2G9WA

Crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
119
Chain Sequence
b'KLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMAVLQRLAKKNLVLQIRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 37
structure length 119
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g9wA01
2DT5A 3LA2A 3BZ6A 1O7FA 3C1DA 4A6DA 1F4KA 4BYYA 1R1UA 1I5ZA 2LNBA 2JTVA 3S2WA 2QQAA 1R1TA 1IRFA 1O3SA 4IHSA 1HKQA 1BJAA 2MC3A 2WC2A 2OU2A 1HW1A 2JRTA 2A6HF 3C7JA 1KU9A 4M9SA 4BQAA 1U6GA 2XHKA 2W25A 4EM2A 4FHTA 3CUOA 2K86A 5JR3A 4BHBA 2HYFA 4XBFA 5KK1A 4LK0F 1BI3A 1LDKB 1STZA 4B09A 2P4WA 3HSEA 5LHGA 4KICA 4G7ZF 2CWEA 4WXDA 3VEPA 1XCVA 1S7OA 1U3EM 2YX7A 1OMIA 1JHHA 1QPMA 4MTDA 4CXFA 1U5TA 3RTRA 1QGPA 1J7KA 3WTXC 1GXPA 3KP3A 2GAUA 2M8EA 2BE5F 4L18B 1ZYRF 3OV8A 3QOPA 3ERED 3GZ5A 2XGXA 2A61A 2L4AA 3LSTA 4IVNA 1OKRA 2HOEA 1W7PA 2W57A 1REPC 4R79A 4M9XA 2ELHA 2PEXA 4WCGA 1O57A 5JHUA 2IT0A 4MNUA 4HQEA 2VODA 1MD0A 5DEQA 3L00A 3HSRA 2K02A 2HYGD 2P5VA 1H9TA 4HZFA 4OIOF 1XMKA 3BWGA 5F6FA 2L3DA 4I7HA 2VXZA 3H3ZA 1I1GA 2F5EA 1LDDA 2ZXJA 2Z9OA 2OZUA 4OMYA 3DF8A 2FMYA 3ZMVA 1F1ZA 3SXYA 1LEBA 3F3XA 3W6KB 3C18A 3COAC 3JTGA 2QUFA 2XROA 4UNOA 2PBIA 1UCRA 5LGNA 5LHHA 4GYGA 2D1VA 3WTUC 3I58A 5EEHA 1XSDA 3E6CC 2DPUA 1Y0UA 1FOKA 1PP7U 3PFIA 3ZPLA 4WWCA 3WGIA 4NHJA 1KA8A 2Z3YA 3BPVA 3EUHA 3I59B 2C6YA 1KU2A 2Z33A 2RVCA 3ECOA 1DPUA 2CG4A 3E5QA 3WTYC 2FE3A 4U0WA 1TQPA 2X0LA 3F72A 1WKMA 2LF7A 1T98A 2W24A 2FXAA 1HKTA 2XKOA 4KMUX 4P9UA 2MBFA 3EYYA 3GW2A 4RS8A 2GXBA 1IN6A 3QU6A 2XKPA 3GEZA 1G3TA 4KNYA 3SZPA 2RKHA 3T5XA 2MH9A 2JPCA 4I0AA 3RPQA 1FBSA 1MJAA 2ISZA 1TTYA 1G3YA 2YPRA 1U5TC 1YFHA 1IN8A 4PGHA 4EJTA 3IHUA 3GX4X 4U0YA 4G6QA 3E97A 5H6RA 3F6OA 5DYMA 3F8MA 2WV0A 3QAHA 5LRRA 4Q5SF 2QWWA 4HLXA 1D3YA 3E6MA 4UXNA 5JVTA 1U8RA 2HR3A 1UHWA 3NQOA 3WTWC 5TRDA 2YSRA 2E1NA 2D45A 5ICEA 1R22A 4HV5A 1XSXA 3KZZA 4KIFA 3J81K 4HDUA 4FX0A 4GGGA 4KT5C 2DPDA 4YG2F 3BJOA 3P9KA 3HYIA 4ZYEA 1LB2A 2EV5A 4N0BA 4LB5A 2X4HA 1FZPB 1BOAA 4M72A 4ASNA 1TW3A 3BOQA 4BNCA 1IF1A 1FP2A 3QRFF 4B8XA 5BPIA 3R4KA 3TQNA 5ICCA 3EDPA 1W5SA 3LA3A 1ON1A 3DEUA 3KEOA 1YS7A 2EJRA 1MKMA 3K1NA 3ZMTA 1ZG3A 2Q2EA 5IT9K 1KU7A 4HX7A 4BH9A 3FF5A 3HUGA 1XGMA 1SD6A 5CLSA 1AWCA 2UXNA 5ICFA 1OR7A 2KJCA 4RGRA 2KRFA 2QBYA 3E5UA 3HOSA 3LFKA 4KFCA 2ZMEA 1KQ9A 3KP5A 4RAZA 3IRRA 4N9HA 3J81Z 5LRSA 4UV8A 2XAQA 1T0FA 2BEOA 1RZ4A 1TLHB 2DLLA 3WODF 5J8CA 5D8KB 2UZKA 4AWXB 4EM1A 3F8BA 2CSOA 1XDUA 4P5OA 1LJ9A 2K27A 3MZYA 4H0EA 2XVCA 3DKWA 2DAOA 2UWMA 3BPXA 4EJUA 2Y0MA 1W7PD 3F8CA 2IA1A 3I71A 1S29A 2G7UA 1SMYF 4HYEA 1FYMA 2FNAA 2ESNA 2LDUA 1XMAA 4CYDA 3T8RA 5IT9Z 4O3MA 2IPQX 2QVOA 4HV6A 4P55A 2XUBA 1RUOA 1D5VA 2O61A 3WTZA 2VBYA 2DBBA 2ZFWA 3GWZA 2ESHA 2P5LC 3ECHA 4I0BA 4MQ9F 5LGTA 1USTA 2V1XA 1W4MA 4ZH4F 2D1HA 2EV6A 4UHTA 2FOKA 2WTEA 2DFIA 2P6SA 2EFPA 1I6XA 3U9GA 3QPTA 3J80K 5HLGA 4ENNA 2BBYA 4G94A 3P7NA 1U5TB 2D2WA 3DPLC 1HW5A 3RKYA 2JSCA 3I5UA 3GUDA 5DCMA 2VT3A 3CDHA 1HSTA 4IPAA 4TV7A 3U1DA 1HQCA 1K7AA 1W7PB 1XD7A 5E1XA 2A68F 1ZARA 2H6CA 1OYWA 1YTYA 4GYIA 1PUEE 2TDXA 4XRFA 4QLCU 4XLPF 2AXLA 3VFZA 4I09A 2F5DA 1ZAOA 2CO5A 2W85A 2PMHA 3BY6A 2EFNA 3LWFA 1ZRDA 1O7LA 1T2KA 2RNJA 1F9NA 4I98B 2V6CA 3R0AA 1ZG5A 1USSA 4F7ZA 3E3VA 5D4SA 2ZKZA 1L3LA 1GXQA 1SFXA 3ZMDA 4EJVA 1UFMA 1JE8A 1GVJA 4IF4A 3KETA 2HFHA 2BGCA 3J80Z 1EH7A 2H94A 2E7WA 2ZCWA 4Q47A 2FNPA 2CW0F 3O6BB 3F8NA 3CJNA 1CF7A 3QP6A 5LGUA 3V7CA 2H6BA 1G4DA 4EVIA 2OQGA 3LA7A 1ONVA 1R5GA 1FYKA 3V7SA 5BQTA 3WTVC 1ZG1A 3LQRA 2R7FA 1ZGAA 2Z99A 3FMQA 2A07F 2ETHA 3QPHA 3AAFA 4AD9A 4ENKA 1B6AA 2QM3A 5AIPA 3RKWA 2QQ9A 3T1BA 2Q8KA 1TNTA 3H3UA 4LK1F 2DQRA 4L5JA 2XAFA 1WQ2A 1TQIA 4IRHA 5H20A 4MEXF 2MLKA 1FBQA 1ZLJA 4L9VA 1HW2A 2STTA 6PAXA 3M1EA 4IRGA 2P5KA 3R0JA 4LG0A 1XGOA 4M6YA 5FLXK 2GIVA 1GHCA 3KZYA 3W6JB 2R7DA 1BN5A 1HKSA 3GZ6A 3WU0A 2NYXA 5E20A 4AVPA 4LLGF 2FBHA 5DDGA 3KLNA 1RNLA 4YFKF 1YW9A 2MA3A 3V4GA 2EWNA 4U7DA 4NB5A 4ESFA 5CVUA 3DP7A 3K1PA 2F2EA 3IWFA 3DQVC 1KU3A 1B9MA 5D4RA 3RYPA 2EK5A 1ZREA 1FC3A 1IRGA 4A0YA 3RPUA 5KVRA 5HOOA 4P96A 2FEZA 1RI7A 2JZYA 5TJJA 4Y13A 3NRVA 3ISPA 1MJ9A 4G7OF 1HXDA 3ML6A 1IN4A 3DV8A 1FWZA 1KGSA 3TKYA 4QWQA 1DUXC 3V7RA 2UXXA 4G8XA 1P4AA 4OIQF 3CO6C 2HEOA 1ODDA 1OYYA 2RDPA 2DW4A 3I64A 2ZO4A 3HSFA 4CHUA 1S3JA 4EM0B 5ILUA 4AIKA 2COMA 3CO7C 2V1UA 3M9AA 5FLXZ 2OA4A 1BI0A 4HBLA 3KE2A 2PMUA 2XAHA 4JK1X 2PI0A 2HTJA 5HDKA 2O6GE 1XSVA 3GFLA 3JSOA 3MAJA 1D8JA 1X3UA 3MWMA 1DDNA 4UVBA 4ESJA 4WK8F 2QBYB 4EJWA 2VE9A 3BJ6A 1KYZA 1A04A 2Y75A 4EGYA 3N97A 3HTSB 4A12A 2QLZA 2ZMEB 5HS7A 2FSWA 2BV6A 2VBXA 2M87A 2VOPA 4WXCA 3JW4A 1O3QA 1TNSA 1FYLA 1R00A 4RB0A 3IRQA 2LF8A 1FBUA 1FX7A 4ENJA 3CUQA 3BROA 4PDKA 3F6VA 4BAYA 3K0LA 5K1YA 3SQNA 4IRIA 1H9GA 2GXGA 4HF0A 1IW7F 1MDMA 2FMLA 3ZQ7A 4BHCA 2HZTA 5FD6A 3KP7A 1G6NA 3FZVA 3MEXA 3M8FA 1YLFA 3RKXA 3M8EA 5D5WB 3E6BA 1K78A 3R6SA 1XGNA 2E1CA 2EFOA 3RI4A 4FX4A 3GFIA 5HS8A 2ACJA 4OINF 1WRJA 1QO0D 3B73A 2ADUA 2XRNA 1EH6A 1ZLKA 2G9WA 2J5PA 5BMZA 5ED4A 2FA5A 1IXCA 4IHTA 2K4BA 1L0OC 2DU9A 3TOAA 2VONA 5D5UB 3GXOA 3HHHA 2F5CA 3RYRA 1UB9A 3NEUA 2WWYA 4KN4X 2IW5A 1J2XA 1BC7C 3IC7A 4OMZA 1SMTA 1B1BA 1R5HA 2FF4A 4U7BA 3L2CA 5HLHA 2XV4S 4M73A 1BIBA 1Z7UA 5DCMB 4XLNF 1F5TA 2VOOA 1Q1HA 4HX4A 5HS9A 2OQRA 1I1SA 4O6JA 2O8XA 4E70A 4M74A 2HKXA 3MFKA 4GO1A 4N9IA 1O3TA 3DFGA 3SHFA 5BS6A 4AIJA 1MJBA 2OAZA 2STWA 2YU3A 4UVAA 3ZN0A 4RGXA 2EFQA 2A3SA 2FBIA 1R23A 2CYYA 2A5YB 2ISYA 2L54A 1JGSA 1ZH5A 2DTRA 3T0YA 3V8KA 4CDGA 4M6XA 2HKOA 4CZZA 2E7XA 2EV0A 2R3SA 1YS6A 3CUQC 1BI2A 1FT9A 5EEGA 5FGMA 1Z91A 5L3BA 1S6LA 3E5XA 4L5IA 2B0LA 4A0ZA 4O5VA 3ZN1A 1V4RA 1CF7B 4KIGA 5D5VB 4KN7X 4MEYF 3K2ZA 2V1DA 3HHGA 4PGGA 1QZYA 2M45A 4Z2YA 4HF1A 1YYVA 1FLIA 3ELKA 1ZHFA 4JQFA 3D5LA 2A6EF 2Q0OA 3LAPA 2GWRA 1P6RA 2XASA 4S05A 1MGTA 3D0SA 2HQRA 2MLGA 2MH2A 2DQLA 1J0RA 1FY7A 2IJLA 2IRFG 1R36A 4I01A 1Z9CA 2QQBA 1R58A 1PP8F 1SFEA 3FX3A 1QZZA 3GF2A 3IKTA 4ZZLA 2IP2A 1XB4A 3WE2A 1BM9A 5K5OA 4LG0B 1K79A 5ICGA 1HSJA 2XAJA 3P9CA 1YO5C 3FHZA 4HF2A 1EH8A 4YFXF 3P9IA 4MHGA 2F5FA 4WXHA 4PZJA 3FWEA 1FSHA 4OIPF 3E6DA 1I27A 4RB2C 3O2PE 3FM5A 5D6FA 2P7CB 1YIOA 3FMSA 3TO9A 1ZN2A 5CVRA 5LBQA 2ZNZA 3PQKA 4EMSA 5BOXA 4M71A 1J75A 4KMFA 1CGPA 1R1VA 4U0VA 2LSOA 2O3FA 4ZYDA 1J59A 2M1BA 2DK5A 1RIOH 5E1ZB 5LEJA 3EETA 4RGSA 2G7HA 1YW7A 2KKOA 1D8KA 2FU4A 3WTTC 2YR2A 4ZZDA 1ZRFA 3K69A 4EV0A 1TBXA 1QBJA 1UHMA 3ABUA 1B59A 4UV9A 3FXRA 3GO5A 5E8GA 4L9JA 1FP1D 2HGCA 2KIMA 1V3FA 4G6DA 3OOPA 2GQQA 4A6EA 1WWXA 1VTNC 4GCVA 3HRTA 1SD7A 3C3WA 4K2EA 2NAZA 1G3SA 3DPTA 4HLYA 4A5NA 5J6XA 2ZJ2A 5HDNA 1XCBA 3WTSC 1NHAA 1T39A 2W84A 3FXQA 4L0ZB 4KUMA 1R7JA 1YW8A 2CFXA 5ILSA 2OBPA 4G9YA 2ZNYA 4A5MA 5D8LB 4HDVA 4IXAA 3CLOA 2RN7A 3IL2A 2VBWA 3FMRA 3IWZA 5FFZA 2MD5A 5FD5A 3CUQB 5LHIA 1K6OA 1Z05A 3TO7A 3HRMA 1S7AA 3KCCA 5BPDA 4LJZF 5E17F 4OIRF 3HTUA 1MDMB 1KYWA 3TDZC 1IXRC 4RB3C 5K5QA 2O0YA 3U2RA 1IZ1A 1O3RA 2L01A 1TQMA 3WU1B 1T38A 3ULQB 1K78B 4P9FA 2HWVA 2AS5F 4L0YB 4U88A 5HLIA 1U2WA 3GFMA 2BYVE 4LLLA 5L3CA 1OPCA 5IT3A 4AIHA 3F8FA 2PLYA 2QZ8A 4L9TA 2V79A 4Q4ZF 4R8HA 5L3EA 5AONA 3WGHA 2O03A 4MGRA 3I4PA 4KIBA 4YIFA 5HVQC 4CICA 2Z5UA 1YQAA 3Q5FA 4OOIA 1QNTA 2IA2A 3TDUC 4S04A 3T8TA 1TW2A 4LLNA 4ZYGA 3MZHA 4ESBA 3QP5A 5DV5A 3JSPA 4WF2A 3BDDA 1ZRCA 1JXSA 5ERIA 4M9ZA 3LQQA 1U78A 3K1MA 4BHPA 2NNYA 1P2FA 3HOTA 1DP7P 5FB2A 2L02A 4YIIA 2GA2A 2VN2A 3B02A 4Q48A 2DK8A 4GXOA 1P4WA 4FT8A 2XIGA 3I54A 3WE3A 4ZYHA 3Q9VA 4L9NA 2YX4A 3DXJF 2FQ3A 3WGGA 2IVMA 3G73A 4LB6B 3KEQA 1FPQA 1RUNA 2CGPA 2HS5A 1H0MA 2QYOA 1BIAA 2JT1A 3K9TA 3J7AO 3PQJA 1QQIA 4DNCA 5LEKA 3TOBA 1C0WA 4UVCA 3KP2A 4KDPA 2L4MA 1ZGJA 2ZBKA 5DD4A 5H6QA 4RAYA 2FBKA 4LGWA 3V8JA 2J5OA 1IXSB 5CVJA 2KJBA 4A2UA 1LNWA 3VOEA 3EYIA 3KLOA 1SD4A 4Y15A 3F22A 5JI6A 3TGNA 1MZBA 3ABTA 4LD5A 3ZMUA 5CVIA 4ON0A 1XGSA 3MCZA 1WSUA 5CYVA 2HDCA 4HAMA 1XN7A 4RB1A 2EB7A 2V9VA 1Z1DA 2OZ6A 2PN6A 4RGUA 1BI1A 5F1RA 2PJPA 4HOBA 1ON2A 2RV8A 2VBZA 4ENMA 2NS0A 1Z6TA 2DO7A 2A69F 4BXUA 3ZMZA 5DUIA 1JHFA 3GLXA 4PCQA 5FFXA 1YG2A 1FNNA 1G3WA 1T6SA 1KQ8A 3GFJA 2P6TA 3L7WA 4UUVA 2PQ8A 2EFWA 4MTEA 3N4MA 3LAJA 3G3ZA 3KFWX 2M30A 4XSXF 5CVVA 3I59A 3H92A 2CQKA 1EV7A 3L09A 4EQQA 1HBXG 1B4AA 3O3KA 1J5YA 5L3DA 3JTHA 3KP4A 5DUKA 1IUYA 5DD8A 4LFUA 4KA4A 3MQ0A 1E2XA 5JFRA 1SFUA 3Q9SA 2FRHA 5A2QK 2VT2A 4I2OA 2HTSA 5CJ9A 5D6EA 1AOYA 2HQNA 3I0TA 1LDJA 2GZWA 2JPBA 3RJPA 3RIRA 4XSZF 2DI3A 3I53A 4I02A 4EGZA 1FSEA 3CTAA 3WG9A 2P8TA 1IAWA 1PDNC 4A0XA 5AIQA 1S8NA 3IKVA 5LLQA 2GA1A 4Y17A 2PG4A 3F23A 5ILVA 4HW0A 4OU0A 3TO6A 5DCFA 1BBYA 4R1HA 4HX8A 3HRSA 4LMYA 3ZMSA 1KQ0A 5J8FA 4EJOA 5D5XB 5F64A 1B9NA 3EQLF 1IN5A 2EA4A 3HRUA 3R61A 4HA8A 3FM3A 3QU3A 1SAXA 2RC4A 2H09A 5L3GA 3SFZA 1SD5A 3FXUA 2K7LA 3JAMK 2KIUA 2XAGA 5L3FA 4YFNF 1LEAA 2EA2A 1P92A 4D0PA 3F21A 3SZTA 2IA0A 4CGZA 5A2QZ 4JBAA 1DPRA 5K5RA 3V8LA 1LQ1A 1BC8C 3GYHX 3HIFA 2M5WA 3BJAA 5HDGA 4NQWA 3ROUA 3ZP5A 3KP6A 2PFBA 1OYIA 4WX9A 5FO5A 2H27A 2LKPA 1P4XA 4HQMA 2P7VB 1Z6RA 4G7HF 1J9IA 1ULYA 2K4JA 3M7GA 2QENA 4ETSA 5E8IA 3BP8A 5E18F 4IJAA 4DQ2A 1IN7A 2VC0A 2VE8A 2NRAC 2VC1A 1E17A 2KIFA 4CO8A 2NNNA 5E1WA 4MQVA 3GVAA 3JAMZ 3R60A 1XDSA 1W5TA 3RDIA 4KYWA 2OD5A 3VB2A 3VODA 1WI9A 2RQPA 2RGVA 3REOA 1LVAA 2Y48A 3L9FA
chains in the Genus database with same CATH superfamily
1F36A 2DT5A 3LA2A 3BZ6A 5FJ8J 3M3YJ 1BJZA 1O7FA 3K4LA 5F0HA 3C1DA 2QA4I 3TW6A 5TISC 2QCOA 4A6DA 2CQXA 1LUJB 2DMQA 2IBDA 3C2HA 1F4KA 1EF4A 4BYYA 3HPGA 1R1UA 1R49A 4RAGA 2ME6A 3OL4A 1I5ZA 2LNBA 3ABKH 2JTVA 2K9SA 1JT0A 2LY2A 2Y0SA 4PJJA 3S2WA 1MSEC 2QQAA 1DU0A 1R1TA 1IRFA 1O3SA 4IHSA 4IHVA 2EH3A 1HKQA 1BJAA 1NTCA 2MC3A 2DDAA 4DYQA 4RAFA 2WC2A 4XKBA 2OU2A 1HW1A 2JRTA 2A6HF 1IRZA 1VQNI 3C7JA 1KU9A 3BR5A 4M9SA 1GV2A 1S72I 4BQAA 3M07A 3OSGA 4F3QA 1U6GA 3H3VK 2XHKA 2W25A 4EM2A 4FHTA 1WGXA 3CUOA 2K86A 4IEJA 2E60A 5JR3A 4BHBA 2HYFA 4XBFA 5KK1A 4LK0F 1BI3A 5IP6A 1LDKB 4PJ0C 1STZA 3A2KA 4B09A 2P4WA 3BG9A 3HSEA 5LHGA 3HL2A 4KICA 4G7ZF 2XB0X 2CWEA 1GLNA 1I3QJ 4WXDA 3VWBA 1AKHA 3VEPA 1XCVA 1S7OA 3LOCA 1U3EM 4Y4RA 5H2FC 2YX7A 1OMIA 1X4OA 2M0MA 2X6XA 1JHHA 1QPMA 4MTDA 1W0TA 1BA5A 4CXFA 3CCUI 1U5TA 3RTRA 2XB5A 3HEFA 3CCJI 1QGPA 2HDWA 1J7KA 3WTXC 1GXPA 2M3AA 3ZXSA 3KP3A 2LR8A 2GAUA 1A6IA 4BUPA 2M8EA 2BE5F 4L18B 1ZYRF 2E34A 3OV8A 3QOPA 3JREA 3GZ5A 3ERED 2XGXA 4CSWA 2A61A 2L4AA 5GADJ 2GOXB 3LSTA 3TL4X 5EJCA 2DJNA 5DTDA 2IGNA 4IVNA 1BR1A 4J00A 3SJMA 4BBRJ 3PO3J 1OKRA 2HOEA 1W7PA 2EIMH 2W57A 1REPC 2EZHA 2E36A 3VYTB 3FISA 4FASD 4M9XA 4R79A 4LG3A 4DOZA 2ELHA 3BC8A 3HC7A 3OOUA 2PEXA 4WCGA 1O57A 5K7FA 5JHUA 2B9SA 2IT0A 1RKWA 4B3XA 5GAGJ 2UV1A 3HOUJ 4MNUA 5F0CA 3JRAA 4HQEA 2VODA 2W00A 1OLTA 1MD0A 4IX7A 5DEQA 3L00A 3HSRA 2K02A 2HYGD 3GTOJ 2P5VA 3RCOA 1H9TA 4HZFA 3MKZA 4OIOF 1XMKA 4E7JA 3CF5F 3CJQB 3BWGA 5F6FA 1X3WB 2L3DA 4I7HA 2IXSA 2VXZA 3H3ZA 3S1MJ 2E5NA 1I1GA 3CCYA 1TWCJ 3MKYB 2F5EA 2OCEA 1LDDA 2ZXJA 3CZ6A 3DBHB 2DMTA 3QPSA 1T8IA 1LVKA 1E3OC 2Z9OA 3S16J 5FKNA 5C3EJ 2OZUA 2XSJC 3DF8A 4OMYA 2WAQA 2ZSIB 2FMYA 2KIQA 3OYFA 2Z1DA 3ZMVA 3HB9A 1EJ9A 1F1ZA 3SXYA 3OYKA 1LEBA 1CQTA 1BR2A 3F3XA 3FHNA 1MBFA 3W6KB 3ZQHA 3C18A 3COAC 3JTGA 5DM7F 2BVLA 2QUFA 2XROA 1VQ7I 4UNOA 2PBIA 4E7ZA 3CESA 1UCRA 5LGNA 5LHHA 4GYGA 2FX0A 1IDYA 2D1VA 3WTUC 4B43A 3I58A 5EEHA 1XSDA 3E6CC 2DPUA 2LC2A 1Y0UA 1VQ9I 1FOKA 1PP7U 3ZGKA 1YE9A 3PFIA 4XN3A 3ZPLA 2ZB9A 4WWCA 5FKOA 3WGIA 2OTLI 4NHJA 1MMSA 1KA8A 2CJJA 1QVTA 2Z3YA 3BPVA 1HDDC 3EUHA 3PUFA 3WHCA 5HNFA 3I59B 2C6YA 1KU2A 3FIWA 4F91B 2Z33A 2RVCA 2R93J 2W1OA 1Z77A 2WBMA 3ECOA 2CG4A 3E5QA 1DPUA 3IH3A 3WTYC 2HVRA 2FE3A 4XOPA 3IAS2 2YU9J 3FXOA 3TW7A 4U0WA 1TQPA 3FBNB 2X0LA 3A03A 3ERMA 3F72A 1WKMA 2LF7A 3GLLA 1T98A 2W24A 2FXAA 1HKTA 2XKOA 4BL0B 4KMUX 4W1UA 4P9UA 5EZHA 4ZDOA 2MBFA 3EYYA 3FXMA 3GW2A 2WY8Q 1G8XA 1JI8A 1TWAJ 4RS8A 5DS9A 1TWFJ 2ID6A 1PVEA 1QHHD 3ESWB 1OCPA 3HZJA 2GXBA 1IN6A 5KAIC 4B1RA 5IOYA 4IZZA 3M1CA 3S3MA 3QU6A 2XKPA 3GEZA 1G3TA 4KNYA 3SZPA 4A3MJ 3BT9A 2ZJPF 5DM6F 2A05A 4NC8A 1TWGJ 2RKHA 1BR4A 2AHQA 1P7JA 3T5XA 2MH9A 2L7KA 4PK4A 2JPCA 1V5GA 4J01A 4I0AA 2HOSA 3RPQA 1FBSA 1MJAA 2LMDA 2ISZA 1TTYA 2NS7A 1G3YA 4BEHA 2YPRA 1U5TC 2YS9A 5M5XJ 1YFHA 1IN8A 4PGHA 2W7NA 4EJTA 3IHUA 3DBLB 2LD5A 1AA7A 3GX4X 4U0YA 4ABZA 4S0HB 3LSPA 1RR8C 2OTJI 2Y9YA 4G6QA 1KZHA 3A02A 3E97A 4FCYA 5H6RA 2DA4A 4X6AJ 2AO9A 2LBFA 1VQOI 1FMVA 3F6OA 2KZVA 5DYMA 3F8MA 2WV0A 3QAHA 2XPVA 5LRRA 5LD2C 4Q5SF 2QWWA 4U87A 4HLXA 1D3YA 3E6MA 4UXNA 5JVTA 3OIQA 1U8RA 2DFFA 3BR3A 2HR3A 2VB6A 2RQQA 1ETXA 2F4OB 3SZGA 5M3MJ 1UHWA 3NQOA 3WTWC 5TRDA 4FISA 4QTRA 2YSRA 2NXNB 2E1NA 3OS0A 4BE2A 2D45A 5ICEA 1R22A 4HV5A 3H35A 1XSXA 3GTKJ 2WAFA 3KZZA 4KIFA 3J81K 1T08B 4HDUA 4II3A 4FX0A 3GTMJ 4GGGA 4W97A 4KT5C 3JRFA 1RPWA 2CUFA 3SDGA 2LY9A 3BJOA 4YG2F 2DPDA 3P9KA 3DBRB 3HYIA 4ZYEA 2VPLA 5EG0B 4AYBN 5B3SH 1O4XA 3OYGA 1LB2A 2EV5A 4N0BA 4LB5A 2Y30A 2BVMA 4C3JJ 2X4HA 1FZPB 2WA0A 1FOYA 4C30A 1BOAA 4M72A 4ASNA 4DYRA 1TW3A 3BOQA 4BNCA 1IF1A 1FP2A 4F52A 2VLAA 3QRFF 4B8XA 1IGNA 5F0FA 3D1NI 2XPWA 2IAIA 5BPIA 1OCOH 3I3LA 1BW6A 2B7EA 3R4KA 3TQNA 1HC8A 5ICCA 3D5RC 4NQWB 1YJWI 3EDPA 1W5SA 4KJZA 1YJNI 3LA3A 2IS1A 1ON1A 3DEUA 2L7ZA 4LIVA 3S14J 3KEOA 1YS7A 3V42A 2HZDA 3SEQA 3KX2A 2EJRA 4BXFA 1MKMA 3K1NA 5IOZA 3CQZJ 2JWTA 3ZMTA 1ZG3A 2Q2EA 5IT9K 3EUHC 3AG1H 1KU7A 1ETQA 1JUPA 2EZLA 4HX7A 4BH9A 3HKZA 3FF5A 3HUGA 4BE0A 1XGMA 1SD6A 5CLSA 4A3LJ 1MW7A 1IO2A 1AWCA 2UXNA 5ICFA 2O5RA 1OR7A 2KJCA 4RGRA 1JKRC 1B8IB 1E0EA 2DFEA 3A01B 2KRFA 4CCKA 1MBJA 3OYNA 4D9JA 2X48A 2K5CA 2QBYA 3E5UA 2WADA 3HOSA 3LFKA 4KFCA 2ZMEA 2EQRA 1KQ9A 3KP5A 2GOMA 4RAZA 4UY8I 3IRRA 4N9HA 3Q0VA 3U1KA 3VYRB 5JVGF 2Q1ZB 4LOCA 4A3EJ 3J81Z 5LRSA 1Y0NA 3HPHA 4UV8A 2XAQA 1T0FA 2BEOA 3UNGC 4YRVA 1RZ4A 1TLHB 2DLLA 3WODF 2F4MB 5J8CA 2V26A 5D8KB 2UZKA 2V6EA 4AWXB 4EM1A 1X1PA 3F8BA 3FBIB 1TL8A 3QOEA 2F5VA 2CSOA 2QKMB 3HOXJ 1XDUA 4P5OA 1LJ9A 2K27A 3MZYA 5FRMA 3CC4I 4H0EA 1WJEA 2XVCA 3DKWA 2MC4A 2TRTA 5FLVA 4DGWB 5EEAA 4D5FA 2DAOA 2UWMA 3BPXA 2NS8A 3PO2J 4EJUA 1SAUA 2Y0MA 1VQ5I 1ZK8A 3CJRB 2XDVA 3CCEI 4GRIA 1W7PD 3F8CA 4J19A 2IA1A 3LSIA 2LOOA 3I71A 1S29A 2V7FA 2G7UA 1SMYF 4HYEA 3OYAA 3CP8A 1JJ8C 3OS2A 1FYMA 2FNAA 2DCEA 2ESNA 3PUBA 3BLYA 5E3MA 2KL4A 2M4KA 3KIOA 3PSIA 3ZQGA 2E2JJ 1YI2I 3OY9A 2LDUA 2EIKH 4PUSA 1XMAA 4CYDA 3T8RA 1B72A 4HPQA 5IT9Z 4O3MA 2IPQX 2QVOA 4HV6A 3LSRA 2NVYJ 2DXIA 4P55A 2XUBA 1RUOA 1JUSA 2X6WA 1D5VA 2DA2A 2O61A 3WTZA 2VBYA 3HG9A 2DBBA 2ZFWA 4XIDA 4IHWA 2X6OA 2LRDA 3GWZA 2ESHA 1YOVB 2P5LC 3CDLA 2UUZA 2K9QA 3ECHA 4I0BA 4ZDPA 4RM2A 1VQ4I 4MQ9F 2CUEA 5LGTA 1LFPA 1USTA 2V1XA 1W4MA 2GXAA 3ZR8X 1YRNA 2ECCA 2D1HA 2EV6A 5JLXA 4UHTA 4ZH4F 3KYLA 1UHSA 3QODA 4AIDA 5EYRA 2FOKA 2WTEA 2DFIA 2P6SA 2H8RA 2EFPA 1I6XA 3MVPA 1E3HA 2LK2A 3U9GA 4E7SA 2JUCA 1LE8A 3QPTA 1AKHB 3J80K 1DQUA 2DFHA 5HLGA 4ENNA 2BBYA 4IQ4A 4G94A 3CJTB 3P7NA 1U5TB 2D2WA 2E71A 3DPLC 1HW5A 3RKYA 4A3DJ 4X0GA 2JSCA 2L7MP 3I5UA 3GTJJ 4NC6A 1NK3P 5J1YA 2BW3A 1W0UA 3GUDA 3L2QA 5DCMA 2R7SA 3CMYA 2VT3A 3CDHA 1HSTA 3OSFA 4ZJZA 1TT0A 1M1EB 4IPAA 4TV7A 3U1DA 4DW6A 1HQCA 1K7AA 3K4MA 1W7PB 1XD7A 5E1XA 2A68F 1ZARA 2H6CA 4JX4A 1OYWA 1YTYA 4ZC3A 4GYIA 1PUEE 1RETA 2TDXA 2BOLA 3S3NA 4XRFA 4QLCU 1OR7C 1X1AA 2DT6A 5IY5H 2AXLA 4XLPF 4AC0A 2KPMA 3BTJA 4HSTA 4YEJA 3VFZA 4I09A 2F5DA 4MIMA 1ZAOA 2CO5A 5M5YJ 2W85A 5KNLA 3G4SI 2CW7A 2PMHA 2ZJQF 1D1BA 2JUGA 2ZMEC 3BY6A 2EFNA 2E5ZA 2M34A 2V1NA 1JTXA 1ACIA 2IGKA 3LWFA 3DU5A 1ZRDA 2DA7A 5F08A 5EZGA 2PMZA 1O7LA 1T2KA 2RNJA 1F9NA 3RZDJ 4I98B 4IO9F 2V6CA 4DBQA 3R0AA 2EILH 1ZG5A 4JX6A 4PJMA 1T0FC 1USSA 4HSRA 4F7ZA 3E3VA 1G59A 4XRSG 5F04A 2ZKZA 4BY7J 5D4SA 1L3LA 1GXQA 4BGDA 3JCUC 1SFXA 3QYBA 3PIPF 5EF6A 2R5YA 4A3JJ 3ZMDA 4EJVA 1MMNA 4BKXA 1UFMA 1JE8A 1BL0A 1GVJA 1AU7A 1S7EA 4IF4A 5C44J 3KETA 2HFHA 2L9SA 2BGCA 3J80Z 2ZXIA 1EH7A 5CPRB 2H94A 2E7WA 1OCCH 3PNTA 2ZCWA 3G2BA 3L2UA 3AG3H 4Q47A 2FNPA 2CW0F 3CLQA 3O6BB 3SEZA 1Z0XA 2R7VA 3F8NA 4DZJA 3CJNA 1A6QA 2M9HA 2QQ8A 1CF7A 3QP6A 2F4IA 5LGUA 3V7CA 2H6BA 1G4DA 1JKOC 2FJ1A 2GIZA 4EVIA 2BZTA 3CMMA 2OQGA 3P5JA 2RAEA 1S5LC 3LA7A 1ONVA 3H0DA 4RLFA 1JKQC 1R5GA 2R7WA 2HDDA 1FYKA 2V4JC 1IJWC 2D5VA 3V7SA 4LIUA 5BQTA 5LFAA 4AVZA 3WTVC 1ZG1A 1ZELA 1MBHA 2KHMA 5KHDA 3LQRA 5B5EC 3PFYA 4CCJA 2R7FA 1ZGAA 2Z99A 2R4GA 2VL8A 3FMQA 2ETHA 3QPHA 1R71A 2A07F 3ZRGA 2KDZA 4BDZA 3AAFA 3HGYA 4AD9A 4ENKA 1B6AA 2QM3A 5AIPA 1X1BA 2M2EA 3AFHA 2R5ZA 4IL6C 3RKWA 2QQ9A 4C3HJ 3T1BA 3J7AY 4NUBA 1TNTA 3H3UA 2ZFUA 4LK1F 2DQRA 4L5JA 2Q8KA 2K3PA 2XAFA 2X6YA 4BS9A 1WQ2A 2CMPA 1R5ID 4I6ZA 3HM5A 3SYTA 4DZPA 4N4NB 1TQIA 1FMWA 4JYKA 4IRHA 5H20A 4BACA 4X1EA 4MEXF 3TBIA 1XG1A 2MLKA 1I50J 1X2NA 1FJLA 2E19A 1FBQA 1ZLJA 2XGCA 4L9VA 1HW2A 4BEHB 2STTA 6PAXA 1WH5A 3M1EA 4E7LA 4IRGA 1JUMA 2Y31A 4RBOA 2P5KA 3R0JA 4M3DA 4CA0A 2FUG2 4LG0A 1XGOA 4QPOA 4M6YA 5FLXK 3ABLH 2H8WA 3OMYA 2GIVA 1GHCA 3KZYA 1FIPA 1Y39A 2X51A 4CCMA 3GTGJ 3H5AA 3O8HA 2CH0A 3W6JB 4B44A 1WJ5A 4NNJA 2R7DA 1BN5A 1HKSA 2ZC2A 3FK7A 2DN0A 3GZ6A 2LBFB 3WU0A 2NYXA 1MIJA 5E20A 4AVPA 2VJ5A 4M3EA 5K7ZA 1YJ9I 1FOXA 1ZR4A 2R7ZJ 4LLGF 2FBHA 5DDGA 3KLNA 1RNLA 4II2A 4YFKF 1YW9A 2MA3A 3CCRI 1PYVA 3S1NJ 3V4GA 4C2MJ 2EWNA 1IC8A 1UAAA 2QSGX 3VYSB 4XK4A 4U7DA 4NB5A 3A0HC 2WB1A 2K85A 3U21A 4ESFA 2QKLB 5KAFC 1GUUA 2JA8J 5CVUA 4PFPA 2M8GX 3DP7A 3K1PA 2F2EA 2JQ7A 4XQFA 3K4BA 3IWFA 2GM4A 3DQVC 1KU3A 1F43A 1B9MA 4I76A 1XC5A 3FKIJ 3BTCA 4FTHA 1QU3A 5D4RA 3RYPA 3S2DJ 2BY1A 2HXIA 2DA1A 2EK5A 1ZREA 1HF0A 1FC3A 2EIJH 1IRGA 4A0YA 1MMDA 3RPUA 3DCFA 2OV7A 3OYCA 3LSJA 3OWTA 1I3AA 3ZQIA 4DYCA 5KVRA 3QQAA 5HOOA 4P96A 2FEZA 1RI7A 2JZYA 5TJJA 4Y13A 2IS6A 3BZCA 3NRVA 3ISPA 5J47A 1JJ6C 1MJ9A 4G7OF 1HXDA 1T33A 3ML6A 1IN4A 3DV8A 1H89C 4CCLA 1FWZA 1KGSA 3S93A 3TKYA 4XLFA 4QWQA 1DUXC 3V7RA 2UXXA 4G8XA 4BY1J 1P4AA 1SEUA 3CO6C 4OIQF 1MBGA 5B1BH 1D5YA 2HEOA 3BG6A 1ODDA 1OYYA 2B63J 2RDPA 1DGWY 1T56A 1ENHA 1U0JA 2DW4A 2HI3A 3EUAA 1ZTRA 4DIQA 3I64A 3K70D 2W82A 2I8DA 2ZO4A 3HSFA 4CHUA 1S3JA 3B6CA 4EM0B 1A5JA 5ILUA 2FOWA 4AIKA 2COMA 2K9NA 3CO7C 3M9AA 2V1UA 1ETVA 5FLXZ 2OA4A 1BI0A 2KP6A 2Q2EB 2FD5A 4HBLA 4AUXA 3BG7A 2O9LA 5KCMA 3KE2A 2PMUA 3HDDA 1EA3A 2XAHA 4JK1X 2PI0A 5GTIC 2HTJA 5HDKA 1WFXA 2O6GE 1XSVA 3D5SC 3HUGB 1LFBA 1WZ2A 3GFLA 3JSOA 3MAJA 3M4OJ 4NC7A 3OR1C 3HXLA 5GPAA 2EZIA 3ZQLA 4HNUA 4IHYA 1JTYA 1D8JA 4JX5A 1X3UA 3MWMA 1DDNA 2TCTA 3TP0A 4UVBA 3C2BA 1W5CC 1Z3YA 5FKMA 4WK8F 4ESJA 4EJWA 2VE9A 3BJ6A 2QBYB 4I99C 1KYZA 1A04A 2Y75A 4EGYA 3N97A 3HTSB 3JR9A 4A12A 2QLZA 2ZMEB 4H4KC 4XKVA 5HS7A 1RC9A 3GBGA 2BXYA 3K4KA 3OYHA 2FSWA 2BV6A 4D7MA 4CYCA 2VBXA 2NOJB 2M87A 1WJCA 2VOPA 4HRIA 4WXCA 1Z7LA 3JW4A 3CMEI 1TNSA 3BQYA 1O3QA 2HU9A 2VQCA 1FYLA 5FKKA 2LYCA 3QWLA 2R92J 1SVOA 1BOBA 1R00A 4RB0A 2R7RA 4ZTFA 3IRQA 2LF8A 1FBUA 1X3ZB 3GCMA 5GPCA 1FX7A 2HVQA 4ENJA 3CUQA 3BROA 4D5CA 4RA2A 4PDKA 3F6VA 3H9QA 1K4TA 4BAYA 3K0LA 5K1YA 3SQNA 4IRIA 1V55H 2VQHA 3PM1A 1H9GA 2GXGA 4HF0A 3ONQA 1VQPI 1IW7F 2LY1A 1MDMA 2FMLA 1ZR2A 3ZQ7A 4BHCA 1K6YA 2HZTA 3SDBA 1IG7A 5FD6A 3JRIA 3KP7A 3C2GA 1P9QC 1G6NA 3FZVA 1Z3XA 3M8FA 3MEXA 1YLFA 3RKXA 2VKEA 4RM3A 3VDXA 3M8EA 2XAUA 5D5WB 3W6VA 3E6BA 3G71I 3Q0WA 3PL8A 2OF7A 1MNEA 1K78A 1B72B 2JK3A 3R6SA 1XGNA 2QGUA 2VJJA 2VQGA 3SFIA 2E1CA 1IV8A 2EFOA 3RZOJ 2DOAA 3RI4A 1MNMC 3MKLA 4FX4A 3GFIA 5HS8A 2ACJA 3HJEA 1OCTC 2RNGA 4UB8C 4OINF 1WRJA 1QO0D 3B73A 2ADUA 2XRNA 4XKCA 5C4XJ 1EH6A 2DOEA 1YHQI 1ZLKA 2FQ4A 3F0CA 2XF7A 1GV5A 2G9WA 2J5PA 5BMZA 4HEA2 5ED4A 1WJDA 2FA5A 1V5EA 4XONA 4AU7A 3L2RA 1IXCA 1YRNB 4IHTA 2K4BA 1A35A 1L0OC 4AM3A 2DU9A 3WG7H 3TOAA 2LLKA 2VONA 3KZIC 5D5UB 1N78A 1X4PA 3FDYA 2KRHA 3GXOA 3HHHA 2F5CA 3LSGA 3FXKA 1LE8B 3RYRA 1UB9A 3NEUA 2WWYA 1QPIA 4KN4X 2IW5A 1J2XA 3F9KA 1BC7C 1SC7A 3MN2A 3IC7A 3DU6A 4OMZA 1SMTA 3OIPA 5EGOA 3MD2A 2BY2A 2E2IJ 1B1BA 3OYIA 2YUSA 1R5HA 2FF4A 3RSNA 4U7BA 2L5QA 2JVHA 5HLHA 3L2CA 2XV4S 3W2VA 2BW3B 4M73A 1BIBA 2KDOA 5GP9A 1Z7UA 5DCMB 4XLNF 4Y7NJ 1F5TA 2VOOA 1Q1HA 1OFCX 4HX4A 5HS9A 5J1UA 2ELJA 4B4CA 2OQRA 1I1SA 4O6JA 2O8XA 4E70A 4M74A 1UZCA 2HKXA 1V54H 3MFKA 4GO1A 2ZSHB 4N9IA 1ETYA 1O3TA 3AG2H 3DFGA 3ZQCA 1RRJA 1LFUP 3SHFA 5FROA 5BS6A 3CD6I 1ERDA 3H36A 3LSHA 4NDLA 5K7HA 2HPIA 4AIJA 1MJBA 2OAZA 1AHDP 2VJIA 2STWA 2YU3A 4UVAA 3ZN0A 1RESA 4RGXA 2EFQA 1T95A 2LP0A 3CDIA 2A3SA 3OYLA 1XTAA 3S1RJ 2FBIA 1R23A 2CYYA 2A5YB 2ISYA 2L54A 5F27A 3WU2C 1FTZA 1JGSA 3E1SA 3G6EI 1ZH5A 2DTRA 2AXTC 3T0YA 2Y9ZA 3K7AJ 3V8KA 4CDGA 3H1CA 1WCMJ 4M6XA 2QSFX 3L2VA 3H0GJ 3KYCB 2IGMA 2HKOA 2IEKA 2R5YB 4BU2A 4CZZA 2DA6A 5TGTA 2E7XA 3OS1A 2JA7J 2EV0A 4HNVA 2R3SA 5JHFA 1YS6A 3CUQC 5IYBJ 2JA6J 1QVUA 4UUSA 1BI2A 1FT9A 1GT0C 2OPTA 5EEGA 1W1WE 2JVGA 4E6KG 2X85A 5FGMA 2E1MC 2F48A 4CCOA 1Z91A 5L3BA 3MKWB 1S6LA 1WPKA 3E5XA 4L5IA 5J3LA 2B0LA 2VKDA 4A0ZA 3IV5A 2CV1A 3S8PA 4O5VA 3ZN1A 1V4RA 1CF7B 1OCZH 4KIGA 4XLAA 5D5VB 1G2HA 2DDBA 4KN7X 4MEYF 3O8GA 3K2ZA 2V1DA 1DP3A 3HHGA 4PGGA 1QZYA 2M45A 2VASA 2VKHA 4Z2YA 5CKTA 4HF1A 2N8GA 1YYVA 3LFUA 1FLIA 3NARA 2IGOA 2LH9A 3ELKA 1ZHFA 4E7KA 2H1KA 4AYBA 2NVQJ 4JQFA 3D5LA 5M5WJ 2DYSH 3ASOH 4KT6A 5GAHJ 5GAEJ 3J7ZI 2XGDA 4L5EA 1MMGA 4A3IJ 1XPXA 3TEDA 3BR6A 3RPUD 1OCRH 2A6EF 4ITVA 2Q0OA 1WHUA 3LAPA 1H8AC 3NWTA 3VPRA 1WH7A 5BNGA 1DU6A 4IKFA 2R5ZB 1JKPC 2GWRA 1P6RA 2XASA 4S05A 1MGTA 4XM3A 4B48A 3D0SA 2HQRA 2MLGA 2MH2A 4XKWA 1J0RA 2DQLA 1FY7A 2IJLA 2WAEA 2IRFG 4XL9A 4RDUA 3DLAA 3KYDB 1R36A 3N05A 4I01A 3RKQA 4XICA 1Z9CA 2QQBA 1R58A 1TZLA 2JA2A 1PP8F 1SFEA 5J1RA 3FX3A 3DTKA 1QZZA 3GF2A 2DODA 3IKTA 3LSMA 4ZZLA 2IP2A 2PJRA 1HA8A 1XB4A 2CRGA 3WE2A 1BM9A 5K5OA 4RLQA 2LKXA 4LG0B 1K79A 1MBEA 5ICGA 1A36A 1HSJA 2XAJA 3P9CA 1YO5C 1WJAA 2M0CA 3GZNB 3FHZA 4HF2A 1EH8A 5J4VA 4YFXF 2KLOA 3AKZA 2L7FP 3HBLA 1XMXA 3P9IA 1N25A 4MHGA 2F5FA 3CCQI 4G6TB 4WXHA 4PZJA 1NH3A 3FWEA 4JOMA 2GBYA 4UB6C 1FSHA 4OIPF 4CUGA 3E6DA 2XGEA 1FTTA 1UG0A 1I27A 2LG4A 3JRCA 4RB2C 3O2PE 1YX3A 3FM5A 1FOWA 4V19K 1Z21A 2DOFA 3L1PA 5D6FA 2P7CB 2EINH 1RKTA 1YIOA 4FE7A 4BE1A 4EEFG 3DPUA 3FMSA 1MNDA 1YX5A 1ZN2A 3TO9A 1SVLA 3MMYB 4DBRA 5CVRA 5LBQA 2LTPA 2XPUA 2ZNZA 1POGA 3PQKA 1U9OA 1Y8QB 4EMSA 1MMAA 3FK6A 3Q3SA 5IYCJ 4BQNA 5BOXA 3RQ4A 3HGGA 3S1QJ 4M71A 3CCVI 1J75A 4IQJA 2O8KA 1SANA 4KMFA 2DA3A 1CGPA 2ZXWH 1R1VA 3BQZA 4U0VA 3W2AA 2QEXI 1VQ8I 2LSOA 2O3FA 4ZYDA 3ASNH 1J59A 2M1BA 3IH4A 2DK5A 3OL3A 1RIOH 5E1ZB 5LEJA 2VI6A 1H88C 1UG2A 3PNVA 3EETA 2LFBA 2COBA 4RGSA 3DEWA 4IHXA 2G7HA 1YW7A 2KKOA 2R7OA 2M4GA 1D8KA 1D0YA 2FU4A 3WTTC 4GFBA 2YR2A 2JN6A 4QSHA 4ZZDA 4CCNA 3I4MJ 4XRSA 2WY7Q 1ZRFA 3K70C 3H9JA 3K69A 4EV0A 1TBXA 4PSWA 4Z6YA 3K6GA 1UHMA 3X2QH 1QBJA 3ABUA 1B59A 4UV9A 3S3OA 3FXRA 1TC3C 3K4JA 4XOTA 3GO5A 5E8GA 2M7AA 2CU7A 1FP1D 4L9JA 2VUMJ 2XF5A 2HGCA 2KIMA 3OR2C 1V3FA 2XF6A 4MFDA 4G6DA 1QRYA 3OOPA 2GQQA 5FKLA 4A6EA 1WWXA 2I10A 1VTNC 4C2UA 4FE4A 3E7LA 4D1QA 1R6RA 3DEEA 4GCVA 1R4NB 3HRTA 1SD7A 3C3WA 4K2EA 2NAZA 3AL0C 1Z67A 1G3SA 3DPTA 3I56I 3VSLA 4A5NA 5J6XA 4HLYA 2ZJ2A 5HDNA 1XCBA 3WTSC 1NHAA 2DT7B 2I5UA 2O7OA 2KZGA 2PX9A 4M3FA 1KONA 1T39A 1J09A 2W84A 4C3IJ 5B66C 3FXQA 5EDNA 2JJ7A 4L0ZB 4KUMA 1R7JA 1QZEA 3W2WA 4CYCB 1YW8A 1X58A 5IPAA 2R7UA 3S15J 4BBSJ 2CFXA 4BQOA 2KRCA 2IS4A 3PIOF 5ILSA 3BG3A 2OBPA 4G9YA 2ZNYA 4A5MA 5D8LB 1I6HJ 1R4MB 4HDVA 3OYEA 4IXAA 3ZCOA 2HPMA 1I39A 3CLOA 2RN7A 2HQAA 3IL2A 2VBWA 1NK2P 3FMRA 3TP3A 1ETOA 3IWZA 5FFZA 1PUFA 5F1JA 5E3NA 2M7BA 2MD5A 3S32A 5FD5A 2LVSA 3CUQB 2GLOA 3OYBA 5LHIA 1K6OA 1Z05A 4CH7A 2DYRH 3TO7A 3S2HJ 3HRMA 1S7AA 2K9LA 2R7QA 3KCCA 2E1MB 5BPDA 4LJZF 3LNQA 4F93B 5E17F 4OIRF 3BCBA 3HTUA 2VPRA 1MDMB 4ZTJA 3JRGA 3DWLE 1KYWA 3BR1A 3Q0UA 2JA5J 3TDZC 4XLHA 1IXRC 4RB3C 3GMEA 3AG4H 5K5QA 2O0YA 2CW8A 3U2RA 1IZ1A 2P0WA 3DTEA 4F92B 1O3RA 2L01A 1TQMA 4UUTA 3WU1B 3CCSI 1SFKA 1T38A 5E3OA 3BTIA 3ULQB 4P9FA 1K78B 2HWVA 3HOVJ 2AS5F 4L0YB 3VSKA 4U88A 5HLIA 1R9TJ 2KISA 1U2WA 3GFMA 2BYVE 2EBIA 3IH2A 4LLLA 5L3CA 3L2WA 3NWSA 3OIOA 2K9MA 3BCAA 5J4YA 1LKXA 1OPCA 5IT3A 4AIHA 3F8FA 2VJ4A 2PLYA 1U9NA 4GDFA 2MFZA 2NVXJ 3S17J 1IRXA 2QZ8A 4L9TA 2V79A 3K4CA 4Q4ZF 3QPLA 4R8HA 5L3EA 1X2MA 5AONA 1SFOJ 4E4HA 2JMWA 2K40A 3WGHA 2O03A 4RMNA 4MGRA 2XRLA 3I4PA 2DTZA 4KIBA 4QPQA 4B3AA 4YIFA 5HVQC 4OWRB 2P81A 4CICA 2Z5UA 3G1LA 1PJRA 1S9HA 5GTHC 1YQAA 3OYMA 2ZXHA 1Y1VJ 4MFEA 3Q5FA 2MYSA 2WV1A 5EGOB 4OOIA 1QNTA 2IA2A 3TDUC 4S04A 3T8TA 2VKVA 1TW2A 3MZ8A 3PNYA 4LLNA 1JGGA 1WJBA 2R7XA 4ZYGA 3MZHA 4ESBA 3QP5A 5DV5A 3JSPA 1UELB 4WF2A 2L2OA 2W48A 3ZQQA 3BDDA 1ZRCA 1JXSA 1MSFC 5ERIA 4M9ZA 3LQQA 1U78A 1VQ6I 3K1MA 4KISA 4CZCA 1W36C 3H9GA 4BHPA 2NNYA 4PSXA 1P2FA 3HOTA 1D1CA 2V9PA 5E79C 1DP7P 1EKEA 3G1OA 2L02A 5FB2A 3KPHA 4YIIA 2BY3A 1WJFA 2GA2A 3LSKA 2VN2A 4PJNA 3B02A 3E0JB 2DK8A 4Q48A 4NBQA 4GXOA 2BHZA 2EPFA 4V2GA 1P4WA 4FT8A 3JRBA 2XIGA 3I54A 3M8JA 4XR6A 4YIRX 1YITI 3NAUA 3WE3A 4ZYHA 4IOCF 3Q9VA 2G0EA 4L9NA 3ZQFA 3HKZN 2KFDA 3FXLA 2MSYA 4Y3OA 4HNTA 5JLWA 2YX4A 3DXJF 2FQ3A 5J40A 3WGGA 2IVMA 3G1MA 4FQGA 3DKXA 3G73A 2CQQA 2MGQA 4LB6B 3KEQA 2HQ5A 1XX5A 1FPQA 2OUMA 1ETWA 1A31A 1RUNA 2CGPA 2HS5A 2VIXA 1H0MA 2QYOA 1BIAA 2JT1A 3K9TA 1ITYA 2XC7A 3J7AO 3PQJA 1QQIA 4DNCA 5LEKA 4A93J 3TOBA 3JRDA 4UUSB 1C0WA 4UVCA 3KP2A 4KDPA 4ZYAA 2L4MA 1ZGJA 2ZBKA 5DD4A 5H6QA 4RAYA 2FBKA 4LGWA 3GTLJ 3GTQJ 3V8JA 2J5OA 4PFOA 2ECBA 1IXSB 5CVJA 2KJBA 4A2UA 1LNWA 2AQEA 1Y6IA 2L9RA 1GVDA 1YIJI 1MH4A 2LREA 5FRNA 3VOEA 3EYIA 3KLOA 2CQNA 2L0KA 1SD4A 1VQKI 4Y15A 3F22A 3DLLF 5JI6A 1TWHJ 3TMOA 3TGNA 1Y56A 2X1CA 1MZBA 3ABTA 3CMAI 3K10A 4LD5A 1N77A 2Z16A 3ZMUA 3K2AA 2KT0A 5CVIA 4ON0A 4M3BA 4F55A 1XGSA 3MCZA 3H5NA 1WSUA 5CYVA 1OISA 2HDCA 3DTIA 3AL0B 4HAMA 1XN7A 2H1LA 2E35A 5E3LA 2CUZA 2EZKA 4C2TA 4RB1A 2EB7A 4A69C 1D0XA 2V9VA 1X19A 3JRHA 1Z1DA 2OZ6A 2CUJA 1ZKGA 2NVTJ 1ZQ3P 4V2FA 3A1YA 2PN6A 4XMYA 1NG6A 1BI1A 4RGUA 5F1RA 1MBKA 2PJPA 4HOBA 1ON2A 2RV8A 1X1CA 2Z2SB 2VBZA 4G12A 1VQLI 5CQEA 2NS0A 4ENMA 2HOTA 1FEXA 1Z6TA 2DO7A 4B47A 2A69F 1BW5A 2A5WA 4BXUA 3ZMZA 2ICWG 5DUIA 1JHFA 3QYFA 3GLXA 4IOAF 4PCQA 3QYEA 3K4NA 4A3FJ 5FFXA 1YG2A 1FNNA 1DGRM 1G3WA 5IP9J 2HXOA 2PJRB 1T6SA 4E7IA 1KQ8A 3GFJA 3UKGA 2P6TA 3L7WA 3FXJA 2HVSA 4UUVA 1W36D 2PQ8A 2EFWA 4MTEA 2L9VA 2CS3A 2CQ7A 3N4MA 3LAJA 2ELKA 3G3ZA 1K83J 2E2HJ 1LPQA 2L9NA 1VQMI 3KFWX 1IDZA 1VI0A 2M30A 1K61A 1WI3A 4BJ6C 4XSXF 5CVVA 3I59A 3H92A 1TP4A 3PJRA 2CQKA 1EV7A 4XNFA 3L09A 4EQQA 3HOWJ 1HBXG 1VF9A 4M6VA 1B4AA 3RQIA 3O3KA 4BJTA 1J5YA 1HCRA 5L3DA 3JTHA 3KP4A 4Y33A 5DUKA 2CV0A 1QHGA 1IUYA 5DD8A 4MO7A 4LFUA 3CF2A 4EATA 4KA4A 3MQ0A 1E2XA 5JFRA 1SFUA 4BQQA 4XLEA 4DJAA 3Q9SA 2FRHA 5A2QK 2VT2A 4I2OA 1NG7A 2HTSA 5CJ9A 5D6EA 1AOYA 1Y8RB 3A4CA 2HQNA 3I0TA 3H5RA 4KITB 1LDJA 2GZWA 2IS2A 2JPBA 3RJPA 3EPZA 3RIRA 4ZDLA 2X9DA 2ME0A 2Y2ZA 2OC6A 1ORKA 4XSZF 2DI3A 3I55I 3IUOA 1APLC 3I53A 2R0QC 1VNDA 4I02A 4EGZA 1FSEA 1HLVA 3CTAA 2DJIA 3WG9A 2P8TA 2W4SA 2PMZN 1IAWA 1PDNC 4A0XA 5AIQA 4BJ5C 2BY0A 2HNHA 5IP7J 5B1AH 1S8NA 3IKVA 5LLQA 2GA1A 4ANJA 4A3BJ 4A3CJ 4Y17A 2PG4A 3VYUB 3F23A 2F6CA 5ILVA 4HW0A 4MLOA 3FKJA 4OU0A 3TO6A 5DCFA 5M3FJ 1IV6A 1BBYA 2DMPA 4R1HA 3KEYA 4HX8A 3HRSA 4LMYA 3ZMSA 1KQ0A 2MD0A 5J8FA 3IP4B 4EJOA 1UMQA 5D5XB 5F64A 1QA6A 1B9NA 3EQLF 1IN5A 4N4OB 2EA4A 3HRUA 3R61A 4XLCA 3I9V2 2Y0SN 4HA8A 4LITA 3FM3A 3QU3A 1GDTA 4BDYA 1SAXA 3A0BC 4BXXJ 2MW8A 3DKYA 1IUFA 2RC4A 4FETA 4QIWN 1RR7A 1MH3A 2H09A 5L3GA 3SFZA 2A6TA 2K3FA 1SD5A 3FXUA 2K7LA 3W3CA 3I4NJ 3JAMK 2BXZA 2KIUA 1E3PA 2V9KA 2BHYA 2XAGA 5HODA 5L3FA 4E7HA 1UJ8A 4YFNF 1LEAA 2EA2A 1P92A 3BTLA 5C4JJ 4XORA 4D0PA 1V5FA 3F21A 2X1EA 3SZTA 3HOZJ 2IA0A 5EG0A 5IYDJ 2DA5A 4HG2A 4CGZA 2CFOA 5A2QZ 4JBAA 1DPRA 5K5RA 3BR0A 3V8LA 2MABA 1LQ1A 9ANTA 1SVMA 2MG4A 2RREA 1U8BA 1PUFB 4OAZA 4M3GA 1D1AA 1BC8C 4XN0A 3GYHX 2JSPA 2KMUA 2M5WA 3HIFA 1JT6A 3BJAA 5HDGA 4NQWA 3WHBA 3CP2A 3ROUA 1K4SA 3BG5A 3ZP5A 4A3GJ 3KP6A 3OYJA 1TT5B 2ZJRF 2XSDC 2PFBA 5HLTA 1OYIA 2NVUB 2OJED 4WX9A 5FO5A 4Y52J 1N75A 4YELA 2H27A 2R7TA 2LKPA 2QSHX 1ETKA 1P4XA 4A3KJ 3LMMA 4HQMA 4JP0A 2P7VB 1Z6RA 4G7HF 3CC2I 1J9IA 1ULYA 2K4JA 2VXDA 3M7GA 3PSFA 2QENA 4ETSA 5FLMJ 2NOGA 2Y69H 1XS9A 2JRMA 2LKSA 2ID3A 5E8IA 2VQLA 3BP8A 5E18F 4IJAA 1HDPA 3HOYJ 2HYJA 4OAYA 4DQ2A 1OQYA 1VZ0A 5HNHA 1B8IA 1IN7A 3OYDA 3A01A 1WVRA 2CV2A 1FIAA 2VC0A 1Y1WJ 2VE8A 3EUKL 2QF7A 2NRAC 2VC1A 3LL7A 2X1DA 3BZKA 1E17A 3B6AA 2KIFA 4CO8A 4D7NA 2NNNA 5E1WA 4MQVA 3GVAA 2HOAA 4XRMA 2E1OA 5CQGA 3JAMZ 3IAM2 3R60A 2WB1N 3CCLI 1XDSA 3ZOBA 3CC7I 1W5TA 3UR3C 1HOMA 3RDIA 1X1DA 3ABMH 2OD5A 1D0ZA 3VB2A 3VODA 1OJLA 4KYWA 1WI9A 2DMNA 2RQPA 3CCMI 2OCCH 1VFCA 4PJLA 1ZGWA 1P7IA 2RGVA 3BR2A 3REOA 1Q1VA 1LVAA 2KQRA 4C9YA 3J7YJ 2DMUA 2WAQN 4P1WA 2Y48A 3GTPJ 3L9FA 2AQFA
chains in the Genus database with same CATH topology
2DT5A 3LA2A 3BZ6A 1O7FA 3C1DA 4A6DA 1F4KA 4BYYA 1R1UA 1I5ZA 2LNBA 2JTVA 3S2WA 2QQAA 1R1TA 1IRFA 1O3SA 4IHSA 1HKQA 1BJAA 2MC3A 2WC2A 2OU2A 1HW1A 2JRTA 2A6HF 3C7JA 1KU9A 4M9SA 4BQAA 1U6GA 2XHKA 2W25A 4EM2A 4FHTA 3CUOA 2K86A 5JR3A 4BHBA 2HYFA 4XBFA 5KK1A 4LK0F 1BI3A 1LDKB 1STZA 4B09A 2P4WA 3HSEA 5LHGA 4KICA 4G7ZF 2CWEA 4WXDA 3VEPA 1XCVA 1S7OA 1U3EM 2YX7A 1OMIA 1JHHA 1QPMA 4MTDA 4CXFA 1U5TA 3RTRA 1QGPA 1J7KA 3WTXC 1GXPA 3KP3A 2GAUA 2M8EA 2BE5F 4L18B 1ZYRF 3OV8A 3QOPA 3ERED 3GZ5A 2XGXA 2A61A 2L4AA 3LSTA 4IVNA 1OKRA 2HOEA 1W7PA 2W57A 1REPC 4R79A 4M9XA 2ELHA 2PEXA 4WCGA 1O57A 5JHUA 2IT0A 4MNUA 4HQEA 2VODA 1MD0A 5DEQA 3L00A 3HSRA 2K02A 2HYGD 2P5VA 1H9TA 4HZFA 4OIOF 1XMKA 3BWGA 5F6FA 2L3DA 4I7HA 2VXZA 3H3ZA 1I1GA 2F5EA 1LDDA 2ZXJA 2Z9OA 2OZUA 4OMYA 3DF8A 2FMYA 3ZMVA 1F1ZA 3SXYA 1LEBA 3F3XA 3W6KB 3C18A 3COAC 3JTGA 2QUFA 2XROA 4UNOA 2PBIA 1UCRA 5LGNA 5LHHA 4GYGA 2D1VA 3WTUC 3I58A 5EEHA 1XSDA 3E6CC 2DPUA 1Y0UA 1FOKA 1PP7U 3PFIA 3ZPLA 4WWCA 3WGIA 4NHJA 1KA8A 2Z3YA 3BPVA 3EUHA 3I59B 2C6YA 1KU2A 2Z33A 2RVCA 3ECOA 1DPUA 2CG4A 3E5QA 3WTYC 2FE3A 4U0WA 1TQPA 2X0LA 3F72A 1WKMA 2LF7A 1T98A 2W24A 2FXAA 1HKTA 2XKOA 4KMUX 4P9UA 2MBFA 3EYYA 3GW2A 4RS8A 2GXBA 1IN6A 3QU6A 2XKPA 3GEZA 1G3TA 4KNYA 3SZPA 2RKHA 3T5XA 2MH9A 2JPCA 4I0AA 3RPQA 1FBSA 1MJAA 2ISZA 1TTYA 1G3YA 2YPRA 1U5TC 1YFHA 1IN8A 4PGHA 4EJTA 3IHUA 3GX4X 4U0YA 4G6QA 3E97A 5H6RA 3F6OA 5DYMA 3F8MA 2WV0A 3QAHA 5LRRA 4Q5SF 2QWWA 4HLXA 1D3YA 3E6MA 4UXNA 5JVTA 1U8RA 2HR3A 1UHWA 3NQOA 3WTWC 5TRDA 2YSRA 2E1NA 2D45A 5ICEA 1R22A 4HV5A 1XSXA 3KZZA 4KIFA 3J81K 4HDUA 4FX0A 4GGGA 4KT5C 2DPDA 4YG2F 3BJOA 3P9KA 3HYIA 4ZYEA 1LB2A 2EV5A 4N0BA 4LB5A 2X4HA 1FZPB 1BOAA 4M72A 4ASNA 1TW3A 3BOQA 4BNCA 1IF1A 1FP2A 3QRFF 4B8XA 5BPIA 3R4KA 3TQNA 5ICCA 3EDPA 1W5SA 3LA3A 1ON1A 3DEUA 3KEOA 1YS7A 2EJRA 1MKMA 3K1NA 3ZMTA 1ZG3A 2Q2EA 5IT9K 1KU7A 4HX7A 4BH9A 3FF5A 3HUGA 1XGMA 1SD6A 5CLSA 1AWCA 2UXNA 5ICFA 1OR7A 2KJCA 4RGRA 2KRFA 2QBYA 3E5UA 3HOSA 3LFKA 4KFCA 2ZMEA 1KQ9A 3KP5A 4RAZA 3IRRA 4N9HA 3J81Z 5LRSA 4UV8A 2XAQA 1T0FA 2BEOA 1RZ4A 1TLHB 2DLLA 3WODF 5J8CA 5D8KB 2UZKA 4AWXB 4EM1A 3F8BA 2CSOA 1XDUA 4P5OA 1LJ9A 2K27A 3MZYA 4H0EA 2XVCA 3DKWA 2DAOA 2UWMA 3BPXA 4EJUA 2Y0MA 1W7PD 3F8CA 2IA1A 3I71A 1S29A 2G7UA 1SMYF 4HYEA 1FYMA 2FNAA 2ESNA 2LDUA 1XMAA 4CYDA 3T8RA 5IT9Z 4O3MA 2IPQX 2QVOA 4HV6A 4P55A 2XUBA 1RUOA 1D5VA 2O61A 3WTZA 2VBYA 2DBBA 2ZFWA 3GWZA 2ESHA 2P5LC 3ECHA 4I0BA 4MQ9F 5LGTA 1USTA 2V1XA 1W4MA 4ZH4F 2D1HA 2EV6A 4UHTA 2FOKA 2WTEA 2DFIA 2P6SA 2EFPA 1I6XA 3U9GA 3QPTA 3J80K 5HLGA 4ENNA 2BBYA 4G94A 3P7NA 1U5TB 2D2WA 3DPLC 1HW5A 3RKYA 2JSCA 3I5UA 3GUDA 5DCMA 2VT3A 3CDHA 1HSTA 4IPAA 4TV7A 3U1DA 1HQCA 1K7AA 1W7PB 1XD7A 5E1XA 2A68F 1ZARA 2H6CA 1OYWA 1YTYA 4GYIA 1PUEE 2TDXA 4XRFA 4QLCU 4XLPF 2AXLA 3VFZA 4I09A 2F5DA 1ZAOA 2CO5A 2W85A 2PMHA 3BY6A 2EFNA 3LWFA 1ZRDA 1O7LA 1T2KA 2RNJA 1F9NA 4I98B 2V6CA 3R0AA 1ZG5A 1USSA 4F7ZA 3E3VA 5D4SA 2ZKZA 1L3LA 1GXQA 1SFXA 3ZMDA 4EJVA 1UFMA 1JE8A 1GVJA 4IF4A 3KETA 2HFHA 2BGCA 3J80Z 1EH7A 2H94A 2E7WA 2ZCWA 4Q47A 2FNPA 2CW0F 3O6BB 3F8NA 3CJNA 1CF7A 3QP6A 5LGUA 3V7CA 2H6BA 1G4DA 4EVIA 2OQGA 3LA7A 1ONVA 1R5GA 1FYKA 3V7SA 5BQTA 3WTVC 1ZG1A 3LQRA 2R7FA 1ZGAA 2Z99A 3FMQA 2A07F 2ETHA 3QPHA 3AAFA 4AD9A 4ENKA 1B6AA 2QM3A 5AIPA 3RKWA 2QQ9A 3T1BA 2Q8KA 1TNTA 3H3UA 4LK1F 2DQRA 4L5JA 2XAFA 1WQ2A 1TQIA 4IRHA 5H20A 4MEXF 2MLKA 1FBQA 1ZLJA 4L9VA 1HW2A 2STTA 6PAXA 3M1EA 4IRGA 2P5KA 3R0JA 4LG0A 1XGOA 4M6YA 5FLXK 2GIVA 1GHCA 3KZYA 3W6JB 2R7DA 1BN5A 1HKSA 3GZ6A 3WU0A 2NYXA 5E20A 4AVPA 4LLGF 2FBHA 5DDGA 3KLNA 1RNLA 4YFKF 1YW9A 2MA3A 3V4GA 2EWNA 4U7DA 4NB5A 4ESFA 5CVUA 3DP7A 3K1PA 2F2EA 3IWFA 3DQVC 1KU3A 1B9MA 5D4RA 3RYPA 2EK5A 1ZREA 1FC3A 1IRGA 4A0YA 3RPUA 5KVRA 5HOOA 4P96A 2FEZA 1RI7A 2JZYA 5TJJA 4Y13A 3NRVA 3ISPA 1MJ9A 4G7OF 1HXDA 3ML6A 1IN4A 3DV8A 1FWZA 1KGSA 3TKYA 4QWQA 1DUXC 3V7RA 2UXXA 4G8XA 1P4AA 4OIQF 3CO6C 2HEOA 1ODDA 1OYYA 2RDPA 2DW4A 3I64A 2ZO4A 3HSFA 4CHUA 1S3JA 4EM0B 5ILUA 4AIKA 2COMA 3CO7C 2V1UA 3M9AA 5FLXZ 2OA4A 1BI0A 4HBLA 3KE2A 2PMUA 2XAHA 4JK1X 2PI0A 2HTJA 5HDKA 2O6GE 1XSVA 3GFLA 3JSOA 3MAJA 1D8JA 1X3UA 3MWMA 1DDNA 4UVBA 4ESJA 4WK8F 2QBYB 4EJWA 2VE9A 3BJ6A 1KYZA 1A04A 2Y75A 4EGYA 3N97A 3HTSB 4A12A 2QLZA 2ZMEB 5HS7A 2FSWA 2BV6A 2VBXA 2M87A 2VOPA 4WXCA 3JW4A 1O3QA 1TNSA 1FYLA 1R00A 4RB0A 3IRQA 2LF8A 1FBUA 1FX7A 4ENJA 3CUQA 3BROA 4PDKA 3F6VA 4BAYA 3K0LA 5K1YA 3SQNA 4IRIA 1H9GA 2GXGA 4HF0A 1IW7F 1MDMA 2FMLA 3ZQ7A 4BHCA 2HZTA 5FD6A 3KP7A 1G6NA 3FZVA 3MEXA 3M8FA 1YLFA 3RKXA 3M8EA 5D5WB 3E6BA 1K78A 3R6SA 1XGNA 2E1CA 2EFOA 3RI4A 4FX4A 3GFIA 5HS8A 2ACJA 4OINF 1WRJA 1QO0D 3B73A 2ADUA 2XRNA 1EH6A 1ZLKA 2G9WA 2J5PA 5BMZA 5ED4A 2FA5A 1IXCA 4IHTA 2K4BA 1L0OC 2DU9A 3TOAA 2VONA 5D5UB 3GXOA 3HHHA 2F5CA 3RYRA 1UB9A 3NEUA 2WWYA 4KN4X 2IW5A 1J2XA 1BC7C 3IC7A 4OMZA 1SMTA 1B1BA 1R5HA 2FF4A 4U7BA 3L2CA 5HLHA 2XV4S 4M73A 1BIBA 1Z7UA 5DCMB 4XLNF 1F5TA 2VOOA 1Q1HA 4HX4A 5HS9A 2OQRA 1I1SA 4O6JA 2O8XA 4E70A 4M74A 2HKXA 3MFKA 4GO1A 4N9IA 1O3TA 3DFGA 3SHFA 5BS6A 4AIJA 1MJBA 2OAZA 2STWA 2YU3A 4UVAA 3ZN0A 4RGXA 2EFQA 2A3SA 2FBIA 1R23A 2CYYA 2A5YB 2ISYA 2L54A 1JGSA 1ZH5A 2DTRA 3T0YA 3V8KA 4CDGA 4M6XA 2HKOA 4CZZA 2E7XA 2EV0A 2R3SA 1YS6A 3CUQC 1BI2A 1FT9A 5EEGA 5FGMA 1Z91A 5L3BA 1S6LA 3E5XA 4L5IA 2B0LA 4A0ZA 4O5VA 3ZN1A 1V4RA 1CF7B 4KIGA 5D5VB 4KN7X 4MEYF 3K2ZA 2V1DA 3HHGA 4PGGA 1QZYA 2M45A 4Z2YA 4HF1A 1YYVA 1FLIA 3ELKA 1ZHFA 4JQFA 3D5LA 2A6EF 2Q0OA 3LAPA 2GWRA 1P6RA 2XASA 4S05A 1MGTA 3D0SA 2HQRA 2MLGA 2MH2A 2DQLA 1J0RA 1FY7A 2IJLA 2IRFG 1R36A 4I01A 1Z9CA 2QQBA 1R58A 1PP8F 1SFEA 3FX3A 1QZZA 3GF2A 3IKTA 4ZZLA 2IP2A 1XB4A 3WE2A 1BM9A 5K5OA 4LG0B 1K79A 5ICGA 1HSJA 2XAJA 3P9CA 1YO5C 3FHZA 4HF2A 1EH8A 4YFXF 3P9IA 4MHGA 2F5FA 4WXHA 4PZJA 3FWEA 1FSHA 4OIPF 3E6DA 1I27A 4RB2C 3O2PE 3FM5A 5D6FA 2P7CB 1YIOA 3FMSA 3TO9A 1ZN2A 5CVRA 5LBQA 2ZNZA 3PQKA 4EMSA 5BOXA 4M71A 1J75A 4KMFA 1CGPA 1R1VA 4U0VA 2LSOA 2O3FA 4ZYDA 1J59A 2M1BA 2DK5A 1RIOH 5E1ZB 5LEJA 3EETA 4RGSA 2G7HA 1YW7A 2KKOA 1D8KA 2FU4A 3WTTC 2YR2A 4ZZDA 1ZRFA 3K69A 4EV0A 1TBXA 1QBJA 1UHMA 3ABUA 1B59A 4UV9A 3FXRA 3GO5A 5E8GA 4L9JA 1FP1D 2HGCA 2KIMA 1V3FA 4G6DA 3OOPA 2GQQA 4A6EA 1WWXA 1VTNC 4GCVA 3HRTA 1SD7A 3C3WA 4K2EA 2NAZA 1G3SA 3DPTA 4HLYA 4A5NA 5J6XA 2ZJ2A 5HDNA 1XCBA 3WTSC 1NHAA 1T39A 2W84A 3FXQA 4L0ZB 4KUMA 1R7JA 1YW8A 2CFXA 5ILSA 2OBPA 4G9YA 2ZNYA 4A5MA 5D8LB 4HDVA 4IXAA 3CLOA 2RN7A 3IL2A 2VBWA 3FMRA 3IWZA 5FFZA 2MD5A 5FD5A 3CUQB 5LHIA 1K6OA 1Z05A 3TO7A 3HRMA 1S7AA 3KCCA 5BPDA 4LJZF 5E17F 4OIRF 3HTUA 1MDMB 1KYWA 3TDZC 1IXRC 4RB3C 5K5QA 2O0YA 3U2RA 1IZ1A 1O3RA 2L01A 1TQMA 3WU1B 1T38A 3ULQB 1K78B 4P9FA 2HWVA 2AS5F 4L0YB 4U88A 5HLIA 1U2WA 3GFMA 2BYVE 4LLLA 5L3CA 1OPCA 5IT3A 4AIHA 3F8FA 2PLYA 2QZ8A 4L9TA 2V79A 4Q4ZF 4R8HA 5L3EA 5AONA 3WGHA 2O03A 4MGRA 3I4PA 4KIBA 4YIFA 5HVQC 4CICA 2Z5UA 1YQAA 3Q5FA 4OOIA 1QNTA 2IA2A 3TDUC 4S04A 3T8TA 1TW2A 4LLNA 4ZYGA 3MZHA 4ESBA 3QP5A 5DV5A 3JSPA 4WF2A 3BDDA 1ZRCA 1JXSA 5ERIA 4M9ZA 3LQQA 1U78A 3K1MA 4BHPA 2NNYA 1P2FA 3HOTA 1DP7P 5FB2A 2L02A 4YIIA 2GA2A 2VN2A 3B02A 4Q48A 2DK8A 4GXOA 1P4WA 4FT8A 2XIGA 3I54A 3WE3A 4ZYHA 3Q9VA 4L9NA 2YX4A 3DXJF 2FQ3A 3WGGA 2IVMA 3G73A 4LB6B 3KEQA 1FPQA 1RUNA 2CGPA 2HS5A 1H0MA 2QYOA 1BIAA 2JT1A 3K9TA 3J7AO 3PQJA 1QQIA 4DNCA 5LEKA 3TOBA 1C0WA 4UVCA 3KP2A 4KDPA 2L4MA 1ZGJA 2ZBKA 5DD4A 5H6QA 4RAYA 2FBKA 4LGWA 3V8JA 2J5OA 1IXSB 5CVJA 2KJBA 4A2UA 1LNWA 3VOEA 3EYIA 3KLOA 1SD4A 4Y15A 3F22A 5JI6A 3TGNA 1MZBA 3ABTA 4LD5A 3ZMUA 5CVIA 4ON0A 1XGSA 3MCZA 1WSUA 5CYVA 2HDCA 4HAMA 1XN7A 4RB1A 2EB7A 2V9VA 1Z1DA 2OZ6A 2PN6A 4RGUA 1BI1A 5F1RA 2PJPA 4HOBA 1ON2A 2RV8A 2VBZA 4ENMA 2NS0A 1Z6TA 2DO7A 2A69F 4BXUA 3ZMZA 5DUIA 1JHFA 3GLXA 4PCQA 5FFXA 1YG2A 1FNNA 1G3WA 1T6SA 1KQ8A 3GFJA 2P6TA 3L7WA 4UUVA 2PQ8A 2EFWA 4MTEA 3N4MA 3LAJA 3G3ZA 3KFWX 2M30A 4XSXF 5CVVA 3I59A 3H92A 2CQKA 1EV7A 3L09A 4EQQA 1HBXG 1B4AA 3O3KA 1J5YA 5L3DA 3JTHA 3KP4A 5DUKA 1IUYA 5DD8A 4LFUA 4KA4A 3MQ0A 1E2XA 5JFRA 1SFUA 3Q9SA 2FRHA 5A2QK 2VT2A 4I2OA 2HTSA 5CJ9A 5D6EA 1AOYA 2HQNA 3I0TA 1LDJA 2GZWA 2JPBA 3RJPA 3RIRA 4XSZF 2DI3A 3I53A 4I02A 4EGZA 1FSEA 3CTAA 3WG9A 2P8TA 1IAWA 1PDNC 4A0XA 5AIQA 1S8NA 3IKVA 5LLQA 2GA1A 4Y17A 2PG4A 3F23A 5ILVA 4HW0A 4OU0A 3TO6A 5DCFA 1BBYA 4R1HA 4HX8A 3HRSA 4LMYA 3ZMSA 1KQ0A 5J8FA 4EJOA 5D5XB 5F64A 1B9NA 3EQLF 1IN5A 2EA4A 3HRUA 3R61A 4HA8A 3FM3A 3QU3A 1SAXA 2RC4A 2H09A 5L3GA 3SFZA 1SD5A 3FXUA 2K7LA 3JAMK 2KIUA 2XAGA 5L3FA 4YFNF 1LEAA 2EA2A 1P92A 4D0PA 3F21A 3SZTA 2IA0A 4CGZA 5A2QZ 4JBAA 1DPRA 5K5RA 3V8LA 1LQ1A 1BC8C 3GYHX 3HIFA 2M5WA 3BJAA 5HDGA 4NQWA 3ROUA 3ZP5A 3KP6A 2PFBA 1OYIA 4WX9A 5FO5A 2H27A 2LKPA 1P4XA 4HQMA 2P7VB 1Z6RA 4G7HF 1J9IA 1ULYA 2K4JA 3M7GA 2QENA 4ETSA 5E8IA 3BP8A 5E18F 4IJAA 4DQ2A 1IN7A 2VC0A 2VE8A 2NRAC 2VC1A 1E17A 2KIFA 4CO8A 2NNNA 5E1WA 4MQVA 3GVAA 3JAMZ 3R60A 1XDSA 1W5TA 3RDIA 4KYWA 2OD5A 3VB2A 3VODA 1WI9A 2RQPA 2RGVA 3REOA 1LVAA 2Y48A 3L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT5 A;  3LA2 A;  3BZ6 A;  1O7F A;  3C1D A;  4A6D A;  1F4K A;  4BYY A;  1R1U A;  1I5Z A;  2LNB A;  2JTV A;  3S2W A;  2QQA A;  1R1T A;  1IRF A;  1O3S A;  4IHS A;  1HKQ A;  1BJA A;  2MC3 A;  2WC2 A;  2OU2 A;  1HW1 A;  2JRT A;  2A6H F;  3C7J A;  1KU9 A;  4M9S A;  4BQA A;  1U6G A;  2XHK A;  2W25 A;  4EM2 A;  4FHT A;  3CUO A;  2K86 A;  5JR3 A;  4BHB A;  2HYF A;  4XBF A;  5KK1 A;  4LK0 F;  1BI3 A;  1LDK B;  1STZ A;  4B09 A;  2P4W A;  3HSE A;  5LHG A;  4KIC A;  4G7Z F;  2CWE A;  4WXD A;  3VEP A;  1XCV A;  1S7O A;  1U3E M;  2YX7 A;  1OMI A;  1JHH A;  1QPM A;  4MTD A;  4CXF A;  1U5T A;  3RTR A;  1QGP A;  1J7K A;  3WTX C;  1GXP A;  3KP3 A;  2GAU A;  2M8E A;  2BE5 F;  4L18 B;  1ZYR F;  3OV8 A;  3QOP A;  3ERE D;  3GZ5 A;  2XGX A;  2A61 A;  2L4A A;  3LST A;  4IVN A;  1OKR A;  2HOE A;  1W7P A;  2W57 A;  1REP C;  4R79 A;  4M9X A;  2ELH A;  2PEX A;  4WCG A;  1O57 A;  5JHU A;  2IT0 A;  4MNU A;  4HQE A;  2VOD A;  1MD0 A;  5DEQ A;  3L00 A;  3HSR A;  2K02 A;  2HYG D;  2P5V A;  1H9T A;  4HZF A;  4OIO F;  1XMK A;  3BWG A;  5F6F A;  2L3D A;  4I7H A;  2VXZ A;  3H3Z A;  1I1G A;  2F5E A;  1LDD A;  2ZXJ A;  2Z9O A;  2OZU A;  4OMY A;  3DF8 A;  2FMY A;  3ZMV A;  1F1Z A;  3SXY A;  1LEB A;  3F3X A;  3W6K B;  3C18 A;  3COA C;  3JTG A;  2QUF A;  2XRO A;  4UNO A;  2PBI A;  1UCR A;  5LGN A;  5LHH A;  4GYG A;  2D1V A;  3WTU C;  3I58 A;  5EEH A;  1XSD A;  3E6C C;  2DPU A;  1Y0U A;  1FOK A;  1PP7 U;  3PFI A;  3ZPL A;  4WWC A;  3WGI A;  4NHJ A;  1KA8 A;  2Z3Y A;  3BPV A;  3EUH A;  3I59 B;  2C6Y A;  1KU2 A;  2Z33 A;  2RVC A;  3ECO A;  1DPU A;  2CG4 A;  3E5Q A;  3WTY C;  2FE3 A;  4U0W A;  1TQP A;  2X0L A;  3F72 A;  1WKM A;  2LF7 A;  1T98 A;  2W24 A;  2FXA A;  1HKT A;  2XKO A;  4KMU X;  4P9U A;  2MBF A;  3EYY A;  3GW2 A;  4RS8 A;  2GXB A;  1IN6 A;  3QU6 A;  2XKP A;  3GEZ A;  1G3T A;  4KNY A;  3SZP A;  2RKH A;  3T5X A;  2MH9 A;  2JPC A;  4I0A A;  3RPQ A;  1FBS A;  1MJA A;  2ISZ A;  1TTY A;  1G3Y A;  2YPR A;  1U5T C;  1YFH A;  1IN8 A;  4PGH A;  4EJT A;  3IHU A;  3GX4 X;  4U0Y A;  4G6Q A;  3E97 A;  5H6R A;  3F6O A;  5DYM A;  3F8M A;  2WV0 A;  3QAH A;  5LRR A;  4Q5S F;  2QWW A;  4HLX A;  1D3Y A;  3E6M A;  4UXN A;  5JVT A;  1U8R A;  2HR3 A;  1UHW A;  3NQO A;  3WTW C;  5TRD A;  2YSR A;  2E1N A;  2D45 A;  5ICE A;  1R22 A;  4HV5 A;  1XSX A;  3KZZ A;  4KIF A;  3J81 K;  4HDU A;  4FX0 A;  4GGG A;  4KT5 C;  2DPD A;  4YG2 F;  3BJO A;  3P9K A;  3HYI A;  4ZYE A;  1LB2 A;  2EV5 A;  4N0B A;  4LB5 A;  2X4H A;  1FZP B;  1BOA A;  4M72 A;  4ASN A;  1TW3 A;  3BOQ A;  4BNC A;  1IF1 A;  1FP2 A;  3QRF F;  4B8X A;  5BPI A;  3R4K A;  3TQN A;  5ICC A;  3EDP A;  1W5S A;  3LA3 A;  1ON1 A;  3DEU A;  3KEO A;  1YS7 A;  2EJR A;  1MKM A;  3K1N A;  3ZMT A;  1ZG3 A;  2Q2E A;  5IT9 K;  1KU7 A;  4HX7 A;  4BH9 A;  3FF5 A;  3HUG A;  1XGM A;  1SD6 A;  5CLS A;  1AWC A;  2UXN A;  5ICF A;  1OR7 A;  2KJC A;  4RGR A;  2KRF A;  2QBY A;  3E5U A;  3HOS A;  3LFK A;  4KFC A;  2ZME A;  1KQ9 A;  3KP5 A;  4RAZ A;  3IRR A;  4N9H A;  3J81 Z;  5LRS A;  4UV8 A;  2XAQ A;  1T0F A;  2BEO A;  1RZ4 A;  1TLH B;  2DLL A;  3WOD F;  5J8C A;  5D8K B;  2UZK A;  4AWX B;  4EM1 A;  3F8B A;  2CSO A;  1XDU A;  4P5O A;  1LJ9 A;  2K27 A;  3MZY A;  4H0E A;  2XVC A;  3DKW A;  2DAO A;  2UWM A;  3BPX A;  4EJU A;  2Y0M A;  1W7P D;  3F8C A;  2IA1 A;  3I71 A;  1S29 A;  2G7U A;  1SMY F;  4HYE A;  1FYM A;  2FNA A;  2ESN A;  2LDU A;  1XMA A;  4CYD A;  3T8R A;  5IT9 Z;  4O3M A;  2IPQ X;  2QVO A;  4HV6 A;  4P55 A;  2XUB A;  1RUO A;  1D5V A;  2O61 A;  3WTZ A;  2VBY A;  2DBB A;  2ZFW A;  3GWZ A;  2ESH A;  2P5L C;  3ECH A;  4I0B A;  4MQ9 F;  5LGT A;  1UST A;  2V1X A;  1W4M A;  4ZH4 F;  2D1H A;  2EV6 A;  4UHT A;  2FOK A;  2WTE A;  2DFI A;  2P6S A;  2EFP A;  1I6X A;  3U9G A;  3QPT A;  3J80 K;  5HLG A;  4ENN A;  2BBY A;  4G94 A;  3P7N A;  1U5T B;  2D2W A;  3DPL C;  1HW5 A;  3RKY A;  2JSC A;  3I5U A;  3GUD A;  5DCM A;  2VT3 A;  3CDH A;  1HST A;  4IPA A;  4TV7 A;  3U1D A;  1HQC A;  1K7A A;  1W7P B;  1XD7 A;  5E1X A;  2A68 F;  1ZAR A;  2H6C A;  1OYW A;  1YTY A;  4GYI A;  1PUE E;  2TDX A;  4XRF A;  4QLC U;  4XLP F;  2AXL A;  3VFZ A;  4I09 A;  2F5D A;  1ZAO A;  2CO5 A;  2W85 A;  2PMH A;  3BY6 A;  2EFN A;  3LWF A;  1ZRD A;  1O7L A;  1T2K A;  2RNJ A;  1F9N A;  4I98 B;  2V6C A;  3R0A A;  1ZG5 A;  1USS A;  4F7Z A;  3E3V A;  5D4S A;  2ZKZ A;  1L3L A;  1GXQ A;  1SFX A;  3ZMD A;  4EJV A;  1UFM A;  1JE8 A;  1GVJ A;  4IF4 A;  3KET A;  2HFH A;  2BGC A;  3J80 Z;  1EH7 A;  2H94 A;  2E7W A;  2ZCW A;  4Q47 A;  2FNP A;  2CW0 F;  3O6B B;  3F8N A;  3CJN A;  1CF7 A;  3QP6 A;  5LGU A;  3V7C A;  2H6B A;  1G4D A;  4EVI A;  2OQG A;  3LA7 A;  1ONV A;  1R5G A;  1FYK A;  3V7S A;  5BQT A;  3WTV C;  1ZG1 A;  3LQR A;  2R7F A;  1ZGA A;  2Z99 A;  3FMQ A;  2A07 F;  2ETH A;  3QPH A;  3AAF A;  4AD9 A;  4ENK A;  1B6A A;  2QM3 A;  5AIP A;  3RKW A;  2QQ9 A;  3T1B A;  2Q8K A;  1TNT A;  3H3U A;  4LK1 F;  2DQR A;  4L5J A;  2XAF A;  1WQ2 A;  1TQI A;  4IRH A;  5H20 A;  4MEX F;  2MLK A;  1FBQ A;  1ZLJ A;  4L9V A;  1HW2 A;  2STT A;  6PAX A;  3M1E A;  4IRG A;  2P5K A;  3R0J A;  4LG0 A;  1XGO A;  4M6Y A;  5FLX K;  2GIV A;  1GHC A;  3KZY A;  3W6J B;  2R7D A;  1BN5 A;  1HKS A;  3GZ6 A;  3WU0 A;  2NYX A;  5E20 A;  4AVP A;  4LLG F;  2FBH A;  5DDG A;  3KLN A;  1RNL A;  4YFK F;  1YW9 A;  2MA3 A;  3V4G A;  2EWN A;  4U7D A;  4NB5 A;  4ESF A;  5CVU A;  3DP7 A;  3K1P A;  2F2E A;  3IWF A;  3DQV C;  1KU3 A;  1B9M A;  5D4R A;  3RYP A;  2EK5 A;  1ZRE A;  1FC3 A;  1IRG A;  4A0Y A;  3RPU A;  5KVR A;  5HOO A;  4P96 A;  2FEZ A;  1RI7 A;  2JZY A;  5TJJ A;  4Y13 A;  3NRV A;  3ISP A;  1MJ9 A;  4G7O F;  1HXD A;  3ML6 A;  1IN4 A;  3DV8 A;  1FWZ A;  1KGS A;  3TKY A;  4QWQ A;  1DUX C;  3V7R A;  2UXX A;  4G8X A;  1P4A A;  4OIQ F;  3CO6 C;  2HEO A;  1ODD A;  1OYY A;  2RDP A;  2DW4 A;  3I64 A;  2ZO4 A;  3HSF A;  4CHU A;  1S3J A;  4EM0 B;  5ILU A;  4AIK A;  2COM A;  3CO7 C;  2V1U A;  3M9A A;  5FLX Z;  2OA4 A;  1BI0 A;  4HBL A;  3KE2 A;  2PMU A;  2XAH A;  4JK1 X;  2PI0 A;  2HTJ A;  5HDK A;  2O6G E;  1XSV A;  3GFL A;  3JSO A;  3MAJ A;  1D8J A;  1X3U A;  3MWM A;  1DDN A;  4UVB A;  4ESJ A;  4WK8 F;  2QBY B;  4EJW A;  2VE9 A;  3BJ6 A;  1KYZ A;  1A04 A;  2Y75 A;  4EGY A;  3N97 A;  3HTS B;  4A12 A;  2QLZ A;  2ZME B;  5HS7 A;  2FSW A;  2BV6 A;  2VBX A;  2M87 A;  2VOP A;  4WXC A;  3JW4 A;  1O3Q A;  1TNS A;  1FYL A;  1R00 A;  4RB0 A;  3IRQ A;  2LF8 A;  1FBU A;  1FX7 A;  4ENJ A;  3CUQ A;  3BRO A;  4PDK A;  3F6V A;  4BAY A;  3K0L A;  5K1Y A;  3SQN A;  4IRI A;  1H9G A;  2GXG A;  4HF0 A;  1IW7 F;  1MDM A;  2FML A;  3ZQ7 A;  4BHC A;  2HZT A;  5FD6 A;  3KP7 A;  1G6N A;  3FZV A;  3MEX A;  3M8F A;  1YLF A;  3RKX A;  3M8E A;  5D5W B;  3E6B A;  1K78 A;  3R6S A;  1XGN A;  2E1C A;  2EFO A;  3RI4 A;  4FX4 A;  3GFI A;  5HS8 A;  2ACJ A;  4OIN F;  1WRJ A;  1QO0 D;  3B73 A;  2ADU A;  2XRN A;  1EH6 A;  1ZLK A;  2G9W A;  2J5P A;  5BMZ A;  5ED4 A;  2FA5 A;  1IXC A;  4IHT A;  2K4B A;  1L0O C;  2DU9 A;  3TOA A;  2VON A;  5D5U B;  3GXO A;  3HHH A;  2F5C A;  3RYR A;  1UB9 A;  3NEU A;  2WWY A;  4KN4 X;  2IW5 A;  1J2X A;  1BC7 C;  3IC7 A;  4OMZ A;  1SMT A;  1B1B A;  1R5H A;  2FF4 A;  4U7B A;  3L2C A;  5HLH A;  2XV4 S;  4M73 A;  1BIB A;  1Z7U A;  5DCM B;  4XLN F;  1F5T A;  2VOO A;  1Q1H A;  4HX4 A;  5HS9 A;  2OQR A;  1I1S A;  4O6J A;  2O8X A;  4E70 A;  4M74 A;  2HKX A;  3MFK A;  4GO1 A;  4N9I A;  1O3T A;  3DFG A;  3SHF A;  5BS6 A;  4AIJ A;  1MJB A;  2OAZ A;  2STW A;  2YU3 A;  4UVA A;  3ZN0 A;  4RGX A;  2EFQ A;  2A3S A;  2FBI A;  1R23 A;  2CYY A;  2A5Y B;  2ISY A;  2L54 A;  1JGS A;  1ZH5 A;  2DTR A;  3T0Y A;  3V8K A;  4CDG A;  4M6X A;  2HKO A;  4CZZ A;  2E7X A;  2EV0 A;  2R3S A;  1YS6 A;  3CUQ C;  1BI2 A;  1FT9 A;  5EEG A;  5FGM A;  1Z91 A;  5L3B A;  1S6L A;  3E5X A;  4L5I A;  2B0L A;  4A0Z A;  4O5V A;  3ZN1 A;  1V4R A;  1CF7 B;  4KIG A;  5D5V B;  4KN7 X;  4MEY F;  3K2Z A;  2V1D A;  3HHG A;  4PGG A;  1QZY A;  2M45 A;  4Z2Y A;  4HF1 A;  1YYV A;  1FLI A;  3ELK A;  1ZHF A;  4JQF A;  3D5L A;  2A6E F;  2Q0O A;  3LAP A;  2GWR A;  1P6R A;  2XAS A;  4S05 A;  1MGT A;  3D0S A;  2HQR A;  2MLG A;  2MH2 A;  2DQL A;  1J0R A;  1FY7 A;  2IJL A;  2IRF G;  1R36 A;  4I01 A;  1Z9C A;  2QQB A;  1R58 A;  1PP8 F;  1SFE A;  3FX3 A;  1QZZ A;  3GF2 A;  3IKT A;  4ZZL A;  2IP2 A;  1XB4 A;  3WE2 A;  1BM9 A;  5K5O A;  4LG0 B;  1K79 A;  5ICG A;  1HSJ A;  2XAJ A;  3P9C A;  1YO5 C;  3FHZ A;  4HF2 A;  1EH8 A;  4YFX F;  3P9I A;  4MHG A;  2F5F A;  4WXH A;  4PZJ A;  3FWE A;  1FSH A;  4OIP F;  3E6D A;  1I27 A;  4RB2 C;  3O2P E;  3FM5 A;  5D6F A;  2P7C B;  1YIO A;  3FMS A;  3TO9 A;  1ZN2 A;  5CVR A;  5LBQ A;  2ZNZ A;  3PQK A;  4EMS A;  5BOX A;  4M71 A;  1J75 A;  4KMF A;  1CGP A;  1R1V A;  4U0V A;  2LSO A;  2O3F A;  4ZYD A;  1J59 A;  2M1B A;  2DK5 A;  1RIO H;  5E1Z B;  5LEJ A;  3EET A;  4RGS A;  2G7H A;  1YW7 A;  2KKO A;  1D8K A;  2FU4 A;  3WTT C;  2YR2 A;  4ZZD A;  1ZRF A;  3K69 A;  4EV0 A;  1TBX A;  1QBJ A;  1UHM A;  3ABU A;  1B59 A;  4UV9 A;  3FXR A;  3GO5 A;  5E8G A;  4L9J A;  1FP1 D;  2HGC A;  2KIM A;  1V3F A;  4G6D A;  3OOP A;  2GQQ A;  4A6E A;  1WWX A;  1VTN C;  4GCV A;  3HRT A;  1SD7 A;  3C3W A;  4K2E A;  2NAZ A;  1G3S A;  3DPT A;  4HLY A;  4A5N A;  5J6X A;  2ZJ2 A;  5HDN A;  1XCB A;  3WTS C;  1NHA A;  1T39 A;  2W84 A;  3FXQ A;  4L0Z B;  4KUM A;  1R7J A;  1YW8 A;  2CFX A;  5ILS A;  2OBP A;  4G9Y A;  2ZNY A;  4A5M A;  5D8L B;  4HDV A;  4IXA A;  3CLO A;  2RN7 A;  3IL2 A;  2VBW A;  3FMR A;  3IWZ A;  5FFZ A;  2MD5 A;  5FD5 A;  3CUQ B;  5LHI A;  1K6O A;  1Z05 A;  3TO7 A;  3HRM A;  1S7A A;  3KCC A;  5BPD A;  4LJZ F;  5E17 F;  4OIR F;  3HTU A;  1MDM B;  1KYW A;  3TDZ C;  1IXR C;  4RB3 C;  5K5Q A;  2O0Y A;  3U2R A;  1IZ1 A;  1O3R A;  2L01 A;  1TQM A;  3WU1 B;  1T38 A;  3ULQ B;  1K78 B;  4P9F A;  2HWV A;  2AS5 F;  4L0Y B;  4U88 A;  5HLI A;  1U2W A;  3GFM A;  2BYV E;  4LLL A;  5L3C A;  1OPC A;  5IT3 A;  4AIH A;  3F8F A;  2PLY A;  2QZ8 A;  4L9T A;  2V79 A;  4Q4Z F;  4R8H A;  5L3E A;  5AON A;  3WGH A;  2O03 A;  4MGR A;  3I4P A;  4KIB A;  4YIF A;  5HVQ C;  4CIC A;  2Z5U A;  1YQA A;  3Q5F A;  4OOI A;  1QNT A;  2IA2 A;  3TDU C;  4S04 A;  3T8T A;  1TW2 A;  4LLN A;  4ZYG A;  3MZH A;  4ESB A;  3QP5 A;  5DV5 A;  3JSP A;  4WF2 A;  3BDD A;  1ZRC A;  1JXS A;  5ERI A;  4M9Z A;  3LQQ A;  1U78 A;  3K1M A;  4BHP A;  2NNY A;  1P2F A;  3HOT A;  1DP7 P;  5FB2 A;  2L02 A;  4YII A;  2GA2 A;  2VN2 A;  3B02 A;  4Q48 A;  2DK8 A;  4GXO A;  1P4W A;  4FT8 A;  2XIG A;  3I54 A;  3WE3 A;  4ZYH A;  3Q9V A;  4L9N A;  2YX4 A;  3DXJ F;  2FQ3 A;  3WGG A;  2IVM A;  3G73 A;  4LB6 B;  3KEQ A;  1FPQ A;  1RUN A;  2CGP A;  2HS5 A;  1H0M A;  2QYO A;  1BIA A;  2JT1 A;  3K9T A;  3J7A O;  3PQJ A;  1QQI A;  4DNC A;  5LEK A;  3TOB A;  1C0W A;  4UVC A;  3KP2 A;  4KDP A;  2L4M A;  1ZGJ A;  2ZBK A;  5DD4 A;  5H6Q A;  4RAY A;  2FBK A;  4LGW A;  3V8J A;  2J5O A;  1IXS B;  5CVJ A;  2KJB A;  4A2U A;  1LNW A;  3VOE A;  3EYI A;  3KLO A;  1SD4 A;  4Y15 A;  3F22 A;  5JI6 A;  3TGN A;  1MZB A;  3ABT A;  4LD5 A;  3ZMU A;  5CVI A;  4ON0 A;  1XGS A;  3MCZ A;  1WSU A;  5CYV A;  2HDC A;  4HAM A;  1XN7 A;  4RB1 A;  2EB7 A;  2V9V A;  1Z1D A;  2OZ6 A;  2PN6 A;  4RGU A;  1BI1 A;  5F1R A;  2PJP A;  4HOB A;  1ON2 A;  2RV8 A;  2VBZ A;  4ENM A;  2NS0 A;  1Z6T A;  2DO7 A;  2A69 F;  4BXU A;  3ZMZ A;  5DUI A;  1JHF A;  3GLX A;  4PCQ A;  5FFX A;  1YG2 A;  1FNN A;  1G3W A;  1T6S A;  1KQ8 A;  3GFJ A;  2P6T A;  3L7W A;  4UUV A;  2PQ8 A;  2EFW A;  4MTE A;  3N4M A;  3LAJ A;  3G3Z A;  3KFW X;  2M30 A;  4XSX F;  5CVV A;  3I59 A;  3H92 A;  2CQK A;  1EV7 A;  3L09 A;  4EQQ A;  1HBX G;  1B4A A;  3O3K A;  1J5Y A;  5L3D A;  3JTH A;  3KP4 A;  5DUK A;  1IUY A;  5DD8 A;  4LFU A;  4KA4 A;  3MQ0 A;  1E2X A;  5JFR A;  1SFU A;  3Q9S A;  2FRH A;  5A2Q K;  2VT2 A;  4I2O A;  2HTS A;  5CJ9 A;  5D6E A;  1AOY A;  2HQN A;  3I0T A;  1LDJ A;  2GZW A;  2JPB A;  3RJP A;  3RIR A;  4XSZ F;  2DI3 A;  3I53 A;  4I02 A;  4EGZ A;  1FSE A;  3CTA A;  3WG9 A;  2P8T A;  1IAW A;  1PDN C;  4A0X A;  5AIQ A;  1S8N A;  3IKV A;  5LLQ A;  2GA1 A;  4Y17 A;  2PG4 A;  3F23 A;  5ILV A;  4HW0 A;  4OU0 A;  3TO6 A;  5DCF A;  1BBY A;  4R1H A;  4HX8 A;  3HRS A;  4LMY A;  3ZMS A;  1KQ0 A;  5J8F A;  4EJO A;  5D5X B;  5F64 A;  1B9N A;  3EQL F;  1IN5 A;  2EA4 A;  3HRU A;  3R61 A;  4HA8 A;  3FM3 A;  3QU3 A;  1SAX A;  2RC4 A;  2H09 A;  5L3G A;  3SFZ A;  1SD5 A;  3FXU A;  2K7L A;  3JAM K;  2KIU A;  2XAG A;  5L3F A;  4YFN F;  1LEA A;  2EA2 A;  1P92 A;  4D0P A;  3F21 A;  3SZT A;  2IA0 A;  4CGZ A;  5A2Q Z;  4JBA A;  1DPR A;  5K5R A;  3V8L A;  1LQ1 A;  1BC8 C;  3GYH X;  3HIF A;  2M5W A;  3BJA A;  5HDG A;  4NQW A;  3ROU A;  3ZP5 A;  3KP6 A;  2PFB A;  1OYI A;  4WX9 A;  5FO5 A;  2H27 A;  2LKP A;  1P4X A;  4HQM A;  2P7V B;  1Z6R A;  4G7H F;  1J9I A;  1ULY A;  2K4J A;  3M7G A;  2QEN A;  4ETS A;  5E8I A;  3BP8 A;  5E18 F;  4IJA A;  4DQ2 A;  1IN7 A;  2VC0 A;  2VE8 A;  2NRA C;  2VC1 A;  1E17 A;  2KIF A;  4CO8 A;  2NNN A;  5E1W A;  4MQV A;  3GVA A;  3JAM Z;  3R60 A;  1XDS A;  1W5T A;  3RDI A;  4KYW A;  2OD5 A;  3VB2 A;  3VOD A;  1WI9 A;  2RQP A;  2RGV A;  3REO A;  1LVA A;  2Y48 A;  3L9F A; 
#chains in the Genus database with same CATH topology
 1F36 A;  2DT5 A;  3LA2 A;  3BZ6 A;  5FJ8 J;  3M3Y J;  1BJZ A;  1O7F A;  3K4L A;  5F0H A;  3C1D A;  2QA4 I;  3TW6 A;  5TIS C;  2QCO A;  4A6D A;  2CQX A;  1LUJ B;  2DMQ A;  2IBD A;  3C2H A;  1F4K A;  1EF4 A;  4BYY A;  3HPG A;  1R1U A;  1R49 A;  4RAG A;  2ME6 A;  3OL4 A;  1I5Z A;  2LNB A;  3ABK H;  2JTV A;  2K9S A;  1JT0 A;  2LY2 A;  2Y0S A;  4PJJ A;  3S2W A;  1MSE C;  2QQA A;  1DU0 A;  1R1T A;  1IRF A;  1O3S A;  4IHS A;  4IHV A;  2EH3 A;  1HKQ A;  1BJA A;  1NTC A;  2MC3 A;  2DDA A;  4DYQ A;  4RAF A;  2WC2 A;  4XKB A;  2OU2 A;  1HW1 A;  2JRT A;  2A6H F;  1IRZ A;  1VQN I;  3C7J A;  1KU9 A;  3BR5 A;  4M9S A;  1GV2 A;  1S72 I;  4BQA A;  3M07 A;  3OSG A;  4F3Q A;  1U6G A;  3H3V K;  2XHK A;  2W25 A;  4EM2 A;  4FHT A;  1WGX A;  3CUO A;  2K86 A;  4IEJ A;  2E60 A;  5JR3 A;  4BHB A;  2HYF A;  4XBF A;  5KK1 A;  4LK0 F;  1BI3 A;  5IP6 A;  1LDK B;  4PJ0 C;  1STZ A;  3A2K A;  4B09 A;  2P4W A;  3BG9 A;  3HSE A;  5LHG A;  3HL2 A;  4KIC A;  4G7Z F;  2XB0 X;  2CWE A;  1GLN A;  1I3Q J;  4WXD A;  3VWB A;  1AKH A;  3VEP A;  1XCV A;  1S7O A;  3LOC A;  1U3E M;  4Y4R A;  5H2F C;  2YX7 A;  1OMI A;  1X4O A;  2M0M A;  2X6X A;  1JHH A;  1QPM A;  4MTD A;  1W0T A;  1BA5 A;  4CXF A;  3CCU I;  1U5T A;  3RTR A;  2XB5 A;  3HEF A;  3CCJ I;  1QGP A;  2HDW A;  1J7K A;  3WTX C;  1GXP A;  2M3A A;  3ZXS A;  3KP3 A;  2LR8 A;  2GAU A;  1A6I A;  4BUP A;  2M8E A;  2BE5 F;  4L18 B;  1ZYR F;  2E34 A;  3OV8 A;  3QOP A;  3JRE A;  3GZ5 A;  3ERE D;  2XGX A;  4CSW A;  2A61 A;  2L4A A;  5GAD J;  2GOX B;  3LST A;  3TL4 X;  5EJC A;  2DJN A;  5DTD A;  2IGN A;  4IVN A;  1BR1 A;  4J00 A;  3SJM A;  4BBR J;  3PO3 J;  1OKR A;  2HOE A;  1W7P A;  2EIM H;  2W57 A;  1REP C;  2EZH A;  2E36 A;  3VYT B;  3FIS A;  4FAS D;  4M9X A;  4R79 A;  4LG3 A;  4DOZ A;  2ELH A;  3BC8 A;  3HC7 A;  3OOU A;  2PEX A;  4WCG A;  1O57 A;  5K7F A;  5JHU A;  2B9S A;  2IT0 A;  1RKW A;  4B3X A;  5GAG J;  2UV1 A;  3HOU J;  4MNU A;  5F0C A;  3JRA A;  4HQE A;  2VOD A;  2W00 A;  1OLT A;  1MD0 A;  4IX7 A;  5DEQ A;  3L00 A;  3HSR A;  2K02 A;  2HYG D;  3GTO J;  2P5V A;  3RCO A;  1H9T A;  4HZF A;  3MKZ A;  4OIO F;  1XMK A;  4E7J A;  3CF5 F;  3CJQ B;  3BWG A;  5F6F A;  1X3W B;  2L3D A;  4I7H A;  2IXS A;  2VXZ A;  3H3Z A;  3S1M J;  2E5N A;  1I1G A;  3CCY A;  1TWC J;  3MKY B;  2F5E A;  2OCE A;  1LDD A;  2ZXJ A;  3CZ6 A;  3DBH B;  2DMT A;  3QPS A;  1T8I A;  1LVK A;  1E3O C;  2Z9O A;  3S16 J;  5FKN A;  5C3E J;  2OZU A;  2XSJ C;  3DF8 A;  4OMY A;  2WAQ A;  2ZSI B;  2FMY A;  2KIQ A;  3OYF A;  2Z1D A;  3ZMV A;  3HB9 A;  1EJ9 A;  1F1Z A;  3SXY A;  3OYK A;  1LEB A;  1CQT A;  1BR2 A;  3F3X A;  3FHN A;  1MBF A;  3W6K B;  3ZQH A;  3C18 A;  3COA C;  3JTG A;  5DM7 F;  2BVL A;  2QUF A;  2XRO A;  1VQ7 I;  4UNO A;  2PBI A;  4E7Z A;  3CES A;  1UCR A;  5LGN A;  5LHH A;  4GYG A;  2FX0 A;  1IDY A;  2D1V A;  3WTU C;  4B43 A;  3I58 A;  5EEH A;  1XSD A;  3E6C C;  2DPU A;  2LC2 A;  1Y0U A;  1VQ9 I;  1FOK A;  1PP7 U;  3ZGK A;  1YE9 A;  3PFI A;  4XN3 A;  3ZPL A;  2ZB9 A;  4WWC A;  5FKO A;  3WGI A;  2OTL I;  4NHJ A;  1MMS A;  1KA8 A;  2CJJ A;  1QVT A;  2Z3Y A;  3BPV A;  1HDD C;  3EUH A;  3PUF A;  3WHC A;  5HNF A;  3I59 B;  2C6Y A;  1KU2 A;  3FIW A;  4F91 B;  2Z33 A;  2RVC A;  2R93 J;  2W1O A;  1Z77 A;  2WBM A;  3ECO A;  2CG4 A;  3E5Q A;  1DPU A;  3IH3 A;  3WTY C;  2HVR A;  2FE3 A;  4XOP A;  3IAS 2;  2YU9 J;  3FXO A;  3TW7 A;  4U0W A;  1TQP A;  3FBN B;  2X0L A;  3A03 A;  3ERM A;  3F72 A;  1WKM A;  2LF7 A;  3GLL A;  1T98 A;  2W24 A;  2FXA A;  1HKT A;  2XKO A;  4BL0 B;  4KMU X;  4W1U A;  4P9U A;  5EZH A;  4ZDO A;  2MBF A;  3EYY A;  3FXM A;  3GW2 A;  2WY8 Q;  1G8X A;  1JI8 A;  1TWA J;  4RS8 A;  5DS9 A;  1TWF J;  2ID6 A;  1PVE A;  1QHH D;  3ESW B;  1OCP A;  3HZJ A;  2GXB A;  1IN6 A;  5KAI C;  4B1R A;  5IOY A;  4IZZ A;  3M1C A;  3S3M A;  3QU6 A;  2XKP A;  3GEZ A;  1G3T A;  4KNY A;  3SZP A;  4A3M J;  3BT9 A;  2ZJP F;  5DM6 F;  2A05 A;  4NC8 A;  1TWG J;  2RKH A;  1BR4 A;  2AHQ A;  1P7J A;  3T5X A;  2MH9 A;  2L7K A;  4PK4 A;  2JPC A;  1V5G A;  4J01 A;  4I0A A;  2HOS A;  3RPQ A;  1FBS A;  1MJA A;  2LMD A;  2ISZ A;  1TTY A;  2NS7 A;  1G3Y A;  4BEH A;  2YPR A;  1U5T C;  2YS9 A;  5M5X J;  1YFH A;  1IN8 A;  4PGH A;  2W7N A;  4EJT A;  3IHU A;  3DBL B;  2LD5 A;  1AA7 A;  3GX4 X;  4U0Y A;  4ABZ A;  4S0H B;  3LSP A;  1RR8 C;  2OTJ I;  2Y9Y A;  4G6Q A;  1KZH A;  3A02 A;  3E97 A;  4FCY A;  5H6R A;  2DA4 A;  4X6A J;  2AO9 A;  2LBF A;  1VQO I;  1FMV A;  3F6O A;  2KZV A;  5DYM A;  3F8M A;  2WV0 A;  3QAH A;  2XPV A;  5LRR A;  5LD2 C;  4Q5S F;  2QWW A;  4U87 A;  4HLX A;  1D3Y A;  3E6M A;  4UXN A;  5JVT A;  3OIQ A;  1U8R A;  2DFF A;  3BR3 A;  2HR3 A;  2VB6 A;  2RQQ A;  1ETX A;  2F4O B;  3SZG A;  5M3M J;  1UHW A;  3NQO A;  3WTW C;  5TRD A;  4FIS A;  4QTR A;  2YSR A;  2NXN B;  2E1N A;  3OS0 A;  4BE2 A;  2D45 A;  5ICE A;  1R22 A;  4HV5 A;  3H35 A;  1XSX A;  3GTK J;  2WAF A;  3KZZ A;  4KIF A;  3J81 K;  1T08 B;  4HDU A;  4II3 A;  4FX0 A;  3GTM J;  4GGG A;  4W97 A;  4KT5 C;  3JRF A;  1RPW A;  2CUF A;  3SDG A;  2LY9 A;  3BJO A;  4YG2 F;  2DPD A;  3P9K A;  3DBR B;  3HYI A;  4ZYE A;  2VPL A;  5EG0 B;  4AYB N;  5B3S H;  1O4X A;  3OYG A;  1LB2 A;  2EV5 A;  4N0B A;  4LB5 A;  2Y30 A;  2BVM A;  4C3J J;  2X4H A;  1FZP B;  2WA0 A;  1FOY A;  4C30 A;  1BOA A;  4M72 A;  4ASN A;  4DYR A;  1TW3 A;  3BOQ A;  4BNC A;  1IF1 A;  1FP2 A;  4F52 A;  2VLA A;  3QRF F;  4B8X A;  1IGN A;  5F0F A;  3D1N I;  2XPW A;  2IAI A;  5BPI A;  1OCO H;  3I3L A;  1BW6 A;  2B7E A;  3R4K A;  3TQN A;  1HC8 A;  5ICC A;  3D5R C;  4NQW B;  1YJW I;  3EDP A;  1W5S A;  4KJZ A;  1YJN I;  3LA3 A;  2IS1 A;  1ON1 A;  3DEU A;  2L7Z A;  4LIV A;  3S14 J;  3KEO A;  1YS7 A;  3V42 A;  2HZD A;  3SEQ A;  3KX2 A;  2EJR A;  4BXF A;  1MKM A;  3K1N A;  5IOZ A;  3CQZ J;  2JWT A;  3ZMT A;  1ZG3 A;  2Q2E A;  5IT9 K;  3EUH C;  3AG1 H;  1KU7 A;  1ETQ A;  1JUP A;  2EZL A;  4HX7 A;  4BH9 A;  3HKZ A;  3FF5 A;  3HUG A;  4BE0 A;  1XGM A;  1SD6 A;  5CLS A;  4A3L J;  1MW7 A;  1IO2 A;  1AWC A;  2UXN A;  5ICF A;  2O5R A;  1OR7 A;  2KJC A;  4RGR A;  1JKR C;  1B8I B;  1E0E A;  2DFE A;  3A01 B;  2KRF A;  4CCK A;  1MBJ A;  3OYN A;  4D9J A;  2X48 A;  2K5C A;  2QBY A;  3E5U A;  2WAD A;  3HOS A;  3LFK A;  4KFC A;  2ZME A;  2EQR A;  1KQ9 A;  3KP5 A;  2GOM A;  4RAZ A;  4UY8 I;  3IRR A;  4N9H A;  3Q0V A;  3U1K A;  3VYR B;  5JVG F;  2Q1Z B;  4LOC A;  4A3E J;  3J81 Z;  5LRS A;  1Y0N A;  3HPH A;  4UV8 A;  2XAQ A;  1T0F A;  2BEO A;  3UNG C;  4YRV A;  1RZ4 A;  1TLH B;  2DLL A;  3WOD F;  2F4M B;  5J8C A;  2V26 A;  5D8K B;  2UZK A;  2V6E A;  4AWX B;  4EM1 A;  1X1P A;  3F8B A;  3FBI B;  1TL8 A;  3QOE A;  2F5V A;  2CSO A;  2QKM B;  3HOX J;  1XDU A;  4P5O A;  1LJ9 A;  2K27 A;  3MZY A;  5FRM A;  3CC4 I;  4H0E A;  1WJE A;  2XVC A;  3DKW A;  2MC4 A;  2TRT A;  5FLV A;  4DGW B;  5EEA A;  4D5F A;  2DAO A;  2UWM A;  3BPX A;  2NS8 A;  3PO2 J;  4EJU A;  1SAU A;  2Y0M A;  1VQ5 I;  1ZK8 A;  3CJR B;  2XDV A;  3CCE I;  4GRI A;  1W7P D;  3F8C A;  4J19 A;  2IA1 A;  3LSI A;  2LOO A;  3I71 A;  1S29 A;  2V7F A;  2G7U A;  1SMY F;  4HYE A;  3OYA A;  3CP8 A;  1JJ8 C;  3OS2 A;  1FYM A;  2FNA A;  2DCE A;  2ESN A;  3PUB A;  3BLY A;  5E3M A;  2KL4 A;  2M4K A;  3KIO A;  3PSI A;  3ZQG A;  2E2J J;  1YI2 I;  3OY9 A;  2LDU A;  2EIK H;  4PUS A;  1XMA A;  4CYD A;  3T8R A;  1B72 A;  4HPQ A;  5IT9 Z;  4O3M A;  2IPQ X;  2QVO A;  4HV6 A;  3LSR A;  2NVY J;  2DXI A;  4P55 A;  2XUB A;  1RUO A;  1JUS A;  2X6W A;  1D5V A;  2DA2 A;  2O61 A;  3WTZ A;  2VBY A;  3HG9 A;  2DBB A;  2ZFW A;  4XID A;  4IHW A;  2X6O A;  2LRD A;  3GWZ A;  2ESH A;  1YOV B;  2P5L C;  3CDL A;  2UUZ A;  2K9Q A;  3ECH A;  4I0B A;  4ZDP A;  4RM2 A;  1VQ4 I;  4MQ9 F;  2CUE A;  5LGT A;  1LFP A;  1UST A;  2V1X A;  1W4M A;  2GXA A;  3ZR8 X;  1YRN A;  2ECC A;  2D1H A;  2EV6 A;  5JLX A;  4UHT A;  4ZH4 F;  3KYL A;  1UHS A;  3QOD A;  4AID A;  5EYR A;  2FOK A;  2WTE A;  2DFI A;  2P6S A;  2H8R A;  2EFP A;  1I6X A;  3MVP A;  1E3H A;  2LK2 A;  3U9G A;  4E7S A;  2JUC A;  1LE8 A;  3QPT A;  1AKH B;  3J80 K;  1DQU A;  2DFH A;  5HLG A;  4ENN A;  2BBY A;  4IQ4 A;  4G94 A;  3CJT B;  3P7N A;  1U5T B;  2D2W A;  2E71 A;  3DPL C;  1HW5 A;  3RKY A;  4A3D J;  4X0G A;  2JSC A;  2L7M P;  3I5U A;  3GTJ J;  4NC6 A;  1NK3 P;  5J1Y A;  2BW3 A;  1W0U A;  3GUD A;  3L2Q A;  5DCM A;  2R7S A;  3CMY A;  2VT3 A;  3CDH A;  1HST A;  3OSF A;  4ZJZ A;  1TT0 A;  1M1E B;  4IPA A;  4TV7 A;  3U1D A;  4DW6 A;  1HQC A;  1K7A A;  3K4M A;  1W7P B;  1XD7 A;  5E1X A;  2A68 F;  1ZAR A;  2H6C A;  4JX4 A;  1OYW A;  1YTY A;  4ZC3 A;  4GYI A;  1PUE E;  1RET A;  2TDX A;  2BOL A;  3S3N A;  4XRF A;  4QLC U;  1OR7 C;  1X1A A;  2DT6 A;  5IY5 H;  2AXL A;  4XLP F;  4AC0 A;  2KPM A;  3BTJ A;  4HST A;  4YEJ A;  3VFZ A;  4I09 A;  2F5D A;  4MIM A;  1ZAO A;  2CO5 A;  5M5Y J;  2W85 A;  5KNL A;  3G4S I;  2CW7 A;  2PMH A;  2ZJQ F;  1D1B A;  2JUG A;  2ZME C;  3BY6 A;  2EFN A;  2E5Z A;  2M34 A;  2V1N A;  1JTX A;  1ACI A;  2IGK A;  3LWF A;  3DU5 A;  1ZRD A;  2DA7 A;  5F08 A;  5EZG A;  2PMZ A;  1O7L A;  1T2K A;  2RNJ A;  1F9N A;  3RZD J;  4I98 B;  4IO9 F;  2V6C A;  4DBQ A;  3R0A A;  2EIL H;  1ZG5 A;  4JX6 A;  4PJM A;  1T0F C;  1USS A;  4HSR A;  4F7Z A;  3E3V A;  1G59 A;  4XRS G;  5F04 A;  2ZKZ A;  4BY7 J;  5D4S A;  1L3L A;  1GXQ A;  4BGD A;  3JCU C;  1SFX A;  3QYB A;  3PIP F;  5EF6 A;  2R5Y A;  4A3J J;  3ZMD A;  4EJV A;  1MMN A;  4BKX A;  1UFM A;  1JE8 A;  1BL0 A;  1GVJ A;  1AU7 A;  1S7E A;  4IF4 A;  5C44 J;  3KET A;  2HFH A;  2L9S A;  2BGC A;  3J80 Z;  2ZXI A;  1EH7 A;  5CPR B;  2H94 A;  2E7W A;  1OCC H;  3PNT A;  2ZCW A;  3G2B A;  3L2U A;  3AG3 H;  4Q47 A;  2FNP A;  2CW0 F;  3CLQ A;  3O6B B;  3SEZ A;  1Z0X A;  2R7V A;  3F8N A;  4DZJ A;  3CJN A;  1A6Q A;  2M9H A;  2QQ8 A;  1CF7 A;  3QP6 A;  2F4I A;  5LGU A;  3V7C A;  2H6B A;  1G4D A;  1JKO C;  2FJ1 A;  2GIZ A;  4EVI A;  2BZT A;  3CMM A;  2OQG A;  3P5J A;  2RAE A;  1S5L C;  3LA7 A;  1ONV A;  3H0D A;  4RLF A;  1JKQ C;  1R5G A;  2R7W A;  2HDD A;  1FYK A;  2V4J C;  1IJW C;  2D5V A;  3V7S A;  4LIU A;  5BQT A;  5LFA A;  4AVZ A;  3WTV C;  1ZG1 A;  1ZEL A;  1MBH A;  2KHM A;  5KHD A;  3LQR A;  5B5E C;  3PFY A;  4CCJ A;  2R7F A;  1ZGA A;  2Z99 A;  2R4G A;  2VL8 A;  3FMQ A;  2ETH A;  3QPH A;  1R71 A;  2A07 F;  3ZRG A;  2KDZ A;  4BDZ A;  3AAF A;  3HGY A;  4AD9 A;  4ENK A;  1B6A A;  2QM3 A;  5AIP A;  1X1B A;  2M2E A;  3AFH A;  2R5Z A;  4IL6 C;  3RKW A;  2QQ9 A;  4C3H J;  3T1B A;  3J7A Y;  4NUB A;  1TNT A;  3H3U A;  2ZFU A;  4LK1 F;  2DQR A;  4L5J A;  2Q8K A;  2K3P A;  2XAF A;  2X6Y A;  4BS9 A;  1WQ2 A;  2CMP A;  1R5I D;  4I6Z A;  3HM5 A;  3SYT A;  4DZP A;  4N4N B;  1TQI A;  1FMW A;  4JYK A;  4IRH A;  5H20 A;  4BAC A;  4X1E A;  4MEX F;  3TBI A;  1XG1 A;  2MLK A;  1I50 J;  1X2N A;  1FJL A;  2E19 A;  1FBQ A;  1ZLJ A;  2XGC A;  4L9V A;  1HW2 A;  4BEH B;  2STT A;  6PAX A;  1WH5 A;  3M1E A;  4E7L A;  4IRG A;  1JUM A;  2Y31 A;  4RBO A;  2P5K A;  3R0J A;  4M3D A;  4CA0 A;  2FUG 2;  4LG0 A;  1XGO A;  4QPO A;  4M6Y A;  5FLX K;  3ABL H;  2H8W A;  3OMY A;  2GIV A;  1GHC A;  3KZY A;  1FIP A;  1Y39 A;  2X51 A;  4CCM A;  3GTG J;  3H5A A;  3O8H A;  2CH0 A;  3W6J B;  4B44 A;  1WJ5 A;  4NNJ A;  2R7D A;  1BN5 A;  1HKS A;  2ZC2 A;  3FK7 A;  2DN0 A;  3GZ6 A;  2LBF B;  3WU0 A;  2NYX A;  1MIJ A;  5E20 A;  4AVP A;  2VJ5 A;  4M3E A;  5K7Z A;  1YJ9 I;  1FOX A;  1ZR4 A;  2R7Z J;  4LLG F;  2FBH A;  5DDG A;  3KLN A;  1RNL A;  4II2 A;  4YFK F;  1YW9 A;  2MA3 A;  3CCR I;  1PYV A;  3S1N J;  3V4G A;  4C2M J;  2EWN A;  1IC8 A;  1UAA A;  2QSG X;  3VYS B;  4XK4 A;  4U7D A;  4NB5 A;  3A0H C;  2WB1 A;  2K85 A;  3U21 A;  4ESF A;  2QKL B;  5KAF C;  1GUU A;  2JA8 J;  5CVU A;  4PFP A;  2M8G X;  3DP7 A;  3K1P A;  2F2E A;  2JQ7 A;  4XQF A;  3K4B A;  3IWF A;  2GM4 A;  3DQV C;  1KU3 A;  1F43 A;  1B9M A;  4I76 A;  1XC5 A;  3FKI J;  3BTC A;  4FTH A;  1QU3 A;  5D4R A;  3RYP A;  3S2D J;  2BY1 A;  2HXI A;  2DA1 A;  2EK5 A;  1ZRE A;  1HF0 A;  1FC3 A;  2EIJ H;  1IRG A;  4A0Y A;  1MMD A;  3RPU A;  3DCF A;  2OV7 A;  3OYC A;  3LSJ A;  3OWT A;  1I3A A;  3ZQI A;  4DYC A;  5KVR A;  3QQA A;  5HOO A;  4P96 A;  2FEZ A;  1RI7 A;  2JZY A;  5TJJ A;  4Y13 A;  2IS6 A;  3BZC A;  3NRV A;  3ISP A;  5J47 A;  1JJ6 C;  1MJ9 A;  4G7O F;  1HXD A;  1T33 A;  3ML6 A;  1IN4 A;  3DV8 A;  1H89 C;  4CCL A;  1FWZ A;  1KGS A;  3S93 A;  3TKY A;  4XLF A;  4QWQ A;  1DUX C;  3V7R A;  2UXX A;  4G8X A;  4BY1 J;  1P4A A;  1SEU A;  3CO6 C;  4OIQ F;  1MBG A;  5B1B H;  1D5Y A;  2HEO A;  3BG6 A;  1ODD A;  1OYY A;  2B63 J;  2RDP A;  1DGW Y;  1T56 A;  1ENH A;  1U0J A;  2DW4 A;  2HI3 A;  3EUA A;  1ZTR A;  4DIQ A;  3I64 A;  3K70 D;  2W82 A;  2I8D A;  2ZO4 A;  3HSF A;  4CHU A;  1S3J A;  3B6C A;  4EM0 B;  1A5J A;  5ILU A;  2FOW A;  4AIK A;  2COM A;  2K9N A;  3CO7 C;  3M9A A;  2V1U A;  1ETV A;  5FLX Z;  2OA4 A;  1BI0 A;  2KP6 A;  2Q2E B;  2FD5 A;  4HBL A;  4AUX A;  3BG7 A;  2O9L A;  5KCM A;  3KE2 A;  2PMU A;  3HDD A;  1EA3 A;  2XAH A;  4JK1 X;  2PI0 A;  5GTI C;  2HTJ A;  5HDK A;  1WFX A;  2O6G E;  1XSV A;  3D5S C;  3HUG B;  1LFB A;  1WZ2 A;  3GFL A;  3JSO A;  3MAJ A;  3M4O J;  4NC7 A;  3OR1 C;  3HXL A;  5GPA A;  2EZI A;  3ZQL A;  4HNU A;  4IHY A;  1JTY A;  1D8J A;  4JX5 A;  1X3U A;  3MWM A;  1DDN A;  2TCT A;  3TP0 A;  4UVB A;  3C2B A;  1W5C C;  1Z3Y A;  5FKM A;  4WK8 F;  4ESJ A;  4EJW A;  2VE9 A;  3BJ6 A;  2QBY B;  4I99 C;  1KYZ A;  1A04 A;  2Y75 A;  4EGY A;  3N97 A;  3HTS B;  3JR9 A;  4A12 A;  2QLZ A;  2ZME B;  4H4K C;  4XKV A;  5HS7 A;  1RC9 A;  3GBG A;  2BXY A;  3K4K A;  3OYH A;  2FSW A;  2BV6 A;  4D7M A;  4CYC A;  2VBX A;  2NOJ B;  2M87 A;  1WJC A;  2VOP A;  4HRI A;  4WXC A;  1Z7L A;  3JW4 A;  3CME I;  1TNS A;  3BQY A;  1O3Q A;  2HU9 A;  2VQC A;  1FYL A;  5FKK A;  2LYC A;  3QWL A;  2R92 J;  1SVO A;  1BOB A;  1R00 A;  4RB0 A;  2R7R A;  4ZTF A;  3IRQ A;  2LF8 A;  1FBU A;  1X3Z B;  3GCM A;  5GPC A;  1FX7 A;  2HVQ A;  4ENJ A;  3CUQ A;  3BRO A;  4D5C A;  4RA2 A;  4PDK A;  3F6V A;  3H9Q A;  1K4T A;  4BAY A;  3K0L A;  5K1Y A;  3SQN A;  4IRI A;  1V55 H;  2VQH A;  3PM1 A;  1H9G A;  2GXG A;  4HF0 A;  3ONQ A;  1VQP I;  1IW7 F;  2LY1 A;  1MDM A;  2FML A;  1ZR2 A;  3ZQ7 A;  4BHC A;  1K6Y A;  2HZT A;  3SDB A;  1IG7 A;  5FD6 A;  3JRI A;  3KP7 A;  3C2G A;  1P9Q C;  1G6N A;  3FZV A;  1Z3X A;  3M8F A;  3MEX A;  1YLF A;  3RKX A;  2VKE A;  4RM3 A;  3VDX A;  3M8E A;  2XAU A;  5D5W B;  3W6V A;  3E6B A;  3G71 I;  3Q0W A;  3PL8 A;  2OF7 A;  1MNE A;  1K78 A;  1B72 B;  2JK3 A;  3R6S A;  1XGN A;  2QGU A;  2VJJ A;  2VQG A;  3SFI A;  2E1C A;  1IV8 A;  2EFO A;  3RZO J;  2DOA A;  3RI4 A;  1MNM C;  3MKL A;  4FX4 A;  3GFI A;  5HS8 A;  2ACJ A;  3HJE A;  1OCT C;  2RNG A;  4UB8 C;  4OIN F;  1WRJ A;  1QO0 D;  3B73 A;  2ADU A;  2XRN A;  4XKC A;  5C4X J;  1EH6 A;  2DOE A;  1YHQ I;  1ZLK A;  2FQ4 A;  3F0C A;  2XF7 A;  1GV5 A;  2G9W A;  2J5P A;  5BMZ A;  4HEA 2;  5ED4 A;  1WJD A;  2FA5 A;  1V5E A;  4XON A;  4AU7 A;  3L2R A;  1IXC A;  1YRN B;  4IHT A;  2K4B A;  1A35 A;  1L0O C;  4AM3 A;  2DU9 A;  3WG7 H;  3TOA A;  2LLK A;  2VON A;  3KZI C;  5D5U B;  1N78 A;  1X4P A;  3FDY A;  2KRH A;  3GXO A;  3HHH A;  2F5C A;  3LSG A;  3FXK A;  1LE8 B;  3RYR A;  1UB9 A;  3NEU A;  2WWY A;  1QPI A;  4KN4 X;  2IW5 A;  1J2X A;  3F9K A;  1BC7 C;  1SC7 A;  3MN2 A;  3IC7 A;  3DU6 A;  4OMZ A;  1SMT A;  3OIP A;  5EGO A;  3MD2 A;  2BY2 A;  2E2I J;  1B1B A;  3OYI A;  2YUS A;  1R5H A;  2FF4 A;  3RSN A;  4U7B A;  2L5Q A;  2JVH A;  5HLH A;  3L2C A;  2XV4 S;  3W2V A;  2BW3 B;  4M73 A;  1BIB A;  2KDO A;  5GP9 A;  1Z7U A;  5DCM B;  4XLN F;  4Y7N J;  1F5T A;  2VOO A;  1Q1H A;  1OFC X;  4HX4 A;  5HS9 A;  5J1U A;  2ELJ A;  4B4C A;  2OQR A;  1I1S A;  4O6J A;  2O8X A;  4E70 A;  4M74 A;  1UZC A;  2HKX A;  1V54 H;  3MFK A;  4GO1 A;  2ZSH B;  4N9I A;  1ETY A;  1O3T A;  3AG2 H;  3DFG A;  3ZQC A;  1RRJ A;  1LFU P;  3SHF A;  5FRO A;  5BS6 A;  3CD6 I;  1ERD A;  3H36 A;  3LSH A;  4NDL A;  5K7H A;  2HPI A;  4AIJ A;  1MJB A;  2OAZ A;  1AHD P;  2VJI A;  2STW A;  2YU3 A;  4UVA A;  3ZN0 A;  1RES A;  4RGX A;  2EFQ A;  1T95 A;  2LP0 A;  3CDI A;  2A3S A;  3OYL A;  1XTA A;  3S1R J;  2FBI A;  1R23 A;  2CYY A;  2A5Y B;  2ISY A;  2L54 A;  5F27 A;  3WU2 C;  1FTZ A;  1JGS A;  3E1S A;  3G6E I;  1ZH5 A;  2DTR A;  2AXT C;  3T0Y A;  2Y9Z A;  3K7A J;  3V8K A;  4CDG A;  3H1C A;  1WCM J;  4M6X A;  2QSF X;  3L2V A;  3H0G J;  3KYC B;  2IGM A;  2HKO A;  2IEK A;  2R5Y B;  4BU2 A;  4CZZ A;  2DA6 A;  5TGT A;  2E7X A;  3OS1 A;  2JA7 J;  2EV0 A;  4HNV A;  2R3S A;  5JHF A;  1YS6 A;  3CUQ C;  5IYB J;  2JA6 J;  1QVU A;  4UUS A;  1BI2 A;  1FT9 A;  1GT0 C;  2OPT A;  5EEG A;  1W1W E;  2JVG A;  4E6K G;  2X85 A;  5FGM A;  2E1M C;  2F48 A;  4CCO A;  1Z91 A;  5L3B A;  3MKW B;  1S6L A;  1WPK A;  3E5X A;  4L5I A;  5J3L A;  2B0L A;  2VKD A;  4A0Z A;  3IV5 A;  2CV1 A;  3S8P A;  4O5V A;  3ZN1 A;  1V4R A;  1CF7 B;  1OCZ H;  4KIG A;  4XLA A;  5D5V B;  1G2H A;  2DDB A;  4KN7 X;  4MEY F;  3O8G A;  3K2Z A;  2V1D A;  1DP3 A;  3HHG A;  4PGG A;  1QZY A;  2M45 A;  2VAS A;  2VKH A;  4Z2Y A;  5CKT A;  4HF1 A;  2N8G A;  1YYV A;  3LFU A;  1FLI A;  3NAR A;  2IGO A;  2LH9 A;  3ELK A;  1ZHF A;  4E7K A;  2H1K A;  4AYB A;  2NVQ J;  4JQF A;  3D5L A;  5M5W J;  2DYS H;  3ASO H;  4KT6 A;  5GAH J;  5GAE J;  3J7Z I;  2XGD A;  4L5E A;  1MMG A;  4A3I J;  1XPX A;  3TED A;  3BR6 A;  3RPU D;  1OCR H;  2A6E F;  4ITV A;  2Q0O A;  1WHU A;  3LAP A;  1H8A C;  3NWT A;  3VPR A;  1WH7 A;  5BNG A;  1DU6 A;  4IKF A;  2R5Z B;  1JKP C;  2GWR A;  1P6R A;  2XAS A;  4S05 A;  1MGT A;  4XM3 A;  4B48 A;  3D0S A;  2HQR A;  2MLG A;  2MH2 A;  4XKW A;  1J0R A;  2DQL A;  1FY7 A;  2IJL A;  2WAE A;  2IRF G;  4XL9 A;  4RDU A;  3DLA A;  3KYD B;  1R36 A;  3N05 A;  4I01 A;  3RKQ A;  4XIC A;  1Z9C A;  2QQB A;  1R58 A;  1TZL A;  2JA2 A;  1PP8 F;  1SFE A;  5J1R A;  3FX3 A;  3DTK A;  1QZZ A;  3GF2 A;  2DOD A;  3IKT A;  3LSM A;  4ZZL A;  2IP2 A;  2PJR A;  1HA8 A;  1XB4 A;  2CRG A;  3WE2 A;  1BM9 A;  5K5O A;  4RLQ A;  2LKX A;  4LG0 B;  1K79 A;  1MBE A;  5ICG A;  1A36 A;  1HSJ A;  2XAJ A;  3P9C A;  1YO5 C;  1WJA A;  2M0C A;  3GZN B;  3FHZ A;  4HF2 A;  1EH8 A;  5J4V A;  4YFX F;  2KLO A;  3AKZ A;  2L7F P;  3HBL A;  1XMX A;  3P9I A;  1N25 A;  4MHG A;  2F5F A;  3CCQ I;  4G6T B;  4WXH A;  4PZJ A;  1NH3 A;  3FWE A;  4JOM A;  2GBY A;  4UB6 C;  1FSH A;  4OIP F;  4CUG A;  3E6D A;  2XGE A;  1FTT A;  1UG0 A;  1I27 A;  2LG4 A;  3JRC A;  4RB2 C;  3O2P E;  1YX3 A;  3FM5 A;  1FOW A;  4V19 K;  1Z21 A;  2DOF A;  3L1P A;  5D6F A;  2P7C B;  2EIN H;  1RKT A;  1YIO A;  4FE7 A;  4BE1 A;  4EEF G;  3DPU A;  3FMS A;  1MND A;  1YX5 A;  1ZN2 A;  3TO9 A;  1SVL A;  3MMY B;  4DBR A;  5CVR A;  5LBQ A;  2LTP A;  2XPU A;  2ZNZ A;  1POG A;  3PQK A;  1U9O A;  1Y8Q B;  4EMS A;  1MMA A;  3FK6 A;  3Q3S A;  5IYC J;  4BQN A;  5BOX A;  3RQ4 A;  3HGG A;  3S1Q J;  4M71 A;  3CCV I;  1J75 A;  4IQJ A;  2O8K A;  1SAN A;  4KMF A;  2DA3 A;  1CGP A;  2ZXW H;  1R1V A;  3BQZ A;  4U0V A;  3W2A A;  2QEX I;  1VQ8 I;  2LSO A;  2O3F A;  4ZYD A;  3ASN H;  1J59 A;  2M1B A;  3IH4 A;  2DK5 A;  3OL3 A;  1RIO H;  5E1Z B;  5LEJ A;  2VI6 A;  1H88 C;  1UG2 A;  3PNV A;  3EET A;  2LFB A;  2COB A;  4RGS A;  3DEW A;  4IHX A;  2G7H A;  1YW7 A;  2KKO A;  2R7O A;  2M4G A;  1D8K A;  1D0Y A;  2FU4 A;  3WTT C;  4GFB A;  2YR2 A;  2JN6 A;  4QSH A;  4ZZD A;  4CCN A;  3I4M J;  4XRS A;  2WY7 Q;  1ZRF A;  3K70 C;  3H9J A;  3K69 A;  4EV0 A;  1TBX A;  4PSW A;  4Z6Y A;  3K6G A;  1UHM A;  3X2Q H;  1QBJ A;  3ABU A;  1B59 A;  4UV9 A;  3S3O A;  3FXR A;  1TC3 C;  3K4J A;  4XOT A;  3GO5 A;  5E8G A;  2M7A A;  2CU7 A;  1FP1 D;  4L9J A;  2VUM J;  2XF5 A;  2HGC A;  2KIM A;  3OR2 C;  1V3F A;  2XF6 A;  4MFD A;  4G6D A;  1QRY A;  3OOP A;  2GQQ A;  5FKL A;  4A6E A;  1WWX A;  2I10 A;  1VTN C;  4C2U A;  4FE4 A;  3E7L A;  4D1Q A;  1R6R A;  3DEE A;  4GCV A;  1R4N B;  3HRT A;  1SD7 A;  3C3W A;  4K2E A;  2NAZ A;  3AL0 C;  1Z67 A;  1G3S A;  3DPT A;  3I56 I;  3VSL A;  4A5N A;  5J6X A;  4HLY A;  2ZJ2 A;  5HDN A;  1XCB A;  3WTS C;  1NHA A;  2DT7 B;  2I5U A;  2O7O A;  2KZG A;  2PX9 A;  4M3F A;  1KON A;  1T39 A;  1J09 A;  2W84 A;  4C3I J;  5B66 C;  3FXQ A;  5EDN A;  2JJ7 A;  4L0Z B;  4KUM A;  1R7J A;  1QZE A;  3W2W A;  4CYC B;  1YW8 A;  1X58 A;  5IPA A;  2R7U A;  3S15 J;  4BBS J;  2CFX A;  4BQO A;  2KRC A;  2IS4 A;  3PIO F;  5ILS A;  3BG3 A;  2OBP A;  4G9Y A;  2ZNY A;  4A5M A;  5D8L B;  1I6H J;  1R4M B;  4HDV A;  3OYE A;  4IXA A;  3ZCO A;  2HPM A;  1I39 A;  3CLO A;  2RN7 A;  2HQA A;  3IL2 A;  2VBW A;  1NK2 P;  3FMR A;  3TP3 A;  1ETO A;  3IWZ A;  5FFZ A;  1PUF A;  5F1J A;  5E3N A;  2M7B A;  2MD5 A;  3S32 A;  5FD5 A;  2LVS A;  3CUQ B;  2GLO A;  3OYB A;  5LHI A;  1K6O A;  1Z05 A;  4CH7 A;  2DYR H;  3TO7 A;  3S2H J;  3HRM A;  1S7A A;  2K9L A;  2R7Q A;  3KCC A;  2E1M B;  5BPD A;  4LJZ F;  3LNQ A;  4F93 B;  5E17 F;  4OIR F;  3BCB A;  3HTU A;  2VPR A;  1MDM B;  4ZTJ A;  3JRG A;  3DWL E;  1KYW A;  3BR1 A;  3Q0U A;  2JA5 J;  3TDZ C;  4XLH A;  1IXR C;  4RB3 C;  3GME A;  3AG4 H;  5K5Q A;  2O0Y A;  2CW8 A;  3U2R A;  1IZ1 A;  2P0W A;  3DTE A;  4F92 B;  1O3R A;  2L01 A;  1TQM A;  4UUT A;  3WU1 B;  3CCS I;  1SFK A;  1T38 A;  5E3O A;  3BTI A;  3ULQ B;  4P9F A;  1K78 B;  2HWV A;  3HOV J;  2AS5 F;  4L0Y B;  3VSK A;  4U88 A;  5HLI A;  1R9T J;  2KIS A;  1U2W A;  3GFM A;  2BYV E;  2EBI A;  3IH2 A;  4LLL A;  5L3C A;  3L2W A;  3NWS A;  3OIO A;  2K9M A;  3BCA A;  5J4Y A;  1LKX A;  1OPC A;  5IT3 A;  4AIH A;  3F8F A;  2VJ4 A;  2PLY A;  1U9N A;  4GDF A;  2MFZ A;  2NVX J;  3S17 J;  1IRX A;  2QZ8 A;  4L9T A;  2V79 A;  3K4C A;  4Q4Z F;  3QPL A;  4R8H A;  5L3E A;  1X2M A;  5AON A;  1SFO J;  4E4H A;  2JMW A;  2K40 A;  3WGH A;  2O03 A;  4RMN A;  4MGR A;  2XRL A;  3I4P A;  2DTZ A;  4KIB A;  4QPQ A;  4B3A A;  4YIF A;  5HVQ C;  4OWR B;  2P81 A;  4CIC A;  2Z5U A;  3G1L A;  1PJR A;  1S9H A;  5GTH C;  1YQA A;  3OYM A;  2ZXH A;  1Y1V J;  4MFE A;  3Q5F A;  2MYS A;  2WV1 A;  5EGO B;  4OOI A;  1QNT A;  2IA2 A;  3TDU C;  4S04 A;  3T8T A;  2VKV A;  1TW2 A;  3MZ8 A;  3PNY A;  4LLN A;  1JGG A;  1WJB A;  2R7X A;  4ZYG A;  3MZH A;  4ESB A;  3QP5 A;  5DV5 A;  3JSP A;  1UEL B;  4WF2 A;  2L2O A;  2W48 A;  3ZQQ A;  3BDD A;  1ZRC A;  1JXS A;  1MSF C;  5ERI A;  4M9Z A;  3LQQ A;  1U78 A;  1VQ6 I;  3K1M A;  4KIS A;  4CZC A;  1W36 C;  3H9G A;  4BHP A;  2NNY A;  4PSX A;  1P2F A;  3HOT A;  1D1C A;  2V9P A;  5E79 C;  1DP7 P;  1EKE A;  3G1O A;  2L02 A;  5FB2 A;  3KPH A;  4YII A;  2BY3 A;  1WJF A;  2GA2 A;  3LSK A;  2VN2 A;  4PJN A;  3B02 A;  3E0J B;  2DK8 A;  4Q48 A;  4NBQ A;  4GXO A;  2BHZ A;  2EPF A;  4V2G A;  1P4W A;  4FT8 A;  3JRB A;  2XIG A;  3I54 A;  3M8J A;  4XR6 A;  4YIR X;  1YIT I;  3NAU A;  3WE3 A;  4ZYH A;  4IOC F;  3Q9V A;  2G0E A;  4L9N A;  3ZQF A;  3HKZ N;  2KFD A;  3FXL A;  2MSY A;  4Y3O A;  4HNT A;  5JLW A;  2YX4 A;  3DXJ F;  2FQ3 A;  5J40 A;  3WGG A;  2IVM A;  3G1M A;  4FQG A;  3DKX A;  3G73 A;  2CQQ A;  2MGQ A;  4LB6 B;  3KEQ A;  2HQ5 A;  1XX5 A;  1FPQ A;  2OUM A;  1ETW A;  1A31 A;  1RUN A;  2CGP A;  2HS5 A;  2VIX A;  1H0M A;  2QYO A;  1BIA A;  2JT1 A;  3K9T A;  1ITY A;  2XC7 A;  3J7A O;  3PQJ A;  1QQI A;  4DNC A;  5LEK A;  4A93 J;  3TOB A;  3JRD A;  4UUS B;  1C0W A;  4UVC A;  3KP2 A;  4KDP A;  4ZYA A;  2L4M A;  1ZGJ A;  2ZBK A;  5DD4 A;  5H6Q A;  4RAY A;  2FBK A;  4LGW A;  3GTL J;  3GTQ J;  3V8J A;  2J5O A;  4PFO A;  2ECB A;  1IXS B;  5CVJ A;  2KJB A;  4A2U A;  1LNW A;  2AQE A;  1Y6I A;  2L9R A;  1GVD A;  1YIJ I;  1MH4 A;  2LRE A;  5FRN A;  3VOE A;  3EYI A;  3KLO A;  2CQN A;  2L0K A;  1SD4 A;  1VQK I;  4Y15 A;  3F22 A;  3DLL F;  5JI6 A;  1TWH J;  3TMO A;  3TGN A;  1Y56 A;  2X1C A;  1MZB A;  3ABT A;  3CMA I;  3K10 A;  4LD5 A;  1N77 A;  2Z16 A;  3ZMU A;  3K2A A;  2KT0 A;  5CVI A;  4ON0 A;  4M3B A;  4F55 A;  1XGS A;  3MCZ A;  3H5N A;  1WSU A;  5CYV A;  1OIS A;  2HDC A;  3DTI A;  3AL0 B;  4HAM A;  1XN7 A;  2H1L A;  2E35 A;  5E3L A;  2CUZ A;  2EZK A;  4C2T A;  4RB1 A;  2EB7 A;  4A69 C;  1D0X A;  2V9V A;  1X19 A;  3JRH A;  1Z1D A;  2OZ6 A;  2CUJ A;  1ZKG A;  2NVT J;  1ZQ3 P;  4V2F A;  3A1Y A;  2PN6 A;  4XMY A;  1NG6 A;  1BI1 A;  4RGU A;  5F1R A;  1MBK A;  2PJP A;  4HOB A;  1ON2 A;  2RV8 A;  1X1C A;  2Z2S B;  2VBZ A;  4G12 A;  1VQL I;  5CQE A;  2NS0 A;  4ENM A;  2HOT A;  1FEX A;  1Z6T A;  2DO7 A;  4B47 A;  2A69 F;  1BW5 A;  2A5W A;  4BXU A;  3ZMZ A;  2ICW G;  5DUI A;  1JHF A;  3QYF A;  3GLX A;  4IOA F;  4PCQ A;  3QYE A;  3K4N A;  4A3F J;  5FFX A;  1YG2 A;  1FNN A;  1DGR M;  1G3W A;  5IP9 J;  2HXO A;  2PJR B;  1T6S A;  4E7I A;  1KQ8 A;  3GFJ A;  3UKG A;  2P6T A;  3L7W A;  3FXJ A;  2HVS A;  4UUV A;  1W36 D;  2PQ8 A;  2EFW A;  4MTE A;  2L9V A;  2CS3 A;  2CQ7 A;  3N4M A;  3LAJ A;  2ELK A;  3G3Z A;  1K83 J;  2E2H J;  1LPQ A;  2L9N A;  1VQM I;  3KFW X;  1IDZ A;  1VI0 A;  2M30 A;  1K61 A;  1WI3 A;  4BJ6 C;  4XSX F;  5CVV A;  3I59 A;  3H92 A;  1TP4 A;  3PJR A;  2CQK A;  1EV7 A;  4XNF A;  3L09 A;  4EQQ A;  3HOW J;  1HBX G;  1VF9 A;  4M6V A;  1B4A A;  3RQI A;  3O3K A;  4BJT A;  1J5Y A;  1HCR A;  5L3D A;  3JTH A;  3KP4 A;  4Y33 A;  5DUK A;  2CV0 A;  1QHG A;  1IUY A;  5DD8 A;  4MO7 A;  4LFU A;  3CF2 A;  4EAT A;  4KA4 A;  3MQ0 A;  1E2X A;  5JFR A;  1SFU A;  4BQQ A;  4XLE A;  4DJA A;  3Q9S A;  2FRH A;  5A2Q K;  2VT2 A;  4I2O A;  1NG7 A;  2HTS A;  5CJ9 A;  5D6E A;  1AOY A;  1Y8R B;  3A4C A;  2HQN A;  3I0T A;  3H5R A;  4KIT B;  1LDJ A;  2GZW A;  2IS2 A;  2JPB A;  3RJP A;  3EPZ A;  3RIR A;  4ZDL A;  2X9D A;  2ME0 A;  2Y2Z A;  2OC6 A;  1ORK A;  4XSZ F;  2DI3 A;  3I55 I;  3IUO A;  1APL C;  3I53 A;  2R0Q C;  1VND A;  4I02 A;  4EGZ A;  1FSE A;  1HLV A;  3CTA A;  2DJI A;  3WG9 A;  2P8T A;  2W4S A;  2PMZ N;  1IAW A;  1PDN C;  4A0X A;  5AIQ A;  4BJ5 C;  2BY0 A;  2HNH A;  5IP7 J;  5B1A H;  1S8N A;  3IKV A;  5LLQ A;  2GA1 A;  4ANJ A;  4A3B J;  4A3C J;  4Y17 A;  2PG4 A;  3VYU B;  3F23 A;  2F6C A;  5ILV A;  4HW0 A;  4MLO A;  3FKJ A;  4OU0 A;  3TO6 A;  5DCF A;  5M3F J;  1IV6 A;  1BBY A;  2DMP A;  4R1H A;  3KEY A;  4HX8 A;  3HRS A;  4LMY A;  3ZMS A;  1KQ0 A;  2MD0 A;  5J8F A;  3IP4 B;  4EJO A;  1UMQ A;  5D5X B;  5F64 A;  1QA6 A;  1B9N A;  3EQL F;  1IN5 A;  4N4O B;  2EA4 A;  3HRU A;  3R61 A;  4XLC A;  3I9V 2;  2Y0S N;  4HA8 A;  4LIT A;  3FM3 A;  3QU3 A;  1GDT A;  4BDY A;  1SAX A;  3A0B C;  4BXX J;  2MW8 A;  3DKY A;  1IUF A;  2RC4 A;  4FET A;  4QIW N;  1RR7 A;  1MH3 A;  2H09 A;  5L3G A;  3SFZ A;  2A6T A;  2K3F A;  1SD5 A;  3FXU A;  2K7L A;  3W3C A;  3I4N J;  3JAM K;  2BXZ A;  2KIU A;  1E3P A;  2V9K A;  2BHY A;  2XAG A;  5HOD A;  5L3F A;  4E7H A;  1UJ8 A;  4YFN F;  1LEA A;  2EA2 A;  1P92 A;  3BTL A;  5C4J J;  4XOR A;  4D0P A;  1V5F A;  3F21 A;  2X1E A;  3SZT A;  3HOZ J;  2IA0 A;  5EG0 A;  5IYD J;  2DA5 A;  4HG2 A;  4CGZ A;  2CFO A;  5A2Q Z;  4JBA A;  1DPR A;  5K5R A;  3BR0 A;  3V8L A;  2MAB A;  1LQ1 A;  9ANT A;  1SVM A;  2MG4 A;  2RRE A;  1U8B A;  1PUF B;  4OAZ A;  4M3G A;  1D1A A;  1BC8 C;  4XN0 A;  3GYH X;  2JSP A;  2KMU A;  2M5W A;  3HIF A;  1JT6 A;  3BJA A;  5HDG A;  4NQW A;  3WHB A;  3CP2 A;  3ROU A;  1K4S A;  3BG5 A;  3ZP5 A;  4A3G J;  3KP6 A;  3OYJ A;  1TT5 B;  2ZJR F;  2XSD C;  2PFB A;  5HLT A;  1OYI A;  2NVU B;  2OJE D;  4WX9 A;  5FO5 A;  4Y52 J;  1N75 A;  4YEL A;  2H27 A;  2R7T A;  2LKP A;  2QSH X;  1ETK A;  1P4X A;  4A3K J;  3LMM A;  4HQM A;  4JP0 A;  2P7V B;  1Z6R A;  4G7H F;  3CC2 I;  1J9I A;  1ULY A;  2K4J A;  2VXD A;  3M7G A;  3PSF A;  2QEN A;  4ETS A;  5FLM J;  2NOG A;  2Y69 H;  1XS9 A;  2JRM A;  2LKS A;  2ID3 A;  5E8I A;  2VQL A;  3BP8 A;  5E18 F;  4IJA A;  1HDP A;  3HOY J;  2HYJ A;  4OAY A;  4DQ2 A;  1OQY A;  1VZ0 A;  5HNH A;  1B8I A;  1IN7 A;  3OYD A;  3A01 A;  1WVR A;  2CV2 A;  1FIA A;  2VC0 A;  1Y1W J;  2VE8 A;  3EUK L;  2QF7 A;  2NRA C;  2VC1 A;  3LL7 A;  2X1D A;  3BZK A;  1E17 A;  3B6A A;  2KIF A;  4CO8 A;  4D7N A;  2NNN A;  5E1W A;  4MQV A;  3GVA A;  2HOA A;  4XRM A;  2E1O A;  5CQG A;  3JAM Z;  3IAM 2;  3R60 A;  2WB1 N;  3CCL I;  1XDS A;  3ZOB A;  3CC7 I;  1W5T A;  3UR3 C;  1HOM A;  3RDI A;  1X1D A;  3ABM H;  2OD5 A;  1D0Z A;  3VB2 A;  3VOD A;  1OJL A;  4KYW A;  1WI9 A;  2DMN A;  2RQP A;  3CCM I;  2OCC H;  1VFC A;  4PJL A;  1ZGW A;  1P7I A;  2RGV A;  3BR2 A;  3REO A;  1Q1V A;  1LVA A;  2KQR A;  4C9Y A;  3J7Y J;  2DMU A;  2WAQ N;  4P1W A;  2Y48 A;  3GTP J;  3L9F A;  2AQF A; 
#chains in the Genus database with same CATH homology
 2DT5 A;  3LA2 A;  3BZ6 A;  1O7F A;  3C1D A;  4A6D A;  1F4K A;  4BYY A;  1R1U A;  1I5Z A;  2LNB A;  2JTV A;  3S2W A;  2QQA A;  1R1T A;  1IRF A;  1O3S A;  4IHS A;  1HKQ A;  1BJA A;  2MC3 A;  2WC2 A;  2OU2 A;  1HW1 A;  2JRT A;  2A6H F;  3C7J A;  1KU9 A;  4M9S A;  4BQA A;  1U6G A;  2XHK A;  2W25 A;  4EM2 A;  4FHT A;  3CUO A;  2K86 A;  5JR3 A;  4BHB A;  2HYF A;  4XBF A;  5KK1 A;  4LK0 F;  1BI3 A;  1LDK B;  1STZ A;  4B09 A;  2P4W A;  3HSE A;  5LHG A;  4KIC A;  4G7Z F;  2CWE A;  4WXD A;  3VEP A;  1XCV A;  1S7O A;  1U3E M;  2YX7 A;  1OMI A;  1JHH A;  1QPM A;  4MTD A;  4CXF A;  1U5T A;  3RTR A;  1QGP A;  1J7K A;  3WTX C;  1GXP A;  3KP3 A;  2GAU A;  2M8E A;  2BE5 F;  4L18 B;  1ZYR F;  3OV8 A;  3QOP A;  3ERE D;  3GZ5 A;  2XGX A;  2A61 A;  2L4A A;  3LST A;  4IVN A;  1OKR A;  2HOE A;  1W7P A;  2W57 A;  1REP C;  4R79 A;  4M9X A;  2ELH A;  2PEX A;  4WCG A;  1O57 A;  5JHU A;  2IT0 A;  4MNU A;  4HQE A;  2VOD A;  1MD0 A;  5DEQ A;  3L00 A;  3HSR A;  2K02 A;  2HYG D;  2P5V A;  1H9T A;  4HZF A;  4OIO F;  1XMK A;  3BWG A;  5F6F A;  2L3D A;  4I7H A;  2VXZ A;  3H3Z A;  1I1G A;  2F5E A;  1LDD A;  2ZXJ A;  2Z9O A;  2OZU A;  4OMY A;  3DF8 A;  2FMY A;  3ZMV A;  1F1Z A;  3SXY A;  1LEB A;  3F3X A;  3W6K B;  3C18 A;  3COA C;  3JTG A;  2QUF A;  2XRO A;  4UNO A;  2PBI A;  1UCR A;  5LGN A;  5LHH A;  4GYG A;  2D1V A;  3WTU C;  3I58 A;  5EEH A;  1XSD A;  3E6C C;  2DPU A;  1Y0U A;  1FOK A;  1PP7 U;  3PFI A;  3ZPL A;  4WWC A;  3WGI A;  4NHJ A;  1KA8 A;  2Z3Y A;  3BPV A;  3EUH A;  3I59 B;  2C6Y A;  1KU2 A;  2Z33 A;  2RVC A;  3ECO A;  1DPU A;  2CG4 A;  3E5Q A;  3WTY C;  2FE3 A;  4U0W A;  1TQP A;  2X0L A;  3F72 A;  1WKM A;  2LF7 A;  1T98 A;  2W24 A;  2FXA A;  1HKT A;  2XKO A;  4KMU X;  4P9U A;  2MBF A;  3EYY A;  3GW2 A;  4RS8 A;  2GXB A;  1IN6 A;  3QU6 A;  2XKP A;  3GEZ A;  1G3T A;  4KNY A;  3SZP A;  2RKH A;  3T5X A;  2MH9 A;  2JPC A;  4I0A A;  3RPQ A;  1FBS A;  1MJA A;  2ISZ A;  1TTY A;  1G3Y A;  2YPR A;  1U5T C;  1YFH A;  1IN8 A;  4PGH A;  4EJT A;  3IHU A;  3GX4 X;  4U0Y A;  4G6Q A;  3E97 A;  5H6R A;  3F6O A;  5DYM A;  3F8M A;  2WV0 A;  3QAH A;  5LRR A;  4Q5S F;  2QWW A;  4HLX A;  1D3Y A;  3E6M A;  4UXN A;  5JVT A;  1U8R A;  2HR3 A;  1UHW A;  3NQO A;  3WTW C;  5TRD A;  2YSR A;  2E1N A;  2D45 A;  5ICE A;  1R22 A;  4HV5 A;  1XSX A;  3KZZ A;  4KIF A;  3J81 K;  4HDU A;  4FX0 A;  4GGG A;  4KT5 C;  2DPD A;  4YG2 F;  3BJO A;  3P9K A;  3HYI A;  4ZYE A;  1LB2 A;  2EV5 A;  4N0B A;  4LB5 A;  2X4H A;  1FZP B;  1BOA A;  4M72 A;  4ASN A;  1TW3 A;  3BOQ A;  4BNC A;  1IF1 A;  1FP2 A;  3QRF F;  4B8X A;  5BPI A;  3R4K A;  3TQN A;  5ICC A;  3EDP A;  1W5S A;  3LA3 A;  1ON1 A;  3DEU A;  3KEO A;  1YS7 A;  2EJR A;  1MKM A;  3K1N A;  3ZMT A;  1ZG3 A;  2Q2E A;  5IT9 K;  1KU7 A;  4HX7 A;  4BH9 A;  3FF5 A;  3HUG A;  1XGM A;  1SD6 A;  5CLS A;  1AWC A;  2UXN A;  5ICF A;  1OR7 A;  2KJC A;  4RGR A;  2KRF A;  2QBY A;  3E5U A;  3HOS A;  3LFK A;  4KFC A;  2ZME A;  1KQ9 A;  3KP5 A;  4RAZ A;  3IRR A;  4N9H A;  3J81 Z;  5LRS A;  4UV8 A;  2XAQ A;  1T0F A;  2BEO A;  1RZ4 A;  1TLH B;  2DLL A;  3WOD F;  5J8C A;  5D8K B;  2UZK A;  4AWX B;  4EM1 A;  3F8B A;  2CSO A;  1XDU A;  4P5O A;  1LJ9 A;  2K27 A;  3MZY A;  4H0E A;  2XVC A;  3DKW A;  2DAO A;  2UWM A;  3BPX A;  4EJU A;  2Y0M A;  1W7P D;  3F8C A;  2IA1 A;  3I71 A;  1S29 A;  2G7U A;  1SMY F;  4HYE A;  1FYM A;  2FNA A;  2ESN A;  2LDU A;  1XMA A;  4CYD A;  3T8R A;  5IT9 Z;  4O3M A;  2IPQ X;  2QVO A;  4HV6 A;  4P55 A;  2XUB A;  1RUO A;  1D5V A;  2O61 A;  3WTZ A;  2VBY A;  2DBB A;  2ZFW A;  3GWZ A;  2ESH A;  2P5L C;  3ECH A;  4I0B A;  4MQ9 F;  5LGT A;  1UST A;  2V1X A;  1W4M A;  4ZH4 F;  2D1H A;  2EV6 A;  4UHT A;  2FOK A;  2WTE A;  2DFI A;  2P6S A;  2EFP A;  1I6X A;  3U9G A;  3QPT A;  3J80 K;  5HLG A;  4ENN A;  2BBY A;  4G94 A;  3P7N A;  1U5T B;  2D2W A;  3DPL C;  1HW5 A;  3RKY A;  2JSC A;  3I5U A;  3GUD A;  5DCM A;  2VT3 A;  3CDH A;  1HST A;  4IPA A;  4TV7 A;  3U1D A;  1HQC A;  1K7A A;  1W7P B;  1XD7 A;  5E1X A;  2A68 F;  1ZAR A;  2H6C A;  1OYW A;  1YTY A;  4GYI A;  1PUE E;  2TDX A;  4XRF A;  4QLC U;  4XLP F;  2AXL A;  3VFZ A;  4I09 A;  2F5D A;  1ZAO A;  2CO5 A;  2W85 A;  2PMH A;  3BY6 A;  2EFN A;  3LWF A;  1ZRD A;  1O7L A;  1T2K A;  2RNJ A;  1F9N A;  4I98 B;  2V6C A;  3R0A A;  1ZG5 A;  1USS A;  4F7Z A;  3E3V A;  5D4S A;  2ZKZ A;  1L3L A;  1GXQ A;  1SFX A;  3ZMD A;  4EJV A;  1UFM A;  1JE8 A;  1GVJ A;  4IF4 A;  3KET A;  2HFH A;  2BGC A;  3J80 Z;  1EH7 A;  2H94 A;  2E7W A;  2ZCW A;  4Q47 A;  2FNP A;  2CW0 F;  3O6B B;  3F8N A;  3CJN A;  1CF7 A;  3QP6 A;  5LGU A;  3V7C A;  2H6B A;  1G4D A;  4EVI A;  2OQG A;  3LA7 A;  1ONV A;  1R5G A;  1FYK A;  3V7S A;  5BQT A;  3WTV C;  1ZG1 A;  3LQR A;  2R7F A;  1ZGA A;  2Z99 A;  3FMQ A;  2A07 F;  2ETH A;  3QPH A;  3AAF A;  4AD9 A;  4ENK A;  1B6A A;  2QM3 A;  5AIP A;  3RKW A;  2QQ9 A;  3T1B A;  2Q8K A;  1TNT A;  3H3U A;  4LK1 F;  2DQR A;  4L5J A;  2XAF A;  1WQ2 A;  1TQI A;  4IRH A;  5H20 A;  4MEX F;  2MLK A;  1FBQ A;  1ZLJ A;  4L9V A;  1HW2 A;  2STT A;  6PAX A;  3M1E A;  4IRG A;  2P5K A;  3R0J A;  4LG0 A;  1XGO A;  4M6Y A;  5FLX K;  2GIV A;  1GHC A;  3KZY A;  3W6J B;  2R7D A;  1BN5 A;  1HKS A;  3GZ6 A;  3WU0 A;  2NYX A;  5E20 A;  4AVP A;  4LLG F;  2FBH A;  5DDG A;  3KLN A;  1RNL A;  4YFK F;  1YW9 A;  2MA3 A;  3V4G A;  2EWN A;  4U7D A;  4NB5 A;  4ESF A;  5CVU A;  3DP7 A;  3K1P A;  2F2E A;  3IWF A;  3DQV C;  1KU3 A;  1B9M A;  5D4R A;  3RYP A;  2EK5 A;  1ZRE A;  1FC3 A;  1IRG A;  4A0Y A;  3RPU A;  5KVR A;  5HOO A;  4P96 A;  2FEZ A;  1RI7 A;  2JZY A;  5TJJ A;  4Y13 A;  3NRV A;  3ISP A;  1MJ9 A;  4G7O F;  1HXD A;  3ML6 A;  1IN4 A;  3DV8 A;  1FWZ A;  1KGS A;  3TKY A;  4QWQ A;  1DUX C;  3V7R A;  2UXX A;  4G8X A;  1P4A A;  4OIQ F;  3CO6 C;  2HEO A;  1ODD A;  1OYY A;  2RDP A;  2DW4 A;  3I64 A;  2ZO4 A;  3HSF A;  4CHU A;  1S3J A;  4EM0 B;  5ILU A;  4AIK A;  2COM A;  3CO7 C;  2V1U A;  3M9A A;  5FLX Z;  2OA4 A;  1BI0 A;  4HBL A;  3KE2 A;  2PMU A;  2XAH A;  4JK1 X;  2PI0 A;  2HTJ A;  5HDK A;  2O6G E;  1XSV A;  3GFL A;  3JSO A;  3MAJ A;  1D8J A;  1X3U A;  3MWM A;  1DDN A;  4UVB A;  4ESJ A;  4WK8 F;  2QBY B;  4EJW A;  2VE9 A;  3BJ6 A;  1KYZ A;  1A04 A;  2Y75 A;  4EGY A;  3N97 A;  3HTS B;  4A12 A;  2QLZ A;  2ZME B;  5HS7 A;  2FSW A;  2BV6 A;  2VBX A;  2M87 A;  2VOP A;  4WXC A;  3JW4 A;  1O3Q A;  1TNS A;  1FYL A;  1R00 A;  4RB0 A;  3IRQ A;  2LF8 A;  1FBU A;  1FX7 A;  4ENJ A;  3CUQ A;  3BRO A;  4PDK A;  3F6V A;  4BAY A;  3K0L A;  5K1Y A;  3SQN A;  4IRI A;  1H9G A;  2GXG A;  4HF0 A;  1IW7 F;  1MDM A;  2FML A;  3ZQ7 A;  4BHC A;  2HZT A;  5FD6 A;  3KP7 A;  1G6N A;  3FZV A;  3MEX A;  3M8F A;  1YLF A;  3RKX A;  3M8E A;  5D5W B;  3E6B A;  1K78 A;  3R6S A;  1XGN A;  2E1C A;  2EFO A;  3RI4 A;  4FX4 A;  3GFI A;  5HS8 A;  2ACJ A;  4OIN F;  1WRJ A;  1QO0 D;  3B73 A;  2ADU A;  2XRN A;  1EH6 A;  1ZLK A;  2G9W A;  2J5P A;  5BMZ A;  5ED4 A;  2FA5 A;  1IXC A;  4IHT A;  2K4B A;  1L0O C;  2DU9 A;  3TOA A;  2VON A;  5D5U B;  3GXO A;  3HHH A;  2F5C A;  3RYR A;  1UB9 A;  3NEU A;  2WWY A;  4KN4 X;  2IW5 A;  1J2X A;  1BC7 C;  3IC7 A;  4OMZ A;  1SMT A;  1B1B A;  1R5H A;  2FF4 A;  4U7B A;  3L2C A;  5HLH A;  2XV4 S;  4M73 A;  1BIB A;  1Z7U A;  5DCM B;  4XLN F;  1F5T A;  2VOO A;  1Q1H A;  4HX4 A;  5HS9 A;  2OQR A;  1I1S A;  4O6J A;  2O8X A;  4E70 A;  4M74 A;  2HKX A;  3MFK A;  4GO1 A;  4N9I A;  1O3T A;  3DFG A;  3SHF A;  5BS6 A;  4AIJ A;  1MJB A;  2OAZ A;  2STW A;  2YU3 A;  4UVA A;  3ZN0 A;  4RGX A;  2EFQ A;  2A3S A;  2FBI A;  1R23 A;  2CYY A;  2A5Y B;  2ISY A;  2L54 A;  1JGS A;  1ZH5 A;  2DTR A;  3T0Y A;  3V8K A;  4CDG A;  4M6X A;  2HKO A;  4CZZ A;  2E7X A;  2EV0 A;  2R3S A;  1YS6 A;  3CUQ C;  1BI2 A;  1FT9 A;  5EEG A;  5FGM A;  1Z91 A;  5L3B A;  1S6L A;  3E5X A;  4L5I A;  2B0L A;  4A0Z A;  4O5V A;  3ZN1 A;  1V4R A;  1CF7 B;  4KIG A;  5D5V B;  4KN7 X;  4MEY F;  3K2Z A;  2V1D A;  3HHG A;  4PGG A;  1QZY A;  2M45 A;  4Z2Y A;  4HF1 A;  1YYV A;  1FLI A;  3ELK A;  1ZHF A;  4JQF A;  3D5L A;  2A6E F;  2Q0O A;  3LAP A;  2GWR A;  1P6R A;  2XAS A;  4S05 A;  1MGT A;  3D0S A;  2HQR A;  2MLG A;  2MH2 A;  2DQL A;  1J0R A;  1FY7 A;  2IJL A;  2IRF G;  1R36 A;  4I01 A;  1Z9C A;  2QQB A;  1R58 A;  1PP8 F;  1SFE A;  3FX3 A;  1QZZ A;  3GF2 A;  3IKT A;  4ZZL A;  2IP2 A;  1XB4 A;  3WE2 A;  1BM9 A;  5K5O A;  4LG0 B;  1K79 A;  5ICG A;  1HSJ A;  2XAJ A;  3P9C A;  1YO5 C;  3FHZ A;  4HF2 A;  1EH8 A;  4YFX F;  3P9I A;  4MHG A;  2F5F A;  4WXH A;  4PZJ A;  3FWE A;  1FSH A;  4OIP F;  3E6D A;  1I27 A;  4RB2 C;  3O2P E;  3FM5 A;  5D6F A;  2P7C B;  1YIO A;  3FMS A;  3TO9 A;  1ZN2 A;  5CVR A;  5LBQ A;  2ZNZ A;  3PQK A;  4EMS A;  5BOX A;  4M71 A;  1J75 A;  4KMF A;  1CGP A;  1R1V A;  4U0V A;  2LSO A;  2O3F A;  4ZYD A;  1J59 A;  2M1B A;  2DK5 A;  1RIO H;  5E1Z B;  5LEJ A;  3EET A;  4RGS A;  2G7H A;  1YW7 A;  2KKO A;  1D8K A;  2FU4 A;  3WTT C;  2YR2 A;  4ZZD A;  1ZRF A;  3K69 A;  4EV0 A;  1TBX A;  1QBJ A;  1UHM A;  3ABU A;  1B59 A;  4UV9 A;  3FXR A;  3GO5 A;  5E8G A;  4L9J A;  1FP1 D;  2HGC A;  2KIM A;  1V3F A;  4G6D A;  3OOP A;  2GQQ A;  4A6E A;  1WWX A;  1VTN C;  4GCV A;  3HRT A;  1SD7 A;  3C3W A;  4K2E A;  2NAZ A;  1G3S A;  3DPT A;  4HLY A;  4A5N A;  5J6X A;  2ZJ2 A;  5HDN A;  1XCB A;  3WTS C;  1NHA A;  1T39 A;  2W84 A;  3FXQ A;  4L0Z B;  4KUM A;  1R7J A;  1YW8 A;  2CFX A;  5ILS A;  2OBP A;  4G9Y A;  2ZNY A;  4A5M A;  5D8L B;  4HDV A;  4IXA A;  3CLO A;  2RN7 A;  3IL2 A;  2VBW A;  3FMR A;  3IWZ A;  5FFZ A;  2MD5 A;  5FD5 A;  3CUQ B;  5LHI A;  1K6O A;  1Z05 A;  3TO7 A;  3HRM A;  1S7A A;  3KCC A;  5BPD A;  4LJZ F;  5E17 F;  4OIR F;  3HTU A;  1MDM B;  1KYW A;  3TDZ C;  1IXR C;  4RB3 C;  5K5Q A;  2O0Y A;  3U2R A;  1IZ1 A;  1O3R A;  2L01 A;  1TQM A;  3WU1 B;  1T38 A;  3ULQ B;  1K78 B;  4P9F A;  2HWV A;  2AS5 F;  4L0Y B;  4U88 A;  5HLI A;  1U2W A;  3GFM A;  2BYV E;  4LLL A;  5L3C A;  1OPC A;  5IT3 A;  4AIH A;  3F8F A;  2PLY A;  2QZ8 A;  4L9T A;  2V79 A;  4Q4Z F;  4R8H A;  5L3E A;  5AON A;  3WGH A;  2O03 A;  4MGR A;  3I4P A;  4KIB A;  4YIF A;  5HVQ C;  4CIC A;  2Z5U A;  1YQA A;  3Q5F A;  4OOI A;  1QNT A;  2IA2 A;  3TDU C;  4S04 A;  3T8T A;  1TW2 A;  4LLN A;  4ZYG A;  3MZH A;  4ESB A;  3QP5 A;  5DV5 A;  3JSP A;  4WF2 A;  3BDD A;  1ZRC A;  1JXS A;  5ERI A;  4M9Z A;  3LQQ A;  1U78 A;  3K1M A;  4BHP A;  2NNY A;  1P2F A;  3HOT A;  1DP7 P;  5FB2 A;  2L02 A;  4YII A;  2GA2 A;  2VN2 A;  3B02 A;  4Q48 A;  2DK8 A;  4GXO A;  1P4W A;  4FT8 A;  2XIG A;  3I54 A;  3WE3 A;  4ZYH A;  3Q9V A;  4L9N A;  2YX4 A;  3DXJ F;  2FQ3 A;  3WGG A;  2IVM A;  3G73 A;  4LB6 B;  3KEQ A;  1FPQ A;  1RUN A;  2CGP A;  2HS5 A;  1H0M A;  2QYO A;  1BIA A;  2JT1 A;  3K9T A;  3J7A O;  3PQJ A;  1QQI A;  4DNC A;  5LEK A;  3TOB A;  1C0W A;  4UVC A;  3KP2 A;  4KDP A;  2L4M A;  1ZGJ A;  2ZBK A;  5DD4 A;  5H6Q A;  4RAY A;  2FBK A;  4LGW A;  3V8J A;  2J5O A;  1IXS B;  5CVJ A;  2KJB A;  4A2U A;  1LNW A;  3VOE A;  3EYI A;  3KLO A;  1SD4 A;  4Y15 A;  3F22 A;  5JI6 A;  3TGN A;  1MZB A;  3ABT A;  4LD5 A;  3ZMU A;  5CVI A;  4ON0 A;  1XGS A;  3MCZ A;  1WSU A;  5CYV A;  2HDC A;  4HAM A;  1XN7 A;  4RB1 A;  2EB7 A;  2V9V A;  1Z1D A;  2OZ6 A;  2PN6 A;  4RGU A;  1BI1 A;  5F1R A;  2PJP A;  4HOB A;  1ON2 A;  2RV8 A;  2VBZ A;  4ENM A;  2NS0 A;  1Z6T A;  2DO7 A;  2A69 F;  4BXU A;  3ZMZ A;  5DUI A;  1JHF A;  3GLX A;  4PCQ A;  5FFX A;  1YG2 A;  1FNN A;  1G3W A;  1T6S A;  1KQ8 A;  3GFJ A;  2P6T A;  3L7W A;  4UUV A;  2PQ8 A;  2EFW A;  4MTE A;  3N4M A;  3LAJ A;  3G3Z A;  3KFW X;  2M30 A;  4XSX F;  5CVV A;  3I59 A;  3H92 A;  2CQK A;  1EV7 A;  3L09 A;  4EQQ A;  1HBX G;  1B4A A;  3O3K A;  1J5Y A;  5L3D A;  3JTH A;  3KP4 A;  5DUK A;  1IUY A;  5DD8 A;  4LFU A;  4KA4 A;  3MQ0 A;  1E2X A;  5JFR A;  1SFU A;  3Q9S A;  2FRH A;  5A2Q K;  2VT2 A;  4I2O A;  2HTS A;  5CJ9 A;  5D6E A;  1AOY A;  2HQN A;  3I0T A;  1LDJ A;  2GZW A;  2JPB A;  3RJP A;  3RIR A;  4XSZ F;  2DI3 A;  3I53 A;  4I02 A;  4EGZ A;  1FSE A;  3CTA A;  3WG9 A;  2P8T A;  1IAW A;  1PDN C;  4A0X A;  5AIQ A;  1S8N A;  3IKV A;  5LLQ A;  2GA1 A;  4Y17 A;  2PG4 A;  3F23 A;  5ILV A;  4HW0 A;  4OU0 A;  3TO6 A;  5DCF A;  1BBY A;  4R1H A;  4HX8 A;  3HRS A;  4LMY A;  3ZMS A;  1KQ0 A;  5J8F A;  4EJO A;  5D5X B;  5F64 A;  1B9N A;  3EQL F;  1IN5 A;  2EA4 A;  3HRU A;  3R61 A;  4HA8 A;  3FM3 A;  3QU3 A;  1SAX A;  2RC4 A;  2H09 A;  5L3G A;  3SFZ A;  1SD5 A;  3FXU A;  2K7L A;  3JAM K;  2KIU A;  2XAG A;  5L3F A;  4YFN F;  1LEA A;  2EA2 A;  1P92 A;  4D0P A;  3F21 A;  3SZT A;  2IA0 A;  4CGZ A;  5A2Q Z;  4JBA A;  1DPR A;  5K5R A;  3V8L A;  1LQ1 A;  1BC8 C;  3GYH X;  3HIF A;  2M5W A;  3BJA A;  5HDG A;  4NQW A;  3ROU A;  3ZP5 A;  3KP6 A;  2PFB A;  1OYI A;  4WX9 A;  5FO5 A;  2H27 A;  2LKP A;  1P4X A;  4HQM A;  2P7V B;  1Z6R A;  4G7H F;  1J9I A;  1ULY A;  2K4J A;  3M7G A;  2QEN A;  4ETS A;  5E8I A;  3BP8 A;  5E18 F;  4IJA A;  4DQ2 A;  1IN7 A;  2VC0 A;  2VE8 A;  2NRA C;  2VC1 A;  1E17 A;  2KIF A;  4CO8 A;  2NNN A;  5E1W A;  4MQV A;  3GVA A;  3JAM Z;  3R60 A;  1XDS A;  1W5T A;  3RDI A;  4KYW A;  2OD5 A;  3VB2 A;  3VOD A;  1WI9 A;  2RQP A;  2RGV A;  3REO A;  1LVA A;  2Y48 A;  3L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...