2RQPA

The solution structure of heterochromatin protein 1-binding protein 74 histone h1 like domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
GPGMASSPRPKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Heterochromatin protein 1-binding protein 3
publication title The middle region of an HP1-binding protein, HP1-BP74, associates with linker DNA at the entry/exit site of nucleosomal DNA
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rqpA00
4JK1X 1RUNA 3NRVA 1KU9A 1YW7A 3F23A 2QVOA 3CJNA 4KT5C 4UNOA 2M1BA 5DCMB 3TQNA 4BYYA 5LGNA 4WK8F 2K4BA 1XMKA 1TQIA 3DV8A 3V8LA 4A6EA 1HBXG 2HKXA 4M9XA 2HTSA 1MD0A 3HRTA 2V79A 4HOBA 2KRFA 1LDJA 3ISPA 1U8RA 4LLNA 3GW2A 1IXRC 5F1RA 1I5ZA 2NNNA 2PN6A 1GXPA 1U5TA 3T8RA 3F8MA 4PCQA 5D6FA 1LNWA 4ASNA 1UB9A 5LLQA 4EQQA 2C6YA 1FOKA 1W5TA 2XAHA 4DNCA 2PMHA 3J80Z 2QENA 4RAYA 2DU9A 4AIHA 4BQAA 1J75A 5L3BA 1G4DA 3WGHA 5DUKA 1UHWA 4EJUA 1BOAA 2IP2A 1SD6A 1EH8A 1B1BA 3MZYA 3WTZA 2ZMEB 1IZ1A 4L9JA 3GFJA 2MLGA 3F6VA 2NAZA 1AOYA 2R7DA 2HYGD 3M9AA 4KNYA 4O3MA 4LLLA 5ICEA 3FM5A 3AAFA 2V1UA 1FNNA 3ERED 3CUQA 3TOAA 2VODA 4E70A 1JHFA 5HOOA 1HSTA 1IRGA 1PDNC 2G9WA 5D5UB 3FMQA 2JZYA 1KYWA 4MQ9F 4ENKA 1FZPB 3F8CA 3HHGA 4IRHA 4NQWA 3F8NA 3PQKA 4Q47A 4P9UA 1ZHFA 4LG0B 4U0WA 4R1HA 5LBQA 2VBZA 1TQMA 1IUYA 4EV0A 2FU4A 2ZJ2A 3ZPLA 1C0WA 1ZRCA 4ZH4F 2Q2EA 3BJOA 5D8LB 2H6CA 4ZYDA 1R00A 2A07F 1I6XA 4LLGF 1P6RA 3QRFF 4NHJA 1O57A 2DLLA 5IT9Z 2X0LA 4BHBA 1B9MA 1HKSA 5DUIA 4YIIA 3V7SA 3V7RA 3WU1B 1XD7A 4GGGA 2L4AA 2JSCA 1XSVA 2FMLA 5FLXZ 2EFWA 1BC8C 5L3DA 2B0LA 1TW2A 1QGPA 3LWFA 4EJTA 1IRFA 1WSUA 1FX7A 2GXBA 3RDIA 3D0SA 3T8TA 5D8KB 3QU6A 3KETA 2IVMA 4ESBA 1ZLJA 5FD6A 1RI7A 2OA4A 1A04A 1BIBA 3QP6A 1KU7A 2QM3A 2RVCA 4L5IA 1FWZA 2F2EA 1F1ZA 1U2WA 1K7AA 5LGTA 2L01A 1W5SA 4WXCA 3HIFA 3GYHX 1ZYRF 5K5QA 3BP8A 1F9NA 2QQ9A 2HYFA 3Q9VA 4I98B 4BNCA 1QBJA 1B6AA 5ILSA 4QLCU 4H0EA 3RKWA 3F6OA 2P8TA 2VN2A 2CWEA 3DF8A 2PLYA 4ZZDA 1JHHA 1VTNC 2EFNA 2OZ6A 1HXDA 2LKPA 4OU0A 3N4MA 4HW0A 1KU2A 4OIPF 1WKMA 4I0BA 4R79A 3KP2A 1LJ9A 1P4AA 2DO7A 2HGCA 1QPMA 1SMTA 2K4JA 1YW9A 3E5QA 3RKYA 1Z6TA 3HOTA 3F22A 3SHFA 1RUOA 4OIOF 3C7JA 1YS6A 1IN4A 1IN7A 2H09A 3I5UA 5FO5A 5K5OA 4AWXB 1AWCA 2QBYA 4OINF 3J80K 4IPAA 1IXCA 2F5FA 3M8FA 2ZBKA 1W7PB 2XIGA 4PDKA 4WXDA 1K78A 2RQPA 1SFXA 3ML6A 2LF7A 3B02A 3WODF 3DEUA 1MJAA 3RTRA 1NHAA 1EH7A 1MDMA 1XN7A 3QU3A 4RB2C 3I71A 5JHUA 4XSZF 3FM3A 2IPQX 4OOIA 5DV5A 3E3VA 1BI3A 4UV9A 2YX7A 3CTAA 3MCZA 5E1WA 1DPUA 2K86A 3MFKA 1SMYF 3ZN1A 4G7HF 3QP5A 3QOPA 1WRJA 3BJAA 2IRFG 2HZTA 5J6XA 4LB5A 1BBYA 1YW8A 5F64A 1HW5A 4WX9A 2RNJA 2DPUA 3LAJA 4KFCA 4HF0A 1LDKB 1JE8A 1ZG3A 4XRFA 2UXNA 3ROUA 4FX4A 3GFMA 1H9TA 4EM2A 5D5VB 5HS8A 2QLZA 3ZMDA 3J81Z 1FP2A 1IW7F 3COAC 3BPXA 3L09A 6PAXA 3F8FA 1YIOA 5BQTA 5D5WB 4LK0F 1FLIA 1I1GA 4MQVA 1E2XA 1XGNA 3DQVC 5LEKA 5IT9K 2A5YB 1UFMA 2XHKA 4KUMA 4UVCA 2DW4A 3LA2A 5FLXK 3IRRA 2VT2A 4MEXF 1T39A 2WV0A 1L0OC 2E7WA 4B8XA 2ETHA 4G7OF 3DXJF 2JTVA 1R5HA 3EYYA 4A2UA 1P2FA 3I0TA 1EV7A 3WTTC 3K1NA 3HTUA 2ZFWA 1OPCA 4EGYA 2GAUA 4U88A 4M74A 1FBUA 4HZFA 1BJAA 2PFBA 1GHCA 3ZN0A 5D4SA 5FGMA 1IXSB 1CF7A 2XROA 4ENMA 4A5MA 2G7UA 4LD5A 4G6DA 3V7CA 3L00A 4A6DA 1USTA 4GYGA 1J7KA 2GXGA 3IC7A 1W7PD 1F5TA 3ZMZA 3F72A 1XGOA 2Z99A 1HW1A 2OAZA 2CQKA 2ISZA 3F21A 5D4RA 1Y0UA 5FD5A 5AIQA 3IWZA 3RIRA 5KK1A 4A0YA 2O6GE 2RV8A 1G6NA 4O5VA 3TO6A 2D1VA 3FXUA 2DK5A 5DCMA 2Y75A 1SFEA 4HDVA 5D5XB 4BXUA 1Z05A 2Z33A 1MZBA 3S2WA 5J8FA 2IA2A 2EWNA 4JBAA 2UXXA 4CDGA 1QQIA 5HVQC 3TOBA 2HEOA 2HDCA 3F8BA 4Y17A 2V6CA 1MKMA 4AIJA 1W4MA 4YIFA 4P9FA 1S8NA 5ED4A 4M72A 1KQ8A 2MLKA 5J8CA 3KP6A 4OIRF 4BHCA 1FSHA 2IT0A 4RB3C 1DDNA 1E17A 4I09A 4PZJA 3GO5A 2WTEA 4L9TA 2H6BA 5E17F 1B9NA 3BROA 2FF4A 1DP7P 3E97A 2J5OA 1ULYA 1R7JA 1O3RA 4HF2A 4P96A 2DT5A 4N9HA 2CG4A 2ZMEA 5L3FA 1IN5A 5JVTA 1LEAA 5FB2A 4N0BA 1R58A 3J81K 1IN8A 3I64A 3HOSA 2VBWA 1RNLA 2CGPA 1R5GA 2W84A 2P7CB 3T0YA 3RI4A 3LA7A 1MJ9A 1USSA 4HAMA 3WU0A 4U7BA 4KYWA 4EJVA 3K69A 4S04A 2O03A 1ZGJA 4BHPA 3MWMA 2BEOA 5CVVA 1PUEE 3BOQA 5JR3A 3WTYC 4LG0A 3I53A 3H3ZA 3JAMK 2VE8A 4Y15A 3QAHA 2H27A 1F4KA 2DTRA 5HS7A 4HLXA 1IAWA 1JXSA 4L9VA 1B59A 2GZWA 2QWWA 4FT8A 3FXRA 3NEUA 4UVAA 2V9VA 2W25A 3GXOA 3E6MA 1XGSA 4L5JA 5DEQA 1ZRFA 3WE2A 4F7ZA 1D5VA 3ULQB 1KYZA 2HKOA 1V4RA 1GXQA 3FZVA 2FEZA 2KIUA 3FXQA 2W24A 2COMA 4LGWA 3R4KA 5CVUA 4LK1F 5E20A 3LA3A 5BPDA 2DK8A 1ZN2A 2XAFA 2NYXA 2IJLA 4EM1A 1TNSA 1UHMA 3IHUA 2CO5A 1J0RA 3L2CA 3P9IA 1B4AA 3LQRA 4I0AA 4ESJA 1TQPA 1D3YA 4LFUA 3RJPA 2ADUA 1TNTA 5HDGA 4XLNF 5BMZA 5H6QA 5FFZA 3K9TA 3JTGA 2QQAA 2L54A 2KIMA 4A12A 3Q5FA 1LVAA 2JPBA 1S6LA 3P9KA 4CHUA 1KA8A 1T0FA 3SFZA 1JGSA 4G9YA 2EA4A 4IXAA 5ICCA 4EVIA 3CO7C 1Z1DA 4BH9A 3JSOA 5AONA 4XBFA 3TDZC 2CW0F 2QQBA 2XGXA 4KICA 5LHIA 3U9GA 2PI0A 4P55A 3ZQ7A 3WGIA 1KQ0A 2MA3A 1P4XA 4S05A 3V8KA 2FBKA 1R1VA 2YR2A 2VT3A 5DYMA 3CO6C 2RDPA 4MHGA 4CYDA 2P5KA 4GXOA 2EFPA 3E5UA 1UCRA 2VXZA 1J59A 4A0ZA 2LSOA 3SZTA 5BS6A 3RYPA 2STWA 3KP3A 2DPDA 4KA4A 1BI2A 3KP5A 5HDKA 1LDDA 3TKYA 5HLHA 3OOPA 4RB0A 1O7LA 4RGSA 1LQ1A 4Y13A 3FF5A 5BPIA 2MH9A 4CGZA 3FHZA 2LNBA 3LFKA 1W7PA 3H3UA 2K27A 1TTYA 1U78A 2MD5A 2OU2A 5LRSA 3HYIA 4XSXF 2A6HF 3K1MA 1U6GA 2V1XA 4HQEA 3L9FA 1PP8F 1G3YA 1P92A 4IHSA 4OMYA 3M1EA 5EEHA 5HLGA 5DD4A 3GF2A 2HTJA 2F5DA 2M45A 2FNAA 2BYVE 2RKHA 2Z5UA 1OMIA 4KN4X 1S7AA 5DCFA 2OQGA 4KN7X 4A0XA 3BWGA 2OBPA 2JRTA 3GEZA 4O6JA 2ESHA 4YFXF 5H6RA 5ERIA 1OYWA 2FSWA 3BJ6A 3BZ6A 4HX8A 1OKRA 2VBXA 2ESNA 1YG2A 3GFIA 1OYYA 4U7DA 1I1SA 2XAJA 2P5LC 1XB4A 1ZLKA 4I7HA 1FYKA 3G73A 1ZG1A 3O3KA 1Z6RA 2VC0A 1QZYA 4OIQF 5TJJA 4ENNA 4L0ZB 2YPRA 2AXLA 1FYLA 2DAOA 3TO9A 2BBYA 3TDUC 3GX4X 4IVNA 2FBHA 2HQNA 3ELKA 3JAMZ 4EM0B 3E5XA 5CVJA 4QWQA 2O8XA 3R60A 3GUDA 2UZKA 5LRRA 4GCVA 4P5OA 3H92A 1K6OA 3ECHA 3MAJA 3ABUA 1XSDA 4UUVA 3C1DA 2UWMA 2O61A 3IKTA 4G94A 2AS5F 3SZPA 4YFNF 4M9ZA 1ON1A 1QO0D 2ZNYA 1REPC 4ON0A 3ZMVA 1U5TC 2DQLA 1TBXA 3GZ6A 2GQQA 3I59A 4DQ2A 1K79A 1MGTA 1FYMA 3M8EA 4GO1A 3ABTA 3RYRA 2HS5A 3WTSC 2GIVA 1I27A 5JI6A 2DI3A 5LHGA 4KIGA 4Q48A 2A61A 2ZO4A 2OD5A 3SXYA 2MBFA 5D6EA 3ZMSA 4D0PA 2HR3A 2P6SA 4HX4A 1FC3A 2FA5A 1WI9A 4IRGA 1R36A 1HKQA 2NNYA 3VFZA 1T98A 3KZYA 2QZ8A 3DKWA 1XDSA 2VBYA 3CUQC 3V4GA 3I4PA 5CLSA 1L3LA 5L3CA 1YTYA 2PG4A 4HX7A 3M7GA 3I58A 2P6TA 2YU3A 3LAPA 3IWFA 4UHTA 2VC1A 2G7HA 3KEQA 4HDUA 5KVRA 2HQRA 1O7FA 1FSEA 3MEXA 4WWCA 1ZREA 5L3GA 4M9SA 5HLIA 4CZZA 3IL2A 1S3JA 3EUHA 3L7WA 4G6QA 1SD4A 5DDGA 4L9NA 4ESFA 4RAZA 1KGSA 2XV4S 4UVBA 3QPTA 1XSXA 2IA1A 1U5TB 1IN6A 2LF8A 1X3UA 3U2RA 4K2EA 4NB5A 4Z2YA 3D5LA 1BIAA 3R61A 4AVPA 1YYVA 5E1XA 2R3SA 3KZZA 3EYIA 3GVAA 5BOXA 2E1NA 5HDNA 4EJOA 2XUBA 3WG9A 2EK5A 1FP1D 5E8GA 2FNPA 2JPCA 1FBSA 3TO7A 4MTDA 1U3EM 1T38A 4KDPA 2NS0A 3WTVC 4BAYA 2YSRA 4LMYA 1QZZA 1SD5A 5L3EA 2E7XA 3KCCA 4EJWA 3GFLA 4B09A 5EEGA 4M73A 1O3TA 3I54A 3IRQA 4AD9A 2FRHA 3ECOA 1G3WA 3ZP5A 3CUQB 3HRUA 2KJCA 4RGUA 1BI0A 1FBQA 3PFIA 2RC4A 3CUOA 2ZCWA 2GA2A 4YG2F 2XRNA 2BGCA 5LEJA 2R7FA 2XVCA 3HSFA 3EQLF 3CDHA 2DFIA 3V8JA 3G3ZA 3GLXA 1IF1A 2Z9OA 3U1DA 3Q9SA 3DPLC 4N9IA 3R0JA 2K02A 2DBBA 4M6XA 2YX4A 3KLNA 1R1UA 2EJRA 3VB2A 2XAGA 2GWRA 1H9GA 3R6SA 3JW4A 2PMUA 3QPHA 2EV5A 2FMYA 3P7NA 3HRMA 2BE5F 2W57A 2M30A 3WTWC 4HYEA 2KKOA 1P4WA 2O0YA 2XAQA 4Q4ZF 2RGVA 1D8JA 2F5CA 3NQOA 3WE3A 4HV6A 4L0YB 3BDDA 1ZG5A 2P4WA 2ACJA 4A5NA 4KIBA 4PGHA 2K7LA 2V1DA 1STZA 2ZNZA 3HRSA 3K1PA 3E6DA 1O3QA 5F6FA 3ZMUA 3K2ZA 3W6JB 3DP7A 4L18B 1MJBA 1DUXC 4I01A 1RIOH 4KIFA 5CYVA 2W85A 4G8XA 2P5VA 4AIKA 5CVIA 4HF1A 3RPUA 3MQ0A 4G7ZF 1ODDA 4EMSA 2VOOA 3EETA 1LEBA 2VOPA 3FX3A 1WWXA 3KP7A 1Z9CA 2ZKZA 1G3SA 2TDXA 3JSPA 2X4HA 1HKTA 2A69F 5K1YA 2PEXA 2Z3YA 1R22A 3HHHA 2EFOA 1LB2A 2ISYA 2STTA 2Q8KA 3N97A 2Y0MA 4HA8A 2Y48A 4ZYHA 5LHHA 3KLOA 2D2WA 2A3SA 3C18A 2M87A 1Z91A 2D1HA 1ON2A 2M5WA 3E6BA 1SFUA 2QUFA 1RZ4A 2PBIA 4WCGA 3FMSA 1Q1HA 3OV8A 1T2KA 2HWVA 3HSRA 5CVRA 4I2OA 4ENJA 3PQJA 4WXHA 2H94A 4LB6B 1YQAA 5ILUA 2HFHA 1QNTA 5A2QZ 1XMAA 5IT3A 3VOEA 1S29A 2MH2A 4HQMA 1BI1A 4I02A 4U0VA 3HSEA 2EFQA 2L3DA 3P9CA 2EV0A 3MZHA 3B73A 1T6SA 3KP4A 2VE9A 3C3WA 4ZZLA 2L02A 4XLPF 3BPVA 1J9IA 5E1ZB 3GWZA 1BM9A 5CJ9A 4GYIA 1KU3A 5AIPA 4MEYF 2IA0A 3CLOA 2LDUA 3DFGA 2O3FA 2OQRA 2QBYB 1XDUA 4HLYA 1O3SA 3BY6A 1YLFA 2FOKA 1BC7C 2CSOA 4KMFA 2VONA 3O6BB 4KMUX 3F3XA 1K78B 2KJBA 5JFRA 4ZYEA 1ZRDA 3ZMTA 2F5EA 2WWYA 1OYIA 3HUGA 1R1TA 5ICGA 4MNUA 4RGXA 4TV7A 1MDMB 3RKXA 1HSJA 4RGRA 3DPTA 3REOA 1TLHB 1XCVA 1J2XA 4R8HA 5HS9A 2EV6A 3IKVA 1R23A 4FHTA 3EDPA 2L4MA 1FY7A 1YO5C 1BN5A 1J5YA 4MGRA 4IRIA 4ETSA 2E1CA 1YS7A 4CXFA 2CFXA 3VODA 2OZUA 5ILVA 4IF4A 4UXNA 1ZARA 4IHTA 3JTHA 2A68F 1XGMA 3WTUC 4HBLA 2MC3A 3GZ5A 1HW2A 2GA1A 3LQQA 2XASA 1WQ2A 2HOEA 3VEPA 2XKPA 1D8KA 4MTEA 2QYOA 1ZH5A 1ZGAA 2A6EF 2P7VB 2DQRA 2EA2A 2BV6A 1TW3A 2KIFA 1V3FA 1CGPA 2FE3A 2PJPA 5H20A 4FX0A 1PP7U 1FT9A 1YFHA 1ZAOA 2ZXJA 1SAXA 1GVJA 2CYYA 4M71A 3W6KB 5TRDA 1G3TA 1SD7A 2RN7A 3T1BA 1KQ9A 5ICFA 4UV8A 1H0MA 4M6YA 2J5PA 1XCBA 1Z7UA 1HQCA 3I59B 3K0LA 4U0YA 3FWEA 3WTXC 2D45A 1EH6A 4RS8A 5FFXA 3WGGA 4YFKF 2FXAA 3E6CC 1DPRA 4ZYGA 2Q0OA 4EGZA 2WC2A 3R0AA 2IW5A 2M8EA 3LSTA 1CF7B 4PGGA 3TGNA 3O2PE 2PQ8A 4LJZF 3KEOA 4CO8A 3HTSB 3J7AO 4Q5SF 4OMZA 2FBIA 1S7OA 2EB7A 4JQFA 2XKOA 5E18F 5A2QK 5LGUA 4CICA 3KFWX 3SQNA 4IJAA 3FMRA 1OR7A 4RB1A 3KE2A 4WF2A 5K5RA 2FQ3A 2JT1A 5E8IA 2NRAC 2ELHA 4HV5A 3RPQA 1ONVA 3T5XA 5DD8A 1FPQA
chains in the Genus database with same CATH superfamily
4JK1X 1RUNA 3NRVA 1KU9A 1YW7A 2NOJB 3F23A 2QVOA 3CJNA 4KT5C 4UNOA 2GIZA 3QYFA 2Y0SA 2M1BA 4RM2A 5DCMB 1VQ7I 3TQNA 2K3PA 1Z67A 1VZ0A 4IQ4A 4B44A 2EIJH 3BTJA 4BYYA 3U21A 1DGRM 5LGNA 5EEAA 4M3DA 2DMNA 4WK8F 2K4BA 1XMKA 3GZNB 3KYDB 1AKHA 1TQIA 3DV8A 1QA6A 1QHGA 1X58A 3V8LA 4A6EA 3OR2C 4HNVA 3RQ4A 1HBXG 2HKXA 4M9XA 1TZLA 1X2MA 2HTSA 1MD0A 3E7LA 2L9VA 2DT6A 3HRTA 2L0KA 2V79A 3HC7A 4HOBA 2KRFA 1LDJA 3ISPA 1U8RA 4LLNA 4A3CJ 3GW2A 2N8GA 1N25A 1IXRC 3ABLH 3CCSI 5F1RA 1I5ZA 2NNNA 2PN6A 4RAFA 1GXPA 1U5TA 3T8RA 3ZQFA 4F3QA 3Q0WA 3F8MA 4PCQA 5D6FA 5FKOA 2HPMA 1TWGJ 3LL7A 1LNWA 4ASNA 2VI6A 4PFPA 2VPLA 1UB9A 3D5SC 5LLQA 3OYAA 4XKVA 4EQQA 2C6YA 2ZXWH 2EIMH 2OCCH 1W5TA 2XAHA 4DNCA 1FOKA 3KIOA 2PMHA 3SEZA 1JKRC 3ZQIA 1RC9A 1TT5B 3J80Z 3HPGA 2H1KA 2QENA 4RAYA 4BJ5C 3TW6A 2DU9A 2Z16A 2AXTC 4AIHA 4BQAA 1IJWC 3LNQA 2M7AA 1MMSA 2OF7A 3WG7H 5L3BA 1J75A 4I76A 4IEJA 1G4DA 3MKYB 3WGHA 1A6QA 5DUKA 3W2WA 1UHWA 1VQ5I 4EJUA 1BOAA 4CCNA 2IP2A 4P1WA 2ELKA 3UR3C 1WJFA 1SD6A 1EH8A 1B1BA 3HGYA 3MZYA 5EZGA 2ZMEB 3WTZA 1IZ1A 4L9JA 3IUOA 3GFJA 2MLGA 3F6VA 3JCUC 2KPMA 1MSFC 2NAZA 2NVQJ 1AOYA 2R7DA 2BY2A 2HYGD 3M9AA 2QQ8A 4G12A 4KNYA 4O3MA 4LLLA 5ICEA 4XLFA 3FM5A 3JRCA 1DU6A 4H4KC 3AAFA 2OUMA 3ABMH 2R5ZA 1IDYA 2V1UA 2F4OB 1FTZA 1FNNA 1HOMA 2F48A 3ERED 3CUQA 3TOAA 1ETWA 2V6EA 2VODA 2NVUB 4E70A 5F0FA 1RR8C 1JHFA 2HYJA 5HOOA 1HSTA 3S17J 3M8JA 1IRGA 2E2JJ 4ZC3A 2W00A 5KNLA 1PDNC 1S5LC 2G9WA 3LSKA 1R71A 5D5UB 3FMQA 2JZYA 1KYWA 4MQ9F 5DS9A 4ENKA 1FZPB 3F8CA 3HHGA 4IRHA 3PIPF 3MKLA 4NQWA 4C3JJ 2D5VA 3F8NA 3PQKA 1ZR4A 3GMEA 4Q47A 4P9UA 3S2DJ 3I3LA 1APLC 2R4GA 1WJCA 3GTMJ 1JTXA 1ZHFA 1ETKA 2CUJA 4LG0B 1LFBA 4II2A 4U0WA 4R1HA 5LBQA 1WJBA 5EG0A 2VBZA 1XTAA 1TQMA 3RSNA 1IUYA 1B72B 4EV0A 1D0ZA 1LE8B 2FU4A 2P81A 2ZJ2A 3ZPLA 1H89C 1C0WA 1A36A 2LRDA 1ZRCA 4ZH4F 2FOWA 1QPIA 4A3LJ 3LSMA 2Q2EA 3K4LA 3BJOA 5D8LB 2H6CA 4GFBA 5LFAA 2IGKA 3DLAA 4ZYDA 1N75A 1R00A 2A07F 1I6XA 3MKZA 2QF7A 4LLGF 4A3BJ 1P6RA 3VSKA 3QRFF 2VKEA 4F52A 2Q1ZB 2MC4A 3CJQB 4NHJA 1O57A 2KL4A 1TL8A 2DLLA 5IT9Z 2X0LA 4BHBA 4XM3A 4IHYA 1B9MA 3FIWA 1HKSA 5DUIA 1Y1WJ 5CQGA 4YIIA 3V7SA 3JRHA 1VQNI 3V7RA 2DFFA 3WU1B 1XD7A 4GGGA 3L2VA 1V54H 2L4AA 4AU7A 4D7MA 2JSCA 1XSVA 1E3PA 1SEUA 2FMLA 2LP0A 1UMQA 5FLXZ 2EFWA 2DODA 3IH4A 4Y33A 1BC8C 2PX9A 5L3DA 3K4MA 1I39A 2B0LA 1TW2A 2LC2A 1QGPA 3LWFA 4EJTA 1IRFA 1WSUA 3MKWB 1FX7A 3OYMA 4DBRA 3RDIA 2GXBA 3QOEA 4YEJA 3D0SA 3K70D 4OAYA 3BZCA 3T8TA 1G59A 5D8KB 2BY0A 3AKZA 3QU6A 3KETA 2IVMA 4ESBA 1ZLJA 5FD6A 1RI7A 2OA4A 1RRJA 4FASD 3SYTA 2EQRA 1A04A 3L2UA 1BIBA 1FMWA 3Q0UA 3QP6A 1MBHA 2IGNA 4FE4A 2QM3A 1KU7A 3DBHB 3CCUI 2EILH 2RVCA 4L5IA 1FWZA 1GUUA 2OJED 4LOCA 3AG4H 3F0CA 2F2EA 3HKZN 3OYIA 4XL9A 1F1ZA 4C9YA 2DMPA 2K9SA 3W2AA 1X1BA 1U2WA 1K7AA 5LGTA 1VQKI 2L01A 1W5SA 2IGOA 4AM3A 4WXCA 3JRDA 3HIFA 3GYHX 2TCTA 3J7ZI 1ZYRF 5K5QA 3BP8A 3S1QJ 1S7EA 1T08B 2O9LA 1GVDA 1F9NA 5HNFA 2CRGA 3Q3SA 1SVLA 2QQ9A 3TW7A 1RKTA 3QQAA 2HYFA 5DTDA 3Q9VA 1ETQA 1ENHA 3QYEA 4BEHA 4I98B 4BNCA 1QBJA 1B6AA 5ILSA 4QLCU 5F0CA 5IP6A 4H0EA 3RKWA 3F6OA 4CSWA 1T56A 4CCMA 2P8TA 2VN2A 2JWTA 4FETA 2HXOA 2CWEA 4XICA 3DF8A 2ZB9A 1NK3P 3NAUA 2HDWA 2R7QA 3FXLA 3HG9A 2PLYA 4ZZDA 3IAS2 5EF6A 1JHHA 4S0HB 3H3VK 1VTNC 2EFNA 2L9NA 2OZ6A 1HXDA 2VJIA 2LKPA 3PO3J 4OU0A 3N4MA 4HW0A 2L2OA 3OL4A 1KU2A 3DEWA 3PJRA 2E36A 1WKMA 4OIPF 2IXSA 5J4YA 5TISC 4I0BA 4R79A 5FJ8J 2LYCA 3KP2A 1LJ9A 1P4AA 2DO7A 1TWCJ 2DTZA 2WB1N 3L2RA 2HGCA 1QPMA 1SMTA 4U87A 2K4JA 1YW9A 3E5QA 3RKYA 1Z6TA 2CQQA 3HOTA 2BZTA 3CJRB 3F22A 3SHFA 1RUOA 4OIOF 3C7JA 5J1UA 1YS6A 1I3AA 3CP2A 2BY1A 1IN4A 1IN7A 4CCOA 2H09A 1BJZA 4YELA 3I5UA 3D5RC 5FO5A 4RBOA 5K5OA 4BJ6C 5M5XJ 4AWXB 1AWCA 2KIQA 2QBYA 4A3IJ 4OINF 3J80K 2IBDA 4IPAA 1IXCA 4IQJA 3ASNH 2F5FA 3M8FA 2ZBKA 4JX5A 1W7PB 2XIGA 1W1WE 2V26A 4PDKA 4WXDA 1K78A 2X85A 2K9NA 4AUXA 2RQPA 1PUFB 1SFXA 2JK3A 3ML6A 2LF7A 2WY7Q 4XKCA 4E6KG 3M4OJ 3B02A 3WODF 3DEUA 1MJAA 3RTRA 1OCZH 5J1RA 1NHAA 2R5YA 1EH7A 2E35A 1XN7A 1MDMA 3QU3A 4RB2C 2LR8A 2JJ7A 3I71A 5JHUA 4BXXJ 4XSZF 3FM3A 2IPQX 1VQ9I 5IOZA 4DZPA 2LKXA 4LG3A 4OOIA 5DV5A 2R7ZJ 2XB5A 3E3VA 4E7ZA 1BI3A 2VXDA 4KISA 4UV9A 4B4CA 2YX7A 2FQ4A 3CTAA 5B66C 3MCZA 3MMYB 4MLOA 2K86A 5E1WA 2DXIA 1DPUA 4YIRX 3MFKA 1SMYF 1JUMA 3ZN1A 2LMDA 4G7HF 3QP5A 1U9NA 3QOPA 1WRJA 3KEYA 3BJAA 5IP7J 3BTLA 2IRFG 2GM4A 2HZTA 5CQEA 5J6XA 2F5VA 1WJDA 4LB5A 1FMVA 1BBYA 1YW8A 5F64A 3G1MA 5J1YA 1HW5A 4WX9A 4BU2A 2RNJA 2DPUA 3LAJA 2E5ZA 4HF0A 4KFCA 3BR1A 4PUSA 1LDKB 1JE8A 2XSDC 1ZG3A 2F6CA 4BUPA 4XRFA 3H9GA 2UXNA 3ROUA 4FX4A 3CCYA 2BW3A 2W7NA 3GFMA 4A3DJ 2EBIA 1H9TA 2KT0A 1GV5A 1RPWA 4EM2A 4E4HA 5D5VB 5HS8A 2QLZA 5GTIC 3ZMDA 3J81Z 1FP2A 1IW7F 3COAC 3BPXA 5J47A 4HPQA 3CC4I 2ECCA 4BE2A 2KLOA 3L09A 1OR7C 2M34A 6PAXA 3F8FA 1YIOA 3ZXSA 5BQTA 5D5WB 2EH3A 4LK0F 3K4NA 1FLIA 2EZIA 2CU7A 1I1GA 5EDNA 4UY8I 4MQVA 5JLWA 1E2XA 1XGNA 2MG4A 1MBJA 4BL0B 5E3NA 4CYCA 3DQVC 1UELB 2Y9YA 5LEKA 1Y39A 2LH9A 5IT9K 4BDYA 2IS2A 5EGOA 2A5YB 1VQOI 3L2QA 1UFMA 1HLVA 2I8DA 2XHKA 2E34A 4KUMA 3A02A 1YOVB 2BHZA 3OYEA 4UVCA 1D5YA 4E7HA 2DW4A 3CCRI 3LA2A 5FLXK 3IRRA 5KCMA 2KISA 3AG3H 2VT2A 2AO9A 4MEXF 1T39A 2WV0A 1L0OC 2E7WA 4B8XA 2ETHA 2M0CA 2VUMJ 5C4XJ 5F04A 3SDGA 4C3IJ 3S3MA 1MNMC 3W3CA 4G7OF 3DXJF 2FD5A 2JTVA 4M3EA 4CCKA 1DGWY 1R5HA 3JRAA 1FIAA 3EYYA 4A2UA 1P2FA 2ID3A 3M3YJ 3I0TA 1EV7A 2X6YA 3WTTC 3L2WA 1MIJA 3K1NA 4N4OB 3HTUA 2ZFWA 3EUAA 1K4TA 1OPCA 3TL4X 2A05A 3DBRB 4EGYA 2X6XA 2GAUA 4U88A 1NTCA 4M74A 4V2FA 4E7KA 3K4BA 1JKQC 1FBUA 2V4JC 2LBFA 4HZFA 1R4MB 1RKWA 5KAIC 1FOXA 3TBIA 3W6VA 1BJAA 3O8GA 4MFEA 2PFBA 1GHCA 3ZN0A 5D4SA 5FGMA 1EJ9A 4HRIA 2DYRH 3IH2A 5IPAA 3G71I 2E19A 1IXSB 1CF7A 1VQLI 2VQCA 2XROA 3HEFA 4ENMA 2L7MP 4A5MA 4GDFA 3LSHA 1ORKA 1Z3YA 1FTTA 2G7UA 4LD5A 2X1CA 4G6DA 4XOPA 2XF7A 2JN6A 2GOMA 3V7CA 2Y0SN 3L00A 4DIQA 3QODA 3MZ8A 4A6DA 1USTA 1YHQI 3GTJJ 4GYGA 3PNYA 1J7KA 1Z77A 1HCRA 2GXGA 1Y8RB 2KZVA 3IC7A 1W7PD 1F5TA 2GLOA 2CUFA 3BG7A 2A5WA 3ZMZA 3F72A 2PJRA 4A93J 1XGOA 3BCBA 2Z99A 1MSEC 1HW1A 4ABZA 3S1RJ 2OAZA 2CQKA 4BACA 3FISA 2ISZA 3F21A 4FE7A 5D4RA 3BG6A 1TWAJ 1KONA 1Y0UA 1VQ8I 5FD5A 5C3EJ 5AIQA 2R7TA 1UAAA 3IWZA 2QKLB 4DYQA 3RIRA 5KK1A 4NNJA 3KYCB 3OSFA 4A0YA 2QGUA 4F91B 2O6GE 2BXYA 3HGGA 4B3XA 2RV8A 1G6NA 4PK4A 2CUZA 4UB8C 3CMEI 3MD2A 4RM3A 4O5VA 3TO6A 2D1VA 2A6TA 4ZYAA 3FXUA 2DK5A 4XNFA 5DCMA 2Y75A 2HDDA 1SFEA 4PJNA 3GTKJ 2VQHA 4AYBA 2R7UA 4HDVA 2W48A 5D5XB 4BXUA 1Z05A 2RNGA 2Z33A 3LMMA 1SC7A 1MZBA 2DA4A 3S8PA 3S2WA 5J8FA 1UJ8A 2IGMA 5HODA 3S1MJ 2IA2A 2B63J 4M3GA 2EWNA 5C4JJ 4JBAA 5M5YJ 1B8IB 2DCEA 2UXXA 4PSWA 4CDGA 2E1MB 1QQIA 3TEDA 4J01A 5M3FJ 5HVQC 5GP9A 1AU7A 3TOBA 2Y9ZA 2HEOA 1UG0A 3F8BA 2HDCA 4Y17A 4PSXA 1Y8QB 2V6CA 4RA2A 4D7NA 1N78A 3HZJA 1WFXA 4X6AJ 1MKMA 1ITYA 2HVQA 2L7ZA 4AIJA 2XPWA 1W4MA 2XGDA 4QTRA 4YIFA 3RZOJ 4BBSJ 1R6RA 2CV1A 3SDBA 4P9FA 3ZQQA 1S8NA 5ED4A 4M72A 1KQ8A 4AIDA 1QHHD 2MLKA 5J8CA 2LK2A 4BS9A 5J40A 3KP6A 4OIRF 4BHCA 1FSHA 3K2AA 2IT0A 4FISA 1IG7A 3EPZA 4W1UA 4ZTFA 4RB3C 1VQ4I 1DDNA 1E17A 1CQTA 1D1BA 4I09A 4PZJA 3GO5A 3IV5A 2WTEA 3JRFA 4L9TA 5TGTA 3B6CA 2H6BA 5E17F 1B9NA 2DFHA 3BROA 4XRSG 2FF4A 1DP7P 2BVMA 2R7VA 2KRCA 1G8XA 3E97A 2J5OA 1ULYA 1R7JA 1O3RA 4HF2A 4P96A 1MW7A 2DT5A 4N9HA 2CG4A 5M3MJ 2ZMEA 5L3FA 2WAFA 1IN5A 3VPRA 5JVTA 3S15J 2IAIA 2M7BA 4A3KJ 3AG1H 4IOAF 2FJ1A 2R5ZB 1LEAA 5FB2A 4N0BA 1R58A 3J81K 1IN8A 4E7IA 2NOGA 3I64A 3HOSA 2VBWA 5F27A 2E71A 1RNLA 4RMNA 2CGPA 1R5GA 3QPSA 3BR3A 2W84A 2P7CB 3T0YA 3RI4A 3LA7A 1Y6IA 2JQ7A 2CS3A 4CCLA 3OYDA 1MJ9A 1USSA 3UNGC 1X19A 3J7AY 4HAMA 1K6YA 3WU0A 4U7BA 2LVSA 1IRZA 4KYWA 4EJVA 4JOMA 3K69A 1MMAA 4HG2A 3I4MJ 2V7FA 4D5CA 1MNDA 4S04A 2O03A 1ZGJA 4BHPA 5B1AH 4RLQA 3MWMA 2BEOA 5CVVA 3FXJA 1YRNB 3PFYA 1F36A 2YU9J 2QKMB 1PUEE 1V5EA 2CH0A 3BOQA 5JR3A 3SJMA 3OYGA 3WTYC 4LG0A 3I53A 3H3ZA 2KQRA 3JAMK 2VE8A 4Y15A 3QAHA 2H27A 1F4KA 2DTRA 5HS7A 4HLXA 1IAWA 4IHXA 1JXSA 1W0TA 3PM1A 4L9VA 4MFDA 1LE8A 3BG3A 1B59A 2GZWA 5K7HA 3I4NJ 2QWWA 4FT8A 3FXRA 3NEUA 4UVAA 2V9VA 2W25A 2AQFA 1G2HA 3GXOA 2XPVA 3E6MA 1XGSA 1JUSA 4L5JA 5DEQA 1ZR2A 1ZRFA 3WE2A 4F7ZA 1D5VA 3FBNB 3ULQB 1JJ6C 1U8BA 1KYZA 1FOYA 1TP4A 2HKOA 1V4RA 4XN3A 1GXQA 3FZVA 4CA0A 1JGGA 2FEZA 4PJLA 2KIUA 3FXQA 2W24A 2COMA 4LGWA 2VJ4A 1SVOA 3R4KA 3GTPJ 5CVUA 4LK1F 1FOWA 2W1OA 5E20A 4IZZA 3LA3A 1WJAA 3HXLA 5BPDA 2DK8A 1ZN2A 1VQ6I 2XPUA 2XAFA 2K3FA 1UHSA 2NYXA 2PMZN 4PFOA 3RKQA 4JP0A 3DLLF 2IJLA 1VNDA 4EM1A 3FKJA 1TNSA 3G6EI 2WAQN 4HNUA 4XMYA 3CC7I 2R7SA 1UHMA 3IHUA 3GLLA 1OJLA 3NWSA 3CCLI 4Y4RA 2CO5A 1J0RA 2JUGA 4F92B 3L2CA 3PO2J 3P9IA 1B4AA 3LQRA 4I0AA 1DQUA 5F08A 1XG1A 1LFUP 4ESJA 1TQPA 1D3YA 4BQQA 3TMOA 4I99C 4LFUA 1SFKA 2Y69H 2B7EA 3ASOH 1X4OA 4QPQA 2ADUA 3RJPA 5JHFA 1TNTA 5HDGA 3OYFA 4ZJZA 4XLNF 2VB6A 5BMZA 2CFOA 5H6QA 4ZDPA 5FFZA 3A01B 4BE0A 4C2UA 1BR1A 3OR1C 3K9TA 3TP3A 3JTGA 2QQAA 3BZKA 2L54A 2KIMA 4A12A 1Y56A 3Q5FA 4MIMA 1LVAA 3E1SA 2KHMA 2JPBA 1S6LA 3A4CA 3P9KA 4MO7A 4CHUA 1YX3A 1KA8A 1T0FA 2DA5A 3SFZA 1JGSA 3A2KA 4G9YA 2M0MA 5H2FC 2EA4A 1VF9A 1PJRA 4IXAA 5ICCA 4EVIA 4Y3OA 3CO7C 5C44J 1P7JA 1RR7A 1T95A 4M3FA 4RAGA 1D1AA 3RQIA 1Z1DA 4DW6A 2QSHX 4EEFG 2JVGA 2XRLA 4BH9A 3JSOA 2JSPA 5AONA 1OISA 4XBFA 2R7RA 3HOZJ 2E5NA 2ECBA 3VDXA 3AG2H 3TDZC 3WU2C 2CW0F 2QQBA 2XGXA 4KICA 1T8IA 3OOUA 3VYUB 4XRSA 3QPLA 3OYLA 5LHIA 3JR9A 3U9GA 2O8KA 2PI0A 2VKDA 4P55A 3M1CA 3ZQ7A 3WGIA 1LKXA 1KQ0A 2MA3A 1MBGA 3PNVA 1SVMA 3B6AA 1P4XA 1X2NA 2M4KA 4S05A 3VSLA 3V8KA 1UG2A 2EIKH 2FBKA 4CUGA 4HNTA 1R1VA 3K4JA 1PVEA 2YR2A 2VT3A 5DYMA 3CO6C 2M4GA 2RDPA 1QVTA 4MHGA 4CYDA 3OY9A 3U1KA 3HKZA 2P5KA 4GXOA 2EFPA 2OTLI 1IV6A 3E5UA 3ZQGA 1UCRA 4DJAA 2DMTA 5GADJ 2VXZA 1MMGA 2KP6A 2NS8A 1J59A 5IYBJ 4A0ZA 2LSOA 3SZTA 4RDUA 3IH3A 2K9QA 3HOWJ 5BS6A 3RYPA 2XAUA 2STWA 3KP3A 4W97A 2DPDA 4KA4A 1BI2A 5K7ZA 4M6VA 3H5RA 3KP5A 5HDKA 2DOFA 1LDDA 3TKYA 4B1RA 3ESWB 1OCTC 5HLHA 1Z21A 3OOPA 4L5EA 4RB0A 2MYSA 1WPKA 1O7LA 2VL8A 4RGSA 3BR5A 1LQ1A 2LLKA 2VJ5A 2P0WA 4Y13A 4A3MJ 3HUGB 3LSIA 3FF5A 5BPIA 2MH9A 1OCPA 1R49A 4CGZA 3FHZA 2LNBA 3LFKA 3PUFA 4A3EJ 3CF5F 2RREA 1YI2I 1W7PA 2F4IA 3H3UA 2K27A 3DKXA 1RESA 1ETOA 1TTYA 4D5FA 1U78A 2MD5A 2OU2A 4UB6C 2LKSA 1NG6A 1X1AA 3OL3A 4CCJA 4IHWA 4HEA2 1W5CC 5LRSA 3DBLB 2QA4I 4E7JA 3HYIA 1BOBA 2E1OA 3ZGKA 4XSXF 1VQMI 1QVUA 1R5ID 2A6HF 2HVSA 3K1MA 1U6GA 4Y7NJ 2V1XA 4HQEA 4J19A 4QIWN 3L9FA 1PP8F 2LFBA 3OYJA 1G3YA 1P92A 4IHSA 4OMYA 3M1EA 5EEHA 2DOAA 5HLGA 4D1QA 5DD4A 4ANJA 1TWHJ 3G2BA 1JTYA 3GF2A 2HOSA 3OWTA 2HTJA 3D1NI 3GBGA 2GXAA 1LVKA 2F5DA 2M45A 1D0YA 2FNAA 3ZRGA 1TWFJ 3MN2A 3ZQHA 2BYVE 1QRYA 3FXOA 1HF0A 2RKHA 2Z5UA 1OMIA 1U9OA 1DP3A 4YRVA 4KN4X 4A3JJ 1S7AA 2UV1A 4M3BA 5DCFA 2OQGA 3MVPA 3S14J 3AL0C 2EPFA 3RPUD 4KN7X 4A0XA 2NVTJ 3BWGA 2OBPA 1IC8A 3CDIA 4XN0A 2JRTA 1V55H 3GEZA 1GT0C 4O6JA 2ESHA 3N05A 4YFXF 1YJ9I 4X1EA 5H6RA 5ERIA 2FX0A 1OYWA 4C3HJ 1YIJI 2EZKA 5JLXA 3CCVI 2FSWA 2WAEA 2Y30A 4PJMA 3OIPA 2KDZA 3BJ6A 3CCJI 3BZ6A 4HX8A 1H88C 2VASA 2LREA 3FXMA 3ONQA 1OKRA 2VBXA 2ESNA 2X1EA 1YG2A 3GFIA 1OYYA 3DU5A 5M5WJ 4U7DA 1PYVA 1I1SA 2XAJA 1S72I 3OYKA 2P5LC 1XB4A 1ZLKA 4I7HA 1FYKA 3G73A 2DMUA 1ZG1A 2DJNA 3O3KA 1U0JA 2JA5J 1ETXA 3BR2A 1IRXA 1Z6RA 2VC0A 4NC6A 1QZYA 4OIQF 5TJJA 4ENNA 1ZK8A 4L0ZB 3P5JA 3Q0VA 2OC6A 2YPRA 2AXLA 1FYLA 2DAOA 3TO9A 5IOYA 4XRMA 2BBYA 3TDUC 2L9SA 2X51A 3BTIA 3GX4X 2XSJC 3DU6A 4IVNA 2FBHA 2E2IJ 4QSHA 3VYSB 2HQNA 3ELKA 3JAMZ 4EM0B 3E5XA 5CVJA 4QWQA 2O8XA 3R60A 4XKWA 3PNTA 5E3LA 2AHQA 3GUDA 2UZKA 1OQYA 5LRRA 5FKMA 4GCVA 4P5OA 3H92A 4C2MJ 1K6OA 3ECHA 3MAJA 3ABUA 1XSDA 4UUVA 3C1DA 2R7WA 5IY5H 3LSJA 3J7YJ 2UWMA 5KAFC 1R9TJ 1OCOH 1X4PA 1ZQ3P 2O61A 1MMDA 3IKTA 4G94A 2AS5F 3SZPA 4YFNF 5F1JA 3OYHA 3H5AA 4M9ZA 1ON1A 4XKBA 1QO0D 2ZNYA 1REPC 1K83J 4ON0A 3ZMVA 3TP0A 1U5TC 2DQLA 1TBXA 3K7AJ 3L1PA 2H8WA 2G0EA 2YUSA 3GZ6A 2WBMA 2GQQA 3ZOBA 3I59A 2B9SA 4DQ2A 2MABA 1K79A 3ABKH 1MGTA 1FYMA 3KPHA 4BE1A 2VJJA 3M8EA 4GO1A 1JUPA 3E0JB 2ZSHB 3ABTA 3RYRA 3CMAI 2HS5A 3WTSC 2DN0A 2GIVA 3BCAA 1EA3A 1I27A 1ETYA 4DGWB 5JI6A 2DI3A 5LHGA 2IS4A 4KIGA 2VKVA 4Q48A 1WH7A 2ZXHA 2A61A 2ZO4A 2OD5A 3SXYA 1FEXA 5E79C 1D0XA 2MBFA 4AVZA 3I55I 5D6EA 1LFPA 3ZMSA 3AL0B 2OCEA 4J00A 1H8AC 1N77A 4D0PA 5GTHC 2HR3A 3DPUA 1AHDP 2W82A 2P6SA 4HX4A 1FC3A 3ZR8X 1YJNI 2NS7A 3DTEA 2R7XA 2FA5A 2XGEA 1W0UA 2HQ5A 1XPXA 1WI9A 4IRGA 5EZHA 1R36A 4UUSB 4D9JA 1HKQA 2NNYA 3VFZA 1E3HA 4BQNA 4AYBN 1T98A 4DBQA 1JKPC 3KZYA 2QZ8A 2V9KA 4QPOA 3DKWA 1XDSA 2VBYA 2CMPA 3CUQC 3V4GA 3I4PA 1BA5A 3BTCA 1JT6A 4N4NB 1MH3A 5CLSA 1L3LA 5L3CA 1YTYA 2PG4A 4HX7A 2GOXB 3M7GA 4XLHA 4E7LA 3I58A 2P6TA 3GTQJ 2YU3A 3LAPA 5DM6F 3IWFA 4UHTA 3AFHA 2DA7A 2VC1A 2G7HA 3HOUJ 3KEQA 2LD5A 2VIXA 4HDUA 5DM7F 5KVRA 2QSFX 3VYTB 2HQRA 2KRHA 5B1BH 1ZGWA 1O7FA 1FSEA 2HOAA 2BHYA 3K6GA 1AKHB 3MEXA 4WWCA 1ZREA 5L3GA 2ME0A 4M9SA 2LTPA 3PUBA 4JX6A 5HLIA 3BG5A 3V42A 4CZZA 2R92J 3PSFA 2MGQA 3S32A 3DKYA 3IL2A 1S3JA 1O4XA 2VQLA 3EUHA 3L7WA 4XORA 4G6QA 3OS2A 3I56I 1SD4A 4IOCF 5DDGA 4L9NA 4XLEA 4ESFA 4RAZA 3BQYA 2DT7B 1KGSA 2XV4S 3ZQCA 1GDTA 4UVBA 3QPTA 1XSXA 5FRMA 2W4SA 3CD6I 3K4CA 5CPRB 2IA1A 1U5TB 5GAHJ 1B8IA 3HJEA 1IN6A 2LF8A 3WHCA 1X3UA 3U2RA 4HSRA 4K2EA 4NB5A 4Z2YA 3D5LA 2R0QC 2ZSIB 1BIAA 3R61A 3ERMA 2HZDA 2X6OA 1YYVA 4AVPA 4IO9F 1WZ2A 5E1XA 2R3SA 3KZZA 1LPQA 1XMXA 1JI8A 2MSYA 3OIOA 3EYIA 3VWBA 3GTGJ 1POGA 1IUFA 3GVAA 3SFIA 4UUTA 4C30A 5BOXA 2E1NA 1WH5A 1IO2A 1YE9A 4BQOA 5HDNA 4EJOA 2XDVA 2XB0X 3H36A 1Z3XA 3JRBA 2XUBA 2XF6A 3WG9A 2EK5A 1IGNA 1FP1D 5E8GA 2FNPA 2JPCA 1FBSA 3TO7A 4MTDA 1U3EM 1T38A 1X1PA 4KDPA 2NS0A 4Y52J 3HOYJ 3WTVC 3PIOF 4BAYA 2YSRA 4LMYA 2FUG2 1QZZA 1SD5A 1RETA 1Z0XA 2E7XA 5J3LA 5L3EA 3KCCA 4EJWA 1Q1VA 3GFLA 4I6ZA 4B09A 5EEGA 2DJIA 4M73A 1O3TA 2DMQA 2MD0A 1J09A 3I54A 3I9V2 3IRQA 4AD9A 1YITI 2FRHA 3LOCA 2KMUA 3BR6A 3FDYA 3ECOA 1G3WA 3ZP5A 5GPCA 3CUQB 1BW6A 3OYNA 2MFZA 3HRUA 2KJCA 2M3AA 4RGUA 1BI0A 3CUOA 1FBQA 2RC4A 3PFIA 2ZCWA 2GA2A 4YG2F 2XRNA 1SFOJ 2BGCA 5LEJA 1JJ8C 3HL2A 2R7FA 2XVCA 3HSFA 4FCYA 3EQLF 2O5RA 2BXZA 3CDHA 2JVHA 3HOVJ 2DFIA 3V8JA 3G3ZA 3GLXA 1IF1A 1T0FC 2Z9OA 3U1DA 4RLFA 3Q9SA 3DPLC 4N9IA 3IAM2 3R0JA 1R4NB 2K02A 2DBBA 1GV2A 2R7OA 4M6XA 1S9HA 1OFCX 2YX4A 4NQWB 4DZJA 3KLNA 5B5EC 1R1UA 2EJRA 4X0GA 1W36C 3VB2A 2XAGA 2M9HA 2CV2A 2GWRA 3C2GA 1H9GA 1A6IA 2JA2A 2NVYJ 3R6SA 3S3OA 2PMUA 3JW4A 3QPHA 1WJ5A 2EV5A 2FMYA 3P7NA 5EG0B 5IYDJ 1EF4A 3A1YA 5BNGA 3HRMA 2BE5F 1K4SA 1F43A 1YRNA 2W57A 2M30A 3FXKA 3WTWC 3G1LA 2LG4A 4HYEA 2KDOA 2KKOA 4F55A 1B72A 1P4WA 3NWTA 2K9MA 2CW8A 2O0YA 3M07A 2GBYA 3CLQA 1AA7A 2XAQA 4Q4ZF 2X6WA 2RGVA 1D8JA 2Q2EB 2F5CA 2KZGA 1MH4A 3NQOA 4G6TB 4XOTA 3WE3A 1GLNA 4BDZA 4HV6A 1MBEA 4L0YB 3CQZJ 3BDDA 1JKOC 3PL8A 3GTLJ 2CQXA 2AQEA 1P7IA 3SEQA 1ZG5A 2P4WA 4FQGA 3A0HC 4A5NA 2ACJA 2OPTA 4KIBA 2CUEA 2MW8A 3DTKA 3UKGA 4PGHA 2K7LA 2V1DA 1STZA 2ZNZA 2ID6A 3HRSA 3IP4B 5FRNA 3K1PA 3E6DA 1O3QA 5F6FA 3ZMUA 3K2ZA 3W6JB 3DP7A 1K61A 4L18B 1MJBA 2DOEA 4C2TA 1DUXC 3PSIA 1HC8A 4I01A 4B48A 1RIOH 5EYRA 4KIFA 5CYVA 2W85A 4PJ0C 3CCQI 4G8XA 2P5VA 1SAUA 3WHBA 4KJZA 4AIKA 5CVIA 4HF1A 3RPUA 4E7SA 3S3NA 3MQ0A 4G7ZF 1ODDA 4EMSA 3BQZA 2VOOA 3EETA 3G1OA 2OV7A 1LEBA 2E2HJ 5HLTA 2VOPA 3FX3A 1WWXA 4KT6A 3KP7A 1Z9CA 2ZKZA 1G3SA 4Z6YA 1HA8A 2TDXA 3JSPA 2NVXJ 2X4HA 1HKTA 2ZC2A 2A69F 3FHNA 5K1YA 2IS6A 2PEXA 1X1CA 2Z3YA 1R22A 4XLCA 3HHHA 2ZFUA 1BL0A 1WJEA 2EFOA 1LB2A 2ELJA 2ISYA 2STTA 3SZGA 2F4MB 2Y31A 4A3FJ 1WVRA 4AC0A 3H35A 1TT0A 3RZDJ 5IP9J 2Q8KA 1A35A 3N97A 5E3OA 2Y0MA 4HA8A 2R93J 2Y48A 4ZYHA 5LHHA 3A01A 4BKXA 2DDBA 3KLOA 4LIUA 3OIQA 3RCOA 2D2WA 2A3SA 3DCFA 2CQNA 3C18A 2M87A 3BR0A 4NBQA 2L9RA 1Z91A 4XQFA 1M1EB 2D1HA 1ON2A 1BR2A 2M5WA 3E6BA 1I50J 1BW5A 1FIPA 1SFUA 2QUFA 4A69C 2K40A 1RZ4A 4GRIA 1IDZA 2PBIA 3LSGA 4WCGA 3FMSA 1Q1HA 2PMZA 3OV8A 1T2KA 3HDDA 2HWVA 2VPRA 1MBKA 4BEHB 2WV1A 3HSRA 2DA6A 3LSRA 2X1DA 5CVRA 5FKLA 1A31A 1IV8A 4CZCA 2WAQA 2E60A 5FKNA 3HOXJ 2JA8J 4I2OA 4ENJA 2V1NA 4V2GA 3PQJA 4WXHA 2H94A 2CQ7A 2ICWG 2L7KA 3H1CA 3FK6A 4JX4A 4LB6B 5KHDA 1YQAA 5ILUA 2HFHA 5LD2C 1VQPI 4PJJA 1QNTA 5A2QZ 1XMAA 5IT3A 4XIDA 3VOEA 1VI0A 1A5JA 1S29A 2MH2A 4HQMA 1XS9A 3C2HA 2M2EA 1BI1A 4I02A 3H9JA 4U0VA 3HSEA 2EFQA 2L3DA 3P9CA 3OS0A 2EV0A 3JRGA 3MZHA 3B73A 2HI3A 1T6SA 3KP4A 5EJCA 2VE9A 3C2BA 1X3ZB 1TC3C 3C3WA 4NUBA 4OAZA 3BLYA 4ZZLA 2L02A 3KYLA 3DTIA 3H9QA 5GAEJ 4XLPF 2HOTA 3S2HJ 3BPVA 2VKHA 2DFEA 1OCRH 5E1ZB 1J9IA 3GWZA 2RAEA 1BM9A 5CJ9A 4GYIA 1KU3A 5AIPA 1MBFA 1V5GA 4MEYF 4ZDLA 2IA0A 3CLOA 2LDUA 2X9DA 3DFGA 2O3FA 2LY1A 5FROA 4NC7A 2OQRA 2QBYB 1XDUA 4HLYA 1O3SA 3S1NJ 3BY6A 1YLFA 5FLVA 2FOKA 3OS1A 2V9PA 2CSOA 1BC7C 4JYKA 2HQAA 3CJTB 4KMFA 1WGXA 1NK2P 4ITVA 5FLMJ 3O6BB 2VONA 2UUZA 4KMUX 3F3XA 1K78B 3CC2I 3S93A 2KJBA 5JFRA 2EZLA 4ZYEA 1ZRDA 3ZMTA 2F5EA 3DEEA 4ZDOA 3O8HA 2XC7A 4BY1J 4CH7A 1Z7LA 2WWYA 1PUFA 1OYIA 3HUGA 3NARA 1R1TA 5J4VA 5ICGA 2BY3A 4MNUA 3CCEI 4RGXA 4TV7A 2R5YB 1MDMB 2HU9A 1WCMJ 3RKXA 1HSJA 2WB1A 4RGRA 2QCOA 3DPTA 1Y0NA 2VLAA 3REOA 1TLHB 4IKFA 1XCVA 4KITB 1J2XA 2M8GX 4R8HA 1D1CA 1MMNA 5HS9A 2I10A 5GPAA 5E3MA 1XC5A 1DU0A 2EV6A 2K5CA 3IKVA 4V19K 3CF2A 1E0EA 5B3SH 1R23A 4BBRJ 4FHTA 5FKKA 3EDPA 2LY2A 2HNHA 4DYCA 1E3OC 2L4MA 3K4KA 1FY7A 3HB9A 4XR6A 1YO5C 3A03A 1P9QC 1BN5A 1J5YA 4MGRA 4IRIA 4ETSA 2E1CA 2LY9A 2QEXI 1YS7A 3LFUA 4CXFA 2IS1A 2CFXA 3EUKL 3VODA 2OZUA 3FK7A 5ILVA 2CW7A 1HDDC 2BW3B 4FTHA 2JA6J 3QWLA 3FKIJ 2Z2SB 3HBLA 3JREA 2Z1DA 4IF4A 5HNHA 3FBIB 3QYBA 3LSPA 2L5QA 4UXNA 1VFCA 1ZARA 4XONA 4BGDA 2QSGX 2XGCA 4B3AA 4IHTA 3CMMA 3JTHA 2A68F 2NXNB 1XGMA 2EINH 4ZTJA 1ZTRA 2DYSH 1OLTA 3WTUC 3A0BC 4HBLA 2MC3A 4B43A 3GZ5A 3CMYA 5JVGF 1HW2A 2GA1A 3LQQA 1ETVA 1WQ2A 2O7OA 2XASA 3F9KA 2HOEA 2H8RA 4CYCB 4HSTA 3VEPA 2XKPA 3DWLE 1D8KA 2IEKA 2BVLA 4MTEA 2Y2ZA 2LOOA 2RQQA 2QYOA 1ZH5A 1ZGAA 2BOLA 5EGOB 2XF5A 2A6EF 1QZEA 4IHVA 2P7VB 2DQRA 5F0HA 3GTOJ 1I3QJ 2EA2A 2BV6A 1TW3A 2DA3A 1V3FA 2KIFA 1CGPA 3H0DA 3K70C 2FE3A 1X1DA 2PJPA 2DDAA 3BG9A 5H20A 1MNEA 3ZCOA 1W36D 4FX0A 1Y1VJ 1OCCH 1FT9A 2I5UA 1YFHA 1PP7U 4XK4A 2JA7J 1ZAOA 2ZXJA 5IYCJ 4A3GJ 5GAGJ 3CP8A 4IX7A 1SAXA 3K10A 3EUHC 1GVJA 2CYYA 2TRTA 4M71A 1V5FA 3W6KB 5TRDA 1G3TA 1SD7A 4B47A 1EKEA 3H0GJ 2ZJQF 3CZ6A 2K9LA 4BJTA 4NDLA 2RN7A 3X2QH 3OYBA 3T1BA 1KZHA 1KQ9A 2JUCA 3CESA 2ME6A 4F93B 5ICFA 4UV8A 3VYRB 1H0MA 2KFDA 4M6YA 2J5PA 1XCBA 2E1MC 1Z7UA 1HQCA 3I59B 1QU3A 4LITA 3K0LA 3OYCA 2ZJRF 4U0YA 1SANA 1T33A 3FWEA 4BY7J 3OSGA 1X3WB 1LUJB 3WTXC 2LBFB 2D45A 3GCMA 1EH6A 2JRMA 5K7FA 4RS8A 5FFXA 3W2VA 3WGGA 4YFKF 2FXAA 1ERDA 3E6CC 1FJLA 2JMWA 1YJWI 1DPRA 2H1LA 4ZYGA 3JRIA 2Q0OA 9ANTA 2HVRA 4EGZA 2WC2A 3R0AA 4LIVA 2IW5A 2M8EA 4NC8A 3LSTA 1UZCA 3KZIC 3CDLA 5CKTA 3CCMI 1WHUA 1CF7B 2EZHA 4PGGA 3BC8A 4OWRB 3TGNA 1NG7A 3HM5A 3OMYA 3O2PE 2VQGA 4BXFA 3HPHA 2PQ8A 2WADA 2L7FP 3BT9A 2HXIA 2OTJI 1HDPA 1ZKGA 3KX2A 4LJZF 3KEOA 4CO8A 3S16J 3G4SI 3H5NA 3HTSB 3J7AO 4Q5SF 4OMZA 1NH3A 1ACIA 1I6HJ 2FBIA 1ZELA 2ZMEC 2WA0A 1S7OA 2EB7A 4JQFA 2XKOA 2X48A 5E18F 5A2QK 4XLAA 5LGUA 3ZQLA 2CJJA 4CICA 4II3A 2YS9A 3KFWX 2COBA 4UUSA 3SQNA 2PJRB 2ZXIA 2DA2A 4IJAA 1WI3A 1JT0A 3FMRA 2ZJPF 2CV0A 1OR7A 4DOZA 4RB1A 1BR4A 3KE2A 4WF2A 5K5RA 2FQ3A 1XX5A 4DYRA 4EATA 2JT1A 5E8IA 2NRAC 2ELHA 2DA1A 4HV5A 3RPQA 1YX5A 1ONVA 3T5XA 5DD8A 2HPIA 2K85A 1FPQA 4IL6C 2WY8Q
chains in the Genus database with same CATH topology
4JK1X 1RUNA 3NRVA 1KU9A 1YW7A 3F23A 2QVOA 3CJNA 4KT5C 4UNOA 2M1BA 5DCMB 3TQNA 4BYYA 5LGNA 4WK8F 2K4BA 1XMKA 1TQIA 3DV8A 3V8LA 4A6EA 1HBXG 2HKXA 4M9XA 2HTSA 1MD0A 3HRTA 2V79A 4HOBA 2KRFA 1LDJA 3ISPA 1U8RA 4LLNA 3GW2A 1IXRC 5F1RA 1I5ZA 2NNNA 2PN6A 1GXPA 1U5TA 3T8RA 3F8MA 4PCQA 5D6FA 1LNWA 4ASNA 1UB9A 5LLQA 4EQQA 2C6YA 1FOKA 1W5TA 2XAHA 4DNCA 2PMHA 3J80Z 2QENA 4RAYA 2DU9A 4AIHA 4BQAA 1J75A 5L3BA 1G4DA 3WGHA 5DUKA 1UHWA 4EJUA 1BOAA 2IP2A 1SD6A 1EH8A 1B1BA 3MZYA 3WTZA 2ZMEB 1IZ1A 4L9JA 3GFJA 2MLGA 3F6VA 2NAZA 1AOYA 2R7DA 2HYGD 3M9AA 4KNYA 4O3MA 4LLLA 5ICEA 3FM5A 3AAFA 2V1UA 1FNNA 3ERED 3CUQA 3TOAA 2VODA 4E70A 1JHFA 5HOOA 1HSTA 1IRGA 1PDNC 2G9WA 5D5UB 3FMQA 2JZYA 1KYWA 4MQ9F 4ENKA 1FZPB 3F8CA 3HHGA 4IRHA 4NQWA 3F8NA 3PQKA 4Q47A 4P9UA 1ZHFA 4LG0B 4U0WA 4R1HA 5LBQA 2VBZA 1TQMA 1IUYA 4EV0A 2FU4A 2ZJ2A 3ZPLA 1C0WA 1ZRCA 4ZH4F 2Q2EA 3BJOA 5D8LB 2H6CA 4ZYDA 1R00A 2A07F 1I6XA 4LLGF 1P6RA 3QRFF 4NHJA 1O57A 2DLLA 5IT9Z 2X0LA 4BHBA 1B9MA 1HKSA 5DUIA 4YIIA 3V7SA 3V7RA 3WU1B 1XD7A 4GGGA 2L4AA 2JSCA 1XSVA 2FMLA 5FLXZ 2EFWA 1BC8C 5L3DA 2B0LA 1TW2A 1QGPA 3LWFA 4EJTA 1IRFA 1WSUA 1FX7A 2GXBA 3RDIA 3D0SA 3T8TA 5D8KB 3QU6A 3KETA 2IVMA 4ESBA 1ZLJA 5FD6A 1RI7A 2OA4A 1A04A 1BIBA 3QP6A 1KU7A 2QM3A 2RVCA 4L5IA 1FWZA 2F2EA 1F1ZA 1U2WA 1K7AA 5LGTA 2L01A 1W5SA 4WXCA 3HIFA 3GYHX 1ZYRF 5K5QA 3BP8A 1F9NA 2QQ9A 2HYFA 3Q9VA 4I98B 4BNCA 1QBJA 1B6AA 5ILSA 4QLCU 4H0EA 3RKWA 3F6OA 2P8TA 2VN2A 2CWEA 3DF8A 2PLYA 4ZZDA 1JHHA 1VTNC 2EFNA 2OZ6A 1HXDA 2LKPA 4OU0A 3N4MA 4HW0A 1KU2A 4OIPF 1WKMA 4I0BA 4R79A 3KP2A 1LJ9A 1P4AA 2DO7A 2HGCA 1QPMA 1SMTA 2K4JA 1YW9A 3E5QA 3RKYA 1Z6TA 3HOTA 3F22A 3SHFA 1RUOA 4OIOF 3C7JA 1YS6A 1IN4A 1IN7A 2H09A 3I5UA 5FO5A 5K5OA 4AWXB 1AWCA 2QBYA 4OINF 3J80K 4IPAA 1IXCA 2F5FA 3M8FA 2ZBKA 1W7PB 2XIGA 4PDKA 4WXDA 1K78A 2RQPA 1SFXA 3ML6A 2LF7A 3B02A 3WODF 3DEUA 1MJAA 3RTRA 1NHAA 1EH7A 1MDMA 1XN7A 3QU3A 4RB2C 3I71A 5JHUA 4XSZF 3FM3A 2IPQX 4OOIA 5DV5A 3E3VA 1BI3A 4UV9A 2YX7A 3CTAA 3MCZA 5E1WA 1DPUA 2K86A 3MFKA 1SMYF 3ZN1A 4G7HF 3QP5A 3QOPA 1WRJA 3BJAA 2IRFG 2HZTA 5J6XA 4LB5A 1BBYA 1YW8A 5F64A 1HW5A 4WX9A 2RNJA 2DPUA 3LAJA 4KFCA 4HF0A 1LDKB 1JE8A 1ZG3A 4XRFA 2UXNA 3ROUA 4FX4A 3GFMA 1H9TA 4EM2A 5D5VB 5HS8A 2QLZA 3ZMDA 3J81Z 1FP2A 1IW7F 3COAC 3BPXA 3L09A 6PAXA 3F8FA 1YIOA 5BQTA 5D5WB 4LK0F 1FLIA 1I1GA 4MQVA 1E2XA 1XGNA 3DQVC 5LEKA 5IT9K 2A5YB 1UFMA 2XHKA 4KUMA 4UVCA 2DW4A 3LA2A 5FLXK 3IRRA 2VT2A 4MEXF 1T39A 2WV0A 1L0OC 2E7WA 4B8XA 2ETHA 4G7OF 3DXJF 2JTVA 1R5HA 3EYYA 4A2UA 1P2FA 3I0TA 1EV7A 3WTTC 3K1NA 3HTUA 2ZFWA 1OPCA 4EGYA 2GAUA 4U88A 4M74A 1FBUA 4HZFA 1BJAA 2PFBA 1GHCA 3ZN0A 5D4SA 5FGMA 1IXSB 1CF7A 2XROA 4ENMA 4A5MA 2G7UA 4LD5A 4G6DA 3V7CA 3L00A 4A6DA 1USTA 4GYGA 1J7KA 2GXGA 3IC7A 1W7PD 1F5TA 3ZMZA 3F72A 1XGOA 2Z99A 1HW1A 2OAZA 2CQKA 2ISZA 3F21A 5D4RA 1Y0UA 5FD5A 5AIQA 3IWZA 3RIRA 5KK1A 4A0YA 2O6GE 2RV8A 1G6NA 4O5VA 3TO6A 2D1VA 3FXUA 2DK5A 5DCMA 2Y75A 1SFEA 4HDVA 5D5XB 4BXUA 1Z05A 2Z33A 1MZBA 3S2WA 5J8FA 2IA2A 2EWNA 4JBAA 2UXXA 4CDGA 1QQIA 5HVQC 3TOBA 2HEOA 2HDCA 3F8BA 4Y17A 2V6CA 1MKMA 4AIJA 1W4MA 4YIFA 4P9FA 1S8NA 5ED4A 4M72A 1KQ8A 2MLKA 5J8CA 3KP6A 4OIRF 4BHCA 1FSHA 2IT0A 4RB3C 1DDNA 1E17A 4I09A 4PZJA 3GO5A 2WTEA 4L9TA 2H6BA 5E17F 1B9NA 3BROA 2FF4A 1DP7P 3E97A 2J5OA 1ULYA 1R7JA 1O3RA 4HF2A 4P96A 2DT5A 4N9HA 2CG4A 2ZMEA 5L3FA 1IN5A 5JVTA 1LEAA 5FB2A 4N0BA 1R58A 3J81K 1IN8A 3I64A 3HOSA 2VBWA 1RNLA 2CGPA 1R5GA 2W84A 2P7CB 3T0YA 3RI4A 3LA7A 1MJ9A 1USSA 4HAMA 3WU0A 4U7BA 4KYWA 4EJVA 3K69A 4S04A 2O03A 1ZGJA 4BHPA 3MWMA 2BEOA 5CVVA 1PUEE 3BOQA 5JR3A 3WTYC 4LG0A 3I53A 3H3ZA 3JAMK 2VE8A 4Y15A 3QAHA 2H27A 1F4KA 2DTRA 5HS7A 4HLXA 1IAWA 1JXSA 4L9VA 1B59A 2GZWA 2QWWA 4FT8A 3FXRA 3NEUA 4UVAA 2V9VA 2W25A 3GXOA 3E6MA 1XGSA 4L5JA 5DEQA 1ZRFA 3WE2A 4F7ZA 1D5VA 3ULQB 1KYZA 2HKOA 1V4RA 1GXQA 3FZVA 2FEZA 2KIUA 3FXQA 2W24A 2COMA 4LGWA 3R4KA 5CVUA 4LK1F 5E20A 3LA3A 5BPDA 2DK8A 1ZN2A 2XAFA 2NYXA 2IJLA 4EM1A 1TNSA 1UHMA 3IHUA 2CO5A 1J0RA 3L2CA 3P9IA 1B4AA 3LQRA 4I0AA 4ESJA 1TQPA 1D3YA 4LFUA 3RJPA 2ADUA 1TNTA 5HDGA 4XLNF 5BMZA 5H6QA 5FFZA 3K9TA 3JTGA 2QQAA 2L54A 2KIMA 4A12A 3Q5FA 1LVAA 2JPBA 1S6LA 3P9KA 4CHUA 1KA8A 1T0FA 3SFZA 1JGSA 4G9YA 2EA4A 4IXAA 5ICCA 4EVIA 3CO7C 1Z1DA 4BH9A 3JSOA 5AONA 4XBFA 3TDZC 2CW0F 2QQBA 2XGXA 4KICA 5LHIA 3U9GA 2PI0A 4P55A 3ZQ7A 3WGIA 1KQ0A 2MA3A 1P4XA 4S05A 3V8KA 2FBKA 1R1VA 2YR2A 2VT3A 5DYMA 3CO6C 2RDPA 4MHGA 4CYDA 2P5KA 4GXOA 2EFPA 3E5UA 1UCRA 2VXZA 1J59A 4A0ZA 2LSOA 3SZTA 5BS6A 3RYPA 2STWA 3KP3A 2DPDA 4KA4A 1BI2A 3KP5A 5HDKA 1LDDA 3TKYA 5HLHA 3OOPA 4RB0A 1O7LA 4RGSA 1LQ1A 4Y13A 3FF5A 5BPIA 2MH9A 4CGZA 3FHZA 2LNBA 3LFKA 1W7PA 3H3UA 2K27A 1TTYA 1U78A 2MD5A 2OU2A 5LRSA 3HYIA 4XSXF 2A6HF 3K1MA 1U6GA 2V1XA 4HQEA 3L9FA 1PP8F 1G3YA 1P92A 4IHSA 4OMYA 3M1EA 5EEHA 5HLGA 5DD4A 3GF2A 2HTJA 2F5DA 2M45A 2FNAA 2BYVE 2RKHA 2Z5UA 1OMIA 4KN4X 1S7AA 5DCFA 2OQGA 4KN7X 4A0XA 3BWGA 2OBPA 2JRTA 3GEZA 4O6JA 2ESHA 4YFXF 5H6RA 5ERIA 1OYWA 2FSWA 3BJ6A 3BZ6A 4HX8A 1OKRA 2VBXA 2ESNA 1YG2A 3GFIA 1OYYA 4U7DA 1I1SA 2XAJA 2P5LC 1XB4A 1ZLKA 4I7HA 1FYKA 3G73A 1ZG1A 3O3KA 1Z6RA 2VC0A 1QZYA 4OIQF 5TJJA 4ENNA 4L0ZB 2YPRA 2AXLA 1FYLA 2DAOA 3TO9A 2BBYA 3TDUC 3GX4X 4IVNA 2FBHA 2HQNA 3ELKA 3JAMZ 4EM0B 3E5XA 5CVJA 4QWQA 2O8XA 3R60A 3GUDA 2UZKA 5LRRA 4GCVA 4P5OA 3H92A 1K6OA 3ECHA 3MAJA 3ABUA 1XSDA 4UUVA 3C1DA 2UWMA 2O61A 3IKTA 4G94A 2AS5F 3SZPA 4YFNF 4M9ZA 1ON1A 1QO0D 2ZNYA 1REPC 4ON0A 3ZMVA 1U5TC 2DQLA 1TBXA 3GZ6A 2GQQA 3I59A 4DQ2A 1K79A 1MGTA 1FYMA 3M8EA 4GO1A 3ABTA 3RYRA 2HS5A 3WTSC 2GIVA 1I27A 5JI6A 2DI3A 5LHGA 4KIGA 4Q48A 2A61A 2ZO4A 2OD5A 3SXYA 2MBFA 5D6EA 3ZMSA 4D0PA 2HR3A 2P6SA 4HX4A 1FC3A 2FA5A 1WI9A 4IRGA 1R36A 1HKQA 2NNYA 3VFZA 1T98A 3KZYA 2QZ8A 3DKWA 1XDSA 2VBYA 3CUQC 3V4GA 3I4PA 5CLSA 1L3LA 5L3CA 1YTYA 2PG4A 4HX7A 3M7GA 3I58A 2P6TA 2YU3A 3LAPA 3IWFA 4UHTA 2VC1A 2G7HA 3KEQA 4HDUA 5KVRA 2HQRA 1O7FA 1FSEA 3MEXA 4WWCA 1ZREA 5L3GA 4M9SA 5HLIA 4CZZA 3IL2A 1S3JA 3EUHA 3L7WA 4G6QA 1SD4A 5DDGA 4L9NA 4ESFA 4RAZA 1KGSA 2XV4S 4UVBA 3QPTA 1XSXA 2IA1A 1U5TB 1IN6A 2LF8A 1X3UA 3U2RA 4K2EA 4NB5A 4Z2YA 3D5LA 1BIAA 3R61A 4AVPA 1YYVA 5E1XA 2R3SA 3KZZA 3EYIA 3GVAA 5BOXA 2E1NA 5HDNA 4EJOA 2XUBA 3WG9A 2EK5A 1FP1D 5E8GA 2FNPA 2JPCA 1FBSA 3TO7A 4MTDA 1U3EM 1T38A 4KDPA 2NS0A 3WTVC 4BAYA 2YSRA 4LMYA 1QZZA 1SD5A 5L3EA 2E7XA 3KCCA 4EJWA 3GFLA 4B09A 5EEGA 4M73A 1O3TA 3I54A 3IRQA 4AD9A 2FRHA 3ECOA 1G3WA 3ZP5A 3CUQB 3HRUA 2KJCA 4RGUA 1BI0A 1FBQA 3PFIA 2RC4A 3CUOA 2ZCWA 2GA2A 4YG2F 2XRNA 2BGCA 5LEJA 2R7FA 2XVCA 3HSFA 3EQLF 3CDHA 2DFIA 3V8JA 3G3ZA 3GLXA 1IF1A 2Z9OA 3U1DA 3Q9SA 3DPLC 4N9IA 3R0JA 2K02A 2DBBA 4M6XA 2YX4A 3KLNA 1R1UA 2EJRA 3VB2A 2XAGA 2GWRA 1H9GA 3R6SA 3JW4A 2PMUA 3QPHA 2EV5A 2FMYA 3P7NA 3HRMA 2BE5F 2W57A 2M30A 3WTWC 4HYEA 2KKOA 1P4WA 2O0YA 2XAQA 4Q4ZF 2RGVA 1D8JA 2F5CA 3NQOA 3WE3A 4HV6A 4L0YB 3BDDA 1ZG5A 2P4WA 2ACJA 4A5NA 4KIBA 4PGHA 2K7LA 2V1DA 1STZA 2ZNZA 3HRSA 3K1PA 3E6DA 1O3QA 5F6FA 3ZMUA 3K2ZA 3W6JB 3DP7A 4L18B 1MJBA 1DUXC 4I01A 1RIOH 4KIFA 5CYVA 2W85A 4G8XA 2P5VA 4AIKA 5CVIA 4HF1A 3RPUA 3MQ0A 4G7ZF 1ODDA 4EMSA 2VOOA 3EETA 1LEBA 2VOPA 3FX3A 1WWXA 3KP7A 1Z9CA 2ZKZA 1G3SA 2TDXA 3JSPA 2X4HA 1HKTA 2A69F 5K1YA 2PEXA 2Z3YA 1R22A 3HHHA 2EFOA 1LB2A 2ISYA 2STTA 2Q8KA 3N97A 2Y0MA 4HA8A 2Y48A 4ZYHA 5LHHA 3KLOA 2D2WA 2A3SA 3C18A 2M87A 1Z91A 2D1HA 1ON2A 2M5WA 3E6BA 1SFUA 2QUFA 1RZ4A 2PBIA 4WCGA 3FMSA 1Q1HA 3OV8A 1T2KA 2HWVA 3HSRA 5CVRA 4I2OA 4ENJA 3PQJA 4WXHA 2H94A 4LB6B 1YQAA 5ILUA 2HFHA 1QNTA 5A2QZ 1XMAA 5IT3A 3VOEA 1S29A 2MH2A 4HQMA 1BI1A 4I02A 4U0VA 3HSEA 2EFQA 2L3DA 3P9CA 2EV0A 3MZHA 3B73A 1T6SA 3KP4A 2VE9A 3C3WA 4ZZLA 2L02A 4XLPF 3BPVA 1J9IA 5E1ZB 3GWZA 1BM9A 5CJ9A 4GYIA 1KU3A 5AIPA 4MEYF 2IA0A 3CLOA 2LDUA 3DFGA 2O3FA 2OQRA 2QBYB 1XDUA 4HLYA 1O3SA 3BY6A 1YLFA 2FOKA 1BC7C 2CSOA 4KMFA 2VONA 3O6BB 4KMUX 3F3XA 1K78B 2KJBA 5JFRA 4ZYEA 1ZRDA 3ZMTA 2F5EA 2WWYA 1OYIA 3HUGA 1R1TA 5ICGA 4MNUA 4RGXA 4TV7A 1MDMB 3RKXA 1HSJA 4RGRA 3DPTA 3REOA 1TLHB 1XCVA 1J2XA 4R8HA 5HS9A 2EV6A 3IKVA 1R23A 4FHTA 3EDPA 2L4MA 1FY7A 1YO5C 1BN5A 1J5YA 4MGRA 4IRIA 4ETSA 2E1CA 1YS7A 4CXFA 2CFXA 3VODA 2OZUA 5ILVA 4IF4A 4UXNA 1ZARA 4IHTA 3JTHA 2A68F 1XGMA 3WTUC 4HBLA 2MC3A 3GZ5A 1HW2A 2GA1A 3LQQA 2XASA 1WQ2A 2HOEA 3VEPA 2XKPA 1D8KA 4MTEA 2QYOA 1ZH5A 1ZGAA 2A6EF 2P7VB 2DQRA 2EA2A 2BV6A 1TW3A 2KIFA 1V3FA 1CGPA 2FE3A 2PJPA 5H20A 4FX0A 1PP7U 1FT9A 1YFHA 1ZAOA 2ZXJA 1SAXA 1GVJA 2CYYA 4M71A 3W6KB 5TRDA 1G3TA 1SD7A 2RN7A 3T1BA 1KQ9A 5ICFA 4UV8A 1H0MA 4M6YA 2J5PA 1XCBA 1Z7UA 1HQCA 3I59B 3K0LA 4U0YA 3FWEA 3WTXC 2D45A 1EH6A 4RS8A 5FFXA 3WGGA 4YFKF 2FXAA 3E6CC 1DPRA 4ZYGA 2Q0OA 4EGZA 2WC2A 3R0AA 2IW5A 2M8EA 3LSTA 1CF7B 4PGGA 3TGNA 3O2PE 2PQ8A 4LJZF 3KEOA 4CO8A 3HTSB 3J7AO 4Q5SF 4OMZA 2FBIA 1S7OA 2EB7A 4JQFA 2XKOA 5E18F 5A2QK 5LGUA 4CICA 3KFWX 3SQNA 4IJAA 3FMRA 1OR7A 4RB1A 3KE2A 4WF2A 5K5RA 2FQ3A 2JT1A 5E8IA 2NRAC 2ELHA 4HV5A 3RPQA 1ONVA 3T5XA 5DD8A 1FPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 X;  1RUN A;  3NRV A;  1KU9 A;  1YW7 A;  3F23 A;  2QVO A;  3CJN A;  4KT5 C;  4UNO A;  2M1B A;  5DCM B;  3TQN A;  4BYY A;  5LGN A;  4WK8 F;  2K4B A;  1XMK A;  1TQI A;  3DV8 A;  3V8L A;  4A6E A;  1HBX G;  2HKX A;  4M9X A;  2HTS A;  1MD0 A;  3HRT A;  2V79 A;  4HOB A;  2KRF A;  1LDJ A;  3ISP A;  1U8R A;  4LLN A;  3GW2 A;  1IXR C;  5F1R A;  1I5Z A;  2NNN A;  2PN6 A;  1GXP A;  1U5T A;  3T8R A;  3F8M A;  4PCQ A;  5D6F A;  1LNW A;  4ASN A;  1UB9 A;  5LLQ A;  4EQQ A;  2C6Y A;  1FOK A;  1W5T A;  2XAH A;  4DNC A;  2PMH A;  3J80 Z;  2QEN A;  4RAY A;  2DU9 A;  4AIH A;  4BQA A;  1J75 A;  5L3B A;  1G4D A;  3WGH A;  5DUK A;  1UHW A;  4EJU A;  1BOA A;  2IP2 A;  1SD6 A;  1EH8 A;  1B1B A;  3MZY A;  3WTZ A;  2ZME B;  1IZ1 A;  4L9J A;  3GFJ A;  2MLG A;  3F6V A;  2NAZ A;  1AOY A;  2R7D A;  2HYG D;  3M9A A;  4KNY A;  4O3M A;  4LLL A;  5ICE A;  3FM5 A;  3AAF A;  2V1U A;  1FNN A;  3ERE D;  3CUQ A;  3TOA A;  2VOD A;  4E70 A;  1JHF A;  5HOO A;  1HST A;  1IRG A;  1PDN C;  2G9W A;  5D5U B;  3FMQ A;  2JZY A;  1KYW A;  4MQ9 F;  4ENK A;  1FZP B;  3F8C A;  3HHG A;  4IRH A;  4NQW A;  3F8N A;  3PQK A;  4Q47 A;  4P9U A;  1ZHF A;  4LG0 B;  4U0W A;  4R1H A;  5LBQ A;  2VBZ A;  1TQM A;  1IUY A;  4EV0 A;  2FU4 A;  2ZJ2 A;  3ZPL A;  1C0W A;  1ZRC A;  4ZH4 F;  2Q2E A;  3BJO A;  5D8L B;  2H6C A;  4ZYD A;  1R00 A;  2A07 F;  1I6X A;  4LLG F;  1P6R A;  3QRF F;  4NHJ A;  1O57 A;  2DLL A;  5IT9 Z;  2X0L A;  4BHB A;  1B9M A;  1HKS A;  5DUI A;  4YII A;  3V7S A;  3V7R A;  3WU1 B;  1XD7 A;  4GGG A;  2L4A A;  2JSC A;  1XSV A;  2FML A;  5FLX Z;  2EFW A;  1BC8 C;  5L3D A;  2B0L A;  1TW2 A;  1QGP A;  3LWF A;  4EJT A;  1IRF A;  1WSU A;  1FX7 A;  2GXB A;  3RDI A;  3D0S A;  3T8T A;  5D8K B;  3QU6 A;  3KET A;  2IVM A;  4ESB A;  1ZLJ A;  5FD6 A;  1RI7 A;  2OA4 A;  1A04 A;  1BIB A;  3QP6 A;  1KU7 A;  2QM3 A;  2RVC A;  4L5I A;  1FWZ A;  2F2E A;  1F1Z A;  1U2W A;  1K7A A;  5LGT A;  2L01 A;  1W5S A;  4WXC A;  3HIF A;  3GYH X;  1ZYR F;  5K5Q A;  3BP8 A;  1F9N A;  2QQ9 A;  2HYF A;  3Q9V A;  4I98 B;  4BNC A;  1QBJ A;  1B6A A;  5ILS A;  4QLC U;  4H0E A;  3RKW A;  3F6O A;  2P8T A;  2VN2 A;  2CWE A;  3DF8 A;  2PLY A;  4ZZD A;  1JHH A;  1VTN C;  2EFN A;  2OZ6 A;  1HXD A;  2LKP A;  4OU0 A;  3N4M A;  4HW0 A;  1KU2 A;  4OIP F;  1WKM A;  4I0B A;  4R79 A;  3KP2 A;  1LJ9 A;  1P4A A;  2DO7 A;  2HGC A;  1QPM A;  1SMT A;  2K4J A;  1YW9 A;  3E5Q A;  3RKY A;  1Z6T A;  3HOT A;  3F22 A;  3SHF A;  1RUO A;  4OIO F;  3C7J A;  1YS6 A;  1IN4 A;  1IN7 A;  2H09 A;  3I5U A;  5FO5 A;  5K5O A;  4AWX B;  1AWC A;  2QBY A;  4OIN F;  3J80 K;  4IPA A;  1IXC A;  2F5F A;  3M8F A;  2ZBK A;  1W7P B;  2XIG A;  4PDK A;  4WXD A;  1K78 A;  2RQP A;  1SFX A;  3ML6 A;  2LF7 A;  3B02 A;  3WOD F;  3DEU A;  1MJA A;  3RTR A;  1NHA A;  1EH7 A;  1MDM A;  1XN7 A;  3QU3 A;  4RB2 C;  3I71 A;  5JHU A;  4XSZ F;  3FM3 A;  2IPQ X;  4OOI A;  5DV5 A;  3E3V A;  1BI3 A;  4UV9 A;  2YX7 A;  3CTA A;  3MCZ A;  5E1W A;  1DPU A;  2K86 A;  3MFK A;  1SMY F;  3ZN1 A;  4G7H F;  3QP5 A;  3QOP A;  1WRJ A;  3BJA A;  2IRF G;  2HZT A;  5J6X A;  4LB5 A;  1BBY A;  1YW8 A;  5F64 A;  1HW5 A;  4WX9 A;  2RNJ A;  2DPU A;  3LAJ A;  4KFC A;  4HF0 A;  1LDK B;  1JE8 A;  1ZG3 A;  4XRF A;  2UXN A;  3ROU A;  4FX4 A;  3GFM A;  1H9T A;  4EM2 A;  5D5V B;  5HS8 A;  2QLZ A;  3ZMD A;  3J81 Z;  1FP2 A;  1IW7 F;  3COA C;  3BPX A;  3L09 A;  6PAX A;  3F8F A;  1YIO A;  5BQT A;  5D5W B;  4LK0 F;  1FLI A;  1I1G A;  4MQV A;  1E2X A;  1XGN A;  3DQV C;  5LEK A;  5IT9 K;  2A5Y B;  1UFM A;  2XHK A;  4KUM A;  4UVC A;  2DW4 A;  3LA2 A;  5FLX K;  3IRR A;  2VT2 A;  4MEX F;  1T39 A;  2WV0 A;  1L0O C;  2E7W A;  4B8X A;  2ETH A;  4G7O F;  3DXJ F;  2JTV A;  1R5H A;  3EYY A;  4A2U A;  1P2F A;  3I0T A;  1EV7 A;  3WTT C;  3K1N A;  3HTU A;  2ZFW A;  1OPC A;  4EGY A;  2GAU A;  4U88 A;  4M74 A;  1FBU A;  4HZF A;  1BJA A;  2PFB A;  1GHC A;  3ZN0 A;  5D4S A;  5FGM A;  1IXS B;  1CF7 A;  2XRO A;  4ENM A;  4A5M A;  2G7U A;  4LD5 A;  4G6D A;  3V7C A;  3L00 A;  4A6D A;  1UST A;  4GYG A;  1J7K A;  2GXG A;  3IC7 A;  1W7P D;  1F5T A;  3ZMZ A;  3F72 A;  1XGO A;  2Z99 A;  1HW1 A;  2OAZ A;  2CQK A;  2ISZ A;  3F21 A;  5D4R A;  1Y0U A;  5FD5 A;  5AIQ A;  3IWZ A;  3RIR A;  5KK1 A;  4A0Y A;  2O6G E;  2RV8 A;  1G6N A;  4O5V A;  3TO6 A;  2D1V A;  3FXU A;  2DK5 A;  5DCM A;  2Y75 A;  1SFE A;  4HDV A;  5D5X B;  4BXU A;  1Z05 A;  2Z33 A;  1MZB A;  3S2W A;  5J8F A;  2IA2 A;  2EWN A;  4JBA A;  2UXX A;  4CDG A;  1QQI A;  5HVQ C;  3TOB A;  2HEO A;  2HDC A;  3F8B A;  4Y17 A;  2V6C A;  1MKM A;  4AIJ A;  1W4M A;  4YIF A;  4P9F A;  1S8N A;  5ED4 A;  4M72 A;  1KQ8 A;  2MLK A;  5J8C A;  3KP6 A;  4OIR F;  4BHC A;  1FSH A;  2IT0 A;  4RB3 C;  1DDN A;  1E17 A;  4I09 A;  4PZJ A;  3GO5 A;  2WTE A;  4L9T A;  2H6B A;  5E17 F;  1B9N A;  3BRO A;  2FF4 A;  1DP7 P;  3E97 A;  2J5O A;  1ULY A;  1R7J A;  1O3R A;  4HF2 A;  4P96 A;  2DT5 A;  4N9H A;  2CG4 A;  2ZME A;  5L3F A;  1IN5 A;  5JVT A;  1LEA A;  5FB2 A;  4N0B A;  1R58 A;  3J81 K;  1IN8 A;  3I64 A;  3HOS A;  2VBW A;  1RNL A;  2CGP A;  1R5G A;  2W84 A;  2P7C B;  3T0Y A;  3RI4 A;  3LA7 A;  1MJ9 A;  1USS A;  4HAM A;  3WU0 A;  4U7B A;  4KYW A;  4EJV A;  3K69 A;  4S04 A;  2O03 A;  1ZGJ A;  4BHP A;  3MWM A;  2BEO A;  5CVV A;  1PUE E;  3BOQ A;  5JR3 A;  3WTY C;  4LG0 A;  3I53 A;  3H3Z A;  3JAM K;  2VE8 A;  4Y15 A;  3QAH A;  2H27 A;  1F4K A;  2DTR A;  5HS7 A;  4HLX A;  1IAW A;  1JXS A;  4L9V A;  1B59 A;  2GZW A;  2QWW A;  4FT8 A;  3FXR A;  3NEU A;  4UVA A;  2V9V A;  2W25 A;  3GXO A;  3E6M A;  1XGS A;  4L5J A;  5DEQ A;  1ZRF A;  3WE2 A;  4F7Z A;  1D5V A;  3ULQ B;  1KYZ A;  2HKO A;  1V4R A;  1GXQ A;  3FZV A;  2FEZ A;  2KIU A;  3FXQ A;  2W24 A;  2COM A;  4LGW A;  3R4K A;  5CVU A;  4LK1 F;  5E20 A;  3LA3 A;  5BPD A;  2DK8 A;  1ZN2 A;  2XAF A;  2NYX A;  2IJL A;  4EM1 A;  1TNS A;  1UHM A;  3IHU A;  2CO5 A;  1J0R A;  3L2C A;  3P9I A;  1B4A A;  3LQR A;  4I0A A;  4ESJ A;  1TQP A;  1D3Y A;  4LFU A;  3RJP A;  2ADU A;  1TNT A;  5HDG A;  4XLN F;  5BMZ A;  5H6Q A;  5FFZ A;  3K9T A;  3JTG A;  2QQA A;  2L54 A;  2KIM A;  4A12 A;  3Q5F A;  1LVA A;  2JPB A;  1S6L A;  3P9K A;  4CHU A;  1KA8 A;  1T0F A;  3SFZ A;  1JGS A;  4G9Y A;  2EA4 A;  4IXA A;  5ICC A;  4EVI A;  3CO7 C;  1Z1D A;  4BH9 A;  3JSO A;  5AON A;  4XBF A;  3TDZ C;  2CW0 F;  2QQB A;  2XGX A;  4KIC A;  5LHI A;  3U9G A;  2PI0 A;  4P55 A;  3ZQ7 A;  3WGI A;  1KQ0 A;  2MA3 A;  1P4X A;  4S05 A;  3V8K A;  2FBK A;  1R1V A;  2YR2 A;  2VT3 A;  5DYM A;  3CO6 C;  2RDP A;  4MHG A;  4CYD A;  2P5K A;  4GXO A;  2EFP A;  3E5U A;  1UCR A;  2VXZ A;  1J59 A;  4A0Z A;  2LSO A;  3SZT A;  5BS6 A;  3RYP A;  2STW A;  3KP3 A;  2DPD A;  4KA4 A;  1BI2 A;  3KP5 A;  5HDK A;  1LDD A;  3TKY A;  5HLH A;  3OOP A;  4RB0 A;  1O7L A;  4RGS A;  1LQ1 A;  4Y13 A;  3FF5 A;  5BPI A;  2MH9 A;  4CGZ A;  3FHZ A;  2LNB A;  3LFK A;  1W7P A;  3H3U A;  2K27 A;  1TTY A;  1U78 A;  2MD5 A;  2OU2 A;  5LRS A;  3HYI A;  4XSX F;  2A6H F;  3K1M A;  1U6G A;  2V1X A;  4HQE A;  3L9F A;  1PP8 F;  1G3Y A;  1P92 A;  4IHS A;  4OMY A;  3M1E A;  5EEH A;  5HLG A;  5DD4 A;  3GF2 A;  2HTJ A;  2F5D A;  2M45 A;  2FNA A;  2BYV E;  2RKH A;  2Z5U A;  1OMI A;  4KN4 X;  1S7A A;  5DCF A;  2OQG A;  4KN7 X;  4A0X A;  3BWG A;  2OBP A;  2JRT A;  3GEZ A;  4O6J A;  2ESH A;  4YFX F;  5H6R A;  5ERI A;  1OYW A;  2FSW A;  3BJ6 A;  3BZ6 A;  4HX8 A;  1OKR A;  2VBX A;  2ESN A;  1YG2 A;  3GFI A;  1OYY A;  4U7D A;  1I1S A;  2XAJ A;  2P5L C;  1XB4 A;  1ZLK A;  4I7H A;  1FYK A;  3G73 A;  1ZG1 A;  3O3K A;  1Z6R A;  2VC0 A;  1QZY A;  4OIQ F;  5TJJ A;  4ENN A;  4L0Z B;  2YPR A;  2AXL A;  1FYL A;  2DAO A;  3TO9 A;  2BBY A;  3TDU C;  3GX4 X;  4IVN A;  2FBH A;  2HQN A;  3ELK A;  3JAM Z;  4EM0 B;  3E5X A;  5CVJ A;  4QWQ A;  2O8X A;  3R60 A;  3GUD A;  2UZK A;  5LRR A;  4GCV A;  4P5O A;  3H92 A;  1K6O A;  3ECH A;  3MAJ A;  3ABU A;  1XSD A;  4UUV A;  3C1D A;  2UWM A;  2O61 A;  3IKT A;  4G94 A;  2AS5 F;  3SZP A;  4YFN F;  4M9Z A;  1ON1 A;  1QO0 D;  2ZNY A;  1REP C;  4ON0 A;  3ZMV A;  1U5T C;  2DQL A;  1TBX A;  3GZ6 A;  2GQQ A;  3I59 A;  4DQ2 A;  1K79 A;  1MGT A;  1FYM A;  3M8E A;  4GO1 A;  3ABT A;  3RYR A;  2HS5 A;  3WTS C;  2GIV A;  1I27 A;  5JI6 A;  2DI3 A;  5LHG A;  4KIG A;  4Q48 A;  2A61 A;  2ZO4 A;  2OD5 A;  3SXY A;  2MBF A;  5D6E A;  3ZMS A;  4D0P A;  2HR3 A;  2P6S A;  4HX4 A;  1FC3 A;  2FA5 A;  1WI9 A;  4IRG A;  1R36 A;  1HKQ A;  2NNY A;  3VFZ A;  1T98 A;  3KZY A;  2QZ8 A;  3DKW A;  1XDS A;  2VBY A;  3CUQ C;  3V4G A;  3I4P A;  5CLS A;  1L3L A;  5L3C A;  1YTY A;  2PG4 A;  4HX7 A;  3M7G A;  3I58 A;  2P6T A;  2YU3 A;  3LAP A;  3IWF A;  4UHT A;  2VC1 A;  2G7H A;  3KEQ A;  4HDU A;  5KVR A;  2HQR A;  1O7F A;  1FSE A;  3MEX A;  4WWC A;  1ZRE A;  5L3G A;  4M9S A;  5HLI A;  4CZZ A;  3IL2 A;  1S3J A;  3EUH A;  3L7W A;  4G6Q A;  1SD4 A;  5DDG A;  4L9N A;  4ESF A;  4RAZ A;  1KGS A;  2XV4 S;  4UVB A;  3QPT A;  1XSX A;  2IA1 A;  1U5T B;  1IN6 A;  2LF8 A;  1X3U A;  3U2R A;  4K2E A;  4NB5 A;  4Z2Y A;  3D5L A;  1BIA A;  3R61 A;  4AVP A;  1YYV A;  5E1X A;  2R3S A;  3KZZ A;  3EYI A;  3GVA A;  5BOX A;  2E1N A;  5HDN A;  4EJO A;  2XUB A;  3WG9 A;  2EK5 A;  1FP1 D;  5E8G A;  2FNP A;  2JPC A;  1FBS A;  3TO7 A;  4MTD A;  1U3E M;  1T38 A;  4KDP A;  2NS0 A;  3WTV C;  4BAY A;  2YSR A;  4LMY A;  1QZZ A;  1SD5 A;  5L3E A;  2E7X A;  3KCC A;  4EJW A;  3GFL A;  4B09 A;  5EEG A;  4M73 A;  1O3T A;  3I54 A;  3IRQ A;  4AD9 A;  2FRH A;  3ECO A;  1G3W A;  3ZP5 A;  3CUQ B;  3HRU A;  2KJC A;  4RGU A;  1BI0 A;  1FBQ A;  3PFI A;  2RC4 A;  3CUO A;  2ZCW A;  2GA2 A;  4YG2 F;  2XRN A;  2BGC A;  5LEJ A;  2R7F A;  2XVC A;  3HSF A;  3EQL F;  3CDH A;  2DFI A;  3V8J A;  3G3Z A;  3GLX A;  1IF1 A;  2Z9O A;  3U1D A;  3Q9S A;  3DPL C;  4N9I A;  3R0J A;  2K02 A;  2DBB A;  4M6X A;  2YX4 A;  3KLN A;  1R1U A;  2EJR A;  3VB2 A;  2XAG A;  2GWR A;  1H9G A;  3R6S A;  3JW4 A;  2PMU A;  3QPH A;  2EV5 A;  2FMY A;  3P7N A;  3HRM A;  2BE5 F;  2W57 A;  2M30 A;  3WTW C;  4HYE A;  2KKO A;  1P4W A;  2O0Y A;  2XAQ A;  4Q4Z F;  2RGV A;  1D8J A;  2F5C A;  3NQO A;  3WE3 A;  4HV6 A;  4L0Y B;  3BDD A;  1ZG5 A;  2P4W A;  2ACJ A;  4A5N A;  4KIB A;  4PGH A;  2K7L A;  2V1D A;  1STZ A;  2ZNZ A;  3HRS A;  3K1P A;  3E6D A;  1O3Q A;  5F6F A;  3ZMU A;  3K2Z A;  3W6J B;  3DP7 A;  4L18 B;  1MJB A;  1DUX C;  4I01 A;  1RIO H;  4KIF A;  5CYV A;  2W85 A;  4G8X A;  2P5V A;  4AIK A;  5CVI A;  4HF1 A;  3RPU A;  3MQ0 A;  4G7Z F;  1ODD A;  4EMS A;  2VOO A;  3EET A;  1LEB A;  2VOP A;  3FX3 A;  1WWX A;  3KP7 A;  1Z9C A;  2ZKZ A;  1G3S A;  2TDX A;  3JSP A;  2X4H A;  1HKT A;  2A69 F;  5K1Y A;  2PEX A;  2Z3Y A;  1R22 A;  3HHH A;  2EFO A;  1LB2 A;  2ISY A;  2STT A;  2Q8K A;  3N97 A;  2Y0M A;  4HA8 A;  2Y48 A;  4ZYH A;  5LHH A;  3KLO A;  2D2W A;  2A3S A;  3C18 A;  2M87 A;  1Z91 A;  2D1H A;  1ON2 A;  2M5W A;  3E6B A;  1SFU A;  2QUF A;  1RZ4 A;  2PBI A;  4WCG A;  3FMS A;  1Q1H A;  3OV8 A;  1T2K A;  2HWV A;  3HSR A;  5CVR A;  4I2O A;  4ENJ A;  3PQJ A;  4WXH A;  2H94 A;  4LB6 B;  1YQA A;  5ILU A;  2HFH A;  1QNT A;  5A2Q Z;  1XMA A;  5IT3 A;  3VOE A;  1S29 A;  2MH2 A;  4HQM A;  1BI1 A;  4I02 A;  4U0V A;  3HSE A;  2EFQ A;  2L3D A;  3P9C A;  2EV0 A;  3MZH A;  3B73 A;  1T6S A;  3KP4 A;  2VE9 A;  3C3W A;  4ZZL A;  2L02 A;  4XLP F;  3BPV A;  1J9I A;  5E1Z B;  3GWZ A;  1BM9 A;  5CJ9 A;  4GYI A;  1KU3 A;  5AIP A;  4MEY F;  2IA0 A;  3CLO A;  2LDU A;  3DFG A;  2O3F A;  2OQR A;  2QBY B;  1XDU A;  4HLY A;  1O3S A;  3BY6 A;  1YLF A;  2FOK A;  1BC7 C;  2CSO A;  4KMF A;  2VON A;  3O6B B;  4KMU X;  3F3X A;  1K78 B;  2KJB A;  5JFR A;  4ZYE A;  1ZRD A;  3ZMT A;  2F5E A;  2WWY A;  1OYI A;  3HUG A;  1R1T A;  5ICG A;  4MNU A;  4RGX A;  4TV7 A;  1MDM B;  3RKX A;  1HSJ A;  4RGR A;  3DPT A;  3REO A;  1TLH B;  1XCV A;  1J2X A;  4R8H A;  5HS9 A;  2EV6 A;  3IKV A;  1R23 A;  4FHT A;  3EDP A;  2L4M A;  1FY7 A;  1YO5 C;  1BN5 A;  1J5Y A;  4MGR A;  4IRI A;  4ETS A;  2E1C A;  1YS7 A;  4CXF A;  2CFX A;  3VOD A;  2OZU A;  5ILV A;  4IF4 A;  4UXN A;  1ZAR A;  4IHT A;  3JTH A;  2A68 F;  1XGM A;  3WTU C;  4HBL A;  2MC3 A;  3GZ5 A;  1HW2 A;  2GA1 A;  3LQQ A;  2XAS A;  1WQ2 A;  2HOE A;  3VEP A;  2XKP A;  1D8K A;  4MTE A;  2QYO A;  1ZH5 A;  1ZGA A;  2A6E F;  2P7V B;  2DQR A;  2EA2 A;  2BV6 A;  1TW3 A;  2KIF A;  1V3F A;  1CGP A;  2FE3 A;  2PJP A;  5H20 A;  4FX0 A;  1PP7 U;  1FT9 A;  1YFH A;  1ZAO A;  2ZXJ A;  1SAX A;  1GVJ A;  2CYY A;  4M71 A;  3W6K B;  5TRD A;  1G3T A;  1SD7 A;  2RN7 A;  3T1B A;  1KQ9 A;  5ICF A;  4UV8 A;  1H0M A;  4M6Y A;  2J5P A;  1XCB A;  1Z7U A;  1HQC A;  3I59 B;  3K0L A;  4U0Y A;  3FWE A;  3WTX C;  2D45 A;  1EH6 A;  4RS8 A;  5FFX A;  3WGG A;  4YFK F;  2FXA A;  3E6C C;  1DPR A;  4ZYG A;  2Q0O A;  4EGZ A;  2WC2 A;  3R0A A;  2IW5 A;  2M8E A;  3LST A;  1CF7 B;  4PGG A;  3TGN A;  3O2P E;  2PQ8 A;  4LJZ F;  3KEO A;  4CO8 A;  3HTS B;  3J7A O;  4Q5S F;  4OMZ A;  2FBI A;  1S7O A;  2EB7 A;  4JQF A;  2XKO A;  5E18 F;  5A2Q K;  5LGU A;  4CIC A;  3KFW X;  3SQN A;  4IJA A;  3FMR A;  1OR7 A;  4RB1 A;  3KE2 A;  4WF2 A;  5K5R A;  2FQ3 A;  2JT1 A;  5E8I A;  2NRA C;  2ELH A;  4HV5 A;  3RPQ A;  1ONV A;  3T5X A;  5DD8 A;  1FPQ A; 
#chains in the Genus database with same CATH topology
 4JK1 X;  1RUN A;  3NRV A;  1KU9 A;  1YW7 A;  2NOJ B;  3F23 A;  2QVO A;  3CJN A;  4KT5 C;  4UNO A;  2GIZ A;  3QYF A;  2Y0S A;  2M1B A;  4RM2 A;  5DCM B;  1VQ7 I;  3TQN A;  2K3P A;  1Z67 A;  1VZ0 A;  4IQ4 A;  4B44 A;  2EIJ H;  3BTJ A;  4BYY A;  3U21 A;  1DGR M;  5LGN A;  5EEA A;  4M3D A;  2DMN A;  4WK8 F;  2K4B A;  1XMK A;  3GZN B;  3KYD B;  1AKH A;  1TQI A;  3DV8 A;  1QA6 A;  1QHG A;  1X58 A;  3V8L A;  4A6E A;  3OR2 C;  4HNV A;  3RQ4 A;  1HBX G;  2HKX A;  4M9X A;  1TZL A;  1X2M A;  2HTS A;  1MD0 A;  3E7L A;  2L9V A;  2DT6 A;  3HRT A;  2L0K A;  2V79 A;  3HC7 A;  4HOB A;  2KRF A;  1LDJ A;  3ISP A;  1U8R A;  4LLN A;  4A3C J;  3GW2 A;  2N8G A;  1N25 A;  1IXR C;  3ABL H;  3CCS I;  5F1R A;  1I5Z A;  2NNN A;  2PN6 A;  4RAF A;  1GXP A;  1U5T A;  3T8R A;  3ZQF A;  4F3Q A;  3Q0W A;  3F8M A;  4PCQ A;  5D6F A;  5FKO A;  2HPM A;  1TWG J;  3LL7 A;  1LNW A;  4ASN A;  2VI6 A;  4PFP A;  2VPL A;  1UB9 A;  3D5S C;  5LLQ A;  3OYA A;  4XKV A;  4EQQ A;  2C6Y A;  2ZXW H;  2EIM H;  2OCC H;  1W5T A;  2XAH A;  4DNC A;  1FOK A;  3KIO A;  2PMH A;  3SEZ A;  1JKR C;  3ZQI A;  1RC9 A;  1TT5 B;  3J80 Z;  3HPG A;  2H1K A;  2QEN A;  4RAY A;  4BJ5 C;  3TW6 A;  2DU9 A;  2Z16 A;  2AXT C;  4AIH A;  4BQA A;  1IJW C;  3LNQ A;  2M7A A;  1MMS A;  2OF7 A;  3WG7 H;  5L3B A;  1J75 A;  4I76 A;  4IEJ A;  1G4D A;  3MKY B;  3WGH A;  1A6Q A;  5DUK A;  3W2W A;  1UHW A;  1VQ5 I;  4EJU A;  1BOA A;  4CCN A;  2IP2 A;  4P1W A;  2ELK A;  3UR3 C;  1WJF A;  1SD6 A;  1EH8 A;  1B1B A;  3HGY A;  3MZY A;  5EZG A;  2ZME B;  3WTZ A;  1IZ1 A;  4L9J A;  3IUO A;  3GFJ A;  2MLG A;  3F6V A;  3JCU C;  2KPM A;  1MSF C;  2NAZ A;  2NVQ J;  1AOY A;  2R7D A;  2BY2 A;  2HYG D;  3M9A A;  2QQ8 A;  4G12 A;  4KNY A;  4O3M A;  4LLL A;  5ICE A;  4XLF A;  3FM5 A;  3JRC A;  1DU6 A;  4H4K C;  3AAF A;  2OUM A;  3ABM H;  2R5Z A;  1IDY A;  2V1U A;  2F4O B;  1FTZ A;  1FNN A;  1HOM A;  2F48 A;  3ERE D;  3CUQ A;  3TOA A;  1ETW A;  2V6E A;  2VOD A;  2NVU B;  4E70 A;  5F0F A;  1RR8 C;  1JHF A;  2HYJ A;  5HOO A;  1HST A;  3S17 J;  3M8J A;  1IRG A;  2E2J J;  4ZC3 A;  2W00 A;  5KNL A;  1PDN C;  1S5L C;  2G9W A;  3LSK A;  1R71 A;  5D5U B;  3FMQ A;  2JZY A;  1KYW A;  4MQ9 F;  5DS9 A;  4ENK A;  1FZP B;  3F8C A;  3HHG A;  4IRH A;  3PIP F;  3MKL A;  4NQW A;  4C3J J;  2D5V A;  3F8N A;  3PQK A;  1ZR4 A;  3GME A;  4Q47 A;  4P9U A;  3S2D J;  3I3L A;  1APL C;  2R4G A;  1WJC A;  3GTM J;  1JTX A;  1ZHF A;  1ETK A;  2CUJ A;  4LG0 B;  1LFB A;  4II2 A;  4U0W A;  4R1H A;  5LBQ A;  1WJB A;  5EG0 A;  2VBZ A;  1XTA A;  1TQM A;  3RSN A;  1IUY A;  1B72 B;  4EV0 A;  1D0Z A;  1LE8 B;  2FU4 A;  2P81 A;  2ZJ2 A;  3ZPL A;  1H89 C;  1C0W A;  1A36 A;  2LRD A;  1ZRC A;  4ZH4 F;  2FOW A;  1QPI A;  4A3L J;  3LSM A;  2Q2E A;  3K4L A;  3BJO A;  5D8L B;  2H6C A;  4GFB A;  5LFA A;  2IGK A;  3DLA A;  4ZYD A;  1N75 A;  1R00 A;  2A07 F;  1I6X A;  3MKZ A;  2QF7 A;  4LLG F;  4A3B J;  1P6R A;  3VSK A;  3QRF F;  2VKE A;  4F52 A;  2Q1Z B;  2MC4 A;  3CJQ B;  4NHJ A;  1O57 A;  2KL4 A;  1TL8 A;  2DLL A;  5IT9 Z;  2X0L A;  4BHB A;  4XM3 A;  4IHY A;  1B9M A;  3FIW A;  1HKS A;  5DUI A;  1Y1W J;  5CQG A;  4YII A;  3V7S A;  3JRH A;  1VQN I;  3V7R A;  2DFF A;  3WU1 B;  1XD7 A;  4GGG A;  3L2V A;  1V54 H;  2L4A A;  4AU7 A;  4D7M A;  2JSC A;  1XSV A;  1E3P A;  1SEU A;  2FML A;  2LP0 A;  1UMQ A;  5FLX Z;  2EFW A;  2DOD A;  3IH4 A;  4Y33 A;  1BC8 C;  2PX9 A;  5L3D A;  3K4M A;  1I39 A;  2B0L A;  1TW2 A;  2LC2 A;  1QGP A;  3LWF A;  4EJT A;  1IRF A;  1WSU A;  3MKW B;  1FX7 A;  3OYM A;  4DBR A;  3RDI A;  2GXB A;  3QOE A;  4YEJ A;  3D0S A;  3K70 D;  4OAY A;  3BZC A;  3T8T A;  1G59 A;  5D8K B;  2BY0 A;  3AKZ A;  3QU6 A;  3KET A;  2IVM A;  4ESB A;  1ZLJ A;  5FD6 A;  1RI7 A;  2OA4 A;  1RRJ A;  4FAS D;  3SYT A;  2EQR A;  1A04 A;  3L2U A;  1BIB A;  1FMW A;  3Q0U A;  3QP6 A;  1MBH A;  2IGN A;  4FE4 A;  2QM3 A;  1KU7 A;  3DBH B;  3CCU I;  2EIL H;  2RVC A;  4L5I A;  1FWZ A;  1GUU A;  2OJE D;  4LOC A;  3AG4 H;  3F0C A;  2F2E A;  3HKZ N;  3OYI A;  4XL9 A;  1F1Z A;  4C9Y A;  2DMP A;  2K9S A;  3W2A A;  1X1B A;  1U2W A;  1K7A A;  5LGT A;  1VQK I;  2L01 A;  1W5S A;  2IGO A;  4AM3 A;  4WXC A;  3JRD A;  3HIF A;  3GYH X;  2TCT A;  3J7Z I;  1ZYR F;  5K5Q A;  3BP8 A;  3S1Q J;  1S7E A;  1T08 B;  2O9L A;  1GVD A;  1F9N A;  5HNF A;  2CRG A;  3Q3S A;  1SVL A;  2QQ9 A;  3TW7 A;  1RKT A;  3QQA A;  2HYF A;  5DTD A;  3Q9V A;  1ETQ A;  1ENH A;  3QYE A;  4BEH A;  4I98 B;  4BNC A;  1QBJ A;  1B6A A;  5ILS A;  4QLC U;  5F0C A;  5IP6 A;  4H0E A;  3RKW A;  3F6O A;  4CSW A;  1T56 A;  4CCM A;  2P8T A;  2VN2 A;  2JWT A;  4FET A;  2HXO A;  2CWE A;  4XIC A;  3DF8 A;  2ZB9 A;  1NK3 P;  3NAU A;  2HDW A;  2R7Q A;  3FXL A;  3HG9 A;  2PLY A;  4ZZD A;  3IAS 2;  5EF6 A;  1JHH A;  4S0H B;  3H3V K;  1VTN C;  2EFN A;  2L9N A;  2OZ6 A;  1HXD A;  2VJI A;  2LKP A;  3PO3 J;  4OU0 A;  3N4M A;  4HW0 A;  2L2O A;  3OL4 A;  1KU2 A;  3DEW A;  3PJR A;  2E36 A;  1WKM A;  4OIP F;  2IXS A;  5J4Y A;  5TIS C;  4I0B A;  4R79 A;  5FJ8 J;  2LYC A;  3KP2 A;  1LJ9 A;  1P4A A;  2DO7 A;  1TWC J;  2DTZ A;  2WB1 N;  3L2R A;  2HGC A;  1QPM A;  1SMT A;  4U87 A;  2K4J A;  1YW9 A;  3E5Q A;  3RKY A;  1Z6T A;  2CQQ A;  3HOT A;  2BZT A;  3CJR B;  3F22 A;  3SHF A;  1RUO A;  4OIO F;  3C7J A;  5J1U A;  1YS6 A;  1I3A A;  3CP2 A;  2BY1 A;  1IN4 A;  1IN7 A;  4CCO A;  2H09 A;  1BJZ A;  4YEL A;  3I5U A;  3D5R C;  5FO5 A;  4RBO A;  5K5O A;  4BJ6 C;  5M5X J;  4AWX B;  1AWC A;  2KIQ A;  2QBY A;  4A3I J;  4OIN F;  3J80 K;  2IBD A;  4IPA A;  1IXC A;  4IQJ A;  3ASN H;  2F5F A;  3M8F A;  2ZBK A;  4JX5 A;  1W7P B;  2XIG A;  1W1W E;  2V26 A;  4PDK A;  4WXD A;  1K78 A;  2X85 A;  2K9N A;  4AUX A;  2RQP A;  1PUF B;  1SFX A;  2JK3 A;  3ML6 A;  2LF7 A;  2WY7 Q;  4XKC A;  4E6K G;  3M4O J;  3B02 A;  3WOD F;  3DEU A;  1MJA A;  3RTR A;  1OCZ H;  5J1R A;  1NHA A;  2R5Y A;  1EH7 A;  2E35 A;  1XN7 A;  1MDM A;  3QU3 A;  4RB2 C;  2LR8 A;  2JJ7 A;  3I71 A;  5JHU A;  4BXX J;  4XSZ F;  3FM3 A;  2IPQ X;  1VQ9 I;  5IOZ A;  4DZP A;  2LKX A;  4LG3 A;  4OOI A;  5DV5 A;  2R7Z J;  2XB5 A;  3E3V A;  4E7Z A;  1BI3 A;  2VXD A;  4KIS A;  4UV9 A;  4B4C A;  2YX7 A;  2FQ4 A;  3CTA A;  5B66 C;  3MCZ A;  3MMY B;  4MLO A;  2K86 A;  5E1W A;  2DXI A;  1DPU A;  4YIR X;  3MFK A;  1SMY F;  1JUM A;  3ZN1 A;  2LMD A;  4G7H F;  3QP5 A;  1U9N A;  3QOP A;  1WRJ A;  3KEY A;  3BJA A;  5IP7 J;  3BTL A;  2IRF G;  2GM4 A;  2HZT A;  5CQE A;  5J6X A;  2F5V A;  1WJD A;  4LB5 A;  1FMV A;  1BBY A;  1YW8 A;  5F64 A;  3G1M A;  5J1Y A;  1HW5 A;  4WX9 A;  4BU2 A;  2RNJ A;  2DPU A;  3LAJ A;  2E5Z A;  4HF0 A;  4KFC A;  3BR1 A;  4PUS A;  1LDK B;  1JE8 A;  2XSD C;  1ZG3 A;  2F6C A;  4BUP A;  4XRF A;  3H9G A;  2UXN A;  3ROU A;  4FX4 A;  3CCY A;  2BW3 A;  2W7N A;  3GFM A;  4A3D J;  2EBI A;  1H9T A;  2KT0 A;  1GV5 A;  1RPW A;  4EM2 A;  4E4H A;  5D5V B;  5HS8 A;  2QLZ A;  5GTI C;  3ZMD A;  3J81 Z;  1FP2 A;  1IW7 F;  3COA C;  3BPX A;  5J47 A;  4HPQ A;  3CC4 I;  2ECC A;  4BE2 A;  2KLO A;  3L09 A;  1OR7 C;  2M34 A;  6PAX A;  3F8F A;  1YIO A;  3ZXS A;  5BQT A;  5D5W B;  2EH3 A;  4LK0 F;  3K4N A;  1FLI A;  2EZI A;  2CU7 A;  1I1G A;  5EDN A;  4UY8 I;  4MQV A;  5JLW A;  1E2X A;  1XGN A;  2MG4 A;  1MBJ A;  4BL0 B;  5E3N A;  4CYC A;  3DQV C;  1UEL B;  2Y9Y A;  5LEK A;  1Y39 A;  2LH9 A;  5IT9 K;  4BDY A;  2IS2 A;  5EGO A;  2A5Y B;  1VQO I;  3L2Q A;  1UFM A;  1HLV A;  2I8D A;  2XHK A;  2E34 A;  4KUM A;  3A02 A;  1YOV B;  2BHZ A;  3OYE A;  4UVC A;  1D5Y A;  4E7H A;  2DW4 A;  3CCR I;  3LA2 A;  5FLX K;  3IRR A;  5KCM A;  2KIS A;  3AG3 H;  2VT2 A;  2AO9 A;  4MEX F;  1T39 A;  2WV0 A;  1L0O C;  2E7W A;  4B8X A;  2ETH A;  2M0C A;  2VUM J;  5C4X J;  5F04 A;  3SDG A;  4C3I J;  3S3M A;  1MNM C;  3W3C A;  4G7O F;  3DXJ F;  2FD5 A;  2JTV A;  4M3E A;  4CCK A;  1DGW Y;  1R5H A;  3JRA A;  1FIA A;  3EYY A;  4A2U A;  1P2F A;  2ID3 A;  3M3Y J;  3I0T A;  1EV7 A;  2X6Y A;  3WTT C;  3L2W A;  1MIJ A;  3K1N A;  4N4O B;  3HTU A;  2ZFW A;  3EUA A;  1K4T A;  1OPC A;  3TL4 X;  2A05 A;  3DBR B;  4EGY A;  2X6X A;  2GAU A;  4U88 A;  1NTC A;  4M74 A;  4V2F A;  4E7K A;  3K4B A;  1JKQ C;  1FBU A;  2V4J C;  2LBF A;  4HZF A;  1R4M B;  1RKW A;  5KAI C;  1FOX A;  3TBI A;  3W6V A;  1BJA A;  3O8G A;  4MFE A;  2PFB A;  1GHC A;  3ZN0 A;  5D4S A;  5FGM A;  1EJ9 A;  4HRI A;  2DYR H;  3IH2 A;  5IPA A;  3G71 I;  2E19 A;  1IXS B;  1CF7 A;  1VQL I;  2VQC A;  2XRO A;  3HEF A;  4ENM A;  2L7M P;  4A5M A;  4GDF A;  3LSH A;  1ORK A;  1Z3Y A;  1FTT A;  2G7U A;  4LD5 A;  2X1C A;  4G6D A;  4XOP A;  2XF7 A;  2JN6 A;  2GOM A;  3V7C A;  2Y0S N;  3L00 A;  4DIQ A;  3QOD A;  3MZ8 A;  4A6D A;  1UST A;  1YHQ I;  3GTJ J;  4GYG A;  3PNY A;  1J7K A;  1Z77 A;  1HCR A;  2GXG A;  1Y8R B;  2KZV A;  3IC7 A;  1W7P D;  1F5T A;  2GLO A;  2CUF A;  3BG7 A;  2A5W A;  3ZMZ A;  3F72 A;  2PJR A;  4A93 J;  1XGO A;  3BCB A;  2Z99 A;  1MSE C;  1HW1 A;  4ABZ A;  3S1R J;  2OAZ A;  2CQK A;  4BAC A;  3FIS A;  2ISZ A;  3F21 A;  4FE7 A;  5D4R A;  3BG6 A;  1TWA J;  1KON A;  1Y0U A;  1VQ8 I;  5FD5 A;  5C3E J;  5AIQ A;  2R7T A;  1UAA A;  3IWZ A;  2QKL B;  4DYQ A;  3RIR A;  5KK1 A;  4NNJ A;  3KYC B;  3OSF A;  4A0Y A;  2QGU A;  4F91 B;  2O6G E;  2BXY A;  3HGG A;  4B3X A;  2RV8 A;  1G6N A;  4PK4 A;  2CUZ A;  4UB8 C;  3CME I;  3MD2 A;  4RM3 A;  4O5V A;  3TO6 A;  2D1V A;  2A6T A;  4ZYA A;  3FXU A;  2DK5 A;  4XNF A;  5DCM A;  2Y75 A;  2HDD A;  1SFE A;  4PJN A;  3GTK J;  2VQH A;  4AYB A;  2R7U A;  4HDV A;  2W48 A;  5D5X B;  4BXU A;  1Z05 A;  2RNG A;  2Z33 A;  3LMM A;  1SC7 A;  1MZB A;  2DA4 A;  3S8P A;  3S2W A;  5J8F A;  1UJ8 A;  2IGM A;  5HOD A;  3S1M J;  2IA2 A;  2B63 J;  4M3G A;  2EWN A;  5C4J J;  4JBA A;  5M5Y J;  1B8I B;  2DCE A;  2UXX A;  4PSW A;  4CDG A;  2E1M B;  1QQI A;  3TED A;  4J01 A;  5M3F J;  5HVQ C;  5GP9 A;  1AU7 A;  3TOB A;  2Y9Z A;  2HEO A;  1UG0 A;  3F8B A;  2HDC A;  4Y17 A;  4PSX A;  1Y8Q B;  2V6C A;  4RA2 A;  4D7N A;  1N78 A;  3HZJ A;  1WFX A;  4X6A J;  1MKM A;  1ITY A;  2HVQ A;  2L7Z A;  4AIJ A;  2XPW A;  1W4M A;  2XGD A;  4QTR A;  4YIF A;  3RZO J;  4BBS J;  1R6R A;  2CV1 A;  3SDB A;  4P9F A;  3ZQQ A;  1S8N A;  5ED4 A;  4M72 A;  1KQ8 A;  4AID A;  1QHH D;  2MLK A;  5J8C A;  2LK2 A;  4BS9 A;  5J40 A;  3KP6 A;  4OIR F;  4BHC A;  1FSH A;  3K2A A;  2IT0 A;  4FIS A;  1IG7 A;  3EPZ A;  4W1U A;  4ZTF A;  4RB3 C;  1VQ4 I;  1DDN A;  1E17 A;  1CQT A;  1D1B A;  4I09 A;  4PZJ A;  3GO5 A;  3IV5 A;  2WTE A;  3JRF A;  4L9T A;  5TGT A;  3B6C A;  2H6B A;  5E17 F;  1B9N A;  2DFH A;  3BRO A;  4XRS G;  2FF4 A;  1DP7 P;  2BVM A;  2R7V A;  2KRC A;  1G8X A;  3E97 A;  2J5O A;  1ULY A;  1R7J A;  1O3R A;  4HF2 A;  4P96 A;  1MW7 A;  2DT5 A;  4N9H A;  2CG4 A;  5M3M J;  2ZME A;  5L3F A;  2WAF A;  1IN5 A;  3VPR A;  5JVT A;  3S15 J;  2IAI A;  2M7B A;  4A3K J;  3AG1 H;  4IOA F;  2FJ1 A;  2R5Z B;  1LEA A;  5FB2 A;  4N0B A;  1R58 A;  3J81 K;  1IN8 A;  4E7I A;  2NOG A;  3I64 A;  3HOS A;  2VBW A;  5F27 A;  2E71 A;  1RNL A;  4RMN A;  2CGP A;  1R5G A;  3QPS A;  3BR3 A;  2W84 A;  2P7C B;  3T0Y A;  3RI4 A;  3LA7 A;  1Y6I A;  2JQ7 A;  2CS3 A;  4CCL A;  3OYD A;  1MJ9 A;  1USS A;  3UNG C;  1X19 A;  3J7A Y;  4HAM A;  1K6Y A;  3WU0 A;  4U7B A;  2LVS A;  1IRZ A;  4KYW A;  4EJV A;  4JOM A;  3K69 A;  1MMA A;  4HG2 A;  3I4M J;  2V7F A;  4D5C A;  1MND A;  4S04 A;  2O03 A;  1ZGJ A;  4BHP A;  5B1A H;  4RLQ A;  3MWM A;  2BEO A;  5CVV A;  3FXJ A;  1YRN B;  3PFY A;  1F36 A;  2YU9 J;  2QKM B;  1PUE E;  1V5E A;  2CH0 A;  3BOQ A;  5JR3 A;  3SJM A;  3OYG A;  3WTY C;  4LG0 A;  3I53 A;  3H3Z A;  2KQR A;  3JAM K;  2VE8 A;  4Y15 A;  3QAH A;  2H27 A;  1F4K A;  2DTR A;  5HS7 A;  4HLX A;  1IAW A;  4IHX A;  1JXS A;  1W0T A;  3PM1 A;  4L9V A;  4MFD A;  1LE8 A;  3BG3 A;  1B59 A;  2GZW A;  5K7H A;  3I4N J;  2QWW A;  4FT8 A;  3FXR A;  3NEU A;  4UVA A;  2V9V A;  2W25 A;  2AQF A;  1G2H A;  3GXO A;  2XPV A;  3E6M A;  1XGS A;  1JUS A;  4L5J A;  5DEQ A;  1ZR2 A;  1ZRF A;  3WE2 A;  4F7Z A;  1D5V A;  3FBN B;  3ULQ B;  1JJ6 C;  1U8B A;  1KYZ A;  1FOY A;  1TP4 A;  2HKO A;  1V4R A;  4XN3 A;  1GXQ A;  3FZV A;  4CA0 A;  1JGG A;  2FEZ A;  4PJL A;  2KIU A;  3FXQ A;  2W24 A;  2COM A;  4LGW A;  2VJ4 A;  1SVO A;  3R4K A;  3GTP J;  5CVU A;  4LK1 F;  1FOW A;  2W1O A;  5E20 A;  4IZZ A;  3LA3 A;  1WJA A;  3HXL A;  5BPD A;  2DK8 A;  1ZN2 A;  1VQ6 I;  2XPU A;  2XAF A;  2K3F A;  1UHS A;  2NYX A;  2PMZ N;  4PFO A;  3RKQ A;  4JP0 A;  3DLL F;  2IJL A;  1VND A;  4EM1 A;  3FKJ A;  1TNS A;  3G6E I;  2WAQ N;  4HNU A;  4XMY A;  3CC7 I;  2R7S A;  1UHM A;  3IHU A;  3GLL A;  1OJL A;  3NWS A;  3CCL I;  4Y4R A;  2CO5 A;  1J0R A;  2JUG A;  4F92 B;  3L2C A;  3PO2 J;  3P9I A;  1B4A A;  3LQR A;  4I0A A;  1DQU A;  5F08 A;  1XG1 A;  1LFU P;  4ESJ A;  1TQP A;  1D3Y A;  4BQQ A;  3TMO A;  4I99 C;  4LFU A;  1SFK A;  2Y69 H;  2B7E A;  3ASO H;  1X4O A;  4QPQ A;  2ADU A;  3RJP A;  5JHF A;  1TNT A;  5HDG A;  3OYF A;  4ZJZ A;  4XLN F;  2VB6 A;  5BMZ A;  2CFO A;  5H6Q A;  4ZDP A;  5FFZ A;  3A01 B;  4BE0 A;  4C2U A;  1BR1 A;  3OR1 C;  3K9T A;  3TP3 A;  3JTG A;  2QQA A;  3BZK A;  2L54 A;  2KIM A;  4A12 A;  1Y56 A;  3Q5F A;  4MIM A;  1LVA A;  3E1S A;  2KHM A;  2JPB A;  1S6L A;  3A4C A;  3P9K A;  4MO7 A;  4CHU A;  1YX3 A;  1KA8 A;  1T0F A;  2DA5 A;  3SFZ A;  1JGS A;  3A2K A;  4G9Y A;  2M0M A;  5H2F C;  2EA4 A;  1VF9 A;  1PJR A;  4IXA A;  5ICC A;  4EVI A;  4Y3O A;  3CO7 C;  5C44 J;  1P7J A;  1RR7 A;  1T95 A;  4M3F A;  4RAG A;  1D1A A;  3RQI A;  1Z1D A;  4DW6 A;  2QSH X;  4EEF G;  2JVG A;  2XRL A;  4BH9 A;  3JSO A;  2JSP A;  5AON A;  1OIS A;  4XBF A;  2R7R A;  3HOZ J;  2E5N A;  2ECB A;  3VDX A;  3AG2 H;  3TDZ C;  3WU2 C;  2CW0 F;  2QQB A;  2XGX A;  4KIC A;  1T8I A;  3OOU A;  3VYU B;  4XRS A;  3QPL A;  3OYL A;  5LHI A;  3JR9 A;  3U9G A;  2O8K A;  2PI0 A;  2VKD A;  4P55 A;  3M1C A;  3ZQ7 A;  3WGI A;  1LKX A;  1KQ0 A;  2MA3 A;  1MBG A;  3PNV A;  1SVM A;  3B6A A;  1P4X A;  1X2N A;  2M4K A;  4S05 A;  3VSL A;  3V8K A;  1UG2 A;  2EIK H;  2FBK A;  4CUG A;  4HNT A;  1R1V A;  3K4J A;  1PVE A;  2YR2 A;  2VT3 A;  5DYM A;  3CO6 C;  2M4G A;  2RDP A;  1QVT A;  4MHG A;  4CYD A;  3OY9 A;  3U1K A;  3HKZ A;  2P5K A;  4GXO A;  2EFP A;  2OTL I;  1IV6 A;  3E5U A;  3ZQG A;  1UCR A;  4DJA A;  2DMT A;  5GAD J;  2VXZ A;  1MMG A;  2KP6 A;  2NS8 A;  1J59 A;  5IYB J;  4A0Z A;  2LSO A;  3SZT A;  4RDU A;  3IH3 A;  2K9Q A;  3HOW J;  5BS6 A;  3RYP A;  2XAU A;  2STW A;  3KP3 A;  4W97 A;  2DPD A;  4KA4 A;  1BI2 A;  5K7Z A;  4M6V A;  3H5R A;  3KP5 A;  5HDK A;  2DOF A;  1LDD A;  3TKY A;  4B1R A;  3ESW B;  1OCT C;  5HLH A;  1Z21 A;  3OOP A;  4L5E A;  4RB0 A;  2MYS A;  1WPK A;  1O7L A;  2VL8 A;  4RGS A;  3BR5 A;  1LQ1 A;  2LLK A;  2VJ5 A;  2P0W A;  4Y13 A;  4A3M J;  3HUG B;  3LSI A;  3FF5 A;  5BPI A;  2MH9 A;  1OCP A;  1R49 A;  4CGZ A;  3FHZ A;  2LNB A;  3LFK A;  3PUF A;  4A3E J;  3CF5 F;  2RRE A;  1YI2 I;  1W7P A;  2F4I A;  3H3U A;  2K27 A;  3DKX A;  1RES A;  1ETO A;  1TTY A;  4D5F A;  1U78 A;  2MD5 A;  2OU2 A;  4UB6 C;  2LKS A;  1NG6 A;  1X1A A;  3OL3 A;  4CCJ A;  4IHW A;  4HEA 2;  1W5C C;  5LRS A;  3DBL B;  2QA4 I;  4E7J A;  3HYI A;  1BOB A;  2E1O A;  3ZGK A;  4XSX F;  1VQM I;  1QVU A;  1R5I D;  2A6H F;  2HVS A;  3K1M A;  1U6G A;  4Y7N J;  2V1X A;  4HQE A;  4J19 A;  4QIW N;  3L9F A;  1PP8 F;  2LFB A;  3OYJ A;  1G3Y A;  1P92 A;  4IHS A;  4OMY A;  3M1E A;  5EEH A;  2DOA A;  5HLG A;  4D1Q A;  5DD4 A;  4ANJ A;  1TWH J;  3G2B A;  1JTY A;  3GF2 A;  2HOS A;  3OWT A;  2HTJ A;  3D1N I;  3GBG A;  2GXA A;  1LVK A;  2F5D A;  2M45 A;  1D0Y A;  2FNA A;  3ZRG A;  1TWF J;  3MN2 A;  3ZQH A;  2BYV E;  1QRY A;  3FXO A;  1HF0 A;  2RKH A;  2Z5U A;  1OMI A;  1U9O A;  1DP3 A;  4YRV A;  4KN4 X;  4A3J J;  1S7A A;  2UV1 A;  4M3B A;  5DCF A;  2OQG A;  3MVP A;  3S14 J;  3AL0 C;  2EPF A;  3RPU D;  4KN7 X;  4A0X A;  2NVT J;  3BWG A;  2OBP A;  1IC8 A;  3CDI A;  4XN0 A;  2JRT A;  1V55 H;  3GEZ A;  1GT0 C;  4O6J A;  2ESH A;  3N05 A;  4YFX F;  1YJ9 I;  4X1E A;  5H6R A;  5ERI A;  2FX0 A;  1OYW A;  4C3H J;  1YIJ I;  2EZK A;  5JLX A;  3CCV I;  2FSW A;  2WAE A;  2Y30 A;  4PJM A;  3OIP A;  2KDZ A;  3BJ6 A;  3CCJ I;  3BZ6 A;  4HX8 A;  1H88 C;  2VAS A;  2LRE A;  3FXM A;  3ONQ A;  1OKR A;  2VBX A;  2ESN A;  2X1E A;  1YG2 A;  3GFI A;  1OYY A;  3DU5 A;  5M5W J;  4U7D A;  1PYV A;  1I1S A;  2XAJ A;  1S72 I;  3OYK A;  2P5L C;  1XB4 A;  1ZLK A;  4I7H A;  1FYK A;  3G73 A;  2DMU A;  1ZG1 A;  2DJN A;  3O3K A;  1U0J A;  2JA5 J;  1ETX A;  3BR2 A;  1IRX A;  1Z6R A;  2VC0 A;  4NC6 A;  1QZY A;  4OIQ F;  5TJJ A;  4ENN A;  1ZK8 A;  4L0Z B;  3P5J A;  3Q0V A;  2OC6 A;  2YPR A;  2AXL A;  1FYL A;  2DAO A;  3TO9 A;  5IOY A;  4XRM A;  2BBY A;  3TDU C;  2L9S A;  2X51 A;  3BTI A;  3GX4 X;  2XSJ C;  3DU6 A;  4IVN A;  2FBH A;  2E2I J;  4QSH A;  3VYS B;  2HQN A;  3ELK A;  3JAM Z;  4EM0 B;  3E5X A;  5CVJ A;  4QWQ A;  2O8X A;  3R60 A;  4XKW A;  3PNT A;  5E3L A;  2AHQ A;  3GUD A;  2UZK A;  1OQY A;  5LRR A;  5FKM A;  4GCV A;  4P5O A;  3H92 A;  4C2M J;  1K6O A;  3ECH A;  3MAJ A;  3ABU A;  1XSD A;  4UUV A;  3C1D A;  2R7W A;  5IY5 H;  3LSJ A;  3J7Y J;  2UWM A;  5KAF C;  1R9T J;  1OCO H;  1X4P A;  1ZQ3 P;  2O61 A;  1MMD A;  3IKT A;  4G94 A;  2AS5 F;  3SZP A;  4YFN F;  5F1J A;  3OYH A;  3H5A A;  4M9Z A;  1ON1 A;  4XKB A;  1QO0 D;  2ZNY A;  1REP C;  1K83 J;  4ON0 A;  3ZMV A;  3TP0 A;  1U5T C;  2DQL A;  1TBX A;  3K7A J;  3L1P A;  2H8W A;  2G0E A;  2YUS A;  3GZ6 A;  2WBM A;  2GQQ A;  3ZOB A;  3I59 A;  2B9S A;  4DQ2 A;  2MAB A;  1K79 A;  3ABK H;  1MGT A;  1FYM A;  3KPH A;  4BE1 A;  2VJJ A;  3M8E A;  4GO1 A;  1JUP A;  3E0J B;  2ZSH B;  3ABT A;  3RYR A;  3CMA I;  2HS5 A;  3WTS C;  2DN0 A;  2GIV A;  3BCA A;  1EA3 A;  1I27 A;  1ETY A;  4DGW B;  5JI6 A;  2DI3 A;  5LHG A;  2IS4 A;  4KIG A;  2VKV A;  4Q48 A;  1WH7 A;  2ZXH A;  2A61 A;  2ZO4 A;  2OD5 A;  3SXY A;  1FEX A;  5E79 C;  1D0X A;  2MBF A;  4AVZ A;  3I55 I;  5D6E A;  1LFP A;  3ZMS A;  3AL0 B;  2OCE A;  4J00 A;  1H8A C;  1N77 A;  4D0P A;  5GTH C;  2HR3 A;  3DPU A;  1AHD P;  2W82 A;  2P6S A;  4HX4 A;  1FC3 A;  3ZR8 X;  1YJN I;  2NS7 A;  3DTE A;  2R7X A;  2FA5 A;  2XGE A;  1W0U A;  2HQ5 A;  1XPX A;  1WI9 A;  4IRG A;  5EZH A;  1R36 A;  4UUS B;  4D9J A;  1HKQ A;  2NNY A;  3VFZ A;  1E3H A;  4BQN A;  4AYB N;  1T98 A;  4DBQ A;  1JKP C;  3KZY A;  2QZ8 A;  2V9K A;  4QPO A;  3DKW A;  1XDS A;  2VBY A;  2CMP A;  3CUQ C;  3V4G A;  3I4P A;  1BA5 A;  3BTC A;  1JT6 A;  4N4N B;  1MH3 A;  5CLS A;  1L3L A;  5L3C A;  1YTY A;  2PG4 A;  4HX7 A;  2GOX B;  3M7G A;  4XLH A;  4E7L A;  3I58 A;  2P6T A;  3GTQ J;  2YU3 A;  3LAP A;  5DM6 F;  3IWF A;  4UHT A;  3AFH A;  2DA7 A;  2VC1 A;  2G7H A;  3HOU J;  3KEQ A;  2LD5 A;  2VIX A;  4HDU A;  5DM7 F;  5KVR A;  2QSF X;  3VYT B;  2HQR A;  2KRH A;  5B1B H;  1ZGW A;  1O7F A;  1FSE A;  2HOA A;  2BHY A;  3K6G A;  1AKH B;  3MEX A;  4WWC A;  1ZRE A;  5L3G A;  2ME0 A;  4M9S A;  2LTP A;  3PUB A;  4JX6 A;  5HLI A;  3BG5 A;  3V42 A;  4CZZ A;  2R92 J;  3PSF A;  2MGQ A;  3S32 A;  3DKY A;  3IL2 A;  1S3J A;  1O4X A;  2VQL A;  3EUH A;  3L7W A;  4XOR A;  4G6Q A;  3OS2 A;  3I56 I;  1SD4 A;  4IOC F;  5DDG A;  4L9N A;  4XLE A;  4ESF A;  4RAZ A;  3BQY A;  2DT7 B;  1KGS A;  2XV4 S;  3ZQC A;  1GDT A;  4UVB A;  3QPT A;  1XSX A;  5FRM A;  2W4S A;  3CD6 I;  3K4C A;  5CPR B;  2IA1 A;  1U5T B;  5GAH J;  1B8I A;  3HJE A;  1IN6 A;  2LF8 A;  3WHC A;  1X3U A;  3U2R A;  4HSR A;  4K2E A;  4NB5 A;  4Z2Y A;  3D5L A;  2R0Q C;  2ZSI B;  1BIA A;  3R61 A;  3ERM A;  2HZD A;  2X6O A;  1YYV A;  4AVP A;  4IO9 F;  1WZ2 A;  5E1X A;  2R3S A;  3KZZ A;  1LPQ A;  1XMX A;  1JI8 A;  2MSY A;  3OIO A;  3EYI A;  3VWB A;  3GTG J;  1POG A;  1IUF A;  3GVA A;  3SFI A;  4UUT A;  4C30 A;  5BOX A;  2E1N A;  1WH5 A;  1IO2 A;  1YE9 A;  4BQO A;  5HDN A;  4EJO A;  2XDV A;  2XB0 X;  3H36 A;  1Z3X A;  3JRB A;  2XUB A;  2XF6 A;  3WG9 A;  2EK5 A;  1IGN A;  1FP1 D;  5E8G A;  2FNP A;  2JPC A;  1FBS A;  3TO7 A;  4MTD A;  1U3E M;  1T38 A;  1X1P A;  4KDP A;  2NS0 A;  4Y52 J;  3HOY J;  3WTV C;  3PIO F;  4BAY A;  2YSR A;  4LMY A;  2FUG 2;  1QZZ A;  1SD5 A;  1RET A;  1Z0X A;  2E7X A;  5J3L A;  5L3E A;  3KCC A;  4EJW A;  1Q1V A;  3GFL A;  4I6Z A;  4B09 A;  5EEG A;  2DJI A;  4M73 A;  1O3T A;  2DMQ A;  2MD0 A;  1J09 A;  3I54 A;  3I9V 2;  3IRQ A;  4AD9 A;  1YIT I;  2FRH A;  3LOC A;  2KMU A;  3BR6 A;  3FDY A;  3ECO A;  1G3W A;  3ZP5 A;  5GPC A;  3CUQ B;  1BW6 A;  3OYN A;  2MFZ A;  3HRU A;  2KJC A;  2M3A A;  4RGU A;  1BI0 A;  3CUO A;  1FBQ A;  2RC4 A;  3PFI A;  2ZCW A;  2GA2 A;  4YG2 F;  2XRN A;  1SFO J;  2BGC A;  5LEJ A;  1JJ8 C;  3HL2 A;  2R7F A;  2XVC A;  3HSF A;  4FCY A;  3EQL F;  2O5R A;  2BXZ A;  3CDH A;  2JVH A;  3HOV J;  2DFI A;  3V8J A;  3G3Z A;  3GLX A;  1IF1 A;  1T0F C;  2Z9O A;  3U1D A;  4RLF A;  3Q9S A;  3DPL C;  4N9I A;  3IAM 2;  3R0J A;  1R4N B;  2K02 A;  2DBB A;  1GV2 A;  2R7O A;  4M6X A;  1S9H A;  1OFC X;  2YX4 A;  4NQW B;  4DZJ A;  3KLN A;  5B5E C;  1R1U A;  2EJR A;  4X0G A;  1W36 C;  3VB2 A;  2XAG A;  2M9H A;  2CV2 A;  2GWR A;  3C2G A;  1H9G A;  1A6I A;  2JA2 A;  2NVY J;  3R6S A;  3S3O A;  2PMU A;  3JW4 A;  3QPH A;  1WJ5 A;  2EV5 A;  2FMY A;  3P7N A;  5EG0 B;  5IYD J;  1EF4 A;  3A1Y A;  5BNG A;  3HRM A;  2BE5 F;  1K4S A;  1F43 A;  1YRN A;  2W57 A;  2M30 A;  3FXK A;  3WTW C;  3G1L A;  2LG4 A;  4HYE A;  2KDO A;  2KKO A;  4F55 A;  1B72 A;  1P4W A;  3NWT A;  2K9M A;  2CW8 A;  2O0Y A;  3M07 A;  2GBY A;  3CLQ A;  1AA7 A;  2XAQ A;  4Q4Z F;  2X6W A;  2RGV A;  1D8J A;  2Q2E B;  2F5C A;  2KZG A;  1MH4 A;  3NQO A;  4G6T B;  4XOT A;  3WE3 A;  1GLN A;  4BDZ A;  4HV6 A;  1MBE A;  4L0Y B;  3CQZ J;  3BDD A;  1JKO C;  3PL8 A;  3GTL J;  2CQX A;  2AQE A;  1P7I A;  3SEQ A;  1ZG5 A;  2P4W A;  4FQG A;  3A0H C;  4A5N A;  2ACJ A;  2OPT A;  4KIB A;  2CUE A;  2MW8 A;  3DTK A;  3UKG A;  4PGH A;  2K7L A;  2V1D A;  1STZ A;  2ZNZ A;  2ID6 A;  3HRS A;  3IP4 B;  5FRN A;  3K1P A;  3E6D A;  1O3Q A;  5F6F A;  3ZMU A;  3K2Z A;  3W6J B;  3DP7 A;  1K61 A;  4L18 B;  1MJB A;  2DOE A;  4C2T A;  1DUX C;  3PSI A;  1HC8 A;  4I01 A;  4B48 A;  1RIO H;  5EYR A;  4KIF A;  5CYV A;  2W85 A;  4PJ0 C;  3CCQ I;  4G8X A;  2P5V A;  1SAU A;  3WHB A;  4KJZ A;  4AIK A;  5CVI A;  4HF1 A;  3RPU A;  4E7S A;  3S3N A;  3MQ0 A;  4G7Z F;  1ODD A;  4EMS A;  3BQZ A;  2VOO A;  3EET A;  3G1O A;  2OV7 A;  1LEB A;  2E2H J;  5HLT A;  2VOP A;  3FX3 A;  1WWX A;  4KT6 A;  3KP7 A;  1Z9C A;  2ZKZ A;  1G3S A;  4Z6Y A;  1HA8 A;  2TDX A;  3JSP A;  2NVX J;  2X4H A;  1HKT A;  2ZC2 A;  2A69 F;  3FHN A;  5K1Y A;  2IS6 A;  2PEX A;  1X1C A;  2Z3Y A;  1R22 A;  4XLC A;  3HHH A;  2ZFU A;  1BL0 A;  1WJE A;  2EFO A;  1LB2 A;  2ELJ A;  2ISY A;  2STT A;  3SZG A;  2F4M B;  2Y31 A;  4A3F J;  1WVR A;  4AC0 A;  3H35 A;  1TT0 A;  3RZD J;  5IP9 J;  2Q8K A;  1A35 A;  3N97 A;  5E3O A;  2Y0M A;  4HA8 A;  2R93 J;  2Y48 A;  4ZYH A;  5LHH A;  3A01 A;  4BKX A;  2DDB A;  3KLO A;  4LIU A;  3OIQ A;  3RCO A;  2D2W A;  2A3S A;  3DCF A;  2CQN A;  3C18 A;  2M87 A;  3BR0 A;  4NBQ A;  2L9R A;  1Z91 A;  4XQF A;  1M1E B;  2D1H A;  1ON2 A;  1BR2 A;  2M5W A;  3E6B A;  1I50 J;  1BW5 A;  1FIP A;  1SFU A;  2QUF A;  4A69 C;  2K40 A;  1RZ4 A;  4GRI A;  1IDZ A;  2PBI A;  3LSG A;  4WCG A;  3FMS A;  1Q1H A;  2PMZ A;  3OV8 A;  1T2K A;  3HDD A;  2HWV A;  2VPR A;  1MBK A;  4BEH B;  2WV1 A;  3HSR A;  2DA6 A;  3LSR A;  2X1D A;  5CVR A;  5FKL A;  1A31 A;  1IV8 A;  4CZC A;  2WAQ A;  2E60 A;  5FKN A;  3HOX J;  2JA8 J;  4I2O A;  4ENJ A;  2V1N A;  4V2G A;  3PQJ A;  4WXH A;  2H94 A;  2CQ7 A;  2ICW G;  2L7K A;  3H1C A;  3FK6 A;  4JX4 A;  4LB6 B;  5KHD A;  1YQA A;  5ILU A;  2HFH A;  5LD2 C;  1VQP I;  4PJJ A;  1QNT A;  5A2Q Z;  1XMA A;  5IT3 A;  4XID A;  3VOE A;  1VI0 A;  1A5J A;  1S29 A;  2MH2 A;  4HQM A;  1XS9 A;  3C2H A;  2M2E A;  1BI1 A;  4I02 A;  3H9J A;  4U0V A;  3HSE A;  2EFQ A;  2L3D A;  3P9C A;  3OS0 A;  2EV0 A;  3JRG A;  3MZH A;  3B73 A;  2HI3 A;  1T6S A;  3KP4 A;  5EJC A;  2VE9 A;  3C2B A;  1X3Z B;  1TC3 C;  3C3W A;  4NUB A;  4OAZ A;  3BLY A;  4ZZL A;  2L02 A;  3KYL A;  3DTI A;  3H9Q A;  5GAE J;  4XLP F;  2HOT A;  3S2H J;  3BPV A;  2VKH A;  2DFE A;  1OCR H;  5E1Z B;  1J9I A;  3GWZ A;  2RAE A;  1BM9 A;  5CJ9 A;  4GYI A;  1KU3 A;  5AIP A;  1MBF A;  1V5G A;  4MEY F;  4ZDL A;  2IA0 A;  3CLO A;  2LDU A;  2X9D A;  3DFG A;  2O3F A;  2LY1 A;  5FRO A;  4NC7 A;  2OQR A;  2QBY B;  1XDU A;  4HLY A;  1O3S A;  3S1N J;  3BY6 A;  1YLF A;  5FLV A;  2FOK A;  3OS1 A;  2V9P A;  2CSO A;  1BC7 C;  4JYK A;  2HQA A;  3CJT B;  4KMF A;  1WGX A;  1NK2 P;  4ITV A;  5FLM J;  3O6B B;  2VON A;  2UUZ A;  4KMU X;  3F3X A;  1K78 B;  3CC2 I;  3S93 A;  2KJB A;  5JFR A;  2EZL A;  4ZYE A;  1ZRD A;  3ZMT A;  2F5E A;  3DEE A;  4ZDO A;  3O8H A;  2XC7 A;  4BY1 J;  4CH7 A;  1Z7L A;  2WWY A;  1PUF A;  1OYI A;  3HUG A;  3NAR A;  1R1T A;  5J4V A;  5ICG A;  2BY3 A;  4MNU A;  3CCE I;  4RGX A;  4TV7 A;  2R5Y B;  1MDM B;  2HU9 A;  1WCM J;  3RKX A;  1HSJ A;  2WB1 A;  4RGR A;  2QCO A;  3DPT A;  1Y0N A;  2VLA A;  3REO A;  1TLH B;  4IKF A;  1XCV A;  4KIT B;  1J2X A;  2M8G X;  4R8H A;  1D1C A;  1MMN A;  5HS9 A;  2I10 A;  5GPA A;  5E3M A;  1XC5 A;  1DU0 A;  2EV6 A;  2K5C A;  3IKV A;  4V19 K;  3CF2 A;  1E0E A;  5B3S H;  1R23 A;  4BBR J;  4FHT A;  5FKK A;  3EDP A;  2LY2 A;  2HNH A;  4DYC A;  1E3O C;  2L4M A;  3K4K A;  1FY7 A;  3HB9 A;  4XR6 A;  1YO5 C;  3A03 A;  1P9Q C;  1BN5 A;  1J5Y A;  4MGR A;  4IRI A;  4ETS A;  2E1C A;  2LY9 A;  2QEX I;  1YS7 A;  3LFU A;  4CXF A;  2IS1 A;  2CFX A;  3EUK L;  3VOD A;  2OZU A;  3FK7 A;  5ILV A;  2CW7 A;  1HDD C;  2BW3 B;  4FTH A;  2JA6 J;  3QWL A;  3FKI J;  2Z2S B;  3HBL A;  3JRE A;  2Z1D A;  4IF4 A;  5HNH A;  3FBI B;  3QYB A;  3LSP A;  2L5Q A;  4UXN A;  1VFC A;  1ZAR A;  4XON A;  4BGD A;  2QSG X;  2XGC A;  4B3A A;  4IHT A;  3CMM A;  3JTH A;  2A68 F;  2NXN B;  1XGM A;  2EIN H;  4ZTJ A;  1ZTR A;  2DYS H;  1OLT A;  3WTU C;  3A0B C;  4HBL A;  2MC3 A;  4B43 A;  3GZ5 A;  3CMY A;  5JVG F;  1HW2 A;  2GA1 A;  3LQQ A;  1ETV A;  1WQ2 A;  2O7O A;  2XAS A;  3F9K A;  2HOE A;  2H8R A;  4CYC B;  4HST A;  3VEP A;  2XKP A;  3DWL E;  1D8K A;  2IEK A;  2BVL A;  4MTE A;  2Y2Z A;  2LOO A;  2RQQ A;  2QYO A;  1ZH5 A;  1ZGA A;  2BOL A;  5EGO B;  2XF5 A;  2A6E F;  1QZE A;  4IHV A;  2P7V B;  2DQR A;  5F0H A;  3GTO J;  1I3Q J;  2EA2 A;  2BV6 A;  1TW3 A;  2DA3 A;  1V3F A;  2KIF A;  1CGP A;  3H0D A;  3K70 C;  2FE3 A;  1X1D A;  2PJP A;  2DDA A;  3BG9 A;  5H20 A;  1MNE A;  3ZCO A;  1W36 D;  4FX0 A;  1Y1V J;  1OCC H;  1FT9 A;  2I5U A;  1YFH A;  1PP7 U;  4XK4 A;  2JA7 J;  1ZAO A;  2ZXJ A;  5IYC J;  4A3G J;  5GAG J;  3CP8 A;  4IX7 A;  1SAX A;  3K10 A;  3EUH C;  1GVJ A;  2CYY A;  2TRT A;  4M71 A;  1V5F A;  3W6K B;  5TRD A;  1G3T A;  1SD7 A;  4B47 A;  1EKE A;  3H0G J;  2ZJQ F;  3CZ6 A;  2K9L A;  4BJT A;  4NDL A;  2RN7 A;  3X2Q H;  3OYB A;  3T1B A;  1KZH A;  1KQ9 A;  2JUC A;  3CES A;  2ME6 A;  4F93 B;  5ICF A;  4UV8 A;  3VYR B;  1H0M A;  2KFD A;  4M6Y A;  2J5P A;  1XCB A;  2E1M C;  1Z7U A;  1HQC A;  3I59 B;  1QU3 A;  4LIT A;  3K0L A;  3OYC A;  2ZJR F;  4U0Y A;  1SAN A;  1T33 A;  3FWE A;  4BY7 J;  3OSG A;  1X3W B;  1LUJ B;  3WTX C;  2LBF B;  2D45 A;  3GCM A;  1EH6 A;  2JRM A;  5K7F A;  4RS8 A;  5FFX A;  3W2V A;  3WGG A;  4YFK F;  2FXA A;  1ERD A;  3E6C C;  1FJL A;  2JMW A;  1YJW I;  1DPR A;  2H1L A;  4ZYG A;  3JRI A;  2Q0O A;  9ANT A;  2HVR A;  4EGZ A;  2WC2 A;  3R0A A;  4LIV A;  2IW5 A;  2M8E A;  4NC8 A;  3LST A;  1UZC A;  3KZI C;  3CDL A;  5CKT A;  3CCM I;  1WHU A;  1CF7 B;  2EZH A;  4PGG A;  3BC8 A;  4OWR B;  3TGN A;  1NG7 A;  3HM5 A;  3OMY A;  3O2P E;  2VQG A;  4BXF A;  3HPH A;  2PQ8 A;  2WAD A;  2L7F P;  3BT9 A;  2HXI A;  2OTJ I;  1HDP A;  1ZKG A;  3KX2 A;  4LJZ F;  3KEO A;  4CO8 A;  3S16 J;  3G4S I;  3H5N A;  3HTS B;  3J7A O;  4Q5S F;  4OMZ A;  1NH3 A;  1ACI A;  1I6H J;  2FBI A;  1ZEL A;  2ZME C;  2WA0 A;  1S7O A;  2EB7 A;  4JQF A;  2XKO A;  2X48 A;  5E18 F;  5A2Q K;  4XLA A;  5LGU A;  3ZQL A;  2CJJ A;  4CIC A;  4II3 A;  2YS9 A;  3KFW X;  2COB A;  4UUS A;  3SQN A;  2PJR B;  2ZXI A;  2DA2 A;  4IJA A;  1WI3 A;  1JT0 A;  3FMR A;  2ZJP F;  2CV0 A;  1OR7 A;  4DOZ A;  4RB1 A;  1BR4 A;  3KE2 A;  4WF2 A;  5K5R A;  2FQ3 A;  1XX5 A;  4DYR A;  4EAT A;  2JT1 A;  5E8I A;  2NRA C;  2ELH A;  2DA1 A;  4HV5 A;  3RPQ A;  1YX5 A;  1ONV A;  3T5X A;  5DD8 A;  2HPI A;  2K85 A;  1FPQ A;  4IL6 C;  2WY8 Q; 
#chains in the Genus database with same CATH homology
 4JK1 X;  1RUN A;  3NRV A;  1KU9 A;  1YW7 A;  3F23 A;  2QVO A;  3CJN A;  4KT5 C;  4UNO A;  2M1B A;  5DCM B;  3TQN A;  4BYY A;  5LGN A;  4WK8 F;  2K4B A;  1XMK A;  1TQI A;  3DV8 A;  3V8L A;  4A6E A;  1HBX G;  2HKX A;  4M9X A;  2HTS A;  1MD0 A;  3HRT A;  2V79 A;  4HOB A;  2KRF A;  1LDJ A;  3ISP A;  1U8R A;  4LLN A;  3GW2 A;  1IXR C;  5F1R A;  1I5Z A;  2NNN A;  2PN6 A;  1GXP A;  1U5T A;  3T8R A;  3F8M A;  4PCQ A;  5D6F A;  1LNW A;  4ASN A;  1UB9 A;  5LLQ A;  4EQQ A;  2C6Y A;  1FOK A;  1W5T A;  2XAH A;  4DNC A;  2PMH A;  3J80 Z;  2QEN A;  4RAY A;  2DU9 A;  4AIH A;  4BQA A;  1J75 A;  5L3B A;  1G4D A;  3WGH A;  5DUK A;  1UHW A;  4EJU A;  1BOA A;  2IP2 A;  1SD6 A;  1EH8 A;  1B1B A;  3MZY A;  3WTZ A;  2ZME B;  1IZ1 A;  4L9J A;  3GFJ A;  2MLG A;  3F6V A;  2NAZ A;  1AOY A;  2R7D A;  2HYG D;  3M9A A;  4KNY A;  4O3M A;  4LLL A;  5ICE A;  3FM5 A;  3AAF A;  2V1U A;  1FNN A;  3ERE D;  3CUQ A;  3TOA A;  2VOD A;  4E70 A;  1JHF A;  5HOO A;  1HST A;  1IRG A;  1PDN C;  2G9W A;  5D5U B;  3FMQ A;  2JZY A;  1KYW A;  4MQ9 F;  4ENK A;  1FZP B;  3F8C A;  3HHG A;  4IRH A;  4NQW A;  3F8N A;  3PQK A;  4Q47 A;  4P9U A;  1ZHF A;  4LG0 B;  4U0W A;  4R1H A;  5LBQ A;  2VBZ A;  1TQM A;  1IUY A;  4EV0 A;  2FU4 A;  2ZJ2 A;  3ZPL A;  1C0W A;  1ZRC A;  4ZH4 F;  2Q2E A;  3BJO A;  5D8L B;  2H6C A;  4ZYD A;  1R00 A;  2A07 F;  1I6X A;  4LLG F;  1P6R A;  3QRF F;  4NHJ A;  1O57 A;  2DLL A;  5IT9 Z;  2X0L A;  4BHB A;  1B9M A;  1HKS A;  5DUI A;  4YII A;  3V7S A;  3V7R A;  3WU1 B;  1XD7 A;  4GGG A;  2L4A A;  2JSC A;  1XSV A;  2FML A;  5FLX Z;  2EFW A;  1BC8 C;  5L3D A;  2B0L A;  1TW2 A;  1QGP A;  3LWF A;  4EJT A;  1IRF A;  1WSU A;  1FX7 A;  2GXB A;  3RDI A;  3D0S A;  3T8T A;  5D8K B;  3QU6 A;  3KET A;  2IVM A;  4ESB A;  1ZLJ A;  5FD6 A;  1RI7 A;  2OA4 A;  1A04 A;  1BIB A;  3QP6 A;  1KU7 A;  2QM3 A;  2RVC A;  4L5I A;  1FWZ A;  2F2E A;  1F1Z A;  1U2W A;  1K7A A;  5LGT A;  2L01 A;  1W5S A;  4WXC A;  3HIF A;  3GYH X;  1ZYR F;  5K5Q A;  3BP8 A;  1F9N A;  2QQ9 A;  2HYF A;  3Q9V A;  4I98 B;  4BNC A;  1QBJ A;  1B6A A;  5ILS A;  4QLC U;  4H0E A;  3RKW A;  3F6O A;  2P8T A;  2VN2 A;  2CWE A;  3DF8 A;  2PLY A;  4ZZD A;  1JHH A;  1VTN C;  2EFN A;  2OZ6 A;  1HXD A;  2LKP A;  4OU0 A;  3N4M A;  4HW0 A;  1KU2 A;  4OIP F;  1WKM A;  4I0B A;  4R79 A;  3KP2 A;  1LJ9 A;  1P4A A;  2DO7 A;  2HGC A;  1QPM A;  1SMT A;  2K4J A;  1YW9 A;  3E5Q A;  3RKY A;  1Z6T A;  3HOT A;  3F22 A;  3SHF A;  1RUO A;  4OIO F;  3C7J A;  1YS6 A;  1IN4 A;  1IN7 A;  2H09 A;  3I5U A;  5FO5 A;  5K5O A;  4AWX B;  1AWC A;  2QBY A;  4OIN F;  3J80 K;  4IPA A;  1IXC A;  2F5F A;  3M8F A;  2ZBK A;  1W7P B;  2XIG A;  4PDK A;  4WXD A;  1K78 A;  2RQP A;  1SFX A;  3ML6 A;  2LF7 A;  3B02 A;  3WOD F;  3DEU A;  1MJA A;  3RTR A;  1NHA A;  1EH7 A;  1MDM A;  1XN7 A;  3QU3 A;  4RB2 C;  3I71 A;  5JHU A;  4XSZ F;  3FM3 A;  2IPQ X;  4OOI A;  5DV5 A;  3E3V A;  1BI3 A;  4UV9 A;  2YX7 A;  3CTA A;  3MCZ A;  5E1W A;  1DPU A;  2K86 A;  3MFK A;  1SMY F;  3ZN1 A;  4G7H F;  3QP5 A;  3QOP A;  1WRJ A;  3BJA A;  2IRF G;  2HZT A;  5J6X A;  4LB5 A;  1BBY A;  1YW8 A;  5F64 A;  1HW5 A;  4WX9 A;  2RNJ A;  2DPU A;  3LAJ A;  4KFC A;  4HF0 A;  1LDK B;  1JE8 A;  1ZG3 A;  4XRF A;  2UXN A;  3ROU A;  4FX4 A;  3GFM A;  1H9T A;  4EM2 A;  5D5V B;  5HS8 A;  2QLZ A;  3ZMD A;  3J81 Z;  1FP2 A;  1IW7 F;  3COA C;  3BPX A;  3L09 A;  6PAX A;  3F8F A;  1YIO A;  5BQT A;  5D5W B;  4LK0 F;  1FLI A;  1I1G A;  4MQV A;  1E2X A;  1XGN A;  3DQV C;  5LEK A;  5IT9 K;  2A5Y B;  1UFM A;  2XHK A;  4KUM A;  4UVC A;  2DW4 A;  3LA2 A;  5FLX K;  3IRR A;  2VT2 A;  4MEX F;  1T39 A;  2WV0 A;  1L0O C;  2E7W A;  4B8X A;  2ETH A;  4G7O F;  3DXJ F;  2JTV A;  1R5H A;  3EYY A;  4A2U A;  1P2F A;  3I0T A;  1EV7 A;  3WTT C;  3K1N A;  3HTU A;  2ZFW A;  1OPC A;  4EGY A;  2GAU A;  4U88 A;  4M74 A;  1FBU A;  4HZF A;  1BJA A;  2PFB A;  1GHC A;  3ZN0 A;  5D4S A;  5FGM A;  1IXS B;  1CF7 A;  2XRO A;  4ENM A;  4A5M A;  2G7U A;  4LD5 A;  4G6D A;  3V7C A;  3L00 A;  4A6D A;  1UST A;  4GYG A;  1J7K A;  2GXG A;  3IC7 A;  1W7P D;  1F5T A;  3ZMZ A;  3F72 A;  1XGO A;  2Z99 A;  1HW1 A;  2OAZ A;  2CQK A;  2ISZ A;  3F21 A;  5D4R A;  1Y0U A;  5FD5 A;  5AIQ A;  3IWZ A;  3RIR A;  5KK1 A;  4A0Y A;  2O6G E;  2RV8 A;  1G6N A;  4O5V A;  3TO6 A;  2D1V A;  3FXU A;  2DK5 A;  5DCM A;  2Y75 A;  1SFE A;  4HDV A;  5D5X B;  4BXU A;  1Z05 A;  2Z33 A;  1MZB A;  3S2W A;  5J8F A;  2IA2 A;  2EWN A;  4JBA A;  2UXX A;  4CDG A;  1QQI A;  5HVQ C;  3TOB A;  2HEO A;  2HDC A;  3F8B A;  4Y17 A;  2V6C A;  1MKM A;  4AIJ A;  1W4M A;  4YIF A;  4P9F A;  1S8N A;  5ED4 A;  4M72 A;  1KQ8 A;  2MLK A;  5J8C A;  3KP6 A;  4OIR F;  4BHC A;  1FSH A;  2IT0 A;  4RB3 C;  1DDN A;  1E17 A;  4I09 A;  4PZJ A;  3GO5 A;  2WTE A;  4L9T A;  2H6B A;  5E17 F;  1B9N A;  3BRO A;  2FF4 A;  1DP7 P;  3E97 A;  2J5O A;  1ULY A;  1R7J A;  1O3R A;  4HF2 A;  4P96 A;  2DT5 A;  4N9H A;  2CG4 A;  2ZME A;  5L3F A;  1IN5 A;  5JVT A;  1LEA A;  5FB2 A;  4N0B A;  1R58 A;  3J81 K;  1IN8 A;  3I64 A;  3HOS A;  2VBW A;  1RNL A;  2CGP A;  1R5G A;  2W84 A;  2P7C B;  3T0Y A;  3RI4 A;  3LA7 A;  1MJ9 A;  1USS A;  4HAM A;  3WU0 A;  4U7B A;  4KYW A;  4EJV A;  3K69 A;  4S04 A;  2O03 A;  1ZGJ A;  4BHP A;  3MWM A;  2BEO A;  5CVV A;  1PUE E;  3BOQ A;  5JR3 A;  3WTY C;  4LG0 A;  3I53 A;  3H3Z A;  3JAM K;  2VE8 A;  4Y15 A;  3QAH A;  2H27 A;  1F4K A;  2DTR A;  5HS7 A;  4HLX A;  1IAW A;  1JXS A;  4L9V A;  1B59 A;  2GZW A;  2QWW A;  4FT8 A;  3FXR A;  3NEU A;  4UVA A;  2V9V A;  2W25 A;  3GXO A;  3E6M A;  1XGS A;  4L5J A;  5DEQ A;  1ZRF A;  3WE2 A;  4F7Z A;  1D5V A;  3ULQ B;  1KYZ A;  2HKO A;  1V4R A;  1GXQ A;  3FZV A;  2FEZ A;  2KIU A;  3FXQ A;  2W24 A;  2COM A;  4LGW A;  3R4K A;  5CVU A;  4LK1 F;  5E20 A;  3LA3 A;  5BPD A;  2DK8 A;  1ZN2 A;  2XAF A;  2NYX A;  2IJL A;  4EM1 A;  1TNS A;  1UHM A;  3IHU A;  2CO5 A;  1J0R A;  3L2C A;  3P9I A;  1B4A A;  3LQR A;  4I0A A;  4ESJ A;  1TQP A;  1D3Y A;  4LFU A;  3RJP A;  2ADU A;  1TNT A;  5HDG A;  4XLN F;  5BMZ A;  5H6Q A;  5FFZ A;  3K9T A;  3JTG A;  2QQA A;  2L54 A;  2KIM A;  4A12 A;  3Q5F A;  1LVA A;  2JPB A;  1S6L A;  3P9K A;  4CHU A;  1KA8 A;  1T0F A;  3SFZ A;  1JGS A;  4G9Y A;  2EA4 A;  4IXA A;  5ICC A;  4EVI A;  3CO7 C;  1Z1D A;  4BH9 A;  3JSO A;  5AON A;  4XBF A;  3TDZ C;  2CW0 F;  2QQB A;  2XGX A;  4KIC A;  5LHI A;  3U9G A;  2PI0 A;  4P55 A;  3ZQ7 A;  3WGI A;  1KQ0 A;  2MA3 A;  1P4X A;  4S05 A;  3V8K A;  2FBK A;  1R1V A;  2YR2 A;  2VT3 A;  5DYM A;  3CO6 C;  2RDP A;  4MHG A;  4CYD A;  2P5K A;  4GXO A;  2EFP A;  3E5U A;  1UCR A;  2VXZ A;  1J59 A;  4A0Z A;  2LSO A;  3SZT A;  5BS6 A;  3RYP A;  2STW A;  3KP3 A;  2DPD A;  4KA4 A;  1BI2 A;  3KP5 A;  5HDK A;  1LDD A;  3TKY A;  5HLH A;  3OOP A;  4RB0 A;  1O7L A;  4RGS A;  1LQ1 A;  4Y13 A;  3FF5 A;  5BPI A;  2MH9 A;  4CGZ A;  3FHZ A;  2LNB A;  3LFK A;  1W7P A;  3H3U A;  2K27 A;  1TTY A;  1U78 A;  2MD5 A;  2OU2 A;  5LRS A;  3HYI A;  4XSX F;  2A6H F;  3K1M A;  1U6G A;  2V1X A;  4HQE A;  3L9F A;  1PP8 F;  1G3Y A;  1P92 A;  4IHS A;  4OMY A;  3M1E A;  5EEH A;  5HLG A;  5DD4 A;  3GF2 A;  2HTJ A;  2F5D A;  2M45 A;  2FNA A;  2BYV E;  2RKH A;  2Z5U A;  1OMI A;  4KN4 X;  1S7A A;  5DCF A;  2OQG A;  4KN7 X;  4A0X A;  3BWG A;  2OBP A;  2JRT A;  3GEZ A;  4O6J A;  2ESH A;  4YFX F;  5H6R A;  5ERI A;  1OYW A;  2FSW A;  3BJ6 A;  3BZ6 A;  4HX8 A;  1OKR A;  2VBX A;  2ESN A;  1YG2 A;  3GFI A;  1OYY A;  4U7D A;  1I1S A;  2XAJ A;  2P5L C;  1XB4 A;  1ZLK A;  4I7H A;  1FYK A;  3G73 A;  1ZG1 A;  3O3K A;  1Z6R A;  2VC0 A;  1QZY A;  4OIQ F;  5TJJ A;  4ENN A;  4L0Z B;  2YPR A;  2AXL A;  1FYL A;  2DAO A;  3TO9 A;  2BBY A;  3TDU C;  3GX4 X;  4IVN A;  2FBH A;  2HQN A;  3ELK A;  3JAM Z;  4EM0 B;  3E5X A;  5CVJ A;  4QWQ A;  2O8X A;  3R60 A;  3GUD A;  2UZK A;  5LRR A;  4GCV A;  4P5O A;  3H92 A;  1K6O A;  3ECH A;  3MAJ A;  3ABU A;  1XSD A;  4UUV A;  3C1D A;  2UWM A;  2O61 A;  3IKT A;  4G94 A;  2AS5 F;  3SZP A;  4YFN F;  4M9Z A;  1ON1 A;  1QO0 D;  2ZNY A;  1REP C;  4ON0 A;  3ZMV A;  1U5T C;  2DQL A;  1TBX A;  3GZ6 A;  2GQQ A;  3I59 A;  4DQ2 A;  1K79 A;  1MGT A;  1FYM A;  3M8E A;  4GO1 A;  3ABT A;  3RYR A;  2HS5 A;  3WTS C;  2GIV A;  1I27 A;  5JI6 A;  2DI3 A;  5LHG A;  4KIG A;  4Q48 A;  2A61 A;  2ZO4 A;  2OD5 A;  3SXY A;  2MBF A;  5D6E A;  3ZMS A;  4D0P A;  2HR3 A;  2P6S A;  4HX4 A;  1FC3 A;  2FA5 A;  1WI9 A;  4IRG A;  1R36 A;  1HKQ A;  2NNY A;  3VFZ A;  1T98 A;  3KZY A;  2QZ8 A;  3DKW A;  1XDS A;  2VBY A;  3CUQ C;  3V4G A;  3I4P A;  5CLS A;  1L3L A;  5L3C A;  1YTY A;  2PG4 A;  4HX7 A;  3M7G A;  3I58 A;  2P6T A;  2YU3 A;  3LAP A;  3IWF A;  4UHT A;  2VC1 A;  2G7H A;  3KEQ A;  4HDU A;  5KVR A;  2HQR A;  1O7F A;  1FSE A;  3MEX A;  4WWC A;  1ZRE A;  5L3G A;  4M9S A;  5HLI A;  4CZZ A;  3IL2 A;  1S3J A;  3EUH A;  3L7W A;  4G6Q A;  1SD4 A;  5DDG A;  4L9N A;  4ESF A;  4RAZ A;  1KGS A;  2XV4 S;  4UVB A;  3QPT A;  1XSX A;  2IA1 A;  1U5T B;  1IN6 A;  2LF8 A;  1X3U A;  3U2R A;  4K2E A;  4NB5 A;  4Z2Y A;  3D5L A;  1BIA A;  3R61 A;  4AVP A;  1YYV A;  5E1X A;  2R3S A;  3KZZ A;  3EYI A;  3GVA A;  5BOX A;  2E1N A;  5HDN A;  4EJO A;  2XUB A;  3WG9 A;  2EK5 A;  1FP1 D;  5E8G A;  2FNP A;  2JPC A;  1FBS A;  3TO7 A;  4MTD A;  1U3E M;  1T38 A;  4KDP A;  2NS0 A;  3WTV C;  4BAY A;  2YSR A;  4LMY A;  1QZZ A;  1SD5 A;  5L3E A;  2E7X A;  3KCC A;  4EJW A;  3GFL A;  4B09 A;  5EEG A;  4M73 A;  1O3T A;  3I54 A;  3IRQ A;  4AD9 A;  2FRH A;  3ECO A;  1G3W A;  3ZP5 A;  3CUQ B;  3HRU A;  2KJC A;  4RGU A;  1BI0 A;  1FBQ A;  3PFI A;  2RC4 A;  3CUO A;  2ZCW A;  2GA2 A;  4YG2 F;  2XRN A;  2BGC A;  5LEJ A;  2R7F A;  2XVC A;  3HSF A;  3EQL F;  3CDH A;  2DFI A;  3V8J A;  3G3Z A;  3GLX A;  1IF1 A;  2Z9O A;  3U1D A;  3Q9S A;  3DPL C;  4N9I A;  3R0J A;  2K02 A;  2DBB A;  4M6X A;  2YX4 A;  3KLN A;  1R1U A;  2EJR A;  3VB2 A;  2XAG A;  2GWR A;  1H9G A;  3R6S A;  3JW4 A;  2PMU A;  3QPH A;  2EV5 A;  2FMY A;  3P7N A;  3HRM A;  2BE5 F;  2W57 A;  2M30 A;  3WTW C;  4HYE A;  2KKO A;  1P4W A;  2O0Y A;  2XAQ A;  4Q4Z F;  2RGV A;  1D8J A;  2F5C A;  3NQO A;  3WE3 A;  4HV6 A;  4L0Y B;  3BDD A;  1ZG5 A;  2P4W A;  2ACJ A;  4A5N A;  4KIB A;  4PGH A;  2K7L A;  2V1D A;  1STZ A;  2ZNZ A;  3HRS A;  3K1P A;  3E6D A;  1O3Q A;  5F6F A;  3ZMU A;  3K2Z A;  3W6J B;  3DP7 A;  4L18 B;  1MJB A;  1DUX C;  4I01 A;  1RIO H;  4KIF A;  5CYV A;  2W85 A;  4G8X A;  2P5V A;  4AIK A;  5CVI A;  4HF1 A;  3RPU A;  3MQ0 A;  4G7Z F;  1ODD A;  4EMS A;  2VOO A;  3EET A;  1LEB A;  2VOP A;  3FX3 A;  1WWX A;  3KP7 A;  1Z9C A;  2ZKZ A;  1G3S A;  2TDX A;  3JSP A;  2X4H A;  1HKT A;  2A69 F;  5K1Y A;  2PEX A;  2Z3Y A;  1R22 A;  3HHH A;  2EFO A;  1LB2 A;  2ISY A;  2STT A;  2Q8K A;  3N97 A;  2Y0M A;  4HA8 A;  2Y48 A;  4ZYH A;  5LHH A;  3KLO A;  2D2W A;  2A3S A;  3C18 A;  2M87 A;  1Z91 A;  2D1H A;  1ON2 A;  2M5W A;  3E6B A;  1SFU A;  2QUF A;  1RZ4 A;  2PBI A;  4WCG A;  3FMS A;  1Q1H A;  3OV8 A;  1T2K A;  2HWV A;  3HSR A;  5CVR A;  4I2O A;  4ENJ A;  3PQJ A;  4WXH A;  2H94 A;  4LB6 B;  1YQA A;  5ILU A;  2HFH A;  1QNT A;  5A2Q Z;  1XMA A;  5IT3 A;  3VOE A;  1S29 A;  2MH2 A;  4HQM A;  1BI1 A;  4I02 A;  4U0V A;  3HSE A;  2EFQ A;  2L3D A;  3P9C A;  2EV0 A;  3MZH A;  3B73 A;  1T6S A;  3KP4 A;  2VE9 A;  3C3W A;  4ZZL A;  2L02 A;  4XLP F;  3BPV A;  1J9I A;  5E1Z B;  3GWZ A;  1BM9 A;  5CJ9 A;  4GYI A;  1KU3 A;  5AIP A;  4MEY F;  2IA0 A;  3CLO A;  2LDU A;  3DFG A;  2O3F A;  2OQR A;  2QBY B;  1XDU A;  4HLY A;  1O3S A;  3BY6 A;  1YLF A;  2FOK A;  1BC7 C;  2CSO A;  4KMF A;  2VON A;  3O6B B;  4KMU X;  3F3X A;  1K78 B;  2KJB A;  5JFR A;  4ZYE A;  1ZRD A;  3ZMT A;  2F5E A;  2WWY A;  1OYI A;  3HUG A;  1R1T A;  5ICG A;  4MNU A;  4RGX A;  4TV7 A;  1MDM B;  3RKX A;  1HSJ A;  4RGR A;  3DPT A;  3REO A;  1TLH B;  1XCV A;  1J2X A;  4R8H A;  5HS9 A;  2EV6 A;  3IKV A;  1R23 A;  4FHT A;  3EDP A;  2L4M A;  1FY7 A;  1YO5 C;  1BN5 A;  1J5Y A;  4MGR A;  4IRI A;  4ETS A;  2E1C A;  1YS7 A;  4CXF A;  2CFX A;  3VOD A;  2OZU A;  5ILV A;  4IF4 A;  4UXN A;  1ZAR A;  4IHT A;  3JTH A;  2A68 F;  1XGM A;  3WTU C;  4HBL A;  2MC3 A;  3GZ5 A;  1HW2 A;  2GA1 A;  3LQQ A;  2XAS A;  1WQ2 A;  2HOE A;  3VEP A;  2XKP A;  1D8K A;  4MTE A;  2QYO A;  1ZH5 A;  1ZGA A;  2A6E F;  2P7V B;  2DQR A;  2EA2 A;  2BV6 A;  1TW3 A;  2KIF A;  1V3F A;  1CGP A;  2FE3 A;  2PJP A;  5H20 A;  4FX0 A;  1PP7 U;  1FT9 A;  1YFH A;  1ZAO A;  2ZXJ A;  1SAX A;  1GVJ A;  2CYY A;  4M71 A;  3W6K B;  5TRD A;  1G3T A;  1SD7 A;  2RN7 A;  3T1B A;  1KQ9 A;  5ICF A;  4UV8 A;  1H0M A;  4M6Y A;  2J5P A;  1XCB A;  1Z7U A;  1HQC A;  3I59 B;  3K0L A;  4U0Y A;  3FWE A;  3WTX C;  2D45 A;  1EH6 A;  4RS8 A;  5FFX A;  3WGG A;  4YFK F;  2FXA A;  3E6C C;  1DPR A;  4ZYG A;  2Q0O A;  4EGZ A;  2WC2 A;  3R0A A;  2IW5 A;  2M8E A;  3LST A;  1CF7 B;  4PGG A;  3TGN A;  3O2P E;  2PQ8 A;  4LJZ F;  3KEO A;  4CO8 A;  3HTS B;  3J7A O;  4Q5S F;  4OMZ A;  2FBI A;  1S7O A;  2EB7 A;  4JQF A;  2XKO A;  5E18 F;  5A2Q K;  5LGU A;  4CIC A;  3KFW X;  3SQN A;  4IJA A;  3FMR A;  1OR7 A;  4RB1 A;  3KE2 A;  4WF2 A;  5K5R A;  2FQ3 A;  2JT1 A;  5E8I A;  2NRA C;  2ELH A;  4HV5 A;  3RPQ A;  1ONV A;  3T5X A;  5DD8 A;  1FPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...