2RQPA

The solution structure of heterochromatin protein 1-binding protein 74 histone h1 like domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
GPGMASSPRPKMDAILTEAIKACFQKSGASVVAIRKYIIHKYPSLELERRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The middle region of an HP1-binding protein, HP1-BP74, associates with linker DNA at the entry/exit site of nucleosomal DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Heterochromatin protein 1-binding protein 3
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rqpA00
2XUBA 2RDPA 1F4KA 2O8XA 4KYWA 4AVPA 1QPMA 2RV8A 3DP7A 1MDMB 1U5TA 1YW9A 5E1WA 3IL2A 4H0EA 5CVRA 3JAMZ 3D5LA 4TV7A 2DPDA 1KA8A 1F5TA 4Q47A 3J80K 3WGHA 2JT1A 1E2XA 3ABUA 4RS8A 1B59A 4LK0F 4B09A 4L18B 1ON2A 1DP7P 1V3FA 2K4JA 1OYYA 1SD4A 1IN6A 2W24A 3FM3A 1HKQA 1TW3A 2K27A 4U0YA 4Y15A 2PEXA 3M9AA 4WXCA 3LA2A 2XIGA 3CJNA 1W7PD 3R0AA 4I02A 4RB2C 2XAQA 3MWMA 5DD4A 2D2WA 2JTVA 1EH6A 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 3RYPA 1BI3A 2IT0A 3V7CA 3P9IA 1DDNA 5A2QZ 4Q4ZF 1TNSA 1IZ1A 1UHMA 2F5EA 4ZYDA 1NHAA 1YQAA 1R1VA 3ERED 4GXOA 2RN7A 2VBYA 2NS0A 3E6CC 2RNJA 2JRTA 4LB6B 3VB2A 4ENKA 1UCRA 1ZRDA 1WKMA 4MEYF 1J5YA 3GO5A 2EFWA 3BWGA 5EEGA 1GHCA 3R4KA 3BJOA 4KFCA 4KNYA 2W84A 5BPDA 2EB7A 3F23A 5BOXA 5FD5A 3U2RA 3O2PE 3I4PA 1XSDA 4KICA 2FU4A 3C1DA 2M30A 4UUVA 4OOIA 1SMTA 5DCMA 3U9GA 5LRSA 5D5WB 1BI0A 3CUQC 2OD5A 2TDXA 4HQMA 4P9FA 3K1MA 3LQRA 4BHPA 2ZXJA 2HTSA 2GWRA 1JXSA 2FOKA 3KP7A 5D6EA 3GLXA 3RTRA 1I27A 3CO6C 2D45A 3KP4A 4ZYEA 4EGYA 2XAGA 4ZYGA 3Q9VA 2MLKA 1FZPB 3QPHA 2BBYA 2GXBA 4MEXF 1FLIA 2LKPA 3MFKA 2X0LA 5CLSA 4UNOA 1XGOA 3GW2A 4M9XA 1P6RA 3HRUA 4KIFA 1LJ9A 2E1NA 1BI2A 4LD5A 4WWCA 4NQWA 1SD5A 3GFLA 4BXUA 1U78A 5CVIA 5CJ9A 3V7SA 2H6CA 1B6AA 2PN6A 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 2KJBA 3JTHA 5DEQA 1ZARA 2DBBA 2A6HF 2HZTA 5A2QK 1FSHA 1WI9A 3RKXA 1IN5A 4IJAA 2L3DA 5L3FA 2MD5A 2MH2A 1EH8A 2A61A 4U7DA 1GXQA 5D4RA 4EGZA 2A69F 2RC4A 2E7XA 1HW1A 1MJAA 4I09A 2DQLA 2FBHA 1HKTA 4PZJA 2EFPA 3VFZA 3DFGA 3PQJA 4HF2A 5DDGA 2Y75A 4L9NA 2OA4A 1MJ9A 4CGZA 4A5NA 3QRFF 1QO0D 4A0YA 3LA7A 3WGGA 2KIUA 5FFXA 4HYEA 4I7HA 4IHSA 3F6VA 1SMYF 3MEXA 4G7OF 3FF5A 3JW4A 4CXFA 5IT9K 3DEUA 3QPTA 3CUOA 4WCGA 4CDGA 2BYVE 3DV8A 3BROA 3KFWX 2QQ9A 3T1BA 5AIPA 1Z05A 1IN7A 2KJCA 1XD7A 4S05A 2YU3A 4U0WA 2H09A 3TGNA 1J7KA 3LFKA 2DK5A 2VN2A 3BZ6A 2JZYA 1O3TA 2EK5A 1ZLJA 2PLYA 4QLCU 1J59A 2IW5A 4L9JA 2YPRA 3IKVA 5KK1A 3E6MA 3F21A 2WV0A 1BC8C 3JSPA 2Q8KA 2QENA 3WTUC 3CDHA 4BHCA 3HOSA 3MAJA 5D5XB 3O6BB 1QNTA 1YO5C 2A5YB 2OZ6A 1T98A 3GXOA 3FMRA 2D1HA 2JPCA 1CF7A 4IRHA 4Q48A 1HW5A 1FBUA 5ICCA 3O3KA 4AIKA 3SXYA 2VT3A 1BJAA 1YYVA 3GFMA 3I59A 2ZNZA 2DPUA 3BPXA 1D3YA 1L3LA 1LB2A 4HF1A 2FXAA 2GA2A 2ZCWA 3K1NA 3CTAA 2KIMA 1IF1A 3B73A 3IC7A 2PG4A 3E5XA 3RJPA 3K69A 5LHIA 4HV6A 1LDJA 1OPCA 5D5VB 3P9KA 5BQTA 4A6DA 2V1DA 2LF8A 3HSRA 1B4AA 2FRHA 2CWEA 2G7UA 4HV5A 4HOBA 4PCQA 1IUYA 3HTSB 3J81K 1TTYA 1FNNA 3C7JA 2BGCA 1B9NA 2ZMEA 2IA0A 2QM3A 3F72A 3HTUA 3W6KB 5CYVA 4JQFA 1I6XA 3KEOA 2M5WA 5CVVA 1Y0UA 2O03A 4IF4A 3QU3A 2PFBA 2OZUA 2EJRA 4ZH4F 3JTGA 3GZ5A 3ZPLA 4JK1X 3RYRA 1YFHA 1V4RA 1BIBA 2M8EA 3ELKA 1I1GA 5FD6A 1O7FA 3EYYA 4EM1A 3S2WA 3FX3A 4CICA 3OOPA 4EJOA 1WRJA 2ELHA 2G9WA 4EJWA 2ZMEB 3F22A 2F2EA 1YW8A 3GVAA 1RUOA 3W6JB 1TW2A 2OU2A 3WODF 4NHJA 3HRSA 1XCBA 1GVJA 4LG0B 1CGPA 5IT3A 2O0YA 4KA4A 3BJAA 2P7VB 4MNUA 5L3CA 1IRGA 3TQNA 1ULYA 2CQKA 3KEQA 2P7CB 1ZG3A 5FLXZ 1BC7C 2ACJA 2BV6A 2IA1A 1K78A 3D0SA 1MDMA 3KP6A 1D8KA 4UV8A 2XASA 1U3EM 4CZZA 2ISZA 3DQVC 1REPC 1MGTA 2KRFA 2QLZA 3R61A 3ZMTA 1T38A 3WTXC 2COMA 5LGNA 3I53A 1QZYA 4HLYA 5JVTA 3GFIA 5F1RA 2VC0A 5LHGA 3BP8A 1HQCA 3Q9SA 3LA3A 4M6YA 2VT2A 2DLLA 2IRFG 1FYKA 1F1ZA 3F6OA 4R8HA 2GAUA 3I71A 3H92A 2IA2A 2NRAC 3FMSA 1XDUA 1R22A 3M1EA 1K7AA 2K02A 4O5VA 1BM9A 4RAYA 2OBPA 2CO5A 1TLHB 1XGSA 2Z33A 4Y13A 1ZRCA 1U6GA 5LGTA 3FXUA 4QWQA 2NNNA 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 1VTNC 1W4MA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 5DUKA 4UXNA 2ADUA 1HKSA 3KP3A 1O57A 1U5TC 2P5KA 2EV5A 1SD7A 2ZNYA 3ULQB 2MBFA 2HGCA 2P6SA 5LEJA 2VOOA 2VODA 5LEKA 2ISYA 2K7LA 4L5IA 3F8BA 5HS9A 2HQNA 2Z5UA 1B1BA 3I59B 4RGRA 2QQBA 2DTRA 3E5UA 3QU6A 1P4AA 3HHHA 2R7DA 1QQIA 4Z2YA 2VE9A 5HDKA 1W5TA 5BS6A 1TNTA 3C3WA 4M72A 1LDDA 5FGMA 2QVOA 1P4WA 1IN4A 4NB5A 3CO7C 3J7AO 1R1TA 2QUFA 4P96A 2QBYA 2M45A 1ODDA 3FZVA 2EA2A 4HX7A 2V9VA 1W7PA 2RGVA 1KYZA 4GCVA 2XAHA 3ZN1A 3OV8A 1HXDA 2DO7A 1QGPA 2Z3YA 4PGHA 4KMFA 4Q5SF 1C0WA 3ZMVA 4BHBA 2FE3A 1H9GA 5E18F 2GXGA 1BOAA 4IRGA 5F6FA 4OIQF 2FEZA 2LDUA 3QAHA 1IXCA 3FHZA 1G6NA 3N97A 3FXQA 4YFXF 1JE8A 2R7FA 3FWEA 5K5QA 5ILUA 4LB5A 1LVAA 1XDSA 4EJUA 3EDPA 2VONA 3NEUA 2V79A 3IRQA 2XAJA 4DNCA 3ZP5A 1G3WA 1MJBA 2WTEA 2V6CA 2A3SA 3ZMSA 2G7HA 3BDDA 3DKWA 1W7PB 4L9VA 1S7OA 1AWCA 5E17F 3RI4A 5D8LB 2P5VA 2O6GE 1FT9A 1RI7A 4M9SA 2FBIA 4O3MA 2HKXA 1O7LA 1YS6A 3LSTA 2J5OA 1MD0A 2DQRA 5KVRA 4OIPF 2Z9OA 4HZFA 5K1YA 3DPTA 4KT5C 1U8RA 1UHWA 4N9IA 3QP6A 2OQGA 2Y0MA 3CLOA 3ECHA 4IPAA 5H20A 3WE2A 4GYIA 2KKOA 3I58A 2Q2EA 3IRRA 4BYYA 2PJPA 1Z7UA 5L3GA 2NNYA 2F5DA 1Z6TA 2DT5A 1OMIA 4FX4A 1KU9A 4LMYA 1P92A 1QZZA 2RKHA 2P6TA 4IXAA 4OIOF 1FPQA 2VC1A 3BOQA 4KN4X 1SD6A 1B9MA 1KU3A 3KZZA 5FB2A 4P9UA 5HDGA 4LGWA 2H6BA 4LLLA 5JR3A 1FSEA 1ZRFA 2JPBA 2XVCA 3ZMZA 2CFXA 5K5RA 1XMAA 4ESFA 3IWZA 1Z1DA 4HAMA 1UB9A 1FY7A 2A68F 4KUMA 2EFNA 2O3FA 1R23A 4I2OA 2BEOA 4IVNA 2MC3A 2K4BA 5E1XA 4CHUA 1G3YA 1XGMA 1R00A 2WC2A 5HS7A 4EJTA 4AWXB 4RAZA 3ISPA 4BNCA 5FO5A 1FOKA 1W5SA 1PP8F 4HBLA 2STTA 2QWWA 4ASNA 1LQ1A 3IHUA 3L00A 3J80Z 2HFHA 4ESBA 4L9TA 3N4MA 4FX0A 2X4HA 1IN8A 2IPQX 3U1DA 2HYGD 1KGSA 2HTJA 5EEHA 2B0LA 4G6DA 3I64A 2GZWA 3SZPA 4ZZLA 1WSUA 1TQMA 2MA3A 3E6DA 1YG2A 2YR2A 5IT9Z 5ERIA 2YSRA 3T8TA 3GFJA 5D6FA 2XROA 4PGGA 2HEOA 4I01A 2LSOA 2PI0A 2FMLA 1KQ9A 2QYOA 3TO7A 1R7JA 3M8FA 1BIAA 4M73A 2MLGA 2VBXA 3MCZA 4LG0A 3WTSC 1FP1D 3ZMDA 3R0JA 5HVQC 1SFXA 4LLGF 1TQIA 1XCVA 1O3QA 6PAXA 5AIQA 4ENNA 1DPUA 4R1HA 1EV7A 2QZ8A 1HBXG 4ETSA 3KETA 1ZYRF 3KLOA 2ZKZA 3F8NA 2VXZA 1ZGJA 2EWNA 2DAOA 4IRIA 5JHUA 3F8CA 2XKOA 4I0AA 4ZYHA 3HSEA 5FFZA 1J2XA 5ILVA 4AD9A 2YX4A 1J9IA 2L4MA 3V4GA 3ZMUA 4MQVA 5HLGA 1XSVA 3P9CA 4ENMA 1R5GA 4G6QA 2V1UA 5K5OA 4M9ZA 5L3BA 4KN7X 2PQ8A 1SFEA 3L09A 2GA1A 1BN5A 4HLXA 4L0ZB 1JHHA 3IKTA 1R58A 1S7AA 2Y48A 3E97A 1LEBA 5DCMB 2K86A 4XLPF 5L3DA 3HUGA 3KE2A 5TRDA 2ZBKA 3NRVA 1T6SA 1D5VA 4MHGA 3AAFA 1K6OA 2A07F 2H27A 3DXJF 2EFQA 3WTTC 3WGIA 4KIGA 3HYIA 1X3UA 1TQPA 2PBIA 5BMZA 4CYDA 3TOBA 3G3ZA 4FT8A 2ESNA 4MQ9F 5E20A 3E6BA 2EFOA 3EUHA 3MQ0A 2R3SA 4KMUX 4YFKF 2W25A 1P2FA 3REOA 1ZGAA 5CVUA 5JFRA 1K79A 3WU1B 3HRTA 1FBSA 4N9HA 1R36A 2Q0OA 4Y17A 3K9TA 5TJJA 4HA8A 3NQOA 4ZZDA 3GYHX 1ZLKA 4M71A 4XBFA 4YIFA 3KP2A 1HSJA 3F8FA 5AONA 2CG4A 2XHKA 1KU2A 4RGSA 2FF4A 3QP5A 1YIOA 3HSFA 5D5UB 3WG9A 3PQKA 4WX9A 3I54A 2LF7A 2DI3A 2RQPA 3TO9A 3L9FA 1STZA 3B02A 2HKOA 1L0OC 4RB3C 1RUNA 5D8KB 2VBZA 3BJ6A 2CYYA 4B8XA 1WQ2A 4WF2A 5ED4A 2V1XA 5CVJA 2ZFWA 1GXPA 4G9YA 1E17A 4UVAA 1Z91A 2DK8A 3KZYA 4EQQA 5LRRA 1LNWA 3H3ZA 2A6EF 3HOTA 1HW2A 3Q5FA 3SFZA 5E8GA 3GX4X 3IWFA 2RVCA 1J75A 2UXXA 4ENJA 3PFIA 4R79A 1MZBA 4L5JA 2DFIA 1S29A 3I5UA 4EM2A 4LLNA 3JAMK 4OU0A 4G94A 3BY6A 4GYGA 1FX7A 3K0LA 4FHTA 5LBQA 1CF7B 4N0BA 2XGXA 3WE3A 2E7WA 1MKMA 2AS5F 1OKRA 3FM5A 1XGNA 5J6XA 1R1UA 3FXRA 1G3TA 2PMHA 1IAWA 3GF2A 5LHHA 3QOPA 3BPVA 3ROUA 4U88A 2QBYB 4GO1A 3RPUA 2L4AA 4M74A 1O3SA 4LK1F 2GIVA 2L54A 4HF0A 5H6QA 2FQ3A 1J0RA 4HDUA 3DPLC 3RIRA 1LEAA 4PDKA 4U0VA 4OINF 1KQ8A 1SAXA 1Q1HA 1YW7A 2Z99A 2W85A 1USTA 2CW0F 2YX7A 1ZG1A 2F5CA 2FNPA 2LNBA 4A0XA 5HS8A 2HDCA 3R6SA 3CUQB 3GUDA 5ILSA 2OAZA 4P5OA 4EMSA 2IVMA 2L02A 4I98B 4KDPA 4WXDA 5HDNA 1DUXC 4MGRA 5FLXK 1RIOH 1KU7A 4G7HF 1SFUA 3GWZA 1AOYA 4RB0A 3ZN0A 3HIFA 1KYWA 2D1VA 5HLIA 3K2ZA 1USSA 2ETHA 4E70A 3K1PA 3E3VA 4EVIA 4YFNF 1F9NA 3L2CA 3L7WA 3HHGA 1ONVA 2O61A 5DUIA 5LLQA 4G8XA 1U2WA 5ICEA 5DD8A 2MH9A 2EV6A 5F64A 3FMQA 1LDKB 2XAFA 4F7ZA 4YIIA 2UZKA 1OYWA 2IJLA 1ON1A 2CGPA 3F8MA 1FC3A 4UVCA 3EQLF 1HSTA 4MTDA 3TKYA 4D0PA 1OR7A 3VOEA 4A2UA 3SHFA 4OMZA 5DCFA 4IHTA 1YLFA 3TDZC 1G3SA 4I0BA 3RPQA 1PDNC 1XN7A 1ZREA 1U5TB 1ZAOA 2XV4S 2P4WA 5J8CA 3V8KA 1O3RA 3EETA 4MTEA 4XRFA 3JSOA 1ZN2A 4BQAA 3E5QA 3H3UA 1JGSA 2NYXA 4WXHA 1YS7A 3V7RA 4A5MA 1FYLA 4OIRF 4CO8A 4YG2F 3WTZA 2J5PA 3ZQ7A 1BBYA 1S3JA 3TOAA 3T8RA 3WTYC 3TO6A 1UFMA 4M6XA 4A6EA 2E1CA 1IXSB 3RKYA 1I5ZA 4JBAA 2STWA 1IXRC 2CSOA 1IW7F 3T5XA 4ESJA 1T39A 3R60A 5DYMA 2F5FA 3EYIA 1QBJA 3MZHA 3LQQA 4UVBA 4XLNF 4HX8A 5DV5A 1R5HA 3GEZA 2OQRA 4OMYA 3ECOA 1G4DA 2P8TA 2P5LC 2ESHA 1Z6RA 3LAPA 4UV9A 2FA5A 3G73A 4EJVA 2UXNA 5L3EA 4AIHA 4XSXF 4EV0A 4ON0A 4HDVA 4LJZF 2HQRA 4BH9A 3P7NA 3TDUC 4EM0B 4G7ZF 3LAJA 1H9TA 3F3XA 2BE5F 4K2EA 3T0YA 3J81Z 3KLNA 2C6YA 1RNLA 3SZTA 1XSXA 1FP2A 2HOEA 2M87A 1JHFA 3ABTA 5H6RA 1A04A 4BAYA 1PP7U 2EA4A 1ZH5A 4XSZF 4HW0A 3SQNA 1ZG5A 4HQEA 4AIJA 2W57A 1OYIA 2ZO4A 3M8EA 4U7BA 4WK8F 2KIFA 3VODA 1FYMA 2NAZA 5JI6A 1S8NA 2QQAA 3CUQA 4HX4A 4P55A 5E1ZB 2HR3A 4A0ZA 1XB4A 1Z9CA 2VE8A 1RZ4A 1ZHFA 2WWYA 1H0MA 2HS5A 3M7GA 3WTVC 2FMYA 4LFUA 3RDIA 1P4XA 3COAC 3V8JA 2XRNA 2HWVA 2EV0A 1K78B 5LGUA 2ZJ2A 1EH7A 2DU9A 4GGGA 2UWMA 2IP2A 3GZ6A 1YTYA 4L0YB 2FSWA 4UHTA 4A12A 2GQQA 5D4SA 1T0FA 2FNAA 1PUEE 1TBXA 5J8FA 3WU0A 5ICGA 1T2KA 3I0TA 1S6LA 2H94A 1D8JA 4RGUA 1KQ0A 1I1SA 4RB1A 2M1BA 4RGXA 1FBQA 4S04A 5E8IA 2HYFA 3ML6A 2L01A 5BPIA 3KCCA 3V8LA 3KP5A 1BI1A 2VOPA 3RKWA 1DPRA 3C18A 3LWFA
chains in the Genus database with same CATH superfamily
2XUBA 1E3HA 2L7MP 2RDPA 5B5EC 1EJ9A 1F4KA 3OYMA 2O8XA 3VSLA 4QIWN 4KYWA 4AVPA 1QPMA 4RA2A 1B8IB 2RV8A 1ETKA 1TWGJ 3DP7A 4D9JA 5HLTA 1MDMB 1U5TA 1A6QA 1YW9A 5E1WA 3IL2A 4H0EA 2NS7A 5CVRA 3DTKA 1VFCA 3W6VA 4CUGA 3JAMZ 1Z3XA 3KEYA 3D5LA 4TV7A 4CH7A 2DPDA 1KA8A 3PNTA 1F5TA 4Q47A 4DZPA 3ABMH 1D1BA 1XPXA 2KT0A 3J80K 3WGHA 2JT1A 1TWAJ 1E2XA 4BQQA 3ABUA 4XRMA 4RS8A 5CKTA 2LC2A 1X1BA 2BOLA 1B59A 2DYRH 4LK0F 2MYSA 4B09A 4DGWB 4L18B 1JKQC 1ON2A 1OCRH 1DP7P 1V3FA 2K4JA 1OYYA 4CCNA 2ID3A 5J40A 2M7BA 3TBIA 4D5CA 1SD4A 5E3OA 3I4NJ 1IN6A 2VKHA 3G1LA 2W24A 2WB1A 3TW6A 2KP6A 2R5ZB 1Y1WJ 3HKZN 3FM3A 1B72B 4FE7A 1HKQA 1TW3A 5CQGA 4B48A 1BA5A 3RZDJ 1MNMC 2K27A 4ZTFA 4U0YA 1ZGWA 3DBRB 4Y15A 2PEXA 3M9AA 2NS8A 2KIQA 3LA2A 4WXCA 3PNYA 4XM3A 2E19A 4F3QA 2XIGA 4XRSA 4IO9F 3CJNA 1W7PD 3R0AA 4I02A 3CC7I 4RB2C 2XAQA 3MWMA 5DD4A 2MG4A 2D2WA 2JTVA 2DJIA 1EH6A 4D1QA 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 2JA7J 3RYPA 1BI3A 2IT0A 1VQ6I 1MSFC 3V7CA 3P9IA 1DDNA 1QPIA 2UV1A 4V19K 5A2QZ 4Q4ZF 1TNSA 1IZ1A 1UHMA 2LLKA 3CMEI 1F43A 3A0BC 5EEAA 2F5EA 4ZYDA 1T08B 1NHAA 2KFDA 4OAYA 1GV5A 1YQAA 2OCCH 1R1VA 3ERED 1RKTA 3RQ4A 4GXOA 2DN0A 2RN7A 2VBYA 3K4CA 2NS0A 1JTYA 2HNHA 3E6CC 4C3HJ 2RNJA 2JRTA 4BXXJ 1WZ2A 4LB6B 3I4MJ 1T56A 3VB2A 4ENKA 1UCRA 1Y0NA 4NBQA 1WKMA 3MKYB 4MEYF 1ZRDA 4E7SA 1J5YA 3OSGA 3GO5A 3OYKA 1P9QC 3CMAI 3GMEA 2EFWA 3H0GJ 4RAGA 3BWGA 5GTHC 5EEGA 3HL2A 1I50J 5HNHA 1QZEA 2LBFB 3S3NA 1GHCA 1X58A 3R4KA 2V6EA 5EZGA 3K7AJ 2HOTA 5GPCA 3BJOA 5C3EJ 4KFCA 4KNYA 2W84A 2XF6A 2EZIA 5BPDA 4MO7A 1BR1A 1W0TA 3LSJA 5EJCA 3HBLA 2EB7A 4XR6A 3F23A 5BOXA 5FD5A 4YRVA 1UELB 3U2RA 3JRFA 2BXYA 2EH3A 3O2PE 4XORA 1K61A 3J7ZI 2E2IJ 3I4PA 1XSDA 1YRNB 2L0KA 4KICA 2OCEA 2FU4A 3C1DA 1OFCX 2M30A 4UUVA 2M4GA 3K4NA 2LOOA 4OOIA 1SMTA 5DCMA 3U9GA 4RLQA 2VI6A 1IDYA 5LRSA 2HQ5A 5D5WB 1BI0A 3CUQC 3F9KA 1VQ5I 2OD5A 2TDXA 1QHGA 2V9KA 2KRCA 4HQMA 2BHYA 2CUEA 3S2DJ 4P9FA 3K1MA 3LQRA 1JJ6C 1OCOH 4BHPA 2KQRA 1WH7A 2BY2A 2ZXJA 2I10A 2HTSA 2GWRA 5FKKA 2FOKA 1LFUP 1HC8A 1JXSA 5K7FA 3KP7A 1JI8A 1G2HA 3KZIC 3FBIB 5D6EA 3GLXA 3RTRA 2DMTA 3ZCOA 1KONA 1I27A 3CO6C 2L2OA 2D45A 3KP4A 5KHDA 4ZYEA 4EGYA 1MBJA 2XAGA 4ZYGA 3Q9VA 3CCYA 1WJEA 2MLKA 4NC7A 4I6ZA 2Y0SN 1FZPB 3QPHA 2DDBA 3S2HJ 2BXZA 2DJNA 2BBYA 3QOEA 2GXBA 4MEXF 2BW3B 1FLIA 1MIJA 2LKPA 3MFKA 2X0LA 5CLSA 2JVHA 4UNOA 4A3LJ 5FRNA 3BT9A 1XGOA 2CUZA 3GW2A 4M9XA 3CCUI 1P6RA 3HRUA 2CU7A 4KIFA 5GADJ 1LJ9A 3I9V2 3H0DA 2E1NA 3OMYA 1BI2A 4BUPA 2IGKA 4LD5A 1B72A 3CF5F 4WWCA 4NQWA 1SD5A 3GFLA 4BXUA 3UNGC 1U78A 5CVIA 3BR2A 5CJ9A 2IEKA 2H6CA 3V7SA 3SEQA 4CCLA 1B6AA 2PN6A 2JVGA 2RQQA 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 2A5WA 2KJBA 3JTHA 5DEQA 1ZARA 4RDUA 2DBBA 2AQEA 4BY7J 2A6HF 3ZRGA 2HZTA 3AG3H 5A2QK 5J1UA 3A03A 2HXIA 3S1RJ 1FSHA 1WI9A 2IBDA 3RKXA 1A5JA 1IN5A 4OAZA 4RM2A 1VQ4I 4S0HB 2DOEA 4IJAA 4QTRA 2KDZA 2L3DA 3DU5A 5L3FA 1YITI 2IGMA 2MD5A 1VI0A 2MH2A 3B6AA 1EH8A 2A61A 4PJ0C 4U7DA 3OYIA 3CQZJ 1GXQA 5D4RA 4EGZA 2R7VA 1YOVB 2A69F 2B63J 2RC4A 2E7XA 2VQHA 1NTCA 2XB5A 2JN6A 1W36C 2BVMA 1HW1A 4NNJA 1MJAA 4KITB 4I09A 3GTLJ 3HC7A 5EYRA 2DQLA 2FBHA 1HKTA 2LRDA 2JWTA 4PZJA 2EFPA 1UAAA 3VFZA 2WAQA 3DFGA 3PQJA 4HF2A 3H3VK 5DDGA 2Y75A 4L9NA 2M3AA 2DT6A 2OA4A 5J4VA 2UUZA 3OYCA 1B8IA 1MJ9A 4ZJZA 3CCEI 3S32A 2FD5A 1LE8B 4CGZA 4A5NA 3QRFF 1QO0D 4A0YA 3PM1A 5IP9J 3LA7A 1SVMA 2KIUA 5FFXA 4HYEA 3WGGA 4I7HA 5HODA 4ZDOA 4IHSA 3AG4H 1SANA 3F6VA 2ZJPF 3K2AA 1SMYF 3MEXA 4G7OF 4PJNA 3FF5A 3JW4A 4CXFA 3U21A 5IT9K 2LP0A 4XMYA 3DEUA 4AU7A 4AYBA 2L7KA 3QPTA 3CUOA 4WCGA 4CDGA 2BYVE 3H35A 3DV8A 3BROA 3KFWX 2QQ9A 3AG1H 2M7AA 3T1BA 3H36A 5AIPA 1Z05A 1IN7A 3ASOH 3M4OJ 2KJCA 3Q0UA 2ZSHB 1XD7A 4NDLA 4XKWA 2YU3A 2Y9YA 4S05A 3CCSI 2XRLA 4U0WA 2PMZA 2DA6A 1YJWI 4XONA 2H09A 3GBGA 3LSMA 4HEA2 3TGNA 1J7KA 1Y1VJ 2PJRA 3LFKA 4MFDA 2DK5A 3HOYJ 2VN2A 5EF6A 3BZ6A 2BVLA 1JGGA 2JZYA 1O3TA 2WBMA 3HGGA 2EK5A 2F6CA 1ZLJA 3ONQA 1YRNA 2PLYA 4QLCU 4A69C 4UUSB 2BHZA 2B7EA 1J59A 4B43A 2IW5A 3AL0B 4L9JA 2YPRA 3IKVA 1ZR2A 3EUHC 5KK1A 3E6MA 3F21A 2WV0A 1BC8C 2CQQA 3JSPA 4LIUA 2Q8KA 3CDIA 2QENA 3WTUC 2FJ1A 1YIJI 3CDHA 2M0CA 2OC6A 2HZDA 4BHCA 1T95A 3HOSA 2JA2A 3MAJA 4G12A 5D5XB 5J47A 3O6BB 1QNTA 4XL9A 1YO5C 4XOPA 1FMVA 3HKZA 2A5YB 1IGNA 2X51A 2OZ6A 1T98A 1MH3A 4FASD 1PVEA 3GXOA 3FMRA 3I56I 2V26A 3VDXA 2D1HA 4F93B 2JPCA 3DKYA 1CF7A 1VNDA 1E0EA 4IRHA 4Q48A 3V42A 1HW5A 3K4BA 2IGNA 2K9SA 3BTLA 1FBUA 5M5WJ 3G6EI 4M3EA 5ICCA 3O3KA 4AIKA 4Y3OA 3SXYA 1R9TJ 2Y69H 2VT3A 4II3A 3JREA 1BJAA 2EBIA 3HJEA 1YYVA 4PSXA 1MBEA 3DU6A 3GFMA 3I59A 2ZNZA 5E3LA 2DPUA 3BPXA 2V9PA 1N75A 1A31A 3SEZA 3H9GA 1D3YA 3K10A 1LB2A 1L3LA 2H1LA 2FXAA 2GA2A 1IUFA 4HF1A 3LL7A 1W5CC 2DMPA 4U87A 5B66C 2K85A 3CP8A 2ZCWA 4UUSA 2LH9A 3K1NA 3FBNB 1WH5A 2BW3A 3CTAA 3E7LA 2KIMA 3TEDA 2K3PA 1ETVA 2N8GA 5EGOA 1IF1A 3B73A 3IAM2 3IC7A 2PG4A 3E5XA 1OQYA 4YEJA 3N05A 3RJPA 3K69A 5LHIA 4PSWA 1RR7A 4HV6A 1LDJA 2L9VA 1OPCA 5D5VB 2V1NA 1SVOA 5F04A 2IS2A 2AHQA 3P9KA 5BQTA 3FKIJ 4A6DA 2V1DA 4X1EA 2ME0A 3FISA 3OS1A 3C2HA 3U1KA 3K4MA 3OYFA 2LF8A 3HSRA 1B4AA 2ZXHA 2FRHA 3CMMA 2O7OA 3RCOA 4BGDA 2CWEA 2G7UA 3QPLA 2EZHA 4HV5A 4HOBA 4PCQA 2E35A 3WHBA 1IUYA 3HTSB 4FCYA 3J81K 1TTYA 2ZFUA 1N77A 1CQTA 1FNNA 3C7JA 3OSFA 3FK7A 4M3BA 3JR9A 1Q1VA 2BGCA 3OYGA 1B9NA 2ZMEA 3BR3A 2IA0A 4AUXA 2QM3A 3F72A 4NQWB 1WJBA 3HTUA 3W6KB 2AQFA 5CYVA 1HDDC 4AYBN 1YI2I 1VQ8I 1WJ5A 1I39A 4JQFA 4ZC3A 4B3XA 1I6XA 3KEOA 4MIMA 2M5WA 1X19A 3ERMA 5CVVA 1Y0UA 5KNLA 2O03A 4IF4A 3QU3A 5F0FA 1MBFA 2PFBA 1SVLA 2OZUA 4W97A 3JRBA 1IRZA 2X6OA 2EJRA 4ZH4F 2LFBA 3JTGA 2KMUA 4D7NA 3GZ5A 2XPVA 3ZPLA 4JK1X 2FX0A 2ICWG 3RYRA 3NWSA 1YFHA 1V4RA 1BIBA 2M8EA 3ELKA 1I1GA 5FD6A 3H1CA 1IV8A 1VF9A 4E7ZA 1O7FA 3EYYA 4EM1A 3S1MJ 2OTLI 3S2WA 3FX3A 4CICA 2M34A 1V5GA 3OOPA 3PSIA 4EJOA 1WRJA 4B1RA 5FRMA 3HUGB 2EILH 2XPWA 2ELHA 1FOWA 4HSTA 2G9WA 1W0UA 4E7IA 4EJWA 4BBSJ 3VYUB 2ZMEB 3F22A 2DTZA 4CYCB 3FKJA 4BDZA 2F2EA 1JTXA 2YU9J 4IHXA 1YW8A 3GVAA 1RUOA 2L5QA 3W6JB 1MNEA 1TW2A 4AM3A 4XLCA 2OU2A 2OJED 3WODF 2LY2A 2LREA 4NHJA 4F52A 1AKHA 1ZKGA 4A3JJ 3HRSA 2NOJB 1XCBA 2VUMJ 4N4OB 1GVJA 4LG0B 1CGPA 2DFFA 5IT3A 4YELA 5JHFA 2O0YA 4BE1A 4KA4A 2QCOA 3BJAA 5TGTA 2P7VB 4MNUA 2D5VA 5L3CA 1IRGA 3TQNA 2XGCA 4JX6A 3FXKA 1ULYA 2MD0A 3HOZJ 2CQKA 3KEQA 2P7CB 4IOCF 3OIPA 1ZG3A 5FLXZ 4BE2A 1BC7C 3TP3A 3LSIA 4IEJA 3HZJA 2ACJA 2BV6A 2CUFA 3E1SA 3SJMA 2IA1A 3H5AA 2H1KA 1K78A 2GM4A 3D0SA 1MDMA 2CQXA 1D8KA 3KP6A 4UV8A 2XASA 2AXTC 1U3EM 1ETQA 1I3AA 4CZZA 2NVUB 3WU2C 4F91B 4XQFA 2ISZA 4C30A 4LG3A 2WA0A 3DQVC 1REPC 2GOXB 1S7EA 2DFEA 1MGTA 2KRFA 2QLZA 3R61A 3MVPA 3ZMTA 1T38A 5F0HA 3WTXC 2COMA 5LGNA 3I53A 4ABZA 1QZYA 4BXFA 3I55I 2Y2ZA 3LSPA 5JVTA 3GFIA 4HLYA 2JA5J 5F1RA 2VC0A 5LHGA 3BP8A 1HQCA 3Q9SA 1XTAA 2KLOA 3CP2A 2K5CA 3S17J 3LA3A 4M6YA 2DMQA 4XK4A 2VT2A 4A3IJ 2DLLA 4M3DA 2IRFG 3G71I 3CCMI 3JRCA 1FYKA 2HXOA 5EG0A 3DPUA 1F1ZA 2XB0X 5GP9A 2HVQA 3F6OA 2VIXA 5KAFC 1OCCH 4R8HA 2E5NA 2GAUA 4DYRA 2W1OA 3I71A 5B1AH 3H92A 2WADA 1LKXA 2IA2A 2NRAC 3CMYA 3FMSA 2F4OB 1R5ID 4PJMA 2HOSA 4QPQA 1XDUA 3GCMA 2IS4A 5FKLA 3OR1C 5BNGA 1H88C 4C9YA 2PJRB 1R22A 3M1EA 1K7AA 2HDWA 1WJDA 1QVUA 2K02A 3S14J 5M3FJ 1DGWY 2FUG2 4O5VA 4AC0A 1JUMA 4LIVA 1BM9A 2HVRA 4RAYA 2OBPA 1Z77A 1AU7A 1WJCA 2CO5A 1TLHB 1WVRA 4A3FJ 3S3OA 1IJWC 1XGSA 2Z33A 4Y13A 1ZRCA 1U6GA 5LGTA 3S1QJ 3RSNA 1HA8A 3FXUA 4QWQA 2MC4A 3Q0WA 2NNNA 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 1M1EB 4GDFA 2HI3A 2QF7A 1VTNC 2QSGX 3OYEA 3OYLA 3GTKJ 1TT5B 1W4MA 2GIZA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 4M6VA 5CQEA 5DUKA 2BY1A 2KDOA 3ZR8X 3S1NJ 4UXNA 2ADUA 3PIOF 1K4TA 1HKSA 3KP3A 1MBHA 4HSRA 3LOCA 1LFPA 1O57A 1U5TC 2P5KA 2EV5A 3J7AY 1SD7A 2ZNYA 5IP6A 3ULQB 2MBFA 4D7MA 2KZVA 2HGCA 2P6SA 5LEJA 3CJQB 2VOOA 2AO9A 2VODA 5LEKA 2ISYA 4ZTJA 2K7LA 4L5IA 3PO2J 2QEXI 1P7IA 3F8BA 2ZJQF 1Y6IA 5HS9A 2HQNA 2Z5UA 1B1BA 4PJLA 5F0CA 2BY3A 4B44A 3I59B 4RGRA 3PO3J 2QQBA 2DTRA 3E5UA 3QU6A 1P4AA 2R5YB 2DOFA 3HHHA 3OWTA 2R7DA 3O8GA 1QQIA 4Z2YA 2VE9A 5HDKA 3OYJA 1W5TA 5BS6A 1TNTA 2MSYA 3C3WA 3SDBA 5KAIC 2I8DA 4M72A 1LDDA 5FGMA 3PFYA 2QVOA 2V4JC 1P4WA 1IN4A 4NB5A 3CO7C 2VASA 3ZQHA 3J7AO 4AIDA 2LY9A 1Y39A 1R1TA 4CSWA 2XDVA 2QUFA 4P96A 5B3SH 1PYVA 2HYJA 2RNGA 3VYTB 3CJTB 2QBYA 2LBFA 1EA3A 4YIRX 4E6KG 2M45A 4V2GA 1ODDA 2W48A 3FZVA 1DQUA 2EA2A 3FIWA 1UMQA 4HX7A 1ETYA 2V9VA 1W7PA 5GPAA 2RGVA 1KYZA 4GCVA 2R7QA 1JT0A 1X1AA 1XC5A 2XAHA 2MGQA 3ZN1A 3OV8A 1P7JA 1HXDA 2FQ4A 2DO7A 4M3GA 5C44J 1QGPA 2F5VA 3QWLA 1NH3A 3HOXJ 2Z3YA 2K3FA 1D1AA 4PGHA 2X85A 4UUTA 4XICA 1ENHA 1MNDA 2R7ZJ 1YJNI 4KMFA 4Q5SF 4BU2A 1C0WA 3ZMVA 4BHBA 2FE3A 2EZLA 1H9GA 2Z2SB 5E18F 4XOTA 4BACA 4A3BJ 2L9SA 2Q1ZB 2GXGA 1BOAA 2O5RA 1E3OC 4IRGA 5F6FA 1J09A 2Y31A 2IGOA 4OIQF 2FEZA 2LDUA 2VB6A 3QAHA 1IXCA 3FHZA 1G6NA 1RPWA 3N97A 2B9SA 3FXQA 4YFXF 1JE8A 3H5NA 2R7FA 3FWEA 3H9QA 3NAUA 3K4LA 5FROA 5K5QA 5ILUA 4LB5A 1LVAA 1XDSA 1HCRA 1X4OA 4EJUA 3EDPA 2VONA 5B1BH 2HDDA 2WV1A 2R5YA 1D0YA 3NEUA 1EKEA 2V79A 2XAJA 3IRQA 1O4XA 2ZMEC 1I3QJ 4XNFA 3G4SI 4DNCA 3ZP5A 1G3WA 1MJBA 2WTEA 1U9NA 2V6CA 2A3SA 2Z16A 1ZK8A 3ZMSA 2G7HA 3ZQCA 3PL8A 4Y4RA 1IC8A 3BDDA 3DKWA 1W7PB 4L9VA 1Z3YA 1S7OA 4BEHA 1AWCA 3IAS2 5E17F 2Y30A 3RI4A 2WY8Q 1VQOI 5D8LB 2KISA 3JRDA 4Y33A 2P5VA 3ZGKA 2O6GE 1FT9A 2VQCA 1RI7A 4M9SA 1VQMI 1KZHA 2EPFA 1ZR4A 2FBIA 4O3MA 4IHVA 2HVSA 2HKXA 3BZKA 1O7LA 1YS6A 3LSTA 3MKLA 3CCVI 2DXIA 2J5OA 1MD0A 3OS2A 5IP7J 3BTCA 5GAGJ 2DQRA 5KVRA 4OIPF 2Z9OA 4HZFA 5K1YA 3DLLF 3DPTA 3UKGA 2LG4A 4KT5C 4NC6A 1U8RA 1UHWA 2VJ4A 4RMNA 4N9IA 2BZTA 4A3CJ 2R7UA 3QP6A 1SEUA 3RZOJ 4EATA 3RKQA 4J01A 1ETXA 2OQGA 1YHQI 2Y0MA 3HXLA 1JUSA 3CLOA 3ECHA 4IPAA 5H20A 3WE2A 4GYIA 4DIQA 2ECBA 4FETA 2KKOA 3M8JA 3A4CA 2QKLB 1K6YA 1QA6A 2Y9ZA 1SFKA 3HOVJ 2EIMH 2DCEA 2FOWA 3I58A 1ACIA 2Q2EA 3IRRA 3A1YA 4BYYA 2PJPA 1Z7UA 5L3GA 2NNYA 1MSEC 1Y56A 2CH0A 4IL6C 1WJFA 2F5DA 1Z6TA 4W1UA 2DT5A 1OMIA 4FX4A 1KU9A 2MW8A 4LMYA 4E7HA 1P92A 1QZZA 2RKHA 2P6TA 2W00A 4XLAA 4IXAA 1FPQA 2VC1A 4OIOF 1HLVA 3BOQA 3UR3C 4CCMA 2OPTA 2K40A 3E0JB 4KN4X 4KISA 1SD6A 2JK3A 1B9MA 3FHNA 1BR2A 1KU3A 3KZZA 5FB2A 4XKCA 4P9UA 5HDGA 4LGWA 3C2GA 2VL8A 2H6BA 2XF7A 4LLLA 5JR3A 1FSEA 4I99C 4ZYAA 1ZRFA 2JPBA 1D0ZA 3CCLI 2XVCA 2E34A 2ECCA 1DGRM 3ZMZA 1YJ9I 2MFZA 2XGEA 4DYCA 2A05A 3HPHA 2CFXA 5K5RA 1U8BA 1XMAA 2MABA 4ESFA 3IWZA 1Z1DA 4HAMA 2XSDC 1UB9A 2OV7A 1G59A 1FY7A 2HQAA 2CV1A 2A68F 4KUMA 2EFNA 2O3FA 1X2MA 1R23A 2EZKA 4I2OA 2BEOA 4IVNA 2MC3A 2VPRA 2K4BA 5E1XA 1G3YA 1XGMA 4CHUA 1R00A 2WC2A 5HS7A 4EJTA 1FOYA 4AWXB 2RREA 2KPMA 3GTMJ 1DU6A 2DDAA 3ZQQA 4RAZA 3A2KA 4BKXA 3I3LA 3ISPA 4IQ4A 4BNCA 4Y52J 5TISC 2LK2A 2DODA 2ELJA 4II2A 5FO5A 1FOKA 1W5SA 3BQYA 1PP8F 3DKXA 4HBLA 3K6GA 2STTA 1K4SA 2QWWA 4ASNA 1MBKA 1LQ1A 3MZ8A 3L2VA 3IHUA 3S3MA 3L00A 3J80Z 4AVZA 2HFHA 4ESBA 4L9TA 3N4MA 4FX0A 2X4HA 1IN8A 2IPQX 3U1DA 2HPMA 2PX9A 2HYGD 3BLYA 1KGSA 2HTJA 5EEHA 2K9LA 2B0LA 2DA1A 4G6DA 3QYEA 2HPIA 3K4JA 2X6YA 3I64A 2GZWA 3SZPA 2HU9A 5DM6F 4ZZLA 1WSUA 1TQMA 1LPQA 1RKWA 2MA3A 1YG2A 3E6DA 2YR2A 5IT9Z 4JX4A 3BTJA 5ERIA 1BW6A 1GV2A 2M2EA 2YSRA 3T8TA 3GFJA 5D6FA 1DP3A 3H9JA 3ZQIA 2XROA 4PGGA 2JMWA 2HEOA 5IOYA 2XPUA 4I01A 1ITYA 2X6XA 3EUKL 4HNVA 4DZJA 1XS9A 3PNVA 2DT7B 2LSOA 2PI0A 2FMLA 4P1WA 1KQ9A 2QYOA 2CQ7A 3TO7A 1X3ZB 1VQ7I 1R7JA 3D5RC 1WFXA 5EGOB 3M8FA 5IYBJ 1BIAA 2K9NA 4M73A 2MLGA 2VBXA 3MCZA 3QQAA 4LG0A 3WTSC 3CC2I 1FP1D 3ZMDA 3R0JA 5HVQC 1IRXA 4UB6C 4HNUA 1SFXA 4HG2A 3HEFA 3OS0A 3PJRA 2WB1N 1ZELA 2VPLA 4LLGF 1TQIA 3FXLA 3CCQI 1XCVA 1O3QA 3PUFA 1Y8RB 6PAXA 5AIQA 3G2BA 4ENNA 1DPUA 4R1HA 1FTTA 1WHUA 2KRHA 1RR8C 3JRIA 2COBA 2JA8J 1EV7A 1WJAA 2E36A 2QZ8A 3D5SC 5LD2C 1HBXG 3LSGA 2ZC2A 5M5YJ 1VQPI 1WPKA 4ETSA 1LFBA 1ZYRF 5J4YA 2WAEA 2KL4A 3KETA 3KLOA 4IQJA 2YUSA 2QSFX 2Y0SA 2ZKZA 3F8NA 2VXZA 3LNQA 1ZGJA 3IUOA 3K70C 2EWNA 1GVDA 2DAOA 3AKZA 4IRIA 5JHUA 3F8CA 2XKOA 4I0AA 4ZYHA 3HSEA 5FFZA 1J2XA 3W2VA 5ILVA 2R93J 4AD9A 1ORKA 2YX4A 1J9IA 2O8KA 2L4MA 3V4GA 4BS9A 1S72I 3ZMUA 1A6IA 4MQVA 1TZLA 4XIDA 4Z6YA 3DTEA 5F27A 5HLGA 1XSVA 3P9CA 4ENMA 1R5GA 3PUBA 1MH4A 1HDPA 4G6QA 5K5OA 2V1UA 5FLMJ 5C4XJ 4M9ZA 2O9LA 2W82A 1U0JA 5L3BA 1RESA 4KN7X 2PQ8A 2VKVA 3ZXSA 1SFEA 2VJ5A 3BC8A 3L09A 4RAFA 2GA1A 4DYQA 1MMSA 1BN5A 4HLXA 4BEHB 1AHDP 4L0ZB 5IOZA 1JHHA 3TP0A 3ASNH 3OYDA 3IKTA 1R58A 1S7AA 2BY0A 4BQOA 2Y48A 2DA3A 2R0QC 3E97A 2IS1A 3OYBA 1LEBA 2DA5A 5DCMB 5IYDJ 4UB8C 2K86A 4XLPF 2CS3A 3F0CA 3KX2A 5L3DA 3IV5A 2JJ7A 3HUGA 3KE2A 1T8IA 5TRDA 5DTDA 2CW7A 3EPZA 2ZBKA 3A02A 3NRVA 1T6SA 4UY8I 1D5VA 5E3MA 4MHGA 4F92B 4E7JA 3DEEA 3MN2A 3CCRI 1D1CA 3AAFA 1Y8QB 2VQGA 4KT6A 1OCZH 2GBYA 4BJ6C 1K6OA 3DXJF 2A07F 2H27A 1BR4A 3HPGA 2EFQA 3WTTC 2VKDA 3WGIA 4KIGA 3HYIA 3LSKA 1OR7C 1X3UA 1TQPA 2PBIA 4M3FA 3SZGA 4MLOA 5BMZA 2Q2EB 4CYDA 3TOBA 1UG2A 3FXOA 3G3ZA 3BQZA 4FT8A 2XGDA 2ESNA 2Z1DA 4MQ9F 5E20A 2XC7A 4A93J 4J19A 3E6BA 3MD2A 3LSRA 3AL0C 2IS6A 3MKWB 2EFOA 4PJJA 1APLC 2W7NA 1S5LC 1XG1A 1R4MB 3EUHA 1IV6A 3MQ0A 3HGYA 1PJRA 1QHHD 2R3SA 5LFAA 4KMUX 4YFKF 2W25A 1P2FA 3BTIA 3REOA 1ZGAA 5CVUA 5JFRA 1K79A 1H8AC 3WU1B 4E4HA 3HRTA 2ELKA 1FBSA 4N9HA 3TL4X 4A3KJ 3OR2C 2OTJI 3AFHA 2F4MB 1R36A 2Q0OA 3K4KA 4Y17A 1MMNA 3K9TA 4JOMA 5TJJA 1R6RA 4HA8A 3NQOA 4ZZDA 1JKRC 4EEFG 5JVGF 3ESWB 3GYHX 4HNTA 3D1NI 5K7ZA 1ZLKA 4M71A 3M07A 4CCKA 4XBFA 3MKZA 4YIFA 1YX5A 3KP2A 4QSHA 1HSJA 4FQGA 3F8FA 3L2RA 5AONA 2WAFA 2CG4A 4GFBA 1GLNA 2XHKA 1FMWA 1KU2A 4RGSA 1JT6A 2FF4A 3FK6A 2ZXIA 2EINH 3QP5A 1YIOA 3HSFA 2NOGA 4ZDLA 5D5UB 4E7LA 3NARA 3WG9A 3PQKA 4WX9A 3I54A 2LF7A 2DOAA 4X0GA 1N78A 2DI3A 1LUJB 2RQPA 3TO9A 3MMYB 3L9FA 3DWLE 1WGXA 1STZA 3QPSA 4PFOA 3RPUD 3BCBA 1MMDA 3B02A 2HKOA 2K9QA 5JLWA 2CMPA 1LE8A 2F4IA 4IOAF 1L0OC 3ABLH 4OWRB 4RB3C 1RUNA 3CC4I 3BG7A 3VYSB 1R4NB 1OLTA 5D8KB 4GRIA 1UHSA 3ABKH 2VBZA 4V2FA 3BJ6A 3DTIA 2CYYA 3SYTA 4B8XA 1WQ2A 4XLHA 1I6HJ 4WF2A 5ED4A 2E1MB 2DYSH 2V1XA 4C2TA 4G6TB 5CVJA 2ZFWA 3QODA 1GXPA 1X2NA 4G9YA 3GLLA 4XRSG 1E17A 4UVAA 1Z91A 2DK8A 4CCJA 3KZYA 3O8HA 3A0HC 3FXMA 2LR8A 2H8RA 4EQQA 5LRRA 1OCTC 1XX5A 1LNWA 1YX3A 1Z0XA 2A6TA 4PFPA 3B6CA 3H3ZA 2CRGA 2A6EF 3HOTA 4B3AA 5M3MJ 1HW2A 2JA6J 1G8XA 3Q5FA 4RM3A 5CPRB 1X1PA 4BJTA 3C2BA 3SFZA 1GUUA 3TW7A 3ZOBA 5E8GA 1R49A 2M4KA 3L2QA 3IH4A 3GX4X 2M0MA 4BJ5C 3IWFA 2R7WA 2RVCA 3K70D 1J75A 3SFIA 2UXXA 4ENJA 3PFIA 2CV2A 4RLFA 4R79A 1MZBA 4L5JA 1BL0A 1NK3P 2M9HA 4J00A 2CW8A 2DFIA 1S29A 4JX5A 3BG5A 3I5UA 4EM2A 4A3EJ 4LLNA 3JAMK 3Q0VA 2KHMA 4OU0A 3PSFA 1QU3A 4G94A 3BY6A 2G0EA 1D0XA 2NXNB 4D5FA 4GYGA 1FX7A 3K0LA 4FHTA 5LBQA 3JRHA 1MMGA 1CF7B 1OISA 4N0BA 2E60A 3S93A 2XGXA 5J1RA 3HM5A 2QKMB 2LYCA 3WE3A 2E7WA 1MKMA 1TWCJ 2AS5F 2VJIA 1NK2P 3GZNB 1OKRA 3PIPF 1W36D 5HNFA 3FM5A 5GAEJ 1Z7LA 1XGNA 5J6XA 1R1UA 1Z67A 3FXRA 4XKVA 1G3TA 2PMHA 2X9DA 1N25A 3OYNA 4HPQA 1IAWA 1T33A 3GTJJ 3GF2A 5LHHA 3H5RA 3QOPA 5J3LA 3BPVA 5GAHJ 3ROUA 2NVQJ 4U88A 2QBYB 4GO1A 3RPUA 2L4AA 1FTZA 1V54H 3OYAA 4M74A 1O3SA 1V5EA 4PUSA 3BCAA 4LK1F 1H89C 3HDDA 2GIVA 2L54A 2VXDA 4HF0A 5H6QA 1VQ9I 2FQ3A 3BZCA 1J0RA 2R7XA 3OL3A 4HDUA 4BDYA 4PK4A 3DPLC 3RIRA 1MMAA 1LEAA 1QRYA 4PDKA 4U0VA 4OINF 3BR0A 1KQ8A 1SAXA 1Q1HA 1YW7A 1NG7A 2VLAA 2LKSA 2Z99A 3S15J 1ERDA 2W85A 1USTA 1OJLA 4Y7NJ 2CW0F 1SC7A 2YX7A 4C3IJ 1ZG1A 2F5CA 4ITVA 2FNPA 3JRGA 3EUAA 2LNBA 1IG7A 3GTGJ 4A0XA 5HS8A 1JUPA 2JSPA 2HDCA 4QPOA 1UJ8A 3R6SA 1RC9A 1VQNI 3CUQB 4H4KC 2GLOA 3KIOA 1BJZA 3HOUJ 3BG6A 3GUDA 5ILSA 2OAZA 4P5OA 4EMSA 4E7KA 3X2QH 2IVMA 2L02A 1A36A 4I98B 3HG9A 4KDPA 3P5JA 4WXDA 3A01B 1X3WB 2L7FP 4XN3A 5HDNA 1DUXC 4XLEA 4MGRA 5FLXK 2LKXA 2TRTA 4FTHA 1RIOH 1KU7A 4BE0A 4G7HF 1SFUA 2E2HJ 3GWZA 3VWBA 1AOYA 5M5XJ 4RB0A 3CESA 3ZN0A 4I76A 1BOBA 3HIFA 1KYWA 3S8PA 2D1VA 5HLIA 4A3GJ 2XF5A 2IAIA 1MBGA 3K2ZA 4CZCA 1USSA 2ETHA 2XSJC 4E70A 2QGUA 3K1PA 3KPHA 2DA4A 3E3VA 1K83J 2X48A 4EVIA 4YFNF 1F9NA 2DA7A 2I5UA 3L2CA 3L7WA 3HHGA 4NUBA 5EG0B 1ONVA 1GT0C 2O61A 5DUIA 5LLQA 4G8XA 1U2WA 2GXAA 5ICEA 5DD8A 2MH9A 3OIQA 2EV6A 5F64A 3FMQA 1LDKB 2LMDA 5J1YA 2CV0A 2XAFA 4N4NB 2H8WA 1FIPA 4F7ZA 2JQ7A 3FDYA 4YIIA 5C4JJ 2UZKA 1AA7A 1POGA 1OYWA 2IJLA 1ON1A 3ZQGA 3SDGA 2CGPA 3F8MA 1A35A 4XLFA 5DS9A 3S16J 1FC3A 3ZQFA 4UVCA 3DLAA 4BBRJ 3EQLF 1HSTA 2L7ZA 4MTDA 4IHYA 4ANJA 3TKYA 1TT0A 5FKMA 4D0PA 1OR7A 1UZCA 3VOEA 4A3DJ 4A2UA 3CDLA 3SHFA 4OMZA 3GTQJ 5DCFA 4IHTA 3CLQA 3VYRB 1YLFA 3G1OA 3AG2H 3OYHA 2WAQN 2X1DA 3TDZC 4LOCA 2IXSA 1G3SA 5IPAA 1VZ0A 2R7RA 1D5YA 3CZ6A 4I0BA 1W1WE 1FIAA 2JRMA 3RPQA 1PDNC 1XN7A 2M8GX 5FJ8J 5FLVA 4C2MJ 1ZREA 1U5TB 4BL0B 3TMOA 1ZAOA 2XV4S 2P4WA 4DOZA 3HB9A 5J8CA 3V8KA 1O3RA 2YS9A 3EETA 2W4SA 4MTEA 4XRFA 3JSOA 2WY7Q 1ZN2A 2DFHA 2VQLA 2QA4I 1E3PA 4BQAA 2ZJRF 2R4GA 3LFUA 3E5QA 3H3UA 1JGSA 2NYXA 4WXHA 2CUJA 4DBQA 4IKFA 3KYDB 2NVTJ 1YS7A 3V7RA 4A5MA 3CJRB 1V55H 2RAEA 1FYLA 4OIRF 4CO8A 4YG2F 4F55A 3ZQLA 3WTZA 3BG9A 1HF0A 3GTOJ 2X1CA 5IY5H 1F36A 2J5PA 3ZQ7A 1X1CA 5K7HA 2E1MC 4JYKA 3JCUC 1BBYA 1S3JA 3A01A 3TOAA 3T8RA 3WTYC 1R71A 3TO6A 1UFMA 2GOMA 4M6XA 4XKBA 1X1DA 1Z21A 4A6EA 3OY9A 2E1CA 1IXSB 4MFEA 2DMNA 3IH2A 3RKYA 2EQRA 1LVKA 2NVXJ 1I5ZA 1U9OA 4JBAA 2STWA 3DBLB 4DW6A 4FE4A 1XMXA 1IXRC 3W3CA 2E1OA 2CSOA 2L9RA 1PUFB 1BW5A 1IW7F 3T5XA 4ESJA 5DM7F 1T39A 2F48A 3R60A 5DYMA 2F5FA 3LMMA 3EYIA 1QBJA 1NG6A 9ANTA 1SAUA 3OIOA 2R5ZA 3LQQA 4UVBA 4XLNF 3MZHA 4HX8A 5DV5A 1R5HA 3QYBA 2X1EA 3GEZA 3OL4A 2R7TA 2OQRA 3CCJI 3WG7H 4OMYA 3ECOA 3W2AA 5GTIC 1WI3A 1G4DA 2P8TA 2P5LC 2ESHA 1Z6RA 2CFOA 3LAPA 2VKEA 4UV9A 2FA5A 5E79C 3G73A 4C3JJ 4EJVA 3KYLA 2UXNA 1TP4A 5L3EA 3L2WA 1JJ8C 4AIHA 1VQKI 1WCMJ 4XSXF 4EV0A 3BG3A 1QVTA 4ON0A 3BR1A 4LJZF 4HDVA 4B4CA 2ID6A 3IH3A 4DBRA 2HQRA 4BH9A 3P7NA 3TDUC 4EM0B 1HOMA 1T0FC 4G7ZF 3LAJA 1H9TA 2ZB9A 3F3XA 3IP4B 2BE5F 4K2EA 3NWTA 3T0YA 3J81Z 3KLNA 2C6YA 1RNLA 3SZTA 2E2JJ 4B47A 1XSXA 4L5EA 1FP2A 2K9MA 4KJZA 4ZDPA 1VQLI 2HOEA 4C2UA 3DBHB 1TL8A 2M87A 3LSHA 1JHFA 3ABTA 3FXJA 5H6RA 1PUFA 1A04A 2ZSIB 1ETOA 1RRJA 4BAYA 3RQIA 1PP7U 1YE9A 3G1MA 3OOUA 2EA4A 1ZH5A 1ZQ3P 1UG0A 3HOWJ 4LITA 4XSZF 4HW0A 1TC3C 3SQNA 1ZG5A 5KCMA 4HQEA 5EZHA 2CQNA 4AIJA 2PMZN 1ZTRA 5F08A 2W57A 1OYIA 2ZO4A 3M8EA 4U7BA 4WK8F 2KIFA 3VODA 1FYMA 2CJJA 2LY1A 1OCPA 1V5FA 2NAZA 5JI6A 1S8NA 1TWHJ 4CCOA 2QQAA 2QQ8A 3L1PA 2EIJH 5H2FC 3CUQA 4IHWA 4HX4A 4P55A 3CF2A 1X4PA 5E1ZB 2HR3A 4A0ZA 5JLXA 1XB4A 1Z9CA 2VE8A 1RZ4A 1ZHFA 2XAUA 2ZXWH 1GDTA 1JKPC 2WWYA 4A3MJ 1MW7A 1H0MA 3GTPJ 3WHCA 2DMUA 2HS5A 2X6WA 3J7YJ 3M7GA 3WTVC 2FMYA 3M3YJ 4IZZA 1TWFJ 3Q3SA 5FKNA 4LFUA 4JP0A 5E3NA 3RDIA 2ME6A 1IO2A 3JRAA 2P81A 1P4XA 1IDZA 4CYCA 3COAC 3V8JA 4BY1J 1FJLA 3L2UA 2XRNA 2HWVA 2EV0A 3BR5A 1K78B 5LGUA 2ZJ2A 4XN0A 3DCFA 3W2WA 1EH7A 4RBOA 3BR6A 2DU9A 2JUCA 5FKOA 2V7FA 4GGGA 2UWMA 2JUGA 2E5ZA 2IP2A 3VPRA 3GZ6A 1YTYA 3VSKA 4L0YB 2FSWA 4UHTA 2R7OA 4BQNA 4A12A 2QSHX 2VJJA 2GQQA 3DEWA 2NVYJ 5D4SA 1T0FA 2FNAA 1DU0A 3M1CA 1PUEE 2E71A 2R7SA 2HOAA 1TBXA 4CA0A 2P0WA 5IYCJ 3QYFA 2L9NA 4FISA 4X6AJ 5J8FA 2DA2A 3WU0A 4NC8A 1FOXA 5ICGA 1T2KA 3I0TA 1S6LA 2H94A 1D8JA 4RGUA 1KQ0A 1I1SA 4RB1A 2M1BA 4RGXA 2KZGA 1FBQA 5EDNA 1RETA 1JKOC 4IX7A 4S04A 2LD5A 2EIKH 2LVSA 1SFOJ 1AKHB 5E8IA 1ETWA 4HRIA 2HYFA 1S9HA 3ML6A 2L01A 2LTPA 3KCCA 5BPIA 3V8LA 5F1JA 3KYCB 2OUMA 3KP5A 1BI1A 2OF7A 4DJAA 2R92J 2TCTA 2VOPA 3RKWA 3CD6I 1DPRA 3C18A 3LWFA 1EF4A 1FEXA
chains in the Genus database with same CATH topology
2XUBA 2RDPA 1F4KA 2O8XA 4KYWA 4AVPA 1QPMA 2RV8A 3DP7A 1MDMB 1U5TA 1YW9A 5E1WA 3IL2A 4H0EA 5CVRA 3JAMZ 3D5LA 4TV7A 2DPDA 1KA8A 1F5TA 4Q47A 3J80K 3WGHA 2JT1A 1E2XA 3ABUA 4RS8A 1B59A 4LK0F 4B09A 4L18B 1ON2A 1DP7P 1V3FA 2K4JA 1OYYA 1SD4A 1IN6A 2W24A 3FM3A 1HKQA 1TW3A 2K27A 4U0YA 4Y15A 2PEXA 3M9AA 4WXCA 3LA2A 2XIGA 3CJNA 1W7PD 3R0AA 4I02A 4RB2C 2XAQA 3MWMA 5DD4A 2D2WA 2JTVA 1EH6A 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 3RYPA 1BI3A 2IT0A 3V7CA 3P9IA 1DDNA 5A2QZ 4Q4ZF 1TNSA 1IZ1A 1UHMA 2F5EA 4ZYDA 1NHAA 1YQAA 1R1VA 3ERED 4GXOA 2RN7A 2VBYA 2NS0A 3E6CC 2RNJA 2JRTA 4LB6B 3VB2A 4ENKA 1UCRA 1ZRDA 1WKMA 4MEYF 1J5YA 3GO5A 2EFWA 3BWGA 5EEGA 1GHCA 3R4KA 3BJOA 4KFCA 4KNYA 2W84A 5BPDA 2EB7A 3F23A 5BOXA 5FD5A 3U2RA 3O2PE 3I4PA 1XSDA 4KICA 2FU4A 3C1DA 2M30A 4UUVA 4OOIA 1SMTA 5DCMA 3U9GA 5LRSA 5D5WB 1BI0A 3CUQC 2OD5A 2TDXA 4HQMA 4P9FA 3K1MA 3LQRA 4BHPA 2ZXJA 2HTSA 2GWRA 1JXSA 2FOKA 3KP7A 5D6EA 3GLXA 3RTRA 1I27A 3CO6C 2D45A 3KP4A 4ZYEA 4EGYA 2XAGA 4ZYGA 3Q9VA 2MLKA 1FZPB 3QPHA 2BBYA 2GXBA 4MEXF 1FLIA 2LKPA 3MFKA 2X0LA 5CLSA 4UNOA 1XGOA 3GW2A 4M9XA 1P6RA 3HRUA 4KIFA 1LJ9A 2E1NA 1BI2A 4LD5A 4WWCA 4NQWA 1SD5A 3GFLA 4BXUA 1U78A 5CVIA 5CJ9A 3V7SA 2H6CA 1B6AA 2PN6A 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 2KJBA 3JTHA 5DEQA 1ZARA 2DBBA 2A6HF 2HZTA 5A2QK 1FSHA 1WI9A 3RKXA 1IN5A 4IJAA 2L3DA 5L3FA 2MD5A 2MH2A 1EH8A 2A61A 4U7DA 1GXQA 5D4RA 4EGZA 2A69F 2RC4A 2E7XA 1HW1A 1MJAA 4I09A 2DQLA 2FBHA 1HKTA 4PZJA 2EFPA 3VFZA 3DFGA 3PQJA 4HF2A 5DDGA 2Y75A 4L9NA 2OA4A 1MJ9A 4CGZA 4A5NA 3QRFF 1QO0D 4A0YA 3LA7A 3WGGA 2KIUA 5FFXA 4HYEA 4I7HA 4IHSA 3F6VA 1SMYF 3MEXA 4G7OF 3FF5A 3JW4A 4CXFA 5IT9K 3DEUA 3QPTA 3CUOA 4WCGA 4CDGA 2BYVE 3DV8A 3BROA 3KFWX 2QQ9A 3T1BA 5AIPA 1Z05A 1IN7A 2KJCA 1XD7A 4S05A 2YU3A 4U0WA 2H09A 3TGNA 1J7KA 3LFKA 2DK5A 2VN2A 3BZ6A 2JZYA 1O3TA 2EK5A 1ZLJA 2PLYA 4QLCU 1J59A 2IW5A 4L9JA 2YPRA 3IKVA 5KK1A 3E6MA 3F21A 2WV0A 1BC8C 3JSPA 2Q8KA 2QENA 3WTUC 3CDHA 4BHCA 3HOSA 3MAJA 5D5XB 3O6BB 1QNTA 1YO5C 2A5YB 2OZ6A 1T98A 3GXOA 3FMRA 2D1HA 2JPCA 1CF7A 4IRHA 4Q48A 1HW5A 1FBUA 5ICCA 3O3KA 4AIKA 3SXYA 2VT3A 1BJAA 1YYVA 3GFMA 3I59A 2ZNZA 2DPUA 3BPXA 1D3YA 1L3LA 1LB2A 4HF1A 2FXAA 2GA2A 2ZCWA 3K1NA 3CTAA 2KIMA 1IF1A 3B73A 3IC7A 2PG4A 3E5XA 3RJPA 3K69A 5LHIA 4HV6A 1LDJA 1OPCA 5D5VB 3P9KA 5BQTA 4A6DA 2V1DA 2LF8A 3HSRA 1B4AA 2FRHA 2CWEA 2G7UA 4HV5A 4HOBA 4PCQA 1IUYA 3HTSB 3J81K 1TTYA 1FNNA 3C7JA 2BGCA 1B9NA 2ZMEA 2IA0A 2QM3A 3F72A 3HTUA 3W6KB 5CYVA 4JQFA 1I6XA 3KEOA 2M5WA 5CVVA 1Y0UA 2O03A 4IF4A 3QU3A 2PFBA 2OZUA 2EJRA 4ZH4F 3JTGA 3GZ5A 3ZPLA 4JK1X 3RYRA 1YFHA 1V4RA 1BIBA 2M8EA 3ELKA 1I1GA 5FD6A 1O7FA 3EYYA 4EM1A 3S2WA 3FX3A 4CICA 3OOPA 4EJOA 1WRJA 2ELHA 2G9WA 4EJWA 2ZMEB 3F22A 2F2EA 1YW8A 3GVAA 1RUOA 3W6JB 1TW2A 2OU2A 3WODF 4NHJA 3HRSA 1XCBA 1GVJA 4LG0B 1CGPA 5IT3A 2O0YA 4KA4A 3BJAA 2P7VB 4MNUA 5L3CA 1IRGA 3TQNA 1ULYA 2CQKA 3KEQA 2P7CB 1ZG3A 5FLXZ 1BC7C 2ACJA 2BV6A 2IA1A 1K78A 3D0SA 1MDMA 3KP6A 1D8KA 4UV8A 2XASA 1U3EM 4CZZA 2ISZA 3DQVC 1REPC 1MGTA 2KRFA 2QLZA 3R61A 3ZMTA 1T38A 3WTXC 2COMA 5LGNA 3I53A 1QZYA 4HLYA 5JVTA 3GFIA 5F1RA 2VC0A 5LHGA 3BP8A 1HQCA 3Q9SA 3LA3A 4M6YA 2VT2A 2DLLA 2IRFG 1FYKA 1F1ZA 3F6OA 4R8HA 2GAUA 3I71A 3H92A 2IA2A 2NRAC 3FMSA 1XDUA 1R22A 3M1EA 1K7AA 2K02A 4O5VA 1BM9A 4RAYA 2OBPA 2CO5A 1TLHB 1XGSA 2Z33A 4Y13A 1ZRCA 1U6GA 5LGTA 3FXUA 4QWQA 2NNNA 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 1VTNC 1W4MA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 5DUKA 4UXNA 2ADUA 1HKSA 3KP3A 1O57A 1U5TC 2P5KA 2EV5A 1SD7A 2ZNYA 3ULQB 2MBFA 2HGCA 2P6SA 5LEJA 2VOOA 2VODA 5LEKA 2ISYA 2K7LA 4L5IA 3F8BA 5HS9A 2HQNA 2Z5UA 1B1BA 3I59B 4RGRA 2QQBA 2DTRA 3E5UA 3QU6A 1P4AA 3HHHA 2R7DA 1QQIA 4Z2YA 2VE9A 5HDKA 1W5TA 5BS6A 1TNTA 3C3WA 4M72A 1LDDA 5FGMA 2QVOA 1P4WA 1IN4A 4NB5A 3CO7C 3J7AO 1R1TA 2QUFA 4P96A 2QBYA 2M45A 1ODDA 3FZVA 2EA2A 4HX7A 2V9VA 1W7PA 2RGVA 1KYZA 4GCVA 2XAHA 3ZN1A 3OV8A 1HXDA 2DO7A 1QGPA 2Z3YA 4PGHA 4KMFA 4Q5SF 1C0WA 3ZMVA 4BHBA 2FE3A 1H9GA 5E18F 2GXGA 1BOAA 4IRGA 5F6FA 4OIQF 2FEZA 2LDUA 3QAHA 1IXCA 3FHZA 1G6NA 3N97A 3FXQA 4YFXF 1JE8A 2R7FA 3FWEA 5K5QA 5ILUA 4LB5A 1LVAA 1XDSA 4EJUA 3EDPA 2VONA 3NEUA 2V79A 3IRQA 2XAJA 4DNCA 3ZP5A 1G3WA 1MJBA 2WTEA 2V6CA 2A3SA 3ZMSA 2G7HA 3BDDA 3DKWA 1W7PB 4L9VA 1S7OA 1AWCA 5E17F 3RI4A 5D8LB 2P5VA 2O6GE 1FT9A 1RI7A 4M9SA 2FBIA 4O3MA 2HKXA 1O7LA 1YS6A 3LSTA 2J5OA 1MD0A 2DQRA 5KVRA 4OIPF 2Z9OA 4HZFA 5K1YA 3DPTA 4KT5C 1U8RA 1UHWA 4N9IA 3QP6A 2OQGA 2Y0MA 3CLOA 3ECHA 4IPAA 5H20A 3WE2A 4GYIA 2KKOA 3I58A 2Q2EA 3IRRA 4BYYA 2PJPA 1Z7UA 5L3GA 2NNYA 2F5DA 1Z6TA 2DT5A 1OMIA 4FX4A 1KU9A 4LMYA 1P92A 1QZZA 2RKHA 2P6TA 4IXAA 4OIOF 1FPQA 2VC1A 3BOQA 4KN4X 1SD6A 1B9MA 1KU3A 3KZZA 5FB2A 4P9UA 5HDGA 4LGWA 2H6BA 4LLLA 5JR3A 1FSEA 1ZRFA 2JPBA 2XVCA 3ZMZA 2CFXA 5K5RA 1XMAA 4ESFA 3IWZA 1Z1DA 4HAMA 1UB9A 1FY7A 2A68F 4KUMA 2EFNA 2O3FA 1R23A 4I2OA 2BEOA 4IVNA 2MC3A 2K4BA 5E1XA 4CHUA 1G3YA 1XGMA 1R00A 2WC2A 5HS7A 4EJTA 4AWXB 4RAZA 3ISPA 4BNCA 5FO5A 1FOKA 1W5SA 1PP8F 4HBLA 2STTA 2QWWA 4ASNA 1LQ1A 3IHUA 3L00A 3J80Z 2HFHA 4ESBA 4L9TA 3N4MA 4FX0A 2X4HA 1IN8A 2IPQX 3U1DA 2HYGD 1KGSA 2HTJA 5EEHA 2B0LA 4G6DA 3I64A 2GZWA 3SZPA 4ZZLA 1WSUA 1TQMA 2MA3A 3E6DA 1YG2A 2YR2A 5IT9Z 5ERIA 2YSRA 3T8TA 3GFJA 5D6FA 2XROA 4PGGA 2HEOA 4I01A 2LSOA 2PI0A 2FMLA 1KQ9A 2QYOA 3TO7A 1R7JA 3M8FA 1BIAA 4M73A 2MLGA 2VBXA 3MCZA 4LG0A 3WTSC 1FP1D 3ZMDA 3R0JA 5HVQC 1SFXA 4LLGF 1TQIA 1XCVA 1O3QA 6PAXA 5AIQA 4ENNA 1DPUA 4R1HA 1EV7A 2QZ8A 1HBXG 4ETSA 3KETA 1ZYRF 3KLOA 2ZKZA 3F8NA 2VXZA 1ZGJA 2EWNA 2DAOA 4IRIA 5JHUA 3F8CA 2XKOA 4I0AA 4ZYHA 3HSEA 5FFZA 1J2XA 5ILVA 4AD9A 2YX4A 1J9IA 2L4MA 3V4GA 3ZMUA 4MQVA 5HLGA 1XSVA 3P9CA 4ENMA 1R5GA 4G6QA 2V1UA 5K5OA 4M9ZA 5L3BA 4KN7X 2PQ8A 1SFEA 3L09A 2GA1A 1BN5A 4HLXA 4L0ZB 1JHHA 3IKTA 1R58A 1S7AA 2Y48A 3E97A 1LEBA 5DCMB 2K86A 4XLPF 5L3DA 3HUGA 3KE2A 5TRDA 2ZBKA 3NRVA 1T6SA 1D5VA 4MHGA 3AAFA 1K6OA 2A07F 2H27A 3DXJF 2EFQA 3WTTC 3WGIA 4KIGA 3HYIA 1X3UA 1TQPA 2PBIA 5BMZA 4CYDA 3TOBA 3G3ZA 4FT8A 2ESNA 4MQ9F 5E20A 3E6BA 2EFOA 3EUHA 3MQ0A 2R3SA 4KMUX 4YFKF 2W25A 1P2FA 3REOA 1ZGAA 5CVUA 5JFRA 1K79A 3WU1B 3HRTA 1FBSA 4N9HA 1R36A 2Q0OA 4Y17A 3K9TA 5TJJA 4HA8A 3NQOA 4ZZDA 3GYHX 1ZLKA 4M71A 4XBFA 4YIFA 3KP2A 1HSJA 3F8FA 5AONA 2CG4A 2XHKA 1KU2A 4RGSA 2FF4A 3QP5A 1YIOA 3HSFA 5D5UB 3WG9A 3PQKA 4WX9A 3I54A 2LF7A 2DI3A 2RQPA 3TO9A 3L9FA 1STZA 3B02A 2HKOA 1L0OC 4RB3C 1RUNA 5D8KB 2VBZA 3BJ6A 2CYYA 4B8XA 1WQ2A 4WF2A 5ED4A 2V1XA 5CVJA 2ZFWA 1GXPA 4G9YA 1E17A 4UVAA 1Z91A 2DK8A 3KZYA 4EQQA 5LRRA 1LNWA 3H3ZA 2A6EF 3HOTA 1HW2A 3Q5FA 3SFZA 5E8GA 3GX4X 3IWFA 2RVCA 1J75A 2UXXA 4ENJA 3PFIA 4R79A 1MZBA 4L5JA 2DFIA 1S29A 3I5UA 4EM2A 4LLNA 3JAMK 4OU0A 4G94A 3BY6A 4GYGA 1FX7A 3K0LA 4FHTA 5LBQA 1CF7B 4N0BA 2XGXA 3WE3A 2E7WA 1MKMA 2AS5F 1OKRA 3FM5A 1XGNA 5J6XA 1R1UA 3FXRA 1G3TA 2PMHA 1IAWA 3GF2A 5LHHA 3QOPA 3BPVA 3ROUA 4U88A 2QBYB 4GO1A 3RPUA 2L4AA 4M74A 1O3SA 4LK1F 2GIVA 2L54A 4HF0A 5H6QA 2FQ3A 1J0RA 4HDUA 3DPLC 3RIRA 1LEAA 4PDKA 4U0VA 4OINF 1KQ8A 1SAXA 1Q1HA 1YW7A 2Z99A 2W85A 1USTA 2CW0F 2YX7A 1ZG1A 2F5CA 2FNPA 2LNBA 4A0XA 5HS8A 2HDCA 3R6SA 3CUQB 3GUDA 5ILSA 2OAZA 4P5OA 4EMSA 2IVMA 2L02A 4I98B 4KDPA 4WXDA 5HDNA 1DUXC 4MGRA 5FLXK 1RIOH 1KU7A 4G7HF 1SFUA 3GWZA 1AOYA 4RB0A 3ZN0A 3HIFA 1KYWA 2D1VA 5HLIA 3K2ZA 1USSA 2ETHA 4E70A 3K1PA 3E3VA 4EVIA 4YFNF 1F9NA 3L2CA 3L7WA 3HHGA 1ONVA 2O61A 5DUIA 5LLQA 4G8XA 1U2WA 5ICEA 5DD8A 2MH9A 2EV6A 5F64A 3FMQA 1LDKB 2XAFA 4F7ZA 4YIIA 2UZKA 1OYWA 2IJLA 1ON1A 2CGPA 3F8MA 1FC3A 4UVCA 3EQLF 1HSTA 4MTDA 3TKYA 4D0PA 1OR7A 3VOEA 4A2UA 3SHFA 4OMZA 5DCFA 4IHTA 1YLFA 3TDZC 1G3SA 4I0BA 3RPQA 1PDNC 1XN7A 1ZREA 1U5TB 1ZAOA 2XV4S 2P4WA 5J8CA 3V8KA 1O3RA 3EETA 4MTEA 4XRFA 3JSOA 1ZN2A 4BQAA 3E5QA 3H3UA 1JGSA 2NYXA 4WXHA 1YS7A 3V7RA 4A5MA 1FYLA 4OIRF 4CO8A 4YG2F 3WTZA 2J5PA 3ZQ7A 1BBYA 1S3JA 3TOAA 3T8RA 3WTYC 3TO6A 1UFMA 4M6XA 4A6EA 2E1CA 1IXSB 3RKYA 1I5ZA 4JBAA 2STWA 1IXRC 2CSOA 1IW7F 3T5XA 4ESJA 1T39A 3R60A 5DYMA 2F5FA 3EYIA 1QBJA 3MZHA 3LQQA 4UVBA 4XLNF 4HX8A 5DV5A 1R5HA 3GEZA 2OQRA 4OMYA 3ECOA 1G4DA 2P8TA 2P5LC 2ESHA 1Z6RA 3LAPA 4UV9A 2FA5A 3G73A 4EJVA 2UXNA 5L3EA 4AIHA 4XSXF 4EV0A 4ON0A 4HDVA 4LJZF 2HQRA 4BH9A 3P7NA 3TDUC 4EM0B 4G7ZF 3LAJA 1H9TA 3F3XA 2BE5F 4K2EA 3T0YA 3J81Z 3KLNA 2C6YA 1RNLA 3SZTA 1XSXA 1FP2A 2HOEA 2M87A 1JHFA 3ABTA 5H6RA 1A04A 4BAYA 1PP7U 2EA4A 1ZH5A 4XSZF 4HW0A 3SQNA 1ZG5A 4HQEA 4AIJA 2W57A 1OYIA 2ZO4A 3M8EA 4U7BA 4WK8F 2KIFA 3VODA 1FYMA 2NAZA 5JI6A 1S8NA 2QQAA 3CUQA 4HX4A 4P55A 5E1ZB 2HR3A 4A0ZA 1XB4A 1Z9CA 2VE8A 1RZ4A 1ZHFA 2WWYA 1H0MA 2HS5A 3M7GA 3WTVC 2FMYA 4LFUA 3RDIA 1P4XA 3COAC 3V8JA 2XRNA 2HWVA 2EV0A 1K78B 5LGUA 2ZJ2A 1EH7A 2DU9A 4GGGA 2UWMA 2IP2A 3GZ6A 1YTYA 4L0YB 2FSWA 4UHTA 4A12A 2GQQA 5D4SA 1T0FA 2FNAA 1PUEE 1TBXA 5J8FA 3WU0A 5ICGA 1T2KA 3I0TA 1S6LA 2H94A 1D8JA 4RGUA 1KQ0A 1I1SA 4RB1A 2M1BA 4RGXA 1FBQA 4S04A 5E8IA 2HYFA 3ML6A 2L01A 5BPIA 3KCCA 3V8LA 3KP5A 1BI1A 2VOPA 3RKWA 1DPRA 3C18A 3LWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XUB A;  2RDP A;  1F4K A;  2O8X A;  4KYW A;  4AVP A;  1QPM A;  2RV8 A;  3DP7 A;  1MDM B;  1U5T A;  1YW9 A;  5E1W A;  3IL2 A;  4H0E A;  5CVR A;  3JAM Z;  3D5L A;  4TV7 A;  2DPD A;  1KA8 A;  1F5T A;  4Q47 A;  3J80 K;  3WGH A;  2JT1 A;  1E2X A;  3ABU A;  4RS8 A;  1B59 A;  4LK0 F;  4B09 A;  4L18 B;  1ON2 A;  1DP7 P;  1V3F A;  2K4J A;  1OYY A;  1SD4 A;  1IN6 A;  2W24 A;  3FM3 A;  1HKQ A;  1TW3 A;  2K27 A;  4U0Y A;  4Y15 A;  2PEX A;  3M9A A;  4WXC A;  3LA2 A;  2XIG A;  3CJN A;  1W7P D;  3R0A A;  4I02 A;  4RB2 C;  2XAQ A;  3MWM A;  5DD4 A;  2D2W A;  2JTV A;  1EH6 A;  3DF8 A;  1XMK A;  2VBW A;  2AXL A;  5HLH A;  3RYP A;  1BI3 A;  2IT0 A;  3V7C A;  3P9I A;  1DDN A;  5A2Q Z;  4Q4Z F;  1TNS A;  1IZ1 A;  1UHM A;  2F5E A;  4ZYD A;  1NHA A;  1YQA A;  1R1V A;  3ERE D;  4GXO A;  2RN7 A;  2VBY A;  2NS0 A;  3E6C C;  2RNJ A;  2JRT A;  4LB6 B;  3VB2 A;  4ENK A;  1UCR A;  1ZRD A;  1WKM A;  4MEY F;  1J5Y A;  3GO5 A;  2EFW A;  3BWG A;  5EEG A;  1GHC A;  3R4K A;  3BJO A;  4KFC A;  4KNY A;  2W84 A;  5BPD A;  2EB7 A;  3F23 A;  5BOX A;  5FD5 A;  3U2R A;  3O2P E;  3I4P A;  1XSD A;  4KIC A;  2FU4 A;  3C1D A;  2M30 A;  4UUV A;  4OOI A;  1SMT A;  5DCM A;  3U9G A;  5LRS A;  5D5W B;  1BI0 A;  3CUQ C;  2OD5 A;  2TDX A;  4HQM A;  4P9F A;  3K1M A;  3LQR A;  4BHP A;  2ZXJ A;  2HTS A;  2GWR A;  1JXS A;  2FOK A;  3KP7 A;  5D6E A;  3GLX A;  3RTR A;  1I27 A;  3CO6 C;  2D45 A;  3KP4 A;  4ZYE A;  4EGY A;  2XAG A;  4ZYG A;  3Q9V A;  2MLK A;  1FZP B;  3QPH A;  2BBY A;  2GXB A;  4MEX F;  1FLI A;  2LKP A;  3MFK A;  2X0L A;  5CLS A;  4UNO A;  1XGO A;  3GW2 A;  4M9X A;  1P6R A;  3HRU A;  4KIF A;  1LJ9 A;  2E1N A;  1BI2 A;  4LD5 A;  4WWC A;  4NQW A;  1SD5 A;  3GFL A;  4BXU A;  1U78 A;  5CVI A;  5CJ9 A;  3V7S A;  2H6C A;  1B6A A;  2PN6 A;  2XKP A;  4DQ2 A;  2DW4 A;  3WTW C;  2JSC A;  5HOO A;  2KJB A;  3JTH A;  5DEQ A;  1ZAR A;  2DBB A;  2A6H F;  2HZT A;  5A2Q K;  1FSH A;  1WI9 A;  3RKX A;  1IN5 A;  4IJA A;  2L3D A;  5L3F A;  2MD5 A;  2MH2 A;  1EH8 A;  2A61 A;  4U7D A;  1GXQ A;  5D4R A;  4EGZ A;  2A69 F;  2RC4 A;  2E7X A;  1HW1 A;  1MJA A;  4I09 A;  2DQL A;  2FBH A;  1HKT A;  4PZJ A;  2EFP A;  3VFZ A;  3DFG A;  3PQJ A;  4HF2 A;  5DDG A;  2Y75 A;  4L9N A;  2OA4 A;  1MJ9 A;  4CGZ A;  4A5N A;  3QRF F;  1QO0 D;  4A0Y A;  3LA7 A;  3WGG A;  2KIU A;  5FFX A;  4HYE A;  4I7H A;  4IHS A;  3F6V A;  1SMY F;  3MEX A;  4G7O F;  3FF5 A;  3JW4 A;  4CXF A;  5IT9 K;  3DEU A;  3QPT A;  3CUO A;  4WCG A;  4CDG A;  2BYV E;  3DV8 A;  3BRO A;  3KFW X;  2QQ9 A;  3T1B A;  5AIP A;  1Z05 A;  1IN7 A;  2KJC A;  1XD7 A;  4S05 A;  2YU3 A;  4U0W A;  2H09 A;  3TGN A;  1J7K A;  3LFK A;  2DK5 A;  2VN2 A;  3BZ6 A;  2JZY A;  1O3T A;  2EK5 A;  1ZLJ A;  2PLY A;  4QLC U;  1J59 A;  2IW5 A;  4L9J A;  2YPR A;  3IKV A;  5KK1 A;  3E6M A;  3F21 A;  2WV0 A;  1BC8 C;  3JSP A;  2Q8K A;  2QEN A;  3WTU C;  3CDH A;  4BHC A;  3HOS A;  3MAJ A;  5D5X B;  3O6B B;  1QNT A;  1YO5 C;  2A5Y B;  2OZ6 A;  1T98 A;  3GXO A;  3FMR A;  2D1H A;  2JPC A;  1CF7 A;  4IRH A;  4Q48 A;  1HW5 A;  1FBU A;  5ICC A;  3O3K A;  4AIK A;  3SXY A;  2VT3 A;  1BJA A;  1YYV A;  3GFM A;  3I59 A;  2ZNZ A;  2DPU A;  3BPX A;  1D3Y A;  1L3L A;  1LB2 A;  4HF1 A;  2FXA A;  2GA2 A;  2ZCW A;  3K1N A;  3CTA A;  2KIM A;  1IF1 A;  3B73 A;  3IC7 A;  2PG4 A;  3E5X A;  3RJP A;  3K69 A;  5LHI A;  4HV6 A;  1LDJ A;  1OPC A;  5D5V B;  3P9K A;  5BQT A;  4A6D A;  2V1D A;  2LF8 A;  3HSR A;  1B4A A;  2FRH A;  2CWE A;  2G7U A;  4HV5 A;  4HOB A;  4PCQ A;  1IUY A;  3HTS B;  3J81 K;  1TTY A;  1FNN A;  3C7J A;  2BGC A;  1B9N A;  2ZME A;  2IA0 A;  2QM3 A;  3F72 A;  3HTU A;  3W6K B;  5CYV A;  4JQF A;  1I6X A;  3KEO A;  2M5W A;  5CVV A;  1Y0U A;  2O03 A;  4IF4 A;  3QU3 A;  2PFB A;  2OZU A;  2EJR A;  4ZH4 F;  3JTG A;  3GZ5 A;  3ZPL A;  4JK1 X;  3RYR A;  1YFH A;  1V4R A;  1BIB A;  2M8E A;  3ELK A;  1I1G A;  5FD6 A;  1O7F A;  3EYY A;  4EM1 A;  3S2W A;  3FX3 A;  4CIC A;  3OOP A;  4EJO A;  1WRJ A;  2ELH A;  2G9W A;  4EJW A;  2ZME B;  3F22 A;  2F2E A;  1YW8 A;  3GVA A;  1RUO A;  3W6J B;  1TW2 A;  2OU2 A;  3WOD F;  4NHJ A;  3HRS A;  1XCB A;  1GVJ A;  4LG0 B;  1CGP A;  5IT3 A;  2O0Y A;  4KA4 A;  3BJA A;  2P7V B;  4MNU A;  5L3C A;  1IRG A;  3TQN A;  1ULY A;  2CQK A;  3KEQ A;  2P7C B;  1ZG3 A;  5FLX Z;  1BC7 C;  2ACJ A;  2BV6 A;  2IA1 A;  1K78 A;  3D0S A;  1MDM A;  3KP6 A;  1D8K A;  4UV8 A;  2XAS A;  1U3E M;  4CZZ A;  2ISZ A;  3DQV C;  1REP C;  1MGT A;  2KRF A;  2QLZ A;  3R61 A;  3ZMT A;  1T38 A;  3WTX C;  2COM A;  5LGN A;  3I53 A;  1QZY A;  4HLY A;  5JVT A;  3GFI A;  5F1R A;  2VC0 A;  5LHG A;  3BP8 A;  1HQC A;  3Q9S A;  3LA3 A;  4M6Y A;  2VT2 A;  2DLL A;  2IRF G;  1FYK A;  1F1Z A;  3F6O A;  4R8H A;  2GAU A;  3I71 A;  3H92 A;  2IA2 A;  2NRA C;  3FMS A;  1XDU A;  1R22 A;  3M1E A;  1K7A A;  2K02 A;  4O5V A;  1BM9 A;  4RAY A;  2OBP A;  2CO5 A;  1TLH B;  1XGS A;  2Z33 A;  4Y13 A;  1ZRC A;  1U6G A;  5LGT A;  3FXU A;  4QWQ A;  2NNN A;  4O6J A;  2FBK A;  3HRM A;  5ICF A;  3VEP A;  1WWX A;  1VTN C;  1W4M A;  1IRF A;  1FWZ A;  3MZY A;  4KIB A;  2PMU A;  5DUK A;  4UXN A;  2ADU A;  1HKS A;  3KP3 A;  1O57 A;  1U5T C;  2P5K A;  2EV5 A;  1SD7 A;  2ZNY A;  3ULQ B;  2MBF A;  2HGC A;  2P6S A;  5LEJ A;  2VOO A;  2VOD A;  5LEK A;  2ISY A;  2K7L A;  4L5I A;  3F8B A;  5HS9 A;  2HQN A;  2Z5U A;  1B1B A;  3I59 B;  4RGR A;  2QQB A;  2DTR A;  3E5U A;  3QU6 A;  1P4A A;  3HHH A;  2R7D A;  1QQI A;  4Z2Y A;  2VE9 A;  5HDK A;  1W5T A;  5BS6 A;  1TNT A;  3C3W A;  4M72 A;  1LDD A;  5FGM A;  2QVO A;  1P4W A;  1IN4 A;  4NB5 A;  3CO7 C;  3J7A O;  1R1T A;  2QUF A;  4P96 A;  2QBY A;  2M45 A;  1ODD A;  3FZV A;  2EA2 A;  4HX7 A;  2V9V A;  1W7P A;  2RGV A;  1KYZ A;  4GCV A;  2XAH A;  3ZN1 A;  3OV8 A;  1HXD A;  2DO7 A;  1QGP A;  2Z3Y A;  4PGH A;  4KMF A;  4Q5S F;  1C0W A;  3ZMV A;  4BHB A;  2FE3 A;  1H9G A;  5E18 F;  2GXG A;  1BOA A;  4IRG A;  5F6F A;  4OIQ F;  2FEZ A;  2LDU A;  3QAH A;  1IXC A;  3FHZ A;  1G6N A;  3N97 A;  3FXQ A;  4YFX F;  1JE8 A;  2R7F A;  3FWE A;  5K5Q A;  5ILU A;  4LB5 A;  1LVA A;  1XDS A;  4EJU A;  3EDP A;  2VON A;  3NEU A;  2V79 A;  3IRQ A;  2XAJ A;  4DNC A;  3ZP5 A;  1G3W A;  1MJB A;  2WTE A;  2V6C A;  2A3S A;  3ZMS A;  2G7H A;  3BDD A;  3DKW A;  1W7P B;  4L9V A;  1S7O A;  1AWC A;  5E17 F;  3RI4 A;  5D8L B;  2P5V A;  2O6G E;  1FT9 A;  1RI7 A;  4M9S A;  2FBI A;  4O3M A;  2HKX A;  1O7L A;  1YS6 A;  3LST A;  2J5O A;  1MD0 A;  2DQR A;  5KVR A;  4OIP F;  2Z9O A;  4HZF A;  5K1Y A;  3DPT A;  4KT5 C;  1U8R A;  1UHW A;  4N9I A;  3QP6 A;  2OQG A;  2Y0M A;  3CLO A;  3ECH A;  4IPA A;  5H20 A;  3WE2 A;  4GYI A;  2KKO A;  3I58 A;  2Q2E A;  3IRR A;  4BYY A;  2PJP A;  1Z7U A;  5L3G A;  2NNY A;  2F5D A;  1Z6T A;  2DT5 A;  1OMI A;  4FX4 A;  1KU9 A;  4LMY A;  1P92 A;  1QZZ A;  2RKH A;  2P6T A;  4IXA A;  4OIO F;  1FPQ A;  2VC1 A;  3BOQ A;  4KN4 X;  1SD6 A;  1B9M A;  1KU3 A;  3KZZ A;  5FB2 A;  4P9U A;  5HDG A;  4LGW A;  2H6B A;  4LLL A;  5JR3 A;  1FSE A;  1ZRF A;  2JPB A;  2XVC A;  3ZMZ A;  2CFX A;  5K5R A;  1XMA A;  4ESF A;  3IWZ A;  1Z1D A;  4HAM A;  1UB9 A;  1FY7 A;  2A68 F;  4KUM A;  2EFN A;  2O3F A;  1R23 A;  4I2O A;  2BEO A;  4IVN A;  2MC3 A;  2K4B A;  5E1X A;  4CHU A;  1G3Y A;  1XGM A;  1R00 A;  2WC2 A;  5HS7 A;  4EJT A;  4AWX B;  4RAZ A;  3ISP A;  4BNC A;  5FO5 A;  1FOK A;  1W5S A;  1PP8 F;  4HBL A;  2STT A;  2QWW A;  4ASN A;  1LQ1 A;  3IHU A;  3L00 A;  3J80 Z;  2HFH A;  4ESB A;  4L9T A;  3N4M A;  4FX0 A;  2X4H A;  1IN8 A;  2IPQ X;  3U1D A;  2HYG D;  1KGS A;  2HTJ A;  5EEH A;  2B0L A;  4G6D A;  3I64 A;  2GZW A;  3SZP A;  4ZZL A;  1WSU A;  1TQM A;  2MA3 A;  3E6D A;  1YG2 A;  2YR2 A;  5IT9 Z;  5ERI A;  2YSR A;  3T8T A;  3GFJ A;  5D6F A;  2XRO A;  4PGG A;  2HEO A;  4I01 A;  2LSO A;  2PI0 A;  2FML A;  1KQ9 A;  2QYO A;  3TO7 A;  1R7J A;  3M8F A;  1BIA A;  4M73 A;  2MLG A;  2VBX A;  3MCZ A;  4LG0 A;  3WTS C;  1FP1 D;  3ZMD A;  3R0J A;  5HVQ C;  1SFX A;  4LLG F;  1TQI A;  1XCV A;  1O3Q A;  6PAX A;  5AIQ A;  4ENN A;  1DPU A;  4R1H A;  1EV7 A;  2QZ8 A;  1HBX G;  4ETS A;  3KET A;  1ZYR F;  3KLO A;  2ZKZ A;  3F8N A;  2VXZ A;  1ZGJ A;  2EWN A;  2DAO A;  4IRI A;  5JHU A;  3F8C A;  2XKO A;  4I0A A;  4ZYH A;  3HSE A;  5FFZ A;  1J2X A;  5ILV A;  4AD9 A;  2YX4 A;  1J9I A;  2L4M A;  3V4G A;  3ZMU A;  4MQV A;  5HLG A;  1XSV A;  3P9C A;  4ENM A;  1R5G A;  4G6Q A;  2V1U A;  5K5O A;  4M9Z A;  5L3B A;  4KN7 X;  2PQ8 A;  1SFE A;  3L09 A;  2GA1 A;  1BN5 A;  4HLX A;  4L0Z B;  1JHH A;  3IKT A;  1R58 A;  1S7A A;  2Y48 A;  3E97 A;  1LEB A;  5DCM B;  2K86 A;  4XLP F;  5L3D A;  3HUG A;  3KE2 A;  5TRD A;  2ZBK A;  3NRV A;  1T6S A;  1D5V A;  4MHG A;  3AAF A;  1K6O A;  2A07 F;  2H27 A;  3DXJ F;  2EFQ A;  3WTT C;  3WGI A;  4KIG A;  3HYI A;  1X3U A;  1TQP A;  2PBI A;  5BMZ A;  4CYD A;  3TOB A;  3G3Z A;  4FT8 A;  2ESN A;  4MQ9 F;  5E20 A;  3E6B A;  2EFO A;  3EUH A;  3MQ0 A;  2R3S A;  4KMU X;  4YFK F;  2W25 A;  1P2F A;  3REO A;  1ZGA A;  5CVU A;  5JFR A;  1K79 A;  3WU1 B;  3HRT A;  1FBS A;  4N9H A;  1R36 A;  2Q0O A;  4Y17 A;  3K9T A;  5TJJ A;  4HA8 A;  3NQO A;  4ZZD A;  3GYH X;  1ZLK A;  4M71 A;  4XBF A;  4YIF A;  3KP2 A;  1HSJ A;  3F8F A;  5AON A;  2CG4 A;  2XHK A;  1KU2 A;  4RGS A;  2FF4 A;  3QP5 A;  1YIO A;  3HSF A;  5D5U B;  3WG9 A;  3PQK A;  4WX9 A;  3I54 A;  2LF7 A;  2DI3 A;  2RQP A;  3TO9 A;  3L9F A;  1STZ A;  3B02 A;  2HKO A;  1L0O C;  4RB3 C;  1RUN A;  5D8K B;  2VBZ A;  3BJ6 A;  2CYY A;  4B8X A;  1WQ2 A;  4WF2 A;  5ED4 A;  2V1X A;  5CVJ A;  2ZFW A;  1GXP A;  4G9Y A;  1E17 A;  4UVA A;  1Z91 A;  2DK8 A;  3KZY A;  4EQQ A;  5LRR A;  1LNW A;  3H3Z A;  2A6E F;  3HOT A;  1HW2 A;  3Q5F A;  3SFZ A;  5E8G A;  3GX4 X;  3IWF A;  2RVC A;  1J75 A;  2UXX A;  4ENJ A;  3PFI A;  4R79 A;  1MZB A;  4L5J A;  2DFI A;  1S29 A;  3I5U A;  4EM2 A;  4LLN A;  3JAM K;  4OU0 A;  4G94 A;  3BY6 A;  4GYG A;  1FX7 A;  3K0L A;  4FHT A;  5LBQ A;  1CF7 B;  4N0B A;  2XGX A;  3WE3 A;  2E7W A;  1MKM A;  2AS5 F;  1OKR A;  3FM5 A;  1XGN A;  5J6X A;  1R1U A;  3FXR A;  1G3T A;  2PMH A;  1IAW A;  3GF2 A;  5LHH A;  3QOP A;  3BPV A;  3ROU A;  4U88 A;  2QBY B;  4GO1 A;  3RPU A;  2L4A A;  4M74 A;  1O3S A;  4LK1 F;  2GIV A;  2L54 A;  4HF0 A;  5H6Q A;  2FQ3 A;  1J0R A;  4HDU A;  3DPL C;  3RIR A;  1LEA A;  4PDK A;  4U0V A;  4OIN F;  1KQ8 A;  1SAX A;  1Q1H A;  1YW7 A;  2Z99 A;  2W85 A;  1UST A;  2CW0 F;  2YX7 A;  1ZG1 A;  2F5C A;  2FNP A;  2LNB A;  4A0X A;  5HS8 A;  2HDC A;  3R6S A;  3CUQ B;  3GUD A;  5ILS A;  2OAZ A;  4P5O A;  4EMS A;  2IVM A;  2L02 A;  4I98 B;  4KDP A;  4WXD A;  5HDN A;  1DUX C;  4MGR A;  5FLX K;  1RIO H;  1KU7 A;  4G7H F;  1SFU A;  3GWZ A;  1AOY A;  4RB0 A;  3ZN0 A;  3HIF A;  1KYW A;  2D1V A;  5HLI A;  3K2Z A;  1USS A;  2ETH A;  4E70 A;  3K1P A;  3E3V A;  4EVI A;  4YFN F;  1F9N A;  3L2C A;  3L7W A;  3HHG A;  1ONV A;  2O61 A;  5DUI A;  5LLQ A;  4G8X A;  1U2W A;  5ICE A;  5DD8 A;  2MH9 A;  2EV6 A;  5F64 A;  3FMQ A;  1LDK B;  2XAF A;  4F7Z A;  4YII A;  2UZK A;  1OYW A;  2IJL A;  1ON1 A;  2CGP A;  3F8M A;  1FC3 A;  4UVC A;  3EQL F;  1HST A;  4MTD A;  3TKY A;  4D0P A;  1OR7 A;  3VOE A;  4A2U A;  3SHF A;  4OMZ A;  5DCF A;  4IHT A;  1YLF A;  3TDZ C;  1G3S A;  4I0B A;  3RPQ A;  1PDN C;  1XN7 A;  1ZRE A;  1U5T B;  1ZAO A;  2XV4 S;  2P4W A;  5J8C A;  3V8K A;  1O3R A;  3EET A;  4MTE A;  4XRF A;  3JSO A;  1ZN2 A;  4BQA A;  3E5Q A;  3H3U A;  1JGS A;  2NYX A;  4WXH A;  1YS7 A;  3V7R A;  4A5M A;  1FYL A;  4OIR F;  4CO8 A;  4YG2 F;  3WTZ A;  2J5P A;  3ZQ7 A;  1BBY A;  1S3J A;  3TOA A;  3T8R A;  3WTY C;  3TO6 A;  1UFM A;  4M6X A;  4A6E A;  2E1C A;  1IXS B;  3RKY A;  1I5Z A;  4JBA A;  2STW A;  1IXR C;  2CSO A;  1IW7 F;  3T5X A;  4ESJ A;  1T39 A;  3R60 A;  5DYM A;  2F5F A;  3EYI A;  1QBJ A;  3MZH A;  3LQQ A;  4UVB A;  4XLN F;  4HX8 A;  5DV5 A;  1R5H A;  3GEZ A;  2OQR A;  4OMY A;  3ECO A;  1G4D A;  2P8T A;  2P5L C;  2ESH A;  1Z6R A;  3LAP A;  4UV9 A;  2FA5 A;  3G73 A;  4EJV A;  2UXN A;  5L3E A;  4AIH A;  4XSX F;  4EV0 A;  4ON0 A;  4HDV A;  4LJZ F;  2HQR A;  4BH9 A;  3P7N A;  3TDU C;  4EM0 B;  4G7Z F;  3LAJ A;  1H9T A;  3F3X A;  2BE5 F;  4K2E A;  3T0Y A;  3J81 Z;  3KLN A;  2C6Y A;  1RNL A;  3SZT A;  1XSX A;  1FP2 A;  2HOE A;  2M87 A;  1JHF A;  3ABT A;  5H6R A;  1A04 A;  4BAY A;  1PP7 U;  2EA4 A;  1ZH5 A;  4XSZ F;  4HW0 A;  3SQN A;  1ZG5 A;  4HQE A;  4AIJ A;  2W57 A;  1OYI A;  2ZO4 A;  3M8E A;  4U7B A;  4WK8 F;  2KIF A;  3VOD A;  1FYM A;  2NAZ A;  5JI6 A;  1S8N A;  2QQA A;  3CUQ A;  4HX4 A;  4P55 A;  5E1Z B;  2HR3 A;  4A0Z A;  1XB4 A;  1Z9C A;  2VE8 A;  1RZ4 A;  1ZHF A;  2WWY A;  1H0M A;  2HS5 A;  3M7G A;  3WTV C;  2FMY A;  4LFU A;  3RDI A;  1P4X A;  3COA C;  3V8J A;  2XRN A;  2HWV A;  2EV0 A;  1K78 B;  5LGU A;  2ZJ2 A;  1EH7 A;  2DU9 A;  4GGG A;  2UWM A;  2IP2 A;  3GZ6 A;  1YTY A;  4L0Y B;  2FSW A;  4UHT A;  4A12 A;  2GQQ A;  5D4S A;  1T0F A;  2FNA A;  1PUE E;  1TBX A;  5J8F A;  3WU0 A;  5ICG A;  1T2K A;  3I0T A;  1S6L A;  2H94 A;  1D8J A;  4RGU A;  1KQ0 A;  1I1S A;  4RB1 A;  2M1B A;  4RGX A;  1FBQ A;  4S04 A;  5E8I A;  2HYF A;  3ML6 A;  2L01 A;  5BPI A;  3KCC A;  3V8L A;  3KP5 A;  1BI1 A;  2VOP A;  3RKW A;  1DPR A;  3C18 A;  3LWF A; 
#chains in the Genus database with same CATH topology
 2XUB A;  1E3H A;  2L7M P;  2RDP A;  5B5E C;  1EJ9 A;  1F4K A;  3OYM A;  2O8X A;  3VSL A;  4QIW N;  4KYW A;  4AVP A;  1QPM A;  4RA2 A;  1B8I B;  2RV8 A;  1ETK A;  1TWG J;  3DP7 A;  4D9J A;  5HLT A;  1MDM B;  1U5T A;  1A6Q A;  1YW9 A;  5E1W A;  3IL2 A;  4H0E A;  2NS7 A;  5CVR A;  3DTK A;  1VFC A;  3W6V A;  4CUG A;  3JAM Z;  1Z3X A;  3KEY A;  3D5L A;  4TV7 A;  4CH7 A;  2DPD A;  1KA8 A;  3PNT A;  1F5T A;  4Q47 A;  4DZP A;  3ABM H;  1D1B A;  1XPX A;  2KT0 A;  3J80 K;  3WGH A;  2JT1 A;  1TWA J;  1E2X A;  4BQQ A;  3ABU A;  4XRM A;  4RS8 A;  5CKT A;  2LC2 A;  1X1B A;  2BOL A;  1B59 A;  2DYR H;  4LK0 F;  2MYS A;  4B09 A;  4DGW B;  4L18 B;  1JKQ C;  1ON2 A;  1OCR H;  1DP7 P;  1V3F A;  2K4J A;  1OYY A;  4CCN A;  2ID3 A;  5J40 A;  2M7B A;  3TBI A;  4D5C A;  1SD4 A;  5E3O A;  3I4N J;  1IN6 A;  2VKH A;  3G1L A;  2W24 A;  2WB1 A;  3TW6 A;  2KP6 A;  2R5Z B;  1Y1W J;  3HKZ N;  3FM3 A;  1B72 B;  4FE7 A;  1HKQ A;  1TW3 A;  5CQG A;  4B48 A;  1BA5 A;  3RZD J;  1MNM C;  2K27 A;  4ZTF A;  4U0Y A;  1ZGW A;  3DBR B;  4Y15 A;  2PEX A;  3M9A A;  2NS8 A;  2KIQ A;  3LA2 A;  4WXC A;  3PNY A;  4XM3 A;  2E19 A;  4F3Q A;  2XIG A;  4XRS A;  4IO9 F;  3CJN A;  1W7P D;  3R0A A;  4I02 A;  3CC7 I;  4RB2 C;  2XAQ A;  3MWM A;  5DD4 A;  2MG4 A;  2D2W A;  2JTV A;  2DJI A;  1EH6 A;  4D1Q A;  3DF8 A;  1XMK A;  2VBW A;  2AXL A;  5HLH A;  2JA7 J;  3RYP A;  1BI3 A;  2IT0 A;  1VQ6 I;  1MSF C;  3V7C A;  3P9I A;  1DDN A;  1QPI A;  2UV1 A;  4V19 K;  5A2Q Z;  4Q4Z F;  1TNS A;  1IZ1 A;  1UHM A;  2LLK A;  3CME I;  1F43 A;  3A0B C;  5EEA A;  2F5E A;  4ZYD A;  1T08 B;  1NHA A;  2KFD A;  4OAY A;  1GV5 A;  1YQA A;  2OCC H;  1R1V A;  3ERE D;  1RKT A;  3RQ4 A;  4GXO A;  2DN0 A;  2RN7 A;  2VBY A;  3K4C A;  2NS0 A;  1JTY A;  2HNH A;  3E6C C;  4C3H J;  2RNJ A;  2JRT A;  4BXX J;  1WZ2 A;  4LB6 B;  3I4M J;  1T56 A;  3VB2 A;  4ENK A;  1UCR A;  1Y0N A;  4NBQ A;  1WKM A;  3MKY B;  4MEY F;  1ZRD A;  4E7S A;  1J5Y A;  3OSG A;  3GO5 A;  3OYK A;  1P9Q C;  3CMA I;  3GME A;  2EFW A;  3H0G J;  4RAG A;  3BWG A;  5GTH C;  5EEG A;  3HL2 A;  1I50 J;  5HNH A;  1QZE A;  2LBF B;  3S3N A;  1GHC A;  1X58 A;  3R4K A;  2V6E A;  5EZG A;  3K7A J;  2HOT A;  5GPC A;  3BJO A;  5C3E J;  4KFC A;  4KNY A;  2W84 A;  2XF6 A;  2EZI A;  5BPD A;  4MO7 A;  1BR1 A;  1W0T A;  3LSJ A;  5EJC A;  3HBL A;  2EB7 A;  4XR6 A;  3F23 A;  5BOX A;  5FD5 A;  4YRV A;  1UEL B;  3U2R A;  3JRF A;  2BXY A;  2EH3 A;  3O2P E;  4XOR A;  1K61 A;  3J7Z I;  2E2I J;  3I4P A;  1XSD A;  1YRN B;  2L0K A;  4KIC A;  2OCE A;  2FU4 A;  3C1D A;  1OFC X;  2M30 A;  4UUV A;  2M4G A;  3K4N A;  2LOO A;  4OOI A;  1SMT A;  5DCM A;  3U9G A;  4RLQ A;  2VI6 A;  1IDY A;  5LRS A;  2HQ5 A;  5D5W B;  1BI0 A;  3CUQ C;  3F9K A;  1VQ5 I;  2OD5 A;  2TDX A;  1QHG A;  2V9K A;  2KRC A;  4HQM A;  2BHY A;  2CUE A;  3S2D J;  4P9F A;  3K1M A;  3LQR A;  1JJ6 C;  1OCO H;  4BHP A;  2KQR A;  1WH7 A;  2BY2 A;  2ZXJ A;  2I10 A;  2HTS A;  2GWR A;  5FKK A;  2FOK A;  1LFU P;  1HC8 A;  1JXS A;  5K7F A;  3KP7 A;  1JI8 A;  1G2H A;  3KZI C;  3FBI B;  5D6E A;  3GLX A;  3RTR A;  2DMT A;  3ZCO A;  1KON A;  1I27 A;  3CO6 C;  2L2O A;  2D45 A;  3KP4 A;  5KHD A;  4ZYE A;  4EGY A;  1MBJ A;  2XAG A;  4ZYG A;  3Q9V A;  3CCY A;  1WJE A;  2MLK A;  4NC7 A;  4I6Z A;  2Y0S N;  1FZP B;  3QPH A;  2DDB A;  3S2H J;  2BXZ A;  2DJN A;  2BBY A;  3QOE A;  2GXB A;  4MEX F;  2BW3 B;  1FLI A;  1MIJ A;  2LKP A;  3MFK A;  2X0L A;  5CLS A;  2JVH A;  4UNO A;  4A3L J;  5FRN A;  3BT9 A;  1XGO A;  2CUZ A;  3GW2 A;  4M9X A;  3CCU I;  1P6R A;  3HRU A;  2CU7 A;  4KIF A;  5GAD J;  1LJ9 A;  3I9V 2;  3H0D A;  2E1N A;  3OMY A;  1BI2 A;  4BUP A;  2IGK A;  4LD5 A;  1B72 A;  3CF5 F;  4WWC A;  4NQW A;  1SD5 A;  3GFL A;  4BXU A;  3UNG C;  1U78 A;  5CVI A;  3BR2 A;  5CJ9 A;  2IEK A;  2H6C A;  3V7S A;  3SEQ A;  4CCL A;  1B6A A;  2PN6 A;  2JVG A;  2RQQ A;  2XKP A;  4DQ2 A;  2DW4 A;  3WTW C;  2JSC A;  5HOO A;  2A5W A;  2KJB A;  3JTH A;  5DEQ A;  1ZAR A;  4RDU A;  2DBB A;  2AQE A;  4BY7 J;  2A6H F;  3ZRG A;  2HZT A;  3AG3 H;  5A2Q K;  5J1U A;  3A03 A;  2HXI A;  3S1R J;  1FSH A;  1WI9 A;  2IBD A;  3RKX A;  1A5J A;  1IN5 A;  4OAZ A;  4RM2 A;  1VQ4 I;  4S0H B;  2DOE A;  4IJA A;  4QTR A;  2KDZ A;  2L3D A;  3DU5 A;  5L3F A;  1YIT I;  2IGM A;  2MD5 A;  1VI0 A;  2MH2 A;  3B6A A;  1EH8 A;  2A61 A;  4PJ0 C;  4U7D A;  3OYI A;  3CQZ J;  1GXQ A;  5D4R A;  4EGZ A;  2R7V A;  1YOV B;  2A69 F;  2B63 J;  2RC4 A;  2E7X A;  2VQH A;  1NTC A;  2XB5 A;  2JN6 A;  1W36 C;  2BVM A;  1HW1 A;  4NNJ A;  1MJA A;  4KIT B;  4I09 A;  3GTL J;  3HC7 A;  5EYR A;  2DQL A;  2FBH A;  1HKT A;  2LRD A;  2JWT A;  4PZJ A;  2EFP A;  1UAA A;  3VFZ A;  2WAQ A;  3DFG A;  3PQJ A;  4HF2 A;  3H3V K;  5DDG A;  2Y75 A;  4L9N A;  2M3A A;  2DT6 A;  2OA4 A;  5J4V A;  2UUZ A;  3OYC A;  1B8I A;  1MJ9 A;  4ZJZ A;  3CCE I;  3S32 A;  2FD5 A;  1LE8 B;  4CGZ A;  4A5N A;  3QRF F;  1QO0 D;  4A0Y A;  3PM1 A;  5IP9 J;  3LA7 A;  1SVM A;  2KIU A;  5FFX A;  4HYE A;  3WGG A;  4I7H A;  5HOD A;  4ZDO A;  4IHS A;  3AG4 H;  1SAN A;  3F6V A;  2ZJP F;  3K2A A;  1SMY F;  3MEX A;  4G7O F;  4PJN A;  3FF5 A;  3JW4 A;  4CXF A;  3U21 A;  5IT9 K;  2LP0 A;  4XMY A;  3DEU A;  4AU7 A;  4AYB A;  2L7K A;  3QPT A;  3CUO A;  4WCG A;  4CDG A;  2BYV E;  3H35 A;  3DV8 A;  3BRO A;  3KFW X;  2QQ9 A;  3AG1 H;  2M7A A;  3T1B A;  3H36 A;  5AIP A;  1Z05 A;  1IN7 A;  3ASO H;  3M4O J;  2KJC A;  3Q0U A;  2ZSH B;  1XD7 A;  4NDL A;  4XKW A;  2YU3 A;  2Y9Y A;  4S05 A;  3CCS I;  2XRL A;  4U0W A;  2PMZ A;  2DA6 A;  1YJW I;  4XON A;  2H09 A;  3GBG A;  3LSM A;  4HEA 2;  3TGN A;  1J7K A;  1Y1V J;  2PJR A;  3LFK A;  4MFD A;  2DK5 A;  3HOY J;  2VN2 A;  5EF6 A;  3BZ6 A;  2BVL A;  1JGG A;  2JZY A;  1O3T A;  2WBM A;  3HGG A;  2EK5 A;  2F6C A;  1ZLJ A;  3ONQ A;  1YRN A;  2PLY A;  4QLC U;  4A69 C;  4UUS B;  2BHZ A;  2B7E A;  1J59 A;  4B43 A;  2IW5 A;  3AL0 B;  4L9J A;  2YPR A;  3IKV A;  1ZR2 A;  3EUH C;  5KK1 A;  3E6M A;  3F21 A;  2WV0 A;  1BC8 C;  2CQQ A;  3JSP A;  4LIU A;  2Q8K A;  3CDI A;  2QEN A;  3WTU C;  2FJ1 A;  1YIJ I;  3CDH A;  2M0C A;  2OC6 A;  2HZD A;  4BHC A;  1T95 A;  3HOS A;  2JA2 A;  3MAJ A;  4G12 A;  5D5X B;  5J47 A;  3O6B B;  1QNT A;  4XL9 A;  1YO5 C;  4XOP A;  1FMV A;  3HKZ A;  2A5Y B;  1IGN A;  2X51 A;  2OZ6 A;  1T98 A;  1MH3 A;  4FAS D;  1PVE A;  3GXO A;  3FMR A;  3I56 I;  2V26 A;  3VDX A;  2D1H A;  4F93 B;  2JPC A;  3DKY A;  1CF7 A;  1VND A;  1E0E A;  4IRH A;  4Q48 A;  3V42 A;  1HW5 A;  3K4B A;  2IGN A;  2K9S A;  3BTL A;  1FBU A;  5M5W J;  3G6E I;  4M3E A;  5ICC A;  3O3K A;  4AIK A;  4Y3O A;  3SXY A;  1R9T J;  2Y69 H;  2VT3 A;  4II3 A;  3JRE A;  1BJA A;  2EBI A;  3HJE A;  1YYV A;  4PSX A;  1MBE A;  3DU6 A;  3GFM A;  3I59 A;  2ZNZ A;  5E3L A;  2DPU A;  3BPX A;  2V9P A;  1N75 A;  1A31 A;  3SEZ A;  3H9G A;  1D3Y A;  3K10 A;  1LB2 A;  1L3L A;  2H1L A;  2FXA A;  2GA2 A;  1IUF A;  4HF1 A;  3LL7 A;  1W5C C;  2DMP A;  4U87 A;  5B66 C;  2K85 A;  3CP8 A;  2ZCW A;  4UUS A;  2LH9 A;  3K1N A;  3FBN B;  1WH5 A;  2BW3 A;  3CTA A;  3E7L A;  2KIM A;  3TED A;  2K3P A;  1ETV A;  2N8G A;  5EGO A;  1IF1 A;  3B73 A;  3IAM 2;  3IC7 A;  2PG4 A;  3E5X A;  1OQY A;  4YEJ A;  3N05 A;  3RJP A;  3K69 A;  5LHI A;  4PSW A;  1RR7 A;  4HV6 A;  1LDJ A;  2L9V A;  1OPC A;  5D5V B;  2V1N A;  1SVO A;  5F04 A;  2IS2 A;  2AHQ A;  3P9K A;  5BQT A;  3FKI J;  4A6D A;  2V1D A;  4X1E A;  2ME0 A;  3FIS A;  3OS1 A;  3C2H A;  3U1K A;  3K4M A;  3OYF A;  2LF8 A;  3HSR A;  1B4A A;  2ZXH A;  2FRH A;  3CMM A;  2O7O A;  3RCO A;  4BGD A;  2CWE A;  2G7U A;  3QPL A;  2EZH A;  4HV5 A;  4HOB A;  4PCQ A;  2E35 A;  3WHB A;  1IUY A;  3HTS B;  4FCY A;  3J81 K;  1TTY A;  2ZFU A;  1N77 A;  1CQT A;  1FNN A;  3C7J A;  3OSF A;  3FK7 A;  4M3B A;  3JR9 A;  1Q1V A;  2BGC A;  3OYG A;  1B9N A;  2ZME A;  3BR3 A;  2IA0 A;  4AUX A;  2QM3 A;  3F72 A;  4NQW B;  1WJB A;  3HTU A;  3W6K B;  2AQF A;  5CYV A;  1HDD C;  4AYB N;  1YI2 I;  1VQ8 I;  1WJ5 A;  1I39 A;  4JQF A;  4ZC3 A;  4B3X A;  1I6X A;  3KEO A;  4MIM A;  2M5W A;  1X19 A;  3ERM A;  5CVV A;  1Y0U A;  5KNL A;  2O03 A;  4IF4 A;  3QU3 A;  5F0F A;  1MBF A;  2PFB A;  1SVL A;  2OZU A;  4W97 A;  3JRB A;  1IRZ A;  2X6O A;  2EJR A;  4ZH4 F;  2LFB A;  3JTG A;  2KMU A;  4D7N A;  3GZ5 A;  2XPV A;  3ZPL A;  4JK1 X;  2FX0 A;  2ICW G;  3RYR A;  3NWS A;  1YFH A;  1V4R A;  1BIB A;  2M8E A;  3ELK A;  1I1G A;  5FD6 A;  3H1C A;  1IV8 A;  1VF9 A;  4E7Z A;  1O7F A;  3EYY A;  4EM1 A;  3S1M J;  2OTL I;  3S2W A;  3FX3 A;  4CIC A;  2M34 A;  1V5G A;  3OOP A;  3PSI A;  4EJO A;  1WRJ A;  4B1R A;  5FRM A;  3HUG B;  2EIL H;  2XPW A;  2ELH A;  1FOW A;  4HST A;  2G9W A;  1W0U A;  4E7I A;  4EJW A;  4BBS J;  3VYU B;  2ZME B;  3F22 A;  2DTZ A;  4CYC B;  3FKJ A;  4BDZ A;  2F2E A;  1JTX A;  2YU9 J;  4IHX A;  1YW8 A;  3GVA A;  1RUO A;  2L5Q A;  3W6J B;  1MNE A;  1TW2 A;  4AM3 A;  4XLC A;  2OU2 A;  2OJE D;  3WOD F;  2LY2 A;  2LRE A;  4NHJ A;  4F52 A;  1AKH A;  1ZKG A;  4A3J J;  3HRS A;  2NOJ B;  1XCB A;  2VUM J;  4N4O B;  1GVJ A;  4LG0 B;  1CGP A;  2DFF A;  5IT3 A;  4YEL A;  5JHF A;  2O0Y A;  4BE1 A;  4KA4 A;  2QCO A;  3BJA A;  5TGT A;  2P7V B;  4MNU A;  2D5V A;  5L3C A;  1IRG A;  3TQN A;  2XGC A;  4JX6 A;  3FXK A;  1ULY A;  2MD0 A;  3HOZ J;  2CQK A;  3KEQ A;  2P7C B;  4IOC F;  3OIP A;  1ZG3 A;  5FLX Z;  4BE2 A;  1BC7 C;  3TP3 A;  3LSI A;  4IEJ A;  3HZJ A;  2ACJ A;  2BV6 A;  2CUF A;  3E1S A;  3SJM A;  2IA1 A;  3H5A A;  2H1K A;  1K78 A;  2GM4 A;  3D0S A;  1MDM A;  2CQX A;  1D8K A;  3KP6 A;  4UV8 A;  2XAS A;  2AXT C;  1U3E M;  1ETQ A;  1I3A A;  4CZZ A;  2NVU B;  3WU2 C;  4F91 B;  4XQF A;  2ISZ A;  4C30 A;  4LG3 A;  2WA0 A;  3DQV C;  1REP C;  2GOX B;  1S7E A;  2DFE A;  1MGT A;  2KRF A;  2QLZ A;  3R61 A;  3MVP A;  3ZMT A;  1T38 A;  5F0H A;  3WTX C;  2COM A;  5LGN A;  3I53 A;  4ABZ A;  1QZY A;  4BXF A;  3I55 I;  2Y2Z A;  3LSP A;  5JVT A;  3GFI A;  4HLY A;  2JA5 J;  5F1R A;  2VC0 A;  5LHG A;  3BP8 A;  1HQC A;  3Q9S A;  1XTA A;  2KLO A;  3CP2 A;  2K5C A;  3S17 J;  3LA3 A;  4M6Y A;  2DMQ A;  4XK4 A;  2VT2 A;  4A3I J;  2DLL A;  4M3D A;  2IRF G;  3G71 I;  3CCM I;  3JRC A;  1FYK A;  2HXO A;  5EG0 A;  3DPU A;  1F1Z A;  2XB0 X;  5GP9 A;  2HVQ A;  3F6O A;  2VIX A;  5KAF C;  1OCC H;  4R8H A;  2E5N A;  2GAU A;  4DYR A;  2W1O A;  3I71 A;  5B1A H;  3H92 A;  2WAD A;  1LKX A;  2IA2 A;  2NRA C;  3CMY A;  3FMS A;  2F4O B;  1R5I D;  4PJM A;  2HOS A;  4QPQ A;  1XDU A;  3GCM A;  2IS4 A;  5FKL A;  3OR1 C;  5BNG A;  1H88 C;  4C9Y A;  2PJR B;  1R22 A;  3M1E A;  1K7A A;  2HDW A;  1WJD A;  1QVU A;  2K02 A;  3S14 J;  5M3F J;  1DGW Y;  2FUG 2;  4O5V A;  4AC0 A;  1JUM A;  4LIV A;  1BM9 A;  2HVR A;  4RAY A;  2OBP A;  1Z77 A;  1AU7 A;  1WJC A;  2CO5 A;  1TLH B;  1WVR A;  4A3F J;  3S3O A;  1IJW C;  1XGS A;  2Z33 A;  4Y13 A;  1ZRC A;  1U6G A;  5LGT A;  3S1Q J;  3RSN A;  1HA8 A;  3FXU A;  4QWQ A;  2MC4 A;  3Q0W A;  2NNN A;  4O6J A;  2FBK A;  3HRM A;  5ICF A;  3VEP A;  1WWX A;  1M1E B;  4GDF A;  2HI3 A;  2QF7 A;  1VTN C;  2QSG X;  3OYE A;  3OYL A;  3GTK J;  1TT5 B;  1W4M A;  2GIZ A;  1IRF A;  1FWZ A;  3MZY A;  4KIB A;  2PMU A;  4M6V A;  5CQE A;  5DUK A;  2BY1 A;  2KDO A;  3ZR8 X;  3S1N J;  4UXN A;  2ADU A;  3PIO F;  1K4T A;  1HKS A;  3KP3 A;  1MBH A;  4HSR A;  3LOC A;  1LFP A;  1O57 A;  1U5T C;  2P5K A;  2EV5 A;  3J7A Y;  1SD7 A;  2ZNY A;  5IP6 A;  3ULQ B;  2MBF A;  4D7M A;  2KZV A;  2HGC A;  2P6S A;  5LEJ A;  3CJQ B;  2VOO A;  2AO9 A;  2VOD A;  5LEK A;  2ISY A;  4ZTJ A;  2K7L A;  4L5I A;  3PO2 J;  2QEX I;  1P7I A;  3F8B A;  2ZJQ F;  1Y6I A;  5HS9 A;  2HQN A;  2Z5U A;  1B1B A;  4PJL A;  5F0C A;  2BY3 A;  4B44 A;  3I59 B;  4RGR A;  3PO3 J;  2QQB A;  2DTR A;  3E5U A;  3QU6 A;  1P4A A;  2R5Y B;  2DOF A;  3HHH A;  3OWT A;  2R7D A;  3O8G A;  1QQI A;  4Z2Y A;  2VE9 A;  5HDK A;  3OYJ A;  1W5T A;  5BS6 A;  1TNT A;  2MSY A;  3C3W A;  3SDB A;  5KAI C;  2I8D A;  4M72 A;  1LDD A;  5FGM A;  3PFY A;  2QVO A;  2V4J C;  1P4W A;  1IN4 A;  4NB5 A;  3CO7 C;  2VAS A;  3ZQH A;  3J7A O;  4AID A;  2LY9 A;  1Y39 A;  1R1T A;  4CSW A;  2XDV A;  2QUF A;  4P96 A;  5B3S H;  1PYV A;  2HYJ A;  2RNG A;  3VYT B;  3CJT B;  2QBY A;  2LBF A;  1EA3 A;  4YIR X;  4E6K G;  2M45 A;  4V2G A;  1ODD A;  2W48 A;  3FZV A;  1DQU A;  2EA2 A;  3FIW A;  1UMQ A;  4HX7 A;  1ETY A;  2V9V A;  1W7P A;  5GPA A;  2RGV A;  1KYZ A;  4GCV A;  2R7Q A;  1JT0 A;  1X1A A;  1XC5 A;  2XAH A;  2MGQ A;  3ZN1 A;  3OV8 A;  1P7J A;  1HXD A;  2FQ4 A;  2DO7 A;  4M3G A;  5C44 J;  1QGP A;  2F5V A;  3QWL A;  1NH3 A;  3HOX J;  2Z3Y A;  2K3F A;  1D1A A;  4PGH A;  2X85 A;  4UUT A;  4XIC A;  1ENH A;  1MND A;  2R7Z J;  1YJN I;  4KMF A;  4Q5S F;  4BU2 A;  1C0W A;  3ZMV A;  4BHB A;  2FE3 A;  2EZL A;  1H9G A;  2Z2S B;  5E18 F;  4XOT A;  4BAC A;  4A3B J;  2L9S A;  2Q1Z B;  2GXG A;  1BOA A;  2O5R A;  1E3O C;  4IRG A;  5F6F A;  1J09 A;  2Y31 A;  2IGO A;  4OIQ F;  2FEZ A;  2LDU A;  2VB6 A;  3QAH A;  1IXC A;  3FHZ A;  1G6N A;  1RPW A;  3N97 A;  2B9S A;  3FXQ A;  4YFX F;  1JE8 A;  3H5N A;  2R7F A;  3FWE A;  3H9Q A;  3NAU A;  3K4L A;  5FRO A;  5K5Q A;  5ILU A;  4LB5 A;  1LVA A;  1XDS A;  1HCR A;  1X4O A;  4EJU A;  3EDP A;  2VON A;  5B1B H;  2HDD A;  2WV1 A;  2R5Y A;  1D0Y A;  3NEU A;  1EKE A;  2V79 A;  2XAJ A;  3IRQ A;  1O4X A;  2ZME C;  1I3Q J;  4XNF A;  3G4S I;  4DNC A;  3ZP5 A;  1G3W A;  1MJB A;  2WTE A;  1U9N A;  2V6C A;  2A3S A;  2Z16 A;  1ZK8 A;  3ZMS A;  2G7H A;  3ZQC A;  3PL8 A;  4Y4R A;  1IC8 A;  3BDD A;  3DKW A;  1W7P B;  4L9V A;  1Z3Y A;  1S7O A;  4BEH A;  1AWC A;  3IAS 2;  5E17 F;  2Y30 A;  3RI4 A;  2WY8 Q;  1VQO I;  5D8L B;  2KIS A;  3JRD A;  4Y33 A;  2P5V A;  3ZGK A;  2O6G E;  1FT9 A;  2VQC A;  1RI7 A;  4M9S A;  1VQM I;  1KZH A;  2EPF A;  1ZR4 A;  2FBI A;  4O3M A;  4IHV A;  2HVS A;  2HKX A;  3BZK A;  1O7L A;  1YS6 A;  3LST A;  3MKL A;  3CCV I;  2DXI A;  2J5O A;  1MD0 A;  3OS2 A;  5IP7 J;  3BTC A;  5GAG J;  2DQR A;  5KVR A;  4OIP F;  2Z9O A;  4HZF A;  5K1Y A;  3DLL F;  3DPT A;  3UKG A;  2LG4 A;  4KT5 C;  4NC6 A;  1U8R A;  1UHW A;  2VJ4 A;  4RMN A;  4N9I A;  2BZT A;  4A3C J;  2R7U A;  3QP6 A;  1SEU A;  3RZO J;  4EAT A;  3RKQ A;  4J01 A;  1ETX A;  2OQG A;  1YHQ I;  2Y0M A;  3HXL A;  1JUS A;  3CLO A;  3ECH A;  4IPA A;  5H20 A;  3WE2 A;  4GYI A;  4DIQ A;  2ECB A;  4FET A;  2KKO A;  3M8J A;  3A4C A;  2QKL B;  1K6Y A;  1QA6 A;  2Y9Z A;  1SFK A;  3HOV J;  2EIM H;  2DCE A;  2FOW A;  3I58 A;  1ACI A;  2Q2E A;  3IRR A;  3A1Y A;  4BYY A;  2PJP A;  1Z7U A;  5L3G A;  2NNY A;  1MSE C;  1Y56 A;  2CH0 A;  4IL6 C;  1WJF A;  2F5D A;  1Z6T A;  4W1U A;  2DT5 A;  1OMI A;  4FX4 A;  1KU9 A;  2MW8 A;  4LMY A;  4E7H A;  1P92 A;  1QZZ A;  2RKH A;  2P6T A;  2W00 A;  4XLA A;  4IXA A;  1FPQ A;  2VC1 A;  4OIO F;  1HLV A;  3BOQ A;  3UR3 C;  4CCM A;  2OPT A;  2K40 A;  3E0J B;  4KN4 X;  4KIS A;  1SD6 A;  2JK3 A;  1B9M A;  3FHN A;  1BR2 A;  1KU3 A;  3KZZ A;  5FB2 A;  4XKC A;  4P9U A;  5HDG A;  4LGW A;  3C2G A;  2VL8 A;  2H6B A;  2XF7 A;  4LLL A;  5JR3 A;  1FSE A;  4I99 C;  4ZYA A;  1ZRF A;  2JPB A;  1D0Z A;  3CCL I;  2XVC A;  2E34 A;  2ECC A;  1DGR M;  3ZMZ A;  1YJ9 I;  2MFZ A;  2XGE A;  4DYC A;  2A05 A;  3HPH A;  2CFX A;  5K5R A;  1U8B A;  1XMA A;  2MAB A;  4ESF A;  3IWZ A;  1Z1D A;  4HAM A;  2XSD C;  1UB9 A;  2OV7 A;  1G59 A;  1FY7 A;  2HQA A;  2CV1 A;  2A68 F;  4KUM A;  2EFN A;  2O3F A;  1X2M A;  1R23 A;  2EZK A;  4I2O A;  2BEO A;  4IVN A;  2MC3 A;  2VPR A;  2K4B A;  5E1X A;  1G3Y A;  1XGM A;  4CHU A;  1R00 A;  2WC2 A;  5HS7 A;  4EJT A;  1FOY A;  4AWX B;  2RRE A;  2KPM A;  3GTM J;  1DU6 A;  2DDA A;  3ZQQ A;  4RAZ A;  3A2K A;  4BKX A;  3I3L A;  3ISP A;  4IQ4 A;  4BNC A;  4Y52 J;  5TIS C;  2LK2 A;  2DOD A;  2ELJ A;  4II2 A;  5FO5 A;  1FOK A;  1W5S A;  3BQY A;  1PP8 F;  3DKX A;  4HBL A;  3K6G A;  2STT A;  1K4S A;  2QWW A;  4ASN A;  1MBK A;  1LQ1 A;  3MZ8 A;  3L2V A;  3IHU A;  3S3M A;  3L00 A;  3J80 Z;  4AVZ A;  2HFH A;  4ESB A;  4L9T A;  3N4M A;  4FX0 A;  2X4H A;  1IN8 A;  2IPQ X;  3U1D A;  2HPM A;  2PX9 A;  2HYG D;  3BLY A;  1KGS A;  2HTJ A;  5EEH A;  2K9L A;  2B0L A;  2DA1 A;  4G6D A;  3QYE A;  2HPI A;  3K4J A;  2X6Y A;  3I64 A;  2GZW A;  3SZP A;  2HU9 A;  5DM6 F;  4ZZL A;  1WSU A;  1TQM A;  1LPQ A;  1RKW A;  2MA3 A;  1YG2 A;  3E6D A;  2YR2 A;  5IT9 Z;  4JX4 A;  3BTJ A;  5ERI A;  1BW6 A;  1GV2 A;  2M2E A;  2YSR A;  3T8T A;  3GFJ A;  5D6F A;  1DP3 A;  3H9J A;  3ZQI A;  2XRO A;  4PGG A;  2JMW A;  2HEO A;  5IOY A;  2XPU A;  4I01 A;  1ITY A;  2X6X A;  3EUK L;  4HNV A;  4DZJ A;  1XS9 A;  3PNV A;  2DT7 B;  2LSO A;  2PI0 A;  2FML A;  4P1W A;  1KQ9 A;  2QYO A;  2CQ7 A;  3TO7 A;  1X3Z B;  1VQ7 I;  1R7J A;  3D5R C;  1WFX A;  5EGO B;  3M8F A;  5IYB J;  1BIA A;  2K9N A;  4M73 A;  2MLG A;  2VBX A;  3MCZ A;  3QQA A;  4LG0 A;  3WTS C;  3CC2 I;  1FP1 D;  3ZMD A;  3R0J A;  5HVQ C;  1IRX A;  4UB6 C;  4HNU A;  1SFX A;  4HG2 A;  3HEF A;  3OS0 A;  3PJR A;  2WB1 N;  1ZEL A;  2VPL A;  4LLG F;  1TQI A;  3FXL A;  3CCQ I;  1XCV A;  1O3Q A;  3PUF A;  1Y8R B;  6PAX A;  5AIQ A;  3G2B A;  4ENN A;  1DPU A;  4R1H A;  1FTT A;  1WHU A;  2KRH A;  1RR8 C;  3JRI A;  2COB A;  2JA8 J;  1EV7 A;  1WJA A;  2E36 A;  2QZ8 A;  3D5S C;  5LD2 C;  1HBX G;  3LSG A;  2ZC2 A;  5M5Y J;  1VQP I;  1WPK A;  4ETS A;  1LFB A;  1ZYR F;  5J4Y A;  2WAE A;  2KL4 A;  3KET A;  3KLO A;  4IQJ A;  2YUS A;  2QSF X;  2Y0S A;  2ZKZ A;  3F8N A;  2VXZ A;  3LNQ A;  1ZGJ A;  3IUO A;  3K70 C;  2EWN A;  1GVD A;  2DAO A;  3AKZ A;  4IRI A;  5JHU A;  3F8C A;  2XKO A;  4I0A A;  4ZYH A;  3HSE A;  5FFZ A;  1J2X A;  3W2V A;  5ILV A;  2R93 J;  4AD9 A;  1ORK A;  2YX4 A;  1J9I A;  2O8K A;  2L4M A;  3V4G A;  4BS9 A;  1S72 I;  3ZMU A;  1A6I A;  4MQV A;  1TZL A;  4XID A;  4Z6Y A;  3DTE A;  5F27 A;  5HLG A;  1XSV A;  3P9C A;  4ENM A;  1R5G A;  3PUB A;  1MH4 A;  1HDP A;  4G6Q A;  5K5O A;  2V1U A;  5FLM J;  5C4X J;  4M9Z A;  2O9L A;  2W82 A;  1U0J A;  5L3B A;  1RES A;  4KN7 X;  2PQ8 A;  2VKV A;  3ZXS A;  1SFE A;  2VJ5 A;  3BC8 A;  3L09 A;  4RAF A;  2GA1 A;  4DYQ A;  1MMS A;  1BN5 A;  4HLX A;  4BEH B;  1AHD P;  4L0Z B;  5IOZ A;  1JHH A;  3TP0 A;  3ASN H;  3OYD A;  3IKT A;  1R58 A;  1S7A A;  2BY0 A;  4BQO A;  2Y48 A;  2DA3 A;  2R0Q C;  3E97 A;  2IS1 A;  3OYB A;  1LEB A;  2DA5 A;  5DCM B;  5IYD J;  4UB8 C;  2K86 A;  4XLP F;  2CS3 A;  3F0C A;  3KX2 A;  5L3D A;  3IV5 A;  2JJ7 A;  3HUG A;  3KE2 A;  1T8I A;  5TRD A;  5DTD A;  2CW7 A;  3EPZ A;  2ZBK A;  3A02 A;  3NRV A;  1T6S A;  4UY8 I;  1D5V A;  5E3M A;  4MHG A;  4F92 B;  4E7J A;  3DEE A;  3MN2 A;  3CCR I;  1D1C A;  3AAF A;  1Y8Q B;  2VQG A;  4KT6 A;  1OCZ H;  2GBY A;  4BJ6 C;  1K6O A;  3DXJ F;  2A07 F;  2H27 A;  1BR4 A;  3HPG A;  2EFQ A;  3WTT C;  2VKD A;  3WGI A;  4KIG A;  3HYI A;  3LSK A;  1OR7 C;  1X3U A;  1TQP A;  2PBI A;  4M3F A;  3SZG A;  4MLO A;  5BMZ A;  2Q2E B;  4CYD A;  3TOB A;  1UG2 A;  3FXO A;  3G3Z A;  3BQZ A;  4FT8 A;  2XGD A;  2ESN A;  2Z1D A;  4MQ9 F;  5E20 A;  2XC7 A;  4A93 J;  4J19 A;  3E6B A;  3MD2 A;  3LSR A;  3AL0 C;  2IS6 A;  3MKW B;  2EFO A;  4PJJ A;  1APL C;  2W7N A;  1S5L C;  1XG1 A;  1R4M B;  3EUH A;  1IV6 A;  3MQ0 A;  3HGY A;  1PJR A;  1QHH D;  2R3S A;  5LFA A;  4KMU X;  4YFK F;  2W25 A;  1P2F A;  3BTI A;  3REO A;  1ZGA A;  5CVU A;  5JFR A;  1K79 A;  1H8A C;  3WU1 B;  4E4H A;  3HRT A;  2ELK A;  1FBS A;  4N9H A;  3TL4 X;  4A3K J;  3OR2 C;  2OTJ I;  3AFH A;  2F4M B;  1R36 A;  2Q0O A;  3K4K A;  4Y17 A;  1MMN A;  3K9T A;  4JOM A;  5TJJ A;  1R6R A;  4HA8 A;  3NQO A;  4ZZD A;  1JKR C;  4EEF G;  5JVG F;  3ESW B;  3GYH X;  4HNT A;  3D1N I;  5K7Z A;  1ZLK A;  4M71 A;  3M07 A;  4CCK A;  4XBF A;  3MKZ A;  4YIF A;  1YX5 A;  3KP2 A;  4QSH A;  1HSJ A;  4FQG A;  3F8F A;  3L2R A;  5AON A;  2WAF A;  2CG4 A;  4GFB A;  1GLN A;  2XHK A;  1FMW A;  1KU2 A;  4RGS A;  1JT6 A;  2FF4 A;  3FK6 A;  2ZXI A;  2EIN H;  3QP5 A;  1YIO A;  3HSF A;  2NOG A;  4ZDL A;  5D5U B;  4E7L A;  3NAR A;  3WG9 A;  3PQK A;  4WX9 A;  3I54 A;  2LF7 A;  2DOA A;  4X0G A;  1N78 A;  2DI3 A;  1LUJ B;  2RQP A;  3TO9 A;  3MMY B;  3L9F A;  3DWL E;  1WGX A;  1STZ A;  3QPS A;  4PFO A;  3RPU D;  3BCB A;  1MMD A;  3B02 A;  2HKO A;  2K9Q A;  5JLW A;  2CMP A;  1LE8 A;  2F4I A;  4IOA F;  1L0O C;  3ABL H;  4OWR B;  4RB3 C;  1RUN A;  3CC4 I;  3BG7 A;  3VYS B;  1R4N B;  1OLT A;  5D8K B;  4GRI A;  1UHS A;  3ABK H;  2VBZ A;  4V2F A;  3BJ6 A;  3DTI A;  2CYY A;  3SYT A;  4B8X A;  1WQ2 A;  4XLH A;  1I6H J;  4WF2 A;  5ED4 A;  2E1M B;  2DYS H;  2V1X A;  4C2T A;  4G6T B;  5CVJ A;  2ZFW A;  3QOD A;  1GXP A;  1X2N A;  4G9Y A;  3GLL A;  4XRS G;  1E17 A;  4UVA A;  1Z91 A;  2DK8 A;  4CCJ A;  3KZY A;  3O8H A;  3A0H C;  3FXM A;  2LR8 A;  2H8R A;  4EQQ A;  5LRR A;  1OCT C;  1XX5 A;  1LNW A;  1YX3 A;  1Z0X A;  2A6T A;  4PFP A;  3B6C A;  3H3Z A;  2CRG A;  2A6E F;  3HOT A;  4B3A A;  5M3M J;  1HW2 A;  2JA6 J;  1G8X A;  3Q5F A;  4RM3 A;  5CPR B;  1X1P A;  4BJT A;  3C2B A;  3SFZ A;  1GUU A;  3TW7 A;  3ZOB A;  5E8G A;  1R49 A;  2M4K A;  3L2Q A;  3IH4 A;  3GX4 X;  2M0M A;  4BJ5 C;  3IWF A;  2R7W A;  2RVC A;  3K70 D;  1J75 A;  3SFI A;  2UXX A;  4ENJ A;  3PFI A;  2CV2 A;  4RLF A;  4R79 A;  1MZB A;  4L5J A;  1BL0 A;  1NK3 P;  2M9H A;  4J00 A;  2CW8 A;  2DFI A;  1S29 A;  4JX5 A;  3BG5 A;  3I5U A;  4EM2 A;  4A3E J;  4LLN A;  3JAM K;  3Q0V A;  2KHM A;  4OU0 A;  3PSF A;  1QU3 A;  4G94 A;  3BY6 A;  2G0E A;  1D0X A;  2NXN B;  4D5F A;  4GYG A;  1FX7 A;  3K0L A;  4FHT A;  5LBQ A;  3JRH A;  1MMG A;  1CF7 B;  1OIS A;  4N0B A;  2E60 A;  3S93 A;  2XGX A;  5J1R A;  3HM5 A;  2QKM B;  2LYC A;  3WE3 A;  2E7W A;  1MKM A;  1TWC J;  2AS5 F;  2VJI A;  1NK2 P;  3GZN B;  1OKR A;  3PIP F;  1W36 D;  5HNF A;  3FM5 A;  5GAE J;  1Z7L A;  1XGN A;  5J6X A;  1R1U A;  1Z67 A;  3FXR A;  4XKV A;  1G3T A;  2PMH A;  2X9D A;  1N25 A;  3OYN A;  4HPQ A;  1IAW A;  1T33 A;  3GTJ J;  3GF2 A;  5LHH A;  3H5R A;  3QOP A;  5J3L A;  3BPV A;  5GAH J;  3ROU A;  2NVQ J;  4U88 A;  2QBY B;  4GO1 A;  3RPU A;  2L4A A;  1FTZ A;  1V54 H;  3OYA A;  4M74 A;  1O3S A;  1V5E A;  4PUS A;  3BCA A;  4LK1 F;  1H89 C;  3HDD A;  2GIV A;  2L54 A;  2VXD A;  4HF0 A;  5H6Q A;  1VQ9 I;  2FQ3 A;  3BZC A;  1J0R A;  2R7X A;  3OL3 A;  4HDU A;  4BDY A;  4PK4 A;  3DPL C;  3RIR A;  1MMA A;  1LEA A;  1QRY A;  4PDK A;  4U0V A;  4OIN F;  3BR0 A;  1KQ8 A;  1SAX A;  1Q1H A;  1YW7 A;  1NG7 A;  2VLA A;  2LKS A;  2Z99 A;  3S15 J;  1ERD A;  2W85 A;  1UST A;  1OJL A;  4Y7N J;  2CW0 F;  1SC7 A;  2YX7 A;  4C3I J;  1ZG1 A;  2F5C A;  4ITV A;  2FNP A;  3JRG A;  3EUA A;  2LNB A;  1IG7 A;  3GTG J;  4A0X A;  5HS8 A;  1JUP A;  2JSP A;  2HDC A;  4QPO A;  1UJ8 A;  3R6S A;  1RC9 A;  1VQN I;  3CUQ B;  4H4K C;  2GLO A;  3KIO A;  1BJZ A;  3HOU J;  3BG6 A;  3GUD A;  5ILS A;  2OAZ A;  4P5O A;  4EMS A;  4E7K A;  3X2Q H;  2IVM A;  2L02 A;  1A36 A;  4I98 B;  3HG9 A;  4KDP A;  3P5J A;  4WXD A;  3A01 B;  1X3W B;  2L7F P;  4XN3 A;  5HDN A;  1DUX C;  4XLE A;  4MGR A;  5FLX K;  2LKX A;  2TRT A;  4FTH A;  1RIO H;  1KU7 A;  4BE0 A;  4G7H F;  1SFU A;  2E2H J;  3GWZ A;  3VWB A;  1AOY A;  5M5X J;  4RB0 A;  3CES A;  3ZN0 A;  4I76 A;  1BOB A;  3HIF A;  1KYW A;  3S8P A;  2D1V A;  5HLI A;  4A3G J;  2XF5 A;  2IAI A;  1MBG A;  3K2Z A;  4CZC A;  1USS A;  2ETH A;  2XSJ C;  4E70 A;  2QGU A;  3K1P A;  3KPH A;  2DA4 A;  3E3V A;  1K83 J;  2X48 A;  4EVI A;  4YFN F;  1F9N A;  2DA7 A;  2I5U A;  3L2C A;  3L7W A;  3HHG A;  4NUB A;  5EG0 B;  1ONV A;  1GT0 C;  2O61 A;  5DUI A;  5LLQ A;  4G8X A;  1U2W A;  2GXA A;  5ICE A;  5DD8 A;  2MH9 A;  3OIQ A;  2EV6 A;  5F64 A;  3FMQ A;  1LDK B;  2LMD A;  5J1Y A;  2CV0 A;  2XAF A;  4N4N B;  2H8W A;  1FIP A;  4F7Z A;  2JQ7 A;  3FDY A;  4YII A;  5C4J J;  2UZK A;  1AA7 A;  1POG A;  1OYW A;  2IJL A;  1ON1 A;  3ZQG A;  3SDG A;  2CGP A;  3F8M A;  1A35 A;  4XLF A;  5DS9 A;  3S16 J;  1FC3 A;  3ZQF A;  4UVC A;  3DLA A;  4BBR J;  3EQL F;  1HST A;  2L7Z A;  4MTD A;  4IHY A;  4ANJ A;  3TKY A;  1TT0 A;  5FKM A;  4D0P A;  1OR7 A;  1UZC A;  3VOE A;  4A3D J;  4A2U A;  3CDL A;  3SHF A;  4OMZ A;  3GTQ J;  5DCF A;  4IHT A;  3CLQ A;  3VYR B;  1YLF A;  3G1O A;  3AG2 H;  3OYH A;  2WAQ N;  2X1D A;  3TDZ C;  4LOC A;  2IXS A;  1G3S A;  5IPA A;  1VZ0 A;  2R7R A;  1D5Y A;  3CZ6 A;  4I0B A;  1W1W E;  1FIA A;  2JRM A;  3RPQ A;  1PDN C;  1XN7 A;  2M8G X;  5FJ8 J;  5FLV A;  4C2M J;  1ZRE A;  1U5T B;  4BL0 B;  3TMO A;  1ZAO A;  2XV4 S;  2P4W A;  4DOZ A;  3HB9 A;  5J8C A;  3V8K A;  1O3R A;  2YS9 A;  3EET A;  2W4S A;  4MTE A;  4XRF A;  3JSO A;  2WY7 Q;  1ZN2 A;  2DFH A;  2VQL A;  2QA4 I;  1E3P A;  4BQA A;  2ZJR F;  2R4G A;  3LFU A;  3E5Q A;  3H3U A;  1JGS A;  2NYX A;  4WXH A;  2CUJ A;  4DBQ A;  4IKF A;  3KYD B;  2NVT J;  1YS7 A;  3V7R A;  4A5M A;  3CJR B;  1V55 H;  2RAE A;  1FYL A;  4OIR F;  4CO8 A;  4YG2 F;  4F55 A;  3ZQL A;  3WTZ A;  3BG9 A;  1HF0 A;  3GTO J;  2X1C A;  5IY5 H;  1F36 A;  2J5P A;  3ZQ7 A;  1X1C A;  5K7H A;  2E1M C;  4JYK A;  3JCU C;  1BBY A;  1S3J A;  3A01 A;  3TOA A;  3T8R A;  3WTY C;  1R71 A;  3TO6 A;  1UFM A;  2GOM A;  4M6X A;  4XKB A;  1X1D A;  1Z21 A;  4A6E A;  3OY9 A;  2E1C A;  1IXS B;  4MFE A;  2DMN A;  3IH2 A;  3RKY A;  2EQR A;  1LVK A;  2NVX J;  1I5Z A;  1U9O A;  4JBA A;  2STW A;  3DBL B;  4DW6 A;  4FE4 A;  1XMX A;  1IXR C;  3W3C A;  2E1O A;  2CSO A;  2L9R A;  1PUF B;  1BW5 A;  1IW7 F;  3T5X A;  4ESJ A;  5DM7 F;  1T39 A;  2F48 A;  3R60 A;  5DYM A;  2F5F A;  3LMM A;  3EYI A;  1QBJ A;  1NG6 A;  9ANT A;  1SAU A;  3OIO A;  2R5Z A;  3LQQ A;  4UVB A;  4XLN F;  3MZH A;  4HX8 A;  5DV5 A;  1R5H A;  3QYB A;  2X1E A;  3GEZ A;  3OL4 A;  2R7T A;  2OQR A;  3CCJ I;  3WG7 H;  4OMY A;  3ECO A;  3W2A A;  5GTI C;  1WI3 A;  1G4D A;  2P8T A;  2P5L C;  2ESH A;  1Z6R A;  2CFO A;  3LAP A;  2VKE A;  4UV9 A;  2FA5 A;  5E79 C;  3G73 A;  4C3J J;  4EJV A;  3KYL A;  2UXN A;  1TP4 A;  5L3E A;  3L2W A;  1JJ8 C;  4AIH A;  1VQK I;  1WCM J;  4XSX F;  4EV0 A;  3BG3 A;  1QVT A;  4ON0 A;  3BR1 A;  4LJZ F;  4HDV A;  4B4C A;  2ID6 A;  3IH3 A;  4DBR A;  2HQR A;  4BH9 A;  3P7N A;  3TDU C;  4EM0 B;  1HOM A;  1T0F C;  4G7Z F;  3LAJ A;  1H9T A;  2ZB9 A;  3F3X A;  3IP4 B;  2BE5 F;  4K2E A;  3NWT A;  3T0Y A;  3J81 Z;  3KLN A;  2C6Y A;  1RNL A;  3SZT A;  2E2J J;  4B47 A;  1XSX A;  4L5E A;  1FP2 A;  2K9M A;  4KJZ A;  4ZDP A;  1VQL I;  2HOE A;  4C2U A;  3DBH B;  1TL8 A;  2M87 A;  3LSH A;  1JHF A;  3ABT A;  3FXJ A;  5H6R A;  1PUF A;  1A04 A;  2ZSI B;  1ETO A;  1RRJ A;  4BAY A;  3RQI A;  1PP7 U;  1YE9 A;  3G1M A;  3OOU A;  2EA4 A;  1ZH5 A;  1ZQ3 P;  1UG0 A;  3HOW J;  4LIT A;  4XSZ F;  4HW0 A;  1TC3 C;  3SQN A;  1ZG5 A;  5KCM A;  4HQE A;  5EZH A;  2CQN A;  4AIJ A;  2PMZ N;  1ZTR A;  5F08 A;  2W57 A;  1OYI A;  2ZO4 A;  3M8E A;  4U7B A;  4WK8 F;  2KIF A;  3VOD A;  1FYM A;  2CJJ A;  2LY1 A;  1OCP A;  1V5F A;  2NAZ A;  5JI6 A;  1S8N A;  1TWH J;  4CCO A;  2QQA A;  2QQ8 A;  3L1P A;  2EIJ H;  5H2F C;  3CUQ A;  4IHW A;  4HX4 A;  4P55 A;  3CF2 A;  1X4P A;  5E1Z B;  2HR3 A;  4A0Z A;  5JLX A;  1XB4 A;  1Z9C A;  2VE8 A;  1RZ4 A;  1ZHF A;  2XAU A;  2ZXW H;  1GDT A;  1JKP C;  2WWY A;  4A3M J;  1MW7 A;  1H0M A;  3GTP J;  3WHC A;  2DMU A;  2HS5 A;  2X6W A;  3J7Y J;  3M7G A;  3WTV C;  2FMY A;  3M3Y J;  4IZZ A;  1TWF J;  3Q3S A;  5FKN A;  4LFU A;  4JP0 A;  5E3N A;  3RDI A;  2ME6 A;  1IO2 A;  3JRA A;  2P81 A;  1P4X A;  1IDZ A;  4CYC A;  3COA C;  3V8J A;  4BY1 J;  1FJL A;  3L2U A;  2XRN A;  2HWV A;  2EV0 A;  3BR5 A;  1K78 B;  5LGU A;  2ZJ2 A;  4XN0 A;  3DCF A;  3W2W A;  1EH7 A;  4RBO A;  3BR6 A;  2DU9 A;  2JUC A;  5FKO A;  2V7F A;  4GGG A;  2UWM A;  2JUG A;  2E5Z A;  2IP2 A;  3VPR A;  3GZ6 A;  1YTY A;  3VSK A;  4L0Y B;  2FSW A;  4UHT A;  2R7O A;  4BQN A;  4A12 A;  2QSH X;  2VJJ A;  2GQQ A;  3DEW A;  2NVY J;  5D4S A;  1T0F A;  2FNA A;  1DU0 A;  3M1C A;  1PUE E;  2E71 A;  2R7S A;  2HOA A;  1TBX A;  4CA0 A;  2P0W A;  5IYC J;  3QYF A;  2L9N A;  4FIS A;  4X6A J;  5J8F A;  2DA2 A;  3WU0 A;  4NC8 A;  1FOX A;  5ICG A;  1T2K A;  3I0T A;  1S6L A;  2H94 A;  1D8J A;  4RGU A;  1KQ0 A;  1I1S A;  4RB1 A;  2M1B A;  4RGX A;  2KZG A;  1FBQ A;  5EDN A;  1RET A;  1JKO C;  4IX7 A;  4S04 A;  2LD5 A;  2EIK H;  2LVS A;  1SFO J;  1AKH B;  5E8I A;  1ETW A;  4HRI A;  2HYF A;  1S9H A;  3ML6 A;  2L01 A;  2LTP A;  3KCC A;  5BPI A;  3V8L A;  5F1J A;  3KYC B;  2OUM A;  3KP5 A;  1BI1 A;  2OF7 A;  4DJA A;  2R92 J;  2TCT A;  2VOP A;  3RKW A;  3CD6 I;  1DPR A;  3C18 A;  3LWF A;  1EF4 A;  1FEX A; 
#chains in the Genus database with same CATH homology
 2XUB A;  2RDP A;  1F4K A;  2O8X A;  4KYW A;  4AVP A;  1QPM A;  2RV8 A;  3DP7 A;  1MDM B;  1U5T A;  1YW9 A;  5E1W A;  3IL2 A;  4H0E A;  5CVR A;  3JAM Z;  3D5L A;  4TV7 A;  2DPD A;  1KA8 A;  1F5T A;  4Q47 A;  3J80 K;  3WGH A;  2JT1 A;  1E2X A;  3ABU A;  4RS8 A;  1B59 A;  4LK0 F;  4B09 A;  4L18 B;  1ON2 A;  1DP7 P;  1V3F A;  2K4J A;  1OYY A;  1SD4 A;  1IN6 A;  2W24 A;  3FM3 A;  1HKQ A;  1TW3 A;  2K27 A;  4U0Y A;  4Y15 A;  2PEX A;  3M9A A;  4WXC A;  3LA2 A;  2XIG A;  3CJN A;  1W7P D;  3R0A A;  4I02 A;  4RB2 C;  2XAQ A;  3MWM A;  5DD4 A;  2D2W A;  2JTV A;  1EH6 A;  3DF8 A;  1XMK A;  2VBW A;  2AXL A;  5HLH A;  3RYP A;  1BI3 A;  2IT0 A;  3V7C A;  3P9I A;  1DDN A;  5A2Q Z;  4Q4Z F;  1TNS A;  1IZ1 A;  1UHM A;  2F5E A;  4ZYD A;  1NHA A;  1YQA A;  1R1V A;  3ERE D;  4GXO A;  2RN7 A;  2VBY A;  2NS0 A;  3E6C C;  2RNJ A;  2JRT A;  4LB6 B;  3VB2 A;  4ENK A;  1UCR A;  1ZRD A;  1WKM A;  4MEY F;  1J5Y A;  3GO5 A;  2EFW A;  3BWG A;  5EEG A;  1GHC A;  3R4K A;  3BJO A;  4KFC A;  4KNY A;  2W84 A;  5BPD A;  2EB7 A;  3F23 A;  5BOX A;  5FD5 A;  3U2R A;  3O2P E;  3I4P A;  1XSD A;  4KIC A;  2FU4 A;  3C1D A;  2M30 A;  4UUV A;  4OOI A;  1SMT A;  5DCM A;  3U9G A;  5LRS A;  5D5W B;  1BI0 A;  3CUQ C;  2OD5 A;  2TDX A;  4HQM A;  4P9F A;  3K1M A;  3LQR A;  4BHP A;  2ZXJ A;  2HTS A;  2GWR A;  1JXS A;  2FOK A;  3KP7 A;  5D6E A;  3GLX A;  3RTR A;  1I27 A;  3CO6 C;  2D45 A;  3KP4 A;  4ZYE A;  4EGY A;  2XAG A;  4ZYG A;  3Q9V A;  2MLK A;  1FZP B;  3QPH A;  2BBY A;  2GXB A;  4MEX F;  1FLI A;  2LKP A;  3MFK A;  2X0L A;  5CLS A;  4UNO A;  1XGO A;  3GW2 A;  4M9X A;  1P6R A;  3HRU A;  4KIF A;  1LJ9 A;  2E1N A;  1BI2 A;  4LD5 A;  4WWC A;  4NQW A;  1SD5 A;  3GFL A;  4BXU A;  1U78 A;  5CVI A;  5CJ9 A;  3V7S A;  2H6C A;  1B6A A;  2PN6 A;  2XKP A;  4DQ2 A;  2DW4 A;  3WTW C;  2JSC A;  5HOO A;  2KJB A;  3JTH A;  5DEQ A;  1ZAR A;  2DBB A;  2A6H F;  2HZT A;  5A2Q K;  1FSH A;  1WI9 A;  3RKX A;  1IN5 A;  4IJA A;  2L3D A;  5L3F A;  2MD5 A;  2MH2 A;  1EH8 A;  2A61 A;  4U7D A;  1GXQ A;  5D4R A;  4EGZ A;  2A69 F;  2RC4 A;  2E7X A;  1HW1 A;  1MJA A;  4I09 A;  2DQL A;  2FBH A;  1HKT A;  4PZJ A;  2EFP A;  3VFZ A;  3DFG A;  3PQJ A;  4HF2 A;  5DDG A;  2Y75 A;  4L9N A;  2OA4 A;  1MJ9 A;  4CGZ A;  4A5N A;  3QRF F;  1QO0 D;  4A0Y A;  3LA7 A;  3WGG A;  2KIU A;  5FFX A;  4HYE A;  4I7H A;  4IHS A;  3F6V A;  1SMY F;  3MEX A;  4G7O F;  3FF5 A;  3JW4 A;  4CXF A;  5IT9 K;  3DEU A;  3QPT A;  3CUO A;  4WCG A;  4CDG A;  2BYV E;  3DV8 A;  3BRO A;  3KFW X;  2QQ9 A;  3T1B A;  5AIP A;  1Z05 A;  1IN7 A;  2KJC A;  1XD7 A;  4S05 A;  2YU3 A;  4U0W A;  2H09 A;  3TGN A;  1J7K A;  3LFK A;  2DK5 A;  2VN2 A;  3BZ6 A;  2JZY A;  1O3T A;  2EK5 A;  1ZLJ A;  2PLY A;  4QLC U;  1J59 A;  2IW5 A;  4L9J A;  2YPR A;  3IKV A;  5KK1 A;  3E6M A;  3F21 A;  2WV0 A;  1BC8 C;  3JSP A;  2Q8K A;  2QEN A;  3WTU C;  3CDH A;  4BHC A;  3HOS A;  3MAJ A;  5D5X B;  3O6B B;  1QNT A;  1YO5 C;  2A5Y B;  2OZ6 A;  1T98 A;  3GXO A;  3FMR A;  2D1H A;  2JPC A;  1CF7 A;  4IRH A;  4Q48 A;  1HW5 A;  1FBU A;  5ICC A;  3O3K A;  4AIK A;  3SXY A;  2VT3 A;  1BJA A;  1YYV A;  3GFM A;  3I59 A;  2ZNZ A;  2DPU A;  3BPX A;  1D3Y A;  1L3L A;  1LB2 A;  4HF1 A;  2FXA A;  2GA2 A;  2ZCW A;  3K1N A;  3CTA A;  2KIM A;  1IF1 A;  3B73 A;  3IC7 A;  2PG4 A;  3E5X A;  3RJP A;  3K69 A;  5LHI A;  4HV6 A;  1LDJ A;  1OPC A;  5D5V B;  3P9K A;  5BQT A;  4A6D A;  2V1D A;  2LF8 A;  3HSR A;  1B4A A;  2FRH A;  2CWE A;  2G7U A;  4HV5 A;  4HOB A;  4PCQ A;  1IUY A;  3HTS B;  3J81 K;  1TTY A;  1FNN A;  3C7J A;  2BGC A;  1B9N A;  2ZME A;  2IA0 A;  2QM3 A;  3F72 A;  3HTU A;  3W6K B;  5CYV A;  4JQF A;  1I6X A;  3KEO A;  2M5W A;  5CVV A;  1Y0U A;  2O03 A;  4IF4 A;  3QU3 A;  2PFB A;  2OZU A;  2EJR A;  4ZH4 F;  3JTG A;  3GZ5 A;  3ZPL A;  4JK1 X;  3RYR A;  1YFH A;  1V4R A;  1BIB A;  2M8E A;  3ELK A;  1I1G A;  5FD6 A;  1O7F A;  3EYY A;  4EM1 A;  3S2W A;  3FX3 A;  4CIC A;  3OOP A;  4EJO A;  1WRJ A;  2ELH A;  2G9W A;  4EJW A;  2ZME B;  3F22 A;  2F2E A;  1YW8 A;  3GVA A;  1RUO A;  3W6J B;  1TW2 A;  2OU2 A;  3WOD F;  4NHJ A;  3HRS A;  1XCB A;  1GVJ A;  4LG0 B;  1CGP A;  5IT3 A;  2O0Y A;  4KA4 A;  3BJA A;  2P7V B;  4MNU A;  5L3C A;  1IRG A;  3TQN A;  1ULY A;  2CQK A;  3KEQ A;  2P7C B;  1ZG3 A;  5FLX Z;  1BC7 C;  2ACJ A;  2BV6 A;  2IA1 A;  1K78 A;  3D0S A;  1MDM A;  3KP6 A;  1D8K A;  4UV8 A;  2XAS A;  1U3E M;  4CZZ A;  2ISZ A;  3DQV C;  1REP C;  1MGT A;  2KRF A;  2QLZ A;  3R61 A;  3ZMT A;  1T38 A;  3WTX C;  2COM A;  5LGN A;  3I53 A;  1QZY A;  4HLY A;  5JVT A;  3GFI A;  5F1R A;  2VC0 A;  5LHG A;  3BP8 A;  1HQC A;  3Q9S A;  3LA3 A;  4M6Y A;  2VT2 A;  2DLL A;  2IRF G;  1FYK A;  1F1Z A;  3F6O A;  4R8H A;  2GAU A;  3I71 A;  3H92 A;  2IA2 A;  2NRA C;  3FMS A;  1XDU A;  1R22 A;  3M1E A;  1K7A A;  2K02 A;  4O5V A;  1BM9 A;  4RAY A;  2OBP A;  2CO5 A;  1TLH B;  1XGS A;  2Z33 A;  4Y13 A;  1ZRC A;  1U6G A;  5LGT A;  3FXU A;  4QWQ A;  2NNN A;  4O6J A;  2FBK A;  3HRM A;  5ICF A;  3VEP A;  1WWX A;  1VTN C;  1W4M A;  1IRF A;  1FWZ A;  3MZY A;  4KIB A;  2PMU A;  5DUK A;  4UXN A;  2ADU A;  1HKS A;  3KP3 A;  1O57 A;  1U5T C;  2P5K A;  2EV5 A;  1SD7 A;  2ZNY A;  3ULQ B;  2MBF A;  2HGC A;  2P6S A;  5LEJ A;  2VOO A;  2VOD A;  5LEK A;  2ISY A;  2K7L A;  4L5I A;  3F8B A;  5HS9 A;  2HQN A;  2Z5U A;  1B1B A;  3I59 B;  4RGR A;  2QQB A;  2DTR A;  3E5U A;  3QU6 A;  1P4A A;  3HHH A;  2R7D A;  1QQI A;  4Z2Y A;  2VE9 A;  5HDK A;  1W5T A;  5BS6 A;  1TNT A;  3C3W A;  4M72 A;  1LDD A;  5FGM A;  2QVO A;  1P4W A;  1IN4 A;  4NB5 A;  3CO7 C;  3J7A O;  1R1T A;  2QUF A;  4P96 A;  2QBY A;  2M45 A;  1ODD A;  3FZV A;  2EA2 A;  4HX7 A;  2V9V A;  1W7P A;  2RGV A;  1KYZ A;  4GCV A;  2XAH A;  3ZN1 A;  3OV8 A;  1HXD A;  2DO7 A;  1QGP A;  2Z3Y A;  4PGH A;  4KMF A;  4Q5S F;  1C0W A;  3ZMV A;  4BHB A;  2FE3 A;  1H9G A;  5E18 F;  2GXG A;  1BOA A;  4IRG A;  5F6F A;  4OIQ F;  2FEZ A;  2LDU A;  3QAH A;  1IXC A;  3FHZ A;  1G6N A;  3N97 A;  3FXQ A;  4YFX F;  1JE8 A;  2R7F A;  3FWE A;  5K5Q A;  5ILU A;  4LB5 A;  1LVA A;  1XDS A;  4EJU A;  3EDP A;  2VON A;  3NEU A;  2V79 A;  3IRQ A;  2XAJ A;  4DNC A;  3ZP5 A;  1G3W A;  1MJB A;  2WTE A;  2V6C A;  2A3S A;  3ZMS A;  2G7H A;  3BDD A;  3DKW A;  1W7P B;  4L9V A;  1S7O A;  1AWC A;  5E17 F;  3RI4 A;  5D8L B;  2P5V A;  2O6G E;  1FT9 A;  1RI7 A;  4M9S A;  2FBI A;  4O3M A;  2HKX A;  1O7L A;  1YS6 A;  3LST A;  2J5O A;  1MD0 A;  2DQR A;  5KVR A;  4OIP F;  2Z9O A;  4HZF A;  5K1Y A;  3DPT A;  4KT5 C;  1U8R A;  1UHW A;  4N9I A;  3QP6 A;  2OQG A;  2Y0M A;  3CLO A;  3ECH A;  4IPA A;  5H20 A;  3WE2 A;  4GYI A;  2KKO A;  3I58 A;  2Q2E A;  3IRR A;  4BYY A;  2PJP A;  1Z7U A;  5L3G A;  2NNY A;  2F5D A;  1Z6T A;  2DT5 A;  1OMI A;  4FX4 A;  1KU9 A;  4LMY A;  1P92 A;  1QZZ A;  2RKH A;  2P6T A;  4IXA A;  4OIO F;  1FPQ A;  2VC1 A;  3BOQ A;  4KN4 X;  1SD6 A;  1B9M A;  1KU3 A;  3KZZ A;  5FB2 A;  4P9U A;  5HDG A;  4LGW A;  2H6B A;  4LLL A;  5JR3 A;  1FSE A;  1ZRF A;  2JPB A;  2XVC A;  3ZMZ A;  2CFX A;  5K5R A;  1XMA A;  4ESF A;  3IWZ A;  1Z1D A;  4HAM A;  1UB9 A;  1FY7 A;  2A68 F;  4KUM A;  2EFN A;  2O3F A;  1R23 A;  4I2O A;  2BEO A;  4IVN A;  2MC3 A;  2K4B A;  5E1X A;  4CHU A;  1G3Y A;  1XGM A;  1R00 A;  2WC2 A;  5HS7 A;  4EJT A;  4AWX B;  4RAZ A;  3ISP A;  4BNC A;  5FO5 A;  1FOK A;  1W5S A;  1PP8 F;  4HBL A;  2STT A;  2QWW A;  4ASN A;  1LQ1 A;  3IHU A;  3L00 A;  3J80 Z;  2HFH A;  4ESB A;  4L9T A;  3N4M A;  4FX0 A;  2X4H A;  1IN8 A;  2IPQ X;  3U1D A;  2HYG D;  1KGS A;  2HTJ A;  5EEH A;  2B0L A;  4G6D A;  3I64 A;  2GZW A;  3SZP A;  4ZZL A;  1WSU A;  1TQM A;  2MA3 A;  3E6D A;  1YG2 A;  2YR2 A;  5IT9 Z;  5ERI A;  2YSR A;  3T8T A;  3GFJ A;  5D6F A;  2XRO A;  4PGG A;  2HEO A;  4I01 A;  2LSO A;  2PI0 A;  2FML A;  1KQ9 A;  2QYO A;  3TO7 A;  1R7J A;  3M8F A;  1BIA A;  4M73 A;  2MLG A;  2VBX A;  3MCZ A;  4LG0 A;  3WTS C;  1FP1 D;  3ZMD A;  3R0J A;  5HVQ C;  1SFX A;  4LLG F;  1TQI A;  1XCV A;  1O3Q A;  6PAX A;  5AIQ A;  4ENN A;  1DPU A;  4R1H A;  1EV7 A;  2QZ8 A;  1HBX G;  4ETS A;  3KET A;  1ZYR F;  3KLO A;  2ZKZ A;  3F8N A;  2VXZ A;  1ZGJ A;  2EWN A;  2DAO A;  4IRI A;  5JHU A;  3F8C A;  2XKO A;  4I0A A;  4ZYH A;  3HSE A;  5FFZ A;  1J2X A;  5ILV A;  4AD9 A;  2YX4 A;  1J9I A;  2L4M A;  3V4G A;  3ZMU A;  4MQV A;  5HLG A;  1XSV A;  3P9C A;  4ENM A;  1R5G A;  4G6Q A;  2V1U A;  5K5O A;  4M9Z A;  5L3B A;  4KN7 X;  2PQ8 A;  1SFE A;  3L09 A;  2GA1 A;  1BN5 A;  4HLX A;  4L0Z B;  1JHH A;  3IKT A;  1R58 A;  1S7A A;  2Y48 A;  3E97 A;  1LEB A;  5DCM B;  2K86 A;  4XLP F;  5L3D A;  3HUG A;  3KE2 A;  5TRD A;  2ZBK A;  3NRV A;  1T6S A;  1D5V A;  4MHG A;  3AAF A;  1K6O A;  2A07 F;  2H27 A;  3DXJ F;  2EFQ A;  3WTT C;  3WGI A;  4KIG A;  3HYI A;  1X3U A;  1TQP A;  2PBI A;  5BMZ A;  4CYD A;  3TOB A;  3G3Z A;  4FT8 A;  2ESN A;  4MQ9 F;  5E20 A;  3E6B A;  2EFO A;  3EUH A;  3MQ0 A;  2R3S A;  4KMU X;  4YFK F;  2W25 A;  1P2F A;  3REO A;  1ZGA A;  5CVU A;  5JFR A;  1K79 A;  3WU1 B;  3HRT A;  1FBS A;  4N9H A;  1R36 A;  2Q0O A;  4Y17 A;  3K9T A;  5TJJ A;  4HA8 A;  3NQO A;  4ZZD A;  3GYH X;  1ZLK A;  4M71 A;  4XBF A;  4YIF A;  3KP2 A;  1HSJ A;  3F8F A;  5AON A;  2CG4 A;  2XHK A;  1KU2 A;  4RGS A;  2FF4 A;  3QP5 A;  1YIO A;  3HSF A;  5D5U B;  3WG9 A;  3PQK A;  4WX9 A;  3I54 A;  2LF7 A;  2DI3 A;  2RQP A;  3TO9 A;  3L9F A;  1STZ A;  3B02 A;  2HKO A;  1L0O C;  4RB3 C;  1RUN A;  5D8K B;  2VBZ A;  3BJ6 A;  2CYY A;  4B8X A;  1WQ2 A;  4WF2 A;  5ED4 A;  2V1X A;  5CVJ A;  2ZFW A;  1GXP A;  4G9Y A;  1E17 A;  4UVA A;  1Z91 A;  2DK8 A;  3KZY A;  4EQQ A;  5LRR A;  1LNW A;  3H3Z A;  2A6E F;  3HOT A;  1HW2 A;  3Q5F A;  3SFZ A;  5E8G A;  3GX4 X;  3IWF A;  2RVC A;  1J75 A;  2UXX A;  4ENJ A;  3PFI A;  4R79 A;  1MZB A;  4L5J A;  2DFI A;  1S29 A;  3I5U A;  4EM2 A;  4LLN A;  3JAM K;  4OU0 A;  4G94 A;  3BY6 A;  4GYG A;  1FX7 A;  3K0L A;  4FHT A;  5LBQ A;  1CF7 B;  4N0B A;  2XGX A;  3WE3 A;  2E7W A;  1MKM A;  2AS5 F;  1OKR A;  3FM5 A;  1XGN A;  5J6X A;  1R1U A;  3FXR A;  1G3T A;  2PMH A;  1IAW A;  3GF2 A;  5LHH A;  3QOP A;  3BPV A;  3ROU A;  4U88 A;  2QBY B;  4GO1 A;  3RPU A;  2L4A A;  4M74 A;  1O3S A;  4LK1 F;  2GIV A;  2L54 A;  4HF0 A;  5H6Q A;  2FQ3 A;  1J0R A;  4HDU A;  3DPL C;  3RIR A;  1LEA A;  4PDK A;  4U0V A;  4OIN F;  1KQ8 A;  1SAX A;  1Q1H A;  1YW7 A;  2Z99 A;  2W85 A;  1UST A;  2CW0 F;  2YX7 A;  1ZG1 A;  2F5C A;  2FNP A;  2LNB A;  4A0X A;  5HS8 A;  2HDC A;  3R6S A;  3CUQ B;  3GUD A;  5ILS A;  2OAZ A;  4P5O A;  4EMS A;  2IVM A;  2L02 A;  4I98 B;  4KDP A;  4WXD A;  5HDN A;  1DUX C;  4MGR A;  5FLX K;  1RIO H;  1KU7 A;  4G7H F;  1SFU A;  3GWZ A;  1AOY A;  4RB0 A;  3ZN0 A;  3HIF A;  1KYW A;  2D1V A;  5HLI A;  3K2Z A;  1USS A;  2ETH A;  4E70 A;  3K1P A;  3E3V A;  4EVI A;  4YFN F;  1F9N A;  3L2C A;  3L7W A;  3HHG A;  1ONV A;  2O61 A;  5DUI A;  5LLQ A;  4G8X A;  1U2W A;  5ICE A;  5DD8 A;  2MH9 A;  2EV6 A;  5F64 A;  3FMQ A;  1LDK B;  2XAF A;  4F7Z A;  4YII A;  2UZK A;  1OYW A;  2IJL A;  1ON1 A;  2CGP A;  3F8M A;  1FC3 A;  4UVC A;  3EQL F;  1HST A;  4MTD A;  3TKY A;  4D0P A;  1OR7 A;  3VOE A;  4A2U A;  3SHF A;  4OMZ A;  5DCF A;  4IHT A;  1YLF A;  3TDZ C;  1G3S A;  4I0B A;  3RPQ A;  1PDN C;  1XN7 A;  1ZRE A;  1U5T B;  1ZAO A;  2XV4 S;  2P4W A;  5J8C A;  3V8K A;  1O3R A;  3EET A;  4MTE A;  4XRF A;  3JSO A;  1ZN2 A;  4BQA A;  3E5Q A;  3H3U A;  1JGS A;  2NYX A;  4WXH A;  1YS7 A;  3V7R A;  4A5M A;  1FYL A;  4OIR F;  4CO8 A;  4YG2 F;  3WTZ A;  2J5P A;  3ZQ7 A;  1BBY A;  1S3J A;  3TOA A;  3T8R A;  3WTY C;  3TO6 A;  1UFM A;  4M6X A;  4A6E A;  2E1C A;  1IXS B;  3RKY A;  1I5Z A;  4JBA A;  2STW A;  1IXR C;  2CSO A;  1IW7 F;  3T5X A;  4ESJ A;  1T39 A;  3R60 A;  5DYM A;  2F5F A;  3EYI A;  1QBJ A;  3MZH A;  3LQQ A;  4UVB A;  4XLN F;  4HX8 A;  5DV5 A;  1R5H A;  3GEZ A;  2OQR A;  4OMY A;  3ECO A;  1G4D A;  2P8T A;  2P5L C;  2ESH A;  1Z6R A;  3LAP A;  4UV9 A;  2FA5 A;  3G73 A;  4EJV A;  2UXN A;  5L3E A;  4AIH A;  4XSX F;  4EV0 A;  4ON0 A;  4HDV A;  4LJZ F;  2HQR A;  4BH9 A;  3P7N A;  3TDU C;  4EM0 B;  4G7Z F;  3LAJ A;  1H9T A;  3F3X A;  2BE5 F;  4K2E A;  3T0Y A;  3J81 Z;  3KLN A;  2C6Y A;  1RNL A;  3SZT A;  1XSX A;  1FP2 A;  2HOE A;  2M87 A;  1JHF A;  3ABT A;  5H6R A;  1A04 A;  4BAY A;  1PP7 U;  2EA4 A;  1ZH5 A;  4XSZ F;  4HW0 A;  3SQN A;  1ZG5 A;  4HQE A;  4AIJ A;  2W57 A;  1OYI A;  2ZO4 A;  3M8E A;  4U7B A;  4WK8 F;  2KIF A;  3VOD A;  1FYM A;  2NAZ A;  5JI6 A;  1S8N A;  2QQA A;  3CUQ A;  4HX4 A;  4P55 A;  5E1Z B;  2HR3 A;  4A0Z A;  1XB4 A;  1Z9C A;  2VE8 A;  1RZ4 A;  1ZHF A;  2WWY A;  1H0M A;  2HS5 A;  3M7G A;  3WTV C;  2FMY A;  4LFU A;  3RDI A;  1P4X A;  3COA C;  3V8J A;  2XRN A;  2HWV A;  2EV0 A;  1K78 B;  5LGU A;  2ZJ2 A;  1EH7 A;  2DU9 A;  4GGG A;  2UWM A;  2IP2 A;  3GZ6 A;  1YTY A;  4L0Y B;  2FSW A;  4UHT A;  4A12 A;  2GQQ A;  5D4S A;  1T0F A;  2FNA A;  1PUE E;  1TBX A;  5J8F A;  3WU0 A;  5ICG A;  1T2K A;  3I0T A;  1S6L A;  2H94 A;  1D8J A;  4RGU A;  1KQ0 A;  1I1S A;  4RB1 A;  2M1B A;  4RGX A;  1FBQ A;  4S04 A;  5E8I A;  2HYF A;  3ML6 A;  2L01 A;  5BPI A;  3KCC A;  3V8L A;  3KP5 A;  1BI1 A;  2VOP A;  3RKW A;  1DPR A;  3C18 A;  3LWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...