2G9WA

Crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
119
Chain Sequence
KLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMAVLQRLAKKNLVLQIRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords conserved hypothetical protein
total genus 37
structure length 119
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g9wA01
3DFGA 4KT5C 4KMFA 1YYVA 3GUDA 2ELHA 1F9NA 5ICFA 3F22A 2CYYA 2BYVE 5D5XB 3REOA 3RIRA 2ZO4A 5LLQA 1W4MA 1J7KA 5F64A 2MC3A 1U3EM 2J5OA 2QVOA 5D6EA 5F1RA 1KU2A 2QLZA 3WE2A 3CO7C 5DUKA 1BI3A 5L3FA 1KYWA 4A6DA 1P2FA 2VC0A 3GFJA 1HKQA 2J5PA 3F6OA 1F5TA 4ZZLA 4P55A 4IRHA 5LHHA 2PMHA 4QLCU 2KIUA 2RQPA 1FYKA 1IAWA 2Y48A 3CUOA 4EM0B 3P9CA 4WCGA 5L3CA 4Q5SF 1F1ZA 3ROUA 2OU2A 1Q1HA 1EH6A 4LLGF 1QNTA 1YIOA 2P5LC 2DQLA 4CICA 1HXDA 1IRFA 5CVIA 2E7WA 1Z91A 3FZVA 3ZQ7A 4UVCA 4ZYGA 2XAQA 2MLGA 4G8XA 3QOPA 2PI0A 1BN5A 2L4MA 4MQ9F 4EJOA 1ZHFA 1XDUA 3CUQB 1EH8A 5HS8A 1MGTA 3EDPA 6PAXA 4KN4X 2G7HA 2VE9A 2NNNA 2HEOA 2E1CA 5HLHA 2DPDA 1LDKB 5CJ9A 2ZCWA 2BE5F 3MZYA 4O3MA 3R0JA 2OZUA 4H0EA 4LB5A 1WI9A 4O5VA 1NHAA 3QU3A 5ICEA 2K4BA 1O3QA 1IN6A 1B6AA 5JHUA 2MBFA 4M9ZA 5AIPA 1ZGJA 2DU9A 2PN6A 5AONA 5DCMA 1FSHA 1HSTA 4RGUA 2DT5A 2MH9A 4Y13A 1PUEE 5DEQA 1YG2A 4O6JA 3K69A 2FMYA 3RPUA 2NNYA 3VB2A 5A2QK 4PGGA 5D5WB 4BYYA 2B0LA 2P8TA 2H6CA 4P9UA 3MQ0A 2QQAA 1SD4A 1R36A 1YFHA 1TQIA 2DLLA 1ULYA 1BI0A 2IJLA 2XROA 1FC3A 3FM5A 1EH7A 2OZ6A 5LEKA 2UXNA 1FZPB 1TQMA 1FNNA 2VBWA 4L9TA 4IJAA 1XD7A 1PP8F 1B9NA 2YR2A 1OYWA 3KP6A 3I5UA 2P7VB 4KN7X 3KZYA 1P4AA 5LEJA 1XMKA 4HV5A 1BOAA 3SZTA 3LQQA 2W85A 2BEOA 2OQRA 3W6KB 2K02A 2QM3A 2MH2A 4I2OA 5E8GA 5FFZA 3JTGA 5H6RA 1ZRFA 1Z1DA 4G7HF 5CVRA 4AIHA 1LNWA 2O03A 4HX7A 4LG0B 5CYVA 2YU3A 2OAZA 4EVIA 4CO8A 2EK5A 2DBBA 5HDNA 3WTUC 4YFXF 1AWCA 3EQLF 1BC8C 1O7FA 1GXQA 2ZBKA 2BBYA 2V1UA 4LD5A 3PQJA 4WXDA 3C7JA 5LHGA 1YW8A 1BI1A 3CJNA 2VXZA 3QAHA 1G4DA 2FEZA 4IF4A 1USTA 3GVAA 2CO5A 2K27A 1MJ9A 4A6EA 4D0PA 4Z2YA 5BPDA 1ONVA 2K86A 4YFNF 5D4RA 1QGPA 4AWXB 5TJJA 3HRMA 4WWCA 3TO6A 2STWA 3RKXA 1HKSA 1MDMB 3I64A 1P4WA 3BWGA 3BDDA 2DAOA 2DO7A 3EYIA 2LDUA 2UZKA 2ESNA 3KP4A 4G9YA 3MCZA 2QBYB 3U1DA 5F6FA 3R61A 2PLYA 4L0ZB 1IRGA 5E1XA 1BM9A 2IA0A 2VODA 1O3RA 4XSXF 5EEGA 5E20A 2UXXA 3N4MA 4MTEA 1FP1D 5DCFA 4NHJA 4L18B 1HBXG 3KLOA 2GXBA 1T6SA 3KP2A 1CGPA 5ED4A 3ZPLA 2KRFA 1BI2A 3DPLC 1SFXA 2RN7A 3F8FA 1USSA 1XSVA 1R5GA 2E7XA 4R1HA 3LQRA 1ZREA 2EV6A 1UFMA 3E6MA 4P96A 1CF7A 2H6BA 1A04A 1FWZA 2LSOA 2FF4A 3IRRA 1RNLA 2VBXA 3HSEA 3K2ZA 2UWMA 2G9WA 3GLXA 3QRFF 2AXLA 2R7FA 4RAZA 3E97A 2PQ8A 3ZMVA 1Y0UA 3C3WA 2YPRA 5D8LB 4AIKA 2VOOA 2HQRA 3G3ZA 1SD6A 4A5MA 1R5HA 1W5TA 3B02A 3J81K 2EA4A 4JQFA 1ODDA 4IPAA 4RGSA 1PP7U 4PDKA 4KIFA 3NRVA 1IN8A 1KGSA 1R00A 3E5XA 2GA2A 3H92A 5HLGA 5K5RA 2F5FA 1RZ4A 3I0TA 4G94A 5HOOA 3K9TA 2LKPA 2V1XA 3T5XA 3K1NA 4IHTA 2M1BA 4CDGA 2XKPA 3LA3A 2JRTA 3LAJA 4IRIA 4BHCA 2D1HA 1ZN2A 4UV8A 5ILVA 4EGZA 2ISZA 4Y17A 4L9NA 1B1BA 4HQEA 4HZFA 3BJOA 2ESHA 1IUYA 2RDPA 3WTXC 4ENNA 4ESJA 2CW0F 1TQPA 2PFBA 1XCVA 4G6QA 3K1PA 3MAJA 3I58A 2PJPA 2DK5A 2JPCA 5LGUA 3F21A 4I02A 1SFEA 1DP7P 4U88A 1U5TC 1FYMA 2HFHA 3HOTA 3SXYA 2P4WA 3LSTA 2OA4A 1D3YA 1G3WA 4R8HA 1OR7A 3I59B 2BV6A 3AAFA 3RJPA 1IXRC 1KQ8A 3DV8A 5DUIA 3EYYA 1O3TA 3HRTA 4HQMA 1JGSA 1UB9A 5D4SA 2DQRA 5KK1A 2Z3YA 1KU3A 2CWEA 2EB7A 4DQ2A 2YX4A 1BIAA 5FO5A 2O61A 3GZ6A 4WXCA 2DPUA 3BPVA 5D6FA 1KU9A 1X3UA 4LK0F 2RVCA 3T8TA 1IN4A 5J8CA 3ML6A 2HKXA 3L9FA 4RB3C 4TV7A 1FX7A 2KIMA 1Z6TA 4Q48A 1D8JA 1JXSA 2HTJA 3OOPA 1S6LA 1WSUA 3SHFA 1HW1A 3HRSA 3WTWC 3O3KA 3WTTC 2MA3A 1WRJA 1LVAA 4XLNF 4OINF 3J80Z 2MD5A 3FF5A 3LFKA 4I0AA 1H9TA 4OMYA 4GGGA 4AVPA 1WKMA 4WK8F 1Z7UA 4M74A 3T0YA 2EFOA 4MEXF 3HTSB 1R58A 1WQ2A 2P6SA 4U0VA 2Y75A 4S04A 1W7PB 1ZARA 1YLFA 2FBIA 3BY6A 3MEXA 3M1EA 4QWQA 4HLYA 3TOBA 2EFPA 1S8NA 4BNCA 2BGCA 3D0SA 2GQQA 2ETHA 3V8KA 2Q8KA 2WV0A 3SQNA 3RPQA 1O7LA 4PZJA 4LJZF 2HR3A 4EJUA 2A69F 4M9XA 2ZFWA 5AIQA 1I1SA 3BZ6A 4RAYA 3JAMK 2NS0A 4IXAA 1V3FA 1B9MA 4PCQA 3F23A 1OYYA 1IXCA 3ZMDA 1QQIA 1STZA 3V7CA 3VEPA 1GHCA 3GO5A 3V8LA 4MNUA 3FMRA 1I6XA 1S3JA 3D5LA 1FOKA 3HRUA 2OQGA 3T1BA 3JW4A 1BIBA 1Z6RA 4I0BA 3GEZA 5LGNA 4KNYA 5JFRA 4OU0A 3I54A 4I98B 4RS8A 1YTYA 3QPTA 4OIQF 3ABUA 2HOEA 4N9IA 1J59A 4RGXA 3WGIA 1I1GA 2YSRA 2P5VA 2KKOA 2G7UA 5BS6A 3JSPA 2L4AA 1ZG1A 4WX9A 3F6VA 1OYIA 4CGZA 4KIGA 4FHTA 1XMAA 4EJWA 4HA8A 1V4RA 3MZHA 2IW5A 2XAFA 3F8CA 2C6YA 1ZH5A 1U2WA 2KIFA 1DUXC 1DDNA 3Q9VA 1QO0D 5ICCA 1QZYA 4IRGA 5IT9K 4EQQA 2EJRA 4RB1A 1IN5A 2W84A 4Q4ZF 3FMSA 4ETSA 3HTUA 2GAUA 2DI3A 4ZZDA 5DDGA 4EV0A 1KA8A 3KCCA 4EM1A 1DPUA 2ISYA 4KDPA 4IVNA 3O2PE 2A6EF 3FXQA 1G3TA 4RB0A 2HZTA 4PGHA 1O3SA 2EA2A 4MHGA 1HQCA 2QUFA 2NYXA 4MQVA 4FT8A 5JR3A 4ASNA 1XSDA 1J0RA 1HKTA 2Y0MA 3GYHX 5L3DA 4BQAA 1QPMA 3DEUA 4YIIA 3LA2A 3QPHA 4A0XA 4FX4A 4ENMA 3TKYA 3E5QA 3DF8A 2XUBA 3JTHA 2CQKA 1EV7A 3R0AA 3WODF 1ZGAA 2JPBA 3EUHA 3GW2A 3WG9A 4KYWA 5D8KB 3ZN0A 2XHKA 4M6YA 3FHZA 2FSWA 1J75A 1S7OA 2ZNYA 3GF2A 2VN2A 1B4AA 4Y15A 2M87A 1LQ1A 4RB2C 1R23A 3ERED 1U78A 4GCVA 1HW2A 3HSRA 2XAGA 1ZLJA 1JHFA 4IHSA 2HS5A 5IT9Z 1I5ZA 1YS6A 5J6XA 2F2EA 4R79A 4HF1A 4S05A 3G73A 4LGWA 5E8IA 1ZLKA 4OIOF 2GA1A 3KLNA 3MWMA 2EFNA 3EETA 1LDJA 2H94A 3KP5A 4UXNA 2V79A 3L7WA 4LMYA 2QQ9A 2QZ8A 5LBQA 2JT1A 2A68F 4LFUA 2A07F 1ZYRF 5L3GA 1TW3A 4HW0A 1TTYA 5HVQC 3GFIA 4GYGA 1T0FA 2P5KA 3ZMSA 5E1ZB 2P6TA 4LG0A 4GO1A 3RKYA 1U8RA 2CFXA 5A2QZ 3N97A 2FMLA 3U9GA 2EFQA 2HWVA 4K2EA 2FBHA 2WC2A 2IP2A 4NQWA 2IVMA 2VBYA 3VODA 1L0OC 3CDHA 3E6CC 3TGNA 1CF7B 3GX4X 2F5DA 4HOBA 2IA1A 1ON2A 3NQOA 3R4KA 2O0YA 3I71A 3VFZA 3CTAA 3TOAA 1IN7A 2ZMEA 2HKOA 1T98A 1GVJA 5D5UB 4HBLA 2XV4S 3P7NA 4BHBA 4P5OA 1G6NA 1HSJA 4M72A 1XGOA 1G3SA 1T39A 2IPQX 3ULQB 3IC7A 3RTRA 4YFKF 3P9KA 5ERIA 3O6BB 3VOEA 3IL2A 3IKTA 2PBIA 5HLIA 2H27A 1R1TA 1SFUA 3DKWA 3BPXA 5BMZA 3V7SA 2XAJA 5LRRA 1R7JA 4MGRA 3V7RA 4XLPF 5HDGA 3RYPA 5K5OA 2QBYA 3V8JA 3WGHA 3NEUA 4U0WA 4ESBA 2FQ3A 2FNPA 2IRFG 5D5VB 1ZRDA 1QZZA 4HF2A 4KICA 5K1YA 2VT3A 1B59A 2M8EA 3IWFA 2QYOA 4WXHA 2GXGA 3C18A 1ZRCA 1MD0A 3WGGA 2VE8A 3IKVA 4M9SA 2NRAC 1XGSA 2L3DA 4ON0A 1E17A 5ICGA 3WTSC 3J80K 1SMYF 3P9IA 4BAYA 1H9GA 1K7AA 2A6HF 2FBKA 5EEHA 2DTRA 5L3BA 1YS7A 1KQ9A 2KJCA 2JSCA 4F7ZA 4OIRF 2D2WA 3LAPA 2QENA 4A5NA 4HV6A 3QP6A 2RNJA 1ZG5A 2IT0A 2A61A 2HTSA 3GXOA 1MDMA 1JHHA 3KP3A 5JVTA 3WTZA 3JAMZ 4OOIA 1XB4A 2O6GE 3PQKA 1FYLA 1UHWA 1RUNA 4YIFA 1DPRA 4HYEA 3L00A 2V9VA 2JZYA 4KIBA 3HUGA 3RKWA 2DK8A 4HX4A 3E5UA 4UHTA 5E18F 3FM3A 5ILSA 4XRFA 2VC1A 3HYIA 3WTYC 3RYRA 3GZ5A 5CVJA 2FE3A 1IXSB 3LA7A 1W7PD 3E3VA 2V6CA 5BOXA 2M45A 4HF0A 2O8XA 3TDUC 2R7DA 2FRHA 3DXJF 4B09A 3JSOA 1OPCA 4Q47A 2FNAA 2HGCA 4I01A 5LHIA 1YQAA 2W24A 3KEQA 1IF1A 2YX7A 1S7AA 1ZG3A 2VOPA 3ZN1A 5E17F 1S29A 2RGVA 3KP7A 2L01A 3HHGA 3H3ZA 4KA4A 1SAXA 3MFKA 2CSOA 2K4JA 3KZZA 2HDCA 2R3SA 4L9VA 1YO5C 3COAC 3M7GA 4HDUA 2TDXA 1L3LA 2Q0OA 2XIGA 4ZH4F 4EJTA 1IZ1A 5DYMA 3I4PA 2DFIA 1KU7A 2CGPA 2CG4A 3F8BA 3DPTA 1BC7C 4ESFA 5HS9A 1LB2A 1RIOH 3F72A 3GWZA 5BPIA 1W7PA 1D5VA 3WTVC 5CLSA 4G7OF 3S2WA 4JK1X 1REPC 1PDNC 2A5YB 2COMA 3QU6A 2EFWA 3T8RA 2HQNA 5BQTA 4RGRA 2ZKZA 1SD5A 4M71A 4UV9A 4EGYA 1P4XA 2WWYA 1K79A 2RKHA 2XRNA 4OMZA 5FB2A 1XCBA 3CUQC 1J5YA 1J2XA 3F8MA 3CO6C 3TO7A 2W57A 4A12A 1FBUA 1F4KA 1OKRA 3L2CA 1QBJA 3TDZC 4I09A 2X4HA 4KFCA 4U7DA 3PFIA 5FLXK 2XASA 5LGTA 4HX8A 5K5QA 5DD4A 3BOQA 3DQVC 3RI4A 1I27A 3LWFA 3OV8A 3HOSA 1FLIA 4B8XA 3HSFA 4U7BA 2ZJ2A 3ABTA 2HYFA 5FGMA 4UVBA 1TBXA 4A0ZA 1FP2A 3RDIA 1MJBA 4MEYF 4LK1F 1KQ0A 3Q9SA 2NAZA 3W6JB 3FXRA 2AS5F 3GFMA 1ON1A 2MLKA 2WTEA 3ZMUA 3FMQA 2EV5A 3I59A 1H0MA 1U6GA 4LB6B 1T2KA 2LNBA 4UNOA 3GFLA 3CUQA 1RI7A 2FA5A 5DCMB 2QWWA 3J7AO 4A0YA 2Q2EA 4GXOA 3BJ6A 2GWRA 2PG4A 2Z33A 4G6DA 4FX0A 3FXUA 3BJAA 2FXAA 5DD8A 3DP7A 5FD6A 2L54A 3TQNA 2ZMEB 1KYZA 5LRSA 3WU1B 2ACJA 4LLLA 1XDSA 1MKMA 1FBSA 4ENJA 3WU0A 3M9AA 2XGXA 3KETA 5L3EA 4KUMA 2M30A 3KE2A 2DW4A 2Z9OA 4WF2A 2VONA 2RV8A 4XSZF 5FFXA 1T38A 3E6BA 1W5SA 3K1MA 5E1WA 4YG2F 4CYDA 1LEBA 3QP5A 2VT2A 5HS7A 3FX3A 4N9HA 5CVUA 2V1DA 1TNTA 1P6RA 3KFWX 3R6SA 1Z9CA 1FPQA 3ELKA 1LDDA 3WE3A 1UCRA 1YW7A 1K78B 2LF8A 2M5WA 2EWNA 3IRQA 1HW5A 2OD5A 3TO9A 1XSXA 4BHPA 3B73A 4M6XA 1TW2A 4GYIA 4HLXA 3ECOA 2X0LA 3SZPA 3E6DA 3ZP5A 4OIPF 1SD7A 2XAHA 5JI6A 5H6QA 1ZAOA 5DV5A 1FBQA 1MZBA 3I53A 2VBZA 1J9IA 4EM2A 1G3YA 2ZNZA 1K78A 1XN7A 5IT3A 3HIFA 2FOKA 4L5JA 1D8KA 4BXUA 2A3SA 2LF7A 1TNSA 2OBPA 1C0WA 4LLNA 1LEAA 3KEOA 2GIVA 5H20A 1K6OA 5FLXZ 1XGNA 4MTDA 4AIJA 1TLHB 2W25A 5HDKA 2XKOA 5CVVA 1U5TA 3U2RA 4NB5A 4ZYHA 2HYGD 1BBYA 1YW9A 2PEXA 2GZWA 3C1DA 3K0LA 5ILUA 1MJAA 1E2XA 2K7LA 4CZZA 2EV0A 4ZYEA 3FWEA 1JE8A 3ISPA 4EJVA 4E70A 3CLOA 3J81Z 4CXFA 1R22A 1FSEA 3IWZA 1UHMA 4P9FA 1R1UA 3ZMZA 2IA2A 3SFZA 1U5TB 3F3XA 2F5CA 4XBFA 4N0BA 5TRDA 2ZXJA 3R60A 2D45A 1VTNC 2F5EA 2Z5UA 2STTA 4AD9A 3BP8A 1GXPA 4U0YA 3F8NA 1AOYA 1FY7A 1RUOA 4G7ZF 3M8EA 1WWXA 1R1VA 3IHUA 4L9JA 1LJ9A 4JBAA 3V4GA 3ZMTA 4L5IA 4EMSA 3BROA 2O3FA 1XGMA 5J8FA 2JTVA 4CHUA 2ADUA 3M8FA 4ENKA 1IW7F 4UVAA 2D1VA 2P7CB 4I7HA 2XVCA 4M73A 1Z05A 4HAMA 2H09A 2FU4A 4ZYDA 2RC4A 1FT9A 4UUVA 4BH9A 3HHHA 4HDVA 4KMUX 1O57A 5FD5A 2QQBA 1SMTA 1OMIA 3L09A 1P92A 2E1NA 2PMUA 1BJAA 4L0YB 3H3UA 2L02A 4DNCA 4A2UA 2Z99A 3Q5FA 5KVRA 3ECHA 2KJBA
chains in the Genus database with same CATH superfamily
5GPAA 3DFGA 3QPLA 4KT5C 4KMFA 2ID6A 1RETA 2QSHX 1YYVA 1D1AA 3GUDA 3BR1A 3HC7A 2DA2A 3O8HA 5JVGF 1X2NA 2ELHA 4PJLA 2HQAA 1F9NA 5ICFA 3Q0WA 3F22A 2CYYA 2BYVE 5D5XB 4AU7A 3REOA 4NQWB 2V9KA 3RIRA 3VWBA 2R5YB 2ZO4A 5LLQA 1W4MA 3TW7A 4XICA 4H4KC 2NOJB 1J7KA 5F64A 2F4IA 2R7SA 2MC3A 3I56I 2E1MC 1U3EM 1BJZA 2J5OA 2HOTA 2QVOA 2M4GA 3K2AA 5D6EA 5F1RA 3VSLA 1KU2A 1A6QA 3A0BC 2QLZA 3WE2A 1HC8A 3PNVA 3CO7C 3CCUI 2E34A 2BW3B 3BTJA 4NDLA 1S9HA 2K9SA 1BI3A 5DUKA 3OYJA 3HKZN 1JT6A 2LY2A 1KYWA 5L3FA 2LFBA 4PJMA 4A6DA 1P2FA 2JWTA 3LNQA 2VC0A 3ABLH 2CQNA 3GFJA 4D1QA 1HKQA 2Q2EB 3GZNB 2J5PA 3F6OA 1MSEC 1F5TA 4ZZLA 3A2KA 1OFCX 4ANJA 4P55A 2AQEA 3MKZA 3IAS2 3J7AY 4IRHA 5LHHA 4XLFA 2GLOA 1IC8A 2PMHA 3DTIA 4E7ZA 2KMUA 3CMMA 4QLCU 2JK3A 1Y56A 2KIUA 2RQPA 1FYKA 2LC2A 4XRSG 2LP0A 2HOSA 1SVOA 4J01A 1IAWA 3S1QJ 2BY1A 2ZC2A 2Y48A 3CUOA 1PYVA 2R0QC 3LSGA 2YUSA 1S7EA 4EM0B 3H9GA 1N77A 3P9CA 4WCGA 2DA4A 1VQMI 5L3CA 4Q5SF 1AKHB 1F1ZA 3ROUA 2OU2A 1Q1HA 1EH6A 1MMDA 3BZCA 4XN3A 1I6HJ 4LLGF 4C3IJ 1QNTA 4MIMA 1YIOA 5J4VA 3MKYB 2P5LC 2DQLA 2M3AA 4DBRA 2IS2A 4CICA 2IS6A 1HXDA 1IRFA 5CVIA 2E7WA 1Z91A 3FZVA 3ZQ7A 1W36C 2E60A 4UVCA 4XLHA 4F52A 4ZYGA 2XAQA 3S3OA 2MLGA 2ZSIB 4G8XA 3QOPA 2PI0A 2LR8A 3PUBA 2NVUB 2RAEA 2IGOA 1BN5A 5M5YJ 4CCOA 2L4MA 1TL8A 4MQ9F 4EJOA 4FCYA 1ZHFA 2EIKH 4OWRB 1XDUA 3CUQB 2IAIA 2DA5A 1EH8A 3K4JA 5HS8A 1MGTA 4QTRA 2IEKA 2K9QA 3EDPA 3D5SC 1BR4A 2K9MA 2KDOA 3FK7A 4KN4X 1CQTA 6PAXA 1VZ0A 2BHYA 5B1AH 3TBIA 2NVXJ 2G7HA 2VE9A 2GOXB 3F9KA 3DKXA 3HPGA 1Y1VJ 4FASD 2NNNA 2X6WA 2E1CA 2HEOA 5HLHA 1B8IB 2DPDA 1LDKB 5B3SH 4XRMA 3CC2I 5CJ9A 2ZCWA 2BE5F 3MZYA 2BY0A 3HM5A 2M7BA 4M3BA 4O3MA 3WG7H 3BR5A 4NC8A 5EGOA 3LSJA 1OCTC 3R0JA 1OCRH 3HL2A 3MN2A 2OZUA 1VNDA 3BG5A 4H0EA 4E7SA 4YRVA 4LB5A 1MMSA 1OISA 1WI9A 5EG0A 4O5VA 1NHAA 2MW8A 2XSJC 3CQZJ 3QU3A 1V5FA 3OYFA 5ICEA 2K4BA 1O3QA 4C2TA 1IN6A 2CW7A 1B6AA 5JHUA 2MBFA 2ZJQF 2NVTJ 4M9ZA 5AIPA 1ZGJA 2DU9A 2K85A 1GDTA 2PN6A 2F4OB 2HVQA 5AONA 5DCMA 1FSHA 4B3XA 2CUZA 3KIOA 1HSTA 4RGUA 2R92J 2DT5A 2F6CA 2MH9A 3NAUA 4Y13A 2KDZA 2LMDA 1PUEE 5DEQA 3SJMA 1YG2A 4O6JA 4V2GA 3OIPA 3K69A 3I55I 3K7AJ 2XGDA 2FMYA 3GTPJ 3RPUA 2NNYA 5FRNA 3ZR8X 3ZQHA 2CS3A 2UUZA 3VB2A 1K4TA 4EEFG 3PIPF 5FKMA 3CJQB 2DMTA 5A2QK 3I4NJ 4YELA 4PGGA 3CMAI 5FLMJ 1T95A 2W82A 4M3FA 4BEHB 5D5WB 2XF7A 4BYYA 1VFCA 2B0LA 2P8TA 2H6CA 3SDBA 2VJ5A 1UHSA 1Z0XA 3LSIA 4P9UA 3MQ0A 4B48A 2DN0A 4CCJA 2QQAA 1SD4A 1R36A 4W1UA 3OSFA 1YFHA 1TQIA 4L5EA 2DLLA 2KZGA 1ULYA 4PSWA 1BI0A 3CCQI 2IJLA 2EZLA 2XROA 1FC3A 2MYSA 3FM5A 1EH7A 2OZ6A 1YJWI 4U87A 5LEKA 2JUGA 2BW3A 2UXNA 1FZPB 1TQMA 2QQ8A 1FNNA 4BGDA 2X6OA 4XLCA 1JJ8C 2VBWA 3CMYA 4L9TA 4B44A 3BC8A 3OL4A 2D5VA 4JX6A 4IJAA 4P1WA 1FEXA 1XD7A 1PP8F 1EA3A 1B9NA 3L2VA 3U21A 1WZ2A 2YR2A 1OYWA 4B4CA 3KP6A 3I5UA 2P7VB 4KN7X 3BZKA 3AFHA 3KZYA 4NC7A 1P4AA 5LEJA 1XMKA 2L9SA 4HV5A 2LOOA 1BOAA 5DS9A 2PJRB 1X1BA 2LK2A 3SZTA 3LQQA 3V42A 1VQ7I 2W85A 2V26A 2BEOA 2OQRA 3W6KB 2K02A 3S1RJ 2QM3A 2MH2A 2GOMA 3JRBA 1TWFJ 1LFPA 3G1LA 5E8GA 5FFZA 3JTGA 4I2OA 5H6RA 1ZRFA 2QF7A 1FIPA 1Z1DA 2DDBA 2ECBA 4G7HF 5CVRA 1LUJB 3BCBA 2Y2ZA 4AIHA 1LNWA 2O03A 1RKTA 2BVMA 3VYUB 4HX7A 1E0EA 4LG0B 5CYVA 2YU3A 1FTTA 2Y31A 2DTZA 2NS8A 2OAZA 4NBQA 4EVIA 1Y1WJ 2B7EA 4CO8A 2EK5A 1K4SA 2DBBA 5HDNA 5B66C 3WTUC 1RR7A 3DBLB 4LG3A 2LBFA 1LFUP 1QVTA 4RAGA 1DP3A 4YFXF 1V5GA 4A3DJ 1AWCA 3EQLF 1BC8C 1R4NB 1FMWA 1O7FA 5EJCA 1I3QJ 2W00A 5J40A 5IP6A 1GXQA 2ZBKA 2BBYA 1QHHD 2V1UA 4LD5A 3PQJA 4WXDA 2H8WA 3C7JA 4MFDA 5LHGA 1YW8A 2I10A 1BI1A 1XG1A 3CJNA 1D0ZA 2VXZA 3QAHA 1G4DA 3FISA 2FEZA 2E5NA 3FXKA 3OYNA 4IF4A 3E0JB 5JHFA 1WI3A 3MMYB 1USTA 1Y39A 4CCKA 3LOCA 3GVAA 2CO5A 2K27A 1MJ9A 2COBA 4A6EA 3OR2C 4D0PA 4UUSB 4Z2YA 5BPDA 1ONVA 2K86A 3FHNA 4YFNF 3OYBA 3JRIA 2V7FA 4NNJA 3H3VK 5D4RA 4J00A 2Z1DA 1QGPA 2VUMJ 4AWXB 4ZYAA 1VF9A 5TJJA 3HRMA 2LREA 3PUFA 4WWCA 2WY7Q 1SFOJ 3TO6A 4JX5A 2XGCA 2N8GA 2STWA 3RKXA 1HKSA 3PO3J 1MDMB 4ZC3A 2DT7B 1BR2A 3I64A 4XM3A 2W4SA 4X0GA 1P4WA 3BWGA 2ZJRF 3BDDA 2L7ZA 5M5WJ 2DAOA 1TZLA 2DO7A 3EYIA 1D1CA 3ONQA 5E3LA 1JKRC 1ETOA 2LDUA 1JJ6C 2UZKA 2ESNA 1T8IA 1LE8B 4IX7A 1QRYA 2K5CA 2K9NA 3KP4A 1WH5A 2HDWA 3KEYA 4G9YA 3MCZA 2QBYB 3U1DA 4AYBN 5F6FA 1I50J 3KPHA 1TT0A 3R61A 4M3DA 2PLYA 4PSXA 4L0ZB 4B1RA 1ERDA 1IRGA 2JSPA 5E1XA 2XRLA 1BM9A 1YITI 2IA0A 1BOBA 4AVZA 2VODA 1O3RA 4XSXF 4XN0A 1TWGJ 5EEGA 3WHCA 5E20A 2UXXA 3N4MA 1EF4A 4D5FA 3TEDA 4ABZA 2VKVA 3A03A 4MTEA 1FP1D 3VSKA 3HUGB 5DCFA 4NHJA 5E3OA 4I99C 3ZQIA 4L18B 1HBXG 3KLOA 2E1MB 4BBSJ 5FKLA 3RQIA 1T6SA 3KP2A 5KAFC 1CGPA 2GXBA 2ZXIA 5ED4A 3CCSI 3W2AA 3ZPLA 2KRFA 1BI2A 3DPLC 1SFXA 1UG0A 2HQ5A 1VQ5I 2RREA 2RN7A 3F8FA 1USSA 1XSVA 4CSWA 1R5GA 1YX3A 2E7XA 4R1HA 1VQNI 3LQRA 1ZREA 2EV6A 4DZPA 1UFMA 2DODA 3A4CA 4E6KG 2LKXA 3CZ6A 3ESWB 4NC6A 3E6MA 4P96A 3OYAA 1CF7A 2H6BA 4FISA 2VJIA 1A04A 1FWZA 3G1MA 9ANTA 2ZSHB 3GLLA 2LSOA 4ZTJA 3JRAA 2FF4A 3IRRA 1RNLA 2VBXA 2WAFA 3HSEA 3H5NA 1D1BA 3K2ZA 4AM3A 2UWMA 3PO2J 4IEJA 2EPFA 2G9WA 3GLXA 3QRFF 1YJNI 1RR8C 2AXLA 2R7FA 3I9V2 4RAZA 3E97A 2VJJA 2PQ8A 1R4MB 3ZMVA 4V19K 1Y0UA 3C3WA 2YPRA 5D8LB 4AIKA 1XPXA 4XKCA 2M0MA 1XS9A 1JUPA 4Y3OA 5EYRA 2KIQA 2KL4A 1AA7A 2VOOA 2XPUA 3D5RC 2HQRA 3G3ZA 1SD6A 4A5MA 1R5HA 1W5TA 4RDUA 5DTDA 3B02A 3J81K 2EA4A 4JQFA 2JA8J 4BJ6C 1ODDA 4IPAA 4RGSA 4A3BJ 4C3HJ 1PP7U 4PDKA 1X1AA 4KIFA 3S14J 3NRVA 1I39A 2LTPA 1IN8A 3VYRB 1KGSA 3B6CA 1R00A 5F08A 4BE1A 1DQUA 2QKMB 3E5XA 2GA2A 3OSGA 1B72B 3H92A 4A3MJ 3HPHA 1BL0A 3S2HJ 3FBNB 5HLGA 5K5RA 2F5FA 1RZ4A 3I0TA 4G94A 5HOOA 3AL0B 3K9TA 2KT0A 4QSHA 2LKPA 3HOVJ 5HLTA 2V1XA 1UZCA 3T5XA 1SANA 3PM1A 4JP0A 3K1NA 4IHTA 3QOEA 2M1BA 4CDGA 2XKPA 4XIDA 1MW7A 3LA3A 2JRTA 2Y0SN 3LAJA 2CV0A 4IRIA 2NVQJ 4BHCA 2D1HA 1ZN2A 2TCTA 4UV8A 5ILVA 4EGZA 2ISZA 4Y17A 4L9NA 3CC4I 1B1BA 4IHXA 1IUFA 4HQEA 4HZFA 3BJOA 2ESHA 1IUYA 2RDPA 5GP9A 3WTXC 4ENNA 1MSFC 2OUMA 2CW0F 3QODA 4ESJA 3NARA 1TQPA 2PFBA 3MKWB 1XCVA 4G6QA 4OAYA 3GTJJ 4AIDA 2Z16A 3K1PA 3MAJA 3I58A 2PJPA 2DK5A 2JPCA 5LGUA 3F21A 2R4GA 4I02A 1SFEA 4M6VA 1DP7P 2DJNA 1AHDP 4U88A 1U5TC 1FYMA 3JREA 2HFHA 3HOTA 2E35A 3SXYA 1AU7A 2P4WA 1E3OC 1FJLA 2K40A 3LSTA 2OA4A 1D3YA 1G3WA 4R8HA 1NK3P 1V54H 4HG2A 1OR7A 3I59B 2BV6A 2QKLB 3AAFA 3RJPA 4A3IJ 4UB8C 1IXRC 4BEHA 2K9LA 4RLQA 4DYRA 1O4XA 2X48A 3DV8A 5DUIA 1KQ8A 2R5ZB 3AG2H 3EYYA 1O3TA 3HRTA 1FTZA 5HODA 2LG4A 3JR9A 4HQMA 1JGSA 1UB9A 3HOUJ 2PMZN 2L2OA 5D4SA 4B43A 2DQRA 2OJED 5KK1A 1K61A 2Z3YA 1KU3A 1VQOI 2EIMH 3HOZJ 3BG6A 2HZDA 2CWEA 3M4OJ 1WJFA 2EB7A 4A3CJ 4DQ2A 1DGWY 2YX4A 1H8AC 1SC7A 1BIAA 5FO5A 2O61A 1T08B 3GZ6A 2K3PA 4WXCA 2DPUA 3BPVA 5D6FA 4I6ZA 1GV5A 1KU9A 1X3UA 4LK0F 3DTKA 1WJCA 3GTGJ 2MG4A 1MH4A 2RVCA 3T8TA 3HGGA 4PFPA 1IN4A 5J8CA 3ML6A 2ZFUA 2HKXA 3L9FA 4RB3C 1MBFA 1GVDA 4IQ4A 2GIZA 4TV7A 3TMOA 1FX7A 2AQFA 3W3CA 2KIMA 1Z6TA 4Q48A 1D8JA 1JXSA 4IO9F 2HTJA 2M9HA 3FDYA 3DTEA 1YRNB 2DMUA 3OOPA 1S6LA 1E3PA 1WSUA 3OS0A 1WGXA 3SHFA 5HNHA 2XSDC 4FE7A 1HW1A 3HRSA 3WTWC 3EUKL 3O3KA 3WTTC 2DA1A 4FE4A 2BZTA 3RPUD 2MA3A 2VKEA 1WRJA 1LVAA 2KPMA 4XLNF 5IP7J 3J7YJ 3K4KA 4OINF 3S3MA 3J80Z 2MD5A 4XNFA 1YE9A 3JCUC 3FF5A 3LFKA 2FX0A 3OL3A 5CQGA 4I0AA 1YRNA 4BL0B 3VPRA 3FXMA 1H9TA 3L1PA 4OMYA 4GGGA 5F04A 1WKMA 4AVPA 3SDGA 4WK8F 2E5ZA 1Z7UA 4M74A 3T0YA 2EFOA 2JJ7A 3BG7A 4MEXF 3X2QH 3HTSB 1R58A 1WQ2A 5GAEJ 2P6SA 2L0KA 2Y75A 4U0VA 4S04A 3OS1A 1W7PB 2WB1N 1ZARA 4KT6A 1MBJA 1YLFA 2FBIA 4CUGA 2MC4A 3BY6A 3MEXA 1MNMC 3M1EA 4QWQA 4C2MJ 4HLYA 3TOBA 2EFPA 1S8NA 2NOGA 3OYHA 3ZRGA 4W97A 4UUSA 4BNCA 2BGCA 3D0SA 2GQQA 2M7AA 3SYTA 1TWCJ 4C9YA 3IH4A 3GCMA 2ETHA 4G6TB 3V8KA 2Q8KA 2KLOA 3HJEA 2WV0A 4D9JA 5EGOB 3SQNA 5TGTA 2P0WA 1N78A 1K83J 3BCAA 2XGEA 1O7LA 3RPQA 2HXOA 2X6XA 4PZJA 4LJZF 2HR3A 3H35A 2A69F 4FQGA 4EJUA 4LOCA 4M9XA 1X2MA 5GAHJ 2DDAA 3A01B 2ZFWA 5AIQA 3GTQJ 1I1SA 2R5ZA 2VLAA 3HKZA 3A1YA 2LYCA 3BZ6A 2O8KA 4RAYA 2EILH 3JAMK 2NS0A 2A6TA 2XAUA 4IXAA 1V3FA 4BXFA 2JA5J 4NUBA 1B9MA 4PCQA 4DOZA 2R7ZJ 3F23A 2ELJA 1OYYA 4A3KJ 1IXCA 1FOWA 2OC6A 3ZMDA 3M07A 1QQIA 3E7LA 1STZA 2ID3A 3V7CA 1PVEA 1Y0NA 2VJ4A 2DFHA 3VEPA 3J7ZI 1GHCA 3GO5A 2EQRA 2HNHA 3V8LA 4DYCA 4XQFA 5J3LA 3A01A 4MNUA 2I8DA 4XK4A 2ECCA 1X3ZB 3FMRA 3TP0A 1I6XA 3DPUA 2VKDA 1JI8A 2LKSA 2DMNA 4RM3A 4HNVA 1S3JA 1W36D 1W5CC 3D5LA 1FOKA 3KYDB 2CFOA 3HRUA 2YU9J 2OQGA 3T1BA 3ZOBA 3JW4A 1SVMA 1OR7C 3I4MJ 1BIBA 2E2IJ 4ZDLA 1Z6RA 2IS1A 1MNEA 4I0BA 3ZQLA 3GEZA 5LGNA 3K70C 4J19A 4KNYA 2DMPA 4GFBA 3DCFA 4HNUA 4OU0A 5JFRA 3G4SI 3I54A 4I98B 4RS8A 1HDPA 1Y8QB 1YTYA 4CYCA 2HVRA 3QPTA 4OIQF 1ETQA 4XKVA 3BQYA 4XL9A 2R7WA 3ABUA 3S1NJ 2HOEA 4N9IA 1J59A 4RGXA 5CKTA 1KZHA 3WGIA 1I1GA 1IO2A 2YSRA 2P5VA 2A5WA 3F0CA 2M4KA 2KKOA 1GV2A 2G7UA 3S2DJ 4CCNA 5BS6A 5HNFA 3JSPA 2L4AA 2XC7A 2EZHA 1ZG1A 3FXJA 4WX9A 3F6VA 3D1NI 2VIXA 4ZTFA 1OYIA 1YX5A 4CCMA 3ABMH 4CGZA 4KIGA 4FHTA 4YIRX 1F43A 1XMAA 5IOYA 4HEA2 2OTLI 1Y6IA 4EJWA 2ME6A 1JT0A 5FLVA 4HA8A 4F93B 1V4RA 2UV1A 3CCYA 3MZHA 3FK6A 2IW5A 2L9RA 2XAFA 3F8CA 2C6YA 1ZH5A 1U2WA 2KIFA 1DUXC 1DDNA 2E2JJ 2PX9A 4BY1J 3Q9VA 1QO0D 5ICCA 1QZYA 4IRGA 5IT9K 4EQQA 2HVSA 3DEEA 5GPCA 2EJRA 4RB1A 1IN5A 1DU0A 2W84A 3BR6A 4Q4ZF 3FMSA 1WJBA 5LD2C 4E7LA 4ETSA 4C2UA 3HTUA 2GAUA 4CH7A 2DI3A 4ZZDA 3ZCOA 1G8XA 5DDGA 4EV0A 1KA8A 3KCCA 4EM1A 4DYQA 1BA5A 1DPUA 2ISYA 3N05A 4KDPA 4IVNA 3O2PE 1MMAA 1QZEA 2A6EF 2VQGA 3GBGA 3FXQA 2GBYA 3TW6A 1G3TA 4RB0A 2X51A 4BE2A 1GLNA 1SAUA 2HZTA 3BR3A 3CLQA 3AG4H 4PGHA 2EA2A 4E4HA 4E7KA 1O3SA 2KHMA 4MHGA 1HQCA 2QUFA 1YIJI 1Z67A 2NYXA 3CP8A 2OTJI 2Y30A 4MQVA 4FT8A 5JR3A 4ASNA 1XSDA 1J0RA 1Y8RB 1HKTA 1TWAJ 2Y0MA 3GYHX 5L3DA 4AC0A 3M1CA 1Q1VA 4BQAA 1QPMA 3DEUA 3S16J 4YIIA 3LA2A 1WVRA 3QPHA 4A0XA 4FX4A 4ENMA 4CZCA 3LSKA 3SFIA 4XORA 3TKYA 3E5QA 2DA7A 3DF8A 2XUBA 3JTHA 2CQKA 1EV7A 4XOTA 5EDNA 1Z3XA 2OF7A 2IXSA 3CJTB 3BR0A 3R0AA 3DLLF 2L7MP 2XF5A 2XPWA 3WODF 1ZGAA 3MZ8A 2JPBA 3GTOJ 4CCLA 3EUHA 3GW2A 4XLAA 3W6VA 3VYSB 3WG9A 4JX4A 4KYWA 5D8KB 2JA2A 3ZN0A 2L7KA 2ZMEC 4IKFA 3OYEA 2XHKA 4M6YA 2JMWA 1UAAA 3PJRA 2WAQN 2BXYA 4BDYA 4E7JA 3FHZA 2FSWA 3K4MA 3HOXJ 1J75A 2DXIA 1S7OA 1U9OA 2ZNYA 5JLXA 1ZQ3P 2EH3A 2R93J 3GF2A 2VN2A 1B4AA 4A3JJ 4Y15A 2M87A 1HDDC 1LQ1A 1W0TA 4RB2C 3BG9A 1R23A 2KRCA 3ERED 4XMYA 3C2HA 2XB5A 2E19A 1U78A 3QQAA 4GCVA 1HW2A 4UUTA 4BJ5C 1XX5A 3HSRA 2XAGA 1ZLJA 1JHFA 2X1EA 2H8RA 2DCEA 4BJTA 4IHSA 2BOLA 2HS5A 1Z7LA 1AKHA 5IT9Z 2JQ7A 1I5ZA 1YS6A 4IHYA 5J6XA 4BACA 2F2EA 4R79A 3H0GJ 4HF1A 4S05A 3G73A 4LGWA 5E8IA 1ZLKA 4OIOF 1OJLA 2GA1A 3S93A 3KLNA 2H1LA 3K6GA 3MWMA 2EFNA 5C3EJ 4FETA 3EETA 3RKQA 3HZJA 4V2FA 1LDJA 2H94A 3KP5A 3PL8A 2O7OA 4HSRA 4UXNA 5K7ZA 2V79A 3C2GA 3IUOA 3L7WA 2FD5A 4LMYA 2E71A 3JRDA 4Y4RA 1ZKGA 2QQ9A 2WAEA 2QZ8A 5LBQA 2JT1A 5GAGJ 2A68F 4LFUA 1POGA 2A07F 5DM6F 2LD5A 1ZYRF 1WJAA 1DU6A 5L3GA 2VQCA 1TW3A 4Y7NJ 3LSRA 3OMYA 3WU2C 3S15J 4HW0A 1TTYA 5HVQC 3GFIA 1OCOH 1JUSA 2OCEA 4GYGA 1T0FA 2P5KA 3W2WA 3ZMSA 2AXTC 3FIWA 1EKEA 3HXLA 3K10A 5E1ZB 2X1CA 2P6TA 2BVLA 4LG0A 4GO1A 2CMPA 2KQRA 2KZVA 3RKYA 1U8RA 4OAZA 3RCOA 3KYCB 4PJJA 2CFXA 5A2QZ 2EIJH 3N97A 1WJ5A 2FMLA 5EZGA 3U9GA 3WHBA 2EFQA 2HWVA 1GT0C 1VI0A 4K2EA 1ZR4A 2FBHA 2WC2A 4CYCB 2IP2A 4NQWA 2IVMA 5M5XJ 2VBYA 3VODA 1L0OC 3CDHA 3E6CC 3TGNA 3FXLA 2BY3A 3L2UA 1CF7B 1QPIA 1PJRA 3SZGA 3GX4X 1IV8A 2F5DA 4HOBA 2IA1A 4HSTA 1ON2A 4XRSA 1X1DA 3NQOA 3R4KA 2O0YA 3I71A 3G71I 1YJ9I 2NS7A 3CTAA 3VFZA 4D7MA 2Y0SA 3TOAA 1IN7A 2ZMEA 4N4OB 3KX2A 3K4CA 2HKOA 1T98A 1GVJA 5D5UB 2WADA 4HBLA 5EZHA 1SEUA 2XV4S 3P7NA 4BHBA 4N4NB 1WJDA 2DFFA 4P5OA 3PNTA 1G6NA 1HSJA 4M72A 2R7QA 1XGOA 1G3SA 1HA8A 1T39A 2IPQX 3SEZA 4KJZA 3ULQB 3IC7A 5E79C 3RTRA 2OPTA 2QSFX 4YFKF 3OY9A 3P9KA 5ERIA 3O6BB 3VOEA 3IL2A 2FJ1A 3IKTA 2PBIA 4UY8I 5HLIA 2H27A 1R1TA 1SFUA 3DKWA 3BPXA 4LITA 5BMZA 3AL0C 3V7SA 2XAJA 3G2BA 5LRRA 4HNTA 1R7JA 4MGRA 3V7RA 3OYKA 3Q0VA 4XLPF 4BU2A 4RLFA 1TC3C 3HOYJ 5HDGA 3RYPA 5K5OA 2QBYA 3V8JA 3WGHA 1SFKA 3FXOA 2W1OA 2KFDA 3NEUA 2ICWG 2XF6A 4U0WA 2R7UA 4ESBA 2FQ3A 2FNPA 2V6EA 2IRFG 5D5VB 3DBRB 4ZDOA 3AKZA 1QZZA 1ZRDA 4HF2A 1UG2A 3RQ4A 1X4OA 4KICA 5LFAA 4D7NA 5K1YA 2FUG2 2VT3A 1B59A 2M8EA 3IWFA 1YI2I 2QYOA 4WXHA 4II2A 2GXGA 3C18A 1T33A 4IOAF 3IH2A 2HYJA 2MFZA 1JTXA 2XB0X 5C44J 1ACIA 1ZRCA 1MD0A 2JA6J 3WGGA 3GTKJ 4M3GA 1LFBA 2L7FP 1X58A 2VE8A 3IKVA 4M9SA 2NRAC 1XGSA 5EEAA 2L3DA 4ON0A 1E17A 5ICGA 3WTSC 3J80K 3JRHA 1X1PA 1KONA 1EJ9A 4A3LJ 3S3NA 1SMYF 3P9IA 4BAYA 4C3JJ 1H9GA 1K7AA 1HLVA 2VQHA 2A6HF 2FBKA 4ITVA 3S32A 2I5UA 1QHGA 5EEHA 2DTRA 5L3BA 1YS7A 1KQ9A 4XONA 2KJCA 4MFEA 4RMNA 5BNGA 1FIAA 2JSCA 3QYEA 4F7ZA 3OYDA 3K4BA 1OCCH 5F1JA 5IOZA 4OIRF 4GDFA 1NG6A 3NWSA 4Z6YA 2WBMA 2EBIA 2D2WA 3LAPA 2QENA 3Q0UA 1S5LC 4A5NA 1N25A 1U9NA 3K4LA 3G6EI 1TT5B 4HV6A 1N75A 1M1EB 3QP6A 2HI3A 4EATA 1D5YA 2E2HJ 2RNJA 1ZG5A 2IT0A 1IRXA 2A61A 2HTSA 1YOVB 3GXOA 3B6AA 3HEFA 1MDMA 1JHHA 3KP3A 2VXDA 4BQOA 5JVTA 2X1DA 3WTZA 3JAMZ 5FROA 2IS4A 4OOIA 1JKOC 1XMXA 1XB4A 2O6GE 3PQKA 1FYLA 2HDDA 1UHWA 1RUNA 4YIFA 2DOFA 3S8PA 4YEJA 1DPRA 4HYEA 3L00A 3EUAA 3HDDA 2VL8A 2V9VA 3QYFA 1TP4A 2JZYA 3W2VA 1YHQI 4KIBA 3S1MJ 3HUGA 3RKWA 2DK8A 3UNGC 4HX4A 3E5UA 4UHTA 5E18F 1MNDA 1A6IA 3FM3A 5ILSA 4XRFA 2VC1A 3HYIA 4PJ0C 4DGWB 3RYRA 3WTYC 3CD6I 3GZ5A 2Y69H 3OYGA 3K70D 1JGGA 3BTLA 1BW6A 2DA3A 2TRTA 5CVJA 5IY5H 2FE3A 1IXSB 3LA7A 1R71A 1W7PD 3E3VA 2V6CA 2DJIA 5BOXA 4JYKA 1Z21A 2M45A 3HG9A 2O8XA 4HF0A 4IL6C 4IQJA 4KITB 4FTHA 2IBDA 1VQPI 5GADJ 3TDUC 2R7DA 2F4MB 1WHUA 3QYBA 5K7FA 2PMZA 3FKIJ 2FRHA 3DXJF 2CQXA 3CJRB 2DYSH 3S17J 4B09A 2X85A 3JSOA 4KISA 1OPCA 4Q47A 2O9LA 3VDXA 3H5AA 2B9SA 4A69C 4S0HB 2FNAA 2HGCA 4XOPA 4QPOA 3DWLE 4I01A 5LHIA 3DU6A 1YQAA 2W24A 3KEQA 3BT9A 2VB6A 1IF1A 2DOAA 1WH7A 4BQQA 2YX7A 3MVPA 1S7AA 1ETWA 5F0FA 2K3FA 2V1NA 1ZG3A 4LIVA 3SEQA 2VOPA 1MBGA 3ZN1A 4BKXA 5E17F 1S29A 2RGVA 1R9TJ 3OYMA 3GTLJ 4ZJZA 3KP7A 2L01A 1IDYA 3L2WA 3HHGA 2VPLA 5CQEA 3H3ZA 1MBHA 3DLAA 4KA4A 1SAXA 2CSOA 1MBKA 2K4JA 3Q3SA 3KZZA 3MFKA 2R3SA 4L9VA 1YO5C 2HDCA 3COAC 3M7GA 4HDUA 2TDXA 3KZIC 1L3LA 3PSFA 2Q0OA 1P7IA 4DIQA 2LH9A 2VKHA 4AUXA 2XIGA 4UB6C 3LSPA 3QWLA 4ZH4F 3H36A 1BR1A 2EINH 4IHVA 3AG1H 3UKGA 4EJTA 1IZ1A 2RQQA 5DYMA 3I4PA 2DFIA 1KU7A 1ETYA 3LFUA 5J47A 2CGPA 2CG4A 3F8BA 3DPTA 1BC7C 1TWHJ 4ESFA 1VQ8I 4DW6A 5HS9A 2LVSA 1LB2A 3JRFA 1RIOH 3A0HC 1DGRM 3F72A 3BG3A 5IYCJ 3GWZA 3AG3H 5J4YA 5BPIA 1W7PA 1D5VA 2IGKA 2QCOA 3WTVC 5CLSA 1D0YA 1I3AA 3ZGKA 3QPSA 2W48A 1IJWC 3GTMJ 4G7OF 4E7IA 3CC7I 2WAQA 3S2WA 4JK1X 1REPC 5KCMA 1PDNC 3ZQFA 2AHQA 2A5YB 1FOXA 2COMA 4F91B 3QU6A 2EFWA 3MD2A 4D5CA 3T8RA 2HQNA 3OOUA 5BQTA 1OCPA 5C4XJ 4RGRA 1B8IA 2ZKZA 1SD5A 4M71A 1ENHA 4PJNA 4UV9A 4EGYA 1P4XA 4II3A 3M3YJ 2WWYA 5TISC 3M8JA 4DZJA 1K79A 1NTCA 1OCZH 2RKHA 2XRNA 4OMZA 4HRIA 2E1OA 5FB2A 1HOMA 1XCBA 1UJ8A 1BW5A 3ZQCA 3CUQC 2DT6A 1J5YA 1J2XA 3F8MA 3CO6C 2CW8A 3HGYA 3TO7A 2W57A 1HCRA 4A12A 1FBUA 1F4KA 1OKRA 3L2CA 3O8GA 1QBJA 2WB1A 3TDZC 4I09A 2EZIA 2X4HA 1VQLI 4JOMA 2GXAA 4KFCA 4U7DA 3PFIA 5FLXK 1Z77A 3GMEA 2XASA 2RNGA 5LGTA 4HX8A 3IV5A 2CH0A 3CF5F 2CUJA 5FKOA 5K5QA 2GM4A 3G1OA 5DD4A 3BOQA 3DQVC 4G12A 1I27A 2ME0A 3LWFA 3OV8A 3RI4A 3HOSA 2LY9A 1FLIA 4B8XA 3HSFA 4QPQA 4U7BA 2DMQA 2ZJ2A 3ZXSA 1Z3YA 5IYBJ 3ABTA 2HYFA 5FGMA 4UVBA 1TBXA 3PIOF 4A0ZA 1W1WE 1FP2A 1A35A 3RDIA 3ZQQA 2L9NA 1MJBA 1W0UA 2CV2A 3H9JA 4MEYF 4LK1F 2MSYA 4BQNA 1KQ0A 3P5JA 4BBRJ 3Q9SA 2NAZA 3HBLA 3W6JB 3FXRA 2AS5F 1JTYA 1ITYA 3GFMA 3OIOA 3CCMI 1ON1A 2MLKA 3CCLI 2M0CA 2WTEA 1VQ9I 3ZMUA 3FMQA 2EV5A 2CQ7A 5E3MA 3I59A 3ABKH 1LKXA 1H0MA 1LPQA 1U6GA 4LB6B 1T2KA 1OLTA 2LNBA 4UNOA 3GFLA 3KYLA 4F3QA 1F36A 4PK4A 4BDZA 3CUQA 1RI7A 2QGUA 2KRHA 2FA5A 5DCMB 1XC5A 2QWWA 5H2FC 2B63J 3J7AO 4A0YA 2Q2EA 3ERMA 2V4JC 5KAIC 1A5JA 3LL7A 3ASNH 3CDIA 4GXOA 3BJ6A 4XLEA 1APLC 1VQ4I 2GWRA 2PG4A 2Y9YA 3RSNA 3H9QA 2Z33A 4G6DA 4FX0A 3C2BA 3BJAA 3FXUA 2R7RA 5EG0B 2P81A 2FXAA 3CCEI 2LLKA 5DD8A 3DP7A 3DU5A 1NK2P 3JRGA 4BXXJ 2CUEA 4DBQA 5FD6A 5FRMA 2L54A 2VQLA 3TQNA 2V9PA 3TP3A 3CCVI 2JVGA 2ZMEB 1KYZA 1WJEA 1G2HA 2CQQA 1E3HA 1XTAA 3BR2A 5GTIC 2R5YA 5LRSA 4MLOA 3WU1B 2ACJA 4C30A 4LLLA 1V5EA 1XDSA 1MKMA 2FQ4A 1FBSA 3OS2A 2DOEA 4ENJA 3L2RA 4XR6A 3WU0A 1ETKA 3M9AA 1NH3A 4Y33A 2XGXA 1K6YA 3KETA 5L3EA 4KUMA 2M30A 3KE2A 2DW4A 2Z9OA 3JRCA 4WF2A 1LVKA 3H5RA 2VONA 2O5RA 3RZOJ 2RV8A 4I76A 4XSZF 5FFXA 1T38A 3DKYA 3OR1C 4RBOA 3E6BA 3PFYA 1W5SA 3K1MA 4BY7J 5E1WA 4YG2F 1VQ6I 1PUFA 4CYDA 3RZDJ 2KISA 5DM7F 1LEBA 3QP5A 2VT2A 1RRJA 1R5ID 5HS7A 2R7XA 1ETVA 2MABA 2VI6A 4CA0A 1JUMA 3FX3A 4N9HA 5CVUA 2V1DA 1TNTA 1P6RA 3KFWX 4B47A 2WY8Q 3IP4B 3R6SA 1Z9CA 1FPQA 3ELKA 1LDDA 1QA6A 3WE3A 3LMMA 1UCRA 1YW7A 1K78B 2LF8A 4DJAA 5CPRB 1V55H 3A02A 1MH3A 1G59A 2M5WA 2EWNA 2QEXI 2DA6A 3OIQA 3IRQA 1HW5A 2F48A 2OD5A 1XSXA 3TO9A 4BHPA 3B73A 2IGNA 4M6XA 1TW2A 4GYIA 4HLXA 3ECOA 2X0LA 3SZPA 3E6DA 3ZP5A 4OIPF 4X1EA 1SD7A 4A3GJ 1ORKA 2XAHA 5JI6A 3EPZA 5FKNA 1SVLA 2ZXHA 1B72A 5H6QA 1ZAOA 5DV5A 1FBQA 1MZBA 2DFEA 2R7OA 3I53A 2XDVA 2ZJPF 2VBZA 1J9IA 1H88C 4EM2A 1G3YA 4A3EJ 3I3LA 5C4JJ 2ZNZA 1RC9A 1K78A 1XN7A 5IT3A 1QU3A 1RKWA 3HIFA 2FOKA 2FOWA 4L5JA 1A31A 1D8KA 1WCMJ 4BXUA 5F0CA 3CDLA 2A3SA 5EF6A 2M8GX 2VPRA 2LF7A 1TNSA 2OBPA 1C0WA 1QVUA 4LLNA 2H1KA 1LEAA 3BTIA 3HB9A 5F0HA 1PUFB 3KEOA 2MD0A 2GIVA 2WA0A 1MBEA 5KHDA 2X9DA 5H20A 1K6OA 5FLXZ 1XGNA 4F55A 3TL4X 4MTDA 3K4NA 4E7HA 1JKPC 1JKQC 4AIJA 1TLHB 1WPKA 2W25A 4LIUA 1ZK8A 2Y9ZA 3ASOH 5J1UA 4IZZA 2OCCH 5IP9J 5HDKA 2HU9A 2XKOA 5CVVA 1U5TA 3U2RA 1J09A 2IGMA 4IOCF 4NB5A 4ZYHA 2HYGD 4RA2A 5IPAA 2ELKA 1BBYA 2R7VA 2E36A 3FKJA 4RAFA 2R7TA 1YW9A 2PEXA 2GZWA 4GRIA 2M34A 3C1DA 2JUCA 5GTHC 2NXNB 2JVHA 3K0LA 3U1KA 1R6RA 2YS9A 4IHWA 5ILUA 1ZTRA 3DEWA 1MJAA 4XKBA 3CCRI 2HOAA 1E2XA 3L2QA 1D0XA 4B3AA 2K7LA 4CZZA 2QSGX 2EV0A 4ZYEA 3FWEA 3E1SA 1JE8A 1HF0A 3ISPA 3H0DA 1ZELA 2CJJA 2L9VA 4EJVA 4E70A 3CLOA 3J81Z 4CXFA 1R22A 1FSEA 3IWZA 3CCJI 2Z2SB 1UHMA 1NG7A 4P9FA 4BS9A 1R1UA 1R49A 3ZMZA 2IA2A 4XKWA 3SFZA 1IV6A 1MMGA 1MIJA 2Q1ZB 4F92B 2MGQA 5IYDJ 1RPWA 1U5TB 1IG7A 5FJ8J 1ZR2A 1X3WB 5J1YA 2LY1A 3F3XA 2F5CA 2JN6A 3OWTA 4X6AJ 4XBFA 1P7JA 1RESA 1ZGWA 4N0BA 1U0JA 2QA4I 2XPVA 4BUPA 5TRDA 2ZXJA 3R60A 2BHZA 2AO9A 2D45A 1VTNC 5B5EC 3CESA 2F5EA 1T56A 2Z5UA 3OYCA 1X19A 2STTA 1WFXA 2ZXWH 4AD9A 3BP8A 1GXPA 4U0YA 1X1CA 5JLWA 3F8NA 4M3EA 1AOYA 1FY7A 2M2EA 1RUOA 1LE8A 4G7ZF 2HXIA 3M8EA 3UR3C 3OYLA 3HOWJ 1WWXA 1FOYA 1R1VA 3IHUA 3LSMA 2A05A 3FBIB 4L9JA 1LJ9A 3PNYA 2WV1A 4RM2A 2CUFA 1S72I 1VQKI 4JBAA 3V4GA 3ZMTA 4L5IA 4PUSA 4EMSA 2L5QA 3BROA 1MMNA 2O3FA 3CF2A 3VYTB 4Y52J 2JA7J 3OYIA 2X6YA 1XGMA 2BY2A 2CRGA 1H89C 4A93J 5J8FA 1IRZA 2HPMA 2JTVA 4CHUA 2ADUA 5J1RA 2BXZA 3M8FA 4ENKA 1IW7F 3MKLA 4QIWN 4UVAA 2D1VA 3PSIA 2P7CB 4I7HA 4HPQA 2XVCA 3EUHC 3BLYA 1U8BA 2NVYJ 2CV1A 2PJRA 4M73A 2F5VA 3LSHA 1Z05A 4HAMA 2W7NA 1FMVA 2H09A 2FU4A 4ZYDA 2RC4A 1GUUA 2G0EA 1FT9A 1IDZA 1X4PA 4UUVA 4MO7A 4BH9A 3HHHA 4HDVA 4A3FJ 5K7HA 5KNLA 2LRDA 3DBHB 4KMUX 5B1BH 1O57A 2CU7A 5FD5A 4ZDPA 2QQBA 2EZKA 2VASA 1SMTA 2KP6A 1ETXA 1OMIA 3CP2A 3ZQGA 4PFOA 1UMQA 3L09A 2DYRH 1P92A 1P9QC 2E1NA 3NWTA 4AYBA 3BTCA 2OV7A 2PMUA 1IGNA 2LBFB 2HPIA 5F27A 3IAM2 1UELB 3BQZA 1A36A 5M3FJ 1OQYA 1BJAA 4L0YB 3H3UA 5M3MJ 2L02A 5E3NA 4DNCA 3CMEI 4A2UA 5FKKA 1T0FC 2Z99A 3IH3A 2JRMA 3Q5FA 5KVRA 4BE0A 2ZB9A 3H1CA 3ECHA 2KJBA
chains in the Genus database with same CATH topology
3DFGA 4KT5C 4KMFA 1YYVA 3GUDA 2ELHA 1F9NA 5ICFA 3F22A 2CYYA 2BYVE 5D5XB 3REOA 3RIRA 2ZO4A 5LLQA 1W4MA 1J7KA 5F64A 2MC3A 1U3EM 2J5OA 2QVOA 5D6EA 5F1RA 1KU2A 2QLZA 3WE2A 3CO7C 5DUKA 1BI3A 5L3FA 1KYWA 4A6DA 1P2FA 2VC0A 3GFJA 1HKQA 2J5PA 3F6OA 1F5TA 4ZZLA 4P55A 4IRHA 5LHHA 2PMHA 4QLCU 2KIUA 2RQPA 1FYKA 1IAWA 2Y48A 3CUOA 4EM0B 3P9CA 4WCGA 5L3CA 4Q5SF 1F1ZA 3ROUA 2OU2A 1Q1HA 1EH6A 4LLGF 1QNTA 1YIOA 2P5LC 2DQLA 4CICA 1HXDA 1IRFA 5CVIA 2E7WA 1Z91A 3FZVA 3ZQ7A 4UVCA 4ZYGA 2XAQA 2MLGA 4G8XA 3QOPA 2PI0A 1BN5A 2L4MA 4MQ9F 4EJOA 1ZHFA 1XDUA 3CUQB 1EH8A 5HS8A 1MGTA 3EDPA 6PAXA 4KN4X 2G7HA 2VE9A 2NNNA 2HEOA 2E1CA 5HLHA 2DPDA 1LDKB 5CJ9A 2ZCWA 2BE5F 3MZYA 4O3MA 3R0JA 2OZUA 4H0EA 4LB5A 1WI9A 4O5VA 1NHAA 3QU3A 5ICEA 2K4BA 1O3QA 1IN6A 1B6AA 5JHUA 2MBFA 4M9ZA 5AIPA 1ZGJA 2DU9A 2PN6A 5AONA 5DCMA 1FSHA 1HSTA 4RGUA 2DT5A 2MH9A 4Y13A 1PUEE 5DEQA 1YG2A 4O6JA 3K69A 2FMYA 3RPUA 2NNYA 3VB2A 5A2QK 4PGGA 5D5WB 4BYYA 2B0LA 2P8TA 2H6CA 4P9UA 3MQ0A 2QQAA 1SD4A 1R36A 1YFHA 1TQIA 2DLLA 1ULYA 1BI0A 2IJLA 2XROA 1FC3A 3FM5A 1EH7A 2OZ6A 5LEKA 2UXNA 1FZPB 1TQMA 1FNNA 2VBWA 4L9TA 4IJAA 1XD7A 1PP8F 1B9NA 2YR2A 1OYWA 3KP6A 3I5UA 2P7VB 4KN7X 3KZYA 1P4AA 5LEJA 1XMKA 4HV5A 1BOAA 3SZTA 3LQQA 2W85A 2BEOA 2OQRA 3W6KB 2K02A 2QM3A 2MH2A 4I2OA 5E8GA 5FFZA 3JTGA 5H6RA 1ZRFA 1Z1DA 4G7HF 5CVRA 4AIHA 1LNWA 2O03A 4HX7A 4LG0B 5CYVA 2YU3A 2OAZA 4EVIA 4CO8A 2EK5A 2DBBA 5HDNA 3WTUC 4YFXF 1AWCA 3EQLF 1BC8C 1O7FA 1GXQA 2ZBKA 2BBYA 2V1UA 4LD5A 3PQJA 4WXDA 3C7JA 5LHGA 1YW8A 1BI1A 3CJNA 2VXZA 3QAHA 1G4DA 2FEZA 4IF4A 1USTA 3GVAA 2CO5A 2K27A 1MJ9A 4A6EA 4D0PA 4Z2YA 5BPDA 1ONVA 2K86A 4YFNF 5D4RA 1QGPA 4AWXB 5TJJA 3HRMA 4WWCA 3TO6A 2STWA 3RKXA 1HKSA 1MDMB 3I64A 1P4WA 3BWGA 3BDDA 2DAOA 2DO7A 3EYIA 2LDUA 2UZKA 2ESNA 3KP4A 4G9YA 3MCZA 2QBYB 3U1DA 5F6FA 3R61A 2PLYA 4L0ZB 1IRGA 5E1XA 1BM9A 2IA0A 2VODA 1O3RA 4XSXF 5EEGA 5E20A 2UXXA 3N4MA 4MTEA 1FP1D 5DCFA 4NHJA 4L18B 1HBXG 3KLOA 2GXBA 1T6SA 3KP2A 1CGPA 5ED4A 3ZPLA 2KRFA 1BI2A 3DPLC 1SFXA 2RN7A 3F8FA 1USSA 1XSVA 1R5GA 2E7XA 4R1HA 3LQRA 1ZREA 2EV6A 1UFMA 3E6MA 4P96A 1CF7A 2H6BA 1A04A 1FWZA 2LSOA 2FF4A 3IRRA 1RNLA 2VBXA 3HSEA 3K2ZA 2UWMA 2G9WA 3GLXA 3QRFF 2AXLA 2R7FA 4RAZA 3E97A 2PQ8A 3ZMVA 1Y0UA 3C3WA 2YPRA 5D8LB 4AIKA 2VOOA 2HQRA 3G3ZA 1SD6A 4A5MA 1R5HA 1W5TA 3B02A 3J81K 2EA4A 4JQFA 1ODDA 4IPAA 4RGSA 1PP7U 4PDKA 4KIFA 3NRVA 1IN8A 1KGSA 1R00A 3E5XA 2GA2A 3H92A 5HLGA 5K5RA 2F5FA 1RZ4A 3I0TA 4G94A 5HOOA 3K9TA 2LKPA 2V1XA 3T5XA 3K1NA 4IHTA 2M1BA 4CDGA 2XKPA 3LA3A 2JRTA 3LAJA 4IRIA 4BHCA 2D1HA 1ZN2A 4UV8A 5ILVA 4EGZA 2ISZA 4Y17A 4L9NA 1B1BA 4HQEA 4HZFA 3BJOA 2ESHA 1IUYA 2RDPA 3WTXC 4ENNA 4ESJA 2CW0F 1TQPA 2PFBA 1XCVA 4G6QA 3K1PA 3MAJA 3I58A 2PJPA 2DK5A 2JPCA 5LGUA 3F21A 4I02A 1SFEA 1DP7P 4U88A 1U5TC 1FYMA 2HFHA 3HOTA 3SXYA 2P4WA 3LSTA 2OA4A 1D3YA 1G3WA 4R8HA 1OR7A 3I59B 2BV6A 3AAFA 3RJPA 1IXRC 1KQ8A 3DV8A 5DUIA 3EYYA 1O3TA 3HRTA 4HQMA 1JGSA 1UB9A 5D4SA 2DQRA 5KK1A 2Z3YA 1KU3A 2CWEA 2EB7A 4DQ2A 2YX4A 1BIAA 5FO5A 2O61A 3GZ6A 4WXCA 2DPUA 3BPVA 5D6FA 1KU9A 1X3UA 4LK0F 2RVCA 3T8TA 1IN4A 5J8CA 3ML6A 2HKXA 3L9FA 4RB3C 4TV7A 1FX7A 2KIMA 1Z6TA 4Q48A 1D8JA 1JXSA 2HTJA 3OOPA 1S6LA 1WSUA 3SHFA 1HW1A 3HRSA 3WTWC 3O3KA 3WTTC 2MA3A 1WRJA 1LVAA 4XLNF 4OINF 3J80Z 2MD5A 3FF5A 3LFKA 4I0AA 1H9TA 4OMYA 4GGGA 4AVPA 1WKMA 4WK8F 1Z7UA 4M74A 3T0YA 2EFOA 4MEXF 3HTSB 1R58A 1WQ2A 2P6SA 4U0VA 2Y75A 4S04A 1W7PB 1ZARA 1YLFA 2FBIA 3BY6A 3MEXA 3M1EA 4QWQA 4HLYA 3TOBA 2EFPA 1S8NA 4BNCA 2BGCA 3D0SA 2GQQA 2ETHA 3V8KA 2Q8KA 2WV0A 3SQNA 3RPQA 1O7LA 4PZJA 4LJZF 2HR3A 4EJUA 2A69F 4M9XA 2ZFWA 5AIQA 1I1SA 3BZ6A 4RAYA 3JAMK 2NS0A 4IXAA 1V3FA 1B9MA 4PCQA 3F23A 1OYYA 1IXCA 3ZMDA 1QQIA 1STZA 3V7CA 3VEPA 1GHCA 3GO5A 3V8LA 4MNUA 3FMRA 1I6XA 1S3JA 3D5LA 1FOKA 3HRUA 2OQGA 3T1BA 3JW4A 1BIBA 1Z6RA 4I0BA 3GEZA 5LGNA 4KNYA 5JFRA 4OU0A 3I54A 4I98B 4RS8A 1YTYA 3QPTA 4OIQF 3ABUA 2HOEA 4N9IA 1J59A 4RGXA 3WGIA 1I1GA 2YSRA 2P5VA 2KKOA 2G7UA 5BS6A 3JSPA 2L4AA 1ZG1A 4WX9A 3F6VA 1OYIA 4CGZA 4KIGA 4FHTA 1XMAA 4EJWA 4HA8A 1V4RA 3MZHA 2IW5A 2XAFA 3F8CA 2C6YA 1ZH5A 1U2WA 2KIFA 1DUXC 1DDNA 3Q9VA 1QO0D 5ICCA 1QZYA 4IRGA 5IT9K 4EQQA 2EJRA 4RB1A 1IN5A 2W84A 4Q4ZF 3FMSA 4ETSA 3HTUA 2GAUA 2DI3A 4ZZDA 5DDGA 4EV0A 1KA8A 3KCCA 4EM1A 1DPUA 2ISYA 4KDPA 4IVNA 3O2PE 2A6EF 3FXQA 1G3TA 4RB0A 2HZTA 4PGHA 1O3SA 2EA2A 4MHGA 1HQCA 2QUFA 2NYXA 4MQVA 4FT8A 5JR3A 4ASNA 1XSDA 1J0RA 1HKTA 2Y0MA 3GYHX 5L3DA 4BQAA 1QPMA 3DEUA 4YIIA 3LA2A 3QPHA 4A0XA 4FX4A 4ENMA 3TKYA 3E5QA 3DF8A 2XUBA 3JTHA 2CQKA 1EV7A 3R0AA 3WODF 1ZGAA 2JPBA 3EUHA 3GW2A 3WG9A 4KYWA 5D8KB 3ZN0A 2XHKA 4M6YA 3FHZA 2FSWA 1J75A 1S7OA 2ZNYA 3GF2A 2VN2A 1B4AA 4Y15A 2M87A 1LQ1A 4RB2C 1R23A 3ERED 1U78A 4GCVA 1HW2A 3HSRA 2XAGA 1ZLJA 1JHFA 4IHSA 2HS5A 5IT9Z 1I5ZA 1YS6A 5J6XA 2F2EA 4R79A 4HF1A 4S05A 3G73A 4LGWA 5E8IA 1ZLKA 4OIOF 2GA1A 3KLNA 3MWMA 2EFNA 3EETA 1LDJA 2H94A 3KP5A 4UXNA 2V79A 3L7WA 4LMYA 2QQ9A 2QZ8A 5LBQA 2JT1A 2A68F 4LFUA 2A07F 1ZYRF 5L3GA 1TW3A 4HW0A 1TTYA 5HVQC 3GFIA 4GYGA 1T0FA 2P5KA 3ZMSA 5E1ZB 2P6TA 4LG0A 4GO1A 3RKYA 1U8RA 2CFXA 5A2QZ 3N97A 2FMLA 3U9GA 2EFQA 2HWVA 4K2EA 2FBHA 2WC2A 2IP2A 4NQWA 2IVMA 2VBYA 3VODA 1L0OC 3CDHA 3E6CC 3TGNA 1CF7B 3GX4X 2F5DA 4HOBA 2IA1A 1ON2A 3NQOA 3R4KA 2O0YA 3I71A 3VFZA 3CTAA 3TOAA 1IN7A 2ZMEA 2HKOA 1T98A 1GVJA 5D5UB 4HBLA 2XV4S 3P7NA 4BHBA 4P5OA 1G6NA 1HSJA 4M72A 1XGOA 1G3SA 1T39A 2IPQX 3ULQB 3IC7A 3RTRA 4YFKF 3P9KA 5ERIA 3O6BB 3VOEA 3IL2A 3IKTA 2PBIA 5HLIA 2H27A 1R1TA 1SFUA 3DKWA 3BPXA 5BMZA 3V7SA 2XAJA 5LRRA 1R7JA 4MGRA 3V7RA 4XLPF 5HDGA 3RYPA 5K5OA 2QBYA 3V8JA 3WGHA 3NEUA 4U0WA 4ESBA 2FQ3A 2FNPA 2IRFG 5D5VB 1ZRDA 1QZZA 4HF2A 4KICA 5K1YA 2VT3A 1B59A 2M8EA 3IWFA 2QYOA 4WXHA 2GXGA 3C18A 1ZRCA 1MD0A 3WGGA 2VE8A 3IKVA 4M9SA 2NRAC 1XGSA 2L3DA 4ON0A 1E17A 5ICGA 3WTSC 3J80K 1SMYF 3P9IA 4BAYA 1H9GA 1K7AA 2A6HF 2FBKA 5EEHA 2DTRA 5L3BA 1YS7A 1KQ9A 2KJCA 2JSCA 4F7ZA 4OIRF 2D2WA 3LAPA 2QENA 4A5NA 4HV6A 3QP6A 2RNJA 1ZG5A 2IT0A 2A61A 2HTSA 3GXOA 1MDMA 1JHHA 3KP3A 5JVTA 3WTZA 3JAMZ 4OOIA 1XB4A 2O6GE 3PQKA 1FYLA 1UHWA 1RUNA 4YIFA 1DPRA 4HYEA 3L00A 2V9VA 2JZYA 4KIBA 3HUGA 3RKWA 2DK8A 4HX4A 3E5UA 4UHTA 5E18F 3FM3A 5ILSA 4XRFA 2VC1A 3HYIA 3WTYC 3RYRA 3GZ5A 5CVJA 2FE3A 1IXSB 3LA7A 1W7PD 3E3VA 2V6CA 5BOXA 2M45A 4HF0A 2O8XA 3TDUC 2R7DA 2FRHA 3DXJF 4B09A 3JSOA 1OPCA 4Q47A 2FNAA 2HGCA 4I01A 5LHIA 1YQAA 2W24A 3KEQA 1IF1A 2YX7A 1S7AA 1ZG3A 2VOPA 3ZN1A 5E17F 1S29A 2RGVA 3KP7A 2L01A 3HHGA 3H3ZA 4KA4A 1SAXA 3MFKA 2CSOA 2K4JA 3KZZA 2HDCA 2R3SA 4L9VA 1YO5C 3COAC 3M7GA 4HDUA 2TDXA 1L3LA 2Q0OA 2XIGA 4ZH4F 4EJTA 1IZ1A 5DYMA 3I4PA 2DFIA 1KU7A 2CGPA 2CG4A 3F8BA 3DPTA 1BC7C 4ESFA 5HS9A 1LB2A 1RIOH 3F72A 3GWZA 5BPIA 1W7PA 1D5VA 3WTVC 5CLSA 4G7OF 3S2WA 4JK1X 1REPC 1PDNC 2A5YB 2COMA 3QU6A 2EFWA 3T8RA 2HQNA 5BQTA 4RGRA 2ZKZA 1SD5A 4M71A 4UV9A 4EGYA 1P4XA 2WWYA 1K79A 2RKHA 2XRNA 4OMZA 5FB2A 1XCBA 3CUQC 1J5YA 1J2XA 3F8MA 3CO6C 3TO7A 2W57A 4A12A 1FBUA 1F4KA 1OKRA 3L2CA 1QBJA 3TDZC 4I09A 2X4HA 4KFCA 4U7DA 3PFIA 5FLXK 2XASA 5LGTA 4HX8A 5K5QA 5DD4A 3BOQA 3DQVC 3RI4A 1I27A 3LWFA 3OV8A 3HOSA 1FLIA 4B8XA 3HSFA 4U7BA 2ZJ2A 3ABTA 2HYFA 5FGMA 4UVBA 1TBXA 4A0ZA 1FP2A 3RDIA 1MJBA 4MEYF 4LK1F 1KQ0A 3Q9SA 2NAZA 3W6JB 3FXRA 2AS5F 3GFMA 1ON1A 2MLKA 2WTEA 3ZMUA 3FMQA 2EV5A 3I59A 1H0MA 1U6GA 4LB6B 1T2KA 2LNBA 4UNOA 3GFLA 3CUQA 1RI7A 2FA5A 5DCMB 2QWWA 3J7AO 4A0YA 2Q2EA 4GXOA 3BJ6A 2GWRA 2PG4A 2Z33A 4G6DA 4FX0A 3FXUA 3BJAA 2FXAA 5DD8A 3DP7A 5FD6A 2L54A 3TQNA 2ZMEB 1KYZA 5LRSA 3WU1B 2ACJA 4LLLA 1XDSA 1MKMA 1FBSA 4ENJA 3WU0A 3M9AA 2XGXA 3KETA 5L3EA 4KUMA 2M30A 3KE2A 2DW4A 2Z9OA 4WF2A 2VONA 2RV8A 4XSZF 5FFXA 1T38A 3E6BA 1W5SA 3K1MA 5E1WA 4YG2F 4CYDA 1LEBA 3QP5A 2VT2A 5HS7A 3FX3A 4N9HA 5CVUA 2V1DA 1TNTA 1P6RA 3KFWX 3R6SA 1Z9CA 1FPQA 3ELKA 1LDDA 3WE3A 1UCRA 1YW7A 1K78B 2LF8A 2M5WA 2EWNA 3IRQA 1HW5A 2OD5A 3TO9A 1XSXA 4BHPA 3B73A 4M6XA 1TW2A 4GYIA 4HLXA 3ECOA 2X0LA 3SZPA 3E6DA 3ZP5A 4OIPF 1SD7A 2XAHA 5JI6A 5H6QA 1ZAOA 5DV5A 1FBQA 1MZBA 3I53A 2VBZA 1J9IA 4EM2A 1G3YA 2ZNZA 1K78A 1XN7A 5IT3A 3HIFA 2FOKA 4L5JA 1D8KA 4BXUA 2A3SA 2LF7A 1TNSA 2OBPA 1C0WA 4LLNA 1LEAA 3KEOA 2GIVA 5H20A 1K6OA 5FLXZ 1XGNA 4MTDA 4AIJA 1TLHB 2W25A 5HDKA 2XKOA 5CVVA 1U5TA 3U2RA 4NB5A 4ZYHA 2HYGD 1BBYA 1YW9A 2PEXA 2GZWA 3C1DA 3K0LA 5ILUA 1MJAA 1E2XA 2K7LA 4CZZA 2EV0A 4ZYEA 3FWEA 1JE8A 3ISPA 4EJVA 4E70A 3CLOA 3J81Z 4CXFA 1R22A 1FSEA 3IWZA 1UHMA 4P9FA 1R1UA 3ZMZA 2IA2A 3SFZA 1U5TB 3F3XA 2F5CA 4XBFA 4N0BA 5TRDA 2ZXJA 3R60A 2D45A 1VTNC 2F5EA 2Z5UA 2STTA 4AD9A 3BP8A 1GXPA 4U0YA 3F8NA 1AOYA 1FY7A 1RUOA 4G7ZF 3M8EA 1WWXA 1R1VA 3IHUA 4L9JA 1LJ9A 4JBAA 3V4GA 3ZMTA 4L5IA 4EMSA 3BROA 2O3FA 1XGMA 5J8FA 2JTVA 4CHUA 2ADUA 3M8FA 4ENKA 1IW7F 4UVAA 2D1VA 2P7CB 4I7HA 2XVCA 4M73A 1Z05A 4HAMA 2H09A 2FU4A 4ZYDA 2RC4A 1FT9A 4UUVA 4BH9A 3HHHA 4HDVA 4KMUX 1O57A 5FD5A 2QQBA 1SMTA 1OMIA 3L09A 1P92A 2E1NA 2PMUA 1BJAA 4L0YB 3H3UA 2L02A 4DNCA 4A2UA 2Z99A 3Q5FA 5KVRA 3ECHA 2KJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DFG A;  4KT5 C;  4KMF A;  1YYV A;  3GUD A;  2ELH A;  1F9N A;  5ICF A;  3F22 A;  2CYY A;  2BYV E;  5D5X B;  3REO A;  3RIR A;  2ZO4 A;  5LLQ A;  1W4M A;  1J7K A;  5F64 A;  2MC3 A;  1U3E M;  2J5O A;  2QVO A;  5D6E A;  5F1R A;  1KU2 A;  2QLZ A;  3WE2 A;  3CO7 C;  5DUK A;  1BI3 A;  5L3F A;  1KYW A;  4A6D A;  1P2F A;  2VC0 A;  3GFJ A;  1HKQ A;  2J5P A;  3F6O A;  1F5T A;  4ZZL A;  4P55 A;  4IRH A;  5LHH A;  2PMH A;  4QLC U;  2KIU A;  2RQP A;  1FYK A;  1IAW A;  2Y48 A;  3CUO A;  4EM0 B;  3P9C A;  4WCG A;  5L3C A;  4Q5S F;  1F1Z A;  3ROU A;  2OU2 A;  1Q1H A;  1EH6 A;  4LLG F;  1QNT A;  1YIO A;  2P5L C;  2DQL A;  4CIC A;  1HXD A;  1IRF A;  5CVI A;  2E7W A;  1Z91 A;  3FZV A;  3ZQ7 A;  4UVC A;  4ZYG A;  2XAQ A;  2MLG A;  4G8X A;  3QOP A;  2PI0 A;  1BN5 A;  2L4M A;  4MQ9 F;  4EJO A;  1ZHF A;  1XDU A;  3CUQ B;  1EH8 A;  5HS8 A;  1MGT A;  3EDP A;  6PAX A;  4KN4 X;  2G7H A;  2VE9 A;  2NNN A;  2HEO A;  2E1C A;  5HLH A;  2DPD A;  1LDK B;  5CJ9 A;  2ZCW A;  2BE5 F;  3MZY A;  4O3M A;  3R0J A;  2OZU A;  4H0E A;  4LB5 A;  1WI9 A;  4O5V A;  1NHA A;  3QU3 A;  5ICE A;  2K4B A;  1O3Q A;  1IN6 A;  1B6A A;  5JHU A;  2MBF A;  4M9Z A;  5AIP A;  1ZGJ A;  2DU9 A;  2PN6 A;  5AON A;  5DCM A;  1FSH A;  1HST A;  4RGU A;  2DT5 A;  2MH9 A;  4Y13 A;  1PUE E;  5DEQ A;  1YG2 A;  4O6J A;  3K69 A;  2FMY A;  3RPU A;  2NNY A;  3VB2 A;  5A2Q K;  4PGG A;  5D5W B;  4BYY A;  2B0L A;  2P8T A;  2H6C A;  4P9U A;  3MQ0 A;  2QQA A;  1SD4 A;  1R36 A;  1YFH A;  1TQI A;  2DLL A;  1ULY A;  1BI0 A;  2IJL A;  2XRO A;  1FC3 A;  3FM5 A;  1EH7 A;  2OZ6 A;  5LEK A;  2UXN A;  1FZP B;  1TQM A;  1FNN A;  2VBW A;  4L9T A;  4IJA A;  1XD7 A;  1PP8 F;  1B9N A;  2YR2 A;  1OYW A;  3KP6 A;  3I5U A;  2P7V B;  4KN7 X;  3KZY A;  1P4A A;  5LEJ A;  1XMK A;  4HV5 A;  1BOA A;  3SZT A;  3LQQ A;  2W85 A;  2BEO A;  2OQR A;  3W6K B;  2K02 A;  2QM3 A;  2MH2 A;  4I2O A;  5E8G A;  5FFZ A;  3JTG A;  5H6R A;  1ZRF A;  1Z1D A;  4G7H F;  5CVR A;  4AIH A;  1LNW A;  2O03 A;  4HX7 A;  4LG0 B;  5CYV A;  2YU3 A;  2OAZ A;  4EVI A;  4CO8 A;  2EK5 A;  2DBB A;  5HDN A;  3WTU C;  4YFX F;  1AWC A;  3EQL F;  1BC8 C;  1O7F A;  1GXQ A;  2ZBK A;  2BBY A;  2V1U A;  4LD5 A;  3PQJ A;  4WXD A;  3C7J A;  5LHG A;  1YW8 A;  1BI1 A;  3CJN A;  2VXZ A;  3QAH A;  1G4D A;  2FEZ A;  4IF4 A;  1UST A;  3GVA A;  2CO5 A;  2K27 A;  1MJ9 A;  4A6E A;  4D0P A;  4Z2Y A;  5BPD A;  1ONV A;  2K86 A;  4YFN F;  5D4R A;  1QGP A;  4AWX B;  5TJJ A;  3HRM A;  4WWC A;  3TO6 A;  2STW A;  3RKX A;  1HKS A;  1MDM B;  3I64 A;  1P4W A;  3BWG A;  3BDD A;  2DAO A;  2DO7 A;  3EYI A;  2LDU A;  2UZK A;  2ESN A;  3KP4 A;  4G9Y A;  3MCZ A;  2QBY B;  3U1D A;  5F6F A;  3R61 A;  2PLY A;  4L0Z B;  1IRG A;  5E1X A;  1BM9 A;  2IA0 A;  2VOD A;  1O3R A;  4XSX F;  5EEG A;  5E20 A;  2UXX A;  3N4M A;  4MTE A;  1FP1 D;  5DCF A;  4NHJ A;  4L18 B;  1HBX G;  3KLO A;  2GXB A;  1T6S A;  3KP2 A;  1CGP A;  5ED4 A;  3ZPL A;  2KRF A;  1BI2 A;  3DPL C;  1SFX A;  2RN7 A;  3F8F A;  1USS A;  1XSV A;  1R5G A;  2E7X A;  4R1H A;  3LQR A;  1ZRE A;  2EV6 A;  1UFM A;  3E6M A;  4P96 A;  1CF7 A;  2H6B A;  1A04 A;  1FWZ A;  2LSO A;  2FF4 A;  3IRR A;  1RNL A;  2VBX A;  3HSE A;  3K2Z A;  2UWM A;  2G9W A;  3GLX A;  3QRF F;  2AXL A;  2R7F A;  4RAZ A;  3E97 A;  2PQ8 A;  3ZMV A;  1Y0U A;  3C3W A;  2YPR A;  5D8L B;  4AIK A;  2VOO A;  2HQR A;  3G3Z A;  1SD6 A;  4A5M A;  1R5H A;  1W5T A;  3B02 A;  3J81 K;  2EA4 A;  4JQF A;  1ODD A;  4IPA A;  4RGS A;  1PP7 U;  4PDK A;  4KIF A;  3NRV A;  1IN8 A;  1KGS A;  1R00 A;  3E5X A;  2GA2 A;  3H92 A;  5HLG A;  5K5R A;  2F5F A;  1RZ4 A;  3I0T A;  4G94 A;  5HOO A;  3K9T A;  2LKP A;  2V1X A;  3T5X A;  3K1N A;  4IHT A;  2M1B A;  4CDG A;  2XKP A;  3LA3 A;  2JRT A;  3LAJ A;  4IRI A;  4BHC A;  2D1H A;  1ZN2 A;  4UV8 A;  5ILV A;  4EGZ A;  2ISZ A;  4Y17 A;  4L9N A;  1B1B A;  4HQE A;  4HZF A;  3BJO A;  2ESH A;  1IUY A;  2RDP A;  3WTX C;  4ENN A;  4ESJ A;  2CW0 F;  1TQP A;  2PFB A;  1XCV A;  4G6Q A;  3K1P A;  3MAJ A;  3I58 A;  2PJP A;  2DK5 A;  2JPC A;  5LGU A;  3F21 A;  4I02 A;  1SFE A;  1DP7 P;  4U88 A;  1U5T C;  1FYM A;  2HFH A;  3HOT A;  3SXY A;  2P4W A;  3LST A;  2OA4 A;  1D3Y A;  1G3W A;  4R8H A;  1OR7 A;  3I59 B;  2BV6 A;  3AAF A;  3RJP A;  1IXR C;  1KQ8 A;  3DV8 A;  5DUI A;  3EYY A;  1O3T A;  3HRT A;  4HQM A;  1JGS A;  1UB9 A;  5D4S A;  2DQR A;  5KK1 A;  2Z3Y A;  1KU3 A;  2CWE A;  2EB7 A;  4DQ2 A;  2YX4 A;  1BIA A;  5FO5 A;  2O61 A;  3GZ6 A;  4WXC A;  2DPU A;  3BPV A;  5D6F A;  1KU9 A;  1X3U A;  4LK0 F;  2RVC A;  3T8T A;  1IN4 A;  5J8C A;  3ML6 A;  2HKX A;  3L9F A;  4RB3 C;  4TV7 A;  1FX7 A;  2KIM A;  1Z6T A;  4Q48 A;  1D8J A;  1JXS A;  2HTJ A;  3OOP A;  1S6L A;  1WSU A;  3SHF A;  1HW1 A;  3HRS A;  3WTW C;  3O3K A;  3WTT C;  2MA3 A;  1WRJ A;  1LVA A;  4XLN F;  4OIN F;  3J80 Z;  2MD5 A;  3FF5 A;  3LFK A;  4I0A A;  1H9T A;  4OMY A;  4GGG A;  4AVP A;  1WKM A;  4WK8 F;  1Z7U A;  4M74 A;  3T0Y A;  2EFO A;  4MEX F;  3HTS B;  1R58 A;  1WQ2 A;  2P6S A;  4U0V A;  2Y75 A;  4S04 A;  1W7P B;  1ZAR A;  1YLF A;  2FBI A;  3BY6 A;  3MEX A;  3M1E A;  4QWQ A;  4HLY A;  3TOB A;  2EFP A;  1S8N A;  4BNC A;  2BGC A;  3D0S A;  2GQQ A;  2ETH A;  3V8K A;  2Q8K A;  2WV0 A;  3SQN A;  3RPQ A;  1O7L A;  4PZJ A;  4LJZ F;  2HR3 A;  4EJU A;  2A69 F;  4M9X A;  2ZFW A;  5AIQ A;  1I1S A;  3BZ6 A;  4RAY A;  3JAM K;  2NS0 A;  4IXA A;  1V3F A;  1B9M A;  4PCQ A;  3F23 A;  1OYY A;  1IXC A;  3ZMD A;  1QQI A;  1STZ A;  3V7C A;  3VEP A;  1GHC A;  3GO5 A;  3V8L A;  4MNU A;  3FMR A;  1I6X A;  1S3J A;  3D5L A;  1FOK A;  3HRU A;  2OQG A;  3T1B A;  3JW4 A;  1BIB A;  1Z6R A;  4I0B A;  3GEZ A;  5LGN A;  4KNY A;  5JFR A;  4OU0 A;  3I54 A;  4I98 B;  4RS8 A;  1YTY A;  3QPT A;  4OIQ F;  3ABU A;  2HOE A;  4N9I A;  1J59 A;  4RGX A;  3WGI A;  1I1G A;  2YSR A;  2P5V A;  2KKO A;  2G7U A;  5BS6 A;  3JSP A;  2L4A A;  1ZG1 A;  4WX9 A;  3F6V A;  1OYI A;  4CGZ A;  4KIG A;  4FHT A;  1XMA A;  4EJW A;  4HA8 A;  1V4R A;  3MZH A;  2IW5 A;  2XAF A;  3F8C A;  2C6Y A;  1ZH5 A;  1U2W A;  2KIF A;  1DUX C;  1DDN A;  3Q9V A;  1QO0 D;  5ICC A;  1QZY A;  4IRG A;  5IT9 K;  4EQQ A;  2EJR A;  4RB1 A;  1IN5 A;  2W84 A;  4Q4Z F;  3FMS A;  4ETS A;  3HTU A;  2GAU A;  2DI3 A;  4ZZD A;  5DDG A;  4EV0 A;  1KA8 A;  3KCC A;  4EM1 A;  1DPU A;  2ISY A;  4KDP A;  4IVN A;  3O2P E;  2A6E F;  3FXQ A;  1G3T A;  4RB0 A;  2HZT A;  4PGH A;  1O3S A;  2EA2 A;  4MHG A;  1HQC A;  2QUF A;  2NYX A;  4MQV A;  4FT8 A;  5JR3 A;  4ASN A;  1XSD A;  1J0R A;  1HKT A;  2Y0M A;  3GYH X;  5L3D A;  4BQA A;  1QPM A;  3DEU A;  4YII A;  3LA2 A;  3QPH A;  4A0X A;  4FX4 A;  4ENM A;  3TKY A;  3E5Q A;  3DF8 A;  2XUB A;  3JTH A;  2CQK A;  1EV7 A;  3R0A A;  3WOD F;  1ZGA A;  2JPB A;  3EUH A;  3GW2 A;  3WG9 A;  4KYW A;  5D8K B;  3ZN0 A;  2XHK A;  4M6Y A;  3FHZ A;  2FSW A;  1J75 A;  1S7O A;  2ZNY A;  3GF2 A;  2VN2 A;  1B4A A;  4Y15 A;  2M87 A;  1LQ1 A;  4RB2 C;  1R23 A;  3ERE D;  1U78 A;  4GCV A;  1HW2 A;  3HSR A;  2XAG A;  1ZLJ A;  1JHF A;  4IHS A;  2HS5 A;  5IT9 Z;  1I5Z A;  1YS6 A;  5J6X A;  2F2E A;  4R79 A;  4HF1 A;  4S05 A;  3G73 A;  4LGW A;  5E8I A;  1ZLK A;  4OIO F;  2GA1 A;  3KLN A;  3MWM A;  2EFN A;  3EET A;  1LDJ A;  2H94 A;  3KP5 A;  4UXN A;  2V79 A;  3L7W A;  4LMY A;  2QQ9 A;  2QZ8 A;  5LBQ A;  2JT1 A;  2A68 F;  4LFU A;  2A07 F;  1ZYR F;  5L3G A;  1TW3 A;  4HW0 A;  1TTY A;  5HVQ C;  3GFI A;  4GYG A;  1T0F A;  2P5K A;  3ZMS A;  5E1Z B;  2P6T A;  4LG0 A;  4GO1 A;  3RKY A;  1U8R A;  2CFX A;  5A2Q Z;  3N97 A;  2FML A;  3U9G A;  2EFQ A;  2HWV A;  4K2E A;  2FBH A;  2WC2 A;  2IP2 A;  4NQW A;  2IVM A;  2VBY A;  3VOD A;  1L0O C;  3CDH A;  3E6C C;  3TGN A;  1CF7 B;  3GX4 X;  2F5D A;  4HOB A;  2IA1 A;  1ON2 A;  3NQO A;  3R4K A;  2O0Y A;  3I71 A;  3VFZ A;  3CTA A;  3TOA A;  1IN7 A;  2ZME A;  2HKO A;  1T98 A;  1GVJ A;  5D5U B;  4HBL A;  2XV4 S;  3P7N A;  4BHB A;  4P5O A;  1G6N A;  1HSJ A;  4M72 A;  1XGO A;  1G3S A;  1T39 A;  2IPQ X;  3ULQ B;  3IC7 A;  3RTR A;  4YFK F;  3P9K A;  5ERI A;  3O6B B;  3VOE A;  3IL2 A;  3IKT A;  2PBI A;  5HLI A;  2H27 A;  1R1T A;  1SFU A;  3DKW A;  3BPX A;  5BMZ A;  3V7S A;  2XAJ A;  5LRR A;  1R7J A;  4MGR A;  3V7R A;  4XLP F;  5HDG A;  3RYP A;  5K5O A;  2QBY A;  3V8J A;  3WGH A;  3NEU A;  4U0W A;  4ESB A;  2FQ3 A;  2FNP A;  2IRF G;  5D5V B;  1ZRD A;  1QZZ A;  4HF2 A;  4KIC A;  5K1Y A;  2VT3 A;  1B59 A;  2M8E A;  3IWF A;  2QYO A;  4WXH A;  2GXG A;  3C18 A;  1ZRC A;  1MD0 A;  3WGG A;  2VE8 A;  3IKV A;  4M9S A;  2NRA C;  1XGS A;  2L3D A;  4ON0 A;  1E17 A;  5ICG A;  3WTS C;  3J80 K;  1SMY F;  3P9I A;  4BAY A;  1H9G A;  1K7A A;  2A6H F;  2FBK A;  5EEH A;  2DTR A;  5L3B A;  1YS7 A;  1KQ9 A;  2KJC A;  2JSC A;  4F7Z A;  4OIR F;  2D2W A;  3LAP A;  2QEN A;  4A5N A;  4HV6 A;  3QP6 A;  2RNJ A;  1ZG5 A;  2IT0 A;  2A61 A;  2HTS A;  3GXO A;  1MDM A;  1JHH A;  3KP3 A;  5JVT A;  3WTZ A;  3JAM Z;  4OOI A;  1XB4 A;  2O6G E;  3PQK A;  1FYL A;  1UHW A;  1RUN A;  4YIF A;  1DPR A;  4HYE A;  3L00 A;  2V9V A;  2JZY A;  4KIB A;  3HUG A;  3RKW A;  2DK8 A;  4HX4 A;  3E5U A;  4UHT A;  5E18 F;  3FM3 A;  5ILS A;  4XRF A;  2VC1 A;  3HYI A;  3WTY C;  3RYR A;  3GZ5 A;  5CVJ A;  2FE3 A;  1IXS B;  3LA7 A;  1W7P D;  3E3V A;  2V6C A;  5BOX A;  2M45 A;  4HF0 A;  2O8X A;  3TDU C;  2R7D A;  2FRH A;  3DXJ F;  4B09 A;  3JSO A;  1OPC A;  4Q47 A;  2FNA A;  2HGC A;  4I01 A;  5LHI A;  1YQA A;  2W24 A;  3KEQ A;  1IF1 A;  2YX7 A;  1S7A A;  1ZG3 A;  2VOP A;  3ZN1 A;  5E17 F;  1S29 A;  2RGV A;  3KP7 A;  2L01 A;  3HHG A;  3H3Z A;  4KA4 A;  1SAX A;  3MFK A;  2CSO A;  2K4J A;  3KZZ A;  2HDC A;  2R3S A;  4L9V A;  1YO5 C;  3COA C;  3M7G A;  4HDU A;  2TDX A;  1L3L A;  2Q0O A;  2XIG A;  4ZH4 F;  4EJT A;  1IZ1 A;  5DYM A;  3I4P A;  2DFI A;  1KU7 A;  2CGP A;  2CG4 A;  3F8B A;  3DPT A;  1BC7 C;  4ESF A;  5HS9 A;  1LB2 A;  1RIO H;  3F72 A;  3GWZ A;  5BPI A;  1W7P A;  1D5V A;  3WTV C;  5CLS A;  4G7O F;  3S2W A;  4JK1 X;  1REP C;  1PDN C;  2A5Y B;  2COM A;  3QU6 A;  2EFW A;  3T8R A;  2HQN A;  5BQT A;  4RGR A;  2ZKZ A;  1SD5 A;  4M71 A;  4UV9 A;  4EGY A;  1P4X A;  2WWY A;  1K79 A;  2RKH A;  2XRN A;  4OMZ A;  5FB2 A;  1XCB A;  3CUQ C;  1J5Y A;  1J2X A;  3F8M A;  3CO6 C;  3TO7 A;  2W57 A;  4A12 A;  1FBU A;  1F4K A;  1OKR A;  3L2C A;  1QBJ A;  3TDZ C;  4I09 A;  2X4H A;  4KFC A;  4U7D A;  3PFI A;  5FLX K;  2XAS A;  5LGT A;  4HX8 A;  5K5Q A;  5DD4 A;  3BOQ A;  3DQV C;  3RI4 A;  1I27 A;  3LWF A;  3OV8 A;  3HOS A;  1FLI A;  4B8X A;  3HSF A;  4U7B A;  2ZJ2 A;  3ABT A;  2HYF A;  5FGM A;  4UVB A;  1TBX A;  4A0Z A;  1FP2 A;  3RDI A;  1MJB A;  4MEY F;  4LK1 F;  1KQ0 A;  3Q9S A;  2NAZ A;  3W6J B;  3FXR A;  2AS5 F;  3GFM A;  1ON1 A;  2MLK A;  2WTE A;  3ZMU A;  3FMQ A;  2EV5 A;  3I59 A;  1H0M A;  1U6G A;  4LB6 B;  1T2K A;  2LNB A;  4UNO A;  3GFL A;  3CUQ A;  1RI7 A;  2FA5 A;  5DCM B;  2QWW A;  3J7A O;  4A0Y A;  2Q2E A;  4GXO A;  3BJ6 A;  2GWR A;  2PG4 A;  2Z33 A;  4G6D A;  4FX0 A;  3FXU A;  3BJA A;  2FXA A;  5DD8 A;  3DP7 A;  5FD6 A;  2L54 A;  3TQN A;  2ZME B;  1KYZ A;  5LRS A;  3WU1 B;  2ACJ A;  4LLL A;  1XDS A;  1MKM A;  1FBS A;  4ENJ A;  3WU0 A;  3M9A A;  2XGX A;  3KET A;  5L3E A;  4KUM A;  2M30 A;  3KE2 A;  2DW4 A;  2Z9O A;  4WF2 A;  2VON A;  2RV8 A;  4XSZ F;  5FFX A;  1T38 A;  3E6B A;  1W5S A;  3K1M A;  5E1W A;  4YG2 F;  4CYD A;  1LEB A;  3QP5 A;  2VT2 A;  5HS7 A;  3FX3 A;  4N9H A;  5CVU A;  2V1D A;  1TNT A;  1P6R A;  3KFW X;  3R6S A;  1Z9C A;  1FPQ A;  3ELK A;  1LDD A;  3WE3 A;  1UCR A;  1YW7 A;  1K78 B;  2LF8 A;  2M5W A;  2EWN A;  3IRQ A;  1HW5 A;  2OD5 A;  3TO9 A;  1XSX A;  4BHP A;  3B73 A;  4M6X A;  1TW2 A;  4GYI A;  4HLX A;  3ECO A;  2X0L A;  3SZP A;  3E6D A;  3ZP5 A;  4OIP F;  1SD7 A;  2XAH A;  5JI6 A;  5H6Q A;  1ZAO A;  5DV5 A;  1FBQ A;  1MZB A;  3I53 A;  2VBZ A;  1J9I A;  4EM2 A;  1G3Y A;  2ZNZ A;  1K78 A;  1XN7 A;  5IT3 A;  3HIF A;  2FOK A;  4L5J A;  1D8K A;  4BXU A;  2A3S A;  2LF7 A;  1TNS A;  2OBP A;  1C0W A;  4LLN A;  1LEA A;  3KEO A;  2GIV A;  5H20 A;  1K6O A;  5FLX Z;  1XGN A;  4MTD A;  4AIJ A;  1TLH B;  2W25 A;  5HDK A;  2XKO A;  5CVV A;  1U5T A;  3U2R A;  4NB5 A;  4ZYH A;  2HYG D;  1BBY A;  1YW9 A;  2PEX A;  2GZW A;  3C1D A;  3K0L A;  5ILU A;  1MJA A;  1E2X A;  2K7L A;  4CZZ A;  2EV0 A;  4ZYE A;  3FWE A;  1JE8 A;  3ISP A;  4EJV A;  4E70 A;  3CLO A;  3J81 Z;  4CXF A;  1R22 A;  1FSE A;  3IWZ A;  1UHM A;  4P9F A;  1R1U A;  3ZMZ A;  2IA2 A;  3SFZ A;  1U5T B;  3F3X A;  2F5C A;  4XBF A;  4N0B A;  5TRD A;  2ZXJ A;  3R60 A;  2D45 A;  1VTN C;  2F5E A;  2Z5U A;  2STT A;  4AD9 A;  3BP8 A;  1GXP A;  4U0Y A;  3F8N A;  1AOY A;  1FY7 A;  1RUO A;  4G7Z F;  3M8E A;  1WWX A;  1R1V A;  3IHU A;  4L9J A;  1LJ9 A;  4JBA A;  3V4G A;  3ZMT A;  4L5I A;  4EMS A;  3BRO A;  2O3F A;  1XGM A;  5J8F A;  2JTV A;  4CHU A;  2ADU A;  3M8F A;  4ENK A;  1IW7 F;  4UVA A;  2D1V A;  2P7C B;  4I7H A;  2XVC A;  4M73 A;  1Z05 A;  4HAM A;  2H09 A;  2FU4 A;  4ZYD A;  2RC4 A;  1FT9 A;  4UUV A;  4BH9 A;  3HHH A;  4HDV A;  4KMU X;  1O57 A;  5FD5 A;  2QQB A;  1SMT A;  1OMI A;  3L09 A;  1P92 A;  2E1N A;  2PMU A;  1BJA A;  4L0Y B;  3H3U A;  2L02 A;  4DNC A;  4A2U A;  2Z99 A;  3Q5F A;  5KVR A;  3ECH A;  2KJB A; 
#chains in the Genus database with same CATH topology
 5GPA A;  3DFG A;  3QPL A;  4KT5 C;  4KMF A;  2ID6 A;  1RET A;  2QSH X;  1YYV A;  1D1A A;  3GUD A;  3BR1 A;  3HC7 A;  2DA2 A;  3O8H A;  5JVG F;  1X2N A;  2ELH A;  4PJL A;  2HQA A;  1F9N A;  5ICF A;  3Q0W A;  3F22 A;  2CYY A;  2BYV E;  5D5X B;  4AU7 A;  3REO A;  4NQW B;  2V9K A;  3RIR A;  3VWB A;  2R5Y B;  2ZO4 A;  5LLQ A;  1W4M A;  3TW7 A;  4XIC A;  4H4K C;  2NOJ B;  1J7K A;  5F64 A;  2F4I A;  2R7S A;  2MC3 A;  3I56 I;  2E1M C;  1U3E M;  1BJZ A;  2J5O A;  2HOT A;  2QVO A;  2M4G A;  3K2A A;  5D6E A;  5F1R A;  3VSL A;  1KU2 A;  1A6Q A;  3A0B C;  2QLZ A;  3WE2 A;  1HC8 A;  3PNV A;  3CO7 C;  3CCU I;  2E34 A;  2BW3 B;  3BTJ A;  4NDL A;  1S9H A;  2K9S A;  1BI3 A;  5DUK A;  3OYJ A;  3HKZ N;  1JT6 A;  2LY2 A;  1KYW A;  5L3F A;  2LFB A;  4PJM A;  4A6D A;  1P2F A;  2JWT A;  3LNQ A;  2VC0 A;  3ABL H;  2CQN A;  3GFJ A;  4D1Q A;  1HKQ A;  2Q2E B;  3GZN B;  2J5P A;  3F6O A;  1MSE C;  1F5T A;  4ZZL A;  3A2K A;  1OFC X;  4ANJ A;  4P55 A;  2AQE A;  3MKZ A;  3IAS 2;  3J7A Y;  4IRH A;  5LHH A;  4XLF A;  2GLO A;  1IC8 A;  2PMH A;  3DTI A;  4E7Z A;  2KMU A;  3CMM A;  4QLC U;  2JK3 A;  1Y56 A;  2KIU A;  2RQP A;  1FYK A;  2LC2 A;  4XRS G;  2LP0 A;  2HOS A;  1SVO A;  4J01 A;  1IAW A;  3S1Q J;  2BY1 A;  2ZC2 A;  2Y48 A;  3CUO A;  1PYV A;  2R0Q C;  3LSG A;  2YUS A;  1S7E A;  4EM0 B;  3H9G A;  1N77 A;  3P9C A;  4WCG A;  2DA4 A;  1VQM I;  5L3C A;  4Q5S F;  1AKH B;  1F1Z A;  3ROU A;  2OU2 A;  1Q1H A;  1EH6 A;  1MMD A;  3BZC A;  4XN3 A;  1I6H J;  4LLG F;  4C3I J;  1QNT A;  4MIM A;  1YIO A;  5J4V A;  3MKY B;  2P5L C;  2DQL A;  2M3A A;  4DBR A;  2IS2 A;  4CIC A;  2IS6 A;  1HXD A;  1IRF A;  5CVI A;  2E7W A;  1Z91 A;  3FZV A;  3ZQ7 A;  1W36 C;  2E60 A;  4UVC A;  4XLH A;  4F52 A;  4ZYG A;  2XAQ A;  3S3O A;  2MLG A;  2ZSI B;  4G8X A;  3QOP A;  2PI0 A;  2LR8 A;  3PUB A;  2NVU B;  2RAE A;  2IGO A;  1BN5 A;  5M5Y J;  4CCO A;  2L4M A;  1TL8 A;  4MQ9 F;  4EJO A;  4FCY A;  1ZHF A;  2EIK H;  4OWR B;  1XDU A;  3CUQ B;  2IAI A;  2DA5 A;  1EH8 A;  3K4J A;  5HS8 A;  1MGT A;  4QTR A;  2IEK A;  2K9Q A;  3EDP A;  3D5S C;  1BR4 A;  2K9M A;  2KDO A;  3FK7 A;  4KN4 X;  1CQT A;  6PAX A;  1VZ0 A;  2BHY A;  5B1A H;  3TBI A;  2NVX J;  2G7H A;  2VE9 A;  2GOX B;  3F9K A;  3DKX A;  3HPG A;  1Y1V J;  4FAS D;  2NNN A;  2X6W A;  2E1C A;  2HEO A;  5HLH A;  1B8I B;  2DPD A;  1LDK B;  5B3S H;  4XRM A;  3CC2 I;  5CJ9 A;  2ZCW A;  2BE5 F;  3MZY A;  2BY0 A;  3HM5 A;  2M7B A;  4M3B A;  4O3M A;  3WG7 H;  3BR5 A;  4NC8 A;  5EGO A;  3LSJ A;  1OCT C;  3R0J A;  1OCR H;  3HL2 A;  3MN2 A;  2OZU A;  1VND A;  3BG5 A;  4H0E A;  4E7S A;  4YRV A;  4LB5 A;  1MMS A;  1OIS A;  1WI9 A;  5EG0 A;  4O5V A;  1NHA A;  2MW8 A;  2XSJ C;  3CQZ J;  3QU3 A;  1V5F A;  3OYF A;  5ICE A;  2K4B A;  1O3Q A;  4C2T A;  1IN6 A;  2CW7 A;  1B6A A;  5JHU A;  2MBF A;  2ZJQ F;  2NVT J;  4M9Z A;  5AIP A;  1ZGJ A;  2DU9 A;  2K85 A;  1GDT A;  2PN6 A;  2F4O B;  2HVQ A;  5AON A;  5DCM A;  1FSH A;  4B3X A;  2CUZ A;  3KIO A;  1HST A;  4RGU A;  2R92 J;  2DT5 A;  2F6C A;  2MH9 A;  3NAU A;  4Y13 A;  2KDZ A;  2LMD A;  1PUE E;  5DEQ A;  3SJM A;  1YG2 A;  4O6J A;  4V2G A;  3OIP A;  3K69 A;  3I55 I;  3K7A J;  2XGD A;  2FMY A;  3GTP J;  3RPU A;  2NNY A;  5FRN A;  3ZR8 X;  3ZQH A;  2CS3 A;  2UUZ A;  3VB2 A;  1K4T A;  4EEF G;  3PIP F;  5FKM A;  3CJQ B;  2DMT A;  5A2Q K;  3I4N J;  4YEL A;  4PGG A;  3CMA I;  5FLM J;  1T95 A;  2W82 A;  4M3F A;  4BEH B;  5D5W B;  2XF7 A;  4BYY A;  1VFC A;  2B0L A;  2P8T A;  2H6C A;  3SDB A;  2VJ5 A;  1UHS A;  1Z0X A;  3LSI A;  4P9U A;  3MQ0 A;  4B48 A;  2DN0 A;  4CCJ A;  2QQA A;  1SD4 A;  1R36 A;  4W1U A;  3OSF A;  1YFH A;  1TQI A;  4L5E A;  2DLL A;  2KZG A;  1ULY A;  4PSW A;  1BI0 A;  3CCQ I;  2IJL A;  2EZL A;  2XRO A;  1FC3 A;  2MYS A;  3FM5 A;  1EH7 A;  2OZ6 A;  1YJW I;  4U87 A;  5LEK A;  2JUG A;  2BW3 A;  2UXN A;  1FZP B;  1TQM A;  2QQ8 A;  1FNN A;  4BGD A;  2X6O A;  4XLC A;  1JJ8 C;  2VBW A;  3CMY A;  4L9T A;  4B44 A;  3BC8 A;  3OL4 A;  2D5V A;  4JX6 A;  4IJA A;  4P1W A;  1FEX A;  1XD7 A;  1PP8 F;  1EA3 A;  1B9N A;  3L2V A;  3U21 A;  1WZ2 A;  2YR2 A;  1OYW A;  4B4C A;  3KP6 A;  3I5U A;  2P7V B;  4KN7 X;  3BZK A;  3AFH A;  3KZY A;  4NC7 A;  1P4A A;  5LEJ A;  1XMK A;  2L9S A;  4HV5 A;  2LOO A;  1BOA A;  5DS9 A;  2PJR B;  1X1B A;  2LK2 A;  3SZT A;  3LQQ A;  3V42 A;  1VQ7 I;  2W85 A;  2V26 A;  2BEO A;  2OQR A;  3W6K B;  2K02 A;  3S1R J;  2QM3 A;  2MH2 A;  2GOM A;  3JRB A;  1TWF J;  1LFP A;  3G1L A;  5E8G A;  5FFZ A;  3JTG A;  4I2O A;  5H6R A;  1ZRF A;  2QF7 A;  1FIP A;  1Z1D A;  2DDB A;  2ECB A;  4G7H F;  5CVR A;  1LUJ B;  3BCB A;  2Y2Z A;  4AIH A;  1LNW A;  2O03 A;  1RKT A;  2BVM A;  3VYU B;  4HX7 A;  1E0E A;  4LG0 B;  5CYV A;  2YU3 A;  1FTT A;  2Y31 A;  2DTZ A;  2NS8 A;  2OAZ A;  4NBQ A;  4EVI A;  1Y1W J;  2B7E A;  4CO8 A;  2EK5 A;  1K4S A;  2DBB A;  5HDN A;  5B66 C;  3WTU C;  1RR7 A;  3DBL B;  4LG3 A;  2LBF A;  1LFU P;  1QVT A;  4RAG A;  1DP3 A;  4YFX F;  1V5G A;  4A3D J;  1AWC A;  3EQL F;  1BC8 C;  1R4N B;  1FMW A;  1O7F A;  5EJC A;  1I3Q J;  2W00 A;  5J40 A;  5IP6 A;  1GXQ A;  2ZBK A;  2BBY A;  1QHH D;  2V1U A;  4LD5 A;  3PQJ A;  4WXD A;  2H8W A;  3C7J A;  4MFD A;  5LHG A;  1YW8 A;  2I10 A;  1BI1 A;  1XG1 A;  3CJN A;  1D0Z A;  2VXZ A;  3QAH A;  1G4D A;  3FIS A;  2FEZ A;  2E5N A;  3FXK A;  3OYN A;  4IF4 A;  3E0J B;  5JHF A;  1WI3 A;  3MMY B;  1UST A;  1Y39 A;  4CCK A;  3LOC A;  3GVA A;  2CO5 A;  2K27 A;  1MJ9 A;  2COB A;  4A6E A;  3OR2 C;  4D0P A;  4UUS B;  4Z2Y A;  5BPD A;  1ONV A;  2K86 A;  3FHN A;  4YFN F;  3OYB A;  3JRI A;  2V7F A;  4NNJ A;  3H3V K;  5D4R A;  4J00 A;  2Z1D A;  1QGP A;  2VUM J;  4AWX B;  4ZYA A;  1VF9 A;  5TJJ A;  3HRM A;  2LRE A;  3PUF A;  4WWC A;  2WY7 Q;  1SFO J;  3TO6 A;  4JX5 A;  2XGC A;  2N8G A;  2STW A;  3RKX A;  1HKS A;  3PO3 J;  1MDM B;  4ZC3 A;  2DT7 B;  1BR2 A;  3I64 A;  4XM3 A;  2W4S A;  4X0G A;  1P4W A;  3BWG A;  2ZJR F;  3BDD A;  2L7Z A;  5M5W J;  2DAO A;  1TZL A;  2DO7 A;  3EYI A;  1D1C A;  3ONQ A;  5E3L A;  1JKR C;  1ETO A;  2LDU A;  1JJ6 C;  2UZK A;  2ESN A;  1T8I A;  1LE8 B;  4IX7 A;  1QRY A;  2K5C A;  2K9N A;  3KP4 A;  1WH5 A;  2HDW A;  3KEY A;  4G9Y A;  3MCZ A;  2QBY B;  3U1D A;  4AYB N;  5F6F A;  1I50 J;  3KPH A;  1TT0 A;  3R61 A;  4M3D A;  2PLY A;  4PSX A;  4L0Z B;  4B1R A;  1ERD A;  1IRG A;  2JSP A;  5E1X A;  2XRL A;  1BM9 A;  1YIT I;  2IA0 A;  1BOB A;  4AVZ A;  2VOD A;  1O3R A;  4XSX F;  4XN0 A;  1TWG J;  5EEG A;  3WHC A;  5E20 A;  2UXX A;  3N4M A;  1EF4 A;  4D5F A;  3TED A;  4ABZ A;  2VKV A;  3A03 A;  4MTE A;  1FP1 D;  3VSK A;  3HUG B;  5DCF A;  4NHJ A;  5E3O A;  4I99 C;  3ZQI A;  4L18 B;  1HBX G;  3KLO A;  2E1M B;  4BBS J;  5FKL A;  3RQI A;  1T6S A;  3KP2 A;  5KAF C;  1CGP A;  2GXB A;  2ZXI A;  5ED4 A;  3CCS I;  3W2A A;  3ZPL A;  2KRF A;  1BI2 A;  3DPL C;  1SFX A;  1UG0 A;  2HQ5 A;  1VQ5 I;  2RRE A;  2RN7 A;  3F8F A;  1USS A;  1XSV A;  4CSW A;  1R5G A;  1YX3 A;  2E7X A;  4R1H A;  1VQN I;  3LQR A;  1ZRE A;  2EV6 A;  4DZP A;  1UFM A;  2DOD A;  3A4C A;  4E6K G;  2LKX A;  3CZ6 A;  3ESW B;  4NC6 A;  3E6M A;  4P96 A;  3OYA A;  1CF7 A;  2H6B A;  4FIS A;  2VJI A;  1A04 A;  1FWZ A;  3G1M A;  9ANT A;  2ZSH B;  3GLL A;  2LSO A;  4ZTJ A;  3JRA A;  2FF4 A;  3IRR A;  1RNL A;  2VBX A;  2WAF A;  3HSE A;  3H5N A;  1D1B A;  3K2Z A;  4AM3 A;  2UWM A;  3PO2 J;  4IEJ A;  2EPF A;  2G9W A;  3GLX A;  3QRF F;  1YJN I;  1RR8 C;  2AXL A;  2R7F A;  3I9V 2;  4RAZ A;  3E97 A;  2VJJ A;  2PQ8 A;  1R4M B;  3ZMV A;  4V19 K;  1Y0U A;  3C3W A;  2YPR A;  5D8L B;  4AIK A;  1XPX A;  4XKC A;  2M0M A;  1XS9 A;  1JUP A;  4Y3O A;  5EYR A;  2KIQ A;  2KL4 A;  1AA7 A;  2VOO A;  2XPU A;  3D5R C;  2HQR A;  3G3Z A;  1SD6 A;  4A5M A;  1R5H A;  1W5T A;  4RDU A;  5DTD A;  3B02 A;  3J81 K;  2EA4 A;  4JQF A;  2JA8 J;  4BJ6 C;  1ODD A;  4IPA A;  4RGS A;  4A3B J;  4C3H J;  1PP7 U;  4PDK A;  1X1A A;  4KIF A;  3S14 J;  3NRV A;  1I39 A;  2LTP A;  1IN8 A;  3VYR B;  1KGS A;  3B6C A;  1R00 A;  5F08 A;  4BE1 A;  1DQU A;  2QKM B;  3E5X A;  2GA2 A;  3OSG A;  1B72 B;  3H92 A;  4A3M J;  3HPH A;  1BL0 A;  3S2H J;  3FBN B;  5HLG A;  5K5R A;  2F5F A;  1RZ4 A;  3I0T A;  4G94 A;  5HOO A;  3AL0 B;  3K9T A;  2KT0 A;  4QSH A;  2LKP A;  3HOV J;  5HLT A;  2V1X A;  1UZC A;  3T5X A;  1SAN A;  3PM1 A;  4JP0 A;  3K1N A;  4IHT A;  3QOE A;  2M1B A;  4CDG A;  2XKP A;  4XID A;  1MW7 A;  3LA3 A;  2JRT A;  2Y0S N;  3LAJ A;  2CV0 A;  4IRI A;  2NVQ J;  4BHC A;  2D1H A;  1ZN2 A;  2TCT A;  4UV8 A;  5ILV A;  4EGZ A;  2ISZ A;  4Y17 A;  4L9N A;  3CC4 I;  1B1B A;  4IHX A;  1IUF A;  4HQE A;  4HZF A;  3BJO A;  2ESH A;  1IUY A;  2RDP A;  5GP9 A;  3WTX C;  4ENN A;  1MSF C;  2OUM A;  2CW0 F;  3QOD A;  4ESJ A;  3NAR A;  1TQP A;  2PFB A;  3MKW B;  1XCV A;  4G6Q A;  4OAY A;  3GTJ J;  4AID A;  2Z16 A;  3K1P A;  3MAJ A;  3I58 A;  2PJP A;  2DK5 A;  2JPC A;  5LGU A;  3F21 A;  2R4G A;  4I02 A;  1SFE A;  4M6V A;  1DP7 P;  2DJN A;  1AHD P;  4U88 A;  1U5T C;  1FYM A;  3JRE A;  2HFH A;  3HOT A;  2E35 A;  3SXY A;  1AU7 A;  2P4W A;  1E3O C;  1FJL A;  2K40 A;  3LST A;  2OA4 A;  1D3Y A;  1G3W A;  4R8H A;  1NK3 P;  1V54 H;  4HG2 A;  1OR7 A;  3I59 B;  2BV6 A;  2QKL B;  3AAF A;  3RJP A;  4A3I J;  4UB8 C;  1IXR C;  4BEH A;  2K9L A;  4RLQ A;  4DYR A;  1O4X A;  2X48 A;  3DV8 A;  5DUI A;  1KQ8 A;  2R5Z B;  3AG2 H;  3EYY A;  1O3T A;  3HRT A;  1FTZ A;  5HOD A;  2LG4 A;  3JR9 A;  4HQM A;  1JGS A;  1UB9 A;  3HOU J;  2PMZ N;  2L2O A;  5D4S A;  4B43 A;  2DQR A;  2OJE D;  5KK1 A;  1K61 A;  2Z3Y A;  1KU3 A;  1VQO I;  2EIM H;  3HOZ J;  3BG6 A;  2HZD A;  2CWE A;  3M4O J;  1WJF A;  2EB7 A;  4A3C J;  4DQ2 A;  1DGW Y;  2YX4 A;  1H8A C;  1SC7 A;  1BIA A;  5FO5 A;  2O61 A;  1T08 B;  3GZ6 A;  2K3P A;  4WXC A;  2DPU A;  3BPV A;  5D6F A;  4I6Z A;  1GV5 A;  1KU9 A;  1X3U A;  4LK0 F;  3DTK A;  1WJC A;  3GTG J;  2MG4 A;  1MH4 A;  2RVC A;  3T8T A;  3HGG A;  4PFP A;  1IN4 A;  5J8C A;  3ML6 A;  2ZFU A;  2HKX A;  3L9F A;  4RB3 C;  1MBF A;  1GVD A;  4IQ4 A;  2GIZ A;  4TV7 A;  3TMO A;  1FX7 A;  2AQF A;  3W3C A;  2KIM A;  1Z6T A;  4Q48 A;  1D8J A;  1JXS A;  4IO9 F;  2HTJ A;  2M9H A;  3FDY A;  3DTE A;  1YRN B;  2DMU A;  3OOP A;  1S6L A;  1E3P A;  1WSU A;  3OS0 A;  1WGX A;  3SHF A;  5HNH A;  2XSD C;  4FE7 A;  1HW1 A;  3HRS A;  3WTW C;  3EUK L;  3O3K A;  3WTT C;  2DA1 A;  4FE4 A;  2BZT A;  3RPU D;  2MA3 A;  2VKE A;  1WRJ A;  1LVA A;  2KPM A;  4XLN F;  5IP7 J;  3J7Y J;  3K4K A;  4OIN F;  3S3M A;  3J80 Z;  2MD5 A;  4XNF A;  1YE9 A;  3JCU C;  3FF5 A;  3LFK A;  2FX0 A;  3OL3 A;  5CQG A;  4I0A A;  1YRN A;  4BL0 B;  3VPR A;  3FXM A;  1H9T A;  3L1P A;  4OMY A;  4GGG A;  5F04 A;  1WKM A;  4AVP A;  3SDG A;  4WK8 F;  2E5Z A;  1Z7U A;  4M74 A;  3T0Y A;  2EFO A;  2JJ7 A;  3BG7 A;  4MEX F;  3X2Q H;  3HTS B;  1R58 A;  1WQ2 A;  5GAE J;  2P6S A;  2L0K A;  2Y75 A;  4U0V A;  4S04 A;  3OS1 A;  1W7P B;  2WB1 N;  1ZAR A;  4KT6 A;  1MBJ A;  1YLF A;  2FBI A;  4CUG A;  2MC4 A;  3BY6 A;  3MEX A;  1MNM C;  3M1E A;  4QWQ A;  4C2M J;  4HLY A;  3TOB A;  2EFP A;  1S8N A;  2NOG A;  3OYH A;  3ZRG A;  4W97 A;  4UUS A;  4BNC A;  2BGC A;  3D0S A;  2GQQ A;  2M7A A;  3SYT A;  1TWC J;  4C9Y A;  3IH4 A;  3GCM A;  2ETH A;  4G6T B;  3V8K A;  2Q8K A;  2KLO A;  3HJE A;  2WV0 A;  4D9J A;  5EGO B;  3SQN A;  5TGT A;  2P0W A;  1N78 A;  1K83 J;  3BCA A;  2XGE A;  1O7L A;  3RPQ A;  2HXO A;  2X6X A;  4PZJ A;  4LJZ F;  2HR3 A;  3H35 A;  2A69 F;  4FQG A;  4EJU A;  4LOC A;  4M9X A;  1X2M A;  5GAH J;  2DDA A;  3A01 B;  2ZFW A;  5AIQ A;  3GTQ J;  1I1S A;  2R5Z A;  2VLA A;  3HKZ A;  3A1Y A;  2LYC A;  3BZ6 A;  2O8K A;  4RAY A;  2EIL H;  3JAM K;  2NS0 A;  2A6T A;  2XAU A;  4IXA A;  1V3F A;  4BXF A;  2JA5 J;  4NUB A;  1B9M A;  4PCQ A;  4DOZ A;  2R7Z J;  3F23 A;  2ELJ A;  1OYY A;  4A3K J;  1IXC A;  1FOW A;  2OC6 A;  3ZMD A;  3M07 A;  1QQI A;  3E7L A;  1STZ A;  2ID3 A;  3V7C A;  1PVE A;  1Y0N A;  2VJ4 A;  2DFH A;  3VEP A;  3J7Z I;  1GHC A;  3GO5 A;  2EQR A;  2HNH A;  3V8L A;  4DYC A;  4XQF A;  5J3L A;  3A01 A;  4MNU A;  2I8D A;  4XK4 A;  2ECC A;  1X3Z B;  3FMR A;  3TP0 A;  1I6X A;  3DPU A;  2VKD A;  1JI8 A;  2LKS A;  2DMN A;  4RM3 A;  4HNV A;  1S3J A;  1W36 D;  1W5C C;  3D5L A;  1FOK A;  3KYD B;  2CFO A;  3HRU A;  2YU9 J;  2OQG A;  3T1B A;  3ZOB A;  3JW4 A;  1SVM A;  1OR7 C;  3I4M J;  1BIB A;  2E2I J;  4ZDL A;  1Z6R A;  2IS1 A;  1MNE A;  4I0B A;  3ZQL A;  3GEZ A;  5LGN A;  3K70 C;  4J19 A;  4KNY A;  2DMP A;  4GFB A;  3DCF A;  4HNU A;  4OU0 A;  5JFR A;  3G4S I;  3I54 A;  4I98 B;  4RS8 A;  1HDP A;  1Y8Q B;  1YTY A;  4CYC A;  2HVR A;  3QPT A;  4OIQ F;  1ETQ A;  4XKV A;  3BQY A;  4XL9 A;  2R7W A;  3ABU A;  3S1N J;  2HOE A;  4N9I A;  1J59 A;  4RGX A;  5CKT A;  1KZH A;  3WGI A;  1I1G A;  1IO2 A;  2YSR A;  2P5V A;  2A5W A;  3F0C A;  2M4K A;  2KKO A;  1GV2 A;  2G7U A;  3S2D J;  4CCN A;  5BS6 A;  5HNF A;  3JSP A;  2L4A A;  2XC7 A;  2EZH A;  1ZG1 A;  3FXJ A;  4WX9 A;  3F6V A;  3D1N I;  2VIX A;  4ZTF A;  1OYI A;  1YX5 A;  4CCM A;  3ABM H;  4CGZ A;  4KIG A;  4FHT A;  4YIR X;  1F43 A;  1XMA A;  5IOY A;  4HEA 2;  2OTL I;  1Y6I A;  4EJW A;  2ME6 A;  1JT0 A;  5FLV A;  4HA8 A;  4F93 B;  1V4R A;  2UV1 A;  3CCY A;  3MZH A;  3FK6 A;  2IW5 A;  2L9R A;  2XAF A;  3F8C A;  2C6Y A;  1ZH5 A;  1U2W A;  2KIF A;  1DUX C;  1DDN A;  2E2J J;  2PX9 A;  4BY1 J;  3Q9V A;  1QO0 D;  5ICC A;  1QZY A;  4IRG A;  5IT9 K;  4EQQ A;  2HVS A;  3DEE A;  5GPC A;  2EJR A;  4RB1 A;  1IN5 A;  1DU0 A;  2W84 A;  3BR6 A;  4Q4Z F;  3FMS A;  1WJB A;  5LD2 C;  4E7L A;  4ETS A;  4C2U A;  3HTU A;  2GAU A;  4CH7 A;  2DI3 A;  4ZZD A;  3ZCO A;  1G8X A;  5DDG A;  4EV0 A;  1KA8 A;  3KCC A;  4EM1 A;  4DYQ A;  1BA5 A;  1DPU A;  2ISY A;  3N05 A;  4KDP A;  4IVN A;  3O2P E;  1MMA A;  1QZE A;  2A6E F;  2VQG A;  3GBG A;  3FXQ A;  2GBY A;  3TW6 A;  1G3T A;  4RB0 A;  2X51 A;  4BE2 A;  1GLN A;  1SAU A;  2HZT A;  3BR3 A;  3CLQ A;  3AG4 H;  4PGH A;  2EA2 A;  4E4H A;  4E7K A;  1O3S A;  2KHM A;  4MHG A;  1HQC A;  2QUF A;  1YIJ I;  1Z67 A;  2NYX A;  3CP8 A;  2OTJ I;  2Y30 A;  4MQV A;  4FT8 A;  5JR3 A;  4ASN A;  1XSD A;  1J0R A;  1Y8R B;  1HKT A;  1TWA J;  2Y0M A;  3GYH X;  5L3D A;  4AC0 A;  3M1C A;  1Q1V A;  4BQA A;  1QPM A;  3DEU A;  3S16 J;  4YII A;  3LA2 A;  1WVR A;  3QPH A;  4A0X A;  4FX4 A;  4ENM A;  4CZC A;  3LSK A;  3SFI A;  4XOR A;  3TKY A;  3E5Q A;  2DA7 A;  3DF8 A;  2XUB A;  3JTH A;  2CQK A;  1EV7 A;  4XOT A;  5EDN A;  1Z3X A;  2OF7 A;  2IXS A;  3CJT B;  3BR0 A;  3R0A A;  3DLL F;  2L7M P;  2XF5 A;  2XPW A;  3WOD F;  1ZGA A;  3MZ8 A;  2JPB A;  3GTO J;  4CCL A;  3EUH A;  3GW2 A;  4XLA A;  3W6V A;  3VYS B;  3WG9 A;  4JX4 A;  4KYW A;  5D8K B;  2JA2 A;  3ZN0 A;  2L7K A;  2ZME C;  4IKF A;  3OYE A;  2XHK A;  4M6Y A;  2JMW A;  1UAA A;  3PJR A;  2WAQ N;  2BXY A;  4BDY A;  4E7J A;  3FHZ A;  2FSW A;  3K4M A;  3HOX J;  1J75 A;  2DXI A;  1S7O A;  1U9O A;  2ZNY A;  5JLX A;  1ZQ3 P;  2EH3 A;  2R93 J;  3GF2 A;  2VN2 A;  1B4A A;  4A3J J;  4Y15 A;  2M87 A;  1HDD C;  1LQ1 A;  1W0T A;  4RB2 C;  3BG9 A;  1R23 A;  2KRC A;  3ERE D;  4XMY A;  3C2H A;  2XB5 A;  2E19 A;  1U78 A;  3QQA A;  4GCV A;  1HW2 A;  4UUT A;  4BJ5 C;  1XX5 A;  3HSR A;  2XAG A;  1ZLJ A;  1JHF A;  2X1E A;  2H8R A;  2DCE A;  4BJT A;  4IHS A;  2BOL A;  2HS5 A;  1Z7L A;  1AKH A;  5IT9 Z;  2JQ7 A;  1I5Z A;  1YS6 A;  4IHY A;  5J6X A;  4BAC A;  2F2E A;  4R79 A;  3H0G J;  4HF1 A;  4S05 A;  3G73 A;  4LGW A;  5E8I A;  1ZLK A;  4OIO F;  1OJL A;  2GA1 A;  3S93 A;  3KLN A;  2H1L A;  3K6G A;  3MWM A;  2EFN A;  5C3E J;  4FET A;  3EET A;  3RKQ A;  3HZJ A;  4V2F A;  1LDJ A;  2H94 A;  3KP5 A;  3PL8 A;  2O7O A;  4HSR A;  4UXN A;  5K7Z A;  2V79 A;  3C2G A;  3IUO A;  3L7W A;  2FD5 A;  4LMY A;  2E71 A;  3JRD A;  4Y4R A;  1ZKG A;  2QQ9 A;  2WAE A;  2QZ8 A;  5LBQ A;  2JT1 A;  5GAG J;  2A68 F;  4LFU A;  1POG A;  2A07 F;  5DM6 F;  2LD5 A;  1ZYR F;  1WJA A;  1DU6 A;  5L3G A;  2VQC A;  1TW3 A;  4Y7N J;  3LSR A;  3OMY A;  3WU2 C;  3S15 J;  4HW0 A;  1TTY A;  5HVQ C;  3GFI A;  1OCO H;  1JUS A;  2OCE A;  4GYG A;  1T0F A;  2P5K A;  3W2W A;  3ZMS A;  2AXT C;  3FIW A;  1EKE A;  3HXL A;  3K10 A;  5E1Z B;  2X1C A;  2P6T A;  2BVL A;  4LG0 A;  4GO1 A;  2CMP A;  2KQR A;  2KZV A;  3RKY A;  1U8R A;  4OAZ A;  3RCO A;  3KYC B;  4PJJ A;  2CFX A;  5A2Q Z;  2EIJ H;  3N97 A;  1WJ5 A;  2FML A;  5EZG A;  3U9G A;  3WHB A;  2EFQ A;  2HWV A;  1GT0 C;  1VI0 A;  4K2E A;  1ZR4 A;  2FBH A;  2WC2 A;  4CYC B;  2IP2 A;  4NQW A;  2IVM A;  5M5X J;  2VBY A;  3VOD A;  1L0O C;  3CDH A;  3E6C C;  3TGN A;  3FXL A;  2BY3 A;  3L2U A;  1CF7 B;  1QPI A;  1PJR A;  3SZG A;  3GX4 X;  1IV8 A;  2F5D A;  4HOB A;  2IA1 A;  4HST A;  1ON2 A;  4XRS A;  1X1D A;  3NQO A;  3R4K A;  2O0Y A;  3I71 A;  3G71 I;  1YJ9 I;  2NS7 A;  3CTA A;  3VFZ A;  4D7M A;  2Y0S A;  3TOA A;  1IN7 A;  2ZME A;  4N4O B;  3KX2 A;  3K4C A;  2HKO A;  1T98 A;  1GVJ A;  5D5U B;  2WAD A;  4HBL A;  5EZH A;  1SEU A;  2XV4 S;  3P7N A;  4BHB A;  4N4N B;  1WJD A;  2DFF A;  4P5O A;  3PNT A;  1G6N A;  1HSJ A;  4M72 A;  2R7Q A;  1XGO A;  1G3S A;  1HA8 A;  1T39 A;  2IPQ X;  3SEZ A;  4KJZ A;  3ULQ B;  3IC7 A;  5E79 C;  3RTR A;  2OPT A;  2QSF X;  4YFK F;  3OY9 A;  3P9K A;  5ERI A;  3O6B B;  3VOE A;  3IL2 A;  2FJ1 A;  3IKT A;  2PBI A;  4UY8 I;  5HLI A;  2H27 A;  1R1T A;  1SFU A;  3DKW A;  3BPX A;  4LIT A;  5BMZ A;  3AL0 C;  3V7S A;  2XAJ A;  3G2B A;  5LRR A;  4HNT A;  1R7J A;  4MGR A;  3V7R A;  3OYK A;  3Q0V A;  4XLP F;  4BU2 A;  4RLF A;  1TC3 C;  3HOY J;  5HDG A;  3RYP A;  5K5O A;  2QBY A;  3V8J A;  3WGH A;  1SFK A;  3FXO A;  2W1O A;  2KFD A;  3NEU A;  2ICW G;  2XF6 A;  4U0W A;  2R7U A;  4ESB A;  2FQ3 A;  2FNP A;  2V6E A;  2IRF G;  5D5V B;  3DBR B;  4ZDO A;  3AKZ A;  1QZZ A;  1ZRD A;  4HF2 A;  1UG2 A;  3RQ4 A;  1X4O A;  4KIC A;  5LFA A;  4D7N A;  5K1Y A;  2FUG 2;  2VT3 A;  1B59 A;  2M8E A;  3IWF A;  1YI2 I;  2QYO A;  4WXH A;  4II2 A;  2GXG A;  3C18 A;  1T33 A;  4IOA F;  3IH2 A;  2HYJ A;  2MFZ A;  1JTX A;  2XB0 X;  5C44 J;  1ACI A;  1ZRC A;  1MD0 A;  2JA6 J;  3WGG A;  3GTK J;  4M3G A;  1LFB A;  2L7F P;  1X58 A;  2VE8 A;  3IKV A;  4M9S A;  2NRA C;  1XGS A;  5EEA A;  2L3D A;  4ON0 A;  1E17 A;  5ICG A;  3WTS C;  3J80 K;  3JRH A;  1X1P A;  1KON A;  1EJ9 A;  4A3L J;  3S3N A;  1SMY F;  3P9I A;  4BAY A;  4C3J J;  1H9G A;  1K7A A;  1HLV A;  2VQH A;  2A6H F;  2FBK A;  4ITV A;  3S32 A;  2I5U A;  1QHG A;  5EEH A;  2DTR A;  5L3B A;  1YS7 A;  1KQ9 A;  4XON A;  2KJC A;  4MFE A;  4RMN A;  5BNG A;  1FIA A;  2JSC A;  3QYE A;  4F7Z A;  3OYD A;  3K4B A;  1OCC H;  5F1J A;  5IOZ A;  4OIR F;  4GDF A;  1NG6 A;  3NWS A;  4Z6Y A;  2WBM A;  2EBI A;  2D2W A;  3LAP A;  2QEN A;  3Q0U A;  1S5L C;  4A5N A;  1N25 A;  1U9N A;  3K4L A;  3G6E I;  1TT5 B;  4HV6 A;  1N75 A;  1M1E B;  3QP6 A;  2HI3 A;  4EAT A;  1D5Y A;  2E2H J;  2RNJ A;  1ZG5 A;  2IT0 A;  1IRX A;  2A61 A;  2HTS A;  1YOV B;  3GXO A;  3B6A A;  3HEF A;  1MDM A;  1JHH A;  3KP3 A;  2VXD A;  4BQO A;  5JVT A;  2X1D A;  3WTZ A;  3JAM Z;  5FRO A;  2IS4 A;  4OOI A;  1JKO C;  1XMX A;  1XB4 A;  2O6G E;  3PQK A;  1FYL A;  2HDD A;  1UHW A;  1RUN A;  4YIF A;  2DOF A;  3S8P A;  4YEJ A;  1DPR A;  4HYE A;  3L00 A;  3EUA A;  3HDD A;  2VL8 A;  2V9V A;  3QYF A;  1TP4 A;  2JZY A;  3W2V A;  1YHQ I;  4KIB A;  3S1M J;  3HUG A;  3RKW A;  2DK8 A;  3UNG C;  4HX4 A;  3E5U A;  4UHT A;  5E18 F;  1MND A;  1A6I A;  3FM3 A;  5ILS A;  4XRF A;  2VC1 A;  3HYI A;  4PJ0 C;  4DGW B;  3RYR A;  3WTY C;  3CD6 I;  3GZ5 A;  2Y69 H;  3OYG A;  3K70 D;  1JGG A;  3BTL A;  1BW6 A;  2DA3 A;  2TRT A;  5CVJ A;  5IY5 H;  2FE3 A;  1IXS B;  3LA7 A;  1R71 A;  1W7P D;  3E3V A;  2V6C A;  2DJI A;  5BOX A;  4JYK A;  1Z21 A;  2M45 A;  3HG9 A;  2O8X A;  4HF0 A;  4IL6 C;  4IQJ A;  4KIT B;  4FTH A;  2IBD A;  1VQP I;  5GAD J;  3TDU C;  2R7D A;  2F4M B;  1WHU A;  3QYB A;  5K7F A;  2PMZ A;  3FKI J;  2FRH A;  3DXJ F;  2CQX A;  3CJR B;  2DYS H;  3S17 J;  4B09 A;  2X85 A;  3JSO A;  4KIS A;  1OPC A;  4Q47 A;  2O9L A;  3VDX A;  3H5A A;  2B9S A;  4A69 C;  4S0H B;  2FNA A;  2HGC A;  4XOP A;  4QPO A;  3DWL E;  4I01 A;  5LHI A;  3DU6 A;  1YQA A;  2W24 A;  3KEQ A;  3BT9 A;  2VB6 A;  1IF1 A;  2DOA A;  1WH7 A;  4BQQ A;  2YX7 A;  3MVP A;  1S7A A;  1ETW A;  5F0F A;  2K3F A;  2V1N A;  1ZG3 A;  4LIV A;  3SEQ A;  2VOP A;  1MBG A;  3ZN1 A;  4BKX A;  5E17 F;  1S29 A;  2RGV A;  1R9T J;  3OYM A;  3GTL J;  4ZJZ A;  3KP7 A;  2L01 A;  1IDY A;  3L2W A;  3HHG A;  2VPL A;  5CQE A;  3H3Z A;  1MBH A;  3DLA A;  4KA4 A;  1SAX A;  2CSO A;  1MBK A;  2K4J A;  3Q3S A;  3KZZ A;  3MFK A;  2R3S A;  4L9V A;  1YO5 C;  2HDC A;  3COA C;  3M7G A;  4HDU A;  2TDX A;  3KZI C;  1L3L A;  3PSF A;  2Q0O A;  1P7I A;  4DIQ A;  2LH9 A;  2VKH A;  4AUX A;  2XIG A;  4UB6 C;  3LSP A;  3QWL A;  4ZH4 F;  3H36 A;  1BR1 A;  2EIN H;  4IHV A;  3AG1 H;  3UKG A;  4EJT A;  1IZ1 A;  2RQQ A;  5DYM A;  3I4P A;  2DFI A;  1KU7 A;  1ETY A;  3LFU A;  5J47 A;  2CGP A;  2CG4 A;  3F8B A;  3DPT A;  1BC7 C;  1TWH J;  4ESF A;  1VQ8 I;  4DW6 A;  5HS9 A;  2LVS A;  1LB2 A;  3JRF A;  1RIO H;  3A0H C;  1DGR M;  3F72 A;  3BG3 A;  5IYC J;  3GWZ A;  3AG3 H;  5J4Y A;  5BPI A;  1W7P A;  1D5V A;  2IGK A;  2QCO A;  3WTV C;  5CLS A;  1D0Y A;  1I3A A;  3ZGK A;  3QPS A;  2W48 A;  1IJW C;  3GTM J;  4G7O F;  4E7I A;  3CC7 I;  2WAQ A;  3S2W A;  4JK1 X;  1REP C;  5KCM A;  1PDN C;  3ZQF A;  2AHQ A;  2A5Y B;  1FOX A;  2COM A;  4F91 B;  3QU6 A;  2EFW A;  3MD2 A;  4D5C A;  3T8R A;  2HQN A;  3OOU A;  5BQT A;  1OCP A;  5C4X J;  4RGR A;  1B8I A;  2ZKZ A;  1SD5 A;  4M71 A;  1ENH A;  4PJN A;  4UV9 A;  4EGY A;  1P4X A;  4II3 A;  3M3Y J;  2WWY A;  5TIS C;  3M8J A;  4DZJ A;  1K79 A;  1NTC A;  1OCZ H;  2RKH A;  2XRN A;  4OMZ A;  4HRI A;  2E1O A;  5FB2 A;  1HOM A;  1XCB A;  1UJ8 A;  1BW5 A;  3ZQC A;  3CUQ C;  2DT6 A;  1J5Y A;  1J2X A;  3F8M A;  3CO6 C;  2CW8 A;  3HGY A;  3TO7 A;  2W57 A;  1HCR A;  4A12 A;  1FBU A;  1F4K A;  1OKR A;  3L2C A;  3O8G A;  1QBJ A;  2WB1 A;  3TDZ C;  4I09 A;  2EZI A;  2X4H A;  1VQL I;  4JOM A;  2GXA A;  4KFC A;  4U7D A;  3PFI A;  5FLX K;  1Z77 A;  3GME A;  2XAS A;  2RNG A;  5LGT A;  4HX8 A;  3IV5 A;  2CH0 A;  3CF5 F;  2CUJ A;  5FKO A;  5K5Q A;  2GM4 A;  3G1O A;  5DD4 A;  3BOQ A;  3DQV C;  4G12 A;  1I27 A;  2ME0 A;  3LWF A;  3OV8 A;  3RI4 A;  3HOS A;  2LY9 A;  1FLI A;  4B8X A;  3HSF A;  4QPQ A;  4U7B A;  2DMQ A;  2ZJ2 A;  3ZXS A;  1Z3Y A;  5IYB J;  3ABT A;  2HYF A;  5FGM A;  4UVB A;  1TBX A;  3PIO F;  4A0Z A;  1W1W E;  1FP2 A;  1A35 A;  3RDI A;  3ZQQ A;  2L9N A;  1MJB A;  1W0U A;  2CV2 A;  3H9J A;  4MEY F;  4LK1 F;  2MSY A;  4BQN A;  1KQ0 A;  3P5J A;  4BBR J;  3Q9S A;  2NAZ A;  3HBL A;  3W6J B;  3FXR A;  2AS5 F;  1JTY A;  1ITY A;  3GFM A;  3OIO A;  3CCM I;  1ON1 A;  2MLK A;  3CCL I;  2M0C A;  2WTE A;  1VQ9 I;  3ZMU A;  3FMQ A;  2EV5 A;  2CQ7 A;  5E3M A;  3I59 A;  3ABK H;  1LKX A;  1H0M A;  1LPQ A;  1U6G A;  4LB6 B;  1T2K A;  1OLT A;  2LNB A;  4UNO A;  3GFL A;  3KYL A;  4F3Q A;  1F36 A;  4PK4 A;  4BDZ A;  3CUQ A;  1RI7 A;  2QGU A;  2KRH A;  2FA5 A;  5DCM B;  1XC5 A;  2QWW A;  5H2F C;  2B63 J;  3J7A O;  4A0Y A;  2Q2E A;  3ERM A;  2V4J C;  5KAI C;  1A5J A;  3LL7 A;  3ASN H;  3CDI A;  4GXO A;  3BJ6 A;  4XLE A;  1APL C;  1VQ4 I;  2GWR A;  2PG4 A;  2Y9Y A;  3RSN A;  3H9Q A;  2Z33 A;  4G6D A;  4FX0 A;  3C2B A;  3BJA A;  3FXU A;  2R7R A;  5EG0 B;  2P81 A;  2FXA A;  3CCE I;  2LLK A;  5DD8 A;  3DP7 A;  3DU5 A;  1NK2 P;  3JRG A;  4BXX J;  2CUE A;  4DBQ A;  5FD6 A;  5FRM A;  2L54 A;  2VQL A;  3TQN A;  2V9P A;  3TP3 A;  3CCV I;  2JVG A;  2ZME B;  1KYZ A;  1WJE A;  1G2H A;  2CQQ A;  1E3H A;  1XTA A;  3BR2 A;  5GTI C;  2R5Y A;  5LRS A;  4MLO A;  3WU1 B;  2ACJ A;  4C30 A;  4LLL A;  1V5E A;  1XDS A;  1MKM A;  2FQ4 A;  1FBS A;  3OS2 A;  2DOE A;  4ENJ A;  3L2R A;  4XR6 A;  3WU0 A;  1ETK A;  3M9A A;  1NH3 A;  4Y33 A;  2XGX A;  1K6Y A;  3KET A;  5L3E A;  4KUM A;  2M30 A;  3KE2 A;  2DW4 A;  2Z9O A;  3JRC A;  4WF2 A;  1LVK A;  3H5R A;  2VON A;  2O5R A;  3RZO J;  2RV8 A;  4I76 A;  4XSZ F;  5FFX A;  1T38 A;  3DKY A;  3OR1 C;  4RBO A;  3E6B A;  3PFY A;  1W5S A;  3K1M A;  4BY7 J;  5E1W A;  4YG2 F;  1VQ6 I;  1PUF A;  4CYD A;  3RZD J;  2KIS A;  5DM7 F;  1LEB A;  3QP5 A;  2VT2 A;  1RRJ A;  1R5I D;  5HS7 A;  2R7X A;  1ETV A;  2MAB A;  2VI6 A;  4CA0 A;  1JUM A;  3FX3 A;  4N9H A;  5CVU A;  2V1D A;  1TNT A;  1P6R A;  3KFW X;  4B47 A;  2WY8 Q;  3IP4 B;  3R6S A;  1Z9C A;  1FPQ A;  3ELK A;  1LDD A;  1QA6 A;  3WE3 A;  3LMM A;  1UCR A;  1YW7 A;  1K78 B;  2LF8 A;  4DJA A;  5CPR B;  1V55 H;  3A02 A;  1MH3 A;  1G59 A;  2M5W A;  2EWN A;  2QEX I;  2DA6 A;  3OIQ A;  3IRQ A;  1HW5 A;  2F48 A;  2OD5 A;  1XSX A;  3TO9 A;  4BHP A;  3B73 A;  2IGN A;  4M6X A;  1TW2 A;  4GYI A;  4HLX A;  3ECO A;  2X0L A;  3SZP A;  3E6D A;  3ZP5 A;  4OIP F;  4X1E A;  1SD7 A;  4A3G J;  1ORK A;  2XAH A;  5JI6 A;  3EPZ A;  5FKN A;  1SVL A;  2ZXH A;  1B72 A;  5H6Q A;  1ZAO A;  5DV5 A;  1FBQ A;  1MZB A;  2DFE A;  2R7O A;  3I53 A;  2XDV A;  2ZJP F;  2VBZ A;  1J9I A;  1H88 C;  4EM2 A;  1G3Y A;  4A3E J;  3I3L A;  5C4J J;  2ZNZ A;  1RC9 A;  1K78 A;  1XN7 A;  5IT3 A;  1QU3 A;  1RKW A;  3HIF A;  2FOK A;  2FOW A;  4L5J A;  1A31 A;  1D8K A;  1WCM J;  4BXU A;  5F0C A;  3CDL A;  2A3S A;  5EF6 A;  2M8G X;  2VPR A;  2LF7 A;  1TNS A;  2OBP A;  1C0W A;  1QVU A;  4LLN A;  2H1K A;  1LEA A;  3BTI A;  3HB9 A;  5F0H A;  1PUF B;  3KEO A;  2MD0 A;  2GIV A;  2WA0 A;  1MBE A;  5KHD A;  2X9D A;  5H20 A;  1K6O A;  5FLX Z;  1XGN A;  4F55 A;  3TL4 X;  4MTD A;  3K4N A;  4E7H A;  1JKP C;  1JKQ C;  4AIJ A;  1TLH B;  1WPK A;  2W25 A;  4LIU A;  1ZK8 A;  2Y9Z A;  3ASO H;  5J1U A;  4IZZ A;  2OCC H;  5IP9 J;  5HDK A;  2HU9 A;  2XKO A;  5CVV A;  1U5T A;  3U2R A;  1J09 A;  2IGM A;  4IOC F;  4NB5 A;  4ZYH A;  2HYG D;  4RA2 A;  5IPA A;  2ELK A;  1BBY A;  2R7V A;  2E36 A;  3FKJ A;  4RAF A;  2R7T A;  1YW9 A;  2PEX A;  2GZW A;  4GRI A;  2M34 A;  3C1D A;  2JUC A;  5GTH C;  2NXN B;  2JVH A;  3K0L A;  3U1K A;  1R6R A;  2YS9 A;  4IHW A;  5ILU A;  1ZTR A;  3DEW A;  1MJA A;  4XKB A;  3CCR I;  2HOA A;  1E2X A;  3L2Q A;  1D0X A;  4B3A A;  2K7L A;  4CZZ A;  2QSG X;  2EV0 A;  4ZYE A;  3FWE A;  3E1S A;  1JE8 A;  1HF0 A;  3ISP A;  3H0D A;  1ZEL A;  2CJJ A;  2L9V A;  4EJV A;  4E70 A;  3CLO A;  3J81 Z;  4CXF A;  1R22 A;  1FSE A;  3IWZ A;  3CCJ I;  2Z2S B;  1UHM A;  1NG7 A;  4P9F A;  4BS9 A;  1R1U A;  1R49 A;  3ZMZ A;  2IA2 A;  4XKW A;  3SFZ A;  1IV6 A;  1MMG A;  1MIJ A;  2Q1Z B;  4F92 B;  2MGQ A;  5IYD J;  1RPW A;  1U5T B;  1IG7 A;  5FJ8 J;  1ZR2 A;  1X3W B;  5J1Y A;  2LY1 A;  3F3X A;  2F5C A;  2JN6 A;  3OWT A;  4X6A J;  4XBF A;  1P7J A;  1RES A;  1ZGW A;  4N0B A;  1U0J A;  2QA4 I;  2XPV A;  4BUP A;  5TRD A;  2ZXJ A;  3R60 A;  2BHZ A;  2AO9 A;  2D45 A;  1VTN C;  5B5E C;  3CES A;  2F5E A;  1T56 A;  2Z5U A;  3OYC A;  1X19 A;  2STT A;  1WFX A;  2ZXW H;  4AD9 A;  3BP8 A;  1GXP A;  4U0Y A;  1X1C A;  5JLW A;  3F8N A;  4M3E A;  1AOY A;  1FY7 A;  2M2E A;  1RUO A;  1LE8 A;  4G7Z F;  2HXI A;  3M8E A;  3UR3 C;  3OYL A;  3HOW J;  1WWX A;  1FOY A;  1R1V A;  3IHU A;  3LSM A;  2A05 A;  3FBI B;  4L9J A;  1LJ9 A;  3PNY A;  2WV1 A;  4RM2 A;  2CUF A;  1S72 I;  1VQK I;  4JBA A;  3V4G A;  3ZMT A;  4L5I A;  4PUS A;  4EMS A;  2L5Q A;  3BRO A;  1MMN A;  2O3F A;  3CF2 A;  3VYT B;  4Y52 J;  2JA7 J;  3OYI A;  2X6Y A;  1XGM A;  2BY2 A;  2CRG A;  1H89 C;  4A93 J;  5J8F A;  1IRZ A;  2HPM A;  2JTV A;  4CHU A;  2ADU A;  5J1R A;  2BXZ A;  3M8F A;  4ENK A;  1IW7 F;  3MKL A;  4QIW N;  4UVA A;  2D1V A;  3PSI A;  2P7C B;  4I7H A;  4HPQ A;  2XVC A;  3EUH C;  3BLY A;  1U8B A;  2NVY J;  2CV1 A;  2PJR A;  4M73 A;  2F5V A;  3LSH A;  1Z05 A;  4HAM A;  2W7N A;  1FMV A;  2H09 A;  2FU4 A;  4ZYD A;  2RC4 A;  1GUU A;  2G0E A;  1FT9 A;  1IDZ A;  1X4P A;  4UUV A;  4MO7 A;  4BH9 A;  3HHH A;  4HDV A;  4A3F J;  5K7H A;  5KNL A;  2LRD A;  3DBH B;  4KMU X;  5B1B H;  1O57 A;  2CU7 A;  5FD5 A;  4ZDP A;  2QQB A;  2EZK A;  2VAS A;  1SMT A;  2KP6 A;  1ETX A;  1OMI A;  3CP2 A;  3ZQG A;  4PFO A;  1UMQ A;  3L09 A;  2DYR H;  1P92 A;  1P9Q C;  2E1N A;  3NWT A;  4AYB A;  3BTC A;  2OV7 A;  2PMU A;  1IGN A;  2LBF B;  2HPI A;  5F27 A;  3IAM 2;  1UEL B;  3BQZ A;  1A36 A;  5M3F J;  1OQY A;  1BJA A;  4L0Y B;  3H3U A;  5M3M J;  2L02 A;  5E3N A;  4DNC A;  3CME I;  4A2U A;  5FKK A;  1T0F C;  2Z99 A;  3IH3 A;  2JRM A;  3Q5F A;  5KVR A;  4BE0 A;  2ZB9 A;  3H1C A;  3ECH A;  2KJB A; 
#chains in the Genus database with same CATH homology
 3DFG A;  4KT5 C;  4KMF A;  1YYV A;  3GUD A;  2ELH A;  1F9N A;  5ICF A;  3F22 A;  2CYY A;  2BYV E;  5D5X B;  3REO A;  3RIR A;  2ZO4 A;  5LLQ A;  1W4M A;  1J7K A;  5F64 A;  2MC3 A;  1U3E M;  2J5O A;  2QVO A;  5D6E A;  5F1R A;  1KU2 A;  2QLZ A;  3WE2 A;  3CO7 C;  5DUK A;  1BI3 A;  5L3F A;  1KYW A;  4A6D A;  1P2F A;  2VC0 A;  3GFJ A;  1HKQ A;  2J5P A;  3F6O A;  1F5T A;  4ZZL A;  4P55 A;  4IRH A;  5LHH A;  2PMH A;  4QLC U;  2KIU A;  2RQP A;  1FYK A;  1IAW A;  2Y48 A;  3CUO A;  4EM0 B;  3P9C A;  4WCG A;  5L3C A;  4Q5S F;  1F1Z A;  3ROU A;  2OU2 A;  1Q1H A;  1EH6 A;  4LLG F;  1QNT A;  1YIO A;  2P5L C;  2DQL A;  4CIC A;  1HXD A;  1IRF A;  5CVI A;  2E7W A;  1Z91 A;  3FZV A;  3ZQ7 A;  4UVC A;  4ZYG A;  2XAQ A;  2MLG A;  4G8X A;  3QOP A;  2PI0 A;  1BN5 A;  2L4M A;  4MQ9 F;  4EJO A;  1ZHF A;  1XDU A;  3CUQ B;  1EH8 A;  5HS8 A;  1MGT A;  3EDP A;  6PAX A;  4KN4 X;  2G7H A;  2VE9 A;  2NNN A;  2HEO A;  2E1C A;  5HLH A;  2DPD A;  1LDK B;  5CJ9 A;  2ZCW A;  2BE5 F;  3MZY A;  4O3M A;  3R0J A;  2OZU A;  4H0E A;  4LB5 A;  1WI9 A;  4O5V A;  1NHA A;  3QU3 A;  5ICE A;  2K4B A;  1O3Q A;  1IN6 A;  1B6A A;  5JHU A;  2MBF A;  4M9Z A;  5AIP A;  1ZGJ A;  2DU9 A;  2PN6 A;  5AON A;  5DCM A;  1FSH A;  1HST A;  4RGU A;  2DT5 A;  2MH9 A;  4Y13 A;  1PUE E;  5DEQ A;  1YG2 A;  4O6J A;  3K69 A;  2FMY A;  3RPU A;  2NNY A;  3VB2 A;  5A2Q K;  4PGG A;  5D5W B;  4BYY A;  2B0L A;  2P8T A;  2H6C A;  4P9U A;  3MQ0 A;  2QQA A;  1SD4 A;  1R36 A;  1YFH A;  1TQI A;  2DLL A;  1ULY A;  1BI0 A;  2IJL A;  2XRO A;  1FC3 A;  3FM5 A;  1EH7 A;  2OZ6 A;  5LEK A;  2UXN A;  1FZP B;  1TQM A;  1FNN A;  2VBW A;  4L9T A;  4IJA A;  1XD7 A;  1PP8 F;  1B9N A;  2YR2 A;  1OYW A;  3KP6 A;  3I5U A;  2P7V B;  4KN7 X;  3KZY A;  1P4A A;  5LEJ A;  1XMK A;  4HV5 A;  1BOA A;  3SZT A;  3LQQ A;  2W85 A;  2BEO A;  2OQR A;  3W6K B;  2K02 A;  2QM3 A;  2MH2 A;  4I2O A;  5E8G A;  5FFZ A;  3JTG A;  5H6R A;  1ZRF A;  1Z1D A;  4G7H F;  5CVR A;  4AIH A;  1LNW A;  2O03 A;  4HX7 A;  4LG0 B;  5CYV A;  2YU3 A;  2OAZ A;  4EVI A;  4CO8 A;  2EK5 A;  2DBB A;  5HDN A;  3WTU C;  4YFX F;  1AWC A;  3EQL F;  1BC8 C;  1O7F A;  1GXQ A;  2ZBK A;  2BBY A;  2V1U A;  4LD5 A;  3PQJ A;  4WXD A;  3C7J A;  5LHG A;  1YW8 A;  1BI1 A;  3CJN A;  2VXZ A;  3QAH A;  1G4D A;  2FEZ A;  4IF4 A;  1UST A;  3GVA A;  2CO5 A;  2K27 A;  1MJ9 A;  4A6E A;  4D0P A;  4Z2Y A;  5BPD A;  1ONV A;  2K86 A;  4YFN F;  5D4R A;  1QGP A;  4AWX B;  5TJJ A;  3HRM A;  4WWC A;  3TO6 A;  2STW A;  3RKX A;  1HKS A;  1MDM B;  3I64 A;  1P4W A;  3BWG A;  3BDD A;  2DAO A;  2DO7 A;  3EYI A;  2LDU A;  2UZK A;  2ESN A;  3KP4 A;  4G9Y A;  3MCZ A;  2QBY B;  3U1D A;  5F6F A;  3R61 A;  2PLY A;  4L0Z B;  1IRG A;  5E1X A;  1BM9 A;  2IA0 A;  2VOD A;  1O3R A;  4XSX F;  5EEG A;  5E20 A;  2UXX A;  3N4M A;  4MTE A;  1FP1 D;  5DCF A;  4NHJ A;  4L18 B;  1HBX G;  3KLO A;  2GXB A;  1T6S A;  3KP2 A;  1CGP A;  5ED4 A;  3ZPL A;  2KRF A;  1BI2 A;  3DPL C;  1SFX A;  2RN7 A;  3F8F A;  1USS A;  1XSV A;  1R5G A;  2E7X A;  4R1H A;  3LQR A;  1ZRE A;  2EV6 A;  1UFM A;  3E6M A;  4P96 A;  1CF7 A;  2H6B A;  1A04 A;  1FWZ A;  2LSO A;  2FF4 A;  3IRR A;  1RNL A;  2VBX A;  3HSE A;  3K2Z A;  2UWM A;  2G9W A;  3GLX A;  3QRF F;  2AXL A;  2R7F A;  4RAZ A;  3E97 A;  2PQ8 A;  3ZMV A;  1Y0U A;  3C3W A;  2YPR A;  5D8L B;  4AIK A;  2VOO A;  2HQR A;  3G3Z A;  1SD6 A;  4A5M A;  1R5H A;  1W5T A;  3B02 A;  3J81 K;  2EA4 A;  4JQF A;  1ODD A;  4IPA A;  4RGS A;  1PP7 U;  4PDK A;  4KIF A;  3NRV A;  1IN8 A;  1KGS A;  1R00 A;  3E5X A;  2GA2 A;  3H92 A;  5HLG A;  5K5R A;  2F5F A;  1RZ4 A;  3I0T A;  4G94 A;  5HOO A;  3K9T A;  2LKP A;  2V1X A;  3T5X A;  3K1N A;  4IHT A;  2M1B A;  4CDG A;  2XKP A;  3LA3 A;  2JRT A;  3LAJ A;  4IRI A;  4BHC A;  2D1H A;  1ZN2 A;  4UV8 A;  5ILV A;  4EGZ A;  2ISZ A;  4Y17 A;  4L9N A;  1B1B A;  4HQE A;  4HZF A;  3BJO A;  2ESH A;  1IUY A;  2RDP A;  3WTX C;  4ENN A;  4ESJ A;  2CW0 F;  1TQP A;  2PFB A;  1XCV A;  4G6Q A;  3K1P A;  3MAJ A;  3I58 A;  2PJP A;  2DK5 A;  2JPC A;  5LGU A;  3F21 A;  4I02 A;  1SFE A;  1DP7 P;  4U88 A;  1U5T C;  1FYM A;  2HFH A;  3HOT A;  3SXY A;  2P4W A;  3LST A;  2OA4 A;  1D3Y A;  1G3W A;  4R8H A;  1OR7 A;  3I59 B;  2BV6 A;  3AAF A;  3RJP A;  1IXR C;  1KQ8 A;  3DV8 A;  5DUI A;  3EYY A;  1O3T A;  3HRT A;  4HQM A;  1JGS A;  1UB9 A;  5D4S A;  2DQR A;  5KK1 A;  2Z3Y A;  1KU3 A;  2CWE A;  2EB7 A;  4DQ2 A;  2YX4 A;  1BIA A;  5FO5 A;  2O61 A;  3GZ6 A;  4WXC A;  2DPU A;  3BPV A;  5D6F A;  1KU9 A;  1X3U A;  4LK0 F;  2RVC A;  3T8T A;  1IN4 A;  5J8C A;  3ML6 A;  2HKX A;  3L9F A;  4RB3 C;  4TV7 A;  1FX7 A;  2KIM A;  1Z6T A;  4Q48 A;  1D8J A;  1JXS A;  2HTJ A;  3OOP A;  1S6L A;  1WSU A;  3SHF A;  1HW1 A;  3HRS A;  3WTW C;  3O3K A;  3WTT C;  2MA3 A;  1WRJ A;  1LVA A;  4XLN F;  4OIN F;  3J80 Z;  2MD5 A;  3FF5 A;  3LFK A;  4I0A A;  1H9T A;  4OMY A;  4GGG A;  4AVP A;  1WKM A;  4WK8 F;  1Z7U A;  4M74 A;  3T0Y A;  2EFO A;  4MEX F;  3HTS B;  1R58 A;  1WQ2 A;  2P6S A;  4U0V A;  2Y75 A;  4S04 A;  1W7P B;  1ZAR A;  1YLF A;  2FBI A;  3BY6 A;  3MEX A;  3M1E A;  4QWQ A;  4HLY A;  3TOB A;  2EFP A;  1S8N A;  4BNC A;  2BGC A;  3D0S A;  2GQQ A;  2ETH A;  3V8K A;  2Q8K A;  2WV0 A;  3SQN A;  3RPQ A;  1O7L A;  4PZJ A;  4LJZ F;  2HR3 A;  4EJU A;  2A69 F;  4M9X A;  2ZFW A;  5AIQ A;  1I1S A;  3BZ6 A;  4RAY A;  3JAM K;  2NS0 A;  4IXA A;  1V3F A;  1B9M A;  4PCQ A;  3F23 A;  1OYY A;  1IXC A;  3ZMD A;  1QQI A;  1STZ A;  3V7C A;  3VEP A;  1GHC A;  3GO5 A;  3V8L A;  4MNU A;  3FMR A;  1I6X A;  1S3J A;  3D5L A;  1FOK A;  3HRU A;  2OQG A;  3T1B A;  3JW4 A;  1BIB A;  1Z6R A;  4I0B A;  3GEZ A;  5LGN A;  4KNY A;  5JFR A;  4OU0 A;  3I54 A;  4I98 B;  4RS8 A;  1YTY A;  3QPT A;  4OIQ F;  3ABU A;  2HOE A;  4N9I A;  1J59 A;  4RGX A;  3WGI A;  1I1G A;  2YSR A;  2P5V A;  2KKO A;  2G7U A;  5BS6 A;  3JSP A;  2L4A A;  1ZG1 A;  4WX9 A;  3F6V A;  1OYI A;  4CGZ A;  4KIG A;  4FHT A;  1XMA A;  4EJW A;  4HA8 A;  1V4R A;  3MZH A;  2IW5 A;  2XAF A;  3F8C A;  2C6Y A;  1ZH5 A;  1U2W A;  2KIF A;  1DUX C;  1DDN A;  3Q9V A;  1QO0 D;  5ICC A;  1QZY A;  4IRG A;  5IT9 K;  4EQQ A;  2EJR A;  4RB1 A;  1IN5 A;  2W84 A;  4Q4Z F;  3FMS A;  4ETS A;  3HTU A;  2GAU A;  2DI3 A;  4ZZD A;  5DDG A;  4EV0 A;  1KA8 A;  3KCC A;  4EM1 A;  1DPU A;  2ISY A;  4KDP A;  4IVN A;  3O2P E;  2A6E F;  3FXQ A;  1G3T A;  4RB0 A;  2HZT A;  4PGH A;  1O3S A;  2EA2 A;  4MHG A;  1HQC A;  2QUF A;  2NYX A;  4MQV A;  4FT8 A;  5JR3 A;  4ASN A;  1XSD A;  1J0R A;  1HKT A;  2Y0M A;  3GYH X;  5L3D A;  4BQA A;  1QPM A;  3DEU A;  4YII A;  3LA2 A;  3QPH A;  4A0X A;  4FX4 A;  4ENM A;  3TKY A;  3E5Q A;  3DF8 A;  2XUB A;  3JTH A;  2CQK A;  1EV7 A;  3R0A A;  3WOD F;  1ZGA A;  2JPB A;  3EUH A;  3GW2 A;  3WG9 A;  4KYW A;  5D8K B;  3ZN0 A;  2XHK A;  4M6Y A;  3FHZ A;  2FSW A;  1J75 A;  1S7O A;  2ZNY A;  3GF2 A;  2VN2 A;  1B4A A;  4Y15 A;  2M87 A;  1LQ1 A;  4RB2 C;  1R23 A;  3ERE D;  1U78 A;  4GCV A;  1HW2 A;  3HSR A;  2XAG A;  1ZLJ A;  1JHF A;  4IHS A;  2HS5 A;  5IT9 Z;  1I5Z A;  1YS6 A;  5J6X A;  2F2E A;  4R79 A;  4HF1 A;  4S05 A;  3G73 A;  4LGW A;  5E8I A;  1ZLK A;  4OIO F;  2GA1 A;  3KLN A;  3MWM A;  2EFN A;  3EET A;  1LDJ A;  2H94 A;  3KP5 A;  4UXN A;  2V79 A;  3L7W A;  4LMY A;  2QQ9 A;  2QZ8 A;  5LBQ A;  2JT1 A;  2A68 F;  4LFU A;  2A07 F;  1ZYR F;  5L3G A;  1TW3 A;  4HW0 A;  1TTY A;  5HVQ C;  3GFI A;  4GYG A;  1T0F A;  2P5K A;  3ZMS A;  5E1Z B;  2P6T A;  4LG0 A;  4GO1 A;  3RKY A;  1U8R A;  2CFX A;  5A2Q Z;  3N97 A;  2FML A;  3U9G A;  2EFQ A;  2HWV A;  4K2E A;  2FBH A;  2WC2 A;  2IP2 A;  4NQW A;  2IVM A;  2VBY A;  3VOD A;  1L0O C;  3CDH A;  3E6C C;  3TGN A;  1CF7 B;  3GX4 X;  2F5D A;  4HOB A;  2IA1 A;  1ON2 A;  3NQO A;  3R4K A;  2O0Y A;  3I71 A;  3VFZ A;  3CTA A;  3TOA A;  1IN7 A;  2ZME A;  2HKO A;  1T98 A;  1GVJ A;  5D5U B;  4HBL A;  2XV4 S;  3P7N A;  4BHB A;  4P5O A;  1G6N A;  1HSJ A;  4M72 A;  1XGO A;  1G3S A;  1T39 A;  2IPQ X;  3ULQ B;  3IC7 A;  3RTR A;  4YFK F;  3P9K A;  5ERI A;  3O6B B;  3VOE A;  3IL2 A;  3IKT A;  2PBI A;  5HLI A;  2H27 A;  1R1T A;  1SFU A;  3DKW A;  3BPX A;  5BMZ A;  3V7S A;  2XAJ A;  5LRR A;  1R7J A;  4MGR A;  3V7R A;  4XLP F;  5HDG A;  3RYP A;  5K5O A;  2QBY A;  3V8J A;  3WGH A;  3NEU A;  4U0W A;  4ESB A;  2FQ3 A;  2FNP A;  2IRF G;  5D5V B;  1ZRD A;  1QZZ A;  4HF2 A;  4KIC A;  5K1Y A;  2VT3 A;  1B59 A;  2M8E A;  3IWF A;  2QYO A;  4WXH A;  2GXG A;  3C18 A;  1ZRC A;  1MD0 A;  3WGG A;  2VE8 A;  3IKV A;  4M9S A;  2NRA C;  1XGS A;  2L3D A;  4ON0 A;  1E17 A;  5ICG A;  3WTS C;  3J80 K;  1SMY F;  3P9I A;  4BAY A;  1H9G A;  1K7A A;  2A6H F;  2FBK A;  5EEH A;  2DTR A;  5L3B A;  1YS7 A;  1KQ9 A;  2KJC A;  2JSC A;  4F7Z A;  4OIR F;  2D2W A;  3LAP A;  2QEN A;  4A5N A;  4HV6 A;  3QP6 A;  2RNJ A;  1ZG5 A;  2IT0 A;  2A61 A;  2HTS A;  3GXO A;  1MDM A;  1JHH A;  3KP3 A;  5JVT A;  3WTZ A;  3JAM Z;  4OOI A;  1XB4 A;  2O6G E;  3PQK A;  1FYL A;  1UHW A;  1RUN A;  4YIF A;  1DPR A;  4HYE A;  3L00 A;  2V9V A;  2JZY A;  4KIB A;  3HUG A;  3RKW A;  2DK8 A;  4HX4 A;  3E5U A;  4UHT A;  5E18 F;  3FM3 A;  5ILS A;  4XRF A;  2VC1 A;  3HYI A;  3WTY C;  3RYR A;  3GZ5 A;  5CVJ A;  2FE3 A;  1IXS B;  3LA7 A;  1W7P D;  3E3V A;  2V6C A;  5BOX A;  2M45 A;  4HF0 A;  2O8X A;  3TDU C;  2R7D A;  2FRH A;  3DXJ F;  4B09 A;  3JSO A;  1OPC A;  4Q47 A;  2FNA A;  2HGC A;  4I01 A;  5LHI A;  1YQA A;  2W24 A;  3KEQ A;  1IF1 A;  2YX7 A;  1S7A A;  1ZG3 A;  2VOP A;  3ZN1 A;  5E17 F;  1S29 A;  2RGV A;  3KP7 A;  2L01 A;  3HHG A;  3H3Z A;  4KA4 A;  1SAX A;  3MFK A;  2CSO A;  2K4J A;  3KZZ A;  2HDC A;  2R3S A;  4L9V A;  1YO5 C;  3COA C;  3M7G A;  4HDU A;  2TDX A;  1L3L A;  2Q0O A;  2XIG A;  4ZH4 F;  4EJT A;  1IZ1 A;  5DYM A;  3I4P A;  2DFI A;  1KU7 A;  2CGP A;  2CG4 A;  3F8B A;  3DPT A;  1BC7 C;  4ESF A;  5HS9 A;  1LB2 A;  1RIO H;  3F72 A;  3GWZ A;  5BPI A;  1W7P A;  1D5V A;  3WTV C;  5CLS A;  4G7O F;  3S2W A;  4JK1 X;  1REP C;  1PDN C;  2A5Y B;  2COM A;  3QU6 A;  2EFW A;  3T8R A;  2HQN A;  5BQT A;  4RGR A;  2ZKZ A;  1SD5 A;  4M71 A;  4UV9 A;  4EGY A;  1P4X A;  2WWY A;  1K79 A;  2RKH A;  2XRN A;  4OMZ A;  5FB2 A;  1XCB A;  3CUQ C;  1J5Y A;  1J2X A;  3F8M A;  3CO6 C;  3TO7 A;  2W57 A;  4A12 A;  1FBU A;  1F4K A;  1OKR A;  3L2C A;  1QBJ A;  3TDZ C;  4I09 A;  2X4H A;  4KFC A;  4U7D A;  3PFI A;  5FLX K;  2XAS A;  5LGT A;  4HX8 A;  5K5Q A;  5DD4 A;  3BOQ A;  3DQV C;  3RI4 A;  1I27 A;  3LWF A;  3OV8 A;  3HOS A;  1FLI A;  4B8X A;  3HSF A;  4U7B A;  2ZJ2 A;  3ABT A;  2HYF A;  5FGM A;  4UVB A;  1TBX A;  4A0Z A;  1FP2 A;  3RDI A;  1MJB A;  4MEY F;  4LK1 F;  1KQ0 A;  3Q9S A;  2NAZ A;  3W6J B;  3FXR A;  2AS5 F;  3GFM A;  1ON1 A;  2MLK A;  2WTE A;  3ZMU A;  3FMQ A;  2EV5 A;  3I59 A;  1H0M A;  1U6G A;  4LB6 B;  1T2K A;  2LNB A;  4UNO A;  3GFL A;  3CUQ A;  1RI7 A;  2FA5 A;  5DCM B;  2QWW A;  3J7A O;  4A0Y A;  2Q2E A;  4GXO A;  3BJ6 A;  2GWR A;  2PG4 A;  2Z33 A;  4G6D A;  4FX0 A;  3FXU A;  3BJA A;  2FXA A;  5DD8 A;  3DP7 A;  5FD6 A;  2L54 A;  3TQN A;  2ZME B;  1KYZ A;  5LRS A;  3WU1 B;  2ACJ A;  4LLL A;  1XDS A;  1MKM A;  1FBS A;  4ENJ A;  3WU0 A;  3M9A A;  2XGX A;  3KET A;  5L3E A;  4KUM A;  2M30 A;  3KE2 A;  2DW4 A;  2Z9O A;  4WF2 A;  2VON A;  2RV8 A;  4XSZ F;  5FFX A;  1T38 A;  3E6B A;  1W5S A;  3K1M A;  5E1W A;  4YG2 F;  4CYD A;  1LEB A;  3QP5 A;  2VT2 A;  5HS7 A;  3FX3 A;  4N9H A;  5CVU A;  2V1D A;  1TNT A;  1P6R A;  3KFW X;  3R6S A;  1Z9C A;  1FPQ A;  3ELK A;  1LDD A;  3WE3 A;  1UCR A;  1YW7 A;  1K78 B;  2LF8 A;  2M5W A;  2EWN A;  3IRQ A;  1HW5 A;  2OD5 A;  3TO9 A;  1XSX A;  4BHP A;  3B73 A;  4M6X A;  1TW2 A;  4GYI A;  4HLX A;  3ECO A;  2X0L A;  3SZP A;  3E6D A;  3ZP5 A;  4OIP F;  1SD7 A;  2XAH A;  5JI6 A;  5H6Q A;  1ZAO A;  5DV5 A;  1FBQ A;  1MZB A;  3I53 A;  2VBZ A;  1J9I A;  4EM2 A;  1G3Y A;  2ZNZ A;  1K78 A;  1XN7 A;  5IT3 A;  3HIF A;  2FOK A;  4L5J A;  1D8K A;  4BXU A;  2A3S A;  2LF7 A;  1TNS A;  2OBP A;  1C0W A;  4LLN A;  1LEA A;  3KEO A;  2GIV A;  5H20 A;  1K6O A;  5FLX Z;  1XGN A;  4MTD A;  4AIJ A;  1TLH B;  2W25 A;  5HDK A;  2XKO A;  5CVV A;  1U5T A;  3U2R A;  4NB5 A;  4ZYH A;  2HYG D;  1BBY A;  1YW9 A;  2PEX A;  2GZW A;  3C1D A;  3K0L A;  5ILU A;  1MJA A;  1E2X A;  2K7L A;  4CZZ A;  2EV0 A;  4ZYE A;  3FWE A;  1JE8 A;  3ISP A;  4EJV A;  4E70 A;  3CLO A;  3J81 Z;  4CXF A;  1R22 A;  1FSE A;  3IWZ A;  1UHM A;  4P9F A;  1R1U A;  3ZMZ A;  2IA2 A;  3SFZ A;  1U5T B;  3F3X A;  2F5C A;  4XBF A;  4N0B A;  5TRD A;  2ZXJ A;  3R60 A;  2D45 A;  1VTN C;  2F5E A;  2Z5U A;  2STT A;  4AD9 A;  3BP8 A;  1GXP A;  4U0Y A;  3F8N A;  1AOY A;  1FY7 A;  1RUO A;  4G7Z F;  3M8E A;  1WWX A;  1R1V A;  3IHU A;  4L9J A;  1LJ9 A;  4JBA A;  3V4G A;  3ZMT A;  4L5I A;  4EMS A;  3BRO A;  2O3F A;  1XGM A;  5J8F A;  2JTV A;  4CHU A;  2ADU A;  3M8F A;  4ENK A;  1IW7 F;  4UVA A;  2D1V A;  2P7C B;  4I7H A;  2XVC A;  4M73 A;  1Z05 A;  4HAM A;  2H09 A;  2FU4 A;  4ZYD A;  2RC4 A;  1FT9 A;  4UUV A;  4BH9 A;  3HHH A;  4HDV A;  4KMU X;  1O57 A;  5FD5 A;  2QQB A;  1SMT A;  1OMI A;  3L09 A;  1P92 A;  2E1N A;  2PMU A;  1BJA A;  4L0Y B;  3H3U A;  2L02 A;  4DNC A;  4A2U A;  2Z99 A;  3Q5F A;  5KVR A;  3ECH A;  2KJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...