5JVGF

The large ribosomal subunit from deinococcus radiodurans in complex with avilamycin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5jvgF00
3CCLI 3CCEI 1VQ8I 3CMAI 1VQPI 2E34A 1VQ6I 1YITI 1FOXA 1YJNI 5DM7F 3G4SI 4V19K 2QEXI 3I56I 1VQ7I 2QA4I 4IO9F 5JVGF 3CF5F 1Y39A 1VQ9I 1MMSA 1YHQI 1FOYA 2OTLI 5GAEJ 3CC7I 1S72I 5DM6F 3CCMI 3CCQI 3PIOF 2ZJPF 1YIJI 1YJ9I 3CCRI 2FOWA 1VQNI 2OTJI 3I55I 1VQKI 1HC8A 2JQ7A 5GAGJ 4UY8I 2K3FA 1QA6A 3CC2I 1FOWA 2NXNB 1ACIA 1VQLI 2E35A 2H8WA 3DLLF 3CJTB 2E36A 1VQMI 4IOAF 3CMEI 3J7ZI 1VQ4I 3CC4I 3G6EI 2ZJQF 3CCSI 5GADJ 3G71I 2ZJRF 5GAHJ 3J7YJ 3CCUI 3CCJI 1YI2I 1VQ5I 1YJWI 1VQOI 3CD6I 3PIPF 3CCVI 4IOCF
chains in the Genus database with same CATH superfamily
1HQCA 4BS9A 1UB9A 1RESA 3S1QJ 2E2IJ 3VOEA 1G6NA 3A02A 4DQ2A 2MH2A 2CW8A 3E6BA 5DM6F 1OCPA 2RNJA 3KEQA 1SAXA 4XL9A 1IN5A 3VFZA 3W2WA 3AKZA 1TW3A 2XAGA 3CF2A 4R8HA 3TGNA 1ZGAA 1Z7LA 4PSXA 5IP9J 2XGXA 5LHIA 3O2PE 3JRFA 3C1DA 5E3LA 4F3QA 1RUNA 4KMFA 2E7XA 2DPUA 1R7JA 2K40A 1CF7B 1YQAA 4CGZA 1X2MA 2VE9A 3V8JA 4ZYEA 5EJCA 5M5XJ 2XRLA 3OIQA 3TO9A 1FSHA 2ZXIA 1JTYA 2XF5A 3JRCA 2TRTA 2ZMEC 3KP2A 2Z9OA 5L3FA 2P8TA 3ML6A 3F8BA 3PFYA 5CQEA 4RB3C 3BPVA 4NB5A 4PCQA 2W7NA 2IBDA 2KT0A 2K4JA 3MWMA 4KN7X 2K9SA 2V9VA 1HW1A 5E1ZB 3DCFA 2M7AA 1X58A 4BU2A 2R92J 3MZHA 2IW5A 3VYRB 1YO5C 1F4KA 1S72I 2EV6A 3ZCOA 4ON0A 5B66C 2R7ZJ 4H0EA 4YRVA 4OIOF 3MVPA 4XIDA 1W0TA 1O7LA 4QWQA 2V1XA 5IOZA 1VI0A 3W2VA 3N97A 3BR2A 3GFMA 3DPLC 4AUXA 2DPDA 4LLGF 1HKQA 2KZVA 1ETKA 1LJ9A 2TCTA 1ITYA 4C30A 3LSGA 3BZKA 3RZDJ 2K5CA 1D3YA 1Z7UA 2UWMA 1X3UA 1B4AA 5D5UB 1YG2A 2DT6A 1MMNA 3K69A 1MJ9A 5DCMB 1G3SA 1L3LA 4XM3A 1J0RA 2F5EA 2J5PA 2OAZA 2DA4A 2G7HA 4R79A 2ZJPF 4IHTA 3GTMJ 1T95A 3U21A 2O8XA 1J2XA 1WJDA 2PMZN 3A4CA 1IG7A 2L9VA 5TGTA 4EM2A 1N78A 3JTHA 4PJMA 1RPWA 2VPLA 1YJNI 4XKWA 2VBWA 4MTDA 2VN2A 2DTRA 4F91B 1P6RA 1W4MA 2QSFX 3ZQCA 2UUZA 1BIBA 2F4IA 5DV5A 1L0OC 3OL3A 3M4OJ 2VXZA 3FZVA 2X6XA 2YU9J 2LMDA 5JVTA 4XSZF 3B02A 3H9GA 5L3CA 4LGWA 1P7JA 2M0CA 1N77A 1EH6A 2VI6A 2MLGA 2OCEA 1U6GA 3JRBA 1VQOI 4PDKA 3BQYA 2E1CA 2K9LA 2WAEA 1VQPI 3MZYA 2E1MC 3PL8A 3K4CA 4XN0A 3V8LA 3GZ6A 4BE2A 2HZTA 3L2RA 3C3WA 3FMRA 1A6QA 3BCBA 4YFXF 3OMYA 1QQIA 3BZ6A 2XGEA 3CC2I 3FWEA 1OCCH 2GXGA 3DLLF 2XB5A 5EZGA 2GXBA 5JHUA 1PVEA 3ZN0A 1AKHB 3KCCA 1S3JA 4BACA 3CCUI 2R7TA 3SDBA 3ZMZA 2GOMA 3FX3A 3OS2A 3IWZA 2K4BA 1ETOA 3T5XA 3ECHA 4DOZA 2YX7A 2JJ7A 4CZZA 2ZBKA 1U9OA 2FUG2 5ILSA 2LC2A 1R5GA 2QKLB 1GV2A 3H5RA 2EH3A 1LDKB 2DYSH 1D0ZA 5E3OA 4HEA2 3TOAA 3FBIB 3SJMA 2NVYJ 2X1DA 3MAJA 2GAUA 3E5XA 3CJNA 3NRVA 5KCMA 1LVKA 5J8CA 1JJ8C 1B72A 1BBYA 5ILVA 1SVMA 4P9FA 1I27A 1P7IA 4XLEA 1A5JA 1O3TA 4XICA 3GTKJ 3CCJI 2WWYA 3CCLI 3CCEI 1OQYA 3WGGA 3GCMA 4UUTA 1RR7A 1TL8A 4OMYA 4ZZLA 5E79C 3G3ZA 4DNCA 2M87A 3A0BC 1FP2A 2DMPA 1I3AA 4Q5SF 2Q2EB 5J1YA 1BM9A 1HDDC 2DA6A 5EZHA 3G1LA 2JRMA 4WK8F 3RKQA 3JTGA 4QIWN 1WRJA 4J00A 5HOOA 3O6BB 3K1MA 1D0XA 2H8WA 4U0WA 1UHMA 1HXDA 3ZR8X 2QYOA 2HTJA 1D8KA 4P1WA 3HXLA 2CV1A 4DYCA 3JRIA 1VNDA 4AC0A 4PSWA 4IJAA 1H89C 1T0FC 3GFLA 4EGZA 1VQ8I 3HOVJ 2R7VA 2MD0A 2A6TA 1UG0A 5IT9Z 5ICGA 5FKLA 1X2NA 3WG9A 2XVCA 1MBEA 2ZB9A 2PJRB 2R7WA 3FXUA 3OYKA 2P5KA 2XRNA 3BTJA 1ZKGA 2HU9A 4M9SA 3GW2A 2H8RA 2AXLA 2ESNA 3K7AJ 3G1OA 4XQFA 5JHFA 2HYJA 2WY7Q 1JE8A 3FISA 2P5LC 5HLHA 2L4MA 4GYIA 2HWVA 4DGWB 1I50J 3BJAA 3MMYB 2DA7A 2JMWA 3IH2A 3ZPLA 1ZH5A 3K70C 2BV6A 2CQKA 3J7YJ 2HOTA 2QBYA 2OUMA 2Q1ZB 3HOZJ 4E6KG 2XSDC 2CWEA 2HOSA 1I1GA 4XN3A 1YX3A 1EH8A 1NK3P 3KP4A 1X4OA 2ZC2A 2E60A 2JVGA 2M1BA 4RMNA 4XRSG 4GDFA 1NTCA 2R5YA 1E17A 2W82A 4C3JJ 1U2WA 1X1PA 2P81A 2XF6A 3S2HJ 1ZYRF 2FE3A 2EFNA 1V5FA 3HBLA 3ZMSA 3G2BA 4E7HA 2DJNA 1QU3A 1K4SA 2KIMA 4IHWA 2XKPA 2EIKH 4XLAA 1R9TJ 1JGSA 4MGRA 1Z6RA 1YITI 5IY5H 2K7LA 3KIOA 4BE1A 3M3YJ 1B59A 1R49A 4MIMA 3K4LA 4NNJA 4EVIA 4MFDA 3K1PA 5LFAA 4M3FA 1TWGJ 3KE2A 2ESHA 4HDUA 3SXYA 1PYVA 1UELB 2VBZA 3CUOA 3IL2A 1D1CA 2E36A 4E4HA 5CVUA 4DZJA 5LLQA 3HDDA 3K1NA 3RI4A 4A3JJ 1R58A 2DAOA 3QOPA 1OFCX 5ICCA 5A2QK 4MEYF 2Y30A 5LEKA 1S29A 3QP5A 3KP5A 1BR4A 1U3EM 2KP6A 2GIVA 2WADA 3IC7A 2R4GA 1LVAA 3EUAA 3FK7A 4YG2F 1ZRFA 1IJWC 3PSFA 2OTLI 4B3XA 1QBJA 4YIIA 3SHFA 3QQAA 1V54H 4DYRA 3CJRB 1QA6A 1HSTA 1F5TA 1XN7A 2D1HA 1HDPA 1KU9A 2HVSA 4NC8A 1V5GA 4JYKA 2M0MA 1WJEA 2ZJ2A 5K5QA 1AWCA 3G4SI 3RZOJ 3HUGB 2KIFA 4L0YB 2ME6A 3F8MA 1FOYA 1YX5A 2EWNA 4CA0A 2EFPA 2DA3A 3K10A 3FHZA 4J19A 3S3OA 3H5NA 5FJ8J 2DFFA 2EA2A 3FXJA 3JRDA 1KONA 3DFGA 3BC8A 2LY1A 4KMUX 1ZARA 3CP8A 1MJAA 4MEXF 1QNTA 4MQ9F 2AS5F 3HM5A 3JCUC 4LK1F 4XOTA 5FLMJ 2WA0A 2WBMA 1B9NA 2VKEA 3BJOA 3GLLA 4LOCA 4X1EA 3BZCA 2CW0F 5EGOA 4ZTFA 2KIQA 4KNYA 5FB2A 2CMPA 1W36C 1C0WA 3GVAA 4JOMA 4UVBA 2F4MB 1Y56A 3MKYB 4MNUA 3HOTA 3FIWA 3I0TA 1IXSB 5FKKA 2V79A 4A0ZA 2JUCA 1FJLA 4MTEA 3GXOA 4NC7A 1AHDP 4EJTA 5JFRA 3HOXJ 2P7CB 3BP8A 1M1EB 1Q1VA 1SD7A 4A6EA 4HRIA 2B63J 4MQVA 3VSKA 2EZIA 5JVGF 2DLLA 5KNLA 3OYJA 2M4GA 2ACJA 4I6ZA 2HEOA 1GXPA 4XLPF 2R7DA 1YIJI 3QPLA 4U7DA 3T0YA 4BQNA 2XROA 4PJJA 3WGIA 2ID3A 4Q47A 2PFBA 4ASNA 2NYXA 4OIRF 1KU3A 2ISZA 2Q0OA 1BOAA 1LE8B 2O03A 2X6YA 2IPQX 1IN7A 4I02A 2F5CA 3FKJA 1ZG3A 4P55A 1H0MA 1Z21A 2QKMB 1KZHA 3ZMUA 1PP7U 2LDUA 3A01B 1TWAJ 3UR3C 3R4KA 1FPQA 1RKWA 1SD4A 2YR2A 3QPSA 3OYEA 4GXOA 2JN6A 4M9XA 4IEJA 5CYVA 4AVZA 2R7SA 1W36D 2BXZA 3RPUA 1ZN2A 4WCGA 4XK4A 3ZQ7A 4B1RA 1G3YA 5E3NA 4RB2C 1BW5A 2VE8A 3HEFA 2N8GA 2HDWA 1NH3A 2HPMA 1OCOH 1GXQA 3MZ8A 4BKXA 4Y17A 1XMKA 2D45A 4A69C 3BTIA 5DM7F 5F0CA 1Q1HA 2DCEA 4UB6C 1OR7A 3QYEA 4A5MA 4AYBA 1VFCA 1TWHJ 3LQQA 1WJAA 4U7BA 3CCMI 2WV1A 1B6AA 2LNBA 4BHPA 2IGKA 4KICA 2EIJH 2ELKA 3M1CA 1JKRC 5CQGA 1S7AA 2QM3A 1BC8C 5HVQC 4BDZA 4NHJA 5JR3A 1QO0D 5K7ZA 2XGDA 2KDZA 1HLVA 1KQ8A 3EETA 3BR5A 1ZRDA 1WI9A 2O7OA 2K27A 1KQ9A 1ULYA 2HKOA 4HNUA 3UKGA 2DA5A 2KHMA 3QOEA 2CQXA 2IRFG 2DT7B 2EIMH 4LMYA 4CSWA 4RGRA 1R1TA 4P9UA 1D0YA 3A1YA 1V55H 5H6QA 1QVUA 3RSNA 4LB5A 1X1AA 3ABTA 1P4WA 4BHCA 5L3BA 3DBHB 4ZYAA 3PNYA 3QU6A 2WAQA 3ZGKA 2R7RA 3EYIA 1GV5A 2DFEA 3HRSA 5BNGA 1VQ6I 1KYWA 3ESWB 1TZLA 3ZQGA 4M3EA 3COAC 3BR3A 3ZRGA 1KQ0A 5J3LA 3V7CA 2EZKA 4ZYDA 1LEAA 5FRNA 5DCFA 3LSMA 3OYLA 2QQAA 1WI3A 4G6TB 1RETA 3J80K 2AHQA 5KHDA 3ZP5A 1FLIA 4L18B 2XAFA 5KVRA 2BVLA 2CU7A 2LKSA 4EGYA 4BE0A 1T08B 2IVMA 5D5WB 4D1QA 3F6OA 4EJUA 3AAFA 1Z67A 3M8FA 3JRHA 1WH5A 3PJRA 1VQ7I 1FWZA 2KRCA 4YELA 1D1AA 1XSDA 2GOXB 3KP6A 1ZK8A 1EA3A 5EGOB 2ADUA 2H94A 1Z9CA 4X6AJ 4JX5A 4V2GA 1FT9A 3CDIA 3TO7A 5HLIA 3ZMVA 3FDYA 3AG4H 1W5CC 1Y8QB 1MBFA 2BY1A 3U1DA 1TLHB 1YIOA 1MIJA 4BEHA 2UXNA 1CF7A 3M9AA 2O9LA 1NK2P 2JT1A 1X3ZB 2CQNA 2V9KA 3R6SA 1OISA 5D6FA 5E17F 3NWTA 4FX4A 2K9MA 1MD0A 4FX0A 1BI1A 1ETYA 2L3DA 4BBSJ 3GFJA 1E3HA 3I54A 3Q0UA 3W6VA 1A35A 1WJCA 4I76A 1YRNA 2QQ9A 3BWGA 3L09A 4OIPF 1K83J 4MLOA 2IGMA 4M6VA 2ZXWH 2JK3A 3DEUA 3OSFA 3DXJF 2VASA 1N25A 1MJBA 1Z1DA 5FGMA 1T98A 3RYPA 1QZZA 3FF5A 4G7HF 2B0LA 1J09A 1GLNA 4AWXB 5DD8A 3TEDA 2BY3A 1ZR2A 1B1BA 4OIQF 1V5EA 4IVNA 4CYCB 2QUFA 4UV8A 3TW7A 1Z3XA 4HAMA 5KK1A 1T33A 5H6RA 2IP2A 1LUJB 4JK1X 1MH4A 3IP4B 5F27A 1W1WE 2G9WA 2VOPA 4E7KA 3K9TA 2LF7A 3B73A 3ISPA 4KIBA 4XBFA 5BOXA 4BJ5C 1YI2I 2OU2A 5J1UA 1I1SA 2FSWA 1OJLA 3ABLH 3IWFA 2DMNA 5FKOA 4YIRX 2ELJA 1TNSA 3NWSA 5L3DA 1HW5A 4HYEA 4LIVA 2VB6A 1FP1D 3NQOA 1D5YA 1STZA 1X1DA 3ROUA 2H6CA 3GTLJ 3OR2C 2OZ6A 2QQ8A 1R00A 3GTJJ 2ZMEA 2OD5A 2ZMEB 3HSRA 5F08A 3R0JA 4X0GA 3HOUJ 3BR0A 3KYCB 1HSJA 3K0LA 3WTXC 4II3A 2HKXA 3O8GA 2E5ZA 1JT6A 2A6HF 4CDGA 2ZNYA 1VZ0A 2C6YA 1IN8A 2EA4A 2KKOA 1Y1WJ 2F5VA 2E71A 5JLWA 3JAMZ 4UV9A 1IRZA 2NVUB 1JT0A 5M5WJ 4A3LJ 1T8IA 3WE3A 2COMA 5D4SA 2XAJA 2E1MB 2EJRA 2QSGX 4A3GJ 3JW4A 2W1OA 2VUMJ 1XGMA 1G3WA 1S5LC 2M34A 1ZTRA 2A68F 3KX2A 2PX9A 2ZSHB 4IPAA 1DPUA 1G59A 4XONA 4KA4A 4E7LA 4HLYA 4A12A 3J80Z 2VJ4A 3F72A 1O7FA 2NOGA 1TQMA 3O3KA 1R4NB 3DV8A 5CLSA 4A0XA 2QEXI 1QHHD 3ABUA 1WWXA 5E20A 5KAIC 3BG3A 3BG7A 3LA3A 3HG9A 1P9QC 1YLFA 2M8GX 2L9RA 4CYDA 1QZYA 3CJTB 4LB6B 2WV0A 3EUHA 3N05A 3KETA 1R1UA 2IS2A 2LOOA 4B09A 4CCJA 1D1BA 2DODA 4Y33A 3RPUD 1FTTA 2IS1A 1VTNC 1UAAA 1R5HA 3WE2A 1SVOA 2VOOA 2EFWA 2AQEA 2M5WA 1MMGA 1B9MA 2HXOA 3S93A 4L9JA 4EJVA 2CFXA 3FXLA 3G1MA 2VL8A 2HQ5A 2CW7A 1DU6A 4H4KC 2AQFA 4WXDA 1BR1A 2FD5A 1SD5A 4HQMA 5B1BH 5JLXA 2XV4S 4BJTA 3K70D 3QRFF 2LG4A 5FLXZ 3BR6A 3DKWA 4LITA 1LFUP 1MDMA 2W24A 3LFKA 4EATA 4IRIA 5C3EJ 3QPHA 3T8TA 3IV5A 5D8KB 5C44J 1LKXA 3ZQQA 4ZDOA 5K5RA 2OQRA 2BHZA 2EPFA 3OWTA 1R23A 2X6OA 3GEZA 3GF2A 4TV7A 3SEQA 2E7WA 4CICA 1ETVA 3E5QA 3RKXA 2KJCA 4IHVA 5D8LB 3BTCA 5M5YJ 4W97A 2V6CA 4U0VA 2DMUA 2Z1DA 2Z2SB 5LGNA 5EF6A 3F6VA 2DW4A 2WB1N 4BBRJ 1SFUA 5J4YA 2EFQA 3IHUA 3BPXA 2HQNA 2VONA 1HC8A 2RN7A 4DJAA 5M3FJ 5DUIA 1A36A 1JHHA 2UZKA 4IKFA 4GO1A 2BHYA 2RKHA 3CMEI 2HVQA 1NG7A 3K4NA 3FXRA 1WJBA 4NBQA 2HZDA 3R60A 4XLHA 3CCVI 2W4SA 4BXFA 2Q2EA 5FD5A 3KYDB 2LSOA 5B5EC 1F1ZA 1MZBA 2ME0A 3CF5F 2A69F 3W2AA 3A2KA 3WU1B 1OKRA 2JSCA 3SFZA 4EQQA 3RCOA 5BPIA 2WAFA 2MGQA 4EM0B 3LQRA 1YS6A 2OPTA 2DBBA 2KRHA 3H92A 2R7XA 3CO7C 2CFOA 1IF1A 4NQWA 4A5NA 4A3MJ 3DF8A 2NOJB 1XCBA 4O5VA 3DWLE 1X4PA 1XMAA 4Z6YA 3FMQA 3OYGA 1ZG5A 1PUEE 3H0DA 1U8BA 2PQ8A 3T8RA 3ONQA 5LGTA 2X0LA 4LFUA 5H20A 3HSFA 5J1RA 1ZHFA 1J9IA 2HR3A 5FLVA 1XDSA 2Y2ZA 1KU7A 5D5VB 5AIQA 3HUGA 3J7AO 3H1CA 1MMDA 4KN4X 2AXTC 2IGOA 4HX4A 3CCQI 3O8HA 3ZMDA 2CGPA 1O3RA 3CCRI 1XDUA 4BXXJ 2DMQA 2V1DA 3C2HA 3DTKA 5CVVA 2H27A 2JQ7A 3HYIA 3OYDA 4N0BA 4AYBN 4KJZA 2XAQA 2L01A 2GM4A 3P9KA 3GTGJ 3GO5A 3BG9A 3GWZA 2NNNA 2L0KA 1I6HJ 4WXCA 4XORA 4A3CJ 1S8NA 2DOAA 1Y39A 4KT6A 3RQIA 2L02A 2Y48A 4PZJA 3TBIA 4CCMA 5ICEA 2BVMA 3ZOBA 4ANJA 5BPDA 4UUVA 3HOYJ 5AIPA 3RTRA 2H1KA 2HTSA 2YU3A 1FYKA 4RAFA 3E6MA 1PUFA 2Z3YA 2RV8A 4AIDA 3K4BA 4BDYA 3LAJA 2ZXHA 2DQRA 2MD5A 3WODF 2JPCA 3DTIA 2RC4A 2I10A 4NDLA 4RAZA 2Y0MA 2R0QC 1ZQ3P 2DK8A 3E6DA 1P4AA 2LKXA 3FKIJ 2VQHA 2FF4A 2BEOA 5EG0B 4F93B 2L4AA 2M45A 3U9GA 5J6XA 2P0WA 4HQEA 2E5NA 2H6BA 5CVRA 4G12A 3GBGA 1G2HA 4M73A 2A5WA 1F9NA 2A61A 2Y75A 3I55I 2CH0A 1OPCA 4RGSA 2LY2A 3GFIA 1RRJA 3CLQA 1OMIA 2FMLA 3SQNA 3CUQC 3ASNH 3VDXA 4NQWB 1DU0A 2YX4A 2DU9A 2DFIA 4BQAA 3QYFA 4LJZF 2JA8J 1E0EA 2JZYA 2VC0A 3D1NI 1ETXA 1SFOJ 1LDJA 3C2BA 2XB0X 2QZ8A 4I99C 4RGXA 3WGHA 1F43A 1BL0A 3KZYA 2KMUA 3CDHA 5IYDJ 4D7NA 5HLGA 1BI0A 2BZTA 2DQLA 4LD5A 1ENHA 1FYLA 3C18A 3M1EA 3IKVA 2KLOA 2LR8A 2LY9A 3VPRA 3D0SA 4Q48A 3DTEA 4FE7A 4O6JA 3Q3SA 2M7BA 3I53A 2CUZA 1AU7A 3S16J 2IA2A 1IO2A 2DN0A 2L2OA 3E6CC 1LPQA 1IDZA 4B48A 2W00A 2G7UA 3GTQJ 4JX6A 1YJWI 4I01A 3LFUA 3DKXA 1IV8A 2KRFA 3CJQB 1Y0UA 2XIGA 4HV5A 3VODA 5GPAA 2CSOA 3GYHX 2KDOA 3M7GA 1U5TA 2WC2A 4B3AA 2MG4A 4U87A 1F36A 4RBOA 3D5LA 2MFZA 4N9HA 3OYAA 3F8FA 2EZLA 1T6SA 2PMHA 2MW8A 4BAYA 1T2KA 2NS0A 1R5ID 2VT2A 3ERED 2VLAA 1APLC 3OY9A 2QQBA 4MFEA 1JKPC 1HF0A 2YUSA 4M74A 3PUFA 5DDGA 4CH7A 4G9YA 3H3VK 3BG5A 4WWCA 2X85A 2JUGA 5LRRA 3LAPA 1TC3C 3LSRA 5LD2C 1XSVA 4XKBA 1MSEC 2PEXA 5EEHA 2KIUA 4ZJZA 3HOSA 4HNTA 1TT0A 4B44A 4U88A 1O4XA 3IRQA 1HCRA 1RC9A 2OV7A 1UHWA 1T0FA 3KPHA 3HL2A 3I9V2 3MD2A 3W6KB 1FOXA 4I7HA 3I56I 1XS9A 2ZNZA 2XAHA 3KP3A 1U5TB 2OCCH 3BOQA 3MCZA 1PDNC 2BBYA 1MBJA 4OOIA 2GLOA 3EQLF 2VIXA 2QLZA 4DW6A 1AKHA 4IHSA 3JAMK 5F64A 2MYSA 5ICFA 4C9YA 1PUFB 3LA2A 1UMQA 2XPWA 1BJAA 3LSIA 2HNHA 2KJBA 3K4KA 4CUGA 3PIPF 2MC4A 1K7AA 4UNOA 4GGGA 1LNWA 4ZZDA 1NHAA 5A2QZ 2CUJA 2RAEA 2UXXA 3KFWX 4IRGA 3W3CA 1MKMA 4QPOA 3K4MA 3PQKA 3VYSB 2PN6A 3FK6A 4BQQA 2VODA 3W6JB 2F6CA 4EMSA 2W84A 1GUUA 2Y0SN 4A3BJ 4PJ0C 1EH7A 1KYZA 2PBIA 3A01A 3J81Z 5DTDA 3P7NA 1RR8C 2KL4A 3RPQA 1JKQC 3TKYA 4EEFG 3WG7H 4G8XA 1YTYA 1LFBA 2K85A 4IOCF 2GA1A 2QBYB 3RIRA 2Y69H 3FBNB 3R61A 3HHHA 1SMTA 4RB1A 2H1LA 5C4JJ 2LRDA 1JUSA 2RREA 5FROA 3H3UA 4RLFA 3OIOA 3WU2C 1IN6A 3KYLA 1OYWA 2XSJC 3LSTA 1IGNA 3JRAA 5EDNA 5GAEJ 3V7SA 2NVQJ 3LA7A 4RGUA 3M8JA 2NRAC 3AFHA 1J5YA 2HOAA 1Y1VJ 1JGGA 2XAUA 3H3ZA 5ERIA 2CV2A 3BR1A 3L2VA 9ANTA 4KIGA 4BYYA 2VC1A 2EILH 3EDPA 1FYMA 4WF2A 3I58A 1EJ9A 1LEBA 3ELKA 4CCNA 1FIAA 4Y3OA 3DLAA 1HKTA 4OINF 1K4TA 2W85A 3HGYA 5TRDA 1X3WB 1FOKA 2IS6A 2X51A 5ILUA 1TQPA 4HF0A 3PO3J 1W7PD 3CC7I 4ESFA 1QHGA 4G6QA 2Q8KA 4MO7A 3OS0A 3D5RC 3QWLA 2VJ5A 3CUQA 4FHTA 3JREA 1SFXA 2JVHA 3NARA 2GWRA 3J7ZI 3BG6A 2IAIA 1PP8F 4RS8A 4HX8A 4Y4RA 1YRNB 1I39A 1DGRM 2CYYA 1IV6A 3GX4X 3HHGA 1IUYA 3ULQB 2J5OA 1TT5B 5CKTA 3R0AA 5HLTA 3VEPA 1O57A 2Z16A 3AG1H 2OZUA 2FX0A 4EJWA 3L7WA 3SEZA 3F3XA 3TQNA 4PJNA 1AA7A 2LLKA 1U78A 2XC7A 3L2WA 2GA2A 2R93J 2M30A 4KUMA 1TP4A 2DI3A 2IA1A 3KLOA 4C2MJ 4XRMA 2FOKA 3MKZA 3T1BA 3CCSI 3ASOH 1YW8A 5K1YA 1IXRC 2FRHA 1DPRA 3HKZN 3CMYA 1JXSA 3HZJA 4LG0B 3AG3H 4IF4A 1WPKA 3NAUA 1QGPA 3U1KA 1KU2A 3OS1A 1IZ1A 2LK2A 4L9VA 3HKZA 4E7ZA 1FNNA 2EK5A 4HNVA 2OQGA 3SZPA 3J7AY 2XPVA 1ORKA 2K9NA 2V1UA 5FRMA 2FA5A 2EV5A 4C2UA 4GFBA 2PMUA 3LSHA 2B7EA 3ABMH 4BXUA 4HSRA 2JA5J 5H2FC 3TDZC 4KISA 3IH4A 3I5UA 2R7OA 1MGTA 2ETHA 1WGXA 2L5QA 3CQZJ 3JRGA 2MLKA 3P5JA 1UG2A 3DPUA 5GAGJ 4Y7NJ 3EUHC 3L2UA 2VBXA 3VYTB 2FBIA 5GADJ 2G0EA 3SYTA 1OYIA 2VKHA 2JA6J 3QYBA 1H8AC 4IQ4A 2XUBA 3KZIC 4I98B 4E7JA 3CZ6A 3I64A 5LGUA 3IAS2 4M72A 4PFPA 3DEWA 4HZFA 1JHFA 3S17J 5HDNA 1RNLA 4KITB 4KDPA 1Z6TA 2Y9YA 3WTVC 1JJ6C 3D5SC 4DBRA 4B4CA 2QGUA 1H9TA 2LREA 1Z77A 2A07F 2MC3A 2ELHA 2L7MP 2XHKA 4IRHA 5BQTA 4AIKA 1JUPA 1XPXA 5EYRA 4M3GA 1IAWA 2DDAA 2GBYA 3PO2J 3LSPA 1R4MB 3HRUA 4CHUA 5E1WA 3SZGA 4L9TA 2ECBA 2JWTA 4N4OB 4OU0A 4PUSA 3IH3A 2QSHX 1WSUA 2X1EA 4QSHA 5EG0A 3HGGA 4QPQA 1W5TA 4FQGA 2HDCA 1QZEA 3AL0C 3OIPA 1TWFJ 3E0JB 2QWWA 3SFIA 3MKLA 3OOUA 2CQQA 1TWCJ 2K86A 1SEUA 1B8IA 2PI0A 3DP7A 1XB4A 2UV1A 4ESJA 1LDDA 1Y6IA 4I2OA 3TO6A 2ZJRF 2R5ZA 1WKMA 1U5TC 3CMAI 1IDYA 1T56A 1RKTA 1SD6A 1BR2A 3GUDA 2O5RA 4E7SA 4YFKF 3GZNB 1FIPA 2JSPA 5CVJA 3H5AA 4HF1A 1X19A 3Q9VA 4A3DJ 1MBGA 1FTZA 2V6EA 1ZGJA 2FMYA 1RI7A 2MH9A 3TMOA 1BA5A 2VKDA 4HF2A 2CQ7A 1R1VA 4CCKA 3VWBA 3OYNA 3BROA 1Z0XA 2HDDA 2DMTA 3F21A 1DQUA 3OYFA 1S6LA 2CV0A 3S1RJ 1GT0C 3AG2H 4HW0A 1DP7P 2CS3A 4BUPA 2O61A 2P4WA 1XC5A 4JQFA 3E5UA 2EINH 4F52A 2W25A 1IRXA 4ENKA 4A3EJ 1YJ9I 4Y15A 1I6XA 3ABKH 3FXKA 1EKEA 1KGSA 4F55A 4CZCA 3IUOA 1S9HA 3I59B 4GYGA 3I4PA 4R1HA 2VBYA 4OAZA 4BY1J 3VYUB 5DYMA 2X1CA 5KAFC 2I5UA 2H09A 2GQQA 1J59A 5D6EA 3FXOA 2MSYA 1VQ9I 1MBKA 4XRFA 2VT3A 2LVSA 1XGNA 2DA1A 3CCYA 1FC3A 3RDIA 3JSPA 2FEZA 1ON2A 3QU3A 4LK0F 4PJLA 1SMYF 2O0YA 1IRGA 3S8PA 4P96A 4IHYA 5E3MA 5TJJA 1OCTC 2BY2A 1FMWA 1XMXA 4ZYGA 4N4NB 3B6AA 1Z91A 3WTZA 1DDNA 4FASD 3E7LA 3BTLA 5GTIC 5K7HA 4XSXF 3HRMA 1TW2A 4O3MA 2HQAA 2TDXA 4RA2A 1XGSA 2JA2A 3OYBA 1X1CA 2K3PA 3PQJA 2VPRA 5BS6A 4YEJA 1CQTA 4NC6A 1SFEA 4KYWA 2VQLA 2P5VA 2HGCA 2A6EF 4CCLA 2DO7A 4RM3A 1XTAA 4A0YA 1ZGWA 5LBQA 2K3FA 2IS4A 1H9GA 2M2EA 2LBFB 4AU7A 3LMMA 3M8EA 1QRYA 1XGOA 1ACIA 2YPRA 4ENJA 2QVOA 2W48A 3CDLA 2OJED 2R7QA 3FHNA 1YYVA 5F1RA 2DDBA 4ABZA 2WB1A 2V1NA 2DJIA 5E8GA 4YFNF 1BI3A 3F0CA 3PM1A 4XRSA 4M3BA 3OOPA 4LLNA 1W5SA 3SZTA 3GLXA 4D0PA 4UUSB 3J81K 2LYCA 1K6OA 1XG1A 3HOWJ 1HOMA 4HLXA 5D4RA 3CUQB 2CRGA 3V7RA 4XNFA 2NAZA 1XCVA 4KT5C 4C3IJ 5LEJA 2Z5UA 3OYMA 2CUEA 3QPTA 3K2ZA 3KEYA 3RKWA 1YFHA 1E2XA 1IC8A 1WFXA 1XD7A 4M9ZA 5DS9A 4Z2YA 2R5ZB 2LF8A 4ENMA 2FU4A 4IZZA 4L5JA 3WTTC 2HYGD 1FEXA 4RDUA 4C3HJ 4UVCA 3ZQLA 2Y9ZA 3I4MJ 4BQOA 2Z99A 4G7OF 1BJZA 1W7PB 3LSKA 2B9SA 1CGPA 2DTZA 2F5DA 5J40A 1ZR4A 3S3NA 1E3OC 1E3PA 5F1JA 3MFKA 1K6YA 5IP6A 2NVXJ 2EV0A 1BW6A 4LLLA 5D5XB 4I0AA 1HBXG 1NG6A 2VXDA 3K4JA 3FM3A 2ECCA 2L9NA 4CCOA 4ZDPA 4RAYA 2P6SA 4AD9A 3H36A 4IL6C 2IEKA 1WH7A 5GTHC 2XF7A 4UUSA 1ZG1A 4DBQA 1V4RA 3S15J 2I8DA 2HXIA 2RNGA 2WY8Q 1LE8A 1FOWA 5C4XJ 1ETWA 3DKYA 2E35A 3F9KA 3KLNA 4WX9A 4FT8A 3M07A 1D5VA 2M3AA 5DUKA 2PLYA 3EUKL 2GXAA 3G73A 3HTUA 3CMMA 1UZCA 2HPIA 1U8RA 4HX7A 2BOLA 2E34A 4Y52J 1ONVA 4BNCA 1FBQA 4HG2A 4ZTJA 3L9FA 3TL4X 5B1AH 3IKTA 1RUOA 4IXAA 3BY6A 4L0ZB 4AM3A 5HS8A 2V4JC 1H88C 3Q0WA 2BW3B 4L5EA 1PJRA 1MMAA 3CLOA 2ZCWA 3JSOA 2R7UA 1FY7A 2XDVA 3S32A 2XGCA 3S3MA 2X4HA 4F92B 4J01A 3A0HC 3CC4I 1SANA 1SAUA 1BOBA 2R7FA 4BGDA 2HVRA 2HOEA 5BMZA 4XMYA 1UFMA 1IXCA 2E1OA 1W0UA 4MHGA 1WJ5A 4DIQA 3CTAA 3CP2A 4XKVA 2V9PA 4LG0A 4A3IJ 2FQ3A 5LHHA 2QF7A 5E18F 4U0YA 2M9HA 1QPMA 4ETSA 4HDVA 1P4XA 2CO5A 5CVIA 2FBHA 2NXNB 3JR9A 2OF7A 1TQIA 4D5CA 3VSLA 5FLXK 1YE9A 2DT5A 3I59A 3RQ4A 2LBFA 2OC6A 3HB9A 1WJFA 3RYRA 3AL0B 3V4GA 3IRRA 4N9IA 2FNPA 2LP0A 3F8CA 1TBXA 2RQQA 1GVJA 2IJLA 1WQ2A 1MMSA 1ZREA 1JUMA 1USSA 3E3VA 2E2HJ 1T39A 3F23A 2IGNA 4RM2A 5HS9A 3PIOF 4BJ6C 3VB2A 1QPIA 4M6XA 2L54A 4UXNA 1KA8A 3RKYA 3C2GA 1R71A 4JP0A 1OCZH 3FM5A 3MQ0A 4M6YA 4M71A 2CG4A 3DQVC 1ZLKA 1REPC 2KISA 3CD6I 1R22A 3FXQA 4BY7J 1U0JA 2BE5F 2QA4I 3K2AA 3OYHA 4KFCA 4EJOA 3PSIA 2BY0A 1YW9A 1HKSA 1LQ1A 5IT9K 3EYYA 4K2EA 1FBSA 2QCOA 4PGGA 1S7OA 2CUFA 1BI2A 2LD5A 4HV6A 1IN4A 4ZC3A 3B6CA 1ODDA 3WTWC 5J47A 2A3SA 3OYCA 5IOYA 1MW7A 3MKWB 1FX7A 1XX5A 1TTYA 3GMEA 3WU0A 1OCRH 1J7KA 2ZXJA 1ZELA 3S2WA 1D8JA 4HSTA 2P7VB 5IP7J 4V2FA 5DEQA 4DYQA 1TNTA 4OWRB 4I0BA 4XR6A 4HOBA 4HA8A 1YHQI 3A03A 1GDTA 4XLCA 1UJ8A 2L7FP 2ZFUA 2X6WA 2V7FA 4FCYA 1JI8A 2DK5A 4L5IA 3NEUA 3HC7A 2GIZA 2OBPA 4BHBA 2BYVE 1N75A 3QAHA 4RB0A 1I3QJ 4W1UA 4P5OA 2MBFA 1P2FA 2R3SA 1FMVA 2LKPA 2XPUA 3Q0VA 4A2UA 5F0HA 2A05A 3GTPJ 2DFHA 2Y0SA 2VJIA 1JKOC 2OA4A 2R5YB 1BC7C 4V19K 3OV8A 3BQZA 5J8FA 3BT9A 4G7ZF 3HPGA 1IUFA 1VF9A 2W57A 1S7EA 2ICWG 2WAQN 4CYCA 2ZFWA 3RJPA 3PNVA 4CXFA 5DCMA 2VKVA 3LNQA 3EPZA 4EV0A 1VQLI 4PGHA 3CO6C 1B8IB 1IRFA 3P9IA 3PNTA 3H0GJ 3QP6A 3V8KA 1ERDA 5HNHA 4E70A 3LSJA 5FKNA 1W7PA 1FZPB 3ZXSA 2STTA 2ZO4A 1MH3A 4GRIA 1G4DA 4ZH4F 5FFXA 2F5FA 1DUXC 2PJRA 1GVDA 5CPRB 4C2TA 4BL0B 3HSEA 4IHXA 2PMZA 2DOEA 3HJEA 5HODA 2DOFA 2F2EA 4A6DA 2QENA 4LG3A 4B8XA 4D7MA 3C7JA 2XKOA 4BH9A 1VQMI 2ZKZA 2RGVA 3BCAA 3G6EI 4UB8C 2L7KA 2FBKA 4AVPA 3S1MJ 5IYBJ 5ED4A 4AIHA 5LRSA 1WCMJ 5HNFA 4II2A 4CO8A 1HA8A 2BGCA 5LHGA 3LOCA 3OYIA 3PUBA 4JX4A 4BEHB 3DU5A 4M3DA 2DYRH 2NNYA 4QTRA 3TP3A 1Y0NA 3BLYA 5EEGA 1SC7A 5AONA 3U2RA 1YOVB 3ZN1A 3L2QA 2D2WA 4RLQA 4FISA 2LH9A 2K02A 3HTSB 5L3EA 2COBA 3HIFA 2ZJQF 4EM1A 2PG4A 1YW7A 3GZ5A 2BXYA 5FO5A 1A04A 3I71A 6PAXA 3I3LA 1ETQA 3F8NA 2FQ4A 2P6TA 4ESBA 1Z3YA 5J4VA 4G94A 3F22A 2HI3A 4OAYA 4ZDLA 3S2DJ 3OL4A 5E8IA 4QLCU 1WZ2A 2A5YB 1Z05A 3DBRB 1USTA 4RAGA 3ZQIA 1J75A 2E19A 1SVLA 1O3QA 2YS9A 4XLNF 2BW3A 5FKMA 4KIFA 3L00A 5M3MJ 2EB7A 2EFOA 5DD4A 1RIOH 3WTUC 1MNMC 2WTEA 2IT0A 5K5OA 1XSXA 4S04A 1ZRCA 3H35A 2L7ZA 2DA2A 1G8XA 1LFPA 2O8KA 2M4KA 1A6IA 5GAHJ 4IX7A 1K61A 4JBAA 1R36A 4WXHA 2O6GE 1OR7C 1QVTA 2EQRA 2MABA 1MDMB 4Q4ZF 4NUBA 3WHBA 1T38A 3WHCA 1UCRA 3V42A 2E1NA 2RVCA 2HFHA 3I4NJ 4XLFA 5IYCJ 3H9QA 1DGWY 3BJ6A 2FOWA 4E7IA 3SDGA 2FXAA 2HS5A 5CJ9A 4UY8I 3TW6A 1Y8RB 4FETA 4PFOA 2CJJA 3FXMA 1EF4A 2RQPA 3H9JA 1B72B 3DEEA 2YSRA 2PJPA 3BDDA 2L9SA 4PK4A 4L9NA 2JA7J 1POGA 2M8EA 5HS7A 2FJ1A 4UHTA 2VJJA 1ZLJA 1WHUA 2V26A 1K78B 1AOYA 4ZYHA 2STWA 4FE4A 1BN5A 2Y31A 2ZSIB 3OSGA 2D5VA 2JTVA 4S05A 1MNEA 1VQNI 2OTJI 3Q9SA 1VQKI 5GP9A 1MNDA 2LTPA 3QODA 3PFIA 3X2QH 2KZGA 1VQ4I 2GZWA 3DBLB 3P9CA 3G71I 4G6DA 3WTYC 5F0FA 3L1PA 1RZ4A 3E1SA 5TISC 4S0HB 5K7FA 5B3SH 1FSEA 4XKCA 2E2JJ 3MN2A 2JPBA 1P92A 1YS7A 2MA3A 3LL7A 2ISYA 1DP3A 2NS7A 2KFDA 1ZAOA 2O3FA 3HRTA 3FMSA 3OR1C 4Y13A 2HYFA 3WTSC 4IQJA 1K79A 5EEAA 4HPQA 3GTOJ 4A3FJ 1FBUA 1O3SA 1WVRA 2HQRA 4A3KJ 3TP0A 1BIAA 4UVAA 4ENNA 4GCVA 2F4OB 3HPHA 1OLTA 1LB2A 3ZQFA 3Q5FA 4ITVA 3DPTA 5F6FA 1GHCA 3CESA 4HBLA 3TDUC 4AIJA 2XASA 1MBHA 2KQRA 2AO9A 4FTHA 1OYYA 1U9NA 5L3GA 2LFBA 1ON1A 1A31A 3ERMA 2NS8A 3L2CA 2JRTA 1JTXA 2RDPA 2FNAA 1K78A 2IXSA 3MEXA 4A93J 4IOAF 1SFKA 3ECOA 3K6GA 3E97A 2KPMA 4I09A 2K9QA 5HDGA 2X9DA 1VQ5I 2IA0A 2EBIA 3KP7A 2EZHA 5JI6A 1V3FA 3S1NJ 4B47A 3IAM2 2Z33A 1HW2A 5E1XA 1I5ZA 4YIFA 3KEOA 4OMZA 4IO9F 5HDKA 1X1BA 3UNGC 1EV7A 5F04A 1R6RA 1IW7F 2D1VA 2X48A 5FFZA 3ZMTA 2VQGA 4B43A 2VQCA 3DU6A 3REOA 3ZQHA 5FD6A 4D5FA 3N4MA 5IT3A 4XOPA 3S14J 3TOBA 4F7ZA 5GPCA 1G3TA 5IPAA 2ID6A 4LIUA 2DXIA 2NVTJ 1MSFC 4DZPA 2F48A 3KZZA 4D9JA 1UHSA 3LWFA
chains in the Genus database with same CATH topology
3CCLI 3CCEI 1VQ8I 3CMAI 1VQPI 2E34A 1VQ6I 1YITI 1FOXA 1YJNI 5DM7F 3G4SI 4V19K 2QEXI 3I56I 1VQ7I 2QA4I 4IO9F 5JVGF 3CF5F 1Y39A 1VQ9I 1MMSA 1YHQI 1FOYA 2OTLI 5GAEJ 3CC7I 1S72I 5DM6F 3CCMI 3CCQI 3PIOF 2ZJPF 1YIJI 1YJ9I 3CCRI 2FOWA 1VQNI 2OTJI 3I55I 1VQKI 1HC8A 2JQ7A 5GAGJ 4UY8I 2K3FA 1QA6A 3CC2I 1FOWA 2NXNB 1ACIA 1VQLI 2E35A 2H8WA 3DLLF 3CJTB 2E36A 1VQMI 4IOAF 3CMEI 3J7ZI 1VQ4I 3CC4I 3G6EI 2ZJQF 3CCSI 5GADJ 3G71I 2ZJRF 5GAHJ 3J7YJ 3CCUI 3CCJI 1YI2I 1VQ5I 1YJWI 1VQOI 3CD6I 3PIPF 3CCVI 4IOCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL I;  3CCE I;  1VQ8 I;  3CMA I;  1VQP I;  2E34 A;  1VQ6 I;  1YIT I;  1FOX A;  1YJN I;  5DM7 F;  3G4S I;  4V19 K;  2QEX I;  3I56 I;  1VQ7 I;  2QA4 I;  4IO9 F;  5JVG F;  3CF5 F;  1Y39 A;  1VQ9 I;  1MMS A;  1YHQ I;  1FOY A;  2OTL I;  5GAE J;  3CC7 I;  1S72 I;  5DM6 F;  3CCM I;  3CCQ I;  3PIO F;  2ZJP F;  1YIJ I;  1YJ9 I;  3CCR I;  2FOW A;  1VQN I;  2OTJ I;  3I55 I;  1VQK I;  1HC8 A;  2JQ7 A;  5GAG J;  4UY8 I;  2K3F A;  1QA6 A;  3CC2 I;  1FOW A;  2NXN B;  1ACI A;  1VQL I;  2E35 A;  2H8W A;  3DLL F;  3CJT B;  2E36 A;  1VQM I;  4IOA F;  3CME I;  3J7Z I;  1VQ4 I;  3CC4 I;  3G6E I;  2ZJQ F;  3CCS I;  5GAD J;  3G71 I;  2ZJR F;  5GAH J;  3J7Y J;  3CCU I;  3CCJ I;  1YI2 I;  1VQ5 I;  1YJW I;  1VQO I;  3CD6 I;  3PIP F;  3CCV I;  4IOC F; 
#chains in the Genus database with same CATH topology
 1HQC A;  4BS9 A;  1UB9 A;  1RES A;  3S1Q J;  2E2I J;  3VOE A;  1G6N A;  3A02 A;  4DQ2 A;  2MH2 A;  2CW8 A;  3E6B A;  5DM6 F;  1OCP A;  2RNJ A;  3KEQ A;  1SAX A;  4XL9 A;  1IN5 A;  3VFZ A;  3W2W A;  3AKZ A;  1TW3 A;  2XAG A;  3CF2 A;  4R8H A;  3TGN A;  1ZGA A;  1Z7L A;  4PSX A;  5IP9 J;  2XGX A;  5LHI A;  3O2P E;  3JRF A;  3C1D A;  5E3L A;  4F3Q A;  1RUN A;  4KMF A;  2E7X A;  2DPU A;  1R7J A;  2K40 A;  1CF7 B;  1YQA A;  4CGZ A;  1X2M A;  2VE9 A;  3V8J A;  4ZYE A;  5EJC A;  5M5X J;  2XRL A;  3OIQ A;  3TO9 A;  1FSH A;  2ZXI A;  1JTY A;  2XF5 A;  3JRC A;  2TRT A;  2ZME C;  3KP2 A;  2Z9O A;  5L3F A;  2P8T A;  3ML6 A;  3F8B A;  3PFY A;  5CQE A;  4RB3 C;  3BPV A;  4NB5 A;  4PCQ A;  2W7N A;  2IBD A;  2KT0 A;  2K4J A;  3MWM A;  4KN7 X;  2K9S A;  2V9V A;  1HW1 A;  5E1Z B;  3DCF A;  2M7A A;  1X58 A;  4BU2 A;  2R92 J;  3MZH A;  2IW5 A;  3VYR B;  1YO5 C;  1F4K A;  1S72 I;  2EV6 A;  3ZCO A;  4ON0 A;  5B66 C;  2R7Z J;  4H0E A;  4YRV A;  4OIO F;  3MVP A;  4XID A;  1W0T A;  1O7L A;  4QWQ A;  2V1X A;  5IOZ A;  1VI0 A;  3W2V A;  3N97 A;  3BR2 A;  3GFM A;  3DPL C;  4AUX A;  2DPD A;  4LLG F;  1HKQ A;  2KZV A;  1ETK A;  1LJ9 A;  2TCT A;  1ITY A;  4C30 A;  3LSG A;  3BZK A;  3RZD J;  2K5C A;  1D3Y A;  1Z7U A;  2UWM A;  1X3U A;  1B4A A;  5D5U B;  1YG2 A;  2DT6 A;  1MMN A;  3K69 A;  1MJ9 A;  5DCM B;  1G3S A;  1L3L A;  4XM3 A;  1J0R A;  2F5E A;  2J5P A;  2OAZ A;  2DA4 A;  2G7H A;  4R79 A;  2ZJP F;  4IHT A;  3GTM J;  1T95 A;  3U21 A;  2O8X A;  1J2X A;  1WJD A;  2PMZ N;  3A4C A;  1IG7 A;  2L9V A;  5TGT A;  4EM2 A;  1N78 A;  3JTH A;  4PJM A;  1RPW A;  2VPL A;  1YJN I;  4XKW A;  2VBW A;  4MTD A;  2VN2 A;  2DTR A;  4F91 B;  1P6R A;  1W4M A;  2QSF X;  3ZQC A;  2UUZ A;  1BIB A;  2F4I A;  5DV5 A;  1L0O C;  3OL3 A;  3M4O J;  2VXZ A;  3FZV A;  2X6X A;  2YU9 J;  2LMD A;  5JVT A;  4XSZ F;  3B02 A;  3H9G A;  5L3C A;  4LGW A;  1P7J A;  2M0C A;  1N77 A;  1EH6 A;  2VI6 A;  2MLG A;  2OCE A;  1U6G A;  3JRB A;  1VQO I;  4PDK A;  3BQY A;  2E1C A;  2K9L A;  2WAE A;  1VQP I;  3MZY A;  2E1M C;  3PL8 A;  3K4C A;  4XN0 A;  3V8L A;  3GZ6 A;  4BE2 A;  2HZT A;  3L2R A;  3C3W A;  3FMR A;  1A6Q A;  3BCB A;  4YFX F;  3OMY A;  1QQI A;  3BZ6 A;  2XGE A;  3CC2 I;  3FWE A;  1OCC H;  2GXG A;  3DLL F;  2XB5 A;  5EZG A;  2GXB A;  5JHU A;  1PVE A;  3ZN0 A;  1AKH B;  3KCC A;  1S3J A;  4BAC A;  3CCU I;  2R7T A;  3SDB A;  3ZMZ A;  2GOM A;  3FX3 A;  3OS2 A;  3IWZ A;  2K4B A;  1ETO A;  3T5X A;  3ECH A;  4DOZ A;  2YX7 A;  2JJ7 A;  4CZZ A;  2ZBK A;  1U9O A;  2FUG 2;  5ILS A;  2LC2 A;  1R5G A;  2QKL B;  1GV2 A;  3H5R A;  2EH3 A;  1LDK B;  2DYS H;  1D0Z A;  5E3O A;  4HEA 2;  3TOA A;  3FBI B;  3SJM A;  2NVY J;  2X1D A;  3MAJ A;  2GAU A;  3E5X A;  3CJN A;  3NRV A;  5KCM A;  1LVK A;  5J8C A;  1JJ8 C;  1B72 A;  1BBY A;  5ILV A;  1SVM A;  4P9F A;  1I27 A;  1P7I A;  4XLE A;  1A5J A;  1O3T A;  4XIC A;  3GTK J;  3CCJ I;  2WWY A;  3CCL I;  3CCE I;  1OQY A;  3WGG A;  3GCM A;  4UUT A;  1RR7 A;  1TL8 A;  4OMY A;  4ZZL A;  5E79 C;  3G3Z A;  4DNC A;  2M87 A;  3A0B C;  1FP2 A;  2DMP A;  1I3A A;  4Q5S F;  2Q2E B;  5J1Y A;  1BM9 A;  1HDD C;  2DA6 A;  5EZH A;  3G1L A;  2JRM A;  4WK8 F;  3RKQ A;  3JTG A;  4QIW N;  1WRJ A;  4J00 A;  5HOO A;  3O6B B;  3K1M A;  1D0X A;  2H8W A;  4U0W A;  1UHM A;  1HXD A;  3ZR8 X;  2QYO A;  2HTJ A;  1D8K A;  4P1W A;  3HXL A;  2CV1 A;  4DYC A;  3JRI A;  1VND A;  4AC0 A;  4PSW A;  4IJA A;  1H89 C;  1T0F C;  3GFL A;  4EGZ A;  1VQ8 I;  3HOV J;  2R7V A;  2MD0 A;  2A6T A;  1UG0 A;  5IT9 Z;  5ICG A;  5FKL A;  1X2N A;  3WG9 A;  2XVC A;  1MBE A;  2ZB9 A;  2PJR B;  2R7W A;  3FXU A;  3OYK A;  2P5K A;  2XRN A;  3BTJ A;  1ZKG A;  2HU9 A;  4M9S A;  3GW2 A;  2H8R A;  2AXL A;  2ESN A;  3K7A J;  3G1O A;  4XQF A;  5JHF A;  2HYJ A;  2WY7 Q;  1JE8 A;  3FIS A;  2P5L C;  5HLH A;  2L4M A;  4GYI A;  2HWV A;  4DGW B;  1I50 J;  3BJA A;  3MMY B;  2DA7 A;  2JMW A;  3IH2 A;  3ZPL A;  1ZH5 A;  3K70 C;  2BV6 A;  2CQK A;  3J7Y J;  2HOT A;  2QBY A;  2OUM A;  2Q1Z B;  3HOZ J;  4E6K G;  2XSD C;  2CWE A;  2HOS A;  1I1G A;  4XN3 A;  1YX3 A;  1EH8 A;  1NK3 P;  3KP4 A;  1X4O A;  2ZC2 A;  2E60 A;  2JVG A;  2M1B A;  4RMN A;  4XRS G;  4GDF A;  1NTC A;  2R5Y A;  1E17 A;  2W82 A;  4C3J J;  1U2W A;  1X1P A;  2P81 A;  2XF6 A;  3S2H J;  1ZYR F;  2FE3 A;  2EFN A;  1V5F A;  3HBL A;  3ZMS A;  3G2B A;  4E7H A;  2DJN A;  1QU3 A;  1K4S A;  2KIM A;  4IHW A;  2XKP A;  2EIK H;  4XLA A;  1R9T J;  1JGS A;  4MGR A;  1Z6R A;  1YIT I;  5IY5 H;  2K7L A;  3KIO A;  4BE1 A;  3M3Y J;  1B59 A;  1R49 A;  4MIM A;  3K4L A;  4NNJ A;  4EVI A;  4MFD A;  3K1P A;  5LFA A;  4M3F A;  1TWG J;  3KE2 A;  2ESH A;  4HDU A;  3SXY A;  1PYV A;  1UEL B;  2VBZ A;  3CUO A;  3IL2 A;  1D1C A;  2E36 A;  4E4H A;  5CVU A;  4DZJ A;  5LLQ A;  3HDD A;  3K1N A;  3RI4 A;  4A3J J;  1R58 A;  2DAO A;  3QOP A;  1OFC X;  5ICC A;  5A2Q K;  4MEY F;  2Y30 A;  5LEK A;  1S29 A;  3QP5 A;  3KP5 A;  1BR4 A;  1U3E M;  2KP6 A;  2GIV A;  2WAD A;  3IC7 A;  2R4G A;  1LVA A;  3EUA A;  3FK7 A;  4YG2 F;  1ZRF A;  1IJW C;  3PSF A;  2OTL I;  4B3X A;  1QBJ A;  4YII A;  3SHF A;  3QQA A;  1V54 H;  4DYR A;  3CJR B;  1QA6 A;  1HST A;  1F5T A;  1XN7 A;  2D1H A;  1HDP A;  1KU9 A;  2HVS A;  4NC8 A;  1V5G A;  4JYK A;  2M0M A;  1WJE A;  2ZJ2 A;  5K5Q A;  1AWC A;  3G4S I;  3RZO J;  3HUG B;  2KIF A;  4L0Y B;  2ME6 A;  3F8M A;  1FOY A;  1YX5 A;  2EWN A;  4CA0 A;  2EFP A;  2DA3 A;  3K10 A;  3FHZ A;  4J19 A;  3S3O A;  3H5N A;  5FJ8 J;  2DFF A;  2EA2 A;  3FXJ A;  3JRD A;  1KON A;  3DFG A;  3BC8 A;  2LY1 A;  4KMU X;  1ZAR A;  3CP8 A;  1MJA A;  4MEX F;  1QNT A;  4MQ9 F;  2AS5 F;  3HM5 A;  3JCU C;  4LK1 F;  4XOT A;  5FLM J;  2WA0 A;  2WBM A;  1B9N A;  2VKE A;  3BJO A;  3GLL A;  4LOC A;  4X1E A;  3BZC A;  2CW0 F;  5EGO A;  4ZTF A;  2KIQ A;  4KNY A;  5FB2 A;  2CMP A;  1W36 C;  1C0W A;  3GVA A;  4JOM A;  4UVB A;  2F4M B;  1Y56 A;  3MKY B;  4MNU A;  3HOT A;  3FIW A;  3I0T A;  1IXS B;  5FKK A;  2V79 A;  4A0Z A;  2JUC A;  1FJL A;  4MTE A;  3GXO A;  4NC7 A;  1AHD P;  4EJT A;  5JFR A;  3HOX J;  2P7C B;  3BP8 A;  1M1E B;  1Q1V A;  1SD7 A;  4A6E A;  4HRI A;  2B63 J;  4MQV A;  3VSK A;  2EZI A;  5JVG F;  2DLL A;  5KNL A;  3OYJ A;  2M4G A;  2ACJ A;  4I6Z A;  2HEO A;  1GXP A;  4XLP F;  2R7D A;  1YIJ I;  3QPL A;  4U7D A;  3T0Y A;  4BQN A;  2XRO A;  4PJJ A;  3WGI A;  2ID3 A;  4Q47 A;  2PFB A;  4ASN A;  2NYX A;  4OIR F;  1KU3 A;  2ISZ A;  2Q0O A;  1BOA A;  1LE8 B;  2O03 A;  2X6Y A;  2IPQ X;  1IN7 A;  4I02 A;  2F5C A;  3FKJ A;  1ZG3 A;  4P55 A;  1H0M A;  1Z21 A;  2QKM B;  1KZH A;  3ZMU A;  1PP7 U;  2LDU A;  3A01 B;  1TWA J;  3UR3 C;  3R4K A;  1FPQ A;  1RKW A;  1SD4 A;  2YR2 A;  3QPS A;  3OYE A;  4GXO A;  2JN6 A;  4M9X A;  4IEJ A;  5CYV A;  4AVZ A;  2R7S A;  1W36 D;  2BXZ A;  3RPU A;  1ZN2 A;  4WCG A;  4XK4 A;  3ZQ7 A;  4B1R A;  1G3Y A;  5E3N A;  4RB2 C;  1BW5 A;  2VE8 A;  3HEF A;  2N8G A;  2HDW A;  1NH3 A;  2HPM A;  1OCO H;  1GXQ A;  3MZ8 A;  4BKX A;  4Y17 A;  1XMK A;  2D45 A;  4A69 C;  3BTI A;  5DM7 F;  5F0C A;  1Q1H A;  2DCE A;  4UB6 C;  1OR7 A;  3QYE A;  4A5M A;  4AYB A;  1VFC A;  1TWH J;  3LQQ A;  1WJA A;  4U7B A;  3CCM I;  2WV1 A;  1B6A A;  2LNB A;  4BHP A;  2IGK A;  4KIC A;  2EIJ H;  2ELK A;  3M1C A;  1JKR C;  5CQG A;  1S7A A;  2QM3 A;  1BC8 C;  5HVQ C;  4BDZ A;  4NHJ A;  5JR3 A;  1QO0 D;  5K7Z A;  2XGD A;  2KDZ A;  1HLV A;  1KQ8 A;  3EET A;  3BR5 A;  1ZRD A;  1WI9 A;  2O7O A;  2K27 A;  1KQ9 A;  1ULY A;  2HKO A;  4HNU A;  3UKG A;  2DA5 A;  2KHM A;  3QOE A;  2CQX A;  2IRF G;  2DT7 B;  2EIM H;  4LMY A;  4CSW A;  4RGR A;  1R1T A;  4P9U A;  1D0Y A;  3A1Y A;  1V55 H;  5H6Q A;  1QVU A;  3RSN A;  4LB5 A;  1X1A A;  3ABT A;  1P4W A;  4BHC A;  5L3B A;  3DBH B;  4ZYA A;  3PNY A;  3QU6 A;  2WAQ A;  3ZGK A;  2R7R A;  3EYI A;  1GV5 A;  2DFE A;  3HRS A;  5BNG A;  1VQ6 I;  1KYW A;  3ESW B;  1TZL A;  3ZQG A;  4M3E A;  3COA C;  3BR3 A;  3ZRG A;  1KQ0 A;  5J3L A;  3V7C A;  2EZK A;  4ZYD A;  1LEA A;  5FRN A;  5DCF A;  3LSM A;  3OYL A;  2QQA A;  1WI3 A;  4G6T B;  1RET A;  3J80 K;  2AHQ A;  5KHD A;  3ZP5 A;  1FLI A;  4L18 B;  2XAF A;  5KVR A;  2BVL A;  2CU7 A;  2LKS A;  4EGY A;  4BE0 A;  1T08 B;  2IVM A;  5D5W B;  4D1Q A;  3F6O A;  4EJU A;  3AAF A;  1Z67 A;  3M8F A;  3JRH A;  1WH5 A;  3PJR A;  1VQ7 I;  1FWZ A;  2KRC A;  4YEL A;  1D1A A;  1XSD A;  2GOX B;  3KP6 A;  1ZK8 A;  1EA3 A;  5EGO B;  2ADU A;  2H94 A;  1Z9C A;  4X6A J;  4JX5 A;  4V2G A;  1FT9 A;  3CDI A;  3TO7 A;  5HLI A;  3ZMV A;  3FDY A;  3AG4 H;  1W5C C;  1Y8Q B;  1MBF A;  2BY1 A;  3U1D A;  1TLH B;  1YIO A;  1MIJ A;  4BEH A;  2UXN A;  1CF7 A;  3M9A A;  2O9L A;  1NK2 P;  2JT1 A;  1X3Z B;  2CQN A;  2V9K A;  3R6S A;  1OIS A;  5D6F A;  5E17 F;  3NWT A;  4FX4 A;  2K9M A;  1MD0 A;  4FX0 A;  1BI1 A;  1ETY A;  2L3D A;  4BBS J;  3GFJ A;  1E3H A;  3I54 A;  3Q0U A;  3W6V A;  1A35 A;  1WJC A;  4I76 A;  1YRN A;  2QQ9 A;  3BWG A;  3L09 A;  4OIP F;  1K83 J;  4MLO A;  2IGM A;  4M6V A;  2ZXW H;  2JK3 A;  3DEU A;  3OSF A;  3DXJ F;  2VAS A;  1N25 A;  1MJB A;  1Z1D A;  5FGM A;  1T98 A;  3RYP A;  1QZZ A;  3FF5 A;  4G7H F;  2B0L A;  1J09 A;  1GLN A;  4AWX B;  5DD8 A;  3TED A;  2BY3 A;  1ZR2 A;  1B1B A;  4OIQ F;  1V5E A;  4IVN A;  4CYC B;  2QUF A;  4UV8 A;  3TW7 A;  1Z3X A;  4HAM A;  5KK1 A;  1T33 A;  5H6R A;  2IP2 A;  1LUJ B;  4JK1 X;  1MH4 A;  3IP4 B;  5F27 A;  1W1W E;  2G9W A;  2VOP A;  4E7K A;  3K9T A;  2LF7 A;  3B73 A;  3ISP A;  4KIB A;  4XBF A;  5BOX A;  4BJ5 C;  1YI2 I;  2OU2 A;  5J1U A;  1I1S A;  2FSW A;  1OJL A;  3ABL H;  3IWF A;  2DMN A;  5FKO A;  4YIR X;  2ELJ A;  1TNS A;  3NWS A;  5L3D A;  1HW5 A;  4HYE A;  4LIV A;  2VB6 A;  1FP1 D;  3NQO A;  1D5Y A;  1STZ A;  1X1D A;  3ROU A;  2H6C A;  3GTL J;  3OR2 C;  2OZ6 A;  2QQ8 A;  1R00 A;  3GTJ J;  2ZME A;  2OD5 A;  2ZME B;  3HSR A;  5F08 A;  3R0J A;  4X0G A;  3HOU J;  3BR0 A;  3KYC B;  1HSJ A;  3K0L A;  3WTX C;  4II3 A;  2HKX A;  3O8G A;  2E5Z A;  1JT6 A;  2A6H F;  4CDG A;  2ZNY A;  1VZ0 A;  2C6Y A;  1IN8 A;  2EA4 A;  2KKO A;  1Y1W J;  2F5V A;  2E71 A;  5JLW A;  3JAM Z;  4UV9 A;  1IRZ A;  2NVU B;  1JT0 A;  5M5W J;  4A3L J;  1T8I A;  3WE3 A;  2COM A;  5D4S A;  2XAJ A;  2E1M B;  2EJR A;  2QSG X;  4A3G J;  3JW4 A;  2W1O A;  2VUM J;  1XGM A;  1G3W A;  1S5L C;  2M34 A;  1ZTR A;  2A68 F;  3KX2 A;  2PX9 A;  2ZSH B;  4IPA A;  1DPU A;  1G59 A;  4XON A;  4KA4 A;  4E7L A;  4HLY A;  4A12 A;  3J80 Z;  2VJ4 A;  3F72 A;  1O7F A;  2NOG A;  1TQM A;  3O3K A;  1R4N B;  3DV8 A;  5CLS A;  4A0X A;  2QEX I;  1QHH D;  3ABU A;  1WWX A;  5E20 A;  5KAI C;  3BG3 A;  3BG7 A;  3LA3 A;  3HG9 A;  1P9Q C;  1YLF A;  2M8G X;  2L9R A;  4CYD A;  1QZY A;  3CJT B;  4LB6 B;  2WV0 A;  3EUH A;  3N05 A;  3KET A;  1R1U A;  2IS2 A;  2LOO A;  4B09 A;  4CCJ A;  1D1B A;  2DOD A;  4Y33 A;  3RPU D;  1FTT A;  2IS1 A;  1VTN C;  1UAA A;  1R5H A;  3WE2 A;  1SVO A;  2VOO A;  2EFW A;  2AQE A;  2M5W A;  1MMG A;  1B9M A;  2HXO A;  3S93 A;  4L9J A;  4EJV A;  2CFX A;  3FXL A;  3G1M A;  2VL8 A;  2HQ5 A;  2CW7 A;  1DU6 A;  4H4K C;  2AQF A;  4WXD A;  1BR1 A;  2FD5 A;  1SD5 A;  4HQM A;  5B1B H;  5JLX A;  2XV4 S;  4BJT A;  3K70 D;  3QRF F;  2LG4 A;  5FLX Z;  3BR6 A;  3DKW A;  4LIT A;  1LFU P;  1MDM A;  2W24 A;  3LFK A;  4EAT A;  4IRI A;  5C3E J;  3QPH A;  3T8T A;  3IV5 A;  5D8K B;  5C44 J;  1LKX A;  3ZQQ A;  4ZDO A;  5K5R A;  2OQR A;  2BHZ A;  2EPF A;  3OWT A;  1R23 A;  2X6O A;  3GEZ A;  3GF2 A;  4TV7 A;  3SEQ A;  2E7W A;  4CIC A;  1ETV A;  3E5Q A;  3RKX A;  2KJC A;  4IHV A;  5D8L B;  3BTC A;  5M5Y J;  4W97 A;  2V6C A;  4U0V A;  2DMU A;  2Z1D A;  2Z2S B;  5LGN A;  5EF6 A;  3F6V A;  2DW4 A;  2WB1 N;  4BBR J;  1SFU A;  5J4Y A;  2EFQ A;  3IHU A;  3BPX A;  2HQN A;  2VON A;  1HC8 A;  2RN7 A;  4DJA A;  5M3F J;  5DUI A;  1A36 A;  1JHH A;  2UZK A;  4IKF A;  4GO1 A;  2BHY A;  2RKH A;  3CME I;  2HVQ A;  1NG7 A;  3K4N A;  3FXR A;  1WJB A;  4NBQ A;  2HZD A;  3R60 A;  4XLH A;  3CCV I;  2W4S A;  4BXF A;  2Q2E A;  5FD5 A;  3KYD B;  2LSO A;  5B5E C;  1F1Z A;  1MZB A;  2ME0 A;  3CF5 F;  2A69 F;  3W2A A;  3A2K A;  3WU1 B;  1OKR A;  2JSC A;  3SFZ A;  4EQQ A;  3RCO A;  5BPI A;  2WAF A;  2MGQ A;  4EM0 B;  3LQR A;  1YS6 A;  2OPT A;  2DBB A;  2KRH A;  3H92 A;  2R7X A;  3CO7 C;  2CFO A;  1IF1 A;  4NQW A;  4A5N A;  4A3M J;  3DF8 A;  2NOJ B;  1XCB A;  4O5V A;  3DWL E;  1X4P A;  1XMA A;  4Z6Y A;  3FMQ A;  3OYG A;  1ZG5 A;  1PUE E;  3H0D A;  1U8B A;  2PQ8 A;  3T8R A;  3ONQ A;  5LGT A;  2X0L A;  4LFU A;  5H20 A;  3HSF A;  5J1R A;  1ZHF A;  1J9I A;  2HR3 A;  5FLV A;  1XDS A;  2Y2Z A;  1KU7 A;  5D5V B;  5AIQ A;  3HUG A;  3J7A O;  3H1C A;  1MMD A;  4KN4 X;  2AXT C;  2IGO A;  4HX4 A;  3CCQ I;  3O8H A;  3ZMD A;  2CGP A;  1O3R A;  3CCR I;  1XDU A;  4BXX J;  2DMQ A;  2V1D A;  3C2H A;  3DTK A;  5CVV A;  2H27 A;  2JQ7 A;  3HYI A;  3OYD A;  4N0B A;  4AYB N;  4KJZ A;  2XAQ A;  2L01 A;  2GM4 A;  3P9K A;  3GTG J;  3GO5 A;  3BG9 A;  3GWZ A;  2NNN A;  2L0K A;  1I6H J;  4WXC A;  4XOR A;  4A3C J;  1S8N A;  2DOA A;  1Y39 A;  4KT6 A;  3RQI A;  2L02 A;  2Y48 A;  4PZJ A;  3TBI A;  4CCM A;  5ICE A;  2BVM A;  3ZOB A;  4ANJ A;  5BPD A;  4UUV A;  3HOY J;  5AIP A;  3RTR A;  2H1K A;  2HTS A;  2YU3 A;  1FYK A;  4RAF A;  3E6M A;  1PUF A;  2Z3Y A;  2RV8 A;  4AID A;  3K4B A;  4BDY A;  3LAJ A;  2ZXH A;  2DQR A;  2MD5 A;  3WOD F;  2JPC A;  3DTI A;  2RC4 A;  2I10 A;  4NDL A;  4RAZ A;  2Y0M A;  2R0Q C;  1ZQ3 P;  2DK8 A;  3E6D A;  1P4A A;  2LKX A;  3FKI J;  2VQH A;  2FF4 A;  2BEO A;  5EG0 B;  4F93 B;  2L4A A;  2M45 A;  3U9G A;  5J6X A;  2P0W A;  4HQE A;  2E5N A;  2H6B A;  5CVR A;  4G12 A;  3GBG A;  1G2H A;  4M73 A;  2A5W A;  1F9N A;  2A61 A;  2Y75 A;  3I55 I;  2CH0 A;  1OPC A;  4RGS A;  2LY2 A;  3GFI A;  1RRJ A;  3CLQ A;  1OMI A;  2FML A;  3SQN A;  3CUQ C;  3ASN H;  3VDX A;  4NQW B;  1DU0 A;  2YX4 A;  2DU9 A;  2DFI A;  4BQA A;  3QYF A;  4LJZ F;  2JA8 J;  1E0E A;  2JZY A;  2VC0 A;  3D1N I;  1ETX A;  1SFO J;  1LDJ A;  3C2B A;  2XB0 X;  2QZ8 A;  4I99 C;  4RGX A;  3WGH A;  1F43 A;  1BL0 A;  3KZY A;  2KMU A;  3CDH A;  5IYD J;  4D7N A;  5HLG A;  1BI0 A;  2BZT A;  2DQL A;  4LD5 A;  1ENH A;  1FYL A;  3C18 A;  3M1E A;  3IKV A;  2KLO A;  2LR8 A;  2LY9 A;  3VPR A;  3D0S A;  4Q48 A;  3DTE A;  4FE7 A;  4O6J A;  3Q3S A;  2M7B A;  3I53 A;  2CUZ A;  1AU7 A;  3S16 J;  2IA2 A;  1IO2 A;  2DN0 A;  2L2O A;  3E6C C;  1LPQ A;  1IDZ A;  4B48 A;  2W00 A;  2G7U A;  3GTQ J;  4JX6 A;  1YJW I;  4I01 A;  3LFU A;  3DKX A;  1IV8 A;  2KRF A;  3CJQ B;  1Y0U A;  2XIG A;  4HV5 A;  3VOD A;  5GPA A;  2CSO A;  3GYH X;  2KDO A;  3M7G A;  1U5T A;  2WC2 A;  4B3A A;  2MG4 A;  4U87 A;  1F36 A;  4RBO A;  3D5L A;  2MFZ A;  4N9H A;  3OYA A;  3F8F A;  2EZL A;  1T6S A;  2PMH A;  2MW8 A;  4BAY A;  1T2K A;  2NS0 A;  1R5I D;  2VT2 A;  3ERE D;  2VLA A;  1APL C;  3OY9 A;  2QQB A;  4MFE A;  1JKP C;  1HF0 A;  2YUS A;  4M74 A;  3PUF A;  5DDG A;  4CH7 A;  4G9Y A;  3H3V K;  3BG5 A;  4WWC A;  2X85 A;  2JUG A;  5LRR A;  3LAP A;  1TC3 C;  3LSR A;  5LD2 C;  1XSV A;  4XKB A;  1MSE C;  2PEX A;  5EEH A;  2KIU A;  4ZJZ A;  3HOS A;  4HNT A;  1TT0 A;  4B44 A;  4U88 A;  1O4X A;  3IRQ A;  1HCR A;  1RC9 A;  2OV7 A;  1UHW A;  1T0F A;  3KPH A;  3HL2 A;  3I9V 2;  3MD2 A;  3W6K B;  1FOX A;  4I7H A;  3I56 I;  1XS9 A;  2ZNZ A;  2XAH A;  3KP3 A;  1U5T B;  2OCC H;  3BOQ A;  3MCZ A;  1PDN C;  2BBY A;  1MBJ A;  4OOI A;  2GLO A;  3EQL F;  2VIX A;  2QLZ A;  4DW6 A;  1AKH A;  4IHS A;  3JAM K;  5F64 A;  2MYS A;  5ICF A;  4C9Y A;  1PUF B;  3LA2 A;  1UMQ A;  2XPW A;  1BJA A;  3LSI A;  2HNH A;  2KJB A;  3K4K A;  4CUG A;  3PIP F;  2MC4 A;  1K7A A;  4UNO A;  4GGG A;  1LNW A;  4ZZD A;  1NHA A;  5A2Q Z;  2CUJ A;  2RAE A;  2UXX A;  3KFW X;  4IRG A;  3W3C A;  1MKM A;  4QPO A;  3K4M A;  3PQK A;  3VYS B;  2PN6 A;  3FK6 A;  4BQQ A;  2VOD A;  3W6J B;  2F6C A;  4EMS A;  2W84 A;  1GUU A;  2Y0S N;  4A3B J;  4PJ0 C;  1EH7 A;  1KYZ A;  2PBI A;  3A01 A;  3J81 Z;  5DTD A;  3P7N A;  1RR8 C;  2KL4 A;  3RPQ A;  1JKQ C;  3TKY A;  4EEF G;  3WG7 H;  4G8X A;  1YTY A;  1LFB A;  2K85 A;  4IOC F;  2GA1 A;  2QBY B;  3RIR A;  2Y69 H;  3FBN B;  3R61 A;  3HHH A;  1SMT A;  4RB1 A;  2H1L A;  5C4J J;  2LRD A;  1JUS A;  2RRE A;  5FRO A;  3H3U A;  4RLF A;  3OIO A;  3WU2 C;  1IN6 A;  3KYL A;  1OYW A;  2XSJ C;  3LST A;  1IGN A;  3JRA A;  5EDN A;  5GAE J;  3V7S A;  2NVQ J;  3LA7 A;  4RGU A;  3M8J A;  2NRA C;  3AFH A;  1J5Y A;  2HOA A;  1Y1V J;  1JGG A;  2XAU A;  3H3Z A;  5ERI A;  2CV2 A;  3BR1 A;  3L2V A;  9ANT A;  4KIG A;  4BYY A;  2VC1 A;  2EIL H;  3EDP A;  1FYM A;  4WF2 A;  3I58 A;  1EJ9 A;  1LEB A;  3ELK A;  4CCN A;  1FIA A;  4Y3O A;  3DLA A;  1HKT A;  4OIN F;  1K4T A;  2W85 A;  3HGY A;  5TRD A;  1X3W B;  1FOK A;  2IS6 A;  2X51 A;  5ILU A;  1TQP A;  4HF0 A;  3PO3 J;  1W7P D;  3CC7 I;  4ESF A;  1QHG A;  4G6Q A;  2Q8K A;  4MO7 A;  3OS0 A;  3D5R C;  3QWL A;  2VJ5 A;  3CUQ A;  4FHT A;  3JRE A;  1SFX A;  2JVH A;  3NAR A;  2GWR A;  3J7Z I;  3BG6 A;  2IAI A;  1PP8 F;  4RS8 A;  4HX8 A;  4Y4R A;  1YRN B;  1I39 A;  1DGR M;  2CYY A;  1IV6 A;  3GX4 X;  3HHG A;  1IUY A;  3ULQ B;  2J5O A;  1TT5 B;  5CKT A;  3R0A A;  5HLT A;  3VEP A;  1O57 A;  2Z16 A;  3AG1 H;  2OZU A;  2FX0 A;  4EJW A;  3L7W A;  3SEZ A;  3F3X A;  3TQN A;  4PJN A;  1AA7 A;  2LLK A;  1U78 A;  2XC7 A;  3L2W A;  2GA2 A;  2R93 J;  2M30 A;  4KUM A;  1TP4 A;  2DI3 A;  2IA1 A;  3KLO A;  4C2M J;  4XRM A;  2FOK A;  3MKZ A;  3T1B A;  3CCS I;  3ASO H;  1YW8 A;  5K1Y A;  1IXR C;  2FRH A;  1DPR A;  3HKZ N;  3CMY A;  1JXS A;  3HZJ A;  4LG0 B;  3AG3 H;  4IF4 A;  1WPK A;  3NAU A;  1QGP A;  3U1K A;  1KU2 A;  3OS1 A;  1IZ1 A;  2LK2 A;  4L9V A;  3HKZ A;  4E7Z A;  1FNN A;  2EK5 A;  4HNV A;  2OQG A;  3SZP A;  3J7A Y;  2XPV A;  1ORK A;  2K9N A;  2V1U A;  5FRM A;  2FA5 A;  2EV5 A;  4C2U A;  4GFB A;  2PMU A;  3LSH A;  2B7E A;  3ABM H;  4BXU A;  4HSR A;  2JA5 J;  5H2F C;  3TDZ C;  4KIS A;  3IH4 A;  3I5U A;  2R7O A;  1MGT A;  2ETH A;  1WGX A;  2L5Q A;  3CQZ J;  3JRG A;  2MLK A;  3P5J A;  1UG2 A;  3DPU A;  5GAG J;  4Y7N J;  3EUH C;  3L2U A;  2VBX A;  3VYT B;  2FBI A;  5GAD J;  2G0E A;  3SYT A;  1OYI A;  2VKH A;  2JA6 J;  3QYB A;  1H8A C;  4IQ4 A;  2XUB A;  3KZI C;  4I98 B;  4E7J A;  3CZ6 A;  3I64 A;  5LGU A;  3IAS 2;  4M72 A;  4PFP A;  3DEW A;  4HZF A;  1JHF A;  3S17 J;  5HDN A;  1RNL A;  4KIT B;  4KDP A;  1Z6T A;  2Y9Y A;  3WTV C;  1JJ6 C;  3D5S C;  4DBR A;  4B4C A;  2QGU A;  1H9T A;  2LRE A;  1Z77 A;  2A07 F;  2MC3 A;  2ELH A;  2L7M P;  2XHK A;  4IRH A;  5BQT A;  4AIK A;  1JUP A;  1XPX A;  5EYR A;  4M3G A;  1IAW A;  2DDA A;  2GBY A;  3PO2 J;  3LSP A;  1R4M B;  3HRU A;  4CHU A;  5E1W A;  3SZG A;  4L9T A;  2ECB A;  2JWT A;  4N4O B;  4OU0 A;  4PUS A;  3IH3 A;  2QSH X;  1WSU A;  2X1E A;  4QSH A;  5EG0 A;  3HGG A;  4QPQ A;  1W5T A;  4FQG A;  2HDC A;  1QZE A;  3AL0 C;  3OIP A;  1TWF J;  3E0J B;  2QWW A;  3SFI A;  3MKL A;  3OOU A;  2CQQ A;  1TWC J;  2K86 A;  1SEU A;  1B8I A;  2PI0 A;  3DP7 A;  1XB4 A;  2UV1 A;  4ESJ A;  1LDD A;  1Y6I A;  4I2O A;  3TO6 A;  2ZJR F;  2R5Z A;  1WKM A;  1U5T C;  3CMA I;  1IDY A;  1T56 A;  1RKT A;  1SD6 A;  1BR2 A;  3GUD A;  2O5R A;  4E7S A;  4YFK F;  3GZN B;  1FIP A;  2JSP A;  5CVJ A;  3H5A A;  4HF1 A;  1X19 A;  3Q9V A;  4A3D J;  1MBG A;  1FTZ A;  2V6E A;  1ZGJ A;  2FMY A;  1RI7 A;  2MH9 A;  3TMO A;  1BA5 A;  2VKD A;  4HF2 A;  2CQ7 A;  1R1V A;  4CCK A;  3VWB A;  3OYN A;  3BRO A;  1Z0X A;  2HDD A;  2DMT A;  3F21 A;  1DQU A;  3OYF A;  1S6L A;  2CV0 A;  3S1R J;  1GT0 C;  3AG2 H;  4HW0 A;  1DP7 P;  2CS3 A;  4BUP A;  2O61 A;  2P4W A;  1XC5 A;  4JQF A;  3E5U A;  2EIN H;  4F52 A;  2W25 A;  1IRX A;  4ENK A;  4A3E J;  1YJ9 I;  4Y15 A;  1I6X A;  3ABK H;  3FXK A;  1EKE A;  1KGS A;  4F55 A;  4CZC A;  3IUO A;  1S9H A;  3I59 B;  4GYG A;  3I4P A;  4R1H A;  2VBY A;  4OAZ A;  4BY1 J;  3VYU B;  5DYM A;  2X1C A;  5KAF C;  2I5U A;  2H09 A;  2GQQ A;  1J59 A;  5D6E A;  3FXO A;  2MSY A;  1VQ9 I;  1MBK A;  4XRF A;  2VT3 A;  2LVS A;  1XGN A;  2DA1 A;  3CCY A;  1FC3 A;  3RDI A;  3JSP A;  2FEZ A;  1ON2 A;  3QU3 A;  4LK0 F;  4PJL A;  1SMY F;  2O0Y A;  1IRG A;  3S8P A;  4P96 A;  4IHY A;  5E3M A;  5TJJ A;  1OCT C;  2BY2 A;  1FMW A;  1XMX A;  4ZYG A;  4N4N B;  3B6A A;  1Z91 A;  3WTZ A;  1DDN A;  4FAS D;  3E7L A;  3BTL A;  5GTI C;  5K7H A;  4XSX F;  3HRM A;  1TW2 A;  4O3M A;  2HQA A;  2TDX A;  4RA2 A;  1XGS A;  2JA2 A;  3OYB A;  1X1C A;  2K3P A;  3PQJ A;  2VPR A;  5BS6 A;  4YEJ A;  1CQT A;  4NC6 A;  1SFE A;  4KYW A;  2VQL A;  2P5V A;  2HGC A;  2A6E F;  4CCL A;  2DO7 A;  4RM3 A;  1XTA A;  4A0Y A;  1ZGW A;  5LBQ A;  2K3F A;  2IS4 A;  1H9G A;  2M2E A;  2LBF B;  4AU7 A;  3LMM A;  3M8E A;  1QRY A;  1XGO A;  1ACI A;  2YPR A;  4ENJ A;  2QVO A;  2W48 A;  3CDL A;  2OJE D;  2R7Q A;  3FHN A;  1YYV A;  5F1R A;  2DDB A;  4ABZ A;  2WB1 A;  2V1N A;  2DJI A;  5E8G A;  4YFN F;  1BI3 A;  3F0C A;  3PM1 A;  4XRS A;  4M3B A;  3OOP A;  4LLN A;  1W5S A;  3SZT A;  3GLX A;  4D0P A;  4UUS B;  3J81 K;  2LYC A;  1K6O A;  1XG1 A;  3HOW J;  1HOM A;  4HLX A;  5D4R A;  3CUQ B;  2CRG A;  3V7R A;  4XNF A;  2NAZ A;  1XCV A;  4KT5 C;  4C3I J;  5LEJ A;  2Z5U A;  3OYM A;  2CUE A;  3QPT A;  3K2Z A;  3KEY A;  3RKW A;  1YFH A;  1E2X A;  1IC8 A;  1WFX A;  1XD7 A;  4M9Z A;  5DS9 A;  4Z2Y A;  2R5Z B;  2LF8 A;  4ENM A;  2FU4 A;  4IZZ A;  4L5J A;  3WTT C;  2HYG D;  1FEX A;  4RDU A;  4C3H J;  4UVC A;  3ZQL A;  2Y9Z A;  3I4M J;  4BQO A;  2Z99 A;  4G7O F;  1BJZ A;  1W7P B;  3LSK A;  2B9S A;  1CGP A;  2DTZ A;  2F5D A;  5J40 A;  1ZR4 A;  3S3N A;  1E3O C;  1E3P A;  5F1J A;  3MFK A;  1K6Y A;  5IP6 A;  2NVX J;  2EV0 A;  1BW6 A;  4LLL A;  5D5X B;  4I0A A;  1HBX G;  1NG6 A;  2VXD A;  3K4J A;  3FM3 A;  2ECC A;  2L9N A;  4CCO A;  4ZDP A;  4RAY A;  2P6S A;  4AD9 A;  3H36 A;  4IL6 C;  2IEK A;  1WH7 A;  5GTH C;  2XF7 A;  4UUS A;  1ZG1 A;  4DBQ A;  1V4R A;  3S15 J;  2I8D A;  2HXI A;  2RNG A;  2WY8 Q;  1LE8 A;  1FOW A;  5C4X J;  1ETW A;  3DKY A;  2E35 A;  3F9K A;  3KLN A;  4WX9 A;  4FT8 A;  3M07 A;  1D5V A;  2M3A A;  5DUK A;  2PLY A;  3EUK L;  2GXA A;  3G73 A;  3HTU A;  3CMM A;  1UZC A;  2HPI A;  1U8R A;  4HX7 A;  2BOL A;  2E34 A;  4Y52 J;  1ONV A;  4BNC A;  1FBQ A;  4HG2 A;  4ZTJ A;  3L9F A;  3TL4 X;  5B1A H;  3IKT A;  1RUO A;  4IXA A;  3BY6 A;  4L0Z B;  4AM3 A;  5HS8 A;  2V4J C;  1H88 C;  3Q0W A;  2BW3 B;  4L5E A;  1PJR A;  1MMA A;  3CLO A;  2ZCW A;  3JSO A;  2R7U A;  1FY7 A;  2XDV A;  3S32 A;  2XGC A;  3S3M A;  2X4H A;  4F92 B;  4J01 A;  3A0H C;  3CC4 I;  1SAN A;  1SAU A;  1BOB A;  2R7F A;  4BGD A;  2HVR A;  2HOE A;  5BMZ A;  4XMY A;  1UFM A;  1IXC A;  2E1O A;  1W0U A;  4MHG A;  1WJ5 A;  4DIQ A;  3CTA A;  3CP2 A;  4XKV A;  2V9P A;  4LG0 A;  4A3I J;  2FQ3 A;  5LHH A;  2QF7 A;  5E18 F;  4U0Y A;  2M9H A;  1QPM A;  4ETS A;  4HDV A;  1P4X A;  2CO5 A;  5CVI A;  2FBH A;  2NXN B;  3JR9 A;  2OF7 A;  1TQI A;  4D5C A;  3VSL A;  5FLX K;  1YE9 A;  2DT5 A;  3I59 A;  3RQ4 A;  2LBF A;  2OC6 A;  3HB9 A;  1WJF A;  3RYR A;  3AL0 B;  3V4G A;  3IRR A;  4N9I A;  2FNP A;  2LP0 A;  3F8C A;  1TBX A;  2RQQ A;  1GVJ A;  2IJL A;  1WQ2 A;  1MMS A;  1ZRE A;  1JUM A;  1USS A;  3E3V A;  2E2H J;  1T39 A;  3F23 A;  2IGN A;  4RM2 A;  5HS9 A;  3PIO F;  4BJ6 C;  3VB2 A;  1QPI A;  4M6X A;  2L54 A;  4UXN A;  1KA8 A;  3RKY A;  3C2G A;  1R71 A;  4JP0 A;  1OCZ H;  3FM5 A;  3MQ0 A;  4M6Y A;  4M71 A;  2CG4 A;  3DQV C;  1ZLK A;  1REP C;  2KIS A;  3CD6 I;  1R22 A;  3FXQ A;  4BY7 J;  1U0J A;  2BE5 F;  2QA4 I;  3K2A A;  3OYH A;  4KFC A;  4EJO A;  3PSI A;  2BY0 A;  1YW9 A;  1HKS A;  1LQ1 A;  5IT9 K;  3EYY A;  4K2E A;  1FBS A;  2QCO A;  4PGG A;  1S7O A;  2CUF A;  1BI2 A;  2LD5 A;  4HV6 A;  1IN4 A;  4ZC3 A;  3B6C A;  1ODD A;  3WTW C;  5J47 A;  2A3S A;  3OYC A;  5IOY A;  1MW7 A;  3MKW B;  1FX7 A;  1XX5 A;  1TTY A;  3GME A;  3WU0 A;  1OCR H;  1J7K A;  2ZXJ A;  1ZEL A;  3S2W A;  1D8J A;  4HST A;  2P7V B;  5IP7 J;  4V2F A;  5DEQ A;  4DYQ A;  1TNT A;  4OWR B;  4I0B A;  4XR6 A;  4HOB A;  4HA8 A;  1YHQ I;  3A03 A;  1GDT A;  4XLC A;  1UJ8 A;  2L7F P;  2ZFU A;  2X6W A;  2V7F A;  4FCY A;  1JI8 A;  2DK5 A;  4L5I A;  3NEU A;  3HC7 A;  2GIZ A;  2OBP A;  4BHB A;  2BYV E;  1N75 A;  3QAH A;  4RB0 A;  1I3Q J;  4W1U A;  4P5O A;  2MBF A;  1P2F A;  2R3S A;  1FMV A;  2LKP A;  2XPU A;  3Q0V A;  4A2U A;  5F0H A;  2A05 A;  3GTP J;  2DFH A;  2Y0S A;  2VJI A;  1JKO C;  2OA4 A;  2R5Y B;  1BC7 C;  4V19 K;  3OV8 A;  3BQZ A;  5J8F A;  3BT9 A;  4G7Z F;  3HPG A;  1IUF A;  1VF9 A;  2W57 A;  1S7E A;  2ICW G;  2WAQ N;  4CYC A;  2ZFW A;  3RJP A;  3PNV A;  4CXF A;  5DCM A;  2VKV A;  3LNQ A;  3EPZ A;  4EV0 A;  1VQL I;  4PGH A;  3CO6 C;  1B8I B;  1IRF A;  3P9I A;  3PNT A;  3H0G J;  3QP6 A;  3V8K A;  1ERD A;  5HNH A;  4E70 A;  3LSJ A;  5FKN A;  1W7P A;  1FZP B;  3ZXS A;  2STT A;  2ZO4 A;  1MH3 A;  4GRI A;  1G4D A;  4ZH4 F;  5FFX A;  2F5F A;  1DUX C;  2PJR A;  1GVD A;  5CPR B;  4C2T A;  4BL0 B;  3HSE A;  4IHX A;  2PMZ A;  2DOE A;  3HJE A;  5HOD A;  2DOF A;  2F2E A;  4A6D A;  2QEN A;  4LG3 A;  4B8X A;  4D7M A;  3C7J A;  2XKO A;  4BH9 A;  1VQM I;  2ZKZ A;  2RGV A;  3BCA A;  3G6E I;  4UB8 C;  2L7K A;  2FBK A;  4AVP A;  3S1M J;  5IYB J;  5ED4 A;  4AIH A;  5LRS A;  1WCM J;  5HNF A;  4II2 A;  4CO8 A;  1HA8 A;  2BGC A;  5LHG A;  3LOC A;  3OYI A;  3PUB A;  4JX4 A;  4BEH B;  3DU5 A;  4M3D A;  2DYR H;  2NNY A;  4QTR A;  3TP3 A;  1Y0N A;  3BLY A;  5EEG A;  1SC7 A;  5AON A;  3U2R A;  1YOV B;  3ZN1 A;  3L2Q A;  2D2W A;  4RLQ A;  4FIS A;  2LH9 A;  2K02 A;  3HTS B;  5L3E A;  2COB A;  3HIF A;  2ZJQ F;  4EM1 A;  2PG4 A;  1YW7 A;  3GZ5 A;  2BXY A;  5FO5 A;  1A04 A;  3I71 A;  6PAX A;  3I3L A;  1ETQ A;  3F8N A;  2FQ4 A;  2P6T A;  4ESB A;  1Z3Y A;  5J4V A;  4G94 A;  3F22 A;  2HI3 A;  4OAY A;  4ZDL A;  3S2D J;  3OL4 A;  5E8I A;  4QLC U;  1WZ2 A;  2A5Y B;  1Z05 A;  3DBR B;  1UST A;  4RAG A;  3ZQI A;  1J75 A;  2E19 A;  1SVL A;  1O3Q A;  2YS9 A;  4XLN F;  2BW3 A;  5FKM A;  4KIF A;  3L00 A;  5M3M J;  2EB7 A;  2EFO A;  5DD4 A;  1RIO H;  3WTU C;  1MNM C;  2WTE A;  2IT0 A;  5K5O A;  1XSX A;  4S04 A;  1ZRC A;  3H35 A;  2L7Z A;  2DA2 A;  1G8X A;  1LFP A;  2O8K A;  2M4K A;  1A6I A;  5GAH J;  4IX7 A;  1K61 A;  4JBA A;  1R36 A;  4WXH A;  2O6G E;  1OR7 C;  1QVT A;  2EQR A;  2MAB A;  1MDM B;  4Q4Z F;  4NUB A;  3WHB A;  1T38 A;  3WHC A;  1UCR A;  3V42 A;  2E1N A;  2RVC A;  2HFH A;  3I4N J;  4XLF A;  5IYC J;  3H9Q A;  1DGW Y;  3BJ6 A;  2FOW A;  4E7I A;  3SDG A;  2FXA A;  2HS5 A;  5CJ9 A;  4UY8 I;  3TW6 A;  1Y8R B;  4FET A;  4PFO A;  2CJJ A;  3FXM A;  1EF4 A;  2RQP A;  3H9J A;  1B72 B;  3DEE A;  2YSR A;  2PJP A;  3BDD A;  2L9S A;  4PK4 A;  4L9N A;  2JA7 J;  1POG A;  2M8E A;  5HS7 A;  2FJ1 A;  4UHT A;  2VJJ A;  1ZLJ A;  1WHU A;  2V26 A;  1K78 B;  1AOY A;  4ZYH A;  2STW A;  4FE4 A;  1BN5 A;  2Y31 A;  2ZSI B;  3OSG A;  2D5V A;  2JTV A;  4S05 A;  1MNE A;  1VQN I;  2OTJ I;  3Q9S A;  1VQK I;  5GP9 A;  1MND A;  2LTP A;  3QOD A;  3PFI A;  3X2Q H;  2KZG A;  1VQ4 I;  2GZW A;  3DBL B;  3P9C A;  3G71 I;  4G6D A;  3WTY C;  5F0F A;  3L1P A;  1RZ4 A;  3E1S A;  5TIS C;  4S0H B;  5K7F A;  5B3S H;  1FSE A;  4XKC A;  2E2J J;  3MN2 A;  2JPB A;  1P92 A;  1YS7 A;  2MA3 A;  3LL7 A;  2ISY A;  1DP3 A;  2NS7 A;  2KFD A;  1ZAO A;  2O3F A;  3HRT A;  3FMS A;  3OR1 C;  4Y13 A;  2HYF A;  3WTS C;  4IQJ A;  1K79 A;  5EEA A;  4HPQ A;  3GTO J;  4A3F J;  1FBU A;  1O3S A;  1WVR A;  2HQR A;  4A3K J;  3TP0 A;  1BIA A;  4UVA A;  4ENN A;  4GCV A;  2F4O B;  3HPH A;  1OLT A;  1LB2 A;  3ZQF A;  3Q5F A;  4ITV A;  3DPT A;  5F6F A;  1GHC A;  3CES A;  4HBL A;  3TDU C;  4AIJ A;  2XAS A;  1MBH A;  2KQR A;  2AO9 A;  4FTH A;  1OYY A;  1U9N A;  5L3G A;  2LFB A;  1ON1 A;  1A31 A;  3ERM A;  2NS8 A;  3L2C A;  2JRT A;  1JTX A;  2RDP A;  2FNA A;  1K78 A;  2IXS A;  3MEX A;  4A93 J;  4IOA F;  1SFK A;  3ECO A;  3K6G A;  3E97 A;  2KPM A;  4I09 A;  2K9Q A;  5HDG A;  2X9D A;  1VQ5 I;  2IA0 A;  2EBI A;  3KP7 A;  2EZH A;  5JI6 A;  1V3F A;  3S1N J;  4B47 A;  3IAM 2;  2Z33 A;  1HW2 A;  5E1X A;  1I5Z A;  4YIF A;  3KEO A;  4OMZ A;  4IO9 F;  5HDK A;  1X1B A;  3UNG C;  1EV7 A;  5F04 A;  1R6R A;  1IW7 F;  2D1V A;  2X48 A;  5FFZ A;  3ZMT A;  2VQG A;  4B43 A;  2VQC A;  3DU6 A;  3REO A;  3ZQH A;  5FD6 A;  4D5F A;  3N4M A;  5IT3 A;  4XOP A;  3S14 J;  3TOB A;  4F7Z A;  5GPC A;  1G3T A;  5IPA A;  2ID6 A;  4LIU A;  2DXI A;  2NVT J;  1MSF C;  4DZP A;  2F48 A;  3KZZ A;  4D9J A;  1UHS A;  3LWF A; 
#chains in the Genus database with same CATH homology
 3CCL I;  3CCE I;  1VQ8 I;  3CMA I;  1VQP I;  2E34 A;  1VQ6 I;  1YIT I;  1FOX A;  1YJN I;  5DM7 F;  3G4S I;  4V19 K;  2QEX I;  3I56 I;  1VQ7 I;  2QA4 I;  4IO9 F;  5JVG F;  3CF5 F;  1Y39 A;  1VQ9 I;  1MMS A;  1YHQ I;  1FOY A;  2OTL I;  5GAE J;  3CC7 I;  1S72 I;  5DM6 F;  3CCM I;  3CCQ I;  3PIO F;  2ZJP F;  1YIJ I;  1YJ9 I;  3CCR I;  2FOW A;  1VQN I;  2OTJ I;  3I55 I;  1VQK I;  1HC8 A;  2JQ7 A;  5GAG J;  4UY8 I;  2K3F A;  1QA6 A;  3CC2 I;  1FOW A;  2NXN B;  1ACI A;  1VQL I;  2E35 A;  2H8W A;  3DLL F;  3CJT B;  2E36 A;  1VQM I;  4IOA F;  3CME I;  3J7Z I;  1VQ4 I;  3CC4 I;  3G6E I;  2ZJQ F;  3CCS I;  5GAD J;  3G71 I;  2ZJR F;  5GAH J;  3J7Y J;  3CCU I;  3CCJ I;  1YI2 I;  1VQ5 I;  1YJW I;  1VQO I;  3CD6 I;  3PIP F;  3CCV I;  4IOC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...