2G9WA

Crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
119
Chain Sequence
KLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMAVLQRLAKKNLVLQIRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 37
structure length 119
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2g9wA01
5D5XB 2W57A 3FXQA 4YFNF 3CUOA 4MEXF 4Y13A 2D2WA 1FX7A 2G7UA 3KFWX 5E1WA 4HF1A 3GZ5A 4M6YA 1JXSA 4R1HA 2AXLA 1ZH5A 3SHFA 3ZN0A 2LDUA 2W84A 4Z2YA 4P96A 2A07F 3HRSA 4LG0A 2JRTA 1G6NA 3H3ZA 4LLGF 3LSTA 2MD5A 4CGZA 4Q5SF 1KA8A 1QZZA 2XAFA 1TNTA 4ESBA 4KDPA 3GZ6A 1XDSA 1HBXG 1H9GA 4G9YA 1FLIA 3RPUA 2VBZA 4ASNA 4WXHA 2GZWA 2XIGA 4M9XA 2KIMA 2Q8KA 5IT9K 1HKQA 2STWA 1RZ4A 1HW2A 2NRAC 1HKTA 2A69F 2XASA 1HSTA 3I4PA 3DP7A 3ISPA 1SFUA 3VEPA 2DW4A 2R3SA 3R6SA 4G8XA 2MBFA 3L09A 5FFZA 2IA2A 2HYGD 3BPVA 3HOTA 5CLSA 3GW2A 3ZMDA 2O3FA 3PFIA 2EV0A 4L9TA 3F8FA 5AIQA 1KYZA 5ICCA 2XKOA 5K5QA 3HHGA 2ZMEB 1JHHA 3R61A 5LEJA 1SD7A 1ZHFA 2HTJA 1KU2A 4YG2F 1XCVA 2ACJA 3BP8A 4AD9A 1RUNA 4UVAA 4I0BA 1G3YA 1XSXA 2K86A 3Q5FA 1YW8A 1P4WA 4HBLA 4CZZA 1EH6A 1U5TC 4G6QA 2KIFA 4ZH4F 2FMYA 4HOBA 5JFRA 2RKHA 3SXYA 1KYWA 3J7AO 4FT8A 2FOKA 1J9IA 2P5VA 2IRFG 3WU0A 4KIBA 2EFQA 4M73A 2UWMA 4ESJA 2IT0A 3QRFF 3ZMZA 1IXSB 2QQ9A 3T5XA 3V8KA 1Q1HA 1J0RA 4O6JA 3KP6A 2A6EF 3COAC 1LEBA 3FHZA 4N9HA 2EA4A 3J81Z 3RKWA 2LSOA 4TV7A 3CUQB 1LDJA 2CYYA 3ABUA 2XUBA 1PP8F 5BQTA 3CO7C 1BI0A 1W5TA 2V9VA 3GWZA 2F5EA 1QPMA 3NEUA 3F6VA 1R7JA 1SFEA 4N9IA 2VT3A 3PQKA 5DV5A 3CJNA 2EA2A 4BHCA 1Z9CA 4EJWA 4RB1A 4FX0A 2FU4A 4O3MA 2EJRA 1BN5A 2P5KA 4HYEA 2H27A 2Q0OA 1ZRDA 2XAHA 5D5VB 2MA3A 1WWXA 4MTEA 3HTUA 5DCMA 1Z7UA 3NQOA 2K7LA 4OIPF 4KYWA 4HA8A 1F4KA 5DUIA 2RN7A 3ZPLA 1XMAA 5L3EA 2GA1A 4M71A 2JZYA 1O3RA 4A0ZA 4RB3C 5CVUA 4BHPA 5F64A 2FNAA 1V3FA 2DO7A 5EEGA 4NQWA 5HOOA 3KP3A 4G7ZF 3O6BB 3ZN1A 1R00A 4YFXF 1OR7A 5AIPA 5JR3A 4ON0A 5FB2A 4YFKF 1BBYA 1W7PD 2LF8A 4A0YA 4KIGA 2JPBA 4K2EA 3DPTA 1RUOA 5BMZA 1WI9A 4EGYA 3ABTA 3I54A 2ZNYA 1CF7B 2EWNA 4XLNF 4OIRF 4YIFA 2FSWA 1XMKA 2WTEA 4XSZF 3TKYA 2G9WA 4Y15A 1D8JA 3V8LA 3HTSB 5LRRA 3GFIA 2XROA 4HV5A 3FX3A 3C7JA 2FF4A 1ZLJA 3LA3A 4WK8F 4GCVA 1ZN2A 1U5TB 1W5SA 2E1NA 3WTUC 3R0AA 4U7BA 1HKSA 5LHGA 1RIOH 3R60A 1P6RA 1ZREA 2JSCA 4HDUA 4OINF 2HGCA 3RPQA 3I59B 1YIOA 4G6DA 3BOQA 5LHHA 4ZZDA 1ZG1A 2V1DA 3I71A 5FFXA 5HS8A 1DDNA 2E7XA 3IRRA 4ZYDA 2H6BA 3P9IA 5ICGA 3HRUA 1BI3A 3LAPA 3SZTA 2O8XA 3I0TA 3QU6A 2MC3A 3E6BA 4ZYEA 3FF5A 2BBYA 3H3UA 5D5UB 3V7RA 3PQJA 1UHWA 4EJUA 2JTVA 1P4AA 2VBXA 3KZYA 3OV8A 4WCGA 1R22A 1P2FA 4ENJA 4EM2A 3S2WA 1L0OC 3ROUA 1F5TA 2FBHA 4HX7A 5LGNA 1FBQA 2OD5A 3U1DA 3LA2A 1UCRA 1TQIA 3IHUA 3K1MA 1AWCA 4WXDA 4HDVA 1T39A 2VBWA 1HQCA 1D8KA 1FBSA 2H6CA 3GVAA 5A2QK 3LFKA 3DEUA 2K4BA 2RVCA 2HQRA 4GYGA 4ESFA 3GF2A 1D3YA 4P5OA 1O3SA 1I5ZA 3F22A 2V1UA 3GFJA 4KFCA 2XGXA 2M30A 1VTNC 2VONA 1JGSA 1YYVA 3FMSA 1R5GA 5KK1A 3RDIA 4A0XA 3BWGA 1G3TA 2DTRA 4L0YB 4L5IA 4LFUA 1WSUA 3VOEA 5DCFA 5CJ9A 1KU7A 3HUGA 3T8RA 5FD5A 3RYPA 4KN7X 2QBYB 2OQGA 1T38A 1W7PA 1G3WA 2VT2A 3E6CC 2M1BA 5HLIA 2VOOA 2D1VA 4S05A 3DPLC 2D45A 2M5WA 3ERED 1IN5A 3J80K 4UVCA 1RNLA 5D4SA 2L3DA 2ZNZA 3FM3A 3MEXA 1I27A 4MEYF 4MQVA 1TQMA 2IA1A 3QU3A 1LDKB 4OIOF 4RGSA 5F1RA 4OMZA 3REOA 4HLXA 3ZMSA 2UZKA 4CICA 1YS6A 1MJAA 1K78B 3V7CA 2W24A 5HLHA 3WG9A 4GO1A 4YIIA 2BYVE 3O2PE 3MAJA 2ZBKA 1IW7F 2DBBA 1B4AA 1GVJA 3Q9VA 3LA7A 1E2XA 5LGUA 3QPTA 3TOAA 2MLKA 3ECHA 2Z3YA 3BZ6A 5JHUA 2HKXA 4L9VA 3LAJA 4KT5C 2MH2A 2E7WA 5ILSA 1IN7A 1Z6RA 4WX9A 3E3VA 2PLYA 3M8FA 3BY6A 4KA4A 4I98B 1ON2A 3GEZA 3SQNA 1STZA 1BI2A 3SFZA 1HXDA 1I1GA 1S29A 5KVRA 1YQAA 4LG0B 3C1DA 3JTHA 5DEQA 2CQKA 4LLNA 1YFHA 1WRJA 1ZGAA 2M87A 3VODA 1TW3A 2FXAA 1L3LA 3GXOA 3TGNA 2CW0F 3WU1B 2GA2A 1EV7A 5D8KB 2H09A 1F9NA 1PUEE 4L9JA 3K0LA 2R7FA 2DPDA 4QLCU 3K1NA 4LMYA 2ZJ2A 1ZLKA 4L0ZB 1MJBA 4R79A 3K1PA 2IW5A 2Y75A 1GXQA 3H92A 5IT3A 1U78A 1QNTA 1AOYA 1YTYA 2K02A 2IA0A 1TQPA 2QQAA 5JI6A 3F72A 3JTGA 1C0WA 2H94A 4IF4A 2DFIA 3F8MA 2QWWA 5CVVA 2PN6A 5CVIA 3LWFA 2XKPA 1MJ9A 4CHUA 2F2EA 4BYYA 3JAMK 3EYIA 4IHTA 3HIFA 3HHHA 1H9TA 2DU9A 2NNNA 3ML6A 2FBIA 1FSEA 5K5RA 3FWEA 2QLZA 1HW5A 3FMRA 2Q2EA 4H0EA 2DLLA 3GYHX 3K9TA 3F8BA 2DK8A 2HS5A 4BNCA 5E1XA 3HYIA 4HX4A 3D5LA 3GX4X 1J75A 2HDCA 2COMA 3L7WA 3P9CA 1HW1A 2XRNA 4DQ2A 2W25A 5FGMA 3TDUC 4G7HF 3GLXA 4PZJA 3TO6A 3LQRA 3EUHA 4KIFA 3WODF 4XSXF 4I09A 2WC2A 3RKYA 3E6MA 2CFXA 4IRGA 2ZO4A 4I0AA 5DD8A 5LBQA 2ZKZA 3E5UA 3KZZA 5H20A 1QQIA 4UV8A 3TOBA 5A2QZ 4OOIA 2WWYA 2ELHA 3KP5A 2M8EA 1S6LA 1LEAA 2EFWA 2FA5A 2X4HA 2KRFA 2P6SA 1IRFA 1XGOA 4DNCA 3MFKA 5FLXZ 1ODDA 2AS5F 4ETSA 4HV6A 1K6OA 2V79A 4A2UA 1B1BA 2VXZA 2J5PA 3CDHA 3B02A 4HZFA 1MD0A 4M6XA 1UHMA 4XBFA 1J2XA 5HLGA 2FMLA 1FT9A 2HFHA 3EYYA 1ZG3A 1ZYRF 4MNUA 2VN2A 3EQLF 2WV0A 3V8JA 2O0YA 3BJAA 5E20A 1UFMA 4BXUA 3WTVC 4RS8A 3ZP5A 2QZ8A 5BPDA 1XD7A 3WGHA 2YU3A 4U88A 2MH9A 2TDXA 1E17A 4AIKA 2DQRA 3MWMA 3KETA 4I7HA 2HZTA 4UVBA 1BI1A 1FC3A 1KQ8A 1YW9A 4GYIA 3F23A 3E97A 2KIUA 1SD5A 3BJOA 5ILVA 5DCMB 1XDUA 1FP1D 4BQAA 4XRFA 1JE8A 3C3WA 3G73A 4MHGA 2DT5A 1KGSA 1LJ9A 5IT9Z 3F3XA 3KCCA 2D1HA 2Z33A 1G4DA 3K2ZA 2HOEA 4A12A 1A04A 4LK0F 4UNOA 2PMUA 1DUXC 4Y17A 3RKXA 2ISYA 2PFBA 3JSOA 1G3SA 3E5QA 3WE2A 3QP6A 2OBPA 3WGGA 2HWVA 1FOKA 1IN4A 1XCBA 2QVOA 4UV9A 2L01A 5CVJA 3OOPA 1MDMA 1TTYA 2QQBA 2FRHA 2BEOA 2VC1A 3ECOA 4NHJA 1U3EM 4KN4X 4JBAA 2IP2A 3CTAA 4EJVA 1T2KA 2PEXA 4P9FA 3IKTA 4U7DA 3BJ6A 2OU2A 1TLHB 4LB5A 2A68F 2B0LA 5ICEA 2FE3A 2LNBA 5FD6A 4D0PA 3W6KB 3SZPA 1BC8C 4M74A 1EH8A 3P9KA 1IN6A 4ZYGA 5EEHA 4IXAA 3WTXC 4BAYA 3FXUA 4EGZA 1JHFA 3U9GA 3T1BA 3C18A 5CVRA 2GIVA 2YSRA 1XGNA 5L3DA 1IRGA 1RI7A 5LGTA 2W85A 1HSJA 1SD4A 3DKWA 2PQ8A 2GQQA 4CYDA 2YR2A 4O5VA 2QUFA 4A5MA 2EK5A 3I64A 3V4GA 4LGWA 3EDPA 4MTDA 1SD6A 3KE2A 3FXRA 2RNJA 4AIJA 2OQRA 1O3TA 1J7KA 2J5OA 4P55A 1Z05A 2A3SA 1SMTA 3QOPA 3Q9SA 2FBKA 3KP4A 4Q48A 4AWXB 3HRMA 4EJTA 4L9NA 5L3CA 3AAFA 3QAHA 4S04A 5CYVA 1OYWA 2DPUA 5D4RA 3BROA 5D5WB 2L02A 1YG2A 4A6EA 3VFZA 5BOXA 3VB2A 2C6YA 5BS6A 3JSPA 5HS7A 1B59A 3HSRA 4OU0A 3M7GA 2Y48A 1B6AA 3F21A 2GAUA 4B8XA 1U8RA 2PBIA 3F6OA 2PMHA 1MKMA 1K79A 2XAJA 4U0VA 4EMSA 2OZ6A 2CSOA 2LF7A 1GXPA 2XAGA 1MZBA 2ADUA 2PJPA 3LQQA 4WXCA 2L54A 3IKVA 5ILUA 4PDKA 1DPRA 4NB5A 1ZG5A 4HX8A 2XAQA 4HLYA 2HYFA 3DXJF 3ULQB 2ZCWA 1SFXA 2ZMEA 3I53A 5E18F 5H6QA 4I02A 2QYOA 2EV6A 4LLLA 3IC7A 3DQVC 4UXNA 1OYYA 2NS0A 4KUMA 3TDZC 3IL2A 4P9UA 1SAXA 5LEKA 3DV8A 1H0MA 1I1SA 4AVPA 1X3UA 1OYIA 3KP7A 4WF2A 3GO5A 5F6FA 1TW2A 1BIBA 4E70A 4G94A 5DD4A 1R1TA 4MGRA 4AIHA 2OZUA 3HRTA 1W7PB 1YW7A 5HDGA 4EM0B 1S8NA 2ETHA 1IN8A 5E1ZB 3IRQA 2OAZA 1B9NA 2A6HF 4CDGA 2STTA 2E1CA 3ELKA 4LJZF 1O7LA 2V6CA 3RIRA 4F7ZA 2MLGA 1LQ1A 1PP7U 3CO6C 3R0JA 2P8TA 2K27A 4ENKA 1Y0UA 1S7OA 1TBXA 4PCQA 1YO5C 1Z6TA 1SMYF 1IXRC 5D6FA 2F5FA 1FBUA 4RGUA 2O6GE 1ZAOA 5J8FA 3CUQA 1USTA 2VOPA 2EFOA 3L2CA 5H6RA 3JW4A 5E17F 3KP2A 2ZFWA 2P7CB 2EV5A 2Z9OA 1FWZA 4QWQA 3GFLA 2KJCA 1O3QA 5E8GA 4HF0A 4A5NA 2IVMA 1R5HA 2ESHA 4LD5A 4Q47A 2CO5A 4EJOA 3KLOA 3T8TA 2CG4A 5HDKA 2HR3A 5E8IA 2HQNA 2FNPA 4IRHA 1WQ2A 1YLFA 5HDNA 4RB0A 4ENMA 3GFMA 4RGXA 3MQ0A 1P92A 4U0WA 2O61A 3B73A 2DK5A 3WTYC 2VBYA 2CWEA 2RDPA 4UUVA 4M72A 2YX4A 4JQFA 4N0BA 4ZYHA 1ZRFA 3N97A 1V4RA 1XSDA 4MQ9F 3MCZA 3EETA 1Z1DA 5L3BA 3E5XA 3M1EA 5HVQC 2DQLA 2G7HA 3KEOA 1DP7P 1ULYA 1TNSA 4RAYA 5DDGA 1DPUA 1IAWA 2A61A 1LDDA 2P7VB 4RGRA 3P7NA 2BE5F 5LHIA 2DI3A 2L4AA 3R4KA 3U2RA 4EQQA 1R58A 1K7AA 4GGGA 1KQ9A 1KU3A 4I01A 1S3JA 3CLOA 5K5OA 1FPQA 1KQ0A 4IJAA 1KU9A 3WGIA 2IJLA 4KMFA 5J6XA 2XV4S 1XSVA 1IF1A 2UXXA 2P6TA 4A6DA 4KMUX 5JVTA 3W6JB 1IXCA 3WTTC 5ICFA 2O03A 2Y0MA 4HQEA 1EH7A 1ZRCA 5L3FA 1BIAA 4IVNA 5ERIA 5DUKA 2FQ3A 4HF2A 2YPRA 1CF7A 1I6XA 3D0SA 2VC0A 2BGCA 3K69A 2IPQX 3IWFA 3M8EA 1XGMA 1BM9A 2GXGA 2HTSA 5LRSA 1O57A 4EVIA 3HOSA 3RYRA 5TRDA 1ON1A 3KLNA 2EB7A 3WTSC 1FZPB 5BPIA 5ED4A 3MZHA 3QP5A 2LKPA 3FM5A 3QPHA 2OA4A 1FSHA 1QZYA 2BV6A 2HEOA 1R1VA 1BJAA 1U5TA 4JK1X 1R36A 2QM3A 1QGPA 4OIQF 1UB9A 1U6GA 1USSA 3N4MA 3J80Z 1S7AA 3ZMUA 5HS9A 1BOAA 3F8NA 4M9ZA 2P5LC 2EFNA 4RB2C 1QO0D 3I59A 4BHBA 2EFPA 1XN7A 2V1XA 3E6DA 3TO9A 6PAXA 2KJBA 4KNYA 1U2WA 4PGGA 3ZMVA 1T6SA 2FEZA 4L5JA 1LB2A 2PI0A 1XB4A 1ONVA 3ZQ7A 1MGTA 4ZZLA 3DFGA 5LLQA 4M9SA 1FP2A 5J8CA 4BH9A 2RV8A 2RGVA 4EM1A 4WWCA 2A5YB 2XVCA 2ESNA 3TO7A 1IZ1A 1LNWA 2KKOA 3WE3A 2GXBA 3RI4A 1NHAA 2P4WA 2ISZA 3V7SA 3BDDA 4FX4A 2CGPA 2RC4A 3I58A 5D6EA 2JPCA 1D5VA 1OKRA 1FNNA 3BPXA 1J59A 3I5UA 4HAMA 4OMYA 5DYMA 2F5DA 2RQPA 2VODA 4PGHA 2ZXJA 4R8HA 4B09A 4GXOA 4Q4ZF 2DAOA 2GWRA 3GUDA 1FYLA 2X0LA 3FMQA 1O7FA 1FYMA 2UXNA 1IUYA 2NAZA 4RAZA 1B9MA 1PDNC 4LK1F 2M45A 1J5YA 3J81K 5L3GA 1YS7A 2JT1A 2HKOA 4EV0A 4ENNA 1GHCA 2VE9A 4UHTA 2NNYA 3L9FA 4L18B 2F5CA 3WTWC 3L00A 4HQMA 2PG4A 1Z91A 3O3KA 3MZYA 5TJJA 3F8CA 1F1ZA 1P4XA 1FYKA 2Z5UA 1OMIA 1XGSA 4LB6B 1ZARA 1QBJA 2YX7A 2QBYA 1BC7C 4IPAA 2R7DA 4G7OF 2VE8A 1T98A 3RJPA 1WKMA 1REPC 4FHTA 2Z99A 4U0YA 3HSFA 3JAMZ 3DF8A 4KICA 2K4JA 3KEQA 3NRVA 3WTZA 1CGPA 5FO5A 1MDMB 1ZGJA 1T0FA 4CO8A 1K78A 3RTRA 1R1UA 4XLPF 3CUQC 3M9AA 3ZMTA 4CXFA 3TQNA 4IHSA 2QENA 3T0YA 4HW0A 2NYXA 1W4MA 1R23A 3G3ZA 2XHKA 3HSEA 1FY7A 3FZVA 5AONA 5FLXK 3IWZA 5D8LB 2L4MA 5K1YA 4IRIA 4I2OA 1LVAA 1OPCA
chains in the Genus database with same CATH superfamily
5D5XB 1RESA 5CKTA 1Z3YA 2OPTA 2W57A 2R0QC 1ORKA 3BTIA 3FXQA 1AKHA 4XKVA 4YFNF 3CUOA 4MEXF 4Y13A 1K6YA 4J19A 4D1QA 2D2WA 1FX7A 3ZRGA 1TZLA 1R4MB 3OYCA 2EIKH 4IHYA 2G7UA 4HNUA 3KFWX 3HOWJ 5E1WA 3CD6I 3U1KA 4HF1A 3GZ5A 4M6YA 1JXSA 4R1HA 4M3FA 1YIJI 3BG5A 1S72I 2AXLA 4QPOA 3QPSA 1ZH5A 3SHFA 2WY7Q 3Q0VA 1IV8A 3ZN0A 2LDUA 2W84A 1YITI 4Z2YA 4P96A 2JQ7A 3RKQA 2A07F 3HRSA 1I6HJ 5EG0B 3RZDJ 4LG0A 2JRTA 1YJ9I 1G6NA 3JRHA 3H3ZA 5FKNA 3BR2A 2HXIA 4LLGF 3LSTA 2MD5A 4CGZA 3K4MA 4Q5SF 3A1YA 1P7JA 1KA8A 1QZZA 3IAM2 3K7AJ 2XAFA 3OL4A 3BG3A 1I50J 1TNTA 2KFDA 4ESBA 2ECCA 3OYAA 1QU3A 4KDPA 2YS9A 1XDSA 4LG3A 5F08A 3GZ6A 1HBXG 3G71I 1H9GA 4G9YA 1FLIA 2M2EA 3CJTB 3RPUA 3G4SI 3CP8A 2FUG2 2VBZA 4ASNA 1MMAA 4WXHA 2GZWA 3S1QJ 2LH9A 3ZQFA 1PJRA 2XIGA 4M9XA 3OYBA 2COBA 2KIMA 2HOTA 3VDXA 2R5YA 2Q8KA 2BZTA 5IT9K 3GMEA 1HKQA 2QGUA 2F4MB 2STWA 4DBRA 1YRNA 1RZ4A 1W36C 1HW2A 2NRAC 1HKTA 2A69F 2XASA 1JT0A 1HSTA 3I4PA 3DP7A 2KPMA 3ISPA 4B47A 3MZ8A 1SFUA 3VEPA 2DW4A 2GIZA 2R3SA 3R6SA 1T8IA 1BW5A 4G8XA 2MBFA 3W6VA 1FIAA 3L09A 5FFZA 2IA2A 2VL8A 2HYGD 3BPVA 1WJFA 4YIRX 4OAYA 3HOTA 1A31A 5CLSA 4J01A 2L9SA 4CZCA 2E36A 3GW2A 4X0GA 1OCOH 4JP0A 3ZMDA 2O3FA 1GDTA 4IZZA 3PFIA 2EV0A 3OYNA 3PNVA 3I55I 4IKFA 3HPGA 4L9TA 2JMWA 3F8FA 5AIQA 1KYZA 1QZEA 2YUSA 1U0JA 4B44A 3OS1A 3H36A 5ICCA 2XKOA 5K5QA 3HHGA 2ZMEB 5CQGA 2QCOA 4XICA 3IH2A 1JHHA 3R61A 4AU7A 5LEJA 2QKMB 3S1MJ 1SD7A 1ZHFA 1D0YA 2E1MC 2HTJA 5FLVA 1KU2A 3W2VA 4YG2F 1XCVA 3F9KA 4OWRB 2ACJA 4RBOA 5J1UA 3BP8A 3QYEA 4XOPA 4J00A 4P1WA 3S3OA 4AD9A 3TMOA 1RUNA 1HDDC 4UVAA 4I0BA 1G3YA 3EUKL 3FXLA 1XSXA 2K86A 5KAIC 3Q5FA 1YW8A 1P4WA 4HBLA 4CZZA 3S2HJ 4Y4RA 1EH6A 1U5TC 4G6QA 4CCMA 3FIWA 2K40A 2KIFA 4XN0A 4ZH4F 4FE7A 5IY5H 2FMYA 4HOBA 1A5JA 2YU9J 3W2WA 5JFRA 2ECBA 2CV1A 2HNHA 2RKHA 2QA4I 3SXYA 1KYWA 1XC5A 3J7AO 3S32A 4FT8A 2FOKA 3TEDA 1BR1A 1J9IA 2P5VA 2HQ5A 2IRFG 2N8GA 3C2BA 2W7NA 3WU0A 4KIBA 2EFQA 4M73A 2UWMA 3GTGJ 2X6YA 3DPUA 2IS2A 4A3EJ 1M1EB 4CUGA 4ESJA 2VLAA 3QRFF 3ZMZA 2IT0A 2LRDA 1IXSB 2QQ9A 2R92J 3ABKH 3T5XA 3F0CA 3V8KA 1Q1HA 2BHZA 1J0RA 4O6JA 2VJJA 3BR5A 2R5ZB 2NVYJ 1UHSA 3KP6A 4Y33A 2A6EF 3COAC 3H9JA 1LEBA 1A6IA 4EEFG 4N9HA 3FHZA 2EA4A 3J81Z 3CDLA 1B72A 1VQMI 2LMDA 3OS0A 3RKWA 2LSOA 4TV7A 2CU7A 3CUQB 3NWSA 1LDJA 3CLQA 2CYYA 5IPAA 3TP0A 4IQ4A 3ABUA 1JKRC 4PFOA 4IOCF 2XPWA 2E5NA 1PUFB 2XUBA 1IUFA 1PP8F 5BQTA 3S1RJ 2M0CA 3CO7C 1FTZA 3K70C 1BI0A 1W5TA 2V9VA 3GWZA 4MFEA 2VXDA 4ZTFA 2F5EA 2H8RA 3PNYA 2VJ4A 1QPMA 2WV1A 4G12A 1R6RA 3NEUA 1TWAJ 3F6VA 4NUBA 4LOCA 1R7JA 1SFEA 4N9IA 3VYRB 1IC8A 2VT3A 2EPFA 3WU2C 3PQKA 5DV5A 2QQ8A 2CUJA 3CJNA 3MD2A 2EA2A 4I99C 4BJ6C 4BHCA 1Z9CA 2X1EA 2AXTC 4EJWA 4RB1A 1X2MA 2DDBA 4FX0A 2FU4A 2K3FA 4O3MA 2EJRA 1BN5A 1VQ9I 5EYRA 2PJRA 2P5KA 4HYEA 2KRHA 4GFBA 2LREA 3MVPA 2H27A 2Q0OA 1ZRDA 3LFUA 5KAFC 2XAHA 5D5VB 2MA3A 1WWXA 2L7ZA 3BG9A 4MTEA 4CCKA 3HTUA 4FISA 5DCMA 1Z7UA 3NQOA 1IG7A 2K7LA 2W00A 4OIPF 3MMYB 4RDUA 2HXOA 4BE1A 1X1CA 4KYWA 4HA8A 1F4KA 5DUIA 2RN7A 1PYVA 2L9NA 3ZPLA 4IOAF 2W4SA 1XMAA 1FOYA 2DMPA 1D1CA 2XPUA 5L3EA 2KIQA 2GA1A 4BGDA 5E3NA 1MBHA 2LG4A 2VQLA 4M71A 3BT9A 3ZQLA 1Y1WJ 3VPRA 3ABMH 4ABZA 2H8WA 2ELKA 1KZHA 2JZYA 1O3RA 4A0ZA 4RB3C 3MKWB 2MYSA 5CVUA 4BHPA 5IP6A 4RAFA 5F64A 3MKZA 2FNAA 4C3HJ 1V3FA 9ANTA 2DO7A 3PUFA 5FKLA 3CCEI 2R7OA 5EEGA 2NVTJ 4NQWA 5J1YA 5HOOA 3KP3A 4G7ZF 2JA2A 2XC7A 3O6BB 3ZN1A 4W97A 3PSFA 1R00A 5M5XJ 4B4CA 2DYRH 3CESA 4YFXF 1OR7A 3HB9A 3M8JA 5B1BH 3KPHA 3J7AY 5FLMJ 4E7IA 1F36A 2HDDA 5AIPA 2K9NA 2XB0X 1LE8B 4C2TA 3H9GA 5JR3A 4ON0A 5FB2A 2DA2A 1LFUP 4YFKF 1BBYA 1QVTA 1W7PD 2LF8A 4A0YA 4KIGA 2EIMH 1V5EA 1XTAA 2JPBA 4K2EA 1E3PA 3DPTA 1BL0A 1RUOA 3OL3A 3M07A 5BMZA 5IYBJ 1WI9A 4FASD 4XONA 4EGYA 3ABTA 3FK6A 3I54A 2DA6A 3LL7A 2VIXA 1BOBA 2ZNYA 1CF7B 1R71A 1MNMC 3FXJA 1RKWA 2EWNA 2VQHA 4XLNF 1W5CC 4OIRF 4YIFA 2FSWA 1XMKA 3CCJI 2V1NA 2WTEA 1MBEA 4XSZF 2F4OB 3TKYA 1VQKI 1I39A 4YRVA 4BBSJ 3GTLJ 2G9WA 4Y15A 2ZJQF 1AA7A 1D8JA 1MMGA 3V8LA 3HTSB 1S9HA 2IXSA 3PL8A 5LRRA 2HPIA 3QQAA 3GFIA 3ONQA 2XROA 1YJNI 4KJZA 5E3OA 4HV5A 4D5FA 3FX3A 4YELA 3C7JA 2FF4A 1ZLJA 3LA3A 4WK8F 2H1LA 3DBHB 2Y2ZA 1ZKGA 4GCVA 4IEJA 1ZN2A 2Y9YA 3CC7I 1U5TB 3C2HA 1W5SA 2E1NA 3WTUC 1XPXA 5C3EJ 2JVGA 1ETOA 3NARA 1W0UA 3R0AA 2RREA 2E2IJ 4UUTA 2B63J 4U7BA 1HKSA 5LHGA 2MG4A 2QEXI 2HVQA 1RIOH 2I8DA 3H5NA 3R60A 1LVKA 1P6RA 3ZQCA 2DMUA 2VB6A 1ZREA 1JTXA 2JSCA 3S3NA 4HDUA 4OINF 2HGCA 4DOZA 3RPQA 3D5RC 3I59B 1YIOA 4G6DA 1WH7A 2FJ1A 5HLTA 4BXXJ 4MIMA 3BOQA 5LHHA 4ZZDA 1ZG1A 2NS8A 4IX7A 2DA3A 2V1DA 3I71A 4I6ZA 2IAIA 3HOZJ 1XX5A 5FFXA 5HS8A 4A3IJ 2TRTA 1K83J 1E0EA 1T08B 2E7XA 3A4CA 4I76A 1DDNA 3IRRA 1H88C 4F3QA 2GM4A 4ZYDA 2H6BA 3P9IA 5JLXA 5ICGA 2IBDA 1GUUA 1OCRH 1BI3A 3HRUA 3LAPA 2MFZA 2NOGA 4ANJA 3SZTA 1VQ5I 2O8XA 5EDNA 3I0TA 3QU6A 2MC3A 3E6BA 4JX6A 4ZYEA 5IP9J 2NOJB 4CCNA 4FE4A 3HOVJ 1WZ2A 3FF5A 4XRSG 2BBYA 5B66C 1ETQA 1B8IA 3H3UA 4DYCA 5D5UB 3V7RA 1T33A 3PQJA 1UHWA 4EJUA 1TP4A 5JVGF 2JTVA 1P4AA 2EZHA 3BCBA 1F43A 1MH3A 2KISA 2VBXA 3KZYA 4CCOA 3OV8A 4WCGA 4N4OB 1R22A 1P2FA 4ENJA 2VI6A 5EGOA 2R7UA 4EM2A 3S2WA 1L0OC 3ROUA 1WI3A 1Y56A 2FBHA 3DKYA 4PFPA 1F5TA 5DTDA 4HX7A 3A0HC 5LGNA 4E7JA 2XGCA 3BG7A 1FBQA 2AQEA 4HPQA 2OD5A 3U1DA 5GAGJ 4XIDA 3S16J 2L5QA 3LA2A 1UCRA 4DW6A 4ZTJA 1X1PA 3TP3A 4A3FJ 1TQIA 2IEKA 3IHUA 1DGRM 3K1MA 5KHDA 1VQ7I 2LK2A 1AWCA 1MMSA 3DLAA 4WXDA 4HDVA 1T39A 2VBWA 2X1DA 3JRCA 1HQCA 1D8KA 1FBSA 2H6CA 1RR8C 3GVAA 5A2QK 2DA5A 3LFKA 2M7BA 3OR1C 3DEUA 1VQPI 2K4BA 2RVCA 1JUSA 2DMTA 2HQRA 4GYGA 3H3VK 4ESFA 3GF2A 1D3YA 4P5OA 1O3SA 1I5ZA 2TCTA 2R93J 1JI8A 3F22A 3AG4H 2V1UA 3GFJA 3L2QA 4KFCA 2OF7A 2JA7J 2XGXA 2M30A 1VTNC 2VONA 1JGSA 1YYVA 3FXKA 2CQ7A 2Y69H 4XOTA 3FMSA 1VNDA 1XMXA 1R5GA 5KK1A 2IS4A 3RDIA 4AUXA 4A0XA 2XF7A 3BWGA 1G3TA 1YOVB 2DTRA 4L0YB 2EZKA 2BY0A 4L5IA 1VQ8I 4LFUA 1WSUA 2BY3A 3VOEA 5DCFA 4DIQA 5M5WJ 2CS3A 2Y9ZA 5CJ9A 1KU7A 4E7LA 2K85A 3HUGA 3T8RA 1Z21A 5FD5A 3RYPA 3BLYA 4KN7X 2QBYB 2OQGA 3L1PA 1T38A 1R9TJ 1W7PA 3RCOA 1G3WA 1TWHJ 4CYCA 4KISA 3FK7A 4EATA 2VT2A 5DM7F 3E6CC 1YX3A 2M1BA 5HLIA 2VOOA 2D1VA 4S05A 3DPLC 2D45A 2M5WA 4XLAA 1GLNA 3ERED 1QHGA 1IN5A 1X3ZB 4A3CJ 3J80K 1AU7A 4UVCA 1RNLA 5D4SA 2L3DA 2ZNZA 4PK4A 3IH4A 2ZJPF 3FM3A 3MEXA 2F5VA 3A01B 3HOUJ 3LSRA 2E5ZA 1I27A 2X6OA 4MEYF 4MQVA 3LNQA 1TQMA 3CF2A 2IA1A 3QU3A 4CH7A 1LDKB 4BY1J 3JREA 4OIOF 4FQGA 4RGSA 5F1RA 4OMZA 3REOA 2ZXHA 4HLXA 3ZMSA 2UZKA 4CICA 1YS6A 1NG7A 4Y7NJ 1MJAA 2UV1A 3V7CA 1K78B 5KNLA 2W24A 1G2HA 2W1OA 5HLHA 3JRGA 2CW8A 3WG9A 4GO1A 4YIIA 3CCSI 4PUSA 4H4KC 1Z7LA 3K6GA 2BYVE 3O2PE 3MAJA 4E7HA 2ZBKA 1IW7F 1NK3P 2A05A 3IH3A 2DBBA 1B4AA 1GVJA 3Q9VA 3LA7A 1E2XA 5LGUA 3QPTA 3TOAA 2MLKA 2KDZA 3ECHA 2Z3YA 4BU2A 3BZ6A 1TWFJ 1UELB 2EILH 3H5RA 5JHUA 2CV2A 1YHQI 3CCYA 2X6XA 3VSLA 5KCMA 2HKXA 3PNTA 1OQYA 4L9VA 2HOSA 3EUAA 2QKLB 3EPZA 1AKHB 2BW3A 3RQIA 2QF7A 1X4OA 3LAJA 2V9KA 1Z0XA 4KT5C 1MBKA 2MH2A 3EUHC 2E7WA 4KT6A 3G6EI 5ILSA 1IN7A 2R4GA 1Z6RA 2DCEA 2WAQN 3GZNB 4WX9A 1D0ZA 1SAUA 5GAEJ 2ME0A 5FKMA 2DFEA 3E3VA 2PLYA 3M8FA 5GPAA 2WAFA 3BY6A 4KA4A 4I98B 4ZDPA 1ON2A 3AL0C 4BS9A 3S17J 2CMPA 3ZCOA 2QSFX 3HGGA 3JR9A 2OC6A 2XSJC 3GEZA 3SQNA 1STZA 1VQNI 3OY9A 1BI2A 1A36A 3S15J 2XB5A 3KEYA 4BXFA 3SFZA 1HXDA 5E3MA 5FRMA 1I1GA 1S29A 3ASNH 4II3A 5KVRA 1YQAA 2EBIA 3CZ6A 3SFIA 4LG0B 4UY8I 5C4XJ 2MD0A 2WA0A 3C1DA 3JTHA 4N4NB 5DEQA 2CQKA 3OWTA 3G1OA 3HL2A 3CCUI 2VASA 4JOMA 4II2A 4LLNA 4A3LJ 1YFHA 3CC2I 1WRJA 1ZGAA 4DYQA 4PJ0C 4CCLA 2MABA 2M87A 3I9V2 3HOYJ 3SEQA 3VODA 1TW3A 2PMZN 1TL8A 2PMZA 2Q1ZB 1OCTC 2FXAA 2KLOA 1L3LA 3GXOA 3TGNA 2CW0F 3WU1B 2GA2A 2LBFA 1EV7A 1Z67A 2H09A 1F9NA 1I3QJ 5D8KB 1PUEE 4L9JA 3K0LA 3CJRB 4A3DJ 1ETWA 2R7FA 4BEHA 2L7KA 2NVUB 4QLCU 2DPDA 3K1NA 1ZR4A 4LMYA 1N25A 2ZJ2A 5GAHJ 1ZLKA 4L0ZB 2JVHA 2R5YB 5CQEA 4UUSA 1MJBA 4R79A 3K1PA 3X2QH 4BY7J 3I4MJ 4IO9F 2IW5A 2Y75A 1YRNB 5B1AH 1GXQA 3H92A 5IT3A 1U78A 1VZ0A 3WHBA 3ZQIA 1QNTA 3BQZA 1AOYA 1FMWA 3VSKA 1YTYA 2K02A 2IA0A 1TQPA 2QQAA 5JI6A 3F72A 1OR7C 1POGA 2W82A 3JTGA 1C0WA 2H94A 4IF4A 3DU6A 2DFIA 3F8MA 2M3AA 5JLWA 1Y8RB 2QWWA 5IYDJ 3HOXJ 5J3LA 3OYDA 5CVVA 2PN6A 4BDZA 5CVIA 2JUGA 3LWFA 5GADJ 1YE9A 1MJ9A 2XKPA 5F0FA 4CHUA 2F2EA 1YI2I 2ME6A 2L2OA 4CCJA 4BYYA 1LFBA 1SVMA 2FOWA 4JX4A 3JAMK 3HPHA 3EYIA 4IHTA 3WHCA 1GVDA 3DTIA 3QYFA 2F4IA 3HIFA 2EQRA 3HHHA 1VQ4I 1H9TA 3ABLH 2DU9A 2KT0A 2NNNA 3DEEA 3ML6A 2Z1DA 2FBIA 1FSEA 5K5RA 3FWEA 1MIJA 2VQCA 4B3XA 1LFPA 1MH4A 3CCQI 4PJMA 3SEZA 3SZGA 2ZB9A 3G1LA 2QLZA 3S2DJ 4XKBA 2R7ZJ 4GRIA 2M7AA 5BNGA 1A6QA 4AVZA 1HW5A 3FMRA 2X9DA 2Q2EA 4H0EA 2DLLA 3LSGA 3K9TA 2MGQA 3GYHX 3H35A 3F8BA 2DK8A 2HS5A 4BNCA 5E1XA 3HYIA 4HX4A 3D5LA 3GX4X 1J75A 2HDCA 4LIVA 2COMA 2IS6A 5E79C 3L7WA 4GDFA 3HJEA 4G6TB 3P9CA 1HW1A 2XRNA 2O7OA 4DQ2A 2W25A 5FGMA 3TDUC 3K10A 4G7HF 3GLXA 3OSFA 1Z77A 4PZJA 2I5UA 3TO6A 3UKGA 2NVXJ 2OCEA 3IV5A 3W2AA 3LQRA 3EUHA 4KIFA 1VQLI 5K7HA 2V7FA 3LSHA 3WODF 4XRMA 4B3AA 4A3GJ 4XSXF 4I09A 2WC2A 3PSIA 3PO2J 3RKYA 1NH3A 3E6MA 2CFXA 2E2HJ 4IRGA 2ZO4A 4I0AA 5DD8A 5LBQA 2ZKZA 4JYKA 2CV0A 3E5UA 3KZZA 5H20A 1IV6A 1MSFC 1WPKA 1QQIA 4UV8A 3TOBA 4S0HB 1X1DA 5A2QZ 4OOIA 5DS9A 2WWYA 1WJEA 2E34A 2LY1A 2ELHA 3KP5A 3CMAI 3ASOH 2P0WA 2M8EA 1S6LA 3K4BA 1OLTA 1LEAA 5FROA 4F93B 2EFWA 4A3JJ 2FA5A 2X4HA 3KZIC 2K5CA 2KRFA 1B72B 2P6SA 1IRFA 1SVOA 1XGOA 4DNCA 3MFKA 3L2VA 5FLXZ 3FXOA 4KITB 1APLC 1ODDA 2AS5F 4ETSA 5IOZA 4HV6A 2KZGA 1K6OA 2V79A 1EJ9A 4A2UA 3H9QA 1B1BA 2VXZA 1IDZA 2J5PA 3CDHA 1U9OA 2A6TA 5HNFA 3B02A 3A2KA 3U21A 1NG6A 4HZFA 3ZQHA 1MD0A 4M6XA 1UHMA 4BDYA 4XBFA 4V2GA 2JWTA 1LKXA 3ZOBA 3E0JB 1J2XA 5HLGA 2FMLA 4UB6C 1A35A 1FT9A 2DOFA 2IGNA 2HFHA 2K3PA 1S7EA 3DEWA 2XDVA 3EYYA 1ZG3A 1ZYRF 2HZDA 1SFOJ 4MNUA 2DA7A 2VN2A 3EQLF 4W1UA 3VYUB 1RRJA 3WG7H 2MSYA 3TW7A 2WV0A 3V8JA 4PJNA 5EZGA 2WBMA 2O0YA 3BJAA 2VJIA 5E20A 1UFMA 4BXUA 3DCFA 3WTVC 2VKHA 2BY2A 4RS8A 4IL6C 1Y6IA 2KMUA 3BTCA 3ZP5A 2QZ8A 1JT6A 5BPDA 1XD7A 3CCMI 3WGHA 3KYDB 2YU3A 1FIPA 2KRCA 1FMVA 3AL0B 3ZR8X 1X1BA 1Y0NA 4U88A 4C2MJ 2MH9A 4LIUA 3ZQGA 2PJRB 4NC7A 2TDXA 3BTJA 1E17A 4AIKA 2DQRA 3DBLB 3DU5A 3JRDA 3MWMA 2JA8J 2HPMA 3KETA 3L2WA 4I7HA 2HZTA 4UVBA 4DBQA 1BI1A 3FBNB 2K9SA 1FC3A 3NAUA 2BXZA 1KQ8A 4XN3A 3A02A 1H89C 4RAGA 1YW9A 2OCCH 4GYIA 3F23A 2FX0A 3E97A 3CCLI 1Y1VJ 2KIUA 1SD5A 3BJOA 5ILVA 5DCMB 4AM3A 2E35A 2EZIA 2E1MB 1XDUA 1V5FA 1FP1D 4BQAA 4XRFA 1X2NA 2KP6A 3JRFA 1JE8A 1TC3C 3C3WA 5J4VA 3G73A 1X1AA 4MHGA 1SANA 5FRNA 4PSXA 4NC6A 2DT5A 3PUBA 3FHNA 1KGSA 1LJ9A 4AIDA 5IT9Z 2E60A 4XL9A 3F3XA 3DWLE 1HC8A 2LOOA 3S93A 5IOYA 3LSJA 4QPQA 4C2UA 3KCCA 2D1HA 2Z33A 1G4DA 3K2ZA 2DT7B 3SJMA 2HOEA 4A12A 1A04A 4LK0F 4BE0A 1JKOC 4UNOA 2PMUA 2R7QA 4Y3OA 2OV7A 1W1WE 1DUXC 3OR2C 2KL4A 4Y17A 1ITYA 3RKXA 2ISYA 1CQTA 1EF4A 2PFBA 3JSOA 1G3SA 2FQ4A 4NQWB 1AHDP 2H1KA 2HI3A 5TISC 3E5QA 1X4PA 2DYSH 1W0TA 3WE2A 5GP9A 3QP6A 2OBPA 3GCMA 2RQQA 3WGGA 1RR7A 4LITA 2HWVA 1FOKA 2JN6A 3M3YJ 1IN4A 1XCBA 3SYTA 4DYRA 3OMYA 2QVOA 4UV9A 2L01A 5CVJA 3W3CA 3OOPA 1MDMA 1TTYA 2QQBA 2FRHA 4C3IJ 3LSMA 2BEOA 4DJAA 1J09A 2VC1A 3ECOA 4NHJA 1U3EM 3HG9A 4KN4X 4JBAA 1DQUA 2IP2A 3CTAA 4XK4A 2VPLA 2ZSHB 1EA3A 4EJVA 2XGDA 1T2KA 2VPRA 3BR3A 2PEXA 2L0KA 4P9FA 3IKTA 4U7DA 3BJ6A 2OU2A 5K7FA 1PVEA 1TLHB 2MC4A 4NBQA 2A68F 2B0LA 4LB5A 5ICEA 2FE3A 2LNBA 5FD6A 4D0PA 3W6KB 3SZPA 1BC8C 4M74A 5J47A 3B6AA 1EH8A 3P9KA 1SEUA 2V6EA 1IN6A 4ZYGA 5EEHA 4M3DA 2R7TA 4BL0B 4IXAA 3WTXC 4BAYA 2Y0SN 2LYCA 4QTRA 3FXUA 5F1JA 4EGZA 1JHFA 3U9GA 4JX5A 1T56A 3T1BA 1ZK8A 4V2FA 3Q3SA 3S3MA 2ZSIB 3C18A 3A0BC 5CVRA 2GIVA 3OYEA 3GTQJ 2YSRA 1XGNA 1ZTRA 4XR6A 2M8GX 1MMDA 5L3DA 1SC7A 4XQFA 1HOMA 1IRGA 1FEXA 1RI7A 1ZQ3P 1MBFA 5K7ZA 4F92B 1Q1VA 5LGTA 3BQYA 2W85A 1HSJA 2O8KA 1SD4A 3DKWA 3Q0UA 3OYJA 1WFXA 2PQ8A 1JKPC 5F0HA 2GQQA 4CYDA 2YR2A 1KONA 3FDYA 4O5VA 3KIOA 2QUFA 4A5MA 3PIPF 2EK5A 3I64A 3V4GA 4LGWA 3EDPA 2W48A 4MTDA 1SD6A 3HBLA 3FXRA 2RNJA 3KE2A 2DODA 3OIPA 2X1CA 5F27A 2EIJH 4AIJA 2OQRA 1O3TA 5EG0A 1J7KA 2J5OA 4P55A 1Z05A 1HLVA 2JUCA 3AG1H 2A3SA 2K9MA 4HEA2 1SMTA 3QOPA 4XORA 3Q9SA 2FBKA 3KP4A 3G2BA 4Q48A 4AWXB 1JKQC 3HRMA 4XKWA 4EJTA 2XPVA 1BA5A 5M3FJ 4L9NA 2HOAA 5L3CA 3AAFA 1UMQA 2D5VA 5TGTA 3QAHA 1K61A 3HGYA 2R7RA 2O5RA 4S04A 3H0DA 4MFDA 3HC7A 3OYFA 5CYVA 4IHWA 1OYWA 4OAZA 2DPUA 5D4RA 3BROA 4RLFA 5D5WB 2L02A 4HNVA 4HRIA 1YG2A 4A6EA 4ZDOA 3QOEA 3VFZA 1GV2A 1ETXA 5BOXA 5FKOA 1D0XA 1QHHD 3VB2A 2E1OA 2OUMA 5BS6A 2C6YA 2JA5J 3JSPA 3H1CA 5HS7A 3CCVI 4IHVA 2HVSA 1B59A 1B8IB 3HSRA 2I10A 2OTLI 4V19K 4OU0A 2LY2A 3M7GA 2DTZA 2Y48A 1B6AA 1DGWY 2LC2A 3F21A 3BG6A 2GAUA 4B8XA 1U8RA 2PBIA 4DZJA 4RLQA 3F6OA 3K4CA 2PMHA 3VYTB 1UAAA 1MKMA 2DDAA 2DA4A 2CH0A 1WGXA 1BW6A 2P81A 2BVLA 4XLEA 1K79A 5F0CA 5EGOB 2XAJA 4U0VA 3OSGA 4EMSA 2OZ6A 5B5EC 2CSOA 2LF7A 1GXPA 2XAGA 1MZBA 2ADUA 5J40A 1V5GA 2PJPA 1MBJA 4ITVA 3LQQA 4WXCA 2L54A 4XLFA 3CF5F 3IKVA 5ILUA 4PDKA 1T95A 3QWLA 1DPRA 2PX9A 1W36D 3QPLA 4NB5A 2JSPA 4HX8A 1ZG5A 3TW6A 2XAQA 4HLYA 2HYFA 2XAUA 4BBRJ 1DP3A 3DXJF 1K4TA 3ULQB 4NDLA 2ZCWA 1SFXA 3L2RA 2ZMEA 3I53A 2NVQJ 5E18F 5GPCA 1U8BA 2M4GA 4PJJA 5M5YJ 5H6QA 2VJ5A 4I02A 1IRZA 2QYOA 2EV6A 2G0EA 1VQOI 3HKZN 3HKZA 4LLLA 3IC7A 3IP4B 3DQVC 4X1EA 4UXNA 1OYYA 2OJED 2NS0A 3ZGKA 4KUMA 3TDZC 4CSWA 2DOAA 3IL2A 3L2UA 4P9UA 1SAXA 5LEKA 2QSGX 2M34A 3DV8A 1H0MA 1UJ8A 1I1SA 2V4JC 1X58A 1G8XA 4A69C 2NS7A 4AVPA 1X3UA 1OYIA 3KP7A 4XMYA 1WJ5A 4WF2A 3GO5A 5F6FA 2LKXA 2M9HA 1WJDA 3JCUC 2LKSA 5C4JJ 2ZFUA 3DBRB 1TW2A 1BIBA 2Z16A 1OCCH 4E70A 3OYLA 2LTPA 5EJCA 4G94A 5C44J 1EKEA 5DD4A 2BVMA 3OOUA 4XNFA 2R7SA 2WAQA 3HUGB 1R1TA 2WAEA 1ZR2A 4AC0A 4MGRA 4ZC3A 4AIHA 3B6CA 2OZUA 3HRTA 3V42A 2JRMA 3TBIA 3OYGA 1W7PB 1OFCX 1SVLA 1YW7A 3HDDA 1R5ID 3I4NJ 5HDGA 4EM0B 1IRXA 1S8NA 4CYCB 2ETHA 1IN8A 5E1ZB 3IRQA 2OAZA 1B9NA 2A6HF 4CDGA 2STTA 2E1CA 3ELKA 4LJZF 1O7LA 2V6CA 3RIRA 4F7ZA 1E3OC 2ID3A 5LFAA 2MLGA 2KQRA 1LQ1A 1PP7U 2XSDC 4DZPA 3CO6C 4A3BJ 4B48A 2Y31A 4RM3A 3OIQA 4F91B 3R0JA 2P8TA 2K27A 4ENKA 1Y0UA 2AQFA 1NK2P 3RSNA 1S7OA 4Z6YA 4M3EA 1TBXA 4PCQA 4U87A 1YO5C 1Z6TA 3G1MA 1VI0A 1SMYF 3ESWB 3DKXA 2BXYA 2R5ZA 1IXRC 3K4NA 5D6FA 2CRGA 4L5EA 1VFCA 4BQQA 2F5FA 1FBUA 4RGUA 2O6GE 1ZAOA 2IGMA 4FETA 5J8FA 2KHMA 3CUQA 1USTA 4B1RA 5DM6F 2VOPA 1GT0C 2CQQA 2HYJA 2EFOA 1JJ8C 3L2CA 5H6RA 3JW4A 5E17F 3KP2A 2ZFWA 1MBGA 1ZGWA 2CFOA 1HCRA 2P7CB 2EV5A 1GV5A 1PUFA 3P5JA 2Z9OA 2WB1N 2WB1A 1FWZA 4QWQA 4RMNA 2ZJRF 3GFLA 4BE2A 2KJCA 1X19A 3S8PA 5E8GA 1O3QA 2CUZA 4HF0A 1G59A 1WVRA 4A5NA 2IVMA 1R5HA 2ESHA 2MW8A 4M3GA 1HF0A 1ACIA 2DXIA 4LD5A 4AYBN 4AYBA 4Q47A 5J4YA 2CO5A 4EJOA 2QSHX 3KLOA 2GBYA 1V54H 3T8TA 4BUPA 2NXNB 2CG4A 5HDKA 2IGKA 3JRBA 2HR3A 2AO9A 2O9LA 2BW3B 2GOXB 2X6WA 5E8IA 2HQNA 2FNPA 4ZDLA 4IRHA 1WQ2A 1YLFA 5LD2C 1RETA 5HDNA 1UG2A 4RB0A 4ENMA 1WJAA 2CW7A 4DGWB 3GFMA 4RGXA 3MQ0A 1P92A 2CUEA 2BHYA 4U0WA 2O61A 5J1RA 2B9SA 2HU9A 4D7MA 3CQZJ 3B73A 2ICWG 2DK5A 4QIWN 3CP2A 3NWTA 3K70D 3BR6A 3WTYC 2VBYA 3FBIB 2CWEA 2RDPA 4UUVA 4M72A 2YX4A 2EH3A 4CA0A 4JQFA 4N0BA 4ZYHA 1ZRFA 1BR4A 1OISA 2OTJI 2M4KA 3N97A 1QVUA 1V4RA 3O8GA 3VYSB 4Y52J 1O4XA 1QRYA 3E7LA 1XSDA 4MQ9F 1S5LC 5EZHA 1N78A 1BR2A 4X6AJ 3MCZA 3EETA 3BC8A 1Z1DA 2E71A 5L3BA 5F04A 2X85A 3E5XA 3M1EA 5HVQC 1ETYA 1DU0A 2DQLA 1WJCA 2G7HA 3KEOA 1Y39A 1DP7P 3AG3H 3ZXSA 3H0GJ 1ULYA 1TNSA 4RAYA 5DDGA 2K9QA 3SDBA 3ZQQA 2LBFB 5HNHA 1DPUA 3BR1A 2DT6A 1IAWA 2GOMA 2A61A 1D5YA 1LDDA 4XLHA 2P7VB 4BEHB 3A03A 3QYBA 4RGRA 1TWCJ 2BE5F 3MKLA 3P7NA 5LHIA 1V55H 4UUSB 2DI3A 2L4AA 3CCRI 3R4KA 2DN0A 3U2RA 4EQQA 1R58A 1K7AA 4GGGA 2IGOA 1KQ9A 1KU3A 2M0MA 2GXAA 4I01A 2BY1A 1S3JA 2ZXIA 3CLOA 5K5OA 3Q0WA 4MO7A 1FPQA 1KQ0A 4BQNA 2XRLA 2LY9A 4IJAA 4HNTA 4XRSA 3BTLA 2KDOA 1KU9A 3WGIA 2A5WA 3H5AA 2IJLA 4B43A 1Y8QB 4E7KA 4KMFA 3O8HA 5J6XA 4NC8A 2XV4S 1XSVA 1YX5A 1LE8A 1IF1A 1QA6A 5HODA 3GTKJ 2UXXA 2P6TA 4A6DA 4KMUX 3BZCA 4D5CA 3LOCA 4ZYAA 1UZCA 5JVTA 3W6JB 1IXCA 2JA6J 3S14J 3UNGC 3WTTC 3AKZA 4QSHA 5FKKA 5ICFA 2O03A 1I3AA 3CC4I 3KYCB 2Y0MA 3CMYA 4HQEA 1EH7A 1ZRCA 5L3FA 1BIAA 2VKDA 3HM5A 3PFYA 2V9PA 5GTHC 4IVNA 3LSKA 2DMQA 5ERIA 5DUKA 2CQNA 2FQ3A 1FOWA 4HF2A 1MMNA 2YPRA 1CF7A 1I6XA 3LSPA 2LVSA 3D0SA 3VWBA 2VC0A 3PIOF 5M3MJ 3OS2A 2BGCA 3K69A 3PJRA 2IPQX 1TT0A 2K9LA 1MW7A 1R4NB 4A93J 3IWFA 3M8EA 1ETVA 1XGMA 4XM3A 1BM9A 3FXMA 2GXGA 2Q2EB 2VKVA 4XLCA 4D7NA 1JJ6C 3CMMA 3HXLA 3CMEI 4E7ZA 4BKXA 2HTSA 5LRSA 1O57A 2ZC2A 4EVIA 2E19A 4A3MJ 3HOSA 1RC9A 2Y30A 1YJWI 3RYRA 5TRDA 4FCYA 1ON1A 4IHXA 1WCMJ 2LR8A 1ETKA 3KLNA 2EB7A 2R7WA 3WTSC 1FZPB 1TWGJ 5BPIA 5ED4A 4F55A 3MZHA 3QP5A 2LKPA 3FM5A 4F52A 3QPHA 2OA4A 1FSHA 3QODA 1QZYA 2BV6A 2HEOA 1XG1A 4HSTA 1R1VA 2CUFA 1H8AC 2GLOA 1BJAA 1U5TA 4JK1X 4BJTA 3GTMJ 1R36A 2QM3A 3JRAA 1QGPA 3I3LA 4OIQF 2VUMJ 1TT5B 1UB9A 3OYHA 4BJ5C 2L7MP 1U6GA 1USSA 3N4MA 3J80Z 2E2JJ 1IO2A 1S7AA 3ZMUA 5HS9A 1IDYA 2DOEA 1BOAA 2Z2SB 3F8NA 2WY8Q 1BJZA 4M9ZA 2P5LC 2EFNA 1N75A 4RB2C 1HA8A 1QO0D 2RNGA 1RPWA 3I59A 4YEJA 4BHBA 2R7XA 3IUOA 2EFPA 1XN7A 2V1XA 1JUMA 3E6DA 3OIOA 2EZLA 4UB8C 1WJBA 5FJ8J 2VKEA 1T0FC 3K4KA 3TO9A 3K2AA 1Z3XA 6PAXA 2KJBA 4KNYA 3OYIA 1U2WA 4PGGA 3ZMVA 1MSEC 2HDWA 3N05A 1T6SA 2AHQA 2FEZA 4L5JA 4A3KJ 3DLLF 3UR3C 1X3WB 2F6CA 2JJ7A 1D1BA 1R49A 2LLKA 4C3JJ 1LB2A 2PI0A 1XB4A 1ONVA 3K4JA 3ZQ7A 1MGTA 1NTCA 4ZZLA 3TL4X 3JRIA 3CDIA 1LUJB 2CJJA 3DFGA 5LLQA 5B3SH 3S1NJ 4M9SA 3J7ZI 1FP2A 2HQAA 2JK3A 3BZKA 5J8CA 4BH9A 2RV8A 2RGVA 4EM1A 4WWCA 4C9YA 1MNDA 2LFBA 2A5YB 2F48A 2XVCA 2ESNA 3TO7A 2ELJA 1IZ1A 1ZELA 3MN2A 3LSIA 1FOXA 1LNWA 3J7YJ 2KKOA 3WE3A 1OJLA 1P7IA 1ERDA 2GXBA 3RI4A 1HDPA 2L9VA 3E1SA 1NHAA 1JUPA 4D9JA 2P4WA 2DA1A 2ISZA 2IS1A 3V7SA 3D5SC 5CPRB 3BDDA 3RPUD 4FX4A 3I56I 3GLLA 2RC4A 3I58A 2CGPA 2BOLA 2ID6A 2XF5A 5D6EA 3HZJA 2JPCA 2X51A 1IJWC 1D5VA 1OKRA 1FNNA 3BPXA 1J59A 3RZOJ 3I5UA 3FISA 4HAMA 2DFFA 4PJLA 2KZVA 4OMYA 2X48A 4HG2A 1JGGA 3FKJA 3DTKA 3KYLA 5DYMA 2F5DA 2RQPA 2ZMEC 2VODA 1DU6A 2WADA 4PGHA 2ZXWH 2ZXJA 4R8HA 4C30A 4B09A 4GXOA 1LPQA 1FTTA 4Q4ZF 2DAOA 2GWRA 1U9NA 2VQGA 3GUDA 1FYLA 2X0LA 1SFKA 3FMQA 4E4HA 1O7FA 5JHFA 4PSWA 1FYMA 2UXNA 1IUYA 5E3LA 3M4OJ 2NAZA 4RAZA 3KX2A 1B9MA 1PDNC 4LK1F 3GBGA 2M45A 1J5YA 3C2GA 3ERMA 3J81K 3BCAA 5L3GA 1YS7A 1WHUA 2DJIA 2JT1A 2L9RA 2HKOA 3PO3J 2DJNA 4EV0A 4ENNA 1GHCA 2VE9A 2DMNA 4UHTA 2DFHA 1XS9A 2NNYA 3L9FA 4FTHA 2FD5A 2Y0SA 2F5CA 3AFHA 3WTWC 4L18B 3L00A 4HQMA 1MNEA 2PG4A 1Z91A 1FJLA 3GTPJ 3O3KA 3MZYA 5TJJA 3OYKA 3F8CA 1ENHA 1F1ZA 1P4XA 3SDGA 3K4LA 1FYKA 2XGEA 3D1NI 2Z5UA 1OMIA 2HVRA 4BQOA 1XGSA 4LB6B 1ZARA 3HEFA 1QBJA 2YX7A 2QBYA 3AG2H 1WH5A 4E6KG 2LD5A 1BC7C 5IP7J 2R7VA 4IPAA 5GTIC 2R7DA 3GTJJ 4M3BA 4RM2A 1K4SA 5IYCJ 4G7OF 2B7EA 2VE8A 3OYMA 1T98A 3M1CA 3RJPA 3BR0A 1WKMA 3CJQB 1REPC 1OCPA 4FHTA 4XKCA 2Z99A 2EINH 4U0YA 3A01A 4MLOA 3MKYB 3HSFA 1UG0A 3RQ4A 3JAMZ 1RKTA 3DF8A 4KICA 2UUZA 1N77A 2K4JA 3KEQA 5H2FC 1D1AA 3NRVA 5EEAA 3WTZA 1CGPA 5FO5A 1MDMB 4NNJA 1ZGJA 4E7SA 1T0FA 4CO8A 4RA2A 2V26A 3LMMA 1K78A 3RTRA 1E3HA 1IGNA 1R1UA 2RAEA 1P9QC 4XLPF 4IQJA 3CUQC 3M9AA 3FKIJ 3ZMTA 4CXFA 3TQNA 1QPIA 1JTYA 4IHSA 2LP0A 3PM1A 2QENA 1VF9A 3T0YA 3DTEA 4HW0A 2NYXA 3GTOJ 3IAS2 1W4MA 1R23A 2L7FP 2XF6A 3G3ZA 4HSRA 1VQ6I 2XHKA 3HSEA 4M6VA 1FY7A 4BACA 3FZVA 5AONA 4ZJZA 5FLXK 5EF6A 3IWZA 5D8LB 2L4MA 5K1YA 4IRIA 4I2OA 1LVAA 1OCZH 1OPCA 2CQXA
chains in the Genus database with same CATH topology
5D5XB 2W57A 3FXQA 4YFNF 3CUOA 4MEXF 4Y13A 2D2WA 1FX7A 2G7UA 3KFWX 5E1WA 4HF1A 3GZ5A 4M6YA 1JXSA 4R1HA 2AXLA 1ZH5A 3SHFA 3ZN0A 2LDUA 2W84A 4Z2YA 4P96A 2A07F 3HRSA 4LG0A 2JRTA 1G6NA 3H3ZA 4LLGF 3LSTA 2MD5A 4CGZA 4Q5SF 1KA8A 1QZZA 2XAFA 1TNTA 4ESBA 4KDPA 3GZ6A 1XDSA 1HBXG 1H9GA 4G9YA 1FLIA 3RPUA 2VBZA 4ASNA 4WXHA 2GZWA 2XIGA 4M9XA 2KIMA 2Q8KA 5IT9K 1HKQA 2STWA 1RZ4A 1HW2A 2NRAC 1HKTA 2A69F 2XASA 1HSTA 3I4PA 3DP7A 3ISPA 1SFUA 3VEPA 2DW4A 2R3SA 3R6SA 4G8XA 2MBFA 3L09A 5FFZA 2IA2A 2HYGD 3BPVA 3HOTA 5CLSA 3GW2A 3ZMDA 2O3FA 3PFIA 2EV0A 4L9TA 3F8FA 5AIQA 1KYZA 5ICCA 2XKOA 5K5QA 3HHGA 2ZMEB 1JHHA 3R61A 5LEJA 1SD7A 1ZHFA 2HTJA 1KU2A 4YG2F 1XCVA 2ACJA 3BP8A 4AD9A 1RUNA 4UVAA 4I0BA 1G3YA 1XSXA 2K86A 3Q5FA 1YW8A 1P4WA 4HBLA 4CZZA 1EH6A 1U5TC 4G6QA 2KIFA 4ZH4F 2FMYA 4HOBA 5JFRA 2RKHA 3SXYA 1KYWA 3J7AO 4FT8A 2FOKA 1J9IA 2P5VA 2IRFG 3WU0A 4KIBA 2EFQA 4M73A 2UWMA 4ESJA 2IT0A 3QRFF 3ZMZA 1IXSB 2QQ9A 3T5XA 3V8KA 1Q1HA 1J0RA 4O6JA 3KP6A 2A6EF 3COAC 1LEBA 3FHZA 4N9HA 2EA4A 3J81Z 3RKWA 2LSOA 4TV7A 3CUQB 1LDJA 2CYYA 3ABUA 2XUBA 1PP8F 5BQTA 3CO7C 1BI0A 1W5TA 2V9VA 3GWZA 2F5EA 1QPMA 3NEUA 3F6VA 1R7JA 1SFEA 4N9IA 2VT3A 3PQKA 5DV5A 3CJNA 2EA2A 4BHCA 1Z9CA 4EJWA 4RB1A 4FX0A 2FU4A 4O3MA 2EJRA 1BN5A 2P5KA 4HYEA 2H27A 2Q0OA 1ZRDA 2XAHA 5D5VB 2MA3A 1WWXA 4MTEA 3HTUA 5DCMA 1Z7UA 3NQOA 2K7LA 4OIPF 4KYWA 4HA8A 1F4KA 5DUIA 2RN7A 3ZPLA 1XMAA 5L3EA 2GA1A 4M71A 2JZYA 1O3RA 4A0ZA 4RB3C 5CVUA 4BHPA 5F64A 2FNAA 1V3FA 2DO7A 5EEGA 4NQWA 5HOOA 3KP3A 4G7ZF 3O6BB 3ZN1A 1R00A 4YFXF 1OR7A 5AIPA 5JR3A 4ON0A 5FB2A 4YFKF 1BBYA 1W7PD 2LF8A 4A0YA 4KIGA 2JPBA 4K2EA 3DPTA 1RUOA 5BMZA 1WI9A 4EGYA 3ABTA 3I54A 2ZNYA 1CF7B 2EWNA 4XLNF 4OIRF 4YIFA 2FSWA 1XMKA 2WTEA 4XSZF 3TKYA 2G9WA 4Y15A 1D8JA 3V8LA 3HTSB 5LRRA 3GFIA 2XROA 4HV5A 3FX3A 3C7JA 2FF4A 1ZLJA 3LA3A 4WK8F 4GCVA 1ZN2A 1U5TB 1W5SA 2E1NA 3WTUC 3R0AA 4U7BA 1HKSA 5LHGA 1RIOH 3R60A 1P6RA 1ZREA 2JSCA 4HDUA 4OINF 2HGCA 3RPQA 3I59B 1YIOA 4G6DA 3BOQA 5LHHA 4ZZDA 1ZG1A 2V1DA 3I71A 5FFXA 5HS8A 1DDNA 2E7XA 3IRRA 4ZYDA 2H6BA 3P9IA 5ICGA 3HRUA 1BI3A 3LAPA 3SZTA 2O8XA 3I0TA 3QU6A 2MC3A 3E6BA 4ZYEA 3FF5A 2BBYA 3H3UA 5D5UB 3V7RA 3PQJA 1UHWA 4EJUA 2JTVA 1P4AA 2VBXA 3KZYA 3OV8A 4WCGA 1R22A 1P2FA 4ENJA 4EM2A 3S2WA 1L0OC 3ROUA 1F5TA 2FBHA 4HX7A 5LGNA 1FBQA 2OD5A 3U1DA 3LA2A 1UCRA 1TQIA 3IHUA 3K1MA 1AWCA 4WXDA 4HDVA 1T39A 2VBWA 1HQCA 1D8KA 1FBSA 2H6CA 3GVAA 5A2QK 3LFKA 3DEUA 2K4BA 2RVCA 2HQRA 4GYGA 4ESFA 3GF2A 1D3YA 4P5OA 1O3SA 1I5ZA 3F22A 2V1UA 3GFJA 4KFCA 2XGXA 2M30A 1VTNC 2VONA 1JGSA 1YYVA 3FMSA 1R5GA 5KK1A 3RDIA 4A0XA 3BWGA 1G3TA 2DTRA 4L0YB 4L5IA 4LFUA 1WSUA 3VOEA 5DCFA 5CJ9A 1KU7A 3HUGA 3T8RA 5FD5A 3RYPA 4KN7X 2QBYB 2OQGA 1T38A 1W7PA 1G3WA 2VT2A 3E6CC 2M1BA 5HLIA 2VOOA 2D1VA 4S05A 3DPLC 2D45A 2M5WA 3ERED 1IN5A 3J80K 4UVCA 1RNLA 5D4SA 2L3DA 2ZNZA 3FM3A 3MEXA 1I27A 4MEYF 4MQVA 1TQMA 2IA1A 3QU3A 1LDKB 4OIOF 4RGSA 5F1RA 4OMZA 3REOA 4HLXA 3ZMSA 2UZKA 4CICA 1YS6A 1MJAA 1K78B 3V7CA 2W24A 5HLHA 3WG9A 4GO1A 4YIIA 2BYVE 3O2PE 3MAJA 2ZBKA 1IW7F 2DBBA 1B4AA 1GVJA 3Q9VA 3LA7A 1E2XA 5LGUA 3QPTA 3TOAA 2MLKA 3ECHA 2Z3YA 3BZ6A 5JHUA 2HKXA 4L9VA 3LAJA 4KT5C 2MH2A 2E7WA 5ILSA 1IN7A 1Z6RA 4WX9A 3E3VA 2PLYA 3M8FA 3BY6A 4KA4A 4I98B 1ON2A 3GEZA 3SQNA 1STZA 1BI2A 3SFZA 1HXDA 1I1GA 1S29A 5KVRA 1YQAA 4LG0B 3C1DA 3JTHA 5DEQA 2CQKA 4LLNA 1YFHA 1WRJA 1ZGAA 2M87A 3VODA 1TW3A 2FXAA 1L3LA 3GXOA 3TGNA 2CW0F 3WU1B 2GA2A 1EV7A 5D8KB 2H09A 1F9NA 1PUEE 4L9JA 3K0LA 2R7FA 2DPDA 4QLCU 3K1NA 4LMYA 2ZJ2A 1ZLKA 4L0ZB 1MJBA 4R79A 3K1PA 2IW5A 2Y75A 1GXQA 3H92A 5IT3A 1U78A 1QNTA 1AOYA 1YTYA 2K02A 2IA0A 1TQPA 2QQAA 5JI6A 3F72A 3JTGA 1C0WA 2H94A 4IF4A 2DFIA 3F8MA 2QWWA 5CVVA 2PN6A 5CVIA 3LWFA 2XKPA 1MJ9A 4CHUA 2F2EA 4BYYA 3JAMK 3EYIA 4IHTA 3HIFA 3HHHA 1H9TA 2DU9A 2NNNA 3ML6A 2FBIA 1FSEA 5K5RA 3FWEA 2QLZA 1HW5A 3FMRA 2Q2EA 4H0EA 2DLLA 3GYHX 3K9TA 3F8BA 2DK8A 2HS5A 4BNCA 5E1XA 3HYIA 4HX4A 3D5LA 3GX4X 1J75A 2HDCA 2COMA 3L7WA 3P9CA 1HW1A 2XRNA 4DQ2A 2W25A 5FGMA 3TDUC 4G7HF 3GLXA 4PZJA 3TO6A 3LQRA 3EUHA 4KIFA 3WODF 4XSXF 4I09A 2WC2A 3RKYA 3E6MA 2CFXA 4IRGA 2ZO4A 4I0AA 5DD8A 5LBQA 2ZKZA 3E5UA 3KZZA 5H20A 1QQIA 4UV8A 3TOBA 5A2QZ 4OOIA 2WWYA 2ELHA 3KP5A 2M8EA 1S6LA 1LEAA 2EFWA 2FA5A 2X4HA 2KRFA 2P6SA 1IRFA 1XGOA 4DNCA 3MFKA 5FLXZ 1ODDA 2AS5F 4ETSA 4HV6A 1K6OA 2V79A 4A2UA 1B1BA 2VXZA 2J5PA 3CDHA 3B02A 4HZFA 1MD0A 4M6XA 1UHMA 4XBFA 1J2XA 5HLGA 2FMLA 1FT9A 2HFHA 3EYYA 1ZG3A 1ZYRF 4MNUA 2VN2A 3EQLF 2WV0A 3V8JA 2O0YA 3BJAA 5E20A 1UFMA 4BXUA 3WTVC 4RS8A 3ZP5A 2QZ8A 5BPDA 1XD7A 3WGHA 2YU3A 4U88A 2MH9A 2TDXA 1E17A 4AIKA 2DQRA 3MWMA 3KETA 4I7HA 2HZTA 4UVBA 1BI1A 1FC3A 1KQ8A 1YW9A 4GYIA 3F23A 3E97A 2KIUA 1SD5A 3BJOA 5ILVA 5DCMB 1XDUA 1FP1D 4BQAA 4XRFA 1JE8A 3C3WA 3G73A 4MHGA 2DT5A 1KGSA 1LJ9A 5IT9Z 3F3XA 3KCCA 2D1HA 2Z33A 1G4DA 3K2ZA 2HOEA 4A12A 1A04A 4LK0F 4UNOA 2PMUA 1DUXC 4Y17A 3RKXA 2ISYA 2PFBA 3JSOA 1G3SA 3E5QA 3WE2A 3QP6A 2OBPA 3WGGA 2HWVA 1FOKA 1IN4A 1XCBA 2QVOA 4UV9A 2L01A 5CVJA 3OOPA 1MDMA 1TTYA 2QQBA 2FRHA 2BEOA 2VC1A 3ECOA 4NHJA 1U3EM 4KN4X 4JBAA 2IP2A 3CTAA 4EJVA 1T2KA 2PEXA 4P9FA 3IKTA 4U7DA 3BJ6A 2OU2A 1TLHB 4LB5A 2A68F 2B0LA 5ICEA 2FE3A 2LNBA 5FD6A 4D0PA 3W6KB 3SZPA 1BC8C 4M74A 1EH8A 3P9KA 1IN6A 4ZYGA 5EEHA 4IXAA 3WTXC 4BAYA 3FXUA 4EGZA 1JHFA 3U9GA 3T1BA 3C18A 5CVRA 2GIVA 2YSRA 1XGNA 5L3DA 1IRGA 1RI7A 5LGTA 2W85A 1HSJA 1SD4A 3DKWA 2PQ8A 2GQQA 4CYDA 2YR2A 4O5VA 2QUFA 4A5MA 2EK5A 3I64A 3V4GA 4LGWA 3EDPA 4MTDA 1SD6A 3KE2A 3FXRA 2RNJA 4AIJA 2OQRA 1O3TA 1J7KA 2J5OA 4P55A 1Z05A 2A3SA 1SMTA 3QOPA 3Q9SA 2FBKA 3KP4A 4Q48A 4AWXB 3HRMA 4EJTA 4L9NA 5L3CA 3AAFA 3QAHA 4S04A 5CYVA 1OYWA 2DPUA 5D4RA 3BROA 5D5WB 2L02A 1YG2A 4A6EA 3VFZA 5BOXA 3VB2A 2C6YA 5BS6A 3JSPA 5HS7A 1B59A 3HSRA 4OU0A 3M7GA 2Y48A 1B6AA 3F21A 2GAUA 4B8XA 1U8RA 2PBIA 3F6OA 2PMHA 1MKMA 1K79A 2XAJA 4U0VA 4EMSA 2OZ6A 2CSOA 2LF7A 1GXPA 2XAGA 1MZBA 2ADUA 2PJPA 3LQQA 4WXCA 2L54A 3IKVA 5ILUA 4PDKA 1DPRA 4NB5A 1ZG5A 4HX8A 2XAQA 4HLYA 2HYFA 3DXJF 3ULQB 2ZCWA 1SFXA 2ZMEA 3I53A 5E18F 5H6QA 4I02A 2QYOA 2EV6A 4LLLA 3IC7A 3DQVC 4UXNA 1OYYA 2NS0A 4KUMA 3TDZC 3IL2A 4P9UA 1SAXA 5LEKA 3DV8A 1H0MA 1I1SA 4AVPA 1X3UA 1OYIA 3KP7A 4WF2A 3GO5A 5F6FA 1TW2A 1BIBA 4E70A 4G94A 5DD4A 1R1TA 4MGRA 4AIHA 2OZUA 3HRTA 1W7PB 1YW7A 5HDGA 4EM0B 1S8NA 2ETHA 1IN8A 5E1ZB 3IRQA 2OAZA 1B9NA 2A6HF 4CDGA 2STTA 2E1CA 3ELKA 4LJZF 1O7LA 2V6CA 3RIRA 4F7ZA 2MLGA 1LQ1A 1PP7U 3CO6C 3R0JA 2P8TA 2K27A 4ENKA 1Y0UA 1S7OA 1TBXA 4PCQA 1YO5C 1Z6TA 1SMYF 1IXRC 5D6FA 2F5FA 1FBUA 4RGUA 2O6GE 1ZAOA 5J8FA 3CUQA 1USTA 2VOPA 2EFOA 3L2CA 5H6RA 3JW4A 5E17F 3KP2A 2ZFWA 2P7CB 2EV5A 2Z9OA 1FWZA 4QWQA 3GFLA 2KJCA 1O3QA 5E8GA 4HF0A 4A5NA 2IVMA 1R5HA 2ESHA 4LD5A 4Q47A 2CO5A 4EJOA 3KLOA 3T8TA 2CG4A 5HDKA 2HR3A 5E8IA 2HQNA 2FNPA 4IRHA 1WQ2A 1YLFA 5HDNA 4RB0A 4ENMA 3GFMA 4RGXA 3MQ0A 1P92A 4U0WA 2O61A 3B73A 2DK5A 3WTYC 2VBYA 2CWEA 2RDPA 4UUVA 4M72A 2YX4A 4JQFA 4N0BA 4ZYHA 1ZRFA 3N97A 1V4RA 1XSDA 4MQ9F 3MCZA 3EETA 1Z1DA 5L3BA 3E5XA 3M1EA 5HVQC 2DQLA 2G7HA 3KEOA 1DP7P 1ULYA 1TNSA 4RAYA 5DDGA 1DPUA 1IAWA 2A61A 1LDDA 2P7VB 4RGRA 3P7NA 2BE5F 5LHIA 2DI3A 2L4AA 3R4KA 3U2RA 4EQQA 1R58A 1K7AA 4GGGA 1KQ9A 1KU3A 4I01A 1S3JA 3CLOA 5K5OA 1FPQA 1KQ0A 4IJAA 1KU9A 3WGIA 2IJLA 4KMFA 5J6XA 2XV4S 1XSVA 1IF1A 2UXXA 2P6TA 4A6DA 4KMUX 5JVTA 3W6JB 1IXCA 3WTTC 5ICFA 2O03A 2Y0MA 4HQEA 1EH7A 1ZRCA 5L3FA 1BIAA 4IVNA 5ERIA 5DUKA 2FQ3A 4HF2A 2YPRA 1CF7A 1I6XA 3D0SA 2VC0A 2BGCA 3K69A 2IPQX 3IWFA 3M8EA 1XGMA 1BM9A 2GXGA 2HTSA 5LRSA 1O57A 4EVIA 3HOSA 3RYRA 5TRDA 1ON1A 3KLNA 2EB7A 3WTSC 1FZPB 5BPIA 5ED4A 3MZHA 3QP5A 2LKPA 3FM5A 3QPHA 2OA4A 1FSHA 1QZYA 2BV6A 2HEOA 1R1VA 1BJAA 1U5TA 4JK1X 1R36A 2QM3A 1QGPA 4OIQF 1UB9A 1U6GA 1USSA 3N4MA 3J80Z 1S7AA 3ZMUA 5HS9A 1BOAA 3F8NA 4M9ZA 2P5LC 2EFNA 4RB2C 1QO0D 3I59A 4BHBA 2EFPA 1XN7A 2V1XA 3E6DA 3TO9A 6PAXA 2KJBA 4KNYA 1U2WA 4PGGA 3ZMVA 1T6SA 2FEZA 4L5JA 1LB2A 2PI0A 1XB4A 1ONVA 3ZQ7A 1MGTA 4ZZLA 3DFGA 5LLQA 4M9SA 1FP2A 5J8CA 4BH9A 2RV8A 2RGVA 4EM1A 4WWCA 2A5YB 2XVCA 2ESNA 3TO7A 1IZ1A 1LNWA 2KKOA 3WE3A 2GXBA 3RI4A 1NHAA 2P4WA 2ISZA 3V7SA 3BDDA 4FX4A 2CGPA 2RC4A 3I58A 5D6EA 2JPCA 1D5VA 1OKRA 1FNNA 3BPXA 1J59A 3I5UA 4HAMA 4OMYA 5DYMA 2F5DA 2RQPA 2VODA 4PGHA 2ZXJA 4R8HA 4B09A 4GXOA 4Q4ZF 2DAOA 2GWRA 3GUDA 1FYLA 2X0LA 3FMQA 1O7FA 1FYMA 2UXNA 1IUYA 2NAZA 4RAZA 1B9MA 1PDNC 4LK1F 2M45A 1J5YA 3J81K 5L3GA 1YS7A 2JT1A 2HKOA 4EV0A 4ENNA 1GHCA 2VE9A 4UHTA 2NNYA 3L9FA 4L18B 2F5CA 3WTWC 3L00A 4HQMA 2PG4A 1Z91A 3O3KA 3MZYA 5TJJA 3F8CA 1F1ZA 1P4XA 1FYKA 2Z5UA 1OMIA 1XGSA 4LB6B 1ZARA 1QBJA 2YX7A 2QBYA 1BC7C 4IPAA 2R7DA 4G7OF 2VE8A 1T98A 3RJPA 1WKMA 1REPC 4FHTA 2Z99A 4U0YA 3HSFA 3JAMZ 3DF8A 4KICA 2K4JA 3KEQA 3NRVA 3WTZA 1CGPA 5FO5A 1MDMB 1ZGJA 1T0FA 4CO8A 1K78A 3RTRA 1R1UA 4XLPF 3CUQC 3M9AA 3ZMTA 4CXFA 3TQNA 4IHSA 2QENA 3T0YA 4HW0A 2NYXA 1W4MA 1R23A 3G3ZA 2XHKA 3HSEA 1FY7A 3FZVA 5AONA 5FLXK 3IWZA 5D8LB 2L4MA 5K1YA 4IRIA 4I2OA 1LVAA 1OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D5X B;  2W57 A;  3FXQ A;  4YFN F;  3CUO A;  4MEX F;  4Y13 A;  2D2W A;  1FX7 A;  2G7U A;  3KFW X;  5E1W A;  4HF1 A;  3GZ5 A;  4M6Y A;  1JXS A;  4R1H A;  2AXL A;  1ZH5 A;  3SHF A;  3ZN0 A;  2LDU A;  2W84 A;  4Z2Y A;  4P96 A;  2A07 F;  3HRS A;  4LG0 A;  2JRT A;  1G6N A;  3H3Z A;  4LLG F;  3LST A;  2MD5 A;  4CGZ A;  4Q5S F;  1KA8 A;  1QZZ A;  2XAF A;  1TNT A;  4ESB A;  4KDP A;  3GZ6 A;  1XDS A;  1HBX G;  1H9G A;  4G9Y A;  1FLI A;  3RPU A;  2VBZ A;  4ASN A;  4WXH A;  2GZW A;  2XIG A;  4M9X A;  2KIM A;  2Q8K A;  5IT9 K;  1HKQ A;  2STW A;  1RZ4 A;  1HW2 A;  2NRA C;  1HKT A;  2A69 F;  2XAS A;  1HST A;  3I4P A;  3DP7 A;  3ISP A;  1SFU A;  3VEP A;  2DW4 A;  2R3S A;  3R6S A;  4G8X A;  2MBF A;  3L09 A;  5FFZ A;  2IA2 A;  2HYG D;  3BPV A;  3HOT A;  5CLS A;  3GW2 A;  3ZMD A;  2O3F A;  3PFI A;  2EV0 A;  4L9T A;  3F8F A;  5AIQ A;  1KYZ A;  5ICC A;  2XKO A;  5K5Q A;  3HHG A;  2ZME B;  1JHH A;  3R61 A;  5LEJ A;  1SD7 A;  1ZHF A;  2HTJ A;  1KU2 A;  4YG2 F;  1XCV A;  2ACJ A;  3BP8 A;  4AD9 A;  1RUN A;  4UVA A;  4I0B A;  1G3Y A;  1XSX A;  2K86 A;  3Q5F A;  1YW8 A;  1P4W A;  4HBL A;  4CZZ A;  1EH6 A;  1U5T C;  4G6Q A;  2KIF A;  4ZH4 F;  2FMY A;  4HOB A;  5JFR A;  2RKH A;  3SXY A;  1KYW A;  3J7A O;  4FT8 A;  2FOK A;  1J9I A;  2P5V A;  2IRF G;  3WU0 A;  4KIB A;  2EFQ A;  4M73 A;  2UWM A;  4ESJ A;  2IT0 A;  3QRF F;  3ZMZ A;  1IXS B;  2QQ9 A;  3T5X A;  3V8K A;  1Q1H A;  1J0R A;  4O6J A;  3KP6 A;  2A6E F;  3COA C;  1LEB A;  3FHZ A;  4N9H A;  2EA4 A;  3J81 Z;  3RKW A;  2LSO A;  4TV7 A;  3CUQ B;  1LDJ A;  2CYY A;  3ABU A;  2XUB A;  1PP8 F;  5BQT A;  3CO7 C;  1BI0 A;  1W5T A;  2V9V A;  3GWZ A;  2F5E A;  1QPM A;  3NEU A;  3F6V A;  1R7J A;  1SFE A;  4N9I A;  2VT3 A;  3PQK A;  5DV5 A;  3CJN A;  2EA2 A;  4BHC A;  1Z9C A;  4EJW A;  4RB1 A;  4FX0 A;  2FU4 A;  4O3M A;  2EJR A;  1BN5 A;  2P5K A;  4HYE A;  2H27 A;  2Q0O A;  1ZRD A;  2XAH A;  5D5V B;  2MA3 A;  1WWX A;  4MTE A;  3HTU A;  5DCM A;  1Z7U A;  3NQO A;  2K7L A;  4OIP F;  4KYW A;  4HA8 A;  1F4K A;  5DUI A;  2RN7 A;  3ZPL A;  1XMA A;  5L3E A;  2GA1 A;  4M71 A;  2JZY A;  1O3R A;  4A0Z A;  4RB3 C;  5CVU A;  4BHP A;  5F64 A;  2FNA A;  1V3F A;  2DO7 A;  5EEG A;  4NQW A;  5HOO A;  3KP3 A;  4G7Z F;  3O6B B;  3ZN1 A;  1R00 A;  4YFX F;  1OR7 A;  5AIP A;  5JR3 A;  4ON0 A;  5FB2 A;  4YFK F;  1BBY A;  1W7P D;  2LF8 A;  4A0Y A;  4KIG A;  2JPB A;  4K2E A;  3DPT A;  1RUO A;  5BMZ A;  1WI9 A;  4EGY A;  3ABT A;  3I54 A;  2ZNY A;  1CF7 B;  2EWN A;  4XLN F;  4OIR F;  4YIF A;  2FSW A;  1XMK A;  2WTE A;  4XSZ F;  3TKY A;  2G9W A;  4Y15 A;  1D8J A;  3V8L A;  3HTS B;  5LRR A;  3GFI A;  2XRO A;  4HV5 A;  3FX3 A;  3C7J A;  2FF4 A;  1ZLJ A;  3LA3 A;  4WK8 F;  4GCV A;  1ZN2 A;  1U5T B;  1W5S A;  2E1N A;  3WTU C;  3R0A A;  4U7B A;  1HKS A;  5LHG A;  1RIO H;  3R60 A;  1P6R A;  1ZRE A;  2JSC A;  4HDU A;  4OIN F;  2HGC A;  3RPQ A;  3I59 B;  1YIO A;  4G6D A;  3BOQ A;  5LHH A;  4ZZD A;  1ZG1 A;  2V1D A;  3I71 A;  5FFX A;  5HS8 A;  1DDN A;  2E7X A;  3IRR A;  4ZYD A;  2H6B A;  3P9I A;  5ICG A;  3HRU A;  1BI3 A;  3LAP A;  3SZT A;  2O8X A;  3I0T A;  3QU6 A;  2MC3 A;  3E6B A;  4ZYE A;  3FF5 A;  2BBY A;  3H3U A;  5D5U B;  3V7R A;  3PQJ A;  1UHW A;  4EJU A;  2JTV A;  1P4A A;  2VBX A;  3KZY A;  3OV8 A;  4WCG A;  1R22 A;  1P2F A;  4ENJ A;  4EM2 A;  3S2W A;  1L0O C;  3ROU A;  1F5T A;  2FBH A;  4HX7 A;  5LGN A;  1FBQ A;  2OD5 A;  3U1D A;  3LA2 A;  1UCR A;  1TQI A;  3IHU A;  3K1M A;  1AWC A;  4WXD A;  4HDV A;  1T39 A;  2VBW A;  1HQC A;  1D8K A;  1FBS A;  2H6C A;  3GVA A;  5A2Q K;  3LFK A;  3DEU A;  2K4B A;  2RVC A;  2HQR A;  4GYG A;  4ESF A;  3GF2 A;  1D3Y A;  4P5O A;  1O3S A;  1I5Z A;  3F22 A;  2V1U A;  3GFJ A;  4KFC A;  2XGX A;  2M30 A;  1VTN C;  2VON A;  1JGS A;  1YYV A;  3FMS A;  1R5G A;  5KK1 A;  3RDI A;  4A0X A;  3BWG A;  1G3T A;  2DTR A;  4L0Y B;  4L5I A;  4LFU A;  1WSU A;  3VOE A;  5DCF A;  5CJ9 A;  1KU7 A;  3HUG A;  3T8R A;  5FD5 A;  3RYP A;  4KN7 X;  2QBY B;  2OQG A;  1T38 A;  1W7P A;  1G3W A;  2VT2 A;  3E6C C;  2M1B A;  5HLI A;  2VOO A;  2D1V A;  4S05 A;  3DPL C;  2D45 A;  2M5W A;  3ERE D;  1IN5 A;  3J80 K;  4UVC A;  1RNL A;  5D4S A;  2L3D A;  2ZNZ A;  3FM3 A;  3MEX A;  1I27 A;  4MEY F;  4MQV A;  1TQM A;  2IA1 A;  3QU3 A;  1LDK B;  4OIO F;  4RGS A;  5F1R A;  4OMZ A;  3REO A;  4HLX A;  3ZMS A;  2UZK A;  4CIC A;  1YS6 A;  1MJA A;  1K78 B;  3V7C A;  2W24 A;  5HLH A;  3WG9 A;  4GO1 A;  4YII A;  2BYV E;  3O2P E;  3MAJ A;  2ZBK A;  1IW7 F;  2DBB A;  1B4A A;  1GVJ A;  3Q9V A;  3LA7 A;  1E2X A;  5LGU A;  3QPT A;  3TOA A;  2MLK A;  3ECH A;  2Z3Y A;  3BZ6 A;  5JHU A;  2HKX A;  4L9V A;  3LAJ A;  4KT5 C;  2MH2 A;  2E7W A;  5ILS A;  1IN7 A;  1Z6R A;  4WX9 A;  3E3V A;  2PLY A;  3M8F A;  3BY6 A;  4KA4 A;  4I98 B;  1ON2 A;  3GEZ A;  3SQN A;  1STZ A;  1BI2 A;  3SFZ A;  1HXD A;  1I1G A;  1S29 A;  5KVR A;  1YQA A;  4LG0 B;  3C1D A;  3JTH A;  5DEQ A;  2CQK A;  4LLN A;  1YFH A;  1WRJ A;  1ZGA A;  2M87 A;  3VOD A;  1TW3 A;  2FXA A;  1L3L A;  3GXO A;  3TGN A;  2CW0 F;  3WU1 B;  2GA2 A;  1EV7 A;  5D8K B;  2H09 A;  1F9N A;  1PUE E;  4L9J A;  3K0L A;  2R7F A;  2DPD A;  4QLC U;  3K1N A;  4LMY A;  2ZJ2 A;  1ZLK A;  4L0Z B;  1MJB A;  4R79 A;  3K1P A;  2IW5 A;  2Y75 A;  1GXQ A;  3H92 A;  5IT3 A;  1U78 A;  1QNT A;  1AOY A;  1YTY A;  2K02 A;  2IA0 A;  1TQP A;  2QQA A;  5JI6 A;  3F72 A;  3JTG A;  1C0W A;  2H94 A;  4IF4 A;  2DFI A;  3F8M A;  2QWW A;  5CVV A;  2PN6 A;  5CVI A;  3LWF A;  2XKP A;  1MJ9 A;  4CHU A;  2F2E A;  4BYY A;  3JAM K;  3EYI A;  4IHT A;  3HIF A;  3HHH A;  1H9T A;  2DU9 A;  2NNN A;  3ML6 A;  2FBI A;  1FSE A;  5K5R A;  3FWE A;  2QLZ A;  1HW5 A;  3FMR A;  2Q2E A;  4H0E A;  2DLL A;  3GYH X;  3K9T A;  3F8B A;  2DK8 A;  2HS5 A;  4BNC A;  5E1X A;  3HYI A;  4HX4 A;  3D5L A;  3GX4 X;  1J75 A;  2HDC A;  2COM A;  3L7W A;  3P9C A;  1HW1 A;  2XRN A;  4DQ2 A;  2W25 A;  5FGM A;  3TDU C;  4G7H F;  3GLX A;  4PZJ A;  3TO6 A;  3LQR A;  3EUH A;  4KIF A;  3WOD F;  4XSX F;  4I09 A;  2WC2 A;  3RKY A;  3E6M A;  2CFX A;  4IRG A;  2ZO4 A;  4I0A A;  5DD8 A;  5LBQ A;  2ZKZ A;  3E5U A;  3KZZ A;  5H20 A;  1QQI A;  4UV8 A;  3TOB A;  5A2Q Z;  4OOI A;  2WWY A;  2ELH A;  3KP5 A;  2M8E A;  1S6L A;  1LEA A;  2EFW A;  2FA5 A;  2X4H A;  2KRF A;  2P6S A;  1IRF A;  1XGO A;  4DNC A;  3MFK A;  5FLX Z;  1ODD A;  2AS5 F;  4ETS A;  4HV6 A;  1K6O A;  2V79 A;  4A2U A;  1B1B A;  2VXZ A;  2J5P A;  3CDH A;  3B02 A;  4HZF A;  1MD0 A;  4M6X A;  1UHM A;  4XBF A;  1J2X A;  5HLG A;  2FML A;  1FT9 A;  2HFH A;  3EYY A;  1ZG3 A;  1ZYR F;  4MNU A;  2VN2 A;  3EQL F;  2WV0 A;  3V8J A;  2O0Y A;  3BJA A;  5E20 A;  1UFM A;  4BXU A;  3WTV C;  4RS8 A;  3ZP5 A;  2QZ8 A;  5BPD A;  1XD7 A;  3WGH A;  2YU3 A;  4U88 A;  2MH9 A;  2TDX A;  1E17 A;  4AIK A;  2DQR A;  3MWM A;  3KET A;  4I7H A;  2HZT A;  4UVB A;  1BI1 A;  1FC3 A;  1KQ8 A;  1YW9 A;  4GYI A;  3F23 A;  3E97 A;  2KIU A;  1SD5 A;  3BJO A;  5ILV A;  5DCM B;  1XDU A;  1FP1 D;  4BQA A;  4XRF A;  1JE8 A;  3C3W A;  3G73 A;  4MHG A;  2DT5 A;  1KGS A;  1LJ9 A;  5IT9 Z;  3F3X A;  3KCC A;  2D1H A;  2Z33 A;  1G4D A;  3K2Z A;  2HOE A;  4A12 A;  1A04 A;  4LK0 F;  4UNO A;  2PMU A;  1DUX C;  4Y17 A;  3RKX A;  2ISY A;  2PFB A;  3JSO A;  1G3S A;  3E5Q A;  3WE2 A;  3QP6 A;  2OBP A;  3WGG A;  2HWV A;  1FOK A;  1IN4 A;  1XCB A;  2QVO A;  4UV9 A;  2L01 A;  5CVJ A;  3OOP A;  1MDM A;  1TTY A;  2QQB A;  2FRH A;  2BEO A;  2VC1 A;  3ECO A;  4NHJ A;  1U3E M;  4KN4 X;  4JBA A;  2IP2 A;  3CTA A;  4EJV A;  1T2K A;  2PEX A;  4P9F A;  3IKT A;  4U7D A;  3BJ6 A;  2OU2 A;  1TLH B;  4LB5 A;  2A68 F;  2B0L A;  5ICE A;  2FE3 A;  2LNB A;  5FD6 A;  4D0P A;  3W6K B;  3SZP A;  1BC8 C;  4M74 A;  1EH8 A;  3P9K A;  1IN6 A;  4ZYG A;  5EEH A;  4IXA A;  3WTX C;  4BAY A;  3FXU A;  4EGZ A;  1JHF A;  3U9G A;  3T1B A;  3C18 A;  5CVR A;  2GIV A;  2YSR A;  1XGN A;  5L3D A;  1IRG A;  1RI7 A;  5LGT A;  2W85 A;  1HSJ A;  1SD4 A;  3DKW A;  2PQ8 A;  2GQQ A;  4CYD A;  2YR2 A;  4O5V A;  2QUF A;  4A5M A;  2EK5 A;  3I64 A;  3V4G A;  4LGW A;  3EDP A;  4MTD A;  1SD6 A;  3KE2 A;  3FXR A;  2RNJ A;  4AIJ A;  2OQR A;  1O3T A;  1J7K A;  2J5O A;  4P55 A;  1Z05 A;  2A3S A;  1SMT A;  3QOP A;  3Q9S A;  2FBK A;  3KP4 A;  4Q48 A;  4AWX B;  3HRM A;  4EJT A;  4L9N A;  5L3C A;  3AAF A;  3QAH A;  4S04 A;  5CYV A;  1OYW A;  2DPU A;  5D4R A;  3BRO A;  5D5W B;  2L02 A;  1YG2 A;  4A6E A;  3VFZ A;  5BOX A;  3VB2 A;  2C6Y A;  5BS6 A;  3JSP A;  5HS7 A;  1B59 A;  3HSR A;  4OU0 A;  3M7G A;  2Y48 A;  1B6A A;  3F21 A;  2GAU A;  4B8X A;  1U8R A;  2PBI A;  3F6O A;  2PMH A;  1MKM A;  1K79 A;  2XAJ A;  4U0V A;  4EMS A;  2OZ6 A;  2CSO A;  2LF7 A;  1GXP A;  2XAG A;  1MZB A;  2ADU A;  2PJP A;  3LQQ A;  4WXC A;  2L54 A;  3IKV A;  5ILU A;  4PDK A;  1DPR A;  4NB5 A;  1ZG5 A;  4HX8 A;  2XAQ A;  4HLY A;  2HYF A;  3DXJ F;  3ULQ B;  2ZCW A;  1SFX A;  2ZME A;  3I53 A;  5E18 F;  5H6Q A;  4I02 A;  2QYO A;  2EV6 A;  4LLL A;  3IC7 A;  3DQV C;  4UXN A;  1OYY A;  2NS0 A;  4KUM A;  3TDZ C;  3IL2 A;  4P9U A;  1SAX A;  5LEK A;  3DV8 A;  1H0M A;  1I1S A;  4AVP A;  1X3U A;  1OYI A;  3KP7 A;  4WF2 A;  3GO5 A;  5F6F A;  1TW2 A;  1BIB A;  4E70 A;  4G94 A;  5DD4 A;  1R1T A;  4MGR A;  4AIH A;  2OZU A;  3HRT A;  1W7P B;  1YW7 A;  5HDG A;  4EM0 B;  1S8N A;  2ETH A;  1IN8 A;  5E1Z B;  3IRQ A;  2OAZ A;  1B9N A;  2A6H F;  4CDG A;  2STT A;  2E1C A;  3ELK A;  4LJZ F;  1O7L A;  2V6C A;  3RIR A;  4F7Z A;  2MLG A;  1LQ1 A;  1PP7 U;  3CO6 C;  3R0J A;  2P8T A;  2K27 A;  4ENK A;  1Y0U A;  1S7O A;  1TBX A;  4PCQ A;  1YO5 C;  1Z6T A;  1SMY F;  1IXR C;  5D6F A;  2F5F A;  1FBU A;  4RGU A;  2O6G E;  1ZAO A;  5J8F A;  3CUQ A;  1UST A;  2VOP A;  2EFO A;  3L2C A;  5H6R A;  3JW4 A;  5E17 F;  3KP2 A;  2ZFW A;  2P7C B;  2EV5 A;  2Z9O A;  1FWZ A;  4QWQ A;  3GFL A;  2KJC A;  1O3Q A;  5E8G A;  4HF0 A;  4A5N A;  2IVM A;  1R5H A;  2ESH A;  4LD5 A;  4Q47 A;  2CO5 A;  4EJO A;  3KLO A;  3T8T A;  2CG4 A;  5HDK A;  2HR3 A;  5E8I A;  2HQN A;  2FNP A;  4IRH A;  1WQ2 A;  1YLF A;  5HDN A;  4RB0 A;  4ENM A;  3GFM A;  4RGX A;  3MQ0 A;  1P92 A;  4U0W A;  2O61 A;  3B73 A;  2DK5 A;  3WTY C;  2VBY A;  2CWE A;  2RDP A;  4UUV A;  4M72 A;  2YX4 A;  4JQF A;  4N0B A;  4ZYH A;  1ZRF A;  3N97 A;  1V4R A;  1XSD A;  4MQ9 F;  3MCZ A;  3EET A;  1Z1D A;  5L3B A;  3E5X A;  3M1E A;  5HVQ C;  2DQL A;  2G7H A;  3KEO A;  1DP7 P;  1ULY A;  1TNS A;  4RAY A;  5DDG A;  1DPU A;  1IAW A;  2A61 A;  1LDD A;  2P7V B;  4RGR A;  3P7N A;  2BE5 F;  5LHI A;  2DI3 A;  2L4A A;  3R4K A;  3U2R A;  4EQQ A;  1R58 A;  1K7A A;  4GGG A;  1KQ9 A;  1KU3 A;  4I01 A;  1S3J A;  3CLO A;  5K5O A;  1FPQ A;  1KQ0 A;  4IJA A;  1KU9 A;  3WGI A;  2IJL A;  4KMF A;  5J6X A;  2XV4 S;  1XSV A;  1IF1 A;  2UXX A;  2P6T A;  4A6D A;  4KMU X;  5JVT A;  3W6J B;  1IXC A;  3WTT C;  5ICF A;  2O03 A;  2Y0M A;  4HQE A;  1EH7 A;  1ZRC A;  5L3F A;  1BIA A;  4IVN A;  5ERI A;  5DUK A;  2FQ3 A;  4HF2 A;  2YPR A;  1CF7 A;  1I6X A;  3D0S A;  2VC0 A;  2BGC A;  3K69 A;  2IPQ X;  3IWF A;  3M8E A;  1XGM A;  1BM9 A;  2GXG A;  2HTS A;  5LRS A;  1O57 A;  4EVI A;  3HOS A;  3RYR A;  5TRD A;  1ON1 A;  3KLN A;  2EB7 A;  3WTS C;  1FZP B;  5BPI A;  5ED4 A;  3MZH A;  3QP5 A;  2LKP A;  3FM5 A;  3QPH A;  2OA4 A;  1FSH A;  1QZY A;  2BV6 A;  2HEO A;  1R1V A;  1BJA A;  1U5T A;  4JK1 X;  1R36 A;  2QM3 A;  1QGP A;  4OIQ F;  1UB9 A;  1U6G A;  1USS A;  3N4M A;  3J80 Z;  1S7A A;  3ZMU A;  5HS9 A;  1BOA A;  3F8N A;  4M9Z A;  2P5L C;  2EFN A;  4RB2 C;  1QO0 D;  3I59 A;  4BHB A;  2EFP A;  1XN7 A;  2V1X A;  3E6D A;  3TO9 A;  6PAX A;  2KJB A;  4KNY A;  1U2W A;  4PGG A;  3ZMV A;  1T6S A;  2FEZ A;  4L5J A;  1LB2 A;  2PI0 A;  1XB4 A;  1ONV A;  3ZQ7 A;  1MGT A;  4ZZL A;  3DFG A;  5LLQ A;  4M9S A;  1FP2 A;  5J8C A;  4BH9 A;  2RV8 A;  2RGV A;  4EM1 A;  4WWC A;  2A5Y B;  2XVC A;  2ESN A;  3TO7 A;  1IZ1 A;  1LNW A;  2KKO A;  3WE3 A;  2GXB A;  3RI4 A;  1NHA A;  2P4W A;  2ISZ A;  3V7S A;  3BDD A;  4FX4 A;  2CGP A;  2RC4 A;  3I58 A;  5D6E A;  2JPC A;  1D5V A;  1OKR A;  1FNN A;  3BPX A;  1J59 A;  3I5U A;  4HAM A;  4OMY A;  5DYM A;  2F5D A;  2RQP A;  2VOD A;  4PGH A;  2ZXJ A;  4R8H A;  4B09 A;  4GXO A;  4Q4Z F;  2DAO A;  2GWR A;  3GUD A;  1FYL A;  2X0L A;  3FMQ A;  1O7F A;  1FYM A;  2UXN A;  1IUY A;  2NAZ A;  4RAZ A;  1B9M A;  1PDN C;  4LK1 F;  2M45 A;  1J5Y A;  3J81 K;  5L3G A;  1YS7 A;  2JT1 A;  2HKO A;  4EV0 A;  4ENN A;  1GHC A;  2VE9 A;  4UHT A;  2NNY A;  3L9F A;  4L18 B;  2F5C A;  3WTW C;  3L00 A;  4HQM A;  2PG4 A;  1Z91 A;  3O3K A;  3MZY A;  5TJJ A;  3F8C A;  1F1Z A;  1P4X A;  1FYK A;  2Z5U A;  1OMI A;  1XGS A;  4LB6 B;  1ZAR A;  1QBJ A;  2YX7 A;  2QBY A;  1BC7 C;  4IPA A;  2R7D A;  4G7O F;  2VE8 A;  1T98 A;  3RJP A;  1WKM A;  1REP C;  4FHT A;  2Z99 A;  4U0Y A;  3HSF A;  3JAM Z;  3DF8 A;  4KIC A;  2K4J A;  3KEQ A;  3NRV A;  3WTZ A;  1CGP A;  5FO5 A;  1MDM B;  1ZGJ A;  1T0F A;  4CO8 A;  1K78 A;  3RTR A;  1R1U A;  4XLP F;  3CUQ C;  3M9A A;  3ZMT A;  4CXF A;  3TQN A;  4IHS A;  2QEN A;  3T0Y A;  4HW0 A;  2NYX A;  1W4M A;  1R23 A;  3G3Z A;  2XHK A;  3HSE A;  1FY7 A;  3FZV A;  5AON A;  5FLX K;  3IWZ A;  5D8L B;  2L4M A;  5K1Y A;  4IRI A;  4I2O A;  1LVA A;  1OPC A; 
#chains in the Genus database with same CATH topology
 5D5X B;  1RES A;  5CKT A;  1Z3Y A;  2OPT A;  2W57 A;  2R0Q C;  1ORK A;  3BTI A;  3FXQ A;  1AKH A;  4XKV A;  4YFN F;  3CUO A;  4MEX F;  4Y13 A;  1K6Y A;  4J19 A;  4D1Q A;  2D2W A;  1FX7 A;  3ZRG A;  1TZL A;  1R4M B;  3OYC A;  2EIK H;  4IHY A;  2G7U A;  4HNU A;  3KFW X;  3HOW J;  5E1W A;  3CD6 I;  3U1K A;  4HF1 A;  3GZ5 A;  4M6Y A;  1JXS A;  4R1H A;  4M3F A;  1YIJ I;  3BG5 A;  1S72 I;  2AXL A;  4QPO A;  3QPS A;  1ZH5 A;  3SHF A;  2WY7 Q;  3Q0V A;  1IV8 A;  3ZN0 A;  2LDU A;  2W84 A;  1YIT I;  4Z2Y A;  4P96 A;  2JQ7 A;  3RKQ A;  2A07 F;  3HRS A;  1I6H J;  5EG0 B;  3RZD J;  4LG0 A;  2JRT A;  1YJ9 I;  1G6N A;  3JRH A;  3H3Z A;  5FKN A;  3BR2 A;  2HXI A;  4LLG F;  3LST A;  2MD5 A;  4CGZ A;  3K4M A;  4Q5S F;  3A1Y A;  1P7J A;  1KA8 A;  1QZZ A;  3IAM 2;  3K7A J;  2XAF A;  3OL4 A;  3BG3 A;  1I50 J;  1TNT A;  2KFD A;  4ESB A;  2ECC A;  3OYA A;  1QU3 A;  4KDP A;  2YS9 A;  1XDS A;  4LG3 A;  5F08 A;  3GZ6 A;  1HBX G;  3G71 I;  1H9G A;  4G9Y A;  1FLI A;  2M2E A;  3CJT B;  3RPU A;  3G4S I;  3CP8 A;  2FUG 2;  2VBZ A;  4ASN A;  1MMA A;  4WXH A;  2GZW A;  3S1Q J;  2LH9 A;  3ZQF A;  1PJR A;  2XIG A;  4M9X A;  3OYB A;  2COB A;  2KIM A;  2HOT A;  3VDX A;  2R5Y A;  2Q8K A;  2BZT A;  5IT9 K;  3GME A;  1HKQ A;  2QGU A;  2F4M B;  2STW A;  4DBR A;  1YRN A;  1RZ4 A;  1W36 C;  1HW2 A;  2NRA C;  1HKT A;  2A69 F;  2XAS A;  1JT0 A;  1HST A;  3I4P A;  3DP7 A;  2KPM A;  3ISP A;  4B47 A;  3MZ8 A;  1SFU A;  3VEP A;  2DW4 A;  2GIZ A;  2R3S A;  3R6S A;  1T8I A;  1BW5 A;  4G8X A;  2MBF A;  3W6V A;  1FIA A;  3L09 A;  5FFZ A;  2IA2 A;  2VL8 A;  2HYG D;  3BPV A;  1WJF A;  4YIR X;  4OAY A;  3HOT A;  1A31 A;  5CLS A;  4J01 A;  2L9S A;  4CZC A;  2E36 A;  3GW2 A;  4X0G A;  1OCO H;  4JP0 A;  3ZMD A;  2O3F A;  1GDT A;  4IZZ A;  3PFI A;  2EV0 A;  3OYN A;  3PNV A;  3I55 I;  4IKF A;  3HPG A;  4L9T A;  2JMW A;  3F8F A;  5AIQ A;  1KYZ A;  1QZE A;  2YUS A;  1U0J A;  4B44 A;  3OS1 A;  3H36 A;  5ICC A;  2XKO A;  5K5Q A;  3HHG A;  2ZME B;  5CQG A;  2QCO A;  4XIC A;  3IH2 A;  1JHH A;  3R61 A;  4AU7 A;  5LEJ A;  2QKM B;  3S1M J;  1SD7 A;  1ZHF A;  1D0Y A;  2E1M C;  2HTJ A;  5FLV A;  1KU2 A;  3W2V A;  4YG2 F;  1XCV A;  3F9K A;  4OWR B;  2ACJ A;  4RBO A;  5J1U A;  3BP8 A;  3QYE A;  4XOP A;  4J00 A;  4P1W A;  3S3O A;  4AD9 A;  3TMO A;  1RUN A;  1HDD C;  4UVA A;  4I0B A;  1G3Y A;  3EUK L;  3FXL A;  1XSX A;  2K86 A;  5KAI C;  3Q5F A;  1YW8 A;  1P4W A;  4HBL A;  4CZZ A;  3S2H J;  4Y4R A;  1EH6 A;  1U5T C;  4G6Q A;  4CCM A;  3FIW A;  2K40 A;  2KIF A;  4XN0 A;  4ZH4 F;  4FE7 A;  5IY5 H;  2FMY A;  4HOB A;  1A5J A;  2YU9 J;  3W2W A;  5JFR A;  2ECB A;  2CV1 A;  2HNH A;  2RKH A;  2QA4 I;  3SXY A;  1KYW A;  1XC5 A;  3J7A O;  3S32 A;  4FT8 A;  2FOK A;  3TED A;  1BR1 A;  1J9I A;  2P5V A;  2HQ5 A;  2IRF G;  2N8G A;  3C2B A;  2W7N A;  3WU0 A;  4KIB A;  2EFQ A;  4M73 A;  2UWM A;  3GTG J;  2X6Y A;  3DPU A;  2IS2 A;  4A3E J;  1M1E B;  4CUG A;  4ESJ A;  2VLA A;  3QRF F;  3ZMZ A;  2IT0 A;  2LRD A;  1IXS B;  2QQ9 A;  2R92 J;  3ABK H;  3T5X A;  3F0C A;  3V8K A;  1Q1H A;  2BHZ A;  1J0R A;  4O6J A;  2VJJ A;  3BR5 A;  2R5Z B;  2NVY J;  1UHS A;  3KP6 A;  4Y33 A;  2A6E F;  3COA C;  3H9J A;  1LEB A;  1A6I A;  4EEF G;  4N9H A;  3FHZ A;  2EA4 A;  3J81 Z;  3CDL A;  1B72 A;  1VQM I;  2LMD A;  3OS0 A;  3RKW A;  2LSO A;  4TV7 A;  2CU7 A;  3CUQ B;  3NWS A;  1LDJ A;  3CLQ A;  2CYY A;  5IPA A;  3TP0 A;  4IQ4 A;  3ABU A;  1JKR C;  4PFO A;  4IOC F;  2XPW A;  2E5N A;  1PUF B;  2XUB A;  1IUF A;  1PP8 F;  5BQT A;  3S1R J;  2M0C A;  3CO7 C;  1FTZ A;  3K70 C;  1BI0 A;  1W5T A;  2V9V A;  3GWZ A;  4MFE A;  2VXD A;  4ZTF A;  2F5E A;  2H8R A;  3PNY A;  2VJ4 A;  1QPM A;  2WV1 A;  4G12 A;  1R6R A;  3NEU A;  1TWA J;  3F6V A;  4NUB A;  4LOC A;  1R7J A;  1SFE A;  4N9I A;  3VYR B;  1IC8 A;  2VT3 A;  2EPF A;  3WU2 C;  3PQK A;  5DV5 A;  2QQ8 A;  2CUJ A;  3CJN A;  3MD2 A;  2EA2 A;  4I99 C;  4BJ6 C;  4BHC A;  1Z9C A;  2X1E A;  2AXT C;  4EJW A;  4RB1 A;  1X2M A;  2DDB A;  4FX0 A;  2FU4 A;  2K3F A;  4O3M A;  2EJR A;  1BN5 A;  1VQ9 I;  5EYR A;  2PJR A;  2P5K A;  4HYE A;  2KRH A;  4GFB A;  2LRE A;  3MVP A;  2H27 A;  2Q0O A;  1ZRD A;  3LFU A;  5KAF C;  2XAH A;  5D5V B;  2MA3 A;  1WWX A;  2L7Z A;  3BG9 A;  4MTE A;  4CCK A;  3HTU A;  4FIS A;  5DCM A;  1Z7U A;  3NQO A;  1IG7 A;  2K7L A;  2W00 A;  4OIP F;  3MMY B;  4RDU A;  2HXO A;  4BE1 A;  1X1C A;  4KYW A;  4HA8 A;  1F4K A;  5DUI A;  2RN7 A;  1PYV A;  2L9N A;  3ZPL A;  4IOA F;  2W4S A;  1XMA A;  1FOY A;  2DMP A;  1D1C A;  2XPU A;  5L3E A;  2KIQ A;  2GA1 A;  4BGD A;  5E3N A;  1MBH A;  2LG4 A;  2VQL A;  4M71 A;  3BT9 A;  3ZQL A;  1Y1W J;  3VPR A;  3ABM H;  4ABZ A;  2H8W A;  2ELK A;  1KZH A;  2JZY A;  1O3R A;  4A0Z A;  4RB3 C;  3MKW B;  2MYS A;  5CVU A;  4BHP A;  5IP6 A;  4RAF A;  5F64 A;  3MKZ A;  2FNA A;  4C3H J;  1V3F A;  9ANT A;  2DO7 A;  3PUF A;  5FKL A;  3CCE I;  2R7O A;  5EEG A;  2NVT J;  4NQW A;  5J1Y A;  5HOO A;  3KP3 A;  4G7Z F;  2JA2 A;  2XC7 A;  3O6B B;  3ZN1 A;  4W97 A;  3PSF A;  1R00 A;  5M5X J;  4B4C A;  2DYR H;  3CES A;  4YFX F;  1OR7 A;  3HB9 A;  3M8J A;  5B1B H;  3KPH A;  3J7A Y;  5FLM J;  4E7I A;  1F36 A;  2HDD A;  5AIP A;  2K9N A;  2XB0 X;  1LE8 B;  4C2T A;  3H9G A;  5JR3 A;  4ON0 A;  5FB2 A;  2DA2 A;  1LFU P;  4YFK F;  1BBY A;  1QVT A;  1W7P D;  2LF8 A;  4A0Y A;  4KIG A;  2EIM H;  1V5E A;  1XTA A;  2JPB A;  4K2E A;  1E3P A;  3DPT A;  1BL0 A;  1RUO A;  3OL3 A;  3M07 A;  5BMZ A;  5IYB J;  1WI9 A;  4FAS D;  4XON A;  4EGY A;  3ABT A;  3FK6 A;  3I54 A;  2DA6 A;  3LL7 A;  2VIX A;  1BOB A;  2ZNY A;  1CF7 B;  1R71 A;  1MNM C;  3FXJ A;  1RKW A;  2EWN A;  2VQH A;  4XLN F;  1W5C C;  4OIR F;  4YIF A;  2FSW A;  1XMK A;  3CCJ I;  2V1N A;  2WTE A;  1MBE A;  4XSZ F;  2F4O B;  3TKY A;  1VQK I;  1I39 A;  4YRV A;  4BBS J;  3GTL J;  2G9W A;  4Y15 A;  2ZJQ F;  1AA7 A;  1D8J A;  1MMG A;  3V8L A;  3HTS B;  1S9H A;  2IXS A;  3PL8 A;  5LRR A;  2HPI A;  3QQA A;  3GFI A;  3ONQ A;  2XRO A;  1YJN I;  4KJZ A;  5E3O A;  4HV5 A;  4D5F A;  3FX3 A;  4YEL A;  3C7J A;  2FF4 A;  1ZLJ A;  3LA3 A;  4WK8 F;  2H1L A;  3DBH B;  2Y2Z A;  1ZKG A;  4GCV A;  4IEJ A;  1ZN2 A;  2Y9Y A;  3CC7 I;  1U5T B;  3C2H A;  1W5S A;  2E1N A;  3WTU C;  1XPX A;  5C3E J;  2JVG A;  1ETO A;  3NAR A;  1W0U A;  3R0A A;  2RRE A;  2E2I J;  4UUT A;  2B63 J;  4U7B A;  1HKS A;  5LHG A;  2MG4 A;  2QEX I;  2HVQ A;  1RIO H;  2I8D A;  3H5N A;  3R60 A;  1LVK A;  1P6R A;  3ZQC A;  2DMU A;  2VB6 A;  1ZRE A;  1JTX A;  2JSC A;  3S3N A;  4HDU A;  4OIN F;  2HGC A;  4DOZ A;  3RPQ A;  3D5R C;  3I59 B;  1YIO A;  4G6D A;  1WH7 A;  2FJ1 A;  5HLT A;  4BXX J;  4MIM A;  3BOQ A;  5LHH A;  4ZZD A;  1ZG1 A;  2NS8 A;  4IX7 A;  2DA3 A;  2V1D A;  3I71 A;  4I6Z A;  2IAI A;  3HOZ J;  1XX5 A;  5FFX A;  5HS8 A;  4A3I J;  2TRT A;  1K83 J;  1E0E A;  1T08 B;  2E7X A;  3A4C A;  4I76 A;  1DDN A;  3IRR A;  1H88 C;  4F3Q A;  2GM4 A;  4ZYD A;  2H6B A;  3P9I A;  5JLX A;  5ICG A;  2IBD A;  1GUU A;  1OCR H;  1BI3 A;  3HRU A;  3LAP A;  2MFZ A;  2NOG A;  4ANJ A;  3SZT A;  1VQ5 I;  2O8X A;  5EDN A;  3I0T A;  3QU6 A;  2MC3 A;  3E6B A;  4JX6 A;  4ZYE A;  5IP9 J;  2NOJ B;  4CCN A;  4FE4 A;  3HOV J;  1WZ2 A;  3FF5 A;  4XRS G;  2BBY A;  5B66 C;  1ETQ A;  1B8I A;  3H3U A;  4DYC A;  5D5U B;  3V7R A;  1T33 A;  3PQJ A;  1UHW A;  4EJU A;  1TP4 A;  5JVG F;  2JTV A;  1P4A A;  2EZH A;  3BCB A;  1F43 A;  1MH3 A;  2KIS A;  2VBX A;  3KZY A;  4CCO A;  3OV8 A;  4WCG A;  4N4O B;  1R22 A;  1P2F A;  4ENJ A;  2VI6 A;  5EGO A;  2R7U A;  4EM2 A;  3S2W A;  1L0O C;  3ROU A;  1WI3 A;  1Y56 A;  2FBH A;  3DKY A;  4PFP A;  1F5T A;  5DTD A;  4HX7 A;  3A0H C;  5LGN A;  4E7J A;  2XGC A;  3BG7 A;  1FBQ A;  2AQE A;  4HPQ A;  2OD5 A;  3U1D A;  5GAG J;  4XID A;  3S16 J;  2L5Q A;  3LA2 A;  1UCR A;  4DW6 A;  4ZTJ A;  1X1P A;  3TP3 A;  4A3F J;  1TQI A;  2IEK A;  3IHU A;  1DGR M;  3K1M A;  5KHD A;  1VQ7 I;  2LK2 A;  1AWC A;  1MMS A;  3DLA A;  4WXD A;  4HDV A;  1T39 A;  2VBW A;  2X1D A;  3JRC A;  1HQC A;  1D8K A;  1FBS A;  2H6C A;  1RR8 C;  3GVA A;  5A2Q K;  2DA5 A;  3LFK A;  2M7B A;  3OR1 C;  3DEU A;  1VQP I;  2K4B A;  2RVC A;  1JUS A;  2DMT A;  2HQR A;  4GYG A;  3H3V K;  4ESF A;  3GF2 A;  1D3Y A;  4P5O A;  1O3S A;  1I5Z A;  2TCT A;  2R93 J;  1JI8 A;  3F22 A;  3AG4 H;  2V1U A;  3GFJ A;  3L2Q A;  4KFC A;  2OF7 A;  2JA7 J;  2XGX A;  2M30 A;  1VTN C;  2VON A;  1JGS A;  1YYV A;  3FXK A;  2CQ7 A;  2Y69 H;  4XOT A;  3FMS A;  1VND A;  1XMX A;  1R5G A;  5KK1 A;  2IS4 A;  3RDI A;  4AUX A;  4A0X A;  2XF7 A;  3BWG A;  1G3T A;  1YOV B;  2DTR A;  4L0Y B;  2EZK A;  2BY0 A;  4L5I A;  1VQ8 I;  4LFU A;  1WSU A;  2BY3 A;  3VOE A;  5DCF A;  4DIQ A;  5M5W J;  2CS3 A;  2Y9Z A;  5CJ9 A;  1KU7 A;  4E7L A;  2K85 A;  3HUG A;  3T8R A;  1Z21 A;  5FD5 A;  3RYP A;  3BLY A;  4KN7 X;  2QBY B;  2OQG A;  3L1P A;  1T38 A;  1R9T J;  1W7P A;  3RCO A;  1G3W A;  1TWH J;  4CYC A;  4KIS A;  3FK7 A;  4EAT A;  2VT2 A;  5DM7 F;  3E6C C;  1YX3 A;  2M1B A;  5HLI A;  2VOO A;  2D1V A;  4S05 A;  3DPL C;  2D45 A;  2M5W A;  4XLA A;  1GLN A;  3ERE D;  1QHG A;  1IN5 A;  1X3Z B;  4A3C J;  3J80 K;  1AU7 A;  4UVC A;  1RNL A;  5D4S A;  2L3D A;  2ZNZ A;  4PK4 A;  3IH4 A;  2ZJP F;  3FM3 A;  3MEX A;  2F5V A;  3A01 B;  3HOU J;  3LSR A;  2E5Z A;  1I27 A;  2X6O A;  4MEY F;  4MQV A;  3LNQ A;  1TQM A;  3CF2 A;  2IA1 A;  3QU3 A;  4CH7 A;  1LDK B;  4BY1 J;  3JRE A;  4OIO F;  4FQG A;  4RGS A;  5F1R A;  4OMZ A;  3REO A;  2ZXH A;  4HLX A;  3ZMS A;  2UZK A;  4CIC A;  1YS6 A;  1NG7 A;  4Y7N J;  1MJA A;  2UV1 A;  3V7C A;  1K78 B;  5KNL A;  2W24 A;  1G2H A;  2W1O A;  5HLH A;  3JRG A;  2CW8 A;  3WG9 A;  4GO1 A;  4YII A;  3CCS I;  4PUS A;  4H4K C;  1Z7L A;  3K6G A;  2BYV E;  3O2P E;  3MAJ A;  4E7H A;  2ZBK A;  1IW7 F;  1NK3 P;  2A05 A;  3IH3 A;  2DBB A;  1B4A A;  1GVJ A;  3Q9V A;  3LA7 A;  1E2X A;  5LGU A;  3QPT A;  3TOA A;  2MLK A;  2KDZ A;  3ECH A;  2Z3Y A;  4BU2 A;  3BZ6 A;  1TWF J;  1UEL B;  2EIL H;  3H5R A;  5JHU A;  2CV2 A;  1YHQ I;  3CCY A;  2X6X A;  3VSL A;  5KCM A;  2HKX A;  3PNT A;  1OQY A;  4L9V A;  2HOS A;  3EUA A;  2QKL B;  3EPZ A;  1AKH B;  2BW3 A;  3RQI A;  2QF7 A;  1X4O A;  3LAJ A;  2V9K A;  1Z0X A;  4KT5 C;  1MBK A;  2MH2 A;  3EUH C;  2E7W A;  4KT6 A;  3G6E I;  5ILS A;  1IN7 A;  2R4G A;  1Z6R A;  2DCE A;  2WAQ N;  3GZN B;  4WX9 A;  1D0Z A;  1SAU A;  5GAE J;  2ME0 A;  5FKM A;  2DFE A;  3E3V A;  2PLY A;  3M8F A;  5GPA A;  2WAF A;  3BY6 A;  4KA4 A;  4I98 B;  4ZDP A;  1ON2 A;  3AL0 C;  4BS9 A;  3S17 J;  2CMP A;  3ZCO A;  2QSF X;  3HGG A;  3JR9 A;  2OC6 A;  2XSJ C;  3GEZ A;  3SQN A;  1STZ A;  1VQN I;  3OY9 A;  1BI2 A;  1A36 A;  3S15 J;  2XB5 A;  3KEY A;  4BXF A;  3SFZ A;  1HXD A;  5E3M A;  5FRM A;  1I1G A;  1S29 A;  3ASN H;  4II3 A;  5KVR A;  1YQA A;  2EBI A;  3CZ6 A;  3SFI A;  4LG0 B;  4UY8 I;  5C4X J;  2MD0 A;  2WA0 A;  3C1D A;  3JTH A;  4N4N B;  5DEQ A;  2CQK A;  3OWT A;  3G1O A;  3HL2 A;  3CCU I;  2VAS A;  4JOM A;  4II2 A;  4LLN A;  4A3L J;  1YFH A;  3CC2 I;  1WRJ A;  1ZGA A;  4DYQ A;  4PJ0 C;  4CCL A;  2MAB A;  2M87 A;  3I9V 2;  3HOY J;  3SEQ A;  3VOD A;  1TW3 A;  2PMZ N;  1TL8 A;  2PMZ A;  2Q1Z B;  1OCT C;  2FXA A;  2KLO A;  1L3L A;  3GXO A;  3TGN A;  2CW0 F;  3WU1 B;  2GA2 A;  2LBF A;  1EV7 A;  1Z67 A;  2H09 A;  1F9N A;  1I3Q J;  5D8K B;  1PUE E;  4L9J A;  3K0L A;  3CJR B;  4A3D J;  1ETW A;  2R7F A;  4BEH A;  2L7K A;  2NVU B;  4QLC U;  2DPD A;  3K1N A;  1ZR4 A;  4LMY A;  1N25 A;  2ZJ2 A;  5GAH J;  1ZLK A;  4L0Z B;  2JVH A;  2R5Y B;  5CQE A;  4UUS A;  1MJB A;  4R79 A;  3K1P A;  3X2Q H;  4BY7 J;  3I4M J;  4IO9 F;  2IW5 A;  2Y75 A;  1YRN B;  5B1A H;  1GXQ A;  3H92 A;  5IT3 A;  1U78 A;  1VZ0 A;  3WHB A;  3ZQI A;  1QNT A;  3BQZ A;  1AOY A;  1FMW A;  3VSK A;  1YTY A;  2K02 A;  2IA0 A;  1TQP A;  2QQA A;  5JI6 A;  3F72 A;  1OR7 C;  1POG A;  2W82 A;  3JTG A;  1C0W A;  2H94 A;  4IF4 A;  3DU6 A;  2DFI A;  3F8M A;  2M3A A;  5JLW A;  1Y8R B;  2QWW A;  5IYD J;  3HOX J;  5J3L A;  3OYD A;  5CVV A;  2PN6 A;  4BDZ A;  5CVI A;  2JUG A;  3LWF A;  5GAD J;  1YE9 A;  1MJ9 A;  2XKP A;  5F0F A;  4CHU A;  2F2E A;  1YI2 I;  2ME6 A;  2L2O A;  4CCJ A;  4BYY A;  1LFB A;  1SVM A;  2FOW A;  4JX4 A;  3JAM K;  3HPH A;  3EYI A;  4IHT A;  3WHC A;  1GVD A;  3DTI A;  3QYF A;  2F4I A;  3HIF A;  2EQR A;  3HHH A;  1VQ4 I;  1H9T A;  3ABL H;  2DU9 A;  2KT0 A;  2NNN A;  3DEE A;  3ML6 A;  2Z1D A;  2FBI A;  1FSE A;  5K5R A;  3FWE A;  1MIJ A;  2VQC A;  4B3X A;  1LFP A;  1MH4 A;  3CCQ I;  4PJM A;  3SEZ A;  3SZG A;  2ZB9 A;  3G1L A;  2QLZ A;  3S2D J;  4XKB A;  2R7Z J;  4GRI A;  2M7A A;  5BNG A;  1A6Q A;  4AVZ A;  1HW5 A;  3FMR A;  2X9D A;  2Q2E A;  4H0E A;  2DLL A;  3LSG A;  3K9T A;  2MGQ A;  3GYH X;  3H35 A;  3F8B A;  2DK8 A;  2HS5 A;  4BNC A;  5E1X A;  3HYI A;  4HX4 A;  3D5L A;  3GX4 X;  1J75 A;  2HDC A;  4LIV A;  2COM A;  2IS6 A;  5E79 C;  3L7W A;  4GDF A;  3HJE A;  4G6T B;  3P9C A;  1HW1 A;  2XRN A;  2O7O A;  4DQ2 A;  2W25 A;  5FGM A;  3TDU C;  3K10 A;  4G7H F;  3GLX A;  3OSF A;  1Z77 A;  4PZJ A;  2I5U A;  3TO6 A;  3UKG A;  2NVX J;  2OCE A;  3IV5 A;  3W2A A;  3LQR A;  3EUH A;  4KIF A;  1VQL I;  5K7H A;  2V7F A;  3LSH A;  3WOD F;  4XRM A;  4B3A A;  4A3G J;  4XSX F;  4I09 A;  2WC2 A;  3PSI A;  3PO2 J;  3RKY A;  1NH3 A;  3E6M A;  2CFX A;  2E2H J;  4IRG A;  2ZO4 A;  4I0A A;  5DD8 A;  5LBQ A;  2ZKZ A;  4JYK A;  2CV0 A;  3E5U A;  3KZZ A;  5H20 A;  1IV6 A;  1MSF C;  1WPK A;  1QQI A;  4UV8 A;  3TOB A;  4S0H B;  1X1D A;  5A2Q Z;  4OOI A;  5DS9 A;  2WWY A;  1WJE A;  2E34 A;  2LY1 A;  2ELH A;  3KP5 A;  3CMA I;  3ASO H;  2P0W A;  2M8E A;  1S6L A;  3K4B A;  1OLT A;  1LEA A;  5FRO A;  4F93 B;  2EFW A;  4A3J J;  2FA5 A;  2X4H A;  3KZI C;  2K5C A;  2KRF A;  1B72 B;  2P6S A;  1IRF A;  1SVO A;  1XGO A;  4DNC A;  3MFK A;  3L2V A;  5FLX Z;  3FXO A;  4KIT B;  1APL C;  1ODD A;  2AS5 F;  4ETS A;  5IOZ A;  4HV6 A;  2KZG A;  1K6O A;  2V79 A;  1EJ9 A;  4A2U A;  3H9Q A;  1B1B A;  2VXZ A;  1IDZ A;  2J5P A;  3CDH A;  1U9O A;  2A6T A;  5HNF A;  3B02 A;  3A2K A;  3U21 A;  1NG6 A;  4HZF A;  3ZQH A;  1MD0 A;  4M6X A;  1UHM A;  4BDY A;  4XBF A;  4V2G A;  2JWT A;  1LKX A;  3ZOB A;  3E0J B;  1J2X A;  5HLG A;  2FML A;  4UB6 C;  1A35 A;  1FT9 A;  2DOF A;  2IGN A;  2HFH A;  2K3P A;  1S7E A;  3DEW A;  2XDV A;  3EYY A;  1ZG3 A;  1ZYR F;  2HZD A;  1SFO J;  4MNU A;  2DA7 A;  2VN2 A;  3EQL F;  4W1U A;  3VYU B;  1RRJ A;  3WG7 H;  2MSY A;  3TW7 A;  2WV0 A;  3V8J A;  4PJN A;  5EZG A;  2WBM A;  2O0Y A;  3BJA A;  2VJI A;  5E20 A;  1UFM A;  4BXU A;  3DCF A;  3WTV C;  2VKH A;  2BY2 A;  4RS8 A;  4IL6 C;  1Y6I A;  2KMU A;  3BTC A;  3ZP5 A;  2QZ8 A;  1JT6 A;  5BPD A;  1XD7 A;  3CCM I;  3WGH A;  3KYD B;  2YU3 A;  1FIP A;  2KRC A;  1FMV A;  3AL0 B;  3ZR8 X;  1X1B A;  1Y0N A;  4U88 A;  4C2M J;  2MH9 A;  4LIU A;  3ZQG A;  2PJR B;  4NC7 A;  2TDX A;  3BTJ A;  1E17 A;  4AIK A;  2DQR A;  3DBL B;  3DU5 A;  3JRD A;  3MWM A;  2JA8 J;  2HPM A;  3KET A;  3L2W A;  4I7H A;  2HZT A;  4UVB A;  4DBQ A;  1BI1 A;  3FBN B;  2K9S A;  1FC3 A;  3NAU A;  2BXZ A;  1KQ8 A;  4XN3 A;  3A02 A;  1H89 C;  4RAG A;  1YW9 A;  2OCC H;  4GYI A;  3F23 A;  2FX0 A;  3E97 A;  3CCL I;  1Y1V J;  2KIU A;  1SD5 A;  3BJO A;  5ILV A;  5DCM B;  4AM3 A;  2E35 A;  2EZI A;  2E1M B;  1XDU A;  1V5F A;  1FP1 D;  4BQA A;  4XRF A;  1X2N A;  2KP6 A;  3JRF A;  1JE8 A;  1TC3 C;  3C3W A;  5J4V A;  3G73 A;  1X1A A;  4MHG A;  1SAN A;  5FRN A;  4PSX A;  4NC6 A;  2DT5 A;  3PUB A;  3FHN A;  1KGS A;  1LJ9 A;  4AID A;  5IT9 Z;  2E60 A;  4XL9 A;  3F3X A;  3DWL E;  1HC8 A;  2LOO A;  3S93 A;  5IOY A;  3LSJ A;  4QPQ A;  4C2U A;  3KCC A;  2D1H A;  2Z33 A;  1G4D A;  3K2Z A;  2DT7 B;  3SJM A;  2HOE A;  4A12 A;  1A04 A;  4LK0 F;  4BE0 A;  1JKO C;  4UNO A;  2PMU A;  2R7Q A;  4Y3O A;  2OV7 A;  1W1W E;  1DUX C;  3OR2 C;  2KL4 A;  4Y17 A;  1ITY A;  3RKX A;  2ISY A;  1CQT A;  1EF4 A;  2PFB A;  3JSO A;  1G3S A;  2FQ4 A;  4NQW B;  1AHD P;  2H1K A;  2HI3 A;  5TIS C;  3E5Q A;  1X4P A;  2DYS H;  1W0T A;  3WE2 A;  5GP9 A;  3QP6 A;  2OBP A;  3GCM A;  2RQQ A;  3WGG A;  1RR7 A;  4LIT A;  2HWV A;  1FOK A;  2JN6 A;  3M3Y J;  1IN4 A;  1XCB A;  3SYT A;  4DYR A;  3OMY A;  2QVO A;  4UV9 A;  2L01 A;  5CVJ A;  3W3C A;  3OOP A;  1MDM A;  1TTY A;  2QQB A;  2FRH A;  4C3I J;  3LSM A;  2BEO A;  4DJA A;  1J09 A;  2VC1 A;  3ECO A;  4NHJ A;  1U3E M;  3HG9 A;  4KN4 X;  4JBA A;  1DQU A;  2IP2 A;  3CTA A;  4XK4 A;  2VPL A;  2ZSH B;  1EA3 A;  4EJV A;  2XGD A;  1T2K A;  2VPR A;  3BR3 A;  2PEX A;  2L0K A;  4P9F A;  3IKT A;  4U7D A;  3BJ6 A;  2OU2 A;  5K7F A;  1PVE A;  1TLH B;  2MC4 A;  4NBQ A;  2A68 F;  2B0L A;  4LB5 A;  5ICE A;  2FE3 A;  2LNB A;  5FD6 A;  4D0P A;  3W6K B;  3SZP A;  1BC8 C;  4M74 A;  5J47 A;  3B6A A;  1EH8 A;  3P9K A;  1SEU A;  2V6E A;  1IN6 A;  4ZYG A;  5EEH A;  4M3D A;  2R7T A;  4BL0 B;  4IXA A;  3WTX C;  4BAY A;  2Y0S N;  2LYC A;  4QTR A;  3FXU A;  5F1J A;  4EGZ A;  1JHF A;  3U9G A;  4JX5 A;  1T56 A;  3T1B A;  1ZK8 A;  4V2F A;  3Q3S A;  3S3M A;  2ZSI B;  3C18 A;  3A0B C;  5CVR A;  2GIV A;  3OYE A;  3GTQ J;  2YSR A;  1XGN A;  1ZTR A;  4XR6 A;  2M8G X;  1MMD A;  5L3D A;  1SC7 A;  4XQF A;  1HOM A;  1IRG A;  1FEX A;  1RI7 A;  1ZQ3 P;  1MBF A;  5K7Z A;  4F92 B;  1Q1V A;  5LGT A;  3BQY A;  2W85 A;  1HSJ A;  2O8K A;  1SD4 A;  3DKW A;  3Q0U A;  3OYJ A;  1WFX A;  2PQ8 A;  1JKP C;  5F0H A;  2GQQ A;  4CYD A;  2YR2 A;  1KON A;  3FDY A;  4O5V A;  3KIO A;  2QUF A;  4A5M A;  3PIP F;  2EK5 A;  3I64 A;  3V4G A;  4LGW A;  3EDP A;  2W48 A;  4MTD A;  1SD6 A;  3HBL A;  3FXR A;  2RNJ A;  3KE2 A;  2DOD A;  3OIP A;  2X1C A;  5F27 A;  2EIJ H;  4AIJ A;  2OQR A;  1O3T A;  5EG0 A;  1J7K A;  2J5O A;  4P55 A;  1Z05 A;  1HLV A;  2JUC A;  3AG1 H;  2A3S A;  2K9M A;  4HEA 2;  1SMT A;  3QOP A;  4XOR A;  3Q9S A;  2FBK A;  3KP4 A;  3G2B A;  4Q48 A;  4AWX B;  1JKQ C;  3HRM A;  4XKW A;  4EJT A;  2XPV A;  1BA5 A;  5M3F J;  4L9N A;  2HOA A;  5L3C A;  3AAF A;  1UMQ A;  2D5V A;  5TGT A;  3QAH A;  1K61 A;  3HGY A;  2R7R A;  2O5R A;  4S04 A;  3H0D A;  4MFD A;  3HC7 A;  3OYF A;  5CYV A;  4IHW A;  1OYW A;  4OAZ A;  2DPU A;  5D4R A;  3BRO A;  4RLF A;  5D5W B;  2L02 A;  4HNV A;  4HRI A;  1YG2 A;  4A6E A;  4ZDO A;  3QOE A;  3VFZ A;  1GV2 A;  1ETX A;  5BOX A;  5FKO A;  1D0X A;  1QHH D;  3VB2 A;  2E1O A;  2OUM A;  5BS6 A;  2C6Y A;  2JA5 J;  3JSP A;  3H1C A;  5HS7 A;  3CCV I;  4IHV A;  2HVS A;  1B59 A;  1B8I B;  3HSR A;  2I10 A;  2OTL I;  4V19 K;  4OU0 A;  2LY2 A;  3M7G A;  2DTZ A;  2Y48 A;  1B6A A;  1DGW Y;  2LC2 A;  3F21 A;  3BG6 A;  2GAU A;  4B8X A;  1U8R A;  2PBI A;  4DZJ A;  4RLQ A;  3F6O A;  3K4C A;  2PMH A;  3VYT B;  1UAA A;  1MKM A;  2DDA A;  2DA4 A;  2CH0 A;  1WGX A;  1BW6 A;  2P81 A;  2BVL A;  4XLE A;  1K79 A;  5F0C A;  5EGO B;  2XAJ A;  4U0V A;  3OSG A;  4EMS A;  2OZ6 A;  5B5E C;  2CSO A;  2LF7 A;  1GXP A;  2XAG A;  1MZB A;  2ADU A;  5J40 A;  1V5G A;  2PJP A;  1MBJ A;  4ITV A;  3LQQ A;  4WXC A;  2L54 A;  4XLF A;  3CF5 F;  3IKV A;  5ILU A;  4PDK A;  1T95 A;  3QWL A;  1DPR A;  2PX9 A;  1W36 D;  3QPL A;  4NB5 A;  2JSP A;  4HX8 A;  1ZG5 A;  3TW6 A;  2XAQ A;  4HLY A;  2HYF A;  2XAU A;  4BBR J;  1DP3 A;  3DXJ F;  1K4T A;  3ULQ B;  4NDL A;  2ZCW A;  1SFX A;  3L2R A;  2ZME A;  3I53 A;  2NVQ J;  5E18 F;  5GPC A;  1U8B A;  2M4G A;  4PJJ A;  5M5Y J;  5H6Q A;  2VJ5 A;  4I02 A;  1IRZ A;  2QYO A;  2EV6 A;  2G0E A;  1VQO I;  3HKZ N;  3HKZ A;  4LLL A;  3IC7 A;  3IP4 B;  3DQV C;  4X1E A;  4UXN A;  1OYY A;  2OJE D;  2NS0 A;  3ZGK A;  4KUM A;  3TDZ C;  4CSW A;  2DOA A;  3IL2 A;  3L2U A;  4P9U A;  1SAX A;  5LEK A;  2QSG X;  2M34 A;  3DV8 A;  1H0M A;  1UJ8 A;  1I1S A;  2V4J C;  1X58 A;  1G8X A;  4A69 C;  2NS7 A;  4AVP A;  1X3U A;  1OYI A;  3KP7 A;  4XMY A;  1WJ5 A;  4WF2 A;  3GO5 A;  5F6F A;  2LKX A;  2M9H A;  1WJD A;  3JCU C;  2LKS A;  5C4J J;  2ZFU A;  3DBR B;  1TW2 A;  1BIB A;  2Z16 A;  1OCC H;  4E70 A;  3OYL A;  2LTP A;  5EJC A;  4G94 A;  5C44 J;  1EKE A;  5DD4 A;  2BVM A;  3OOU A;  4XNF A;  2R7S A;  2WAQ A;  3HUG B;  1R1T A;  2WAE A;  1ZR2 A;  4AC0 A;  4MGR A;  4ZC3 A;  4AIH A;  3B6C A;  2OZU A;  3HRT A;  3V42 A;  2JRM A;  3TBI A;  3OYG A;  1W7P B;  1OFC X;  1SVL A;  1YW7 A;  3HDD A;  1R5I D;  3I4N J;  5HDG A;  4EM0 B;  1IRX A;  1S8N A;  4CYC B;  2ETH A;  1IN8 A;  5E1Z B;  3IRQ A;  2OAZ A;  1B9N A;  2A6H F;  4CDG A;  2STT A;  2E1C A;  3ELK A;  4LJZ F;  1O7L A;  2V6C A;  3RIR A;  4F7Z A;  1E3O C;  2ID3 A;  5LFA A;  2MLG A;  2KQR A;  1LQ1 A;  1PP7 U;  2XSD C;  4DZP A;  3CO6 C;  4A3B J;  4B48 A;  2Y31 A;  4RM3 A;  3OIQ A;  4F91 B;  3R0J A;  2P8T A;  2K27 A;  4ENK A;  1Y0U A;  2AQF A;  1NK2 P;  3RSN A;  1S7O A;  4Z6Y A;  4M3E A;  1TBX A;  4PCQ A;  4U87 A;  1YO5 C;  1Z6T A;  3G1M A;  1VI0 A;  1SMY F;  3ESW B;  3DKX A;  2BXY A;  2R5Z A;  1IXR C;  3K4N A;  5D6F A;  2CRG A;  4L5E A;  1VFC A;  4BQQ A;  2F5F A;  1FBU A;  4RGU A;  2O6G E;  1ZAO A;  2IGM A;  4FET A;  5J8F A;  2KHM A;  3CUQ A;  1UST A;  4B1R A;  5DM6 F;  2VOP A;  1GT0 C;  2CQQ A;  2HYJ A;  2EFO A;  1JJ8 C;  3L2C A;  5H6R A;  3JW4 A;  5E17 F;  3KP2 A;  2ZFW A;  1MBG A;  1ZGW A;  2CFO A;  1HCR A;  2P7C B;  2EV5 A;  1GV5 A;  1PUF A;  3P5J A;  2Z9O A;  2WB1 N;  2WB1 A;  1FWZ A;  4QWQ A;  4RMN A;  2ZJR F;  3GFL A;  4BE2 A;  2KJC A;  1X19 A;  3S8P A;  5E8G A;  1O3Q A;  2CUZ A;  4HF0 A;  1G59 A;  1WVR A;  4A5N A;  2IVM A;  1R5H A;  2ESH A;  2MW8 A;  4M3G A;  1HF0 A;  1ACI A;  2DXI A;  4LD5 A;  4AYB N;  4AYB A;  4Q47 A;  5J4Y A;  2CO5 A;  4EJO A;  2QSH X;  3KLO A;  2GBY A;  1V54 H;  3T8T A;  4BUP A;  2NXN B;  2CG4 A;  5HDK A;  2IGK A;  3JRB A;  2HR3 A;  2AO9 A;  2O9L A;  2BW3 B;  2GOX B;  2X6W A;  5E8I A;  2HQN A;  2FNP A;  4ZDL A;  4IRH A;  1WQ2 A;  1YLF A;  5LD2 C;  1RET A;  5HDN A;  1UG2 A;  4RB0 A;  4ENM A;  1WJA A;  2CW7 A;  4DGW B;  3GFM A;  4RGX A;  3MQ0 A;  1P92 A;  2CUE A;  2BHY A;  4U0W A;  2O61 A;  5J1R A;  2B9S A;  2HU9 A;  4D7M A;  3CQZ J;  3B73 A;  2ICW G;  2DK5 A;  4QIW N;  3CP2 A;  3NWT A;  3K70 D;  3BR6 A;  3WTY C;  2VBY A;  3FBI B;  2CWE A;  2RDP A;  4UUV A;  4M72 A;  2YX4 A;  2EH3 A;  4CA0 A;  4JQF A;  4N0B A;  4ZYH A;  1ZRF A;  1BR4 A;  1OIS A;  2OTJ I;  2M4K A;  3N97 A;  1QVU A;  1V4R A;  3O8G A;  3VYS B;  4Y52 J;  1O4X A;  1QRY A;  3E7L A;  1XSD A;  4MQ9 F;  1S5L C;  5EZH A;  1N78 A;  1BR2 A;  4X6A J;  3MCZ A;  3EET A;  3BC8 A;  1Z1D A;  2E71 A;  5L3B A;  5F04 A;  2X85 A;  3E5X A;  3M1E A;  5HVQ C;  1ETY A;  1DU0 A;  2DQL A;  1WJC A;  2G7H A;  3KEO A;  1Y39 A;  1DP7 P;  3AG3 H;  3ZXS A;  3H0G J;  1ULY A;  1TNS A;  4RAY A;  5DDG A;  2K9Q A;  3SDB A;  3ZQQ A;  2LBF B;  5HNH A;  1DPU A;  3BR1 A;  2DT6 A;  1IAW A;  2GOM A;  2A61 A;  1D5Y A;  1LDD A;  4XLH A;  2P7V B;  4BEH B;  3A03 A;  3QYB A;  4RGR A;  1TWC J;  2BE5 F;  3MKL A;  3P7N A;  5LHI A;  1V55 H;  4UUS B;  2DI3 A;  2L4A A;  3CCR I;  3R4K A;  2DN0 A;  3U2R A;  4EQQ A;  1R58 A;  1K7A A;  4GGG A;  2IGO A;  1KQ9 A;  1KU3 A;  2M0M A;  2GXA A;  4I01 A;  2BY1 A;  1S3J A;  2ZXI A;  3CLO A;  5K5O A;  3Q0W A;  4MO7 A;  1FPQ A;  1KQ0 A;  4BQN A;  2XRL A;  2LY9 A;  4IJA A;  4HNT A;  4XRS A;  3BTL A;  2KDO A;  1KU9 A;  3WGI A;  2A5W A;  3H5A A;  2IJL A;  4B43 A;  1Y8Q B;  4E7K A;  4KMF A;  3O8H A;  5J6X A;  4NC8 A;  2XV4 S;  1XSV A;  1YX5 A;  1LE8 A;  1IF1 A;  1QA6 A;  5HOD A;  3GTK J;  2UXX A;  2P6T A;  4A6D A;  4KMU X;  3BZC A;  4D5C A;  3LOC A;  4ZYA A;  1UZC A;  5JVT A;  3W6J B;  1IXC A;  2JA6 J;  3S14 J;  3UNG C;  3WTT C;  3AKZ A;  4QSH A;  5FKK A;  5ICF A;  2O03 A;  1I3A A;  3CC4 I;  3KYC B;  2Y0M A;  3CMY A;  4HQE A;  1EH7 A;  1ZRC A;  5L3F A;  1BIA A;  2VKD A;  3HM5 A;  3PFY A;  2V9P A;  5GTH C;  4IVN A;  3LSK A;  2DMQ A;  5ERI A;  5DUK A;  2CQN A;  2FQ3 A;  1FOW A;  4HF2 A;  1MMN A;  2YPR A;  1CF7 A;  1I6X A;  3LSP A;  2LVS A;  3D0S A;  3VWB A;  2VC0 A;  3PIO F;  5M3M J;  3OS2 A;  2BGC A;  3K69 A;  3PJR A;  2IPQ X;  1TT0 A;  2K9L A;  1MW7 A;  1R4N B;  4A93 J;  3IWF A;  3M8E A;  1ETV A;  1XGM A;  4XM3 A;  1BM9 A;  3FXM A;  2GXG A;  2Q2E B;  2VKV A;  4XLC A;  4D7N A;  1JJ6 C;  3CMM A;  3HXL A;  3CME I;  4E7Z A;  4BKX A;  2HTS A;  5LRS A;  1O57 A;  2ZC2 A;  4EVI A;  2E19 A;  4A3M J;  3HOS A;  1RC9 A;  2Y30 A;  1YJW I;  3RYR A;  5TRD A;  4FCY A;  1ON1 A;  4IHX A;  1WCM J;  2LR8 A;  1ETK A;  3KLN A;  2EB7 A;  2R7W A;  3WTS C;  1FZP B;  1TWG J;  5BPI A;  5ED4 A;  4F55 A;  3MZH A;  3QP5 A;  2LKP A;  3FM5 A;  4F52 A;  3QPH A;  2OA4 A;  1FSH A;  3QOD A;  1QZY A;  2BV6 A;  2HEO A;  1XG1 A;  4HST A;  1R1V A;  2CUF A;  1H8A C;  2GLO A;  1BJA A;  1U5T A;  4JK1 X;  4BJT A;  3GTM J;  1R36 A;  2QM3 A;  3JRA A;  1QGP A;  3I3L A;  4OIQ F;  2VUM J;  1TT5 B;  1UB9 A;  3OYH A;  4BJ5 C;  2L7M P;  1U6G A;  1USS A;  3N4M A;  3J80 Z;  2E2J J;  1IO2 A;  1S7A A;  3ZMU A;  5HS9 A;  1IDY A;  2DOE A;  1BOA A;  2Z2S B;  3F8N A;  2WY8 Q;  1BJZ A;  4M9Z A;  2P5L C;  2EFN A;  1N75 A;  4RB2 C;  1HA8 A;  1QO0 D;  2RNG A;  1RPW A;  3I59 A;  4YEJ A;  4BHB A;  2R7X A;  3IUO A;  2EFP A;  1XN7 A;  2V1X A;  1JUM A;  3E6D A;  3OIO A;  2EZL A;  4UB8 C;  1WJB A;  5FJ8 J;  2VKE A;  1T0F C;  3K4K A;  3TO9 A;  3K2A A;  1Z3X A;  6PAX A;  2KJB A;  4KNY A;  3OYI A;  1U2W A;  4PGG A;  3ZMV A;  1MSE C;  2HDW A;  3N05 A;  1T6S A;  2AHQ A;  2FEZ A;  4L5J A;  4A3K J;  3DLL F;  3UR3 C;  1X3W B;  2F6C A;  2JJ7 A;  1D1B A;  1R49 A;  2LLK A;  4C3J J;  1LB2 A;  2PI0 A;  1XB4 A;  1ONV A;  3K4J A;  3ZQ7 A;  1MGT A;  1NTC A;  4ZZL A;  3TL4 X;  3JRI A;  3CDI A;  1LUJ B;  2CJJ A;  3DFG A;  5LLQ A;  5B3S H;  3S1N J;  4M9S A;  3J7Z I;  1FP2 A;  2HQA A;  2JK3 A;  3BZK A;  5J8C A;  4BH9 A;  2RV8 A;  2RGV A;  4EM1 A;  4WWC A;  4C9Y A;  1MND A;  2LFB A;  2A5Y B;  2F48 A;  2XVC A;  2ESN A;  3TO7 A;  2ELJ A;  1IZ1 A;  1ZEL A;  3MN2 A;  3LSI A;  1FOX A;  1LNW A;  3J7Y J;  2KKO A;  3WE3 A;  1OJL A;  1P7I A;  1ERD A;  2GXB A;  3RI4 A;  1HDP A;  2L9V A;  3E1S A;  1NHA A;  1JUP A;  4D9J A;  2P4W A;  2DA1 A;  2ISZ A;  2IS1 A;  3V7S A;  3D5S C;  5CPR B;  3BDD A;  3RPU D;  4FX4 A;  3I56 I;  3GLL A;  2RC4 A;  3I58 A;  2CGP A;  2BOL A;  2ID6 A;  2XF5 A;  5D6E A;  3HZJ A;  2JPC A;  2X51 A;  1IJW C;  1D5V A;  1OKR A;  1FNN A;  3BPX A;  1J59 A;  3RZO J;  3I5U A;  3FIS A;  4HAM A;  2DFF A;  4PJL A;  2KZV A;  4OMY A;  2X48 A;  4HG2 A;  1JGG A;  3FKJ A;  3DTK A;  3KYL A;  5DYM A;  2F5D A;  2RQP A;  2ZME C;  2VOD A;  1DU6 A;  2WAD A;  4PGH A;  2ZXW H;  2ZXJ A;  4R8H A;  4C30 A;  4B09 A;  4GXO A;  1LPQ A;  1FTT A;  4Q4Z F;  2DAO A;  2GWR A;  1U9N A;  2VQG A;  3GUD A;  1FYL A;  2X0L A;  1SFK A;  3FMQ A;  4E4H A;  1O7F A;  5JHF A;  4PSW A;  1FYM A;  2UXN A;  1IUY A;  5E3L A;  3M4O J;  2NAZ A;  4RAZ A;  3KX2 A;  1B9M A;  1PDN C;  4LK1 F;  3GBG A;  2M45 A;  1J5Y A;  3C2G A;  3ERM A;  3J81 K;  3BCA A;  5L3G A;  1YS7 A;  1WHU A;  2DJI A;  2JT1 A;  2L9R A;  2HKO A;  3PO3 J;  2DJN A;  4EV0 A;  4ENN A;  1GHC A;  2VE9 A;  2DMN A;  4UHT A;  2DFH A;  1XS9 A;  2NNY A;  3L9F A;  4FTH A;  2FD5 A;  2Y0S A;  2F5C A;  3AFH A;  3WTW C;  4L18 B;  3L00 A;  4HQM A;  1MNE A;  2PG4 A;  1Z91 A;  1FJL A;  3GTP J;  3O3K A;  3MZY A;  5TJJ A;  3OYK A;  3F8C A;  1ENH A;  1F1Z A;  1P4X A;  3SDG A;  3K4L A;  1FYK A;  2XGE A;  3D1N I;  2Z5U A;  1OMI A;  2HVR A;  4BQO A;  1XGS A;  4LB6 B;  1ZAR A;  3HEF A;  1QBJ A;  2YX7 A;  2QBY A;  3AG2 H;  1WH5 A;  4E6K G;  2LD5 A;  1BC7 C;  5IP7 J;  2R7V A;  4IPA A;  5GTI C;  2R7D A;  3GTJ J;  4M3B A;  4RM2 A;  1K4S A;  5IYC J;  4G7O F;  2B7E A;  2VE8 A;  3OYM A;  1T98 A;  3M1C A;  3RJP A;  3BR0 A;  1WKM A;  3CJQ B;  1REP C;  1OCP A;  4FHT A;  4XKC A;  2Z99 A;  2EIN H;  4U0Y A;  3A01 A;  4MLO A;  3MKY B;  3HSF A;  1UG0 A;  3RQ4 A;  3JAM Z;  1RKT A;  3DF8 A;  4KIC A;  2UUZ A;  1N77 A;  2K4J A;  3KEQ A;  5H2F C;  1D1A A;  3NRV A;  5EEA A;  3WTZ A;  1CGP A;  5FO5 A;  1MDM B;  4NNJ A;  1ZGJ A;  4E7S A;  1T0F A;  4CO8 A;  4RA2 A;  2V26 A;  3LMM A;  1K78 A;  3RTR A;  1E3H A;  1IGN A;  1R1U A;  2RAE A;  1P9Q C;  4XLP F;  4IQJ A;  3CUQ C;  3M9A A;  3FKI J;  3ZMT A;  4CXF A;  3TQN A;  1QPI A;  1JTY A;  4IHS A;  2LP0 A;  3PM1 A;  2QEN A;  1VF9 A;  3T0Y A;  3DTE A;  4HW0 A;  2NYX A;  3GTO J;  3IAS 2;  1W4M A;  1R23 A;  2L7F P;  2XF6 A;  3G3Z A;  4HSR A;  1VQ6 I;  2XHK A;  3HSE A;  4M6V A;  1FY7 A;  4BAC A;  3FZV A;  5AON A;  4ZJZ A;  5FLX K;  5EF6 A;  3IWZ A;  5D8L B;  2L4M A;  5K1Y A;  4IRI A;  4I2O A;  1LVA A;  1OCZ H;  1OPC A;  2CQX A; 
#chains in the Genus database with same CATH homology
 5D5X B;  2W57 A;  3FXQ A;  4YFN F;  3CUO A;  4MEX F;  4Y13 A;  2D2W A;  1FX7 A;  2G7U A;  3KFW X;  5E1W A;  4HF1 A;  3GZ5 A;  4M6Y A;  1JXS A;  4R1H A;  2AXL A;  1ZH5 A;  3SHF A;  3ZN0 A;  2LDU A;  2W84 A;  4Z2Y A;  4P96 A;  2A07 F;  3HRS A;  4LG0 A;  2JRT A;  1G6N A;  3H3Z A;  4LLG F;  3LST A;  2MD5 A;  4CGZ A;  4Q5S F;  1KA8 A;  1QZZ A;  2XAF A;  1TNT A;  4ESB A;  4KDP A;  3GZ6 A;  1XDS A;  1HBX G;  1H9G A;  4G9Y A;  1FLI A;  3RPU A;  2VBZ A;  4ASN A;  4WXH A;  2GZW A;  2XIG A;  4M9X A;  2KIM A;  2Q8K A;  5IT9 K;  1HKQ A;  2STW A;  1RZ4 A;  1HW2 A;  2NRA C;  1HKT A;  2A69 F;  2XAS A;  1HST A;  3I4P A;  3DP7 A;  3ISP A;  1SFU A;  3VEP A;  2DW4 A;  2R3S A;  3R6S A;  4G8X A;  2MBF A;  3L09 A;  5FFZ A;  2IA2 A;  2HYG D;  3BPV A;  3HOT A;  5CLS A;  3GW2 A;  3ZMD A;  2O3F A;  3PFI A;  2EV0 A;  4L9T A;  3F8F A;  5AIQ A;  1KYZ A;  5ICC A;  2XKO A;  5K5Q A;  3HHG A;  2ZME B;  1JHH A;  3R61 A;  5LEJ A;  1SD7 A;  1ZHF A;  2HTJ A;  1KU2 A;  4YG2 F;  1XCV A;  2ACJ A;  3BP8 A;  4AD9 A;  1RUN A;  4UVA A;  4I0B A;  1G3Y A;  1XSX A;  2K86 A;  3Q5F A;  1YW8 A;  1P4W A;  4HBL A;  4CZZ A;  1EH6 A;  1U5T C;  4G6Q A;  2KIF A;  4ZH4 F;  2FMY A;  4HOB A;  5JFR A;  2RKH A;  3SXY A;  1KYW A;  3J7A O;  4FT8 A;  2FOK A;  1J9I A;  2P5V A;  2IRF G;  3WU0 A;  4KIB A;  2EFQ A;  4M73 A;  2UWM A;  4ESJ A;  2IT0 A;  3QRF F;  3ZMZ A;  1IXS B;  2QQ9 A;  3T5X A;  3V8K A;  1Q1H A;  1J0R A;  4O6J A;  3KP6 A;  2A6E F;  3COA C;  1LEB A;  3FHZ A;  4N9H A;  2EA4 A;  3J81 Z;  3RKW A;  2LSO A;  4TV7 A;  3CUQ B;  1LDJ A;  2CYY A;  3ABU A;  2XUB A;  1PP8 F;  5BQT A;  3CO7 C;  1BI0 A;  1W5T A;  2V9V A;  3GWZ A;  2F5E A;  1QPM A;  3NEU A;  3F6V A;  1R7J A;  1SFE A;  4N9I A;  2VT3 A;  3PQK A;  5DV5 A;  3CJN A;  2EA2 A;  4BHC A;  1Z9C A;  4EJW A;  4RB1 A;  4FX0 A;  2FU4 A;  4O3M A;  2EJR A;  1BN5 A;  2P5K A;  4HYE A;  2H27 A;  2Q0O A;  1ZRD A;  2XAH A;  5D5V B;  2MA3 A;  1WWX A;  4MTE A;  3HTU A;  5DCM A;  1Z7U A;  3NQO A;  2K7L A;  4OIP F;  4KYW A;  4HA8 A;  1F4K A;  5DUI A;  2RN7 A;  3ZPL A;  1XMA A;  5L3E A;  2GA1 A;  4M71 A;  2JZY A;  1O3R A;  4A0Z A;  4RB3 C;  5CVU A;  4BHP A;  5F64 A;  2FNA A;  1V3F A;  2DO7 A;  5EEG A;  4NQW A;  5HOO A;  3KP3 A;  4G7Z F;  3O6B B;  3ZN1 A;  1R00 A;  4YFX F;  1OR7 A;  5AIP A;  5JR3 A;  4ON0 A;  5FB2 A;  4YFK F;  1BBY A;  1W7P D;  2LF8 A;  4A0Y A;  4KIG A;  2JPB A;  4K2E A;  3DPT A;  1RUO A;  5BMZ A;  1WI9 A;  4EGY A;  3ABT A;  3I54 A;  2ZNY A;  1CF7 B;  2EWN A;  4XLN F;  4OIR F;  4YIF A;  2FSW A;  1XMK A;  2WTE A;  4XSZ F;  3TKY A;  2G9W A;  4Y15 A;  1D8J A;  3V8L A;  3HTS B;  5LRR A;  3GFI A;  2XRO A;  4HV5 A;  3FX3 A;  3C7J A;  2FF4 A;  1ZLJ A;  3LA3 A;  4WK8 F;  4GCV A;  1ZN2 A;  1U5T B;  1W5S A;  2E1N A;  3WTU C;  3R0A A;  4U7B A;  1HKS A;  5LHG A;  1RIO H;  3R60 A;  1P6R A;  1ZRE A;  2JSC A;  4HDU A;  4OIN F;  2HGC A;  3RPQ A;  3I59 B;  1YIO A;  4G6D A;  3BOQ A;  5LHH A;  4ZZD A;  1ZG1 A;  2V1D A;  3I71 A;  5FFX A;  5HS8 A;  1DDN A;  2E7X A;  3IRR A;  4ZYD A;  2H6B A;  3P9I A;  5ICG A;  3HRU A;  1BI3 A;  3LAP A;  3SZT A;  2O8X A;  3I0T A;  3QU6 A;  2MC3 A;  3E6B A;  4ZYE A;  3FF5 A;  2BBY A;  3H3U A;  5D5U B;  3V7R A;  3PQJ A;  1UHW A;  4EJU A;  2JTV A;  1P4A A;  2VBX A;  3KZY A;  3OV8 A;  4WCG A;  1R22 A;  1P2F A;  4ENJ A;  4EM2 A;  3S2W A;  1L0O C;  3ROU A;  1F5T A;  2FBH A;  4HX7 A;  5LGN A;  1FBQ A;  2OD5 A;  3U1D A;  3LA2 A;  1UCR A;  1TQI A;  3IHU A;  3K1M A;  1AWC A;  4WXD A;  4HDV A;  1T39 A;  2VBW A;  1HQC A;  1D8K A;  1FBS A;  2H6C A;  3GVA A;  5A2Q K;  3LFK A;  3DEU A;  2K4B A;  2RVC A;  2HQR A;  4GYG A;  4ESF A;  3GF2 A;  1D3Y A;  4P5O A;  1O3S A;  1I5Z A;  3F22 A;  2V1U A;  3GFJ A;  4KFC A;  2XGX A;  2M30 A;  1VTN C;  2VON A;  1JGS A;  1YYV A;  3FMS A;  1R5G A;  5KK1 A;  3RDI A;  4A0X A;  3BWG A;  1G3T A;  2DTR A;  4L0Y B;  4L5I A;  4LFU A;  1WSU A;  3VOE A;  5DCF A;  5CJ9 A;  1KU7 A;  3HUG A;  3T8R A;  5FD5 A;  3RYP A;  4KN7 X;  2QBY B;  2OQG A;  1T38 A;  1W7P A;  1G3W A;  2VT2 A;  3E6C C;  2M1B A;  5HLI A;  2VOO A;  2D1V A;  4S05 A;  3DPL C;  2D45 A;  2M5W A;  3ERE D;  1IN5 A;  3J80 K;  4UVC A;  1RNL A;  5D4S A;  2L3D A;  2ZNZ A;  3FM3 A;  3MEX A;  1I27 A;  4MEY F;  4MQV A;  1TQM A;  2IA1 A;  3QU3 A;  1LDK B;  4OIO F;  4RGS A;  5F1R A;  4OMZ A;  3REO A;  4HLX A;  3ZMS A;  2UZK A;  4CIC A;  1YS6 A;  1MJA A;  1K78 B;  3V7C A;  2W24 A;  5HLH A;  3WG9 A;  4GO1 A;  4YII A;  2BYV E;  3O2P E;  3MAJ A;  2ZBK A;  1IW7 F;  2DBB A;  1B4A A;  1GVJ A;  3Q9V A;  3LA7 A;  1E2X A;  5LGU A;  3QPT A;  3TOA A;  2MLK A;  3ECH A;  2Z3Y A;  3BZ6 A;  5JHU A;  2HKX A;  4L9V A;  3LAJ A;  4KT5 C;  2MH2 A;  2E7W A;  5ILS A;  1IN7 A;  1Z6R A;  4WX9 A;  3E3V A;  2PLY A;  3M8F A;  3BY6 A;  4KA4 A;  4I98 B;  1ON2 A;  3GEZ A;  3SQN A;  1STZ A;  1BI2 A;  3SFZ A;  1HXD A;  1I1G A;  1S29 A;  5KVR A;  1YQA A;  4LG0 B;  3C1D A;  3JTH A;  5DEQ A;  2CQK A;  4LLN A;  1YFH A;  1WRJ A;  1ZGA A;  2M87 A;  3VOD A;  1TW3 A;  2FXA A;  1L3L A;  3GXO A;  3TGN A;  2CW0 F;  3WU1 B;  2GA2 A;  1EV7 A;  5D8K B;  2H09 A;  1F9N A;  1PUE E;  4L9J A;  3K0L A;  2R7F A;  2DPD A;  4QLC U;  3K1N A;  4LMY A;  2ZJ2 A;  1ZLK A;  4L0Z B;  1MJB A;  4R79 A;  3K1P A;  2IW5 A;  2Y75 A;  1GXQ A;  3H92 A;  5IT3 A;  1U78 A;  1QNT A;  1AOY A;  1YTY A;  2K02 A;  2IA0 A;  1TQP A;  2QQA A;  5JI6 A;  3F72 A;  3JTG A;  1C0W A;  2H94 A;  4IF4 A;  2DFI A;  3F8M A;  2QWW A;  5CVV A;  2PN6 A;  5CVI A;  3LWF A;  2XKP A;  1MJ9 A;  4CHU A;  2F2E A;  4BYY A;  3JAM K;  3EYI A;  4IHT A;  3HIF A;  3HHH A;  1H9T A;  2DU9 A;  2NNN A;  3ML6 A;  2FBI A;  1FSE A;  5K5R A;  3FWE A;  2QLZ A;  1HW5 A;  3FMR A;  2Q2E A;  4H0E A;  2DLL A;  3GYH X;  3K9T A;  3F8B A;  2DK8 A;  2HS5 A;  4BNC A;  5E1X A;  3HYI A;  4HX4 A;  3D5L A;  3GX4 X;  1J75 A;  2HDC A;  2COM A;  3L7W A;  3P9C A;  1HW1 A;  2XRN A;  4DQ2 A;  2W25 A;  5FGM A;  3TDU C;  4G7H F;  3GLX A;  4PZJ A;  3TO6 A;  3LQR A;  3EUH A;  4KIF A;  3WOD F;  4XSX F;  4I09 A;  2WC2 A;  3RKY A;  3E6M A;  2CFX A;  4IRG A;  2ZO4 A;  4I0A A;  5DD8 A;  5LBQ A;  2ZKZ A;  3E5U A;  3KZZ A;  5H20 A;  1QQI A;  4UV8 A;  3TOB A;  5A2Q Z;  4OOI A;  2WWY A;  2ELH A;  3KP5 A;  2M8E A;  1S6L A;  1LEA A;  2EFW A;  2FA5 A;  2X4H A;  2KRF A;  2P6S A;  1IRF A;  1XGO A;  4DNC A;  3MFK A;  5FLX Z;  1ODD A;  2AS5 F;  4ETS A;  4HV6 A;  1K6O A;  2V79 A;  4A2U A;  1B1B A;  2VXZ A;  2J5P A;  3CDH A;  3B02 A;  4HZF A;  1MD0 A;  4M6X A;  1UHM A;  4XBF A;  1J2X A;  5HLG A;  2FML A;  1FT9 A;  2HFH A;  3EYY A;  1ZG3 A;  1ZYR F;  4MNU A;  2VN2 A;  3EQL F;  2WV0 A;  3V8J A;  2O0Y A;  3BJA A;  5E20 A;  1UFM A;  4BXU A;  3WTV C;  4RS8 A;  3ZP5 A;  2QZ8 A;  5BPD A;  1XD7 A;  3WGH A;  2YU3 A;  4U88 A;  2MH9 A;  2TDX A;  1E17 A;  4AIK A;  2DQR A;  3MWM A;  3KET A;  4I7H A;  2HZT A;  4UVB A;  1BI1 A;  1FC3 A;  1KQ8 A;  1YW9 A;  4GYI A;  3F23 A;  3E97 A;  2KIU A;  1SD5 A;  3BJO A;  5ILV A;  5DCM B;  1XDU A;  1FP1 D;  4BQA A;  4XRF A;  1JE8 A;  3C3W A;  3G73 A;  4MHG A;  2DT5 A;  1KGS A;  1LJ9 A;  5IT9 Z;  3F3X A;  3KCC A;  2D1H A;  2Z33 A;  1G4D A;  3K2Z A;  2HOE A;  4A12 A;  1A04 A;  4LK0 F;  4UNO A;  2PMU A;  1DUX C;  4Y17 A;  3RKX A;  2ISY A;  2PFB A;  3JSO A;  1G3S A;  3E5Q A;  3WE2 A;  3QP6 A;  2OBP A;  3WGG A;  2HWV A;  1FOK A;  1IN4 A;  1XCB A;  2QVO A;  4UV9 A;  2L01 A;  5CVJ A;  3OOP A;  1MDM A;  1TTY A;  2QQB A;  2FRH A;  2BEO A;  2VC1 A;  3ECO A;  4NHJ A;  1U3E M;  4KN4 X;  4JBA A;  2IP2 A;  3CTA A;  4EJV A;  1T2K A;  2PEX A;  4P9F A;  3IKT A;  4U7D A;  3BJ6 A;  2OU2 A;  1TLH B;  4LB5 A;  2A68 F;  2B0L A;  5ICE A;  2FE3 A;  2LNB A;  5FD6 A;  4D0P A;  3W6K B;  3SZP A;  1BC8 C;  4M74 A;  1EH8 A;  3P9K A;  1IN6 A;  4ZYG A;  5EEH A;  4IXA A;  3WTX C;  4BAY A;  3FXU A;  4EGZ A;  1JHF A;  3U9G A;  3T1B A;  3C18 A;  5CVR A;  2GIV A;  2YSR A;  1XGN A;  5L3D A;  1IRG A;  1RI7 A;  5LGT A;  2W85 A;  1HSJ A;  1SD4 A;  3DKW A;  2PQ8 A;  2GQQ A;  4CYD A;  2YR2 A;  4O5V A;  2QUF A;  4A5M A;  2EK5 A;  3I64 A;  3V4G A;  4LGW A;  3EDP A;  4MTD A;  1SD6 A;  3KE2 A;  3FXR A;  2RNJ A;  4AIJ A;  2OQR A;  1O3T A;  1J7K A;  2J5O A;  4P55 A;  1Z05 A;  2A3S A;  1SMT A;  3QOP A;  3Q9S A;  2FBK A;  3KP4 A;  4Q48 A;  4AWX B;  3HRM A;  4EJT A;  4L9N A;  5L3C A;  3AAF A;  3QAH A;  4S04 A;  5CYV A;  1OYW A;  2DPU A;  5D4R A;  3BRO A;  5D5W B;  2L02 A;  1YG2 A;  4A6E A;  3VFZ A;  5BOX A;  3VB2 A;  2C6Y A;  5BS6 A;  3JSP A;  5HS7 A;  1B59 A;  3HSR A;  4OU0 A;  3M7G A;  2Y48 A;  1B6A A;  3F21 A;  2GAU A;  4B8X A;  1U8R A;  2PBI A;  3F6O A;  2PMH A;  1MKM A;  1K79 A;  2XAJ A;  4U0V A;  4EMS A;  2OZ6 A;  2CSO A;  2LF7 A;  1GXP A;  2XAG A;  1MZB A;  2ADU A;  2PJP A;  3LQQ A;  4WXC A;  2L54 A;  3IKV A;  5ILU A;  4PDK A;  1DPR A;  4NB5 A;  1ZG5 A;  4HX8 A;  2XAQ A;  4HLY A;  2HYF A;  3DXJ F;  3ULQ B;  2ZCW A;  1SFX A;  2ZME A;  3I53 A;  5E18 F;  5H6Q A;  4I02 A;  2QYO A;  2EV6 A;  4LLL A;  3IC7 A;  3DQV C;  4UXN A;  1OYY A;  2NS0 A;  4KUM A;  3TDZ C;  3IL2 A;  4P9U A;  1SAX A;  5LEK A;  3DV8 A;  1H0M A;  1I1S A;  4AVP A;  1X3U A;  1OYI A;  3KP7 A;  4WF2 A;  3GO5 A;  5F6F A;  1TW2 A;  1BIB A;  4E70 A;  4G94 A;  5DD4 A;  1R1T A;  4MGR A;  4AIH A;  2OZU A;  3HRT A;  1W7P B;  1YW7 A;  5HDG A;  4EM0 B;  1S8N A;  2ETH A;  1IN8 A;  5E1Z B;  3IRQ A;  2OAZ A;  1B9N A;  2A6H F;  4CDG A;  2STT A;  2E1C A;  3ELK A;  4LJZ F;  1O7L A;  2V6C A;  3RIR A;  4F7Z A;  2MLG A;  1LQ1 A;  1PP7 U;  3CO6 C;  3R0J A;  2P8T A;  2K27 A;  4ENK A;  1Y0U A;  1S7O A;  1TBX A;  4PCQ A;  1YO5 C;  1Z6T A;  1SMY F;  1IXR C;  5D6F A;  2F5F A;  1FBU A;  4RGU A;  2O6G E;  1ZAO A;  5J8F A;  3CUQ A;  1UST A;  2VOP A;  2EFO A;  3L2C A;  5H6R A;  3JW4 A;  5E17 F;  3KP2 A;  2ZFW A;  2P7C B;  2EV5 A;  2Z9O A;  1FWZ A;  4QWQ A;  3GFL A;  2KJC A;  1O3Q A;  5E8G A;  4HF0 A;  4A5N A;  2IVM A;  1R5H A;  2ESH A;  4LD5 A;  4Q47 A;  2CO5 A;  4EJO A;  3KLO A;  3T8T A;  2CG4 A;  5HDK A;  2HR3 A;  5E8I A;  2HQN A;  2FNP A;  4IRH A;  1WQ2 A;  1YLF A;  5HDN A;  4RB0 A;  4ENM A;  3GFM A;  4RGX A;  3MQ0 A;  1P92 A;  4U0W A;  2O61 A;  3B73 A;  2DK5 A;  3WTY C;  2VBY A;  2CWE A;  2RDP A;  4UUV A;  4M72 A;  2YX4 A;  4JQF A;  4N0B A;  4ZYH A;  1ZRF A;  3N97 A;  1V4R A;  1XSD A;  4MQ9 F;  3MCZ A;  3EET A;  1Z1D A;  5L3B A;  3E5X A;  3M1E A;  5HVQ C;  2DQL A;  2G7H A;  3KEO A;  1DP7 P;  1ULY A;  1TNS A;  4RAY A;  5DDG A;  1DPU A;  1IAW A;  2A61 A;  1LDD A;  2P7V B;  4RGR A;  3P7N A;  2BE5 F;  5LHI A;  2DI3 A;  2L4A A;  3R4K A;  3U2R A;  4EQQ A;  1R58 A;  1K7A A;  4GGG A;  1KQ9 A;  1KU3 A;  4I01 A;  1S3J A;  3CLO A;  5K5O A;  1FPQ A;  1KQ0 A;  4IJA A;  1KU9 A;  3WGI A;  2IJL A;  4KMF A;  5J6X A;  2XV4 S;  1XSV A;  1IF1 A;  2UXX A;  2P6T A;  4A6D A;  4KMU X;  5JVT A;  3W6J B;  1IXC A;  3WTT C;  5ICF A;  2O03 A;  2Y0M A;  4HQE A;  1EH7 A;  1ZRC A;  5L3F A;  1BIA A;  4IVN A;  5ERI A;  5DUK A;  2FQ3 A;  4HF2 A;  2YPR A;  1CF7 A;  1I6X A;  3D0S A;  2VC0 A;  2BGC A;  3K69 A;  2IPQ X;  3IWF A;  3M8E A;  1XGM A;  1BM9 A;  2GXG A;  2HTS A;  5LRS A;  1O57 A;  4EVI A;  3HOS A;  3RYR A;  5TRD A;  1ON1 A;  3KLN A;  2EB7 A;  3WTS C;  1FZP B;  5BPI A;  5ED4 A;  3MZH A;  3QP5 A;  2LKP A;  3FM5 A;  3QPH A;  2OA4 A;  1FSH A;  1QZY A;  2BV6 A;  2HEO A;  1R1V A;  1BJA A;  1U5T A;  4JK1 X;  1R36 A;  2QM3 A;  1QGP A;  4OIQ F;  1UB9 A;  1U6G A;  1USS A;  3N4M A;  3J80 Z;  1S7A A;  3ZMU A;  5HS9 A;  1BOA A;  3F8N A;  4M9Z A;  2P5L C;  2EFN A;  4RB2 C;  1QO0 D;  3I59 A;  4BHB A;  2EFP A;  1XN7 A;  2V1X A;  3E6D A;  3TO9 A;  6PAX A;  2KJB A;  4KNY A;  1U2W A;  4PGG A;  3ZMV A;  1T6S A;  2FEZ A;  4L5J A;  1LB2 A;  2PI0 A;  1XB4 A;  1ONV A;  3ZQ7 A;  1MGT A;  4ZZL A;  3DFG A;  5LLQ A;  4M9S A;  1FP2 A;  5J8C A;  4BH9 A;  2RV8 A;  2RGV A;  4EM1 A;  4WWC A;  2A5Y B;  2XVC A;  2ESN A;  3TO7 A;  1IZ1 A;  1LNW A;  2KKO A;  3WE3 A;  2GXB A;  3RI4 A;  1NHA A;  2P4W A;  2ISZ A;  3V7S A;  3BDD A;  4FX4 A;  2CGP A;  2RC4 A;  3I58 A;  5D6E A;  2JPC A;  1D5V A;  1OKR A;  1FNN A;  3BPX A;  1J59 A;  3I5U A;  4HAM A;  4OMY A;  5DYM A;  2F5D A;  2RQP A;  2VOD A;  4PGH A;  2ZXJ A;  4R8H A;  4B09 A;  4GXO A;  4Q4Z F;  2DAO A;  2GWR A;  3GUD A;  1FYL A;  2X0L A;  3FMQ A;  1O7F A;  1FYM A;  2UXN A;  1IUY A;  2NAZ A;  4RAZ A;  1B9M A;  1PDN C;  4LK1 F;  2M45 A;  1J5Y A;  3J81 K;  5L3G A;  1YS7 A;  2JT1 A;  2HKO A;  4EV0 A;  4ENN A;  1GHC A;  2VE9 A;  4UHT A;  2NNY A;  3L9F A;  4L18 B;  2F5C A;  3WTW C;  3L00 A;  4HQM A;  2PG4 A;  1Z91 A;  3O3K A;  3MZY A;  5TJJ A;  3F8C A;  1F1Z A;  1P4X A;  1FYK A;  2Z5U A;  1OMI A;  1XGS A;  4LB6 B;  1ZAR A;  1QBJ A;  2YX7 A;  2QBY A;  1BC7 C;  4IPA A;  2R7D A;  4G7O F;  2VE8 A;  1T98 A;  3RJP A;  1WKM A;  1REP C;  4FHT A;  2Z99 A;  4U0Y A;  3HSF A;  3JAM Z;  3DF8 A;  4KIC A;  2K4J A;  3KEQ A;  3NRV A;  3WTZ A;  1CGP A;  5FO5 A;  1MDM B;  1ZGJ A;  1T0F A;  4CO8 A;  1K78 A;  3RTR A;  1R1U A;  4XLP F;  3CUQ C;  3M9A A;  3ZMT A;  4CXF A;  3TQN A;  4IHS A;  2QEN A;  3T0Y A;  4HW0 A;  2NYX A;  1W4M A;  1R23 A;  3G3Z A;  2XHK A;  3HSE A;  1FY7 A;  3FZV A;  5AON A;  5FLX K;  3IWZ A;  5D8L B;  2L4M A;  5K1Y A;  4IRI A;  4I2O A;  1LVA A;  1OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...