX7A 3LL7A 1K6OA 2R5ZB 2MW8A 2IA0A 3BJ6A 3PIPF 5GPCA 1FPQA 1D1CA 2V9KA 3CCYA 2R92J 3E7LA 1O7LA 4V2GA 2VKEA 1HSTA 3SZTA 4HQEA 3ZGKA 2Y0SA 2KPMA 4RGUA 1O7FA 2KQRA 2HPMA 2V9PA 1JUPA 2OQGA 1HF0A 4DZJA 3SDGA 1H9TA 2WAFA 5KVRA 4FX4A 4TV7A 5FRMA 3H9JA 1AKHB 1A6QA 2O6GE 5C4XJ 2VQHA 5BQTA 1TLHB 3ULQB 4RS8A 2WA0A 5JVTA 2HZTA 1FBQA 4A3GJ 2ZJQF 1CGPA 1XCBA 3QWLA 1VF9A 2XF5A 3BWGA 2CJJA 3S14J 4U87A 3KYLA 1HOMA 1ZELA 2Y69H 1EA3A 3LA2A 5FB2A 4UUSB 2R4GA 5H6RA 4AWXB 2F5CA 1SFUA 4XR6A 2XSDC 1GDTA 2UWMA 4WXHA 1F1ZA 1PP7U 1SVOA 4L18B 2DA1A 1ZQ3P 2EA2A 3S1MJ 2QUFA 4IVNA 4BQAA 3J80K 2P6TA 4NQWB 3K70C 5DV5A 1LVAA 3AG2H 1ZG3A 1ZREA 3E1SA 3OYEA 3MFKA 1VQ8I 2OTLI 4A3DJ 2JSCA 2DDAA 4IPAA 2FA5A 2M8EA 1DPRA 3ROUA 4A0YA 3PSFA 1TBXA 3U1DA 3H3ZA 3H0GJ 2A3SA 1AOYA 2LH9A 5J4VA 2DU9A 3V8KA 2GBYA 4HX7A 3IL2A 5EF6A 1EJ9A 1S29A 1W36D 4XKCA 4M6YA 2Z33A 3N4MA 2DMPA 2Y30A 4D7NA 2JVHA 2JRTA 4BQQA 4U88A 5K5QA 2HYFA 2OQRA 5FJ8J 2EV6A 2M5WA 2IRFG 5EDNA 4P1WA 5E1ZB 2K9MA 2HVRA 3ZMSA 3K4KA 1IN4A 2BY3A 4HOBA 4LK0F 3CCLI 1Z05A 3CO7C 1EH7A 3LMMA 2KISA 2V9VA 3JRHA 2FMLA 3PM1A 3B73A 4BS9A 1XB4A 1PJRA 5L3DA 3V4GA 1YS7A 1V4RA 3DTKA 2YSRA 3KLNA 2OV7A 1SD7A 3GZ5A 3MN2A 2L01A 2JA8J 3W6VA 2G0EA 3DKWA 4E7KA 1J2XA 3CESA 2CSOA 3DPLC 3LA7A 4Q4ZF 1ETXA 4EQQA 1Z6TA 1BW5A 3I5UA 2L54A 1ZTRA 4LLLA 1D1AA 1ZK8A 3TGNA 5IT9Z 2VKDA 4C3HJ 4FCYA 1B6AA 3LAPA 4B47A 4M9XA 1Y8QB 3RZOJ 4IF4A 2BW3B 3I59A 2EFQA 1MGTA 2MLGA 4IX7A 2K3FA 3BG3A 3WE2A 1WH5A 4OAYA 2VB6A 4AIKA 3JTGA 4A3MJ 2OCEA 2LOOA 2RGVA 3DP7A 2V6EA 3BR5A 2Y48A 3ZR8X 1ON1A 2JA6J 4HSTA 4ZZLA 4KT6A 4QPOA 3JRGA 2ZJRF 1FY7A 2FRHA 2FOKA 2IS4A 2W82A 4HPQA 1SD5A 2WV0A 3VYSB 5D4SA 5LBQA 5LRSA 2VOPA 1MJ9A 5HVQC 4M9ZA 2CQNA 3L2VA 4RAZA 2EZLA 2COMA 5D6EA 4B44A 3TMOA 1WWXA 1S6LA 2WBMA 2AO9A 1UG2A 5FD5A 3WTYC 3LSJA 5JLXA 1IRZA 1ETKA 1LE8A 1WI9A 4O5VA 4PGHA 4Y17A 5L3EA 5E8GA 4C2UA 5DS9A 1JKOC 1RR8C 4XBFA 1G59A 4C2MJ 3K1MA 5LGNA 4A3BJ 2R5ZA 4RGSA 2ZFWA 4M3BA 3GTQJ 1EF4A 4KUMA 4DZPA 1GV5A 4DQ2A 1TC3C 3ESWB 2OPTA 3VB2A 3K4CA 3NWTA 3JR9A 1XGMA 4UUVA 2VE8A 2D2WA 3EDPA 1BI3A 2KKOA 4A3KJ 1E2XA 2W4SA 2BVLA 4Y13A 4EEFG 1Z67A 1LEBA 4HNUA 1HA8A 4BY1J 1CQTA 2K5CA 2QLZA 1FWZA 4I02A 2WAEA 3E6CC 3V7RA 1O4XA 1AKHA 1IN5A 3ZMZA 2CV0A 5FKMA 2K4BA 4RBOA 1R5HA 3S1RJ 1YW9A 3BR2A 2LNBA 4HV5A 1BI2A 2FD5A 3K69A 3P5JA 3PNYA 2GA1A 4MHGA 3M07A 3G71I 2HEOA 2CQKA 2IAIA 1POGA 2ZSIB 4KMUX 4YFKF 4MQVA 5E3MA 5EYRA 4BUPA 4HA8A 3LA3A 3UKGA 1HW2A 4UUSA 5FD6A 4F7ZA 4A3LJ 2PQ8A 2IEKA 2LTPA 2R7RA 2Z1DA 5E79C 3HTUA 3QODA 2L7FP 5FLXZ 3S3MA 1HBXG 6PAXA 1MNDA 4NQWA 1F5TA 3S2DJ 5IYDJ 5DUKA 2XAUA 4MNUA 1QVUA 3CP8A 2WAQA 2CMPA 2F6CA 4OOIA 5AIQA 1FSEA 2IGMA 2P5LC 2F4OB 2KIFA 4YG2F 2KMUA 5BOXA 1I1GA 4IHSA 1X4PA 3GEZA 1FOXA 2EZIA 1QQIA 2VPRA 4CYDA 1B4AA 3FXLA 5K7HA 2DA6A 2AS5F 3OV8A 2K85A 2QKMB 1NK3P 3ZQGA 2M7AA 2WB1A 3VODA 4ZTFA 5JR3A 4LK1F 2DBBA 3C2BA 1B8IB 3R60A 4MIMA 3HOTA 1A6IA 3C1DA 5C4JJ 3ZQFA 1S7EA 2VBYA 5HODA 4GRIA 3ZQLA 5GAGJ 2KLOA 4QTRA 1JKQC 3WG7H 1I3AA 1LNWA 3FKJA 1QPMA 4G9YA 4XK4A 2IGOA 4UNOA 4DBQA 1ZR2A 3JRDA 3WTVC 4RGXA 3RKXA 1BJAA 3TL4X 4XLNF 2HTJA 3DEWA 3TW6A 2LBFB 3LQRA 3BPXA 1HDDC 4DW6A 3AL0B 1WJFA 3OSFA 2E5ZA 1YJWI 2EJRA 2L9SA 1X1AA 3QYFA 2DI3A 5IYCJ 3G3ZA 4LLNA 1BI1A 4HF1A 2M45A 3IWZA 3I58A 3CCUI 1QZEA 1BBYA 5J8FA 2BW3A 2JUCA 4HF0A 1S7AA 2KIMA 3K4MA 4HYEA 3K0LA 5CQEA 1STZA 2JQ7A 1JXSA 1XSVA 2TCTA 4JX6A 4X6AJ 3HOYJ 2K7LA 2BV6A 4BGDA 1UB9A 3N97A 5JLWA 2E36A 5M5WJ 1FYKA 1QU3A 3IV5A 2NVTJ 4HX4A 3CLQA 3H9GA 1S8NA 1R5ID 1AA7A 1ITYA 3T5XA 1HCRA 4DYQA 1I1SA 2ZJ2A 2OF7A 4YIFA 2C6YA 4FE4A 2LKXA 3FDYA 2DDBA 2K40A 2F4IA 1G3SA 2XUBA 3HTSB 2A6EF 1WKMA 2XF6A 3AG3H 3K7AJ 4L5EA 5E3OA 4BDYA 2QF7A 3DPTA 3GTKJ 3EQLF 1K78A 1R36A 1OCCH 4B3AA 4BE1A 5F08A 4ASNA 2BBYA 4UVAA 3Q3SA 2VODA 1OCZH 3F22A 2VLAA 2BXYA 3ZP5A 3J7AY 4FTHA 4MFDA 3Q5FA 2Z9OA 4D0PA 3FMRA 3K2ZA 2HYGD 2LG4A 3CLOA 4LIVA 4I01A 1D5YA 4CSWA 3KZIC 3JAMZ 3WU0A 2P5VA 5E20A 2XRLA 4Q47A 2O8XA 3ASOH 4W97A 3F23A 3OMYA 4PJ0C 2XGCA 3E3VA 2V6CA 3CCRI 2X4HA 3F8NA 3OWTA 1MMDA 3BJOA 1RNLA 1EH8A 4F93B 4A12A 4EJVA 5HNHA 2EILH 1PUEE 1VQ5I 3CCMI 3QPLA 3PNTA 3HOXJ 4M3FA 1YFHA 3BOQA 3F21A 4IEJA 4B48A 2JZYA 4XKBA 1UJ8A 2HOTA 3BTIA 1UFMA 4QWQA 3TO7A 3EUHA 3OYBA 4KIFA 1H89C 3GVAA 3LSGA 4A69C 1D1BA 2E1OA 5D6FA 3QOPA 3G4SI 2UUZA 3JTHA 4BY7J 3I9V2 4G7HF 4X1EA 5GAEJ 4BBSJ 5FROA 3FXKA 3QP6A 2XB0X 4DIQA 3LSRA 1R23A 5DM6F 1GHCA 4EATA 2P6SA 2O9LA 2VN2A 2EA4A 3SFZA 3K4BA 3OS2A 4YFXF 3ABTA 3T1BA 2XGEA 2L9RA 5IP9J 3I64A 3HJEA 4KN4X 4DGWB 5D5UB 2R7QA 4XQFA 1U5TB 4CXFA 1RKWA 4ZYGA 2L0KA 2OTJI 3CMMA 5D5XB 2DA3A 3CCJI 1Y0UA 4IRHA 2Q1ZB 1FBSA 5B1BH 2LYCA 2E2IJ 1MJBA 1FTZA 3IUOA 4AVPA 3TDZC 3QQAA 3BR1A 3BZ6A 3TOAA 1LPQA 2XPWA 2P4WA 1Y8RB 2HFHA 3CJTB 1IUYA 2NOJB 1U9NA 3DV8A 2VONA 4WF2A 1B8IA 1C0WA 4NUBA 3QYEA 2PMZA 3CJQB 1F9NA 4FHTA 2RNJA 3OYCA 2XVCA 1JJ6C 3BLYA 1SFKA 4EM0B 5H6QA 4A3IJ 2H8RA 5LGUA 1VQMI 4FX0A 4UUTA 4NBQA 4I7HA 2DFIA 3UNGC 2B7EA 4W1UA 3WU2C 4E7HA 2RV8A 4PJLA 2DXIA 4JX5A 5CVVA 4ZYHA 1QGPA 1LFBA 3J7YJ 2UV1A 2Y31A 2ACJA 2LF7A 2FX0A 3BR3A 3LFUA 3BG7A 3MMYB 2XAQA 2K9NA 1KYZA 2LBFA 1O57A 4LG3A 4HQMA 3GTJJ 5L3CA 2X51A 4G12A 2QGUA 4ZYDA 1L3LA 4L9TA 2O8KA 2JVGA 3VYUB 3NAUA 5B5EC 3HM5A 1MSEC 4XN3A 2KJCA 1XSDA 2DTRA 2QSFX 3K70D 4F3QA 1TWAJ 2M3AA 2QZ8A 3KX2A 2PMUA 3IHUA 3KP7A 4PUSA 2P0WA 1G2HA 4O6JA 5IPAA 1ZGWA 4KISA 5IT3A 5D8LB 4KA4A 4BACA 4PZJA 3KP2A 4EMSA 4IQJA 4GO1A 1XGNA 2E1MC 2YU9J 2ZJPF 2LFBA 3H5RA 4IRIA 2DOFA 3MWMA 2X6YA 1UHSA 2FNPA 2FUG2 2DPDA 2XHKA 3LSPA 1NG7A 3OYNA 3H0DA 3ZMVA 4B4CA 1XMXA 3H36A 3CMYA 1UELB 3WHBA 4RM3A 2H6CA 3MZHA 1AHDP 2TRTA 2EK5A 1W5TA 3M3YJ 2QENA 1LDJA 2JUGA 3ERED 3I55I 1BJZA 2XPVA 4V19K 1RESA 1FTTA 2Z99A
chains in the Genus database with same CATH topology
1HSJA 3R6SA 1ZRCA 1FC3A 2MC3A 4A5MA 3J7AO 1ZAOA 2DW4A 2JPCA 3M8EA 1ZARA 2PFBA 2VE9A 3RKWA 3HRSA 4AD9A 3WTTC 1J5YA 1I5ZA 2ESHA 3O2PE 2CO5A 1SMTA 4RB1A 2Y75A 4Y15A 3ZMUA 3KFWX 4R79A 1WSUA 4ENKA 2PBIA 3C18A 3RYPA 1IZ1A 1Q1HA 4BYYA 3FXRA 5HOOA 4U0VA 4HDVA 2FSWA 3D0SA 3J80Z 3DEUA 2XIGA 3QU6A 1DP7P 2A6HF 2MH2A 1KQ0A 1U5TA 1SD4A 4ENJA 1BC7C 3FF5A 2RVCA 4Q5SF 4OIPF 1XSXA 1FZPB 3IKTA 1PDNC 4NHJA 1XGSA 3PQKA 5BPDA 5CLSA 1S7OA 1YO5C 3BJAA 2D1HA 1IXCA 1P92A 1XD7A 4KN7X 4RB3C 3T8TA 2STTA 2EFOA 3WTWC 2PLYA 4ETSA 3P9CA 3CO6C 4KIBA 2A68F 4HLYA 3TKYA 1USTA 1USSA 3MCZA 3QAHA 1RUNA 1R00A 3F8CA 4HZFA 1G3TA 3L9FA 2Q0OA 3GF2A 1P4WA 2NNNA 5DEQA 4LMYA 1T38A 1R1VA 3MZYA 1KYWA 2IA2A 1P2FA 3GFJA 2E7WA 3WODF 4I2OA 2JT1A 1ULYA 1XGOA 2FBHA 4PDKA 3L00A 2K4JA 4P55A 2BYVE 2FU4A 4OMYA 4U0WA 4ZYEA 2EWNA 5LHGA 3FM3A 1OYYA 3R4KA 4RAYA 3BPVA 4HF2A 3RKYA 3F8BA 3RTRA 5JHUA 1U78A 2ESNA 1G6NA 4HW0A 2IA1A 2XASA 3GWZA 2E1NA 1A04A 4MGRA 4IHTA 3CDHA 1O3RA 3M7GA 4S04A 4QLCU 4I0BA 1HKQA 1DPUA 3I71A 1FP1D 1XMAA 3E6MA 3E5UA 1K78B 3LSTA 1B9MA 2FBKA 2OU2A 4OIQF 1W7PB 2J5OA 2A07F 3R61A 4EJWA 1HKTA 1BOAA 2A5YB 2STWA 2GQQA 1YQAA 3FMQA 1BN5A 2UZKA 3LWFA 5L3BA 3L7WA 4M6XA 2FF4A 3JSPA 3WTUC 2YU3A 3VFZA 2V1UA 3IWFA 1G4DA 1HKSA 2M87A 5F64A 2VC1A 3NQOA 2CG4A 3TDUC 4A2UA 1X3UA 3ELKA 4MEXF 3EYYA 2R3SA 1SMYF 3ZMDA 2M30A 4UXNA 4XSZF 4LB6B 5DCFA 4G94A 4CO8A 2GXGA 4YFNF 2DPUA 3DF8A 1J59A 4MTDA 3K1NA 1XDUA 3GO5A 1U2WA 4N9HA 2Q2EA 4G6QA 3WGGA 2FEZA 1EH6A 1ZG1A 4KNYA 3F6VA 5E1XA 2W57A 5FFZA 2EV5A 2B0LA 4WK8F 1HW1A 4HLXA 4L5IA 1SFEA 2DK8A 2DO7A 3KEQA 2ELHA 2GXBA 4LG0B 5EEHA 1QZZA 3SXYA 1FT9A 2YR2A 4CGZA 3HSFA 3F6OA 4AIJA 4WXCA 4EJUA 2CGPA 3EETA 5TJJA 3M8FA 1GXQA 2DQLA 3ECOA 2EFWA 4CHUA 4EJTA 1Z1DA 3FZVA 4I98B 5CVJA 2IVMA 1R22A 4M72A 5D8KB 4M73A 1KGSA 4KT5C 3RPQA 3F72A 2FXAA 1XDSA 3HUGA 3EYIA 5D5VB 1DUXC 2FNAA 1FNNA 2X0LA 1ZN2A 2F5DA 3ECHA 5FO5A 1U3EM 3BROA 1IN7A 3ABUA 1D8KA 1P4AA 2A69F 3P9KA 4KDPA 4ZH4F 5ICEA 1RUOA 1O3QA 3GXOA 1LQ1A 2IPQX 5K5OA 4EVIA 2CYYA 3QP5A 4UV8A 2DK5A 3WG9A 3C7JA 4L9VA 4HX8A 1R1UA 2XAHA 1W7PA 2P5KA 1GXPA 4N9IA 2FQ3A 5ILSA 2W24A 3ISPA 1OPCA 4UV9A 1F4KA 4BHBA 1HXDA 3U2RA 1ZLJA 4A6EA 2OD5A 4OU0A 2HS5A 2ZBKA 3L2CA 2ZXJA 2VT3A 5FFXA 3R0JA 1JHHA 1H9GA 5D4RA 4G7ZF 3HRUA 2EV0A 5H20A 4A6DA 1RZ4A 4OMZA 4GGGA 3P7NA 4HBLA 3CJNA 3KZZA 3E6BA 1ZLKA 4KYWA 3KLOA 2NNYA 2HKOA 2GA2A 4LLGF 3KETA 3FXQA 5J8CA 2MH9A 5BPIA 3CUQC 2OAZA 2NYXA 1OKRA 1T6SA 4PCQA 1MD0A 5LRRA 1S3JA 3B02A 3QU3A 3T0YA 4GYIA 1YTYA 4NB5A 3M9AA 2RC4A 2E7XA 1UCRA 1EV7A 4BXUA 4A0XA 4YIIA 1ODDA 2MBFA 3GLXA 3MQ0A 4RB0A 4LG0A 1FYLA 3J81K 1ZYRF 3NEUA 5HLIA 4KFCA 4A5NA 4P9UA 2W25A 2LSOA 3KP5A 2JTVA 1R7JA 2VBWA 2IP2A 3LQQA 3CTAA 4OIOF 2PN6A 4WX9A 3K9TA 3DQVC 5ERIA 2RN7A 1K7AA 4MQ9F 2IW5A 2BEOA 3IKVA 2K86A 4IXAA 2PG4A 3FX3A 2XKPA 2G9WA 2HKXA 1YW7A 4FT8A 3KE2A 3F8MA 3O3KA 5DUIA 3GX4X 1GVJA 4HAMA 1RIOH 3L09A 1YLFA 4MTEA 3WTXC 3D5LA 1Z91A 4G6DA 1KA8A 1AWCA 1PP8F 4Q48A 5E17F 3TO6A 2O03A 2QQ9A 1LJ9A 3DXJF 2RQPA 1YG2A 5A2QZ 2P7VB 3WGHA 4N0BA 5HLGA 4G7OF 3I4PA 4JK1X 1FSHA 3KP3A 3QRFF 4M9SA 3SQNA 3KP6A 2P8TA 4ESBA 3KCCA 2WTEA 1IAWA 5CYVA 2VOOA 1IRGA 1CF7B 1OMIA 3I0TA 1R5GA 2XAFA 5A2QK 1IF1A 1TW2A 2XGXA 2L3DA 5E1WA 1MKMA 5D5WB 4WWCA 4L0YB 4HV6A 1ZRDA 2DQRA 4BHCA 1E17A 1BM9A 2AXLA 1FOKA 3HHHA 3AAFA 2ZNYA 3FHZA 2QQAA 4L5JA 2LDUA 1IRFA 5CVRA 2Q8KA 2GZWA 3U9GA 5ED4A 4EGZA 2O61A 2W84A 5E18F 1JE8A 4RGRA 4CICA 1BC8C 2O0YA 2M1BA 2NAZA 1HQCA 1W7PD 4IRGA 4R1HA 4WXDA 1TQMA 1G3YA 5HS7A 1ONVA 3LAJA 5F1RA 5K1YA 5HDKA 2HR3A 2GWRA 2F5EA 2LKPA 1D8JA 5DD4A 1YYVA 3HYIA 2HDCA 4OIRF 3RDIA 2V1XA 3P9IA 3GZ6A 4KMFA 1YS6A 3PFIA 5LGTA 1UHWA 5L3GA 5FGMA 1NHAA 3VEPA 4LB5A 4O3MA 4I0AA 1YW8A 2QWWA 3E97A 4ZZDA 1I6XA 1LDKB 4EGYA 1JHFA 1QNTA 4EJOA 2ETHA 1ON2A 5ICGA 1LDDA 2O3FA 2V1DA 3HOSA 2ADUA 3ZMTA 3TO9A 2OZ6A 1KU2A 2FMYA 4JBAA 3IRQA 1Z7UA 1B1BA 3KP4A 4ENMA 1K79A 3HSRA 2KIUA 1O3TA 4BAYA 5HS9A 3V8LA 4MEYF 2VXZA 5HLHA 4BH9A 3SHFA 2H09A 3HIFA 2NRAC 3WGIA 4U0YA 1TNTA 3Q9VA 3E5QA 2K02A 5HDNA 2UXXA 2PI0A 4BHPA 4KICA 1CF7A 5HDGA 3ML6A 4P96A 2EFPA 4E70A 5J6XA 1TNSA 5KK1A 2RDPA 1O3SA 4P9FA 5LEKA 2JPBA 4K2EA 5IT9K 1UHMA 1L0OC 2ZCWA 1KU9A 3BP8A 1LEAA 4S05A 2HQNA 2ZO4A 3H3UA 3I53A 3Q9SA 3W6KB 2W85A 3SZPA 3FMSA 1H0MA 3KEOA 1QZYA 3M1EA 1REPC 3MAJA 5EEGA 4M71A 3WTZA 2DAOA 2R7FA 5DD8A 1DDNA 1IN8A 2G7UA 3K1PA 4G8XA 2BE5F 1FYMA 2UXNA 2EFNA 4P5OA 1LB2A 1IXSB 1MZBA 3WU1B 1FLIA 3RJPA 5ILVA 1BIBA 1P6RA 4EM2A 3TOBA 2YX4A 4JQFA 4HDUA 2XKOA 3S2WA 3WE3A 2DT5A 1KQ8A 1OYIA 1ZRFA 3OOPA 3GW2A 2ZMEB 4LD5A 4XSXF 2XV4S 5LLQA 3GFIA 2XRNA 1D5VA 2QQBA 2ISZA 5F6FA 1OR7A 4UVBA 1SD6A 2J5PA 2VT2A 5LHIA 4IJAA 2FBIA 2CWEA 3E6DA 2BGCA 5DCMB 5FLXK 1ZH5A 2HTSA 4GYGA 1J7KA 2VBZA 2L4AA 1T0FA 2H27A 1HW5A 3IRRA 3V7CA 1W5SA 2CFXA 3RIRA 3REOA 1XN7A 4GCVA 1Z6RA 2E1CA 3LFKA 2QVOA 2A61A 1J9IA 4UVCA 3GUDA 2DLLA 3GFMA 5AIPA 1T98A 3BDDA 1BIAA 4L9NA 2H94A 2QM3A 2VBXA 2PEXA 2HOEA 3FWEA 2XROA 5E8IA 5DYMA 4PGGA 5CVUA 3G73A 1MJAA 1U6GA 4CZZA 1FX7A 1KU3A 3FM5A 1G3WA 1ZHFA 1XMKA 2Z3YA 5JFRA 2G7HA 2WC2A 3NRVA 5AONA 2WWYA 1KU7A 3V8JA 1VTNC 3HRMA 4RB2C 2OA4A 1TTYA 4R8HA 3FXUA 5ILUA 3ZQ7A 5BS6A 1MDMB 2XAGA 1WRJA 3HSEA 2RKHA 1XCVA 3CUOA 2QYOA 3F8FA 2VC0A 2KRFA 4M74A 2TDXA 3C3WA 4OINF 4H0EA 5BMZA 4LJZF 4U7BA 1QBJA 4XRFA 1ZGAA 2MD5A 3CUQB 2ISYA 3RPUA 2QBYB 1OYWA 2H6BA 2OBPA 4I09A 3F3XA 1IXRC 1TW3A 2HWVA 1SAXA 5CJ9A 4Z2YA 5ICFA 3J81Z 2ZNZA 2KJBA 4B09A 1IN6A 3JAMK 2F5FA 3RI4A 2R7DA 3H92A 1KQ9A 2LF8A 1BI0A 1D3YA 1JGSA 2ZMEA 3DFGA 4U7DA 3PQJA 3GYHX 3R0AA 3ZN1A 3KZYA 2CW0F 5LEJA 1J75A 1U5TC 2D45A 4LFUA 4A0ZA 1ZGJA 2XAJA 5DCMA 3COAC 2NS0A 4EV0A 2D1VA 1W4MA 2IJLA 3JSOA 3WTSC 3GFLA 4L9JA 1ZG5A 2PJPA 2MA3A 2Y0MA 3BY6A 3V7SA 2Z5UA 5DDGA 3MEXA 2OZUA 4EM1A 4L0ZB 2HGCA 3RYRA 3TQNA 3HRTA 1B9NA 2GIVA 2L4MA 3ZN0A 3IC7A 1V3FA 5ICCA 2YPRA 2F2EA 1J0RA 3E5XA 1Z9CA 3VOEA 4BNCA 4AIHA 4KIGA 3ZPLA 1B59A 3O6BB 2IT0A 5CVIA 2PMHA 1WQ2A 1RI7A 2V79A 2ZKZA 1T2KA 1TQPA 3I54A 4ESJA 1P4XA 2GAUA 5TRDA 1FBUA 5K5RA 4UHTA 3QPTA 2K27A 3I59B 1MDMA 4ENNA 2P7CB 4XLPF 4ON0A 1T39A 2HQRA 4GXOA 4B8XA 5L3FA 2EB7A 1QO0D 1R58A 1IW7F 2MLKA 1I27A 3HHGA 4ESFA 3CUQA 1SFXA 3T8RA 1FP2A 2QBYA 4DNCA 3JW4A 4LGWA 3QPHA 2FE3A 4WCGA 2L02A 5LHHA 3W6JB 1R1TA 5HS8A 4CDGA 1TQIA 5JI6A 1U8RA 1YIOA 2YX7A 1K6OA 3BJ6A 2IA0A 1FPQA 1O7LA 1HSTA 3SZTA 4HQEA 4RGUA 1O7FA 2OQGA 1H9TA 5KVRA 4FX4A 4TV7A 2O6GE 5BQTA 1TLHB 3ULQB 4RS8A 5JVTA 2HZTA 1FBQA 1CGPA 1XCBA 3BWGA 3LA2A 5FB2A 1SFUA 5H6RA 4AWXB 2F5CA 2UWMA 4WXHA 1F1ZA 1PP7U 4L18B 2EA2A 2QUFA 4IVNA 4BQAA 3J80K 2P6TA 5DV5A 1LVAA 1ZG3A 1ZREA 3MFKA 2JSCA 4IPAA 2FA5A 2M8EA 1DPRA 3ROUA 4A0YA 1TBXA 3U1DA 3H3ZA 2A3SA 1AOYA 2DU9A 3V8KA 4HX7A 3IL2A 1S29A 4M6YA 2Z33A 3N4MA 2JRTA 5K5QA 4U88A 2HYFA 2OQRA 2EV6A 2M5WA 2IRFG 5E1ZB 3ZMSA 1IN4A 4HOBA 4LK0F 1Z05A 3CO7C 1EH7A 2V9VA 2FMLA 3B73A 1XB4A 5L3DA 3V4GA 1YS7A 1V4RA 2YSRA 3KLNA 1SD7A 3GZ5A 2L01A 3DKWA 1J2XA 2CSOA 3DPLC 3LA7A 4Q4ZF 4EQQA 1Z6TA 3I5UA 2L54A 4LLLA 3TGNA 5IT9Z 1B6AA 3LAPA 4M9XA 4IF4A 3I59A 2EFQA 1MGTA 2MLGA 3WE2A 4AIKA 3JTGA 2RGVA 3DP7A 2Y48A 1ON1A 4ZZLA 1FY7A 2FRHA 2FOKA 2VOPA 1SD5A 2WV0A 5D4SA 5LBQA 5LRSA 1MJ9A 5HVQC 4M9ZA 4RAZA 2COMA 5D6EA 1WWXA 1S6LA 5FD5A 3WTYC 1WI9A 4O5VA 4PGHA 4Y17A 5L3EA 5E8GA 4XBFA 3K1MA 5LGNA 4RGSA 2ZFWA 4KUMA 4DQ2A 3VB2A 1XGMA 4UUVA 2VE8A 2D2WA 3EDPA 1BI3A 2KKOA 1E2XA 4Y13A 1LEBA 2QLZA 1FWZA 4I02A 3E6CC 3V7RA 1IN5A 3ZMZA 2K4BA 1R5HA 1YW9A 2LNBA 4HV5A 1BI2A 3K69A 2HEOA 2GA1A 4MHGA 2CQKA 4KMUX 4YFKF 4MQVA 4HA8A 3LA3A 1HW2A 5FD6A 4F7ZA 2PQ8A 3HTUA 5FLXZ 1HBXG 6PAXA 4NQWA 1F5TA 5DUKA 4MNUA 5AIQA 4OOIA 1FSEA 2P5LC 2KIFA 4YG2F 5BOXA 1I1GA 4IHSA 3GEZA 1QQIA 4CYDA 1B4AA 2AS5F 3OV8A 3VODA 5JR3A 4LK1F 2DBBA 3R60A 3HOTA 3C1DA 2VBYA 1LNWA 4G9YA 1QPMA 4UNOA 3WTVC 4RGXA 3RKXA 1BJAA 4XLNF 2HTJA 3LQRA 3BPXA 2EJRA 2DI3A 3G3ZA 4LLNA 1BI1A 4HF1A 2M45A 3IWZA 3I58A 1BBYA 5J8FA 4HF0A 1S7AA 2KIMA 4HYEA 3K0LA 1STZA 1JXSA 1XSVA 2K7LA 2BV6A 1UB9A 3N97A 1FYKA 4HX4A 1S8NA 3T5XA 1I1SA 2ZJ2A 4YIFA 2C6YA 1G3SA 2XUBA 3HTSB 2A6EF 1WKMA 3DPTA 3EQLF 1K78A 1R36A 4ASNA 2BBYA 4UVAA 2VODA 3ZP5A 3F22A 3Q5FA 2Z9OA 4D0PA 3FMRA 3K2ZA 2HYGD 3CLOA 4I01A 3JAMZ 3WU0A 2P5VA 5E20A 4Q47A 2O8XA 3F23A 3E3VA 2V6CA 2X4HA 3F8NA 3BJOA 1RNLA 1EH8A 4A12A 4EJVA 1PUEE 1YFHA 3BOQA 3F21A 2JZYA 1UFMA 4QWQA 3TO7A 3EUHA 4KIFA 3GVAA 5D6FA 3QOPA 3JTHA 4G7HF 3QP6A 1R23A 1GHCA 2P6SA 2VN2A 2EA4A 3SFZA 4YFXF 3ABTA 3T1BA 3I64A 4KN4X 5D5UB 1U5TB 4CXFA 4ZYGA 5D5XB 1Y0UA 4IRHA 1FBSA 1MJBA 4AVPA 3TDZC 3BZ6A 3TOAA 2P4WA 2HFHA 1IUYA 3DV8A 2VONA 4WF2A 1C0WA 1F9NA 4FHTA 2RNJA 2XVCA 4EM0B 5H6QA 5LGUA 4FX0A 4I7HA 2DFIA 2RV8A 5CVVA 4ZYHA 1QGPA 2ACJA 2LF7A 2XAQA 1KYZA 1O57A 4HQMA 5L3CA 4ZYDA 1L3LA 4L9TA 2KJCA 1XSDA 2DTRA 2QZ8A 2PMUA 3IHUA 3KP7A 4O6JA 5IT3A 5D8LB 4KA4A 4PZJA 3KP2A 4EMSA 4GO1A 1XGNA 4IRIA 3MWMA 2FNPA 2DPDA 2XHKA 3ZMVA 2H6CA 3MZHA 2EK5A 1W5TA 2QENA 1LDJA 3ERED 2Z99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSJ A;  3R6S A;  1ZRC A;  1FC3 A;  2MC3 A;  4A5M A;  3J7A O;  1ZAO A;  2DW4 A;  2JPC A;  3M8E A;  1ZAR A;  2PFB A;  2VE9 A;  3RKW A;  3HRS A;  4AD9 A;  3WTT C;  1J5Y A;  1I5Z A;  2ESH A;  3O2P E;  2CO5 A;  1SMT A;  4RB1 A;  2Y75 A;  4Y15 A;  3ZMU A;  3KFW X;  4R79 A;  1WSU A;  4ENK A;  2PBI A;  3C18 A;  3RYP A;  1IZ1 A;  1Q1H A;  4BYY A;  3FXR A;  5HOO A;  4U0V A;  4HDV A;  2FSW A;  3D0S A;  3J80 Z;  3DEU A;  2XIG A;  3QU6 A;  1DP7 P;  2A6H F;  2MH2 A;  1KQ0 A;  1U5T A;  1SD4 A;  4ENJ A;  1BC7 C;  3FF5 A;  2RVC A;  4Q5S F;  4OIP F;  1XSX A;  1FZP B;  3IKT A;  1PDN C;  4NHJ A;  1XGS A;  3PQK A;  5BPD A;  5CLS A;  1S7O A;  1YO5 C;  3BJA A;  2D1H A;  1IXC A;  1P92 A;  1XD7 A;  4KN7 X;  4RB3 C;  3T8T A;  2STT A;  2EFO A;  3WTW C;  2PLY A;  4ETS A;  3P9C A;  3CO6 C;  4KIB A;  2A68 F;  4HLY A;  3TKY A;  1UST A;  1USS A;  3MCZ A;  3QAH A;  1RUN A;  1R00 A;  3F8C A;  4HZF A;  1G3T A;  3L9F A;  2Q0O A;  3GF2 A;  1P4W A;  2NNN A;  5DEQ A;  4LMY A;  1T38 A;  1R1V A;  3MZY A;  1KYW A;  2IA2 A;  1P2F A;  3GFJ A;  2E7W A;  3WOD F;  4I2O A;  2JT1 A;  1ULY A;  1XGO A;  2FBH A;  4PDK A;  3L00 A;  2K4J A;  4P55 A;  2BYV E;  2FU4 A;  4OMY A;  4U0W A;  4ZYE A;  2EWN A;  5LHG A;  3FM3 A;  1OYY A;  3R4K A;  4RAY A;  3BPV A;  4HF2 A;  3RKY A;  3F8B A;  3RTR A;  5JHU A;  1U78 A;  2ESN A;  1G6N A;  4HW0 A;  2IA1 A;  2XAS A;  3GWZ A;  2E1N A;  1A04 A;  4MGR A;  4IHT A;  3CDH A;  1O3R A;  3M7G A;  4S04 A;  4QLC U;  4I0B A;  1HKQ A;  1DPU A;  3I71 A;  1FP1 D;  1XMA A;  3E6M A;  3E5U A;  1K78 B;  3LST A;  1B9M A;  2FBK A;  2OU2 A;  4OIQ F;  1W7P B;  2J5O A;  2A07 F;  3R61 A;  4EJW A;  1HKT A;  1BOA A;  2A5Y B;  2STW A;  2GQQ A;  1YQA A;  3FMQ A;  1BN5 A;  2UZK A;  3LWF A;  5L3B A;  3L7W A;  4M6X A;  2FF4 A;  3JSP A;  3WTU C;  2YU3 A;  3VFZ A;  2V1U A;  3IWF A;  1G4D A;  1HKS A;  2M87 A;  5F64 A;  2VC1 A;  3NQO A;  2CG4 A;  3TDU C;  4A2U A;  1X3U A;  3ELK A;  4MEX F;  3EYY A;  2R3S A;  1SMY F;  3ZMD A;  2M30 A;  4UXN A;  4XSZ F;  4LB6 B;  5DCF A;  4G94 A;  4CO8 A;  2GXG A;  4YFN F;  2DPU A;  3DF8 A;  1J59 A;  4MTD A;  3K1N A;  1XDU A;  3GO5 A;  1U2W A;  4N9H A;  2Q2E A;  4G6Q A;  3WGG A;  2FEZ A;  1EH6 A;  1ZG1 A;  4KNY A;  3F6V A;  5E1X A;  2W57 A;  5FFZ A;  2EV5 A;  2B0L A;  4WK8 F;  1HW1 A;  4HLX A;  4L5I A;  1SFE A;  2DK8 A;  2DO7 A;  3KEQ A;  2ELH A;  2GXB A;  4LG0 B;  5EEH A;  1QZZ A;  3SXY A;  1FT9 A;  2YR2 A;  4CGZ A;  3HSF A;  3F6O A;  4AIJ A;  4WXC A;  4EJU A;  2CGP A;  3EET A;  5TJJ A;  3M8F A;  1GXQ A;  2DQL A;  3ECO A;  2EFW A;  4CHU A;  4EJT A;  1Z1D A;  3FZV A;  4I98 B;  5CVJ A;  2IVM A;  1R22 A;  4M72 A;  5D8K B;  4M73 A;  1KGS A;  4KT5 C;  3RPQ A;  3F72 A;  2FXA A;  1XDS A;  3HUG A;  3EYI A;  5D5V B;  1DUX C;  2FNA A;  1FNN A;  2X0L A;  1ZN2 A;  2F5D A;  3ECH A;  5FO5 A;  1U3E M;  3BRO A;  1IN7 A;  3ABU A;  1D8K A;  1P4A A;  2A69 F;  3P9K A;  4KDP A;  4ZH4 F;  5ICE A;  1RUO A;  1O3Q A;  3GXO A;  1LQ1 A;  2IPQ X;  5K5O A;  4EVI A;  2CYY A;  3QP5 A;  4UV8 A;  2DK5 A;  3WG9 A;  3C7J A;  4L9V A;  4HX8 A;  1R1U A;  2XAH A;  1W7P A;  2P5K A;  1GXP A;  4N9I A;  2FQ3 A;  5ILS A;  2W24 A;  3ISP A;  1OPC A;  4UV9 A;  1F4K A;  4BHB A;  1HXD A;  3U2R A;  1ZLJ A;  4A6E A;  2OD5 A;  4OU0 A;  2HS5 A;  2ZBK A;  3L2C A;  2ZXJ A;  2VT3 A;  5FFX A;  3R0J A;  1JHH A;  1H9G A;  5D4R A;  4G7Z F;  3HRU A;  2EV0 A;  5H20 A;  4A6D A;  1RZ4 A;  4OMZ A;  4GGG A;  3P7N A;  4HBL A;  3CJN A;  3KZZ A;  3E6B A;  1ZLK A;  4KYW A;  3KLO A;  2NNY A;  2HKO A;  2GA2 A;  4LLG F;  3KET A;  3FXQ A;  5J8C A;  2MH9 A;  5BPI A;  3CUQ C;  2OAZ A;  2NYX A;  1OKR A;  1T6S A;  4PCQ A;  1MD0 A;  5LRR A;  1S3J A;  3B02 A;  3QU3 A;  3T0Y A;  4GYI A;  1YTY A;  4NB5 A;  3M9A A;  2RC4 A;  2E7X A;  1UCR A;  1EV7 A;  4BXU A;  4A0X A;  4YII A;  1ODD A;  2MBF A;  3GLX A;  3MQ0 A;  4RB0 A;  4LG0 A;  1FYL A;  3J81 K;  1ZYR F;  3NEU A;  5HLI A;  4KFC A;  4A5N A;  4P9U A;  2W25 A;  2LSO A;  3KP5 A;  2JTV A;  1R7J A;  2VBW A;  2IP2 A;  3LQQ A;  3CTA A;  4OIO F;  2PN6 A;  4WX9 A;  3K9T A;  3DQV C;  5ERI A;  2RN7 A;  1K7A A;  4MQ9 F;  2IW5 A;  2BEO A;  3IKV A;  2K86 A;  4IXA A;  2PG4 A;  3FX3 A;  2XKP A;  2G9W A;  2HKX A;  1YW7 A;  4FT8 A;  3KE2 A;  3F8M A;  3O3K A;  5DUI A;  3GX4 X;  1GVJ A;  4HAM A;  1RIO H;  3L09 A;  1YLF A;  4MTE A;  3WTX C;  3D5L A;  1Z91 A;  4G6D A;  1KA8 A;  1AWC A;  1PP8 F;  4Q48 A;  5E17 F;  3TO6 A;  2O03 A;  2QQ9 A;  1LJ9 A;  3DXJ F;  2RQP A;  1YG2 A;  5A2Q Z;  2P7V B;  3WGH A;  4N0B A;  5HLG A;  4G7O F;  3I4P A;  4JK1 X;  1FSH A;  3KP3 A;  3QRF F;  4M9S A;  3SQN A;  3KP6 A;  2P8T A;  4ESB A;  3KCC A;  2WTE A;  1IAW A;  5CYV A;  2VOO A;  1IRG A;  1CF7 B;  1OMI A;  3I0T A;  1R5G A;  2XAF A;  5A2Q K;  1IF1 A;  1TW2 A;  2XGX A;  2L3D A;  5E1W A;  1MKM A;  5D5W B;  4WWC A;  4L0Y B;  4HV6 A;  1ZRD A;  2DQR A;  4BHC A;  1E17 A;  1BM9 A;  2AXL A;  1FOK A;  3HHH A;  3AAF A;  2ZNY A;  3FHZ A;  2QQA A;  4L5J A;  2LDU A;  1IRF A;  5CVR A;  2Q8K A;  2GZW A;  3U9G A;  5ED4 A;  4EGZ A;  2O61 A;  2W84 A;  5E18 F;  1JE8 A;  4RGR A;  4CIC A;  1BC8 C;  2O0Y A;  2M1B A;  2NAZ A;  1HQC A;  1W7P D;  4IRG A;  4R1H A;  4WXD A;  1TQM A;  1G3Y A;  5HS7 A;  1ONV A;  3LAJ A;  5F1R A;  5K1Y A;  5HDK A;  2HR3 A;  2GWR A;  2F5E A;  2LKP A;  1D8J A;  5DD4 A;  1YYV A;  3HYI A;  2HDC A;  4OIR F;  3RDI A;  2V1X A;  3P9I A;  3GZ6 A;  4KMF A;  1YS6 A;  3PFI A;  5LGT A;  1UHW A;  5L3G A;  5FGM A;  1NHA A;  3VEP A;  4LB5 A;  4O3M A;  4I0A A;  1YW8 A;  2QWW A;  3E97 A;  4ZZD A;  1I6X A;  1LDK B;  4EGY A;  1JHF A;  1QNT A;  4EJO A;  2ETH A;  1ON2 A;  5ICG A;  1LDD A;  2O3F A;  2V1D A;  3HOS A;  2ADU A;  3ZMT A;  3TO9 A;  2OZ6 A;  1KU2 A;  2FMY A;  4JBA A;  3IRQ A;  1Z7U A;  1B1B A;  3KP4 A;  4ENM A;  1K79 A;  3HSR A;  2KIU A;  1O3T A;  4BAY A;  5HS9 A;  3V8L A;  4MEY F;  2VXZ A;  5HLH A;  4BH9 A;  3SHF A;  2H09 A;  3HIF A;  2NRA C;  3WGI A;  4U0Y A;  1TNT A;  3Q9V A;  3E5Q A;  2K02 A;  5HDN A;  2UXX A;  2PI0 A;  4BHP A;  4KIC A;  1CF7 A;  5HDG A;  3ML6 A;  4P96 A;  2EFP A;  4E70 A;  5J6X A;  1TNS A;  5KK1 A;  2RDP A;  1O3S A;  4P9F A;  5LEK A;  2JPB A;  4K2E A;  5IT9 K;  1UHM A;  1L0O C;  2ZCW A;  1KU9 A;  3BP8 A;  1LEA A;  4S05 A;  2HQN A;  2ZO4 A;  3H3U A;  3I53 A;  3Q9S A;  3W6K B;  2W85 A;  3SZP A;  3FMS A;  1H0M A;  3KEO A;  1QZY A;  3M1E A;  1REP C;  3MAJ A;  5EEG A;  4M71 A;  3WTZ A;  2DAO A;  2R7F A;  5DD8 A;  1DDN A;  1IN8 A;  2G7U A;  3K1P A;  4G8X A;  2BE5 F;  1FYM A;  2UXN A;  2EFN A;  4P5O A;  1LB2 A;  1IXS B;  1MZB A;  3WU1 B;  1FLI A;  3RJP A;  5ILV A;  1BIB A;  1P6R A;  4EM2 A;  3TOB A;  2YX4 A;  4JQF A;  4HDU A;  2XKO A;  3S2W A;  3WE3 A;  2DT5 A;  1KQ8 A;  1OYI A;  1ZRF A;  3OOP A;  3GW2 A;  2ZME B;  4LD5 A;  4XSX F;  2XV4 S;  5LLQ A;  3GFI A;  2XRN A;  1D5V A;  2QQB A;  2ISZ A;  5F6F A;  1OR7 A;  4UVB A;  1SD6 A;  2J5P A;  2VT2 A;  5LHI A;  4IJA A;  2FBI A;  2CWE A;  3E6D A;  2BGC A;  5DCM B;  5FLX K;  1ZH5 A;  2HTS A;  4GYG A;  1J7K A;  2VBZ A;  2L4A A;  1T0F A;  2H27 A;  1HW5 A;  3IRR A;  3V7C A;  1W5S A;  2CFX A;  3RIR A;  3REO A;  1XN7 A;  4GCV A;  1Z6R A;  2E1C A;  3LFK A;  2QVO A;  2A61 A;  1J9I A;  4UVC A;  3GUD A;  2DLL A;  3GFM A;  5AIP A;  1T98 A;  3BDD A;  1BIA A;  4L9N A;  2H94 A;  2QM3 A;  2VBX A;  2PEX A;  2HOE A;  3FWE A;  2XRO A;  5E8I A;  5DYM A;  4PGG A;  5CVU A;  3G73 A;  1MJA A;  1U6G A;  4CZZ A;  1FX7 A;  1KU3 A;  3FM5 A;  1G3W A;  1ZHF A;  1XMK A;  2Z3Y A;  5JFR A;  2G7H A;  2WC2 A;  3NRV A;  5AON A;  2WWY A;  1KU7 A;  3V8J A;  1VTN C;  3HRM A;  4RB2 C;  2OA4 A;  1TTY A;  4R8H A;  3FXU A;  5ILU A;  3ZQ7 A;  5BS6 A;  1MDM B;  2XAG A;  1WRJ A;  3HSE A;  2RKH A;  1XCV A;  3CUO A;  2QYO A;  3F8F A;  2VC0 A;  2KRF A;  4M74 A;  2TDX A;  3C3W A;  4OIN F;  4H0E A;  5BMZ A;  4LJZ F;  4U7B A;  1QBJ A;  4XRF A;  1ZGA A;  2MD5 A;  3CUQ B;  2ISY A;  3RPU A;  2QBY B;  1OYW A;  2H6B A;  2OBP A;  4I09 A;  3F3X A;  1IXR C;  1TW3 A;  2HWV A;  1SAX A;  5CJ9 A;  4Z2Y A;  5ICF A;  3J81 Z;  2ZNZ A;  2KJB A;  4B09 A;  1IN6 A;  3JAM K;  2F5F A;  3RI4 A;  2R7D A;  3H92 A;  1KQ9 A;  2LF8 A;  1BI0 A;  1D3Y A;  1JGS A;  2ZME A;  3DFG A;  4U7D A;  3PQJ A;  3GYH X;  3R0A A;  3ZN1 A;  3KZY A;  2CW0 F;  5LEJ A;  1J75 A;  1U5T C;  2D45 A;  4LFU A;  4A0Z A;  1ZGJ A;  2XAJ A;  5DCM A;  3COA C;  2NS0 A;  4EV0 A;  2D1V A;  1W4M A;  2IJL A;  3JSO A;  3WTS C;  3GFL A;  4L9J A;  1ZG5 A;  2PJP A;  2MA3 A;  2Y0M A;  3BY6 A;  3V7S A;  2Z5U A;  5DDG A;  3MEX A;  2OZU A;  4EM1 A;  4L0Z B;  2HGC A;  3RYR A;  3TQN A;  3HRT A;  1B9N A;  2GIV A;  2L4M A;  3ZN0 A;  3IC7 A;  1V3F A;  5ICC A;  2YPR A;  2F2E A;  1J0R A;  3E5X A;  1Z9C A;  3VOE A;  4BNC A;  4AIH A;  4KIG A;  3ZPL A;  1B59 A;  3O6B B;  2IT0 A;  5CVI A;  2PMH A;  1WQ2 A;  1RI7 A;  2V79 A;  2ZKZ A;  1T2K A;  1TQP A;  3I54 A;  4ESJ A;  1P4X A;  2GAU A;  5TRD A;  1FBU A;  5K5R A;  4UHT A;  3QPT A;  2K27 A;  3I59 B;  1MDM A;  4ENN A;  2P7C B;  4XLP F;  4ON0 A;  1T39 A;  2HQR A;  4GXO A;  4B8X A;  5L3F A;  2EB7 A;  1QO0 D;  1R58 A;  1IW7 F;  2MLK A;  1I27 A;  3HHG A;  4ESF A;  3CUQ A;  1SFX A;  3T8R A;  1FP2 A;  2QBY A;  4DNC A;  3JW4 A;  4LGW A;  3QPH A;  2FE3 A;  4WCG A;  2L02 A;  5LHH A;  3W6J B;  1R1T A;  5HS8 A;  4CDG A;  1TQI A;  5JI6 A;  1U8R A;  1YIO A;  2YX7 A;  1K6O A;  3BJ6 A;  2IA0 A;  1FPQ A;  1O7L A;  1HST A;  3SZT A;  4HQE A;  4RGU A;  1O7F A;  2OQG A;  1H9T A;  5KVR A;  4FX4 A;  4TV7 A;  2O6G E;  5BQT A;  1TLH B;  3ULQ B;  4RS8 A;  5JVT A;  2HZT A;  1FBQ A;  1CGP A;  1XCB A;  3BWG A;  3LA2 A;  5FB2 A;  1SFU A;  5H6R A;  4AWX B;  2F5C A;  2UWM A;  4WXH A;  1F1Z A;  1PP7 U;  4L18 B;  2EA2 A;  2QUF A;  4IVN A;  4BQA A;  3J80 K;  2P6T A;  5DV5 A;  1LVA A;  1ZG3 A;  1ZRE A;  3MFK A;  2JSC A;  4IPA A;  2FA5 A;  2M8E A;  1DPR A;  3ROU A;  4A0Y A;  1TBX A;  3U1D A;  3H3Z A;  2A3S A;  1AOY A;  2DU9 A;  3V8K A;  4HX7 A;  3IL2 A;  1S29 A;  4M6Y A;  2Z33 A;  3N4M A;  2JRT A;  5K5Q A;  4U88 A;  2HYF A;  2OQR A;  2EV6 A;  2M5W A;  2IRF G;  5E1Z B;  3ZMS A;  1IN4 A;  4HOB A;  4LK0 F;  1Z05 A;  3CO7 C;  1EH7 A;  2V9V A;  2FML A;  3B73 A;  1XB4 A;  5L3D A;  3V4G A;  1YS7 A;  1V4R A;  2YSR A;  3KLN A;  1SD7 A;  3GZ5 A;  2L01 A;  3DKW A;  1J2X A;  2CSO A;  3DPL C;  3LA7 A;  4Q4Z F;  4EQQ A;  1Z6T A;  3I5U A;  2L54 A;  4LLL A;  3TGN A;  5IT9 Z;  1B6A A;  3LAP A;  4M9X A;  4IF4 A;  3I59 A;  2EFQ A;  1MGT A;  2MLG A;  3WE2 A;  4AIK A;  3JTG A;  2RGV A;  3DP7 A;  2Y48 A;  1ON1 A;  4ZZL A;  1FY7 A;  2FRH A;  2FOK A;  2VOP A;  1SD5 A;  2WV0 A;  5D4S A;  5LBQ A;  5LRS A;  1MJ9 A;  5HVQ C;  4M9Z A;  4RAZ A;  2COM A;  5D6E A;  1WWX A;  1S6L A;  5FD5 A;  3WTY C;  1WI9 A;  4O5V A;  4PGH A;  4Y17 A;  5L3E A;  5E8G A;  4XBF A;  3K1M A;  5LGN A;  4RGS A;  2ZFW A;  4KUM A;  4DQ2 A;  3VB2 A;  1XGM A;  4UUV A;  2VE8 A;  2D2W A;  3EDP A;  1BI3 A;  2KKO A;  1E2X A;  4Y13 A;  1LEB A;  2QLZ A;  1FWZ A;  4I02 A;  3E6C C;  3V7R A;  1IN5 A;  3ZMZ A;  2K4B A;  1R5H A;  1YW9 A;  2LNB A;  4HV5 A;  1BI2 A;  3K69 A;  2HEO A;  2GA1 A;  4MHG A;  2CQK A;  4KMU X;  4YFK F;  4MQV A;  4HA8 A;  3LA3 A;  1HW2 A;  5FD6 A;  4F7Z A;  2PQ8 A;  3HTU A;  5FLX Z;  1HBX G;  6PAX A;  4NQW A;  1F5T A;  5DUK A;  4MNU A;  5AIQ A;  4OOI A;  1FSE A;  2P5L C;  2KIF A;  4YG2 F;  5BOX A;  1I1G A;  4IHS A;  3GEZ A;  1QQI A;  4CYD A;  1B4A A;  2AS5 F;  3OV8 A;  3VOD A;  5JR3 A;  4LK1 F;  2DBB A;  3R60 A;  3HOT A;  3C1D A;  2VBY A;  1LNW A;  4G9Y A;  1QPM A;  4UNO A;  3WTV C;  4RGX A;  3RKX A;  1BJA A;  4XLN F;  2HTJ A;  3LQR A;  3BPX A;  2EJR A;  2DI3 A;  3G3Z A;  4LLN A;  1BI1 A;  4HF1 A;  2M45 A;  3IWZ A;  3I58 A;  1BBY A;  5J8F A;  4HF0 A;  1S7A A;  2KIM A;  4HYE A;  3K0L A;  1STZ A;  1JXS A;  1XSV A;  2K7L A;  2BV6 A;  1UB9 A;  3N97 A;  1FYK A;  4HX4 A;  1S8N A;  3T5X A;  1I1S A;  2ZJ2 A;  4YIF A;  2C6Y A;  1G3S A;  2XUB A;  3HTS B;  2A6E F;  1WKM A;  3DPT A;  3EQL F;  1K78 A;  1R36 A;  4ASN A;  2BBY A;  4UVA A;  2VOD A;  3ZP5 A;  3F22 A;  3Q5F A;  2Z9O A;  4D0P A;  3FMR A;  3K2Z A;  2HYG D;  3CLO A;  4I01 A;  3JAM Z;  3WU0 A;  2P5V A;  5E20 A;  4Q47 A;  2O8X A;  3F23 A;  3E3V A;  2V6C A;  2X4H A;  3F8N A;  3BJO A;  1RNL A;  1EH8 A;  4A12 A;  4EJV A;  1PUE E;  1YFH A;  3BOQ A;  3F21 A;  2JZY A;  1UFM A;  4QWQ A;  3TO7 A;  3EUH A;  4KIF A;  3GVA A;  5D6F A;  3QOP A;  3JTH A;  4G7H F;  3QP6 A;  1R23 A;  1GHC A;  2P6S A;  2VN2 A;  2EA4 A;  3SFZ A;  4YFX F;  3ABT A;  3T1B A;  3I64 A;  4KN4 X;  5D5U B;  1U5T B;  4CXF A;  4ZYG A;  5D5X B;  1Y0U A;  4IRH A;  1FBS A;  1MJB A;  4AVP A;  3TDZ C;  3BZ6 A;  3TOA A;  2P4W A;  2HFH A;  1IUY A;  3DV8 A;  2VON A;  4WF2 A;  1C0W A;  1F9N A;  4FHT A;  2RNJ A;  2XVC A;  4EM0 B;  5H6Q A;  5LGU A;  4FX0 A;  4I7H A;  2DFI A;  2RV8 A;  5CVV A;  4ZYH A;  1QGP A;  2ACJ A;  2LF7 A;  2XAQ A;  1KYZ A;  1O57 A;  4HQM A;  5L3C A;  4ZYD A;  1L3L A;  4L9T A;  2KJC A;  1XSD A;  2DTR A;  2QZ8 A;  2PMU A;  3IHU A;  3KP7 A;  4O6J A;  5IT3 A;  5D8L B;  4KA4 A;  4PZJ A;  3KP2 A;  4EMS A;  4GO1 A;  1XGN A;  4IRI A;  3MWM A;  2FNP A;  2DPD A;  2XHK A;  3ZMV A;  2H6C A;  3MZH A;  2EK5 A;  1W5T A;  2QEN A;  1LDJ A;  3ERE D;  2Z99 A; 
#chains in the Genus database with same CATH topology
 4Y33 A;  1HSJ A;  4PFO A;  3R6S A;  1ZRC A;  1FC3 A;  2MC3 A;  4DBR A;  4YIR X;  4A5M A;  2OC6 A;  3J7A O;  1ZAO A;  2DW4 A;  4XM3 A;  2JPC A;  2DA4 A;  3M8E A;  4BXF A;  1ZAR A;  2PFB A;  3DEE A;  2VE9 A;  3RKW A;  3ZCO A;  1YIJ I;  1H8A C;  2R5Y A;  1YRN A;  1GVD A;  3HRS A;  4AD9 A;  3WTT C;  1J5Y A;  3H5A A;  1I5Z A;  4BBR J;  5EGO B;  2X48 A;  3OYG A;  3FXO A;  2XB5 A;  2X6X A;  4KIT B;  3OYM A;  1Y1V J;  1VND A;  2ECC A;  2ESH A;  2QQ8 A;  2CO5 A;  1SMT A;  2EBI A;  3O2P E;  1MNM C;  3DKX A;  2HVS A;  4RB1 A;  1XX5 A;  4E7L A;  2Y75 A;  3U1K A;  1LKX A;  3ABK H;  4Y15 A;  3KFW X;  3ZMU A;  4CCL A;  2L2O A;  4R79 A;  3OL3 A;  2W7N A;  1WSU A;  4ENK A;  2PBI A;  1DQU A;  4F55 A;  5IYB J;  3QOE A;  1VQ9 I;  3BG6 A;  3ABM H;  3C18 A;  3RQI A;  3RYP A;  1IZ1 A;  3LSI A;  3CQZ J;  5K7F A;  1WJE A;  1VQK I;  2VI6 A;  3OR1 C;  3FIS A;  1Q1H A;  1OCP A;  4BYY A;  2R7U A;  3FXR A;  4NC6 A;  5HOO A;  4U0V A;  4BE0 A;  4HDV A;  2FSW A;  1OIS A;  3D0S A;  3J80 Z;  3DEU A;  2XIG A;  3QU6 A;  2E35 A;  3OS0 A;  2H1K A;  1DP7 P;  2A6H F;  2MH2 A;  1KQ0 A;  1U5T A;  1ETO A;  1SD4 A;  2ID3 A;  3IP4 B;  3VPR A;  1OJL A;  2R7Z J;  4ENJ A;  1BC7 C;  2PJR B;  3FF5 A;  3HPG A;  1Y0N A;  2RVC A;  3S32 A;  1W0U A;  4Q5S F;  4PSW A;  2Y2Z A;  4OIP F;  1XSX A;  1WJB A;  2MC4 A;  1FZP B;  5TGT A;  3HOW J;  1DGR M;  3IKT A;  1PDN C;  1XPX A;  2M7B A;  2E2H J;  3L2R A;  2HDD A;  4NHJ A;  1XGS A;  3PQK A;  2LLK A;  4A3F J;  2YUS A;  5BPD A;  2M8G X;  2LRE A;  2X6W A;  1IC8 A;  5CLS A;  1S7O A;  1ETW A;  1YO5 C;  3Q0V A;  3BJA A;  3OYA A;  3K4N A;  3MVP A;  2EZH A;  3HKZ N;  2D1H A;  1MSF C;  1IXC A;  1P92 A;  1XD7 A;  4IQ4 A;  4KN7 X;  3T8T A;  4RB3 C;  2STT A;  2EFO A;  1OCT C;  3WTW C;  3SZG A;  2PLY A;  4ETS A;  3P9C A;  3CO6 C;  4KIB A;  3SEZ A;  2Q2E B;  2A68 F;  2VJI A;  2X1E A;  4HLY A;  3TKY A;  1UST A;  1USS A;  2Y9Z A;  3MCZ A;  3QAH A;  1RUN A;  1R00 A;  3F8C A;  4HZF A;  1G3T A;  3L9F A;  1W0T A;  2Q0O A;  3GF2 A;  2ELJ A;  1P4W A;  3CDI A;  4G6T B;  1LFP A;  2IBD A;  2NNN A;  5DEQ A;  4LMY A;  3ZOB A;  1T38 A;  1R1V A;  3MZY A;  1BR2 A;  3W2A A;  1S72 I;  2LKS A;  2QKL B;  1R6R A;  1KYW A;  2IA2 A;  1P2F A;  3GFJ A;  2E7W A;  1ERD A;  2NS8 A;  3WOD F;  4I2O A;  2JT1 A;  1ULY A;  2RAE A;  1XGO A;  2FBH A;  1XG1 A;  4PDK A;  1D0Z A;  2CU7 A;  3L00 A;  2K4J A;  1OR7 C;  4OAZ A;  2ID6 A;  2HYJ A;  1KZH A;  4P55 A;  2BYV E;  2DFE A;  1WI3 A;  3W2V A;  2FQ4 A;  2FU4 A;  2M9H A;  1RRJ A;  2DYS H;  4OMY A;  5KNL A;  4U0W A;  2VAS A;  5EJC A;  4ZYE A;  2EWN A;  5LHG A;  1S5L C;  3FM3 A;  1XC5 A;  1OYY A;  3R4K A;  1P7J A;  4RAY A;  2BHZ A;  4V2F A;  3ABL H;  3BPV A;  4HF2 A;  2VJ4 A;  3RKY A;  3F8B A;  2KL4 A;  2KZG A;  4I76 A;  3RTR A;  1T0F C;  2DA2 A;  5EG0 B;  3HUG B;  5B1A H;  5JHU A;  5LFA A;  1U78 A;  2R7X A;  3LNQ A;  2ESN A;  2R7W A;  1G6N A;  4HW0 A;  2IA1 A;  2XAS A;  1FMW A;  3GWZ A;  2E1N A;  4YEJ A;  1A04 A;  5B3S H;  1WVR A;  5DTD A;  4MGR A;  4IHT A;  3CDH A;  4QSH A;  3M7G A;  1O3R A;  1TWC J;  2L9V A;  4S04 A;  4QLC U;  4IZZ A;  2Y0S N;  1HKQ A;  4I0B A;  3S1N J;  1DPU A;  3I71 A;  4ZTJ A;  3A4C A;  1N77 A;  3BTC A;  1FP1 D;  2XPU A;  1XMA A;  2HQ5 A;  3DBL B;  3E6M A;  3E5U A;  4BJ5 C;  2LD5 A;  5EGO A;  2NS7 A;  1K78 B;  3JRB A;  3LST A;  5B66 C;  4FIS A;  4OWR B;  1B9M A;  1K83 J;  1IDY A;  2FBK A;  2DMQ A;  1MH3 A;  2OU2 A;  2Z2S B;  4OIQ F;  1BR1 A;  1W7P B;  2BHY A;  2J5O A;  2MD0 A;  2IGN A;  3OSG A;  2A07 F;  3R61 A;  1XTA A;  4EJW A;  1Y6I A;  2NVQ J;  1BOA A;  1HKT A;  2MYS A;  1V5G A;  2A5Y B;  2STW A;  2GQQ A;  1YQA A;  5IOY A;  3FMQ A;  1U8B A;  2DA7 A;  1YOV B;  2BOL A;  1BN5 A;  3NWS A;  2UZK A;  4GFB A;  1Z3Y A;  3LWF A;  3VDX A;  5L3B A;  3K10 A;  3L7W A;  4M6X A;  4IHX A;  2OCC H;  2ZC2 A;  2FF4 A;  2HOS A;  3JSP A;  1RPW A;  1PUF B;  3WTU C;  2YU3 A;  1JUS A;  5FKK A;  2EPF A;  3VFZ A;  5CKT A;  2V1U A;  1RKT A;  4PJN A;  3SJM A;  1JUM A;  3IWF A;  4PJJ A;  1G4D A;  1HKS A;  1I6H J;  2M87 A;  5F64 A;  2VC1 A;  3NQO A;  4UB6 C;  4HNT A;  5M5Y J;  2CG4 A;  3MZ8 A;  3S93 A;  4I99 C;  2HQA A;  2DFF A;  3TDU C;  4BU2 A;  4A2U A;  1HLV A;  2PJR A;  3GTP J;  3CC2 I;  2KP6 A;  1X3U A;  3ELK A;  1RET A;  4IHW A;  1OFC X;  2VKV A;  1IV6 A;  4MEX F;  2DOA A;  3EYY A;  1FOW A;  2R3S A;  3OOU A;  3MD2 A;  1SMY F;  1JTX A;  2CW7 A;  2CUJ A;  3ZMD A;  2WY8 Q;  2DMT A;  2M30 A;  2EZK A;  4UXN A;  4XSZ F;  1MMS A;  4LB6 B;  5DCF A;  4G94 A;  4CO8 A;  2CQX A;  2GXG A;  4YFN F;  4RLQ A;  5GP9 A;  2DPU A;  3DF8 A;  4E7J A;  4MTD A;  1J59 A;  1TP4 A;  4M3D A;  3K1N A;  1XDU A;  3GO5 A;  2R93 J;  3DLL F;  4CUG A;  1U2W A;  1R4N B;  3OR2 C;  4N9H A;  3O8H A;  2Q2E A;  4G6Q A;  3WGG A;  2FEZ A;  3H35 A;  1GUU A;  1EH6 A;  1ZG1 A;  3I56 I;  4KNY A;  3F6V A;  4XLC A;  5E1X A;  2W57 A;  5FFZ A;  2LY1 A;  3TP3 A;  2EV5 A;  2B0L A;  2BVM A;  2O5R A;  4WK8 F;  5F0H A;  1A5J A;  1HW1 A;  1K6Y A;  4HLX A;  4L5I A;  1SFE A;  1JTY A;  2DK8 A;  2DO7 A;  3KEQ A;  2ELH A;  2GXB A;  4LG0 B;  5EEH A;  3ZQC A;  1QZZ A;  2CUF A;  3SXY A;  1R49 A;  1FT9 A;  1WGX A;  2YR2 A;  2ZME C;  4CGZ A;  3HSF A;  3F6O A;  4AYB A;  4AIJ A;  3TBI A;  2CUZ A;  4WXC A;  4EJU A;  2VIX A;  2CGP A;  3EET A;  5C44 J;  4D9J A;  5TJJ A;  3M8F A;  1GXQ A;  2DQL A;  3ECO A;  2EFW A;  4CHU A;  1UZC A;  5FRN A;  4EJT A;  1Z1D A;  3FZV A;  4Z6Y A;  4I98 B;  5CVJ A;  4B43 A;  2CUE A;  2IVM A;  2JSP A;  1R22 A;  4M72 A;  5D8K B;  3NAR A;  3RSN A;  2ZXW H;  1TT0 A;  2DFH A;  2ELK A;  4M73 A;  1WJD A;  4CCJ A;  1KGS A;  4KT5 C;  3QYB A;  3RPQ A;  9ANT A;  3F72 A;  1WFX A;  1NH3 A;  2KZV A;  2FXA A;  2LP0 A;  1XDS A;  3X2Q H;  4BEH B;  1WJA A;  4S0H B;  1MH4 A;  5EG0 A;  3HUG A;  3HC7 A;  3EYI A;  2M4G A;  5D5V B;  3KYC B;  1IV8 A;  5J1U A;  4J00 A;  1DUX C;  2FNA A;  1FNN A;  1MNE A;  2VKH A;  2X0L A;  1X2M A;  1ZN2 A;  2F5D A;  3ECH A;  5FO5 A;  1R9T J;  5GTI C;  1U3E M;  1APL C;  3JRF A;  2KDO A;  1PYV A;  3BRO A;  1IN7 A;  1LFU P;  1YX5 A;  4FET A;  3ZQQ A;  3LSH A;  2AQE A;  4E7S A;  2K9Q A;  4ZC3 A;  3ABU A;  1D8K A;  1P4A A;  1QHH D;  2A69 F;  3P9K A;  4KDP A;  4ZH4 F;  5ICE A;  1XS9 A;  1RUO A;  1U0J A;  5M3F J;  1O3Q A;  3GXO A;  1V5E A;  1LQ1 A;  2IPQ X;  4A3J J;  2LK2 A;  4EVI A;  5IP6 A;  5K5O A;  3HZJ A;  2CYY A;  3QP5 A;  4UV8 A;  2E34 A;  1E0E A;  2DK5 A;  2K9S A;  3WG9 A;  2LVS A;  3C7J A;  4L9V A;  5CPR B;  4HX8 A;  4HRI A;  1R1U A;  2EIK H;  2MAB A;  2XAH A;  3ZXS A;  1W7P A;  2LC2 A;  2P5K A;  2L7Z A;  1GXP A;  4IKF A;  4N9I A;  2HU9 A;  2FQ3 A;  2CH0 A;  5ILS A;  2W24 A;  3A2K A;  3ISP A;  1E3H A;  1OPC A;  4UV9 A;  2IS6 A;  1F4K A;  4BHB A;  1HXD A;  3U2R A;  1ZLJ A;  2R7S A;  4A6E A;  3HGY A;  3S16 J;  2MG4 A;  1T33 A;  4D7M A;  1VQ4 I;  1JT6 A;  3H1C A;  2OD5 A;  4DJA A;  4OU0 A;  2GOX B;  2R5Y B;  1YRN B;  3FXM A;  2WAQ N;  4MFE A;  2HS5 A;  3A02 A;  3M8J A;  3H9Q A;  2ZBK A;  3L2C A;  2R7T A;  2ZXJ A;  2VT3 A;  1PUF A;  5FFX A;  2JK3 A;  4MO7 A;  3R0J A;  1JHH A;  1H9G A;  4ZDL A;  2P81 A;  2HZD A;  3S1Q J;  2I5U A;  1RC9 A;  5D4R A;  3GTO J;  4XOP A;  3CJR B;  4XRS G;  4G7Z F;  4XOT A;  2CQQ A;  3HRU A;  5FLM J;  2EV0 A;  1Z0X A;  5H20 A;  2DCE A;  3ZRG A;  4A6D A;  2DYR H;  1RZ4 A;  4OMZ A;  1ETY A;  4GGG A;  1YJN I;  3BTL A;  3P7N A;  4HBL A;  4GDF A;  3CJN A;  3KZZ A;  1DU0 A;  3D5S C;  3E6B A;  3S15 J;  1ZLK A;  4KYW A;  3KLO A;  2NVY J;  4DYR A;  2NNY A;  2HKO A;  2X9D A;  2GA2 A;  3BCA A;  4LLG F;  2HNH A;  3KET A;  2ZXH A;  3FXQ A;  5J8C A;  2MH9 A;  5BPI A;  3CUQ C;  5CQG A;  1YJ9 I;  2OAZ A;  2NYX A;  2BY0 A;  2DMN A;  1OKR A;  1T6S A;  5K7Z A;  3CF5 F;  2NXN B;  1MD0 A;  4PCQ A;  4FE7 A;  2JA5 J;  2DT6 A;  5LRR A;  1S3J A;  3B02 A;  3PUB A;  2W1O A;  3QU3 A;  2X1D A;  3HDD A;  3T0Y A;  4GYI A;  4CCO A;  1YTY A;  2IS2 A;  4NB5 A;  3M9A A;  3WHC A;  2Y9Y A;  2RC4 A;  4DOZ A;  2EH3 A;  2EIJ H;  2E7X A;  1UCR A;  1EV7 A;  4BXU A;  4A0X A;  3M1C A;  1MW7 A;  4YII A;  1ODD A;  2MBF A;  3GLX A;  3MQ0 A;  4JOM A;  4E6K G;  2X6O A;  4LIT A;  4RB0 A;  3EPZ A;  4LG0 A;  1I3Q J;  1FYL A;  4E4H A;  3J81 K;  1ZYR F;  4H4K C;  3CD6 I;  2E5N A;  3H3V K;  3NEU A;  5HLI A;  4IO9 F;  4KFC A;  1JKR C;  2V4J C;  4A5N A;  4F91 B;  4F92 B;  2CV2 A;  3OYL A;  4P9U A;  2W25 A;  2LSO A;  3KP5 A;  2JTV A;  1R7J A;  4M6V A;  4Y52 J;  2VBW A;  2L9N A;  2ECB A;  2IP2 A;  3LQQ A;  1QHG A;  3CTA A;  4OIO F;  2PN6 A;  3BR6 A;  2F4M B;  2BZT A;  1BW6 A;  4WX9 A;  3K9T A;  3DQV C;  1WJC A;  5ERI A;  2A05 A;  2COB A;  3ZQI A;  1BL0 A;  2EIM H;  2RN7 A;  3AG1 H;  3JCU C;  1K7A A;  1QRY A;  1X3W B;  1FOY A;  2O7O A;  2VJ5 A;  2IW5 A;  4MQ9 F;  2BEO A;  3VSL A;  5E3L A;  2RRE A;  3OY9 A;  4D1Q A;  1ZKG A;  3KYD B;  3IKV A;  5IOZ A;  1B72 B;  3KPH A;  2HXI A;  1MMA A;  4BEH A;  2K86 A;  4IXA A;  3DTE A;  2PG4 A;  3FX3 A;  2XKP A;  4CYC B;  2E1M B;  2G9W A;  2HKX A;  2B9S A;  1YI2 I;  2QCO A;  3EUA A;  3MKY B;  1SAN A;  1YW7 A;  4FT8 A;  1UMQ A;  3KE2 A;  1VI0 A;  1OCR H;  3CME I;  3J7Z I;  3F8M A;  4ZDO A;  3O3K A;  5DUI A;  3GX4 X;  1GVJ A;  4HAM A;  2JRM A;  1RIO H;  3L09 A;  1YLF A;  3Q0U A;  4C3J J;  3GTL J;  4LOC A;  4MTE A;  3WTX C;  3TP0 A;  1JI8 A;  3D5L A;  4CH7 A;  1Z91 A;  4G6D A;  1KA8 A;  2Z16 A;  2W48 A;  3HOZ J;  1AWC A;  1R4M B;  2ZB9 A;  1PP8 F;  4Q48 A;  5E17 F;  3TO6 A;  2O03 A;  3OYK A;  4XMY A;  2QQ9 A;  1LJ9 A;  2DJI A;  1NG6 A;  4CCN A;  3DXJ F;  2RQP A;  1YG2 A;  3F9K A;  5A2Q Z;  3DBH B;  2P7V B;  1I39 A;  1IGN A;  3DWL E;  1YE9 A;  3WGH A;  4N0B A;  5HLG A;  3CZ6 A;  2FJ1 A;  3DTI A;  4G7O F;  5LD2 C;  3KEY A;  3I4P A;  3MKL A;  5F0F A;  2I8D A;  4JK1 X;  4BQN A;  1FSH A;  3KP3 A;  2VQL A;  3QRF F;  2IGK A;  4M9S A;  3SQN A;  2W00 A;  2DMU A;  3KP6 A;  2P8T A;  4ESB A;  5J4Y A;  2KDZ A;  3KCC A;  2WTE A;  5BNG A;  1IAW A;  4XKW A;  2BY2 A;  2MSY A;  4PJM A;  5CYV A;  1NTC A;  2VOO A;  3S3O A;  1V5F A;  1IRG A;  4YEL A;  1CF7 B;  4N4N B;  3K2A A;  1OMI A;  3I0T A;  3BG9 A;  1A36 A;  1R5G A;  2XAF A;  5A2Q K;  2JMW A;  1IF1 A;  2WV1 A;  2ZXI A;  1IDZ A;  1E3P A;  1TW2 A;  3V42 A;  2XGX A;  2L3D A;  4XOR A;  5E1W A;  2M4K A;  4IOC F;  3SDB A;  1MBE A;  3I3L A;  4C3I J;  3GLL A;  1R71 A;  1MKM A;  4FQG A;  2PMZ N;  2VL8 A;  3A0B C;  3IH2 A;  5D5W B;  1M1E B;  4WWC A;  1X1B A;  1X19 A;  4L0Y B;  4HV6 A;  1ZRD A;  2DQR A;  1MBJ A;  3CF2 A;  4BHC A;  4RLF A;  1E17 A;  1BM9 A;  3K6G A;  2XF7 A;  4XLH A;  3RZD J;  3ONQ A;  2AXL A;  1HDP A;  3DKY A;  1FOK A;  3HHH A;  3I4N J;  2VQC A;  3AAF A;  2ZNY A;  3N05 A;  3FHZ A;  2QQA A;  1I50 J;  1DU6 A;  2K9L A;  2CFO A;  3PUF A;  4HG2 A;  4L5J A;  2LDU A;  1IRF A;  5CVR A;  1T08 B;  3HEF A;  2Q8K A;  3JRA A;  2GZW A;  2R7O A;  3U9G A;  3A01 B;  1F43 A;  2AQF A;  5ED4 A;  4EGZ A;  2O61 A;  3FBI B;  2V26 A;  4MLO A;  5F0C A;  2W84 A;  5E18 F;  1JE8 A;  4RGR A;  4CIC A;  1BC8 C;  2R7V A;  1D0X A;  4ZYA A;  4XON A;  2O0Y A;  2M1B A;  2NAZ A;  1HQC A;  1W7P D;  4IRG A;  4R1H A;  3TW7 A;  4A3C J;  1TWH J;  3U21 A;  4IHV A;  1NK2 P;  4WXD A;  1TQM A;  1TWF J;  1G3Y A;  5HS7 A;  1ONV A;  3LAJ A;  3DCF A;  1X1C A;  5F1R A;  5K1Y A;  5HDK A;  2V1N A;  3CCS I;  2HR3 A;  5EEA A;  2GWR A;  4AU7 A;  2F5E A;  2LKP A;  1D8J A;  3FHN A;  3G1O A;  5DD4 A;  1IO2 A;  1YYV A;  3HYI A;  4E7Z A;  2HDC A;  4OIR F;  3PJR A;  2WAD A;  2NVU B;  3CCE I;  3RDI A;  2V1X A;  3P9I A;  2F48 A;  5GAD J;  3GZ6 A;  4BJT A;  3A03 A;  4XLA A;  4KMF A;  1YS6 A;  1X4O A;  3PFI A;  2KFD A;  5LGT A;  5FKN A;  1UHW A;  5L3G A;  4JYK A;  2YS9 A;  1NHA A;  5FGM A;  3VEP A;  1JJ8 C;  1H88 C;  3LOC A;  1ORK A;  1B72 A;  4LB5 A;  4O3M A;  4I0A A;  1MBF A;  1YW8 A;  2QWW A;  3E97 A;  5KCM A;  4ZZD A;  4YRV A;  3HB9 A;  1I6X A;  1LDK B;  2M0M A;  3RPU D;  4CYC A;  3M4O J;  2QSH X;  2EQR A;  4EGY A;  1IRX A;  3VYR B;  4J19 A;  3JRC A;  1JHF A;  3O8G A;  4FAS D;  4RAG A;  1KON A;  1X58 A;  1OLT A;  1TL8 A;  1QNT A;  4D5C A;  4EJO A;  1WHU A;  2ETH A;  3PIO F;  1E3O C;  1ON2 A;  5ICG A;  1ENH A;  1LDD A;  2I10 A;  2O3F A;  2V1D A;  3HOS A;  3B6A A;  2HI3 A;  3BR0 A;  2ADU A;  3ZMT A;  2L5Q A;  3TO9 A;  2OZ6 A;  5JHF A;  2OJE D;  1KU2 A;  4XID A;  2GOM A;  1WCM J;  2FMY A;  4CCM A;  4JBA A;  1IUF A;  3IRQ A;  1Z7U A;  3HL2 A;  4AUX A;  5IY5 H;  1B1B A;  3DPU A;  3KP4 A;  2IXS A;  4ENM A;  1K79 A;  3HSR A;  3CP2 A;  4CZC A;  2KIU A;  3HOV J;  1O3T A;  4BAY A;  1X2N A;  5HS9 A;  3V8L A;  1Q1V A;  4MEY F;  5M5X J;  2VXZ A;  5HLH A;  4NC8 A;  4BH9 A;  3SHF A;  2H09 A;  3HIF A;  2NRA C;  3WGI A;  4U0Y A;  1TNT A;  4ANJ A;  3Q9V A;  4JP0 A;  3BQZ A;  3E5Q A;  1D0Y A;  3KIO A;  2AXT C;  1X1D A;  4XLF A;  2K02 A;  5HDN A;  3MKZ A;  2UXX A;  5HNF A;  2VUM J;  2PI0 A;  3OIQ A;  1BA5 A;  3FKI J;  5J40 A;  4BHP A;  4KIC A;  1CF7 A;  5HDG A;  2PX9 A;  1DP3 A;  3ML6 A;  1VQO I;  1SFO J;  4P96 A;  4BQO A;  2EFP A;  2N8G A;  3A1Y A;  4XN0 A;  4E70 A;  1LUJ B;  5J6X A;  2LY9 A;  1TNS A;  5KK1 A;  4M3E A;  5J47 A;  2RDP A;  1AU7 A;  4UY8 I;  3A0H C;  1O3S A;  4P9F A;  1FIA A;  3BZK A;  5LEK A;  2JPB A;  4K2E A;  5IT9 K;  4ZJZ A;  1UHM A;  2AHQ A;  4X0G A;  1L0O C;  2ZCW A;  1KU9 A;  3BP8 A;  4BE2 A;  1LEA A;  4RAF A;  5J1R A;  4S05 A;  2L7M P;  3HBL A;  2HQN A;  2HDW A;  2M34 A;  2ZO4 A;  4RDU A;  1SC7 A;  3I4M J;  3H3U A;  3I53 A;  3Q9S A;  1Y39 A;  3F0C A;  3S17 J;  5E3N A;  1UAA A;  3W6K B;  3E0J B;  2W85 A;  3SZP A;  4LIU A;  1YHQ I;  3FMS A;  1Z3X A;  3FXJ A;  1T8I A;  3S3N A;  1QVT A;  2XSJ C;  1H0M A;  3D1N I;  1UG0 A;  3A01 A;  3G6E I;  1EKE A;  3GCM A;  3K4J A;  3KEO A;  2FOW A;  2A5W A;  4AC0 A;  1QZY A;  3M1E A;  1REP C;  2HXO A;  3RQ4 A;  3MAJ A;  5EEG A;  2VPL A;  4M71 A;  2H8W A;  1Z21 A;  3WTZ A;  3H5N A;  3C2H A;  4J01 A;  2DAO A;  2R7F A;  5DD8 A;  1DDN A;  2X1C A;  1G8X A;  2MGQ A;  1IN8 A;  2JWT A;  2GM4 A;  4XRM A;  2G7U A;  3PNV A;  2EIN H;  5GPA A;  4BJ6 C;  3GZN B;  3L2W A;  1W36 C;  3K1P A;  4G8X A;  2DOE A;  2BE5 F;  1FYM A;  2BXZ A;  3OIO A;  2UXN A;  2EFN A;  4P5O A;  1LB2 A;  2XGD A;  1J09 A;  4RM2 A;  1IXS B;  1MZB A;  3EUH C;  3WU1 B;  1FLI A;  3BG5 A;  2H1L A;  3RJP A;  5ILV A;  1N75 A;  1BIB A;  4XL9 A;  1P6R A;  2M0C A;  4EM2 A;  3TOB A;  2YX4 A;  4JQF A;  4HDU A;  2XKO A;  4M3G A;  3S2W A;  3D5R C;  2DT5 A;  3WE3 A;  1KQ8 A;  1OYI A;  1W5C C;  1VQN I;  1ZRF A;  3OOP A;  3BQY A;  3GW2 A;  1V54 H;  2ZME B;  4LD5 A;  4XSX F;  2RQQ A;  3PL8 A;  4IHY A;  2XV4 S;  5LLQ A;  4A3E J;  2GLO A;  5DM7 F;  3GFI A;  2XRN A;  1D5V A;  2F5V A;  2QQB A;  2ISZ A;  5TIS C;  1WZ2 A;  4RMN A;  3S8P A;  3CCQ I;  1K4T A;  5F6F A;  1A35 A;  1OR7 A;  2HVQ A;  3BC8 A;  4ABZ A;  2LR8 A;  4I6Z A;  3ERM A;  4UVB A;  5FLV A;  2RNG A;  1SD6 A;  2GXA A;  2J5P A;  2VT2 A;  2ME0 A;  2X85 A;  5LHI A;  4IJA A;  3FK7 A;  2FBI A;  2CWE A;  3E6D A;  5HLT A;  2BGC A;  5DCM B;  3L1P A;  5FLX K;  1ZH5 A;  2HTS A;  2HPI A;  4GYG A;  2KHM A;  5GTH C;  3CCV I;  2BY1 A;  1J7K A;  3OS1 A;  2VBZ A;  3AKZ A;  2L4A A;  1T56 A;  4AM3 A;  5FKL A;  4Y3O A;  1T0F A;  2H27 A;  1HW5 A;  3IRR A;  3V7C A;  1W5S A;  4ITV A;  3HGG A;  2CFX A;  3GME A;  3RIR A;  4UB8 C;  3L2U A;  3S2H J;  3REO A;  1IJW C;  1XN7 A;  4GCV A;  4E7I A;  1TT5 B;  1Z6R A;  2E1C A;  5M3M J;  3OL4 A;  1N25 A;  2QEX I;  3LFK A;  3LSM A;  3ZQH A;  2QVO A;  1JT0 A;  3HOU J;  1P7I A;  1TZL A;  4QIW N;  1Z77 A;  1X3Z B;  3UR3 C;  2XC7 A;  3OYI A;  2A61 A;  1J9I A;  1A31 A;  3PSI A;  1FEX A;  4UVC A;  3GUD A;  3VSK A;  2DLL A;  3GFM A;  4PFP A;  5AIP A;  1T98 A;  3BDD A;  1BIA A;  3LSK A;  4L9N A;  4N4O B;  2H94 A;  2HOA A;  2QM3 A;  2VBX A;  2PEX A;  1YIT I;  2HOE A;  3FWE A;  2XRO A;  2WY7 Q;  3HPH A;  5E8I A;  5DYM A;  3CC7 I;  5EZG A;  3OIP A;  1SVM A;  4XNF A;  4PGG A;  3OYF A;  5CVU A;  2DA5 A;  3G73 A;  1MJA A;  1U6G A;  3AL0 C;  4C30 A;  2JA2 A;  4CZZ A;  1FX7 A;  3VWB A;  4IL6 C;  2DN0 A;  2JJ7 A;  4AVZ A;  2GIZ A;  5KHD A;  1ACI A;  1K61 A;  1KU3 A;  1GV2 A;  3ASN H;  3K4L A;  4PSX A;  3FM5 A;  1G3W A;  3DU5 A;  2ZSH B;  2JA7 J;  3G1L A;  5C3E J;  1ZHF A;  1VQ6 I;  1XMK A;  2Z3Y A;  5JFR A;  2G7H A;  3GTG J;  2WC2 A;  3IAS 2;  3SFI A;  3NRV A;  1X1P A;  5AON A;  2M2E A;  2WWY A;  1KU7 A;  3V8J A;  1VTN C;  3HRM A;  3AFH A;  4RB2 C;  2OA4 A;  4A93 J;  3G2B A;  1Y1W J;  1TTY A;  4R8H A;  2VJJ A;  3FXU A;  5ILU A;  3ZQ7 A;  5BS6 A;  3L2Q A;  4D5F A;  1MDM B;  1P9Q C;  1JGG A;  1GLN A;  3FK6 A;  2XAG A;  5J1Y A;  1WRJ A;  3HSE A;  2R0Q C;  2E2J J;  3BZC A;  1YX3 A;  2QA4 I;  2RKH A;  1XCV A;  3CUO A;  2QYO A;  1VZ0 A;  3F8F A;  4C9Y A;  2VC0 A;  2KRF A;  1FJL A;  4DYC A;  3HG9 A;  2CW8 A;  2KT0 A;  4M74 A;  2TDX A;  3C3W A;  4OIN F;  1PVE A;  4CA0 A;  4H0E A;  5BMZ A;  4LJZ F;  4F52 A;  4BL0 B;  1VQL I;  2CQ7 A;  2WB1 N;  4U7B A;  1QBJ A;  4XRF A;  3PFY A;  1IG7 A;  1QPI A;  1ZGA A;  2E60 A;  2MD5 A;  3CUQ B;  2ISY A;  3RPU A;  5J3L A;  2DT7 B;  3G1M A;  2QBY B;  2IS1 A;  1MMN A;  1OYW A;  3DLA A;  2L7K A;  2H6B A;  2OBP A;  4I09 A;  3F3X A;  1IXR C;  1TW3 A;  2HWV A;  3DBR B;  1SAX A;  4AYB N;  4KJZ A;  5CJ9 A;  4Z2Y A;  5ICF A;  3J81 Z;  1MIJ A;  2ZNZ A;  3GTM J;  2KJB A;  3W3C A;  4B09 A;  1IN6 A;  3MKW B;  3JAM K;  1W1W E;  2JN6 A;  3DU6 A;  5FKO A;  2F5F A;  1LVK A;  3RI4 A;  1SVL A;  2R7D A;  3H92 A;  2LRD A;  1Z7L A;  1KQ9 A;  2LF8 A;  1BI0 A;  1T95 A;  1VQ7 I;  1TWG J;  3SYT A;  1D3Y A;  1VFC A;  2NOG A;  1FIP A;  2MFZ A;  2XDV A;  1JGS A;  1WPK A;  4II3 A;  2ZME A;  3DFG A;  4Y7N J;  2DOD A;  3PO2 J;  4U7D A;  3PQJ A;  3GYH X;  3R0A A;  5GAH J;  3RCO A;  3ZN1 A;  4XIC A;  3KZY A;  2CW0 F;  1MMG A;  4BKX A;  5LEJ A;  1DGW Y;  1J75 A;  1U5T C;  3Q0W A;  2VXD A;  4HNV A;  2D45 A;  4LFU A;  4A0Z A;  4ZDP A;  3W2W A;  1ZGJ A;  2XAJ A;  5DCM A;  3COA C;  2KRH A;  2NS0 A;  4EV0 A;  4CCK A;  2D1V A;  1W4M A;  1HC8 A;  2IJL A;  1Y56 A;  3JSO A;  3WTS C;  3CMA I;  1RR7 A;  5F27 A;  2CS3 A;  3GFL A;  4L9J A;  5JVG F;  1ZG5 A;  2PJP A;  1GT0 C;  2MA3 A;  3JRI A;  1BR4 A;  4PK4 A;  4B3X A;  2Y0M A;  3BY6 A;  4JX4 A;  4RA2 A;  3QPS A;  5IP7 J;  3V7S A;  2Z5U A;  5DDG A;  3MEX A;  2OZU A;  2E19 A;  4EM1 A;  3CDL A;  4HEA 2;  4L0Z B;  2HGC A;  3RYR A;  3TQN A;  3HRT A;  1B9N A;  2GIV A;  2L4M A;  3ZN0 A;  2ZFU A;  3OYJ A;  1S9H A;  4BDZ A;  3IC7 A;  2V7F A;  1MBH A;  1V3F A;  2VQG A;  5ICC A;  3PO3 J;  2YPR A;  2F2E A;  3OYH A;  2DJN A;  5F1J A;  2CRG A;  1J0R A;  1WJ5 A;  3E5X A;  1Z9C A;  4NNJ A;  3VOE A;  3IH3 A;  1ZR4 A;  4XLE A;  4Y4R A;  4BNC A;  4AIH A;  4KIG A;  4XRS A;  3ZPL A;  1B59 A;  4II2 A;  3O6B B;  2IT0 A;  5CVI A;  3HKZ A;  1ETV A;  1N78 A;  2PMH A;  4C2T A;  1U9O A;  1WQ2 A;  1RI7 A;  2V79 A;  3BCB A;  2ZKZ A;  4BXX J;  1SAU A;  3FIW A;  4NC7 A;  1T2K A;  4HSR A;  1TQP A;  3I54 A;  4ESJ A;  1P4X A;  3VYT B;  1MBG A;  2OUM A;  2DTZ A;  3OYD A;  2QSG X;  1SEU A;  3CC4 I;  2GAU A;  5TRD A;  3B6C A;  1BOB A;  1FBU A;  5K5R A;  3TED A;  3BTJ A;  4UHT A;  2ME6 A;  4AID A;  3GBG A;  5EZH A;  1JKP C;  3AG4 H;  4IOA F;  5H2F C;  1WH7 A;  3QPT A;  2K27 A;  1OQY A;  3IAM 2;  3I59 B;  3EUK L;  1MDM A;  2B63 J;  5F04 A;  4ENN A;  4QPQ A;  2P7C B;  5KAF C;  3C2G A;  4XLP F;  4ON0 A;  1T39 A;  2KIQ A;  3HXL A;  2HQR A;  4GXO A;  2E71 A;  3SEQ A;  4B8X A;  5L3F A;  2A6T A;  2EB7 A;  1VQP I;  1QO0 D;  2LMD A;  2K3P A;  1MBK A;  1R58 A;  1IW7 F;  3BT9 A;  2MLK A;  1I27 A;  3HHG A;  4ESF A;  3JRE A;  3CUQ A;  4B1R A;  1F36 A;  1SFX A;  3T8R A;  2CV1 A;  1FP2 A;  2QBY A;  4DNC A;  1OCO H;  3FBN B;  3JW4 A;  4LGW A;  1QA6 A;  3QPH A;  2FE3 A;  4NDL A;  4WCG A;  2L02 A;  1LE8 B;  5LHH A;  3W6J B;  1R1T A;  5HS8 A;  5KAI C;  4CDG A;  1ETQ A;  1TQI A;  5JI6 A;  1V55 H;  2ICW G;  1U8R A;  1YIO A;  1K4S A;  3IH4 A;  2KRC A;  2D5V A;  1FMV A;  4XKV A;  2LY2 A;  2NVX J;  3RKQ A;  2YX7 A;  3LL7 A;  1K6O A;  2R5Z B;  2MW8 A;  2IA0 A;  3BJ6 A;  3PIP F;  5GPC A;  1FPQ A;  1D1C A;  2V9K A;  3CCY A;  2R92 J;  3E7L A;  1O7L A;  4V2G A;  2VKE A;  1HST A;  3SZT A;  4HQE A;  3ZGK A;  2Y0S A;  2KPM A;  4RGU A;  1O7F A;  2KQR A;  2HPM A;  2V9P A;  1JUP A;  2OQG A;  1HF0 A;  4DZJ A;  3SDG A;  1H9T A;  2WAF A;  5KVR A;  4FX4 A;  4TV7 A;  5FRM A;  3H9J A;  1AKH B;  1A6Q A;  2O6G E;  5C4X J;  2VQH A;  5BQT A;  1TLH B;  3ULQ B;  4RS8 A;  2WA0 A;  5JVT A;  2HZT A;  1FBQ A;  4A3G J;  2ZJQ F;  1CGP A;  1XCB A;  3QWL A;  1VF9 A;  2XF5 A;  3BWG A;  2CJJ A;  3S14 J;  4U87 A;  3KYL A;  1HOM A;  1ZEL A;  2Y69 H;  1EA3 A;  3LA2 A;  5FB2 A;  4UUS B;  2R4G A;  5H6R A;  4AWX B;  2F5C A;  1SFU A;  4XR6 A;  2XSD C;  1GDT A;  2UWM A;  4WXH A;  1F1Z A;  1PP7 U;  1SVO A;  4L18 B;  2DA1 A;  1ZQ3 P;  2EA2 A;  3S1M J;  2QUF A;  4IVN A;  4BQA A;  3J80 K;  2P6T A;  4NQW B;  3K70 C;  5DV5 A;  1LVA A;  3AG2 H;  1ZG3 A;  1ZRE A;  3E1S A;  3OYE A;  3MFK A;  1VQ8 I;  2OTL I;  4A3D J;  2JSC A;  2DDA A;  4IPA A;  2FA5 A;  2M8E A;  1DPR A;  3ROU A;  4A0Y A;  3PSF A;  1TBX A;  3U1D A;  3H3Z A;  3H0G J;  2A3S A;  1AOY A;  2LH9 A;  5J4V A;  2DU9 A;  3V8K A;  2GBY A;  4HX7 A;  3IL2 A;  5EF6 A;  1EJ9 A;  1S29 A;  1W36 D;  4XKC A;  4M6Y A;  2Z33 A;  3N4M A;  2DMP A;  2Y30 A;  4D7N A;  2JVH A;  2JRT A;  4BQQ A;  4U88 A;  5K5Q A;  2HYF A;  2OQR A;  5FJ8 J;  2EV6 A;  2M5W A;  2IRF G;  5EDN A;  4P1W A;  5E1Z B;  2K9M A;  2HVR A;  3ZMS A;  3K4K A;  1IN4 A;  2BY3 A;  4HOB A;  4LK0 F;  3CCL I;  1Z05 A;  3CO7 C;  1EH7 A;  3LMM A;  2KIS A;  2V9V A;  3JRH A;  2FML A;  3PM1 A;  3B73 A;  4BS9 A;  1XB4 A;  1PJR A;  5L3D A;  3V4G A;  1YS7 A;  1V4R A;  3DTK A;  2YSR A;  3KLN A;  2OV7 A;  1SD7 A;  3GZ5 A;  3MN2 A;  2L01 A;  2JA8 J;  3W6V A;  2G0E A;  3DKW A;  4E7K A;  1J2X A;  3CES A;  2CSO A;  3DPL C;  3LA7 A;  4Q4Z F;  1ETX A;  4EQQ A;  1Z6T A;  1BW5 A;  3I5U A;  2L54 A;  1ZTR A;  4LLL A;  1D1A A;  1ZK8 A;  3TGN A;  5IT9 Z;  2VKD A;  4C3H J;  4FCY A;  1B6A A;  3LAP A;  4B47 A;  4M9X A;  1Y8Q B;  3RZO J;  4IF4 A;  2BW3 B;  3I59 A;  2EFQ A;  1MGT A;  2MLG A;  4IX7 A;  2K3F A;  3BG3 A;  3WE2 A;  1WH5 A;  4OAY A;  2VB6 A;  4AIK A;  3JTG A;  4A3M J;  2OCE A;  2LOO A;  2RGV A;  3DP7 A;  2V6E A;  3BR5 A;  2Y48 A;  3ZR8 X;  1ON1 A;  2JA6 J;  4HST A;  4ZZL A;  4KT6 A;  4QPO A;  3JRG A;  2ZJR F;  1FY7 A;  2FRH A;  2FOK A;  2IS4 A;  2W82 A;  4HPQ A;  1SD5 A;  2WV0 A;  3VYS B;  5D4S A;  5LBQ A;  5LRS A;  2VOP A;  1MJ9 A;  5HVQ C;  4M9Z A;  2CQN A;  3L2V A;  4RAZ A;  2EZL A;  2COM A;  5D6E A;  4B44 A;  3TMO A;  1WWX A;  1S6L A;  2WBM A;  2AO9 A;  1UG2 A;  5FD5 A;  3WTY C;  3LSJ A;  5JLX A;  1IRZ A;  1ETK A;  1LE8 A;  1WI9 A;  4O5V A;  4PGH A;  4Y17 A;  5L3E A;  5E8G A;  4C2U A;  5DS9 A;  1JKO C;  1RR8 C;  4XBF A;  1G59 A;  4C2M J;  3K1M A;  5LGN A;  4A3B J;  2R5Z A;  4RGS A;  2ZFW A;  4M3B A;  3GTQ J;  1EF4 A;  4KUM A;  4DZP A;  1GV5 A;  4DQ2 A;  1TC3 C;  3ESW B;  2OPT A;  3VB2 A;  3K4C A;  3NWT A;  3JR9 A;  1XGM A;  4UUV A;  2VE8 A;  2D2W A;  3EDP A;  1BI3 A;  2KKO A;  4A3K J;  1E2X A;  2W4S A;  2BVL A;  4Y13 A;  4EEF G;  1Z67 A;  1LEB A;  4HNU A;  1HA8 A;  4BY1 J;  1CQT A;  2K5C A;  2QLZ A;  1FWZ A;  4I02 A;  2WAE A;  3E6C C;  3V7R A;  1O4X A;  1AKH A;  1IN5 A;  3ZMZ A;  2CV0 A;  5FKM A;  2K4B A;  4RBO A;  1R5H A;  3S1R J;  1YW9 A;  3BR2 A;  2LNB A;  4HV5 A;  1BI2 A;  2FD5 A;  3K69 A;  3P5J A;  3PNY A;  2GA1 A;  4MHG A;  3M07 A;  3G71 I;  2HEO A;  2CQK A;  2IAI A;  1POG A;  2ZSI B;  4KMU X;  4YFK F;  4MQV A;  5E3M A;  5EYR A;  4BUP A;  4HA8 A;  3LA3 A;  3UKG A;  1HW2 A;  4UUS A;  5FD6 A;  4F7Z A;  4A3L J;  2PQ8 A;  2IEK A;  2LTP A;  2R7R A;  2Z1D A;  5E79 C;  3HTU A;  3QOD A;  2L7F P;  5FLX Z;  3S3M A;  1HBX G;  6PAX A;  1MND A;  4NQW A;  1F5T A;  3S2D J;  5IYD J;  5DUK A;  2XAU A;  4MNU A;  1QVU A;  3CP8 A;  2WAQ A;  2CMP A;  2F6C A;  4OOI A;  5AIQ A;  1FSE A;  2IGM A;  2P5L C;  2F4O B;  2KIF A;  4YG2 F;  2KMU A;  5BOX A;  1I1G A;  4IHS A;  1X4P A;  3GEZ A;  1FOX A;  2EZI A;  1QQI A;  2VPR A;  4CYD A;  1B4A A;  3FXL A;  5K7H A;  2DA6 A;  2AS5 F;  3OV8 A;  2K85 A;  2QKM B;  1NK3 P;  3ZQG A;  2M7A A;  2WB1 A;  3VOD A;  4ZTF A;  5JR3 A;  4LK1 F;  2DBB A;  3C2B A;  1B8I B;  3R60 A;  4MIM A;  3HOT A;  1A6I A;  3C1D A;  5C4J J;  3ZQF A;  1S7E A;  2VBY A;  5HOD A;  4GRI A;  3ZQL A;  5GAG J;  2KLO A;  4QTR A;  1JKQ C;  3WG7 H;  1I3A A;  1LNW A;  3FKJ A;  1QPM A;  4G9Y A;  4XK4 A;  2IGO A;  4UNO A;  4DBQ A;  1ZR2 A;  3JRD A;  3WTV C;  4RGX A;  3RKX A;  1BJA A;  3TL4 X;  4XLN F;  2HTJ A;  3DEW A;  3TW6 A;  2LBF B;  3LQR A;  3BPX A;  1HDD C;  4DW6 A;  3AL0 B;  1WJF A;  3OSF A;  2E5Z A;  1YJW I;  2EJR A;  2L9S A;  1X1A A;  3QYF A;  2DI3 A;  5IYC J;  3G3Z A;  4LLN A;  1BI1 A;  4HF1 A;  2M45 A;  3IWZ A;  3I58 A;  3CCU I;  1QZE A;  1BBY A;  5J8F A;  2BW3 A;  2JUC A;  4HF0 A;  1S7A A;  2KIM A;  3K4M A;  4HYE A;  3K0L A;  5CQE A;  1STZ A;  2JQ7 A;  1JXS A;  1XSV A;  2TCT A;  4JX6 A;  4X6A J;  3HOY J;  2K7L A;  2BV6 A;  4BGD A;  1UB9 A;  3N97 A;  5JLW A;  2E36 A;  5M5W J;  1FYK A;  1QU3 A;  3IV5 A;  2NVT J;  4HX4 A;  3CLQ A;  3H9G A;  1S8N A;  1R5I D;  1AA7 A;  1ITY A;  3T5X A;  1HCR A;  4DYQ A;  1I1S A;  2ZJ2 A;  2OF7 A;  4YIF A;  2C6Y A;  4FE4 A;  2LKX A;  3FDY A;  2DDB A;  2K40 A;  2F4I A;  1G3S A;  2XUB A;  3HTS B;  2A6E F;  1WKM A;  2XF6 A;  3AG3 H;  3K7A J;  4L5E A;  5E3O A;  4BDY A;  2QF7 A;  3DPT A;  3GTK J;  3EQL F;  1K78 A;  1R36 A;  1OCC H;  4B3A A;  4BE1 A;  5F08 A;  4ASN A;  2BBY A;  4UVA A;  3Q3S A;  2VOD A;  1OCZ H;  3F22 A;  2VLA A;  2BXY A;  3ZP5 A;  3J7A Y;  4FTH A;  4MFD A;  3Q5F A;  2Z9O A;  4D0P A;  3FMR A;  3K2Z A;  2HYG D;  2LG4 A;  3CLO A;  4LIV A;  4I01 A;  1D5Y A;  4CSW A;  3KZI C;  3JAM Z;  3WU0 A;  2P5V A;  5E20 A;  2XRL A;  4Q47 A;  2O8X A;  3ASO H;  4W97 A;  3F23 A;  3OMY A;  4PJ0 C;  2XGC A;  3E3V A;  2V6C A;  3CCR I;  2X4H A;  3F8N A;  3OWT A;  1MMD A;  3BJO A;  1RNL A;  1EH8 A;  4F93 B;  4A12 A;  4EJV A;  5HNH A;  2EIL H;  1PUE E;  1VQ5 I;  3CCM I;  3QPL A;  3PNT A;  3HOX J;  4M3F A;  1YFH A;  3BOQ A;  3F21 A;  4IEJ A;  4B48 A;  2JZY A;  4XKB A;  1UJ8 A;  2HOT A;  3BTI A;  1UFM A;  4QWQ A;  3TO7 A;  3EUH A;  3OYB A;  4KIF A;  1H89 C;  3GVA A;  3LSG A;  4A69 C;  1D1B A;  2E1O A;  5D6F A;  3QOP A;  3G4S I;  2UUZ A;  3JTH A;  4BY7 J;  3I9V 2;  4G7H F;  4X1E A;  5GAE J;  4BBS J;  5FRO A;  3FXK A;  3QP6 A;  2XB0 X;  4DIQ A;  3LSR A;  1R23 A;  5DM6 F;  1GHC A;  4EAT A;  2P6S A;  2O9L A;  2VN2 A;  2EA4 A;  3SFZ A;  3K4B A;  3OS2 A;  4YFX F;  3ABT A;  3T1B A;  2XGE A;  2L9R A;  5IP9 J;  3I64 A;  3HJE A;  4KN4 X;  4DGW B;  5D5U B;  2R7Q A;  4XQF A;  1U5T B;  4CXF A;  1RKW A;  4ZYG A;  2L0K A;  2OTJ I;  3CMM A;  5D5X B;  2DA3 A;  3CCJ I;  1Y0U A;  4IRH A;  2Q1Z B;  1FBS A;  5B1B H;  2LYC A;  2E2I J;  1MJB A;  1FTZ A;  3IUO A;  4AVP A;  3TDZ C;  3QQA A;  3BR1 A;  3BZ6 A;  3TOA A;  1LPQ A;  2XPW A;  2P4W A;  1Y8R B;  2HFH A;  3CJT B;  1IUY A;  2NOJ B;  1U9N A;  3DV8 A;  2VON A;  4WF2 A;  1B8I A;  1C0W A;  4NUB A;  3QYE A;  2PMZ A;  3CJQ B;  1F9N A;  4FHT A;  2RNJ A;  3OYC A;  2XVC A;  1JJ6 C;  3BLY A;  1SFK A;  4EM0 B;  5H6Q A;  4A3I J;  2H8R A;  5LGU A;  1VQM I;  4FX0 A;  4UUT A;  4NBQ A;  4I7H A;  2DFI A;  3UNG C;  2B7E A;  4W1U A;  3WU2 C;  4E7H A;  2RV8 A;  4PJL A;  2DXI A;  4JX5 A;  5CVV A;  4ZYH A;  1QGP A;  1LFB A;  3J7Y J;  2UV1 A;  2Y31 A;  2ACJ A;  2LF7 A;  2FX0 A;  3BR3 A;  3LFU A;  3BG7 A;  3MMY B;  2XAQ A;  2K9N A;  1KYZ A;  2LBF A;  1O57 A;  4LG3 A;  4HQM A;  3GTJ J;  5L3C A;  2X51 A;  4G12 A;  2QGU A;  4ZYD A;  1L3L A;  4L9T A;  2O8K A;  2JVG A;  3VYU B;  3NAU A;  5B5E C;  3HM5 A;  1MSE C;  4XN3 A;  2KJC A;  1XSD A;  2DTR A;  2QSF X;  3K70 D;  4F3Q A;  1TWA J;  2M3A A;  2QZ8 A;  3KX2 A;  2PMU A;  3IHU A;  3KP7 A;  4PUS A;  2P0W A;  1G2H A;  4O6J A;  5IPA A;  1ZGW A;  4KIS A;  5IT3 A;  5D8L B;  4KA4 A;  4BAC A;  4PZJ A;  3KP2 A;  4EMS A;  4IQJ A;  4GO1 A;  1XGN A;  2E1M C;  2YU9 J;  2ZJP F;  2LFB A;  3H5R A;  4IRI A;  2DOF A;  3MWM A;  2X6Y A;  1UHS A;  2FNP A;  2FUG 2;  2DPD A;  2XHK A;  3LSP A;  1NG7 A;  3OYN A;  3H0D A;  3ZMV A;  4B4C A;  1XMX A;  3H36 A;  3CMY A;  1UEL B;  3WHB A;  4RM3 A;  2H6C A;  3MZH A;  1AHD P;  2TRT A;  2EK5 A;  1W5T A;  3M3Y J;  2QEN A;  1LDJ A;  2JUG A;  3ERE D;  3I55 I;  1BJZ A;  2XPV A;  4V19 K;  1RES A;  1FTT A;  2Z99 A; 
#chains in the Genus database with same CATH homology
 1HSJ A;  3R6S A;  1ZRC A;  1FC3 A;  2MC3 A;  4A5M A;  3J7A O;  1ZAO A;  2DW4 A;  2JPC A;  3M8E A;  1ZAR A;  2PFB A;  2VE9 A;  3RKW A;  3HRS A;  4AD9 A;  3WTT C;  1J5Y A;  1I5Z A;  2ESH A;  3O2P E;  2CO5 A;  1SMT A;  4RB1 A;  2Y75 A;  4Y15 A;  3ZMU A;  3KFW X;  4R79 A;  1WSU A;  4ENK A;  2PBI A;  3C18 A;  3RYP A;  1IZ1 A;  1Q1H A;  4BYY A;  3FXR A;  5HOO A;  4U0V A;  4HDV A;  2FSW A;  3D0S A;  3J80 Z;  3DEU A;  2XIG A;  3QU6 A;  1DP7 P;  2A6H F;  2MH2 A;  1KQ0 A;  1U5T A;  1SD4 A;  4ENJ A;  1BC7 C;  3FF5 A;  2RVC A;  4Q5S F;  4OIP F;  1XSX A;  1FZP B;  3IKT A;  1PDN C;  4NHJ A;  1XGS A;  3PQK A;  5BPD A;  5CLS A;  1S7O A;  1YO5 C;  3BJA A;  2D1H A;  1IXC A;  1P92 A;  1XD7 A;  4KN7 X;  4RB3 C;  3T8T A;  2STT A;  2EFO A;  3WTW C;  2PLY A;  4ETS A;  3P9C A;  3CO6 C;  4KIB A;  2A68 F;  4HLY A;  3TKY A;  1UST A;  1USS A;  3MCZ A;  3QAH A;  1RUN A;  1R00 A;  3F8C A;  4HZF A;  1G3T A;  3L9F A;  2Q0O A;  3GF2 A;  1P4W A;  2NNN A;  5DEQ A;  4LMY A;  1T38 A;  1R1V A;  3MZY A;  1KYW A;  2IA2 A;  1P2F A;  3GFJ A;  2E7W A;  3WOD F;  4I2O A;  2JT1 A;  1ULY A;  1XGO A;  2FBH A;  4PDK A;  3L00 A;  2K4J A;  4P55 A;  2BYV E;  2FU4 A;  4OMY A;  4U0W A;  4ZYE A;  2EWN A;  5LHG A;  3FM3 A;  1OYY A;  3R4K A;  4RAY A;  3BPV A;  4HF2 A;  3RKY A;  3F8B A;  3RTR A;  5JHU A;  1U78 A;  2ESN A;  1G6N A;  4HW0 A;  2IA1 A;  2XAS A;  3GWZ A;  2E1N A;  1A04 A;  4MGR A;  4IHT A;  3CDH A;  1O3R A;  3M7G A;  4S04 A;  4QLC U;  4I0B A;  1HKQ A;  1DPU A;  3I71 A;  1FP1 D;  1XMA A;  3E6M A;  3E5U A;  1K78 B;  3LST A;  1B9M A;  2FBK A;  2OU2 A;  4OIQ F;  1W7P B;  2J5O A;  2A07 F;  3R61 A;  4EJW A;  1HKT A;  1BOA A;  2A5Y B;  2STW A;  2GQQ A;  1YQA A;  3FMQ A;  1BN5 A;  2UZK A;  3LWF A;  5L3B A;  3L7W A;  4M6X A;  2FF4 A;  3JSP A;  3WTU C;  2YU3 A;  3VFZ A;  2V1U A;  3IWF A;  1G4D A;  1HKS A;  2M87 A;  5F64 A;  2VC1 A;  3NQO A;  2CG4 A;  3TDU C;  4A2U A;  1X3U A;  3ELK A;  4MEX F;  3EYY A;  2R3S A;  1SMY F;  3ZMD A;  2M30 A;  4UXN A;  4XSZ F;  4LB6 B;  5DCF A;  4G94 A;  4CO8 A;  2GXG A;  4YFN F;  2DPU A;  3DF8 A;  1J59 A;  4MTD A;  3K1N A;  1XDU A;  3GO5 A;  1U2W A;  4N9H A;  2Q2E A;  4G6Q A;  3WGG A;  2FEZ A;  1EH6 A;  1ZG1 A;  4KNY A;  3F6V A;  5E1X A;  2W57 A;  5FFZ A;  2EV5 A;  2B0L A;  4WK8 F;  1HW1 A;  4HLX A;  4L5I A;  1SFE A;  2DK8 A;  2DO7 A;  3KEQ A;  2ELH A;  2GXB A;  4LG0 B;  5EEH A;  1QZZ A;  3SXY A;  1FT9 A;  2YR2 A;  4CGZ A;  3HSF A;  3F6O A;  4AIJ A;  4WXC A;  4EJU A;  2CGP A;  3EET A;  5TJJ A;  3M8F A;  1GXQ A;  2DQL A;  3ECO A;  2EFW A;  4CHU A;  4EJT A;  1Z1D A;  3FZV A;  4I98 B;  5CVJ A;  2IVM A;  1R22 A;  4M72 A;  5D8K B;  4M73 A;  1KGS A;  4KT5 C;  3RPQ A;  3F72 A;  2FXA A;  1XDS A;  3HUG A;  3EYI A;  5D5V B;  1DUX C;  2FNA A;  1FNN A;  2X0L A;  1ZN2 A;  2F5D A;  3ECH A;  5FO5 A;  1U3E M;  3BRO A;  1IN7 A;  3ABU A;  1D8K A;  1P4A A;  2A69 F;  3P9K A;  4KDP A;  4ZH4 F;  5ICE A;  1RUO A;  1O3Q A;  3GXO A;  1LQ1 A;  2IPQ X;  5K5O A;  4EVI A;  2CYY A;  3QP5 A;  4UV8 A;  2DK5 A;  3WG9 A;  3C7J A;  4L9V A;  4HX8 A;  1R1U A;  2XAH A;  1W7P A;  2P5K A;  1GXP A;  4N9I A;  2FQ3 A;  5ILS A;  2W24 A;  3ISP A;  1OPC A;  4UV9 A;  1F4K A;  4BHB A;  1HXD A;  3U2R A;  1ZLJ A;  4A6E A;  2OD5 A;  4OU0 A;  2HS5 A;  2ZBK A;  3L2C A;  2ZXJ A;  2VT3 A;  5FFX A;  3R0J A;  1JHH A;  1H9G A;  5D4R A;  4G7Z F;  3HRU A;  2EV0 A;  5H20 A;  4A6D A;  1RZ4 A;  4OMZ A;  4GGG A;  3P7N A;  4HBL A;  3CJN A;  3KZZ A;  3E6B A;  1ZLK A;  4KYW A;  3KLO A;  2NNY A;  2HKO A;  2GA2 A;  4LLG F;  3KET A;  3FXQ A;  5J8C A;  2MH9 A;  5BPI A;  3CUQ C;  2OAZ A;  2NYX A;  1OKR A;  1T6S A;  4PCQ A;  1MD0 A;  5LRR A;  1S3J A;  3B02 A;  3QU3 A;  3T0Y A;  4GYI A;  1YTY A;  4NB5 A;  3M9A A;  2RC4 A;  2E7X A;  1UCR A;  1EV7 A;  4BXU A;  4A0X A;  4YII A;  1ODD A;  2MBF A;  3GLX A;  3MQ0 A;  4RB0 A;  4LG0 A;  1FYL A;  3J81 K;  1ZYR F;  3NEU A;  5HLI A;  4KFC A;  4A5N A;  4P9U A;  2W25 A;  2LSO A;  3KP5 A;  2JTV A;  1R7J A;  2VBW A;  2IP2 A;  3LQQ A;  3CTA A;  4OIO F;  2PN6 A;  4WX9 A;  3K9T A;  3DQV C;  5ERI A;  2RN7 A;  1K7A A;  4MQ9 F;  2IW5 A;  2BEO A;  3IKV A;  2K86 A;  4IXA A;  2PG4 A;  3FX3 A;  2XKP A;  2G9W A;  2HKX A;  1YW7 A;  4FT8 A;  3KE2 A;  3F8M A;  3O3K A;  5DUI A;  3GX4 X;  1GVJ A;  4HAM A;  1RIO H;  3L09 A;  1YLF A;  4MTE A;  3WTX C;  3D5L A;  1Z91 A;  4G6D A;  1KA8 A;  1AWC A;  1PP8 F;  4Q48 A;  5E17 F;  3TO6 A;  2O03 A;  2QQ9 A;  1LJ9 A;  3DXJ F;  2RQP A;  1YG2 A;  5A2Q Z;  2P7V B;  3WGH A;  4N0B A;  5HLG A;  4G7O F;  3I4P A;  4JK1 X;  1FSH A;  3KP3 A;  3QRF F;  4M9S A;  3SQN A;  3KP6 A;  2P8T A;  4ESB A;  3KCC A;  2WTE A;  1IAW A;  5CYV A;  2VOO A;  1IRG A;  1CF7 B;  1OMI A;  3I0T A;  1R5G A;  2XAF A;  5A2Q K;  1IF1 A;  1TW2 A;  2XGX A;  2L3D A;  5E1W A;  1MKM A;  5D5W B;  4WWC A;  4L0Y B;  4HV6 A;  1ZRD A;  2DQR A;  4BHC A;  1E17 A;  1BM9 A;  2AXL A;  1FOK A;  3HHH A;  3AAF A;  2ZNY A;  3FHZ A;  2QQA A;  4L5J A;  2LDU A;  1IRF A;  5CVR A;  2Q8K A;  2GZW A;  3U9G A;  5ED4 A;  4EGZ A;  2O61 A;  2W84 A;  5E18 F;  1JE8 A;  4RGR A;  4CIC A;  1BC8 C;  2O0Y A;  2M1B A;  2NAZ A;  1HQC A;  1W7P D;  4IRG A;  4R1H A;  4WXD A;  1TQM A;  1G3Y A;  5HS7 A;  1ONV A;  3LAJ A;  5F1R A;  5K1Y A;  5HDK A;  2HR3 A;  2GWR A;  2F5E A;  2LKP A;  1D8J A;  5DD4 A;  1YYV A;  3HYI A;  2HDC A;  4OIR F;  3RDI A;  2V1X A;  3P9I A;  3GZ6 A;  4KMF A;  1YS6 A;  3PFI A;  5LGT A;  1UHW A;  5L3G A;  5FGM A;  1NHA A;  3VEP A;  4LB5 A;  4O3M A;  4I0A A;  1YW8 A;  2QWW A;  3E97 A;  4ZZD A;  1I6X A;  1LDK B;  4EGY A;  1JHF A;  1QNT A;  4EJO A;  2ETH A;  1ON2 A;  5ICG A;  1LDD A;  2O3F A;  2V1D A;  3HOS A;  2ADU A;  3ZMT A;  3TO9 A;  2OZ6 A;  1KU2 A;  2FMY A;  4JBA A;  3IRQ A;  1Z7U A;  1B1B A;  3KP4 A;  4ENM A;  1K79 A;  3HSR A;  2KIU A;  1O3T A;  4BAY A;  5HS9 A;  3V8L A;  4MEY F;  2VXZ A;  5HLH A;  4BH9 A;  3SHF A;  2H09 A;  3HIF A;  2NRA C;  3WGI A;  4U0Y A;  1TNT A;  3Q9V A;  3E5Q A;  2K02 A;  5HDN A;  2UXX A;  2PI0 A;  4BHP A;  4KIC A;  1CF7 A;  5HDG A;  3ML6 A;  4P96 A;  2EFP A;  4E70 A;  5J6X A;  1TNS A;  5KK1 A;  2RDP A;  1O3S A;  4P9F A;  5LEK A;  2JPB A;  4K2E A;  5IT9 K;  1UHM A;  1L0O C;  2ZCW A;  1KU9 A;  3BP8 A;  1LEA A;  4S05 A;  2HQN A;  2ZO4 A;  3H3U A;  3I53 A;  3Q9S A;  3W6K B;  2W85 A;  3SZP A;  3FMS A;  1H0M A;  3KEO A;  1QZY A;  3M1E A;  1REP C;  3MAJ A;  5EEG A;  4M71 A;  3WTZ A;  2DAO A;  2R7F A;  5DD8 A;  1DDN A;  1IN8 A;  2G7U A;  3K1P A;  4G8X A;  2BE5 F;  1FYM A;  2UXN A;  2EFN A;  4P5O A;  1LB2 A;  1IXS B;  1MZB A;  3WU1 B;  1FLI A;  3RJP A;  5ILV A;  1BIB A;  1P6R A;  4EM2 A;  3TOB A;  2YX4 A;  4JQF A;  4HDU A;  2XKO A;  3S2W A;  3WE3 A;  2DT5 A;  1KQ8 A;  1OYI A;  1ZRF A;  3OOP A;  3GW2 A;  2ZME B;  4LD5 A;  4XSX F;  2XV4 S;  5LLQ A;  3GFI A;  2XRN A;  1D5V A;  2QQB A;  2ISZ A;  5F6F A;  1OR7 A;  4UVB A;  1SD6 A;  2J5P A;  2VT2 A;  5LHI A;  4IJA A;  2FBI A;  2CWE A;  3E6D A;  2BGC A;  5DCM B;  5FLX K;  1ZH5 A;  2HTS A;  4GYG A;  1J7K A;  2VBZ A;  2L4A A;  1T0F A;  2H27 A;  1HW5 A;  3IRR A;  3V7C A;  1W5S A;  2CFX A;  3RIR A;  3REO A;  1XN7 A;  4GCV A;  1Z6R A;  2E1C A;  3LFK A;  2QVO A;  2A61 A;  1J9I A;  4UVC A;  3GUD A;  2DLL A;  3GFM A;  5AIP A;  1T98 A;  3BDD A;  1BIA A;  4L9N A;  2H94 A;  2QM3 A;  2VBX A;  2PEX A;  2HOE A;  3FWE A;  2XRO A;  5E8I A;  5DYM A;  4PGG A;  5CVU A;  3G73 A;  1MJA A;  1U6G A;  4CZZ A;  1FX7 A;  1KU3 A;  3FM5 A;  1G3W A;  1ZHF A;  1XMK A;  2Z3Y A;  5JFR A;  2G7H A;  2WC2 A;  3NRV A;  5AON A;  2WWY A;  1KU7 A;  3V8J A;  1VTN C;  3HRM A;  4RB2 C;  2OA4 A;  1TTY A;  4R8H A;  3FXU A;  5ILU A;  3ZQ7 A;  5BS6 A;  1MDM B;  2XAG A;  1WRJ A;  3HSE A;  2RKH A;  1XCV A;  3CUO A;  2QYO A;  3F8F A;  2VC0 A;  2KRF A;  4M74 A;  2TDX A;  3C3W A;  4OIN F;  4H0E A;  5BMZ A;  4LJZ F;  4U7B A;  1QBJ A;  4XRF A;  1ZGA A;  2MD5 A;  3CUQ B;  2ISY A;  3RPU A;  2QBY B;  1OYW A;  2H6B A;  2OBP A;  4I09 A;  3F3X A;  1IXR C;  1TW3 A;  2HWV A;  1SAX A;  5CJ9 A;  4Z2Y A;  5ICF A;  3J81 Z;  2ZNZ A;  2KJB A;  4B09 A;  1IN6 A;  3JAM K;  2F5F A;  3RI4 A;  2R7D A;  3H92 A;  1KQ9 A;  2LF8 A;  1BI0 A;  1D3Y A;  1JGS A;  2ZME A;  3DFG A;  4U7D A;  3PQJ A;  3GYH X;  3R0A A;  3ZN1 A;  3KZY A;  2CW0 F;  5LEJ A;  1J75 A;  1U5T C;  2D45 A;  4LFU A;  4A0Z A;  1ZGJ A;  2XAJ A;  5DCM A;  3COA C;  2NS0 A;  4EV0 A;  2D1V A;  1W4M A;  2IJL A;  3JSO A;  3WTS C;  3GFL A;  4L9J A;  1ZG5 A;  2PJP A;  2MA3 A;  2Y0M A;  3BY6 A;  3V7S A;  2Z5U A;  5DDG A;  3MEX A;  2OZU A;  4EM1 A;  4L0Z B;  2HGC A;  3RYR A;  3TQN A;  3HRT A;  1B9N A;  2GIV A;  2L4M A;  3ZN0 A;  3IC7 A;  1V3F A;  5ICC A;  2YPR A;  2F2E A;  1J0R A;  3E5X A;  1Z9C A;  3VOE A;  4BNC A;  4AIH A;  4KIG A;  3ZPL A;  1B59 A;  3O6B B;  2IT0 A;  5CVI A;  2PMH A;  1WQ2 A;  1RI7 A;  2V79 A;  2ZKZ A;  1T2K A;  1TQP A;  3I54 A;  4ESJ A;  1P4X A;  2GAU A;  5TRD A;  1FBU A;  5K5R A;  4UHT A;  3QPT A;  2K27 A;  3I59 B;  1MDM A;  4ENN A;  2P7C B;  4XLP F;  4ON0 A;  1T39 A;  2HQR A;  4GXO A;  4B8X A;  5L3F A;  2EB7 A;  1QO0 D;  1R58 A;  1IW7 F;  2MLK A;  1I27 A;  3HHG A;  4ESF A;  3CUQ A;  1SFX A;  3T8R A;  1FP2 A;  2QBY A;  4DNC A;  3JW4 A;  4LGW A;  3QPH A;  2FE3 A;  4WCG A;  2L02 A;  5LHH A;  3W6J B;  1R1T A;  5HS8 A;  4CDG A;  1TQI A;  5JI6 A;  1U8R A;  1YIO A;  2YX7 A;  1K6O A;  3BJ6 A;  2IA0 A;  1FPQ A;  1O7L A;  1HST A;  3SZT A;  4HQE A;  4RGU A;  1O7F A;  2OQG A;  1H9T A;  5KVR A;  4FX4 A;  4TV7 A;  2O6G E;  5BQT A;  1TLH B;  3ULQ B;  4RS8 A;  5JVT A;  2HZT A;  1FBQ A;  1CGP A;  1XCB A;  3BWG A;  3LA2 A;  5FB2 A;  1SFU A;  5H6R A;  4AWX B;  2F5C A;  2UWM A;  4WXH A;  1F1Z A;  1PP7 U;  4L18 B;  2EA2 A;  2QUF A;  4IVN A;  4BQA A;  3J80 K;  2P6T A;  5DV5 A;  1LVA A;  1ZG3 A;  1ZRE A;  3MFK A;  2JSC A;  4IPA A;  2FA5 A;  2M8E A;  1DPR A;  3ROU A;  4A0Y A;  1TBX A;  3U1D A;  3H3Z A;  2A3S A;  1AOY A;  2DU9 A;  3V8K A;  4HX7 A;  3IL2 A;  1S29 A;  4M6Y A;  2Z33 A;  3N4M A;  2JRT A;  5K5Q A;  4U88 A;  2HYF A;  2OQR A;  2EV6 A;  2M5W A;  2IRF G;  5E1Z B;  3ZMS A;  1IN4 A;  4HOB A;  4LK0 F;  1Z05 A;  3CO7 C;  1EH7 A;  2V9V A;  2FML A;  3B73 A;  1XB4 A;  5L3D A;  3V4G A;  1YS7 A;  1V4R A;  2YSR A;  3KLN A;  1SD7 A;  3GZ5 A;  2L01 A;  3DKW A;  1J2X A;  2CSO A;  3DPL C;  3LA7 A;  4Q4Z F;  4EQQ A;  1Z6T A;  3I5U A;  2L54 A;  4LLL A;  3TGN A;  5IT9 Z;  1B6A A;  3LAP A;  4M9X A;  4IF4 A;  3I59 A;  2EFQ A;  1MGT A;  2MLG A;  3WE2 A;  4AIK A;  3JTG A;  2RGV A;  3DP7 A;  2Y48 A;  1ON1 A;  4ZZL A;  1FY7 A;  2FRH A;  2FOK A;  2VOP A;  1SD5 A;  2WV0 A;  5D4S A;  5LBQ A;  5LRS A;  1MJ9 A;  5HVQ C;  4M9Z A;  4RAZ A;  2COM A;  5D6E A;  1WWX A;  1S6L A;  5FD5 A;  3WTY C;  1WI9 A;  4O5V A;  4PGH A;  4Y17 A;  5L3E A;  5E8G A;  4XBF A;  3K1M A;  5LGN A;  4RGS A;  2ZFW A;  4KUM A;  4DQ2 A;  3VB2 A;  1XGM A;  4UUV A;  2VE8 A;  2D2W A;  3EDP A;  1BI3 A;  2KKO A;  1E2X A;  4Y13 A;  1LEB A;  2QLZ A;  1FWZ A;  4I02 A;  3E6C C;  3V7R A;  1IN5 A;  3ZMZ A;  2K4B A;  1R5H A;  1YW9 A;  2LNB A;  4HV5 A;  1BI2 A;  3K69 A;  2HEO A;  2GA1 A;  4MHG A;  2CQK A;  4KMU X;  4YFK F;  4MQV A;  4HA8 A;  3LA3 A;  1HW2 A;  5FD6 A;  4F7Z A;  2PQ8 A;  3HTU A;  5FLX Z;  1HBX G;  6PAX A;  4NQW A;  1F5T A;  5DUK A;  4MNU A;  5AIQ A;  4OOI A;  1FSE A;  2P5L C;  2KIF A;  4YG2 F;  5BOX A;  1I1G A;  4IHS A;  3GEZ A;  1QQI A;  4CYD A;  1B4A A;  2AS5 F;  3OV8 A;  3VOD A;  5JR3 A;  4LK1 F;  2DBB A;  3R60 A;  3HOT A;  3C1D A;  2VBY A;  1LNW A;  4G9Y A;  1QPM A;  4UNO A;  3WTV C;  4RGX A;  3RKX A;  1BJA A;  4XLN F;  2HTJ A;  3LQR A;  3BPX A;  2EJR A;  2DI3 A;  3G3Z A;  4LLN A;  1BI1 A;  4HF1 A;  2M45 A;  3IWZ A;  3I58 A;  1BBY A;  5J8F A;  4HF0 A;  1S7A A;  2KIM A;  4HYE A;  3K0L A;  1STZ A;  1JXS A;  1XSV A;  2K7L A;  2BV6 A;  1UB9 A;  3N97 A;  1FYK A;  4HX4 A;  1S8N A;  3T5X A;  1I1S A;  2ZJ2 A;  4YIF A;  2C6Y A;  1G3S A;  2XUB A;  3HTS B;  2A6E F;  1WKM A;  3DPT A;  3EQL F;  1K78 A;  1R36 A;  4ASN A;  2BBY A;  4UVA A;  2VOD A;  3ZP5 A;  3F22 A;  3Q5F A;  2Z9O A;  4D0P A;  3FMR A;  3K2Z A;  2HYG D;  3CLO A;  4I01 A;  3JAM Z;  3WU0 A;  2P5V A;  5E20 A;  4Q47 A;  2O8X A;  3F23 A;  3E3V A;  2V6C A;  2X4H A;  3F8N A;  3BJO A;  1RNL A;  1EH8 A;  4A12 A;  4EJV A;  1PUE E;  1YFH A;  3BOQ A;  3F21 A;  2JZY A;  1UFM A;  4QWQ A;  3TO7 A;  3EUH A;  4KIF A;  3GVA A;  5D6F A;  3QOP A;  3JTH A;  4G7H F;  3QP6 A;  1R23 A;  1GHC A;  2P6S A;  2VN2 A;  2EA4 A;  3SFZ A;  4YFX F;  3ABT A;  3T1B A;  3I64 A;  4KN4 X;  5D5U B;  1U5T B;  4CXF A;  4ZYG A;  5D5X B;  1Y0U A;  4IRH A;  1FBS A;  1MJB A;  4AVP A;  3TDZ C;  3BZ6 A;  3TOA A;  2P4W A;  2HFH A;  1IUY A;  3DV8 A;  2VON A;  4WF2 A;  1C0W A;  1F9N A;  4FHT A;  2RNJ A;  2XVC A;  4EM0 B;  5H6Q A;  5LGU A;  4FX0 A;  4I7H A;  2DFI A;  2RV8 A;  5CVV A;  4ZYH A;  1QGP A;  2ACJ A;  2LF7 A;  2XAQ A;  1KYZ A;  1O57 A;  4HQM A;  5L3C A;  4ZYD A;  1L3L A;  4L9T A;  2KJC A;  1XSD A;  2DTR A;  2QZ8 A;  2PMU A;  3IHU A;  3KP7 A;  4O6J A;  5IT3 A;  5D8L B;  4KA4 A;  4PZJ A;  3KP2 A;  4EMS A;  4GO1 A;  1XGN A;  4IRI A;  3MWM A;  2FNP A;  2DPD A;  2XHK A;  3ZMV A;  2H6C A;  3MZH A;  2EK5 A;  1W5T A;  2QEN A;  1LDJ A;  3ERE D;  2Z99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...