5HLGA

Structure of reduced abfr bound to dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
134
Chain Sequence
QEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLETKYVFEELEQTLKHLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords DNA (5'-D(*TP*AP*AP*CP*TP*CP*AP*AP*TP*CP*GP*CP*GP*CP*GP*CP*G
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
total genus 48
structure length 134
sequence length 144
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hlgA00
4BHBA 1R22A 4RAYA 2IRFG 2DQLA 2ZMEB 5H6RA 4GO1A 2ZKZA 1TW3A 1OYIA 3TO7A 2PMHA 1GHCA 5D6FA 5LEKA 2EFOA 3ABUA 5HDNA 5DDGA 2Q0OA 5LHIA 2GXGA 2NAZA 1Z9CA 3BJAA 1Z1DA 5ILVA 2E1CA 2W84A 4HV5A 3DV8A 3EQLF 1LB2A 1CF7A 3I4PA 1PP7U 1K6OA 4G94A 3LAPA 1J0RA 4OMZA 1IN5A 1IRFA 5LRRA 3ZMTA 4M6XA 3P7NA 3RI4A 2KIUA 1FY7A 3I58A 2XIGA 1XSVA 2FSWA 3K1NA 3KP5A 5K5RA 2QENA 4M73A 5ILSA 4G6DA 5HVQC 1W7PA 3PFIA 3ZN0A 3IRRA 1XD7A 4G9YA 5HDGA 2P5VA 4LD5A 1IW7F 2IP2A 2A68F 4KDPA 3BY6A 3R60A 3QRFF 2A6HF 4OIRF 5K5QA 4KMFA 4A5MA 2HQRA 1FOKA 2YX4A 1KQ9A 4HQMA 1C0WA 2PBIA 1FYKA 2QQBA 1AWCA 2STWA 4EJOA 3TGNA 1SMTA 5F64A 4MTEA 1MJAA 5D5WB 3T8RA 2NS0A 3J81Z 4IPAA 4EMSA 3TOAA 1I5ZA 2IPQX 2D1VA 3EETA 2NRAC 3T8TA 2E1NA 4YG2F 4OOIA 1YYVA 1ZHFA 1YW7A 4I98B 1IUYA 1L3LA 2PJPA 2JSCA 2QLZA 1B9MA 2HOEA 4KN4X 4DNCA 2FQ3A 5JVTA 1FPQA 3QP6A 4QLCU 2HKOA 5HS7A 1OYWA 1HQCA 1WRJA 4YFXF 5L3BA 2P8TA 2CO5A 4Q4ZF 1H9GA 5L3CA 2EWNA 4U0WA 1SAXA 2JPBA 4RB3C 3BJ6A 1U5TA 4GXOA 5DD8A 1QZZA 3TO9A 2VBWA 4RGSA 4ZZLA 5D5XB 4DQ2A 3OV8A 4HA8A 1F5TA 4I01A 2DO7A 3I54A 3WG9A 4KIGA 2H94A 4IRIA 1W4MA 4G7ZF 2Z33A 2YSRA 2HYGD 1F4KA 5TRDA 2XAGA 2BV6A 4UVBA 2QBYB 3GZ6A 2VC0A 5E17F 2DPDA 2XASA 1DPRA 5E20A 4ENNA 2VOPA 2W25A 2NNYA 2GWRA 1HSJA 5CYVA 3IC7A 2X0LA 4P96A 1CF7B 2DW4A 2A07F 4MQ9F 4L9TA 1ZG1A 1TNSA 3E6BA 1ZAOA 1KQ8A 2DK5A 1R23A 1O3SA 2MLGA 5LGTA 3W6JB 5J6XA 4Y17A 3GFJA 2A61A 3RKWA 4BAYA 4L5JA 1E17A 2EB7A 1W7PB 2FE3A 3NEUA 1FP2A 3JW4A 1FX7A 4KYWA 2OAZA 1REPC 4LK0F 1V3FA 2BEOA 2L4AA 3BPXA 5DEQA 1EH7A 4FX0A 1F1ZA 2O61A 5D8KB 3E5XA 3COAC 3GEZA 2Z99A 3L09A 4FT8A 4KNYA 1FWZA 1FC3A 1KU7A 3WU1B 1G6NA 1P4AA 2MA3A 2HKXA 1BIBA 3M7GA 4ZYGA 4G7OF 3CTAA 3V4GA 2FBKA 4HBLA 3MQ0A 3MZHA 1EV7A 4MEYF 5HLIA 3E3VA 1Z6TA 4Q47A 3ZMVA 2FF4A 1TQIA 4I0BA 3CLOA 1Z6RA 2UXXA 3RJPA 1WSUA 3WTYC 1QQIA 4YIFA 4BQAA 5FGMA 2MLKA 1KQ0A 2F2EA 3HSRA 3Q9VA 1IN8A 1U5TB 5DCMA 1T6SA 2Z3YA 4ENKA 3O3KA 5HDKA 2VOOA 1DUXC 4L18B 1BN5A 1B9NA 1U78A 3HTUA 1QGPA 3M1EA 1YS7A 3TDUC 5AIPA 3I0TA 1HKQA 3ML6A 4CO8A 2BE5F 1PP8F 2XVCA 3FMQA 2CW0F 2ZMEA 3MWMA 3V8KA 2RDPA 2PN6A 1ZGAA 1ZRFA 5A2QZ 4HQEA 4R1HA 4KIBA 1K7AA 3GYHX 1UFMA 1TW2A 3L2CA 1XCVA 2RGVA 4HLYA 2DTRA 5F1RA 1XSXA 4UUVA 3SFZA 4EQQA 3EYYA 1W7PD 3EDPA 2FBHA 5BQTA 1HBXG 3SZTA 3H3ZA 1ONVA 2HZTA 4KMUX 4L9JA 3S2WA 5E1WA 3OOPA 1BOAA 1XGNA 3RKXA 2RC4A 2V79A 5ED4A 4HX8A 3QPTA 3JTGA 4MTDA 1LEAA 1XMAA 4IRHA 5IT9K 1H0MA 3ROUA 2TDXA 3CO7C 5DYMA 5L3GA 2F5CA 2GAUA 2R7FA 1A04A 4UVAA 4ZYDA 2PI0A 3CUQA 1FYMA 1Q1HA 4LJZF 2QVOA 3O6BB 2O6GE 3I64A 3BOQA 1BM9A 2EA4A 1BC8C 1TNTA 3ZN1A 3GFLA 3EYIA 5HS9A 2YX7A 3R61A 3Q5FA 2QWWA 4AWXB 5K1YA 1HXDA 1G3WA 3ZQ7A 4XBFA 1B6AA 3KP6A 3GXOA 4BH9A 2ZO4A 5LEJA 3ISPA 1WI9A 5H6QA 3WTZA 5K5OA 3LQRA 3NRVA 3JSOA 3RKYA 1QBJA 4P9UA 2A69F 2EV0A 2DK8A 2K86A 1XN7A 4EM2A 1I27A 2FNPA 2V1XA 4RS8A 1XGOA 3BP8A 3F22A 3BWGA 3WU0A 1T2KA 5KVRA 3DPTA 4EGYA 2VE8A 5LRSA 2HS5A 1FSHA 3IHUA 1O3QA 2XRNA 2QYOA 1ZARA 3HYIA 4LK1F 2W24A 3F3XA 4OINF 2A3SA 2RN7A 1MJ9A 1ZYRF 4B09A 1YIOA 2LF7A 2O03A 1LDKB 5BS6A 3HHGA 2QBYA 2L4MA 2GQQA 2HTJA 1K78A 2V9VA 3BZ6A 1PDNC 2EFWA 2COMA 1OPCA 4KUMA 4M74A 1O57A 3GW2A 3ZMDA 4LGWA 2AS5F 5ICGA 3FWEA 1HW5A 1ULYA 3F21A 2ISYA 2VN2A 3LAJA 1EH8A 1JGSA 1QNTA 3F8MA 2P5KA 1J5YA 4O6JA 2H6CA 3F8NA 3KP3A 1TTYA 2EFPA 2JT1A 3IRQA 4N0BA 2JRTA 4ZH4F 5HLGA 4G6QA 1R36A 3CUQB 4ESJA 1KYZA 4I7HA 4KICA 4JQFA 4IHTA 1BI0A 1UHWA 3K0LA 4N9HA 2KIMA 2OU2A 4YFKF 1XSDA 3Q9SA 1UB9A 1G4DA 3T0YA 2M30A 4LB6B 1XDSA 1KYWA 2CGPA 3L7WA 3E5QA 4ZYHA 4HYEA 4I02A 1DP7P 3GUDA 5FFXA 5TJJA 4ASNA 4RGUA 1KGSA 2RVCA 2WV0A 4HDVA 3RYRA 2IW5A 3K2ZA 3T1BA 2ESHA 4PCQA 5FLXK 4O5VA 4A12A 2CG4A 5D4SA 2FA5A 4P5OA 2DAOA 5AONA 4M9SA 2K02A 2OQGA 2G9WA 1ZH5A 1S6LA 4G7HF 4IRGA 4EV0A 3JAMZ 3WE2A 3B73A 4AIHA 3JSPA 2EJRA 4GCVA 2KKOA 4HW0A 2Q2EA 4JK1X 3DKWA 4PDKA 1PUEE 2MD5A 3HSEA 3K1PA 1FNNA 3KZYA 1ODDA 3E6MA 2KRFA 3CUOA 1IF1A 1YTYA 5CVVA 3E5UA 3LWFA 4UV9A 1HKTA 4QWQA 2F5FA 2ESNA 4Z2YA 1OR7A 1K78B 5KK1A 4RB2C 1TLHB 2V1UA 2K4JA 1MKMA 2R3SA 3FZVA 4ESFA 4GYIA 3I53A 1U5TC 3V8LA 4A0XA 1IN7A 5BOXA 1GVJA 2FEZA 1RUOA 1ZN2A 2P5LC 3SHFA 3U9GA 4ENJA 4OIQF 4CICA 2VE9A 2FMYA 1LDJA 5D5VB 5LHHA 3RDIA 1S3JA 3M8EA 1IAWA 2HDCA 3BPVA 3HOTA 2K7LA 4R8HA 4HF0A 3KP4A 2V1DA 3I5UA 5J8CA 4I09A 4CDGA 1AOYA 4LFUA 5CLSA 1IZ1A 2EK5A 4WF2A 3V8JA 3P9CA 2XGXA 1RZ4A 2FNAA 1HW2A 3KP7A 2VBYA 2R7DA 4XLNF 3HRMA 3ZP5A 2KIFA 1W5TA 1IXRC 2GXBA 2VT3A 4XSZF 5IT9Z 1FBSA 3D0SA 3M8FA 5HOOA 3WODF 4M9XA 3G3ZA 2DLLA 2L01A 1I6XA 3RPUA 1IXCA 3DPLC 3I71A 1S8NA 2L54A 2FXAA 3JAMK 1ZG3A 1GXQA 1GXPA 1WQ2A 3W6KB 2IA1A 4N9IA 3TQNA 1YG2A 2OBPA 4NHJA 4UNOA 1FT9A 5IT3A 1YFHA 1R00A 3GFMA 1WKMA 3HSFA 2Z5UA 1VTNC 3VB2A 2LKPA 5CVJA 2XUBA 3HRUA 2IA0A 3H3UA 2Q8KA 2MC3A 5HLHA 3E6DA 4M9ZA 4UVCA 4Y15A 1BJAA 2HR3A 3LA2A 5DCFA 4TV7A 4LLNA 4U7DA 4RB1A 4NQWA 1YW9A 1B1BA 3B02A 3VEPA 5FFZA 3KETA 4GGGA 3LFKA 1XGMA 1BI1A 4BHCA 1RI7A 5L3EA 4MGRA 4PGGA 3IKVA 5LBQA 3EUHA 3F8CA 1FYLA 4F7ZA 4WK8F 2O0YA 1SD4A 1BIAA 3C3WA 1USSA 2A6EF 1FBQA 2BYVE 3WTTC 1T39A 2CFXA 1YLFA 1QPMA 4OIPF 5L3DA 3TKYA 5BMZA 3KCCA 1YS6A 4WX9A 2RV8A 2YR2A 5ILUA 2XROA 3ERED 1STZA 4HZFA 2NYXA 3ZMZA 4XSXF 2ISZA 4WXCA 1P4XA 3ZPLA 4CGZA 5D5UB 2VT2A 4KA4A 2VBZA 4MNUA 5JR3A 3AAFA 1ZRDA 5J8FA 1V4RA 4EJUA 2HYFA 4G8XA 3GFIA 1MD0A 3WTVC 3FMSA 1O7FA 2RQPA 2QZ8A 1U8RA 2ZXJA 1SFEA 2XKOA 3VOEA 3MZYA 4IXAA 2AXLA 4I2OA 1ZRCA 4IJAA 2K4BA 3L9FA 2VC1A 2QM3A 2CSOA 4NB5A 4L0ZB 2PG4A 2P6SA 4L5IA 4HOBA 3DEUA 5FO5A 1IN6A 4S05A 3K1MA 1HKSA 2E7WA 2HWVA 2P7CB 2XAJA 2IVMA 5L3FA 2XAQA 3QPHA 3WE3A 4LG0A 4BNCA 1KU3A 5CVRA 3CUQC 1FBUA 1KU9A 5ICEA 3SXYA 4RB0A 2B0LA 2XAFA 4CXFA 4UXNA 3PQKA 1YW8A 4H0EA 1R1VA 2QQAA 1UCRA 2UXNA 1HW1A 2DT5A 1D5VA 2DFIA 4IHSA 1T38A 2M45A 2OD5A 3D5LA 4EGZA 2G7UA 2DPUA 1ON2A 3P9KA 5FLXZ 1U2WA 2GA1A 5CJ9A 1TQMA 2HQNA 2FMLA 1D8JA 1FP1D 2EFNA 1BC7C 3DXJF 3DQVC 2ZNYA 2J5PA 4KT5C 4KN7X 3GLXA 2ADUA 3O2PE 1B4AA 2P4WA 4OMYA 5DV5A 3HTSB 2E7XA 3HIFA 4HX4A 4LMYA 3ABTA 2W57A 3BROA 1QO0D 3GWZA 1J59A 1FLIA 2HTSA 3H92A 4ZZDA 2YU3A 2D2WA 1SFUA 3SQNA 1G3TA 2DBBA 3VODA 3BDDA 4A2UA 1B59A 4CYDA 4R79A 1FSEA 3REOA 2D1HA 3KEQA 1XMKA 2O3FA 1OMIA 3ECOA 2YPRA 1SMYF 3QAHA 3J7AO 3JTHA 4LB5A 2Y75A 1ZLKA 1WWXA 1LJ9A 3M9AA 1JHHA 1LQ1A 3FM5A 4LLGF 4BHPA 2W85A 4HLXA 5AIQA 1I1SA 1DDNA 3WTWC 4ENMA 4D0PA 4A6EA 1MJBA 2FRHA 3KLNA 2C6YA 2EFQA 3KP2A 2Y0MA 1O3TA 1D8KA 4U0VA 2XV4S 1H9TA 4EJVA 3RTRA 1CGPA 3K9TA 1P4WA 1FZPB 4L0YB 2MH2A 4AVPA 1BI3A 3RIRA 2ELHA 3J80K 4HF1A 2KJCA 1RNLA 5BPDA 3SZPA 5BPIA 2D45A 2PQ8A 5JI6A 1Y0UA 3C1DA 2F5EA 2IT0A 1QZYA 4EM0B 1YQAA 4LG0B 4IVNA 4AIJA 1JE8A 2UZKA 1LEBA 1T98A 3E6CC 3LA7A 3F8FA 3KLOA 1LVAA 2ZFWA 3V7SA 3CO6C 1TBXA 1X3UA 5CVIA 1OYYA 3GX4X 2X4HA 2Y48A 2XHKA 2PMUA 3IWFA 3I59B 3BJOA 3F23A 5F6FA 4FX4A 2P6TA 3CDHA 2M1BA 5D8LB 3KZZA 5JHUA 3R0AA 2GA2A 4B8XA 4U0YA 2QUFA 2DI3A 2CYYA 2FOKA 5ERIA 5E8IA 4K2EA 2H6BA 5CVUA 2MH9A 5HS8A 3GZ5A 4XLPF 2BBYA 3ZMSA 3HOSA 1LDDA 5LGNA 2DU9A 3N4MA 4BYYA 4P55A 5D4RA 1DPUA 2ZCWA 3MEXA 5EEHA 2OZ6A 2LF8A 3KFWX 4RGRA 1KA8A 1G3YA 1G3SA 3FM3A 2HGCA 1SD7A 4M72A 3MCZA 1U3EM 3CJNA 2M5WA 1MZBA 1R1UA 2H27A 3F72A 1R58A 2GIVA 4A5NA 1SD5A 4CHUA 2HFHA 2H09A 3FXRA 2K27A 1S7OA 2JZYA 3GF2A 5DD4A 3G73A 1S7AA 1IN4A 1O3RA 2J5OA 1R1TA 2CWEA 2VXZA 3DFGA 4AIKA 3HUGA 3GO5A 4S04A 3PQJA 4A6DA 1P6RA 1MDMA 2LNBA 4M6YA 3ZMUA 4MEXF 2EV6A 2V6CA 5D6EA 2DQRA 2UWMA 1J75A 1EH6A 2PFBA 5EEGA 4EJWA 4XRFA 3J81K 1XDUA 3FMRA 2F5DA 3WTXC 4WWCA 5ICCA 1XGSA 5DUKA 4IF4A 3MAJA 2NNNA 3V7CA 1UHMA 4MQVA 2PLYA 4RGXA 3E97A 1MGTA 3HRSA 3HHHA 1P92A 4EJTA 3WGIA 1LNWA 2IA2A 4Q5SF 4A0ZA 4BXUA 2M8EA 2VBXA 1XCBA 3P9IA 2IJLA 2M87A 1U6GA 4UV8A 3V7RA 1YO5C 2ACJA 4EM1A 1J9IA 4FHTA 2LDUA 4HDUA 3DP7A 1JHFA 4L9VA 2GZWA 2WC2A 1J7KA 4L9NA 2PEXA 3QU6A 2XKPA 2HEOA 5FB2A 1BBYA 3RYPA 3C18A 2RNJA 4YFNF 3TOBA 1S29A 3QOPA 4CZZA 4YIIA 1IXSB 5LHGA 2G7HA 3QP5A 4HAMA 1TQPA 1OKRA 4UHTA 3U1DA 4RAZA 3NQOA 3L00A 2FBIA 3WGHA 3FXQA 3FHZA 3ELKA 3N97A 5E18F 1I1GA 1BI2A 4JBAA 3RPQA 4O3MA 5FD5A 2OA4A 1RUNA 3T5XA 1JXSA 3DF8A 4M71A 2EV5A 2RKHA 1XB4A 3KE2A 2ETHA 1RIOH 1J2XA 4A0YA 2MBFA 3VFZA 2L3DA 4HX7A 1ON1A 1O7LA 4I0AA 3ULQB 2WWYA 2ZJ2A 3HRTA 3KEOA 4AD9A 4P9FA 3FX3A 4PZJA 5JFRA 5ICFA 1ZGJA 3R4KA 1SFXA 1ZREA 4U7BA 2STTA 1MDMB 2OZUA 1Z7UA 2VONA 3F8BA 2ZBKA 4PGHA 4ESBA 4Y13A 4LLLA 2OQRA 5LGUA 6PAXA 1R7JA 3U2RA 2Z9OA 5LLQA 1E2XA 3WGGA 4KIFA 1F9NA 2WTEA 3IWZA 2BGCA 4OIOF 5E1XA 4WCGA 2FU4A 2EA2A 2LSOA 4WXHA 4ON0A 1D3YA 3GVAA 2L02A 3IKTA 4ETSA 1Z05A 2JPCA 1USTA 3LSTA 4HF2A 4ZYEA 1W5SA 2ZNZA 1Z91A 3ECHA 3TO6A 3J80Z 3LQQA 2XAHA 1KU2A 3K69A 2A5YB 2O8XA 3LA3A 4WXDA 2P7VB 3QU3A 1L0OC 3C7JA 5DUIA 5FD6A 4KFCA 3TDZC 1T0FA 1K79A 2KJBA 4Q48A 2QQ9A 4U88A 3I59A 4MHGA 4E70A 1R5GA 1ZLJA 5E1ZB 3MFKA 4HV6A 3R6SA 5E8GA 3R0JA 3F6VA 3WTUC 2VODA 1SD6A 5H20A 5DCMB 1IRGA 1P2FA 4EVIA 3WTSC 2JTVA 1HSTA 4GYGA 3IL2A 5A2QK 3FXUA 2CQKA 3FF5A 1R5HA 3F6OA 4OU0A 1NHAA 1ZG5A
chains in the Genus database with same CATH superfamily
2QF7A 4BHBA 1WJDA 1R22A 4RAYA 4MIMA 2IRFG 2DQLA 1T0FC 2ZMEB 5H6RA 2R5YB 4GO1A 3EUAA 4XRSG 2ZKZA 2E2IJ 1YE9A 1TW3A 3IP4B 1OYIA 3I9V2 4XK4A 1VQOI 4S0HB 3TO7A 2PMHA 1GHCA 3U21A 3S1NJ 5D6FA 5LEKA 2EFOA 3ABUA 3KPHA 5HDNA 2XGCA 5IP6A 1T56A 5DDGA 2Q0OA 2JWTA 2GXGA 5LHIA 3O8GA 1EJ9A 2NAZA 1JJ8C 5J3LA 1Z9CA 3BJAA 1Z1DA 2LBFB 3W2WA 2E1OA 3BTIA 3S16J 5ILVA 2E1CA 2W84A 4HV5A 2M9HA 2E60A 5DM7F 3DV8A 3OIQA 3EQLF 1LB2A 1Z67A 4BEHB 3HGGA 2LOOA 2ID6A 1SFKA 2E2HJ 1CF7A 2K9LA 2X6XA 5IY5H 3I4PA 1PP7U 1K6OA 4G94A 3LAPA 3DTKA 1J0RA 4OMZA 3M1CA 1MMAA 1IN5A 1IRFA 2L9RA 2WY7Q 5LRRA 2WAQA 4DYQA 1RKTA 3ZMTA 1G2HA 4M6XA 3P7NA 3C2BA 2V6EA 3RI4A 2KIUA 1FY7A 2LD5A 3H3VK 1QVTA 3I58A 1Y8RB 5JLWA 3BCAA 2XIGA 3S3OA 4EATA 4YEJA 1XSVA 2FSWA 1ZQ3P 2VUMJ 3JRGA 3K1NA 5IP7J 2Y30A 3KP5A 5K5RA 1FMWA 2QENA 3EUKL 4M73A 2ZB9A 5ILSA 4G6DA 5HVQC 1W7PA 3PFIA 3ZN0A 3MKYB 3IRRA 1XD7A 1TWAJ 2Y0SN 4FQGA 2GOMA 1TT5B 4G9YA 5HDGA 3ZQLA 2P5VA 2X9DA 2JK3A 3H5RA 4LD5A 1IW7F 1S7EA 2IP2A 2A68F 2K9SA 4KDPA 2E5ZA 2IXSA 3BY6A 2LG4A 2M34A 5FKOA 4RBOA 4PSWA 3R60A 1Y1VJ 3QRFF 2A6HF 4OIRF 4B3AA 3BR0A 3PNVA 5HNHA 1VNDA 5K5QA 4KMFA 4A5MA 2HQRA 1FOKA 5J1RA 3A01A 2YX4A 3K4BA 1KQ9A 4HQMA 1C0WA 2PBIA 1FYKA 1XX5A 2QQBA 1AWCA 4HNVA 2STWA 2IAIA 1JJ6C 4EJOA 1QA6A 2QSHX 1X2MA 3TGNA 1SMTA 4XKBA 4ANJA 3ERMA 5F64A 4MTEA 1MJAA 3CDIA 5D5WB 3T8RA 2NS0A 1K4SA 2ICWG 4E7KA 3GTMJ 2DJNA 3J81Z 2QEXI 4IPAA 4BQNA 4EMSA 3TOAA 3PSIA 1I5ZA 2IPQX 2LMDA 2D1VA 4PFPA 3EETA 2NRAC 3T8TA 1DGRM 1V54H 2DT7B 2E1NA 2P0WA 4YG2F 4OOIA 1YYVA 1ZHFA 1YW7A 4I98B 1IUYA 1L3LA 1Z3YA 1A6QA 2PJPA 2JSCA 5M5XJ 4BUPA 2QLZA 1B9MA 2HOEA 4IO9F 4KN4X 4DNCA 2FQ3A 5JVTA 3TW7A 2LP0A 1FPQA 3QP6A 4RA2A 1ACIA 4QLCU 3D5SC 2E2JJ 2HKOA 5HS7A 2CUJA 3LOCA 4XL9A 1OYWA 2L5QA 1HQCA 2K5CA 1WRJA 4YFXF 1WH5A 5L3BA 2P8TA 2CO5A 5B1BH 3HPGA 5J1YA 4Q4ZF 1H9GA 2DTZA 5L3CA 2EWNA 4U0WA 1SAXA 1SFOJ 2E34A 2JPBA 4PJJA 3QODA 3L2RA 2DMTA 4RB3C 3BJ6A 1U5TA 1ZELA 2UUZA 4GXOA 1HF0A 1OJLA 5DD8A 2V7FA 4Z6YA 1MNMC 5HNFA 2BY1A 1MH4A 2VPRA 4E7HA 1QZZA 3TO9A 2VBWA 4RGSA 3BR2A 5D5XB 4ZZLA 1WJ5A 4DQ2A 3BCBA 3OV8A 1P9QC 3BTLA 4M3DA 1WJEA 4HA8A 1F5TA 4I01A 2DO7A 3I54A 2F4OB 3WG9A 4J00A 4KIGA 1R9TJ 1FMVA 2H94A 4IRIA 5EYRA 1W4MA 5J1UA 2Z33A 3BT9A 4G7ZF 3J7ZI 2YSRA 1I3AA 2HYGD 1F4KA 5TRDA 3L2QA 2XAGA 2BV6A 2E19A 4UVBA 3HOZJ 2MSYA 2X48A 5KHDA 3GZ6A 2QBYB 2VC0A 2ZSIB 4A3EJ 2DOAA 5E17F 2DPDA 5IP9J 2XASA 1DPRA 3LSJA 5E20A 1WPKA 2KRHA 2L7FP 4A3LJ 1AA7A 5CQGA 3K10A 4ENNA 1QZEA 4RDUA 4Y7NJ 3FXMA 2VOPA 2W25A 4L5EA 3DBRB 1X1PA 3PIOF 2BOLA 2NNYA 2GWRA 2VQCA 2NVXJ 1HSJA 5CYVA 3IC7A 2X0LA 4P96A 1CF7B 2DW4A 2A07F 4MQ9F 2PMZA 4L9TA 3SEQA 1ZG1A 1TNSA 3E6BA 1ZAOA 1KQ8A 2DK5A 1R23A 1O3SA 2MLGA 5LGTA 2HVSA 3VYUB 2XPVA 2BHZA 3K4LA 3W6JB 3LSMA 5J6XA 4ZC3A 4RAFA 3GTPJ 3OSFA 3S2DJ 3W2AA 4Y17A 1OLTA 1W1WE 2DA3A 1ZTRA 2HQAA 1K61A 3GFJA 3MZ8A 5J4VA 4IHWA 5HODA 2A61A 4Y3OA 3WG7H 3RKWA 4BAYA 3FISA 2XF5A 1TWGJ 4L5JA 1E17A 2EB7A 3DWLE 1W7PB 5F0CA 1SVLA 2FE3A 2ZJQF 3NEUA 1RESA 2EH3A 1FP2A 1X1AA 3VPRA 3S32A 3JW4A 1FX7A 2NS7A 3AFHA 4KYWA 3VYSB 2OAZA 3FXKA 3G1LA 1REPC 4LK0F 3AL0C 3K4MA 1EA3A 4IOCF 4N4NB 4W1UA 2W4SA 1V3FA 1I50J 2BEOA 3AG1H 3JRCA 3OS0A 2L4AA 3BPXA 5DEQA 1JT0A 2JN6A 1EH7A 1LFUP 4FX0A 1F1ZA 2OV7A 2O61A 5D8KB 3E5XA 2X6WA 3COAC 3CQZJ 1LPQA 3B6AA 3CESA 2K3FA 3FIWA 5F04A 3K4NA 3GEZA 2Z99A 3DEWA 2H8WA 3L09A 4FT8A 5DM6F 4KNYA 1FWZA 1FC3A 1TP4A 1KU7A 4AM3A 3WU1B 1G6NA 1P4AA 2MA3A 3BR6A 3UNGC 5E3NA 4RLQA 1X1DA 2HKXA 2E71A 1BIBA 3M7GA 4ZYGA 4ZYAA 4G7OF 3CTAA 2NVYJ 2R7XA 2RAEA 4BJ5C 5B5EC 1ITYA 3V4GA 3OR2C 5F1JA 5C4XJ 1U8BA 2WA0A 2FBKA 4HBLA 5JVGF 3MQ0A 4XONA 1IG7A 3MZHA 3FBIB 2TCTA 1EV7A 2CS3A 4MEYF 3CD6I 1XC5A 3ZQQA 1WHUA 4IL6C 4QSHA 4XLFA 5HLIA 2WAFA 1FOYA 3FXLA 2ME6A 3E3VA 1Z6TA 4Q47A 3ZMVA 2FF4A 1ETYA 1TQIA 4I0BA 2DMQA 3CLOA 4BXXJ 1Z6RA 2BY2A 2UXXA 2Y2ZA 3RJPA 3LSPA 2QSGX 4IEJA 1WSUA 3WTYC 1QQIA 4YIFA 5GPAA 4BQAA 1TWFJ 5FGMA 3VSLA 2MLKA 1KQ0A 3HOWJ 2F2EA 3VYRB 4BKXA 3BG7A 3HSRA 4HNUA 3Q9VA 4ZTJA 3DLLF 1AKHB 1IN8A 2OCCH 3CF2A 3NAUA 1U5TB 2FUG2 5DCMA 4XOTA 1V55H 1T6SA 2Z3YA 3RSNA 2Q2EB 4ENKA 3BR1A 3QOEA 3O3KA 5HDKA 2VOOA 1DUXC 4F52A 4BE2A 4L18B 2F48A 1BN5A 1B9NA 1U78A 3GZNB 3HTUA 4DIQA 1QGPA 2KISA 3M1EA 4W97A 5FLVA 1YS7A 2DFEA 3TDUC 4FASD 5AIPA 1GV5A 3I0TA 1HKQA 4CCKA 3ML6A 4CO8A 1E3HA 4B44A 2BE5F 2A5WA 1V5GA 1S72I 1PP8F 2XVCA 3FMQA 4CUGA 2CW0F 3TP0A 3ZQHA 2ZMEA 3MWMA 3V8KA 1GVDA 2XF7A 2RDPA 3NWSA 2R7TA 1YIJI 2PN6A 5EGOA 3BG6A 1ZGAA 3ASNH 3DTIA 3JRDA 1ZRFA 1JUMA 5A2QZ 5B1AH 1GLNA 4HQEA 4R1HA 3H0GJ 1PJRA 4A3FJ 1AU7A 4KIBA 1K7AA 3ABMH 4F93B 3GYHX 1UFMA 2HDWA 1TW2A 3L2CA 4JOMA 1XCVA 2RGVA 4HLYA 5K7ZA 2X6OA 3BG5A 2EBIA 2AHQA 2DTRA 5F1RA 1BR1A 3ZQGA 1KONA 3H1CA 1XSXA 2M0MA 4UUVA 3SFZA 4EQQA 3EYYA 2H1LA 1W7PD 4BE1A 1FOWA 3EDPA 2FBHA 5BQTA 1HBXG 2Z16A 3SZTA 3H3ZA 1ONVA 2HZTA 4KMUX 4L9JA 3S2WA 5E1WA 1BOAA 3OOPA 3JRIA 1XGNA 1JKRC 3VSKA 3RKXA 3OYKA 2DODA 2RC4A 2V79A 4XLEA 5ED4A 4HX8A 4BXFA 3QPTA 3ZCOA 1VI0A 4F92B 3JTGA 4D7NA 4XKWA 4KITB 2M2EA 3CP8A 1LEAA 1XMAA 4IRHA 4MTDA 5IT9K 1H0MA 2VQGA 3ROUA 2TDXA 3CO7C 4PSXA 2LKSA 2ZMEC 5DYMA 1MBJA 5L3GA 4XQFA 2KLOA 2BY3A 2F5CA 1DU6A 2VKVA 1HDDC 4JYKA 2GAUA 2R7FA 1ETQA 1RR7A 1A04A 2IGKA 3AKZA 4UVAA 4ZYDA 3LSIA 3CUQA 2Y0SA 2PI0A 3PNTA 1FYMA 2EZIA 1Q1HA 4FCYA 4LJZF 5C3EJ 3CJQB 2QVOA 5EDNA 3O6BB 2O6GE 1J09A 4GFBA 3I64A 3BOQA 1BM9A 2L9SA 3FKIJ 2EA4A 1LE8B 3O8HA 4DZJA 1BC8C 4CZCA 1HOMA 1TNTA 3ZN1A 3GFLA 3EYIA 5HS9A 2YX7A 1LVKA 3FK6A 1VFCA 3R61A 3Q5FA 2QWWA 2ELKA 4AWXB 5K1YA 1HXDA 1G3WA 3ZQ7A 2YS9A 4XBFA 2HPMA 1B6AA 3KP6A 2W48A 3AG2H 1JI8A 2W00A 3GXOA 2LR8A 2E36A 4BH9A 4MFDA 3OYNA 2ZO4A 5LEJA 3ISPA 4HNTA 3HL2A 2PX9A 3OYGA 1WI9A 1ORKA 5H6QA 4F91B 1UELB 3WTZA 1W5CC 3L2UA 5K5OA 3LQRA 4EEFG 4C2TA 3NRVA 3OWTA 4BBRJ 3JSOA 3RKYA 1D5YA 1X1CA 2ELJA 1QBJA 4P9UA 4J19A 1TC3C 2A69F 2EV0A 2HPIA 2DK8A 2K86A 1XN7A 1IV6A 4EM2A 1I27A 2FNPA 2V1XA 4RS8A 1I39A 1XGOA 1MNDA 2WB1N 3BP8A 3GMEA 3HOUJ 3F22A 3BWGA 3P5JA 3WU0A 1MMDA 1MH3A 2MW8A 1T2KA 1X2NA 3TL4X 2B7EA 5F27A 2MGQA 3E7LA 4C2MJ 3D1NI 1X4PA 3LFUA 5KVRA 2R0QC 3DPTA 4EGYA 1E0EA 2VE8A 4GRIA 2X6YA 2JQ7A 5LRSA 2HS5A 1JKPC 1FSHA 4RMNA 1LUJB 3IHUA 1O3QA 1JGGA 3H36A 2XRNA 2QYOA 3OYAA 5EG0B 4UUSA 5IOYA 1ZARA 3HYIA 4LK1F 1SEUA 3J7YJ 2OCEA 1YX5A 4M3EA 2W24A 4XLHA 2DDAA 5F08A 1Y8QB 5EGOB 3F3XA 4OINF 2A3SA 2IGNA 3ZXSA 2W1OA 4AYBN 2RREA 2RN7A 2ZSHB 3VWBA 1MJ9A 1ZYRF 4B09A 1YIOA 1W36D 3CCSI 2LF7A 2O03A 1LDKB 5BS6A 5FKLA 3HHGA 2QBYA 2L4MA 3HOXJ 9ANTA 1Z3XA 1X58A 2GQQA 2HTJA 1M1EB 3PUBA 2GLOA 1K78A 1LKXA 2V9VA 3BZ6A 3L2VA 1PDNC 1N25A 2L9NA 3CP2A 2EFWA 1JKOC 1R49A 2COMA 1OPCA 3MN2A 5K7FA 2MC4A 3Q0UA 4KUMA 4M74A 3IV5A 1O57A 2CV0A 2VJJA 3GW2A 1RKWA 3ZMDA 1W0UA 4LGWA 2DXIA 2AS5F 4A93J 5ICGA 1DP3A 1MSFC 2EZHA 3ZOBA 3FWEA 3OSGA 1VQ8I 1HW5A 1ULYA 2O5RA 4GDFA 4A3BJ 2BZTA 2DYRH 3F21A 5GTHC 2ISYA 2VN2A 1DQUA 2EIJH 3LAJA 5J4YA 1EH8A 1JGSA 2VB6A 3MMYB 1QNTA 3UR3C 3F8MA 2P5KA 4ZDPA 3PSFA 1J5YA 3SDBA 4O6JA 2H6CA 3F8NA 3KP3A 1TTYA 2DA1A 4UB6C 2EFPA 1VQKI 2JT1A 3A0BC 2KPMA 3EPZA 1FEXA 4FETA 3IRQA 4ZDOA 4N0BA 4AU7A 2JRTA 4E7ZA 1BOBA 3Q3SA 4ZH4F 4X1EA 5HLGA 3S93A 4G6QA 1WVRA 1R36A 3CUQB 4ESJA 1KYZA 1TWHJ 4I7HA 4KICA 3RPUD 2R7QA 2HNHA 4JQFA 2WADA 4IHTA 1BI0A 1UHWA 3K0LA 4N9HA 3IAS2 2KIMA 2OU2A 4YFKF 1OFCX 1XSDA 3Q9SA 1UB9A 1G4DA 1UMQA 3T0YA 5B3SH 4A3DJ 4V2GA 1OCTC 3HBLA 2CV1A 3KEYA 4NC7A 4BDYA 4BU2A 3A4CA 1Y39A 1CQTA 3HDDA 3RZDJ 2M30A 4LB6B 1XDSA 3DLAA 1IGNA 2LH9A 1KYWA 2CGPA 3L7WA 3KYDB 1PUFA 3E5QA 3I3LA 4ZYHA 4HYEA 1JTXA 5EZHA 3RKQA 4I02A 3HZJA 1FIPA 1DP7P 3GUDA 5FFXA 5TJJA 4ASNA 1VF9A 2YU9J 4B43A 4RGUA 1KGSA 2RVCA 2WV0A 5CQEA 3JRAA 4HDVA 3PUFA 3RYRA 2IW5A 3K2ZA 3T1BA 4BACA 2BVMA 3AG3H 2LKXA 4HSRA 1D1AA 2ESHA 3W6VA 4PCQA 5FLXK 1HLVA 4O5VA 4A12A 2CG4A 2FA5A 5D4SA 4P5OA 3PL8A 3ZQCA 2KMUA 2DAOA 5AONA 1WH7A 2X51A 4M9SA 1LFPA 2BY0A 4N4OB 1YI2I 2K02A 2OQGA 3G1OA 4CCNA 2G9WA 3LNQA 1ETWA 3S8PA 1ZH5A 1S6LA 4G7HF 4IRGA 1BL0A 3ASOH 4EV0A 4X6AJ 2KL4A 1Y1WJ 2NS8A 1GT0C 1H88C 3JAMZ 3WE2A 4MO7A 3B73A 4XRSA 2FX0A 1S5LC 2F4IA 4AIHA 3JSPA 1AKHA 5LFAA 1FTTA 2XC7A 2EJRA 4GCVA 1SVOA 3SFIA 4YELA 1WZ2A 3K4CA 1P7IA 2DA6A 2VI6A 2HOAA 2KKOA 4HW0A 4A3KJ 2Q2EA 5FKKA 3E0JB 4JK1X 3LSGA 3DKWA 4PDKA 1PUEE 3ONQA 4B4CA 2MD5A 3MD2A 3HSEA 3K1PA 4M3FA 4UUSB 1FNNA 3KZYA 1ODDA 3E6MA 2KRFA 1T08B 4OWRB 3CUOA 4HEA2 3WU2C 2ME0A 1IF1A 2VJ5A 1DGWY 2O9LA 3CJTB 4NDLA 2CW7A 2CFOA 3M07A 4E6KG 1YTYA 5CVVA 4D7MA 4BJTA 3OYHA 1VQPI 3E5UA 3CMYA 2HZDA 3MVPA 3S2HJ 1I3QJ 3LWFA 4UV9A 3S1MJ 1HKTA 4QWQA 2CUFA 2TRTA 2F5FA 4LITA 5H2FC 2ESNA 4Z2YA 1W0TA 1OR7A 2K9NA 1K78B 4Y4RA 5KK1A 2E1MB 4DJAA 4RAGA 1E3OC 3X2QH 1BW5A 2L7ZA 4RB2C 1TLHB 2V1UA 4BDZA 4DBQA 1RC9A 2K4JA 1MKMA 2K9QA 3LSKA 2R3SA 3FZVA 4ESFA 1YX3A 5IPAA 4BY1J 3KIOA 1SAUA 4GYIA 2MYSA 3I53A 1U5TC 1OCCH 4I6ZA 2M7BA 3V8LA 4A0XA 1IN7A 2D5VA 5BOXA 4RLFA 1GVJA 1RETA 1T33A 3JRBA 2FEZA 1A6IA 1RUOA 1SC7A 1ZN2A 3PM1A 3SYTA 2P5LC 3SHFA 3U9GA 1G59A 2HXOA 3GTQJ 4ENJA 1Y56A 1NTCA 4OIQF 1HC8A 5GTIC 3OIOA 4CICA 2FMYA 2VE9A 1LDJA 4A3GJ 2Y9YA 3FDYA 5D5VB 5LHHA 3RDIA 1S3JA 3OS1A 2CMPA 3M8EA 1IAWA 1R71A 2HDCA 3BPVA 3IH4A 4D5CA 3HOTA 2K7LA 4AVZA 4R8HA 5BNGA 4HF0A 3HPHA 4DZPA 3KP4A 2V1DA 4BBSJ 3I5UA 5J8CA 4I09A 2HQ5A 4CDGA 1AOYA 3FBNB 4LFUA 1XMXA 1D0YA 1IZ1A 5CLSA 2EK5A 4WF2A 4OAYA 3P9CA 3V8JA 4CYCB 2XGXA 1RZ4A 2FNAA 4FE4A 3K70D 4FE7A 3TEDA 1HW2A 2G0EA 3CMEI 3KP7A 2VBYA 2OJED 2R7DA 2KRCA 2KDOA 2CUEA 4XLNF 1V5EA 3HRMA 1P7JA 3LSHA 2O8KA 3QQAA 3ZP5A 3BZKA 2KIFA 1MMGA 1W5TA 3SJMA 4E7LA 2OF7A 1ZR2A 1IXRC 2IEKA 3OIPA 2GXBA 2DYSH 2VT3A 4XSZF 2EZLA 1VQ9I 5IT9Z 2XPUA 2PJRB 1FBSA 3D0SA 1Y0NA 3M8FA 5HOOA 3WODF 1PUFB 1A35A 4M9XA 1XG1A 3Q0WA 1LE8A 2HVQA 3BZCA 2DA5A 4LIVA 3G3ZA 2CW8A 3VDXA 2K3PA 3I4MJ 2DLLA 5E3MA 2L01A 1I6XA 3RPUA 1F43A 2ECCA 1IXCA 3DPLC 4QPQA 3I71A 1S8NA 2ZXWH 2V9KA 2L54A 2ZC2A 4CCOA 2FXAA 3JAMK 1ZG3A 4ABZA 1GXQA 1GXPA 1WQ2A 2DDBA 2LC2A 3W6KB 1OCOH 2CQ7A 2IA1A 3I4NJ 4N9IA 4BY7J 3TQNA 1YG2A 3OYLA 2OBPA 2X1DA 3CCMI 3S1QJ 4NHJA 4UNOA 1FT9A 5KAFC 1JUSA 3RCOA 4AC0A 5IT3A 1YFHA 1R00A 3GFMA 4PK4A 2XSDC 3G2BA 1WKMA 3HSFA 2Z5UA 2O7OA 1VTNC 3VB2A 4XLCA 1FIAA 2LKPA 5CVJA 1N78A 2IBDA 2VKEA 2BXZA 2Y69H 2XUBA 2KFDA 3H9GA 3HRUA 2IA0A 3FKJA 3U1KA 3H3UA 1UZCA 2Q8KA 1T95A 5KCMA 2MC3A 5HLHA 3E6DA 4M9ZA 5CKTA 4UVCA 4Y33A 4Y15A 1BJAA 2CU7A 2HR3A 1KZHA 2VXDA 2EIKH 2LK2A 2WB1A 2Y31A 4UUTA 3LA2A 2VASA 5DCFA 4TV7A 4LLNA 2MABA 4U7DA 3UKGA 4RB1A 3CC7I 5EEAA 1QHHD 5M3MJ 4NQWA 1YW9A 2V9PA 1B1BA 5KAIC 3B02A 3ZR8X 3CCYA 2LLKA 2VQHA 2QGUA 4V19K 3VEPA 3DEEA 2CUZA 5EG0A 5FFZA 3CCRI 3KETA 4GGGA 1ZGWA 2VJIA 4F3QA 5K7HA 3I56I 3LFKA 1XGMA 2EQRA 1BI1A 2L9VA 4BHCA 2GOXB 2VPLA 1RI7A 5L3EA 1WJFA 4MGRA 5CPRB 1OCZH 3A03A 5E3LA 4PGGA 3IKVA 5LBQA 4AYBA 3F9KA 3EUHA 3KX2A 2M4KA 1BR2A 2R4GA 3F8CA 4IOAF 1FYLA 4F7ZA 4WK8F 3ZQFA 1BR4A 2IGMA 2O0YA 1SD4A 1BIAA 2LYCA 3C3WA 1USSA 3DKXA 2WV1A 3HOYJ 2A6EF 1FBQA 2BYVE 3H35A 3WTTC 1T39A 4XR6A 4I99C 2JA7J 4X0GA 2CFXA 3OMYA 5EF6A 2Y9ZA 1YLFA 1QPMA 4OIPF 5L3DA 5EJCA 3TKYA 5BMZA 3KCCA 1VQLI 2R7UA 1YS6A 4WX9A 3OYMA 2DA4A 4B3XA 2RV8A 1QRYA 2YR2A 1IRZA 5ILUA 3FHNA 3OL4A 2XROA 3GCMA 3ERED 1STZA 1JTYA 4HZFA 2NYXA 2DN0A 3GTLJ 3HOVJ 3ZMZA 4XSXF 4HG2A 2F5VA 2JVHA 4I76A 3OY9A 2ISZA 4WXCA 1P4XA 3ZPLA 4CGZA 2JSPA 5D5UB 3QWLA 5JHFA 2VT2A 1VQ5I 3EUHC 2L2OA 2VBZA 4KA4A 4MNUA 3CC4I 5JR3A 3AAFA 5E79C 1MMNA 1ZRDA 5J8FA 2IS2A 1V4RA 4EJUA 4DBRA 2HYFA 4G8XA 3GFIA 1MD0A 3WTVC 2AQEA 5DS9A 3FMSA 1O7FA 2RQPA 2QZ8A 3K4KA 1U8RA 3KYLA 2ZXJA 1SFEA 2DOEA 4IX7A 2XKOA 3VOEA 3MZYA 2UV1A 4IXAA 4BGDA 2AXLA 4I2OA 1ZRCA 4CH7A 5GADJ 3BLYA 2K4BA 4IJAA 1V5FA 3VYTB 5E3OA 3L9FA 3C2HA 2VC1A 2QM3A 1ETOA 2CSOA 3BG9A 4XMYA 4NB5A 4B1RA 4L0ZB 1WJCA 2P6SA 2PG4A 4L5IA 2H1KA 1B8IA 4HOBA 3JRHA 4LG3A 1Z7LA 3DEUA 5FO5A 1WJBA 1IN6A 4S05A 3TP3A 3K1MA 4IHYA 1HKSA 2E7WA 1D1CA 1D0ZA 2HWVA 4C3HJ 1AHDP 2P7CB 2NVQJ 2XAJA 1IDZA 1MBGA 2IVMA 5L3FA 3MKWB 2QSFX 2XAQA 3QPHA 3WE3A 4LG0A 4E7SA 2R5ZA 4BNCA 1KU3A 5CVRA 4CCJA 3CUQC 1FBUA 1KU9A 5ICEA 2BW3B 3SXYA 3OYBA 4RB0A 2B0LA 2JUGA 2XAFA 4JP0A 1MIJA 2XF6A 4CXFA 5M5YJ 2VKDA 2ZFUA 4IKFA 4UXNA 2CRGA 4PUSA 5FROA 3OYDA 3PQKA 3S17J 1YW8A 4H0EA 1R1VA 2QQAA 1UCRA 2UXNA 1HW1A 3SDGA 4YIRX 5F0FA 2DT5A 2R7VA 3HG9A 1D5VA 2DFIA 4IHSA 1T38A 2M45A 2OD5A 1X3ZB 3D5LA 2LFBA 4EGZA 2G7UA 4NQWB 2DPUA 1ON2A 3P9KA 5FLXZ 2R7ZJ 1U2WA 5HLTA 4XM3A 1B72B 3RQ4A 1GV2A 2GA1A 5CJ9A 1TL8A 1TQMA 2HQNA 3OS2A 2FMLA 1D8JA 1FP1D 4A3JJ 2EFNA 1BC7C 4IQ4A 3E1SA 4KJZA 3DXJF 3DQVC 2ZNYA 2RQQA 2J5PA 4KT5C 2DFHA 4KN7X 1WCMJ 4IHVA 5IYDJ 1YJWI 3AG4H 3JCUC 3CF5F 3S15J 4JX5A 3GLXA 1PYVA 2ADUA 3O2PE 1B4AA 1NG7A 1OCRH 2P4WA 4DYCA 1D1BA 4OMYA 1BA5A 1E3PA 5DV5A 3HTSB 2E7XA 3K2AA 3HIFA 4HX4A 3QPSA 4LMYA 3ABTA 1A36A 3GBGA 2CH0A 2W57A 3BROA 3BTJA 4MFEA 1WFXA 1QO0D 3GWZA 2OTLI 1J59A 1FLIA 2HTSA 3H92A 4MLOA 3H5NA 1VQ6I 2JA5J 1MW7A 4ZZDA 2YU3A 4BJ6C 2D2WA 2IS4A 5GAHJ 2HOTA 4U87A 3M3YJ 2QKMB 1SFUA 2DMUA 2NVTJ 2ZJPF 3SQNA 1G3TA 3LMMA 3ZGKA 2DBBA 3VODA 3BDDA 2DMPA 4A2UA 1UHSA 2JUCA 1B59A 2XGEA 1BJZA 3QYFA 1IUFA 4QPOA 4CYDA 4R79A 1FSEA 3REOA 2D1HA 2K85A 3KEQA 1XMKA 2O3FA 1OMIA 3ECOA 3HKZN 2YPRA 3CCJI 4HPQA 3V42A 4XN0A 1NG6A 1X4OA 1SMYF 3J7AY 3QAHA 4XNFA 2I10A 3J7AO 2IGOA 3JTHA 4LB5A 2Y75A 1ZLKA 2NXNB 1WWXA 2R7SA 1LJ9A 3M9AA 1JHHA 1IV8A 1LQ1A 3DBLB 2Z2SB 3FM5A 1ETXA 4LLGF 3GTKJ 4BHPA 1MBEA 2W85A 4HLXA 1IO2A 5AIQA 1MMSA 2B9SA 1I1SA 4PFOA 3BTCA 1DDNA 4AUXA 2DA2A 3WTWC 3A2KA 2X1CA 4ENMA 4D0PA 4A6EA 1VQ7I 1MJBA 2E1MC 4C2UA 2FRHA 4CYCA 2VKHA 3KLNA 4NC6A 4B47A 2C6YA 1X3WB 2RNGA 2EFQA 3KP2A 2Y0MA 3QYBA 3I55I 2KQRA 1O3TA 1D8KA 1DU0A 4RM3A 4U0VA 4BL0B 4D5FA 2XV4S 1H9TA 4EJVA 1WGXA 3RTRA 1CGPA 2GBYA 1EF4A 3PIPF 2CV2A 5FJ8J 1N77A 2PJRA 3K9TA 1P4WA 2OC6A 4ITVA 1FZPB 4L0YB 2MH2A 4AVPA 2MG4A 3HGYA 1BI3A 1B8IB 3RIRA 2ELHA 3J80K 4HF1A 2VL8A 2KJCA 1RNLA 3JRFA 5BPDA 4BS9A 2YUSA 3SZPA 3S1RJ 2DOFA 5BPIA 1HDPA 4FTHA 2D45A 3CLQA 1NH3A 2XB0X 2PQ8A 4JX4A 5JI6A 1IRXA 1Y0UA 3C1DA 2F5EA 4NBQA 3K7AJ 2IT0A 3CCUI 1QZYA 4EM0B 1YQAA 1TT0A 1ZK8A 2R5ZB 2GM4A 4IVNA 4LG0B 3DU6A 4AIJA 2W82A 1JE8A 2UZKA 3G71I 5IYBJ 3DPUA 1RPWA 2L7MP 1GUUA 1LEBA 1T98A 2DFFA 2R7RA 2NOJB 3E6CC 3LA7A 3F8FA 3KLOA 1LVAA 2ZFWA 3V7SA 3CO6C 3JREA 4A69C 4ZTFA 1TBXA 1X3UA 3H5AA 2AXTC 1HCRA 1JUPA 1VQMI 5CVIA 1OYYA 1ENHA 3GX4X 2X4HA 2Y48A 2ID3A 5J40A 2XHKA 2PMUA 3A1YA 3IWFA 3I59B 3BJOA 3F23A 5F6FA 4FX4A 3BR5A 3S3MA 2P6TA 3CDHA 2JA6J 4E7JA 2P81A 2M1BA 1Z0XA 4A3CJ 2R7OA 4ZDLA 4UY8I 2HU9A 1OISA 4DYRA 5D8LB 3KZZA 4BQQA 5FKMA 5JHUA 1ZKGA 2GIZA 3R0AA 2GA2A 4B8XA 1OQYA 4U0YA 3K6GA 2KDZA 2QUFA 2CQQA 2DI3A 3NWTA 2CYYA 2FOKA 3D5RC 5ERIA 5E8IA 4DW6A 2WY8Q 4K2EA 4AIDA 2H6BA 5CVUA 2MH9A 3B6CA 5HS8A 3GZ5A 4XLPF 2BBYA 1YRNB 1A31A 2K9MA 3ZMSA 3HOSA 1LDDA 1MNEA 2JVGA 3HJEA 2VIXA 3BR3A 5LGNA 2DU9A 3N4MA 1Q1VA 3HM5A 3L2WA 1UG2A 4P55A 4BYYA 5D4RA 2R7WA 4QTRA 1U9NA 1UG0A 3CDLA 3JR9A 1DPUA 2ZCWA 1T8IA 4XKCA 4XIDA 2QA4I 3MEXA 4M3BA 1XTAA 2OZ6A 2LF8A 3KFWX 4RGRA 5EEHA 1HA8A 1JKQC 1KA8A 1G3YA 1G3SA 3FM3A 2HGCA 2QQ8A 1SD7A 4M72A 3MCZA 2KP6A 1U3EM 3CJNA 2M5WA 1F36A 1MZBA 4A3MJ 1R1UA 2H27A 3CCEI 1Y6IA 3F72A 3TMOA 1R58A 2GIVA 2AO9A 2WAEA 1VQNI 3A02A 2V1NA 4A5NA 4ZJZA 1SD5A 4CCLA 4B48A 4CHUA 2HFHA 3S14J 3G4SI 2H09A 1ERDA 4PJMA 2M4GA 3FXRA 2K27A 3ABKH 1S7OA 2LREA 2JZYA 2L0KA 3GF2A 3CCQI 3OYIA 5FRMA 2L7KA 5DD4A 3G73A 1OCPA 1S7AA 2E5NA 1IN4A 1R4NB 2KHMA 3HEFA 3C2GA 3OYFA 4RM2A 4KT6A 1O3RA 2WAQN 2HVRA 2J5OA 3CMMA 1R1TA 2CWEA 2VXZA 4F55A 1X19A 3DFGA 4AIKA 3HUGA 2LY2A 3GO5A 2A6TA 3LSRA 1OR7C 4S04A 4J01A 4PJ0C 2BVLA 1MBKA 1IDYA 3PQJA 3OYEA 4C9YA 4A6DA 5EZGA 1P6RA 4C3JJ 4PJNA 1MDMA 4D9JA 2R92J 2LNBA 1MBHA 4M6YA 4Y52J 3ZMUA 4MEXF 2EV6A 2V6CA 5D6EA 2DQRA 3PO2J 4XORA 2UWMA 3CMAI 1J75A 2B63J 3OOUA 1EH6A 2PFBA 2JMWA 2QKLB 3OL3A 5EEGA 4HSTA 2M8GX 3GTGJ 4EJWA 1W36C 2XDVA 4XRFA 5FKNA 3H9JA 3J81K 1RRJA 2JA2A 1U0JA 4XICA 1XDUA 3QYEA 1XS9A 2LTPA 2F5DA 2FD5A 3FMRA 3WTXC 3H0DA 4NC8A 4WWCA 5ICCA 1XGSA 5DUKA 4IF4A 3MAJA 2NNNA 3V7CA 1UHMA 4MQVA 3BC8A 4UB8C 2PLYA 4RGXA 1SANA 2DMNA 3LL7A 2OUMA 3A01B 1YITI 1VZ0A 3E97A 4IZZA 1IC8A 1MGTA 3HRSA 3SZGA 3HHHA 3MKZA 3M4OJ 1P92A 2AQFA 1SVMA 4EJTA 2V4JC 2XB5A 3RZOJ 3WGIA 1LNWA 3TBIA 2IA2A 4Q5SF 2HOSA 3PO3J 2W7NA 4A0ZA 4BXUA 5J47A 2M8EA 3FK7A 3IH3A 2Z1DA 2VBXA 1XCBA 2XAUA 3P9IA 3SEZA 2IJLA 1R6RA 2M7AA 2M87A 3K4JA 1U6GA 2BW3A 1U9OA 4UV8A 3V7RA 5C44J 5GAGJ 4G12A 1YO5C 2IS6A 4NNJA 2ACJA 2X85A 4CA0A 4EM1A 1WI3A 1J9IA 4FHTA 1ETVA 3HB9A 3BG3A 2LDUA 4BQOA 4JX6A 2DA7A 4CCMA 3DP7A 5JLXA 4HDUA 3ZQIA 1JHFA 2CQXA 4L9VA 2GZWA 2WC2A 5FLMJ 1J7KA 4L9NA 4E4HA 3RQIA 2NVUB 2PEXA 3CJRB 2HDDA 3CCVI 3QU6A 2XKPA 3L1PA 2HEOA 3PNYA 2EILH 2FQ4A 5FB2A 4HRIA 1BBYA 3FXJA 3RYPA 4D1QA 3C18A 2EINH 4QIWN 3DKYA 2V26A 1IJWC 2KZGA 2DCEA 2RNJA 1I6HJ 4H4KC 1S9HA 2H8RA 2LY1A 3DU5A 1B72A 1YJ9I 4YFNF 3TOBA 1S29A 3QOPA 2ZXHA 1XPXA 4CZZA 4YIIA 1IXSB 5C4JJ 1R5ID 5LHGA 2G7HA 1ZR4A 3QP5A 4HAMA 1TQPA 2CQNA 2XGDA 1OKRA 4UHTA 4C3IJ 1MBFA 4XN3A 3U1DA 2FJ1A 2HXIA 4RAZA 1G8XA 3NQOA 3ESWB 3L00A 2FBIA 3WGHA 2KIQA 3ZRGA 4DGWB 5F0HA 2VLAA 3IH2A 3FXQA 3CZ6A 3FHZA 2OTJI 4A3IJ 3NARA 1FOXA 4G6TB 3ELKA 2K40A 3N97A 2JJ7A 2DJIA 5E18F 1I1GA 1JT6A 4P1WA 2R5YA 5GAEJ 1POGA 2Q1ZB 1BI2A 1Z21A 4JBAA 2E35A 3RPQA 4CSWA 1H8AC 1TZLA 5FD5A 4O3MA 2OA4A 3AL0B 1RUNA 3T5XA 1JXSA 3DF8A 1MSEC 2IS1A 1NK2P 1QHGA 4M71A 1BW6A 3KYCB 3MKLA 2EV5A 4WXDA 1K4TA 3GTOJ 2RKHA 1XB4A 5IYCJ 3Q0VA 2I5UA 1QVUA 3KE2A 2ETHA 1RIOH 1TWCJ 1J2XA 1APLC 4A0YA 2PMZN 2MBFA 3VFZA 4XKVA 2LBFA 2L3DA 2N8GA 4HX7A 5B66C 1ON1A 3HKZA 2MD0A 1O7LA 4I0AA 3ULQB 2WWYA 2ZJ2A 3M8JA 4DOZA 3HRTA 2M0CA 3HUGB 3KEOA 4AD9A 4P9FA 3FX3A 4PZJA 4BEHA 5JFRA 1YHQI 2JRMA 5ICFA 1A5JA 4BE0A 1VQ4I 1PVEA 2KT0A 2HI3A 4FISA 4XLAA 2JA8J 1ZGJA 2QCOA 3R4KA 1SFXA 4IQJA 5KNLA 3OR1C 1ZREA 2ZJRF 4U7BA 2I8DA 2STTA 4PJLA 3WHCA 3CCLI 3DBHB 1MDMB 2ZXIA 2OZUA 1Z7UA 5TGTA 4KISA 2GXAA 2VONA 3F8BA 2ZBKA 4NUBA 3G1MA 4PGHA 4ESBA 4Y13A 4LLLA 1RR8C 1UAAA 5IOZA 2OQRA 1LFBA 5LGUA 6PAXA 5GPCA 3ABLH 1R7JA 3TW6A 3U2RA 2Z9OA 5LLQA 2LY9A 1E2XA 4YRVA 3WGGA 5GP9A 5M5WJ 4KIFA 2LVSA 1F9NA 1EKEA 2WTEA 2X1EA 5LD2C 2EZKA 3IWZA 3GTJJ 1GDTA 2BGCA 4OIOF 5M3FJ 5E1XA 5DTDA 3DCFA 4WCGA 4C30A 3N05A 2WBMA 1UJ8A 1QU3A 5FRNA 2FU4A 3F0CA 2EA2A 2LSOA 1QPIA 4WXHA 4ON0A 4XOPA 2HYJA 1D3YA 3GVAA 2L02A 2BXYA 5TISC 3IKTA 4ETSA 3IUOA 3W3CA 1Z05A 2JPCA 1USTA 2BHYA 1FTZA 2COBA 2R93J 3LSTA 1WJAA 1H89C 4HF2A 2CJJA 4ZYEA 1W5SA 2VJ4A 3G6EI 1O4XA 2ZNZA 3GLLA 1Z91A 3KZIC 3ECHA 3A0HC 3TO6A 3J80Z 3FXOA 3LQQA 2XPWA 2XAHA 3BQYA 3PJRA 2FOWA 2F4MB 2A05A 1KU2A 3HC7A 2A5YB 2O8XA 2DT6A 3K69A 2P7VB 3LA3A 3PFYA 1L0OC 3QU3A 3C7JA 5DUIA 5FD6A 4KFCA 3TDZC 1K6YA 1K83J 1T0FA 1K79A 2KJBA 4E7IA 3H9QA 4Q48A 2QQ9A 1X1BA 4U88A 1YJNI 3I59A 1D0XA 4M3GA 4MHGA 4II2A 2EIMH 4E70A 4IHXA 2NOGA 1R5GA 3IAM2 3W2VA 3K70C 4V2FA 3HXLA 1ZLJA 5E1ZB 3QPLA 3MFKA 4HV6A 1FJLA 3R6SA 2ECBA 2F6CA 5E8GA 3R0JA 3F6VA 4OAZA 3WTUC 3WHBA 1SD6A 2M3AA 5H20A 2VODA 4LIUA 4LOCA 5DCMB 2KZVA 2LRDA 1IRGA 1P2FA 1YOVB 2OPTA 3BQZA 3DTEA 2JTVA 4II3A 4EVIA 3WTSC 1HSTA 1Z77A 3OYCA 4GYGA 3OYJA 4M6VA 3IL2A 1ETKA 2XSJC 2VQLA 5A2QK 3FXUA 1NK3P 3CC2I 2CQKA 2MFZA 1R4MB 2XRLA 3FF5A 1N75A 1R5HA 2EPFA 3F6OA 4OU0A 1NHAA 1ZG5A 3S3NA 1YRNA 4XRMA
chains in the Genus database with same CATH topology
4BHBA 1R22A 4RAYA 2IRFG 2DQLA 2ZMEB 5H6RA 4GO1A 2ZKZA 1TW3A 1OYIA 3TO7A 2PMHA 1GHCA 5D6FA 5LEKA 2EFOA 3ABUA 5HDNA 5DDGA 2Q0OA 5LHIA 2GXGA 2NAZA 1Z9CA 3BJAA 1Z1DA 5ILVA 2E1CA 2W84A 4HV5A 3DV8A 3EQLF 1LB2A 1CF7A 3I4PA 1PP7U 1K6OA 4G94A 3LAPA 1J0RA 4OMZA 1IN5A 1IRFA 5LRRA 3ZMTA 4M6XA 3P7NA 3RI4A 2KIUA 1FY7A 3I58A 2XIGA 1XSVA 2FSWA 3K1NA 3KP5A 5K5RA 2QENA 4M73A 5ILSA 4G6DA 5HVQC 1W7PA 3PFIA 3ZN0A 3IRRA 1XD7A 4G9YA 5HDGA 2P5VA 4LD5A 1IW7F 2IP2A 2A68F 4KDPA 3BY6A 3R60A 3QRFF 2A6HF 4OIRF 5K5QA 4KMFA 4A5MA 2HQRA 1FOKA 2YX4A 1KQ9A 4HQMA 1C0WA 2PBIA 1FYKA 2QQBA 1AWCA 2STWA 4EJOA 3TGNA 1SMTA 5F64A 4MTEA 1MJAA 5D5WB 3T8RA 2NS0A 3J81Z 4IPAA 4EMSA 3TOAA 1I5ZA 2IPQX 2D1VA 3EETA 2NRAC 3T8TA 2E1NA 4YG2F 4OOIA 1YYVA 1ZHFA 1YW7A 4I98B 1IUYA 1L3LA 2PJPA 2JSCA 2QLZA 1B9MA 2HOEA 4KN4X 4DNCA 2FQ3A 5JVTA 1FPQA 3QP6A 4QLCU 2HKOA 5HS7A 1OYWA 1HQCA 1WRJA 4YFXF 5L3BA 2P8TA 2CO5A 4Q4ZF 1H9GA 5L3CA 2EWNA 4U0WA 1SAXA 2JPBA 4RB3C 3BJ6A 1U5TA 4GXOA 5DD8A 1QZZA 3TO9A 2VBWA 4RGSA 4ZZLA 5D5XB 4DQ2A 3OV8A 4HA8A 1F5TA 4I01A 2DO7A 3I54A 3WG9A 4KIGA 2H94A 4IRIA 1W4MA 4G7ZF 2Z33A 2YSRA 2HYGD 1F4KA 5TRDA 2XAGA 2BV6A 4UVBA 2QBYB 3GZ6A 2VC0A 5E17F 2DPDA 2XASA 1DPRA 5E20A 4ENNA 2VOPA 2W25A 2NNYA 2GWRA 1HSJA 5CYVA 3IC7A 2X0LA 4P96A 1CF7B 2DW4A 2A07F 4MQ9F 4L9TA 1ZG1A 1TNSA 3E6BA 1ZAOA 1KQ8A 2DK5A 1R23A 1O3SA 2MLGA 5LGTA 3W6JB 5J6XA 4Y17A 3GFJA 2A61A 3RKWA 4BAYA 4L5JA 1E17A 2EB7A 1W7PB 2FE3A 3NEUA 1FP2A 3JW4A 1FX7A 4KYWA 2OAZA 1REPC 4LK0F 1V3FA 2BEOA 2L4AA 3BPXA 5DEQA 1EH7A 4FX0A 1F1ZA 2O61A 5D8KB 3E5XA 3COAC 3GEZA 2Z99A 3L09A 4FT8A 4KNYA 1FWZA 1FC3A 1KU7A 3WU1B 1G6NA 1P4AA 2MA3A 2HKXA 1BIBA 3M7GA 4ZYGA 4G7OF 3CTAA 3V4GA 2FBKA 4HBLA 3MQ0A 3MZHA 1EV7A 4MEYF 5HLIA 3E3VA 1Z6TA 4Q47A 3ZMVA 2FF4A 1TQIA 4I0BA 3CLOA 1Z6RA 2UXXA 3RJPA 1WSUA 3WTYC 1QQIA 4YIFA 4BQAA 5FGMA 2MLKA 1KQ0A 2F2EA 3HSRA 3Q9VA 1IN8A 1U5TB 5DCMA 1T6SA 2Z3YA 4ENKA 3O3KA 5HDKA 2VOOA 1DUXC 4L18B 1BN5A 1B9NA 1U78A 3HTUA 1QGPA 3M1EA 1YS7A 3TDUC 5AIPA 3I0TA 1HKQA 3ML6A 4CO8A 2BE5F 1PP8F 2XVCA 3FMQA 2CW0F 2ZMEA 3MWMA 3V8KA 2RDPA 2PN6A 1ZGAA 1ZRFA 5A2QZ 4HQEA 4R1HA 4KIBA 1K7AA 3GYHX 1UFMA 1TW2A 3L2CA 1XCVA 2RGVA 4HLYA 2DTRA 5F1RA 1XSXA 4UUVA 3SFZA 4EQQA 3EYYA 1W7PD 3EDPA 2FBHA 5BQTA 1HBXG 3SZTA 3H3ZA 1ONVA 2HZTA 4KMUX 4L9JA 3S2WA 5E1WA 3OOPA 1BOAA 1XGNA 3RKXA 2RC4A 2V79A 5ED4A 4HX8A 3QPTA 3JTGA 4MTDA 1LEAA 1XMAA 4IRHA 5IT9K 1H0MA 3ROUA 2TDXA 3CO7C 5DYMA 5L3GA 2F5CA 2GAUA 2R7FA 1A04A 4UVAA 4ZYDA 2PI0A 3CUQA 1FYMA 1Q1HA 4LJZF 2QVOA 3O6BB 2O6GE 3I64A 3BOQA 1BM9A 2EA4A 1BC8C 1TNTA 3ZN1A 3GFLA 3EYIA 5HS9A 2YX7A 3R61A 3Q5FA 2QWWA 4AWXB 5K1YA 1HXDA 1G3WA 3ZQ7A 4XBFA 1B6AA 3KP6A 3GXOA 4BH9A 2ZO4A 5LEJA 3ISPA 1WI9A 5H6QA 3WTZA 5K5OA 3LQRA 3NRVA 3JSOA 3RKYA 1QBJA 4P9UA 2A69F 2EV0A 2DK8A 2K86A 1XN7A 4EM2A 1I27A 2FNPA 2V1XA 4RS8A 1XGOA 3BP8A 3F22A 3BWGA 3WU0A 1T2KA 5KVRA 3DPTA 4EGYA 2VE8A 5LRSA 2HS5A 1FSHA 3IHUA 1O3QA 2XRNA 2QYOA 1ZARA 3HYIA 4LK1F 2W24A 3F3XA 4OINF 2A3SA 2RN7A 1MJ9A 1ZYRF 4B09A 1YIOA 2LF7A 2O03A 1LDKB 5BS6A 3HHGA 2QBYA 2L4MA 2GQQA 2HTJA 1K78A 2V9VA 3BZ6A 1PDNC 2EFWA 2COMA 1OPCA 4KUMA 4M74A 1O57A 3GW2A 3ZMDA 4LGWA 2AS5F 5ICGA 3FWEA 1HW5A 1ULYA 3F21A 2ISYA 2VN2A 3LAJA 1EH8A 1JGSA 1QNTA 3F8MA 2P5KA 1J5YA 4O6JA 2H6CA 3F8NA 3KP3A 1TTYA 2EFPA 2JT1A 3IRQA 4N0BA 2JRTA 4ZH4F 5HLGA 4G6QA 1R36A 3CUQB 4ESJA 1KYZA 4I7HA 4KICA 4JQFA 4IHTA 1BI0A 1UHWA 3K0LA 4N9HA 2KIMA 2OU2A 4YFKF 1XSDA 3Q9SA 1UB9A 1G4DA 3T0YA 2M30A 4LB6B 1XDSA 1KYWA 2CGPA 3L7WA 3E5QA 4ZYHA 4HYEA 4I02A 1DP7P 3GUDA 5FFXA 5TJJA 4ASNA 4RGUA 1KGSA 2RVCA 2WV0A 4HDVA 3RYRA 2IW5A 3K2ZA 3T1BA 2ESHA 4PCQA 5FLXK 4O5VA 4A12A 2CG4A 5D4SA 2FA5A 4P5OA 2DAOA 5AONA 4M9SA 2K02A 2OQGA 2G9WA 1ZH5A 1S6LA 4G7HF 4IRGA 4EV0A 3JAMZ 3WE2A 3B73A 4AIHA 3JSPA 2EJRA 4GCVA 2KKOA 4HW0A 2Q2EA 4JK1X 3DKWA 4PDKA 1PUEE 2MD5A 3HSEA 3K1PA 1FNNA 3KZYA 1ODDA 3E6MA 2KRFA 3CUOA 1IF1A 1YTYA 5CVVA 3E5UA 3LWFA 4UV9A 1HKTA 4QWQA 2F5FA 2ESNA 4Z2YA 1OR7A 1K78B 5KK1A 4RB2C 1TLHB 2V1UA 2K4JA 1MKMA 2R3SA 3FZVA 4ESFA 4GYIA 3I53A 1U5TC 3V8LA 4A0XA 1IN7A 5BOXA 1GVJA 2FEZA 1RUOA 1ZN2A 2P5LC 3SHFA 3U9GA 4ENJA 4OIQF 4CICA 2VE9A 2FMYA 1LDJA 5D5VB 5LHHA 3RDIA 1S3JA 3M8EA 1IAWA 2HDCA 3BPVA 3HOTA 2K7LA 4R8HA 4HF0A 3KP4A 2V1DA 3I5UA 5J8CA 4I09A 4CDGA 1AOYA 4LFUA 5CLSA 1IZ1A 2EK5A 4WF2A 3V8JA 3P9CA 2XGXA 1RZ4A 2FNAA 1HW2A 3KP7A 2VBYA 2R7DA 4XLNF 3HRMA 3ZP5A 2KIFA 1W5TA 1IXRC 2GXBA 2VT3A 4XSZF 5IT9Z 1FBSA 3D0SA 3M8FA 5HOOA 3WODF 4M9XA 3G3ZA 2DLLA 2L01A 1I6XA 3RPUA 1IXCA 3DPLC 3I71A 1S8NA 2L54A 2FXAA 3JAMK 1ZG3A 1GXQA 1GXPA 1WQ2A 3W6KB 2IA1A 4N9IA 3TQNA 1YG2A 2OBPA 4NHJA 4UNOA 1FT9A 5IT3A 1YFHA 1R00A 3GFMA 1WKMA 3HSFA 2Z5UA 1VTNC 3VB2A 2LKPA 5CVJA 2XUBA 3HRUA 2IA0A 3H3UA 2Q8KA 2MC3A 5HLHA 3E6DA 4M9ZA 4UVCA 4Y15A 1BJAA 2HR3A 3LA2A 5DCFA 4TV7A 4LLNA 4U7DA 4RB1A 4NQWA 1YW9A 1B1BA 3B02A 3VEPA 5FFZA 3KETA 4GGGA 3LFKA 1XGMA 1BI1A 4BHCA 1RI7A 5L3EA 4MGRA 4PGGA 3IKVA 5LBQA 3EUHA 3F8CA 1FYLA 4F7ZA 4WK8F 2O0YA 1SD4A 1BIAA 3C3WA 1USSA 2A6EF 1FBQA 2BYVE 3WTTC 1T39A 2CFXA 1YLFA 1QPMA 4OIPF 5L3DA 3TKYA 5BMZA 3KCCA 1YS6A 4WX9A 2RV8A 2YR2A 5ILUA 2XROA 3ERED 1STZA 4HZFA 2NYXA 3ZMZA 4XSXF 2ISZA 4WXCA 1P4XA 3ZPLA 4CGZA 5D5UB 2VT2A 4KA4A 2VBZA 4MNUA 5JR3A 3AAFA 1ZRDA 5J8FA 1V4RA 4EJUA 2HYFA 4G8XA 3GFIA 1MD0A 3WTVC 3FMSA 1O7FA 2RQPA 2QZ8A 1U8RA 2ZXJA 1SFEA 2XKOA 3VOEA 3MZYA 4IXAA 2AXLA 4I2OA 1ZRCA 4IJAA 2K4BA 3L9FA 2VC1A 2QM3A 2CSOA 4NB5A 4L0ZB 2PG4A 2P6SA 4L5IA 4HOBA 3DEUA 5FO5A 1IN6A 4S05A 3K1MA 1HKSA 2E7WA 2HWVA 2P7CB 2XAJA 2IVMA 5L3FA 2XAQA 3QPHA 3WE3A 4LG0A 4BNCA 1KU3A 5CVRA 3CUQC 1FBUA 1KU9A 5ICEA 3SXYA 4RB0A 2B0LA 2XAFA 4CXFA 4UXNA 3PQKA 1YW8A 4H0EA 1R1VA 2QQAA 1UCRA 2UXNA 1HW1A 2DT5A 1D5VA 2DFIA 4IHSA 1T38A 2M45A 2OD5A 3D5LA 4EGZA 2G7UA 2DPUA 1ON2A 3P9KA 5FLXZ 1U2WA 2GA1A 5CJ9A 1TQMA 2HQNA 2FMLA 1D8JA 1FP1D 2EFNA 1BC7C 3DXJF 3DQVC 2ZNYA 2J5PA 4KT5C 4KN7X 3GLXA 2ADUA 3O2PE 1B4AA 2P4WA 4OMYA 5DV5A 3HTSB 2E7XA 3HIFA 4HX4A 4LMYA 3ABTA 2W57A 3BROA 1QO0D 3GWZA 1J59A 1FLIA 2HTSA 3H92A 4ZZDA 2YU3A 2D2WA 1SFUA 3SQNA 1G3TA 2DBBA 3VODA 3BDDA 4A2UA 1B59A 4CYDA 4R79A 1FSEA 3REOA 2D1HA 3KEQA 1XMKA 2O3FA 1OMIA 3ECOA 2YPRA 1SMYF 3QAHA 3J7AO 3JTHA 4LB5A 2Y75A 1ZLKA 1WWXA 1LJ9A 3M9AA 1JHHA 1LQ1A 3FM5A 4LLGF 4BHPA 2W85A 4HLXA 5AIQA 1I1SA 1DDNA 3WTWC 4ENMA 4D0PA 4A6EA 1MJBA 2FRHA 3KLNA 2C6YA 2EFQA 3KP2A 2Y0MA 1O3TA 1D8KA 4U0VA 2XV4S 1H9TA 4EJVA 3RTRA 1CGPA 3K9TA 1P4WA 1FZPB 4L0YB 2MH2A 4AVPA 1BI3A 3RIRA 2ELHA 3J80K 4HF1A 2KJCA 1RNLA 5BPDA 3SZPA 5BPIA 2D45A 2PQ8A 5JI6A 1Y0UA 3C1DA 2F5EA 2IT0A 1QZYA 4EM0B 1YQAA 4LG0B 4IVNA 4AIJA 1JE8A 2UZKA 1LEBA 1T98A 3E6CC 3LA7A 3F8FA 3KLOA 1LVAA 2ZFWA 3V7SA 3CO6C 1TBXA 1X3UA 5CVIA 1OYYA 3GX4X 2X4HA 2Y48A 2XHKA 2PMUA 3IWFA 3I59B 3BJOA 3F23A 5F6FA 4FX4A 2P6TA 3CDHA 2M1BA 5D8LB 3KZZA 5JHUA 3R0AA 2GA2A 4B8XA 4U0YA 2QUFA 2DI3A 2CYYA 2FOKA 5ERIA 5E8IA 4K2EA 2H6BA 5CVUA 2MH9A 5HS8A 3GZ5A 4XLPF 2BBYA 3ZMSA 3HOSA 1LDDA 5LGNA 2DU9A 3N4MA 4BYYA 4P55A 5D4RA 1DPUA 2ZCWA 3MEXA 5EEHA 2OZ6A 2LF8A 3KFWX 4RGRA 1KA8A 1G3YA 1G3SA 3FM3A 2HGCA 1SD7A 4M72A 3MCZA 1U3EM 3CJNA 2M5WA 1MZBA 1R1UA 2H27A 3F72A 1R58A 2GIVA 4A5NA 1SD5A 4CHUA 2HFHA 2H09A 3FXRA 2K27A 1S7OA 2JZYA 3GF2A 5DD4A 3G73A 1S7AA 1IN4A 1O3RA 2J5OA 1R1TA 2CWEA 2VXZA 3DFGA 4AIKA 3HUGA 3GO5A 4S04A 3PQJA 4A6DA 1P6RA 1MDMA 2LNBA 4M6YA 3ZMUA 4MEXF 2EV6A 2V6CA 5D6EA 2DQRA 2UWMA 1J75A 1EH6A 2PFBA 5EEGA 4EJWA 4XRFA 3J81K 1XDUA 3FMRA 2F5DA 3WTXC 4WWCA 5ICCA 1XGSA 5DUKA 4IF4A 3MAJA 2NNNA 3V7CA 1UHMA 4MQVA 2PLYA 4RGXA 3E97A 1MGTA 3HRSA 3HHHA 1P92A 4EJTA 3WGIA 1LNWA 2IA2A 4Q5SF 4A0ZA 4BXUA 2M8EA 2VBXA 1XCBA 3P9IA 2IJLA 2M87A 1U6GA 4UV8A 3V7RA 1YO5C 2ACJA 4EM1A 1J9IA 4FHTA 2LDUA 4HDUA 3DP7A 1JHFA 4L9VA 2GZWA 2WC2A 1J7KA 4L9NA 2PEXA 3QU6A 2XKPA 2HEOA 5FB2A 1BBYA 3RYPA 3C18A 2RNJA 4YFNF 3TOBA 1S29A 3QOPA 4CZZA 4YIIA 1IXSB 5LHGA 2G7HA 3QP5A 4HAMA 1TQPA 1OKRA 4UHTA 3U1DA 4RAZA 3NQOA 3L00A 2FBIA 3WGHA 3FXQA 3FHZA 3ELKA 3N97A 5E18F 1I1GA 1BI2A 4JBAA 3RPQA 4O3MA 5FD5A 2OA4A 1RUNA 3T5XA 1JXSA 3DF8A 4M71A 2EV5A 2RKHA 1XB4A 3KE2A 2ETHA 1RIOH 1J2XA 4A0YA 2MBFA 3VFZA 2L3DA 4HX7A 1ON1A 1O7LA 4I0AA 3ULQB 2WWYA 2ZJ2A 3HRTA 3KEOA 4AD9A 4P9FA 3FX3A 4PZJA 5JFRA 5ICFA 1ZGJA 3R4KA 1SFXA 1ZREA 4U7BA 2STTA 1MDMB 2OZUA 1Z7UA 2VONA 3F8BA 2ZBKA 4PGHA 4ESBA 4Y13A 4LLLA 2OQRA 5LGUA 6PAXA 1R7JA 3U2RA 2Z9OA 5LLQA 1E2XA 3WGGA 4KIFA 1F9NA 2WTEA 3IWZA 2BGCA 4OIOF 5E1XA 4WCGA 2FU4A 2EA2A 2LSOA 4WXHA 4ON0A 1D3YA 3GVAA 2L02A 3IKTA 4ETSA 1Z05A 2JPCA 1USTA 3LSTA 4HF2A 4ZYEA 1W5SA 2ZNZA 1Z91A 3ECHA 3TO6A 3J80Z 3LQQA 2XAHA 1KU2A 3K69A 2A5YB 2O8XA 3LA3A 4WXDA 2P7VB 3QU3A 1L0OC 3C7JA 5DUIA 5FD6A 4KFCA 3TDZC 1T0FA 1K79A 2KJBA 4Q48A 2QQ9A 4U88A 3I59A 4MHGA 4E70A 1R5GA 1ZLJA 5E1ZB 3MFKA 4HV6A 3R6SA 5E8GA 3R0JA 3F6VA 3WTUC 2VODA 1SD6A 5H20A 5DCMB 1IRGA 1P2FA 4EVIA 3WTSC 2JTVA 1HSTA 4GYGA 3IL2A 5A2QK 3FXUA 2CQKA 3FF5A 1R5HA 3F6OA 4OU0A 1NHAA 1ZG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BHB A;  1R22 A;  4RAY A;  2IRF G;  2DQL A;  2ZME B;  5H6R A;  4GO1 A;  2ZKZ A;  1TW3 A;  1OYI A;  3TO7 A;  2PMH A;  1GHC A;  5D6F A;  5LEK A;  2EFO A;  3ABU A;  5HDN A;  5DDG A;  2Q0O A;  5LHI A;  2GXG A;  2NAZ A;  1Z9C A;  3BJA A;  1Z1D A;  5ILV A;  2E1C A;  2W84 A;  4HV5 A;  3DV8 A;  3EQL F;  1LB2 A;  1CF7 A;  3I4P A;  1PP7 U;  1K6O A;  4G94 A;  3LAP A;  1J0R A;  4OMZ A;  1IN5 A;  1IRF A;  5LRR A;  3ZMT A;  4M6X A;  3P7N A;  3RI4 A;  2KIU A;  1FY7 A;  3I58 A;  2XIG A;  1XSV A;  2FSW A;  3K1N A;  3KP5 A;  5K5R A;  2QEN A;  4M73 A;  5ILS A;  4G6D A;  5HVQ C;  1W7P A;  3PFI A;  3ZN0 A;  3IRR A;  1XD7 A;  4G9Y A;  5HDG A;  2P5V A;  4LD5 A;  1IW7 F;  2IP2 A;  2A68 F;  4KDP A;  3BY6 A;  3R60 A;  3QRF F;  2A6H F;  4OIR F;  5K5Q A;  4KMF A;  4A5M A;  2HQR A;  1FOK A;  2YX4 A;  1KQ9 A;  4HQM A;  1C0W A;  2PBI A;  1FYK A;  2QQB A;  1AWC A;  2STW A;  4EJO A;  3TGN A;  1SMT A;  5F64 A;  4MTE A;  1MJA A;  5D5W B;  3T8R A;  2NS0 A;  3J81 Z;  4IPA A;  4EMS A;  3TOA A;  1I5Z A;  2IPQ X;  2D1V A;  3EET A;  2NRA C;  3T8T A;  2E1N A;  4YG2 F;  4OOI A;  1YYV A;  1ZHF A;  1YW7 A;  4I98 B;  1IUY A;  1L3L A;  2PJP A;  2JSC A;  2QLZ A;  1B9M A;  2HOE A;  4KN4 X;  4DNC A;  2FQ3 A;  5JVT A;  1FPQ A;  3QP6 A;  4QLC U;  2HKO A;  5HS7 A;  1OYW A;  1HQC A;  1WRJ A;  4YFX F;  5L3B A;  2P8T A;  2CO5 A;  4Q4Z F;  1H9G A;  5L3C A;  2EWN A;  4U0W A;  1SAX A;  2JPB A;  4RB3 C;  3BJ6 A;  1U5T A;  4GXO A;  5DD8 A;  1QZZ A;  3TO9 A;  2VBW A;  4RGS A;  4ZZL A;  5D5X B;  4DQ2 A;  3OV8 A;  4HA8 A;  1F5T A;  4I01 A;  2DO7 A;  3I54 A;  3WG9 A;  4KIG A;  2H94 A;  4IRI A;  1W4M A;  4G7Z F;  2Z33 A;  2YSR A;  2HYG D;  1F4K A;  5TRD A;  2XAG A;  2BV6 A;  4UVB A;  2QBY B;  3GZ6 A;  2VC0 A;  5E17 F;  2DPD A;  2XAS A;  1DPR A;  5E20 A;  4ENN A;  2VOP A;  2W25 A;  2NNY A;  2GWR A;  1HSJ A;  5CYV A;  3IC7 A;  2X0L A;  4P96 A;  1CF7 B;  2DW4 A;  2A07 F;  4MQ9 F;  4L9T A;  1ZG1 A;  1TNS A;  3E6B A;  1ZAO A;  1KQ8 A;  2DK5 A;  1R23 A;  1O3S A;  2MLG A;  5LGT A;  3W6J B;  5J6X A;  4Y17 A;  3GFJ A;  2A61 A;  3RKW A;  4BAY A;  4L5J A;  1E17 A;  2EB7 A;  1W7P B;  2FE3 A;  3NEU A;  1FP2 A;  3JW4 A;  1FX7 A;  4KYW A;  2OAZ A;  1REP C;  4LK0 F;  1V3F A;  2BEO A;  2L4A A;  3BPX A;  5DEQ A;  1EH7 A;  4FX0 A;  1F1Z A;  2O61 A;  5D8K B;  3E5X A;  3COA C;  3GEZ A;  2Z99 A;  3L09 A;  4FT8 A;  4KNY A;  1FWZ A;  1FC3 A;  1KU7 A;  3WU1 B;  1G6N A;  1P4A A;  2MA3 A;  2HKX A;  1BIB A;  3M7G A;  4ZYG A;  4G7O F;  3CTA A;  3V4G A;  2FBK A;  4HBL A;  3MQ0 A;  3MZH A;  1EV7 A;  4MEY F;  5HLI A;  3E3V A;  1Z6T A;  4Q47 A;  3ZMV A;  2FF4 A;  1TQI A;  4I0B A;  3CLO A;  1Z6R A;  2UXX A;  3RJP A;  1WSU A;  3WTY C;  1QQI A;  4YIF A;  4BQA A;  5FGM A;  2MLK A;  1KQ0 A;  2F2E A;  3HSR A;  3Q9V A;  1IN8 A;  1U5T B;  5DCM A;  1T6S A;  2Z3Y A;  4ENK A;  3O3K A;  5HDK A;  2VOO A;  1DUX C;  4L18 B;  1BN5 A;  1B9N A;  1U78 A;  3HTU A;  1QGP A;  3M1E A;  1YS7 A;  3TDU C;  5AIP A;  3I0T A;  1HKQ A;  3ML6 A;  4CO8 A;  2BE5 F;  1PP8 F;  2XVC A;  3FMQ A;  2CW0 F;  2ZME A;  3MWM A;  3V8K A;  2RDP A;  2PN6 A;  1ZGA A;  1ZRF A;  5A2Q Z;  4HQE A;  4R1H A;  4KIB A;  1K7A A;  3GYH X;  1UFM A;  1TW2 A;  3L2C A;  1XCV A;  2RGV A;  4HLY A;  2DTR A;  5F1R A;  1XSX A;  4UUV A;  3SFZ A;  4EQQ A;  3EYY A;  1W7P D;  3EDP A;  2FBH A;  5BQT A;  1HBX G;  3SZT A;  3H3Z A;  1ONV A;  2HZT A;  4KMU X;  4L9J A;  3S2W A;  5E1W A;  3OOP A;  1BOA A;  1XGN A;  3RKX A;  2RC4 A;  2V79 A;  5ED4 A;  4HX8 A;  3QPT A;  3JTG A;  4MTD A;  1LEA A;  1XMA A;  4IRH A;  5IT9 K;  1H0M A;  3ROU A;  2TDX A;  3CO7 C;  5DYM A;  5L3G A;  2F5C A;  2GAU A;  2R7F A;  1A04 A;  4UVA A;  4ZYD A;  2PI0 A;  3CUQ A;  1FYM A;  1Q1H A;  4LJZ F;  2QVO A;  3O6B B;  2O6G E;  3I64 A;  3BOQ A;  1BM9 A;  2EA4 A;  1BC8 C;  1TNT A;  3ZN1 A;  3GFL A;  3EYI A;  5HS9 A;  2YX7 A;  3R61 A;  3Q5F A;  2QWW A;  4AWX B;  5K1Y A;  1HXD A;  1G3W A;  3ZQ7 A;  4XBF A;  1B6A A;  3KP6 A;  3GXO A;  4BH9 A;  2ZO4 A;  5LEJ A;  3ISP A;  1WI9 A;  5H6Q A;  3WTZ A;  5K5O A;  3LQR A;  3NRV A;  3JSO A;  3RKY A;  1QBJ A;  4P9U A;  2A69 F;  2EV0 A;  2DK8 A;  2K86 A;  1XN7 A;  4EM2 A;  1I27 A;  2FNP A;  2V1X A;  4RS8 A;  1XGO A;  3BP8 A;  3F22 A;  3BWG A;  3WU0 A;  1T2K A;  5KVR A;  3DPT A;  4EGY A;  2VE8 A;  5LRS A;  2HS5 A;  1FSH A;  3IHU A;  1O3Q A;  2XRN A;  2QYO A;  1ZAR A;  3HYI A;  4LK1 F;  2W24 A;  3F3X A;  4OIN F;  2A3S A;  2RN7 A;  1MJ9 A;  1ZYR F;  4B09 A;  1YIO A;  2LF7 A;  2O03 A;  1LDK B;  5BS6 A;  3HHG A;  2QBY A;  2L4M A;  2GQQ A;  2HTJ A;  1K78 A;  2V9V A;  3BZ6 A;  1PDN C;  2EFW A;  2COM A;  1OPC A;  4KUM A;  4M74 A;  1O57 A;  3GW2 A;  3ZMD A;  4LGW A;  2AS5 F;  5ICG A;  3FWE A;  1HW5 A;  1ULY A;  3F21 A;  2ISY A;  2VN2 A;  3LAJ A;  1EH8 A;  1JGS A;  1QNT A;  3F8M A;  2P5K A;  1J5Y A;  4O6J A;  2H6C A;  3F8N A;  3KP3 A;  1TTY A;  2EFP A;  2JT1 A;  3IRQ A;  4N0B A;  2JRT A;  4ZH4 F;  5HLG A;  4G6Q A;  1R36 A;  3CUQ B;  4ESJ A;  1KYZ A;  4I7H A;  4KIC A;  4JQF A;  4IHT A;  1BI0 A;  1UHW A;  3K0L A;  4N9H A;  2KIM A;  2OU2 A;  4YFK F;  1XSD A;  3Q9S A;  1UB9 A;  1G4D A;  3T0Y A;  2M30 A;  4LB6 B;  1XDS A;  1KYW A;  2CGP A;  3L7W A;  3E5Q A;  4ZYH A;  4HYE A;  4I02 A;  1DP7 P;  3GUD A;  5FFX A;  5TJJ A;  4ASN A;  4RGU A;  1KGS A;  2RVC A;  2WV0 A;  4HDV A;  3RYR A;  2IW5 A;  3K2Z A;  3T1B A;  2ESH A;  4PCQ A;  5FLX K;  4O5V A;  4A12 A;  2CG4 A;  5D4S A;  2FA5 A;  4P5O A;  2DAO A;  5AON A;  4M9S A;  2K02 A;  2OQG A;  2G9W A;  1ZH5 A;  1S6L A;  4G7H F;  4IRG A;  4EV0 A;  3JAM Z;  3WE2 A;  3B73 A;  4AIH A;  3JSP A;  2EJR A;  4GCV A;  2KKO A;  4HW0 A;  2Q2E A;  4JK1 X;  3DKW A;  4PDK A;  1PUE E;  2MD5 A;  3HSE A;  3K1P A;  1FNN A;  3KZY A;  1ODD A;  3E6M A;  2KRF A;  3CUO A;  1IF1 A;  1YTY A;  5CVV A;  3E5U A;  3LWF A;  4UV9 A;  1HKT A;  4QWQ A;  2F5F A;  2ESN A;  4Z2Y A;  1OR7 A;  1K78 B;  5KK1 A;  4RB2 C;  1TLH B;  2V1U A;  2K4J A;  1MKM A;  2R3S A;  3FZV A;  4ESF A;  4GYI A;  3I53 A;  1U5T C;  3V8L A;  4A0X A;  1IN7 A;  5BOX A;  1GVJ A;  2FEZ A;  1RUO A;  1ZN2 A;  2P5L C;  3SHF A;  3U9G A;  4ENJ A;  4OIQ F;  4CIC A;  2VE9 A;  2FMY A;  1LDJ A;  5D5V B;  5LHH A;  3RDI A;  1S3J A;  3M8E A;  1IAW A;  2HDC A;  3BPV A;  3HOT A;  2K7L A;  4R8H A;  4HF0 A;  3KP4 A;  2V1D A;  3I5U A;  5J8C A;  4I09 A;  4CDG A;  1AOY A;  4LFU A;  5CLS A;  1IZ1 A;  2EK5 A;  4WF2 A;  3V8J A;  3P9C A;  2XGX A;  1RZ4 A;  2FNA A;  1HW2 A;  3KP7 A;  2VBY A;  2R7D A;  4XLN F;  3HRM A;  3ZP5 A;  2KIF A;  1W5T A;  1IXR C;  2GXB A;  2VT3 A;  4XSZ F;  5IT9 Z;  1FBS A;  3D0S A;  3M8F A;  5HOO A;  3WOD F;  4M9X A;  3G3Z A;  2DLL A;  2L01 A;  1I6X A;  3RPU A;  1IXC A;  3DPL C;  3I71 A;  1S8N A;  2L54 A;  2FXA A;  3JAM K;  1ZG3 A;  1GXQ A;  1GXP A;  1WQ2 A;  3W6K B;  2IA1 A;  4N9I A;  3TQN A;  1YG2 A;  2OBP A;  4NHJ A;  4UNO A;  1FT9 A;  5IT3 A;  1YFH A;  1R00 A;  3GFM A;  1WKM A;  3HSF A;  2Z5U A;  1VTN C;  3VB2 A;  2LKP A;  5CVJ A;  2XUB A;  3HRU A;  2IA0 A;  3H3U A;  2Q8K A;  2MC3 A;  5HLH A;  3E6D A;  4M9Z A;  4UVC A;  4Y15 A;  1BJA A;  2HR3 A;  3LA2 A;  5DCF A;  4TV7 A;  4LLN A;  4U7D A;  4RB1 A;  4NQW A;  1YW9 A;  1B1B A;  3B02 A;  3VEP A;  5FFZ A;  3KET A;  4GGG A;  3LFK A;  1XGM A;  1BI1 A;  4BHC A;  1RI7 A;  5L3E A;  4MGR A;  4PGG A;  3IKV A;  5LBQ A;  3EUH A;  3F8C A;  1FYL A;  4F7Z A;  4WK8 F;  2O0Y A;  1SD4 A;  1BIA A;  3C3W A;  1USS A;  2A6E F;  1FBQ A;  2BYV E;  3WTT C;  1T39 A;  2CFX A;  1YLF A;  1QPM A;  4OIP F;  5L3D A;  3TKY A;  5BMZ A;  3KCC A;  1YS6 A;  4WX9 A;  2RV8 A;  2YR2 A;  5ILU A;  2XRO A;  3ERE D;  1STZ A;  4HZF A;  2NYX A;  3ZMZ A;  4XSX F;  2ISZ A;  4WXC A;  1P4X A;  3ZPL A;  4CGZ A;  5D5U B;  2VT2 A;  4KA4 A;  2VBZ A;  4MNU A;  5JR3 A;  3AAF A;  1ZRD A;  5J8F A;  1V4R A;  4EJU A;  2HYF A;  4G8X A;  3GFI A;  1MD0 A;  3WTV C;  3FMS A;  1O7F A;  2RQP A;  2QZ8 A;  1U8R A;  2ZXJ A;  1SFE A;  2XKO A;  3VOE A;  3MZY A;  4IXA A;  2AXL A;  4I2O A;  1ZRC A;  4IJA A;  2K4B A;  3L9F A;  2VC1 A;  2QM3 A;  2CSO A;  4NB5 A;  4L0Z B;  2PG4 A;  2P6S A;  4L5I A;  4HOB A;  3DEU A;  5FO5 A;  1IN6 A;  4S05 A;  3K1M A;  1HKS A;  2E7W A;  2HWV A;  2P7C B;  2XAJ A;  2IVM A;  5L3F A;  2XAQ A;  3QPH A;  3WE3 A;  4LG0 A;  4BNC A;  1KU3 A;  5CVR A;  3CUQ C;  1FBU A;  1KU9 A;  5ICE A;  3SXY A;  4RB0 A;  2B0L A;  2XAF A;  4CXF A;  4UXN A;  3PQK A;  1YW8 A;  4H0E A;  1R1V A;  2QQA A;  1UCR A;  2UXN A;  1HW1 A;  2DT5 A;  1D5V A;  2DFI A;  4IHS A;  1T38 A;  2M45 A;  2OD5 A;  3D5L A;  4EGZ A;  2G7U A;  2DPU A;  1ON2 A;  3P9K A;  5FLX Z;  1U2W A;  2GA1 A;  5CJ9 A;  1TQM A;  2HQN A;  2FML A;  1D8J A;  1FP1 D;  2EFN A;  1BC7 C;  3DXJ F;  3DQV C;  2ZNY A;  2J5P A;  4KT5 C;  4KN7 X;  3GLX A;  2ADU A;  3O2P E;  1B4A A;  2P4W A;  4OMY A;  5DV5 A;  3HTS B;  2E7X A;  3HIF A;  4HX4 A;  4LMY A;  3ABT A;  2W57 A;  3BRO A;  1QO0 D;  3GWZ A;  1J59 A;  1FLI A;  2HTS A;  3H92 A;  4ZZD A;  2YU3 A;  2D2W A;  1SFU A;  3SQN A;  1G3T A;  2DBB A;  3VOD A;  3BDD A;  4A2U A;  1B59 A;  4CYD A;  4R79 A;  1FSE A;  3REO A;  2D1H A;  3KEQ A;  1XMK A;  2O3F A;  1OMI A;  3ECO A;  2YPR A;  1SMY F;  3QAH A;  3J7A O;  3JTH A;  4LB5 A;  2Y75 A;  1ZLK A;  1WWX A;  1LJ9 A;  3M9A A;  1JHH A;  1LQ1 A;  3FM5 A;  4LLG F;  4BHP A;  2W85 A;  4HLX A;  5AIQ A;  1I1S A;  1DDN A;  3WTW C;  4ENM A;  4D0P A;  4A6E A;  1MJB A;  2FRH A;  3KLN A;  2C6Y A;  2EFQ A;  3KP2 A;  2Y0M A;  1O3T A;  1D8K A;  4U0V A;  2XV4 S;  1H9T A;  4EJV A;  3RTR A;  1CGP A;  3K9T A;  1P4W A;  1FZP B;  4L0Y B;  2MH2 A;  4AVP A;  1BI3 A;  3RIR A;  2ELH A;  3J80 K;  4HF1 A;  2KJC A;  1RNL A;  5BPD A;  3SZP A;  5BPI A;  2D45 A;  2PQ8 A;  5JI6 A;  1Y0U A;  3C1D A;  2F5E A;  2IT0 A;  1QZY A;  4EM0 B;  1YQA A;  4LG0 B;  4IVN A;  4AIJ A;  1JE8 A;  2UZK A;  1LEB A;  1T98 A;  3E6C C;  3LA7 A;  3F8F A;  3KLO A;  1LVA A;  2ZFW A;  3V7S A;  3CO6 C;  1TBX A;  1X3U A;  5CVI A;  1OYY A;  3GX4 X;  2X4H A;  2Y48 A;  2XHK A;  2PMU A;  3IWF A;  3I59 B;  3BJO A;  3F23 A;  5F6F A;  4FX4 A;  2P6T A;  3CDH A;  2M1B A;  5D8L B;  3KZZ A;  5JHU A;  3R0A A;  2GA2 A;  4B8X A;  4U0Y A;  2QUF A;  2DI3 A;  2CYY A;  2FOK A;  5ERI A;  5E8I A;  4K2E A;  2H6B A;  5CVU A;  2MH9 A;  5HS8 A;  3GZ5 A;  4XLP F;  2BBY A;  3ZMS A;  3HOS A;  1LDD A;  5LGN A;  2DU9 A;  3N4M A;  4BYY A;  4P55 A;  5D4R A;  1DPU A;  2ZCW A;  3MEX A;  5EEH A;  2OZ6 A;  2LF8 A;  3KFW X;  4RGR A;  1KA8 A;  1G3Y A;  1G3S A;  3FM3 A;  2HGC A;  1SD7 A;  4M72 A;  3MCZ A;  1U3E M;  3CJN A;  2M5W A;  1MZB A;  1R1U A;  2H27 A;  3F72 A;  1R58 A;  2GIV A;  4A5N A;  1SD5 A;  4CHU A;  2HFH A;  2H09 A;  3FXR A;  2K27 A;  1S7O A;  2JZY A;  3GF2 A;  5DD4 A;  3G73 A;  1S7A A;  1IN4 A;  1O3R A;  2J5O A;  1R1T A;  2CWE A;  2VXZ A;  3DFG A;  4AIK A;  3HUG A;  3GO5 A;  4S04 A;  3PQJ A;  4A6D A;  1P6R A;  1MDM A;  2LNB A;  4M6Y A;  3ZMU A;  4MEX F;  2EV6 A;  2V6C A;  5D6E A;  2DQR A;  2UWM A;  1J75 A;  1EH6 A;  2PFB A;  5EEG A;  4EJW A;  4XRF A;  3J81 K;  1XDU A;  3FMR A;  2F5D A;  3WTX C;  4WWC A;  5ICC A;  1XGS A;  5DUK A;  4IF4 A;  3MAJ A;  2NNN A;  3V7C A;  1UHM A;  4MQV A;  2PLY A;  4RGX A;  3E97 A;  1MGT A;  3HRS A;  3HHH A;  1P92 A;  4EJT A;  3WGI A;  1LNW A;  2IA2 A;  4Q5S F;  4A0Z A;  4BXU A;  2M8E A;  2VBX A;  1XCB A;  3P9I A;  2IJL A;  2M87 A;  1U6G A;  4UV8 A;  3V7R A;  1YO5 C;  2ACJ A;  4EM1 A;  1J9I A;  4FHT A;  2LDU A;  4HDU A;  3DP7 A;  1JHF A;  4L9V A;  2GZW A;  2WC2 A;  1J7K A;  4L9N A;  2PEX A;  3QU6 A;  2XKP A;  2HEO A;  5FB2 A;  1BBY A;  3RYP A;  3C18 A;  2RNJ A;  4YFN F;  3TOB A;  1S29 A;  3QOP A;  4CZZ A;  4YII A;  1IXS B;  5LHG A;  2G7H A;  3QP5 A;  4HAM A;  1TQP A;  1OKR A;  4UHT A;  3U1D A;  4RAZ A;  3NQO A;  3L00 A;  2FBI A;  3WGH A;  3FXQ A;  3FHZ A;  3ELK A;  3N97 A;  5E18 F;  1I1G A;  1BI2 A;  4JBA A;  3RPQ A;  4O3M A;  5FD5 A;  2OA4 A;  1RUN A;  3T5X A;  1JXS A;  3DF8 A;  4M71 A;  2EV5 A;  2RKH A;  1XB4 A;  3KE2 A;  2ETH A;  1RIO H;  1J2X A;  4A0Y A;  2MBF A;  3VFZ A;  2L3D A;  4HX7 A;  1ON1 A;  1O7L A;  4I0A A;  3ULQ B;  2WWY A;  2ZJ2 A;  3HRT A;  3KEO A;  4AD9 A;  4P9F A;  3FX3 A;  4PZJ A;  5JFR A;  5ICF A;  1ZGJ A;  3R4K A;  1SFX A;  1ZRE A;  4U7B A;  2STT A;  1MDM B;  2OZU A;  1Z7U A;  2VON A;  3F8B A;  2ZBK A;  4PGH A;  4ESB A;  4Y13 A;  4LLL A;  2OQR A;  5LGU A;  6PAX A;  1R7J A;  3U2R A;  2Z9O A;  5LLQ A;  1E2X A;  3WGG A;  4KIF A;  1F9N A;  2WTE A;  3IWZ A;  2BGC A;  4OIO F;  5E1X A;  4WCG A;  2FU4 A;  2EA2 A;  2LSO A;  4WXH A;  4ON0 A;  1D3Y A;  3GVA A;  2L02 A;  3IKT A;  4ETS A;  1Z05 A;  2JPC A;  1UST A;  3LST A;  4HF2 A;  4ZYE A;  1W5S A;  2ZNZ A;  1Z91 A;  3ECH A;  3TO6 A;  3J80 Z;  3LQQ A;  2XAH A;  1KU2 A;  3K69 A;  2A5Y B;  2O8X A;  3LA3 A;  4WXD A;  2P7V B;  3QU3 A;  1L0O C;  3C7J A;  5DUI A;  5FD6 A;  4KFC A;  3TDZ C;  1T0F A;  1K79 A;  2KJB A;  4Q48 A;  2QQ9 A;  4U88 A;  3I59 A;  4MHG A;  4E70 A;  1R5G A;  1ZLJ A;  5E1Z B;  3MFK A;  4HV6 A;  3R6S A;  5E8G A;  3R0J A;  3F6V A;  3WTU C;  2VOD A;  1SD6 A;  5H20 A;  5DCM B;  1IRG A;  1P2F A;  4EVI A;  3WTS C;  2JTV A;  1HST A;  4GYG A;  3IL2 A;  5A2Q K;  3FXU A;  2CQK A;  3FF5 A;  1R5H A;  3F6O A;  4OU0 A;  1NHA A;  1ZG5 A; 
#chains in the Genus database with same CATH topology
 2QF7 A;  4BHB A;  1WJD A;  1R22 A;  4RAY A;  4MIM A;  2IRF G;  2DQL A;  1T0F C;  2ZME B;  5H6R A;  2R5Y B;  4GO1 A;  3EUA A;  4XRS G;  2ZKZ A;  2E2I J;  1YE9 A;  1TW3 A;  3IP4 B;  1OYI A;  3I9V 2;  4XK4 A;  1VQO I;  4S0H B;  3TO7 A;  2PMH A;  1GHC A;  3U21 A;  3S1N J;  5D6F A;  5LEK A;  2EFO A;  3ABU A;  3KPH A;  5HDN A;  2XGC A;  5IP6 A;  1T56 A;  5DDG A;  2Q0O A;  2JWT A;  2GXG A;  5LHI A;  3O8G A;  1EJ9 A;  2NAZ A;  1JJ8 C;  5J3L A;  1Z9C A;  3BJA A;  1Z1D A;  2LBF B;  3W2W A;  2E1O A;  3BTI A;  3S16 J;  5ILV A;  2E1C A;  2W84 A;  4HV5 A;  2M9H A;  2E60 A;  5DM7 F;  3DV8 A;  3OIQ A;  3EQL F;  1LB2 A;  1Z67 A;  4BEH B;  3HGG A;  2LOO A;  2ID6 A;  1SFK A;  2E2H J;  1CF7 A;  2K9L A;  2X6X A;  5IY5 H;  3I4P A;  1PP7 U;  1K6O A;  4G94 A;  3LAP A;  3DTK A;  1J0R A;  4OMZ A;  3M1C A;  1MMA A;  1IN5 A;  1IRF A;  2L9R A;  2WY7 Q;  5LRR A;  2WAQ A;  4DYQ A;  1RKT A;  3ZMT A;  1G2H A;  4M6X A;  3P7N A;  3C2B A;  2V6E A;  3RI4 A;  2KIU A;  1FY7 A;  2LD5 A;  3H3V K;  1QVT A;  3I58 A;  1Y8R B;  5JLW A;  3BCA A;  2XIG A;  3S3O A;  4EAT A;  4YEJ A;  1XSV A;  2FSW A;  1ZQ3 P;  2VUM J;  3JRG A;  3K1N A;  5IP7 J;  2Y30 A;  3KP5 A;  5K5R A;  1FMW A;  2QEN A;  3EUK L;  4M73 A;  2ZB9 A;  5ILS A;  4G6D A;  5HVQ C;  1W7P A;  3PFI A;  3ZN0 A;  3MKY B;  3IRR A;  1XD7 A;  1TWA J;  2Y0S N;  4FQG A;  2GOM A;  1TT5 B;  4G9Y A;  5HDG A;  3ZQL A;  2P5V A;  2X9D A;  2JK3 A;  3H5R A;  4LD5 A;  1IW7 F;  1S7E A;  2IP2 A;  2A68 F;  2K9S A;  4KDP A;  2E5Z A;  2IXS A;  3BY6 A;  2LG4 A;  2M34 A;  5FKO A;  4RBO A;  4PSW A;  3R60 A;  1Y1V J;  3QRF F;  2A6H F;  4OIR F;  4B3A A;  3BR0 A;  3PNV A;  5HNH A;  1VND A;  5K5Q A;  4KMF A;  4A5M A;  2HQR A;  1FOK A;  5J1R A;  3A01 A;  2YX4 A;  3K4B A;  1KQ9 A;  4HQM A;  1C0W A;  2PBI A;  1FYK A;  1XX5 A;  2QQB A;  1AWC A;  4HNV A;  2STW A;  2IAI A;  1JJ6 C;  4EJO A;  1QA6 A;  2QSH X;  1X2M A;  3TGN A;  1SMT A;  4XKB A;  4ANJ A;  3ERM A;  5F64 A;  4MTE A;  1MJA A;  3CDI A;  5D5W B;  3T8R A;  2NS0 A;  1K4S A;  2ICW G;  4E7K A;  3GTM J;  2DJN A;  3J81 Z;  2QEX I;  4IPA A;  4BQN A;  4EMS A;  3TOA A;  3PSI A;  1I5Z A;  2IPQ X;  2LMD A;  2D1V A;  4PFP A;  3EET A;  2NRA C;  3T8T A;  1DGR M;  1V54 H;  2DT7 B;  2E1N A;  2P0W A;  4YG2 F;  4OOI A;  1YYV A;  1ZHF A;  1YW7 A;  4I98 B;  1IUY A;  1L3L A;  1Z3Y A;  1A6Q A;  2PJP A;  2JSC A;  5M5X J;  4BUP A;  2QLZ A;  1B9M A;  2HOE A;  4IO9 F;  4KN4 X;  4DNC A;  2FQ3 A;  5JVT A;  3TW7 A;  2LP0 A;  1FPQ A;  3QP6 A;  4RA2 A;  1ACI A;  4QLC U;  3D5S C;  2E2J J;  2HKO A;  5HS7 A;  2CUJ A;  3LOC A;  4XL9 A;  1OYW A;  2L5Q A;  1HQC A;  2K5C A;  1WRJ A;  4YFX F;  1WH5 A;  5L3B A;  2P8T A;  2CO5 A;  5B1B H;  3HPG A;  5J1Y A;  4Q4Z F;  1H9G A;  2DTZ A;  5L3C A;  2EWN A;  4U0W A;  1SAX A;  1SFO J;  2E34 A;  2JPB A;  4PJJ A;  3QOD A;  3L2R A;  2DMT A;  4RB3 C;  3BJ6 A;  1U5T A;  1ZEL A;  2UUZ A;  4GXO A;  1HF0 A;  1OJL A;  5DD8 A;  2V7F A;  4Z6Y A;  1MNM C;  5HNF A;  2BY1 A;  1MH4 A;  2VPR A;  4E7H A;  1QZZ A;  3TO9 A;  2VBW A;  4RGS A;  3BR2 A;  5D5X B;  4ZZL A;  1WJ5 A;  4DQ2 A;  3BCB A;  3OV8 A;  1P9Q C;  3BTL A;  4M3D A;  1WJE A;  4HA8 A;  1F5T A;  4I01 A;  2DO7 A;  3I54 A;  2F4O B;  3WG9 A;  4J00 A;  4KIG A;  1R9T J;  1FMV A;  2H94 A;  4IRI A;  5EYR A;  1W4M A;  5J1U A;  2Z33 A;  3BT9 A;  4G7Z F;  3J7Z I;  2YSR A;  1I3A A;  2HYG D;  1F4K A;  5TRD A;  3L2Q A;  2XAG A;  2BV6 A;  2E19 A;  4UVB A;  3HOZ J;  2MSY A;  2X48 A;  5KHD A;  3GZ6 A;  2QBY B;  2VC0 A;  2ZSI B;  4A3E J;  2DOA A;  5E17 F;  2DPD A;  5IP9 J;  2XAS A;  1DPR A;  3LSJ A;  5E20 A;  1WPK A;  2KRH A;  2L7F P;  4A3L J;  1AA7 A;  5CQG A;  3K10 A;  4ENN A;  1QZE A;  4RDU A;  4Y7N J;  3FXM A;  2VOP A;  2W25 A;  4L5E A;  3DBR B;  1X1P A;  3PIO F;  2BOL A;  2NNY A;  2GWR A;  2VQC A;  2NVX J;  1HSJ A;  5CYV A;  3IC7 A;  2X0L A;  4P96 A;  1CF7 B;  2DW4 A;  2A07 F;  4MQ9 F;  2PMZ A;  4L9T A;  3SEQ A;  1ZG1 A;  1TNS A;  3E6B A;  1ZAO A;  1KQ8 A;  2DK5 A;  1R23 A;  1O3S A;  2MLG A;  5LGT A;  2HVS A;  3VYU B;  2XPV A;  2BHZ A;  3K4L A;  3W6J B;  3LSM A;  5J6X A;  4ZC3 A;  4RAF A;  3GTP J;  3OSF A;  3S2D J;  3W2A A;  4Y17 A;  1OLT A;  1W1W E;  2DA3 A;  1ZTR A;  2HQA A;  1K61 A;  3GFJ A;  3MZ8 A;  5J4V A;  4IHW A;  5HOD A;  2A61 A;  4Y3O A;  3WG7 H;  3RKW A;  4BAY A;  3FIS A;  2XF5 A;  1TWG J;  4L5J A;  1E17 A;  2EB7 A;  3DWL E;  1W7P B;  5F0C A;  1SVL A;  2FE3 A;  2ZJQ F;  3NEU A;  1RES A;  2EH3 A;  1FP2 A;  1X1A A;  3VPR A;  3S32 A;  3JW4 A;  1FX7 A;  2NS7 A;  3AFH A;  4KYW A;  3VYS B;  2OAZ A;  3FXK A;  3G1L A;  1REP C;  4LK0 F;  3AL0 C;  3K4M A;  1EA3 A;  4IOC F;  4N4N B;  4W1U A;  2W4S A;  1V3F A;  1I50 J;  2BEO A;  3AG1 H;  3JRC A;  3OS0 A;  2L4A A;  3BPX A;  5DEQ A;  1JT0 A;  2JN6 A;  1EH7 A;  1LFU P;  4FX0 A;  1F1Z A;  2OV7 A;  2O61 A;  5D8K B;  3E5X A;  2X6W A;  3COA C;  3CQZ J;  1LPQ A;  3B6A A;  3CES A;  2K3F A;  3FIW A;  5F04 A;  3K4N A;  3GEZ A;  2Z99 A;  3DEW A;  2H8W A;  3L09 A;  4FT8 A;  5DM6 F;  4KNY A;  1FWZ A;  1FC3 A;  1TP4 A;  1KU7 A;  4AM3 A;  3WU1 B;  1G6N A;  1P4A A;  2MA3 A;  3BR6 A;  3UNG C;  5E3N A;  4RLQ A;  1X1D A;  2HKX A;  2E71 A;  1BIB A;  3M7G A;  4ZYG A;  4ZYA A;  4G7O F;  3CTA A;  2NVY J;  2R7X A;  2RAE A;  4BJ5 C;  5B5E C;  1ITY A;  3V4G A;  3OR2 C;  5F1J A;  5C4X J;  1U8B A;  2WA0 A;  2FBK A;  4HBL A;  5JVG F;  3MQ0 A;  4XON A;  1IG7 A;  3MZH A;  3FBI B;  2TCT A;  1EV7 A;  2CS3 A;  4MEY F;  3CD6 I;  1XC5 A;  3ZQQ A;  1WHU A;  4IL6 C;  4QSH A;  4XLF A;  5HLI A;  2WAF A;  1FOY A;  3FXL A;  2ME6 A;  3E3V A;  1Z6T A;  4Q47 A;  3ZMV A;  2FF4 A;  1ETY A;  1TQI A;  4I0B A;  2DMQ A;  3CLO A;  4BXX J;  1Z6R A;  2BY2 A;  2UXX A;  2Y2Z A;  3RJP A;  3LSP A;  2QSG X;  4IEJ A;  1WSU A;  3WTY C;  1QQI A;  4YIF A;  5GPA A;  4BQA A;  1TWF J;  5FGM A;  3VSL A;  2MLK A;  1KQ0 A;  3HOW J;  2F2E A;  3VYR B;  4BKX A;  3BG7 A;  3HSR A;  4HNU A;  3Q9V A;  4ZTJ A;  3DLL F;  1AKH B;  1IN8 A;  2OCC H;  3CF2 A;  3NAU A;  1U5T B;  2FUG 2;  5DCM A;  4XOT A;  1V55 H;  1T6S A;  2Z3Y A;  3RSN A;  2Q2E B;  4ENK A;  3BR1 A;  3QOE A;  3O3K A;  5HDK A;  2VOO A;  1DUX C;  4F52 A;  4BE2 A;  4L18 B;  2F48 A;  1BN5 A;  1B9N A;  1U78 A;  3GZN B;  3HTU A;  4DIQ A;  1QGP A;  2KIS A;  3M1E A;  4W97 A;  5FLV A;  1YS7 A;  2DFE A;  3TDU C;  4FAS D;  5AIP A;  1GV5 A;  3I0T A;  1HKQ A;  4CCK A;  3ML6 A;  4CO8 A;  1E3H A;  4B44 A;  2BE5 F;  2A5W A;  1V5G A;  1S72 I;  1PP8 F;  2XVC A;  3FMQ A;  4CUG A;  2CW0 F;  3TP0 A;  3ZQH A;  2ZME A;  3MWM A;  3V8K A;  1GVD A;  2XF7 A;  2RDP A;  3NWS A;  2R7T A;  1YIJ I;  2PN6 A;  5EGO A;  3BG6 A;  1ZGA A;  3ASN H;  3DTI A;  3JRD A;  1ZRF A;  1JUM A;  5A2Q Z;  5B1A H;  1GLN A;  4HQE A;  4R1H A;  3H0G J;  1PJR A;  4A3F J;  1AU7 A;  4KIB A;  1K7A A;  3ABM H;  4F93 B;  3GYH X;  1UFM A;  2HDW A;  1TW2 A;  3L2C A;  4JOM A;  1XCV A;  2RGV A;  4HLY A;  5K7Z A;  2X6O A;  3BG5 A;  2EBI A;  2AHQ A;  2DTR A;  5F1R A;  1BR1 A;  3ZQG A;  1KON A;  3H1C A;  1XSX A;  2M0M A;  4UUV A;  3SFZ A;  4EQQ A;  3EYY A;  2H1L A;  1W7P D;  4BE1 A;  1FOW A;  3EDP A;  2FBH A;  5BQT A;  1HBX G;  2Z16 A;  3SZT A;  3H3Z A;  1ONV A;  2HZT A;  4KMU X;  4L9J A;  3S2W A;  5E1W A;  1BOA A;  3OOP A;  3JRI A;  1XGN A;  1JKR C;  3VSK A;  3RKX A;  3OYK A;  2DOD A;  2RC4 A;  2V79 A;  4XLE A;  5ED4 A;  4HX8 A;  4BXF A;  3QPT A;  3ZCO A;  1VI0 A;  4F92 B;  3JTG A;  4D7N A;  4XKW A;  4KIT B;  2M2E A;  3CP8 A;  1LEA A;  1XMA A;  4IRH A;  4MTD A;  5IT9 K;  1H0M A;  2VQG A;  3ROU A;  2TDX A;  3CO7 C;  4PSX A;  2LKS A;  2ZME C;  5DYM A;  1MBJ A;  5L3G A;  4XQF A;  2KLO A;  2BY3 A;  2F5C A;  1DU6 A;  2VKV A;  1HDD C;  4JYK A;  2GAU A;  2R7F A;  1ETQ A;  1RR7 A;  1A04 A;  2IGK A;  3AKZ A;  4UVA A;  4ZYD A;  3LSI A;  3CUQ A;  2Y0S A;  2PI0 A;  3PNT A;  1FYM A;  2EZI A;  1Q1H A;  4FCY A;  4LJZ F;  5C3E J;  3CJQ B;  2QVO A;  5EDN A;  3O6B B;  2O6G E;  1J09 A;  4GFB A;  3I64 A;  3BOQ A;  1BM9 A;  2L9S A;  3FKI J;  2EA4 A;  1LE8 B;  3O8H A;  4DZJ A;  1BC8 C;  4CZC A;  1HOM A;  1TNT A;  3ZN1 A;  3GFL A;  3EYI A;  5HS9 A;  2YX7 A;  1LVK A;  3FK6 A;  1VFC A;  3R61 A;  3Q5F A;  2QWW A;  2ELK A;  4AWX B;  5K1Y A;  1HXD A;  1G3W A;  3ZQ7 A;  2YS9 A;  4XBF A;  2HPM A;  1B6A A;  3KP6 A;  2W48 A;  3AG2 H;  1JI8 A;  2W00 A;  3GXO A;  2LR8 A;  2E36 A;  4BH9 A;  4MFD A;  3OYN A;  2ZO4 A;  5LEJ A;  3ISP A;  4HNT A;  3HL2 A;  2PX9 A;  3OYG A;  1WI9 A;  1ORK A;  5H6Q A;  4F91 B;  1UEL B;  3WTZ A;  1W5C C;  3L2U A;  5K5O A;  3LQR A;  4EEF G;  4C2T A;  3NRV A;  3OWT A;  4BBR J;  3JSO A;  3RKY A;  1D5Y A;  1X1C A;  2ELJ A;  1QBJ A;  4P9U A;  4J19 A;  1TC3 C;  2A69 F;  2EV0 A;  2HPI A;  2DK8 A;  2K86 A;  1XN7 A;  1IV6 A;  4EM2 A;  1I27 A;  2FNP A;  2V1X A;  4RS8 A;  1I39 A;  1XGO A;  1MND A;  2WB1 N;  3BP8 A;  3GME A;  3HOU J;  3F22 A;  3BWG A;  3P5J A;  3WU0 A;  1MMD A;  1MH3 A;  2MW8 A;  1T2K A;  1X2N A;  3TL4 X;  2B7E A;  5F27 A;  2MGQ A;  3E7L A;  4C2M J;  3D1N I;  1X4P A;  3LFU A;  5KVR A;  2R0Q C;  3DPT A;  4EGY A;  1E0E A;  2VE8 A;  4GRI A;  2X6Y A;  2JQ7 A;  5LRS A;  2HS5 A;  1JKP C;  1FSH A;  4RMN A;  1LUJ B;  3IHU A;  1O3Q A;  1JGG A;  3H36 A;  2XRN A;  2QYO A;  3OYA A;  5EG0 B;  4UUS A;  5IOY A;  1ZAR A;  3HYI A;  4LK1 F;  1SEU A;  3J7Y J;  2OCE A;  1YX5 A;  4M3E A;  2W24 A;  4XLH A;  2DDA A;  5F08 A;  1Y8Q B;  5EGO B;  3F3X A;  4OIN F;  2A3S A;  2IGN A;  3ZXS A;  2W1O A;  4AYB N;  2RRE A;  2RN7 A;  2ZSH B;  3VWB A;  1MJ9 A;  1ZYR F;  4B09 A;  1YIO A;  1W36 D;  3CCS I;  2LF7 A;  2O03 A;  1LDK B;  5BS6 A;  5FKL A;  3HHG A;  2QBY A;  2L4M A;  3HOX J;  9ANT A;  1Z3X A;  1X58 A;  2GQQ A;  2HTJ A;  1M1E B;  3PUB A;  2GLO A;  1K78 A;  1LKX A;  2V9V A;  3BZ6 A;  3L2V A;  1PDN C;  1N25 A;  2L9N A;  3CP2 A;  2EFW A;  1JKO C;  1R49 A;  2COM A;  1OPC A;  3MN2 A;  5K7F A;  2MC4 A;  3Q0U A;  4KUM A;  4M74 A;  3IV5 A;  1O57 A;  2CV0 A;  2VJJ A;  3GW2 A;  1RKW A;  3ZMD A;  1W0U A;  4LGW A;  2DXI A;  2AS5 F;  4A93 J;  5ICG A;  1DP3 A;  1MSF C;  2EZH A;  3ZOB A;  3FWE A;  3OSG A;  1VQ8 I;  1HW5 A;  1ULY A;  2O5R A;  4GDF A;  4A3B J;  2BZT A;  2DYR H;  3F21 A;  5GTH C;  2ISY A;  2VN2 A;  1DQU A;  2EIJ H;  3LAJ A;  5J4Y A;  1EH8 A;  1JGS A;  2VB6 A;  3MMY B;  1QNT A;  3UR3 C;  3F8M A;  2P5K A;  4ZDP A;  3PSF A;  1J5Y A;  3SDB A;  4O6J A;  2H6C A;  3F8N A;  3KP3 A;  1TTY A;  2DA1 A;  4UB6 C;  2EFP A;  1VQK I;  2JT1 A;  3A0B C;  2KPM A;  3EPZ A;  1FEX A;  4FET A;  3IRQ A;  4ZDO A;  4N0B A;  4AU7 A;  2JRT A;  4E7Z A;  1BOB A;  3Q3S A;  4ZH4 F;  4X1E A;  5HLG A;  3S93 A;  4G6Q A;  1WVR A;  1R36 A;  3CUQ B;  4ESJ A;  1KYZ A;  1TWH J;  4I7H A;  4KIC A;  3RPU D;  2R7Q A;  2HNH A;  4JQF A;  2WAD A;  4IHT A;  1BI0 A;  1UHW A;  3K0L A;  4N9H A;  3IAS 2;  2KIM A;  2OU2 A;  4YFK F;  1OFC X;  1XSD A;  3Q9S A;  1UB9 A;  1G4D A;  1UMQ A;  3T0Y A;  5B3S H;  4A3D J;  4V2G A;  1OCT C;  3HBL A;  2CV1 A;  3KEY A;  4NC7 A;  4BDY A;  4BU2 A;  3A4C A;  1Y39 A;  1CQT A;  3HDD A;  3RZD J;  2M30 A;  4LB6 B;  1XDS A;  3DLA A;  1IGN A;  2LH9 A;  1KYW A;  2CGP A;  3L7W A;  3KYD B;  1PUF A;  3E5Q A;  3I3L A;  4ZYH A;  4HYE A;  1JTX A;  5EZH A;  3RKQ A;  4I02 A;  3HZJ A;  1FIP A;  1DP7 P;  3GUD A;  5FFX A;  5TJJ A;  4ASN A;  1VF9 A;  2YU9 J;  4B43 A;  4RGU A;  1KGS A;  2RVC A;  2WV0 A;  5CQE A;  3JRA A;  4HDV A;  3PUF A;  3RYR A;  2IW5 A;  3K2Z A;  3T1B A;  4BAC A;  2BVM A;  3AG3 H;  2LKX A;  4HSR A;  1D1A A;  2ESH A;  3W6V A;  4PCQ A;  5FLX K;  1HLV A;  4O5V A;  4A12 A;  2CG4 A;  2FA5 A;  5D4S A;  4P5O A;  3PL8 A;  3ZQC A;  2KMU A;  2DAO A;  5AON A;  1WH7 A;  2X51 A;  4M9S A;  1LFP A;  2BY0 A;  4N4O B;  1YI2 I;  2K02 A;  2OQG A;  3G1O A;  4CCN A;  2G9W A;  3LNQ A;  1ETW A;  3S8P A;  1ZH5 A;  1S6L A;  4G7H F;  4IRG A;  1BL0 A;  3ASO H;  4EV0 A;  4X6A J;  2KL4 A;  1Y1W J;  2NS8 A;  1GT0 C;  1H88 C;  3JAM Z;  3WE2 A;  4MO7 A;  3B73 A;  4XRS A;  2FX0 A;  1S5L C;  2F4I A;  4AIH A;  3JSP A;  1AKH A;  5LFA A;  1FTT A;  2XC7 A;  2EJR A;  4GCV A;  1SVO A;  3SFI A;  4YEL A;  1WZ2 A;  3K4C A;  1P7I A;  2DA6 A;  2VI6 A;  2HOA A;  2KKO A;  4HW0 A;  4A3K J;  2Q2E A;  5FKK A;  3E0J B;  4JK1 X;  3LSG A;  3DKW A;  4PDK A;  1PUE E;  3ONQ A;  4B4C A;  2MD5 A;  3MD2 A;  3HSE A;  3K1P A;  4M3F A;  4UUS B;  1FNN A;  3KZY A;  1ODD A;  3E6M A;  2KRF A;  1T08 B;  4OWR B;  3CUO A;  4HEA 2;  3WU2 C;  2ME0 A;  1IF1 A;  2VJ5 A;  1DGW Y;  2O9L A;  3CJT B;  4NDL A;  2CW7 A;  2CFO A;  3M07 A;  4E6K G;  1YTY A;  5CVV A;  4D7M A;  4BJT A;  3OYH A;  1VQP I;  3E5U A;  3CMY A;  2HZD A;  3MVP A;  3S2H J;  1I3Q J;  3LWF A;  4UV9 A;  3S1M J;  1HKT A;  4QWQ A;  2CUF A;  2TRT A;  2F5F A;  4LIT A;  5H2F C;  2ESN A;  4Z2Y A;  1W0T A;  1OR7 A;  2K9N A;  1K78 B;  4Y4R A;  5KK1 A;  2E1M B;  4DJA A;  4RAG A;  1E3O C;  3X2Q H;  1BW5 A;  2L7Z A;  4RB2 C;  1TLH B;  2V1U A;  4BDZ A;  4DBQ A;  1RC9 A;  2K4J A;  1MKM A;  2K9Q A;  3LSK A;  2R3S A;  3FZV A;  4ESF A;  1YX3 A;  5IPA A;  4BY1 J;  3KIO A;  1SAU A;  4GYI A;  2MYS A;  3I53 A;  1U5T C;  1OCC H;  4I6Z A;  2M7B A;  3V8L A;  4A0X A;  1IN7 A;  2D5V A;  5BOX A;  4RLF A;  1GVJ A;  1RET A;  1T33 A;  3JRB A;  2FEZ A;  1A6I A;  1RUO A;  1SC7 A;  1ZN2 A;  3PM1 A;  3SYT A;  2P5L C;  3SHF A;  3U9G A;  1G59 A;  2HXO A;  3GTQ J;  4ENJ A;  1Y56 A;  1NTC A;  4OIQ F;  1HC8 A;  5GTI C;  3OIO A;  4CIC A;  2FMY A;  2VE9 A;  1LDJ A;  4A3G J;  2Y9Y A;  3FDY A;  5D5V B;  5LHH A;  3RDI A;  1S3J A;  3OS1 A;  2CMP A;  3M8E A;  1IAW A;  1R71 A;  2HDC A;  3BPV A;  3IH4 A;  4D5C A;  3HOT A;  2K7L A;  4AVZ A;  4R8H A;  5BNG A;  4HF0 A;  3HPH A;  4DZP A;  3KP4 A;  2V1D A;  4BBS J;  3I5U A;  5J8C A;  4I09 A;  2HQ5 A;  4CDG A;  1AOY A;  3FBN B;  4LFU A;  1XMX A;  1D0Y A;  1IZ1 A;  5CLS A;  2EK5 A;  4WF2 A;  4OAY A;  3P9C A;  3V8J A;  4CYC B;  2XGX A;  1RZ4 A;  2FNA A;  4FE4 A;  3K70 D;  4FE7 A;  3TED A;  1HW2 A;  2G0E A;  3CME I;  3KP7 A;  2VBY A;  2OJE D;  2R7D A;  2KRC A;  2KDO A;  2CUE A;  4XLN F;  1V5E A;  3HRM A;  1P7J A;  3LSH A;  2O8K A;  3QQA A;  3ZP5 A;  3BZK A;  2KIF A;  1MMG A;  1W5T A;  3SJM A;  4E7L A;  2OF7 A;  1ZR2 A;  1IXR C;  2IEK A;  3OIP A;  2GXB A;  2DYS H;  2VT3 A;  4XSZ F;  2EZL A;  1VQ9 I;  5IT9 Z;  2XPU A;  2PJR B;  1FBS A;  3D0S A;  1Y0N A;  3M8F A;  5HOO A;  3WOD F;  1PUF B;  1A35 A;  4M9X A;  1XG1 A;  3Q0W A;  1LE8 A;  2HVQ A;  3BZC A;  2DA5 A;  4LIV A;  3G3Z A;  2CW8 A;  3VDX A;  2K3P A;  3I4M J;  2DLL A;  5E3M A;  2L01 A;  1I6X A;  3RPU A;  1F43 A;  2ECC A;  1IXC A;  3DPL C;  4QPQ A;  3I71 A;  1S8N A;  2ZXW H;  2V9K A;  2L54 A;  2ZC2 A;  4CCO A;  2FXA A;  3JAM K;  1ZG3 A;  4ABZ A;  1GXQ A;  1GXP A;  1WQ2 A;  2DDB A;  2LC2 A;  3W6K B;  1OCO H;  2CQ7 A;  2IA1 A;  3I4N J;  4N9I A;  4BY7 J;  3TQN A;  1YG2 A;  3OYL A;  2OBP A;  2X1D A;  3CCM I;  3S1Q J;  4NHJ A;  4UNO A;  1FT9 A;  5KAF C;  1JUS A;  3RCO A;  4AC0 A;  5IT3 A;  1YFH A;  1R00 A;  3GFM A;  4PK4 A;  2XSD C;  3G2B A;  1WKM A;  3HSF A;  2Z5U A;  2O7O A;  1VTN C;  3VB2 A;  4XLC A;  1FIA A;  2LKP A;  5CVJ A;  1N78 A;  2IBD A;  2VKE A;  2BXZ A;  2Y69 H;  2XUB A;  2KFD A;  3H9G A;  3HRU A;  2IA0 A;  3FKJ A;  3U1K A;  3H3U A;  1UZC A;  2Q8K A;  1T95 A;  5KCM A;  2MC3 A;  5HLH A;  3E6D A;  4M9Z A;  5CKT A;  4UVC A;  4Y33 A;  4Y15 A;  1BJA A;  2CU7 A;  2HR3 A;  1KZH A;  2VXD A;  2EIK H;  2LK2 A;  2WB1 A;  2Y31 A;  4UUT A;  3LA2 A;  2VAS A;  5DCF A;  4TV7 A;  4LLN A;  2MAB A;  4U7D A;  3UKG A;  4RB1 A;  3CC7 I;  5EEA A;  1QHH D;  5M3M J;  4NQW A;  1YW9 A;  2V9P A;  1B1B A;  5KAI C;  3B02 A;  3ZR8 X;  3CCY A;  2LLK A;  2VQH A;  2QGU A;  4V19 K;  3VEP A;  3DEE A;  2CUZ A;  5EG0 A;  5FFZ A;  3CCR I;  3KET A;  4GGG A;  1ZGW A;  2VJI A;  4F3Q A;  5K7H A;  3I56 I;  3LFK A;  1XGM A;  2EQR A;  1BI1 A;  2L9V A;  4BHC A;  2GOX B;  2VPL A;  1RI7 A;  5L3E A;  1WJF A;  4MGR A;  5CPR B;  1OCZ H;  3A03 A;  5E3L A;  4PGG A;  3IKV A;  5LBQ A;  4AYB A;  3F9K A;  3EUH A;  3KX2 A;  2M4K A;  1BR2 A;  2R4G A;  3F8C A;  4IOA F;  1FYL A;  4F7Z A;  4WK8 F;  3ZQF A;  1BR4 A;  2IGM A;  2O0Y A;  1SD4 A;  1BIA A;  2LYC A;  3C3W A;  1USS A;  3DKX A;  2WV1 A;  3HOY J;  2A6E F;  1FBQ A;  2BYV E;  3H35 A;  3WTT C;  1T39 A;  4XR6 A;  4I99 C;  2JA7 J;  4X0G A;  2CFX A;  3OMY A;  5EF6 A;  2Y9Z A;  1YLF A;  1QPM A;  4OIP F;  5L3D A;  5EJC A;  3TKY A;  5BMZ A;  3KCC A;  1VQL I;  2R7U A;  1YS6 A;  4WX9 A;  3OYM A;  2DA4 A;  4B3X A;  2RV8 A;  1QRY A;  2YR2 A;  1IRZ A;  5ILU A;  3FHN A;  3OL4 A;  2XRO A;  3GCM A;  3ERE D;  1STZ A;  1JTY A;  4HZF A;  2NYX A;  2DN0 A;  3GTL J;  3HOV J;  3ZMZ A;  4XSX F;  4HG2 A;  2F5V A;  2JVH A;  4I76 A;  3OY9 A;  2ISZ A;  4WXC A;  1P4X A;  3ZPL A;  4CGZ A;  2JSP A;  5D5U B;  3QWL A;  5JHF A;  2VT2 A;  1VQ5 I;  3EUH C;  2L2O A;  2VBZ A;  4KA4 A;  4MNU A;  3CC4 I;  5JR3 A;  3AAF A;  5E79 C;  1MMN A;  1ZRD A;  5J8F A;  2IS2 A;  1V4R A;  4EJU A;  4DBR A;  2HYF A;  4G8X A;  3GFI A;  1MD0 A;  3WTV C;  2AQE A;  5DS9 A;  3FMS A;  1O7F A;  2RQP A;  2QZ8 A;  3K4K A;  1U8R A;  3KYL A;  2ZXJ A;  1SFE A;  2DOE A;  4IX7 A;  2XKO A;  3VOE A;  3MZY A;  2UV1 A;  4IXA A;  4BGD A;  2AXL A;  4I2O A;  1ZRC A;  4CH7 A;  5GAD J;  3BLY A;  2K4B A;  4IJA A;  1V5F A;  3VYT B;  5E3O A;  3L9F A;  3C2H A;  2VC1 A;  2QM3 A;  1ETO A;  2CSO A;  3BG9 A;  4XMY A;  4NB5 A;  4B1R A;  4L0Z B;  1WJC A;  2P6S A;  2PG4 A;  4L5I A;  2H1K A;  1B8I A;  4HOB A;  3JRH A;  4LG3 A;  1Z7L A;  3DEU A;  5FO5 A;  1WJB A;  1IN6 A;  4S05 A;  3TP3 A;  3K1M A;  4IHY A;  1HKS A;  2E7W A;  1D1C A;  1D0Z A;  2HWV A;  4C3H J;  1AHD P;  2P7C B;  2NVQ J;  2XAJ A;  1IDZ A;  1MBG A;  2IVM A;  5L3F A;  3MKW B;  2QSF X;  2XAQ A;  3QPH A;  3WE3 A;  4LG0 A;  4E7S A;  2R5Z A;  4BNC A;  1KU3 A;  5CVR A;  4CCJ A;  3CUQ C;  1FBU A;  1KU9 A;  5ICE A;  2BW3 B;  3SXY A;  3OYB A;  4RB0 A;  2B0L A;  2JUG A;  2XAF A;  4JP0 A;  1MIJ A;  2XF6 A;  4CXF A;  5M5Y J;  2VKD A;  2ZFU A;  4IKF A;  4UXN A;  2CRG A;  4PUS A;  5FRO A;  3OYD A;  3PQK A;  3S17 J;  1YW8 A;  4H0E A;  1R1V A;  2QQA A;  1UCR A;  2UXN A;  1HW1 A;  3SDG A;  4YIR X;  5F0F A;  2DT5 A;  2R7V A;  3HG9 A;  1D5V A;  2DFI A;  4IHS A;  1T38 A;  2M45 A;  2OD5 A;  1X3Z B;  3D5L A;  2LFB A;  4EGZ A;  2G7U A;  4NQW B;  2DPU A;  1ON2 A;  3P9K A;  5FLX Z;  2R7Z J;  1U2W A;  5HLT A;  4XM3 A;  1B72 B;  3RQ4 A;  1GV2 A;  2GA1 A;  5CJ9 A;  1TL8 A;  1TQM A;  2HQN A;  3OS2 A;  2FML A;  1D8J A;  1FP1 D;  4A3J J;  2EFN A;  1BC7 C;  4IQ4 A;  3E1S A;  4KJZ A;  3DXJ F;  3DQV C;  2ZNY A;  2RQQ A;  2J5P A;  4KT5 C;  2DFH A;  4KN7 X;  1WCM J;  4IHV A;  5IYD J;  1YJW I;  3AG4 H;  3JCU C;  3CF5 F;  3S15 J;  4JX5 A;  3GLX A;  1PYV A;  2ADU A;  3O2P E;  1B4A A;  1NG7 A;  1OCR H;  2P4W A;  4DYC A;  1D1B A;  4OMY A;  1BA5 A;  1E3P A;  5DV5 A;  3HTS B;  2E7X A;  3K2A A;  3HIF A;  4HX4 A;  3QPS A;  4LMY A;  3ABT A;  1A36 A;  3GBG A;  2CH0 A;  2W57 A;  3BRO A;  3BTJ A;  4MFE A;  1WFX A;  1QO0 D;  3GWZ A;  2OTL I;  1J59 A;  1FLI A;  2HTS A;  3H92 A;  4MLO A;  3H5N A;  1VQ6 I;  2JA5 J;  1MW7 A;  4ZZD A;  2YU3 A;  4BJ6 C;  2D2W A;  2IS4 A;  5GAH J;  2HOT A;  4U87 A;  3M3Y J;  2QKM B;  1SFU A;  2DMU A;  2NVT J;  2ZJP F;  3SQN A;  1G3T A;  3LMM A;  3ZGK A;  2DBB A;  3VOD A;  3BDD A;  2DMP A;  4A2U A;  1UHS A;  2JUC A;  1B59 A;  2XGE A;  1BJZ A;  3QYF A;  1IUF A;  4QPO A;  4CYD A;  4R79 A;  1FSE A;  3REO A;  2D1H A;  2K85 A;  3KEQ A;  1XMK A;  2O3F A;  1OMI A;  3ECO A;  3HKZ N;  2YPR A;  3CCJ I;  4HPQ A;  3V42 A;  4XN0 A;  1NG6 A;  1X4O A;  1SMY F;  3J7A Y;  3QAH A;  4XNF A;  2I10 A;  3J7A O;  2IGO A;  3JTH A;  4LB5 A;  2Y75 A;  1ZLK A;  2NXN B;  1WWX A;  2R7S A;  1LJ9 A;  3M9A A;  1JHH A;  1IV8 A;  1LQ1 A;  3DBL B;  2Z2S B;  3FM5 A;  1ETX A;  4LLG F;  3GTK J;  4BHP A;  1MBE A;  2W85 A;  4HLX A;  1IO2 A;  5AIQ A;  1MMS A;  2B9S A;  1I1S A;  4PFO A;  3BTC A;  1DDN A;  4AUX A;  2DA2 A;  3WTW C;  3A2K A;  2X1C A;  4ENM A;  4D0P A;  4A6E A;  1VQ7 I;  1MJB A;  2E1M C;  4C2U A;  2FRH A;  4CYC A;  2VKH A;  3KLN A;  4NC6 A;  4B47 A;  2C6Y A;  1X3W B;  2RNG A;  2EFQ A;  3KP2 A;  2Y0M A;  3QYB A;  3I55 I;  2KQR A;  1O3T A;  1D8K A;  1DU0 A;  4RM3 A;  4U0V A;  4BL0 B;  4D5F A;  2XV4 S;  1H9T A;  4EJV A;  1WGX A;  3RTR A;  1CGP A;  2GBY A;  1EF4 A;  3PIP F;  2CV2 A;  5FJ8 J;  1N77 A;  2PJR A;  3K9T A;  1P4W A;  2OC6 A;  4ITV A;  1FZP B;  4L0Y B;  2MH2 A;  4AVP A;  2MG4 A;  3HGY A;  1BI3 A;  1B8I B;  3RIR A;  2ELH A;  3J80 K;  4HF1 A;  2VL8 A;  2KJC A;  1RNL A;  3JRF A;  5BPD A;  4BS9 A;  2YUS A;  3SZP A;  3S1R J;  2DOF A;  5BPI A;  1HDP A;  4FTH A;  2D45 A;  3CLQ A;  1NH3 A;  2XB0 X;  2PQ8 A;  4JX4 A;  5JI6 A;  1IRX A;  1Y0U A;  3C1D A;  2F5E A;  4NBQ A;  3K7A J;  2IT0 A;  3CCU I;  1QZY A;  4EM0 B;  1YQA A;  1TT0 A;  1ZK8 A;  2R5Z B;  2GM4 A;  4IVN A;  4LG0 B;  3DU6 A;  4AIJ A;  2W82 A;  1JE8 A;  2UZK A;  3G71 I;  5IYB J;  3DPU A;  1RPW A;  2L7M P;  1GUU A;  1LEB A;  1T98 A;  2DFF A;  2R7R A;  2NOJ B;  3E6C C;  3LA7 A;  3F8F A;  3KLO A;  1LVA A;  2ZFW A;  3V7S A;  3CO6 C;  3JRE A;  4A69 C;  4ZTF A;  1TBX A;  1X3U A;  3H5A A;  2AXT C;  1HCR A;  1JUP A;  1VQM I;  5CVI A;  1OYY A;  1ENH A;  3GX4 X;  2X4H A;  2Y48 A;  2ID3 A;  5J40 A;  2XHK A;  2PMU A;  3A1Y A;  3IWF A;  3I59 B;  3BJO A;  3F23 A;  5F6F A;  4FX4 A;  3BR5 A;  3S3M A;  2P6T A;  3CDH A;  2JA6 J;  4E7J A;  2P81 A;  2M1B A;  1Z0X A;  4A3C J;  2R7O A;  4ZDL A;  4UY8 I;  2HU9 A;  1OIS A;  4DYR A;  5D8L B;  3KZZ A;  4BQQ A;  5FKM A;  5JHU A;  1ZKG A;  2GIZ A;  3R0A A;  2GA2 A;  4B8X A;  1OQY A;  4U0Y A;  3K6G A;  2KDZ A;  2QUF A;  2CQQ A;  2DI3 A;  3NWT A;  2CYY A;  2FOK A;  3D5R C;  5ERI A;  5E8I A;  4DW6 A;  2WY8 Q;  4K2E A;  4AID A;  2H6B A;  5CVU A;  2MH9 A;  3B6C A;  5HS8 A;  3GZ5 A;  4XLP F;  2BBY A;  1YRN B;  1A31 A;  2K9M A;  3ZMS A;  3HOS A;  1LDD A;  1MNE A;  2JVG A;  3HJE A;  2VIX A;  3BR3 A;  5LGN A;  2DU9 A;  3N4M A;  1Q1V A;  3HM5 A;  3L2W A;  1UG2 A;  4P55 A;  4BYY A;  5D4R A;  2R7W A;  4QTR A;  1U9N A;  1UG0 A;  3CDL A;  3JR9 A;  1DPU A;  2ZCW A;  1T8I A;  4XKC A;  4XID A;  2QA4 I;  3MEX A;  4M3B A;  1XTA A;  2OZ6 A;  2LF8 A;  3KFW X;  4RGR A;  5EEH A;  1HA8 A;  1JKQ C;  1KA8 A;  1G3Y A;  1G3S A;  3FM3 A;  2HGC A;  2QQ8 A;  1SD7 A;  4M72 A;  3MCZ A;  2KP6 A;  1U3E M;  3CJN A;  2M5W A;  1F36 A;  1MZB A;  4A3M J;  1R1U A;  2H27 A;  3CCE I;  1Y6I A;  3F72 A;  3TMO A;  1R58 A;  2GIV A;  2AO9 A;  2WAE A;  1VQN I;  3A02 A;  2V1N A;  4A5N A;  4ZJZ A;  1SD5 A;  4CCL A;  4B48 A;  4CHU A;  2HFH A;  3S14 J;  3G4S I;  2H09 A;  1ERD A;  4PJM A;  2M4G A;  3FXR A;  2K27 A;  3ABK H;  1S7O A;  2LRE A;  2JZY A;  2L0K A;  3GF2 A;  3CCQ I;  3OYI A;  5FRM A;  2L7K A;  5DD4 A;  3G73 A;  1OCP A;  1S7A A;  2E5N A;  1IN4 A;  1R4N B;  2KHM A;  3HEF A;  3C2G A;  3OYF A;  4RM2 A;  4KT6 A;  1O3R A;  2WAQ N;  2HVR A;  2J5O A;  3CMM A;  1R1T A;  2CWE A;  2VXZ A;  4F55 A;  1X19 A;  3DFG A;  4AIK A;  3HUG A;  2LY2 A;  3GO5 A;  2A6T A;  3LSR A;  1OR7 C;  4S04 A;  4J01 A;  4PJ0 C;  2BVL A;  1MBK A;  1IDY A;  3PQJ A;  3OYE A;  4C9Y A;  4A6D A;  5EZG A;  1P6R A;  4C3J J;  4PJN A;  1MDM A;  4D9J A;  2R92 J;  2LNB A;  1MBH A;  4M6Y A;  4Y52 J;  3ZMU A;  4MEX F;  2EV6 A;  2V6C A;  5D6E A;  2DQR A;  3PO2 J;  4XOR A;  2UWM A;  3CMA I;  1J75 A;  2B63 J;  3OOU A;  1EH6 A;  2PFB A;  2JMW A;  2QKL B;  3OL3 A;  5EEG A;  4HST A;  2M8G X;  3GTG J;  4EJW A;  1W36 C;  2XDV A;  4XRF A;  5FKN A;  3H9J A;  3J81 K;  1RRJ A;  2JA2 A;  1U0J A;  4XIC A;  1XDU A;  3QYE A;  1XS9 A;  2LTP A;  2F5D A;  2FD5 A;  3FMR A;  3WTX C;  3H0D A;  4NC8 A;  4WWC A;  5ICC A;  1XGS A;  5DUK A;  4IF4 A;  3MAJ A;  2NNN A;  3V7C A;  1UHM A;  4MQV A;  3BC8 A;  4UB8 C;  2PLY A;  4RGX A;  1SAN A;  2DMN A;  3LL7 A;  2OUM A;  3A01 B;  1YIT I;  1VZ0 A;  3E97 A;  4IZZ A;  1IC8 A;  1MGT A;  3HRS A;  3SZG A;  3HHH A;  3MKZ A;  3M4O J;  1P92 A;  2AQF A;  1SVM A;  4EJT A;  2V4J C;  2XB5 A;  3RZO J;  3WGI A;  1LNW A;  3TBI A;  2IA2 A;  4Q5S F;  2HOS A;  3PO3 J;  2W7N A;  4A0Z A;  4BXU A;  5J47 A;  2M8E A;  3FK7 A;  3IH3 A;  2Z1D A;  2VBX A;  1XCB A;  2XAU A;  3P9I A;  3SEZ A;  2IJL A;  1R6R A;  2M7A A;  2M87 A;  3K4J A;  1U6G A;  2BW3 A;  1U9O A;  4UV8 A;  3V7R A;  5C44 J;  5GAG J;  4G12 A;  1YO5 C;  2IS6 A;  4NNJ A;  2ACJ A;  2X85 A;  4CA0 A;  4EM1 A;  1WI3 A;  1J9I A;  4FHT A;  1ETV A;  3HB9 A;  3BG3 A;  2LDU A;  4BQO A;  4JX6 A;  2DA7 A;  4CCM A;  3DP7 A;  5JLX A;  4HDU A;  3ZQI A;  1JHF A;  2CQX A;  4L9V A;  2GZW A;  2WC2 A;  5FLM J;  1J7K A;  4L9N A;  4E4H A;  3RQI A;  2NVU B;  2PEX A;  3CJR B;  2HDD A;  3CCV I;  3QU6 A;  2XKP A;  3L1P A;  2HEO A;  3PNY A;  2EIL H;  2FQ4 A;  5FB2 A;  4HRI A;  1BBY A;  3FXJ A;  3RYP A;  4D1Q A;  3C18 A;  2EIN H;  4QIW N;  3DKY A;  2V26 A;  1IJW C;  2KZG A;  2DCE A;  2RNJ A;  1I6H J;  4H4K C;  1S9H A;  2H8R A;  2LY1 A;  3DU5 A;  1B72 A;  1YJ9 I;  4YFN F;  3TOB A;  1S29 A;  3QOP A;  2ZXH A;  1XPX A;  4CZZ A;  4YII A;  1IXS B;  5C4J J;  1R5I D;  5LHG A;  2G7H A;  1ZR4 A;  3QP5 A;  4HAM A;  1TQP A;  2CQN A;  2XGD A;  1OKR A;  4UHT A;  4C3I J;  1MBF A;  4XN3 A;  3U1D A;  2FJ1 A;  2HXI A;  4RAZ A;  1G8X A;  3NQO A;  3ESW B;  3L00 A;  2FBI A;  3WGH A;  2KIQ A;  3ZRG A;  4DGW B;  5F0H A;  2VLA A;  3IH2 A;  3FXQ A;  3CZ6 A;  3FHZ A;  2OTJ I;  4A3I J;  3NAR A;  1FOX A;  4G6T B;  3ELK A;  2K40 A;  3N97 A;  2JJ7 A;  2DJI A;  5E18 F;  1I1G A;  1JT6 A;  4P1W A;  2R5Y A;  5GAE J;  1POG A;  2Q1Z B;  1BI2 A;  1Z21 A;  4JBA A;  2E35 A;  3RPQ A;  4CSW A;  1H8A C;  1TZL A;  5FD5 A;  4O3M A;  2OA4 A;  3AL0 B;  1RUN A;  3T5X A;  1JXS A;  3DF8 A;  1MSE C;  2IS1 A;  1NK2 P;  1QHG A;  4M71 A;  1BW6 A;  3KYC B;  3MKL A;  2EV5 A;  4WXD A;  1K4T A;  3GTO J;  2RKH A;  1XB4 A;  5IYC J;  3Q0V A;  2I5U A;  1QVU A;  3KE2 A;  2ETH A;  1RIO H;  1TWC J;  1J2X A;  1APL C;  4A0Y A;  2PMZ N;  2MBF A;  3VFZ A;  4XKV A;  2LBF A;  2L3D A;  2N8G A;  4HX7 A;  5B66 C;  1ON1 A;  3HKZ A;  2MD0 A;  1O7L A;  4I0A A;  3ULQ B;  2WWY A;  2ZJ2 A;  3M8J A;  4DOZ A;  3HRT A;  2M0C A;  3HUG B;  3KEO A;  4AD9 A;  4P9F A;  3FX3 A;  4PZJ A;  4BEH A;  5JFR A;  1YHQ I;  2JRM A;  5ICF A;  1A5J A;  4BE0 A;  1VQ4 I;  1PVE A;  2KT0 A;  2HI3 A;  4FIS A;  4XLA A;  2JA8 J;  1ZGJ A;  2QCO A;  3R4K A;  1SFX A;  4IQJ A;  5KNL A;  3OR1 C;  1ZRE A;  2ZJR F;  4U7B A;  2I8D A;  2STT A;  4PJL A;  3WHC A;  3CCL I;  3DBH B;  1MDM B;  2ZXI A;  2OZU A;  1Z7U A;  5TGT A;  4KIS A;  2GXA A;  2VON A;  3F8B A;  2ZBK A;  4NUB A;  3G1M A;  4PGH A;  4ESB A;  4Y13 A;  4LLL A;  1RR8 C;  1UAA A;  5IOZ A;  2OQR A;  1LFB A;  5LGU A;  6PAX A;  5GPC A;  3ABL H;  1R7J A;  3TW6 A;  3U2R A;  2Z9O A;  5LLQ A;  2LY9 A;  1E2X A;  4YRV A;  3WGG A;  5GP9 A;  5M5W J;  4KIF A;  2LVS A;  1F9N A;  1EKE A;  2WTE A;  2X1E A;  5LD2 C;  2EZK A;  3IWZ A;  3GTJ J;  1GDT A;  2BGC A;  4OIO F;  5M3F J;  5E1X A;  5DTD A;  3DCF A;  4WCG A;  4C30 A;  3N05 A;  2WBM A;  1UJ8 A;  1QU3 A;  5FRN A;  2FU4 A;  3F0C A;  2EA2 A;  2LSO A;  1QPI A;  4WXH A;  4ON0 A;  4XOP A;  2HYJ A;  1D3Y A;  3GVA A;  2L02 A;  2BXY A;  5TIS C;  3IKT A;  4ETS A;  3IUO A;  3W3C A;  1Z05 A;  2JPC A;  1UST A;  2BHY A;  1FTZ A;  2COB A;  2R93 J;  3LST A;  1WJA A;  1H89 C;  4HF2 A;  2CJJ A;  4ZYE A;  1W5S A;  2VJ4 A;  3G6E I;  1O4X A;  2ZNZ A;  3GLL A;  1Z91 A;  3KZI C;  3ECH A;  3A0H C;  3TO6 A;  3J80 Z;  3FXO A;  3LQQ A;  2XPW A;  2XAH A;  3BQY A;  3PJR A;  2FOW A;  2F4M B;  2A05 A;  1KU2 A;  3HC7 A;  2A5Y B;  2O8X A;  2DT6 A;  3K69 A;  2P7V B;  3LA3 A;  3PFY A;  1L0O C;  3QU3 A;  3C7J A;  5DUI A;  5FD6 A;  4KFC A;  3TDZ C;  1K6Y A;  1K83 J;  1T0F A;  1K79 A;  2KJB A;  4E7I A;  3H9Q A;  4Q48 A;  2QQ9 A;  1X1B A;  4U88 A;  1YJN I;  3I59 A;  1D0X A;  4M3G A;  4MHG A;  4II2 A;  2EIM H;  4E70 A;  4IHX A;  2NOG A;  1R5G A;  3IAM 2;  3W2V A;  3K70 C;  4V2F A;  3HXL A;  1ZLJ A;  5E1Z B;  3QPL A;  3MFK A;  4HV6 A;  1FJL A;  3R6S A;  2ECB A;  2F6C A;  5E8G A;  3R0J A;  3F6V A;  4OAZ A;  3WTU C;  3WHB A;  1SD6 A;  2M3A A;  5H20 A;  2VOD A;  4LIU A;  4LOC A;  5DCM B;  2KZV A;  2LRD A;  1IRG A;  1P2F A;  1YOV B;  2OPT A;  3BQZ A;  3DTE A;  2JTV A;  4II3 A;  4EVI A;  3WTS C;  1HST A;  1Z77 A;  3OYC A;  4GYG A;  3OYJ A;  4M6V A;  3IL2 A;  1ETK A;  2XSJ C;  2VQL A;  5A2Q K;  3FXU A;  1NK3 P;  3CC2 I;  2CQK A;  2MFZ A;  1R4M B;  2XRL A;  3FF5 A;  1N75 A;  1R5H A;  2EPF A;  3F6O A;  4OU0 A;  1NHA A;  1ZG5 A;  3S3N A;  1YRN A;  4XRM A; 
#chains in the Genus database with same CATH homology
 4BHB A;  1R22 A;  4RAY A;  2IRF G;  2DQL A;  2ZME B;  5H6R A;  4GO1 A;  2ZKZ A;  1TW3 A;  1OYI A;  3TO7 A;  2PMH A;  1GHC A;  5D6F A;  5LEK A;  2EFO A;  3ABU A;  5HDN A;  5DDG A;  2Q0O A;  5LHI A;  2GXG A;  2NAZ A;  1Z9C A;  3BJA A;  1Z1D A;  5ILV A;  2E1C A;  2W84 A;  4HV5 A;  3DV8 A;  3EQL F;  1LB2 A;  1CF7 A;  3I4P A;  1PP7 U;  1K6O A;  4G94 A;  3LAP A;  1J0R A;  4OMZ A;  1IN5 A;  1IRF A;  5LRR A;  3ZMT A;  4M6X A;  3P7N A;  3RI4 A;  2KIU A;  1FY7 A;  3I58 A;  2XIG A;  1XSV A;  2FSW A;  3K1N A;  3KP5 A;  5K5R A;  2QEN A;  4M73 A;  5ILS A;  4G6D A;  5HVQ C;  1W7P A;  3PFI A;  3ZN0 A;  3IRR A;  1XD7 A;  4G9Y A;  5HDG A;  2P5V A;  4LD5 A;  1IW7 F;  2IP2 A;  2A68 F;  4KDP A;  3BY6 A;  3R60 A;  3QRF F;  2A6H F;  4OIR F;  5K5Q A;  4KMF A;  4A5M A;  2HQR A;  1FOK A;  2YX4 A;  1KQ9 A;  4HQM A;  1C0W A;  2PBI A;  1FYK A;  2QQB A;  1AWC A;  2STW A;  4EJO A;  3TGN A;  1SMT A;  5F64 A;  4MTE A;  1MJA A;  5D5W B;  3T8R A;  2NS0 A;  3J81 Z;  4IPA A;  4EMS A;  3TOA A;  1I5Z A;  2IPQ X;  2D1V A;  3EET A;  2NRA C;  3T8T A;  2E1N A;  4YG2 F;  4OOI A;  1YYV A;  1ZHF A;  1YW7 A;  4I98 B;  1IUY A;  1L3L A;  2PJP A;  2JSC A;  2QLZ A;  1B9M A;  2HOE A;  4KN4 X;  4DNC A;  2FQ3 A;  5JVT A;  1FPQ A;  3QP6 A;  4QLC U;  2HKO A;  5HS7 A;  1OYW A;  1HQC A;  1WRJ A;  4YFX F;  5L3B A;  2P8T A;  2CO5 A;  4Q4Z F;  1H9G A;  5L3C A;  2EWN A;  4U0W A;  1SAX A;  2JPB A;  4RB3 C;  3BJ6 A;  1U5T A;  4GXO A;  5DD8 A;  1QZZ A;  3TO9 A;  2VBW A;  4RGS A;  4ZZL A;  5D5X B;  4DQ2 A;  3OV8 A;  4HA8 A;  1F5T A;  4I01 A;  2DO7 A;  3I54 A;  3WG9 A;  4KIG A;  2H94 A;  4IRI A;  1W4M A;  4G7Z F;  2Z33 A;  2YSR A;  2HYG D;  1F4K A;  5TRD A;  2XAG A;  2BV6 A;  4UVB A;  2QBY B;  3GZ6 A;  2VC0 A;  5E17 F;  2DPD A;  2XAS A;  1DPR A;  5E20 A;  4ENN A;  2VOP A;  2W25 A;  2NNY A;  2GWR A;  1HSJ A;  5CYV A;  3IC7 A;  2X0L A;  4P96 A;  1CF7 B;  2DW4 A;  2A07 F;  4MQ9 F;  4L9T A;  1ZG1 A;  1TNS A;  3E6B A;  1ZAO A;  1KQ8 A;  2DK5 A;  1R23 A;  1O3S A;  2MLG A;  5LGT A;  3W6J B;  5J6X A;  4Y17 A;  3GFJ A;  2A61 A;  3RKW A;  4BAY A;  4L5J A;  1E17 A;  2EB7 A;  1W7P B;  2FE3 A;  3NEU A;  1FP2 A;  3JW4 A;  1FX7 A;  4KYW A;  2OAZ A;  1REP C;  4LK0 F;  1V3F A;  2BEO A;  2L4A A;  3BPX A;  5DEQ A;  1EH7 A;  4FX0 A;  1F1Z A;  2O61 A;  5D8K B;  3E5X A;  3COA C;  3GEZ A;  2Z99 A;  3L09 A;  4FT8 A;  4KNY A;  1FWZ A;  1FC3 A;  1KU7 A;  3WU1 B;  1G6N A;  1P4A A;  2MA3 A;  2HKX A;  1BIB A;  3M7G A;  4ZYG A;  4G7O F;  3CTA A;  3V4G A;  2FBK A;  4HBL A;  3MQ0 A;  3MZH A;  1EV7 A;  4MEY F;  5HLI A;  3E3V A;  1Z6T A;  4Q47 A;  3ZMV A;  2FF4 A;  1TQI A;  4I0B A;  3CLO A;  1Z6R A;  2UXX A;  3RJP A;  1WSU A;  3WTY C;  1QQI A;  4YIF A;  4BQA A;  5FGM A;  2MLK A;  1KQ0 A;  2F2E A;  3HSR A;  3Q9V A;  1IN8 A;  1U5T B;  5DCM A;  1T6S A;  2Z3Y A;  4ENK A;  3O3K A;  5HDK A;  2VOO A;  1DUX C;  4L18 B;  1BN5 A;  1B9N A;  1U78 A;  3HTU A;  1QGP A;  3M1E A;  1YS7 A;  3TDU C;  5AIP A;  3I0T A;  1HKQ A;  3ML6 A;  4CO8 A;  2BE5 F;  1PP8 F;  2XVC A;  3FMQ A;  2CW0 F;  2ZME A;  3MWM A;  3V8K A;  2RDP A;  2PN6 A;  1ZGA A;  1ZRF A;  5A2Q Z;  4HQE A;  4R1H A;  4KIB A;  1K7A A;  3GYH X;  1UFM A;  1TW2 A;  3L2C A;  1XCV A;  2RGV A;  4HLY A;  2DTR A;  5F1R A;  1XSX A;  4UUV A;  3SFZ A;  4EQQ A;  3EYY A;  1W7P D;  3EDP A;  2FBH A;  5BQT A;  1HBX G;  3SZT A;  3H3Z A;  1ONV A;  2HZT A;  4KMU X;  4L9J A;  3S2W A;  5E1W A;  3OOP A;  1BOA A;  1XGN A;  3RKX A;  2RC4 A;  2V79 A;  5ED4 A;  4HX8 A;  3QPT A;  3JTG A;  4MTD A;  1LEA A;  1XMA A;  4IRH A;  5IT9 K;  1H0M A;  3ROU A;  2TDX A;  3CO7 C;  5DYM A;  5L3G A;  2F5C A;  2GAU A;  2R7F A;  1A04 A;  4UVA A;  4ZYD A;  2PI0 A;  3CUQ A;  1FYM A;  1Q1H A;  4LJZ F;  2QVO A;  3O6B B;  2O6G E;  3I64 A;  3BOQ A;  1BM9 A;  2EA4 A;  1BC8 C;  1TNT A;  3ZN1 A;  3GFL A;  3EYI A;  5HS9 A;  2YX7 A;  3R61 A;  3Q5F A;  2QWW A;  4AWX B;  5K1Y A;  1HXD A;  1G3W A;  3ZQ7 A;  4XBF A;  1B6A A;  3KP6 A;  3GXO A;  4BH9 A;  2ZO4 A;  5LEJ A;  3ISP A;  1WI9 A;  5H6Q A;  3WTZ A;  5K5O A;  3LQR A;  3NRV A;  3JSO A;  3RKY A;  1QBJ A;  4P9U A;  2A69 F;  2EV0 A;  2DK8 A;  2K86 A;  1XN7 A;  4EM2 A;  1I27 A;  2FNP A;  2V1X A;  4RS8 A;  1XGO A;  3BP8 A;  3F22 A;  3BWG A;  3WU0 A;  1T2K A;  5KVR A;  3DPT A;  4EGY A;  2VE8 A;  5LRS A;  2HS5 A;  1FSH A;  3IHU A;  1O3Q A;  2XRN A;  2QYO A;  1ZAR A;  3HYI A;  4LK1 F;  2W24 A;  3F3X A;  4OIN F;  2A3S A;  2RN7 A;  1MJ9 A;  1ZYR F;  4B09 A;  1YIO A;  2LF7 A;  2O03 A;  1LDK B;  5BS6 A;  3HHG A;  2QBY A;  2L4M A;  2GQQ A;  2HTJ A;  1K78 A;  2V9V A;  3BZ6 A;  1PDN C;  2EFW A;  2COM A;  1OPC A;  4KUM A;  4M74 A;  1O57 A;  3GW2 A;  3ZMD A;  4LGW A;  2AS5 F;  5ICG A;  3FWE A;  1HW5 A;  1ULY A;  3F21 A;  2ISY A;  2VN2 A;  3LAJ A;  1EH8 A;  1JGS A;  1QNT A;  3F8M A;  2P5K A;  1J5Y A;  4O6J A;  2H6C A;  3F8N A;  3KP3 A;  1TTY A;  2EFP A;  2JT1 A;  3IRQ A;  4N0B A;  2JRT A;  4ZH4 F;  5HLG A;  4G6Q A;  1R36 A;  3CUQ B;  4ESJ A;  1KYZ A;  4I7H A;  4KIC A;  4JQF A;  4IHT A;  1BI0 A;  1UHW A;  3K0L A;  4N9H A;  2KIM A;  2OU2 A;  4YFK F;  1XSD A;  3Q9S A;  1UB9 A;  1G4D A;  3T0Y A;  2M30 A;  4LB6 B;  1XDS A;  1KYW A;  2CGP A;  3L7W A;  3E5Q A;  4ZYH A;  4HYE A;  4I02 A;  1DP7 P;  3GUD A;  5FFX A;  5TJJ A;  4ASN A;  4RGU A;  1KGS A;  2RVC A;  2WV0 A;  4HDV A;  3RYR A;  2IW5 A;  3K2Z A;  3T1B A;  2ESH A;  4PCQ A;  5FLX K;  4O5V A;  4A12 A;  2CG4 A;  5D4S A;  2FA5 A;  4P5O A;  2DAO A;  5AON A;  4M9S A;  2K02 A;  2OQG A;  2G9W A;  1ZH5 A;  1S6L A;  4G7H F;  4IRG A;  4EV0 A;  3JAM Z;  3WE2 A;  3B73 A;  4AIH A;  3JSP A;  2EJR A;  4GCV A;  2KKO A;  4HW0 A;  2Q2E A;  4JK1 X;  3DKW A;  4PDK A;  1PUE E;  2MD5 A;  3HSE A;  3K1P A;  1FNN A;  3KZY A;  1ODD A;  3E6M A;  2KRF A;  3CUO A;  1IF1 A;  1YTY A;  5CVV A;  3E5U A;  3LWF A;  4UV9 A;  1HKT A;  4QWQ A;  2F5F A;  2ESN A;  4Z2Y A;  1OR7 A;  1K78 B;  5KK1 A;  4RB2 C;  1TLH B;  2V1U A;  2K4J A;  1MKM A;  2R3S A;  3FZV A;  4ESF A;  4GYI A;  3I53 A;  1U5T C;  3V8L A;  4A0X A;  1IN7 A;  5BOX A;  1GVJ A;  2FEZ A;  1RUO A;  1ZN2 A;  2P5L C;  3SHF A;  3U9G A;  4ENJ A;  4OIQ F;  4CIC A;  2VE9 A;  2FMY A;  1LDJ A;  5D5V B;  5LHH A;  3RDI A;  1S3J A;  3M8E A;  1IAW A;  2HDC A;  3BPV A;  3HOT A;  2K7L A;  4R8H A;  4HF0 A;  3KP4 A;  2V1D A;  3I5U A;  5J8C A;  4I09 A;  4CDG A;  1AOY A;  4LFU A;  5CLS A;  1IZ1 A;  2EK5 A;  4WF2 A;  3V8J A;  3P9C A;  2XGX A;  1RZ4 A;  2FNA A;  1HW2 A;  3KP7 A;  2VBY A;  2R7D A;  4XLN F;  3HRM A;  3ZP5 A;  2KIF A;  1W5T A;  1IXR C;  2GXB A;  2VT3 A;  4XSZ F;  5IT9 Z;  1FBS A;  3D0S A;  3M8F A;  5HOO A;  3WOD F;  4M9X A;  3G3Z A;  2DLL A;  2L01 A;  1I6X A;  3RPU A;  1IXC A;  3DPL C;  3I71 A;  1S8N A;  2L54 A;  2FXA A;  3JAM K;  1ZG3 A;  1GXQ A;  1GXP A;  1WQ2 A;  3W6K B;  2IA1 A;  4N9I A;  3TQN A;  1YG2 A;  2OBP A;  4NHJ A;  4UNO A;  1FT9 A;  5IT3 A;  1YFH A;  1R00 A;  3GFM A;  1WKM A;  3HSF A;  2Z5U A;  1VTN C;  3VB2 A;  2LKP A;  5CVJ A;  2XUB A;  3HRU A;  2IA0 A;  3H3U A;  2Q8K A;  2MC3 A;  5HLH A;  3E6D A;  4M9Z A;  4UVC A;  4Y15 A;  1BJA A;  2HR3 A;  3LA2 A;  5DCF A;  4TV7 A;  4LLN A;  4U7D A;  4RB1 A;  4NQW A;  1YW9 A;  1B1B A;  3B02 A;  3VEP A;  5FFZ A;  3KET A;  4GGG A;  3LFK A;  1XGM A;  1BI1 A;  4BHC A;  1RI7 A;  5L3E A;  4MGR A;  4PGG A;  3IKV A;  5LBQ A;  3EUH A;  3F8C A;  1FYL A;  4F7Z A;  4WK8 F;  2O0Y A;  1SD4 A;  1BIA A;  3C3W A;  1USS A;  2A6E F;  1FBQ A;  2BYV E;  3WTT C;  1T39 A;  2CFX A;  1YLF A;  1QPM A;  4OIP F;  5L3D A;  3TKY A;  5BMZ A;  3KCC A;  1YS6 A;  4WX9 A;  2RV8 A;  2YR2 A;  5ILU A;  2XRO A;  3ERE D;  1STZ A;  4HZF A;  2NYX A;  3ZMZ A;  4XSX F;  2ISZ A;  4WXC A;  1P4X A;  3ZPL A;  4CGZ A;  5D5U B;  2VT2 A;  4KA4 A;  2VBZ A;  4MNU A;  5JR3 A;  3AAF A;  1ZRD A;  5J8F A;  1V4R A;  4EJU A;  2HYF A;  4G8X A;  3GFI A;  1MD0 A;  3WTV C;  3FMS A;  1O7F A;  2RQP A;  2QZ8 A;  1U8R A;  2ZXJ A;  1SFE A;  2XKO A;  3VOE A;  3MZY A;  4IXA A;  2AXL A;  4I2O A;  1ZRC A;  4IJA A;  2K4B A;  3L9F A;  2VC1 A;  2QM3 A;  2CSO A;  4NB5 A;  4L0Z B;  2PG4 A;  2P6S A;  4L5I A;  4HOB A;  3DEU A;  5FO5 A;  1IN6 A;  4S05 A;  3K1M A;  1HKS A;  2E7W A;  2HWV A;  2P7C B;  2XAJ A;  2IVM A;  5L3F A;  2XAQ A;  3QPH A;  3WE3 A;  4LG0 A;  4BNC A;  1KU3 A;  5CVR A;  3CUQ C;  1FBU A;  1KU9 A;  5ICE A;  3SXY A;  4RB0 A;  2B0L A;  2XAF A;  4CXF A;  4UXN A;  3PQK A;  1YW8 A;  4H0E A;  1R1V A;  2QQA A;  1UCR A;  2UXN A;  1HW1 A;  2DT5 A;  1D5V A;  2DFI A;  4IHS A;  1T38 A;  2M45 A;  2OD5 A;  3D5L A;  4EGZ A;  2G7U A;  2DPU A;  1ON2 A;  3P9K A;  5FLX Z;  1U2W A;  2GA1 A;  5CJ9 A;  1TQM A;  2HQN A;  2FML A;  1D8J A;  1FP1 D;  2EFN A;  1BC7 C;  3DXJ F;  3DQV C;  2ZNY A;  2J5P A;  4KT5 C;  4KN7 X;  3GLX A;  2ADU A;  3O2P E;  1B4A A;  2P4W A;  4OMY A;  5DV5 A;  3HTS B;  2E7X A;  3HIF A;  4HX4 A;  4LMY A;  3ABT A;  2W57 A;  3BRO A;  1QO0 D;  3GWZ A;  1J59 A;  1FLI A;  2HTS A;  3H92 A;  4ZZD A;  2YU3 A;  2D2W A;  1SFU A;  3SQN A;  1G3T A;  2DBB A;  3VOD A;  3BDD A;  4A2U A;  1B59 A;  4CYD A;  4R79 A;  1FSE A;  3REO A;  2D1H A;  3KEQ A;  1XMK A;  2O3F A;  1OMI A;  3ECO A;  2YPR A;  1SMY F;  3QAH A;  3J7A O;  3JTH A;  4LB5 A;  2Y75 A;  1ZLK A;  1WWX A;  1LJ9 A;  3M9A A;  1JHH A;  1LQ1 A;  3FM5 A;  4LLG F;  4BHP A;  2W85 A;  4HLX A;  5AIQ A;  1I1S A;  1DDN A;  3WTW C;  4ENM A;  4D0P A;  4A6E A;  1MJB A;  2FRH A;  3KLN A;  2C6Y A;  2EFQ A;  3KP2 A;  2Y0M A;  1O3T A;  1D8K A;  4U0V A;  2XV4 S;  1H9T A;  4EJV A;  3RTR A;  1CGP A;  3K9T A;  1P4W A;  1FZP B;  4L0Y B;  2MH2 A;  4AVP A;  1BI3 A;  3RIR A;  2ELH A;  3J80 K;  4HF1 A;  2KJC A;  1RNL A;  5BPD A;  3SZP A;  5BPI A;  2D45 A;  2PQ8 A;  5JI6 A;  1Y0U A;  3C1D A;  2F5E A;  2IT0 A;  1QZY A;  4EM0 B;  1YQA A;  4LG0 B;  4IVN A;  4AIJ A;  1JE8 A;  2UZK A;  1LEB A;  1T98 A;  3E6C C;  3LA7 A;  3F8F A;  3KLO A;  1LVA A;  2ZFW A;  3V7S A;  3CO6 C;  1TBX A;  1X3U A;  5CVI A;  1OYY A;  3GX4 X;  2X4H A;  2Y48 A;  2XHK A;  2PMU A;  3IWF A;  3I59 B;  3BJO A;  3F23 A;  5F6F A;  4FX4 A;  2P6T A;  3CDH A;  2M1B A;  5D8L B;  3KZZ A;  5JHU A;  3R0A A;  2GA2 A;  4B8X A;  4U0Y A;  2QUF A;  2DI3 A;  2CYY A;  2FOK A;  5ERI A;  5E8I A;  4K2E A;  2H6B A;  5CVU A;  2MH9 A;  5HS8 A;  3GZ5 A;  4XLP F;  2BBY A;  3ZMS A;  3HOS A;  1LDD A;  5LGN A;  2DU9 A;  3N4M A;  4BYY A;  4P55 A;  5D4R A;  1DPU A;  2ZCW A;  3MEX A;  5EEH A;  2OZ6 A;  2LF8 A;  3KFW X;  4RGR A;  1KA8 A;  1G3Y A;  1G3S A;  3FM3 A;  2HGC A;  1SD7 A;  4M72 A;  3MCZ A;  1U3E M;  3CJN A;  2M5W A;  1MZB A;  1R1U A;  2H27 A;  3F72 A;  1R58 A;  2GIV A;  4A5N A;  1SD5 A;  4CHU A;  2HFH A;  2H09 A;  3FXR A;  2K27 A;  1S7O A;  2JZY A;  3GF2 A;  5DD4 A;  3G73 A;  1S7A A;  1IN4 A;  1O3R A;  2J5O A;  1R1T A;  2CWE A;  2VXZ A;  3DFG A;  4AIK A;  3HUG A;  3GO5 A;  4S04 A;  3PQJ A;  4A6D A;  1P6R A;  1MDM A;  2LNB A;  4M6Y A;  3ZMU A;  4MEX F;  2EV6 A;  2V6C A;  5D6E A;  2DQR A;  2UWM A;  1J75 A;  1EH6 A;  2PFB A;  5EEG A;  4EJW A;  4XRF A;  3J81 K;  1XDU A;  3FMR A;  2F5D A;  3WTX C;  4WWC A;  5ICC A;  1XGS A;  5DUK A;  4IF4 A;  3MAJ A;  2NNN A;  3V7C A;  1UHM A;  4MQV A;  2PLY A;  4RGX A;  3E97 A;  1MGT A;  3HRS A;  3HHH A;  1P92 A;  4EJT A;  3WGI A;  1LNW A;  2IA2 A;  4Q5S F;  4A0Z A;  4BXU A;  2M8E A;  2VBX A;  1XCB A;  3P9I A;  2IJL A;  2M87 A;  1U6G A;  4UV8 A;  3V7R A;  1YO5 C;  2ACJ A;  4EM1 A;  1J9I A;  4FHT A;  2LDU A;  4HDU A;  3DP7 A;  1JHF A;  4L9V A;  2GZW A;  2WC2 A;  1J7K A;  4L9N A;  2PEX A;  3QU6 A;  2XKP A;  2HEO A;  5FB2 A;  1BBY A;  3RYP A;  3C18 A;  2RNJ A;  4YFN F;  3TOB A;  1S29 A;  3QOP A;  4CZZ A;  4YII A;  1IXS B;  5LHG A;  2G7H A;  3QP5 A;  4HAM A;  1TQP A;  1OKR A;  4UHT A;  3U1D A;  4RAZ A;  3NQO A;  3L00 A;  2FBI A;  3WGH A;  3FXQ A;  3FHZ A;  3ELK A;  3N97 A;  5E18 F;  1I1G A;  1BI2 A;  4JBA A;  3RPQ A;  4O3M A;  5FD5 A;  2OA4 A;  1RUN A;  3T5X A;  1JXS A;  3DF8 A;  4M71 A;  2EV5 A;  2RKH A;  1XB4 A;  3KE2 A;  2ETH A;  1RIO H;  1J2X A;  4A0Y A;  2MBF A;  3VFZ A;  2L3D A;  4HX7 A;  1ON1 A;  1O7L A;  4I0A A;  3ULQ B;  2WWY A;  2ZJ2 A;  3HRT A;  3KEO A;  4AD9 A;  4P9F A;  3FX3 A;  4PZJ A;  5JFR A;  5ICF A;  1ZGJ A;  3R4K A;  1SFX A;  1ZRE A;  4U7B A;  2STT A;  1MDM B;  2OZU A;  1Z7U A;  2VON A;  3F8B A;  2ZBK A;  4PGH A;  4ESB A;  4Y13 A;  4LLL A;  2OQR A;  5LGU A;  6PAX A;  1R7J A;  3U2R A;  2Z9O A;  5LLQ A;  1E2X A;  3WGG A;  4KIF A;  1F9N A;  2WTE A;  3IWZ A;  2BGC A;  4OIO F;  5E1X A;  4WCG A;  2FU4 A;  2EA2 A;  2LSO A;  4WXH A;  4ON0 A;  1D3Y A;  3GVA A;  2L02 A;  3IKT A;  4ETS A;  1Z05 A;  2JPC A;  1UST A;  3LST A;  4HF2 A;  4ZYE A;  1W5S A;  2ZNZ A;  1Z91 A;  3ECH A;  3TO6 A;  3J80 Z;  3LQQ A;  2XAH A;  1KU2 A;  3K69 A;  2A5Y B;  2O8X A;  3LA3 A;  4WXD A;  2P7V B;  3QU3 A;  1L0O C;  3C7J A;  5DUI A;  5FD6 A;  4KFC A;  3TDZ C;  1T0F A;  1K79 A;  2KJB A;  4Q48 A;  2QQ9 A;  4U88 A;  3I59 A;  4MHG A;  4E70 A;  1R5G A;  1ZLJ A;  5E1Z B;  3MFK A;  4HV6 A;  3R6S A;  5E8G A;  3R0J A;  3F6V A;  3WTU C;  2VOD A;  1SD6 A;  5H20 A;  5DCM B;  1IRG A;  1P2F A;  4EVI A;  3WTS C;  2JTV A;  1HST A;  4GYG A;  3IL2 A;  5A2Q K;  3FXU A;  2CQK A;  3FF5 A;  1R5H A;  3F6O A;  4OU0 A;  1NHA A;  1ZG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...