1L0OC

Crystal structure of the bacillus stearothermophilus anti-sigma factor spoiiab with the sporulation sigma factor sigmaf
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
b'DGTVKVSRSLKEMGNKIRKAKDELSKTRGRAPTVTEIADHLGISPEDVVLAQEAVRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anti-sigma F factor
publication title Crystal structure of the Bacillus stearothermophilus anti-sigma factor SpoIIAB with the sporulation sigma factor sigmaF.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Protein binding
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2002-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04539 Sigma70_r3 Sigma-70 region 3
C PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1l0oC00
1G3YA 1FZPB 2FRHA 4WXCA 4IPAA 2PLYA 1Z9CA 4YFKF 1TQMA 4B8XA 1DP7P 3N97A 2VBZA 1T6SA 5TRDA 2ZNZA 4OIRF 4PGGA 4GGGA 5DUIA 4Y17A 1DPUA 1U6GA 5BQTA 3DEUA 2NYXA 2KIMA 2JPBA 1JXSA 1U5TB 2HTJA 4YIIA 3WTYC 1XCVA 4HLYA 3HTSB 3MEXA 3RI4A 4JBAA 1R36A 2DAOA 2FXAA 2D2WA 1K7AA 2A07F 3CLOA 2XV4S 3BDDA 1KQ9A 3HSEA 4RAYA 4OIPF 1FBQA 5DDGA 4L0YB 2K27A 4RB1A 1YQAA 4BYYA 5FB2A 5KVRA 5FO5A 1SD5A 2R7FA 4BHCA 1J0RA 1O3QA 5LHGA 1IN5A 3FMRA 3RYPA 1U3EM 3BPVA 1G3TA 4UUVA 2JTVA 1O3TA 3IWZA 3K0LA 4RGUA 4KIGA 5D5WB 2UWMA 1U8RA 1YTYA 2ETHA 2IA1A 3V8LA 1HSTA 3K1MA 5JHUA 2MLKA 1QPMA 3I59B 3ZMSA 5F64A 2QBYB 5L3BA 2GZWA 5D8KB 1MGTA 1Z6RA 2E1CA 4M9SA 2CQKA 3HRMA 4G9YA 3MFKA 5D4SA 4O5VA 3TDZC 3FHZA 3H3UA 4PDKA 3KZYA 1STZA 5KK1A 2JRTA 1EH8A 1GVJA 3HIFA 1XSVA 3M7GA 3KP3A 4UNOA 5K5RA 1O7FA 1FLIA 1P2FA 1XCBA 2MA3A 3DV8A 3I71A 5BPIA 3K1NA 1B9NA 2VE9A 3HSRA 5K5QA 1S8NA 3EYYA 3BROA 5CLSA 3R0JA 1W7PA 2LF8A 3RKXA 2A69F 2YX7A 5ILUA 2RC4A 1QQIA 3VOEA 4JQFA 4P9UA 3J81Z 3D0SA 5FLXZ 5J8FA 1H9GA 1S7AA 3QPHA 2QUFA 3QP6A 1YFHA 2EV6A 1IRFA 1BC7C 4G6QA 3F8BA 3DKWA 1FWZA 1HKSA 3PFIA 5ICFA 4OU0A 2XROA 2WV0A 2K4JA 2QVOA 4Q4ZF 3BJAA 3I54A 3QRFF 4ZYGA 1ZARA 1KU2A 4AIKA 3L9FA 2JT1A 3S2WA 1LNWA 5L3EA 1FP2A 3P7NA 3P9IA 4L18B 2X4HA 3ZN1A 1KQ0A 2QQ9A 3KCCA 1MZBA 3LAPA 3HTUA 3FF5A 3GWZA 4KUMA 5D6EA 2EV5A 2IA2A 1YW8A 1H0MA 4IHTA 3TO9A 1ZG3A 4HV5A 2PI0A 1WI9A 2M1BA 2FNAA 2O6GE 1ZGAA 1MJ9A 2V1XA 2Z3YA 4EM0B 4XLNF 2BYVE 1KYZA 2P5LC 2X0LA 5BPDA 2L01A 1ZHFA 2ZCWA 3SHFA 1MDMB 2FMLA 3B02A 3KP4A 3R61A 4G8XA 1OYYA 4M72A 4EMSA 3E5XA 2YX4A 2K7LA 3RPQA 2Y0MA 1F9NA 1FX7A 2D1HA 5LEKA 2ZJ2A 3Q9VA 4MEYF 3IRQA 1MJAA 1SD6A 2J5PA 1ZYRF 2FBKA 5A2QZ 4HAMA 1I5ZA 1FOKA 4KNYA 2P6SA 3KP2A 2IRFG 4LGWA 3JAMZ 2M8EA 2IJLA 1C0WA 4UXNA 5HLGA 2DQLA 3J7AO 1EH7A 5DCFA 5JFRA 1HW1A 1Z6TA 2Z33A 2V9VA 5E1XA 4HQEA 4LLGF 5IT3A 2QZ8A 4LD5A 4BNCA 2M5WA 1LEBA 1SD7A 2NRAC 4IRGA 1RUNA 3F8CA 5JI6A 3GFJA 3LA7A 1P92A 2F2EA 2ISYA 3T5XA 2XUBA 5L3CA 5HS8A 3WG9A 4ZH4F 3IL2A 2EFPA 3ZMZA 1FSEA 1FYLA 4IJAA 1J75A 1LEAA 4AD9A 5LRSA 5DYMA 1ULYA 1GHCA 3NRVA 3R6SA 1P4XA 2XAGA 2KJBA 1BN5A 3O6BB 2STTA 4LK1F 1G6NA 1R5GA 3J81K 2VC1A 5FLXK 2WTEA 4S04A 3N4MA 2BV6A 1TNSA 4A2UA 4A12A 2VE8A 3HSFA 3MWMA 3DP7A 1TNTA 3ZMUA 5L3GA 2H94A 3GW2A 3SZPA 4YFXF 3HHHA 3T8RA 2VBYA 4XBFA 1V4RA 1J59A 4LFUA 4ESFA 1XMKA 5BMZA 2ESHA 2DFIA 5FD5A 1ZLJA 2ZMEB 3CUQA 4I7HA 2HR3A 3WTSC 3SFZA 2H09A 1HW5A 1P4WA 2LSOA 3ROUA 4ON0A 1B59A 3LWFA 1SFUA 3WTTC 3I53A 2RKHA 4EM1A 1I1GA 4M6YA 4CO8A 3C7JA 1T98A 4WWCA 1V3FA 3TQNA 3WU1B 1VTNC 4RB3C 3E3VA 2Q8KA 3GLXA 5AIPA 5E1WA 1D8KA 4P55A 2CGPA 2OAZA 1XMAA 4RGRA 1U5TA 3T0YA 3BJOA 5HS7A 3L00A 3RKYA 2NNNA 4MGRA 1SMYF 1UCRA 2B0LA 2K86A 2CSOA 5E8GA 4HX8A 5CVJA 4L5JA 3IKTA 4WK8F 1XSXA 2GWRA 3U1DA 2IT0A 4HDUA 1ZGJA 5A2QK 3ZMVA 1FYKA 3KP6A 1K79A 4IRHA 2Q2EA 4JK1X 4HF1A 3JAMK 1L0OC 1HKTA 5ICEA 2LKPA 1RZ4A 3FZVA 1JGSA 4RGSA 4M9ZA 2FF4A 4EJWA 4G7ZF 1TW2A 3F3XA 2PFBA 4MQVA 3E6DA 5LHIA 3RJPA 3P9CA 1G4DA 2WWYA 4CHUA 4XSXF 4RGXA 2ESNA 5LEJA 3I59A 1IZ1A 2QBYA 5DV5A 4Z2YA 1T39A 3F23A 2GAUA 3ZMTA 5JVTA 1FT9A 4ENMA 1MJBA 3F21A 1ON2A 5E8IA 2NS0A 3I0TA 5HOOA 1F5TA 1LDDA 4WCGA 1OKRA 1YG2A 2F5EA 1PUEE 1YS6A 1FPQA 4KICA 2L4AA 4I0BA 3L7WA 1KQ8A 2C6YA 1O7LA 5H6RA 1K78B 2PQ8A 1BOAA 2XGXA 2DK8A 2XVCA 5D4RA 2QYOA 1F4KA 4N0BA 4EM2A 5L3DA 4MTEA 1GXPA 4Y13A 2EA2A 4LMYA 4DNCA 2QM3A 3G73A 4PCQA 2FBIA 1W5SA 4F7ZA 2VODA 3H3ZA 1QZZA 5HVQC 3GZ6A 5BOXA 1FBUA 5ICGA 1B6AA 1D8JA 4GYIA 1OMIA 1E2XA 3I58A 5DEQA 2EFNA 2QQAA 3SQNA 3KFWX 2L4MA 4I98B 2FBHA 1BBYA 3RYRA 5CJ9A 2BGCA 2WC2A 1ZG5A 2R3SA 3DPTA 5CVVA 2ZNYA 1WQ2A 3GEZA 3EUHA 4G6DA 2CW0F 4RS8A 2YU3A 1W4MA 1WRJA 4DQ2A 2CWEA 5DUKA 1HBXG 2Y75A 1YO5C 5FFZA 2VC0A 4BH9A 3F8MA 3GFIA 3FM5A 1IAWA 3QU3A 2HTSA 2ADUA 4OMYA 5JR3A 1MKMA 3BPXA 2FOKA 1MDMA 2UXXA 3WE3A 4FT8A 1RI7A 1YS7A 4R79A 4OOIA 4RAZA 3QAHA 1LJ9A 4L9VA 2FNPA 4EVIA 3E5UA 5LGNA 3U2RA 3EQLF 2HFHA 2UZKA 3QPTA 2FU4A 5H6QA 1BIBA 5L3FA 5E1ZB 1PP7U 4YG2F 1I6XA 3JTGA 2DO7A 1GXQA 2F5CA 2FA5A 5EEGA 1Z1DA 3GX4X 1UFMA 3KLNA 3VEPA 2RNJA 3FMQA 2NAZA 4YFNF 4Q48A 3TKYA 4YIFA 1FC3A 3MZHA 2IA0A 4A6DA 2EFWA 3RTRA 1ZREA 2VN2A 3I64A 5ED4A 2M30A 1R1UA 3CJNA 1KYWA 3BWGA 3BOQA 1MD0A 4B09A 1JE8A 3HRTA 1XDUA 3ELKA 2LDUA 4GO1A 3KEOA 2HEOA 1AOYA 1R1TA 1I1SA 1HXDA 3CO7C 2STWA 1G3SA 2VT3A 2GXGA 1DPRA 1CGPA 3BP8A 1YW7A 3IRRA 1ZRCA 1A04A 3G3ZA 4I02A 2BE5F 3JW4A 5DD4A 2RVCA 2P7VB 4HBLA 3FXRA 2DBBA 2HOEA 2DK5A 5ERIA 3ABTA 4N9HA 3RIRA 1JHHA 2P5KA 3K9TA 1D5VA 1O3SA 2BBYA 2XIGA 3J80Z 3DF8A 3ISPA 5LLQA 2ZO4A 1IN7A 4OINF 4UVBA 1LQ1A 2XHKA 2NNYA 3L09A 1YW9A 4M9XA 4BAYA 2ZKZA 3ERED 4GYGA 1KA8A 2ZMEA 1KU3A 1FY7A 2PMUA 3PQKA 2MLGA 3IHUA 1K6OA 3O2PE 4LG0B 1B9MA 1XGOA 2L02A 2YPRA 4M6XA 2KIFA 3K69A 4MQ9F 5DCMB 1KGSA 4IRIA 5CVRA 2EB7A 4UVCA 1WSUA 2VBXA 5K1YA 3WU0A 1O3RA 1ZRFA 2PEXA 2Z9OA 5IT9Z 3QOPA 2P5VA 1EH6A 1HKQA 1S6LA 2XKPA 2L54A 1USSA 4WX9A 2G7HA 3LAJA 4GXOA 4HX7A 2LF7A 4KDPA 3WTUC 1CF7B 2HDCA 1RNLA 5CYVA 1Z7UA 4P5OA 3LQRA 4ENKA 2HQNA 2OU2A 4CICA 3LA2A 3H92A 3KLOA 4BQAA 1R58A 4HYEA 3KE2A 5F6FA 2CG4A 2MC3A 1UHMA 3CTAA 1WKMA 2W84A 4TV7A 1P4AA 2P4WA 1QNTA 2IP2A 3E6CC 1XN7A 3KZZA 3JSPA 3DXJF 1T38A 1O57A 1BI3A 3TO6A 4EJVA 3D5LA 2XASA 3U9GA 2FQ3A 1IN4A 2O03A 1QZYA 1XB4A 3FWEA 2TDXA 3GYHX 4HA8A 1HQCA 3WGGA 4U0VA 4HLXA 2PN6A 2AXLA 1FP1D 2M87A 4XLPF 1R23A 4ASNA 3F22A 4M71A 4WF2A 3RPUA 1ZRDA 4EQQA 2EJRA 3V7CA 1J5YA 3WTXC 2CO5A 4ENNA 2DLLA 2JZYA 3OV8A 1XSDA 1T2KA 1BIAA 3R60A 2QQBA 3TO7A 1Z05A 4EV0A 1Q1HA 2L3DA 5F1RA 3V7SA 3ZPLA 3HRUA 5D5XB 3BJ6A 4A5MA 3F6OA 4G7HF 3V8JA 2AS5F 2XAJA 3BY6A 3ZP5A 1K78A 3WTZA 1EV7A 4U7BA 2GQQA 4P9FA 2MH2A 2DPDA 5ILVA 1XGNA 2OD5A 4HQMA 1KU7A 4ZYEA 4P96A 1U5TC 3C1DA 1FYMA 4I09A 1L3LA 4H0EA 3DQVC 1IUYA 5J6XA 3J80K 5ILSA 2EWNA 6PAXA 4KMUX 2JSCA 5H20A 2GA2A 4IXAA 4CDGA 5J8CA 4IF4A 2CFXA 4HZFA 2DTRA 4U0YA 1ZH5A 5HDNA 3E6MA 3GUDA 2F5DA 1S7OA 1W5TA 4LLNA 3NEUA 1J9IA 2DI3A 4KN4X 1UB9A 1OPCA 1XD7A 4UHTA 1NHAA 1W7PD 3ZMDA 1OYWA 2XAQA 4AIJA 3O3KA 4PGHA 4CZZA 5IT9K 3WODF 4EJTA 3KETA 1QO0D 3QU6A 4IVNA 4KMFA 4QWQA 3I5UA 4FX4A 2RDPA 3TDUC 1P6RA 5EEHA 2A5YB 4U88A 3GVAA 1OR7A 3M8EA 5ICCA 1U2WA 2KRFA 4OIOF 1JHFA 2HYGD 1USTA 3F8FA 4ESBA 2MBFA 4RB2C 1IXSB 3HUGA 4XSZF 1R1VA 4D0PA 3E5QA 5HLIA 3AAFA 3QP5A 5D5VB 2W85A 4L5IA 2H6BA 5D5UB 4HV6A 3HYIA 1R7JA 3GZ5A 4HF2A 2W24A 1LB2A 3TOAA 1I27A 2JPCA 1IF1A 1FSHA 3IC7A 1BI1A 2VXZA 3JSOA 5D6FA 1ZN2A 2FE3A 1UHWA 4E70A 4ENJA 1YLFA 1XGSA 4NB5A 3W6KB 1ON1A 5CVIA 3HHGA 2VT2A 4HDVA 2MD5A 2GXBA 3LQQA 3WTWC 4HOBA 2XKOA 3K1PA 1U78A 3NQOA 2QENA 3MZYA 2V79A 1SD4A 1ODDA 2K4BA 3CUOA 4A6EA 2DPUA 2V1DA 4G94A 3M8FA 1TBXA 1H9TA 3R0AA 3M9AA 1SAXA 3C18A 5LGUA 2Y48A 1D3YA 1R00A 3V8KA 3IKVA 4Q5SF 1TQIA 3LSTA 1Z91A 4M73A 2CYYA 2A3SA 1R22A 3SXYA 3F6VA 4CXFA 4CGZA 2KJCA 3VB2A 3R4KA 2FMYA 2Q0OA 4AVPA 2A61A 4ZYDA 1Y0UA 1J7KA 3KEQA 1IN8A 3FXUA 2KKOA 1S3JA 5LGTA 4BHPA 4I01A 2O3FA 3M1EA 2D1VA 4HF0A 2ELHA 2LNBA 4MNUA 1R5HA 2DT5A 1KU9A 4L9TA 2A6EF 3HOTA 4U7DA 3FM3A 1E17A 2V1UA 2W57A 3ZN0A 1RUOA 3FX3A 2DU9A 4KA4A 4EGYA 1IXCA 2OZ6A 4KIBA 2EK5A 2YR2A 3TOBA 4XRFA 1PP8F 4AIHA 5D8LB 2R7DA 5E18F 5TJJA 4MHGA 1RIOH 2K02A 4LG0A 3WTVC 1IN6A 2P7CB 5DCMA 4A0YA 1SMTA 1TQPA 2D45A 2VOOA 5LHHA 3RKWA 4O6JA 3ECHA 4U0WA 4ZZDA 3PQJA 3T1BA 2ZFWA 5HDKA 3FMSA 3CO6C 3T8TA 2O0YA 4I0AA 1S29A 2HKXA 2HS5A 4I2OA 1YIOA 1CF7A 3ZQ7A 2ACJA 5HDGA 1DDNA 2M45A 2P8TA 1ONVA 1W7PB 2W25A 4A5NA 4G7OF 4UVAA 2GIVA 3WGIA 2HKOA 4KFCA 2RV8A 3BZ6A 4KYWA 2E7WA 2EFOA 3ABUA 2A6HF 1XGMA 2ZXJA 1FBSA 1B4AA 4L0ZB 2GA1A 3K2ZA 4HX4A 3TGNA 2E1NA 4S05A 2Z5UA 4N9IA 2QWWA 5E20A 2EFQA 2BEOA 2VOPA 3ECOA 1HW2A 1T0FA 3LA3A 3W6JB 3EYIA 3F8NA 2PMHA 3E6BA 3IWFA 4R8HA 4LB5A 4LJZF 2HZTA 2ZBKA 2HGCA 3B73A 3E97A 2J5OA 4BHBA 2MH9A 3CDHA 1WWXA 1BJAA 1TLHB 1SFEA 3HOSA 2H6CA 2OQRA 4A0XA 3GO5A 3VODA 2P6TA 3GFLA 4UV9A 3ML6A 4Y15A 5HS9A 3VFZA 3HRSA 2EA4A 4FHTA 4LK0F 5LRRA 4ETSA 1FNNA 4QLCU 4WXHA 3MAJA 3DFGA 2G7UA 1BM9A 4ZZLA 4CYDA 3LFKA 4UV8A 3MQ0A 3P9KA 1TW3A 2PBIA 2Z99A 3KP7A 5FGMA 5K5OA 4FX0A 4PZJA 1QGPA 2UXNA 4IHSA 5BS6A 2FSWA 2IVMA 1X3UA 1SFXA 3WGHA 1IW7F 1XDSA 4M74A 3JTHA 5DD8A 3ULQB 2O8XA 2RN7A 1ZLKA 1F1ZA 4LLLA 5HLHA 2DQRA 2VONA 1IRGA 2VBWA 3I4PA 1G3WA 4O3MA 1BC8C 2V6CA 1ZAOA 2G9WA 3FXQA 3V4GA 4NHJA 4A0ZA 2RQPA 4HW0A 3GF2A 2IPQX 3COAC 1AWCA 1QBJA 3CUQC 4KIFA 1B1BA 4GCVA 4ESJA 2F5FA 2YSRA 4NQWA 4MTDA 1LVAA 4ZYHA 2XAHA 4L9NA 3WE2A 3GFMA 2XRNA 1TTYA 2A68F 2IW5A 1BI0A 2XAFA 2E7XA 5AONA 1BI2A 3OOPA 3KP5A 2HQRA 4EGZA 5LBQA 2OA4A 3L2CA 4EJUA 4KN7X 3MCZA 3GXOA 4EJOA 5E17F 5FD6A 1ZG1A 2HWVA 2O61A 3C3WA 4OMZA 2H27A 2PJPA 4L9JA 5FFXA 1REPC 4MEXF 2ISZA 3Q5FA 4BXUA 3EDPA 3REOA 1IXRC 3V7RA 5CVUA 2OBPA 4KT5C 1OYIA 1LDJA 4WXDA 4Q47A 2OZUA 4OIQF 2COMA 2PG4A 2KIUA 3SZTA 1DUXC 4AWXB 3F72A 1HSJA 1YYVA 2EV0A 1PDNC 4K2EA 1LDKB 4R1HA 5AIQA 3CUQB 3Q9SA 4RB0A 4LB6B 2QLZA 2OQGA 2HYFA 3RDIA 3EETA 3DPLC 1J2XA 2DW4A 2RGVA 2FEZA
chains in the Genus database with same CATH superfamily
1G3YA 4ITVA 2H8WA 1FZPB 2FRHA 2OUMA 4WXCA 4IPAA 2PLYA 1Z9CA 3QYEA 3VYRB 1QHGA 4YFKF 3VWBA 1D1BA 3K6GA 1TQMA 2PJRA 4B8XA 1DP7P 3N97A 4X6AJ 5FROA 4NNJA 5H2FC 2VBZA 1T6SA 5TRDA 1I50J 2ZNZA 4OIRF 4A3GJ 2IGKA 4F55A 5C4XJ 4ZC3A 2AO9A 4PGGA 3JREA 3D5SC 1NG7A 1VQLI 3A0HC 4GGGA 1XPXA 2NXNB 5DUIA 2EZIA 4BDZA 4Y17A 3AG4H 2GBYA 1DPUA 2Y69H 1U6GA 2HXIA 3RCOA 4XKVA 5BQTA 3DEUA 2NYXA 2KIMA 2JPBA 1JXSA 1U5TB 2HTJA 4YIIA 4F93B 4RM3A 3WTYC 1XCVA 4HLYA 1IDZA 2JWTA 2AQFA 3CDLA 3HTSB 3MEXA 3RI4A 4JBAA 3MMYB 1R36A 2DAOA 2FXAA 2D2WA 1H88C 1K7AA 2A07F 3CLOA 4P1WA 2XV4S 3BDDA 1KQ9A 3HSEA 4BACA 2R0QC 1OR7C 1OISA 4RAYA 1YJWI 3LSPA 3TW7A 1FIPA 5J1UA 3GTQJ 4OIPF 1FBQA 5DDGA 3L2UA 3CMYA 1EF4A 3OS0A 4IO9F 4L0YB 2K27A 5IYBJ 4FE4A 4RB1A 1YQAA 4BYYA 3ZQLA 3OYAA 5FB2A 4A3KJ 4C3HJ 5KVRA 3S8PA 5FO5A 4A69C 2OTLI 1SD5A 1D5YA 2Q2EB 2R7VA 2R7FA 4BHCA 2BHYA 1J0RA 2KRHA 4BUPA 4E7SA 2X85A 1MNDA 1O3QA 5LHGA 1IN5A 3FMRA 1JKRC 3RYPA 1U3EM 1QU3A 1XG1A 1XMXA 1MNEA 3S93A 2ZB9A 3BPVA 1G3TA 4UUVA 2JTVA 3Q0WA 5K7ZA 1O3TA 5KAFC 2K3FA 3IWZA 2DTZA 2VI6A 3K0LA 2F6CA 4RGUA 4KIGA 3B6AA 5D5WB 2JA7J 1TWFJ 3DPUA 3HKZN 1Y6IA 2UWMA 1HDPA 1U8RA 1YTYA 2ETHA 2IA1A 3V8LA 3OIQA 2DA1A 1HSTA 3K1MA 3K7AJ 3TMOA 5JHUA 1X19A 3OSFA 2ZSIB 2MLKA 3RQ4A 2IS1A 4XKBA 1QPMA 3I59B 4CYCA 3ZMSA 5F64A 2WAQN 4HNUA 1N25A 2QBYB 5L3BA 2GZWA 5F1JA 5D8KB 3EPZA 1MGTA 2CQNA 1ETWA 4IQ4A 1Z6RA 1DGWY 4BE1A 2E1CA 2P81A 4M9SA 1NK3P 4PJJA 1RETA 2CQKA 1WI3A 1WJFA 2WY7Q 3HRMA 4G9YA 3QODA 1JUMA 3MFKA 5D4SA 1YIJI 2VLAA 4O5VA 3TDZC 3FHZA 5F08A 3H3UA 2XGDA 4PDKA 3KZYA 1STZA 5KK1A 4KJZA 3AG1H 1Y56A 2JRTA 1EH8A 1GVJA 1TWAJ 3HIFA 2K5CA 1XSVA 4CH7A 3M7GA 3KP3A 4UNOA 5K5RA 1O7FA 1FLIA 1P2FA 1XCBA 2MA3A 3DV8A 3I71A 2F5VA 5BPIA 2JA2A 3K1NA 3OYBA 1UHSA 1X4PA 4L5EA 1B9NA 3OYGA 3RQIA 2VE9A 3HSRA 5K5QA 1S8NA 5IYCJ 3EYYA 1OJLA 2E5NA 3BROA 5CLSA 3R0JA 1W7PA 2LF8A 3RKXA 2A69F 4Y3OA 2YX7A 5ILUA 2RC4A 1AU7A 1QQIA 4IHXA 3VOEA 2CV2A 4X1EA 4FISA 1BW5A 4JQFA 3BG7A 4P9UA 3J81Z 2IS2A 3D0SA 3I55I 5FLXZ 2HDWA 5J8FA 1H9GA 1S7AA 4D1QA 3QPHA 2QUFA 3QP6A 4KISA 1YFHA 3H35A 3UKGA 1IRFA 2EV6A 5E3NA 2JUGA 1BC7C 3ZR8X 1T95A 4G6QA 5DM7F 1DGRM 5FKMA 2NS7A 3F8BA 3JRCA 2R7WA 2VJIA 3DKWA 1FWZA 3JRHA 1HKSA 3WHBA 1PVEA 3GZNB 3L2VA 3N05A 3PFIA 5ICFA 4OU0A 2XROA 3VSLA 3HOUJ 5GTHC 2WV0A 2K4JA 3K4CA 2QVOA 4HPQA 4CCLA 4Q4ZF 3BJAA 3I54A 4XL9A 2BW3B 3QRFF 4ZYGA 1ZARA 2QSGX 2CFOA 4V2FA 1KU2A 1LE8A 4AIKA 2BY0A 3L9FA 2JT1A 3S2WA 1LNWA 5L3EA 3CCQI 2IS6A 1FP2A 3P7NA 2V7FA 3CCVI 2MD0A 1MMAA 3P9IA 4E7KA 1QVUA 3S17J 4L18B 3QQAA 2B7EA 3I4MJ 2X4HA 3DBHB 3ZN1A 1MBHA 1KQ0A 2PX9A 4UUTA 2QQ9A 3KCCA 3H9GA 1MZBA 3HOZJ 3K4JA 3LAPA 3HTUA 3FF5A 3GWZA 4KUMA 5D6EA 2EV5A 4EEFG 2IA2A 1YW8A 1H0MA 2UV1A 4IHTA 3TO9A 1EA3A 1ZG3A 4HV5A 2LFBA 2HXOA 5KCMA 2GXAA 1WI9A 2PI0A 2M1BA 1V5EA 4M3BA 1X1AA 2FNAA 4F91B 2O6GE 2KDOA 2R5ZA 1ZGAA 1MJ9A 2V1XA 2Z3YA 4EM0B 4XLNF 2BYVE 5BNGA 1GT0C 1KYZA 2M8GX 2P5LC 2HU9A 2X0LA 4E7ZA 1VQOI 5BPDA 5EJCA 2VKDA 1WVRA 4BQQA 5J4YA 3H5AA 2E60A 2L01A 1ZHFA 2M4GA 2ZCWA 2K9MA 3SHFA 5KAIC 3QOEA 3VYTB 1MDMB 5IP6A 3OYEA 2FMLA 3B02A 3KP4A 3R61A 3CJQB 5CPRB 4G8XA 4A3BJ 3AL0C 1OYYA 4LOCA 4M72A 4EMSA 3E5XA 2YX4A 2K7LA 3RPQA 2Y0MA 2E35A 1F9NA 1FX7A 4RLQA 5GPAA 2D1HA 5LEKA 2ZJ2A 3Q9VA 4MEYF 3BLYA 4DYQA 3IRQA 3LSRA 1A6QA 2E1MC 3HL2A 1W0UA 3HG9A 1MJAA 1SD6A 2J5PA 2KT0A 2JK3A 3AG3H 2WAFA 2X6WA 1ZYRF 2VKHA 3F0CA 2FBKA 4HG2A 5A2QZ 2BXYA 4HAMA 3DTIA 1I5ZA 1FOKA 3PSIA 4KNYA 5EF6A 3TP3A 2P6SA 2OF7A 3KP2A 3AG2H 3OYCA 2RAEA 4LGWA 2IRFG 3JAMZ 2M8EA 1B8IB 2IJLA 5IP7J 1C0WA 4UXNA 3PM1A 2G0EA 3M1CA 2DQLA 5HLGA 3J7AO 3KYDB 3S32A 2XPVA 3S3OA 4JX4A 3DBLB 1YRNA 1EH7A 1E3PA 4MFEA 5DCFA 5JFRA 3OYFA 2ZJRF 1HW1A 1Z6TA 3RZOJ 2Z33A 4PUSA 2V9VA 1YX3A 5F27A 4H4KC 5EG0B 1RR7A 2LG4A 3A01A 5E1XA 2LTPA 2JMWA 4HQEA 1JKPC 4LLGF 4IX7A 3C2HA 5GADJ 5IT3A 1XS9A 2OCCH 4BY1J 3EUKL 2OC6A 2ELKA 2QZ8A 3G6EI 4LD5A 1W5CC 4BNCA 2M5WA 3M3YJ 1SD7A 1VFCA 1LEBA 2NRAC 5EDNA 4IRGA 3Q3SA 4DZJA 3IH3A 4JP0A 1RUNA 2DDBA 2ECBA 3F8CA 5JI6A 2RQQA 3GFJA 1AHDP 3LA7A 1P92A 2HQAA 1T8IA 2F2EA 1AKHB 2ICWG 3CCUI 5F0CA 1FEXA 2ISYA 3T5XA 2CU7A 4XORA 2XUBA 1W36D 5L3CA 2QF7A 5HS8A 3WG9A 4ZH4F 1K6YA 3GTGJ 3IL2A 2IAIA 2EFPA 4V19K 4XLHA 3ZMZA 1FSEA 2F48A 4IJAA 1FYLA 3BR1A 1J75A 1LEAA 3CJTB 4AD9A 5LRSA 3BR0A 5DYMA 1XX5A 1ULYA 1GHCA 2QQ8A 1TP4A 2OJED 3NRVA 1P4XA 3NWSA 3R6SA 2XAGA 2KJBA 2QEXI 5M5WJ 1BN5A 2BVMA 2CRGA 3O6BB 2STTA 4LK1F 1OFCX 2KISA 3ABLH 4W1UA 1G6NA 1R5GA 3J81K 2VC1A 5FLXK 2WTEA 2XAUA 4S04A 3FXKA 3N4MA 3CLQA 2BV6A 1TNSA 4A2UA 4XRSA 2GIZA 3IH4A 4A12A 2VE8A 3HSFA 2JN6A 3MWMA 3DP7A 1TNTA 1FTTA 4UY8I 5IP9J 1FMVA 3ZMUA 5L3GA 1F43A 4XR6A 2H94A 3GBGA 3GW2A 3SZPA 2K9NA 4AU7A 2ID3A 3OIPA 4YFXF 3OYIA 3HHHA 3L2WA 3T8RA 2VBYA 4XBFA 1V4RA 1J59A 1E3HA 4LFUA 4ESFA 1XMKA 3FBNB 3L2QA 5BMZA 2ESHA 2DFIA 5FD5A 3BC8A 1ZLJA 2R5YB 4B1RA 2ZMEB 3CUQA 4I7HA 2IGMA 2HR3A 3WTSC 3SFZA 1MBEA 2H09A 3M07A 1HW5A 4DZPA 1P4WA 1VQNI 2LSOA 3ROUA 2Y2ZA 2DA2A 3BG3A 1ERDA 4ON0A 1B59A 3LWFA 1SFUA 1OLTA 3WTTC 3I53A 1Y8QB 2RKHA 1TWGJ 3HC7A 1POGA 4QTRA 4EM1A 1I1GA 4M6YA 2A6TA 4CO8A 3C7JA 1T98A 1YJ9I 3IP4B 2BZTA 4WWCA 1V3FA 2R4GA 1S72I 4HSRA 1W0TA 2ZJPF 4NC6A 3TQNA 3C2GA 3WU1B 4DOZA 3QYBA 2DFFA 1VTNC 1ZKGA 4RB3C 2DMQA 3E3VA 2Q8KA 3E0JB 3GLXA 5AIPA 3VPRA 2ECCA 3W2VA 2KRCA 2VQHA 5E1WA 1D8KA 5IYDJ 4P55A 1I3AA 9ANTA 2I10A 3LOCA 2JVGA 2OAZA 2CGPA 2HYJA 2L9SA 1YE9A 4BBSJ 1XMAA 4RGRA 1U5TA 1A6IA 2L7ZA 3T0YA 3CMAI 3BJOA 5HS7A 4J01A 3L00A 1XC5A 3NWTA 3IH2A 1GLNA 3RKYA 3BQZA 2DA4A 4E4HA 2CUZA 2NNNA 1WCMJ 1SMYF 4MGRA 1UCRA 2X48A 3DEWA 1HOMA 2B0LA 2K86A 5J40A 2CSOA 3VYUB 4BY7J 2L9RA 4HX8A 5E8GA 5IOYA 2VIXA 5CVJA 2R7ZJ 4L5JA 1WPKA 3IKTA 4WK8F 1XSXA 3DCFA 2GWRA 3IAM2 3H5NA 2O5RA 3U1DA 2IT0A 4HDUA 2XB0X 4RAGA 3OYHA 1ZGJA 1ZQ3P 3S2HJ 5A2QK 4XLAA 3ZMVA 4AM3A 5FJ8J 1FYKA 2WAEA 3KP6A 1FMWA 3A4CA 3DKYA 1K79A 4IRHA 4B48A 5B1BH 2Q2EA 2VJ4A 1G2HA 4JK1X 2JJ7A 4HF1A 4XRSG 1L0OC 3JAMK 3SFIA 1HKTA 5ICEA 1R49A 2LKPA 1RC9A 5DM6F 2H1KA 2K85A 4Y33A 1ITYA 1RZ4A 3G1LA 3FZVA 1JGSA 4RGSA 3O8HA 4M9ZA 4BXFA 5F0FA 4UB8C 2FF4A 4EJWA 4G7ZF 3PNYA 1TW2A 2LREA 4I76A 4KITB 1EKEA 2OPTA 3ZRGA 3SEQA 3F3XA 2NVUB 1U9OA 2PFBA 4MQVA 3E6DA 2LBFA 1BOBA 5LHIA 1D0ZA 3RJPA 3P9CA 2DFEA 1G4DA 1W36C 3JRIA 2DJNA 1VI0A 2A05A 2WWYA 2MSYA 3SZGA 4KT6A 4CHUA 4XSXF 4DYCA 4RGXA 2ESNA 3CMEI 5LEJA 3I59A 5B66C 3GTLJ 1IZ1A 2DODA 2QBYA 4DJAA 4NUBA 5DV5A 4Z2YA 3RSNA 3F23A 1T39A 3GTMJ 4QIWN 2GAUA 1IV8A 2EPFA 2VQCA 3ZMTA 1XTAA 5JVTA 1FT9A 3GLLA 4ENMA 1MJBA 3F21A 1ON2A 2NS0A 3I0TA 5E8IA 5HOOA 1F5TA 5EGOB 1LDDA 4WCGA 1OKRA 1ETKA 1YG2A 5EYRA 2F5EA 3PJRA 3IV5A 3OYNA 1PUEE 2CV0A 2IS4A 1K61A 1YS6A 2LYCA 1FPQA 2ZXIA 4KICA 2L4AA 1Y1WJ 4I0BA 3L7WA 4Y4RA 1V5GA 5C3EJ 1KQ8A 2C6YA 1O7LA 5H6RA 4CCJA 1K78B 2PQ8A 3WHCA 2W4SA 1BOAA 2XGXA 4XQFA 2DK8A 2XVCA 4DW6A 1Y39A 5D4RA 3FK7A 2QYOA 4BKXA 1F4KA 4A3CJ 1N77A 4N0BA 4Y7NJ 1ZGWA 4EM2A 1YI2I 5L3DA 4MTEA 1GXPA 3KX2A 2EZKA 2Y0SA 4XLCA 5IPAA 2R7UA 4Y13A 2EA2A 4LMYA 1BL0A 4DNCA 2QM3A 3G73A 5JHFA 2QGUA 4PCQA 2FBIA 1IJWC 3GTJJ 1W5SA 4F7ZA 2VODA 2CV1A 3H3ZA 1QZZA 2RREA 5HVQC 3BR5A 3GZ6A 4NDLA 2GOXB 5BOXA 1FBUA 5ICGA 3CC4I 3SJMA 1B6AA 1D8JA 4GYIA 3HOXJ 2E34A 1P7JA 1OMIA 1E2XA 3MKWB 3PO2J 1ETYA 1QZEA 3I58A 2LBFB 2O7OA 5DEQA 3K4LA 4DYRA 1JT6A 2EFNA 2QQAA 3SQNA 3KFWX 2L4MA 5J1YA 4JX5A 3HJEA 4RAFA 2IEKA 3BQYA 1X3WB 2E5ZA 4Y52J 4BGDA 3GTKJ 1YHQI 2BW3A 4I98B 2FBHA 1BBYA 3RYRA 1Z21A 3FXMA 5F0HA 2W00A 5CJ9A 5E3MA 2BGCA 2WC2A 4D7MA 2O8KA 3OYKA 1ZG5A 1BJZA 2ZSHB 2R3SA 3DPTA 4PFPA 5CVVA 2ZNYA 3H0GJ 4BQNA 1UZCA 4BXXJ 3PSFA 1WQ2A 1OCOH 3GEZA 1WHUA 3EUHA 4A3IJ 4G6DA 2LRDA 2CW0F 2MYSA 2FOWA 4RS8A 3HKZA 3U1KA 2YU3A 1W4MA 2L9VA 3OYLA 1WRJA 1Q1VA 1HF0A 2CJJA 4DQ2A 2CWEA 3CC2I 2KMUA 2HDDA 5DUKA 2KQRA 1HBXG 2UUZA 2Y75A 3BG5A 1X1CA 1YO5C 5FFZA 3D5RC 1I39A 4F3QA 2VC0A 4NC7A 3MKZA 4A3MJ 4BH9A 3F8MA 3ZOBA 3GFIA 2WAQA 3CP8A 4I99C 2TCTA 3FM5A 2FX0A 1X2MA 2HNHA 4Z6YA 1IAWA 3QU3A 3TL4X 3JRGA 3ERMA 4CCOA 2HTSA 5IOZA 3KIOA 3A0BC 2ADUA 4OMYA 3HUGB 5JR3A 1MKMA 3BPXA 2FOKA 3SYTA 1MDMA 2UXXA 3WE3A 2N8GA 4AUXA 2A5WA 2PMZN 1VQKI 4J00A 2K40A 3LSGA 4FT8A 1GUUA 1RI7A 2M7AA 3EUAA 2K9LA 1YS7A 1MMNA 3G2BA 5KNLA 4PK4A 3FDYA 4R79A 3JRDA 2V26A 2JA6J 4OOIA 2DFHA 2HOTA 4RAZA 5HODA 2GOMA 3QAHA 5JVGF 1LJ9A 4L9VA 4N4NB 1JKOC 1Z3XA 2FNPA 4EVIA 3E5UA 3CC7I 5M5YJ 2V6EA 2ZXWH 2DYSH 3S3NA 1NH3A 3CCSI 5LGNA 1GV2A 1MBFA 3U2RA 3EQLF 3GMEA 2HFHA 2UZKA 1F36A 3QPTA 3ZQFA 3OR2C 2FU4A 5H6QA 1BIBA 5EZHA 1OCTC 5L3FA 2AQEA 5J47A 5E1ZB 1HCRA 1PP7U 4YG2F 1I6XA 3JTGA 2DO7A 1GXQA 2F5CA 3I4NJ 1B8IA 1QVTA 3BG6A 2ZXHA 2FA5A 5EEGA 3K4MA 1Z1DA 2AXTC 3DBRB 3DTEA 1CQTA 4X0GA 3GX4X 1KONA 1UFMA 1QPIA 3MN2A 3KLNA 1X1DA 3PNTA 1FOXA 3VEPA 1D0XA 3OR1C 1WJDA 2RNJA 2LY2A 1V55H 3E7LA 1VZ0A 1X1PA 5EG0A 3FMQA 2NAZA 3ZQCA 4YFNF 4Q48A 5B5EC 3TKYA 4YIFA 1FC3A 4II3A 2FD5A 4C30A 3MZHA 2IA0A 4ZTJA 2Y9YA 4M3EA 4DIQA 4A6DA 2EFWA 1TC3C 2XC7A 1QHHD 3OYJA 3DEEA 5EZGA 3RTRA 1ZREA 4XOPA 3ZQQA 2FJ1A 2VN2A 5K7FA 2DA6A 1A35A 3I64A 4IKFA 2VPLA 2BY3A 5DTDA 1PUFB 3GCMA 5ED4A 1P9QC 1JTYA 2TRTA 2M30A 1R1UA 1AKHA 3HBLA 3PIPF 4FE7A 3CJNA 1KYWA 3BWGA 4XONA 1LFBA 1MD0A 1MMDA 3BOQA 3K4KA 4B09A 2X6OA 2COBA 2E36A 3M4OJ 3LSMA 1JE8A 2JSPA 3HRTA 2DMPA 2W7NA 1XDUA 1LFUP 3AKZA 3ELKA 2LDUA 4GO1A 3KEOA 2HEOA 1AOYA 1R1TA 1SAUA 4ZYAA 1I1SA 1HXDA 3CO7C 2STWA 1G3SA 2GM4A 3PNVA 2VT3A 2GXGA 1DPRA 1CGPA 3BP8A 4U87A 2Z2SB 2H1LA 4ZDLA 1YW7A 4HNTA 3IRRA 1ZRCA 1A04A 3CESA 3G3ZA 4I02A 4IHVA 4A3LJ 1G59A 2BE5F 2VPRA 3PUBA 3JW4A 2LKSA 3CD6I 5DD4A 2RVCA 2KPMA 4UUSB 2JA8J 2P7VB 2IGNA 4HBLA 3FXRA 2DBBA 2HOEA 2DK5A 3W2AA 5ERIA 5HLTA 2V9PA 3ABTA 4N9HA 1A36A 3RIRA 2YUSA 4XMYA 4MO7A 4RDUA 1JHHA 5B1AH 2DN0A 1D0YA 2P5KA 3K9TA 2DT7B 1D5VA 1O3SA 2BBYA 2XIGA 3J80Z 1P7IA 1K4TA 4C2TA 3I56I 2LP0A 3DF8A 3ISPA 5B3SH 1MMSA 5LLQA 2ZO4A 3SDGA 1IN7A 4PJLA 4ZJZA 4M3GA 4OINF 1BR2A 4B4CA 2BVLA 4UVBA 1LQ1A 2XHKA 4XK4A 2NNYA 3L09A 1YW9A 4XN0A 3BTCA 3ZXSA 4M9XA 2HOAA 5GTIC 4BAYA 2ZKZA 2R5YA 3ERED 4GYGA 1KA8A 4IQJA 2XF7A 2ZMEA 1KU3A 3OMYA 1FY7A 1Z3YA 2PMUA 3PQKA 2MLGA 5J3LA 5TISC 3IHUA 1ZK8A 1K6OA 3O2PE 3QWLA 4LG0B 2F4MB 1B9MA 1XGOA 2L02A 2YPRA 2XSJC 2KIFA 2KZGA 3K69A 4M6XA 4MQ9F 3BCBA 5DCMB 3ZQHA 4J19A 1KGSA 1B72B 4IRIA 5CVRA 2EB7A 1G8XA 4UVCA 2I8DA 2MC4A 2VBXA 5K1YA 1WSUA 3WU0A 1O3RA 1ORKA 2DMUA 4IHWA 1T0FC 1ZRFA 2PEXA 2XF5A 2Z9OA 2BOLA 3C2BA 3J7ZI 2XDVA 5IT9Z 3QOPA 2IXSA 2P5VA 4A3EJ 1EH6A 1HKQA 3AL0B 3S3MA 3DU6A 1JKQC 1S6LA 2XKPA 2L54A 2E19A 2IGOA 1USSA 1T33A 5J4VA 2G7HA 2DOFA 4AYBA 4WX9A 2CW8A 3LAJA 4GXOA 2EH3A 1U9NA 4HX7A 2XF6A 2LF7A 2KFDA 1RR8C 1UAAA 4BDYA 4KDPA 3WTUC 1CF7B 2HDCA 1RNLA 5CYVA 1Z7UA 4P5OA 2X1DA 3LQRA 2E1MB 4ENKA 3GTOJ 2HQNA 2OU2A 4B3AA 1VQ6I 4CICA 1TT5B 3LA2A 3S15J 3H92A 3OS1A 1ACIA 2R7QA 1NG6A 1N75A 3HZJA 3KLOA 4G6TB 4BQAA 2EIJH 2F4IA 5GAEJ 1IRXA 1R58A 4HYEA 1TWHJ 1SVLA 2OV7A 1R4NB 3KE2A 1MSFC 4FETA 3L1PA 1JI8A 1LKXA 2KL4A 4DBRA 2DYRH 5F6FA 2DOEA 2CG4A 1DQUA 3CCEI 2MC3A 2V9KA 1UHMA 3CTAA 1WKMA 2W84A 1IGNA 4TV7A 3WG7H 3BTLA 4CUGA 1P4AA 1X4OA 2P4WA 2WB1N 1QNTA 2IP2A 3E6CC 1XN7A 5JLWA 3KZZA 2EIMH 5F04A 3ABKH 3JSPA 1WJAA 3DXJF 1TT0A 1T38A 1O57A 3TEDA 1BI3A 2RNGA 2CQQA 3TO6A 3H36A 2NVTJ 4FASD 4EJVA 4N4OB 3D5LA 2JRMA 2XASA 3U9GA 4GFBA 2VXDA 2FQ3A 1IN4A 2O03A 3H9QA 3CP2A 1QZYA 1XB4A 2XSDC 2Y9ZA 2DA7A 2B63J 1IO2A 2E2JJ 3FWEA 2TDXA 3GYHX 4HA8A 1SC7A 1HQCA 3S14J 3WGGA 4U0VA 1DU0A 4XNFA 4MFDA 4HLXA 5LD2C 2PN6A 2AXLA 1J09A 1FP1D 2M87A 3BR2A 3HEFA 1A5JA 1MH4A 3VYSB 4XLPF 1TZLA 3BR3A 1R23A 4ASNA 1EJ9A 1H89C 3F22A 4M71A 4WF2A 2QA4I 3HM5A 3RPUA 1ZRDA 4EQQA 1MMGA 3HB9A 1SEUA 2EJRA 3ABMH 3V7CA 1J5YA 3AFHA 3WTXC 3CCMI 4PSXA 2CO5A 2CUJA 1HLVA 4M3FA 3SEZA 4ENNA 2OCEA 3QYFA 4BEHB 2R7SA 4V2GA 1R5ID 2DLLA 2JZYA 1YX5A 4CCNA 3OV8A 1XSDA 1T2KA 1BIAA 2EINH 3FXLA 3KEYA 3R60A 2QQBA 3TO7A 2LY9A 3G1OA 1Z05A 3ASOH 3X2QH 4CA0A 4EV0A 5EGOA 1VQ9I 4ZDPA 1Q1HA 1RKTA 2VKEA 5JLXA 4YRVA 2L3DA 3BCAA 3OS2A 5E79C 5F1RA 1UJ8A 2LH9A 3V7SA 4PJNA 4D5CA 3G4SI 5M3FJ 3ZPLA 1HA8A 3HRUA 5D5XB 4CSWA 3BJ6A 4A5MA 5FKLA 1MNMC 3F6OA 4G7HF 3V8JA 4FQGA 4B44A 2AS5F 3BG9A 2XAJA 3BY6A 2WBMA 2E2IJ 3ZP5A 1K78A 2B9SA 3S1QJ 3HXLA 3WTZA 1EV7A 4U7BA 2GQQA 2E71A 4P9FA 2MH2A 2MGQA 1HC8A 2DPDA 5ILVA 1XGNA 3S16J 2OD5A 4HQMA 1JT0A 4ZYEA 4P96A 1U5TC 3C1DA 1KU7A 4JX6A 3PUFA 1FYMA 4I09A 2CQXA 2I5UA 2XGEA 1L3LA 4H0EA 3DQVC 3OY9A 1IUYA 4XN3A 5J6XA 2DA3A 2Z16A 4JOMA 3J80K 5ILSA 3CMMA 2L9NA 2EWNA 6PAXA 4KMUX 3BTIA 2JSCA 5H20A 2GA2A 4IXAA 4CDGA 2R92J 1Z0XA 5J8CA 2BY2A 4IF4A 1MSEC 3HPHA 2CFXA 2QSFX 2DTRA 2ZC2A 4HZFA 4U0YA 1LPQA 1ZH5A 4AVZA 5HDNA 3KZIC 3E6MA 3GUDA 3NAUA 2F5DA 3OL3A 4E6KG 1S7OA 2MABA 1W5TA 3U21A 4LLNA 1Y1VJ 3NEUA 3K4NA 1J9IA 3H3VK 3PIOF 2XB5A 2DI3A 4KN4X 3HOWJ 1UB9A 1OPCA 3ASNH 1X58A 1XD7A 2XPWA 2JQ7A 4UHTA 1NHAA 1W7PD 3ZMDA 1YJNI 1OYWA 2XAQA 3LSIA 4ANJA 3E1SA 4G12A 5C4JJ 3Q0VA 4AIJA 1GVDA 2DJIA 2X6YA 3O3KA 4PGHA 4CZZA 2L0KA 2NOGA 1S5LC 2MG4A 5IT9K 2FUG2 4D9JA 3WODF 1Z7LA 2L7FP 4EJTA 3KETA 1QO0D 3QU6A 1S9HA 4IVNA 4KMFA 4QWQA 4QPOA 3I5UA 4XICA 4FX4A 2RDPA 5DS9A 3TDUC 1P6RA 4NQWB 5EEHA 2A5YB 3FXJA 1JTXA 4IEJA 4U88A 3GVAA 4PFOA 5FRMA 4B47A 5GPCA 5FLMJ 1OR7A 2EILH 2X1EA 3M8EA 4HEA2 3J7AY 5ICCA 1ZELA 1U2WA 2KRFA 3A03A 4OIOF 3OYDA 5M3MJ 1JHFA 2HYGD 1USTA 1X1BA 3F8FA 4NC8A 4A3JJ 3CQZJ 2M2EA 1E3OC 4ESBA 4OWRB 1QRYA 2MBFA 1Z67A 1UMQA 4XLFA 3UNGC 2LR8A 4RB2C 1IXSB 2Y0SN 3HUGA 4XSZF 1R1VA 4D0PA 2DA5A 2WY8Q 1VQ7I 5EEAA 3E5QA 5HLIA 3JCUC 3F9KA 3JRAA 3AAFA 3QP5A 5D5VB 1MIJA 2W85A 4L5IA 1WZ2A 2H6BA 4B3XA 5D5UB 4FCYA 1UELB 4HV6A 2R7RA 3K4BA 3HYIA 3KYLA 1FIAA 3ESWB 3V42A 3MKLA 1R7JA 2L7MP 2M4KA 3GZ5A 4A3FJ 5GP9A 4HF2A 4E7IA 2W24A 4D5FA 1VQ5I 3BTJA 3FIWA 3TOAA 4BJ6C 1LB2A 1ZTRA 1I27A 2JPCA 1IF1A 4LIVA 1FSHA 3IC7A 1K4SA 1BI1A 3O8GA 2VXZA 3DKXA 2YU9J 1OCCH 3JSOA 5D6FA 2DMNA 1ZN2A 3MKYB 2FE3A 3IAS2 1UHWA 1BR1A 1PJRA 4E70A 4ENJA 1YLFA 1XGSA 4NB5A 3W6KB 3W2WA 1ON1A 5CVIA 4BE0A 3HHGA 1ENHA 1IRZA 1LVKA 2DDAA 2LOOA 2VT2A 2FQ4A 4HDVA 2MD5A 2R7XA 2GXBA 3LQQA 3WTWC 4QSHA 1T56A 1X2NA 4HOBA 4F92B 2XKOA 3UR3C 3K70D 3K1PA 1U78A 3H5RA 4OAYA 3NQOA 2QENA 3MZYA 2L2OA 2V79A 2PJRB 2YS9A 1SD4A 1ODDA 2K4BA 3CUOA 4A6EA 2DPUA 4PJMA 1T08B 2V1DA 4G94A 3M8FA 1TBXA 2ZJQF 1H9TA 3R0AA 3ZQIA 3M9AA 1SAXA 3C18A 5LGUA 2KHMA 2K9SA 1SFKA 2KP6A 2Y48A 1OQYA 3J7YJ 4II2A 4IHYA 1JJ8C 1D3YA 2KDZA 1R00A 3V8KA 3IKVA 4Q5SF 1TQIA 3LSTA 1PUFA 2DCEA 2IBDA 1Z91A 4M73A 2CYYA 4C9YA 2A3SA 4PSWA 1PYVA 1R22A 3HOYJ 1TWCJ 3MD2A 3SXYA 1D1CA 3EUHC 1WGXA 3TW6A 5FKNA 3F6VA 4CXFA 4CGZA 2VASA 2KJCA 3H9JA 2VJ5A 3VB2A 3R4KA 2FMYA 2Q0OA 4AVPA 2A61A 4ZYDA 4E7LA 2KZVA 5FRNA 2K3PA 1Y0UA 3A2KA 1J7KA 3KEQA 2VJJA 3W3CA 4E7HA 1ETVA 1BW6A 1IN8A 3FXUA 2KKOA 1TL8A 2JVHA 1S3JA 4BJTA 1E0EA 1I6HJ 4DBQA 5LGTA 4BHPA 2LD5A 3QPLA 2HPIA 4I01A 4UUSA 3OL4A 2O3FA 3M1EA 2D1VA 4HF0A 2ELHA 2LNBA 4MNUA 2JA5J 1M1EB 3DTKA 1R5HA 5E3LA 2DT5A 2PMZA 2O9LA 4HRIA 1KU9A 1MBKA 2HZDA 2E1OA 4L9TA 2WADA 2A6EF 3OOUA 3HOTA 1OCPA 4U7DA 3FM3A 1E17A 2V1UA 4RM2A 2W57A 1SANA 3ZN0A 5K7HA 1RUOA 2W82A 3FX3A 3CF5F 2DU9A 4KA4A 4IL6C 4EGYA 2K9QA 1IXCA 2OZ6A 5M5XJ 5CQEA 2DMTA 2EK5A 4KIBA 5IY5H 2HVRA 2YR2A 3S1RJ 1ZR2A 1YITI 2R7OA 3TOBA 3BR6A 4EATA 2HVQA 4XRFA 1PP8F 1RRJA 4AIHA 5D8LB 1X3ZB 3LSKA 2R7DA 5E18F 5TJJA 2QSHX 4MHGA 3CCRI 1RIOH 1R71A 2K02A 2M0MA 2X6XA 3LSJA 4CYCB 1WJCA 4LG0A 3WTVC 4XM3A 3CCJI 1IN6A 2P7CB 5DCMA 3ZQGA 4HSTA 3DLAA 4IZZA 4A0YA 1B72A 1SMTA 1TQPA 2D45A 2VOOA 3OSGA 1U8BA 5LHHA 4OAZA 3CDIA 1SVOA 3RKWA 4O6JA 3ECHA 4U0WA 1V5FA 3PO3J 1RPWA 4ZZDA 2M34A 4ABZA 3PQJA 4LG3A 1OCRH 3T1BA 2ZFWA 3K2AA 2QKLB 1UG2A 5HDKA 1R4MB 2LVSA 3FMSA 3I9V2 3CO6C 3T8TA 2O0YA 4LIUA 4I0AA 1S29A 4XLEA 2NVQJ 2HKXA 4DGWB 2M0CA 2HS5A 4AC0A 4I2OA 4B43A 2Z1DA 2HQ5A 2CQ7A 4MIMA 1YIOA 2MW8A 1CF7A 4A3DJ 1NK2P 3ZQ7A 1APLC 2LKXA 2ACJA 3HDDA 1I3QJ 4GRIA 5HDGA 3JRFA 1DDNA 2M45A 2HOSA 2P8TA 1ONVA 1W7PB 2LY1A 2W25A 4A5NA 4YIRX 4G7OF 4UVAA 2CH0A 2M9HA 2GIVA 3WU2C 1NTCA 2R7TA 3RKQA 3WGIA 3BZKA 1Y8RB 5FKOA 4JYKA 2X9DA 2ELJA 3LSHA 3RPUD 4IOCF 1JUSA 2HKOA 2RV8A 3BZ6A 4C3IJ 4KFCA 4XIDA 4KYWA 2E7WA 3FKJA 2EFOA 1WH5A 3ABUA 2A6HF 1N78A 1XGMA 2L7KA 1JUPA 2ZXJA 2WV1A 1FBSA 2EBIA 1B4AA 1BA5A 1FTZA 2WA0A 1ETQA 3LMMA 3K70C 4L0ZB 3CF2A 4FTHA 2GA1A 1LFPA 1O4XA 2VB6A 3K2ZA 4HX4A 1WFXA 4YELA 3TGNA 3RZDJ 3TBIA 2ME0A 2E1NA 3H0DA 4S05A 4CCKA 2QKMB 4C3JJ 2V4JC 1MBJA 2Z5UA 1HDDC 1AA7A 2VL8A 1WJ5A 2LLKA 2NOJB 2VQGA 3JRBA 1Z77A 5CQGA 4N9IA 3GTPJ 2QWWA 5E20A 2EFQA 2CW7A 2BEOA 1LE8B 2VOPA 3ECOA 1HW2A 1ZR4A 1ETOA 1T0FA 3LA3A 3W6JB 3EYIA 3F8NA 2PMHA 3E6BA 3IWFA 4BBRJ 2E2HJ 1S7EA 2XPUA 4R8HA 3G1MA 4LB5A 4LJZF 4LITA 1KZHA 2HZTA 4A93J 3FHNA 2ZBKA 1IV6A 2BXZA 1IC8A 3FXOA 2HGCA 3B73A 3TP0A 3LNQA 2ZFUA 4AYBN 3E97A 2J5OA 2Y31A 1MW7A 2MH9A 4BHBA 3CDHA 2F4OB 1MBGA 1FOYA 1A31A 2EZHA 1WWXA 2BHZA 1R6RA 4YEJA 1BJAA 1TLHB 4BS9A 3BZCA 2ZMEC 4C2UA 1SFEA 3ONQA 3KPHA 3HOSA 2H6CA 3CJRB 5C44J 2R5ZB 4BEHA 2Y30A 2R93J 4I6ZA 2ME6A 2OQRA 2QCOA 1R9TJ 2Q1ZB 4A0XA 3L2RA 4HNVA 3GO5A 3VODA 2P6TA 3GFLA 4UV9A 4ZDOA 3ML6A 4Y15A 4RLFA 5HS9A 3VFZA 3HRSA 3CCLI 3FK6A 3M8JA 2EA4A 4FHTA 3PFYA 4LK0F 5LRRA 4ETSA 3Q0UA 1FNNA 4QLCU 4WXHA 1D1AA 3MAJA 1BR4A 3DFGA 1H8AC 2G7UA 1DP3A 4PJ0C 1BM9A 4BL0B 4ZZLA 3FISA 3FBIB 4CYDA 3LFKA 3DU5A 4UV8A 3MQ0A 3KYCB 1TW3A 2V1NA 1YOVB 3P9KA 3NARA 5HNFA 2X1CA 2W1OA 1RKWA 2PBIA 2Z99A 1FOWA 3KP7A 5FGMA 4FX0A 5LFAA 5K5OA 3G71I 4PZJA 1QGPA 4MLOA 2UXNA 4RA2A 3LFUA 4IHSA 5BS6A 4D7NA 2FSWA 2IVMA 2EZLA 1X3UA 1U0JA 5GAGJ 1SFXA 4M6VA 3WGHA 1IW7F 1DU6A 1XDSA 4M74A 3JTHA 4RMNA 5DD8A 3ULQB 2W48A 3P5JA 2O8XA 5CKTA 4GDFA 5FLVA 4XOTA 2RN7A 4AIDA 1F1ZA 4LLLA 1ZLKA 3DLLF 5HLHA 2CMPA 1YRNB 2DQRA 2VONA 4CCMA 1IRGA 2VBWA 3I4PA 1G3WA 1OCZH 1UG0A 1VQMI 4O3MA 2M7BA 1BC8C 5FKKA 2V6CA 2CUEA 3D1NI 2VKVA 1GV5A 1ZAOA 2G9WA 2NS8A 3A01B 4ZTFA 2HI3A 4IOAF 3FXQA 2WB1A 3V4GA 2L5QA 2ID6A 3ZCOA 4NHJA 2CUFA 2DT6A 3CZ6A 4A0ZA 2RQPA 4UB6C 4HW0A 3OWTA 3GF2A 2IPQX 4F52A 4S0HB 3COAC 3A02A 1AWCA 2VUMJ 1QBJA 3CUQC 4BJ5C 1FJLA 4KIFA 3I3LA 4E7JA 3HGYA 1B1BA 4GCVA 2MFZA 4ESJA 1JJ6C 3A1YA 3VDXA 2F5FA 1W1WE 1RESA 1MH3A 2P0WA 3CCYA 2DOAA 2YSRA 3W6VA 3S1MJ 4NQWA 1VNDA 4W97A 5E3OA 4MTDA 1LVAA 4ZYHA 1JGGA 2LK2A 3JR9A 2XAHA 2NVXJ 4L9NA 3WE2A 2LMDA 3MZ8A 4QPQA 3S1NJ 1IDYA 3GFMA 5TGTA 3BT9A 2XRNA 3SDBA 2OTJI 1TTYA 2A68F 2KLOA 1WJBA 1Y0NA 2IW5A 1BI0A 2DXIA 2H8RA 2XAFA 2E7XA 2XGCA 5AONA 1GDTA 1BI2A 1WH7A 2EIKH 5HNHA 3OOPA 3QPSA 3KP5A 2LC2A 2HVSA 2HQRA 2M3AA 2CS3A 5KHDA 4EGZA 3ZGKA 5LBQA 2OA4A 2NVYJ 3L2CA 4EJUA 2GLOA 4KN7X 1IUFA 3MCZA 2D5VA 3GXOA 4EJOA 4XRMA 5E17F 2XRLA 5FD6A 3DWLE 4BQOA 1SFOJ 1ZG1A 2HWVA 2O61A 3PL8A 4NBQA 2BY1A 4CZCA 2HPMA 4BE2A 1VF9A 3C3WA 4OMZA 1WJEA 2H27A 3HOVJ 3H1CA 1V54H 2PJPA 1ETXA 4L9JA 5FFXA 1REPC 4MEXF 2AHQA 2ISZA 1IG7A 3Q5FA 4BXUA 3EDPA 3REOA 1IXRC 2KIQA 3FKIJ 3V7RA 5CVUA 2OBPA 1LUJB 3OIOA 4KT5C 1OYIA 5GAHJ 1LDJA 4WXDA 4Q47A 2OZUA 1QA6A 4OIQF 1SVMA 4C2MJ 2COMA 3K10A 2PG4A 3S2DJ 1VQ4I 2KIUA 3SZTA 1DUXC 4AWXB 3IUOA 3HPGA 2X51A 2VQLA 3F72A 3HGGA 1VQ8I 1HSJA 1YYVA 2EV0A 4RBOA 2JUCA 1PDNC 3MVPA 1LDKB 4K2EA 4R1HA 4XKCA 1K83J 3CUQB 5AIQA 4BU2A 3OYMA 2EQRA 1VQPI 3Q9SA 4RB0A 4LB6B 4M3DA 5J1RA 2QLZA 2OQGA 3B6CA 4XKWA 2HYFA 3RDIA 3VSKA 3EETA 3DPLC 1J2XA 2DW4A 2RGVA 2FEZA 3LL7A
chains in the Genus database with same CATH topology
1G3YA 1FZPB 2FRHA 4WXCA 4IPAA 2PLYA 1Z9CA 4YFKF 1TQMA 4B8XA 1DP7P 3N97A 2VBZA 1T6SA 5TRDA 2ZNZA 4OIRF 4PGGA 4GGGA 5DUIA 4Y17A 1DPUA 1U6GA 5BQTA 3DEUA 2NYXA 2KIMA 2JPBA 1JXSA 1U5TB 2HTJA 4YIIA 3WTYC 1XCVA 4HLYA 3HTSB 3MEXA 3RI4A 4JBAA 1R36A 2DAOA 2FXAA 2D2WA 1K7AA 2A07F 3CLOA 2XV4S 3BDDA 1KQ9A 3HSEA 4RAYA 4OIPF 1FBQA 5DDGA 4L0YB 2K27A 4RB1A 1YQAA 4BYYA 5FB2A 5KVRA 5FO5A 1SD5A 2R7FA 4BHCA 1J0RA 1O3QA 5LHGA 1IN5A 3FMRA 3RYPA 1U3EM 3BPVA 1G3TA 4UUVA 2JTVA 1O3TA 3IWZA 3K0LA 4RGUA 4KIGA 5D5WB 2UWMA 1U8RA 1YTYA 2ETHA 2IA1A 3V8LA 1HSTA 3K1MA 5JHUA 2MLKA 1QPMA 3I59B 3ZMSA 5F64A 2QBYB 5L3BA 2GZWA 5D8KB 1MGTA 1Z6RA 2E1CA 4M9SA 2CQKA 3HRMA 4G9YA 3MFKA 5D4SA 4O5VA 3TDZC 3FHZA 3H3UA 4PDKA 3KZYA 1STZA 5KK1A 2JRTA 1EH8A 1GVJA 3HIFA 1XSVA 3M7GA 3KP3A 4UNOA 5K5RA 1O7FA 1FLIA 1P2FA 1XCBA 2MA3A 3DV8A 3I71A 5BPIA 3K1NA 1B9NA 2VE9A 3HSRA 5K5QA 1S8NA 3EYYA 3BROA 5CLSA 3R0JA 1W7PA 2LF8A 3RKXA 2A69F 2YX7A 5ILUA 2RC4A 1QQIA 3VOEA 4JQFA 4P9UA 3J81Z 3D0SA 5FLXZ 5J8FA 1H9GA 1S7AA 3QPHA 2QUFA 3QP6A 1YFHA 2EV6A 1IRFA 1BC7C 4G6QA 3F8BA 3DKWA 1FWZA 1HKSA 3PFIA 5ICFA 4OU0A 2XROA 2WV0A 2K4JA 2QVOA 4Q4ZF 3BJAA 3I54A 3QRFF 4ZYGA 1ZARA 1KU2A 4AIKA 3L9FA 2JT1A 3S2WA 1LNWA 5L3EA 1FP2A 3P7NA 3P9IA 4L18B 2X4HA 3ZN1A 1KQ0A 2QQ9A 3KCCA 1MZBA 3LAPA 3HTUA 3FF5A 3GWZA 4KUMA 5D6EA 2EV5A 2IA2A 1YW8A 1H0MA 4IHTA 3TO9A 1ZG3A 4HV5A 2PI0A 1WI9A 2M1BA 2FNAA 2O6GE 1ZGAA 1MJ9A 2V1XA 2Z3YA 4EM0B 4XLNF 2BYVE 1KYZA 2P5LC 2X0LA 5BPDA 2L01A 1ZHFA 2ZCWA 3SHFA 1MDMB 2FMLA 3B02A 3KP4A 3R61A 4G8XA 1OYYA 4M72A 4EMSA 3E5XA 2YX4A 2K7LA 3RPQA 2Y0MA 1F9NA 1FX7A 2D1HA 5LEKA 2ZJ2A 3Q9VA 4MEYF 3IRQA 1MJAA 1SD6A 2J5PA 1ZYRF 2FBKA 5A2QZ 4HAMA 1I5ZA 1FOKA 4KNYA 2P6SA 3KP2A 2IRFG 4LGWA 3JAMZ 2M8EA 2IJLA 1C0WA 4UXNA 5HLGA 2DQLA 3J7AO 1EH7A 5DCFA 5JFRA 1HW1A 1Z6TA 2Z33A 2V9VA 5E1XA 4HQEA 4LLGF 5IT3A 2QZ8A 4LD5A 4BNCA 2M5WA 1LEBA 1SD7A 2NRAC 4IRGA 1RUNA 3F8CA 5JI6A 3GFJA 3LA7A 1P92A 2F2EA 2ISYA 3T5XA 2XUBA 5L3CA 5HS8A 3WG9A 4ZH4F 3IL2A 2EFPA 3ZMZA 1FSEA 1FYLA 4IJAA 1J75A 1LEAA 4AD9A 5LRSA 5DYMA 1ULYA 1GHCA 3NRVA 3R6SA 1P4XA 2XAGA 2KJBA 1BN5A 3O6BB 2STTA 4LK1F 1G6NA 1R5GA 3J81K 2VC1A 5FLXK 2WTEA 4S04A 3N4MA 2BV6A 1TNSA 4A2UA 4A12A 2VE8A 3HSFA 3MWMA 3DP7A 1TNTA 3ZMUA 5L3GA 2H94A 3GW2A 3SZPA 4YFXF 3HHHA 3T8RA 2VBYA 4XBFA 1V4RA 1J59A 4LFUA 4ESFA 1XMKA 5BMZA 2ESHA 2DFIA 5FD5A 1ZLJA 2ZMEB 3CUQA 4I7HA 2HR3A 3WTSC 3SFZA 2H09A 1HW5A 1P4WA 2LSOA 3ROUA 4ON0A 1B59A 3LWFA 1SFUA 3WTTC 3I53A 2RKHA 4EM1A 1I1GA 4M6YA 4CO8A 3C7JA 1T98A 4WWCA 1V3FA 3TQNA 3WU1B 1VTNC 4RB3C 3E3VA 2Q8KA 3GLXA 5AIPA 5E1WA 1D8KA 4P55A 2CGPA 2OAZA 1XMAA 4RGRA 1U5TA 3T0YA 3BJOA 5HS7A 3L00A 3RKYA 2NNNA 4MGRA 1SMYF 1UCRA 2B0LA 2K86A 2CSOA 5E8GA 4HX8A 5CVJA 4L5JA 3IKTA 4WK8F 1XSXA 2GWRA 3U1DA 2IT0A 4HDUA 1ZGJA 5A2QK 3ZMVA 1FYKA 3KP6A 1K79A 4IRHA 2Q2EA 4JK1X 4HF1A 3JAMK 1L0OC 1HKTA 5ICEA 2LKPA 1RZ4A 3FZVA 1JGSA 4RGSA 4M9ZA 2FF4A 4EJWA 4G7ZF 1TW2A 3F3XA 2PFBA 4MQVA 3E6DA 5LHIA 3RJPA 3P9CA 1G4DA 2WWYA 4CHUA 4XSXF 4RGXA 2ESNA 5LEJA 3I59A 1IZ1A 2QBYA 5DV5A 4Z2YA 1T39A 3F23A 2GAUA 3ZMTA 5JVTA 1FT9A 4ENMA 1MJBA 3F21A 1ON2A 5E8IA 2NS0A 3I0TA 5HOOA 1F5TA 1LDDA 4WCGA 1OKRA 1YG2A 2F5EA 1PUEE 1YS6A 1FPQA 4KICA 2L4AA 4I0BA 3L7WA 1KQ8A 2C6YA 1O7LA 5H6RA 1K78B 2PQ8A 1BOAA 2XGXA 2DK8A 2XVCA 5D4RA 2QYOA 1F4KA 4N0BA 4EM2A 5L3DA 4MTEA 1GXPA 4Y13A 2EA2A 4LMYA 4DNCA 2QM3A 3G73A 4PCQA 2FBIA 1W5SA 4F7ZA 2VODA 3H3ZA 1QZZA 5HVQC 3GZ6A 5BOXA 1FBUA 5ICGA 1B6AA 1D8JA 4GYIA 1OMIA 1E2XA 3I58A 5DEQA 2EFNA 2QQAA 3SQNA 3KFWX 2L4MA 4I98B 2FBHA 1BBYA 3RYRA 5CJ9A 2BGCA 2WC2A 1ZG5A 2R3SA 3DPTA 5CVVA 2ZNYA 1WQ2A 3GEZA 3EUHA 4G6DA 2CW0F 4RS8A 2YU3A 1W4MA 1WRJA 4DQ2A 2CWEA 5DUKA 1HBXG 2Y75A 1YO5C 5FFZA 2VC0A 4BH9A 3F8MA 3GFIA 3FM5A 1IAWA 3QU3A 2HTSA 2ADUA 4OMYA 5JR3A 1MKMA 3BPXA 2FOKA 1MDMA 2UXXA 3WE3A 4FT8A 1RI7A 1YS7A 4R79A 4OOIA 4RAZA 3QAHA 1LJ9A 4L9VA 2FNPA 4EVIA 3E5UA 5LGNA 3U2RA 3EQLF 2HFHA 2UZKA 3QPTA 2FU4A 5H6QA 1BIBA 5L3FA 5E1ZB 1PP7U 4YG2F 1I6XA 3JTGA 2DO7A 1GXQA 2F5CA 2FA5A 5EEGA 1Z1DA 3GX4X 1UFMA 3KLNA 3VEPA 2RNJA 3FMQA 2NAZA 4YFNF 4Q48A 3TKYA 4YIFA 1FC3A 3MZHA 2IA0A 4A6DA 2EFWA 3RTRA 1ZREA 2VN2A 3I64A 5ED4A 2M30A 1R1UA 3CJNA 1KYWA 3BWGA 3BOQA 1MD0A 4B09A 1JE8A 3HRTA 1XDUA 3ELKA 2LDUA 4GO1A 3KEOA 2HEOA 1AOYA 1R1TA 1I1SA 1HXDA 3CO7C 2STWA 1G3SA 2VT3A 2GXGA 1DPRA 1CGPA 3BP8A 1YW7A 3IRRA 1ZRCA 1A04A 3G3ZA 4I02A 2BE5F 3JW4A 5DD4A 2RVCA 2P7VB 4HBLA 3FXRA 2DBBA 2HOEA 2DK5A 5ERIA 3ABTA 4N9HA 3RIRA 1JHHA 2P5KA 3K9TA 1D5VA 1O3SA 2BBYA 2XIGA 3J80Z 3DF8A 3ISPA 5LLQA 2ZO4A 1IN7A 4OINF 4UVBA 1LQ1A 2XHKA 2NNYA 3L09A 1YW9A 4M9XA 4BAYA 2ZKZA 3ERED 4GYGA 1KA8A 2ZMEA 1KU3A 1FY7A 2PMUA 3PQKA 2MLGA 3IHUA 1K6OA 3O2PE 4LG0B 1B9MA 1XGOA 2L02A 2YPRA 4M6XA 2KIFA 3K69A 4MQ9F 5DCMB 1KGSA 4IRIA 5CVRA 2EB7A 4UVCA 1WSUA 2VBXA 5K1YA 3WU0A 1O3RA 1ZRFA 2PEXA 2Z9OA 5IT9Z 3QOPA 2P5VA 1EH6A 1HKQA 1S6LA 2XKPA 2L54A 1USSA 4WX9A 2G7HA 3LAJA 4GXOA 4HX7A 2LF7A 4KDPA 3WTUC 1CF7B 2HDCA 1RNLA 5CYVA 1Z7UA 4P5OA 3LQRA 4ENKA 2HQNA 2OU2A 4CICA 3LA2A 3H92A 3KLOA 4BQAA 1R58A 4HYEA 3KE2A 5F6FA 2CG4A 2MC3A 1UHMA 3CTAA 1WKMA 2W84A 4TV7A 1P4AA 2P4WA 1QNTA 2IP2A 3E6CC 1XN7A 3KZZA 3JSPA 3DXJF 1T38A 1O57A 1BI3A 3TO6A 4EJVA 3D5LA 2XASA 3U9GA 2FQ3A 1IN4A 2O03A 1QZYA 1XB4A 3FWEA 2TDXA 3GYHX 4HA8A 1HQCA 3WGGA 4U0VA 4HLXA 2PN6A 2AXLA 1FP1D 2M87A 4XLPF 1R23A 4ASNA 3F22A 4M71A 4WF2A 3RPUA 1ZRDA 4EQQA 2EJRA 3V7CA 1J5YA 3WTXC 2CO5A 4ENNA 2DLLA 2JZYA 3OV8A 1XSDA 1T2KA 1BIAA 3R60A 2QQBA 3TO7A 1Z05A 4EV0A 1Q1HA 2L3DA 5F1RA 3V7SA 3ZPLA 3HRUA 5D5XB 3BJ6A 4A5MA 3F6OA 4G7HF 3V8JA 2AS5F 2XAJA 3BY6A 3ZP5A 1K78A 3WTZA 1EV7A 4U7BA 2GQQA 4P9FA 2MH2A 2DPDA 5ILVA 1XGNA 2OD5A 4HQMA 1KU7A 4ZYEA 4P96A 1U5TC 3C1DA 1FYMA 4I09A 1L3LA 4H0EA 3DQVC 1IUYA 5J6XA 3J80K 5ILSA 2EWNA 6PAXA 4KMUX 2JSCA 5H20A 2GA2A 4IXAA 4CDGA 5J8CA 4IF4A 2CFXA 4HZFA 2DTRA 4U0YA 1ZH5A 5HDNA 3E6MA 3GUDA 2F5DA 1S7OA 1W5TA 4LLNA 3NEUA 1J9IA 2DI3A 4KN4X 1UB9A 1OPCA 1XD7A 4UHTA 1NHAA 1W7PD 3ZMDA 1OYWA 2XAQA 4AIJA 3O3KA 4PGHA 4CZZA 5IT9K 3WODF 4EJTA 3KETA 1QO0D 3QU6A 4IVNA 4KMFA 4QWQA 3I5UA 4FX4A 2RDPA 3TDUC 1P6RA 5EEHA 2A5YB 4U88A 3GVAA 1OR7A 3M8EA 5ICCA 1U2WA 2KRFA 4OIOF 1JHFA 2HYGD 1USTA 3F8FA 4ESBA 2MBFA 4RB2C 1IXSB 3HUGA 4XSZF 1R1VA 4D0PA 3E5QA 5HLIA 3AAFA 3QP5A 5D5VB 2W85A 4L5IA 2H6BA 5D5UB 4HV6A 3HYIA 1R7JA 3GZ5A 4HF2A 2W24A 1LB2A 3TOAA 1I27A 2JPCA 1IF1A 1FSHA 3IC7A 1BI1A 2VXZA 3JSOA 5D6FA 1ZN2A 2FE3A 1UHWA 4E70A 4ENJA 1YLFA 1XGSA 4NB5A 3W6KB 1ON1A 5CVIA 3HHGA 2VT2A 4HDVA 2MD5A 2GXBA 3LQQA 3WTWC 4HOBA 2XKOA 3K1PA 1U78A 3NQOA 2QENA 3MZYA 2V79A 1SD4A 1ODDA 2K4BA 3CUOA 4A6EA 2DPUA 2V1DA 4G94A 3M8FA 1TBXA 1H9TA 3R0AA 3M9AA 1SAXA 3C18A 5LGUA 2Y48A 1D3YA 1R00A 3V8KA 3IKVA 4Q5SF 1TQIA 3LSTA 1Z91A 4M73A 2CYYA 2A3SA 1R22A 3SXYA 3F6VA 4CXFA 4CGZA 2KJCA 3VB2A 3R4KA 2FMYA 2Q0OA 4AVPA 2A61A 4ZYDA 1Y0UA 1J7KA 3KEQA 1IN8A 3FXUA 2KKOA 1S3JA 5LGTA 4BHPA 4I01A 2O3FA 3M1EA 2D1VA 4HF0A 2ELHA 2LNBA 4MNUA 1R5HA 2DT5A 1KU9A 4L9TA 2A6EF 3HOTA 4U7DA 3FM3A 1E17A 2V1UA 2W57A 3ZN0A 1RUOA 3FX3A 2DU9A 4KA4A 4EGYA 1IXCA 2OZ6A 4KIBA 2EK5A 2YR2A 3TOBA 4XRFA 1PP8F 4AIHA 5D8LB 2R7DA 5E18F 5TJJA 4MHGA 1RIOH 2K02A 4LG0A 3WTVC 1IN6A 2P7CB 5DCMA 4A0YA 1SMTA 1TQPA 2D45A 2VOOA 5LHHA 3RKWA 4O6JA 3ECHA 4U0WA 4ZZDA 3PQJA 3T1BA 2ZFWA 5HDKA 3FMSA 3CO6C 3T8TA 2O0YA 4I0AA 1S29A 2HKXA 2HS5A 4I2OA 1YIOA 1CF7A 3ZQ7A 2ACJA 5HDGA 1DDNA 2M45A 2P8TA 1ONVA 1W7PB 2W25A 4A5NA 4G7OF 4UVAA 2GIVA 3WGIA 2HKOA 4KFCA 2RV8A 3BZ6A 4KYWA 2E7WA 2EFOA 3ABUA 2A6HF 1XGMA 2ZXJA 1FBSA 1B4AA 4L0ZB 2GA1A 3K2ZA 4HX4A 3TGNA 2E1NA 4S05A 2Z5UA 4N9IA 2QWWA 5E20A 2EFQA 2BEOA 2VOPA 3ECOA 1HW2A 1T0FA 3LA3A 3W6JB 3EYIA 3F8NA 2PMHA 3E6BA 3IWFA 4R8HA 4LB5A 4LJZF 2HZTA 2ZBKA 2HGCA 3B73A 3E97A 2J5OA 4BHBA 2MH9A 3CDHA 1WWXA 1BJAA 1TLHB 1SFEA 3HOSA 2H6CA 2OQRA 4A0XA 3GO5A 3VODA 2P6TA 3GFLA 4UV9A 3ML6A 4Y15A 5HS9A 3VFZA 3HRSA 2EA4A 4FHTA 4LK0F 5LRRA 4ETSA 1FNNA 4QLCU 4WXHA 3MAJA 3DFGA 2G7UA 1BM9A 4ZZLA 4CYDA 3LFKA 4UV8A 3MQ0A 3P9KA 1TW3A 2PBIA 2Z99A 3KP7A 5FGMA 5K5OA 4FX0A 4PZJA 1QGPA 2UXNA 4IHSA 5BS6A 2FSWA 2IVMA 1X3UA 1SFXA 3WGHA 1IW7F 1XDSA 4M74A 3JTHA 5DD8A 3ULQB 2O8XA 2RN7A 1ZLKA 1F1ZA 4LLLA 5HLHA 2DQRA 2VONA 1IRGA 2VBWA 3I4PA 1G3WA 4O3MA 1BC8C 2V6CA 1ZAOA 2G9WA 3FXQA 3V4GA 4NHJA 4A0ZA 2RQPA 4HW0A 3GF2A 2IPQX 3COAC 1AWCA 1QBJA 3CUQC 4KIFA 1B1BA 4GCVA 4ESJA 2F5FA 2YSRA 4NQWA 4MTDA 1LVAA 4ZYHA 2XAHA 4L9NA 3WE2A 3GFMA 2XRNA 1TTYA 2A68F 2IW5A 1BI0A 2XAFA 2E7XA 5AONA 1BI2A 3OOPA 3KP5A 2HQRA 4EGZA 5LBQA 2OA4A 3L2CA 4EJUA 4KN7X 3MCZA 3GXOA 4EJOA 5E17F 5FD6A 1ZG1A 2HWVA 2O61A 3C3WA 4OMZA 2H27A 2PJPA 4L9JA 5FFXA 1REPC 4MEXF 2ISZA 3Q5FA 4BXUA 3EDPA 3REOA 1IXRC 3V7RA 5CVUA 2OBPA 4KT5C 1OYIA 1LDJA 4WXDA 4Q47A 2OZUA 4OIQF 2COMA 2PG4A 2KIUA 3SZTA 1DUXC 4AWXB 3F72A 1HSJA 1YYVA 2EV0A 1PDNC 4K2EA 1LDKB 4R1HA 5AIQA 3CUQB 3Q9SA 4RB0A 4LB6B 2QLZA 2OQGA 2HYFA 3RDIA 3EETA 3DPLC 1J2XA 2DW4A 2RGVA 2FEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3Y A;  1FZP B;  2FRH A;  4WXC A;  4IPA A;  2PLY A;  1Z9C A;  4YFK F;  1TQM A;  4B8X A;  1DP7 P;  3N97 A;  2VBZ A;  1T6S A;  5TRD A;  2ZNZ A;  4OIR F;  4PGG A;  4GGG A;  5DUI A;  4Y17 A;  1DPU A;  1U6G A;  5BQT A;  3DEU A;  2NYX A;  2KIM A;  2JPB A;  1JXS A;  1U5T B;  2HTJ A;  4YII A;  3WTY C;  1XCV A;  4HLY A;  3HTS B;  3MEX A;  3RI4 A;  4JBA A;  1R36 A;  2DAO A;  2FXA A;  2D2W A;  1K7A A;  2A07 F;  3CLO A;  2XV4 S;  3BDD A;  1KQ9 A;  3HSE A;  4RAY A;  4OIP F;  1FBQ A;  5DDG A;  4L0Y B;  2K27 A;  4RB1 A;  1YQA A;  4BYY A;  5FB2 A;  5KVR A;  5FO5 A;  1SD5 A;  2R7F A;  4BHC A;  1J0R A;  1O3Q A;  5LHG A;  1IN5 A;  3FMR A;  3RYP A;  1U3E M;  3BPV A;  1G3T A;  4UUV A;  2JTV A;  1O3T A;  3IWZ A;  3K0L A;  4RGU A;  4KIG A;  5D5W B;  2UWM A;  1U8R A;  1YTY A;  2ETH A;  2IA1 A;  3V8L A;  1HST A;  3K1M A;  5JHU A;  2MLK A;  1QPM A;  3I59 B;  3ZMS A;  5F64 A;  2QBY B;  5L3B A;  2GZW A;  5D8K B;  1MGT A;  1Z6R A;  2E1C A;  4M9S A;  2CQK A;  3HRM A;  4G9Y A;  3MFK A;  5D4S A;  4O5V A;  3TDZ C;  3FHZ A;  3H3U A;  4PDK A;  3KZY A;  1STZ A;  5KK1 A;  2JRT A;  1EH8 A;  1GVJ A;  3HIF A;  1XSV A;  3M7G A;  3KP3 A;  4UNO A;  5K5R A;  1O7F A;  1FLI A;  1P2F A;  1XCB A;  2MA3 A;  3DV8 A;  3I71 A;  5BPI A;  3K1N A;  1B9N A;  2VE9 A;  3HSR A;  5K5Q A;  1S8N A;  3EYY A;  3BRO A;  5CLS A;  3R0J A;  1W7P A;  2LF8 A;  3RKX A;  2A69 F;  2YX7 A;  5ILU A;  2RC4 A;  1QQI A;  3VOE A;  4JQF A;  4P9U A;  3J81 Z;  3D0S A;  5FLX Z;  5J8F A;  1H9G A;  1S7A A;  3QPH A;  2QUF A;  3QP6 A;  1YFH A;  2EV6 A;  1IRF A;  1BC7 C;  4G6Q A;  3F8B A;  3DKW A;  1FWZ A;  1HKS A;  3PFI A;  5ICF A;  4OU0 A;  2XRO A;  2WV0 A;  2K4J A;  2QVO A;  4Q4Z F;  3BJA A;  3I54 A;  3QRF F;  4ZYG A;  1ZAR A;  1KU2 A;  4AIK A;  3L9F A;  2JT1 A;  3S2W A;  1LNW A;  5L3E A;  1FP2 A;  3P7N A;  3P9I A;  4L18 B;  2X4H A;  3ZN1 A;  1KQ0 A;  2QQ9 A;  3KCC A;  1MZB A;  3LAP A;  3HTU A;  3FF5 A;  3GWZ A;  4KUM A;  5D6E A;  2EV5 A;  2IA2 A;  1YW8 A;  1H0M A;  4IHT A;  3TO9 A;  1ZG3 A;  4HV5 A;  2PI0 A;  1WI9 A;  2M1B A;  2FNA A;  2O6G E;  1ZGA A;  1MJ9 A;  2V1X A;  2Z3Y A;  4EM0 B;  4XLN F;  2BYV E;  1KYZ A;  2P5L C;  2X0L A;  5BPD A;  2L01 A;  1ZHF A;  2ZCW A;  3SHF A;  1MDM B;  2FML A;  3B02 A;  3KP4 A;  3R61 A;  4G8X A;  1OYY A;  4M72 A;  4EMS A;  3E5X A;  2YX4 A;  2K7L A;  3RPQ A;  2Y0M A;  1F9N A;  1FX7 A;  2D1H A;  5LEK A;  2ZJ2 A;  3Q9V A;  4MEY F;  3IRQ A;  1MJA A;  1SD6 A;  2J5P A;  1ZYR F;  2FBK A;  5A2Q Z;  4HAM A;  1I5Z A;  1FOK A;  4KNY A;  2P6S A;  3KP2 A;  2IRF G;  4LGW A;  3JAM Z;  2M8E A;  2IJL A;  1C0W A;  4UXN A;  5HLG A;  2DQL A;  3J7A O;  1EH7 A;  5DCF A;  5JFR A;  1HW1 A;  1Z6T A;  2Z33 A;  2V9V A;  5E1X A;  4HQE A;  4LLG F;  5IT3 A;  2QZ8 A;  4LD5 A;  4BNC A;  2M5W A;  1LEB A;  1SD7 A;  2NRA C;  4IRG A;  1RUN A;  3F8C A;  5JI6 A;  3GFJ A;  3LA7 A;  1P92 A;  2F2E A;  2ISY A;  3T5X A;  2XUB A;  5L3C A;  5HS8 A;  3WG9 A;  4ZH4 F;  3IL2 A;  2EFP A;  3ZMZ A;  1FSE A;  1FYL A;  4IJA A;  1J75 A;  1LEA A;  4AD9 A;  5LRS A;  5DYM A;  1ULY A;  1GHC A;  3NRV A;  3R6S A;  1P4X A;  2XAG A;  2KJB A;  1BN5 A;  3O6B B;  2STT A;  4LK1 F;  1G6N A;  1R5G A;  3J81 K;  2VC1 A;  5FLX K;  2WTE A;  4S04 A;  3N4M A;  2BV6 A;  1TNS A;  4A2U A;  4A12 A;  2VE8 A;  3HSF A;  3MWM A;  3DP7 A;  1TNT A;  3ZMU A;  5L3G A;  2H94 A;  3GW2 A;  3SZP A;  4YFX F;  3HHH A;  3T8R A;  2VBY A;  4XBF A;  1V4R A;  1J59 A;  4LFU A;  4ESF A;  1XMK A;  5BMZ A;  2ESH A;  2DFI A;  5FD5 A;  1ZLJ A;  2ZME B;  3CUQ A;  4I7H A;  2HR3 A;  3WTS C;  3SFZ A;  2H09 A;  1HW5 A;  1P4W A;  2LSO A;  3ROU A;  4ON0 A;  1B59 A;  3LWF A;  1SFU A;  3WTT C;  3I53 A;  2RKH A;  4EM1 A;  1I1G A;  4M6Y A;  4CO8 A;  3C7J A;  1T98 A;  4WWC A;  1V3F A;  3TQN A;  3WU1 B;  1VTN C;  4RB3 C;  3E3V A;  2Q8K A;  3GLX A;  5AIP A;  5E1W A;  1D8K A;  4P55 A;  2CGP A;  2OAZ A;  1XMA A;  4RGR A;  1U5T A;  3T0Y A;  3BJO A;  5HS7 A;  3L00 A;  3RKY A;  2NNN A;  4MGR A;  1SMY F;  1UCR A;  2B0L A;  2K86 A;  2CSO A;  5E8G A;  4HX8 A;  5CVJ A;  4L5J A;  3IKT A;  4WK8 F;  1XSX A;  2GWR A;  3U1D A;  2IT0 A;  4HDU A;  1ZGJ A;  5A2Q K;  3ZMV A;  1FYK A;  3KP6 A;  1K79 A;  4IRH A;  2Q2E A;  4JK1 X;  4HF1 A;  3JAM K;  1L0O C;  1HKT A;  5ICE A;  2LKP A;  1RZ4 A;  3FZV A;  1JGS A;  4RGS A;  4M9Z A;  2FF4 A;  4EJW A;  4G7Z F;  1TW2 A;  3F3X A;  2PFB A;  4MQV A;  3E6D A;  5LHI A;  3RJP A;  3P9C A;  1G4D A;  2WWY A;  4CHU A;  4XSX F;  4RGX A;  2ESN A;  5LEJ A;  3I59 A;  1IZ1 A;  2QBY A;  5DV5 A;  4Z2Y A;  1T39 A;  3F23 A;  2GAU A;  3ZMT A;  5JVT A;  1FT9 A;  4ENM A;  1MJB A;  3F21 A;  1ON2 A;  5E8I A;  2NS0 A;  3I0T A;  5HOO A;  1F5T A;  1LDD A;  4WCG A;  1OKR A;  1YG2 A;  2F5E A;  1PUE E;  1YS6 A;  1FPQ A;  4KIC A;  2L4A A;  4I0B A;  3L7W A;  1KQ8 A;  2C6Y A;  1O7L A;  5H6R A;  1K78 B;  2PQ8 A;  1BOA A;  2XGX A;  2DK8 A;  2XVC A;  5D4R A;  2QYO A;  1F4K A;  4N0B A;  4EM2 A;  5L3D A;  4MTE A;  1GXP A;  4Y13 A;  2EA2 A;  4LMY A;  4DNC A;  2QM3 A;  3G73 A;  4PCQ A;  2FBI A;  1W5S A;  4F7Z A;  2VOD A;  3H3Z A;  1QZZ A;  5HVQ C;  3GZ6 A;  5BOX A;  1FBU A;  5ICG A;  1B6A A;  1D8J A;  4GYI A;  1OMI A;  1E2X A;  3I58 A;  5DEQ A;  2EFN A;  2QQA A;  3SQN A;  3KFW X;  2L4M A;  4I98 B;  2FBH A;  1BBY A;  3RYR A;  5CJ9 A;  2BGC A;  2WC2 A;  1ZG5 A;  2R3S A;  3DPT A;  5CVV A;  2ZNY A;  1WQ2 A;  3GEZ A;  3EUH A;  4G6D A;  2CW0 F;  4RS8 A;  2YU3 A;  1W4M A;  1WRJ A;  4DQ2 A;  2CWE A;  5DUK A;  1HBX G;  2Y75 A;  1YO5 C;  5FFZ A;  2VC0 A;  4BH9 A;  3F8M A;  3GFI A;  3FM5 A;  1IAW A;  3QU3 A;  2HTS A;  2ADU A;  4OMY A;  5JR3 A;  1MKM A;  3BPX A;  2FOK A;  1MDM A;  2UXX A;  3WE3 A;  4FT8 A;  1RI7 A;  1YS7 A;  4R79 A;  4OOI A;  4RAZ A;  3QAH A;  1LJ9 A;  4L9V A;  2FNP A;  4EVI A;  3E5U A;  5LGN A;  3U2R A;  3EQL F;  2HFH A;  2UZK A;  3QPT A;  2FU4 A;  5H6Q A;  1BIB A;  5L3F A;  5E1Z B;  1PP7 U;  4YG2 F;  1I6X A;  3JTG A;  2DO7 A;  1GXQ A;  2F5C A;  2FA5 A;  5EEG A;  1Z1D A;  3GX4 X;  1UFM A;  3KLN A;  3VEP A;  2RNJ A;  3FMQ A;  2NAZ A;  4YFN F;  4Q48 A;  3TKY A;  4YIF A;  1FC3 A;  3MZH A;  2IA0 A;  4A6D A;  2EFW A;  3RTR A;  1ZRE A;  2VN2 A;  3I64 A;  5ED4 A;  2M30 A;  1R1U A;  3CJN A;  1KYW A;  3BWG A;  3BOQ A;  1MD0 A;  4B09 A;  1JE8 A;  3HRT A;  1XDU A;  3ELK A;  2LDU A;  4GO1 A;  3KEO A;  2HEO A;  1AOY A;  1R1T A;  1I1S A;  1HXD A;  3CO7 C;  2STW A;  1G3S A;  2VT3 A;  2GXG A;  1DPR A;  1CGP A;  3BP8 A;  1YW7 A;  3IRR A;  1ZRC A;  1A04 A;  3G3Z A;  4I02 A;  2BE5 F;  3JW4 A;  5DD4 A;  2RVC A;  2P7V B;  4HBL A;  3FXR A;  2DBB A;  2HOE A;  2DK5 A;  5ERI A;  3ABT A;  4N9H A;  3RIR A;  1JHH A;  2P5K A;  3K9T A;  1D5V A;  1O3S A;  2BBY A;  2XIG A;  3J80 Z;  3DF8 A;  3ISP A;  5LLQ A;  2ZO4 A;  1IN7 A;  4OIN F;  4UVB A;  1LQ1 A;  2XHK A;  2NNY A;  3L09 A;  1YW9 A;  4M9X A;  4BAY A;  2ZKZ A;  3ERE D;  4GYG A;  1KA8 A;  2ZME A;  1KU3 A;  1FY7 A;  2PMU A;  3PQK A;  2MLG A;  3IHU A;  1K6O A;  3O2P E;  4LG0 B;  1B9M A;  1XGO A;  2L02 A;  2YPR A;  4M6X A;  2KIF A;  3K69 A;  4MQ9 F;  5DCM B;  1KGS A;  4IRI A;  5CVR A;  2EB7 A;  4UVC A;  1WSU A;  2VBX A;  5K1Y A;  3WU0 A;  1O3R A;  1ZRF A;  2PEX A;  2Z9O A;  5IT9 Z;  3QOP A;  2P5V A;  1EH6 A;  1HKQ A;  1S6L A;  2XKP A;  2L54 A;  1USS A;  4WX9 A;  2G7H A;  3LAJ A;  4GXO A;  4HX7 A;  2LF7 A;  4KDP A;  3WTU C;  1CF7 B;  2HDC A;  1RNL A;  5CYV A;  1Z7U A;  4P5O A;  3LQR A;  4ENK A;  2HQN A;  2OU2 A;  4CIC A;  3LA2 A;  3H92 A;  3KLO A;  4BQA A;  1R58 A;  4HYE A;  3KE2 A;  5F6F A;  2CG4 A;  2MC3 A;  1UHM A;  3CTA A;  1WKM A;  2W84 A;  4TV7 A;  1P4A A;  2P4W A;  1QNT A;  2IP2 A;  3E6C C;  1XN7 A;  3KZZ A;  3JSP A;  3DXJ F;  1T38 A;  1O57 A;  1BI3 A;  3TO6 A;  4EJV A;  3D5L A;  2XAS A;  3U9G A;  2FQ3 A;  1IN4 A;  2O03 A;  1QZY A;  1XB4 A;  3FWE A;  2TDX A;  3GYH X;  4HA8 A;  1HQC A;  3WGG A;  4U0V A;  4HLX A;  2PN6 A;  2AXL A;  1FP1 D;  2M87 A;  4XLP F;  1R23 A;  4ASN A;  3F22 A;  4M71 A;  4WF2 A;  3RPU A;  1ZRD A;  4EQQ A;  2EJR A;  3V7C A;  1J5Y A;  3WTX C;  2CO5 A;  4ENN A;  2DLL A;  2JZY A;  3OV8 A;  1XSD A;  1T2K A;  1BIA A;  3R60 A;  2QQB A;  3TO7 A;  1Z05 A;  4EV0 A;  1Q1H A;  2L3D A;  5F1R A;  3V7S A;  3ZPL A;  3HRU A;  5D5X B;  3BJ6 A;  4A5M A;  3F6O A;  4G7H F;  3V8J A;  2AS5 F;  2XAJ A;  3BY6 A;  3ZP5 A;  1K78 A;  3WTZ A;  1EV7 A;  4U7B A;  2GQQ A;  4P9F A;  2MH2 A;  2DPD A;  5ILV A;  1XGN A;  2OD5 A;  4HQM A;  1KU7 A;  4ZYE A;  4P96 A;  1U5T C;  3C1D A;  1FYM A;  4I09 A;  1L3L A;  4H0E A;  3DQV C;  1IUY A;  5J6X A;  3J80 K;  5ILS A;  2EWN A;  6PAX A;  4KMU X;  2JSC A;  5H20 A;  2GA2 A;  4IXA A;  4CDG A;  5J8C A;  4IF4 A;  2CFX A;  4HZF A;  2DTR A;  4U0Y A;  1ZH5 A;  5HDN A;  3E6M A;  3GUD A;  2F5D A;  1S7O A;  1W5T A;  4LLN A;  3NEU A;  1J9I A;  2DI3 A;  4KN4 X;  1UB9 A;  1OPC A;  1XD7 A;  4UHT A;  1NHA A;  1W7P D;  3ZMD A;  1OYW A;  2XAQ A;  4AIJ A;  3O3K A;  4PGH A;  4CZZ A;  5IT9 K;  3WOD F;  4EJT A;  3KET A;  1QO0 D;  3QU6 A;  4IVN A;  4KMF A;  4QWQ A;  3I5U A;  4FX4 A;  2RDP A;  3TDU C;  1P6R A;  5EEH A;  2A5Y B;  4U88 A;  3GVA A;  1OR7 A;  3M8E A;  5ICC A;  1U2W A;  2KRF A;  4OIO F;  1JHF A;  2HYG D;  1UST A;  3F8F A;  4ESB A;  2MBF A;  4RB2 C;  1IXS B;  3HUG A;  4XSZ F;  1R1V A;  4D0P A;  3E5Q A;  5HLI A;  3AAF A;  3QP5 A;  5D5V B;  2W85 A;  4L5I A;  2H6B A;  5D5U B;  4HV6 A;  3HYI A;  1R7J A;  3GZ5 A;  4HF2 A;  2W24 A;  1LB2 A;  3TOA A;  1I27 A;  2JPC A;  1IF1 A;  1FSH A;  3IC7 A;  1BI1 A;  2VXZ A;  3JSO A;  5D6F A;  1ZN2 A;  2FE3 A;  1UHW A;  4E70 A;  4ENJ A;  1YLF A;  1XGS A;  4NB5 A;  3W6K B;  1ON1 A;  5CVI A;  3HHG A;  2VT2 A;  4HDV A;  2MD5 A;  2GXB A;  3LQQ A;  3WTW C;  4HOB A;  2XKO A;  3K1P A;  1U78 A;  3NQO A;  2QEN A;  3MZY A;  2V79 A;  1SD4 A;  1ODD A;  2K4B A;  3CUO A;  4A6E A;  2DPU A;  2V1D A;  4G94 A;  3M8F A;  1TBX A;  1H9T A;  3R0A A;  3M9A A;  1SAX A;  3C18 A;  5LGU A;  2Y48 A;  1D3Y A;  1R00 A;  3V8K A;  3IKV A;  4Q5S F;  1TQI A;  3LST A;  1Z91 A;  4M73 A;  2CYY A;  2A3S A;  1R22 A;  3SXY A;  3F6V A;  4CXF A;  4CGZ A;  2KJC A;  3VB2 A;  3R4K A;  2FMY A;  2Q0O A;  4AVP A;  2A61 A;  4ZYD A;  1Y0U A;  1J7K A;  3KEQ A;  1IN8 A;  3FXU A;  2KKO A;  1S3J A;  5LGT A;  4BHP A;  4I01 A;  2O3F A;  3M1E A;  2D1V A;  4HF0 A;  2ELH A;  2LNB A;  4MNU A;  1R5H A;  2DT5 A;  1KU9 A;  4L9T A;  2A6E F;  3HOT A;  4U7D A;  3FM3 A;  1E17 A;  2V1U A;  2W57 A;  3ZN0 A;  1RUO A;  3FX3 A;  2DU9 A;  4KA4 A;  4EGY A;  1IXC A;  2OZ6 A;  4KIB A;  2EK5 A;  2YR2 A;  3TOB A;  4XRF A;  1PP8 F;  4AIH A;  5D8L B;  2R7D A;  5E18 F;  5TJJ A;  4MHG A;  1RIO H;  2K02 A;  4LG0 A;  3WTV C;  1IN6 A;  2P7C B;  5DCM A;  4A0Y A;  1SMT A;  1TQP A;  2D45 A;  2VOO A;  5LHH A;  3RKW A;  4O6J A;  3ECH A;  4U0W A;  4ZZD A;  3PQJ A;  3T1B A;  2ZFW A;  5HDK A;  3FMS A;  3CO6 C;  3T8T A;  2O0Y A;  4I0A A;  1S29 A;  2HKX A;  2HS5 A;  4I2O A;  1YIO A;  1CF7 A;  3ZQ7 A;  2ACJ A;  5HDG A;  1DDN A;  2M45 A;  2P8T A;  1ONV A;  1W7P B;  2W25 A;  4A5N A;  4G7O F;  4UVA A;  2GIV A;  3WGI A;  2HKO A;  4KFC A;  2RV8 A;  3BZ6 A;  4KYW A;  2E7W A;  2EFO A;  3ABU A;  2A6H F;  1XGM A;  2ZXJ A;  1FBS A;  1B4A A;  4L0Z B;  2GA1 A;  3K2Z A;  4HX4 A;  3TGN A;  2E1N A;  4S05 A;  2Z5U A;  4N9I A;  2QWW A;  5E20 A;  2EFQ A;  2BEO A;  2VOP A;  3ECO A;  1HW2 A;  1T0F A;  3LA3 A;  3W6J B;  3EYI A;  3F8N A;  2PMH A;  3E6B A;  3IWF A;  4R8H A;  4LB5 A;  4LJZ F;  2HZT A;  2ZBK A;  2HGC A;  3B73 A;  3E97 A;  2J5O A;  4BHB A;  2MH9 A;  3CDH A;  1WWX A;  1BJA A;  1TLH B;  1SFE A;  3HOS A;  2H6C A;  2OQR A;  4A0X A;  3GO5 A;  3VOD A;  2P6T A;  3GFL A;  4UV9 A;  3ML6 A;  4Y15 A;  5HS9 A;  3VFZ A;  3HRS A;  2EA4 A;  4FHT A;  4LK0 F;  5LRR A;  4ETS A;  1FNN A;  4QLC U;  4WXH A;  3MAJ A;  3DFG A;  2G7U A;  1BM9 A;  4ZZL A;  4CYD A;  3LFK A;  4UV8 A;  3MQ0 A;  3P9K A;  1TW3 A;  2PBI A;  2Z99 A;  3KP7 A;  5FGM A;  5K5O A;  4FX0 A;  4PZJ A;  1QGP A;  2UXN A;  4IHS A;  5BS6 A;  2FSW A;  2IVM A;  1X3U A;  1SFX A;  3WGH A;  1IW7 F;  1XDS A;  4M74 A;  3JTH A;  5DD8 A;  3ULQ B;  2O8X A;  2RN7 A;  1ZLK A;  1F1Z A;  4LLL A;  5HLH A;  2DQR A;  2VON A;  1IRG A;  2VBW A;  3I4P A;  1G3W A;  4O3M A;  1BC8 C;  2V6C A;  1ZAO A;  2G9W A;  3FXQ A;  3V4G A;  4NHJ A;  4A0Z A;  2RQP A;  4HW0 A;  3GF2 A;  2IPQ X;  3COA C;  1AWC A;  1QBJ A;  3CUQ C;  4KIF A;  1B1B A;  4GCV A;  4ESJ A;  2F5F A;  2YSR A;  4NQW A;  4MTD A;  1LVA A;  4ZYH A;  2XAH A;  4L9N A;  3WE2 A;  3GFM A;  2XRN A;  1TTY A;  2A68 F;  2IW5 A;  1BI0 A;  2XAF A;  2E7X A;  5AON A;  1BI2 A;  3OOP A;  3KP5 A;  2HQR A;  4EGZ A;  5LBQ A;  2OA4 A;  3L2C A;  4EJU A;  4KN7 X;  3MCZ A;  3GXO A;  4EJO A;  5E17 F;  5FD6 A;  1ZG1 A;  2HWV A;  2O61 A;  3C3W A;  4OMZ A;  2H27 A;  2PJP A;  4L9J A;  5FFX A;  1REP C;  4MEX F;  2ISZ A;  3Q5F A;  4BXU A;  3EDP A;  3REO A;  1IXR C;  3V7R A;  5CVU A;  2OBP A;  4KT5 C;  1OYI A;  1LDJ A;  4WXD A;  4Q47 A;  2OZU A;  4OIQ F;  2COM A;  2PG4 A;  2KIU A;  3SZT A;  1DUX C;  4AWX B;  3F72 A;  1HSJ A;  1YYV A;  2EV0 A;  1PDN C;  4K2E A;  1LDK B;  4R1H A;  5AIQ A;  3CUQ B;  3Q9S A;  4RB0 A;  4LB6 B;  2QLZ A;  2OQG A;  2HYF A;  3RDI A;  3EET A;  3DPL C;  1J2X A;  2DW4 A;  2RGV A;  2FEZ A; 
#chains in the Genus database with same CATH topology
 1G3Y A;  4ITV A;  2H8W A;  1FZP B;  2FRH A;  2OUM A;  4WXC A;  4IPA A;  2PLY A;  1Z9C A;  3QYE A;  3VYR B;  1QHG A;  4YFK F;  3VWB A;  1D1B A;  3K6G A;  1TQM A;  2PJR A;  4B8X A;  1DP7 P;  3N97 A;  4X6A J;  5FRO A;  4NNJ A;  5H2F C;  2VBZ A;  1T6S A;  5TRD A;  1I50 J;  2ZNZ A;  4OIR F;  4A3G J;  2IGK A;  4F55 A;  5C4X J;  4ZC3 A;  2AO9 A;  4PGG A;  3JRE A;  3D5S C;  1NG7 A;  1VQL I;  3A0H C;  4GGG A;  1XPX A;  2NXN B;  5DUI A;  2EZI A;  4BDZ A;  4Y17 A;  3AG4 H;  2GBY A;  1DPU A;  2Y69 H;  1U6G A;  2HXI A;  3RCO A;  4XKV A;  5BQT A;  3DEU A;  2NYX A;  2KIM A;  2JPB A;  1JXS A;  1U5T B;  2HTJ A;  4YII A;  4F93 B;  4RM3 A;  3WTY C;  1XCV A;  4HLY A;  1IDZ A;  2JWT A;  2AQF A;  3CDL A;  3HTS B;  3MEX A;  3RI4 A;  4JBA A;  3MMY B;  1R36 A;  2DAO A;  2FXA A;  2D2W A;  1H88 C;  1K7A A;  2A07 F;  3CLO A;  4P1W A;  2XV4 S;  3BDD A;  1KQ9 A;  3HSE A;  4BAC A;  2R0Q C;  1OR7 C;  1OIS A;  4RAY A;  1YJW I;  3LSP A;  3TW7 A;  1FIP A;  5J1U A;  3GTQ J;  4OIP F;  1FBQ A;  5DDG A;  3L2U A;  3CMY A;  1EF4 A;  3OS0 A;  4IO9 F;  4L0Y B;  2K27 A;  5IYB J;  4FE4 A;  4RB1 A;  1YQA A;  4BYY A;  3ZQL A;  3OYA A;  5FB2 A;  4A3K J;  4C3H J;  5KVR A;  3S8P A;  5FO5 A;  4A69 C;  2OTL I;  1SD5 A;  1D5Y A;  2Q2E B;  2R7V A;  2R7F A;  4BHC A;  2BHY A;  1J0R A;  2KRH A;  4BUP A;  4E7S A;  2X85 A;  1MND A;  1O3Q A;  5LHG A;  1IN5 A;  3FMR A;  1JKR C;  3RYP A;  1U3E M;  1QU3 A;  1XG1 A;  1XMX A;  1MNE A;  3S93 A;  2ZB9 A;  3BPV A;  1G3T A;  4UUV A;  2JTV A;  3Q0W A;  5K7Z A;  1O3T A;  5KAF C;  2K3F A;  3IWZ A;  2DTZ A;  2VI6 A;  3K0L A;  2F6C A;  4RGU A;  4KIG A;  3B6A A;  5D5W B;  2JA7 J;  1TWF J;  3DPU A;  3HKZ N;  1Y6I A;  2UWM A;  1HDP A;  1U8R A;  1YTY A;  2ETH A;  2IA1 A;  3V8L A;  3OIQ A;  2DA1 A;  1HST A;  3K1M A;  3K7A J;  3TMO A;  5JHU A;  1X19 A;  3OSF A;  2ZSI B;  2MLK A;  3RQ4 A;  2IS1 A;  4XKB A;  1QPM A;  3I59 B;  4CYC A;  3ZMS A;  5F64 A;  2WAQ N;  4HNU A;  1N25 A;  2QBY B;  5L3B A;  2GZW A;  5F1J A;  5D8K B;  3EPZ A;  1MGT A;  2CQN A;  1ETW A;  4IQ4 A;  1Z6R A;  1DGW Y;  4BE1 A;  2E1C A;  2P81 A;  4M9S A;  1NK3 P;  4PJJ A;  1RET A;  2CQK A;  1WI3 A;  1WJF A;  2WY7 Q;  3HRM A;  4G9Y A;  3QOD A;  1JUM A;  3MFK A;  5D4S A;  1YIJ I;  2VLA A;  4O5V A;  3TDZ C;  3FHZ A;  5F08 A;  3H3U A;  2XGD A;  4PDK A;  3KZY A;  1STZ A;  5KK1 A;  4KJZ A;  3AG1 H;  1Y56 A;  2JRT A;  1EH8 A;  1GVJ A;  1TWA J;  3HIF A;  2K5C A;  1XSV A;  4CH7 A;  3M7G A;  3KP3 A;  4UNO A;  5K5R A;  1O7F A;  1FLI A;  1P2F A;  1XCB A;  2MA3 A;  3DV8 A;  3I71 A;  2F5V A;  5BPI A;  2JA2 A;  3K1N A;  3OYB A;  1UHS A;  1X4P A;  4L5E A;  1B9N A;  3OYG A;  3RQI A;  2VE9 A;  3HSR A;  5K5Q A;  1S8N A;  5IYC J;  3EYY A;  1OJL A;  2E5N A;  3BRO A;  5CLS A;  3R0J A;  1W7P A;  2LF8 A;  3RKX A;  2A69 F;  4Y3O A;  2YX7 A;  5ILU A;  2RC4 A;  1AU7 A;  1QQI A;  4IHX A;  3VOE A;  2CV2 A;  4X1E A;  4FIS A;  1BW5 A;  4JQF A;  3BG7 A;  4P9U A;  3J81 Z;  2IS2 A;  3D0S A;  3I55 I;  5FLX Z;  2HDW A;  5J8F A;  1H9G A;  1S7A A;  4D1Q A;  3QPH A;  2QUF A;  3QP6 A;  4KIS A;  1YFH A;  3H35 A;  3UKG A;  1IRF A;  2EV6 A;  5E3N A;  2JUG A;  1BC7 C;  3ZR8 X;  1T95 A;  4G6Q A;  5DM7 F;  1DGR M;  5FKM A;  2NS7 A;  3F8B A;  3JRC A;  2R7W A;  2VJI A;  3DKW A;  1FWZ A;  3JRH A;  1HKS A;  3WHB A;  1PVE A;  3GZN B;  3L2V A;  3N05 A;  3PFI A;  5ICF A;  4OU0 A;  2XRO A;  3VSL A;  3HOU J;  5GTH C;  2WV0 A;  2K4J A;  3K4C A;  2QVO A;  4HPQ A;  4CCL A;  4Q4Z F;  3BJA A;  3I54 A;  4XL9 A;  2BW3 B;  3QRF F;  4ZYG A;  1ZAR A;  2QSG X;  2CFO A;  4V2F A;  1KU2 A;  1LE8 A;  4AIK A;  2BY0 A;  3L9F A;  2JT1 A;  3S2W A;  1LNW A;  5L3E A;  3CCQ I;  2IS6 A;  1FP2 A;  3P7N A;  2V7F A;  3CCV I;  2MD0 A;  1MMA A;  3P9I A;  4E7K A;  1QVU A;  3S17 J;  4L18 B;  3QQA A;  2B7E A;  3I4M J;  2X4H A;  3DBH B;  3ZN1 A;  1MBH A;  1KQ0 A;  2PX9 A;  4UUT A;  2QQ9 A;  3KCC A;  3H9G A;  1MZB A;  3HOZ J;  3K4J A;  3LAP A;  3HTU A;  3FF5 A;  3GWZ A;  4KUM A;  5D6E A;  2EV5 A;  4EEF G;  2IA2 A;  1YW8 A;  1H0M A;  2UV1 A;  4IHT A;  3TO9 A;  1EA3 A;  1ZG3 A;  4HV5 A;  2LFB A;  2HXO A;  5KCM A;  2GXA A;  1WI9 A;  2PI0 A;  2M1B A;  1V5E A;  4M3B A;  1X1A A;  2FNA A;  4F91 B;  2O6G E;  2KDO A;  2R5Z A;  1ZGA A;  1MJ9 A;  2V1X A;  2Z3Y A;  4EM0 B;  4XLN F;  2BYV E;  5BNG A;  1GT0 C;  1KYZ A;  2M8G X;  2P5L C;  2HU9 A;  2X0L A;  4E7Z A;  1VQO I;  5BPD A;  5EJC A;  2VKD A;  1WVR A;  4BQQ A;  5J4Y A;  3H5A A;  2E60 A;  2L01 A;  1ZHF A;  2M4G A;  2ZCW A;  2K9M A;  3SHF A;  5KAI C;  3QOE A;  3VYT B;  1MDM B;  5IP6 A;  3OYE A;  2FML A;  3B02 A;  3KP4 A;  3R61 A;  3CJQ B;  5CPR B;  4G8X A;  4A3B J;  3AL0 C;  1OYY A;  4LOC A;  4M72 A;  4EMS A;  3E5X A;  2YX4 A;  2K7L A;  3RPQ A;  2Y0M A;  2E35 A;  1F9N A;  1FX7 A;  4RLQ A;  5GPA A;  2D1H A;  5LEK A;  2ZJ2 A;  3Q9V A;  4MEY F;  3BLY A;  4DYQ A;  3IRQ A;  3LSR A;  1A6Q A;  2E1M C;  3HL2 A;  1W0U A;  3HG9 A;  1MJA A;  1SD6 A;  2J5P A;  2KT0 A;  2JK3 A;  3AG3 H;  2WAF A;  2X6W A;  1ZYR F;  2VKH A;  3F0C A;  2FBK A;  4HG2 A;  5A2Q Z;  2BXY A;  4HAM A;  3DTI A;  1I5Z A;  1FOK A;  3PSI A;  4KNY A;  5EF6 A;  3TP3 A;  2P6S A;  2OF7 A;  3KP2 A;  3AG2 H;  3OYC A;  2RAE A;  4LGW A;  2IRF G;  3JAM Z;  2M8E A;  1B8I B;  2IJL A;  5IP7 J;  1C0W A;  4UXN A;  3PM1 A;  2G0E A;  3M1C A;  2DQL A;  5HLG A;  3J7A O;  3KYD B;  3S32 A;  2XPV A;  3S3O A;  4JX4 A;  3DBL B;  1YRN A;  1EH7 A;  1E3P A;  4MFE A;  5DCF A;  5JFR A;  3OYF A;  2ZJR F;  1HW1 A;  1Z6T A;  3RZO J;  2Z33 A;  4PUS A;  2V9V A;  1YX3 A;  5F27 A;  4H4K C;  5EG0 B;  1RR7 A;  2LG4 A;  3A01 A;  5E1X A;  2LTP A;  2JMW A;  4HQE A;  1JKP C;  4LLG F;  4IX7 A;  3C2H A;  5GAD J;  5IT3 A;  1XS9 A;  2OCC H;  4BY1 J;  3EUK L;  2OC6 A;  2ELK A;  2QZ8 A;  3G6E I;  4LD5 A;  1W5C C;  4BNC A;  2M5W A;  3M3Y J;  1SD7 A;  1VFC A;  1LEB A;  2NRA C;  5EDN A;  4IRG A;  3Q3S A;  4DZJ A;  3IH3 A;  4JP0 A;  1RUN A;  2DDB A;  2ECB A;  3F8C A;  5JI6 A;  2RQQ A;  3GFJ A;  1AHD P;  3LA7 A;  1P92 A;  2HQA A;  1T8I A;  2F2E A;  1AKH B;  2ICW G;  3CCU I;  5F0C A;  1FEX A;  2ISY A;  3T5X A;  2CU7 A;  4XOR A;  2XUB A;  1W36 D;  5L3C A;  2QF7 A;  5HS8 A;  3WG9 A;  4ZH4 F;  1K6Y A;  3GTG J;  3IL2 A;  2IAI A;  2EFP A;  4V19 K;  4XLH A;  3ZMZ A;  1FSE A;  2F48 A;  4IJA A;  1FYL A;  3BR1 A;  1J75 A;  1LEA A;  3CJT B;  4AD9 A;  5LRS A;  3BR0 A;  5DYM A;  1XX5 A;  1ULY A;  1GHC A;  2QQ8 A;  1TP4 A;  2OJE D;  3NRV A;  1P4X A;  3NWS A;  3R6S A;  2XAG A;  2KJB A;  2QEX I;  5M5W J;  1BN5 A;  2BVM A;  2CRG A;  3O6B B;  2STT A;  4LK1 F;  1OFC X;  2KIS A;  3ABL H;  4W1U A;  1G6N A;  1R5G A;  3J81 K;  2VC1 A;  5FLX K;  2WTE A;  2XAU A;  4S04 A;  3FXK A;  3N4M A;  3CLQ A;  2BV6 A;  1TNS A;  4A2U A;  4XRS A;  2GIZ A;  3IH4 A;  4A12 A;  2VE8 A;  3HSF A;  2JN6 A;  3MWM A;  3DP7 A;  1TNT A;  1FTT A;  4UY8 I;  5IP9 J;  1FMV A;  3ZMU A;  5L3G A;  1F43 A;  4XR6 A;  2H94 A;  3GBG A;  3GW2 A;  3SZP A;  2K9N A;  4AU7 A;  2ID3 A;  3OIP A;  4YFX F;  3OYI A;  3HHH A;  3L2W A;  3T8R A;  2VBY A;  4XBF A;  1V4R A;  1J59 A;  1E3H A;  4LFU A;  4ESF A;  1XMK A;  3FBN B;  3L2Q A;  5BMZ A;  2ESH A;  2DFI A;  5FD5 A;  3BC8 A;  1ZLJ A;  2R5Y B;  4B1R A;  2ZME B;  3CUQ A;  4I7H A;  2IGM A;  2HR3 A;  3WTS C;  3SFZ A;  1MBE A;  2H09 A;  3M07 A;  1HW5 A;  4DZP A;  1P4W A;  1VQN I;  2LSO A;  3ROU A;  2Y2Z A;  2DA2 A;  3BG3 A;  1ERD A;  4ON0 A;  1B59 A;  3LWF A;  1SFU A;  1OLT A;  3WTT C;  3I53 A;  1Y8Q B;  2RKH A;  1TWG J;  3HC7 A;  1POG A;  4QTR A;  4EM1 A;  1I1G A;  4M6Y A;  2A6T A;  4CO8 A;  3C7J A;  1T98 A;  1YJ9 I;  3IP4 B;  2BZT A;  4WWC A;  1V3F A;  2R4G A;  1S72 I;  4HSR A;  1W0T A;  2ZJP F;  4NC6 A;  3TQN A;  3C2G A;  3WU1 B;  4DOZ A;  3QYB A;  2DFF A;  1VTN C;  1ZKG A;  4RB3 C;  2DMQ A;  3E3V A;  2Q8K A;  3E0J B;  3GLX A;  5AIP A;  3VPR A;  2ECC A;  3W2V A;  2KRC A;  2VQH A;  5E1W A;  1D8K A;  5IYD J;  4P55 A;  1I3A A;  9ANT A;  2I10 A;  3LOC A;  2JVG A;  2OAZ A;  2CGP A;  2HYJ A;  2L9S A;  1YE9 A;  4BBS J;  1XMA A;  4RGR A;  1U5T A;  1A6I A;  2L7Z A;  3T0Y A;  3CMA I;  3BJO A;  5HS7 A;  4J01 A;  3L00 A;  1XC5 A;  3NWT A;  3IH2 A;  1GLN A;  3RKY A;  3BQZ A;  2DA4 A;  4E4H A;  2CUZ A;  2NNN A;  1WCM J;  1SMY F;  4MGR A;  1UCR A;  2X48 A;  3DEW A;  1HOM A;  2B0L A;  2K86 A;  5J40 A;  2CSO A;  3VYU B;  4BY7 J;  2L9R A;  4HX8 A;  5E8G A;  5IOY A;  2VIX A;  5CVJ A;  2R7Z J;  4L5J A;  1WPK A;  3IKT A;  4WK8 F;  1XSX A;  3DCF A;  2GWR A;  3IAM 2;  3H5N A;  2O5R A;  3U1D A;  2IT0 A;  4HDU A;  2XB0 X;  4RAG A;  3OYH A;  1ZGJ A;  1ZQ3 P;  3S2H J;  5A2Q K;  4XLA A;  3ZMV A;  4AM3 A;  5FJ8 J;  1FYK A;  2WAE A;  3KP6 A;  1FMW A;  3A4C A;  3DKY A;  1K79 A;  4IRH A;  4B48 A;  5B1B H;  2Q2E A;  2VJ4 A;  1G2H A;  4JK1 X;  2JJ7 A;  4HF1 A;  4XRS G;  1L0O C;  3JAM K;  3SFI A;  1HKT A;  5ICE A;  1R49 A;  2LKP A;  1RC9 A;  5DM6 F;  2H1K A;  2K85 A;  4Y33 A;  1ITY A;  1RZ4 A;  3G1L A;  3FZV A;  1JGS A;  4RGS A;  3O8H A;  4M9Z A;  4BXF A;  5F0F A;  4UB8 C;  2FF4 A;  4EJW A;  4G7Z F;  3PNY A;  1TW2 A;  2LRE A;  4I76 A;  4KIT B;  1EKE A;  2OPT A;  3ZRG A;  3SEQ A;  3F3X A;  2NVU B;  1U9O A;  2PFB A;  4MQV A;  3E6D A;  2LBF A;  1BOB A;  5LHI A;  1D0Z A;  3RJP A;  3P9C A;  2DFE A;  1G4D A;  1W36 C;  3JRI A;  2DJN A;  1VI0 A;  2A05 A;  2WWY A;  2MSY A;  3SZG A;  4KT6 A;  4CHU A;  4XSX F;  4DYC A;  4RGX A;  2ESN A;  3CME I;  5LEJ A;  3I59 A;  5B66 C;  3GTL J;  1IZ1 A;  2DOD A;  2QBY A;  4DJA A;  4NUB A;  5DV5 A;  4Z2Y A;  3RSN A;  3F23 A;  1T39 A;  3GTM J;  4QIW N;  2GAU A;  1IV8 A;  2EPF A;  2VQC A;  3ZMT A;  1XTA A;  5JVT A;  1FT9 A;  3GLL A;  4ENM A;  1MJB A;  3F21 A;  1ON2 A;  2NS0 A;  3I0T A;  5E8I A;  5HOO A;  1F5T A;  5EGO B;  1LDD A;  4WCG A;  1OKR A;  1ETK A;  1YG2 A;  5EYR A;  2F5E A;  3PJR A;  3IV5 A;  3OYN A;  1PUE E;  2CV0 A;  2IS4 A;  1K61 A;  1YS6 A;  2LYC A;  1FPQ A;  2ZXI A;  4KIC A;  2L4A A;  1Y1W J;  4I0B A;  3L7W A;  4Y4R A;  1V5G A;  5C3E J;  1KQ8 A;  2C6Y A;  1O7L A;  5H6R A;  4CCJ A;  1K78 B;  2PQ8 A;  3WHC A;  2W4S A;  1BOA A;  2XGX A;  4XQF A;  2DK8 A;  2XVC A;  4DW6 A;  1Y39 A;  5D4R A;  3FK7 A;  2QYO A;  4BKX A;  1F4K A;  4A3C J;  1N77 A;  4N0B A;  4Y7N J;  1ZGW A;  4EM2 A;  1YI2 I;  5L3D A;  4MTE A;  1GXP A;  3KX2 A;  2EZK A;  2Y0S A;  4XLC A;  5IPA A;  2R7U A;  4Y13 A;  2EA2 A;  4LMY A;  1BL0 A;  4DNC A;  2QM3 A;  3G73 A;  5JHF A;  2QGU A;  4PCQ A;  2FBI A;  1IJW C;  3GTJ J;  1W5S A;  4F7Z A;  2VOD A;  2CV1 A;  3H3Z A;  1QZZ A;  2RRE A;  5HVQ C;  3BR5 A;  3GZ6 A;  4NDL A;  2GOX B;  5BOX A;  1FBU A;  5ICG A;  3CC4 I;  3SJM A;  1B6A A;  1D8J A;  4GYI A;  3HOX J;  2E34 A;  1P7J A;  1OMI A;  1E2X A;  3MKW B;  3PO2 J;  1ETY A;  1QZE A;  3I58 A;  2LBF B;  2O7O A;  5DEQ A;  3K4L A;  4DYR A;  1JT6 A;  2EFN A;  2QQA A;  3SQN A;  3KFW X;  2L4M A;  5J1Y A;  4JX5 A;  3HJE A;  4RAF A;  2IEK A;  3BQY A;  1X3W B;  2E5Z A;  4Y52 J;  4BGD A;  3GTK J;  1YHQ I;  2BW3 A;  4I98 B;  2FBH A;  1BBY A;  3RYR A;  1Z21 A;  3FXM A;  5F0H A;  2W00 A;  5CJ9 A;  5E3M A;  2BGC A;  2WC2 A;  4D7M A;  2O8K A;  3OYK A;  1ZG5 A;  1BJZ A;  2ZSH B;  2R3S A;  3DPT A;  4PFP A;  5CVV A;  2ZNY A;  3H0G J;  4BQN A;  1UZC A;  4BXX J;  3PSF A;  1WQ2 A;  1OCO H;  3GEZ A;  1WHU A;  3EUH A;  4A3I J;  4G6D A;  2LRD A;  2CW0 F;  2MYS A;  2FOW A;  4RS8 A;  3HKZ A;  3U1K A;  2YU3 A;  1W4M A;  2L9V A;  3OYL A;  1WRJ A;  1Q1V A;  1HF0 A;  2CJJ A;  4DQ2 A;  2CWE A;  3CC2 I;  2KMU A;  2HDD A;  5DUK A;  2KQR A;  1HBX G;  2UUZ A;  2Y75 A;  3BG5 A;  1X1C A;  1YO5 C;  5FFZ A;  3D5R C;  1I39 A;  4F3Q A;  2VC0 A;  4NC7 A;  3MKZ A;  4A3M J;  4BH9 A;  3F8M A;  3ZOB A;  3GFI A;  2WAQ A;  3CP8 A;  4I99 C;  2TCT A;  3FM5 A;  2FX0 A;  1X2M A;  2HNH A;  4Z6Y A;  1IAW A;  3QU3 A;  3TL4 X;  3JRG A;  3ERM A;  4CCO A;  2HTS A;  5IOZ A;  3KIO A;  3A0B C;  2ADU A;  4OMY A;  3HUG B;  5JR3 A;  1MKM A;  3BPX A;  2FOK A;  3SYT A;  1MDM A;  2UXX A;  3WE3 A;  2N8G A;  4AUX A;  2A5W A;  2PMZ N;  1VQK I;  4J00 A;  2K40 A;  3LSG A;  4FT8 A;  1GUU A;  1RI7 A;  2M7A A;  3EUA A;  2K9L A;  1YS7 A;  1MMN A;  3G2B A;  5KNL A;  4PK4 A;  3FDY A;  4R79 A;  3JRD A;  2V26 A;  2JA6 J;  4OOI A;  2DFH A;  2HOT A;  4RAZ A;  5HOD A;  2GOM A;  3QAH A;  5JVG F;  1LJ9 A;  4L9V A;  4N4N B;  1JKO C;  1Z3X A;  2FNP A;  4EVI A;  3E5U A;  3CC7 I;  5M5Y J;  2V6E A;  2ZXW H;  2DYS H;  3S3N A;  1NH3 A;  3CCS I;  5LGN A;  1GV2 A;  1MBF A;  3U2R A;  3EQL F;  3GME A;  2HFH A;  2UZK A;  1F36 A;  3QPT A;  3ZQF A;  3OR2 C;  2FU4 A;  5H6Q A;  1BIB A;  5EZH A;  1OCT C;  5L3F A;  2AQE A;  5J47 A;  5E1Z B;  1HCR A;  1PP7 U;  4YG2 F;  1I6X A;  3JTG A;  2DO7 A;  1GXQ A;  2F5C A;  3I4N J;  1B8I A;  1QVT A;  3BG6 A;  2ZXH A;  2FA5 A;  5EEG A;  3K4M A;  1Z1D A;  2AXT C;  3DBR B;  3DTE A;  1CQT A;  4X0G A;  3GX4 X;  1KON A;  1UFM A;  1QPI A;  3MN2 A;  3KLN A;  1X1D A;  3PNT A;  1FOX A;  3VEP A;  1D0X A;  3OR1 C;  1WJD A;  2RNJ A;  2LY2 A;  1V55 H;  3E7L A;  1VZ0 A;  1X1P A;  5EG0 A;  3FMQ A;  2NAZ A;  3ZQC A;  4YFN F;  4Q48 A;  5B5E C;  3TKY A;  4YIF A;  1FC3 A;  4II3 A;  2FD5 A;  4C30 A;  3MZH A;  2IA0 A;  4ZTJ A;  2Y9Y A;  4M3E A;  4DIQ A;  4A6D A;  2EFW A;  1TC3 C;  2XC7 A;  1QHH D;  3OYJ A;  3DEE A;  5EZG A;  3RTR A;  1ZRE A;  4XOP A;  3ZQQ A;  2FJ1 A;  2VN2 A;  5K7F A;  2DA6 A;  1A35 A;  3I64 A;  4IKF A;  2VPL A;  2BY3 A;  5DTD A;  1PUF B;  3GCM A;  5ED4 A;  1P9Q C;  1JTY A;  2TRT A;  2M30 A;  1R1U A;  1AKH A;  3HBL A;  3PIP F;  4FE7 A;  3CJN A;  1KYW A;  3BWG A;  4XON A;  1LFB A;  1MD0 A;  1MMD A;  3BOQ A;  3K4K A;  4B09 A;  2X6O A;  2COB A;  2E36 A;  3M4O J;  3LSM A;  1JE8 A;  2JSP A;  3HRT A;  2DMP A;  2W7N A;  1XDU A;  1LFU P;  3AKZ A;  3ELK A;  2LDU A;  4GO1 A;  3KEO A;  2HEO A;  1AOY A;  1R1T A;  1SAU A;  4ZYA A;  1I1S A;  1HXD A;  3CO7 C;  2STW A;  1G3S A;  2GM4 A;  3PNV A;  2VT3 A;  2GXG A;  1DPR A;  1CGP A;  3BP8 A;  4U87 A;  2Z2S B;  2H1L A;  4ZDL A;  1YW7 A;  4HNT A;  3IRR A;  1ZRC A;  1A04 A;  3CES A;  3G3Z A;  4I02 A;  4IHV A;  4A3L J;  1G59 A;  2BE5 F;  2VPR A;  3PUB A;  3JW4 A;  2LKS A;  3CD6 I;  5DD4 A;  2RVC A;  2KPM A;  4UUS B;  2JA8 J;  2P7V B;  2IGN A;  4HBL A;  3FXR A;  2DBB A;  2HOE A;  2DK5 A;  3W2A A;  5ERI A;  5HLT A;  2V9P A;  3ABT A;  4N9H A;  1A36 A;  3RIR A;  2YUS A;  4XMY A;  4MO7 A;  4RDU A;  1JHH A;  5B1A H;  2DN0 A;  1D0Y A;  2P5K A;  3K9T A;  2DT7 B;  1D5V A;  1O3S A;  2BBY A;  2XIG A;  3J80 Z;  1P7I A;  1K4T A;  4C2T A;  3I56 I;  2LP0 A;  3DF8 A;  3ISP A;  5B3S H;  1MMS A;  5LLQ A;  2ZO4 A;  3SDG A;  1IN7 A;  4PJL A;  4ZJZ A;  4M3G A;  4OIN F;  1BR2 A;  4B4C A;  2BVL A;  4UVB A;  1LQ1 A;  2XHK A;  4XK4 A;  2NNY A;  3L09 A;  1YW9 A;  4XN0 A;  3BTC A;  3ZXS A;  4M9X A;  2HOA A;  5GTI C;  4BAY A;  2ZKZ A;  2R5Y A;  3ERE D;  4GYG A;  1KA8 A;  4IQJ A;  2XF7 A;  2ZME A;  1KU3 A;  3OMY A;  1FY7 A;  1Z3Y A;  2PMU A;  3PQK A;  2MLG A;  5J3L A;  5TIS C;  3IHU A;  1ZK8 A;  1K6O A;  3O2P E;  3QWL A;  4LG0 B;  2F4M B;  1B9M A;  1XGO A;  2L02 A;  2YPR A;  2XSJ C;  2KIF A;  2KZG A;  3K69 A;  4M6X A;  4MQ9 F;  3BCB A;  5DCM B;  3ZQH A;  4J19 A;  1KGS A;  1B72 B;  4IRI A;  5CVR A;  2EB7 A;  1G8X A;  4UVC A;  2I8D A;  2MC4 A;  2VBX A;  5K1Y A;  1WSU A;  3WU0 A;  1O3R A;  1ORK A;  2DMU A;  4IHW A;  1T0F C;  1ZRF A;  2PEX A;  2XF5 A;  2Z9O A;  2BOL A;  3C2B A;  3J7Z I;  2XDV A;  5IT9 Z;  3QOP A;  2IXS A;  2P5V A;  4A3E J;  1EH6 A;  1HKQ A;  3AL0 B;  3S3M A;  3DU6 A;  1JKQ C;  1S6L A;  2XKP A;  2L54 A;  2E19 A;  2IGO A;  1USS A;  1T33 A;  5J4V A;  2G7H A;  2DOF A;  4AYB A;  4WX9 A;  2CW8 A;  3LAJ A;  4GXO A;  2EH3 A;  1U9N A;  4HX7 A;  2XF6 A;  2LF7 A;  2KFD A;  1RR8 C;  1UAA A;  4BDY A;  4KDP A;  3WTU C;  1CF7 B;  2HDC A;  1RNL A;  5CYV A;  1Z7U A;  4P5O A;  2X1D A;  3LQR A;  2E1M B;  4ENK A;  3GTO J;  2HQN A;  2OU2 A;  4B3A A;  1VQ6 I;  4CIC A;  1TT5 B;  3LA2 A;  3S15 J;  3H92 A;  3OS1 A;  1ACI A;  2R7Q A;  1NG6 A;  1N75 A;  3HZJ A;  3KLO A;  4G6T B;  4BQA A;  2EIJ H;  2F4I A;  5GAE J;  1IRX A;  1R58 A;  4HYE A;  1TWH J;  1SVL A;  2OV7 A;  1R4N B;  3KE2 A;  1MSF C;  4FET A;  3L1P A;  1JI8 A;  1LKX A;  2KL4 A;  4DBR A;  2DYR H;  5F6F A;  2DOE A;  2CG4 A;  1DQU A;  3CCE I;  2MC3 A;  2V9K A;  1UHM A;  3CTA A;  1WKM A;  2W84 A;  1IGN A;  4TV7 A;  3WG7 H;  3BTL A;  4CUG A;  1P4A A;  1X4O A;  2P4W A;  2WB1 N;  1QNT A;  2IP2 A;  3E6C C;  1XN7 A;  5JLW A;  3KZZ A;  2EIM H;  5F04 A;  3ABK H;  3JSP A;  1WJA A;  3DXJ F;  1TT0 A;  1T38 A;  1O57 A;  3TED A;  1BI3 A;  2RNG A;  2CQQ A;  3TO6 A;  3H36 A;  2NVT J;  4FAS D;  4EJV A;  4N4O B;  3D5L A;  2JRM A;  2XAS A;  3U9G A;  4GFB A;  2VXD A;  2FQ3 A;  1IN4 A;  2O03 A;  3H9Q A;  3CP2 A;  1QZY A;  1XB4 A;  2XSD C;  2Y9Z A;  2DA7 A;  2B63 J;  1IO2 A;  2E2J J;  3FWE A;  2TDX A;  3GYH X;  4HA8 A;  1SC7 A;  1HQC A;  3S14 J;  3WGG A;  4U0V A;  1DU0 A;  4XNF A;  4MFD A;  4HLX A;  5LD2 C;  2PN6 A;  2AXL A;  1J09 A;  1FP1 D;  2M87 A;  3BR2 A;  3HEF A;  1A5J A;  1MH4 A;  3VYS B;  4XLP F;  1TZL A;  3BR3 A;  1R23 A;  4ASN A;  1EJ9 A;  1H89 C;  3F22 A;  4M71 A;  4WF2 A;  2QA4 I;  3HM5 A;  3RPU A;  1ZRD A;  4EQQ A;  1MMG A;  3HB9 A;  1SEU A;  2EJR A;  3ABM H;  3V7C A;  1J5Y A;  3AFH A;  3WTX C;  3CCM I;  4PSX A;  2CO5 A;  2CUJ A;  1HLV A;  4M3F A;  3SEZ A;  4ENN A;  2OCE A;  3QYF A;  4BEH B;  2R7S A;  4V2G A;  1R5I D;  2DLL A;  2JZY A;  1YX5 A;  4CCN A;  3OV8 A;  1XSD A;  1T2K A;  1BIA A;  2EIN H;  3FXL A;  3KEY A;  3R60 A;  2QQB A;  3TO7 A;  2LY9 A;  3G1O A;  1Z05 A;  3ASO H;  3X2Q H;  4CA0 A;  4EV0 A;  5EGO A;  1VQ9 I;  4ZDP A;  1Q1H A;  1RKT A;  2VKE A;  5JLX A;  4YRV A;  2L3D A;  3BCA A;  3OS2 A;  5E79 C;  5F1R A;  1UJ8 A;  2LH9 A;  3V7S A;  4PJN A;  4D5C A;  3G4S I;  5M3F J;  3ZPL A;  1HA8 A;  3HRU A;  5D5X B;  4CSW A;  3BJ6 A;  4A5M A;  5FKL A;  1MNM C;  3F6O A;  4G7H F;  3V8J A;  4FQG A;  4B44 A;  2AS5 F;  3BG9 A;  2XAJ A;  3BY6 A;  2WBM A;  2E2I J;  3ZP5 A;  1K78 A;  2B9S A;  3S1Q J;  3HXL A;  3WTZ A;  1EV7 A;  4U7B A;  2GQQ A;  2E71 A;  4P9F A;  2MH2 A;  2MGQ A;  1HC8 A;  2DPD A;  5ILV A;  1XGN A;  3S16 J;  2OD5 A;  4HQM A;  1JT0 A;  4ZYE A;  4P96 A;  1U5T C;  3C1D A;  1KU7 A;  4JX6 A;  3PUF A;  1FYM A;  4I09 A;  2CQX A;  2I5U A;  2XGE A;  1L3L A;  4H0E A;  3DQV C;  3OY9 A;  1IUY A;  4XN3 A;  5J6X A;  2DA3 A;  2Z16 A;  4JOM A;  3J80 K;  5ILS A;  3CMM A;  2L9N A;  2EWN A;  6PAX A;  4KMU X;  3BTI A;  2JSC A;  5H20 A;  2GA2 A;  4IXA A;  4CDG A;  2R92 J;  1Z0X A;  5J8C A;  2BY2 A;  4IF4 A;  1MSE C;  3HPH A;  2CFX A;  2QSF X;  2DTR A;  2ZC2 A;  4HZF A;  4U0Y A;  1LPQ A;  1ZH5 A;  4AVZ A;  5HDN A;  3KZI C;  3E6M A;  3GUD A;  3NAU A;  2F5D A;  3OL3 A;  4E6K G;  1S7O A;  2MAB A;  1W5T A;  3U21 A;  4LLN A;  1Y1V J;  3NEU A;  3K4N A;  1J9I A;  3H3V K;  3PIO F;  2XB5 A;  2DI3 A;  4KN4 X;  3HOW J;  1UB9 A;  1OPC A;  3ASN H;  1X58 A;  1XD7 A;  2XPW A;  2JQ7 A;  4UHT A;  1NHA A;  1W7P D;  3ZMD A;  1YJN I;  1OYW A;  2XAQ A;  3LSI A;  4ANJ A;  3E1S A;  4G12 A;  5C4J J;  3Q0V A;  4AIJ A;  1GVD A;  2DJI A;  2X6Y A;  3O3K A;  4PGH A;  4CZZ A;  2L0K A;  2NOG A;  1S5L C;  2MG4 A;  5IT9 K;  2FUG 2;  4D9J A;  3WOD F;  1Z7L A;  2L7F P;  4EJT A;  3KET A;  1QO0 D;  3QU6 A;  1S9H A;  4IVN A;  4KMF A;  4QWQ A;  4QPO A;  3I5U A;  4XIC A;  4FX4 A;  2RDP A;  5DS9 A;  3TDU C;  1P6R A;  4NQW B;  5EEH A;  2A5Y B;  3FXJ A;  1JTX A;  4IEJ A;  4U88 A;  3GVA A;  4PFO A;  5FRM A;  4B47 A;  5GPC A;  5FLM J;  1OR7 A;  2EIL H;  2X1E A;  3M8E A;  4HEA 2;  3J7A Y;  5ICC A;  1ZEL A;  1U2W A;  2KRF A;  3A03 A;  4OIO F;  3OYD A;  5M3M J;  1JHF A;  2HYG D;  1UST A;  1X1B A;  3F8F A;  4NC8 A;  4A3J J;  3CQZ J;  2M2E A;  1E3O C;  4ESB A;  4OWR B;  1QRY A;  2MBF A;  1Z67 A;  1UMQ A;  4XLF A;  3UNG C;  2LR8 A;  4RB2 C;  1IXS B;  2Y0S N;  3HUG A;  4XSZ F;  1R1V A;  4D0P A;  2DA5 A;  2WY8 Q;  1VQ7 I;  5EEA A;  3E5Q A;  5HLI A;  3JCU C;  3F9K A;  3JRA A;  3AAF A;  3QP5 A;  5D5V B;  1MIJ A;  2W85 A;  4L5I A;  1WZ2 A;  2H6B A;  4B3X A;  5D5U B;  4FCY A;  1UEL B;  4HV6 A;  2R7R A;  3K4B A;  3HYI A;  3KYL A;  1FIA A;  3ESW B;  3V42 A;  3MKL A;  1R7J A;  2L7M P;  2M4K A;  3GZ5 A;  4A3F J;  5GP9 A;  4HF2 A;  4E7I A;  2W24 A;  4D5F A;  1VQ5 I;  3BTJ A;  3FIW A;  3TOA A;  4BJ6 C;  1LB2 A;  1ZTR A;  1I27 A;  2JPC A;  1IF1 A;  4LIV A;  1FSH A;  3IC7 A;  1K4S A;  1BI1 A;  3O8G A;  2VXZ A;  3DKX A;  2YU9 J;  1OCC H;  3JSO A;  5D6F A;  2DMN A;  1ZN2 A;  3MKY B;  2FE3 A;  3IAS 2;  1UHW A;  1BR1 A;  1PJR A;  4E70 A;  4ENJ A;  1YLF A;  1XGS A;  4NB5 A;  3W6K B;  3W2W A;  1ON1 A;  5CVI A;  4BE0 A;  3HHG A;  1ENH A;  1IRZ A;  1LVK A;  2DDA A;  2LOO A;  2VT2 A;  2FQ4 A;  4HDV A;  2MD5 A;  2R7X A;  2GXB A;  3LQQ A;  3WTW C;  4QSH A;  1T56 A;  1X2N A;  4HOB A;  4F92 B;  2XKO A;  3UR3 C;  3K70 D;  3K1P A;  1U78 A;  3H5R A;  4OAY A;  3NQO A;  2QEN A;  3MZY A;  2L2O A;  2V79 A;  2PJR B;  2YS9 A;  1SD4 A;  1ODD A;  2K4B A;  3CUO A;  4A6E A;  2DPU A;  4PJM A;  1T08 B;  2V1D A;  4G94 A;  3M8F A;  1TBX A;  2ZJQ F;  1H9T A;  3R0A A;  3ZQI A;  3M9A A;  1SAX A;  3C18 A;  5LGU A;  2KHM A;  2K9S A;  1SFK A;  2KP6 A;  2Y48 A;  1OQY A;  3J7Y J;  4II2 A;  4IHY A;  1JJ8 C;  1D3Y A;  2KDZ A;  1R00 A;  3V8K A;  3IKV A;  4Q5S F;  1TQI A;  3LST A;  1PUF A;  2DCE A;  2IBD A;  1Z91 A;  4M73 A;  2CYY A;  4C9Y A;  2A3S A;  4PSW A;  1PYV A;  1R22 A;  3HOY J;  1TWC J;  3MD2 A;  3SXY A;  1D1C A;  3EUH C;  1WGX A;  3TW6 A;  5FKN A;  3F6V A;  4CXF A;  4CGZ A;  2VAS A;  2KJC A;  3H9J A;  2VJ5 A;  3VB2 A;  3R4K A;  2FMY A;  2Q0O A;  4AVP A;  2A61 A;  4ZYD A;  4E7L A;  2KZV A;  5FRN A;  2K3P A;  1Y0U A;  3A2K A;  1J7K A;  3KEQ A;  2VJJ A;  3W3C A;  4E7H A;  1ETV A;  1BW6 A;  1IN8 A;  3FXU A;  2KKO A;  1TL8 A;  2JVH A;  1S3J A;  4BJT A;  1E0E A;  1I6H J;  4DBQ A;  5LGT A;  4BHP A;  2LD5 A;  3QPL A;  2HPI A;  4I01 A;  4UUS A;  3OL4 A;  2O3F A;  3M1E A;  2D1V A;  4HF0 A;  2ELH A;  2LNB A;  4MNU A;  2JA5 J;  1M1E B;  3DTK A;  1R5H A;  5E3L A;  2DT5 A;  2PMZ A;  2O9L A;  4HRI A;  1KU9 A;  1MBK A;  2HZD A;  2E1O A;  4L9T A;  2WAD A;  2A6E F;  3OOU A;  3HOT A;  1OCP A;  4U7D A;  3FM3 A;  1E17 A;  2V1U A;  4RM2 A;  2W57 A;  1SAN A;  3ZN0 A;  5K7H A;  1RUO A;  2W82 A;  3FX3 A;  3CF5 F;  2DU9 A;  4KA4 A;  4IL6 C;  4EGY A;  2K9Q A;  1IXC A;  2OZ6 A;  5M5X J;  5CQE A;  2DMT A;  2EK5 A;  4KIB A;  5IY5 H;  2HVR A;  2YR2 A;  3S1R J;  1ZR2 A;  1YIT I;  2R7O A;  3TOB A;  3BR6 A;  4EAT A;  2HVQ A;  4XRF A;  1PP8 F;  1RRJ A;  4AIH A;  5D8L B;  1X3Z B;  3LSK A;  2R7D A;  5E18 F;  5TJJ A;  2QSH X;  4MHG A;  3CCR I;  1RIO H;  1R71 A;  2K02 A;  2M0M A;  2X6X A;  3LSJ A;  4CYC B;  1WJC A;  4LG0 A;  3WTV C;  4XM3 A;  3CCJ I;  1IN6 A;  2P7C B;  5DCM A;  3ZQG A;  4HST A;  3DLA A;  4IZZ A;  4A0Y A;  1B72 A;  1SMT A;  1TQP A;  2D45 A;  2VOO A;  3OSG A;  1U8B A;  5LHH A;  4OAZ A;  3CDI A;  1SVO A;  3RKW A;  4O6J A;  3ECH A;  4U0W A;  1V5F A;  3PO3 J;  1RPW A;  4ZZD A;  2M34 A;  4ABZ A;  3PQJ A;  4LG3 A;  1OCR H;  3T1B A;  2ZFW A;  3K2A A;  2QKL B;  1UG2 A;  5HDK A;  1R4M B;  2LVS A;  3FMS A;  3I9V 2;  3CO6 C;  3T8T A;  2O0Y A;  4LIU A;  4I0A A;  1S29 A;  4XLE A;  2NVQ J;  2HKX A;  4DGW B;  2M0C A;  2HS5 A;  4AC0 A;  4I2O A;  4B43 A;  2Z1D A;  2HQ5 A;  2CQ7 A;  4MIM A;  1YIO A;  2MW8 A;  1CF7 A;  4A3D J;  1NK2 P;  3ZQ7 A;  1APL C;  2LKX A;  2ACJ A;  3HDD A;  1I3Q J;  4GRI A;  5HDG A;  3JRF A;  1DDN A;  2M45 A;  2HOS A;  2P8T A;  1ONV A;  1W7P B;  2LY1 A;  2W25 A;  4A5N A;  4YIR X;  4G7O F;  4UVA A;  2CH0 A;  2M9H A;  2GIV A;  3WU2 C;  1NTC A;  2R7T A;  3RKQ A;  3WGI A;  3BZK A;  1Y8R B;  5FKO A;  4JYK A;  2X9D A;  2ELJ A;  3LSH A;  3RPU D;  4IOC F;  1JUS A;  2HKO A;  2RV8 A;  3BZ6 A;  4C3I J;  4KFC A;  4XID A;  4KYW A;  2E7W A;  3FKJ A;  2EFO A;  1WH5 A;  3ABU A;  2A6H F;  1N78 A;  1XGM A;  2L7K A;  1JUP A;  2ZXJ A;  2WV1 A;  1FBS A;  2EBI A;  1B4A A;  1BA5 A;  1FTZ A;  2WA0 A;  1ETQ A;  3LMM A;  3K70 C;  4L0Z B;  3CF2 A;  4FTH A;  2GA1 A;  1LFP A;  1O4X A;  2VB6 A;  3K2Z A;  4HX4 A;  1WFX A;  4YEL A;  3TGN A;  3RZD J;  3TBI A;  2ME0 A;  2E1N A;  3H0D A;  4S05 A;  4CCK A;  2QKM B;  4C3J J;  2V4J C;  1MBJ A;  2Z5U A;  1HDD C;  1AA7 A;  2VL8 A;  1WJ5 A;  2LLK A;  2NOJ B;  2VQG A;  3JRB A;  1Z77 A;  5CQG A;  4N9I A;  3GTP J;  2QWW A;  5E20 A;  2EFQ A;  2CW7 A;  2BEO A;  1LE8 B;  2VOP A;  3ECO A;  1HW2 A;  1ZR4 A;  1ETO A;  1T0F A;  3LA3 A;  3W6J B;  3EYI A;  3F8N A;  2PMH A;  3E6B A;  3IWF A;  4BBR J;  2E2H J;  1S7E A;  2XPU A;  4R8H A;  3G1M A;  4LB5 A;  4LJZ F;  4LIT A;  1KZH A;  2HZT A;  4A93 J;  3FHN A;  2ZBK A;  1IV6 A;  2BXZ A;  1IC8 A;  3FXO A;  2HGC A;  3B73 A;  3TP0 A;  3LNQ A;  2ZFU A;  4AYB N;  3E97 A;  2J5O A;  2Y31 A;  1MW7 A;  2MH9 A;  4BHB A;  3CDH A;  2F4O B;  1MBG A;  1FOY A;  1A31 A;  2EZH A;  1WWX A;  2BHZ A;  1R6R A;  4YEJ A;  1BJA A;  1TLH B;  4BS9 A;  3BZC A;  2ZME C;  4C2U A;  1SFE A;  3ONQ A;  3KPH A;  3HOS A;  2H6C A;  3CJR B;  5C44 J;  2R5Z B;  4BEH A;  2Y30 A;  2R93 J;  4I6Z A;  2ME6 A;  2OQR A;  2QCO A;  1R9T J;  2Q1Z B;  4A0X A;  3L2R A;  4HNV A;  3GO5 A;  3VOD A;  2P6T A;  3GFL A;  4UV9 A;  4ZDO A;  3ML6 A;  4Y15 A;  4RLF A;  5HS9 A;  3VFZ A;  3HRS A;  3CCL I;  3FK6 A;  3M8J A;  2EA4 A;  4FHT A;  3PFY A;  4LK0 F;  5LRR A;  4ETS A;  3Q0U A;  1FNN A;  4QLC U;  4WXH A;  1D1A A;  3MAJ A;  1BR4 A;  3DFG A;  1H8A C;  2G7U A;  1DP3 A;  4PJ0 C;  1BM9 A;  4BL0 B;  4ZZL A;  3FIS A;  3FBI B;  4CYD A;  3LFK A;  3DU5 A;  4UV8 A;  3MQ0 A;  3KYC B;  1TW3 A;  2V1N A;  1YOV B;  3P9K A;  3NAR A;  5HNF A;  2X1C A;  2W1O A;  1RKW A;  2PBI A;  2Z99 A;  1FOW A;  3KP7 A;  5FGM A;  4FX0 A;  5LFA A;  5K5O A;  3G71 I;  4PZJ A;  1QGP A;  4MLO A;  2UXN A;  4RA2 A;  3LFU A;  4IHS A;  5BS6 A;  4D7N A;  2FSW A;  2IVM A;  2EZL A;  1X3U A;  1U0J A;  5GAG J;  1SFX A;  4M6V A;  3WGH A;  1IW7 F;  1DU6 A;  1XDS A;  4M74 A;  3JTH A;  4RMN A;  5DD8 A;  3ULQ B;  2W48 A;  3P5J A;  2O8X A;  5CKT A;  4GDF A;  5FLV A;  4XOT A;  2RN7 A;  4AID A;  1F1Z A;  4LLL A;  1ZLK A;  3DLL F;  5HLH A;  2CMP A;  1YRN B;  2DQR A;  2VON A;  4CCM A;  1IRG A;  2VBW A;  3I4P A;  1G3W A;  1OCZ H;  1UG0 A;  1VQM I;  4O3M A;  2M7B A;  1BC8 C;  5FKK A;  2V6C A;  2CUE A;  3D1N I;  2VKV A;  1GV5 A;  1ZAO A;  2G9W A;  2NS8 A;  3A01 B;  4ZTF A;  2HI3 A;  4IOA F;  3FXQ A;  2WB1 A;  3V4G A;  2L5Q A;  2ID6 A;  3ZCO A;  4NHJ A;  2CUF A;  2DT6 A;  3CZ6 A;  4A0Z A;  2RQP A;  4UB6 C;  4HW0 A;  3OWT A;  3GF2 A;  2IPQ X;  4F52 A;  4S0H B;  3COA C;  3A02 A;  1AWC A;  2VUM J;  1QBJ A;  3CUQ C;  4BJ5 C;  1FJL A;  4KIF A;  3I3L A;  4E7J A;  3HGY A;  1B1B A;  4GCV A;  2MFZ A;  4ESJ A;  1JJ6 C;  3A1Y A;  3VDX A;  2F5F A;  1W1W E;  1RES A;  1MH3 A;  2P0W A;  3CCY A;  2DOA A;  2YSR A;  3W6V A;  3S1M J;  4NQW A;  1VND A;  4W97 A;  5E3O A;  4MTD A;  1LVA A;  4ZYH A;  1JGG A;  2LK2 A;  3JR9 A;  2XAH A;  2NVX J;  4L9N A;  3WE2 A;  2LMD A;  3MZ8 A;  4QPQ A;  3S1N J;  1IDY A;  3GFM A;  5TGT A;  3BT9 A;  2XRN A;  3SDB A;  2OTJ I;  1TTY A;  2A68 F;  2KLO A;  1WJB A;  1Y0N A;  2IW5 A;  1BI0 A;  2DXI A;  2H8R A;  2XAF A;  2E7X A;  2XGC A;  5AON A;  1GDT A;  1BI2 A;  1WH7 A;  2EIK H;  5HNH A;  3OOP A;  3QPS A;  3KP5 A;  2LC2 A;  2HVS A;  2HQR A;  2M3A A;  2CS3 A;  5KHD A;  4EGZ A;  3ZGK A;  5LBQ A;  2OA4 A;  2NVY J;  3L2C A;  4EJU A;  2GLO A;  4KN7 X;  1IUF A;  3MCZ A;  2D5V A;  3GXO A;  4EJO A;  4XRM A;  5E17 F;  2XRL A;  5FD6 A;  3DWL E;  4BQO A;  1SFO J;  1ZG1 A;  2HWV A;  2O61 A;  3PL8 A;  4NBQ A;  2BY1 A;  4CZC A;  2HPM A;  4BE2 A;  1VF9 A;  3C3W A;  4OMZ A;  1WJE A;  2H27 A;  3HOV J;  3H1C A;  1V54 H;  2PJP A;  1ETX A;  4L9J A;  5FFX A;  1REP C;  4MEX F;  2AHQ A;  2ISZ A;  1IG7 A;  3Q5F A;  4BXU A;  3EDP A;  3REO A;  1IXR C;  2KIQ A;  3FKI J;  3V7R A;  5CVU A;  2OBP A;  1LUJ B;  3OIO A;  4KT5 C;  1OYI A;  5GAH J;  1LDJ A;  4WXD A;  4Q47 A;  2OZU A;  1QA6 A;  4OIQ F;  1SVM A;  4C2M J;  2COM A;  3K10 A;  2PG4 A;  3S2D J;  1VQ4 I;  2KIU A;  3SZT A;  1DUX C;  4AWX B;  3IUO A;  3HPG A;  2X51 A;  2VQL A;  3F72 A;  3HGG A;  1VQ8 I;  1HSJ A;  1YYV A;  2EV0 A;  4RBO A;  2JUC A;  1PDN C;  3MVP A;  1LDK B;  4K2E A;  4R1H A;  4XKC A;  1K83 J;  3CUQ B;  5AIQ A;  4BU2 A;  3OYM A;  2EQR A;  1VQP I;  3Q9S A;  4RB0 A;  4LB6 B;  4M3D A;  5J1R A;  2QLZ A;  2OQG A;  3B6C A;  4XKW A;  2HYF A;  3RDI A;  3VSK A;  3EET A;  3DPL C;  1J2X A;  2DW4 A;  2RGV A;  2FEZ A;  3LL7 A; 
#chains in the Genus database with same CATH homology
 1G3Y A;  1FZP B;  2FRH A;  4WXC A;  4IPA A;  2PLY A;  1Z9C A;  4YFK F;  1TQM A;  4B8X A;  1DP7 P;  3N97 A;  2VBZ A;  1T6S A;  5TRD A;  2ZNZ A;  4OIR F;  4PGG A;  4GGG A;  5DUI A;  4Y17 A;  1DPU A;  1U6G A;  5BQT A;  3DEU A;  2NYX A;  2KIM A;  2JPB A;  1JXS A;  1U5T B;  2HTJ A;  4YII A;  3WTY C;  1XCV A;  4HLY A;  3HTS B;  3MEX A;  3RI4 A;  4JBA A;  1R36 A;  2DAO A;  2FXA A;  2D2W A;  1K7A A;  2A07 F;  3CLO A;  2XV4 S;  3BDD A;  1KQ9 A;  3HSE A;  4RAY A;  4OIP F;  1FBQ A;  5DDG A;  4L0Y B;  2K27 A;  4RB1 A;  1YQA A;  4BYY A;  5FB2 A;  5KVR A;  5FO5 A;  1SD5 A;  2R7F A;  4BHC A;  1J0R A;  1O3Q A;  5LHG A;  1IN5 A;  3FMR A;  3RYP A;  1U3E M;  3BPV A;  1G3T A;  4UUV A;  2JTV A;  1O3T A;  3IWZ A;  3K0L A;  4RGU A;  4KIG A;  5D5W B;  2UWM A;  1U8R A;  1YTY A;  2ETH A;  2IA1 A;  3V8L A;  1HST A;  3K1M A;  5JHU A;  2MLK A;  1QPM A;  3I59 B;  3ZMS A;  5F64 A;  2QBY B;  5L3B A;  2GZW A;  5D8K B;  1MGT A;  1Z6R A;  2E1C A;  4M9S A;  2CQK A;  3HRM A;  4G9Y A;  3MFK A;  5D4S A;  4O5V A;  3TDZ C;  3FHZ A;  3H3U A;  4PDK A;  3KZY A;  1STZ A;  5KK1 A;  2JRT A;  1EH8 A;  1GVJ A;  3HIF A;  1XSV A;  3M7G A;  3KP3 A;  4UNO A;  5K5R A;  1O7F A;  1FLI A;  1P2F A;  1XCB A;  2MA3 A;  3DV8 A;  3I71 A;  5BPI A;  3K1N A;  1B9N A;  2VE9 A;  3HSR A;  5K5Q A;  1S8N A;  3EYY A;  3BRO A;  5CLS A;  3R0J A;  1W7P A;  2LF8 A;  3RKX A;  2A69 F;  2YX7 A;  5ILU A;  2RC4 A;  1QQI A;  3VOE A;  4JQF A;  4P9U A;  3J81 Z;  3D0S A;  5FLX Z;  5J8F A;  1H9G A;  1S7A A;  3QPH A;  2QUF A;  3QP6 A;  1YFH A;  2EV6 A;  1IRF A;  1BC7 C;  4G6Q A;  3F8B A;  3DKW A;  1FWZ A;  1HKS A;  3PFI A;  5ICF A;  4OU0 A;  2XRO A;  2WV0 A;  2K4J A;  2QVO A;  4Q4Z F;  3BJA A;  3I54 A;  3QRF F;  4ZYG A;  1ZAR A;  1KU2 A;  4AIK A;  3L9F A;  2JT1 A;  3S2W A;  1LNW A;  5L3E A;  1FP2 A;  3P7N A;  3P9I A;  4L18 B;  2X4H A;  3ZN1 A;  1KQ0 A;  2QQ9 A;  3KCC A;  1MZB A;  3LAP A;  3HTU A;  3FF5 A;  3GWZ A;  4KUM A;  5D6E A;  2EV5 A;  2IA2 A;  1YW8 A;  1H0M A;  4IHT A;  3TO9 A;  1ZG3 A;  4HV5 A;  2PI0 A;  1WI9 A;  2M1B A;  2FNA A;  2O6G E;  1ZGA A;  1MJ9 A;  2V1X A;  2Z3Y A;  4EM0 B;  4XLN F;  2BYV E;  1KYZ A;  2P5L C;  2X0L A;  5BPD A;  2L01 A;  1ZHF A;  2ZCW A;  3SHF A;  1MDM B;  2FML A;  3B02 A;  3KP4 A;  3R61 A;  4G8X A;  1OYY A;  4M72 A;  4EMS A;  3E5X A;  2YX4 A;  2K7L A;  3RPQ A;  2Y0M A;  1F9N A;  1FX7 A;  2D1H A;  5LEK A;  2ZJ2 A;  3Q9V A;  4MEY F;  3IRQ A;  1MJA A;  1SD6 A;  2J5P A;  1ZYR F;  2FBK A;  5A2Q Z;  4HAM A;  1I5Z A;  1FOK A;  4KNY A;  2P6S A;  3KP2 A;  2IRF G;  4LGW A;  3JAM Z;  2M8E A;  2IJL A;  1C0W A;  4UXN A;  5HLG A;  2DQL A;  3J7A O;  1EH7 A;  5DCF A;  5JFR A;  1HW1 A;  1Z6T A;  2Z33 A;  2V9V A;  5E1X A;  4HQE A;  4LLG F;  5IT3 A;  2QZ8 A;  4LD5 A;  4BNC A;  2M5W A;  1LEB A;  1SD7 A;  2NRA C;  4IRG A;  1RUN A;  3F8C A;  5JI6 A;  3GFJ A;  3LA7 A;  1P92 A;  2F2E A;  2ISY A;  3T5X A;  2XUB A;  5L3C A;  5HS8 A;  3WG9 A;  4ZH4 F;  3IL2 A;  2EFP A;  3ZMZ A;  1FSE A;  1FYL A;  4IJA A;  1J75 A;  1LEA A;  4AD9 A;  5LRS A;  5DYM A;  1ULY A;  1GHC A;  3NRV A;  3R6S A;  1P4X A;  2XAG A;  2KJB A;  1BN5 A;  3O6B B;  2STT A;  4LK1 F;  1G6N A;  1R5G A;  3J81 K;  2VC1 A;  5FLX K;  2WTE A;  4S04 A;  3N4M A;  2BV6 A;  1TNS A;  4A2U A;  4A12 A;  2VE8 A;  3HSF A;  3MWM A;  3DP7 A;  1TNT A;  3ZMU A;  5L3G A;  2H94 A;  3GW2 A;  3SZP A;  4YFX F;  3HHH A;  3T8R A;  2VBY A;  4XBF A;  1V4R A;  1J59 A;  4LFU A;  4ESF A;  1XMK A;  5BMZ A;  2ESH A;  2DFI A;  5FD5 A;  1ZLJ A;  2ZME B;  3CUQ A;  4I7H A;  2HR3 A;  3WTS C;  3SFZ A;  2H09 A;  1HW5 A;  1P4W A;  2LSO A;  3ROU A;  4ON0 A;  1B59 A;  3LWF A;  1SFU A;  3WTT C;  3I53 A;  2RKH A;  4EM1 A;  1I1G A;  4M6Y A;  4CO8 A;  3C7J A;  1T98 A;  4WWC A;  1V3F A;  3TQN A;  3WU1 B;  1VTN C;  4RB3 C;  3E3V A;  2Q8K A;  3GLX A;  5AIP A;  5E1W A;  1D8K A;  4P55 A;  2CGP A;  2OAZ A;  1XMA A;  4RGR A;  1U5T A;  3T0Y A;  3BJO A;  5HS7 A;  3L00 A;  3RKY A;  2NNN A;  4MGR A;  1SMY F;  1UCR A;  2B0L A;  2K86 A;  2CSO A;  5E8G A;  4HX8 A;  5CVJ A;  4L5J A;  3IKT A;  4WK8 F;  1XSX A;  2GWR A;  3U1D A;  2IT0 A;  4HDU A;  1ZGJ A;  5A2Q K;  3ZMV A;  1FYK A;  3KP6 A;  1K79 A;  4IRH A;  2Q2E A;  4JK1 X;  4HF1 A;  3JAM K;  1L0O C;  1HKT A;  5ICE A;  2LKP A;  1RZ4 A;  3FZV A;  1JGS A;  4RGS A;  4M9Z A;  2FF4 A;  4EJW A;  4G7Z F;  1TW2 A;  3F3X A;  2PFB A;  4MQV A;  3E6D A;  5LHI A;  3RJP A;  3P9C A;  1G4D A;  2WWY A;  4CHU A;  4XSX F;  4RGX A;  2ESN A;  5LEJ A;  3I59 A;  1IZ1 A;  2QBY A;  5DV5 A;  4Z2Y A;  1T39 A;  3F23 A;  2GAU A;  3ZMT A;  5JVT A;  1FT9 A;  4ENM A;  1MJB A;  3F21 A;  1ON2 A;  5E8I A;  2NS0 A;  3I0T A;  5HOO A;  1F5T A;  1LDD A;  4WCG A;  1OKR A;  1YG2 A;  2F5E A;  1PUE E;  1YS6 A;  1FPQ A;  4KIC A;  2L4A A;  4I0B A;  3L7W A;  1KQ8 A;  2C6Y A;  1O7L A;  5H6R A;  1K78 B;  2PQ8 A;  1BOA A;  2XGX A;  2DK8 A;  2XVC A;  5D4R A;  2QYO A;  1F4K A;  4N0B A;  4EM2 A;  5L3D A;  4MTE A;  1GXP A;  4Y13 A;  2EA2 A;  4LMY A;  4DNC A;  2QM3 A;  3G73 A;  4PCQ A;  2FBI A;  1W5S A;  4F7Z A;  2VOD A;  3H3Z A;  1QZZ A;  5HVQ C;  3GZ6 A;  5BOX A;  1FBU A;  5ICG A;  1B6A A;  1D8J A;  4GYI A;  1OMI A;  1E2X A;  3I58 A;  5DEQ A;  2EFN A;  2QQA A;  3SQN A;  3KFW X;  2L4M A;  4I98 B;  2FBH A;  1BBY A;  3RYR A;  5CJ9 A;  2BGC A;  2WC2 A;  1ZG5 A;  2R3S A;  3DPT A;  5CVV A;  2ZNY A;  1WQ2 A;  3GEZ A;  3EUH A;  4G6D A;  2CW0 F;  4RS8 A;  2YU3 A;  1W4M A;  1WRJ A;  4DQ2 A;  2CWE A;  5DUK A;  1HBX G;  2Y75 A;  1YO5 C;  5FFZ A;  2VC0 A;  4BH9 A;  3F8M A;  3GFI A;  3FM5 A;  1IAW A;  3QU3 A;  2HTS A;  2ADU A;  4OMY A;  5JR3 A;  1MKM A;  3BPX A;  2FOK A;  1MDM A;  2UXX A;  3WE3 A;  4FT8 A;  1RI7 A;  1YS7 A;  4R79 A;  4OOI A;  4RAZ A;  3QAH A;  1LJ9 A;  4L9V A;  2FNP A;  4EVI A;  3E5U A;  5LGN A;  3U2R A;  3EQL F;  2HFH A;  2UZK A;  3QPT A;  2FU4 A;  5H6Q A;  1BIB A;  5L3F A;  5E1Z B;  1PP7 U;  4YG2 F;  1I6X A;  3JTG A;  2DO7 A;  1GXQ A;  2F5C A;  2FA5 A;  5EEG A;  1Z1D A;  3GX4 X;  1UFM A;  3KLN A;  3VEP A;  2RNJ A;  3FMQ A;  2NAZ A;  4YFN F;  4Q48 A;  3TKY A;  4YIF A;  1FC3 A;  3MZH A;  2IA0 A;  4A6D A;  2EFW A;  3RTR A;  1ZRE A;  2VN2 A;  3I64 A;  5ED4 A;  2M30 A;  1R1U A;  3CJN A;  1KYW A;  3BWG A;  3BOQ A;  1MD0 A;  4B09 A;  1JE8 A;  3HRT A;  1XDU A;  3ELK A;  2LDU A;  4GO1 A;  3KEO A;  2HEO A;  1AOY A;  1R1T A;  1I1S A;  1HXD A;  3CO7 C;  2STW A;  1G3S A;  2VT3 A;  2GXG A;  1DPR A;  1CGP A;  3BP8 A;  1YW7 A;  3IRR A;  1ZRC A;  1A04 A;  3G3Z A;  4I02 A;  2BE5 F;  3JW4 A;  5DD4 A;  2RVC A;  2P7V B;  4HBL A;  3FXR A;  2DBB A;  2HOE A;  2DK5 A;  5ERI A;  3ABT A;  4N9H A;  3RIR A;  1JHH A;  2P5K A;  3K9T A;  1D5V A;  1O3S A;  2BBY A;  2XIG A;  3J80 Z;  3DF8 A;  3ISP A;  5LLQ A;  2ZO4 A;  1IN7 A;  4OIN F;  4UVB A;  1LQ1 A;  2XHK A;  2NNY A;  3L09 A;  1YW9 A;  4M9X A;  4BAY A;  2ZKZ A;  3ERE D;  4GYG A;  1KA8 A;  2ZME A;  1KU3 A;  1FY7 A;  2PMU A;  3PQK A;  2MLG A;  3IHU A;  1K6O A;  3O2P E;  4LG0 B;  1B9M A;  1XGO A;  2L02 A;  2YPR A;  4M6X A;  2KIF A;  3K69 A;  4MQ9 F;  5DCM B;  1KGS A;  4IRI A;  5CVR A;  2EB7 A;  4UVC A;  1WSU A;  2VBX A;  5K1Y A;  3WU0 A;  1O3R A;  1ZRF A;  2PEX A;  2Z9O A;  5IT9 Z;  3QOP A;  2P5V A;  1EH6 A;  1HKQ A;  1S6L A;  2XKP A;  2L54 A;  1USS A;  4WX9 A;  2G7H A;  3LAJ A;  4GXO A;  4HX7 A;  2LF7 A;  4KDP A;  3WTU C;  1CF7 B;  2HDC A;  1RNL A;  5CYV A;  1Z7U A;  4P5O A;  3LQR A;  4ENK A;  2HQN A;  2OU2 A;  4CIC A;  3LA2 A;  3H92 A;  3KLO A;  4BQA A;  1R58 A;  4HYE A;  3KE2 A;  5F6F A;  2CG4 A;  2MC3 A;  1UHM A;  3CTA A;  1WKM A;  2W84 A;  4TV7 A;  1P4A A;  2P4W A;  1QNT A;  2IP2 A;  3E6C C;  1XN7 A;  3KZZ A;  3JSP A;  3DXJ F;  1T38 A;  1O57 A;  1BI3 A;  3TO6 A;  4EJV A;  3D5L A;  2XAS A;  3U9G A;  2FQ3 A;  1IN4 A;  2O03 A;  1QZY A;  1XB4 A;  3FWE A;  2TDX A;  3GYH X;  4HA8 A;  1HQC A;  3WGG A;  4U0V A;  4HLX A;  2PN6 A;  2AXL A;  1FP1 D;  2M87 A;  4XLP F;  1R23 A;  4ASN A;  3F22 A;  4M71 A;  4WF2 A;  3RPU A;  1ZRD A;  4EQQ A;  2EJR A;  3V7C A;  1J5Y A;  3WTX C;  2CO5 A;  4ENN A;  2DLL A;  2JZY A;  3OV8 A;  1XSD A;  1T2K A;  1BIA A;  3R60 A;  2QQB A;  3TO7 A;  1Z05 A;  4EV0 A;  1Q1H A;  2L3D A;  5F1R A;  3V7S A;  3ZPL A;  3HRU A;  5D5X B;  3BJ6 A;  4A5M A;  3F6O A;  4G7H F;  3V8J A;  2AS5 F;  2XAJ A;  3BY6 A;  3ZP5 A;  1K78 A;  3WTZ A;  1EV7 A;  4U7B A;  2GQQ A;  4P9F A;  2MH2 A;  2DPD A;  5ILV A;  1XGN A;  2OD5 A;  4HQM A;  1KU7 A;  4ZYE A;  4P96 A;  1U5T C;  3C1D A;  1FYM A;  4I09 A;  1L3L A;  4H0E A;  3DQV C;  1IUY A;  5J6X A;  3J80 K;  5ILS A;  2EWN A;  6PAX A;  4KMU X;  2JSC A;  5H20 A;  2GA2 A;  4IXA A;  4CDG A;  5J8C A;  4IF4 A;  2CFX A;  4HZF A;  2DTR A;  4U0Y A;  1ZH5 A;  5HDN A;  3E6M A;  3GUD A;  2F5D A;  1S7O A;  1W5T A;  4LLN A;  3NEU A;  1J9I A;  2DI3 A;  4KN4 X;  1UB9 A;  1OPC A;  1XD7 A;  4UHT A;  1NHA A;  1W7P D;  3ZMD A;  1OYW A;  2XAQ A;  4AIJ A;  3O3K A;  4PGH A;  4CZZ A;  5IT9 K;  3WOD F;  4EJT A;  3KET A;  1QO0 D;  3QU6 A;  4IVN A;  4KMF A;  4QWQ A;  3I5U A;  4FX4 A;  2RDP A;  3TDU C;  1P6R A;  5EEH A;  2A5Y B;  4U88 A;  3GVA A;  1OR7 A;  3M8E A;  5ICC A;  1U2W A;  2KRF A;  4OIO F;  1JHF A;  2HYG D;  1UST A;  3F8F A;  4ESB A;  2MBF A;  4RB2 C;  1IXS B;  3HUG A;  4XSZ F;  1R1V A;  4D0P A;  3E5Q A;  5HLI A;  3AAF A;  3QP5 A;  5D5V B;  2W85 A;  4L5I A;  2H6B A;  5D5U B;  4HV6 A;  3HYI A;  1R7J A;  3GZ5 A;  4HF2 A;  2W24 A;  1LB2 A;  3TOA A;  1I27 A;  2JPC A;  1IF1 A;  1FSH A;  3IC7 A;  1BI1 A;  2VXZ A;  3JSO A;  5D6F A;  1ZN2 A;  2FE3 A;  1UHW A;  4E70 A;  4ENJ A;  1YLF A;  1XGS A;  4NB5 A;  3W6K B;  1ON1 A;  5CVI A;  3HHG A;  2VT2 A;  4HDV A;  2MD5 A;  2GXB A;  3LQQ A;  3WTW C;  4HOB A;  2XKO A;  3K1P A;  1U78 A;  3NQO A;  2QEN A;  3MZY A;  2V79 A;  1SD4 A;  1ODD A;  2K4B A;  3CUO A;  4A6E A;  2DPU A;  2V1D A;  4G94 A;  3M8F A;  1TBX A;  1H9T A;  3R0A A;  3M9A A;  1SAX A;  3C18 A;  5LGU A;  2Y48 A;  1D3Y A;  1R00 A;  3V8K A;  3IKV A;  4Q5S F;  1TQI A;  3LST A;  1Z91 A;  4M73 A;  2CYY A;  2A3S A;  1R22 A;  3SXY A;  3F6V A;  4CXF A;  4CGZ A;  2KJC A;  3VB2 A;  3R4K A;  2FMY A;  2Q0O A;  4AVP A;  2A61 A;  4ZYD A;  1Y0U A;  1J7K A;  3KEQ A;  1IN8 A;  3FXU A;  2KKO A;  1S3J A;  5LGT A;  4BHP A;  4I01 A;  2O3F A;  3M1E A;  2D1V A;  4HF0 A;  2ELH A;  2LNB A;  4MNU A;  1R5H A;  2DT5 A;  1KU9 A;  4L9T A;  2A6E F;  3HOT A;  4U7D A;  3FM3 A;  1E17 A;  2V1U A;  2W57 A;  3ZN0 A;  1RUO A;  3FX3 A;  2DU9 A;  4KA4 A;  4EGY A;  1IXC A;  2OZ6 A;  4KIB A;  2EK5 A;  2YR2 A;  3TOB A;  4XRF A;  1PP8 F;  4AIH A;  5D8L B;  2R7D A;  5E18 F;  5TJJ A;  4MHG A;  1RIO H;  2K02 A;  4LG0 A;  3WTV C;  1IN6 A;  2P7C B;  5DCM A;  4A0Y A;  1SMT A;  1TQP A;  2D45 A;  2VOO A;  5LHH A;  3RKW A;  4O6J A;  3ECH A;  4U0W A;  4ZZD A;  3PQJ A;  3T1B A;  2ZFW A;  5HDK A;  3FMS A;  3CO6 C;  3T8T A;  2O0Y A;  4I0A A;  1S29 A;  2HKX A;  2HS5 A;  4I2O A;  1YIO A;  1CF7 A;  3ZQ7 A;  2ACJ A;  5HDG A;  1DDN A;  2M45 A;  2P8T A;  1ONV A;  1W7P B;  2W25 A;  4A5N A;  4G7O F;  4UVA A;  2GIV A;  3WGI A;  2HKO A;  4KFC A;  2RV8 A;  3BZ6 A;  4KYW A;  2E7W A;  2EFO A;  3ABU A;  2A6H F;  1XGM A;  2ZXJ A;  1FBS A;  1B4A A;  4L0Z B;  2GA1 A;  3K2Z A;  4HX4 A;  3TGN A;  2E1N A;  4S05 A;  2Z5U A;  4N9I A;  2QWW A;  5E20 A;  2EFQ A;  2BEO A;  2VOP A;  3ECO A;  1HW2 A;  1T0F A;  3LA3 A;  3W6J B;  3EYI A;  3F8N A;  2PMH A;  3E6B A;  3IWF A;  4R8H A;  4LB5 A;  4LJZ F;  2HZT A;  2ZBK A;  2HGC A;  3B73 A;  3E97 A;  2J5O A;  4BHB A;  2MH9 A;  3CDH A;  1WWX A;  1BJA A;  1TLH B;  1SFE A;  3HOS A;  2H6C A;  2OQR A;  4A0X A;  3GO5 A;  3VOD A;  2P6T A;  3GFL A;  4UV9 A;  3ML6 A;  4Y15 A;  5HS9 A;  3VFZ A;  3HRS A;  2EA4 A;  4FHT A;  4LK0 F;  5LRR A;  4ETS A;  1FNN A;  4QLC U;  4WXH A;  3MAJ A;  3DFG A;  2G7U A;  1BM9 A;  4ZZL A;  4CYD A;  3LFK A;  4UV8 A;  3MQ0 A;  3P9K A;  1TW3 A;  2PBI A;  2Z99 A;  3KP7 A;  5FGM A;  5K5O A;  4FX0 A;  4PZJ A;  1QGP A;  2UXN A;  4IHS A;  5BS6 A;  2FSW A;  2IVM A;  1X3U A;  1SFX A;  3WGH A;  1IW7 F;  1XDS A;  4M74 A;  3JTH A;  5DD8 A;  3ULQ B;  2O8X A;  2RN7 A;  1ZLK A;  1F1Z A;  4LLL A;  5HLH A;  2DQR A;  2VON A;  1IRG A;  2VBW A;  3I4P A;  1G3W A;  4O3M A;  1BC8 C;  2V6C A;  1ZAO A;  2G9W A;  3FXQ A;  3V4G A;  4NHJ A;  4A0Z A;  2RQP A;  4HW0 A;  3GF2 A;  2IPQ X;  3COA C;  1AWC A;  1QBJ A;  3CUQ C;  4KIF A;  1B1B A;  4GCV A;  4ESJ A;  2F5F A;  2YSR A;  4NQW A;  4MTD A;  1LVA A;  4ZYH A;  2XAH A;  4L9N A;  3WE2 A;  3GFM A;  2XRN A;  1TTY A;  2A68 F;  2IW5 A;  1BI0 A;  2XAF A;  2E7X A;  5AON A;  1BI2 A;  3OOP A;  3KP5 A;  2HQR A;  4EGZ A;  5LBQ A;  2OA4 A;  3L2C A;  4EJU A;  4KN7 X;  3MCZ A;  3GXO A;  4EJO A;  5E17 F;  5FD6 A;  1ZG1 A;  2HWV A;  2O61 A;  3C3W A;  4OMZ A;  2H27 A;  2PJP A;  4L9J A;  5FFX A;  1REP C;  4MEX F;  2ISZ A;  3Q5F A;  4BXU A;  3EDP A;  3REO A;  1IXR C;  3V7R A;  5CVU A;  2OBP A;  4KT5 C;  1OYI A;  1LDJ A;  4WXD A;  4Q47 A;  2OZU A;  4OIQ F;  2COM A;  2PG4 A;  2KIU A;  3SZT A;  1DUX C;  4AWX B;  3F72 A;  1HSJ A;  1YYV A;  2EV0 A;  1PDN C;  4K2E A;  1LDK B;  4R1H A;  5AIQ A;  3CUQ B;  3Q9S A;  4RB0 A;  4LB6 B;  2QLZ A;  2OQG A;  2HYF A;  3RDI A;  3EET A;  3DPL C;  1J2X A;  2DW4 A;  2RGV A;  2FEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...