5HLGA

Structure of reduced abfr bound to dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
134
Chain Sequence
QEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLETKYVFEELEQTLKHLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*AP*CP*TP*CP*AP*AP*TP*CP*GP*CP*GP*CP*GP*CP*G
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator/dna
total genus 48
structure length 134
sequence length 144
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hlgA00
4OMYA 2E1NA 2KIMA 3GLXA 4R79A 2ZNZA 3WGIA 1J75A 1KQ8A 2PFBA 3HSRA 3L7WA 2IA2A 3I64A 2ACJA 3KEOA 1XMAA 1MD0A 5ERIA 3ML6A 2HS5A 3K1MA 3I54A 1U6GA 5E8IA 1BIBA 4EM2A 3RKYA 2PI0A 1LEAA 1S3JA 1R00A 1RUNA 2GQQA 3ZN1A 1ZG5A 2BGCA 2ZO4A 5DUIA 4M9XA 3RPQA 4L18B 3EETA 3CUQA 4BQAA 4IHTA 2V9VA 3HUGA 2ZKZA 2MC3A 4MGRA 3KETA 3SQNA 4UVAA 2YR2A 4LK1F 4RAZA 3V7SA 2FEZA 3RPUA 2HGCA 3ECOA 3JTHA 2ISZA 3ELKA 1F1ZA 2FNAA 2ZBKA 3QOPA 4L5IA 1K7AA 3PQKA 5DCFA 4LLGF 3VEPA 2V1DA 2XGXA 2Z33A 2KJCA 1RI7A 1FYKA 3DF8A 1FSHA 2PN6A 2ZMEA 4I2OA 4HX4A 4HLYA 2XAJA 5ILVA 2OBPA 1C0WA 4M6XA 2A07F 1DPUA 3LFKA 1HSJA 1QZZA 3FMQA 2HWVA 3W6KB 1KU7A 1RNLA 1J5YA 4ESBA 5CVJA 4Y13A 2A68F 3E6MA 4KNYA 2OAZA 2VXZA 3NRVA 4FX0A 1HW1A 3J81Z 2R3SA 4GCVA 4ETSA 1TQMA 4DNCA 2O61A 4Z2YA 1KYZA 1U8RA 2EA4A 3U9GA 5BMZA 4G7OF 3DP7A 5BPDA 3WU1B 3BJOA 2JRTA 2ZJ2A 3DFGA 1D8KA 2HKOA 3J7AO 4CYDA 1ODDA 4HOBA 3SFZA 4NQWA 4BXUA 4ZH4F 3BDDA 1HBXG 4YIFA 4RB0A 5CVVA 2LDUA 1K6OA 4RB1A 2ZCWA 2NAZA 2NS0A 2W84A 3KLOA 5HS8A 3RKWA 2XAQA 2OA4A 3K1NA 2FE3A 3M8FA 1QGPA 2VT2A 1B9NA 3FZVA 5HDKA 2DPUA 2HQNA 2UXNA 1YQAA 2Z9OA 5A2QZ 5LEJA 1H9GA 1S7OA 1L3LA 5HLHA 3ISPA 2FXAA 4OU0A 2GZWA 1Z6TA 1XD7A 2OZUA 4M74A 4IRIA 3E97A 1HQCA 2TDXA 2ZNYA 4I01A 3KZYA 2VC1A 4M9ZA 1UFMA 4KUMA 2XAHA 3M1EA 5KVRA 3R4KA 1W5TA 1FBSA 1BC8C 3QU6A 4WK8F 5L3CA 4F7ZA 2QBYA 2OQRA 1W7PD 3HYIA 4MTDA 3RYPA 3I5UA 4A0ZA 2STWA 3AAFA 2FA5A 4ZYDA 2O03A 1MDMB 3DPLC 5H6RA 4IF4A 3TO9A 1BJAA 2AXLA 5E1XA 1R22A 1UHMA 3P9CA 2EB7A 3U2RA 1B6AA 2IP2A 4KN4X 1XSVA 2IVMA 2MLGA 4BHBA 2CGPA 2JPBA 3BZ6A 3ZMDA 5H20A 4S04A 5J8CA 3WGHA 1YIOA 2IRFG 2QZ8A 4ENNA 3DQVC 1FYMA 3JAMK 5DEQA 4FHTA 3F8MA 5E20A 5FFZA 5IT9Z 2L3DA 4EJWA 2M8EA 2RKHA 4GYIA 1BI1A 2FOKA 2H09A 3ABTA 2BE5F 4I0BA 2XHKA 5F6FA 3GFJA 4A0XA 1XB4A 2Q8KA 3LQRA 2XV4S 2EFPA 1LVAA 5DD8A 3Q9SA 3M7GA 4FT8A 4EQQA 1HSTA 4YFXF 2VT3A 1QNTA 3JW4A 3H92A 1KQ0A 2NNNA 1JHFA 2K02A 3HOTA 4UUVA 1OKRA 1AWCA 1YYVA 1OYWA 1WI9A 3ZMZA 2H94A 5BOXA 1XDSA 3QPHA 4ESFA 2RQPA 2ESHA 2CG4A 2F5DA 5EEGA 1F9NA 2P6TA 4P96A 3WTUC 1UB9A 3V8JA 1IN7A 5CYVA 1XGOA 1MZBA 1XN7A 3K0LA 2M30A 1R36A 4HA8A 4HDVA 4TV7A 2P8TA 2KIFA 3GFIA 2A3SA 5DD4A 2DI3A 2FBIA 2G9WA 2Z5UA 4HQMA 2LF7A 4RGXA 2PLYA 4IVNA 4NB5A 1CGPA 3DEUA 1I1GA 1G3SA 3V8LA 1FPQA 3I71A 2CWEA 1ZHFA 1LB2A 2IPQX 2A61A 3H3UA 1HKTA 4G6DA 4YG2F 2DQRA 1ON2A 2DW4A 4LJZF 5DV5A 2X4HA 3ZP5A 2XIGA 1TLHB 3R61A 2W24A 2J5OA 1R23A 2M87A 3D5LA 1QQIA 4GYGA 3WGGA 3HSEA 4YFKF 4P9FA 1HW5A 1MJ9A 3FWEA 1Z91A 1R58A 3CLOA 4LFUA 1K78B 1G4DA 4G8XA 5FLXK 4U0YA 1SD6A 1PP8F 1I6XA 4B8XA 3K9TA 4HX8A 2G7UA 1S29A 1UHWA 3RJPA 1FX7A 5D4RA 2ZFWA 3GYHX 3O6BB 2RVCA 3F8CA 1JHHA 3JSOA 4Q48A 4U0VA 4WXDA 1CF7B 5LEKA 2R7FA 2F2EA 5BS6A 4UNOA 3P7NA 1V4RA 3OOPA 1JGSA 4M6YA 4D0PA 3VODA 3SHFA 2MH2A 3T5XA 2H6BA 4BYYA 1LDJA 2VONA 2RDPA 1R7JA 1T6SA 3WU0A 4XBFA 1QO0D 1USTA 2K4JA 3CUOA 2FF4A 1Z9CA 3E5XA 3L9FA 2LNBA 2UZKA 2HOEA 3HTUA 2PJPA 3MCZA 4IJAA 3GFMA 4A6EA 3IRQA 1R5GA 4JQFA 4LLLA 4RB2C 4MQVA 4U7DA 3U1DA 1TTYA 2HKXA 4OIQF 3FXQA 5D8LB 4ENMA 2MH9A 2HZTA 1ZAOA 1SFXA 1O3TA 1KU9A 3NQOA 4I98B 4EJUA 3J80Z 3ZPLA 4A5MA 4G94A 4ON0A 4WF2A 3E6BA 4PGHA 3TO6A 3HRUA 1MDMA 4EVIA 1YFHA 1SAXA 3ZN0A 1FBUA 4JK1X 3GEZA 1GXPA 3F21A 3KE2A 1ZN2A 3E6DA 2VBXA 2WWYA 1AOYA 1IXCA 2E7XA 1TW2A 3GWZA 2P5LC 2VOOA 3LQQA 3N97A 1H0MA 5LRSA 1F5TA 3C1DA 1IZ1A 3FM5A 2FBHA 4XSXF 2JSCA 4DQ2A 2K86A 2PQ8A 4AIHA 3F6OA 5F1RA 4M72A 5HS9A 4N9IA 1ZRFA 2EA2A 3IKTA 1E2XA 4AWXB 1XMKA 2QUFA 1LQ1A 2O6GE 3TDZC 1B9MA 3I0TA 1Y0UA 2M5WA 5ICEA 4GO1A 2DAOA 2DK8A 4EJVA 3F8FA 5CJ9A 3F72A 3D0SA 3FMRA 1FOKA 2HTSA 2KRFA 2FBKA 4ZZDA 5K5RA 1IUYA 3M9AA 2L4AA 3CUQC 3GF2A 3LAJA 3ZQ7A 3HRMA 1FY7A 2WC2A 4KA4A 1P4XA 4PGGA 3T0YA 1SFEA 2MLKA 3GUDA 4MHGA 2K27A 2BBYA 1YO5C 4A2UA 5ICCA 3Q9VA 1XDUA 1DP7P 4IPAA 2Q0OA 3BY6A 3EYYA 1XSDA 3IL2A 3DPTA 5HS7A 3PFIA 1DDNA 1IN6A 4RGRA 2DO7A 1TBXA 3WTSC 2D1VA 2XROA 6PAXA 1PDNC 5AIQA 2O3FA 2XASA 2V79A 3F8NA 3E5UA 3VOEA 1L0OC 4M71A 1PP7U 1BI3A 4HF2A 2DPDA 3O3KA 4HLXA 4CDGA 2MBFA 2YX4A 2X0LA 1R1TA 3JTGA 3BOQA 1BI0A 3KP2A 5E8GA 2UXXA 3GFLA 4G9YA 1Z1DA 3K69A 1J9IA 2JPCA 5HDNA 1EH8A 3HRSA 4EGYA 3WTWC 1DUXC 4AIJA 2QQAA 3KP6A 2VBWA 2RGVA 4Y15A 2VBZA 3I58A 3MQ0A 3MZYA 4HW0A 3IRRA 2Y0MA 4U7BA 5JI6A 1K78A 2ESNA 1FZPB 1TQPA 1WSUA 2O8XA 4R8HA 3WTXC 2LSOA 4G7HF 3MWMA 2QLZA 3F6VA 4ENKA 5DYMA 5CVIA 4LB5A 2IT0A 1W4MA 1YS7A 1D8JA 4LG0B 1CF7A 3GO5A 5FO5A 3ZMUA 3IWFA 2P5KA 3K2ZA 4RS8A 3NEUA 2FU4A 4KN7X 5LGUA 1RZ4A 1P4AA 2VE9A 5E1WA 2DBBA 1P4WA 3RYRA 2FMLA 2P7VB 5L3DA 2FNPA 4O5VA 2BEOA 1XCVA 2W25A 4L5JA 4A12A 3V7CA 5DCMB 1ONVA 1G6NA 4QLCU 2EFOA 1XGNA 2V6CA 2EJRA 3I4PA 3GZ5A 1OR7A 3F22A 2UWMA 1G3YA 3QAHA 1XGSA 2M1BA 3L2CA 1O3SA 1JE8A 2DLLA 3FXUA 2WTEA 1QBJA 3QPTA 3QU3A 5J6XA 5ED4A 2EFQA 4MNUA 3E3VA 3BJ6A 4L9TA 1VTNC 3KP5A 1IXSB 5LGTA 4M9SA 5D5UB 4O3MA 4PZJA 4KT5C 3QRFF 4P5OA 2BYVE 5DUKA 1J7KA 2HFHA 2CSOA 4WWCA 1D3YA 1OYIA 1YLFA 3PQJA 5HLIA 2F5FA 3I59B 1WKMA 2ZXJA 2XAFA 2F5EA 4AIKA 2W57A 3ZMSA 1W5SA 1LJ9A 2D2WA 1U78A 1SD5A 2GXBA 3RIRA 1I1SA 1WWXA 1FC3A 1BM9A 3FMSA 3TQNA 1QPMA 3MAJA 4AVPA 1REPC 2EFNA 1STZA 4G6QA 4XSZF 4OIOF 5ICGA 4H0EA 3FHZA 1IW7F 3ULQB 5D6FA 2EV6A 5AIPA 4ZYEA 2IW5A 1E17A 4IRGA 4OIPF 1SD7A 4BHPA 2CYYA 3BPXA 1USSA 2IA1A 2ADUA 1P6RA 4CO8A 4CGZA 1MGTA 3EDPA 4UV9A 1FBQA 5JHUA 1XGMA 4GXOA 4WXHA 1ZGJA 3IC7A 2EWNA 1B59A 5JR3A 2RNJA 1PUEE 1IRFA 4HBLA 5D6EA 3WE2A 2A6EF 1T98A 3GW2A 3QP6A 2HEOA 5FD6A 5CLSA 3TDUC 2VBYA 4OIRF 2E7WA 3MFKA 3FX3A 5FFXA 2V1XA 3CJNA 3LA7A 1DPRA 4ZYGA 2A6HF 2Q2EA 1GHCA 4KIBA 1GVJA 1LDDA 1ZYRF 2IJLA 5D8KB 5F64A 1B1BA 2COMA 4L0ZB 2XRNA 4LMYA 3M8EA 2FMYA 2QQ9A 4K2EA 1ZLJA 2QQBA 2D1HA 4UHTA 1O7FA 3S2WA 3DXJF 3WTZA 4HQEA 1HKSA 2OD5A 2JZYA 2Z3YA 4R1HA 2RN7A 1V3FA 2XUBA 1LDKB 2OZ6A 1O7LA 3HIFA 1MJAA 2EFWA 4JBAA 1MKMA 2KKOA 2VN2A 1IAWA 1RUOA 2QENA 5EEHA 4I09A 5LRRA 5CVUA 4KMFA 4LK0F 2CQKA 1SD4A 1W7PB 1RIOH 2GA1A 2D45A 4KFCA 4ZZLA 3WODF 2L54A 4HX7A 2EK5A 1HKQA 5L3FA 1X3UA 3WE3A 2G7HA 2GA2A 4I02A 4E70A 3KCCA 5L3GA 4LG0A 5FLXZ 2DU9A 4LD5A 2A69F 5L3BA 1D5VA 2JT1A 4RGUA 3LA2A 2VC0A 4A0YA 2E1CA 3LSTA 3LA3A 4CICA 3J81K 3V7RA 3BROA 4BNCA 5DCMA 3TKYA 3T1BA 5LHIA 2PMUA 1J2XA 5L3EA 3T8RA 4I7HA 2FQ3A 5KK1A 1EV7A 3SZTA 3REOA 3P9IA 1R1UA 3G73A 1IN5A 5H6QA 4HV5A 2VE8A 3E5QA 4L0YB 1S8NA 1U5TB 3GZ6A 4P55A 2CFXA 2EV5A 2QM3A 1O57A 1J59A 1Q1HA 1IRGA 2DQLA 2WV0A 1TQIA 1G3WA 3W6JB 3IWZA 1IN4A 3H3ZA 1ZG1A 3Q5FA 3BPVA 4YFNF 3R0JA 5AONA 5FB2A 3CO7C 4HZFA 4MTEA 3RDIA 2W85A 2YPRA 2R7DA 3I59A 5A2QK 3SZPA 4NHJA 2O0YA 1YW7A 2V1UA 4PDKA 4WCGA 1TNSA 3SXYA 1KQ9A 1ZLKA 3L09A 4IHSA 3RI4A 5TJJA 3LAPA 2BV6A 3WTYC 3KP7A 4UXNA 4LGWA 3CDHA 1ZREA 2KJBA 1T38A 3DV8A 3COAC 4KMUX 2PG4A 2F5CA 4EMSA 4HF1A 1MJBA 4HV6A 1S6LA 3I53A 2MA3A 3WTTC 3BP8A 3RKXA 1NHAA 2ETHA 4CXFA 1EH7A 3E6CC 5HLGA 3ABUA 1KGSA 1LEBA 4G7ZF 3LWFA 3C7JA 1U3EM 2CW0F 2OU2A 4A6DA 1O3QA 2FRHA 3WTVC 4M73A 3N4MA 2DFIA 1HW2A 4KYWA 1Z6RA 5IT9K 4MQ9F 2HDCA 2A5YB 3QP5A 4A5NA 4L9JA 1FLIA 4IRHA 3KFWX 3R0AA 4Q47A 2DTRA 4U88A 4KDPA 5LHHA 2VOPA 2P5VA 5FGMA 1Z05A 2STTA 2DT5A 2XKPA 4EV0A 1FNNA 2K4BA 3R60A 3G3ZA 3C3WA 5IT3A 2RC4A 3V8KA 4OMZA 3ROUA 2KIUA 4WXCA 4Y17A 1A04A 1QZYA 3BJAA 3R6SA 2L4MA 4Q5SF 4PCQA 1R1VA 1I5ZA 3KEQA 4U0WA 2LF8A 1XCBA 4XRFA 1H9TA 3IHUA 3GX4X 1FP2A 1FT9A 3B73A 1FSEA 1HXDA 1T0FA 3ZMVA 2H6CA 3FM3A 3K1PA 1UCRA 2XVCA 4UV8A 5FD5A 2P6SA 2OQGA 1JXSA 1ZRCA 2FSWA 3B02A 2L01A 1J0RA 1SFUA 3V4GA 5BQTA 4CHUA 5HVQC 2NRAC 4HAMA 1YTYA 5TRDA 4L9NA 4RB3C 5LBQA 3GVAA 1KA8A 5ICFA 2AS5F 5HOOA 3OV8A 2ISYA 3CUQB 3VFZA 4WX9A 1F4KA 1ZH5A 1FWZA 2EV0A 2K7LA 1W7PA 1SMYF 3TOBA 4QWQA 4FX4A 3L00A 5LHGA 3MZHA 2HTJA 5E1ZB 1OMIA 5LGNA 1KU2A 3TO7A 1P92A 1IXRC 5ILUA 2NNYA 4RGSA 4EJOA 5K5QA 4EGZA 1ON1A 1ZG3A 1YW9A 1KU3A 4Q4ZF 2HQRA 3F23A 5LLQA 2P4WA 1ZRDA 3C18A 4ENJA 1K79A 2ZMEB 3EYIA 4N9HA 1XSXA 3HHHA 1S7AA 3BWGA 2NYXA 5D4SA 4BAYA 1ULYA 4ZYHA 4AD9A 2HYGD 2GWRA 5HDGA 3MEXA 5J8FA 3HTSB 2QVOA 2J5PA 5E18F 4ESJA 1TW3A 1YS6A 2JTVA 4EM1A 4KICA 4BHCA 4IXAA 4MEXF 1ZGAA 4UVCA 3ERED 4XLNF 5K5OA 1LNWA 2PEXA 2QYOA 3HSFA 5JFRA 1U5TA 1U2WA 2ELHA 2Z99A 2GXGA 2PBIA 1BIAA 2CO5A 3KLNA 2DK5A 3WG9A 2Y75A 4O6JA 1OPCA 3EUHA 2MD5A 4HDUA 2Y48A 3JAMZ 5BPIA 3GXOA 3FF5A 3CTAA 1FYLA 1FP1D 3O2PE 1KYWA 5ILSA 5D5XB 4HYEA 4LB6B 1EH6A 4XLPF 4HF0A 3DKWA 1YG2A 3T8TA 1IN8A 1WQ2A 2QWWA 3HRTA 3F8BA 2M45A 3JSPA 1O3RA 3VB2A 3TOAA 1YW8A 2HYFA 5D5VB 2IA0A 1OYYA 4P9UA 4B09A 4L9VA 4KIFA 1U5TC 2YSRA 2B0LA 1I27A 4BH9A 2P7CB 4EJTA 1SMTA 5JVTA 1T39A 3P9KA 4OINF 4KIGA 4YIIA 3HOSA 1BBYA 5DDGA 1BC7C 4N0BA 3J80K 1R5HA 3ECHA 1BOAA 4CZZA 3TGNA 1B4AA 1Z7UA 3CO6C 5E17F 3IKVA 1BI2A 4LLNA 2C6YA 2VODA 2PMHA 1G3TA 3F3XA 4UVBA 2YU3A 3KP3A 5K1YA 1P2FA 2H27A 2QBYB 4OOIA 4S05A 3KZZA 3HHGA 4GGGA 1IF1A 2GIVA 3ZMTA 5CVRA 1T2KA 3RTRA 1TNTA 2RV8A 1GXQA 4I0AA 5D5WB 1ZARA 3FXRA 2YX7A 2XKOA 4EM0B 2L02A 3KP4A 1WRJA 1BN5A 2LKPA 2HR3A 4RAYA 4ASNA 2GAUA 4MEYF 3EQLF 2XAGA
chains in the Genus database with same CATH superfamily
1JUSA 2IXSA 4XL9A 1J09A 4OMYA 2E1NA 2DA5A 2KIMA 3GLXA 4R79A 2ZNZA 3DBLB 2R7TA 3WGIA 1J75A 1V54H 1KQ8A 2PFBA 3HSRA 2XRLA 3L7WA 2IA2A 4X6AJ 4XKWA 3I64A 3ONQA 2K3PA 2ACJA 3KEOA 1TT5B 1XMAA 1MD0A 4LG3A 1KONA 4ZDLA 1E0EA 1TWFJ 4FE4A 5EDNA 5ERIA 1W0TA 3ML6A 1Y8RB 2HS5A 3D5SC 3S8PA 2R5YB 3K1MA 1FTZA 3UR3C 3I54A 2XSJC 2JA7J 1U6GA 5E8IA 4GFBA 1BIBA 5FJ8J 1PUFB 4EM2A 1W36C 4E7JA 3RKYA 3ABMH 5JVGF 2PI0A 1LEAA 1S3JA 3BQYA 4PJLA 3P5JA 1W0UA 1ETKA 1R00A 1LFBA 2QKLB 1RUNA 2GQQA 3ZN1A 4G12A 1N25A 3BQZA 4YIRX 2QGUA 1D0ZA 4ZTJA 3BG6A 2HPMA 1ZG5A 2NXNB 2BGCA 2KT0A 3HOXJ 3GZNB 2ZO4A 2R7QA 5DUIA 4M9XA 1I50J 3RPQA 2DA1A 2PJRB 4IX7A 2BZTA 3EETA 4L18B 1JT6A 3CUQA 4BQAA 2VASA 4IHTA 2V9VA 3KPHA 3CDLA 3HUGA 2ZJQF 4BU2A 1E3OC 1TWCJ 3BC8A 5GPAA 2ZKZA 4CYCA 3BR5A 5J4VA 2MC3A 2LD5A 3ZQLA 2EILH 4MGRA 2CQQA 3S1MJ 3KETA 2JA2A 4EATA 1YITI 4BE0A 4UUSB 2CFOA 3SQNA 1MMAA 4UVAA 2YR2A 3HJEA 2H8WA 2NVUB 4LK1F 4RAZA 3V7SA 2FEZA 4IQJA 2DMTA 3RPUA 2HGCA 1LUJB 1NH3A 3ECOA 2WAQN 3JTHA 2ISZA 3ELKA 1F1ZA 2GBYA 1OISA 4BQQA 1MH4A 3B6CA 2FNAA 2Y69H 2X9DA 5IP9J 3O8GA 2ZBKA 1YHQI 4ANJA 3QOPA 1HOMA 1OCZH 1SAUA 4L5IA 4CA0A 1K7AA 1Y56A 2DDAA 2KISA 3PQKA 3EPZA 5DCFA 4LLGF 3VEPA 2V1DA 2ZJPF 3CCYA 4IO9F 2XGXA 2Z33A 2KJCA 1RI7A 1FYKA 2M2EA 3GLLA 3DF8A 4XKBA 1FSHA 2PN6A 2ZMEA 2HYJA 1BR1A 4I2OA 4HX4A 1X1BA 4HLYA 3I9V2 3AL0B 3C2HA 1MMGA 2XAJA 5ILVA 4BY1J 2LFBA 1SFKA 2IS2A 2OBPA 1C0WA 2LYCA 4M6XA 4F92B 2A07F 1DPUA 3LFKA 1HSJA 2LREA 1QZZA 3FMQA 3JRCA 2HWVA 5HLTA 5F0HA 3OYDA 4J00A 3W6KB 1KU7A 2Y9ZA 1P7IA 1J5YA 1RNLA 4ESBA 5CVJA 1BR2A 1Z3XA 2KP6A 4Y13A 1VFCA 2A05A 2A68F 3E6MA 3OYIA 4KNYA 2OAZA 4XORA 4ZYAA 4NC7A 2VXZA 2XAUA 3NRVA 3CCRI 4FX0A 3HG9A 3HBLA 1IDZA 3SEQA 1ETXA 3OMYA 1HW1A 2E36A 3J81Z 3WU2C 4XMYA 2R3SA 4GCVA 1I39A 4ETSA 1TQMA 2BXYA 2WA0A 3TW6A 4DNCA 3PIPF 3ZQGA 1QPIA 2EQRA 2O61A 3NWTA 2OF7A 1KYZA 4Z2YA 1U8RA 1OCOH 2MABA 2EA4A 1OJLA 3PNTA 3QPSA 1LPQA 3J7YJ 3U9GA 5BMZA 4G7OF 4AUXA 3DP7A 5BPDA 2CV0A 4G6TB 3WU1B 3BJOA 2JRTA 4CSWA 2ZJ2A 3DFGA 2HDWA 1D8KA 2HKOA 3J7AO 4CYDA 1ODDA 2MW8A 2LY9A 1MMSA 4V19K 1F36A 4HOBA 3OS0A 2ZMEC 3SFZA 1VF9A 4NQWA 4BXUA 4ZH4F 1MBHA 2EZKA 1S72I 1CQTA 5C4JJ 3BDDA 1HBXG 1HCRA 1YX3A 4YIFA 4HSTA 4RB0A 2LR8A 5CVVA 5CQGA 2B63J 4JP0A 3BR1A 1P7JA 2LDUA 4AU7A 3RCOA 1U9NA 1K6OA 3DTKA 4RB1A 1X1AA 2ZCWA 3L2UA 5J1RA 2NAZA 2NS0A 2W84A 5IOYA 3KLOA 2X48A 5IYCJ 5HS8A 1YI2I 2G0EA 3RKWA 2XAQA 2LBFB 2OA4A 3K1NA 3PSIA 2YUSA 2LG4A 2MC4A 3GTMJ 2FE3A 3M8FA 1H89C 2KDOA 1QGPA 2VT2A 3I4MJ 1WCMJ 1B9NA 2VUMJ 4LIVA 3OS2A 2HPIA 3FZVA 2CUEA 5HDKA 2DPUA 2HQNA 2X1CA 2UXNA 1YQAA 2Z9OA 5A2QZ 5LEJA 1H9GA 3L2VA 5DM7F 4RMNA 1S7OA 4JX4A 1JT0A 4A93J 3CC2I 1L3LA 5HLHA 3H5AA 3ISPA 2FXAA 4OU0A 2GZWA 4DIQA 5GTIC 2Y9YA 1OCCH 1Z6TA 1XD7A 2OZUA 4M74A 4IRIA 3E97A 1HQCA 2TDXA 2LY1A 2ZNYA 4I01A 3KZYA 2KHMA 1JKRC 2VC1A 1TT0A 1X19A 4ITVA 4M9ZA 1UFMA 4KUMA 2MSYA 2XAHA 5GPCA 3M1EA 3IH3A 3CCMI 5KVRA 3R4KA 1W5TA 1FBSA 4A3EJ 1BC8C 3BT9A 3QU6A 3H9QA 4WK8F 5LFAA 3TBIA 5L3CA 1BOBA 4F7ZA 2FJ1A 3BCAA 4CZCA 2QBYA 2R7WA 2OQRA 3PUBA 1MBGA 1W7PD 1WGXA 3HYIA 5EGOB 4XN0A 4MTDA 4C2UA 3RYPA 4UY8I 3I5UA 4A0ZA 4A3GJ 3VDXA 2STWA 1ZR2A 3AAFA 2FA5A 2K85A 3OL4A 1UG0A 4ZYDA 2KZGA 2O03A 1MDMB 2E1MC 2ZC2A 3DPLC 5H6RA 2E2HJ 1JGGA 2HNHA 4IF4A 3TO9A 1BJAA 2AXLA 5E1XA 1R22A 1UHMA 3P9CA 2EB7A 4D5FA 2K40A 3U2RA 2P0WA 1B6AA 4Y3OA 4GRIA 2IP2A 4KN4X 2M8GX 5IY5H 1XSVA 2IVMA 2WY7Q 1UMQA 3QYEA 1VQNI 2O8KA 2MLGA 4BHBA 2CGPA 2Y30A 3OYGA 2JPBA 3BZ6A 3BR0A 2LH9A 4B3XA 3MKWB 3SEZA 3ZMDA 5H20A 4S04A 5J8CA 3CC4I 2F4OB 3WGHA 2VQCA 1YIOA 2RAEA 2QZ8A 2EPFA 4ENNA 2IRFG 2Y0SN 2R92J 3DQVC 1FYMA 3JAMK 5DEQA 4FHTA 3F8MA 5E20A 1P9QC 5FFZA 1WJBA 3UKGA 5IT9Z 1UAAA 3H9JA 2L3DA 2ELJA 4EJWA 2M8EA 3FXLA 2RKHA 3A4CA 2VJ4A 2V4JC 4GYIA 3LMMA 2ZFUA 1BI1A 3PFYA 2FOKA 2QF7A 2H09A 1MNEA 3G6EI 3ABTA 2BE5F 4I0BA 2XHKA 5F6FA 3GFJA 3G1MA 4A0XA 1XB4A 1VQKI 2Q8KA 3LQRA 1ZKGA 2XV4S 5GAHJ 2EFPA 2HU9A 2R5YA 1A31A 1LVAA 3JRDA 1A35A 5DD8A 3RSNA 3Q9SA 3M7GA 4ZDPA 2B7EA 5DTDA 4FT8A 2BW3B 3QYFA 1PUFA 4EQQA 4M3EA 1D1BA 2R7RA 4CH7A 5FKNA 1HSTA 4A3FJ 3K4MA 3M8JA 4Y52J 4YFXF 2VT3A 3MD2A 1QNTA 2E34A 3JW4A 3H92A 4MIMA 1KQ0A 2NNNA 5GP9A 1JHFA 3S3NA 2K02A 3HOTA 4C30A 4UUVA 2VPLA 4UB6C 1OKRA 1AWCA 3JRGA 1YYVA 3SDGA 4XICA 1OYWA 1WI9A 3ZMZA 3BTIA 2H94A 5BOXA 1X2MA 2DOFA 2PJRA 4BJ5C 1XDSA 3QPHA 5J1YA 3KYCB 4ESFA 2RQPA 2ESHA 2CG4A 2F5DA 2L7ZA 5EEGA 1TWHJ 4CCKA 5IP7J 3CCUI 2AHQA 1AHDP 1X2NA 1F9NA 2P6TA 4P96A 5IOZA 2JA5J 5M3MJ 3WTUC 3OYKA 2R5ZB 4CCMA 1UB9A 2VB6A 4UUSA 3V8JA 1IN7A 4XIDA 2L7KA 5CYVA 1JTXA 1XGOA 1MZBA 3K4BA 3C2GA 1XN7A 3K0LA 2M30A 4MO7A 1R36A 4HA8A 2QSFX 4HDVA 4TV7A 2P8TA 2KIFA 3GFIA 1TP4A 2A3SA 5DD4A 2EINH 3FXKA 2DI3A 5CKTA 2FBIA 3AG4H 3IH4A 3S3OA 3CF5F 2G9WA 4PJNA 2Z5UA 5K7ZA 4HQMA 2LF7A 2XF5A 4RGXA 5GAEJ 2L7FP 2PLYA 4XNFA 3CCEI 4IVNA 3HOWJ 2JA6J 4NB5A 2JRMA 2M0CA 1CGPA 3DEUA 1I1GA 1G3SA 3V8LA 1FPQA 3I71A 2CWEA 1X4PA 4F52A 2VXDA 1ZHFA 2EH3A 2HQ5A 2ICWG 1LB2A 2KLOA 4BJTA 2IPQX 2A61A 1MBKA 3H3UA 3KYDB 1HKTA 4HSRA 4G6DA 3ZQFA 4YG2F 4LOCA 2DQRA 1Z21A 1ON2A 3Q3SA 2DW4A 1Y0NA 4LJZF 2X4HA 5DV5A 3ZP5A 1HA8A 2XIGA 2E35A 1TLHB 4NC8A 2IGMA 3R61A 4S0HB 2W24A 2J5OA 4XRSG 3HXLA 1R23A 2M87A 3D5LA 1QQIA 4GYGA 2LTPA 3MMYB 3WGGA 3HSEA 1XTAA 1H88C 2DA4A 2E1OA 2JSPA 4YFKF 2JWTA 4P9FA 4IHVA 1SFOJ 3EUHC 1HW5A 1MJ9A 1WHUA 3FWEA 1Z91A 2NOJB 1R58A 4I99C 3CLOA 4LFUA 5B1BH 3X2QH 3GTGJ 4PJ0C 1TC3C 1K78B 1G4DA 4G8XA 5FLXK 1MBEA 4U0YA 3F9KA 4BL0B 1SD6A 1PP8F 1I6XA 4B8XA 3K9TA 3FXMA 4HX8A 2B9SA 2G7UA 5IP6A 2ELKA 2K3FA 2QQ8A 1S29A 2LC2A 3OIOA 1UHWA 3RJPA 1FX7A 5D4RA 2ZFWA 3GYHX 4JOMA 3O6BB 1Y1WJ 2RVCA 1VQ8I 1X4OA 3F8CA 1JHHA 3CCQI 4XLAA 3JSOA 1V5EA 4Q48A 4FTHA 3AL0C 3JRHA 1ZTRA 1R71A 4U0VA 3K4KA 3TP0A 2DOEA 1N77A 3ZXSA 4DYCA 4WXDA 1CF7B 3NAUA 5LEKA 3Q0VA 4XQFA 2R7FA 1UZCA 2F2EA 2HVQA 5JHFA 5F0FA 2XDVA 5BS6A 4IL6C 4UNOA 2MD0A 3P7NA 1V4RA 4PFPA 4DZPA 1WZ2A 2K9LA 3OOPA 1JGSA 4M6YA 4D7MA 4M3DA 2LBFA 4D0PA 2ID3A 3VODA 4XR6A 3LNQA 1ITYA 3SHFA 2MH2A 5C3EJ 3DTEA 3T5XA 2WB1A 4XN3A 4BACA 3CP2A 2H6BA 5LD2C 4BYYA 1FIAA 1LDJA 2VONA 2DT7B 2RDPA 1R7JA 3CQZJ 5KNLA 1T6SA 3WU0A 4XBFA 2DMPA 1QO0D 1USTA 4KJZA 2M0MA 2LMDA 1B8IB 2K4JA 1T56A 3CUOA 2FF4A 2GOMA 1Z9CA 3E5XA 4AVZA 3L9FA 2LNBA 3A1YA 2UZKA 2HOEA 4A3CJ 3HTUA 1A36A 2PJPA 2W4SA 3MCZA 4IJAA 1MBJA 3GFMA 4A6EA 3IRQA 2V9KA 2ZB9A 3GMEA 3F0CA 1R5GA 4JQFA 3Q0UA 4LLLA 3MKYB 5M5WJ 4RB2C 3GTPJ 1A5JA 4MQVA 3LSKA 1LKXA 3VYTB 2JQ7A 4E6KG 4U7DA 3U1DA 1TTYA 3VSLA 3RQIA 4BQNA 2HKXA 3K70D 2E2JJ 1WFXA 3J7ZI 2ZXIA 4OIQF 3FXQA 5D8LB 2VQHA 2NVYJ 4DYQA 3PIOF 4ENMA 3G1LA 2Y2ZA 4M3GA 2MH9A 2HZTA 3OYNA 1ZAOA 2UUZA 1SFXA 2EIMH 1Z7LA 1KU9A 2E5ZA 2KFDA 1O3TA 3NQOA 4I98B 5EJCA 5F08A 4EJUA 2M34A 4XOPA 3IAM2 4CCLA 5EGOA 4Z6YA 3J80Z 3ZPLA 2Y31A 3SZGA 4A5MA 3S2HJ 2VL8A 2NOGA 4G94A 5KCMA 4ON0A 2DXIA 4WF2A 4IOAF 3E6BA 2JJ7A 4PGHA 3RPUD 3TO6A 3VYRB 3HRUA 1F43A 1MDMA 2EIKH 4EVIA 1YFHA 1SAXA 4XLCA 3ZN0A 1FBUA 2OPTA 4JK1X 4BEHB 2R7OA 1VQ4I 3GEZA 4XONA 2O5RA 1GXPA 5F04A 3F21A 3KE2A 1ZN2A 3E6DA 1H8AC 2VBXA 2WWYA 1PYVA 2ME6A 1AOYA 1IXCA 5BNGA 2E7XA 2AO9A 5FKMA 1TW2A 1SVMA 2VPRA 2I8DA 3GWZA 2P5LC 3DKXA 2DA7A 3S1NJ 2VOOA 3LQQA 3N97A 1H0MA 2QEXI 3SYTA 5LRSA 3I55I 1F5TA 1FOYA 1S9HA 3C1DA 3ESWB 5EZHA 4BGDA 3DLAA 2KPMA 1IO2A 4NNJA 4XOTA 1IZ1A 3FM5A 2FBHA 2LK2A 4XSXF 2CUZA 2JSCA 4DQ2A 1MW7A 1X3WB 3ZQHA 2K86A 2PQ8A 4AIHA 3F6OA 4D9JA 5F1RA 1U9OA 4M72A 2D5VA 2R7XA 3HB9A 5HS9A 3M07A 4N9IA 4YEJA 1ZRFA 2M4KA 4RLQA 2EA2A 5K7FA 3IKTA 1E2XA 4AWXB 1I3AA 4XKVA 1NK2P 4F93B 5J3LA 5FROA 5B5EC 1XMKA 2QUFA 3LFUA 3BTJA 1LQ1A 4ZC3A 1K4TA 1E3HA 1GV2A 3K4JA 3TEDA 1FMVA 2O6GE 4J01A 3TDZC 2V6EA 4QPQA 1B9MA 3I0TA 1Y0UA 2M5WA 3ZQIA 1ORKA 3CLQA 5ICEA 2CQNA 2FQ4A 4GO1A 3U1KA 2WB1N 2DAOA 2BW3A 2DK8A 4B1RA 4EJVA 3F8FA 4II2A 4OAYA 5CJ9A 2VJJA 1G2HA 1D5YA 3F72A 3K70C 3D0SA 3FMRA 1IDYA 2HTSA 2KRFA 1FOKA 2DJNA 2FBKA 4ZZDA 5K5RA 2CH0A 1IUYA 4B4CA 3M9AA 2L4AA 1X58A 2BVMA 3CUQC 3HGYA 2GXAA 3L2RA 2VJIA 3GF2A 3LAJA 3ZQ7A 3HRMA 2WADA 4IHYA 1FY7A 3RZOJ 2WC2A 3OYLA 4KA4A 1P4XA 2JVGA 4PGGA 1SFEA 3T0YA 2MLKA 3GUDA 4MHGA 2L9NA 1S7EA 3BLYA 5M5YJ 2NVXJ 2K27A 2BBYA 1YO5C 4A2UA 3GBGA 3E0JB 5ICCA 4X0GA 4BQOA 3Q9VA 1XDUA 4IZZA 1DP7P 4IPAA 3OYJA 2IEKA 1D0YA 2Q0OA 3BY6A 3EYYA 2Z16A 1XSDA 1ETVA 1FMWA 3IL2A 1XS9A 1WJAA 3DPTA 5HS7A 3PFIA 1DDNA 1IN6A 2VQLA 4RGRA 2DO7A 5FRNA 3W6VA 3DPUA 2R5ZA 1TBXA 1W5CC 4W1UA 3K4NA 2HOSA 2Q2EB 3WTSC 3CC7I 2D1VA 3PNVA 3TMOA 4PK4A 1Y1VJ 2XROA 4BXXJ 6PAXA 5GADJ 2Y0SA 1PDNC 3TL4X 4A3KJ 4E7HA 2LOOA 5AIQA 2E2IJ 2O3FA 3OY9A 3JRIA 2XASA 1FOXA 9ANTA 2OV7A 2V79A 2VIXA 3F8NA 3E5UA 3VOEA 1L0OC 1HF0A 2JN6A 3LOCA 3O8HA 4KT6A 4M71A 3JRFA 1PP7U 1BI3A 3BTLA 3PL8A 4HF2A 1Z3YA 2JUGA 1RETA 2DPDA 1OFCX 1JUPA 2V7FA 4MFDA 2BY0A 1QHHD 3O3KA 4HLXA 1D1CA 4CDGA 2COBA 2MBFA 2YX4A 2BVLA 3CMMA 3BR2A 3HKZA 2X0LA 1WJFA 4Y33A 1R1TA 4OAZA 3JTGA 3CMAI 3M3YJ 1D0XA 3BOQA 1BI0A 3W2WA 3KP2A 3OYHA 5E8GA 3FK6A 2UXXA 3GFLA 4PSXA 2L9VA 3IP4B 4G9YA 1Z1DA 1GLNA 3K69A 1J9IA 2JPCA 5HDNA 5HNHA 1EH8A 3HRSA 1T95A 1VQ5I 1ACIA 4AC0A 4EGYA 2ECBA 3A0HC 3WTWC 1LVKA 1DUXC 2XPWA 2R7ZJ 1U8BA 4AIJA 5IPAA 1NG6A 1VQ6I 1JKOC 2QQAA 3KP6A 2VBWA 4NBQA 3U21A 2RGVA 2KQRA 3EUKL 1R49A 1FIPA 4HNVA 4F3QA 1ZK8A 4NC6A 4Y15A 2VBZA 3I58A 3MQ0A 4H4KC 1TWAJ 3MZYA 3FK7A 4DBQA 4HW0A 3IRRA 5CQEA 2Y0MA 4U7BA 5JI6A 3HM5A 1K78A 2ESNA 5IYDJ 2AQEA 1FZPB 1TQPA 1WSUA 2N8GA 2O8XA 5E3MA 4R8HA 2I5UA 2CRGA 3C2BA 4GDFA 3WTXC 2M7BA 2LSOA 2I10A 4G7HF 3MWMA 2QLZA 3F6VA 4PFOA 2JA8J 4ENKA 5DYMA 5CVIA 1T33A 2HXOA 1UELB 2H1KA 4LB5A 3QQAA 2IT0A 1WH5A 1W4MA 3CMYA 1YS7A 2R4GA 3G4SI 4LG0B 1D8JA 3OOUA 1CF7A 3GO5A 1R4MB 5FO5A 1VQ7I 3ZMUA 3IWFA 2P5KA 1W1WE 3K2ZA 4RS8A 3NEUA 5DS9A 2FU4A 1QU3A 4KN7X 5JLWA 5LGUA 1RZ4A 1P4AA 1SVOA 2VE9A 5E1WA 2L2OA 2DBBA 1P4WA 3RYRA 1JI8A 1SANA 2FMLA 3FBIB 2P7VB 3G71I 3K10A 3CCJI 1RC9A 2FNPA 5L3DA 4O5VA 5GAGJ 2OTJI 4NUBA 2BEOA 3FHNA 5KAFC 1XCVA 2W25A 1X1CA 2FUG2 4L5JA 1R4NB 3V7CA 4C3IJ 4A12A 5DCMB 2LKXA 1ONVA 2DYSH 2IGNA 2HOTA 1RR8C 1G6NA 4QLCU 2EFOA 1XGNA 1S5LC 2V6CA 2EJRA 2DTZA 1FEXA 1QZEA 3GZ5A 3I4PA 2VKDA 1OR7A 1DGRM 3F22A 1B8IA 2UWMA 3PSFA 1G3YA 5C44J 3OL3A 5C4XJ 3QAHA 2V9PA 2QA4I 2OCCH 1XGSA 3IAS2 2M1BA 3L2CA 1SC7A 1O3SA 1JE8A 2BXZA 2DLLA 3FXUA 1IV6A 2WTEA 1QBJA 3QPTA 3QU3A 5J6XA 5ED4A 2EFQA 3RZDJ 4MNUA 3GCMA 1DP3A 2OCEA 3BJ6A 3E3VA 4L9TA 1VTNC 4BUPA 3LSJA 2X6OA 1IXSB 3CJTB 3ERMA 3KP5A 3QODA 5LGTA 1X1DA 4M9SA 3A02A 5D5UB 4O3MA 4PZJA 3LSPA 3S1RJ 2A6TA 4KT5C 4PJMA 1NK3P 3QRFF 4BJ6C 2NVTJ 3HKZN 4P5OA 2BYVE 4QTRA 2IBDA 3PJRA 4ZJZA 2XB5A 4NDLA 2BY2A 5DUKA 3A0BC 1J7KA 2HFHA 1IRXA 3BCBA 4ZDOA 4RM3A 1DGWY 2CSOA 3BG5A 3JRBA 2CS3A 4WWCA 1OQYA 2EZIA 1D3YA 2PMZA 2EBIA 1OYIA 3E7LA 1YLFA 1Y6IA 2WAFA 4IHWA 1XMXA 2DN0A 3PQJA 2M7AA 3DWLE 5HLIA 4Y7NJ 2F5FA 3I59B 3DEWA 3LSGA 5KHDA 1IRZA 1WKMA 2ZXJA 4E7LA 2XAFA 3BR3A 1EF4A 2F5EA 3DU5A 4BEHA 4AIKA 1OR7C 2HDDA 3GTQJ 5DM6F 2W57A 4D1QA 2CQXA 1BA5A 4HNTA 3ZMSA 5EG0B 4PJJA 3ZQCA 1W5SA 2DA2A 1LJ9A 3AG1H 2D2WA 2X1EA 3FKIJ 1U78A 4MFEA 1SD5A 1VQPI 2GXBA 4BBRJ 1B72B 1UHSA 4A3BJ 4E7IA 4DBRA 4RLFA 3RIRA 5FKLA 1WWXA 3QPLA 1I1SA 1FC3A 2TRTA 1BM9A 1TL8A 3FMSA 3TQNA 2OTLI 2BY3A 1SEUA 1I3QJ 1QPMA 3MAJA 4ABZA 2MYSA 3DEEA 4AVPA 1REPC 4A3IJ 2EFNA 1ETQA 1G59A 1STZA 1AU7A 4G6QA 4XSZF 4OIOF 1LFPA 5ICGA 4H0EA 3FHZA 1MSFC 1IW7F 3RQ4A 1K61A 1T8IA 3ULQB 3HDDA 1X1PA 1RKWA 3AG3H 3OYMA 4I76A 5H2FC 5D6FA 2EV6A 5AIPA 4ZYEA 2IW5A 2O7OA 2CMPA 4XKCA 4BDYA 3I4NJ 4PUSA 1FJLA 4XK4A 1E17A 4IRGA 3ABKH 4OIPF 1SD7A 2DJIA 4BHPA 2CYYA 3BPXA 2K9NA 1USSA 4DW6A 1IGNA 3BR6A 4W97A 1VI0A 2IA1A 4D7NA 2ADUA 4E4HA 3H0GJ 1P6RA 4CO8A 4CGZA 1MGTA 3EDPA 4UV9A 5B66C 1FBQA 4AM3A 3FXOA 4FISA 3PO3J 5JHUA 5J1UA 1QVUA 1XGMA 4GXOA 4WXHA 1ZGJA 2RNGA 2HOAA 3IC7A 2EWNA 3ZRGA 1B59A 4DGWB 4EEFG 5JR3A 2RNJA 4BY7J 1PUEE 2X51A 1YJNI 1QA6A 1IRFA 3G1OA 3MZ8A 2CQ7A 2L9RA 4HBLA 1BW6A 5D6EA 3WE2A 2HI3A 1A6IA 3PO2J 2R7SA 2A6EF 3RKQA 3CDIA 2A5WA 4RBOA 2KRHA 1JKQC 3FDYA 1T98A 2AXTC 3PNYA 2DA3A 1VQOI 3HC7A 3Q0WA 3GW2A 3QP6A 2HEOA 3K7AJ 4V2GA 3ASNH 5FD6A 3DBRB 3PM1A 3OYBA 5CLSA 3TDUC 2VBYA 3NWSA 4OIRF 2XPUA 2E7WA 5E79C 3MFKA 3FX3A 5FFXA 3SJMA 2V1XA 3CJNA 2F48A 1DPRA 3LA7A 2NS7A 2A6HF 4ZYGA 3HL2A 1LE8B 2Q2EA 1GHCA 4UB8C 3BG9A 1GVJA 4KIBA 1LDDA 1WPKA 1ZYRF 2IJLA 1WJ5A 5D8KB 5F64A 1AKHB 2PMZN 1Q1VA 1SVLA 5K7HA 2X85A 4A3LJ 1B1BA 2COMA 2XF6A 3IUOA 2XRNA 4LMYA 2LY2A 4L0ZB 3ASOH 1EA3A 3M8EA 4OWRB 4UUTA 5EF6A 1Z0XA 1ERDA 2FMYA 3JCUC 3H9GA 2QQ9A 3DKYA 3L2WA 1YRNB 1AA7A 4RAFA 4K2EA 2XGCA 1N75A 1ZLJA 2QQBA 4IOCF 2D1HA 4C3JJ 4UHTA 1V55H 1JJ6C 1O7FA 1NG7A 4QPOA 3S2WA 5EEAA 3DXJF 2LKSA 3CCSI 3K4CA 3WTZA 4HQEA 4C3HJ 1HKSA 1WI3A 4JYKA 4XLHA 3M4OJ 1MNDA 2OD5A 2VKEA 3S93A 3JREA 3WHCA 5TGTA 2JZYA 2Z3YA 4R1HA 2RN7A 1V3FA 2DT6A 1NTCA 1ETYA 2XUBA 3S3MA 1LDKB 2LLKA 2OZ6A 3KEYA 5J4YA 2XSDC 5F0CA 1O7LA 2ZXHA 2K5CA 3HIFA 1MJAA 2IGKA 2QSHX 2EFWA 2H1LA 5JLXA 2HZDA 2WBMA 2QKMB 1R9TJ 4FE7A 4JBAA 4A3JJ 2AQFA 1MKMA 2F4IA 2KKOA 2VN2A 1IAWA 1RUOA 2QENA 2VJ5A 5EEHA 2L9SA 1LFUP 1VQ9I 4CCJA 3HPHA 4M3FA 4I09A 3J7AY 3OR1C 2BOLA 5LRRA 5CVUA 4KMFA 1M1EB 3QOEA 2CQKA 4LK0F 1SD4A 1W7PB 5FKKA 1RIOH 1MSEC 2JVHA 3H36A 3MVPA 2GA1A 2D45A 4KFCA 3GTLJ 4ZZLA 1FTTA 4RM2A 2CUFA 3MKLA 3S2DJ 3WODF 2L54A 4HX7A 2EK5A 2ZSIB 3VPRA 1HKQA 5L3FA 1X3UA 3WE3A 3IV5A 2G7HA 2XB0X 3AKZA 2GA2A 1JUMA 4I02A 4E70A 3E1SA 4BKXA 5GTHC 3KCCA 5L3GA 1YJWI 1TZLA 4LG0A 3H1CA 2L5QA 2MFZA 2GOXB 5FLXZ 2DU9A 4LD5A 2M4GA 2A69F 5L3BA 2OJED 1D5VA 2JT1A 3FKJA 3LA2A 2VC0A 4RGUA 4A0YA 2E1CA 3LSTA 3LA3A 1IUFA 1JTYA 4N4NB 3HOZJ 1R6RA 3LSIA 2CV1A 1XC5A 4CICA 4DJAA 3J81K 1OCTC 3LSRA 1Y8QB 5F27A 3V7RA 3ZGKA 3BROA 4BNCA 3BG7A 3M1CA 4HG2A 2DODA 5DCMA 4B48A 3TKYA 2EZLA 3T1BA 5LHIA 2PMUA 4IKFA 1J2XA 5L3EA 3T8RA 3WG7H 3IH2A 2W48A 4I7HA 3HOUJ 2FQ3A 5KK1A 1EV7A 3SZTA 2CW7A 3REOA 3P9IA 1Y39A 1R1UA 2JMWA 3TW7A 3G73A 2E5NA 1Z67A 4X1EA 1IN5A 3K4LA 3L2QA 5FRMA 5H6QA 2YS9A 4HV5A 2VE8A 3E5QA 4L0YB 3G2BA 2GM4A 1S8NA 1U5TB 2WY8Q 3WHBA 2QCOA 3B6AA 1MMDA 3GZ6A 4P55A 2FD5A 4PSWA 4C9YA 2BHYA 2CFXA 2EV5A 3K2AA 2QM3A 2VLAA 4XRMA 1O57A 1J59A 3VSKA 4CUGA 5IYBJ 2O9LA 1Q1HA 2VI6A 1IRGA 3OIQA 3S16J 2DQLA 2DCEA 2WV0A 1BL0A 1TQIA 1G3WA 3IWZA 3W6JB 1IN4A 4QIWN 3H3ZA 2X6WA 2RREA 1ZG1A 3Q5FA 2LP0A 3BPVA 2M3AA 4AYBN 3S17J 4YFNF 3I56I 3R0JA 5AONA 1BW5A 5FB2A 4B43A 4HZFA 4MTEA 3CO7C 3RDIA 2W85A 2YPRA 2R7DA 3I59A 2V26A 1QRYA 5A2QK 4QSHA 3SZPA 4NHJA 2O0YA 1YW7A 5J47A 3ZR8X 2V1UA 3QYBA 2WAEA 4PDKA 4WCGA 1TNSA 2ZXWH 3SXYA 1KQ9A 4BE1A 5EG0A 1EKEA 3HOYJ 1T08B 1ZLKA 3L09A 3S1QJ 1APLC 3FBNB 1GT0C 4IHSA 1IV8A 2KL4A 3RI4A 2DOAA 5TJJA 3LAPA 1B72A 2BV6A 3WTYC 2VKHA 4YRVA 2X6XA 3KP7A 4UXNA 2K9SA 4LGWA 5M3FJ 3KZIC 3CDHA 1ZREA 4BBSJ 2KJBA 3AG2H 5E3NA 3HOVJ 1T38A 3DV8A 1JJ8C 3COAC 4KMUX 1G8XA 2PG4A 2F5CA 3BZCA 2E71A 3LSMA 4EMSA 4HF1A 2E60A 4F91B 1MJBA 4HV6A 1S6LA 3I53A 3OSFA 1ZELA 2MA3A 5HODA 3N05A 3WTTC 3BP8A 3RKXA 1XG1A 2BHZA 1NHAA 4JX5A 2UV1A 4BXFA 2YU9J 2ETHA 4CXFA 4RAGA 1EH7A 1ETOA 2DMUA 5FKOA 4P1WA 3PUFA 4F55A 1WH7A 2XF7A 3E6CC 1Z77A 5HLGA 3ABUA 1JKPC 1XX5A 2OUMA 1KGSA 1LEBA 2HVSA 1IC8A 4G7ZF 5M5XJ 1ZGWA 1V5GA 3LWFA 2IGOA 3OSGA 3C7JA 3HPGA 3CD6I 1U3EM 4YELA 3NARA 3A03A 2CW0F 1FOWA 2OU2A 4A6DA 1O3QA 2FRHA 3WTVC 4M73A 3N4MA 1X3ZB 2MGQA 4FQGA 1YJ9I 2DMNA 1OCRH 2DFIA 1HW2A 4KYWA 2CV2A 2L0KA 4BE2A 3DU6A 1Z6RA 3OYEA 5IT9K 4MQ9F 3OS1A 2HDCA 1N78A 3OWTA 1HDPA 2A5YB 3K6GA 3QP5A 4A5NA 4D5CA 4L9JA 2HVRA 3ZCOA 3W2VA 1FLIA 4IRHA 3KFWX 3A01B 3R0AA 4Q47A 2DTRA 2GIZA 4U88A 4E7SA 4M3BA 4KDPA 3KIOA 1YE9A 4A3MJ 2CJJA 3ABLH 5LHHA 1ETWA 2VOPA 3TP3A 2P5VA 5FGMA 1Z05A 4HEA2 2STTA 2DT5A 1LE8A 2XKPA 4FASD 4EV0A 1FNNA 2K4BA 3R60A 4AIDA 3I3LA 3G3ZA 3C3WA 2ZJRF 5IT3A 2RC4A 3V8KA 4OMZA 3ROUA 2KIUA 1AKHA 4DZJA 4WXCA 4Y17A 1A04A 2BY1A 1XPXA 1QZYA 3LL7A 3GTOJ 3BJAA 3CF2A 2L4MA 3R6SA 3JRAA 4Q5SF 1K83J 1VZ0A 4PCQA 4IEJA 1R1VA 1I5ZA 5HNFA 1YRNA 3KEQA 4U0WA 4A3DJ 3A2KA 3HGGA 3H0DA 2F4MB 2DFHA 1PJRA 2LF8A 1VNDA 1XCBA 3EUAA 4XRFA 1H9TA 1HDDC 3IHUA 4LIUA 3GX4X 1FP2A 1FT9A 3B73A 1UG2A 2IAIA 2QSGX 1FSEA 2DYRH 1HXDA 1T0FA 3ZMVA 3AFHA 4E7KA 2H6CA 3FM3A 3K1PA 2CU7A 2W1OA 3FXJA 4B3AA 1UCRA 2XVCA 4UV8A 4CCOA 5FD5A 3MKZA 2P6SA 2NS8A 1I6HJ 2OQGA 1JXSA 1ZRCA 2FSWA 3B02A 2L01A 1J0RA 1SFUA 3V4GA 5BQTA 4CHUA 2DDBA 5HVQC 2NRAC 1K6YA 4DYRA 2VKVA 4HAMA 4HRIA 1YTYA 4HNUA 5TRDA 2XGEA 3BG3A 3VYSB 4KISA 4L9NA 3CCLI 2W82A 4RB3C 5LBQA 3GVAA 1RESA 3BTCA 1KA8A 3FISA 3OYCA 5ICFA 2AS5F 3S14J 4L5EA 2R7VA 3H3VK 3UNGC 2H8RA 4C2MJ 1PVEA 1TWGJ 2DMQA 5HOOA 4N4OB 3OV8A 1MMNA 2ISYA 2Q1ZB 3CUQB 3VFZA 3SDBA 1POGA 4I6ZA 4WX9A 1F4KA 3HUGB 1ZH5A 1FWZA 2EV0A 2K7LA 1W7PA 1WVRA 4CYCB 4MLOA 1MNMC 1SMYF 3CJQB 3TOBA 4QWQA 4FX4A 1RRJA 3L00A 5LHGA 3OYAA 3CCVI 3MZHA 4B44A 4LITA 2HTJA 5E1ZB 1OMIA 5LGNA 1KU2A 3TO7A 1P92A 3S15J 4BDZA 1IXRC 1MBFA 5ILUA 1VQLI 2IS4A 1T0FC 2IS6A 2NNYA 3CP8A 2K9MA 4RGSA 4EJOA 5K5QA 3JR9A 4EGZA 1ON1A 2FOWA 1ZG3A 1YW9A 2LVSA 2JK3A 1MIJA 2HXIA 4FCYA 3L1PA 2E19A 1KU3A 1ZQ3P 4Q4ZF 2HQRA 4U87A 3F23A 1YOVB 5LLQA 1IG7A 2EZHA 2P4WA 1ZRDA 3C18A 1RPWA 4ENJA 1K79A 1EJ9A 2ZMEB 3EYIA 4N9HA 1XSXA 3SFIA 2KRCA 3HHHA 1S7AA 3BWGA 2NYXA 5D4SA 4XRSA 4BAYA 1ULYA 2CUJA 4C2TA 3MN2A 2X6YA 1UJ8A 4ZYHA 1V5FA 4AD9A 3W2AA 4A69C 2HYGD 2GWRA 5HDGA 3MEXA 3OR2C 5J8FA 3HTSB 1ZR4A 2QVOA 3D1NI 2F5VA 2J5PA 4DOZA 5E18F 4CCNA 1YIJI 3HZJA 4ESJA 5TISC 1DU6A 1DQUA 2FX0A 1TW3A 2X1DA 2DA6A 3W3CA 1YS6A 2JTVA 2Z1DA 2KMUA 4EM1A 4KICA 3FIWA 4BHCA 4IXAA 1VQMI 1GVDA 4MEXF 3OIPA 1ZGAA 4UVCA 3ERED 4XLNF 3OYFA 5K5OA 1LNWA 2PEXA 2KZVA 3H35A 5B3SH 2QYOA 2XGDA 3HSFA 4KITB 4XLFA 5JFRA 2NVQJ 1U5TA 1U2WA 3H5RA 2ELHA 2Z99A 2IS1A 3CMEI 2HQAA 2GXGA 2PBIA 1BJZA 1BIAA 2ECCA 2CO5A 3KLNA 2DK5A 3WG9A 3VYUB 2Y75A 4O6JA 5EYRA 1OPCA 3EUHA 2MD5A 5CPRB 1QHGA 2Y48A 4HDUA 4JX6A 2V1NA 1ENHA 3JAMZ 5FLVA 4NQWB 5BPIA 3GXOA 3FF5A 3CTAA 1RR7A 1FYLA 1GDTA 1FP1D 1WJDA 4XLEA 3O2PE 1WJEA 2KIQA 2EIJH 1KYWA 5ILSA 5D5XB 3HEFA 4HYEA 3ZOBA 4LB6B 2WV1A 1EH6A 3BZKA 2Z2SB 4XLPF 4HF0A 5FLMJ 2CW8A 3DBHB 3DKWA 1YG2A 4V2FA 3T8TA 1IN8A 5F1JA 1WQ2A 3KX2A 2QWWA 3HRTA 3F8BA 2M45A 3JSPA 1BR4A 1O3RA 2M9HA 3DCFA 3VB2A 2F6CA 1OCPA 1YW8A 3TOAA 5E3LA 2HYFA 5D5VB 1IJWC 2IA0A 1OYYA 2W00A 4P9UA 4B09A 2E1MB 4L9VA 3DLLF 4KIFA 1U5TC 2YSRA 2B0LA 1RKTA 1I27A 4BH9A 2P7CB 4EJTA 1SMTA 5JVTA 1T39A 1K4SA 3P9KA 5KAIC 4J19A 4M6VA 4OINF 4KIGA 4YIIA 2R93J 3ZQQA 3HOSA 3V42A 2OC6A 1BBYA 5DDGA 1DU0A 1QVTA 1BC7C 4N0BA 3J80K 1R5HA 2PX9A 3ECHA 4RA2A 1BOAA 4CZZA 3GTKJ 2JUCA 3TGNA 4RDUA 1W36D 5J40A 1B4AA 1GUUA 2XC7A 1GV5A 1Z7UA 3D5RC 3GTJJ 3CO6C 5E17F 3IKVA 2MG4A 3LSHA 4E7ZA 1BI2A 2DFEA 4LLNA 2C6YA 2VODA 2PMHA 1U0JA 3DTIA 1G3TA 3F3XA 4UVBA 2YU3A 3KP3A 2VQGA 5K1YA 2L7MP 1P2FA 4IQ4A 3QWLA 2H27A 3VWBA 2QBYB 3CJRB 4OOIA 2ID6A 4S05A 3KZZA 2RQQA 3HHGA 4Y4RA 1HC8A 2XPVA 1YX5A 2W7NA 3CESA 2WAQA 4IHXA 4GGGA 2DFFA 1E3PA 1IF1A 2GIVA 5EZGA 3ZMTA 4BS9A 1O4XA 5CVRA 1T2KA 3RTRA 1TNTA 1R5ID 2RV8A 4AYBA 1GXQA 4I0AA 5D5WB 1ZARA 3FXRA 2LRDA 2YX7A 1WJCA 2XKOA 3KYLA 2R0QC 4EM0B 1HLVA 1KZHA 3S32A 2L02A 3KP4A 3H5NA 1WRJA 3CZ6A 2K9QA 4ZTFA 1BN5A 2P81A 5B1AH 2GLOA 2R7UA 1A6QA 2LKPA 3A01A 2HR3A 4II3A 4RAYA 4XM3A 2ZSHB 1MH3A 2ME0A 2TCTA 5E3OA 4B47A 2KDZA 4ASNA 2GAUA 4MEYF 1OLTA 4HPQA 3EQLF 2XAGA 4FETA 1D1AA
chains in the Genus database with same CATH topology
4OMYA 2E1NA 2KIMA 3GLXA 4R79A 2ZNZA 3WGIA 1J75A 1KQ8A 2PFBA 3HSRA 3L7WA 2IA2A 3I64A 2ACJA 3KEOA 1XMAA 1MD0A 5ERIA 3ML6A 2HS5A 3K1MA 3I54A 1U6GA 5E8IA 1BIBA 4EM2A 3RKYA 2PI0A 1LEAA 1S3JA 1R00A 1RUNA 2GQQA 3ZN1A 1ZG5A 2BGCA 2ZO4A 5DUIA 4M9XA 3RPQA 4L18B 3EETA 3CUQA 4BQAA 4IHTA 2V9VA 3HUGA 2ZKZA 2MC3A 4MGRA 3KETA 3SQNA 4UVAA 2YR2A 4LK1F 4RAZA 3V7SA 2FEZA 3RPUA 2HGCA 3ECOA 3JTHA 2ISZA 3ELKA 1F1ZA 2FNAA 2ZBKA 3QOPA 4L5IA 1K7AA 3PQKA 5DCFA 4LLGF 3VEPA 2V1DA 2XGXA 2Z33A 2KJCA 1RI7A 1FYKA 3DF8A 1FSHA 2PN6A 2ZMEA 4I2OA 4HX4A 4HLYA 2XAJA 5ILVA 2OBPA 1C0WA 4M6XA 2A07F 1DPUA 3LFKA 1HSJA 1QZZA 3FMQA 2HWVA 3W6KB 1KU7A 1RNLA 1J5YA 4ESBA 5CVJA 4Y13A 2A68F 3E6MA 4KNYA 2OAZA 2VXZA 3NRVA 4FX0A 1HW1A 3J81Z 2R3SA 4GCVA 4ETSA 1TQMA 4DNCA 2O61A 4Z2YA 1KYZA 1U8RA 2EA4A 3U9GA 5BMZA 4G7OF 3DP7A 5BPDA 3WU1B 3BJOA 2JRTA 2ZJ2A 3DFGA 1D8KA 2HKOA 3J7AO 4CYDA 1ODDA 4HOBA 3SFZA 4NQWA 4BXUA 4ZH4F 3BDDA 1HBXG 4YIFA 4RB0A 5CVVA 2LDUA 1K6OA 4RB1A 2ZCWA 2NAZA 2NS0A 2W84A 3KLOA 5HS8A 3RKWA 2XAQA 2OA4A 3K1NA 2FE3A 3M8FA 1QGPA 2VT2A 1B9NA 3FZVA 5HDKA 2DPUA 2HQNA 2UXNA 1YQAA 2Z9OA 5A2QZ 5LEJA 1H9GA 1S7OA 1L3LA 5HLHA 3ISPA 2FXAA 4OU0A 2GZWA 1Z6TA 1XD7A 2OZUA 4M74A 4IRIA 3E97A 1HQCA 2TDXA 2ZNYA 4I01A 3KZYA 2VC1A 4M9ZA 1UFMA 4KUMA 2XAHA 3M1EA 5KVRA 3R4KA 1W5TA 1FBSA 1BC8C 3QU6A 4WK8F 5L3CA 4F7ZA 2QBYA 2OQRA 1W7PD 3HYIA 4MTDA 3RYPA 3I5UA 4A0ZA 2STWA 3AAFA 2FA5A 4ZYDA 2O03A 1MDMB 3DPLC 5H6RA 4IF4A 3TO9A 1BJAA 2AXLA 5E1XA 1R22A 1UHMA 3P9CA 2EB7A 3U2RA 1B6AA 2IP2A 4KN4X 1XSVA 2IVMA 2MLGA 4BHBA 2CGPA 2JPBA 3BZ6A 3ZMDA 5H20A 4S04A 5J8CA 3WGHA 1YIOA 2IRFG 2QZ8A 4ENNA 3DQVC 1FYMA 3JAMK 5DEQA 4FHTA 3F8MA 5E20A 5FFZA 5IT9Z 2L3DA 4EJWA 2M8EA 2RKHA 4GYIA 1BI1A 2FOKA 2H09A 3ABTA 2BE5F 4I0BA 2XHKA 5F6FA 3GFJA 4A0XA 1XB4A 2Q8KA 3LQRA 2XV4S 2EFPA 1LVAA 5DD8A 3Q9SA 3M7GA 4FT8A 4EQQA 1HSTA 4YFXF 2VT3A 1QNTA 3JW4A 3H92A 1KQ0A 2NNNA 1JHFA 2K02A 3HOTA 4UUVA 1OKRA 1AWCA 1YYVA 1OYWA 1WI9A 3ZMZA 2H94A 5BOXA 1XDSA 3QPHA 4ESFA 2RQPA 2ESHA 2CG4A 2F5DA 5EEGA 1F9NA 2P6TA 4P96A 3WTUC 1UB9A 3V8JA 1IN7A 5CYVA 1XGOA 1MZBA 1XN7A 3K0LA 2M30A 1R36A 4HA8A 4HDVA 4TV7A 2P8TA 2KIFA 3GFIA 2A3SA 5DD4A 2DI3A 2FBIA 2G9WA 2Z5UA 4HQMA 2LF7A 4RGXA 2PLYA 4IVNA 4NB5A 1CGPA 3DEUA 1I1GA 1G3SA 3V8LA 1FPQA 3I71A 2CWEA 1ZHFA 1LB2A 2IPQX 2A61A 3H3UA 1HKTA 4G6DA 4YG2F 2DQRA 1ON2A 2DW4A 4LJZF 5DV5A 2X4HA 3ZP5A 2XIGA 1TLHB 3R61A 2W24A 2J5OA 1R23A 2M87A 3D5LA 1QQIA 4GYGA 3WGGA 3HSEA 4YFKF 4P9FA 1HW5A 1MJ9A 3FWEA 1Z91A 1R58A 3CLOA 4LFUA 1K78B 1G4DA 4G8XA 5FLXK 4U0YA 1SD6A 1PP8F 1I6XA 4B8XA 3K9TA 4HX8A 2G7UA 1S29A 1UHWA 3RJPA 1FX7A 5D4RA 2ZFWA 3GYHX 3O6BB 2RVCA 3F8CA 1JHHA 3JSOA 4Q48A 4U0VA 4WXDA 1CF7B 5LEKA 2R7FA 2F2EA 5BS6A 4UNOA 3P7NA 1V4RA 3OOPA 1JGSA 4M6YA 4D0PA 3VODA 3SHFA 2MH2A 3T5XA 2H6BA 4BYYA 1LDJA 2VONA 2RDPA 1R7JA 1T6SA 3WU0A 4XBFA 1QO0D 1USTA 2K4JA 3CUOA 2FF4A 1Z9CA 3E5XA 3L9FA 2LNBA 2UZKA 2HOEA 3HTUA 2PJPA 3MCZA 4IJAA 3GFMA 4A6EA 3IRQA 1R5GA 4JQFA 4LLLA 4RB2C 4MQVA 4U7DA 3U1DA 1TTYA 2HKXA 4OIQF 3FXQA 5D8LB 4ENMA 2MH9A 2HZTA 1ZAOA 1SFXA 1O3TA 1KU9A 3NQOA 4I98B 4EJUA 3J80Z 3ZPLA 4A5MA 4G94A 4ON0A 4WF2A 3E6BA 4PGHA 3TO6A 3HRUA 1MDMA 4EVIA 1YFHA 1SAXA 3ZN0A 1FBUA 4JK1X 3GEZA 1GXPA 3F21A 3KE2A 1ZN2A 3E6DA 2VBXA 2WWYA 1AOYA 1IXCA 2E7XA 1TW2A 3GWZA 2P5LC 2VOOA 3LQQA 3N97A 1H0MA 5LRSA 1F5TA 3C1DA 1IZ1A 3FM5A 2FBHA 4XSXF 2JSCA 4DQ2A 2K86A 2PQ8A 4AIHA 3F6OA 5F1RA 4M72A 5HS9A 4N9IA 1ZRFA 2EA2A 3IKTA 1E2XA 4AWXB 1XMKA 2QUFA 1LQ1A 2O6GE 3TDZC 1B9MA 3I0TA 1Y0UA 2M5WA 5ICEA 4GO1A 2DAOA 2DK8A 4EJVA 3F8FA 5CJ9A 3F72A 3D0SA 3FMRA 1FOKA 2HTSA 2KRFA 2FBKA 4ZZDA 5K5RA 1IUYA 3M9AA 2L4AA 3CUQC 3GF2A 3LAJA 3ZQ7A 3HRMA 1FY7A 2WC2A 4KA4A 1P4XA 4PGGA 3T0YA 1SFEA 2MLKA 3GUDA 4MHGA 2K27A 2BBYA 1YO5C 4A2UA 5ICCA 3Q9VA 1XDUA 1DP7P 4IPAA 2Q0OA 3BY6A 3EYYA 1XSDA 3IL2A 3DPTA 5HS7A 3PFIA 1DDNA 1IN6A 4RGRA 2DO7A 1TBXA 3WTSC 2D1VA 2XROA 6PAXA 1PDNC 5AIQA 2O3FA 2XASA 2V79A 3F8NA 3E5UA 3VOEA 1L0OC 4M71A 1PP7U 1BI3A 4HF2A 2DPDA 3O3KA 4HLXA 4CDGA 2MBFA 2YX4A 2X0LA 1R1TA 3JTGA 3BOQA 1BI0A 3KP2A 5E8GA 2UXXA 3GFLA 4G9YA 1Z1DA 3K69A 1J9IA 2JPCA 5HDNA 1EH8A 3HRSA 4EGYA 3WTWC 1DUXC 4AIJA 2QQAA 3KP6A 2VBWA 2RGVA 4Y15A 2VBZA 3I58A 3MQ0A 3MZYA 4HW0A 3IRRA 2Y0MA 4U7BA 5JI6A 1K78A 2ESNA 1FZPB 1TQPA 1WSUA 2O8XA 4R8HA 3WTXC 2LSOA 4G7HF 3MWMA 2QLZA 3F6VA 4ENKA 5DYMA 5CVIA 4LB5A 2IT0A 1W4MA 1YS7A 1D8JA 4LG0B 1CF7A 3GO5A 5FO5A 3ZMUA 3IWFA 2P5KA 3K2ZA 4RS8A 3NEUA 2FU4A 4KN7X 5LGUA 1RZ4A 1P4AA 2VE9A 5E1WA 2DBBA 1P4WA 3RYRA 2FMLA 2P7VB 5L3DA 2FNPA 4O5VA 2BEOA 1XCVA 2W25A 4L5JA 4A12A 3V7CA 5DCMB 1ONVA 1G6NA 4QLCU 2EFOA 1XGNA 2V6CA 2EJRA 3I4PA 3GZ5A 1OR7A 3F22A 2UWMA 1G3YA 3QAHA 1XGSA 2M1BA 3L2CA 1O3SA 1JE8A 2DLLA 3FXUA 2WTEA 1QBJA 3QPTA 3QU3A 5J6XA 5ED4A 2EFQA 4MNUA 3E3VA 3BJ6A 4L9TA 1VTNC 3KP5A 1IXSB 5LGTA 4M9SA 5D5UB 4O3MA 4PZJA 4KT5C 3QRFF 4P5OA 2BYVE 5DUKA 1J7KA 2HFHA 2CSOA 4WWCA 1D3YA 1OYIA 1YLFA 3PQJA 5HLIA 2F5FA 3I59B 1WKMA 2ZXJA 2XAFA 2F5EA 4AIKA 2W57A 3ZMSA 1W5SA 1LJ9A 2D2WA 1U78A 1SD5A 2GXBA 3RIRA 1I1SA 1WWXA 1FC3A 1BM9A 3FMSA 3TQNA 1QPMA 3MAJA 4AVPA 1REPC 2EFNA 1STZA 4G6QA 4XSZF 4OIOF 5ICGA 4H0EA 3FHZA 1IW7F 3ULQB 5D6FA 2EV6A 5AIPA 4ZYEA 2IW5A 1E17A 4IRGA 4OIPF 1SD7A 4BHPA 2CYYA 3BPXA 1USSA 2IA1A 2ADUA 1P6RA 4CO8A 4CGZA 1MGTA 3EDPA 4UV9A 1FBQA 5JHUA 1XGMA 4GXOA 4WXHA 1ZGJA 3IC7A 2EWNA 1B59A 5JR3A 2RNJA 1PUEE 1IRFA 4HBLA 5D6EA 3WE2A 2A6EF 1T98A 3GW2A 3QP6A 2HEOA 5FD6A 5CLSA 3TDUC 2VBYA 4OIRF 2E7WA 3MFKA 3FX3A 5FFXA 2V1XA 3CJNA 3LA7A 1DPRA 4ZYGA 2A6HF 2Q2EA 1GHCA 4KIBA 1GVJA 1LDDA 1ZYRF 2IJLA 5D8KB 5F64A 1B1BA 2COMA 4L0ZB 2XRNA 4LMYA 3M8EA 2FMYA 2QQ9A 4K2EA 1ZLJA 2QQBA 2D1HA 4UHTA 1O7FA 3S2WA 3DXJF 3WTZA 4HQEA 1HKSA 2OD5A 2JZYA 2Z3YA 4R1HA 2RN7A 1V3FA 2XUBA 1LDKB 2OZ6A 1O7LA 3HIFA 1MJAA 2EFWA 4JBAA 1MKMA 2KKOA 2VN2A 1IAWA 1RUOA 2QENA 5EEHA 4I09A 5LRRA 5CVUA 4KMFA 4LK0F 2CQKA 1SD4A 1W7PB 1RIOH 2GA1A 2D45A 4KFCA 4ZZLA 3WODF 2L54A 4HX7A 2EK5A 1HKQA 5L3FA 1X3UA 3WE3A 2G7HA 2GA2A 4I02A 4E70A 3KCCA 5L3GA 4LG0A 5FLXZ 2DU9A 4LD5A 2A69F 5L3BA 1D5VA 2JT1A 4RGUA 3LA2A 2VC0A 4A0YA 2E1CA 3LSTA 3LA3A 4CICA 3J81K 3V7RA 3BROA 4BNCA 5DCMA 3TKYA 3T1BA 5LHIA 2PMUA 1J2XA 5L3EA 3T8RA 4I7HA 2FQ3A 5KK1A 1EV7A 3SZTA 3REOA 3P9IA 1R1UA 3G73A 1IN5A 5H6QA 4HV5A 2VE8A 3E5QA 4L0YB 1S8NA 1U5TB 3GZ6A 4P55A 2CFXA 2EV5A 2QM3A 1O57A 1J59A 1Q1HA 1IRGA 2DQLA 2WV0A 1TQIA 1G3WA 3W6JB 3IWZA 1IN4A 3H3ZA 1ZG1A 3Q5FA 3BPVA 4YFNF 3R0JA 5AONA 5FB2A 3CO7C 4HZFA 4MTEA 3RDIA 2W85A 2YPRA 2R7DA 3I59A 5A2QK 3SZPA 4NHJA 2O0YA 1YW7A 2V1UA 4PDKA 4WCGA 1TNSA 3SXYA 1KQ9A 1ZLKA 3L09A 4IHSA 3RI4A 5TJJA 3LAPA 2BV6A 3WTYC 3KP7A 4UXNA 4LGWA 3CDHA 1ZREA 2KJBA 1T38A 3DV8A 3COAC 4KMUX 2PG4A 2F5CA 4EMSA 4HF1A 1MJBA 4HV6A 1S6LA 3I53A 2MA3A 3WTTC 3BP8A 3RKXA 1NHAA 2ETHA 4CXFA 1EH7A 3E6CC 5HLGA 3ABUA 1KGSA 1LEBA 4G7ZF 3LWFA 3C7JA 1U3EM 2CW0F 2OU2A 4A6DA 1O3QA 2FRHA 3WTVC 4M73A 3N4MA 2DFIA 1HW2A 4KYWA 1Z6RA 5IT9K 4MQ9F 2HDCA 2A5YB 3QP5A 4A5NA 4L9JA 1FLIA 4IRHA 3KFWX 3R0AA 4Q47A 2DTRA 4U88A 4KDPA 5LHHA 2VOPA 2P5VA 5FGMA 1Z05A 2STTA 2DT5A 2XKPA 4EV0A 1FNNA 2K4BA 3R60A 3G3ZA 3C3WA 5IT3A 2RC4A 3V8KA 4OMZA 3ROUA 2KIUA 4WXCA 4Y17A 1A04A 1QZYA 3BJAA 3R6SA 2L4MA 4Q5SF 4PCQA 1R1VA 1I5ZA 3KEQA 4U0WA 2LF8A 1XCBA 4XRFA 1H9TA 3IHUA 3GX4X 1FP2A 1FT9A 3B73A 1FSEA 1HXDA 1T0FA 3ZMVA 2H6CA 3FM3A 3K1PA 1UCRA 2XVCA 4UV8A 5FD5A 2P6SA 2OQGA 1JXSA 1ZRCA 2FSWA 3B02A 2L01A 1J0RA 1SFUA 3V4GA 5BQTA 4CHUA 5HVQC 2NRAC 4HAMA 1YTYA 5TRDA 4L9NA 4RB3C 5LBQA 3GVAA 1KA8A 5ICFA 2AS5F 5HOOA 3OV8A 2ISYA 3CUQB 3VFZA 4WX9A 1F4KA 1ZH5A 1FWZA 2EV0A 2K7LA 1W7PA 1SMYF 3TOBA 4QWQA 4FX4A 3L00A 5LHGA 3MZHA 2HTJA 5E1ZB 1OMIA 5LGNA 1KU2A 3TO7A 1P92A 1IXRC 5ILUA 2NNYA 4RGSA 4EJOA 5K5QA 4EGZA 1ON1A 1ZG3A 1YW9A 1KU3A 4Q4ZF 2HQRA 3F23A 5LLQA 2P4WA 1ZRDA 3C18A 4ENJA 1K79A 2ZMEB 3EYIA 4N9HA 1XSXA 3HHHA 1S7AA 3BWGA 2NYXA 5D4SA 4BAYA 1ULYA 4ZYHA 4AD9A 2HYGD 2GWRA 5HDGA 3MEXA 5J8FA 3HTSB 2QVOA 2J5PA 5E18F 4ESJA 1TW3A 1YS6A 2JTVA 4EM1A 4KICA 4BHCA 4IXAA 4MEXF 1ZGAA 4UVCA 3ERED 4XLNF 5K5OA 1LNWA 2PEXA 2QYOA 3HSFA 5JFRA 1U5TA 1U2WA 2ELHA 2Z99A 2GXGA 2PBIA 1BIAA 2CO5A 3KLNA 2DK5A 3WG9A 2Y75A 4O6JA 1OPCA 3EUHA 2MD5A 4HDUA 2Y48A 3JAMZ 5BPIA 3GXOA 3FF5A 3CTAA 1FYLA 1FP1D 3O2PE 1KYWA 5ILSA 5D5XB 4HYEA 4LB6B 1EH6A 4XLPF 4HF0A 3DKWA 1YG2A 3T8TA 1IN8A 1WQ2A 2QWWA 3HRTA 3F8BA 2M45A 3JSPA 1O3RA 3VB2A 3TOAA 1YW8A 2HYFA 5D5VB 2IA0A 1OYYA 4P9UA 4B09A 4L9VA 4KIFA 1U5TC 2YSRA 2B0LA 1I27A 4BH9A 2P7CB 4EJTA 1SMTA 5JVTA 1T39A 3P9KA 4OINF 4KIGA 4YIIA 3HOSA 1BBYA 5DDGA 1BC7C 4N0BA 3J80K 1R5HA 3ECHA 1BOAA 4CZZA 3TGNA 1B4AA 1Z7UA 3CO6C 5E17F 3IKVA 1BI2A 4LLNA 2C6YA 2VODA 2PMHA 1G3TA 3F3XA 4UVBA 2YU3A 3KP3A 5K1YA 1P2FA 2H27A 2QBYB 4OOIA 4S05A 3KZZA 3HHGA 4GGGA 1IF1A 2GIVA 3ZMTA 5CVRA 1T2KA 3RTRA 1TNTA 2RV8A 1GXQA 4I0AA 5D5WB 1ZARA 3FXRA 2YX7A 2XKOA 4EM0B 2L02A 3KP4A 1WRJA 1BN5A 2LKPA 2HR3A 4RAYA 4ASNA 2GAUA 4MEYF 3EQLF 2XAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMY A;  2E1N A;  2KIM A;  3GLX A;  4R79 A;  2ZNZ A;  3WGI A;  1J75 A;  1KQ8 A;  2PFB A;  3HSR A;  3L7W A;  2IA2 A;  3I64 A;  2ACJ A;  3KEO A;  1XMA A;  1MD0 A;  5ERI A;  3ML6 A;  2HS5 A;  3K1M A;  3I54 A;  1U6G A;  5E8I A;  1BIB A;  4EM2 A;  3RKY A;  2PI0 A;  1LEA A;  1S3J A;  1R00 A;  1RUN A;  2GQQ A;  3ZN1 A;  1ZG5 A;  2BGC A;  2ZO4 A;  5DUI A;  4M9X A;  3RPQ A;  4L18 B;  3EET A;  3CUQ A;  4BQA A;  4IHT A;  2V9V A;  3HUG A;  2ZKZ A;  2MC3 A;  4MGR A;  3KET A;  3SQN A;  4UVA A;  2YR2 A;  4LK1 F;  4RAZ A;  3V7S A;  2FEZ A;  3RPU A;  2HGC A;  3ECO A;  3JTH A;  2ISZ A;  3ELK A;  1F1Z A;  2FNA A;  2ZBK A;  3QOP A;  4L5I A;  1K7A A;  3PQK A;  5DCF A;  4LLG F;  3VEP A;  2V1D A;  2XGX A;  2Z33 A;  2KJC A;  1RI7 A;  1FYK A;  3DF8 A;  1FSH A;  2PN6 A;  2ZME A;  4I2O A;  4HX4 A;  4HLY A;  2XAJ A;  5ILV A;  2OBP A;  1C0W A;  4M6X A;  2A07 F;  1DPU A;  3LFK A;  1HSJ A;  1QZZ A;  3FMQ A;  2HWV A;  3W6K B;  1KU7 A;  1RNL A;  1J5Y A;  4ESB A;  5CVJ A;  4Y13 A;  2A68 F;  3E6M A;  4KNY A;  2OAZ A;  2VXZ A;  3NRV A;  4FX0 A;  1HW1 A;  3J81 Z;  2R3S A;  4GCV A;  4ETS A;  1TQM A;  4DNC A;  2O61 A;  4Z2Y A;  1KYZ A;  1U8R A;  2EA4 A;  3U9G A;  5BMZ A;  4G7O F;  3DP7 A;  5BPD A;  3WU1 B;  3BJO A;  2JRT A;  2ZJ2 A;  3DFG A;  1D8K A;  2HKO A;  3J7A O;  4CYD A;  1ODD A;  4HOB A;  3SFZ A;  4NQW A;  4BXU A;  4ZH4 F;  3BDD A;  1HBX G;  4YIF A;  4RB0 A;  5CVV A;  2LDU A;  1K6O A;  4RB1 A;  2ZCW A;  2NAZ A;  2NS0 A;  2W84 A;  3KLO A;  5HS8 A;  3RKW A;  2XAQ A;  2OA4 A;  3K1N A;  2FE3 A;  3M8F A;  1QGP A;  2VT2 A;  1B9N A;  3FZV A;  5HDK A;  2DPU A;  2HQN A;  2UXN A;  1YQA A;  2Z9O A;  5A2Q Z;  5LEJ A;  1H9G A;  1S7O A;  1L3L A;  5HLH A;  3ISP A;  2FXA A;  4OU0 A;  2GZW A;  1Z6T A;  1XD7 A;  2OZU A;  4M74 A;  4IRI A;  3E97 A;  1HQC A;  2TDX A;  2ZNY A;  4I01 A;  3KZY A;  2VC1 A;  4M9Z A;  1UFM A;  4KUM A;  2XAH A;  3M1E A;  5KVR A;  3R4K A;  1W5T A;  1FBS A;  1BC8 C;  3QU6 A;  4WK8 F;  5L3C A;  4F7Z A;  2QBY A;  2OQR A;  1W7P D;  3HYI A;  4MTD A;  3RYP A;  3I5U A;  4A0Z A;  2STW A;  3AAF A;  2FA5 A;  4ZYD A;  2O03 A;  1MDM B;  3DPL C;  5H6R A;  4IF4 A;  3TO9 A;  1BJA A;  2AXL A;  5E1X A;  1R22 A;  1UHM A;  3P9C A;  2EB7 A;  3U2R A;  1B6A A;  2IP2 A;  4KN4 X;  1XSV A;  2IVM A;  2MLG A;  4BHB A;  2CGP A;  2JPB A;  3BZ6 A;  3ZMD A;  5H20 A;  4S04 A;  5J8C A;  3WGH A;  1YIO A;  2IRF G;  2QZ8 A;  4ENN A;  3DQV C;  1FYM A;  3JAM K;  5DEQ A;  4FHT A;  3F8M A;  5E20 A;  5FFZ A;  5IT9 Z;  2L3D A;  4EJW A;  2M8E A;  2RKH A;  4GYI A;  1BI1 A;  2FOK A;  2H09 A;  3ABT A;  2BE5 F;  4I0B A;  2XHK A;  5F6F A;  3GFJ A;  4A0X A;  1XB4 A;  2Q8K A;  3LQR A;  2XV4 S;  2EFP A;  1LVA A;  5DD8 A;  3Q9S A;  3M7G A;  4FT8 A;  4EQQ A;  1HST A;  4YFX F;  2VT3 A;  1QNT A;  3JW4 A;  3H92 A;  1KQ0 A;  2NNN A;  1JHF A;  2K02 A;  3HOT A;  4UUV A;  1OKR A;  1AWC A;  1YYV A;  1OYW A;  1WI9 A;  3ZMZ A;  2H94 A;  5BOX A;  1XDS A;  3QPH A;  4ESF A;  2RQP A;  2ESH A;  2CG4 A;  2F5D A;  5EEG A;  1F9N A;  2P6T A;  4P96 A;  3WTU C;  1UB9 A;  3V8J A;  1IN7 A;  5CYV A;  1XGO A;  1MZB A;  1XN7 A;  3K0L A;  2M30 A;  1R36 A;  4HA8 A;  4HDV A;  4TV7 A;  2P8T A;  2KIF A;  3GFI A;  2A3S A;  5DD4 A;  2DI3 A;  2FBI A;  2G9W A;  2Z5U A;  4HQM A;  2LF7 A;  4RGX A;  2PLY A;  4IVN A;  4NB5 A;  1CGP A;  3DEU A;  1I1G A;  1G3S A;  3V8L A;  1FPQ A;  3I71 A;  2CWE A;  1ZHF A;  1LB2 A;  2IPQ X;  2A61 A;  3H3U A;  1HKT A;  4G6D A;  4YG2 F;  2DQR A;  1ON2 A;  2DW4 A;  4LJZ F;  5DV5 A;  2X4H A;  3ZP5 A;  2XIG A;  1TLH B;  3R61 A;  2W24 A;  2J5O A;  1R23 A;  2M87 A;  3D5L A;  1QQI A;  4GYG A;  3WGG A;  3HSE A;  4YFK F;  4P9F A;  1HW5 A;  1MJ9 A;  3FWE A;  1Z91 A;  1R58 A;  3CLO A;  4LFU A;  1K78 B;  1G4D A;  4G8X A;  5FLX K;  4U0Y A;  1SD6 A;  1PP8 F;  1I6X A;  4B8X A;  3K9T A;  4HX8 A;  2G7U A;  1S29 A;  1UHW A;  3RJP A;  1FX7 A;  5D4R A;  2ZFW A;  3GYH X;  3O6B B;  2RVC A;  3F8C A;  1JHH A;  3JSO A;  4Q48 A;  4U0V A;  4WXD A;  1CF7 B;  5LEK A;  2R7F A;  2F2E A;  5BS6 A;  4UNO A;  3P7N A;  1V4R A;  3OOP A;  1JGS A;  4M6Y A;  4D0P A;  3VOD A;  3SHF A;  2MH2 A;  3T5X A;  2H6B A;  4BYY A;  1LDJ A;  2VON A;  2RDP A;  1R7J A;  1T6S A;  3WU0 A;  4XBF A;  1QO0 D;  1UST A;  2K4J A;  3CUO A;  2FF4 A;  1Z9C A;  3E5X A;  3L9F A;  2LNB A;  2UZK A;  2HOE A;  3HTU A;  2PJP A;  3MCZ A;  4IJA A;  3GFM A;  4A6E A;  3IRQ A;  1R5G A;  4JQF A;  4LLL A;  4RB2 C;  4MQV A;  4U7D A;  3U1D A;  1TTY A;  2HKX A;  4OIQ F;  3FXQ A;  5D8L B;  4ENM A;  2MH9 A;  2HZT A;  1ZAO A;  1SFX A;  1O3T A;  1KU9 A;  3NQO A;  4I98 B;  4EJU A;  3J80 Z;  3ZPL A;  4A5M A;  4G94 A;  4ON0 A;  4WF2 A;  3E6B A;  4PGH A;  3TO6 A;  3HRU A;  1MDM A;  4EVI A;  1YFH A;  1SAX A;  3ZN0 A;  1FBU A;  4JK1 X;  3GEZ A;  1GXP A;  3F21 A;  3KE2 A;  1ZN2 A;  3E6D A;  2VBX A;  2WWY A;  1AOY A;  1IXC A;  2E7X A;  1TW2 A;  3GWZ A;  2P5L C;  2VOO A;  3LQQ A;  3N97 A;  1H0M A;  5LRS A;  1F5T A;  3C1D A;  1IZ1 A;  3FM5 A;  2FBH A;  4XSX F;  2JSC A;  4DQ2 A;  2K86 A;  2PQ8 A;  4AIH A;  3F6O A;  5F1R A;  4M72 A;  5HS9 A;  4N9I A;  1ZRF A;  2EA2 A;  3IKT A;  1E2X A;  4AWX B;  1XMK A;  2QUF A;  1LQ1 A;  2O6G E;  3TDZ C;  1B9M A;  3I0T A;  1Y0U A;  2M5W A;  5ICE A;  4GO1 A;  2DAO A;  2DK8 A;  4EJV A;  3F8F A;  5CJ9 A;  3F72 A;  3D0S A;  3FMR A;  1FOK A;  2HTS A;  2KRF A;  2FBK A;  4ZZD A;  5K5R A;  1IUY A;  3M9A A;  2L4A A;  3CUQ C;  3GF2 A;  3LAJ A;  3ZQ7 A;  3HRM A;  1FY7 A;  2WC2 A;  4KA4 A;  1P4X A;  4PGG A;  3T0Y A;  1SFE A;  2MLK A;  3GUD A;  4MHG A;  2K27 A;  2BBY A;  1YO5 C;  4A2U A;  5ICC A;  3Q9V A;  1XDU A;  1DP7 P;  4IPA A;  2Q0O A;  3BY6 A;  3EYY A;  1XSD A;  3IL2 A;  3DPT A;  5HS7 A;  3PFI A;  1DDN A;  1IN6 A;  4RGR A;  2DO7 A;  1TBX A;  3WTS C;  2D1V A;  2XRO A;  6PAX A;  1PDN C;  5AIQ A;  2O3F A;  2XAS A;  2V79 A;  3F8N A;  3E5U A;  3VOE A;  1L0O C;  4M71 A;  1PP7 U;  1BI3 A;  4HF2 A;  2DPD A;  3O3K A;  4HLX A;  4CDG A;  2MBF A;  2YX4 A;  2X0L A;  1R1T A;  3JTG A;  3BOQ A;  1BI0 A;  3KP2 A;  5E8G A;  2UXX A;  3GFL A;  4G9Y A;  1Z1D A;  3K69 A;  1J9I A;  2JPC A;  5HDN A;  1EH8 A;  3HRS A;  4EGY A;  3WTW C;  1DUX C;  4AIJ A;  2QQA A;  3KP6 A;  2VBW A;  2RGV A;  4Y15 A;  2VBZ A;  3I58 A;  3MQ0 A;  3MZY A;  4HW0 A;  3IRR A;  2Y0M A;  4U7B A;  5JI6 A;  1K78 A;  2ESN A;  1FZP B;  1TQP A;  1WSU A;  2O8X A;  4R8H A;  3WTX C;  2LSO A;  4G7H F;  3MWM A;  2QLZ A;  3F6V A;  4ENK A;  5DYM A;  5CVI A;  4LB5 A;  2IT0 A;  1W4M A;  1YS7 A;  1D8J A;  4LG0 B;  1CF7 A;  3GO5 A;  5FO5 A;  3ZMU A;  3IWF A;  2P5K A;  3K2Z A;  4RS8 A;  3NEU A;  2FU4 A;  4KN7 X;  5LGU A;  1RZ4 A;  1P4A A;  2VE9 A;  5E1W A;  2DBB A;  1P4W A;  3RYR A;  2FML A;  2P7V B;  5L3D A;  2FNP A;  4O5V A;  2BEO A;  1XCV A;  2W25 A;  4L5J A;  4A12 A;  3V7C A;  5DCM B;  1ONV A;  1G6N A;  4QLC U;  2EFO A;  1XGN A;  2V6C A;  2EJR A;  3I4P A;  3GZ5 A;  1OR7 A;  3F22 A;  2UWM A;  1G3Y A;  3QAH A;  1XGS A;  2M1B A;  3L2C A;  1O3S A;  1JE8 A;  2DLL A;  3FXU A;  2WTE A;  1QBJ A;  3QPT A;  3QU3 A;  5J6X A;  5ED4 A;  2EFQ A;  4MNU A;  3E3V A;  3BJ6 A;  4L9T A;  1VTN C;  3KP5 A;  1IXS B;  5LGT A;  4M9S A;  5D5U B;  4O3M A;  4PZJ A;  4KT5 C;  3QRF F;  4P5O A;  2BYV E;  5DUK A;  1J7K A;  2HFH A;  2CSO A;  4WWC A;  1D3Y A;  1OYI A;  1YLF A;  3PQJ A;  5HLI A;  2F5F A;  3I59 B;  1WKM A;  2ZXJ A;  2XAF A;  2F5E A;  4AIK A;  2W57 A;  3ZMS A;  1W5S A;  1LJ9 A;  2D2W A;  1U78 A;  1SD5 A;  2GXB A;  3RIR A;  1I1S A;  1WWX A;  1FC3 A;  1BM9 A;  3FMS A;  3TQN A;  1QPM A;  3MAJ A;  4AVP A;  1REP C;  2EFN A;  1STZ A;  4G6Q A;  4XSZ F;  4OIO F;  5ICG A;  4H0E A;  3FHZ A;  1IW7 F;  3ULQ B;  5D6F A;  2EV6 A;  5AIP A;  4ZYE A;  2IW5 A;  1E17 A;  4IRG A;  4OIP F;  1SD7 A;  4BHP A;  2CYY A;  3BPX A;  1USS A;  2IA1 A;  2ADU A;  1P6R A;  4CO8 A;  4CGZ A;  1MGT A;  3EDP A;  4UV9 A;  1FBQ A;  5JHU A;  1XGM A;  4GXO A;  4WXH A;  1ZGJ A;  3IC7 A;  2EWN A;  1B59 A;  5JR3 A;  2RNJ A;  1PUE E;  1IRF A;  4HBL A;  5D6E A;  3WE2 A;  2A6E F;  1T98 A;  3GW2 A;  3QP6 A;  2HEO A;  5FD6 A;  5CLS A;  3TDU C;  2VBY A;  4OIR F;  2E7W A;  3MFK A;  3FX3 A;  5FFX A;  2V1X A;  3CJN A;  3LA7 A;  1DPR A;  4ZYG A;  2A6H F;  2Q2E A;  1GHC A;  4KIB A;  1GVJ A;  1LDD A;  1ZYR F;  2IJL A;  5D8K B;  5F64 A;  1B1B A;  2COM A;  4L0Z B;  2XRN A;  4LMY A;  3M8E A;  2FMY A;  2QQ9 A;  4K2E A;  1ZLJ A;  2QQB A;  2D1H A;  4UHT A;  1O7F A;  3S2W A;  3DXJ F;  3WTZ A;  4HQE A;  1HKS A;  2OD5 A;  2JZY A;  2Z3Y A;  4R1H A;  2RN7 A;  1V3F A;  2XUB A;  1LDK B;  2OZ6 A;  1O7L A;  3HIF A;  1MJA A;  2EFW A;  4JBA A;  1MKM A;  2KKO A;  2VN2 A;  1IAW A;  1RUO A;  2QEN A;  5EEH A;  4I09 A;  5LRR A;  5CVU A;  4KMF A;  4LK0 F;  2CQK A;  1SD4 A;  1W7P B;  1RIO H;  2GA1 A;  2D45 A;  4KFC A;  4ZZL A;  3WOD F;  2L54 A;  4HX7 A;  2EK5 A;  1HKQ A;  5L3F A;  1X3U A;  3WE3 A;  2G7H A;  2GA2 A;  4I02 A;  4E70 A;  3KCC A;  5L3G A;  4LG0 A;  5FLX Z;  2DU9 A;  4LD5 A;  2A69 F;  5L3B A;  1D5V A;  2JT1 A;  4RGU A;  3LA2 A;  2VC0 A;  4A0Y A;  2E1C A;  3LST A;  3LA3 A;  4CIC A;  3J81 K;  3V7R A;  3BRO A;  4BNC A;  5DCM A;  3TKY A;  3T1B A;  5LHI A;  2PMU A;  1J2X A;  5L3E A;  3T8R A;  4I7H A;  2FQ3 A;  5KK1 A;  1EV7 A;  3SZT A;  3REO A;  3P9I A;  1R1U A;  3G73 A;  1IN5 A;  5H6Q A;  4HV5 A;  2VE8 A;  3E5Q A;  4L0Y B;  1S8N A;  1U5T B;  3GZ6 A;  4P55 A;  2CFX A;  2EV5 A;  2QM3 A;  1O57 A;  1J59 A;  1Q1H A;  1IRG A;  2DQL A;  2WV0 A;  1TQI A;  1G3W A;  3W6J B;  3IWZ A;  1IN4 A;  3H3Z A;  1ZG1 A;  3Q5F A;  3BPV A;  4YFN F;  3R0J A;  5AON A;  5FB2 A;  3CO7 C;  4HZF A;  4MTE A;  3RDI A;  2W85 A;  2YPR A;  2R7D A;  3I59 A;  5A2Q K;  3SZP A;  4NHJ A;  2O0Y A;  1YW7 A;  2V1U A;  4PDK A;  4WCG A;  1TNS A;  3SXY A;  1KQ9 A;  1ZLK A;  3L09 A;  4IHS A;  3RI4 A;  5TJJ A;  3LAP A;  2BV6 A;  3WTY C;  3KP7 A;  4UXN A;  4LGW A;  3CDH A;  1ZRE A;  2KJB A;  1T38 A;  3DV8 A;  3COA C;  4KMU X;  2PG4 A;  2F5C A;  4EMS A;  4HF1 A;  1MJB A;  4HV6 A;  1S6L A;  3I53 A;  2MA3 A;  3WTT C;  3BP8 A;  3RKX A;  1NHA A;  2ETH A;  4CXF A;  1EH7 A;  3E6C C;  5HLG A;  3ABU A;  1KGS A;  1LEB A;  4G7Z F;  3LWF A;  3C7J A;  1U3E M;  2CW0 F;  2OU2 A;  4A6D A;  1O3Q A;  2FRH A;  3WTV C;  4M73 A;  3N4M A;  2DFI A;  1HW2 A;  4KYW A;  1Z6R A;  5IT9 K;  4MQ9 F;  2HDC A;  2A5Y B;  3QP5 A;  4A5N A;  4L9J A;  1FLI A;  4IRH A;  3KFW X;  3R0A A;  4Q47 A;  2DTR A;  4U88 A;  4KDP A;  5LHH A;  2VOP A;  2P5V A;  5FGM A;  1Z05 A;  2STT A;  2DT5 A;  2XKP A;  4EV0 A;  1FNN A;  2K4B A;  3R60 A;  3G3Z A;  3C3W A;  5IT3 A;  2RC4 A;  3V8K A;  4OMZ A;  3ROU A;  2KIU A;  4WXC A;  4Y17 A;  1A04 A;  1QZY A;  3BJA A;  3R6S A;  2L4M A;  4Q5S F;  4PCQ A;  1R1V A;  1I5Z A;  3KEQ A;  4U0W A;  2LF8 A;  1XCB A;  4XRF A;  1H9T A;  3IHU A;  3GX4 X;  1FP2 A;  1FT9 A;  3B73 A;  1FSE A;  1HXD A;  1T0F A;  3ZMV A;  2H6C A;  3FM3 A;  3K1P A;  1UCR A;  2XVC A;  4UV8 A;  5FD5 A;  2P6S A;  2OQG A;  1JXS A;  1ZRC A;  2FSW A;  3B02 A;  2L01 A;  1J0R A;  1SFU A;  3V4G A;  5BQT A;  4CHU A;  5HVQ C;  2NRA C;  4HAM A;  1YTY A;  5TRD A;  4L9N A;  4RB3 C;  5LBQ A;  3GVA A;  1KA8 A;  5ICF A;  2AS5 F;  5HOO A;  3OV8 A;  2ISY A;  3CUQ B;  3VFZ A;  4WX9 A;  1F4K A;  1ZH5 A;  1FWZ A;  2EV0 A;  2K7L A;  1W7P A;  1SMY F;  3TOB A;  4QWQ A;  4FX4 A;  3L00 A;  5LHG A;  3MZH A;  2HTJ A;  5E1Z B;  1OMI A;  5LGN A;  1KU2 A;  3TO7 A;  1P92 A;  1IXR C;  5ILU A;  2NNY A;  4RGS A;  4EJO A;  5K5Q A;  4EGZ A;  1ON1 A;  1ZG3 A;  1YW9 A;  1KU3 A;  4Q4Z F;  2HQR A;  3F23 A;  5LLQ A;  2P4W A;  1ZRD A;  3C18 A;  4ENJ A;  1K79 A;  2ZME B;  3EYI A;  4N9H A;  1XSX A;  3HHH A;  1S7A A;  3BWG A;  2NYX A;  5D4S A;  4BAY A;  1ULY A;  4ZYH A;  4AD9 A;  2HYG D;  2GWR A;  5HDG A;  3MEX A;  5J8F A;  3HTS B;  2QVO A;  2J5P A;  5E18 F;  4ESJ A;  1TW3 A;  1YS6 A;  2JTV A;  4EM1 A;  4KIC A;  4BHC A;  4IXA A;  4MEX F;  1ZGA A;  4UVC A;  3ERE D;  4XLN F;  5K5O A;  1LNW A;  2PEX A;  2QYO A;  3HSF A;  5JFR A;  1U5T A;  1U2W A;  2ELH A;  2Z99 A;  2GXG A;  2PBI A;  1BIA A;  2CO5 A;  3KLN A;  2DK5 A;  3WG9 A;  2Y75 A;  4O6J A;  1OPC A;  3EUH A;  2MD5 A;  4HDU A;  2Y48 A;  3JAM Z;  5BPI A;  3GXO A;  3FF5 A;  3CTA A;  1FYL A;  1FP1 D;  3O2P E;  1KYW A;  5ILS A;  5D5X B;  4HYE A;  4LB6 B;  1EH6 A;  4XLP F;  4HF0 A;  3DKW A;  1YG2 A;  3T8T A;  1IN8 A;  1WQ2 A;  2QWW A;  3HRT A;  3F8B A;  2M45 A;  3JSP A;  1O3R A;  3VB2 A;  3TOA A;  1YW8 A;  2HYF A;  5D5V B;  2IA0 A;  1OYY A;  4P9U A;  4B09 A;  4L9V A;  4KIF A;  1U5T C;  2YSR A;  2B0L A;  1I27 A;  4BH9 A;  2P7C B;  4EJT A;  1SMT A;  5JVT A;  1T39 A;  3P9K A;  4OIN F;  4KIG A;  4YII A;  3HOS A;  1BBY A;  5DDG A;  1BC7 C;  4N0B A;  3J80 K;  1R5H A;  3ECH A;  1BOA A;  4CZZ A;  3TGN A;  1B4A A;  1Z7U A;  3CO6 C;  5E17 F;  3IKV A;  1BI2 A;  4LLN A;  2C6Y A;  2VOD A;  2PMH A;  1G3T A;  3F3X A;  4UVB A;  2YU3 A;  3KP3 A;  5K1Y A;  1P2F A;  2H27 A;  2QBY B;  4OOI A;  4S05 A;  3KZZ A;  3HHG A;  4GGG A;  1IF1 A;  2GIV A;  3ZMT A;  5CVR A;  1T2K A;  3RTR A;  1TNT A;  2RV8 A;  1GXQ A;  4I0A A;  5D5W B;  1ZAR A;  3FXR A;  2YX7 A;  2XKO A;  4EM0 B;  2L02 A;  3KP4 A;  1WRJ A;  1BN5 A;  2LKP A;  2HR3 A;  4RAY A;  4ASN A;  2GAU A;  4MEY F;  3EQL F;  2XAG A; 
#chains in the Genus database with same CATH topology
 1JUS A;  2IXS A;  4XL9 A;  1J09 A;  4OMY A;  2E1N A;  2DA5 A;  2KIM A;  3GLX A;  4R79 A;  2ZNZ A;  3DBL B;  2R7T A;  3WGI A;  1J75 A;  1V54 H;  1KQ8 A;  2PFB A;  3HSR A;  2XRL A;  3L7W A;  2IA2 A;  4X6A J;  4XKW A;  3I64 A;  3ONQ A;  2K3P A;  2ACJ A;  3KEO A;  1TT5 B;  1XMA A;  1MD0 A;  4LG3 A;  1KON A;  4ZDL A;  1E0E A;  1TWF J;  4FE4 A;  5EDN A;  5ERI A;  1W0T A;  3ML6 A;  1Y8R B;  2HS5 A;  3D5S C;  3S8P A;  2R5Y B;  3K1M A;  1FTZ A;  3UR3 C;  3I54 A;  2XSJ C;  2JA7 J;  1U6G A;  5E8I A;  4GFB A;  1BIB A;  5FJ8 J;  1PUF B;  4EM2 A;  1W36 C;  4E7J A;  3RKY A;  3ABM H;  5JVG F;  2PI0 A;  1LEA A;  1S3J A;  3BQY A;  4PJL A;  3P5J A;  1W0U A;  1ETK A;  1R00 A;  1LFB A;  2QKL B;  1RUN A;  2GQQ A;  3ZN1 A;  4G12 A;  1N25 A;  3BQZ A;  4YIR X;  2QGU A;  1D0Z A;  4ZTJ A;  3BG6 A;  2HPM A;  1ZG5 A;  2NXN B;  2BGC A;  2KT0 A;  3HOX J;  3GZN B;  2ZO4 A;  2R7Q A;  5DUI A;  4M9X A;  1I50 J;  3RPQ A;  2DA1 A;  2PJR B;  4IX7 A;  2BZT A;  3EET A;  4L18 B;  1JT6 A;  3CUQ A;  4BQA A;  2VAS A;  4IHT A;  2V9V A;  3KPH A;  3CDL A;  3HUG A;  2ZJQ F;  4BU2 A;  1E3O C;  1TWC J;  3BC8 A;  5GPA A;  2ZKZ A;  4CYC A;  3BR5 A;  5J4V A;  2MC3 A;  2LD5 A;  3ZQL A;  2EIL H;  4MGR A;  2CQQ A;  3S1M J;  3KET A;  2JA2 A;  4EAT A;  1YIT I;  4BE0 A;  4UUS B;  2CFO A;  3SQN A;  1MMA A;  4UVA A;  2YR2 A;  3HJE A;  2H8W A;  2NVU B;  4LK1 F;  4RAZ A;  3V7S A;  2FEZ A;  4IQJ A;  2DMT A;  3RPU A;  2HGC A;  1LUJ B;  1NH3 A;  3ECO A;  2WAQ N;  3JTH A;  2ISZ A;  3ELK A;  1F1Z A;  2GBY A;  1OIS A;  4BQQ A;  1MH4 A;  3B6C A;  2FNA A;  2Y69 H;  2X9D A;  5IP9 J;  3O8G A;  2ZBK A;  1YHQ I;  4ANJ A;  3QOP A;  1HOM A;  1OCZ H;  1SAU A;  4L5I A;  4CA0 A;  1K7A A;  1Y56 A;  2DDA A;  2KIS A;  3PQK A;  3EPZ A;  5DCF A;  4LLG F;  3VEP A;  2V1D A;  2ZJP F;  3CCY A;  4IO9 F;  2XGX A;  2Z33 A;  2KJC A;  1RI7 A;  1FYK A;  2M2E A;  3GLL A;  3DF8 A;  4XKB A;  1FSH A;  2PN6 A;  2ZME A;  2HYJ A;  1BR1 A;  4I2O A;  4HX4 A;  1X1B A;  4HLY A;  3I9V 2;  3AL0 B;  3C2H A;  1MMG A;  2XAJ A;  5ILV A;  4BY1 J;  2LFB A;  1SFK A;  2IS2 A;  2OBP A;  1C0W A;  2LYC A;  4M6X A;  4F92 B;  2A07 F;  1DPU A;  3LFK A;  1HSJ A;  2LRE A;  1QZZ A;  3FMQ A;  3JRC A;  2HWV A;  5HLT A;  5F0H A;  3OYD A;  4J00 A;  3W6K B;  1KU7 A;  2Y9Z A;  1P7I A;  1J5Y A;  1RNL A;  4ESB A;  5CVJ A;  1BR2 A;  1Z3X A;  2KP6 A;  4Y13 A;  1VFC A;  2A05 A;  2A68 F;  3E6M A;  3OYI A;  4KNY A;  2OAZ A;  4XOR A;  4ZYA A;  4NC7 A;  2VXZ A;  2XAU A;  3NRV A;  3CCR I;  4FX0 A;  3HG9 A;  3HBL A;  1IDZ A;  3SEQ A;  1ETX A;  3OMY A;  1HW1 A;  2E36 A;  3J81 Z;  3WU2 C;  4XMY A;  2R3S A;  4GCV A;  1I39 A;  4ETS A;  1TQM A;  2BXY A;  2WA0 A;  3TW6 A;  4DNC A;  3PIP F;  3ZQG A;  1QPI A;  2EQR A;  2O61 A;  3NWT A;  2OF7 A;  1KYZ A;  4Z2Y A;  1U8R A;  1OCO H;  2MAB A;  2EA4 A;  1OJL A;  3PNT A;  3QPS A;  1LPQ A;  3J7Y J;  3U9G A;  5BMZ A;  4G7O F;  4AUX A;  3DP7 A;  5BPD A;  2CV0 A;  4G6T B;  3WU1 B;  3BJO A;  2JRT A;  4CSW A;  2ZJ2 A;  3DFG A;  2HDW A;  1D8K A;  2HKO A;  3J7A O;  4CYD A;  1ODD A;  2MW8 A;  2LY9 A;  1MMS A;  4V19 K;  1F36 A;  4HOB A;  3OS0 A;  2ZME C;  3SFZ A;  1VF9 A;  4NQW A;  4BXU A;  4ZH4 F;  1MBH A;  2EZK A;  1S72 I;  1CQT A;  5C4J J;  3BDD A;  1HBX G;  1HCR A;  1YX3 A;  4YIF A;  4HST A;  4RB0 A;  2LR8 A;  5CVV A;  5CQG A;  2B63 J;  4JP0 A;  3BR1 A;  1P7J A;  2LDU A;  4AU7 A;  3RCO A;  1U9N A;  1K6O A;  3DTK A;  4RB1 A;  1X1A A;  2ZCW A;  3L2U A;  5J1R A;  2NAZ A;  2NS0 A;  2W84 A;  5IOY A;  3KLO A;  2X48 A;  5IYC J;  5HS8 A;  1YI2 I;  2G0E A;  3RKW A;  2XAQ A;  2LBF B;  2OA4 A;  3K1N A;  3PSI A;  2YUS A;  2LG4 A;  2MC4 A;  3GTM J;  2FE3 A;  3M8F A;  1H89 C;  2KDO A;  1QGP A;  2VT2 A;  3I4M J;  1WCM J;  1B9N A;  2VUM J;  4LIV A;  3OS2 A;  2HPI A;  3FZV A;  2CUE A;  5HDK A;  2DPU A;  2HQN A;  2X1C A;  2UXN A;  1YQA A;  2Z9O A;  5A2Q Z;  5LEJ A;  1H9G A;  3L2V A;  5DM7 F;  4RMN A;  1S7O A;  4JX4 A;  1JT0 A;  4A93 J;  3CC2 I;  1L3L A;  5HLH A;  3H5A A;  3ISP A;  2FXA A;  4OU0 A;  2GZW A;  4DIQ A;  5GTI C;  2Y9Y A;  1OCC H;  1Z6T A;  1XD7 A;  2OZU A;  4M74 A;  4IRI A;  3E97 A;  1HQC A;  2TDX A;  2LY1 A;  2ZNY A;  4I01 A;  3KZY A;  2KHM A;  1JKR C;  2VC1 A;  1TT0 A;  1X19 A;  4ITV A;  4M9Z A;  1UFM A;  4KUM A;  2MSY A;  2XAH A;  5GPC A;  3M1E A;  3IH3 A;  3CCM I;  5KVR A;  3R4K A;  1W5T A;  1FBS A;  4A3E J;  1BC8 C;  3BT9 A;  3QU6 A;  3H9Q A;  4WK8 F;  5LFA A;  3TBI A;  5L3C A;  1BOB A;  4F7Z A;  2FJ1 A;  3BCA A;  4CZC A;  2QBY A;  2R7W A;  2OQR A;  3PUB A;  1MBG A;  1W7P D;  1WGX A;  3HYI A;  5EGO B;  4XN0 A;  4MTD A;  4C2U A;  3RYP A;  4UY8 I;  3I5U A;  4A0Z A;  4A3G J;  3VDX A;  2STW A;  1ZR2 A;  3AAF A;  2FA5 A;  2K85 A;  3OL4 A;  1UG0 A;  4ZYD A;  2KZG A;  2O03 A;  1MDM B;  2E1M C;  2ZC2 A;  3DPL C;  5H6R A;  2E2H J;  1JGG A;  2HNH A;  4IF4 A;  3TO9 A;  1BJA A;  2AXL A;  5E1X A;  1R22 A;  1UHM A;  3P9C A;  2EB7 A;  4D5F A;  2K40 A;  3U2R A;  2P0W A;  1B6A A;  4Y3O A;  4GRI A;  2IP2 A;  4KN4 X;  2M8G X;  5IY5 H;  1XSV A;  2IVM A;  2WY7 Q;  1UMQ A;  3QYE A;  1VQN I;  2O8K A;  2MLG A;  4BHB A;  2CGP A;  2Y30 A;  3OYG A;  2JPB A;  3BZ6 A;  3BR0 A;  2LH9 A;  4B3X A;  3MKW B;  3SEZ A;  3ZMD A;  5H20 A;  4S04 A;  5J8C A;  3CC4 I;  2F4O B;  3WGH A;  2VQC A;  1YIO A;  2RAE A;  2QZ8 A;  2EPF A;  4ENN A;  2IRF G;  2Y0S N;  2R92 J;  3DQV C;  1FYM A;  3JAM K;  5DEQ A;  4FHT A;  3F8M A;  5E20 A;  1P9Q C;  5FFZ A;  1WJB A;  3UKG A;  5IT9 Z;  1UAA A;  3H9J A;  2L3D A;  2ELJ A;  4EJW A;  2M8E A;  3FXL A;  2RKH A;  3A4C A;  2VJ4 A;  2V4J C;  4GYI A;  3LMM A;  2ZFU A;  1BI1 A;  3PFY A;  2FOK A;  2QF7 A;  2H09 A;  1MNE A;  3G6E I;  3ABT A;  2BE5 F;  4I0B A;  2XHK A;  5F6F A;  3GFJ A;  3G1M A;  4A0X A;  1XB4 A;  1VQK I;  2Q8K A;  3LQR A;  1ZKG A;  2XV4 S;  5GAH J;  2EFP A;  2HU9 A;  2R5Y A;  1A31 A;  1LVA A;  3JRD A;  1A35 A;  5DD8 A;  3RSN A;  3Q9S A;  3M7G A;  4ZDP A;  2B7E A;  5DTD A;  4FT8 A;  2BW3 B;  3QYF A;  1PUF A;  4EQQ A;  4M3E A;  1D1B A;  2R7R A;  4CH7 A;  5FKN A;  1HST A;  4A3F J;  3K4M A;  3M8J A;  4Y52 J;  4YFX F;  2VT3 A;  3MD2 A;  1QNT A;  2E34 A;  3JW4 A;  3H92 A;  4MIM A;  1KQ0 A;  2NNN A;  5GP9 A;  1JHF A;  3S3N A;  2K02 A;  3HOT A;  4C30 A;  4UUV A;  2VPL A;  4UB6 C;  1OKR A;  1AWC A;  3JRG A;  1YYV A;  3SDG A;  4XIC A;  1OYW A;  1WI9 A;  3ZMZ A;  3BTI A;  2H94 A;  5BOX A;  1X2M A;  2DOF A;  2PJR A;  4BJ5 C;  1XDS A;  3QPH A;  5J1Y A;  3KYC B;  4ESF A;  2RQP A;  2ESH A;  2CG4 A;  2F5D A;  2L7Z A;  5EEG A;  1TWH J;  4CCK A;  5IP7 J;  3CCU I;  2AHQ A;  1AHD P;  1X2N A;  1F9N A;  2P6T A;  4P96 A;  5IOZ A;  2JA5 J;  5M3M J;  3WTU C;  3OYK A;  2R5Z B;  4CCM A;  1UB9 A;  2VB6 A;  4UUS A;  3V8J A;  1IN7 A;  4XID A;  2L7K A;  5CYV A;  1JTX A;  1XGO A;  1MZB A;  3K4B A;  3C2G A;  1XN7 A;  3K0L A;  2M30 A;  4MO7 A;  1R36 A;  4HA8 A;  2QSF X;  4HDV A;  4TV7 A;  2P8T A;  2KIF A;  3GFI A;  1TP4 A;  2A3S A;  5DD4 A;  2EIN H;  3FXK A;  2DI3 A;  5CKT A;  2FBI A;  3AG4 H;  3IH4 A;  3S3O A;  3CF5 F;  2G9W A;  4PJN A;  2Z5U A;  5K7Z A;  4HQM A;  2LF7 A;  2XF5 A;  4RGX A;  5GAE J;  2L7F P;  2PLY A;  4XNF A;  3CCE I;  4IVN A;  3HOW J;  2JA6 J;  4NB5 A;  2JRM A;  2M0C A;  1CGP A;  3DEU A;  1I1G A;  1G3S A;  3V8L A;  1FPQ A;  3I71 A;  2CWE A;  1X4P A;  4F52 A;  2VXD A;  1ZHF A;  2EH3 A;  2HQ5 A;  2ICW G;  1LB2 A;  2KLO A;  4BJT A;  2IPQ X;  2A61 A;  1MBK A;  3H3U A;  3KYD B;  1HKT A;  4HSR A;  4G6D A;  3ZQF A;  4YG2 F;  4LOC A;  2DQR A;  1Z21 A;  1ON2 A;  3Q3S A;  2DW4 A;  1Y0N A;  4LJZ F;  2X4H A;  5DV5 A;  3ZP5 A;  1HA8 A;  2XIG A;  2E35 A;  1TLH B;  4NC8 A;  2IGM A;  3R61 A;  4S0H B;  2W24 A;  2J5O A;  4XRS G;  3HXL A;  1R23 A;  2M87 A;  3D5L A;  1QQI A;  4GYG A;  2LTP A;  3MMY B;  3WGG A;  3HSE A;  1XTA A;  1H88 C;  2DA4 A;  2E1O A;  2JSP A;  4YFK F;  2JWT A;  4P9F A;  4IHV A;  1SFO J;  3EUH C;  1HW5 A;  1MJ9 A;  1WHU A;  3FWE A;  1Z91 A;  2NOJ B;  1R58 A;  4I99 C;  3CLO A;  4LFU A;  5B1B H;  3X2Q H;  3GTG J;  4PJ0 C;  1TC3 C;  1K78 B;  1G4D A;  4G8X A;  5FLX K;  1MBE A;  4U0Y A;  3F9K A;  4BL0 B;  1SD6 A;  1PP8 F;  1I6X A;  4B8X A;  3K9T A;  3FXM A;  4HX8 A;  2B9S A;  2G7U A;  5IP6 A;  2ELK A;  2K3F A;  2QQ8 A;  1S29 A;  2LC2 A;  3OIO A;  1UHW A;  3RJP A;  1FX7 A;  5D4R A;  2ZFW A;  3GYH X;  4JOM A;  3O6B B;  1Y1W J;  2RVC A;  1VQ8 I;  1X4O A;  3F8C A;  1JHH A;  3CCQ I;  4XLA A;  3JSO A;  1V5E A;  4Q48 A;  4FTH A;  3AL0 C;  3JRH A;  1ZTR A;  1R71 A;  4U0V A;  3K4K A;  3TP0 A;  2DOE A;  1N77 A;  3ZXS A;  4DYC A;  4WXD A;  1CF7 B;  3NAU A;  5LEK A;  3Q0V A;  4XQF A;  2R7F A;  1UZC A;  2F2E A;  2HVQ A;  5JHF A;  5F0F A;  2XDV A;  5BS6 A;  4IL6 C;  4UNO A;  2MD0 A;  3P7N A;  1V4R A;  4PFP A;  4DZP A;  1WZ2 A;  2K9L A;  3OOP A;  1JGS A;  4M6Y A;  4D7M A;  4M3D A;  2LBF A;  4D0P A;  2ID3 A;  3VOD A;  4XR6 A;  3LNQ A;  1ITY A;  3SHF A;  2MH2 A;  5C3E J;  3DTE A;  3T5X A;  2WB1 A;  4XN3 A;  4BAC A;  3CP2 A;  2H6B A;  5LD2 C;  4BYY A;  1FIA A;  1LDJ A;  2VON A;  2DT7 B;  2RDP A;  1R7J A;  3CQZ J;  5KNL A;  1T6S A;  3WU0 A;  4XBF A;  2DMP A;  1QO0 D;  1UST A;  4KJZ A;  2M0M A;  2LMD A;  1B8I B;  2K4J A;  1T56 A;  3CUO A;  2FF4 A;  2GOM A;  1Z9C A;  3E5X A;  4AVZ A;  3L9F A;  2LNB A;  3A1Y A;  2UZK A;  2HOE A;  4A3C J;  3HTU A;  1A36 A;  2PJP A;  2W4S A;  3MCZ A;  4IJA A;  1MBJ A;  3GFM A;  4A6E A;  3IRQ A;  2V9K A;  2ZB9 A;  3GME A;  3F0C A;  1R5G A;  4JQF A;  3Q0U A;  4LLL A;  3MKY B;  5M5W J;  4RB2 C;  3GTP J;  1A5J A;  4MQV A;  3LSK A;  1LKX A;  3VYT B;  2JQ7 A;  4E6K G;  4U7D A;  3U1D A;  1TTY A;  3VSL A;  3RQI A;  4BQN A;  2HKX A;  3K70 D;  2E2J J;  1WFX A;  3J7Z I;  2ZXI A;  4OIQ F;  3FXQ A;  5D8L B;  2VQH A;  2NVY J;  4DYQ A;  3PIO F;  4ENM A;  3G1L A;  2Y2Z A;  4M3G A;  2MH9 A;  2HZT A;  3OYN A;  1ZAO A;  2UUZ A;  1SFX A;  2EIM H;  1Z7L A;  1KU9 A;  2E5Z A;  2KFD A;  1O3T A;  3NQO A;  4I98 B;  5EJC A;  5F08 A;  4EJU A;  2M34 A;  4XOP A;  3IAM 2;  4CCL A;  5EGO A;  4Z6Y A;  3J80 Z;  3ZPL A;  2Y31 A;  3SZG A;  4A5M A;  3S2H J;  2VL8 A;  2NOG A;  4G94 A;  5KCM A;  4ON0 A;  2DXI A;  4WF2 A;  4IOA F;  3E6B A;  2JJ7 A;  4PGH A;  3RPU D;  3TO6 A;  3VYR B;  3HRU A;  1F43 A;  1MDM A;  2EIK H;  4EVI A;  1YFH A;  1SAX A;  4XLC A;  3ZN0 A;  1FBU A;  2OPT A;  4JK1 X;  4BEH B;  2R7O A;  1VQ4 I;  3GEZ A;  4XON A;  2O5R A;  1GXP A;  5F04 A;  3F21 A;  3KE2 A;  1ZN2 A;  3E6D A;  1H8A C;  2VBX A;  2WWY A;  1PYV A;  2ME6 A;  1AOY A;  1IXC A;  5BNG A;  2E7X A;  2AO9 A;  5FKM A;  1TW2 A;  1SVM A;  2VPR A;  2I8D A;  3GWZ A;  2P5L C;  3DKX A;  2DA7 A;  3S1N J;  2VOO A;  3LQQ A;  3N97 A;  1H0M A;  2QEX I;  3SYT A;  5LRS A;  3I55 I;  1F5T A;  1FOY A;  1S9H A;  3C1D A;  3ESW B;  5EZH A;  4BGD A;  3DLA A;  2KPM A;  1IO2 A;  4NNJ A;  4XOT A;  1IZ1 A;  3FM5 A;  2FBH A;  2LK2 A;  4XSX F;  2CUZ A;  2JSC A;  4DQ2 A;  1MW7 A;  1X3W B;  3ZQH A;  2K86 A;  2PQ8 A;  4AIH A;  3F6O A;  4D9J A;  5F1R A;  1U9O A;  4M72 A;  2D5V A;  2R7X A;  3HB9 A;  5HS9 A;  3M07 A;  4N9I A;  4YEJ A;  1ZRF A;  2M4K A;  4RLQ A;  2EA2 A;  5K7F A;  3IKT A;  1E2X A;  4AWX B;  1I3A A;  4XKV A;  1NK2 P;  4F93 B;  5J3L A;  5FRO A;  5B5E C;  1XMK A;  2QUF A;  3LFU A;  3BTJ A;  1LQ1 A;  4ZC3 A;  1K4T A;  1E3H A;  1GV2 A;  3K4J A;  3TED A;  1FMV A;  2O6G E;  4J01 A;  3TDZ C;  2V6E A;  4QPQ A;  1B9M A;  3I0T A;  1Y0U A;  2M5W A;  3ZQI A;  1ORK A;  3CLQ A;  5ICE A;  2CQN A;  2FQ4 A;  4GO1 A;  3U1K A;  2WB1 N;  2DAO A;  2BW3 A;  2DK8 A;  4B1R A;  4EJV A;  3F8F A;  4II2 A;  4OAY A;  5CJ9 A;  2VJJ A;  1G2H A;  1D5Y A;  3F72 A;  3K70 C;  3D0S A;  3FMR A;  1IDY A;  2HTS A;  2KRF A;  1FOK A;  2DJN A;  2FBK A;  4ZZD A;  5K5R A;  2CH0 A;  1IUY A;  4B4C A;  3M9A A;  2L4A A;  1X58 A;  2BVM A;  3CUQ C;  3HGY A;  2GXA A;  3L2R A;  2VJI A;  3GF2 A;  3LAJ A;  3ZQ7 A;  3HRM A;  2WAD A;  4IHY A;  1FY7 A;  3RZO J;  2WC2 A;  3OYL A;  4KA4 A;  1P4X A;  2JVG A;  4PGG A;  1SFE A;  3T0Y A;  2MLK A;  3GUD A;  4MHG A;  2L9N A;  1S7E A;  3BLY A;  5M5Y J;  2NVX J;  2K27 A;  2BBY A;  1YO5 C;  4A2U A;  3GBG A;  3E0J B;  5ICC A;  4X0G A;  4BQO A;  3Q9V A;  1XDU A;  4IZZ A;  1DP7 P;  4IPA A;  3OYJ A;  2IEK A;  1D0Y A;  2Q0O A;  3BY6 A;  3EYY A;  2Z16 A;  1XSD A;  1ETV A;  1FMW A;  3IL2 A;  1XS9 A;  1WJA A;  3DPT A;  5HS7 A;  3PFI A;  1DDN A;  1IN6 A;  2VQL A;  4RGR A;  2DO7 A;  5FRN A;  3W6V A;  3DPU A;  2R5Z A;  1TBX A;  1W5C C;  4W1U A;  3K4N A;  2HOS A;  2Q2E B;  3WTS C;  3CC7 I;  2D1V A;  3PNV A;  3TMO A;  4PK4 A;  1Y1V J;  2XRO A;  4BXX J;  6PAX A;  5GAD J;  2Y0S A;  1PDN C;  3TL4 X;  4A3K J;  4E7H A;  2LOO A;  5AIQ A;  2E2I J;  2O3F A;  3OY9 A;  3JRI A;  2XAS A;  1FOX A;  9ANT A;  2OV7 A;  2V79 A;  2VIX A;  3F8N A;  3E5U A;  3VOE A;  1L0O C;  1HF0 A;  2JN6 A;  3LOC A;  3O8H A;  4KT6 A;  4M71 A;  3JRF A;  1PP7 U;  1BI3 A;  3BTL A;  3PL8 A;  4HF2 A;  1Z3Y A;  2JUG A;  1RET A;  2DPD A;  1OFC X;  1JUP A;  2V7F A;  4MFD A;  2BY0 A;  1QHH D;  3O3K A;  4HLX A;  1D1C A;  4CDG A;  2COB A;  2MBF A;  2YX4 A;  2BVL A;  3CMM A;  3BR2 A;  3HKZ A;  2X0L A;  1WJF A;  4Y33 A;  1R1T A;  4OAZ A;  3JTG A;  3CMA I;  3M3Y J;  1D0X A;  3BOQ A;  1BI0 A;  3W2W A;  3KP2 A;  3OYH A;  5E8G A;  3FK6 A;  2UXX A;  3GFL A;  4PSX A;  2L9V A;  3IP4 B;  4G9Y A;  1Z1D A;  1GLN A;  3K69 A;  1J9I A;  2JPC A;  5HDN A;  5HNH A;  1EH8 A;  3HRS A;  1T95 A;  1VQ5 I;  1ACI A;  4AC0 A;  4EGY A;  2ECB A;  3A0H C;  3WTW C;  1LVK A;  1DUX C;  2XPW A;  2R7Z J;  1U8B A;  4AIJ A;  5IPA A;  1NG6 A;  1VQ6 I;  1JKO C;  2QQA A;  3KP6 A;  2VBW A;  4NBQ A;  3U21 A;  2RGV A;  2KQR A;  3EUK L;  1R49 A;  1FIP A;  4HNV A;  4F3Q A;  1ZK8 A;  4NC6 A;  4Y15 A;  2VBZ A;  3I58 A;  3MQ0 A;  4H4K C;  1TWA J;  3MZY A;  3FK7 A;  4DBQ A;  4HW0 A;  3IRR A;  5CQE A;  2Y0M A;  4U7B A;  5JI6 A;  3HM5 A;  1K78 A;  2ESN A;  5IYD J;  2AQE A;  1FZP B;  1TQP A;  1WSU A;  2N8G A;  2O8X A;  5E3M A;  4R8H A;  2I5U A;  2CRG A;  3C2B A;  4GDF A;  3WTX C;  2M7B A;  2LSO A;  2I10 A;  4G7H F;  3MWM A;  2QLZ A;  3F6V A;  4PFO A;  2JA8 J;  4ENK A;  5DYM A;  5CVI A;  1T33 A;  2HXO A;  1UEL B;  2H1K A;  4LB5 A;  3QQA A;  2IT0 A;  1WH5 A;  1W4M A;  3CMY A;  1YS7 A;  2R4G A;  3G4S I;  4LG0 B;  1D8J A;  3OOU A;  1CF7 A;  3GO5 A;  1R4M B;  5FO5 A;  1VQ7 I;  3ZMU A;  3IWF A;  2P5K A;  1W1W E;  3K2Z A;  4RS8 A;  3NEU A;  5DS9 A;  2FU4 A;  1QU3 A;  4KN7 X;  5JLW A;  5LGU A;  1RZ4 A;  1P4A A;  1SVO A;  2VE9 A;  5E1W A;  2L2O A;  2DBB A;  1P4W A;  3RYR A;  1JI8 A;  1SAN A;  2FML A;  3FBI B;  2P7V B;  3G71 I;  3K10 A;  3CCJ I;  1RC9 A;  2FNP A;  5L3D A;  4O5V A;  5GAG J;  2OTJ I;  4NUB A;  2BEO A;  3FHN A;  5KAF C;  1XCV A;  2W25 A;  1X1C A;  2FUG 2;  4L5J A;  1R4N B;  3V7C A;  4C3I J;  4A12 A;  5DCM B;  2LKX A;  1ONV A;  2DYS H;  2IGN A;  2HOT A;  1RR8 C;  1G6N A;  4QLC U;  2EFO A;  1XGN A;  1S5L C;  2V6C A;  2EJR A;  2DTZ A;  1FEX A;  1QZE A;  3GZ5 A;  3I4P A;  2VKD A;  1OR7 A;  1DGR M;  3F22 A;  1B8I A;  2UWM A;  3PSF A;  1G3Y A;  5C44 J;  3OL3 A;  5C4X J;  3QAH A;  2V9P A;  2QA4 I;  2OCC H;  1XGS A;  3IAS 2;  2M1B A;  3L2C A;  1SC7 A;  1O3S A;  1JE8 A;  2BXZ A;  2DLL A;  3FXU A;  1IV6 A;  2WTE A;  1QBJ A;  3QPT A;  3QU3 A;  5J6X A;  5ED4 A;  2EFQ A;  3RZD J;  4MNU A;  3GCM A;  1DP3 A;  2OCE A;  3BJ6 A;  3E3V A;  4L9T A;  1VTN C;  4BUP A;  3LSJ A;  2X6O A;  1IXS B;  3CJT B;  3ERM A;  3KP5 A;  3QOD A;  5LGT A;  1X1D A;  4M9S A;  3A02 A;  5D5U B;  4O3M A;  4PZJ A;  3LSP A;  3S1R J;  2A6T A;  4KT5 C;  4PJM A;  1NK3 P;  3QRF F;  4BJ6 C;  2NVT J;  3HKZ N;  4P5O A;  2BYV E;  4QTR A;  2IBD A;  3PJR A;  4ZJZ A;  2XB5 A;  4NDL A;  2BY2 A;  5DUK A;  3A0B C;  1J7K A;  2HFH A;  1IRX A;  3BCB A;  4ZDO A;  4RM3 A;  1DGW Y;  2CSO A;  3BG5 A;  3JRB A;  2CS3 A;  4WWC A;  1OQY A;  2EZI A;  1D3Y A;  2PMZ A;  2EBI A;  1OYI A;  3E7L A;  1YLF A;  1Y6I A;  2WAF A;  4IHW A;  1XMX A;  2DN0 A;  3PQJ A;  2M7A A;  3DWL E;  5HLI A;  4Y7N J;  2F5F A;  3I59 B;  3DEW A;  3LSG A;  5KHD A;  1IRZ A;  1WKM A;  2ZXJ A;  4E7L A;  2XAF A;  3BR3 A;  1EF4 A;  2F5E A;  3DU5 A;  4BEH A;  4AIK A;  1OR7 C;  2HDD A;  3GTQ J;  5DM6 F;  2W57 A;  4D1Q A;  2CQX A;  1BA5 A;  4HNT A;  3ZMS A;  5EG0 B;  4PJJ A;  3ZQC A;  1W5S A;  2DA2 A;  1LJ9 A;  3AG1 H;  2D2W A;  2X1E A;  3FKI J;  1U78 A;  4MFE A;  1SD5 A;  1VQP I;  2GXB A;  4BBR J;  1B72 B;  1UHS A;  4A3B J;  4E7I A;  4DBR A;  4RLF A;  3RIR A;  5FKL A;  1WWX A;  3QPL A;  1I1S A;  1FC3 A;  2TRT A;  1BM9 A;  1TL8 A;  3FMS A;  3TQN A;  2OTL I;  2BY3 A;  1SEU A;  1I3Q J;  1QPM A;  3MAJ A;  4ABZ A;  2MYS A;  3DEE A;  4AVP A;  1REP C;  4A3I J;  2EFN A;  1ETQ A;  1G59 A;  1STZ A;  1AU7 A;  4G6Q A;  4XSZ F;  4OIO F;  1LFP A;  5ICG A;  4H0E A;  3FHZ A;  1MSF C;  1IW7 F;  3RQ4 A;  1K61 A;  1T8I A;  3ULQ B;  3HDD A;  1X1P A;  1RKW A;  3AG3 H;  3OYM A;  4I76 A;  5H2F C;  5D6F A;  2EV6 A;  5AIP A;  4ZYE A;  2IW5 A;  2O7O A;  2CMP A;  4XKC A;  4BDY A;  3I4N J;  4PUS A;  1FJL A;  4XK4 A;  1E17 A;  4IRG A;  3ABK H;  4OIP F;  1SD7 A;  2DJI A;  4BHP A;  2CYY A;  3BPX A;  2K9N A;  1USS A;  4DW6 A;  1IGN A;  3BR6 A;  4W97 A;  1VI0 A;  2IA1 A;  4D7N A;  2ADU A;  4E4H A;  3H0G J;  1P6R A;  4CO8 A;  4CGZ A;  1MGT A;  3EDP A;  4UV9 A;  5B66 C;  1FBQ A;  4AM3 A;  3FXO A;  4FIS A;  3PO3 J;  5JHU A;  5J1U A;  1QVU A;  1XGM A;  4GXO A;  4WXH A;  1ZGJ A;  2RNG A;  2HOA A;  3IC7 A;  2EWN A;  3ZRG A;  1B59 A;  4DGW B;  4EEF G;  5JR3 A;  2RNJ A;  4BY7 J;  1PUE E;  2X51 A;  1YJN I;  1QA6 A;  1IRF A;  3G1O A;  3MZ8 A;  2CQ7 A;  2L9R A;  4HBL A;  1BW6 A;  5D6E A;  3WE2 A;  2HI3 A;  1A6I A;  3PO2 J;  2R7S A;  2A6E F;  3RKQ A;  3CDI A;  2A5W A;  4RBO A;  2KRH A;  1JKQ C;  3FDY A;  1T98 A;  2AXT C;  3PNY A;  2DA3 A;  1VQO I;  3HC7 A;  3Q0W A;  3GW2 A;  3QP6 A;  2HEO A;  3K7A J;  4V2G A;  3ASN H;  5FD6 A;  3DBR B;  3PM1 A;  3OYB A;  5CLS A;  3TDU C;  2VBY A;  3NWS A;  4OIR F;  2XPU A;  2E7W A;  5E79 C;  3MFK A;  3FX3 A;  5FFX A;  3SJM A;  2V1X A;  3CJN A;  2F48 A;  1DPR A;  3LA7 A;  2NS7 A;  2A6H F;  4ZYG A;  3HL2 A;  1LE8 B;  2Q2E A;  1GHC A;  4UB8 C;  3BG9 A;  1GVJ A;  4KIB A;  1LDD A;  1WPK A;  1ZYR F;  2IJL A;  1WJ5 A;  5D8K B;  5F64 A;  1AKH B;  2PMZ N;  1Q1V A;  1SVL A;  5K7H A;  2X85 A;  4A3L J;  1B1B A;  2COM A;  2XF6 A;  3IUO A;  2XRN A;  4LMY A;  2LY2 A;  4L0Z B;  3ASO H;  1EA3 A;  3M8E A;  4OWR B;  4UUT A;  5EF6 A;  1Z0X A;  1ERD A;  2FMY A;  3JCU C;  3H9G A;  2QQ9 A;  3DKY A;  3L2W A;  1YRN B;  1AA7 A;  4RAF A;  4K2E A;  2XGC A;  1N75 A;  1ZLJ A;  2QQB A;  4IOC F;  2D1H A;  4C3J J;  4UHT A;  1V55 H;  1JJ6 C;  1O7F A;  1NG7 A;  4QPO A;  3S2W A;  5EEA A;  3DXJ F;  2LKS A;  3CCS I;  3K4C A;  3WTZ A;  4HQE A;  4C3H J;  1HKS A;  1WI3 A;  4JYK A;  4XLH A;  3M4O J;  1MND A;  2OD5 A;  2VKE A;  3S93 A;  3JRE A;  3WHC A;  5TGT A;  2JZY A;  2Z3Y A;  4R1H A;  2RN7 A;  1V3F A;  2DT6 A;  1NTC A;  1ETY A;  2XUB A;  3S3M A;  1LDK B;  2LLK A;  2OZ6 A;  3KEY A;  5J4Y A;  2XSD C;  5F0C A;  1O7L A;  2ZXH A;  2K5C A;  3HIF A;  1MJA A;  2IGK A;  2QSH X;  2EFW A;  2H1L A;  5JLX A;  2HZD A;  2WBM A;  2QKM B;  1R9T J;  4FE7 A;  4JBA A;  4A3J J;  2AQF A;  1MKM A;  2F4I A;  2KKO A;  2VN2 A;  1IAW A;  1RUO A;  2QEN A;  2VJ5 A;  5EEH A;  2L9S A;  1LFU P;  1VQ9 I;  4CCJ A;  3HPH A;  4M3F A;  4I09 A;  3J7A Y;  3OR1 C;  2BOL A;  5LRR A;  5CVU A;  4KMF A;  1M1E B;  3QOE A;  2CQK A;  4LK0 F;  1SD4 A;  1W7P B;  5FKK A;  1RIO H;  1MSE C;  2JVH A;  3H36 A;  3MVP A;  2GA1 A;  2D45 A;  4KFC A;  3GTL J;  4ZZL A;  1FTT A;  4RM2 A;  2CUF A;  3MKL A;  3S2D J;  3WOD F;  2L54 A;  4HX7 A;  2EK5 A;  2ZSI B;  3VPR A;  1HKQ A;  5L3F A;  1X3U A;  3WE3 A;  3IV5 A;  2G7H A;  2XB0 X;  3AKZ A;  2GA2 A;  1JUM A;  4I02 A;  4E70 A;  3E1S A;  4BKX A;  5GTH C;  3KCC A;  5L3G A;  1YJW I;  1TZL A;  4LG0 A;  3H1C A;  2L5Q A;  2MFZ A;  2GOX B;  5FLX Z;  2DU9 A;  4LD5 A;  2M4G A;  2A69 F;  5L3B A;  2OJE D;  1D5V A;  2JT1 A;  3FKJ A;  3LA2 A;  2VC0 A;  4RGU A;  4A0Y A;  2E1C A;  3LST A;  3LA3 A;  1IUF A;  1JTY A;  4N4N B;  3HOZ J;  1R6R A;  3LSI A;  2CV1 A;  1XC5 A;  4CIC A;  4DJA A;  3J81 K;  1OCT C;  3LSR A;  1Y8Q B;  5F27 A;  3V7R A;  3ZGK A;  3BRO A;  4BNC A;  3BG7 A;  3M1C A;  4HG2 A;  2DOD A;  5DCM A;  4B48 A;  3TKY A;  2EZL A;  3T1B A;  5LHI A;  2PMU A;  4IKF A;  1J2X A;  5L3E A;  3T8R A;  3WG7 H;  3IH2 A;  2W48 A;  4I7H A;  3HOU J;  2FQ3 A;  5KK1 A;  1EV7 A;  3SZT A;  2CW7 A;  3REO A;  3P9I A;  1Y39 A;  1R1U A;  2JMW A;  3TW7 A;  3G73 A;  2E5N A;  1Z67 A;  4X1E A;  1IN5 A;  3K4L A;  3L2Q A;  5FRM A;  5H6Q A;  2YS9 A;  4HV5 A;  2VE8 A;  3E5Q A;  4L0Y B;  3G2B A;  2GM4 A;  1S8N A;  1U5T B;  2WY8 Q;  3WHB A;  2QCO A;  3B6A A;  1MMD A;  3GZ6 A;  4P55 A;  2FD5 A;  4PSW A;  4C9Y A;  2BHY A;  2CFX A;  2EV5 A;  3K2A A;  2QM3 A;  2VLA A;  4XRM A;  1O57 A;  1J59 A;  3VSK A;  4CUG A;  5IYB J;  2O9L A;  1Q1H A;  2VI6 A;  1IRG A;  3OIQ A;  3S16 J;  2DQL A;  2DCE A;  2WV0 A;  1BL0 A;  1TQI A;  1G3W A;  3IWZ A;  3W6J B;  1IN4 A;  4QIW N;  3H3Z A;  2X6W A;  2RRE A;  1ZG1 A;  3Q5F A;  2LP0 A;  3BPV A;  2M3A A;  4AYB N;  3S17 J;  4YFN F;  3I56 I;  3R0J A;  5AON A;  1BW5 A;  5FB2 A;  4B43 A;  4HZF A;  4MTE A;  3CO7 C;  3RDI A;  2W85 A;  2YPR A;  2R7D A;  3I59 A;  2V26 A;  1QRY A;  5A2Q K;  4QSH A;  3SZP A;  4NHJ A;  2O0Y A;  1YW7 A;  5J47 A;  3ZR8 X;  2V1U A;  3QYB A;  2WAE A;  4PDK A;  4WCG A;  1TNS A;  2ZXW H;  3SXY A;  1KQ9 A;  4BE1 A;  5EG0 A;  1EKE A;  3HOY J;  1T08 B;  1ZLK A;  3L09 A;  3S1Q J;  1APL C;  3FBN B;  1GT0 C;  4IHS A;  1IV8 A;  2KL4 A;  3RI4 A;  2DOA A;  5TJJ A;  3LAP A;  1B72 A;  2BV6 A;  3WTY C;  2VKH A;  4YRV A;  2X6X A;  3KP7 A;  4UXN A;  2K9S A;  4LGW A;  5M3F J;  3KZI C;  3CDH A;  1ZRE A;  4BBS J;  2KJB A;  3AG2 H;  5E3N A;  3HOV J;  1T38 A;  3DV8 A;  1JJ8 C;  3COA C;  4KMU X;  1G8X A;  2PG4 A;  2F5C A;  3BZC A;  2E71 A;  3LSM A;  4EMS A;  4HF1 A;  2E60 A;  4F91 B;  1MJB A;  4HV6 A;  1S6L A;  3I53 A;  3OSF A;  1ZEL A;  2MA3 A;  5HOD A;  3N05 A;  3WTT C;  3BP8 A;  3RKX A;  1XG1 A;  2BHZ A;  1NHA A;  4JX5 A;  2UV1 A;  4BXF A;  2YU9 J;  2ETH A;  4CXF A;  4RAG A;  1EH7 A;  1ETO A;  2DMU A;  5FKO A;  4P1W A;  3PUF A;  4F55 A;  1WH7 A;  2XF7 A;  3E6C C;  1Z77 A;  5HLG A;  3ABU A;  1JKP C;  1XX5 A;  2OUM A;  1KGS A;  1LEB A;  2HVS A;  1IC8 A;  4G7Z F;  5M5X J;  1ZGW A;  1V5G A;  3LWF A;  2IGO A;  3OSG A;  3C7J A;  3HPG A;  3CD6 I;  1U3E M;  4YEL A;  3NAR A;  3A03 A;  2CW0 F;  1FOW A;  2OU2 A;  4A6D A;  1O3Q A;  2FRH A;  3WTV C;  4M73 A;  3N4M A;  1X3Z B;  2MGQ A;  4FQG A;  1YJ9 I;  2DMN A;  1OCR H;  2DFI A;  1HW2 A;  4KYW A;  2CV2 A;  2L0K A;  4BE2 A;  3DU6 A;  1Z6R A;  3OYE A;  5IT9 K;  4MQ9 F;  3OS1 A;  2HDC A;  1N78 A;  3OWT A;  1HDP A;  2A5Y B;  3K6G A;  3QP5 A;  4A5N A;  4D5C A;  4L9J A;  2HVR A;  3ZCO A;  3W2V A;  1FLI A;  4IRH A;  3KFW X;  3A01 B;  3R0A A;  4Q47 A;  2DTR A;  2GIZ A;  4U88 A;  4E7S A;  4M3B A;  4KDP A;  3KIO A;  1YE9 A;  4A3M J;  2CJJ A;  3ABL H;  5LHH A;  1ETW A;  2VOP A;  3TP3 A;  2P5V A;  5FGM A;  1Z05 A;  4HEA 2;  2STT A;  2DT5 A;  1LE8 A;  2XKP A;  4FAS D;  4EV0 A;  1FNN A;  2K4B A;  3R60 A;  4AID A;  3I3L A;  3G3Z A;  3C3W A;  2ZJR F;  5IT3 A;  2RC4 A;  3V8K A;  4OMZ A;  3ROU A;  2KIU A;  1AKH A;  4DZJ A;  4WXC A;  4Y17 A;  1A04 A;  2BY1 A;  1XPX A;  1QZY A;  3LL7 A;  3GTO J;  3BJA A;  3CF2 A;  2L4M A;  3R6S A;  3JRA A;  4Q5S F;  1K83 J;  1VZ0 A;  4PCQ A;  4IEJ A;  1R1V A;  1I5Z A;  5HNF A;  1YRN A;  3KEQ A;  4U0W A;  4A3D J;  3A2K A;  3HGG A;  3H0D A;  2F4M B;  2DFH A;  1PJR A;  2LF8 A;  1VND A;  1XCB A;  3EUA A;  4XRF A;  1H9T A;  1HDD C;  3IHU A;  4LIU A;  3GX4 X;  1FP2 A;  1FT9 A;  3B73 A;  1UG2 A;  2IAI A;  2QSG X;  1FSE A;  2DYR H;  1HXD A;  1T0F A;  3ZMV A;  3AFH A;  4E7K A;  2H6C A;  3FM3 A;  3K1P A;  2CU7 A;  2W1O A;  3FXJ A;  4B3A A;  1UCR A;  2XVC A;  4UV8 A;  4CCO A;  5FD5 A;  3MKZ A;  2P6S A;  2NS8 A;  1I6H J;  2OQG A;  1JXS A;  1ZRC A;  2FSW A;  3B02 A;  2L01 A;  1J0R A;  1SFU A;  3V4G A;  5BQT A;  4CHU A;  2DDB A;  5HVQ C;  2NRA C;  1K6Y A;  4DYR A;  2VKV A;  4HAM A;  4HRI A;  1YTY A;  4HNU A;  5TRD A;  2XGE A;  3BG3 A;  3VYS B;  4KIS A;  4L9N A;  3CCL I;  2W82 A;  4RB3 C;  5LBQ A;  3GVA A;  1RES A;  3BTC A;  1KA8 A;  3FIS A;  3OYC A;  5ICF A;  2AS5 F;  3S14 J;  4L5E A;  2R7V A;  3H3V K;  3UNG C;  2H8R A;  4C2M J;  1PVE A;  1TWG J;  2DMQ A;  5HOO A;  4N4O B;  3OV8 A;  1MMN A;  2ISY A;  2Q1Z B;  3CUQ B;  3VFZ A;  3SDB A;  1POG A;  4I6Z A;  4WX9 A;  1F4K A;  3HUG B;  1ZH5 A;  1FWZ A;  2EV0 A;  2K7L A;  1W7P A;  1WVR A;  4CYC B;  4MLO A;  1MNM C;  1SMY F;  3CJQ B;  3TOB A;  4QWQ A;  4FX4 A;  1RRJ A;  3L00 A;  5LHG A;  3OYA A;  3CCV I;  3MZH A;  4B44 A;  4LIT A;  2HTJ A;  5E1Z B;  1OMI A;  5LGN A;  1KU2 A;  3TO7 A;  1P92 A;  3S15 J;  4BDZ A;  1IXR C;  1MBF A;  5ILU A;  1VQL I;  2IS4 A;  1T0F C;  2IS6 A;  2NNY A;  3CP8 A;  2K9M A;  4RGS A;  4EJO A;  5K5Q A;  3JR9 A;  4EGZ A;  1ON1 A;  2FOW A;  1ZG3 A;  1YW9 A;  2LVS A;  2JK3 A;  1MIJ A;  2HXI A;  4FCY A;  3L1P A;  2E19 A;  1KU3 A;  1ZQ3 P;  4Q4Z F;  2HQR A;  4U87 A;  3F23 A;  1YOV B;  5LLQ A;  1IG7 A;  2EZH A;  2P4W A;  1ZRD A;  3C18 A;  1RPW A;  4ENJ A;  1K79 A;  1EJ9 A;  2ZME B;  3EYI A;  4N9H A;  1XSX A;  3SFI A;  2KRC A;  3HHH A;  1S7A A;  3BWG A;  2NYX A;  5D4S A;  4XRS A;  4BAY A;  1ULY A;  2CUJ A;  4C2T A;  3MN2 A;  2X6Y A;  1UJ8 A;  4ZYH A;  1V5F A;  4AD9 A;  3W2A A;  4A69 C;  2HYG D;  2GWR A;  5HDG A;  3MEX A;  3OR2 C;  5J8F A;  3HTS B;  1ZR4 A;  2QVO A;  3D1N I;  2F5V A;  2J5P A;  4DOZ A;  5E18 F;  4CCN A;  1YIJ I;  3HZJ A;  4ESJ A;  5TIS C;  1DU6 A;  1DQU A;  2FX0 A;  1TW3 A;  2X1D A;  2DA6 A;  3W3C A;  1YS6 A;  2JTV A;  2Z1D A;  2KMU A;  4EM1 A;  4KIC A;  3FIW A;  4BHC A;  4IXA A;  1VQM I;  1GVD A;  4MEX F;  3OIP A;  1ZGA A;  4UVC A;  3ERE D;  4XLN F;  3OYF A;  5K5O A;  1LNW A;  2PEX A;  2KZV A;  3H35 A;  5B3S H;  2QYO A;  2XGD A;  3HSF A;  4KIT B;  4XLF A;  5JFR A;  2NVQ J;  1U5T A;  1U2W A;  3H5R A;  2ELH A;  2Z99 A;  2IS1 A;  3CME I;  2HQA A;  2GXG A;  2PBI A;  1BJZ A;  1BIA A;  2ECC A;  2CO5 A;  3KLN A;  2DK5 A;  3WG9 A;  3VYU B;  2Y75 A;  4O6J A;  5EYR A;  1OPC A;  3EUH A;  2MD5 A;  5CPR B;  1QHG A;  2Y48 A;  4HDU A;  4JX6 A;  2V1N A;  1ENH A;  3JAM Z;  5FLV A;  4NQW B;  5BPI A;  3GXO A;  3FF5 A;  3CTA A;  1RR7 A;  1FYL A;  1GDT A;  1FP1 D;  1WJD A;  4XLE A;  3O2P E;  1WJE A;  2KIQ A;  2EIJ H;  1KYW A;  5ILS A;  5D5X B;  3HEF A;  4HYE A;  3ZOB A;  4LB6 B;  2WV1 A;  1EH6 A;  3BZK A;  2Z2S B;  4XLP F;  4HF0 A;  5FLM J;  2CW8 A;  3DBH B;  3DKW A;  1YG2 A;  4V2F A;  3T8T A;  1IN8 A;  5F1J A;  1WQ2 A;  3KX2 A;  2QWW A;  3HRT A;  3F8B A;  2M45 A;  3JSP A;  1BR4 A;  1O3R A;  2M9H A;  3DCF A;  3VB2 A;  2F6C A;  1OCP A;  1YW8 A;  3TOA A;  5E3L A;  2HYF A;  5D5V B;  1IJW C;  2IA0 A;  1OYY A;  2W00 A;  4P9U A;  4B09 A;  2E1M B;  4L9V A;  3DLL F;  4KIF A;  1U5T C;  2YSR A;  2B0L A;  1RKT A;  1I27 A;  4BH9 A;  2P7C B;  4EJT A;  1SMT A;  5JVT A;  1T39 A;  1K4S A;  3P9K A;  5KAI C;  4J19 A;  4M6V A;  4OIN F;  4KIG A;  4YII A;  2R93 J;  3ZQQ A;  3HOS A;  3V42 A;  2OC6 A;  1BBY A;  5DDG A;  1DU0 A;  1QVT A;  1BC7 C;  4N0B A;  3J80 K;  1R5H A;  2PX9 A;  3ECH A;  4RA2 A;  1BOA A;  4CZZ A;  3GTK J;  2JUC A;  3TGN A;  4RDU A;  1W36 D;  5J40 A;  1B4A A;  1GUU A;  2XC7 A;  1GV5 A;  1Z7U A;  3D5R C;  3GTJ J;  3CO6 C;  5E17 F;  3IKV A;  2MG4 A;  3LSH A;  4E7Z A;  1BI2 A;  2DFE A;  4LLN A;  2C6Y A;  2VOD A;  2PMH A;  1U0J A;  3DTI A;  1G3T A;  3F3X A;  4UVB A;  2YU3 A;  3KP3 A;  2VQG A;  5K1Y A;  2L7M P;  1P2F A;  4IQ4 A;  3QWL A;  2H27 A;  3VWB A;  2QBY B;  3CJR B;  4OOI A;  2ID6 A;  4S05 A;  3KZZ A;  2RQQ A;  3HHG A;  4Y4R A;  1HC8 A;  2XPV A;  1YX5 A;  2W7N A;  3CES A;  2WAQ A;  4IHX A;  4GGG A;  2DFF A;  1E3P A;  1IF1 A;  2GIV A;  5EZG A;  3ZMT A;  4BS9 A;  1O4X A;  5CVR A;  1T2K A;  3RTR A;  1TNT A;  1R5I D;  2RV8 A;  4AYB A;  1GXQ A;  4I0A A;  5D5W B;  1ZAR A;  3FXR A;  2LRD A;  2YX7 A;  1WJC A;  2XKO A;  3KYL A;  2R0Q C;  4EM0 B;  1HLV A;  1KZH A;  3S32 A;  2L02 A;  3KP4 A;  3H5N A;  1WRJ A;  3CZ6 A;  2K9Q A;  4ZTF A;  1BN5 A;  2P81 A;  5B1A H;  2GLO A;  2R7U A;  1A6Q A;  2LKP A;  3A01 A;  2HR3 A;  4II3 A;  4RAY A;  4XM3 A;  2ZSH B;  1MH3 A;  2ME0 A;  2TCT A;  5E3O A;  4B47 A;  2KDZ A;  4ASN A;  2GAU A;  4MEY F;  1OLT A;  4HPQ A;  3EQL F;  2XAG A;  4FET A;  1D1A A; 
#chains in the Genus database with same CATH homology
 4OMY A;  2E1N A;  2KIM A;  3GLX A;  4R79 A;  2ZNZ A;  3WGI A;  1J75 A;  1KQ8 A;  2PFB A;  3HSR A;  3L7W A;  2IA2 A;  3I64 A;  2ACJ A;  3KEO A;  1XMA A;  1MD0 A;  5ERI A;  3ML6 A;  2HS5 A;  3K1M A;  3I54 A;  1U6G A;  5E8I A;  1BIB A;  4EM2 A;  3RKY A;  2PI0 A;  1LEA A;  1S3J A;  1R00 A;  1RUN A;  2GQQ A;  3ZN1 A;  1ZG5 A;  2BGC A;  2ZO4 A;  5DUI A;  4M9X A;  3RPQ A;  4L18 B;  3EET A;  3CUQ A;  4BQA A;  4IHT A;  2V9V A;  3HUG A;  2ZKZ A;  2MC3 A;  4MGR A;  3KET A;  3SQN A;  4UVA A;  2YR2 A;  4LK1 F;  4RAZ A;  3V7S A;  2FEZ A;  3RPU A;  2HGC A;  3ECO A;  3JTH A;  2ISZ A;  3ELK A;  1F1Z A;  2FNA A;  2ZBK A;  3QOP A;  4L5I A;  1K7A A;  3PQK A;  5DCF A;  4LLG F;  3VEP A;  2V1D A;  2XGX A;  2Z33 A;  2KJC A;  1RI7 A;  1FYK A;  3DF8 A;  1FSH A;  2PN6 A;  2ZME A;  4I2O A;  4HX4 A;  4HLY A;  2XAJ A;  5ILV A;  2OBP A;  1C0W A;  4M6X A;  2A07 F;  1DPU A;  3LFK A;  1HSJ A;  1QZZ A;  3FMQ A;  2HWV A;  3W6K B;  1KU7 A;  1RNL A;  1J5Y A;  4ESB A;  5CVJ A;  4Y13 A;  2A68 F;  3E6M A;  4KNY A;  2OAZ A;  2VXZ A;  3NRV A;  4FX0 A;  1HW1 A;  3J81 Z;  2R3S A;  4GCV A;  4ETS A;  1TQM A;  4DNC A;  2O61 A;  4Z2Y A;  1KYZ A;  1U8R A;  2EA4 A;  3U9G A;  5BMZ A;  4G7O F;  3DP7 A;  5BPD A;  3WU1 B;  3BJO A;  2JRT A;  2ZJ2 A;  3DFG A;  1D8K A;  2HKO A;  3J7A O;  4CYD A;  1ODD A;  4HOB A;  3SFZ A;  4NQW A;  4BXU A;  4ZH4 F;  3BDD A;  1HBX G;  4YIF A;  4RB0 A;  5CVV A;  2LDU A;  1K6O A;  4RB1 A;  2ZCW A;  2NAZ A;  2NS0 A;  2W84 A;  3KLO A;  5HS8 A;  3RKW A;  2XAQ A;  2OA4 A;  3K1N A;  2FE3 A;  3M8F A;  1QGP A;  2VT2 A;  1B9N A;  3FZV A;  5HDK A;  2DPU A;  2HQN A;  2UXN A;  1YQA A;  2Z9O A;  5A2Q Z;  5LEJ A;  1H9G A;  1S7O A;  1L3L A;  5HLH A;  3ISP A;  2FXA A;  4OU0 A;  2GZW A;  1Z6T A;  1XD7 A;  2OZU A;  4M74 A;  4IRI A;  3E97 A;  1HQC A;  2TDX A;  2ZNY A;  4I01 A;  3KZY A;  2VC1 A;  4M9Z A;  1UFM A;  4KUM A;  2XAH A;  3M1E A;  5KVR A;  3R4K A;  1W5T A;  1FBS A;  1BC8 C;  3QU6 A;  4WK8 F;  5L3C A;  4F7Z A;  2QBY A;  2OQR A;  1W7P D;  3HYI A;  4MTD A;  3RYP A;  3I5U A;  4A0Z A;  2STW A;  3AAF A;  2FA5 A;  4ZYD A;  2O03 A;  1MDM B;  3DPL C;  5H6R A;  4IF4 A;  3TO9 A;  1BJA A;  2AXL A;  5E1X A;  1R22 A;  1UHM A;  3P9C A;  2EB7 A;  3U2R A;  1B6A A;  2IP2 A;  4KN4 X;  1XSV A;  2IVM A;  2MLG A;  4BHB A;  2CGP A;  2JPB A;  3BZ6 A;  3ZMD A;  5H20 A;  4S04 A;  5J8C A;  3WGH A;  1YIO A;  2IRF G;  2QZ8 A;  4ENN A;  3DQV C;  1FYM A;  3JAM K;  5DEQ A;  4FHT A;  3F8M A;  5E20 A;  5FFZ A;  5IT9 Z;  2L3D A;  4EJW A;  2M8E A;  2RKH A;  4GYI A;  1BI1 A;  2FOK A;  2H09 A;  3ABT A;  2BE5 F;  4I0B A;  2XHK A;  5F6F A;  3GFJ A;  4A0X A;  1XB4 A;  2Q8K A;  3LQR A;  2XV4 S;  2EFP A;  1LVA A;  5DD8 A;  3Q9S A;  3M7G A;  4FT8 A;  4EQQ A;  1HST A;  4YFX F;  2VT3 A;  1QNT A;  3JW4 A;  3H92 A;  1KQ0 A;  2NNN A;  1JHF A;  2K02 A;  3HOT A;  4UUV A;  1OKR A;  1AWC A;  1YYV A;  1OYW A;  1WI9 A;  3ZMZ A;  2H94 A;  5BOX A;  1XDS A;  3QPH A;  4ESF A;  2RQP A;  2ESH A;  2CG4 A;  2F5D A;  5EEG A;  1F9N A;  2P6T A;  4P96 A;  3WTU C;  1UB9 A;  3V8J A;  1IN7 A;  5CYV A;  1XGO A;  1MZB A;  1XN7 A;  3K0L A;  2M30 A;  1R36 A;  4HA8 A;  4HDV A;  4TV7 A;  2P8T A;  2KIF A;  3GFI A;  2A3S A;  5DD4 A;  2DI3 A;  2FBI A;  2G9W A;  2Z5U A;  4HQM A;  2LF7 A;  4RGX A;  2PLY A;  4IVN A;  4NB5 A;  1CGP A;  3DEU A;  1I1G A;  1G3S A;  3V8L A;  1FPQ A;  3I71 A;  2CWE A;  1ZHF A;  1LB2 A;  2IPQ X;  2A61 A;  3H3U A;  1HKT A;  4G6D A;  4YG2 F;  2DQR A;  1ON2 A;  2DW4 A;  4LJZ F;  5DV5 A;  2X4H A;  3ZP5 A;  2XIG A;  1TLH B;  3R61 A;  2W24 A;  2J5O A;  1R23 A;  2M87 A;  3D5L A;  1QQI A;  4GYG A;  3WGG A;  3HSE A;  4YFK F;  4P9F A;  1HW5 A;  1MJ9 A;  3FWE A;  1Z91 A;  1R58 A;  3CLO A;  4LFU A;  1K78 B;  1G4D A;  4G8X A;  5FLX K;  4U0Y A;  1SD6 A;  1PP8 F;  1I6X A;  4B8X A;  3K9T A;  4HX8 A;  2G7U A;  1S29 A;  1UHW A;  3RJP A;  1FX7 A;  5D4R A;  2ZFW A;  3GYH X;  3O6B B;  2RVC A;  3F8C A;  1JHH A;  3JSO A;  4Q48 A;  4U0V A;  4WXD A;  1CF7 B;  5LEK A;  2R7F A;  2F2E A;  5BS6 A;  4UNO A;  3P7N A;  1V4R A;  3OOP A;  1JGS A;  4M6Y A;  4D0P A;  3VOD A;  3SHF A;  2MH2 A;  3T5X A;  2H6B A;  4BYY A;  1LDJ A;  2VON A;  2RDP A;  1R7J A;  1T6S A;  3WU0 A;  4XBF A;  1QO0 D;  1UST A;  2K4J A;  3CUO A;  2FF4 A;  1Z9C A;  3E5X A;  3L9F A;  2LNB A;  2UZK A;  2HOE A;  3HTU A;  2PJP A;  3MCZ A;  4IJA A;  3GFM A;  4A6E A;  3IRQ A;  1R5G A;  4JQF A;  4LLL A;  4RB2 C;  4MQV A;  4U7D A;  3U1D A;  1TTY A;  2HKX A;  4OIQ F;  3FXQ A;  5D8L B;  4ENM A;  2MH9 A;  2HZT A;  1ZAO A;  1SFX A;  1O3T A;  1KU9 A;  3NQO A;  4I98 B;  4EJU A;  3J80 Z;  3ZPL A;  4A5M A;  4G94 A;  4ON0 A;  4WF2 A;  3E6B A;  4PGH A;  3TO6 A;  3HRU A;  1MDM A;  4EVI A;  1YFH A;  1SAX A;  3ZN0 A;  1FBU A;  4JK1 X;  3GEZ A;  1GXP A;  3F21 A;  3KE2 A;  1ZN2 A;  3E6D A;  2VBX A;  2WWY A;  1AOY A;  1IXC A;  2E7X A;  1TW2 A;  3GWZ A;  2P5L C;  2VOO A;  3LQQ A;  3N97 A;  1H0M A;  5LRS A;  1F5T A;  3C1D A;  1IZ1 A;  3FM5 A;  2FBH A;  4XSX F;  2JSC A;  4DQ2 A;  2K86 A;  2PQ8 A;  4AIH A;  3F6O A;  5F1R A;  4M72 A;  5HS9 A;  4N9I A;  1ZRF A;  2EA2 A;  3IKT A;  1E2X A;  4AWX B;  1XMK A;  2QUF A;  1LQ1 A;  2O6G E;  3TDZ C;  1B9M A;  3I0T A;  1Y0U A;  2M5W A;  5ICE A;  4GO1 A;  2DAO A;  2DK8 A;  4EJV A;  3F8F A;  5CJ9 A;  3F72 A;  3D0S A;  3FMR A;  1FOK A;  2HTS A;  2KRF A;  2FBK A;  4ZZD A;  5K5R A;  1IUY A;  3M9A A;  2L4A A;  3CUQ C;  3GF2 A;  3LAJ A;  3ZQ7 A;  3HRM A;  1FY7 A;  2WC2 A;  4KA4 A;  1P4X A;  4PGG A;  3T0Y A;  1SFE A;  2MLK A;  3GUD A;  4MHG A;  2K27 A;  2BBY A;  1YO5 C;  4A2U A;  5ICC A;  3Q9V A;  1XDU A;  1DP7 P;  4IPA A;  2Q0O A;  3BY6 A;  3EYY A;  1XSD A;  3IL2 A;  3DPT A;  5HS7 A;  3PFI A;  1DDN A;  1IN6 A;  4RGR A;  2DO7 A;  1TBX A;  3WTS C;  2D1V A;  2XRO A;  6PAX A;  1PDN C;  5AIQ A;  2O3F A;  2XAS A;  2V79 A;  3F8N A;  3E5U A;  3VOE A;  1L0O C;  4M71 A;  1PP7 U;  1BI3 A;  4HF2 A;  2DPD A;  3O3K A;  4HLX A;  4CDG A;  2MBF A;  2YX4 A;  2X0L A;  1R1T A;  3JTG A;  3BOQ A;  1BI0 A;  3KP2 A;  5E8G A;  2UXX A;  3GFL A;  4G9Y A;  1Z1D A;  3K69 A;  1J9I A;  2JPC A;  5HDN A;  1EH8 A;  3HRS A;  4EGY A;  3WTW C;  1DUX C;  4AIJ A;  2QQA A;  3KP6 A;  2VBW A;  2RGV A;  4Y15 A;  2VBZ A;  3I58 A;  3MQ0 A;  3MZY A;  4HW0 A;  3IRR A;  2Y0M A;  4U7B A;  5JI6 A;  1K78 A;  2ESN A;  1FZP B;  1TQP A;  1WSU A;  2O8X A;  4R8H A;  3WTX C;  2LSO A;  4G7H F;  3MWM A;  2QLZ A;  3F6V A;  4ENK A;  5DYM A;  5CVI A;  4LB5 A;  2IT0 A;  1W4M A;  1YS7 A;  1D8J A;  4LG0 B;  1CF7 A;  3GO5 A;  5FO5 A;  3ZMU A;  3IWF A;  2P5K A;  3K2Z A;  4RS8 A;  3NEU A;  2FU4 A;  4KN7 X;  5LGU A;  1RZ4 A;  1P4A A;  2VE9 A;  5E1W A;  2DBB A;  1P4W A;  3RYR A;  2FML A;  2P7V B;  5L3D A;  2FNP A;  4O5V A;  2BEO A;  1XCV A;  2W25 A;  4L5J A;  4A12 A;  3V7C A;  5DCM B;  1ONV A;  1G6N A;  4QLC U;  2EFO A;  1XGN A;  2V6C A;  2EJR A;  3I4P A;  3GZ5 A;  1OR7 A;  3F22 A;  2UWM A;  1G3Y A;  3QAH A;  1XGS A;  2M1B A;  3L2C A;  1O3S A;  1JE8 A;  2DLL A;  3FXU A;  2WTE A;  1QBJ A;  3QPT A;  3QU3 A;  5J6X A;  5ED4 A;  2EFQ A;  4MNU A;  3E3V A;  3BJ6 A;  4L9T A;  1VTN C;  3KP5 A;  1IXS B;  5LGT A;  4M9S A;  5D5U B;  4O3M A;  4PZJ A;  4KT5 C;  3QRF F;  4P5O A;  2BYV E;  5DUK A;  1J7K A;  2HFH A;  2CSO A;  4WWC A;  1D3Y A;  1OYI A;  1YLF A;  3PQJ A;  5HLI A;  2F5F A;  3I59 B;  1WKM A;  2ZXJ A;  2XAF A;  2F5E A;  4AIK A;  2W57 A;  3ZMS A;  1W5S A;  1LJ9 A;  2D2W A;  1U78 A;  1SD5 A;  2GXB A;  3RIR A;  1I1S A;  1WWX A;  1FC3 A;  1BM9 A;  3FMS A;  3TQN A;  1QPM A;  3MAJ A;  4AVP A;  1REP C;  2EFN A;  1STZ A;  4G6Q A;  4XSZ F;  4OIO F;  5ICG A;  4H0E A;  3FHZ A;  1IW7 F;  3ULQ B;  5D6F A;  2EV6 A;  5AIP A;  4ZYE A;  2IW5 A;  1E17 A;  4IRG A;  4OIP F;  1SD7 A;  4BHP A;  2CYY A;  3BPX A;  1USS A;  2IA1 A;  2ADU A;  1P6R A;  4CO8 A;  4CGZ A;  1MGT A;  3EDP A;  4UV9 A;  1FBQ A;  5JHU A;  1XGM A;  4GXO A;  4WXH A;  1ZGJ A;  3IC7 A;  2EWN A;  1B59 A;  5JR3 A;  2RNJ A;  1PUE E;  1IRF A;  4HBL A;  5D6E A;  3WE2 A;  2A6E F;  1T98 A;  3GW2 A;  3QP6 A;  2HEO A;  5FD6 A;  5CLS A;  3TDU C;  2VBY A;  4OIR F;  2E7W A;  3MFK A;  3FX3 A;  5FFX A;  2V1X A;  3CJN A;  3LA7 A;  1DPR A;  4ZYG A;  2A6H F;  2Q2E A;  1GHC A;  4KIB A;  1GVJ A;  1LDD A;  1ZYR F;  2IJL A;  5D8K B;  5F64 A;  1B1B A;  2COM A;  4L0Z B;  2XRN A;  4LMY A;  3M8E A;  2FMY A;  2QQ9 A;  4K2E A;  1ZLJ A;  2QQB A;  2D1H A;  4UHT A;  1O7F A;  3S2W A;  3DXJ F;  3WTZ A;  4HQE A;  1HKS A;  2OD5 A;  2JZY A;  2Z3Y A;  4R1H A;  2RN7 A;  1V3F A;  2XUB A;  1LDK B;  2OZ6 A;  1O7L A;  3HIF A;  1MJA A;  2EFW A;  4JBA A;  1MKM A;  2KKO A;  2VN2 A;  1IAW A;  1RUO A;  2QEN A;  5EEH A;  4I09 A;  5LRR A;  5CVU A;  4KMF A;  4LK0 F;  2CQK A;  1SD4 A;  1W7P B;  1RIO H;  2GA1 A;  2D45 A;  4KFC A;  4ZZL A;  3WOD F;  2L54 A;  4HX7 A;  2EK5 A;  1HKQ A;  5L3F A;  1X3U A;  3WE3 A;  2G7H A;  2GA2 A;  4I02 A;  4E70 A;  3KCC A;  5L3G A;  4LG0 A;  5FLX Z;  2DU9 A;  4LD5 A;  2A69 F;  5L3B A;  1D5V A;  2JT1 A;  4RGU A;  3LA2 A;  2VC0 A;  4A0Y A;  2E1C A;  3LST A;  3LA3 A;  4CIC A;  3J81 K;  3V7R A;  3BRO A;  4BNC A;  5DCM A;  3TKY A;  3T1B A;  5LHI A;  2PMU A;  1J2X A;  5L3E A;  3T8R A;  4I7H A;  2FQ3 A;  5KK1 A;  1EV7 A;  3SZT A;  3REO A;  3P9I A;  1R1U A;  3G73 A;  1IN5 A;  5H6Q A;  4HV5 A;  2VE8 A;  3E5Q A;  4L0Y B;  1S8N A;  1U5T B;  3GZ6 A;  4P55 A;  2CFX A;  2EV5 A;  2QM3 A;  1O57 A;  1J59 A;  1Q1H A;  1IRG A;  2DQL A;  2WV0 A;  1TQI A;  1G3W A;  3W6J B;  3IWZ A;  1IN4 A;  3H3Z A;  1ZG1 A;  3Q5F A;  3BPV A;  4YFN F;  3R0J A;  5AON A;  5FB2 A;  3CO7 C;  4HZF A;  4MTE A;  3RDI A;  2W85 A;  2YPR A;  2R7D A;  3I59 A;  5A2Q K;  3SZP A;  4NHJ A;  2O0Y A;  1YW7 A;  2V1U A;  4PDK A;  4WCG A;  1TNS A;  3SXY A;  1KQ9 A;  1ZLK A;  3L09 A;  4IHS A;  3RI4 A;  5TJJ A;  3LAP A;  2BV6 A;  3WTY C;  3KP7 A;  4UXN A;  4LGW A;  3CDH A;  1ZRE A;  2KJB A;  1T38 A;  3DV8 A;  3COA C;  4KMU X;  2PG4 A;  2F5C A;  4EMS A;  4HF1 A;  1MJB A;  4HV6 A;  1S6L A;  3I53 A;  2MA3 A;  3WTT C;  3BP8 A;  3RKX A;  1NHA A;  2ETH A;  4CXF A;  1EH7 A;  3E6C C;  5HLG A;  3ABU A;  1KGS A;  1LEB A;  4G7Z F;  3LWF A;  3C7J A;  1U3E M;  2CW0 F;  2OU2 A;  4A6D A;  1O3Q A;  2FRH A;  3WTV C;  4M73 A;  3N4M A;  2DFI A;  1HW2 A;  4KYW A;  1Z6R A;  5IT9 K;  4MQ9 F;  2HDC A;  2A5Y B;  3QP5 A;  4A5N A;  4L9J A;  1FLI A;  4IRH A;  3KFW X;  3R0A A;  4Q47 A;  2DTR A;  4U88 A;  4KDP A;  5LHH A;  2VOP A;  2P5V A;  5FGM A;  1Z05 A;  2STT A;  2DT5 A;  2XKP A;  4EV0 A;  1FNN A;  2K4B A;  3R60 A;  3G3Z A;  3C3W A;  5IT3 A;  2RC4 A;  3V8K A;  4OMZ A;  3ROU A;  2KIU A;  4WXC A;  4Y17 A;  1A04 A;  1QZY A;  3BJA A;  3R6S A;  2L4M A;  4Q5S F;  4PCQ A;  1R1V A;  1I5Z A;  3KEQ A;  4U0W A;  2LF8 A;  1XCB A;  4XRF A;  1H9T A;  3IHU A;  3GX4 X;  1FP2 A;  1FT9 A;  3B73 A;  1FSE A;  1HXD A;  1T0F A;  3ZMV A;  2H6C A;  3FM3 A;  3K1P A;  1UCR A;  2XVC A;  4UV8 A;  5FD5 A;  2P6S A;  2OQG A;  1JXS A;  1ZRC A;  2FSW A;  3B02 A;  2L01 A;  1J0R A;  1SFU A;  3V4G A;  5BQT A;  4CHU A;  5HVQ C;  2NRA C;  4HAM A;  1YTY A;  5TRD A;  4L9N A;  4RB3 C;  5LBQ A;  3GVA A;  1KA8 A;  5ICF A;  2AS5 F;  5HOO A;  3OV8 A;  2ISY A;  3CUQ B;  3VFZ A;  4WX9 A;  1F4K A;  1ZH5 A;  1FWZ A;  2EV0 A;  2K7L A;  1W7P A;  1SMY F;  3TOB A;  4QWQ A;  4FX4 A;  3L00 A;  5LHG A;  3MZH A;  2HTJ A;  5E1Z B;  1OMI A;  5LGN A;  1KU2 A;  3TO7 A;  1P92 A;  1IXR C;  5ILU A;  2NNY A;  4RGS A;  4EJO A;  5K5Q A;  4EGZ A;  1ON1 A;  1ZG3 A;  1YW9 A;  1KU3 A;  4Q4Z F;  2HQR A;  3F23 A;  5LLQ A;  2P4W A;  1ZRD A;  3C18 A;  4ENJ A;  1K79 A;  2ZME B;  3EYI A;  4N9H A;  1XSX A;  3HHH A;  1S7A A;  3BWG A;  2NYX A;  5D4S A;  4BAY A;  1ULY A;  4ZYH A;  4AD9 A;  2HYG D;  2GWR A;  5HDG A;  3MEX A;  5J8F A;  3HTS B;  2QVO A;  2J5P A;  5E18 F;  4ESJ A;  1TW3 A;  1YS6 A;  2JTV A;  4EM1 A;  4KIC A;  4BHC A;  4IXA A;  4MEX F;  1ZGA A;  4UVC A;  3ERE D;  4XLN F;  5K5O A;  1LNW A;  2PEX A;  2QYO A;  3HSF A;  5JFR A;  1U5T A;  1U2W A;  2ELH A;  2Z99 A;  2GXG A;  2PBI A;  1BIA A;  2CO5 A;  3KLN A;  2DK5 A;  3WG9 A;  2Y75 A;  4O6J A;  1OPC A;  3EUH A;  2MD5 A;  4HDU A;  2Y48 A;  3JAM Z;  5BPI A;  3GXO A;  3FF5 A;  3CTA A;  1FYL A;  1FP1 D;  3O2P E;  1KYW A;  5ILS A;  5D5X B;  4HYE A;  4LB6 B;  1EH6 A;  4XLP F;  4HF0 A;  3DKW A;  1YG2 A;  3T8T A;  1IN8 A;  1WQ2 A;  2QWW A;  3HRT A;  3F8B A;  2M45 A;  3JSP A;  1O3R A;  3VB2 A;  3TOA A;  1YW8 A;  2HYF A;  5D5V B;  2IA0 A;  1OYY A;  4P9U A;  4B09 A;  4L9V A;  4KIF A;  1U5T C;  2YSR A;  2B0L A;  1I27 A;  4BH9 A;  2P7C B;  4EJT A;  1SMT A;  5JVT A;  1T39 A;  3P9K A;  4OIN F;  4KIG A;  4YII A;  3HOS A;  1BBY A;  5DDG A;  1BC7 C;  4N0B A;  3J80 K;  1R5H A;  3ECH A;  1BOA A;  4CZZ A;  3TGN A;  1B4A A;  1Z7U A;  3CO6 C;  5E17 F;  3IKV A;  1BI2 A;  4LLN A;  2C6Y A;  2VOD A;  2PMH A;  1G3T A;  3F3X A;  4UVB A;  2YU3 A;  3KP3 A;  5K1Y A;  1P2F A;  2H27 A;  2QBY B;  4OOI A;  4S05 A;  3KZZ A;  3HHG A;  4GGG A;  1IF1 A;  2GIV A;  3ZMT A;  5CVR A;  1T2K A;  3RTR A;  1TNT A;  2RV8 A;  1GXQ A;  4I0A A;  5D5W B;  1ZAR A;  3FXR A;  2YX7 A;  2XKO A;  4EM0 B;  2L02 A;  3KP4 A;  1WRJ A;  1BN5 A;  2LKP A;  2HR3 A;  4RAY A;  4ASN A;  2GAU A;  4MEY F;  3EQL F;  2XAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...