2RQPA

The solution structure of heterochromatin protein 1-binding protein 74 histone h1 like domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
GPGMASSPRPKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heterochromatin protein 1-binding protein 3
publication title The middle region of an HP1-binding protein, HP1-BP74, associates with linker DNA at the entry/exit site of nucleosomal DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rqpA00
4RGUA 4IHTA 1O3SA 2HKXA 4RB2C 1FPQA 3RDIA 3FWEA 4BH9A 5FB2A 2VXZA 1IN4A 2XAJA 3RIRA 3L9FA 4RB0A 5IT3A 1BOAA 3J80K 5TRDA 1K7AA 3MCZA 5E20A 4BQAA 1W7PD 3MQ0A 4A0YA 2XIGA 3I64A 3N97A 3CO7C 5D5WB 2GXBA 4OMZA 4PZJA 4FX0A 5CYVA 1I1SA 2EV0A 1P92A 2M8EA 1IXSB 2JPCA 2HR3A 2BYVE 3KE2A 2QVOA 3TOBA 4GCVA 4HF1A 4I0BA 3JSPA 5KK1A 5L3GA 1J0RA 3BZ6A 4A0ZA 2EFPA 1J75A 4Y13A 2DAOA 1KQ9A 2VBZA 4HA8A 2D1HA 4EJOA 2H6BA 3F8NA 2KIMA 4UV9A 5JHUA 3ABTA 3ULQB 5E1XA 2OQRA 4B09A 3F6VA 4ESJA 2P5LC 2J5OA 2EV5A 4IF4A 1KU2A 2IJLA 3IKVA 1P4WA 2VONA 1J5YA 5DCFA 1SFEA 5DCMA 2DLLA 2FXAA 5D8KB 4EGYA 1TW3A 3RYRA 4L0YB 5KVRA 1ZH5A 4S04A 2QBYA 2TDXA 1RNLA 2UWMA 4IPAA 2WWYA 1T2KA 1T6SA 2EFOA 4EM1A 1PUEE 3KP7A 3GZ6A 2OZ6A 3KEOA 2K02A 2FU4A 5K5QA 4HDVA 2BV6A 5LGUA 2QM3A 2H6CA 1ZARA 5IT9Z 1OR7A 1ONVA 3I0TA 4MNUA 1X3UA 3L00A 1A04A 3F21A 1MJ9A 1O3TA 5ILVA 1HKQA 4RAYA 1GVJA 3K1MA 3L7WA 1IRGA 4UUVA 2DO7A 4CICA 2K27A 4O6JA 4DQ2A 4RB1A 2GZWA 4YIFA 5CVIA 1ZLJA 4AIJA 2EFNA 5FLXK 1W7PB 4N0BA 4MHGA 5L3EA 5LEJA 3F8FA 5E1ZB 1YFHA 3BPVA 1BIBA 1KU9A 3KP6A 5FGMA 4L0ZB 3C3WA 1IN6A 1FSHA 3O6BB 1ZHFA 2FNPA 5ICGA 4BYYA 1U2WA 1BJAA 2NYXA 5E18F 1H9GA 1USSA 4Y17A 2P8TA 5FO5A 4S05A 4WF2A 4L18B 2ACJA 4I98B 2FE3A 2QQ9A 2IT0A 1YIOA 4Q47A 4ENJA 1BBYA 4M6YA 4G6DA 2PI0A 2L3DA 5HOOA 2QQBA 3H92A 1SD7A 2RN7A 5DD4A 1LB2A 4ESBA 4HX8A 5HVQC 2V9VA 1D8JA 3ZN0A 3BOQA 2HDCA 2EJRA 3QU6A 4LJZF 1FOKA 3FX3A 3K69A 3HRMA 2W25A 3V7RA 2XV4S 2CFXA 4KIBA 2V1XA 4U0YA 3F6OA 4PGGA 1Z6RA 4KICA 5DCMB 1RUOA 4U0VA 3T5XA 2VT2A 4AD9A 2CG4A 2MLGA 3EQLF 4M6XA 2B0LA 2G7UA 4ZZDA 2P5VA 1F4KA 4I09A 3FM3A 3F8BA 1I1GA 2M1BA 1IF1A 2PLYA 1U3EM 3ZMTA 2VOOA 3M1EA 4KYWA 1KYWA 2IA0A 3BPXA 3B02A 4G7HF 2V79A 3GUDA 2E7WA 3G73A 3MFKA 2JZYA 5K1YA 1YS7A 5D5UB 5H20A 2P5KA 3GF2A 1SFXA 5ILSA 1DPRA 3KP4A 4HX4A 4MEXF 5IT9K 5BOXA 3RTRA 5JFRA 2VC0A 1FP1D 2O3FA 3GXOA 2K4BA 1FYLA 1MGTA 3KETA 1VTNC 4UNOA 1TNSA 2FEZA 3RJPA 5L3BA 1LEAA 4UVBA 3HRSA 5AONA 2X4HA 5LHGA 4LB6B 2GAUA 3W6KB 3KZYA 3WU1B 3QP5A 1ZGAA 2XKOA 1S7OA 4IRIA 1F9NA 1LDKB 4CO8A 1TNTA 4R8HA 1XD7A 3F8MA 2PJPA 1FYMA 1YW8A 3FXRA 4GO1A 1G4DA 4L9TA 1FBSA 2KIFA 2RQPA 3I54A 3RKYA 3EETA 1MJBA 3RKXA 2GWRA 2JPBA 3BJAA 5BQTA 1LDDA 2JSCA 1V3FA 2KJCA 3W6JB 1IRFA 3KLNA 1LNWA 3DKWA 2FQ3A 2NS0A 3O3KA 2A61A 2ZO4A 3HOTA 4HF2A 4CDGA 4FT8A 3K1NA 2DT5A 4PCQA 2DBBA 3SHFA 4HBLA 4HQEA 2VBYA 1KQ8A 2FOKA 1O3RA 3JTHA 4M74A 5JI6A 3R61A 1S29A 5CLSA 4L9NA 5HDGA 3R0JA 1ZRFA 2ETHA 2RNJA 2VE9A 4KUMA 2YX7A 2M45A 3ZMZA 3ZN1A 4KDPA 4BHPA 1BC8C 1OYWA 3WTXC 1ODDA 4UXNA 4ZYDA 1S8NA 3NQOA 2K4JA 4L5JA 3HHGA 4ZYGA 4OIPF 2JT1A 3GVAA 1IZ1A 4TV7A 1R5HA 3SXYA 3KEQA 2HQNA 1T98A 4LFUA 3VEPA 3B73A 1WI9A 5D4SA 2FBHA 1WQ2A 3MWMA 4ZH4F 3KFWX 2WV0A 5D4RA 4EGZA 5HLIA 1R5GA 5FLXZ 1CGPA 5DUKA 4DNCA 3U1DA 3HUGA 1ZGJA 1JHHA 2J5PA 1MDMA 5F6FA 3AAFA 3GFLA 1SAXA 2FNAA 2W57A 4G8XA 1PP8F 4BHCA 1YW7A 3LFKA 1D3YA 2JTVA 1SMTA 5FD5A 4RS8A 4KIFA 2XGXA 4LLNA 1HQCA 4IJAA 4M73A 3WTUC 1R7JA 1SFUA 1V4RA 1CF7B 3MZHA 1IXCA 3GFMA 1IN8A 1ZRCA 3E5QA 3ISPA 1HW5A 2PQ8A 2KJBA 3V7SA 4IRHA 2MH9A 3I53A 1QZYA 5LRRA 2YPRA 1ULYA 3VOEA 5E1WA 2L4MA 2A6EF 1B9MA 1EH8A 2CGPA 5CVUA 1Z1DA 2QWWA 4XRFA 3KP5A 1R1VA 3EUHA 1BC7C 4I0AA 3I5UA 3LA2A 4ENMA 2MA3A 4KMUX 2IA1A 2H27A 5CVVA 3FXQA 3HTUA 4HZFA 2ESNA 2MH2A 1F1ZA 5L3CA 3CDHA 3ELKA 2AS5F 1J2XA 4M9ZA 2L02A 2VBWA 4BNCA 2RC4A 1C0WA 3WTSC 3J81K 2IW5A 3ZQ7A 4G9YA 2STTA 2IVMA 2KRFA 4LLLA 2YX4A 1FBQA 4CZZA 1I27A 3WGIA 3WE3A 2NNNA 4I7HA 2O0YA 2CW0F 4Y15A 3F72A 4CGZA 5BS6A 1R22A 2Z5UA 3LWFA 4HAMA 3E6CC 1T0FA 3WTZA 3I59A 3LSTA 4WX9A 3CUQA 3L2CA 1S7AA 1J9IA 3K0LA 2HOEA 5LGNA 4XSXF 3DEUA 4EJWA 2R7DA 3ZMSA 3R4KA 1QBJA 5FFXA 2EV6A 1HW1A 4O5VA 4AIKA 2V1DA 1ZN2A 4HQMA 5ILUA 3TKYA 3HSFA 4UVAA 1O57A 2F5FA 4XBFA 3JSOA 3DF8A 2IP2A 4R79A 3T8RA 2CO5A 5D5XB 4KN7X 5DEQA 1KQ0A 3IWFA 1T39A 2E1CA 1B59A 1BN5A 1HSTA 2XHKA 2IA2A 2FBIA 3QU3A 2FSWA 5J6XA 4MQ9F 1U78A 2P6TA 3HIFA 3TQNA 4EJTA 1FNNA 1R1TA 2GA2A 3IL2A 3LQRA 3FM5A 4HDUA 1ZRDA 1S3JA 4N9IA 3IC7A 3MAJA 2YR2A 2OZUA 3LAJA 3F22A 3IHUA 3VFZA 1KYZA 2NNYA 2YU3A 1LJ9A 1XMAA 1H9TA 2NRAC 5LHHA 4JK1X 1D8KA 4MQVA 2RDPA 2XASA 4NQWA 1DDNA 1SD5A 3K2ZA 1MJAA 4LGWA 1K6OA 2CYYA 5DYMA 2BE5F 5H6QA 2OAZA 3T0YA 1FBUA 1ZREA 1NHAA 3OOPA 2HKOA 2ELHA 3ABUA 3DQVC 4BHBA 2G9WA 5EEHA 2P7CB 1IAWA 3MZYA 3HTSB 4L5IA 3F8CA 1XSXA 4ON0A 2EB7A 3GYHX 3P9IA 4LG0A 2ZFWA 4M9SA 2ZMEA 2MLKA 2GXGA 1O7LA 2JRTA 2VN2A 2STWA 2P6SA 4M72A 1J59A 4GYIA 4HW0A 1YLFA 2PMHA 1J7KA 3WTYC 3FZVA 3N4MA 2QBYB 1K79A 5E17F 2OU2A 2DK5A 3DPTA 4A0XA 2COMA 1IUYA 2PG4A 4ZYHA 3M8FA 3EDPA 3PFIA 1I6XA 2E7XA 2FA5A 1XN7A 3FXUA 5FFZA 1B4AA 4GYGA 1I5ZA 2QQAA 1ZLKA 3RPUA 1YG2A 1RZ4A 1P4XA 3M7GA 2DI3A 4G7OF 2R3SA 3I4PA 5FD6A 4M9XA 1FP2A 1B1BA 4U7DA 1JGSA 3SQNA 2M5WA 1XGMA 2RGVA 3HHHA 4KT5C 3KP3A 2VC1A 3TDZC 3TDUC 3REOA 3R60A 1EH7A 1DPUA 2VODA 3S2WA 3P7NA 1B9NA 2DQLA 2XUBA 4EJVA 4EVIA 4MTEA 1L0OC 4WWCA 2ZNYA 1IN5A 4RGXA 2ZBKA 4IHSA 2XRNA 3P9KA 3E5UA 1K78A 5CVJA 3CUOA 4OINF 1YYVA 4G94A 3TGNA 1OYIA 2LSOA 2QUFA 1R23A 5H6RA 1FSEA 3ML6A 1O3QA 2IRFG 4CXFA 4F7ZA 2DK8A 3EYYA 2Q8KA 5AIPA 1O7FA 2O03A 1OYYA 4QWQA 2OBPA 3J81Z 4EMSA 3BY6A 5DDGA 2DU9A 1RUNA 3K9TA 3HSRA 3V8LA 1IXRC 3CJNA 3CO6C 4P55A 5LBQA 2D45A 1WRJA 1WKMA 4O3MA 4GXOA 2W84A 5CJ9A 2EWNA 3H3UA 1H0MA 4KMFA 1FLIA 4P9UA 2D1VA 2Y0MA 3G3ZA 3GEZA 1YS6A 4EV0A 5J8CA 2A3SA 2R7FA 2V1UA 3CLOA 3KZZA 2AXLA 1ON1A 2QENA 1G3YA 2G7HA 3GZ5A 1RIOH 1Z6TA 3TO7A 2O8XA 2MD5A 3V8JA 4B8XA 5ED4A 1REPC 2L54A 3I58A 2DPDA 3V8KA 3IRRA 1JXSA 1U5TC 1HBXG 3KLOA 3HOSA 3V4GA 4HLYA 3SZPA 3RI4A 2LF7A 5L3DA 4R1HA 2DFIA 5ICFA 3LA3A 5EEGA 3CUQC 4UVCA 4MTDA 4A6DA 4I02A 1GHCA 3R6SA 2VOPA 1QNTA 3T1BA 2OD5A 4Q5SF 3O2PE 5D8LB 4PDKA 2PFBA 1QPMA 4KIGA 4A5NA 2E1NA 3HRUA 5BPDA 2F5DA 2XVCA 4QLCU 5D6FA 3TO6A 1TBXA 1TQMA 2EA2A 5HS9A 4U0WA 2ISYA 1ZYRF 3GW2A 1Z7UA 5A2QK 3JAMK 5LLQA 2MC3A 4Q4ZF 1K78B 1MZBA 3PQJA 1QZZA 2FBKA 3QOPA 1FY7A 1G3SA 2XAFA 4U88A 3E97A 5HLGA 4P9FA 2A6HF 4FHTA 5CVRA 2DPUA 2PMUA 1BI1A 1EV7A 1FYKA 3QAHA 3VB2A 4G6QA 1W7PA 2EFQA 1QQIA 1XB4A 2XAHA 3IWZA 1ZG5A 1Z05A 1XDUA 3NRVA 1DP7P 1XSDA 3FHZA 4EM0B 2EFWA 4WXDA 2GQQA 4HF0A 4AVPA 1FZPB 4BXUA 5DD8A 2UZKA 2H94A 3WE2A 5HS7A 4LK1F 4WK8F 1TQIA 2LKPA 2QZ8A 2Y75A 4CYDA 4L9JA 1T38A 3DXJF 2IPQX 3TOAA 1LEBA 2GA1A 3WODF 4MEYF 3OV8A 3F23A 4ZYEA 4AIHA 1TW2A 2HTSA 3BJ6A 3C7JA 4BAYA 1U5TA 4M71A 3E6DA 4IVNA 1AOYA 1BI2A 4HV5A 3DP7A 4WXHA 3ERED 1AWCA 4OIQF 1D5VA 3BROA 3ECOA 4JBAA 4A5MA 3WGHA 3RYPA 2XROA 1QO0D 4KNYA 4YG2F 2ZXJA 4N9HA 1XGSA 4RGSA 5JVTA 4LB5A 5BMZA 1L3LA 5E8IA 3ECHA 3HSEA 1KU3A 5L3FA 4YFKF 2A68F 2MBFA 3IKTA 3D0SA 1BI0A 3ZP5A 3HRTA 1QGPA 2H09A 1P4AA 4PGHA 4HYEA 4ENKA 1U8RA 2XAQA 3EYIA 1SMYF 2ZCWA 1MDMB 2FF4A 3I71A 3GWZA 1UB9A 2CSOA 1E2XA 3QRFF 1FC3A 3VODA 2Q0OA 1IW7F 4KFCA 3V7CA 3C1DA 1XDSA 3CTAA 1ON2A 1SD6A 2Q2EA 3NEUA 2L01A 2A5YB 1F5TA 4IXAA 2C6YA 3FMSA 2XKPA 1WWXA 2M87A 4LMYA 3E5XA 4EM2A 3LA7A 2ZJ2A 1Z91A 1HXDA 3H3ZA 1G3TA 1RI7A 2W24A 2GIVA 2ZKZA 2ZNZA 2LDUA 5AIQA 1KU7A 1JE8A 3J7AO 1ZAOA 2D2WA 4RB3C 2Z33A 3ZPLA 2HFHA 5HLHA 2LF8A 4UV8A 1USTA 4OIOF 2WTEA 4XLNF 1U6GA 3L09A 1YTYA 2A07F 2X0LA 3DPLC 2BBYA 3PQKA 3ZMVA 3C18A 5K5OA 3RKWA 2HQRA 4EQQA 1S6LA 3JW4A 2WC2A 5HDNA 4YFXF 4ESFA 2RV8A 1YQAA 1PDNC 2VE8A 3DFGA 2QLZA 1R1UA 1XGOA 4MGRA 1W4MA 2NAZA 4NHJA 3QP6A 1TQPA 2VBXA 1FT9A 2FRHA 2ADUA 4D0PA 1U5TB 5K5RA 3QPHA 5J8FA 4AWXB 4KA4A 5TJJA 5F64A 2FMLA 5ICEA 1HKTA 3E6MA 3I59B 5ERIA 2CWEA 3ZMDA 3LQQA 3CUQB 2Z9OA 3ZMUA 1OMIA 3P9CA 3Q9VA 2HS5A 3FMRA 1BM9A 1ZG3A 3R0AA 4XSZF 1GXPA 2DTRA 5BPIA 4ASNA 3KP2A 3QPTA 2QYOA 3Q5FA 3BP8A 4XLPF 1HKSA 4IRGA 4LK0F 2CQKA 5HS8A 1G3WA 2HYFA 4A6EA 2K86A 1R58A 2Z99A 4OU0A 1UHMA 4HLXA 1UHWA 3F3XA 2XAGA 3KCCA 2OQGA 2KIUA 3GO5A 5A2QZ 4LD5A 3JAMZ 1XSVA 5D6EA 5F1RA 3IRQA 2HTJA 5LHIA 1STZA 3BWGA 1XMKA 2M30A 1Y0UA 2EK5A 1TTYA 1MD0A 1P6RA 1LDJA 3E6BA 1Z9CA 4I01A 2HWVA 2OA4A 1W5TA 4Z2YA 3FMQA 3SZTA 2P7VB 2RKHA 3WGGA 1LQ1A 2HZTA 1BI3A 2HYGD 1ZG1A 6PAXA 2VT3A 5LRSA 3M9AA 3FF5A 3U2RA 1P2FA 3RPQA 4LLGF 3WTWC 3J80Z 4HX7A 4P5OA 1KGSA 2F2EA 3E3VA 4GGGA 2BGCA 3U9GA 4KN4X 5LEKA 1HW2A 4P96A 4YIIA 2A69F 2UXNA 2O61A 2KKOA 4A2UA 1PP7U 5ICCA 1CF7A 4OMYA 1DUXC 3D5LA 3GFIA 4H0EA 4E70A 3GX4X 2FMYA 4ETSA 3HYIA 4K2EA 4G7ZF 3M8EA 1KA8A 2Z3YA 2RVCA 4I2OA 1IN7A 1UCRA 2Y48A 4LG0B 4RAZA 2ZMEB 1FWZA 1G6NA 2P4WA 4Q48A 3K1PA 1FX7A 2HGCA 2ISZA 2ESHA 3DV8A 3WU0A 4OIRF 1WSUA 5DUIA 1YW9A 4CHUA 1TLHB 2LNBA 4RGRA 3LAPA 5D5VB 2PBIA 3COAC 3MEXA 5JR3A 4JQFA 3WTTC 1LVAA 1OPCA 4FX4A 1BIAA 2L4AA 4YFNF 4ZZLA 1W5SA 2BEOA 1MKMA 4UHTA 1XCVA 2K7LA 5DV5A 5HDKA 3ROUA 2UXXA 2O6GE 1E17A 4L9VA 1R00A 1XGNA 1JHFA 3GFJA 2PN6A 3Q9SA 3T8TA 4WXCA 2F5CA 4HV6A 4U7BA 3BJOA 2DQRA 1EH6A 5LGTA 3SFZA 3WG9A 2V6CA 1XCBA 1YO5C 2YSRA 1Q1HA 4NB5A 4OOIA 1HSJA 4EJUA 2DW4A 4HOBA 3TO9A 3GLXA 3JTGA 4ENNA 2EA4A 3WTVC 2HEOA 2PEXA 1OKRA 3BDDA 5E8GA 1GXQA 4WCGA 2W85A 1B6AA 1SD4A 1UFMA 1R36A 4A12A 2F5EA
chains in the Genus database with same CATH superfamily
1XPXA 3CCEI 4RGUA 4IHTA 1O3SA 2HKXA 4RB2C 1FPQA 2VUMJ 2QSFX 3BG5A 1QZEA 1R5ID 3RDIA 2Y9YA 2VJIA 2M7BA 3FWEA 3PIPF 4BH9A 3M4OJ 5FB2A 3GTGJ 2VXZA 3W6VA 1JT6A 1IN4A 1BJZA 2XAJA 3RIRA 4C3JJ 3L9FA 4CSWA 4RB0A 5IT3A 2WAQA 1BOAA 3J80K 5TRDA 1K7AA 3PUFA 3MCZA 3BQYA 5E20A 4BQAA 1W7PD 2VQHA 3MQ0A 3LSJA 4A0YA 2XIGA 3BR5A 1NH3A 2X9DA 3I64A 3N97A 2CV1A 1E0EA 4PJJA 4RMNA 3CO7C 2HNHA 3ONQA 5D5WB 4IHVA 1Y1WJ 2GXBA 4OMZA 1QVUA 3CCSI 1FJLA 2RNGA 5GADJ 4IEJA 4PZJA 4FX0A 5CYVA 1I1SA 2EV0A 1WFXA 1P92A 2M8EA 1IXSB 2X1DA 4W1UA 2JPCA 5EF6A 3K70C 2HR3A 2BYVE 3KE2A 2QVOA 3TOBA 1XTAA 4PJNA 1RKTA 4GCVA 2QA4I 4HF1A 4I0BA 5CQEA 3JSPA 1TWAJ 5KK1A 5L3GA 1J0RA 3BZ6A 4XLEA 4A0ZA 2EFPA 1Y8QB 4XICA 2PMZN 1TL8A 2KIQA 4Y13A 1J75A 5EDNA 2FQ4A 2DAOA 1KQ9A 2VBZA 4HA8A 1GT0C 2D1HA 2HPMA 3HKZN 4EJOA 1A31A 2DMNA 2XB5A 2H6BA 3F8NA 1D1CA 2M34A 2KIMA 4UV9A 3CMAI 5JHUA 2DA7A 3ABTA 1LVKA 2JUGA 3ULQB 1YJ9I 3U21A 5E1XA 2OQRA 4B09A 3F6VA 4ESJA 2O9LA 2P5LC 3OYMA 2J5OA 2NS7A 3JR9A 2EV5A 4IF4A 1KU2A 2IJLA 3IKVA 1NG7A 1P4WA 2VONA 1MBHA 3FKJA 1J5YA 1YHQI 3MKYB 5DCFA 2R7ZJ 1SFEA 5DCMA 3NAUA 1HF0A 3OYNA 2QKLB 1OCPA 5F04A 2OTJI 2DLLA 2FXAA 2LY9A 5D8KB 4EGYA 1POGA 1YRNB 1TW3A 3RYRA 1XMXA 3BCAA 4L0YB 3MD2A 3BQZA 5KVRA 1ZH5A 2OJED 3PL8A 3DWLE 3V42A 2X6YA 4S04A 2QBYA 2P0WA 1K61A 2TDXA 1RNLA 2OPTA 4Y52J 2UWMA 3BG9A 1IG7A 2M3AA 4IPAA 2WWYA 1T2KA 1T6SA 2EZLA 3C2BA 4BU2A 2EFOA 2HOAA 2W4SA 3K2AA 2F5VA 4EM1A 3KP7A 4E7ZA 3ZQQA 3GZ6A 2OZ6A 3KEOA 1PUEE 5LFAA 2K02A 3CDIA 1WJBA 2FU4A 5JHFA 5K5QA 3UKGA 4HDVA 2O5RA 2BV6A 2KZVA 2QM3A 5LGUA 4IHYA 2H6CA 1ZARA 1ZTRA 5IT9Z 1OR7A 2W00A 1ONVA 3I0TA 3H9JA 4MNUA 1X3UA 3L00A 1A04A 1VQMI 2M4KA 3F21A 2CUZA 1UMQA 2H1KA 1QVTA 1MJ9A 3JCUC 3OYBA 3NARA 3OL4A 1O3TA 3LNQA 4XLCA 4BACA 5ILVA 1HKQA 3G6EI 4BBRJ 3HJEA 4RAYA 2CRGA 1GVJA 5CKTA 2DDBA 3K1MA 3L7WA 1IRGA 3FK6A 4UUVA 2DO7A 4CICA 2K27A 2LRDA 3X2QH 4NUBA 1Z21A 4O6JA 4DQ2A 4XN0A 3H1CA 2OCEA 4RB1A 2GZWA 3D5SC 3TP0A 3Q3SA 2HU9A 3WHCA 4YIFA 3W2VA 4A3BJ 4E4HA 5CVIA 2A05A 1ZLJA 2KZGA 4AIJA 2EFNA 5FLXK 1W7PB 1YIJI 1LPQA 5KAFC 3M07A 4N0BA 4MHGA 5L3EA 5LEJA 3F8FA 3BT9A 5E1ZB 2AHQA 2XGCA 1YFHA 2EBIA 4KITB 1VQ4I 3BPVA 2K5CA 3TP3A 1XS9A 2H1LA 1BIBA 1KU9A 3KP6A 3ASNH 3G4SI 5FGMA 4L0ZB 4M6VA 3C3WA 3IV5A 4XLAA 1UAAA 2DOEA 2R7UA 4Y33A 1IN6A 2NXNB 1YITI 3CC4I 1FSHA 3O6BB 1ZHFA 2FNPA 5ICGA 4BYYA 1U2WA 1BJAA 2FOWA 2NYXA 5IPAA 5E18F 4C9YA 1MBFA 1H9GA 1USSA 3HGYA 1X3WB 4Y17A 2P8TA 2I10A 5FO5A 4S05A 4AYBN 4WF2A 2KP6A 3I55I 3OR2C 2E1MC 4L18B 2W1OA 2ACJA 2V7FA 1YX5A 4I98B 3G71I 2FE3A 1JKRC 1BW5A 4XKCA 2QQ9A 2IT0A 2L0KA 1YIOA 4Q47A 3H3VK 2ZJQF 4ENJA 1BBYA 4Y4RA 1OCTC 4M6YA 4G6DA 2PI0A 2L3DA 4NNJA 5HOOA 1H89C 2X6XA 1R4NB 2OTLI 3FIWA 2WBMA 3BR3A 1BR2A 2QQBA 3H92A 1SD7A 2RN7A 1BW6A 1VI0A 3L2VA 1K83J 3LSKA 5DD4A 3DBRB 1LB2A 4ESBA 4HX8A 2V4JC 5HVQC 1R6RA 2V9VA 4RM3A 2BHZA 1D8JA 2XSJC 3KX2A 3ZN0A 3BOQA 2HDCA 2EJRA 3QU6A 2HVRA 3L2WA 4LJZF 1FOKA 3MKLA 2NVUB 3FX3A 3CLQA 1T56A 3K69A 2E71A 3HRMA 2W25A 4BE2A 3V7RA 2XV4S 2CFXA 3HKZA 1OQYA 2V1XA 3PNVA 4KIBA 4U0YA 3F6OA 2ZJRF 2VKDA 1IDYA 4PGGA 5J47A 1DU0A 1A35A 4XKWA 3ZQFA 4Z6YA 1Z6RA 4KICA 5DCMB 1RUOA 1BA5A 4U0VA 1SVLA 3T5XA 2VT2A 1TWHJ 4AD9A 2CG4A 2MLGA 2W82A 2KRCA 3EQLF 4M6XA 2B0LA 2G7UA 2R7OA 2MW8A 4ZZDA 2P5VA 4IOAF 3GBGA 1ETYA 2CH0A 3TEDA 4B44A 1F4KA 4I09A 3FM3A 3S17J 1GVDA 3F8BA 1I1GA 1LE8B 2M1BA 3DKYA 1IF1A 2PLYA 3L2UA 5M3MJ 1U3EM 3ZMTA 2VOOA 3M1EA 4KYWA 1KYWA 3AL0B 2R7QA 1MSFC 2WY8Q 1ETKA 1HDDC 2NVXJ 2Q2EB 2IA0A 3BPXA 3B02A 4G7HF 3ABKH 2CU7A 2V79A 2NVYJ 3GUDA 2E7WA 4CCMA 3G73A 4FCYA 3MFKA 1BR1A 2JZYA 1AA7A 2JA8J 5K1YA 1YS7A 5F08A 5D5UB 5H20A 5M5WJ 1JJ6C 2P5KA 3GF2A 3BG7A 1SFXA 1YJNI 2ECBA 3GTPJ 5ILSA 4UB8C 3OY9A 1DPRA 2VB6A 3KP4A 2IBDA 1UG0A 4BJ6C 4II2A 4HX4A 2LOOA 4MEXF 1QU3A 5IT9K 3S2HJ 5BOXA 3RTRA 4CYCA 5JFRA 5C4XJ 2VC0A 1FP1D 2K9LA 3ZQHA 2O3FA 2VJ4A 1RPWA 3TL4X 1OLTA 3GXOA 3OS1A 2EIKH 2K4BA 2Z16A 3DLLF 1FYLA 1MGTA 2L7ZA 2B9SA 3J7AY 4ZDPA 3KETA 2DOAA 2F5EA 3RKQA 4X6AJ 1VTNC 5E3OA 4UNOA 2L9VA 2M9HA 2M7AA 1TNSA 2FEZA 5HNHA 3RJPA 4LITA 3H9QA 1Y6IA 5L3BA 1LEAA 4UVBA 3HRSA 5AONA 2X4HA 4B3XA 5LHGA 4BS9A 1R71A 4LB6B 2GAUA 3W6KB 1VQPI 2R5ZB 3KZYA 3WU1B 3QP5A 1ZGAA 2XKOA 1S7OA 1A6QA 4IRIA 1F9NA 1LDKB 1ZKGA 2WAQN 4CO8A 1TNTA 4R8HA 4RAFA 3VDXA 3K10A 3S3MA 2EIJH 1V55H 2M0MA 1P7IA 5GPAA 1XD7A 4AYBA 3VPRA 2NVQJ 1JUMA 3F8MA 2PJPA 1X2MA 2ZC2A 1FYMA 1YW8A 2BZTA 4D5FA 2R7SA 5EYRA 1PJRA 3FXRA 3JRDA 3P5JA 2V1NA 4GO1A 2LBFB 1G4DA 4L9TA 4AUXA 1FBSA 2KIFA 5GAEJ 2HDWA 3ESWB 2RQPA 1VQ9I 2VJJA 3HPGA 3I54A 3RKYA 3EETA 4D9JA 1MJBA 2K9NA 3RKXA 4B47A 2GWRA 5CPRB 2JPBA 3FXLA 5J4VA 2DA5A 3BJAA 5BQTA 5JLXA 3SEZA 1LDDA 2JSCA 1V3FA 2CMPA 2JSPA 2KJCA 4DBQA 3W6JB 4IZZA 1IRFA 3KLNA 1LNWA 1U8BA 1ERDA 3DKWA 4V2GA 5J1YA 4E6KG 2FQ3A 2NS0A 3ZQLA 3HL2A 2CUJA 3O3KA 2A61A 4CCKA 2ZO4A 3HOTA 4HF2A 4CDGA 4FE4A 2LKSA 4FT8A 3K1NA 3EUHC 4UUSB 1OCCH 1VNDA 1HDPA 3ZQCA 2L9RA 2DT5A 2EILH 4PCQA 2HVQA 1WJFA 4BXFA 1UZCA 2DBBA 2R5YA 3SHFA 3SZGA 4FQGA 5H2FC 4HBLA 4FE7A 1FTZA 3CQZJ 4HQEA 2VBYA 1WJDA 2DT7B 3UR3C 2FOKA 5IP7J 2ZSIB 1O3RA 1KQ8A 5F0FA 1LUJB 3JTHA 4AIDA 4M74A 5JI6A 1IRXA 3R61A 5FRMA 1S29A 2DFEA 4L9NA 5CLSA 1KZHA 5HDGA 3R0JA 4I76A 1ZRFA 2ETHA 2RNJA 4PFPA 2VE9A 1OISA 1AHDP 3GTOJ 4KUMA 1FMVA 3RZDJ 2YX7A 3U1KA 4Y7NJ 3CC7I 3SFIA 2M45A 3ZMZA 5EEAA 3ZN1A 4KDPA 4BHPA 1QPIA 1BC8C 1OYWA 3WTXC 3RQ4A 1ODDA 4UXNA 4ZYDA 3EUKL 3S8PA 4XRSG 2VLAA 1JJ8C 3K6GA 1S8NA 3NQOA 2NOJB 2DODA 5J1RA 2ZSHB 2K4JA 4L5JA 1GLNA 1VZ0A 1XC5A 3ASOH 3HHGA 5EGOA 4ZYGA 1T0FC 4OIPF 2JT1A 3GVAA 1IZ1A 3H36A 4TV7A 1R5HA 3SXYA 5K7HA 3KEQA 2HQNA 1T98A 4LFUA 3VEPA 4DJAA 2LVSA 4J00A 3GZNB 3B73A 1WI9A 4B4CA 5D4SA 2FBHA 1WQ2A 2BHYA 1HC8A 3MWMA 4MO7A 2Y0SA 3KFWX 4F52A 4ZH4F 2WV0A 5D4RA 4EGZA 5HLIA 1R5GA 5FLXZ 1CGPA 5DUKA 1PVEA 4DNCA 3U1DA 4NC8A 3HUGA 4CYCB 3DBHB 1ZGJA 2DJNA 1T33A 1A6IA 1JHHA 3FBIB 2J5PA 1MDMA 5F6FA 3AAFA 3GFLA 1OCZH 1SAXA 2FNAA 2W57A 3MZ8A 4G8XA 1PP8F 4BHCA 1YW7A 2XSDC 1M1EB 3LFKA 1D3YA 2JTVA 2K40A 2E1MB 1X1AA 4FISA 2DMUA 1SMTA 2IXSA 4BEHA 1W0UA 5FD5A 5DS9A 5HNFA 3FKIJ 3IAS2 4KT6A 4RS8A 3GCMA 3RSNA 4KIFA 3W3CA 2XGXA 4LLNA 3Q0WA 3H0DA 3BR6A 3BTCA 1VQ5I 4RLFA 1HQCA 4IJAA 2P81A 3S32A 4M73A 3WTUC 4A3DJ 3DTEA 1R7JA 1SFUA 2JK3A 1MBGA 5BNGA 3OYAA 1V4RA 1CF7B 3MZHA 1IXCA 3GFMA 1VQLI 1IN8A 1ZRCA 3E5QA 3ISPA 1HW5A 1TZLA 2PQ8A 2DA2A 2I8DA 2HYJA 2KJBA 1I50J 3V7SA 5TISC 4IRHA 4GDFA 2MH9A 1H88C 4HNUA 3I53A 1W5CC 3I3LA 3CCVI 3H35A 1QZYA 5LRRA 2GXAA 2YPRA 1ULYA 3VOEA 5E1WA 2L4MA 2A6EF 1B9MA 5EG0A 1ETWA 1EH8A 2CGPA 2M0CA 5CVUA 5J3LA 1Z1DA 4DZPA 4IQJA 3A0HC 1SFOJ 4PK4A 2QWWA 4XRFA 3PUBA 3KP5A 1R1VA 3EUHA 4PJ0C 3S15J 1X1PA 1JKQC 2BVMA 1BC7C 4I0AA 3I5UA 3LA2A 4ENMA 5B3SH 2MA3A 4KMUX 3JRHA 3WG7H 2XF6A 2JWTA 4AVZA 2IA1A 2H27A 2E60A 4A3JJ 5CVVA 2L9NA 3FXQA 3HTUA 4HZFA 4KISA 2ESNA 2MH2A 1F1ZA 5L3CA 3CDHA 4PSWA 3ELKA 3A0BC 3K4CA 5FRNA 1OCOH 2COBA 1TT0A 2AS5F 2R5YB 1J2XA 3L1PA 2OC6A 2Q1ZB 2L02A 4M9ZA 2VBWA 4BNCA 2RC4A 2CW8A 2E35A 2ELJA 2KL4A 1C0WA 1D0YA 3VYUB 3WTSC 4A3GJ 3A1YA 4MIMA 3J81K 1WCMJ 2IW5A 1ZR2A 3ZQ7A 5IOYA 5J40A 1W36C 4G9YA 2STTA 4CCOA 2IVMA 3IH2A 2KRFA 4LLLA 2YX4A 1FBQA 2LREA 4LIUA 2MG4A 4CZZA 3LSGA 3JRGA 1I27A 3WGIA 3LSHA 3WE3A 2M2EA 4AU7A 2NNNA 4IX7A 4I7HA 2O0YA 2CW0F 4Y15A 3MMYB 4A93J 3QYFA 3F72A 3HGGA 4PSXA 5GPCA 2A5WA 2HXIA 4DYRA 5BS6A 1R22A 4HNTA 4CGZA 2Z5UA 1WHUA 3LWFA 4HAMA 1T0FA 3E6CC 3WTZA 3I59A 3LSTA 3LOCA 4CCLA 4WX9A 3CUQA 2EIMH 3L2CA 3C2HA 2ZMEC 1Z3XA 4JX6A 1S7AA 1X2NA 1J9IA 4EATA 3CCUI 4M3DA 3K0LA 2HOEA 5LGNA 4XSXF 3DEUA 4EJWA 4PJMA 2MSYA 1AKHB 4YRVA 2R7DA 3ZMSA 3R4KA 1QBJA 3PIOF 5FFXA 2EV6A 2V9PA 1HW1A 4O5VA 4XLFA 4AIKA 2V1DA 1ZN2A 4HQMA 5ILUA 3TKYA 3HSFA 4UVAA 4XONA 1O57A 2F5FA 2X1CA 4XBFA 1B72A 1F43A 3M1CA 3JSOA 3H5AA 1IRZA 2N8GA 3DF8A 2IP2A 4I99C 4R79A 3DU5A 3T8RA 2CO5A 2VL8A 3OR1C 3WHBA 1ACIA 3MKWB 3BR2A 5GAGJ 5D5XB 3HUGB 2LH9A 2DFFA 4KN7X 1X1BA 5DEQA 4D7MA 1KQ0A 1IGNA 3IWFA 1T39A 2E1CA 1B59A 1BN5A 1HSTA 1Z7LA 3HZJA 4C2TA 3GTKJ 2IGKA 2LY1A 2XHKA 4E7KA 2IA2A 2FBIA 3QU3A 2FSWA 5J6XA 2BY0A 4HRIA 4BEHB 2LD5A 4MQ9F 1ZQ3P 2LKXA 1U78A 4ITVA 2P6TA 3IP4B 3HIFA 4BGDA 2XPUA 3S93A 3TQNA 4EJTA 1FNNA 2IS2A 4IOCF 2R0QC 4QIWN 1R1TA 3HOYJ 4RDUA 5FLMJ 3SEQA 1MH3A 2GA2A 2MGQA 1K4TA 2LLKA 3IL2A 3LQRA 5FROA 3FM5A 4HDUA 1ZRDA 1S3JA 4N9IA 4C2UA 3IC7A 3SJMA 3MAJA 4OAZA 2E2JJ 1VQ6I 2XPWA 4BL0B 4CH7A 2YR2A 2LMDA 3W2WA 2OZUA 3LAJA 3F22A 3IHUA 3VFZA 1KYZA 1X1CA 3CESA 2NNYA 1VQNI 1I3AA 3F0CA 2DTZA 3A01A 2YU3A 3H9GA 5B1BH 3FXMA 3SDGA 3MVPA 2DA3A 1YE9A 1LJ9A 1XMAA 3LSIA 4KJZA 4L5EA 1A5JA 1H9TA 2ZB9A 2NRAC 3ZQIA 5LHHA 4JK1X 1D8KA 1FMWA 4MQVA 2RDPA 2XASA 4JYKA 1V5EA 4NQWA 3S1RJ 1DDNA 1SD5A 3K2ZA 4BJTA 1MJAA 4LGWA 1K6OA 2CYYA 4G6TB 5DYMA 5KCMA 2PJRA 5K7ZA 4A3KJ 3AKZA 2BE5F 2E36A 1IDZA 5H6QA 1IJWC 2OAZA 4B43A 4IL6C 2CW7A 3T0YA 1D5YA 3OIQA 2UV1A 3VSKA 1FBUA 1ZREA 1NHAA 3OOPA 2HKOA 1NG6A 2ELHA 3ABUA 3DQVC 3K70D 4BHBA 2G9WA 4FETA 1DQUA 3ZGKA 2HPIA 3BTIA 5EEHA 1YI2I 1IAWA 2P7CB 2KFDA 3MZYA 3OYHA 2WAFA 3S1MJ 1O4XA 1QRYA 5F1JA 1FIAA 3HTSB 3S1NJ 4E7HA 4L5IA 4D7NA 5HODA 3F8CA 3MN2A 1XSXA 4ON0A 2EB7A 3GYHX 2L7MP 1WJCA 3P9IA 1XG1A 4LG0A 1BL0A 2ZFWA 4M9SA 2ZMEA 5DTDA 2MLKA 2GXGA 1LFUP 1O7LA 2JRTA 2VN2A 3BR0A 2STWA 1Y8RB 2LY2A 1MMSA 2L7FP 3K4NA 2DYRH 1Y56A 2VPLA 4A3MJ 2P6SA 4M72A 2HQ5A 1MIJA 3CJTB 3HEFA 4XMYA 1J59A 4GYIA 1RC9A 3I9V2 4HW0A 4IHWA 2KDOA 1YLFA 2PMHA 3OSGA 4DW6A 1J7KA 3ZXSA 2KPMA 5K7FA 3WTYC 3FZVA 3QQAA 4ZTFA 3N4MA 3QOEA 2QBYB 1K79A 1JKOC 5E17F 2OU2A 3OIPA 4M3FA 2DK5A 3DPTA 4A0XA 4NBQA 1B72B 2COMA 1IUYA 1R49A 2PG4A 4ZYHA 3M8FA 3JRFA 3EDPA 3GTLJ 2IS6A 3H0GJ 2E1OA 3Q0VA 3PFIA 2FUG2 1I6XA 2E7XA 3OYCA 2FA5A 4A3EJ 1XN7A 2IS4A 3FXUA 1NTCA 5FFZA 3A4CA 1B4AA 2DOFA 2TRTA 2X51A 4GYGA 1I5ZA 2QQAA 2VJ5A 1ZLKA 3RPUA 2Y0SN 1YG2A 1RZ4A 1P4XA 1MMDA 1RKWA 2OUMA 3M7GA 2DI3A 4G7OF 1S5LC 2ZFUA 4H4KC 2QEXI 3KYLA 2WV1A 2QQ8A 2R3SA 3I4PA 2FX0A 5FD6A 4M9XA 1AU7A 4DYCA 1FP2A 4XOPA 1B1BA 1A36A 4U7DA 1JGSA 3SQNA 1NK2P 1ETOA 2M5WA 2DA4A 1XGMA 2RGVA 3CCJI 2HQAA 4IHXA 3HHHA 4KT5C 3KP3A 2VC1A 4XORA 3TDZC 3TDUC 3MKZA 4ANJA 1SEUA 4XQFA 3REOA 2JUCA 1OJLA 2EZIA 2WAEA 3PM1A 3R60A 1EH7A 2I5UA 2F4OB 3QWLA 1DPUA 3LSPA 3PNTA 2VODA 3S2WA 3P7NA 1B9NA 2DQLA 4PFOA 2XUBA 4EJVA 4EVIA 2CQNA 1ETVA 4MTEA 4IO9F 1L0OC 3PFYA 4WWCA 2ZNYA 1IN5A 4RGXA 3VSLA 2ZBKA 3A01B 4IHSA 2XRNA 2QKMB 3P9KA 1CQTA 3E5UA 1K78A 5CVJA 1VQ8I 3DU6A 3CUOA 4OINF 1YYVA 4NQWB 4G94A 3TGNA 1OYIA 1RETA 2LSOA 2QUFA 3JRIA 2DMQA 1R23A 2PJRB 2WY7Q 3ZRGA 5H6RA 1FSEA 2H8RA 3ML6A 2M4GA 3OYDA 1O3QA 2IRFG 3ABLH 3E7LA 2GOXB 4CXFA 4F7ZA 2DK8A 4CCNA 1B8IA 3EYYA 2R7VA 1H8AC 1TWGJ 1Z3YA 2VKEA 2JN6A 2Q8KA 4BQOA 4A3FJ 3VWBA 1UJ8A 3DTIA 4XKBA 5AIPA 3OS0A 3DCFA 1O7FA 4FTHA 1YOVB 4BE0A 1N78A 4ZC3A 3OYEA 2JVGA 2O03A 1OYYA 2CS3A 2YUSA 4QWQA 2GBYA 2OBPA 3DEEA 2ME0A 3QYBA 1LFPA 3GLLA 1D1AA 2R7TA 3J81Z 4UB6C 4EMSA 3JREA 1E3OC 3BY6A 5EJCA 1NK3P 3GTQJ 2R4GA 5DDGA 4I6ZA 2DU9A 1RUNA 3K9TA 4DBRA 2DMTA 2JVHA 3HSRA 3V8LA 3CCMI 1IXRC 3CJNA 2QCOA 3CO6C 4P55A 3PJRA 5LBQA 2D45A 1WRJA 4AC0A 1I3QJ 1WKMA 2GIZA 4O3MA 1P9QC 4GXOA 2AQEA 2W84A 2Y69H 5CJ9A 5E3NA 1PUFA 2EWNA 1HCRA 3H3UA 1H0MA 4KMFA 3K4KA 3BTLA 1FLIA 4P9UA 5C44J 2D1VA 2Y0MA 3G3ZA 3GEZA 3G1MA 1YS6A 3PO2J 3GTJJ 4EV0A 5F27A 3CF5F 3K4LA 5J8CA 2A3SA 2R7FA 2BOLA 2V1UA 3CLOA 3I4MJ 3KZZA 1R9TJ 5M5YJ 2XAUA 4NC6A 2AXLA 1ON1A 2QENA 1ZGWA 1G3YA 2LTPA 2G7HA 3GZ5A 1SANA 4HSTA 1RIOH 1Z6TA 3TO7A 4CA0A 3B6CA 1ORKA 2O8XA 2MD5A 3CMEI 3V8JA 1FOWA 1W1WE 3DPUA 4B8XA 1FIPA 1OFCX 1YX3A 3ERMA 4YELA 3NWTA 5ED4A 1REPC 2L54A 4A69C 3JRBA 3I58A 2DPDA 1DGRM 3V8KA 3IRRA 2MC4A 1JT0A 1JXSA 3BTJA 1U5TC 1Y39A 1HBXG 3KLOA 3CC2I 3K7AJ 3HOSA 3V4GA 4HLYA 3SZPA 3RI4A 4F3QA 2VQLA 2LF7A 4ZTJA 3KYCB 5L3DA 4R1HA 1ETQA 3JRAA 2DFIA 4N4OB 3BZKA 3LA3A 5ICFA 2VKVA 5EEGA 1XX5A 1MMAA 2FD5A 2ID3A 3CUQC 2ZJPF 2HDDA 4UVCA 4MTDA 2EPFA 4A6DA 4I02A 4ZDLA 1GHCA 3R6SA 2LFBA 2VOPA 1QNTA 1T95A 2XDVA 2OD5A 3T1BA 4Q5SF 1G2HA 1HOMA 2XF5A 3O2PE 3OL3A 5D8LB 4S0HB 4PDKA 1N25A 2LYCA 2PFBA 4U87A 1QPMA 2CUEA 2DXIA 4YIRX 4KIGA 4A5NA 5B1AH 2QSHX 3KIOA 2E1NA 3HRUA 4ABZA 5BPDA 2F5DA 2XVCA 3CCYA 3M8JA 4QLCU 5D6FA 2AO9A 3E1SA 3LSMA 3TO6A 1TBXA 1TQMA 2EA2A 3F9KA 5HS9A 1Q1VA 4QPQA 4U0WA 2ISYA 1ZYRF 2QSGX 3GW2A 4HPQA 4EEFG 1Z7UA 5A2QK 2W7NA 3WU2C 1WI3A 3JAMK 1DU6A 4BE1A 3KEYA 5LLQA 3FXJA 4M3BA 2ME6A 4ZJZA 3HBLA 2MC3A 4MFEA 2O8KA 4Q4ZF 1OCRH 2HVSA 2QF7A 1MZBA 3PQJA 1K78B 1QZZA 2FBKA 3QOPA 2R92J 2CQ7A 4BXXJ 4XRSA 4BJ5C 1FY7A 2DDAA 1MMNA 3PNYA 1D0XA 1G3SA 2XAFA 4U88A 3E97A 2LK2A 4IQ4A 4M3EA 5HLGA 2JA6J 2DT6A 3G1LA 4P9FA 2CJJA 2W48A 2A6HF 4FHTA 4JX4A 1W0TA 5CVRA 2DPUA 2PMUA 1BI1A 2VKHA 1EV7A 3KZIC 4RLQA 1TC3C 4B3AA 1TT5B 2GM4A 4F55A 1FYKA 1FOYA 3QAHA 3VB2A 4G6QA 1GUUA 4AM3A 1W7PA 2BW3A 3HXLA 2EFQA 4PUSA 1QQIA 4E7LA 1XB4A 3TBIA 2XAHA 1Y1VJ 2VI6A 1ZELA 3IWZA 1Z05A 5E79C 1ZG5A 1HLVA 1XDUA 3NRVA 1DP7P 1XSDA 3L2QA 4BBSJ 3FHZA 4EM0B 2EFWA 4WXDA 3BG6A 2R7WA 2GQQA 1MNDA 3S14J 4HF0A 5GP9A 4AVPA 1FZPB 4BXUA 3HPHA 1RESA 2BXYA 3G1OA 5DD8A 4DGWB 2LG4A 3J7ZI 2V6EA 2UZKA 2H94A 3HC7A 3OYLA 3WE2A 5HS7A 1VFCA 5DM6F 4LK1F 4WK8F 1TQIA 4NC7A 2XF7A 2LKPA 2QZ8A 1SC7A 2B63J 1PUFB 2L5QA 2E2IJ 1FEXA 2Y75A 4CYDA 2MYSA 4L9JA 2GOMA 1T38A 2VPRA 1JGGA 3OYIA 3RCOA 5F0CA 3DXJF 2IPQX 2IGNA 3C2GA 3HM5A 3BR1A 2HXOA 2EZHA 3TOAA 1LEBA 2GA1A 3WODF 4MEYF 3OV8A 4C2MJ 4B1RA 5TGTA 3F23A 1WPKA 1Z0XA 3OOUA 4ZYEA 4AIHA 1TW2A 3AFHA 1SFKA 2HTSA 3BJ6A 1JKPC 3C7JA 3ZOBA 4BAYA 1U5TA 3CCRI 2LC2A 4BY1J 4M71A 3D5RC 3E6DA 2Z1DA 4IVNA 1T08B 2VASA 3AG4H 1AOYA 1BI2A 4HV5A 4P1WA 1JTYA 3DP7A 4WXHA 3ERED 1AWCA 4OIQF 1D5VA 1FTTA 3BROA 2DYSH 3ECOA 3K4JA 1EA3A 4JBAA 3H5RA 4A5MA 2XRLA 4HSRA 5FKOA 3WGHA 3RYPA 2XROA 1WVRA 1QO0D 1SVMA 4KNYA 3K4MA 1JTXA 4UUTA 2ZXJA 4N9HA 4XOTA 4YG2F 1XGSA 4RGSA 5JVTA 4LB5A 5BMZA 3GMEA 2F4IA 3CJRB 2L9SA 3HOXJ 1TP4A 1L3LA 3PO3J 5E8IA 1MBKA 5EGOB 3ECHA 1MNEA 3HSEA 1KU3A 4RBOA 2CV2A 2DJIA 2NVTJ 5L3FA 4YFKF 2A68F 2MBFA 3IKTA 4II3A 2KT0A 3D0SA 1BI0A 3W2AA 3ZP5A 2V26A 2KQRA 3HRTA 1QGPA 2H09A 2KRHA 1P4AA 1V5FA 4PGHA 4HYEA 4ENKA 2JA2A 1U8RA 3OYJA 1X58A 2XAQA 3EYIA 3ABMH 1IV6A 1RRJA 1SMYF 2TCTA 3HOWJ 1MH4A 2ZCWA 1MDMB 2FF4A 3FK7A 3I71A 2KHMA 3GWZA 1UB9A 2CSOA 1E2XA 4RA2A 3S16J 3QRFF 1FC3A 3VODA 2Q0OA 1IW7F 1LE8A 1U9NA 4KFCA 3V7CA 2CFOA 3C1DA 2GLOA 1IC8A 2IS1A 2ELKA 2UUZA 3M3YJ 1XDSA 3CTAA 1ON2A 1SD6A 2Q2EA 4XK4A 3NEUA 5EZHA 1K4SA 2L01A 2YS9A 2A5YB 3HDDA 1F5TA 4IXAA 2C6YA 4BDZA 3IH3A 3FMSA 2XKPA 3SYTA 4IKFA 1WWXA 2M87A 4LMYA 1Z67A 3E5XA 4EM2A 1BR4A 2ICWG 4F93B 3LA7A 1WZ2A 1ITYA 1ETXA 2BY1A 2E19A 4FASD 3BCBA 2ZJ2A 4QSHA 2AXTC 1Z91A 4BQNA 1HXDA 2DCEA 5IOZA 1U0JA 3LMMA 3H3ZA 4LG3A 1MW7A 1X4PA 2HOTA 1G3TA 1GV5A 3TW6A 2X85A 4J01A 1RI7A 3PSIA 1K6YA 2BW3B 2GIVA 2W24A 3A2KA 3QYEA 2ZKZA 2ZNZA 2LDUA 4CUGA 4PJLA 3AG3H 2XB0X 2JRMA 5AIQA 5EG0B 1KU7A 3QPSA 1JE8A 3J7AO 1ZAOA 2D2WA 1UELB 4C3HJ 4RB3C 3QODA 2Z33A 3ZPLA 2HFHA 5HLHA 4DZJA 3QPLA 2LF8A 4D1QA 3DEWA 4UV8A 1USTA 4OIOF 5C3EJ 3AG1H 1P7JA 5FKLA 2E34A 2WTEA 4XLNF 1U6GA 3L09A 1YTYA 2A07F 2ZXHA 4MLOA 2X0LA 4DIQA 2BVLA 3DPLC 2BBYA 3PQKA 3ZMVA 2K3FA 3C18A 5K5OA 1N75A 1WGXA 3RKWA 2HQRA 2WB1N 3A03A 4RAGA 2R5ZA 1FOXA 1VQOI 1G8XA 4EQQA 3CMYA 1RR8C 3VYRB 1EKEA 2JJ7A 1RR7A 2DN0A 1S6LA 2XPVA 2WC2A 3JW4A 3TMOA 2PX9A 2HI3A 5HDNA 1TWFJ 2XGDA 4YFXF 1DGWY 4ESFA 4HNVA 2RV8A 3J7YJ 1D1BA 1YQAA 1PDNC 2VE8A 3DFGA 2QLZA 3OYFA 1R1UA 4X0GA 1XGOA 2WADA 1W4MA 4MGRA 1GDTA 2NAZA 4NHJA 2KISA 1UHSA 3QP6A 1TQPA 2VBXA 4DOZA 1FT9A 2FRHA 2ADUA 4XL9A 2LBFA 3FXOA 3O8HA 4X1EA 1U5TB 4D0PA 2JQ7A 3LFUA 1J09A 1S9HA 2DA1A 5K5RA 4MFDA 4UY8I 3CD6I 3QPHA 5J8FA 4AWXB 4ZYAA 1W36D 4KA4A 4N4NB 1UG2A 5TJJA 2QGUA 5F64A 2ECCA 1PYVA 2FMLA 3RQIA 5M5XJ 5ICEA 1HKTA 4V19K 3E6MA 3I59B 5ERIA 5LD2C 2CWEA 3ZMDA 2B7EA 2PMZA 3A02A 3LQQA 3CUQB 2BY3A 1E3PA 4RM2A 2Z9OA 3ZMUA 1OMIA 3CZ6A 5E3MA 3P9CA 3Q9VA 2HS5A 4LOCA 3FMRA 1BM9A 1ZG3A 3FXKA 3G2BA 3R0AA 1WH5A 4XSZF 1GXPA 4UUSA 2DTRA 5GTHC 5BPIA 2RREA 4ASNA 4JOMA 5IP9J 2JA5J 3KP2A 5FKKA 3OWTA 3QPTA 2CQXA 2QYOA 3OS2A 3CCQI 3Q5FA 3BP8A 4XLPF 1HKSA 3LL7A 4XN3A 5IY5H 3FDYA 3HOUJ 2CUFA 2G0EA 2IGOA 4IRGA 4LK0F 4QPOA 2CQKA 2RQQA 5HS8A 3UNGC 1G3WA 4C3IJ 4LIVA 2HYFA 4A6EA 2K86A 1R58A 2Z99A 1I39A 2EH3A 4OU0A 5B5EC 2DFHA 2DMPA 5IYCJ 1UHMA 4HLXA 1UHWA 3F3XA 2XAGA 3KCCA 2MFZA 2KIUA 2OQGA 1SAUA 3GO5A 4YEJA 1VF9A 5A2QZ 4LD5A 1IV8A 4BDYA 3JAMZ 1APLC 1XSVA 3HOZJ 5D6EA 1Z77A 4CZCA 3S2DJ 4W97A 1JUPA 2F6CA 5F1RA 2ZXIA 2VQCA 3IRQA 5E3LA 4JX5A 3VYSB 4M3GA 2HTJA 4A3CJ 5LHIA 2EINH 2FJ1A 1STZA 3BWGA 2CQQA 1XMKA 5JVGF 2M30A 1Y0UA 1YJWI 2EK5A 1TTYA 1MD0A 1P6RA 2BY2A 4XM3A 5CQGA 1LDJA 3E6BA 1Z9CA 4I01A 5IP6A 3JRCA 2R7XA 2HWVA 3B6AA 1QA6A 3RPUD 4BY7J 4GFBA 2BXZA 2K85A 2MABA 2OA4A 1W5TA 4Z2YA 4DYQA 2WA0A 2E5NA 2X6WA 3FMQA 3OMYA 1JI8A 3SZTA 2P7VB 2RKHA 1X1DA 3WGGA 2V9KA 3BLYA 1WH7A 1LQ1A 2HZTA 3S3OA 2A6TA 5FJ8J 1BI3A 2HYGD 2H8WA 3S3NA 1ZG1A 6PAXA 2VT3A 2VXDA 4XLHA 3OSFA 1F36A 5LRSA 3M9AA 3FF5A 3U2RA 3RZOJ 1P2FA 3RPQA 3E0JB 4LLGF 3WTWC 2YU9J 3J80Z 4HX7A 4P5OA 1KGSA 2F2EA 3DTKA 3E3VA 3BG3A 4GGGA 5C4JJ 2BGCA 1MMGA 2XGEA 3CCLI 3CP8A 3U9GA 4KN4X 5LEKA 2L7KA 1HW2A 3H5NA 4P96A 1WJ5A 4YIIA 2A69F 3FHNA 2UXNA 4Y3OA 2O61A 1HA8A 3K4BA 2KKOA 4A2UA 4F92B 1PP7U 5M3FJ 3FBNB 5ICCA 1CF7A 2X48A 4OMYA 3O8GA 2IAIA 1DUXC 2Z2SB 1ZR4A 3D5LA 3HB9A 1VQ7I 5B66C 4G12A 3ZCOA 3GFIA 4E70A 4H0EA 2VIXA 3GX4X 2FMYA 4ETSA 5FKMA 3HYIA 4K2EA 4BKXA 2WB1A 4G7ZF 1V5GA 3EPZA 3M8EA 1KA8A 1DP3A 2Z3YA 2RVCA 4I2OA 3CF2A 3DLAA 1IN7A 2Y30A 1UCRA 2Y48A 4XRMA 1SVOA 4LG0B 2F48A 4OAYA 5J4YA 4RAZA 2ZMEB 1FWZA 4HEA2 1EJ9A 3PSFA 1G6NA 2P4WA 3CMMA 4Q48A 3K1PA 1FX7A 3ZQGA 3OYKA 3TW7A 1I6HJ 3IUOA 2HGCA 4D5CA 2ISZA 2ESHA 1G59A 3L2RA 3DV8A 1WJEA 3WU0A 2E2HJ 4OIRF 1WSUA 2KDZA 5FLVA 4B48A 5IYDJ 5DM7F 1QHHD 5DUIA 1YW9A 4CHUA 2VQGA 4BQQA 1TLHB 4JP0A 2LNBA 4RGRA 3KPHA 4F91B 5D5VB 3LAPA 2PBIA 3IH4A 3ZR8X 4E7SA 9ANTA 3GTMJ 1MSEC 1QHGA 2KLOA 5JLWA 5FKNA 3COAC 4BUPA 3MEXA 1D0ZA 3VYTB 2LR8A 5JR3A 4V2FA 4CCJA 3SDBA 4JQFA 5IYBJ 1X4OA 5GAHJ 1E3HA 3BC8A 2O7OA 3WTTC 3I4NJ 3I56I 2MD0A 1LVAA 3IAM2 1OPCA 5KAIC 4FX4A 1BIAA 4E7JA 1R4MB 3KYDB 3D1NI 2L4AA 1VQKI 1IO2A 4YFNF 4ZZLA 3OIOA 1T8IA 1EF4A 4A3IJ 1W5SA 2BEOA 1MKMA 4NDLA 4UHTA 1XCVA 2K7LA 4A3LJ 2L2OA 5DV5A 5HDKA 3ROUA 2UXXA 2K9MA 2O6GE 5KHDA 2Y31A 2X6OA 4HG2A 2R7RA 1E17A 2NS8A 1R00A 1TWCJ 4L9VA 3NWSA 1XGNA 1JHFA 3GFJA 1MNMC 2OV7A 2PN6A 3Q9SA 3T8TA 2AQFA 4WXCA 1LKXA 2F5CA 4HV6A 2HZDA 2IEKA 1YRNA 4U7BA 4QTRA 1Y0NA 2R93J 3FISA 3CP2A 1N77A 1S7EA 3BJOA 2DQRA 5F0HA 1EH6A 5LGTA 3BZCA 3SFZA 3WG9A 1AKHA 1U9OA 4J19A 3LSRA 2V6CA 2XC7A 2X1EA 1XCBA 3DBLB 2KMUA 2JA7J 5J1UA 2JMWA 1YO5C 2F4MB 4ZDOA 2YSRA 1Q1HA 4NB5A 4OOIA 1ENHA 2RAEA 1HSJA 2DA6A 4EJUA 2DW4A 2K9QA 1GV2A 2EQRA 5GTIC 4E7IA 4HOBA 4XR6A 3N05A 4XNFA 3TO9A 3GLXA 3HOVJ 5KNLA 3JTGA 4ENNA 1BOBA 1S72I 2EA4A 3WTVC 2HEOA 1JUSA 1IUFA 2NOGA 5EZGA 2PEXA 3AG2H 1X19A 4XKVA 4XIDA 1OKRA 2M8GX 3CJQB 2Y9ZA 2K3PA 2LP0A 3BDDA 3S1QJ 5E8GA 2E5ZA 1MBJA 1OR7C 3AL0C 1GXQA 3HG9A 1WJAA 1MBEA 3EUAA 4WCGA 3CDLA 3OYGA 2W85A 1B6AA 2IGMA 4GRIA 4C30A 2OCCH 1V54H 2K9SA 3DKXA 5HLTA 1SD4A 1ZK8A 1LFBA 1B8IB 1KONA 1UFMA 3Q0UA 1X3ZB 2CV0A 1R36A 4OWRB 2HOSA 2Y2ZA 2OF7A 4A12A 2ZXWH 2EZKA 2D5VA 2ID6A
chains in the Genus database with same CATH topology
4RGUA 4IHTA 1O3SA 2HKXA 4RB2C 1FPQA 3RDIA 3FWEA 4BH9A 5FB2A 2VXZA 1IN4A 2XAJA 3RIRA 3L9FA 4RB0A 5IT3A 1BOAA 3J80K 5TRDA 1K7AA 3MCZA 5E20A 4BQAA 1W7PD 3MQ0A 4A0YA 2XIGA 3I64A 3N97A 3CO7C 5D5WB 2GXBA 4OMZA 4PZJA 4FX0A 5CYVA 1I1SA 2EV0A 1P92A 2M8EA 1IXSB 2JPCA 2HR3A 2BYVE 3KE2A 2QVOA 3TOBA 4GCVA 4HF1A 4I0BA 3JSPA 5KK1A 5L3GA 1J0RA 3BZ6A 4A0ZA 2EFPA 1J75A 4Y13A 2DAOA 1KQ9A 2VBZA 4HA8A 2D1HA 4EJOA 2H6BA 3F8NA 2KIMA 4UV9A 5JHUA 3ABTA 3ULQB 5E1XA 2OQRA 4B09A 3F6VA 4ESJA 2P5LC 2J5OA 2EV5A 4IF4A 1KU2A 2IJLA 3IKVA 1P4WA 2VONA 1J5YA 5DCFA 1SFEA 5DCMA 2DLLA 2FXAA 5D8KB 4EGYA 1TW3A 3RYRA 4L0YB 5KVRA 1ZH5A 4S04A 2QBYA 2TDXA 1RNLA 2UWMA 4IPAA 2WWYA 1T2KA 1T6SA 2EFOA 4EM1A 1PUEE 3KP7A 3GZ6A 2OZ6A 3KEOA 2K02A 2FU4A 5K5QA 4HDVA 2BV6A 5LGUA 2QM3A 2H6CA 1ZARA 5IT9Z 1OR7A 1ONVA 3I0TA 4MNUA 1X3UA 3L00A 1A04A 3F21A 1MJ9A 1O3TA 5ILVA 1HKQA 4RAYA 1GVJA 3K1MA 3L7WA 1IRGA 4UUVA 2DO7A 4CICA 2K27A 4O6JA 4DQ2A 4RB1A 2GZWA 4YIFA 5CVIA 1ZLJA 4AIJA 2EFNA 5FLXK 1W7PB 4N0BA 4MHGA 5L3EA 5LEJA 3F8FA 5E1ZB 1YFHA 3BPVA 1BIBA 1KU9A 3KP6A 5FGMA 4L0ZB 3C3WA 1IN6A 1FSHA 3O6BB 1ZHFA 2FNPA 5ICGA 4BYYA 1U2WA 1BJAA 2NYXA 5E18F 1H9GA 1USSA 4Y17A 2P8TA 5FO5A 4S05A 4WF2A 4L18B 2ACJA 4I98B 2FE3A 2QQ9A 2IT0A 1YIOA 4Q47A 4ENJA 1BBYA 4M6YA 4G6DA 2PI0A 2L3DA 5HOOA 2QQBA 3H92A 1SD7A 2RN7A 5DD4A 1LB2A 4ESBA 4HX8A 5HVQC 2V9VA 1D8JA 3ZN0A 3BOQA 2HDCA 2EJRA 3QU6A 4LJZF 1FOKA 3FX3A 3K69A 3HRMA 2W25A 3V7RA 2XV4S 2CFXA 4KIBA 2V1XA 4U0YA 3F6OA 4PGGA 1Z6RA 4KICA 5DCMB 1RUOA 4U0VA 3T5XA 2VT2A 4AD9A 2CG4A 2MLGA 3EQLF 4M6XA 2B0LA 2G7UA 4ZZDA 2P5VA 1F4KA 4I09A 3FM3A 3F8BA 1I1GA 2M1BA 1IF1A 2PLYA 1U3EM 3ZMTA 2VOOA 3M1EA 4KYWA 1KYWA 2IA0A 3BPXA 3B02A 4G7HF 2V79A 3GUDA 2E7WA 3G73A 3MFKA 2JZYA 5K1YA 1YS7A 5D5UB 5H20A 2P5KA 3GF2A 1SFXA 5ILSA 1DPRA 3KP4A 4HX4A 4MEXF 5IT9K 5BOXA 3RTRA 5JFRA 2VC0A 1FP1D 2O3FA 3GXOA 2K4BA 1FYLA 1MGTA 3KETA 1VTNC 4UNOA 1TNSA 2FEZA 3RJPA 5L3BA 1LEAA 4UVBA 3HRSA 5AONA 2X4HA 5LHGA 4LB6B 2GAUA 3W6KB 3KZYA 3WU1B 3QP5A 1ZGAA 2XKOA 1S7OA 4IRIA 1F9NA 1LDKB 4CO8A 1TNTA 4R8HA 1XD7A 3F8MA 2PJPA 1FYMA 1YW8A 3FXRA 4GO1A 1G4DA 4L9TA 1FBSA 2KIFA 2RQPA 3I54A 3RKYA 3EETA 1MJBA 3RKXA 2GWRA 2JPBA 3BJAA 5BQTA 1LDDA 2JSCA 1V3FA 2KJCA 3W6JB 1IRFA 3KLNA 1LNWA 3DKWA 2FQ3A 2NS0A 3O3KA 2A61A 2ZO4A 3HOTA 4HF2A 4CDGA 4FT8A 3K1NA 2DT5A 4PCQA 2DBBA 3SHFA 4HBLA 4HQEA 2VBYA 1KQ8A 2FOKA 1O3RA 3JTHA 4M74A 5JI6A 3R61A 1S29A 5CLSA 4L9NA 5HDGA 3R0JA 1ZRFA 2ETHA 2RNJA 2VE9A 4KUMA 2YX7A 2M45A 3ZMZA 3ZN1A 4KDPA 4BHPA 1BC8C 1OYWA 3WTXC 1ODDA 4UXNA 4ZYDA 1S8NA 3NQOA 2K4JA 4L5JA 3HHGA 4ZYGA 4OIPF 2JT1A 3GVAA 1IZ1A 4TV7A 1R5HA 3SXYA 3KEQA 2HQNA 1T98A 4LFUA 3VEPA 3B73A 1WI9A 5D4SA 2FBHA 1WQ2A 3MWMA 4ZH4F 3KFWX 2WV0A 5D4RA 4EGZA 5HLIA 1R5GA 5FLXZ 1CGPA 5DUKA 4DNCA 3U1DA 3HUGA 1ZGJA 1JHHA 2J5PA 1MDMA 5F6FA 3AAFA 3GFLA 1SAXA 2FNAA 2W57A 4G8XA 1PP8F 4BHCA 1YW7A 3LFKA 1D3YA 2JTVA 1SMTA 5FD5A 4RS8A 4KIFA 2XGXA 4LLNA 1HQCA 4IJAA 4M73A 3WTUC 1R7JA 1SFUA 1V4RA 1CF7B 3MZHA 1IXCA 3GFMA 1IN8A 1ZRCA 3E5QA 3ISPA 1HW5A 2PQ8A 2KJBA 3V7SA 4IRHA 2MH9A 3I53A 1QZYA 5LRRA 2YPRA 1ULYA 3VOEA 5E1WA 2L4MA 2A6EF 1B9MA 1EH8A 2CGPA 5CVUA 1Z1DA 2QWWA 4XRFA 3KP5A 1R1VA 3EUHA 1BC7C 4I0AA 3I5UA 3LA2A 4ENMA 2MA3A 4KMUX 2IA1A 2H27A 5CVVA 3FXQA 3HTUA 4HZFA 2ESNA 2MH2A 1F1ZA 5L3CA 3CDHA 3ELKA 2AS5F 1J2XA 4M9ZA 2L02A 2VBWA 4BNCA 2RC4A 1C0WA 3WTSC 3J81K 2IW5A 3ZQ7A 4G9YA 2STTA 2IVMA 2KRFA 4LLLA 2YX4A 1FBQA 4CZZA 1I27A 3WGIA 3WE3A 2NNNA 4I7HA 2O0YA 2CW0F 4Y15A 3F72A 4CGZA 5BS6A 1R22A 2Z5UA 3LWFA 4HAMA 3E6CC 1T0FA 3WTZA 3I59A 3LSTA 4WX9A 3CUQA 3L2CA 1S7AA 1J9IA 3K0LA 2HOEA 5LGNA 4XSXF 3DEUA 4EJWA 2R7DA 3ZMSA 3R4KA 1QBJA 5FFXA 2EV6A 1HW1A 4O5VA 4AIKA 2V1DA 1ZN2A 4HQMA 5ILUA 3TKYA 3HSFA 4UVAA 1O57A 2F5FA 4XBFA 3JSOA 3DF8A 2IP2A 4R79A 3T8RA 2CO5A 5D5XB 4KN7X 5DEQA 1KQ0A 3IWFA 1T39A 2E1CA 1B59A 1BN5A 1HSTA 2XHKA 2IA2A 2FBIA 3QU3A 2FSWA 5J6XA 4MQ9F 1U78A 2P6TA 3HIFA 3TQNA 4EJTA 1FNNA 1R1TA 2GA2A 3IL2A 3LQRA 3FM5A 4HDUA 1ZRDA 1S3JA 4N9IA 3IC7A 3MAJA 2YR2A 2OZUA 3LAJA 3F22A 3IHUA 3VFZA 1KYZA 2NNYA 2YU3A 1LJ9A 1XMAA 1H9TA 2NRAC 5LHHA 4JK1X 1D8KA 4MQVA 2RDPA 2XASA 4NQWA 1DDNA 1SD5A 3K2ZA 1MJAA 4LGWA 1K6OA 2CYYA 5DYMA 2BE5F 5H6QA 2OAZA 3T0YA 1FBUA 1ZREA 1NHAA 3OOPA 2HKOA 2ELHA 3ABUA 3DQVC 4BHBA 2G9WA 5EEHA 2P7CB 1IAWA 3MZYA 3HTSB 4L5IA 3F8CA 1XSXA 4ON0A 2EB7A 3GYHX 3P9IA 4LG0A 2ZFWA 4M9SA 2ZMEA 2MLKA 2GXGA 1O7LA 2JRTA 2VN2A 2STWA 2P6SA 4M72A 1J59A 4GYIA 4HW0A 1YLFA 2PMHA 1J7KA 3WTYC 3FZVA 3N4MA 2QBYB 1K79A 5E17F 2OU2A 2DK5A 3DPTA 4A0XA 2COMA 1IUYA 2PG4A 4ZYHA 3M8FA 3EDPA 3PFIA 1I6XA 2E7XA 2FA5A 1XN7A 3FXUA 5FFZA 1B4AA 4GYGA 1I5ZA 2QQAA 1ZLKA 3RPUA 1YG2A 1RZ4A 1P4XA 3M7GA 2DI3A 4G7OF 2R3SA 3I4PA 5FD6A 4M9XA 1FP2A 1B1BA 4U7DA 1JGSA 3SQNA 2M5WA 1XGMA 2RGVA 3HHHA 4KT5C 3KP3A 2VC1A 3TDZC 3TDUC 3REOA 3R60A 1EH7A 1DPUA 2VODA 3S2WA 3P7NA 1B9NA 2DQLA 2XUBA 4EJVA 4EVIA 4MTEA 1L0OC 4WWCA 2ZNYA 1IN5A 4RGXA 2ZBKA 4IHSA 2XRNA 3P9KA 3E5UA 1K78A 5CVJA 3CUOA 4OINF 1YYVA 4G94A 3TGNA 1OYIA 2LSOA 2QUFA 1R23A 5H6RA 1FSEA 3ML6A 1O3QA 2IRFG 4CXFA 4F7ZA 2DK8A 3EYYA 2Q8KA 5AIPA 1O7FA 2O03A 1OYYA 4QWQA 2OBPA 3J81Z 4EMSA 3BY6A 5DDGA 2DU9A 1RUNA 3K9TA 3HSRA 3V8LA 1IXRC 3CJNA 3CO6C 4P55A 5LBQA 2D45A 1WRJA 1WKMA 4O3MA 4GXOA 2W84A 5CJ9A 2EWNA 3H3UA 1H0MA 4KMFA 1FLIA 4P9UA 2D1VA 2Y0MA 3G3ZA 3GEZA 1YS6A 4EV0A 5J8CA 2A3SA 2R7FA 2V1UA 3CLOA 3KZZA 2AXLA 1ON1A 2QENA 1G3YA 2G7HA 3GZ5A 1RIOH 1Z6TA 3TO7A 2O8XA 2MD5A 3V8JA 4B8XA 5ED4A 1REPC 2L54A 3I58A 2DPDA 3V8KA 3IRRA 1JXSA 1U5TC 1HBXG 3KLOA 3HOSA 3V4GA 4HLYA 3SZPA 3RI4A 2LF7A 5L3DA 4R1HA 2DFIA 5ICFA 3LA3A 5EEGA 3CUQC 4UVCA 4MTDA 4A6DA 4I02A 1GHCA 3R6SA 2VOPA 1QNTA 3T1BA 2OD5A 4Q5SF 3O2PE 5D8LB 4PDKA 2PFBA 1QPMA 4KIGA 4A5NA 2E1NA 3HRUA 5BPDA 2F5DA 2XVCA 4QLCU 5D6FA 3TO6A 1TBXA 1TQMA 2EA2A 5HS9A 4U0WA 2ISYA 1ZYRF 3GW2A 1Z7UA 5A2QK 3JAMK 5LLQA 2MC3A 4Q4ZF 1K78B 1MZBA 3PQJA 1QZZA 2FBKA 3QOPA 1FY7A 1G3SA 2XAFA 4U88A 3E97A 5HLGA 4P9FA 2A6HF 4FHTA 5CVRA 2DPUA 2PMUA 1BI1A 1EV7A 1FYKA 3QAHA 3VB2A 4G6QA 1W7PA 2EFQA 1QQIA 1XB4A 2XAHA 3IWZA 1ZG5A 1Z05A 1XDUA 3NRVA 1DP7P 1XSDA 3FHZA 4EM0B 2EFWA 4WXDA 2GQQA 4HF0A 4AVPA 1FZPB 4BXUA 5DD8A 2UZKA 2H94A 3WE2A 5HS7A 4LK1F 4WK8F 1TQIA 2LKPA 2QZ8A 2Y75A 4CYDA 4L9JA 1T38A 3DXJF 2IPQX 3TOAA 1LEBA 2GA1A 3WODF 4MEYF 3OV8A 3F23A 4ZYEA 4AIHA 1TW2A 2HTSA 3BJ6A 3C7JA 4BAYA 1U5TA 4M71A 3E6DA 4IVNA 1AOYA 1BI2A 4HV5A 3DP7A 4WXHA 3ERED 1AWCA 4OIQF 1D5VA 3BROA 3ECOA 4JBAA 4A5MA 3WGHA 3RYPA 2XROA 1QO0D 4KNYA 4YG2F 2ZXJA 4N9HA 1XGSA 4RGSA 5JVTA 4LB5A 5BMZA 1L3LA 5E8IA 3ECHA 3HSEA 1KU3A 5L3FA 4YFKF 2A68F 2MBFA 3IKTA 3D0SA 1BI0A 3ZP5A 3HRTA 1QGPA 2H09A 1P4AA 4PGHA 4HYEA 4ENKA 1U8RA 2XAQA 3EYIA 1SMYF 2ZCWA 1MDMB 2FF4A 3I71A 3GWZA 1UB9A 2CSOA 1E2XA 3QRFF 1FC3A 3VODA 2Q0OA 1IW7F 4KFCA 3V7CA 3C1DA 1XDSA 3CTAA 1ON2A 1SD6A 2Q2EA 3NEUA 2L01A 2A5YB 1F5TA 4IXAA 2C6YA 3FMSA 2XKPA 1WWXA 2M87A 4LMYA 3E5XA 4EM2A 3LA7A 2ZJ2A 1Z91A 1HXDA 3H3ZA 1G3TA 1RI7A 2W24A 2GIVA 2ZKZA 2ZNZA 2LDUA 5AIQA 1KU7A 1JE8A 3J7AO 1ZAOA 2D2WA 4RB3C 2Z33A 3ZPLA 2HFHA 5HLHA 2LF8A 4UV8A 1USTA 4OIOF 2WTEA 4XLNF 1U6GA 3L09A 1YTYA 2A07F 2X0LA 3DPLC 2BBYA 3PQKA 3ZMVA 3C18A 5K5OA 3RKWA 2HQRA 4EQQA 1S6LA 3JW4A 2WC2A 5HDNA 4YFXF 4ESFA 2RV8A 1YQAA 1PDNC 2VE8A 3DFGA 2QLZA 1R1UA 1XGOA 4MGRA 1W4MA 2NAZA 4NHJA 3QP6A 1TQPA 2VBXA 1FT9A 2FRHA 2ADUA 4D0PA 1U5TB 5K5RA 3QPHA 5J8FA 4AWXB 4KA4A 5TJJA 5F64A 2FMLA 5ICEA 1HKTA 3E6MA 3I59B 5ERIA 2CWEA 3ZMDA 3LQQA 3CUQB 2Z9OA 3ZMUA 1OMIA 3P9CA 3Q9VA 2HS5A 3FMRA 1BM9A 1ZG3A 3R0AA 4XSZF 1GXPA 2DTRA 5BPIA 4ASNA 3KP2A 3QPTA 2QYOA 3Q5FA 3BP8A 4XLPF 1HKSA 4IRGA 4LK0F 2CQKA 5HS8A 1G3WA 2HYFA 4A6EA 2K86A 1R58A 2Z99A 4OU0A 1UHMA 4HLXA 1UHWA 3F3XA 2XAGA 3KCCA 2OQGA 2KIUA 3GO5A 5A2QZ 4LD5A 3JAMZ 1XSVA 5D6EA 5F1RA 3IRQA 2HTJA 5LHIA 1STZA 3BWGA 1XMKA 2M30A 1Y0UA 2EK5A 1TTYA 1MD0A 1P6RA 1LDJA 3E6BA 1Z9CA 4I01A 2HWVA 2OA4A 1W5TA 4Z2YA 3FMQA 3SZTA 2P7VB 2RKHA 3WGGA 1LQ1A 2HZTA 1BI3A 2HYGD 1ZG1A 6PAXA 2VT3A 5LRSA 3M9AA 3FF5A 3U2RA 1P2FA 3RPQA 4LLGF 3WTWC 3J80Z 4HX7A 4P5OA 1KGSA 2F2EA 3E3VA 4GGGA 2BGCA 3U9GA 4KN4X 5LEKA 1HW2A 4P96A 4YIIA 2A69F 2UXNA 2O61A 2KKOA 4A2UA 1PP7U 5ICCA 1CF7A 4OMYA 1DUXC 3D5LA 3GFIA 4H0EA 4E70A 3GX4X 2FMYA 4ETSA 3HYIA 4K2EA 4G7ZF 3M8EA 1KA8A 2Z3YA 2RVCA 4I2OA 1IN7A 1UCRA 2Y48A 4LG0B 4RAZA 2ZMEB 1FWZA 1G6NA 2P4WA 4Q48A 3K1PA 1FX7A 2HGCA 2ISZA 2ESHA 3DV8A 3WU0A 4OIRF 1WSUA 5DUIA 1YW9A 4CHUA 1TLHB 2LNBA 4RGRA 3LAPA 5D5VB 2PBIA 3COAC 3MEXA 5JR3A 4JQFA 3WTTC 1LVAA 1OPCA 4FX4A 1BIAA 2L4AA 4YFNF 4ZZLA 1W5SA 2BEOA 1MKMA 4UHTA 1XCVA 2K7LA 5DV5A 5HDKA 3ROUA 2UXXA 2O6GE 1E17A 4L9VA 1R00A 1XGNA 1JHFA 3GFJA 2PN6A 3Q9SA 3T8TA 4WXCA 2F5CA 4HV6A 4U7BA 3BJOA 2DQRA 1EH6A 5LGTA 3SFZA 3WG9A 2V6CA 1XCBA 1YO5C 2YSRA 1Q1HA 4NB5A 4OOIA 1HSJA 4EJUA 2DW4A 4HOBA 3TO9A 3GLXA 3JTGA 4ENNA 2EA4A 3WTVC 2HEOA 2PEXA 1OKRA 3BDDA 5E8GA 1GXQA 4WCGA 2W85A 1B6AA 1SD4A 1UFMA 1R36A 4A12A 2F5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGU A;  4IHT A;  1O3S A;  2HKX A;  4RB2 C;  1FPQ A;  3RDI A;  3FWE A;  4BH9 A;  5FB2 A;  2VXZ A;  1IN4 A;  2XAJ A;  3RIR A;  3L9F A;  4RB0 A;  5IT3 A;  1BOA A;  3J80 K;  5TRD A;  1K7A A;  3MCZ A;  5E20 A;  4BQA A;  1W7P D;  3MQ0 A;  4A0Y A;  2XIG A;  3I64 A;  3N97 A;  3CO7 C;  5D5W B;  2GXB A;  4OMZ A;  4PZJ A;  4FX0 A;  5CYV A;  1I1S A;  2EV0 A;  1P92 A;  2M8E A;  1IXS B;  2JPC A;  2HR3 A;  2BYV E;  3KE2 A;  2QVO A;  3TOB A;  4GCV A;  4HF1 A;  4I0B A;  3JSP A;  5KK1 A;  5L3G A;  1J0R A;  3BZ6 A;  4A0Z A;  2EFP A;  1J75 A;  4Y13 A;  2DAO A;  1KQ9 A;  2VBZ A;  4HA8 A;  2D1H A;  4EJO A;  2H6B A;  3F8N A;  2KIM A;  4UV9 A;  5JHU A;  3ABT A;  3ULQ B;  5E1X A;  2OQR A;  4B09 A;  3F6V A;  4ESJ A;  2P5L C;  2J5O A;  2EV5 A;  4IF4 A;  1KU2 A;  2IJL A;  3IKV A;  1P4W A;  2VON A;  1J5Y A;  5DCF A;  1SFE A;  5DCM A;  2DLL A;  2FXA A;  5D8K B;  4EGY A;  1TW3 A;  3RYR A;  4L0Y B;  5KVR A;  1ZH5 A;  4S04 A;  2QBY A;  2TDX A;  1RNL A;  2UWM A;  4IPA A;  2WWY A;  1T2K A;  1T6S A;  2EFO A;  4EM1 A;  1PUE E;  3KP7 A;  3GZ6 A;  2OZ6 A;  3KEO A;  2K02 A;  2FU4 A;  5K5Q A;  4HDV A;  2BV6 A;  5LGU A;  2QM3 A;  2H6C A;  1ZAR A;  5IT9 Z;  1OR7 A;  1ONV A;  3I0T A;  4MNU A;  1X3U A;  3L00 A;  1A04 A;  3F21 A;  1MJ9 A;  1O3T A;  5ILV A;  1HKQ A;  4RAY A;  1GVJ A;  3K1M A;  3L7W A;  1IRG A;  4UUV A;  2DO7 A;  4CIC A;  2K27 A;  4O6J A;  4DQ2 A;  4RB1 A;  2GZW A;  4YIF A;  5CVI A;  1ZLJ A;  4AIJ A;  2EFN A;  5FLX K;  1W7P B;  4N0B A;  4MHG A;  5L3E A;  5LEJ A;  3F8F A;  5E1Z B;  1YFH A;  3BPV A;  1BIB A;  1KU9 A;  3KP6 A;  5FGM A;  4L0Z B;  3C3W A;  1IN6 A;  1FSH A;  3O6B B;  1ZHF A;  2FNP A;  5ICG A;  4BYY A;  1U2W A;  1BJA A;  2NYX A;  5E18 F;  1H9G A;  1USS A;  4Y17 A;  2P8T A;  5FO5 A;  4S05 A;  4WF2 A;  4L18 B;  2ACJ A;  4I98 B;  2FE3 A;  2QQ9 A;  2IT0 A;  1YIO A;  4Q47 A;  4ENJ A;  1BBY A;  4M6Y A;  4G6D A;  2PI0 A;  2L3D A;  5HOO A;  2QQB A;  3H92 A;  1SD7 A;  2RN7 A;  5DD4 A;  1LB2 A;  4ESB A;  4HX8 A;  5HVQ C;  2V9V A;  1D8J A;  3ZN0 A;  3BOQ A;  2HDC A;  2EJR A;  3QU6 A;  4LJZ F;  1FOK A;  3FX3 A;  3K69 A;  3HRM A;  2W25 A;  3V7R A;  2XV4 S;  2CFX A;  4KIB A;  2V1X A;  4U0Y A;  3F6O A;  4PGG A;  1Z6R A;  4KIC A;  5DCM B;  1RUO A;  4U0V A;  3T5X A;  2VT2 A;  4AD9 A;  2CG4 A;  2MLG A;  3EQL F;  4M6X A;  2B0L A;  2G7U A;  4ZZD A;  2P5V A;  1F4K A;  4I09 A;  3FM3 A;  3F8B A;  1I1G A;  2M1B A;  1IF1 A;  2PLY A;  1U3E M;  3ZMT A;  2VOO A;  3M1E A;  4KYW A;  1KYW A;  2IA0 A;  3BPX A;  3B02 A;  4G7H F;  2V79 A;  3GUD A;  2E7W A;  3G73 A;  3MFK A;  2JZY A;  5K1Y A;  1YS7 A;  5D5U B;  5H20 A;  2P5K A;  3GF2 A;  1SFX A;  5ILS A;  1DPR A;  3KP4 A;  4HX4 A;  4MEX F;  5IT9 K;  5BOX A;  3RTR A;  5JFR A;  2VC0 A;  1FP1 D;  2O3F A;  3GXO A;  2K4B A;  1FYL A;  1MGT A;  3KET A;  1VTN C;  4UNO A;  1TNS A;  2FEZ A;  3RJP A;  5L3B A;  1LEA A;  4UVB A;  3HRS A;  5AON A;  2X4H A;  5LHG A;  4LB6 B;  2GAU A;  3W6K B;  3KZY A;  3WU1 B;  3QP5 A;  1ZGA A;  2XKO A;  1S7O A;  4IRI A;  1F9N A;  1LDK B;  4CO8 A;  1TNT A;  4R8H A;  1XD7 A;  3F8M A;  2PJP A;  1FYM A;  1YW8 A;  3FXR A;  4GO1 A;  1G4D A;  4L9T A;  1FBS A;  2KIF A;  2RQP A;  3I54 A;  3RKY A;  3EET A;  1MJB A;  3RKX A;  2GWR A;  2JPB A;  3BJA A;  5BQT A;  1LDD A;  2JSC A;  1V3F A;  2KJC A;  3W6J B;  1IRF A;  3KLN A;  1LNW A;  3DKW A;  2FQ3 A;  2NS0 A;  3O3K A;  2A61 A;  2ZO4 A;  3HOT A;  4HF2 A;  4CDG A;  4FT8 A;  3K1N A;  2DT5 A;  4PCQ A;  2DBB A;  3SHF A;  4HBL A;  4HQE A;  2VBY A;  1KQ8 A;  2FOK A;  1O3R A;  3JTH A;  4M74 A;  5JI6 A;  3R61 A;  1S29 A;  5CLS A;  4L9N A;  5HDG A;  3R0J A;  1ZRF A;  2ETH A;  2RNJ A;  2VE9 A;  4KUM A;  2YX7 A;  2M45 A;  3ZMZ A;  3ZN1 A;  4KDP A;  4BHP A;  1BC8 C;  1OYW A;  3WTX C;  1ODD A;  4UXN A;  4ZYD A;  1S8N A;  3NQO A;  2K4J A;  4L5J A;  3HHG A;  4ZYG A;  4OIP F;  2JT1 A;  3GVA A;  1IZ1 A;  4TV7 A;  1R5H A;  3SXY A;  3KEQ A;  2HQN A;  1T98 A;  4LFU A;  3VEP A;  3B73 A;  1WI9 A;  5D4S A;  2FBH A;  1WQ2 A;  3MWM A;  4ZH4 F;  3KFW X;  2WV0 A;  5D4R A;  4EGZ A;  5HLI A;  1R5G A;  5FLX Z;  1CGP A;  5DUK A;  4DNC A;  3U1D A;  3HUG A;  1ZGJ A;  1JHH A;  2J5P A;  1MDM A;  5F6F A;  3AAF A;  3GFL A;  1SAX A;  2FNA A;  2W57 A;  4G8X A;  1PP8 F;  4BHC A;  1YW7 A;  3LFK A;  1D3Y A;  2JTV A;  1SMT A;  5FD5 A;  4RS8 A;  4KIF A;  2XGX A;  4LLN A;  1HQC A;  4IJA A;  4M73 A;  3WTU C;  1R7J A;  1SFU A;  1V4R A;  1CF7 B;  3MZH A;  1IXC A;  3GFM A;  1IN8 A;  1ZRC A;  3E5Q A;  3ISP A;  1HW5 A;  2PQ8 A;  2KJB A;  3V7S A;  4IRH A;  2MH9 A;  3I53 A;  1QZY A;  5LRR A;  2YPR A;  1ULY A;  3VOE A;  5E1W A;  2L4M A;  2A6E F;  1B9M A;  1EH8 A;  2CGP A;  5CVU A;  1Z1D A;  2QWW A;  4XRF A;  3KP5 A;  1R1V A;  3EUH A;  1BC7 C;  4I0A A;  3I5U A;  3LA2 A;  4ENM A;  2MA3 A;  4KMU X;  2IA1 A;  2H27 A;  5CVV A;  3FXQ A;  3HTU A;  4HZF A;  2ESN A;  2MH2 A;  1F1Z A;  5L3C A;  3CDH A;  3ELK A;  2AS5 F;  1J2X A;  4M9Z A;  2L02 A;  2VBW A;  4BNC A;  2RC4 A;  1C0W A;  3WTS C;  3J81 K;  2IW5 A;  3ZQ7 A;  4G9Y A;  2STT A;  2IVM A;  2KRF A;  4LLL A;  2YX4 A;  1FBQ A;  4CZZ A;  1I27 A;  3WGI A;  3WE3 A;  2NNN A;  4I7H A;  2O0Y A;  2CW0 F;  4Y15 A;  3F72 A;  4CGZ A;  5BS6 A;  1R22 A;  2Z5U A;  3LWF A;  4HAM A;  3E6C C;  1T0F A;  3WTZ A;  3I59 A;  3LST A;  4WX9 A;  3CUQ A;  3L2C A;  1S7A A;  1J9I A;  3K0L A;  2HOE A;  5LGN A;  4XSX F;  3DEU A;  4EJW A;  2R7D A;  3ZMS A;  3R4K A;  1QBJ A;  5FFX A;  2EV6 A;  1HW1 A;  4O5V A;  4AIK A;  2V1D A;  1ZN2 A;  4HQM A;  5ILU A;  3TKY A;  3HSF A;  4UVA A;  1O57 A;  2F5F A;  4XBF A;  3JSO A;  3DF8 A;  2IP2 A;  4R79 A;  3T8R A;  2CO5 A;  5D5X B;  4KN7 X;  5DEQ A;  1KQ0 A;  3IWF A;  1T39 A;  2E1C A;  1B59 A;  1BN5 A;  1HST A;  2XHK A;  2IA2 A;  2FBI A;  3QU3 A;  2FSW A;  5J6X A;  4MQ9 F;  1U78 A;  2P6T A;  3HIF A;  3TQN A;  4EJT A;  1FNN A;  1R1T A;  2GA2 A;  3IL2 A;  3LQR A;  3FM5 A;  4HDU A;  1ZRD A;  1S3J A;  4N9I A;  3IC7 A;  3MAJ A;  2YR2 A;  2OZU A;  3LAJ A;  3F22 A;  3IHU A;  3VFZ A;  1KYZ A;  2NNY A;  2YU3 A;  1LJ9 A;  1XMA A;  1H9T A;  2NRA C;  5LHH A;  4JK1 X;  1D8K A;  4MQV A;  2RDP A;  2XAS A;  4NQW A;  1DDN A;  1SD5 A;  3K2Z A;  1MJA A;  4LGW A;  1K6O A;  2CYY A;  5DYM A;  2BE5 F;  5H6Q A;  2OAZ A;  3T0Y A;  1FBU A;  1ZRE A;  1NHA A;  3OOP A;  2HKO A;  2ELH A;  3ABU A;  3DQV C;  4BHB A;  2G9W A;  5EEH A;  2P7C B;  1IAW A;  3MZY A;  3HTS B;  4L5I A;  3F8C A;  1XSX A;  4ON0 A;  2EB7 A;  3GYH X;  3P9I A;  4LG0 A;  2ZFW A;  4M9S A;  2ZME A;  2MLK A;  2GXG A;  1O7L A;  2JRT A;  2VN2 A;  2STW A;  2P6S A;  4M72 A;  1J59 A;  4GYI A;  4HW0 A;  1YLF A;  2PMH A;  1J7K A;  3WTY C;  3FZV A;  3N4M A;  2QBY B;  1K79 A;  5E17 F;  2OU2 A;  2DK5 A;  3DPT A;  4A0X A;  2COM A;  1IUY A;  2PG4 A;  4ZYH A;  3M8F A;  3EDP A;  3PFI A;  1I6X A;  2E7X A;  2FA5 A;  1XN7 A;  3FXU A;  5FFZ A;  1B4A A;  4GYG A;  1I5Z A;  2QQA A;  1ZLK A;  3RPU A;  1YG2 A;  1RZ4 A;  1P4X A;  3M7G A;  2DI3 A;  4G7O F;  2R3S A;  3I4P A;  5FD6 A;  4M9X A;  1FP2 A;  1B1B A;  4U7D A;  1JGS A;  3SQN A;  2M5W A;  1XGM A;  2RGV A;  3HHH A;  4KT5 C;  3KP3 A;  2VC1 A;  3TDZ C;  3TDU C;  3REO A;  3R60 A;  1EH7 A;  1DPU A;  2VOD A;  3S2W A;  3P7N A;  1B9N A;  2DQL A;  2XUB A;  4EJV A;  4EVI A;  4MTE A;  1L0O C;  4WWC A;  2ZNY A;  1IN5 A;  4RGX A;  2ZBK A;  4IHS A;  2XRN A;  3P9K A;  3E5U A;  1K78 A;  5CVJ A;  3CUO A;  4OIN F;  1YYV A;  4G94 A;  3TGN A;  1OYI A;  2LSO A;  2QUF A;  1R23 A;  5H6R A;  1FSE A;  3ML6 A;  1O3Q A;  2IRF G;  4CXF A;  4F7Z A;  2DK8 A;  3EYY A;  2Q8K A;  5AIP A;  1O7F A;  2O03 A;  1OYY A;  4QWQ A;  2OBP A;  3J81 Z;  4EMS A;  3BY6 A;  5DDG A;  2DU9 A;  1RUN A;  3K9T A;  3HSR A;  3V8L A;  1IXR C;  3CJN A;  3CO6 C;  4P55 A;  5LBQ A;  2D45 A;  1WRJ A;  1WKM A;  4O3M A;  4GXO A;  2W84 A;  5CJ9 A;  2EWN A;  3H3U A;  1H0M A;  4KMF A;  1FLI A;  4P9U A;  2D1V A;  2Y0M A;  3G3Z A;  3GEZ A;  1YS6 A;  4EV0 A;  5J8C A;  2A3S A;  2R7F A;  2V1U A;  3CLO A;  3KZZ A;  2AXL A;  1ON1 A;  2QEN A;  1G3Y A;  2G7H A;  3GZ5 A;  1RIO H;  1Z6T A;  3TO7 A;  2O8X A;  2MD5 A;  3V8J A;  4B8X A;  5ED4 A;  1REP C;  2L54 A;  3I58 A;  2DPD A;  3V8K A;  3IRR A;  1JXS A;  1U5T C;  1HBX G;  3KLO A;  3HOS A;  3V4G A;  4HLY A;  3SZP A;  3RI4 A;  2LF7 A;  5L3D A;  4R1H A;  2DFI A;  5ICF A;  3LA3 A;  5EEG A;  3CUQ C;  4UVC A;  4MTD A;  4A6D A;  4I02 A;  1GHC A;  3R6S A;  2VOP A;  1QNT A;  3T1B A;  2OD5 A;  4Q5S F;  3O2P E;  5D8L B;  4PDK A;  2PFB A;  1QPM A;  4KIG A;  4A5N A;  2E1N A;  3HRU A;  5BPD A;  2F5D A;  2XVC A;  4QLC U;  5D6F A;  3TO6 A;  1TBX A;  1TQM A;  2EA2 A;  5HS9 A;  4U0W A;  2ISY A;  1ZYR F;  3GW2 A;  1Z7U A;  5A2Q K;  3JAM K;  5LLQ A;  2MC3 A;  4Q4Z F;  1K78 B;  1MZB A;  3PQJ A;  1QZZ A;  2FBK A;  3QOP A;  1FY7 A;  1G3S A;  2XAF A;  4U88 A;  3E97 A;  5HLG A;  4P9F A;  2A6H F;  4FHT A;  5CVR A;  2DPU A;  2PMU A;  1BI1 A;  1EV7 A;  1FYK A;  3QAH A;  3VB2 A;  4G6Q A;  1W7P A;  2EFQ A;  1QQI A;  1XB4 A;  2XAH A;  3IWZ A;  1ZG5 A;  1Z05 A;  1XDU A;  3NRV A;  1DP7 P;  1XSD A;  3FHZ A;  4EM0 B;  2EFW A;  4WXD A;  2GQQ A;  4HF0 A;  4AVP A;  1FZP B;  4BXU A;  5DD8 A;  2UZK A;  2H94 A;  3WE2 A;  5HS7 A;  4LK1 F;  4WK8 F;  1TQI A;  2LKP A;  2QZ8 A;  2Y75 A;  4CYD A;  4L9J A;  1T38 A;  3DXJ F;  2IPQ X;  3TOA A;  1LEB A;  2GA1 A;  3WOD F;  4MEY F;  3OV8 A;  3F23 A;  4ZYE A;  4AIH A;  1TW2 A;  2HTS A;  3BJ6 A;  3C7J A;  4BAY A;  1U5T A;  4M71 A;  3E6D A;  4IVN A;  1AOY A;  1BI2 A;  4HV5 A;  3DP7 A;  4WXH A;  3ERE D;  1AWC A;  4OIQ F;  1D5V A;  3BRO A;  3ECO A;  4JBA A;  4A5M A;  3WGH A;  3RYP A;  2XRO A;  1QO0 D;  4KNY A;  4YG2 F;  2ZXJ A;  4N9H A;  1XGS A;  4RGS A;  5JVT A;  4LB5 A;  5BMZ A;  1L3L A;  5E8I A;  3ECH A;  3HSE A;  1KU3 A;  5L3F A;  4YFK F;  2A68 F;  2MBF A;  3IKT A;  3D0S A;  1BI0 A;  3ZP5 A;  3HRT A;  1QGP A;  2H09 A;  1P4A A;  4PGH A;  4HYE A;  4ENK A;  1U8R A;  2XAQ A;  3EYI A;  1SMY F;  2ZCW A;  1MDM B;  2FF4 A;  3I71 A;  3GWZ A;  1UB9 A;  2CSO A;  1E2X A;  3QRF F;  1FC3 A;  3VOD A;  2Q0O A;  1IW7 F;  4KFC A;  3V7C A;  3C1D A;  1XDS A;  3CTA A;  1ON2 A;  1SD6 A;  2Q2E A;  3NEU A;  2L01 A;  2A5Y B;  1F5T A;  4IXA A;  2C6Y A;  3FMS A;  2XKP A;  1WWX A;  2M87 A;  4LMY A;  3E5X A;  4EM2 A;  3LA7 A;  2ZJ2 A;  1Z91 A;  1HXD A;  3H3Z A;  1G3T A;  1RI7 A;  2W24 A;  2GIV A;  2ZKZ A;  2ZNZ A;  2LDU A;  5AIQ A;  1KU7 A;  1JE8 A;  3J7A O;  1ZAO A;  2D2W A;  4RB3 C;  2Z33 A;  3ZPL A;  2HFH A;  5HLH A;  2LF8 A;  4UV8 A;  1UST A;  4OIO F;  2WTE A;  4XLN F;  1U6G A;  3L09 A;  1YTY A;  2A07 F;  2X0L A;  3DPL C;  2BBY A;  3PQK A;  3ZMV A;  3C18 A;  5K5O A;  3RKW A;  2HQR A;  4EQQ A;  1S6L A;  3JW4 A;  2WC2 A;  5HDN A;  4YFX F;  4ESF A;  2RV8 A;  1YQA A;  1PDN C;  2VE8 A;  3DFG A;  2QLZ A;  1R1U A;  1XGO A;  4MGR A;  1W4M A;  2NAZ A;  4NHJ A;  3QP6 A;  1TQP A;  2VBX A;  1FT9 A;  2FRH A;  2ADU A;  4D0P A;  1U5T B;  5K5R A;  3QPH A;  5J8F A;  4AWX B;  4KA4 A;  5TJJ A;  5F64 A;  2FML A;  5ICE A;  1HKT A;  3E6M A;  3I59 B;  5ERI A;  2CWE A;  3ZMD A;  3LQQ A;  3CUQ B;  2Z9O A;  3ZMU A;  1OMI A;  3P9C A;  3Q9V A;  2HS5 A;  3FMR A;  1BM9 A;  1ZG3 A;  3R0A A;  4XSZ F;  1GXP A;  2DTR A;  5BPI A;  4ASN A;  3KP2 A;  3QPT A;  2QYO A;  3Q5F A;  3BP8 A;  4XLP F;  1HKS A;  4IRG A;  4LK0 F;  2CQK A;  5HS8 A;  1G3W A;  2HYF A;  4A6E A;  2K86 A;  1R58 A;  2Z99 A;  4OU0 A;  1UHM A;  4HLX A;  1UHW A;  3F3X A;  2XAG A;  3KCC A;  2OQG A;  2KIU A;  3GO5 A;  5A2Q Z;  4LD5 A;  3JAM Z;  1XSV A;  5D6E A;  5F1R A;  3IRQ A;  2HTJ A;  5LHI A;  1STZ A;  3BWG A;  1XMK A;  2M30 A;  1Y0U A;  2EK5 A;  1TTY A;  1MD0 A;  1P6R A;  1LDJ A;  3E6B A;  1Z9C A;  4I01 A;  2HWV A;  2OA4 A;  1W5T A;  4Z2Y A;  3FMQ A;  3SZT A;  2P7V B;  2RKH A;  3WGG A;  1LQ1 A;  2HZT A;  1BI3 A;  2HYG D;  1ZG1 A;  6PAX A;  2VT3 A;  5LRS A;  3M9A A;  3FF5 A;  3U2R A;  1P2F A;  3RPQ A;  4LLG F;  3WTW C;  3J80 Z;  4HX7 A;  4P5O A;  1KGS A;  2F2E A;  3E3V A;  4GGG A;  2BGC A;  3U9G A;  4KN4 X;  5LEK A;  1HW2 A;  4P96 A;  4YII A;  2A69 F;  2UXN A;  2O61 A;  2KKO A;  4A2U A;  1PP7 U;  5ICC A;  1CF7 A;  4OMY A;  1DUX C;  3D5L A;  3GFI A;  4H0E A;  4E70 A;  3GX4 X;  2FMY A;  4ETS A;  3HYI A;  4K2E A;  4G7Z F;  3M8E A;  1KA8 A;  2Z3Y A;  2RVC A;  4I2O A;  1IN7 A;  1UCR A;  2Y48 A;  4LG0 B;  4RAZ A;  2ZME B;  1FWZ A;  1G6N A;  2P4W A;  4Q48 A;  3K1P A;  1FX7 A;  2HGC A;  2ISZ A;  2ESH A;  3DV8 A;  3WU0 A;  4OIR F;  1WSU A;  5DUI A;  1YW9 A;  4CHU A;  1TLH B;  2LNB A;  4RGR A;  3LAP A;  5D5V B;  2PBI A;  3COA C;  3MEX A;  5JR3 A;  4JQF A;  3WTT C;  1LVA A;  1OPC A;  4FX4 A;  1BIA A;  2L4A A;  4YFN F;  4ZZL A;  1W5S A;  2BEO A;  1MKM A;  4UHT A;  1XCV A;  2K7L A;  5DV5 A;  5HDK A;  3ROU A;  2UXX A;  2O6G E;  1E17 A;  4L9V A;  1R00 A;  1XGN A;  1JHF A;  3GFJ A;  2PN6 A;  3Q9S A;  3T8T A;  4WXC A;  2F5C A;  4HV6 A;  4U7B A;  3BJO A;  2DQR A;  1EH6 A;  5LGT A;  3SFZ A;  3WG9 A;  2V6C A;  1XCB A;  1YO5 C;  2YSR A;  1Q1H A;  4NB5 A;  4OOI A;  1HSJ A;  4EJU A;  2DW4 A;  4HOB A;  3TO9 A;  3GLX A;  3JTG A;  4ENN A;  2EA4 A;  3WTV C;  2HEO A;  2PEX A;  1OKR A;  3BDD A;  5E8G A;  1GXQ A;  4WCG A;  2W85 A;  1B6A A;  1SD4 A;  1UFM A;  1R36 A;  4A12 A;  2F5E A; 
#chains in the Genus database with same CATH topology
 1XPX A;  3CCE I;  4RGU A;  4IHT A;  1O3S A;  2HKX A;  4RB2 C;  1FPQ A;  2VUM J;  2QSF X;  3BG5 A;  1QZE A;  1R5I D;  3RDI A;  2Y9Y A;  2VJI A;  2M7B A;  3FWE A;  3PIP F;  4BH9 A;  3M4O J;  5FB2 A;  3GTG J;  2VXZ A;  3W6V A;  1JT6 A;  1IN4 A;  1BJZ A;  2XAJ A;  3RIR A;  4C3J J;  3L9F A;  4CSW A;  4RB0 A;  5IT3 A;  2WAQ A;  1BOA A;  3J80 K;  5TRD A;  1K7A A;  3PUF A;  3MCZ A;  3BQY A;  5E20 A;  4BQA A;  1W7P D;  2VQH A;  3MQ0 A;  3LSJ A;  4A0Y A;  2XIG A;  3BR5 A;  1NH3 A;  2X9D A;  3I64 A;  3N97 A;  2CV1 A;  1E0E A;  4PJJ A;  4RMN A;  3CO7 C;  2HNH A;  3ONQ A;  5D5W B;  4IHV A;  1Y1W J;  2GXB A;  4OMZ A;  1QVU A;  3CCS I;  1FJL A;  2RNG A;  5GAD J;  4IEJ A;  4PZJ A;  4FX0 A;  5CYV A;  1I1S A;  2EV0 A;  1WFX A;  1P92 A;  2M8E A;  1IXS B;  2X1D A;  4W1U A;  2JPC A;  5EF6 A;  3K70 C;  2HR3 A;  2BYV E;  3KE2 A;  2QVO A;  3TOB A;  1XTA A;  4PJN A;  1RKT A;  4GCV A;  2QA4 I;  4HF1 A;  4I0B A;  5CQE A;  3JSP A;  1TWA J;  5KK1 A;  5L3G A;  1J0R A;  3BZ6 A;  4XLE A;  4A0Z A;  2EFP A;  1Y8Q B;  4XIC A;  2PMZ N;  1TL8 A;  2KIQ A;  4Y13 A;  1J75 A;  5EDN A;  2FQ4 A;  2DAO A;  1KQ9 A;  2VBZ A;  4HA8 A;  1GT0 C;  2D1H A;  2HPM A;  3HKZ N;  4EJO A;  1A31 A;  2DMN A;  2XB5 A;  2H6B A;  3F8N A;  1D1C A;  2M34 A;  2KIM A;  4UV9 A;  3CMA I;  5JHU A;  2DA7 A;  3ABT A;  1LVK A;  2JUG A;  3ULQ B;  1YJ9 I;  3U21 A;  5E1X A;  2OQR A;  4B09 A;  3F6V A;  4ESJ A;  2O9L A;  2P5L C;  3OYM A;  2J5O A;  2NS7 A;  3JR9 A;  2EV5 A;  4IF4 A;  1KU2 A;  2IJL A;  3IKV A;  1NG7 A;  1P4W A;  2VON A;  1MBH A;  3FKJ A;  1J5Y A;  1YHQ I;  3MKY B;  5DCF A;  2R7Z J;  1SFE A;  5DCM A;  3NAU A;  1HF0 A;  3OYN A;  2QKL B;  1OCP A;  5F04 A;  2OTJ I;  2DLL A;  2FXA A;  2LY9 A;  5D8K B;  4EGY A;  1POG A;  1YRN B;  1TW3 A;  3RYR A;  1XMX A;  3BCA A;  4L0Y B;  3MD2 A;  3BQZ A;  5KVR A;  1ZH5 A;  2OJE D;  3PL8 A;  3DWL E;  3V42 A;  2X6Y A;  4S04 A;  2QBY A;  2P0W A;  1K61 A;  2TDX A;  1RNL A;  2OPT A;  4Y52 J;  2UWM A;  3BG9 A;  1IG7 A;  2M3A A;  4IPA A;  2WWY A;  1T2K A;  1T6S A;  2EZL A;  3C2B A;  4BU2 A;  2EFO A;  2HOA A;  2W4S A;  3K2A A;  2F5V A;  4EM1 A;  3KP7 A;  4E7Z A;  3ZQQ A;  3GZ6 A;  2OZ6 A;  3KEO A;  1PUE E;  5LFA A;  2K02 A;  3CDI A;  1WJB A;  2FU4 A;  5JHF A;  5K5Q A;  3UKG A;  4HDV A;  2O5R A;  2BV6 A;  2KZV A;  2QM3 A;  5LGU A;  4IHY A;  2H6C A;  1ZAR A;  1ZTR A;  5IT9 Z;  1OR7 A;  2W00 A;  1ONV A;  3I0T A;  3H9J A;  4MNU A;  1X3U A;  3L00 A;  1A04 A;  1VQM I;  2M4K A;  3F21 A;  2CUZ A;  1UMQ A;  2H1K A;  1QVT A;  1MJ9 A;  3JCU C;  3OYB A;  3NAR A;  3OL4 A;  1O3T A;  3LNQ A;  4XLC A;  4BAC A;  5ILV A;  1HKQ A;  3G6E I;  4BBR J;  3HJE A;  4RAY A;  2CRG A;  1GVJ A;  5CKT A;  2DDB A;  3K1M A;  3L7W A;  1IRG A;  3FK6 A;  4UUV A;  2DO7 A;  4CIC A;  2K27 A;  2LRD A;  3X2Q H;  4NUB A;  1Z21 A;  4O6J A;  4DQ2 A;  4XN0 A;  3H1C A;  2OCE A;  4RB1 A;  2GZW A;  3D5S C;  3TP0 A;  3Q3S A;  2HU9 A;  3WHC A;  4YIF A;  3W2V A;  4A3B J;  4E4H A;  5CVI A;  2A05 A;  1ZLJ A;  2KZG A;  4AIJ A;  2EFN A;  5FLX K;  1W7P B;  1YIJ I;  1LPQ A;  5KAF C;  3M07 A;  4N0B A;  4MHG A;  5L3E A;  5LEJ A;  3F8F A;  3BT9 A;  5E1Z B;  2AHQ A;  2XGC A;  1YFH A;  2EBI A;  4KIT B;  1VQ4 I;  3BPV A;  2K5C A;  3TP3 A;  1XS9 A;  2H1L A;  1BIB A;  1KU9 A;  3KP6 A;  3ASN H;  3G4S I;  5FGM A;  4L0Z B;  4M6V A;  3C3W A;  3IV5 A;  4XLA A;  1UAA A;  2DOE A;  2R7U A;  4Y33 A;  1IN6 A;  2NXN B;  1YIT I;  3CC4 I;  1FSH A;  3O6B B;  1ZHF A;  2FNP A;  5ICG A;  4BYY A;  1U2W A;  1BJA A;  2FOW A;  2NYX A;  5IPA A;  5E18 F;  4C9Y A;  1MBF A;  1H9G A;  1USS A;  3HGY A;  1X3W B;  4Y17 A;  2P8T A;  2I10 A;  5FO5 A;  4S05 A;  4AYB N;  4WF2 A;  2KP6 A;  3I55 I;  3OR2 C;  2E1M C;  4L18 B;  2W1O A;  2ACJ A;  2V7F A;  1YX5 A;  4I98 B;  3G71 I;  2FE3 A;  1JKR C;  1BW5 A;  4XKC A;  2QQ9 A;  2IT0 A;  2L0K A;  1YIO A;  4Q47 A;  3H3V K;  2ZJQ F;  4ENJ A;  1BBY A;  4Y4R A;  1OCT C;  4M6Y A;  4G6D A;  2PI0 A;  2L3D A;  4NNJ A;  5HOO A;  1H89 C;  2X6X A;  1R4N B;  2OTL I;  3FIW A;  2WBM A;  3BR3 A;  1BR2 A;  2QQB A;  3H92 A;  1SD7 A;  2RN7 A;  1BW6 A;  1VI0 A;  3L2V A;  1K83 J;  3LSK A;  5DD4 A;  3DBR B;  1LB2 A;  4ESB A;  4HX8 A;  2V4J C;  5HVQ C;  1R6R A;  2V9V A;  4RM3 A;  2BHZ A;  1D8J A;  2XSJ C;  3KX2 A;  3ZN0 A;  3BOQ A;  2HDC A;  2EJR A;  3QU6 A;  2HVR A;  3L2W A;  4LJZ F;  1FOK A;  3MKL A;  2NVU B;  3FX3 A;  3CLQ A;  1T56 A;  3K69 A;  2E71 A;  3HRM A;  2W25 A;  4BE2 A;  3V7R A;  2XV4 S;  2CFX A;  3HKZ A;  1OQY A;  2V1X A;  3PNV A;  4KIB A;  4U0Y A;  3F6O A;  2ZJR F;  2VKD A;  1IDY A;  4PGG A;  5J47 A;  1DU0 A;  1A35 A;  4XKW A;  3ZQF A;  4Z6Y A;  1Z6R A;  4KIC A;  5DCM B;  1RUO A;  1BA5 A;  4U0V A;  1SVL A;  3T5X A;  2VT2 A;  1TWH J;  4AD9 A;  2CG4 A;  2MLG A;  2W82 A;  2KRC A;  3EQL F;  4M6X A;  2B0L A;  2G7U A;  2R7O A;  2MW8 A;  4ZZD A;  2P5V A;  4IOA F;  3GBG A;  1ETY A;  2CH0 A;  3TED A;  4B44 A;  1F4K A;  4I09 A;  3FM3 A;  3S17 J;  1GVD A;  3F8B A;  1I1G A;  1LE8 B;  2M1B A;  3DKY A;  1IF1 A;  2PLY A;  3L2U A;  5M3M J;  1U3E M;  3ZMT A;  2VOO A;  3M1E A;  4KYW A;  1KYW A;  3AL0 B;  2R7Q A;  1MSF C;  2WY8 Q;  1ETK A;  1HDD C;  2NVX J;  2Q2E B;  2IA0 A;  3BPX A;  3B02 A;  4G7H F;  3ABK H;  2CU7 A;  2V79 A;  2NVY J;  3GUD A;  2E7W A;  4CCM A;  3G73 A;  4FCY A;  3MFK A;  1BR1 A;  2JZY A;  1AA7 A;  2JA8 J;  5K1Y A;  1YS7 A;  5F08 A;  5D5U B;  5H20 A;  5M5W J;  1JJ6 C;  2P5K A;  3GF2 A;  3BG7 A;  1SFX A;  1YJN I;  2ECB A;  3GTP J;  5ILS A;  4UB8 C;  3OY9 A;  1DPR A;  2VB6 A;  3KP4 A;  2IBD A;  1UG0 A;  4BJ6 C;  4II2 A;  4HX4 A;  2LOO A;  4MEX F;  1QU3 A;  5IT9 K;  3S2H J;  5BOX A;  3RTR A;  4CYC A;  5JFR A;  5C4X J;  2VC0 A;  1FP1 D;  2K9L A;  3ZQH A;  2O3F A;  2VJ4 A;  1RPW A;  3TL4 X;  1OLT A;  3GXO A;  3OS1 A;  2EIK H;  2K4B A;  2Z16 A;  3DLL F;  1FYL A;  1MGT A;  2L7Z A;  2B9S A;  3J7A Y;  4ZDP A;  3KET A;  2DOA A;  2F5E A;  3RKQ A;  4X6A J;  1VTN C;  5E3O A;  4UNO A;  2L9V A;  2M9H A;  2M7A A;  1TNS A;  2FEZ A;  5HNH A;  3RJP A;  4LIT A;  3H9Q A;  1Y6I A;  5L3B A;  1LEA A;  4UVB A;  3HRS A;  5AON A;  2X4H A;  4B3X A;  5LHG A;  4BS9 A;  1R71 A;  4LB6 B;  2GAU A;  3W6K B;  1VQP I;  2R5Z B;  3KZY A;  3WU1 B;  3QP5 A;  1ZGA A;  2XKO A;  1S7O A;  1A6Q A;  4IRI A;  1F9N A;  1LDK B;  1ZKG A;  2WAQ N;  4CO8 A;  1TNT A;  4R8H A;  4RAF A;  3VDX A;  3K10 A;  3S3M A;  2EIJ H;  1V55 H;  2M0M A;  1P7I A;  5GPA A;  1XD7 A;  4AYB A;  3VPR A;  2NVQ J;  1JUM A;  3F8M A;  2PJP A;  1X2M A;  2ZC2 A;  1FYM A;  1YW8 A;  2BZT A;  4D5F A;  2R7S A;  5EYR A;  1PJR A;  3FXR A;  3JRD A;  3P5J A;  2V1N A;  4GO1 A;  2LBF B;  1G4D A;  4L9T A;  4AUX A;  1FBS A;  2KIF A;  5GAE J;  2HDW A;  3ESW B;  2RQP A;  1VQ9 I;  2VJJ A;  3HPG A;  3I54 A;  3RKY A;  3EET A;  4D9J A;  1MJB A;  2K9N A;  3RKX A;  4B47 A;  2GWR A;  5CPR B;  2JPB A;  3FXL A;  5J4V A;  2DA5 A;  3BJA A;  5BQT A;  5JLX A;  3SEZ A;  1LDD A;  2JSC A;  1V3F A;  2CMP A;  2JSP A;  2KJC A;  4DBQ A;  3W6J B;  4IZZ A;  1IRF A;  3KLN A;  1LNW A;  1U8B A;  1ERD A;  3DKW A;  4V2G A;  5J1Y A;  4E6K G;  2FQ3 A;  2NS0 A;  3ZQL A;  3HL2 A;  2CUJ A;  3O3K A;  2A61 A;  4CCK A;  2ZO4 A;  3HOT A;  4HF2 A;  4CDG A;  4FE4 A;  2LKS A;  4FT8 A;  3K1N A;  3EUH C;  4UUS B;  1OCC H;  1VND A;  1HDP A;  3ZQC A;  2L9R A;  2DT5 A;  2EIL H;  4PCQ A;  2HVQ A;  1WJF A;  4BXF A;  1UZC A;  2DBB A;  2R5Y A;  3SHF A;  3SZG A;  4FQG A;  5H2F C;  4HBL A;  4FE7 A;  1FTZ A;  3CQZ J;  4HQE A;  2VBY A;  1WJD A;  2DT7 B;  3UR3 C;  2FOK A;  5IP7 J;  2ZSI B;  1O3R A;  1KQ8 A;  5F0F A;  1LUJ B;  3JTH A;  4AID A;  4M74 A;  5JI6 A;  1IRX A;  3R61 A;  5FRM A;  1S29 A;  2DFE A;  4L9N A;  5CLS A;  1KZH A;  5HDG A;  3R0J A;  4I76 A;  1ZRF A;  2ETH A;  2RNJ A;  4PFP A;  2VE9 A;  1OIS A;  1AHD P;  3GTO J;  4KUM A;  1FMV A;  3RZD J;  2YX7 A;  3U1K A;  4Y7N J;  3CC7 I;  3SFI A;  2M45 A;  3ZMZ A;  5EEA A;  3ZN1 A;  4KDP A;  4BHP A;  1QPI A;  1BC8 C;  1OYW A;  3WTX C;  3RQ4 A;  1ODD A;  4UXN A;  4ZYD A;  3EUK L;  3S8P A;  4XRS G;  2VLA A;  1JJ8 C;  3K6G A;  1S8N A;  3NQO A;  2NOJ B;  2DOD A;  5J1R A;  2ZSH B;  2K4J A;  4L5J A;  1GLN A;  1VZ0 A;  1XC5 A;  3ASO H;  3HHG A;  5EGO A;  4ZYG A;  1T0F C;  4OIP F;  2JT1 A;  3GVA A;  1IZ1 A;  3H36 A;  4TV7 A;  1R5H A;  3SXY A;  5K7H A;  3KEQ A;  2HQN A;  1T98 A;  4LFU A;  3VEP A;  4DJA A;  2LVS A;  4J00 A;  3GZN B;  3B73 A;  1WI9 A;  4B4C A;  5D4S A;  2FBH A;  1WQ2 A;  2BHY A;  1HC8 A;  3MWM A;  4MO7 A;  2Y0S A;  3KFW X;  4F52 A;  4ZH4 F;  2WV0 A;  5D4R A;  4EGZ A;  5HLI A;  1R5G A;  5FLX Z;  1CGP A;  5DUK A;  1PVE A;  4DNC A;  3U1D A;  4NC8 A;  3HUG A;  4CYC B;  3DBH B;  1ZGJ A;  2DJN A;  1T33 A;  1A6I A;  1JHH A;  3FBI B;  2J5P A;  1MDM A;  5F6F A;  3AAF A;  3GFL A;  1OCZ H;  1SAX A;  2FNA A;  2W57 A;  3MZ8 A;  4G8X A;  1PP8 F;  4BHC A;  1YW7 A;  2XSD C;  1M1E B;  3LFK A;  1D3Y A;  2JTV A;  2K40 A;  2E1M B;  1X1A A;  4FIS A;  2DMU A;  1SMT A;  2IXS A;  4BEH A;  1W0U A;  5FD5 A;  5DS9 A;  5HNF A;  3FKI J;  3IAS 2;  4KT6 A;  4RS8 A;  3GCM A;  3RSN A;  4KIF A;  3W3C A;  2XGX A;  4LLN A;  3Q0W A;  3H0D A;  3BR6 A;  3BTC A;  1VQ5 I;  4RLF A;  1HQC A;  4IJA A;  2P81 A;  3S32 A;  4M73 A;  3WTU C;  4A3D J;  3DTE A;  1R7J A;  1SFU A;  2JK3 A;  1MBG A;  5BNG A;  3OYA A;  1V4R A;  1CF7 B;  3MZH A;  1IXC A;  3GFM A;  1VQL I;  1IN8 A;  1ZRC A;  3E5Q A;  3ISP A;  1HW5 A;  1TZL A;  2PQ8 A;  2DA2 A;  2I8D A;  2HYJ A;  2KJB A;  1I50 J;  3V7S A;  5TIS C;  4IRH A;  4GDF A;  2MH9 A;  1H88 C;  4HNU A;  3I53 A;  1W5C C;  3I3L A;  3CCV I;  3H35 A;  1QZY A;  5LRR A;  2GXA A;  2YPR A;  1ULY A;  3VOE A;  5E1W A;  2L4M A;  2A6E F;  1B9M A;  5EG0 A;  1ETW A;  1EH8 A;  2CGP A;  2M0C A;  5CVU A;  5J3L A;  1Z1D A;  4DZP A;  4IQJ A;  3A0H C;  1SFO J;  4PK4 A;  2QWW A;  4XRF A;  3PUB A;  3KP5 A;  1R1V A;  3EUH A;  4PJ0 C;  3S15 J;  1X1P A;  1JKQ C;  2BVM A;  1BC7 C;  4I0A A;  3I5U A;  3LA2 A;  4ENM A;  5B3S H;  2MA3 A;  4KMU X;  3JRH A;  3WG7 H;  2XF6 A;  2JWT A;  4AVZ A;  2IA1 A;  2H27 A;  2E60 A;  4A3J J;  5CVV A;  2L9N A;  3FXQ A;  3HTU A;  4HZF A;  4KIS A;  2ESN A;  2MH2 A;  1F1Z A;  5L3C A;  3CDH A;  4PSW A;  3ELK A;  3A0B C;  3K4C A;  5FRN A;  1OCO H;  2COB A;  1TT0 A;  2AS5 F;  2R5Y B;  1J2X A;  3L1P A;  2OC6 A;  2Q1Z B;  2L02 A;  4M9Z A;  2VBW A;  4BNC A;  2RC4 A;  2CW8 A;  2E35 A;  2ELJ A;  2KL4 A;  1C0W A;  1D0Y A;  3VYU B;  3WTS C;  4A3G J;  3A1Y A;  4MIM A;  3J81 K;  1WCM J;  2IW5 A;  1ZR2 A;  3ZQ7 A;  5IOY A;  5J40 A;  1W36 C;  4G9Y A;  2STT A;  4CCO A;  2IVM A;  3IH2 A;  2KRF A;  4LLL A;  2YX4 A;  1FBQ A;  2LRE A;  4LIU A;  2MG4 A;  4CZZ A;  3LSG A;  3JRG A;  1I27 A;  3WGI A;  3LSH A;  3WE3 A;  2M2E A;  4AU7 A;  2NNN A;  4IX7 A;  4I7H A;  2O0Y A;  2CW0 F;  4Y15 A;  3MMY B;  4A93 J;  3QYF A;  3F72 A;  3HGG A;  4PSX A;  5GPC A;  2A5W A;  2HXI A;  4DYR A;  5BS6 A;  1R22 A;  4HNT A;  4CGZ A;  2Z5U A;  1WHU A;  3LWF A;  4HAM A;  1T0F A;  3E6C C;  3WTZ A;  3I59 A;  3LST A;  3LOC A;  4CCL A;  4WX9 A;  3CUQ A;  2EIM H;  3L2C A;  3C2H A;  2ZME C;  1Z3X A;  4JX6 A;  1S7A A;  1X2N A;  1J9I A;  4EAT A;  3CCU I;  4M3D A;  3K0L A;  2HOE A;  5LGN A;  4XSX F;  3DEU A;  4EJW A;  4PJM A;  2MSY A;  1AKH B;  4YRV A;  2R7D A;  3ZMS A;  3R4K A;  1QBJ A;  3PIO F;  5FFX A;  2EV6 A;  2V9P A;  1HW1 A;  4O5V A;  4XLF A;  4AIK A;  2V1D A;  1ZN2 A;  4HQM A;  5ILU A;  3TKY A;  3HSF A;  4UVA A;  4XON A;  1O57 A;  2F5F A;  2X1C A;  4XBF A;  1B72 A;  1F43 A;  3M1C A;  3JSO A;  3H5A A;  1IRZ A;  2N8G A;  3DF8 A;  2IP2 A;  4I99 C;  4R79 A;  3DU5 A;  3T8R A;  2CO5 A;  2VL8 A;  3OR1 C;  3WHB A;  1ACI A;  3MKW B;  3BR2 A;  5GAG J;  5D5X B;  3HUG B;  2LH9 A;  2DFF A;  4KN7 X;  1X1B A;  5DEQ A;  4D7M A;  1KQ0 A;  1IGN A;  3IWF A;  1T39 A;  2E1C A;  1B59 A;  1BN5 A;  1HST A;  1Z7L A;  3HZJ A;  4C2T A;  3GTK J;  2IGK A;  2LY1 A;  2XHK A;  4E7K A;  2IA2 A;  2FBI A;  3QU3 A;  2FSW A;  5J6X A;  2BY0 A;  4HRI A;  4BEH B;  2LD5 A;  4MQ9 F;  1ZQ3 P;  2LKX A;  1U78 A;  4ITV A;  2P6T A;  3IP4 B;  3HIF A;  4BGD A;  2XPU A;  3S93 A;  3TQN A;  4EJT A;  1FNN A;  2IS2 A;  4IOC F;  2R0Q C;  4QIW N;  1R1T A;  3HOY J;  4RDU A;  5FLM J;  3SEQ A;  1MH3 A;  2GA2 A;  2MGQ A;  1K4T A;  2LLK A;  3IL2 A;  3LQR A;  5FRO A;  3FM5 A;  4HDU A;  1ZRD A;  1S3J A;  4N9I A;  4C2U A;  3IC7 A;  3SJM A;  3MAJ A;  4OAZ A;  2E2J J;  1VQ6 I;  2XPW A;  4BL0 B;  4CH7 A;  2YR2 A;  2LMD A;  3W2W A;  2OZU A;  3LAJ A;  3F22 A;  3IHU A;  3VFZ A;  1KYZ A;  1X1C A;  3CES A;  2NNY A;  1VQN I;  1I3A A;  3F0C A;  2DTZ A;  3A01 A;  2YU3 A;  3H9G A;  5B1B H;  3FXM A;  3SDG A;  3MVP A;  2DA3 A;  1YE9 A;  1LJ9 A;  1XMA A;  3LSI A;  4KJZ A;  4L5E A;  1A5J A;  1H9T A;  2ZB9 A;  2NRA C;  3ZQI A;  5LHH A;  4JK1 X;  1D8K A;  1FMW A;  4MQV A;  2RDP A;  2XAS A;  4JYK A;  1V5E A;  4NQW A;  3S1R J;  1DDN A;  1SD5 A;  3K2Z A;  4BJT A;  1MJA A;  4LGW A;  1K6O A;  2CYY A;  4G6T B;  5DYM A;  5KCM A;  2PJR A;  5K7Z A;  4A3K J;  3AKZ A;  2BE5 F;  2E36 A;  1IDZ A;  5H6Q A;  1IJW C;  2OAZ A;  4B43 A;  4IL6 C;  2CW7 A;  3T0Y A;  1D5Y A;  3OIQ A;  2UV1 A;  3VSK A;  1FBU A;  1ZRE A;  1NHA A;  3OOP A;  2HKO A;  1NG6 A;  2ELH A;  3ABU A;  3DQV C;  3K70 D;  4BHB A;  2G9W A;  4FET A;  1DQU A;  3ZGK A;  2HPI A;  3BTI A;  5EEH A;  1YI2 I;  1IAW A;  2P7C B;  2KFD A;  3MZY A;  3OYH A;  2WAF A;  3S1M J;  1O4X A;  1QRY A;  5F1J A;  1FIA A;  3HTS B;  3S1N J;  4E7H A;  4L5I A;  4D7N A;  5HOD A;  3F8C A;  3MN2 A;  1XSX A;  4ON0 A;  2EB7 A;  3GYH X;  2L7M P;  1WJC A;  3P9I A;  1XG1 A;  4LG0 A;  1BL0 A;  2ZFW A;  4M9S A;  2ZME A;  5DTD A;  2MLK A;  2GXG A;  1LFU P;  1O7L A;  2JRT A;  2VN2 A;  3BR0 A;  2STW A;  1Y8R B;  2LY2 A;  1MMS A;  2L7F P;  3K4N A;  2DYR H;  1Y56 A;  2VPL A;  4A3M J;  2P6S A;  4M72 A;  2HQ5 A;  1MIJ A;  3CJT B;  3HEF A;  4XMY A;  1J59 A;  4GYI A;  1RC9 A;  3I9V 2;  4HW0 A;  4IHW A;  2KDO A;  1YLF A;  2PMH A;  3OSG A;  4DW6 A;  1J7K A;  3ZXS A;  2KPM A;  5K7F A;  3WTY C;  3FZV A;  3QQA A;  4ZTF A;  3N4M A;  3QOE A;  2QBY B;  1K79 A;  1JKO C;  5E17 F;  2OU2 A;  3OIP A;  4M3F A;  2DK5 A;  3DPT A;  4A0X A;  4NBQ A;  1B72 B;  2COM A;  1IUY A;  1R49 A;  2PG4 A;  4ZYH A;  3M8F A;  3JRF A;  3EDP A;  3GTL J;  2IS6 A;  3H0G J;  2E1O A;  3Q0V A;  3PFI A;  2FUG 2;  1I6X A;  2E7X A;  3OYC A;  2FA5 A;  4A3E J;  1XN7 A;  2IS4 A;  3FXU A;  1NTC A;  5FFZ A;  3A4C A;  1B4A A;  2DOF A;  2TRT A;  2X51 A;  4GYG A;  1I5Z A;  2QQA A;  2VJ5 A;  1ZLK A;  3RPU A;  2Y0S N;  1YG2 A;  1RZ4 A;  1P4X A;  1MMD A;  1RKW A;  2OUM A;  3M7G A;  2DI3 A;  4G7O F;  1S5L C;  2ZFU A;  4H4K C;  2QEX I;  3KYL A;  2WV1 A;  2QQ8 A;  2R3S A;  3I4P A;  2FX0 A;  5FD6 A;  4M9X A;  1AU7 A;  4DYC A;  1FP2 A;  4XOP A;  1B1B A;  1A36 A;  4U7D A;  1JGS A;  3SQN A;  1NK2 P;  1ETO A;  2M5W A;  2DA4 A;  1XGM A;  2RGV A;  3CCJ I;  2HQA A;  4IHX A;  3HHH A;  4KT5 C;  3KP3 A;  2VC1 A;  4XOR A;  3TDZ C;  3TDU C;  3MKZ A;  4ANJ A;  1SEU A;  4XQF A;  3REO A;  2JUC A;  1OJL A;  2EZI A;  2WAE A;  3PM1 A;  3R60 A;  1EH7 A;  2I5U A;  2F4O B;  3QWL A;  1DPU A;  3LSP A;  3PNT A;  2VOD A;  3S2W A;  3P7N A;  1B9N A;  2DQL A;  4PFO A;  2XUB A;  4EJV A;  4EVI A;  2CQN A;  1ETV A;  4MTE A;  4IO9 F;  1L0O C;  3PFY A;  4WWC A;  2ZNY A;  1IN5 A;  4RGX A;  3VSL A;  2ZBK A;  3A01 B;  4IHS A;  2XRN A;  2QKM B;  3P9K A;  1CQT A;  3E5U A;  1K78 A;  5CVJ A;  1VQ8 I;  3DU6 A;  3CUO A;  4OIN F;  1YYV A;  4NQW B;  4G94 A;  3TGN A;  1OYI A;  1RET A;  2LSO A;  2QUF A;  3JRI A;  2DMQ A;  1R23 A;  2PJR B;  2WY7 Q;  3ZRG A;  5H6R A;  1FSE A;  2H8R A;  3ML6 A;  2M4G A;  3OYD A;  1O3Q A;  2IRF G;  3ABL H;  3E7L A;  2GOX B;  4CXF A;  4F7Z A;  2DK8 A;  4CCN A;  1B8I A;  3EYY A;  2R7V A;  1H8A C;  1TWG J;  1Z3Y A;  2VKE A;  2JN6 A;  2Q8K A;  4BQO A;  4A3F J;  3VWB A;  1UJ8 A;  3DTI A;  4XKB A;  5AIP A;  3OS0 A;  3DCF A;  1O7F A;  4FTH A;  1YOV B;  4BE0 A;  1N78 A;  4ZC3 A;  3OYE A;  2JVG A;  2O03 A;  1OYY A;  2CS3 A;  2YUS A;  4QWQ A;  2GBY A;  2OBP A;  3DEE A;  2ME0 A;  3QYB A;  1LFP A;  3GLL A;  1D1A A;  2R7T A;  3J81 Z;  4UB6 C;  4EMS A;  3JRE A;  1E3O C;  3BY6 A;  5EJC A;  1NK3 P;  3GTQ J;  2R4G A;  5DDG A;  4I6Z A;  2DU9 A;  1RUN A;  3K9T A;  4DBR A;  2DMT A;  2JVH A;  3HSR A;  3V8L A;  3CCM I;  1IXR C;  3CJN A;  2QCO A;  3CO6 C;  4P55 A;  3PJR A;  5LBQ A;  2D45 A;  1WRJ A;  4AC0 A;  1I3Q J;  1WKM A;  2GIZ A;  4O3M A;  1P9Q C;  4GXO A;  2AQE A;  2W84 A;  2Y69 H;  5CJ9 A;  5E3N A;  1PUF A;  2EWN A;  1HCR A;  3H3U A;  1H0M A;  4KMF A;  3K4K A;  3BTL A;  1FLI A;  4P9U A;  5C44 J;  2D1V A;  2Y0M A;  3G3Z A;  3GEZ A;  3G1M A;  1YS6 A;  3PO2 J;  3GTJ J;  4EV0 A;  5F27 A;  3CF5 F;  3K4L A;  5J8C A;  2A3S A;  2R7F A;  2BOL A;  2V1U A;  3CLO A;  3I4M J;  3KZZ A;  1R9T J;  5M5Y J;  2XAU A;  4NC6 A;  2AXL A;  1ON1 A;  2QEN A;  1ZGW A;  1G3Y A;  2LTP A;  2G7H A;  3GZ5 A;  1SAN A;  4HST A;  1RIO H;  1Z6T A;  3TO7 A;  4CA0 A;  3B6C A;  1ORK A;  2O8X A;  2MD5 A;  3CME I;  3V8J A;  1FOW A;  1W1W E;  3DPU A;  4B8X A;  1FIP A;  1OFC X;  1YX3 A;  3ERM A;  4YEL A;  3NWT A;  5ED4 A;  1REP C;  2L54 A;  4A69 C;  3JRB A;  3I58 A;  2DPD A;  1DGR M;  3V8K A;  3IRR A;  2MC4 A;  1JT0 A;  1JXS A;  3BTJ A;  1U5T C;  1Y39 A;  1HBX G;  3KLO A;  3CC2 I;  3K7A J;  3HOS A;  3V4G A;  4HLY A;  3SZP A;  3RI4 A;  4F3Q A;  2VQL A;  2LF7 A;  4ZTJ A;  3KYC B;  5L3D A;  4R1H A;  1ETQ A;  3JRA A;  2DFI A;  4N4O B;  3BZK A;  3LA3 A;  5ICF A;  2VKV A;  5EEG A;  1XX5 A;  1MMA A;  2FD5 A;  2ID3 A;  3CUQ C;  2ZJP F;  2HDD A;  4UVC A;  4MTD A;  2EPF A;  4A6D A;  4I02 A;  4ZDL A;  1GHC A;  3R6S A;  2LFB A;  2VOP A;  1QNT A;  1T95 A;  2XDV A;  2OD5 A;  3T1B A;  4Q5S F;  1G2H A;  1HOM A;  2XF5 A;  3O2P E;  3OL3 A;  5D8L B;  4S0H B;  4PDK A;  1N25 A;  2LYC A;  2PFB A;  4U87 A;  1QPM A;  2CUE A;  2DXI A;  4YIR X;  4KIG A;  4A5N A;  5B1A H;  2QSH X;  3KIO A;  2E1N A;  3HRU A;  4ABZ A;  5BPD A;  2F5D A;  2XVC A;  3CCY A;  3M8J A;  4QLC U;  5D6F A;  2AO9 A;  3E1S A;  3LSM A;  3TO6 A;  1TBX A;  1TQM A;  2EA2 A;  3F9K A;  5HS9 A;  1Q1V A;  4QPQ A;  4U0W A;  2ISY A;  1ZYR F;  2QSG X;  3GW2 A;  4HPQ A;  4EEF G;  1Z7U A;  5A2Q K;  2W7N A;  3WU2 C;  1WI3 A;  3JAM K;  1DU6 A;  4BE1 A;  3KEY A;  5LLQ A;  3FXJ A;  4M3B A;  2ME6 A;  4ZJZ A;  3HBL A;  2MC3 A;  4MFE A;  2O8K A;  4Q4Z F;  1OCR H;  2HVS A;  2QF7 A;  1MZB A;  3PQJ A;  1K78 B;  1QZZ A;  2FBK A;  3QOP A;  2R92 J;  2CQ7 A;  4BXX J;  4XRS A;  4BJ5 C;  1FY7 A;  2DDA A;  1MMN A;  3PNY A;  1D0X A;  1G3S A;  2XAF A;  4U88 A;  3E97 A;  2LK2 A;  4IQ4 A;  4M3E A;  5HLG A;  2JA6 J;  2DT6 A;  3G1L A;  4P9F A;  2CJJ A;  2W48 A;  2A6H F;  4FHT A;  4JX4 A;  1W0T A;  5CVR A;  2DPU A;  2PMU A;  1BI1 A;  2VKH A;  1EV7 A;  3KZI C;  4RLQ A;  1TC3 C;  4B3A A;  1TT5 B;  2GM4 A;  4F55 A;  1FYK A;  1FOY A;  3QAH A;  3VB2 A;  4G6Q A;  1GUU A;  4AM3 A;  1W7P A;  2BW3 A;  3HXL A;  2EFQ A;  4PUS A;  1QQI A;  4E7L A;  1XB4 A;  3TBI A;  2XAH A;  1Y1V J;  2VI6 A;  1ZEL A;  3IWZ A;  1Z05 A;  5E79 C;  1ZG5 A;  1HLV A;  1XDU A;  3NRV A;  1DP7 P;  1XSD A;  3L2Q A;  4BBS J;  3FHZ A;  4EM0 B;  2EFW A;  4WXD A;  3BG6 A;  2R7W A;  2GQQ A;  1MND A;  3S14 J;  4HF0 A;  5GP9 A;  4AVP A;  1FZP B;  4BXU A;  3HPH A;  1RES A;  2BXY A;  3G1O A;  5DD8 A;  4DGW B;  2LG4 A;  3J7Z I;  2V6E A;  2UZK A;  2H94 A;  3HC7 A;  3OYL A;  3WE2 A;  5HS7 A;  1VFC A;  5DM6 F;  4LK1 F;  4WK8 F;  1TQI A;  4NC7 A;  2XF7 A;  2LKP A;  2QZ8 A;  1SC7 A;  2B63 J;  1PUF B;  2L5Q A;  2E2I J;  1FEX A;  2Y75 A;  4CYD A;  2MYS A;  4L9J A;  2GOM A;  1T38 A;  2VPR A;  1JGG A;  3OYI A;  3RCO A;  5F0C A;  3DXJ F;  2IPQ X;  2IGN A;  3C2G A;  3HM5 A;  3BR1 A;  2HXO A;  2EZH A;  3TOA A;  1LEB A;  2GA1 A;  3WOD F;  4MEY F;  3OV8 A;  4C2M J;  4B1R A;  5TGT A;  3F23 A;  1WPK A;  1Z0X A;  3OOU A;  4ZYE A;  4AIH A;  1TW2 A;  3AFH A;  1SFK A;  2HTS A;  3BJ6 A;  1JKP C;  3C7J A;  3ZOB A;  4BAY A;  1U5T A;  3CCR I;  2LC2 A;  4BY1 J;  4M71 A;  3D5R C;  3E6D A;  2Z1D A;  4IVN A;  1T08 B;  2VAS A;  3AG4 H;  1AOY A;  1BI2 A;  4HV5 A;  4P1W A;  1JTY A;  3DP7 A;  4WXH A;  3ERE D;  1AWC A;  4OIQ F;  1D5V A;  1FTT A;  3BRO A;  2DYS H;  3ECO A;  3K4J A;  1EA3 A;  4JBA A;  3H5R A;  4A5M A;  2XRL A;  4HSR A;  5FKO A;  3WGH A;  3RYP A;  2XRO A;  1WVR A;  1QO0 D;  1SVM A;  4KNY A;  3K4M A;  1JTX A;  4UUT A;  2ZXJ A;  4N9H A;  4XOT A;  4YG2 F;  1XGS A;  4RGS A;  5JVT A;  4LB5 A;  5BMZ A;  3GME A;  2F4I A;  3CJR B;  2L9S A;  3HOX J;  1TP4 A;  1L3L A;  3PO3 J;  5E8I A;  1MBK A;  5EGO B;  3ECH A;  1MNE A;  3HSE A;  1KU3 A;  4RBO A;  2CV2 A;  2DJI A;  2NVT J;  5L3F A;  4YFK F;  2A68 F;  2MBF A;  3IKT A;  4II3 A;  2KT0 A;  3D0S A;  1BI0 A;  3W2A A;  3ZP5 A;  2V26 A;  2KQR A;  3HRT A;  1QGP A;  2H09 A;  2KRH A;  1P4A A;  1V5F A;  4PGH A;  4HYE A;  4ENK A;  2JA2 A;  1U8R A;  3OYJ A;  1X58 A;  2XAQ A;  3EYI A;  3ABM H;  1IV6 A;  1RRJ A;  1SMY F;  2TCT A;  3HOW J;  1MH4 A;  2ZCW A;  1MDM B;  2FF4 A;  3FK7 A;  3I71 A;  2KHM A;  3GWZ A;  1UB9 A;  2CSO A;  1E2X A;  4RA2 A;  3S16 J;  3QRF F;  1FC3 A;  3VOD A;  2Q0O A;  1IW7 F;  1LE8 A;  1U9N A;  4KFC A;  3V7C A;  2CFO A;  3C1D A;  2GLO A;  1IC8 A;  2IS1 A;  2ELK A;  2UUZ A;  3M3Y J;  1XDS A;  3CTA A;  1ON2 A;  1SD6 A;  2Q2E A;  4XK4 A;  3NEU A;  5EZH A;  1K4S A;  2L01 A;  2YS9 A;  2A5Y B;  3HDD A;  1F5T A;  4IXA A;  2C6Y A;  4BDZ A;  3IH3 A;  3FMS A;  2XKP A;  3SYT A;  4IKF A;  1WWX A;  2M87 A;  4LMY A;  1Z67 A;  3E5X A;  4EM2 A;  1BR4 A;  2ICW G;  4F93 B;  3LA7 A;  1WZ2 A;  1ITY A;  1ETX A;  2BY1 A;  2E19 A;  4FAS D;  3BCB A;  2ZJ2 A;  4QSH A;  2AXT C;  1Z91 A;  4BQN A;  1HXD A;  2DCE A;  5IOZ A;  1U0J A;  3LMM A;  3H3Z A;  4LG3 A;  1MW7 A;  1X4P A;  2HOT A;  1G3T A;  1GV5 A;  3TW6 A;  2X85 A;  4J01 A;  1RI7 A;  3PSI A;  1K6Y A;  2BW3 B;  2GIV A;  2W24 A;  3A2K A;  3QYE A;  2ZKZ A;  2ZNZ A;  2LDU A;  4CUG A;  4PJL A;  3AG3 H;  2XB0 X;  2JRM A;  5AIQ A;  5EG0 B;  1KU7 A;  3QPS A;  1JE8 A;  3J7A O;  1ZAO A;  2D2W A;  1UEL B;  4C3H J;  4RB3 C;  3QOD A;  2Z33 A;  3ZPL A;  2HFH A;  5HLH A;  4DZJ A;  3QPL A;  2LF8 A;  4D1Q A;  3DEW A;  4UV8 A;  1UST A;  4OIO F;  5C3E J;  3AG1 H;  1P7J A;  5FKL A;  2E34 A;  2WTE A;  4XLN F;  1U6G A;  3L09 A;  1YTY A;  2A07 F;  2ZXH A;  4MLO A;  2X0L A;  4DIQ A;  2BVL A;  3DPL C;  2BBY A;  3PQK A;  3ZMV A;  2K3F A;  3C18 A;  5K5O A;  1N75 A;  1WGX A;  3RKW A;  2HQR A;  2WB1 N;  3A03 A;  4RAG A;  2R5Z A;  1FOX A;  1VQO I;  1G8X A;  4EQQ A;  3CMY A;  1RR8 C;  3VYR B;  1EKE A;  2JJ7 A;  1RR7 A;  2DN0 A;  1S6L A;  2XPV A;  2WC2 A;  3JW4 A;  3TMO A;  2PX9 A;  2HI3 A;  5HDN A;  1TWF J;  2XGD A;  4YFX F;  1DGW Y;  4ESF A;  4HNV A;  2RV8 A;  3J7Y J;  1D1B A;  1YQA A;  1PDN C;  2VE8 A;  3DFG A;  2QLZ A;  3OYF A;  1R1U A;  4X0G A;  1XGO A;  2WAD A;  1W4M A;  4MGR A;  1GDT A;  2NAZ A;  4NHJ A;  2KIS A;  1UHS A;  3QP6 A;  1TQP A;  2VBX A;  4DOZ A;  1FT9 A;  2FRH A;  2ADU A;  4XL9 A;  2LBF A;  3FXO A;  3O8H A;  4X1E A;  1U5T B;  4D0P A;  2JQ7 A;  3LFU A;  1J09 A;  1S9H A;  2DA1 A;  5K5R A;  4MFD A;  4UY8 I;  3CD6 I;  3QPH A;  5J8F A;  4AWX B;  4ZYA A;  1W36 D;  4KA4 A;  4N4N B;  1UG2 A;  5TJJ A;  2QGU A;  5F64 A;  2ECC A;  1PYV A;  2FML A;  3RQI A;  5M5X J;  5ICE A;  1HKT A;  4V19 K;  3E6M A;  3I59 B;  5ERI A;  5LD2 C;  2CWE A;  3ZMD A;  2B7E A;  2PMZ A;  3A02 A;  3LQQ A;  3CUQ B;  2BY3 A;  1E3P A;  4RM2 A;  2Z9O A;  3ZMU A;  1OMI A;  3CZ6 A;  5E3M A;  3P9C A;  3Q9V A;  2HS5 A;  4LOC A;  3FMR A;  1BM9 A;  1ZG3 A;  3FXK A;  3G2B A;  3R0A A;  1WH5 A;  4XSZ F;  1GXP A;  4UUS A;  2DTR A;  5GTH C;  5BPI A;  2RRE A;  4ASN A;  4JOM A;  5IP9 J;  2JA5 J;  3KP2 A;  5FKK A;  3OWT A;  3QPT A;  2CQX A;  2QYO A;  3OS2 A;  3CCQ I;  3Q5F A;  3BP8 A;  4XLP F;  1HKS A;  3LL7 A;  4XN3 A;  5IY5 H;  3FDY A;  3HOU J;  2CUF A;  2G0E A;  2IGO A;  4IRG A;  4LK0 F;  4QPO A;  2CQK A;  2RQQ A;  5HS8 A;  3UNG C;  1G3W A;  4C3I J;  4LIV A;  2HYF A;  4A6E A;  2K86 A;  1R58 A;  2Z99 A;  1I39 A;  2EH3 A;  4OU0 A;  5B5E C;  2DFH A;  2DMP A;  5IYC J;  1UHM A;  4HLX A;  1UHW A;  3F3X A;  2XAG A;  3KCC A;  2MFZ A;  2KIU A;  2OQG A;  1SAU A;  3GO5 A;  4YEJ A;  1VF9 A;  5A2Q Z;  4LD5 A;  1IV8 A;  4BDY A;  3JAM Z;  1APL C;  1XSV A;  3HOZ J;  5D6E A;  1Z77 A;  4CZC A;  3S2D J;  4W97 A;  1JUP A;  2F6C A;  5F1R A;  2ZXI A;  2VQC A;  3IRQ A;  5E3L A;  4JX5 A;  3VYS B;  4M3G A;  2HTJ A;  4A3C J;  5LHI A;  2EIN H;  2FJ1 A;  1STZ A;  3BWG A;  2CQQ A;  1XMK A;  5JVG F;  2M30 A;  1Y0U A;  1YJW I;  2EK5 A;  1TTY A;  1MD0 A;  1P6R A;  2BY2 A;  4XM3 A;  5CQG A;  1LDJ A;  3E6B A;  1Z9C A;  4I01 A;  5IP6 A;  3JRC A;  2R7X A;  2HWV A;  3B6A A;  1QA6 A;  3RPU D;  4BY7 J;  4GFB A;  2BXZ A;  2K85 A;  2MAB A;  2OA4 A;  1W5T A;  4Z2Y A;  4DYQ A;  2WA0 A;  2E5N A;  2X6W A;  3FMQ A;  3OMY A;  1JI8 A;  3SZT A;  2P7V B;  2RKH A;  1X1D A;  3WGG A;  2V9K A;  3BLY A;  1WH7 A;  1LQ1 A;  2HZT A;  3S3O A;  2A6T A;  5FJ8 J;  1BI3 A;  2HYG D;  2H8W A;  3S3N A;  1ZG1 A;  6PAX A;  2VT3 A;  2VXD A;  4XLH A;  3OSF A;  1F36 A;  5LRS A;  3M9A A;  3FF5 A;  3U2R A;  3RZO J;  1P2F A;  3RPQ A;  3E0J B;  4LLG F;  3WTW C;  2YU9 J;  3J80 Z;  4HX7 A;  4P5O A;  1KGS A;  2F2E A;  3DTK A;  3E3V A;  3BG3 A;  4GGG A;  5C4J J;  2BGC A;  1MMG A;  2XGE A;  3CCL I;  3CP8 A;  3U9G A;  4KN4 X;  5LEK A;  2L7K A;  1HW2 A;  3H5N A;  4P96 A;  1WJ5 A;  4YII A;  2A69 F;  3FHN A;  2UXN A;  4Y3O A;  2O61 A;  1HA8 A;  3K4B A;  2KKO A;  4A2U A;  4F92 B;  1PP7 U;  5M3F J;  3FBN B;  5ICC A;  1CF7 A;  2X48 A;  4OMY A;  3O8G A;  2IAI A;  1DUX C;  2Z2S B;  1ZR4 A;  3D5L A;  3HB9 A;  1VQ7 I;  5B66 C;  4G12 A;  3ZCO A;  3GFI A;  4E70 A;  4H0E A;  2VIX A;  3GX4 X;  2FMY A;  4ETS A;  5FKM A;  3HYI A;  4K2E A;  4BKX A;  2WB1 A;  4G7Z F;  1V5G A;  3EPZ A;  3M8E A;  1KA8 A;  1DP3 A;  2Z3Y A;  2RVC A;  4I2O A;  3CF2 A;  3DLA A;  1IN7 A;  2Y30 A;  1UCR A;  2Y48 A;  4XRM A;  1SVO A;  4LG0 B;  2F48 A;  4OAY A;  5J4Y A;  4RAZ A;  2ZME B;  1FWZ A;  4HEA 2;  1EJ9 A;  3PSF A;  1G6N A;  2P4W A;  3CMM A;  4Q48 A;  3K1P A;  1FX7 A;  3ZQG A;  3OYK A;  3TW7 A;  1I6H J;  3IUO A;  2HGC A;  4D5C A;  2ISZ A;  2ESH A;  1G59 A;  3L2R A;  3DV8 A;  1WJE A;  3WU0 A;  2E2H J;  4OIR F;  1WSU A;  2KDZ A;  5FLV A;  4B48 A;  5IYD J;  5DM7 F;  1QHH D;  5DUI A;  1YW9 A;  4CHU A;  2VQG A;  4BQQ A;  1TLH B;  4JP0 A;  2LNB A;  4RGR A;  3KPH A;  4F91 B;  5D5V B;  3LAP A;  2PBI A;  3IH4 A;  3ZR8 X;  4E7S A;  9ANT A;  3GTM J;  1MSE C;  1QHG A;  2KLO A;  5JLW A;  5FKN A;  3COA C;  4BUP A;  3MEX A;  1D0Z A;  3VYT B;  2LR8 A;  5JR3 A;  4V2F A;  4CCJ A;  3SDB A;  4JQF A;  5IYB J;  1X4O A;  5GAH J;  1E3H A;  3BC8 A;  2O7O A;  3WTT C;  3I4N J;  3I56 I;  2MD0 A;  1LVA A;  3IAM 2;  1OPC A;  5KAI C;  4FX4 A;  1BIA A;  4E7J A;  1R4M B;  3KYD B;  3D1N I;  2L4A A;  1VQK I;  1IO2 A;  4YFN F;  4ZZL A;  3OIO A;  1T8I A;  1EF4 A;  4A3I J;  1W5S A;  2BEO A;  1MKM A;  4NDL A;  4UHT A;  1XCV A;  2K7L A;  4A3L J;  2L2O A;  5DV5 A;  5HDK A;  3ROU A;  2UXX A;  2K9M A;  2O6G E;  5KHD A;  2Y31 A;  2X6O A;  4HG2 A;  2R7R A;  1E17 A;  2NS8 A;  1R00 A;  1TWC J;  4L9V A;  3NWS A;  1XGN A;  1JHF A;  3GFJ A;  1MNM C;  2OV7 A;  2PN6 A;  3Q9S A;  3T8T A;  2AQF A;  4WXC A;  1LKX A;  2F5C A;  4HV6 A;  2HZD A;  2IEK A;  1YRN A;  4U7B A;  4QTR A;  1Y0N A;  2R93 J;  3FIS A;  3CP2 A;  1N77 A;  1S7E A;  3BJO A;  2DQR A;  5F0H A;  1EH6 A;  5LGT A;  3BZC A;  3SFZ A;  3WG9 A;  1AKH A;  1U9O A;  4J19 A;  3LSR A;  2V6C A;  2XC7 A;  2X1E A;  1XCB A;  3DBL B;  2KMU A;  2JA7 J;  5J1U A;  2JMW A;  1YO5 C;  2F4M B;  4ZDO A;  2YSR A;  1Q1H A;  4NB5 A;  4OOI A;  1ENH A;  2RAE A;  1HSJ A;  2DA6 A;  4EJU A;  2DW4 A;  2K9Q A;  1GV2 A;  2EQR A;  5GTI C;  4E7I A;  4HOB A;  4XR6 A;  3N05 A;  4XNF A;  3TO9 A;  3GLX A;  3HOV J;  5KNL A;  3JTG A;  4ENN A;  1BOB A;  1S72 I;  2EA4 A;  3WTV C;  2HEO A;  1JUS A;  1IUF A;  2NOG A;  5EZG A;  2PEX A;  3AG2 H;  1X19 A;  4XKV A;  4XID A;  1OKR A;  2M8G X;  3CJQ B;  2Y9Z A;  2K3P A;  2LP0 A;  3BDD A;  3S1Q J;  5E8G A;  2E5Z A;  1MBJ A;  1OR7 C;  3AL0 C;  1GXQ A;  3HG9 A;  1WJA A;  1MBE A;  3EUA A;  4WCG A;  3CDL A;  3OYG A;  2W85 A;  1B6A A;  2IGM A;  4GRI A;  4C30 A;  2OCC H;  1V54 H;  2K9S A;  3DKX A;  5HLT A;  1SD4 A;  1ZK8 A;  1LFB A;  1B8I B;  1KON A;  1UFM A;  3Q0U A;  1X3Z B;  2CV0 A;  1R36 A;  4OWR B;  2HOS A;  2Y2Z A;  2OF7 A;  4A12 A;  2ZXW H;  2EZK A;  2D5V A;  2ID6 A; 
#chains in the Genus database with same CATH homology
 4RGU A;  4IHT A;  1O3S A;  2HKX A;  4RB2 C;  1FPQ A;  3RDI A;  3FWE A;  4BH9 A;  5FB2 A;  2VXZ A;  1IN4 A;  2XAJ A;  3RIR A;  3L9F A;  4RB0 A;  5IT3 A;  1BOA A;  3J80 K;  5TRD A;  1K7A A;  3MCZ A;  5E20 A;  4BQA A;  1W7P D;  3MQ0 A;  4A0Y A;  2XIG A;  3I64 A;  3N97 A;  3CO7 C;  5D5W B;  2GXB A;  4OMZ A;  4PZJ A;  4FX0 A;  5CYV A;  1I1S A;  2EV0 A;  1P92 A;  2M8E A;  1IXS B;  2JPC A;  2HR3 A;  2BYV E;  3KE2 A;  2QVO A;  3TOB A;  4GCV A;  4HF1 A;  4I0B A;  3JSP A;  5KK1 A;  5L3G A;  1J0R A;  3BZ6 A;  4A0Z A;  2EFP A;  1J75 A;  4Y13 A;  2DAO A;  1KQ9 A;  2VBZ A;  4HA8 A;  2D1H A;  4EJO A;  2H6B A;  3F8N A;  2KIM A;  4UV9 A;  5JHU A;  3ABT A;  3ULQ B;  5E1X A;  2OQR A;  4B09 A;  3F6V A;  4ESJ A;  2P5L C;  2J5O A;  2EV5 A;  4IF4 A;  1KU2 A;  2IJL A;  3IKV A;  1P4W A;  2VON A;  1J5Y A;  5DCF A;  1SFE A;  5DCM A;  2DLL A;  2FXA A;  5D8K B;  4EGY A;  1TW3 A;  3RYR A;  4L0Y B;  5KVR A;  1ZH5 A;  4S04 A;  2QBY A;  2TDX A;  1RNL A;  2UWM A;  4IPA A;  2WWY A;  1T2K A;  1T6S A;  2EFO A;  4EM1 A;  1PUE E;  3KP7 A;  3GZ6 A;  2OZ6 A;  3KEO A;  2K02 A;  2FU4 A;  5K5Q A;  4HDV A;  2BV6 A;  5LGU A;  2QM3 A;  2H6C A;  1ZAR A;  5IT9 Z;  1OR7 A;  1ONV A;  3I0T A;  4MNU A;  1X3U A;  3L00 A;  1A04 A;  3F21 A;  1MJ9 A;  1O3T A;  5ILV A;  1HKQ A;  4RAY A;  1GVJ A;  3K1M A;  3L7W A;  1IRG A;  4UUV A;  2DO7 A;  4CIC A;  2K27 A;  4O6J A;  4DQ2 A;  4RB1 A;  2GZW A;  4YIF A;  5CVI A;  1ZLJ A;  4AIJ A;  2EFN A;  5FLX K;  1W7P B;  4N0B A;  4MHG A;  5L3E A;  5LEJ A;  3F8F A;  5E1Z B;  1YFH A;  3BPV A;  1BIB A;  1KU9 A;  3KP6 A;  5FGM A;  4L0Z B;  3C3W A;  1IN6 A;  1FSH A;  3O6B B;  1ZHF A;  2FNP A;  5ICG A;  4BYY A;  1U2W A;  1BJA A;  2NYX A;  5E18 F;  1H9G A;  1USS A;  4Y17 A;  2P8T A;  5FO5 A;  4S05 A;  4WF2 A;  4L18 B;  2ACJ A;  4I98 B;  2FE3 A;  2QQ9 A;  2IT0 A;  1YIO A;  4Q47 A;  4ENJ A;  1BBY A;  4M6Y A;  4G6D A;  2PI0 A;  2L3D A;  5HOO A;  2QQB A;  3H92 A;  1SD7 A;  2RN7 A;  5DD4 A;  1LB2 A;  4ESB A;  4HX8 A;  5HVQ C;  2V9V A;  1D8J A;  3ZN0 A;  3BOQ A;  2HDC A;  2EJR A;  3QU6 A;  4LJZ F;  1FOK A;  3FX3 A;  3K69 A;  3HRM A;  2W25 A;  3V7R A;  2XV4 S;  2CFX A;  4KIB A;  2V1X A;  4U0Y A;  3F6O A;  4PGG A;  1Z6R A;  4KIC A;  5DCM B;  1RUO A;  4U0V A;  3T5X A;  2VT2 A;  4AD9 A;  2CG4 A;  2MLG A;  3EQL F;  4M6X A;  2B0L A;  2G7U A;  4ZZD A;  2P5V A;  1F4K A;  4I09 A;  3FM3 A;  3F8B A;  1I1G A;  2M1B A;  1IF1 A;  2PLY A;  1U3E M;  3ZMT A;  2VOO A;  3M1E A;  4KYW A;  1KYW A;  2IA0 A;  3BPX A;  3B02 A;  4G7H F;  2V79 A;  3GUD A;  2E7W A;  3G73 A;  3MFK A;  2JZY A;  5K1Y A;  1YS7 A;  5D5U B;  5H20 A;  2P5K A;  3GF2 A;  1SFX A;  5ILS A;  1DPR A;  3KP4 A;  4HX4 A;  4MEX F;  5IT9 K;  5BOX A;  3RTR A;  5JFR A;  2VC0 A;  1FP1 D;  2O3F A;  3GXO A;  2K4B A;  1FYL A;  1MGT A;  3KET A;  1VTN C;  4UNO A;  1TNS A;  2FEZ A;  3RJP A;  5L3B A;  1LEA A;  4UVB A;  3HRS A;  5AON A;  2X4H A;  5LHG A;  4LB6 B;  2GAU A;  3W6K B;  3KZY A;  3WU1 B;  3QP5 A;  1ZGA A;  2XKO A;  1S7O A;  4IRI A;  1F9N A;  1LDK B;  4CO8 A;  1TNT A;  4R8H A;  1XD7 A;  3F8M A;  2PJP A;  1FYM A;  1YW8 A;  3FXR A;  4GO1 A;  1G4D A;  4L9T A;  1FBS A;  2KIF A;  2RQP A;  3I54 A;  3RKY A;  3EET A;  1MJB A;  3RKX A;  2GWR A;  2JPB A;  3BJA A;  5BQT A;  1LDD A;  2JSC A;  1V3F A;  2KJC A;  3W6J B;  1IRF A;  3KLN A;  1LNW A;  3DKW A;  2FQ3 A;  2NS0 A;  3O3K A;  2A61 A;  2ZO4 A;  3HOT A;  4HF2 A;  4CDG A;  4FT8 A;  3K1N A;  2DT5 A;  4PCQ A;  2DBB A;  3SHF A;  4HBL A;  4HQE A;  2VBY A;  1KQ8 A;  2FOK A;  1O3R A;  3JTH A;  4M74 A;  5JI6 A;  3R61 A;  1S29 A;  5CLS A;  4L9N A;  5HDG A;  3R0J A;  1ZRF A;  2ETH A;  2RNJ A;  2VE9 A;  4KUM A;  2YX7 A;  2M45 A;  3ZMZ A;  3ZN1 A;  4KDP A;  4BHP A;  1BC8 C;  1OYW A;  3WTX C;  1ODD A;  4UXN A;  4ZYD A;  1S8N A;  3NQO A;  2K4J A;  4L5J A;  3HHG A;  4ZYG A;  4OIP F;  2JT1 A;  3GVA A;  1IZ1 A;  4TV7 A;  1R5H A;  3SXY A;  3KEQ A;  2HQN A;  1T98 A;  4LFU A;  3VEP A;  3B73 A;  1WI9 A;  5D4S A;  2FBH A;  1WQ2 A;  3MWM A;  4ZH4 F;  3KFW X;  2WV0 A;  5D4R A;  4EGZ A;  5HLI A;  1R5G A;  5FLX Z;  1CGP A;  5DUK A;  4DNC A;  3U1D A;  3HUG A;  1ZGJ A;  1JHH A;  2J5P A;  1MDM A;  5F6F A;  3AAF A;  3GFL A;  1SAX A;  2FNA A;  2W57 A;  4G8X A;  1PP8 F;  4BHC A;  1YW7 A;  3LFK A;  1D3Y A;  2JTV A;  1SMT A;  5FD5 A;  4RS8 A;  4KIF A;  2XGX A;  4LLN A;  1HQC A;  4IJA A;  4M73 A;  3WTU C;  1R7J A;  1SFU A;  1V4R A;  1CF7 B;  3MZH A;  1IXC A;  3GFM A;  1IN8 A;  1ZRC A;  3E5Q A;  3ISP A;  1HW5 A;  2PQ8 A;  2KJB A;  3V7S A;  4IRH A;  2MH9 A;  3I53 A;  1QZY A;  5LRR A;  2YPR A;  1ULY A;  3VOE A;  5E1W A;  2L4M A;  2A6E F;  1B9M A;  1EH8 A;  2CGP A;  5CVU A;  1Z1D A;  2QWW A;  4XRF A;  3KP5 A;  1R1V A;  3EUH A;  1BC7 C;  4I0A A;  3I5U A;  3LA2 A;  4ENM A;  2MA3 A;  4KMU X;  2IA1 A;  2H27 A;  5CVV A;  3FXQ A;  3HTU A;  4HZF A;  2ESN A;  2MH2 A;  1F1Z A;  5L3C A;  3CDH A;  3ELK A;  2AS5 F;  1J2X A;  4M9Z A;  2L02 A;  2VBW A;  4BNC A;  2RC4 A;  1C0W A;  3WTS C;  3J81 K;  2IW5 A;  3ZQ7 A;  4G9Y A;  2STT A;  2IVM A;  2KRF A;  4LLL A;  2YX4 A;  1FBQ A;  4CZZ A;  1I27 A;  3WGI A;  3WE3 A;  2NNN A;  4I7H A;  2O0Y A;  2CW0 F;  4Y15 A;  3F72 A;  4CGZ A;  5BS6 A;  1R22 A;  2Z5U A;  3LWF A;  4HAM A;  3E6C C;  1T0F A;  3WTZ A;  3I59 A;  3LST A;  4WX9 A;  3CUQ A;  3L2C A;  1S7A A;  1J9I A;  3K0L A;  2HOE A;  5LGN A;  4XSX F;  3DEU A;  4EJW A;  2R7D A;  3ZMS A;  3R4K A;  1QBJ A;  5FFX A;  2EV6 A;  1HW1 A;  4O5V A;  4AIK A;  2V1D A;  1ZN2 A;  4HQM A;  5ILU A;  3TKY A;  3HSF A;  4UVA A;  1O57 A;  2F5F A;  4XBF A;  3JSO A;  3DF8 A;  2IP2 A;  4R79 A;  3T8R A;  2CO5 A;  5D5X B;  4KN7 X;  5DEQ A;  1KQ0 A;  3IWF A;  1T39 A;  2E1C A;  1B59 A;  1BN5 A;  1HST A;  2XHK A;  2IA2 A;  2FBI A;  3QU3 A;  2FSW A;  5J6X A;  4MQ9 F;  1U78 A;  2P6T A;  3HIF A;  3TQN A;  4EJT A;  1FNN A;  1R1T A;  2GA2 A;  3IL2 A;  3LQR A;  3FM5 A;  4HDU A;  1ZRD A;  1S3J A;  4N9I A;  3IC7 A;  3MAJ A;  2YR2 A;  2OZU A;  3LAJ A;  3F22 A;  3IHU A;  3VFZ A;  1KYZ A;  2NNY A;  2YU3 A;  1LJ9 A;  1XMA A;  1H9T A;  2NRA C;  5LHH A;  4JK1 X;  1D8K A;  4MQV A;  2RDP A;  2XAS A;  4NQW A;  1DDN A;  1SD5 A;  3K2Z A;  1MJA A;  4LGW A;  1K6O A;  2CYY A;  5DYM A;  2BE5 F;  5H6Q A;  2OAZ A;  3T0Y A;  1FBU A;  1ZRE A;  1NHA A;  3OOP A;  2HKO A;  2ELH A;  3ABU A;  3DQV C;  4BHB A;  2G9W A;  5EEH A;  2P7C B;  1IAW A;  3MZY A;  3HTS B;  4L5I A;  3F8C A;  1XSX A;  4ON0 A;  2EB7 A;  3GYH X;  3P9I A;  4LG0 A;  2ZFW A;  4M9S A;  2ZME A;  2MLK A;  2GXG A;  1O7L A;  2JRT A;  2VN2 A;  2STW A;  2P6S A;  4M72 A;  1J59 A;  4GYI A;  4HW0 A;  1YLF A;  2PMH A;  1J7K A;  3WTY C;  3FZV A;  3N4M A;  2QBY B;  1K79 A;  5E17 F;  2OU2 A;  2DK5 A;  3DPT A;  4A0X A;  2COM A;  1IUY A;  2PG4 A;  4ZYH A;  3M8F A;  3EDP A;  3PFI A;  1I6X A;  2E7X A;  2FA5 A;  1XN7 A;  3FXU A;  5FFZ A;  1B4A A;  4GYG A;  1I5Z A;  2QQA A;  1ZLK A;  3RPU A;  1YG2 A;  1RZ4 A;  1P4X A;  3M7G A;  2DI3 A;  4G7O F;  2R3S A;  3I4P A;  5FD6 A;  4M9X A;  1FP2 A;  1B1B A;  4U7D A;  1JGS A;  3SQN A;  2M5W A;  1XGM A;  2RGV A;  3HHH A;  4KT5 C;  3KP3 A;  2VC1 A;  3TDZ C;  3TDU C;  3REO A;  3R60 A;  1EH7 A;  1DPU A;  2VOD A;  3S2W A;  3P7N A;  1B9N A;  2DQL A;  2XUB A;  4EJV A;  4EVI A;  4MTE A;  1L0O C;  4WWC A;  2ZNY A;  1IN5 A;  4RGX A;  2ZBK A;  4IHS A;  2XRN A;  3P9K A;  3E5U A;  1K78 A;  5CVJ A;  3CUO A;  4OIN F;  1YYV A;  4G94 A;  3TGN A;  1OYI A;  2LSO A;  2QUF A;  1R23 A;  5H6R A;  1FSE A;  3ML6 A;  1O3Q A;  2IRF G;  4CXF A;  4F7Z A;  2DK8 A;  3EYY A;  2Q8K A;  5AIP A;  1O7F A;  2O03 A;  1OYY A;  4QWQ A;  2OBP A;  3J81 Z;  4EMS A;  3BY6 A;  5DDG A;  2DU9 A;  1RUN A;  3K9T A;  3HSR A;  3V8L A;  1IXR C;  3CJN A;  3CO6 C;  4P55 A;  5LBQ A;  2D45 A;  1WRJ A;  1WKM A;  4O3M A;  4GXO A;  2W84 A;  5CJ9 A;  2EWN A;  3H3U A;  1H0M A;  4KMF A;  1FLI A;  4P9U A;  2D1V A;  2Y0M A;  3G3Z A;  3GEZ A;  1YS6 A;  4EV0 A;  5J8C A;  2A3S A;  2R7F A;  2V1U A;  3CLO A;  3KZZ A;  2AXL A;  1ON1 A;  2QEN A;  1G3Y A;  2G7H A;  3GZ5 A;  1RIO H;  1Z6T A;  3TO7 A;  2O8X A;  2MD5 A;  3V8J A;  4B8X A;  5ED4 A;  1REP C;  2L54 A;  3I58 A;  2DPD A;  3V8K A;  3IRR A;  1JXS A;  1U5T C;  1HBX G;  3KLO A;  3HOS A;  3V4G A;  4HLY A;  3SZP A;  3RI4 A;  2LF7 A;  5L3D A;  4R1H A;  2DFI A;  5ICF A;  3LA3 A;  5EEG A;  3CUQ C;  4UVC A;  4MTD A;  4A6D A;  4I02 A;  1GHC A;  3R6S A;  2VOP A;  1QNT A;  3T1B A;  2OD5 A;  4Q5S F;  3O2P E;  5D8L B;  4PDK A;  2PFB A;  1QPM A;  4KIG A;  4A5N A;  2E1N A;  3HRU A;  5BPD A;  2F5D A;  2XVC A;  4QLC U;  5D6F A;  3TO6 A;  1TBX A;  1TQM A;  2EA2 A;  5HS9 A;  4U0W A;  2ISY A;  1ZYR F;  3GW2 A;  1Z7U A;  5A2Q K;  3JAM K;  5LLQ A;  2MC3 A;  4Q4Z F;  1K78 B;  1MZB A;  3PQJ A;  1QZZ A;  2FBK A;  3QOP A;  1FY7 A;  1G3S A;  2XAF A;  4U88 A;  3E97 A;  5HLG A;  4P9F A;  2A6H F;  4FHT A;  5CVR A;  2DPU A;  2PMU A;  1BI1 A;  1EV7 A;  1FYK A;  3QAH A;  3VB2 A;  4G6Q A;  1W7P A;  2EFQ A;  1QQI A;  1XB4 A;  2XAH A;  3IWZ A;  1ZG5 A;  1Z05 A;  1XDU A;  3NRV A;  1DP7 P;  1XSD A;  3FHZ A;  4EM0 B;  2EFW A;  4WXD A;  2GQQ A;  4HF0 A;  4AVP A;  1FZP B;  4BXU A;  5DD8 A;  2UZK A;  2H94 A;  3WE2 A;  5HS7 A;  4LK1 F;  4WK8 F;  1TQI A;  2LKP A;  2QZ8 A;  2Y75 A;  4CYD A;  4L9J A;  1T38 A;  3DXJ F;  2IPQ X;  3TOA A;  1LEB A;  2GA1 A;  3WOD F;  4MEY F;  3OV8 A;  3F23 A;  4ZYE A;  4AIH A;  1TW2 A;  2HTS A;  3BJ6 A;  3C7J A;  4BAY A;  1U5T A;  4M71 A;  3E6D A;  4IVN A;  1AOY A;  1BI2 A;  4HV5 A;  3DP7 A;  4WXH A;  3ERE D;  1AWC A;  4OIQ F;  1D5V A;  3BRO A;  3ECO A;  4JBA A;  4A5M A;  3WGH A;  3RYP A;  2XRO A;  1QO0 D;  4KNY A;  4YG2 F;  2ZXJ A;  4N9H A;  1XGS A;  4RGS A;  5JVT A;  4LB5 A;  5BMZ A;  1L3L A;  5E8I A;  3ECH A;  3HSE A;  1KU3 A;  5L3F A;  4YFK F;  2A68 F;  2MBF A;  3IKT A;  3D0S A;  1BI0 A;  3ZP5 A;  3HRT A;  1QGP A;  2H09 A;  1P4A A;  4PGH A;  4HYE A;  4ENK A;  1U8R A;  2XAQ A;  3EYI A;  1SMY F;  2ZCW A;  1MDM B;  2FF4 A;  3I71 A;  3GWZ A;  1UB9 A;  2CSO A;  1E2X A;  3QRF F;  1FC3 A;  3VOD A;  2Q0O A;  1IW7 F;  4KFC A;  3V7C A;  3C1D A;  1XDS A;  3CTA A;  1ON2 A;  1SD6 A;  2Q2E A;  3NEU A;  2L01 A;  2A5Y B;  1F5T A;  4IXA A;  2C6Y A;  3FMS A;  2XKP A;  1WWX A;  2M87 A;  4LMY A;  3E5X A;  4EM2 A;  3LA7 A;  2ZJ2 A;  1Z91 A;  1HXD A;  3H3Z A;  1G3T A;  1RI7 A;  2W24 A;  2GIV A;  2ZKZ A;  2ZNZ A;  2LDU A;  5AIQ A;  1KU7 A;  1JE8 A;  3J7A O;  1ZAO A;  2D2W A;  4RB3 C;  2Z33 A;  3ZPL A;  2HFH A;  5HLH A;  2LF8 A;  4UV8 A;  1UST A;  4OIO F;  2WTE A;  4XLN F;  1U6G A;  3L09 A;  1YTY A;  2A07 F;  2X0L A;  3DPL C;  2BBY A;  3PQK A;  3ZMV A;  3C18 A;  5K5O A;  3RKW A;  2HQR A;  4EQQ A;  1S6L A;  3JW4 A;  2WC2 A;  5HDN A;  4YFX F;  4ESF A;  2RV8 A;  1YQA A;  1PDN C;  2VE8 A;  3DFG A;  2QLZ A;  1R1U A;  1XGO A;  4MGR A;  1W4M A;  2NAZ A;  4NHJ A;  3QP6 A;  1TQP A;  2VBX A;  1FT9 A;  2FRH A;  2ADU A;  4D0P A;  1U5T B;  5K5R A;  3QPH A;  5J8F A;  4AWX B;  4KA4 A;  5TJJ A;  5F64 A;  2FML A;  5ICE A;  1HKT A;  3E6M A;  3I59 B;  5ERI A;  2CWE A;  3ZMD A;  3LQQ A;  3CUQ B;  2Z9O A;  3ZMU A;  1OMI A;  3P9C A;  3Q9V A;  2HS5 A;  3FMR A;  1BM9 A;  1ZG3 A;  3R0A A;  4XSZ F;  1GXP A;  2DTR A;  5BPI A;  4ASN A;  3KP2 A;  3QPT A;  2QYO A;  3Q5F A;  3BP8 A;  4XLP F;  1HKS A;  4IRG A;  4LK0 F;  2CQK A;  5HS8 A;  1G3W A;  2HYF A;  4A6E A;  2K86 A;  1R58 A;  2Z99 A;  4OU0 A;  1UHM A;  4HLX A;  1UHW A;  3F3X A;  2XAG A;  3KCC A;  2OQG A;  2KIU A;  3GO5 A;  5A2Q Z;  4LD5 A;  3JAM Z;  1XSV A;  5D6E A;  5F1R A;  3IRQ A;  2HTJ A;  5LHI A;  1STZ A;  3BWG A;  1XMK A;  2M30 A;  1Y0U A;  2EK5 A;  1TTY A;  1MD0 A;  1P6R A;  1LDJ A;  3E6B A;  1Z9C A;  4I01 A;  2HWV A;  2OA4 A;  1W5T A;  4Z2Y A;  3FMQ A;  3SZT A;  2P7V B;  2RKH A;  3WGG A;  1LQ1 A;  2HZT A;  1BI3 A;  2HYG D;  1ZG1 A;  6PAX A;  2VT3 A;  5LRS A;  3M9A A;  3FF5 A;  3U2R A;  1P2F A;  3RPQ A;  4LLG F;  3WTW C;  3J80 Z;  4HX7 A;  4P5O A;  1KGS A;  2F2E A;  3E3V A;  4GGG A;  2BGC A;  3U9G A;  4KN4 X;  5LEK A;  1HW2 A;  4P96 A;  4YII A;  2A69 F;  2UXN A;  2O61 A;  2KKO A;  4A2U A;  1PP7 U;  5ICC A;  1CF7 A;  4OMY A;  1DUX C;  3D5L A;  3GFI A;  4H0E A;  4E70 A;  3GX4 X;  2FMY A;  4ETS A;  3HYI A;  4K2E A;  4G7Z F;  3M8E A;  1KA8 A;  2Z3Y A;  2RVC A;  4I2O A;  1IN7 A;  1UCR A;  2Y48 A;  4LG0 B;  4RAZ A;  2ZME B;  1FWZ A;  1G6N A;  2P4W A;  4Q48 A;  3K1P A;  1FX7 A;  2HGC A;  2ISZ A;  2ESH A;  3DV8 A;  3WU0 A;  4OIR F;  1WSU A;  5DUI A;  1YW9 A;  4CHU A;  1TLH B;  2LNB A;  4RGR A;  3LAP A;  5D5V B;  2PBI A;  3COA C;  3MEX A;  5JR3 A;  4JQF A;  3WTT C;  1LVA A;  1OPC A;  4FX4 A;  1BIA A;  2L4A A;  4YFN F;  4ZZL A;  1W5S A;  2BEO A;  1MKM A;  4UHT A;  1XCV A;  2K7L A;  5DV5 A;  5HDK A;  3ROU A;  2UXX A;  2O6G E;  1E17 A;  4L9V A;  1R00 A;  1XGN A;  1JHF A;  3GFJ A;  2PN6 A;  3Q9S A;  3T8T A;  4WXC A;  2F5C A;  4HV6 A;  4U7B A;  3BJO A;  2DQR A;  1EH6 A;  5LGT A;  3SFZ A;  3WG9 A;  2V6C A;  1XCB A;  1YO5 C;  2YSR A;  1Q1H A;  4NB5 A;  4OOI A;  1HSJ A;  4EJU A;  2DW4 A;  4HOB A;  3TO9 A;  3GLX A;  3JTG A;  4ENN A;  2EA4 A;  3WTV C;  2HEO A;  2PEX A;  1OKR A;  3BDD A;  5E8G A;  1GXQ A;  4WCG A;  2W85 A;  1B6A A;  1SD4 A;  1UFM A;  1R36 A;  4A12 A;  2F5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...