2G9WA

Crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
119
Chain Sequence
KLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMAVLQRLAKKNLVLQIRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords conserved hypothetical protein
publication title Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 37
structure length 119
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g9wA01
3MCZA 2KIMA 2VT2A 1IZ1A 1E2XA 2F5CA 3M1EA 3GFJA 2LF7A 2HS5A 1OYYA 2YU3A 4ZZLA 1Z1DA 3FM3A 1G3WA 4KIGA 4L9VA 5ILVA 4EQQA 3JAMK 3DV8A 4LB5A 4BXUA 1IUYA 3DPLC 5ERIA 3REOA 4YFNF 4EJWA 3V4GA 2MC3A 2YPRA 1SMTA 2KJBA 4ENNA 2K4BA 1H9TA 4M72A 4WXHA 3QPHA 1YW9A 1HSTA 5DUIA 3LSTA 3WGIA 4OIPF 1UB9A 1XCBA 2J5OA 3Q9SA 5K5OA 2EFQA 5LHHA 4A2UA 2DPDA 1SFXA 3TQNA 3HRMA 3GW2A 1G4DA 1ZAOA 1B59A 3J80Z 3MEXA 2P5VA 5D8LB 2A6HF 2PLYA 3DPTA 1KGSA 1YYVA 3EYYA 4P5OA 2K7LA 5DCMA 4IRHA 2Q8KA 3DXJF 2XAFA 3ECOA 3HRTA 3FXQA 1FSHA 1KQ9A 1HBXG 1MJBA 2DU9A 4HV6A 3CDHA 3O3KA 4YIFA 5A2QK 4EGYA 3I58A 2W24A 1ON2A 1U8RA 4KMUX 2FRHA 2F5EA 1XGOA 1SD5A 1FC3A 3FM5A 3I53A 1USTA 4IHSA 4MEXF 1LDDA 4RAZA 3E3VA 3GUDA 1SD6A 2DPUA 1R1UA 5J6XA 1YQAA 3NQOA 4CYDA 4L9JA 2P6TA 1QO0D 2JTVA 1J5YA 5H20A 2IPQX 1JGSA 1O3RA 5FD6A 4Y13A 3ZMTA 3K1PA 3M8FA 2KIFA 1WKMA 4ENKA 2JZYA 5HOOA 2OQRA 2MD5A 1WRJA 3MQ0A 3ERED 1TNSA 4OIRF 1UHMA 3GYHX 5LHGA 4MTDA 1I1SA 2M5WA 1W7PA 4PDKA 5CVVA 5FD5A 2GZWA 3S2WA 3T1BA 1FBSA 1FP2A 4KIBA 2O61A 3BOQA 5F6FA 1LEAA 2F2EA 4GYIA 3R60A 2STWA 2Z5UA 1OYIA 1MKMA 2PJPA 2OZUA 2NS0A 2Z3YA 1IN4A 1FPQA 2XAHA 2W85A 3GFIA 5L3GA 2XAGA 3WTSC 2E7XA 1D5VA 3I71A 1USSA 2CWEA 5LGNA 1J2XA 4BQAA 1LNWA 1KQ0A 4FX4A 1JHFA 2IT0A 3ELKA 4KNYA 3F6VA 3FXRA 4XLPF 2E1CA 2XRNA 3HSFA 5ICFA 5E1XA 2CQKA 2MH2A 4HW0A 1BOAA 1JHHA 4RB2C 3KETA 2E1NA 1QQIA 3C18A 4G6QA 4PGGA 5D5WB 1F5TA 2XIGA 3LA7A 4HAMA 3QU6A 4UXNA 5FB2A 3DKWA 1FOKA 5HDNA 3HTUA 4XBFA 2V79A 1DPRA 4EJUA 2FF4A 1BI0A 3T8TA 4CXFA 4L5IA 4B09A 3DF8A 5HS9A 1D8KA 4QWQA 5D5UB 3HUGA 1KA8A 3ECHA 1IN5A 1WWXA 3P7NA 1ZRDA 1K7AA 1MDMB 4LD5A 1ODDA 1PP8F 1QBJA 3KP5A 2ISYA 1ZLKA 1LEBA 2ZJ2A 1XCVA 3ZMVA 1U2WA 5J8FA 1P4XA 2ZXJA 3K2ZA 4CGZA 4LK0F 5D8KB 4MQVA 4S05A 1O3SA 3VB2A 5BS6A 3ULQB 5FO5A 1U5TA 2BV6A 3F8FA 4U88A 1DP7P 2PFBA 5TRDA 3ZMSA 2V6CA 3I64A 4HLXA 1XMAA 3NEUA 2CO5A 2EA4A 4LFUA 1DPUA 2KRFA 3E6DA 4YG2F 2EV0A 5JR3A 3GX4X 1B9NA 2ACJA 1LB2A 3F6OA 4LLLA 2RGVA 1O3QA 2QYOA 1R23A 1XSVA 4NHJA 3CO7C 2A5YB 2RKHA 2HZTA 3FHZA 3ZP5A 3TO6A 5HS7A 4YFKF 4EM1A 2B0LA 2EFOA 4U0YA 1FSEA 2ESHA 1G6NA 3W6KB 4D0PA 2VXZA 4HQEA 5KK1A 3J80K 5L3EA 2CFXA 4PZJA 1YW7A 1WQ2A 4M9SA 2H94A 3M8EA 2A69F 5BQTA 4ENMA 1TQPA 1SD7A 3U1DA 3LA3A 3BJOA 2L54A 1GXQA 2ZO4A 2NYXA 4EMSA 2M45A 4EGZA 4LGWA 1B6AA 2RNJA 1W5SA 1FX7A 5ICCA 5IT9K 3QP6A 5ICGA 4U7DA 2HDCA 5H6RA 5DEQA 3WU1B 2FNAA 3WTTC 5DD8A 1SFEA 1K78A 4IHTA 4KICA 5KVRA 4TV7A 1XSXA 4BAYA 3M7GA 5AIPA 3OOPA 3FXUA 1MJAA 2FEZA 5JHUA 4M73A 3L7WA 2EV6A 2NAZA 3N97A 1CF7B 2JT1A 4G7ZF 2OAZA 2EFWA 2LNBA 4ESBA 1W5TA 2CW0F 3KP2A 1KYWA 3IL2A 2M87A 1T0FA 4WK8F 1ZREA 4HF0A 1XGMA 1ZRCA 3BPVA 4G6DA 4RB1A 2YX4A 1D3YA 4ZYDA 5D4RA 2UXNA 1K78B 4UVBA 3KZYA 3TDUC 2WWYA 5FGMA 1FLIA 4A5NA 2X0LA 2FA5A 1WSUA 5E18F 3U9GA 4UV8A 3WG9A 2VC0A 3LQQA 5FFXA 2EFNA 3IHUA 1RUOA 4I0BA 2J5PA 3SZPA 1T2KA 3IRQA 3SHFA 5DYMA 2RVCA 1ZG5A 3H3ZA 4FHTA 2IA2A 3KLNA 4K2EA 3VEPA 4CICA 2JRTA 4KDPA 3H3UA 2RC4A 1ON1A 4B8XA 1NHAA 2D1VA 4LG0A 3CUOA 1DDNA 4EVIA 1ZRFA 4A0YA 1J75A 2QLZA 2GWRA 4HLYA 2P7VB 1R36A 1L3LA 3TO7A 3EETA 1B9MA 1RIOH 2YSRA 4RB0A 3TOBA 2DLLA 2IVMA 1Z6RA 5K5RA 1BIBA 5DDGA 1R1TA 4HF1A 3DQVC 2FBKA 3GF2A 4LG0B 2LKPA 1R58A 1KU7A 1T39A 3E6BA 4P9UA 2VBYA 3F3XA 2K27A 4PCQA 2BYVE 3FX3A 4DNCA 3RI4A 2NNNA 5D4SA 2YR2A 2R7DA 1YG2A 1FYKA 4HA8A 3QAHA 4L0YB 3PFIA 2FBIA 1S8NA 4I0AA 4IXAA 3ZN1A 3F22A 4RGXA 5D6EA 3VOEA 1Z6TA 2H09A 5LBQA 2IW5A 4Q4ZF 1U78A 3BZ6A 1TW3A 4IRGA 4YFXF 3MZYA 1QGPA 2DFIA 4P96A 1YO5C 2CGPA 2HQRA 2NRAC 2DO7A 3PQJA 2QM3A 1SFUA 1OMIA 4XLNF 3F23A 2L01A 1B1BA 3V7SA 5BOXA 2VE8A 2VE9A 3KP3A 4EM0B 4M6YA 3CLOA 2OD5A 3L2CA 2ESNA 1IRFA 1IAWA 2H27A 4WXCA 5DCFA 3R4KA 5E1WA 4HOBA 5DUKA 3WTVC 3L9FA 4RGUA 2KJCA 2GAUA 3GZ5A 2GXGA 2JPBA 4JQFA 4UHTA 3ZMDA 5ICEA 3M9AA 2V1DA 3EUHA 3I5UA 4GYGA 2P4WA 1K6OA 1MGTA 3WTUC 2QBYB 2P8TA 2RV8A 3O2PE 4UV9A 3L00A 1R5HA 4FT8A 3G73A 1HQCA 2GA2A 2CG4A 1KU9A 2V1XA 3BWGA 4LJZF 1HW1A 5JFRA 5E8GA 1S29A 1QZZA 1FT9A 1RI7A 1RUNA 4WF2A 3IWFA 4HX4A 3K0LA 4EJOA 1PDNC 2QUFA 3K69A 2ZKZA 3JW4A 4LB6B 1I5ZA 3ABTA 3B73A 1IW7F 3E6CC 4AD9A 2P6SA 5DV5A 2O3FA 1FBUA 3VODA 4NQWA 3GLXA 2L3DA 1EH8A 1P4AA 1BBYA 3CUQC 4CDGA 3RKWA 1LVAA 3J7AO 2XASA 1IN6A 1S7OA 4L5JA 1OPCA 1ZGJA 2Q0OA 1AOYA 3IRRA 2FU4A 4LMYA 4AIHA 1OYWA 3TOAA 4BH9A 5LGUA 2D2WA 2O03A 3Q9VA 4ZYEA 2DI3A 5EEHA 1OR7A 1J0RA 1STZA 3KFWX 3FZVA 3WTXC 1W7PD 2BEOA 1QPMA 3F8NA 3ISPA 4H0EA 4KN7X 2PI0A 2H6CA 2O0YA 2Y48A 5LLQA 3AAFA 3BROA 1KU3A 1R00A 2HKXA 2HQNA 2R7FA 4OINF 5LGTA 2ADUA 2MLGA 2EK5A 2FSWA 3RYRA 1MDMA 3E5XA 3L09A 5H6QA 1FYLA 4Q5SF 1TQMA 1T98A 1P92A 1H9GA 1E17A 4S04A 4JBAA 2RQPA 4A0ZA 2Q2EA 4E70A 2LSOA 4Z2YA 3R61A 1U5TC 3F8MA 2FQ3A 1P4WA 3QU3A 2XKPA 1YS6A 1ZARA 3KEQA 4EM2A 4LLNA 3R0JA 3FMQA 1IN8A 2OZ6A 5HLGA 4A12A 2VN2A 4RAYA 4CHUA 3BDDA 1YIOA 2HTJA 2VT3A 1J7KA 4BHBA 4G8XA 2HTSA 2HFHA 2W57A 2GXBA 4KIFA 2K86A 5ILUA 2DQRA 3HOTA 1BJAA 1DUXC 2EFPA 2E7WA 2XVCA 2VBXA 3HOSA 1B4AA 4BYYA 5JVTA 3WE3A 4KA4A 1YLFA 3ABUA 4DQ2A 2MH9A 2KIUA 5TJJA 1R5GA 2WTEA 5HVQC 3GEZA 1XDSA 4KN4X 1G3YA 4ZYHA 1GHCA 1I27A 4OIQF 2Z9OA 4MQ9F 4KMFA 1K79A 5D5VB 1EH6A 4M9XA 1S7AA 4AIKA 4AIJA 1KU2A 4A6DA 4A6EA 2STTA 3IKTA 2X4HA 4BNCA 3BJAA 2BE5F 5AONA 1BI1A 3R6SA 1CF7A 1I1GA 5AIQA 1UHWA 3JTHA 1XGSA 4HX8A 3KE2A 2VOPA 2CSOA 5HDGA 3LFKA 2D1HA 1YTYA 1KQ8A 3F72A 1EV7A 4WX9A 2G7UA 2NNYA 3F8CA 2EA2A 1GXPA 2PBIA 2VONA 2RN7A 2R3SA 3P9CA 3IWZA 3I0TA 2Y0MA 5BMZA 5LRRA 3COAC 3J81Z 4OMZA 4HBLA 4PGHA 4P55A 3E5UA 1AWCA 4EJVA 4AVPA 1PUEE 2IA0A 3LAJA 3P9KA 5LEKA 2QQ9A 2PN6A 5F64A 2TDXA 5E20A 2JSCA 1ZH5A 4G7OF 2UWMA 4Q47A 2WC2A 3FF5A 2FMLA 3ZMUA 4GGGA 2FE3A 3V7CA 5CLSA 4R8HA 1YFHA 2QWWA 2VBZA 2QQAA 4ENJA 2ZNZA 3KP6A 4UUVA 1Z9CA 3HSEA 1J59A 2HGCA 1BI2A 2LDUA 3CO6C 3RPUA 2A61A 4RB3C 2MLKA 4RGSA 2DTRA 3FWEA 3GO5A 1TLHB 2IRFG 2COMA 1BN5A 5L3CA 5K5QA 1R22A 5CYVA 5BPDA 2JPCA 3N4MA 1HKQA 1KYZA 2A6EF 2DBBA 1Q1HA 2XAJA 2ISZA 4BHCA 4OOIA 4ESJA 2HWVA 2IJLA 5CVUA 1G3SA 5JI6A 5BPIA 4EJTA 4A5MA 2M8EA 1YS7A 1REPC 3QPTA 3IKVA 3BP8A 3HHHA 1O7LA 4O5VA 2L4AA 4HF2A 2HKOA 3WODF 4Q48A 3QOPA 3RIRA 4G7HF 2XROA 5HLHA 4HZFA 3SZTA 3DP7A 3GFLA 3DEUA 3R0AA 3TO9A 1XDUA 4ESFA 1SMYF 1F1ZA 3BY6A 3HTSB 3HHGA 3TGNA 3SFZA 3H92A 3VFZA 1FYMA 4HYEA 4N9HA 1T6SA 1Y0UA 2QBYA 1O57A 2P5LC 2FNPA 3RJPA 2A07F 1ZG3A 3JSOA 1PP7U 1VTNC 1Z7UA 1GVJA 5FFZA 5HLIA 2ZFWA 2RDPA 2Z33A 2D45A 4NB5A 3ZQ7A 2AS5F 4R79A 3EQLF 5HS8A 2DT5A 1XD7A 1FP1D 3SQNA 3KEOA 5CJ9A 3BPXA 5E8IA 5EEGA 1P2FA 3T8RA 1G3TA 4MGRA 1EH7A 3D0SA 4KFCA 5IT9Z 5LRSA 5ED4A 2FXAA 3EDPA 3JTGA 3MZHA 3PQKA 2A3SA 1MZBA 3K1MA 2L02A 4MTEA 1T38A 4I02A 3NRVA 2QENA 3WGGA 1HKTA 3FMSA 4UNOA 4IJAA 4IVNA 1XGNA 5DCMB 4M9ZA 1UFMA 1IXSB 2EWNA 2O6GE 3RKXA 1YW8A 1QZYA 4I7HA 5K1YA 4YIIA 5D5XB 3RTRA 4RGRA 4KUMA 1TTYA 1HXDA 3WTWC 3HRSA 3IC7A 5J8CA 5FLXZ 4FX0A 1HW2A 3KP7A 2EJRA 3ZN0A 3RYPA 2PMUA 3TKYA 1FWZA 4HQMA 3I54A 2FBHA 4M6XA 2GA1A 1JXSA 3E5QA 3GWZA 4R1HA 1XN7A 6PAXA 2LF8A 2PMHA 3K9TA 2VOOA 1A04A 2K4JA 3CTAA 1IF1A 4BHPA 1ZN2A 3WTZA 1R1VA 1C0WA 1XSDA 5L3FA 4L9NA 1LDJA 4M71A 3WGHA 1LDKB 5CVJA 1S3JA 2ZBKA 4ETSA 3V7RA 2YX7A 4A0XA 4U0VA 3MWMA 3RKYA 2BBYA 4Y17A 3J81K 4XSXF 1W7PB 2UZKA 3WE2A 2P7CB 1CGPA 3JAMZ 2QZ8A 2Z99A 3KZZA 5D6FA 2VODA 1HKSA 3QP5A 2CYYA 1IN7A 3WU0A 3CUQA 4WWCA 4G94A 1OKRA 3QRFF 2OU2A 2XV4S 2VC1A 4LLGF 4GXOA 1L0OC 5ILSA 3B02A 2IA1A 2KKOA 4HDVA 3BJ6A 2PEXA 4UVAA 1BC7C 3HYIA 2OQGA 2M30A 4U7BA 4WXDA 4KYWA 2HYFA 2WV0A 1U3EM 2EV5A 3F21A 3Q5FA 2FOKA 3MAJA 3P9IA 3CUQB 1ULYA 4O3MA 1UCRA 4LK1F 2QQBA 3ZPLA 4XRFA 2ZNYA 4L18B 2XHKA 2PQ8A 4XSZF 5CVIA 2A68F 1Z91A 4QLCU 2M1BA 2V9VA 1V3FA 1O7FA 4I2OA 1JE8A 2QVOA 3I59A 5E17F 3V8JA 5A2QZ 1MJ9A 1V4RA 3LA2A 3ROUA 2BGCA 1P6RA 2O8XA 3O6BB 1QNTA 3ML6A 1IXCA 2HOEA 2ZCWA 2F5FA 4GO1A 2MBFA 2MA3A 4OIOF 4U0WA 2GQQA 1XMKA 3DFGA 3V8LA 1D8JA 2XGXA 4KT5C 3V8KA 3LQRA 1W4MA 3RDIA 1SD4A 3I59B 3WTYC 4ON0A 1XB4A 4UVCA 4OU0A 3EYIA 1BIAA 5LHIA 2XAQA 4HV5A 1SAXA 3C3WA 2FMYA 2HEOA 4RS8A 2C6YA 5F1RA 4EV0A 1TQIA 5E1ZB 3G3ZA 4MHGA 2HR3A 1FY7A 3KCCA 1ZG1A 1FZPB 3OV8A 1F9NA 2VBWA 3KP4A 1U5TB 4F7ZA 1BI3A 2ETHA 4CZZA 4IPAA 1ZGAA 5L3BA 4MNUA 1X3UA 4HDUA 1ZHFA 1HSJA 2W25A 1J9IA 2IP2A 2DK8A 2ZMEA 1O3TA 4L9TA 3HRUA 3C1DA 2DQLA 2DW4A 3RPQA 2W84A 4WCGA 3E6MA 1ZYRF 3HIFA 3TDZC 2EB7A 3W6JB 4ZZDA 3C7JA 4P9FA 3LWFA 1BC8C 1LJ9A 4HX7A 4OMYA 3F8BA 2OBPA 1ZLJA 4AWXB 3T0YA 1I6XA 2ELHA 2DK5A 3I4PA 2GIVA 4IRIA 2XUBA 2ZMEB 2HYGD 1TW2A 2G7HA 3FMRA 4M74A 3CJNA 2H6BA 2UXXA 3GZ6A 3GXOA 1F4KA 2Y75A 1H0MA 2AXLA 3MFKA 3KLOA 3U2RA 2V1UA 4G9YA 4IF4A 3K1NA 2K02A 4O6JA 4ZH4F 3SXYA 3E97A 3T5XA 1U6GA 3GFMA 4ZYGA 1ONVA 1FNNA 2P5KA 2L4MA 5HDKA 4ASNA 2F5DA 4GCVA 4Y15A 5FLXK 4JK1X 4N9IA 1S6LA 4MEYF 1TNTA 4N0BA 1BM9A 2OA4A 1IRGA 2XKOA 4I09A 1RZ4A 3D5LA 5LEJA 1WI9A 1TBXA 2PG4A 3LAPA 5CVRA 4I01A 1LQ1A 1FBQA 2G9WA 4CO8A 1IXRC 1R7JA 5IT3A 1RNLA 3HSRA 3JSPA 5L3DA 1Z05A 3GVAA 2DAOA 4I98B 3ZMZA 1HW5A 4L0ZB 1MD0A 5DD4A
chains in the Genus database with same CATH superfamily
3MCZA 2KIMA 4IOAF 1X2MA 4CH7A 1V5FA 2M7AA 2NVTJ 2VT2A 2QKMB 5EGOA 3HB9A 1ERDA 4BJ5C 1IZ1A 1R4NB 3ABMH 4BE0A 1E2XA 2F5VA 2F5CA 3BZCA 3M1EA 3GFJA 3S17J 3K4NA 2LVSA 2LF7A 2HS5A 3KZIC 1OYYA 1HC8A 1VQPI 2X1DA 4M3FA 2YU3A 4BY1J 4ZZLA 1Z1DA 5B3SH 3FM3A 1G3WA 3TEDA 4IO9F 4KIGA 2CW8A 4L9VA 5ILVA 3RQIA 4E7LA 2MD0A 4EQQA 2KQRA 3JAMK 3DV8A 2ELJA 4LB5A 4IZZA 4BXUA 3QWLA 3CF5F 3ZQFA 2LKSA 1IUYA 3DPLC 2HI3A 3TL4X 5ERIA 3REOA 4YFNF 4EJWA 3V4GA 2MC3A 3TBIA 1POGA 1SMTA 2YPRA 2XC7A 2KJBA 4ENNA 2K3FA 3GTOJ 5J3LA 2X48A 5EZHA 3CCRI 3GTQJ 5FLMJ 2K4BA 3MKWB 5EGOB 3EUHC 1H9TA 1Q1VA 4M72A 4WXHA 2YU9J 5E3OA 2F4OB 3QPHA 1YW9A 3CF2A 1I3AA 4LIVA 1O4XA 3S32A 1HSTA 2DTZA 1VQ8I 5DUIA 3OYBA 3LSTA 1LVKA 4BS9A 3CJTB 3WGIA 3M3YJ 5CQEA 4OIPF 1UB9A 1XCBA 4ITVA 2J5OA 1BR4A 3Q9SA 1QVUA 5F0CA 2EFQA 5K5OA 1SEUA 2R7TA 5LHHA 4A2UA 2DPDA 1SFXA 2O5RA 1UAAA 5H2FC 2R7OA 3TQNA 1IG7A 3FDYA 3HRMA 3S93A 2TRTA 3GW2A 1G4DA 3ZQCA 1Z3XA 1B59A 1ZAOA 3MEXA 3X2QH 3J80Z 4A69C 2P5VA 3BTIA 5D8LB 2A6HF 3H5NA 1LE8A 2LFBA 2PLYA 3DPTA 4FCYA 1KGSA 2KLOA 1YYVA 3OIOA 1F43A 3EYYA 4P5OA 2K7LA 1S9HA 5DCMA 2M8GX 5FKMA 2DFEA 3FHNA 4IRHA 2Q8KA 3DXJF 2XAFA 3WU2C 3S2DJ 2ELKA 2DA6A 3ECOA 3HRTA 2HPMA 3FXQA 2RREA 1FSHA 1KQ9A 3MN2A 1HBXG 1MJBA 4E4HA 2DU9A 2CJJA 4HV6A 3DTEA 3K6GA 3CDHA 1BR2A 3O3KA 4YIFA 5A2QK 2QKLB 5GAEJ 4EGYA 3I58A 4QIWN 4A3JJ 5HNFA 3S14J 5C4XJ 3QYEA 2W24A 1ON2A 1U8RA 1SVOA 4KMUX 2FRHA 2F5EA 1XGOA 4V2GA 1LE8B 3K4MA 1SD5A 1WJAA 1N25A 1XMXA 1FC3A 2CH0A 3FM5A 4XM3A 3I53A 1HDDC 3PM1A 1E3PA 1USTA 3S3MA 4IHSA 4MEXF 1LDDA 4RAZA 3E3VA 3BR2A 5IPAA 3BR6A 3GUDA 3E1SA 1SD6A 4NC6A 2DPUA 4EATA 1T8IA 1X1BA 1R1UA 5J6XA 1YQAA 1HLVA 3NQOA 2OC6A 1VZ0A 4CYDA 3DEWA 2XF5A 4L9JA 2XSDC 2CV2A 5FJ8J 3S1QJ 3VYTB 2P6TA 3JRDA 1QO0D 1T95A 3ZQQA 2JTVA 3K4CA 1J5YA 4MFDA 3CC4I 1OCRH 5H20A 1YITI 2IPQX 1JGSA 1XC5A 2IXSA 1O3RA 5FD6A 4Y13A 4DOZA 3ZMTA 5F1JA 3DKYA 4PJLA 3K1PA 3M8FA 2KIFA 3PO3J 2WA0A 1WKMA 4ENKA 1YE9A 2JZYA 5HOOA 2OQRA 2MD5A 1WRJA 2PX9A 2Y9YA 2EBIA 2L0KA 2DYSH 4A3EJ 2CQ7A 1Y1WJ 4NDLA 3MQ0A 3ERED 1TNSA 4OIRF 1UHMA 3AG1H 3C2GA 3GYHX 3E0JB 5LHGA 5DM7F 3QOEA 4MTDA 1I1SA 1R9TJ 3OYDA 1JKOC 2M5WA 2MSYA 3LMMA 1W7PA 3G6EI 4PDKA 5CVVA 5FD5A 2X6YA 1AU7A 2GZWA 3S2WA 2EIKH 3HOVJ 3T1BA 1W5CC 2X6OA 1FBSA 1FP2A 4KIBA 2O61A 1R6RA 3BOQA 4XONA 5EZGA 3JRHA 5F6FA 1LEAA 3OSGA 3QYBA 2H8RA 3HM5A 2L7ZA 4GFBA 2F2EA 4GYIA 3HPHA 3R60A 2STWA 2LYCA 4U87A 2W1OA 2Z5UA 1OYIA 1EKEA 4KT6A 2DA1A 2OTJI 1MKMA 4XL9A 2PJPA 2OZUA 3OYIA 2NS0A 1Z67A 4BXXJ 4PJ0C 4EEFG 2Z3YA 1MBEA 1IN4A 1FPQA 4ABZA 2XAHA 2K9QA 1KONA 2W85A 3H9QA 3GFIA 2A05A 3KEYA 4Y52J 2X1CA 5L3GA 3AFHA 2XAGA 1LFPA 3WTSC 4YRVA 2E7XA 1D5VA 3I71A 1USSA 2CWEA 5LGNA 5C4JJ 1VQNI 2E71A 1J2XA 4BQAA 1LNWA 2CRGA 3GTKJ 1KQ0A 4FE7A 2JSPA 4FX4A 3OS1A 1JHFA 5M3FJ 1U8BA 2IT0A 3ELKA 1I3QJ 1T33A 2HDDA 3FIWA 4KNYA 3GTLJ 2R7VA 3F6VA 2B63J 1K4TA 3VWBA 2HOAA 3FXRA 3QQAA 4XOTA 4XLPF 2E1CA 2XRNA 3HSFA 5ICFA 5E1XA 2CQKA 2DA5A 2MH2A 4HW0A 1TC3C 3D5SC 1BOAA 2ZJQF 2E60A 1JHHA 4RB2C 3KETA 1D5YA 1YI2I 4XOPA 2E1NA 1QQIA 4V2FA 2K9NA 3C18A 1G2HA 3HOXJ 4G6QA 4PGGA 2B9SA 4ZJZA 3I55I 5D5WB 1D0ZA 1F5TA 2FD5A 3OY9A 2XIGA 3LA7A 4IKFA 4HAMA 3QU6A 2XPUA 2CFOA 2M9HA 4DZJA 4UXNA 5FB2A 2R4GA 1DGRM 1IRZA 3DKWA 1FOKA 5HDNA 3J7AY 3HTUA 4XBFA 5LFAA 3OYNA 2HDWA 2V79A 3VYSB 1DGWY 4RAFA 1DPRA 2ECCA 4EJUA 2FF4A 3H5AA 4M6VA 1BI0A 1RRJA 1MIJA 1EF4A 3LSHA 3OYMA 2LK2A 3I3LA 3L1PA 2BHZA 3T8TA 4CXFA 4A3IJ 4L5IA 4PFOA 1TWAJ 3WHCA 2GOMA 2DA7A 4Y33A 4B09A 3DF8A 2QA4I 5HS9A 3Q3SA 1D8KA 3LL7A 4QWQA 3HUGA 5D5UB 1KA8A 3BZKA 1K6YA 1MBGA 3SDGA 3FXMA 4M3DA 1XG1A 3ECHA 4ANJA 4I6ZA 2VKHA 1IN5A 1WWXA 2OCCH 2KZVA 2GXAA 3P7NA 3HKZN 3G1MA 1ZRDA 1K7AA 2VPLA 1MDMB 5TGTA 3HGGA 3DWLE 4LD5A 4AC0A 2IGOA 3CC7I 1ODDA 1PP8F 4BU2A 1QBJA 3KP5A 2ISYA 1ZLKA 2LC2A 1LEBA 2ZJ2A 1XCVA 3ZMVA 1U2WA 2E5ZA 5IP7J 1R5ID 5J8FA 1P4XA 3OYGA 2ZXJA 3K2ZA 4XRMA 3A02A 4CGZA 1X3WB 4J01A 4LK0F 1MSFC 3QPLA 1ETWA 5D8KB 2KT0A 3GTMJ 1RR8C 4MQVA 4S05A 1UJ8A 1LKXA 1O3SA 5IOYA 3S1NJ 1ITYA 3VB2A 1IDZA 5BS6A 3ULQB 2YS9A 5GAGJ 1RKTA 2WB1N 3G71I 5FO5A 1U5TA 2XF6A 3HUGB 3DU6A 2CS3A 1OCPA 2BV6A 4AM3A 2LBFA 3ZR8X 3F8FA 1Y6IA 4U88A 3SZGA 1DP7P 2PFBA 4ZTFA 4BY7J 3A1YA 5TRDA 3ZMSA 2V6CA 3I64A 4HLXA 5GTIC 1SANA 1SVLA 1XMAA 3NEUA 3AL0B 2CO5A 2EA4A 2LMDA 5C3EJ 2Y0SN 4LFUA 2EIMH 3CCJI 1AA7A 3OSFA 1DPUA 2KRFA 3E6DA 4YG2F 4X0GA 4E7KA 2EV0A 1P7JA 5JR3A 3DEEA 1RETA 3GX4X 4KISA 5M5YJ 2VJJA 4E7SA 1B9NA 2ACJA 1SVMA 1LB2A 3F6OA 4LLLA 2RGVA 1O3QA 4BBRJ 2QYOA 1R23A 1XSVA 4NHJA 3CO7C 2A5YB 1ETKA 2RKHA 4PJNA 2HZTA 3MMYB 3FHZA 3BTLA 1CQTA 4UUSA 3ZP5A 3TO6A 5HS7A 1FMWA 4YFKF 2JA2A 4EM1A 3H3VK 1FOXA 2B0LA 2EFOA 4U0YA 1FSEA 2ESHA 1G6NA 2ZXWH 3BR3A 3W6KB 3ZQIA 3HGYA 4D0PA 2VXZA 4HQEA 2V7FA 5KK1A 3J80K 1Y0NA 4HEA2 3H35A 1DQUA 5L3EA 3L2WA 2CFXA 4PZJA 4XLFA 4B44A 1MH3A 1GDTA 1YW7A 3BR0A 1WQ2A 4M9SA 4A3GJ 2H94A 3M8EA 2A69F 5BQTA 4ENMA 1U9OA 1TQPA 1SD7A 3U1DA 3LA3A 3BJOA 2L54A 1GXQA 2ZO4A 3JRFA 2NYXA 4EMSA 1OISA 2M45A 1BW6A 4EGZA 4LGWA 1A6IA 1B6AA 2VIXA 2RNJA 1W5SA 1FX7A 3G1OA 4XORA 4XKVA 5ICCA 5IT9K 4UUSB 3LNQA 4M3BA 2XB0X 3QP6A 4XKCA 4BDZA 2R7QA 5ICGA 4U7DA 2HDCA 1W1WE 5H6RA 5DEQA 3WU1B 2FNAA 3WTTC 1VQKI 5DD8A 1SFEA 2ZSHB 1K78A 4IHTA 4KICA 5KVRA 1PYVA 4TV7A 1XSXA 1FTZA 4BAYA 3M7GA 5AIPA 2E34A 3OOPA 3FXUA 3ZQHA 1MJAA 2FEZA 2FOWA 5JHUA 2NVYJ 2BZTA 2CQXA 2ME0A 4M73A 5F04A 5IP6A 3L7WA 2IGNA 2EV6A 2NAZA 3N97A 1CF7B 2NVQJ 2JT1A 4G7ZF 2OAZA 2Y31A 1W0TA 2XPVA 1W0UA 2JA5J 2EFWA 2LNBA 2OJED 2CUEA 4ESBA 3TP3A 3FXKA 1W5TA 2M7BA 3OWTA 2CW0F 3KP2A 1YRNA 2X6WA 2IEKA 1KYWA 3IL2A 2M87A 1T0FA 4WK8F 2R7RA 2VJIA 2MGQA 3W2AA 1ZREA 3WHBA 4HF0A 1XGMA 1ZRCA 2MG4A 3BPVA 4G6DA 3LFUA 3G1LA 4BBSJ 2DMPA 2EILH 2HQAA 3M07A 2ZB9A 2AHQA 4RB1A 2VKVA 2YX4A 4BQQA 1D3YA 2G0EA 4ZYDA 3K4JA 2L9SA 5D4RA 2UXNA 1S72I 5K7FA 1K78B 4PJJA 4UVBA 3KZYA 3TDUC 2WWYA 3OR2C 5FGMA 1MH4A 5IP9J 1JKRC 2CV1A 1FLIA 4D5CA 4A5NA 2X0LA 2FA5A 1VFCA 1WSUA 5E18F 3U9GA 4UV8A 3WG9A 4X6AJ 2VC0A 3LQQA 5FFXA 1MMDA 2EFNA 3IHUA 3LSMA 1RUOA 5M5WJ 2WADA 4I0BA 2J5PA 4W97A 3SZPA 3AKZA 1T2KA 3IRQA 3SHFA 5DYMA 2JA8J 3HOYJ 3Q0VA 5GP9A 4Y4RA 2RVCA 1ZG5A 3I56I 3JRCA 2XAUA 1MMGA 3H3ZA 4FHTA 2IA2A 2QQ8A 4PUSA 3G2BA 4F55A 3KLNA 4K2EA 2I10A 3VEPA 3PIPF 3HG9A 4CICA 2JRTA 4KDPA 3H3UA 2RC4A 1ON1A 4B8XA 1PJRA 2FJ1A 1Z3YA 2OUMA 1NHAA 1FIAA 1Z0XA 4H4KC 1TP4A 3M1CA 2D1VA 3QPSA 4LG0A 3CUOA 4BE2A 3K4KA 1DDNA 4EVIA 2AO9A 2Y30A 1YX5A 1ZRFA 2JA6J 2NVUB 2EPFA 2DT6A 2XPWA 4A0YA 3L2UA 1J75A 3O8HA 2O7OA 2Y2ZA 1QU3A 2QLZA 2WAQA 1UG0A 2X9DA 2GWRA 3H9JA 4A3CJ 4E6KG 4HLYA 2P7VB 1R36A 1L3LA 3TO7A 1MNMC 3EETA 1B9MA 4NUBA 2HYJA 3DTIA 4PSXA 4DIQA 1RIOH 1HA8A 2YSRA 4MFEA 3F9KA 4RB0A 3TOBA 2DLLA 3PNYA 2IVMA 1E3OC 1WCMJ 1Z6RA 2CUJA 2P0WA 1XTAA 5K5RA 1BIBA 4OWRB 3RSNA 5DDGA 2LY9A 4I76A 1R1TA 3RPUD 4HF1A 5FRMA 3BG9A 3DQVC 2YUSA 3Q0UA 3A2KA 2FBKA 3GF2A 4LG0B 3HXLA 2LKPA 1R58A 4CCKA 4B1RA 4DYQA 1KU7A 1A31A 2H1LA 3MKZA 1T39A 3E6BA 2VQGA 3OR1C 3Q0WA 2VBYA 4P9UA 4BKXA 3F3XA 1YHQI 2K27A 4PCQA 4HNVA 2BYVE 3MVPA 3FX3A 4FTHA 4DNCA 3RI4A 3ERMA 2NNNA 5D4SA 2BW3B 2VXDA 2YR2A 3MKLA 4ZDOA 3OS0A 2R7DA 1YG2A 1FYKA 3DBHB 3IV5A 2F4IA 2OV7A 1B8IB 4HA8A 3QAHA 2VI6A 4L0YB 3PFIA 4CUGA 2FBIA 2F6CA 3ZRGA 2MC4A 4D5FA 2X6XA 2E36A 1S8NA 2EINH 4I0AA 4IXAA 2DXIA 4E7ZA 3HC7A 3JR9A 3ZN1A 3F22A 4RGXA 5D6EA 2IS4A 3VOEA 1VQMI 3C2HA 1Z6TA 2DOEA 2H09A 2ZFUA 3LSPA 2KDOA 1GLNA 3GZNB 5LBQA 2IW5A 4F93B 4Q4ZF 3CP2A 1U78A 3BZ6A 5EG0B 1TW3A 2CQQA 4IRGA 1A36A 4YFXF 2ZJPF 3MZYA 1QGPA 3LOCA 2K3PA 4L5EA 2DFIA 4P96A 3EUAA 1PVEA 1YO5C 3OYEA 2CGPA 1VQ7I 2HQRA 3H36A 1HF0A 3AG2H 2NRAC 2DO7A 3PQJA 2QM3A 1SFUA 3BR5A 1OMIA 5KHDA 4XLNF 3F23A 4XNFA 2L01A 1B1BA 3V7SA 1FJLA 2KMUA 5BOXA 2VE8A 2VE9A 1X1CA 2VQLA 1K4SA 3KP3A 2QSGX 2PMZN 4FQGA 2DT7B 2JUCA 4EM0B 1ZK8A 3AG3H 3HJEA 4M6YA 3CLOA 2F48A 2OD5A 3L2CA 1W36C 2ESNA 1WFXA 1IRFA 1IAWA 2H27A 2MABA 4WXCA 1MNDA 2Y69H 5DCFA 3R4KA 5E1WA 1WVRA 4HOBA 5DUKA 2EH3A 1XX5A 3WTVC 3L9FA 3KX2A 3LSRA 4RGUA 2KJCA 2PMZA 2GAUA 3GZ5A 3A0HC 2GXGA 4CCLA 2JUGA 2JPBA 4JQFA 4UHTA 3ZMDA 2VKDA 5ICEA 3M9AA 2V1DA 3EUHA 1MSEC 3UKGA 3I5UA 5FKLA 4GYGA 2P4WA 3D1NI 1K6OA 3VPRA 2LTPA 1JUPA 2L9VA 3O8GA 1MGTA 3WTUC 3CDIA 2QBYB 2P8TA 5KAFC 2RV8A 4BJTA 2QF7A 3U1KA 4IHXA 1S7EA 3O2PE 2CU7A 3L00A 4UV9A 1R5HA 5E3MA 1A6QA 2VASA 4N4OB 5E3NA 4B43A 4FT8A 4YELA 1OCOH 3G73A 4B3XA 1HQCA 3H0GJ 5F08A 2P81A 2GA2A 2L7MP 2CG4A 1KU9A 2V1XA 3BWGA 4LJZF 5M5XJ 1HW1A 5JFRA 5E8GA 4A3LJ 1S29A 3GLLA 5DTDA 1A5JA 1QZZA 1FT9A 1RI7A 3BR1A 1TWHJ 4A3MJ 1RUNA 5CPRB 3DU5A 4OAZA 4WF2A 1EJ9A 3IWFA 2EIJH 4YIRX 3CP8A 4HX4A 2LD5A 3SJMA 2VLAA 1NTCA 3K4BA 3TW7A 1JUMA 5GTHC 1X3ZB 3K0LA 4EJOA 1PDNC 2QUFA 4QSHA 4XRSG 3ZQLA 3I4NJ 3K69A 2ZKZA 3JW4A 2L5QA 4LB6B 1I5ZA 4BGDA 3ABTA 2XF7A 3B73A 5F0HA 3DPUA 1IW7F 4IOCF 1IV6A 3E6CC 1X1PA 1JKQC 4AD9A 5J4YA 4P1WA 2P6SA 5DV5A 1JTYA 2O3FA 2KDZA 4MO7A 2WAFA 5K7ZA 1FBUA 3VSKA 3CQZJ 3VODA 4NQWA 3GLXA 2HVQA 2QSFX 4C30A 2AQEA 2L3DA 1W36D 1H89C 3HDDA 1QHHD 1IDYA 1EH8A 1P4AA 2LY2A 5EYRA 2BOLA 1BBYA 3M8JA 3CUQC 4I99C 4HSRA 3SYTA 1FMVA 1IC8A 4CDGA 3RKWA 4XLEA 3DLAA 1ZR4A 1LVAA 3IH2A 3J7AO 2XASA 1DP3A 1IN6A 1UELB 1S7OA 4L5JA 1OPCA 1ZGJA 3S1RJ 2Q0OA 1AOYA 3IRRA 2FU4A 3U21A 3HPGA 3FISA 4LMYA 3F0CA 5FKNA 3OOUA 3EPZA 3V42A 2ZXHA 3CESA 4AIHA 1OYWA 2DMQA 2COBA 3BQZA 4NQWB 3TOAA 2JVGA 4BH9A 2XGEA 5J47A 5LGUA 2D2WA 3C2BA 2O03A 4ZYAA 3Q9VA 4ZYEA 1WPKA 2DI3A 3W2VA 5EEHA 1OR7A 1J0RA 1NH3A 2BY2A 1DU0A 1STZA 3VDXA 4D1QA 3KFWX 3FZVA 3PUFA 3WTXC 2O8KA 2XDVA 5JLXA 4BEHB 1W7PD 2BEOA 2V9PA 1QPMA 3F8NA 4XKWA 1Y8QB 3ISPA 4XLCA 4H0EA 4KN7X 2PI0A 1G8XA 4CYCA 4J00A 1S5LC 2CUFA 2H6CA 2O0YA 2Y48A 5LLQA 3AAFA 3BROA 1KU3A 1R00A 4ZC3A 2HKXA 2K9LA 2KRCA 1TWCJ 2HQNA 5GADJ 3PJRA 4JP0A 2F4MB 2R7FA 5GAHJ 1QA6A 2R7UA 4OINF 5LGTA 2ADUA 2MLGA 5FLVA 4XMYA 2R0QC 4XIDA 2EK5A 1K61A 2KFDA 4PSWA 2AQFA 2FSWA 3RYRA 1MDMA 3FK6A 4C3JJ 3E5XA 1VQOI 3L09A 5H6QA 1FYLA 2V6EA 4Q5SF 1TQMA 2VB6A 5J40A 3S16J 1T98A 1P92A 1H9GA 4F3QA 1E17A 4S04A 1TWFJ 4JBAA 1AHDP 2RQPA 4A0ZA 1YX3A 4CYCB 1FEXA 2Q2EA 5KCMA 4E70A 1LUJB 1RPWA 2DFFA 2IBDA 2LSOA 2BVLA 4Z2YA 2NVXJ 3R61A 1U5TC 3F8MA 2FQ3A 1P4WA 3QU3A 2XKPA 1YS6A 2M3AA 3S15J 1ZARA 3KEQA 1P7IA 3DBLB 3FBIB 4EM2A 2PJRA 4LLNA 3R0JA 1GUUA 1JUSA 2DA3A 1OFCX 3FMQA 1IN8A 2OZ6A 1WGXA 4JOMA 4BQOA 5HLGA 4A12A 1K83J 2VN2A 3BC8A 4RAYA 4CHUA 1WJFA 3BDDA 1J09A 3JRAA 2CV0A 1D1CA 1YIOA 2HTJA 2JN6A 2VT3A 3KYCB 1J7KA 2BHYA 4BHBA 1ZKGA 2Q2EB 3HKZA 4G8XA 1ETYA 2HTSA 2HFHA 4BACA 2NOGA 2DDBA 2W57A 4DYCA 4KIFA 2GXBA 2KRHA 2K86A 1SAUA 5ILUA 3PFYA 2DQRA 3HOTA 1BJAA 3HBLA 1MMAA 1DUXC 2EFPA 2E7WA 2XVCA 2VBXA 2QCOA 3HOSA 4G6TB 3BCBA 4GRIA 4M3GA 2R7WA 2PJRB 3HOZJ 3OIQA 1B4AA 2EZLA 4BYYA 4JX6A 4DZPA 4V19K 2M0CA 2ZMEC 4M3EA 3CDLA 5JVTA 4D7MA 3CCEI 2WB1A 3WE3A 4KA4A 2IGKA 1YLFA 4BXFA 3ABUA 5E79C 3H1CA 4DQ2A 3DBRB 4AIDA 2MH9A 2AXTC 2KIUA 3W2WA 5TJJA 1BA5A 1R5GA 2WTEA 5HVQC 3ABKH 3GEZA 1XDSA 4DBQA 4KN4X 1ORKA 2A6TA 2GIZA 3N05A 1G3YA 4ZYHA 3B6AA 3NWTA 3RQ4A 1VQ4I 1ZTRA 1GHCA 1I27A 1Y1VJ 2GLOA 2ID6A 4KITB 4OIQF 2Z9OA 2K9SA 3KPHA 2DMTA 4MQ9F 3P5JA 4AVZA 2HPIA 2Y0SA 4KMFA 4IQJA 1VQ6I 1K79A 5D5VB 1EH6A 2DMUA 1ETOA 4M9XA 1S7AA 2NS7A 4LIUA 2ECBA 4AIKA 4AIJA 1KU2A 2V1NA 4A6DA 4A6EA 1V54H 2STTA 4CZCA 1D1BA 5FRNA 2QGUA 2BXYA 1IV8A 4NC8A 3IKTA 2NS8A 2DA2A 5J1RA 5EEAA 2X4HA 4BNCA 3BJAA 2BE5F 2XRLA 5AONA 2VUMJ 3SDBA 1BI1A 2I5UA 3R6SA 3MKYB 1CF7A 3IAS2 1I1GA 1X58A 2HQ5A 1OLTA 5AIQA 1NG6A 1T0FC 1GVDA 1UHWA 3JTHA 1MW7A 1XGSA 4HX8A 3KE2A 4AYBN 4DJAA 1X4OA 2QEXI 4B3AA 2VOPA 2CSOA 3BTJA 5HDGA 3LFKA 2D1HA 4S0HB 4D9JA 2R7XA 1YTYA 1KQ8A 3F72A 1EV7A 2BXZA 4WX9A 2G7UA 3KYLA 1JTXA 3RKQA 3OYKA 4LITA 2NNYA 5JLWA 3GTGJ 5LD2C 4XN3A 2K9MA 3F8CA 4XLHA 3UNGC 5BNGA 1RR7A 3S8PA 4A3DJ 2R5YA 2EA2A 1ZELA 3I9V2 1WHUA 3CCLI 1GXPA 4A3KJ 1R49A 2PBIA 2VONA 2RN7A 2R3SA 3P9CA 3L2RA 3IWZA 3I0TA 2DOAA 2CQNA 1D0XA 1MNEA 2EQRA 2RQQA 2Y0MA 4D7NA 5BMZA 5LRRA 3IH4A 3COAC 3J81Z 4OMZA 1Z21A 5CQGA 2E2HJ 2JQ7A 4HBLA 4PGHA 3HOUJ 4P55A 4UUTA 1G59A 4RDUA 1ENHA 3E5UA 3OL4A 2E5NA 2CW7A 1AWCA 3FXLA 4EJVA 1BOBA 3LSIA 4AVPA 2EZKA 1PUEE 2IA0A 3LAJA 1WH5A 3P9KA 3FKJA 5LEKA 4YEJA 2BY1A 2QQ9A 2PN6A 3E7LA 2Z16A 1D0YA 2K40A 4RLFA 2JA7J 5F64A 2R5YB 2TDXA 3CCQI 5E20A 2JSCA 5FKOA 1ZH5A 4G7OF 5GPCA 4Q47A 4C2TA 2WC2A 2UWMA 1ACIA 3FF5A 5J1YA 1RC9A 2FMLA 4W1UA 3ZMUA 4GGGA 2FE3A 2K85A 5DM6F 3V7CA 5CLSA 4R8HA 1YFHA 1DU6A 2QWWA 3BCAA 2LR8A 2VBZA 3S3OA 3A4CA 2QQAA 1NK2P 4ENJA 2ZNZA 3KP6A 4UUVA 5HNHA 3AG4H 4XKBA 2VKEA 1Z9CA 2RNGA 1GT0C 2E2JJ 3HSEA 1IGNA 5B1AH 1J59A 2HGCA 3KYDB 1BI2A 2LDUA 3CO6C 3RPUA 2R92J 3BTCA 2XSJC 3B6CA 3A01A 2A61A 4RB3C 2MLKA 4RGSA 2DTRA 1OJLA 3FWEA 3UR3C 3GO5A 2E1MC 1TLHB 2JRMA 2DJIA 4E7IA 2IRFG 2COMA 1BN5A 1F36A 5L3CA 4HNTA 5K5QA 1R22A 2BW3A 5CYVA 5BPDA 2K5CA 4HG2A 4C2UA 2JPCA 3N4MA 1B8IA 4Y7NJ 1HKQA 1KYZA 2A6EF 2DBBA 1GV5A 1Q1HA 4MLOA 2XAJA 2ISZA 4BHCA 1I39A 4XRSA 3K7AJ 3HZJA 4OOIA 4ESJA 1HCRA 2HWVA 4HRIA 1APLC 3H5RA 1JJ6C 1TZLA 2KP6A 1JKPC 2IJLA 1FIPA 4XK4A 5CVUA 1G3SA 3OIPA 5JI6A 5BPIA 4EJTA 4A5MA 3K10A 2M8EA 4FETA 3SEQA 1YS7A 2EZHA 3OYAA 1REPC 3QPTA 3IKVA 5EG0A 3BP8A 3A01B 3HHHA 3PO2J 5JHFA 2LH9A 1O7LA 1ZGWA 4O5VA 3FKIJ 3MZ8A 4RLQA 2L4AA 4HF2A 3PNTA 2HKOA 3WODF 5E3LA 4Q48A 3ZCOA 3QOPA 4JX4A 4QPQA 5F27A 1ETQA 3RIRA 3PNVA 4DGWB 2IS6A 2DODA 2XROA 1TT0A 4G7HF 4AUXA 2Y9ZA 3H9GA 5HLHA 2HXIA 2VQHA 4HZFA 3SZTA 3TMOA 3DP7A 1MBKA 3GFLA 3DEUA 3R0AA 4JX5A 2V4JC 3K4LA 3TO9A 1XDUA 2ID3A 2L2OA 1FTTA 4ESFA 1SMYF 4J19A 2IS1A 1F1ZA 3BY6A 5IOZA 3HTSB 3KIOA 1LPQA 1N77A 3OYHA 3HHGA 3TGNA 4Y3OA 3HEFA 3SFZA 2WV1A 1X19A 3IAM2 3H92A 4PFPA 1X2NA 1ZQ3P 4A93J 3VFZA 1FYMA 4II3A 5M3MJ 2LREA 2M4GA 4HYEA 1IO2A 2DA4A 4N9HA 1Z77A 5B1BH 4HNUA 4E7JA 2R93J 1QRYA 1T6SA 1Y0UA 2EZIA 2ZSIB 4NBQA 2HNHA 2QBYA 2H8WA 1D1AA 3OMYA 1O57A 2P5LC 1WJBA 2FNPA 2NXNB 1UZCA 3RJPA 2A07F 1JT6A 1ZG3A 3JSOA 1PP7U 2FUG2 1OCTC 1VTNC 1Z7UA 1GVJA 5FFZA 1P9QC 2KISA 2E1MB 1U0JA 2ZFWA 5HLIA 2RDPA 1E0EA 2BVMA 2OTLI 3SEZA 1VI0A 1HOMA 2M4KA 2Z33A 2D45A 3L2VA 4NB5A 1BJZA 2XGCA 3ZQ7A 2AS5F 4R79A 3EQLF 5HS8A 3CMEI 2DT5A 1XD7A 1FP1D 2M2EA 3SQNA 3KEOA 5CJ9A 1VNDA 3BPXA 5DS9A 4A3FJ 2KIQA 5E8IA 2LOOA 3BQYA 4N4NB 1P2FA 5EEGA 3IH3A 3BG6A 3T8RA 1G3TA 3QYFA 3JRBA 1E3HA 4MGRA 1EH7A 1OQYA 1WJ5A 1NK3P 1QHGA 3D0SA 4KFCA 3CD6I 3CJQB 2JWTA 5IT9Z 2DFHA 3BG5A 3ZQGA 2FXAA 5LRSA 5ED4A 2ZXIA 3EDPA 4ZDPA 3JTGA 3MZHA 5FKKA 1VQLI 1U9NA 3PQKA 2LKXA 2A3SA 4XQFA 5EDNA 2TCTA 1MZBA 2IGMA 2E2IJ 4BDYA 3K1MA 2L02A 2VJ4A 2A5WA 1WZ2A 5KAIC 4MTEA 1T56A 1T38A 1N75A 4I02A 3ASOH 2KZGA 1BR1A 3NRVA 2QENA 4CCNA 2Z2SB 3WGGA 1HKTA 3FMSA 5IY5H 3JRGA 3ABLH 3S1MJ 4UNOA 4IJAA 4IVNA 5IYBJ 3GBGA 1XGNA 3A0BC 5DCMB 2KHMA 4M9ZA 1UFMA 5J4VA 1IXSB 3BLYA 2EWNA 2O6GE 4RA2A 4Z6YA 3RKXA 1V5EA 3HL2A 2HU9A 2L9NA 3CMMA 1YW8A 3FXOA 1QZYA 2X85A 2DYRH 2ZC2A 4I7HA 5K1YA 4YIIA 5HODA 2LY1A 5D5XB 3RTRA 3H0DA 3OYLA 4F52A 4BL0B 4RGRA 3L2QA 4KUMA 1TTYA 1ZR2A 3J7ZI 4PJMA 1HXDA 4AU7A 5CKTA 3WTWC 3WG7H 3HRSA 3IC7A 5J8CA 5FLXZ 4FX0A 1HW2A 2FX0A 3KP7A 2EJRA 3ZN0A 1LFUP 2UV1A 3RYPA 2PMUA 3TKYA 1FWZA 1OR7C 4HQMA 3I54A 1H88C 2FBHA 1V5GA 4M6XA 2GA1A 2W7NA 3VYUB 1YIJI 1X1AA 9ANTA 1JXSA 3EUKL 3MD2A 3E5QA 2VL8A 3GWZA 4BEHA 4A3BJ 4R1HA 1XN7A 6PAXA 1ETVA 2LF8A 1UHSA 3JREA 1YOVB 1XPXA 2PMHA 3VYRB 3K9TA 2VOOA 4XR6A 3PIOF 1A04A 2K4JA 2R5ZA 3CTAA 4DYRA 2H1KA 3IP4B 1IF1A 2HXOA 2CUZA 3FBNB 4BHPA 1ZN2A 3WTZA 1SFOJ 1R1VA 1MBHA 3S2HJ 4XICA 1C0WA 4IHVA 1XSDA 5F0FA 5L3FA 5GPAA 5B66C 4L9NA 1LDJA 4M71A 5FROA 3WGHA 1LDKB 1R71A 4IHYA 1QVTA 5CVJA 1RKWA 2L7KA 1S3JA 2ZBKA 4MIMA 2JJ7A 1RESA 4B48A 4CSWA 1IUFA 4ETSA 3V7RA 2YX7A 2OPTA 4A0XA 3RZDJ 4U0VA 1JJ8C 3MWMA 1SC7A 3RKYA 3K70C 2BBYA 2R7SA 4Y17A 3J81K 4XSXF 1VF9A 4B47A 1OCCH 1W7PB 2UZKA 3WE2A 1N78A 2P7CB 1CGPA 3JAMZ 4BQNA 2R5ZB 1BW5A 2MFZA 2QZ8A 2Z99A 3OL3A 3OYFA 3KZZA 5D6FA 3DTKA 2VODA 3QODA 4QPOA 5JVGF 3ZXSA 1HKSA 3W6VA 3QP5A 1WJEA 2CYYA 2XB5A 2JK3A 3CCMI 2JMWA 3NWSA 1IN7A 3WU0A 1PUFA 3CUQA 4C3IJ 4WWCA 4G94A 1OKRA 1A35A 1ETXA 3QRFF 2OU2A 3ONQA 4CCOA 5C44J 4LG3A 1X4PA 1IRXA 4X1EA 2XV4S 3AL0C 1VQ5I 4G12A 2LP0A 2VC1A 4LLGF 4GXOA 4UB8C 1L0OC 3DKXA 1I6HJ 5ILSA 3B02A 2IA1A 2KKOA 3PSFA 4HDVA 3BJ6A 2KL4A 2PEXA 4UVAA 1BC7C 3HYIA 1T08B 4E7HA 2ME6A 3CMAI 5K7HA 2OQGA 2M0MA 2W82A 2WBMA 2M30A 4U7BA 3FXJA 4WXDA 4KYWA 2HYFA 2KPMA 2WV0A 3CC2I 3FK7A 1U3EM 2EV5A 3F21A 3Q5FA 2OF7A 4IX7A 2FOKA 3MAJA 3P9IA 3CUQB 1PUFB 5J1UA 3W3CA 1ULYA 4O3MA 3OYCA 2DOFA 1UCRA 3ASNH 4LK1F 2QQBA 1UG2A 3ZPLA 4XRFA 2ZNYA 4IEJA 3IUOA 4L18B 2XHKA 2PQ8A 4XSZF 5CVIA 2W00A 3ZOBA 2A68F 1Z91A 3CCUI 4QLCU 4C3HJ 2M1BA 2V9VA 1V3FA 1O7FA 5TISC 4RMNA 4ZTJA 2WAEA 2QSHX 4I2OA 1JE8A 1R4MB 3ESWB 2QVOA 4CCMA 4XLAA 4QTRA 2HOSA 3I59A 2Z1DA 2HOTA 5E17F 3V8JA 1SFKA 5A2QZ 1WI3A 1B72A 1MJ9A 1V4RA 3LA2A 3ROUA 2BGCA 3JCUC 4GDFA 1YJWI 5HLTA 4F92B 1P6RA 3K70D 2O8XA 3O6BB 1QNTA 3ML6A 1IXCA 3PSIA 4F91B 2HOEA 3LSKA 1M1EB 2ZCWA 2F5FA 4GO1A 2MBFA 2VJ5A 2MA3A 4OIOF 2ICWG 4U0WA 2HZDA 1MMSA 2GQQA 1XMKA 4JYKA 3DFGA 3V8LA 4FASD 4XN0A 2E35A 1KZHA 3S3NA 1D8JA 2XGXA 3OYJA 3M4OJ 1QZEA 4KT5C 1EA3A 3BG3A 3V8KA 3LQRA 3CZ6A 1Y39A 1VQ9I 1W4MA 3RDIA 2MYSA 1SD4A 2ZJRF 3I59B 3NARA 3WTYC 4ON0A 1XB4A 1BL0A 1JGGA 2HVRA 2L7FP 3A03A 4UVCA 4OU0A 3EYIA 1B72B 5EJCA 1BIAA 2M34A 2MW8A 2V9KA 2D5VA 3CCSI 5LHIA 3CCVI 2XAQA 4HV5A 1SAXA 3C3WA 2GOXB 3CCYA 2FMYA 4IL6C 1WJDA 2HEOA 3PL8A 4RS8A 2R7ZJ 1Z7LA 2E1OA 4RM3A 2C6YA 3D5RC 5F1RA 4EV0A 1TQIA 4HPQA 5E1ZB 1AKHA 3G3ZA 1MBJA 4MHGA 1NG7A 1WJCA 2HR3A 1FY7A 3KCCA 1ZG1A 3J7YJ 2GBYA 1FZPB 3OV8A 1F9NA 2VBWA 2VQCA 1MMNA 3KP4A 1U5TB 2OCEA 4UB6C 1JT0A 4F7ZA 1BI3A 1JI8A 2ETHA 4CZZA 4B4CA 4IPAA 2LBFB 1ZGAA 2GM4A 4II2A 2Q1ZB 2UUZA 5L3BA 4MNUA 1X3UA 5B5EC 4HDUA 2IS2A 2X1EA 1ZHFA 1XS9A 4UY8I 1HSJA 2W25A 4FISA 4CA0A 1H8AC 1J9IA 3BG7A 4BUPA 2IP2A 2DK8A 2ZMEA 4OAYA 1O3TA 4L9TA 3HRUA 3C1DA 2DQLA 1X1DA 2DW4A 3RPQA 3HOWJ 2W84A 4WCGA 3E6MA 2DJNA 4IQ4A 1LFBA 3PUBA 1TWGJ 2LG4A 1ZYRF 3HIFA 3RCOA 3TDZC 2EB7A 1V55H 3W6JB 4ZZDA 4AYBA 3C7JA 1AKHB 3SFIA 4P9FA 3LWFA 1BC8C 3RZOJ 1LJ9A 1FOWA 1FOYA 3CLQA 2V26A 4HX7A 5EF6A 4OMYA 4NNJA 3F8BA 3ZGKA 2NOJB 2OBPA 1ZLJA 2FQ4A 4AWXB 3T0YA 1I6XA 3OS2A 3NAUA 2ELHA 3GCMA 2DDAA 2DK5A 3I4PA 2GIVA 3TP0A 4IRIA 2XUBA 2X51A 1OCZH 2ZMEB 2HYGD 1TW2A 2G7HA 3FMRA 3LSJA 4M74A 3CJNA 2H6BA 2UXXA 3GZ6A 4RAGA 3GXOA 2DN0A 3GTPJ 3G4SI 3BT9A 2Y75A 4FE4A 4KJZA 1H0MA 1F4KA 2E19A 2AXLA 3MFKA 4BJ6C 2VPRA 3KLOA 2CMPA 3U2RA 3GMEA 4G9YA 4C9YA 2V1UA 5IYCJ 4IF4A 4ZDLA 2BY3A 3K1NA 2HVSA 3LSGA 2K02A 4O6JA 4ZH4F 1WH7A 2I8DA 3SXYA 3E97A 3T5XA 1U6GA 1YJNI 2L9RA 1TT5B 3K2AA 3TW6A 3GFMA 3VSLA 5KNLA 4ZYGA 2XGDA 4HSTA 4BE1A 1ONVA 2N8GA 1FNNA 3JRIA 1Y56A 2P5KA 4LOCA 2L4MA 2BY0A 5HDKA 2W48A 4ASNA 3CMYA 2IAIA 2F5DA 4GCVA 4Y15A 2WY7Q 5FLXK 2O9LA 4JK1X 4N9IA 1I50J 1S6LA 4MEYF 1TNTA 4N0BA 3DLLF 4RBOA 1BM9A 2W4SA 1QPIA 2OA4A 1IRGA 1YRNB 2XKOA 4RM2A 4DW6A 1HDPA 3I4MJ 4I09A 4PK4A 1RZ4A 3D5LA 1YJ9I 5LEJA 1WI9A 1TBXA 1MBFA 2PG4A 5CVRA 1Y8RB 4I01A 4DBRA 1FBQA 3LAPA 2WAQN 1LQ1A 2WY8Q 2G9WA 4CCJA 4CO8A 1IXRC 1R7JA 2JVHA 5IT3A 3CJRB 1RNLA 2DCEA 2DMNA 2LLKA 3HSRA 5IYDJ 3JSPA 1GV2A 4C2MJ 5L3DA 1Z05A 3GVAA 2DAOA 3GTJJ 3DCFA 4I98B 2B7EA 3ZMZA 2LRDA 1HW5A 4L0ZB 4IHWA 1IJWC 1MD0A 1UMQA 4NC7A 5DD4A 2RAEA 1TL8A
chains in the Genus database with same CATH topology
3MCZA 2KIMA 2VT2A 1IZ1A 1E2XA 2F5CA 3M1EA 3GFJA 2LF7A 2HS5A 1OYYA 2YU3A 4ZZLA 1Z1DA 3FM3A 1G3WA 4KIGA 4L9VA 5ILVA 4EQQA 3JAMK 3DV8A 4LB5A 4BXUA 1IUYA 3DPLC 5ERIA 3REOA 4YFNF 4EJWA 3V4GA 2MC3A 2YPRA 1SMTA 2KJBA 4ENNA 2K4BA 1H9TA 4M72A 4WXHA 3QPHA 1YW9A 1HSTA 5DUIA 3LSTA 3WGIA 4OIPF 1UB9A 1XCBA 2J5OA 3Q9SA 5K5OA 2EFQA 5LHHA 4A2UA 2DPDA 1SFXA 3TQNA 3HRMA 3GW2A 1G4DA 1ZAOA 1B59A 3J80Z 3MEXA 2P5VA 5D8LB 2A6HF 2PLYA 3DPTA 1KGSA 1YYVA 3EYYA 4P5OA 2K7LA 5DCMA 4IRHA 2Q8KA 3DXJF 2XAFA 3ECOA 3HRTA 3FXQA 1FSHA 1KQ9A 1HBXG 1MJBA 2DU9A 4HV6A 3CDHA 3O3KA 4YIFA 5A2QK 4EGYA 3I58A 2W24A 1ON2A 1U8RA 4KMUX 2FRHA 2F5EA 1XGOA 1SD5A 1FC3A 3FM5A 3I53A 1USTA 4IHSA 4MEXF 1LDDA 4RAZA 3E3VA 3GUDA 1SD6A 2DPUA 1R1UA 5J6XA 1YQAA 3NQOA 4CYDA 4L9JA 2P6TA 1QO0D 2JTVA 1J5YA 5H20A 2IPQX 1JGSA 1O3RA 5FD6A 4Y13A 3ZMTA 3K1PA 3M8FA 2KIFA 1WKMA 4ENKA 2JZYA 5HOOA 2OQRA 2MD5A 1WRJA 3MQ0A 3ERED 1TNSA 4OIRF 1UHMA 3GYHX 5LHGA 4MTDA 1I1SA 2M5WA 1W7PA 4PDKA 5CVVA 5FD5A 2GZWA 3S2WA 3T1BA 1FBSA 1FP2A 4KIBA 2O61A 3BOQA 5F6FA 1LEAA 2F2EA 4GYIA 3R60A 2STWA 2Z5UA 1OYIA 1MKMA 2PJPA 2OZUA 2NS0A 2Z3YA 1IN4A 1FPQA 2XAHA 2W85A 3GFIA 5L3GA 2XAGA 3WTSC 2E7XA 1D5VA 3I71A 1USSA 2CWEA 5LGNA 1J2XA 4BQAA 1LNWA 1KQ0A 4FX4A 1JHFA 2IT0A 3ELKA 4KNYA 3F6VA 3FXRA 4XLPF 2E1CA 2XRNA 3HSFA 5ICFA 5E1XA 2CQKA 2MH2A 4HW0A 1BOAA 1JHHA 4RB2C 3KETA 2E1NA 1QQIA 3C18A 4G6QA 4PGGA 5D5WB 1F5TA 2XIGA 3LA7A 4HAMA 3QU6A 4UXNA 5FB2A 3DKWA 1FOKA 5HDNA 3HTUA 4XBFA 2V79A 1DPRA 4EJUA 2FF4A 1BI0A 3T8TA 4CXFA 4L5IA 4B09A 3DF8A 5HS9A 1D8KA 4QWQA 5D5UB 3HUGA 1KA8A 3ECHA 1IN5A 1WWXA 3P7NA 1ZRDA 1K7AA 1MDMB 4LD5A 1ODDA 1PP8F 1QBJA 3KP5A 2ISYA 1ZLKA 1LEBA 2ZJ2A 1XCVA 3ZMVA 1U2WA 5J8FA 1P4XA 2ZXJA 3K2ZA 4CGZA 4LK0F 5D8KB 4MQVA 4S05A 1O3SA 3VB2A 5BS6A 3ULQB 5FO5A 1U5TA 2BV6A 3F8FA 4U88A 1DP7P 2PFBA 5TRDA 3ZMSA 2V6CA 3I64A 4HLXA 1XMAA 3NEUA 2CO5A 2EA4A 4LFUA 1DPUA 2KRFA 3E6DA 4YG2F 2EV0A 5JR3A 3GX4X 1B9NA 2ACJA 1LB2A 3F6OA 4LLLA 2RGVA 1O3QA 2QYOA 1R23A 1XSVA 4NHJA 3CO7C 2A5YB 2RKHA 2HZTA 3FHZA 3ZP5A 3TO6A 5HS7A 4YFKF 4EM1A 2B0LA 2EFOA 4U0YA 1FSEA 2ESHA 1G6NA 3W6KB 4D0PA 2VXZA 4HQEA 5KK1A 3J80K 5L3EA 2CFXA 4PZJA 1YW7A 1WQ2A 4M9SA 2H94A 3M8EA 2A69F 5BQTA 4ENMA 1TQPA 1SD7A 3U1DA 3LA3A 3BJOA 2L54A 1GXQA 2ZO4A 2NYXA 4EMSA 2M45A 4EGZA 4LGWA 1B6AA 2RNJA 1W5SA 1FX7A 5ICCA 5IT9K 3QP6A 5ICGA 4U7DA 2HDCA 5H6RA 5DEQA 3WU1B 2FNAA 3WTTC 5DD8A 1SFEA 1K78A 4IHTA 4KICA 5KVRA 4TV7A 1XSXA 4BAYA 3M7GA 5AIPA 3OOPA 3FXUA 1MJAA 2FEZA 5JHUA 4M73A 3L7WA 2EV6A 2NAZA 3N97A 1CF7B 2JT1A 4G7ZF 2OAZA 2EFWA 2LNBA 4ESBA 1W5TA 2CW0F 3KP2A 1KYWA 3IL2A 2M87A 1T0FA 4WK8F 1ZREA 4HF0A 1XGMA 1ZRCA 3BPVA 4G6DA 4RB1A 2YX4A 1D3YA 4ZYDA 5D4RA 2UXNA 1K78B 4UVBA 3KZYA 3TDUC 2WWYA 5FGMA 1FLIA 4A5NA 2X0LA 2FA5A 1WSUA 5E18F 3U9GA 4UV8A 3WG9A 2VC0A 3LQQA 5FFXA 2EFNA 3IHUA 1RUOA 4I0BA 2J5PA 3SZPA 1T2KA 3IRQA 3SHFA 5DYMA 2RVCA 1ZG5A 3H3ZA 4FHTA 2IA2A 3KLNA 4K2EA 3VEPA 4CICA 2JRTA 4KDPA 3H3UA 2RC4A 1ON1A 4B8XA 1NHAA 2D1VA 4LG0A 3CUOA 1DDNA 4EVIA 1ZRFA 4A0YA 1J75A 2QLZA 2GWRA 4HLYA 2P7VB 1R36A 1L3LA 3TO7A 3EETA 1B9MA 1RIOH 2YSRA 4RB0A 3TOBA 2DLLA 2IVMA 1Z6RA 5K5RA 1BIBA 5DDGA 1R1TA 4HF1A 3DQVC 2FBKA 3GF2A 4LG0B 2LKPA 1R58A 1KU7A 1T39A 3E6BA 4P9UA 2VBYA 3F3XA 2K27A 4PCQA 2BYVE 3FX3A 4DNCA 3RI4A 2NNNA 5D4SA 2YR2A 2R7DA 1YG2A 1FYKA 4HA8A 3QAHA 4L0YB 3PFIA 2FBIA 1S8NA 4I0AA 4IXAA 3ZN1A 3F22A 4RGXA 5D6EA 3VOEA 1Z6TA 2H09A 5LBQA 2IW5A 4Q4ZF 1U78A 3BZ6A 1TW3A 4IRGA 4YFXF 3MZYA 1QGPA 2DFIA 4P96A 1YO5C 2CGPA 2HQRA 2NRAC 2DO7A 3PQJA 2QM3A 1SFUA 1OMIA 4XLNF 3F23A 2L01A 1B1BA 3V7SA 5BOXA 2VE8A 2VE9A 3KP3A 4EM0B 4M6YA 3CLOA 2OD5A 3L2CA 2ESNA 1IRFA 1IAWA 2H27A 4WXCA 5DCFA 3R4KA 5E1WA 4HOBA 5DUKA 3WTVC 3L9FA 4RGUA 2KJCA 2GAUA 3GZ5A 2GXGA 2JPBA 4JQFA 4UHTA 3ZMDA 5ICEA 3M9AA 2V1DA 3EUHA 3I5UA 4GYGA 2P4WA 1K6OA 1MGTA 3WTUC 2QBYB 2P8TA 2RV8A 3O2PE 4UV9A 3L00A 1R5HA 4FT8A 3G73A 1HQCA 2GA2A 2CG4A 1KU9A 2V1XA 3BWGA 4LJZF 1HW1A 5JFRA 5E8GA 1S29A 1QZZA 1FT9A 1RI7A 1RUNA 4WF2A 3IWFA 4HX4A 3K0LA 4EJOA 1PDNC 2QUFA 3K69A 2ZKZA 3JW4A 4LB6B 1I5ZA 3ABTA 3B73A 1IW7F 3E6CC 4AD9A 2P6SA 5DV5A 2O3FA 1FBUA 3VODA 4NQWA 3GLXA 2L3DA 1EH8A 1P4AA 1BBYA 3CUQC 4CDGA 3RKWA 1LVAA 3J7AO 2XASA 1IN6A 1S7OA 4L5JA 1OPCA 1ZGJA 2Q0OA 1AOYA 3IRRA 2FU4A 4LMYA 4AIHA 1OYWA 3TOAA 4BH9A 5LGUA 2D2WA 2O03A 3Q9VA 4ZYEA 2DI3A 5EEHA 1OR7A 1J0RA 1STZA 3KFWX 3FZVA 3WTXC 1W7PD 2BEOA 1QPMA 3F8NA 3ISPA 4H0EA 4KN7X 2PI0A 2H6CA 2O0YA 2Y48A 5LLQA 3AAFA 3BROA 1KU3A 1R00A 2HKXA 2HQNA 2R7FA 4OINF 5LGTA 2ADUA 2MLGA 2EK5A 2FSWA 3RYRA 1MDMA 3E5XA 3L09A 5H6QA 1FYLA 4Q5SF 1TQMA 1T98A 1P92A 1H9GA 1E17A 4S04A 4JBAA 2RQPA 4A0ZA 2Q2EA 4E70A 2LSOA 4Z2YA 3R61A 1U5TC 3F8MA 2FQ3A 1P4WA 3QU3A 2XKPA 1YS6A 1ZARA 3KEQA 4EM2A 4LLNA 3R0JA 3FMQA 1IN8A 2OZ6A 5HLGA 4A12A 2VN2A 4RAYA 4CHUA 3BDDA 1YIOA 2HTJA 2VT3A 1J7KA 4BHBA 4G8XA 2HTSA 2HFHA 2W57A 2GXBA 4KIFA 2K86A 5ILUA 2DQRA 3HOTA 1BJAA 1DUXC 2EFPA 2E7WA 2XVCA 2VBXA 3HOSA 1B4AA 4BYYA 5JVTA 3WE3A 4KA4A 1YLFA 3ABUA 4DQ2A 2MH9A 2KIUA 5TJJA 1R5GA 2WTEA 5HVQC 3GEZA 1XDSA 4KN4X 1G3YA 4ZYHA 1GHCA 1I27A 4OIQF 2Z9OA 4MQ9F 4KMFA 1K79A 5D5VB 1EH6A 4M9XA 1S7AA 4AIKA 4AIJA 1KU2A 4A6DA 4A6EA 2STTA 3IKTA 2X4HA 4BNCA 3BJAA 2BE5F 5AONA 1BI1A 3R6SA 1CF7A 1I1GA 5AIQA 1UHWA 3JTHA 1XGSA 4HX8A 3KE2A 2VOPA 2CSOA 5HDGA 3LFKA 2D1HA 1YTYA 1KQ8A 3F72A 1EV7A 4WX9A 2G7UA 2NNYA 3F8CA 2EA2A 1GXPA 2PBIA 2VONA 2RN7A 2R3SA 3P9CA 3IWZA 3I0TA 2Y0MA 5BMZA 5LRRA 3COAC 3J81Z 4OMZA 4HBLA 4PGHA 4P55A 3E5UA 1AWCA 4EJVA 4AVPA 1PUEE 2IA0A 3LAJA 3P9KA 5LEKA 2QQ9A 2PN6A 5F64A 2TDXA 5E20A 2JSCA 1ZH5A 4G7OF 2UWMA 4Q47A 2WC2A 3FF5A 2FMLA 3ZMUA 4GGGA 2FE3A 3V7CA 5CLSA 4R8HA 1YFHA 2QWWA 2VBZA 2QQAA 4ENJA 2ZNZA 3KP6A 4UUVA 1Z9CA 3HSEA 1J59A 2HGCA 1BI2A 2LDUA 3CO6C 3RPUA 2A61A 4RB3C 2MLKA 4RGSA 2DTRA 3FWEA 3GO5A 1TLHB 2IRFG 2COMA 1BN5A 5L3CA 5K5QA 1R22A 5CYVA 5BPDA 2JPCA 3N4MA 1HKQA 1KYZA 2A6EF 2DBBA 1Q1HA 2XAJA 2ISZA 4BHCA 4OOIA 4ESJA 2HWVA 2IJLA 5CVUA 1G3SA 5JI6A 5BPIA 4EJTA 4A5MA 2M8EA 1YS7A 1REPC 3QPTA 3IKVA 3BP8A 3HHHA 1O7LA 4O5VA 2L4AA 4HF2A 2HKOA 3WODF 4Q48A 3QOPA 3RIRA 4G7HF 2XROA 5HLHA 4HZFA 3SZTA 3DP7A 3GFLA 3DEUA 3R0AA 3TO9A 1XDUA 4ESFA 1SMYF 1F1ZA 3BY6A 3HTSB 3HHGA 3TGNA 3SFZA 3H92A 3VFZA 1FYMA 4HYEA 4N9HA 1T6SA 1Y0UA 2QBYA 1O57A 2P5LC 2FNPA 3RJPA 2A07F 1ZG3A 3JSOA 1PP7U 1VTNC 1Z7UA 1GVJA 5FFZA 5HLIA 2ZFWA 2RDPA 2Z33A 2D45A 4NB5A 3ZQ7A 2AS5F 4R79A 3EQLF 5HS8A 2DT5A 1XD7A 1FP1D 3SQNA 3KEOA 5CJ9A 3BPXA 5E8IA 5EEGA 1P2FA 3T8RA 1G3TA 4MGRA 1EH7A 3D0SA 4KFCA 5IT9Z 5LRSA 5ED4A 2FXAA 3EDPA 3JTGA 3MZHA 3PQKA 2A3SA 1MZBA 3K1MA 2L02A 4MTEA 1T38A 4I02A 3NRVA 2QENA 3WGGA 1HKTA 3FMSA 4UNOA 4IJAA 4IVNA 1XGNA 5DCMB 4M9ZA 1UFMA 1IXSB 2EWNA 2O6GE 3RKXA 1YW8A 1QZYA 4I7HA 5K1YA 4YIIA 5D5XB 3RTRA 4RGRA 4KUMA 1TTYA 1HXDA 3WTWC 3HRSA 3IC7A 5J8CA 5FLXZ 4FX0A 1HW2A 3KP7A 2EJRA 3ZN0A 3RYPA 2PMUA 3TKYA 1FWZA 4HQMA 3I54A 2FBHA 4M6XA 2GA1A 1JXSA 3E5QA 3GWZA 4R1HA 1XN7A 6PAXA 2LF8A 2PMHA 3K9TA 2VOOA 1A04A 2K4JA 3CTAA 1IF1A 4BHPA 1ZN2A 3WTZA 1R1VA 1C0WA 1XSDA 5L3FA 4L9NA 1LDJA 4M71A 3WGHA 1LDKB 5CVJA 1S3JA 2ZBKA 4ETSA 3V7RA 2YX7A 4A0XA 4U0VA 3MWMA 3RKYA 2BBYA 4Y17A 3J81K 4XSXF 1W7PB 2UZKA 3WE2A 2P7CB 1CGPA 3JAMZ 2QZ8A 2Z99A 3KZZA 5D6FA 2VODA 1HKSA 3QP5A 2CYYA 1IN7A 3WU0A 3CUQA 4WWCA 4G94A 1OKRA 3QRFF 2OU2A 2XV4S 2VC1A 4LLGF 4GXOA 1L0OC 5ILSA 3B02A 2IA1A 2KKOA 4HDVA 3BJ6A 2PEXA 4UVAA 1BC7C 3HYIA 2OQGA 2M30A 4U7BA 4WXDA 4KYWA 2HYFA 2WV0A 1U3EM 2EV5A 3F21A 3Q5FA 2FOKA 3MAJA 3P9IA 3CUQB 1ULYA 4O3MA 1UCRA 4LK1F 2QQBA 3ZPLA 4XRFA 2ZNYA 4L18B 2XHKA 2PQ8A 4XSZF 5CVIA 2A68F 1Z91A 4QLCU 2M1BA 2V9VA 1V3FA 1O7FA 4I2OA 1JE8A 2QVOA 3I59A 5E17F 3V8JA 5A2QZ 1MJ9A 1V4RA 3LA2A 3ROUA 2BGCA 1P6RA 2O8XA 3O6BB 1QNTA 3ML6A 1IXCA 2HOEA 2ZCWA 2F5FA 4GO1A 2MBFA 2MA3A 4OIOF 4U0WA 2GQQA 1XMKA 3DFGA 3V8LA 1D8JA 2XGXA 4KT5C 3V8KA 3LQRA 1W4MA 3RDIA 1SD4A 3I59B 3WTYC 4ON0A 1XB4A 4UVCA 4OU0A 3EYIA 1BIAA 5LHIA 2XAQA 4HV5A 1SAXA 3C3WA 2FMYA 2HEOA 4RS8A 2C6YA 5F1RA 4EV0A 1TQIA 5E1ZB 3G3ZA 4MHGA 2HR3A 1FY7A 3KCCA 1ZG1A 1FZPB 3OV8A 1F9NA 2VBWA 3KP4A 1U5TB 4F7ZA 1BI3A 2ETHA 4CZZA 4IPAA 1ZGAA 5L3BA 4MNUA 1X3UA 4HDUA 1ZHFA 1HSJA 2W25A 1J9IA 2IP2A 2DK8A 2ZMEA 1O3TA 4L9TA 3HRUA 3C1DA 2DQLA 2DW4A 3RPQA 2W84A 4WCGA 3E6MA 1ZYRF 3HIFA 3TDZC 2EB7A 3W6JB 4ZZDA 3C7JA 4P9FA 3LWFA 1BC8C 1LJ9A 4HX7A 4OMYA 3F8BA 2OBPA 1ZLJA 4AWXB 3T0YA 1I6XA 2ELHA 2DK5A 3I4PA 2GIVA 4IRIA 2XUBA 2ZMEB 2HYGD 1TW2A 2G7HA 3FMRA 4M74A 3CJNA 2H6BA 2UXXA 3GZ6A 3GXOA 1F4KA 2Y75A 1H0MA 2AXLA 3MFKA 3KLOA 3U2RA 2V1UA 4G9YA 4IF4A 3K1NA 2K02A 4O6JA 4ZH4F 3SXYA 3E97A 3T5XA 1U6GA 3GFMA 4ZYGA 1ONVA 1FNNA 2P5KA 2L4MA 5HDKA 4ASNA 2F5DA 4GCVA 4Y15A 5FLXK 4JK1X 4N9IA 1S6LA 4MEYF 1TNTA 4N0BA 1BM9A 2OA4A 1IRGA 2XKOA 4I09A 1RZ4A 3D5LA 5LEJA 1WI9A 1TBXA 2PG4A 3LAPA 5CVRA 4I01A 1LQ1A 1FBQA 2G9WA 4CO8A 1IXRC 1R7JA 5IT3A 1RNLA 3HSRA 3JSPA 5L3DA 1Z05A 3GVAA 2DAOA 4I98B 3ZMZA 1HW5A 4L0ZB 1MD0A 5DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCZ A;  2KIM A;  2VT2 A;  1IZ1 A;  1E2X A;  2F5C A;  3M1E A;  3GFJ A;  2LF7 A;  2HS5 A;  1OYY A;  2YU3 A;  4ZZL A;  1Z1D A;  3FM3 A;  1G3W A;  4KIG A;  4L9V A;  5ILV A;  4EQQ A;  3JAM K;  3DV8 A;  4LB5 A;  4BXU A;  1IUY A;  3DPL C;  5ERI A;  3REO A;  4YFN F;  4EJW A;  3V4G A;  2MC3 A;  2YPR A;  1SMT A;  2KJB A;  4ENN A;  2K4B A;  1H9T A;  4M72 A;  4WXH A;  3QPH A;  1YW9 A;  1HST A;  5DUI A;  3LST A;  3WGI A;  4OIP F;  1UB9 A;  1XCB A;  2J5O A;  3Q9S A;  5K5O A;  2EFQ A;  5LHH A;  4A2U A;  2DPD A;  1SFX A;  3TQN A;  3HRM A;  3GW2 A;  1G4D A;  1ZAO A;  1B59 A;  3J80 Z;  3MEX A;  2P5V A;  5D8L B;  2A6H F;  2PLY A;  3DPT A;  1KGS A;  1YYV A;  3EYY A;  4P5O A;  2K7L A;  5DCM A;  4IRH A;  2Q8K A;  3DXJ F;  2XAF A;  3ECO A;  3HRT A;  3FXQ A;  1FSH A;  1KQ9 A;  1HBX G;  1MJB A;  2DU9 A;  4HV6 A;  3CDH A;  3O3K A;  4YIF A;  5A2Q K;  4EGY A;  3I58 A;  2W24 A;  1ON2 A;  1U8R A;  4KMU X;  2FRH A;  2F5E A;  1XGO A;  1SD5 A;  1FC3 A;  3FM5 A;  3I53 A;  1UST A;  4IHS A;  4MEX F;  1LDD A;  4RAZ A;  3E3V A;  3GUD A;  1SD6 A;  2DPU A;  1R1U A;  5J6X A;  1YQA A;  3NQO A;  4CYD A;  4L9J A;  2P6T A;  1QO0 D;  2JTV A;  1J5Y A;  5H20 A;  2IPQ X;  1JGS A;  1O3R A;  5FD6 A;  4Y13 A;  3ZMT A;  3K1P A;  3M8F A;  2KIF A;  1WKM A;  4ENK A;  2JZY A;  5HOO A;  2OQR A;  2MD5 A;  1WRJ A;  3MQ0 A;  3ERE D;  1TNS A;  4OIR F;  1UHM A;  3GYH X;  5LHG A;  4MTD A;  1I1S A;  2M5W A;  1W7P A;  4PDK A;  5CVV A;  5FD5 A;  2GZW A;  3S2W A;  3T1B A;  1FBS A;  1FP2 A;  4KIB A;  2O61 A;  3BOQ A;  5F6F A;  1LEA A;  2F2E A;  4GYI A;  3R60 A;  2STW A;  2Z5U A;  1OYI A;  1MKM A;  2PJP A;  2OZU A;  2NS0 A;  2Z3Y A;  1IN4 A;  1FPQ A;  2XAH A;  2W85 A;  3GFI A;  5L3G A;  2XAG A;  3WTS C;  2E7X A;  1D5V A;  3I71 A;  1USS A;  2CWE A;  5LGN A;  1J2X A;  4BQA A;  1LNW A;  1KQ0 A;  4FX4 A;  1JHF A;  2IT0 A;  3ELK A;  4KNY A;  3F6V A;  3FXR A;  4XLP F;  2E1C A;  2XRN A;  3HSF A;  5ICF A;  5E1X A;  2CQK A;  2MH2 A;  4HW0 A;  1BOA A;  1JHH A;  4RB2 C;  3KET A;  2E1N A;  1QQI A;  3C18 A;  4G6Q A;  4PGG A;  5D5W B;  1F5T A;  2XIG A;  3LA7 A;  4HAM A;  3QU6 A;  4UXN A;  5FB2 A;  3DKW A;  1FOK A;  5HDN A;  3HTU A;  4XBF A;  2V79 A;  1DPR A;  4EJU A;  2FF4 A;  1BI0 A;  3T8T A;  4CXF A;  4L5I A;  4B09 A;  3DF8 A;  5HS9 A;  1D8K A;  4QWQ A;  5D5U B;  3HUG A;  1KA8 A;  3ECH A;  1IN5 A;  1WWX A;  3P7N A;  1ZRD A;  1K7A A;  1MDM B;  4LD5 A;  1ODD A;  1PP8 F;  1QBJ A;  3KP5 A;  2ISY A;  1ZLK A;  1LEB A;  2ZJ2 A;  1XCV A;  3ZMV A;  1U2W A;  5J8F A;  1P4X A;  2ZXJ A;  3K2Z A;  4CGZ A;  4LK0 F;  5D8K B;  4MQV A;  4S05 A;  1O3S A;  3VB2 A;  5BS6 A;  3ULQ B;  5FO5 A;  1U5T A;  2BV6 A;  3F8F A;  4U88 A;  1DP7 P;  2PFB A;  5TRD A;  3ZMS A;  2V6C A;  3I64 A;  4HLX A;  1XMA A;  3NEU A;  2CO5 A;  2EA4 A;  4LFU A;  1DPU A;  2KRF A;  3E6D A;  4YG2 F;  2EV0 A;  5JR3 A;  3GX4 X;  1B9N A;  2ACJ A;  1LB2 A;  3F6O A;  4LLL A;  2RGV A;  1O3Q A;  2QYO A;  1R23 A;  1XSV A;  4NHJ A;  3CO7 C;  2A5Y B;  2RKH A;  2HZT A;  3FHZ A;  3ZP5 A;  3TO6 A;  5HS7 A;  4YFK F;  4EM1 A;  2B0L A;  2EFO A;  4U0Y A;  1FSE A;  2ESH A;  1G6N A;  3W6K B;  4D0P A;  2VXZ A;  4HQE A;  5KK1 A;  3J80 K;  5L3E A;  2CFX A;  4PZJ A;  1YW7 A;  1WQ2 A;  4M9S A;  2H94 A;  3M8E A;  2A69 F;  5BQT A;  4ENM A;  1TQP A;  1SD7 A;  3U1D A;  3LA3 A;  3BJO A;  2L54 A;  1GXQ A;  2ZO4 A;  2NYX A;  4EMS A;  2M45 A;  4EGZ A;  4LGW A;  1B6A A;  2RNJ A;  1W5S A;  1FX7 A;  5ICC A;  5IT9 K;  3QP6 A;  5ICG A;  4U7D A;  2HDC A;  5H6R A;  5DEQ A;  3WU1 B;  2FNA A;  3WTT C;  5DD8 A;  1SFE A;  1K78 A;  4IHT A;  4KIC A;  5KVR A;  4TV7 A;  1XSX A;  4BAY A;  3M7G A;  5AIP A;  3OOP A;  3FXU A;  1MJA A;  2FEZ A;  5JHU A;  4M73 A;  3L7W A;  2EV6 A;  2NAZ A;  3N97 A;  1CF7 B;  2JT1 A;  4G7Z F;  2OAZ A;  2EFW A;  2LNB A;  4ESB A;  1W5T A;  2CW0 F;  3KP2 A;  1KYW A;  3IL2 A;  2M87 A;  1T0F A;  4WK8 F;  1ZRE A;  4HF0 A;  1XGM A;  1ZRC A;  3BPV A;  4G6D A;  4RB1 A;  2YX4 A;  1D3Y A;  4ZYD A;  5D4R A;  2UXN A;  1K78 B;  4UVB A;  3KZY A;  3TDU C;  2WWY A;  5FGM A;  1FLI A;  4A5N A;  2X0L A;  2FA5 A;  1WSU A;  5E18 F;  3U9G A;  4UV8 A;  3WG9 A;  2VC0 A;  3LQQ A;  5FFX A;  2EFN A;  3IHU A;  1RUO A;  4I0B A;  2J5P A;  3SZP A;  1T2K A;  3IRQ A;  3SHF A;  5DYM A;  2RVC A;  1ZG5 A;  3H3Z A;  4FHT A;  2IA2 A;  3KLN A;  4K2E A;  3VEP A;  4CIC A;  2JRT A;  4KDP A;  3H3U A;  2RC4 A;  1ON1 A;  4B8X A;  1NHA A;  2D1V A;  4LG0 A;  3CUO A;  1DDN A;  4EVI A;  1ZRF A;  4A0Y A;  1J75 A;  2QLZ A;  2GWR A;  4HLY A;  2P7V B;  1R36 A;  1L3L A;  3TO7 A;  3EET A;  1B9M A;  1RIO H;  2YSR A;  4RB0 A;  3TOB A;  2DLL A;  2IVM A;  1Z6R A;  5K5R A;  1BIB A;  5DDG A;  1R1T A;  4HF1 A;  3DQV C;  2FBK A;  3GF2 A;  4LG0 B;  2LKP A;  1R58 A;  1KU7 A;  1T39 A;  3E6B A;  4P9U A;  2VBY A;  3F3X A;  2K27 A;  4PCQ A;  2BYV E;  3FX3 A;  4DNC A;  3RI4 A;  2NNN A;  5D4S A;  2YR2 A;  2R7D A;  1YG2 A;  1FYK A;  4HA8 A;  3QAH A;  4L0Y B;  3PFI A;  2FBI A;  1S8N A;  4I0A A;  4IXA A;  3ZN1 A;  3F22 A;  4RGX A;  5D6E A;  3VOE A;  1Z6T A;  2H09 A;  5LBQ A;  2IW5 A;  4Q4Z F;  1U78 A;  3BZ6 A;  1TW3 A;  4IRG A;  4YFX F;  3MZY A;  1QGP A;  2DFI A;  4P96 A;  1YO5 C;  2CGP A;  2HQR A;  2NRA C;  2DO7 A;  3PQJ A;  2QM3 A;  1SFU A;  1OMI A;  4XLN F;  3F23 A;  2L01 A;  1B1B A;  3V7S A;  5BOX A;  2VE8 A;  2VE9 A;  3KP3 A;  4EM0 B;  4M6Y A;  3CLO A;  2OD5 A;  3L2C A;  2ESN A;  1IRF A;  1IAW A;  2H27 A;  4WXC A;  5DCF A;  3R4K A;  5E1W A;  4HOB A;  5DUK A;  3WTV C;  3L9F A;  4RGU A;  2KJC A;  2GAU A;  3GZ5 A;  2GXG A;  2JPB A;  4JQF A;  4UHT A;  3ZMD A;  5ICE A;  3M9A A;  2V1D A;  3EUH A;  3I5U A;  4GYG A;  2P4W A;  1K6O A;  1MGT A;  3WTU C;  2QBY B;  2P8T A;  2RV8 A;  3O2P E;  4UV9 A;  3L00 A;  1R5H A;  4FT8 A;  3G73 A;  1HQC A;  2GA2 A;  2CG4 A;  1KU9 A;  2V1X A;  3BWG A;  4LJZ F;  1HW1 A;  5JFR A;  5E8G A;  1S29 A;  1QZZ A;  1FT9 A;  1RI7 A;  1RUN A;  4WF2 A;  3IWF A;  4HX4 A;  3K0L A;  4EJO A;  1PDN C;  2QUF A;  3K69 A;  2ZKZ A;  3JW4 A;  4LB6 B;  1I5Z A;  3ABT A;  3B73 A;  1IW7 F;  3E6C C;  4AD9 A;  2P6S A;  5DV5 A;  2O3F A;  1FBU A;  3VOD A;  4NQW A;  3GLX A;  2L3D A;  1EH8 A;  1P4A A;  1BBY A;  3CUQ C;  4CDG A;  3RKW A;  1LVA A;  3J7A O;  2XAS A;  1IN6 A;  1S7O A;  4L5J A;  1OPC A;  1ZGJ A;  2Q0O A;  1AOY A;  3IRR A;  2FU4 A;  4LMY A;  4AIH A;  1OYW A;  3TOA A;  4BH9 A;  5LGU A;  2D2W A;  2O03 A;  3Q9V A;  4ZYE A;  2DI3 A;  5EEH A;  1OR7 A;  1J0R A;  1STZ A;  3KFW X;  3FZV A;  3WTX C;  1W7P D;  2BEO A;  1QPM A;  3F8N A;  3ISP A;  4H0E A;  4KN7 X;  2PI0 A;  2H6C A;  2O0Y A;  2Y48 A;  5LLQ A;  3AAF A;  3BRO A;  1KU3 A;  1R00 A;  2HKX A;  2HQN A;  2R7F A;  4OIN F;  5LGT A;  2ADU A;  2MLG A;  2EK5 A;  2FSW A;  3RYR A;  1MDM A;  3E5X A;  3L09 A;  5H6Q A;  1FYL A;  4Q5S F;  1TQM A;  1T98 A;  1P92 A;  1H9G A;  1E17 A;  4S04 A;  4JBA A;  2RQP A;  4A0Z A;  2Q2E A;  4E70 A;  2LSO A;  4Z2Y A;  3R61 A;  1U5T C;  3F8M A;  2FQ3 A;  1P4W A;  3QU3 A;  2XKP A;  1YS6 A;  1ZAR A;  3KEQ A;  4EM2 A;  4LLN A;  3R0J A;  3FMQ A;  1IN8 A;  2OZ6 A;  5HLG A;  4A12 A;  2VN2 A;  4RAY A;  4CHU A;  3BDD A;  1YIO A;  2HTJ A;  2VT3 A;  1J7K A;  4BHB A;  4G8X A;  2HTS A;  2HFH A;  2W57 A;  2GXB A;  4KIF A;  2K86 A;  5ILU A;  2DQR A;  3HOT A;  1BJA A;  1DUX C;  2EFP A;  2E7W A;  2XVC A;  2VBX A;  3HOS A;  1B4A A;  4BYY A;  5JVT A;  3WE3 A;  4KA4 A;  1YLF A;  3ABU A;  4DQ2 A;  2MH9 A;  2KIU A;  5TJJ A;  1R5G A;  2WTE A;  5HVQ C;  3GEZ A;  1XDS A;  4KN4 X;  1G3Y A;  4ZYH A;  1GHC A;  1I27 A;  4OIQ F;  2Z9O A;  4MQ9 F;  4KMF A;  1K79 A;  5D5V B;  1EH6 A;  4M9X A;  1S7A A;  4AIK A;  4AIJ A;  1KU2 A;  4A6D A;  4A6E A;  2STT A;  3IKT A;  2X4H A;  4BNC A;  3BJA A;  2BE5 F;  5AON A;  1BI1 A;  3R6S A;  1CF7 A;  1I1G A;  5AIQ A;  1UHW A;  3JTH A;  1XGS A;  4HX8 A;  3KE2 A;  2VOP A;  2CSO A;  5HDG A;  3LFK A;  2D1H A;  1YTY A;  1KQ8 A;  3F72 A;  1EV7 A;  4WX9 A;  2G7U A;  2NNY A;  3F8C A;  2EA2 A;  1GXP A;  2PBI A;  2VON A;  2RN7 A;  2R3S A;  3P9C A;  3IWZ A;  3I0T A;  2Y0M A;  5BMZ A;  5LRR A;  3COA C;  3J81 Z;  4OMZ A;  4HBL A;  4PGH A;  4P55 A;  3E5U A;  1AWC A;  4EJV A;  4AVP A;  1PUE E;  2IA0 A;  3LAJ A;  3P9K A;  5LEK A;  2QQ9 A;  2PN6 A;  5F64 A;  2TDX A;  5E20 A;  2JSC A;  1ZH5 A;  4G7O F;  2UWM A;  4Q47 A;  2WC2 A;  3FF5 A;  2FML A;  3ZMU A;  4GGG A;  2FE3 A;  3V7C A;  5CLS A;  4R8H A;  1YFH A;  2QWW A;  2VBZ A;  2QQA A;  4ENJ A;  2ZNZ A;  3KP6 A;  4UUV A;  1Z9C A;  3HSE A;  1J59 A;  2HGC A;  1BI2 A;  2LDU A;  3CO6 C;  3RPU A;  2A61 A;  4RB3 C;  2MLK A;  4RGS A;  2DTR A;  3FWE A;  3GO5 A;  1TLH B;  2IRF G;  2COM A;  1BN5 A;  5L3C A;  5K5Q A;  1R22 A;  5CYV A;  5BPD A;  2JPC A;  3N4M A;  1HKQ A;  1KYZ A;  2A6E F;  2DBB A;  1Q1H A;  2XAJ A;  2ISZ A;  4BHC A;  4OOI A;  4ESJ A;  2HWV A;  2IJL A;  5CVU A;  1G3S A;  5JI6 A;  5BPI A;  4EJT A;  4A5M A;  2M8E A;  1YS7 A;  1REP C;  3QPT A;  3IKV A;  3BP8 A;  3HHH A;  1O7L A;  4O5V A;  2L4A A;  4HF2 A;  2HKO A;  3WOD F;  4Q48 A;  3QOP A;  3RIR A;  4G7H F;  2XRO A;  5HLH A;  4HZF A;  3SZT A;  3DP7 A;  3GFL A;  3DEU A;  3R0A A;  3TO9 A;  1XDU A;  4ESF A;  1SMY F;  1F1Z A;  3BY6 A;  3HTS B;  3HHG A;  3TGN A;  3SFZ A;  3H92 A;  3VFZ A;  1FYM A;  4HYE A;  4N9H A;  1T6S A;  1Y0U A;  2QBY A;  1O57 A;  2P5L C;  2FNP A;  3RJP A;  2A07 F;  1ZG3 A;  3JSO A;  1PP7 U;  1VTN C;  1Z7U A;  1GVJ A;  5FFZ A;  5HLI A;  2ZFW A;  2RDP A;  2Z33 A;  2D45 A;  4NB5 A;  3ZQ7 A;  2AS5 F;  4R79 A;  3EQL F;  5HS8 A;  2DT5 A;  1XD7 A;  1FP1 D;  3SQN A;  3KEO A;  5CJ9 A;  3BPX A;  5E8I A;  5EEG A;  1P2F A;  3T8R A;  1G3T A;  4MGR A;  1EH7 A;  3D0S A;  4KFC A;  5IT9 Z;  5LRS A;  5ED4 A;  2FXA A;  3EDP A;  3JTG A;  3MZH A;  3PQK A;  2A3S A;  1MZB A;  3K1M A;  2L02 A;  4MTE A;  1T38 A;  4I02 A;  3NRV A;  2QEN A;  3WGG A;  1HKT A;  3FMS A;  4UNO A;  4IJA A;  4IVN A;  1XGN A;  5DCM B;  4M9Z A;  1UFM A;  1IXS B;  2EWN A;  2O6G E;  3RKX A;  1YW8 A;  1QZY A;  4I7H A;  5K1Y A;  4YII A;  5D5X B;  3RTR A;  4RGR A;  4KUM A;  1TTY A;  1HXD A;  3WTW C;  3HRS A;  3IC7 A;  5J8C A;  5FLX Z;  4FX0 A;  1HW2 A;  3KP7 A;  2EJR A;  3ZN0 A;  3RYP A;  2PMU A;  3TKY A;  1FWZ A;  4HQM A;  3I54 A;  2FBH A;  4M6X A;  2GA1 A;  1JXS A;  3E5Q A;  3GWZ A;  4R1H A;  1XN7 A;  6PAX A;  2LF8 A;  2PMH A;  3K9T A;  2VOO A;  1A04 A;  2K4J A;  3CTA A;  1IF1 A;  4BHP A;  1ZN2 A;  3WTZ A;  1R1V A;  1C0W A;  1XSD A;  5L3F A;  4L9N A;  1LDJ A;  4M71 A;  3WGH A;  1LDK B;  5CVJ A;  1S3J A;  2ZBK A;  4ETS A;  3V7R A;  2YX7 A;  4A0X A;  4U0V A;  3MWM A;  3RKY A;  2BBY A;  4Y17 A;  3J81 K;  4XSX F;  1W7P B;  2UZK A;  3WE2 A;  2P7C B;  1CGP A;  3JAM Z;  2QZ8 A;  2Z99 A;  3KZZ A;  5D6F A;  2VOD A;  1HKS A;  3QP5 A;  2CYY A;  1IN7 A;  3WU0 A;  3CUQ A;  4WWC A;  4G94 A;  1OKR A;  3QRF F;  2OU2 A;  2XV4 S;  2VC1 A;  4LLG F;  4GXO A;  1L0O C;  5ILS A;  3B02 A;  2IA1 A;  2KKO A;  4HDV A;  3BJ6 A;  2PEX A;  4UVA A;  1BC7 C;  3HYI A;  2OQG A;  2M30 A;  4U7B A;  4WXD A;  4KYW A;  2HYF A;  2WV0 A;  1U3E M;  2EV5 A;  3F21 A;  3Q5F A;  2FOK A;  3MAJ A;  3P9I A;  3CUQ B;  1ULY A;  4O3M A;  1UCR A;  4LK1 F;  2QQB A;  3ZPL A;  4XRF A;  2ZNY A;  4L18 B;  2XHK A;  2PQ8 A;  4XSZ F;  5CVI A;  2A68 F;  1Z91 A;  4QLC U;  2M1B A;  2V9V A;  1V3F A;  1O7F A;  4I2O A;  1JE8 A;  2QVO A;  3I59 A;  5E17 F;  3V8J A;  5A2Q Z;  1MJ9 A;  1V4R A;  3LA2 A;  3ROU A;  2BGC A;  1P6R A;  2O8X A;  3O6B B;  1QNT A;  3ML6 A;  1IXC A;  2HOE A;  2ZCW A;  2F5F A;  4GO1 A;  2MBF A;  2MA3 A;  4OIO F;  4U0W A;  2GQQ A;  1XMK A;  3DFG A;  3V8L A;  1D8J A;  2XGX A;  4KT5 C;  3V8K A;  3LQR A;  1W4M A;  3RDI A;  1SD4 A;  3I59 B;  3WTY C;  4ON0 A;  1XB4 A;  4UVC A;  4OU0 A;  3EYI A;  1BIA A;  5LHI A;  2XAQ A;  4HV5 A;  1SAX A;  3C3W A;  2FMY A;  2HEO A;  4RS8 A;  2C6Y A;  5F1R A;  4EV0 A;  1TQI A;  5E1Z B;  3G3Z A;  4MHG A;  2HR3 A;  1FY7 A;  3KCC A;  1ZG1 A;  1FZP B;  3OV8 A;  1F9N A;  2VBW A;  3KP4 A;  1U5T B;  4F7Z A;  1BI3 A;  2ETH A;  4CZZ A;  4IPA A;  1ZGA A;  5L3B A;  4MNU A;  1X3U A;  4HDU A;  1ZHF A;  1HSJ A;  2W25 A;  1J9I A;  2IP2 A;  2DK8 A;  2ZME A;  1O3T A;  4L9T A;  3HRU A;  3C1D A;  2DQL A;  2DW4 A;  3RPQ A;  2W84 A;  4WCG A;  3E6M A;  1ZYR F;  3HIF A;  3TDZ C;  2EB7 A;  3W6J B;  4ZZD A;  3C7J A;  4P9F A;  3LWF A;  1BC8 C;  1LJ9 A;  4HX7 A;  4OMY A;  3F8B A;  2OBP A;  1ZLJ A;  4AWX B;  3T0Y A;  1I6X A;  2ELH A;  2DK5 A;  3I4P A;  2GIV A;  4IRI A;  2XUB A;  2ZME B;  2HYG D;  1TW2 A;  2G7H A;  3FMR A;  4M74 A;  3CJN A;  2H6B A;  2UXX A;  3GZ6 A;  3GXO A;  1F4K A;  2Y75 A;  1H0M A;  2AXL A;  3MFK A;  3KLO A;  3U2R A;  2V1U A;  4G9Y A;  4IF4 A;  3K1N A;  2K02 A;  4O6J A;  4ZH4 F;  3SXY A;  3E97 A;  3T5X A;  1U6G A;  3GFM A;  4ZYG A;  1ONV A;  1FNN A;  2P5K A;  2L4M A;  5HDK A;  4ASN A;  2F5D A;  4GCV A;  4Y15 A;  5FLX K;  4JK1 X;  4N9I A;  1S6L A;  4MEY F;  1TNT A;  4N0B A;  1BM9 A;  2OA4 A;  1IRG A;  2XKO A;  4I09 A;  1RZ4 A;  3D5L A;  5LEJ A;  1WI9 A;  1TBX A;  2PG4 A;  3LAP A;  5CVR A;  4I01 A;  1LQ1 A;  1FBQ A;  2G9W A;  4CO8 A;  1IXR C;  1R7J A;  5IT3 A;  1RNL A;  3HSR A;  3JSP A;  5L3D A;  1Z05 A;  3GVA A;  2DAO A;  4I98 B;  3ZMZ A;  1HW5 A;  4L0Z B;  1MD0 A;  5DD4 A; 
#chains in the Genus database with same CATH topology
 3MCZ A;  2KIM A;  4IOA F;  1X2M A;  4CH7 A;  1V5F A;  2M7A A;  2NVT J;  2VT2 A;  2QKM B;  5EGO A;  3HB9 A;  1ERD A;  4BJ5 C;  1IZ1 A;  1R4N B;  3ABM H;  4BE0 A;  1E2X A;  2F5V A;  2F5C A;  3BZC A;  3M1E A;  3GFJ A;  3S17 J;  3K4N A;  2LVS A;  2LF7 A;  2HS5 A;  3KZI C;  1OYY A;  1HC8 A;  1VQP I;  2X1D A;  4M3F A;  2YU3 A;  4BY1 J;  4ZZL A;  1Z1D A;  5B3S H;  3FM3 A;  1G3W A;  3TED A;  4IO9 F;  4KIG A;  2CW8 A;  4L9V A;  5ILV A;  3RQI A;  4E7L A;  2MD0 A;  4EQQ A;  2KQR A;  3JAM K;  3DV8 A;  2ELJ A;  4LB5 A;  4IZZ A;  4BXU A;  3QWL A;  3CF5 F;  3ZQF A;  2LKS A;  1IUY A;  3DPL C;  2HI3 A;  3TL4 X;  5ERI A;  3REO A;  4YFN F;  4EJW A;  3V4G A;  2MC3 A;  3TBI A;  1POG A;  1SMT A;  2YPR A;  2XC7 A;  2KJB A;  4ENN A;  2K3F A;  3GTO J;  5J3L A;  2X48 A;  5EZH A;  3CCR I;  3GTQ J;  5FLM J;  2K4B A;  3MKW B;  5EGO B;  3EUH C;  1H9T A;  1Q1V A;  4M72 A;  4WXH A;  2YU9 J;  5E3O A;  2F4O B;  3QPH A;  1YW9 A;  3CF2 A;  1I3A A;  4LIV A;  1O4X A;  3S32 A;  1HST A;  2DTZ A;  1VQ8 I;  5DUI A;  3OYB A;  3LST A;  1LVK A;  4BS9 A;  3CJT B;  3WGI A;  3M3Y J;  5CQE A;  4OIP F;  1UB9 A;  1XCB A;  4ITV A;  2J5O A;  1BR4 A;  3Q9S A;  1QVU A;  5F0C A;  2EFQ A;  5K5O A;  1SEU A;  2R7T A;  5LHH A;  4A2U A;  2DPD A;  1SFX A;  2O5R A;  1UAA A;  5H2F C;  2R7O A;  3TQN A;  1IG7 A;  3FDY A;  3HRM A;  3S93 A;  2TRT A;  3GW2 A;  1G4D A;  3ZQC A;  1Z3X A;  1B59 A;  1ZAO A;  3MEX A;  3X2Q H;  3J80 Z;  4A69 C;  2P5V A;  3BTI A;  5D8L B;  2A6H F;  3H5N A;  1LE8 A;  2LFB A;  2PLY A;  3DPT A;  4FCY A;  1KGS A;  2KLO A;  1YYV A;  3OIO A;  1F43 A;  3EYY A;  4P5O A;  2K7L A;  1S9H A;  5DCM A;  2M8G X;  5FKM A;  2DFE A;  3FHN A;  4IRH A;  2Q8K A;  3DXJ F;  2XAF A;  3WU2 C;  3S2D J;  2ELK A;  2DA6 A;  3ECO A;  3HRT A;  2HPM A;  3FXQ A;  2RRE A;  1FSH A;  1KQ9 A;  3MN2 A;  1HBX G;  1MJB A;  4E4H A;  2DU9 A;  2CJJ A;  4HV6 A;  3DTE A;  3K6G A;  3CDH A;  1BR2 A;  3O3K A;  4YIF A;  5A2Q K;  2QKL B;  5GAE J;  4EGY A;  3I58 A;  4QIW N;  4A3J J;  5HNF A;  3S14 J;  5C4X J;  3QYE A;  2W24 A;  1ON2 A;  1U8R A;  1SVO A;  4KMU X;  2FRH A;  2F5E A;  1XGO A;  4V2G A;  1LE8 B;  3K4M A;  1SD5 A;  1WJA A;  1N25 A;  1XMX A;  1FC3 A;  2CH0 A;  3FM5 A;  4XM3 A;  3I53 A;  1HDD C;  3PM1 A;  1E3P A;  1UST A;  3S3M A;  4IHS A;  4MEX F;  1LDD A;  4RAZ A;  3E3V A;  3BR2 A;  5IPA A;  3BR6 A;  3GUD A;  3E1S A;  1SD6 A;  4NC6 A;  2DPU A;  4EAT A;  1T8I A;  1X1B A;  1R1U A;  5J6X A;  1YQA A;  1HLV A;  3NQO A;  2OC6 A;  1VZ0 A;  4CYD A;  3DEW A;  2XF5 A;  4L9J A;  2XSD C;  2CV2 A;  5FJ8 J;  3S1Q J;  3VYT B;  2P6T A;  3JRD A;  1QO0 D;  1T95 A;  3ZQQ A;  2JTV A;  3K4C A;  1J5Y A;  4MFD A;  3CC4 I;  1OCR H;  5H20 A;  1YIT I;  2IPQ X;  1JGS A;  1XC5 A;  2IXS A;  1O3R A;  5FD6 A;  4Y13 A;  4DOZ A;  3ZMT A;  5F1J A;  3DKY A;  4PJL A;  3K1P A;  3M8F A;  2KIF A;  3PO3 J;  2WA0 A;  1WKM A;  4ENK A;  1YE9 A;  2JZY A;  5HOO A;  2OQR A;  2MD5 A;  1WRJ A;  2PX9 A;  2Y9Y A;  2EBI A;  2L0K A;  2DYS H;  4A3E J;  2CQ7 A;  1Y1W J;  4NDL A;  3MQ0 A;  3ERE D;  1TNS A;  4OIR F;  1UHM A;  3AG1 H;  3C2G A;  3GYH X;  3E0J B;  5LHG A;  5DM7 F;  3QOE A;  4MTD A;  1I1S A;  1R9T J;  3OYD A;  1JKO C;  2M5W A;  2MSY A;  3LMM A;  1W7P A;  3G6E I;  4PDK A;  5CVV A;  5FD5 A;  2X6Y A;  1AU7 A;  2GZW A;  3S2W A;  2EIK H;  3HOV J;  3T1B A;  1W5C C;  2X6O A;  1FBS A;  1FP2 A;  4KIB A;  2O61 A;  1R6R A;  3BOQ A;  4XON A;  5EZG A;  3JRH A;  5F6F A;  1LEA A;  3OSG A;  3QYB A;  2H8R A;  3HM5 A;  2L7Z A;  4GFB A;  2F2E A;  4GYI A;  3HPH A;  3R60 A;  2STW A;  2LYC A;  4U87 A;  2W1O A;  2Z5U A;  1OYI A;  1EKE A;  4KT6 A;  2DA1 A;  2OTJ I;  1MKM A;  4XL9 A;  2PJP A;  2OZU A;  3OYI A;  2NS0 A;  1Z67 A;  4BXX J;  4PJ0 C;  4EEF G;  2Z3Y A;  1MBE A;  1IN4 A;  1FPQ A;  4ABZ A;  2XAH A;  2K9Q A;  1KON A;  2W85 A;  3H9Q A;  3GFI A;  2A05 A;  3KEY A;  4Y52 J;  2X1C A;  5L3G A;  3AFH A;  2XAG A;  1LFP A;  3WTS C;  4YRV A;  2E7X A;  1D5V A;  3I71 A;  1USS A;  2CWE A;  5LGN A;  5C4J J;  1VQN I;  2E71 A;  1J2X A;  4BQA A;  1LNW A;  2CRG A;  3GTK J;  1KQ0 A;  4FE7 A;  2JSP A;  4FX4 A;  3OS1 A;  1JHF A;  5M3F J;  1U8B A;  2IT0 A;  3ELK A;  1I3Q J;  1T33 A;  2HDD A;  3FIW A;  4KNY A;  3GTL J;  2R7V A;  3F6V A;  2B63 J;  1K4T A;  3VWB A;  2HOA A;  3FXR A;  3QQA A;  4XOT A;  4XLP F;  2E1C A;  2XRN A;  3HSF A;  5ICF A;  5E1X A;  2CQK A;  2DA5 A;  2MH2 A;  4HW0 A;  1TC3 C;  3D5S C;  1BOA A;  2ZJQ F;  2E60 A;  1JHH A;  4RB2 C;  3KET A;  1D5Y A;  1YI2 I;  4XOP A;  2E1N A;  1QQI A;  4V2F A;  2K9N A;  3C18 A;  1G2H A;  3HOX J;  4G6Q A;  4PGG A;  2B9S A;  4ZJZ A;  3I55 I;  5D5W B;  1D0Z A;  1F5T A;  2FD5 A;  3OY9 A;  2XIG A;  3LA7 A;  4IKF A;  4HAM A;  3QU6 A;  2XPU A;  2CFO A;  2M9H A;  4DZJ A;  4UXN A;  5FB2 A;  2R4G A;  1DGR M;  1IRZ A;  3DKW A;  1FOK A;  5HDN A;  3J7A Y;  3HTU A;  4XBF A;  5LFA A;  3OYN A;  2HDW A;  2V79 A;  3VYS B;  1DGW Y;  4RAF A;  1DPR A;  2ECC A;  4EJU A;  2FF4 A;  3H5A A;  4M6V A;  1BI0 A;  1RRJ A;  1MIJ A;  1EF4 A;  3LSH A;  3OYM A;  2LK2 A;  3I3L A;  3L1P A;  2BHZ A;  3T8T A;  4CXF A;  4A3I J;  4L5I A;  4PFO A;  1TWA J;  3WHC A;  2GOM A;  2DA7 A;  4Y33 A;  4B09 A;  3DF8 A;  2QA4 I;  5HS9 A;  3Q3S A;  1D8K A;  3LL7 A;  4QWQ A;  3HUG A;  5D5U B;  1KA8 A;  3BZK A;  1K6Y A;  1MBG A;  3SDG A;  3FXM A;  4M3D A;  1XG1 A;  3ECH A;  4ANJ A;  4I6Z A;  2VKH A;  1IN5 A;  1WWX A;  2OCC H;  2KZV A;  2GXA A;  3P7N A;  3HKZ N;  3G1M A;  1ZRD A;  1K7A A;  2VPL A;  1MDM B;  5TGT A;  3HGG A;  3DWL E;  4LD5 A;  4AC0 A;  2IGO A;  3CC7 I;  1ODD A;  1PP8 F;  4BU2 A;  1QBJ A;  3KP5 A;  2ISY A;  1ZLK A;  2LC2 A;  1LEB A;  2ZJ2 A;  1XCV A;  3ZMV A;  1U2W A;  2E5Z A;  5IP7 J;  1R5I D;  5J8F A;  1P4X A;  3OYG A;  2ZXJ A;  3K2Z A;  4XRM A;  3A02 A;  4CGZ A;  1X3W B;  4J01 A;  4LK0 F;  1MSF C;  3QPL A;  1ETW A;  5D8K B;  2KT0 A;  3GTM J;  1RR8 C;  4MQV A;  4S05 A;  1UJ8 A;  1LKX A;  1O3S A;  5IOY A;  3S1N J;  1ITY A;  3VB2 A;  1IDZ A;  5BS6 A;  3ULQ B;  2YS9 A;  5GAG J;  1RKT A;  2WB1 N;  3G71 I;  5FO5 A;  1U5T A;  2XF6 A;  3HUG B;  3DU6 A;  2CS3 A;  1OCP A;  2BV6 A;  4AM3 A;  2LBF A;  3ZR8 X;  3F8F A;  1Y6I A;  4U88 A;  3SZG A;  1DP7 P;  2PFB A;  4ZTF A;  4BY7 J;  3A1Y A;  5TRD A;  3ZMS A;  2V6C A;  3I64 A;  4HLX A;  5GTI C;  1SAN A;  1SVL A;  1XMA A;  3NEU A;  3AL0 B;  2CO5 A;  2EA4 A;  2LMD A;  5C3E J;  2Y0S N;  4LFU A;  2EIM H;  3CCJ I;  1AA7 A;  3OSF A;  1DPU A;  2KRF A;  3E6D A;  4YG2 F;  4X0G A;  4E7K A;  2EV0 A;  1P7J A;  5JR3 A;  3DEE A;  1RET A;  3GX4 X;  4KIS A;  5M5Y J;  2VJJ A;  4E7S A;  1B9N A;  2ACJ A;  1SVM A;  1LB2 A;  3F6O A;  4LLL A;  2RGV A;  1O3Q A;  4BBR J;  2QYO A;  1R23 A;  1XSV A;  4NHJ A;  3CO7 C;  2A5Y B;  1ETK A;  2RKH A;  4PJN A;  2HZT A;  3MMY B;  3FHZ A;  3BTL A;  1CQT A;  4UUS A;  3ZP5 A;  3TO6 A;  5HS7 A;  1FMW A;  4YFK F;  2JA2 A;  4EM1 A;  3H3V K;  1FOX A;  2B0L A;  2EFO A;  4U0Y A;  1FSE A;  2ESH A;  1G6N A;  2ZXW H;  3BR3 A;  3W6K B;  3ZQI A;  3HGY A;  4D0P A;  2VXZ A;  4HQE A;  2V7F A;  5KK1 A;  3J80 K;  1Y0N A;  4HEA 2;  3H35 A;  1DQU A;  5L3E A;  3L2W A;  2CFX A;  4PZJ A;  4XLF A;  4B44 A;  1MH3 A;  1GDT A;  1YW7 A;  3BR0 A;  1WQ2 A;  4M9S A;  4A3G J;  2H94 A;  3M8E A;  2A69 F;  5BQT A;  4ENM A;  1U9O A;  1TQP A;  1SD7 A;  3U1D A;  3LA3 A;  3BJO A;  2L54 A;  1GXQ A;  2ZO4 A;  3JRF A;  2NYX A;  4EMS A;  1OIS A;  2M45 A;  1BW6 A;  4EGZ A;  4LGW A;  1A6I A;  1B6A A;  2VIX A;  2RNJ A;  1W5S A;  1FX7 A;  3G1O A;  4XOR A;  4XKV A;  5ICC A;  5IT9 K;  4UUS B;  3LNQ A;  4M3B A;  2XB0 X;  3QP6 A;  4XKC A;  4BDZ A;  2R7Q A;  5ICG A;  4U7D A;  2HDC A;  1W1W E;  5H6R A;  5DEQ A;  3WU1 B;  2FNA A;  3WTT C;  1VQK I;  5DD8 A;  1SFE A;  2ZSH B;  1K78 A;  4IHT A;  4KIC A;  5KVR A;  1PYV A;  4TV7 A;  1XSX A;  1FTZ A;  4BAY A;  3M7G A;  5AIP A;  2E34 A;  3OOP A;  3FXU A;  3ZQH A;  1MJA A;  2FEZ A;  2FOW A;  5JHU A;  2NVY J;  2BZT A;  2CQX A;  2ME0 A;  4M73 A;  5F04 A;  5IP6 A;  3L7W A;  2IGN A;  2EV6 A;  2NAZ A;  3N97 A;  1CF7 B;  2NVQ J;  2JT1 A;  4G7Z F;  2OAZ A;  2Y31 A;  1W0T A;  2XPV A;  1W0U A;  2JA5 J;  2EFW A;  2LNB A;  2OJE D;  2CUE A;  4ESB A;  3TP3 A;  3FXK A;  1W5T A;  2M7B A;  3OWT A;  2CW0 F;  3KP2 A;  1YRN A;  2X6W A;  2IEK A;  1KYW A;  3IL2 A;  2M87 A;  1T0F A;  4WK8 F;  2R7R A;  2VJI A;  2MGQ A;  3W2A A;  1ZRE A;  3WHB A;  4HF0 A;  1XGM A;  1ZRC A;  2MG4 A;  3BPV A;  4G6D A;  3LFU A;  3G1L A;  4BBS J;  2DMP A;  2EIL H;  2HQA A;  3M07 A;  2ZB9 A;  2AHQ A;  4RB1 A;  2VKV A;  2YX4 A;  4BQQ A;  1D3Y A;  2G0E A;  4ZYD A;  3K4J A;  2L9S A;  5D4R A;  2UXN A;  1S72 I;  5K7F A;  1K78 B;  4PJJ A;  4UVB A;  3KZY A;  3TDU C;  2WWY A;  3OR2 C;  5FGM A;  1MH4 A;  5IP9 J;  1JKR C;  2CV1 A;  1FLI A;  4D5C A;  4A5N A;  2X0L A;  2FA5 A;  1VFC A;  1WSU A;  5E18 F;  3U9G A;  4UV8 A;  3WG9 A;  4X6A J;  2VC0 A;  3LQQ A;  5FFX A;  1MMD A;  2EFN A;  3IHU A;  3LSM A;  1RUO A;  5M5W J;  2WAD A;  4I0B A;  2J5P A;  4W97 A;  3SZP A;  3AKZ A;  1T2K A;  3IRQ A;  3SHF A;  5DYM A;  2JA8 J;  3HOY J;  3Q0V A;  5GP9 A;  4Y4R A;  2RVC A;  1ZG5 A;  3I56 I;  3JRC A;  2XAU A;  1MMG A;  3H3Z A;  4FHT A;  2IA2 A;  2QQ8 A;  4PUS A;  3G2B A;  4F55 A;  3KLN A;  4K2E A;  2I10 A;  3VEP A;  3PIP F;  3HG9 A;  4CIC A;  2JRT A;  4KDP A;  3H3U A;  2RC4 A;  1ON1 A;  4B8X A;  1PJR A;  2FJ1 A;  1Z3Y A;  2OUM A;  1NHA A;  1FIA A;  1Z0X A;  4H4K C;  1TP4 A;  3M1C A;  2D1V A;  3QPS A;  4LG0 A;  3CUO A;  4BE2 A;  3K4K A;  1DDN A;  4EVI A;  2AO9 A;  2Y30 A;  1YX5 A;  1ZRF A;  2JA6 J;  2NVU B;  2EPF A;  2DT6 A;  2XPW A;  4A0Y A;  3L2U A;  1J75 A;  3O8H A;  2O7O A;  2Y2Z A;  1QU3 A;  2QLZ A;  2WAQ A;  1UG0 A;  2X9D A;  2GWR A;  3H9J A;  4A3C J;  4E6K G;  4HLY A;  2P7V B;  1R36 A;  1L3L A;  3TO7 A;  1MNM C;  3EET A;  1B9M A;  4NUB A;  2HYJ A;  3DTI A;  4PSX A;  4DIQ A;  1RIO H;  1HA8 A;  2YSR A;  4MFE A;  3F9K A;  4RB0 A;  3TOB A;  2DLL A;  3PNY A;  2IVM A;  1E3O C;  1WCM J;  1Z6R A;  2CUJ A;  2P0W A;  1XTA A;  5K5R A;  1BIB A;  4OWR B;  3RSN A;  5DDG A;  2LY9 A;  4I76 A;  1R1T A;  3RPU D;  4HF1 A;  5FRM A;  3BG9 A;  3DQV C;  2YUS A;  3Q0U A;  3A2K A;  2FBK A;  3GF2 A;  4LG0 B;  3HXL A;  2LKP A;  1R58 A;  4CCK A;  4B1R A;  4DYQ A;  1KU7 A;  1A31 A;  2H1L A;  3MKZ A;  1T39 A;  3E6B A;  2VQG A;  3OR1 C;  3Q0W A;  2VBY A;  4P9U A;  4BKX A;  3F3X A;  1YHQ I;  2K27 A;  4PCQ A;  4HNV A;  2BYV E;  3MVP A;  3FX3 A;  4FTH A;  4DNC A;  3RI4 A;  3ERM A;  2NNN A;  5D4S A;  2BW3 B;  2VXD A;  2YR2 A;  3MKL A;  4ZDO A;  3OS0 A;  2R7D A;  1YG2 A;  1FYK A;  3DBH B;  3IV5 A;  2F4I A;  2OV7 A;  1B8I B;  4HA8 A;  3QAH A;  2VI6 A;  4L0Y B;  3PFI A;  4CUG A;  2FBI A;  2F6C A;  3ZRG A;  2MC4 A;  4D5F A;  2X6X A;  2E36 A;  1S8N A;  2EIN H;  4I0A A;  4IXA A;  2DXI A;  4E7Z A;  3HC7 A;  3JR9 A;  3ZN1 A;  3F22 A;  4RGX A;  5D6E A;  2IS4 A;  3VOE A;  1VQM I;  3C2H A;  1Z6T A;  2DOE A;  2H09 A;  2ZFU A;  3LSP A;  2KDO A;  1GLN A;  3GZN B;  5LBQ A;  2IW5 A;  4F93 B;  4Q4Z F;  3CP2 A;  1U78 A;  3BZ6 A;  5EG0 B;  1TW3 A;  2CQQ A;  4IRG A;  1A36 A;  4YFX F;  2ZJP F;  3MZY A;  1QGP A;  3LOC A;  2K3P A;  4L5E A;  2DFI A;  4P96 A;  3EUA A;  1PVE A;  1YO5 C;  3OYE A;  2CGP A;  1VQ7 I;  2HQR A;  3H36 A;  1HF0 A;  3AG2 H;  2NRA C;  2DO7 A;  3PQJ A;  2QM3 A;  1SFU A;  3BR5 A;  1OMI A;  5KHD A;  4XLN F;  3F23 A;  4XNF A;  2L01 A;  1B1B A;  3V7S A;  1FJL A;  2KMU A;  5BOX A;  2VE8 A;  2VE9 A;  1X1C A;  2VQL A;  1K4S A;  3KP3 A;  2QSG X;  2PMZ N;  4FQG A;  2DT7 B;  2JUC A;  4EM0 B;  1ZK8 A;  3AG3 H;  3HJE A;  4M6Y A;  3CLO A;  2F48 A;  2OD5 A;  3L2C A;  1W36 C;  2ESN A;  1WFX A;  1IRF A;  1IAW A;  2H27 A;  2MAB A;  4WXC A;  1MND A;  2Y69 H;  5DCF A;  3R4K A;  5E1W A;  1WVR A;  4HOB A;  5DUK A;  2EH3 A;  1XX5 A;  3WTV C;  3L9F A;  3KX2 A;  3LSR A;  4RGU A;  2KJC A;  2PMZ A;  2GAU A;  3GZ5 A;  3A0H C;  2GXG A;  4CCL A;  2JUG A;  2JPB A;  4JQF A;  4UHT A;  3ZMD A;  2VKD A;  5ICE A;  3M9A A;  2V1D A;  3EUH A;  1MSE C;  3UKG A;  3I5U A;  5FKL A;  4GYG A;  2P4W A;  3D1N I;  1K6O A;  3VPR A;  2LTP A;  1JUP A;  2L9V A;  3O8G A;  1MGT A;  3WTU C;  3CDI A;  2QBY B;  2P8T A;  5KAF C;  2RV8 A;  4BJT A;  2QF7 A;  3U1K A;  4IHX A;  1S7E A;  3O2P E;  2CU7 A;  3L00 A;  4UV9 A;  1R5H A;  5E3M A;  1A6Q A;  2VAS A;  4N4O B;  5E3N A;  4B43 A;  4FT8 A;  4YEL A;  1OCO H;  3G73 A;  4B3X A;  1HQC A;  3H0G J;  5F08 A;  2P81 A;  2GA2 A;  2L7M P;  2CG4 A;  1KU9 A;  2V1X A;  3BWG A;  4LJZ F;  5M5X J;  1HW1 A;  5JFR A;  5E8G A;  4A3L J;  1S29 A;  3GLL A;  5DTD A;  1A5J A;  1QZZ A;  1FT9 A;  1RI7 A;  3BR1 A;  1TWH J;  4A3M J;  1RUN A;  5CPR B;  3DU5 A;  4OAZ A;  4WF2 A;  1EJ9 A;  3IWF A;  2EIJ H;  4YIR X;  3CP8 A;  4HX4 A;  2LD5 A;  3SJM A;  2VLA A;  1NTC A;  3K4B A;  3TW7 A;  1JUM A;  5GTH C;  1X3Z B;  3K0L A;  4EJO A;  1PDN C;  2QUF A;  4QSH A;  4XRS G;  3ZQL A;  3I4N J;  3K69 A;  2ZKZ A;  3JW4 A;  2L5Q A;  4LB6 B;  1I5Z A;  4BGD A;  3ABT A;  2XF7 A;  3B73 A;  5F0H A;  3DPU A;  1IW7 F;  4IOC F;  1IV6 A;  3E6C C;  1X1P A;  1JKQ C;  4AD9 A;  5J4Y A;  4P1W A;  2P6S A;  5DV5 A;  1JTY A;  2O3F A;  2KDZ A;  4MO7 A;  2WAF A;  5K7Z A;  1FBU A;  3VSK A;  3CQZ J;  3VOD A;  4NQW A;  3GLX A;  2HVQ A;  2QSF X;  4C30 A;  2AQE A;  2L3D A;  1W36 D;  1H89 C;  3HDD A;  1QHH D;  1IDY A;  1EH8 A;  1P4A A;  2LY2 A;  5EYR A;  2BOL A;  1BBY A;  3M8J A;  3CUQ C;  4I99 C;  4HSR A;  3SYT A;  1FMV A;  1IC8 A;  4CDG A;  3RKW A;  4XLE A;  3DLA A;  1ZR4 A;  1LVA A;  3IH2 A;  3J7A O;  2XAS A;  1DP3 A;  1IN6 A;  1UEL B;  1S7O A;  4L5J A;  1OPC A;  1ZGJ A;  3S1R J;  2Q0O A;  1AOY A;  3IRR A;  2FU4 A;  3U21 A;  3HPG A;  3FIS A;  4LMY A;  3F0C A;  5FKN A;  3OOU A;  3EPZ A;  3V42 A;  2ZXH A;  3CES A;  4AIH A;  1OYW A;  2DMQ A;  2COB A;  3BQZ A;  4NQW B;  3TOA A;  2JVG A;  4BH9 A;  2XGE A;  5J47 A;  5LGU A;  2D2W A;  3C2B A;  2O03 A;  4ZYA A;  3Q9V A;  4ZYE A;  1WPK A;  2DI3 A;  3W2V A;  5EEH A;  1OR7 A;  1J0R A;  1NH3 A;  2BY2 A;  1DU0 A;  1STZ A;  3VDX A;  4D1Q A;  3KFW X;  3FZV A;  3PUF A;  3WTX C;  2O8K A;  2XDV A;  5JLX A;  4BEH B;  1W7P D;  2BEO A;  2V9P A;  1QPM A;  3F8N A;  4XKW A;  1Y8Q B;  3ISP A;  4XLC A;  4H0E A;  4KN7 X;  2PI0 A;  1G8X A;  4CYC A;  4J00 A;  1S5L C;  2CUF A;  2H6C A;  2O0Y A;  2Y48 A;  5LLQ A;  3AAF A;  3BRO A;  1KU3 A;  1R00 A;  4ZC3 A;  2HKX A;  2K9L A;  2KRC A;  1TWC J;  2HQN A;  5GAD J;  3PJR A;  4JP0 A;  2F4M B;  2R7F A;  5GAH J;  1QA6 A;  2R7U A;  4OIN F;  5LGT A;  2ADU A;  2MLG A;  5FLV A;  4XMY A;  2R0Q C;  4XID A;  2EK5 A;  1K61 A;  2KFD A;  4PSW A;  2AQF A;  2FSW A;  3RYR A;  1MDM A;  3FK6 A;  4C3J J;  3E5X A;  1VQO I;  3L09 A;  5H6Q A;  1FYL A;  2V6E A;  4Q5S F;  1TQM A;  2VB6 A;  5J40 A;  3S16 J;  1T98 A;  1P92 A;  1H9G A;  4F3Q A;  1E17 A;  4S04 A;  1TWF J;  4JBA A;  1AHD P;  2RQP A;  4A0Z A;  1YX3 A;  4CYC B;  1FEX A;  2Q2E A;  5KCM A;  4E70 A;  1LUJ B;  1RPW A;  2DFF A;  2IBD A;  2LSO A;  2BVL A;  4Z2Y A;  2NVX J;  3R61 A;  1U5T C;  3F8M A;  2FQ3 A;  1P4W A;  3QU3 A;  2XKP A;  1YS6 A;  2M3A A;  3S15 J;  1ZAR A;  3KEQ A;  1P7I A;  3DBL B;  3FBI B;  4EM2 A;  2PJR A;  4LLN A;  3R0J A;  1GUU A;  1JUS A;  2DA3 A;  1OFC X;  3FMQ A;  1IN8 A;  2OZ6 A;  1WGX A;  4JOM A;  4BQO A;  5HLG A;  4A12 A;  1K83 J;  2VN2 A;  3BC8 A;  4RAY A;  4CHU A;  1WJF A;  3BDD A;  1J09 A;  3JRA A;  2CV0 A;  1D1C A;  1YIO A;  2HTJ A;  2JN6 A;  2VT3 A;  3KYC B;  1J7K A;  2BHY A;  4BHB A;  1ZKG A;  2Q2E B;  3HKZ A;  4G8X A;  1ETY A;  2HTS A;  2HFH A;  4BAC A;  2NOG A;  2DDB A;  2W57 A;  4DYC A;  4KIF A;  2GXB A;  2KRH A;  2K86 A;  1SAU A;  5ILU A;  3PFY A;  2DQR A;  3HOT A;  1BJA A;  3HBL A;  1MMA A;  1DUX C;  2EFP A;  2E7W A;  2XVC A;  2VBX A;  2QCO A;  3HOS A;  4G6T B;  3BCB A;  4GRI A;  4M3G A;  2R7W A;  2PJR B;  3HOZ J;  3OIQ A;  1B4A A;  2EZL A;  4BYY A;  4JX6 A;  4DZP A;  4V19 K;  2M0C A;  2ZME C;  4M3E A;  3CDL A;  5JVT A;  4D7M A;  3CCE I;  2WB1 A;  3WE3 A;  4KA4 A;  2IGK A;  1YLF A;  4BXF A;  3ABU A;  5E79 C;  3H1C A;  4DQ2 A;  3DBR B;  4AID A;  2MH9 A;  2AXT C;  2KIU A;  3W2W A;  5TJJ A;  1BA5 A;  1R5G A;  2WTE A;  5HVQ C;  3ABK H;  3GEZ A;  1XDS A;  4DBQ A;  4KN4 X;  1ORK A;  2A6T A;  2GIZ A;  3N05 A;  1G3Y A;  4ZYH A;  3B6A A;  3NWT A;  3RQ4 A;  1VQ4 I;  1ZTR A;  1GHC A;  1I27 A;  1Y1V J;  2GLO A;  2ID6 A;  4KIT B;  4OIQ F;  2Z9O A;  2K9S A;  3KPH A;  2DMT A;  4MQ9 F;  3P5J A;  4AVZ A;  2HPI A;  2Y0S A;  4KMF A;  4IQJ A;  1VQ6 I;  1K79 A;  5D5V B;  1EH6 A;  2DMU A;  1ETO A;  4M9X A;  1S7A A;  2NS7 A;  4LIU A;  2ECB A;  4AIK A;  4AIJ A;  1KU2 A;  2V1N A;  4A6D A;  4A6E A;  1V54 H;  2STT A;  4CZC A;  1D1B A;  5FRN A;  2QGU A;  2BXY A;  1IV8 A;  4NC8 A;  3IKT A;  2NS8 A;  2DA2 A;  5J1R A;  5EEA A;  2X4H A;  4BNC A;  3BJA A;  2BE5 F;  2XRL A;  5AON A;  2VUM J;  3SDB A;  1BI1 A;  2I5U A;  3R6S A;  3MKY B;  1CF7 A;  3IAS 2;  1I1G A;  1X58 A;  2HQ5 A;  1OLT A;  5AIQ A;  1NG6 A;  1T0F C;  1GVD A;  1UHW A;  3JTH A;  1MW7 A;  1XGS A;  4HX8 A;  3KE2 A;  4AYB N;  4DJA A;  1X4O A;  2QEX I;  4B3A A;  2VOP A;  2CSO A;  3BTJ A;  5HDG A;  3LFK A;  2D1H A;  4S0H B;  4D9J A;  2R7X A;  1YTY A;  1KQ8 A;  3F72 A;  1EV7 A;  2BXZ A;  4WX9 A;  2G7U A;  3KYL A;  1JTX A;  3RKQ A;  3OYK A;  4LIT A;  2NNY A;  5JLW A;  3GTG J;  5LD2 C;  4XN3 A;  2K9M A;  3F8C A;  4XLH A;  3UNG C;  5BNG A;  1RR7 A;  3S8P A;  4A3D J;  2R5Y A;  2EA2 A;  1ZEL A;  3I9V 2;  1WHU A;  3CCL I;  1GXP A;  4A3K J;  1R49 A;  2PBI A;  2VON A;  2RN7 A;  2R3S A;  3P9C A;  3L2R A;  3IWZ A;  3I0T A;  2DOA A;  2CQN A;  1D0X A;  1MNE A;  2EQR A;  2RQQ A;  2Y0M A;  4D7N A;  5BMZ A;  5LRR A;  3IH4 A;  3COA C;  3J81 Z;  4OMZ A;  1Z21 A;  5CQG A;  2E2H J;  2JQ7 A;  4HBL A;  4PGH A;  3HOU J;  4P55 A;  4UUT A;  1G59 A;  4RDU A;  1ENH A;  3E5U A;  3OL4 A;  2E5N A;  2CW7 A;  1AWC A;  3FXL A;  4EJV A;  1BOB A;  3LSI A;  4AVP A;  2EZK A;  1PUE E;  2IA0 A;  3LAJ A;  1WH5 A;  3P9K A;  3FKJ A;  5LEK A;  4YEJ A;  2BY1 A;  2QQ9 A;  2PN6 A;  3E7L A;  2Z16 A;  1D0Y A;  2K40 A;  4RLF A;  2JA7 J;  5F64 A;  2R5Y B;  2TDX A;  3CCQ I;  5E20 A;  2JSC A;  5FKO A;  1ZH5 A;  4G7O F;  5GPC A;  4Q47 A;  4C2T A;  2WC2 A;  2UWM A;  1ACI A;  3FF5 A;  5J1Y A;  1RC9 A;  2FML A;  4W1U A;  3ZMU A;  4GGG A;  2FE3 A;  2K85 A;  5DM6 F;  3V7C A;  5CLS A;  4R8H A;  1YFH A;  1DU6 A;  2QWW A;  3BCA A;  2LR8 A;  2VBZ A;  3S3O A;  3A4C A;  2QQA A;  1NK2 P;  4ENJ A;  2ZNZ A;  3KP6 A;  4UUV A;  5HNH A;  3AG4 H;  4XKB A;  2VKE A;  1Z9C A;  2RNG A;  1GT0 C;  2E2J J;  3HSE A;  1IGN A;  5B1A H;  1J59 A;  2HGC A;  3KYD B;  1BI2 A;  2LDU A;  3CO6 C;  3RPU A;  2R92 J;  3BTC A;  2XSJ C;  3B6C A;  3A01 A;  2A61 A;  4RB3 C;  2MLK A;  4RGS A;  2DTR A;  1OJL A;  3FWE A;  3UR3 C;  3GO5 A;  2E1M C;  1TLH B;  2JRM A;  2DJI A;  4E7I A;  2IRF G;  2COM A;  1BN5 A;  1F36 A;  5L3C A;  4HNT A;  5K5Q A;  1R22 A;  2BW3 A;  5CYV A;  5BPD A;  2K5C A;  4HG2 A;  4C2U A;  2JPC A;  3N4M A;  1B8I A;  4Y7N J;  1HKQ A;  1KYZ A;  2A6E F;  2DBB A;  1GV5 A;  1Q1H A;  4MLO A;  2XAJ A;  2ISZ A;  4BHC A;  1I39 A;  4XRS A;  3K7A J;  3HZJ A;  4OOI A;  4ESJ A;  1HCR A;  2HWV A;  4HRI A;  1APL C;  3H5R A;  1JJ6 C;  1TZL A;  2KP6 A;  1JKP C;  2IJL A;  1FIP A;  4XK4 A;  5CVU A;  1G3S A;  3OIP A;  5JI6 A;  5BPI A;  4EJT A;  4A5M A;  3K10 A;  2M8E A;  4FET A;  3SEQ A;  1YS7 A;  2EZH A;  3OYA A;  1REP C;  3QPT A;  3IKV A;  5EG0 A;  3BP8 A;  3A01 B;  3HHH A;  3PO2 J;  5JHF A;  2LH9 A;  1O7L A;  1ZGW A;  4O5V A;  3FKI J;  3MZ8 A;  4RLQ A;  2L4A A;  4HF2 A;  3PNT A;  2HKO A;  3WOD F;  5E3L A;  4Q48 A;  3ZCO A;  3QOP A;  4JX4 A;  4QPQ A;  5F27 A;  1ETQ A;  3RIR A;  3PNV A;  4DGW B;  2IS6 A;  2DOD A;  2XRO A;  1TT0 A;  4G7H F;  4AUX A;  2Y9Z A;  3H9G A;  5HLH A;  2HXI A;  2VQH A;  4HZF A;  3SZT A;  3TMO A;  3DP7 A;  1MBK A;  3GFL A;  3DEU A;  3R0A A;  4JX5 A;  2V4J C;  3K4L A;  3TO9 A;  1XDU A;  2ID3 A;  2L2O A;  1FTT A;  4ESF A;  1SMY F;  4J19 A;  2IS1 A;  1F1Z A;  3BY6 A;  5IOZ A;  3HTS B;  3KIO A;  1LPQ A;  1N77 A;  3OYH A;  3HHG A;  3TGN A;  4Y3O A;  3HEF A;  3SFZ A;  2WV1 A;  1X19 A;  3IAM 2;  3H92 A;  4PFP A;  1X2N A;  1ZQ3 P;  4A93 J;  3VFZ A;  1FYM A;  4II3 A;  5M3M J;  2LRE A;  2M4G A;  4HYE A;  1IO2 A;  2DA4 A;  4N9H A;  1Z77 A;  5B1B H;  4HNU A;  4E7J A;  2R93 J;  1QRY A;  1T6S A;  1Y0U A;  2EZI A;  2ZSI B;  4NBQ A;  2HNH A;  2QBY A;  2H8W A;  1D1A A;  3OMY A;  1O57 A;  2P5L C;  1WJB A;  2FNP A;  2NXN B;  1UZC A;  3RJP A;  2A07 F;  1JT6 A;  1ZG3 A;  3JSO A;  1PP7 U;  2FUG 2;  1OCT C;  1VTN C;  1Z7U A;  1GVJ A;  5FFZ A;  1P9Q C;  2KIS A;  2E1M B;  1U0J A;  2ZFW A;  5HLI A;  2RDP A;  1E0E A;  2BVM A;  2OTL I;  3SEZ A;  1VI0 A;  1HOM A;  2M4K A;  2Z33 A;  2D45 A;  3L2V A;  4NB5 A;  1BJZ A;  2XGC A;  3ZQ7 A;  2AS5 F;  4R79 A;  3EQL F;  5HS8 A;  3CME I;  2DT5 A;  1XD7 A;  1FP1 D;  2M2E A;  3SQN A;  3KEO A;  5CJ9 A;  1VND A;  3BPX A;  5DS9 A;  4A3F J;  2KIQ A;  5E8I A;  2LOO A;  3BQY A;  4N4N B;  1P2F A;  5EEG A;  3IH3 A;  3BG6 A;  3T8R A;  1G3T A;  3QYF A;  3JRB A;  1E3H A;  4MGR A;  1EH7 A;  1OQY A;  1WJ5 A;  1NK3 P;  1QHG A;  3D0S A;  4KFC A;  3CD6 I;  3CJQ B;  2JWT A;  5IT9 Z;  2DFH A;  3BG5 A;  3ZQG A;  2FXA A;  5LRS A;  5ED4 A;  2ZXI A;  3EDP A;  4ZDP A;  3JTG A;  3MZH A;  5FKK A;  1VQL I;  1U9N A;  3PQK A;  2LKX A;  2A3S A;  4XQF A;  5EDN A;  2TCT A;  1MZB A;  2IGM A;  2E2I J;  4BDY A;  3K1M A;  2L02 A;  2VJ4 A;  2A5W A;  1WZ2 A;  5KAI C;  4MTE A;  1T56 A;  1T38 A;  1N75 A;  4I02 A;  3ASO H;  2KZG A;  1BR1 A;  3NRV A;  2QEN A;  4CCN A;  2Z2S B;  3WGG A;  1HKT A;  3FMS A;  5IY5 H;  3JRG A;  3ABL H;  3S1M J;  4UNO A;  4IJA A;  4IVN A;  5IYB J;  3GBG A;  1XGN A;  3A0B C;  5DCM B;  2KHM A;  4M9Z A;  1UFM A;  5J4V A;  1IXS B;  3BLY A;  2EWN A;  2O6G E;  4RA2 A;  4Z6Y A;  3RKX A;  1V5E A;  3HL2 A;  2HU9 A;  2L9N A;  3CMM A;  1YW8 A;  3FXO A;  1QZY A;  2X85 A;  2DYR H;  2ZC2 A;  4I7H A;  5K1Y A;  4YII A;  5HOD A;  2LY1 A;  5D5X B;  3RTR A;  3H0D A;  3OYL A;  4F52 A;  4BL0 B;  4RGR A;  3L2Q A;  4KUM A;  1TTY A;  1ZR2 A;  3J7Z I;  4PJM A;  1HXD A;  4AU7 A;  5CKT A;  3WTW C;  3WG7 H;  3HRS A;  3IC7 A;  5J8C A;  5FLX Z;  4FX0 A;  1HW2 A;  2FX0 A;  3KP7 A;  2EJR A;  3ZN0 A;  1LFU P;  2UV1 A;  3RYP A;  2PMU A;  3TKY A;  1FWZ A;  1OR7 C;  4HQM A;  3I54 A;  1H88 C;  2FBH A;  1V5G A;  4M6X A;  2GA1 A;  2W7N A;  3VYU B;  1YIJ I;  1X1A A;  9ANT A;  1JXS A;  3EUK L;  3MD2 A;  3E5Q A;  2VL8 A;  3GWZ A;  4BEH A;  4A3B J;  4R1H A;  1XN7 A;  6PAX A;  1ETV A;  2LF8 A;  1UHS A;  3JRE A;  1YOV B;  1XPX A;  2PMH A;  3VYR B;  3K9T A;  2VOO A;  4XR6 A;  3PIO F;  1A04 A;  2K4J A;  2R5Z A;  3CTA A;  4DYR A;  2H1K A;  3IP4 B;  1IF1 A;  2HXO A;  2CUZ A;  3FBN B;  4BHP A;  1ZN2 A;  3WTZ A;  1SFO J;  1R1V A;  1MBH A;  3S2H J;  4XIC A;  1C0W A;  4IHV A;  1XSD A;  5F0F A;  5L3F A;  5GPA A;  5B66 C;  4L9N A;  1LDJ A;  4M71 A;  5FRO A;  3WGH A;  1LDK B;  1R71 A;  4IHY A;  1QVT A;  5CVJ A;  1RKW A;  2L7K A;  1S3J A;  2ZBK A;  4MIM A;  2JJ7 A;  1RES A;  4B48 A;  4CSW A;  1IUF A;  4ETS A;  3V7R A;  2YX7 A;  2OPT A;  4A0X A;  3RZD J;  4U0V A;  1JJ8 C;  3MWM A;  1SC7 A;  3RKY A;  3K70 C;  2BBY A;  2R7S A;  4Y17 A;  3J81 K;  4XSX F;  1VF9 A;  4B47 A;  1OCC H;  1W7P B;  2UZK A;  3WE2 A;  1N78 A;  2P7C B;  1CGP A;  3JAM Z;  4BQN A;  2R5Z B;  1BW5 A;  2MFZ A;  2QZ8 A;  2Z99 A;  3OL3 A;  3OYF A;  3KZZ A;  5D6F A;  3DTK A;  2VOD A;  3QOD A;  4QPO A;  5JVG F;  3ZXS A;  1HKS A;  3W6V A;  3QP5 A;  1WJE A;  2CYY A;  2XB5 A;  2JK3 A;  3CCM I;  2JMW A;  3NWS A;  1IN7 A;  3WU0 A;  1PUF A;  3CUQ A;  4C3I J;  4WWC A;  4G94 A;  1OKR A;  1A35 A;  1ETX A;  3QRF F;  2OU2 A;  3ONQ A;  4CCO A;  5C44 J;  4LG3 A;  1X4P A;  1IRX A;  4X1E A;  2XV4 S;  3AL0 C;  1VQ5 I;  4G12 A;  2LP0 A;  2VC1 A;  4LLG F;  4GXO A;  4UB8 C;  1L0O C;  3DKX A;  1I6H J;  5ILS A;  3B02 A;  2IA1 A;  2KKO A;  3PSF A;  4HDV A;  3BJ6 A;  2KL4 A;  2PEX A;  4UVA A;  1BC7 C;  3HYI A;  1T08 B;  4E7H A;  2ME6 A;  3CMA I;  5K7H A;  2OQG A;  2M0M A;  2W82 A;  2WBM A;  2M30 A;  4U7B A;  3FXJ A;  4WXD A;  4KYW A;  2HYF A;  2KPM A;  2WV0 A;  3CC2 I;  3FK7 A;  1U3E M;  2EV5 A;  3F21 A;  3Q5F A;  2OF7 A;  4IX7 A;  2FOK A;  3MAJ A;  3P9I A;  3CUQ B;  1PUF B;  5J1U A;  3W3C A;  1ULY A;  4O3M A;  3OYC A;  2DOF A;  1UCR A;  3ASN H;  4LK1 F;  2QQB A;  1UG2 A;  3ZPL A;  4XRF A;  2ZNY A;  4IEJ A;  3IUO A;  4L18 B;  2XHK A;  2PQ8 A;  4XSZ F;  5CVI A;  2W00 A;  3ZOB A;  2A68 F;  1Z91 A;  3CCU I;  4QLC U;  4C3H J;  2M1B A;  2V9V A;  1V3F A;  1O7F A;  5TIS C;  4RMN A;  4ZTJ A;  2WAE A;  2QSH X;  4I2O A;  1JE8 A;  1R4M B;  3ESW B;  2QVO A;  4CCM A;  4XLA A;  4QTR A;  2HOS A;  3I59 A;  2Z1D A;  2HOT A;  5E17 F;  3V8J A;  1SFK A;  5A2Q Z;  1WI3 A;  1B72 A;  1MJ9 A;  1V4R A;  3LA2 A;  3ROU A;  2BGC A;  3JCU C;  4GDF A;  1YJW I;  5HLT A;  4F92 B;  1P6R A;  3K70 D;  2O8X A;  3O6B B;  1QNT A;  3ML6 A;  1IXC A;  3PSI A;  4F91 B;  2HOE A;  3LSK A;  1M1E B;  2ZCW A;  2F5F A;  4GO1 A;  2MBF A;  2VJ5 A;  2MA3 A;  4OIO F;  2ICW G;  4U0W A;  2HZD A;  1MMS A;  2GQQ A;  1XMK A;  4JYK A;  3DFG A;  3V8L A;  4FAS D;  4XN0 A;  2E35 A;  1KZH A;  3S3N A;  1D8J A;  2XGX A;  3OYJ A;  3M4O J;  1QZE A;  4KT5 C;  1EA3 A;  3BG3 A;  3V8K A;  3LQR A;  3CZ6 A;  1Y39 A;  1VQ9 I;  1W4M A;  3RDI A;  2MYS A;  1SD4 A;  2ZJR F;  3I59 B;  3NAR A;  3WTY C;  4ON0 A;  1XB4 A;  1BL0 A;  1JGG A;  2HVR A;  2L7F P;  3A03 A;  4UVC A;  4OU0 A;  3EYI A;  1B72 B;  5EJC A;  1BIA A;  2M34 A;  2MW8 A;  2V9K A;  2D5V A;  3CCS I;  5LHI A;  3CCV I;  2XAQ A;  4HV5 A;  1SAX A;  3C3W A;  2GOX B;  3CCY A;  2FMY A;  4IL6 C;  1WJD A;  2HEO A;  3PL8 A;  4RS8 A;  2R7Z J;  1Z7L A;  2E1O A;  4RM3 A;  2C6Y A;  3D5R C;  5F1R A;  4EV0 A;  1TQI A;  4HPQ A;  5E1Z B;  1AKH A;  3G3Z A;  1MBJ A;  4MHG A;  1NG7 A;  1WJC A;  2HR3 A;  1FY7 A;  3KCC A;  1ZG1 A;  3J7Y J;  2GBY A;  1FZP B;  3OV8 A;  1F9N A;  2VBW A;  2VQC A;  1MMN A;  3KP4 A;  1U5T B;  2OCE A;  4UB6 C;  1JT0 A;  4F7Z A;  1BI3 A;  1JI8 A;  2ETH A;  4CZZ A;  4B4C A;  4IPA A;  2LBF B;  1ZGA A;  2GM4 A;  4II2 A;  2Q1Z B;  2UUZ A;  5L3B A;  4MNU A;  1X3U A;  5B5E C;  4HDU A;  2IS2 A;  2X1E A;  1ZHF A;  1XS9 A;  4UY8 I;  1HSJ A;  2W25 A;  4FIS A;  4CA0 A;  1H8A C;  1J9I A;  3BG7 A;  4BUP A;  2IP2 A;  2DK8 A;  2ZME A;  4OAY A;  1O3T A;  4L9T A;  3HRU A;  3C1D A;  2DQL A;  1X1D A;  2DW4 A;  3RPQ A;  3HOW J;  2W84 A;  4WCG A;  3E6M A;  2DJN A;  4IQ4 A;  1LFB A;  3PUB A;  1TWG J;  2LG4 A;  1ZYR F;  3HIF A;  3RCO A;  3TDZ C;  2EB7 A;  1V55 H;  3W6J B;  4ZZD A;  4AYB A;  3C7J A;  1AKH B;  3SFI A;  4P9F A;  3LWF A;  1BC8 C;  3RZO J;  1LJ9 A;  1FOW A;  1FOY A;  3CLQ A;  2V26 A;  4HX7 A;  5EF6 A;  4OMY A;  4NNJ A;  3F8B A;  3ZGK A;  2NOJ B;  2OBP A;  1ZLJ A;  2FQ4 A;  4AWX B;  3T0Y A;  1I6X A;  3OS2 A;  3NAU A;  2ELH A;  3GCM A;  2DDA A;  2DK5 A;  3I4P A;  2GIV A;  3TP0 A;  4IRI A;  2XUB A;  2X51 A;  1OCZ H;  2ZME B;  2HYG D;  1TW2 A;  2G7H A;  3FMR A;  3LSJ A;  4M74 A;  3CJN A;  2H6B A;  2UXX A;  3GZ6 A;  4RAG A;  3GXO A;  2DN0 A;  3GTP J;  3G4S I;  3BT9 A;  2Y75 A;  4FE4 A;  4KJZ A;  1H0M A;  1F4K A;  2E19 A;  2AXL A;  3MFK A;  4BJ6 C;  2VPR A;  3KLO A;  2CMP A;  3U2R A;  3GME A;  4G9Y A;  4C9Y A;  2V1U A;  5IYC J;  4IF4 A;  4ZDL A;  2BY3 A;  3K1N A;  2HVS A;  3LSG A;  2K02 A;  4O6J A;  4ZH4 F;  1WH7 A;  2I8D A;  3SXY A;  3E97 A;  3T5X A;  1U6G A;  1YJN I;  2L9R A;  1TT5 B;  3K2A A;  3TW6 A;  3GFM A;  3VSL A;  5KNL A;  4ZYG A;  2XGD A;  4HST A;  4BE1 A;  1ONV A;  2N8G A;  1FNN A;  3JRI A;  1Y56 A;  2P5K A;  4LOC A;  2L4M A;  2BY0 A;  5HDK A;  2W48 A;  4ASN A;  3CMY A;  2IAI A;  2F5D A;  4GCV A;  4Y15 A;  2WY7 Q;  5FLX K;  2O9L A;  4JK1 X;  4N9I A;  1I50 J;  1S6L A;  4MEY F;  1TNT A;  4N0B A;  3DLL F;  4RBO A;  1BM9 A;  2W4S A;  1QPI A;  2OA4 A;  1IRG A;  1YRN B;  2XKO A;  4RM2 A;  4DW6 A;  1HDP A;  3I4M J;  4I09 A;  4PK4 A;  1RZ4 A;  3D5L A;  1YJ9 I;  5LEJ A;  1WI9 A;  1TBX A;  1MBF A;  2PG4 A;  5CVR A;  1Y8R B;  4I01 A;  4DBR A;  1FBQ A;  3LAP A;  2WAQ N;  1LQ1 A;  2WY8 Q;  2G9W A;  4CCJ A;  4CO8 A;  1IXR C;  1R7J A;  2JVH A;  5IT3 A;  3CJR B;  1RNL A;  2DCE A;  2DMN A;  2LLK A;  3HSR A;  5IYD J;  3JSP A;  1GV2 A;  4C2M J;  5L3D A;  1Z05 A;  3GVA A;  2DAO A;  3GTJ J;  3DCF A;  4I98 B;  2B7E A;  3ZMZ A;  2LRD A;  1HW5 A;  4L0Z B;  4IHW A;  1IJW C;  1MD0 A;  1UMQ A;  4NC7 A;  5DD4 A;  2RAE A;  1TL8 A; 
#chains in the Genus database with same CATH homology
 3MCZ A;  2KIM A;  2VT2 A;  1IZ1 A;  1E2X A;  2F5C A;  3M1E A;  3GFJ A;  2LF7 A;  2HS5 A;  1OYY A;  2YU3 A;  4ZZL A;  1Z1D A;  3FM3 A;  1G3W A;  4KIG A;  4L9V A;  5ILV A;  4EQQ A;  3JAM K;  3DV8 A;  4LB5 A;  4BXU A;  1IUY A;  3DPL C;  5ERI A;  3REO A;  4YFN F;  4EJW A;  3V4G A;  2MC3 A;  2YPR A;  1SMT A;  2KJB A;  4ENN A;  2K4B A;  1H9T A;  4M72 A;  4WXH A;  3QPH A;  1YW9 A;  1HST A;  5DUI A;  3LST A;  3WGI A;  4OIP F;  1UB9 A;  1XCB A;  2J5O A;  3Q9S A;  5K5O A;  2EFQ A;  5LHH A;  4A2U A;  2DPD A;  1SFX A;  3TQN A;  3HRM A;  3GW2 A;  1G4D A;  1ZAO A;  1B59 A;  3J80 Z;  3MEX A;  2P5V A;  5D8L B;  2A6H F;  2PLY A;  3DPT A;  1KGS A;  1YYV A;  3EYY A;  4P5O A;  2K7L A;  5DCM A;  4IRH A;  2Q8K A;  3DXJ F;  2XAF A;  3ECO A;  3HRT A;  3FXQ A;  1FSH A;  1KQ9 A;  1HBX G;  1MJB A;  2DU9 A;  4HV6 A;  3CDH A;  3O3K A;  4YIF A;  5A2Q K;  4EGY A;  3I58 A;  2W24 A;  1ON2 A;  1U8R A;  4KMU X;  2FRH A;  2F5E A;  1XGO A;  1SD5 A;  1FC3 A;  3FM5 A;  3I53 A;  1UST A;  4IHS A;  4MEX F;  1LDD A;  4RAZ A;  3E3V A;  3GUD A;  1SD6 A;  2DPU A;  1R1U A;  5J6X A;  1YQA A;  3NQO A;  4CYD A;  4L9J A;  2P6T A;  1QO0 D;  2JTV A;  1J5Y A;  5H20 A;  2IPQ X;  1JGS A;  1O3R A;  5FD6 A;  4Y13 A;  3ZMT A;  3K1P A;  3M8F A;  2KIF A;  1WKM A;  4ENK A;  2JZY A;  5HOO A;  2OQR A;  2MD5 A;  1WRJ A;  3MQ0 A;  3ERE D;  1TNS A;  4OIR F;  1UHM A;  3GYH X;  5LHG A;  4MTD A;  1I1S A;  2M5W A;  1W7P A;  4PDK A;  5CVV A;  5FD5 A;  2GZW A;  3S2W A;  3T1B A;  1FBS A;  1FP2 A;  4KIB A;  2O61 A;  3BOQ A;  5F6F A;  1LEA A;  2F2E A;  4GYI A;  3R60 A;  2STW A;  2Z5U A;  1OYI A;  1MKM A;  2PJP A;  2OZU A;  2NS0 A;  2Z3Y A;  1IN4 A;  1FPQ A;  2XAH A;  2W85 A;  3GFI A;  5L3G A;  2XAG A;  3WTS C;  2E7X A;  1D5V A;  3I71 A;  1USS A;  2CWE A;  5LGN A;  1J2X A;  4BQA A;  1LNW A;  1KQ0 A;  4FX4 A;  1JHF A;  2IT0 A;  3ELK A;  4KNY A;  3F6V A;  3FXR A;  4XLP F;  2E1C A;  2XRN A;  3HSF A;  5ICF A;  5E1X A;  2CQK A;  2MH2 A;  4HW0 A;  1BOA A;  1JHH A;  4RB2 C;  3KET A;  2E1N A;  1QQI A;  3C18 A;  4G6Q A;  4PGG A;  5D5W B;  1F5T A;  2XIG A;  3LA7 A;  4HAM A;  3QU6 A;  4UXN A;  5FB2 A;  3DKW A;  1FOK A;  5HDN A;  3HTU A;  4XBF A;  2V79 A;  1DPR A;  4EJU A;  2FF4 A;  1BI0 A;  3T8T A;  4CXF A;  4L5I A;  4B09 A;  3DF8 A;  5HS9 A;  1D8K A;  4QWQ A;  5D5U B;  3HUG A;  1KA8 A;  3ECH A;  1IN5 A;  1WWX A;  3P7N A;  1ZRD A;  1K7A A;  1MDM B;  4LD5 A;  1ODD A;  1PP8 F;  1QBJ A;  3KP5 A;  2ISY A;  1ZLK A;  1LEB A;  2ZJ2 A;  1XCV A;  3ZMV A;  1U2W A;  5J8F A;  1P4X A;  2ZXJ A;  3K2Z A;  4CGZ A;  4LK0 F;  5D8K B;  4MQV A;  4S05 A;  1O3S A;  3VB2 A;  5BS6 A;  3ULQ B;  5FO5 A;  1U5T A;  2BV6 A;  3F8F A;  4U88 A;  1DP7 P;  2PFB A;  5TRD A;  3ZMS A;  2V6C A;  3I64 A;  4HLX A;  1XMA A;  3NEU A;  2CO5 A;  2EA4 A;  4LFU A;  1DPU A;  2KRF A;  3E6D A;  4YG2 F;  2EV0 A;  5JR3 A;  3GX4 X;  1B9N A;  2ACJ A;  1LB2 A;  3F6O A;  4LLL A;  2RGV A;  1O3Q A;  2QYO A;  1R23 A;  1XSV A;  4NHJ A;  3CO7 C;  2A5Y B;  2RKH A;  2HZT A;  3FHZ A;  3ZP5 A;  3TO6 A;  5HS7 A;  4YFK F;  4EM1 A;  2B0L A;  2EFO A;  4U0Y A;  1FSE A;  2ESH A;  1G6N A;  3W6K B;  4D0P A;  2VXZ A;  4HQE A;  5KK1 A;  3J80 K;  5L3E A;  2CFX A;  4PZJ A;  1YW7 A;  1WQ2 A;  4M9S A;  2H94 A;  3M8E A;  2A69 F;  5BQT A;  4ENM A;  1TQP A;  1SD7 A;  3U1D A;  3LA3 A;  3BJO A;  2L54 A;  1GXQ A;  2ZO4 A;  2NYX A;  4EMS A;  2M45 A;  4EGZ A;  4LGW A;  1B6A A;  2RNJ A;  1W5S A;  1FX7 A;  5ICC A;  5IT9 K;  3QP6 A;  5ICG A;  4U7D A;  2HDC A;  5H6R A;  5DEQ A;  3WU1 B;  2FNA A;  3WTT C;  5DD8 A;  1SFE A;  1K78 A;  4IHT A;  4KIC A;  5KVR A;  4TV7 A;  1XSX A;  4BAY A;  3M7G A;  5AIP A;  3OOP A;  3FXU A;  1MJA A;  2FEZ A;  5JHU A;  4M73 A;  3L7W A;  2EV6 A;  2NAZ A;  3N97 A;  1CF7 B;  2JT1 A;  4G7Z F;  2OAZ A;  2EFW A;  2LNB A;  4ESB A;  1W5T A;  2CW0 F;  3KP2 A;  1KYW A;  3IL2 A;  2M87 A;  1T0F A;  4WK8 F;  1ZRE A;  4HF0 A;  1XGM A;  1ZRC A;  3BPV A;  4G6D A;  4RB1 A;  2YX4 A;  1D3Y A;  4ZYD A;  5D4R A;  2UXN A;  1K78 B;  4UVB A;  3KZY A;  3TDU C;  2WWY A;  5FGM A;  1FLI A;  4A5N A;  2X0L A;  2FA5 A;  1WSU A;  5E18 F;  3U9G A;  4UV8 A;  3WG9 A;  2VC0 A;  3LQQ A;  5FFX A;  2EFN A;  3IHU A;  1RUO A;  4I0B A;  2J5P A;  3SZP A;  1T2K A;  3IRQ A;  3SHF A;  5DYM A;  2RVC A;  1ZG5 A;  3H3Z A;  4FHT A;  2IA2 A;  3KLN A;  4K2E A;  3VEP A;  4CIC A;  2JRT A;  4KDP A;  3H3U A;  2RC4 A;  1ON1 A;  4B8X A;  1NHA A;  2D1V A;  4LG0 A;  3CUO A;  1DDN A;  4EVI A;  1ZRF A;  4A0Y A;  1J75 A;  2QLZ A;  2GWR A;  4HLY A;  2P7V B;  1R36 A;  1L3L A;  3TO7 A;  3EET A;  1B9M A;  1RIO H;  2YSR A;  4RB0 A;  3TOB A;  2DLL A;  2IVM A;  1Z6R A;  5K5R A;  1BIB A;  5DDG A;  1R1T A;  4HF1 A;  3DQV C;  2FBK A;  3GF2 A;  4LG0 B;  2LKP A;  1R58 A;  1KU7 A;  1T39 A;  3E6B A;  4P9U A;  2VBY A;  3F3X A;  2K27 A;  4PCQ A;  2BYV E;  3FX3 A;  4DNC A;  3RI4 A;  2NNN A;  5D4S A;  2YR2 A;  2R7D A;  1YG2 A;  1FYK A;  4HA8 A;  3QAH A;  4L0Y B;  3PFI A;  2FBI A;  1S8N A;  4I0A A;  4IXA A;  3ZN1 A;  3F22 A;  4RGX A;  5D6E A;  3VOE A;  1Z6T A;  2H09 A;  5LBQ A;  2IW5 A;  4Q4Z F;  1U78 A;  3BZ6 A;  1TW3 A;  4IRG A;  4YFX F;  3MZY A;  1QGP A;  2DFI A;  4P96 A;  1YO5 C;  2CGP A;  2HQR A;  2NRA C;  2DO7 A;  3PQJ A;  2QM3 A;  1SFU A;  1OMI A;  4XLN F;  3F23 A;  2L01 A;  1B1B A;  3V7S A;  5BOX A;  2VE8 A;  2VE9 A;  3KP3 A;  4EM0 B;  4M6Y A;  3CLO A;  2OD5 A;  3L2C A;  2ESN A;  1IRF A;  1IAW A;  2H27 A;  4WXC A;  5DCF A;  3R4K A;  5E1W A;  4HOB A;  5DUK A;  3WTV C;  3L9F A;  4RGU A;  2KJC A;  2GAU A;  3GZ5 A;  2GXG A;  2JPB A;  4JQF A;  4UHT A;  3ZMD A;  5ICE A;  3M9A A;  2V1D A;  3EUH A;  3I5U A;  4GYG A;  2P4W A;  1K6O A;  1MGT A;  3WTU C;  2QBY B;  2P8T A;  2RV8 A;  3O2P E;  4UV9 A;  3L00 A;  1R5H A;  4FT8 A;  3G73 A;  1HQC A;  2GA2 A;  2CG4 A;  1KU9 A;  2V1X A;  3BWG A;  4LJZ F;  1HW1 A;  5JFR A;  5E8G A;  1S29 A;  1QZZ A;  1FT9 A;  1RI7 A;  1RUN A;  4WF2 A;  3IWF A;  4HX4 A;  3K0L A;  4EJO A;  1PDN C;  2QUF A;  3K69 A;  2ZKZ A;  3JW4 A;  4LB6 B;  1I5Z A;  3ABT A;  3B73 A;  1IW7 F;  3E6C C;  4AD9 A;  2P6S A;  5DV5 A;  2O3F A;  1FBU A;  3VOD A;  4NQW A;  3GLX A;  2L3D A;  1EH8 A;  1P4A A;  1BBY A;  3CUQ C;  4CDG A;  3RKW A;  1LVA A;  3J7A O;  2XAS A;  1IN6 A;  1S7O A;  4L5J A;  1OPC A;  1ZGJ A;  2Q0O A;  1AOY A;  3IRR A;  2FU4 A;  4LMY A;  4AIH A;  1OYW A;  3TOA A;  4BH9 A;  5LGU A;  2D2W A;  2O03 A;  3Q9V A;  4ZYE A;  2DI3 A;  5EEH A;  1OR7 A;  1J0R A;  1STZ A;  3KFW X;  3FZV A;  3WTX C;  1W7P D;  2BEO A;  1QPM A;  3F8N A;  3ISP A;  4H0E A;  4KN7 X;  2PI0 A;  2H6C A;  2O0Y A;  2Y48 A;  5LLQ A;  3AAF A;  3BRO A;  1KU3 A;  1R00 A;  2HKX A;  2HQN A;  2R7F A;  4OIN F;  5LGT A;  2ADU A;  2MLG A;  2EK5 A;  2FSW A;  3RYR A;  1MDM A;  3E5X A;  3L09 A;  5H6Q A;  1FYL A;  4Q5S F;  1TQM A;  1T98 A;  1P92 A;  1H9G A;  1E17 A;  4S04 A;  4JBA A;  2RQP A;  4A0Z A;  2Q2E A;  4E70 A;  2LSO A;  4Z2Y A;  3R61 A;  1U5T C;  3F8M A;  2FQ3 A;  1P4W A;  3QU3 A;  2XKP A;  1YS6 A;  1ZAR A;  3KEQ A;  4EM2 A;  4LLN A;  3R0J A;  3FMQ A;  1IN8 A;  2OZ6 A;  5HLG A;  4A12 A;  2VN2 A;  4RAY A;  4CHU A;  3BDD A;  1YIO A;  2HTJ A;  2VT3 A;  1J7K A;  4BHB A;  4G8X A;  2HTS A;  2HFH A;  2W57 A;  2GXB A;  4KIF A;  2K86 A;  5ILU A;  2DQR A;  3HOT A;  1BJA A;  1DUX C;  2EFP A;  2E7W A;  2XVC A;  2VBX A;  3HOS A;  1B4A A;  4BYY A;  5JVT A;  3WE3 A;  4KA4 A;  1YLF A;  3ABU A;  4DQ2 A;  2MH9 A;  2KIU A;  5TJJ A;  1R5G A;  2WTE A;  5HVQ C;  3GEZ A;  1XDS A;  4KN4 X;  1G3Y A;  4ZYH A;  1GHC A;  1I27 A;  4OIQ F;  2Z9O A;  4MQ9 F;  4KMF A;  1K79 A;  5D5V B;  1EH6 A;  4M9X A;  1S7A A;  4AIK A;  4AIJ A;  1KU2 A;  4A6D A;  4A6E A;  2STT A;  3IKT A;  2X4H A;  4BNC A;  3BJA A;  2BE5 F;  5AON A;  1BI1 A;  3R6S A;  1CF7 A;  1I1G A;  5AIQ A;  1UHW A;  3JTH A;  1XGS A;  4HX8 A;  3KE2 A;  2VOP A;  2CSO A;  5HDG A;  3LFK A;  2D1H A;  1YTY A;  1KQ8 A;  3F72 A;  1EV7 A;  4WX9 A;  2G7U A;  2NNY A;  3F8C A;  2EA2 A;  1GXP A;  2PBI A;  2VON A;  2RN7 A;  2R3S A;  3P9C A;  3IWZ A;  3I0T A;  2Y0M A;  5BMZ A;  5LRR A;  3COA C;  3J81 Z;  4OMZ A;  4HBL A;  4PGH A;  4P55 A;  3E5U A;  1AWC A;  4EJV A;  4AVP A;  1PUE E;  2IA0 A;  3LAJ A;  3P9K A;  5LEK A;  2QQ9 A;  2PN6 A;  5F64 A;  2TDX A;  5E20 A;  2JSC A;  1ZH5 A;  4G7O F;  2UWM A;  4Q47 A;  2WC2 A;  3FF5 A;  2FML A;  3ZMU A;  4GGG A;  2FE3 A;  3V7C A;  5CLS A;  4R8H A;  1YFH A;  2QWW A;  2VBZ A;  2QQA A;  4ENJ A;  2ZNZ A;  3KP6 A;  4UUV A;  1Z9C A;  3HSE A;  1J59 A;  2HGC A;  1BI2 A;  2LDU A;  3CO6 C;  3RPU A;  2A61 A;  4RB3 C;  2MLK A;  4RGS A;  2DTR A;  3FWE A;  3GO5 A;  1TLH B;  2IRF G;  2COM A;  1BN5 A;  5L3C A;  5K5Q A;  1R22 A;  5CYV A;  5BPD A;  2JPC A;  3N4M A;  1HKQ A;  1KYZ A;  2A6E F;  2DBB A;  1Q1H A;  2XAJ A;  2ISZ A;  4BHC A;  4OOI A;  4ESJ A;  2HWV A;  2IJL A;  5CVU A;  1G3S A;  5JI6 A;  5BPI A;  4EJT A;  4A5M A;  2M8E A;  1YS7 A;  1REP C;  3QPT A;  3IKV A;  3BP8 A;  3HHH A;  1O7L A;  4O5V A;  2L4A A;  4HF2 A;  2HKO A;  3WOD F;  4Q48 A;  3QOP A;  3RIR A;  4G7H F;  2XRO A;  5HLH A;  4HZF A;  3SZT A;  3DP7 A;  3GFL A;  3DEU A;  3R0A A;  3TO9 A;  1XDU A;  4ESF A;  1SMY F;  1F1Z A;  3BY6 A;  3HTS B;  3HHG A;  3TGN A;  3SFZ A;  3H92 A;  3VFZ A;  1FYM A;  4HYE A;  4N9H A;  1T6S A;  1Y0U A;  2QBY A;  1O57 A;  2P5L C;  2FNP A;  3RJP A;  2A07 F;  1ZG3 A;  3JSO A;  1PP7 U;  1VTN C;  1Z7U A;  1GVJ A;  5FFZ A;  5HLI A;  2ZFW A;  2RDP A;  2Z33 A;  2D45 A;  4NB5 A;  3ZQ7 A;  2AS5 F;  4R79 A;  3EQL F;  5HS8 A;  2DT5 A;  1XD7 A;  1FP1 D;  3SQN A;  3KEO A;  5CJ9 A;  3BPX A;  5E8I A;  5EEG A;  1P2F A;  3T8R A;  1G3T A;  4MGR A;  1EH7 A;  3D0S A;  4KFC A;  5IT9 Z;  5LRS A;  5ED4 A;  2FXA A;  3EDP A;  3JTG A;  3MZH A;  3PQK A;  2A3S A;  1MZB A;  3K1M A;  2L02 A;  4MTE A;  1T38 A;  4I02 A;  3NRV A;  2QEN A;  3WGG A;  1HKT A;  3FMS A;  4UNO A;  4IJA A;  4IVN A;  1XGN A;  5DCM B;  4M9Z A;  1UFM A;  1IXS B;  2EWN A;  2O6G E;  3RKX A;  1YW8 A;  1QZY A;  4I7H A;  5K1Y A;  4YII A;  5D5X B;  3RTR A;  4RGR A;  4KUM A;  1TTY A;  1HXD A;  3WTW C;  3HRS A;  3IC7 A;  5J8C A;  5FLX Z;  4FX0 A;  1HW2 A;  3KP7 A;  2EJR A;  3ZN0 A;  3RYP A;  2PMU A;  3TKY A;  1FWZ A;  4HQM A;  3I54 A;  2FBH A;  4M6X A;  2GA1 A;  1JXS A;  3E5Q A;  3GWZ A;  4R1H A;  1XN7 A;  6PAX A;  2LF8 A;  2PMH A;  3K9T A;  2VOO A;  1A04 A;  2K4J A;  3CTA A;  1IF1 A;  4BHP A;  1ZN2 A;  3WTZ A;  1R1V A;  1C0W A;  1XSD A;  5L3F A;  4L9N A;  1LDJ A;  4M71 A;  3WGH A;  1LDK B;  5CVJ A;  1S3J A;  2ZBK A;  4ETS A;  3V7R A;  2YX7 A;  4A0X A;  4U0V A;  3MWM A;  3RKY A;  2BBY A;  4Y17 A;  3J81 K;  4XSX F;  1W7P B;  2UZK A;  3WE2 A;  2P7C B;  1CGP A;  3JAM Z;  2QZ8 A;  2Z99 A;  3KZZ A;  5D6F A;  2VOD A;  1HKS A;  3QP5 A;  2CYY A;  1IN7 A;  3WU0 A;  3CUQ A;  4WWC A;  4G94 A;  1OKR A;  3QRF F;  2OU2 A;  2XV4 S;  2VC1 A;  4LLG F;  4GXO A;  1L0O C;  5ILS A;  3B02 A;  2IA1 A;  2KKO A;  4HDV A;  3BJ6 A;  2PEX A;  4UVA A;  1BC7 C;  3HYI A;  2OQG A;  2M30 A;  4U7B A;  4WXD A;  4KYW A;  2HYF A;  2WV0 A;  1U3E M;  2EV5 A;  3F21 A;  3Q5F A;  2FOK A;  3MAJ A;  3P9I A;  3CUQ B;  1ULY A;  4O3M A;  1UCR A;  4LK1 F;  2QQB A;  3ZPL A;  4XRF A;  2ZNY A;  4L18 B;  2XHK A;  2PQ8 A;  4XSZ F;  5CVI A;  2A68 F;  1Z91 A;  4QLC U;  2M1B A;  2V9V A;  1V3F A;  1O7F A;  4I2O A;  1JE8 A;  2QVO A;  3I59 A;  5E17 F;  3V8J A;  5A2Q Z;  1MJ9 A;  1V4R A;  3LA2 A;  3ROU A;  2BGC A;  1P6R A;  2O8X A;  3O6B B;  1QNT A;  3ML6 A;  1IXC A;  2HOE A;  2ZCW A;  2F5F A;  4GO1 A;  2MBF A;  2MA3 A;  4OIO F;  4U0W A;  2GQQ A;  1XMK A;  3DFG A;  3V8L A;  1D8J A;  2XGX A;  4KT5 C;  3V8K A;  3LQR A;  1W4M A;  3RDI A;  1SD4 A;  3I59 B;  3WTY C;  4ON0 A;  1XB4 A;  4UVC A;  4OU0 A;  3EYI A;  1BIA A;  5LHI A;  2XAQ A;  4HV5 A;  1SAX A;  3C3W A;  2FMY A;  2HEO A;  4RS8 A;  2C6Y A;  5F1R A;  4EV0 A;  1TQI A;  5E1Z B;  3G3Z A;  4MHG A;  2HR3 A;  1FY7 A;  3KCC A;  1ZG1 A;  1FZP B;  3OV8 A;  1F9N A;  2VBW A;  3KP4 A;  1U5T B;  4F7Z A;  1BI3 A;  2ETH A;  4CZZ A;  4IPA A;  1ZGA A;  5L3B A;  4MNU A;  1X3U A;  4HDU A;  1ZHF A;  1HSJ A;  2W25 A;  1J9I A;  2IP2 A;  2DK8 A;  2ZME A;  1O3T A;  4L9T A;  3HRU A;  3C1D A;  2DQL A;  2DW4 A;  3RPQ A;  2W84 A;  4WCG A;  3E6M A;  1ZYR F;  3HIF A;  3TDZ C;  2EB7 A;  3W6J B;  4ZZD A;  3C7J A;  4P9F A;  3LWF A;  1BC8 C;  1LJ9 A;  4HX7 A;  4OMY A;  3F8B A;  2OBP A;  1ZLJ A;  4AWX B;  3T0Y A;  1I6X A;  2ELH A;  2DK5 A;  3I4P A;  2GIV A;  4IRI A;  2XUB A;  2ZME B;  2HYG D;  1TW2 A;  2G7H A;  3FMR A;  4M74 A;  3CJN A;  2H6B A;  2UXX A;  3GZ6 A;  3GXO A;  1F4K A;  2Y75 A;  1H0M A;  2AXL A;  3MFK A;  3KLO A;  3U2R A;  2V1U A;  4G9Y A;  4IF4 A;  3K1N A;  2K02 A;  4O6J A;  4ZH4 F;  3SXY A;  3E97 A;  3T5X A;  1U6G A;  3GFM A;  4ZYG A;  1ONV A;  1FNN A;  2P5K A;  2L4M A;  5HDK A;  4ASN A;  2F5D A;  4GCV A;  4Y15 A;  5FLX K;  4JK1 X;  4N9I A;  1S6L A;  4MEY F;  1TNT A;  4N0B A;  1BM9 A;  2OA4 A;  1IRG A;  2XKO A;  4I09 A;  1RZ4 A;  3D5L A;  5LEJ A;  1WI9 A;  1TBX A;  2PG4 A;  3LAP A;  5CVR A;  4I01 A;  1LQ1 A;  1FBQ A;  2G9W A;  4CO8 A;  1IXR C;  1R7J A;  5IT3 A;  1RNL A;  3HSR A;  3JSP A;  5L3D A;  1Z05 A;  3GVA A;  2DAO A;  4I98 B;  3ZMZ A;  1HW5 A;  4L0Z B;  1MD0 A;  5DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...