2FRHA

Crystal structure of sara, a transcription regulator from staphylococcus aureus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
127
structure length
127
Chain Sequence
b'GSHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal accessory regulator A
publication title Structural and function analyses of the global regulatory protein SarA from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 41
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2frhA00
1Z7UA 2HEOA 3KLNA 5D5VB 3K0LA 2FE3A 2W24A 3SZPA 5ICCA 3I53A 2V9VA 2V1UA 2A6HF 2ZFWA 3JTHA 3RYRA 2IVMA 3JSPA 2MD5A 1HKQA 4ETSA 1G4DA 3JW4A 1XB4A 1IRFA 3T1BA 4L0YB 5DCMA 4M9SA 4D0PA 2LKPA 4JBAA 1IXSB 1G3YA 2ESHA 3R61A 3F6OA 5CVUA 2RKHA 1LDKB 4IRGA 2D45A 3LA2A 3R60A 2Z5UA 2CYYA 3CTAA 1P4WA 3WTSC 4BXUA 5HDKA 4OOIA 3IWFA 1FP1D 5E8GA 2VOPA 4BYYA 1QBJA 3J80Z 2COMA 2M30A 3E6MA 4RAYA 5FFXA 2GIVA 5JR3A 4IVNA 4BNCA 4MQVA 3ULQB 4IRHA 2NRAC 4BH9A 3E6CC 1UHWA 3ZMZA 4O6JA 2JZYA 2YSRA 1R1VA 1JHFA 3CUOA 5EEGA 1MGTA 4I2OA 1BBYA 4WXCA 2OA4A 2QBYB 2FNPA 3ZP5A 4Q48A 5IT9K 2M8EA 4YFKF 2FEZA 3OOPA 2F5CA 2ZNZA 1D5VA 3IC7A 3ROUA 1YLFA 2PMUA 1XSXA 5CVIA 2JRTA 3F8FA 3FHZA 5A2QZ 1XN7A 2DI3A 2PFBA 4IJAA 1R58A 3KFWX 4CZZA 4RGXA 3LFKA 3CO7C 3QP5A 4ENMA 3KP3A 1W7PD 1O7FA 1V4RA 4AIKA 4YG2F 1T6SA 2GXGA 3M1EA 1BI1A 1KU9A 2V1XA 4UVAA 4IXAA 1U5TC 1DP7P 2R7DA 2F2EA 2DPDA 5ERIA 2O6GE 4G7OF 2QQ9A 1S7OA 1RZ4A 1JE8A 3V7SA 4Z2YA 3DPLC 4A6EA 3SZTA 3BZ6A 2HYGD 3REOA 1XGNA 1FYMA 3TO7A 3ZMUA 2MLKA 3IL2A 4M74A 2HZTA 3FZVA 5TRDA 4UUVA 4IPAA 4A0XA 4L9JA 2HS5A 4FX4A 2NS0A 2NAZA 2STTA 3F23A 3PFIA 5HLHA 1R22A 3QU3A 2L54A 3IRRA 4OIRF 1B6AA 2EB7A 1A04A 3F72A 3L9FA 1R00A 1R36A 2VBXA 3NQOA 4A0ZA 2DQLA 1WKMA 1L3LA 2Z33A 2CO5A 1BN5A 2XROA 1ODDA 1K6OA 4ESBA 3CDHA 3HUGA 1K78B 1BC7C 1P4AA 2F5FA 2IA1A 1BI3A 5D8KB 3FMRA 5ILVA 5CJ9A 3J81Z 4HYEA 2HKOA 4RB1A 3MFKA 3HTUA 4EGYA 3V8LA 4QWQA 1YG2A 5FLXZ 5F6FA 3RPQA 1S7AA 2CG4A 4G94A 1XCVA 5FLXK 3C7JA 4OIQF 1XDSA 3VOEA 1IN5A 5J8CA 3L2CA 3ZN0A 1USSA 2EA2A 1T98A 4CHUA 1IN6A 1J0RA 3FM5A 1FBUA 4A12A 4YFXF 1TTYA 1BI2A 4A5MA 3R0AA 4N0BA 1H9TA 1TW3A 3I54A 3I5UA 5DDGA 2HDCA 1S3JA 1F5TA 5CLSA 4R79A 1R23A 1AWCA 3RKWA 4AD9A 3ZMVA 4IHSA 3MQ0A 1FX7A 2L4MA 3F8CA 2FBHA 5JHUA 2BYVE 1GXQA 2XKOA 3Q9SA 1FOKA 4U0WA 1R1UA 1IF1A 4MQ9F 3S2WA 3F21A 3RKYA 3GEZA 4HDVA 1ZG1A 4GYGA 1OPCA 2XV4S 2XVCA 4QLCU 5TJJA 1YIOA 3P7NA 1FNNA 3CUQA 4MTDA 2XAGA 3G3ZA 3QRFF 3P9IA 1W4MA 2JSCA 3K69A 3KETA 3ZMDA 3K2ZA 1LB2A 2J5OA 2QLZA 1G3SA 1S6LA 2IT0A 4NQWA 1T39A 1UCRA 3GVAA 4IRIA 2V6CA 3E5XA 2IA2A 3WGHA 1IZ1A 1EH8A 3M8EA 2RNJA 1B4AA 3KE2A 4LG0B 4G6DA 1MKMA 2FA5A 4P5OA 5ICFA 1MDMB 2AS5F 2VE8A 4Q47A 1BC8C 1BIBA 3I59A 4WXDA 1F4KA 3HHGA 3OV8A 2YU3A 3HRUA 2Y75A 4K2EA 3B73A 1OYWA 3E97A 1DPUA 1H9GA 1RIOH 1PP7U 3M9AA 1YS7A 3HRSA 1KGSA 1BM9A 2BGCA 3F8MA 1HW2A 2XASA 5HDNA 2M87A 3RI4A 2HQNA 2OBPA 3VB2A 1SD6A 1RUNA 2VC0A 5AIQA 2GAUA 3KP6A 4TV7A 4L0ZB 1YW9A 3M8FA 1FT9A 6PAXA 2MLGA 3PQJA 2IRFG 4EQQA 1FSEA 1Z05A 5KK1A 4HBLA 1ZH5A 4KA4A 2ISYA 3J7AO 4M73A 4EJTA 5BMZA 5JI6A 1BJAA 1XSDA 5DD4A 1B9NA 3K1PA 1Z1DA 3ABUA 3Q9VA 3H3ZA 2KJBA 4LD5A 2H09A 2FBKA 3LA7A 1OR7A 3DEUA 5D5UB 5L3FA 1J2XA 2LDUA 1GXPA 1SD7A 2Y0MA 3ECOA 4S05A 2P7CB 2VE9A 1ON2A 2HGCA 3QPTA 2DBBA 4G6QA 5D5WB 3WTXC 3E3VA 1XCBA 3F8NA 2EJRA 1WSUA 2VXZA 1ZLKA 4HQEA 4ENJA 3KZZA 4CO8A 4EJUA 2LSOA 3K1NA 3ELKA 4A5NA 4CGZA 1TNSA 2O03A 1VTNC 4LB6B 1I5ZA 1B9MA 2BEOA 2QYOA 5FD5A 3D5LA 2FF4A 4FT8A 4I0AA 1ZG5A 3BJ6A 3EUHA 1ZLJA 2GXBA 5HOOA 2PI0A 5FB2A 4ZYHA 1P4XA 5D6FA 2P6SA 4ENNA 2M1BA 2V79A 4GO1A 4ZYDA 2LF8A 2VBYA 2X0LA 1LEAA 2H27A 4R8HA 3VFZA 1CF7B 2PLYA 2STWA 1HSTA 1T0FA 1PUEE 2W57A 5ICEA 2Q0OA 5DV5A 4HLYA 4I02A 3TDZC 4EM1A 2F5DA 4YFNF 1IXRC 3NEUA 3MAJA 3J80K 3RDIA 1OKRA 1FBQA 2M45A 2EWNA 3MCZA 4KNYA 1KQ8A 5K5QA 2NNNA 1IXCA 4BHPA 2XIGA 3K9TA 4A2UA 1V3FA 3FXQA 2KIMA 2VOOA 4LK0F 1O3RA 1FYKA 1ZRFA 3RYPA 4YIFA 4RGSA 4KIGA 3EYYA 4HW0A 2LF7A 3KCCA 2H94A 1O3TA 1RNLA 3WG9A 3MZYA 3FWEA 1QPMA 4M9ZA 2CW0F 3ECHA 4U0VA 1HXDA 3TO6A 3R6SA 3Q5FA 3HYIA 2QM3A 5AONA 3D0SA 5D4SA 3O2PE 4L5IA 1QO0D 4MGRA 4HQMA 5A2QK 1IUYA 1YW8A 2HKXA 2WC2A 2EFWA 2IA0A 3ZMSA 2EFPA 2HQRA 5FO5A 2XUBA 2ZKZA 4XLPF 2HTSA 3W6KB 2K27A 4HX7A 4FX0A 1STZA 1I1SA 4G7HF 1HQCA 2QENA 5H6QA 4CDGA 1SFXA 3WTZA 5E20A 5F1RA 2A3SA 5LEJA 4HV6A 4RGUA 4U7DA 2Q8KA 4M71A 1W5SA 2H6BA 4M6YA 3GLXA 1LQ1A 4A0YA 1SFUA 3BY6A 3V7CA 5DEQA 5BPIA 1MZBA 1EH6A 1MJBA 3E6DA 2A68F 3H92A 3QPHA 1FPQA 4Y13A 1R1TA 2GA1A 4CICA 2DTRA 2GQQA 3C18A 3GFIA 4PCQA 1P92A 1YS6A 2Y48A 2GZWA 2VONA 4XSXF 3HOSA 2O61A 3BWGA 1ZHFA 4KN7X 3KP2A 5E8IA 2OD5A 3DKWA 3KLOA 2W85A 3L09A 2D2WA 1ON1A 3EDPA 4ON0A 2YX4A 3RTRA 3F22A 1R5GA 3BROA 5ICGA 2BE5F 2RV8A 5HS9A 2CFXA 3F8BA 3WE2A 3TGNA 4HF0A 1J59A 5ILUA 3J81K 3BOQA 4EVIA 3E5UA 2XGXA 4KYWA 4NB5A 3WTVC 2KIUA 2MC3A 3U9GA 5L3DA 1W5TA 2XAQA 3V7RA 1NHAA 3MZHA 2DT5A 1XSVA 1WRJA 5F64A 1P2FA 4UHTA 2G9WA 2ELHA 4KICA 1MDMA 2FOKA 3SHFA 3KEQA 5CYVA 5HLGA 1Q1HA 4ASNA 3HTSB 1R5HA 3ISPA 2ZBKA 2YX7A 1YW7A 4M72A 1ZARA 1U5TA 2AXLA 3FM3A 4WK8F 4A6DA 2EFOA 1J5YA 1KQ0A 3TKYA 4N9HA 4LLNA 1LNWA 2DU9A 3ML6A 3ERED 3WTWC 2OU2A 2P8TA 3TDUC 1U8RA 4BHCA 4KIBA 4GGGA 4OIOF 5HLIA 4EM0B 5CVRA 2UWMA 3TQNA 4EJVA 3DXJF 2EFQA 3HSEA 1O3SA 3FF5A 1IN4A 3R0JA 3HOTA 1E17A 5LEKA 4AVPA 3WGGA 2UZKA 4L18B 3B02A 1U6GA 4PGHA 1MD0A 3GF2A 2D1VA 2X4HA 3QP6A 3ZMTA 3BJOA 1BOAA 5LBQA 4B09A 2JPCA 1J7KA 1UB9A 4U88A 3CLOA 3DP7A 5H6RA 3JAMZ 1QGPA 4WF2A 4G7ZF 4LFUA 3HIFA 2KIFA 3HRMA 5ILSA 3I58A 1QNTA 3N4MA 3QAHA 5JVTA 3ZQ7A 5HDGA 3T5XA 4WCGA 1IW7F 2ADUA 5J8FA 3F3XA 2FQ3A 3LQQA 4UVBA 1KU3A 2V1DA 5HS8A 1ZREA 4P96A 3LWFA 4RB3C 4BQAA 3KP7A 3T0YA 4KT5C 2W25A 3C3WA 3C1DA 3WE3A 2HTJA 3KEOA 4EGZA 2MH2A 3RPUA 1X3UA 3CUQB 4HOBA 5CVVA 3WU1B 4RS8A 3GUDA 2FSWA 3U2RA 3GFJA 4G8XA 3T8TA 4L5JA 4U0YA 5CVJA 2VODA 1OYIA 1E2XA 2A61A 1R7JA 3IHUA 1FBSA 1G3WA 4B8XA 1W7PB 4ZZDA 5JFRA 2A6EF 4HZFA 2O3FA 3HSFA 4L9VA 1P6RA 2ZMEB 2OQGA 2QBYA 1FC3A 5EEHA 3WTTC 4EJWA 5HVQC 4P9UA 1ONVA 1USTA 1HW1A 2J5PA 2ZJ2A 3DV8A 1G6NA 1SAXA 3I59B 1FZPB 3GFLA 1J75A 1J9IA 2YR2A 4OIPF 2K4BA 2D1HA 1MJAA 5DD8A 4H0EA 2K86A 2NNYA 2QZ8A 5L3CA 1UHMA 2NYXA 3V8KA 1FY7A 1FSHA 4AIHA 1S29A 4U7BA 1Z9CA 3E5QA 4M6XA 3GZ5A 2EV6A 3FXUA 5D6EA 3BDDA 5L3EA 2DK5A 2GWRA 2XHKA 1GHCA 1JHHA 2CGPA 5ED4A 3MEXA 3HSRA 1XD7A 2O8XA 1SMTA 4OINF 2XAFA 2PG4A 4R1HA 5K1YA 3P9CA 2VT2A 3H3UA 4FHTA 3WODF 1ZGAA 1LEBA 3SFZA 1HBXG 4UV9A 2KRFA 1MJ9A 2E7XA 4XLNF 4LGWA 4ZH4F 4DNCA 1G3TA 1EV7A 1HW5A 1KYWA 2QWWA 3EETA 2ACJA 3R4KA 3FMQA 3EQLF 1FWZA 4RAZA 3COAC 2DAOA 3ZN1A 2P4WA 5LGUA 1TQMA 1HKTA 1SD5A 5J6XA 2ISZA 5IT3A 4P9FA 3FX3A 5E1ZB 3PQKA 3I64A 4ENKA 2DLLA 2HOEA 1D8JA 5IT9Z 4MEXF 4LJZF 4OMYA 1KQ9A 1OMIA 1K78A 3SXYA 2G7UA 3CJNA 4HDUA 4UVCA 4HF1A 1T38A 4KMUX 3T8RA 1QZYA 3GXOA 3KP4A 3BP8A 2MA3A 1O7LA 2VBWA 4Y17A 4HX8A 2VBZA 2L3DA 1K79A 1HSJA 2FU4A 5LGTA 3VEPA 3AAFA 1B59A 2VC1A 3RJPA 4NHJA 2E7WA 1TQPA 1Z91A 5E1WA 3MWMA 2A69F 2K4JA 2JPBA 4GYIA 1T2KA 5E1XA 4Q5SF 2G7HA 2DFIA 3SQNA 3TOAA 4IHTA 1U2WA 5DCMB 2JT1A 4WWCA 4O3MA 3GZ6A 3HHHA 2DQRA 1UFMA 5LHGA 4ESJA 3WU0A 3EYIA 1FLIA 2EA4A 2VT3A 1ZYRF 4BAYA 4L9TA 3VODA 1PP8F 4N9IA 2MH9A 2QQBA 2DPUA 2ZXJA 3DF8A 4MNUA 3E6BA 3DPTA 1F9NA 1TW2A 4I0BA 2L4AA 1REPC 2PEXA 3CUQC 3DQVC 3IRQA 1YYVA 1KYZA 2E1CA 4E70A 1K7AA 1FP2A 3L7WA 2PMHA 2L02A 1TNTA 5FD6A 2OQRA 2HR3A 4OMZA 4L9NA 4ESFA 2XAHA 3U1DA 2R7FA 3TOBA 1O3QA 2M5WA 2P7VB 2KKOA 1LVAA 1SFEA 2BV6A 1FYLA 2YPRA 1LDDA 2FMLA 2HWVA 3K1MA 3WTUC 4HX4A 2OAZA 4PGGA 4IF4A 2UXNA 1ULYA 1IRGA 1YQAA 4ZYGA 3V4GA 2HFHA 4EV0A 1XMKA 2C6YA 3GO5A 4I09A 2P5KA 2Z99A 2ETHA 4MTEA 5LHHA 2Z9OA 1B1BA 2PN6A 2QVOA 3I4PA 3JTGA 2A07F 1TQIA 2FNAA 1GVJA 2PJPA 5K5RA 3F6VA 3P9KA 4DQ2A 3M7GA 2B0LA 1WI9A 4LG0A 1Y0UA 1KU7A 1KU2A 4EJOA 4LLGF 4Y15A 2ESNA 2ZCWA 4UV8A 4ZZLA 3WTYC 3GFMA 4UXNA 1I1GA 3FMSA 3KZYA 2RDPA 4F7ZA 1F1ZA 2RN7A 2FBIA 1KA8A 1SD4A 1O57A 1SMYF 2FXAA 4EMSA 4PDKA 5BPDA 2PQ8A 3KP5A 1DUXC 1XMAA 3IKVA 4RGRA 2RQPA 5DUKA 3V8JA 4WX9A 1ZG3A 3BPVA 2GA2A 4RB2C 1LJ9A 4RB0A 3LQRA 1U3EM 5HS7A 2PBIA 3CO6C 1C0WA 1TBXA 3WGIA 1IAWA 3NRVA 4P55A 1EH7A 1OYYA 1L0OC 1YFHA 1XGOA 4XBFA 4EM2A 5E18F 2QQAA 5H20A 2E1NA 1BIAA 4KIFA 3IKTA 1IN7A 1I6XA 1S8NA 1JGSA 4OU0A 4XRFA 2L01A 4S04A 4BHBA 2H6CA 1WQ2A 3RIRA 1D3YA 2IPQX 4MHGA 2ZNYA 3LA3A 4HF2A 4AIJA 5LGNA 2CQKA 4UNOA 2R3SA 3GW2A 2FRHA 3LAPA 4HAMA 3QOPA 1U78A 3GWZA 4O5VA 5DUIA 5LRSA 3TO9A 3I0TA 2WTEA 1QQIA 2EV5A 1QZZA 4HLXA 1W7PA 1ZN2A 4LMYA 1XDUA 3W6JB 2ZMEA 4WXHA 3JAMK 1H0MA 2UXXA 4G9YA 2RVCA 3L00A 4I98B 2EFNA 1YTYA 5LLQA 5E17F 1YO5C 4KMFA 1ZGJA 4LB5A 1HKSA 2DO7A 4KN4X 1AOYA 3I71A 2TDXA 4KDPA 2K7LA 2IW5A 1BI0A 1LDJA 1U5TB 2P6TA 3BPXA 1ZRCA 3BJAA 2P5LC 4LLLA 3GX4X 3HRTA 4YIIA 2ZO4A 2OZ6A 1I27A 4Q4ZF 3G73A 4HA8A 2EK5A 5D4RA 3LSTA 4GXOA 4I7HA 3N97A 3JSOA 4ZYEA 5FFZA 1CF7A 1RUOA 3O3KA 4KFCA 3IWZA 2JTVA 4PZJA 5BOXA 2BBYA 1ZRDA 1XGSA 4LK1F 1Z6TA 5FGMA 3O6BB 4XSZF 2WWYA 5BQTA 2EV0A 1D8KA 5D5XB 2LNBA 5L3BA 2MBFA 2RC4A 1TLHB 2CSOA 1IN8A 4HV5A 2IP2A 2F5EA 3LAJA 2CWEA 5D8LB 4I01A 4MEYF 3ABTA 1DDNA 2DK8A 1WWXA 5K5OA 4CYDA 5LRRA 1DPRA 3QU6A 5KVRA 2WV0A 3ZPLA 5DYMA 1XGMA 5LHIA 4AWXB 2K02A 1Z6RA 3DFGA 3FXRA 2QUFA 2P5VA 4JQFA 3RKXA 2XRNA 5L3GA 2FMYA 5AIPA 2OZUA 2W84A 4KUMA 2RGVA 4GCVA 2XKPA 2Z3YA 2HYFA 1ZAOA 2DW4A 4M9XA 2Q2EA 2A5YB 1JXSA 2VN2A 3GYHX 2XAJA 1PDNC 5BS6A 2IJLA 2O0YA 1RI7A 4JK1X 1CGPA 4CXFA 2KJCA 5DCFA
chains in the Genus database with same CATH superfamily
2DFFA 4RM2A 2E2IJ 1IDYA 1Z7UA 1XC5A 5C44J 2KIQA 1D1BA 5F0CA 1WJDA 1WH5A 2HEOA 2JVGA 3KLNA 4XKWA 3VSLA 2D5VA 4XLFA 5D5VB 1Z21A 1MNEA 2EILH 3K0LA 3B6CA 2FE3A 4ZC3A 2W24A 2ME6A 3SZPA 4HNTA 1QHHD 2EIJH 3I53A 5ICCA 2V9VA 2V1UA 2A6HF 1DGRM 2ZFWA 3JTHA 3RYRA 2IVMA 3JSPA 2MD5A 1OCZH 1HKQA 4ETSA 1G4DA 3JW4A 2DT6A 4BXXJ 1XB4A 1IRFA 3T1BA 4MFEA 3DBRB 4L0YB 5DCMA 4M9SA 4D0PA 2LKPA 4RLQA 4CCJA 4JBAA 1MIJA 1IXSB 1G3YA 2ESHA 4XN0A 3G1OA 3R61A 3F6OA 5CVUA 2LVSA 3GTJJ 2RKHA 2PMZN 2XC7A 4E7KA 3HOZJ 4N4NB 1E3HA 4X1EA 3FBNB 1LDKB 4IRGA 3OYBA 2D45A 2CUFA 3LA2A 4BKXA 3R60A 2Z5UA 2CYYA 4UUSB 3CTAA 3F0CA 1BR4A 1P4WA 2X1CA 3X2QH 3WTSC 4BXUA 5HDKA 4OOIA 3IWFA 1FP1D 2WA0A 2Z2SB 5E8GA 2VOPA 4BYYA 1QBJA 3J80Z 2COMA 2DDAA 3JRCA 2M30A 2O5RA 3TW7A 3H5RA 1MBHA 3E6MA 4RAYA 2IEKA 3ZQHA 5FFXA 2GIVA 5JR3A 3J7AY 5M5XJ 4IVNA 3K4NA 4BNCA 4MQVA 4AIDA 1EA3A 3ULQB 1W0UA 4CYCA 4IRHA 3CCRI 2NRAC 4M3FA 1Z77A 4BH9A 1VFCA 3E6CC 4AM3A 3CCVI 1UHWA 3ZMZA 4O6JA 4OAZA 3CCSI 1W36D 3K4JA 3W2WA 3K4MA 2JZYA 2YSRA 2NVTJ 1R1VA 1JHFA 3CUOA 1TT0A 1LE8A 5EEGA 1MGTA 2HQ5A 3CC7I 4I2OA 1BBYA 1ETKA 1SC7A 4WXCA 2OA4A 1NG7A 2FNPA 2QBYB 1IUFA 1D0XA 3BCBA 4Q48A 2M8EA 2R7RA 3ZP5A 5IT9K 4XN3A 4YFKF 3W2AA 2MYSA 4QSHA 2FEZA 3OOPA 2F5CA 3LSRA 2ZNZA 1D5VA 1YX5A 1X1CA 3BR3A 2JA2A 3BZKA 3IC7A 3ROUA 2F4MB 1YLFA 4A3EJ 4C3JJ 2PMUA 1G59A 5HODA 1XSXA 5CVIA 1NK3P 2JRTA 3S3OA 3F8FA 3TW6A 3H3VK 3IV5A 4IOCF 4C3HJ 3FHZA 5A2QZ 4X0GA 1XN7A 2DI3A 2PFBA 4IJAA 1R58A 3CCQI 3KX2A 3KFWX 4CZZA 3ZCOA 4RGXA 3LFKA 3CO7C 2KDZA 1VQ9I 3QP5A 4ENMA 3KP3A 2EZHA 1W7PD 1O7FA 1V4RA 5CQEA 4AIKA 4YG2F 3LSIA 1T6SA 1WJBA 2EZIA 2IS1A 2GXGA 3M1EA 1BI1A 3LSHA 4PFOA 1KU9A 2V1XA 1A6IA 4UVAA 4IXAA 1N77A 1U5TC 4UB8C 1DP7P 3NARA 4CZCA 2R7DA 2F2EA 2KQRA 2DPDA 3QYBA 2DJNA 5ERIA 2M0MA 5H2FC 3G71I 1A5JA 5GP9A 2O6GE 3S2DJ 4G7OF 1WH7A 2QQ9A 1S7OA 1RZ4A 1JE8A 3V7SA 4Z2YA 3DPLC 4A6EA 3CLQA 3SZTA 3BZ6A 2HYGD 4M3GA 2IS6A 3REOA 1XGNA 1FYMA 2WY7Q 1ZELA 2HZDA 3S1RJ 1WJCA 3TO7A 2K3PA 1TWCJ 3ZMUA 2MLKA 2HXOA 5DS9A 4M74A 3IL2A 4BE2A 2NVXJ 4RBOA 2HZTA 3FZVA 5TRDA 1I6HJ 4Y3OA 4UUVA 4IPAA 5HNHA 3Q0WA 2Y9YA 4NNJA 4L9JA 4A0XA 1RETA 2NS8A 2HS5A 2K9MA 4FX4A 2L7FP 4BQNA 1PUFB 5FRNA 2ZXHA 2NS0A 2LMDA 2NAZA 2STTA 3F23A 4AUXA 3PFIA 3I56I 5HLHA 1R22A 3QU3A 2L54A 4BS9A 4IHVA 3IRRA 4OIRF 1B6AA 2EB7A 3HOVJ 1A04A 3F72A 3KYCB 4GDFA 3L9FA 1R00A 2MFZA 4XORA 1R36A 2VBXA 1MMGA 3NQOA 4DYRA 3OS0A 2CQ7A 4A0ZA 1WJEA 2DQLA 1WKMA 1L3LA 2Z33A 3GBGA 3H0DA 2CO5A 1ZK8A 4XLAA 3FXKA 1BN5A 2CRGA 2XROA 2NXNB 1ODDA 1K6OA 3OYDA 2KPMA 4ESBA 3CDHA 3S1QJ 3HUGA 1K78B 3OIOA 2W82A 2GOMA 3L2UA 3TEDA 4MFDA 1T08B 2V9KA 2Y69H 5F0FA 4X6AJ 3S3NA 1BC7C 1P4AA 3QYEA 3ZXSA 2F5FA 2XPUA 2IA1A 3DBHB 4DBQA 1Z3YA 1DQUA 1BI3A 1SAUA 3AG2H 2OPTA 5D8KB 3FMRA 5ILVA 1EKEA 3ZQFA 4B3XA 2ZC2A 3GTQJ 5CJ9A 4OAYA 3J81Z 1BW5A 4HYEA 3CDIA 3FISA 5DM7F 2HKOA 4RB1A 3MFKA 3HTUA 4EGYA 2VQCA 3V8LA 3JRBA 4QWQA 1UJ8A 2WV1A 1YG2A 4RAFA 2G0EA 2CW8A 2RQQA 3C2HA 5FLXZ 5F6FA 3RPQA 1S7AA 4L5EA 1OFCX 5IP7J 2CG4A 1Y6IA 5JHFA 4G94A 2DODA 3WU2C 1XCVA 5FLXK 3C7JA 4OIQF 1XDSA 3VOEA 1ZR4A 1IN5A 5J8CA 3L2CA 3ZN0A 4CUGA 3PL8A 3Q0UA 1USSA 3BR6A 2EA2A 2IBDA 5J47A 1T98A 4II3A 4CHUA 2DMQA 4I76A 3KEYA 1IN6A 1J0RA 3FM5A 1OISA 1FBUA 2KRHA 2JVHA 4A12A 1IG7A 4YFXF 1FTZA 1TTYA 1BI2A 1LUJB 4A5MA 5F0HA 3R0AA 4IEJA 4N0BA 2VUMJ 1H9TA 1TW3A 2VKVA 3I54A 5HLTA 1WFXA 5KNLA 3DLLF 3I5UA 5DDGA 2HDCA 1S3JA 1FOYA 1F5TA 5CLSA 4R79A 1R23A 3MVPA 2R5ZA 1AWCA 1X1AA 3RKWA 4M6VA 3OS1A 2E36A 4AD9A 2B63J 1WPKA 3ZMVA 4IHSA 1T56A 3CF5F 1VQKI 4AU7A 2OTLI 4F92B 4HEA2 3MQ0A 3A01A 1FX7A 3PO3J 2L4MA 2WB1N 3F8CA 3L2RA 2FBHA 5JHUA 2BYVE 1GXQA 1Z67A 4FISA 2XKOA 3BQZA 3KIOA 2JRMA 1YIJI 1OR7C 3Q9SA 1FOKA 3PSFA 4U0WA 1R1UA 1IF1A 2FQ4A 2VKHA 4MQ9F 3S2WA 3F21A 3RKYA 2OCCH 3GEZA 4HDVA 2HDDA 2KISA 1ZG1A 5K7FA 4GYGA 1OPCA 2XV4S 2I8DA 2XVCA 1IRXA 4QLCU 3VPRA 5TJJA 1YIOA 3P7NA 1FNNA 3CUQA 4MTDA 2XAGA 3CCEI 1Z0XA 2ID6A 2XF5A 3G3ZA 1FMWA 2BOLA 3QRFF 2M9HA 3P9IA 5F04A 3JREA 1W4MA 2JSCA 2R5YA 2IXSA 3DKYA 3K69A 5TISC 2VIXA 1A6QA 3KETA 3ZMDA 3FKJA 3K2ZA 1S5LC 1LB2A 1RC9A 2JK3A 3GTPJ 2J5OA 2QLZA 3DPUA 3FBIB 1G3SA 1S6LA 2WBMA 4LG3A 4E7JA 3S16J 2WB1A 3OOUA 2IT0A 4NQWA 1HF0A 1ORKA 4DW6A 1T39A 1UCRA 2KHMA 3GVAA 4IRIA 2V6CA 3E5XA 1S72I 2IA2A 3WGHA 4CSWA 1X19A 3BTJA 3RQ4A 2XPWA 4PJLA 1IZ1A 5F1JA 3DEEA 3HB9A 2XSJC 1EH8A 3M8EA 2RNJA 2X9DA 2HOTA 1B4AA 3KE2A 3UKGA 4LG0B 5FKKA 4G6DA 2Q1ZB 1MKMA 2FA5A 4P5OA 3S1NJ 3L2WA 3GZNB 5ICFA 3BC8A 4D7NA 1T33A 1MDMB 3HOYJ 2WAFA 4EEFG 2AS5F 1OCTC 2VE8A 4Q47A 1BC8C 1BIBA 4QTRA 1HCRA 4BEHA 2E34A 2OC6A 3I59A 4WXDA 3WHBA 2QQ8A 2UV1A 1F4KA 2CV2A 3HHGA 3OV8A 2YU3A 3HRUA 3I4MJ 2Y75A 1P7JA 4K2EA 3B73A 4RLFA 1OYWA 3CCUI 3E97A 3WG7H 2ZJRF 1DPUA 1H9GA 1RIOH 1T95A 3QYFA 1PP7U 3M9AA 1YS7A 3HRSA 1DU0A 1KGSA 4ZJZA 2IGMA 4XLEA 1ZTRA 1BM9A 1WCMJ 2ZFUA 2E2JJ 1GV5A 3K4LA 3IAS2 2HPMA 2LC2A 2BGCA 3F8MA 1HW2A 2XASA 4NC7A 2XGCA 4RM3A 5HDNA 2M87A 3RI4A 2LRDA 2HQNA 2K9NA 2OBPA 1SD6A 3VB2A 2HNHA 5FKLA 3ZQCA 3IAM2 2VC0A 1RUNA 5EF6A 2H8RA 2W48A 4FCYA 4ZYAA 5AIQA 3N05A 2GAUA 3KP6A 3LSPA 4TV7A 4L0ZB 1YW9A 3M8FA 1FT9A 6PAXA 3BR1A 2MLGA 3PUBA 2V4JC 3HG9A 3I9V2 3PQJA 4A3GJ 2IRFG 4EQQA 1ETYA 1FSEA 1Z05A 5KK1A 4HBLA 1ZH5A 4ZDLA 5EZHA 4KA4A 2ISYA 4AYBN 2JA6J 3J7AO 3CJQB 4M73A 1BJZA 4EJTA 5BMZA 5JI6A 3I55I 4FE4A 5K7HA 1BJAA 2EH3A 2F5VA 3OIPA 1B9NA 5DD4A 1XSDA 3K1PA 2YS9A 3D5RC 1Z1DA 4XLCA 3CC2I 3FDYA 3K7AJ 3ABUA 1D0ZA 3OR1C 3K4KA 3Q9VA 1N75A 2L7KA 3H3ZA 2KJBA 4LD5A 2H09A 4QPQA 2FBKA 1RRJA 2LBFA 3LA7A 1OR7A 3NWTA 3DEUA 4JYKA 2L5QA 1MH3A 5C4JJ 4G12A 2VL8A 5D5UB 2R0QC 4PK4A 5L3FA 1J2XA 2LDUA 4JX6A 1GXPA 1SD7A 2Y0MA 1YHQI 4C3IJ 2CQQA 3ECOA 4S05A 1AKHA 2P7CB 2VE9A 1ON2A 2HGCA 3QPTA 2DBBA 4BQQA 5FLMJ 4G6QA 5D5WB 3WTXC 1MBFA 3E3VA 3ERMA 1XCBA 3HKZN 3F8NA 1MMAA 3LOCA 3WHCA 2EJRA 1VQPI 1WSUA 2UUZA 2VXZA 1ZLKA 4HQEA 1ETWA 2MG4A 1U9OA 4FETA 1TP4A 4AYBA 4ENJA 2OCEA 3CMAI 2IGNA 3KZZA 4CO8A 4EJUA 3K70C 2LSOA 3K1NA 3CMYA 3ELKA 4A5NA 4CGZA 1TNSA 2HQAA 1VZ0A 3DTEA 2O03A 3K4BA 1MMSA 1VTNC 1JUPA 4LB6B 1I5ZA 3HM5A 4DBRA 3CDLA 2JJ7A 1B9MA 4PJJA 2BEOA 1W1WE 2QYOA 3UNGC 4DZPA 1GV2A 5FD5A 3D5LA 2FF4A 4FT8A 4I0AA 1ZG5A 2ZJQF 3BJ6A 3EUHA 1ZLJA 2GXBA 4XK4A 4GRIA 1WJ5A 1I39A 2QSHX 2M4KA 3HKZA 2ELJA 2E1MB 2H1LA 2XAUA 1Y0NA 2FOWA 5HOOA 2PI0A 5B5EC 5FKOA 2DOFA 5FB2A 4ZYHA 4RMNA 2K3FA 1P4XA 5D6FA 3S93A 1OCRH 2P6SA 4ENNA 5FLVA 4ABZA 2R7OA 4J01A 2M1BA 2V79A 4GO1A 4ZYDA 2LF8A 2VBYA 2K85A 2X0LA 4DIQA 5B1AH 1LEAA 4BJ5C 4R8HA 1B8IB 1GDTA 2H27A 3VFZA 1RESA 1ACIA 1CF7B 2FX0A 1HLVA 1K6YA 1JKPC 2PLYA 1XTAA 2STWA 1HSTA 1T0FA 1PUEE 2W57A 5ICEA 2Q0OA 2Z1DA 5DV5A 4HLYA 1H8AC 4I02A 2F4IA 3TDZC 5F08A 4EM1A 4D1QA 5HNFA 4QIWN 2XRLA 4IKFA 2IS4A 4IHXA 1VQ5I 2F5DA 3JRFA 4C2UA 1JJ8C 1LFUP 4F3QA 4YFNF 5GTHC 1IXRC 3H35A 3NEUA 1POGA 3MAJA 2CFOA 3J80K 2H8WA 3RDIA 2R7WA 1OKRA 1FBQA 2M45A 2QCOA 5J40A 2XB0X 2EWNA 4BBRJ 3MCZA 4KNYA 1KQ8A 5K5QA 2DT7B 5B66C 4RDUA 2NNNA 1PUFA 1QHGA 1IXCA 4BHPA 5GAEJ 2XIGA 3IUOA 3K9TA 4IZZA 1ENHA 4A2UA 1V3FA 3FXQA 2PMZA 2KIMA 2VOOA 3VWBA 4LK0F 3SJMA 2GLOA 4BL0B 1JGGA 2EIMH 1QVUA 2VB6A 1O3RA 1FJLA 1FYKA 1XG1A 1Y1VJ 1R49A 1ZRFA 1Z7LA 2EZLA 3CQZJ 3RYPA 4YIFA 4RGSA 4KIGA 4E6KG 5J4YA 3EYYA 4G6TB 4HW0A 2LF7A 3KCCA 4ZDOA 2H94A 2MC4A 2VI6A 1O3TA 1PYVA 1RNLA 3WG9A 5LFAA 3B6AA 3DCFA 3MZYA 2HOAA 2Q2EB 3FWEA 1QPMA 4M9ZA 4PSXA 4XONA 4E7ZA 2CW0F 3QQAA 3BCAA 3ECHA 4PSWA 4U0VA 1QVTA 4A3KJ 4I6ZA 2BY0A 2CMPA 3KPHA 1HXDA 3BT9A 2ZSIB 3R6SA 3TO6A 2CV0A 3M3YJ 3Q5FA 3HYIA 2QM3A 5AONA 1YITI 3D0SA 3ABKH 5BNGA 5D4SA 2I10A 3O2PE 4L5IA 4NC6A 4HSRA 1QO0D 4MGRA 4HQMA 5A2QK 1IUYA 1R71A 2DFEA 4HRIA 1D0YA 1YW8A 1JKQC 2BVLA 2HKXA 2QF7A 2WC2A 2Z16A 5K7ZA 4MLOA 4IHWA 2EFWA 4KJZA 2IA0A 3ZMSA 1MBKA 2EFPA 2DYRH 2HQRA 5FO5A 3CMMA 3OYEA 4MIMA 2XF7A 2K40A 2JA8J 2EIKH 4A3CJ 2NOJB 2XUBA 2ZKZA 4XLPF 3W3CA 5FJ8J 2HTSA 2O7OA 3W6KB 2BHZA 4PJ0C 4BJ6C 2K27A 3FKIJ 3PM1A 4HX7A 2VLAA 2LH9A 4FX0A 2DYSH 3AL0B 1TWHJ 2DDBA 1STZA 4IL6C 1OLTA 1I1SA 4G7HF 1HQCA 1VF9A 2QENA 1HOMA 5H6QA 4CDGA 1SFXA 4UUTA 3GLLA 5GPCA 3OYLA 3WTZA 3PUFA 5E20A 5F1RA 2A3SA 3RKQA 5C3EJ 5LEJA 5E3LA 1D5YA 4HV6A 4RGUA 2LYCA 4PUSA 4XRSA 4U7DA 2Q8KA 4E7HA 2DN0A 4M71A 2M8GX 1AHDP 1W5SA 2H6BA 4M6YA 3GLXA 3IH4A 1LQ1A 4KISA 1ETQA 4A0YA 2R7SA 1Z3XA 3M07A 2L9VA 1SFUA 3BY6A 3V7CA 5DEQA 5BPIA 2LY2A 1UMQA 4E4HA 1MZBA 1EH6A 5EJCA 1MJBA 3E6DA 2A68F 3H92A 3QPHA 3CESA 1FPQA 4Y13A 1R1TA 4QPOA 2IS2A 2GA1A 1U0JA 4CICA 2DTRA 2GQQA 3C18A 3GFIA 1WVRA 2VQLA 1VQ7I 4PCQA 1P92A 4CYCB 1WHUA 4FE7A 1YRNB 4ZDPA 1YS6A 2Y48A 4CCMA 5FRMA 1R4MB 4CH7A 3LSGA 2GZWA 1WJAA 3PFYA 2NVYJ 2VONA 4XSXF 3K2AA 2DA1A 3HOSA 5IYBJ 2O61A 3BWGA 3G1MA 2GIZA 1ZHFA 3PJRA 1JTXA 1X58A 4KN7X 3MKZA 3KP2A 5E8IA 1XMXA 1ZQ3P 4FASD 2OD5A 2OF7A 2QKLB 3DKWA 3KLOA 2W85A 3L09A 2D2WA 3OYGA 1SVOA 1ON1A 2P81A 2VJ4A 3EDPA 2OJED 4ON0A 2I5UA 2YX4A 3RTRA 3F22A 3NAUA 1R5GA 2KFDA 1BA5A 3BROA 5ICGA 2HDWA 1I3AA 2BE5F 2RV8A 5HS9A 1H89C 1H88C 2CFXA 2K5CA 3GTMJ 3F8BA 3AG1H 1WJFA 3WE2A 1U9NA 1MNMC 2R7UA 2ECBA 4EATA 3PO2J 3TGNA 5KCMA 2BHYA 4HF0A 1J59A 3ASNH 5ILUA 3BG7A 3J81K 2MGQA 3BOQA 3K4CA 2X1EA 4EVIA 3IH2A 3BZCA 3E5UA 2CW7A 1QRYA 2XGXA 3A0HC 1QA6A 4KYWA 2KP6A 2NS7A 4NB5A 3WTVC 2KIUA 2MC3A 2A5WA 3U9GA 9ANTA 3NWSA 1D1CA 5L3DA 3QOEA 1TL8A 1W5TA 4B4CA 4OWRB 2GM4A 1OCOH 2XAQA 3V7RA 1NHAA 3MZHA 1TWAJ 2DT5A 4IO9F 2AQEA 1XSVA 4F55A 1WRJA 3LSKA 2DFHA 3A02A 3HPGA 2W00A 2E1MC 1P2FA 5F64A 4UHTA 4F52A 2G9WA 2ELHA 4KICA 3OYAA 1ZR2A 1MDMA 2FOKA 2M2EA 3SHFA 3OYHA 3KEQA 5CYVA 5HLGA 1Q1HA 3BR5A 2VJIA 3TP0A 4DYQA 4ASNA 2L9SA 2V26A 3HTSB 1IJWC 3DEWA 4BJTA 1R5HA 3ISPA 2FUG2 1T8IA 2ZBKA 5J1YA 2YX7A 3G4SI 5M3FJ 3OYCA 1YW7A 4KT6A 4V19K 4M72A 1ZARA 1U5TA 3RQIA 5GAHJ 2AXLA 3S2HJ 5IP9J 2HI3A 4ZTFA 4BE1A 3FM3A 2VXDA 1TT5B 4WK8F 3FHNA 4A6DA 2EFOA 2DA7A 4DGWB 3E0JB 3VSKA 1J5YA 1SEUA 1N25A 2R7QA 3H0GJ 4XM3A 1KQ0A 3A03A 1IRZA 1MMNA 4BDZA 1X1BA 1V5FA 4IX7A 3TKYA 4D9JA 1BL0A 4KITB 3PIPF 4N9HA 1ZGWA 4LLNA 1LNWA 2DU9A 3ML6A 3ERED 3OSFA 3WTWC 2CUZA 3H9JA 5TGTA 2OU2A 3JR9A 2P8TA 3TDUC 3BG6A 1U8RA 3ZQGA 4BHCA 2KDOA 2BXZA 4KIBA 2E5ZA 4GGGA 4OIOF 5HLIA 5EDNA 4EM0B 5CVRA 2UWMA 3TQNA 4EJVA 1UAAA 3KZIC 3DXJF 1IO2A 2GOXB 5DTDA 2EFQA 3HSEA 4Y33A 1O3SA 3ASOH 3FF5A 3MN2A 1IN4A 1RKWA 1MBEA 1QZEA 3R0JA 3PNVA 3HUGB 5J4VA 4E7IA 3H9QA 3FXLA 2VJ5A 2A6TA 2B9SA 3HOTA 1E17A 5LEKA 1Y56A 1ETVA 3DKXA 3RSNA 3WGGA 4AVPA 3KYDB 2UZKA 4L18B 2KT0A 3B02A 3ZR8X 3TL4X 1U6GA 4MO7A 4PGHA 1MD0A 3GF2A 4CA0A 1JUMA 2D1VA 4XLHA 3HC7A 2X4HA 3QP6A 3J7YJ 2E5NA 3ZMTA 3BJOA 1N78A 1BOAA 5LBQA 2M3AA 3CJTB 4B09A 1ETXA 2JPCA 3M8JA 1J7KA 1AU7A 1UB9A 3JRGA 4DYCA 3L2QA 2QKMB 1Y39A 4U88A 3D5SC 3CLOA 3BG5A 3DP7A 2Y9ZA 2X6YA 3FK6A 5H6RA 3RZDJ 3JAMZ 1QU3A 1QGPA 2IGOA 3S1MJ 2E19A 4WF2A 4G7ZF 4LFUA 1E0EA 3HIFA 2CUJA 1TWFJ 1JKOC 2Y30A 1IDZA 3U1KA 1BR2A 4BY7J 2AXTC 2KIFA 3HRMA 5ILSA 4BU2A 3I58A 5J3LA 1QNTA 3ZQIA 2BW3A 3N4MA 3AL0C 5IY5H 2BVMA 3QAHA 3HGYA 5JVTA 3TBIA 3ZQ7A 3UR3C 5HDGA 3T5XA 4WCGA 1X2MA 3ZOBA 1I3QJ 3L2VA 1G8XA 1W5CC 1IW7F 3LSMA 4BACA 2ADUA 1NG6A 5B1BH 5J8FA 3F3XA 3I4NJ 2COBA 2R5ZB 2NVUB 4ANJA 3H5AA 3C2BA 1JKRC 2FQ3A 3MMYB 3LQQA 4UVBA 3OYJA 2XPVA 1KU3A 2V1DA 5HS8A 5E3OA 1ZREA 3H5NA 2R4GA 2F48A 3MKYB 5E79C 4P96A 3LWFA 4RB3C 3LFUA 4BQAA 3JCUC 3SDGA 2X6OA 3CZ6A 4HPQA 3A2KA 3A4CA 2CV1A 2ME0A 1B72B 3KP7A 2E1OA 5KAFC 1B8IA 3CP2A 3ESWB 3T0YA 3HZJA 4AVZA 2VASA 4KT5C 1FTTA 2EINH 3SEQA 3GTKJ 3CC4I 2W25A 2XB5A 3C3WA 3C1DA 4JP0A 2DA2A 3WE3A 2HTJA 2FD5A 3KEOA 4A3JJ 2P0WA 4UUSA 4EGZA 2MH2A 3RPUA 1X3UA 3CUQB 2XGDA 4M3EA 4HOBA 5CVVA 3WU1B 2VPRA 3CCLI 4RS8A 1FOXA 2R93J 2PX9A 2R5YB 1G2HA 3GUDA 2FSWA 3AFHA 3U2RA 3QPLA 3C2GA 3GFJA 4HNUA 4G8XA 3T8TA 4AC0A 1YJNI 4A3DJ 2LREA 1SFKA 3OYMA 2W7NA 4L5JA 4U0YA 5CVJA 4JX5A 2JQ7A 1OCPA 2DCEA 1OYIA 2VODA 1E2XA 4NQWB 2A61A 3H9GA 1R7JA 3FIWA 3I3LA 3IHUA 1FBSA 1VQ6I 3CP8A 1G3WA 4U87A 2MD0A 4B8XA 1W7PB 2DMNA 4ZZDA 5JFRA 2A6EF 2LOOA 4HZFA 4A69C 2O3FA 3HSFA 2MSYA 4L9VA 1P6RA 3VDXA 2ZMEB 1UELB 2OQGA 2QBYA 1FC3A 2CJJA 3OY9A 3W2VA 3DU5A 5IPAA 1YX3A 4BGDA 5EEHA 3WTTC 5JLWA 4EJWA 1MBJA 1MW7A 4B48A 2HU9A 2HYJA 5HVQC 4P9UA 1ONVA 2ID3A 1USTA 4LIVA 1HW1A 3HEFA 4XRMA 2J5PA 2ZJ2A 3DV8A 1EF4A 1XX5A 1VI0A 3GTGJ 1G6NA 2F6CA 4BDYA 1SAXA 3I59B 3HXLA 3SEZA 1FZPB 3GFLA 1YJ9I 1J75A 1J9IA 1WZ2A 3BTIA 2LY9A 2YR2A 4Y7NJ 4OIPF 2K4BA 1M1EB 2D1HA 3SFIA 2MW8A 2LLKA 2KZVA 1MJAA 5DD8A 4H0EA 3OYIA 2X85A 3G6EI 2K86A 2NNYA 2QZ8A 2PJRB 5L3CA 1VQNI 1UHMA 2NYXA 3V8KA 1GT0C 1FY7A 1R4NB 5EGOB 1FSHA 4AIHA 1S29A 4D5FA 1S7EA 2X1DA 4U7BA 1Z9CA 3E5QA 3PNYA 4M6XA 2TCTA 4II2A 5CQGA 1X3ZB 2KL4A 2ZXWH 3EUKL 3GZ5A 2EV6A 1P7IA 3FXUA 5D6EA 3BDDA 5L3EA 2HOSA 2JA7J 4D7MA 2DK5A 2GWRA 2XHKA 3IH3A 3LL7A 1HC8A 1GHCA 2AHQA 1QPIA 4NBQA 3HL2A 3OYFA 1JHHA 2CGPA 3D1NI 5ED4A 3MEXA 3HSRA 3HOUJ 1XD7A 2O8XA 1SMTA 2YUSA 4OINF 2XAFA 5CPRB 3RZOJ 2PG4A 1RKTA 4R1HA 5K1YA 5FKMA 3P9CA 4V2FA 2VT2A 3H3UA 4FHTA 2EQRA 3A1YA 1Y8QB 3WODF 1ZGAA 2L2OA 1LEBA 3SFZA 3BG3A 1HBXG 4UV9A 3GTLJ 3S15J 5EEAA 4C9YA 4IHYA 5E3MA 2OV7A 2V6EA 2QEXI 2KRFA 2ZJPF 1MJ9A 2KMUA 4BE0A 1TZLA 2E7XA 2M4GA 4XLNF 2VKDA 4LGWA 3RCOA 4A3MJ 4ZH4F 4DNCA 1X1PA 1G3TA 1WGXA 3HJEA 1EV7A 2QSGX 5C4XJ 1HW5A 2KZGA 2QGUA 2Y2ZA 2M7AA 3O8GA 1KYWA 2LBFB 3ZRGA 5E3NA 2QWWA 2L9NA 3EETA 2ACJA 3R4KA 3FMQA 3EQLF 1V5EA 1FWZA 4RAZA 3COAC 1VQOI 2DAOA 3ZN1A 2P4WA 5LGUA 1TQMA 1YRNA 1HKTA 3DLAA 1APLC 1SD5A 1AKHB 5J6XA 2ISZA 3FXOA 5IT3A 4P9FA 3FX3A 5E1ZB 3Q0VA 2QSFX 3PQKA 3VYUB 4B43A 3DTIA 3I64A 4W97A 4E7SA 4ENKA 2DLLA 1W0TA 2HOEA 4ITVA 3BTCA 1JUSA 2LK2A 1D8JA 5IT9Z 2ZSHB 4MEXF 4LJZF 2DTZA 5IYCJ 4OMYA 1KQ9A 4DOZA 1OMIA 2LKXA 1K78A 3SXYA 2WAQN 1TWGJ 3MD2A 2G7UA 3CJNA 5J1RA 4HDUA 1YJWI 4UVCA 2BY3A 4HF1A 2X6WA 5EZGA 4KMUX 1T38A 1RR8C 3LSJA 3BR2A 3VYRB 5M5YJ 1LFPA 3T8RA 3M4OJ 1QZYA 3ABMH 3GXOA 3A0BC 3KP4A 3BP8A 5JVGF 2XDVA 2MA3A 1O7LA 5EG0B 2VBWA 2VPLA 4Y17A 4B1RA 3CCJI 4HX8A 2BY1A 2VBZA 1RPWA 2L3DA 1K79A 1HSJA 2FU4A 4NUBA 3AKZA 4J19A 1IC8A 5LGTA 3VEPA 3AAFA 1B59A 3GMEA 4XIDA 2VC1A 3RJPA 2KRCA 3F9KA 4NHJA 2E7WA 1JT0A 1UZCA 3LNQA 1TQPA 1Z91A 5E1WA 3MWMA 2A69F 4C2TA 2K4JA 4A3IJ 4YELA 2JA5J 2JPBA 4IQJA 4GYIA 4LITA 3OYNA 1YOVB 3U21A 1T2KA 1MNDA 5E1XA 4XICA 2GBYA 4Q5SF 1UG2A 4PJMA 2G7HA 2E60A 2DFIA 2XF6A 2BXYA 2L7ZA 3SQNA 3TOAA 4IHTA 3H1CA 4P1WA 1U2WA 5DCMB 2DA6A 1EJ9A 2JT1A 4WWCA 4O3MA 3GZ6A 2DOAA 3HHHA 2ECCA 2WAQA 1R9TJ 1KONA 1XS9A 1NTCA 2DQRA 1V5GA 1UFMA 1X2NA 4DJAA 5LHGA 1K4TA 2ZXIA 1PJRA 4ESJA 3DU6A 4M3DA 3WU0A 2JUGA 4XKVA 3EYIA 3S14J 2R7TA 1FLIA 3OMYA 3OL4A 1MSFC 4XKCA 4XRSG 4UY8I 2EA4A 2CU7A 3ABLH 2VT3A 2TRTA 1ZYRF 5GPAA 2HXIA 4BAYA 5B3SH 1MH4A 3K10A 4L9TA 3VODA 3OL3A 4RA2A 1UHSA 1W36C 1PP8F 4N9IA 2MH9A 2QQBA 2WAEA 2DPUA 2ZXJA 4M3BA 3S32A 2CQNA 2QA4I 2LTPA 3DF8A 4MNUA 3E6BA 3JRDA 2IGKA 3DBLB 2DA3A 3DPTA 1F9NA 1TW2A 3VYTB 2CH0A 2IAIA 4I0BA 2L4AA 1REPC 2DMPA 3TP3A 1ITYA 2PEXA 3CUQC 3DQVC 2RNGA 3HGGA 3IRQA 1YYVA 2DA4A 3M1CA 1KYZA 1P9QC 3HBLA 2W4SA 3MKLA 2E1CA 1PVEA 2E35A 4HNVA 4CCLA 4E70A 1R6RA 1LE8B 1K7AA 1FP2A 3DTKA 3L7WA 2JN6A 4GFBA 2PMHA 2L02A 5F27A 1TNTA 5FD6A 1X4PA 1UG0A 3RPUD 1HA8A 2OQRA 3P5JA 1IV8A 3DWLE 2HR3A 4OMZA 4L9NA 4ESFA 2XAHA 1BOBA 5CKTA 3U1DA 2R7FA 3TOBA 1O3QA 2M5WA 2P7VB 2KKOA 2M7BA 1LVAA 1SFEA 2BV6A 2FJ1A 1FYLA 2YPRA 1LDDA 2FMLA 3QPSA 2JWTA 1SANA 1V54H 2X6XA 2L0KA 2VKEA 2HWVA 1LVKA 3K1MA 3WTUC 4HX4A 3ZGKA 2ZMEC 2OAZA 2DMUA 2NOGA 4IF4A 2JMWA 4PGGA 2XSDC 2UXNA 1ULYA 1IRGA 1YQAA 1JTYA 3HPHA 2R7ZJ 4ZYGA 3PSIA 3V4GA 4XNFA 2HFHA 4EV0A 2V9PA 1V55H 1XMKA 2C6YA 3GO5A 4I09A 2P5KA 2Y0SN 2Z99A 2ETHA 1D1AA 1JJ6C 4MTEA 4LOCA 1F43A 4F93B 2VJJA 5LHHA 2Z9OA 1B1BA 2PN6A 2QVOA 3I4PA 3JTGA 2A07F 2O8KA 4I99C 2R7VA 1TQIA 5GAGJ 2FNAA 1SVMA 1GVJA 2PJPA 4XOTA 4XQFA 5K5RA 1MMDA 1K83J 3F6VA 1OJLA 3P9KA 3FK7A 4DQ2A 2HPIA 3M7GA 2M0CA 2B0LA 2BY2A 1WI9A 4LG0A 3S17J 1TC3C 1KZHA 1Y0UA 1KU7A 3HOXJ 4E7LA 1KU2A 4EJOA 3EPZA 4LLGF 4Y15A 2ESNA 2ZCWA 4UV8A 4ZZLA 2MABA 4HG2A 4BQOA 3WTYC 2LFBA 1X4OA 2KLOA 3GFMA 3OS2A 4UXNA 2EBIA 1I1GA 3FMSA 4UB6C 3KZYA 2RDPA 3CF2A 1VQLI 4F7ZA 1F1ZA 4B3AA 2RN7A 2FBIA 1KA8A 1SD4A 1O57A 5IP6A 1SMYF 2FXAA 4EMSA 2WADA 4PDKA 5BPDA 2Y0SA 2PQ8A 4XOPA 1VQ8I 1GVDA 4BY1J 3KP5A 1DUXC 1XMAA 4JX4A 4C2MJ 2X48A 3IKVA 2RQPA 3O8HA 4RGRA 5DUKA 3V8JA 4CCKA 2X51A 3FXMA 4WX9A 2R7XA 1JI8A 3BLYA 2LP0A 1ZG3A 3BPVA 4D5CA 2GA2A 4RB2C 1LJ9A 3HDDA 4RB0A 3H36A 1HDDC 1RR7A 3LQRA 1U3EM 4NDLA 1HDPA 2PBIA 5HS7A 3SDBA 1SVLA 2AO9A 3CO6C 1C0WA 1TBXA 3WGIA 4CCNA 1FIAA 5LD2C 1IAWA 3NRVA 4P55A 4C30A 3CCMI 1EH7A 1OYYA 3OSGA 1L0OC 1ETOA 1YFHA 1XGOA 4XBFA 2LY1A 4EM2A 2DXIA 1SFOJ 5E18F 1MSEC 2N8GA 2VQGA 1FIPA 1S9HA 2QQAA 3QODA 4XMYA 5H20A 2LD5A 2E1NA 1BIAA 2ICWG 1B72A 5M5WJ 2O9LA 4KIFA 1IV6A 3IKTA 3VYSB 1IN7A 1I6XA 1JT6A 2L9RA 1S8NA 1BR1A 4BUPA 1E3PA 1JGSA 4OU0A 4XRFA 2L01A 2W1OA 1CQTA 4S04A 1A36A 4BHBA 2H6CA 4JOMA 4BXFA 2K9LA 1WQ2A 2E71A 3RIRA 4DZJA 3MKWB 1D3YA 1DP3A 2CQXA 1FEXA 2IPQX 4MHGA 2ZNYA 3LA3A 1BW6A 4HF2A 2M34A 2DA5A 2Y31A 4AIJA 4CCOA 1K61A 3E1SA 5GTIC 5LGNA 2CQKA 1YE9A 4UNOA 2R3SA 5EYRA 1LPQA 2A05A 3GW2A 2V1NA 2FRHA 3LAPA 3LMMA 4HAMA 1YI2I 2LR8A 4NC8A 3QOPA 2OUMA 2R92J 1U78A 4RAGA 1A31A 2YU9J 3GCMA 3J7ZI 3GWZA 4O5VA 5DUIA 5LRSA 2ELKA 3TO9A 3SYTA 3I0TA 2WTEA 1QQIA 4LIUA 3W6VA 2EV5A 1DU6A 4F91B 1X1DA 1X3WB 3HOWJ 2CS3A 3BG9A 1U8BA 5GADJ 1GUUA 4ZTJA 3PIOF 4A3BJ 1QZZA 4HLXA 1W7PA 1ERDA 1ZN2A 3CJRB 4LMYA 1XDUA 3EUHC 5M3MJ 3W6JB 2ZMEA 4WXHA 2K9QA 1FOWA 3JAMK 1NK2P 1H0MA 3G1LA 2UXXA 4G9YA 3L1PA 2RVCA 3L00A 3QWLA 4I98B 2EFNA 1FMVA 5JLXA 1VNDA 3CD6I 2E2HJ 2EPFA 1YTYA 4YEJA 3V42A 5LLQA 4HSTA 5E17F 1YO5C 4KMFA 1ZGJA 2L7MP 4LB5A 1HKSA 2DO7A 1AA7A 4KN4X 1AOYA 3I71A 3K70D 3S3MA 2F4OB 2TDXA 4KDPA 2K7LA 3ZQQA 4IOAF 2IW5A 2LKSA 2EZKA 1BI0A 1LDJA 1U5TB 2DJIA 2P6TA 2RAEA 2JUCA 3CMEI 1T0FC 2PJRA 3BQYA 3BPXA 1ZRCA 5EGOA 3BJAA 4BBSJ 2P5LC 4LLLA 3A01B 3GX4X 2RREA 1VQMI 3HRTA 3JRIA 3G2BA 3MZ8A 1A35A 4YIIA 2ZO4A 2OZ6A 5KAIC 1I27A 2JSPA 5IOZA 4Q4ZF 4HA8A 3G73A 2EK5A 1O4XA 5D4RA 3LSTA 4IQ4A 4GXOA 4I7HA 2K9SA 4A3FJ 3N97A 1E3OC 5J1UA 4FQGA 3JSOA 4ZYEA 5FFZA 1OQYA 3ZQLA 1CF7A 3JRHA 1RUOA 3O3KA 4KFCA 3IWZA 2JTVA 2VQHA 3OWTA 3GTOJ 2HVRA 4PZJA 3OR2C 1I50J 3KYLA 5BOXA 2BBYA 1ZRDA 1XGSA 4LK1F 1Z6TA 5FGMA 3O6BB 4XSZF 3OYKA 2WWYA 3BR0A 5BQTA 4N4OB 2EV0A 2DMTA 1D8KA 4YRVA 5D5XB 2LNBA 5L3BA 3Q3SA 1LFBA 2MBFA 4PFPA 2LG4A 4V2GA 2RC4A 1TLHB 2CSOA 1IN8A 4XL9A 4HV5A 3S8PA 2IP2A 2F5EA 4YIRX 3LAJA 1IGNA 2AQFA 3E7LA 1VQ4I 2CWEA 2DOEA 2H1KA 5D8LB 4Y52J 4S0HB 4I01A 4MEYF 3ABTA 1R5ID 1DDNA 3IP4B 3JRAA 5FKNA 2DK8A 1WWXA 5K5OA 4CYDA 3PNTA 5LRRA 4A93J 1DPRA 3QU6A 4B44A 5IYDJ 5KVRA 2WV0A 5DM6F 1Y1WJ 3ZPLA 5DYMA 3AG4H 1LKXA 1XGMA 1GLNA 5LHIA 2V7FA 4AWXB 5IOYA 3EUAA 2K02A 4H4KC 1WI3A 1OCCH 2ZB9A 2NVQJ 1Z6RA 3DFGA 3FXRA 2QUFA 1Y8RB 3BTLA 4B47A 2P5VA 1K4SA 4JQFA 3RKXA 2XRNA 5L3GA 2FMYA 5AIPA 2XGEA 2OZUA 4A3LJ 3SZGA 2W84A 2BZTA 4KUMA 2RGVA 4GCVA 2CUEA 2XKPA 4FTHA 2Z3YA 4PJNA 2HYFA 1ZAOA 2DW4A 4M9XA 1XPXA 2HVSA 2Q2EA 2A5YB 3FXJA 4Z6YA 2B7EA 1JXSA 2VN2A 3AG3H 4BEHB 5KHDA 3GYHX 2WY8Q 4XKBA 3ONQA 1ZKGA 2XAJA 4W1UA 2GXAA 3OIQA 1NH3A 3TMOA 1Q1VA 1MBGA 1PDNC 3CCYA 4Y4RA 5BS6A 5FROA 2IJLA 1DGWY 1RI7A 2O0YA 3K6GA 4JK1X 1CGPA 4XR6A 4J00A 1J09A 1F36A 2BW3B 4CXFA 2HVQA 2OTJI 5EG0A 2KJCA 5DCFA
chains in the Genus database with same CATH topology
1Z7UA 2HEOA 3KLNA 5D5VB 3K0LA 2FE3A 2W24A 3SZPA 5ICCA 3I53A 2V9VA 2V1UA 2A6HF 2ZFWA 3JTHA 3RYRA 2IVMA 3JSPA 2MD5A 1HKQA 4ETSA 1G4DA 3JW4A 1XB4A 1IRFA 3T1BA 4L0YB 5DCMA 4M9SA 4D0PA 2LKPA 4JBAA 1IXSB 1G3YA 2ESHA 3R61A 3F6OA 5CVUA 2RKHA 1LDKB 4IRGA 2D45A 3LA2A 3R60A 2Z5UA 2CYYA 3CTAA 1P4WA 3WTSC 4BXUA 5HDKA 4OOIA 3IWFA 1FP1D 5E8GA 2VOPA 4BYYA 1QBJA 3J80Z 2COMA 2M30A 3E6MA 4RAYA 5FFXA 2GIVA 5JR3A 4IVNA 4BNCA 4MQVA 3ULQB 4IRHA 2NRAC 4BH9A 3E6CC 1UHWA 3ZMZA 4O6JA 2JZYA 2YSRA 1R1VA 1JHFA 3CUOA 5EEGA 1MGTA 4I2OA 1BBYA 4WXCA 2OA4A 2QBYB 2FNPA 3ZP5A 4Q48A 5IT9K 2M8EA 4YFKF 2FEZA 3OOPA 2F5CA 2ZNZA 1D5VA 3IC7A 3ROUA 1YLFA 2PMUA 1XSXA 5CVIA 2JRTA 3F8FA 3FHZA 5A2QZ 1XN7A 2DI3A 2PFBA 4IJAA 1R58A 3KFWX 4CZZA 4RGXA 3LFKA 3CO7C 3QP5A 4ENMA 3KP3A 1W7PD 1O7FA 1V4RA 4AIKA 4YG2F 1T6SA 2GXGA 3M1EA 1BI1A 1KU9A 2V1XA 4UVAA 4IXAA 1U5TC 1DP7P 2R7DA 2F2EA 2DPDA 5ERIA 2O6GE 4G7OF 2QQ9A 1S7OA 1RZ4A 1JE8A 3V7SA 4Z2YA 3DPLC 4A6EA 3SZTA 3BZ6A 2HYGD 3REOA 1XGNA 1FYMA 3TO7A 3ZMUA 2MLKA 3IL2A 4M74A 2HZTA 3FZVA 5TRDA 4UUVA 4IPAA 4A0XA 4L9JA 2HS5A 4FX4A 2NS0A 2NAZA 2STTA 3F23A 3PFIA 5HLHA 1R22A 3QU3A 2L54A 3IRRA 4OIRF 1B6AA 2EB7A 1A04A 3F72A 3L9FA 1R00A 1R36A 2VBXA 3NQOA 4A0ZA 2DQLA 1WKMA 1L3LA 2Z33A 2CO5A 1BN5A 2XROA 1ODDA 1K6OA 4ESBA 3CDHA 3HUGA 1K78B 1BC7C 1P4AA 2F5FA 2IA1A 1BI3A 5D8KB 3FMRA 5ILVA 5CJ9A 3J81Z 4HYEA 2HKOA 4RB1A 3MFKA 3HTUA 4EGYA 3V8LA 4QWQA 1YG2A 5FLXZ 5F6FA 3RPQA 1S7AA 2CG4A 4G94A 1XCVA 5FLXK 3C7JA 4OIQF 1XDSA 3VOEA 1IN5A 5J8CA 3L2CA 3ZN0A 1USSA 2EA2A 1T98A 4CHUA 1IN6A 1J0RA 3FM5A 1FBUA 4A12A 4YFXF 1TTYA 1BI2A 4A5MA 3R0AA 4N0BA 1H9TA 1TW3A 3I54A 3I5UA 5DDGA 2HDCA 1S3JA 1F5TA 5CLSA 4R79A 1R23A 1AWCA 3RKWA 4AD9A 3ZMVA 4IHSA 3MQ0A 1FX7A 2L4MA 3F8CA 2FBHA 5JHUA 2BYVE 1GXQA 2XKOA 3Q9SA 1FOKA 4U0WA 1R1UA 1IF1A 4MQ9F 3S2WA 3F21A 3RKYA 3GEZA 4HDVA 1ZG1A 4GYGA 1OPCA 2XV4S 2XVCA 4QLCU 5TJJA 1YIOA 3P7NA 1FNNA 3CUQA 4MTDA 2XAGA 3G3ZA 3QRFF 3P9IA 1W4MA 2JSCA 3K69A 3KETA 3ZMDA 3K2ZA 1LB2A 2J5OA 2QLZA 1G3SA 1S6LA 2IT0A 4NQWA 1T39A 1UCRA 3GVAA 4IRIA 2V6CA 3E5XA 2IA2A 3WGHA 1IZ1A 1EH8A 3M8EA 2RNJA 1B4AA 3KE2A 4LG0B 4G6DA 1MKMA 2FA5A 4P5OA 5ICFA 1MDMB 2AS5F 2VE8A 4Q47A 1BC8C 1BIBA 3I59A 4WXDA 1F4KA 3HHGA 3OV8A 2YU3A 3HRUA 2Y75A 4K2EA 3B73A 1OYWA 3E97A 1DPUA 1H9GA 1RIOH 1PP7U 3M9AA 1YS7A 3HRSA 1KGSA 1BM9A 2BGCA 3F8MA 1HW2A 2XASA 5HDNA 2M87A 3RI4A 2HQNA 2OBPA 3VB2A 1SD6A 1RUNA 2VC0A 5AIQA 2GAUA 3KP6A 4TV7A 4L0ZB 1YW9A 3M8FA 1FT9A 6PAXA 2MLGA 3PQJA 2IRFG 4EQQA 1FSEA 1Z05A 5KK1A 4HBLA 1ZH5A 4KA4A 2ISYA 3J7AO 4M73A 4EJTA 5BMZA 5JI6A 1BJAA 1XSDA 5DD4A 1B9NA 3K1PA 1Z1DA 3ABUA 3Q9VA 3H3ZA 2KJBA 4LD5A 2H09A 2FBKA 3LA7A 1OR7A 3DEUA 5D5UB 5L3FA 1J2XA 2LDUA 1GXPA 1SD7A 2Y0MA 3ECOA 4S05A 2P7CB 2VE9A 1ON2A 2HGCA 3QPTA 2DBBA 4G6QA 5D5WB 3WTXC 3E3VA 1XCBA 3F8NA 2EJRA 1WSUA 2VXZA 1ZLKA 4HQEA 4ENJA 3KZZA 4CO8A 4EJUA 2LSOA 3K1NA 3ELKA 4A5NA 4CGZA 1TNSA 2O03A 1VTNC 4LB6B 1I5ZA 1B9MA 2BEOA 2QYOA 5FD5A 3D5LA 2FF4A 4FT8A 4I0AA 1ZG5A 3BJ6A 3EUHA 1ZLJA 2GXBA 5HOOA 2PI0A 5FB2A 4ZYHA 1P4XA 5D6FA 2P6SA 4ENNA 2M1BA 2V79A 4GO1A 4ZYDA 2LF8A 2VBYA 2X0LA 1LEAA 2H27A 4R8HA 3VFZA 1CF7B 2PLYA 2STWA 1HSTA 1T0FA 1PUEE 2W57A 5ICEA 2Q0OA 5DV5A 4HLYA 4I02A 3TDZC 4EM1A 2F5DA 4YFNF 1IXRC 3NEUA 3MAJA 3J80K 3RDIA 1OKRA 1FBQA 2M45A 2EWNA 3MCZA 4KNYA 1KQ8A 5K5QA 2NNNA 1IXCA 4BHPA 2XIGA 3K9TA 4A2UA 1V3FA 3FXQA 2KIMA 2VOOA 4LK0F 1O3RA 1FYKA 1ZRFA 3RYPA 4YIFA 4RGSA 4KIGA 3EYYA 4HW0A 2LF7A 3KCCA 2H94A 1O3TA 1RNLA 3WG9A 3MZYA 3FWEA 1QPMA 4M9ZA 2CW0F 3ECHA 4U0VA 1HXDA 3TO6A 3R6SA 3Q5FA 3HYIA 2QM3A 5AONA 3D0SA 5D4SA 3O2PE 4L5IA 1QO0D 4MGRA 4HQMA 5A2QK 1IUYA 1YW8A 2HKXA 2WC2A 2EFWA 2IA0A 3ZMSA 2EFPA 2HQRA 5FO5A 2XUBA 2ZKZA 4XLPF 2HTSA 3W6KB 2K27A 4HX7A 4FX0A 1STZA 1I1SA 4G7HF 1HQCA 2QENA 5H6QA 4CDGA 1SFXA 3WTZA 5E20A 5F1RA 2A3SA 5LEJA 4HV6A 4RGUA 4U7DA 2Q8KA 4M71A 1W5SA 2H6BA 4M6YA 3GLXA 1LQ1A 4A0YA 1SFUA 3BY6A 3V7CA 5DEQA 5BPIA 1MZBA 1EH6A 1MJBA 3E6DA 2A68F 3H92A 3QPHA 1FPQA 4Y13A 1R1TA 2GA1A 4CICA 2DTRA 2GQQA 3C18A 3GFIA 4PCQA 1P92A 1YS6A 2Y48A 2GZWA 2VONA 4XSXF 3HOSA 2O61A 3BWGA 1ZHFA 4KN7X 3KP2A 5E8IA 2OD5A 3DKWA 3KLOA 2W85A 3L09A 2D2WA 1ON1A 3EDPA 4ON0A 2YX4A 3RTRA 3F22A 1R5GA 3BROA 5ICGA 2BE5F 2RV8A 5HS9A 2CFXA 3F8BA 3WE2A 3TGNA 4HF0A 1J59A 5ILUA 3J81K 3BOQA 4EVIA 3E5UA 2XGXA 4KYWA 4NB5A 3WTVC 2KIUA 2MC3A 3U9GA 5L3DA 1W5TA 2XAQA 3V7RA 1NHAA 3MZHA 2DT5A 1XSVA 1WRJA 5F64A 1P2FA 4UHTA 2G9WA 2ELHA 4KICA 1MDMA 2FOKA 3SHFA 3KEQA 5CYVA 5HLGA 1Q1HA 4ASNA 3HTSB 1R5HA 3ISPA 2ZBKA 2YX7A 1YW7A 4M72A 1ZARA 1U5TA 2AXLA 3FM3A 4WK8F 4A6DA 2EFOA 1J5YA 1KQ0A 3TKYA 4N9HA 4LLNA 1LNWA 2DU9A 3ML6A 3ERED 3WTWC 2OU2A 2P8TA 3TDUC 1U8RA 4BHCA 4KIBA 4GGGA 4OIOF 5HLIA 4EM0B 5CVRA 2UWMA 3TQNA 4EJVA 3DXJF 2EFQA 3HSEA 1O3SA 3FF5A 1IN4A 3R0JA 3HOTA 1E17A 5LEKA 4AVPA 3WGGA 2UZKA 4L18B 3B02A 1U6GA 4PGHA 1MD0A 3GF2A 2D1VA 2X4HA 3QP6A 3ZMTA 3BJOA 1BOAA 5LBQA 4B09A 2JPCA 1J7KA 1UB9A 4U88A 3CLOA 3DP7A 5H6RA 3JAMZ 1QGPA 4WF2A 4G7ZF 4LFUA 3HIFA 2KIFA 3HRMA 5ILSA 3I58A 1QNTA 3N4MA 3QAHA 5JVTA 3ZQ7A 5HDGA 3T5XA 4WCGA 1IW7F 2ADUA 5J8FA 3F3XA 2FQ3A 3LQQA 4UVBA 1KU3A 2V1DA 5HS8A 1ZREA 4P96A 3LWFA 4RB3C 4BQAA 3KP7A 3T0YA 4KT5C 2W25A 3C3WA 3C1DA 3WE3A 2HTJA 3KEOA 4EGZA 2MH2A 3RPUA 1X3UA 3CUQB 4HOBA 5CVVA 3WU1B 4RS8A 3GUDA 2FSWA 3U2RA 3GFJA 4G8XA 3T8TA 4L5JA 4U0YA 5CVJA 2VODA 1OYIA 1E2XA 2A61A 1R7JA 3IHUA 1FBSA 1G3WA 4B8XA 1W7PB 4ZZDA 5JFRA 2A6EF 4HZFA 2O3FA 3HSFA 4L9VA 1P6RA 2ZMEB 2OQGA 2QBYA 1FC3A 5EEHA 3WTTC 4EJWA 5HVQC 4P9UA 1ONVA 1USTA 1HW1A 2J5PA 2ZJ2A 3DV8A 1G6NA 1SAXA 3I59B 1FZPB 3GFLA 1J75A 1J9IA 2YR2A 4OIPF 2K4BA 2D1HA 1MJAA 5DD8A 4H0EA 2K86A 2NNYA 2QZ8A 5L3CA 1UHMA 2NYXA 3V8KA 1FY7A 1FSHA 4AIHA 1S29A 4U7BA 1Z9CA 3E5QA 4M6XA 3GZ5A 2EV6A 3FXUA 5D6EA 3BDDA 5L3EA 2DK5A 2GWRA 2XHKA 1GHCA 1JHHA 2CGPA 5ED4A 3MEXA 3HSRA 1XD7A 2O8XA 1SMTA 4OINF 2XAFA 2PG4A 4R1HA 5K1YA 3P9CA 2VT2A 3H3UA 4FHTA 3WODF 1ZGAA 1LEBA 3SFZA 1HBXG 4UV9A 2KRFA 1MJ9A 2E7XA 4XLNF 4LGWA 4ZH4F 4DNCA 1G3TA 1EV7A 1HW5A 1KYWA 2QWWA 3EETA 2ACJA 3R4KA 3FMQA 3EQLF 1FWZA 4RAZA 3COAC 2DAOA 3ZN1A 2P4WA 5LGUA 1TQMA 1HKTA 1SD5A 5J6XA 2ISZA 5IT3A 4P9FA 3FX3A 5E1ZB 3PQKA 3I64A 4ENKA 2DLLA 2HOEA 1D8JA 5IT9Z 4MEXF 4LJZF 4OMYA 1KQ9A 1OMIA 1K78A 3SXYA 2G7UA 3CJNA 4HDUA 4UVCA 4HF1A 1T38A 4KMUX 3T8RA 1QZYA 3GXOA 3KP4A 3BP8A 2MA3A 1O7LA 2VBWA 4Y17A 4HX8A 2VBZA 2L3DA 1K79A 1HSJA 2FU4A 5LGTA 3VEPA 3AAFA 1B59A 2VC1A 3RJPA 4NHJA 2E7WA 1TQPA 1Z91A 5E1WA 3MWMA 2A69F 2K4JA 2JPBA 4GYIA 1T2KA 5E1XA 4Q5SF 2G7HA 2DFIA 3SQNA 3TOAA 4IHTA 1U2WA 5DCMB 2JT1A 4WWCA 4O3MA 3GZ6A 3HHHA 2DQRA 1UFMA 5LHGA 4ESJA 3WU0A 3EYIA 1FLIA 2EA4A 2VT3A 1ZYRF 4BAYA 4L9TA 3VODA 1PP8F 4N9IA 2MH9A 2QQBA 2DPUA 2ZXJA 3DF8A 4MNUA 3E6BA 3DPTA 1F9NA 1TW2A 4I0BA 2L4AA 1REPC 2PEXA 3CUQC 3DQVC 3IRQA 1YYVA 1KYZA 2E1CA 4E70A 1K7AA 1FP2A 3L7WA 2PMHA 2L02A 1TNTA 5FD6A 2OQRA 2HR3A 4OMZA 4L9NA 4ESFA 2XAHA 3U1DA 2R7FA 3TOBA 1O3QA 2M5WA 2P7VB 2KKOA 1LVAA 1SFEA 2BV6A 1FYLA 2YPRA 1LDDA 2FMLA 2HWVA 3K1MA 3WTUC 4HX4A 2OAZA 4PGGA 4IF4A 2UXNA 1ULYA 1IRGA 1YQAA 4ZYGA 3V4GA 2HFHA 4EV0A 1XMKA 2C6YA 3GO5A 4I09A 2P5KA 2Z99A 2ETHA 4MTEA 5LHHA 2Z9OA 1B1BA 2PN6A 2QVOA 3I4PA 3JTGA 2A07F 1TQIA 2FNAA 1GVJA 2PJPA 5K5RA 3F6VA 3P9KA 4DQ2A 3M7GA 2B0LA 1WI9A 4LG0A 1Y0UA 1KU7A 1KU2A 4EJOA 4LLGF 4Y15A 2ESNA 2ZCWA 4UV8A 4ZZLA 3WTYC 3GFMA 4UXNA 1I1GA 3FMSA 3KZYA 2RDPA 4F7ZA 1F1ZA 2RN7A 2FBIA 1KA8A 1SD4A 1O57A 1SMYF 2FXAA 4EMSA 4PDKA 5BPDA 2PQ8A 3KP5A 1DUXC 1XMAA 3IKVA 4RGRA 2RQPA 5DUKA 3V8JA 4WX9A 1ZG3A 3BPVA 2GA2A 4RB2C 1LJ9A 4RB0A 3LQRA 1U3EM 5HS7A 2PBIA 3CO6C 1C0WA 1TBXA 3WGIA 1IAWA 3NRVA 4P55A 1EH7A 1OYYA 1L0OC 1YFHA 1XGOA 4XBFA 4EM2A 5E18F 2QQAA 5H20A 2E1NA 1BIAA 4KIFA 3IKTA 1IN7A 1I6XA 1S8NA 1JGSA 4OU0A 4XRFA 2L01A 4S04A 4BHBA 2H6CA 1WQ2A 3RIRA 1D3YA 2IPQX 4MHGA 2ZNYA 3LA3A 4HF2A 4AIJA 5LGNA 2CQKA 4UNOA 2R3SA 3GW2A 2FRHA 3LAPA 4HAMA 3QOPA 1U78A 3GWZA 4O5VA 5DUIA 5LRSA 3TO9A 3I0TA 2WTEA 1QQIA 2EV5A 1QZZA 4HLXA 1W7PA 1ZN2A 4LMYA 1XDUA 3W6JB 2ZMEA 4WXHA 3JAMK 1H0MA 2UXXA 4G9YA 2RVCA 3L00A 4I98B 2EFNA 1YTYA 5LLQA 5E17F 1YO5C 4KMFA 1ZGJA 4LB5A 1HKSA 2DO7A 4KN4X 1AOYA 3I71A 2TDXA 4KDPA 2K7LA 2IW5A 1BI0A 1LDJA 1U5TB 2P6TA 3BPXA 1ZRCA 3BJAA 2P5LC 4LLLA 3GX4X 3HRTA 4YIIA 2ZO4A 2OZ6A 1I27A 4Q4ZF 3G73A 4HA8A 2EK5A 5D4RA 3LSTA 4GXOA 4I7HA 3N97A 3JSOA 4ZYEA 5FFZA 1CF7A 1RUOA 3O3KA 4KFCA 3IWZA 2JTVA 4PZJA 5BOXA 2BBYA 1ZRDA 1XGSA 4LK1F 1Z6TA 5FGMA 3O6BB 4XSZF 2WWYA 5BQTA 2EV0A 1D8KA 5D5XB 2LNBA 5L3BA 2MBFA 2RC4A 1TLHB 2CSOA 1IN8A 4HV5A 2IP2A 2F5EA 3LAJA 2CWEA 5D8LB 4I01A 4MEYF 3ABTA 1DDNA 2DK8A 1WWXA 5K5OA 4CYDA 5LRRA 1DPRA 3QU6A 5KVRA 2WV0A 3ZPLA 5DYMA 1XGMA 5LHIA 4AWXB 2K02A 1Z6RA 3DFGA 3FXRA 2QUFA 2P5VA 4JQFA 3RKXA 2XRNA 5L3GA 2FMYA 5AIPA 2OZUA 2W84A 4KUMA 2RGVA 4GCVA 2XKPA 2Z3YA 2HYFA 1ZAOA 2DW4A 4M9XA 2Q2EA 2A5YB 1JXSA 2VN2A 3GYHX 2XAJA 1PDNC 5BS6A 2IJLA 2O0YA 1RI7A 4JK1X 1CGPA 4CXFA 2KJCA 5DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7U A;  2HEO A;  3KLN A;  5D5V B;  3K0L A;  2FE3 A;  2W24 A;  3SZP A;  5ICC A;  3I53 A;  2V9V A;  2V1U A;  2A6H F;  2ZFW A;  3JTH A;  3RYR A;  2IVM A;  3JSP A;  2MD5 A;  1HKQ A;  4ETS A;  1G4D A;  3JW4 A;  1XB4 A;  1IRF A;  3T1B A;  4L0Y B;  5DCM A;  4M9S A;  4D0P A;  2LKP A;  4JBA A;  1IXS B;  1G3Y A;  2ESH A;  3R61 A;  3F6O A;  5CVU A;  2RKH A;  1LDK B;  4IRG A;  2D45 A;  3LA2 A;  3R60 A;  2Z5U A;  2CYY A;  3CTA A;  1P4W A;  3WTS C;  4BXU A;  5HDK A;  4OOI A;  3IWF A;  1FP1 D;  5E8G A;  2VOP A;  4BYY A;  1QBJ A;  3J80 Z;  2COM A;  2M30 A;  3E6M A;  4RAY A;  5FFX A;  2GIV A;  5JR3 A;  4IVN A;  4BNC A;  4MQV A;  3ULQ B;  4IRH A;  2NRA C;  4BH9 A;  3E6C C;  1UHW A;  3ZMZ A;  4O6J A;  2JZY A;  2YSR A;  1R1V A;  1JHF A;  3CUO A;  5EEG A;  1MGT A;  4I2O A;  1BBY A;  4WXC A;  2OA4 A;  2QBY B;  2FNP A;  3ZP5 A;  4Q48 A;  5IT9 K;  2M8E A;  4YFK F;  2FEZ A;  3OOP A;  2F5C A;  2ZNZ A;  1D5V A;  3IC7 A;  3ROU A;  1YLF A;  2PMU A;  1XSX A;  5CVI A;  2JRT A;  3F8F A;  3FHZ A;  5A2Q Z;  1XN7 A;  2DI3 A;  2PFB A;  4IJA A;  1R58 A;  3KFW X;  4CZZ A;  4RGX A;  3LFK A;  3CO7 C;  3QP5 A;  4ENM A;  3KP3 A;  1W7P D;  1O7F A;  1V4R A;  4AIK A;  4YG2 F;  1T6S A;  2GXG A;  3M1E A;  1BI1 A;  1KU9 A;  2V1X A;  4UVA A;  4IXA A;  1U5T C;  1DP7 P;  2R7D A;  2F2E A;  2DPD A;  5ERI A;  2O6G E;  4G7O F;  2QQ9 A;  1S7O A;  1RZ4 A;  1JE8 A;  3V7S A;  4Z2Y A;  3DPL C;  4A6E A;  3SZT A;  3BZ6 A;  2HYG D;  3REO A;  1XGN A;  1FYM A;  3TO7 A;  3ZMU A;  2MLK A;  3IL2 A;  4M74 A;  2HZT A;  3FZV A;  5TRD A;  4UUV A;  4IPA A;  4A0X A;  4L9J A;  2HS5 A;  4FX4 A;  2NS0 A;  2NAZ A;  2STT A;  3F23 A;  3PFI A;  5HLH A;  1R22 A;  3QU3 A;  2L54 A;  3IRR A;  4OIR F;  1B6A A;  2EB7 A;  1A04 A;  3F72 A;  3L9F A;  1R00 A;  1R36 A;  2VBX A;  3NQO A;  4A0Z A;  2DQL A;  1WKM A;  1L3L A;  2Z33 A;  2CO5 A;  1BN5 A;  2XRO A;  1ODD A;  1K6O A;  4ESB A;  3CDH A;  3HUG A;  1K78 B;  1BC7 C;  1P4A A;  2F5F A;  2IA1 A;  1BI3 A;  5D8K B;  3FMR A;  5ILV A;  5CJ9 A;  3J81 Z;  4HYE A;  2HKO A;  4RB1 A;  3MFK A;  3HTU A;  4EGY A;  3V8L A;  4QWQ A;  1YG2 A;  5FLX Z;  5F6F A;  3RPQ A;  1S7A A;  2CG4 A;  4G94 A;  1XCV A;  5FLX K;  3C7J A;  4OIQ F;  1XDS A;  3VOE A;  1IN5 A;  5J8C A;  3L2C A;  3ZN0 A;  1USS A;  2EA2 A;  1T98 A;  4CHU A;  1IN6 A;  1J0R A;  3FM5 A;  1FBU A;  4A12 A;  4YFX F;  1TTY A;  1BI2 A;  4A5M A;  3R0A A;  4N0B A;  1H9T A;  1TW3 A;  3I54 A;  3I5U A;  5DDG A;  2HDC A;  1S3J A;  1F5T A;  5CLS A;  4R79 A;  1R23 A;  1AWC A;  3RKW A;  4AD9 A;  3ZMV A;  4IHS A;  3MQ0 A;  1FX7 A;  2L4M A;  3F8C A;  2FBH A;  5JHU A;  2BYV E;  1GXQ A;  2XKO A;  3Q9S A;  1FOK A;  4U0W A;  1R1U A;  1IF1 A;  4MQ9 F;  3S2W A;  3F21 A;  3RKY A;  3GEZ A;  4HDV A;  1ZG1 A;  4GYG A;  1OPC A;  2XV4 S;  2XVC A;  4QLC U;  5TJJ A;  1YIO A;  3P7N A;  1FNN A;  3CUQ A;  4MTD A;  2XAG A;  3G3Z A;  3QRF F;  3P9I A;  1W4M A;  2JSC A;  3K69 A;  3KET A;  3ZMD A;  3K2Z A;  1LB2 A;  2J5O A;  2QLZ A;  1G3S A;  1S6L A;  2IT0 A;  4NQW A;  1T39 A;  1UCR A;  3GVA A;  4IRI A;  2V6C A;  3E5X A;  2IA2 A;  3WGH A;  1IZ1 A;  1EH8 A;  3M8E A;  2RNJ A;  1B4A A;  3KE2 A;  4LG0 B;  4G6D A;  1MKM A;  2FA5 A;  4P5O A;  5ICF A;  1MDM B;  2AS5 F;  2VE8 A;  4Q47 A;  1BC8 C;  1BIB A;  3I59 A;  4WXD A;  1F4K A;  3HHG A;  3OV8 A;  2YU3 A;  3HRU A;  2Y75 A;  4K2E A;  3B73 A;  1OYW A;  3E97 A;  1DPU A;  1H9G A;  1RIO H;  1PP7 U;  3M9A A;  1YS7 A;  3HRS A;  1KGS A;  1BM9 A;  2BGC A;  3F8M A;  1HW2 A;  2XAS A;  5HDN A;  2M87 A;  3RI4 A;  2HQN A;  2OBP A;  3VB2 A;  1SD6 A;  1RUN A;  2VC0 A;  5AIQ A;  2GAU A;  3KP6 A;  4TV7 A;  4L0Z B;  1YW9 A;  3M8F A;  1FT9 A;  6PAX A;  2MLG A;  3PQJ A;  2IRF G;  4EQQ A;  1FSE A;  1Z05 A;  5KK1 A;  4HBL A;  1ZH5 A;  4KA4 A;  2ISY A;  3J7A O;  4M73 A;  4EJT A;  5BMZ A;  5JI6 A;  1BJA A;  1XSD A;  5DD4 A;  1B9N A;  3K1P A;  1Z1D A;  3ABU A;  3Q9V A;  3H3Z A;  2KJB A;  4LD5 A;  2H09 A;  2FBK A;  3LA7 A;  1OR7 A;  3DEU A;  5D5U B;  5L3F A;  1J2X A;  2LDU A;  1GXP A;  1SD7 A;  2Y0M A;  3ECO A;  4S05 A;  2P7C B;  2VE9 A;  1ON2 A;  2HGC A;  3QPT A;  2DBB A;  4G6Q A;  5D5W B;  3WTX C;  3E3V A;  1XCB A;  3F8N A;  2EJR A;  1WSU A;  2VXZ A;  1ZLK A;  4HQE A;  4ENJ A;  3KZZ A;  4CO8 A;  4EJU A;  2LSO A;  3K1N A;  3ELK A;  4A5N A;  4CGZ A;  1TNS A;  2O03 A;  1VTN C;  4LB6 B;  1I5Z A;  1B9M A;  2BEO A;  2QYO A;  5FD5 A;  3D5L A;  2FF4 A;  4FT8 A;  4I0A A;  1ZG5 A;  3BJ6 A;  3EUH A;  1ZLJ A;  2GXB A;  5HOO A;  2PI0 A;  5FB2 A;  4ZYH A;  1P4X A;  5D6F A;  2P6S A;  4ENN A;  2M1B A;  2V79 A;  4GO1 A;  4ZYD A;  2LF8 A;  2VBY A;  2X0L A;  1LEA A;  2H27 A;  4R8H A;  3VFZ A;  1CF7 B;  2PLY A;  2STW A;  1HST A;  1T0F A;  1PUE E;  2W57 A;  5ICE A;  2Q0O A;  5DV5 A;  4HLY A;  4I02 A;  3TDZ C;  4EM1 A;  2F5D A;  4YFN F;  1IXR C;  3NEU A;  3MAJ A;  3J80 K;  3RDI A;  1OKR A;  1FBQ A;  2M45 A;  2EWN A;  3MCZ A;  4KNY A;  1KQ8 A;  5K5Q A;  2NNN A;  1IXC A;  4BHP A;  2XIG A;  3K9T A;  4A2U A;  1V3F A;  3FXQ A;  2KIM A;  2VOO A;  4LK0 F;  1O3R A;  1FYK A;  1ZRF A;  3RYP A;  4YIF A;  4RGS A;  4KIG A;  3EYY A;  4HW0 A;  2LF7 A;  3KCC A;  2H94 A;  1O3T A;  1RNL A;  3WG9 A;  3MZY A;  3FWE A;  1QPM A;  4M9Z A;  2CW0 F;  3ECH A;  4U0V A;  1HXD A;  3TO6 A;  3R6S A;  3Q5F A;  3HYI A;  2QM3 A;  5AON A;  3D0S A;  5D4S A;  3O2P E;  4L5I A;  1QO0 D;  4MGR A;  4HQM A;  5A2Q K;  1IUY A;  1YW8 A;  2HKX A;  2WC2 A;  2EFW A;  2IA0 A;  3ZMS A;  2EFP A;  2HQR A;  5FO5 A;  2XUB A;  2ZKZ A;  4XLP F;  2HTS A;  3W6K B;  2K27 A;  4HX7 A;  4FX0 A;  1STZ A;  1I1S A;  4G7H F;  1HQC A;  2QEN A;  5H6Q A;  4CDG A;  1SFX A;  3WTZ A;  5E20 A;  5F1R A;  2A3S A;  5LEJ A;  4HV6 A;  4RGU A;  4U7D A;  2Q8K A;  4M71 A;  1W5S A;  2H6B A;  4M6Y A;  3GLX A;  1LQ1 A;  4A0Y A;  1SFU A;  3BY6 A;  3V7C A;  5DEQ A;  5BPI A;  1MZB A;  1EH6 A;  1MJB A;  3E6D A;  2A68 F;  3H92 A;  3QPH A;  1FPQ A;  4Y13 A;  1R1T A;  2GA1 A;  4CIC A;  2DTR A;  2GQQ A;  3C18 A;  3GFI A;  4PCQ A;  1P92 A;  1YS6 A;  2Y48 A;  2GZW A;  2VON A;  4XSX F;  3HOS A;  2O61 A;  3BWG A;  1ZHF A;  4KN7 X;  3KP2 A;  5E8I A;  2OD5 A;  3DKW A;  3KLO A;  2W85 A;  3L09 A;  2D2W A;  1ON1 A;  3EDP A;  4ON0 A;  2YX4 A;  3RTR A;  3F22 A;  1R5G A;  3BRO A;  5ICG A;  2BE5 F;  2RV8 A;  5HS9 A;  2CFX A;  3F8B A;  3WE2 A;  3TGN A;  4HF0 A;  1J59 A;  5ILU A;  3J81 K;  3BOQ A;  4EVI A;  3E5U A;  2XGX A;  4KYW A;  4NB5 A;  3WTV C;  2KIU A;  2MC3 A;  3U9G A;  5L3D A;  1W5T A;  2XAQ A;  3V7R A;  1NHA A;  3MZH A;  2DT5 A;  1XSV A;  1WRJ A;  5F64 A;  1P2F A;  4UHT A;  2G9W A;  2ELH A;  4KIC A;  1MDM A;  2FOK A;  3SHF A;  3KEQ A;  5CYV A;  5HLG A;  1Q1H A;  4ASN A;  3HTS B;  1R5H A;  3ISP A;  2ZBK A;  2YX7 A;  1YW7 A;  4M72 A;  1ZAR A;  1U5T A;  2AXL A;  3FM3 A;  4WK8 F;  4A6D A;  2EFO A;  1J5Y A;  1KQ0 A;  3TKY A;  4N9H A;  4LLN A;  1LNW A;  2DU9 A;  3ML6 A;  3ERE D;  3WTW C;  2OU2 A;  2P8T A;  3TDU C;  1U8R A;  4BHC A;  4KIB A;  4GGG A;  4OIO F;  5HLI A;  4EM0 B;  5CVR A;  2UWM A;  3TQN A;  4EJV A;  3DXJ F;  2EFQ A;  3HSE A;  1O3S A;  3FF5 A;  1IN4 A;  3R0J A;  3HOT A;  1E17 A;  5LEK A;  4AVP A;  3WGG A;  2UZK A;  4L18 B;  3B02 A;  1U6G A;  4PGH A;  1MD0 A;  3GF2 A;  2D1V A;  2X4H A;  3QP6 A;  3ZMT A;  3BJO A;  1BOA A;  5LBQ A;  4B09 A;  2JPC A;  1J7K A;  1UB9 A;  4U88 A;  3CLO A;  3DP7 A;  5H6R A;  3JAM Z;  1QGP A;  4WF2 A;  4G7Z F;  4LFU A;  3HIF A;  2KIF A;  3HRM A;  5ILS A;  3I58 A;  1QNT A;  3N4M A;  3QAH A;  5JVT A;  3ZQ7 A;  5HDG A;  3T5X A;  4WCG A;  1IW7 F;  2ADU A;  5J8F A;  3F3X A;  2FQ3 A;  3LQQ A;  4UVB A;  1KU3 A;  2V1D A;  5HS8 A;  1ZRE A;  4P96 A;  3LWF A;  4RB3 C;  4BQA A;  3KP7 A;  3T0Y A;  4KT5 C;  2W25 A;  3C3W A;  3C1D A;  3WE3 A;  2HTJ A;  3KEO A;  4EGZ A;  2MH2 A;  3RPU A;  1X3U A;  3CUQ B;  4HOB A;  5CVV A;  3WU1 B;  4RS8 A;  3GUD A;  2FSW A;  3U2R A;  3GFJ A;  4G8X A;  3T8T A;  4L5J A;  4U0Y A;  5CVJ A;  2VOD A;  1OYI A;  1E2X A;  2A61 A;  1R7J A;  3IHU A;  1FBS A;  1G3W A;  4B8X A;  1W7P B;  4ZZD A;  5JFR A;  2A6E F;  4HZF A;  2O3F A;  3HSF A;  4L9V A;  1P6R A;  2ZME B;  2OQG A;  2QBY A;  1FC3 A;  5EEH A;  3WTT C;  4EJW A;  5HVQ C;  4P9U A;  1ONV A;  1UST A;  1HW1 A;  2J5P A;  2ZJ2 A;  3DV8 A;  1G6N A;  1SAX A;  3I59 B;  1FZP B;  3GFL A;  1J75 A;  1J9I A;  2YR2 A;  4OIP F;  2K4B A;  2D1H A;  1MJA A;  5DD8 A;  4H0E A;  2K86 A;  2NNY A;  2QZ8 A;  5L3C A;  1UHM A;  2NYX A;  3V8K A;  1FY7 A;  1FSH A;  4AIH A;  1S29 A;  4U7B A;  1Z9C A;  3E5Q A;  4M6X A;  3GZ5 A;  2EV6 A;  3FXU A;  5D6E A;  3BDD A;  5L3E A;  2DK5 A;  2GWR A;  2XHK A;  1GHC A;  1JHH A;  2CGP A;  5ED4 A;  3MEX A;  3HSR A;  1XD7 A;  2O8X A;  1SMT A;  4OIN F;  2XAF A;  2PG4 A;  4R1H A;  5K1Y A;  3P9C A;  2VT2 A;  3H3U A;  4FHT A;  3WOD F;  1ZGA A;  1LEB A;  3SFZ A;  1HBX G;  4UV9 A;  2KRF A;  1MJ9 A;  2E7X A;  4XLN F;  4LGW A;  4ZH4 F;  4DNC A;  1G3T A;  1EV7 A;  1HW5 A;  1KYW A;  2QWW A;  3EET A;  2ACJ A;  3R4K A;  3FMQ A;  3EQL F;  1FWZ A;  4RAZ A;  3COA C;  2DAO A;  3ZN1 A;  2P4W A;  5LGU A;  1TQM A;  1HKT A;  1SD5 A;  5J6X A;  2ISZ A;  5IT3 A;  4P9F A;  3FX3 A;  5E1Z B;  3PQK A;  3I64 A;  4ENK A;  2DLL A;  2HOE A;  1D8J A;  5IT9 Z;  4MEX F;  4LJZ F;  4OMY A;  1KQ9 A;  1OMI A;  1K78 A;  3SXY A;  2G7U A;  3CJN A;  4HDU A;  4UVC A;  4HF1 A;  1T38 A;  4KMU X;  3T8R A;  1QZY A;  3GXO A;  3KP4 A;  3BP8 A;  2MA3 A;  1O7L A;  2VBW A;  4Y17 A;  4HX8 A;  2VBZ A;  2L3D A;  1K79 A;  1HSJ A;  2FU4 A;  5LGT A;  3VEP A;  3AAF A;  1B59 A;  2VC1 A;  3RJP A;  4NHJ A;  2E7W A;  1TQP A;  1Z91 A;  5E1W A;  3MWM A;  2A69 F;  2K4J A;  2JPB A;  4GYI A;  1T2K A;  5E1X A;  4Q5S F;  2G7H A;  2DFI A;  3SQN A;  3TOA A;  4IHT A;  1U2W A;  5DCM B;  2JT1 A;  4WWC A;  4O3M A;  3GZ6 A;  3HHH A;  2DQR A;  1UFM A;  5LHG A;  4ESJ A;  3WU0 A;  3EYI A;  1FLI A;  2EA4 A;  2VT3 A;  1ZYR F;  4BAY A;  4L9T A;  3VOD A;  1PP8 F;  4N9I A;  2MH9 A;  2QQB A;  2DPU A;  2ZXJ A;  3DF8 A;  4MNU A;  3E6B A;  3DPT A;  1F9N A;  1TW2 A;  4I0B A;  2L4A A;  1REP C;  2PEX A;  3CUQ C;  3DQV C;  3IRQ A;  1YYV A;  1KYZ A;  2E1C A;  4E70 A;  1K7A A;  1FP2 A;  3L7W A;  2PMH A;  2L02 A;  1TNT A;  5FD6 A;  2OQR A;  2HR3 A;  4OMZ A;  4L9N A;  4ESF A;  2XAH A;  3U1D A;  2R7F A;  3TOB A;  1O3Q A;  2M5W A;  2P7V B;  2KKO A;  1LVA A;  1SFE A;  2BV6 A;  1FYL A;  2YPR A;  1LDD A;  2FML A;  2HWV A;  3K1M A;  3WTU C;  4HX4 A;  2OAZ A;  4PGG A;  4IF4 A;  2UXN A;  1ULY A;  1IRG A;  1YQA A;  4ZYG A;  3V4G A;  2HFH A;  4EV0 A;  1XMK A;  2C6Y A;  3GO5 A;  4I09 A;  2P5K A;  2Z99 A;  2ETH A;  4MTE A;  5LHH A;  2Z9O A;  1B1B A;  2PN6 A;  2QVO A;  3I4P A;  3JTG A;  2A07 F;  1TQI A;  2FNA A;  1GVJ A;  2PJP A;  5K5R A;  3F6V A;  3P9K A;  4DQ2 A;  3M7G A;  2B0L A;  1WI9 A;  4LG0 A;  1Y0U A;  1KU7 A;  1KU2 A;  4EJO A;  4LLG F;  4Y15 A;  2ESN A;  2ZCW A;  4UV8 A;  4ZZL A;  3WTY C;  3GFM A;  4UXN A;  1I1G A;  3FMS A;  3KZY A;  2RDP A;  4F7Z A;  1F1Z A;  2RN7 A;  2FBI A;  1KA8 A;  1SD4 A;  1O57 A;  1SMY F;  2FXA A;  4EMS A;  4PDK A;  5BPD A;  2PQ8 A;  3KP5 A;  1DUX C;  1XMA A;  3IKV A;  4RGR A;  2RQP A;  5DUK A;  3V8J A;  4WX9 A;  1ZG3 A;  3BPV A;  2GA2 A;  4RB2 C;  1LJ9 A;  4RB0 A;  3LQR A;  1U3E M;  5HS7 A;  2PBI A;  3CO6 C;  1C0W A;  1TBX A;  3WGI A;  1IAW A;  3NRV A;  4P55 A;  1EH7 A;  1OYY A;  1L0O C;  1YFH A;  1XGO A;  4XBF A;  4EM2 A;  5E18 F;  2QQA A;  5H20 A;  2E1N A;  1BIA A;  4KIF A;  3IKT A;  1IN7 A;  1I6X A;  1S8N A;  1JGS A;  4OU0 A;  4XRF A;  2L01 A;  4S04 A;  4BHB A;  2H6C A;  1WQ2 A;  3RIR A;  1D3Y A;  2IPQ X;  4MHG A;  2ZNY A;  3LA3 A;  4HF2 A;  4AIJ A;  5LGN A;  2CQK A;  4UNO A;  2R3S A;  3GW2 A;  2FRH A;  3LAP A;  4HAM A;  3QOP A;  1U78 A;  3GWZ A;  4O5V A;  5DUI A;  5LRS A;  3TO9 A;  3I0T A;  2WTE A;  1QQI A;  2EV5 A;  1QZZ A;  4HLX A;  1W7P A;  1ZN2 A;  4LMY A;  1XDU A;  3W6J B;  2ZME A;  4WXH A;  3JAM K;  1H0M A;  2UXX A;  4G9Y A;  2RVC A;  3L00 A;  4I98 B;  2EFN A;  1YTY A;  5LLQ A;  5E17 F;  1YO5 C;  4KMF A;  1ZGJ A;  4LB5 A;  1HKS A;  2DO7 A;  4KN4 X;  1AOY A;  3I71 A;  2TDX A;  4KDP A;  2K7L A;  2IW5 A;  1BI0 A;  1LDJ A;  1U5T B;  2P6T A;  3BPX A;  1ZRC A;  3BJA A;  2P5L C;  4LLL A;  3GX4 X;  3HRT A;  4YII A;  2ZO4 A;  2OZ6 A;  1I27 A;  4Q4Z F;  3G73 A;  4HA8 A;  2EK5 A;  5D4R A;  3LST A;  4GXO A;  4I7H A;  3N97 A;  3JSO A;  4ZYE A;  5FFZ A;  1CF7 A;  1RUO A;  3O3K A;  4KFC A;  3IWZ A;  2JTV A;  4PZJ A;  5BOX A;  2BBY A;  1ZRD A;  1XGS A;  4LK1 F;  1Z6T A;  5FGM A;  3O6B B;  4XSZ F;  2WWY A;  5BQT A;  2EV0 A;  1D8K A;  5D5X B;  2LNB A;  5L3B A;  2MBF A;  2RC4 A;  1TLH B;  2CSO A;  1IN8 A;  4HV5 A;  2IP2 A;  2F5E A;  3LAJ A;  2CWE A;  5D8L B;  4I01 A;  4MEY F;  3ABT A;  1DDN A;  2DK8 A;  1WWX A;  5K5O A;  4CYD A;  5LRR A;  1DPR A;  3QU6 A;  5KVR A;  2WV0 A;  3ZPL A;  5DYM A;  1XGM A;  5LHI A;  4AWX B;  2K02 A;  1Z6R A;  3DFG A;  3FXR A;  2QUF A;  2P5V A;  4JQF A;  3RKX A;  2XRN A;  5L3G A;  2FMY A;  5AIP A;  2OZU A;  2W84 A;  4KUM A;  2RGV A;  4GCV A;  2XKP A;  2Z3Y A;  2HYF A;  1ZAO A;  2DW4 A;  4M9X A;  2Q2E A;  2A5Y B;  1JXS A;  2VN2 A;  3GYH X;  2XAJ A;  1PDN C;  5BS6 A;  2IJL A;  2O0Y A;  1RI7 A;  4JK1 X;  1CGP A;  4CXF A;  2KJC A;  5DCF A; 
#chains in the Genus database with same CATH topology
 2DFF A;  4RM2 A;  2E2I J;  1IDY A;  1Z7U A;  1XC5 A;  5C44 J;  2KIQ A;  1D1B A;  5F0C A;  1WJD A;  1WH5 A;  2HEO A;  2JVG A;  3KLN A;  4XKW A;  3VSL A;  2D5V A;  4XLF A;  5D5V B;  1Z21 A;  1MNE A;  2EIL H;  3K0L A;  3B6C A;  2FE3 A;  4ZC3 A;  2W24 A;  2ME6 A;  3SZP A;  4HNT A;  1QHH D;  2EIJ H;  3I53 A;  5ICC A;  2V9V A;  2V1U A;  2A6H F;  1DGR M;  2ZFW A;  3JTH A;  3RYR A;  2IVM A;  3JSP A;  2MD5 A;  1OCZ H;  1HKQ A;  4ETS A;  1G4D A;  3JW4 A;  2DT6 A;  4BXX J;  1XB4 A;  1IRF A;  3T1B A;  4MFE A;  3DBR B;  4L0Y B;  5DCM A;  4M9S A;  4D0P A;  2LKP A;  4RLQ A;  4CCJ A;  4JBA A;  1MIJ A;  1IXS B;  1G3Y A;  2ESH A;  4XN0 A;  3G1O A;  3R61 A;  3F6O A;  5CVU A;  2LVS A;  3GTJ J;  2RKH A;  2PMZ N;  2XC7 A;  4E7K A;  3HOZ J;  4N4N B;  1E3H A;  4X1E A;  3FBN B;  1LDK B;  4IRG A;  3OYB A;  2D45 A;  2CUF A;  3LA2 A;  4BKX A;  3R60 A;  2Z5U A;  2CYY A;  4UUS B;  3CTA A;  3F0C A;  1BR4 A;  1P4W A;  2X1C A;  3X2Q H;  3WTS C;  4BXU A;  5HDK A;  4OOI A;  3IWF A;  1FP1 D;  2WA0 A;  2Z2S B;  5E8G A;  2VOP A;  4BYY A;  1QBJ A;  3J80 Z;  2COM A;  2DDA A;  3JRC A;  2M30 A;  2O5R A;  3TW7 A;  3H5R A;  1MBH A;  3E6M A;  4RAY A;  2IEK A;  3ZQH A;  5FFX A;  2GIV A;  5JR3 A;  3J7A Y;  5M5X J;  4IVN A;  3K4N A;  4BNC A;  4MQV A;  4AID A;  1EA3 A;  3ULQ B;  1W0U A;  4CYC A;  4IRH A;  3CCR I;  2NRA C;  4M3F A;  1Z77 A;  4BH9 A;  1VFC A;  3E6C C;  4AM3 A;  3CCV I;  1UHW A;  3ZMZ A;  4O6J A;  4OAZ A;  3CCS I;  1W36 D;  3K4J A;  3W2W A;  3K4M A;  2JZY A;  2YSR A;  2NVT J;  1R1V A;  1JHF A;  3CUO A;  1TT0 A;  1LE8 A;  5EEG A;  1MGT A;  2HQ5 A;  3CC7 I;  4I2O A;  1BBY A;  1ETK A;  1SC7 A;  4WXC A;  2OA4 A;  1NG7 A;  2FNP A;  2QBY B;  1IUF A;  1D0X A;  3BCB A;  4Q48 A;  2M8E A;  2R7R A;  3ZP5 A;  5IT9 K;  4XN3 A;  4YFK F;  3W2A A;  2MYS A;  4QSH A;  2FEZ A;  3OOP A;  2F5C A;  3LSR A;  2ZNZ A;  1D5V A;  1YX5 A;  1X1C A;  3BR3 A;  2JA2 A;  3BZK A;  3IC7 A;  3ROU A;  2F4M B;  1YLF A;  4A3E J;  4C3J J;  2PMU A;  1G59 A;  5HOD A;  1XSX A;  5CVI A;  1NK3 P;  2JRT A;  3S3O A;  3F8F A;  3TW6 A;  3H3V K;  3IV5 A;  4IOC F;  4C3H J;  3FHZ A;  5A2Q Z;  4X0G A;  1XN7 A;  2DI3 A;  2PFB A;  4IJA A;  1R58 A;  3CCQ I;  3KX2 A;  3KFW X;  4CZZ A;  3ZCO A;  4RGX A;  3LFK A;  3CO7 C;  2KDZ A;  1VQ9 I;  3QP5 A;  4ENM A;  3KP3 A;  2EZH A;  1W7P D;  1O7F A;  1V4R A;  5CQE A;  4AIK A;  4YG2 F;  3LSI A;  1T6S A;  1WJB A;  2EZI A;  2IS1 A;  2GXG A;  3M1E A;  1BI1 A;  3LSH A;  4PFO A;  1KU9 A;  2V1X A;  1A6I A;  4UVA A;  4IXA A;  1N77 A;  1U5T C;  4UB8 C;  1DP7 P;  3NAR A;  4CZC A;  2R7D A;  2F2E A;  2KQR A;  2DPD A;  3QYB A;  2DJN A;  5ERI A;  2M0M A;  5H2F C;  3G71 I;  1A5J A;  5GP9 A;  2O6G E;  3S2D J;  4G7O F;  1WH7 A;  2QQ9 A;  1S7O A;  1RZ4 A;  1JE8 A;  3V7S A;  4Z2Y A;  3DPL C;  4A6E A;  3CLQ A;  3SZT A;  3BZ6 A;  2HYG D;  4M3G A;  2IS6 A;  3REO A;  1XGN A;  1FYM A;  2WY7 Q;  1ZEL A;  2HZD A;  3S1R J;  1WJC A;  3TO7 A;  2K3P A;  1TWC J;  3ZMU A;  2MLK A;  2HXO A;  5DS9 A;  4M74 A;  3IL2 A;  4BE2 A;  2NVX J;  4RBO A;  2HZT A;  3FZV A;  5TRD A;  1I6H J;  4Y3O A;  4UUV A;  4IPA A;  5HNH A;  3Q0W A;  2Y9Y A;  4NNJ A;  4L9J A;  4A0X A;  1RET A;  2NS8 A;  2HS5 A;  2K9M A;  4FX4 A;  2L7F P;  4BQN A;  1PUF B;  5FRN A;  2ZXH A;  2NS0 A;  2LMD A;  2NAZ A;  2STT A;  3F23 A;  4AUX A;  3PFI A;  3I56 I;  5HLH A;  1R22 A;  3QU3 A;  2L54 A;  4BS9 A;  4IHV A;  3IRR A;  4OIR F;  1B6A A;  2EB7 A;  3HOV J;  1A04 A;  3F72 A;  3KYC B;  4GDF A;  3L9F A;  1R00 A;  2MFZ A;  4XOR A;  1R36 A;  2VBX A;  1MMG A;  3NQO A;  4DYR A;  3OS0 A;  2CQ7 A;  4A0Z A;  1WJE A;  2DQL A;  1WKM A;  1L3L A;  2Z33 A;  3GBG A;  3H0D A;  2CO5 A;  1ZK8 A;  4XLA A;  3FXK A;  1BN5 A;  2CRG A;  2XRO A;  2NXN B;  1ODD A;  1K6O A;  3OYD A;  2KPM A;  4ESB A;  3CDH A;  3S1Q J;  3HUG A;  1K78 B;  3OIO A;  2W82 A;  2GOM A;  3L2U A;  3TED A;  4MFD A;  1T08 B;  2V9K A;  2Y69 H;  5F0F A;  4X6A J;  3S3N A;  1BC7 C;  1P4A A;  3QYE A;  3ZXS A;  2F5F A;  2XPU A;  2IA1 A;  3DBH B;  4DBQ A;  1Z3Y A;  1DQU A;  1BI3 A;  1SAU A;  3AG2 H;  2OPT A;  5D8K B;  3FMR A;  5ILV A;  1EKE A;  3ZQF A;  4B3X A;  2ZC2 A;  3GTQ J;  5CJ9 A;  4OAY A;  3J81 Z;  1BW5 A;  4HYE A;  3CDI A;  3FIS A;  5DM7 F;  2HKO A;  4RB1 A;  3MFK A;  3HTU A;  4EGY A;  2VQC A;  3V8L A;  3JRB A;  4QWQ A;  1UJ8 A;  2WV1 A;  1YG2 A;  4RAF A;  2G0E A;  2CW8 A;  2RQQ A;  3C2H A;  5FLX Z;  5F6F A;  3RPQ A;  1S7A A;  4L5E A;  1OFC X;  5IP7 J;  2CG4 A;  1Y6I A;  5JHF A;  4G94 A;  2DOD A;  3WU2 C;  1XCV A;  5FLX K;  3C7J A;  4OIQ F;  1XDS A;  3VOE A;  1ZR4 A;  1IN5 A;  5J8C A;  3L2C A;  3ZN0 A;  4CUG A;  3PL8 A;  3Q0U A;  1USS A;  3BR6 A;  2EA2 A;  2IBD A;  5J47 A;  1T98 A;  4II3 A;  4CHU A;  2DMQ A;  4I76 A;  3KEY A;  1IN6 A;  1J0R A;  3FM5 A;  1OIS A;  1FBU A;  2KRH A;  2JVH A;  4A12 A;  1IG7 A;  4YFX F;  1FTZ A;  1TTY A;  1BI2 A;  1LUJ B;  4A5M A;  5F0H A;  3R0A A;  4IEJ A;  4N0B A;  2VUM J;  1H9T A;  1TW3 A;  2VKV A;  3I54 A;  5HLT A;  1WFX A;  5KNL A;  3DLL F;  3I5U A;  5DDG A;  2HDC A;  1S3J A;  1FOY A;  1F5T A;  5CLS A;  4R79 A;  1R23 A;  3MVP A;  2R5Z A;  1AWC A;  1X1A A;  3RKW A;  4M6V A;  3OS1 A;  2E36 A;  4AD9 A;  2B63 J;  1WPK A;  3ZMV A;  4IHS A;  1T56 A;  3CF5 F;  1VQK I;  4AU7 A;  2OTL I;  4F92 B;  4HEA 2;  3MQ0 A;  3A01 A;  1FX7 A;  3PO3 J;  2L4M A;  2WB1 N;  3F8C A;  3L2R A;  2FBH A;  5JHU A;  2BYV E;  1GXQ A;  1Z67 A;  4FIS A;  2XKO A;  3BQZ A;  3KIO A;  2JRM A;  1YIJ I;  1OR7 C;  3Q9S A;  1FOK A;  3PSF A;  4U0W A;  1R1U A;  1IF1 A;  2FQ4 A;  2VKH A;  4MQ9 F;  3S2W A;  3F21 A;  3RKY A;  2OCC H;  3GEZ A;  4HDV A;  2HDD A;  2KIS A;  1ZG1 A;  5K7F A;  4GYG A;  1OPC A;  2XV4 S;  2I8D A;  2XVC A;  1IRX A;  4QLC U;  3VPR A;  5TJJ A;  1YIO A;  3P7N A;  1FNN A;  3CUQ A;  4MTD A;  2XAG A;  3CCE I;  1Z0X A;  2ID6 A;  2XF5 A;  3G3Z A;  1FMW A;  2BOL A;  3QRF F;  2M9H A;  3P9I A;  5F04 A;  3JRE A;  1W4M A;  2JSC A;  2R5Y A;  2IXS A;  3DKY A;  3K69 A;  5TIS C;  2VIX A;  1A6Q A;  3KET A;  3ZMD A;  3FKJ A;  3K2Z A;  1S5L C;  1LB2 A;  1RC9 A;  2JK3 A;  3GTP J;  2J5O A;  2QLZ A;  3DPU A;  3FBI B;  1G3S A;  1S6L A;  2WBM A;  4LG3 A;  4E7J A;  3S16 J;  2WB1 A;  3OOU A;  2IT0 A;  4NQW A;  1HF0 A;  1ORK A;  4DW6 A;  1T39 A;  1UCR A;  2KHM A;  3GVA A;  4IRI A;  2V6C A;  3E5X A;  1S72 I;  2IA2 A;  3WGH A;  4CSW A;  1X19 A;  3BTJ A;  3RQ4 A;  2XPW A;  4PJL A;  1IZ1 A;  5F1J A;  3DEE A;  3HB9 A;  2XSJ C;  1EH8 A;  3M8E A;  2RNJ A;  2X9D A;  2HOT A;  1B4A A;  3KE2 A;  3UKG A;  4LG0 B;  5FKK A;  4G6D A;  2Q1Z B;  1MKM A;  2FA5 A;  4P5O A;  3S1N J;  3L2W A;  3GZN B;  5ICF A;  3BC8 A;  4D7N A;  1T33 A;  1MDM B;  3HOY J;  2WAF A;  4EEF G;  2AS5 F;  1OCT C;  2VE8 A;  4Q47 A;  1BC8 C;  1BIB A;  4QTR A;  1HCR A;  4BEH A;  2E34 A;  2OC6 A;  3I59 A;  4WXD A;  3WHB A;  2QQ8 A;  2UV1 A;  1F4K A;  2CV2 A;  3HHG A;  3OV8 A;  2YU3 A;  3HRU A;  3I4M J;  2Y75 A;  1P7J A;  4K2E A;  3B73 A;  4RLF A;  1OYW A;  3CCU I;  3E97 A;  3WG7 H;  2ZJR F;  1DPU A;  1H9G A;  1RIO H;  1T95 A;  3QYF A;  1PP7 U;  3M9A A;  1YS7 A;  3HRS A;  1DU0 A;  1KGS A;  4ZJZ A;  2IGM A;  4XLE A;  1ZTR A;  1BM9 A;  1WCM J;  2ZFU A;  2E2J J;  1GV5 A;  3K4L A;  3IAS 2;  2HPM A;  2LC2 A;  2BGC A;  3F8M A;  1HW2 A;  2XAS A;  4NC7 A;  2XGC A;  4RM3 A;  5HDN A;  2M87 A;  3RI4 A;  2LRD A;  2HQN A;  2K9N A;  2OBP A;  1SD6 A;  3VB2 A;  2HNH A;  5FKL A;  3ZQC A;  3IAM 2;  2VC0 A;  1RUN A;  5EF6 A;  2H8R A;  2W48 A;  4FCY A;  4ZYA A;  5AIQ A;  3N05 A;  2GAU A;  3KP6 A;  3LSP A;  4TV7 A;  4L0Z B;  1YW9 A;  3M8F A;  1FT9 A;  6PAX A;  3BR1 A;  2MLG A;  3PUB A;  2V4J C;  3HG9 A;  3I9V 2;  3PQJ A;  4A3G J;  2IRF G;  4EQQ A;  1ETY A;  1FSE A;  1Z05 A;  5KK1 A;  4HBL A;  1ZH5 A;  4ZDL A;  5EZH A;  4KA4 A;  2ISY A;  4AYB N;  2JA6 J;  3J7A O;  3CJQ B;  4M73 A;  1BJZ A;  4EJT A;  5BMZ A;  5JI6 A;  3I55 I;  4FE4 A;  5K7H A;  1BJA A;  2EH3 A;  2F5V A;  3OIP A;  1B9N A;  5DD4 A;  1XSD A;  3K1P A;  2YS9 A;  3D5R C;  1Z1D A;  4XLC A;  3CC2 I;  3FDY A;  3K7A J;  3ABU A;  1D0Z A;  3OR1 C;  3K4K A;  3Q9V A;  1N75 A;  2L7K A;  3H3Z A;  2KJB A;  4LD5 A;  2H09 A;  4QPQ A;  2FBK A;  1RRJ A;  2LBF A;  3LA7 A;  1OR7 A;  3NWT A;  3DEU A;  4JYK A;  2L5Q A;  1MH3 A;  5C4J J;  4G12 A;  2VL8 A;  5D5U B;  2R0Q C;  4PK4 A;  5L3F A;  1J2X A;  2LDU A;  4JX6 A;  1GXP A;  1SD7 A;  2Y0M A;  1YHQ I;  4C3I J;  2CQQ A;  3ECO A;  4S05 A;  1AKH A;  2P7C B;  2VE9 A;  1ON2 A;  2HGC A;  3QPT A;  2DBB A;  4BQQ A;  5FLM J;  4G6Q A;  5D5W B;  3WTX C;  1MBF A;  3E3V A;  3ERM A;  1XCB A;  3HKZ N;  3F8N A;  1MMA A;  3LOC A;  3WHC A;  2EJR A;  1VQP I;  1WSU A;  2UUZ A;  2VXZ A;  1ZLK A;  4HQE A;  1ETW A;  2MG4 A;  1U9O A;  4FET A;  1TP4 A;  4AYB A;  4ENJ A;  2OCE A;  3CMA I;  2IGN A;  3KZZ A;  4CO8 A;  4EJU A;  3K70 C;  2LSO A;  3K1N A;  3CMY A;  3ELK A;  4A5N A;  4CGZ A;  1TNS A;  2HQA A;  1VZ0 A;  3DTE A;  2O03 A;  3K4B A;  1MMS A;  1VTN C;  1JUP A;  4LB6 B;  1I5Z A;  3HM5 A;  4DBR A;  3CDL A;  2JJ7 A;  1B9M A;  4PJJ A;  2BEO A;  1W1W E;  2QYO A;  3UNG C;  4DZP A;  1GV2 A;  5FD5 A;  3D5L A;  2FF4 A;  4FT8 A;  4I0A A;  1ZG5 A;  2ZJQ F;  3BJ6 A;  3EUH A;  1ZLJ A;  2GXB A;  4XK4 A;  4GRI A;  1WJ5 A;  1I39 A;  2QSH X;  2M4K A;  3HKZ A;  2ELJ A;  2E1M B;  2H1L A;  2XAU A;  1Y0N A;  2FOW A;  5HOO A;  2PI0 A;  5B5E C;  5FKO A;  2DOF A;  5FB2 A;  4ZYH A;  4RMN A;  2K3F A;  1P4X A;  5D6F A;  3S93 A;  1OCR H;  2P6S A;  4ENN A;  5FLV A;  4ABZ A;  2R7O A;  4J01 A;  2M1B A;  2V79 A;  4GO1 A;  4ZYD A;  2LF8 A;  2VBY A;  2K85 A;  2X0L A;  4DIQ A;  5B1A H;  1LEA A;  4BJ5 C;  4R8H A;  1B8I B;  1GDT A;  2H27 A;  3VFZ A;  1RES A;  1ACI A;  1CF7 B;  2FX0 A;  1HLV A;  1K6Y A;  1JKP C;  2PLY A;  1XTA A;  2STW A;  1HST A;  1T0F A;  1PUE E;  2W57 A;  5ICE A;  2Q0O A;  2Z1D A;  5DV5 A;  4HLY A;  1H8A C;  4I02 A;  2F4I A;  3TDZ C;  5F08 A;  4EM1 A;  4D1Q A;  5HNF A;  4QIW N;  2XRL A;  4IKF A;  2IS4 A;  4IHX A;  1VQ5 I;  2F5D A;  3JRF A;  4C2U A;  1JJ8 C;  1LFU P;  4F3Q A;  4YFN F;  5GTH C;  1IXR C;  3H35 A;  3NEU A;  1POG A;  3MAJ A;  2CFO A;  3J80 K;  2H8W A;  3RDI A;  2R7W A;  1OKR A;  1FBQ A;  2M45 A;  2QCO A;  5J40 A;  2XB0 X;  2EWN A;  4BBR J;  3MCZ A;  4KNY A;  1KQ8 A;  5K5Q A;  2DT7 B;  5B66 C;  4RDU A;  2NNN A;  1PUF A;  1QHG A;  1IXC A;  4BHP A;  5GAE J;  2XIG A;  3IUO A;  3K9T A;  4IZZ A;  1ENH A;  4A2U A;  1V3F A;  3FXQ A;  2PMZ A;  2KIM A;  2VOO A;  3VWB A;  4LK0 F;  3SJM A;  2GLO A;  4BL0 B;  1JGG A;  2EIM H;  1QVU A;  2VB6 A;  1O3R A;  1FJL A;  1FYK A;  1XG1 A;  1Y1V J;  1R49 A;  1ZRF A;  1Z7L A;  2EZL A;  3CQZ J;  3RYP A;  4YIF A;  4RGS A;  4KIG A;  4E6K G;  5J4Y A;  3EYY A;  4G6T B;  4HW0 A;  2LF7 A;  3KCC A;  4ZDO A;  2H94 A;  2MC4 A;  2VI6 A;  1O3T A;  1PYV A;  1RNL A;  3WG9 A;  5LFA A;  3B6A A;  3DCF A;  3MZY A;  2HOA A;  2Q2E B;  3FWE A;  1QPM A;  4M9Z A;  4PSX A;  4XON A;  4E7Z A;  2CW0 F;  3QQA A;  3BCA A;  3ECH A;  4PSW A;  4U0V A;  1QVT A;  4A3K J;  4I6Z A;  2BY0 A;  2CMP A;  3KPH A;  1HXD A;  3BT9 A;  2ZSI B;  3R6S A;  3TO6 A;  2CV0 A;  3M3Y J;  3Q5F A;  3HYI A;  2QM3 A;  5AON A;  1YIT I;  3D0S A;  3ABK H;  5BNG A;  5D4S A;  2I10 A;  3O2P E;  4L5I A;  4NC6 A;  4HSR A;  1QO0 D;  4MGR A;  4HQM A;  5A2Q K;  1IUY A;  1R71 A;  2DFE A;  4HRI A;  1D0Y A;  1YW8 A;  1JKQ C;  2BVL A;  2HKX A;  2QF7 A;  2WC2 A;  2Z16 A;  5K7Z A;  4MLO A;  4IHW A;  2EFW A;  4KJZ A;  2IA0 A;  3ZMS A;  1MBK A;  2EFP A;  2DYR H;  2HQR A;  5FO5 A;  3CMM A;  3OYE A;  4MIM A;  2XF7 A;  2K40 A;  2JA8 J;  2EIK H;  4A3C J;  2NOJ B;  2XUB A;  2ZKZ A;  4XLP F;  3W3C A;  5FJ8 J;  2HTS A;  2O7O A;  3W6K B;  2BHZ A;  4PJ0 C;  4BJ6 C;  2K27 A;  3FKI J;  3PM1 A;  4HX7 A;  2VLA A;  2LH9 A;  4FX0 A;  2DYS H;  3AL0 B;  1TWH J;  2DDB A;  1STZ A;  4IL6 C;  1OLT A;  1I1S A;  4G7H F;  1HQC A;  1VF9 A;  2QEN A;  1HOM A;  5H6Q A;  4CDG A;  1SFX A;  4UUT A;  3GLL A;  5GPC A;  3OYL A;  3WTZ A;  3PUF A;  5E20 A;  5F1R A;  2A3S A;  3RKQ A;  5C3E J;  5LEJ A;  5E3L A;  1D5Y A;  4HV6 A;  4RGU A;  2LYC A;  4PUS A;  4XRS A;  4U7D A;  2Q8K A;  4E7H A;  2DN0 A;  4M71 A;  2M8G X;  1AHD P;  1W5S A;  2H6B A;  4M6Y A;  3GLX A;  3IH4 A;  1LQ1 A;  4KIS A;  1ETQ A;  4A0Y A;  2R7S A;  1Z3X A;  3M07 A;  2L9V A;  1SFU A;  3BY6 A;  3V7C A;  5DEQ A;  5BPI A;  2LY2 A;  1UMQ A;  4E4H A;  1MZB A;  1EH6 A;  5EJC A;  1MJB A;  3E6D A;  2A68 F;  3H92 A;  3QPH A;  3CES A;  1FPQ A;  4Y13 A;  1R1T A;  4QPO A;  2IS2 A;  2GA1 A;  1U0J A;  4CIC A;  2DTR A;  2GQQ A;  3C18 A;  3GFI A;  1WVR A;  2VQL A;  1VQ7 I;  4PCQ A;  1P92 A;  4CYC B;  1WHU A;  4FE7 A;  1YRN B;  4ZDP A;  1YS6 A;  2Y48 A;  4CCM A;  5FRM A;  1R4M B;  4CH7 A;  3LSG A;  2GZW A;  1WJA A;  3PFY A;  2NVY J;  2VON A;  4XSX F;  3K2A A;  2DA1 A;  3HOS A;  5IYB J;  2O61 A;  3BWG A;  3G1M A;  2GIZ A;  1ZHF A;  3PJR A;  1JTX A;  1X58 A;  4KN7 X;  3MKZ A;  3KP2 A;  5E8I A;  1XMX A;  1ZQ3 P;  4FAS D;  2OD5 A;  2OF7 A;  2QKL B;  3DKW A;  3KLO A;  2W85 A;  3L09 A;  2D2W A;  3OYG A;  1SVO A;  1ON1 A;  2P81 A;  2VJ4 A;  3EDP A;  2OJE D;  4ON0 A;  2I5U A;  2YX4 A;  3RTR A;  3F22 A;  3NAU A;  1R5G A;  2KFD A;  1BA5 A;  3BRO A;  5ICG A;  2HDW A;  1I3A A;  2BE5 F;  2RV8 A;  5HS9 A;  1H89 C;  1H88 C;  2CFX A;  2K5C A;  3GTM J;  3F8B A;  3AG1 H;  1WJF A;  3WE2 A;  1U9N A;  1MNM C;  2R7U A;  2ECB A;  4EAT A;  3PO2 J;  3TGN A;  5KCM A;  2BHY A;  4HF0 A;  1J59 A;  3ASN H;  5ILU A;  3BG7 A;  3J81 K;  2MGQ A;  3BOQ A;  3K4C A;  2X1E A;  4EVI A;  3IH2 A;  3BZC A;  3E5U A;  2CW7 A;  1QRY A;  2XGX A;  3A0H C;  1QA6 A;  4KYW A;  2KP6 A;  2NS7 A;  4NB5 A;  3WTV C;  2KIU A;  2MC3 A;  2A5W A;  3U9G A;  9ANT A;  3NWS A;  1D1C A;  5L3D A;  3QOE A;  1TL8 A;  1W5T A;  4B4C A;  4OWR B;  2GM4 A;  1OCO H;  2XAQ A;  3V7R A;  1NHA A;  3MZH A;  1TWA J;  2DT5 A;  4IO9 F;  2AQE A;  1XSV A;  4F55 A;  1WRJ A;  3LSK A;  2DFH A;  3A02 A;  3HPG A;  2W00 A;  2E1M C;  1P2F A;  5F64 A;  4UHT A;  4F52 A;  2G9W A;  2ELH A;  4KIC A;  3OYA A;  1ZR2 A;  1MDM A;  2FOK A;  2M2E A;  3SHF A;  3OYH A;  3KEQ A;  5CYV A;  5HLG A;  1Q1H A;  3BR5 A;  2VJI A;  3TP0 A;  4DYQ A;  4ASN A;  2L9S A;  2V26 A;  3HTS B;  1IJW C;  3DEW A;  4BJT A;  1R5H A;  3ISP A;  2FUG 2;  1T8I A;  2ZBK A;  5J1Y A;  2YX7 A;  3G4S I;  5M3F J;  3OYC A;  1YW7 A;  4KT6 A;  4V19 K;  4M72 A;  1ZAR A;  1U5T A;  3RQI A;  5GAH J;  2AXL A;  3S2H J;  5IP9 J;  2HI3 A;  4ZTF A;  4BE1 A;  3FM3 A;  2VXD A;  1TT5 B;  4WK8 F;  3FHN A;  4A6D A;  2EFO A;  2DA7 A;  4DGW B;  3E0J B;  3VSK A;  1J5Y A;  1SEU A;  1N25 A;  2R7Q A;  3H0G J;  4XM3 A;  1KQ0 A;  3A03 A;  1IRZ A;  1MMN A;  4BDZ A;  1X1B A;  1V5F A;  4IX7 A;  3TKY A;  4D9J A;  1BL0 A;  4KIT B;  3PIP F;  4N9H A;  1ZGW A;  4LLN A;  1LNW A;  2DU9 A;  3ML6 A;  3ERE D;  3OSF A;  3WTW C;  2CUZ A;  3H9J A;  5TGT A;  2OU2 A;  3JR9 A;  2P8T A;  3TDU C;  3BG6 A;  1U8R A;  3ZQG A;  4BHC A;  2KDO A;  2BXZ A;  4KIB A;  2E5Z A;  4GGG A;  4OIO F;  5HLI A;  5EDN A;  4EM0 B;  5CVR A;  2UWM A;  3TQN A;  4EJV A;  1UAA A;  3KZI C;  3DXJ F;  1IO2 A;  2GOX B;  5DTD A;  2EFQ A;  3HSE A;  4Y33 A;  1O3S A;  3ASO H;  3FF5 A;  3MN2 A;  1IN4 A;  1RKW A;  1MBE A;  1QZE A;  3R0J A;  3PNV A;  3HUG B;  5J4V A;  4E7I A;  3H9Q A;  3FXL A;  2VJ5 A;  2A6T A;  2B9S A;  3HOT A;  1E17 A;  5LEK A;  1Y56 A;  1ETV A;  3DKX A;  3RSN A;  3WGG A;  4AVP A;  3KYD B;  2UZK A;  4L18 B;  2KT0 A;  3B02 A;  3ZR8 X;  3TL4 X;  1U6G A;  4MO7 A;  4PGH A;  1MD0 A;  3GF2 A;  4CA0 A;  1JUM A;  2D1V A;  4XLH A;  3HC7 A;  2X4H A;  3QP6 A;  3J7Y J;  2E5N A;  3ZMT A;  3BJO A;  1N78 A;  1BOA A;  5LBQ A;  2M3A A;  3CJT B;  4B09 A;  1ETX A;  2JPC A;  3M8J A;  1J7K A;  1AU7 A;  1UB9 A;  3JRG A;  4DYC A;  3L2Q A;  2QKM B;  1Y39 A;  4U88 A;  3D5S C;  3CLO A;  3BG5 A;  3DP7 A;  2Y9Z A;  2X6Y A;  3FK6 A;  5H6R A;  3RZD J;  3JAM Z;  1QU3 A;  1QGP A;  2IGO A;  3S1M J;  2E19 A;  4WF2 A;  4G7Z F;  4LFU A;  1E0E A;  3HIF A;  2CUJ A;  1TWF J;  1JKO C;  2Y30 A;  1IDZ A;  3U1K A;  1BR2 A;  4BY7 J;  2AXT C;  2KIF A;  3HRM A;  5ILS A;  4BU2 A;  3I58 A;  5J3L A;  1QNT A;  3ZQI A;  2BW3 A;  3N4M A;  3AL0 C;  5IY5 H;  2BVM A;  3QAH A;  3HGY A;  5JVT A;  3TBI A;  3ZQ7 A;  3UR3 C;  5HDG A;  3T5X A;  4WCG A;  1X2M A;  3ZOB A;  1I3Q J;  3L2V A;  1G8X A;  1W5C C;  1IW7 F;  3LSM A;  4BAC A;  2ADU A;  1NG6 A;  5B1B H;  5J8F A;  3F3X A;  3I4N J;  2COB A;  2R5Z B;  2NVU B;  4ANJ A;  3H5A A;  3C2B A;  1JKR C;  2FQ3 A;  3MMY B;  3LQQ A;  4UVB A;  3OYJ A;  2XPV A;  1KU3 A;  2V1D A;  5HS8 A;  5E3O A;  1ZRE A;  3H5N A;  2R4G A;  2F48 A;  3MKY B;  5E79 C;  4P96 A;  3LWF A;  4RB3 C;  3LFU A;  4BQA A;  3JCU C;  3SDG A;  2X6O A;  3CZ6 A;  4HPQ A;  3A2K A;  3A4C A;  2CV1 A;  2ME0 A;  1B72 B;  3KP7 A;  2E1O A;  5KAF C;  1B8I A;  3CP2 A;  3ESW B;  3T0Y A;  3HZJ A;  4AVZ A;  2VAS A;  4KT5 C;  1FTT A;  2EIN H;  3SEQ A;  3GTK J;  3CC4 I;  2W25 A;  2XB5 A;  3C3W A;  3C1D A;  4JP0 A;  2DA2 A;  3WE3 A;  2HTJ A;  2FD5 A;  3KEO A;  4A3J J;  2P0W A;  4UUS A;  4EGZ A;  2MH2 A;  3RPU A;  1X3U A;  3CUQ B;  2XGD A;  4M3E A;  4HOB A;  5CVV A;  3WU1 B;  2VPR A;  3CCL I;  4RS8 A;  1FOX A;  2R93 J;  2PX9 A;  2R5Y B;  1G2H A;  3GUD A;  2FSW A;  3AFH A;  3U2R A;  3QPL A;  3C2G A;  3GFJ A;  4HNU A;  4G8X A;  3T8T A;  4AC0 A;  1YJN I;  4A3D J;  2LRE A;  1SFK A;  3OYM A;  2W7N A;  4L5J A;  4U0Y A;  5CVJ A;  4JX5 A;  2JQ7 A;  1OCP A;  2DCE A;  1OYI A;  2VOD A;  1E2X A;  4NQW B;  2A61 A;  3H9G A;  1R7J A;  3FIW A;  3I3L A;  3IHU A;  1FBS A;  1VQ6 I;  3CP8 A;  1G3W A;  4U87 A;  2MD0 A;  4B8X A;  1W7P B;  2DMN A;  4ZZD A;  5JFR A;  2A6E F;  2LOO A;  4HZF A;  4A69 C;  2O3F A;  3HSF A;  2MSY A;  4L9V A;  1P6R A;  3VDX A;  2ZME B;  1UEL B;  2OQG A;  2QBY A;  1FC3 A;  2CJJ A;  3OY9 A;  3W2V A;  3DU5 A;  5IPA A;  1YX3 A;  4BGD A;  5EEH A;  3WTT C;  5JLW A;  4EJW A;  1MBJ A;  1MW7 A;  4B48 A;  2HU9 A;  2HYJ A;  5HVQ C;  4P9U A;  1ONV A;  2ID3 A;  1UST A;  4LIV A;  1HW1 A;  3HEF A;  4XRM A;  2J5P A;  2ZJ2 A;  3DV8 A;  1EF4 A;  1XX5 A;  1VI0 A;  3GTG J;  1G6N A;  2F6C A;  4BDY A;  1SAX A;  3I59 B;  3HXL A;  3SEZ A;  1FZP B;  3GFL A;  1YJ9 I;  1J75 A;  1J9I A;  1WZ2 A;  3BTI A;  2LY9 A;  2YR2 A;  4Y7N J;  4OIP F;  2K4B A;  1M1E B;  2D1H A;  3SFI A;  2MW8 A;  2LLK A;  2KZV A;  1MJA A;  5DD8 A;  4H0E A;  3OYI A;  2X85 A;  3G6E I;  2K86 A;  2NNY A;  2QZ8 A;  2PJR B;  5L3C A;  1VQN I;  1UHM A;  2NYX A;  3V8K A;  1GT0 C;  1FY7 A;  1R4N B;  5EGO B;  1FSH A;  4AIH A;  1S29 A;  4D5F A;  1S7E A;  2X1D A;  4U7B A;  1Z9C A;  3E5Q A;  3PNY A;  4M6X A;  2TCT A;  4II2 A;  5CQG A;  1X3Z B;  2KL4 A;  2ZXW H;  3EUK L;  3GZ5 A;  2EV6 A;  1P7I A;  3FXU A;  5D6E A;  3BDD A;  5L3E A;  2HOS A;  2JA7 J;  4D7M A;  2DK5 A;  2GWR A;  2XHK A;  3IH3 A;  3LL7 A;  1HC8 A;  1GHC A;  2AHQ A;  1QPI A;  4NBQ A;  3HL2 A;  3OYF A;  1JHH A;  2CGP A;  3D1N I;  5ED4 A;  3MEX A;  3HSR A;  3HOU J;  1XD7 A;  2O8X A;  1SMT A;  2YUS A;  4OIN F;  2XAF A;  5CPR B;  3RZO J;  2PG4 A;  1RKT A;  4R1H A;  5K1Y A;  5FKM A;  3P9C A;  4V2F A;  2VT2 A;  3H3U A;  4FHT A;  2EQR A;  3A1Y A;  1Y8Q B;  3WOD F;  1ZGA A;  2L2O A;  1LEB A;  3SFZ A;  3BG3 A;  1HBX G;  4UV9 A;  3GTL J;  3S15 J;  5EEA A;  4C9Y A;  4IHY A;  5E3M A;  2OV7 A;  2V6E A;  2QEX I;  2KRF A;  2ZJP F;  1MJ9 A;  2KMU A;  4BE0 A;  1TZL A;  2E7X A;  2M4G A;  4XLN F;  2VKD A;  4LGW A;  3RCO A;  4A3M J;  4ZH4 F;  4DNC A;  1X1P A;  1G3T A;  1WGX A;  3HJE A;  1EV7 A;  2QSG X;  5C4X J;  1HW5 A;  2KZG A;  2QGU A;  2Y2Z A;  2M7A A;  3O8G A;  1KYW A;  2LBF B;  3ZRG A;  5E3N A;  2QWW A;  2L9N A;  3EET A;  2ACJ A;  3R4K A;  3FMQ A;  3EQL F;  1V5E A;  1FWZ A;  4RAZ A;  3COA C;  1VQO I;  2DAO A;  3ZN1 A;  2P4W A;  5LGU A;  1TQM A;  1YRN A;  1HKT A;  3DLA A;  1APL C;  1SD5 A;  1AKH B;  5J6X A;  2ISZ A;  3FXO A;  5IT3 A;  4P9F A;  3FX3 A;  5E1Z B;  3Q0V A;  2QSF X;  3PQK A;  3VYU B;  4B43 A;  3DTI A;  3I64 A;  4W97 A;  4E7S A;  4ENK A;  2DLL A;  1W0T A;  2HOE A;  4ITV A;  3BTC A;  1JUS A;  2LK2 A;  1D8J A;  5IT9 Z;  2ZSH B;  4MEX F;  4LJZ F;  2DTZ A;  5IYC J;  4OMY A;  1KQ9 A;  4DOZ A;  1OMI A;  2LKX A;  1K78 A;  3SXY A;  2WAQ N;  1TWG J;  3MD2 A;  2G7U A;  3CJN A;  5J1R A;  4HDU A;  1YJW I;  4UVC A;  2BY3 A;  4HF1 A;  2X6W A;  5EZG A;  4KMU X;  1T38 A;  1RR8 C;  3LSJ A;  3BR2 A;  3VYR B;  5M5Y J;  1LFP A;  3T8R A;  3M4O J;  1QZY A;  3ABM H;  3GXO A;  3A0B C;  3KP4 A;  3BP8 A;  5JVG F;  2XDV A;  2MA3 A;  1O7L A;  5EG0 B;  2VBW A;  2VPL A;  4Y17 A;  4B1R A;  3CCJ I;  4HX8 A;  2BY1 A;  2VBZ A;  1RPW A;  2L3D A;  1K79 A;  1HSJ A;  2FU4 A;  4NUB A;  3AKZ A;  4J19 A;  1IC8 A;  5LGT A;  3VEP A;  3AAF A;  1B59 A;  3GME A;  4XID A;  2VC1 A;  3RJP A;  2KRC A;  3F9K A;  4NHJ A;  2E7W A;  1JT0 A;  1UZC A;  3LNQ A;  1TQP A;  1Z91 A;  5E1W A;  3MWM A;  2A69 F;  4C2T A;  2K4J A;  4A3I J;  4YEL A;  2JA5 J;  2JPB A;  4IQJ A;  4GYI A;  4LIT A;  3OYN A;  1YOV B;  3U21 A;  1T2K A;  1MND A;  5E1X A;  4XIC A;  2GBY A;  4Q5S F;  1UG2 A;  4PJM A;  2G7H A;  2E60 A;  2DFI A;  2XF6 A;  2BXY A;  2L7Z A;  3SQN A;  3TOA A;  4IHT A;  3H1C A;  4P1W A;  1U2W A;  5DCM B;  2DA6 A;  1EJ9 A;  2JT1 A;  4WWC A;  4O3M A;  3GZ6 A;  2DOA A;  3HHH A;  2ECC A;  2WAQ A;  1R9T J;  1KON A;  1XS9 A;  1NTC A;  2DQR A;  1V5G A;  1UFM A;  1X2N A;  4DJA A;  5LHG A;  1K4T A;  2ZXI A;  1PJR A;  4ESJ A;  3DU6 A;  4M3D A;  3WU0 A;  2JUG A;  4XKV A;  3EYI A;  3S14 J;  2R7T A;  1FLI A;  3OMY A;  3OL4 A;  1MSF C;  4XKC A;  4XRS G;  4UY8 I;  2EA4 A;  2CU7 A;  3ABL H;  2VT3 A;  2TRT A;  1ZYR F;  5GPA A;  2HXI A;  4BAY A;  5B3S H;  1MH4 A;  3K10 A;  4L9T A;  3VOD A;  3OL3 A;  4RA2 A;  1UHS A;  1W36 C;  1PP8 F;  4N9I A;  2MH9 A;  2QQB A;  2WAE A;  2DPU A;  2ZXJ A;  4M3B A;  3S32 A;  2CQN A;  2QA4 I;  2LTP A;  3DF8 A;  4MNU A;  3E6B A;  3JRD A;  2IGK A;  3DBL B;  2DA3 A;  3DPT A;  1F9N A;  1TW2 A;  3VYT B;  2CH0 A;  2IAI A;  4I0B A;  2L4A A;  1REP C;  2DMP A;  3TP3 A;  1ITY A;  2PEX A;  3CUQ C;  3DQV C;  2RNG A;  3HGG A;  3IRQ A;  1YYV A;  2DA4 A;  3M1C A;  1KYZ A;  1P9Q C;  3HBL A;  2W4S A;  3MKL A;  2E1C A;  1PVE A;  2E35 A;  4HNV A;  4CCL A;  4E70 A;  1R6R A;  1LE8 B;  1K7A A;  1FP2 A;  3DTK A;  3L7W A;  2JN6 A;  4GFB A;  2PMH A;  2L02 A;  5F27 A;  1TNT A;  5FD6 A;  1X4P A;  1UG0 A;  3RPU D;  1HA8 A;  2OQR A;  3P5J A;  1IV8 A;  3DWL E;  2HR3 A;  4OMZ A;  4L9N A;  4ESF A;  2XAH A;  1BOB A;  5CKT A;  3U1D A;  2R7F A;  3TOB A;  1O3Q A;  2M5W A;  2P7V B;  2KKO A;  2M7B A;  1LVA A;  1SFE A;  2BV6 A;  2FJ1 A;  1FYL A;  2YPR A;  1LDD A;  2FML A;  3QPS A;  2JWT A;  1SAN A;  1V54 H;  2X6X A;  2L0K A;  2VKE A;  2HWV A;  1LVK A;  3K1M A;  3WTU C;  4HX4 A;  3ZGK A;  2ZME C;  2OAZ A;  2DMU A;  2NOG A;  4IF4 A;  2JMW A;  4PGG A;  2XSD C;  2UXN A;  1ULY A;  1IRG A;  1YQA A;  1JTY A;  3HPH A;  2R7Z J;  4ZYG A;  3PSI A;  3V4G A;  4XNF A;  2HFH A;  4EV0 A;  2V9P A;  1V55 H;  1XMK A;  2C6Y A;  3GO5 A;  4I09 A;  2P5K A;  2Y0S N;  2Z99 A;  2ETH A;  1D1A A;  1JJ6 C;  4MTE A;  4LOC A;  1F43 A;  4F93 B;  2VJJ A;  5LHH A;  2Z9O A;  1B1B A;  2PN6 A;  2QVO A;  3I4P A;  3JTG A;  2A07 F;  2O8K A;  4I99 C;  2R7V A;  1TQI A;  5GAG J;  2FNA A;  1SVM A;  1GVJ A;  2PJP A;  4XOT A;  4XQF A;  5K5R A;  1MMD A;  1K83 J;  3F6V A;  1OJL A;  3P9K A;  3FK7 A;  4DQ2 A;  2HPI A;  3M7G A;  2M0C A;  2B0L A;  2BY2 A;  1WI9 A;  4LG0 A;  3S17 J;  1TC3 C;  1KZH A;  1Y0U A;  1KU7 A;  3HOX J;  4E7L A;  1KU2 A;  4EJO A;  3EPZ A;  4LLG F;  4Y15 A;  2ESN A;  2ZCW A;  4UV8 A;  4ZZL A;  2MAB A;  4HG2 A;  4BQO A;  3WTY C;  2LFB A;  1X4O A;  2KLO A;  3GFM A;  3OS2 A;  4UXN A;  2EBI A;  1I1G A;  3FMS A;  4UB6 C;  3KZY A;  2RDP A;  3CF2 A;  1VQL I;  4F7Z A;  1F1Z A;  4B3A A;  2RN7 A;  2FBI A;  1KA8 A;  1SD4 A;  1O57 A;  5IP6 A;  1SMY F;  2FXA A;  4EMS A;  2WAD A;  4PDK A;  5BPD A;  2Y0S A;  2PQ8 A;  4XOP A;  1VQ8 I;  1GVD A;  4BY1 J;  3KP5 A;  1DUX C;  1XMA A;  4JX4 A;  4C2M J;  2X48 A;  3IKV A;  2RQP A;  3O8H A;  4RGR A;  5DUK A;  3V8J A;  4CCK A;  2X51 A;  3FXM A;  4WX9 A;  2R7X A;  1JI8 A;  3BLY A;  2LP0 A;  1ZG3 A;  3BPV A;  4D5C A;  2GA2 A;  4RB2 C;  1LJ9 A;  3HDD A;  4RB0 A;  3H36 A;  1HDD C;  1RR7 A;  3LQR A;  1U3E M;  4NDL A;  1HDP A;  2PBI A;  5HS7 A;  3SDB A;  1SVL A;  2AO9 A;  3CO6 C;  1C0W A;  1TBX A;  3WGI A;  4CCN A;  1FIA A;  5LD2 C;  1IAW A;  3NRV A;  4P55 A;  4C30 A;  3CCM I;  1EH7 A;  1OYY A;  3OSG A;  1L0O C;  1ETO A;  1YFH A;  1XGO A;  4XBF A;  2LY1 A;  4EM2 A;  2DXI A;  1SFO J;  5E18 F;  1MSE C;  2N8G A;  2VQG A;  1FIP A;  1S9H A;  2QQA A;  3QOD A;  4XMY A;  5H20 A;  2LD5 A;  2E1N A;  1BIA A;  2ICW G;  1B72 A;  5M5W J;  2O9L A;  4KIF A;  1IV6 A;  3IKT A;  3VYS B;  1IN7 A;  1I6X A;  1JT6 A;  2L9R A;  1S8N A;  1BR1 A;  4BUP A;  1E3P A;  1JGS A;  4OU0 A;  4XRF A;  2L01 A;  2W1O A;  1CQT A;  4S04 A;  1A36 A;  4BHB A;  2H6C A;  4JOM A;  4BXF A;  2K9L A;  1WQ2 A;  2E71 A;  3RIR A;  4DZJ A;  3MKW B;  1D3Y A;  1DP3 A;  2CQX A;  1FEX A;  2IPQ X;  4MHG A;  2ZNY A;  3LA3 A;  1BW6 A;  4HF2 A;  2M34 A;  2DA5 A;  2Y31 A;  4AIJ A;  4CCO A;  1K61 A;  3E1S A;  5GTI C;  5LGN A;  2CQK A;  1YE9 A;  4UNO A;  2R3S A;  5EYR A;  1LPQ A;  2A05 A;  3GW2 A;  2V1N A;  2FRH A;  3LAP A;  3LMM A;  4HAM A;  1YI2 I;  2LR8 A;  4NC8 A;  3QOP A;  2OUM A;  2R92 J;  1U78 A;  4RAG A;  1A31 A;  2YU9 J;  3GCM A;  3J7Z I;  3GWZ A;  4O5V A;  5DUI A;  5LRS A;  2ELK A;  3TO9 A;  3SYT A;  3I0T A;  2WTE A;  1QQI A;  4LIU A;  3W6V A;  2EV5 A;  1DU6 A;  4F91 B;  1X1D A;  1X3W B;  3HOW J;  2CS3 A;  3BG9 A;  1U8B A;  5GAD J;  1GUU A;  4ZTJ A;  3PIO F;  4A3B J;  1QZZ A;  4HLX A;  1W7P A;  1ERD A;  1ZN2 A;  3CJR B;  4LMY A;  1XDU A;  3EUH C;  5M3M J;  3W6J B;  2ZME A;  4WXH A;  2K9Q A;  1FOW A;  3JAM K;  1NK2 P;  1H0M A;  3G1L A;  2UXX A;  4G9Y A;  3L1P A;  2RVC A;  3L00 A;  3QWL A;  4I98 B;  2EFN A;  1FMV A;  5JLX A;  1VND A;  3CD6 I;  2E2H J;  2EPF A;  1YTY A;  4YEJ A;  3V42 A;  5LLQ A;  4HST A;  5E17 F;  1YO5 C;  4KMF A;  1ZGJ A;  2L7M P;  4LB5 A;  1HKS A;  2DO7 A;  1AA7 A;  4KN4 X;  1AOY A;  3I71 A;  3K70 D;  3S3M A;  2F4O B;  2TDX A;  4KDP A;  2K7L A;  3ZQQ A;  4IOA F;  2IW5 A;  2LKS A;  2EZK A;  1BI0 A;  1LDJ A;  1U5T B;  2DJI A;  2P6T A;  2RAE A;  2JUC A;  3CME I;  1T0F C;  2PJR A;  3BQY A;  3BPX A;  1ZRC A;  5EGO A;  3BJA A;  4BBS J;  2P5L C;  4LLL A;  3A01 B;  3GX4 X;  2RRE A;  1VQM I;  3HRT A;  3JRI A;  3G2B A;  3MZ8 A;  1A35 A;  4YII A;  2ZO4 A;  2OZ6 A;  5KAI C;  1I27 A;  2JSP A;  5IOZ A;  4Q4Z F;  4HA8 A;  3G73 A;  2EK5 A;  1O4X A;  5D4R A;  3LST A;  4IQ4 A;  4GXO A;  4I7H A;  2K9S A;  4A3F J;  3N97 A;  1E3O C;  5J1U A;  4FQG A;  3JSO A;  4ZYE A;  5FFZ A;  1OQY A;  3ZQL A;  1CF7 A;  3JRH A;  1RUO A;  3O3K A;  4KFC A;  3IWZ A;  2JTV A;  2VQH A;  3OWT A;  3GTO J;  2HVR A;  4PZJ A;  3OR2 C;  1I50 J;  3KYL A;  5BOX A;  2BBY A;  1ZRD A;  1XGS A;  4LK1 F;  1Z6T A;  5FGM A;  3O6B B;  4XSZ F;  3OYK A;  2WWY A;  3BR0 A;  5BQT A;  4N4O B;  2EV0 A;  2DMT A;  1D8K A;  4YRV A;  5D5X B;  2LNB A;  5L3B A;  3Q3S A;  1LFB A;  2MBF A;  4PFP A;  2LG4 A;  4V2G A;  2RC4 A;  1TLH B;  2CSO A;  1IN8 A;  4XL9 A;  4HV5 A;  3S8P A;  2IP2 A;  2F5E A;  4YIR X;  3LAJ A;  1IGN A;  2AQF A;  3E7L A;  1VQ4 I;  2CWE A;  2DOE A;  2H1K A;  5D8L B;  4Y52 J;  4S0H B;  4I01 A;  4MEY F;  3ABT A;  1R5I D;  1DDN A;  3IP4 B;  3JRA A;  5FKN A;  2DK8 A;  1WWX A;  5K5O A;  4CYD A;  3PNT A;  5LRR A;  4A93 J;  1DPR A;  3QU6 A;  4B44 A;  5IYD J;  5KVR A;  2WV0 A;  5DM6 F;  1Y1W J;  3ZPL A;  5DYM A;  3AG4 H;  1LKX A;  1XGM A;  1GLN A;  5LHI A;  2V7F A;  4AWX B;  5IOY A;  3EUA A;  2K02 A;  4H4K C;  1WI3 A;  1OCC H;  2ZB9 A;  2NVQ J;  1Z6R A;  3DFG A;  3FXR A;  2QUF A;  1Y8R B;  3BTL A;  4B47 A;  2P5V A;  1K4S A;  4JQF A;  3RKX A;  2XRN A;  5L3G A;  2FMY A;  5AIP A;  2XGE A;  2OZU A;  4A3L J;  3SZG A;  2W84 A;  2BZT A;  4KUM A;  2RGV A;  4GCV A;  2CUE A;  2XKP A;  4FTH A;  2Z3Y A;  4PJN A;  2HYF A;  1ZAO A;  2DW4 A;  4M9X A;  1XPX A;  2HVS A;  2Q2E A;  2A5Y B;  3FXJ A;  4Z6Y A;  2B7E A;  1JXS A;  2VN2 A;  3AG3 H;  4BEH B;  5KHD A;  3GYH X;  2WY8 Q;  4XKB A;  3ONQ A;  1ZKG A;  2XAJ A;  4W1U A;  2GXA A;  3OIQ A;  1NH3 A;  3TMO A;  1Q1V A;  1MBG A;  1PDN C;  3CCY A;  4Y4R A;  5BS6 A;  5FRO A;  2IJL A;  1DGW Y;  1RI7 A;  2O0Y A;  3K6G A;  4JK1 X;  1CGP A;  4XR6 A;  4J00 A;  1J09 A;  1F36 A;  2BW3 B;  4CXF A;  2HVQ A;  2OTJ I;  5EG0 A;  2KJC A;  5DCF A; 
#chains in the Genus database with same CATH homology
 1Z7U A;  2HEO A;  3KLN A;  5D5V B;  3K0L A;  2FE3 A;  2W24 A;  3SZP A;  5ICC A;  3I53 A;  2V9V A;  2V1U A;  2A6H F;  2ZFW A;  3JTH A;  3RYR A;  2IVM A;  3JSP A;  2MD5 A;  1HKQ A;  4ETS A;  1G4D A;  3JW4 A;  1XB4 A;  1IRF A;  3T1B A;  4L0Y B;  5DCM A;  4M9S A;  4D0P A;  2LKP A;  4JBA A;  1IXS B;  1G3Y A;  2ESH A;  3R61 A;  3F6O A;  5CVU A;  2RKH A;  1LDK B;  4IRG A;  2D45 A;  3LA2 A;  3R60 A;  2Z5U A;  2CYY A;  3CTA A;  1P4W A;  3WTS C;  4BXU A;  5HDK A;  4OOI A;  3IWF A;  1FP1 D;  5E8G A;  2VOP A;  4BYY A;  1QBJ A;  3J80 Z;  2COM A;  2M30 A;  3E6M A;  4RAY A;  5FFX A;  2GIV A;  5JR3 A;  4IVN A;  4BNC A;  4MQV A;  3ULQ B;  4IRH A;  2NRA C;  4BH9 A;  3E6C C;  1UHW A;  3ZMZ A;  4O6J A;  2JZY A;  2YSR A;  1R1V A;  1JHF A;  3CUO A;  5EEG A;  1MGT A;  4I2O A;  1BBY A;  4WXC A;  2OA4 A;  2QBY B;  2FNP A;  3ZP5 A;  4Q48 A;  5IT9 K;  2M8E A;  4YFK F;  2FEZ A;  3OOP A;  2F5C A;  2ZNZ A;  1D5V A;  3IC7 A;  3ROU A;  1YLF A;  2PMU A;  1XSX A;  5CVI A;  2JRT A;  3F8F A;  3FHZ A;  5A2Q Z;  1XN7 A;  2DI3 A;  2PFB A;  4IJA A;  1R58 A;  3KFW X;  4CZZ A;  4RGX A;  3LFK A;  3CO7 C;  3QP5 A;  4ENM A;  3KP3 A;  1W7P D;  1O7F A;  1V4R A;  4AIK A;  4YG2 F;  1T6S A;  2GXG A;  3M1E A;  1BI1 A;  1KU9 A;  2V1X A;  4UVA A;  4IXA A;  1U5T C;  1DP7 P;  2R7D A;  2F2E A;  2DPD A;  5ERI A;  2O6G E;  4G7O F;  2QQ9 A;  1S7O A;  1RZ4 A;  1JE8 A;  3V7S A;  4Z2Y A;  3DPL C;  4A6E A;  3SZT A;  3BZ6 A;  2HYG D;  3REO A;  1XGN A;  1FYM A;  3TO7 A;  3ZMU A;  2MLK A;  3IL2 A;  4M74 A;  2HZT A;  3FZV A;  5TRD A;  4UUV A;  4IPA A;  4A0X A;  4L9J A;  2HS5 A;  4FX4 A;  2NS0 A;  2NAZ A;  2STT A;  3F23 A;  3PFI A;  5HLH A;  1R22 A;  3QU3 A;  2L54 A;  3IRR A;  4OIR F;  1B6A A;  2EB7 A;  1A04 A;  3F72 A;  3L9F A;  1R00 A;  1R36 A;  2VBX A;  3NQO A;  4A0Z A;  2DQL A;  1WKM A;  1L3L A;  2Z33 A;  2CO5 A;  1BN5 A;  2XRO A;  1ODD A;  1K6O A;  4ESB A;  3CDH A;  3HUG A;  1K78 B;  1BC7 C;  1P4A A;  2F5F A;  2IA1 A;  1BI3 A;  5D8K B;  3FMR A;  5ILV A;  5CJ9 A;  3J81 Z;  4HYE A;  2HKO A;  4RB1 A;  3MFK A;  3HTU A;  4EGY A;  3V8L A;  4QWQ A;  1YG2 A;  5FLX Z;  5F6F A;  3RPQ A;  1S7A A;  2CG4 A;  4G94 A;  1XCV A;  5FLX K;  3C7J A;  4OIQ F;  1XDS A;  3VOE A;  1IN5 A;  5J8C A;  3L2C A;  3ZN0 A;  1USS A;  2EA2 A;  1T98 A;  4CHU A;  1IN6 A;  1J0R A;  3FM5 A;  1FBU A;  4A12 A;  4YFX F;  1TTY A;  1BI2 A;  4A5M A;  3R0A A;  4N0B A;  1H9T A;  1TW3 A;  3I54 A;  3I5U A;  5DDG A;  2HDC A;  1S3J A;  1F5T A;  5CLS A;  4R79 A;  1R23 A;  1AWC A;  3RKW A;  4AD9 A;  3ZMV A;  4IHS A;  3MQ0 A;  1FX7 A;  2L4M A;  3F8C A;  2FBH A;  5JHU A;  2BYV E;  1GXQ A;  2XKO A;  3Q9S A;  1FOK A;  4U0W A;  1R1U A;  1IF1 A;  4MQ9 F;  3S2W A;  3F21 A;  3RKY A;  3GEZ A;  4HDV A;  1ZG1 A;  4GYG A;  1OPC A;  2XV4 S;  2XVC A;  4QLC U;  5TJJ A;  1YIO A;  3P7N A;  1FNN A;  3CUQ A;  4MTD A;  2XAG A;  3G3Z A;  3QRF F;  3P9I A;  1W4M A;  2JSC A;  3K69 A;  3KET A;  3ZMD A;  3K2Z A;  1LB2 A;  2J5O A;  2QLZ A;  1G3S A;  1S6L A;  2IT0 A;  4NQW A;  1T39 A;  1UCR A;  3GVA A;  4IRI A;  2V6C A;  3E5X A;  2IA2 A;  3WGH A;  1IZ1 A;  1EH8 A;  3M8E A;  2RNJ A;  1B4A A;  3KE2 A;  4LG0 B;  4G6D A;  1MKM A;  2FA5 A;  4P5O A;  5ICF A;  1MDM B;  2AS5 F;  2VE8 A;  4Q47 A;  1BC8 C;  1BIB A;  3I59 A;  4WXD A;  1F4K A;  3HHG A;  3OV8 A;  2YU3 A;  3HRU A;  2Y75 A;  4K2E A;  3B73 A;  1OYW A;  3E97 A;  1DPU A;  1H9G A;  1RIO H;  1PP7 U;  3M9A A;  1YS7 A;  3HRS A;  1KGS A;  1BM9 A;  2BGC A;  3F8M A;  1HW2 A;  2XAS A;  5HDN A;  2M87 A;  3RI4 A;  2HQN A;  2OBP A;  3VB2 A;  1SD6 A;  1RUN A;  2VC0 A;  5AIQ A;  2GAU A;  3KP6 A;  4TV7 A;  4L0Z B;  1YW9 A;  3M8F A;  1FT9 A;  6PAX A;  2MLG A;  3PQJ A;  2IRF G;  4EQQ A;  1FSE A;  1Z05 A;  5KK1 A;  4HBL A;  1ZH5 A;  4KA4 A;  2ISY A;  3J7A O;  4M73 A;  4EJT A;  5BMZ A;  5JI6 A;  1BJA A;  1XSD A;  5DD4 A;  1B9N A;  3K1P A;  1Z1D A;  3ABU A;  3Q9V A;  3H3Z A;  2KJB A;  4LD5 A;  2H09 A;  2FBK A;  3LA7 A;  1OR7 A;  3DEU A;  5D5U B;  5L3F A;  1J2X A;  2LDU A;  1GXP A;  1SD7 A;  2Y0M A;  3ECO A;  4S05 A;  2P7C B;  2VE9 A;  1ON2 A;  2HGC A;  3QPT A;  2DBB A;  4G6Q A;  5D5W B;  3WTX C;  3E3V A;  1XCB A;  3F8N A;  2EJR A;  1WSU A;  2VXZ A;  1ZLK A;  4HQE A;  4ENJ A;  3KZZ A;  4CO8 A;  4EJU A;  2LSO A;  3K1N A;  3ELK A;  4A5N A;  4CGZ A;  1TNS A;  2O03 A;  1VTN C;  4LB6 B;  1I5Z A;  1B9M A;  2BEO A;  2QYO A;  5FD5 A;  3D5L A;  2FF4 A;  4FT8 A;  4I0A A;  1ZG5 A;  3BJ6 A;  3EUH A;  1ZLJ A;  2GXB A;  5HOO A;  2PI0 A;  5FB2 A;  4ZYH A;  1P4X A;  5D6F A;  2P6S A;  4ENN A;  2M1B A;  2V79 A;  4GO1 A;  4ZYD A;  2LF8 A;  2VBY A;  2X0L A;  1LEA A;  2H27 A;  4R8H A;  3VFZ A;  1CF7 B;  2PLY A;  2STW A;  1HST A;  1T0F A;  1PUE E;  2W57 A;  5ICE A;  2Q0O A;  5DV5 A;  4HLY A;  4I02 A;  3TDZ C;  4EM1 A;  2F5D A;  4YFN F;  1IXR C;  3NEU A;  3MAJ A;  3J80 K;  3RDI A;  1OKR A;  1FBQ A;  2M45 A;  2EWN A;  3MCZ A;  4KNY A;  1KQ8 A;  5K5Q A;  2NNN A;  1IXC A;  4BHP A;  2XIG A;  3K9T A;  4A2U A;  1V3F A;  3FXQ A;  2KIM A;  2VOO A;  4LK0 F;  1O3R A;  1FYK A;  1ZRF A;  3RYP A;  4YIF A;  4RGS A;  4KIG A;  3EYY A;  4HW0 A;  2LF7 A;  3KCC A;  2H94 A;  1O3T A;  1RNL A;  3WG9 A;  3MZY A;  3FWE A;  1QPM A;  4M9Z A;  2CW0 F;  3ECH A;  4U0V A;  1HXD A;  3TO6 A;  3R6S A;  3Q5F A;  3HYI A;  2QM3 A;  5AON A;  3D0S A;  5D4S A;  3O2P E;  4L5I A;  1QO0 D;  4MGR A;  4HQM A;  5A2Q K;  1IUY A;  1YW8 A;  2HKX A;  2WC2 A;  2EFW A;  2IA0 A;  3ZMS A;  2EFP A;  2HQR A;  5FO5 A;  2XUB A;  2ZKZ A;  4XLP F;  2HTS A;  3W6K B;  2K27 A;  4HX7 A;  4FX0 A;  1STZ A;  1I1S A;  4G7H F;  1HQC A;  2QEN A;  5H6Q A;  4CDG A;  1SFX A;  3WTZ A;  5E20 A;  5F1R A;  2A3S A;  5LEJ A;  4HV6 A;  4RGU A;  4U7D A;  2Q8K A;  4M71 A;  1W5S A;  2H6B A;  4M6Y A;  3GLX A;  1LQ1 A;  4A0Y A;  1SFU A;  3BY6 A;  3V7C A;  5DEQ A;  5BPI A;  1MZB A;  1EH6 A;  1MJB A;  3E6D A;  2A68 F;  3H92 A;  3QPH A;  1FPQ A;  4Y13 A;  1R1T A;  2GA1 A;  4CIC A;  2DTR A;  2GQQ A;  3C18 A;  3GFI A;  4PCQ A;  1P92 A;  1YS6 A;  2Y48 A;  2GZW A;  2VON A;  4XSX F;  3HOS A;  2O61 A;  3BWG A;  1ZHF A;  4KN7 X;  3KP2 A;  5E8I A;  2OD5 A;  3DKW A;  3KLO A;  2W85 A;  3L09 A;  2D2W A;  1ON1 A;  3EDP A;  4ON0 A;  2YX4 A;  3RTR A;  3F22 A;  1R5G A;  3BRO A;  5ICG A;  2BE5 F;  2RV8 A;  5HS9 A;  2CFX A;  3F8B A;  3WE2 A;  3TGN A;  4HF0 A;  1J59 A;  5ILU A;  3J81 K;  3BOQ A;  4EVI A;  3E5U A;  2XGX A;  4KYW A;  4NB5 A;  3WTV C;  2KIU A;  2MC3 A;  3U9G A;  5L3D A;  1W5T A;  2XAQ A;  3V7R A;  1NHA A;  3MZH A;  2DT5 A;  1XSV A;  1WRJ A;  5F64 A;  1P2F A;  4UHT A;  2G9W A;  2ELH A;  4KIC A;  1MDM A;  2FOK A;  3SHF A;  3KEQ A;  5CYV A;  5HLG A;  1Q1H A;  4ASN A;  3HTS B;  1R5H A;  3ISP A;  2ZBK A;  2YX7 A;  1YW7 A;  4M72 A;  1ZAR A;  1U5T A;  2AXL A;  3FM3 A;  4WK8 F;  4A6D A;  2EFO A;  1J5Y A;  1KQ0 A;  3TKY A;  4N9H A;  4LLN A;  1LNW A;  2DU9 A;  3ML6 A;  3ERE D;  3WTW C;  2OU2 A;  2P8T A;  3TDU C;  1U8R A;  4BHC A;  4KIB A;  4GGG A;  4OIO F;  5HLI A;  4EM0 B;  5CVR A;  2UWM A;  3TQN A;  4EJV A;  3DXJ F;  2EFQ A;  3HSE A;  1O3S A;  3FF5 A;  1IN4 A;  3R0J A;  3HOT A;  1E17 A;  5LEK A;  4AVP A;  3WGG A;  2UZK A;  4L18 B;  3B02 A;  1U6G A;  4PGH A;  1MD0 A;  3GF2 A;  2D1V A;  2X4H A;  3QP6 A;  3ZMT A;  3BJO A;  1BOA A;  5LBQ A;  4B09 A;  2JPC A;  1J7K A;  1UB9 A;  4U88 A;  3CLO A;  3DP7 A;  5H6R A;  3JAM Z;  1QGP A;  4WF2 A;  4G7Z F;  4LFU A;  3HIF A;  2KIF A;  3HRM A;  5ILS A;  3I58 A;  1QNT A;  3N4M A;  3QAH A;  5JVT A;  3ZQ7 A;  5HDG A;  3T5X A;  4WCG A;  1IW7 F;  2ADU A;  5J8F A;  3F3X A;  2FQ3 A;  3LQQ A;  4UVB A;  1KU3 A;  2V1D A;  5HS8 A;  1ZRE A;  4P96 A;  3LWF A;  4RB3 C;  4BQA A;  3KP7 A;  3T0Y A;  4KT5 C;  2W25 A;  3C3W A;  3C1D A;  3WE3 A;  2HTJ A;  3KEO A;  4EGZ A;  2MH2 A;  3RPU A;  1X3U A;  3CUQ B;  4HOB A;  5CVV A;  3WU1 B;  4RS8 A;  3GUD A;  2FSW A;  3U2R A;  3GFJ A;  4G8X A;  3T8T A;  4L5J A;  4U0Y A;  5CVJ A;  2VOD A;  1OYI A;  1E2X A;  2A61 A;  1R7J A;  3IHU A;  1FBS A;  1G3W A;  4B8X A;  1W7P B;  4ZZD A;  5JFR A;  2A6E F;  4HZF A;  2O3F A;  3HSF A;  4L9V A;  1P6R A;  2ZME B;  2OQG A;  2QBY A;  1FC3 A;  5EEH A;  3WTT C;  4EJW A;  5HVQ C;  4P9U A;  1ONV A;  1UST A;  1HW1 A;  2J5P A;  2ZJ2 A;  3DV8 A;  1G6N A;  1SAX A;  3I59 B;  1FZP B;  3GFL A;  1J75 A;  1J9I A;  2YR2 A;  4OIP F;  2K4B A;  2D1H A;  1MJA A;  5DD8 A;  4H0E A;  2K86 A;  2NNY A;  2QZ8 A;  5L3C A;  1UHM A;  2NYX A;  3V8K A;  1FY7 A;  1FSH A;  4AIH A;  1S29 A;  4U7B A;  1Z9C A;  3E5Q A;  4M6X A;  3GZ5 A;  2EV6 A;  3FXU A;  5D6E A;  3BDD A;  5L3E A;  2DK5 A;  2GWR A;  2XHK A;  1GHC A;  1JHH A;  2CGP A;  5ED4 A;  3MEX A;  3HSR A;  1XD7 A;  2O8X A;  1SMT A;  4OIN F;  2XAF A;  2PG4 A;  4R1H A;  5K1Y A;  3P9C A;  2VT2 A;  3H3U A;  4FHT A;  3WOD F;  1ZGA A;  1LEB A;  3SFZ A;  1HBX G;  4UV9 A;  2KRF A;  1MJ9 A;  2E7X A;  4XLN F;  4LGW A;  4ZH4 F;  4DNC A;  1G3T A;  1EV7 A;  1HW5 A;  1KYW A;  2QWW A;  3EET A;  2ACJ A;  3R4K A;  3FMQ A;  3EQL F;  1FWZ A;  4RAZ A;  3COA C;  2DAO A;  3ZN1 A;  2P4W A;  5LGU A;  1TQM A;  1HKT A;  1SD5 A;  5J6X A;  2ISZ A;  5IT3 A;  4P9F A;  3FX3 A;  5E1Z B;  3PQK A;  3I64 A;  4ENK A;  2DLL A;  2HOE A;  1D8J A;  5IT9 Z;  4MEX F;  4LJZ F;  4OMY A;  1KQ9 A;  1OMI A;  1K78 A;  3SXY A;  2G7U A;  3CJN A;  4HDU A;  4UVC A;  4HF1 A;  1T38 A;  4KMU X;  3T8R A;  1QZY A;  3GXO A;  3KP4 A;  3BP8 A;  2MA3 A;  1O7L A;  2VBW A;  4Y17 A;  4HX8 A;  2VBZ A;  2L3D A;  1K79 A;  1HSJ A;  2FU4 A;  5LGT A;  3VEP A;  3AAF A;  1B59 A;  2VC1 A;  3RJP A;  4NHJ A;  2E7W A;  1TQP A;  1Z91 A;  5E1W A;  3MWM A;  2A69 F;  2K4J A;  2JPB A;  4GYI A;  1T2K A;  5E1X A;  4Q5S F;  2G7H A;  2DFI A;  3SQN A;  3TOA A;  4IHT A;  1U2W A;  5DCM B;  2JT1 A;  4WWC A;  4O3M A;  3GZ6 A;  3HHH A;  2DQR A;  1UFM A;  5LHG A;  4ESJ A;  3WU0 A;  3EYI A;  1FLI A;  2EA4 A;  2VT3 A;  1ZYR F;  4BAY A;  4L9T A;  3VOD A;  1PP8 F;  4N9I A;  2MH9 A;  2QQB A;  2DPU A;  2ZXJ A;  3DF8 A;  4MNU A;  3E6B A;  3DPT A;  1F9N A;  1TW2 A;  4I0B A;  2L4A A;  1REP C;  2PEX A;  3CUQ C;  3DQV C;  3IRQ A;  1YYV A;  1KYZ A;  2E1C A;  4E70 A;  1K7A A;  1FP2 A;  3L7W A;  2PMH A;  2L02 A;  1TNT A;  5FD6 A;  2OQR A;  2HR3 A;  4OMZ A;  4L9N A;  4ESF A;  2XAH A;  3U1D A;  2R7F A;  3TOB A;  1O3Q A;  2M5W A;  2P7V B;  2KKO A;  1LVA A;  1SFE A;  2BV6 A;  1FYL A;  2YPR A;  1LDD A;  2FML A;  2HWV A;  3K1M A;  3WTU C;  4HX4 A;  2OAZ A;  4PGG A;  4IF4 A;  2UXN A;  1ULY A;  1IRG A;  1YQA A;  4ZYG A;  3V4G A;  2HFH A;  4EV0 A;  1XMK A;  2C6Y A;  3GO5 A;  4I09 A;  2P5K A;  2Z99 A;  2ETH A;  4MTE A;  5LHH A;  2Z9O A;  1B1B A;  2PN6 A;  2QVO A;  3I4P A;  3JTG A;  2A07 F;  1TQI A;  2FNA A;  1GVJ A;  2PJP A;  5K5R A;  3F6V A;  3P9K A;  4DQ2 A;  3M7G A;  2B0L A;  1WI9 A;  4LG0 A;  1Y0U A;  1KU7 A;  1KU2 A;  4EJO A;  4LLG F;  4Y15 A;  2ESN A;  2ZCW A;  4UV8 A;  4ZZL A;  3WTY C;  3GFM A;  4UXN A;  1I1G A;  3FMS A;  3KZY A;  2RDP A;  4F7Z A;  1F1Z A;  2RN7 A;  2FBI A;  1KA8 A;  1SD4 A;  1O57 A;  1SMY F;  2FXA A;  4EMS A;  4PDK A;  5BPD A;  2PQ8 A;  3KP5 A;  1DUX C;  1XMA A;  3IKV A;  4RGR A;  2RQP A;  5DUK A;  3V8J A;  4WX9 A;  1ZG3 A;  3BPV A;  2GA2 A;  4RB2 C;  1LJ9 A;  4RB0 A;  3LQR A;  1U3E M;  5HS7 A;  2PBI A;  3CO6 C;  1C0W A;  1TBX A;  3WGI A;  1IAW A;  3NRV A;  4P55 A;  1EH7 A;  1OYY A;  1L0O C;  1YFH A;  1XGO A;  4XBF A;  4EM2 A;  5E18 F;  2QQA A;  5H20 A;  2E1N A;  1BIA A;  4KIF A;  3IKT A;  1IN7 A;  1I6X A;  1S8N A;  1JGS A;  4OU0 A;  4XRF A;  2L01 A;  4S04 A;  4BHB A;  2H6C A;  1WQ2 A;  3RIR A;  1D3Y A;  2IPQ X;  4MHG A;  2ZNY A;  3LA3 A;  4HF2 A;  4AIJ A;  5LGN A;  2CQK A;  4UNO A;  2R3S A;  3GW2 A;  2FRH A;  3LAP A;  4HAM A;  3QOP A;  1U78 A;  3GWZ A;  4O5V A;  5DUI A;  5LRS A;  3TO9 A;  3I0T A;  2WTE A;  1QQI A;  2EV5 A;  1QZZ A;  4HLX A;  1W7P A;  1ZN2 A;  4LMY A;  1XDU A;  3W6J B;  2ZME A;  4WXH A;  3JAM K;  1H0M A;  2UXX A;  4G9Y A;  2RVC A;  3L00 A;  4I98 B;  2EFN A;  1YTY A;  5LLQ A;  5E17 F;  1YO5 C;  4KMF A;  1ZGJ A;  4LB5 A;  1HKS A;  2DO7 A;  4KN4 X;  1AOY A;  3I71 A;  2TDX A;  4KDP A;  2K7L A;  2IW5 A;  1BI0 A;  1LDJ A;  1U5T B;  2P6T A;  3BPX A;  1ZRC A;  3BJA A;  2P5L C;  4LLL A;  3GX4 X;  3HRT A;  4YII A;  2ZO4 A;  2OZ6 A;  1I27 A;  4Q4Z F;  3G73 A;  4HA8 A;  2EK5 A;  5D4R A;  3LST A;  4GXO A;  4I7H A;  3N97 A;  3JSO A;  4ZYE A;  5FFZ A;  1CF7 A;  1RUO A;  3O3K A;  4KFC A;  3IWZ A;  2JTV A;  4PZJ A;  5BOX A;  2BBY A;  1ZRD A;  1XGS A;  4LK1 F;  1Z6T A;  5FGM A;  3O6B B;  4XSZ F;  2WWY A;  5BQT A;  2EV0 A;  1D8K A;  5D5X B;  2LNB A;  5L3B A;  2MBF A;  2RC4 A;  1TLH B;  2CSO A;  1IN8 A;  4HV5 A;  2IP2 A;  2F5E A;  3LAJ A;  2CWE A;  5D8L B;  4I01 A;  4MEY F;  3ABT A;  1DDN A;  2DK8 A;  1WWX A;  5K5O A;  4CYD A;  5LRR A;  1DPR A;  3QU6 A;  5KVR A;  2WV0 A;  3ZPL A;  5DYM A;  1XGM A;  5LHI A;  4AWX B;  2K02 A;  1Z6R A;  3DFG A;  3FXR A;  2QUF A;  2P5V A;  4JQF A;  3RKX A;  2XRN A;  5L3G A;  2FMY A;  5AIP A;  2OZU A;  2W84 A;  4KUM A;  2RGV A;  4GCV A;  2XKP A;  2Z3Y A;  2HYF A;  1ZAO A;  2DW4 A;  4M9X A;  2Q2E A;  2A5Y B;  1JXS A;  2VN2 A;  3GYH X;  2XAJ A;  1PDN C;  5BS6 A;  2IJL A;  2O0Y A;  1RI7 A;  4JK1 X;  1CGP A;  4CXF A;  2KJC A;  5DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...