5HLGA

Structure of reduced abfr bound to dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
134
Chain Sequence
QEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLETKYVFEELEQTLKHLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator/dna
molecule keywords DNA (5'-D(*TP*AP*AP*CP*TP*CP*AP*AP*TP*CP*GP*CP*GP*CP*GP*CP*G
total genus 48
structure length 134
sequence length 144
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hlgA00
3J80K 3S2WA 1U3EM 3MZYA 3MCZA 1PP8F 2QWWA 1FZPB 1BI3A 1KU9A 1D5VA 1IN7A 1XDSA 2AS5F 3QU3A 1SD6A 3EYYA 2ZJ2A 5ILVA 1T39A 1O7FA 1ODDA 4IRHA 5IT3A 3K69A 3LA7A 1TBXA 4UXNA 3VOEA 4OIQF 4EJOA 2LF7A 3SHFA 5L3DA 3TKYA 2ZFWA 4E70A 5E18F 3K1MA 3ERED 3P9KA 2VC1A 1FWZA 3ZN1A 1YS6A 2VOOA 1JHHA 1SFUA 3O3KA 2DU9A 2XUBA 2FF4A 5TJJA 2QENA 3I59B 5L3CA 2RGVA 3KP4A 2VE9A 2RNJA 2DT5A 1YIOA 3HRSA 1R5GA 1TQPA 1JXSA 3CTAA 1ON1A 2FMYA 5F1RA 3WTXC 5LLQA 5TRDA 2MBFA 4MQ9F 2OAZA 3TO7A 4ZYHA 1R5HA 2EFOA 2M30A 1T6SA 1P6RA 3IHUA 1R1TA 5J8CA 3QP6A 2OA4A 2E7WA 3T1BA 2DFIA 3E6DA 2K86A 3GFIA 5DCFA 5JI6A 2AXLA 4M9XA 1D3YA 4OIOF 1U5TA 2WWYA 2VE8A 2ZNYA 3KP2A 2BGCA 3D0SA 4WX9A 3T0YA 4BHCA 3ZMSA 2VT3A 3MEXA 3KFWX 1IUYA 3GXOA 3HIFA 2A6EF 3FZVA 4EVIA 4UNOA 5D5VB 4LFUA 4N9HA 1RIOH 4Q48A 3DQVC 4EJWA 3KEQA 5LRRA 2GXGA 3F8MA 5AIPA 2PEXA 2PJPA 3GYHX 1R36A 1D8JA 1B4AA 3RPUA 1BI1A 1P4AA 4XLNF 5ILSA 3TDUC 4GXOA 1KQ9A 3V7CA 1J59A 4FT8A 4KDPA 4UHTA 2MH9A 3LQRA 2LNBA 4ZZLA 2HZTA 2P8TA 1J5YA 4I0AA 1G4DA 2X4HA 5CYVA 2XKOA 3NQOA 4FX4A 5HS7A 2KJBA 5H6RA 5LHIA 1F4KA 5CVIA 1ZGAA 4LG0A 2EV5A 2HTSA 3BPXA 3L2CA 2FA5A 2MC3A 1E2XA 4O3MA 3ABTA 4HLYA 3B73A 4M71A 3HSRA 3QPHA 1Y0UA 4G6QA 2FOKA 2KIFA 3WGGA 2NS0A 3E6MA 4MEXF 4QLCU 1V3FA 1KU7A 1XCBA 1IXRC 2VT2A 2EFNA 2HWVA 3BJAA 5LGUA 4YFNF 3KP5A 2HR3A 5FGMA 2IT0A 3FHZA 1I27A 4IRGA 5DUIA 1SMYF 2MLGA 1IW7F 2DLLA 3IWZA 2V9VA 2XRNA 2IW5A 1D8KA 1MJBA 1BC7C 1HKTA 4UV9A 2CYYA 1QBJA 2ZMEB 2GXBA 4HZFA 4AWXB 4OMZA 1WKMA 1XCVA 4BH9A 1R22A 1ONVA 2B0LA 4U0WA 2EFWA 2HYGD 1BN5A 2IRFG 5LGNA 3GZ6A 4N0BA 4ASNA 3BROA 1ZN2A 2GQQA 3I71A 3TO9A 1U8RA 2FMLA 3JTHA 4CO8A 2FBHA 1TNTA 3KETA 2PLYA 1ZREA 5L3BA 2PI0A 2IA2A 4MGRA 4P55A 2LF8A 1YYVA 4XSZF 1YG2A 2P4WA 4M9ZA 3RKXA 4M73A 5FB2A 1K79A 3DEUA 3BP8A 4A0XA 3F72A 4WXDA 3FM3A 5E1XA 3VEPA 1LQ1A 1S6LA 1SAXA 3T8RA 2XHKA 1KYZA 2NYXA 3Q9VA 1K78A 3GO5A 4HV5A 4M74A 2KJCA 4RAYA 3K9TA 5K5QA 4OMYA 2V6CA 3SQNA 4P9UA 3CDHA 5D5UB 3G73A 2O6GE 3ECHA 4Q47A 1FBSA 4ZZDA 2GAUA 5FLXZ 2JRTA 4RB0A 3GLXA 3RYRA 4LGWA 4Q5SF 2DK5A 2PN6A 5FFXA 2HKXA 3ZQ7A 4GYIA 4HF0A 4U0VA 1OPCA 2Q2EA 1XD7A 5LEKA 2EJRA 3I58A 3RJPA 5CLSA 4ESJA 1FLIA 4UVCA 1SD5A 5K5RA 2ZCWA 5ICCA 2P6TA 2PBIA 4EJVA 1XSVA 3ML6A 1XGSA 4MHGA 3SFZA 4AIHA 2HKOA 5AIQA 2HDCA 1R7JA 2F2EA 3KZZA 3JSOA 3ZP5A 4L0ZB 2Z99A 2Y75A 2XAHA 1U78A 3TQNA 1QNTA 3FX3A 1ZARA 3BPVA 5K5OA 3W6KB 5E1WA 3LSTA 4PCQA 5HLHA 4HX7A 3WG9A 4BAYA 4LK1F 5BPDA 1WSUA 2O8XA 3L09A 2IVMA 4G7ZF 3E5XA 4L9JA 3I53A 4PGGA 3H3ZA 2EA2A 1TNSA 2H94A 3MFKA 1T2KA 2G7UA 1B59A 1DUXC 2CQKA 2VBWA 2V1XA 2DQLA 4RB1A 3LQQA 2PQ8A 4L5IA 2P7VB 3SXYA 1FP2A 5DV5A 3DPTA 4WK8F 3J80Z 1HXDA 3KP3A 4ZYDA 4FX0A 4JK1X 4R79A 4I0BA 4EQQA 3ISPA 5FFZA 2FRHA 2RC4A 4EM2A 3R6SA 3BWGA 2UXNA 4O5VA 3RKWA 1LNWA 2YPRA 1KQ8A 1TW2A 1FYMA 5D8KB 2MLKA 2A5YB 3QP5A 4IF4A 4OINF 1J9IA 5LEJA 2G7HA 2H09A 2OZ6A 4UV8A 2ZNZA 3GF2A 1UHWA 1W4MA 1LJ9A 1ZGJA 1RZ4A 2XAJA 3OOPA 4LJZF 2P7CB 4LK0F 1K78B 5ERIA 2QQAA 2KRFA 3N97A 2JPCA 4HX4A 1K6OA 4LLNA 3DPLC 2ISYA 2M87A 4CZZA 4HOBA 5EEGA 5BPIA 3WTTC 4KFCA 1YLFA 1P4XA 4ON0A 1I1GA 2D1HA 5D5WB 4IXAA 4P96A 2E7XA 3V7RA 2A6HF 1O3QA 1IAWA 1XDUA 4KIBA 2V1UA 3L9FA 3FMSA 4XRFA 2CFXA 2L01A 1TLHB 3HHHA 4AD9A 2OBPA 5H20A 3TOAA 2P5VA 3R0AA 1O7LA 4UVBA 3K1PA 5IT9K 1DPUA 1IZ1A 2EWNA 2STTA 1OR7A 4M72A 4I2OA 2K4JA 3TO6A 3BZ6A 3IKVA 4YFKF 4A2UA 5LHGA 2R7FA 1OKRA 3F6VA 5A2QK 2G9WA 1BIBA 3V7SA 1MJ9A 4CGZA 3PFIA 1IN6A 4BQAA 3DFGA 1MZBA 2E1CA 3V8LA 4DQ2A 1FBUA 3CLOA 2RN7A 2XROA 3V8KA 4Y17A 2JTVA 4ETSA 2CG4A 3DV8A 1STZA 4EGYA 2HS5A 1J2XA 2Z33A 3M1EA 2D45A 2M8EA 1V4RA 2D1VA 2LSOA 3ZPLA 3F8FA 1Z6TA 5LGTA 3MQ0A 5KVRA 1J7KA 4A5MA 3V4GA 2FQ3A 2E1NA 3L00A 3HSFA 3IRRA 2HFHA 1T98A 4RB2C 1VTNC 5HS9A 3I4PA 2VN2A 1YW7A 4KYWA 5J8FA 2EA4A 5ILUA 4U88A 2C6YA 4WXHA 2A3SA 3KE2A 4LB6B 5E8GA 3HSEA 4G6DA 4OOIA 4ENMA 3GX4X 4U0YA 4Z2YA 2A07F 2QQBA 2QQ9A 3FMRA 2BYVE 2GWRA 2F5CA 1XGOA 4YFXF 4IHTA 3WGHA 3ZMUA 3LA3A 1PUEE 2RKHA 4G7HF 4NB5A 4HW0A 2YU3A 1IRGA 3M8FA 2NAZA 2H27A 1IF1A 4M6YA 3CO7C 2KIMA 5K1YA 4HBLA 2QM3A 4UVAA 1YO5C 4I01A 4JQFA 1I5ZA 3RPQA 4IRIA 3KP6A 1KA8A 2ISZA 2QYOA 3OV8A 2BEOA 5FD5A 3C3WA 3FXRA 1R23A 1RNLA 4G94A 1F1ZA 3H3UA 2YX7A 1BBYA 2UXXA 3FWEA 4KUMA 2BV6A 3RKYA 3E6CC 2ZBKA 3EYIA 5HDKA 4HF1A 2O61A 2W85A 3HTUA 1IN5A 3WU0A 3LWFA 2VBXA 1I1SA 4AVPA 4YIFA 1P4WA 2CGPA 1JGSA 2MD5A 1AWCA 5IT9Z 2MH2A 4L9TA 1J75A 1YFHA 3DP7A 3K1NA 2HQNA 1FPQA 4CICA 1NHAA 2FNAA 1S7AA 1H0MA 4CYDA 1KQ0A 1AOYA 4DNCA 3KLNA 2HTJA 2MA3A 3E97A 1ZLJA 4OIRF 1ZLKA 5LRSA 1FBQA 5DDGA 2NNNA 4P5OA 3QPTA 1WWXA 1G6NA 2TDXA 4HQMA 2FU4A 3I5UA 5DEQA 4B09A 1T38A 3GVAA 3R4KA 4AIKA 1Z6RA 1KGSA 1X3UA 4AIJA 4O6JA 1ON2A 4ZH4F 3P9CA 4KT5C 5E20A 2EFQA 3FXUA 2JSCA 5HLIA 5D4SA 1BIAA 1YS7A 1HSJA 3EETA 3LAJA 1I6XA 2VBYA 2EV6A 4HDUA 4MTDA 3GEZA 2J5OA 5BMZA 4Q4ZF 5DYMA 1LEBA 3ABUA 3M8EA 1FSHA 3KCCA 1FP1D 1HQCA 5CJ9A 1USSA 5HS8A 3H92A 1T0FA 4IPAA 4RS8A 2W57A 2EB7A 1QZYA 1DP7P 2NRAC 3KP7A 2JZYA 1MJAA 3COAC 4RGRA 4GO1A 3J81Z 2ADUA 3F3XA 4WF2A 1MDMA 3SZTA 5EEHA 4F7ZA 4M9SA 1ZRFA 2OD5A 1ZHFA 4RGXA 4LB5A 4LMYA 1SMTA 3U9GA 4YG2F 3WODF 2GZWA 5J6XA 5FLXK 2DPUA 1XMKA 2HYFA 4MNUA 3G3ZA 1G3YA 3K2ZA 1QZZA 2O3FA 1F5TA 2NNYA 2EK5A 4L5JA 2FXAA 3R60A 1P92A 3QU6A 2M1BA 1ZH5A 2CSOA 5CVVA 3CO6C 1LEAA 2COMA 3O2PE 2H6CA 3E5UA 2IA0A 3BJOA 3AAFA 3CJNA 3BOQA 3FMQA 2HQRA 4EMSA 2D2WA 1SD7A 3U2RA 3F23A 1KU3A 4CHUA 1Z1DA 1LVAA 2VONA 1G3TA 3CUQA 2O0YA 1Z05A 1OYIA 1QGPA 2FBKA 2JPBA 4GGGA 4LLGF 1IRFA 2PG4A 1IXSB 4KNYA 3R61A 1FT9A 1ULYA 2XGXA 2FE3A 1BC8C 2WV0A 2XV4S 3IL2A 5DUKA 2FNPA 4A12A 1A04A 1DDNA 4GCVA 4MQVA 4EM0B 3WTWC 3DF8A 2QLZA 4LLLA 2IJLA 1H9GA 1FSEA 1XGNA 3P9IA 4KIFA 1EV7A 5LBQA 3WTYC 1U6GA 2L54A 5JR3A 1HW5A 2Z5UA 1REPC 3I0TA 3MZHA 4H0EA 4WCGA 1TQMA 1W7PB 2ZXJA 4PZJA 4S05A 3J81K 1R1UA 4A5NA 1W5TA 3Q5FA 4U7DA 3HHGA 1SFEA 1K7AA 2VC0A 1GHCA 5D6EA 2ZO4A 1MGTA 1BI2A 4PDKA 2XASA 1GXPA 3WTUC 2ZMEA 2Z9OA 3RIRA 2Q0OA 5H6QA 2O03A 4G9YA 4XBFA 1RUOA 2ESNA 4Y15A 3C18A 3WTSC 3HTSB 4B8XA 3HOTA 4WWCA 1DPRA 5D5XB 1UHMA 3KLOA 4R8HA 1HSTA 2X0LA 5CVJA 4KIGA 3FM5A 2WTEA 1XB4A 2QVOA 2DO7A 2XAGA 4I7HA 4LD5A 1IXCA 1LDDA 2W24A 2IA1A 1PP7U 2V79A 4BHPA 2DQRA 3WTVC 1HW2A 2FEZA 1S29A 3LFKA 1Z7UA 4RGUA 3PQJA 4L18B 4FHTA 1L0OC 4ESBA 1QQIA 4LG0B 3HOSA 4S04A 3F8BA 4PGHA 3LAPA 1S7OA 2FBIA 2UZKA 4I98B 3U1DA 3FXQA 3R0JA 2ELHA 3SZPA 1EH8A 1EH7A 3EDPA 3V8JA 3HRMA 4IJAA 5BOXA 5HDNA 3M9AA 4P9FA 1LDJA 3MWMA 5E8IA 3IC7A 2PFBA 4BNCA 4MTEA 1IN8A 4HAMA 1USTA 4KN7X 1U2WA 3F21A 1FOKA 3WGIA 2PMHA 2XVCA 5FD6A 2F5EA 4MEYF 2LDUA 2XAFA 3REOA 3PQKA 3RTRA 5FO5A 3ROUA 3NEUA 5E1ZB 2K7LA 1B9NA 3TOBA 4G8XA 5JFRA 3NRVA 3I64A 4IVNA 2RDPA 3ZMVA 1U5TB 5DD8A 2ZKZA 2L3DA 4NQWA 2CW0F 4A0ZA 1YTYA 5LHHA 3F8CA 4RB3C 1W7PD 4A0YA 1KU2A 5E17F 3F8NA 1L3LA 2DPDA 4KICA 3C7JA 1IN4A 4EV0A 1XN7A 2RVCA 2QBYB 1U5TC 1EH6A 4OIPF 2A69F 3WU1B 3JW4A 3E5QA 1FC3A 1R1VA 2GIVA 3IWFA 2W25A 1UCRA 2QBYA 2EV0A 1ZG5A 1CGPA 3ZMZA 3FF5A 4Y13A 1FY7A 3L7WA 3I59A 2RV8A 5JVTA 1BI0A 3F6OA 3HRUA 1RI7A 1OYWA 1F9NA 3D5LA 1WQ2A 5F6FA 5F64A 4KMUX 4ESFA 2GA1A 3T8TA 2R3SA 4KMFA 4YIIA 2J5PA 3WE2A 4EM1A 1LDKB 5D6FA 5ED4A 4N9IA 4TV7A 1YQAA 4OU0A 1WI9A 1WRJA 1ZG1A 3GWZA 3N4MA 4JBAA 3VB2A 2DBBA 5L3GA 4HQEA 3I54A 4L0YB 2YR2A 2VXZA 5ICFA 3HUGA 2OZUA 4I02A 2HOEA 4WXCA 5CVUA 2IPQX 1ZAOA 5L3EA 3CUOA 1TW3A 3QAHA 1Z9CA 2P5LC 3BJ6A 1R58A 4L9NA 5HVQC 2DW4A 1G3WA 1O3SA 1HKQA 1B6AA 1FNNA 3ULQB 1MD0A 4KA4A 5L3FA 2ACJA 1OYYA 3CUQC 4U7BA 4UUVA 2L4MA 5KK1A 1B1BA 4KN4X 4L9VA 5HDGA 3E6BA 2V1DA 1MKMA 3QRFF 3IRQA 2W84A 2VOPA 2M5WA 3ZMDA 3P7NA 3EQLF 2Z3YA 1UB9A 3WTZA 1ZG3A 1FYLA 1XSXA 5DD4A 1YW8A 3KEOA 3F22A 2L4AA 2RQPA 2IP2A 4XSXF 5HLGA 4EJTA 2UWMA 2YX4A 3O6BB 2BBYA 2Q8KA 3RI4A 3ECOA 1O3TA 4ZYEA 1G3SA 1H9TA 5ICEA 4CDGA 1CF7A 1B9MA 2LKPA 3TGNA 3Q9SA 2ETHA 2F5FA 3K0LA 1TTYA 4G7OF 3J7AO 1SD4A 5AONA 5HOOA 4HYEA 3GFMA 4R1HA 2Y48A 3IKTA 4BYYA 1W7PA 2ESHA 5A2QZ 2EFPA 5JHUA 4A6EA 1J0RA 3VFZA 5DCMA 2QZ8A 2GA2A 2P5KA 1PDNC 2OU2A 4HV6A 2KKOA 3GZ5A 5BQTA 1OMIA 3M7GA 2VBZA 3WE3A 1ZYRF 1SFXA 2XKPA 3RDIA 1BM9A 6PAXA 4ENKA 2K27A 3E3VA 3MAJA 4BHBA 3HYIA 2CO5A 5DCMB 3JSPA 1UFMA 4M6XA 3B02A 1C0WA 3JTGA 3VODA 2M45A 1Z91A 5D8LB 3T5XA 1GXQA 3JAMZ 2DAOA 5D4RA 4IHSA 1S3JA 2F5DA 3CUQB 4HDVA 4HX8A 3C1DA 2DTRA 1P2FA 3GW2A 1S8NA 3KZYA 1QO0D 3GFLA 2HEOA 2A68F 1TQIA 2P6SA 4GYGA 4HF2A 1CF7B 1JHFA 3W6JB 4EGZA 2CWEA 4CXFA 2XAQA 1BJAA 3ZMTA 5CVRA 2H6BA 1QPMA 2DI3A 1E17A 1ZRDA 4A6DA 4D0PA 1HW1A 1Q1HA 4HLXA 1O57A 2K4BA 2A61A 4I09A 1LB2A 4NHJA 2Y0MA 2FSWA 5ICGA 4ZYGA 2L02A 4HA8A 2WC2A 2K02A 3TDZC 1HKSA 3LA2A 2KIUA 4K2EA 1GVJA 5BS6A 2PMUA 1XSDA 1YW9A 1XMAA 3JAMK 2VODA 1R00A 2STWA 3ZN0A 3DKWA 3HRTA 1BOAA 4QWQA 4XLPF 1MDMB 1ZRCA 1FX7A 3GUDA 1HBXG 3DXJF 4ENNA 2BE5F 1W5SA 3BY6A 4EJUA 1RUNA 1JE8A 2OQGA 4BXUA 4ENJA 2R7DA 2HGCA 2QUFA 3BDDA 1FYKA 2DK8A 4RGSA 2OQRA 3ELKA 3GFJA 3RYPA 3QOPA 1O3RA 1XGMA 2JT1A 1KYWA 4RAZA 2XIGA 2YSRA 3EUHA
chains in the Genus database with same CATH superfamily
3J80K 1UG2A 2LKSA 4PJJA 3S2WA 1DP3A 1OFCX 4ZTJA 2BOLA 2XF6A 3PUFA 1U3EM 5J4YA 3SYTA 1HDPA 1IDZA 3HPGA 3HUGB 3MZYA 3MCZA 1ZR4A 2X1DA 4B43A 2KRHA 3L2UA 4HLYA 2A05A 1PP8F 2QWWA 5F0FA 2A6TA 4NC7A 1FZPB 1VQ7I 1BI3A 2VJ4A 2KT0A 1KU9A 1D5VA 2DFHA 1IN7A 1D1BA 1XDSA 2DA1A 1TT5B 2AS5F 3CQZJ 3QU3A 2XC7A 1SD6A 3EYYA 2ZJ2A 5ILVA 3N05A 4E7SA 1VFCA 4B44A 1T39A 1O7FA 1MBGA 1ODDA 2ECCA 2LTPA 4IRHA 4AC0A 4DZPA 3FDYA 3NAUA 5IT3A 3K69A 2DYRH 3LA7A 4XLHA 3DBHB 3I3LA 4D5FA 3SDGA 1Z77A 1TBXA 4UXNA 1BL0A 3VOEA 2HDDA 3BG3A 4OIQF 1Z7LA 2FOWA 4EJOA 4EATA 3PIOF 2CQNA 2LF7A 3SHFA 1IC8A 2NVUB 5KHDA 2DA5A 5L3DA 1TC3C 3TKYA 2K9QA 3K4NA 2ZFWA 4E70A 5LFAA 5E18F 1ZQ3P 3K1MA 2LD5A 3ERED 3P9KA 2R7QA 4HG2A 1IRXA 3HM5A 2VC1A 1FWZA 3ZN1A 4D9JA 1YS6A 2XB0X 2KFDA 4NDLA 2VOOA 1JHHA 1SFUA 3O3KA 2DU9A 2XUBA 2FF4A 5TJJA 2QENA 2LY1A 1HCRA 1WVRA 3G1MA 3I59B 3WHBA 2HXOA 2RGVA 5L3CA 3KP4A 2VE9A 4RM2A 2RNJA 2DT5A 1YIOA 3OYAA 3HRSA 1R5GA 3HOWJ 1TQPA 1JXSA 3CTAA 1WHUA 1ON1A 2DMNA 2FMYA 3PSFA 5EDNA 3MMYB 3TEDA 5F1RA 3WTXC 1RR7A 1TWAJ 5LLQA 2O7OA 4BEHA 2AQEA 5TRDA 1H88C 2MBFA 1MBKA 4MQ9F 4RBOA 4IOCF 2OAZA 3TO7A 1OR7C 4ZYHA 1R5HA 2EFOA 2M30A 3ZCOA 1T6SA 1P6RA 3IHUA 1R1TA 5J8CA 2JN6A 3QP6A 2OA4A 2N8GA 2M0MA 1JUPA 2E7WA 3BG7A 3T1BA 2DFIA 3E6DA 2L5QA 4RLFA 3CC2I 4BDYA 1N78A 2VUMJ 2LOOA 2VJ5A 3BR0A 1I3AA 2BW3B 2K86A 1TL8A 3GFIA 5DCFA 4NQWB 5JI6A 2AXLA 1MMNA 4M9XA 1D3YA 2B63J 4OIOF 3GTQJ 1U5TA 5JLWA 1WI3A 2WWYA 2EIKH 2VE8A 2ZNYA 2BGCA 3D0SA 3KP2A 2VLAA 2Y0SN 1JT6A 4WX9A 2X6OA 4XLCA 5B3SH 3T0YA 3ABLH 4IEJA 4BHCA 3ZMSA 2VT3A 3RPUD 3MEXA 3KFWX 2HQAA 1GLNA 1IUYA 3GXOA 1B72B 3HIFA 4XLEA 2A6EF 3FZVA 3F9KA 3WU2C 4EVIA 4UNOA 5D5VB 4LFUA 3PNVA 3IAM2 4YELA 2LR8A 4N9HA 4Z6YA 1RESA 1RIOH 4Q48A 3DQVC 4EJWA 1E3PA 1W0UA 3KEQA 2R7WA 3S17J 5LRRA 2GXGA 3H0DA 1HDDC 3F8MA 3HZJA 5AIPA 3JRCA 2PEXA 4X1EA 2PJPA 3GYHX 2E5NA 1R36A 1D8JA 1B4AA 3RPUA 1X4OA 1X1CA 2ELKA 1BI1A 3LOCA 2LFBA 3ZRGA 1P4AA 3K4LA 1WPKA 4LG3A 2DFEA 2KHMA 4XLNF 5ILSA 3TDUC 3OYCA 4GXOA 1S9HA 1KQ9A 3V7CA 1J59A 1I6HJ 2HVQA 3IH3A 1LE8A 4BE1A 4FT8A 1X1BA 1YHQI 4KDPA 4UHTA 2R7OA 4P1WA 1B8IA 2MH9A 1ZGWA 1VQNI 1OCCH 4IKFA 3LQRA 2DOAA 2LNBA 3SDBA 4ZZLA 1EKEA 2HZTA 2P8TA 2R7TA 1J5YA 3JR9A 3HKZA 2EZKA 2JA2A 2OV7A 4I0AA 1G4DA 2X4HA 2X6YA 3BC8A 1F43A 3K6GA 1VQLI 5CYVA 3H9QA 2XKOA 5EGOB 3NQOA 4FX4A 2XGDA 3GTKJ 2CH0A 5HS7A 2CMPA 2KJBA 5H6RA 5LHIA 3CMYA 1F4KA 5CVIA 1ZGAA 3MN2A 4RM3A 2EV5A 3KIOA 4LG0A 2PJRA 1D0YA 2XGCA 2HTSA 2VQCA 3BPXA 2E2HJ 2CS3A 4XRSG 2FA5A 2MC3A 1E2XA 3L2CA 4O3MA 2AXTC 2FQ4A 3ABTA 3B73A 3M1CA 4M71A 3HSRA 2QQ8A 2MYSA 3QPHA 4M6VA 4XLFA 1Y0UA 4G6QA 2FOKA 1OCTC 4Y3OA 2KIFA 3WGGA 3WHCA 2NS0A 4CYCB 1YJWI 3E6MA 4MEXF 4QLCU 1V3FA 2GBYA 3K4KA 1KU7A 3AL0B 2QSGX 3G1LA 1XCBA 2LP0A 3MD2A 1IXRC 2VT2A 2EFNA 2HWVA 3BJAA 2PX9A 5LGUA 1ETVA 3PIPF 2QF7A 4YFNF 3KP5A 2HR3A 3W2AA 5M3MJ 2ZFUA 5FGMA 5F27A 2IT0A 4CUGA 2E2IJ 3FHZA 1I27A 4IRGA 2H1KA 3BG6A 1SMYF 4CCMA 4F91B 1WJFA 5DUIA 2MLGA 3HOYJ 5DM7F 2ZXWH 4A3EJ 1UMQA 1IW7F 2DLLA 3TW6A 4E6KG 3IWZA 1WFXA 3G1OA 2V9VA 2R7SA 4JYKA 4XKBA 4IO9F 2LREA 2XRNA 2E2JJ 2IW5A 1D8KA 1MJBA 3X2QH 1BC7C 3W6VA 1TWHJ 3IH4A 1HKTA 3QYFA 4FCYA 3RQIA 2Q1ZB 3ASNH 2CYYA 4UV9A 1XX5A 1QBJA 3QYBA 2M7BA 2ZMEB 2GXBA 4HZFA 3S2DJ 4AWXB 4OMZA 1WKMA 5IP7J 1XCVA 4BH9A 1R22A 1ONVA 2B0LA 4U0WA 2E1MB 2EFWA 2HYGD 1BN5A 2IRFG 1ACIA 5LGNA 5DTDA 1K4SA 2VJIA 3DBLB 3A0HC 3GZ6A 3PO2J 4UB8C 5EF6A 4DBQA 2K9SA 4N0BA 4ASNA 3BROA 2UUZA 2Z1DA 1LUJB 5CKTA 1ZN2A 1BA5A 2GQQA 3I71A 3TO9A 5IP9J 2IEKA 2V9PA 4OWRB 1U8RA 2FMLA 1OCRH 2PMZA 3JTHA 1T0FC 2FBHA 3QOEA 4CO8A 1TNTA 4E7ZA 3KETA 2PLYA 1ZREA 2NVYJ 3D5RC 5L3BA 4KISA 1AA7A 3VYSB 2L9SA 1Y0NA 2PI0A 3HEFA 2IA2A 4MGRA 3TW7A 4P55A 4S0HB 2LF8A 1H89C 1YYVA 4XSZF 1YG2A 2E35A 2P4WA 3HXLA 3I4MJ 1DGRM 4G6TB 2O5RA 3IAS2 3PUBA 4FE4A 3K4CA 1FMWA 4BE2A 3D1NI 4M9ZA 3RKXA 1LVKA 4M73A 4N4OB 1Y6IA 2O9LA 3RSNA 5FB2A 4E7HA 3LSPA 1OLTA 1K79A 3EUAA 3DEUA 3BP8A 4A0XA 3F72A 1X4PA 4WXDA 3FM3A 5E1XA 3VEPA 5FKLA 2DDAA 2ELJA 3HDDA 3EUKL 1LQ1A 3ZXSA 1S6LA 1SAXA 3T8RA 3CCVI 2BZTA 2EZHA 4FTHA 2XHKA 2M9HA 2M4GA 5FKMA 2MD0A 1KYZA 4XICA 3QPLA 2NYXA 3BTCA 3Q9VA 3JRAA 1K78A 3AG3H 4BBSJ 2Z16A 3FKIJ 3GO5A 2QGUA 4HV5A 4M74A 3DEEA 2KJCA 4RAYA 3K9TA 5K5QA 4OMYA 3OSGA 4B4CA 4UUSA 2V6CA 2FX0A 5HNFA 3SQNA 4P9UA 4PJ0C 3CDHA 2H8RA 1ETKA 3IP4B 4IQJA 4BY7J 5D5UB 3P5JA 3UNGC 4Y52J 1FEXA 3G73A 4V2FA 2O6GE 3ECHA 2OJED 3O8GA 4Q47A 1FBSA 2V7FA 1OCPA 4ZZDA 2GAUA 5FLXZ 2JRTA 4RB0A 2QEXI 3GLXA 3RYRA 3JRDA 4LGWA 4Q5SF 4RA2A 2KRCA 1Z67A 1AHDP 2ID6A 1MSEC 1MMSA 2DK5A 5FKNA 2PN6A 3DU5A 5FFXA 2HKXA 3ZQ7A 4GYIA 4HF0A 2XPUA 4OAZA 4U0VA 1OPCA 3KX2A 2DT7B 2Q2EA 1QA6A 3KEYA 4ABZA 4ZTFA 1SANA 2CUFA 3OYFA 3HGGA 1XD7A 5LEKA 2EJRA 1W36C 1A5JA 3I58A 3RJPA 5CLSA 4ESJA 1FLIA 5JHFA 1BW6A 4UVCA 3J7ZI 3CMAI 2W7NA 1X58A 1SD5A 5K5RA 2ZCWA 1Y8QB 2VASA 5ICCA 2P6TA 3LSIA 2W1OA 1XC5A 1YI2I 2PBIA 2DTZA 2E34A 3S1MJ 3VSLA 4EJVA 1XSVA 3ML6A 4BY1J 1R4NB 1XGSA 2DMQA 1LFUP 4MHGA 3SFZA 3FXKA 4AIHA 1SC7A 2HKOA 5AIQA 2HDCA 1R7JA 2CU7A 2F2EA 4BQOA 2LK2A 3KZZA 2DA2A 5EG0B 3CCQI 4A3MJ 3JSOA 2F4MB 3OWTA 3ZP5A 2QA4I 4L0ZB 2Z99A 2Y75A 2KQRA 2XAHA 3HG9A 4B3AA 1U78A 3TQNA 1QNTA 3FX3A 3ZQFA 1ZARA 3A4CA 3BPVA 5K5OA 2OCCH 1IO2A 3W6KB 5E1WA 3LSTA 3TP0A 3H1CA 4PCQA 3S2HJ 1MW7A 5HLHA 4QPQA 4HX7A 3WG9A 4BAYA 3VPRA 3VSKA 4LK1F 3JRIA 1APLC 5BPDA 4FE7A 1WSUA 2O8XA 3L09A 4D5CA 2VQHA 3DTKA 2IVMA 5IYBJ 2IXSA 1G2HA 4BUPA 4G7ZF 3E5XA 4C2TA 4L9JA 3I53A 3K7AJ 2EIMH 4PGGA 1DQUA 3H3ZA 3LSHA 4AUXA 2EA2A 5F1JA 1TNSA 4PUSA 2H94A 3OIPA 3L2WA 3MFKA 1T2KA 4XOPA 3IH2A 3OL3A 2G7UA 2D5VA 1B59A 3K70D 1DUXC 2CQKA 2VBWA 2ID3A 1KONA 1V5GA 2LLKA 2V1XA 1VZ0A 3G2BA 4DZJA 2TCTA 2DQLA 3CJRB 4G12A 5B1BH 4RB1A 1IV6A 2IS6A 2TRTA 3LQQA 2PQ8A 2XPWA 2P7VB 4L5IA 2M2EA 2VI6A 4A3CJ 3LSKA 1FP2A 3SXYA 3CC4I 5DV5A 1HC8A 3DPTA 4WK8F 1DU6A 1BR1A 3GTPJ 3J80Z 2HOAA 5IY5H 1VQPI 2JVHA 5GTIC 1HXDA 3KP3A 3QWLA 4E7JA 4ZYDA 4FX0A 3CD6I 3BR3A 4JK1X 3ZQCA 2EBIA 4R79A 2CUJA 3BQZA 4I0BA 4EQQA 4BQQA 3ISPA 2XRLA 1NG7A 5FFZA 2FRHA 2V4JC 2RC4A 2LG4A 4EM2A 3R6SA 2CV2A 4JX4A 5C3EJ 3OL4A 4LIUA 3EUHC 3AG1H 3BWGA 2R7UA 2UXNA 4O5VA 1A36A 3RKWA 3AL0C 1LNWA 5DM6F 2WY7Q 3L1PA 2JWTA 3QPSA 4MO7A 5B66C 3CF2A 2YPRA 3RCOA 2LY2A 1KQ8A 1TW2A 1NTCA 1V5EA 4A3FJ 1FYMA 1K6YA 3FXOA 4C3IJ 2XSDC 5D8KB 2DCEA 2A5YB 2MLKA 3QP5A 4IF4A 4OINF 1J9IA 3B6CA 5LEJA 1A6IA 2G7HA 2H09A 2L9VA 2OZ6A 2LH9A 4UV8A 2ZNZA 1G59A 3GF2A 2JA5J 1FOWA 3W2VA 1UHWA 2XDVA 1W4MA 1LJ9A 3CCUI 2ZXHA 1ZELA 1ZGJA 5GAGJ 5J1UA 2IBDA 4UUSB 2JQ7A 1GUUA 3S93A 2KDZA 1RZ4A 4DYQA 4A3BJ 2XAJA 2DFFA 1E3HA 3OOPA 5EJCA 4LJZF 2WB1N 2P7CB 4LK0F 5IOYA 1K78B 2BHYA 2QQAA 5ERIA 1X1DA 2KRFA 3N97A 2JPCA 1BR4A 2VJJA 4E7IA 3CDIA 1I3QJ 4HX4A 1K6OA 2OTJI 3ZQQA 3PJRA 2O8KA 4LLNA 1R4MB 3CCJI 3DPLC 2ISYA 2M87A 4CZZA 5EEAA 4QTRA 2ZMEC 4I76A 3K10A 4HOBA 5EEGA 5BPIA 1P9QC 1S7EA 2CQXA 3WTTC 2KL4A 2IS2A 1MSFC 3WG7H 2L7MP 4XR6A 1ITYA 1Z3YA 4KFCA 1YLFA 3AKZA 1P4XA 4ON0A 5IP6A 1I1GA 2HXIA 3GTJJ 1JKPC 1U9OA 2D1HA 2DA3A 3ZQLA 2BXZA 5D5WB 4IXAA 4P96A 1NG6A 5B1AH 2E7XA 3V7RA 2A6HF 1O3QA 2KIQA 4IX7A 1IAWA 1XDUA 4KIBA 5C4XJ 2BXYA 2MSYA 2V1UA 3L9FA 3FMSA 4XRFA 2CFXA 2L01A 1K4TA 1TLHB 3HHHA 4AD9A 2KP6A 2OBPA 5H20A 3TOAA 3LL7A 2P5VA 3R0AA 1O7LA 4UVBA 1TZLA 3K1PA 4BQNA 3DKXA 5IT9K 1DPUA 1IZ1A 2EWNA 3O8HA 5CQEA 2STTA 1OR7A 4M72A 2GM4A 1TP4A 4M3BA 4HPQA 1TWFJ 4CCLA 4I2OA 4C30A 2MG4A 4QPOA 2K4JA 3TO6A 1RETA 2IAIA 3BZ6A 3G6EI 3IKVA 4YFKF 1D0ZA 4PK4A 1YJNI 2I10A 4A2UA 2E1OA 5LHGA 1DU0A 2R7FA 1OKRA 3F6VA 5A2QK 2G9WA 1BIBA 3CLQA 1OJLA 2FD5A 3V7SA 1MJ9A 1NK2P 1H8AC 4CGZA 3H35A 4M3FA 3PFIA 4A3JJ 1IN6A 2EPFA 5TISC 4BQAA 3DFGA 1MZBA 2E1CA 3V8LA 2Y2ZA 1AKHA 1XTAA 1FBUA 3CLOA 4DQ2A 2RN7A 2XROA 3V8KA 4Y17A 2JTVA 1IDYA 2DYSH 3H9JA 4EEFG 4ETSA 2CG4A 3DV8A 1STZA 4EGYA 2HS5A 3S1NJ 1J2XA 2Z33A 3M1EA 2D45A 2M8EA 3K4JA 4QSHA 1V4RA 2D1VA 2LSOA 3ZPLA 3S1RJ 3F8FA 1Z6TA 5LGTA 1D0XA 3MQ0A 1OISA 1I39A 1ORKA 5KVRA 4C3JJ 5C44J 1J7KA 4ZJZA 4A5MA 3V4GA 3Q0UA 2FQ3A 2E1NA 3L00A 3HSFA 1V5FA 3IRRA 2AO9A 5E79C 2HFHA 4HSTA 1T98A 4RB2C 1VTNC 2F4IA 3EPZA 5HS9A 3I4PA 2VN2A 1YW7A 3AG2H 4KYWA 3IUOA 5J8FA 2EA4A 5ILUA 4U88A 2C6YA 2K5CA 2A3SA 4WXHA 3KE2A 5CPRB 4YIRX 1N77A 2YS9A 1ZK8A 4BGDA 5HLTA 3ONQA 2R5ZB 2Y0SA 2WAQN 1MMAA 5F0HA 1F36A 5E8GA 4LB6B 1ERDA 1X1AA 5EYRA 3OYEA 1LPQA 3HSEA 4G6DA 1MNDA 1WJDA 1UELB 3F0CA 4FETA 4YRVA 4OOIA 4ENMA 3GX4X 4A3GJ 2R5ZA 4J01A 4HNVA 2IS1A 4U0YA 5J4VA 4Z2YA 1W1WE 1OQYA 2A07F 3JREA 2R7RA 2QQBA 2QQ9A 3FMRA 2L7ZA 3RZDJ 2BYVE 2GWRA 2F5CA 1XGOA 4YFXF 4IHTA 1EJ9A 1XS9A 2CRGA 3WGHA 3ZMUA 4CH7A 1HA8A 2F6CA 1WH7A 3LA3A 4V2GA 1PUEE 2RKHA 3S1QJ 4G7HF 1SFKA 3BR5A 4NB5A 1FOXA 4HW0A 2YU3A 1IRGA 4M3GA 3M8FA 3HOZJ 5FROA 2WADA 2NAZA 2H27A 1IF1A 4M6YA 2ZB9A 3CO7C 4IHWA 1D1AA 2KIMA 5K1YA 1OCOH 4HBLA 2QM3A 4UVAA 1MIJA 1YO5C 4I01A 4JQFA 4MFEA 1I5ZA 3RPQA 4IRIA 3CF5F 3KP6A 4CZCA 3VWBA 1KA8A 2F4OB 2ISZA 4II3A 2HVSA 3A0BC 2QYOA 3OV8A 2BEOA 1MH3A 3C3WA 5FD5A 3AG4H 3FXRA 1R23A 1RNLA 3PNTA 4G94A 2X6WA 3E1SA 3LSMA 1F1ZA 3H3UA 3ZQGA 1AKHB 2YX7A 1BBYA 1XMXA 2UXXA 3FWEA 4KUMA 3OR2C 1Z3XA 2BV6A 3W2WA 3OYDA 2DMPA 2A5WA 3K2AA 2X6XA 3LFUA 2K9NA 3RKYA 3E6CC 2ZBKA 4NBQA 3EYIA 2B7EA 5HDKA 3MKZA 2F48A 4HF1A 2R7ZJ 1ZTRA 4A69C 2O61A 2W85A 3HTUA 1IN5A 3WU0A 3LWFA 1UG0A 2VBXA 1I1SA 1VQMI 4AVPA 5F04A 4YIFA 4J00A 1HLVA 3KZIC 2ME0A 1UAAA 4DOZA 1P4WA 2CGPA 1JGSA 3KPHA 1X1PA 4DJAA 2MD5A 1AWCA 5IT9Z 1RPWA 2CUEA 2MH2A 4L9TA 1J75A 1YFHA 3DP7A 3K1NA 2HQNA 2HDWA 4XNFA 5DS9A 1U8BA 2VL8A 1FPQA 3CCLI 4CICA 4PJNA 4XL9A 1NHAA 2FNAA 4BEHB 2JK3A 1S7AA 1H0MA 4CYDA 1KQ0A 4XRMA 2WV1A 1WJ5A 4HRIA 1AOYA 2E19A 4DNCA 4XQFA 3KLNA 5B5EC 2HTJA 2MA3A 3E97A 3DTIA 1ZLJA 4IZZA 4ANJA 4OIRF 1ZLKA 5LRSA 1FBQA 4A3IJ 3E7LA 5DDGA 2NNNA 4P5OA 3QPTA 3DU6A 3OOUA 1WWXA 5FKKA 1G6NA 2TDXA 4HQMA 1D1CA 2FU4A 3I5UA 1BW5A 1WGXA 5F0CA 5F08A 2VKVA 2WAFA 4XN0A 3VYRB 4B3XA 3CCSI 4Y4RA 5DEQA 4B09A 4IHYA 2JMWA 1T38A 3GVAA 3R4KA 5KCMA 5FLMJ 4AIKA 3BR2A 1Z6RA 1KGSA 1YJ9I 1X3UA 5C4JJ 3HC7A 4JP0A 4AIJA 3M8JA 3FHNA 4O6JA 2DJNA 1ON2A 4ZH4F 1N25A 3C2GA 5K7HA 3P9CA 2Y31A 4KT5C 1ETXA 2KISA 5E20A 2EFQA 1X3ZB 3FXUA 4C2MJ 4XIDA 2CV0A 3S32A 3G4SI 2JSCA 2LMDA 5HLIA 1YX3A 5D4SA 1T8IA 4PSWA 1BIAA 2X1EA 3HL2A 4AYBA 2KZGA 1YS7A 2ZXIA 1HSJA 5JLXA 4MIMA 3EETA 1MNMC 3LAJA 1I6XA 3H0GJ 3JRGA 4XOTA 2K3PA 1WJCA 2VBYA 2X1CA 2EV6A 2VIXA 4HDUA 4MTDA 3BQYA 5J1RA 5IYDJ 3HGYA 3GEZA 3OS0A 2J5OA 1JTYA 5BMZA 4A3KJ 4Q4ZF 5DYMA 1LEBA 3ABUA 2GOXB 3M8EA 1KZHA 1P7IA 3ZR8X 1FSHA 3KCCA 1FP1D 3GZNB 4LITA 4BS9A 1HQCA 3MVPA 5K7FA 5CJ9A 1USSA 1FTTA 3B6AA 4RLQA 1VF9A 5HS8A 3H92A 5FRMA 1T0FA 2DN0A 4IPAA 4RS8A 2W57A 1MH4A 2EB7A 4XK4A 2HOTA 1QZYA 2CUZA 2DA7A 3TL4X 1DP7P 2NRAC 3I4NJ 3KP7A 3DCFA 3S3MA 1NK3P 2JZYA 1MJAA 2M7AA 3COAC 1ETYA 3DWLE 4RGRA 4GO1A 2XSJC 3PNYA 2R0QC 2B9SA 5EZGA 3J81Z 2ADUA 1U0JA 2VKDA 4PFPA 2WB1A 3F3XA 4WF2A 1MDMA 3SZTA 5EEHA 2IGOA 4F7ZA 1FMVA 2OTLI 4BKXA 4M9SA 4BJ5C 1ZRFA 2OD5A 4A3DJ 5FKOA 4PSXA 1ZHFA 1IUFA 4RGXA 4LB5A 4GFBA 2P81A 4LMYA 2CFOA 2E5ZA 3H5NA 1SMTA 3U9GA 4YG2F 3WODF 4U87A 3SFIA 2W00A 2GZWA 5J6XA 5FLXK 2QSFX 4NC6A 2DPUA 1XMKA 4LOCA 5EG0A 2GIZA 2HYFA 4MNUA 3G3ZA 1P7JA 1G3YA 2KPMA 1YRNA 1ZR2A 3K2ZA 1QZZA 2JSPA 4RMNA 1MMGA 2Y30A 2O3FA 1F5TA 2NNYA 2EK5A 4L5JA 1UJ8A 1IJWC 2FXAA 3HPHA 3K4BA 4L5EA 4A93J 3R60A 1P92A 2EIJH 2BY1A 2M1BA 2M4KA 3QU6A 2XPVA 3DTEA 3DEWA 1ZH5A 2ZSIB 4ITVA 3SZGA 2CSOA 5CVVA 3CO6C 4YEJA 5KAFC 1LEAA 2COMA 1BR2A 2ZSHB 3OR1C 3QQAA 2MW8A 2BHZA 3C2HA 3O2PE 2H6CA 3E5UA 2XF7A 2IA0A 3BJOA 4LIVA 3AAFA 3CJNA 3BOQA 2DMTA 2ECBA 3FMQA 2HQRA 3G71I 1TT0A 2DOFA 2ZJQF 4J19A 1W36D 4EMSA 3PO3J 3HJEA 3VDXA 2D2WA 2E36A 1SD7A 2H1LA 3U2RA 4CCNA 5J40A 1XPXA 2Q2EB 1O4XA 4BL0B 1R9TJ 3PL8A 3F23A 5GPCA 3SJMA 1TWGJ 1EF4A 3FXLA 2L7KA 3ABMH 2NVTJ 1R5ID 1KU3A 2KZVA 4CHUA 3OS1A 1Z1DA 3DLLF 1LVAA 4DIQA 3MKYB 1JUSA 2VONA 1G3TA 3CUQA 2O0YA 1Z05A 1OYIA 4DGWB 1QGPA 2FBKA 2JPBA 3Q0WA 4GGGA 3W3CA 2QSHX 4LLGF 3DLAA 1IRFA 1XG1A 2PG4A 3UKGA 1IXSB 2IGNA 2XGEA 4BJ6C 2QKMB 4B47A 3HOXJ 1VI0A 4KNYA 3R61A 1FT9A 4JOMA 1AU7A 5JVGF 1QPIA 1ULYA 1HF0A 2XGXA 1G8XA 2FE3A 1BC8C 2KDOA 2WV0A 4F93B 2XV4S 2NS8A 3IL2A 3ZGKA 5DUKA 5GADJ 2FNPA 4A12A 1A04A 2R93J 2K40A 3I56I 1DDNA 4GCVA 4MQVA 4EM0B 3DF8A 2QLZA 4LLLA 3WTWC 4IOAF 2IJLA 1H9GA 1QRYA 1FSEA 1XGNA 3P9IA 2I5UA 4KIFA 1EV7A 2MGQA 5LBQA 3WTYC 2VKEA 2IGKA 5GAHJ 1U6GA 2L54A 5JR3A 1HW5A 2Z5UA 3JRHA 1REPC 3HB9A 3GBGA 1DGWY 1WJBA 4C3HJ 4B48A 3I0TA 3MZHA 3HOVJ 4H0EA 1FOYA 4WCGA 1TQMA 1W7PB 2BVMA 2LVSA 3OSFA 1Q1VA 2ZXJA 2DA6A 1PVEA 2HOSA 4PZJA 4DYCA 3L2RA 2DA4A 4S05A 4OAYA 2EZLA 3J81K 1R1UA 5HNHA 4BU2A 4A5NA 3S3OA 2L0KA 1W5TA 3Q5FA 5M5YJ 4U7DA 4DYRA 5GPAA 1MNEA 3U1KA 3GTOJ 1FTZA 2H8WA 3HHGA 1SFEA 3OYJA 2HVRA 1YX5A 1JT0A 1K7AA 1Z21A 2VC0A 2EH3A 1GHCA 2EZIA 3CZ6A 3OS2A 5D6EA 2ZO4A 3A1YA 1MGTA 2YUSA 1BI2A 1WH5A 4FASD 4PDKA 2XASA 3BTLA 3BZKA 1GXPA 3WTUC 2W4SA 2ZMEA 2VPRA 2Z9OA 3RIRA 2Q0OA 5H6QA 2O03A 4NUBA 4G9YA 1X2MA 4XBFA 3S3NA 1Z0XA 1RUOA 2ESNA 2R5YB 3H3VK 1IG7A 4Y15A 1UZCA 3C18A 3JCUC 3U21A 2WAEA 3WTSC 4WWCA 4B8XA 3ESWB 3HOTA 3HTSB 3DKYA 1QU3A 1DPRA 3CJTB 1K83J 1WJAA 3ZQHA 5D5XB 3LSRA 1JKQC 5KAIC 1UHMA 3MKLA 2L9NA 3KLOA 4R8HA 1JJ6C 1HSTA 1X19A 2X0LA 2G0EA 2KLOA 2IS4A 1YOVB 5CVJA 4BXFA 2EQRA 4KIGA 5E3MA 3FM5A 3RZOJ 2WTEA 2K85A 3GTGJ 1XB4A 2QVOA 3OIOA 2DO7A 2XAGA 2VXDA 3ERMA 4I7HA 4LD5A 1IXCA 3BTIA 2X48A 3TBIA 4QIWN 1LDDA 2NVQJ 2W24A 3KYCB 1MMDA 2IA1A 2VQLA 5M5WJ 1PP7U 1NH3A 3V42A 2V79A 4BHPA 1A31A 1FJLA 2DQRA 3WTVC 4Y33A 4CYCA 2MC4A 2FEZA 1M1EB 1RKTA 3LMMA 3ZQIA 1S29A 3LFKA 1HW2A 3L2QA 3H9GA 4ZDPA 1T33A 1Z7UA 3DBRB 3OYIA 4RGUA 1T56A 5HODA 3PQJA 4NNJA 4FHTA 4L18B 1CQTA 1L0OC 2BY0A 4XN3A 4ESBA 2PMZN 1QQIA 2PJRB 3S8PA 1YE9A 4LG0B 1RKWA 1FIAA 3HOSA 2XB5A 5EGOA 4S04A 3F8BA 4PGHA 3LAPA 5E3OA 3LSJA 1YIJI 1ENHA 1S7OA 2OCEA 1QHHD 2FBIA 2UZKA 1B8IB 4I98B 3U1DA 3FXQA 3R0JA 2ELHA 3SZPA 3OYHA 1LE8B 2X9DA 1S5LC 1EH8A 2LBFA 2JA7J 1EH7A 3EDPA 3V8JA 3HRMA 4IJAA 5BOXA 3I55I 5HDNA 3M9AA 4P9FA 1LKXA 1LDJA 2KMUA 3MWMA 4KJZA 5E8IA 3BCBA 3IC7A 2PFBA 1JJ8C 4MTEA 3OYMA 1IN8A 4BNCA 4W97A 1BOBA 1POGA 2LC2A 4HAMA 2K9LA 4A3LJ 2E71A 4HSRA 3BG9A 1USTA 2XF5A 1J09A 4KN7X 1U2WA 3F21A 1FOKA 1I50J 2EINH 3WGIA 2PMHA 2XVCA 2M8GX 5FD6A 2F5EA 3LSGA 4MEYF 3Q0VA 2LDUA 2QCOA 2XAFA 3REOA 3PQKA 3RTRA 2WY8Q 2HYJA 1B72A 2W82A 4FQGA 5FO5A 3PFYA 3ROUA 3NEUA 5E1ZB 1IRZA 2K7LA 2CQQA 3OIQA 1B9NA 3TOBA 2W48A 4G8XA 1Y8RB 5JFRA 3NRVA 2NS7A 3I64A 2LY9A 5K7ZA 4IVNA 4CSWA 2RDPA 1VQ8I 3ZMVA 1U5TB 5DD8A 2ZKZA 2L3DA 2ZC2A 3LNQA 4NQWA 3K70C 2R7XA 2CW0F 2BW3A 3SEZA 4A0ZA 1YTYA 4H4KC 5LHHA 3F8CA 4RB3C 3CCRI 1MBHA 2RQQA 4F55A 2GLOA 1W7PD 4A0YA 1KU2A 5E17F 3F8NA 4KITB 4GDFA 1L3LA 1R49A 2HPMA 2DPDA 2X51A 2NOJB 4KICA 2AQFA 3C7JA 1IN4A 1SVOA 4EV0A 1XN7A 3OY9A 2COBA 2RVCA 1JGGA 2QBYB 1U5TC 1EH6A 3A03A 2A69F 2WBMA 4FISA 4OIPF 3S15J 4RAGA 3JW4A 3WU1B 2HI3A 3FBIB 1FC3A 1R1VA 2GIVA 2V9KA 2JUGA 3E5QA 3KYDB 4JX5A 3IWFA 2W25A 1UCRA 2QBYA 2RAEA 4ZDOA 1A6QA 2EV0A 2VB6A 3CCEI 4N4NB 1ZG5A 4II2A 1CGPA 3ZMZA 3FF5A 4Y13A 1FY7A 2VQGA 3MKWB 1SFOJ 3L7WA 3H5RA 2X85A 3I59A 2RV8A 4RAFA 5JVTA 2QKLB 3Q3SA 2UV1A 4CCJA 1BI0A 3IV5A 4UB6C 3CJQB 2IGMA 3F6OA 4XORA 2E60A 1RC9A 4BBRJ 3HRUA 2LRDA 1RI7A 1OYWA 3BR6A 2NVXJ 1VQOI 4HNTA 2JRMA 3RKQA 1F9NA 2BY3A 3D5LA 5KNLA 1WQ2A 2Y9YA 5F6FA 3OYKA 1GT0C 5F64A 1QVUA 1Y1VJ 4KMUX 4ESFA 2GA1A 3T8TA 1RR8C 2R3SA 1ETQA 1V54H 4KMFA 4YIIA 2J5PA 3WE2A 3TMOA 4EM1A 3OYNA 1LDKB 2MABA 5D6FA 1BJZA 5ED4A 4N9IA 5E3NA 1JTXA 4TV7A 2P0WA 1YQAA 2R4GA 4OU0A 3ASOH 1WI9A 4DBRA 1WRJA 4CCKA 1ZG1A 3GWZA 4RDUA 3N4MA 4JBAA 3VB2A 2VPLA 2DBBA 5GAEJ 2XAUA 3J7YJ 5L3GA 2BVLA 4X0GA 1R6RA 1WCMJ 4HQEA 3I54A 4BJTA 2HPIA 1MBEA 2LKXA 4L0YB 2YR2A 2VXZA 4GRIA 3JRFA 5ICFA 1SAUA 3HUGA 2OZUA 4I02A 2HOEA 2LBFB 1FIPA 4WXCA 2M3AA 4E4HA 5CVUA 2IPQX 2ICWG 1ZAOA 2HNHA 2DMUA 5L3EA 3CUOA 1TW3A 2CW8A 3QAHA 2DOEA 1Z9CA 3OYBA 2P5LC 3QODA 3BJ6A 2NXNB 1R58A 1GV2A 4L9NA 5HVQC 3TP3A 2DW4A 1OCZH 4E7LA 3PSIA 3QYEA 1G3WA 1O3SA 1HKQA 3NWTA 1B6AA 1FNNA 5IYCJ 2F5VA 3ULQB 1MD0A 3CCYA 4KA4A 1E0EA 5E3LA 5L3FA 2ACJA 1OYYA 3CUQC 4M3DA 3JRBA 2EILH 4U7BA 4UUVA 2L4MA 2L9RA 2R7VA 1VQ5I 5KK1A 3VYUB 1B1BA 3GTMJ 3I9V2 1ETOA 4KN4X 4D1QA 1ETWA 1GVDA 4L9VA 5HDGA 4AM3A 3E6BA 3FIWA 3NWSA 2V1DA 1MKMA 3QRFF 5BNGA 3NARA 2M34A 4PJMA 3IRQA 1VQ9I 3A01A 2W84A 4IHVA 2VOPA 2M5WA 3ZMDA 3OMYA 3P7NA 2MFZA 3EQLF 3KYLA 3PM1A 2Z3YA 5J1YA 1UB9A 3WTZA 4DW6A 1SVMA 1ZG3A 3CESA 1FYLA 3L2VA 1XSXA 1A35A 5DD4A 1YW8A 5H2FC 3BR1A 3CP2A 1Y39A 3M4OJ 3KEOA 4JX6A 2DJIA 1N75A 3CC7I 3K4MA 3F22A 5FJ8J 2L4AA 2K9MA 3ZOBA 2DODA 3ABKH 2ZJRF 2RQPA 2IP2A 3H5AA 4I99C 4XSXF 5HLGA 2R5YA 2GXAA 4EJTA 2UWMA 4W1UA 4I6ZA 2YX4A 3O6BB 2BBYA 2Q8KA 4AVZA 3RI4A 3ECOA 3FISA 5GTHC 1O3TA 2JJ7A 3CDLA 1GV5A 4ZYEA 1G3SA 3UR3C 1H9TA 5ICEA 2V6EA 4CDGA 2ZJPF 3A2KA 1CF7A 5IOZA 1B9MA 2LKPA 3TGNA 3Q9SA 2ME6A 2ETHA 2F5FA 4V19K 4X6AJ 2L7FP 3K0LA 2OUMA 4AU7A 1TTYA 3C2BA 4G7OF 3DPUA 3J7AO 1LFPA 1SD4A 5AONA 5HOOA 3BT9A 1UHSA 4HYEA 3GFMA 4R1HA 2Y48A 2R92J 3IKTA 4BYYA 1HOMA 1W7PA 2ESHA 3E0JB 5A2QZ 2EFPA 1PYVA 2FJ1A 1PUFB 2FUG2 5JHUA 1VNDA 4IQ4A 4A6EA 1VQKI 1J0RA 3VFZA 2Y69H 5DCMA 2QZ8A 1JKRC 5FLVA 2GA2A 2LYCA 2P5KA 1PDNC 4UUTA 2V1NA 2OU2A 4PJLA 1IV8A 2RNGA 4HV6A 3VYTB 1JI8A 3BTJA 1PJRA 4XMYA 2BY2A 2KKOA 3GZ5A 9ANTA 5BQTA 1OMIA 3M7GA 1SEUA 1SVLA 2VBZA 3WE3A 3SEQA 1ZYRF 1SFXA 2V26A 2XKPA 2OC6A 1MBFA 1JUMA 4ZYAA 4D7MA 1QZEA 3RDIA 4BACA 1BM9A 6PAXA 2GOMA 4ENKA 2WAQA 2K27A 3E3VA 3MAJA 4BHBA 4MFDA 4IHXA 3HYIA 4XKCA 4UY8I 2CO5A 5DCMB 3JSPA 1GDTA 3BZCA 4BXXJ 4ZDLA 2CQ7A 1UFMA 1D5YA 3AFHA 3BLYA 4M6XA 3B02A 1C0WA 3J7AY 3JTGA 1S72I 3VODA 3RQ4A 2JA6J 2M45A 4C2UA 1QHGA 1QVTA 1PUFA 1Z91A 3H36A 5D8LB 3T5XA 1GXQA 1K61A 3JAMZ 2DAOA 4PFOA 5D4RA 4AIDA 1X3WB 1W0TA 4IHSA 1S3JA 2F5DA 3CUQB 4HDVA 3MZ8A 4HX8A 3C1DA 2DTRA 2I8DA 1Y1WJ 2NOGA 1P2FA 3GW2A 1VQ4I 1S8NA 3FK7A 3KZYA 1MBJA 1QO0D 3GFLA 1R71A 2HEOA 2A68F 3GCMA 1TQIA 2P6SA 3OYLA 4GYGA 4F52A 4HF2A 2L2OA 2DT6A 1CF7B 4IL6C 1JHFA 3W6JB 3CMEI 4EGZA 4XRSA 2CWEA 4HNUA 1X2NA 2JUCA 2RREA 3CMMA 4CXFA 5FRNA 1LFBA 1ZKGA 2XAQA 5CQGA 1BJAA 2HZDA 3ZMTA 2Y9ZA 4D7NA 2CJJA 5CVRA 2H6BA 3HOUJ 1JKOC 3FK6A 1QPMA 2DI3A 1E17A 1ZRDA 5J47A 1WJEA 4A6DA 5M3FJ 3HBLA 4D0PA 2VKHA 1HW1A 1W5CC 4MLOA 4B1RA 2HU9A 1Q1HA 2JVGA 2K3FA 4HLXA 4BDZA 4F92B 1O57A 4ZC3A 4KT6A 4F3QA 4AYBN 1RRJA 2K4BA 2A61A 4I09A 1LB2A 4E7KA 4CCOA 1YITI 4XM3A 1YRNB 4NHJA 2Y0MA 2DXIA 1T95A 4HEA2 4XKWA 2CW7A 2FSWA 5ICGA 3GMEA 4ZYGA 2L02A 3M07A 4HA8A 3FBNB 2WC2A 4NC8A 4M3EA 4C9YA 2K02A 3FKJA 5EZHA 3TDZC 1HKSA 3LA2A 2KIUA 4K2EA 1EA3A 1GVJA 2WA0A 4BE0A 1U9NA 5BS6A 3A01B 2PMUA 1Y56A 2AHQA 1XSDA 1YW9A 2HQ5A 1XMAA 3JAMK 2VODA 2CV1A 1R00A 3CP8A 2STWA 3M3YJ 3ZN0A 2Z2SB 3DKWA 5GP9A 3HRTA 1BOAA 2E1MC 4QWQA 1WZ2A 2M0CA 3FXMA 4XKVA 5TGTA 5M5XJ 4XLPF 2JA8J 2DDBA 1MDMB 1ZRCA 4CA0A 1FX7A 2OF7A 3FXJA 1V55H 3BCAA 3GUDA 1HBXG 1IGNA 3HKZN 5J3LA 3BG5A 3DXJF 4ENNA 2BE5F 2YU9J 3S14J 1W5SA 3BY6A 5IPAA 3GLLA 2OPTA 4EJUA 1RUNA 1JE8A 2OQGA 4BXUA 4ENJA 2R7DA 2HGCA 3GTLJ 2QUFA 3BDDA 4Y7NJ 2DK8A 1FYKA 4RGSA 2OQRA 3ELKA 3GFJA 3RYPA 3OYGA 3A02A 3QOPA 1O3RA 1T08B 1XGMA 2JT1A 1KYWA 3CCMI 3S16J 1VQ6I 4XONA 4XLAA 5LD2C 4RAZA 1TWCJ 2XIGA 2YSRA 3D5SC 3EUHA 1E3OC
chains in the Genus database with same CATH topology
3J80K 3S2WA 1U3EM 3MZYA 3MCZA 1PP8F 2QWWA 1FZPB 1BI3A 1KU9A 1D5VA 1IN7A 1XDSA 2AS5F 3QU3A 1SD6A 3EYYA 2ZJ2A 5ILVA 1T39A 1O7FA 1ODDA 4IRHA 5IT3A 3K69A 3LA7A 1TBXA 4UXNA 3VOEA 4OIQF 4EJOA 2LF7A 3SHFA 5L3DA 3TKYA 2ZFWA 4E70A 5E18F 3K1MA 3ERED 3P9KA 2VC1A 1FWZA 3ZN1A 1YS6A 2VOOA 1JHHA 1SFUA 3O3KA 2DU9A 2XUBA 2FF4A 5TJJA 2QENA 3I59B 5L3CA 2RGVA 3KP4A 2VE9A 2RNJA 2DT5A 1YIOA 3HRSA 1R5GA 1TQPA 1JXSA 3CTAA 1ON1A 2FMYA 5F1RA 3WTXC 5LLQA 5TRDA 2MBFA 4MQ9F 2OAZA 3TO7A 4ZYHA 1R5HA 2EFOA 2M30A 1T6SA 1P6RA 3IHUA 1R1TA 5J8CA 3QP6A 2OA4A 2E7WA 3T1BA 2DFIA 3E6DA 2K86A 3GFIA 5DCFA 5JI6A 2AXLA 4M9XA 1D3YA 4OIOF 1U5TA 2WWYA 2VE8A 2ZNYA 3KP2A 2BGCA 3D0SA 4WX9A 3T0YA 4BHCA 3ZMSA 2VT3A 3MEXA 3KFWX 1IUYA 3GXOA 3HIFA 2A6EF 3FZVA 4EVIA 4UNOA 5D5VB 4LFUA 4N9HA 1RIOH 4Q48A 3DQVC 4EJWA 3KEQA 5LRRA 2GXGA 3F8MA 5AIPA 2PEXA 2PJPA 3GYHX 1R36A 1D8JA 1B4AA 3RPUA 1BI1A 1P4AA 4XLNF 5ILSA 3TDUC 4GXOA 1KQ9A 3V7CA 1J59A 4FT8A 4KDPA 4UHTA 2MH9A 3LQRA 2LNBA 4ZZLA 2HZTA 2P8TA 1J5YA 4I0AA 1G4DA 2X4HA 5CYVA 2XKOA 3NQOA 4FX4A 5HS7A 2KJBA 5H6RA 5LHIA 1F4KA 5CVIA 1ZGAA 4LG0A 2EV5A 2HTSA 3BPXA 3L2CA 2FA5A 2MC3A 1E2XA 4O3MA 3ABTA 4HLYA 3B73A 4M71A 3HSRA 3QPHA 1Y0UA 4G6QA 2FOKA 2KIFA 3WGGA 2NS0A 3E6MA 4MEXF 4QLCU 1V3FA 1KU7A 1XCBA 1IXRC 2VT2A 2EFNA 2HWVA 3BJAA 5LGUA 4YFNF 3KP5A 2HR3A 5FGMA 2IT0A 3FHZA 1I27A 4IRGA 5DUIA 1SMYF 2MLGA 1IW7F 2DLLA 3IWZA 2V9VA 2XRNA 2IW5A 1D8KA 1MJBA 1BC7C 1HKTA 4UV9A 2CYYA 1QBJA 2ZMEB 2GXBA 4HZFA 4AWXB 4OMZA 1WKMA 1XCVA 4BH9A 1R22A 1ONVA 2B0LA 4U0WA 2EFWA 2HYGD 1BN5A 2IRFG 5LGNA 3GZ6A 4N0BA 4ASNA 3BROA 1ZN2A 2GQQA 3I71A 3TO9A 1U8RA 2FMLA 3JTHA 4CO8A 2FBHA 1TNTA 3KETA 2PLYA 1ZREA 5L3BA 2PI0A 2IA2A 4MGRA 4P55A 2LF8A 1YYVA 4XSZF 1YG2A 2P4WA 4M9ZA 3RKXA 4M73A 5FB2A 1K79A 3DEUA 3BP8A 4A0XA 3F72A 4WXDA 3FM3A 5E1XA 3VEPA 1LQ1A 1S6LA 1SAXA 3T8RA 2XHKA 1KYZA 2NYXA 3Q9VA 1K78A 3GO5A 4HV5A 4M74A 2KJCA 4RAYA 3K9TA 5K5QA 4OMYA 2V6CA 3SQNA 4P9UA 3CDHA 5D5UB 3G73A 2O6GE 3ECHA 4Q47A 1FBSA 4ZZDA 2GAUA 5FLXZ 2JRTA 4RB0A 3GLXA 3RYRA 4LGWA 4Q5SF 2DK5A 2PN6A 5FFXA 2HKXA 3ZQ7A 4GYIA 4HF0A 4U0VA 1OPCA 2Q2EA 1XD7A 5LEKA 2EJRA 3I58A 3RJPA 5CLSA 4ESJA 1FLIA 4UVCA 1SD5A 5K5RA 2ZCWA 5ICCA 2P6TA 2PBIA 4EJVA 1XSVA 3ML6A 1XGSA 4MHGA 3SFZA 4AIHA 2HKOA 5AIQA 2HDCA 1R7JA 2F2EA 3KZZA 3JSOA 3ZP5A 4L0ZB 2Z99A 2Y75A 2XAHA 1U78A 3TQNA 1QNTA 3FX3A 1ZARA 3BPVA 5K5OA 3W6KB 5E1WA 3LSTA 4PCQA 5HLHA 4HX7A 3WG9A 4BAYA 4LK1F 5BPDA 1WSUA 2O8XA 3L09A 2IVMA 4G7ZF 3E5XA 4L9JA 3I53A 4PGGA 3H3ZA 2EA2A 1TNSA 2H94A 3MFKA 1T2KA 2G7UA 1B59A 1DUXC 2CQKA 2VBWA 2V1XA 2DQLA 4RB1A 3LQQA 2PQ8A 4L5IA 2P7VB 3SXYA 1FP2A 5DV5A 3DPTA 4WK8F 3J80Z 1HXDA 3KP3A 4ZYDA 4FX0A 4JK1X 4R79A 4I0BA 4EQQA 3ISPA 5FFZA 2FRHA 2RC4A 4EM2A 3R6SA 3BWGA 2UXNA 4O5VA 3RKWA 1LNWA 2YPRA 1KQ8A 1TW2A 1FYMA 5D8KB 2MLKA 2A5YB 3QP5A 4IF4A 4OINF 1J9IA 5LEJA 2G7HA 2H09A 2OZ6A 4UV8A 2ZNZA 3GF2A 1UHWA 1W4MA 1LJ9A 1ZGJA 1RZ4A 2XAJA 3OOPA 4LJZF 2P7CB 4LK0F 1K78B 5ERIA 2QQAA 2KRFA 3N97A 2JPCA 4HX4A 1K6OA 4LLNA 3DPLC 2ISYA 2M87A 4CZZA 4HOBA 5EEGA 5BPIA 3WTTC 4KFCA 1YLFA 1P4XA 4ON0A 1I1GA 2D1HA 5D5WB 4IXAA 4P96A 2E7XA 3V7RA 2A6HF 1O3QA 1IAWA 1XDUA 4KIBA 2V1UA 3L9FA 3FMSA 4XRFA 2CFXA 2L01A 1TLHB 3HHHA 4AD9A 2OBPA 5H20A 3TOAA 2P5VA 3R0AA 1O7LA 4UVBA 3K1PA 5IT9K 1DPUA 1IZ1A 2EWNA 2STTA 1OR7A 4M72A 4I2OA 2K4JA 3TO6A 3BZ6A 3IKVA 4YFKF 4A2UA 5LHGA 2R7FA 1OKRA 3F6VA 5A2QK 2G9WA 1BIBA 3V7SA 1MJ9A 4CGZA 3PFIA 1IN6A 4BQAA 3DFGA 1MZBA 2E1CA 3V8LA 4DQ2A 1FBUA 3CLOA 2RN7A 2XROA 3V8KA 4Y17A 2JTVA 4ETSA 2CG4A 3DV8A 1STZA 4EGYA 2HS5A 1J2XA 2Z33A 3M1EA 2D45A 2M8EA 1V4RA 2D1VA 2LSOA 3ZPLA 3F8FA 1Z6TA 5LGTA 3MQ0A 5KVRA 1J7KA 4A5MA 3V4GA 2FQ3A 2E1NA 3L00A 3HSFA 3IRRA 2HFHA 1T98A 4RB2C 1VTNC 5HS9A 3I4PA 2VN2A 1YW7A 4KYWA 5J8FA 2EA4A 5ILUA 4U88A 2C6YA 4WXHA 2A3SA 3KE2A 4LB6B 5E8GA 3HSEA 4G6DA 4OOIA 4ENMA 3GX4X 4U0YA 4Z2YA 2A07F 2QQBA 2QQ9A 3FMRA 2BYVE 2GWRA 2F5CA 1XGOA 4YFXF 4IHTA 3WGHA 3ZMUA 3LA3A 1PUEE 2RKHA 4G7HF 4NB5A 4HW0A 2YU3A 1IRGA 3M8FA 2NAZA 2H27A 1IF1A 4M6YA 3CO7C 2KIMA 5K1YA 4HBLA 2QM3A 4UVAA 1YO5C 4I01A 4JQFA 1I5ZA 3RPQA 4IRIA 3KP6A 1KA8A 2ISZA 2QYOA 3OV8A 2BEOA 5FD5A 3C3WA 3FXRA 1R23A 1RNLA 4G94A 1F1ZA 3H3UA 2YX7A 1BBYA 2UXXA 3FWEA 4KUMA 2BV6A 3RKYA 3E6CC 2ZBKA 3EYIA 5HDKA 4HF1A 2O61A 2W85A 3HTUA 1IN5A 3WU0A 3LWFA 2VBXA 1I1SA 4AVPA 4YIFA 1P4WA 2CGPA 1JGSA 2MD5A 1AWCA 5IT9Z 2MH2A 4L9TA 1J75A 1YFHA 3DP7A 3K1NA 2HQNA 1FPQA 4CICA 1NHAA 2FNAA 1S7AA 1H0MA 4CYDA 1KQ0A 1AOYA 4DNCA 3KLNA 2HTJA 2MA3A 3E97A 1ZLJA 4OIRF 1ZLKA 5LRSA 1FBQA 5DDGA 2NNNA 4P5OA 3QPTA 1WWXA 1G6NA 2TDXA 4HQMA 2FU4A 3I5UA 5DEQA 4B09A 1T38A 3GVAA 3R4KA 4AIKA 1Z6RA 1KGSA 1X3UA 4AIJA 4O6JA 1ON2A 4ZH4F 3P9CA 4KT5C 5E20A 2EFQA 3FXUA 2JSCA 5HLIA 5D4SA 1BIAA 1YS7A 1HSJA 3EETA 3LAJA 1I6XA 2VBYA 2EV6A 4HDUA 4MTDA 3GEZA 2J5OA 5BMZA 4Q4ZF 5DYMA 1LEBA 3ABUA 3M8EA 1FSHA 3KCCA 1FP1D 1HQCA 5CJ9A 1USSA 5HS8A 3H92A 1T0FA 4IPAA 4RS8A 2W57A 2EB7A 1QZYA 1DP7P 2NRAC 3KP7A 2JZYA 1MJAA 3COAC 4RGRA 4GO1A 3J81Z 2ADUA 3F3XA 4WF2A 1MDMA 3SZTA 5EEHA 4F7ZA 4M9SA 1ZRFA 2OD5A 1ZHFA 4RGXA 4LB5A 4LMYA 1SMTA 3U9GA 4YG2F 3WODF 2GZWA 5J6XA 5FLXK 2DPUA 1XMKA 2HYFA 4MNUA 3G3ZA 1G3YA 3K2ZA 1QZZA 2O3FA 1F5TA 2NNYA 2EK5A 4L5JA 2FXAA 3R60A 1P92A 3QU6A 2M1BA 1ZH5A 2CSOA 5CVVA 3CO6C 1LEAA 2COMA 3O2PE 2H6CA 3E5UA 2IA0A 3BJOA 3AAFA 3CJNA 3BOQA 3FMQA 2HQRA 4EMSA 2D2WA 1SD7A 3U2RA 3F23A 1KU3A 4CHUA 1Z1DA 1LVAA 2VONA 1G3TA 3CUQA 2O0YA 1Z05A 1OYIA 1QGPA 2FBKA 2JPBA 4GGGA 4LLGF 1IRFA 2PG4A 1IXSB 4KNYA 3R61A 1FT9A 1ULYA 2XGXA 2FE3A 1BC8C 2WV0A 2XV4S 3IL2A 5DUKA 2FNPA 4A12A 1A04A 1DDNA 4GCVA 4MQVA 4EM0B 3WTWC 3DF8A 2QLZA 4LLLA 2IJLA 1H9GA 1FSEA 1XGNA 3P9IA 4KIFA 1EV7A 5LBQA 3WTYC 1U6GA 2L54A 5JR3A 1HW5A 2Z5UA 1REPC 3I0TA 3MZHA 4H0EA 4WCGA 1TQMA 1W7PB 2ZXJA 4PZJA 4S05A 3J81K 1R1UA 4A5NA 1W5TA 3Q5FA 4U7DA 3HHGA 1SFEA 1K7AA 2VC0A 1GHCA 5D6EA 2ZO4A 1MGTA 1BI2A 4PDKA 2XASA 1GXPA 3WTUC 2ZMEA 2Z9OA 3RIRA 2Q0OA 5H6QA 2O03A 4G9YA 4XBFA 1RUOA 2ESNA 4Y15A 3C18A 3WTSC 3HTSB 4B8XA 3HOTA 4WWCA 1DPRA 5D5XB 1UHMA 3KLOA 4R8HA 1HSTA 2X0LA 5CVJA 4KIGA 3FM5A 2WTEA 1XB4A 2QVOA 2DO7A 2XAGA 4I7HA 4LD5A 1IXCA 1LDDA 2W24A 2IA1A 1PP7U 2V79A 4BHPA 2DQRA 3WTVC 1HW2A 2FEZA 1S29A 3LFKA 1Z7UA 4RGUA 3PQJA 4L18B 4FHTA 1L0OC 4ESBA 1QQIA 4LG0B 3HOSA 4S04A 3F8BA 4PGHA 3LAPA 1S7OA 2FBIA 2UZKA 4I98B 3U1DA 3FXQA 3R0JA 2ELHA 3SZPA 1EH8A 1EH7A 3EDPA 3V8JA 3HRMA 4IJAA 5BOXA 5HDNA 3M9AA 4P9FA 1LDJA 3MWMA 5E8IA 3IC7A 2PFBA 4BNCA 4MTEA 1IN8A 4HAMA 1USTA 4KN7X 1U2WA 3F21A 1FOKA 3WGIA 2PMHA 2XVCA 5FD6A 2F5EA 4MEYF 2LDUA 2XAFA 3REOA 3PQKA 3RTRA 5FO5A 3ROUA 3NEUA 5E1ZB 2K7LA 1B9NA 3TOBA 4G8XA 5JFRA 3NRVA 3I64A 4IVNA 2RDPA 3ZMVA 1U5TB 5DD8A 2ZKZA 2L3DA 4NQWA 2CW0F 4A0ZA 1YTYA 5LHHA 3F8CA 4RB3C 1W7PD 4A0YA 1KU2A 5E17F 3F8NA 1L3LA 2DPDA 4KICA 3C7JA 1IN4A 4EV0A 1XN7A 2RVCA 2QBYB 1U5TC 1EH6A 4OIPF 2A69F 3WU1B 3JW4A 3E5QA 1FC3A 1R1VA 2GIVA 3IWFA 2W25A 1UCRA 2QBYA 2EV0A 1ZG5A 1CGPA 3ZMZA 3FF5A 4Y13A 1FY7A 3L7WA 3I59A 2RV8A 5JVTA 1BI0A 3F6OA 3HRUA 1RI7A 1OYWA 1F9NA 3D5LA 1WQ2A 5F6FA 5F64A 4KMUX 4ESFA 2GA1A 3T8TA 2R3SA 4KMFA 4YIIA 2J5PA 3WE2A 4EM1A 1LDKB 5D6FA 5ED4A 4N9IA 4TV7A 1YQAA 4OU0A 1WI9A 1WRJA 1ZG1A 3GWZA 3N4MA 4JBAA 3VB2A 2DBBA 5L3GA 4HQEA 3I54A 4L0YB 2YR2A 2VXZA 5ICFA 3HUGA 2OZUA 4I02A 2HOEA 4WXCA 5CVUA 2IPQX 1ZAOA 5L3EA 3CUOA 1TW3A 3QAHA 1Z9CA 2P5LC 3BJ6A 1R58A 4L9NA 5HVQC 2DW4A 1G3WA 1O3SA 1HKQA 1B6AA 1FNNA 3ULQB 1MD0A 4KA4A 5L3FA 2ACJA 1OYYA 3CUQC 4U7BA 4UUVA 2L4MA 5KK1A 1B1BA 4KN4X 4L9VA 5HDGA 3E6BA 2V1DA 1MKMA 3QRFF 3IRQA 2W84A 2VOPA 2M5WA 3ZMDA 3P7NA 3EQLF 2Z3YA 1UB9A 3WTZA 1ZG3A 1FYLA 1XSXA 5DD4A 1YW8A 3KEOA 3F22A 2L4AA 2RQPA 2IP2A 4XSXF 5HLGA 4EJTA 2UWMA 2YX4A 3O6BB 2BBYA 2Q8KA 3RI4A 3ECOA 1O3TA 4ZYEA 1G3SA 1H9TA 5ICEA 4CDGA 1CF7A 1B9MA 2LKPA 3TGNA 3Q9SA 2ETHA 2F5FA 3K0LA 1TTYA 4G7OF 3J7AO 1SD4A 5AONA 5HOOA 4HYEA 3GFMA 4R1HA 2Y48A 3IKTA 4BYYA 1W7PA 2ESHA 5A2QZ 2EFPA 5JHUA 4A6EA 1J0RA 3VFZA 5DCMA 2QZ8A 2GA2A 2P5KA 1PDNC 2OU2A 4HV6A 2KKOA 3GZ5A 5BQTA 1OMIA 3M7GA 2VBZA 3WE3A 1ZYRF 1SFXA 2XKPA 3RDIA 1BM9A 6PAXA 4ENKA 2K27A 3E3VA 3MAJA 4BHBA 3HYIA 2CO5A 5DCMB 3JSPA 1UFMA 4M6XA 3B02A 1C0WA 3JTGA 3VODA 2M45A 1Z91A 5D8LB 3T5XA 1GXQA 3JAMZ 2DAOA 5D4RA 4IHSA 1S3JA 2F5DA 3CUQB 4HDVA 4HX8A 3C1DA 2DTRA 1P2FA 3GW2A 1S8NA 3KZYA 1QO0D 3GFLA 2HEOA 2A68F 1TQIA 2P6SA 4GYGA 4HF2A 1CF7B 1JHFA 3W6JB 4EGZA 2CWEA 4CXFA 2XAQA 1BJAA 3ZMTA 5CVRA 2H6BA 1QPMA 2DI3A 1E17A 1ZRDA 4A6DA 4D0PA 1HW1A 1Q1HA 4HLXA 1O57A 2K4BA 2A61A 4I09A 1LB2A 4NHJA 2Y0MA 2FSWA 5ICGA 4ZYGA 2L02A 4HA8A 2WC2A 2K02A 3TDZC 1HKSA 3LA2A 2KIUA 4K2EA 1GVJA 5BS6A 2PMUA 1XSDA 1YW9A 1XMAA 3JAMK 2VODA 1R00A 2STWA 3ZN0A 3DKWA 3HRTA 1BOAA 4QWQA 4XLPF 1MDMB 1ZRCA 1FX7A 3GUDA 1HBXG 3DXJF 4ENNA 2BE5F 1W5SA 3BY6A 4EJUA 1RUNA 1JE8A 2OQGA 4BXUA 4ENJA 2R7DA 2HGCA 2QUFA 3BDDA 1FYKA 2DK8A 4RGSA 2OQRA 3ELKA 3GFJA 3RYPA 3QOPA 1O3RA 1XGMA 2JT1A 1KYWA 4RAZA 2XIGA 2YSRA 3EUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 K;  3S2W A;  1U3E M;  3MZY A;  3MCZ A;  1PP8 F;  2QWW A;  1FZP B;  1BI3 A;  1KU9 A;  1D5V A;  1IN7 A;  1XDS A;  2AS5 F;  3QU3 A;  1SD6 A;  3EYY A;  2ZJ2 A;  5ILV A;  1T39 A;  1O7F A;  1ODD A;  4IRH A;  5IT3 A;  3K69 A;  3LA7 A;  1TBX A;  4UXN A;  3VOE A;  4OIQ F;  4EJO A;  2LF7 A;  3SHF A;  5L3D A;  3TKY A;  2ZFW A;  4E70 A;  5E18 F;  3K1M A;  3ERE D;  3P9K A;  2VC1 A;  1FWZ A;  3ZN1 A;  1YS6 A;  2VOO A;  1JHH A;  1SFU A;  3O3K A;  2DU9 A;  2XUB A;  2FF4 A;  5TJJ A;  2QEN A;  3I59 B;  5L3C A;  2RGV A;  3KP4 A;  2VE9 A;  2RNJ A;  2DT5 A;  1YIO A;  3HRS A;  1R5G A;  1TQP A;  1JXS A;  3CTA A;  1ON1 A;  2FMY A;  5F1R A;  3WTX C;  5LLQ A;  5TRD A;  2MBF A;  4MQ9 F;  2OAZ A;  3TO7 A;  4ZYH A;  1R5H A;  2EFO A;  2M30 A;  1T6S A;  1P6R A;  3IHU A;  1R1T A;  5J8C A;  3QP6 A;  2OA4 A;  2E7W A;  3T1B A;  2DFI A;  3E6D A;  2K86 A;  3GFI A;  5DCF A;  5JI6 A;  2AXL A;  4M9X A;  1D3Y A;  4OIO F;  1U5T A;  2WWY A;  2VE8 A;  2ZNY A;  3KP2 A;  2BGC A;  3D0S A;  4WX9 A;  3T0Y A;  4BHC A;  3ZMS A;  2VT3 A;  3MEX A;  3KFW X;  1IUY A;  3GXO A;  3HIF A;  2A6E F;  3FZV A;  4EVI A;  4UNO A;  5D5V B;  4LFU A;  4N9H A;  1RIO H;  4Q48 A;  3DQV C;  4EJW A;  3KEQ A;  5LRR A;  2GXG A;  3F8M A;  5AIP A;  2PEX A;  2PJP A;  3GYH X;  1R36 A;  1D8J A;  1B4A A;  3RPU A;  1BI1 A;  1P4A A;  4XLN F;  5ILS A;  3TDU C;  4GXO A;  1KQ9 A;  3V7C A;  1J59 A;  4FT8 A;  4KDP A;  4UHT A;  2MH9 A;  3LQR A;  2LNB A;  4ZZL A;  2HZT A;  2P8T A;  1J5Y A;  4I0A A;  1G4D A;  2X4H A;  5CYV A;  2XKO A;  3NQO A;  4FX4 A;  5HS7 A;  2KJB A;  5H6R A;  5LHI A;  1F4K A;  5CVI A;  1ZGA A;  4LG0 A;  2EV5 A;  2HTS A;  3BPX A;  3L2C A;  2FA5 A;  2MC3 A;  1E2X A;  4O3M A;  3ABT A;  4HLY A;  3B73 A;  4M71 A;  3HSR A;  3QPH A;  1Y0U A;  4G6Q A;  2FOK A;  2KIF A;  3WGG A;  2NS0 A;  3E6M A;  4MEX F;  4QLC U;  1V3F A;  1KU7 A;  1XCB A;  1IXR C;  2VT2 A;  2EFN A;  2HWV A;  3BJA A;  5LGU A;  4YFN F;  3KP5 A;  2HR3 A;  5FGM A;  2IT0 A;  3FHZ A;  1I27 A;  4IRG A;  5DUI A;  1SMY F;  2MLG A;  1IW7 F;  2DLL A;  3IWZ A;  2V9V A;  2XRN A;  2IW5 A;  1D8K A;  1MJB A;  1BC7 C;  1HKT A;  4UV9 A;  2CYY A;  1QBJ A;  2ZME B;  2GXB A;  4HZF A;  4AWX B;  4OMZ A;  1WKM A;  1XCV A;  4BH9 A;  1R22 A;  1ONV A;  2B0L A;  4U0W A;  2EFW A;  2HYG D;  1BN5 A;  2IRF G;  5LGN A;  3GZ6 A;  4N0B A;  4ASN A;  3BRO A;  1ZN2 A;  2GQQ A;  3I71 A;  3TO9 A;  1U8R A;  2FML A;  3JTH A;  4CO8 A;  2FBH A;  1TNT A;  3KET A;  2PLY A;  1ZRE A;  5L3B A;  2PI0 A;  2IA2 A;  4MGR A;  4P55 A;  2LF8 A;  1YYV A;  4XSZ F;  1YG2 A;  2P4W A;  4M9Z A;  3RKX A;  4M73 A;  5FB2 A;  1K79 A;  3DEU A;  3BP8 A;  4A0X A;  3F72 A;  4WXD A;  3FM3 A;  5E1X A;  3VEP A;  1LQ1 A;  1S6L A;  1SAX A;  3T8R A;  2XHK A;  1KYZ A;  2NYX A;  3Q9V A;  1K78 A;  3GO5 A;  4HV5 A;  4M74 A;  2KJC A;  4RAY A;  3K9T A;  5K5Q A;  4OMY A;  2V6C A;  3SQN A;  4P9U A;  3CDH A;  5D5U B;  3G73 A;  2O6G E;  3ECH A;  4Q47 A;  1FBS A;  4ZZD A;  2GAU A;  5FLX Z;  2JRT A;  4RB0 A;  3GLX A;  3RYR A;  4LGW A;  4Q5S F;  2DK5 A;  2PN6 A;  5FFX A;  2HKX A;  3ZQ7 A;  4GYI A;  4HF0 A;  4U0V A;  1OPC A;  2Q2E A;  1XD7 A;  5LEK A;  2EJR A;  3I58 A;  3RJP A;  5CLS A;  4ESJ A;  1FLI A;  4UVC A;  1SD5 A;  5K5R A;  2ZCW A;  5ICC A;  2P6T A;  2PBI A;  4EJV A;  1XSV A;  3ML6 A;  1XGS A;  4MHG A;  3SFZ A;  4AIH A;  2HKO A;  5AIQ A;  2HDC A;  1R7J A;  2F2E A;  3KZZ A;  3JSO A;  3ZP5 A;  4L0Z B;  2Z99 A;  2Y75 A;  2XAH A;  1U78 A;  3TQN A;  1QNT A;  3FX3 A;  1ZAR A;  3BPV A;  5K5O A;  3W6K B;  5E1W A;  3LST A;  4PCQ A;  5HLH A;  4HX7 A;  3WG9 A;  4BAY A;  4LK1 F;  5BPD A;  1WSU A;  2O8X A;  3L09 A;  2IVM A;  4G7Z F;  3E5X A;  4L9J A;  3I53 A;  4PGG A;  3H3Z A;  2EA2 A;  1TNS A;  2H94 A;  3MFK A;  1T2K A;  2G7U A;  1B59 A;  1DUX C;  2CQK A;  2VBW A;  2V1X A;  2DQL A;  4RB1 A;  3LQQ A;  2PQ8 A;  4L5I A;  2P7V B;  3SXY A;  1FP2 A;  5DV5 A;  3DPT A;  4WK8 F;  3J80 Z;  1HXD A;  3KP3 A;  4ZYD A;  4FX0 A;  4JK1 X;  4R79 A;  4I0B A;  4EQQ A;  3ISP A;  5FFZ A;  2FRH A;  2RC4 A;  4EM2 A;  3R6S A;  3BWG A;  2UXN A;  4O5V A;  3RKW A;  1LNW A;  2YPR A;  1KQ8 A;  1TW2 A;  1FYM A;  5D8K B;  2MLK A;  2A5Y B;  3QP5 A;  4IF4 A;  4OIN F;  1J9I A;  5LEJ A;  2G7H A;  2H09 A;  2OZ6 A;  4UV8 A;  2ZNZ A;  3GF2 A;  1UHW A;  1W4M A;  1LJ9 A;  1ZGJ A;  1RZ4 A;  2XAJ A;  3OOP A;  4LJZ F;  2P7C B;  4LK0 F;  1K78 B;  5ERI A;  2QQA A;  2KRF A;  3N97 A;  2JPC A;  4HX4 A;  1K6O A;  4LLN A;  3DPL C;  2ISY A;  2M87 A;  4CZZ A;  4HOB A;  5EEG A;  5BPI A;  3WTT C;  4KFC A;  1YLF A;  1P4X A;  4ON0 A;  1I1G A;  2D1H A;  5D5W B;  4IXA A;  4P96 A;  2E7X A;  3V7R A;  2A6H F;  1O3Q A;  1IAW A;  1XDU A;  4KIB A;  2V1U A;  3L9F A;  3FMS A;  4XRF A;  2CFX A;  2L01 A;  1TLH B;  3HHH A;  4AD9 A;  2OBP A;  5H20 A;  3TOA A;  2P5V A;  3R0A A;  1O7L A;  4UVB A;  3K1P A;  5IT9 K;  1DPU A;  1IZ1 A;  2EWN A;  2STT A;  1OR7 A;  4M72 A;  4I2O A;  2K4J A;  3TO6 A;  3BZ6 A;  3IKV A;  4YFK F;  4A2U A;  5LHG A;  2R7F A;  1OKR A;  3F6V A;  5A2Q K;  2G9W A;  1BIB A;  3V7S A;  1MJ9 A;  4CGZ A;  3PFI A;  1IN6 A;  4BQA A;  3DFG A;  1MZB A;  2E1C A;  3V8L A;  4DQ2 A;  1FBU A;  3CLO A;  2RN7 A;  2XRO A;  3V8K A;  4Y17 A;  2JTV A;  4ETS A;  2CG4 A;  3DV8 A;  1STZ A;  4EGY A;  2HS5 A;  1J2X A;  2Z33 A;  3M1E A;  2D45 A;  2M8E A;  1V4R A;  2D1V A;  2LSO A;  3ZPL A;  3F8F A;  1Z6T A;  5LGT A;  3MQ0 A;  5KVR A;  1J7K A;  4A5M A;  3V4G A;  2FQ3 A;  2E1N A;  3L00 A;  3HSF A;  3IRR A;  2HFH A;  1T98 A;  4RB2 C;  1VTN C;  5HS9 A;  3I4P A;  2VN2 A;  1YW7 A;  4KYW A;  5J8F A;  2EA4 A;  5ILU A;  4U88 A;  2C6Y A;  4WXH A;  2A3S A;  3KE2 A;  4LB6 B;  5E8G A;  3HSE A;  4G6D A;  4OOI A;  4ENM A;  3GX4 X;  4U0Y A;  4Z2Y A;  2A07 F;  2QQB A;  2QQ9 A;  3FMR A;  2BYV E;  2GWR A;  2F5C A;  1XGO A;  4YFX F;  4IHT A;  3WGH A;  3ZMU A;  3LA3 A;  1PUE E;  2RKH A;  4G7H F;  4NB5 A;  4HW0 A;  2YU3 A;  1IRG A;  3M8F A;  2NAZ A;  2H27 A;  1IF1 A;  4M6Y A;  3CO7 C;  2KIM A;  5K1Y A;  4HBL A;  2QM3 A;  4UVA A;  1YO5 C;  4I01 A;  4JQF A;  1I5Z A;  3RPQ A;  4IRI A;  3KP6 A;  1KA8 A;  2ISZ A;  2QYO A;  3OV8 A;  2BEO A;  5FD5 A;  3C3W A;  3FXR A;  1R23 A;  1RNL A;  4G94 A;  1F1Z A;  3H3U A;  2YX7 A;  1BBY A;  2UXX A;  3FWE A;  4KUM A;  2BV6 A;  3RKY A;  3E6C C;  2ZBK A;  3EYI A;  5HDK A;  4HF1 A;  2O61 A;  2W85 A;  3HTU A;  1IN5 A;  3WU0 A;  3LWF A;  2VBX A;  1I1S A;  4AVP A;  4YIF A;  1P4W A;  2CGP A;  1JGS A;  2MD5 A;  1AWC A;  5IT9 Z;  2MH2 A;  4L9T A;  1J75 A;  1YFH A;  3DP7 A;  3K1N A;  2HQN A;  1FPQ A;  4CIC A;  1NHA A;  2FNA A;  1S7A A;  1H0M A;  4CYD A;  1KQ0 A;  1AOY A;  4DNC A;  3KLN A;  2HTJ A;  2MA3 A;  3E97 A;  1ZLJ A;  4OIR F;  1ZLK A;  5LRS A;  1FBQ A;  5DDG A;  2NNN A;  4P5O A;  3QPT A;  1WWX A;  1G6N A;  2TDX A;  4HQM A;  2FU4 A;  3I5U A;  5DEQ A;  4B09 A;  1T38 A;  3GVA A;  3R4K A;  4AIK A;  1Z6R A;  1KGS A;  1X3U A;  4AIJ A;  4O6J A;  1ON2 A;  4ZH4 F;  3P9C A;  4KT5 C;  5E20 A;  2EFQ A;  3FXU A;  2JSC A;  5HLI A;  5D4S A;  1BIA A;  1YS7 A;  1HSJ A;  3EET A;  3LAJ A;  1I6X A;  2VBY A;  2EV6 A;  4HDU A;  4MTD A;  3GEZ A;  2J5O A;  5BMZ A;  4Q4Z F;  5DYM A;  1LEB A;  3ABU A;  3M8E A;  1FSH A;  3KCC A;  1FP1 D;  1HQC A;  5CJ9 A;  1USS A;  5HS8 A;  3H92 A;  1T0F A;  4IPA A;  4RS8 A;  2W57 A;  2EB7 A;  1QZY A;  1DP7 P;  2NRA C;  3KP7 A;  2JZY A;  1MJA A;  3COA C;  4RGR A;  4GO1 A;  3J81 Z;  2ADU A;  3F3X A;  4WF2 A;  1MDM A;  3SZT A;  5EEH A;  4F7Z A;  4M9S A;  1ZRF A;  2OD5 A;  1ZHF A;  4RGX A;  4LB5 A;  4LMY A;  1SMT A;  3U9G A;  4YG2 F;  3WOD F;  2GZW A;  5J6X A;  5FLX K;  2DPU A;  1XMK A;  2HYF A;  4MNU A;  3G3Z A;  1G3Y A;  3K2Z A;  1QZZ A;  2O3F A;  1F5T A;  2NNY A;  2EK5 A;  4L5J A;  2FXA A;  3R60 A;  1P92 A;  3QU6 A;  2M1B A;  1ZH5 A;  2CSO A;  5CVV A;  3CO6 C;  1LEA A;  2COM A;  3O2P E;  2H6C A;  3E5U A;  2IA0 A;  3BJO A;  3AAF A;  3CJN A;  3BOQ A;  3FMQ A;  2HQR A;  4EMS A;  2D2W A;  1SD7 A;  3U2R A;  3F23 A;  1KU3 A;  4CHU A;  1Z1D A;  1LVA A;  2VON A;  1G3T A;  3CUQ A;  2O0Y A;  1Z05 A;  1OYI A;  1QGP A;  2FBK A;  2JPB A;  4GGG A;  4LLG F;  1IRF A;  2PG4 A;  1IXS B;  4KNY A;  3R61 A;  1FT9 A;  1ULY A;  2XGX A;  2FE3 A;  1BC8 C;  2WV0 A;  2XV4 S;  3IL2 A;  5DUK A;  2FNP A;  4A12 A;  1A04 A;  1DDN A;  4GCV A;  4MQV A;  4EM0 B;  3WTW C;  3DF8 A;  2QLZ A;  4LLL A;  2IJL A;  1H9G A;  1FSE A;  1XGN A;  3P9I A;  4KIF A;  1EV7 A;  5LBQ A;  3WTY C;  1U6G A;  2L54 A;  5JR3 A;  1HW5 A;  2Z5U A;  1REP C;  3I0T A;  3MZH A;  4H0E A;  4WCG A;  1TQM A;  1W7P B;  2ZXJ A;  4PZJ A;  4S05 A;  3J81 K;  1R1U A;  4A5N A;  1W5T A;  3Q5F A;  4U7D A;  3HHG A;  1SFE A;  1K7A A;  2VC0 A;  1GHC A;  5D6E A;  2ZO4 A;  1MGT A;  1BI2 A;  4PDK A;  2XAS A;  1GXP A;  3WTU C;  2ZME A;  2Z9O A;  3RIR A;  2Q0O A;  5H6Q A;  2O03 A;  4G9Y A;  4XBF A;  1RUO A;  2ESN A;  4Y15 A;  3C18 A;  3WTS C;  3HTS B;  4B8X A;  3HOT A;  4WWC A;  1DPR A;  5D5X B;  1UHM A;  3KLO A;  4R8H A;  1HST A;  2X0L A;  5CVJ A;  4KIG A;  3FM5 A;  2WTE A;  1XB4 A;  2QVO A;  2DO7 A;  2XAG A;  4I7H A;  4LD5 A;  1IXC A;  1LDD A;  2W24 A;  2IA1 A;  1PP7 U;  2V79 A;  4BHP A;  2DQR A;  3WTV C;  1HW2 A;  2FEZ A;  1S29 A;  3LFK A;  1Z7U A;  4RGU A;  3PQJ A;  4L18 B;  4FHT A;  1L0O C;  4ESB A;  1QQI A;  4LG0 B;  3HOS A;  4S04 A;  3F8B A;  4PGH A;  3LAP A;  1S7O A;  2FBI A;  2UZK A;  4I98 B;  3U1D A;  3FXQ A;  3R0J A;  2ELH A;  3SZP A;  1EH8 A;  1EH7 A;  3EDP A;  3V8J A;  3HRM A;  4IJA A;  5BOX A;  5HDN A;  3M9A A;  4P9F A;  1LDJ A;  3MWM A;  5E8I A;  3IC7 A;  2PFB A;  4BNC A;  4MTE A;  1IN8 A;  4HAM A;  1UST A;  4KN7 X;  1U2W A;  3F21 A;  1FOK A;  3WGI A;  2PMH A;  2XVC A;  5FD6 A;  2F5E A;  4MEY F;  2LDU A;  2XAF A;  3REO A;  3PQK A;  3RTR A;  5FO5 A;  3ROU A;  3NEU A;  5E1Z B;  2K7L A;  1B9N A;  3TOB A;  4G8X A;  5JFR A;  3NRV A;  3I64 A;  4IVN A;  2RDP A;  3ZMV A;  1U5T B;  5DD8 A;  2ZKZ A;  2L3D A;  4NQW A;  2CW0 F;  4A0Z A;  1YTY A;  5LHH A;  3F8C A;  4RB3 C;  1W7P D;  4A0Y A;  1KU2 A;  5E17 F;  3F8N A;  1L3L A;  2DPD A;  4KIC A;  3C7J A;  1IN4 A;  4EV0 A;  1XN7 A;  2RVC A;  2QBY B;  1U5T C;  1EH6 A;  4OIP F;  2A69 F;  3WU1 B;  3JW4 A;  3E5Q A;  1FC3 A;  1R1V A;  2GIV A;  3IWF A;  2W25 A;  1UCR A;  2QBY A;  2EV0 A;  1ZG5 A;  1CGP A;  3ZMZ A;  3FF5 A;  4Y13 A;  1FY7 A;  3L7W A;  3I59 A;  2RV8 A;  5JVT A;  1BI0 A;  3F6O A;  3HRU A;  1RI7 A;  1OYW A;  1F9N A;  3D5L A;  1WQ2 A;  5F6F A;  5F64 A;  4KMU X;  4ESF A;  2GA1 A;  3T8T A;  2R3S A;  4KMF A;  4YII A;  2J5P A;  3WE2 A;  4EM1 A;  1LDK B;  5D6F A;  5ED4 A;  4N9I A;  4TV7 A;  1YQA A;  4OU0 A;  1WI9 A;  1WRJ A;  1ZG1 A;  3GWZ A;  3N4M A;  4JBA A;  3VB2 A;  2DBB A;  5L3G A;  4HQE A;  3I54 A;  4L0Y B;  2YR2 A;  2VXZ A;  5ICF A;  3HUG A;  2OZU A;  4I02 A;  2HOE A;  4WXC A;  5CVU A;  2IPQ X;  1ZAO A;  5L3E A;  3CUO A;  1TW3 A;  3QAH A;  1Z9C A;  2P5L C;  3BJ6 A;  1R58 A;  4L9N A;  5HVQ C;  2DW4 A;  1G3W A;  1O3S A;  1HKQ A;  1B6A A;  1FNN A;  3ULQ B;  1MD0 A;  4KA4 A;  5L3F A;  2ACJ A;  1OYY A;  3CUQ C;  4U7B A;  4UUV A;  2L4M A;  5KK1 A;  1B1B A;  4KN4 X;  4L9V A;  5HDG A;  3E6B A;  2V1D A;  1MKM A;  3QRF F;  3IRQ A;  2W84 A;  2VOP A;  2M5W A;  3ZMD A;  3P7N A;  3EQL F;  2Z3Y A;  1UB9 A;  3WTZ A;  1ZG3 A;  1FYL A;  1XSX A;  5DD4 A;  1YW8 A;  3KEO A;  3F22 A;  2L4A A;  2RQP A;  2IP2 A;  4XSX F;  5HLG A;  4EJT A;  2UWM A;  2YX4 A;  3O6B B;  2BBY A;  2Q8K A;  3RI4 A;  3ECO A;  1O3T A;  4ZYE A;  1G3S A;  1H9T A;  5ICE A;  4CDG A;  1CF7 A;  1B9M A;  2LKP A;  3TGN A;  3Q9S A;  2ETH A;  2F5F A;  3K0L A;  1TTY A;  4G7O F;  3J7A O;  1SD4 A;  5AON A;  5HOO A;  4HYE A;  3GFM A;  4R1H A;  2Y48 A;  3IKT A;  4BYY A;  1W7P A;  2ESH A;  5A2Q Z;  2EFP A;  5JHU A;  4A6E A;  1J0R A;  3VFZ A;  5DCM A;  2QZ8 A;  2GA2 A;  2P5K A;  1PDN C;  2OU2 A;  4HV6 A;  2KKO A;  3GZ5 A;  5BQT A;  1OMI A;  3M7G A;  2VBZ A;  3WE3 A;  1ZYR F;  1SFX A;  2XKP A;  3RDI A;  1BM9 A;  6PAX A;  4ENK A;  2K27 A;  3E3V A;  3MAJ A;  4BHB A;  3HYI A;  2CO5 A;  5DCM B;  3JSP A;  1UFM A;  4M6X A;  3B02 A;  1C0W A;  3JTG A;  3VOD A;  2M45 A;  1Z91 A;  5D8L B;  3T5X A;  1GXQ A;  3JAM Z;  2DAO A;  5D4R A;  4IHS A;  1S3J A;  2F5D A;  3CUQ B;  4HDV A;  4HX8 A;  3C1D A;  2DTR A;  1P2F A;  3GW2 A;  1S8N A;  3KZY A;  1QO0 D;  3GFL A;  2HEO A;  2A68 F;  1TQI A;  2P6S A;  4GYG A;  4HF2 A;  1CF7 B;  1JHF A;  3W6J B;  4EGZ A;  2CWE A;  4CXF A;  2XAQ A;  1BJA A;  3ZMT A;  5CVR A;  2H6B A;  1QPM A;  2DI3 A;  1E17 A;  1ZRD A;  4A6D A;  4D0P A;  1HW1 A;  1Q1H A;  4HLX A;  1O57 A;  2K4B A;  2A61 A;  4I09 A;  1LB2 A;  4NHJ A;  2Y0M A;  2FSW A;  5ICG A;  4ZYG A;  2L02 A;  4HA8 A;  2WC2 A;  2K02 A;  3TDZ C;  1HKS A;  3LA2 A;  2KIU A;  4K2E A;  1GVJ A;  5BS6 A;  2PMU A;  1XSD A;  1YW9 A;  1XMA A;  3JAM K;  2VOD A;  1R00 A;  2STW A;  3ZN0 A;  3DKW A;  3HRT A;  1BOA A;  4QWQ A;  4XLP F;  1MDM B;  1ZRC A;  1FX7 A;  3GUD A;  1HBX G;  3DXJ F;  4ENN A;  2BE5 F;  1W5S A;  3BY6 A;  4EJU A;  1RUN A;  1JE8 A;  2OQG A;  4BXU A;  4ENJ A;  2R7D A;  2HGC A;  2QUF A;  3BDD A;  1FYK A;  2DK8 A;  4RGS A;  2OQR A;  3ELK A;  3GFJ A;  3RYP A;  3QOP A;  1O3R A;  1XGM A;  2JT1 A;  1KYW A;  4RAZ A;  2XIG A;  2YSR A;  3EUH A; 
#chains in the Genus database with same CATH topology
 3J80 K;  1UG2 A;  2LKS A;  4PJJ A;  3S2W A;  1DP3 A;  1OFC X;  4ZTJ A;  2BOL A;  2XF6 A;  3PUF A;  1U3E M;  5J4Y A;  3SYT A;  1HDP A;  1IDZ A;  3HPG A;  3HUG B;  3MZY A;  3MCZ A;  1ZR4 A;  2X1D A;  4B43 A;  2KRH A;  3L2U A;  4HLY A;  2A05 A;  1PP8 F;  2QWW A;  5F0F A;  2A6T A;  4NC7 A;  1FZP B;  1VQ7 I;  1BI3 A;  2VJ4 A;  2KT0 A;  1KU9 A;  1D5V A;  2DFH A;  1IN7 A;  1D1B A;  1XDS A;  2DA1 A;  1TT5 B;  2AS5 F;  3CQZ J;  3QU3 A;  2XC7 A;  1SD6 A;  3EYY A;  2ZJ2 A;  5ILV A;  3N05 A;  4E7S A;  1VFC A;  4B44 A;  1T39 A;  1O7F A;  1MBG A;  1ODD A;  2ECC A;  2LTP A;  4IRH A;  4AC0 A;  4DZP A;  3FDY A;  3NAU A;  5IT3 A;  3K69 A;  2DYR H;  3LA7 A;  4XLH A;  3DBH B;  3I3L A;  4D5F A;  3SDG A;  1Z77 A;  1TBX A;  4UXN A;  1BL0 A;  3VOE A;  2HDD A;  3BG3 A;  4OIQ F;  1Z7L A;  2FOW A;  4EJO A;  4EAT A;  3PIO F;  2CQN A;  2LF7 A;  3SHF A;  1IC8 A;  2NVU B;  5KHD A;  2DA5 A;  5L3D A;  1TC3 C;  3TKY A;  2K9Q A;  3K4N A;  2ZFW A;  4E70 A;  5LFA A;  5E18 F;  1ZQ3 P;  3K1M A;  2LD5 A;  3ERE D;  3P9K A;  2R7Q A;  4HG2 A;  1IRX A;  3HM5 A;  2VC1 A;  1FWZ A;  3ZN1 A;  4D9J A;  1YS6 A;  2XB0 X;  2KFD A;  4NDL A;  2VOO A;  1JHH A;  1SFU A;  3O3K A;  2DU9 A;  2XUB A;  2FF4 A;  5TJJ A;  2QEN A;  2LY1 A;  1HCR A;  1WVR A;  3G1M A;  3I59 B;  3WHB A;  2HXO A;  2RGV A;  5L3C A;  3KP4 A;  2VE9 A;  4RM2 A;  2RNJ A;  2DT5 A;  1YIO A;  3OYA A;  3HRS A;  1R5G A;  3HOW J;  1TQP A;  1JXS A;  3CTA A;  1WHU A;  1ON1 A;  2DMN A;  2FMY A;  3PSF A;  5EDN A;  3MMY B;  3TED A;  5F1R A;  3WTX C;  1RR7 A;  1TWA J;  5LLQ A;  2O7O A;  4BEH A;  2AQE A;  5TRD A;  1H88 C;  2MBF A;  1MBK A;  4MQ9 F;  4RBO A;  4IOC F;  2OAZ A;  3TO7 A;  1OR7 C;  4ZYH A;  1R5H A;  2EFO A;  2M30 A;  3ZCO A;  1T6S A;  1P6R A;  3IHU A;  1R1T A;  5J8C A;  2JN6 A;  3QP6 A;  2OA4 A;  2N8G A;  2M0M A;  1JUP A;  2E7W A;  3BG7 A;  3T1B A;  2DFI A;  3E6D A;  2L5Q A;  4RLF A;  3CC2 I;  4BDY A;  1N78 A;  2VUM J;  2LOO A;  2VJ5 A;  3BR0 A;  1I3A A;  2BW3 B;  2K86 A;  1TL8 A;  3GFI A;  5DCF A;  4NQW B;  5JI6 A;  2AXL A;  1MMN A;  4M9X A;  1D3Y A;  2B63 J;  4OIO F;  3GTQ J;  1U5T A;  5JLW A;  1WI3 A;  2WWY A;  2EIK H;  2VE8 A;  2ZNY A;  2BGC A;  3D0S A;  3KP2 A;  2VLA A;  2Y0S N;  1JT6 A;  4WX9 A;  2X6O A;  4XLC A;  5B3S H;  3T0Y A;  3ABL H;  4IEJ A;  4BHC A;  3ZMS A;  2VT3 A;  3RPU D;  3MEX A;  3KFW X;  2HQA A;  1GLN A;  1IUY A;  3GXO A;  1B72 B;  3HIF A;  4XLE A;  2A6E F;  3FZV A;  3F9K A;  3WU2 C;  4EVI A;  4UNO A;  5D5V B;  4LFU A;  3PNV A;  3IAM 2;  4YEL A;  2LR8 A;  4N9H A;  4Z6Y A;  1RES A;  1RIO H;  4Q48 A;  3DQV C;  4EJW A;  1E3P A;  1W0U A;  3KEQ A;  2R7W A;  3S17 J;  5LRR A;  2GXG A;  3H0D A;  1HDD C;  3F8M A;  3HZJ A;  5AIP A;  3JRC A;  2PEX A;  4X1E A;  2PJP A;  3GYH X;  2E5N A;  1R36 A;  1D8J A;  1B4A A;  3RPU A;  1X4O A;  1X1C A;  2ELK A;  1BI1 A;  3LOC A;  2LFB A;  3ZRG A;  1P4A A;  3K4L A;  1WPK A;  4LG3 A;  2DFE A;  2KHM A;  4XLN F;  5ILS A;  3TDU C;  3OYC A;  4GXO A;  1S9H A;  1KQ9 A;  3V7C A;  1J59 A;  1I6H J;  2HVQ A;  3IH3 A;  1LE8 A;  4BE1 A;  4FT8 A;  1X1B A;  1YHQ I;  4KDP A;  4UHT A;  2R7O A;  4P1W A;  1B8I A;  2MH9 A;  1ZGW A;  1VQN I;  1OCC H;  4IKF A;  3LQR A;  2DOA A;  2LNB A;  3SDB A;  4ZZL A;  1EKE A;  2HZT A;  2P8T A;  2R7T A;  1J5Y A;  3JR9 A;  3HKZ A;  2EZK A;  2JA2 A;  2OV7 A;  4I0A A;  1G4D A;  2X4H A;  2X6Y A;  3BC8 A;  1F43 A;  3K6G A;  1VQL I;  5CYV A;  3H9Q A;  2XKO A;  5EGO B;  3NQO A;  4FX4 A;  2XGD A;  3GTK J;  2CH0 A;  5HS7 A;  2CMP A;  2KJB A;  5H6R A;  5LHI A;  3CMY A;  1F4K A;  5CVI A;  1ZGA A;  3MN2 A;  4RM3 A;  2EV5 A;  3KIO A;  4LG0 A;  2PJR A;  1D0Y A;  2XGC A;  2HTS A;  2VQC A;  3BPX A;  2E2H J;  2CS3 A;  4XRS G;  2FA5 A;  2MC3 A;  1E2X A;  3L2C A;  4O3M A;  2AXT C;  2FQ4 A;  3ABT A;  3B73 A;  3M1C A;  4M71 A;  3HSR A;  2QQ8 A;  2MYS A;  3QPH A;  4M6V A;  4XLF A;  1Y0U A;  4G6Q A;  2FOK A;  1OCT C;  4Y3O A;  2KIF A;  3WGG A;  3WHC A;  2NS0 A;  4CYC B;  1YJW I;  3E6M A;  4MEX F;  4QLC U;  1V3F A;  2GBY A;  3K4K A;  1KU7 A;  3AL0 B;  2QSG X;  3G1L A;  1XCB A;  2LP0 A;  3MD2 A;  1IXR C;  2VT2 A;  2EFN A;  2HWV A;  3BJA A;  2PX9 A;  5LGU A;  1ETV A;  3PIP F;  2QF7 A;  4YFN F;  3KP5 A;  2HR3 A;  3W2A A;  5M3M J;  2ZFU A;  5FGM A;  5F27 A;  2IT0 A;  4CUG A;  2E2I J;  3FHZ A;  1I27 A;  4IRG A;  2H1K A;  3BG6 A;  1SMY F;  4CCM A;  4F91 B;  1WJF A;  5DUI A;  2MLG A;  3HOY J;  5DM7 F;  2ZXW H;  4A3E J;  1UMQ A;  1IW7 F;  2DLL A;  3TW6 A;  4E6K G;  3IWZ A;  1WFX A;  3G1O A;  2V9V A;  2R7S A;  4JYK A;  4XKB A;  4IO9 F;  2LRE A;  2XRN A;  2E2J J;  2IW5 A;  1D8K A;  1MJB A;  3X2Q H;  1BC7 C;  3W6V A;  1TWH J;  3IH4 A;  1HKT A;  3QYF A;  4FCY A;  3RQI A;  2Q1Z B;  3ASN H;  2CYY A;  4UV9 A;  1XX5 A;  1QBJ A;  3QYB A;  2M7B A;  2ZME B;  2GXB A;  4HZF A;  3S2D J;  4AWX B;  4OMZ A;  1WKM A;  5IP7 J;  1XCV A;  4BH9 A;  1R22 A;  1ONV A;  2B0L A;  4U0W A;  2E1M B;  2EFW A;  2HYG D;  1BN5 A;  2IRF G;  1ACI A;  5LGN A;  5DTD A;  1K4S A;  2VJI A;  3DBL B;  3A0H C;  3GZ6 A;  3PO2 J;  4UB8 C;  5EF6 A;  4DBQ A;  2K9S A;  4N0B A;  4ASN A;  3BRO A;  2UUZ A;  2Z1D A;  1LUJ B;  5CKT A;  1ZN2 A;  1BA5 A;  2GQQ A;  3I71 A;  3TO9 A;  5IP9 J;  2IEK A;  2V9P A;  4OWR B;  1U8R A;  2FML A;  1OCR H;  2PMZ A;  3JTH A;  1T0F C;  2FBH A;  3QOE A;  4CO8 A;  1TNT A;  4E7Z A;  3KET A;  2PLY A;  1ZRE A;  2NVY J;  3D5R C;  5L3B A;  4KIS A;  1AA7 A;  3VYS B;  2L9S A;  1Y0N A;  2PI0 A;  3HEF A;  2IA2 A;  4MGR A;  3TW7 A;  4P55 A;  4S0H B;  2LF8 A;  1H89 C;  1YYV A;  4XSZ F;  1YG2 A;  2E35 A;  2P4W A;  3HXL A;  3I4M J;  1DGR M;  4G6T B;  2O5R A;  3IAS 2;  3PUB A;  4FE4 A;  3K4C A;  1FMW A;  4BE2 A;  3D1N I;  4M9Z A;  3RKX A;  1LVK A;  4M73 A;  4N4O B;  1Y6I A;  2O9L A;  3RSN A;  5FB2 A;  4E7H A;  3LSP A;  1OLT A;  1K79 A;  3EUA A;  3DEU A;  3BP8 A;  4A0X A;  3F72 A;  1X4P A;  4WXD A;  3FM3 A;  5E1X A;  3VEP A;  5FKL A;  2DDA A;  2ELJ A;  3HDD A;  3EUK L;  1LQ1 A;  3ZXS A;  1S6L A;  1SAX A;  3T8R A;  3CCV I;  2BZT A;  2EZH A;  4FTH A;  2XHK A;  2M9H A;  2M4G A;  5FKM A;  2MD0 A;  1KYZ A;  4XIC A;  3QPL A;  2NYX A;  3BTC A;  3Q9V A;  3JRA A;  1K78 A;  3AG3 H;  4BBS J;  2Z16 A;  3FKI J;  3GO5 A;  2QGU A;  4HV5 A;  4M74 A;  3DEE A;  2KJC A;  4RAY A;  3K9T A;  5K5Q A;  4OMY A;  3OSG A;  4B4C A;  4UUS A;  2V6C A;  2FX0 A;  5HNF A;  3SQN A;  4P9U A;  4PJ0 C;  3CDH A;  2H8R A;  1ETK A;  3IP4 B;  4IQJ A;  4BY7 J;  5D5U B;  3P5J A;  3UNG C;  4Y52 J;  1FEX A;  3G73 A;  4V2F A;  2O6G E;  3ECH A;  2OJE D;  3O8G A;  4Q47 A;  1FBS A;  2V7F A;  1OCP A;  4ZZD A;  2GAU A;  5FLX Z;  2JRT A;  4RB0 A;  2QEX I;  3GLX A;  3RYR A;  3JRD A;  4LGW A;  4Q5S F;  4RA2 A;  2KRC A;  1Z67 A;  1AHD P;  2ID6 A;  1MSE C;  1MMS A;  2DK5 A;  5FKN A;  2PN6 A;  3DU5 A;  5FFX A;  2HKX A;  3ZQ7 A;  4GYI A;  4HF0 A;  2XPU A;  4OAZ A;  4U0V A;  1OPC A;  3KX2 A;  2DT7 B;  2Q2E A;  1QA6 A;  3KEY A;  4ABZ A;  4ZTF A;  1SAN A;  2CUF A;  3OYF A;  3HGG A;  1XD7 A;  5LEK A;  2EJR A;  1W36 C;  1A5J A;  3I58 A;  3RJP A;  5CLS A;  4ESJ A;  1FLI A;  5JHF A;  1BW6 A;  4UVC A;  3J7Z I;  3CMA I;  2W7N A;  1X58 A;  1SD5 A;  5K5R A;  2ZCW A;  1Y8Q B;  2VAS A;  5ICC A;  2P6T A;  3LSI A;  2W1O A;  1XC5 A;  1YI2 I;  2PBI A;  2DTZ A;  2E34 A;  3S1M J;  3VSL A;  4EJV A;  1XSV A;  3ML6 A;  4BY1 J;  1R4N B;  1XGS A;  2DMQ A;  1LFU P;  4MHG A;  3SFZ A;  3FXK A;  4AIH A;  1SC7 A;  2HKO A;  5AIQ A;  2HDC A;  1R7J A;  2CU7 A;  2F2E A;  4BQO A;  2LK2 A;  3KZZ A;  2DA2 A;  5EG0 B;  3CCQ I;  4A3M J;  3JSO A;  2F4M B;  3OWT A;  3ZP5 A;  2QA4 I;  4L0Z B;  2Z99 A;  2Y75 A;  2KQR A;  2XAH A;  3HG9 A;  4B3A A;  1U78 A;  3TQN A;  1QNT A;  3FX3 A;  3ZQF A;  1ZAR A;  3A4C A;  3BPV A;  5K5O A;  2OCC H;  1IO2 A;  3W6K B;  5E1W A;  3LST A;  3TP0 A;  3H1C A;  4PCQ A;  3S2H J;  1MW7 A;  5HLH A;  4QPQ A;  4HX7 A;  3WG9 A;  4BAY A;  3VPR A;  3VSK A;  4LK1 F;  3JRI A;  1APL C;  5BPD A;  4FE7 A;  1WSU A;  2O8X A;  3L09 A;  4D5C A;  2VQH A;  3DTK A;  2IVM A;  5IYB J;  2IXS A;  1G2H A;  4BUP A;  4G7Z F;  3E5X A;  4C2T A;  4L9J A;  3I53 A;  3K7A J;  2EIM H;  4PGG A;  1DQU A;  3H3Z A;  3LSH A;  4AUX A;  2EA2 A;  5F1J A;  1TNS A;  4PUS A;  2H94 A;  3OIP A;  3L2W A;  3MFK A;  1T2K A;  4XOP A;  3IH2 A;  3OL3 A;  2G7U A;  2D5V A;  1B59 A;  3K70 D;  1DUX C;  2CQK A;  2VBW A;  2ID3 A;  1KON A;  1V5G A;  2LLK A;  2V1X A;  1VZ0 A;  3G2B A;  4DZJ A;  2TCT A;  2DQL A;  3CJR B;  4G12 A;  5B1B H;  4RB1 A;  1IV6 A;  2IS6 A;  2TRT A;  3LQQ A;  2PQ8 A;  2XPW A;  2P7V B;  4L5I A;  2M2E A;  2VI6 A;  4A3C J;  3LSK A;  1FP2 A;  3SXY A;  3CC4 I;  5DV5 A;  1HC8 A;  3DPT A;  4WK8 F;  1DU6 A;  1BR1 A;  3GTP J;  3J80 Z;  2HOA A;  5IY5 H;  1VQP I;  2JVH A;  5GTI C;  1HXD A;  3KP3 A;  3QWL A;  4E7J A;  4ZYD A;  4FX0 A;  3CD6 I;  3BR3 A;  4JK1 X;  3ZQC A;  2EBI A;  4R79 A;  2CUJ A;  3BQZ A;  4I0B A;  4EQQ A;  4BQQ A;  3ISP A;  2XRL A;  1NG7 A;  5FFZ A;  2FRH A;  2V4J C;  2RC4 A;  2LG4 A;  4EM2 A;  3R6S A;  2CV2 A;  4JX4 A;  5C3E J;  3OL4 A;  4LIU A;  3EUH C;  3AG1 H;  3BWG A;  2R7U A;  2UXN A;  4O5V A;  1A36 A;  3RKW A;  3AL0 C;  1LNW A;  5DM6 F;  2WY7 Q;  3L1P A;  2JWT A;  3QPS A;  4MO7 A;  5B66 C;  3CF2 A;  2YPR A;  3RCO A;  2LY2 A;  1KQ8 A;  1TW2 A;  1NTC A;  1V5E A;  4A3F J;  1FYM A;  1K6Y A;  3FXO A;  4C3I J;  2XSD C;  5D8K B;  2DCE A;  2A5Y B;  2MLK A;  3QP5 A;  4IF4 A;  4OIN F;  1J9I A;  3B6C A;  5LEJ A;  1A6I A;  2G7H A;  2H09 A;  2L9V A;  2OZ6 A;  2LH9 A;  4UV8 A;  2ZNZ A;  1G59 A;  3GF2 A;  2JA5 J;  1FOW A;  3W2V A;  1UHW A;  2XDV A;  1W4M A;  1LJ9 A;  3CCU I;  2ZXH A;  1ZEL A;  1ZGJ A;  5GAG J;  5J1U A;  2IBD A;  4UUS B;  2JQ7 A;  1GUU A;  3S93 A;  2KDZ A;  1RZ4 A;  4DYQ A;  4A3B J;  2XAJ A;  2DFF A;  1E3H A;  3OOP A;  5EJC A;  4LJZ F;  2WB1 N;  2P7C B;  4LK0 F;  5IOY A;  1K78 B;  2BHY A;  2QQA A;  5ERI A;  1X1D A;  2KRF A;  3N97 A;  2JPC A;  1BR4 A;  2VJJ A;  4E7I A;  3CDI A;  1I3Q J;  4HX4 A;  1K6O A;  2OTJ I;  3ZQQ A;  3PJR A;  2O8K A;  4LLN A;  1R4M B;  3CCJ I;  3DPL C;  2ISY A;  2M87 A;  4CZZ A;  5EEA A;  4QTR A;  2ZME C;  4I76 A;  3K10 A;  4HOB A;  5EEG A;  5BPI A;  1P9Q C;  1S7E A;  2CQX A;  3WTT C;  2KL4 A;  2IS2 A;  1MSF C;  3WG7 H;  2L7M P;  4XR6 A;  1ITY A;  1Z3Y A;  4KFC A;  1YLF A;  3AKZ A;  1P4X A;  4ON0 A;  5IP6 A;  1I1G A;  2HXI A;  3GTJ J;  1JKP C;  1U9O A;  2D1H A;  2DA3 A;  3ZQL A;  2BXZ A;  5D5W B;  4IXA A;  4P96 A;  1NG6 A;  5B1A H;  2E7X A;  3V7R A;  2A6H F;  1O3Q A;  2KIQ A;  4IX7 A;  1IAW A;  1XDU A;  4KIB A;  5C4X J;  2BXY A;  2MSY A;  2V1U A;  3L9F A;  3FMS A;  4XRF A;  2CFX A;  2L01 A;  1K4T A;  1TLH B;  3HHH A;  4AD9 A;  2KP6 A;  2OBP A;  5H20 A;  3TOA A;  3LL7 A;  2P5V A;  3R0A A;  1O7L A;  4UVB A;  1TZL A;  3K1P A;  4BQN A;  3DKX A;  5IT9 K;  1DPU A;  1IZ1 A;  2EWN A;  3O8H A;  5CQE A;  2STT A;  1OR7 A;  4M72 A;  2GM4 A;  1TP4 A;  4M3B A;  4HPQ A;  1TWF J;  4CCL A;  4I2O A;  4C30 A;  2MG4 A;  4QPO A;  2K4J A;  3TO6 A;  1RET A;  2IAI A;  3BZ6 A;  3G6E I;  3IKV A;  4YFK F;  1D0Z A;  4PK4 A;  1YJN I;  2I10 A;  4A2U A;  2E1O A;  5LHG A;  1DU0 A;  2R7F A;  1OKR A;  3F6V A;  5A2Q K;  2G9W A;  1BIB A;  3CLQ A;  1OJL A;  2FD5 A;  3V7S A;  1MJ9 A;  1NK2 P;  1H8A C;  4CGZ A;  3H35 A;  4M3F A;  3PFI A;  4A3J J;  1IN6 A;  2EPF A;  5TIS C;  4BQA A;  3DFG A;  1MZB A;  2E1C A;  3V8L A;  2Y2Z A;  1AKH A;  1XTA A;  1FBU A;  3CLO A;  4DQ2 A;  2RN7 A;  2XRO A;  3V8K A;  4Y17 A;  2JTV A;  1IDY A;  2DYS H;  3H9J A;  4EEF G;  4ETS A;  2CG4 A;  3DV8 A;  1STZ A;  4EGY A;  2HS5 A;  3S1N J;  1J2X A;  2Z33 A;  3M1E A;  2D45 A;  2M8E A;  3K4J A;  4QSH A;  1V4R A;  2D1V A;  2LSO A;  3ZPL A;  3S1R J;  3F8F A;  1Z6T A;  5LGT A;  1D0X A;  3MQ0 A;  1OIS A;  1I39 A;  1ORK A;  5KVR A;  4C3J J;  5C44 J;  1J7K A;  4ZJZ A;  4A5M A;  3V4G A;  3Q0U A;  2FQ3 A;  2E1N A;  3L00 A;  3HSF A;  1V5F A;  3IRR A;  2AO9 A;  5E79 C;  2HFH A;  4HST A;  1T98 A;  4RB2 C;  1VTN C;  2F4I A;  3EPZ A;  5HS9 A;  3I4P A;  2VN2 A;  1YW7 A;  3AG2 H;  4KYW A;  3IUO A;  5J8F A;  2EA4 A;  5ILU A;  4U88 A;  2C6Y A;  2K5C A;  2A3S A;  4WXH A;  3KE2 A;  5CPR B;  4YIR X;  1N77 A;  2YS9 A;  1ZK8 A;  4BGD A;  5HLT A;  3ONQ A;  2R5Z B;  2Y0S A;  2WAQ N;  1MMA A;  5F0H A;  1F36 A;  5E8G A;  4LB6 B;  1ERD A;  1X1A A;  5EYR A;  3OYE A;  1LPQ A;  3HSE A;  4G6D A;  1MND A;  1WJD A;  1UEL B;  3F0C A;  4FET A;  4YRV A;  4OOI A;  4ENM A;  3GX4 X;  4A3G J;  2R5Z A;  4J01 A;  4HNV A;  2IS1 A;  4U0Y A;  5J4V A;  4Z2Y A;  1W1W E;  1OQY A;  2A07 F;  3JRE A;  2R7R A;  2QQB A;  2QQ9 A;  3FMR A;  2L7Z A;  3RZD J;  2BYV E;  2GWR A;  2F5C A;  1XGO A;  4YFX F;  4IHT A;  1EJ9 A;  1XS9 A;  2CRG A;  3WGH A;  3ZMU A;  4CH7 A;  1HA8 A;  2F6C A;  1WH7 A;  3LA3 A;  4V2G A;  1PUE E;  2RKH A;  3S1Q J;  4G7H F;  1SFK A;  3BR5 A;  4NB5 A;  1FOX A;  4HW0 A;  2YU3 A;  1IRG A;  4M3G A;  3M8F A;  3HOZ J;  5FRO A;  2WAD A;  2NAZ A;  2H27 A;  1IF1 A;  4M6Y A;  2ZB9 A;  3CO7 C;  4IHW A;  1D1A A;  2KIM A;  5K1Y A;  1OCO H;  4HBL A;  2QM3 A;  4UVA A;  1MIJ A;  1YO5 C;  4I01 A;  4JQF A;  4MFE A;  1I5Z A;  3RPQ A;  4IRI A;  3CF5 F;  3KP6 A;  4CZC A;  3VWB A;  1KA8 A;  2F4O B;  2ISZ A;  4II3 A;  2HVS A;  3A0B C;  2QYO A;  3OV8 A;  2BEO A;  1MH3 A;  3C3W A;  5FD5 A;  3AG4 H;  3FXR A;  1R23 A;  1RNL A;  3PNT A;  4G94 A;  2X6W A;  3E1S A;  3LSM A;  1F1Z A;  3H3U A;  3ZQG A;  1AKH B;  2YX7 A;  1BBY A;  1XMX A;  2UXX A;  3FWE A;  4KUM A;  3OR2 C;  1Z3X A;  2BV6 A;  3W2W A;  3OYD A;  2DMP A;  2A5W A;  3K2A A;  2X6X A;  3LFU A;  2K9N A;  3RKY A;  3E6C C;  2ZBK A;  4NBQ A;  3EYI A;  2B7E A;  5HDK A;  3MKZ A;  2F48 A;  4HF1 A;  2R7Z J;  1ZTR A;  4A69 C;  2O61 A;  2W85 A;  3HTU A;  1IN5 A;  3WU0 A;  3LWF A;  1UG0 A;  2VBX A;  1I1S A;  1VQM I;  4AVP A;  5F04 A;  4YIF A;  4J00 A;  1HLV A;  3KZI C;  2ME0 A;  1UAA A;  4DOZ A;  1P4W A;  2CGP A;  1JGS A;  3KPH A;  1X1P A;  4DJA A;  2MD5 A;  1AWC A;  5IT9 Z;  1RPW A;  2CUE A;  2MH2 A;  4L9T A;  1J75 A;  1YFH A;  3DP7 A;  3K1N A;  2HQN A;  2HDW A;  4XNF A;  5DS9 A;  1U8B A;  2VL8 A;  1FPQ A;  3CCL I;  4CIC A;  4PJN A;  4XL9 A;  1NHA A;  2FNA A;  4BEH B;  2JK3 A;  1S7A A;  1H0M A;  4CYD A;  1KQ0 A;  4XRM A;  2WV1 A;  1WJ5 A;  4HRI A;  1AOY A;  2E19 A;  4DNC A;  4XQF A;  3KLN A;  5B5E C;  2HTJ A;  2MA3 A;  3E97 A;  3DTI A;  1ZLJ A;  4IZZ A;  4ANJ A;  4OIR F;  1ZLK A;  5LRS A;  1FBQ A;  4A3I J;  3E7L A;  5DDG A;  2NNN A;  4P5O A;  3QPT A;  3DU6 A;  3OOU A;  1WWX A;  5FKK A;  1G6N A;  2TDX A;  4HQM A;  1D1C A;  2FU4 A;  3I5U A;  1BW5 A;  1WGX A;  5F0C A;  5F08 A;  2VKV A;  2WAF A;  4XN0 A;  3VYR B;  4B3X A;  3CCS I;  4Y4R A;  5DEQ A;  4B09 A;  4IHY A;  2JMW A;  1T38 A;  3GVA A;  3R4K A;  5KCM A;  5FLM J;  4AIK A;  3BR2 A;  1Z6R A;  1KGS A;  1YJ9 I;  1X3U A;  5C4J J;  3HC7 A;  4JP0 A;  4AIJ A;  3M8J A;  3FHN A;  4O6J A;  2DJN A;  1ON2 A;  4ZH4 F;  1N25 A;  3C2G A;  5K7H A;  3P9C A;  2Y31 A;  4KT5 C;  1ETX A;  2KIS A;  5E20 A;  2EFQ A;  1X3Z B;  3FXU A;  4C2M J;  4XID A;  2CV0 A;  3S32 A;  3G4S I;  2JSC A;  2LMD A;  5HLI A;  1YX3 A;  5D4S A;  1T8I A;  4PSW A;  1BIA A;  2X1E A;  3HL2 A;  4AYB A;  2KZG A;  1YS7 A;  2ZXI A;  1HSJ A;  5JLX A;  4MIM A;  3EET A;  1MNM C;  3LAJ A;  1I6X A;  3H0G J;  3JRG A;  4XOT A;  2K3P A;  1WJC A;  2VBY A;  2X1C A;  2EV6 A;  2VIX A;  4HDU A;  4MTD A;  3BQY A;  5J1R A;  5IYD J;  3HGY A;  3GEZ A;  3OS0 A;  2J5O A;  1JTY A;  5BMZ A;  4A3K J;  4Q4Z F;  5DYM A;  1LEB A;  3ABU A;  2GOX B;  3M8E A;  1KZH A;  1P7I A;  3ZR8 X;  1FSH A;  3KCC A;  1FP1 D;  3GZN B;  4LIT A;  4BS9 A;  1HQC A;  3MVP A;  5K7F A;  5CJ9 A;  1USS A;  1FTT A;  3B6A A;  4RLQ A;  1VF9 A;  5HS8 A;  3H92 A;  5FRM A;  1T0F A;  2DN0 A;  4IPA A;  4RS8 A;  2W57 A;  1MH4 A;  2EB7 A;  4XK4 A;  2HOT A;  1QZY A;  2CUZ A;  2DA7 A;  3TL4 X;  1DP7 P;  2NRA C;  3I4N J;  3KP7 A;  3DCF A;  3S3M A;  1NK3 P;  2JZY A;  1MJA A;  2M7A A;  3COA C;  1ETY A;  3DWL E;  4RGR A;  4GO1 A;  2XSJ C;  3PNY A;  2R0Q C;  2B9S A;  5EZG A;  3J81 Z;  2ADU A;  1U0J A;  2VKD A;  4PFP A;  2WB1 A;  3F3X A;  4WF2 A;  1MDM A;  3SZT A;  5EEH A;  2IGO A;  4F7Z A;  1FMV A;  2OTL I;  4BKX A;  4M9S A;  4BJ5 C;  1ZRF A;  2OD5 A;  4A3D J;  5FKO A;  4PSX A;  1ZHF A;  1IUF A;  4RGX A;  4LB5 A;  4GFB A;  2P81 A;  4LMY A;  2CFO A;  2E5Z A;  3H5N A;  1SMT A;  3U9G A;  4YG2 F;  3WOD F;  4U87 A;  3SFI A;  2W00 A;  2GZW A;  5J6X A;  5FLX K;  2QSF X;  4NC6 A;  2DPU A;  1XMK A;  4LOC A;  5EG0 A;  2GIZ A;  2HYF A;  4MNU A;  3G3Z A;  1P7J A;  1G3Y A;  2KPM A;  1YRN A;  1ZR2 A;  3K2Z A;  1QZZ A;  2JSP A;  4RMN A;  1MMG A;  2Y30 A;  2O3F A;  1F5T A;  2NNY A;  2EK5 A;  4L5J A;  1UJ8 A;  1IJW C;  2FXA A;  3HPH A;  3K4B A;  4L5E A;  4A93 J;  3R60 A;  1P92 A;  2EIJ H;  2BY1 A;  2M1B A;  2M4K A;  3QU6 A;  2XPV A;  3DTE A;  3DEW A;  1ZH5 A;  2ZSI B;  4ITV A;  3SZG A;  2CSO A;  5CVV A;  3CO6 C;  4YEJ A;  5KAF C;  1LEA A;  2COM A;  1BR2 A;  2ZSH B;  3OR1 C;  3QQA A;  2MW8 A;  2BHZ A;  3C2H A;  3O2P E;  2H6C A;  3E5U A;  2XF7 A;  2IA0 A;  3BJO A;  4LIV A;  3AAF A;  3CJN A;  3BOQ A;  2DMT A;  2ECB A;  3FMQ A;  2HQR A;  3G71 I;  1TT0 A;  2DOF A;  2ZJQ F;  4J19 A;  1W36 D;  4EMS A;  3PO3 J;  3HJE A;  3VDX A;  2D2W A;  2E36 A;  1SD7 A;  2H1L A;  3U2R A;  4CCN A;  5J40 A;  1XPX A;  2Q2E B;  1O4X A;  4BL0 B;  1R9T J;  3PL8 A;  3F23 A;  5GPC A;  3SJM A;  1TWG J;  1EF4 A;  3FXL A;  2L7K A;  3ABM H;  2NVT J;  1R5I D;  1KU3 A;  2KZV A;  4CHU A;  3OS1 A;  1Z1D A;  3DLL F;  1LVA A;  4DIQ A;  3MKY B;  1JUS A;  2VON A;  1G3T A;  3CUQ A;  2O0Y A;  1Z05 A;  1OYI A;  4DGW B;  1QGP A;  2FBK A;  2JPB A;  3Q0W A;  4GGG A;  3W3C A;  2QSH X;  4LLG F;  3DLA A;  1IRF A;  1XG1 A;  2PG4 A;  3UKG A;  1IXS B;  2IGN A;  2XGE A;  4BJ6 C;  2QKM B;  4B47 A;  3HOX J;  1VI0 A;  4KNY A;  3R61 A;  1FT9 A;  4JOM A;  1AU7 A;  5JVG F;  1QPI A;  1ULY A;  1HF0 A;  2XGX A;  1G8X A;  2FE3 A;  1BC8 C;  2KDO A;  2WV0 A;  4F93 B;  2XV4 S;  2NS8 A;  3IL2 A;  3ZGK A;  5DUK A;  5GAD J;  2FNP A;  4A12 A;  1A04 A;  2R93 J;  2K40 A;  3I56 I;  1DDN A;  4GCV A;  4MQV A;  4EM0 B;  3DF8 A;  2QLZ A;  4LLL A;  3WTW C;  4IOA F;  2IJL A;  1H9G A;  1QRY A;  1FSE A;  1XGN A;  3P9I A;  2I5U A;  4KIF A;  1EV7 A;  2MGQ A;  5LBQ A;  3WTY C;  2VKE A;  2IGK A;  5GAH J;  1U6G A;  2L54 A;  5JR3 A;  1HW5 A;  2Z5U A;  3JRH A;  1REP C;  3HB9 A;  3GBG A;  1DGW Y;  1WJB A;  4C3H J;  4B48 A;  3I0T A;  3MZH A;  3HOV J;  4H0E A;  1FOY A;  4WCG A;  1TQM A;  1W7P B;  2BVM A;  2LVS A;  3OSF A;  1Q1V A;  2ZXJ A;  2DA6 A;  1PVE A;  2HOS A;  4PZJ A;  4DYC A;  3L2R A;  2DA4 A;  4S05 A;  4OAY A;  2EZL A;  3J81 K;  1R1U A;  5HNH A;  4BU2 A;  4A5N A;  3S3O A;  2L0K A;  1W5T A;  3Q5F A;  5M5Y J;  4U7D A;  4DYR A;  5GPA A;  1MNE A;  3U1K A;  3GTO J;  1FTZ A;  2H8W A;  3HHG A;  1SFE A;  3OYJ A;  2HVR A;  1YX5 A;  1JT0 A;  1K7A A;  1Z21 A;  2VC0 A;  2EH3 A;  1GHC A;  2EZI A;  3CZ6 A;  3OS2 A;  5D6E A;  2ZO4 A;  3A1Y A;  1MGT A;  2YUS A;  1BI2 A;  1WH5 A;  4FAS D;  4PDK A;  2XAS A;  3BTL A;  3BZK A;  1GXP A;  3WTU C;  2W4S A;  2ZME A;  2VPR A;  2Z9O A;  3RIR A;  2Q0O A;  5H6Q A;  2O03 A;  4NUB A;  4G9Y A;  1X2M A;  4XBF A;  3S3N A;  1Z0X A;  1RUO A;  2ESN A;  2R5Y B;  3H3V K;  1IG7 A;  4Y15 A;  1UZC A;  3C18 A;  3JCU C;  3U21 A;  2WAE A;  3WTS C;  4WWC A;  4B8X A;  3ESW B;  3HOT A;  3HTS B;  3DKY A;  1QU3 A;  1DPR A;  3CJT B;  1K83 J;  1WJA A;  3ZQH A;  5D5X B;  3LSR A;  1JKQ C;  5KAI C;  1UHM A;  3MKL A;  2L9N A;  3KLO A;  4R8H A;  1JJ6 C;  1HST A;  1X19 A;  2X0L A;  2G0E A;  2KLO A;  2IS4 A;  1YOV B;  5CVJ A;  4BXF A;  2EQR A;  4KIG A;  5E3M A;  3FM5 A;  3RZO J;  2WTE A;  2K85 A;  3GTG J;  1XB4 A;  2QVO A;  3OIO A;  2DO7 A;  2XAG A;  2VXD A;  3ERM A;  4I7H A;  4LD5 A;  1IXC A;  3BTI A;  2X48 A;  3TBI A;  4QIW N;  1LDD A;  2NVQ J;  2W24 A;  3KYC B;  1MMD A;  2IA1 A;  2VQL A;  5M5W J;  1PP7 U;  1NH3 A;  3V42 A;  2V79 A;  4BHP A;  1A31 A;  1FJL A;  2DQR A;  3WTV C;  4Y33 A;  4CYC A;  2MC4 A;  2FEZ A;  1M1E B;  1RKT A;  3LMM A;  3ZQI A;  1S29 A;  3LFK A;  1HW2 A;  3L2Q A;  3H9G A;  4ZDP A;  1T33 A;  1Z7U A;  3DBR B;  3OYI A;  4RGU A;  1T56 A;  5HOD A;  3PQJ A;  4NNJ A;  4FHT A;  4L18 B;  1CQT A;  1L0O C;  2BY0 A;  4XN3 A;  4ESB A;  2PMZ N;  1QQI A;  2PJR B;  3S8P A;  1YE9 A;  4LG0 B;  1RKW A;  1FIA A;  3HOS A;  2XB5 A;  5EGO A;  4S04 A;  3F8B A;  4PGH A;  3LAP A;  5E3O A;  3LSJ A;  1YIJ I;  1ENH A;  1S7O A;  2OCE A;  1QHH D;  2FBI A;  2UZK A;  1B8I B;  4I98 B;  3U1D A;  3FXQ A;  3R0J A;  2ELH A;  3SZP A;  3OYH A;  1LE8 B;  2X9D A;  1S5L C;  1EH8 A;  2LBF A;  2JA7 J;  1EH7 A;  3EDP A;  3V8J A;  3HRM A;  4IJA A;  5BOX A;  3I55 I;  5HDN A;  3M9A A;  4P9F A;  1LKX A;  1LDJ A;  2KMU A;  3MWM A;  4KJZ A;  5E8I A;  3BCB A;  3IC7 A;  2PFB A;  1JJ8 C;  4MTE A;  3OYM A;  1IN8 A;  4BNC A;  4W97 A;  1BOB A;  1POG A;  2LC2 A;  4HAM A;  2K9L A;  4A3L J;  2E71 A;  4HSR A;  3BG9 A;  1UST A;  2XF5 A;  1J09 A;  4KN7 X;  1U2W A;  3F21 A;  1FOK A;  1I50 J;  2EIN H;  3WGI A;  2PMH A;  2XVC A;  2M8G X;  5FD6 A;  2F5E A;  3LSG A;  4MEY F;  3Q0V A;  2LDU A;  2QCO A;  2XAF A;  3REO A;  3PQK A;  3RTR A;  2WY8 Q;  2HYJ A;  1B72 A;  2W82 A;  4FQG A;  5FO5 A;  3PFY A;  3ROU A;  3NEU A;  5E1Z B;  1IRZ A;  2K7L A;  2CQQ A;  3OIQ A;  1B9N A;  3TOB A;  2W48 A;  4G8X A;  1Y8R B;  5JFR A;  3NRV A;  2NS7 A;  3I64 A;  2LY9 A;  5K7Z A;  4IVN A;  4CSW A;  2RDP A;  1VQ8 I;  3ZMV A;  1U5T B;  5DD8 A;  2ZKZ A;  2L3D A;  2ZC2 A;  3LNQ A;  4NQW A;  3K70 C;  2R7X A;  2CW0 F;  2BW3 A;  3SEZ A;  4A0Z A;  1YTY A;  4H4K C;  5LHH A;  3F8C A;  4RB3 C;  3CCR I;  1MBH A;  2RQQ A;  4F55 A;  2GLO A;  1W7P D;  4A0Y A;  1KU2 A;  5E17 F;  3F8N A;  4KIT B;  4GDF A;  1L3L A;  1R49 A;  2HPM A;  2DPD A;  2X51 A;  2NOJ B;  4KIC A;  2AQF A;  3C7J A;  1IN4 A;  1SVO A;  4EV0 A;  1XN7 A;  3OY9 A;  2COB A;  2RVC A;  1JGG A;  2QBY B;  1U5T C;  1EH6 A;  3A03 A;  2A69 F;  2WBM A;  4FIS A;  4OIP F;  3S15 J;  4RAG A;  3JW4 A;  3WU1 B;  2HI3 A;  3FBI B;  1FC3 A;  1R1V A;  2GIV A;  2V9K A;  2JUG A;  3E5Q A;  3KYD B;  4JX5 A;  3IWF A;  2W25 A;  1UCR A;  2QBY A;  2RAE A;  4ZDO A;  1A6Q A;  2EV0 A;  2VB6 A;  3CCE I;  4N4N B;  1ZG5 A;  4II2 A;  1CGP A;  3ZMZ A;  3FF5 A;  4Y13 A;  1FY7 A;  2VQG A;  3MKW B;  1SFO J;  3L7W A;  3H5R A;  2X85 A;  3I59 A;  2RV8 A;  4RAF A;  5JVT A;  2QKL B;  3Q3S A;  2UV1 A;  4CCJ A;  1BI0 A;  3IV5 A;  4UB6 C;  3CJQ B;  2IGM A;  3F6O A;  4XOR A;  2E60 A;  1RC9 A;  4BBR J;  3HRU A;  2LRD A;  1RI7 A;  1OYW A;  3BR6 A;  2NVX J;  1VQO I;  4HNT A;  2JRM A;  3RKQ A;  1F9N A;  2BY3 A;  3D5L A;  5KNL A;  1WQ2 A;  2Y9Y A;  5F6F A;  3OYK A;  1GT0 C;  5F64 A;  1QVU A;  1Y1V J;  4KMU X;  4ESF A;  2GA1 A;  3T8T A;  1RR8 C;  2R3S A;  1ETQ A;  1V54 H;  4KMF A;  4YII A;  2J5P A;  3WE2 A;  3TMO A;  4EM1 A;  3OYN A;  1LDK B;  2MAB A;  5D6F A;  1BJZ A;  5ED4 A;  4N9I A;  5E3N A;  1JTX A;  4TV7 A;  2P0W A;  1YQA A;  2R4G A;  4OU0 A;  3ASO H;  1WI9 A;  4DBR A;  1WRJ A;  4CCK A;  1ZG1 A;  3GWZ A;  4RDU A;  3N4M A;  4JBA A;  3VB2 A;  2VPL A;  2DBB A;  5GAE J;  2XAU A;  3J7Y J;  5L3G A;  2BVL A;  4X0G A;  1R6R A;  1WCM J;  4HQE A;  3I54 A;  4BJT A;  2HPI A;  1MBE A;  2LKX A;  4L0Y B;  2YR2 A;  2VXZ A;  4GRI A;  3JRF A;  5ICF A;  1SAU A;  3HUG A;  2OZU A;  4I02 A;  2HOE A;  2LBF B;  1FIP A;  4WXC A;  2M3A A;  4E4H A;  5CVU A;  2IPQ X;  2ICW G;  1ZAO A;  2HNH A;  2DMU A;  5L3E A;  3CUO A;  1TW3 A;  2CW8 A;  3QAH A;  2DOE A;  1Z9C A;  3OYB A;  2P5L C;  3QOD A;  3BJ6 A;  2NXN B;  1R58 A;  1GV2 A;  4L9N A;  5HVQ C;  3TP3 A;  2DW4 A;  1OCZ H;  4E7L A;  3PSI A;  3QYE A;  1G3W A;  1O3S A;  1HKQ A;  3NWT A;  1B6A A;  1FNN A;  5IYC J;  2F5V A;  3ULQ B;  1MD0 A;  3CCY A;  4KA4 A;  1E0E A;  5E3L A;  5L3F A;  2ACJ A;  1OYY A;  3CUQ C;  4M3D A;  3JRB A;  2EIL H;  4U7B A;  4UUV A;  2L4M A;  2L9R A;  2R7V A;  1VQ5 I;  5KK1 A;  3VYU B;  1B1B A;  3GTM J;  3I9V 2;  1ETO A;  4KN4 X;  4D1Q A;  1ETW A;  1GVD A;  4L9V A;  5HDG A;  4AM3 A;  3E6B A;  3FIW A;  3NWS A;  2V1D A;  1MKM A;  3QRF F;  5BNG A;  3NAR A;  2M34 A;  4PJM A;  3IRQ A;  1VQ9 I;  3A01 A;  2W84 A;  4IHV A;  2VOP A;  2M5W A;  3ZMD A;  3OMY A;  3P7N A;  2MFZ A;  3EQL F;  3KYL A;  3PM1 A;  2Z3Y A;  5J1Y A;  1UB9 A;  3WTZ A;  4DW6 A;  1SVM A;  1ZG3 A;  3CES A;  1FYL A;  3L2V A;  1XSX A;  1A35 A;  5DD4 A;  1YW8 A;  5H2F C;  3BR1 A;  3CP2 A;  1Y39 A;  3M4O J;  3KEO A;  4JX6 A;  2DJI A;  1N75 A;  3CC7 I;  3K4M A;  3F22 A;  5FJ8 J;  2L4A A;  2K9M A;  3ZOB A;  2DOD A;  3ABK H;  2ZJR F;  2RQP A;  2IP2 A;  3H5A A;  4I99 C;  4XSX F;  5HLG A;  2R5Y A;  2GXA A;  4EJT A;  2UWM A;  4W1U A;  4I6Z A;  2YX4 A;  3O6B B;  2BBY A;  2Q8K A;  4AVZ A;  3RI4 A;  3ECO A;  3FIS A;  5GTH C;  1O3T A;  2JJ7 A;  3CDL A;  1GV5 A;  4ZYE A;  1G3S A;  3UR3 C;  1H9T A;  5ICE A;  2V6E A;  4CDG A;  2ZJP F;  3A2K A;  1CF7 A;  5IOZ A;  1B9M A;  2LKP A;  3TGN A;  3Q9S A;  2ME6 A;  2ETH A;  2F5F A;  4V19 K;  4X6A J;  2L7F P;  3K0L A;  2OUM A;  4AU7 A;  1TTY A;  3C2B A;  4G7O F;  3DPU A;  3J7A O;  1LFP A;  1SD4 A;  5AON A;  5HOO A;  3BT9 A;  1UHS A;  4HYE A;  3GFM A;  4R1H A;  2Y48 A;  2R92 J;  3IKT A;  4BYY A;  1HOM A;  1W7P A;  2ESH A;  3E0J B;  5A2Q Z;  2EFP A;  1PYV A;  2FJ1 A;  1PUF B;  2FUG 2;  5JHU A;  1VND A;  4IQ4 A;  4A6E A;  1VQK I;  1J0R A;  3VFZ A;  2Y69 H;  5DCM A;  2QZ8 A;  1JKR C;  5FLV A;  2GA2 A;  2LYC A;  2P5K A;  1PDN C;  4UUT A;  2V1N A;  2OU2 A;  4PJL A;  1IV8 A;  2RNG A;  4HV6 A;  3VYT B;  1JI8 A;  3BTJ A;  1PJR A;  4XMY A;  2BY2 A;  2KKO A;  3GZ5 A;  9ANT A;  5BQT A;  1OMI A;  3M7G A;  1SEU A;  1SVL A;  2VBZ A;  3WE3 A;  3SEQ A;  1ZYR F;  1SFX A;  2V26 A;  2XKP A;  2OC6 A;  1MBF A;  1JUM A;  4ZYA A;  4D7M A;  1QZE A;  3RDI A;  4BAC A;  1BM9 A;  6PAX A;  2GOM A;  4ENK A;  2WAQ A;  2K27 A;  3E3V A;  3MAJ A;  4BHB A;  4MFD A;  4IHX A;  3HYI A;  4XKC A;  4UY8 I;  2CO5 A;  5DCM B;  3JSP A;  1GDT A;  3BZC A;  4BXX J;  4ZDL A;  2CQ7 A;  1UFM A;  1D5Y A;  3AFH A;  3BLY A;  4M6X A;  3B02 A;  1C0W A;  3J7A Y;  3JTG A;  1S72 I;  3VOD A;  3RQ4 A;  2JA6 J;  2M45 A;  4C2U A;  1QHG A;  1QVT A;  1PUF A;  1Z91 A;  3H36 A;  5D8L B;  3T5X A;  1GXQ A;  1K61 A;  3JAM Z;  2DAO A;  4PFO A;  5D4R A;  4AID A;  1X3W B;  1W0T A;  4IHS A;  1S3J A;  2F5D A;  3CUQ B;  4HDV A;  3MZ8 A;  4HX8 A;  3C1D A;  2DTR A;  2I8D A;  1Y1W J;  2NOG A;  1P2F A;  3GW2 A;  1VQ4 I;  1S8N A;  3FK7 A;  3KZY A;  1MBJ A;  1QO0 D;  3GFL A;  1R71 A;  2HEO A;  2A68 F;  3GCM A;  1TQI A;  2P6S A;  3OYL A;  4GYG A;  4F52 A;  4HF2 A;  2L2O A;  2DT6 A;  1CF7 B;  4IL6 C;  1JHF A;  3W6J B;  3CME I;  4EGZ A;  4XRS A;  2CWE A;  4HNU A;  1X2N A;  2JUC A;  2RRE A;  3CMM A;  4CXF A;  5FRN A;  1LFB A;  1ZKG A;  2XAQ A;  5CQG A;  1BJA A;  2HZD A;  3ZMT A;  2Y9Z A;  4D7N A;  2CJJ A;  5CVR A;  2H6B A;  3HOU J;  1JKO C;  3FK6 A;  1QPM A;  2DI3 A;  1E17 A;  1ZRD A;  5J47 A;  1WJE A;  4A6D A;  5M3F J;  3HBL A;  4D0P A;  2VKH A;  1HW1 A;  1W5C C;  4MLO A;  4B1R A;  2HU9 A;  1Q1H A;  2JVG A;  2K3F A;  4HLX A;  4BDZ A;  4F92 B;  1O57 A;  4ZC3 A;  4KT6 A;  4F3Q A;  4AYB N;  1RRJ A;  2K4B A;  2A61 A;  4I09 A;  1LB2 A;  4E7K A;  4CCO A;  1YIT I;  4XM3 A;  1YRN B;  4NHJ A;  2Y0M A;  2DXI A;  1T95 A;  4HEA 2;  4XKW A;  2CW7 A;  2FSW A;  5ICG A;  3GME A;  4ZYG A;  2L02 A;  3M07 A;  4HA8 A;  3FBN B;  2WC2 A;  4NC8 A;  4M3E A;  4C9Y A;  2K02 A;  3FKJ A;  5EZH A;  3TDZ C;  1HKS A;  3LA2 A;  2KIU A;  4K2E A;  1EA3 A;  1GVJ A;  2WA0 A;  4BE0 A;  1U9N A;  5BS6 A;  3A01 B;  2PMU A;  1Y56 A;  2AHQ A;  1XSD A;  1YW9 A;  2HQ5 A;  1XMA A;  3JAM K;  2VOD A;  2CV1 A;  1R00 A;  3CP8 A;  2STW A;  3M3Y J;  3ZN0 A;  2Z2S B;  3DKW A;  5GP9 A;  3HRT A;  1BOA A;  2E1M C;  4QWQ A;  1WZ2 A;  2M0C A;  3FXM A;  4XKV A;  5TGT A;  5M5X J;  4XLP F;  2JA8 J;  2DDB A;  1MDM B;  1ZRC A;  4CA0 A;  1FX7 A;  2OF7 A;  3FXJ A;  1V55 H;  3BCA A;  3GUD A;  1HBX G;  1IGN A;  3HKZ N;  5J3L A;  3BG5 A;  3DXJ F;  4ENN A;  2BE5 F;  2YU9 J;  3S14 J;  1W5S A;  3BY6 A;  5IPA A;  3GLL A;  2OPT A;  4EJU A;  1RUN A;  1JE8 A;  2OQG A;  4BXU A;  4ENJ A;  2R7D A;  2HGC A;  3GTL J;  2QUF A;  3BDD A;  4Y7N J;  2DK8 A;  1FYK A;  4RGS A;  2OQR A;  3ELK A;  3GFJ A;  3RYP A;  3OYG A;  3A02 A;  3QOP A;  1O3R A;  1T08 B;  1XGM A;  2JT1 A;  1KYW A;  3CCM I;  3S16 J;  1VQ6 I;  4XON A;  4XLA A;  5LD2 C;  4RAZ A;  1TWC J;  2XIG A;  2YSR A;  3D5S C;  3EUH A;  1E3O C; 
#chains in the Genus database with same CATH homology
 3J80 K;  3S2W A;  1U3E M;  3MZY A;  3MCZ A;  1PP8 F;  2QWW A;  1FZP B;  1BI3 A;  1KU9 A;  1D5V A;  1IN7 A;  1XDS A;  2AS5 F;  3QU3 A;  1SD6 A;  3EYY A;  2ZJ2 A;  5ILV A;  1T39 A;  1O7F A;  1ODD A;  4IRH A;  5IT3 A;  3K69 A;  3LA7 A;  1TBX A;  4UXN A;  3VOE A;  4OIQ F;  4EJO A;  2LF7 A;  3SHF A;  5L3D A;  3TKY A;  2ZFW A;  4E70 A;  5E18 F;  3K1M A;  3ERE D;  3P9K A;  2VC1 A;  1FWZ A;  3ZN1 A;  1YS6 A;  2VOO A;  1JHH A;  1SFU A;  3O3K A;  2DU9 A;  2XUB A;  2FF4 A;  5TJJ A;  2QEN A;  3I59 B;  5L3C A;  2RGV A;  3KP4 A;  2VE9 A;  2RNJ A;  2DT5 A;  1YIO A;  3HRS A;  1R5G A;  1TQP A;  1JXS A;  3CTA A;  1ON1 A;  2FMY A;  5F1R A;  3WTX C;  5LLQ A;  5TRD A;  2MBF A;  4MQ9 F;  2OAZ A;  3TO7 A;  4ZYH A;  1R5H A;  2EFO A;  2M30 A;  1T6S A;  1P6R A;  3IHU A;  1R1T A;  5J8C A;  3QP6 A;  2OA4 A;  2E7W A;  3T1B A;  2DFI A;  3E6D A;  2K86 A;  3GFI A;  5DCF A;  5JI6 A;  2AXL A;  4M9X A;  1D3Y A;  4OIO F;  1U5T A;  2WWY A;  2VE8 A;  2ZNY A;  3KP2 A;  2BGC A;  3D0S A;  4WX9 A;  3T0Y A;  4BHC A;  3ZMS A;  2VT3 A;  3MEX A;  3KFW X;  1IUY A;  3GXO A;  3HIF A;  2A6E F;  3FZV A;  4EVI A;  4UNO A;  5D5V B;  4LFU A;  4N9H A;  1RIO H;  4Q48 A;  3DQV C;  4EJW A;  3KEQ A;  5LRR A;  2GXG A;  3F8M A;  5AIP A;  2PEX A;  2PJP A;  3GYH X;  1R36 A;  1D8J A;  1B4A A;  3RPU A;  1BI1 A;  1P4A A;  4XLN F;  5ILS A;  3TDU C;  4GXO A;  1KQ9 A;  3V7C A;  1J59 A;  4FT8 A;  4KDP A;  4UHT A;  2MH9 A;  3LQR A;  2LNB A;  4ZZL A;  2HZT A;  2P8T A;  1J5Y A;  4I0A A;  1G4D A;  2X4H A;  5CYV A;  2XKO A;  3NQO A;  4FX4 A;  5HS7 A;  2KJB A;  5H6R A;  5LHI A;  1F4K A;  5CVI A;  1ZGA A;  4LG0 A;  2EV5 A;  2HTS A;  3BPX A;  3L2C A;  2FA5 A;  2MC3 A;  1E2X A;  4O3M A;  3ABT A;  4HLY A;  3B73 A;  4M71 A;  3HSR A;  3QPH A;  1Y0U A;  4G6Q A;  2FOK A;  2KIF A;  3WGG A;  2NS0 A;  3E6M A;  4MEX F;  4QLC U;  1V3F A;  1KU7 A;  1XCB A;  1IXR C;  2VT2 A;  2EFN A;  2HWV A;  3BJA A;  5LGU A;  4YFN F;  3KP5 A;  2HR3 A;  5FGM A;  2IT0 A;  3FHZ A;  1I27 A;  4IRG A;  5DUI A;  1SMY F;  2MLG A;  1IW7 F;  2DLL A;  3IWZ A;  2V9V A;  2XRN A;  2IW5 A;  1D8K A;  1MJB A;  1BC7 C;  1HKT A;  4UV9 A;  2CYY A;  1QBJ A;  2ZME B;  2GXB A;  4HZF A;  4AWX B;  4OMZ A;  1WKM A;  1XCV A;  4BH9 A;  1R22 A;  1ONV A;  2B0L A;  4U0W A;  2EFW A;  2HYG D;  1BN5 A;  2IRF G;  5LGN A;  3GZ6 A;  4N0B A;  4ASN A;  3BRO A;  1ZN2 A;  2GQQ A;  3I71 A;  3TO9 A;  1U8R A;  2FML A;  3JTH A;  4CO8 A;  2FBH A;  1TNT A;  3KET A;  2PLY A;  1ZRE A;  5L3B A;  2PI0 A;  2IA2 A;  4MGR A;  4P55 A;  2LF8 A;  1YYV A;  4XSZ F;  1YG2 A;  2P4W A;  4M9Z A;  3RKX A;  4M73 A;  5FB2 A;  1K79 A;  3DEU A;  3BP8 A;  4A0X A;  3F72 A;  4WXD A;  3FM3 A;  5E1X A;  3VEP A;  1LQ1 A;  1S6L A;  1SAX A;  3T8R A;  2XHK A;  1KYZ A;  2NYX A;  3Q9V A;  1K78 A;  3GO5 A;  4HV5 A;  4M74 A;  2KJC A;  4RAY A;  3K9T A;  5K5Q A;  4OMY A;  2V6C A;  3SQN A;  4P9U A;  3CDH A;  5D5U B;  3G73 A;  2O6G E;  3ECH A;  4Q47 A;  1FBS A;  4ZZD A;  2GAU A;  5FLX Z;  2JRT A;  4RB0 A;  3GLX A;  3RYR A;  4LGW A;  4Q5S F;  2DK5 A;  2PN6 A;  5FFX A;  2HKX A;  3ZQ7 A;  4GYI A;  4HF0 A;  4U0V A;  1OPC A;  2Q2E A;  1XD7 A;  5LEK A;  2EJR A;  3I58 A;  3RJP A;  5CLS A;  4ESJ A;  1FLI A;  4UVC A;  1SD5 A;  5K5R A;  2ZCW A;  5ICC A;  2P6T A;  2PBI A;  4EJV A;  1XSV A;  3ML6 A;  1XGS A;  4MHG A;  3SFZ A;  4AIH A;  2HKO A;  5AIQ A;  2HDC A;  1R7J A;  2F2E A;  3KZZ A;  3JSO A;  3ZP5 A;  4L0Z B;  2Z99 A;  2Y75 A;  2XAH A;  1U78 A;  3TQN A;  1QNT A;  3FX3 A;  1ZAR A;  3BPV A;  5K5O A;  3W6K B;  5E1W A;  3LST A;  4PCQ A;  5HLH A;  4HX7 A;  3WG9 A;  4BAY A;  4LK1 F;  5BPD A;  1WSU A;  2O8X A;  3L09 A;  2IVM A;  4G7Z F;  3E5X A;  4L9J A;  3I53 A;  4PGG A;  3H3Z A;  2EA2 A;  1TNS A;  2H94 A;  3MFK A;  1T2K A;  2G7U A;  1B59 A;  1DUX C;  2CQK A;  2VBW A;  2V1X A;  2DQL A;  4RB1 A;  3LQQ A;  2PQ8 A;  4L5I A;  2P7V B;  3SXY A;  1FP2 A;  5DV5 A;  3DPT A;  4WK8 F;  3J80 Z;  1HXD A;  3KP3 A;  4ZYD A;  4FX0 A;  4JK1 X;  4R79 A;  4I0B A;  4EQQ A;  3ISP A;  5FFZ A;  2FRH A;  2RC4 A;  4EM2 A;  3R6S A;  3BWG A;  2UXN A;  4O5V A;  3RKW A;  1LNW A;  2YPR A;  1KQ8 A;  1TW2 A;  1FYM A;  5D8K B;  2MLK A;  2A5Y B;  3QP5 A;  4IF4 A;  4OIN F;  1J9I A;  5LEJ A;  2G7H A;  2H09 A;  2OZ6 A;  4UV8 A;  2ZNZ A;  3GF2 A;  1UHW A;  1W4M A;  1LJ9 A;  1ZGJ A;  1RZ4 A;  2XAJ A;  3OOP A;  4LJZ F;  2P7C B;  4LK0 F;  1K78 B;  5ERI A;  2QQA A;  2KRF A;  3N97 A;  2JPC A;  4HX4 A;  1K6O A;  4LLN A;  3DPL C;  2ISY A;  2M87 A;  4CZZ A;  4HOB A;  5EEG A;  5BPI A;  3WTT C;  4KFC A;  1YLF A;  1P4X A;  4ON0 A;  1I1G A;  2D1H A;  5D5W B;  4IXA A;  4P96 A;  2E7X A;  3V7R A;  2A6H F;  1O3Q A;  1IAW A;  1XDU A;  4KIB A;  2V1U A;  3L9F A;  3FMS A;  4XRF A;  2CFX A;  2L01 A;  1TLH B;  3HHH A;  4AD9 A;  2OBP A;  5H20 A;  3TOA A;  2P5V A;  3R0A A;  1O7L A;  4UVB A;  3K1P A;  5IT9 K;  1DPU A;  1IZ1 A;  2EWN A;  2STT A;  1OR7 A;  4M72 A;  4I2O A;  2K4J A;  3TO6 A;  3BZ6 A;  3IKV A;  4YFK F;  4A2U A;  5LHG A;  2R7F A;  1OKR A;  3F6V A;  5A2Q K;  2G9W A;  1BIB A;  3V7S A;  1MJ9 A;  4CGZ A;  3PFI A;  1IN6 A;  4BQA A;  3DFG A;  1MZB A;  2E1C A;  3V8L A;  4DQ2 A;  1FBU A;  3CLO A;  2RN7 A;  2XRO A;  3V8K A;  4Y17 A;  2JTV A;  4ETS A;  2CG4 A;  3DV8 A;  1STZ A;  4EGY A;  2HS5 A;  1J2X A;  2Z33 A;  3M1E A;  2D45 A;  2M8E A;  1V4R A;  2D1V A;  2LSO A;  3ZPL A;  3F8F A;  1Z6T A;  5LGT A;  3MQ0 A;  5KVR A;  1J7K A;  4A5M A;  3V4G A;  2FQ3 A;  2E1N A;  3L00 A;  3HSF A;  3IRR A;  2HFH A;  1T98 A;  4RB2 C;  1VTN C;  5HS9 A;  3I4P A;  2VN2 A;  1YW7 A;  4KYW A;  5J8F A;  2EA4 A;  5ILU A;  4U88 A;  2C6Y A;  4WXH A;  2A3S A;  3KE2 A;  4LB6 B;  5E8G A;  3HSE A;  4G6D A;  4OOI A;  4ENM A;  3GX4 X;  4U0Y A;  4Z2Y A;  2A07 F;  2QQB A;  2QQ9 A;  3FMR A;  2BYV E;  2GWR A;  2F5C A;  1XGO A;  4YFX F;  4IHT A;  3WGH A;  3ZMU A;  3LA3 A;  1PUE E;  2RKH A;  4G7H F;  4NB5 A;  4HW0 A;  2YU3 A;  1IRG A;  3M8F A;  2NAZ A;  2H27 A;  1IF1 A;  4M6Y A;  3CO7 C;  2KIM A;  5K1Y A;  4HBL A;  2QM3 A;  4UVA A;  1YO5 C;  4I01 A;  4JQF A;  1I5Z A;  3RPQ A;  4IRI A;  3KP6 A;  1KA8 A;  2ISZ A;  2QYO A;  3OV8 A;  2BEO A;  5FD5 A;  3C3W A;  3FXR A;  1R23 A;  1RNL A;  4G94 A;  1F1Z A;  3H3U A;  2YX7 A;  1BBY A;  2UXX A;  3FWE A;  4KUM A;  2BV6 A;  3RKY A;  3E6C C;  2ZBK A;  3EYI A;  5HDK A;  4HF1 A;  2O61 A;  2W85 A;  3HTU A;  1IN5 A;  3WU0 A;  3LWF A;  2VBX A;  1I1S A;  4AVP A;  4YIF A;  1P4W A;  2CGP A;  1JGS A;  2MD5 A;  1AWC A;  5IT9 Z;  2MH2 A;  4L9T A;  1J75 A;  1YFH A;  3DP7 A;  3K1N A;  2HQN A;  1FPQ A;  4CIC A;  1NHA A;  2FNA A;  1S7A A;  1H0M A;  4CYD A;  1KQ0 A;  1AOY A;  4DNC A;  3KLN A;  2HTJ A;  2MA3 A;  3E97 A;  1ZLJ A;  4OIR F;  1ZLK A;  5LRS A;  1FBQ A;  5DDG A;  2NNN A;  4P5O A;  3QPT A;  1WWX A;  1G6N A;  2TDX A;  4HQM A;  2FU4 A;  3I5U A;  5DEQ A;  4B09 A;  1T38 A;  3GVA A;  3R4K A;  4AIK A;  1Z6R A;  1KGS A;  1X3U A;  4AIJ A;  4O6J A;  1ON2 A;  4ZH4 F;  3P9C A;  4KT5 C;  5E20 A;  2EFQ A;  3FXU A;  2JSC A;  5HLI A;  5D4S A;  1BIA A;  1YS7 A;  1HSJ A;  3EET A;  3LAJ A;  1I6X A;  2VBY A;  2EV6 A;  4HDU A;  4MTD A;  3GEZ A;  2J5O A;  5BMZ A;  4Q4Z F;  5DYM A;  1LEB A;  3ABU A;  3M8E A;  1FSH A;  3KCC A;  1FP1 D;  1HQC A;  5CJ9 A;  1USS A;  5HS8 A;  3H92 A;  1T0F A;  4IPA A;  4RS8 A;  2W57 A;  2EB7 A;  1QZY A;  1DP7 P;  2NRA C;  3KP7 A;  2JZY A;  1MJA A;  3COA C;  4RGR A;  4GO1 A;  3J81 Z;  2ADU A;  3F3X A;  4WF2 A;  1MDM A;  3SZT A;  5EEH A;  4F7Z A;  4M9S A;  1ZRF A;  2OD5 A;  1ZHF A;  4RGX A;  4LB5 A;  4LMY A;  1SMT A;  3U9G A;  4YG2 F;  3WOD F;  2GZW A;  5J6X A;  5FLX K;  2DPU A;  1XMK A;  2HYF A;  4MNU A;  3G3Z A;  1G3Y A;  3K2Z A;  1QZZ A;  2O3F A;  1F5T A;  2NNY A;  2EK5 A;  4L5J A;  2FXA A;  3R60 A;  1P92 A;  3QU6 A;  2M1B A;  1ZH5 A;  2CSO A;  5CVV A;  3CO6 C;  1LEA A;  2COM A;  3O2P E;  2H6C A;  3E5U A;  2IA0 A;  3BJO A;  3AAF A;  3CJN A;  3BOQ A;  3FMQ A;  2HQR A;  4EMS A;  2D2W A;  1SD7 A;  3U2R A;  3F23 A;  1KU3 A;  4CHU A;  1Z1D A;  1LVA A;  2VON A;  1G3T A;  3CUQ A;  2O0Y A;  1Z05 A;  1OYI A;  1QGP A;  2FBK A;  2JPB A;  4GGG A;  4LLG F;  1IRF A;  2PG4 A;  1IXS B;  4KNY A;  3R61 A;  1FT9 A;  1ULY A;  2XGX A;  2FE3 A;  1BC8 C;  2WV0 A;  2XV4 S;  3IL2 A;  5DUK A;  2FNP A;  4A12 A;  1A04 A;  1DDN A;  4GCV A;  4MQV A;  4EM0 B;  3WTW C;  3DF8 A;  2QLZ A;  4LLL A;  2IJL A;  1H9G A;  1FSE A;  1XGN A;  3P9I A;  4KIF A;  1EV7 A;  5LBQ A;  3WTY C;  1U6G A;  2L54 A;  5JR3 A;  1HW5 A;  2Z5U A;  1REP C;  3I0T A;  3MZH A;  4H0E A;  4WCG A;  1TQM A;  1W7P B;  2ZXJ A;  4PZJ A;  4S05 A;  3J81 K;  1R1U A;  4A5N A;  1W5T A;  3Q5F A;  4U7D A;  3HHG A;  1SFE A;  1K7A A;  2VC0 A;  1GHC A;  5D6E A;  2ZO4 A;  1MGT A;  1BI2 A;  4PDK A;  2XAS A;  1GXP A;  3WTU C;  2ZME A;  2Z9O A;  3RIR A;  2Q0O A;  5H6Q A;  2O03 A;  4G9Y A;  4XBF A;  1RUO A;  2ESN A;  4Y15 A;  3C18 A;  3WTS C;  3HTS B;  4B8X A;  3HOT A;  4WWC A;  1DPR A;  5D5X B;  1UHM A;  3KLO A;  4R8H A;  1HST A;  2X0L A;  5CVJ A;  4KIG A;  3FM5 A;  2WTE A;  1XB4 A;  2QVO A;  2DO7 A;  2XAG A;  4I7H A;  4LD5 A;  1IXC A;  1LDD A;  2W24 A;  2IA1 A;  1PP7 U;  2V79 A;  4BHP A;  2DQR A;  3WTV C;  1HW2 A;  2FEZ A;  1S29 A;  3LFK A;  1Z7U A;  4RGU A;  3PQJ A;  4L18 B;  4FHT A;  1L0O C;  4ESB A;  1QQI A;  4LG0 B;  3HOS A;  4S04 A;  3F8B A;  4PGH A;  3LAP A;  1S7O A;  2FBI A;  2UZK A;  4I98 B;  3U1D A;  3FXQ A;  3R0J A;  2ELH A;  3SZP A;  1EH8 A;  1EH7 A;  3EDP A;  3V8J A;  3HRM A;  4IJA A;  5BOX A;  5HDN A;  3M9A A;  4P9F A;  1LDJ A;  3MWM A;  5E8I A;  3IC7 A;  2PFB A;  4BNC A;  4MTE A;  1IN8 A;  4HAM A;  1UST A;  4KN7 X;  1U2W A;  3F21 A;  1FOK A;  3WGI A;  2PMH A;  2XVC A;  5FD6 A;  2F5E A;  4MEY F;  2LDU A;  2XAF A;  3REO A;  3PQK A;  3RTR A;  5FO5 A;  3ROU A;  3NEU A;  5E1Z B;  2K7L A;  1B9N A;  3TOB A;  4G8X A;  5JFR A;  3NRV A;  3I64 A;  4IVN A;  2RDP A;  3ZMV A;  1U5T B;  5DD8 A;  2ZKZ A;  2L3D A;  4NQW A;  2CW0 F;  4A0Z A;  1YTY A;  5LHH A;  3F8C A;  4RB3 C;  1W7P D;  4A0Y A;  1KU2 A;  5E17 F;  3F8N A;  1L3L A;  2DPD A;  4KIC A;  3C7J A;  1IN4 A;  4EV0 A;  1XN7 A;  2RVC A;  2QBY B;  1U5T C;  1EH6 A;  4OIP F;  2A69 F;  3WU1 B;  3JW4 A;  3E5Q A;  1FC3 A;  1R1V A;  2GIV A;  3IWF A;  2W25 A;  1UCR A;  2QBY A;  2EV0 A;  1ZG5 A;  1CGP A;  3ZMZ A;  3FF5 A;  4Y13 A;  1FY7 A;  3L7W A;  3I59 A;  2RV8 A;  5JVT A;  1BI0 A;  3F6O A;  3HRU A;  1RI7 A;  1OYW A;  1F9N A;  3D5L A;  1WQ2 A;  5F6F A;  5F64 A;  4KMU X;  4ESF A;  2GA1 A;  3T8T A;  2R3S A;  4KMF A;  4YII A;  2J5P A;  3WE2 A;  4EM1 A;  1LDK B;  5D6F A;  5ED4 A;  4N9I A;  4TV7 A;  1YQA A;  4OU0 A;  1WI9 A;  1WRJ A;  1ZG1 A;  3GWZ A;  3N4M A;  4JBA A;  3VB2 A;  2DBB A;  5L3G A;  4HQE A;  3I54 A;  4L0Y B;  2YR2 A;  2VXZ A;  5ICF A;  3HUG A;  2OZU A;  4I02 A;  2HOE A;  4WXC A;  5CVU A;  2IPQ X;  1ZAO A;  5L3E A;  3CUO A;  1TW3 A;  3QAH A;  1Z9C A;  2P5L C;  3BJ6 A;  1R58 A;  4L9N A;  5HVQ C;  2DW4 A;  1G3W A;  1O3S A;  1HKQ A;  1B6A A;  1FNN A;  3ULQ B;  1MD0 A;  4KA4 A;  5L3F A;  2ACJ A;  1OYY A;  3CUQ C;  4U7B A;  4UUV A;  2L4M A;  5KK1 A;  1B1B A;  4KN4 X;  4L9V A;  5HDG A;  3E6B A;  2V1D A;  1MKM A;  3QRF F;  3IRQ A;  2W84 A;  2VOP A;  2M5W A;  3ZMD A;  3P7N A;  3EQL F;  2Z3Y A;  1UB9 A;  3WTZ A;  1ZG3 A;  1FYL A;  1XSX A;  5DD4 A;  1YW8 A;  3KEO A;  3F22 A;  2L4A A;  2RQP A;  2IP2 A;  4XSX F;  5HLG A;  4EJT A;  2UWM A;  2YX4 A;  3O6B B;  2BBY A;  2Q8K A;  3RI4 A;  3ECO A;  1O3T A;  4ZYE A;  1G3S A;  1H9T A;  5ICE A;  4CDG A;  1CF7 A;  1B9M A;  2LKP A;  3TGN A;  3Q9S A;  2ETH A;  2F5F A;  3K0L A;  1TTY A;  4G7O F;  3J7A O;  1SD4 A;  5AON A;  5HOO A;  4HYE A;  3GFM A;  4R1H A;  2Y48 A;  3IKT A;  4BYY A;  1W7P A;  2ESH A;  5A2Q Z;  2EFP A;  5JHU A;  4A6E A;  1J0R A;  3VFZ A;  5DCM A;  2QZ8 A;  2GA2 A;  2P5K A;  1PDN C;  2OU2 A;  4HV6 A;  2KKO A;  3GZ5 A;  5BQT A;  1OMI A;  3M7G A;  2VBZ A;  3WE3 A;  1ZYR F;  1SFX A;  2XKP A;  3RDI A;  1BM9 A;  6PAX A;  4ENK A;  2K27 A;  3E3V A;  3MAJ A;  4BHB A;  3HYI A;  2CO5 A;  5DCM B;  3JSP A;  1UFM A;  4M6X A;  3B02 A;  1C0W A;  3JTG A;  3VOD A;  2M45 A;  1Z91 A;  5D8L B;  3T5X A;  1GXQ A;  3JAM Z;  2DAO A;  5D4R A;  4IHS A;  1S3J A;  2F5D A;  3CUQ B;  4HDV A;  4HX8 A;  3C1D A;  2DTR A;  1P2F A;  3GW2 A;  1S8N A;  3KZY A;  1QO0 D;  3GFL A;  2HEO A;  2A68 F;  1TQI A;  2P6S A;  4GYG A;  4HF2 A;  1CF7 B;  1JHF A;  3W6J B;  4EGZ A;  2CWE A;  4CXF A;  2XAQ A;  1BJA A;  3ZMT A;  5CVR A;  2H6B A;  1QPM A;  2DI3 A;  1E17 A;  1ZRD A;  4A6D A;  4D0P A;  1HW1 A;  1Q1H A;  4HLX A;  1O57 A;  2K4B A;  2A61 A;  4I09 A;  1LB2 A;  4NHJ A;  2Y0M A;  2FSW A;  5ICG A;  4ZYG A;  2L02 A;  4HA8 A;  2WC2 A;  2K02 A;  3TDZ C;  1HKS A;  3LA2 A;  2KIU A;  4K2E A;  1GVJ A;  5BS6 A;  2PMU A;  1XSD A;  1YW9 A;  1XMA A;  3JAM K;  2VOD A;  1R00 A;  2STW A;  3ZN0 A;  3DKW A;  3HRT A;  1BOA A;  4QWQ A;  4XLP F;  1MDM B;  1ZRC A;  1FX7 A;  3GUD A;  1HBX G;  3DXJ F;  4ENN A;  2BE5 F;  1W5S A;  3BY6 A;  4EJU A;  1RUN A;  1JE8 A;  2OQG A;  4BXU A;  4ENJ A;  2R7D A;  2HGC A;  2QUF A;  3BDD A;  1FYK A;  2DK8 A;  4RGS A;  2OQR A;  3ELK A;  3GFJ A;  3RYP A;  3QOP A;  1O3R A;  1XGM A;  2JT1 A;  1KYW A;  4RAZ A;  2XIG A;  2YSR A;  3EUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...