5JVGF

The large ribosomal subunit from deinococcus radiodurans in complex with avilamycin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5jvgF00
3CCEI 1YJNI 1YITI 3CJTB 2FOWA 1VQPI 1ACIA 4V19K 1FOXA 5DM7F 1FOWA 2ZJPF 1YJ9I 5GAEJ 1FOYA 2OTJI 1HC8A 1VQ7I 3CC2I 2K3FA 3DLLF 2QEXI 1MMSA 1YJWI 1VQ8I 3PIPF 3J7ZI 1Y39A 5JVGF 1VQLI 3CCRI 4IOCF 3I56I 1VQ9I 4IOAF 3J7YJ 2NXNB 1QA6A 2JQ7A 4IO9F 1YI2I 3CCQI 3CCVI 3CC4I 3CD6I 5GADJ 4UY8I 2E36A 2E34A 3CCUI 2OTLI 1S72I 2H8WA 1VQMI 1YIJI 5GAHJ 3CF5F 2E35A 3G4SI 3CCMI 5GAGJ 1VQ5I 3CMEI 5DM6F 3CMAI 2ZJQF 3PIOF 1VQ6I 3CCLI 3CCJI 1VQ4I 2ZJRF 3I55I 3G71I 1VQNI 1YHQI 1VQOI 3CCSI 3G6EI 2QA4I 3CC7I 1VQKI
chains in the Genus database with same CATH superfamily
3LL7A 1K83J 3ML6A 3V7RA 4F52A 2V9KA 2E1NA 2I5UA 3SZTA 4OAZA 1BM9A 4FISA 3A1YA 4RA2A 2E7XA 3QAHA 2CS3A 4MFEA 3HOWJ 3I64A 1YTYA 2NAZA 3OMYA 2K3PA 2LY1A 3SXYA 3A01A 5EEGA 3U2RA 4JX6A 5FKKA 3CMMA 2MC3A 2V7FA 3JRDA 3C18A 3V7CA 2M87A 2HDCA 1J75A 2P5KA 3H1CA 3PSFA 2E5NA 4MQVA 2ECCA 4MEYF 1XN7A 1SVLA 1AU7A 5LBQA 1JT6A 2XSDC 5TJJA 4HSTA 5F1JA 1IRXA 1XCVA 1OISA 2ZC2A 4MGRA 3QOPA 2JA7J 5J4VA 1IRFA 2WADA 1JJ6C 2NVXJ 3QP5A 5KAFC 5M3MJ 2LBFA 1S9HA 4NC6A 5L3GA 1MMSA 5FD6A 2ZXHA 1O3QA 2LF7A 2VC0A 4NQWB 3MFKA 1P4AA 3F8CA 3KZIC 4BBSJ 3FXUA 2NVUB 3L2CA 2HU9A 3OY9A 1REPC 3EYYA 1SD6A 2BE5F 1WJDA 2E7WA 4LG0A 3OYHA 2PJPA 2F5DA 1TBXA 3G1MA 2RVCA 3FM3A 1DGWY 1LDDA 3HSFA 4C3JJ 1R22A 4CDGA 2QWWA 5M5YJ 1QPMA 4BQAA 5IT9Z 5F27A 1FTTA 3E5QA 2DT6A 3RPUA 1FMVA 1C0WA 3Q9VA 2JN6A 1RR8C 3S1MJ 4UUSA 3LSMA 1BIBA 1DP3A 4BJ6C 3DKWA 4I02A 2ISYA 4CCLA 2DA3A 3BZKA 3LMMA 4NDLA 1B59A 1NK3P 1WH7A 1XTAA 3BR0A 3SQNA 3ZMUA 4ETSA 2MH2A 4GYIA 5HS7A 2R4GA 5HODA 4A0XA 1IRZA 2A6HF 2X48A 2QQ9A 2R7UA 3HHGA 1HQCA 3BLYA 2MSYA 3CMAI 2EK5A 4Y52J 3K70C 4P9UA 3FXJA 2EZKA 4RB3C 5JFRA 3CCLI 1NTCA 4X1EA 1J7KA 2QBYB 1SFUA 5ILVA 1WHUA 1NG6A 2K86A 2E2IJ 1ETXA 2FUG2 4S0HB 4KDPA 3S16J 3I9V2 4LOCA 4Y15A 5J1RA 3CC7I 2F2EA 4ZC3A 3KETA 1ZH5A 3FHNA 5FLXZ 2CV1A 4BEHA 1Y1WJ 4QPOA 2L7FP 2X1DA 5ICEA 2PI0A 3AG2H 2CQKA 2LTPA 3PJRA 4HF2A 1R6RA 4XNFA 2RDPA 3GVAA 1MZBA 2XROA 2QLZA 1XGNA 2VJ5A 3P9IA 1FOXA 1PJRA 2ZJPF 1AKHB 3K4LA 1WSUA 2ZB9A 2XPUA 2DK5A 1HC8A 1D0YA 1Y0NA 2IBDA 2LOOA 4ZYDA 4MTEA 3HKZA 2K02A 4HNUA 4CCKA 1Z21A 4X6AJ 4XRFA 1XMKA 2L7KA 1X2MA 3FDYA 4XRSA 2IS1A 3HOYJ 2GIZA 1P4XA 2GM4A 1TWGJ 3MD2A 1H8AC 4PJ0C 1YFHA 3QPSA 3RPUD 5DTDA 1GVDA 3L2WA 1GHCA 1R5ID 3AAFA 3HRUA 4B48A 4JP0A 2LNBA 2JUGA 3ZXSA 1YIOA 5JLXA 1VQ9I 2IA1A 4ZDPA 3G2BA 3WHCA 2XV4S 3J7YJ 4YFKF 5D5UB 1YG2A 3W2AA 4YRVA 2CUJA 2IGNA 3RYRA 3GW2A 1B8IA 2E1CA 3ZRGA 3B6AA 4IL6C 1MBJA 1UCRA 2LFBA 3J81Z 4DJAA 3M3YJ 2JPCA 4ON0A 4J19A 3QODA 4PSWA 4I7HA 4PFOA 2Q2EB 3OIQA 3N05A 1OCZH 3N97A 4XM3A 4IHWA 4KICA 3GF2A 3K4MA 5FRMA 2DOEA 4G12A 2E1MC 3N4MA 2Y31A 3E3VA 5GAHJ 2DK8A 2L7ZA 3AL0B 2X9DA 3ZQGA 4BDZA 1JXSA 1IV6A 1TQIA 3QWLA 1EH6A 1MSFC 4OMZA 5AIQA 1XDSA 2ELJA 2HVQA 1F5TA 2XF6A 2RN7A 4H4KC 3IAM2 2FSWA 3G71I 2L5QA 2VOOA 3JSOA 1LFPA 1U5TB 2YS9A 1Q1HA 2G0EA 4BJ5C 4I98B 4FX4A 1X4OA 3ZQCA 4ZZLA 3F8BA 4Z6YA 1ZREA 4BY1J 4L5EA 2XF5A 3RKWA 4WK8F 3RKXA 3KP6A 4RS8A 2LC2A 3OYJA 4C3IJ 5D5WB 2NYXA 4U87A 2CQQA 5IYCJ 3EUHC 4QIWN 2R7WA 1KQ8A 5HS8A 3FIWA 3H9JA 1RUOA 3V8LA 5A2QZ 1AWCA 5FLVA 1RNLA 3LSRA 1HLVA 3CO6C 5IPAA 4XLFA 1XC5A 2OBPA 3GTKJ 1MDMB 1YE9A 3CF2A 1K78A 2X6OA 1KZHA 2O61A 3GTMJ 2IEKA 1V4RA 4PFPA 5HLIA 2E2JJ 1IAWA 2OJED 2VI6A 5BS6A 1R49A 5KHDA 2VONA 2TDXA 3IV5A 2XPVA 3NWSA 1FMWA 1CF7A 2LKSA 2W7NA 4AYBA 2B9SA 1UZCA 2Y69H 2ME6A 1IN4A 2DJIA 2KP6A 6PAXA 3M1CA 3G73A 2FJ1A 3BG5A 4IOCF 4E6KG 1B8IB 1XSXA 1TW3A 2BW3A 4W1UA 5CVVA 1SAXA 2QGUA 2RNJA 4A6EA 5K7HA 2GZWA 2G7HA 1F43A 2LVSA 3S93A 2Y2ZA 2DA7A 3DU6A 1N75A 3IH3A 4HW0A 1W0UA 1VZ0A 2FA5A 4BDYA 1FBUA 4KIGA 2Y48A 3ASOH 1QBJA 3S32A 2JWTA 5AONA 1K79A 4KUMA 2DDBA 1W7PD 2PG4A 4PJLA 4Z2YA 5L3BA 2O8KA 2HDWA 4XL9A 2VODA 3DTIA 2CUEA 5HNFA 2RGVA 4S04A 3OR2C 2F4IA 4CCJA 1V54H 4NNJA 1NK2P 4Q5SF 3QPHA 3RJPA 2FMLA 3DCFA 4C2TA 3VOEA 2LD5A 2J5OA 2LG4A 5HNHA 2HQRA 4A6DA 1IXCA 3A02A 3FXLA 1HXDA 4RAFA 2DMPA 3S3OA 1P9QC 5C44J 5DD4A 3MZ8A 2ZJRF 1KU7A 3OL4A 2R5YA 5GPCA 4U0WA 3H5RA 4IHTA 2VQCA 3GTQJ 1VQOI 2IA2A 1E3HA 4KJZA 3I53A 4MFDA 3HZJA 4LK1F 5DCMA 2OUMA 5B1BH 1FBSA 3KP2A 2M34A 4M6YA 4Q48A 3UR3C 3ZMDA 3ZMSA 1LB2A 2TRTA 3ERMA 2K85A 2FNPA 1B9MA 2QSGX 2LDUA 3FXOA 2ICWG 3KZYA 3RIRA 4MHGA 4ENMA 3ZQHA 2KMUA 1ZHFA 4FE4A 3NQOA 5D5XB 2BV6A 4IF4A 4FQGA 3M4OJ 1QZEA 1K78B 3C2GA 5HLHA 2YR2A 1P92A 1ZK8A 2P81A 4BY7J 3BP8A 1E17A 2M30A 3DP7A 2EWNA 2CYYA 4B47A 1X3WB 5CPRB 4UVCA 4BKXA 1W5TA 3WE3A 2RAEA 2Z5UA 4CZZA 1A31A 1EJ9A 3CC2I 2WB1A 5CVUA 1LUJB 3DLLF 3LAJA 2FBKA 3RSNA 4L5IA 1Z9CA 3W6JB 3K10A 5K5RA 3BG6A 2DYSH 3OYEA 4XQFA 5B1AH 1I6XA 2FXAA 3LQRA 3GTLJ 1BI1A 1IV8A 1UELB 2CUFA 5K5OA 1XMAA 5JVGF 4AVZA 4IRGA 3C7JA 3HBLA 2O03A 3H35A 4CYCB 1BOAA 2KFDA 4RGSA 4IOAF 3KFWX 4LG3A 4MEXF 2IS2A 3F0CA 3TQNA 1SMYF 2P6TA 2W00A 1OLTA 3SDGA 2WAQA 4R1HA 2K40A 4IPAA 2JA2A 2NS7A 4LB5A 3PUFA 4E7JA 3AKZA 4HOBA 3BPVA 1ONVA 3RDIA 2WAEA 1XX5A 3DF8A 5L3CA 3KYDB 4M3EA 4FX0A 2L01A 3RQ4A 2WAFA 5JHFA 4M9SA 4BJTA 2Z9OA 4GGGA 3WGGA 4D1QA 1CGPA 2M2EA 4CXFA 3H3VK 3LQQA 1R00A 1ORKA 3C2HA 2R7RA 5ILSA 3BR6A 3HM5A 5IOZA 1HSJA 3CQZJ 2MGQA 1JKQC 1GV5A 2BHZA 3BC8A 2W25A 2KPMA 3IUOA 3QU3A 2ZJQF 2JK3A 5E3NA 2ADUA 3WTXC 3RTRA 1X1CA 4AM3A 2V26A 2DT7B 2DDAA 5DCMB 4BE0A 4QPQA 4EJVA 2LRDA 1BC7C 1ULYA 3CJNA 3HXLA 2M3AA 1FP1D 5CVIA 1FSEA 3G3ZA 2R7FA 2L7MP 2WV0A 3JR9A 3CCSI 3K1PA 2R0QC 4R79A 2ZFWA 4KN4X 1QHGA 2HS5A 1M1EB 4XKVA 3TO6A 1W1WE 5KCMA 2KHMA 1J9IA 2BGCA 2XB0X 5LGTA 1G6NA 5FLMJ 3CJRB 4Y4RA 1BN5A 2KISA 2VB6A 2QUFA 1T95A 4CYDA 2KIMA 3IP4B 3BZCA 1V5EA 4Y7NJ 2MD0A 1DPUA 4M73A 1LDJA 2EFOA 2VBZA 2EB7A 1JKOC 3M1EA 2NRAC 4KA4A 2EIKH 1MH3A 3I59B 4UUVA 1T0FC 1ZLKA 3EPZA 4N9HA 5JVTA 1TTYA 2Q0OA 2XRNA 4LK0F 1XPXA 1WCMJ 1Z1DA 2FOKA 1B4AA 2HYFA 2NVQJ 1I5ZA 1A6QA 3BR3A 4XLHA 2MG4A 2Y9ZA 4IZZA 4WXHA 3DXJF 1QQIA 1VQ8I 1DU6A 4HLXA 3KCCA 1I3QJ 2OF7A 4NC8A 4EJOA 1DUXC 1WPKA 2D1VA 1LDKB 5GTHC 5E18F 2DJNA 3GUDA 1CQTA 2WY8Q 1SEUA 4KIFA 3K0LA 1KGSA 5HLGA 1R5HA 1IO2A 2HZTA 3F23A 1XS9A 1HKSA 3U9GA 2H09A 1HKQA 2OCEA 2V9VA 2VC1A 3GWZA 4A3IJ 2A5WA 2XASA 3F9KA 2CW8A 2P7VB 2JTVA 2BY2A 3DPTA 2N8GA 3OS0A 1SFOJ 1JTXA 4A3GJ 2L9RA 4LIVA 2JT1A 3GX4X 2HI3A 5FROA 3HIFA 2LYCA 3LOCA 3VDXA 2ME0A 2VKHA 2MLKA 1ZGWA 2JRTA 4OIOF 3BR2A 1MMNA 1SFXA 4KT6A 2VN2A 4NQWA 3K4JA 2DA5A 3KEQA 2ID3A 4IKFA 1H9TA 4GYGA 3KLOA 5D5VB 1KQ9A 3MQ0A 5HS9A 4E70A 4UVAA 1F4KA 1LKXA 1RETA 3MMYB 4KIBA 3GTGJ 2QCOA 1T6SA 2DTRA 5E3LA 3BZ6A 3D5SC 4ESBA 3M7GA 3WGHA 3VSLA 4ZJZA 1Z3XA 4L0YB 3HPHA 5B5EC 3F8NA 1BW5A 3QYBA 2ECBA 1O57A 4DYCA 4RLQA 3AFHA 1X1AA 4L9NA 4ENJA 1ACIA 3EUHA 2MD5A 2VQHA 4LGWA 1D8KA 3FHZA 2I10A 2JVHA 4AUXA 1EH8A 3BOQA 3PL8A 2HEOA 3ZN0A 1MW7A 1EKEA 3Q3SA 1XD7A 3F6VA 4IHVA 3P7NA 1OYYA 4DGWB 1K6YA 4ZH4F 1YX5A 1IN5A 5K7FA 4C3HJ 4RB0A 3F6OA 2A05A 4B3XA 1XCBA 3ECHA 1FOYA 3MKLA 3O8HA 5FJ8J 2OTJI 3E6DA 5FD5A 4ABZA 5HLTA 4B44A 2JRMA 5DS9A 2DTZA 1W36D 1G59A 1YW7A 2X6WA 3RPQA 5EZHA 4HEA2 3WTVC 1LEBA 3RCOA 5LRSA 1HOMA 5FB2A 2IXSA 3F21A 4L5JA 3ZR8X 1TLHB 1WZ2A 4Q4ZF 1QO0D 3FWEA 5KK1A 3A4CA 2IP2A 1R9TJ 3OYGA 2DQLA 2JSPA 2R92J 4DZJA 4A3BJ 3CCRI 4N4OB 2MBFA 3JRGA 3BJOA 3HPGA 5F0CA 2QM3A 1U9OA 2Q1ZB 2JUCA 1FIPA 5E3OA 1AKHA 1UB9A 3LAPA 4HZFA 1DDNA 2ZNYA 1O7LA 2E1MB 1G3TA 1Z91A 4RAGA 1SD7A 1Z77A 1RRJA 4XRMA 4CA0A 2STWA 5BPDA 4ZTFA 3WODF 3CC4I 2E2HJ 2GQQA 2FQ4A 2Z1DA 5J47A 4UY8I 3TEDA 3E6CC 3HSRA 3A03A 4XN0A 4XLAA 1GUUA 4BUPA 3GFMA 1ON1A 3ABMH 3IWZA 2H8WA 4QSHA 5TISC 3CESA 1VTNC 4YIRX 1LEAA 2O8XA 3CF5F 4CH7A 4DYRA 1BBYA 4HG2A 3JRCA 3TDUC 2BBYA 3JREA 3JRHA 3CMEI 2Y0SN 3FBIB 5C3EJ 2LKPA 4E7IA 4LFUA 1QNTA 4U88A 4JYKA 1VQ6I 4XKWA 2C6YA 5E20A 2QSFX 3C2BA 1P6RA 5CJ9A 2X0LA 1VQNI 4IXAA 1U2WA 4S05A 1TWHJ 1XB4A 3GLLA 2A69F 4CUGA 2R7OA 2ELKA 3OYMA 2IAIA 4XN3A 3T1BA 1TNTA 2FD5A 3S3NA 5EZGA 2ACJA 2A61A 4WWCA 1JGGA 2Q2EA 1MNMC 2ETHA 2IT0A 2B63J 3VYSB 2K9LA 3OOPA 1MBGA 5EGOB 4QLCU 1UG0A 2K4JA 1FSHA 3AG4H 2F4OB 2BVLA 2WBMA 2D2WA 2L9NA 5E8GA 1GT0C 2W82A 3WTTC 2UWMA 1R1TA 2G9WA 2ZBKA 3TW6A 5IP9J 4HV6A 3TDZC 1USSA 1FIAA 1EV7A 1G3YA 1W5CC 5LD2C 1B1BA 1N25A 2DT5A 3AG3H 2DA6A 1BJZA 2VJJA 3NAUA 3K2ZA 4D5FA 4BBRJ 4CCMA 1A5JA 1BW6A 1H0MA 3B73A 4UB8C 1U5TA 4XSZF 3HOTA 2ID6A 2OD5A 2VPLA 3HGYA 2DPDA 4CCNA 1TQMA 1ON2A 2M8EA 3CDIA 1KU2A 1ETQA 2W4SA 2FX0A 2YUSA 3IC7A 2HOSA 2HTSA 4G8XA 4HDVA 1D3YA 2PN6A 5LRRA 3TP0A 1GV2A 4M3BA 4CZCA 5HOOA 4N4NB 3LFKA 1FT9A 2LKXA 1D0XA 1IRGA 3K69A 4HRIA 2L54A 2E1OA 2MA3A 3QU6A 1APLC 4Y3OA 4U0VA 5ICGA 2F48A 2Q8KA 1IGNA 3I4NJ 1X2NA 4G9YA 4G6DA 1QA6A 2J5PA 2PMUA 4ZYEA 4UB6C 1D1CA 5CQEA 1MDMA 1ZQ3P 4AC0A 2NNYA 4D0PA 3ZMZA 5H6RA 1F36A 4A3KJ 3K2AA 1OYIA 1HW5A 3CD6I 1QPIA 3PSIA 1GXQA 2D5VA 5E1XA 3JW4A 1SVOA 3DLAA 3OYLA 1V55H 1G4DA 1I1SA 3CUQC 1DPRA 1MNEA 2OU2A 5L3FA 3R61A 2V6EA 1OYWA 2E35A 3G4SI 4KT5C 1J5YA 1W5SA 2EV0A 3HOXJ 4RLFA 2BVMA 4JK1X 1KYZA 4IVNA 2EFPA 1NH3A 3X2QH 4KN7X 5ERIA 5FKOA 4BAYA 1XGSA 5LEJA 1PUEE 4OMYA 1U9NA 5D4SA 1GXPA 4PK4A 1IUYA 2A5YB 4D9JA 1USTA 4GFBA 4JX5A 3OYIA 3ZQ7A 4HDUA 2ESHA 1MBKA 2QENA 3FK6A 3E6MA 5C4XJ 1VQPI 3ZQLA 3ZCOA 1JHFA 5F04A 2XPWA 2XAFA 3OS1A 1R58A 4PZJA 1I27A 2VUMJ 3F72A 2HKXA 2KDOA 1D5VA 4L0ZB 5F6FA 3PO3J 5M3FJ 3NRVA 3WG7H 4EJWA 2YX7A 5C4JJ 1O3SA 1JTYA 3MAJA 4B8XA 1T33A 3FMSA 3H9QA 2WV1A 3HRMA 4IX7A 3VYTB 5GAEJ 2Z2SB 4BXUA 3V4GA 1L0OC 2R5ZB 4DBRA 2K4BA 3HHHA 3OWTA 1UJ8A 2OC6A 2GXGA 4BL0B 5LEKA 3ULQB 2K3FA 3DBLB 2NOJB 2P8TA 2AS5F 1FP2A 2OQRA 4OWRB 3PNVA 2XGDA 3C3WA 1ZTRA 1FTZA 3ASNH 5LGNA 2MW8A 3HSEA 1YQAA 2QKLB 3L9FA 3ONQA 3BJAA 4JOMA 2JPBA 1AOYA 2W85A 2M45A 4D7MA 5EJCA 4RGRA 3ISPA 1LNWA 2V1NA 3BCBA 1OR7C 3PFYA 4EV0A 1O4XA 2JA6J 1FYLA 2W24A 3DU5A 4M74A 2FE3A 4WCGA 4I6ZA 2VBYA 4EATA 2XAJA 5D4RA 2YSRA 3HOZJ 4E7ZA 2VE8A 2EV6A 5FKNA 1T08B 1FYMA 4LIUA 4A5MA 1YI2I 3OV8A 3RYPA 3CCQI 4ANJA 2OZ6A 1K4TA 2P5LC 3MEXA 4CCOA 2ISZA 4A12A 2DODA 3QP6A 3CLQA 1S6LA 1Q1VA 4N9IA 1PP8F 2BOLA 4F91B 1T38A 1FLIA 2EIJH 4ZDLA 3B6CA 3TBIA 2ZXJA 4CYCA 3TO9A 2AXTC 3LA7A 1VQ5I 3C1DA 5F1RA 2W1OA 5E1ZB 1ODDA 4DZPA 2YPRA 3DEEA 4ZYHA 4C30A 3IKVA 2LP0A 1FZPB 4BHPA 3W3CA 3BG3A 2R7VA 5LHHA 3RZDJ 1S29A 4WX9A 1MJBA 1T39A 2QA4I 1BI3A 2E5ZA 4AD9A 3WGIA 2DFIA 5J6XA 3FXQA 2KIFA 2K9NA 4B3AA 3IRRA 2VT2A 2QQAA 4G94A 3VPRA 4KYWA 2XVCA 2AXLA 3MZYA 4WXCA 1IN7A 2LF8A 1G3SA 5JI6A 3Q9SA 3ZMTA 2BY3A 3CMYA 2UXNA 1MBEA 2KIUA 2DOFA 4BNCA 3R60A 2CQNA 3CP8A 3OOUA 1FBQA 4G7OF 5BOXA 1KU9A 1IXSB 3R6SA 1ETVA 5DD8A 3M8FA 1WI9A 2XGEA 2EQRA 1P4WA 3G1LA 3BDDA 1RKWA 1Z6RA 2P4WA 2K27A 3H5AA 3TL4X 1WJAA 4BHCA 1LFBA 2CG4A 2Z3YA 1K61A 3V8KA 4M9ZA 3VYUB 1S7OA 1N78A 3KE2A 4U0YA 3OYAA 3QPLA 2VKEA 2EV5A 3OSFA 4B4CA 2AQEA 3ZMVA 5J4YA 5DV5A 2KIQA 2STTA 1Z67A 1LJ9A 2L2OA 2RV8A 3F3XA 4C2MJ 2HQAA 3DBRB 4FETA 5DEQA 4QWQA 2LLKA 4CSWA 5E3MA 5EG0B 2DMUA 2M5WA 2VT3A 4OIQF 4HNVA 2O0YA 1FX7A 1WVRA 1KA8A 2HOAA 5EF6A 2M0CA 2H6CA 4XORA 1GLNA 2E19A 3HUGA 2AO9A 4LLNA 3I59A 4IQJA 4GDFA 5D6FA 1ZR2A 3L7WA 4IO9F 1X4PA 3I71A 4EGZA 1X58A 1R1UA 2HKOA 3S1QJ 2ZFUA 3CCVI 1SD5A 2EJRA 4ENKA 2HXOA 3D5RC 4JQFA 2A3SA 1QZYA 3ABLH 1FNNA 2CW7A 2FF4A 1UAAA 3ZN1A 2L4AA 1ZG1A 3S14J 1U6GA 3HTUA 2MLGA 1MSEC 4A2UA 4J01A 2R7ZJ 1BA5A 3ZQIA 4AIDA 1X19A 2NNNA 3OYKA 3KP3A 5E1WA 3RQIA 4U7DA 2EZHA 2IS4A 1ETWA 4M3FA 5CVJA 4I76A 1U0JA 3A0HC 2GA1A 2QF7A 2ZKZA 1XGMA 3JRIA 1SC7A 4IRHA 1S7AA 1JUPA 1V5GA 1K6OA 1IF1A 2DA1A 5D8LB 2WY7Q 2NVYJ 3MCZA 1ZRDA 2PMZN 2HDDA 1RUNA 3VWBA 2RREA 5JR3A 2KRHA 1P2FA 2DA4A 4HX8A 1W0TA 4MQ9F 2FRHA 4PJJA 1VNDA 2HQ5A 1BI0A 1QVUA 2XSJC 1O7FA 3K4CA 4GRIA 3GBGA 1DQUA 2CFOA 2V4JC 4HLYA 4N0BA 2PBIA 3OYFA 3U1DA 2VKDA 2FBHA 2H1KA 5EYRA 1BR4A 5HDKA 2BY1A 2KKOA 2KL4A 5J3LA 1I39A 4D7NA 3IRQA 1FWZA 2M7AA 3H92A 2UZKA 3K1NA 2HYGD 5H2FC 3DV8A 3G1OA 3MKYB 4UVBA 1MH4A 3VSKA 3JTGA 3KZZA 3EETA 2OAZA 4NHJA 2VPRA 3Q0VA 4MLOA 3ZP5A 3ESWB 1BIAA 5CVRA 3L00A 1ZG3A 2VBXA 2F4MB 3HDDA 2M0MA 2QEXI 2CV2A 2DLLA 1U8BA 3BG9A 4P9FA 1TWFJ 1YYVA 2EBIA 1WQ2A 1ZRFA 3GTOJ 3S1RJ 1H89C 2Y0MA 2JA5J 4IHSA 4HX7A 2IGMA 3SZPA 1PVEA 1KYWA 3LWFA 1I6HJ 1ZELA 5F0HA 4PCQA 1DP7P 3HUGB 5H6QA 3I4MJ 3WTUC 4RMNA 3LSJA 2BZTA 2B0LA 1JHHA 3HTSB 1LVKA 5LHGA 2CSOA 2VLAA 3QPTA 1OCCH 1BR2A 2OA4A 4XKCA 4A0YA 4U7BA 2H1LA 2QSHX 3W6VA 2M7BA 1TWCJ 3S15J 1HW2A 2X51A 1WJ5A 5CYVA 5ICCA 1D8JA 4BQQA 2JJ7A 2WWYA 1H9GA 2VXDA 1S8NA 4XKBA 4BXXJ 3OYCA 5FFXA 5BQTA 1V3FA 1LE8A 2Y30A 3DTEA 5GADJ 5ED4A 3NARA 4LB6B 2E36A 1OFCX 2XUBA 4OINF 3CCUI 2P6SA 3IWFA 1DU0A 3R0JA 2HOEA 3TKYA 1D1BA 4M72A 4O6JA 5CQGA 4B09A 3K70D 1RKTA 1UHWA 3B02A 2KLOA 4EM0B 1YS7A 4NB5A 4ZTJA 1K4SA 3CCMI 1WH5A 2H8RA 3S17J 5J8FA 2IGOA 2R93J 4MTDA 1P7IA 3PIOF 5LFAA 3CCJI 1R1VA 4I0BA 3LA2A 3KLNA 5KNLA 3DEWA 3I55I 2QYOA 3K7AJ 3GCMA 1TL8A 4RBOA 4BXFA 3HG9A 5E79C 4PGHA 4X0GA 2XRLA 4A69C 1D1AA 3CCEI 1YJNI 3SFIA 1ENHA 3R4KA 4A3JJ 1EH7A 2V1DA 3WU0A 4BQNA 1TT0A 5IOYA 3S2HJ 3FZVA 1SMTA 2IRFG 3GZ5A 1F1ZA 2CQXA 2E71A 1OMIA 4HQMA 1MJAA 3E97A 4AVPA 3GYHX 3V42A 4OIPF 4C2UA 5TGTA 4MNUA 1A36A 2EZIA 3KIOA 3UKGA 1YJ9I 4DIQA 1WFXA 3H0GJ 1RESA 1EA3A 1X3ZB 2A68F 1RIOH 1TNSA 2HR3A 2F6CA 3TP3A 4M9XA 2A6EF 5AIPA 3HOSA 1IDYA 2QQBA 2UUZA 1T2KA 4RM3A 2L3DA 3RKQA 3SYTA 2DFFA 4C9YA 3D1NI 2HYJA 3PIPF 2PLYA 1X3UA 5F0FA 4RGXA 5EGOA 1OR7A 3DKXA 1MKMA 1RC9A 4XMYA 3L09A 2YU9J 1ETOA 3BR1A 3HKZN 4NBQA 4BQOA 2V1XA 3FK7A 2XAGA 2DW4A 2HOTA 2NS0A 1EF4A 4UV8A 1ZAOA 2M1BA 1ZG5A 1ZR4A 1JUSA 3P9KA 3HOUJ 2PMZA 1X1BA 1LE8B 3CUQB 2GOXB 2DA2A 5LLQA 5FKMA 5FO5A 3BG7A 1Y0UA 2DYRH 2KQRA 3GFIA 1TZLA 3JRBA 2GLOA 5EEHA 2OV7A 3FF5A 3O3KA 2XAQA 1JT0A 3E1SA 2E34A 3SFZA 5IP6A 3Q5FA 2XAHA 4D5CA 1SFEA 4WF2A 2KT0A 1JKPC 2OTLI 2Y9YA 3QYFA 1Z6TA 3BROA 4AWXB 4PJNA 4PUSA 2TCTA 3CCYA 2VJ4A 4W97A 5J8CA 2A07F 3IH4A 5K7ZA 3VB2A 5HDNA 2JA8J 3W2WA 4XR6A 4RAZA 3HYIA 4G6QA 4IJAA 1OCOH 3BWGA 4E7HA 2I8DA 1O3RA 2Z33A 1E0EA 3H9GA 3KX2A 4LD5A 1IN8A 4I2OA 1IJWC 2WC2A 1E3PA 4ZYGA 1FC3A 2M8GX 3L1PA 4EJTA 1UMQA 1WJCA 3OYDA 2XAUA 1P7JA 5KVRA 2VKVA 1R71A 3F8FA 1I50J 1YW9A 3BCAA 3FX3A 3I0TA 4XICA 4I01A 2XGXA 4DQ2A 3DQVC 2COBA 1YX3A 1B72B 4IRIA 3BR5A 4OIRF 3MKZA 1E3OC 3DKYA 3REOA 4EM2A 4FCYA 1PP7U 5J40A 3JTHA 2LSOA 5DCFA 4KFCA 1JUMA 5DM7F 4XSXF 4B43A 2VJIA 1Z7LA 4PJMA 3BJ6A 4P96A 2EA4A 2B7EA 5CLSA 2V6CA 1FJLA 2DI3A 3MKWB 1YRNA 3TW7A 1WI3A 2F5FA 3PQJA 3LSGA 4E7SA 3GEZA 3WHBA 5CKTA 1R36A 4KITB 1Y8RB 1J0RA 2KRFA 1BOBA 4P5OA 3L2QA 1R4NB 2X4HA 5ILUA 2XGCA 1Y1VJ 1UHMA 1MNDA 3PQKA 4KNYA 2OPTA 4DOZA 1ZGAA 3M8JA 4L9VA 1YO5C 4H0EA 2ZMEB 2W48A 4Q47A 2DOAA 3FMQA 3GTPJ 1VF9A 2CUZA 2JVGA 1GVJA 1WJBA 2HXIA 3HB9A 4CICA 2JZYA 2PEXA 4HF0A 2ZSIB 3GZ6A 4QTRA 3CDLA 1QZZA 1QRYA 2GIVA 1YLFA 3FXKA 4AYBN 1KONA 2R5ZA 5IYBJ 4GCVA 3WG9A 4YIIA 2DQRA 2XB5A 5J1UA 5IYDJ 2DO7A 3FXMA 3LSIA 4EJUA 1I1GA 2XDVA 3COAC 3P5JA 1QVTA 1Z0XA 2W84A 4NC7A 1T56A 4KMFA 3CUOA 2QZ8A 4G7ZF 4G6TB 1MMAA 4EMSA 3A01B 2CO5A 2DMNA 3FMRA 4XOPA 4RAYA 1WKMA 2EILH 5GTIC 4KISA 1W4MA 4PSXA 1YOVB 4Y33A 4UNOA 3FISA 1HA8A 4A3LJ 3JAMK 3QRFF 5GP9A 3AG1H 2FBIA 2K5CA 2QQ8A 2WA0A 2YU3A 3TOAA 3CLOA 4B1RA 1DGRM 1QHHD 3H3ZA 5F08A 3S8PA 2COMA 3IL2A 4R8HA 3J7AY 3J7AO 3V7SA 1WGXA 3GFJA 5M5WJ 3CTAA 2CMPA 2HPIA 4LMYA 2RQQA 2LBFB 2XF7A 1RR7A 1YITI 1G2HA 1T8IA 3CJTB 4F3QA 4K2EA 3F8MA 5HDGA 3M07A 4EEFG 3H3UA 2LMDA 4HQEA 2R7TA 4FT8A 1A6IA 1S7EA 3HRTA 1QU3A 1V5FA 5DDGA 4LG0B 2GXAA 5FFZA 3I3LA 1IG7A 5H20A 1YRNB 1F9NA 2FNAA 3WE2A 3LFUA 2KZVA 1WJFA 1MGTA 4MO7A 4F7ZA 2VOPA 3OYNA 5HVQC 4YG2F 4FHTA 1BL0A 4JBAA 1HF0A 2GAUA 4LLGF 4XK4A 1QGPA 2DN0A 3DPUA 5B66C 3L2RA 2PJRA 3JSPA 3ZQFA 3RKYA 4UUSB 2BHYA 3OL3A 3I4PA 2D1HA 3I58A 5D6EA 1HBXG 2ZXIA 1W36C 1SFKA 4P1WA 4YIFA 1TQPA 2K9SA 2XIGA 3EQLF 1YW8A 2BEOA 4JX4A 2UV1A 5ICFA 1TW2A 3T0YA 1T0FA 3PFIA 4ZDOA 2ZSHB 2CRGA 1T98A 2XHKA 5KAIC 4UHTA 4A3MJ 1U8RA 4E4HA 3OIPA 1NG7A 3J80Z 2H27A 2IS6A 5F64A 1KQ0A 2FQ3A 2WB1N 5K5QA 3ABTA 4EM1A 3IAS2 1ERDA 4LLLA 4HYEA 3SDBA 4BGDA 4NUBA 1K7AA 4UUTA 2O3FA 1HCRA 2JQ7A 2LH9A 3DPLC 1Y6IA 2DU9A 3ZGKA 3I5UA 2Y0SA 2MH9A 4DW6A 3LSPA 3FBNB 1PUFA 2DCEA 1BC8C 1W7PA 4BEHB 3HL2A 3QQAA 1ZYRF 2XC7A 4ZYAA 3QOEA 3VFZA 3OIOA 2GA2A 4AIHA 3DTKA 2P7CB 4CGZA 1LVAA 2WAQN 3ZOBA 1S72I 1BI2A 1RI7A 3K4KA 5FGMA 4YFXF 3VEPA 3S2DJ 2L02A 3BPXA 1S3JA 5EG0A 3L2VA 1R4MB 2M4KA 2G7UA 3T5XA 1TT5B 4XRSG 2ELHA 2ZO4A 1XSVA 5BMZA 1OCPA 1RPWA 1U78A 2ZMEC 2GWRA 4IHXA 1XMXA 1PYVA 1X1DA 2R7DA 1UFMA 3CO7C 1VQKI 2X6XA 2IJLA 1U3EM 4II3A 3PNTA 2Y75A 2DMTA 3BT9A 2HPMA 1G3WA 1SD4A 3KP4A 3F22A 4ESFA 3ZQQA 4PDKA 5M5XJ 4Y13A 2F5VA 3V8JA 2X6YA 3HGGA 3T8TA 4V19K 1MMGA 4UXNA 1HSTA 3H5NA 5EEAA 4ESJA 2O9LA 2KZGA 4M6VA 3HJEA 3MN2A 4MIMA 1VFCA 2PJRB 4I99C 3I54A 2VQLA 4BH9A 3K4NA 1TC3C 3JRFA 2L4MA 3WTSC 3S3MA 1ETYA 2V79A 3GMEA 1SANA 3FXRA 4IHYA 1ZARA 5DUIA 3NEUA 1LPQA 3TGNA 1A04A 3WTWC 2HVRA 3PO2J 3VODA 1OPCA 4O3MA 1HW1A 4YELA 3KP5A 4OAYA 3FM5A 2H6BA 2PQ8A 1ZKGA 2VL8A 2CU7A 1YJWI 3JCUC 4EQQA 1OKRA 3LSHA 3K4BA 4AIKA 4ENNA 1MMDA 2KRCA 4A93J 2V9PA 4Y17A 2OQGA 4HBLA 2EPFA 3DWLE 4II2A 2HTJA 3I56I 3BTJA 3ELKA 1IUFA 3R0AA 3KEOA 1S5LC 3ABUA 2EFQA 4A3DJ 3DFGA 2JSCA 1FEXA 3BY6A 2EINH 4EVIA 2PX9A 1PUFB 5IT3A 1J2XA 3QYEA 1W7PB 4EGYA 1JE8A 1GDTA 3L2UA 3LSTA 3OS2A 4BACA 1HKTA 3E0JB 5JHUA 1R5GA 2VASA 2VXZA 5BNGA 5L3EA 3VYRB 5E8IA 3GFLA 9ANTA 2EA2A 2IPQX 3E7LA 2UXXA 4XOTA 3K1MA 4PGGA 1I3AA 5FKLA 2X85A 3BTLA 4IEJA 3A2KA 5GAGJ 3PUBA 2R7XA 4HV5A 2CFXA 1MD0A 2M4GA 3CDHA 1ZRCA 3KEYA 4GXOA 3E5XA 5K1YA 2HNHA 4AU7A 1IZ1A 1SAUA 3S1NJ 5BPIA 5JLWA 2O5RA 3ECOA 2O6GE 2FU4A 5IY5H 5IT9K 2V1UA 2EIMH 3AL0C 3MZHA 1BJAA 4V2GA 5FRNA 4M3DA 2ZNZA 3MVPA 1CF7B 5TRDA 2FOWA 2AHQA 2HQNA 4A3EJ 4CHUA 4P55A 4OU0A 1JJ8C 1TWAJ 4RB2C 1U5TC 3ERED 3CZ6A 2BW3B 3S2WA 4HX4A 2ZXWH 4HPQA 3M8EA 4CO8A 2IW5A 4DYQA 5IP7J 1XGOA 3KYCB 2CW0F 2E60A 2MABA 5B3SH 2RC4A 4FASD 3GO5A 2QKMB 1LQ1A 2QVOA 3GXOA 2CGPA 3GZNB 4DBQA 1VQ7I 1SVMA 3O8GA 1Z7UA 2NS8A 3H0DA 1HDPA 4HSRA 1IW7F 1WJEA 4ZZDA 3WU2C 3K9TA 5FLXK 4YEJA 4XLPF 3RZOJ 2H94A 2HZDA 2LK2A 2FEZA 3HEFA 1VQLI 2VE9A 3CJQB 3NWTA 3PM1A 1Y8QB 2RKHA 4TV7A 3TMOA 1IXRC 1JKRC 1OQYA 1IDZA 3CP2A 2HWVA 1ZN2A 2NVTJ 1XDUA 2EH3A 1FY7A 3JAMZ 3WTYC 1XSDA 3LA3A 2KJCA 4AIJA 3W2VA 3IKTA 2LREA 2R5YB 1MBFA 2HGCA 2OCCH 2KDZA 2X1CA 5D8KB 2CJJA 4WXDA 1ZLJA 3JRAA 2JMWA 4E7LA 3SZGA 2K7LA 4G7HF 3FKIJ 1TP4A 4XONA 2HFHA 5L3DA 2D45A 3E6BA 2R3SA 2DFHA 5LGUA 3RI4A 1RZ4A 4XLCA 2MC4A 3KPHA 1X1PA 1YIJI 4YFNF 1B6AA 3ZPLA 4XIDA 1WWXA 1HDDC 3T8RA 4HF1A 4M6XA 1OCTC 3HRSA 2F5CA 4M71A 4FTHA 2GBYA 1MBHA 4M3GA 2R7SA 3GLXA 2VIXA 2ZJ2A 2HVSA 2KJBA 2ZCWA 3WTZA 1ETKA 1STZA 1ZGJA 2CH0A 4OOIA 4HAMA 5J1YA 2DFEA 1YS6A 2VBWA 4KMUX 3J81K 1D5YA 3CUQA 3SEZA 3SHFA 2YX4A 4I0AA 1JGSA 1JI8A 2K9QA 1Z05A 2Z16A 2L9VA 2BY0A 3ABKH 1O3TA 2DPUA 4IQ4A 3HOVJ 3FKJA 2BXZA 2XKOA 4BU2A 2CV0A 2WTEA 3D5LA 1FOKA 1OJLA 3Q0UA 4BYYA 2L9SA 3J80K 4A5NA 2EFNA 3U21A 1R23A 4J00A 1Z3YA 3OSGA 3LNQA 3SJMA 4HA8A 4RM2A 2DAOA 2BXYA 1XG1A 2DMQA 3LSKA 3Q0WA 4XLEA 2DBBA 1FYKA 3D0SA 3IH2A 3TO7A 1MJ9A 3KP7A 1FOWA 3M9AA 3OR1C 3P9CA 4BE2A 4FE7A 1VI0A 3BQZA 4L9TA 3UNGC 3H36A 1OCRH 3GTJJ 2LY9A 2M9HA 2IA0A 3E5UA 3DBHB 1J09A 1FPQA 1AA7A 2EZLA 4A3CJ 3BTIA 4DNCA 3EDPA 3EUAA 1BR1A 1POGA 5LHIA 2BYVE 2LR8A 3O6BB 2ESNA 3KYLA 3J7ZI 3MWMA 2LY2A 1B9NA 4RB1A 1MIJA 2NOGA 1Y39A 2DXIA 4A0ZA 3BQYA 1LFUP 2IGKA 3IHUA 2GXBA 4F93B 5E17F 4F92B 2FMYA 1B72A 2VQGA 2CWEA 5GPAA 2XKPA 3U1KA 4RGUA 3BTCA 2NXNB 5A2QK 2R7QA 4L9JA 1WRJA 2K9MA 4BS9A 4F55A 1KU3A 2MFZA 2RNGA 3O2PE 2EFWA 5EDNA 3OYBA 3EUKL 2A6TA 5DYMA 3ROUA 4L18B 1H88C 1R7JA 2CQ7A 1Y56A 2F5EA 2W57A 1PDNC 2P5VA 4I09A 1A35A 1G8XA 3A0BC 2X1EA 3DEUA 1D0ZA 4ASNA 4RDUA 3WU1B 2O7OA 1N77A 1VQMI 3EYIA 1E2XA 2RQPA 3TOBA 2MYSA 4GO1A 5DUKA 2L0KA 4BHBA 4HNTA 1UG2A 2Z99A 4XLNF 4BE1A 1ITYA 1AHDP 2ZMEA 3W6KB 4UV9A 5DM6F 2IVMA 3PNYA 4V2FA 1IC8A 4A3FJ 2AQFA 2OZUA 4ITVA 1VQ4I 4E7KA 4LITA 4O5VA 2PFBA 1J59A 1L3LA 2GOMA 3HC7A 4LJZF 3SEQA 1YHQI 1IN6A 1UHSA 2P0WA 4XBFA 3G6EI 2QBYA 1NHAA 2PMHA 3K6GA
chains in the Genus database with same CATH topology
3CCEI 1YJNI 1YITI 3CJTB 2FOWA 1VQPI 1ACIA 4V19K 1FOXA 5DM7F 1FOWA 2ZJPF 1YJ9I 5GAEJ 1FOYA 2OTJI 1HC8A 1VQ7I 3CC2I 2K3FA 3DLLF 2QEXI 1MMSA 1YJWI 1VQ8I 3PIPF 3J7ZI 1Y39A 5JVGF 1VQLI 3CCRI 4IOCF 3I56I 1VQ9I 4IOAF 3J7YJ 2NXNB 1QA6A 2JQ7A 4IO9F 1YI2I 3CCQI 3CCVI 3CC4I 3CD6I 5GADJ 4UY8I 2E36A 2E34A 3CCUI 2OTLI 1S72I 2H8WA 1VQMI 1YIJI 5GAHJ 3CF5F 2E35A 3G4SI 3CCMI 5GAGJ 1VQ5I 3CMEI 5DM6F 3CMAI 2ZJQF 3PIOF 1VQ6I 3CCLI 3CCJI 1VQ4I 2ZJRF 3I55I 3G71I 1VQNI 1YHQI 1VQOI 3CCSI 3G6EI 2QA4I 3CC7I 1VQKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE I;  1YJN I;  1YIT I;  3CJT B;  2FOW A;  1VQP I;  1ACI A;  4V19 K;  1FOX A;  5DM7 F;  1FOW A;  2ZJP F;  1YJ9 I;  5GAE J;  1FOY A;  2OTJ I;  1HC8 A;  1VQ7 I;  3CC2 I;  2K3F A;  3DLL F;  2QEX I;  1MMS A;  1YJW I;  1VQ8 I;  3PIP F;  3J7Z I;  1Y39 A;  5JVG F;  1VQL I;  3CCR I;  4IOC F;  3I56 I;  1VQ9 I;  4IOA F;  3J7Y J;  2NXN B;  1QA6 A;  2JQ7 A;  4IO9 F;  1YI2 I;  3CCQ I;  3CCV I;  3CC4 I;  3CD6 I;  5GAD J;  4UY8 I;  2E36 A;  2E34 A;  3CCU I;  2OTL I;  1S72 I;  2H8W A;  1VQM I;  1YIJ I;  5GAH J;  3CF5 F;  2E35 A;  3G4S I;  3CCM I;  5GAG J;  1VQ5 I;  3CME I;  5DM6 F;  3CMA I;  2ZJQ F;  3PIO F;  1VQ6 I;  3CCL I;  3CCJ I;  1VQ4 I;  2ZJR F;  3I55 I;  3G71 I;  1VQN I;  1YHQ I;  1VQO I;  3CCS I;  3G6E I;  2QA4 I;  3CC7 I;  1VQK I; 
#chains in the Genus database with same CATH topology
 3LL7 A;  1K83 J;  3ML6 A;  3V7R A;  4F52 A;  2V9K A;  2E1N A;  2I5U A;  3SZT A;  4OAZ A;  1BM9 A;  4FIS A;  3A1Y A;  4RA2 A;  2E7X A;  3QAH A;  2CS3 A;  4MFE A;  3HOW J;  3I64 A;  1YTY A;  2NAZ A;  3OMY A;  2K3P A;  2LY1 A;  3SXY A;  3A01 A;  5EEG A;  3U2R A;  4JX6 A;  5FKK A;  3CMM A;  2MC3 A;  2V7F A;  3JRD A;  3C18 A;  3V7C A;  2M87 A;  2HDC A;  1J75 A;  2P5K A;  3H1C A;  3PSF A;  2E5N A;  4MQV A;  2ECC A;  4MEY F;  1XN7 A;  1SVL A;  1AU7 A;  5LBQ A;  1JT6 A;  2XSD C;  5TJJ A;  4HST A;  5F1J A;  1IRX A;  1XCV A;  1OIS A;  2ZC2 A;  4MGR A;  3QOP A;  2JA7 J;  5J4V A;  1IRF A;  2WAD A;  1JJ6 C;  2NVX J;  3QP5 A;  5KAF C;  5M3M J;  2LBF A;  1S9H A;  4NC6 A;  5L3G A;  1MMS A;  5FD6 A;  2ZXH A;  1O3Q A;  2LF7 A;  2VC0 A;  4NQW B;  3MFK A;  1P4A A;  3F8C A;  3KZI C;  4BBS J;  3FXU A;  2NVU B;  3L2C A;  2HU9 A;  3OY9 A;  1REP C;  3EYY A;  1SD6 A;  2BE5 F;  1WJD A;  2E7W A;  4LG0 A;  3OYH A;  2PJP A;  2F5D A;  1TBX A;  3G1M A;  2RVC A;  3FM3 A;  1DGW Y;  1LDD A;  3HSF A;  4C3J J;  1R22 A;  4CDG A;  2QWW A;  5M5Y J;  1QPM A;  4BQA A;  5IT9 Z;  5F27 A;  1FTT A;  3E5Q A;  2DT6 A;  3RPU A;  1FMV A;  1C0W A;  3Q9V A;  2JN6 A;  1RR8 C;  3S1M J;  4UUS A;  3LSM A;  1BIB A;  1DP3 A;  4BJ6 C;  3DKW A;  4I02 A;  2ISY A;  4CCL A;  2DA3 A;  3BZK A;  3LMM A;  4NDL A;  1B59 A;  1NK3 P;  1WH7 A;  1XTA A;  3BR0 A;  3SQN A;  3ZMU A;  4ETS A;  2MH2 A;  4GYI A;  5HS7 A;  2R4G A;  5HOD A;  4A0X A;  1IRZ A;  2A6H F;  2X48 A;  2QQ9 A;  2R7U A;  3HHG A;  1HQC A;  3BLY A;  2MSY A;  3CMA I;  2EK5 A;  4Y52 J;  3K70 C;  4P9U A;  3FXJ A;  2EZK A;  4RB3 C;  5JFR A;  3CCL I;  1NTC A;  4X1E A;  1J7K A;  2QBY B;  1SFU A;  5ILV A;  1WHU A;  1NG6 A;  2K86 A;  2E2I J;  1ETX A;  2FUG 2;  4S0H B;  4KDP A;  3S16 J;  3I9V 2;  4LOC A;  4Y15 A;  5J1R A;  3CC7 I;  2F2E A;  4ZC3 A;  3KET A;  1ZH5 A;  3FHN A;  5FLX Z;  2CV1 A;  4BEH A;  1Y1W J;  4QPO A;  2L7F P;  2X1D A;  5ICE A;  2PI0 A;  3AG2 H;  2CQK A;  2LTP A;  3PJR A;  4HF2 A;  1R6R A;  4XNF A;  2RDP A;  3GVA A;  1MZB A;  2XRO A;  2QLZ A;  1XGN A;  2VJ5 A;  3P9I A;  1FOX A;  1PJR A;  2ZJP F;  1AKH B;  3K4L A;  1WSU A;  2ZB9 A;  2XPU A;  2DK5 A;  1HC8 A;  1D0Y A;  1Y0N A;  2IBD A;  2LOO A;  4ZYD A;  4MTE A;  3HKZ A;  2K02 A;  4HNU A;  4CCK A;  1Z21 A;  4X6A J;  4XRF A;  1XMK A;  2L7K A;  1X2M A;  3FDY A;  4XRS A;  2IS1 A;  3HOY J;  2GIZ A;  1P4X A;  2GM4 A;  1TWG J;  3MD2 A;  1H8A C;  4PJ0 C;  1YFH A;  3QPS A;  3RPU D;  5DTD A;  1GVD A;  3L2W A;  1GHC A;  1R5I D;  3AAF A;  3HRU A;  4B48 A;  4JP0 A;  2LNB A;  2JUG A;  3ZXS A;  1YIO A;  5JLX A;  1VQ9 I;  2IA1 A;  4ZDP A;  3G2B A;  3WHC A;  2XV4 S;  3J7Y J;  4YFK F;  5D5U B;  1YG2 A;  3W2A A;  4YRV A;  2CUJ A;  2IGN A;  3RYR A;  3GW2 A;  1B8I A;  2E1C A;  3ZRG A;  3B6A A;  4IL6 C;  1MBJ A;  1UCR A;  2LFB A;  3J81 Z;  4DJA A;  3M3Y J;  2JPC A;  4ON0 A;  4J19 A;  3QOD A;  4PSW A;  4I7H A;  4PFO A;  2Q2E B;  3OIQ A;  3N05 A;  1OCZ H;  3N97 A;  4XM3 A;  4IHW A;  4KIC A;  3GF2 A;  3K4M A;  5FRM A;  2DOE A;  4G12 A;  2E1M C;  3N4M A;  2Y31 A;  3E3V A;  5GAH J;  2DK8 A;  2L7Z A;  3AL0 B;  2X9D A;  3ZQG A;  4BDZ A;  1JXS A;  1IV6 A;  1TQI A;  3QWL A;  1EH6 A;  1MSF C;  4OMZ A;  5AIQ A;  1XDS A;  2ELJ A;  2HVQ A;  1F5T A;  2XF6 A;  2RN7 A;  4H4K C;  3IAM 2;  2FSW A;  3G71 I;  2L5Q A;  2VOO A;  3JSO A;  1LFP A;  1U5T B;  2YS9 A;  1Q1H A;  2G0E A;  4BJ5 C;  4I98 B;  4FX4 A;  1X4O A;  3ZQC A;  4ZZL A;  3F8B A;  4Z6Y A;  1ZRE A;  4BY1 J;  4L5E A;  2XF5 A;  3RKW A;  4WK8 F;  3RKX A;  3KP6 A;  4RS8 A;  2LC2 A;  3OYJ A;  4C3I J;  5D5W B;  2NYX A;  4U87 A;  2CQQ A;  5IYC J;  3EUH C;  4QIW N;  2R7W A;  1KQ8 A;  5HS8 A;  3FIW A;  3H9J A;  1RUO A;  3V8L A;  5A2Q Z;  1AWC A;  5FLV A;  1RNL A;  3LSR A;  1HLV A;  3CO6 C;  5IPA A;  4XLF A;  1XC5 A;  2OBP A;  3GTK J;  1MDM B;  1YE9 A;  3CF2 A;  1K78 A;  2X6O A;  1KZH A;  2O61 A;  3GTM J;  2IEK A;  1V4R A;  4PFP A;  5HLI A;  2E2J J;  1IAW A;  2OJE D;  2VI6 A;  5BS6 A;  1R49 A;  5KHD A;  2VON A;  2TDX A;  3IV5 A;  2XPV A;  3NWS A;  1FMW A;  1CF7 A;  2LKS A;  2W7N A;  4AYB A;  2B9S A;  1UZC A;  2Y69 H;  2ME6 A;  1IN4 A;  2DJI A;  2KP6 A;  6PAX A;  3M1C A;  3G73 A;  2FJ1 A;  3BG5 A;  4IOC F;  4E6K G;  1B8I B;  1XSX A;  1TW3 A;  2BW3 A;  4W1U A;  5CVV A;  1SAX A;  2QGU A;  2RNJ A;  4A6E A;  5K7H A;  2GZW A;  2G7H A;  1F43 A;  2LVS A;  3S93 A;  2Y2Z A;  2DA7 A;  3DU6 A;  1N75 A;  3IH3 A;  4HW0 A;  1W0U A;  1VZ0 A;  2FA5 A;  4BDY A;  1FBU A;  4KIG A;  2Y48 A;  3ASO H;  1QBJ A;  3S32 A;  2JWT A;  5AON A;  1K79 A;  4KUM A;  2DDB A;  1W7P D;  2PG4 A;  4PJL A;  4Z2Y A;  5L3B A;  2O8K A;  2HDW A;  4XL9 A;  2VOD A;  3DTI A;  2CUE A;  5HNF A;  2RGV A;  4S04 A;  3OR2 C;  2F4I A;  4CCJ A;  1V54 H;  4NNJ A;  1NK2 P;  4Q5S F;  3QPH A;  3RJP A;  2FML A;  3DCF A;  4C2T A;  3VOE A;  2LD5 A;  2J5O A;  2LG4 A;  5HNH A;  2HQR A;  4A6D A;  1IXC A;  3A02 A;  3FXL A;  1HXD A;  4RAF A;  2DMP A;  3S3O A;  1P9Q C;  5C44 J;  5DD4 A;  3MZ8 A;  2ZJR F;  1KU7 A;  3OL4 A;  2R5Y A;  5GPC A;  4U0W A;  3H5R A;  4IHT A;  2VQC A;  3GTQ J;  1VQO I;  2IA2 A;  1E3H A;  4KJZ A;  3I53 A;  4MFD A;  3HZJ A;  4LK1 F;  5DCM A;  2OUM A;  5B1B H;  1FBS A;  3KP2 A;  2M34 A;  4M6Y A;  4Q48 A;  3UR3 C;  3ZMD A;  3ZMS A;  1LB2 A;  2TRT A;  3ERM A;  2K85 A;  2FNP A;  1B9M A;  2QSG X;  2LDU A;  3FXO A;  2ICW G;  3KZY A;  3RIR A;  4MHG A;  4ENM A;  3ZQH A;  2KMU A;  1ZHF A;  4FE4 A;  3NQO A;  5D5X B;  2BV6 A;  4IF4 A;  4FQG A;  3M4O J;  1QZE A;  1K78 B;  3C2G A;  5HLH A;  2YR2 A;  1P92 A;  1ZK8 A;  2P81 A;  4BY7 J;  3BP8 A;  1E17 A;  2M30 A;  3DP7 A;  2EWN A;  2CYY A;  4B47 A;  1X3W B;  5CPR B;  4UVC A;  4BKX A;  1W5T A;  3WE3 A;  2RAE A;  2Z5U A;  4CZZ A;  1A31 A;  1EJ9 A;  3CC2 I;  2WB1 A;  5CVU A;  1LUJ B;  3DLL F;  3LAJ A;  2FBK A;  3RSN A;  4L5I A;  1Z9C A;  3W6J B;  3K10 A;  5K5R A;  3BG6 A;  2DYS H;  3OYE A;  4XQF A;  5B1A H;  1I6X A;  2FXA A;  3LQR A;  3GTL J;  1BI1 A;  1IV8 A;  1UEL B;  2CUF A;  5K5O A;  1XMA A;  5JVG F;  4AVZ A;  4IRG A;  3C7J A;  3HBL A;  2O03 A;  3H35 A;  4CYC B;  1BOA A;  2KFD A;  4RGS A;  4IOA F;  3KFW X;  4LG3 A;  4MEX F;  2IS2 A;  3F0C A;  3TQN A;  1SMY F;  2P6T A;  2W00 A;  1OLT A;  3SDG A;  2WAQ A;  4R1H A;  2K40 A;  4IPA A;  2JA2 A;  2NS7 A;  4LB5 A;  3PUF A;  4E7J A;  3AKZ A;  4HOB A;  3BPV A;  1ONV A;  3RDI A;  2WAE A;  1XX5 A;  3DF8 A;  5L3C A;  3KYD B;  4M3E A;  4FX0 A;  2L01 A;  3RQ4 A;  2WAF A;  5JHF A;  4M9S A;  4BJT A;  2Z9O A;  4GGG A;  3WGG A;  4D1Q A;  1CGP A;  2M2E A;  4CXF A;  3H3V K;  3LQQ A;  1R00 A;  1ORK A;  3C2H A;  2R7R A;  5ILS A;  3BR6 A;  3HM5 A;  5IOZ A;  1HSJ A;  3CQZ J;  2MGQ A;  1JKQ C;  1GV5 A;  2BHZ A;  3BC8 A;  2W25 A;  2KPM A;  3IUO A;  3QU3 A;  2ZJQ F;  2JK3 A;  5E3N A;  2ADU A;  3WTX C;  3RTR A;  1X1C A;  4AM3 A;  2V26 A;  2DT7 B;  2DDA A;  5DCM B;  4BE0 A;  4QPQ A;  4EJV A;  2LRD A;  1BC7 C;  1ULY A;  3CJN A;  3HXL A;  2M3A A;  1FP1 D;  5CVI A;  1FSE A;  3G3Z A;  2R7F A;  2L7M P;  2WV0 A;  3JR9 A;  3CCS I;  3K1P A;  2R0Q C;  4R79 A;  2ZFW A;  4KN4 X;  1QHG A;  2HS5 A;  1M1E B;  4XKV A;  3TO6 A;  1W1W E;  5KCM A;  2KHM A;  1J9I A;  2BGC A;  2XB0 X;  5LGT A;  1G6N A;  5FLM J;  3CJR B;  4Y4R A;  1BN5 A;  2KIS A;  2VB6 A;  2QUF A;  1T95 A;  4CYD A;  2KIM A;  3IP4 B;  3BZC A;  1V5E A;  4Y7N J;  2MD0 A;  1DPU A;  4M73 A;  1LDJ A;  2EFO A;  2VBZ A;  2EB7 A;  1JKO C;  3M1E A;  2NRA C;  4KA4 A;  2EIK H;  1MH3 A;  3I59 B;  4UUV A;  1T0F C;  1ZLK A;  3EPZ A;  4N9H A;  5JVT A;  1TTY A;  2Q0O A;  2XRN A;  4LK0 F;  1XPX A;  1WCM J;  1Z1D A;  2FOK A;  1B4A A;  2HYF A;  2NVQ J;  1I5Z A;  1A6Q A;  3BR3 A;  4XLH A;  2MG4 A;  2Y9Z A;  4IZZ A;  4WXH A;  3DXJ F;  1QQI A;  1VQ8 I;  1DU6 A;  4HLX A;  3KCC A;  1I3Q J;  2OF7 A;  4NC8 A;  4EJO A;  1DUX C;  1WPK A;  2D1V A;  1LDK B;  5GTH C;  5E18 F;  2DJN A;  3GUD A;  1CQT A;  2WY8 Q;  1SEU A;  4KIF A;  3K0L A;  1KGS A;  5HLG A;  1R5H A;  1IO2 A;  2HZT A;  3F23 A;  1XS9 A;  1HKS A;  3U9G A;  2H09 A;  1HKQ A;  2OCE A;  2V9V A;  2VC1 A;  3GWZ A;  4A3I J;  2A5W A;  2XAS A;  3F9K A;  2CW8 A;  2P7V B;  2JTV A;  2BY2 A;  3DPT A;  2N8G A;  3OS0 A;  1SFO J;  1JTX A;  4A3G J;  2L9R A;  4LIV A;  2JT1 A;  3GX4 X;  2HI3 A;  5FRO A;  3HIF A;  2LYC A;  3LOC A;  3VDX A;  2ME0 A;  2VKH A;  2MLK A;  1ZGW A;  2JRT A;  4OIO F;  3BR2 A;  1MMN A;  1SFX A;  4KT6 A;  2VN2 A;  4NQW A;  3K4J A;  2DA5 A;  3KEQ A;  2ID3 A;  4IKF A;  1H9T A;  4GYG A;  3KLO A;  5D5V B;  1KQ9 A;  3MQ0 A;  5HS9 A;  4E70 A;  4UVA A;  1F4K A;  1LKX A;  1RET A;  3MMY B;  4KIB A;  3GTG J;  2QCO A;  1T6S A;  2DTR A;  5E3L A;  3BZ6 A;  3D5S C;  4ESB A;  3M7G A;  3WGH A;  3VSL A;  4ZJZ A;  1Z3X A;  4L0Y B;  3HPH A;  5B5E C;  3F8N A;  1BW5 A;  3QYB A;  2ECB A;  1O57 A;  4DYC A;  4RLQ A;  3AFH A;  1X1A A;  4L9N A;  4ENJ A;  1ACI A;  3EUH A;  2MD5 A;  2VQH A;  4LGW A;  1D8K A;  3FHZ A;  2I10 A;  2JVH A;  4AUX A;  1EH8 A;  3BOQ A;  3PL8 A;  2HEO A;  3ZN0 A;  1MW7 A;  1EKE A;  3Q3S A;  1XD7 A;  3F6V A;  4IHV A;  3P7N A;  1OYY A;  4DGW B;  1K6Y A;  4ZH4 F;  1YX5 A;  1IN5 A;  5K7F A;  4C3H J;  4RB0 A;  3F6O A;  2A05 A;  4B3X A;  1XCB A;  3ECH A;  1FOY A;  3MKL A;  3O8H A;  5FJ8 J;  2OTJ I;  3E6D A;  5FD5 A;  4ABZ A;  5HLT A;  4B44 A;  2JRM A;  5DS9 A;  2DTZ A;  1W36 D;  1G59 A;  1YW7 A;  2X6W A;  3RPQ A;  5EZH A;  4HEA 2;  3WTV C;  1LEB A;  3RCO A;  5LRS A;  1HOM A;  5FB2 A;  2IXS A;  3F21 A;  4L5J A;  3ZR8 X;  1TLH B;  1WZ2 A;  4Q4Z F;  1QO0 D;  3FWE A;  5KK1 A;  3A4C A;  2IP2 A;  1R9T J;  3OYG A;  2DQL A;  2JSP A;  2R92 J;  4DZJ A;  4A3B J;  3CCR I;  4N4O B;  2MBF A;  3JRG A;  3BJO A;  3HPG A;  5F0C A;  2QM3 A;  1U9O A;  2Q1Z B;  2JUC A;  1FIP A;  5E3O A;  1AKH A;  1UB9 A;  3LAP A;  4HZF A;  1DDN A;  2ZNY A;  1O7L A;  2E1M B;  1G3T A;  1Z91 A;  4RAG A;  1SD7 A;  1Z77 A;  1RRJ A;  4XRM A;  4CA0 A;  2STW A;  5BPD A;  4ZTF A;  3WOD F;  3CC4 I;  2E2H J;  2GQQ A;  2FQ4 A;  2Z1D A;  5J47 A;  4UY8 I;  3TED A;  3E6C C;  3HSR A;  3A03 A;  4XN0 A;  4XLA A;  1GUU A;  4BUP A;  3GFM A;  1ON1 A;  3ABM H;  3IWZ A;  2H8W A;  4QSH A;  5TIS C;  3CES A;  1VTN C;  4YIR X;  1LEA A;  2O8X A;  3CF5 F;  4CH7 A;  4DYR A;  1BBY A;  4HG2 A;  3JRC A;  3TDU C;  2BBY A;  3JRE A;  3JRH A;  3CME I;  2Y0S N;  3FBI B;  5C3E J;  2LKP A;  4E7I A;  4LFU A;  1QNT A;  4U88 A;  4JYK A;  1VQ6 I;  4XKW A;  2C6Y A;  5E20 A;  2QSF X;  3C2B A;  1P6R A;  5CJ9 A;  2X0L A;  1VQN I;  4IXA A;  1U2W A;  4S05 A;  1TWH J;  1XB4 A;  3GLL A;  2A69 F;  4CUG A;  2R7O A;  2ELK A;  3OYM A;  2IAI A;  4XN3 A;  3T1B A;  1TNT A;  2FD5 A;  3S3N A;  5EZG A;  2ACJ A;  2A61 A;  4WWC A;  1JGG A;  2Q2E A;  1MNM C;  2ETH A;  2IT0 A;  2B63 J;  3VYS B;  2K9L A;  3OOP A;  1MBG A;  5EGO B;  4QLC U;  1UG0 A;  2K4J A;  1FSH A;  3AG4 H;  2F4O B;  2BVL A;  2WBM A;  2D2W A;  2L9N A;  5E8G A;  1GT0 C;  2W82 A;  3WTT C;  2UWM A;  1R1T A;  2G9W A;  2ZBK A;  3TW6 A;  5IP9 J;  4HV6 A;  3TDZ C;  1USS A;  1FIA A;  1EV7 A;  1G3Y A;  1W5C C;  5LD2 C;  1B1B A;  1N25 A;  2DT5 A;  3AG3 H;  2DA6 A;  1BJZ A;  2VJJ A;  3NAU A;  3K2Z A;  4D5F A;  4BBR J;  4CCM A;  1A5J A;  1BW6 A;  1H0M A;  3B73 A;  4UB8 C;  1U5T A;  4XSZ F;  3HOT A;  2ID6 A;  2OD5 A;  2VPL A;  3HGY A;  2DPD A;  4CCN A;  1TQM A;  1ON2 A;  2M8E A;  3CDI A;  1KU2 A;  1ETQ A;  2W4S A;  2FX0 A;  2YUS A;  3IC7 A;  2HOS A;  2HTS A;  4G8X A;  4HDV A;  1D3Y A;  2PN6 A;  5LRR A;  3TP0 A;  1GV2 A;  4M3B A;  4CZC A;  5HOO A;  4N4N B;  3LFK A;  1FT9 A;  2LKX A;  1D0X A;  1IRG A;  3K69 A;  4HRI A;  2L54 A;  2E1O A;  2MA3 A;  3QU6 A;  1APL C;  4Y3O A;  4U0V A;  5ICG A;  2F48 A;  2Q8K A;  1IGN A;  3I4N J;  1X2N A;  4G9Y A;  4G6D A;  1QA6 A;  2J5P A;  2PMU A;  4ZYE A;  4UB6 C;  1D1C A;  5CQE A;  1MDM A;  1ZQ3 P;  4AC0 A;  2NNY A;  4D0P A;  3ZMZ A;  5H6R A;  1F36 A;  4A3K J;  3K2A A;  1OYI A;  1HW5 A;  3CD6 I;  1QPI A;  3PSI A;  1GXQ A;  2D5V A;  5E1X A;  3JW4 A;  1SVO A;  3DLA A;  3OYL A;  1V55 H;  1G4D A;  1I1S A;  3CUQ C;  1DPR A;  1MNE A;  2OU2 A;  5L3F A;  3R61 A;  2V6E A;  1OYW A;  2E35 A;  3G4S I;  4KT5 C;  1J5Y A;  1W5S A;  2EV0 A;  3HOX J;  4RLF A;  2BVM A;  4JK1 X;  1KYZ A;  4IVN A;  2EFP A;  1NH3 A;  3X2Q H;  4KN7 X;  5ERI A;  5FKO A;  4BAY A;  1XGS A;  5LEJ A;  1PUE E;  4OMY A;  1U9N A;  5D4S A;  1GXP A;  4PK4 A;  1IUY A;  2A5Y B;  4D9J A;  1UST A;  4GFB A;  4JX5 A;  3OYI A;  3ZQ7 A;  4HDU A;  2ESH A;  1MBK A;  2QEN A;  3FK6 A;  3E6M A;  5C4X J;  1VQP I;  3ZQL A;  3ZCO A;  1JHF A;  5F04 A;  2XPW A;  2XAF A;  3OS1 A;  1R58 A;  4PZJ A;  1I27 A;  2VUM J;  3F72 A;  2HKX A;  2KDO A;  1D5V A;  4L0Z B;  5F6F A;  3PO3 J;  5M3F J;  3NRV A;  3WG7 H;  4EJW A;  2YX7 A;  5C4J J;  1O3S A;  1JTY A;  3MAJ A;  4B8X A;  1T33 A;  3FMS A;  3H9Q A;  2WV1 A;  3HRM A;  4IX7 A;  3VYT B;  5GAE J;  2Z2S B;  4BXU A;  3V4G A;  1L0O C;  2R5Z B;  4DBR A;  2K4B A;  3HHH A;  3OWT A;  1UJ8 A;  2OC6 A;  2GXG A;  4BL0 B;  5LEK A;  3ULQ B;  2K3F A;  3DBL B;  2NOJ B;  2P8T A;  2AS5 F;  1FP2 A;  2OQR A;  4OWR B;  3PNV A;  2XGD A;  3C3W A;  1ZTR A;  1FTZ A;  3ASN H;  5LGN A;  2MW8 A;  3HSE A;  1YQA A;  2QKL B;  3L9F A;  3ONQ A;  3BJA A;  4JOM A;  2JPB A;  1AOY A;  2W85 A;  2M45 A;  4D7M A;  5EJC A;  4RGR A;  3ISP A;  1LNW A;  2V1N A;  3BCB A;  1OR7 C;  3PFY A;  4EV0 A;  1O4X A;  2JA6 J;  1FYL A;  2W24 A;  3DU5 A;  4M74 A;  2FE3 A;  4WCG A;  4I6Z A;  2VBY A;  4EAT A;  2XAJ A;  5D4R A;  2YSR A;  3HOZ J;  4E7Z A;  2VE8 A;  2EV6 A;  5FKN A;  1T08 B;  1FYM A;  4LIU A;  4A5M A;  1YI2 I;  3OV8 A;  3RYP A;  3CCQ I;  4ANJ A;  2OZ6 A;  1K4T A;  2P5L C;  3MEX A;  4CCO A;  2ISZ A;  4A12 A;  2DOD A;  3QP6 A;  3CLQ A;  1S6L A;  1Q1V A;  4N9I A;  1PP8 F;  2BOL A;  4F91 B;  1T38 A;  1FLI A;  2EIJ H;  4ZDL A;  3B6C A;  3TBI A;  2ZXJ A;  4CYC A;  3TO9 A;  2AXT C;  3LA7 A;  1VQ5 I;  3C1D A;  5F1R A;  2W1O A;  5E1Z B;  1ODD A;  4DZP A;  2YPR A;  3DEE A;  4ZYH A;  4C30 A;  3IKV A;  2LP0 A;  1FZP B;  4BHP A;  3W3C A;  3BG3 A;  2R7V A;  5LHH A;  3RZD J;  1S29 A;  4WX9 A;  1MJB A;  1T39 A;  2QA4 I;  1BI3 A;  2E5Z A;  4AD9 A;  3WGI A;  2DFI A;  5J6X A;  3FXQ A;  2KIF A;  2K9N A;  4B3A A;  3IRR A;  2VT2 A;  2QQA A;  4G94 A;  3VPR A;  4KYW A;  2XVC A;  2AXL A;  3MZY A;  4WXC A;  1IN7 A;  2LF8 A;  1G3S A;  5JI6 A;  3Q9S A;  3ZMT A;  2BY3 A;  3CMY A;  2UXN A;  1MBE A;  2KIU A;  2DOF A;  4BNC A;  3R60 A;  2CQN A;  3CP8 A;  3OOU A;  1FBQ A;  4G7O F;  5BOX A;  1KU9 A;  1IXS B;  3R6S A;  1ETV A;  5DD8 A;  3M8F A;  1WI9 A;  2XGE A;  2EQR A;  1P4W A;  3G1L A;  3BDD A;  1RKW A;  1Z6R A;  2P4W A;  2K27 A;  3H5A A;  3TL4 X;  1WJA A;  4BHC A;  1LFB A;  2CG4 A;  2Z3Y A;  1K61 A;  3V8K A;  4M9Z A;  3VYU B;  1S7O A;  1N78 A;  3KE2 A;  4U0Y A;  3OYA A;  3QPL A;  2VKE A;  2EV5 A;  3OSF A;  4B4C A;  2AQE A;  3ZMV A;  5J4Y A;  5DV5 A;  2KIQ A;  2STT A;  1Z67 A;  1LJ9 A;  2L2O A;  2RV8 A;  3F3X A;  4C2M J;  2HQA A;  3DBR B;  4FET A;  5DEQ A;  4QWQ A;  2LLK A;  4CSW A;  5E3M A;  5EG0 B;  2DMU A;  2M5W A;  2VT3 A;  4OIQ F;  4HNV A;  2O0Y A;  1FX7 A;  1WVR A;  1KA8 A;  2HOA A;  5EF6 A;  2M0C A;  2H6C A;  4XOR A;  1GLN A;  2E19 A;  3HUG A;  2AO9 A;  4LLN A;  3I59 A;  4IQJ A;  4GDF A;  5D6F A;  1ZR2 A;  3L7W A;  4IO9 F;  1X4P A;  3I71 A;  4EGZ A;  1X58 A;  1R1U A;  2HKO A;  3S1Q J;  2ZFU A;  3CCV I;  1SD5 A;  2EJR A;  4ENK A;  2HXO A;  3D5R C;  4JQF A;  2A3S A;  1QZY A;  3ABL H;  1FNN A;  2CW7 A;  2FF4 A;  1UAA A;  3ZN1 A;  2L4A A;  1ZG1 A;  3S14 J;  1U6G A;  3HTU A;  2MLG A;  1MSE C;  4A2U A;  4J01 A;  2R7Z J;  1BA5 A;  3ZQI A;  4AID A;  1X19 A;  2NNN A;  3OYK A;  3KP3 A;  5E1W A;  3RQI A;  4U7D A;  2EZH A;  2IS4 A;  1ETW A;  4M3F A;  5CVJ A;  4I76 A;  1U0J A;  3A0H C;  2GA1 A;  2QF7 A;  2ZKZ A;  1XGM A;  3JRI A;  1SC7 A;  4IRH A;  1S7A A;  1JUP A;  1V5G A;  1K6O A;  1IF1 A;  2DA1 A;  5D8L B;  2WY7 Q;  2NVY J;  3MCZ A;  1ZRD A;  2PMZ N;  2HDD A;  1RUN A;  3VWB A;  2RRE A;  5JR3 A;  2KRH A;  1P2F A;  2DA4 A;  4HX8 A;  1W0T A;  4MQ9 F;  2FRH A;  4PJJ A;  1VND A;  2HQ5 A;  1BI0 A;  1QVU A;  2XSJ C;  1O7F A;  3K4C A;  4GRI A;  3GBG A;  1DQU A;  2CFO A;  2V4J C;  4HLY A;  4N0B A;  2PBI A;  3OYF A;  3U1D A;  2VKD A;  2FBH A;  2H1K A;  5EYR A;  1BR4 A;  5HDK A;  2BY1 A;  2KKO A;  2KL4 A;  5J3L A;  1I39 A;  4D7N A;  3IRQ A;  1FWZ A;  2M7A A;  3H92 A;  2UZK A;  3K1N A;  2HYG D;  5H2F C;  3DV8 A;  3G1O A;  3MKY B;  4UVB A;  1MH4 A;  3VSK A;  3JTG A;  3KZZ A;  3EET A;  2OAZ A;  4NHJ A;  2VPR A;  3Q0V A;  4MLO A;  3ZP5 A;  3ESW B;  1BIA A;  5CVR A;  3L00 A;  1ZG3 A;  2VBX A;  2F4M B;  3HDD A;  2M0M A;  2QEX I;  2CV2 A;  2DLL A;  1U8B A;  3BG9 A;  4P9F A;  1TWF J;  1YYV A;  2EBI A;  1WQ2 A;  1ZRF A;  3GTO J;  3S1R J;  1H89 C;  2Y0M A;  2JA5 J;  4IHS A;  4HX7 A;  2IGM A;  3SZP A;  1PVE A;  1KYW A;  3LWF A;  1I6H J;  1ZEL A;  5F0H A;  4PCQ A;  1DP7 P;  3HUG B;  5H6Q A;  3I4M J;  3WTU C;  4RMN A;  3LSJ A;  2BZT A;  2B0L A;  1JHH A;  3HTS B;  1LVK A;  5LHG A;  2CSO A;  2VLA A;  3QPT A;  1OCC H;  1BR2 A;  2OA4 A;  4XKC A;  4A0Y A;  4U7B A;  2H1L A;  2QSH X;  3W6V A;  2M7B A;  1TWC J;  3S15 J;  1HW2 A;  2X51 A;  1WJ5 A;  5CYV A;  5ICC A;  1D8J A;  4BQQ A;  2JJ7 A;  2WWY A;  1H9G A;  2VXD A;  1S8N A;  4XKB A;  4BXX J;  3OYC A;  5FFX A;  5BQT A;  1V3F A;  1LE8 A;  2Y30 A;  3DTE A;  5GAD J;  5ED4 A;  3NAR A;  4LB6 B;  2E36 A;  1OFC X;  2XUB A;  4OIN F;  3CCU I;  2P6S A;  3IWF A;  1DU0 A;  3R0J A;  2HOE A;  3TKY A;  1D1B A;  4M72 A;  4O6J A;  5CQG A;  4B09 A;  3K70 D;  1RKT A;  1UHW A;  3B02 A;  2KLO A;  4EM0 B;  1YS7 A;  4NB5 A;  4ZTJ A;  1K4S A;  3CCM I;  1WH5 A;  2H8R A;  3S17 J;  5J8F A;  2IGO A;  2R93 J;  4MTD A;  1P7I A;  3PIO F;  5LFA A;  3CCJ I;  1R1V A;  4I0B A;  3LA2 A;  3KLN A;  5KNL A;  3DEW A;  3I55 I;  2QYO A;  3K7A J;  3GCM A;  1TL8 A;  4RBO A;  4BXF A;  3HG9 A;  5E79 C;  4PGH A;  4X0G A;  2XRL A;  4A69 C;  1D1A A;  3CCE I;  1YJN I;  3SFI A;  1ENH A;  3R4K A;  4A3J J;  1EH7 A;  2V1D A;  3WU0 A;  4BQN A;  1TT0 A;  5IOY A;  3S2H J;  3FZV A;  1SMT A;  2IRF G;  3GZ5 A;  1F1Z A;  2CQX A;  2E71 A;  1OMI A;  4HQM A;  1MJA A;  3E97 A;  4AVP A;  3GYH X;  3V42 A;  4OIP F;  4C2U A;  5TGT A;  4MNU A;  1A36 A;  2EZI A;  3KIO A;  3UKG A;  1YJ9 I;  4DIQ A;  1WFX A;  3H0G J;  1RES A;  1EA3 A;  1X3Z B;  2A68 F;  1RIO H;  1TNS A;  2HR3 A;  2F6C A;  3TP3 A;  4M9X A;  2A6E F;  5AIP A;  3HOS A;  1IDY A;  2QQB A;  2UUZ A;  1T2K A;  4RM3 A;  2L3D A;  3RKQ A;  3SYT A;  2DFF A;  4C9Y A;  3D1N I;  2HYJ A;  3PIP F;  2PLY A;  1X3U A;  5F0F A;  4RGX A;  5EGO A;  1OR7 A;  3DKX A;  1MKM A;  1RC9 A;  4XMY A;  3L09 A;  2YU9 J;  1ETO A;  3BR1 A;  3HKZ N;  4NBQ A;  4BQO A;  2V1X A;  3FK7 A;  2XAG A;  2DW4 A;  2HOT A;  2NS0 A;  1EF4 A;  4UV8 A;  1ZAO A;  2M1B A;  1ZG5 A;  1ZR4 A;  1JUS A;  3P9K A;  3HOU J;  2PMZ A;  1X1B A;  1LE8 B;  3CUQ B;  2GOX B;  2DA2 A;  5LLQ A;  5FKM A;  5FO5 A;  3BG7 A;  1Y0U A;  2DYR H;  2KQR A;  3GFI A;  1TZL A;  3JRB A;  2GLO A;  5EEH A;  2OV7 A;  3FF5 A;  3O3K A;  2XAQ A;  1JT0 A;  3E1S A;  2E34 A;  3SFZ A;  5IP6 A;  3Q5F A;  2XAH A;  4D5C A;  1SFE A;  4WF2 A;  2KT0 A;  1JKP C;  2OTL I;  2Y9Y A;  3QYF A;  1Z6T A;  3BRO A;  4AWX B;  4PJN A;  4PUS A;  2TCT A;  3CCY A;  2VJ4 A;  4W97 A;  5J8C A;  2A07 F;  3IH4 A;  5K7Z A;  3VB2 A;  5HDN A;  2JA8 J;  3W2W A;  4XR6 A;  4RAZ A;  3HYI A;  4G6Q A;  4IJA A;  1OCO H;  3BWG A;  4E7H A;  2I8D A;  1O3R A;  2Z33 A;  1E0E A;  3H9G A;  3KX2 A;  4LD5 A;  1IN8 A;  4I2O A;  1IJW C;  2WC2 A;  1E3P A;  4ZYG A;  1FC3 A;  2M8G X;  3L1P A;  4EJT A;  1UMQ A;  1WJC A;  3OYD A;  2XAU A;  1P7J A;  5KVR A;  2VKV A;  1R71 A;  3F8F A;  1I50 J;  1YW9 A;  3BCA A;  3FX3 A;  3I0T A;  4XIC A;  4I01 A;  2XGX A;  4DQ2 A;  3DQV C;  2COB A;  1YX3 A;  1B72 B;  4IRI A;  3BR5 A;  4OIR F;  3MKZ A;  1E3O C;  3DKY A;  3REO A;  4EM2 A;  4FCY A;  1PP7 U;  5J40 A;  3JTH A;  2LSO A;  5DCF A;  4KFC A;  1JUM A;  5DM7 F;  4XSX F;  4B43 A;  2VJI A;  1Z7L A;  4PJM A;  3BJ6 A;  4P96 A;  2EA4 A;  2B7E A;  5CLS A;  2V6C A;  1FJL A;  2DI3 A;  3MKW B;  1YRN A;  3TW7 A;  1WI3 A;  2F5F A;  3PQJ A;  3LSG A;  4E7S A;  3GEZ A;  3WHB A;  5CKT A;  1R36 A;  4KIT B;  1Y8R B;  1J0R A;  2KRF A;  1BOB A;  4P5O A;  3L2Q A;  1R4N B;  2X4H A;  5ILU A;  2XGC A;  1Y1V J;  1UHM A;  1MND A;  3PQK A;  4KNY A;  2OPT A;  4DOZ A;  1ZGA A;  3M8J A;  4L9V A;  1YO5 C;  4H0E A;  2ZME B;  2W48 A;  4Q47 A;  2DOA A;  3FMQ A;  3GTP J;  1VF9 A;  2CUZ A;  2JVG A;  1GVJ A;  1WJB A;  2HXI A;  3HB9 A;  4CIC A;  2JZY A;  2PEX A;  4HF0 A;  2ZSI B;  3GZ6 A;  4QTR A;  3CDL A;  1QZZ A;  1QRY A;  2GIV A;  1YLF A;  3FXK A;  4AYB N;  1KON A;  2R5Z A;  5IYB J;  4GCV A;  3WG9 A;  4YII A;  2DQR A;  2XB5 A;  5J1U A;  5IYD J;  2DO7 A;  3FXM A;  3LSI A;  4EJU A;  1I1G A;  2XDV A;  3COA C;  3P5J A;  1QVT A;  1Z0X A;  2W84 A;  4NC7 A;  1T56 A;  4KMF A;  3CUO A;  2QZ8 A;  4G7Z F;  4G6T B;  1MMA A;  4EMS A;  3A01 B;  2CO5 A;  2DMN A;  3FMR A;  4XOP A;  4RAY A;  1WKM A;  2EIL H;  5GTI C;  4KIS A;  1W4M A;  4PSX A;  1YOV B;  4Y33 A;  4UNO A;  3FIS A;  1HA8 A;  4A3L J;  3JAM K;  3QRF F;  5GP9 A;  3AG1 H;  2FBI A;  2K5C A;  2QQ8 A;  2WA0 A;  2YU3 A;  3TOA A;  3CLO A;  4B1R A;  1DGR M;  1QHH D;  3H3Z A;  5F08 A;  3S8P A;  2COM A;  3IL2 A;  4R8H A;  3J7A Y;  3J7A O;  3V7S A;  1WGX A;  3GFJ A;  5M5W J;  3CTA A;  2CMP A;  2HPI A;  4LMY A;  2RQQ A;  2LBF B;  2XF7 A;  1RR7 A;  1YIT I;  1G2H A;  1T8I A;  3CJT B;  4F3Q A;  4K2E A;  3F8M A;  5HDG A;  3M07 A;  4EEF G;  3H3U A;  2LMD A;  4HQE A;  2R7T A;  4FT8 A;  1A6I A;  1S7E A;  3HRT A;  1QU3 A;  1V5F A;  5DDG A;  4LG0 B;  2GXA A;  5FFZ A;  3I3L A;  1IG7 A;  5H20 A;  1YRN B;  1F9N A;  2FNA A;  3WE2 A;  3LFU A;  2KZV A;  1WJF A;  1MGT A;  4MO7 A;  4F7Z A;  2VOP A;  3OYN A;  5HVQ C;  4YG2 F;  4FHT A;  1BL0 A;  4JBA A;  1HF0 A;  2GAU A;  4LLG F;  4XK4 A;  1QGP A;  2DN0 A;  3DPU A;  5B66 C;  3L2R A;  2PJR A;  3JSP A;  3ZQF A;  3RKY A;  4UUS B;  2BHY A;  3OL3 A;  3I4P A;  2D1H A;  3I58 A;  5D6E A;  1HBX G;  2ZXI A;  1W36 C;  1SFK A;  4P1W A;  4YIF A;  1TQP A;  2K9S A;  2XIG A;  3EQL F;  1YW8 A;  2BEO A;  4JX4 A;  2UV1 A;  5ICF A;  1TW2 A;  3T0Y A;  1T0F A;  3PFI A;  4ZDO A;  2ZSH B;  2CRG A;  1T98 A;  2XHK A;  5KAI C;  4UHT A;  4A3M J;  1U8R A;  4E4H A;  3OIP A;  1NG7 A;  3J80 Z;  2H27 A;  2IS6 A;  5F64 A;  1KQ0 A;  2FQ3 A;  2WB1 N;  5K5Q A;  3ABT A;  4EM1 A;  3IAS 2;  1ERD A;  4LLL A;  4HYE A;  3SDB A;  4BGD A;  4NUB A;  1K7A A;  4UUT A;  2O3F A;  1HCR A;  2JQ7 A;  2LH9 A;  3DPL C;  1Y6I A;  2DU9 A;  3ZGK A;  3I5U A;  2Y0S A;  2MH9 A;  4DW6 A;  3LSP A;  3FBN B;  1PUF A;  2DCE A;  1BC8 C;  1W7P A;  4BEH B;  3HL2 A;  3QQA A;  1ZYR F;  2XC7 A;  4ZYA A;  3QOE A;  3VFZ A;  3OIO A;  2GA2 A;  4AIH A;  3DTK A;  2P7C B;  4CGZ A;  1LVA A;  2WAQ N;  3ZOB A;  1S72 I;  1BI2 A;  1RI7 A;  3K4K A;  5FGM A;  4YFX F;  3VEP A;  3S2D J;  2L02 A;  3BPX A;  1S3J A;  5EG0 A;  3L2V A;  1R4M B;  2M4K A;  2G7U A;  3T5X A;  1TT5 B;  4XRS G;  2ELH A;  2ZO4 A;  1XSV A;  5BMZ A;  1OCP A;  1RPW A;  1U78 A;  2ZME C;  2GWR A;  4IHX A;  1XMX A;  1PYV A;  1X1D A;  2R7D A;  1UFM A;  3CO7 C;  1VQK I;  2X6X A;  2IJL A;  1U3E M;  4II3 A;  3PNT A;  2Y75 A;  2DMT A;  3BT9 A;  2HPM A;  1G3W A;  1SD4 A;  3KP4 A;  3F22 A;  4ESF A;  3ZQQ A;  4PDK A;  5M5X J;  4Y13 A;  2F5V A;  3V8J A;  2X6Y A;  3HGG A;  3T8T A;  4V19 K;  1MMG A;  4UXN A;  1HST A;  3H5N A;  5EEA A;  4ESJ A;  2O9L A;  2KZG A;  4M6V A;  3HJE A;  3MN2 A;  4MIM A;  1VFC A;  2PJR B;  4I99 C;  3I54 A;  2VQL A;  4BH9 A;  3K4N A;  1TC3 C;  3JRF A;  2L4M A;  3WTS C;  3S3M A;  1ETY A;  2V79 A;  3GME A;  1SAN A;  3FXR A;  4IHY A;  1ZAR A;  5DUI A;  3NEU A;  1LPQ A;  3TGN A;  1A04 A;  3WTW C;  2HVR A;  3PO2 J;  3VOD A;  1OPC A;  4O3M A;  1HW1 A;  4YEL A;  3KP5 A;  4OAY A;  3FM5 A;  2H6B A;  2PQ8 A;  1ZKG A;  2VL8 A;  2CU7 A;  1YJW I;  3JCU C;  4EQQ A;  1OKR A;  3LSH A;  3K4B A;  4AIK A;  4ENN A;  1MMD A;  2KRC A;  4A93 J;  2V9P A;  4Y17 A;  2OQG A;  4HBL A;  2EPF A;  3DWL E;  4II2 A;  2HTJ A;  3I56 I;  3BTJ A;  3ELK A;  1IUF A;  3R0A A;  3KEO A;  1S5L C;  3ABU A;  2EFQ A;  4A3D J;  3DFG A;  2JSC A;  1FEX A;  3BY6 A;  2EIN H;  4EVI A;  2PX9 A;  1PUF B;  5IT3 A;  1J2X A;  3QYE A;  1W7P B;  4EGY A;  1JE8 A;  1GDT A;  3L2U A;  3LST A;  3OS2 A;  4BAC A;  1HKT A;  3E0J B;  5JHU A;  1R5G A;  2VAS A;  2VXZ A;  5BNG A;  5L3E A;  3VYR B;  5E8I A;  3GFL A;  9ANT A;  2EA2 A;  2IPQ X;  3E7L A;  2UXX A;  4XOT A;  3K1M A;  4PGG A;  1I3A A;  5FKL A;  2X85 A;  3BTL A;  4IEJ A;  3A2K A;  5GAG J;  3PUB A;  2R7X A;  4HV5 A;  2CFX A;  1MD0 A;  2M4G A;  3CDH A;  1ZRC A;  3KEY A;  4GXO A;  3E5X A;  5K1Y A;  2HNH A;  4AU7 A;  1IZ1 A;  1SAU A;  3S1N J;  5BPI A;  5JLW A;  2O5R A;  3ECO A;  2O6G E;  2FU4 A;  5IY5 H;  5IT9 K;  2V1U A;  2EIM H;  3AL0 C;  3MZH A;  1BJA A;  4V2G A;  5FRN A;  4M3D A;  2ZNZ A;  3MVP A;  1CF7 B;  5TRD A;  2FOW A;  2AHQ A;  2HQN A;  4A3E J;  4CHU A;  4P55 A;  4OU0 A;  1JJ8 C;  1TWA J;  4RB2 C;  1U5T C;  3ERE D;  3CZ6 A;  2BW3 B;  3S2W A;  4HX4 A;  2ZXW H;  4HPQ A;  3M8E A;  4CO8 A;  2IW5 A;  4DYQ A;  5IP7 J;  1XGO A;  3KYC B;  2CW0 F;  2E60 A;  2MAB A;  5B3S H;  2RC4 A;  4FAS D;  3GO5 A;  2QKM B;  1LQ1 A;  2QVO A;  3GXO A;  2CGP A;  3GZN B;  4DBQ A;  1VQ7 I;  1SVM A;  3O8G A;  1Z7U A;  2NS8 A;  3H0D A;  1HDP A;  4HSR A;  1IW7 F;  1WJE A;  4ZZD A;  3WU2 C;  3K9T A;  5FLX K;  4YEJ A;  4XLP F;  3RZO J;  2H94 A;  2HZD A;  2LK2 A;  2FEZ A;  3HEF A;  1VQL I;  2VE9 A;  3CJQ B;  3NWT A;  3PM1 A;  1Y8Q B;  2RKH A;  4TV7 A;  3TMO A;  1IXR C;  1JKR C;  1OQY A;  1IDZ A;  3CP2 A;  2HWV A;  1ZN2 A;  2NVT J;  1XDU A;  2EH3 A;  1FY7 A;  3JAM Z;  3WTY C;  1XSD A;  3LA3 A;  2KJC A;  4AIJ A;  3W2V A;  3IKT A;  2LRE A;  2R5Y B;  1MBF A;  2HGC A;  2OCC H;  2KDZ A;  2X1C A;  5D8K B;  2CJJ A;  4WXD A;  1ZLJ A;  3JRA A;  2JMW A;  4E7L A;  3SZG A;  2K7L A;  4G7H F;  3FKI J;  1TP4 A;  4XON A;  2HFH A;  5L3D A;  2D45 A;  3E6B A;  2R3S A;  2DFH A;  5LGU A;  3RI4 A;  1RZ4 A;  4XLC A;  2MC4 A;  3KPH A;  1X1P A;  1YIJ I;  4YFN F;  1B6A A;  3ZPL A;  4XID A;  1WWX A;  1HDD C;  3T8R A;  4HF1 A;  4M6X A;  1OCT C;  3HRS A;  2F5C A;  4M71 A;  4FTH A;  2GBY A;  1MBH A;  4M3G A;  2R7S A;  3GLX A;  2VIX A;  2ZJ2 A;  2HVS A;  2KJB A;  2ZCW A;  3WTZ A;  1ETK A;  1STZ A;  1ZGJ A;  2CH0 A;  4OOI A;  4HAM A;  5J1Y A;  2DFE A;  1YS6 A;  2VBW A;  4KMU X;  3J81 K;  1D5Y A;  3CUQ A;  3SEZ A;  3SHF A;  2YX4 A;  4I0A A;  1JGS A;  1JI8 A;  2K9Q A;  1Z05 A;  2Z16 A;  2L9V A;  2BY0 A;  3ABK H;  1O3T A;  2DPU A;  4IQ4 A;  3HOV J;  3FKJ A;  2BXZ A;  2XKO A;  4BU2 A;  2CV0 A;  2WTE A;  3D5L A;  1FOK A;  1OJL A;  3Q0U A;  4BYY A;  2L9S A;  3J80 K;  4A5N A;  2EFN A;  3U21 A;  1R23 A;  4J00 A;  1Z3Y A;  3OSG A;  3LNQ A;  3SJM A;  4HA8 A;  4RM2 A;  2DAO A;  2BXY A;  1XG1 A;  2DMQ A;  3LSK A;  3Q0W A;  4XLE A;  2DBB A;  1FYK A;  3D0S A;  3IH2 A;  3TO7 A;  1MJ9 A;  3KP7 A;  1FOW A;  3M9A A;  3OR1 C;  3P9C A;  4BE2 A;  4FE7 A;  1VI0 A;  3BQZ A;  4L9T A;  3UNG C;  3H36 A;  1OCR H;  3GTJ J;  2LY9 A;  2M9H A;  2IA0 A;  3E5U A;  3DBH B;  1J09 A;  1FPQ A;  1AA7 A;  2EZL A;  4A3C J;  3BTI A;  4DNC A;  3EDP A;  3EUA A;  1BR1 A;  1POG A;  5LHI A;  2BYV E;  2LR8 A;  3O6B B;  2ESN A;  3KYL A;  3J7Z I;  3MWM A;  2LY2 A;  1B9N A;  4RB1 A;  1MIJ A;  2NOG A;  1Y39 A;  2DXI A;  4A0Z A;  3BQY A;  1LFU P;  2IGK A;  3IHU A;  2GXB A;  4F93 B;  5E17 F;  4F92 B;  2FMY A;  1B72 A;  2VQG A;  2CWE A;  5GPA A;  2XKP A;  3U1K A;  4RGU A;  3BTC A;  2NXN B;  5A2Q K;  2R7Q A;  4L9J A;  1WRJ A;  2K9M A;  4BS9 A;  4F55 A;  1KU3 A;  2MFZ A;  2RNG A;  3O2P E;  2EFW A;  5EDN A;  3OYB A;  3EUK L;  2A6T A;  5DYM A;  3ROU A;  4L18 B;  1H88 C;  1R7J A;  2CQ7 A;  1Y56 A;  2F5E A;  2W57 A;  1PDN C;  2P5V A;  4I09 A;  1A35 A;  1G8X A;  3A0B C;  2X1E A;  3DEU A;  1D0Z A;  4ASN A;  4RDU A;  3WU1 B;  2O7O A;  1N77 A;  1VQM I;  3EYI A;  1E2X A;  2RQP A;  3TOB A;  2MYS A;  4GO1 A;  5DUK A;  2L0K A;  4BHB A;  4HNT A;  1UG2 A;  2Z99 A;  4XLN F;  4BE1 A;  1ITY A;  1AHD P;  2ZME A;  3W6K B;  4UV9 A;  5DM6 F;  2IVM A;  3PNY A;  4V2F A;  1IC8 A;  4A3F J;  2AQF A;  2OZU A;  4ITV A;  1VQ4 I;  4E7K A;  4LIT A;  4O5V A;  2PFB A;  1J59 A;  1L3L A;  2GOM A;  3HC7 A;  4LJZ F;  3SEQ A;  1YHQ I;  1IN6 A;  1UHS A;  2P0W A;  4XBF A;  3G6E I;  2QBY A;  1NHA A;  2PMH A;  3K6G A; 
#chains in the Genus database with same CATH homology
 3CCE I;  1YJN I;  1YIT I;  3CJT B;  2FOW A;  1VQP I;  1ACI A;  4V19 K;  1FOX A;  5DM7 F;  1FOW A;  2ZJP F;  1YJ9 I;  5GAE J;  1FOY A;  2OTJ I;  1HC8 A;  1VQ7 I;  3CC2 I;  2K3F A;  3DLL F;  2QEX I;  1MMS A;  1YJW I;  1VQ8 I;  3PIP F;  3J7Z I;  1Y39 A;  5JVG F;  1VQL I;  3CCR I;  4IOC F;  3I56 I;  1VQ9 I;  4IOA F;  3J7Y J;  2NXN B;  1QA6 A;  2JQ7 A;  4IO9 F;  1YI2 I;  3CCQ I;  3CCV I;  3CC4 I;  3CD6 I;  5GAD J;  4UY8 I;  2E36 A;  2E34 A;  3CCU I;  2OTL I;  1S72 I;  2H8W A;  1VQM I;  1YIJ I;  5GAH J;  3CF5 F;  2E35 A;  3G4S I;  3CCM I;  5GAG J;  1VQ5 I;  3CME I;  5DM6 F;  3CMA I;  2ZJQ F;  3PIO F;  1VQ6 I;  3CCL I;  3CCJ I;  1VQ4 I;  2ZJR F;  3I55 I;  3G71 I;  1VQN I;  1YHQ I;  1VQO I;  3CCS I;  3G6E I;  2QA4 I;  3CC7 I;  1VQK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...