1L0OC

Crystal structure of the bacillus stearothermophilus anti-sigma factor spoiiab with the sporulation sigma factor sigmaf
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
DGTVKVSRSLKEMGNKIRKAKDELSKTRGRAPTVTEIADHLGISPEDVVLAQEAVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Anti-sigma F factor
publication title Crystal structure of the Bacillus stearothermophilus anti-sigma factor SpoIIAB with the sporulation sigma factor sigmaF.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2002-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04539 Sigma70_r3 Sigma-70 region 3
C PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1l0oC00
2QYOA 4I01A 1FP1D 3D0SA 3LAPA 4MTDA 1KA8A 5LEKA 1S29A 4EJWA 3WE2A 1BI1A 3ULQB 1USSA 5JHUA 4HQMA 4G6QA 1BI0A 3RYPA 4XBFA 4GGGA 4QLCU 3LQQA 2M8EA 1E17A 4U7BA 4IRGA 1R58A 2YX4A 3HUGA 2E7XA 4OMZA 4N9IA 3WTZA 2DBBA 4LB5A 5CJ9A 1DPUA 2F5FA 1P4WA 2F2EA 1XB4A 1G4DA 2ISYA 3HRTA 3F23A 4ENNA 2PG4A 1H0MA 3TO7A 3NRVA 2VBYA 4MQVA 5A2QZ 4ON0A 2L3DA 2DLLA 3DP7A 5H6RA 1MDMB 3R61A 2F5CA 2O6GE 5DV5A 3OV8A 3S2WA 2P7VB 3W6JB 1LEBA 3QPHA 3KEQA 3EETA 5ED4A 4LG0A 2XASA 5IT9Z 5HLIA 1MD0A 2RC4A 2MBFA 3OOPA 4IJAA 1T98A 1WI9A 4EM0B 4HV5A 3ERED 3R4KA 4KMUX 3WGGA 4WK8F 5E20A 3ZMUA 1J0RA 3L7WA 1R36A 1GXQA 4U7DA 2UXXA 3SHFA 2IRFG 3JSPA 3VOEA 2ETHA 1BIBA 2PQ8A 2A68F 5FFXA 4IVNA 3WTTC 1XMAA 3Q9SA 1JHHA 1F1ZA 1XDSA 2J5PA 3K0LA 3RKYA 3N4MA 3RPUA 3C7JA 2VBWA 1YLFA 4HX8A 3HYIA 1KU3A 4M71A 2UWMA 3DQVC 1TQMA 3V8KA 3PQKA 3KP2A 4PGHA 4CICA 4RB3C 2CQKA 5FD5A 5DD4A 1CGPA 2VXZA 4UUVA 3TOAA 2CYYA 2V6CA 4MNUA 5HOOA 1VTNC 4TV7A 1YIOA 4I98B 4ZYDA 5D8LB 4EM1A 2ZCWA 2MLKA 1D5VA 2QVOA 4A5NA 2ZJ2A 3CDHA 4Y17A 4HQEA 4G94A 1UB9A 4BAYA 2DAOA 1TBXA 2OU2A 1UHMA 1WRJA 3KP4A 1O3RA 4I7HA 1NHAA 3VB2A 3B02A 4M6XA 3LA3A 4PGGA 2QQBA 4L5JA 2LSOA 3TDUC 4RS8A 4NHJA 5BS6A 1HSTA 1T6SA 1TNTA 1C0WA 5D5XB 4BH9A 4L18B 2K4JA 2VN2A 4M74A 3HRMA 2IJLA 3VEPA 2XHKA 3E5XA 3KE2A 1FY7A 3F6OA 1R1TA 2DO7A 4O5VA 3HHGA 1ON1A 3V8LA 1FP2A 5LGUA 1YYVA 5J6XA 1XCVA 4HAMA 2QWWA 1MKMA 2CWEA 4YIIA 3J80K 3O6BB 1R23A 3GFLA 3F6VA 1HW1A 5BMZA 5E1ZB 2K27A 1ZH5A 2EV0A 2VC1A 2DQLA 4MQ9F 1FWZA 4BNCA 1HKSA 3T5XA 2Z99A 5DCMB 1B9MA 4A0XA 2EFOA 1XSVA 3QAHA 2LF8A 5LRSA 2X0LA 5HS7A 4L0ZB 3E6CC 4KIFA 1F9NA 1U2WA 3I59A 4BXUA 2RGVA 2H09A 2RVCA 2BGCA 2DTRA 2YX7A 1L0OC 3KFWX 3HSRA 5TRDA 1A04A 4LD5A 1QZYA 4A6DA 2VOOA 1LNWA 1OYWA 2VBZA 3H3UA 1T0FA 3QU6A 1UFMA 2BYVE 2ZFWA 1IUYA 4OOIA 4E70A 2LKPA 1Z91A 1PP8F 3L2CA 3V7CA 4LLGF 2QM3A 3JAMZ 1EV7A 1XSDA 5D5UB 4YFNF 5E1XA 3QU3A 5BPDA 2HEOA 2PFBA 2VC0A 3QP6A 4EQQA 3BPVA 1R7JA 2OZUA 3Q9VA 1YG2A 3E6MA 5BQTA 3M1EA 1I1SA 1U6GA 4Q4ZF 2KRFA 2E1NA 4YG2F 2IW5A 2IA2A 4WWCA 1MDMA 2DU9A 3CUQB 3T0YA 2IA1A 1FPQA 4A12A 4CZZA 3RPQA 2L54A 2HFHA 1U5TB 3LA2A 5ILVA 5F6FA 4A5MA 2Q0OA 2M45A 1IW7F 3O2PE 3O3KA 3J80Z 3I54A 2A6EF 1QGPA 3F22A 1REPC 4HLXA 4LGWA 2VBXA 1BI3A 1MZBA 3WTSC 3FWEA 4RB2C 1TNSA 4DQ2A 3RIRA 3WTVC 4M9XA 4MGRA 3J81K 1IN7A 3G73A 3IKVA 1J2XA 4XLNF 2VT3A 2IPQX 2IP2A 1B6AA 2A07F 5FFZA 1TQPA 5HDKA 1ZG5A 3FMSA 2ZKZA 5D4RA 1S6LA 2STTA 1LDDA 5K1YA 2HZTA 2CSOA 2E7WA 5LRRA 1HBXG 1HSJA 5HDGA 1HKQA 3CLOA 4UV8A 5CVIA 5E8IA 4AIJA 4XSXF 1U8RA 3L00A 5JR3A 1GHCA 3F8MA 2A6HF 2PEXA 3SZPA 1RUNA 3U1DA 2L02A 3GLXA 3M8EA 5D5WB 3MWMA 1YW8A 3VODA 2H6BA 1R1VA 3F3XA 2FNAA 3EYIA 1J7KA 1XMKA 1MJAA 2PBIA 4EJOA 4M9ZA 2DK8A 2G7HA 2XIGA 3R0JA 4YFKF 2O03A 2MH9A 3F8BA 3WTYC 4KN4X 2W84A 2AS5F 4HV6A 2A61A 3IWZA 2P5KA 1O3QA 3BWGA 1IN5A 1ZN2A 2FBIA 5L3EA 1LB2A 3WTWC 3IL2A 2D45A 3P9KA 2ESHA 5FGMA 2OQGA 4NB5A 3KLNA 3WGHA 4IHSA 1SMYF 2Z3YA 1SFUA 3FM5A 2VONA 2NS0A 1Z9CA 3ZMVA 3KLOA 1Z05A 4ENKA 1YW7A 1ZLJA 3HTUA 3TO9A 4A0ZA 2BE5F 3KP5A 5CYVA 3JTHA 2AXLA 4CYDA 4KNYA 2NYXA 1KYWA 1TQIA 3I58A 2HQRA 1KGSA 3J81Z 4L5IA 1BOAA 2GIVA 4WXCA 4OIOF 4U0YA 3CTAA 3BZ6A 3AAFA 4ETSA 1LDJA 2BBYA 1IXSB 4OIRF 4AIHA 2HYFA 1WSUA 4KICA 1R5GA 3ECOA 3T1BA 3LFKA 4IRIA 2GAUA 1R1UA 1S8NA 5FO5A 4LFUA 5ICCA 4GCVA 5FLXK 5KVRA 3CO6C 4K2EA 4PZJA 2EFPA 4HZFA 3TQNA 1O7LA 1EH6A 1DPRA 3DKWA 4U0VA 3IRQA 5LHHA 4R1HA 2PLYA 2ACJA 1YS6A 3FM3A 1U3EM 1FBQA 3DFGA 2COMA 3WTUC 3HRSA 2XKPA 1ODDA 3I0TA 4HDVA 2XAQA 2OQRA 1Z6RA 2EWNA 1DUXC 4S04A 4G9YA 4L9TA 5DYMA 2EK5A 2G7UA 1F5TA 1G6NA 2O0YA 1ON2A 1P4AA 4RAZA 2P6TA 3HIFA 2CG4A 1SMTA 4WXHA 3BDDA 1WWXA 4OMYA 3FXQA 2VOPA 1TW3A 3ZP5A 2D2WA 5DEQA 3DF8A 2HKXA 2VODA 3FZVA 3CUQA 3P9CA 3P7NA 3RTRA 5AONA 1B59A 3WODF 3P9IA 4RGSA 1LDKB 1KU9A 1U5TA 1P4XA 4M72A 1ZLKA 4ZZDA 1XGMA 3D5LA 4JQFA 3ZMDA 3K2ZA 2VE8A 3M7GA 4BHPA 2JRTA 2V1DA 5HLGA 5DUIA 2FRHA 2OD5A 3NQOA 2EFNA 4UVCA 3E3VA 4CO8A 5HVQC 3F8CA 2E1CA 3PQJA 2MLGA 1IRFA 1D8KA 4CHUA 4RB0A 5EEGA 3G3ZA 4FHTA 3CUOA 4RB1A 4HX4A 4GYGA 3V4GA 4UVBA 5E8GA 5FD6A 1STZA 1ZARA 2UZKA 3TOBA 2P5LC 3KP6A 2EV6A 1I5ZA 5CVUA 4IXAA 1FT9A 4EM2A 3DPTA 3QRFF 2DFIA 2RQPA 2LF7A 1LVAA 3RJPA 1FSHA 1MGTA 3TDZC 3IKTA 5BOXA 2NNYA 2FMLA 5CLSA 2R7DA 4GXOA 3GYHX 3MAJA 2HKOA 1IXRC 3ISPA 1Z7UA 2QQ9A 4P96A 4OIQF 2Z5UA 3RI4A 2YR2A 1H9TA 4F7ZA 1Z6TA 3FMQA 5JI6A 3ZPLA 4WCGA 3EQLF 4BHBA 2CW0F 3GZ5A 5HLHA 5DD8A 5D6EA 3E6BA 1SD7A 1IF1A 2P7CB 4HA8A 3BJOA 3KP3A 4G6DA 1W7PB 1TTYA 1RI7A 4G7ZF 3WGIA 5HS9A 1O3SA 3FMRA 1ULYA 4U0WA 3EDPA 1YQAA 2P5VA 2HOEA 2PMHA 3CO7C 2MC3A 4KMFA 1K78B 1L3LA 2XVCA 1BI2A 2FOKA 1IXCA 2GA2A 2WTEA 4GO1A 3CJNA 2DK5A 4ZH4F 3MEXA 2ZNYA 3GXOA 4U88A 5JVTA 2M1BA 3Q5FA 2QENA 1U78A 4NQWA 5H20A 3DEUA 2Y48A 4KN7X 2NRAC 1JXSA 2C6YA 4ZYEA 1FLIA 2O3FA 3F8NA 4O3MA 1JE8A 2FEZA 2KJBA 3ZN0A 2IVMA 3GEZA 6PAXA 2HQNA 3R0AA 4G7OF 5JFRA 4CXFA 3KP7A 2F5DA 3GWZA 1ZRCA 3COAC 5HS8A 4IRHA 3H92A 2RKHA 4P5OA 2V1XA 5D4SA 1USTA 2QBYB 4RGUA 2ISZA 2KIUA 2PMUA 2BEOA 2EFWA 4LLNA 5CVVA 4HF0A 5E1WA 3ML6A 2XRNA 3LSTA 2YSRA 1FBUA 3SFZA 5ICGA 2FBHA 4I2OA 3GFJA 4I0AA 4B09A 1HKTA 1XGOA 2KJCA 1O3TA 3BROA 2NAZA 1FOKA 3VFZA 2L4MA 2DQRA 2IA0A 3MZYA 2Q2EA 4Y15A 5L3FA 4AVPA 2XKOA 2QQAA 4KT5C 1FYMA 4KA4A 4XRFA 2ZMEB 4UXNA 1CF7B 4P9FA 2HR3A 3W6KB 3KZYA 2Y75A 4BHCA 2EA4A 3BPXA 1FC3A 2ELHA 2G9WA 3E97A 4OINF 2ZNZA 3ROUA 1G3WA 1QNTA 1J9IA 3V8JA 2K4BA 2BV6A 4L0YB 1B9NA 3M9AA 4WF2A 5HDNA 2V79A 4KUMA 3V7SA 1IZ1A 5F64A 3DV8A 1IN6A 2JPCA 3F8FA 4BYYA 2XROA 3FXRA 1ONVA 5A2QK 1LJ9A 2TDXA 1G3TA 2H94A 3FXUA 5FB2A 2A3SA 3E5QA 2XUBA 3JW4A 2HTSA 1KQ0A 4AWXB 1H9GA 1FYKA 3K1MA 2QLZA 3I4PA 2D1HA 1ZG1A 1FBSA 2DT5A 1ZRFA 1OR7A 3M8FA 2O8XA 2YPRA 5LEJA 2Q8KA 3RKXA 4EJTA 5DUKA 4CDGA 1Y0UA 4N9HA 1FNNA 5KK1A 4HF1A 2PJPA 1B1BA 4Z2YA 4LLLA 5DCFA 2O61A 2HTJA 4HF2A 5BPIA 4JK1X 2EJRA 2H6CA 4XLPF 2KIMA 3HHHA 1SD5A 2JTVA 1D3YA 3U9GA 4HDUA 4N0BA 4XSZF 1UCRA 1ZG3A 2OZ6A 1WKMA 1IRGA 3NEUA 2D1VA 3C1DA 4HX7A 1BIAA 2FQ3A 4Q5SF 1AOYA 1XGNA 3PFIA 2DPUA 1R5HA 2M87A 4I0BA 2J5OA 1RNLA 2RDPA 1O57A 4MHGA 3TKYA 1W7PA 2W24A 1V3FA 1O7FA 2PN6A 2ZO4A 4EJVA 5LGNA 3EUHA 3ZMSA 3KZZA 4UHTA 5DCMA 2CGPA 1XCBA 3V7RA 1HW2A 1R00A 3QP5A 1D8JA 4EMSA 1JGSA 2XAGA 4JBAA 3H3ZA 4ESFA 2FBKA 1K78A 3GUDA 1SFEA 2FU4A 4ENMA 4UNOA 2FE3A 3J7AO 1Q1HA 1EH7A 2W25A 3KCCA 4ZYGA 3BJ6A 2EA2A 2K02A 4WX9A 3K1PA 1T38A 5D5VB 1PP7U 2GZWA 1UHWA 1S7AA 2P8TA 2W57A 4YFXF 1EH8A 3I64A 3U2RA 5IT3A 1BN5A 4GYIA 5H6QA 4O6JA 1IAWA 3LAJA 1PUEE 1Z1DA 4ASNA 2OBPA 2R3SA 2GXBA 5LGTA 3K1NA 2RNJA 3HRUA 2Z33A 4EJUA 2M5WA 4UV9A 3HOTA 1I6XA 4IHTA 1E2XA 2V1UA 2L4AA 2QBYA 1KQ8A 1MJ9A 4KIBA 5D8KB 4A6EA 1RZ4A 4Q47A 1X3UA 3WTXC 3ELKA 2XV4S 1OYYA 1QO0D 2EB7A 1FYLA 3F72A 5AIQA 2K7LA 2QUFA 2JZYA 1I27A 3MZHA 3L9FA 4DNCA 1W4MA 2XAJA 1MJBA 2JT1A 1JHFA 1ZYRF 1BJAA 2LDUA 3F21A 3E6DA 2FXAA 2ZXJA 3I71A 3QPTA 3JTGA 3RKWA 2PI0A 3IRRA 2K86A 1GXPA 2FA5A 3L09A 5FLXZ 1V4RA 3IHUA 2HS5A 4G7HF 4EV0A 4P9UA 2ZMEA 1J59A 1CF7A 3BJAA 1ZHFA 3ZMZA 2QZ8A 4LJZF 3FHZA 1K6OA 2FSWA 3ZN1A 2W85A 1P92A 2CFXA 2ESNA 4IPAA 2GWRA 1IN4A 3R60A 4S05A 3RYRA 3JAMK 1IN8A 3LQRA 1B4AA 1ZREA 2CO5A 2XAFA 2VT2A 1J75A 1QBJA 1YFHA 3QOPA 3N97A 3C3WA 2RN7A 1I1GA 3HSEA 4A0YA 3WG9A 1KYZA 3EYYA 4L9NA 2RV8A 3ECHA 3LA7A 1P2FA 3LWFA 5LHIA 4R8HA 5ILUA 1OMIA 2DW4A 5K5OA 3HOSA 2B0LA 2GA1A 1T39A 2GXGA 2ADUA 1FZPB 1XD7A 2EV5A 4M9SA 2JSCA 4EGYA 2H27A 1OYIA 3CUQC 3GFMA 4PCQA 3DXJF 1YS7A 2KIFA 4AIKA 1U5TC 1OPCA 3IWFA 4KFCA 5J8CA 3ABTA 1XN7A 2F5EA 5E17F 2WWYA 4HW0A 5CVRA 1T2KA 1YTYA 4KYWA 5L3CA 2DI3A 2EFQA 2MH2A 4HOBA 5L3DA 3MFKA 4OIPF 1W7PD 2LNBA 1XSXA 4WXDA 2L01A 5E18F 1QZZA 2A5YB 4FT8A 4G8XA 4MEYF 5L3GA 5LBQA 1DDNA 3E5UA 4L9JA 4A2UA 1W5SA 2OAZA 1GVJA 4LG0B 3BOQA 1F4KA 1QQIA 1S7OA 1SFXA 1P6RA 1WQ2A 3BY6A 4H0EA 3GW2A 1TW2A 2GQQA 2XGXA 3WU1B 4LK1F 5LHGA 3T8RA 4RAYA 3GO5A 1QPMA 3BP8A 5AIPA 2HDCA 1S3JA 4RGXA 1TLHB 4ESJA 3HTSB 2FF4A 2FNPA 3IC7A 3R6SA 2VE9A 5LLQA 3I5UA 3C18A 2WC2A 1ZGJA 4MTEA 4B8XA 2Z9OA 1OKRA 3FX3A 1ZAOA 3KEOA 1LEAA 2DPDA 1HQCA 2M30A 1XGSA 3HSFA 1HW5A 4LMYA 5K5RA 4RGRA 3MQ0A 2ZBKA 4QWQA 5J8FA 2HWVA 3RDIA 1XDUA 3GZ6A 1BBYA 2YU3A 1SD4A 4FX0A 2A69F 3ABUA 2V9VA 1DP7P 2UXNA 2NNNA 3SXYA 4KIGA 2FMYA 1K79A 4LK0F 4M73A 5L3BA 3GVAA 1ZRDA 1BC8C 4EGZA 5ICEA 4ESBA 1FSEA 4UVAA 5ERIA 1RIOH 1SAXA 1AWCA 3TGNA 1KU7A 4BQAA 1R22A 2MD5A 4LB6B 3K9TA 5DDGA 1HXDA 4ENJA 1K7AA 4PDKA 2Y0MA 2STWA 3FF5A 3GFIA 1YW9A 4L9VA 2WV0A 1BM9A 4FX4A 1YO5C 3T8TA 4HBLA 3SQNA 5F1RA 4KDPA 5ILSA 3I53A 4CGZA 4HYEA 5EEHA 2IT0A 1J5YA 3DPLC 5TJJA 3SZTA 4R79A 4ZYHA 1BC7C 4OU0A 4I09A 3WU0A 1KU2A 2JPBA 2P6SA 2P4WA 3GX4X 4HLYA 3TO6A 4AD9A 2KKOA 1LQ1A 5IT9K 3MCZA 1G3YA 3B73A 4I02A 4YIFA 4Y13A 3K69A 3REOA 4ZZLA 4Q48A 4MEXF 5K5QA 1ZGAA 1PDNC 1SD6A 4IF4A 3ZQ7A 5CVJA 3GF2A 3WE3A 3KETA 2OA4A 5D6FA 3JSOA 4P55A 2XAHA 2X4HA 2R7FA 1W5TA 4M6YA 1FX7A 1RUOA 4EVIA 2HGCA 3I59B 2HYGD 1G3SA 5ICFA 1KQ9A 4D0PA 2MA3A 3ZMTA
chains in the Genus database with same CATH superfamily
2QYOA 4I01A 1FP1D 2LTPA 2EBIA 1TWGJ 3D0SA 3LAPA 2E34A 2NOJB 2XAUA 2LBFA 4MTDA 3SDGA 1KA8A 4MFDA 1OQYA 5LEKA 5CKTA 1S29A 3CCQI 4EJWA 3LSIA 3OL4A 3WE2A 1JJ8C 3BQYA 1BI1A 3ULQB 1USSA 3BR5A 5JHUA 4HQMA 2DYSH 1X2MA 4G6QA 1BI0A 3RYPA 4XBFA 4GGGA 3RSNA 4XNFA 3BG3A 4QLCU 3LQQA 2M8EA 4IL6C 1E17A 4BQQA 3OSFA 3NARA 4PFOA 2EZKA 4U7BA 1RETA 4IRGA 1K6YA 1R58A 2YX4A 5J47A 3HUGA 1YIJI 2E7XA 4OMZA 4N9IA 1MMNA 3H5NA 2V7FA 1HC8A 3WTZA 3BQZA 5F27A 1XS9A 2DBBA 4LB5A 3C2GA 2OCCH 3K4JA 5CJ9A 1DPUA 4E7JA 2F5FA 1P4WA 2F2EA 1XB4A 1G4DA 2KZVA 3IH2A 2ISYA 2QKMB 3HRTA 3KX2A 3F23A 1ETXA 4ENNA 2PG4A 3ZXSA 1IUFA 1H0MA 3TO7A 3A0BC 3NRVA 5IP9J 2VBYA 4MQVA 5A2QZ 4ON0A 2L3DA 3G1MA 4RM3A 2DLLA 3DP7A 2X1DA 5H6RA 1MDMB 2R7OA 3R61A 3CJRB 2F5CA 2O6GE 3A2KA 5DV5A 3MKWB 2MD0A 3OV8A 3VYRB 5GTIC 3S2WA 3HOYJ 2P7VB 4A3EJ 2EZIA 3W6JB 2EQRA 3MZ8A 4CH7A 1LEBA 1WJ5A 2GOXB 3KEQA 3QPHA 3EETA 4BKXA 1QA6A 4CCJA 5ED4A 1RKWA 4LG0A 4MIMA 3OWTA 2XASA 3G2BA 3PL8A 5IT9Z 5HLIA 1EJ9A 2ECBA 1MD0A 1WH7A 2RC4A 4A93J 4FCYA 5FKNA 1ZTRA 2MBFA 3OYKA 4BBRJ 4JX5A 3OOPA 4M6VA 1E0EA 4IJAA 1S72I 1T98A 1WI9A 3VYUB 4HV5A 4EM0B 3S1RJ 3RCOA 3ERED 2K3PA 3R4KA 4KMUX 4C3HJ 3WGGA 4WK8F 5J1YA 1SEUA 5E20A 3BCBA 3GLLA 2ZJRF 2MABA 3CCEI 2KL4A 3ZMUA 1J0RA 3L7WA 1R36A 1GXQA 4U7DA 2UXXA 1SVMA 3I55I 3SHFA 2IRFG 3K70C 1WHUA 4XLFA 2KP6A 3VOEA 2ETHA 3JSPA 2R7WA 1BIBA 2PQ8A 1VNDA 2A68F 2KZGA 4BDZA 5FFXA 4IVNA 3WTTC 1XMAA 3Q9SA 1JHHA 2JN6A 2JA2A 3BR6A 2LH9A 3OS2A 3IAS2 1F1ZA 1XDSA 2J5PA 3K0LA 1WJCA 3S3NA 3RKYA 1TWAJ 3N4MA 2ME6A 3RPUA 3C7JA 4E6KG 1R9TJ 2VBWA 1YLFA 4HX8A 4DYRA 4B3AA 3HYIA 4F91B 1KU3A 4M71A 2UWMA 1SVOA 3G1LA 3DQVC 4UB6C 4IHWA 1TQMA 3V8KA 3PQKA 3KP2A 4PGHA 2K5CA 5IPAA 4CICA 2NVXJ 4YEJA 4RB3C 2DOAA 3EUHC 2CQKA 5E3MA 4V2FA 5K7HA 5FD5A 1APLC 5DD4A 1ZR4A 1UELB 4XORA 1CGPA 3B6CA 2VXZA 4UUVA 2ZFUA 1VQ7I 3TOAA 3HKZA 2CYYA 4A3IJ 2V6CA 3W2VA 3PO2J 2WB1N 4MNUA 1SC7A 5HOOA 1VTNC 3LOCA 3MVPA 2DA2A 4TV7A 5EGOB 1YIOA 4BXXJ 4I98B 4ZYDA 5D8LB 4EM1A 3OYFA 3ZCOA 4XKWA 2ZCWA 4JOMA 4IQJA 2MLKA 1D5VA 2QVOA 4A5NA 2ZJ2A 3CDHA 4IOAF 4Y17A 4HQEA 2AO9A 2WAQA 4G94A 3FXLA 3JRAA 1UB9A 4BAYA 3CCMI 3A0HC 4V2GA 2DAOA 1TBXA 2OU2A 1UHMA 2DCEA 2OTJI 1WRJA 3DEWA 1G2HA 3KP4A 1O3RA 4I7HA 1NHAA 1TT0A 1IDZA 3VB2A 2Q1ZB 3B02A 4M6XA 4ZTFA 3ZQIA 3LA3A 4PGGA 2QQBA 1AKHB 4L5JA 1FMWA 2LSOA 3TDUC 4RS8A 4NHJA 2Y30A 5BS6A 2MW8A 1HSTA 5FLMJ 3MD2A 1T6SA 1DQUA 3H5RA 4F52A 2VPRA 1TNTA 5IYDJ 1SAUA 3DLLF 2Y0SN 1C0WA 5D5XB 2DOFA 4BH9A 4L18B 2L9RA 5J1RA 2K4JA 2VN2A 4M74A 4XKBA 4BGDA 3HRMA 4DZPA 2IJLA 1VQ8I 1V55H 2DA5A 2IS2A 2IS1A 3VEPA 5EJCA 2BHYA 3FISA 4IX7A 4G12A 4D7NA 2XHKA 3E5XA 2O5RA 1LFPA 2O8KA 2HNHA 3KE2A 3PJRA 2X9DA 1FY7A 4M3GA 5E3LA 3CD6I 3F6OA 4QPOA 2HZDA 4LIUA 3SFIA 4XRSA 1R1TA 2DO7A 1MBFA 4O5VA 1Y1WJ 1X3WB 2K3FA 1JUSA 5C4XJ 3HHGA 2ZXIA 4W1UA 1ON1A 5IP7J 4UUTA 3V8LA 1FP2A 5LGUA 1QHGA 1YYVA 2YS9A 5J6XA 1XCVA 4CA0A 4QIWN 4HAMA 1Z21A 4YRVA 3FBNB 2GM4A 2QWWA 2XSJC 1WJAA 1QPIA 1MKMA 2CWEA 4YIIA 4DBRA 3J80K 3LNQA 3O6BB 1R23A 3GFLA 4BL0B 3F6VA 3RQIA 1HW1A 2VKVA 5BMZA 2IS6A 1VQLI 5E1ZB 2K27A 2BW3B 4CUGA 1ZH5A 3FXMA 2EV0A 4BJTA 2VC1A 2DQLA 4JX4A 4MQ9F 3S3OA 1K4TA 5IOYA 1FWZA 1WPKA 3OYJA 1JT0A 3HPHA 4BNCA 1HKSA 3LFUA 3T5XA 2LK2A 2Z99A 4B4CA 5DCMB 1B9MA 4A0XA 2EFOA 1XSVA 3UR3C 3QAHA 2L2OA 4C2MJ 3JRIA 2LF8A 1RRJA 2R5YB 3S1NJ 5LRSA 2X0LA 2ZMEC 5HS7A 2DMQA 2JMWA 4L0ZB 4Y33A 3LSKA 2L0KA 3JREA 3E6CC 4KIFA 3QYFA 1F9NA 1U2WA 2MG4A 3I59A 4BXUA 2RGVA 2H09A 2RVCA 3FXKA 4D9JA 2BGCA 2DTRA 2YU9J 2YX7A 5E79C 3A01B 1L0OC 3KFWX 4E7IA 4FE7A 3HSRA 5TRDA 1D0YA 2TCTA 1ERDA 5HNFA 1A04A 4LD5A 1QZYA 4PUSA 3QYBA 4X1EA 5F1JA 4A6DA 3L2WA 3PIPF 2DOEA 2VOOA 1LNWA 1OYWA 2VBZA 3CCVI 3H3UA 1T0FA 3H9GA 2QSHX 3QU6A 3I4MJ 1UFMA 1JKOC 2BYVE 1V5EA 2ZFWA 2NVUB 1UHSA 4OOIA 1IUYA 4E70A 3UNGC 3IV5A 2LKPA 3EUAA 1Z91A 1PP8F 4HPQA 3A02A 3OL3A 3V7CA 4II2A 3EUKL 3L2CA 1A31A 2W4SA 4LLGF 2QM3A 3JAMZ 5CQEA 1EV7A 4CYCB 4E7SA 1XSDA 3H35A 2ME0A 5D5UB 1I39A 3SEZA 2NVYJ 4E7ZA 1OCCH 4YFNF 5E1XA 1P7JA 3QU3A 5BPDA 2HEOA 2PFBA 1IC8A 2VC0A 2F5VA 3QP6A 4EQQA 1BR1A 3BPVA 1R7JA 2OZUA 2LG4A 2QQ8A 3Q9VA 4E7LA 3RZDJ 1YG2A 3E6MA 5BQTA 3M1EA 1I1SA 1U6GA 4Q4ZF 1SVLA 1R6RA 5BNGA 3H0DA 1OLTA 2KRFA 2E1NA 3KPHA 5J1UA 4YG2F 2IW5A 2L7KA 2MGQA 2QKLB 2QGUA 1FMVA 2IA2A 3M8JA 2DODA 5F08A 4WWCA 1MDMA 1S5LC 2DU9A 3CUQB 3DBHB 2CUJA 3TBIA 3T0YA 2IA1A 2K9QA 1FPQA 4A12A 2M7AA 4CZZA 5B1BH 3RPQA 2R7ZJ 2L54A 2HFHA 1U5TB 3LA2A 5ILVA 5KHDA 2F4IA 4NNJA 5F6FA 3GTJJ 2NVTJ 4Y7NJ 4A5MA 4AVZA 2Q0OA 2M45A 1IW7F 3O2PE 1E3OC 3O3KA 3JRGA 3J80Z 3I54A 2A6EF 1QGPA 3F22A 1REPC 1A6IA 3C2BA 3RPUD 4A3DJ 2GIZA 2L9NA 4HLXA 4LGWA 2VBXA 1BI3A 3AG1H 2ZSHB 1F36A 5JLWA 1MMAA 3BZKA 2IGNA 1MZBA 1ETVA 2DTZA 1I6HJ 3WTSC 2VL8A 3FWEA 1OCTC 4RB2C 3G4SI 4ZDLA 1EKEA 1TNSA 4DQ2A 1W0TA 3RIRA 2H8WA 3WTVC 4M9XA 4MGRA 3J81K 1IN7A 4CCOA 3MKYB 3G73A 3IKVA 2LYCA 1JI8A 4FQGA 4LG3A 1J2XA 1X19A 1ZKGA 2IGMA 4XLNF 1K61A 2VT3A 2IPQX 2IP2A 1B6AA 1P7IA 2IBDA 4XOPA 2A07F 5FFZA 1TQPA 5HDKA 1ZG5A 3HL2A 3FMSA 1WCMJ 2ZKZA 5D4RA 2JRMA 2L7ZA 4XKCA 1S6LA 2STTA 1LDDA 5K1YA 1E3PA 5M5YJ 1ETOA 4XRMA 2HZTA 3W6VA 2CSOA 2E7WA 5LRRA 1HBXG 2K9SA 1HSJA 5HDGA 1T56A 1HKQA 2M0CA 3CLOA 4XM3A 4UV8A 3CCRI 2BXZA 5CVIA 1NH3A 3L2UA 1H8AC 5E8IA 4AIJA 3KZIC 4II3A 1VQKI 4XSXF 4XR6A 1U8RA 3L00A 5JR3A 1GHCA 3HC7A 3F8MA 1EF4A 2A6HF 2PEXA 4J00A 5FRNA 2K9MA 2CW8A 3SZPA 1RUNA 4BS9A 1IG7A 1FIAA 3U1DA 2L02A 4XLHA 3GLXA 3M8EA 2KFDA 5D5WB 2KLOA 2LC2A 3MWMA 2BVMA 3ABLH 1YW8A 3VODA 2H6BA 1R1VA 3F3XA 1LFBA 5EGOA 2FNAA 3EYIA 1J7KA 2W00A 5EZHA 3K2AA 1YJWI 3K6GA 4Y4RA 1Y1VJ 1JT6A 1XMKA 1MJAA 2RAEA 1U9OA 3MKZA 2FD5A 2PBIA 1M1EB 4EJOA 4M9ZA 1SFOJ 4HNTA 2QA4I 2DK8A 2G7HA 2XIGA 3R0JA 4YFKF 2R93J 1MMSA 3DPUA 1JKRC 2O03A 4D1QA 2MH9A 5F0HA 3F8BA 3WTYC 1T8IA 4PSWA 4KN4X 2W84A 5JVGF 2AS5F 4HV6A 1RR7A 2A61A 2BHZA 2KHMA 2P5KA 2XF5A 2Z16A 3IWZA 1W36D 1O3QA 3H9QA 3BWGA 4RLFA 1IN5A 2A05A 1ZN2A 5HODA 2GLOA 3BCAA 1DU6A 4F93B 2JA5J 2FBIA 2OCEA 1ACIA 3ZMTA 5L3EA 1LB2A 1I3AA 3SZGA 1AKHA 3WTWC 3VWBA 3IL2A 2D45A 3P9KA 1MNDA 2VJ5A 3BT9A 1DP3A 2W7NA 2HVQA 2ESHA 5FGMA 2OQGA 3CC2I 5EYRA 4NB5A 3KLNA 3PSIA 3WGHA 4IHSA 1SMYF 2JSPA 2LKXA 2E19A 2Z3YA 3JRFA 1SFUA 3BTJA 3IH4A 3FM5A 3I9V2 1V5GA 2VONA 5CQGA 2HOSA 2X1EA 4XMYA 2NS0A 1Z9CA 2CUEA 3ZMVA 2A6TA 1NTCA 3KLOA 1Z05A 4ENKA 2DMPA 1YW7A 1ZLJA 2COBA 2L7FP 2V26A 3HTUA 3TO9A 4BEHB 1YJNI 4A0ZA 3ZQGA 5EF6A 2BE5F 3KP5A 5CYVA 3JTHA 2AXLA 3HOUJ 3S1QJ 1QVUA 2FJ1A 4CYDA 2HQ5A 3KIOA 1Z3YA 4KNYA 2L9SA 4NQWB 4H4KC 2NYXA 1KYWA 1TQIA 3I58A 2HQRA 2JWTA 3CF5F 1KGSA 4D7MA 2E5ZA 4L5IA 3J81Z 1H88C 1BOAA 2GIVA 4I6ZA 2H1LA 4WXCA 3SDBA 4A3KJ 3CF2A 3PSFA 4OIOF 2KDOA 2VJIA 3WHCA 4U0YA 3U21A 3CTAA 3BZ6A 3AAFA 3CMEI 1KONA 2X1CA 3FBIB 4ETSA 1LDJA 2BBYA 4RBOA 1IXSB 4J19A 1U9NA 4OIRF 3TMOA 4AIHA 2HYFA 1R4NB 1WSUA 4KICA 2W82A 1MSFC 1VQ5I 2DFEA 4BE1A 3JRDA 2XB5A 3QOEA 3HOVJ 2BW3A 1R5GA 2ZSIB 3CQZJ 3ECOA 3T1BA 2KMUA 3LFKA 4IRIA 2PX9A 2QSGX 2GAUA 1MNEA 3LSGA 2VQHA 1R1UA 4RLQA 2BY0A 1S8NA 5FO5A 4LFUA 5ICCA 2X48A 3OIPA 4GCVA 5FLXK 1GLNA 5KVRA 2ZJPF 1XX5A 1YX3A 2VASA 2HDDA 2R4GA 4HRIA 2NVQJ 3CO6C 2R5YA 4K2EA 4PZJA 4BU2A 2EFPA 4HZFA 3TQNA 3S1MJ 4DZJA 4BJ5C 3OMYA 2V9PA 1O7LA 1BW5A 1EH6A 5IP6A 1IJWC 4FISA 1FOWA 2N8GA 3CP8A 3LSRA 1DPRA 2JK3A 3DKWA 3DKYA 4U0VA 1YI2I 3A01A 1ZQ3P 2ID6A 3PUBA 1QHHD 3GCMA 3IRQA 5LHHA 4R1HA 2PLYA 2L7MP 2ACJA 3GTOJ 1YS6A 3FM3A 4BQOA 1U3EM 1FBQA 2XF6A 1X4PA 3DFGA 2COMA 3WTUC 1O4XA 3HRSA 2XKPA 1ODDA 3I0TA 1YJ9I 4HDVA 3JRBA 2VPLA 2XAQA 2OQRA 1FIPA 5J4YA 2CV0A 1Z6RA 1OCRH 2MYSA 3WG7H 4DYCA 2EWNA 1RKTA 3HOWJ 4FASD 3BZCA 4A3JJ 1DUXC 4IHXA 4S04A 4IHYA 3ZR8X 4G9YA 2R7VA 3OS0A 4CYCA 4L9TA 5DYMA 2GOMA 2EK5A 2Q2EB 3ZQLA 1X3ZB 3E0JB 3BG5A 1YE9A 2G7UA 3GTGJ 3AKZA 1F5TA 1X58A 3PNVA 3ZRGA 1VQPI 1G6NA 2O0YA 3ZQCA 1ON2A 1P4AA 2NS7A 4RAZA 2P6TA 3HIFA 3OYNA 1SMTA 3AG3H 4WXHA 3BDDA 1WWXA 2DN0A 4BQNA 4OMYA 3FXQA 2DMUA 4BJ6C 2VOPA 1A6QA 4FTHA 1TW3A 3QWLA 4JP0A 4NC8A 4XL9A 2D2WA 3ZP5A 2M4GA 5DEQA 3DF8A 2HKXA 2E5NA 4DOZA 2VODA 3M3YJ 2IGOA 4A3CJ 1RESA 3RKQA 3FZVA 1K4SA 4NC6A 3CUQA 3P9CA 3JRHA 3P7NA 3OSGA 5GAGJ 2CRGA 3RTRA 5AONA 1B59A 3WODF 3P9IA 4RGSA 1WGXA 1LDKB 3K4NA 3FXJA 4I99C 4OWRB 1KU9A 1U5TA 1P4XA 4M72A 5CPRB 4Y52J 1ZLKA 4ZZDA 1XGMA 3D5LA 2R7RA 1G59A 4JQFA 3ZMDA 1WZ2A 3K2ZA 2VE8A 3M7GA 4BHPA 2VUMJ 2JRTA 3PUFA 2HVRA 2PJRB 2V1DA 3K10A 1ETYA 5FJ8J 5HLGA 3OR1C 5DUIA 3BTCA 2FRHA 1BR2A 1D1CA 2OD5A 3NQOA 2EFNA 4UVCA 2BY1A 3E3VA 3TP3A 2OPTA 3HDDA 1N25A 4CO8A 5HVQC 2FQ4A 3F8CA 3MMYB 4E4HA 2E1CA 2F4OB 3PQJA 2MLGA 2CJJA 1IRFA 1S9HA 3GTQJ 2K9NA 3Q0UA 1QVTA 2WAQN 2AQEA 4HNUA 5HNHA 1D8KA 4CHUA 4RB0A 5EEGA 3ZQFA 4X0GA 4EATA 1VF9A 1BR4A 3G3ZA 4FHTA 3X2QH 2ZJQF 5KNLA 3CUOA 3FXOA 4RB1A 2R7SA 2IGKA 4HX4A 4PJMA 4GYGA 1WH5A 1DGRM 1A35A 2E35A 2Y2ZA 5B66C 3V4GA 4UVBA 3DWLE 5E8GA 3FHNA 2E2HJ 2XF7A 5FD6A 1STZA 1ZARA 2UZKA 3TOBA 2P5LC 3KP6A 2EV6A 2CFOA 4XLAA 1I5ZA 3ZGKA 4A69C 5CVUA 2E2JJ 4IXAA 2XGDA 1FT9A 4EM2A 3DPTA 1FOYA 3QRFF 4FE4A 2K9LA 2DFIA 2E2IJ 1NK3P 2RQPA 1U8BA 2LF7A 1LVAA 4M3EA 4QTRA 3RJPA 3BR2A 1FSHA 1MGTA 3TDZC 2ZB9A 3IKTA 5BOXA 3K4KA 2E36A 1WJBA 2NNYA 1MBGA 2FMLA 5CLSA 2R7DA 3W2AA 3OR2C 4GXOA 3GYHX 4OAYA 3MAJA 2HKOA 3CLQA 3CESA 1PYVA 1T95A 1IXRC 3ISPA 1Z7UA 4AU7A 4HNVA 2QQ9A 4P96A 2CMPA 5C3EJ 4OIQF 4B48A 2Z5UA 3DTEA 3RI4A 1VQMI 1AHDP 2YR2A 1H9TA 2LOOA 4F7ZA 2IEKA 1Z6TA 2CUFA 2UV1A 3FMQA 5JI6A 3ZPLA 2X6OA 4WCGA 3EQLF 2XPVA 3FKIJ 4BHBA 5EDNA 3OYGA 2Y69H 3Q3SA 2CW0F 3GZ5A 2HOTA 5HLHA 5DD8A 1Y8RB 4C2UA 5D6EA 3E6BA 3WHBA 2B9SA 1HDDC 1SD7A 1IF1A 2P7CB 4HA8A 3BJOA 1BOBA 5J40A 3BTLA 4C9YA 2OTLI 3KP3A 4G6DA 1Y39A 2XPWA 1GT0C 4PJNA 5GAHJ 1ETKA 1W7PB 5C44J 1TTYA 1RI7A 4G7ZF 1I3QJ 2CQXA 3QPLA 4IHVA 3IH3A 3S14J 2NOGA 3WGIA 5HS9A 1VQ6I 1ORKA 1O3SA 3LSPA 3FMRA 3ASOH 1ULYA 4U0WA 3EDPA 1YQAA 2CH0A 2P5VA 2E1MC 2HOEA 4DJAA 5B3SH 1TZLA 2PMHA 3TW6A 3CO7C 1HOMA 1A5JA 2MC3A 4GDFA 4KMFA 5F04A 1K78B 1FJLA 5K7ZA 1L3LA 2XVCA 1BI2A 4B47A 1MMDA 2FOKA 1IXCA 2GA2A 1BJZA 5J4VA 2OUMA 2WTEA 2HDWA 5M5XJ 3FKJA 4GO1A 1XC5A 1Q1VA 3CJNA 2LMDA 3K4MA 4BEHA 3ONQA 2DK5A 4ZH4F 3MEXA 2D5VA 2ZNYA 3GXOA 4U88A 3HGGA 5JVTA 2E71A 2M1BA 3RZOJ 3IUOA 4KITB 3BR3A 3Q5FA 4ZYAA 1MBJA 2QENA 4M3DA 1U78A 4NQWA 5H20A 5FKOA 2R0QC 5F0FA 1MBEA 1Y0NA 3DEUA 3H36A 2ZXWH 3AFHA 2Y48A 4KN7X 2NRAC 1JXSA 3OYAA 4JYKA 3GBGA 4B43A 2JQ7A 2DDBA 4ZYEA 2C6YA 1FLIA 2O3FA 3F8NA 3Q0WA 4O3MA 1JE8A 2UUZA 4IQ4A 3CDIA 2OJED 2FEZA 2I5UA 2KJBA 2X51A 1WI3A 3ZN0A 2IVMA 3GEZA 6PAXA 1J09A 1B72B 2Y31A 2HQNA 3R0AA 4G7OF 1UAAA 2DA1A 2E1OA 5JFRA 4CXFA 2NS8A 3KP7A 2HPMA 2F5DA 3GWZA 4I76A 3COAC 1ZRCA 3OYHA 5HS8A 1W36C 4IRHA 1QRYA 2LLKA 2MFZA 5KAIC 2VQGA 3H92A 2RKHA 4P5OA 2EIKH 1X4OA 2V1XA 4RAGA 1USTA 3OIOA 5D4SA 4UY8I 2QBYB 4RGUA 2JA6J 2ISZA 5FROA 2KIUA 2PMUA 3BC8A 2BEOA 4C2TA 4GRIA 5M3FJ 2EFWA 2YUSA 4LLNA 2DFFA 5CVVA 4HF0A 3DBLB 1TL8A 2WADA 5E1WA 4KISA 3PIOF 3ML6A 3ZQQA 2XRNA 3HXLA 1IRZA 2EZHA 4S0HB 3DEEA 4NBQA 4B44A 3LSTA 2YSRA 3GMEA 2EIMH 1H89C 1FBUA 3CCLI 2AQFA 1R49A 3S17J 3SFZA 5ICGA 2FBHA 4I2OA 3GFJA 3PNYA 4I0AA 4B09A 1FTZA 1HKTA 4AUXA 1XGOA 2KJCA 3L2VA 4LIVA 1PUFB 2KDZA 4BY1J 2IXSA 2XB0X 3SYTA 3CCSI 1O3TA 2KISA 2VJJA 3BROA 1MH4A 2NAZA 1FOKA 4DIQA 3AL0C 2LKSA 3VFZA 2L4MA 2DQRA 4HSRA 1OCZH 2IA0A 4XN3A 3MZYA 4NUBA 2Q2EA 3OYEA 2M7BA 4IEJA 5FRMA 4Y15A 5L3FA 4AVPA 4IO9F 2HQAA 4AC0A 1ZGWA 1LKXA 2RQQA 2QQAA 2XKOA 5J3LA 4MLOA 4KT5C 2DFHA 2M9HA 1FYMA 1B8IB 4KA4A 4XRFA 2ZMEB 3CCJI 4UXNA 4JX6A 2K85A 1CF7B 1ETWA 3HOZJ 4P9FA 2HR3A 3W6KB 4PJJA 3KZYA 2Y75A 4BHCA 4BBSJ 2EA4A 3BPXA 2XGCA 1FC3A 1FTTA 2ELHA 3RQ4A 2G9WA 1T0FC 2QSFX 3E97A 1X1PA 5GADJ 2XC7A 1W5CC 4OINF 2LREA 2ZNZA 1YITI 3H0GJ 3ROUA 1G3WA 3HB9A 4A3BJ 2R7UA 1QNTA 3H9JA 1IO2A 1WFXA 1J9IA 1X1AA 3V8JA 2W48A 5DS9A 1SANA 5IYCJ 2V9KA 2K4BA 2BV6A 4L0YB 1B9NA 2VKDA 3M9AA 4WF2A 3TEDA 3GTMJ 3VYTB 1QZEA 5HDNA 2PJRA 2V79A 4KUMA 3IAM2 4B1RA 3V7SA 1IZ1A 2JUCA 5F64A 3DV8A 4BDYA 4IOCF 1IN6A 2JPCA 5LD2C 4P1WA 2XGEA 1NK2P 1P9QC 2W1OA 3F8FA 4BYYA 2M4KA 2XROA 2VJ4A 3FXRA 1ONVA 5A2QK 4YIRX 1MSEC 1LJ9A 2DA3A 2TDXA 1G3TA 1FEXA 2H94A 3AG2H 3FXUA 3LSHA 3Q0VA 4M3FA 5FB2A 1XMXA 2A3SA 3J7AY 3E5QA 2V6EA 3L2RA 2XUBA 3JW4A 2HTSA 2ZXHA 4C3IJ 1KQ0A 2KQRA 1SFKA 1W0UA 4AWXB 1H9GA 4AIDA 1FYKA 3K1MA 1HA8A 3OYIA 2QLZA 4V19K 3DU5A 2M34A 3I4PA 2D1HA 2PMZA 4AYBA 1ZG1A 1FBSA 2DT5A 4UB8C 1ZRFA 1OR7A 2KRHA 2VKEA 3M8FA 2O8XA 3S3MA 2QCOA 1X1CA 3A4CA 2YPRA 5LEJA 5F0CA 2Q8KA 2X6XA 3RKXA 4EJTA 1MMGA 1Z67A 5DUKA 4IKFA 4CDGA 1Y0UA 1IV8A 4N9HA 1FNNA 5KK1A 4HF1A 2PJPA 3M4OJ 1B1BA 4Z2YA 4LLLA 5DCFA 1POGA 2O61A 1EA3A 2HTJA 4RDUA 4HF2A 1HDPA 1NG7A 5BPIA 4JK1X 4XONA 2EJRA 1VQ4I 2H6CA 4Z6YA 1GUUA 4XLPF 4PJLA 2KIMA 5EG0B 3HHHA 3OIQA 1SD5A 2JTVA 1D3YA 3QYEA 1JJ6C 2DMTA 3U9GA 2I10A 4HDUA 4C3JJ 4N0BA 3NWSA 1UCRA 4XSZF 1CQTA 1AU7A 5IY5H 1ZG3A 1LUJB 1RC9A 1JTXA 2KPMA 2OZ6A 1WKMA 1IRGA 4BE2A 3NEUA 3ZQHA 2D1VA 3C1DA 1GDTA 2IAIA 4HX7A 3GZNB 1BIAA 2FQ3A 5FKLA 4F92B 4Q5SF 3K4LA 1AOYA 1TWHJ 1XGNA 2IS4A 2CW7A 3PFIA 2DPUA 1R5HA 2M87A 1T08B 3DKXA 4ANJA 4I0BA 3J7ZI 2J5OA 1RNLA 2RDPA 1O57A 2EILH 4MHGA 2LY9A 4X6AJ 4PJ0C 3TKYA 1W7PA 2W24A 3BG6A 3OOUA 2CS3A 2HXOA 1V3FA 1O7FA 3HM5A 2PN6A 2ZO4A 4EJVA 5LGNA 3EUHA 2MSYA 2OF7A 2ELKA 3ZMSA 3KZZA 4UHTA 3HJEA 5DCMA 3SEQA 1XCBA 3V7RA 2CGPA 4DW6A 1HW2A 1R00A 3QP5A 4D5FA 3VDXA 2ZC2A 1D8JA 5GP9A 3P5JA 4EMSA 1DU0A 1FOXA 1DGWY 3S2HJ 1JGSA 2XAGA 2LP0A 4JBAA 3H3ZA 3O8HA 2FBKA 4ESFA 2QEXI 2DDAA 4CCKA 2FX0A 1K78A 1ENHA 4Y3OA 3W2WA 3GUDA 4UUSB 1SFEA 2F6CA 1WVRA 2FU4A 4ENMA 4B3XA 4UNOA 1VZ0A 2FE3A 3J7AO 4CCMA 5JHFA 2M8GX 5C4JJ 1Q1HA 1EH7A 1HLVA 2W25A 1YHQI 4PSXA 3KCCA 4ZYGA 2WAEA 3BJ6A 4U87A 2EA2A 2K02A 3HEFA 4WX9A 3B6AA 3K1PA 1T38A 2CQ7A 3FDYA 5D5VB 1PP7U 2HXIA 2R5ZB 2GZWA 1UHWA 1S7AA 2AHQA 1UJ8A 2P8TA 2W57A 3K4BA 4EEFG 4YFXF 1EH8A 3I64A 5E3OA 3U2RA 2CQQA 2FOWA 2DT6A 2LRDA 5IT3A 1OR7C 3HOXJ 1BN5A 4GYIA 1Z3XA 5H6QA 4O6JA 3CCYA 1R71A 1GVDA 1IAWA 2GBYA 3WU2C 3LAJA 1HF0A 1PUEE 5H2FC 4ZJZA 5M3MJ 3CMAI 1Z1DA 4ASNA 2OBPA 2R3SA 3IP4B 2GXBA 1B72A 5LGTA 4BXFA 3K1NA 4KT6A 2RNJA 1WJFA 1TP4A 1X2NA 3HRUA 1JKPC 1IDYA 2Z33A 4EJUA 9ANTA 2VI6A 1JTYA 2M5WA 4UV9A 1MNMC 4BACA 3HOTA 3E1SA 1YX5A 5KAFC 1I6XA 4IHTA 2O7OA 1E2XA 3ABKH 2BVLA 5GAEJ 1UMQA 5IYBJ 2V1UA 2X85A 4DYQA 1G8XA 2XRLA 1NG6A 3S2DJ 2L4AA 2V1NA 5B5EC 2QBYA 1KQ8A 4YELA 1MJ9A 4KIBA 1K83J 5D8KB 2ICWG 4A6EA 1RZ4A 2K40A 4Q47A 1TC3C 1VQ9I 1X3UA 1LE8B 3C2HA 3WTXC 4LITA 3ELKA 2XV4S 1MBHA 1OYYA 1UG0A 3A1YA 3TW7A 1QO0D 1S7EA 2EB7A 1FYLA 3F72A 2LD5A 5AIQA 4XQFA 4CCLA 3FK6A 4C30A 2K7LA 3N05A 2QUFA 3BG9A 2JZYA 5EEAA 5DM6F 1I27A 3MZHA 3L9FA 1XG1A 5HLTA 4E7KA 2BOLA 4DNCA 1W4MA 2XAJA 1MJBA 2JT1A 1I50J 3HKZN 5TISC 4E7HA 1V5FA 1JHFA 2BY3A 1ZYRF 1PUFA 1Z77A 2EINH 1BJAA 2LDUA 3PO3J 3F21A 3E6DA 2DYRH 2FXAA 2VKHA 2ZXJA 1YRNB 2WB1A 3I71A 3QPTA 3JTGA 4XN0A 3RKWA 4L5EA 1D0ZA 1VQOI 3CP2A 2PI0A 3IRRA 3JCUC 5TGTA 2K86A 1WJEA 2BXYA 2FA5A 2XPUA 3AG4H 3L09A 5EZGA 1V4RA 3IHUA 3PM1A 5FLXZ 1R4MB 1XTAA 2HS5A 3I3LA 2XDVA 1PVEA 3L2QA 5M5WJ 4EV0A 4P9UA 2ZMEA 4G7HF 1B8IA 1J59A 1WJDA 1CF7A 2DA6A 3F9KA 3BJAA 2WY8Q 1ZHFA 4RMNA 4ZTJA 3S93A 2QZ8A 3ZMZA 4HEA2 2I8DA 4LJZF 3FHZA 1K6OA 2P81A 3HZJA 2FSWA 3ZN1A 2W85A 1P92A 2CFXA 2JJ7A 3UKGA 1N77A 4ZC3A 2ESNA 4IPAA 3VSLA 3OYDA 2GWRA 1OCPA 2EZLA 4A3GJ 1ZK8A 2F48A 1IN4A 4ITVA 2M0MA 3MKLA 3R60A 4XLEA 5DM7F 3KYCB 4S05A 2H8RA 3CZ6A 3RYRA 3JAMK 2ID3A 1IN8A 1Y8QB 3LQRA 2R92J 3CDLA 1B4AA 1ZREA 2CO5A 3KYDB 1YOVB 2XAFA 3PFYA 2VLAA 2VT2A 1J75A 1QBJA 5JLXA 2HPIA 4XRSG 1GV2A 2Y0SA 3CJQB 3I56I 1YFHA 1MW7A 1JUMA 4A3LJ 2KIQA 3D5SC 3QOPA 3N97A 3C3WA 4DBQA 2RN7A 1IV6A 2P0WA 1I1GA 3HSEA 4A0YA 3WG9A 2H1KA 1JKQC 1KYZA 3EYYA 2DA4A 4AM3A 2CU7A 3F0CA 4L9NA 2RV8A 3ECHA 3LA7A 1P2FA 3LWFA 5LHIA 1HCRA 1IRXA 4R8HA 5ILUA 2QF7A 5GPAA 2L9VA 1OFCX 1OMIA 4MO7A 2DW4A 2LBFB 4XKVA 5K5OA 3HOSA 2B0LA 2GA1A 1T39A 2GXGA 4LOCA 2ADUA 1Z0XA 1FZPB 1XD7A 2RREA 3U1KA 2EV5A 2ECCA 2JUGA 4KJZA 4M9SA 2JSCA 3D1NI 4EGYA 1OYIA 3CUQC 3GFMA 2H27A 4PCQA 3DBRB 4RAFA 3DXJF 1TT5B 3JR9A 1YS7A 2CV1A 2KIFA 4RM2A 4AIKA 1U5TC 5GTHC 3NAUA 1OPCA 3IWFA 2NXNB 4KFCA 1Y56A 3OY9A 5J8CA 2E60A 3S16J 4HSTA 1Z7LA 3FK7A 3K70D 2A5WA 3ABTA 1XN7A 1LPQA 1MH3A 2F5EA 3SJMA 2WA0A 3HUGB 5E17F 2WWYA 4HW0A 5CVRA 1D1AA 1T2KA 1YTYA 4ZDOA 1ITYA 4KYWA 5L3CA 2DI3A 2EFQA 3GTPJ 3GTLJ 1VI0A 4CSWA 2MH2A 4HOBA 5L3DA 3D5RC 3MFKA 4OIPF 2Z2SB 1QU3A 1V54H 5K7FA 3DU6A 2RNGA 1JUPA 1W7PD 3VPRA 2LNBA 1ETQA 5FKKA 2WBMA 2WAFA 1XSXA 2DXIA 4WXDA 2L01A 2LY1A 3CMMA 1OISA 1QZZA 3HG9A 2A5YB 3S8PA 5E18F 1JGGA 2DMNA 4XOTA 2B7EA 4FT8A 5EG0A 3ZOBA 4G8XA 4MEYF 2XSDC 5L3GA 5LBQA 1DDNA 1BL0A 3OYMA 3E5UA 4L9JA 2BZTA 4A2UA 3LL7A 1MBKA 3J7YJ 1W5SA 2OAZA 1GVJA 1MIJA 4LG0B 3BOQA 3NWTA 2HYJA 1F4KA 1QQIA 3EPZA 3OYBA 1S7OA 4CCNA 1SFXA 4XK4A 1P6RA 1WQ2A 3BY6A 4H0EA 3GW2A 2VXDA 5LFAA 3G1OA 1TW2A 2GQQA 2XGXA 1N78A 5FKMA 3WU1B 4LK1F 2O9LA 5LHGA 3T8RA 2HOAA 2X6YA 4RAYA 3GO5A 4DGWB 1QPMA 3BP8A 5AIPA 4FETA 2HDCA 1S3JA 4RGXA 1TLHB 4N4NB 4ESJA 4MFEA 2OV7A 3HTSB 2FF4A 2FNPA 3IC7A 3L1PA 3R6SA 2LFBA 2JA8J 2VE9A 3QODA 5LLQA 4J01A 3I5UA 1D1BA 2EIJH 3E7LA 3KYLA 2LVSA 3CMYA 4BUPA 3C18A 2WC2A 1ZGJA 3BTIA 2Y9YA 3ASNH 4RA2A 4MTEA 3M1CA 1OCOH 4B8XA 2MC4A 4UUSA 2Z9OA 2VQLA 3BLYA 1OKRA 3FX3A 3M07A 4BY7J 4N4OB 4NDLA 1ZAOA 3KEOA 5IOZA 3H3VK 1LEAA 2DPDA 1HQCA 2M30A 2GXAA 1XGSA 2FUG2 4GFBA 2EPFA 3HSFA 1XPXA 4W97A 2R5ZA 1HW5A 4LMYA 5K5RA 2DJIA 4RGRA 3TL4X 3O8GA 3G71I 3MQ0A 1UG2A 2ZBKA 4QPQA 2HVSA 2WV1A 3VYSB 1ZELA 4QWQA 3K7AJ 1Y6IA 3ESWB 1PJRA 3DCFA 3FIWA 5J8FA 2HWVA 3RDIA 2L5QA 1XDUA 3S32A 3GZ6A 1BBYA 2YU3A 3BR0A 1SD4A 3OYCA 4FX0A 2A69F 2E1MB 2EH3A 3ABUA 1A36A 2V9VA 2JVHA 1DP7P 1TWCJ 5GPCA 2UXNA 2NNNA 3V42A 3SXYA 2JA7J 4A3MJ 5DTDA 3A03A 1N75A 4KIGA 4XLCA 4ZDPA 4CZCA 2FMYA 1K79A 3KEYA 2HU9A 4LK0F 4M73A 4G6TB 5B1AH 5L3BA 3GVAA 1ZRDA 1BC8C 3DTIA 1IGNA 4PK4A 4IZZA 4EGZA 5ICEA 4ESBA 2ELJA 1LE8A 1R5ID 1FSEA 3LSMA 4UVAA 2DJNA 5ERIA 1RIOH 1SAXA 1X1DA 2M3AA 2VIXA 1AWCA 3TGNA 1KU7A 5E3NA 2CUZA 3HBLA 1W1WE 2OC6A 1LFUP 4BQAA 1R22A 2MD5A 4LB6B 5KCMA 3K9TA 5DDGA 1HXDA 2LY2A 5FLVA 4ENJA 1K7AA 1OJLA 4PDKA 2Y0MA 2STWA 2F4MB 3FF5A 3GFIA 2R7TA 3QQAA 4OAZA 3OS1A 3CCUI 1YW9A 2Z1DA 4L9VA 2VQCA 1GV5A 2TRTA 2R7XA 2WV0A 1AA7A 1BM9A 1X1BA 3LSJA 3GTKJ 3I4NJ 3OYLA 4FX4A 1YO5C 3T8TA 4HBLA 3SQNA 4XICA 5F1RA 1U0JA 1ZR2A 3PNTA 1YRNA 4KDPA 5ILSA 1RR8C 3I53A 4CGZA 3LMMA 4HYEA 5EEHA 4BE0A 2IT0A 1J5YA 3BR1A 3CJTB 3DPLC 5TJJA 3SZTA 4R79A 4ZYHA 4XIDA 1BC7C 4D5CA 3CC7I 2B63J 3DLAA 4OU0A 3BG7A 1D5YA 4I09A 3ABMH 3WU0A 1KU2A 2R7QA 2JPBA 2P6SA 2P4WA 1RPWA 3HGYA 2DA7A 1VQNI 3GX4X 4HLYA 4ABZA 3ERMA 3TO6A 1D0XA 4AD9A 2KKOA 1LQ1A 1GXPA 3HPGA 5IT9K 3MCZA 2X6WA 1G3YA 2WY7Q 3B73A 4I02A 1BA5A 4YIFA 2PMZN 4AYBN 2CV2A 4Y13A 4F55A 2CQNA 2KT0A 2LR8A 3K69A 3REOA 4ZZLA 2BY2A 1T33A 2G0EA 3QPSA 4HG2A 4Q48A 5K5QA 4MEXF 1LVKA 2DT7B 1ZGAA 2JVGA 2M2EA 1PDNC 3H5AA 1SD6A 3H1CA 1E3HA 4IF4A 3ZQ7A 3MN2A 5CVJA 3VSKA 3GF2A 4F3QA 3DTKA 4QSHA 3JRCA 2V4JC 3WE3A 3G6EI 2Y9ZA 3KETA 3AL0B 4M3BA 2OA4A 4A3FJ 5D6FA 3JSOA 4P55A 3CC4I 2XAHA 1KZHA 2X4HA 2KRCA 1W5TA 2R7FA 3K4CA 4PFPA 4M6YA 1TWFJ 2HI3A 1FX7A 2VB6A 1F43A 1VFCA 1RUOA 3W3CA 4NC7A 1UZCA 2HGCA 3I59B 2HYGD 4EVIA 1G3SA 3TP0A 5ICFA 1KQ9A 4D0PA 1BW6A 2AXTC 2MA3A 3S15J 2CG4A
chains in the Genus database with same CATH topology
2QYOA 4I01A 1FP1D 3D0SA 3LAPA 4MTDA 1KA8A 5LEKA 1S29A 4EJWA 3WE2A 1BI1A 3ULQB 1USSA 5JHUA 4HQMA 4G6QA 1BI0A 3RYPA 4XBFA 4GGGA 4QLCU 3LQQA 2M8EA 1E17A 4U7BA 4IRGA 1R58A 2YX4A 3HUGA 2E7XA 4OMZA 4N9IA 3WTZA 2DBBA 4LB5A 5CJ9A 1DPUA 2F5FA 1P4WA 2F2EA 1XB4A 1G4DA 2ISYA 3HRTA 3F23A 4ENNA 2PG4A 1H0MA 3TO7A 3NRVA 2VBYA 4MQVA 5A2QZ 4ON0A 2L3DA 2DLLA 3DP7A 5H6RA 1MDMB 3R61A 2F5CA 2O6GE 5DV5A 3OV8A 3S2WA 2P7VB 3W6JB 1LEBA 3QPHA 3KEQA 3EETA 5ED4A 4LG0A 2XASA 5IT9Z 5HLIA 1MD0A 2RC4A 2MBFA 3OOPA 4IJAA 1T98A 1WI9A 4EM0B 4HV5A 3ERED 3R4KA 4KMUX 3WGGA 4WK8F 5E20A 3ZMUA 1J0RA 3L7WA 1R36A 1GXQA 4U7DA 2UXXA 3SHFA 2IRFG 3JSPA 3VOEA 2ETHA 1BIBA 2PQ8A 2A68F 5FFXA 4IVNA 3WTTC 1XMAA 3Q9SA 1JHHA 1F1ZA 1XDSA 2J5PA 3K0LA 3RKYA 3N4MA 3RPUA 3C7JA 2VBWA 1YLFA 4HX8A 3HYIA 1KU3A 4M71A 2UWMA 3DQVC 1TQMA 3V8KA 3PQKA 3KP2A 4PGHA 4CICA 4RB3C 2CQKA 5FD5A 5DD4A 1CGPA 2VXZA 4UUVA 3TOAA 2CYYA 2V6CA 4MNUA 5HOOA 1VTNC 4TV7A 1YIOA 4I98B 4ZYDA 5D8LB 4EM1A 2ZCWA 2MLKA 1D5VA 2QVOA 4A5NA 2ZJ2A 3CDHA 4Y17A 4HQEA 4G94A 1UB9A 4BAYA 2DAOA 1TBXA 2OU2A 1UHMA 1WRJA 3KP4A 1O3RA 4I7HA 1NHAA 3VB2A 3B02A 4M6XA 3LA3A 4PGGA 2QQBA 4L5JA 2LSOA 3TDUC 4RS8A 4NHJA 5BS6A 1HSTA 1T6SA 1TNTA 1C0WA 5D5XB 4BH9A 4L18B 2K4JA 2VN2A 4M74A 3HRMA 2IJLA 3VEPA 2XHKA 3E5XA 3KE2A 1FY7A 3F6OA 1R1TA 2DO7A 4O5VA 3HHGA 1ON1A 3V8LA 1FP2A 5LGUA 1YYVA 5J6XA 1XCVA 4HAMA 2QWWA 1MKMA 2CWEA 4YIIA 3J80K 3O6BB 1R23A 3GFLA 3F6VA 1HW1A 5BMZA 5E1ZB 2K27A 1ZH5A 2EV0A 2VC1A 2DQLA 4MQ9F 1FWZA 4BNCA 1HKSA 3T5XA 2Z99A 5DCMB 1B9MA 4A0XA 2EFOA 1XSVA 3QAHA 2LF8A 5LRSA 2X0LA 5HS7A 4L0ZB 3E6CC 4KIFA 1F9NA 1U2WA 3I59A 4BXUA 2RGVA 2H09A 2RVCA 2BGCA 2DTRA 2YX7A 1L0OC 3KFWX 3HSRA 5TRDA 1A04A 4LD5A 1QZYA 4A6DA 2VOOA 1LNWA 1OYWA 2VBZA 3H3UA 1T0FA 3QU6A 1UFMA 2BYVE 2ZFWA 1IUYA 4OOIA 4E70A 2LKPA 1Z91A 1PP8F 3L2CA 3V7CA 4LLGF 2QM3A 3JAMZ 1EV7A 1XSDA 5D5UB 4YFNF 5E1XA 3QU3A 5BPDA 2HEOA 2PFBA 2VC0A 3QP6A 4EQQA 3BPVA 1R7JA 2OZUA 3Q9VA 1YG2A 3E6MA 5BQTA 3M1EA 1I1SA 1U6GA 4Q4ZF 2KRFA 2E1NA 4YG2F 2IW5A 2IA2A 4WWCA 1MDMA 2DU9A 3CUQB 3T0YA 2IA1A 1FPQA 4A12A 4CZZA 3RPQA 2L54A 2HFHA 1U5TB 3LA2A 5ILVA 5F6FA 4A5MA 2Q0OA 2M45A 1IW7F 3O2PE 3O3KA 3J80Z 3I54A 2A6EF 1QGPA 3F22A 1REPC 4HLXA 4LGWA 2VBXA 1BI3A 1MZBA 3WTSC 3FWEA 4RB2C 1TNSA 4DQ2A 3RIRA 3WTVC 4M9XA 4MGRA 3J81K 1IN7A 3G73A 3IKVA 1J2XA 4XLNF 2VT3A 2IPQX 2IP2A 1B6AA 2A07F 5FFZA 1TQPA 5HDKA 1ZG5A 3FMSA 2ZKZA 5D4RA 1S6LA 2STTA 1LDDA 5K1YA 2HZTA 2CSOA 2E7WA 5LRRA 1HBXG 1HSJA 5HDGA 1HKQA 3CLOA 4UV8A 5CVIA 5E8IA 4AIJA 4XSXF 1U8RA 3L00A 5JR3A 1GHCA 3F8MA 2A6HF 2PEXA 3SZPA 1RUNA 3U1DA 2L02A 3GLXA 3M8EA 5D5WB 3MWMA 1YW8A 3VODA 2H6BA 1R1VA 3F3XA 2FNAA 3EYIA 1J7KA 1XMKA 1MJAA 2PBIA 4EJOA 4M9ZA 2DK8A 2G7HA 2XIGA 3R0JA 4YFKF 2O03A 2MH9A 3F8BA 3WTYC 4KN4X 2W84A 2AS5F 4HV6A 2A61A 3IWZA 2P5KA 1O3QA 3BWGA 1IN5A 1ZN2A 2FBIA 5L3EA 1LB2A 3WTWC 3IL2A 2D45A 3P9KA 2ESHA 5FGMA 2OQGA 4NB5A 3KLNA 3WGHA 4IHSA 1SMYF 2Z3YA 1SFUA 3FM5A 2VONA 2NS0A 1Z9CA 3ZMVA 3KLOA 1Z05A 4ENKA 1YW7A 1ZLJA 3HTUA 3TO9A 4A0ZA 2BE5F 3KP5A 5CYVA 3JTHA 2AXLA 4CYDA 4KNYA 2NYXA 1KYWA 1TQIA 3I58A 2HQRA 1KGSA 3J81Z 4L5IA 1BOAA 2GIVA 4WXCA 4OIOF 4U0YA 3CTAA 3BZ6A 3AAFA 4ETSA 1LDJA 2BBYA 1IXSB 4OIRF 4AIHA 2HYFA 1WSUA 4KICA 1R5GA 3ECOA 3T1BA 3LFKA 4IRIA 2GAUA 1R1UA 1S8NA 5FO5A 4LFUA 5ICCA 4GCVA 5FLXK 5KVRA 3CO6C 4K2EA 4PZJA 2EFPA 4HZFA 3TQNA 1O7LA 1EH6A 1DPRA 3DKWA 4U0VA 3IRQA 5LHHA 4R1HA 2PLYA 2ACJA 1YS6A 3FM3A 1U3EM 1FBQA 3DFGA 2COMA 3WTUC 3HRSA 2XKPA 1ODDA 3I0TA 4HDVA 2XAQA 2OQRA 1Z6RA 2EWNA 1DUXC 4S04A 4G9YA 4L9TA 5DYMA 2EK5A 2G7UA 1F5TA 1G6NA 2O0YA 1ON2A 1P4AA 4RAZA 2P6TA 3HIFA 2CG4A 1SMTA 4WXHA 3BDDA 1WWXA 4OMYA 3FXQA 2VOPA 1TW3A 3ZP5A 2D2WA 5DEQA 3DF8A 2HKXA 2VODA 3FZVA 3CUQA 3P9CA 3P7NA 3RTRA 5AONA 1B59A 3WODF 3P9IA 4RGSA 1LDKB 1KU9A 1U5TA 1P4XA 4M72A 1ZLKA 4ZZDA 1XGMA 3D5LA 4JQFA 3ZMDA 3K2ZA 2VE8A 3M7GA 4BHPA 2JRTA 2V1DA 5HLGA 5DUIA 2FRHA 2OD5A 3NQOA 2EFNA 4UVCA 3E3VA 4CO8A 5HVQC 3F8CA 2E1CA 3PQJA 2MLGA 1IRFA 1D8KA 4CHUA 4RB0A 5EEGA 3G3ZA 4FHTA 3CUOA 4RB1A 4HX4A 4GYGA 3V4GA 4UVBA 5E8GA 5FD6A 1STZA 1ZARA 2UZKA 3TOBA 2P5LC 3KP6A 2EV6A 1I5ZA 5CVUA 4IXAA 1FT9A 4EM2A 3DPTA 3QRFF 2DFIA 2RQPA 2LF7A 1LVAA 3RJPA 1FSHA 1MGTA 3TDZC 3IKTA 5BOXA 2NNYA 2FMLA 5CLSA 2R7DA 4GXOA 3GYHX 3MAJA 2HKOA 1IXRC 3ISPA 1Z7UA 2QQ9A 4P96A 4OIQF 2Z5UA 3RI4A 2YR2A 1H9TA 4F7ZA 1Z6TA 3FMQA 5JI6A 3ZPLA 4WCGA 3EQLF 4BHBA 2CW0F 3GZ5A 5HLHA 5DD8A 5D6EA 3E6BA 1SD7A 1IF1A 2P7CB 4HA8A 3BJOA 3KP3A 4G6DA 1W7PB 1TTYA 1RI7A 4G7ZF 3WGIA 5HS9A 1O3SA 3FMRA 1ULYA 4U0WA 3EDPA 1YQAA 2P5VA 2HOEA 2PMHA 3CO7C 2MC3A 4KMFA 1K78B 1L3LA 2XVCA 1BI2A 2FOKA 1IXCA 2GA2A 2WTEA 4GO1A 3CJNA 2DK5A 4ZH4F 3MEXA 2ZNYA 3GXOA 4U88A 5JVTA 2M1BA 3Q5FA 2QENA 1U78A 4NQWA 5H20A 3DEUA 2Y48A 4KN7X 2NRAC 1JXSA 2C6YA 4ZYEA 1FLIA 2O3FA 3F8NA 4O3MA 1JE8A 2FEZA 2KJBA 3ZN0A 2IVMA 3GEZA 6PAXA 2HQNA 3R0AA 4G7OF 5JFRA 4CXFA 3KP7A 2F5DA 3GWZA 1ZRCA 3COAC 5HS8A 4IRHA 3H92A 2RKHA 4P5OA 2V1XA 5D4SA 1USTA 2QBYB 4RGUA 2ISZA 2KIUA 2PMUA 2BEOA 2EFWA 4LLNA 5CVVA 4HF0A 5E1WA 3ML6A 2XRNA 3LSTA 2YSRA 1FBUA 3SFZA 5ICGA 2FBHA 4I2OA 3GFJA 4I0AA 4B09A 1HKTA 1XGOA 2KJCA 1O3TA 3BROA 2NAZA 1FOKA 3VFZA 2L4MA 2DQRA 2IA0A 3MZYA 2Q2EA 4Y15A 5L3FA 4AVPA 2XKOA 2QQAA 4KT5C 1FYMA 4KA4A 4XRFA 2ZMEB 4UXNA 1CF7B 4P9FA 2HR3A 3W6KB 3KZYA 2Y75A 4BHCA 2EA4A 3BPXA 1FC3A 2ELHA 2G9WA 3E97A 4OINF 2ZNZA 3ROUA 1G3WA 1QNTA 1J9IA 3V8JA 2K4BA 2BV6A 4L0YB 1B9NA 3M9AA 4WF2A 5HDNA 2V79A 4KUMA 3V7SA 1IZ1A 5F64A 3DV8A 1IN6A 2JPCA 3F8FA 4BYYA 2XROA 3FXRA 1ONVA 5A2QK 1LJ9A 2TDXA 1G3TA 2H94A 3FXUA 5FB2A 2A3SA 3E5QA 2XUBA 3JW4A 2HTSA 1KQ0A 4AWXB 1H9GA 1FYKA 3K1MA 2QLZA 3I4PA 2D1HA 1ZG1A 1FBSA 2DT5A 1ZRFA 1OR7A 3M8FA 2O8XA 2YPRA 5LEJA 2Q8KA 3RKXA 4EJTA 5DUKA 4CDGA 1Y0UA 4N9HA 1FNNA 5KK1A 4HF1A 2PJPA 1B1BA 4Z2YA 4LLLA 5DCFA 2O61A 2HTJA 4HF2A 5BPIA 4JK1X 2EJRA 2H6CA 4XLPF 2KIMA 3HHHA 1SD5A 2JTVA 1D3YA 3U9GA 4HDUA 4N0BA 4XSZF 1UCRA 1ZG3A 2OZ6A 1WKMA 1IRGA 3NEUA 2D1VA 3C1DA 4HX7A 1BIAA 2FQ3A 4Q5SF 1AOYA 1XGNA 3PFIA 2DPUA 1R5HA 2M87A 4I0BA 2J5OA 1RNLA 2RDPA 1O57A 4MHGA 3TKYA 1W7PA 2W24A 1V3FA 1O7FA 2PN6A 2ZO4A 4EJVA 5LGNA 3EUHA 3ZMSA 3KZZA 4UHTA 5DCMA 2CGPA 1XCBA 3V7RA 1HW2A 1R00A 3QP5A 1D8JA 4EMSA 1JGSA 2XAGA 4JBAA 3H3ZA 4ESFA 2FBKA 1K78A 3GUDA 1SFEA 2FU4A 4ENMA 4UNOA 2FE3A 3J7AO 1Q1HA 1EH7A 2W25A 3KCCA 4ZYGA 3BJ6A 2EA2A 2K02A 4WX9A 3K1PA 1T38A 5D5VB 1PP7U 2GZWA 1UHWA 1S7AA 2P8TA 2W57A 4YFXF 1EH8A 3I64A 3U2RA 5IT3A 1BN5A 4GYIA 5H6QA 4O6JA 1IAWA 3LAJA 1PUEE 1Z1DA 4ASNA 2OBPA 2R3SA 2GXBA 5LGTA 3K1NA 2RNJA 3HRUA 2Z33A 4EJUA 2M5WA 4UV9A 3HOTA 1I6XA 4IHTA 1E2XA 2V1UA 2L4AA 2QBYA 1KQ8A 1MJ9A 4KIBA 5D8KB 4A6EA 1RZ4A 4Q47A 1X3UA 3WTXC 3ELKA 2XV4S 1OYYA 1QO0D 2EB7A 1FYLA 3F72A 5AIQA 2K7LA 2QUFA 2JZYA 1I27A 3MZHA 3L9FA 4DNCA 1W4MA 2XAJA 1MJBA 2JT1A 1JHFA 1ZYRF 1BJAA 2LDUA 3F21A 3E6DA 2FXAA 2ZXJA 3I71A 3QPTA 3JTGA 3RKWA 2PI0A 3IRRA 2K86A 1GXPA 2FA5A 3L09A 5FLXZ 1V4RA 3IHUA 2HS5A 4G7HF 4EV0A 4P9UA 2ZMEA 1J59A 1CF7A 3BJAA 1ZHFA 3ZMZA 2QZ8A 4LJZF 3FHZA 1K6OA 2FSWA 3ZN1A 2W85A 1P92A 2CFXA 2ESNA 4IPAA 2GWRA 1IN4A 3R60A 4S05A 3RYRA 3JAMK 1IN8A 3LQRA 1B4AA 1ZREA 2CO5A 2XAFA 2VT2A 1J75A 1QBJA 1YFHA 3QOPA 3N97A 3C3WA 2RN7A 1I1GA 3HSEA 4A0YA 3WG9A 1KYZA 3EYYA 4L9NA 2RV8A 3ECHA 3LA7A 1P2FA 3LWFA 5LHIA 4R8HA 5ILUA 1OMIA 2DW4A 5K5OA 3HOSA 2B0LA 2GA1A 1T39A 2GXGA 2ADUA 1FZPB 1XD7A 2EV5A 4M9SA 2JSCA 4EGYA 2H27A 1OYIA 3CUQC 3GFMA 4PCQA 3DXJF 1YS7A 2KIFA 4AIKA 1U5TC 1OPCA 3IWFA 4KFCA 5J8CA 3ABTA 1XN7A 2F5EA 5E17F 2WWYA 4HW0A 5CVRA 1T2KA 1YTYA 4KYWA 5L3CA 2DI3A 2EFQA 2MH2A 4HOBA 5L3DA 3MFKA 4OIPF 1W7PD 2LNBA 1XSXA 4WXDA 2L01A 5E18F 1QZZA 2A5YB 4FT8A 4G8XA 4MEYF 5L3GA 5LBQA 1DDNA 3E5UA 4L9JA 4A2UA 1W5SA 2OAZA 1GVJA 4LG0B 3BOQA 1F4KA 1QQIA 1S7OA 1SFXA 1P6RA 1WQ2A 3BY6A 4H0EA 3GW2A 1TW2A 2GQQA 2XGXA 3WU1B 4LK1F 5LHGA 3T8RA 4RAYA 3GO5A 1QPMA 3BP8A 5AIPA 2HDCA 1S3JA 4RGXA 1TLHB 4ESJA 3HTSB 2FF4A 2FNPA 3IC7A 3R6SA 2VE9A 5LLQA 3I5UA 3C18A 2WC2A 1ZGJA 4MTEA 4B8XA 2Z9OA 1OKRA 3FX3A 1ZAOA 3KEOA 1LEAA 2DPDA 1HQCA 2M30A 1XGSA 3HSFA 1HW5A 4LMYA 5K5RA 4RGRA 3MQ0A 2ZBKA 4QWQA 5J8FA 2HWVA 3RDIA 1XDUA 3GZ6A 1BBYA 2YU3A 1SD4A 4FX0A 2A69F 3ABUA 2V9VA 1DP7P 2UXNA 2NNNA 3SXYA 4KIGA 2FMYA 1K79A 4LK0F 4M73A 5L3BA 3GVAA 1ZRDA 1BC8C 4EGZA 5ICEA 4ESBA 1FSEA 4UVAA 5ERIA 1RIOH 1SAXA 1AWCA 3TGNA 1KU7A 4BQAA 1R22A 2MD5A 4LB6B 3K9TA 5DDGA 1HXDA 4ENJA 1K7AA 4PDKA 2Y0MA 2STWA 3FF5A 3GFIA 1YW9A 4L9VA 2WV0A 1BM9A 4FX4A 1YO5C 3T8TA 4HBLA 3SQNA 5F1RA 4KDPA 5ILSA 3I53A 4CGZA 4HYEA 5EEHA 2IT0A 1J5YA 3DPLC 5TJJA 3SZTA 4R79A 4ZYHA 1BC7C 4OU0A 4I09A 3WU0A 1KU2A 2JPBA 2P6SA 2P4WA 3GX4X 4HLYA 3TO6A 4AD9A 2KKOA 1LQ1A 5IT9K 3MCZA 1G3YA 3B73A 4I02A 4YIFA 4Y13A 3K69A 3REOA 4ZZLA 4Q48A 4MEXF 5K5QA 1ZGAA 1PDNC 1SD6A 4IF4A 3ZQ7A 5CVJA 3GF2A 3WE3A 3KETA 2OA4A 5D6FA 3JSOA 4P55A 2XAHA 2X4HA 2R7FA 1W5TA 4M6YA 1FX7A 1RUOA 4EVIA 2HGCA 3I59B 2HYGD 1G3SA 5ICFA 1KQ9A 4D0PA 2MA3A 3ZMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYO A;  4I01 A;  1FP1 D;  3D0S A;  3LAP A;  4MTD A;  1KA8 A;  5LEK A;  1S29 A;  4EJW A;  3WE2 A;  1BI1 A;  3ULQ B;  1USS A;  5JHU A;  4HQM A;  4G6Q A;  1BI0 A;  3RYP A;  4XBF A;  4GGG A;  4QLC U;  3LQQ A;  2M8E A;  1E17 A;  4U7B A;  4IRG A;  1R58 A;  2YX4 A;  3HUG A;  2E7X A;  4OMZ A;  4N9I A;  3WTZ A;  2DBB A;  4LB5 A;  5CJ9 A;  1DPU A;  2F5F A;  1P4W A;  2F2E A;  1XB4 A;  1G4D A;  2ISY A;  3HRT A;  3F23 A;  4ENN A;  2PG4 A;  1H0M A;  3TO7 A;  3NRV A;  2VBY A;  4MQV A;  5A2Q Z;  4ON0 A;  2L3D A;  2DLL A;  3DP7 A;  5H6R A;  1MDM B;  3R61 A;  2F5C A;  2O6G E;  5DV5 A;  3OV8 A;  3S2W A;  2P7V B;  3W6J B;  1LEB A;  3QPH A;  3KEQ A;  3EET A;  5ED4 A;  4LG0 A;  2XAS A;  5IT9 Z;  5HLI A;  1MD0 A;  2RC4 A;  2MBF A;  3OOP A;  4IJA A;  1T98 A;  1WI9 A;  4EM0 B;  4HV5 A;  3ERE D;  3R4K A;  4KMU X;  3WGG A;  4WK8 F;  5E20 A;  3ZMU A;  1J0R A;  3L7W A;  1R36 A;  1GXQ A;  4U7D A;  2UXX A;  3SHF A;  2IRF G;  3JSP A;  3VOE A;  2ETH A;  1BIB A;  2PQ8 A;  2A68 F;  5FFX A;  4IVN A;  3WTT C;  1XMA A;  3Q9S A;  1JHH A;  1F1Z A;  1XDS A;  2J5P A;  3K0L A;  3RKY A;  3N4M A;  3RPU A;  3C7J A;  2VBW A;  1YLF A;  4HX8 A;  3HYI A;  1KU3 A;  4M71 A;  2UWM A;  3DQV C;  1TQM A;  3V8K A;  3PQK A;  3KP2 A;  4PGH A;  4CIC A;  4RB3 C;  2CQK A;  5FD5 A;  5DD4 A;  1CGP A;  2VXZ A;  4UUV A;  3TOA A;  2CYY A;  2V6C A;  4MNU A;  5HOO A;  1VTN C;  4TV7 A;  1YIO A;  4I98 B;  4ZYD A;  5D8L B;  4EM1 A;  2ZCW A;  2MLK A;  1D5V A;  2QVO A;  4A5N A;  2ZJ2 A;  3CDH A;  4Y17 A;  4HQE A;  4G94 A;  1UB9 A;  4BAY A;  2DAO A;  1TBX A;  2OU2 A;  1UHM A;  1WRJ A;  3KP4 A;  1O3R A;  4I7H A;  1NHA A;  3VB2 A;  3B02 A;  4M6X A;  3LA3 A;  4PGG A;  2QQB A;  4L5J A;  2LSO A;  3TDU C;  4RS8 A;  4NHJ A;  5BS6 A;  1HST A;  1T6S A;  1TNT A;  1C0W A;  5D5X B;  4BH9 A;  4L18 B;  2K4J A;  2VN2 A;  4M74 A;  3HRM A;  2IJL A;  3VEP A;  2XHK A;  3E5X A;  3KE2 A;  1FY7 A;  3F6O A;  1R1T A;  2DO7 A;  4O5V A;  3HHG A;  1ON1 A;  3V8L A;  1FP2 A;  5LGU A;  1YYV A;  5J6X A;  1XCV A;  4HAM A;  2QWW A;  1MKM A;  2CWE A;  4YII A;  3J80 K;  3O6B B;  1R23 A;  3GFL A;  3F6V A;  1HW1 A;  5BMZ A;  5E1Z B;  2K27 A;  1ZH5 A;  2EV0 A;  2VC1 A;  2DQL A;  4MQ9 F;  1FWZ A;  4BNC A;  1HKS A;  3T5X A;  2Z99 A;  5DCM B;  1B9M A;  4A0X A;  2EFO A;  1XSV A;  3QAH A;  2LF8 A;  5LRS A;  2X0L A;  5HS7 A;  4L0Z B;  3E6C C;  4KIF A;  1F9N A;  1U2W A;  3I59 A;  4BXU A;  2RGV A;  2H09 A;  2RVC A;  2BGC A;  2DTR A;  2YX7 A;  1L0O C;  3KFW X;  3HSR A;  5TRD A;  1A04 A;  4LD5 A;  1QZY A;  4A6D A;  2VOO A;  1LNW A;  1OYW A;  2VBZ A;  3H3U A;  1T0F A;  3QU6 A;  1UFM A;  2BYV E;  2ZFW A;  1IUY A;  4OOI A;  4E70 A;  2LKP A;  1Z91 A;  1PP8 F;  3L2C A;  3V7C A;  4LLG F;  2QM3 A;  3JAM Z;  1EV7 A;  1XSD A;  5D5U B;  4YFN F;  5E1X A;  3QU3 A;  5BPD A;  2HEO A;  2PFB A;  2VC0 A;  3QP6 A;  4EQQ A;  3BPV A;  1R7J A;  2OZU A;  3Q9V A;  1YG2 A;  3E6M A;  5BQT A;  3M1E A;  1I1S A;  1U6G A;  4Q4Z F;  2KRF A;  2E1N A;  4YG2 F;  2IW5 A;  2IA2 A;  4WWC A;  1MDM A;  2DU9 A;  3CUQ B;  3T0Y A;  2IA1 A;  1FPQ A;  4A12 A;  4CZZ A;  3RPQ A;  2L54 A;  2HFH A;  1U5T B;  3LA2 A;  5ILV A;  5F6F A;  4A5M A;  2Q0O A;  2M45 A;  1IW7 F;  3O2P E;  3O3K A;  3J80 Z;  3I54 A;  2A6E F;  1QGP A;  3F22 A;  1REP C;  4HLX A;  4LGW A;  2VBX A;  1BI3 A;  1MZB A;  3WTS C;  3FWE A;  4RB2 C;  1TNS A;  4DQ2 A;  3RIR A;  3WTV C;  4M9X A;  4MGR A;  3J81 K;  1IN7 A;  3G73 A;  3IKV A;  1J2X A;  4XLN F;  2VT3 A;  2IPQ X;  2IP2 A;  1B6A A;  2A07 F;  5FFZ A;  1TQP A;  5HDK A;  1ZG5 A;  3FMS A;  2ZKZ A;  5D4R A;  1S6L A;  2STT A;  1LDD A;  5K1Y A;  2HZT A;  2CSO A;  2E7W A;  5LRR A;  1HBX G;  1HSJ A;  5HDG A;  1HKQ A;  3CLO A;  4UV8 A;  5CVI A;  5E8I A;  4AIJ A;  4XSX F;  1U8R A;  3L00 A;  5JR3 A;  1GHC A;  3F8M A;  2A6H F;  2PEX A;  3SZP A;  1RUN A;  3U1D A;  2L02 A;  3GLX A;  3M8E A;  5D5W B;  3MWM A;  1YW8 A;  3VOD A;  2H6B A;  1R1V A;  3F3X A;  2FNA A;  3EYI A;  1J7K A;  1XMK A;  1MJA A;  2PBI A;  4EJO A;  4M9Z A;  2DK8 A;  2G7H A;  2XIG A;  3R0J A;  4YFK F;  2O03 A;  2MH9 A;  3F8B A;  3WTY C;  4KN4 X;  2W84 A;  2AS5 F;  4HV6 A;  2A61 A;  3IWZ A;  2P5K A;  1O3Q A;  3BWG A;  1IN5 A;  1ZN2 A;  2FBI A;  5L3E A;  1LB2 A;  3WTW C;  3IL2 A;  2D45 A;  3P9K A;  2ESH A;  5FGM A;  2OQG A;  4NB5 A;  3KLN A;  3WGH A;  4IHS A;  1SMY F;  2Z3Y A;  1SFU A;  3FM5 A;  2VON A;  2NS0 A;  1Z9C A;  3ZMV A;  3KLO A;  1Z05 A;  4ENK A;  1YW7 A;  1ZLJ A;  3HTU A;  3TO9 A;  4A0Z A;  2BE5 F;  3KP5 A;  5CYV A;  3JTH A;  2AXL A;  4CYD A;  4KNY A;  2NYX A;  1KYW A;  1TQI A;  3I58 A;  2HQR A;  1KGS A;  3J81 Z;  4L5I A;  1BOA A;  2GIV A;  4WXC A;  4OIO F;  4U0Y A;  3CTA A;  3BZ6 A;  3AAF A;  4ETS A;  1LDJ A;  2BBY A;  1IXS B;  4OIR F;  4AIH A;  2HYF A;  1WSU A;  4KIC A;  1R5G A;  3ECO A;  3T1B A;  3LFK A;  4IRI A;  2GAU A;  1R1U A;  1S8N A;  5FO5 A;  4LFU A;  5ICC A;  4GCV A;  5FLX K;  5KVR A;  3CO6 C;  4K2E A;  4PZJ A;  2EFP A;  4HZF A;  3TQN A;  1O7L A;  1EH6 A;  1DPR A;  3DKW A;  4U0V A;  3IRQ A;  5LHH A;  4R1H A;  2PLY A;  2ACJ A;  1YS6 A;  3FM3 A;  1U3E M;  1FBQ A;  3DFG A;  2COM A;  3WTU C;  3HRS A;  2XKP A;  1ODD A;  3I0T A;  4HDV A;  2XAQ A;  2OQR A;  1Z6R A;  2EWN A;  1DUX C;  4S04 A;  4G9Y A;  4L9T A;  5DYM A;  2EK5 A;  2G7U A;  1F5T A;  1G6N A;  2O0Y A;  1ON2 A;  1P4A A;  4RAZ A;  2P6T A;  3HIF A;  2CG4 A;  1SMT A;  4WXH A;  3BDD A;  1WWX A;  4OMY A;  3FXQ A;  2VOP A;  1TW3 A;  3ZP5 A;  2D2W A;  5DEQ A;  3DF8 A;  2HKX A;  2VOD A;  3FZV A;  3CUQ A;  3P9C A;  3P7N A;  3RTR A;  5AON A;  1B59 A;  3WOD F;  3P9I A;  4RGS A;  1LDK B;  1KU9 A;  1U5T A;  1P4X A;  4M72 A;  1ZLK A;  4ZZD A;  1XGM A;  3D5L A;  4JQF A;  3ZMD A;  3K2Z A;  2VE8 A;  3M7G A;  4BHP A;  2JRT A;  2V1D A;  5HLG A;  5DUI A;  2FRH A;  2OD5 A;  3NQO A;  2EFN A;  4UVC A;  3E3V A;  4CO8 A;  5HVQ C;  3F8C A;  2E1C A;  3PQJ A;  2MLG A;  1IRF A;  1D8K A;  4CHU A;  4RB0 A;  5EEG A;  3G3Z A;  4FHT A;  3CUO A;  4RB1 A;  4HX4 A;  4GYG A;  3V4G A;  4UVB A;  5E8G A;  5FD6 A;  1STZ A;  1ZAR A;  2UZK A;  3TOB A;  2P5L C;  3KP6 A;  2EV6 A;  1I5Z A;  5CVU A;  4IXA A;  1FT9 A;  4EM2 A;  3DPT A;  3QRF F;  2DFI A;  2RQP A;  2LF7 A;  1LVA A;  3RJP A;  1FSH A;  1MGT A;  3TDZ C;  3IKT A;  5BOX A;  2NNY A;  2FML A;  5CLS A;  2R7D A;  4GXO A;  3GYH X;  3MAJ A;  2HKO A;  1IXR C;  3ISP A;  1Z7U A;  2QQ9 A;  4P96 A;  4OIQ F;  2Z5U A;  3RI4 A;  2YR2 A;  1H9T A;  4F7Z A;  1Z6T A;  3FMQ A;  5JI6 A;  3ZPL A;  4WCG A;  3EQL F;  4BHB A;  2CW0 F;  3GZ5 A;  5HLH A;  5DD8 A;  5D6E A;  3E6B A;  1SD7 A;  1IF1 A;  2P7C B;  4HA8 A;  3BJO A;  3KP3 A;  4G6D A;  1W7P B;  1TTY A;  1RI7 A;  4G7Z F;  3WGI A;  5HS9 A;  1O3S A;  3FMR A;  1ULY A;  4U0W A;  3EDP A;  1YQA A;  2P5V A;  2HOE A;  2PMH A;  3CO7 C;  2MC3 A;  4KMF A;  1K78 B;  1L3L A;  2XVC A;  1BI2 A;  2FOK A;  1IXC A;  2GA2 A;  2WTE A;  4GO1 A;  3CJN A;  2DK5 A;  4ZH4 F;  3MEX A;  2ZNY A;  3GXO A;  4U88 A;  5JVT A;  2M1B A;  3Q5F A;  2QEN A;  1U78 A;  4NQW A;  5H20 A;  3DEU A;  2Y48 A;  4KN7 X;  2NRA C;  1JXS A;  2C6Y A;  4ZYE A;  1FLI A;  2O3F A;  3F8N A;  4O3M A;  1JE8 A;  2FEZ A;  2KJB A;  3ZN0 A;  2IVM A;  3GEZ A;  6PAX A;  2HQN A;  3R0A A;  4G7O F;  5JFR A;  4CXF A;  3KP7 A;  2F5D A;  3GWZ A;  1ZRC A;  3COA C;  5HS8 A;  4IRH A;  3H92 A;  2RKH A;  4P5O A;  2V1X A;  5D4S A;  1UST A;  2QBY B;  4RGU A;  2ISZ A;  2KIU A;  2PMU A;  2BEO A;  2EFW A;  4LLN A;  5CVV A;  4HF0 A;  5E1W A;  3ML6 A;  2XRN A;  3LST A;  2YSR A;  1FBU A;  3SFZ A;  5ICG A;  2FBH A;  4I2O A;  3GFJ A;  4I0A A;  4B09 A;  1HKT A;  1XGO A;  2KJC A;  1O3T A;  3BRO A;  2NAZ A;  1FOK A;  3VFZ A;  2L4M A;  2DQR A;  2IA0 A;  3MZY A;  2Q2E A;  4Y15 A;  5L3F A;  4AVP A;  2XKO A;  2QQA A;  4KT5 C;  1FYM A;  4KA4 A;  4XRF A;  2ZME B;  4UXN A;  1CF7 B;  4P9F A;  2HR3 A;  3W6K B;  3KZY A;  2Y75 A;  4BHC A;  2EA4 A;  3BPX A;  1FC3 A;  2ELH A;  2G9W A;  3E97 A;  4OIN F;  2ZNZ A;  3ROU A;  1G3W A;  1QNT A;  1J9I A;  3V8J A;  2K4B A;  2BV6 A;  4L0Y B;  1B9N A;  3M9A A;  4WF2 A;  5HDN A;  2V79 A;  4KUM A;  3V7S A;  1IZ1 A;  5F64 A;  3DV8 A;  1IN6 A;  2JPC A;  3F8F A;  4BYY A;  2XRO A;  3FXR A;  1ONV A;  5A2Q K;  1LJ9 A;  2TDX A;  1G3T A;  2H94 A;  3FXU A;  5FB2 A;  2A3S A;  3E5Q A;  2XUB A;  3JW4 A;  2HTS A;  1KQ0 A;  4AWX B;  1H9G A;  1FYK A;  3K1M A;  2QLZ A;  3I4P A;  2D1H A;  1ZG1 A;  1FBS A;  2DT5 A;  1ZRF A;  1OR7 A;  3M8F A;  2O8X A;  2YPR A;  5LEJ A;  2Q8K A;  3RKX A;  4EJT A;  5DUK A;  4CDG A;  1Y0U A;  4N9H A;  1FNN A;  5KK1 A;  4HF1 A;  2PJP A;  1B1B A;  4Z2Y A;  4LLL A;  5DCF A;  2O61 A;  2HTJ A;  4HF2 A;  5BPI A;  4JK1 X;  2EJR A;  2H6C A;  4XLP F;  2KIM A;  3HHH A;  1SD5 A;  2JTV A;  1D3Y A;  3U9G A;  4HDU A;  4N0B A;  4XSZ F;  1UCR A;  1ZG3 A;  2OZ6 A;  1WKM A;  1IRG A;  3NEU A;  2D1V A;  3C1D A;  4HX7 A;  1BIA A;  2FQ3 A;  4Q5S F;  1AOY A;  1XGN A;  3PFI A;  2DPU A;  1R5H A;  2M87 A;  4I0B A;  2J5O A;  1RNL A;  2RDP A;  1O57 A;  4MHG A;  3TKY A;  1W7P A;  2W24 A;  1V3F A;  1O7F A;  2PN6 A;  2ZO4 A;  4EJV A;  5LGN A;  3EUH A;  3ZMS A;  3KZZ A;  4UHT A;  5DCM A;  2CGP A;  1XCB A;  3V7R A;  1HW2 A;  1R00 A;  3QP5 A;  1D8J A;  4EMS A;  1JGS A;  2XAG A;  4JBA A;  3H3Z A;  4ESF A;  2FBK A;  1K78 A;  3GUD A;  1SFE A;  2FU4 A;  4ENM A;  4UNO A;  2FE3 A;  3J7A O;  1Q1H A;  1EH7 A;  2W25 A;  3KCC A;  4ZYG A;  3BJ6 A;  2EA2 A;  2K02 A;  4WX9 A;  3K1P A;  1T38 A;  5D5V B;  1PP7 U;  2GZW A;  1UHW A;  1S7A A;  2P8T A;  2W57 A;  4YFX F;  1EH8 A;  3I64 A;  3U2R A;  5IT3 A;  1BN5 A;  4GYI A;  5H6Q A;  4O6J A;  1IAW A;  3LAJ A;  1PUE E;  1Z1D A;  4ASN A;  2OBP A;  2R3S A;  2GXB A;  5LGT A;  3K1N A;  2RNJ A;  3HRU A;  2Z33 A;  4EJU A;  2M5W A;  4UV9 A;  3HOT A;  1I6X A;  4IHT A;  1E2X A;  2V1U A;  2L4A A;  2QBY A;  1KQ8 A;  1MJ9 A;  4KIB A;  5D8K B;  4A6E A;  1RZ4 A;  4Q47 A;  1X3U A;  3WTX C;  3ELK A;  2XV4 S;  1OYY A;  1QO0 D;  2EB7 A;  1FYL A;  3F72 A;  5AIQ A;  2K7L A;  2QUF A;  2JZY A;  1I27 A;  3MZH A;  3L9F A;  4DNC A;  1W4M A;  2XAJ A;  1MJB A;  2JT1 A;  1JHF A;  1ZYR F;  1BJA A;  2LDU A;  3F21 A;  3E6D A;  2FXA A;  2ZXJ A;  3I71 A;  3QPT A;  3JTG A;  3RKW A;  2PI0 A;  3IRR A;  2K86 A;  1GXP A;  2FA5 A;  3L09 A;  5FLX Z;  1V4R A;  3IHU A;  2HS5 A;  4G7H F;  4EV0 A;  4P9U A;  2ZME A;  1J59 A;  1CF7 A;  3BJA A;  1ZHF A;  3ZMZ A;  2QZ8 A;  4LJZ F;  3FHZ A;  1K6O A;  2FSW A;  3ZN1 A;  2W85 A;  1P92 A;  2CFX A;  2ESN A;  4IPA A;  2GWR A;  1IN4 A;  3R60 A;  4S05 A;  3RYR A;  3JAM K;  1IN8 A;  3LQR A;  1B4A A;  1ZRE A;  2CO5 A;  2XAF A;  2VT2 A;  1J75 A;  1QBJ A;  1YFH A;  3QOP A;  3N97 A;  3C3W A;  2RN7 A;  1I1G A;  3HSE A;  4A0Y A;  3WG9 A;  1KYZ A;  3EYY A;  4L9N A;  2RV8 A;  3ECH A;  3LA7 A;  1P2F A;  3LWF A;  5LHI A;  4R8H A;  5ILU A;  1OMI A;  2DW4 A;  5K5O A;  3HOS A;  2B0L A;  2GA1 A;  1T39 A;  2GXG A;  2ADU A;  1FZP B;  1XD7 A;  2EV5 A;  4M9S A;  2JSC A;  4EGY A;  2H27 A;  1OYI A;  3CUQ C;  3GFM A;  4PCQ A;  3DXJ F;  1YS7 A;  2KIF A;  4AIK A;  1U5T C;  1OPC A;  3IWF A;  4KFC A;  5J8C A;  3ABT A;  1XN7 A;  2F5E A;  5E17 F;  2WWY A;  4HW0 A;  5CVR A;  1T2K A;  1YTY A;  4KYW A;  5L3C A;  2DI3 A;  2EFQ A;  2MH2 A;  4HOB A;  5L3D A;  3MFK A;  4OIP F;  1W7P D;  2LNB A;  1XSX A;  4WXD A;  2L01 A;  5E18 F;  1QZZ A;  2A5Y B;  4FT8 A;  4G8X A;  4MEY F;  5L3G A;  5LBQ A;  1DDN A;  3E5U A;  4L9J A;  4A2U A;  1W5S A;  2OAZ A;  1GVJ A;  4LG0 B;  3BOQ A;  1F4K A;  1QQI A;  1S7O A;  1SFX A;  1P6R A;  1WQ2 A;  3BY6 A;  4H0E A;  3GW2 A;  1TW2 A;  2GQQ A;  2XGX A;  3WU1 B;  4LK1 F;  5LHG A;  3T8R A;  4RAY A;  3GO5 A;  1QPM A;  3BP8 A;  5AIP A;  2HDC A;  1S3J A;  4RGX A;  1TLH B;  4ESJ A;  3HTS B;  2FF4 A;  2FNP A;  3IC7 A;  3R6S A;  2VE9 A;  5LLQ A;  3I5U A;  3C18 A;  2WC2 A;  1ZGJ A;  4MTE A;  4B8X A;  2Z9O A;  1OKR A;  3FX3 A;  1ZAO A;  3KEO A;  1LEA A;  2DPD A;  1HQC A;  2M30 A;  1XGS A;  3HSF A;  1HW5 A;  4LMY A;  5K5R A;  4RGR A;  3MQ0 A;  2ZBK A;  4QWQ A;  5J8F A;  2HWV A;  3RDI A;  1XDU A;  3GZ6 A;  1BBY A;  2YU3 A;  1SD4 A;  4FX0 A;  2A69 F;  3ABU A;  2V9V A;  1DP7 P;  2UXN A;  2NNN A;  3SXY A;  4KIG A;  2FMY A;  1K79 A;  4LK0 F;  4M73 A;  5L3B A;  3GVA A;  1ZRD A;  1BC8 C;  4EGZ A;  5ICE A;  4ESB A;  1FSE A;  4UVA A;  5ERI A;  1RIO H;  1SAX A;  1AWC A;  3TGN A;  1KU7 A;  4BQA A;  1R22 A;  2MD5 A;  4LB6 B;  3K9T A;  5DDG A;  1HXD A;  4ENJ A;  1K7A A;  4PDK A;  2Y0M A;  2STW A;  3FF5 A;  3GFI A;  1YW9 A;  4L9V A;  2WV0 A;  1BM9 A;  4FX4 A;  1YO5 C;  3T8T A;  4HBL A;  3SQN A;  5F1R A;  4KDP A;  5ILS A;  3I53 A;  4CGZ A;  4HYE A;  5EEH A;  2IT0 A;  1J5Y A;  3DPL C;  5TJJ A;  3SZT A;  4R79 A;  4ZYH A;  1BC7 C;  4OU0 A;  4I09 A;  3WU0 A;  1KU2 A;  2JPB A;  2P6S A;  2P4W A;  3GX4 X;  4HLY A;  3TO6 A;  4AD9 A;  2KKO A;  1LQ1 A;  5IT9 K;  3MCZ A;  1G3Y A;  3B73 A;  4I02 A;  4YIF A;  4Y13 A;  3K69 A;  3REO A;  4ZZL A;  4Q48 A;  4MEX F;  5K5Q A;  1ZGA A;  1PDN C;  1SD6 A;  4IF4 A;  3ZQ7 A;  5CVJ A;  3GF2 A;  3WE3 A;  3KET A;  2OA4 A;  5D6F A;  3JSO A;  4P55 A;  2XAH A;  2X4H A;  2R7F A;  1W5T A;  4M6Y A;  1FX7 A;  1RUO A;  4EVI A;  2HGC A;  3I59 B;  2HYG D;  1G3S A;  5ICF A;  1KQ9 A;  4D0P A;  2MA3 A;  3ZMT A; 
#chains in the Genus database with same CATH topology
 2QYO A;  4I01 A;  1FP1 D;  2LTP A;  2EBI A;  1TWG J;  3D0S A;  3LAP A;  2E34 A;  2NOJ B;  2XAU A;  2LBF A;  4MTD A;  3SDG A;  1KA8 A;  4MFD A;  1OQY A;  5LEK A;  5CKT A;  1S29 A;  3CCQ I;  4EJW A;  3LSI A;  3OL4 A;  3WE2 A;  1JJ8 C;  3BQY A;  1BI1 A;  3ULQ B;  1USS A;  3BR5 A;  5JHU A;  4HQM A;  2DYS H;  1X2M A;  4G6Q A;  1BI0 A;  3RYP A;  4XBF A;  4GGG A;  3RSN A;  4XNF A;  3BG3 A;  4QLC U;  3LQQ A;  2M8E A;  4IL6 C;  1E17 A;  4BQQ A;  3OSF A;  3NAR A;  4PFO A;  2EZK A;  4U7B A;  1RET A;  4IRG A;  1K6Y A;  1R58 A;  2YX4 A;  5J47 A;  3HUG A;  1YIJ I;  2E7X A;  4OMZ A;  4N9I A;  1MMN A;  3H5N A;  2V7F A;  1HC8 A;  3WTZ A;  3BQZ A;  5F27 A;  1XS9 A;  2DBB A;  4LB5 A;  3C2G A;  2OCC H;  3K4J A;  5CJ9 A;  1DPU A;  4E7J A;  2F5F A;  1P4W A;  2F2E A;  1XB4 A;  1G4D A;  2KZV A;  3IH2 A;  2ISY A;  2QKM B;  3HRT A;  3KX2 A;  3F23 A;  1ETX A;  4ENN A;  2PG4 A;  3ZXS A;  1IUF A;  1H0M A;  3TO7 A;  3A0B C;  3NRV A;  5IP9 J;  2VBY A;  4MQV A;  5A2Q Z;  4ON0 A;  2L3D A;  3G1M A;  4RM3 A;  2DLL A;  3DP7 A;  2X1D A;  5H6R A;  1MDM B;  2R7O A;  3R61 A;  3CJR B;  2F5C A;  2O6G E;  3A2K A;  5DV5 A;  3MKW B;  2MD0 A;  3OV8 A;  3VYR B;  5GTI C;  3S2W A;  3HOY J;  2P7V B;  4A3E J;  2EZI A;  3W6J B;  2EQR A;  3MZ8 A;  4CH7 A;  1LEB A;  1WJ5 A;  2GOX B;  3KEQ A;  3QPH A;  3EET A;  4BKX A;  1QA6 A;  4CCJ A;  5ED4 A;  1RKW A;  4LG0 A;  4MIM A;  3OWT A;  2XAS A;  3G2B A;  3PL8 A;  5IT9 Z;  5HLI A;  1EJ9 A;  2ECB A;  1MD0 A;  1WH7 A;  2RC4 A;  4A93 J;  4FCY A;  5FKN A;  1ZTR A;  2MBF A;  3OYK A;  4BBR J;  4JX5 A;  3OOP A;  4M6V A;  1E0E A;  4IJA A;  1S72 I;  1T98 A;  1WI9 A;  3VYU B;  4HV5 A;  4EM0 B;  3S1R J;  3RCO A;  3ERE D;  2K3P A;  3R4K A;  4KMU X;  4C3H J;  3WGG A;  4WK8 F;  5J1Y A;  1SEU A;  5E20 A;  3BCB A;  3GLL A;  2ZJR F;  2MAB A;  3CCE I;  2KL4 A;  3ZMU A;  1J0R A;  3L7W A;  1R36 A;  1GXQ A;  4U7D A;  2UXX A;  1SVM A;  3I55 I;  3SHF A;  2IRF G;  3K70 C;  1WHU A;  4XLF A;  2KP6 A;  3VOE A;  2ETH A;  3JSP A;  2R7W A;  1BIB A;  2PQ8 A;  1VND A;  2A68 F;  2KZG A;  4BDZ A;  5FFX A;  4IVN A;  3WTT C;  1XMA A;  3Q9S A;  1JHH A;  2JN6 A;  2JA2 A;  3BR6 A;  2LH9 A;  3OS2 A;  3IAS 2;  1F1Z A;  1XDS A;  2J5P A;  3K0L A;  1WJC A;  3S3N A;  3RKY A;  1TWA J;  3N4M A;  2ME6 A;  3RPU A;  3C7J A;  4E6K G;  1R9T J;  2VBW A;  1YLF A;  4HX8 A;  4DYR A;  4B3A A;  3HYI A;  4F91 B;  1KU3 A;  4M71 A;  2UWM A;  1SVO A;  3G1L A;  3DQV C;  4UB6 C;  4IHW A;  1TQM A;  3V8K A;  3PQK A;  3KP2 A;  4PGH A;  2K5C A;  5IPA A;  4CIC A;  2NVX J;  4YEJ A;  4RB3 C;  2DOA A;  3EUH C;  2CQK A;  5E3M A;  4V2F A;  5K7H A;  5FD5 A;  1APL C;  5DD4 A;  1ZR4 A;  1UEL B;  4XOR A;  1CGP A;  3B6C A;  2VXZ A;  4UUV A;  2ZFU A;  1VQ7 I;  3TOA A;  3HKZ A;  2CYY A;  4A3I J;  2V6C A;  3W2V A;  3PO2 J;  2WB1 N;  4MNU A;  1SC7 A;  5HOO A;  1VTN C;  3LOC A;  3MVP A;  2DA2 A;  4TV7 A;  5EGO B;  1YIO A;  4BXX J;  4I98 B;  4ZYD A;  5D8L B;  4EM1 A;  3OYF A;  3ZCO A;  4XKW A;  2ZCW A;  4JOM A;  4IQJ A;  2MLK A;  1D5V A;  2QVO A;  4A5N A;  2ZJ2 A;  3CDH A;  4IOA F;  4Y17 A;  4HQE A;  2AO9 A;  2WAQ A;  4G94 A;  3FXL A;  3JRA A;  1UB9 A;  4BAY A;  3CCM I;  3A0H C;  4V2G A;  2DAO A;  1TBX A;  2OU2 A;  1UHM A;  2DCE A;  2OTJ I;  1WRJ A;  3DEW A;  1G2H A;  3KP4 A;  1O3R A;  4I7H A;  1NHA A;  1TT0 A;  1IDZ A;  3VB2 A;  2Q1Z B;  3B02 A;  4M6X A;  4ZTF A;  3ZQI A;  3LA3 A;  4PGG A;  2QQB A;  1AKH B;  4L5J A;  1FMW A;  2LSO A;  3TDU C;  4RS8 A;  4NHJ A;  2Y30 A;  5BS6 A;  2MW8 A;  1HST A;  5FLM J;  3MD2 A;  1T6S A;  1DQU A;  3H5R A;  4F52 A;  2VPR A;  1TNT A;  5IYD J;  1SAU A;  3DLL F;  2Y0S N;  1C0W A;  5D5X B;  2DOF A;  4BH9 A;  4L18 B;  2L9R A;  5J1R A;  2K4J A;  2VN2 A;  4M74 A;  4XKB A;  4BGD A;  3HRM A;  4DZP A;  2IJL A;  1VQ8 I;  1V55 H;  2DA5 A;  2IS2 A;  2IS1 A;  3VEP A;  5EJC A;  2BHY A;  3FIS A;  4IX7 A;  4G12 A;  4D7N A;  2XHK A;  3E5X A;  2O5R A;  1LFP A;  2O8K A;  2HNH A;  3KE2 A;  3PJR A;  2X9D A;  1FY7 A;  4M3G A;  5E3L A;  3CD6 I;  3F6O A;  4QPO A;  2HZD A;  4LIU A;  3SFI A;  4XRS A;  1R1T A;  2DO7 A;  1MBF A;  4O5V A;  1Y1W J;  1X3W B;  2K3F A;  1JUS A;  5C4X J;  3HHG A;  2ZXI A;  4W1U A;  1ON1 A;  5IP7 J;  4UUT A;  3V8L A;  1FP2 A;  5LGU A;  1QHG A;  1YYV A;  2YS9 A;  5J6X A;  1XCV A;  4CA0 A;  4QIW N;  4HAM A;  1Z21 A;  4YRV A;  3FBN B;  2GM4 A;  2QWW A;  2XSJ C;  1WJA A;  1QPI A;  1MKM A;  2CWE A;  4YII A;  4DBR A;  3J80 K;  3LNQ A;  3O6B B;  1R23 A;  3GFL A;  4BL0 B;  3F6V A;  3RQI A;  1HW1 A;  2VKV A;  5BMZ A;  2IS6 A;  1VQL I;  5E1Z B;  2K27 A;  2BW3 B;  4CUG A;  1ZH5 A;  3FXM A;  2EV0 A;  4BJT A;  2VC1 A;  2DQL A;  4JX4 A;  4MQ9 F;  3S3O A;  1K4T A;  5IOY A;  1FWZ A;  1WPK A;  3OYJ A;  1JT0 A;  3HPH A;  4BNC A;  1HKS A;  3LFU A;  3T5X A;  2LK2 A;  2Z99 A;  4B4C A;  5DCM B;  1B9M A;  4A0X A;  2EFO A;  1XSV A;  3UR3 C;  3QAH A;  2L2O A;  4C2M J;  3JRI A;  2LF8 A;  1RRJ A;  2R5Y B;  3S1N J;  5LRS A;  2X0L A;  2ZME C;  5HS7 A;  2DMQ A;  2JMW A;  4L0Z B;  4Y33 A;  3LSK A;  2L0K A;  3JRE A;  3E6C C;  4KIF A;  3QYF A;  1F9N A;  1U2W A;  2MG4 A;  3I59 A;  4BXU A;  2RGV A;  2H09 A;  2RVC A;  3FXK A;  4D9J A;  2BGC A;  2DTR A;  2YU9 J;  2YX7 A;  5E79 C;  3A01 B;  1L0O C;  3KFW X;  4E7I A;  4FE7 A;  3HSR A;  5TRD A;  1D0Y A;  2TCT A;  1ERD A;  5HNF A;  1A04 A;  4LD5 A;  1QZY A;  4PUS A;  3QYB A;  4X1E A;  5F1J A;  4A6D A;  3L2W A;  3PIP F;  2DOE A;  2VOO A;  1LNW A;  1OYW A;  2VBZ A;  3CCV I;  3H3U A;  1T0F A;  3H9G A;  2QSH X;  3QU6 A;  3I4M J;  1UFM A;  1JKO C;  2BYV E;  1V5E A;  2ZFW A;  2NVU B;  1UHS A;  4OOI A;  1IUY A;  4E70 A;  3UNG C;  3IV5 A;  2LKP A;  3EUA A;  1Z91 A;  1PP8 F;  4HPQ A;  3A02 A;  3OL3 A;  3V7C A;  4II2 A;  3EUK L;  3L2C A;  1A31 A;  2W4S A;  4LLG F;  2QM3 A;  3JAM Z;  5CQE A;  1EV7 A;  4CYC B;  4E7S A;  1XSD A;  3H35 A;  2ME0 A;  5D5U B;  1I39 A;  3SEZ A;  2NVY J;  4E7Z A;  1OCC H;  4YFN F;  5E1X A;  1P7J A;  3QU3 A;  5BPD A;  2HEO A;  2PFB A;  1IC8 A;  2VC0 A;  2F5V A;  3QP6 A;  4EQQ A;  1BR1 A;  3BPV A;  1R7J A;  2OZU A;  2LG4 A;  2QQ8 A;  3Q9V A;  4E7L A;  3RZD J;  1YG2 A;  3E6M A;  5BQT A;  3M1E A;  1I1S A;  1U6G A;  4Q4Z F;  1SVL A;  1R6R A;  5BNG A;  3H0D A;  1OLT A;  2KRF A;  2E1N A;  3KPH A;  5J1U A;  4YG2 F;  2IW5 A;  2L7K A;  2MGQ A;  2QKL B;  2QGU A;  1FMV A;  2IA2 A;  3M8J A;  2DOD A;  5F08 A;  4WWC A;  1MDM A;  1S5L C;  2DU9 A;  3CUQ B;  3DBH B;  2CUJ A;  3TBI A;  3T0Y A;  2IA1 A;  2K9Q A;  1FPQ A;  4A12 A;  2M7A A;  4CZZ A;  5B1B H;  3RPQ A;  2R7Z J;  2L54 A;  2HFH A;  1U5T B;  3LA2 A;  5ILV A;  5KHD A;  2F4I A;  4NNJ A;  5F6F A;  3GTJ J;  2NVT J;  4Y7N J;  4A5M A;  4AVZ A;  2Q0O A;  2M45 A;  1IW7 F;  3O2P E;  1E3O C;  3O3K A;  3JRG A;  3J80 Z;  3I54 A;  2A6E F;  1QGP A;  3F22 A;  1REP C;  1A6I A;  3C2B A;  3RPU D;  4A3D J;  2GIZ A;  2L9N A;  4HLX A;  4LGW A;  2VBX A;  1BI3 A;  3AG1 H;  2ZSH B;  1F36 A;  5JLW A;  1MMA A;  3BZK A;  2IGN A;  1MZB A;  1ETV A;  2DTZ A;  1I6H J;  3WTS C;  2VL8 A;  3FWE A;  1OCT C;  4RB2 C;  3G4S I;  4ZDL A;  1EKE A;  1TNS A;  4DQ2 A;  1W0T A;  3RIR A;  2H8W A;  3WTV C;  4M9X A;  4MGR A;  3J81 K;  1IN7 A;  4CCO A;  3MKY B;  3G73 A;  3IKV A;  2LYC A;  1JI8 A;  4FQG A;  4LG3 A;  1J2X A;  1X19 A;  1ZKG A;  2IGM A;  4XLN F;  1K61 A;  2VT3 A;  2IPQ X;  2IP2 A;  1B6A A;  1P7I A;  2IBD A;  4XOP A;  2A07 F;  5FFZ A;  1TQP A;  5HDK A;  1ZG5 A;  3HL2 A;  3FMS A;  1WCM J;  2ZKZ A;  5D4R A;  2JRM A;  2L7Z A;  4XKC A;  1S6L A;  2STT A;  1LDD A;  5K1Y A;  1E3P A;  5M5Y J;  1ETO A;  4XRM A;  2HZT A;  3W6V A;  2CSO A;  2E7W A;  5LRR A;  1HBX G;  2K9S A;  1HSJ A;  5HDG A;  1T56 A;  1HKQ A;  2M0C A;  3CLO A;  4XM3 A;  4UV8 A;  3CCR I;  2BXZ A;  5CVI A;  1NH3 A;  3L2U A;  1H8A C;  5E8I A;  4AIJ A;  3KZI C;  4II3 A;  1VQK I;  4XSX F;  4XR6 A;  1U8R A;  3L00 A;  5JR3 A;  1GHC A;  3HC7 A;  3F8M A;  1EF4 A;  2A6H F;  2PEX A;  4J00 A;  5FRN A;  2K9M A;  2CW8 A;  3SZP A;  1RUN A;  4BS9 A;  1IG7 A;  1FIA A;  3U1D A;  2L02 A;  4XLH A;  3GLX A;  3M8E A;  2KFD A;  5D5W B;  2KLO A;  2LC2 A;  3MWM A;  2BVM A;  3ABL H;  1YW8 A;  3VOD A;  2H6B A;  1R1V A;  3F3X A;  1LFB A;  5EGO A;  2FNA A;  3EYI A;  1J7K A;  2W00 A;  5EZH A;  3K2A A;  1YJW I;  3K6G A;  4Y4R A;  1Y1V J;  1JT6 A;  1XMK A;  1MJA A;  2RAE A;  1U9O A;  3MKZ A;  2FD5 A;  2PBI A;  1M1E B;  4EJO A;  4M9Z A;  1SFO J;  4HNT A;  2QA4 I;  2DK8 A;  2G7H A;  2XIG A;  3R0J A;  4YFK F;  2R93 J;  1MMS A;  3DPU A;  1JKR C;  2O03 A;  4D1Q A;  2MH9 A;  5F0H A;  3F8B A;  3WTY C;  1T8I A;  4PSW A;  4KN4 X;  2W84 A;  5JVG F;  2AS5 F;  4HV6 A;  1RR7 A;  2A61 A;  2BHZ A;  2KHM A;  2P5K A;  2XF5 A;  2Z16 A;  3IWZ A;  1W36 D;  1O3Q A;  3H9Q A;  3BWG A;  4RLF A;  1IN5 A;  2A05 A;  1ZN2 A;  5HOD A;  2GLO A;  3BCA A;  1DU6 A;  4F93 B;  2JA5 J;  2FBI A;  2OCE A;  1ACI A;  3ZMT A;  5L3E A;  1LB2 A;  1I3A A;  3SZG A;  1AKH A;  3WTW C;  3VWB A;  3IL2 A;  2D45 A;  3P9K A;  1MND A;  2VJ5 A;  3BT9 A;  1DP3 A;  2W7N A;  2HVQ A;  2ESH A;  5FGM A;  2OQG A;  3CC2 I;  5EYR A;  4NB5 A;  3KLN A;  3PSI A;  3WGH A;  4IHS A;  1SMY F;  2JSP A;  2LKX A;  2E19 A;  2Z3Y A;  3JRF A;  1SFU A;  3BTJ A;  3IH4 A;  3FM5 A;  3I9V 2;  1V5G A;  2VON A;  5CQG A;  2HOS A;  2X1E A;  4XMY A;  2NS0 A;  1Z9C A;  2CUE A;  3ZMV A;  2A6T A;  1NTC A;  3KLO A;  1Z05 A;  4ENK A;  2DMP A;  1YW7 A;  1ZLJ A;  2COB A;  2L7F P;  2V26 A;  3HTU A;  3TO9 A;  4BEH B;  1YJN I;  4A0Z A;  3ZQG A;  5EF6 A;  2BE5 F;  3KP5 A;  5CYV A;  3JTH A;  2AXL A;  3HOU J;  3S1Q J;  1QVU A;  2FJ1 A;  4CYD A;  2HQ5 A;  3KIO A;  1Z3Y A;  4KNY A;  2L9S A;  4NQW B;  4H4K C;  2NYX A;  1KYW A;  1TQI A;  3I58 A;  2HQR A;  2JWT A;  3CF5 F;  1KGS A;  4D7M A;  2E5Z A;  4L5I A;  3J81 Z;  1H88 C;  1BOA A;  2GIV A;  4I6Z A;  2H1L A;  4WXC A;  3SDB A;  4A3K J;  3CF2 A;  3PSF A;  4OIO F;  2KDO A;  2VJI A;  3WHC A;  4U0Y A;  3U21 A;  3CTA A;  3BZ6 A;  3AAF A;  3CME I;  1KON A;  2X1C A;  3FBI B;  4ETS A;  1LDJ A;  2BBY A;  4RBO A;  1IXS B;  4J19 A;  1U9N A;  4OIR F;  3TMO A;  4AIH A;  2HYF A;  1R4N B;  1WSU A;  4KIC A;  2W82 A;  1MSF C;  1VQ5 I;  2DFE A;  4BE1 A;  3JRD A;  2XB5 A;  3QOE A;  3HOV J;  2BW3 A;  1R5G A;  2ZSI B;  3CQZ J;  3ECO A;  3T1B A;  2KMU A;  3LFK A;  4IRI A;  2PX9 A;  2QSG X;  2GAU A;  1MNE A;  3LSG A;  2VQH A;  1R1U A;  4RLQ A;  2BY0 A;  1S8N A;  5FO5 A;  4LFU A;  5ICC A;  2X48 A;  3OIP A;  4GCV A;  5FLX K;  1GLN A;  5KVR A;  2ZJP F;  1XX5 A;  1YX3 A;  2VAS A;  2HDD A;  2R4G A;  4HRI A;  2NVQ J;  3CO6 C;  2R5Y A;  4K2E A;  4PZJ A;  4BU2 A;  2EFP A;  4HZF A;  3TQN A;  3S1M J;  4DZJ A;  4BJ5 C;  3OMY A;  2V9P A;  1O7L A;  1BW5 A;  1EH6 A;  5IP6 A;  1IJW C;  4FIS A;  1FOW A;  2N8G A;  3CP8 A;  3LSR A;  1DPR A;  2JK3 A;  3DKW A;  3DKY A;  4U0V A;  1YI2 I;  3A01 A;  1ZQ3 P;  2ID6 A;  3PUB A;  1QHH D;  3GCM A;  3IRQ A;  5LHH A;  4R1H A;  2PLY A;  2L7M P;  2ACJ A;  3GTO J;  1YS6 A;  3FM3 A;  4BQO A;  1U3E M;  1FBQ A;  2XF6 A;  1X4P A;  3DFG A;  2COM A;  3WTU C;  1O4X A;  3HRS A;  2XKP A;  1ODD A;  3I0T A;  1YJ9 I;  4HDV A;  3JRB A;  2VPL A;  2XAQ A;  2OQR A;  1FIP A;  5J4Y A;  2CV0 A;  1Z6R A;  1OCR H;  2MYS A;  3WG7 H;  4DYC A;  2EWN A;  1RKT A;  3HOW J;  4FAS D;  3BZC A;  4A3J J;  1DUX C;  4IHX A;  4S04 A;  4IHY A;  3ZR8 X;  4G9Y A;  2R7V A;  3OS0 A;  4CYC A;  4L9T A;  5DYM A;  2GOM A;  2EK5 A;  2Q2E B;  3ZQL A;  1X3Z B;  3E0J B;  3BG5 A;  1YE9 A;  2G7U A;  3GTG J;  3AKZ A;  1F5T A;  1X58 A;  3PNV A;  3ZRG A;  1VQP I;  1G6N A;  2O0Y A;  3ZQC A;  1ON2 A;  1P4A A;  2NS7 A;  4RAZ A;  2P6T A;  3HIF A;  3OYN A;  1SMT A;  3AG3 H;  4WXH A;  3BDD A;  1WWX A;  2DN0 A;  4BQN A;  4OMY A;  3FXQ A;  2DMU A;  4BJ6 C;  2VOP A;  1A6Q A;  4FTH A;  1TW3 A;  3QWL A;  4JP0 A;  4NC8 A;  4XL9 A;  2D2W A;  3ZP5 A;  2M4G A;  5DEQ A;  3DF8 A;  2HKX A;  2E5N A;  4DOZ A;  2VOD A;  3M3Y J;  2IGO A;  4A3C J;  1RES A;  3RKQ A;  3FZV A;  1K4S A;  4NC6 A;  3CUQ A;  3P9C A;  3JRH A;  3P7N A;  3OSG A;  5GAG J;  2CRG A;  3RTR A;  5AON A;  1B59 A;  3WOD F;  3P9I A;  4RGS A;  1WGX A;  1LDK B;  3K4N A;  3FXJ A;  4I99 C;  4OWR B;  1KU9 A;  1U5T A;  1P4X A;  4M72 A;  5CPR B;  4Y52 J;  1ZLK A;  4ZZD A;  1XGM A;  3D5L A;  2R7R A;  1G59 A;  4JQF A;  3ZMD A;  1WZ2 A;  3K2Z A;  2VE8 A;  3M7G A;  4BHP A;  2VUM J;  2JRT A;  3PUF A;  2HVR A;  2PJR B;  2V1D A;  3K10 A;  1ETY A;  5FJ8 J;  5HLG A;  3OR1 C;  5DUI A;  3BTC A;  2FRH A;  1BR2 A;  1D1C A;  2OD5 A;  3NQO A;  2EFN A;  4UVC A;  2BY1 A;  3E3V A;  3TP3 A;  2OPT A;  3HDD A;  1N25 A;  4CO8 A;  5HVQ C;  2FQ4 A;  3F8C A;  3MMY B;  4E4H A;  2E1C A;  2F4O B;  3PQJ A;  2MLG A;  2CJJ A;  1IRF A;  1S9H A;  3GTQ J;  2K9N A;  3Q0U A;  1QVT A;  2WAQ N;  2AQE A;  4HNU A;  5HNH A;  1D8K A;  4CHU A;  4RB0 A;  5EEG A;  3ZQF A;  4X0G A;  4EAT A;  1VF9 A;  1BR4 A;  3G3Z A;  4FHT A;  3X2Q H;  2ZJQ F;  5KNL A;  3CUO A;  3FXO A;  4RB1 A;  2R7S A;  2IGK A;  4HX4 A;  4PJM A;  4GYG A;  1WH5 A;  1DGR M;  1A35 A;  2E35 A;  2Y2Z A;  5B66 C;  3V4G A;  4UVB A;  3DWL E;  5E8G A;  3FHN A;  2E2H J;  2XF7 A;  5FD6 A;  1STZ A;  1ZAR A;  2UZK A;  3TOB A;  2P5L C;  3KP6 A;  2EV6 A;  2CFO A;  4XLA A;  1I5Z A;  3ZGK A;  4A69 C;  5CVU A;  2E2J J;  4IXA A;  2XGD A;  1FT9 A;  4EM2 A;  3DPT A;  1FOY A;  3QRF F;  4FE4 A;  2K9L A;  2DFI A;  2E2I J;  1NK3 P;  2RQP A;  1U8B A;  2LF7 A;  1LVA A;  4M3E A;  4QTR A;  3RJP A;  3BR2 A;  1FSH A;  1MGT A;  3TDZ C;  2ZB9 A;  3IKT A;  5BOX A;  3K4K A;  2E36 A;  1WJB A;  2NNY A;  1MBG A;  2FML A;  5CLS A;  2R7D A;  3W2A A;  3OR2 C;  4GXO A;  3GYH X;  4OAY A;  3MAJ A;  2HKO A;  3CLQ A;  3CES A;  1PYV A;  1T95 A;  1IXR C;  3ISP A;  1Z7U A;  4AU7 A;  4HNV A;  2QQ9 A;  4P96 A;  2CMP A;  5C3E J;  4OIQ F;  4B48 A;  2Z5U A;  3DTE A;  3RI4 A;  1VQM I;  1AHD P;  2YR2 A;  1H9T A;  2LOO A;  4F7Z A;  2IEK A;  1Z6T A;  2CUF A;  2UV1 A;  3FMQ A;  5JI6 A;  3ZPL A;  2X6O A;  4WCG A;  3EQL F;  2XPV A;  3FKI J;  4BHB A;  5EDN A;  3OYG A;  2Y69 H;  3Q3S A;  2CW0 F;  3GZ5 A;  2HOT A;  5HLH A;  5DD8 A;  1Y8R B;  4C2U A;  5D6E A;  3E6B A;  3WHB A;  2B9S A;  1HDD C;  1SD7 A;  1IF1 A;  2P7C B;  4HA8 A;  3BJO A;  1BOB A;  5J40 A;  3BTL A;  4C9Y A;  2OTL I;  3KP3 A;  4G6D A;  1Y39 A;  2XPW A;  1GT0 C;  4PJN A;  5GAH J;  1ETK A;  1W7P B;  5C44 J;  1TTY A;  1RI7 A;  4G7Z F;  1I3Q J;  2CQX A;  3QPL A;  4IHV A;  3IH3 A;  3S14 J;  2NOG A;  3WGI A;  5HS9 A;  1VQ6 I;  1ORK A;  1O3S A;  3LSP A;  3FMR A;  3ASO H;  1ULY A;  4U0W A;  3EDP A;  1YQA A;  2CH0 A;  2P5V A;  2E1M C;  2HOE A;  4DJA A;  5B3S H;  1TZL A;  2PMH A;  3TW6 A;  3CO7 C;  1HOM A;  1A5J A;  2MC3 A;  4GDF A;  4KMF A;  5F04 A;  1K78 B;  1FJL A;  5K7Z A;  1L3L A;  2XVC A;  1BI2 A;  4B47 A;  1MMD A;  2FOK A;  1IXC A;  2GA2 A;  1BJZ A;  5J4V A;  2OUM A;  2WTE A;  2HDW A;  5M5X J;  3FKJ A;  4GO1 A;  1XC5 A;  1Q1V A;  3CJN A;  2LMD A;  3K4M A;  4BEH A;  3ONQ A;  2DK5 A;  4ZH4 F;  3MEX A;  2D5V A;  2ZNY A;  3GXO A;  4U88 A;  3HGG A;  5JVT A;  2E71 A;  2M1B A;  3RZO J;  3IUO A;  4KIT B;  3BR3 A;  3Q5F A;  4ZYA A;  1MBJ A;  2QEN A;  4M3D A;  1U78 A;  4NQW A;  5H20 A;  5FKO A;  2R0Q C;  5F0F A;  1MBE A;  1Y0N A;  3DEU A;  3H36 A;  2ZXW H;  3AFH A;  2Y48 A;  4KN7 X;  2NRA C;  1JXS A;  3OYA A;  4JYK A;  3GBG A;  4B43 A;  2JQ7 A;  2DDB A;  4ZYE A;  2C6Y A;  1FLI A;  2O3F A;  3F8N A;  3Q0W A;  4O3M A;  1JE8 A;  2UUZ A;  4IQ4 A;  3CDI A;  2OJE D;  2FEZ A;  2I5U A;  2KJB A;  2X51 A;  1WI3 A;  3ZN0 A;  2IVM A;  3GEZ A;  6PAX A;  1J09 A;  1B72 B;  2Y31 A;  2HQN A;  3R0A A;  4G7O F;  1UAA A;  2DA1 A;  2E1O A;  5JFR A;  4CXF A;  2NS8 A;  3KP7 A;  2HPM A;  2F5D A;  3GWZ A;  4I76 A;  3COA C;  1ZRC A;  3OYH A;  5HS8 A;  1W36 C;  4IRH A;  1QRY A;  2LLK A;  2MFZ A;  5KAI C;  2VQG A;  3H92 A;  2RKH A;  4P5O A;  2EIK H;  1X4O A;  2V1X A;  4RAG A;  1UST A;  3OIO A;  5D4S A;  4UY8 I;  2QBY B;  4RGU A;  2JA6 J;  2ISZ A;  5FRO A;  2KIU A;  2PMU A;  3BC8 A;  2BEO A;  4C2T A;  4GRI A;  5M3F J;  2EFW A;  2YUS A;  4LLN A;  2DFF A;  5CVV A;  4HF0 A;  3DBL B;  1TL8 A;  2WAD A;  5E1W A;  4KIS A;  3PIO F;  3ML6 A;  3ZQQ A;  2XRN A;  3HXL A;  1IRZ A;  2EZH A;  4S0H B;  3DEE A;  4NBQ A;  4B44 A;  3LST A;  2YSR A;  3GME A;  2EIM H;  1H89 C;  1FBU A;  3CCL I;  2AQF A;  1R49 A;  3S17 J;  3SFZ A;  5ICG A;  2FBH A;  4I2O A;  3GFJ A;  3PNY A;  4I0A A;  4B09 A;  1FTZ A;  1HKT A;  4AUX A;  1XGO A;  2KJC A;  3L2V A;  4LIV A;  1PUF B;  2KDZ A;  4BY1 J;  2IXS A;  2XB0 X;  3SYT A;  3CCS I;  1O3T A;  2KIS A;  2VJJ A;  3BRO A;  1MH4 A;  2NAZ A;  1FOK A;  4DIQ A;  3AL0 C;  2LKS A;  3VFZ A;  2L4M A;  2DQR A;  4HSR A;  1OCZ H;  2IA0 A;  4XN3 A;  3MZY A;  4NUB A;  2Q2E A;  3OYE A;  2M7B A;  4IEJ A;  5FRM A;  4Y15 A;  5L3F A;  4AVP A;  4IO9 F;  2HQA A;  4AC0 A;  1ZGW A;  1LKX A;  2RQQ A;  2QQA A;  2XKO A;  5J3L A;  4MLO A;  4KT5 C;  2DFH A;  2M9H A;  1FYM A;  1B8I B;  4KA4 A;  4XRF A;  2ZME B;  3CCJ I;  4UXN A;  4JX6 A;  2K85 A;  1CF7 B;  1ETW A;  3HOZ J;  4P9F A;  2HR3 A;  3W6K B;  4PJJ A;  3KZY A;  2Y75 A;  4BHC A;  4BBS J;  2EA4 A;  3BPX A;  2XGC A;  1FC3 A;  1FTT A;  2ELH A;  3RQ4 A;  2G9W A;  1T0F C;  2QSF X;  3E97 A;  1X1P A;  5GAD J;  2XC7 A;  1W5C C;  4OIN F;  2LRE A;  2ZNZ A;  1YIT I;  3H0G J;  3ROU A;  1G3W A;  3HB9 A;  4A3B J;  2R7U A;  1QNT A;  3H9J A;  1IO2 A;  1WFX A;  1J9I A;  1X1A A;  3V8J A;  2W48 A;  5DS9 A;  1SAN A;  5IYC J;  2V9K A;  2K4B A;  2BV6 A;  4L0Y B;  1B9N A;  2VKD A;  3M9A A;  4WF2 A;  3TED A;  3GTM J;  3VYT B;  1QZE A;  5HDN A;  2PJR A;  2V79 A;  4KUM A;  3IAM 2;  4B1R A;  3V7S A;  1IZ1 A;  2JUC A;  5F64 A;  3DV8 A;  4BDY A;  4IOC F;  1IN6 A;  2JPC A;  5LD2 C;  4P1W A;  2XGE A;  1NK2 P;  1P9Q C;  2W1O A;  3F8F A;  4BYY A;  2M4K A;  2XRO A;  2VJ4 A;  3FXR A;  1ONV A;  5A2Q K;  4YIR X;  1MSE C;  1LJ9 A;  2DA3 A;  2TDX A;  1G3T A;  1FEX A;  2H94 A;  3AG2 H;  3FXU A;  3LSH A;  3Q0V A;  4M3F A;  5FB2 A;  1XMX A;  2A3S A;  3J7A Y;  3E5Q A;  2V6E A;  3L2R A;  2XUB A;  3JW4 A;  2HTS A;  2ZXH A;  4C3I J;  1KQ0 A;  2KQR A;  1SFK A;  1W0U A;  4AWX B;  1H9G A;  4AID A;  1FYK A;  3K1M A;  1HA8 A;  3OYI A;  2QLZ A;  4V19 K;  3DU5 A;  2M34 A;  3I4P A;  2D1H A;  2PMZ A;  4AYB A;  1ZG1 A;  1FBS A;  2DT5 A;  4UB8 C;  1ZRF A;  1OR7 A;  2KRH A;  2VKE A;  3M8F A;  2O8X A;  3S3M A;  2QCO A;  1X1C A;  3A4C A;  2YPR A;  5LEJ A;  5F0C A;  2Q8K A;  2X6X A;  3RKX A;  4EJT A;  1MMG A;  1Z67 A;  5DUK A;  4IKF A;  4CDG A;  1Y0U A;  1IV8 A;  4N9H A;  1FNN A;  5KK1 A;  4HF1 A;  2PJP A;  3M4O J;  1B1B A;  4Z2Y A;  4LLL A;  5DCF A;  1POG A;  2O61 A;  1EA3 A;  2HTJ A;  4RDU A;  4HF2 A;  1HDP A;  1NG7 A;  5BPI A;  4JK1 X;  4XON A;  2EJR A;  1VQ4 I;  2H6C A;  4Z6Y A;  1GUU A;  4XLP F;  4PJL A;  2KIM A;  5EG0 B;  3HHH A;  3OIQ A;  1SD5 A;  2JTV A;  1D3Y A;  3QYE A;  1JJ6 C;  2DMT A;  3U9G A;  2I10 A;  4HDU A;  4C3J J;  4N0B A;  3NWS A;  1UCR A;  4XSZ F;  1CQT A;  1AU7 A;  5IY5 H;  1ZG3 A;  1LUJ B;  1RC9 A;  1JTX A;  2KPM A;  2OZ6 A;  1WKM A;  1IRG A;  4BE2 A;  3NEU A;  3ZQH A;  2D1V A;  3C1D A;  1GDT A;  2IAI A;  4HX7 A;  3GZN B;  1BIA A;  2FQ3 A;  5FKL A;  4F92 B;  4Q5S F;  3K4L A;  1AOY A;  1TWH J;  1XGN A;  2IS4 A;  2CW7 A;  3PFI A;  2DPU A;  1R5H A;  2M87 A;  1T08 B;  3DKX A;  4ANJ A;  4I0B A;  3J7Z I;  2J5O A;  1RNL A;  2RDP A;  1O57 A;  2EIL H;  4MHG A;  2LY9 A;  4X6A J;  4PJ0 C;  3TKY A;  1W7P A;  2W24 A;  3BG6 A;  3OOU A;  2CS3 A;  2HXO A;  1V3F A;  1O7F A;  3HM5 A;  2PN6 A;  2ZO4 A;  4EJV A;  5LGN A;  3EUH A;  2MSY A;  2OF7 A;  2ELK A;  3ZMS A;  3KZZ A;  4UHT A;  3HJE A;  5DCM A;  3SEQ A;  1XCB A;  3V7R A;  2CGP A;  4DW6 A;  1HW2 A;  1R00 A;  3QP5 A;  4D5F A;  3VDX A;  2ZC2 A;  1D8J A;  5GP9 A;  3P5J A;  4EMS A;  1DU0 A;  1FOX A;  1DGW Y;  3S2H J;  1JGS A;  2XAG A;  2LP0 A;  4JBA A;  3H3Z A;  3O8H A;  2FBK A;  4ESF A;  2QEX I;  2DDA A;  4CCK A;  2FX0 A;  1K78 A;  1ENH A;  4Y3O A;  3W2W A;  3GUD A;  4UUS B;  1SFE A;  2F6C A;  1WVR A;  2FU4 A;  4ENM A;  4B3X A;  4UNO A;  1VZ0 A;  2FE3 A;  3J7A O;  4CCM A;  5JHF A;  2M8G X;  5C4J J;  1Q1H A;  1EH7 A;  1HLV A;  2W25 A;  1YHQ I;  4PSX A;  3KCC A;  4ZYG A;  2WAE A;  3BJ6 A;  4U87 A;  2EA2 A;  2K02 A;  3HEF A;  4WX9 A;  3B6A A;  3K1P A;  1T38 A;  2CQ7 A;  3FDY A;  5D5V B;  1PP7 U;  2HXI A;  2R5Z B;  2GZW A;  1UHW A;  1S7A A;  2AHQ A;  1UJ8 A;  2P8T A;  2W57 A;  3K4B A;  4EEF G;  4YFX F;  1EH8 A;  3I64 A;  5E3O A;  3U2R A;  2CQQ A;  2FOW A;  2DT6 A;  2LRD A;  5IT3 A;  1OR7 C;  3HOX J;  1BN5 A;  4GYI A;  1Z3X A;  5H6Q A;  4O6J A;  3CCY A;  1R71 A;  1GVD A;  1IAW A;  2GBY A;  3WU2 C;  3LAJ A;  1HF0 A;  1PUE E;  5H2F C;  4ZJZ A;  5M3M J;  3CMA I;  1Z1D A;  4ASN A;  2OBP A;  2R3S A;  3IP4 B;  2GXB A;  1B72 A;  5LGT A;  4BXF A;  3K1N A;  4KT6 A;  2RNJ A;  1WJF A;  1TP4 A;  1X2N A;  3HRU A;  1JKP C;  1IDY A;  2Z33 A;  4EJU A;  9ANT A;  2VI6 A;  1JTY A;  2M5W A;  4UV9 A;  1MNM C;  4BAC A;  3HOT A;  3E1S A;  1YX5 A;  5KAF C;  1I6X A;  4IHT A;  2O7O A;  1E2X A;  3ABK H;  2BVL A;  5GAE J;  1UMQ A;  5IYB J;  2V1U A;  2X85 A;  4DYQ A;  1G8X A;  2XRL A;  1NG6 A;  3S2D J;  2L4A A;  2V1N A;  5B5E C;  2QBY A;  1KQ8 A;  4YEL A;  1MJ9 A;  4KIB A;  1K83 J;  5D8K B;  2ICW G;  4A6E A;  1RZ4 A;  2K40 A;  4Q47 A;  1TC3 C;  1VQ9 I;  1X3U A;  1LE8 B;  3C2H A;  3WTX C;  4LIT A;  3ELK A;  2XV4 S;  1MBH A;  1OYY A;  1UG0 A;  3A1Y A;  3TW7 A;  1QO0 D;  1S7E A;  2EB7 A;  1FYL A;  3F72 A;  2LD5 A;  5AIQ A;  4XQF A;  4CCL A;  3FK6 A;  4C30 A;  2K7L A;  3N05 A;  2QUF A;  3BG9 A;  2JZY A;  5EEA A;  5DM6 F;  1I27 A;  3MZH A;  3L9F A;  1XG1 A;  5HLT A;  4E7K A;  2BOL A;  4DNC A;  1W4M A;  2XAJ A;  1MJB A;  2JT1 A;  1I50 J;  3HKZ N;  5TIS C;  4E7H A;  1V5F A;  1JHF A;  2BY3 A;  1ZYR F;  1PUF A;  1Z77 A;  2EIN H;  1BJA A;  2LDU A;  3PO3 J;  3F21 A;  3E6D A;  2DYR H;  2FXA A;  2VKH A;  2ZXJ A;  1YRN B;  2WB1 A;  3I71 A;  3QPT A;  3JTG A;  4XN0 A;  3RKW A;  4L5E A;  1D0Z A;  1VQO I;  3CP2 A;  2PI0 A;  3IRR A;  3JCU C;  5TGT A;  2K86 A;  1WJE A;  2BXY A;  2FA5 A;  2XPU A;  3AG4 H;  3L09 A;  5EZG A;  1V4R A;  3IHU A;  3PM1 A;  5FLX Z;  1R4M B;  1XTA A;  2HS5 A;  3I3L A;  2XDV A;  1PVE A;  3L2Q A;  5M5W J;  4EV0 A;  4P9U A;  2ZME A;  4G7H F;  1B8I A;  1J59 A;  1WJD A;  1CF7 A;  2DA6 A;  3F9K A;  3BJA A;  2WY8 Q;  1ZHF A;  4RMN A;  4ZTJ A;  3S93 A;  2QZ8 A;  3ZMZ A;  4HEA 2;  2I8D A;  4LJZ F;  3FHZ A;  1K6O A;  2P81 A;  3HZJ A;  2FSW A;  3ZN1 A;  2W85 A;  1P92 A;  2CFX A;  2JJ7 A;  3UKG A;  1N77 A;  4ZC3 A;  2ESN A;  4IPA A;  3VSL A;  3OYD A;  2GWR A;  1OCP A;  2EZL A;  4A3G J;  1ZK8 A;  2F48 A;  1IN4 A;  4ITV A;  2M0M A;  3MKL A;  3R60 A;  4XLE A;  5DM7 F;  3KYC B;  4S05 A;  2H8R A;  3CZ6 A;  3RYR A;  3JAM K;  2ID3 A;  1IN8 A;  1Y8Q B;  3LQR A;  2R92 J;  3CDL A;  1B4A A;  1ZRE A;  2CO5 A;  3KYD B;  1YOV B;  2XAF A;  3PFY A;  2VLA A;  2VT2 A;  1J75 A;  1QBJ A;  5JLX A;  2HPI A;  4XRS G;  1GV2 A;  2Y0S A;  3CJQ B;  3I56 I;  1YFH A;  1MW7 A;  1JUM A;  4A3L J;  2KIQ A;  3D5S C;  3QOP A;  3N97 A;  3C3W A;  4DBQ A;  2RN7 A;  1IV6 A;  2P0W A;  1I1G A;  3HSE A;  4A0Y A;  3WG9 A;  2H1K A;  1JKQ C;  1KYZ A;  3EYY A;  2DA4 A;  4AM3 A;  2CU7 A;  3F0C A;  4L9N A;  2RV8 A;  3ECH A;  3LA7 A;  1P2F A;  3LWF A;  5LHI A;  1HCR A;  1IRX A;  4R8H A;  5ILU A;  2QF7 A;  5GPA A;  2L9V A;  1OFC X;  1OMI A;  4MO7 A;  2DW4 A;  2LBF B;  4XKV A;  5K5O A;  3HOS A;  2B0L A;  2GA1 A;  1T39 A;  2GXG A;  4LOC A;  2ADU A;  1Z0X A;  1FZP B;  1XD7 A;  2RRE A;  3U1K A;  2EV5 A;  2ECC A;  2JUG A;  4KJZ A;  4M9S A;  2JSC A;  3D1N I;  4EGY A;  1OYI A;  3CUQ C;  3GFM A;  2H27 A;  4PCQ A;  3DBR B;  4RAF A;  3DXJ F;  1TT5 B;  3JR9 A;  1YS7 A;  2CV1 A;  2KIF A;  4RM2 A;  4AIK A;  1U5T C;  5GTH C;  3NAU A;  1OPC A;  3IWF A;  2NXN B;  4KFC A;  1Y56 A;  3OY9 A;  5J8C A;  2E60 A;  3S16 J;  4HST A;  1Z7L A;  3FK7 A;  3K70 D;  2A5W A;  3ABT A;  1XN7 A;  1LPQ A;  1MH3 A;  2F5E A;  3SJM A;  2WA0 A;  3HUG B;  5E17 F;  2WWY A;  4HW0 A;  5CVR A;  1D1A A;  1T2K A;  1YTY A;  4ZDO A;  1ITY A;  4KYW A;  5L3C A;  2DI3 A;  2EFQ A;  3GTP J;  3GTL J;  1VI0 A;  4CSW A;  2MH2 A;  4HOB A;  5L3D A;  3D5R C;  3MFK A;  4OIP F;  2Z2S B;  1QU3 A;  1V54 H;  5K7F A;  3DU6 A;  2RNG A;  1JUP A;  1W7P D;  3VPR A;  2LNB A;  1ETQ A;  5FKK A;  2WBM A;  2WAF A;  1XSX A;  2DXI A;  4WXD A;  2L01 A;  2LY1 A;  3CMM A;  1OIS A;  1QZZ A;  3HG9 A;  2A5Y B;  3S8P A;  5E18 F;  1JGG A;  2DMN A;  4XOT A;  2B7E A;  4FT8 A;  5EG0 A;  3ZOB A;  4G8X A;  4MEY F;  2XSD C;  5L3G A;  5LBQ A;  1DDN A;  1BL0 A;  3OYM A;  3E5U A;  4L9J A;  2BZT A;  4A2U A;  3LL7 A;  1MBK A;  3J7Y J;  1W5S A;  2OAZ A;  1GVJ A;  1MIJ A;  4LG0 B;  3BOQ A;  3NWT A;  2HYJ A;  1F4K A;  1QQI A;  3EPZ A;  3OYB A;  1S7O A;  4CCN A;  1SFX A;  4XK4 A;  1P6R A;  1WQ2 A;  3BY6 A;  4H0E A;  3GW2 A;  2VXD A;  5LFA A;  3G1O A;  1TW2 A;  2GQQ A;  2XGX A;  1N78 A;  5FKM A;  3WU1 B;  4LK1 F;  2O9L A;  5LHG A;  3T8R A;  2HOA A;  2X6Y A;  4RAY A;  3GO5 A;  4DGW B;  1QPM A;  3BP8 A;  5AIP A;  4FET A;  2HDC A;  1S3J A;  4RGX A;  1TLH B;  4N4N B;  4ESJ A;  4MFE A;  2OV7 A;  3HTS B;  2FF4 A;  2FNP A;  3IC7 A;  3L1P A;  3R6S A;  2LFB A;  2JA8 J;  2VE9 A;  3QOD A;  5LLQ A;  4J01 A;  3I5U A;  1D1B A;  2EIJ H;  3E7L A;  3KYL A;  2LVS A;  3CMY A;  4BUP A;  3C18 A;  2WC2 A;  1ZGJ A;  3BTI A;  2Y9Y A;  3ASN H;  4RA2 A;  4MTE A;  3M1C A;  1OCO H;  4B8X A;  2MC4 A;  4UUS A;  2Z9O A;  2VQL A;  3BLY A;  1OKR A;  3FX3 A;  3M07 A;  4BY7 J;  4N4O B;  4NDL A;  1ZAO A;  3KEO A;  5IOZ A;  3H3V K;  1LEA A;  2DPD A;  1HQC A;  2M30 A;  2GXA A;  1XGS A;  2FUG 2;  4GFB A;  2EPF A;  3HSF A;  1XPX A;  4W97 A;  2R5Z A;  1HW5 A;  4LMY A;  5K5R A;  2DJI A;  4RGR A;  3TL4 X;  3O8G A;  3G71 I;  3MQ0 A;  1UG2 A;  2ZBK A;  4QPQ A;  2HVS A;  2WV1 A;  3VYS B;  1ZEL A;  4QWQ A;  3K7A J;  1Y6I A;  3ESW B;  1PJR A;  3DCF A;  3FIW A;  5J8F A;  2HWV A;  3RDI A;  2L5Q A;  1XDU A;  3S32 A;  3GZ6 A;  1BBY A;  2YU3 A;  3BR0 A;  1SD4 A;  3OYC A;  4FX0 A;  2A69 F;  2E1M B;  2EH3 A;  3ABU A;  1A36 A;  2V9V A;  2JVH A;  1DP7 P;  1TWC J;  5GPC A;  2UXN A;  2NNN A;  3V42 A;  3SXY A;  2JA7 J;  4A3M J;  5DTD A;  3A03 A;  1N75 A;  4KIG A;  4XLC A;  4ZDP A;  4CZC A;  2FMY A;  1K79 A;  3KEY A;  2HU9 A;  4LK0 F;  4M73 A;  4G6T B;  5B1A H;  5L3B A;  3GVA A;  1ZRD A;  1BC8 C;  3DTI A;  1IGN A;  4PK4 A;  4IZZ A;  4EGZ A;  5ICE A;  4ESB A;  2ELJ A;  1LE8 A;  1R5I D;  1FSE A;  3LSM A;  4UVA A;  2DJN A;  5ERI A;  1RIO H;  1SAX A;  1X1D A;  2M3A A;  2VIX A;  1AWC A;  3TGN A;  1KU7 A;  5E3N A;  2CUZ A;  3HBL A;  1W1W E;  2OC6 A;  1LFU P;  4BQA A;  1R22 A;  2MD5 A;  4LB6 B;  5KCM A;  3K9T A;  5DDG A;  1HXD A;  2LY2 A;  5FLV A;  4ENJ A;  1K7A A;  1OJL A;  4PDK A;  2Y0M A;  2STW A;  2F4M B;  3FF5 A;  3GFI A;  2R7T A;  3QQA A;  4OAZ A;  3OS1 A;  3CCU I;  1YW9 A;  2Z1D A;  4L9V A;  2VQC A;  1GV5 A;  2TRT A;  2R7X A;  2WV0 A;  1AA7 A;  1BM9 A;  1X1B A;  3LSJ A;  3GTK J;  3I4N J;  3OYL A;  4FX4 A;  1YO5 C;  3T8T A;  4HBL A;  3SQN A;  4XIC A;  5F1R A;  1U0J A;  1ZR2 A;  3PNT A;  1YRN A;  4KDP A;  5ILS A;  1RR8 C;  3I53 A;  4CGZ A;  3LMM A;  4HYE A;  5EEH A;  4BE0 A;  2IT0 A;  1J5Y A;  3BR1 A;  3CJT B;  3DPL C;  5TJJ A;  3SZT A;  4R79 A;  4ZYH A;  4XID A;  1BC7 C;  4D5C A;  3CC7 I;  2B63 J;  3DLA A;  4OU0 A;  3BG7 A;  1D5Y A;  4I09 A;  3ABM H;  3WU0 A;  1KU2 A;  2R7Q A;  2JPB A;  2P6S A;  2P4W A;  1RPW A;  3HGY A;  2DA7 A;  1VQN I;  3GX4 X;  4HLY A;  4ABZ A;  3ERM A;  3TO6 A;  1D0X A;  4AD9 A;  2KKO A;  1LQ1 A;  1GXP A;  3HPG A;  5IT9 K;  3MCZ A;  2X6W A;  1G3Y A;  2WY7 Q;  3B73 A;  4I02 A;  1BA5 A;  4YIF A;  2PMZ N;  4AYB N;  2CV2 A;  4Y13 A;  4F55 A;  2CQN A;  2KT0 A;  2LR8 A;  3K69 A;  3REO A;  4ZZL A;  2BY2 A;  1T33 A;  2G0E A;  3QPS A;  4HG2 A;  4Q48 A;  5K5Q A;  4MEX F;  1LVK A;  2DT7 B;  1ZGA A;  2JVG A;  2M2E A;  1PDN C;  3H5A A;  1SD6 A;  3H1C A;  1E3H A;  4IF4 A;  3ZQ7 A;  3MN2 A;  5CVJ A;  3VSK A;  3GF2 A;  4F3Q A;  3DTK A;  4QSH A;  3JRC A;  2V4J C;  3WE3 A;  3G6E I;  2Y9Z A;  3KET A;  3AL0 B;  4M3B A;  2OA4 A;  4A3F J;  5D6F A;  3JSO A;  4P55 A;  3CC4 I;  2XAH A;  1KZH A;  2X4H A;  2KRC A;  1W5T A;  2R7F A;  3K4C A;  4PFP A;  4M6Y A;  1TWF J;  2HI3 A;  1FX7 A;  2VB6 A;  1F43 A;  1VFC A;  1RUO A;  3W3C A;  4NC7 A;  1UZC A;  2HGC A;  3I59 B;  2HYG D;  4EVI A;  1G3S A;  3TP0 A;  5ICF A;  1KQ9 A;  4D0P A;  1BW6 A;  2AXT C;  2MA3 A;  3S15 J;  2CG4 A; 
#chains in the Genus database with same CATH homology
 2QYO A;  4I01 A;  1FP1 D;  3D0S A;  3LAP A;  4MTD A;  1KA8 A;  5LEK A;  1S29 A;  4EJW A;  3WE2 A;  1BI1 A;  3ULQ B;  1USS A;  5JHU A;  4HQM A;  4G6Q A;  1BI0 A;  3RYP A;  4XBF A;  4GGG A;  4QLC U;  3LQQ A;  2M8E A;  1E17 A;  4U7B A;  4IRG A;  1R58 A;  2YX4 A;  3HUG A;  2E7X A;  4OMZ A;  4N9I A;  3WTZ A;  2DBB A;  4LB5 A;  5CJ9 A;  1DPU A;  2F5F A;  1P4W A;  2F2E A;  1XB4 A;  1G4D A;  2ISY A;  3HRT A;  3F23 A;  4ENN A;  2PG4 A;  1H0M A;  3TO7 A;  3NRV A;  2VBY A;  4MQV A;  5A2Q Z;  4ON0 A;  2L3D A;  2DLL A;  3DP7 A;  5H6R A;  1MDM B;  3R61 A;  2F5C A;  2O6G E;  5DV5 A;  3OV8 A;  3S2W A;  2P7V B;  3W6J B;  1LEB A;  3QPH A;  3KEQ A;  3EET A;  5ED4 A;  4LG0 A;  2XAS A;  5IT9 Z;  5HLI A;  1MD0 A;  2RC4 A;  2MBF A;  3OOP A;  4IJA A;  1T98 A;  1WI9 A;  4EM0 B;  4HV5 A;  3ERE D;  3R4K A;  4KMU X;  3WGG A;  4WK8 F;  5E20 A;  3ZMU A;  1J0R A;  3L7W A;  1R36 A;  1GXQ A;  4U7D A;  2UXX A;  3SHF A;  2IRF G;  3JSP A;  3VOE A;  2ETH A;  1BIB A;  2PQ8 A;  2A68 F;  5FFX A;  4IVN A;  3WTT C;  1XMA A;  3Q9S A;  1JHH A;  1F1Z A;  1XDS A;  2J5P A;  3K0L A;  3RKY A;  3N4M A;  3RPU A;  3C7J A;  2VBW A;  1YLF A;  4HX8 A;  3HYI A;  1KU3 A;  4M71 A;  2UWM A;  3DQV C;  1TQM A;  3V8K A;  3PQK A;  3KP2 A;  4PGH A;  4CIC A;  4RB3 C;  2CQK A;  5FD5 A;  5DD4 A;  1CGP A;  2VXZ A;  4UUV A;  3TOA A;  2CYY A;  2V6C A;  4MNU A;  5HOO A;  1VTN C;  4TV7 A;  1YIO A;  4I98 B;  4ZYD A;  5D8L B;  4EM1 A;  2ZCW A;  2MLK A;  1D5V A;  2QVO A;  4A5N A;  2ZJ2 A;  3CDH A;  4Y17 A;  4HQE A;  4G94 A;  1UB9 A;  4BAY A;  2DAO A;  1TBX A;  2OU2 A;  1UHM A;  1WRJ A;  3KP4 A;  1O3R A;  4I7H A;  1NHA A;  3VB2 A;  3B02 A;  4M6X A;  3LA3 A;  4PGG A;  2QQB A;  4L5J A;  2LSO A;  3TDU C;  4RS8 A;  4NHJ A;  5BS6 A;  1HST A;  1T6S A;  1TNT A;  1C0W A;  5D5X B;  4BH9 A;  4L18 B;  2K4J A;  2VN2 A;  4M74 A;  3HRM A;  2IJL A;  3VEP A;  2XHK A;  3E5X A;  3KE2 A;  1FY7 A;  3F6O A;  1R1T A;  2DO7 A;  4O5V A;  3HHG A;  1ON1 A;  3V8L A;  1FP2 A;  5LGU A;  1YYV A;  5J6X A;  1XCV A;  4HAM A;  2QWW A;  1MKM A;  2CWE A;  4YII A;  3J80 K;  3O6B B;  1R23 A;  3GFL A;  3F6V A;  1HW1 A;  5BMZ A;  5E1Z B;  2K27 A;  1ZH5 A;  2EV0 A;  2VC1 A;  2DQL A;  4MQ9 F;  1FWZ A;  4BNC A;  1HKS A;  3T5X A;  2Z99 A;  5DCM B;  1B9M A;  4A0X A;  2EFO A;  1XSV A;  3QAH A;  2LF8 A;  5LRS A;  2X0L A;  5HS7 A;  4L0Z B;  3E6C C;  4KIF A;  1F9N A;  1U2W A;  3I59 A;  4BXU A;  2RGV A;  2H09 A;  2RVC A;  2BGC A;  2DTR A;  2YX7 A;  1L0O C;  3KFW X;  3HSR A;  5TRD A;  1A04 A;  4LD5 A;  1QZY A;  4A6D A;  2VOO A;  1LNW A;  1OYW A;  2VBZ A;  3H3U A;  1T0F A;  3QU6 A;  1UFM A;  2BYV E;  2ZFW A;  1IUY A;  4OOI A;  4E70 A;  2LKP A;  1Z91 A;  1PP8 F;  3L2C A;  3V7C A;  4LLG F;  2QM3 A;  3JAM Z;  1EV7 A;  1XSD A;  5D5U B;  4YFN F;  5E1X A;  3QU3 A;  5BPD A;  2HEO A;  2PFB A;  2VC0 A;  3QP6 A;  4EQQ A;  3BPV A;  1R7J A;  2OZU A;  3Q9V A;  1YG2 A;  3E6M A;  5BQT A;  3M1E A;  1I1S A;  1U6G A;  4Q4Z F;  2KRF A;  2E1N A;  4YG2 F;  2IW5 A;  2IA2 A;  4WWC A;  1MDM A;  2DU9 A;  3CUQ B;  3T0Y A;  2IA1 A;  1FPQ A;  4A12 A;  4CZZ A;  3RPQ A;  2L54 A;  2HFH A;  1U5T B;  3LA2 A;  5ILV A;  5F6F A;  4A5M A;  2Q0O A;  2M45 A;  1IW7 F;  3O2P E;  3O3K A;  3J80 Z;  3I54 A;  2A6E F;  1QGP A;  3F22 A;  1REP C;  4HLX A;  4LGW A;  2VBX A;  1BI3 A;  1MZB A;  3WTS C;  3FWE A;  4RB2 C;  1TNS A;  4DQ2 A;  3RIR A;  3WTV C;  4M9X A;  4MGR A;  3J81 K;  1IN7 A;  3G73 A;  3IKV A;  1J2X A;  4XLN F;  2VT3 A;  2IPQ X;  2IP2 A;  1B6A A;  2A07 F;  5FFZ A;  1TQP A;  5HDK A;  1ZG5 A;  3FMS A;  2ZKZ A;  5D4R A;  1S6L A;  2STT A;  1LDD A;  5K1Y A;  2HZT A;  2CSO A;  2E7W A;  5LRR A;  1HBX G;  1HSJ A;  5HDG A;  1HKQ A;  3CLO A;  4UV8 A;  5CVI A;  5E8I A;  4AIJ A;  4XSX F;  1U8R A;  3L00 A;  5JR3 A;  1GHC A;  3F8M A;  2A6H F;  2PEX A;  3SZP A;  1RUN A;  3U1D A;  2L02 A;  3GLX A;  3M8E A;  5D5W B;  3MWM A;  1YW8 A;  3VOD A;  2H6B A;  1R1V A;  3F3X A;  2FNA A;  3EYI A;  1J7K A;  1XMK A;  1MJA A;  2PBI A;  4EJO A;  4M9Z A;  2DK8 A;  2G7H A;  2XIG A;  3R0J A;  4YFK F;  2O03 A;  2MH9 A;  3F8B A;  3WTY C;  4KN4 X;  2W84 A;  2AS5 F;  4HV6 A;  2A61 A;  3IWZ A;  2P5K A;  1O3Q A;  3BWG A;  1IN5 A;  1ZN2 A;  2FBI A;  5L3E A;  1LB2 A;  3WTW C;  3IL2 A;  2D45 A;  3P9K A;  2ESH A;  5FGM A;  2OQG A;  4NB5 A;  3KLN A;  3WGH A;  4IHS A;  1SMY F;  2Z3Y A;  1SFU A;  3FM5 A;  2VON A;  2NS0 A;  1Z9C A;  3ZMV A;  3KLO A;  1Z05 A;  4ENK A;  1YW7 A;  1ZLJ A;  3HTU A;  3TO9 A;  4A0Z A;  2BE5 F;  3KP5 A;  5CYV A;  3JTH A;  2AXL A;  4CYD A;  4KNY A;  2NYX A;  1KYW A;  1TQI A;  3I58 A;  2HQR A;  1KGS A;  3J81 Z;  4L5I A;  1BOA A;  2GIV A;  4WXC A;  4OIO F;  4U0Y A;  3CTA A;  3BZ6 A;  3AAF A;  4ETS A;  1LDJ A;  2BBY A;  1IXS B;  4OIR F;  4AIH A;  2HYF A;  1WSU A;  4KIC A;  1R5G A;  3ECO A;  3T1B A;  3LFK A;  4IRI A;  2GAU A;  1R1U A;  1S8N A;  5FO5 A;  4LFU A;  5ICC A;  4GCV A;  5FLX K;  5KVR A;  3CO6 C;  4K2E A;  4PZJ A;  2EFP A;  4HZF A;  3TQN A;  1O7L A;  1EH6 A;  1DPR A;  3DKW A;  4U0V A;  3IRQ A;  5LHH A;  4R1H A;  2PLY A;  2ACJ A;  1YS6 A;  3FM3 A;  1U3E M;  1FBQ A;  3DFG A;  2COM A;  3WTU C;  3HRS A;  2XKP A;  1ODD A;  3I0T A;  4HDV A;  2XAQ A;  2OQR A;  1Z6R A;  2EWN A;  1DUX C;  4S04 A;  4G9Y A;  4L9T A;  5DYM A;  2EK5 A;  2G7U A;  1F5T A;  1G6N A;  2O0Y A;  1ON2 A;  1P4A A;  4RAZ A;  2P6T A;  3HIF A;  2CG4 A;  1SMT A;  4WXH A;  3BDD A;  1WWX A;  4OMY A;  3FXQ A;  2VOP A;  1TW3 A;  3ZP5 A;  2D2W A;  5DEQ A;  3DF8 A;  2HKX A;  2VOD A;  3FZV A;  3CUQ A;  3P9C A;  3P7N A;  3RTR A;  5AON A;  1B59 A;  3WOD F;  3P9I A;  4RGS A;  1LDK B;  1KU9 A;  1U5T A;  1P4X A;  4M72 A;  1ZLK A;  4ZZD A;  1XGM A;  3D5L A;  4JQF A;  3ZMD A;  3K2Z A;  2VE8 A;  3M7G A;  4BHP A;  2JRT A;  2V1D A;  5HLG A;  5DUI A;  2FRH A;  2OD5 A;  3NQO A;  2EFN A;  4UVC A;  3E3V A;  4CO8 A;  5HVQ C;  3F8C A;  2E1C A;  3PQJ A;  2MLG A;  1IRF A;  1D8K A;  4CHU A;  4RB0 A;  5EEG A;  3G3Z A;  4FHT A;  3CUO A;  4RB1 A;  4HX4 A;  4GYG A;  3V4G A;  4UVB A;  5E8G A;  5FD6 A;  1STZ A;  1ZAR A;  2UZK A;  3TOB A;  2P5L C;  3KP6 A;  2EV6 A;  1I5Z A;  5CVU A;  4IXA A;  1FT9 A;  4EM2 A;  3DPT A;  3QRF F;  2DFI A;  2RQP A;  2LF7 A;  1LVA A;  3RJP A;  1FSH A;  1MGT A;  3TDZ C;  3IKT A;  5BOX A;  2NNY A;  2FML A;  5CLS A;  2R7D A;  4GXO A;  3GYH X;  3MAJ A;  2HKO A;  1IXR C;  3ISP A;  1Z7U A;  2QQ9 A;  4P96 A;  4OIQ F;  2Z5U A;  3RI4 A;  2YR2 A;  1H9T A;  4F7Z A;  1Z6T A;  3FMQ A;  5JI6 A;  3ZPL A;  4WCG A;  3EQL F;  4BHB A;  2CW0 F;  3GZ5 A;  5HLH A;  5DD8 A;  5D6E A;  3E6B A;  1SD7 A;  1IF1 A;  2P7C B;  4HA8 A;  3BJO A;  3KP3 A;  4G6D A;  1W7P B;  1TTY A;  1RI7 A;  4G7Z F;  3WGI A;  5HS9 A;  1O3S A;  3FMR A;  1ULY A;  4U0W A;  3EDP A;  1YQA A;  2P5V A;  2HOE A;  2PMH A;  3CO7 C;  2MC3 A;  4KMF A;  1K78 B;  1L3L A;  2XVC A;  1BI2 A;  2FOK A;  1IXC A;  2GA2 A;  2WTE A;  4GO1 A;  3CJN A;  2DK5 A;  4ZH4 F;  3MEX A;  2ZNY A;  3GXO A;  4U88 A;  5JVT A;  2M1B A;  3Q5F A;  2QEN A;  1U78 A;  4NQW A;  5H20 A;  3DEU A;  2Y48 A;  4KN7 X;  2NRA C;  1JXS A;  2C6Y A;  4ZYE A;  1FLI A;  2O3F A;  3F8N A;  4O3M A;  1JE8 A;  2FEZ A;  2KJB A;  3ZN0 A;  2IVM A;  3GEZ A;  6PAX A;  2HQN A;  3R0A A;  4G7O F;  5JFR A;  4CXF A;  3KP7 A;  2F5D A;  3GWZ A;  1ZRC A;  3COA C;  5HS8 A;  4IRH A;  3H92 A;  2RKH A;  4P5O A;  2V1X A;  5D4S A;  1UST A;  2QBY B;  4RGU A;  2ISZ A;  2KIU A;  2PMU A;  2BEO A;  2EFW A;  4LLN A;  5CVV A;  4HF0 A;  5E1W A;  3ML6 A;  2XRN A;  3LST A;  2YSR A;  1FBU A;  3SFZ A;  5ICG A;  2FBH A;  4I2O A;  3GFJ A;  4I0A A;  4B09 A;  1HKT A;  1XGO A;  2KJC A;  1O3T A;  3BRO A;  2NAZ A;  1FOK A;  3VFZ A;  2L4M A;  2DQR A;  2IA0 A;  3MZY A;  2Q2E A;  4Y15 A;  5L3F A;  4AVP A;  2XKO A;  2QQA A;  4KT5 C;  1FYM A;  4KA4 A;  4XRF A;  2ZME B;  4UXN A;  1CF7 B;  4P9F A;  2HR3 A;  3W6K B;  3KZY A;  2Y75 A;  4BHC A;  2EA4 A;  3BPX A;  1FC3 A;  2ELH A;  2G9W A;  3E97 A;  4OIN F;  2ZNZ A;  3ROU A;  1G3W A;  1QNT A;  1J9I A;  3V8J A;  2K4B A;  2BV6 A;  4L0Y B;  1B9N A;  3M9A A;  4WF2 A;  5HDN A;  2V79 A;  4KUM A;  3V7S A;  1IZ1 A;  5F64 A;  3DV8 A;  1IN6 A;  2JPC A;  3F8F A;  4BYY A;  2XRO A;  3FXR A;  1ONV A;  5A2Q K;  1LJ9 A;  2TDX A;  1G3T A;  2H94 A;  3FXU A;  5FB2 A;  2A3S A;  3E5Q A;  2XUB A;  3JW4 A;  2HTS A;  1KQ0 A;  4AWX B;  1H9G A;  1FYK A;  3K1M A;  2QLZ A;  3I4P A;  2D1H A;  1ZG1 A;  1FBS A;  2DT5 A;  1ZRF A;  1OR7 A;  3M8F A;  2O8X A;  2YPR A;  5LEJ A;  2Q8K A;  3RKX A;  4EJT A;  5DUK A;  4CDG A;  1Y0U A;  4N9H A;  1FNN A;  5KK1 A;  4HF1 A;  2PJP A;  1B1B A;  4Z2Y A;  4LLL A;  5DCF A;  2O61 A;  2HTJ A;  4HF2 A;  5BPI A;  4JK1 X;  2EJR A;  2H6C A;  4XLP F;  2KIM A;  3HHH A;  1SD5 A;  2JTV A;  1D3Y A;  3U9G A;  4HDU A;  4N0B A;  4XSZ F;  1UCR A;  1ZG3 A;  2OZ6 A;  1WKM A;  1IRG A;  3NEU A;  2D1V A;  3C1D A;  4HX7 A;  1BIA A;  2FQ3 A;  4Q5S F;  1AOY A;  1XGN A;  3PFI A;  2DPU A;  1R5H A;  2M87 A;  4I0B A;  2J5O A;  1RNL A;  2RDP A;  1O57 A;  4MHG A;  3TKY A;  1W7P A;  2W24 A;  1V3F A;  1O7F A;  2PN6 A;  2ZO4 A;  4EJV A;  5LGN A;  3EUH A;  3ZMS A;  3KZZ A;  4UHT A;  5DCM A;  2CGP A;  1XCB A;  3V7R A;  1HW2 A;  1R00 A;  3QP5 A;  1D8J A;  4EMS A;  1JGS A;  2XAG A;  4JBA A;  3H3Z A;  4ESF A;  2FBK A;  1K78 A;  3GUD A;  1SFE A;  2FU4 A;  4ENM A;  4UNO A;  2FE3 A;  3J7A O;  1Q1H A;  1EH7 A;  2W25 A;  3KCC A;  4ZYG A;  3BJ6 A;  2EA2 A;  2K02 A;  4WX9 A;  3K1P A;  1T38 A;  5D5V B;  1PP7 U;  2GZW A;  1UHW A;  1S7A A;  2P8T A;  2W57 A;  4YFX F;  1EH8 A;  3I64 A;  3U2R A;  5IT3 A;  1BN5 A;  4GYI A;  5H6Q A;  4O6J A;  1IAW A;  3LAJ A;  1PUE E;  1Z1D A;  4ASN A;  2OBP A;  2R3S A;  2GXB A;  5LGT A;  3K1N A;  2RNJ A;  3HRU A;  2Z33 A;  4EJU A;  2M5W A;  4UV9 A;  3HOT A;  1I6X A;  4IHT A;  1E2X A;  2V1U A;  2L4A A;  2QBY A;  1KQ8 A;  1MJ9 A;  4KIB A;  5D8K B;  4A6E A;  1RZ4 A;  4Q47 A;  1X3U A;  3WTX C;  3ELK A;  2XV4 S;  1OYY A;  1QO0 D;  2EB7 A;  1FYL A;  3F72 A;  5AIQ A;  2K7L A;  2QUF A;  2JZY A;  1I27 A;  3MZH A;  3L9F A;  4DNC A;  1W4M A;  2XAJ A;  1MJB A;  2JT1 A;  1JHF A;  1ZYR F;  1BJA A;  2LDU A;  3F21 A;  3E6D A;  2FXA A;  2ZXJ A;  3I71 A;  3QPT A;  3JTG A;  3RKW A;  2PI0 A;  3IRR A;  2K86 A;  1GXP A;  2FA5 A;  3L09 A;  5FLX Z;  1V4R A;  3IHU A;  2HS5 A;  4G7H F;  4EV0 A;  4P9U A;  2ZME A;  1J59 A;  1CF7 A;  3BJA A;  1ZHF A;  3ZMZ A;  2QZ8 A;  4LJZ F;  3FHZ A;  1K6O A;  2FSW A;  3ZN1 A;  2W85 A;  1P92 A;  2CFX A;  2ESN A;  4IPA A;  2GWR A;  1IN4 A;  3R60 A;  4S05 A;  3RYR A;  3JAM K;  1IN8 A;  3LQR A;  1B4A A;  1ZRE A;  2CO5 A;  2XAF A;  2VT2 A;  1J75 A;  1QBJ A;  1YFH A;  3QOP A;  3N97 A;  3C3W A;  2RN7 A;  1I1G A;  3HSE A;  4A0Y A;  3WG9 A;  1KYZ A;  3EYY A;  4L9N A;  2RV8 A;  3ECH A;  3LA7 A;  1P2F A;  3LWF A;  5LHI A;  4R8H A;  5ILU A;  1OMI A;  2DW4 A;  5K5O A;  3HOS A;  2B0L A;  2GA1 A;  1T39 A;  2GXG A;  2ADU A;  1FZP B;  1XD7 A;  2EV5 A;  4M9S A;  2JSC A;  4EGY A;  2H27 A;  1OYI A;  3CUQ C;  3GFM A;  4PCQ A;  3DXJ F;  1YS7 A;  2KIF A;  4AIK A;  1U5T C;  1OPC A;  3IWF A;  4KFC A;  5J8C A;  3ABT A;  1XN7 A;  2F5E A;  5E17 F;  2WWY A;  4HW0 A;  5CVR A;  1T2K A;  1YTY A;  4KYW A;  5L3C A;  2DI3 A;  2EFQ A;  2MH2 A;  4HOB A;  5L3D A;  3MFK A;  4OIP F;  1W7P D;  2LNB A;  1XSX A;  4WXD A;  2L01 A;  5E18 F;  1QZZ A;  2A5Y B;  4FT8 A;  4G8X A;  4MEY F;  5L3G A;  5LBQ A;  1DDN A;  3E5U A;  4L9J A;  4A2U A;  1W5S A;  2OAZ A;  1GVJ A;  4LG0 B;  3BOQ A;  1F4K A;  1QQI A;  1S7O A;  1SFX A;  1P6R A;  1WQ2 A;  3BY6 A;  4H0E A;  3GW2 A;  1TW2 A;  2GQQ A;  2XGX A;  3WU1 B;  4LK1 F;  5LHG A;  3T8R A;  4RAY A;  3GO5 A;  1QPM A;  3BP8 A;  5AIP A;  2HDC A;  1S3J A;  4RGX A;  1TLH B;  4ESJ A;  3HTS B;  2FF4 A;  2FNP A;  3IC7 A;  3R6S A;  2VE9 A;  5LLQ A;  3I5U A;  3C18 A;  2WC2 A;  1ZGJ A;  4MTE A;  4B8X A;  2Z9O A;  1OKR A;  3FX3 A;  1ZAO A;  3KEO A;  1LEA A;  2DPD A;  1HQC A;  2M30 A;  1XGS A;  3HSF A;  1HW5 A;  4LMY A;  5K5R A;  4RGR A;  3MQ0 A;  2ZBK A;  4QWQ A;  5J8F A;  2HWV A;  3RDI A;  1XDU A;  3GZ6 A;  1BBY A;  2YU3 A;  1SD4 A;  4FX0 A;  2A69 F;  3ABU A;  2V9V A;  1DP7 P;  2UXN A;  2NNN A;  3SXY A;  4KIG A;  2FMY A;  1K79 A;  4LK0 F;  4M73 A;  5L3B A;  3GVA A;  1ZRD A;  1BC8 C;  4EGZ A;  5ICE A;  4ESB A;  1FSE A;  4UVA A;  5ERI A;  1RIO H;  1SAX A;  1AWC A;  3TGN A;  1KU7 A;  4BQA A;  1R22 A;  2MD5 A;  4LB6 B;  3K9T A;  5DDG A;  1HXD A;  4ENJ A;  1K7A A;  4PDK A;  2Y0M A;  2STW A;  3FF5 A;  3GFI A;  1YW9 A;  4L9V A;  2WV0 A;  1BM9 A;  4FX4 A;  1YO5 C;  3T8T A;  4HBL A;  3SQN A;  5F1R A;  4KDP A;  5ILS A;  3I53 A;  4CGZ A;  4HYE A;  5EEH A;  2IT0 A;  1J5Y A;  3DPL C;  5TJJ A;  3SZT A;  4R79 A;  4ZYH A;  1BC7 C;  4OU0 A;  4I09 A;  3WU0 A;  1KU2 A;  2JPB A;  2P6S A;  2P4W A;  3GX4 X;  4HLY A;  3TO6 A;  4AD9 A;  2KKO A;  1LQ1 A;  5IT9 K;  3MCZ A;  1G3Y A;  3B73 A;  4I02 A;  4YIF A;  4Y13 A;  3K69 A;  3REO A;  4ZZL A;  4Q48 A;  4MEX F;  5K5Q A;  1ZGA A;  1PDN C;  1SD6 A;  4IF4 A;  3ZQ7 A;  5CVJ A;  3GF2 A;  3WE3 A;  3KET A;  2OA4 A;  5D6F A;  3JSO A;  4P55 A;  2XAH A;  2X4H A;  2R7F A;  1W5T A;  4M6Y A;  1FX7 A;  1RUO A;  4EVI A;  2HGC A;  3I59 B;  2HYG D;  1G3S A;  5ICF A;  1KQ9 A;  4D0P A;  2MA3 A;  3ZMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...