2G9WA

Crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
119
Chain Sequence
b'KLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMAVLQRLAKKNLVLQIRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
molecule tags Dna binding protein
source organism Mycobacterium tuberculosis
publication title Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis
pubmed doi rcsb
total genus 37
structure length 119
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g9wA01
3KLNA 1FYKA 3JTHA 2KJBA 1V3FA 3E97A 1FPQA 1FYMA 4L9VA 4I0AA 1ZAOA 4L9JA 4CICA 4L0YB 1O7LA 3FF5A 1F4KA 5A2QZ 3COAC 5K1YA 4HV6A 5CVIA 5ILSA 4ESFA 3ZPLA 2OQRA 5ERIA 3HOSA 4M6YA 4JBAA 4M74A 1EH6A 4MQ9F 3P7NA 1S6LA 4ZYEA 1YLFA 1QGPA 4OOIA 1HBXG 1I5ZA 2FMYA 4LLLA 2OZ6A 3G73A 2H6CA 5J6XA 3GZ5A 3C18A 1W7PD 3AAFA 1LEAA 2CW0F 3IHUA 1R5HA 4EJVA 5D5UB 2ZCWA 1PP8F 1DDNA 2DBBA 2JPBA 1YYVA 4IVNA 2HS5A 4WXDA 5ICFA 2PLYA 2F5EA 4KN4X 2OZUA 1U2WA 1KU7A 3L9FA 3L00A 1I1GA 1I27A 3JAMK 3J81K 2QBYA 3R61A 2XGXA 4OMYA 1YQAA 2Z9OA 3HSRA 2BGCA 1FZPB 2MLKA 1B9MA 4B8XA 2EA4A 3TDUC 2QBYB 4HX8A 1W4MA 2G7HA 2A07F 2DW4A 3J81Z 2XV4S 2JTVA 4I0BA 4LG0A 3SZTA 5JHUA 5DUKA 1BIAA 3HRTA 1O3QA 3BWGA 2WV0A 3ULQB 4WK8F 2YSRA 1LDDA 4HA8A 2Y0MA 3IWZA 1ZARA 4Q5SF 1TQIA 5JR3A 4HF1A 4BHCA 4L18B 5BPIA 4CZZA 3I0TA 1TQPA 4MGRA 2Z33A 4LD5A 3OOPA 2RNJA 3TKYA 3CJNA 2PJPA 2HFHA 5JFRA 3RKXA 1ZRCA 1MGTA 2EA2A 4EM2A 3MWMA 3V8KA 5FFZA 4Y17A 4ZYHA 2OU2A 2A3SA 4LFUA 2ZFWA 3GFMA 4GYIA 4ZZLA 5LGTA 5DDGA 2A6HF 3BZ6A 2Z3YA 1BI2A 1S7AA 5F6FA 3BY6A 3BJAA 5JI6A 2NS0A 4HDVA 2D2WA 4AD9A 1FBUA 4G8XA 4KT5C 2CQKA 5L3DA 1R1UA 1F1ZA 3L09A 3R0AA 1IUYA 2DK8A 3QP6A 3WU1B 1XGOA 1IZ1A 1KQ0A 5HS9A 4ESJA 5K5RA 1C0WA 3M8FA 3RIRA 1DUXC 4I98B 1WKMA 4IPAA 2M87A 1FSHA 2ESHA 2MA3A 2FE3A 1FC3A 4U0WA 2L01A 5DEQA 5HLIA 1J0RA 4ETSA 3MEXA 3HRSA 1T6SA 2QUFA 5AIPA 4WCGA 5LGUA 5HDGA 5H6QA 1ZYRF 2YU3A 5LBQA 4EM0B 3WE3A 4IRGA 3V4GA 2IA1A 4DQ2A 3RKYA 1DPUA 2PMUA 1B59A 2F2EA 1P92A 1FSEA 1RUOA 4G6QA 2E7WA 4CDGA 4WXCA 1Z05A 2BEOA 2HKOA 5LHIA 1SFUA 4A12A 2LSOA 5KK1A 2VBWA 1IXCA 4XLPF 3VEPA 1YIOA 4L9TA 1P4AA 1U5TC 3IC7A 3MFKA 3IWFA 3LAJA 2RKHA 1U6GA 2RDPA 1JXSA 3W6JB 2GIVA 3IKVA 5FD5A 4HDUA 1QBJA 1X3UA 1FBSA 3ABTA 2FF4A 1H0MA 1D3YA 4AIKA 2COMA 1OYWA 2ADUA 3WGGA 3K1NA 4Q48A 5FO5A 4BXUA 4LG0B 2ZKZA 2ACJA 1DP7P 2B0LA 1OR7A 1BI3A 2JT1A 1STZA 1A04A 3T5XA 3EYIA 3QPHA 2EFPA 1JE8A 1SD4A 2MBFA 4GGGA 2GA1A 5HLHA 4JK1X 4O5VA 4U0YA 3GFLA 4Z2YA 5DYMA 3VFZA 4OMZA 3E3VA 3RI4A 1D5VA 1G3WA 4R8HA 2JZYA 2GWRA 3GFJA 2VODA 5HDNA 4HF0A 1JGSA 5DD4A 3K69A 4N0BA 2K4BA 2QWWA 5FLXK 3FM3A 2IPQX 3TDZC 1CF7A 2W24A 2VONA 4GXOA 3CO7C 1LVAA 2PFBA 5ILUA 2QQBA 2Y75A 2NNNA 1S29A 2OAZA 3SZPA 3CUQB 1UHWA 5K5OA 1EH8A 1E17A 3ZMSA 2L4AA 1YFHA 4CO8A 5HS7A 2HKXA 4P5OA 2IW5A 2HYGD 1AWCA 2HYFA 4KUMA 5ICEA 4M73A 1TW2A 1J59A 4EGYA 1Z6TA 2ESNA 4TV7A 3LSTA 4IHSA 2EV0A 2K86A 4ENMA 2K4JA 1ZRDA 4KIBA 5FGMA 5CYVA 4ZYGA 5DCFA 2HQNA 3KZZA 3U1DA 1I1SA 1AOYA 2ZO4A 3P9CA 1R23A 3HSFA 2Y48A 3L7WA 3WTZA 3F8BA 1S8NA 1ZLJA 3BP8A 1V4RA 1PDNC 1HW1A 3HTSB 1IN7A 1K78B 1IN8A 4L9NA 2STWA 4A6EA 1MJBA 3TO9A 2MH2A 2O8XA 2M1BA 5ED4A 2M5WA 2GAUA 1XGSA 4L5JA 4EVIA 3H3ZA 4EV0A 5HDKA 4ESBA 3JAMZ 1UHMA 2FU4A 2X0LA 2P8TA 1LDKB 2CYYA 3L2CA 2P5KA 2EK5A 3KE2A 2V1XA 2LNBA 4M9XA 4S04A 3F23A 4GO1A 5CVVA 2PN6A 1K7AA 2XAJA 1KU9A 1SD5A 3P9KA 2M8EA 5D6EA 3GW2A 3FMRA 3I54A 2D1HA 3F6OA 3ELKA 2F5DA 4N9HA 3GYHX 4HBLA 1PUEE 2XVCA 3KZYA 2FNAA 1Z6RA 2P7CB 2V1DA 5F64A 2IVMA 5D5VB 2G7UA 3F8FA 3REOA 1FOKA 2FA5A 5F1RA 2W25A 4UXNA 2FOKA 2EWNA 3QP5A 5E1XA 4HLYA 1HKQA 1HW5A 2HTSA 3QU6A 3ZMDA 1JHHA 2VT2A 4H0EA 3HSEA 1GHCA 2M30A 1XDUA 1H9GA 2Q0OA 2GQQA 4M9ZA 1KQ9A 2FBIA 3SQNA 4IHTA 2OD5A 1W7PA 1ZG5A 1E2XA 5LHHA 4AIJA 2HZTA 3KCCA 4RGRA 3WE2A 4EJUA 1XD7A 2LKPA 3WTSC 3LAPA 3O6BB 1R22A 2D1VA 2GA2A 1ZH5A 4G94A 1TBXA 3LA7A 4U7DA 3V7SA 3EYYA 3C3WA 3EETA 2ETHA 4YFNF 3BROA 3F21A 4G9YA 1IN5A 3I71A 1TLHB 4KA4A 3ISPA 1CGPA 3C7JA 4MEXF 3RYRA 1QPMA 1K78A 3GZ6A 1P4WA 4RB2C 4QLCU 4IRHA 3T1BA 3K9TA 4MHGA 1YO5C 3CUQC 2L02A 3K0LA 4GCVA 1ZREA 4NHJA 4B09A 1Y0UA 1G4DA 1F9NA 1OMIA 3O3KA 4YIIA 1IN4A 2KIFA 4I7HA 1GVJA 5L3EA 3I64A 4ENNA 5E1ZB 2VC1A 1SFEA 2O6GE 5DUIA 3KETA 4U7BA 1R1VA 4EGZA 1EV7A 2K27A 1BI0A 3CUOA 5J8FA 1LB2A 5CVUA 2MD5A 1QNTA 5BMZA 1RNLA 1R7JA 5DCMA 1OPCA 1HSTA 1ONVA 2EV5A 2E1CA 1ZN2A 1R5GA 1UB9A 5ICGA 2YPRA 3T8RA 1O3TA 5ILVA 3QRFF 4EJTA 3V7CA 3M7GA 3JTGA 3I5UA 1KU2A 4YIFA 2X4HA 3V8LA 4MTEA 4A0YA 3I58A 2LDUA 2Q2EA 4MTDA 4AIHA 2F5FA 2CWEA 1LNWA 1U3EM 1RIOH 4A0XA 3KEQA 5CLSA 3N4MA 3DFGA 3VODA 3KP7A 2ZBKA 1SMTA 3R4KA 3KP2A 1ON1A 5D4RA 4HX4A 5L3GA 1FT9A 2GXGA 3VB2A 3V7RA 3F6VA 3GWZA 3I59A 4WF2A 1Z9CA 2OA4A 1W5SA 4HZFA 2F5CA 3ZMUA 2P4WA 5CVRA 4BQAA 1R00A 2P5LC 1O7FA 4MNUA 1XSXA 4UHTA 5D8LB 3GVAA 2FBHA 1U5TB 3WTXC 1IRGA 1ZG3A 5BS6A 3ZMZA 2EV6A 2O0YA 4N9IA 2OQGA 2VE8A 4CHUA 1Z91A 3FM5A 4ZYDA 2R7FA 3BJOA 5HS8A 2QM3A 1YS7A 4Q47A 3TGNA 5HVQC 3NQOA 5EEGA 1BM9A 3ZN0A 3CDHA 3RPUA 3MQ0A 3K1PA 5D6FA 3F8CA 1RUNA 4HQMA 5TRDA 2J5OA 4CXFA 5AONA 2V6CA 1LEBA 4M9SA 5DD8A 2P5VA 5JVTA 4HLXA 4OINF 1P4XA 2HWVA 1F5TA 2W57A 3CLOA 2WC2A 2KIMA 3DEUA 5E8IA 2VOOA 3QAHA 4LMYA 3Q9SA 3R6SA 5FB2A 4XRFA 2K7LA 3WTYC 1FNNA 4UNOA 3CTAA 1ZHFA 3VOEA 2Z5UA 2R3SA 5LLQA 3I59B 3IKTA 4IXAA 2PBIA 2MLGA 4BAYA 1XN7A 1WWXA 4WWCA 3HYIA 2XASA 2DPDA 5LHGA 2QQ9A 1YG2A 2RN7A 4HQEA 1GXQA 3ECOA 3FXQA 3GEZA 4OU0A 2O03A 1YS6A 3ML6A 3WGIA 1FP1D 4ASNA 3ZMTA 4U0VA 2AS5F 3KP4A 4P96A 5D8KB 4AVPA 3ECHA 2IA0A 4KNYA 4I02A 1TNTA 3EQLF 1MKMA 5BPDA 2KJCA 4O6JA 2XAQA 4A2UA 4IF4A 2Z99A 4R79A 3CO6C 4BHPA 3ERED 4BH9A 2JSCA 3HUGA 1REPC 4R1HA 4LK0F 5L3BA 2QVOA 4PDKA 3ZQ7A 2ELHA 3GF2A 2VBYA 3G3ZA 4RB0A 2O61A 1UFMA 1B6AA 1QZYA 3CUQA 4UVBA 1HKSA 3RTRA 1QQIA 5D4SA 3GO5A 3KP5A 4UVCA 2D45A 2A5YB 1JHFA 3EDPA 2ISZA 3JSPA 1RZ4A 1O3RA 3KLOA 3MAJA 1Q1HA 3E5QA 2W84A 4GYGA 2KKOA 3WGHA 1HXDA 1MJ9A 5FLXZ 2AXLA 3PFIA 2ZMEA 1GXPA 1XCVA 1SD7A 3P9IA 3QOPA 1MDMA 2YX7A 2R7DA 4HX7A 4OIRF 5IT9K 1G3TA 4XSZF 3TQNA 3F3XA 2XKOA 4RAYA 2TDXA 1ZRFA 2ZNYA 2BV6A 4PGGA 6PAXA 3T8TA 5K5QA 1J7KA 3LWFA 1B4AA 1BIBA 3C1DA 1LDJA 5BOXA 3HIFA 2O3FA 4XBFA 3MZYA 4PGHA 3FHZA 4BNCA 3BOQA 4KICA 1J2XA 1BI1A 1KGSA 3WU0A 1FYLA 2VOPA 5AIQA 1LJ9A 4D0PA 3BJ6A 1ZGAA 2XAGA 2FXAA 1CF7B 3GUDA 4QWQA 4HV5A 4M6XA 4S05A 5LGNA 2DU9A 2EJRA 5ICCA 2XAFA 5IT9Z 2A69F 4HAMA 2UXNA 5H6RA 1UCRA 2ZJ2A 2ZNZA 3FXRA 4LLGF 1ZLKA 3WTVC 2NAZA 4KYWA 4YFKF 4I09A 4KIFA 3DPTA 3NRVA 2EFQA 3WTWC 4M72A 3RYPA 1KU3A 5BQTA 4G7OF 1XSDA 1R36A 1WSUA 4EM1A 1T98A 1WQ2A 4UUVA 2HTJA 1IXRC 5CVJA 3SFZA 4RB1A 1B1BA 1TNSA 1P6RA 1SMYF 3F8NA 3JSOA 2VXZA 2MH9A 2UWMA 5FD6A 1XGMA 1IN6A 2NRAC 1YW7A 2MC3A 2VN2A 3MCZA 3WODF 3V8JA 5HLGA 3I53A 1ULYA 2H09A 3HRMA 3LA3A 2XRNA 2DQLA 1J9IA 2YX4A 2VC0A 3E6CC 3J7AO 3PQKA 1J75A 3NEUA 3TO7A 2QZ8A 2W85A 2OBPA 1G3SA 2P6SA 3U9GA 4EQQA 1W7PB 1IW7F 1KYZA 4CGZA 2M45A 2PEXA 2QQAA 2FBKA 3FMQA 3QU3A 2V1UA 3ZN1A 4EJOA 2RC4A 4HW0A 2H94A 4HOBA 4KN7X 1T0FA 5HOOA 4P55A 3FX3A 4ENJA 1FP2A 2FMLA 4A6DA 4KIGA 3GXOA 1T38A 2L3DA 4YFXF 2EFNA 1NHAA 2CO5A 2BBYA 1D8KA 5LEKA 1ZG1A 1RI7A 2CFXA 5L3FA 3DXJF 2UZKA 3EUHA 2DPUA 4BYYA 4UV8A 2FQ3A 2IRFG 2EB7A 1J5YA 2H27A 5LRRA 2FSWA 4RGXA 1BJAA 3TOAA 3WG9A 1I6XA 4FHTA 3LQRA 2KRFA 4JQFA 3J80Z 2ZMEB 1QO0D 3R60A 3WTUC 2LF8A 2HOEA 1XB4A 2CGPA 1TQMA 3ZP5A 2DI3A 1MD0A 4PZJA 4KMUX 3HOTA 1Z1DA 1XGNA 5TJJA 3SHFA 4ZZDA 2XUBA 2HQRA 5E20A 1S7OA 1BC8C 1FLIA 1FX7A 3HHHA 1IRFA 1IF1A 1HW2A 4K2EA 1DPRA 4IRIA 1TW3A 4DNCA 5D5WB 1S3JA 2DK5A 2DO7A 3U2RA 4KDPA 5FFXA 4YG2F 2STTA 1SFXA 3D0SA 2HGCA 3E6MA 1Z7UA 3M1EA 4WX9A 2XAHA 3BDDA 4CYDA 2IT0A 2A61A 4LGWA 1BBYA 3J80K 1K79A 2VBZA 4A5MA 4M71A 2GXBA 3HTUA 1IAWA 2P7VB 3IL2A 3E5UA 3LA2A 2PQ8A 3FWEA 2L54A 3E6DA 1LQ1A 2IP2A 2Q8KA 1MZBA 1KQ8A 3FMSA 1FWZA 3S2WA 1KYWA 4EJWA 4KMFA 4KFCA 1R1TA 3QPTA 2VBXA 1SAXA 3F8MA 4LJZF 4ZH4F 3K2ZA 3KEOA 3M8EA 2HDCA 4I01A 4L5IA 3GFIA 1YTYA 3DF8A 3LFKA 4I2OA 4FT8A 2E1NA 4LLNA 4F7ZA 2WWYA 1U5TA 3ZMVA 3RPQA 3RJPA 3E6BA 3IRRA 2BE5F 4OIQF 2A68F 4LK1F 2ISYA 2RGVA 4A5NA 4ENKA 2YR2A 4LB5A 3HRUA 5LRSA 4Y13A 1FY7A 2IJLA 2GZWA 4U88A 4G7ZF 2K02A 1PP7U 3W6KB 3Q5FA 1W5TA 4FX4A 2EFOA 3R0JA 1T39A 1WI9A 3SXYA 3K1MA 1USSA 2DTRA 4P9FA 2WTEA 2CSOA 3E5XA 3FXUA 2XHKA 4PCQA 1BC7C 1XDSA 5E18F 1OYYA 2ZXJA 2PI0A 1USTA 2FRHA 2V9VA 4ON0A 4UVAA 4WXHA 4FX0A 2BYVE 3DKWA 3F22A 3GLXA 5D5XB 3KFWX 1SD6A 4OIPF 2G9WA 4LB6B 4RGUA 1WRJA 2PG4A 3TO6A 5E1WA 5DV5A 3TOBA 3Q9VA 5DCMB 3B02A 1L0OC 1XMKA 3PQJA 1O57A 3OV8A 1MJAA 2HR3A 3ROUA 2DFIA 2VT3A 2P6TA 3MZHA 2XIGA 2IA2A 1FBQA 2CG4A 3GX4X 3IRQA 1XSVA 3BPVA 2H6BA 4MEYF 4NB5A 2HEOA 1OYIA 5L3CA 1D8JA 1G6NA 5EEHA 1QZZA 1O3SA 5J8CA 4A0ZA 2JPCA 1ZGJA 3DP7A 2DQRA 2XROA 2QLZA 1HQCA 3M9AA 3F72A 1ODDA 1U78A 2FNPA 1BN5A 2NNYA 3KP3A 4XLNF 1OKRA 1TTYA 2QYOA 5IT3A 3O2PE 4XSXF 1BOAA 4RGSA 1EH7A 2KIUA 4E70A 1H9TA 4RB3C 4BHBA 1R58A 2E7XA 2NYXA 3ABUA 3FZVA 5LEJA 3RDIA 5E8GA 4L0ZB 4O3MA 4G6DA 1HKTA 3RKWA 3DPLC 4Q4ZF 3D5LA 1U8RA 3WTTC 2C6YA 2FEZA 2UXXA 3I4PA 1HSJA 2VE9A 1G3YA 2DAOA 1P2FA 3DV8A 3H92A 1VTNC 4NQWA 3JW4A 1IXSB 1XCBA 2EFWA 5H20A 1ON2A 1K6OA 5CJ9A 1L3LA 3B73A 2PMHA 4MQVA 1YW9A 3T0YA 5E17F 2V79A 3KP6A 4P9UA 4OIOF 5KVRA 4UV9A 4AWXB 3LQQA 2RVCA 1KA8A 2DT5A 4RS8A 4HF2A 1T2KA 2RV8A 4HYEA 2J5PA 4Y15A 1XMAA 2LF7A 2DLLA 2XKPA 2L4MA 4EMSA 3HHGA 2QENA 1MDMB 1B9NA 2RQPA 5A2QK 4IJAA 4G7HF 2JRTA 4RAZA 3BPXA 1YW8A 3H3UA 2A6EF 3DQVC 3N97A
chains in the Genus database with same CATH superfamily
3KLNA 1FYKA 3JTHA 1OLTA 1V3FA 2KJBA 3KEYA 1GT0C 3E97A 2V7FA 2ZB9A 2ID3A 1FPQA 1FYMA 2M4KA 4L9VA 1S9HA 4I0AA 1ZAOA 3OYFA 4L9JA 5E79C 2VQLA 2L9SA 2X6XA 4CICA 4L0YB 1ORKA 1O7LA 3FF5A 5E3MA 1F4KA 3S16J 2EINH 5A2QZ 1WJAA 2KLOA 2Z2SB 2UV1A 4QIWN 3COAC 5K1YA 4HV6A 5CVIA 1A31A 1HOMA 4FQGA 2AXTC 3QODA 2HVQA 5ILSA 4ESFA 3ZPLA 2OQRA 5ERIA 3K6GA 3HOSA 4M6YA 2KISA 3OYKA 2JA6J 3OR1C 3ABKH 2ID6A 1X3ZB 4E7JA 4JBAA 1GUUA 3CJRB 4A3FJ 4M74A 4RBOA 1EH6A 4MQ9F 3P7NA 1OCCH 1S6LA 3G1MA 1YLFA 4ZYEA 1K4SA 1VQ9I 1QGPA 4DBRA 3E7LA 4OOIA 1HBXG 2VI6A 2DJNA 3IP4B 4RMNA 3K7AJ 1I5ZA 4PSWA 2OF7A 3G6EI 2QQ8A 2FMYA 2XRLA 2PJRA 4LLLA 2OZ6A 1Z0XA 3G73A 2H6CA 5J6XA 3FKIJ 3C18A 3GZ5A 1W7PD 3K4JA 3AAFA 2HYJA 1LEAA 3IH4A 1MMNA 2BZTA 2CW0F 3IHUA 2JA7J 2KZGA 4A3JJ 1R5HA 4EJVA 5D5UB 4A69C 2ZCWA 2L7ZA 2LBFB 1KZHA 1PP8F 5CPRB 1LPQA 1DDNA 2DBBA 2JPBA 1YYVA 2ZXWH 3HGYA 4IVNA 2HPMA 2HS5A 3GTPJ 1D1CA 3OMYA 4BGDA 3HDDA 3Q0WA 4WXDA 3OS2A 4UUSA 1UELB 3S93A 2NVYJ 4M3DA 5ICFA 3SDGA 3ZQFA 1P7JA 4JP0A 2PLYA 4C2TA 2F5EA 4KN4X 2OZUA 1U2WA 4IOCF 1KU7A 3L9FA 1ETOA 3L00A 1I1GA 1I27A 4RAGA 3JAMK 2LVSA 3J81K 3CMMA 2QBYA 1APLC 3IH2A 1VQ6I 4ZDLA 1WH5A 3R61A 2IGKA 2BOLA 2XGXA 4OMYA 1YQAA 3OYEA 1HLVA 1FIAA 2DMTA 2Z9OA 3HSRA 2BGCA 1Z3XA 4BE1A 2PMZN 1B8IA 2KDZA 3I3LA 2MLKA 1B9MA 2E5NA 2E5ZA 1FZPB 3AG4H 4B8XA 3OY9A 2EA4A 3TDUC 2QBYB 2DA2A 3S1QJ 4HX8A 1W4MA 2G7HA 2A07F 3OYLA 3TL4X 1PYVA 4Z6YA 2DW4A 3J81Z 1EF4A 1BW6A 2O5RA 2XV4S 3OR2C 2JTVA 4I0BA 2HXIA 4LG0A 5IP6A 4C3IJ 2XC7A 3SZTA 2DCEA 4YELA 4B1RA 5JHUA 3CMEI 2CQ7A 5DUKA 4BACA 1NH3A 1BIAA 3HRTA 1SAUA 1O3QA 5JLXA 3BWGA 3SJMA 2WV0A 3ULQB 5KAFC 4WK8F 2E2JJ 2AHQA 1LDDA 2YSRA 3D5SC 4HA8A 1JKPC 2Y0MA 4W97A 3IWZA 2R7ZJ 1ZARA 4XKCA 1H89C 3CC7I 4Q5SF 4HPQA 2V9KA 5J1UA 1TQIA 5JR3A 1WJDA 4BHCA 4HF1A 4L18B 5BPIA 2Y2ZA 4CZZA 3I0TA 1TQPA 2Q2EB 4MGRA 1UZCA 4BY7J 2Z33A 3S2DJ 4NC6A 4LD5A 3OOPA 2RNJA 3TKYA 1X1AA 3CJNA 2PJPA 2HFHA 5JFRA 2R7SA 1QA6A 3RKXA 1MH3A 1O4XA 1ZRCA 1MGTA 2EA2A 1MMDA 4EM2A 3MWMA 1V5EA 2R7RA 3V8KA 4XNFA 2NS8A 1YRNB 5FFZA 4X0GA 1YITI 3HOZJ 3BLYA 4Y17A 4ZYHA 2OU2A 4HSRA 2V9PA 2A3SA 3DU6A 4LFUA 3ZQGA 2ZFWA 3GFMA 4GYIA 3K4NA 4ZZLA 5LGTA 2FUG2 5GPCA 5DDGA 2A6HF 2F6CA 3BR2A 2M2EA 3BZ6A 1MNMC 1MBKA 1Q1VA 2Z3YA 1S5LC 3JCUC 1WZ2A 1BI2A 3CJTB 3M07A 4IOAF 1S7AA 1IV6A 2QCOA 3OOUA 5F6FA 2LTPA 3BY6A 3M1CA 3BJAA 2JVGA 1T0FC 5JI6A 2R5YB 2NS0A 4HDVA 2D2WA 4AD9A 3PNTA 3VYUB 2A05A 4C2MJ 1FBUA 4G8XA 5M3FJ 2CQQA 4KT5C 3BQZA 3A0BC 4DYRA 2CQKA 5L3DA 1R1UA 1F1ZA 3KIOA 3L09A 3LSJA 3R0AA 1NG7A 3W2VA 1K4TA 3DTIA 1IUYA 5HODA 1JKQC 2DK8A 1VF9A 3OSGA 2R7XA 3QP6A 3V42A 4IQJA 3WU1B 1DQUA 1XGOA 4ZC3A 2DA3A 1IZ1A 4OWRB 1KQ0A 2DN0A 5HS9A 3F9KA 4UUSB 3I56I 2X1EA 4ESJA 4D1QA 5K5RA 1C0WA 3MKYB 3M8FA 2LH9A 4I98B 3RIRA 1DUXC 1WKMA 4IPAA 3FXLA 3QYBA 3I55I 2M87A 1FSHA 2ESHA 2MA3A 2FE3A 1FC3A 1U8BA 4XOTA 3VDXA 3LFUA 4U0WA 4MFEA 2EBIA 2L01A 3SFIA 1TC3C 5DEQA 3MKZA 4AM3A 5HLIA 1J0RA 4ETSA 3MEXA 3NARA 3HRSA 1T6SA 2QUFA 3DCFA 5DM7F 3A0HC 1JI8A 5FROA 5AIPA 4GDFA 4WCGA 5LGUA 2B9SA 1AKHB 3K70D 3DBHB 1RESA 5GP9A 2ICWG 5HDGA 2GIZA 5H6QA 1ETQA 2IS6A 2XGEA 1ZYRF 2L7MP 2YU3A 5LBQA 1OISA 4EM0B 1UG0A 1WJBA 3WE3A 1B72B 4IRGA 4NBQA 1S7EA 3TP0A 4HEA2 3V4GA 2IA1A 2CMPA 4A93J 4DQ2A 1HDPA 4IEJA 4IQ4A 3ZGKA 2W48A 3RKYA 2O8KA 1DPUA 4J00A 2PMUA 2VQGA 1WJ5A 4FISA 3IUOA 2BY1A 2X51A 2Y9YA 1B59A 1Y6IA 2F2EA 1PUFA 1P92A 2IS2A 1FSEA 3VYSB 4C2UA 2LYCA 3FXKA 1RUOA 2CUEA 2CQXA 4G6QA 4XRSG 1OCRH 2E7WA 2L2OA 1RKWA 2X1CA 5FKOA 4CDGA 4PSXA 1QPIA 4ZYAA 2MC4A 4M3BA 4WXCA 2LY9A 1V5GA 1Z05A 2BEOA 4E7ZA 3ABMH 2GXAA 2HKOA 1GDTA 5LHIA 1W36C 2ZXIA 1SFUA 3MMYB 3CCUI 4A12A 2LSOA 5KK1A 2VBWA 1IXCA 2X9DA 4XLPF 3VEPA 1YIOA 4L9TA 1P4AA 1U5TC 4CYCA 3IC7A 3MFKA 1YX5A 4CCJA 3IWFA 3S32A 2HZDA 3K4CA 4JOMA 5KAIC 3LAJA 3H1CA 2OTLI 2RKHA 1TWHJ 1U6GA 2RDPA 1JXSA 3W6JB 1IDYA 2GIVA 3VSKA 3IKVA 5FD5A 4HDUA 1QBJA 1X3UA 5IOZA 1FBSA 3ABTA 2FF4A 1IJWC 3MN2A 4M3GA 4G6TB 3UR3C 1QZEA 1H0MA 1GV5A 1D3YA 1QVTA 4AIKA 2COMA 1TT5B 1OYWA 2ADUA 3WGGA 3MKLA 2B7EA 2VLAA 1RR7A 3K1NA 2IGMA 2HU9A 4Q48A 5FO5A 1BOBA 3JREA 4BXUA 3AFHA 4LG0B 3CCVI 4Y52J 2ZKZA 2ACJA 1DP7P 2B0LA 1OR7A 2ZJRF 2K5CA 3HEFA 1BI3A 2JT1A 1STZA 1A04A 3T5XA 3EYIA 3OS0A 3QPHA 1E3OC 2EFPA 3LSRA 2DODA 2OUMA 1SD4A 2MBFA 1JE8A 2BW3A 2WADA 4GGGA 3SZGA 3HKZN 2GA1A 5HLHA 4JK1X 4YRVA 4O5VA 2Y30A 3U1KA 4RM3A 4U0YA 3GTGJ 5EGOB 4J01A 3GTJJ 3DEWA 3GFLA 4Z2YA 3OSFA 1E0EA 3WU2C 3WHCA 5DYMA 3OYDA 2HPIA 3VFZA 1LFUP 3FXJA 4OMZA 3E3VA 3RI4A 3JRBA 4E4HA 1D5VA 2R7WA 5KCMA 3FXMA 5FRMA 2CH0A 2BW3B 1G3WA 4R8HA 2JZYA 3OYBA 2GWRA 5B66C 5J47A 5C4XJ 1VQKI 3GFJA 4NNJA 2VODA 1YHQI 5HDNA 4HF0A 2LRDA 1JGSA 5DD4A 1PVEA 5IYCJ 2CU7A 3K69A 4N0BA 1RC9A 2K4BA 5IYBJ 2DDAA 2QWWA 5FLXK 3FM3A 2IPQX 3TDZC 1CF7A 2W24A 2VONA 4GXOA 3FXOA 1VQMI 3CO7C 1VQ8I 1LVAA 2PFBA 5ILUA 4XN3A 2AQEA 2QQBA 2Y75A 2NNNA 2ZC2A 4FASD 4D7MA 1S29A 3JRIA 2OAZA 3SZPA 3CUQB 1UHWA 2MABA 5K5OA 3JRHA 1EH8A 2EH3A 1E17A 3ZMSA 2L4AA 4M6VA 1YFHA 4A3LJ 4CO8A 5HS7A 4U87A 2HKXA 4P5OA 2IW5A 1D5YA 1H8AC 2HYGD 3DLLF 1D1BA 2VPLA 3G71I 1AWCA 4Y33A 2HYFA 1MMGA 4KUMA 4UB6C 1Z77A 2QSFX 4UUTA 3EUHC 3JRGA 5ICEA 4M73A 3HG9A 1J09A 2ZXHA 1R4NB 1TW2A 1J59A 1FMWA 4EGYA 1Z6TA 2ESNA 3H5RA 3HXLA 4TV7A 3QWLA 3QPLA 3LSTA 1Y0NA 4IHSA 2KDOA 2EV0A 2K86A 1X1BA 4ENMA 2K4JA 3FBNB 1ZRDA 3G1OA 4HNVA 4KIBA 5FGMA 2XPUA 5CYVA 1SEUA 3PFYA 1R71A 3OL4A 4ZYGA 4XM3A 5DCFA 4OAZA 5H2FC 2HQNA 3ZQCA 2M7BA 3KZZA 1JKRC 2LY2A 1B72A 3U1DA 4E7SA 1I1SA 2LP0A 1AOYA 1VQOI 1OCPA 2ZO4A 3P9CA 1R23A 1TP4A 4CH7A 1N78A 3BTJA 3CP8A 2X6WA 3HSFA 2Y48A 2H8RA 2JN6A 3L7WA 1X1PA 3WTZA 2P0WA 3F8BA 3BR6A 2R5YA 1S8NA 1ZLJA 3BP8A 1V4RA 3MD2A 2O7OA 1PDNC 1HW1A 2E35A 1BA5A 2X48A 3HTSB 1IN7A 3M8JA 1K78B 5CKTA 1IN8A 4L9NA 2STWA 1IG7A 4A6EA 1MJBA 3TO9A 4D7NA 2ZMEC 2MH2A 4DBQA 2O8XA 2M1BA 5ED4A 2M5WA 5C4JJ 2GAUA 1ZKGA 1XGSA 3BG7A 3RPUD 2JA2A 4L5JA 4EVIA 3H3ZA 3BR1A 4EV0A 2DA5A 4ESBA 5HDKA 2BXYA 3JAMZ 1UHMA 2E36A 2OTJI 2FU4A 2X0LA 3QYEA 2P8TA 3A01A 4FE7A 2VPRA 1LDKB 2CYYA 2CV0A 3L2CA 2P5KA 2EK5A 3L2RA 3KE2A 1FEXA 2V1XA 5CQEA 2LNBA 2M9HA 1BR2A 3U21A 2LLKA 4M9XA 2JUGA 3RQIA 4S04A 2G0EA 2VL8A 3F23A 4G12A 4GO1A 5CVVA 2PN6A 4A3GJ 1R9TJ 1K7AA 3CLQA 2XAJA 1KU9A 2DYSH 1SD5A 1OQYA 3P9KA 2M8EA 4NC7A 2BHZA 3OIOA 2ECCA 2H1LA 5D6EA 3ZCOA 3GW2A 3FMRA 3I54A 1YIJI 2FQ4A 2D1HA 4BQQA 2MW8A 1JT6A 3F6OA 2F4OB 3ELKA 4D5CA 2F5DA 4N9HA 3GYHX 3BR3A 2DMNA 3PIPF 4HBLA 1W36D 3LSIA 1PUEE 1I39A 2XVCA 3KZYA 4I76A 2FNAA 1FJLA 3ABLH 1Z6RA 3VSLA 2P7CB 1A6QA 2V1DA 5F64A 2IVMA 5D5VB 3HZJA 2VQHA 2G7UA 5B5EC 1LVKA 3UNGC 3F8FA 3REOA 1FOKA 2FA5A 5F1RA 2W25A 4UXNA 3H0DA 4DYCA 2BVMA 3FK7A 2LD5A 2FOKA 2VXDA 2EWNA 2DT6A 1Y56A 4V19K 4NQWB 4RAFA 2K9NA 3QP5A 5E1XA 4HLYA 2JK3A 1HKQA 1HW5A 2HTSA 2QF7A 3QU6A 1JHHA 3ZMDA 3ZXSA 4DOZA 2JQ7A 2IS1A 1BL0A 3LL7A 2VT2A 4XKWA 2XGDA 4JX4A 4H0EA 3HSEA 1GHCA 2M30A 1XDUA 1H9GA 2R7QA 4ABZA 1WJEA 2NOGA 3ERMA 4A3KJ 2Q0OA 5GTIC 1TWCJ 2GQQA 4M9ZA 2LREA 1LFPA 1KQ9A 2FBIA 1LUJB 2VKEA 4IHYA 3OL3A 4II2A 3SQNA 5B1BH 5C44J 1W0UA 4IHTA 2OD5A 1Y8RB 1W7PA 1ZG5A 1E2XA 5LHHA 3BTCA 4AIJA 3S15J 2HZTA 3KCCA 1VQPI 4RGRA 3K10A 3WE2A 4EJUA 1X58A 1XD7A 2LKPA 3WTSC 3LAPA 3O6BB 2HXOA 2PJRB 3ZRGA 1R22A 2D1VA 3MKWB 2GA2A 3L2QA 1ZH5A 4G94A 1TBXA 2DOEA 3LA7A 3V7SA 4U7DA 3MZ8A 3EYYA 3J7AY 3C3WA 3EETA 2ETHA 4YFNF 2CV2A 4BXXJ 3BROA 4UB8C 2DA6A 5F08A 3F21A 4G9YA 1IN5A 3BR0A 3I71A 1TLHB 1A6IA 3B6AA 4KA4A 3ISPA 2LY1A 3CCRI 2KPMA 2CUJA 4IL6C 3RZDJ 4LOCA 1CGPA 2WB1N 3C7JA 3RYRA 4MEXF 2TRTA 3W3CA 4MIMA 1QPMA 1K78A 4W1UA 3TP3A 1P4WA 3GZ6A 1NK3P 3H35A 4RB2C 4CCKA 1X1CA 4QLCU 2OC6A 4Y4RA 4IRHA 3T1BA 1SVMA 3K9TA 5HNFA 3LSMA 1Y39A 4MHGA 2HOSA 1WCMJ 1YO5C 3CUQC 2NVTJ 2L02A 3K0LA 2DFHA 4XORA 3NAUA 4GCVA 2OCEA 1ZREA 2K3PA 4NHJA 2Y9ZA 4B09A 1D0XA 3HOYJ 1Y0UA 1G4DA 1F9NA 1OMIA 3O3KA 4CCNA 1MMAA 2HOAA 4YIIA 1IN4A 4XLAA 2EZIA 2K85A 2KIFA 4B3AA 4I7HA 1GVJA 5L3EA 1MSFC 4A3CJ 3I64A 4ENNA 4MO7A 3CC4I 2M3AA 1JUMA 4CUGA 1R5ID 5GADJ 1OCTC 5E1ZB 3NWSA 3L2WA 1TWGJ 2VC1A 4XIDA 2GBYA 1MBHA 1SFEA 2O6GE 5DUIA 3KETA 2WAFA 4U7BA 4DZJA 1R1VA 4EGZA 2M0CA 3ZQQA 5TISC 5KHDA 2QGUA 5LFAA 4BQOA 4CCLA 4E7LA 1EV7A 5IY5H 2K27A 1GVDA 3S3OA 1BI0A 3CUOA 5J8FA 1LB2A 2XF5A 5CVUA 2MD5A 1QNTA 5BMZA 2VJIA 1P7IA 4AIDA 1RNLA 1R7JA 2EILH 5DCMA 4BE2A 1OPCA 1HSTA 3I9V2 1ONVA 2EV5A 2E1CA 9ANTA 1ZN2A 1R5GA 1UB9A 5ICGA 2YPRA 3T8RA 4OAYA 1O3TA 3CDLA 1X3WB 5ILVA 3QRFF 4EJTA 2IGOA 3V7CA 3M7GA 4F93B 1XC5A 1SFOJ 3JTGA 2NS7A 3I5UA 2L0KA 1KU2A 2DA7A 4YIFA 3ASNH 2X4HA 3V8LA 5IPAA 3JR9A 2LMDA 4MTEA 4RLFA 4A0YA 3I58A 2KFDA 2LDUA 1VZ0A 1BJZA 1Z67A 2Q2EA 5LD2C 4MTDA 4AIHA 2F5FA 3PIOF 2CWEA 3EUAA 2HVSA 4MLOA 1LNWA 4C3JJ 3CCJI 1JJ6C 1OJLA 2NOJB 2E34A 1U3EM 2QSHX 1G2HA 4F91B 2OCCH 1RIOH 4IHWA 5TGTA 2BHYA 4A0XA 3KEQA 4LITA 5CLSA 1HDDC 1BR4A 2AO9A 5JHFA 2E1MC 3N4MA 3HOVJ 2ELKA 4D9JA 3DFGA 3OYJA 4BY1J 3VODA 3KP7A 2CW8A 2ZBKA 2BY2A 3PJRA 1SMTA 3R4KA 3KP2A 5EJCA 2IBDA 1ON1A 2I5UA 5D4RA 4HX4A 3LSPA 5L3GA 1ETKA 4PFPA 1FT9A 2GXGA 3K4KA 3VB2A 1TZLA 3S14J 1IV8A 3V7RA 3GTOJ 2LKSA 2EZKA 3F6VA 3GWZA 3I59A 4WF2A 3J7YJ 3JRDA 1Z9CA 2OA4A 3NWTA 4L5EA 4QSHA 1W5SA 4LG3A 1U9OA 4IZZA 4I99C 4HZFA 2F5CA 3CCLI 3ZMUA 4IO9F 2P4WA 4A3DJ 5CVRA 4BQAA 1R00A 4PFOA 1N25A 2VQCA 4N4NB 1O7FA 1WGXA 4MNUA 1XSXA 2P5LC 4UHTA 2E60A 3GVAA 2FBHA 5D8LB 1U5TB 3WTXC 1EKEA 2M7AA 1IRGA 1ZG3A 5BS6A 3ZMZA 2EV6A 2O0YA 2RQQA 2WY8Q 3FISA 1Y8QB 1ZELA 4N9IA 2OQGA 1HCRA 2VE8A 4CHUA 4IX7A 1Z91A 3OIQA 3FM5A 4ZYDA 2R7FA 3BJOA 5HS8A 1ETVA 1V5FA 2L9NA 2QM3A 3A03A 5FKNA 4BKXA 1RRJA 3C2HA 5M5YJ 1N77A 3W6VA 3H9GA 1YS7A 4Q47A 3TGNA 1MBFA 2X6YA 5HVQC 3VYTB 3NQOA 5EEGA 1BM9A 3ZN0A 3CDHA 3RPUA 3MQ0A 3K1PA 5D6FA 3F8CA 1ZQ3P 3A02A 1RUNA 2WAQN 3LSKA 4XICA 2VJJA 4HQMA 5TRDA 2J5OA 1WVRA 3TEDA 4CXFA 3SYTA 1T95A 4JYKA 5AONA 2V6CA 1LEBA 4M9SA 4PK4A 5DD8A 4RLQA 2P5VA 5JVTA 3K4LA 1ZR4A 4HLXA 4OINF 4B43A 1P4XA 3H5AA 4S0HB 3S2HJ 1HA8A 4DIQA 1PUFB 4CCOA 2HWVA 2DOAA 1IUFA 2NXNB 2W57A 1F5TA 1QVUA 2LG4A 3CLOA 2WC2A 1T56A 2KIMA 3BG3A 3DEUA 5E8IA 2VOOA 3H9QA 3QAHA 5EYRA 4LMYA 3Q9SA 3R6SA 5FB2A 4XRFA 2K7LA 1XMXA 3WTYC 3Q0UA 1FNNA 4UNOA 5J4VA 3CTAA 3BCBA 3LMMA 1ZHFA 3IH3A 3A1YA 1QHHD 3VOEA 1X2NA 2Z5UA 4XONA 2QSGX 3KYLA 3M3YJ 4NUBA 2R3SA 5LLQA 1MH4A 1LFBA 3I59B 4RM2A 2LR8A 3IKTA 4IXAA 4C9YA 1ZR2A 2PBIA 1NTCA 3EPZA 4M3EA 4BDZA 2MLGA 1JTXA 1F43A 4BAYA 1XN7A 1WWXA 1WFXA 3SEQA 4F52A 3BCAA 4WWCA 3HYIA 4V2GA 2XASA 2DPDA 2HOTA 4KITB 4NC8A 5LHGA 2L9VA 2QQ9A 5EG0A 2QEXI 3BTIA 1YG2A 1W0TA 1Y1WJ 3E0JB 4JX6A 2RN7A 1LE8A 4HQEA 2JA5J 3DEEA 3GEZA 1GXQA 3ECOA 3FXQA 4BS9A 1VQNI 1Z7LA 2ELJA 1IO2A 2IGNA 4YIRX 1TWFJ 4OU0A 4FETA 3H9JA 2O03A 4PJLA 2E2IJ 1YS6A 3ML6A 3WGIA 4I6ZA 4LIUA 1FP1D 3MVPA 3K4MA 4HSTA 4ASNA 3ZMTA 2LOOA 3KX2A 4U0VA 2AQFA 2Y0SA 2AS5F 3KP4A 4P96A 5D8KB 4AVPA 4P1WA 4Y3OA 3C2BA 3ECHA 3LNQA 1I6HJ 2DT7B 2IA0A 3FIWA 4AYBA 1RPWA 4B47A 2LKXA 2MG4A 4KNYA 2CRGA 2OJED 4I02A 1TNTA 3EQLF 1MKMA 5BPDA 2KJCA 3CD6I 1BW5A 2Y69H 4O6JA 3CMAI 3CCSI 2XAQA 4A2UA 2ZSIB 2Z99A 4IF4A 4R79A 3CO6C 4BHPA 3ERED 2GM4A 4BH9A 4A3BJ 2JSCA 3HUGA 4C30A 1REPC 4R1HA 4NDLA 4LK0F 3HOWJ 3PNYA 5L3BA 3OYCA 4PJMA 4ITVA 1WPKA 2QVOA 5EGOA 4XRSA 1TWAJ 3GTQJ 3ZOBA 4PDKA 4ZTFA 3ZQ7A 5E3NA 2ELHA 3GF2A 5J3LA 2B63J 2VBYA 3G3ZA 4RB0A 2O61A 2K9SA 1UFMA 1B6AA 1QZYA 3CUQA 4UVBA 1HKSA 2DJIA 3RTRA 1VFCA 1QQIA 2PX9A 5D4SA 1DU0A 3CC2I 3GO5A 3H3VK 1IRXA 1A35A 5FKKA 3KP5A 1IC8A 2KT0A 4UVCA 2D45A 4F55A 2YS9A 2A5YB 1JHFA 1JKOC 4EEFG 1R49A 2M34A 1ZGWA 1T33A 3EDPA 2ISZA 2ZJPF 1S72I 3JSPA 1RZ4A 3ZR8X 5DS9A 3PUFA 1VQ5I 1O3RA 3GTKJ 3KLOA 3GZNB 3C2GA 3DTKA 3MAJA 2VJ4A 1Q1HA 3E5QA 2W84A 4A3EJ 5GAHJ 4GYGA 4EATA 2KKOA 3WGHA 1D0ZA 3QPSA 1HXDA 4E7HA 1MJ9A 5FLXZ 1R4MB 2AXLA 3HC7A 3OIPA 3AG1H 2FOWA 3PFIA 4FCYA 2ZMEA 3I4MJ 1GXPA 2F4IA 2R5ZA 1XCVA 1SD7A 2PMZA 4FE4A 3HOXJ 1UJ8A 3P9IA 2Y0SN 2KL4A 2YX7A 3QOPA 1MDMA 2R7DA 5BNGA 4HX7A 5EDNA 4OIRF 5IT9K 1G3TA 1DGRM 3GTLJ 2OV7A 4XOPA 4RDUA 3QQAA 4XSZF 3TQNA 3RQ4A 2HDWA 2E19A 3F3XA 3TBIA 2XKOA 4RAYA 3DTEA 1N75A 4FTHA 2TDXA 5M3MJ 2XSJC 3OS1A 3TW7A 1ZRFA 1WH7A 2CW7A 1X4OA 2ZNYA 2BV6A 1P9QC 4PGGA 6PAXA 4C3HJ 2ZSHB 3T8TA 1JT0A 2F48A 5K5QA 4AC0A 5GAEJ 3VYRB 1VQ4I 3K70C 2MSYA 3FDYA 1J7KA 1Z21A 3LWFA 1B4AA 1BIBA 2RAEA 3C1DA 1LDJA 4XKVA 1K61A 3FHNA 3GMEA 5BOXA 3HIFA 2O3FA 1IRZA 4XBFA 1MNEA 2A5WA 3MZYA 4PGHA 3FHZA 1HF0A 4BNCA 2XB5A 3BOQA 1DP3A 1T08B 2R93J 2GLOA 2DMPA 4KICA 1J2XA 1XPXA 3BZCA 2WA0A 4AU7A 1BI1A 1OR7C 4HG2A 1KGSA 3WU0A 1FYLA 2VOPA 5AIQA 1LJ9A 1FOWA 3ZQHA 4B3XA 4D0PA 3BJ6A 2VIXA 3JRAA 2EZLA 3FBIB 1ZGAA 2Y31A 2XAGA 2FXAA 5C3EJ 1CF7B 5J1YA 2CJJA 4LIVA 3GUDA 4QWQA 1SANA 3BG9A 4HV5A 4M6XA 4S05A 4E7IA 5LGNA 4BJTA 2DU9A 3DKXA 4QPOA 3IAS2 2EJRA 4DJAA 1EJ9A 5ICCA 2XAFA 4B4CA 4HNUA 3AG2H 3HB9A 3PSIA 5IT9Z 2A69F 2Z1DA 2R7OA 4HAMA 2UXNA 5H6RA 2CS3A 2O9LA 1UCRA 2ZJ2A 2ZNZA 3FXRA 4LLGF 1SFKA 1ZLKA 3WTVC 3S1NJ 2NAZA 2HVRA 4KYWA 1W1WE 4YFKF 2KMUA 4I09A 4KIFA 2DYRH 2E1MB 3DPTA 3NRVA 1YE9A 4BEHA 2EFQA 1VQLI 4BU2A 3WTWC 4M72A 3RYPA 1KU3A 2MGQA 1MMSA 1JUPA 5BQTA 2QA4I 4G7OF 2ZJQF 3N05A 2IS4A 1XSDA 1R36A 2CUFA 2H8WA 1T98A 1WQ2A 4EM1A 1WSUA 4UUVA 3CCYA 3X2QH 2HTJA 2KRCA 3KYDB 1IXRC 3PNVA 5CVJA 3G1LA 1MBJA 2KP6A 2LK2A 2I8DA 3SFZA 4RB1A 1B1BA 2IXSA 1TNSA 1P6RA 3DLAA 2KRHA 1SMYF 2DFEA 2W82A 3CZ6A 3F8NA 4CCMA 2VXZA 3JSOA 2MH9A 2UWMA 5FD6A 1XGMA 1VI0A 2R4GA 5EZHA 5K7FA 4PJNA 4E7KA 2V6EA 1IN6A 3KYCB 2NRAC 2I10A 1YW7A 2W7NA 2BVLA 2MC3A 2K3FA 2MD0A 2VN2A 3MCZA 3WODF 3V8JA 1ENHA 5M5WJ 5HLGA 2LC2A 4XMYA 3I53A 1ULYA 4X1EA 2NVQJ 2XB0X 3AKZA 2VKDA 2H09A 4XRMA 2V26A 3HRMA 3LA3A 2L7KA 5DM6F 2ME6A 4DYQA 2R92J 2XRNA 2DQLA 1J9IA 2YX4A 2VC0A 3A4CA 3E6CC 3J7AO 3PQKA 1J75A 3JRFA 2L5QA 3NEUA 4RA2A 3TO7A 1JGGA 2QZ8A 1I3AA 2DOFA 3CF2A 2W85A 5IP9J 2OBPA 1GLNA 1G3SA 2P6SA 3LSGA 3U9GA 4EQQA 1W7PB 2EQRA 1FTZA 3CCQI 3L2UA 1IW7F 1KYZA 3DU5A 4CGZA 2M45A 1MIJA 2PEXA 2GOXB 3HKZA 2QQAA 4BJ5C 2M0MA 4XR6A 3ZQLA 2FBKA 5EG0B 3FMQA 4J19A 4YEJA 3QU3A 5J4YA 2K40A 2V1UA 3PUBA 3ZN1A 4EJOA 2RC4A 1Z3YA 3UKGA 4HW0A 2H94A 1ETXA 4HOBA 4KN7X 1YX3A 1T0FA 2D5VA 3FKJA 3L2VA 3QYFA 3AG3H 5HOOA 4P55A 3FX3A 1F36A 4XQFA 1QRYA 2MYSA 1XS9A 3BTLA 4ENJA 4BBSJ 1ZTRA 1FP2A 2FMLA 2XGCA 4A6DA 3VPRA 4GRIA 1G59A 4KIGA 3GXOA 4BEHB 1JJ8C 3BQYA 1T38A 2L3DA 4M3FA 4YFXF 2EFNA 1NHAA 2CO5A 2BBYA 1D8KA 5LEKA 3CMYA 1ZG1A 1RI7A 2CFXA 1QU3A 1ETYA 5L3FA 3DXJF 3EUHA 3CJQB 4BYYA 2FQ3A 4UV8A 2UZKA 2DPUA 2IRFG 2EB7A 1J5YA 1YOVB 3KPHA 2H27A 4AUXA 5LRRA 2FSWA 1GV2A 4RGXA 1BJAA 2CQNA 3TOAA 3WG9A 2JJ7A 2WB1A 1I6XA 2Q1ZB 4XKBA 4FHTA 3LQRA 2KRFA 4JQFA 3J80Z 2HQAA 2ZMEB 1ETWA 1QO0D 1UG2A 3R60A 3CCEI 3WTUC 2LF8A 2HOEA 3OWTA 1XB4A 2CGPA 3S3MA 1AU7A 1TQMA 2JUCA 2DA1A 3O8HA 3ZP5A 2DI3A 1JTYA 1UAAA 1MD0A 4PZJA 3A01B 4KMUX 2L9RA 2VB6A 3HOTA 1Z1DA 3K4BA 2VJ5A 1XGNA 5TJJA 1T8IA 1HC8A 3SHFA 3CF5F 4ZZDA 2W4SA 2GOMA 2XUBA 1FMVA 5DTDA 3Q3SA 1XG1A 2HQRA 5E20A 1S7OA 1BC8C 4PJJA 1CQTA 1FLIA 1FX7A 3HHHA 1IRFA 1FTTA 1A36A 1IF1A 3KZIC 2IAIA 3SEZA 1HW2A 4K2EA 3OYNA 3D5RC 1RR8C 1DPRA 1G8XA 4IRIA 1TW3A 4DNCA 5D5WB 1S3JA 2DK5A 2DO7A 3U2RA 4KDPA 2M8GX 5FFXA 3HBLA 4YG2F 2STTA 4MFDA 1SFXA 3D0SA 2HGCA 1WI3A 5K7HA 3E6MA 1Z7UA 3BC8A 3M1EA 4WX9A 3G4SI 2XAHA 3BDDA 4ZJZA 2L7FP 4CYDA 1YJWI 2IT0A 2VUMJ 2XPWA 2A61A 3OYIA 4XL9A 1SVOA 3D1NI 1YI2I 4XLCA 5EEAA 2XPVA 2JMWA 4LGWA 1BBYA 2DDBA 3J80K 3WG7H 2FJ1A 2R5ZB 1K79A 2VBZA 4A5MA 5B3SH 3B6CA 3HL2A 5F1JA 4M71A 2GXBA 5J1RA 2YU9J 1EA3A 3HTUA 1IAWA 2UUZA 4A3IJ 4GFBA 2P7VB 3IL2A 2XSDC 3E5UA 3LA2A 2LFBA 2PQ8A 3FWEA 2L54A 1TT0A 3E6DA 5IP7J 1FOYA 1LQ1A 2IP2A 2Q8KA 1MZBA 3J7ZI 3GCMA 1BR1A 3BG6A 2M4GA 5FLMJ 1KQ8A 3CDIA 3FMSA 1XTAA 2X85A 1FWZA 3S2WA 1KYWA 1SVLA 1RKTA 4EJWA 4KMFA 4KFCA 1R1TA 3ONQA 3QPTA 4XK4A 2VBXA 2E2HJ 1SAXA 2DTZA 1H88C 3DKYA 3F8MA 4LJZF 1YJ9I 1FOXA 4ZH4F 4JX5A 5GAGJ 3K2ZA 3GLLA 3KEOA 3PM1A 3M8EA 1PJRA 2HDCA 4I01A 1I50J 4L5IA 3GFIA 1YTYA 3DF8A 3LFKA 4I2OA 4FT8A 1ZK8A 2E1NA 5F0FA 5E3OA 4LLNA 4F7ZA 2RNGA 4CSWA 1AHDP 2WWYA 5F0HA 1U5TA 3ZMVA 2EPFA 3RPQA 3RJPA 3E6BA 2IEKA 3IRRA 2BE5F 4QTRA 4OIQF 1Y1VJ 2A68F 3H0GJ 1V55H 4LK1F 2ISYA 1AKHA 2RGVA 3SDBA 4A5NA 4ENKA 2YR2A 3HRUA 5LRSA 4LB5A 4Y13A 4KISA 3GTMJ 3S8PA 4V2FA 1FY7A 2IJLA 2E71A 2GZWA 4U88A 4G7ZF 3RKQA 1D1AA 2K02A 4DW6A 2JVHA 1ACIA 1PP7U 3W6KB 2VKHA 3Q5FA 1W5TA 1ITYA 4FX4A 2EFOA 1UHSA 3OYHA 1OCZH 3R0JA 3K2AA 3HPHA 1T39A 3S1RJ 5F0CA 2HI3A 1YJNI 4BJ6C 2F4MB 2EZHA 1WI9A 2KHMA 1X1DA 3K1MA 3SXYA 1K83J 1USSA 4IKFA 3CP2A 3RCOA 3BT9A 3PSFA 2V4JC 1TL8A 2DTRA 2CFOA 1M1EB 4F92B 4P9FA 1A5JA 2WTEA 1K6YA 4XN0A 2CSOA 4H4KC 2BY0A 2DMQA 3E5XA 3FXUA 5JVGF 4X6AJ 2FD5A 2XHKA 4PCQA 2COBA 1BC7C 1U0JA 2WAQA 1U9NA 3BG5A 1WJFA 3OYGA 1JUSA 1XDSA 5E18F 2E1OA 1I3QJ 1NK2P 5FLVA 1UMQA 4IHXA 2WBMA 3RZOJ 1R6RA 3JRCA 1ERDA 2ZXJA 1OYYA 4BUPA 1USTA 2PI0A 2FRHA 2V9VA 4ON0A 4UVAA 4WXHA 4FX0A 2BYVE 3ZQIA 2WY7Q 2W1OA 3EUKL 2QKMB 3DKWA 3F22A 1DGWY 2R7UA 3GLXA 3TW6A 5D5XB 3PO3J 1OCOH 4BBRJ 3KFWX 2K9LA 1SD6A 4KJZA 5F27A 5GPAA 2OPTA 4AYBN 5KNLA 4OIPF 3A2KA 2G9WA 2NVUB 4LB6B 4RGUA 1E3PA 1WRJA 2PG4A 3TO6A 5E1WA 3DBRB 4AVZA 5DV5A 4UY8I 1LKXA 2VKVA 3QOEA 3TOBA 4D5FA 2BXZA 3HM5A 5FRNA 3Q9VA 1NG6A 5DCMB 3B02A 1L0OC 1XMKA 3Q0VA 3PQJA 1IDZA 2CV1A 1O57A 3OV8A 2FX0A 2JA8J 3W2WA 3LOCA 3M4OJ 1MJAA 2HR3A 3RSNA 3ROUA 2DFIA 2VASA 2VT3A 2DFFA 4II3A 2R7TA 3P5JA 5GTHC 2P6TA 3MZHA 1YRNA 1OFCX 2XIGA 2IA2A 1FBQA 2CG4A 3GX4X 3IRQA 1XSVA 3BPVA 2K9MA 2H6BA 4MEYF 2LBFA 4KT6A 2QKLB 4NB5A 5IOYA 2EIJH 1IGNA 2HEOA 1OYIA 4CYCB 5L3CA 2HDDA 4ANJA 2YUSA 4N4OB 4BL0B 1D8JA 3DBLB 2V1NA 1X4PA 5HLTA 3OYMA 1G6NA 3HGGA 3AL0C 5EEHA 1RETA 4BQNA 5EF6A 1QZZA 1O3SA 5J8CA 4A0ZA 2JPCA 1ZGJA 3DP7A 2DQRA 3WHBA 2XROA 4IHVA 4BDYA 2DMUA 2QLZA 2R7VA 1HQCA 3M9AA 3F0CA 3F72A 3HOUJ 4PJ0C 3BZKA 2KZVA 2KIQA 2N8GA 1V54H 1VQ7I 1ODDA 1U78A 3H5NA 4HNTA 2FNPA 1BN5A 3G2BA 3CQZJ 2EIMH 5F04A 4ZDPA 2NNYA 3IAM2 1MNDA 3KP3A 4XLNF 1VNDA 1OKRA 1TTYA 2QYOA 5IT3A 3O2PE 4XSXF 1D0YA 1X2MA 1WJCA 1BOAA 2CUZA 2P81A 1EH7A 2JWTA 2KIUA 4RGSA 4E70A 1LE8B 1H9TA 1B8IB 3S1MJ 5M5XJ 3AL0B 4RB3C 4BHBA 2WAEA 1R58A 1X19A 2E7XA 4QPQA 4ZDOA 3HJEA 2XF7A 2NYXA 3ABUA 2H1KA 5JLWA 3FZVA 5LEJA 4HRIA 3L1PA 3RDIA 4ZTJA 5E8GA 2HQ5A 2ECBA 1QHGA 3ESWB 4L0ZB 4O3MA 4G6DA 5J40A 1HKTA 3RKWA 2TCTA 4F3QA 4B48A 3DPLC 2WV1A 4Q4ZF 3PL8A 4XLHA 1KONA 3D5LA 1POGA 1U8RA 3S3NA 3WTTC 2C6YA 2FEZA 4CA0A 1SC7A 3BR5A 2UXXA 1E3HA 5B1AH 3W2AA 4XLEA 1MW7A 3IV5A 3I4PA 2KQRA 1HSJA 4Y7NJ 2VE9A 1G3YA 2X6OA 2RREA 2DAOA 3LSHA 3GBGA 2NVXJ 3O8GA 1P2FA 3DV8A 5EZGA 4CZCA 3S17J 3H92A 1VTNC 4NQWA 3JW4A 1IXSB 3DPUA 3H36A 4XLFA 1DU6A 2JRMA 2DXIA 1XCBA 2F5VA 1MSEC 2JSPA 3FK6A 2EFWA 3CESA 4BXFA 3TMOA 1MBGA 3HPGA 1FIPA 1WHUA 5H20A 1XX5A 4PUSA 1ON2A 1K6OA 5CJ9A 3ASOH 1L3LA 3B73A 2PMHA 4MQVA 1YW9A 3T0YA 2Z16A 5E17F 2A6TA 1W5CC 2V79A 4DZPA 5HNHA 3KP6A 3PO2J 4P9UA 4OIOF 5FKLA 5KVRA 4UV9A 4AWXB 3OYAA 3LQQA 5K7ZA 2RVCA 2W00A 1KA8A 2EIKH 2DT5A 2XF6A 4RS8A 5FKMA 4HF2A 1T2KA 2RV8A 3VWBA 4HYEA 4E6KG 2HNHA 2J5PA 4BE0A 4DGWB 4Y15A 1XMAA 2LF7A 5E3LA 2DLLA 1AA7A 2XKPA 2BY3A 2L4MA 4EMSA 5FJ8J 3HHGA 4B44A 1MBEA 4A3MJ 2QENA 1MDMB 1B9NA 2RQPA 5A2QK 2MFZA 5IYDJ 3DWLE 3HUGB 3E1SA 4IJAA 4G7HF 2ZFUA 3CCMI 2JRTA 2ME0A 2R0QC 2X1DA 4RAZA 2XDVA 3BPXA 1YW8A 3H3UA 3I4NJ 2A6EF 2XAUA 2K9QA 3DQVC 5CQGA 2DA4A 3N97A
chains in the Genus database with same CATH topology
3KLNA 1FYKA 3JTHA 2KJBA 1V3FA 3E97A 1FPQA 1FYMA 4L9VA 4I0AA 1ZAOA 4L9JA 4CICA 4L0YB 1O7LA 3FF5A 1F4KA 5A2QZ 3COAC 5K1YA 4HV6A 5CVIA 5ILSA 4ESFA 3ZPLA 2OQRA 5ERIA 3HOSA 4M6YA 4JBAA 4M74A 1EH6A 4MQ9F 3P7NA 1S6LA 4ZYEA 1YLFA 1QGPA 4OOIA 1HBXG 1I5ZA 2FMYA 4LLLA 2OZ6A 3G73A 2H6CA 5J6XA 3GZ5A 3C18A 1W7PD 3AAFA 1LEAA 2CW0F 3IHUA 1R5HA 4EJVA 5D5UB 2ZCWA 1PP8F 1DDNA 2DBBA 2JPBA 1YYVA 4IVNA 2HS5A 4WXDA 5ICFA 2PLYA 2F5EA 4KN4X 2OZUA 1U2WA 1KU7A 3L9FA 3L00A 1I1GA 1I27A 3JAMK 3J81K 2QBYA 3R61A 2XGXA 4OMYA 1YQAA 2Z9OA 3HSRA 2BGCA 1FZPB 2MLKA 1B9MA 4B8XA 2EA4A 3TDUC 2QBYB 4HX8A 1W4MA 2G7HA 2A07F 2DW4A 3J81Z 2XV4S 2JTVA 4I0BA 4LG0A 3SZTA 5JHUA 5DUKA 1BIAA 3HRTA 1O3QA 3BWGA 2WV0A 3ULQB 4WK8F 2YSRA 1LDDA 4HA8A 2Y0MA 3IWZA 1ZARA 4Q5SF 1TQIA 5JR3A 4HF1A 4BHCA 4L18B 5BPIA 4CZZA 3I0TA 1TQPA 4MGRA 2Z33A 4LD5A 3OOPA 2RNJA 3TKYA 3CJNA 2PJPA 2HFHA 5JFRA 3RKXA 1ZRCA 1MGTA 2EA2A 4EM2A 3MWMA 3V8KA 5FFZA 4Y17A 4ZYHA 2OU2A 2A3SA 4LFUA 2ZFWA 3GFMA 4GYIA 4ZZLA 5LGTA 5DDGA 2A6HF 3BZ6A 2Z3YA 1BI2A 1S7AA 5F6FA 3BY6A 3BJAA 5JI6A 2NS0A 4HDVA 2D2WA 4AD9A 1FBUA 4G8XA 4KT5C 2CQKA 5L3DA 1R1UA 1F1ZA 3L09A 3R0AA 1IUYA 2DK8A 3QP6A 3WU1B 1XGOA 1IZ1A 1KQ0A 5HS9A 4ESJA 5K5RA 1C0WA 3M8FA 3RIRA 1DUXC 4I98B 1WKMA 4IPAA 2M87A 1FSHA 2ESHA 2MA3A 2FE3A 1FC3A 4U0WA 2L01A 5DEQA 5HLIA 1J0RA 4ETSA 3MEXA 3HRSA 1T6SA 2QUFA 5AIPA 4WCGA 5LGUA 5HDGA 5H6QA 1ZYRF 2YU3A 5LBQA 4EM0B 3WE3A 4IRGA 3V4GA 2IA1A 4DQ2A 3RKYA 1DPUA 2PMUA 1B59A 2F2EA 1P92A 1FSEA 1RUOA 4G6QA 2E7WA 4CDGA 4WXCA 1Z05A 2BEOA 2HKOA 5LHIA 1SFUA 4A12A 2LSOA 5KK1A 2VBWA 1IXCA 4XLPF 3VEPA 1YIOA 4L9TA 1P4AA 1U5TC 3IC7A 3MFKA 3IWFA 3LAJA 2RKHA 1U6GA 2RDPA 1JXSA 3W6JB 2GIVA 3IKVA 5FD5A 4HDUA 1QBJA 1X3UA 1FBSA 3ABTA 2FF4A 1H0MA 1D3YA 4AIKA 2COMA 1OYWA 2ADUA 3WGGA 3K1NA 4Q48A 5FO5A 4BXUA 4LG0B 2ZKZA 2ACJA 1DP7P 2B0LA 1OR7A 1BI3A 2JT1A 1STZA 1A04A 3T5XA 3EYIA 3QPHA 2EFPA 1JE8A 1SD4A 2MBFA 4GGGA 2GA1A 5HLHA 4JK1X 4O5VA 4U0YA 3GFLA 4Z2YA 5DYMA 3VFZA 4OMZA 3E3VA 3RI4A 1D5VA 1G3WA 4R8HA 2JZYA 2GWRA 3GFJA 2VODA 5HDNA 4HF0A 1JGSA 5DD4A 3K69A 4N0BA 2K4BA 2QWWA 5FLXK 3FM3A 2IPQX 3TDZC 1CF7A 2W24A 2VONA 4GXOA 3CO7C 1LVAA 2PFBA 5ILUA 2QQBA 2Y75A 2NNNA 1S29A 2OAZA 3SZPA 3CUQB 1UHWA 5K5OA 1EH8A 1E17A 3ZMSA 2L4AA 1YFHA 4CO8A 5HS7A 2HKXA 4P5OA 2IW5A 2HYGD 1AWCA 2HYFA 4KUMA 5ICEA 4M73A 1TW2A 1J59A 4EGYA 1Z6TA 2ESNA 4TV7A 3LSTA 4IHSA 2EV0A 2K86A 4ENMA 2K4JA 1ZRDA 4KIBA 5FGMA 5CYVA 4ZYGA 5DCFA 2HQNA 3KZZA 3U1DA 1I1SA 1AOYA 2ZO4A 3P9CA 1R23A 3HSFA 2Y48A 3L7WA 3WTZA 3F8BA 1S8NA 1ZLJA 3BP8A 1V4RA 1PDNC 1HW1A 3HTSB 1IN7A 1K78B 1IN8A 4L9NA 2STWA 4A6EA 1MJBA 3TO9A 2MH2A 2O8XA 2M1BA 5ED4A 2M5WA 2GAUA 1XGSA 4L5JA 4EVIA 3H3ZA 4EV0A 5HDKA 4ESBA 3JAMZ 1UHMA 2FU4A 2X0LA 2P8TA 1LDKB 2CYYA 3L2CA 2P5KA 2EK5A 3KE2A 2V1XA 2LNBA 4M9XA 4S04A 3F23A 4GO1A 5CVVA 2PN6A 1K7AA 2XAJA 1KU9A 1SD5A 3P9KA 2M8EA 5D6EA 3GW2A 3FMRA 3I54A 2D1HA 3F6OA 3ELKA 2F5DA 4N9HA 3GYHX 4HBLA 1PUEE 2XVCA 3KZYA 2FNAA 1Z6RA 2P7CB 2V1DA 5F64A 2IVMA 5D5VB 2G7UA 3F8FA 3REOA 1FOKA 2FA5A 5F1RA 2W25A 4UXNA 2FOKA 2EWNA 3QP5A 5E1XA 4HLYA 1HKQA 1HW5A 2HTSA 3QU6A 3ZMDA 1JHHA 2VT2A 4H0EA 3HSEA 1GHCA 2M30A 1XDUA 1H9GA 2Q0OA 2GQQA 4M9ZA 1KQ9A 2FBIA 3SQNA 4IHTA 2OD5A 1W7PA 1ZG5A 1E2XA 5LHHA 4AIJA 2HZTA 3KCCA 4RGRA 3WE2A 4EJUA 1XD7A 2LKPA 3WTSC 3LAPA 3O6BB 1R22A 2D1VA 2GA2A 1ZH5A 4G94A 1TBXA 3LA7A 4U7DA 3V7SA 3EYYA 3C3WA 3EETA 2ETHA 4YFNF 3BROA 3F21A 4G9YA 1IN5A 3I71A 1TLHB 4KA4A 3ISPA 1CGPA 3C7JA 4MEXF 3RYRA 1QPMA 1K78A 3GZ6A 1P4WA 4RB2C 4QLCU 4IRHA 3T1BA 3K9TA 4MHGA 1YO5C 3CUQC 2L02A 3K0LA 4GCVA 1ZREA 4NHJA 4B09A 1Y0UA 1G4DA 1F9NA 1OMIA 3O3KA 4YIIA 1IN4A 2KIFA 4I7HA 1GVJA 5L3EA 3I64A 4ENNA 5E1ZB 2VC1A 1SFEA 2O6GE 5DUIA 3KETA 4U7BA 1R1VA 4EGZA 1EV7A 2K27A 1BI0A 3CUOA 5J8FA 1LB2A 5CVUA 2MD5A 1QNTA 5BMZA 1RNLA 1R7JA 5DCMA 1OPCA 1HSTA 1ONVA 2EV5A 2E1CA 1ZN2A 1R5GA 1UB9A 5ICGA 2YPRA 3T8RA 1O3TA 5ILVA 3QRFF 4EJTA 3V7CA 3M7GA 3JTGA 3I5UA 1KU2A 4YIFA 2X4HA 3V8LA 4MTEA 4A0YA 3I58A 2LDUA 2Q2EA 4MTDA 4AIHA 2F5FA 2CWEA 1LNWA 1U3EM 1RIOH 4A0XA 3KEQA 5CLSA 3N4MA 3DFGA 3VODA 3KP7A 2ZBKA 1SMTA 3R4KA 3KP2A 1ON1A 5D4RA 4HX4A 5L3GA 1FT9A 2GXGA 3VB2A 3V7RA 3F6VA 3GWZA 3I59A 4WF2A 1Z9CA 2OA4A 1W5SA 4HZFA 2F5CA 3ZMUA 2P4WA 5CVRA 4BQAA 1R00A 2P5LC 1O7FA 4MNUA 1XSXA 4UHTA 5D8LB 3GVAA 2FBHA 1U5TB 3WTXC 1IRGA 1ZG3A 5BS6A 3ZMZA 2EV6A 2O0YA 4N9IA 2OQGA 2VE8A 4CHUA 1Z91A 3FM5A 4ZYDA 2R7FA 3BJOA 5HS8A 2QM3A 1YS7A 4Q47A 3TGNA 5HVQC 3NQOA 5EEGA 1BM9A 3ZN0A 3CDHA 3RPUA 3MQ0A 3K1PA 5D6FA 3F8CA 1RUNA 4HQMA 5TRDA 2J5OA 4CXFA 5AONA 2V6CA 1LEBA 4M9SA 5DD8A 2P5VA 5JVTA 4HLXA 4OINF 1P4XA 2HWVA 1F5TA 2W57A 3CLOA 2WC2A 2KIMA 3DEUA 5E8IA 2VOOA 3QAHA 4LMYA 3Q9SA 3R6SA 5FB2A 4XRFA 2K7LA 3WTYC 1FNNA 4UNOA 3CTAA 1ZHFA 3VOEA 2Z5UA 2R3SA 5LLQA 3I59B 3IKTA 4IXAA 2PBIA 2MLGA 4BAYA 1XN7A 1WWXA 4WWCA 3HYIA 2XASA 2DPDA 5LHGA 2QQ9A 1YG2A 2RN7A 4HQEA 1GXQA 3ECOA 3FXQA 3GEZA 4OU0A 2O03A 1YS6A 3ML6A 3WGIA 1FP1D 4ASNA 3ZMTA 4U0VA 2AS5F 3KP4A 4P96A 5D8KB 4AVPA 3ECHA 2IA0A 4KNYA 4I02A 1TNTA 3EQLF 1MKMA 5BPDA 2KJCA 4O6JA 2XAQA 4A2UA 4IF4A 2Z99A 4R79A 3CO6C 4BHPA 3ERED 4BH9A 2JSCA 3HUGA 1REPC 4R1HA 4LK0F 5L3BA 2QVOA 4PDKA 3ZQ7A 2ELHA 3GF2A 2VBYA 3G3ZA 4RB0A 2O61A 1UFMA 1B6AA 1QZYA 3CUQA 4UVBA 1HKSA 3RTRA 1QQIA 5D4SA 3GO5A 3KP5A 4UVCA 2D45A 2A5YB 1JHFA 3EDPA 2ISZA 3JSPA 1RZ4A 1O3RA 3KLOA 3MAJA 1Q1HA 3E5QA 2W84A 4GYGA 2KKOA 3WGHA 1HXDA 1MJ9A 5FLXZ 2AXLA 3PFIA 2ZMEA 1GXPA 1XCVA 1SD7A 3P9IA 3QOPA 1MDMA 2YX7A 2R7DA 4HX7A 4OIRF 5IT9K 1G3TA 4XSZF 3TQNA 3F3XA 2XKOA 4RAYA 2TDXA 1ZRFA 2ZNYA 2BV6A 4PGGA 6PAXA 3T8TA 5K5QA 1J7KA 3LWFA 1B4AA 1BIBA 3C1DA 1LDJA 5BOXA 3HIFA 2O3FA 4XBFA 3MZYA 4PGHA 3FHZA 4BNCA 3BOQA 4KICA 1J2XA 1BI1A 1KGSA 3WU0A 1FYLA 2VOPA 5AIQA 1LJ9A 4D0PA 3BJ6A 1ZGAA 2XAGA 2FXAA 1CF7B 3GUDA 4QWQA 4HV5A 4M6XA 4S05A 5LGNA 2DU9A 2EJRA 5ICCA 2XAFA 5IT9Z 2A69F 4HAMA 2UXNA 5H6RA 1UCRA 2ZJ2A 2ZNZA 3FXRA 4LLGF 1ZLKA 3WTVC 2NAZA 4KYWA 4YFKF 4I09A 4KIFA 3DPTA 3NRVA 2EFQA 3WTWC 4M72A 3RYPA 1KU3A 5BQTA 4G7OF 1XSDA 1R36A 1WSUA 4EM1A 1T98A 1WQ2A 4UUVA 2HTJA 1IXRC 5CVJA 3SFZA 4RB1A 1B1BA 1TNSA 1P6RA 1SMYF 3F8NA 3JSOA 2VXZA 2MH9A 2UWMA 5FD6A 1XGMA 1IN6A 2NRAC 1YW7A 2MC3A 2VN2A 3MCZA 3WODF 3V8JA 5HLGA 3I53A 1ULYA 2H09A 3HRMA 3LA3A 2XRNA 2DQLA 1J9IA 2YX4A 2VC0A 3E6CC 3J7AO 3PQKA 1J75A 3NEUA 3TO7A 2QZ8A 2W85A 2OBPA 1G3SA 2P6SA 3U9GA 4EQQA 1W7PB 1IW7F 1KYZA 4CGZA 2M45A 2PEXA 2QQAA 2FBKA 3FMQA 3QU3A 2V1UA 3ZN1A 4EJOA 2RC4A 4HW0A 2H94A 4HOBA 4KN7X 1T0FA 5HOOA 4P55A 3FX3A 4ENJA 1FP2A 2FMLA 4A6DA 4KIGA 3GXOA 1T38A 2L3DA 4YFXF 2EFNA 1NHAA 2CO5A 2BBYA 1D8KA 5LEKA 1ZG1A 1RI7A 2CFXA 5L3FA 3DXJF 2UZKA 3EUHA 2DPUA 4BYYA 4UV8A 2FQ3A 2IRFG 2EB7A 1J5YA 2H27A 5LRRA 2FSWA 4RGXA 1BJAA 3TOAA 3WG9A 1I6XA 4FHTA 3LQRA 2KRFA 4JQFA 3J80Z 2ZMEB 1QO0D 3R60A 3WTUC 2LF8A 2HOEA 1XB4A 2CGPA 1TQMA 3ZP5A 2DI3A 1MD0A 4PZJA 4KMUX 3HOTA 1Z1DA 1XGNA 5TJJA 3SHFA 4ZZDA 2XUBA 2HQRA 5E20A 1S7OA 1BC8C 1FLIA 1FX7A 3HHHA 1IRFA 1IF1A 1HW2A 4K2EA 1DPRA 4IRIA 1TW3A 4DNCA 5D5WB 1S3JA 2DK5A 2DO7A 3U2RA 4KDPA 5FFXA 4YG2F 2STTA 1SFXA 3D0SA 2HGCA 3E6MA 1Z7UA 3M1EA 4WX9A 2XAHA 3BDDA 4CYDA 2IT0A 2A61A 4LGWA 1BBYA 3J80K 1K79A 2VBZA 4A5MA 4M71A 2GXBA 3HTUA 1IAWA 2P7VB 3IL2A 3E5UA 3LA2A 2PQ8A 3FWEA 2L54A 3E6DA 1LQ1A 2IP2A 2Q8KA 1MZBA 1KQ8A 3FMSA 1FWZA 3S2WA 1KYWA 4EJWA 4KMFA 4KFCA 1R1TA 3QPTA 2VBXA 1SAXA 3F8MA 4LJZF 4ZH4F 3K2ZA 3KEOA 3M8EA 2HDCA 4I01A 4L5IA 3GFIA 1YTYA 3DF8A 3LFKA 4I2OA 4FT8A 2E1NA 4LLNA 4F7ZA 2WWYA 1U5TA 3ZMVA 3RPQA 3RJPA 3E6BA 3IRRA 2BE5F 4OIQF 2A68F 4LK1F 2ISYA 2RGVA 4A5NA 4ENKA 2YR2A 4LB5A 3HRUA 5LRSA 4Y13A 1FY7A 2IJLA 2GZWA 4U88A 4G7ZF 2K02A 1PP7U 3W6KB 3Q5FA 1W5TA 4FX4A 2EFOA 3R0JA 1T39A 1WI9A 3SXYA 3K1MA 1USSA 2DTRA 4P9FA 2WTEA 2CSOA 3E5XA 3FXUA 2XHKA 4PCQA 1BC7C 1XDSA 5E18F 1OYYA 2ZXJA 2PI0A 1USTA 2FRHA 2V9VA 4ON0A 4UVAA 4WXHA 4FX0A 2BYVE 3DKWA 3F22A 3GLXA 5D5XB 3KFWX 1SD6A 4OIPF 2G9WA 4LB6B 4RGUA 1WRJA 2PG4A 3TO6A 5E1WA 5DV5A 3TOBA 3Q9VA 5DCMB 3B02A 1L0OC 1XMKA 3PQJA 1O57A 3OV8A 1MJAA 2HR3A 3ROUA 2DFIA 2VT3A 2P6TA 3MZHA 2XIGA 2IA2A 1FBQA 2CG4A 3GX4X 3IRQA 1XSVA 3BPVA 2H6BA 4MEYF 4NB5A 2HEOA 1OYIA 5L3CA 1D8JA 1G6NA 5EEHA 1QZZA 1O3SA 5J8CA 4A0ZA 2JPCA 1ZGJA 3DP7A 2DQRA 2XROA 2QLZA 1HQCA 3M9AA 3F72A 1ODDA 1U78A 2FNPA 1BN5A 2NNYA 3KP3A 4XLNF 1OKRA 1TTYA 2QYOA 5IT3A 3O2PE 4XSXF 1BOAA 4RGSA 1EH7A 2KIUA 4E70A 1H9TA 4RB3C 4BHBA 1R58A 2E7XA 2NYXA 3ABUA 3FZVA 5LEJA 3RDIA 5E8GA 4L0ZB 4O3MA 4G6DA 1HKTA 3RKWA 3DPLC 4Q4ZF 3D5LA 1U8RA 3WTTC 2C6YA 2FEZA 2UXXA 3I4PA 1HSJA 2VE9A 1G3YA 2DAOA 1P2FA 3DV8A 3H92A 1VTNC 4NQWA 3JW4A 1IXSB 1XCBA 2EFWA 5H20A 1ON2A 1K6OA 5CJ9A 1L3LA 3B73A 2PMHA 4MQVA 1YW9A 3T0YA 5E17F 2V79A 3KP6A 4P9UA 4OIOF 5KVRA 4UV9A 4AWXB 3LQQA 2RVCA 1KA8A 2DT5A 4RS8A 4HF2A 1T2KA 2RV8A 4HYEA 2J5PA 4Y15A 1XMAA 2LF7A 2DLLA 2XKPA 2L4MA 4EMSA 3HHGA 2QENA 1MDMB 1B9NA 2RQPA 5A2QK 4IJAA 4G7HF 2JRTA 4RAZA 3BPXA 1YW8A 3H3UA 2A6EF 3DQVC 3N97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLN A;  1FYK A;  3JTH A;  2KJB A;  1V3F A;  3E97 A;  1FPQ A;  1FYM A;  4L9V A;  4I0A A;  1ZAO A;  4L9J A;  4CIC A;  4L0Y B;  1O7L A;  3FF5 A;  1F4K A;  5A2Q Z;  3COA C;  5K1Y A;  4HV6 A;  5CVI A;  5ILS A;  4ESF A;  3ZPL A;  2OQR A;  5ERI A;  3HOS A;  4M6Y A;  4JBA A;  4M74 A;  1EH6 A;  4MQ9 F;  3P7N A;  1S6L A;  4ZYE A;  1YLF A;  1QGP A;  4OOI A;  1HBX G;  1I5Z A;  2FMY A;  4LLL A;  2OZ6 A;  3G73 A;  2H6C A;  5J6X A;  3GZ5 A;  3C18 A;  1W7P D;  3AAF A;  1LEA A;  2CW0 F;  3IHU A;  1R5H A;  4EJV A;  5D5U B;  2ZCW A;  1PP8 F;  1DDN A;  2DBB A;  2JPB A;  1YYV A;  4IVN A;  2HS5 A;  4WXD A;  5ICF A;  2PLY A;  2F5E A;  4KN4 X;  2OZU A;  1U2W A;  1KU7 A;  3L9F A;  3L00 A;  1I1G A;  1I27 A;  3JAM K;  3J81 K;  2QBY A;  3R61 A;  2XGX A;  4OMY A;  1YQA A;  2Z9O A;  3HSR A;  2BGC A;  1FZP B;  2MLK A;  1B9M A;  4B8X A;  2EA4 A;  3TDU C;  2QBY B;  4HX8 A;  1W4M A;  2G7H A;  2A07 F;  2DW4 A;  3J81 Z;  2XV4 S;  2JTV A;  4I0B A;  4LG0 A;  3SZT A;  5JHU A;  5DUK A;  1BIA A;  3HRT A;  1O3Q A;  3BWG A;  2WV0 A;  3ULQ B;  4WK8 F;  2YSR A;  1LDD A;  4HA8 A;  2Y0M A;  3IWZ A;  1ZAR A;  4Q5S F;  1TQI A;  5JR3 A;  4HF1 A;  4BHC A;  4L18 B;  5BPI A;  4CZZ A;  3I0T A;  1TQP A;  4MGR A;  2Z33 A;  4LD5 A;  3OOP A;  2RNJ A;  3TKY A;  3CJN A;  2PJP A;  2HFH A;  5JFR A;  3RKX A;  1ZRC A;  1MGT A;  2EA2 A;  4EM2 A;  3MWM A;  3V8K A;  5FFZ A;  4Y17 A;  4ZYH A;  2OU2 A;  2A3S A;  4LFU A;  2ZFW A;  3GFM A;  4GYI A;  4ZZL A;  5LGT A;  5DDG A;  2A6H F;  3BZ6 A;  2Z3Y A;  1BI2 A;  1S7A A;  5F6F A;  3BY6 A;  3BJA A;  5JI6 A;  2NS0 A;  4HDV A;  2D2W A;  4AD9 A;  1FBU A;  4G8X A;  4KT5 C;  2CQK A;  5L3D A;  1R1U A;  1F1Z A;  3L09 A;  3R0A A;  1IUY A;  2DK8 A;  3QP6 A;  3WU1 B;  1XGO A;  1IZ1 A;  1KQ0 A;  5HS9 A;  4ESJ A;  5K5R A;  1C0W A;  3M8F A;  3RIR A;  1DUX C;  4I98 B;  1WKM A;  4IPA A;  2M87 A;  1FSH A;  2ESH A;  2MA3 A;  2FE3 A;  1FC3 A;  4U0W A;  2L01 A;  5DEQ A;  5HLI A;  1J0R A;  4ETS A;  3MEX A;  3HRS A;  1T6S A;  2QUF A;  5AIP A;  4WCG A;  5LGU A;  5HDG A;  5H6Q A;  1ZYR F;  2YU3 A;  5LBQ A;  4EM0 B;  3WE3 A;  4IRG A;  3V4G A;  2IA1 A;  4DQ2 A;  3RKY A;  1DPU A;  2PMU A;  1B59 A;  2F2E A;  1P92 A;  1FSE A;  1RUO A;  4G6Q A;  2E7W A;  4CDG A;  4WXC A;  1Z05 A;  2BEO A;  2HKO A;  5LHI A;  1SFU A;  4A12 A;  2LSO A;  5KK1 A;  2VBW A;  1IXC A;  4XLP F;  3VEP A;  1YIO A;  4L9T A;  1P4A A;  1U5T C;  3IC7 A;  3MFK A;  3IWF A;  3LAJ A;  2RKH A;  1U6G A;  2RDP A;  1JXS A;  3W6J B;  2GIV A;  3IKV A;  5FD5 A;  4HDU A;  1QBJ A;  1X3U A;  1FBS A;  3ABT A;  2FF4 A;  1H0M A;  1D3Y A;  4AIK A;  2COM A;  1OYW A;  2ADU A;  3WGG A;  3K1N A;  4Q48 A;  5FO5 A;  4BXU A;  4LG0 B;  2ZKZ A;  2ACJ A;  1DP7 P;  2B0L A;  1OR7 A;  1BI3 A;  2JT1 A;  1STZ A;  1A04 A;  3T5X A;  3EYI A;  3QPH A;  2EFP A;  1JE8 A;  1SD4 A;  2MBF A;  4GGG A;  2GA1 A;  5HLH A;  4JK1 X;  4O5V A;  4U0Y A;  3GFL A;  4Z2Y A;  5DYM A;  3VFZ A;  4OMZ A;  3E3V A;  3RI4 A;  1D5V A;  1G3W A;  4R8H A;  2JZY A;  2GWR A;  3GFJ A;  2VOD A;  5HDN A;  4HF0 A;  1JGS A;  5DD4 A;  3K69 A;  4N0B A;  2K4B A;  2QWW A;  5FLX K;  3FM3 A;  2IPQ X;  3TDZ C;  1CF7 A;  2W24 A;  2VON A;  4GXO A;  3CO7 C;  1LVA A;  2PFB A;  5ILU A;  2QQB A;  2Y75 A;  2NNN A;  1S29 A;  2OAZ A;  3SZP A;  3CUQ B;  1UHW A;  5K5O A;  1EH8 A;  1E17 A;  3ZMS A;  2L4A A;  1YFH A;  4CO8 A;  5HS7 A;  2HKX A;  4P5O A;  2IW5 A;  2HYG D;  1AWC A;  2HYF A;  4KUM A;  5ICE A;  4M73 A;  1TW2 A;  1J59 A;  4EGY A;  1Z6T A;  2ESN A;  4TV7 A;  3LST A;  4IHS A;  2EV0 A;  2K86 A;  4ENM A;  2K4J A;  1ZRD A;  4KIB A;  5FGM A;  5CYV A;  4ZYG A;  5DCF A;  2HQN A;  3KZZ A;  3U1D A;  1I1S A;  1AOY A;  2ZO4 A;  3P9C A;  1R23 A;  3HSF A;  2Y48 A;  3L7W A;  3WTZ A;  3F8B A;  1S8N A;  1ZLJ A;  3BP8 A;  1V4R A;  1PDN C;  1HW1 A;  3HTS B;  1IN7 A;  1K78 B;  1IN8 A;  4L9N A;  2STW A;  4A6E A;  1MJB A;  3TO9 A;  2MH2 A;  2O8X A;  2M1B A;  5ED4 A;  2M5W A;  2GAU A;  1XGS A;  4L5J A;  4EVI A;  3H3Z A;  4EV0 A;  5HDK A;  4ESB A;  3JAM Z;  1UHM A;  2FU4 A;  2X0L A;  2P8T A;  1LDK B;  2CYY A;  3L2C A;  2P5K A;  2EK5 A;  3KE2 A;  2V1X A;  2LNB A;  4M9X A;  4S04 A;  3F23 A;  4GO1 A;  5CVV A;  2PN6 A;  1K7A A;  2XAJ A;  1KU9 A;  1SD5 A;  3P9K A;  2M8E A;  5D6E A;  3GW2 A;  3FMR A;  3I54 A;  2D1H A;  3F6O A;  3ELK A;  2F5D A;  4N9H A;  3GYH X;  4HBL A;  1PUE E;  2XVC A;  3KZY A;  2FNA A;  1Z6R A;  2P7C B;  2V1D A;  5F64 A;  2IVM A;  5D5V B;  2G7U A;  3F8F A;  3REO A;  1FOK A;  2FA5 A;  5F1R A;  2W25 A;  4UXN A;  2FOK A;  2EWN A;  3QP5 A;  5E1X A;  4HLY A;  1HKQ A;  1HW5 A;  2HTS A;  3QU6 A;  3ZMD A;  1JHH A;  2VT2 A;  4H0E A;  3HSE A;  1GHC A;  2M30 A;  1XDU A;  1H9G A;  2Q0O A;  2GQQ A;  4M9Z A;  1KQ9 A;  2FBI A;  3SQN A;  4IHT A;  2OD5 A;  1W7P A;  1ZG5 A;  1E2X A;  5LHH A;  4AIJ A;  2HZT A;  3KCC A;  4RGR A;  3WE2 A;  4EJU A;  1XD7 A;  2LKP A;  3WTS C;  3LAP A;  3O6B B;  1R22 A;  2D1V A;  2GA2 A;  1ZH5 A;  4G94 A;  1TBX A;  3LA7 A;  4U7D A;  3V7S A;  3EYY A;  3C3W A;  3EET A;  2ETH A;  4YFN F;  3BRO A;  3F21 A;  4G9Y A;  1IN5 A;  3I71 A;  1TLH B;  4KA4 A;  3ISP A;  1CGP A;  3C7J A;  4MEX F;  3RYR A;  1QPM A;  1K78 A;  3GZ6 A;  1P4W A;  4RB2 C;  4QLC U;  4IRH A;  3T1B A;  3K9T A;  4MHG A;  1YO5 C;  3CUQ C;  2L02 A;  3K0L A;  4GCV A;  1ZRE A;  4NHJ A;  4B09 A;  1Y0U A;  1G4D A;  1F9N A;  1OMI A;  3O3K A;  4YII A;  1IN4 A;  2KIF A;  4I7H A;  1GVJ A;  5L3E A;  3I64 A;  4ENN A;  5E1Z B;  2VC1 A;  1SFE A;  2O6G E;  5DUI A;  3KET A;  4U7B A;  1R1V A;  4EGZ A;  1EV7 A;  2K27 A;  1BI0 A;  3CUO A;  5J8F A;  1LB2 A;  5CVU A;  2MD5 A;  1QNT A;  5BMZ A;  1RNL A;  1R7J A;  5DCM A;  1OPC A;  1HST A;  1ONV A;  2EV5 A;  2E1C A;  1ZN2 A;  1R5G A;  1UB9 A;  5ICG A;  2YPR A;  3T8R A;  1O3T A;  5ILV A;  3QRF F;  4EJT A;  3V7C A;  3M7G A;  3JTG A;  3I5U A;  1KU2 A;  4YIF A;  2X4H A;  3V8L A;  4MTE A;  4A0Y A;  3I58 A;  2LDU A;  2Q2E A;  4MTD A;  4AIH A;  2F5F A;  2CWE A;  1LNW A;  1U3E M;  1RIO H;  4A0X A;  3KEQ A;  5CLS A;  3N4M A;  3DFG A;  3VOD A;  3KP7 A;  2ZBK A;  1SMT A;  3R4K A;  3KP2 A;  1ON1 A;  5D4R A;  4HX4 A;  5L3G A;  1FT9 A;  2GXG A;  3VB2 A;  3V7R A;  3F6V A;  3GWZ A;  3I59 A;  4WF2 A;  1Z9C A;  2OA4 A;  1W5S A;  4HZF A;  2F5C A;  3ZMU A;  2P4W A;  5CVR A;  4BQA A;  1R00 A;  2P5L C;  1O7F A;  4MNU A;  1XSX A;  4UHT A;  5D8L B;  3GVA A;  2FBH A;  1U5T B;  3WTX C;  1IRG A;  1ZG3 A;  5BS6 A;  3ZMZ A;  2EV6 A;  2O0Y A;  4N9I A;  2OQG A;  2VE8 A;  4CHU A;  1Z91 A;  3FM5 A;  4ZYD A;  2R7F A;  3BJO A;  5HS8 A;  2QM3 A;  1YS7 A;  4Q47 A;  3TGN A;  5HVQ C;  3NQO A;  5EEG A;  1BM9 A;  3ZN0 A;  3CDH A;  3RPU A;  3MQ0 A;  3K1P A;  5D6F A;  3F8C A;  1RUN A;  4HQM A;  5TRD A;  2J5O A;  4CXF A;  5AON A;  2V6C A;  1LEB A;  4M9S A;  5DD8 A;  2P5V A;  5JVT A;  4HLX A;  4OIN F;  1P4X A;  2HWV A;  1F5T A;  2W57 A;  3CLO A;  2WC2 A;  2KIM A;  3DEU A;  5E8I A;  2VOO A;  3QAH A;  4LMY A;  3Q9S A;  3R6S A;  5FB2 A;  4XRF A;  2K7L A;  3WTY C;  1FNN A;  4UNO A;  3CTA A;  1ZHF A;  3VOE A;  2Z5U A;  2R3S A;  5LLQ A;  3I59 B;  3IKT A;  4IXA A;  2PBI A;  2MLG A;  4BAY A;  1XN7 A;  1WWX A;  4WWC A;  3HYI A;  2XAS A;  2DPD A;  5LHG A;  2QQ9 A;  1YG2 A;  2RN7 A;  4HQE A;  1GXQ A;  3ECO A;  3FXQ A;  3GEZ A;  4OU0 A;  2O03 A;  1YS6 A;  3ML6 A;  3WGI A;  1FP1 D;  4ASN A;  3ZMT A;  4U0V A;  2AS5 F;  3KP4 A;  4P96 A;  5D8K B;  4AVP A;  3ECH A;  2IA0 A;  4KNY A;  4I02 A;  1TNT A;  3EQL F;  1MKM A;  5BPD A;  2KJC A;  4O6J A;  2XAQ A;  4A2U A;  4IF4 A;  2Z99 A;  4R79 A;  3CO6 C;  4BHP A;  3ERE D;  4BH9 A;  2JSC A;  3HUG A;  1REP C;  4R1H A;  4LK0 F;  5L3B A;  2QVO A;  4PDK A;  3ZQ7 A;  2ELH A;  3GF2 A;  2VBY A;  3G3Z A;  4RB0 A;  2O61 A;  1UFM A;  1B6A A;  1QZY A;  3CUQ A;  4UVB A;  1HKS A;  3RTR A;  1QQI A;  5D4S A;  3GO5 A;  3KP5 A;  4UVC A;  2D45 A;  2A5Y B;  1JHF A;  3EDP A;  2ISZ A;  3JSP A;  1RZ4 A;  1O3R A;  3KLO A;  3MAJ A;  1Q1H A;  3E5Q A;  2W84 A;  4GYG A;  2KKO A;  3WGH A;  1HXD A;  1MJ9 A;  5FLX Z;  2AXL A;  3PFI A;  2ZME A;  1GXP A;  1XCV A;  1SD7 A;  3P9I A;  3QOP A;  1MDM A;  2YX7 A;  2R7D A;  4HX7 A;  4OIR F;  5IT9 K;  1G3T A;  4XSZ F;  3TQN A;  3F3X A;  2XKO A;  4RAY A;  2TDX A;  1ZRF A;  2ZNY A;  2BV6 A;  4PGG A;  6PAX A;  3T8T A;  5K5Q A;  1J7K A;  3LWF A;  1B4A A;  1BIB A;  3C1D A;  1LDJ A;  5BOX A;  3HIF A;  2O3F A;  4XBF A;  3MZY A;  4PGH A;  3FHZ A;  4BNC A;  3BOQ A;  4KIC A;  1J2X A;  1BI1 A;  1KGS A;  3WU0 A;  1FYL A;  2VOP A;  5AIQ A;  1LJ9 A;  4D0P A;  3BJ6 A;  1ZGA A;  2XAG A;  2FXA A;  1CF7 B;  3GUD A;  4QWQ A;  4HV5 A;  4M6X A;  4S05 A;  5LGN A;  2DU9 A;  2EJR A;  5ICC A;  2XAF A;  5IT9 Z;  2A69 F;  4HAM A;  2UXN A;  5H6R A;  1UCR A;  2ZJ2 A;  2ZNZ A;  3FXR A;  4LLG F;  1ZLK A;  3WTV C;  2NAZ A;  4KYW A;  4YFK F;  4I09 A;  4KIF A;  3DPT A;  3NRV A;  2EFQ A;  3WTW C;  4M72 A;  3RYP A;  1KU3 A;  5BQT A;  4G7O F;  1XSD A;  1R36 A;  1WSU A;  4EM1 A;  1T98 A;  1WQ2 A;  4UUV A;  2HTJ A;  1IXR C;  5CVJ A;  3SFZ A;  4RB1 A;  1B1B A;  1TNS A;  1P6R A;  1SMY F;  3F8N A;  3JSO A;  2VXZ A;  2MH9 A;  2UWM A;  5FD6 A;  1XGM A;  1IN6 A;  2NRA C;  1YW7 A;  2MC3 A;  2VN2 A;  3MCZ A;  3WOD F;  3V8J A;  5HLG A;  3I53 A;  1ULY A;  2H09 A;  3HRM A;  3LA3 A;  2XRN A;  2DQL A;  1J9I A;  2YX4 A;  2VC0 A;  3E6C C;  3J7A O;  3PQK A;  1J75 A;  3NEU A;  3TO7 A;  2QZ8 A;  2W85 A;  2OBP A;  1G3S A;  2P6S A;  3U9G A;  4EQQ A;  1W7P B;  1IW7 F;  1KYZ A;  4CGZ A;  2M45 A;  2PEX A;  2QQA A;  2FBK A;  3FMQ A;  3QU3 A;  2V1U A;  3ZN1 A;  4EJO A;  2RC4 A;  4HW0 A;  2H94 A;  4HOB A;  4KN7 X;  1T0F A;  5HOO A;  4P55 A;  3FX3 A;  4ENJ A;  1FP2 A;  2FML A;  4A6D A;  4KIG A;  3GXO A;  1T38 A;  2L3D A;  4YFX F;  2EFN A;  1NHA A;  2CO5 A;  2BBY A;  1D8K A;  5LEK A;  1ZG1 A;  1RI7 A;  2CFX A;  5L3F A;  3DXJ F;  2UZK A;  3EUH A;  2DPU A;  4BYY A;  4UV8 A;  2FQ3 A;  2IRF G;  2EB7 A;  1J5Y A;  2H27 A;  5LRR A;  2FSW A;  4RGX A;  1BJA A;  3TOA A;  3WG9 A;  1I6X A;  4FHT A;  3LQR A;  2KRF A;  4JQF A;  3J80 Z;  2ZME B;  1QO0 D;  3R60 A;  3WTU C;  2LF8 A;  2HOE A;  1XB4 A;  2CGP A;  1TQM A;  3ZP5 A;  2DI3 A;  1MD0 A;  4PZJ A;  4KMU X;  3HOT A;  1Z1D A;  1XGN A;  5TJJ A;  3SHF A;  4ZZD A;  2XUB A;  2HQR A;  5E20 A;  1S7O A;  1BC8 C;  1FLI A;  1FX7 A;  3HHH A;  1IRF A;  1IF1 A;  1HW2 A;  4K2E A;  1DPR A;  4IRI A;  1TW3 A;  4DNC A;  5D5W B;  1S3J A;  2DK5 A;  2DO7 A;  3U2R A;  4KDP A;  5FFX A;  4YG2 F;  2STT A;  1SFX A;  3D0S A;  2HGC A;  3E6M A;  1Z7U A;  3M1E A;  4WX9 A;  2XAH A;  3BDD A;  4CYD A;  2IT0 A;  2A61 A;  4LGW A;  1BBY A;  3J80 K;  1K79 A;  2VBZ A;  4A5M A;  4M71 A;  2GXB A;  3HTU A;  1IAW A;  2P7V B;  3IL2 A;  3E5U A;  3LA2 A;  2PQ8 A;  3FWE A;  2L54 A;  3E6D A;  1LQ1 A;  2IP2 A;  2Q8K A;  1MZB A;  1KQ8 A;  3FMS A;  1FWZ A;  3S2W A;  1KYW A;  4EJW A;  4KMF A;  4KFC A;  1R1T A;  3QPT A;  2VBX A;  1SAX A;  3F8M A;  4LJZ F;  4ZH4 F;  3K2Z A;  3KEO A;  3M8E A;  2HDC A;  4I01 A;  4L5I A;  3GFI A;  1YTY A;  3DF8 A;  3LFK A;  4I2O A;  4FT8 A;  2E1N A;  4LLN A;  4F7Z A;  2WWY A;  1U5T A;  3ZMV A;  3RPQ A;  3RJP A;  3E6B A;  3IRR A;  2BE5 F;  4OIQ F;  2A68 F;  4LK1 F;  2ISY A;  2RGV A;  4A5N A;  4ENK A;  2YR2 A;  4LB5 A;  3HRU A;  5LRS A;  4Y13 A;  1FY7 A;  2IJL A;  2GZW A;  4U88 A;  4G7Z F;  2K02 A;  1PP7 U;  3W6K B;  3Q5F A;  1W5T A;  4FX4 A;  2EFO A;  3R0J A;  1T39 A;  1WI9 A;  3SXY A;  3K1M A;  1USS A;  2DTR A;  4P9F A;  2WTE A;  2CSO A;  3E5X A;  3FXU A;  2XHK A;  4PCQ A;  1BC7 C;  1XDS A;  5E18 F;  1OYY A;  2ZXJ A;  2PI0 A;  1UST A;  2FRH A;  2V9V A;  4ON0 A;  4UVA A;  4WXH A;  4FX0 A;  2BYV E;  3DKW A;  3F22 A;  3GLX A;  5D5X B;  3KFW X;  1SD6 A;  4OIP F;  2G9W A;  4LB6 B;  4RGU A;  1WRJ A;  2PG4 A;  3TO6 A;  5E1W A;  5DV5 A;  3TOB A;  3Q9V A;  5DCM B;  3B02 A;  1L0O C;  1XMK A;  3PQJ A;  1O57 A;  3OV8 A;  1MJA A;  2HR3 A;  3ROU A;  2DFI A;  2VT3 A;  2P6T A;  3MZH A;  2XIG A;  2IA2 A;  1FBQ A;  2CG4 A;  3GX4 X;  3IRQ A;  1XSV A;  3BPV A;  2H6B A;  4MEY F;  4NB5 A;  2HEO A;  1OYI A;  5L3C A;  1D8J A;  1G6N A;  5EEH A;  1QZZ A;  1O3S A;  5J8C A;  4A0Z A;  2JPC A;  1ZGJ A;  3DP7 A;  2DQR A;  2XRO A;  2QLZ A;  1HQC A;  3M9A A;  3F72 A;  1ODD A;  1U78 A;  2FNP A;  1BN5 A;  2NNY A;  3KP3 A;  4XLN F;  1OKR A;  1TTY A;  2QYO A;  5IT3 A;  3O2P E;  4XSX F;  1BOA A;  4RGS A;  1EH7 A;  2KIU A;  4E70 A;  1H9T A;  4RB3 C;  4BHB A;  1R58 A;  2E7X A;  2NYX A;  3ABU A;  3FZV A;  5LEJ A;  3RDI A;  5E8G A;  4L0Z B;  4O3M A;  4G6D A;  1HKT A;  3RKW A;  3DPL C;  4Q4Z F;  3D5L A;  1U8R A;  3WTT C;  2C6Y A;  2FEZ A;  2UXX A;  3I4P A;  1HSJ A;  2VE9 A;  1G3Y A;  2DAO A;  1P2F A;  3DV8 A;  3H92 A;  1VTN C;  4NQW A;  3JW4 A;  1IXS B;  1XCB A;  2EFW A;  5H20 A;  1ON2 A;  1K6O A;  5CJ9 A;  1L3L A;  3B73 A;  2PMH A;  4MQV A;  1YW9 A;  3T0Y A;  5E17 F;  2V79 A;  3KP6 A;  4P9U A;  4OIO F;  5KVR A;  4UV9 A;  4AWX B;  3LQQ A;  2RVC A;  1KA8 A;  2DT5 A;  4RS8 A;  4HF2 A;  1T2K A;  2RV8 A;  4HYE A;  2J5P A;  4Y15 A;  1XMA A;  2LF7 A;  2DLL A;  2XKP A;  2L4M A;  4EMS A;  3HHG A;  2QEN A;  1MDM B;  1B9N A;  2RQP A;  5A2Q K;  4IJA A;  4G7H F;  2JRT A;  4RAZ A;  3BPX A;  1YW8 A;  3H3U A;  2A6E F;  3DQV C;  3N97 A; 
#chains in the Genus database with same CATH topology
 3KLN A;  1FYK A;  3JTH A;  1OLT A;  1V3F A;  2KJB A;  3KEY A;  1GT0 C;  3E97 A;  2V7F A;  2ZB9 A;  2ID3 A;  1FPQ A;  1FYM A;  2M4K A;  4L9V A;  1S9H A;  4I0A A;  1ZAO A;  3OYF A;  4L9J A;  5E79 C;  2VQL A;  2L9S A;  2X6X A;  4CIC A;  4L0Y B;  1ORK A;  1O7L A;  3FF5 A;  5E3M A;  1F4K A;  3S16 J;  2EIN H;  5A2Q Z;  1WJA A;  2KLO A;  2Z2S B;  2UV1 A;  4QIW N;  3COA C;  5K1Y A;  4HV6 A;  5CVI A;  1A31 A;  1HOM A;  4FQG A;  2AXT C;  3QOD A;  2HVQ A;  5ILS A;  4ESF A;  3ZPL A;  2OQR A;  5ERI A;  3K6G A;  3HOS A;  4M6Y A;  2KIS A;  3OYK A;  2JA6 J;  3OR1 C;  3ABK H;  2ID6 A;  1X3Z B;  4E7J A;  4JBA A;  1GUU A;  3CJR B;  4A3F J;  4M74 A;  4RBO A;  1EH6 A;  4MQ9 F;  3P7N A;  1OCC H;  1S6L A;  3G1M A;  1YLF A;  4ZYE A;  1K4S A;  1VQ9 I;  1QGP A;  4DBR A;  3E7L A;  4OOI A;  1HBX G;  2VI6 A;  2DJN A;  3IP4 B;  4RMN A;  3K7A J;  1I5Z A;  4PSW A;  2OF7 A;  3G6E I;  2QQ8 A;  2FMY A;  2XRL A;  2PJR A;  4LLL A;  2OZ6 A;  1Z0X A;  3G73 A;  2H6C A;  5J6X A;  3FKI J;  3C18 A;  3GZ5 A;  1W7P D;  3K4J A;  3AAF A;  2HYJ A;  1LEA A;  3IH4 A;  1MMN A;  2BZT A;  2CW0 F;  3IHU A;  2JA7 J;  2KZG A;  4A3J J;  1R5H A;  4EJV A;  5D5U B;  4A69 C;  2ZCW A;  2L7Z A;  2LBF B;  1KZH A;  1PP8 F;  5CPR B;  1LPQ A;  1DDN A;  2DBB A;  2JPB A;  1YYV A;  2ZXW H;  3HGY A;  4IVN A;  2HPM A;  2HS5 A;  3GTP J;  1D1C A;  3OMY A;  4BGD A;  3HDD A;  3Q0W A;  4WXD A;  3OS2 A;  4UUS A;  1UEL B;  3S93 A;  2NVY J;  4M3D A;  5ICF A;  3SDG A;  3ZQF A;  1P7J A;  4JP0 A;  2PLY A;  4C2T A;  2F5E A;  4KN4 X;  2OZU A;  1U2W A;  4IOC F;  1KU7 A;  3L9F A;  1ETO A;  3L00 A;  1I1G A;  1I27 A;  4RAG A;  3JAM K;  2LVS A;  3J81 K;  3CMM A;  2QBY A;  1APL C;  3IH2 A;  1VQ6 I;  4ZDL A;  1WH5 A;  3R61 A;  2IGK A;  2BOL A;  2XGX A;  4OMY A;  1YQA A;  3OYE A;  1HLV A;  1FIA A;  2DMT A;  2Z9O A;  3HSR A;  2BGC A;  1Z3X A;  4BE1 A;  2PMZ N;  1B8I A;  2KDZ A;  3I3L A;  2MLK A;  1B9M A;  2E5N A;  2E5Z A;  1FZP B;  3AG4 H;  4B8X A;  3OY9 A;  2EA4 A;  3TDU C;  2QBY B;  2DA2 A;  3S1Q J;  4HX8 A;  1W4M A;  2G7H A;  2A07 F;  3OYL A;  3TL4 X;  1PYV A;  4Z6Y A;  2DW4 A;  3J81 Z;  1EF4 A;  1BW6 A;  2O5R A;  2XV4 S;  3OR2 C;  2JTV A;  4I0B A;  2HXI A;  4LG0 A;  5IP6 A;  4C3I J;  2XC7 A;  3SZT A;  2DCE A;  4YEL A;  4B1R A;  5JHU A;  3CME I;  2CQ7 A;  5DUK A;  4BAC A;  1NH3 A;  1BIA A;  3HRT A;  1SAU A;  1O3Q A;  5JLX A;  3BWG A;  3SJM A;  2WV0 A;  3ULQ B;  5KAF C;  4WK8 F;  2E2J J;  2AHQ A;  1LDD A;  2YSR A;  3D5S C;  4HA8 A;  1JKP C;  2Y0M A;  4W97 A;  3IWZ A;  2R7Z J;  1ZAR A;  4XKC A;  1H89 C;  3CC7 I;  4Q5S F;  4HPQ A;  2V9K A;  5J1U A;  1TQI A;  5JR3 A;  1WJD A;  4BHC A;  4HF1 A;  4L18 B;  5BPI A;  2Y2Z A;  4CZZ A;  3I0T A;  1TQP A;  2Q2E B;  4MGR A;  1UZC A;  4BY7 J;  2Z33 A;  3S2D J;  4NC6 A;  4LD5 A;  3OOP A;  2RNJ A;  3TKY A;  1X1A A;  3CJN A;  2PJP A;  2HFH A;  5JFR A;  2R7S A;  1QA6 A;  3RKX A;  1MH3 A;  1O4X A;  1ZRC A;  1MGT A;  2EA2 A;  1MMD A;  4EM2 A;  3MWM A;  1V5E A;  2R7R A;  3V8K A;  4XNF A;  2NS8 A;  1YRN B;  5FFZ A;  4X0G A;  1YIT I;  3HOZ J;  3BLY A;  4Y17 A;  4ZYH A;  2OU2 A;  4HSR A;  2V9P A;  2A3S A;  3DU6 A;  4LFU A;  3ZQG A;  2ZFW A;  3GFM A;  4GYI A;  3K4N A;  4ZZL A;  5LGT A;  2FUG 2;  5GPC A;  5DDG A;  2A6H F;  2F6C A;  3BR2 A;  2M2E A;  3BZ6 A;  1MNM C;  1MBK A;  1Q1V A;  2Z3Y A;  1S5L C;  3JCU C;  1WZ2 A;  1BI2 A;  3CJT B;  3M07 A;  4IOA F;  1S7A A;  1IV6 A;  2QCO A;  3OOU A;  5F6F A;  2LTP A;  3BY6 A;  3M1C A;  3BJA A;  2JVG A;  1T0F C;  5JI6 A;  2R5Y B;  2NS0 A;  4HDV A;  2D2W A;  4AD9 A;  3PNT A;  3VYU B;  2A05 A;  4C2M J;  1FBU A;  4G8X A;  5M3F J;  2CQQ A;  4KT5 C;  3BQZ A;  3A0B C;  4DYR A;  2CQK A;  5L3D A;  1R1U A;  1F1Z A;  3KIO A;  3L09 A;  3LSJ A;  3R0A A;  1NG7 A;  3W2V A;  1K4T A;  3DTI A;  1IUY A;  5HOD A;  1JKQ C;  2DK8 A;  1VF9 A;  3OSG A;  2R7X A;  3QP6 A;  3V42 A;  4IQJ A;  3WU1 B;  1DQU A;  1XGO A;  4ZC3 A;  2DA3 A;  1IZ1 A;  4OWR B;  1KQ0 A;  2DN0 A;  5HS9 A;  3F9K A;  4UUS B;  3I56 I;  2X1E A;  4ESJ A;  4D1Q A;  5K5R A;  1C0W A;  3MKY B;  3M8F A;  2LH9 A;  4I98 B;  3RIR A;  1DUX C;  1WKM A;  4IPA A;  3FXL A;  3QYB A;  3I55 I;  2M87 A;  1FSH A;  2ESH A;  2MA3 A;  2FE3 A;  1FC3 A;  1U8B A;  4XOT A;  3VDX A;  3LFU A;  4U0W A;  4MFE A;  2EBI A;  2L01 A;  3SFI A;  1TC3 C;  5DEQ A;  3MKZ A;  4AM3 A;  5HLI A;  1J0R A;  4ETS A;  3MEX A;  3NAR A;  3HRS A;  1T6S A;  2QUF A;  3DCF A;  5DM7 F;  3A0H C;  1JI8 A;  5FRO A;  5AIP A;  4GDF A;  4WCG A;  5LGU A;  2B9S A;  1AKH B;  3K70 D;  3DBH B;  1RES A;  5GP9 A;  2ICW G;  5HDG A;  2GIZ A;  5H6Q A;  1ETQ A;  2IS6 A;  2XGE A;  1ZYR F;  2L7M P;  2YU3 A;  5LBQ A;  1OIS A;  4EM0 B;  1UG0 A;  1WJB A;  3WE3 A;  1B72 B;  4IRG A;  4NBQ A;  1S7E A;  3TP0 A;  4HEA 2;  3V4G A;  2IA1 A;  2CMP A;  4A93 J;  4DQ2 A;  1HDP A;  4IEJ A;  4IQ4 A;  3ZGK A;  2W48 A;  3RKY A;  2O8K A;  1DPU A;  4J00 A;  2PMU A;  2VQG A;  1WJ5 A;  4FIS A;  3IUO A;  2BY1 A;  2X51 A;  2Y9Y A;  1B59 A;  1Y6I A;  2F2E A;  1PUF A;  1P92 A;  2IS2 A;  1FSE A;  3VYS B;  4C2U A;  2LYC A;  3FXK A;  1RUO A;  2CUE A;  2CQX A;  4G6Q A;  4XRS G;  1OCR H;  2E7W A;  2L2O A;  1RKW A;  2X1C A;  5FKO A;  4CDG A;  4PSX A;  1QPI A;  4ZYA A;  2MC4 A;  4M3B A;  4WXC A;  2LY9 A;  1V5G A;  1Z05 A;  2BEO A;  4E7Z A;  3ABM H;  2GXA A;  2HKO A;  1GDT A;  5LHI A;  1W36 C;  2ZXI A;  1SFU A;  3MMY B;  3CCU I;  4A12 A;  2LSO A;  5KK1 A;  2VBW A;  1IXC A;  2X9D A;  4XLP F;  3VEP A;  1YIO A;  4L9T A;  1P4A A;  1U5T C;  4CYC A;  3IC7 A;  3MFK A;  1YX5 A;  4CCJ A;  3IWF A;  3S32 A;  2HZD A;  3K4C A;  4JOM A;  5KAI C;  3LAJ A;  3H1C A;  2OTL I;  2RKH A;  1TWH J;  1U6G A;  2RDP A;  1JXS A;  3W6J B;  1IDY A;  2GIV A;  3VSK A;  3IKV A;  5FD5 A;  4HDU A;  1QBJ A;  1X3U A;  5IOZ A;  1FBS A;  3ABT A;  2FF4 A;  1IJW C;  3MN2 A;  4M3G A;  4G6T B;  3UR3 C;  1QZE A;  1H0M A;  1GV5 A;  1D3Y A;  1QVT A;  4AIK A;  2COM A;  1TT5 B;  1OYW A;  2ADU A;  3WGG A;  3MKL A;  2B7E A;  2VLA A;  1RR7 A;  3K1N A;  2IGM A;  2HU9 A;  4Q48 A;  5FO5 A;  1BOB A;  3JRE A;  4BXU A;  3AFH A;  4LG0 B;  3CCV I;  4Y52 J;  2ZKZ A;  2ACJ A;  1DP7 P;  2B0L A;  1OR7 A;  2ZJR F;  2K5C A;  3HEF A;  1BI3 A;  2JT1 A;  1STZ A;  1A04 A;  3T5X A;  3EYI A;  3OS0 A;  3QPH A;  1E3O C;  2EFP A;  3LSR A;  2DOD A;  2OUM A;  1SD4 A;  2MBF A;  1JE8 A;  2BW3 A;  2WAD A;  4GGG A;  3SZG A;  3HKZ N;  2GA1 A;  5HLH A;  4JK1 X;  4YRV A;  4O5V A;  2Y30 A;  3U1K A;  4RM3 A;  4U0Y A;  3GTG J;  5EGO B;  4J01 A;  3GTJ J;  3DEW A;  3GFL A;  4Z2Y A;  3OSF A;  1E0E A;  3WU2 C;  3WHC A;  5DYM A;  3OYD A;  2HPI A;  3VFZ A;  1LFU P;  3FXJ A;  4OMZ A;  3E3V A;  3RI4 A;  3JRB A;  4E4H A;  1D5V A;  2R7W A;  5KCM A;  3FXM A;  5FRM A;  2CH0 A;  2BW3 B;  1G3W A;  4R8H A;  2JZY A;  3OYB A;  2GWR A;  5B66 C;  5J47 A;  5C4X J;  1VQK I;  3GFJ A;  4NNJ A;  2VOD A;  1YHQ I;  5HDN A;  4HF0 A;  2LRD A;  1JGS A;  5DD4 A;  1PVE A;  5IYC J;  2CU7 A;  3K69 A;  4N0B A;  1RC9 A;  2K4B A;  5IYB J;  2DDA A;  2QWW A;  5FLX K;  3FM3 A;  2IPQ X;  3TDZ C;  1CF7 A;  2W24 A;  2VON A;  4GXO A;  3FXO A;  1VQM I;  3CO7 C;  1VQ8 I;  1LVA A;  2PFB A;  5ILU A;  4XN3 A;  2AQE A;  2QQB A;  2Y75 A;  2NNN A;  2ZC2 A;  4FAS D;  4D7M A;  1S29 A;  3JRI A;  2OAZ A;  3SZP A;  3CUQ B;  1UHW A;  2MAB A;  5K5O A;  3JRH A;  1EH8 A;  2EH3 A;  1E17 A;  3ZMS A;  2L4A A;  4M6V A;  1YFH A;  4A3L J;  4CO8 A;  5HS7 A;  4U87 A;  2HKX A;  4P5O A;  2IW5 A;  1D5Y A;  1H8A C;  2HYG D;  3DLL F;  1D1B A;  2VPL A;  3G71 I;  1AWC A;  4Y33 A;  2HYF A;  1MMG A;  4KUM A;  4UB6 C;  1Z77 A;  2QSF X;  4UUT A;  3EUH C;  3JRG A;  5ICE A;  4M73 A;  3HG9 A;  1J09 A;  2ZXH A;  1R4N B;  1TW2 A;  1J59 A;  1FMW A;  4EGY A;  1Z6T A;  2ESN A;  3H5R A;  3HXL A;  4TV7 A;  3QWL A;  3QPL A;  3LST A;  1Y0N A;  4IHS A;  2KDO A;  2EV0 A;  2K86 A;  1X1B A;  4ENM A;  2K4J A;  3FBN B;  1ZRD A;  3G1O A;  4HNV A;  4KIB A;  5FGM A;  2XPU A;  5CYV A;  1SEU A;  3PFY A;  1R71 A;  3OL4 A;  4ZYG A;  4XM3 A;  5DCF A;  4OAZ A;  5H2F C;  2HQN A;  3ZQC A;  2M7B A;  3KZZ A;  1JKR C;  2LY2 A;  1B72 A;  3U1D A;  4E7S A;  1I1S A;  2LP0 A;  1AOY A;  1VQO I;  1OCP A;  2ZO4 A;  3P9C A;  1R23 A;  1TP4 A;  4CH7 A;  1N78 A;  3BTJ A;  3CP8 A;  2X6W A;  3HSF A;  2Y48 A;  2H8R A;  2JN6 A;  3L7W A;  1X1P A;  3WTZ A;  2P0W A;  3F8B A;  3BR6 A;  2R5Y A;  1S8N A;  1ZLJ A;  3BP8 A;  1V4R A;  3MD2 A;  2O7O A;  1PDN C;  1HW1 A;  2E35 A;  1BA5 A;  2X48 A;  3HTS B;  1IN7 A;  3M8J A;  1K78 B;  5CKT A;  1IN8 A;  4L9N A;  2STW A;  1IG7 A;  4A6E A;  1MJB A;  3TO9 A;  4D7N A;  2ZME C;  2MH2 A;  4DBQ A;  2O8X A;  2M1B A;  5ED4 A;  2M5W A;  5C4J J;  2GAU A;  1ZKG A;  1XGS A;  3BG7 A;  3RPU D;  2JA2 A;  4L5J A;  4EVI A;  3H3Z A;  3BR1 A;  4EV0 A;  2DA5 A;  4ESB A;  5HDK A;  2BXY A;  3JAM Z;  1UHM A;  2E36 A;  2OTJ I;  2FU4 A;  2X0L A;  3QYE A;  2P8T A;  3A01 A;  4FE7 A;  2VPR A;  1LDK B;  2CYY A;  2CV0 A;  3L2C A;  2P5K A;  2EK5 A;  3L2R A;  3KE2 A;  1FEX A;  2V1X A;  5CQE A;  2LNB A;  2M9H A;  1BR2 A;  3U21 A;  2LLK A;  4M9X A;  2JUG A;  3RQI A;  4S04 A;  2G0E A;  2VL8 A;  3F23 A;  4G12 A;  4GO1 A;  5CVV A;  2PN6 A;  4A3G J;  1R9T J;  1K7A A;  3CLQ A;  2XAJ A;  1KU9 A;  2DYS H;  1SD5 A;  1OQY A;  3P9K A;  2M8E A;  4NC7 A;  2BHZ A;  3OIO A;  2ECC A;  2H1L A;  5D6E A;  3ZCO A;  3GW2 A;  3FMR A;  3I54 A;  1YIJ I;  2FQ4 A;  2D1H A;  4BQQ A;  2MW8 A;  1JT6 A;  3F6O A;  2F4O B;  3ELK A;  4D5C A;  2F5D A;  4N9H A;  3GYH X;  3BR3 A;  2DMN A;  3PIP F;  4HBL A;  1W36 D;  3LSI A;  1PUE E;  1I39 A;  2XVC A;  3KZY A;  4I76 A;  2FNA A;  1FJL A;  3ABL H;  1Z6R A;  3VSL A;  2P7C B;  1A6Q A;  2V1D A;  5F64 A;  2IVM A;  5D5V B;  3HZJ A;  2VQH A;  2G7U A;  5B5E C;  1LVK A;  3UNG C;  3F8F A;  3REO A;  1FOK A;  2FA5 A;  5F1R A;  2W25 A;  4UXN A;  3H0D A;  4DYC A;  2BVM A;  3FK7 A;  2LD5 A;  2FOK A;  2VXD A;  2EWN A;  2DT6 A;  1Y56 A;  4V19 K;  4NQW B;  4RAF A;  2K9N A;  3QP5 A;  5E1X A;  4HLY A;  2JK3 A;  1HKQ A;  1HW5 A;  2HTS A;  2QF7 A;  3QU6 A;  1JHH A;  3ZMD A;  3ZXS A;  4DOZ A;  2JQ7 A;  2IS1 A;  1BL0 A;  3LL7 A;  2VT2 A;  4XKW A;  2XGD A;  4JX4 A;  4H0E A;  3HSE A;  1GHC A;  2M30 A;  1XDU A;  1H9G A;  2R7Q A;  4ABZ A;  1WJE A;  2NOG A;  3ERM A;  4A3K J;  2Q0O A;  5GTI C;  1TWC J;  2GQQ A;  4M9Z A;  2LRE A;  1LFP A;  1KQ9 A;  2FBI A;  1LUJ B;  2VKE A;  4IHY A;  3OL3 A;  4II2 A;  3SQN A;  5B1B H;  5C44 J;  1W0U A;  4IHT A;  2OD5 A;  1Y8R B;  1W7P A;  1ZG5 A;  1E2X A;  5LHH A;  3BTC A;  4AIJ A;  3S15 J;  2HZT A;  3KCC A;  1VQP I;  4RGR A;  3K10 A;  3WE2 A;  4EJU A;  1X58 A;  1XD7 A;  2LKP A;  3WTS C;  3LAP A;  3O6B B;  2HXO A;  2PJR B;  3ZRG A;  1R22 A;  2D1V A;  3MKW B;  2GA2 A;  3L2Q A;  1ZH5 A;  4G94 A;  1TBX A;  2DOE A;  3LA7 A;  3V7S A;  4U7D A;  3MZ8 A;  3EYY A;  3J7A Y;  3C3W A;  3EET A;  2ETH A;  4YFN F;  2CV2 A;  4BXX J;  3BRO A;  4UB8 C;  2DA6 A;  5F08 A;  3F21 A;  4G9Y A;  1IN5 A;  3BR0 A;  3I71 A;  1TLH B;  1A6I A;  3B6A A;  4KA4 A;  3ISP A;  2LY1 A;  3CCR I;  2KPM A;  2CUJ A;  4IL6 C;  3RZD J;  4LOC A;  1CGP A;  2WB1 N;  3C7J A;  3RYR A;  4MEX F;  2TRT A;  3W3C A;  4MIM A;  1QPM A;  1K78 A;  4W1U A;  3TP3 A;  1P4W A;  3GZ6 A;  1NK3 P;  3H35 A;  4RB2 C;  4CCK A;  1X1C A;  4QLC U;  2OC6 A;  4Y4R A;  4IRH A;  3T1B A;  1SVM A;  3K9T A;  5HNF A;  3LSM A;  1Y39 A;  4MHG A;  2HOS A;  1WCM J;  1YO5 C;  3CUQ C;  2NVT J;  2L02 A;  3K0L A;  2DFH A;  4XOR A;  3NAU A;  4GCV A;  2OCE A;  1ZRE A;  2K3P A;  4NHJ A;  2Y9Z A;  4B09 A;  1D0X A;  3HOY J;  1Y0U A;  1G4D A;  1F9N A;  1OMI A;  3O3K A;  4CCN A;  1MMA A;  2HOA A;  4YII A;  1IN4 A;  4XLA A;  2EZI A;  2K85 A;  2KIF A;  4B3A A;  4I7H A;  1GVJ A;  5L3E A;  1MSF C;  4A3C J;  3I64 A;  4ENN A;  4MO7 A;  3CC4 I;  2M3A A;  1JUM A;  4CUG A;  1R5I D;  5GAD J;  1OCT C;  5E1Z B;  3NWS A;  3L2W A;  1TWG J;  2VC1 A;  4XID A;  2GBY A;  1MBH A;  1SFE A;  2O6G E;  5DUI A;  3KET A;  2WAF A;  4U7B A;  4DZJ A;  1R1V A;  4EGZ A;  2M0C A;  3ZQQ A;  5TIS C;  5KHD A;  2QGU A;  5LFA A;  4BQO A;  4CCL A;  4E7L A;  1EV7 A;  5IY5 H;  2K27 A;  1GVD A;  3S3O A;  1BI0 A;  3CUO A;  5J8F A;  1LB2 A;  2XF5 A;  5CVU A;  2MD5 A;  1QNT A;  5BMZ A;  2VJI A;  1P7I A;  4AID A;  1RNL A;  1R7J A;  2EIL H;  5DCM A;  4BE2 A;  1OPC A;  1HST A;  3I9V 2;  1ONV A;  2EV5 A;  2E1C A;  9ANT A;  1ZN2 A;  1R5G A;  1UB9 A;  5ICG A;  2YPR A;  3T8R A;  4OAY A;  1O3T A;  3CDL A;  1X3W B;  5ILV A;  3QRF F;  4EJT A;  2IGO A;  3V7C A;  3M7G A;  4F93 B;  1XC5 A;  1SFO J;  3JTG A;  2NS7 A;  3I5U A;  2L0K A;  1KU2 A;  2DA7 A;  4YIF A;  3ASN H;  2X4H A;  3V8L A;  5IPA A;  3JR9 A;  2LMD A;  4MTE A;  4RLF A;  4A0Y A;  3I58 A;  2KFD A;  2LDU A;  1VZ0 A;  1BJZ A;  1Z67 A;  2Q2E A;  5LD2 C;  4MTD A;  4AIH A;  2F5F A;  3PIO F;  2CWE A;  3EUA A;  2HVS A;  4MLO A;  1LNW A;  4C3J J;  3CCJ I;  1JJ6 C;  1OJL A;  2NOJ B;  2E34 A;  1U3E M;  2QSH X;  1G2H A;  4F91 B;  2OCC H;  1RIO H;  4IHW A;  5TGT A;  2BHY A;  4A0X A;  3KEQ A;  4LIT A;  5CLS A;  1HDD C;  1BR4 A;  2AO9 A;  5JHF A;  2E1M C;  3N4M A;  3HOV J;  2ELK A;  4D9J A;  3DFG A;  3OYJ A;  4BY1 J;  3VOD A;  3KP7 A;  2CW8 A;  2ZBK A;  2BY2 A;  3PJR A;  1SMT A;  3R4K A;  3KP2 A;  5EJC A;  2IBD A;  1ON1 A;  2I5U A;  5D4R A;  4HX4 A;  3LSP A;  5L3G A;  1ETK A;  4PFP A;  1FT9 A;  2GXG A;  3K4K A;  3VB2 A;  1TZL A;  3S14 J;  1IV8 A;  3V7R A;  3GTO J;  2LKS A;  2EZK A;  3F6V A;  3GWZ A;  3I59 A;  4WF2 A;  3J7Y J;  3JRD A;  1Z9C A;  2OA4 A;  3NWT A;  4L5E A;  4QSH A;  1W5S A;  4LG3 A;  1U9O A;  4IZZ A;  4I99 C;  4HZF A;  2F5C A;  3CCL I;  3ZMU A;  4IO9 F;  2P4W A;  4A3D J;  5CVR A;  4BQA A;  1R00 A;  4PFO A;  1N25 A;  2VQC A;  4N4N B;  1O7F A;  1WGX A;  4MNU A;  1XSX A;  2P5L C;  4UHT A;  2E60 A;  3GVA A;  2FBH A;  5D8L B;  1U5T B;  3WTX C;  1EKE A;  2M7A A;  1IRG A;  1ZG3 A;  5BS6 A;  3ZMZ A;  2EV6 A;  2O0Y A;  2RQQ A;  2WY8 Q;  3FIS A;  1Y8Q B;  1ZEL A;  4N9I A;  2OQG A;  1HCR A;  2VE8 A;  4CHU A;  4IX7 A;  1Z91 A;  3OIQ A;  3FM5 A;  4ZYD A;  2R7F A;  3BJO A;  5HS8 A;  1ETV A;  1V5F A;  2L9N A;  2QM3 A;  3A03 A;  5FKN A;  4BKX A;  1RRJ A;  3C2H A;  5M5Y J;  1N77 A;  3W6V A;  3H9G A;  1YS7 A;  4Q47 A;  3TGN A;  1MBF A;  2X6Y A;  5HVQ C;  3VYT B;  3NQO A;  5EEG A;  1BM9 A;  3ZN0 A;  3CDH A;  3RPU A;  3MQ0 A;  3K1P A;  5D6F A;  3F8C A;  1ZQ3 P;  3A02 A;  1RUN A;  2WAQ N;  3LSK A;  4XIC A;  2VJJ A;  4HQM A;  5TRD A;  2J5O A;  1WVR A;  3TED A;  4CXF A;  3SYT A;  1T95 A;  4JYK A;  5AON A;  2V6C A;  1LEB A;  4M9S A;  4PK4 A;  5DD8 A;  4RLQ A;  2P5V A;  5JVT A;  3K4L A;  1ZR4 A;  4HLX A;  4OIN F;  4B43 A;  1P4X A;  3H5A A;  4S0H B;  3S2H J;  1HA8 A;  4DIQ A;  1PUF B;  4CCO A;  2HWV A;  2DOA A;  1IUF A;  2NXN B;  2W57 A;  1F5T A;  1QVU A;  2LG4 A;  3CLO A;  2WC2 A;  1T56 A;  2KIM A;  3BG3 A;  3DEU A;  5E8I A;  2VOO A;  3H9Q A;  3QAH A;  5EYR A;  4LMY A;  3Q9S A;  3R6S A;  5FB2 A;  4XRF A;  2K7L A;  1XMX A;  3WTY C;  3Q0U A;  1FNN A;  4UNO A;  5J4V A;  3CTA A;  3BCB A;  3LMM A;  1ZHF A;  3IH3 A;  3A1Y A;  1QHH D;  3VOE A;  1X2N A;  2Z5U A;  4XON A;  2QSG X;  3KYL A;  3M3Y J;  4NUB A;  2R3S A;  5LLQ A;  1MH4 A;  1LFB A;  3I59 B;  4RM2 A;  2LR8 A;  3IKT A;  4IXA A;  4C9Y A;  1ZR2 A;  2PBI A;  1NTC A;  3EPZ A;  4M3E A;  4BDZ A;  2MLG A;  1JTX A;  1F43 A;  4BAY A;  1XN7 A;  1WWX A;  1WFX A;  3SEQ A;  4F52 A;  3BCA A;  4WWC A;  3HYI A;  4V2G A;  2XAS A;  2DPD A;  2HOT A;  4KIT B;  4NC8 A;  5LHG A;  2L9V A;  2QQ9 A;  5EG0 A;  2QEX I;  3BTI A;  1YG2 A;  1W0T A;  1Y1W J;  3E0J B;  4JX6 A;  2RN7 A;  1LE8 A;  4HQE A;  2JA5 J;  3DEE A;  3GEZ A;  1GXQ A;  3ECO A;  3FXQ A;  4BS9 A;  1VQN I;  1Z7L A;  2ELJ A;  1IO2 A;  2IGN A;  4YIR X;  1TWF J;  4OU0 A;  4FET A;  3H9J A;  2O03 A;  4PJL A;  2E2I J;  1YS6 A;  3ML6 A;  3WGI A;  4I6Z A;  4LIU A;  1FP1 D;  3MVP A;  3K4M A;  4HST A;  4ASN A;  3ZMT A;  2LOO A;  3KX2 A;  4U0V A;  2AQF A;  2Y0S A;  2AS5 F;  3KP4 A;  4P96 A;  5D8K B;  4AVP A;  4P1W A;  4Y3O A;  3C2B A;  3ECH A;  3LNQ A;  1I6H J;  2DT7 B;  2IA0 A;  3FIW A;  4AYB A;  1RPW A;  4B47 A;  2LKX A;  2MG4 A;  4KNY A;  2CRG A;  2OJE D;  4I02 A;  1TNT A;  3EQL F;  1MKM A;  5BPD A;  2KJC A;  3CD6 I;  1BW5 A;  2Y69 H;  4O6J A;  3CMA I;  3CCS I;  2XAQ A;  4A2U A;  2ZSI B;  2Z99 A;  4IF4 A;  4R79 A;  3CO6 C;  4BHP A;  3ERE D;  2GM4 A;  4BH9 A;  4A3B J;  2JSC A;  3HUG A;  4C30 A;  1REP C;  4R1H A;  4NDL A;  4LK0 F;  3HOW J;  3PNY A;  5L3B A;  3OYC A;  4PJM A;  4ITV A;  1WPK A;  2QVO A;  5EGO A;  4XRS A;  1TWA J;  3GTQ J;  3ZOB A;  4PDK A;  4ZTF A;  3ZQ7 A;  5E3N A;  2ELH A;  3GF2 A;  5J3L A;  2B63 J;  2VBY A;  3G3Z A;  4RB0 A;  2O61 A;  2K9S A;  1UFM A;  1B6A A;  1QZY A;  3CUQ A;  4UVB A;  1HKS A;  2DJI A;  3RTR A;  1VFC A;  1QQI A;  2PX9 A;  5D4S A;  1DU0 A;  3CC2 I;  3GO5 A;  3H3V K;  1IRX A;  1A35 A;  5FKK A;  3KP5 A;  1IC8 A;  2KT0 A;  4UVC A;  2D45 A;  4F55 A;  2YS9 A;  2A5Y B;  1JHF A;  1JKO C;  4EEF G;  1R49 A;  2M34 A;  1ZGW A;  1T33 A;  3EDP A;  2ISZ A;  2ZJP F;  1S72 I;  3JSP A;  1RZ4 A;  3ZR8 X;  5DS9 A;  3PUF A;  1VQ5 I;  1O3R A;  3GTK J;  3KLO A;  3GZN B;  3C2G A;  3DTK A;  3MAJ A;  2VJ4 A;  1Q1H A;  3E5Q A;  2W84 A;  4A3E J;  5GAH J;  4GYG A;  4EAT A;  2KKO A;  3WGH A;  1D0Z A;  3QPS A;  1HXD A;  4E7H A;  1MJ9 A;  5FLX Z;  1R4M B;  2AXL A;  3HC7 A;  3OIP A;  3AG1 H;  2FOW A;  3PFI A;  4FCY A;  2ZME A;  3I4M J;  1GXP A;  2F4I A;  2R5Z A;  1XCV A;  1SD7 A;  2PMZ A;  4FE4 A;  3HOX J;  1UJ8 A;  3P9I A;  2Y0S N;  2KL4 A;  2YX7 A;  3QOP A;  1MDM A;  2R7D A;  5BNG A;  4HX7 A;  5EDN A;  4OIR F;  5IT9 K;  1G3T A;  1DGR M;  3GTL J;  2OV7 A;  4XOP A;  4RDU A;  3QQA A;  4XSZ F;  3TQN A;  3RQ4 A;  2HDW A;  2E19 A;  3F3X A;  3TBI A;  2XKO A;  4RAY A;  3DTE A;  1N75 A;  4FTH A;  2TDX A;  5M3M J;  2XSJ C;  3OS1 A;  3TW7 A;  1ZRF A;  1WH7 A;  2CW7 A;  1X4O A;  2ZNY A;  2BV6 A;  1P9Q C;  4PGG A;  6PAX A;  4C3H J;  2ZSH B;  3T8T A;  1JT0 A;  2F48 A;  5K5Q A;  4AC0 A;  5GAE J;  3VYR B;  1VQ4 I;  3K70 C;  2MSY A;  3FDY A;  1J7K A;  1Z21 A;  3LWF A;  1B4A A;  1BIB A;  2RAE A;  3C1D A;  1LDJ A;  4XKV A;  1K61 A;  3FHN A;  3GME A;  5BOX A;  3HIF A;  2O3F A;  1IRZ A;  4XBF A;  1MNE A;  2A5W A;  3MZY A;  4PGH A;  3FHZ A;  1HF0 A;  4BNC A;  2XB5 A;  3BOQ A;  1DP3 A;  1T08 B;  2R93 J;  2GLO A;  2DMP A;  4KIC A;  1J2X A;  1XPX A;  3BZC A;  2WA0 A;  4AU7 A;  1BI1 A;  1OR7 C;  4HG2 A;  1KGS A;  3WU0 A;  1FYL A;  2VOP A;  5AIQ A;  1LJ9 A;  1FOW A;  3ZQH A;  4B3X A;  4D0P A;  3BJ6 A;  2VIX A;  3JRA A;  2EZL A;  3FBI B;  1ZGA A;  2Y31 A;  2XAG A;  2FXA A;  5C3E J;  1CF7 B;  5J1Y A;  2CJJ A;  4LIV A;  3GUD A;  4QWQ A;  1SAN A;  3BG9 A;  4HV5 A;  4M6X A;  4S05 A;  4E7I A;  5LGN A;  4BJT A;  2DU9 A;  3DKX A;  4QPO A;  3IAS 2;  2EJR A;  4DJA A;  1EJ9 A;  5ICC A;  2XAF A;  4B4C A;  4HNU A;  3AG2 H;  3HB9 A;  3PSI A;  5IT9 Z;  2A69 F;  2Z1D A;  2R7O A;  4HAM A;  2UXN A;  5H6R A;  2CS3 A;  2O9L A;  1UCR A;  2ZJ2 A;  2ZNZ A;  3FXR A;  4LLG F;  1SFK A;  1ZLK A;  3WTV C;  3S1N J;  2NAZ A;  2HVR A;  4KYW A;  1W1W E;  4YFK F;  2KMU A;  4I09 A;  4KIF A;  2DYR H;  2E1M B;  3DPT A;  3NRV A;  1YE9 A;  4BEH A;  2EFQ A;  1VQL I;  4BU2 A;  3WTW C;  4M72 A;  3RYP A;  1KU3 A;  2MGQ A;  1MMS A;  1JUP A;  5BQT A;  2QA4 I;  4G7O F;  2ZJQ F;  3N05 A;  2IS4 A;  1XSD A;  1R36 A;  2CUF A;  2H8W A;  1T98 A;  1WQ2 A;  4EM1 A;  1WSU A;  4UUV A;  3CCY A;  3X2Q H;  2HTJ A;  2KRC A;  3KYD B;  1IXR C;  3PNV A;  5CVJ A;  3G1L A;  1MBJ A;  2KP6 A;  2LK2 A;  2I8D A;  3SFZ A;  4RB1 A;  1B1B A;  2IXS A;  1TNS A;  1P6R A;  3DLA A;  2KRH A;  1SMY F;  2DFE A;  2W82 A;  3CZ6 A;  3F8N A;  4CCM A;  2VXZ A;  3JSO A;  2MH9 A;  2UWM A;  5FD6 A;  1XGM A;  1VI0 A;  2R4G A;  5EZH A;  5K7F A;  4PJN A;  4E7K A;  2V6E A;  1IN6 A;  3KYC B;  2NRA C;  2I10 A;  1YW7 A;  2W7N A;  2BVL A;  2MC3 A;  2K3F A;  2MD0 A;  2VN2 A;  3MCZ A;  3WOD F;  3V8J A;  1ENH A;  5M5W J;  5HLG A;  2LC2 A;  4XMY A;  3I53 A;  1ULY A;  4X1E A;  2NVQ J;  2XB0 X;  3AKZ A;  2VKD A;  2H09 A;  4XRM A;  2V26 A;  3HRM A;  3LA3 A;  2L7K A;  5DM6 F;  2ME6 A;  4DYQ A;  2R92 J;  2XRN A;  2DQL A;  1J9I A;  2YX4 A;  2VC0 A;  3A4C A;  3E6C C;  3J7A O;  3PQK A;  1J75 A;  3JRF A;  2L5Q A;  3NEU A;  4RA2 A;  3TO7 A;  1JGG A;  2QZ8 A;  1I3A A;  2DOF A;  3CF2 A;  2W85 A;  5IP9 J;  2OBP A;  1GLN A;  1G3S A;  2P6S A;  3LSG A;  3U9G A;  4EQQ A;  1W7P B;  2EQR A;  1FTZ A;  3CCQ I;  3L2U A;  1IW7 F;  1KYZ A;  3DU5 A;  4CGZ A;  2M45 A;  1MIJ A;  2PEX A;  2GOX B;  3HKZ A;  2QQA A;  4BJ5 C;  2M0M A;  4XR6 A;  3ZQL A;  2FBK A;  5EG0 B;  3FMQ A;  4J19 A;  4YEJ A;  3QU3 A;  5J4Y A;  2K40 A;  2V1U A;  3PUB A;  3ZN1 A;  4EJO A;  2RC4 A;  1Z3Y A;  3UKG A;  4HW0 A;  2H94 A;  1ETX A;  4HOB A;  4KN7 X;  1YX3 A;  1T0F A;  2D5V A;  3FKJ A;  3L2V A;  3QYF A;  3AG3 H;  5HOO A;  4P55 A;  3FX3 A;  1F36 A;  4XQF A;  1QRY A;  2MYS A;  1XS9 A;  3BTL A;  4ENJ A;  4BBS J;  1ZTR A;  1FP2 A;  2FML A;  2XGC A;  4A6D A;  3VPR A;  4GRI A;  1G59 A;  4KIG A;  3GXO A;  4BEH B;  1JJ8 C;  3BQY A;  1T38 A;  2L3D A;  4M3F A;  4YFX F;  2EFN A;  1NHA A;  2CO5 A;  2BBY A;  1D8K A;  5LEK A;  3CMY A;  1ZG1 A;  1RI7 A;  2CFX A;  1QU3 A;  1ETY A;  5L3F A;  3DXJ F;  3EUH A;  3CJQ B;  4BYY A;  2FQ3 A;  4UV8 A;  2UZK A;  2DPU A;  2IRF G;  2EB7 A;  1J5Y A;  1YOV B;  3KPH A;  2H27 A;  4AUX A;  5LRR A;  2FSW A;  1GV2 A;  4RGX A;  1BJA A;  2CQN A;  3TOA A;  3WG9 A;  2JJ7 A;  2WB1 A;  1I6X A;  2Q1Z B;  4XKB A;  4FHT A;  3LQR A;  2KRF A;  4JQF A;  3J80 Z;  2HQA A;  2ZME B;  1ETW A;  1QO0 D;  1UG2 A;  3R60 A;  3CCE I;  3WTU C;  2LF8 A;  2HOE A;  3OWT A;  1XB4 A;  2CGP A;  3S3M A;  1AU7 A;  1TQM A;  2JUC A;  2DA1 A;  3O8H A;  3ZP5 A;  2DI3 A;  1JTY A;  1UAA A;  1MD0 A;  4PZJ A;  3A01 B;  4KMU X;  2L9R A;  2VB6 A;  3HOT A;  1Z1D A;  3K4B A;  2VJ5 A;  1XGN A;  5TJJ A;  1T8I A;  1HC8 A;  3SHF A;  3CF5 F;  4ZZD A;  2W4S A;  2GOM A;  2XUB A;  1FMV A;  5DTD A;  3Q3S A;  1XG1 A;  2HQR A;  5E20 A;  1S7O A;  1BC8 C;  4PJJ A;  1CQT A;  1FLI A;  1FX7 A;  3HHH A;  1IRF A;  1FTT A;  1A36 A;  1IF1 A;  3KZI C;  2IAI A;  3SEZ A;  1HW2 A;  4K2E A;  3OYN A;  3D5R C;  1RR8 C;  1DPR A;  1G8X A;  4IRI A;  1TW3 A;  4DNC A;  5D5W B;  1S3J A;  2DK5 A;  2DO7 A;  3U2R A;  4KDP A;  2M8G X;  5FFX A;  3HBL A;  4YG2 F;  2STT A;  4MFD A;  1SFX A;  3D0S A;  2HGC A;  1WI3 A;  5K7H A;  3E6M A;  1Z7U A;  3BC8 A;  3M1E A;  4WX9 A;  3G4S I;  2XAH A;  3BDD A;  4ZJZ A;  2L7F P;  4CYD A;  1YJW I;  2IT0 A;  2VUM J;  2XPW A;  2A61 A;  3OYI A;  4XL9 A;  1SVO A;  3D1N I;  1YI2 I;  4XLC A;  5EEA A;  2XPV A;  2JMW A;  4LGW A;  1BBY A;  2DDB A;  3J80 K;  3WG7 H;  2FJ1 A;  2R5Z B;  1K79 A;  2VBZ A;  4A5M A;  5B3S H;  3B6C A;  3HL2 A;  5F1J A;  4M71 A;  2GXB A;  5J1R A;  2YU9 J;  1EA3 A;  3HTU A;  1IAW A;  2UUZ A;  4A3I J;  4GFB A;  2P7V B;  3IL2 A;  2XSD C;  3E5U A;  3LA2 A;  2LFB A;  2PQ8 A;  3FWE A;  2L54 A;  1TT0 A;  3E6D A;  5IP7 J;  1FOY A;  1LQ1 A;  2IP2 A;  2Q8K A;  1MZB A;  3J7Z I;  3GCM A;  1BR1 A;  3BG6 A;  2M4G A;  5FLM J;  1KQ8 A;  3CDI A;  3FMS A;  1XTA A;  2X85 A;  1FWZ A;  3S2W A;  1KYW A;  1SVL A;  1RKT A;  4EJW A;  4KMF A;  4KFC A;  1R1T A;  3ONQ A;  3QPT A;  4XK4 A;  2VBX A;  2E2H J;  1SAX A;  2DTZ A;  1H88 C;  3DKY A;  3F8M A;  4LJZ F;  1YJ9 I;  1FOX A;  4ZH4 F;  4JX5 A;  5GAG J;  3K2Z A;  3GLL A;  3KEO A;  3PM1 A;  3M8E A;  1PJR A;  2HDC A;  4I01 A;  1I50 J;  4L5I A;  3GFI A;  1YTY A;  3DF8 A;  3LFK A;  4I2O A;  4FT8 A;  1ZK8 A;  2E1N A;  5F0F A;  5E3O A;  4LLN A;  4F7Z A;  2RNG A;  4CSW A;  1AHD P;  2WWY A;  5F0H A;  1U5T A;  3ZMV A;  2EPF A;  3RPQ A;  3RJP A;  3E6B A;  2IEK A;  3IRR A;  2BE5 F;  4QTR A;  4OIQ F;  1Y1V J;  2A68 F;  3H0G J;  1V55 H;  4LK1 F;  2ISY A;  1AKH A;  2RGV A;  3SDB A;  4A5N A;  4ENK A;  2YR2 A;  3HRU A;  5LRS A;  4LB5 A;  4Y13 A;  4KIS A;  3GTM J;  3S8P A;  4V2F A;  1FY7 A;  2IJL A;  2E71 A;  2GZW A;  4U88 A;  4G7Z F;  3RKQ A;  1D1A A;  2K02 A;  4DW6 A;  2JVH A;  1ACI A;  1PP7 U;  3W6K B;  2VKH A;  3Q5F A;  1W5T A;  1ITY A;  4FX4 A;  2EFO A;  1UHS A;  3OYH A;  1OCZ H;  3R0J A;  3K2A A;  3HPH A;  1T39 A;  3S1R J;  5F0C A;  2HI3 A;  1YJN I;  4BJ6 C;  2F4M B;  2EZH A;  1WI9 A;  2KHM A;  1X1D A;  3K1M A;  3SXY A;  1K83 J;  1USS A;  4IKF A;  3CP2 A;  3RCO A;  3BT9 A;  3PSF A;  2V4J C;  1TL8 A;  2DTR A;  2CFO A;  1M1E B;  4F92 B;  4P9F A;  1A5J A;  2WTE A;  1K6Y A;  4XN0 A;  2CSO A;  4H4K C;  2BY0 A;  2DMQ A;  3E5X A;  3FXU A;  5JVG F;  4X6A J;  2FD5 A;  2XHK A;  4PCQ A;  2COB A;  1BC7 C;  1U0J A;  2WAQ A;  1U9N A;  3BG5 A;  1WJF A;  3OYG A;  1JUS A;  1XDS A;  5E18 F;  2E1O A;  1I3Q J;  1NK2 P;  5FLV A;  1UMQ A;  4IHX A;  2WBM A;  3RZO J;  1R6R A;  3JRC A;  1ERD A;  2ZXJ A;  1OYY A;  4BUP A;  1UST A;  2PI0 A;  2FRH A;  2V9V A;  4ON0 A;  4UVA A;  4WXH A;  4FX0 A;  2BYV E;  3ZQI A;  2WY7 Q;  2W1O A;  3EUK L;  2QKM B;  3DKW A;  3F22 A;  1DGW Y;  2R7U A;  3GLX A;  3TW6 A;  5D5X B;  3PO3 J;  1OCO H;  4BBR J;  3KFW X;  2K9L A;  1SD6 A;  4KJZ A;  5F27 A;  5GPA A;  2OPT A;  4AYB N;  5KNL A;  4OIP F;  3A2K A;  2G9W A;  2NVU B;  4LB6 B;  4RGU A;  1E3P A;  1WRJ A;  2PG4 A;  3TO6 A;  5E1W A;  3DBR B;  4AVZ A;  5DV5 A;  4UY8 I;  1LKX A;  2VKV A;  3QOE A;  3TOB A;  4D5F A;  2BXZ A;  3HM5 A;  5FRN A;  3Q9V A;  1NG6 A;  5DCM B;  3B02 A;  1L0O C;  1XMK A;  3Q0V A;  3PQJ A;  1IDZ A;  2CV1 A;  1O57 A;  3OV8 A;  2FX0 A;  2JA8 J;  3W2W A;  3LOC A;  3M4O J;  1MJA A;  2HR3 A;  3RSN A;  3ROU A;  2DFI A;  2VAS A;  2VT3 A;  2DFF A;  4II3 A;  2R7T A;  3P5J A;  5GTH C;  2P6T A;  3MZH A;  1YRN A;  1OFC X;  2XIG A;  2IA2 A;  1FBQ A;  2CG4 A;  3GX4 X;  3IRQ A;  1XSV A;  3BPV A;  2K9M A;  2H6B A;  4MEY F;  2LBF A;  4KT6 A;  2QKL B;  4NB5 A;  5IOY A;  2EIJ H;  1IGN A;  2HEO A;  1OYI A;  4CYC B;  5L3C A;  2HDD A;  4ANJ A;  2YUS A;  4N4O B;  4BL0 B;  1D8J A;  3DBL B;  2V1N A;  1X4P A;  5HLT A;  3OYM A;  1G6N A;  3HGG A;  3AL0 C;  5EEH A;  1RET A;  4BQN A;  5EF6 A;  1QZZ A;  1O3S A;  5J8C A;  4A0Z A;  2JPC A;  1ZGJ A;  3DP7 A;  2DQR A;  3WHB A;  2XRO A;  4IHV A;  4BDY A;  2DMU A;  2QLZ A;  2R7V A;  1HQC A;  3M9A A;  3F0C A;  3F72 A;  3HOU J;  4PJ0 C;  3BZK A;  2KZV A;  2KIQ A;  2N8G A;  1V54 H;  1VQ7 I;  1ODD A;  1U78 A;  3H5N A;  4HNT A;  2FNP A;  1BN5 A;  3G2B A;  3CQZ J;  2EIM H;  5F04 A;  4ZDP A;  2NNY A;  3IAM 2;  1MND A;  3KP3 A;  4XLN F;  1VND A;  1OKR A;  1TTY A;  2QYO A;  5IT3 A;  3O2P E;  4XSX F;  1D0Y A;  1X2M A;  1WJC A;  1BOA A;  2CUZ A;  2P81 A;  1EH7 A;  2JWT A;  2KIU A;  4RGS A;  4E70 A;  1LE8 B;  1H9T A;  1B8I B;  3S1M J;  5M5X J;  3AL0 B;  4RB3 C;  4BHB A;  2WAE A;  1R58 A;  1X19 A;  2E7X A;  4QPQ A;  4ZDO A;  3HJE A;  2XF7 A;  2NYX A;  3ABU A;  2H1K A;  5JLW A;  3FZV A;  5LEJ A;  4HRI A;  3L1P A;  3RDI A;  4ZTJ A;  5E8G A;  2HQ5 A;  2ECB A;  1QHG A;  3ESW B;  4L0Z B;  4O3M A;  4G6D A;  5J40 A;  1HKT A;  3RKW A;  2TCT A;  4F3Q A;  4B48 A;  3DPL C;  2WV1 A;  4Q4Z F;  3PL8 A;  4XLH A;  1KON A;  3D5L A;  1POG A;  1U8R A;  3S3N A;  3WTT C;  2C6Y A;  2FEZ A;  4CA0 A;  1SC7 A;  3BR5 A;  2UXX A;  1E3H A;  5B1A H;  3W2A A;  4XLE A;  1MW7 A;  3IV5 A;  3I4P A;  2KQR A;  1HSJ A;  4Y7N J;  2VE9 A;  1G3Y A;  2X6O A;  2RRE A;  2DAO A;  3LSH A;  3GBG A;  2NVX J;  3O8G A;  1P2F A;  3DV8 A;  5EZG A;  4CZC A;  3S17 J;  3H92 A;  1VTN C;  4NQW A;  3JW4 A;  1IXS B;  3DPU A;  3H36 A;  4XLF A;  1DU6 A;  2JRM A;  2DXI A;  1XCB A;  2F5V A;  1MSE C;  2JSP A;  3FK6 A;  2EFW A;  3CES A;  4BXF A;  3TMO A;  1MBG A;  3HPG A;  1FIP A;  1WHU A;  5H20 A;  1XX5 A;  4PUS A;  1ON2 A;  1K6O A;  5CJ9 A;  3ASO H;  1L3L A;  3B73 A;  2PMH A;  4MQV A;  1YW9 A;  3T0Y A;  2Z16 A;  5E17 F;  2A6T A;  1W5C C;  2V79 A;  4DZP A;  5HNH A;  3KP6 A;  3PO2 J;  4P9U A;  4OIO F;  5FKL A;  5KVR A;  4UV9 A;  4AWX B;  3OYA A;  3LQQ A;  5K7Z A;  2RVC A;  2W00 A;  1KA8 A;  2EIK H;  2DT5 A;  2XF6 A;  4RS8 A;  5FKM A;  4HF2 A;  1T2K A;  2RV8 A;  3VWB A;  4HYE A;  4E6K G;  2HNH A;  2J5P A;  4BE0 A;  4DGW B;  4Y15 A;  1XMA A;  2LF7 A;  5E3L A;  2DLL A;  1AA7 A;  2XKP A;  2BY3 A;  2L4M A;  4EMS A;  5FJ8 J;  3HHG A;  4B44 A;  1MBE A;  4A3M J;  2QEN A;  1MDM B;  1B9N A;  2RQP A;  5A2Q K;  2MFZ A;  5IYD J;  3DWL E;  3HUG B;  3E1S A;  4IJA A;  4G7H F;  2ZFU A;  3CCM I;  2JRT A;  2ME0 A;  2R0Q C;  2X1D A;  4RAZ A;  2XDV A;  3BPX A;  1YW8 A;  3H3U A;  3I4N J;  2A6E F;  2XAU A;  2K9Q A;  3DQV C;  5CQG A;  2DA4 A;  3N97 A; 
#chains in the Genus database with same CATH homology
 3KLN A;  1FYK A;  3JTH A;  2KJB A;  1V3F A;  3E97 A;  1FPQ A;  1FYM A;  4L9V A;  4I0A A;  1ZAO A;  4L9J A;  4CIC A;  4L0Y B;  1O7L A;  3FF5 A;  1F4K A;  5A2Q Z;  3COA C;  5K1Y A;  4HV6 A;  5CVI A;  5ILS A;  4ESF A;  3ZPL A;  2OQR A;  5ERI A;  3HOS A;  4M6Y A;  4JBA A;  4M74 A;  1EH6 A;  4MQ9 F;  3P7N A;  1S6L A;  4ZYE A;  1YLF A;  1QGP A;  4OOI A;  1HBX G;  1I5Z A;  2FMY A;  4LLL A;  2OZ6 A;  3G73 A;  2H6C A;  5J6X A;  3GZ5 A;  3C18 A;  1W7P D;  3AAF A;  1LEA A;  2CW0 F;  3IHU A;  1R5H A;  4EJV A;  5D5U B;  2ZCW A;  1PP8 F;  1DDN A;  2DBB A;  2JPB A;  1YYV A;  4IVN A;  2HS5 A;  4WXD A;  5ICF A;  2PLY A;  2F5E A;  4KN4 X;  2OZU A;  1U2W A;  1KU7 A;  3L9F A;  3L00 A;  1I1G A;  1I27 A;  3JAM K;  3J81 K;  2QBY A;  3R61 A;  2XGX A;  4OMY A;  1YQA A;  2Z9O A;  3HSR A;  2BGC A;  1FZP B;  2MLK A;  1B9M A;  4B8X A;  2EA4 A;  3TDU C;  2QBY B;  4HX8 A;  1W4M A;  2G7H A;  2A07 F;  2DW4 A;  3J81 Z;  2XV4 S;  2JTV A;  4I0B A;  4LG0 A;  3SZT A;  5JHU A;  5DUK A;  1BIA A;  3HRT A;  1O3Q A;  3BWG A;  2WV0 A;  3ULQ B;  4WK8 F;  2YSR A;  1LDD A;  4HA8 A;  2Y0M A;  3IWZ A;  1ZAR A;  4Q5S F;  1TQI A;  5JR3 A;  4HF1 A;  4BHC A;  4L18 B;  5BPI A;  4CZZ A;  3I0T A;  1TQP A;  4MGR A;  2Z33 A;  4LD5 A;  3OOP A;  2RNJ A;  3TKY A;  3CJN A;  2PJP A;  2HFH A;  5JFR A;  3RKX A;  1ZRC A;  1MGT A;  2EA2 A;  4EM2 A;  3MWM A;  3V8K A;  5FFZ A;  4Y17 A;  4ZYH A;  2OU2 A;  2A3S A;  4LFU A;  2ZFW A;  3GFM A;  4GYI A;  4ZZL A;  5LGT A;  5DDG A;  2A6H F;  3BZ6 A;  2Z3Y A;  1BI2 A;  1S7A A;  5F6F A;  3BY6 A;  3BJA A;  5JI6 A;  2NS0 A;  4HDV A;  2D2W A;  4AD9 A;  1FBU A;  4G8X A;  4KT5 C;  2CQK A;  5L3D A;  1R1U A;  1F1Z A;  3L09 A;  3R0A A;  1IUY A;  2DK8 A;  3QP6 A;  3WU1 B;  1XGO A;  1IZ1 A;  1KQ0 A;  5HS9 A;  4ESJ A;  5K5R A;  1C0W A;  3M8F A;  3RIR A;  1DUX C;  4I98 B;  1WKM A;  4IPA A;  2M87 A;  1FSH A;  2ESH A;  2MA3 A;  2FE3 A;  1FC3 A;  4U0W A;  2L01 A;  5DEQ A;  5HLI A;  1J0R A;  4ETS A;  3MEX A;  3HRS A;  1T6S A;  2QUF A;  5AIP A;  4WCG A;  5LGU A;  5HDG A;  5H6Q A;  1ZYR F;  2YU3 A;  5LBQ A;  4EM0 B;  3WE3 A;  4IRG A;  3V4G A;  2IA1 A;  4DQ2 A;  3RKY A;  1DPU A;  2PMU A;  1B59 A;  2F2E A;  1P92 A;  1FSE A;  1RUO A;  4G6Q A;  2E7W A;  4CDG A;  4WXC A;  1Z05 A;  2BEO A;  2HKO A;  5LHI A;  1SFU A;  4A12 A;  2LSO A;  5KK1 A;  2VBW A;  1IXC A;  4XLP F;  3VEP A;  1YIO A;  4L9T A;  1P4A A;  1U5T C;  3IC7 A;  3MFK A;  3IWF A;  3LAJ A;  2RKH A;  1U6G A;  2RDP A;  1JXS A;  3W6J B;  2GIV A;  3IKV A;  5FD5 A;  4HDU A;  1QBJ A;  1X3U A;  1FBS A;  3ABT A;  2FF4 A;  1H0M A;  1D3Y A;  4AIK A;  2COM A;  1OYW A;  2ADU A;  3WGG A;  3K1N A;  4Q48 A;  5FO5 A;  4BXU A;  4LG0 B;  2ZKZ A;  2ACJ A;  1DP7 P;  2B0L A;  1OR7 A;  1BI3 A;  2JT1 A;  1STZ A;  1A04 A;  3T5X A;  3EYI A;  3QPH A;  2EFP A;  1JE8 A;  1SD4 A;  2MBF A;  4GGG A;  2GA1 A;  5HLH A;  4JK1 X;  4O5V A;  4U0Y A;  3GFL A;  4Z2Y A;  5DYM A;  3VFZ A;  4OMZ A;  3E3V A;  3RI4 A;  1D5V A;  1G3W A;  4R8H A;  2JZY A;  2GWR A;  3GFJ A;  2VOD A;  5HDN A;  4HF0 A;  1JGS A;  5DD4 A;  3K69 A;  4N0B A;  2K4B A;  2QWW A;  5FLX K;  3FM3 A;  2IPQ X;  3TDZ C;  1CF7 A;  2W24 A;  2VON A;  4GXO A;  3CO7 C;  1LVA A;  2PFB A;  5ILU A;  2QQB A;  2Y75 A;  2NNN A;  1S29 A;  2OAZ A;  3SZP A;  3CUQ B;  1UHW A;  5K5O A;  1EH8 A;  1E17 A;  3ZMS A;  2L4A A;  1YFH A;  4CO8 A;  5HS7 A;  2HKX A;  4P5O A;  2IW5 A;  2HYG D;  1AWC A;  2HYF A;  4KUM A;  5ICE A;  4M73 A;  1TW2 A;  1J59 A;  4EGY A;  1Z6T A;  2ESN A;  4TV7 A;  3LST A;  4IHS A;  2EV0 A;  2K86 A;  4ENM A;  2K4J A;  1ZRD A;  4KIB A;  5FGM A;  5CYV A;  4ZYG A;  5DCF A;  2HQN A;  3KZZ A;  3U1D A;  1I1S A;  1AOY A;  2ZO4 A;  3P9C A;  1R23 A;  3HSF A;  2Y48 A;  3L7W A;  3WTZ A;  3F8B A;  1S8N A;  1ZLJ A;  3BP8 A;  1V4R A;  1PDN C;  1HW1 A;  3HTS B;  1IN7 A;  1K78 B;  1IN8 A;  4L9N A;  2STW A;  4A6E A;  1MJB A;  3TO9 A;  2MH2 A;  2O8X A;  2M1B A;  5ED4 A;  2M5W A;  2GAU A;  1XGS A;  4L5J A;  4EVI A;  3H3Z A;  4EV0 A;  5HDK A;  4ESB A;  3JAM Z;  1UHM A;  2FU4 A;  2X0L A;  2P8T A;  1LDK B;  2CYY A;  3L2C A;  2P5K A;  2EK5 A;  3KE2 A;  2V1X A;  2LNB A;  4M9X A;  4S04 A;  3F23 A;  4GO1 A;  5CVV A;  2PN6 A;  1K7A A;  2XAJ A;  1KU9 A;  1SD5 A;  3P9K A;  2M8E A;  5D6E A;  3GW2 A;  3FMR A;  3I54 A;  2D1H A;  3F6O A;  3ELK A;  2F5D A;  4N9H A;  3GYH X;  4HBL A;  1PUE E;  2XVC A;  3KZY A;  2FNA A;  1Z6R A;  2P7C B;  2V1D A;  5F64 A;  2IVM A;  5D5V B;  2G7U A;  3F8F A;  3REO A;  1FOK A;  2FA5 A;  5F1R A;  2W25 A;  4UXN A;  2FOK A;  2EWN A;  3QP5 A;  5E1X A;  4HLY A;  1HKQ A;  1HW5 A;  2HTS A;  3QU6 A;  3ZMD A;  1JHH A;  2VT2 A;  4H0E A;  3HSE A;  1GHC A;  2M30 A;  1XDU A;  1H9G A;  2Q0O A;  2GQQ A;  4M9Z A;  1KQ9 A;  2FBI A;  3SQN A;  4IHT A;  2OD5 A;  1W7P A;  1ZG5 A;  1E2X A;  5LHH A;  4AIJ A;  2HZT A;  3KCC A;  4RGR A;  3WE2 A;  4EJU A;  1XD7 A;  2LKP A;  3WTS C;  3LAP A;  3O6B B;  1R22 A;  2D1V A;  2GA2 A;  1ZH5 A;  4G94 A;  1TBX A;  3LA7 A;  4U7D A;  3V7S A;  3EYY A;  3C3W A;  3EET A;  2ETH A;  4YFN F;  3BRO A;  3F21 A;  4G9Y A;  1IN5 A;  3I71 A;  1TLH B;  4KA4 A;  3ISP A;  1CGP A;  3C7J A;  4MEX F;  3RYR A;  1QPM A;  1K78 A;  3GZ6 A;  1P4W A;  4RB2 C;  4QLC U;  4IRH A;  3T1B A;  3K9T A;  4MHG A;  1YO5 C;  3CUQ C;  2L02 A;  3K0L A;  4GCV A;  1ZRE A;  4NHJ A;  4B09 A;  1Y0U A;  1G4D A;  1F9N A;  1OMI A;  3O3K A;  4YII A;  1IN4 A;  2KIF A;  4I7H A;  1GVJ A;  5L3E A;  3I64 A;  4ENN A;  5E1Z B;  2VC1 A;  1SFE A;  2O6G E;  5DUI A;  3KET A;  4U7B A;  1R1V A;  4EGZ A;  1EV7 A;  2K27 A;  1BI0 A;  3CUO A;  5J8F A;  1LB2 A;  5CVU A;  2MD5 A;  1QNT A;  5BMZ A;  1RNL A;  1R7J A;  5DCM A;  1OPC A;  1HST A;  1ONV A;  2EV5 A;  2E1C A;  1ZN2 A;  1R5G A;  1UB9 A;  5ICG A;  2YPR A;  3T8R A;  1O3T A;  5ILV A;  3QRF F;  4EJT A;  3V7C A;  3M7G A;  3JTG A;  3I5U A;  1KU2 A;  4YIF A;  2X4H A;  3V8L A;  4MTE A;  4A0Y A;  3I58 A;  2LDU A;  2Q2E A;  4MTD A;  4AIH A;  2F5F A;  2CWE A;  1LNW A;  1U3E M;  1RIO H;  4A0X A;  3KEQ A;  5CLS A;  3N4M A;  3DFG A;  3VOD A;  3KP7 A;  2ZBK A;  1SMT A;  3R4K A;  3KP2 A;  1ON1 A;  5D4R A;  4HX4 A;  5L3G A;  1FT9 A;  2GXG A;  3VB2 A;  3V7R A;  3F6V A;  3GWZ A;  3I59 A;  4WF2 A;  1Z9C A;  2OA4 A;  1W5S A;  4HZF A;  2F5C A;  3ZMU A;  2P4W A;  5CVR A;  4BQA A;  1R00 A;  2P5L C;  1O7F A;  4MNU A;  1XSX A;  4UHT A;  5D8L B;  3GVA A;  2FBH A;  1U5T B;  3WTX C;  1IRG A;  1ZG3 A;  5BS6 A;  3ZMZ A;  2EV6 A;  2O0Y A;  4N9I A;  2OQG A;  2VE8 A;  4CHU A;  1Z91 A;  3FM5 A;  4ZYD A;  2R7F A;  3BJO A;  5HS8 A;  2QM3 A;  1YS7 A;  4Q47 A;  3TGN A;  5HVQ C;  3NQO A;  5EEG A;  1BM9 A;  3ZN0 A;  3CDH A;  3RPU A;  3MQ0 A;  3K1P A;  5D6F A;  3F8C A;  1RUN A;  4HQM A;  5TRD A;  2J5O A;  4CXF A;  5AON A;  2V6C A;  1LEB A;  4M9S A;  5DD8 A;  2P5V A;  5JVT A;  4HLX A;  4OIN F;  1P4X A;  2HWV A;  1F5T A;  2W57 A;  3CLO A;  2WC2 A;  2KIM A;  3DEU A;  5E8I A;  2VOO A;  3QAH A;  4LMY A;  3Q9S A;  3R6S A;  5FB2 A;  4XRF A;  2K7L A;  3WTY C;  1FNN A;  4UNO A;  3CTA A;  1ZHF A;  3VOE A;  2Z5U A;  2R3S A;  5LLQ A;  3I59 B;  3IKT A;  4IXA A;  2PBI A;  2MLG A;  4BAY A;  1XN7 A;  1WWX A;  4WWC A;  3HYI A;  2XAS A;  2DPD A;  5LHG A;  2QQ9 A;  1YG2 A;  2RN7 A;  4HQE A;  1GXQ A;  3ECO A;  3FXQ A;  3GEZ A;  4OU0 A;  2O03 A;  1YS6 A;  3ML6 A;  3WGI A;  1FP1 D;  4ASN A;  3ZMT A;  4U0V A;  2AS5 F;  3KP4 A;  4P96 A;  5D8K B;  4AVP A;  3ECH A;  2IA0 A;  4KNY A;  4I02 A;  1TNT A;  3EQL F;  1MKM A;  5BPD A;  2KJC A;  4O6J A;  2XAQ A;  4A2U A;  4IF4 A;  2Z99 A;  4R79 A;  3CO6 C;  4BHP A;  3ERE D;  4BH9 A;  2JSC A;  3HUG A;  1REP C;  4R1H A;  4LK0 F;  5L3B A;  2QVO A;  4PDK A;  3ZQ7 A;  2ELH A;  3GF2 A;  2VBY A;  3G3Z A;  4RB0 A;  2O61 A;  1UFM A;  1B6A A;  1QZY A;  3CUQ A;  4UVB A;  1HKS A;  3RTR A;  1QQI A;  5D4S A;  3GO5 A;  3KP5 A;  4UVC A;  2D45 A;  2A5Y B;  1JHF A;  3EDP A;  2ISZ A;  3JSP A;  1RZ4 A;  1O3R A;  3KLO A;  3MAJ A;  1Q1H A;  3E5Q A;  2W84 A;  4GYG A;  2KKO A;  3WGH A;  1HXD A;  1MJ9 A;  5FLX Z;  2AXL A;  3PFI A;  2ZME A;  1GXP A;  1XCV A;  1SD7 A;  3P9I A;  3QOP A;  1MDM A;  2YX7 A;  2R7D A;  4HX7 A;  4OIR F;  5IT9 K;  1G3T A;  4XSZ F;  3TQN A;  3F3X A;  2XKO A;  4RAY A;  2TDX A;  1ZRF A;  2ZNY A;  2BV6 A;  4PGG A;  6PAX A;  3T8T A;  5K5Q A;  1J7K A;  3LWF A;  1B4A A;  1BIB A;  3C1D A;  1LDJ A;  5BOX A;  3HIF A;  2O3F A;  4XBF A;  3MZY A;  4PGH A;  3FHZ A;  4BNC A;  3BOQ A;  4KIC A;  1J2X A;  1BI1 A;  1KGS A;  3WU0 A;  1FYL A;  2VOP A;  5AIQ A;  1LJ9 A;  4D0P A;  3BJ6 A;  1ZGA A;  2XAG A;  2FXA A;  1CF7 B;  3GUD A;  4QWQ A;  4HV5 A;  4M6X A;  4S05 A;  5LGN A;  2DU9 A;  2EJR A;  5ICC A;  2XAF A;  5IT9 Z;  2A69 F;  4HAM A;  2UXN A;  5H6R A;  1UCR A;  2ZJ2 A;  2ZNZ A;  3FXR A;  4LLG F;  1ZLK A;  3WTV C;  2NAZ A;  4KYW A;  4YFK F;  4I09 A;  4KIF A;  3DPT A;  3NRV A;  2EFQ A;  3WTW C;  4M72 A;  3RYP A;  1KU3 A;  5BQT A;  4G7O F;  1XSD A;  1R36 A;  1WSU A;  4EM1 A;  1T98 A;  1WQ2 A;  4UUV A;  2HTJ A;  1IXR C;  5CVJ A;  3SFZ A;  4RB1 A;  1B1B A;  1TNS A;  1P6R A;  1SMY F;  3F8N A;  3JSO A;  2VXZ A;  2MH9 A;  2UWM A;  5FD6 A;  1XGM A;  1IN6 A;  2NRA C;  1YW7 A;  2MC3 A;  2VN2 A;  3MCZ A;  3WOD F;  3V8J A;  5HLG A;  3I53 A;  1ULY A;  2H09 A;  3HRM A;  3LA3 A;  2XRN A;  2DQL A;  1J9I A;  2YX4 A;  2VC0 A;  3E6C C;  3J7A O;  3PQK A;  1J75 A;  3NEU A;  3TO7 A;  2QZ8 A;  2W85 A;  2OBP A;  1G3S A;  2P6S A;  3U9G A;  4EQQ A;  1W7P B;  1IW7 F;  1KYZ A;  4CGZ A;  2M45 A;  2PEX A;  2QQA A;  2FBK A;  3FMQ A;  3QU3 A;  2V1U A;  3ZN1 A;  4EJO A;  2RC4 A;  4HW0 A;  2H94 A;  4HOB A;  4KN7 X;  1T0F A;  5HOO A;  4P55 A;  3FX3 A;  4ENJ A;  1FP2 A;  2FML A;  4A6D A;  4KIG A;  3GXO A;  1T38 A;  2L3D A;  4YFX F;  2EFN A;  1NHA A;  2CO5 A;  2BBY A;  1D8K A;  5LEK A;  1ZG1 A;  1RI7 A;  2CFX A;  5L3F A;  3DXJ F;  2UZK A;  3EUH A;  2DPU A;  4BYY A;  4UV8 A;  2FQ3 A;  2IRF G;  2EB7 A;  1J5Y A;  2H27 A;  5LRR A;  2FSW A;  4RGX A;  1BJA A;  3TOA A;  3WG9 A;  1I6X A;  4FHT A;  3LQR A;  2KRF A;  4JQF A;  3J80 Z;  2ZME B;  1QO0 D;  3R60 A;  3WTU C;  2LF8 A;  2HOE A;  1XB4 A;  2CGP A;  1TQM A;  3ZP5 A;  2DI3 A;  1MD0 A;  4PZJ A;  4KMU X;  3HOT A;  1Z1D A;  1XGN A;  5TJJ A;  3SHF A;  4ZZD A;  2XUB A;  2HQR A;  5E20 A;  1S7O A;  1BC8 C;  1FLI A;  1FX7 A;  3HHH A;  1IRF A;  1IF1 A;  1HW2 A;  4K2E A;  1DPR A;  4IRI A;  1TW3 A;  4DNC A;  5D5W B;  1S3J A;  2DK5 A;  2DO7 A;  3U2R A;  4KDP A;  5FFX A;  4YG2 F;  2STT A;  1SFX A;  3D0S A;  2HGC A;  3E6M A;  1Z7U A;  3M1E A;  4WX9 A;  2XAH A;  3BDD A;  4CYD A;  2IT0 A;  2A61 A;  4LGW A;  1BBY A;  3J80 K;  1K79 A;  2VBZ A;  4A5M A;  4M71 A;  2GXB A;  3HTU A;  1IAW A;  2P7V B;  3IL2 A;  3E5U A;  3LA2 A;  2PQ8 A;  3FWE A;  2L54 A;  3E6D A;  1LQ1 A;  2IP2 A;  2Q8K A;  1MZB A;  1KQ8 A;  3FMS A;  1FWZ A;  3S2W A;  1KYW A;  4EJW A;  4KMF A;  4KFC A;  1R1T A;  3QPT A;  2VBX A;  1SAX A;  3F8M A;  4LJZ F;  4ZH4 F;  3K2Z A;  3KEO A;  3M8E A;  2HDC A;  4I01 A;  4L5I A;  3GFI A;  1YTY A;  3DF8 A;  3LFK A;  4I2O A;  4FT8 A;  2E1N A;  4LLN A;  4F7Z A;  2WWY A;  1U5T A;  3ZMV A;  3RPQ A;  3RJP A;  3E6B A;  3IRR A;  2BE5 F;  4OIQ F;  2A68 F;  4LK1 F;  2ISY A;  2RGV A;  4A5N A;  4ENK A;  2YR2 A;  4LB5 A;  3HRU A;  5LRS A;  4Y13 A;  1FY7 A;  2IJL A;  2GZW A;  4U88 A;  4G7Z F;  2K02 A;  1PP7 U;  3W6K B;  3Q5F A;  1W5T A;  4FX4 A;  2EFO A;  3R0J A;  1T39 A;  1WI9 A;  3SXY A;  3K1M A;  1USS A;  2DTR A;  4P9F A;  2WTE A;  2CSO A;  3E5X A;  3FXU A;  2XHK A;  4PCQ A;  1BC7 C;  1XDS A;  5E18 F;  1OYY A;  2ZXJ A;  2PI0 A;  1UST A;  2FRH A;  2V9V A;  4ON0 A;  4UVA A;  4WXH A;  4FX0 A;  2BYV E;  3DKW A;  3F22 A;  3GLX A;  5D5X B;  3KFW X;  1SD6 A;  4OIP F;  2G9W A;  4LB6 B;  4RGU A;  1WRJ A;  2PG4 A;  3TO6 A;  5E1W A;  5DV5 A;  3TOB A;  3Q9V A;  5DCM B;  3B02 A;  1L0O C;  1XMK A;  3PQJ A;  1O57 A;  3OV8 A;  1MJA A;  2HR3 A;  3ROU A;  2DFI A;  2VT3 A;  2P6T A;  3MZH A;  2XIG A;  2IA2 A;  1FBQ A;  2CG4 A;  3GX4 X;  3IRQ A;  1XSV A;  3BPV A;  2H6B A;  4MEY F;  4NB5 A;  2HEO A;  1OYI A;  5L3C A;  1D8J A;  1G6N A;  5EEH A;  1QZZ A;  1O3S A;  5J8C A;  4A0Z A;  2JPC A;  1ZGJ A;  3DP7 A;  2DQR A;  2XRO A;  2QLZ A;  1HQC A;  3M9A A;  3F72 A;  1ODD A;  1U78 A;  2FNP A;  1BN5 A;  2NNY A;  3KP3 A;  4XLN F;  1OKR A;  1TTY A;  2QYO A;  5IT3 A;  3O2P E;  4XSX F;  1BOA A;  4RGS A;  1EH7 A;  2KIU A;  4E70 A;  1H9T A;  4RB3 C;  4BHB A;  1R58 A;  2E7X A;  2NYX A;  3ABU A;  3FZV A;  5LEJ A;  3RDI A;  5E8G A;  4L0Z B;  4O3M A;  4G6D A;  1HKT A;  3RKW A;  3DPL C;  4Q4Z F;  3D5L A;  1U8R A;  3WTT C;  2C6Y A;  2FEZ A;  2UXX A;  3I4P A;  1HSJ A;  2VE9 A;  1G3Y A;  2DAO A;  1P2F A;  3DV8 A;  3H92 A;  1VTN C;  4NQW A;  3JW4 A;  1IXS B;  1XCB A;  2EFW A;  5H20 A;  1ON2 A;  1K6O A;  5CJ9 A;  1L3L A;  3B73 A;  2PMH A;  4MQV A;  1YW9 A;  3T0Y A;  5E17 F;  2V79 A;  3KP6 A;  4P9U A;  4OIO F;  5KVR A;  4UV9 A;  4AWX B;  3LQQ A;  2RVC A;  1KA8 A;  2DT5 A;  4RS8 A;  4HF2 A;  1T2K A;  2RV8 A;  4HYE A;  2J5P A;  4Y15 A;  1XMA A;  2LF7 A;  2DLL A;  2XKP A;  2L4M A;  4EMS A;  3HHG A;  2QEN A;  1MDM B;  1B9N A;  2RQP A;  5A2Q K;  4IJA A;  4G7H F;  2JRT A;  4RAZ A;  3BPX A;  1YW8 A;  3H3U A;  2A6E F;  3DQV C;  3N97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...