1WJBA

Solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, 40 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Zn-binding protein
molecule keywords HIV-1 INTEGRASE
publication title Solution structure of the N-terminal zinc binding domain of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 10
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1wjbA00
1KONA 1WJCA 1WJAA 1WJDA 1WJBA 3HPHA 3HPGA 1K6YA 1MW7A 1LFPA 1WJEA 1WJFA 1E0EA 3F9KA 4F3QA
chains in the Genus database with same CATH superfamily
3Q5FA 2IS4A 2NNNA 3BPXA 1ZN2A 1IJWC 4AUXA 2O3FA 2HOTA 5DM7F 3KZIC 3NEUA 4EGYA 1DGWY 5D5XB 2DA4A 3CJRB 4RAYA 4LK0F 2NS0A 3CCLI 5ERIA 4XN3A 1JHFA 1VQKI 2MYSA 5DD4A 2A5YB 4A6EA 2KJBA 5C4XJ 2XPUA 4N4OB 4LMYA 4L0ZB 1A04A 4XOTA 1P4WA 2EFWA 3FZVA 4MFDA 4HDUA 3GTGJ 3OY9A 4F93B 3IKTA 3TKYA 1XX5A 1EJ9A 1FY7A 4BUPA 4YELA 1P7IA 1LVAA 4A12A 1V3FA 4UUSA 5K7HA 2M3AA 2Y69H 3BG6A 2PQ8A 2CUFA 2LF8A 1VQPI 3RJPA 4Q4ZF 1MBKA 2LG4A 4PSXA 4PFOA 3ECHA 3WHCA 4XLPF 1GHCA 1TT5B 1IXCA 2K27A 2F4MB 4BQQA 4ZYAA 2DXIA 4HX7A 2EK5A 4BXUA 5GAHJ 1UG2A 1WRJA 1BN5A 3KEQA 1K4SA 1Y56A 1S7EA 3F72A 3LL7A 2M8EA 2DQLA 3H5RA 3BG7A 3QOPA 4MQVA 4CICA 3TGNA 3S1NJ 3ESWB 4F91B 2HOEA 3CUQB 2Q0OA 3V42A 3WTYC 1GVDA 3EUHC 3ULQB 4U0YA 4MTEA 1UHSA 1HKQA 1UB9A 4WXHA 5B1BH 5DTDA 1FMWA 2W48A 3WTZA 2BY2A 3OYLA 1ORKA 3ZQQA 3JREA 2HVRA 2EZKA 2E7WA 1S6LA 2WB1N 2EPFA 3NRVA 1XGMA 4IEJA 5HS8A 3AAFA 2EB7A 5CQEA 4XBFA 4EJWA 1S72I 1YLFA 5E1ZB 4UV9A 5JLWA 3WGIA 4ESJA 2X51A 3EQLF 1DP3A 2XGDA 2VI6A 3DKXA 1B72A 1WI3A 3A01B 2ZXWH 2TCTA 4G7OF 1DU6A 3H5NA 1TT0A 2ZMEB 3VB2A 1W5TA 2AQFA 2A05A 1FEXA 5E20A 3L00A 2RQQA 2H94A 3DEEA 4ZYDA 3OYEA 2OCEA 2V26A 1ULYA 2MC3A 1S9HA 1VQ6I 2L54A 2W4SA 2VQCA 2HVSA 2FQ3A 2E5ZA 1BJZA 3ZQIA 3DV8A 4IF4A 1GDTA 2B9SA 2ZNZA 3ZQHA 1RZ4A 2DJNA 5DS9A 1F5TA 3P7NA 2H6BA 4QPQA 3QP6A 5HNFA 4YIRX 5HS7A 3HSRA 1BOAA 1Z05A 1BC8C 2IPQX 2ME6A 4WWCA 2DT6A 2L0KA 2A6EF 3WHBA 3HXLA 3SYTA 3VYTB 5GTIC 1ZRCA 1IRXA 1KU2A 4FISA 1Z77A 3TP3A 3BC8A 1CQTA 2WTEA 2ADUA 2PFBA 2R5YA 2FQ4A 3OYMA 4CGZA 5DEQA 1VQLI 3GZ6A 4M9XA 1OPCA 5ICCA 3DLLF 1FOXA 4XRFA 3G1OA 3N4MA 1FOYA 1K6YA 2DI3A 2STWA 5CJ9A 4I0BA 2FEZA 1MMAA 3DPLC 1JT6A 1ZLKA 2HQRA 3OR2C 1G3SA 3BDDA 4HF0A 4F7ZA 4I02A 4PGHA 2FF4A 1K79A 1FSEA 4GRIA 4XKVA 4I99C 4G6TB 3G71I 4A3MJ 1SC7A 4BKXA 3O6BB 4PJJA 4NDLA 1UMQA 3L2UA 2NS7A 5JHUA 1KONA 1XGSA 3BG3A 1CF7A 1GUUA 3FK6A 2JVGA 3IWZA 2ESNA 2QQ9A 3FXQA 4P96A 4ESFA 1HW5A 3E6MA 2RGVA 3FF5A 2CJJA 5EYRA 1SANA 5J1RA 1OCCH 1TZLA 2FX0A 3OWTA 1IUFA 3HRMA 4I2OA 1XDUA 3OYHA 3EUHA 3OIOA 3LA7A 1A6IA 3K2AA 3MD2A 4RM2A 1D0ZA 4WXDA 2QQBA 4C3JJ 2UWMA 3SQNA 1HF0A 1OCTC 5CVJA 1XTAA 4OIOF 1TNSA 3KIOA 4HLXA 2ID3A 1XCBA 2PJPA 2RV8A 3LSHA 1IF1A 2FBIA 4AWXB 4IHTA 2F5DA 4M71A 3WG9A 4L9NA 2CUEA 3BY6A 4R79A 1R00A 1SMTA 2PMHA 1NG7A 3F8CA 2W24A 4JYKA 2GA2A 5AIPA 5D5UB 2I10A 4XLAA 4L5EA 4IRIA 4DNCA 3OIQA 2JA7J 3CD6I 1I1SA 3G2BA 1EA3A 1IN5A 2Z2SB 1R5ID 1SFEA 2F6CA 4HAMA 5H2FC 4HRIA 3S3OA 3OOPA 3GTMJ 3ZMSA 2OC6A 1W5SA 3L2WA 1ETQA 4GYIA 4W1UA 4I01A 4HF2A 5LBQA 2YU9J 4IVNA 4X6AJ 1KGSA 5JVGF 3UKGA 3ZMDA 3GVAA 4XORA 4D5CA 2CW8A 2XIGA 1P6RA 4N9IA 1ZRDA 2E2IJ 3QQAA 2L9RA 4HV5A 3BQYA 2P7CB 4KISA 3IUOA 1P4AA 4R1HA 4PJNA 1MNDA 4LK1F 1ON1A 3HOTA 1DPRA 2E35A 1TWAJ 4W97A 3LAJA 1FYLA 2OF7A 3GEZA 3CC4I 1SD7A 4UB6C 1IW7F 4U0VA 4CYCB 2L7ZA 2CYYA 5D6EA 2P0WA 1U9OA 3KYLA 3L9FA 5E3LA 2HWVA 2ZJ2A 4OIPF 2XAFA 1RUNA 1K4TA 2ID6A 2XKOA 2P6TA 3Q3SA 3HOWJ 1D5YA 2VBWA 4XLHA 3ABKH 2ACJA 3LQQA 5E3MA 4BE2A 2HFHA 2VQLA 2CQNA 2HR3A 1UHMA 2MD5A 4Y3OA 2JUCA 1WJEA 4Q48A 4UVBA 2ZSIB 4FTHA 5K7FA 1VNDA 3M1EA 3EUKL 3S2WA 4XIDA 2JSCA 3R6SA 2EH3A 3H9QA 3FKJA 3ABLH 2K86A 3FXJA 2XAJA 2Q2EA 3CDLA 1XS9A 1X2MA 2GIZA 3TDZC 1WHUA 2KDOA 2M2EA 3NWTA 2Q8KA 3BPVA 5K5OA 4IXAA 3VDXA 2EBIA 1MW7A 4M6VA 2R92J 1DU0A 3A1YA 1YITI 2ECCA 2F5CA 1MMSA 3FMRA 3TBIA 3P9KA 1MMNA 5AONA 1ZGWA 2NYXA 1VFCA 2PJRB 3HTSB 4L9VA 3RDIA 5IT3A 2F5FA 1TW2A 2L9NA 3S8PA 4D5FA 2LP0A 3JRIA 5B1AH 5F04A 1YJ9I 1HLVA 1JKOC 2JSPA 2GA1A 1PP8F 2O6GE 1VQMI 2QM3A 1FIPA 3CC7I 1YX3A 2E36A 3I55I 1W36D 1USSA 3CCEI 4UY8I 3MWMA 3CP8A 5FLMJ 2HZDA 3V7RA 1PP7U 1D0XA 5JVTA 4AIJA 4M3GA 2A07F 5K5QA 4L9TA 1YTYA 1IRGA 2LYCA 2AHQA 3GFMA 2L02A 1MBHA 4KIFA 4HYEA 4JX4A 4XNFA 2VC1A 3GTJJ 2CFXA 1STZA 2O61A 4XRMA 5BOXA 2Y9YA 4RAGA 2VJJA 4AVPA 2L01A 3X2QH 1R1TA 3F8NA 4KICA 3WTXC 3JCUC 4XN0A 5J4VA 3TOBA 4RB1A 3GTKJ 1QVUA 4ESBA 1RIOH 1OQYA 4ZH4F 4YRVA 3I9V2 4NB5A 3S1RJ 2LLKA 2LY9A 4CUGA 4E4HA 4IOAF 1KYZA 5LRSA 1W7PD 2M9HA 3PSFA 3L1PA 2BVMA 3CMMA 4OWRB 4E7KA 3SZTA 3LQRA 1LE8B 1HBXG 2LFBA 5CVVA 1QPIA 1EH6A 1GLNA 2HVQA 2VL8A 3QODA 2HTJA 2IA2A 5EJCA 2XAQA 4DZJA 2WV0A 3DCFA 4P5OA 2KZGA 5J1UA 4PCQA 4UUTA 3H0DA 3LFUA 4KMUX 2K7LA 1XG1A 4M6YA 3FXRA 1USTA 1PUEE 4H4KC 3BG5A 1MIJA 1WJBA 2FU4A 3WG7H 1FOKA 4Q47A 2LY2A 1DPUA 3CCMI 1AOYA 2BBYA 3TW6A 2ZMEC 3HOVJ 2ZBKA 4PZJA 4B1RA 1AU7A 5FD5A 3TQNA 2IVMA 2FNPA 3FMSA 4DBQA 3SHFA 3VWBA 4UHTA 1IC8A 4GDFA 3BJOA 3JAMZ 1ETKA 3JTHA 2CV2A 3AL0B 4B43A 3CUOA 2KP6A 3S93A 2LD5A 2BY0A 1S29A 3FHNA 4BEHB 3R60A 2M0MA 3N97A 2BEOA 2CV0A 4C3HJ 2HZTA 2DOFA 3HC7A 5FRNA 4NQWB 1KU9A 4FE7A 2QKMB 1L3LA 1NG6A 3L09A 4X0GA 1XSVA 2DA7A 2GBYA 2ZFUA 4HG2A 4IJAA 1IZ1A 1RNLA 5JI6A 2CUJA 3E1SA 2XVCA 3H9GA 1D1AA 2OU2A 5CQGA 3D5SC 4OAZA 1I50J 2E1OA 4KUMA 4Y4RA 3VSKA 5ICEA 5KHDA 3OYCA 4LFUA 3DTKA 4OMZA 4PGGA 3HGGA 5IYCJ 1Z9CA 2X1CA 2HKOA 3U2RA 1ONVA 1AA7A 3BTJA 1J2XA 2RC4A 2VPRA 3KPHA 5HS9A 2E2JJ 3D1NI 4A69C 3LA2A 5D8LB 1RKWA 3IH4A 2V1NA 5A2QZ 4OIRF 4N4NB 1VQOI 1V55H 3FK7A 4QTRA 3CCYA 1NK3P 1RUOA 3H35A 2KL4A 3ZQLA 3O2PE 2JVHA 5TRDA 4HNTA 2WWYA 1X3UA 1KQ0A 1HA8A 2KHMA 2ETHA 1MJAA 3M07A 5GADJ 2HYJA 5ILUA 5FLVA 1OMIA 3DBRB 3FWEA 4WCGA 3CO7C 1BOBA 1SAXA 3CUQA 4LIUA 2ZJRF 1ZLJA 3V8LA 1BL0A 3ZPLA 3LA3A 1N75A 4G9YA 2JA2A 5DCMA 4XK4A 4G6DA 2ZFWA 2L4AA 3S1MJ 2V4JC 3J7YJ 1YRNB 2HQAA 2LKSA 4XQFA 1S7OA 1E3HA 5D6FA 4HX4A 1ZG1A 3KYDB 4CO8A 3E6DA 2HDCA 5E8GA 4CCOA 2VPLA 2OA4A 4YFXF 2VQGA 3RIRA 4ITVA 1JT0A 3CCUI 2V6EA 1N25A 1JHHA 1ETYA 2DU9A 3I5UA 4B48A 1IXRC 4KN7X 3ZXSA 1IUYA 5M3MJ 2HQNA 3OYIA 3A01A 4HLYA 5FKLA 2ME0A 4E70A 2O9LA 3BP8A 2EZHA 2ZMEA 2QWWA 2ZKZA 1WJCA 2FMYA 2BHZA 2ICWG 2E19A 4I7HA 1X1PA 2X0LA 4U88A 1WI9A 1JI8A 3D5LA 2VQHA 3E5XA 1HW2A 2P5VA 3P9IA 2OBPA 3OS1A 2JQ7A 3OSFA 2XKPA 2HPMA 1HDPA 2NVTJ 3BOQA 5L3CA 2DDBA 2FSWA 5BNGA 1JGGA 3I4NJ 1S5LC 3MVPA 2KQRA 1I6XA 4LLLA 5GPCA 3I4PA 3KP7A 3CMYA 3JRDA 2OQGA 2CW7A 3RQ4A 1D1BA 3F9KA 3Q9SA 3S32A 5GAGJ 1O4XA 4CHUA 4RAZA 2RKHA 3H92A 2M4GA 1T95A 2LRDA 1F43A 2VODA 2VXDA 2BW3A 4Z2YA 5M5WJ 3PQJA 4BL0B 1SEUA 3OYDA 2BY3A 4QWQA 3KLNA 3M8EA 2R7RA 2V1UA 3G1LA 2KIQA 2OJED 1ON2A 2IW5A 2H09A 3DBLB 1S7AA 2UXXA 1LUJB 4II2A 4HNVA 1I5ZA 1QGPA 4BBRJ 1FC3A 2M0CA 1TQMA 3UR3C 3PNYA 3B73A 4KIGA 1ZGJA 3DEUA 5BPDA 4P55A 2MH2A 2OAZA 3I64A 2EIMH 1AHDP 2LTPA 2W1OA 4IHSA 4HSRA 3OYNA 1T2KA 1GVJA 3RCOA 3QP5A 2EWNA 2BOLA 3ZQCA 2PMUA 1R5GA 3ZR8X 3B02A 3J7AO 3CJTB 3FIWA 5BS6A 1LFPA 1VQ9I 1PYVA 4HBLA 3I53A 2QKLB 1R23A 4G12A 4JQFA 3AKZA 2V9KA 1JE8A 4RDUA 2DQRA 3LOCA 5CVUA 1VQ4I 2YUSA 4FQGA 4AIDA 1FP1D 2DBBA 2DT5A 5J8FA 4P9FA 2LR8A 4G7ZF 1R5HA 1TNTA 4CCNA 2DO7A 1OFCX 4JP0A 2DA5A 1O57A 3PUBA 2K40A 3COAC 3TW7A 1JTYA 1XGOA 4BH9A 3FBIB 4ZTFA 1W7PA 2KMUA 3B6CA 1ZG3A 2VJ5A 4O3MA 2G7HA 4MNUA 1MD0A 5ED4A 2JT1A 1LNWA 2BGCA 4BU2A 2FMLA 1V5FA 4MEYF 2K4JA 3QU6A 2R5ZA 5FKMA 2DMQA 2XF7A 4ABZA 2GXGA 3DU6A 4IX7A 3RSNA 4ASNA 4MGRA 2ELKA 1M1EB 4QIWN 1TP4A 3K2ZA 3BLYA 5EGOB 3JTGA 1ZR2A 2F4IA 5EG0B 1WVRA 1XC5A 3KETA 4KJZA 2Y75A 3A02A 3HRTA 3G1MA 3HSEA 3JAMK 1SVOA 5E3NA 1Y1VJ 4MLOA 2EV5A 4I09A 4LJZF 4MIMA 3IAM2 4OOIA 4EQQA 1X3WB 1W5CC 5EEGA 1SFXA 2E1MB 5K7ZA 2O8KA 4XL9A 1U8BA 4UVAA 2M4KA 3LSMA 4IPAA 2V1DA 2HEOA 1YO5C 3BWGA 4LOCA 3SJMA 1SAUA 3RKXA 1B8IB 4XM3A 4KMFA 3BTIA 4V2FA 1SVLA 1YS7A 5EEAA 2X1DA 1T39A 4P9UA 4CYCA 2OUMA 4ZYHA 3CP2A 2QENA 3C1DA 3SDGA 1MDMB 3LSTA 5F64A 5DD8A 3RZOJ 1ERDA 1UG0A 2UZKA 3V8JA 4DIQA 2HNHA 1EH8A 1IRFA 2VKVA 4PDKA 1T8IA 2HYGD 5E18F 4EGZA 3OYAA 4BHCA 1SD6A 3ABTA 4NHJA 1J5YA 1FPQA 5J40A 3KFWX 5F0FA 5A2QK 5FD6A 2MG4A 4KITB 2WY7Q 3CCRI 1A35A 2X85A 2UV1A 3E6BA 4FCYA 3NAUA 2M34A 4UVCA 2VKHA 2JN6A 2IJLA 4BBSJ 2CO5A 5JR3A 4GO1A 3W6KB 2Z33A 5ILVA 3U1DA 2WAQA 4U87A 2KFDA 4PSWA 1YW8A 1MMGA 3H5AA 2BVLA 1GXPA 1U3EM 3H9JA 4G7HF 1RC9A 3E5QA 1QQIA 1BBYA 3SXYA 4BNCA 1X1AA 5FRMA 1IG7A 4AVZA 4BDYA 1P4XA 2LK2A 3VFZA 1KA8A 4A3FJ 3BROA 2IGOA 3DP7A 1OCOH 1QO0D 3I59A 4U0WA 2DFFA 1IN7A 4B3XA 2QF7A 2E2HJ 2KDZA 3OYKA 2QZ8A 2HXIA 3OYFA 3TL4X 4XRSA 2L7KA 3JRBA 3VEPA 1DP7P 3KLOA 5HVQC 4LITA 1BR2A 3K7AJ 2PEXA 3JRCA 2D45A 2L3DA 2QSFX 1AWCA 3GLXA 3AG4H 1VTNC 4JK1X 2P5KA 1OYYA 2D1HA 3L2VA 4I98B 1NTCA 4WF2A 3H3VK 4XLEA 5DYMA 3LSIA 4KA4A 5IYDJ 2YX4A 1MBFA 2D2WA 1U5TB 4AU7A 3A0BC 3HDDA 1R7JA 1X4OA 1Z67A 2W84A 2LBFA 2GXBA 1ZG5A 5HDNA 4LLNA 2CWEA 2XAGA 3CCSI 3WGHA 2DMPA 2CQQA 3KE2A 2Z99A 3CF2A 5DUIA 3IAS2 4Y52J 3RKQA 2XRLA 4A3LJ 3HKZA 1Z1DA 1BI0A 4ENJA 3KP2A 1OISA 1WJ5A 1WQ2A 3Q9VA 4BQAA 4DGWB 1TC3C 3CLOA 2QYOA 2Z1DA 3AG2H 4LD5A 4EJOA 2RAEA 2XC7A 4AD9A 3A0HC 4PK4A 2DYSH 2QSHX 4NBQA 5D5VB 4YIIA 4XLFA 4H0EA 2W25A 2FD5A 1YW7A 4I6ZA 4M3DA 1FIAA 1MJ9A 1R1UA 5IT9Z 1T98A 2FOWA 1T38A 2K02A 2DT7B 3QYBA 4UUSB 2IGKA 5BMZA 1J0RA 2CRGA 3I54A 3GTOJ 2IGNA 3K69A 1MGTA 2CSOA 2WA0A 1ACIA 4RLFA 1I39A 2KRHA 4ZJZA 3J81K 1YI2I 5C44J 2HOAA 2LVSA 3GBGA 1K78B 2AO9A 2ECBA 4A3BJ 3E97A 5DDGA 4C2TA 1G4DA 5LHGA 1TWGJ 1K6OA 3GFLA 2VIXA 3NARA 3O3KA 2VT3A 5F27A 3D0SA 1ZTRA 2NVXJ 1O7LA 1PVEA 2A6TA 4BQOA 1FLIA 2AXLA 2VOOA 5FFZA 3HOXJ 2X9DA 3H0GJ 4XMYA 3SFZA 3HOYJ 3WU2C 5IP7J 1GV5A 1WCMJ 4BEHA 2IXSA 2MH9A 3K1PA 3M1CA 4OMYA 3BR6A 4EATA 2A61A 2IS6A 1B1BA 5LEKA 2X4HA 1C0WA 3BG9A 2VOPA 1H89C 1W1WE 2CUZA 1QHHD 3R4KA 3OL4A 4N0BA 4NQWA 2K9QA 3WGGA 3U1KA 4C9YA 3MZ8A 2CV1A 2E34A 4RMNA 2XGCA 2GOXB 3FISA 4IRGA 4L9JA 2E71A 4DOZA 1KU3A 3P5JA 2WAQN 1LFUP 2EFQA 5H6QA 3CC2I 3WTUC 3IH3A 1TLHB 2ZNYA 2EV6A 5KCMA 1APLC 5LEJA 1YHQI 4F3QA 4Y7NJ 1TQIA 1Z7UA 1QVTA 1XPXA 2BZTA 4M9SA 3WTTC 1FP2A 5DM6F 4IQ4A 2DOEA 2EFNA 3BZ6A 2WY8Q 4IKFA 1B72B 1OR7C 4EV0A 1LFBA 1O3QA 1FX7A 4L18B 2BV6A 1YIJI 5CLSA 1LKXA 1VI0A 4ZYGA 1SD4A 4G94A 4FX4A 4Y13A 1J9IA 1JJ6C 1UAAA 3KCCA 3K10A 2JZYA 2WAEA 1B59A 4AC0A 4OINF 3CCJI 2GLOA 5KAFC 4M6XA 2B63J 2CS3A 4JBAA 2Y0MA 3KZZA 1TW3A 2HS5A 2KJCA 2H8WA 1OKRA 3PL8A 1T08B 3FXUA 3ZOBA 5L3BA 1FTZA 5LGTA 1BR4A 2YSRA 4BAYA 3DKYA 2YPRA 2QGUA 3BR0A 3VPRA 3FHZA 2VLAA 1Y6IA 1NHAA 4PJ0C 2XASA 5FJ8J 1ZR4A 2LH9A 4A3CJ 3JW4A 3BR2A 5TGTA 5HLTA 3BR3A 1YRNA 2R5YB 2ELHA 3B6AA 2R7VA 2WADA 3F8FA 2JPBA 1HSJA 2E1NA 3HKZN 3RYRA 2PLYA 2JA6J 1WJFA 2QCOA 2PBIA 2VB6A 3C7JA 4CA0A 1EV7A 4A3IJ 3M8JA 3GF2A 2DK8A 2ESHA 3OYGA 4C30A 1D3YA 5F0HA 1IN8A 2EFOA 4XONA 3M4OJ 1ZKGA 2F48A 4NC8A 5FB2A 2W82A 2DMUA 3GO5A 1XD7A 1SFUA 2HTSA 1HDDC 3CUQC 2EILH 3OV8A 3KX2A 3RI4A 3JRFA 4LB6B 5H6RA 1CF7B 3GX4X 3WE3A 3MCZA 2EA4A 1J7KA 3LSJA 3MKLA 3GLLA 1MNMC 1KQ8A 1QRYA 4BE1A 5EEHA 4CDGA 5M5XJ 1QBJA 1E17A 4ZZLA 2A3SA 1TTYA 1F36A 4ZDPA 2STTA 1UJ8A 1A36A 3KEOA 1AKHB 3MZHA 3H3UA 3WTSC 2IBDA 3ECOA 3IWFA 3TDUC 1WFXA 1F1ZA 3LNQA 1DUXC 2NOJB 3ZQFA 5IY5H 2NS8A 3RPUA 5B5EC 4CZCA 4ENMA 4UNOA 2LDUA 4F52A 1HXDA 2EV0A 2P8TA 4ANJA 4IO9F 2IA1A 3K1MA 5FO5A 2MFZA 4IHVA 1KU7A 2GWRA 2KISA 4B44A 2R3SA 2UUZA 4A0ZA 4BXXJ 1WJDA 3CJQB 3HEFA 4NUBA 3IRQA 3WTWC 1BIAA 1OR7A 2XDVA 5E3OA 3DTIA 1MBGA 5HOOA 2K85A 3L2CA 1NH3A 4A93J 4IZZA 1Z21A 4J19A 1G3WA 4XR6A 2OCCH 3GFIA 3RKWA 1YJNI 5CYVA 5ILSA 4HF1A 4CCLA 3ABUA 3PUFA 5E8IA 2NOGA 3S3NA 5IYBJ 2XV4S 4BDZA 4HV6A 4EEFG 1QU3A 2EQRA 2AS5F 3BZKA 3K6GA 4A0YA 4HNUA 2V1XA 3HB9A 2F5EA 2HXOA 1QZZA 1R6RA 4NC6A 4OAYA 4ZC3A 5BQTA 4IQJA 3CZ6A 2JPCA 2O7OA 1BJAA 2V9PA 2VASA 1K61A 4LIVA 1EKEA 4MO7A 2VKEA 3QRFF 2CMPA 4MTDA 4KT5C 3C2BA 3IC7A 4IHWA 2D1VA 1BI1A 1XSDA 3E0JB 2K9NA 3W2VA 1GT0C 2DPDA 3U21A 3CDHA 4BY7J 3SFIA 5TISC 2DN0A 2TRTA 2RNJA 2MBFA 3ZN0A 3HOUJ 1F9NA 3N05A 3ZN1A 3S3MA 5FFXA 4I0AA 1IDZA 1OCPA 5ICFA 5IT9K 3KP5A 1ETVA 1JUSA 3HTUA 4HW0A 4OU0A 1XMXA 3V8KA 2LKXA 3BZCA 1U5TC 5B3SH 4UUVA 3J7AY 5EGOA 3FDYA 2JA8J 2YX7A 3G73A 2Q2EB 4MFEA 1X58A 4S0HB 2OTJI 1HOMA 2MLGA 3FM5A 3K1NA 5TJJA 4XKCA 3BT9A 4HX8A 2OTLI 2HPIA 3S1QJ 4E7LA 2P5LC 1PUFB 2ZJQF 4D7MA 3MKZA 1Z3YA 3AG1H 2ZC2A 1NK2P 2H8RA 1SVMA 2PMZA 2QBYB 2K3FA 3QPLA 4ON0A 1G59A 1ZREA 2L4MA 2XPWA 3QYFA 5HLHA 4GCVA 2KRCA 2X6WA 2Y2ZA 4E7JA 3JRHA 1T6SA 3OS2A 4UXNA 3HRSA 2RREA 4M3FA 5FGMA 4J00A 1BR1A 1P9QC 3M8FA 1Z7LA 2V7FA 3HHHA 3TOAA 1WKMA 4FASD 4V19K 2R7UA 5E17F 3MKWB 2HU9A 3PIOF 1MBEA 1MDMA 4DJAA 1FMVA 5IOZA 4S05A 2M1BA 5JLXA 3TO7A 1V54H 2K5CA 4B8XA 4CXFA 5ICGA 3J7ZI 2O8XA 3WTVC 1WWXA 5D4RA 1BM9A 4J01A 5HDGA 5M3FJ 1XDSA 3ZMZA 1A31A 1V5GA 2IAIA 4BHBA 2EFPA 2P81A 1IO2A 4EM2A 1W0TA 2DW4A 3HM5A 2CGPA 4F55A 1LDJA 2P6SA 3ZP5A 4B47A 1XMKA 3LFKA 4CCJA 2DLLA 4ZTJA 2QSGX 1GXQA 1UELB 1I6HJ 2MSYA 3QPSA 2DPUA 4ZYEA 4EMSA 2DK5A 1I1GA 2NRAC 3VODA 1LEAA 2K9LA 2EZLA 2IP2A 3HUGB 4RS8A 2XGEA 1X1BA 3HSFA 1OJLA 3JR9A 1X1DA 1KZHA 1SFKA 3V7SA 1JJ8C 3JSOA 1YYVA 3DU5A 1YE9A 4EM1A 3A03A 3ZRGA 4AIKA 4FX0A 2KIUA 4RAFA 1X19A 2FBHA 4RA2A 2LF7A 4MHGA 3GZNB 3H36A 5GPAA 2COMA 2Y0SA 3DPUA 1BA5A 1HKTA 3NQOA 2LMDA 2A68F 2AQEA 2IEKA 1OYWA 3CCVI 1E2XA 2TDXA 1ETOA 3HG9A 1G6NA 4UV8A 2YU3A 2XHKA 4LGWA 4A3JJ 1U5TA 3KEYA 5IOYA 3TO9A 5IP6A 3F22A 1OLTA 2QQ8A 3BCBA 2DDAA 1L0OC 2CH0A 2FXAA 1UCRA 1Y1WJ 3RYPA 1RR7A 1PJRA 3HL2A 3W3CA 2ZXHA 2M30A 3FKIJ 1RKTA 3IHUA 3L2RA 2R7XA 3BQZA 2LSOA 4XOPA 5IP9J 2O03A 3IRRA 4XICA 1XB4A 4BY1J 3DPTA 1VQ8I 4RGUA 5FKOA 1N77A 5AIQA 1FJLA 1BI3A 5LHHA 1RI7A 2JTVA 1PDNC 1BC7C 2EIKH 4S04A 4HPQA 1U6GA 3WU0A 2PMZN 4ZDOA 2EJRA 2YR2A 1TBXA 2LREA 4E6KG 3CMEI 2Y9ZA 1HKSA 2Y30A 4RB3C 3LAPA 1U78A 1R9TJ 1MH4A 2FA5A 5GP9A 5L3FA 5FKKA 5B66C 1RETA 2M7BA 4PUSA 2VJ4A 1GV2A 5J3LA 3ZQGA 3PSIA 2VC0A 4L5IA 1IV8A 2F5VA 5L3DA 1K78A 2RVCA 5LGNA 2W7NA 2BYVE 1QZYA 2MGQA 1FNNA 1ZRFA 2R0QC 2H27A 3SEZA 2LNBA 5KK1A 1LJ9A 1WZ2A 2CQ7A 2DTRA 3OIPA 2HKXA 1B9MA 5KVRA 3S14J 2XAUA 4JOMA 5F0CA 3OR1C 3R61A 3FBNB 5DV5A 5DCMB 3HPHA 4EM0B 2KRFA 3KP4A 3SZPA 2XROA 1ZH5A 5K1YA 1ZARA 2ELJA 1R4NB 2DA2A 2MLKA 5LLQA 1YFHA 4ZZDA 2NNYA 3OSGA 5L3EA 4O5VA 3LSRA 2E1CA 3IP4B 2KIMA 1IV6A 1TWFJ 1QHGA 4L5JA 1P92A 1Y39A 3CF5F 2QQAA 4A0XA 1OCRH 5E1XA 3ONQA 1X1CA 3FXOA 1O3RA 1K7AA 2DFHA 1T0FC 2G0EA 3CESA 2CQKA 2Z3YA 3MZYA 3Q0WA 4HZFA 2NVQJ 4KIBA 1EH7A 2JMWA 5E1WA 5FLXZ 3AL0C 4B09A 2L9SA 2ZCWA 3S2DJ 2GAUA 1LDDA 1YOVB 3HHGA 1W0UA 2F4OB 2M45A 2DFIA 1SFOJ 3PFIA 2EIJH 1UZCA 5LHIA 4EJUA 2ISZA 3F3XA 3GUDA 1Y0NA 4BJ5C 2PG4A 2OV7A 5IPAA 2W00A 5CVRA 1VQ7I 3RPUD 4IHXA 2Y0SN 2WV1A 3RQIA 2K9SA 2AXTC 2O0YA 4K2EA 1O7FA 2E60A 3RTRA 1YIOA 2PJRA 2KIFA 3JRGA 2JK3A 4DQ2A 3CTAA 2JRTA 3K9TA 2VXZA 2RQPA 4M73A 1CGPA 1V4RA 1D8KA 1YS6A 2BW3B 1R1VA 2DMNA 4FHTA 1LEBA 2FRHA 3DF8A 4KDPA 3BR1A 3ZMVA 1FYMA 3RKYA 4EJTA 2D5VA 3OL3A 1MJBA 2VBZA 1Q1HA 4CCKA 3T8RA 4RB2C 4A3EJ 2RN7A 3GCMA 4X1EA 4LG0B 1FTTA 2WBMA 2X6YA 4XKWA 4CH7A 4GGGA 4BS9A 2HDDA 2DA6A 2R7QA 2F2EA 3PJRA 3QPTA 3BR5A 2I8DA 5F1RA 1J75A 2HOSA 2WAFA 5KAIC 1Z0XA 3EYYA 3ERED 4HOBA 3LMMA 3SDBA 1D5VA 3EYIA 2ZXIA 2DA1A 1BI2A 4FT8A 2GQQA 3F6OA 3FXKA 4Y15A 1G8XA 3F21A 2R7OA 3REOA 4Y33A 4E7HA 4QSHA 2L9VA 2E7XA 1JKQC 2XF6A 3AFHA 5BPIA 3VYRB 1J59A 2XF5A 3PNVA 3O8HA 3R0JA 1E0EA 1HC8A 1LE8A 2R7SA 2NVYJ 2CU7A 1F4KA 5HNHA 1ETXA 1X3ZB 2R7FA 1I3QJ 1U9NA 2NXNB 2PX9A 3CQZJ 4R8HA 3EPZA 1AKHA 3K4NA 4PFPA 2QUFA 3NWSA 1POGA 1SMYF 3DFGA 5EZGA 4ZDLA 4RM3A 1W7PB 3AG3H 4WX9A 1E3PA 3QU3A 2CFOA 3ASOH 3GFJA 3IKVA 3L7WA 3JSPA 1MZBA 2RNGA 1VQ5I 4ETSA 4XLNF 2M5WA 3WU1B 3MKYB 3K4LA 2GOMA 3GTQJ 2R5ZB 4A3GJ 2KLOA 4LG3A 1JKRC 3V4GA 5D4SA 3E7LA 3EUAA 4YIFA 2V9VA 4HA8A 1JKPC 2CG4A 2G9WA 2VUMJ 1I27A 1T0FA 2K9MA 3MMYB 5JFRA 1YQAA 2H1KA 2L7FP 1O3TA 1EF4A 2XAHA 3H3ZA 1ITYA 2FJ1A 1R58A 4BXFA 2QEXI 2B7EA 3VYSB 3HGYA 3MFKA 1XSXA 3UNGC 2DOAA 5LFAA 4Q5SF 2L5QA 3U9GA 3KYCB 2K3PA 1Y8RB 4CCMA 1YJWI 4E7SA 4IL6C 3MAJA 3K4JA 3PQKA 1DGRM 3K70D 1A6QA 1BW6A 2VBXA 1ENHA 1YW9A 4QLCU 3GYHX 3HPGA 1S8NA 2CW0F 3GMEA 1BIBA 3DQVC 4XRSG 4RGRA 3EDPA 4DW6A 1RRJA 4BGDA 1G3TA 3CO6C 3I71A 1D0YA 1UHWA 3BJAA 3F8BA 4XSZF 3S15J 1ZK8A 1XCVA 2WC2A 1ZHFA 4II3A 4ENNA 4HQMA 1FYKA 1IGNA 1FZPB 2ZSHB 3PNTA 1N78A 3SZGA 1P2FA 1HQCA 4A2UA 2VJIA 4KFCA 3C3WA 1ZGAA 2BHYA 2W57A 3PIPF 3WE2A 5D5WB 4XSXF 3G3ZA 2IA0A 1VQNI 3DKWA 1FOWA 4GFBA 1JXSA 4HDVA 2HYFA 2W85A 4RBOA 1T33A 2Y48A 2FOKA 1WH7A 2G7UA 1ODDA 1MMDA 1K83J 3MN2A 2KT0A 3S16J 2LY1A 3O8GA 5DUKA 3T5XA 1LQ1A 3C2GA 1IRZA 3ZQ7A 5LRRA 1HSTA 3J80Z 3CDIA 3GTLJ 2A69F 3MQ0A 5CKTA 3GWZA 1FBUA 1D1CA 2NAZA 4MEXF 1MKMA 4P1WA 2ZO4A 5HLGA 4GYGA 2R7DA 1O3SA 2LOOA 2DAOA 2BXYA 2XRNA 4E7ZA 3HZJA 2Z5UA 1XMAA 2P4WA 1PUFA 2DA3A 2EINH 3HIFA 3Q0VA 3I4MJ 2VE9A 2R7TA 2IT0A 3D5RC 3I59B 2QBYA 2X48A 3A2KA 1P7JA 3KZYA 4U7BA 5EZHA 5J47A 3W6VA 4YFKF 1MH3A 4XLCA 2KZVA 3A4CA 1W4MA 3I3LA 3H1CA 2YS9A 1ZELA 3JRAA 1MNEA 2JWTA 4OIQF 3V7CA 4BYYA 1MSFC 3R0AA 2XGXA 4G8XA 4RLQA 4XKBA 1H0MA 3I0TA 6PAXA 4EJVA 4YG2F 2GM4A 3QWLA 4V2GA 4BQNA 5C4JJ 1BW5A 4AYBA 2R4GA 3WODF 1REPC 1Z3XA 4KYWA 4D7NA 4IOCF 5FLXK 3HBLA 1E3OC 5FKNA 4FE4A 3F6VA 4Z6YA 4HSTA 4G6QA 2PI0A 2L2OA 2MA3A 2LBFB 2KPMA 1KQ9A 2O5RA 2E1MC 1X4PA 3F0CA 3LWFA 1LB2A 2QVOA 5HLIA 1VF9A 4UB8C 2DFEA 3KP3A 2COBA 3QPHA 2JJ7A 3Q0UA 1RR8C 3ASNH 1LPQA 2FBKA 1IN6A 1J09A 3VYUB 3DTEA 3PO3J 3K70C 4D1QA 4BHPA 1I3AA 1B6AA 5C3EJ 4ENKA 1TWHJ 3C18A 4U7DA 2JUGA 4WK8F 3F8MA 1H8AC 4BJTA 2HQ5A 3BTCA 3BCAA 3HUGA 4CZZA 3BTLA 1FBSA 1QA6A 3TMOA 2M87A 4I76A 2JRMA 3C2HA 2OD5A 2XUBA 3W2AA 3CLQA 3ROUA 2OPTA 3FXMA 1VZ0A 2IGMA 4PJMA 2R7ZJ 3GXOA 5LD2C 5M5YJ 1U0JA 5F08A 1TQPA 2DCEA 4DYRA 3GZ5A 2DJIA 3ABMH 4WXCA 4KT6A 1LVKA 3CCQI 1FBQA 2KKOA 3FM3A 3PFYA 3K4MA 1JUMA 1ZAOA 4C3IJ 3CMAI 4LB5A 1R71A 5J8CA 4M74A 3ISPA 3M9AA 2XB0X 3OYJA 3PO2J 3K4KA 3QOEA 3P9CA 3ELKA 3OS0A 3L2QA 4A3KJ 3IV5A 1WSUA 5J1YA 1FSHA 4E7IA 1RPWA 2X1EA 4AM3A 2DYRH 2IRFG 1Q1VA 2XPVA 5CVIA 2GXAA 1Y8QB 4JX5A 3PM1A 4LLGF 4BE0A 1JTXA 1WJAA 2ZXJA 1WH5A 3GTPJ 5KNLA 2I5UA 4F92B 4A5MA 5K5RA 4DBRA 2PN6A 4YFNF 5JHFA 4KNYA 4PJLA 2J5OA 3CJNA 3OYBA 2VONA 4DYCA 2K4BA 3ZMUA 3T1BA 4DZPA 3RZDJ 4C2MJ 2ZJPF 2VBYA 1G2HA 1HW1A 2A6HF 2NVUB 4A3DJ 4AIHA 1IDYA 3E6CC 1S3JA 3I58A 3LSKA 2M7AA 3F23A 1TWCJ 1Y0UA 4QPOA 2Q1ZB 1RESA 1QNTA 1W36C 3ERMA 1QPMA 3T0YA 2UXNA 4N9HA 5CPRB 1G3YA 1OYIA 1U8RA 1JGSA 4M72A 4M9ZA 3VOEA 5GTHC 5F6FA 4B3AA 2FUG2 2DTZA 5EG0A 3HJEA 1TL8A 3BJ6A 4B4CA 2XSDC 1IN4A 3TP0A 2HI3A 2ZB9A 1X2NA 3DWLE 3QAHA 4RGSA 3HOZJ 1MBJA 3QYEA 1R4MB 3MEXA 1R49A 3HRUA 2LKPA 5E79C 4RGXA 1JUPA 1OCZH 2R7WA 2EZIA 3OOUA 4AYBN 5LGUA 5EDNA 4M3EA 1U2WA 3K0LA 3G4SI 2JA5J 5D8KB 1FT9A 2N8GA 2X6XA 3E3VA 3DEWA 3EETA 2LC2A 1QZEA 1IAWA 4C2UA 1V5EA 4KN4X 2MC4A 5DCFA 1B8IA 4HEA2 5J4YA 3SEQA 2XSJC 5HODA 3T8TA 2H6CA 5GAEJ 2Z9OA 2VE8A 3HOSA 4EVIA 1WGXA 4D0PA 4DYQA 3OMYA 1KYWA 4CSWA 4M3BA 2OZUA 5FROA 3G6EI 1B4AA 4HQEA 4A6DA 5F1JA 2EA2A 1SD5A 2VN2A 1H9TA 1FWZA 5HDKA 1A5JA 1HCRA 2V6CA 1ETWA 1ZYRF 3GW2A 4Y17A 2E5NA 1T56A 1ZQ3P 2X6OA 1XGNA 2Z16A 2QLZA 2IS2A 2DODA 1R36A 4NC7A 3LSPA 3M7GA 2FNAA 2P7VB 2BY1A 2ISYA 4L0YB 3IL2A 1B9NA 2VT2A 9ANTA 2WB1A 3FX3A 4NNJA 3DXJF 2IS1A 4IRHA 4MQ9F 5J6XA 2B0LA 3M3YJ 3K4BA 3J80K 4O6JA 2CQXA 4FETA 3W2WA 4D9JA 2FE3A 2XB5A 5L3GA 4RB0A 3ZCOA 4BACA 4IHYA 3ZGKA 2H1LA 3FMQA 3ZMTA 2V79A 1DDNA 3VSLA 3TEDA 2HGCA 2J5PA 1Z6TA 1Z6RA 1YX5A 4YEJA 1LDKB 2Y31A 1D8JA 3KP6A 2L7MP 2MD0A 2MW8A 4A5NA 2VKDA 1XN7A 2GIVA 3S17J 4CYDA 1WPKA 3ML6A 2RDPA 2A5WA 2DMTA 3I56I 4TV7A 4LG0A 3IH2A 2M8GX 5EF6A 1DQUA 2BE5F 3HYIA 4BJ6C 3J81Z 2C6YA 1R22A 3RPQA 1Z91A 2MABA 2OZ6A 3S2HJ 1YG2A 3TO6A 2GZWA 2HDWA 3E5UA 1H9GA 1UFMA 1MSEC 1IXSB 3FXLA 2R93J 2OQRA 3DBHB 3LSGA 1H88C 3K4CA 5H20A 2QA4I 3W6JB 4JX6A 2BXZA 3DLAA 4GXOA
chains in the Genus database with same CATH topology
3PL8A 1AA7A 2IS4A 2WBMA 2X6YA 4XKWA 4CH7A 1DGWY 1BR4A 3CJRB 4BS9A 3DKYA 2R7QA 2V1NA 2VLAA 1Y6IA 4N4NB 3PJRA 4XN3A 2I8DA 2MYSA 2LH9A 2WAFA 5HLTA 5TGTA 3H35A 3LMMA 3SDBA 2KL4A 4N4OB 2ZXIA 4XOTA 2R7VA 2WADA 2JVHA 1HA8A 4HNTA 3OY9A 2KHMA 4F93B 1WJFA 1G8XA 4BUPA 2R7OA 4YELA 4Y33A 4E7HA 2VB6A 4CA0A 1BOBA 3M8JA 2M3AA 2XF6A 3AFHA 3BG6A 4LIUA 3VYRB 1N75A 2XF5A 2JA2A 3PNVA 4C30A 2LG4A 3OYGA 1E0EA 4PSXA 4PFOA 2R7SA 4XONA 2V4JC 5HNHA 4NC8A 2W82A 2HQAA 4XQFA 4BQQA 3EPZA 4ZYAA 3K4NA 4PFPA 3KX2A 3NWSA 4ZDLA 4CCOA 4RM3A 2VPLA 1Y56A 2CFOA 3LL7A 2VQGA 3H5RA 3BG7A 4ITVA 2V6EA 4F91B 3V42A 2RNGA 4B48A 3EUHC 3MKYB 3K4LA 4BE1A 2GOMA 3ZXSA 2KLOA 4LG3A 3OYIA 3EUAA 1FMWA 4ZDPA 3OYLA 3ZQQA 2HVRA 1WJCA 1WFXA 2K9MA 3MMYB 2DXIA 1JI8A 3D5LA 2NOJB 2VQHA 5CQEA 4BXFA 4CZCA 3OS1A 3VYSB 2HPMA 2X51A 4F52A 1DP3A 4ANJA 2MFZA 3DKXA 3UNGC 2DOAA 5LFAA 4B44A 2KQRA 2L5QA 2UUZA 2K3PA 1WJDA 3CJQB 4CCMA 4E7SA 3H5NA 1TT0A 4NUBA 2AQFA 3K4JA 1DGRM 2CW7A 3RQ4A 1D1BA 3K70D 2XDVA 3F9KA 3S32A 2RQQA 3HPGA 3DTIA 3DEEA 5HOOA 3DQVC 3OYEA 2M4GA 2V26A 1T95A 2LRDA 1S9HA 2VXDA 2BW3A 2W4SA 4BL0B 4BGDA 3OYDA 2VQCA 4IZZA 2HVSA 1Z21A 2R7RA 2E5ZA 4XR6A 1D0YA 4II2A 4II3A 4CCLA 1N78A 2ZSHB 3PNTA 4QPQA 5HNFA 3UR3C 3PNYA 3S3NA 3SZGA 4BDZA 2VJIA 1QU3A 2DT6A 3K6GA 4HNUA 3HXLA 3SYTA 3VYTB 1R6RA 2W1OA 4HSRA 1IRXA 4OAYA 4ZC3A 3OYNA 3RCOA 4IQJA 2BOLA 3CZ6A 3BC8A 3ZR8X 2VASA 4LIVA 2CMPA 3OYMA 1LFPA 1PYVA 1MMDA 2QKLB 2LY1A 3E0JB 4JQFA 1K6YA 3W2VA 2V9KA 3AKZA 3C2GA 3U21A 1MMAA 3DPLC 5CKTA 4CCKA 3OR2C 1D1CA 4P1WA 3N05A 4GRIA 4XKVA 3S3MA 2LOOA 4G6TB 4CCNA 4E7ZA 3PUBA 4PJJA 3L2UA 4ZTFA 3FBIB 3J7AY 2KMUA 2R7TA 2VJ5A 1KONA 3D5RC 3FDYA 3A2KA 2Q2EB 2JVGA 4U7BA 4XLCA 4BU2A 2KZVA 1V5FA 3A4CA 3I3LA 1ZELA 1TZLA 3OWTA 1MNEA 4XKCA 2XF7A 2HPIA 3OYHA 3DU6A 4RLQA 4XKBA 4IX7A 4E7LA 3RSNA 3MD2A 4RM2A 1D0ZA 3MKZA 1Z3YA 2UWMA 4BQNA 2PMZA 3BLYA 4AYBA 2R4GA 2F4IA 1Z3XA 1G59A 3QYFA 4KJZA 3LSHA 2KRCA 2X6WA 4HSTA 4E7JA 2L2OA 2LBFB 3OS2A 2KPMA 2O5RA 4R79A 2RREA 2E1MC 1X4PA 4J00A 1BR1A 1NG7A 4MLOA 1P9QC 1Z7LA 3IAM2 4XLAA 2V7FA 2E1MB 4FASD 2R7UA 3OIQA 3MKWB 2HU9A 3G2BA 1EA3A 4XL9A 2M4KA 4DJAA 1J09A 2Z2SB 3VYUB 1FMVA 3DTEA 2F6CA 3LSMA 3K70C 4HRIA 2K5CA 3S3OA 4D1QA 1SAUA 2JUGA 2OC6A 4XM3A 3L2WA 4BJTA 4J01A 2X1DA 3BCAA 2OUMA 1V5GA 3TMOA 4XORA 3CP2A 3C2HA 3W2AA 2CW8A 1VZ0A 4F55A 2IGMA 4PJMA 4KISA 3IUOA 5LD2C 1UG0A 1ERDA 1U0JA 4B47A 4DIQA 4CCJA 4PJNA 1MNDA 2HNHA 4ZTJA 1UELB 2DCEA 3HOTA 3OYAA 2DJIA 4KT6A 1LVKA 3PFYA 3K4MA 2K9LA 4KITB 2WY7Q 2X85A 2UV1A 2P0WA 3HUGB 2VKHA 3OYJA 3KYLA 1X1BA 3K4KA 3QOEA 1X1DA 3OS0A 3L2QA 1SFKA 2WAQA 4U87A 4E7IA 3DU5A 1YE9A 4XLHA 3ZRGA 4PSWA 1MMGA 3H5AA 2BVLA 2X1EA 4BE2A 1X19A 2VQLA 3H9JA 4Y3OA 1X1AA 5FRMA 1WJEA 4AVZA 2ZSIB 4BDYA 2Y0SA 3DPUA 4BE0A 1WJAA 3EUKL 5KNLA 4F92B 2IGOA 2AQEA 3H9QA 3FKJA 4DBRA 5JHFA 3HG9A 4PJLA 4B3XA 3OYKA 3OYBA 3OYFA 2KDOA 3TL4X 2L7KA 3KEYA 3NWTA 5HVQC 1OLTA 3BCBA 3VDXA 4LITA 2CH0A 1BR2A 1MW7A 1PJRA 3HL2A 3W3CA 2ZXHA 3A1YA 3LSKA 2M7AA 4QPOA 2Q1ZB 3TBIA 3L2RA 1MMNA 1W36C 2R7XA 3L2VA 2PJRB 4XOPA 5CPRB 4XLEA 3LSIA 3DPTA 2L9NA 3S8PA 2FUG2 1N77A 4AU7A 2JSPA 1X4OA 1YX3A 2LBFA 1W36D 3DWLE 3QYEA 3CP8A 2HZDA 4HPQA 3CF2A 3IAS2 1D0XA 2R7WA 3OOUA 4ZDOA 2LYCA 3HKZA 2LREA 4E6KG 2X6XA 1WJ5A 4XNFA 4C2UA 2LC2A 4DGWB 1V5EA 2M7BA 2Z1DA 2MC4A 4PUSA 2VJ4A 2VJJA 4HEA2 3PSIA 3SEQA 2XSJC 2XC7A 2F5VA 4PK4A 2W7NA 4XLFA 4XN0A 3HOSA 3OMYA 3SEZA 4YRVA 4CSWA 3I9V2 5FROA 2DT7B 3QYBA 3OIPA 4CUGA 2IGKA 2XAUA 4JOMA 4E4HA 3OR1C 3FBNB 3PSFA 3HPHA 2IGNA 2BVMA 3CMMA 4OWRB 4E7KA 2WA0A 4RLFA 2KRHA 2ELJA 4ZJZA 1GLNA 2HVQA 2VL8A 3GBGA 2E5NA 3QODA 2Z16A 4P5OA 4C2TA 2IS2A 3H0DA 4NC7A 2VIXA 3LFUA 3IP4B 1QHGA 4BQOA 2A6TA 4H4KC 1WJBA 2WB1A 4XMYA 4NNJA 4BEHA 2IS1A 2LY2A 3ONQA 1X1CA 2IXSA 3M1CA 4EATA 2IS6A 1T0FC 3CESA 3K4BA 4DBQA 4FETA 3VWBA 2CUZA 3W2WA 1QHHD 3AL0C 3OL4A 2L9SA 4C9YA 2CV1A 4D9JA 4RMNA 3ZCOA 2GOXB 4BACA 3ZGKA 2CV2A 4DOZA 3AL0B 4B43A 3VSLA 2KP6A 5KCMA 1YX5A 4YEJA 1LDKB 3S93A 4F3QA 3FHNA 4BEHB 4BJ5C 2MD0A 2OV7A 2M0MA 4IQ4A 2W00A 2VKDA 2WY8Q 3RPUD 4IKFA 1OR7C 2CV0A 3HC7A 2E60A 4NQWB 3RTRA 5FRNA 2A5WA 2QKMB 2PJRA 1NG6A 4X0GA 1LKXA 1DQUA 4BJ6C 2ZFUA 2VXZA 2MABA 4HG2A 1UAAA 2CUJA 3E1SA 3H9GA 3K10A 2BW3B 2WAEA 2HDWA 1D1AA 3LSGA 5CQGA 3D5SC 4OAZA 3K4CA 2CS3A 4Y4RA 3VSKA 5KHDA 3OYCA 3DTKA 3OL3A 3DLAA 2X1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KON A;  1WJC A;  1WJA A;  1WJD A;  1WJB A;  3HPH A;  3HPG A;  1K6Y A;  1MW7 A;  1LFP A;  1WJE A;  1WJF A;  1E0E A;  3F9K A;  4F3Q A; 
#chains in the Genus database with same CATH topology
 3Q5F A;  2IS4 A;  2NNN A;  3BPX A;  1ZN2 A;  1IJW C;  4AUX A;  2O3F A;  2HOT A;  5DM7 F;  3KZI C;  3NEU A;  4EGY A;  1DGW Y;  5D5X B;  2DA4 A;  3CJR B;  4RAY A;  4LK0 F;  2NS0 A;  3CCL I;  5ERI A;  4XN3 A;  1JHF A;  1VQK I;  2MYS A;  5DD4 A;  2A5Y B;  4A6E A;  2KJB A;  5C4X J;  2XPU A;  4N4O B;  4LMY A;  4L0Z B;  1A04 A;  4XOT A;  1P4W A;  2EFW A;  3FZV A;  4MFD A;  4HDU A;  3GTG J;  3OY9 A;  4F93 B;  3IKT A;  3TKY A;  1XX5 A;  1EJ9 A;  1FY7 A;  4BUP A;  4YEL A;  1P7I A;  1LVA A;  4A12 A;  1V3F A;  4UUS A;  5K7H A;  2M3A A;  2Y69 H;  3BG6 A;  2PQ8 A;  2CUF A;  2LF8 A;  1VQP I;  3RJP A;  4Q4Z F;  1MBK A;  2LG4 A;  4PSX A;  4PFO A;  3ECH A;  3WHC A;  4XLP F;  1GHC A;  1TT5 B;  1IXC A;  2K27 A;  2F4M B;  4BQQ A;  4ZYA A;  2DXI A;  4HX7 A;  2EK5 A;  4BXU A;  5GAH J;  1UG2 A;  1WRJ A;  1BN5 A;  3KEQ A;  1K4S A;  1Y56 A;  1S7E A;  3F72 A;  3LL7 A;  2M8E A;  2DQL A;  3H5R A;  3BG7 A;  3QOP A;  4MQV A;  4CIC A;  3TGN A;  3S1N J;  3ESW B;  4F91 B;  2HOE A;  3CUQ B;  2Q0O A;  3V42 A;  3WTY C;  1GVD A;  3EUH C;  3ULQ B;  4U0Y A;  4MTE A;  1UHS A;  1HKQ A;  1UB9 A;  4WXH A;  5B1B H;  5DTD A;  1FMW A;  2W48 A;  3WTZ A;  2BY2 A;  3OYL A;  1ORK A;  3ZQQ A;  3JRE A;  2HVR A;  2EZK A;  2E7W A;  1S6L A;  2WB1 N;  2EPF A;  3NRV A;  1XGM A;  4IEJ A;  5HS8 A;  3AAF A;  2EB7 A;  5CQE A;  4XBF A;  4EJW A;  1S72 I;  1YLF A;  5E1Z B;  4UV9 A;  5JLW A;  3WGI A;  4ESJ A;  2X51 A;  3EQL F;  1DP3 A;  2XGD A;  2VI6 A;  3DKX A;  1B72 A;  1WI3 A;  3A01 B;  2ZXW H;  2TCT A;  4G7O F;  1DU6 A;  3H5N A;  1TT0 A;  2ZME B;  3VB2 A;  1W5T A;  2AQF A;  2A05 A;  1FEX A;  5E20 A;  3L00 A;  2RQQ A;  2H94 A;  3DEE A;  4ZYD A;  3OYE A;  2OCE A;  2V26 A;  1ULY A;  2MC3 A;  1S9H A;  1VQ6 I;  2L54 A;  2W4S A;  2VQC A;  2HVS A;  2FQ3 A;  2E5Z A;  1BJZ A;  3ZQI A;  3DV8 A;  4IF4 A;  1GDT A;  2B9S A;  2ZNZ A;  3ZQH A;  1RZ4 A;  2DJN A;  5DS9 A;  1F5T A;  3P7N A;  2H6B A;  4QPQ A;  3QP6 A;  5HNF A;  4YIR X;  5HS7 A;  3HSR A;  1BOA A;  1Z05 A;  1BC8 C;  2IPQ X;  2ME6 A;  4WWC A;  2DT6 A;  2L0K A;  2A6E F;  3WHB A;  3HXL A;  3SYT A;  3VYT B;  5GTI C;  1ZRC A;  1IRX A;  1KU2 A;  4FIS A;  1Z77 A;  3TP3 A;  3BC8 A;  1CQT A;  2WTE A;  2ADU A;  2PFB A;  2R5Y A;  2FQ4 A;  3OYM A;  4CGZ A;  5DEQ A;  1VQL I;  3GZ6 A;  4M9X A;  1OPC A;  5ICC A;  3DLL F;  1FOX A;  4XRF A;  3G1O A;  3N4M A;  1FOY A;  1K6Y A;  2DI3 A;  2STW A;  5CJ9 A;  4I0B A;  2FEZ A;  1MMA A;  3DPL C;  1JT6 A;  1ZLK A;  2HQR A;  3OR2 C;  1G3S A;  3BDD A;  4HF0 A;  4F7Z A;  4I02 A;  4PGH A;  2FF4 A;  1K79 A;  1FSE A;  4GRI A;  4XKV A;  4I99 C;  4G6T B;  3G71 I;  4A3M J;  1SC7 A;  4BKX A;  3O6B B;  4PJJ A;  4NDL A;  1UMQ A;  3L2U A;  2NS7 A;  5JHU A;  1KON A;  1XGS A;  3BG3 A;  1CF7 A;  1GUU A;  3FK6 A;  2JVG A;  3IWZ A;  2ESN A;  2QQ9 A;  3FXQ A;  4P96 A;  4ESF A;  1HW5 A;  3E6M A;  2RGV A;  3FF5 A;  2CJJ A;  5EYR A;  1SAN A;  5J1R A;  1OCC H;  1TZL A;  2FX0 A;  3OWT A;  1IUF A;  3HRM A;  4I2O A;  1XDU A;  3OYH A;  3EUH A;  3OIO A;  3LA7 A;  1A6I A;  3K2A A;  3MD2 A;  4RM2 A;  1D0Z A;  4WXD A;  2QQB A;  4C3J J;  2UWM A;  3SQN A;  1HF0 A;  1OCT C;  5CVJ A;  1XTA A;  4OIO F;  1TNS A;  3KIO A;  4HLX A;  2ID3 A;  1XCB A;  2PJP A;  2RV8 A;  3LSH A;  1IF1 A;  2FBI A;  4AWX B;  4IHT A;  2F5D A;  4M71 A;  3WG9 A;  4L9N A;  2CUE A;  3BY6 A;  4R79 A;  1R00 A;  1SMT A;  2PMH A;  1NG7 A;  3F8C A;  2W24 A;  4JYK A;  2GA2 A;  5AIP A;  5D5U B;  2I10 A;  4XLA A;  4L5E A;  4IRI A;  4DNC A;  3OIQ A;  2JA7 J;  3CD6 I;  1I1S A;  3G2B A;  1EA3 A;  1IN5 A;  2Z2S B;  1R5I D;  1SFE A;  2F6C A;  4HAM A;  5H2F C;  4HRI A;  3S3O A;  3OOP A;  3GTM J;  3ZMS A;  2OC6 A;  1W5S A;  3L2W A;  1ETQ A;  4GYI A;  4W1U A;  4I01 A;  4HF2 A;  5LBQ A;  2YU9 J;  4IVN A;  4X6A J;  1KGS A;  5JVG F;  3UKG A;  3ZMD A;  3GVA A;  4XOR A;  4D5C A;  2CW8 A;  2XIG A;  1P6R A;  4N9I A;  1ZRD A;  2E2I J;  3QQA A;  2L9R A;  4HV5 A;  3BQY A;  2P7C B;  4KIS A;  3IUO A;  1P4A A;  4R1H A;  4PJN A;  1MND A;  4LK1 F;  1ON1 A;  3HOT A;  1DPR A;  2E35 A;  1TWA J;  4W97 A;  3LAJ A;  1FYL A;  2OF7 A;  3GEZ A;  3CC4 I;  1SD7 A;  4UB6 C;  1IW7 F;  4U0V A;  4CYC B;  2L7Z A;  2CYY A;  5D6E A;  2P0W A;  1U9O A;  3KYL A;  3L9F A;  5E3L A;  2HWV A;  2ZJ2 A;  4OIP F;  2XAF A;  1RUN A;  1K4T A;  2ID6 A;  2XKO A;  2P6T A;  3Q3S A;  3HOW J;  1D5Y A;  2VBW A;  4XLH A;  3ABK H;  2ACJ A;  3LQQ A;  5E3M A;  4BE2 A;  2HFH A;  2VQL A;  2CQN A;  2HR3 A;  1UHM A;  2MD5 A;  4Y3O A;  2JUC A;  1WJE A;  4Q48 A;  4UVB A;  2ZSI B;  4FTH A;  5K7F A;  1VND A;  3M1E A;  3EUK L;  3S2W A;  4XID A;  2JSC A;  3R6S A;  2EH3 A;  3H9Q A;  3FKJ A;  3ABL H;  2K86 A;  3FXJ A;  2XAJ A;  2Q2E A;  3CDL A;  1XS9 A;  1X2M A;  2GIZ A;  3TDZ C;  1WHU A;  2KDO A;  2M2E A;  3NWT A;  2Q8K A;  3BPV A;  5K5O A;  4IXA A;  3VDX A;  2EBI A;  1MW7 A;  4M6V A;  2R92 J;  1DU0 A;  3A1Y A;  1YIT I;  2ECC A;  2F5C A;  1MMS A;  3FMR A;  3TBI A;  3P9K A;  1MMN A;  5AON A;  1ZGW A;  2NYX A;  1VFC A;  2PJR B;  3HTS B;  4L9V A;  3RDI A;  5IT3 A;  2F5F A;  1TW2 A;  2L9N A;  3S8P A;  4D5F A;  2LP0 A;  3JRI A;  5B1A H;  5F04 A;  1YJ9 I;  1HLV A;  1JKO C;  2JSP A;  2GA1 A;  1PP8 F;  2O6G E;  1VQM I;  2QM3 A;  1FIP A;  3CC7 I;  1YX3 A;  2E36 A;  3I55 I;  1W36 D;  1USS A;  3CCE I;  4UY8 I;  3MWM A;  3CP8 A;  5FLM J;  2HZD A;  3V7R A;  1PP7 U;  1D0X A;  5JVT A;  4AIJ A;  4M3G A;  2A07 F;  5K5Q A;  4L9T A;  1YTY A;  1IRG A;  2LYC A;  2AHQ A;  3GFM A;  2L02 A;  1MBH A;  4KIF A;  4HYE A;  4JX4 A;  4XNF A;  2VC1 A;  3GTJ J;  2CFX A;  1STZ A;  2O61 A;  4XRM A;  5BOX A;  2Y9Y A;  4RAG A;  2VJJ A;  4AVP A;  2L01 A;  3X2Q H;  1R1T A;  3F8N A;  4KIC A;  3WTX C;  3JCU C;  4XN0 A;  5J4V A;  3TOB A;  4RB1 A;  3GTK J;  1QVU A;  4ESB A;  1RIO H;  1OQY A;  4ZH4 F;  4YRV A;  3I9V 2;  4NB5 A;  3S1R J;  2LLK A;  2LY9 A;  4CUG A;  4E4H A;  4IOA F;  1KYZ A;  5LRS A;  1W7P D;  2M9H A;  3PSF A;  3L1P A;  2BVM A;  3CMM A;  4OWR B;  4E7K A;  3SZT A;  3LQR A;  1LE8 B;  1HBX G;  2LFB A;  5CVV A;  1QPI A;  1EH6 A;  1GLN A;  2HVQ A;  2VL8 A;  3QOD A;  2HTJ A;  2IA2 A;  5EJC A;  2XAQ A;  4DZJ A;  2WV0 A;  3DCF A;  4P5O A;  2KZG A;  5J1U A;  4PCQ A;  4UUT A;  3H0D A;  3LFU A;  4KMU X;  2K7L A;  1XG1 A;  4M6Y A;  3FXR A;  1UST A;  1PUE E;  4H4K C;  3BG5 A;  1MIJ A;  1WJB A;  2FU4 A;  3WG7 H;  1FOK A;  4Q47 A;  2LY2 A;  1DPU A;  3CCM I;  1AOY A;  2BBY A;  3TW6 A;  2ZME C;  3HOV J;  2ZBK A;  4PZJ A;  4B1R A;  1AU7 A;  5FD5 A;  3TQN A;  2IVM A;  2FNP A;  3FMS A;  4DBQ A;  3SHF A;  3VWB A;  4UHT A;  1IC8 A;  4GDF A;  3BJO A;  3JAM Z;  1ETK A;  3JTH A;  2CV2 A;  3AL0 B;  4B43 A;  3CUO A;  2KP6 A;  3S93 A;  2LD5 A;  2BY0 A;  1S29 A;  3FHN A;  4BEH B;  3R60 A;  2M0M A;  3N97 A;  2BEO A;  2CV0 A;  4C3H J;  2HZT A;  2DOF A;  3HC7 A;  5FRN A;  4NQW B;  1KU9 A;  4FE7 A;  2QKM B;  1L3L A;  1NG6 A;  3L09 A;  4X0G A;  1XSV A;  2DA7 A;  2GBY A;  2ZFU A;  4HG2 A;  4IJA A;  1IZ1 A;  1RNL A;  5JI6 A;  2CUJ A;  3E1S A;  2XVC A;  3H9G A;  1D1A A;  2OU2 A;  5CQG A;  3D5S C;  4OAZ A;  1I50 J;  2E1O A;  4KUM A;  4Y4R A;  3VSK A;  5ICE A;  5KHD A;  3OYC A;  4LFU A;  3DTK A;  4OMZ A;  4PGG A;  3HGG A;  5IYC J;  1Z9C A;  2X1C A;  2HKO A;  3U2R A;  1ONV A;  1AA7 A;  3BTJ A;  1J2X A;  2RC4 A;  2VPR A;  3KPH A;  5HS9 A;  2E2J J;  3D1N I;  4A69 C;  3LA2 A;  5D8L B;  1RKW A;  3IH4 A;  2V1N A;  5A2Q Z;  4OIR F;  4N4N B;  1VQO I;  1V55 H;  3FK7 A;  4QTR A;  3CCY A;  1NK3 P;  1RUO A;  3H35 A;  2KL4 A;  3ZQL A;  3O2P E;  2JVH A;  5TRD A;  4HNT A;  2WWY A;  1X3U A;  1KQ0 A;  1HA8 A;  2KHM A;  2ETH A;  1MJA A;  3M07 A;  5GAD J;  2HYJ A;  5ILU A;  5FLV A;  1OMI A;  3DBR B;  3FWE A;  4WCG A;  3CO7 C;  1BOB A;  1SAX A;  3CUQ A;  4LIU A;  2ZJR F;  1ZLJ A;  3V8L A;  1BL0 A;  3ZPL A;  3LA3 A;  1N75 A;  4G9Y A;  2JA2 A;  5DCM A;  4XK4 A;  4G6D A;  2ZFW A;  2L4A A;  3S1M J;  2V4J C;  3J7Y J;  1YRN B;  2HQA A;  2LKS A;  4XQF A;  1S7O A;  1E3H A;  5D6F A;  4HX4 A;  1ZG1 A;  3KYD B;  4CO8 A;  3E6D A;  2HDC A;  5E8G A;  4CCO A;  2VPL A;  2OA4 A;  4YFX F;  2VQG A;  3RIR A;  4ITV A;  1JT0 A;  3CCU I;  2V6E A;  1N25 A;  1JHH A;  1ETY A;  2DU9 A;  3I5U A;  4B48 A;  1IXR C;  4KN7 X;  3ZXS A;  1IUY A;  5M3M J;  2HQN A;  3OYI A;  3A01 A;  4HLY A;  5FKL A;  2ME0 A;  4E70 A;  2O9L A;  3BP8 A;  2EZH A;  2ZME A;  2QWW A;  2ZKZ A;  1WJC A;  2FMY A;  2BHZ A;  2ICW G;  2E19 A;  4I7H A;  1X1P A;  2X0L A;  4U88 A;  1WI9 A;  1JI8 A;  3D5L A;  2VQH A;  3E5X A;  1HW2 A;  2P5V A;  3P9I A;  2OBP A;  3OS1 A;  2JQ7 A;  3OSF A;  2XKP A;  2HPM A;  1HDP A;  2NVT J;  3BOQ A;  5L3C A;  2DDB A;  2FSW A;  5BNG A;  1JGG A;  3I4N J;  1S5L C;  3MVP A;  2KQR A;  1I6X A;  4LLL A;  5GPC A;  3I4P A;  3KP7 A;  3CMY A;  3JRD A;  2OQG A;  2CW7 A;  3RQ4 A;  1D1B A;  3F9K A;  3Q9S A;  3S32 A;  5GAG J;  1O4X A;  4CHU A;  4RAZ A;  2RKH A;  3H92 A;  2M4G A;  1T95 A;  2LRD A;  1F43 A;  2VOD A;  2VXD A;  2BW3 A;  4Z2Y A;  5M5W J;  3PQJ A;  4BL0 B;  1SEU A;  3OYD A;  2BY3 A;  4QWQ A;  3KLN A;  3M8E A;  2R7R A;  2V1U A;  3G1L A;  2KIQ A;  2OJE D;  1ON2 A;  2IW5 A;  2H09 A;  3DBL B;  1S7A A;  2UXX A;  1LUJ B;  4II2 A;  4HNV A;  1I5Z A;  1QGP A;  4BBR J;  1FC3 A;  2M0C A;  1TQM A;  3UR3 C;  3PNY A;  3B73 A;  4KIG A;  1ZGJ A;  3DEU A;  5BPD A;  4P55 A;  2MH2 A;  2OAZ A;  3I64 A;  2EIM H;  1AHD P;  2LTP A;  2W1O A;  4IHS A;  4HSR A;  3OYN A;  1T2K A;  1GVJ A;  3RCO A;  3QP5 A;  2EWN A;  2BOL A;  3ZQC A;  2PMU A;  1R5G A;  3ZR8 X;  3B02 A;  3J7A O;  3CJT B;  3FIW A;  5BS6 A;  1LFP A;  1VQ9 I;  1PYV A;  4HBL A;  3I53 A;  2QKL B;  1R23 A;  4G12 A;  4JQF A;  3AKZ A;  2V9K A;  1JE8 A;  4RDU A;  2DQR A;  3LOC A;  5CVU A;  1VQ4 I;  2YUS A;  4FQG A;  4AID A;  1FP1 D;  2DBB A;  2DT5 A;  5J8F A;  4P9F A;  2LR8 A;  4G7Z F;  1R5H A;  1TNT A;  4CCN A;  2DO7 A;  1OFC X;  4JP0 A;  2DA5 A;  1O57 A;  3PUB A;  2K40 A;  3COA C;  3TW7 A;  1JTY A;  1XGO A;  4BH9 A;  3FBI B;  4ZTF A;  1W7P A;  2KMU A;  3B6C A;  1ZG3 A;  2VJ5 A;  4O3M A;  2G7H A;  4MNU A;  1MD0 A;  5ED4 A;  2JT1 A;  1LNW A;  2BGC A;  4BU2 A;  2FML A;  1V5F A;  4MEY F;  2K4J A;  3QU6 A;  2R5Z A;  5FKM A;  2DMQ A;  2XF7 A;  4ABZ A;  2GXG A;  3DU6 A;  4IX7 A;  3RSN A;  4ASN A;  4MGR A;  2ELK A;  1M1E B;  4QIW N;  1TP4 A;  3K2Z A;  3BLY A;  5EGO B;  3JTG A;  1ZR2 A;  2F4I A;  5EG0 B;  1WVR A;  1XC5 A;  3KET A;  4KJZ A;  2Y75 A;  3A02 A;  3HRT A;  3G1M A;  3HSE A;  3JAM K;  1SVO A;  5E3N A;  1Y1V J;  4MLO A;  2EV5 A;  4I09 A;  4LJZ F;  4MIM A;  3IAM 2;  4OOI A;  4EQQ A;  1X3W B;  1W5C C;  5EEG A;  1SFX A;  2E1M B;  5K7Z A;  2O8K A;  4XL9 A;  1U8B A;  4UVA A;  2M4K A;  3LSM A;  4IPA A;  2V1D A;  2HEO A;  1YO5 C;  3BWG A;  4LOC A;  3SJM A;  1SAU A;  3RKX A;  1B8I B;  4XM3 A;  4KMF A;  3BTI A;  4V2F A;  1SVL A;  1YS7 A;  5EEA A;  2X1D A;  1T39 A;  4P9U A;  4CYC A;  2OUM A;  4ZYH A;  3CP2 A;  2QEN A;  3C1D A;  3SDG A;  1MDM B;  3LST A;  5F64 A;  5DD8 A;  3RZO J;  1ERD A;  1UG0 A;  2UZK A;  3V8J A;  4DIQ A;  2HNH A;  1EH8 A;  1IRF A;  2VKV A;  4PDK A;  1T8I A;  2HYG D;  5E18 F;  4EGZ A;  3OYA A;  4BHC A;  1SD6 A;  3ABT A;  4NHJ A;  1J5Y A;  1FPQ A;  5J40 A;  3KFW X;  5F0F A;  5A2Q K;  5FD6 A;  2MG4 A;  4KIT B;  2WY7 Q;  3CCR I;  1A35 A;  2X85 A;  2UV1 A;  3E6B A;  4FCY A;  3NAU A;  2M34 A;  4UVC A;  2VKH A;  2JN6 A;  2IJL A;  4BBS J;  2CO5 A;  5JR3 A;  4GO1 A;  3W6K B;  2Z33 A;  5ILV A;  3U1D A;  2WAQ A;  4U87 A;  2KFD A;  4PSW A;  1YW8 A;  1MMG A;  3H5A A;  2BVL A;  1GXP A;  1U3E M;  3H9J A;  4G7H F;  1RC9 A;  3E5Q A;  1QQI A;  1BBY A;  3SXY A;  4BNC A;  1X1A A;  5FRM A;  1IG7 A;  4AVZ A;  4BDY A;  1P4X A;  2LK2 A;  3VFZ A;  1KA8 A;  4A3F J;  3BRO A;  2IGO A;  3DP7 A;  1OCO H;  1QO0 D;  3I59 A;  4U0W A;  2DFF A;  1IN7 A;  4B3X A;  2QF7 A;  2E2H J;  2KDZ A;  3OYK A;  2QZ8 A;  2HXI A;  3OYF A;  3TL4 X;  4XRS A;  2L7K A;  3JRB A;  3VEP A;  1DP7 P;  3KLO A;  5HVQ C;  4LIT A;  1BR2 A;  3K7A J;  2PEX A;  3JRC A;  2D45 A;  2L3D A;  2QSF X;  1AWC A;  3GLX A;  3AG4 H;  1VTN C;  4JK1 X;  2P5K A;  1OYY A;  2D1H A;  3L2V A;  4I98 B;  1NTC A;  4WF2 A;  3H3V K;  4XLE A;  5DYM A;  3LSI A;  4KA4 A;  5IYD J;  2YX4 A;  1MBF A;  2D2W A;  1U5T B;  4AU7 A;  3A0B C;  3HDD A;  1R7J A;  1X4O A;  1Z67 A;  2W84 A;  2LBF A;  2GXB A;  1ZG5 A;  5HDN A;  4LLN A;  2CWE A;  2XAG A;  3CCS I;  3WGH A;  2DMP A;  2CQQ A;  3KE2 A;  2Z99 A;  3CF2 A;  5DUI A;  3IAS 2;  4Y52 J;  3RKQ A;  2XRL A;  4A3L J;  3HKZ A;  1Z1D A;  1BI0 A;  4ENJ A;  3KP2 A;  1OIS A;  1WJ5 A;  1WQ2 A;  3Q9V A;  4BQA A;  4DGW B;  1TC3 C;  3CLO A;  2QYO A;  2Z1D A;  3AG2 H;  4LD5 A;  4EJO A;  2RAE A;  2XC7 A;  4AD9 A;  3A0H C;  4PK4 A;  2DYS H;  2QSH X;  4NBQ A;  5D5V B;  4YII A;  4XLF A;  4H0E A;  2W25 A;  2FD5 A;  1YW7 A;  4I6Z A;  4M3D A;  1FIA A;  1MJ9 A;  1R1U A;  5IT9 Z;  1T98 A;  2FOW A;  1T38 A;  2K02 A;  2DT7 B;  3QYB A;  4UUS B;  2IGK A;  5BMZ A;  1J0R A;  2CRG A;  3I54 A;  3GTO J;  2IGN A;  3K69 A;  1MGT A;  2CSO A;  2WA0 A;  1ACI A;  4RLF A;  1I39 A;  2KRH A;  4ZJZ A;  3J81 K;  1YI2 I;  5C44 J;  2HOA A;  2LVS A;  3GBG A;  1K78 B;  2AO9 A;  2ECB A;  4A3B J;  3E97 A;  5DDG A;  4C2T A;  1G4D A;  5LHG A;  1TWG J;  1K6O A;  3GFL A;  2VIX A;  3NAR A;  3O3K A;  2VT3 A;  5F27 A;  3D0S A;  1ZTR A;  2NVX J;  1O7L A;  1PVE A;  2A6T A;  4BQO A;  1FLI A;  2AXL A;  2VOO A;  5FFZ A;  3HOX J;  2X9D A;  3H0G J;  4XMY A;  3SFZ A;  3HOY J;  3WU2 C;  5IP7 J;  1GV5 A;  1WCM J;  4BEH A;  2IXS A;  2MH9 A;  3K1P A;  3M1C A;  4OMY A;  3BR6 A;  4EAT A;  2A61 A;  2IS6 A;  1B1B A;  5LEK A;  2X4H A;  1C0W A;  3BG9 A;  2VOP A;  1H89 C;  1W1W E;  2CUZ A;  1QHH D;  3R4K A;  3OL4 A;  4N0B A;  4NQW A;  2K9Q A;  3WGG A;  3U1K A;  4C9Y A;  3MZ8 A;  2CV1 A;  2E34 A;  4RMN A;  2XGC A;  2GOX B;  3FIS A;  4IRG A;  4L9J A;  2E71 A;  4DOZ A;  1KU3 A;  3P5J A;  2WAQ N;  1LFU P;  2EFQ A;  5H6Q A;  3CC2 I;  3WTU C;  3IH3 A;  1TLH B;  2ZNY A;  2EV6 A;  5KCM A;  1APL C;  5LEJ A;  1YHQ I;  4F3Q A;  4Y7N J;  1TQI A;  1Z7U A;  1QVT A;  1XPX A;  2BZT A;  4M9S A;  3WTT C;  1FP2 A;  5DM6 F;  4IQ4 A;  2DOE A;  2EFN A;  3BZ6 A;  2WY8 Q;  4IKF A;  1B72 B;  1OR7 C;  4EV0 A;  1LFB A;  1O3Q A;  1FX7 A;  4L18 B;  2BV6 A;  1YIJ I;  5CLS A;  1LKX A;  1VI0 A;  4ZYG A;  1SD4 A;  4G94 A;  4FX4 A;  4Y13 A;  1J9I A;  1JJ6 C;  1UAA A;  3KCC A;  3K10 A;  2JZY A;  2WAE A;  1B59 A;  4AC0 A;  4OIN F;  3CCJ I;  2GLO A;  5KAF C;  4M6X A;  2B63 J;  2CS3 A;  4JBA A;  2Y0M A;  3KZZ A;  1TW3 A;  2HS5 A;  2KJC A;  2H8W A;  1OKR A;  3PL8 A;  1T08 B;  3FXU A;  3ZOB A;  5L3B A;  1FTZ A;  5LGT A;  1BR4 A;  2YSR A;  4BAY A;  3DKY A;  2YPR A;  2QGU A;  3BR0 A;  3VPR A;  3FHZ A;  2VLA A;  1Y6I A;  1NHA A;  4PJ0 C;  2XAS A;  5FJ8 J;  1ZR4 A;  2LH9 A;  4A3C J;  3JW4 A;  3BR2 A;  5TGT A;  5HLT A;  3BR3 A;  1YRN A;  2R5Y B;  2ELH A;  3B6A A;  2R7V A;  2WAD A;  3F8F A;  2JPB A;  1HSJ A;  2E1N A;  3HKZ N;  3RYR A;  2PLY A;  2JA6 J;  1WJF A;  2QCO A;  2PBI A;  2VB6 A;  3C7J A;  4CA0 A;  1EV7 A;  4A3I J;  3M8J A;  3GF2 A;  2DK8 A;  2ESH A;  3OYG A;  4C30 A;  1D3Y A;  5F0H A;  1IN8 A;  2EFO A;  4XON A;  3M4O J;  1ZKG A;  2F48 A;  4NC8 A;  5FB2 A;  2W82 A;  2DMU A;  3GO5 A;  1XD7 A;  1SFU A;  2HTS A;  1HDD C;  3CUQ C;  2EIL H;  3OV8 A;  3KX2 A;  3RI4 A;  3JRF A;  4LB6 B;  5H6R A;  1CF7 B;  3GX4 X;  3WE3 A;  3MCZ A;  2EA4 A;  1J7K A;  3LSJ A;  3MKL A;  3GLL A;  1MNM C;  1KQ8 A;  1QRY A;  4BE1 A;  5EEH A;  4CDG A;  5M5X J;  1QBJ A;  1E17 A;  4ZZL A;  2A3S A;  1TTY A;  1F36 A;  4ZDP A;  2STT A;  1UJ8 A;  1A36 A;  3KEO A;  1AKH B;  3MZH A;  3H3U A;  3WTS C;  2IBD A;  3ECO A;  3IWF A;  3TDU C;  1WFX A;  1F1Z A;  3LNQ A;  1DUX C;  2NOJ B;  3ZQF A;  5IY5 H;  2NS8 A;  3RPU A;  5B5E C;  4CZC A;  4ENM A;  4UNO A;  2LDU A;  4F52 A;  1HXD A;  2EV0 A;  2P8T A;  4ANJ A;  4IO9 F;  2IA1 A;  3K1M A;  5FO5 A;  2MFZ A;  4IHV A;  1KU7 A;  2GWR A;  2KIS A;  4B44 A;  2R3S A;  2UUZ A;  4A0Z A;  4BXX J;  1WJD A;  3CJQ B;  3HEF A;  4NUB A;  3IRQ A;  3WTW C;  1BIA A;  1OR7 A;  2XDV A;  5E3O A;  3DTI A;  1MBG A;  5HOO A;  2K85 A;  3L2C A;  1NH3 A;  4A93 J;  4IZZ A;  1Z21 A;  4J19 A;  1G3W A;  4XR6 A;  2OCC H;  3GFI A;  3RKW A;  1YJN I;  5CYV A;  5ILS A;  4HF1 A;  4CCL A;  3ABU A;  3PUF A;  5E8I A;  2NOG A;  3S3N A;  5IYB J;  2XV4 S;  4BDZ A;  4HV6 A;  4EEF G;  1QU3 A;  2EQR A;  2AS5 F;  3BZK A;  3K6G A;  4A0Y A;  4HNU A;  2V1X A;  3HB9 A;  2F5E A;  2HXO A;  1QZZ A;  1R6R A;  4NC6 A;  4OAY A;  4ZC3 A;  5BQT A;  4IQJ A;  3CZ6 A;  2JPC A;  2O7O A;  1BJA A;  2V9P A;  2VAS A;  1K61 A;  4LIV A;  1EKE A;  4MO7 A;  2VKE A;  3QRF F;  2CMP A;  4MTD A;  4KT5 C;  3C2B A;  3IC7 A;  4IHW A;  2D1V A;  1BI1 A;  1XSD A;  3E0J B;  2K9N A;  3W2V A;  1GT0 C;  2DPD A;  3U21 A;  3CDH A;  4BY7 J;  3SFI A;  5TIS C;  2DN0 A;  2TRT A;  2RNJ A;  2MBF A;  3ZN0 A;  3HOU J;  1F9N A;  3N05 A;  3ZN1 A;  3S3M A;  5FFX A;  4I0A A;  1IDZ A;  1OCP A;  5ICF A;  5IT9 K;  3KP5 A;  1ETV A;  1JUS A;  3HTU A;  4HW0 A;  4OU0 A;  1XMX A;  3V8K A;  2LKX A;  3BZC A;  1U5T C;  5B3S H;  4UUV A;  3J7A Y;  5EGO A;  3FDY A;  2JA8 J;  2YX7 A;  3G73 A;  2Q2E B;  4MFE A;  1X58 A;  4S0H B;  2OTJ I;  1HOM A;  2MLG A;  3FM5 A;  3K1N A;  5TJJ A;  4XKC A;  3BT9 A;  4HX8 A;  2OTL I;  2HPI A;  3S1Q J;  4E7L A;  2P5L C;  1PUF B;  2ZJQ F;  4D7M A;  3MKZ A;  1Z3Y A;  3AG1 H;  2ZC2 A;  1NK2 P;  2H8R A;  1SVM A;  2PMZ A;  2QBY B;  2K3F A;  3QPL A;  4ON0 A;  1G59 A;  1ZRE A;  2L4M A;  2XPW A;  3QYF A;  5HLH A;  4GCV A;  2KRC A;  2X6W A;  2Y2Z A;  4E7J A;  3JRH A;  1T6S A;  3OS2 A;  4UXN A;  3HRS A;  2RRE A;  4M3F A;  5FGM A;  4J00 A;  1BR1 A;  1P9Q C;  3M8F A;  1Z7L A;  2V7F A;  3HHH A;  3TOA A;  1WKM A;  4FAS D;  4V19 K;  2R7U A;  5E17 F;  3MKW B;  2HU9 A;  3PIO F;  1MBE A;  1MDM A;  4DJA A;  1FMV A;  5IOZ A;  4S05 A;  2M1B A;  5JLX A;  3TO7 A;  1V54 H;  2K5C A;  4B8X A;  4CXF A;  5ICG A;  3J7Z I;  2O8X A;  3WTV C;  1WWX A;  5D4R A;  1BM9 A;  4J01 A;  5HDG A;  5M3F J;  1XDS A;  3ZMZ A;  1A31 A;  1V5G A;  2IAI A;  4BHB A;  2EFP A;  2P81 A;  1IO2 A;  4EM2 A;  1W0T A;  2DW4 A;  3HM5 A;  2CGP A;  4F55 A;  1LDJ A;  2P6S A;  3ZP5 A;  4B47 A;  1XMK A;  3LFK A;  4CCJ A;  2DLL A;  4ZTJ A;  2QSG X;  1GXQ A;  1UEL B;  1I6H J;  2MSY A;  3QPS A;  2DPU A;  4ZYE A;  4EMS A;  2DK5 A;  1I1G A;  2NRA C;  3VOD A;  1LEA A;  2K9L A;  2EZL A;  2IP2 A;  3HUG B;  4RS8 A;  2XGE A;  1X1B A;  3HSF A;  1OJL A;  3JR9 A;  1X1D A;  1KZH A;  1SFK A;  3V7S A;  1JJ8 C;  3JSO A;  1YYV A;  3DU5 A;  1YE9 A;  4EM1 A;  3A03 A;  3ZRG A;  4AIK A;  4FX0 A;  2KIU A;  4RAF A;  1X19 A;  2FBH A;  4RA2 A;  2LF7 A;  4MHG A;  3GZN B;  3H36 A;  5GPA A;  2COM A;  2Y0S A;  3DPU A;  1BA5 A;  1HKT A;  3NQO A;  2LMD A;  2A68 F;  2AQE A;  2IEK A;  1OYW A;  3CCV I;  1E2X A;  2TDX A;  1ETO A;  3HG9 A;  1G6N A;  4UV8 A;  2YU3 A;  2XHK A;  4LGW A;  4A3J J;  1U5T A;  3KEY A;  5IOY A;  3TO9 A;  5IP6 A;  3F22 A;  1OLT A;  2QQ8 A;  3BCB A;  2DDA A;  1L0O C;  2CH0 A;  2FXA A;  1UCR A;  1Y1W J;  3RYP A;  1RR7 A;  1PJR A;  3HL2 A;  3W3C A;  2ZXH A;  2M30 A;  3FKI J;  1RKT A;  3IHU A;  3L2R A;  2R7X A;  3BQZ A;  2LSO A;  4XOP A;  5IP9 J;  2O03 A;  3IRR A;  4XIC A;  1XB4 A;  4BY1 J;  3DPT A;  1VQ8 I;  4RGU A;  5FKO A;  1N77 A;  5AIQ A;  1FJL A;  1BI3 A;  5LHH A;  1RI7 A;  2JTV A;  1PDN C;  1BC7 C;  2EIK H;  4S04 A;  4HPQ A;  1U6G A;  3WU0 A;  2PMZ N;  4ZDO A;  2EJR A;  2YR2 A;  1TBX A;  2LRE A;  4E6K G;  3CME I;  2Y9Z A;  1HKS A;  2Y30 A;  4RB3 C;  3LAP A;  1U78 A;  1R9T J;  1MH4 A;  2FA5 A;  5GP9 A;  5L3F A;  5FKK A;  5B66 C;  1RET A;  2M7B A;  4PUS A;  2VJ4 A;  1GV2 A;  5J3L A;  3ZQG A;  3PSI A;  2VC0 A;  4L5I A;  1IV8 A;  2F5V A;  5L3D A;  1K78 A;  2RVC A;  5LGN A;  2W7N A;  2BYV E;  1QZY A;  2MGQ A;  1FNN A;  1ZRF A;  2R0Q C;  2H27 A;  3SEZ A;  2LNB A;  5KK1 A;  1LJ9 A;  1WZ2 A;  2CQ7 A;  2DTR A;  3OIP A;  2HKX A;  1B9M A;  5KVR A;  3S14 J;  2XAU A;  4JOM A;  5F0C A;  3OR1 C;  3R61 A;  3FBN B;  5DV5 A;  5DCM B;  3HPH A;  4EM0 B;  2KRF A;  3KP4 A;  3SZP A;  2XRO A;  1ZH5 A;  5K1Y A;  1ZAR A;  2ELJ A;  1R4N B;  2DA2 A;  2MLK A;  5LLQ A;  1YFH A;  4ZZD A;  2NNY A;  3OSG A;  5L3E A;  4O5V A;  3LSR A;  2E1C A;  3IP4 B;  2KIM A;  1IV6 A;  1TWF J;  1QHG A;  4L5J A;  1P92 A;  1Y39 A;  3CF5 F;  2QQA A;  4A0X A;  1OCR H;  5E1X A;  3ONQ A;  1X1C A;  3FXO A;  1O3R A;  1K7A A;  2DFH A;  1T0F C;  2G0E A;  3CES A;  2CQK A;  2Z3Y A;  3MZY A;  3Q0W A;  4HZF A;  2NVQ J;  4KIB A;  1EH7 A;  2JMW A;  5E1W A;  5FLX Z;  3AL0 C;  4B09 A;  2L9S A;  2ZCW A;  3S2D J;  2GAU A;  1LDD A;  1YOV B;  3HHG A;  1W0U A;  2F4O B;  2M45 A;  2DFI A;  1SFO J;  3PFI A;  2EIJ H;  1UZC A;  5LHI A;  4EJU A;  2ISZ A;  3F3X A;  3GUD A;  1Y0N A;  4BJ5 C;  2PG4 A;  2OV7 A;  5IPA A;  2W00 A;  5CVR A;  1VQ7 I;  3RPU D;  4IHX A;  2Y0S N;  2WV1 A;  3RQI A;  2K9S A;  2AXT C;  2O0Y A;  4K2E A;  1O7F A;  2E60 A;  3RTR A;  1YIO A;  2PJR A;  2KIF A;  3JRG A;  2JK3 A;  4DQ2 A;  3CTA A;  2JRT A;  3K9T A;  2VXZ A;  2RQP A;  4M73 A;  1CGP A;  1V4R A;  1D8K A;  1YS6 A;  2BW3 B;  1R1V A;  2DMN A;  4FHT A;  1LEB A;  2FRH A;  3DF8 A;  4KDP A;  3BR1 A;  3ZMV A;  1FYM A;  3RKY A;  4EJT A;  2D5V A;  3OL3 A;  1MJB A;  2VBZ A;  1Q1H A;  4CCK A;  3T8R A;  4RB2 C;  4A3E J;  2RN7 A;  3GCM A;  4X1E A;  4LG0 B;  1FTT A;  2WBM A;  2X6Y A;  4XKW A;  4CH7 A;  4GGG A;  4BS9 A;  2HDD A;  2DA6 A;  2R7Q A;  2F2E A;  3PJR A;  3QPT A;  3BR5 A;  2I8D A;  5F1R A;  1J75 A;  2HOS A;  2WAF A;  5KAI C;  1Z0X A;  3EYY A;  3ERE D;  4HOB A;  3LMM A;  3SDB A;  1D5V A;  3EYI A;  2ZXI A;  2DA1 A;  1BI2 A;  4FT8 A;  2GQQ A;  3F6O A;  3FXK A;  4Y15 A;  1G8X A;  3F21 A;  2R7O A;  3REO A;  4Y33 A;  4E7H A;  4QSH A;  2L9V A;  2E7X A;  1JKQ C;  2XF6 A;  3AFH A;  5BPI A;  3VYR B;  1J59 A;  2XF5 A;  3PNV A;  3O8H A;  3R0J A;  1E0E A;  1HC8 A;  1LE8 A;  2R7S A;  2NVY J;  2CU7 A;  1F4K A;  5HNH A;  1ETX A;  1X3Z B;  2R7F A;  1I3Q J;  1U9N A;  2NXN B;  2PX9 A;  3CQZ J;  4R8H A;  3EPZ A;  1AKH A;  3K4N A;  4PFP A;  2QUF A;  3NWS A;  1POG A;  1SMY F;  3DFG A;  5EZG A;  4ZDL A;  4RM3 A;  1W7P B;  3AG3 H;  4WX9 A;  1E3P A;  3QU3 A;  2CFO A;  3ASO H;  3GFJ A;  3IKV A;  3L7W A;  3JSP A;  1MZB A;  2RNG A;  1VQ5 I;  4ETS A;  4XLN F;  2M5W A;  3WU1 B;  3MKY B;  3K4L A;  2GOM A;  3GTQ J;  2R5Z B;  4A3G J;  2KLO A;  4LG3 A;  1JKR C;  3V4G A;  5D4S A;  3E7L A;  3EUA A;  4YIF A;  2V9V A;  4HA8 A;  1JKP C;  2CG4 A;  2G9W A;  2VUM J;  1I27 A;  1T0F A;  2K9M A;  3MMY B;  5JFR A;  1YQA A;  2H1K A;  2L7F P;  1O3T A;  1EF4 A;  2XAH A;  3H3Z A;  1ITY A;  2FJ1 A;  1R58 A;  4BXF A;  2QEX I;  2B7E A;  3VYS B;  3HGY A;  3MFK A;  1XSX A;  3UNG C;  2DOA A;  5LFA A;  4Q5S F;  2L5Q A;  3U9G A;  3KYC B;  2K3P A;  1Y8R B;  4CCM A;  1YJW I;  4E7S A;  4IL6 C;  3MAJ A;  3K4J A;  3PQK A;  1DGR M;  3K70 D;  1A6Q A;  1BW6 A;  2VBX A;  1ENH A;  1YW9 A;  4QLC U;  3GYH X;  3HPG A;  1S8N A;  2CW0 F;  3GME A;  1BIB A;  3DQV C;  4XRS G;  4RGR A;  3EDP A;  4DW6 A;  1RRJ A;  4BGD A;  1G3T A;  3CO6 C;  3I71 A;  1D0Y A;  1UHW A;  3BJA A;  3F8B A;  4XSZ F;  3S15 J;  1ZK8 A;  1XCV A;  2WC2 A;  1ZHF A;  4II3 A;  4ENN A;  4HQM A;  1FYK A;  1IGN A;  1FZP B;  2ZSH B;  3PNT A;  1N78 A;  3SZG A;  1P2F A;  1HQC A;  4A2U A;  2VJI A;  4KFC A;  3C3W A;  1ZGA A;  2BHY A;  2W57 A;  3PIP F;  3WE2 A;  5D5W B;  4XSX F;  3G3Z A;  2IA0 A;  1VQN I;  3DKW A;  1FOW A;  4GFB A;  1JXS A;  4HDV A;  2HYF A;  2W85 A;  4RBO A;  1T33 A;  2Y48 A;  2FOK A;  1WH7 A;  2G7U A;  1ODD A;  1MMD A;  1K83 J;  3MN2 A;  2KT0 A;  3S16 J;  2LY1 A;  3O8G A;  5DUK A;  3T5X A;  1LQ1 A;  3C2G A;  1IRZ A;  3ZQ7 A;  5LRR A;  1HST A;  3J80 Z;  3CDI A;  3GTL J;  2A69 F;  3MQ0 A;  5CKT A;  3GWZ A;  1FBU A;  1D1C A;  2NAZ A;  4MEX F;  1MKM A;  4P1W A;  2ZO4 A;  5HLG A;  4GYG A;  2R7D A;  1O3S A;  2LOO A;  2DAO A;  2BXY A;  2XRN A;  4E7Z A;  3HZJ A;  2Z5U A;  1XMA A;  2P4W A;  1PUF A;  2DA3 A;  2EIN H;  3HIF A;  3Q0V A;  3I4M J;  2VE9 A;  2R7T A;  2IT0 A;  3D5R C;  3I59 B;  2QBY A;  2X48 A;  3A2K A;  1P7J A;  3KZY A;  4U7B A;  5EZH A;  5J47 A;  3W6V A;  4YFK F;  1MH3 A;  4XLC A;  2KZV A;  3A4C A;  1W4M A;  3I3L A;  3H1C A;  2YS9 A;  1ZEL A;  3JRA A;  1MNE A;  2JWT A;  4OIQ F;  3V7C A;  4BYY A;  1MSF C;  3R0A A;  2XGX A;  4G8X A;  4RLQ A;  4XKB A;  1H0M A;  3I0T A;  6PAX A;  4EJV A;  4YG2 F;  2GM4 A;  3QWL A;  4V2G A;  4BQN A;  5C4J J;  1BW5 A;  4AYB A;  2R4G A;  3WOD F;  1REP C;  1Z3X A;  4KYW A;  4D7N A;  4IOC F;  5FLX K;  3HBL A;  1E3O C;  5FKN A;  4FE4 A;  3F6V A;  4Z6Y A;  4HST A;  4G6Q A;  2PI0 A;  2L2O A;  2MA3 A;  2LBF B;  2KPM A;  1KQ9 A;  2O5R A;  2E1M C;  1X4P A;  3F0C A;  3LWF A;  1LB2 A;  2QVO A;  5HLI A;  1VF9 A;  4UB8 C;  2DFE A;  3KP3 A;  2COB A;  3QPH A;  2JJ7 A;  3Q0U A;  1RR8 C;  3ASN H;  1LPQ A;  2FBK A;  1IN6 A;  1J09 A;  3VYU B;  3DTE A;  3PO3 J;  3K70 C;  4D1Q A;  4BHP A;  1I3A A;  1B6A A;  5C3E J;  4ENK A;  1TWH J;  3C18 A;  4U7D A;  2JUG A;  4WK8 F;  3F8M A;  1H8A C;  4BJT A;  2HQ5 A;  3BTC A;  3BCA A;  3HUG A;  4CZZ A;  3BTL A;  1FBS A;  1QA6 A;  3TMO A;  2M87 A;  4I76 A;  2JRM A;  3C2H A;  2OD5 A;  2XUB A;  3W2A A;  3CLQ A;  3ROU A;  2OPT A;  3FXM A;  1VZ0 A;  2IGM A;  4PJM A;  2R7Z J;  3GXO A;  5LD2 C;  5M5Y J;  1U0J A;  5F08 A;  1TQP A;  2DCE A;  4DYR A;  3GZ5 A;  2DJI A;  3ABM H;  4WXC A;  4KT6 A;  1LVK A;  3CCQ I;  1FBQ A;  2KKO A;  3FM3 A;  3PFY A;  3K4M A;  1JUM A;  1ZAO A;  4C3I J;  3CMA I;  4LB5 A;  1R71 A;  5J8C A;  4M74 A;  3ISP A;  3M9A A;  2XB0 X;  3OYJ A;  3PO2 J;  3K4K A;  3QOE A;  3P9C A;  3ELK A;  3OS0 A;  3L2Q A;  4A3K J;  3IV5 A;  1WSU A;  5J1Y A;  1FSH A;  4E7I A;  1RPW A;  2X1E A;  4AM3 A;  2DYR H;  2IRF G;  1Q1V A;  2XPV A;  5CVI A;  2GXA A;  1Y8Q B;  4JX5 A;  3PM1 A;  4LLG F;  4BE0 A;  1JTX A;  1WJA A;  2ZXJ A;  1WH5 A;  3GTP J;  5KNL A;  2I5U A;  4F92 B;  4A5M A;  5K5R A;  4DBR A;  2PN6 A;  4YFN F;  5JHF A;  4KNY A;  4PJL A;  2J5O A;  3CJN A;  3OYB A;  2VON A;  4DYC A;  2K4B A;  3ZMU A;  3T1B A;  4DZP A;  3RZD J;  4C2M J;  2ZJP F;  2VBY A;  1G2H A;  1HW1 A;  2A6H F;  2NVU B;  4A3D J;  4AIH A;  1IDY A;  3E6C C;  1S3J A;  3I58 A;  3LSK A;  2M7A A;  3F23 A;  1TWC J;  1Y0U A;  4QPO A;  2Q1Z B;  1RES A;  1QNT A;  1W36 C;  3ERM A;  1QPM A;  3T0Y A;  2UXN A;  4N9H A;  5CPR B;  1G3Y A;  1OYI A;  1U8R A;  1JGS A;  4M72 A;  4M9Z A;  3VOE A;  5GTH C;  5F6F A;  4B3A A;  2FUG 2;  2DTZ A;  5EG0 A;  3HJE A;  1TL8 A;  3BJ6 A;  4B4C A;  2XSD C;  1IN4 A;  3TP0 A;  2HI3 A;  2ZB9 A;  1X2N A;  3DWL E;  3QAH A;  4RGS A;  3HOZ J;  1MBJ A;  3QYE A;  1R4M B;  3MEX A;  1R49 A;  3HRU A;  2LKP A;  5E79 C;  4RGX A;  1JUP A;  1OCZ H;  2R7W A;  2EZI A;  3OOU A;  4AYB N;  5LGU A;  5EDN A;  4M3E A;  1U2W A;  3K0L A;  3G4S I;  2JA5 J;  5D8K B;  1FT9 A;  2N8G A;  2X6X A;  3E3V A;  3DEW A;  3EET A;  2LC2 A;  1QZE A;  1IAW A;  4C2U A;  1V5E A;  4KN4 X;  2MC4 A;  5DCF A;  1B8I A;  4HEA 2;  5J4Y A;  3SEQ A;  2XSJ C;  5HOD A;  3T8T A;  2H6C A;  5GAE J;  2Z9O A;  2VE8 A;  3HOS A;  4EVI A;  1WGX A;  4D0P A;  4DYQ A;  3OMY A;  1KYW A;  4CSW A;  4M3B A;  2OZU A;  5FRO A;  3G6E I;  1B4A A;  4HQE A;  4A6D A;  5F1J A;  2EA2 A;  1SD5 A;  2VN2 A;  1H9T A;  1FWZ A;  5HDK A;  1A5J A;  1HCR A;  2V6C A;  1ETW A;  1ZYR F;  3GW2 A;  4Y17 A;  2E5N A;  1T56 A;  1ZQ3 P;  2X6O A;  1XGN A;  2Z16 A;  2QLZ A;  2IS2 A;  2DOD A;  1R36 A;  4NC7 A;  3LSP A;  3M7G A;  2FNA A;  2P7V B;  2BY1 A;  2ISY A;  4L0Y B;  3IL2 A;  1B9N A;  2VT2 A;  9ANT A;  2WB1 A;  3FX3 A;  4NNJ A;  3DXJ F;  2IS1 A;  4IRH A;  4MQ9 F;  5J6X A;  2B0L A;  3M3Y J;  3K4B A;  3J80 K;  4O6J A;  2CQX A;  4FET A;  3W2W A;  4D9J A;  2FE3 A;  2XB5 A;  5L3G A;  4RB0 A;  3ZCO A;  4BAC A;  4IHY A;  3ZGK A;  2H1L A;  3FMQ A;  3ZMT A;  2V79 A;  1DDN A;  3VSL A;  3TED A;  2HGC A;  2J5P A;  1Z6T A;  1Z6R A;  1YX5 A;  4YEJ A;  1LDK B;  2Y31 A;  1D8J A;  3KP6 A;  2L7M P;  2MD0 A;  2MW8 A;  4A5N A;  2VKD A;  1XN7 A;  2GIV A;  3S17 J;  4CYD A;  1WPK A;  3ML6 A;  2RDP A;  2A5W A;  2DMT A;  3I56 I;  4TV7 A;  4LG0 A;  3IH2 A;  2M8G X;  5EF6 A;  1DQU A;  2BE5 F;  3HYI A;  4BJ6 C;  3J81 Z;  2C6Y A;  1R22 A;  3RPQ A;  1Z91 A;  2MAB A;  2OZ6 A;  3S2H J;  1YG2 A;  3TO6 A;  2GZW A;  2HDW A;  3E5U A;  1H9G A;  1UFM A;  1MSE C;  1IXS B;  3FXL A;  2R93 J;  2OQR A;  3DBH B;  3LSG A;  1H88 C;  3K4C A;  5H20 A;  2QA4 I;  3W6J B;  4JX6 A;  2BXZ A;  3DLA A;  4GXO A; 
#chains in the Genus database with same CATH homology
 3PL8 A;  1AA7 A;  2IS4 A;  2WBM A;  2X6Y A;  4XKW A;  4CH7 A;  1DGW Y;  1BR4 A;  3CJR B;  4BS9 A;  3DKY A;  2R7Q A;  2V1N A;  2VLA A;  1Y6I A;  4N4N B;  3PJR A;  4XN3 A;  2I8D A;  2MYS A;  2LH9 A;  2WAF A;  5HLT A;  5TGT A;  3H35 A;  3LMM A;  3SDB A;  2KL4 A;  4N4O B;  2ZXI A;  4XOT A;  2R7V A;  2WAD A;  2JVH A;  1HA8 A;  4HNT A;  3OY9 A;  2KHM A;  4F93 B;  1WJF A;  1G8X A;  4BUP A;  2R7O A;  4YEL A;  4Y33 A;  4E7H A;  2VB6 A;  4CA0 A;  1BOB A;  3M8J A;  2M3A A;  2XF6 A;  3AFH A;  3BG6 A;  4LIU A;  3VYR B;  1N75 A;  2XF5 A;  2JA2 A;  3PNV A;  4C30 A;  2LG4 A;  3OYG A;  1E0E A;  4PSX A;  4PFO A;  2R7S A;  4XON A;  2V4J C;  5HNH A;  4NC8 A;  2W82 A;  2HQA A;  4XQF A;  4BQQ A;  3EPZ A;  4ZYA A;  3K4N A;  4PFP A;  3KX2 A;  3NWS A;  4ZDL A;  4CCO A;  4RM3 A;  2VPL A;  1Y56 A;  2CFO A;  3LL7 A;  2VQG A;  3H5R A;  3BG7 A;  4ITV A;  2V6E A;  4F91 B;  3V42 A;  2RNG A;  4B48 A;  3EUH C;  3MKY B;  3K4L A;  4BE1 A;  2GOM A;  3ZXS A;  2KLO A;  4LG3 A;  3OYI A;  3EUA A;  1FMW A;  4ZDP A;  3OYL A;  3ZQQ A;  2HVR A;  1WJC A;  1WFX A;  2K9M A;  3MMY B;  2DXI A;  1JI8 A;  3D5L A;  2NOJ B;  2VQH A;  5CQE A;  4BXF A;  4CZC A;  3OS1 A;  3VYS B;  2HPM A;  2X51 A;  4F52 A;  1DP3 A;  4ANJ A;  2MFZ A;  3DKX A;  3UNG C;  2DOA A;  5LFA A;  4B44 A;  2KQR A;  2L5Q A;  2UUZ A;  2K3P A;  1WJD A;  3CJQ B;  4CCM A;  4E7S A;  3H5N A;  1TT0 A;  4NUB A;  2AQF A;  3K4J A;  1DGR M;  2CW7 A;  3RQ4 A;  1D1B A;  3K70 D;  2XDV A;  3F9K A;  3S32 A;  2RQQ A;  3HPG A;  3DTI A;  3DEE A;  5HOO A;  3DQV C;  3OYE A;  2M4G A;  2V26 A;  1T95 A;  2LRD A;  1S9H A;  2VXD A;  2BW3 A;  2W4S A;  4BL0 B;  4BGD A;  3OYD A;  2VQC A;  4IZZ A;  2HVS A;  1Z21 A;  2R7R A;  2E5Z A;  4XR6 A;  1D0Y A;  4II2 A;  4II3 A;  4CCL A;  1N78 A;  2ZSH B;  3PNT A;  4QPQ A;  5HNF A;  3UR3 C;  3PNY A;  3S3N A;  3SZG A;  4BDZ A;  2VJI A;  1QU3 A;  2DT6 A;  3K6G A;  4HNU A;  3HXL A;  3SYT A;  3VYT B;  1R6R A;  2W1O A;  4HSR A;  1IRX A;  4OAY A;  4ZC3 A;  3OYN A;  3RCO A;  4IQJ A;  2BOL A;  3CZ6 A;  3BC8 A;  3ZR8 X;  2VAS A;  4LIV A;  2CMP A;  3OYM A;  1LFP A;  1PYV A;  1MMD A;  2QKL B;  2LY1 A;  3E0J B;  4JQF A;  1K6Y A;  3W2V A;  2V9K A;  3AKZ A;  3C2G A;  3U21 A;  1MMA A;  3DPL C;  5CKT A;  4CCK A;  3OR2 C;  1D1C A;  4P1W A;  3N05 A;  4GRI A;  4XKV A;  3S3M A;  2LOO A;  4G6T B;  4CCN A;  4E7Z A;  3PUB A;  4PJJ A;  3L2U A;  4ZTF A;  3FBI B;  3J7A Y;  2KMU A;  2R7T A;  2VJ5 A;  1KON A;  3D5R C;  3FDY A;  3A2K A;  2Q2E B;  2JVG A;  4U7B A;  4XLC A;  4BU2 A;  2KZV A;  1V5F A;  3A4C A;  3I3L A;  1ZEL A;  1TZL A;  3OWT A;  1MNE A;  4XKC A;  2XF7 A;  2HPI A;  3OYH A;  3DU6 A;  4RLQ A;  4XKB A;  4IX7 A;  4E7L A;  3RSN A;  3MD2 A;  4RM2 A;  1D0Z A;  3MKZ A;  1Z3Y A;  2UWM A;  4BQN A;  2PMZ A;  3BLY A;  4AYB A;  2R4G A;  2F4I A;  1Z3X A;  1G59 A;  3QYF A;  4KJZ A;  3LSH A;  2KRC A;  2X6W A;  4HST A;  4E7J A;  2L2O A;  2LBF B;  3OS2 A;  2KPM A;  2O5R A;  4R79 A;  2RRE A;  2E1M C;  1X4P A;  4J00 A;  1BR1 A;  1NG7 A;  4MLO A;  1P9Q C;  1Z7L A;  3IAM 2;  4XLA A;  2V7F A;  2E1M B;  4FAS D;  2R7U A;  3OIQ A;  3MKW B;  2HU9 A;  3G2B A;  1EA3 A;  4XL9 A;  2M4K A;  4DJA A;  1J09 A;  2Z2S B;  3VYU B;  1FMV A;  3DTE A;  2F6C A;  3LSM A;  3K70 C;  4HRI A;  2K5C A;  3S3O A;  4D1Q A;  1SAU A;  2JUG A;  2OC6 A;  4XM3 A;  3L2W A;  4BJT A;  4J01 A;  2X1D A;  3BCA A;  2OUM A;  1V5G A;  3TMO A;  4XOR A;  3CP2 A;  3C2H A;  3W2A A;  2CW8 A;  1VZ0 A;  4F55 A;  2IGM A;  4PJM A;  4KIS A;  3IUO A;  5LD2 C;  1UG0 A;  1ERD A;  1U0J A;  4B47 A;  4DIQ A;  4CCJ A;  4PJN A;  1MND A;  2HNH A;  4ZTJ A;  1UEL B;  2DCE A;  3HOT A;  3OYA A;  2DJI A;  4KT6 A;  1LVK A;  3PFY A;  3K4M A;  2K9L A;  4KIT B;  2WY7 Q;  2X85 A;  2UV1 A;  2P0W A;  3HUG B;  2VKH A;  3OYJ A;  3KYL A;  1X1B A;  3K4K A;  3QOE A;  1X1D A;  3OS0 A;  3L2Q A;  1SFK A;  2WAQ A;  4U87 A;  4E7I A;  3DU5 A;  1YE9 A;  4XLH A;  3ZRG A;  4PSW A;  1MMG A;  3H5A A;  2BVL A;  2X1E A;  4BE2 A;  1X19 A;  2VQL A;  3H9J A;  4Y3O A;  1X1A A;  5FRM A;  1WJE A;  4AVZ A;  2ZSI B;  4BDY A;  2Y0S A;  3DPU A;  4BE0 A;  1WJA A;  3EUK L;  5KNL A;  4F92 B;  2IGO A;  2AQE A;  3H9Q A;  3FKJ A;  4DBR A;  5JHF A;  3HG9 A;  4PJL A;  4B3X A;  3OYK A;  3OYB A;  3OYF A;  2KDO A;  3TL4 X;  2L7K A;  3KEY A;  3NWT A;  5HVQ C;  1OLT A;  3BCB A;  3VDX A;  4LIT A;  2CH0 A;  1BR2 A;  1MW7 A;  1PJR A;  3HL2 A;  3W3C A;  2ZXH A;  3A1Y A;  3LSK A;  2M7A A;  4QPO A;  2Q1Z B;  3TBI A;  3L2R A;  1MMN A;  1W36 C;  2R7X A;  3L2V A;  2PJR B;  4XOP A;  5CPR B;  4XLE A;  3LSI A;  3DPT A;  2L9N A;  3S8P A;  2FUG 2;  1N77 A;  4AU7 A;  2JSP A;  1X4O A;  1YX3 A;  2LBF A;  1W36 D;  3DWL E;  3QYE A;  3CP8 A;  2HZD A;  4HPQ A;  3CF2 A;  3IAS 2;  1D0X A;  2R7W A;  3OOU A;  4ZDO A;  2LYC A;  3HKZ A;  2LRE A;  4E6K G;  2X6X A;  1WJ5 A;  4XNF A;  4C2U A;  2LC2 A;  4DGW B;  1V5E A;  2M7B A;  2Z1D A;  2MC4 A;  4PUS A;  2VJ4 A;  2VJJ A;  4HEA 2;  3PSI A;  3SEQ A;  2XSJ C;  2XC7 A;  2F5V A;  4PK4 A;  2W7N A;  4XLF A;  4XN0 A;  3HOS A;  3OMY A;  3SEZ A;  4YRV A;  4CSW A;  3I9V 2;  5FRO A;  2DT7 B;  3QYB A;  3OIP A;  4CUG A;  2IGK A;  2XAU A;  4JOM A;  4E4H A;  3OR1 C;  3FBN B;  3PSF A;  3HPH A;  2IGN A;  2BVM A;  3CMM A;  4OWR B;  4E7K A;  2WA0 A;  4RLF A;  2KRH A;  2ELJ A;  4ZJZ A;  1GLN A;  2HVQ A;  2VL8 A;  3GBG A;  2E5N A;  3QOD A;  2Z16 A;  4P5O A;  4C2T A;  2IS2 A;  3H0D A;  4NC7 A;  2VIX A;  3LFU A;  3IP4 B;  1QHG A;  4BQO A;  2A6T A;  4H4K C;  1WJB A;  2WB1 A;  4XMY A;  4NNJ A;  4BEH A;  2IS1 A;  2LY2 A;  3ONQ A;  1X1C A;  2IXS A;  3M1C A;  4EAT A;  2IS6 A;  1T0F C;  3CES A;  3K4B A;  4DBQ A;  4FET A;  3VWB A;  2CUZ A;  3W2W A;  1QHH D;  3AL0 C;  3OL4 A;  2L9S A;  4C9Y A;  2CV1 A;  4D9J A;  4RMN A;  3ZCO A;  2GOX B;  4BAC A;  3ZGK A;  2CV2 A;  4DOZ A;  3AL0 B;  4B43 A;  3VSL A;  2KP6 A;  5KCM A;  1YX5 A;  4YEJ A;  1LDK B;  3S93 A;  4F3Q A;  3FHN A;  4BEH B;  4BJ5 C;  2MD0 A;  2OV7 A;  2M0M A;  4IQ4 A;  2W00 A;  2VKD A;  2WY8 Q;  3RPU D;  4IKF A;  1OR7 C;  2CV0 A;  3HC7 A;  2E60 A;  4NQW B;  3RTR A;  5FRN A;  2A5W A;  2QKM B;  2PJR A;  1NG6 A;  4X0G A;  1LKX A;  1DQU A;  4BJ6 C;  2ZFU A;  2VXZ A;  2MAB A;  4HG2 A;  1UAA A;  2CUJ A;  3E1S A;  3H9G A;  3K10 A;  2BW3 B;  2WAE A;  2HDW A;  1D1A A;  3LSG A;  5CQG A;  3D5S C;  4OAZ A;  3K4C A;  2CS3 A;  4Y4R A;  3VSK A;  5KHD A;  3OYC A;  3DTK A;  3OL3 A;  3DLA A;  2X1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...