2EFWA

Crystal structure of the rtp:nrb complex from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication/dna
molecule keywords DNA (5'-D(*DCP*DT*DAP*DTP*DGP*DTP*DAP*DCP*DCP*DAP*DAP*DAP*DT
publication title An asymmetric structure of the Bacillus subtilis replication terminator protein in complex with DNA
pubmed doi rcsb
source organism Bacillus subtilis
total genus 40
structure length 115
sequence length 115
chains with identical sequence B, F, G
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2efwA00
4XBFA 1ZYRF 2JPBA 1R7JA 2D1VA 3QOPA 1J5YA 4L0ZB 4AVPA 2OQGA 3BOQA 3QRFF 1W5TA 3K69A 3DF8A 3GZ6A 1LEBA 2FNAA 1XMKA 2XAGA 3J7AO 2LF8A 4HV5A 1QNTA 2M5WA 3E6BA 1T98A 3EUHA 2VE8A 1FBUA 1USTA 4CXFA 4EM2A 4UVCA 3LFKA 4HX4A 5LRRA 4M72A 4QLCU 4IXAA 4XSXF 3O3KA 1SD5A 1D8JA 1BJAA 1A04A 1GHCA 3P7NA 1TQMA 4LLGF 1LNWA 4HV6A 2HZTA 2IP2A 4BHCA 2F5FA 1FC3A 3JAMZ 1IAWA 4LGWA 4CDGA 4I09A 2H94A 4OIRF 1XSXA 2DPUA 3T0YA 3D5LA 5F64A 4A6DA 3J80K 3AAFA 4L18B 1UB9A 3FM5A 5D8KB 3BJ6A 3EETA 5HDKA 5L3BA 2XRNA 1ZRCA 2DQRA 1R5HA 1TQIA 2RVCA 3HUGA 3WGHA 4EV0A 3WTZA 3VODA 1LEAA 4K2EA 1QBJA 4L5IA 5F1RA 1YO5C 1IN8A 2P5KA 1Y0UA 1XDUA 2Y75A 5FB2A 1O3QA 1SMTA 1TLHB 3ZN1A 4CO8A 2FRHA 3KZZA 3WTYC 1FY7A 2OQRA 3KP5A 3R6SA 3WTUC 2M8EA 5LHHA 4P5OA 3BY6A 4KMUX 2FBIA 1OKRA 2PEXA 3KCCA 2PG4A 3U9GA 2P5VA 1F1ZA 4IHTA 2P6SA 5ILVA 5FLXK 5JFRA 5DDGA 2OBPA 2R7FA 1ZG3A 4ZYGA 1K7AA 2ISYA 5HOOA 3M8FA 4HOBA 4M73A 3ZN0A 2O8XA 2ZMEB 1ZLKA 1O7LA 4IRGA 4YFXF 1TNSA 4KFCA 4G9YA 3KEOA 4OU0A 2Q2EA 5A2QZ 2LSOA 5CVJA 1YS6A 1FYKA 3ERED 3TGNA 2QBYA 5K5OA 2BGCA 5HLGA 2VT3A 3SZPA 2KIMA 2H27A 3WTTC 2XAJA 5BOXA 2PI0A 3FXRA 2R7DA 2VONA 3HRMA 1T39A 1LB2A 3QU3A 2Z5UA 2QWWA 4N9HA 3BJOA 2IA1A 1W7PB 1DP7P 2A3SA 1GVJA 4GYIA 2MLGA 3ZP5A 3KE2A 4IHSA 3JTHA 2DAOA 2X4HA 1BI1A 4UVBA 1MKMA 4M6XA 1YIOA 5DCMA 2HQRA 3D0SA 2L4AA 3FX3A 4BHPA 5L3FA 3WU1B 3F8BA 3GFMA 5HS8A 3H3UA 2F5CA 3CLOA 2CSOA 3HRTA 2NYXA 2E1NA 1S6LA 3I64A 2HS5A 3S2WA 5DEQA 1ZGJA 2XUBA 4KNYA 5L3GA 3EYIA 4BHBA 4YIIA 3RKXA 3KLNA 4EJUA 2VE9A 5LLQA 3CUQB 2E7XA 3G73A 1C0WA 3ABTA 1R1TA 2GA2A 3TKYA 1ODDA 2COMA 4I0AA 2A68F 5HS9A 3GFLA 2QUFA 1RUNA 3W6KB 3FMRA 5LGUA 4UXNA 2VBWA 2YPRA 4EM1A 4LG0B 3KP7A 4PZJA 5KVRA 3VOEA 3IKTA 2GQQA 2IA2A 3I58A 2W84A 1K6OA 3PQKA 3GEZA 2IT0A 3HIFA 2JTVA 3R60A 4G7HF 4GO1A 4S04A 2RNJA 2CFXA 2RC4A 4LB5A 2Y0MA 1ZN2A 2OAZA 4PGGA 2YX4A 1Z91A 1T38A 3COAC 2W24A 5ILUA 4YFNF 1S8NA 4QWQA 1MGTA 1PUEE 2ELHA 1IXSB 1ZARA 4I01A 2O61A 2DK5A 3GUDA 1SD4A 2MA3A 4TV7A 2EJRA 3V4GA 2O3FA 2XV4S 4M6YA 4Y15A 2FXAA 3J80Z 4R8HA 4Q48A 3CDHA 5FFZA 1O3TA 1IXCA 2ZJ2A 4DQ2A 1FT9A 4KICA 1G3WA 5HDGA 3RKYA 4IPAA 2OA4A 4WXCA 1STZA 2YR2A 2XIGA 2G7HA 4Z2YA 1XGSA 1P4XA 5F6FA 1U5TA 1EV7A 4A6EA 3T5XA 5AIPA 3DQVC 1XSVA 2EV5A 1YLFA 1R1VA 3IRQA 2XGXA 5D6EA 2VC0A 1DUXC 3SZTA 4CYDA 3QP5A 1F9NA 2W57A 1SFUA 5KK1A 5JVTA 3WTWC 1JHFA 2V6CA 3HRSA 2V1DA 5LBQA 3CO7C 2ZCWA 3DPTA 4RGRA 4HAMA 4EJWA 3ROUA 5HVQC 3B73A 1QQIA 4AIKA 4XLPF 1CF7A 3GWZA 4PDKA 4KIFA 3IRRA 1XN7A 2A61A 2BBYA 1H9TA 4XLNF 3MEXA 3O2PE 1XB4A 1U78A 2NS0A 1HXDA 1F5TA 3E97A 3FF5A 3C3WA 3V8KA 2KJBA 3GXOA 3DEUA 1YW8A 2RN7A 2EFNA 3HSRA 2G9WA 1G4DA 2K4JA 2XKOA 2GXGA 3C1DA 4M9XA 1KYWA 2LDUA 2VC1A 2AXLA 2NAZA 1HW1A 1YG2A 4MQ9F 3WE3A 3RPQA 4JQFA 2DO7A 4KN7X 1V3FA 1QZZA 2NNYA 1LQ1A 4HX8A 1BOAA 1YQAA 2F2EA 1JHHA 2GZWA 4UV9A 4OIPF 3F23A 4P9UA 4RB1A 3JSPA 4KIBA 5D6FA 3O6BB 5E8IA 4CHUA 2A07F 2WC2A 2QVOA 4EVIA 3LWFA 4LD5A 3EYYA 4M9SA 1WSUA 1QPMA 2A6HF 4HF0A 2ZNZA 2EWNA 4L9NA 4HBLA 4BQAA 4B8XA 3C7JA 2D2WA 3KP6A 3LA7A 4PCQA 3RPUA 5LEKA 3MWMA 2B0LA 3TDUC 2V79A 3J81K 4GCVA 4I98B 1KU3A 2MD5A 3QP6A 1PDNC 3ABUA 1HKQA 1U5TC 4KYWA 4MEYF 2C6YA 1ONVA 2FBKA 1FBQA 3VFZA 1G6NA 1WI9A 5AONA 2XVCA 1P6RA 5CLSA 3W6JB 4N0BA 1FSEA 2JSCA 4A0XA 4U7DA 4ESJA 1S7OA 2Q8KA 1P92A 4BYYA 4UHTA 2VBYA 2Z99A 2FF4A 4HF2A 2HGCA 1BM9A 3K1MA 2M30A 3ELKA 2D45A 3Q9SA 4KIGA 5DYMA 5D4RA 1FLIA 1Z05A 3HTSB 2OZUA 3JW4A 1LJ9A 1J2XA 3Q9VA 1EH8A 1SFEA 1TTYA 3ML6A 5HDNA 3ZQ7A 3LA2A 4D0PA 2K4BA 1GXQA 1UFMA 3FXQA 2HKXA 3PFIA 4ENKA 2A6EF 5H6QA 3LA3A 2BYVE 4ENNA 3RI4A 1XD7A 4A0YA 1HW5A 4KN4X 2PBIA 3TDZC 3FXUA 4U7BA 1O3RA 4G8XA 2ZO4A 3HOSA 2JRTA 1DPUA 3I5UA 3MCZA 1MDMB 1IN4A 1RUOA 5CVIA 3GX4X 2ADUA 4CICA 3ECHA 4O3MA 1FSHA 3DFGA 2PMUA 1FPQA 3E6DA 1H0MA 2RQPA 3IC7A 2HR3A 2PJPA 3TO6A 1X3UA 3KP4A 3V7CA 2JPCA 4MTEA 2FEZA 3BPVA 3QAHA 1NHAA 4GXOA 1I1GA 1U8RA 2PLYA 2K7LA 2YSRA 1I1SA 4GGGA 4ZYHA 4RGUA 4UV8A 3LAPA 1R58A 1RNLA 3SQNA 1WRJA 5ILSA 1UCRA 2JZYA 2OU2A 3ZMVA 1E17A 4G7ZF 2K02A 4WWCA 1Z6TA 3F3XA 2M45A 2NNNA 3LSTA 2K27A 1HBXG 1J7KA 1YTYA 2E1CA 1R1UA 2RDPA 5CVUA 1Z6RA 5L3CA 5ICEA 3RYPA 4RB3C 3KEQA 2L02A 2Y48A 4WX9A 4L9TA 1CF7B 1TQPA 4ESFA 2VT2A 1JE8A 1FOKA 5BPDA 5LEJA 4IRHA 1U2WA 2IJLA 1LDDA 3TOAA 1P4AA 5FO5A 2IVMA 1XMAA 4WK8F 2XROA 2KIUA 3FMQA 1R5GA 2Z33A 3FWEA 4EGZA 3ULQB 4LK0F 4M9ZA 4HDVA 4BH9A 3E6CC 5ICGA 1KU9A 2YX7A 2O6GE 2O03A 3T8RA 4ETSA 3I59B 3L09A 3V7RA 2QYOA 3HHHA 4EJVA 4I0BA 1R22A 4L9VA 2A5YB 2VBXA 5L3EA 2MBFA 1TW3A 3GVAA 4IF4A 5JR3A 2J5OA 3DXJF 2NRAC 3KFWX 1MJBA 3I71A 2VBZA 3HSEA 2R3SA 1BN5A 3K2ZA 1VTNC 4HLYA 3V7SA 4LJZF 3J81Z 2DLLA 4N9IA 4XSZF 2ZFWA 3M8EA 1UHWA 4O6JA 1HSTA 2LF7A 4HYEA 4A0ZA 1HKTA 3RIRA 4U0YA 2D1HA 1E2XA 4M74A 4FX0A 4UVAA 2MC3A 4JBAA 2HTSA 1ZLJA 2QENA 1O57A 3EQLF 4ESBA 1R36A 1Q1HA 1JXSA 1QO0D 4LB6B 4GYGA 4EM0B 1B59A 2DK8A 5E17F 3WGGA 2HFHA 4FT8A 3TO9A 4G7OF 1IRFA 4PGHA 4BAYA 3NQOA 4AIHA 1S7AA 4CZZA 5DD4A 5BS6A 1F4KA 4ASNA 5FGMA 1ZRDA 3R0AA 4MQVA 3ZMSA 2DBBA 2FA5A 2RV8A 4FX4A 3K0LA 3KP2A 3BDDA 1ZGAA 4RB2C 4RAYA 3BZ6A 3QU6A 3N97A 4MNUA 3LQRA 2LKPA 1IN6A 5E1XA 3BPXA 1YFHA 3TOBA 4E70A 3SFZA 4UNOA 4P55A 3H92A 3MAJA 3IWZA 4B09A 3WGIA 1L0OC 1U3EM 3WG9A 3MFKA 2HTJA 4ZZLA 1KU7A 3HOTA 3F8MA 4HF1A 2UXXA 1FWZA 5J8CA 1PP8F 2VXZA 3CJNA 2V1XA 2O0YA 1BIAA 2K86A 5FD6A 2FMYA 4G94A 3HTUA 1BC8C 3HYIA 3WODF 2H6BA 2J5PA 2CGPA 4HW0A 4NB5A 1WKMA 3ZPLA 3CUOA 1J75A 4ZYEA 2ZMEA 1SFXA 5D5WB 1LDJA 1B9MA 1XDSA 1Z9CA 1V4RA 1IF1A 3BJAA 1OYYA 3KP3A 4ENMA 3DP7A 5IT3A 1KU2A 2XAQA 5J6XA 4YG2F 2DQLA 3ZMZA 4A12A 4YFKF 1OYIA 1FYMA 1W7PA 2DT5A 3FM3A 2KIFA 1AWCA 4ZYDA 4OMYA 1O7FA 2F5DA 3F8FA 3GZ5A 1TBXA 2ISZA 2G7UA 2DPDA 2P6TA 4BNCA 1T2KA 4OINF 2QBYB 2TDXA 1ZG5A 2FNPA 2ESNA 4RS8A 1K78A 1IZ1A 3WTSC 3CTAA 4BXUA 3HSFA 1IW7F 3P9IA 1SD7A 5LGNA 2IW5A 3E5QA 2XASA 3FHZA 1D8KA 4IRIA 3KETA 1HSJA 1G3YA 1TNTA 3GW2A 2GAUA 2X0LA 4EMSA 1W7PD 2ZXJA 3L2CA 1T0FA 1B6AA 1IUYA 3CUQA 1B9NA 3H3ZA 3VB2A 5CVVA 4MHGA 5DCMB 1SAXA 5FFXA 1ON1A 1H9GA 4NHJA 2EFWA 1IRGA 3ZMUA 2KKOA 4AIJA 5HLHA 2PFBA 1USSA 2UZKA 3F72A 3REOA 1Z1DA 3CO6C 3K1PA 4HLXA 3ZMTA 2MH9A 2ETHA 3GFIA 1FBSA 4KUMA 2W25A 4F7ZA 4Y17A 1ZHFA 4EJTA 2P7CB 2VODA 2DU9A 1O3SA 4EQQA 1RI7A 4P96A 3LAJA 5H20A 2P4WA 1BI0A 1IXRC 2QQ9A 2F5EA 1FX7A 2VOPA 3F21A 3V8JA 3M7GA 4RAZA 3BP8A 4MTDA 3DV8A 3OV8A 2FE3A 2A69F 2FU4A 5DUIA 2HWVA 4DNCA 4KMFA 4XRFA 5BPIA 4LLNA 4G6QA 5ICFA 2RGVA 4A5NA 3ISPA 4A5MA 3JSOA 5HS7A 3E3VA 1FP1D 2IRFG 2ACJA 3NRVA 4ENJA 1XCVA 3SHFA 3RTRA 3SXYA 2Z9OA 3F8NA 3K1NA 2L01A 3M1EA 4WCGA 2P8TA 1WQ2A 2GIVA 5CYVA 5K5QA 3U1DA 1U6GA 3EDPA 5DUKA 2UXNA 1OYWA 2QM3A 5D8LB 5DV5A 3B02A 3TQNA 5D5UB 1LDKB 1IN5A 2BEOA 4I7HA 2MH2A 3IHUA 1P4WA 4LK1F 3V8LA 3CUQC 1MJ9A 2L54A 2GXBA 2KRFA 1AOYA 2HYFA 4LLLA 5BMZA 1U5TB 3I4PA 2OD5A 2MLKA 4I02A 3MQ0A 1KYZA 1IN7A 1HKSA 2W85A 4YIFA 3WE2A 1GXPA 4AD9A 2KJCA 2IA0A 5JHUA 1HW2A 1BC7C 4JK1X 4ON0A 1XGOA 3C18A 3IL2A 3ECOA 3HRUA 2EA4A 4WF2A 5AIQA 1KQ8A 3GO5A 1D5VA 5HLIA 5EEHA 4KDPA 3RKWA 4L9JA 3DKWA 3U2RA 2AS5F 1RIOH 5IT9K 4IVNA 1SD6A 5FD5A 3P9CA 3QPTA 1ZH5A 1HQCA 2XAFA 5LRSA 4S05A 1ULYA 4G6DA 2RKHA 4P9FA 1DPRA 3DPLC 3L7WA 1EH6A 1G3TA 2VOOA 3K9TA 2DI3A 4RB0A 4L5JA 5LHGA 2ZBKA 2IPQX 2L3DA 4WXDA 3M9AA 3OOPA 4O5VA 5H6RA 1D3YA 1ZG1A 3MZYA 2H6CA 1FZPB 5ED4A 2ZKZA 2HDCA 1QZYA 1P2FA 2Z3YA 4KA4A 3P9KA 1XGMA 2XHKA 2EV6A 2WV0A 1JGSA 1W5SA 2HQNA 1XSDA 2WWYA 3F22A 1LVAA 4U0WA 1K78B 3VEPA 4OIOF 4L0YB 2P5LC 5E1WA 4CGZA 2CYYA 3N4MA 2BV6A 4Q47A 2HOEA 2OZ6A 3PQJA 3ZMDA 1YYVA 2JT1A 2XAHA 2QQBA 3MZHA 3QPHA 4IJAA 3Q5FA 3WTVC 1DDNA 4Q4ZF 2V9VA 1REPC 1KA8A 2Q0OA 2HYGD 2CWEA 2STTA 3E6MA 3R0JA 1ON2A 2CW0F 5DD8A 2PN6A 1YW7A 2HKOA 1BBYA 4AWXB 5LGTA 1OR7A 2BE5F 4R79A 1R23A 3GF2A 3LQQA 5LHIA 2DFIA 3L9FA 5CVRA 3KZYA 3WU0A 4EGYA 1OPCA 3GFJA 4HDUA 4HZFA 2V1UA 5JI6A 3FMSA 2FQ3A 1MZBA 5K1YA 3E5UA 5L3DA 1SMYF 2EA2A 1QGPA 4KT5C 1S29A 3FZVA 3I54A 2L4MA 4R1HA 1XGNA 3HHGA 2CG4A 1BIBA 1FP2A 1FNNA 1KQ9A 2EFPA 2ESHA 3JAMK 2XKPA 1MDMA 1TW2A 2EFQA 3WTXC 3IWFA 3R61A 1MD0A 2PQ8A 4MEXF 1WWXA 3NEUA 2QLZA 4RGSA 4H0EA 3IKVA 1KGSA 2H09A 2GWRA 3RYRA 5DCFA 2FOKA 3GYHX 2STWA 3GLXA 4U0VA 2VN2A 3E5XA 4HQEA 1W4MA 1R00A 2CO5A 6PAXA 1FYLA 2E7WA 4ZH4F 1MJAA 5D5XB 3BROA 4EJOA 1KQ0A 1T6SA 1BI3A 4Y13A 1ZRFA 4LMYA 2YU3A 2WTEA 5D5VB 4Q5SF 4NQWA 3I53A 4OIQF 3I0TA 4A2UA 1ZREA 1B1BA 5D4SA 1J59A 4I2OA 5FLXZ 4M71A 1YW9A 1I5ZA 1UHMA 1BI2A 5A2QK 2DW4A 1RZ4A 4OOIA 5E1ZB 5ERIA 4HQMA 5E20A 3RJPA 5IT9Z 3F8CA 2ZNYA 4HX7A 2EB7A 1J0RA 1S3JA 1Z7UA 1OMIA 2FBHA 3R4KA 3T1BA 5TRDA 3I59A 4WXHA 4MGRA 4RGXA 1J9IA 5J8FA 5EEGA 5CJ9A 3L00A 1K79A 2P7VB 4ZZDA 2GA1A 2CQKA 3G3ZA 2UWMA 2M1BA 2FMLA 3RDIA 5E8GA 3KLOA 5K5RA 2FSWA 2M87A 4HA8A 4OMZA 3TO7A 5ICCA 2EFOA 2QQAA 1PP7U 4U88A 3JTGA 2EV0A 3BWGA 2QZ8A 4LFUA 3F6OA 1ZAOA 4LG0A 3T8TA 1YS7A 2DTRA 1L3LA 4FHTA 1XCBA 5BQTA 2PMHA 2LNBA 1B4AA 1I6XA 4UUVA 1G3SA 1EH7A 1CGPA 2HEOA 5TJJA 2EK5A 5E18F 3F6VA 1I27A
chains in the Genus database with same CATH superfamily
4XBFA 1ZYRF 2JPBA 3A01B 1R7JA 2D1VA 3IP4B 4HNUA 3E0JB 3QOPA 1J5YA 4L0ZB 3GTQJ 4AVPA 3OYAA 2OQGA 5J4VA 3BOQA 2QA4I 3QRFF 3OYHA 1W5TA 3K69A 1Z67A 3DF8A 5EEAA 2DJIA 4BBRJ 3DU5A 1BL0A 4XRSA 3GZ6A 1PVEA 1LEBA 2FNAA 3DKYA 3LSPA 1XMKA 2CUJA 2XAGA 3J7AO 1TT5B 2LF8A 4HV5A 2CW7A 1QNTA 2M5WA 1B8IB 2LH9A 1NG6A 1T98A 1U9OA 2XGCA 3E6BA 2VE8A 3EUHA 2CH0A 1NK2P 3RKQA 3HOWJ 1FBUA 5M3MJ 1MBKA 1USTA 4JYKA 4CXFA 4EM2A 3RPUD 4UVCA 3LFKA 4HX4A 5LRRA 3CP8A 3B6AA 4M72A 4QLCU 4IXAA 4XSXF 5IYCJ 2K9LA 3O3KA 1SD5A 4BXFA 4C9YA 3HOVJ 2R0QC 1D8JA 1BJAA 4XLCA 1A04A 2ZXIA 4BY1J 4G6TB 1GHCA 4HNVA 1T56A 3P7NA 1TQMA 2QKMB 1LNWA 4LLGF 2M4GA 3HPGA 4HV6A 3GLLA 2HZTA 2MABA 1U8BA 4FISA 1JKQC 2VJ5A 3CCQI 2LR8A 3AG3H 2IP2A 4BHCA 2F5FA 2EH3A 1FC3A 3JAMZ 4BXXJ 5J47A 1O4XA 3DU6A 1IAWA 4LGWA 1R49A 3M07A 4CDGA 4IZZA 1LUJB 2EZLA 4I09A 2H94A 4OIRF 1XSXA 3HKZA 2DPUA 5JHFA 3T0YA 3D5LA 5F64A 4A6DA 1GUUA 2XSDC 4J01A 3J80K 3AAFA 2VASA 3ZQLA 4L18B 3PSIA 1W0TA 1UB9A 3FM5A 3S93A 5D8KB 3BJ6A 3EETA 5HDKA 2HDDA 4XLAA 5L3BA 3K6GA 2LBFA 4XR6A 2XRNA 5GADJ 1ZRCA 2DQRA 1R5HA 1TQIA 2RVCA 3HUGA 3DEWA 3WGHA 3BQZA 4EV0A 3WTZA 3VODA 1LEAA 2DT6A 3AG1H 1AHDP 1YE9A 4K2EA 1QBJA 2R92J 2QCOA 3QOEA 5KAIC 1JKOC 4L5IA 5F1RA 2QQ8A 4A69C 2OC6A 1YO5C 2E2IJ 1IN8A 2DOFA 4N4NB 2P5KA 1EF4A 1Y0UA 3NWSA 1XDUA 2Y75A 2LP0A 5FB2A 1X3ZB 4D9JA 3N05A 1O3QA 1SMTA 1TLHB 3ZN1A 5B1AH 4CO8A 2FRHA 3KZZA 3ZOBA 3WTYC 1FY7A 1MW7A 1GDTA 2OQRA 1TWFJ 3KP5A 3R6SA 5BNGA 4PSXA 2M8EA 3WTUC 5LHHA 4P5OA 3Q0UA 1DGRM 3X2QH 2GIZA 5F1JA 3LOCA 3BY6A 1ZQ3P 4KMUX 2FBIA 1OKRA 2PEXA 3KCCA 1MSFC 4PFOA 2PG4A 3U9GA 1JTXA 3BZCA 3FK7A 2P5VA 4BBSJ 3GMEA 1F1ZA 1Y39A 4IHTA 2P6SA 5ILVA 2EILH 1IUFA 1TWCJ 2HXOA 5FLXK 5JFRA 5DDGA 1Z77A 2DMQA 3S15J 3BR2A 2OBPA 2R7FA 3W6VA 1ZG3A 4ZYGA 1K7AA 4XOTA 2ISYA 1WJCA 5HOOA 3M8FA 4HOBA 4M73A 3ZN0A 5FRNA 4A3KJ 2O8XA 2ZMEB 1ZLKA 1O7LA 1OCOH 4IRGA 4YFXF 5EGOB 1TNSA 4KFCA 4G9YA 5TISC 3KEOA 4A3FJ 4OU0A 2Q2EA 3A0HC 4XL9A 5A2QZ 4M3FA 2LSOA 4E4HA 1AKHA 5CVJA 4NQWB 1YS6A 1FYKA 3MD2A 3CMAI 3ERED 3JR9A 3TGNA 3AKZA 2QBYA 2R7SA 5K5OA 1WH7A 2BGCA 2CV0A 1OJLA 5HLGA 2CS3A 2VT3A 3SZPA 2KIMA 2R5ZA 2H27A 1UELB 4B47A 3AG2H 2N8GA 3WTTC 3PIPF 1WJAA 2XAJA 5BOXA 2PI0A 3FXRA 4JX6A 4A3CJ 2R7DA 3CQZJ 2LTPA 3PUBA 3HRMA 1H89C 2VONA 2WY7Q 2ELKA 1POGA 5F04A 3W3CA 3QU3A 1T39A 1LB2A 3CZ6A 2Z5UA 1D1CA 2QWWA 1YRNA 3OS2A 3ONQA 4ZDPA 4N9HA 2V6EA 1RKWA 2DODA 2M3AA 2IA1A 3BJOA 4JOMA 1TL8A 1W7PB 1DP7P 2A3SA 1GVJA 2OUMA 2KRCA 3EUHC 1MBJA 4GYIA 2MLGA 1Z21A 3ZP5A 3KE2A 4IHSA 3JTHA 2DAOA 2X4HA 1BI1A 4B1RA 2W4SA 4UVBA 1MKMA 4XN0A 1IO2A 2D5VA 4M6XA 3ABLH 1YIOA 3PIOF 5DCMA 2W1OA 2HQRA 3D0SA 5DM7F 4IOAF 2EQRA 2L4AA 3FX3A 4W1UA 4BHPA 5L3FA 4LG3A 1TP4A 2OCCH 3WU1B 2KDZA 3F8BA 4LIUA 5E3NA 3GFMA 4IL6C 5HS8A 3QWLA 3H3UA 2F5CA 1ORKA 2ZFUA 3CLOA 2VPRA 1VQNI 5B3SH 2CSOA 3ZQCA 2CQQA 3HRTA 3S2HJ 2NYXA 2JA7J 4CCJA 2E1NA 1S6LA 3OOUA 1IDZA 4RMNA 1ITYA 2V9KA 3I64A 2HS5A 1HA8A 2LY9A 3S2WA 5C3EJ 3FK6A 3PM1A 2WB1A 5DEQA 2BZTA 3A2KA 1ZGJA 1VQLI 3H5RA 2XUBA 4BUPA 3SJMA 1WH5A 2EIKH 4KNYA 5L3GA 3EYIA 4BHBA 4YIIA 1APLC 3RKXA 5IY5H 3KLNA 3CCMI 4EJUA 2VE9A 2BY3A 3CD6I 5LLQA 1Y1VJ 4X0GA 4X1EA 4W97A 4AU7A 3OYIA 3CUQB 3D5SC 1BOBA 2E7XA 3KYDB 3G73A 1C0WA 3ABTA 1R1TA 1W5CC 3DBLB 2GA2A 3TKYA 2V9PA 1ODDA 2COMA 4LIVA 4I0AA 4NUBA 2A68F 5HS9A 3GFLA 2QUFA 3K7AJ 2Y9ZA 1LKXA 1RUNA 2OTJI 4RAGA 3W6KB 3FMRA 1X2MA 1K4SA 5LGUA 4UXNA 1I3QJ 4BDZA 1F36A 1N25A 9ANTA 1SFOJ 2VBWA 2YPRA 4EM1A 2MGQA 5J1RA 2B9SA 4LG0B 2MFZA 3IAM2 1W1WE 3KP7A 4PZJA 2XC7A 5KVRA 1HOMA 3PSFA 3VOEA 3IKTA 1K4TA 3H0GJ 1RR7A 1QHGA 2CU7A 2GQQA 2IA2A 3I58A 2W84A 5JLXA 4A3JJ 3PQKA 1K6OA 3BTIA 3GEZA 2IT0A 3HIFA 2JTVA 5E3OA 3R60A 2YUSA 3ZQFA 1ZGWA 3CDIA 1R4MB 4G7HF 1IGNA 4GO1A 1ERDA 2VQCA 4S04A 1XX5A 2CQXA 2CFXA 2RNJA 2HYJA 2RC4A 3CCRI 4LB5A 2Y0MA 1ZN2A 2IS2A 3BCAA 2DMTA 3CJRB 3FXOA 2OAZA 2K9SA 2PMZN 4PGGA 2WAFA 1R4NB 2YX4A 1A31A 2R93J 2R5YA 1Z91A 1JTYA 2JRMA 2HOTA 1T38A 3COAC 2W24A 5ILUA 4YFNF 1S8NA 4QWQA 1MGTA 3H9GA 1VNDA 3JREA 1DU0A 3ZXSA 1PUEE 4BEHA 4FCYA 1T95A 5FKNA 5TGTA 3VDXA 2ELHA 4CCMA 1IXSB 1ZARA 4FETA 1VQOI 2WY8Q 4M3EA 4I01A 2O61A 2DK5A 3DEEA 3ZQHA 1D0YA 3UKGA 3FXMA 2DA5A 3VYRB 3GUDA 4M6VA 2ME6A 3CF5F 4C2MJ 3F9KA 3K4NA 4CYCB 1IRXA 3K70C 1EJ9A 2JWTA 1SD4A 3OL4A 2KMUA 2MA3A 4TV7A 3B6CA 1FTZA 1XC5A 2EJRA 1P7IA 2O3FA 3BTCA 3V4GA 3GTPJ 2XV4S 4M6YA 1DP3A 4Y15A 2FXAA 1JGGA 5JLWA 3J80Z 4R8HA 1UZCA 3OYEA 4Q48A 1RESA 3RQ4A 2ECBA 3RZOJ 3CDHA 5FFZA 1O3TA 1IXCA 2ZJ2A 3OS1A 4DQ2A 4DYQA 4ZDLA 1FT9A 4KICA 1G3WA 5HDGA 2E5NA 4N4OB 2XSJC 3RKYA 4IPAA 2OA4A 1X3WB 1STZA 4WXCA 2YR2A 2M7BA 2XIGA 2G7HA 1WJ5A 2AO9A 4Z2YA 3I4MJ 2E71A 1XGSA 1P4XA 1VF9A 1X1PA 1ETYA 4DBRA 5F6FA 1U5TA 1EV7A 4A6EA 3T5XA 5AIPA 3DQVC 1XSVA 1RC9A 2R7RA 4KITB 2EV5A 3OYBA 1YLFA 1R1VA 3BG3A 3IRQA 3C2GA 2E34A 2XGXA 5D6EA 4CCKA 1SANA 2IAIA 4PJMA 2VC0A 1DUXC 5CQEA 2LBFB 3SZTA 2QSHX 4CYDA 3QP5A 1F9NA 1V55H 2W57A 1SFUA 5KK1A 5JVTA 2V26A 3KX2A 1JHFA 3WTWC 2V6CA 1UJ8A 2W82A 3HRSA 4YRVA 2L7KA 2V1DA 1QVUA 5LBQA 3CO7C 3OWTA 3Q0WA 2ZCWA 3RCOA 2DA6A 5GP9A 1Z0XA 4IO9F 3DPTA 4RGRA 2GBYA 2QEXI 4HAMA 4EJWA 3E7LA 3ROUA 5HVQC 2CV1A 4XKBA 4GFBA 3B73A 1QQIA 3WHCA 4AIKA 1NK3P 3TEDA 2E1MB 4XLPF 4X6AJ 1EKEA 1CF7A 3GWZA 4PDKA 4KIFA 5F0CA 3IRRA 3GTOJ 1XN7A 2A61A 2BBYA 3K10A 1YITI 1FIPA 1H9TA 1S9HA 4XLNF 1IV6A 2BVLA 3MEXA 3W2VA 2VQGA 2DDBA 3DBHB 4XM3A 2W48A 4CUGA 3G6EI 5FRMA 3O2PE 2VLAA 1XB4A 1RRJA 1U78A 2NS0A 2JA8J 1HXDA 2K3FA 3E97A 1F5TA 2HPMA 3FF5A 3OIOA 3C3WA 3V8KA 1EA3A 2KJBA 3GXOA 3DEUA 1YW8A 2L9NA 2RN7A 1VQ7I 2EFNA 4IHXA 1FOYA 3ZQIA 3HSRA 2G9WA 4Z6YA 1G4DA 2K4JA 2XKOA 5IOYA 2GXGA 3C1DA 2R7WA 4M9XA 4E7JA 1KYWA 2LDUA 2NVUB 2VC1A 4ZDOA 2AXLA 3RQIA 2DMPA 2NAZA 3BCBA 3M1CA 1HW1A 1F43A 1YG2A 3IV5A 4MQ9F 3WE3A 4BY7J 3CP2A 3PJRA 1HC8A 4QIWN 3RPQA 5KAFC 4JQFA 1WJDA 5EDNA 1AU7A 3S3OA 2DO7A 3L2UA 5FKKA 4KN7X 1V3FA 2IGKA 1QZZA 1J09A 2NNYA 1LQ1A 5HNHA 3EUAA 2R5ZB 5GTHC 4HX8A 1BOAA 4NC8A 1YQAA 2F2EA 1JHHA 2B63J 2GZWA 2Y0SA 4UV9A 4OIPF 3DTKA 3F23A 4P9UA 5EG0A 4RB1A 1BA5A 1U0JA 2K5CA 1PUFA 4KIBA 3JSPA 5D6FA 3O6BB 3G4SI 5E8IA 4CHUA 2XF7A 2A07F 3WU2C 2LREA 2WC2A 2QVOA 4EVIA 3LWFA 4LD5A 3EYYA 4M9SA 2UUZA 1WSUA 2KHMA 3OYMA 1QPMA 3PO3J 2A6HF 4HF0A 2XF6A 2ZNZA 1VQPI 2EWNA 2EPFA 4L9NA 2UV1A 4IHVA 1N77A 4HBLA 2XPUA 3A03A 2WBMA 4BKXA 1E3HA 4BQAA 2HVRA 2JUGA 4B8XA 3C7JA 2D2WA 4PK4A 2XGDA 3KP6A 3LA7A 4PCQA 5DS9A 3RPUA 5LEKA 3MWMA 2I10A 2B0LA 5EJCA 3TDUC 2R4GA 2V79A 4UY8I 3J81K 4GCVA 1R6RA 4I98B 1KU3A 2ZSIB 3SEQA 2MD5A 3QP6A 1PDNC 1WPKA 3ABUA 1HKQA 1U5TC 2XGEA 4KYWA 4MEYF 2C6YA 3CESA 1ONVA 1VQ8I 2HVSA 4Y52J 2FBKA 2HZDA 2IS1A 4PJ0C 1YJ9I 1XS9A 1FBQA 2R7XA 1YOVB 2MYSA 1SVMA 3VFZA 1MH4A 1G6NA 1WI9A 5AONA 2XVCA 1P6RA 5CLSA 4ZTJA 3CC7I 4A3MJ 1LFUP 2MC4A 3W6JB 2W00A 4N0BA 2L9VA 3F0CA 3OL3A 1FSEA 2ME0A 1XG1A 1E3PA 2JSCA 4RLFA 3MVPA 5FKLA 4A0XA 4U7DA 4ESJA 5LD2C 1S7OA 2DDAA 2BW3A 2V7FA 2G0EA 2A6TA 2NOGA 2Q8KA 1MBFA 4NDLA 2YS9A 1P92A 3BR1A 4BYYA 4UHTA 2VBYA 3IH3A 2Z99A 2FF4A 3CJQB 3CCUI 1IC8A 4HF2A 2VUMJ 2HGCA 1BM9A 1WI3A 3K1MA 4RLQA 3OYJA 2ICWG 2M30A 3ELKA 2D45A 2IEKA 1H88C 3Q9SA 5GAGJ 3OYNA 1YJNI 3GZNB 4KIGA 5IOZA 5DYMA 1D0ZA 5D4RA 4DZJA 1FLIA 1YI2I 1TWAJ 1Z05A 3HTSB 2OZUA 3JW4A 3LFUA 1LJ9A 4QPOA 4PFPA 1J2XA 3J7ZI 2LMDA 3OIQA 3Q9VA 1EH8A 3LSKA 1SFEA 1TTYA 3ML6A 4PUSA 5HDNA 1WZ2A 2EBIA 3DCFA 3ZQ7A 4II3A 2KRHA 3LA2A 4D0PA 1JUSA 2CUEA 2K4BA 2HPIA 4A3IJ 1NH3A 1D1AA 3AL0C 1GXQA 1UFMA 3FXQA 2HKXA 3PFIA 4ENKA 2CFOA 3DPUA 2A6EF 1GLNA 1XPXA 5H6QA 3LA3A 2BYVE 4BEHB 4ENNA 3RI4A 1XD7A 4A0YA 1MBEA 1HW5A 2BVMA 4KN4X 2M4KA 3HC7A 2PBIA 3TDZC 3QODA 3FXUA 4U7BA 2L2OA 1O3RA 4G8XA 3LSJA 4PJNA 2ZO4A 2B7EA 3HOSA 2JRTA 3HOZJ 1DPUA 3I5UA 3MCZA 1MDMB 1IN4A 2VB6A 3ZQQA 1RUOA 3CMMA 5CVIA 4F93B 3GX4X 2ADUA 2ID6A 4CICA 3ECHA 2VKEA 4O3MA 3LMMA 4CGZA 1FSHA 3DFGA 3H36A 2PMUA 1FPQA 3E6DA 5J1YA 1XMXA 4XKVA 1H0MA 3AFHA 4IQ4A 1WHUA 2RQPA 2Q1ZB 3IC7A 1SVLA 2HR3A 3IH4A 1WJFA 1A36A 3BR0A 2BXZA 2PJPA 2DFEA 3TO6A 1X3UA 3KP4A 3V7CA 2JPCA 4MTEA 2FEZA 1OQYA 2M7AA 3BPVA 3VSKA 3QAHA 1NHAA 3MZ8A 4GXOA 3K4CA 1I1GA 3C2HA 5FJ8J 2W7NA 1U8RA 2PLYA 5GTIC 1BR4A 4D5CA 2K7LA 2YSRA 2LC2A 1I1SA 2AQEA 4PJLA 4GGGA 4ZYHA 4RGUA 4UV8A 3L2WA 2Z16A 1LFBA 3LAPA 1R58A 1RNLA 3SQNA 1WRJA 5ILSA 2KL4A 2H1LA 1UCRA 2JZYA 3WHBA 2OU2A 3BZKA 3ZMVA 1E17A 4G7ZF 2O8KA 4HNTA 1GT0C 2PMZA 3D5RC 2K02A 4WWCA 1RR8C 1Z6TA 3F3XA 2ZC2A 2M45A 2ELJA 2NNNA 1ETWA 2Z1DA 3LSTA 2K27A 5LFAA 2F5VA 1Y8QB 3CCJI 1HBXG 3GTLJ 3BLYA 1J7KA 2K3PA 3DKXA 3BQYA 1YTYA 2E1CA 2QF7A 1R1UA 2RDPA 4CCOA 5CVUA 4XQFA 4D1QA 1Z6RA 5L3CA 2EIMH 5ICEA 3M3YJ 2K85A 3RYPA 3A1YA 4RB3C 3KEQA 4A3EJ 2L02A 2Y48A 4WX9A 4L9TA 2GOMA 4HPQA 1CF7B 2JVHA 1TQPA 3BR5A 4ESFA 2VT2A 4BACA 1JE8A 1FOKA 5BPDA 5LEJA 2ZJPF 1X58A 4IRHA 1U2WA 2IJLA 5JVGF 1LDDA 2IXSA 3TOAA 1P4AA 2VJ4A 1FEXA 5FO5A 3TP0A 2IVMA 3LL7A 1XMAA 4WK8F 2PJRA 2OCEA 2WAQA 2XROA 2JK3A 2KIUA 3FMQA 1R5GA 2V4JC 2Z33A 2ZXHA 2LLKA 3FWEA 4EGZA 1GV5A 3ULQB 1ZTRA 3DTEA 1KONA 4LK0F 3SEZA 3HGGA 3Q0VA 4M9ZA 1MMNA 4F91B 4HDVA 1MIJA 4BH9A 2XB0X 4YELA 3E6CC 5ICGA 3GTMJ 1KU9A 2YX7A 2O6GE 1U9NA 4BJ6C 3O8GA 2O03A 2WAEA 4I76A 3T8RA 2E36A 3JRHA 4ETSA 4IHWA 4A3LJ 3I59B 3L09A 4M3BA 3V7RA 2QYOA 4F55A 3HHHA 3MKYB 1X4OA 3S1NJ 4XLEA 1OISA 3HDDA 4EJVA 2V1NA 4I0BA 1R22A 2VKHA 3CJTB 4L9VA 3U21A 2A5YB 2MSYA 2KISA 3H3VK 4AC0A 3VYSB 2VBXA 4B3AA 3HG9A 1SFKA 3TW7A 1X4PA 5L3EA 2GOXB 2MBFA 1TW3A 3GVAA 3PFYA 1Q1VA 4IF4A 3HL2A 5JR3A 3HEFA 2J5OA 2JSPA 2Y2ZA 3DXJF 1MSEC 2NRAC 1JT6A 2R7TA 3KFWX 1MJBA 3HKZN 3I3LA 5EG0B 2KLOA 3PL8A 3I71A 3S14J 2VBZA 3HSEA 1BW5A 1MBHA 2R3SA 2IGOA 1BN5A 2CQ7A 3K2ZA 1VTNC 2F6CA 4E7SA 3A01A 3DLAA 1IDYA 4HLYA 3V7SA 4XK4A 4LJZF 3J81Z 2DLLA 1K83J 2NOJB 2NXNB 4N9IA 2ZFWA 4XSZF 3M8EA 4MIMA 3CF2A 1UHWA 4O6JA 2LF7A 1HSTA 1Y56A 4HYEA 3L2VA 3ERMA 4A0ZA 1OLTA 4FASD 1SC7A 4JP0A 2KPMA 1HKTA 3RIRA 1G2HA 2D1HA 1E2XA 2JUCA 4M74A 4AYBA 2BY0A 4FX0A 4U0YA 3HOUJ 2KQRA 4UVAA 2MC3A 4JBAA 4EEFG 1VQ4I 2L9SA 2HTSA 2R7OA 1VQ5I 1ZLJA 3K4JA 4DJAA 2QENA 3GCMA 4QSHA 4NNJA 3K4MA 1O57A 2F48A 1VQ9I 3EQLF 3BT9A 4ESBA 3BG7A 3M8JA 3MKWB 1R36A 1Q1HA 1MH3A 3JRAA 2Y31A 2Y30A 1JXSA 1QO0D 4LB6B 3IAS2 4GYGA 1B59A 4EM0B 2DK8A 2H8RA 3WGGA 2HFHA 1ZKGA 5E17F 4FT8A 1FIAA 3TO9A 4G7OF 1IRFA 3G2BA 4PGHA 4BAYA 1TWHJ 5CQGA 1CQTA 3NQOA 3FBIB 3VPRA 4AIHA 1S7AA 4RAFA 4CZZA 5DD4A 5BS6A 1F4KA 4ASNA 3D1NI 2CUFA 5FGMA 2XRLA 3G1OA 5E79C 1ZRDA 3R0AA 3G1LA 4MQVA 3ZMSA 2DBBA 2FA5A 2RV8A 2VKDA 4FX4A 2ZJRF 5J3LA 3K0LA 4E7IA 2VPLA 2IBDA 3KP2A 1S72I 3BDDA 1ZGAA 1UHSA 4RB2C 4RAYA 3BZ6A 3KEYA 2FQ4A 3QU6A 3N97A 5IP7J 4L5EA 3LQRA 4MNUA 1ENHA 1I39A 2LKPA 3FXLA 2XF5A 5KCMA 2LVSA 4MO7A 4RBOA 1RKTA 4V2GA 4EATA 1IN6A 5E1XA 1MMSA 3W2AA 3BPXA 1YFHA 3WG7H 3TOBA 2VJJA 4E70A 3OR2C 3SFZA 4UNOA 4P55A 3H92A 3MAJA 3IWZA 4B09A 3QYBA 1L0OC 3WGIA 1U3EM 4E7HA 2DT7B 3O8HA 3WG9A 2E2HJ 4A93J 3MMYB 3MFKA 1T8IA 2HTJA 4ZZLA 4XICA 1KU7A 4UUTA 2DYRH 2DJNA 3HOTA 5FKOA 3GTKJ 3F8MA 4HF1A 1V5EA 2UXXA 2M8GX 2KZVA 1FWZA 5J8CA 1PP8F 3J7YJ 2VXZA 3CJNA 2V1XA 2O0YA 5M3FJ 1BIAA 2K86A 2F4IA 4NC6A 5FD6A 1TT0A 1I3AA 2FMYA 4G94A 1IRZA 2LOOA 5J1UA 1RETA 3HTUA 3LNQA 1BC8C 3CCYA 2FOWA 3HUGB 4Y7NJ 3HYIA 1VQKI 3WODF 2H6BA 2J5PA 4D5FA 3RZDJ 2K9MA 4XRMA 2CGPA 4HW0A 2OF7A 5GPCA 2E2JJ 4XLFA 4NB5A 1WKMA 3ZPLA 4OAZA 2QSGX 3QPLA 3CUOA 1J75A 1E0EA 4ZYEA 2ZMEA 5EGOA 4IHYA 3ABKH 2IGMA 2BY1A 2DFHA 2HVQA 3OYDA 1SFXA 2VKVA 4AUXA 5F0HA 5D5WB 2KDOA 1LDJA 1MMAA 1MMGA 4XIDA 1B9MA 1XDSA 1Z9CA 4IQJA 1Y8RB 4XKWA 1V4RA 4I6ZA 1IF1A 3BJAA 4XONA 1OYYA 3KP3A 4ENMA 3FIWA 4BS9A 3TL4X 2EZHA 3DP7A 2DFFA 5C4XJ 5IT3A 1KU2A 5B66C 1JJ6C 1WCMJ 4XOPA 2XAQA 3SDGA 3OY9A 5J6XA 4C3JJ 4YG2F 2DQLA 2DXIA 3ZMZA 4A12A 4YFKF 1OYIA 4B4CA 1FYMA 1W7PA 2DT5A 3FM3A 2KIFA 2LRDA 5K7ZA 2EZIA 4ZYDA 1AWCA 2FX0A 2BHZA 1JKRC 5GAEJ 4HEA2 4OMYA 1XTAA 4U87A 4XKCA 1O7FA 4BL0B 2F5DA 2X6OA 3F8FA 2Q2EB 3GZ5A 1TBXA 1AKHB 3FDYA 2ISZA 2G7UA 2DPDA 2P6TA 4B48A 4F52A 4BNCA 3SYTA 1T2KA 4OINF 3H1CA 2TDXA 2QBYB 1ZG5A 2FNPA 2MD0A 2ESNA 4RS8A 1K78A 1IZ1A 3WTSC 2WADA 3CTAA 4BXUA 3HSFA 1IW7F 4BJ5C 3P9IA 4CCLA 2WV1A 1SD7A 1V5GA 5LGNA 3S32A 2IW5A 3E5QA 4V2FA 2P0WA 2XASA 1YRNB 3FHZA 1Z7LA 1D8KA 4B3XA 4IRIA 3KETA 1ETKA 1W0UA 1WJEA 1HSJA 5C4JJ 1G3YA 1TNTA 3GW2A 3QYFA 2GAUA 2X0LA 4EMSA 3OSFA 1W7PD 2ZXJA 1VI0A 2Z2SB 3L2CA 1T0FA 4DBQA 4BQOA 1B6AA 5DM6F 1IUYA 3CUQA 1B9NA 3H3ZA 3HOYJ 4A3DJ 3VB2A 4BJTA 5CVVA 4MHGA 2M2EA 2VJIA 5DCMB 1SAXA 5FFXA 1ON1A 2OPTA 5CPRB 1H9GA 4GRIA 4NHJA 2HU9A 2KFDA 5EZHA 2EFWA 1IRGA 4DW6A 3ZMUA 3OR1C 2KKOA 2HOAA 4AIJA 2HQAA 4II2A 3OIPA 5HLHA 2PFBA 1USSA 2UZKA 3OYLA 3JRFA 1S7EA 3F72A 3REOA 3TW6A 1Z1DA 4FE7A 2LFBA 3OMYA 3CO6C 3K1PA 3CC4I 4HLXA 3ZMTA 2XDVA 5H2FC 2MH9A 3LSGA 4FQGA 4A3BJ 2ETHA 1B72A 4BU2A 3GFIA 1FBSA 4KUMA 2W25A 4F7ZA 3UR3C 2ZB9A 2OTLI 4Y17A 1ZHFA 4EJTA 2P7CB 3S8PA 2CQNA 1NG7A 3ASNH 1MNDA 3OYKA 2VODA 2DU9A 3PO2J 3VWBA 2LD5A 1DU6A 1LFPA 4BDYA 4DOZA 1O3SA 2F4OB 3SZGA 4EQQA 3H5NA 2L5QA 4M3DA 3DLLF 1RI7A 1Y0NA 2R7VA 4P96A 3A0BC 3LAJA 2RAEA 3CDLA 4RM3A 2DA1A 2CJJA 4J19A 5DTDA 5H20A 2CW8A 2ZMEC 1HLVA 2P4WA 1H8AC 1BI0A 4GDFA 1X2NA 1IXRC 2QQ9A 2AXTC 1UG2A 2FJ1A 2F5EA 2DN0A 1FX7A 2NVQJ 3HJEA 1DGWY 1T08B 5F0FA 3CCSI 3LSHA 3ZCOA 4KISA 2VOPA 4CYCA 3F21A 2O9LA 1D5YA 3V8JA 3BC8A 3M7GA 4RAZA 2E60A 3BP8A 4MTDA 4CSWA 3JRGA 3FISA 3CCEI 3DV8A 3L1PA 3OV8A 5GPAA 2FE3A 2A69F 3LSRA 4BE0A 2FU4A 5DUIA 2ZXWH 2HWVA 3P5JA 1VQMI 3G1MA 1R5ID 4DNCA 4KMFA 4KT6A 4XRFA 5BPIA 3I55I 1AA7A 2ECCA 2R5YB 4LLNA 3H35A 4G6QA 5ICFA 2RGVA 3M4OJ 1ACIA 1VQ6I 4A5NA 4MFDA 3ISPA 4HSTA 4A5MA 4ZJZA 1FOXA 4B43A 3JSOA 5HS7A 4BE1A 3E3VA 1FP1D 2IRFG 4E7LA 2IS6A 2ACJA 1YIJI 3JRIA 3NRVA 1LE8A 4ENJA 1MNEA 4FE4A 1XCVA 1IJWC 3SHFA 5IYBJ 3RTRA 3SXYA 2GM4A 3HOXJ 2Z9OA 3F8NA 1SEUA 3K1NA 2L01A 3FHNA 4E7ZA 3M1EA 2LKSA 4WCGA 4D7NA 4E6KG 4DIQA 2X51A 2R7QA 2P8TA 1WQ2A 2M34A 3S17J 2GIVA 3ZGKA 4MLOA 5CYVA 5K5QA 1ETOA 4IOCF 3U1DA 1U6GA 3EDPA 5DUKA 2UXNA 1FTTA 2TCTA 4LOCA 1OYWA 2QM3A 5D8LB 5DV5A 3KYLA 3B02A 3TQNA 5D5UB 2DA7A 2Y0SN 1R9TJ 1Z3XA 2L9RA 1LDKB 4LITA 2KP6A 3ZRGA 1IN5A 1T33A 2HNHA 2DOEA 2O5RA 4DGWB 3OYCA 4IX7A 2GXAA 3NARA 5KNLA 2BEOA 1PYVA 4I7HA 1T0FC 2MH2A 1E3OC 1TZLA 3IHUA 1P4WA 4IEJA 4LK1F 3CUQC 1MJ9A 2L54A 3V8LA 3C2BA 2KRFA 2GXBA 2HYFA 4LLLA 3I56I 1AOYA 1MMDA 2VL8A 5BMZA 1U5TB 2COBA 3I4PA 2OD5A 1P9QC 1SAUA 1G8XA 2K9NA 4HSRA 4ZYAA 1Z3YA 3S1MJ 1OFCX 2MLKA 2HDWA 4I02A 3MQ0A 1KYZA 4Y4RA 1IN7A 2NS8A 1HKSA 3BTLA 2W85A 4YIFA 4H4KC 3WE2A 1GXPA 3PUFA 4AD9A 5M5YJ 5FROA 2KJCA 2H1KA 1MNMC 2R7UA 3H9QA 3NWTA 1V54H 2EZKA 2IA0A 5JHUA 3S3MA 1HW2A 1BC7C 4JK1X 4YIRX 4UB6C 4ON0A 3DTIA 1WVRA 1XGOA 3C18A 2VI6A 3IL2A 2HXIA 2PX9A 2XPVA 3ECOA 3HRUA 3QPSA 2EA4A 2HQ5A 4WF2A 2X1EA 4XORA 5AIQA 1KQ8A 3GO5A 1D5VA 5HLIA 5EEHA 1HCRA 4KDPA 2OV7A 5E3MA 2LYCA 4L9JA 3RKWA 2IS4A 3TP3A 2X9DA 3DKWA 3U2RA 2ZSHB 2AS5F 1TWGJ 3BG6A 1RIOH 5IT9K 1X1CA 4IVNA 1SD6A 5FD5A 1Y6IA 2R7ZJ 4QPQA 2K9QA 2L7ZA 3P9CA 3QPTA 1V5FA 1ZH5A 1HQCA 1VFCA 4AVZA 1S5LC 2XAFA 5F27A 5LRSA 4S05A 3KIOA 4UUSA 1ULYA 3K4LA 4G6DA 2RKHA 3PNVA 4P9FA 1DPRA 2RQQA 3S2DJ 3DPLC 4PSWA 2QSFX 3L7WA 1EH6A 3KZIC 4G12A 1G3TA 3A4CA 2VOOA 3K9TA 2DI3A 4RB0A 4L5JA 2NS7A 2ZJQF 5LHGA 2ZBKA 2IPQX 2L3DA 4WXDA 1N75A 3M9AA 3QYEA 3OOPA 3BTJA 2LY2A 4O5VA 4XLHA 5M5XJ 5H6RA 1Y1WJ 1D3YA 3AL0B 1A35A 3EPZA 1ZG1A 5B1BH 1I6HJ 3GTGJ 3MZYA 4QTRA 2H6CA 1JKPC 1FZPB 1X1DA 4ABZA 2ZKZA 5ED4A 3AG4H 2DA4A 5K7FA 2HDCA 1BR2A 1KZHA 1QZYA 3A02A 1P2FA 2Z3YA 4KA4A 4JX5A 3P9KA 3VYUB 1OCPA 2X1CA 1FJLA 1XGMA 1UG0A 2TRTA 4AM3A 2XHKA 2EV6A 2WV0A 2X6XA 3U1KA 1JGSA 1W5SA 4IKFA 2HQNA 2JQ7A 1XSDA 5FKMA 2WWYA 3F22A 5J40A 5IYDJ 4PJJA 4CH7A 1LVAA 4ANJA 3OYGA 2HOSA 4U0WA 1K78B 2BHYA 3VEPA 4OIOF 3K70D 4L0YB 3I4NJ 2MW8A 2P5LC 1DQUA 5E1WA 2BXYA 2CYYA 4Q47A 2BV6A 2DTZA 4C3IJ 2HOEA 2OZ6A 3PQJA 3ZMDA 3GTJJ 3N4MA 3KYCB 1YYVA 1BW6A 5CKTA 4MFEA 1PUFB 2JT1A 2XAHA 5IP9J 2QQBA 3SFIA 3L2QA 3FXJA 3MZHA 3QPHA 3VSLA 4IJAA 4DYRA 3Q5FA 2DMNA 3WTVC 3OYFA 4KJZA 4Y3OA 2WA0A 1ZK8A 3K4KA 1DDNA 4Q4ZF 2V9VA 1REPC 1KA8A 1QRYA 2Q0OA 4F3QA 2HYGD 2CWEA 2STTA 3S1RJ 3BR3A 1OCRH 3E6MA 3OSGA 3R0JA 3FBNB 2F4MB 1ON2A 2CW0F 2LK2A 5DD8A 2PN6A 5HLTA 1YW7A 1IV8A 1VZ0A 5EF6A 3GBGA 1UMQA 1D1BA 2HKOA 2M9HA 4XRSG 2VQLA 1BBYA 2CUZA 5E3LA 4AWXB 1OR7A 5LGTA 1B8IA 2X48A 3ESWB 2BE5F 4R79A 1R23A 2P81A 3GF2A 1FMVA 2E1MC 3LQQA 5LHIA 4CCNA 1WJBA 2DFIA 3L9FA 1A5JA 2DCEA 5CVRA 3PNYA 3KZYA 3SDBA 3OS0A 3WU0A 3H0DA 4DYCA 2FD5A 4CA0A 2AQFA 3S3NA 4NC7A 2X1DA 4EGYA 1OPCA 1B72B 3GFJA 2Y69H 4HDUA 4F92B 2NVTJ 4HZFA 4C2TA 2LG4A 2JMWA 2LY1A 2V1UA 5JI6A 5IP6A 3FMSA 3IH2A 2FQ3A 1MZBA 5K1YA 1JJ8C 3E5UA 3MKLA 3JRBA 3FXKA 5L3DA 1JUMA 1SMYF 4S0HB 2BW3B 2EA2A 1QZEA 2RNGA 1QGPA 4KT5C 3CC2I 1S29A 4ITVA 3V42A 4FTHA 2DA2A 3FZVA 4A3GJ 2OJED 3K2AA 3I54A 2L4MA 4R1HA 1ZELA 1XGNA 2E19A 3HHGA 2CG4A 1BIBA 1FP2A 1FNNA 1SVOA 2XAUA 1KQ9A 2EFPA 1ZR4A 2ESHA 3JAMK 2XKPA 5EYRA 1QVTA 1MDMA 1K6YA 1TW2A 1R71A 1QU3A 2EFQA 3WTXC 3IWFA 3BG5A 3R61A 3FKJA 1MD0A 2PQ8A 1M1EB 4MEXF 1WWXA 3NEUA 2YU9J 2QLZA 4RGSA 4H0EA 3IKVA 1KGSA 4OWRB 3CMEI 1LVKA 2KZGA 3NAUA 2MG4A 3IUOA 4C2UA 2KIQA 3CCLI 2H09A 5HNFA 3HM5A 2VQHA 2E35A 2GWRA 4ZTFA 2JA6J 2M0CA 3RYRA 1JT0A 2WAQN 4C3HJ 4E7KA 1MBGA 3I9V2 1YJWI 5DCFA 2AHQA 2FOKA 3TMOA 3Q3SA 3GYHX 3ABMH 3G71I 2STWA 3GLXA 4U0VA 4DZPA 4RM2A 1P7JA 2VN2A 3TBIA 3E5XA 1HDPA 5FLMJ 3LSMA 1QHHD 4HQEA 1BR1A 4UB8C 1W4MA 2DOAA 1LE8B 4I99C 4J00A 1R00A 2CO5A 2RREA 2NVYJ 6PAXA 3VYTB 1HDDC 2K40A 1FYLA 3L2RA 2E7WA 3JCUC 1MJAA 4ZH4F 5D5XB 2X6YA 2NVXJ 4AIDA 3PNTA 1GVDA 2EINH 3BROA 4EJOA 4RDUA 1KQ0A 3HBLA 1T6SA 1BI3A 4Y13A 3ASOH 1ZRFA 1TC3C 4LMYA 5B5EC 2YU3A 2WTEA 1W36D 3RSNA 4C30A 2WB1N 5D5VB 4Q5SF 4NQWA 4OAYA 5K7HA 3CLQA 3I53A 4OIQF 3I0TA 1WGXA 2I5UA 4A2UA 3JRDA 1B1BA 1ZREA 3HZJA 4V19K 4BQNA 3UNGC 3BR6A 1ETQA 2H8WA 2O7OA 3HB9A 5D4SA 3S16J 1ETXA 1FOWA 2XB5A 1J59A 4I2OA 5FLXZ 4M71A 2HI3A 4XMYA 1YW9A 2GLOA 2CRGA 3K4BA 1I5ZA 1UHMA 1BI2A 3MKZA 2X6WA 1A6QA 5A2QK 5C44J 1K61A 1GV2A 1OR7C 2DW4A 1QA6A 5IPAA 1JI8A 1RZ4A 4OOIA 5E1ZB 5ERIA 1X1BA 4HQMA 5E20A 1OCCH 2VXDA 3H5AA 2XPWA 3RJPA 5FLVA 5IT9Z 3F8CA 4JX4A 2ZNYA 4AYBN 4HX7A 5J4YA 2A05A 4HRIA 2JA5J 4NBQA 4BQQA 2EB7A 1D0XA 2BY2A 3S1QJ 2L0KA 3HXLA 2CV2A 1J0RA 1S3JA 1Z7UA 2JA2A 4XN3A 1OMIA 2FBHA 1A6IA 3R4KA 3T1BA 4D7MA 3DWLE 1YHQI 2QGUA 5TRDA 1BJZA 3I59A 4WXHA 4MGRA 4RGXA 3J7AY 1OCTC 1J9IA 3KPHA 2L7MP 5J8FA 5EEGA 1I50J 5CJ9A 3L00A 3JRCA 5F08A 3HGYA 2KT0A 3QQAA 2DYSH 2E1OA 1LPQA 3EUKL 2DA3A 1K79A 2P7VB 2A5WA 4ZZDA 4CZCA 3BG9A 2GA1A 2CQKA 3G3ZA 2UWMA 4UUSB 1X1AA 2M1BA 3CMYA 2I8DA 2QKLB 2FMLA 1JUPA 1RPWA 2L7FP 2PJRB 3RDIA 3H9JA 4BGDA 1FMWA 1UAAA 4HG2A 5E8GA 3KLOA 2BOLA 2CMPA 5K5RA 4RA2A 2FSWA 2M87A 2JJ7A 4HA8A 4OMZA 3TO7A 5EZGA 2E5ZA 3MN2A 3ZQGA 2M0MA 2DMUA 1PJRA 3W2WA 5ICCA 2EFOA 3HPHA 3LSIA 4P1WA 2QQAA 1PP7U 5GAHJ 2Y9YA 3ZR8X 4U88A 2EV0A 3BWGA 3JTGA 1QPIA 4B44A 1W36C 2QZ8A 2JVGA 1N78A 1ETVA 4XNFA 4LFUA 3F6OA 4M3GA 1ZAOA 2VIXA 3CCVI 1OCZH 4LG0A 1IG7A 1G59A 1NTCA 3T8TA 1YS7A 2DTRA 1L3LA 2X85A 5HODA 4FHTA 5KHDA 1XCBA 5BQTA 2PMHA 3FKIJ 1YX5A 4BE2A 2LNBA 5M5WJ 1B4AA 4YEJA 1I6XA 3E1SA 1HF0A 1YX3A 4ZC3A 4UUVA 1G3SA 1EH7A 1X19A 1CGPA 2HEOA 4Y33A 5TJJA 2EK5A 1ZR2A 1WFXA 1I27A 2EIJH 2JN6A 5E18F 2IGNA 2LKXA 3F6VA 2ID3A 2FUG2 3DBRB
chains in the Genus database with same CATH topology
4XBFA 1ZYRF 2JPBA 1R7JA 2D1VA 3QOPA 1J5YA 4L0ZB 4AVPA 2OQGA 3BOQA 3QRFF 1W5TA 3K69A 3DF8A 3GZ6A 1LEBA 2FNAA 1XMKA 2XAGA 3J7AO 2LF8A 4HV5A 1QNTA 2M5WA 3E6BA 1T98A 3EUHA 2VE8A 1FBUA 1USTA 4CXFA 4EM2A 4UVCA 3LFKA 4HX4A 5LRRA 4M72A 4QLCU 4IXAA 4XSXF 3O3KA 1SD5A 1D8JA 1BJAA 1A04A 1GHCA 3P7NA 1TQMA 4LLGF 1LNWA 4HV6A 2HZTA 2IP2A 4BHCA 2F5FA 1FC3A 3JAMZ 1IAWA 4LGWA 4CDGA 4I09A 2H94A 4OIRF 1XSXA 2DPUA 3T0YA 3D5LA 5F64A 4A6DA 3J80K 3AAFA 4L18B 1UB9A 3FM5A 5D8KB 3BJ6A 3EETA 5HDKA 5L3BA 2XRNA 1ZRCA 2DQRA 1R5HA 1TQIA 2RVCA 3HUGA 3WGHA 4EV0A 3WTZA 3VODA 1LEAA 4K2EA 1QBJA 4L5IA 5F1RA 1YO5C 1IN8A 2P5KA 1Y0UA 1XDUA 2Y75A 5FB2A 1O3QA 1SMTA 1TLHB 3ZN1A 4CO8A 2FRHA 3KZZA 3WTYC 1FY7A 2OQRA 3KP5A 3R6SA 3WTUC 2M8EA 5LHHA 4P5OA 3BY6A 4KMUX 2FBIA 1OKRA 2PEXA 3KCCA 2PG4A 3U9GA 2P5VA 1F1ZA 4IHTA 2P6SA 5ILVA 5FLXK 5JFRA 5DDGA 2OBPA 2R7FA 1ZG3A 4ZYGA 1K7AA 2ISYA 5HOOA 3M8FA 4HOBA 4M73A 3ZN0A 2O8XA 2ZMEB 1ZLKA 1O7LA 4IRGA 4YFXF 1TNSA 4KFCA 4G9YA 3KEOA 4OU0A 2Q2EA 5A2QZ 2LSOA 5CVJA 1YS6A 1FYKA 3ERED 3TGNA 2QBYA 5K5OA 2BGCA 5HLGA 2VT3A 3SZPA 2KIMA 2H27A 3WTTC 2XAJA 5BOXA 2PI0A 3FXRA 2R7DA 2VONA 3HRMA 1T39A 1LB2A 3QU3A 2Z5UA 2QWWA 4N9HA 3BJOA 2IA1A 1W7PB 1DP7P 2A3SA 1GVJA 4GYIA 2MLGA 3ZP5A 3KE2A 4IHSA 3JTHA 2DAOA 2X4HA 1BI1A 4UVBA 1MKMA 4M6XA 1YIOA 5DCMA 2HQRA 3D0SA 2L4AA 3FX3A 4BHPA 5L3FA 3WU1B 3F8BA 3GFMA 5HS8A 3H3UA 2F5CA 3CLOA 2CSOA 3HRTA 2NYXA 2E1NA 1S6LA 3I64A 2HS5A 3S2WA 5DEQA 1ZGJA 2XUBA 4KNYA 5L3GA 3EYIA 4BHBA 4YIIA 3RKXA 3KLNA 4EJUA 2VE9A 5LLQA 3CUQB 2E7XA 3G73A 1C0WA 3ABTA 1R1TA 2GA2A 3TKYA 1ODDA 2COMA 4I0AA 2A68F 5HS9A 3GFLA 2QUFA 1RUNA 3W6KB 3FMRA 5LGUA 4UXNA 2VBWA 2YPRA 4EM1A 4LG0B 3KP7A 4PZJA 5KVRA 3VOEA 3IKTA 2GQQA 2IA2A 3I58A 2W84A 1K6OA 3PQKA 3GEZA 2IT0A 3HIFA 2JTVA 3R60A 4G7HF 4GO1A 4S04A 2RNJA 2CFXA 2RC4A 4LB5A 2Y0MA 1ZN2A 2OAZA 4PGGA 2YX4A 1Z91A 1T38A 3COAC 2W24A 5ILUA 4YFNF 1S8NA 4QWQA 1MGTA 1PUEE 2ELHA 1IXSB 1ZARA 4I01A 2O61A 2DK5A 3GUDA 1SD4A 2MA3A 4TV7A 2EJRA 3V4GA 2O3FA 2XV4S 4M6YA 4Y15A 2FXAA 3J80Z 4R8HA 4Q48A 3CDHA 5FFZA 1O3TA 1IXCA 2ZJ2A 4DQ2A 1FT9A 4KICA 1G3WA 5HDGA 3RKYA 4IPAA 2OA4A 4WXCA 1STZA 2YR2A 2XIGA 2G7HA 4Z2YA 1XGSA 1P4XA 5F6FA 1U5TA 1EV7A 4A6EA 3T5XA 5AIPA 3DQVC 1XSVA 2EV5A 1YLFA 1R1VA 3IRQA 2XGXA 5D6EA 2VC0A 1DUXC 3SZTA 4CYDA 3QP5A 1F9NA 2W57A 1SFUA 5KK1A 5JVTA 3WTWC 1JHFA 2V6CA 3HRSA 2V1DA 5LBQA 3CO7C 2ZCWA 3DPTA 4RGRA 4HAMA 4EJWA 3ROUA 5HVQC 3B73A 1QQIA 4AIKA 4XLPF 1CF7A 3GWZA 4PDKA 4KIFA 3IRRA 1XN7A 2A61A 2BBYA 1H9TA 4XLNF 3MEXA 3O2PE 1XB4A 1U78A 2NS0A 1HXDA 1F5TA 3E97A 3FF5A 3C3WA 3V8KA 2KJBA 3GXOA 3DEUA 1YW8A 2RN7A 2EFNA 3HSRA 2G9WA 1G4DA 2K4JA 2XKOA 2GXGA 3C1DA 4M9XA 1KYWA 2LDUA 2VC1A 2AXLA 2NAZA 1HW1A 1YG2A 4MQ9F 3WE3A 3RPQA 4JQFA 2DO7A 4KN7X 1V3FA 1QZZA 2NNYA 1LQ1A 4HX8A 1BOAA 1YQAA 2F2EA 1JHHA 2GZWA 4UV9A 4OIPF 3F23A 4P9UA 4RB1A 3JSPA 4KIBA 5D6FA 3O6BB 5E8IA 4CHUA 2A07F 2WC2A 2QVOA 4EVIA 3LWFA 4LD5A 3EYYA 4M9SA 1WSUA 1QPMA 2A6HF 4HF0A 2ZNZA 2EWNA 4L9NA 4HBLA 4BQAA 4B8XA 3C7JA 2D2WA 3KP6A 3LA7A 4PCQA 3RPUA 5LEKA 3MWMA 2B0LA 3TDUC 2V79A 3J81K 4GCVA 4I98B 1KU3A 2MD5A 3QP6A 1PDNC 3ABUA 1HKQA 1U5TC 4KYWA 4MEYF 2C6YA 1ONVA 2FBKA 1FBQA 3VFZA 1G6NA 1WI9A 5AONA 2XVCA 1P6RA 5CLSA 3W6JB 4N0BA 1FSEA 2JSCA 4A0XA 4U7DA 4ESJA 1S7OA 2Q8KA 1P92A 4BYYA 4UHTA 2VBYA 2Z99A 2FF4A 4HF2A 2HGCA 1BM9A 3K1MA 2M30A 3ELKA 2D45A 3Q9SA 4KIGA 5DYMA 5D4RA 1FLIA 1Z05A 3HTSB 2OZUA 3JW4A 1LJ9A 1J2XA 3Q9VA 1EH8A 1SFEA 1TTYA 3ML6A 5HDNA 3ZQ7A 3LA2A 4D0PA 2K4BA 1GXQA 1UFMA 3FXQA 2HKXA 3PFIA 4ENKA 2A6EF 5H6QA 3LA3A 2BYVE 4ENNA 3RI4A 1XD7A 4A0YA 1HW5A 4KN4X 2PBIA 3TDZC 3FXUA 4U7BA 1O3RA 4G8XA 2ZO4A 3HOSA 2JRTA 1DPUA 3I5UA 3MCZA 1MDMB 1IN4A 1RUOA 5CVIA 3GX4X 2ADUA 4CICA 3ECHA 4O3MA 1FSHA 3DFGA 2PMUA 1FPQA 3E6DA 1H0MA 2RQPA 3IC7A 2HR3A 2PJPA 3TO6A 1X3UA 3KP4A 3V7CA 2JPCA 4MTEA 2FEZA 3BPVA 3QAHA 1NHAA 4GXOA 1I1GA 1U8RA 2PLYA 2K7LA 2YSRA 1I1SA 4GGGA 4ZYHA 4RGUA 4UV8A 3LAPA 1R58A 1RNLA 3SQNA 1WRJA 5ILSA 1UCRA 2JZYA 2OU2A 3ZMVA 1E17A 4G7ZF 2K02A 4WWCA 1Z6TA 3F3XA 2M45A 2NNNA 3LSTA 2K27A 1HBXG 1J7KA 1YTYA 2E1CA 1R1UA 2RDPA 5CVUA 1Z6RA 5L3CA 5ICEA 3RYPA 4RB3C 3KEQA 2L02A 2Y48A 4WX9A 4L9TA 1CF7B 1TQPA 4ESFA 2VT2A 1JE8A 1FOKA 5BPDA 5LEJA 4IRHA 1U2WA 2IJLA 1LDDA 3TOAA 1P4AA 5FO5A 2IVMA 1XMAA 4WK8F 2XROA 2KIUA 3FMQA 1R5GA 2Z33A 3FWEA 4EGZA 3ULQB 4LK0F 4M9ZA 4HDVA 4BH9A 3E6CC 5ICGA 1KU9A 2YX7A 2O6GE 2O03A 3T8RA 4ETSA 3I59B 3L09A 3V7RA 2QYOA 3HHHA 4EJVA 4I0BA 1R22A 4L9VA 2A5YB 2VBXA 5L3EA 2MBFA 1TW3A 3GVAA 4IF4A 5JR3A 2J5OA 3DXJF 2NRAC 3KFWX 1MJBA 3I71A 2VBZA 3HSEA 2R3SA 1BN5A 3K2ZA 1VTNC 4HLYA 3V7SA 4LJZF 3J81Z 2DLLA 4N9IA 4XSZF 2ZFWA 3M8EA 1UHWA 4O6JA 1HSTA 2LF7A 4HYEA 4A0ZA 1HKTA 3RIRA 4U0YA 2D1HA 1E2XA 4M74A 4FX0A 4UVAA 2MC3A 4JBAA 2HTSA 1ZLJA 2QENA 1O57A 3EQLF 4ESBA 1R36A 1Q1HA 1JXSA 1QO0D 4LB6B 4GYGA 4EM0B 1B59A 2DK8A 5E17F 3WGGA 2HFHA 4FT8A 3TO9A 4G7OF 1IRFA 4PGHA 4BAYA 3NQOA 4AIHA 1S7AA 4CZZA 5DD4A 5BS6A 1F4KA 4ASNA 5FGMA 1ZRDA 3R0AA 4MQVA 3ZMSA 2DBBA 2FA5A 2RV8A 4FX4A 3K0LA 3KP2A 3BDDA 1ZGAA 4RB2C 4RAYA 3BZ6A 3QU6A 3N97A 4MNUA 3LQRA 2LKPA 1IN6A 5E1XA 3BPXA 1YFHA 3TOBA 4E70A 3SFZA 4UNOA 4P55A 3H92A 3MAJA 3IWZA 4B09A 3WGIA 1L0OC 1U3EM 3WG9A 3MFKA 2HTJA 4ZZLA 1KU7A 3HOTA 3F8MA 4HF1A 2UXXA 1FWZA 5J8CA 1PP8F 2VXZA 3CJNA 2V1XA 2O0YA 1BIAA 2K86A 5FD6A 2FMYA 4G94A 3HTUA 1BC8C 3HYIA 3WODF 2H6BA 2J5PA 2CGPA 4HW0A 4NB5A 1WKMA 3ZPLA 3CUOA 1J75A 4ZYEA 2ZMEA 1SFXA 5D5WB 1LDJA 1B9MA 1XDSA 1Z9CA 1V4RA 1IF1A 3BJAA 1OYYA 3KP3A 4ENMA 3DP7A 5IT3A 1KU2A 2XAQA 5J6XA 4YG2F 2DQLA 3ZMZA 4A12A 4YFKF 1OYIA 1FYMA 1W7PA 2DT5A 3FM3A 2KIFA 1AWCA 4ZYDA 4OMYA 1O7FA 2F5DA 3F8FA 3GZ5A 1TBXA 2ISZA 2G7UA 2DPDA 2P6TA 4BNCA 1T2KA 4OINF 2QBYB 2TDXA 1ZG5A 2FNPA 2ESNA 4RS8A 1K78A 1IZ1A 3WTSC 3CTAA 4BXUA 3HSFA 1IW7F 3P9IA 1SD7A 5LGNA 2IW5A 3E5QA 2XASA 3FHZA 1D8KA 4IRIA 3KETA 1HSJA 1G3YA 1TNTA 3GW2A 2GAUA 2X0LA 4EMSA 1W7PD 2ZXJA 3L2CA 1T0FA 1B6AA 1IUYA 3CUQA 1B9NA 3H3ZA 3VB2A 5CVVA 4MHGA 5DCMB 1SAXA 5FFXA 1ON1A 1H9GA 4NHJA 2EFWA 1IRGA 3ZMUA 2KKOA 4AIJA 5HLHA 2PFBA 1USSA 2UZKA 3F72A 3REOA 1Z1DA 3CO6C 3K1PA 4HLXA 3ZMTA 2MH9A 2ETHA 3GFIA 1FBSA 4KUMA 2W25A 4F7ZA 4Y17A 1ZHFA 4EJTA 2P7CB 2VODA 2DU9A 1O3SA 4EQQA 1RI7A 4P96A 3LAJA 5H20A 2P4WA 1BI0A 1IXRC 2QQ9A 2F5EA 1FX7A 2VOPA 3F21A 3V8JA 3M7GA 4RAZA 3BP8A 4MTDA 3DV8A 3OV8A 2FE3A 2A69F 2FU4A 5DUIA 2HWVA 4DNCA 4KMFA 4XRFA 5BPIA 4LLNA 4G6QA 5ICFA 2RGVA 4A5NA 3ISPA 4A5MA 3JSOA 5HS7A 3E3VA 1FP1D 2IRFG 2ACJA 3NRVA 4ENJA 1XCVA 3SHFA 3RTRA 3SXYA 2Z9OA 3F8NA 3K1NA 2L01A 3M1EA 4WCGA 2P8TA 1WQ2A 2GIVA 5CYVA 5K5QA 3U1DA 1U6GA 3EDPA 5DUKA 2UXNA 1OYWA 2QM3A 5D8LB 5DV5A 3B02A 3TQNA 5D5UB 1LDKB 1IN5A 2BEOA 4I7HA 2MH2A 3IHUA 1P4WA 4LK1F 3V8LA 3CUQC 1MJ9A 2L54A 2GXBA 2KRFA 1AOYA 2HYFA 4LLLA 5BMZA 1U5TB 3I4PA 2OD5A 2MLKA 4I02A 3MQ0A 1KYZA 1IN7A 1HKSA 2W85A 4YIFA 3WE2A 1GXPA 4AD9A 2KJCA 2IA0A 5JHUA 1HW2A 1BC7C 4JK1X 4ON0A 1XGOA 3C18A 3IL2A 3ECOA 3HRUA 2EA4A 4WF2A 5AIQA 1KQ8A 3GO5A 1D5VA 5HLIA 5EEHA 4KDPA 3RKWA 4L9JA 3DKWA 3U2RA 2AS5F 1RIOH 5IT9K 4IVNA 1SD6A 5FD5A 3P9CA 3QPTA 1ZH5A 1HQCA 2XAFA 5LRSA 4S05A 1ULYA 4G6DA 2RKHA 4P9FA 1DPRA 3DPLC 3L7WA 1EH6A 1G3TA 2VOOA 3K9TA 2DI3A 4RB0A 4L5JA 5LHGA 2ZBKA 2IPQX 2L3DA 4WXDA 3M9AA 3OOPA 4O5VA 5H6RA 1D3YA 1ZG1A 3MZYA 2H6CA 1FZPB 5ED4A 2ZKZA 2HDCA 1QZYA 1P2FA 2Z3YA 4KA4A 3P9KA 1XGMA 2XHKA 2EV6A 2WV0A 1JGSA 1W5SA 2HQNA 1XSDA 2WWYA 3F22A 1LVAA 4U0WA 1K78B 3VEPA 4OIOF 4L0YB 2P5LC 5E1WA 4CGZA 2CYYA 3N4MA 2BV6A 4Q47A 2HOEA 2OZ6A 3PQJA 3ZMDA 1YYVA 2JT1A 2XAHA 2QQBA 3MZHA 3QPHA 4IJAA 3Q5FA 3WTVC 1DDNA 4Q4ZF 2V9VA 1REPC 1KA8A 2Q0OA 2HYGD 2CWEA 2STTA 3E6MA 3R0JA 1ON2A 2CW0F 5DD8A 2PN6A 1YW7A 2HKOA 1BBYA 4AWXB 5LGTA 1OR7A 2BE5F 4R79A 1R23A 3GF2A 3LQQA 5LHIA 2DFIA 3L9FA 5CVRA 3KZYA 3WU0A 4EGYA 1OPCA 3GFJA 4HDUA 4HZFA 2V1UA 5JI6A 3FMSA 2FQ3A 1MZBA 5K1YA 3E5UA 5L3DA 1SMYF 2EA2A 1QGPA 4KT5C 1S29A 3FZVA 3I54A 2L4MA 4R1HA 1XGNA 3HHGA 2CG4A 1BIBA 1FP2A 1FNNA 1KQ9A 2EFPA 2ESHA 3JAMK 2XKPA 1MDMA 1TW2A 2EFQA 3WTXC 3IWFA 3R61A 1MD0A 2PQ8A 4MEXF 1WWXA 3NEUA 2QLZA 4RGSA 4H0EA 3IKVA 1KGSA 2H09A 2GWRA 3RYRA 5DCFA 2FOKA 3GYHX 2STWA 3GLXA 4U0VA 2VN2A 3E5XA 4HQEA 1W4MA 1R00A 2CO5A 6PAXA 1FYLA 2E7WA 4ZH4F 1MJAA 5D5XB 3BROA 4EJOA 1KQ0A 1T6SA 1BI3A 4Y13A 1ZRFA 4LMYA 2YU3A 2WTEA 5D5VB 4Q5SF 4NQWA 3I53A 4OIQF 3I0TA 4A2UA 1ZREA 1B1BA 5D4SA 1J59A 4I2OA 5FLXZ 4M71A 1YW9A 1I5ZA 1UHMA 1BI2A 5A2QK 2DW4A 1RZ4A 4OOIA 5E1ZB 5ERIA 4HQMA 5E20A 3RJPA 5IT9Z 3F8CA 2ZNYA 4HX7A 2EB7A 1J0RA 1S3JA 1Z7UA 1OMIA 2FBHA 3R4KA 3T1BA 5TRDA 3I59A 4WXHA 4MGRA 4RGXA 1J9IA 5J8FA 5EEGA 5CJ9A 3L00A 1K79A 2P7VB 4ZZDA 2GA1A 2CQKA 3G3ZA 2UWMA 2M1BA 2FMLA 3RDIA 5E8GA 3KLOA 5K5RA 2FSWA 2M87A 4HA8A 4OMZA 3TO7A 5ICCA 2EFOA 2QQAA 1PP7U 4U88A 3JTGA 2EV0A 3BWGA 2QZ8A 4LFUA 3F6OA 1ZAOA 4LG0A 3T8TA 1YS7A 2DTRA 1L3LA 4FHTA 1XCBA 5BQTA 2PMHA 2LNBA 1B4AA 1I6XA 4UUVA 1G3SA 1EH7A 1CGPA 2HEOA 5TJJA 2EK5A 5E18F 3F6VA 1I27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBF A;  1ZYR F;  2JPB A;  1R7J A;  2D1V A;  3QOP A;  1J5Y A;  4L0Z B;  4AVP A;  2OQG A;  3BOQ A;  3QRF F;  1W5T A;  3K69 A;  3DF8 A;  3GZ6 A;  1LEB A;  2FNA A;  1XMK A;  2XAG A;  3J7A O;  2LF8 A;  4HV5 A;  1QNT A;  2M5W A;  3E6B A;  1T98 A;  3EUH A;  2VE8 A;  1FBU A;  1UST A;  4CXF A;  4EM2 A;  4UVC A;  3LFK A;  4HX4 A;  5LRR A;  4M72 A;  4QLC U;  4IXA A;  4XSX F;  3O3K A;  1SD5 A;  1D8J A;  1BJA A;  1A04 A;  1GHC A;  3P7N A;  1TQM A;  4LLG F;  1LNW A;  4HV6 A;  2HZT A;  2IP2 A;  4BHC A;  2F5F A;  1FC3 A;  3JAM Z;  1IAW A;  4LGW A;  4CDG A;  4I09 A;  2H94 A;  4OIR F;  1XSX A;  2DPU A;  3T0Y A;  3D5L A;  5F64 A;  4A6D A;  3J80 K;  3AAF A;  4L18 B;  1UB9 A;  3FM5 A;  5D8K B;  3BJ6 A;  3EET A;  5HDK A;  5L3B A;  2XRN A;  1ZRC A;  2DQR A;  1R5H A;  1TQI A;  2RVC A;  3HUG A;  3WGH A;  4EV0 A;  3WTZ A;  3VOD A;  1LEA A;  4K2E A;  1QBJ A;  4L5I A;  5F1R A;  1YO5 C;  1IN8 A;  2P5K A;  1Y0U A;  1XDU A;  2Y75 A;  5FB2 A;  1O3Q A;  1SMT A;  1TLH B;  3ZN1 A;  4CO8 A;  2FRH A;  3KZZ A;  3WTY C;  1FY7 A;  2OQR A;  3KP5 A;  3R6S A;  3WTU C;  2M8E A;  5LHH A;  4P5O A;  3BY6 A;  4KMU X;  2FBI A;  1OKR A;  2PEX A;  3KCC A;  2PG4 A;  3U9G A;  2P5V A;  1F1Z A;  4IHT A;  2P6S A;  5ILV A;  5FLX K;  5JFR A;  5DDG A;  2OBP A;  2R7F A;  1ZG3 A;  4ZYG A;  1K7A A;  2ISY A;  5HOO A;  3M8F A;  4HOB A;  4M73 A;  3ZN0 A;  2O8X A;  2ZME B;  1ZLK A;  1O7L A;  4IRG A;  4YFX F;  1TNS A;  4KFC A;  4G9Y A;  3KEO A;  4OU0 A;  2Q2E A;  5A2Q Z;  2LSO A;  5CVJ A;  1YS6 A;  1FYK A;  3ERE D;  3TGN A;  2QBY A;  5K5O A;  2BGC A;  5HLG A;  2VT3 A;  3SZP A;  2KIM A;  2H27 A;  3WTT C;  2XAJ A;  5BOX A;  2PI0 A;  3FXR A;  2R7D A;  2VON A;  3HRM A;  1T39 A;  1LB2 A;  3QU3 A;  2Z5U A;  2QWW A;  4N9H A;  3BJO A;  2IA1 A;  1W7P B;  1DP7 P;  2A3S A;  1GVJ A;  4GYI A;  2MLG A;  3ZP5 A;  3KE2 A;  4IHS A;  3JTH A;  2DAO A;  2X4H A;  1BI1 A;  4UVB A;  1MKM A;  4M6X A;  1YIO A;  5DCM A;  2HQR A;  3D0S A;  2L4A A;  3FX3 A;  4BHP A;  5L3F A;  3WU1 B;  3F8B A;  3GFM A;  5HS8 A;  3H3U A;  2F5C A;  3CLO A;  2CSO A;  3HRT A;  2NYX A;  2E1N A;  1S6L A;  3I64 A;  2HS5 A;  3S2W A;  5DEQ A;  1ZGJ A;  2XUB A;  4KNY A;  5L3G A;  3EYI A;  4BHB A;  4YII A;  3RKX A;  3KLN A;  4EJU A;  2VE9 A;  5LLQ A;  3CUQ B;  2E7X A;  3G73 A;  1C0W A;  3ABT A;  1R1T A;  2GA2 A;  3TKY A;  1ODD A;  2COM A;  4I0A A;  2A68 F;  5HS9 A;  3GFL A;  2QUF A;  1RUN A;  3W6K B;  3FMR A;  5LGU A;  4UXN A;  2VBW A;  2YPR A;  4EM1 A;  4LG0 B;  3KP7 A;  4PZJ A;  5KVR A;  3VOE A;  3IKT A;  2GQQ A;  2IA2 A;  3I58 A;  2W84 A;  1K6O A;  3PQK A;  3GEZ A;  2IT0 A;  3HIF A;  2JTV A;  3R60 A;  4G7H F;  4GO1 A;  4S04 A;  2RNJ A;  2CFX A;  2RC4 A;  4LB5 A;  2Y0M A;  1ZN2 A;  2OAZ A;  4PGG A;  2YX4 A;  1Z91 A;  1T38 A;  3COA C;  2W24 A;  5ILU A;  4YFN F;  1S8N A;  4QWQ A;  1MGT A;  1PUE E;  2ELH A;  1IXS B;  1ZAR A;  4I01 A;  2O61 A;  2DK5 A;  3GUD A;  1SD4 A;  2MA3 A;  4TV7 A;  2EJR A;  3V4G A;  2O3F A;  2XV4 S;  4M6Y A;  4Y15 A;  2FXA A;  3J80 Z;  4R8H A;  4Q48 A;  3CDH A;  5FFZ A;  1O3T A;  1IXC A;  2ZJ2 A;  4DQ2 A;  1FT9 A;  4KIC A;  1G3W A;  5HDG A;  3RKY A;  4IPA A;  2OA4 A;  4WXC A;  1STZ A;  2YR2 A;  2XIG A;  2G7H A;  4Z2Y A;  1XGS A;  1P4X A;  5F6F A;  1U5T A;  1EV7 A;  4A6E A;  3T5X A;  5AIP A;  3DQV C;  1XSV A;  2EV5 A;  1YLF A;  1R1V A;  3IRQ A;  2XGX A;  5D6E A;  2VC0 A;  1DUX C;  3SZT A;  4CYD A;  3QP5 A;  1F9N A;  2W57 A;  1SFU A;  5KK1 A;  5JVT A;  3WTW C;  1JHF A;  2V6C A;  3HRS A;  2V1D A;  5LBQ A;  3CO7 C;  2ZCW A;  3DPT A;  4RGR A;  4HAM A;  4EJW A;  3ROU A;  5HVQ C;  3B73 A;  1QQI A;  4AIK A;  4XLP F;  1CF7 A;  3GWZ A;  4PDK A;  4KIF A;  3IRR A;  1XN7 A;  2A61 A;  2BBY A;  1H9T A;  4XLN F;  3MEX A;  3O2P E;  1XB4 A;  1U78 A;  2NS0 A;  1HXD A;  1F5T A;  3E97 A;  3FF5 A;  3C3W A;  3V8K A;  2KJB A;  3GXO A;  3DEU A;  1YW8 A;  2RN7 A;  2EFN A;  3HSR A;  2G9W A;  1G4D A;  2K4J A;  2XKO A;  2GXG A;  3C1D A;  4M9X A;  1KYW A;  2LDU A;  2VC1 A;  2AXL A;  2NAZ A;  1HW1 A;  1YG2 A;  4MQ9 F;  3WE3 A;  3RPQ A;  4JQF A;  2DO7 A;  4KN7 X;  1V3F A;  1QZZ A;  2NNY A;  1LQ1 A;  4HX8 A;  1BOA A;  1YQA A;  2F2E A;  1JHH A;  2GZW A;  4UV9 A;  4OIP F;  3F23 A;  4P9U A;  4RB1 A;  3JSP A;  4KIB A;  5D6F A;  3O6B B;  5E8I A;  4CHU A;  2A07 F;  2WC2 A;  2QVO A;  4EVI A;  3LWF A;  4LD5 A;  3EYY A;  4M9S A;  1WSU A;  1QPM A;  2A6H F;  4HF0 A;  2ZNZ A;  2EWN A;  4L9N A;  4HBL A;  4BQA A;  4B8X A;  3C7J A;  2D2W A;  3KP6 A;  3LA7 A;  4PCQ A;  3RPU A;  5LEK A;  3MWM A;  2B0L A;  3TDU C;  2V79 A;  3J81 K;  4GCV A;  4I98 B;  1KU3 A;  2MD5 A;  3QP6 A;  1PDN C;  3ABU A;  1HKQ A;  1U5T C;  4KYW A;  4MEY F;  2C6Y A;  1ONV A;  2FBK A;  1FBQ A;  3VFZ A;  1G6N A;  1WI9 A;  5AON A;  2XVC A;  1P6R A;  5CLS A;  3W6J B;  4N0B A;  1FSE A;  2JSC A;  4A0X A;  4U7D A;  4ESJ A;  1S7O A;  2Q8K A;  1P92 A;  4BYY A;  4UHT A;  2VBY A;  2Z99 A;  2FF4 A;  4HF2 A;  2HGC A;  1BM9 A;  3K1M A;  2M30 A;  3ELK A;  2D45 A;  3Q9S A;  4KIG A;  5DYM A;  5D4R A;  1FLI A;  1Z05 A;  3HTS B;  2OZU A;  3JW4 A;  1LJ9 A;  1J2X A;  3Q9V A;  1EH8 A;  1SFE A;  1TTY A;  3ML6 A;  5HDN A;  3ZQ7 A;  3LA2 A;  4D0P A;  2K4B A;  1GXQ A;  1UFM A;  3FXQ A;  2HKX A;  3PFI A;  4ENK A;  2A6E F;  5H6Q A;  3LA3 A;  2BYV E;  4ENN A;  3RI4 A;  1XD7 A;  4A0Y A;  1HW5 A;  4KN4 X;  2PBI A;  3TDZ C;  3FXU A;  4U7B A;  1O3R A;  4G8X A;  2ZO4 A;  3HOS A;  2JRT A;  1DPU A;  3I5U A;  3MCZ A;  1MDM B;  1IN4 A;  1RUO A;  5CVI A;  3GX4 X;  2ADU A;  4CIC A;  3ECH A;  4O3M A;  1FSH A;  3DFG A;  2PMU A;  1FPQ A;  3E6D A;  1H0M A;  2RQP A;  3IC7 A;  2HR3 A;  2PJP A;  3TO6 A;  1X3U A;  3KP4 A;  3V7C A;  2JPC A;  4MTE A;  2FEZ A;  3BPV A;  3QAH A;  1NHA A;  4GXO A;  1I1G A;  1U8R A;  2PLY A;  2K7L A;  2YSR A;  1I1S A;  4GGG A;  4ZYH A;  4RGU A;  4UV8 A;  3LAP A;  1R58 A;  1RNL A;  3SQN A;  1WRJ A;  5ILS A;  1UCR A;  2JZY A;  2OU2 A;  3ZMV A;  1E17 A;  4G7Z F;  2K02 A;  4WWC A;  1Z6T A;  3F3X A;  2M45 A;  2NNN A;  3LST A;  2K27 A;  1HBX G;  1J7K A;  1YTY A;  2E1C A;  1R1U A;  2RDP A;  5CVU A;  1Z6R A;  5L3C A;  5ICE A;  3RYP A;  4RB3 C;  3KEQ A;  2L02 A;  2Y48 A;  4WX9 A;  4L9T A;  1CF7 B;  1TQP A;  4ESF A;  2VT2 A;  1JE8 A;  1FOK A;  5BPD A;  5LEJ A;  4IRH A;  1U2W A;  2IJL A;  1LDD A;  3TOA A;  1P4A A;  5FO5 A;  2IVM A;  1XMA A;  4WK8 F;  2XRO A;  2KIU A;  3FMQ A;  1R5G A;  2Z33 A;  3FWE A;  4EGZ A;  3ULQ B;  4LK0 F;  4M9Z A;  4HDV A;  4BH9 A;  3E6C C;  5ICG A;  1KU9 A;  2YX7 A;  2O6G E;  2O03 A;  3T8R A;  4ETS A;  3I59 B;  3L09 A;  3V7R A;  2QYO A;  3HHH A;  4EJV A;  4I0B A;  1R22 A;  4L9V A;  2A5Y B;  2VBX A;  5L3E A;  2MBF A;  1TW3 A;  3GVA A;  4IF4 A;  5JR3 A;  2J5O A;  3DXJ F;  2NRA C;  3KFW X;  1MJB A;  3I71 A;  2VBZ A;  3HSE A;  2R3S A;  1BN5 A;  3K2Z A;  1VTN C;  4HLY A;  3V7S A;  4LJZ F;  3J81 Z;  2DLL A;  4N9I A;  4XSZ F;  2ZFW A;  3M8E A;  1UHW A;  4O6J A;  1HST A;  2LF7 A;  4HYE A;  4A0Z A;  1HKT A;  3RIR A;  4U0Y A;  2D1H A;  1E2X A;  4M74 A;  4FX0 A;  4UVA A;  2MC3 A;  4JBA A;  2HTS A;  1ZLJ A;  2QEN A;  1O57 A;  3EQL F;  4ESB A;  1R36 A;  1Q1H A;  1JXS A;  1QO0 D;  4LB6 B;  4GYG A;  4EM0 B;  1B59 A;  2DK8 A;  5E17 F;  3WGG A;  2HFH A;  4FT8 A;  3TO9 A;  4G7O F;  1IRF A;  4PGH A;  4BAY A;  3NQO A;  4AIH A;  1S7A A;  4CZZ A;  5DD4 A;  5BS6 A;  1F4K A;  4ASN A;  5FGM A;  1ZRD A;  3R0A A;  4MQV A;  3ZMS A;  2DBB A;  2FA5 A;  2RV8 A;  4FX4 A;  3K0L A;  3KP2 A;  3BDD A;  1ZGA A;  4RB2 C;  4RAY A;  3BZ6 A;  3QU6 A;  3N97 A;  4MNU A;  3LQR A;  2LKP A;  1IN6 A;  5E1X A;  3BPX A;  1YFH A;  3TOB A;  4E70 A;  3SFZ A;  4UNO A;  4P55 A;  3H92 A;  3MAJ A;  3IWZ A;  4B09 A;  3WGI A;  1L0O C;  1U3E M;  3WG9 A;  3MFK A;  2HTJ A;  4ZZL A;  1KU7 A;  3HOT A;  3F8M A;  4HF1 A;  2UXX A;  1FWZ A;  5J8C A;  1PP8 F;  2VXZ A;  3CJN A;  2V1X A;  2O0Y A;  1BIA A;  2K86 A;  5FD6 A;  2FMY A;  4G94 A;  3HTU A;  1BC8 C;  3HYI A;  3WOD F;  2H6B A;  2J5P A;  2CGP A;  4HW0 A;  4NB5 A;  1WKM A;  3ZPL A;  3CUO A;  1J75 A;  4ZYE A;  2ZME A;  1SFX A;  5D5W B;  1LDJ A;  1B9M A;  1XDS A;  1Z9C A;  1V4R A;  1IF1 A;  3BJA A;  1OYY A;  3KP3 A;  4ENM A;  3DP7 A;  5IT3 A;  1KU2 A;  2XAQ A;  5J6X A;  4YG2 F;  2DQL A;  3ZMZ A;  4A12 A;  4YFK F;  1OYI A;  1FYM A;  1W7P A;  2DT5 A;  3FM3 A;  2KIF A;  1AWC A;  4ZYD A;  4OMY A;  1O7F A;  2F5D A;  3F8F A;  3GZ5 A;  1TBX A;  2ISZ A;  2G7U A;  2DPD A;  2P6T A;  4BNC A;  1T2K A;  4OIN F;  2QBY B;  2TDX A;  1ZG5 A;  2FNP A;  2ESN A;  4RS8 A;  1K78 A;  1IZ1 A;  3WTS C;  3CTA A;  4BXU A;  3HSF A;  1IW7 F;  3P9I A;  1SD7 A;  5LGN A;  2IW5 A;  3E5Q A;  2XAS A;  3FHZ A;  1D8K A;  4IRI A;  3KET A;  1HSJ A;  1G3Y A;  1TNT A;  3GW2 A;  2GAU A;  2X0L A;  4EMS A;  1W7P D;  2ZXJ A;  3L2C A;  1T0F A;  1B6A A;  1IUY A;  3CUQ A;  1B9N A;  3H3Z A;  3VB2 A;  5CVV A;  4MHG A;  5DCM B;  1SAX A;  5FFX A;  1ON1 A;  1H9G A;  4NHJ A;  2EFW A;  1IRG A;  3ZMU A;  2KKO A;  4AIJ A;  5HLH A;  2PFB A;  1USS A;  2UZK A;  3F72 A;  3REO A;  1Z1D A;  3CO6 C;  3K1P A;  4HLX A;  3ZMT A;  2MH9 A;  2ETH A;  3GFI A;  1FBS A;  4KUM A;  2W25 A;  4F7Z A;  4Y17 A;  1ZHF A;  4EJT A;  2P7C B;  2VOD A;  2DU9 A;  1O3S A;  4EQQ A;  1RI7 A;  4P96 A;  3LAJ A;  5H20 A;  2P4W A;  1BI0 A;  1IXR C;  2QQ9 A;  2F5E A;  1FX7 A;  2VOP A;  3F21 A;  3V8J A;  3M7G A;  4RAZ A;  3BP8 A;  4MTD A;  3DV8 A;  3OV8 A;  2FE3 A;  2A69 F;  2FU4 A;  5DUI A;  2HWV A;  4DNC A;  4KMF A;  4XRF A;  5BPI A;  4LLN A;  4G6Q A;  5ICF A;  2RGV A;  4A5N A;  3ISP A;  4A5M A;  3JSO A;  5HS7 A;  3E3V A;  1FP1 D;  2IRF G;  2ACJ A;  3NRV A;  4ENJ A;  1XCV A;  3SHF A;  3RTR A;  3SXY A;  2Z9O A;  3F8N A;  3K1N A;  2L01 A;  3M1E A;  4WCG A;  2P8T A;  1WQ2 A;  2GIV A;  5CYV A;  5K5Q A;  3U1D A;  1U6G A;  3EDP A;  5DUK A;  2UXN A;  1OYW A;  2QM3 A;  5D8L B;  5DV5 A;  3B02 A;  3TQN A;  5D5U B;  1LDK B;  1IN5 A;  2BEO A;  4I7H A;  2MH2 A;  3IHU A;  1P4W A;  4LK1 F;  3V8L A;  3CUQ C;  1MJ9 A;  2L54 A;  2GXB A;  2KRF A;  1AOY A;  2HYF A;  4LLL A;  5BMZ A;  1U5T B;  3I4P A;  2OD5 A;  2MLK A;  4I02 A;  3MQ0 A;  1KYZ A;  1IN7 A;  1HKS A;  2W85 A;  4YIF A;  3WE2 A;  1GXP A;  4AD9 A;  2KJC A;  2IA0 A;  5JHU A;  1HW2 A;  1BC7 C;  4JK1 X;  4ON0 A;  1XGO A;  3C18 A;  3IL2 A;  3ECO A;  3HRU A;  2EA4 A;  4WF2 A;  5AIQ A;  1KQ8 A;  3GO5 A;  1D5V A;  5HLI A;  5EEH A;  4KDP A;  3RKW A;  4L9J A;  3DKW A;  3U2R A;  2AS5 F;  1RIO H;  5IT9 K;  4IVN A;  1SD6 A;  5FD5 A;  3P9C A;  3QPT A;  1ZH5 A;  1HQC A;  2XAF A;  5LRS A;  4S05 A;  1ULY A;  4G6D A;  2RKH A;  4P9F A;  1DPR A;  3DPL C;  3L7W A;  1EH6 A;  1G3T A;  2VOO A;  3K9T A;  2DI3 A;  4RB0 A;  4L5J A;  5LHG A;  2ZBK A;  2IPQ X;  2L3D A;  4WXD A;  3M9A A;  3OOP A;  4O5V A;  5H6R A;  1D3Y A;  1ZG1 A;  3MZY A;  2H6C A;  1FZP B;  5ED4 A;  2ZKZ A;  2HDC A;  1QZY A;  1P2F A;  2Z3Y A;  4KA4 A;  3P9K A;  1XGM A;  2XHK A;  2EV6 A;  2WV0 A;  1JGS A;  1W5S A;  2HQN A;  1XSD A;  2WWY A;  3F22 A;  1LVA A;  4U0W A;  1K78 B;  3VEP A;  4OIO F;  4L0Y B;  2P5L C;  5E1W A;  4CGZ A;  2CYY A;  3N4M A;  2BV6 A;  4Q47 A;  2HOE A;  2OZ6 A;  3PQJ A;  3ZMD A;  1YYV A;  2JT1 A;  2XAH A;  2QQB A;  3MZH A;  3QPH A;  4IJA A;  3Q5F A;  3WTV C;  1DDN A;  4Q4Z F;  2V9V A;  1REP C;  1KA8 A;  2Q0O A;  2HYG D;  2CWE A;  2STT A;  3E6M A;  3R0J A;  1ON2 A;  2CW0 F;  5DD8 A;  2PN6 A;  1YW7 A;  2HKO A;  1BBY A;  4AWX B;  5LGT A;  1OR7 A;  2BE5 F;  4R79 A;  1R23 A;  3GF2 A;  3LQQ A;  5LHI A;  2DFI A;  3L9F A;  5CVR A;  3KZY A;  3WU0 A;  4EGY A;  1OPC A;  3GFJ A;  4HDU A;  4HZF A;  2V1U A;  5JI6 A;  3FMS A;  2FQ3 A;  1MZB A;  5K1Y A;  3E5U A;  5L3D A;  1SMY F;  2EA2 A;  1QGP A;  4KT5 C;  1S29 A;  3FZV A;  3I54 A;  2L4M A;  4R1H A;  1XGN A;  3HHG A;  2CG4 A;  1BIB A;  1FP2 A;  1FNN A;  1KQ9 A;  2EFP A;  2ESH A;  3JAM K;  2XKP A;  1MDM A;  1TW2 A;  2EFQ A;  3WTX C;  3IWF A;  3R61 A;  1MD0 A;  2PQ8 A;  4MEX F;  1WWX A;  3NEU A;  2QLZ A;  4RGS A;  4H0E A;  3IKV A;  1KGS A;  2H09 A;  2GWR A;  3RYR A;  5DCF A;  2FOK A;  3GYH X;  2STW A;  3GLX A;  4U0V A;  2VN2 A;  3E5X A;  4HQE A;  1W4M A;  1R00 A;  2CO5 A;  6PAX A;  1FYL A;  2E7W A;  4ZH4 F;  1MJA A;  5D5X B;  3BRO A;  4EJO A;  1KQ0 A;  1T6S A;  1BI3 A;  4Y13 A;  1ZRF A;  4LMY A;  2YU3 A;  2WTE A;  5D5V B;  4Q5S F;  4NQW A;  3I53 A;  4OIQ F;  3I0T A;  4A2U A;  1ZRE A;  1B1B A;  5D4S A;  1J59 A;  4I2O A;  5FLX Z;  4M71 A;  1YW9 A;  1I5Z A;  1UHM A;  1BI2 A;  5A2Q K;  2DW4 A;  1RZ4 A;  4OOI A;  5E1Z B;  5ERI A;  4HQM A;  5E20 A;  3RJP A;  5IT9 Z;  3F8C A;  2ZNY A;  4HX7 A;  2EB7 A;  1J0R A;  1S3J A;  1Z7U A;  1OMI A;  2FBH A;  3R4K A;  3T1B A;  5TRD A;  3I59 A;  4WXH A;  4MGR A;  4RGX A;  1J9I A;  5J8F A;  5EEG A;  5CJ9 A;  3L00 A;  1K79 A;  2P7V B;  4ZZD A;  2GA1 A;  2CQK A;  3G3Z A;  2UWM A;  2M1B A;  2FML A;  3RDI A;  5E8G A;  3KLO A;  5K5R A;  2FSW A;  2M87 A;  4HA8 A;  4OMZ A;  3TO7 A;  5ICC A;  2EFO A;  2QQA A;  1PP7 U;  4U88 A;  3JTG A;  2EV0 A;  3BWG A;  2QZ8 A;  4LFU A;  3F6O A;  1ZAO A;  4LG0 A;  3T8T A;  1YS7 A;  2DTR A;  1L3L A;  4FHT A;  1XCB A;  5BQT A;  2PMH A;  2LNB A;  1B4A A;  1I6X A;  4UUV A;  1G3S A;  1EH7 A;  1CGP A;  2HEO A;  5TJJ A;  2EK5 A;  5E18 F;  3F6V A;  1I27 A; 
#chains in the Genus database with same CATH topology
 4XBF A;  1ZYR F;  2JPB A;  3A01 B;  1R7J A;  2D1V A;  3IP4 B;  4HNU A;  3E0J B;  3QOP A;  1J5Y A;  4L0Z B;  3GTQ J;  4AVP A;  3OYA A;  2OQG A;  5J4V A;  3BOQ A;  2QA4 I;  3QRF F;  3OYH A;  1W5T A;  3K69 A;  1Z67 A;  3DF8 A;  5EEA A;  2DJI A;  4BBR J;  3DU5 A;  1BL0 A;  4XRS A;  3GZ6 A;  1PVE A;  1LEB A;  2FNA A;  3DKY A;  3LSP A;  1XMK A;  2CUJ A;  2XAG A;  3J7A O;  1TT5 B;  2LF8 A;  4HV5 A;  2CW7 A;  1QNT A;  2M5W A;  1B8I B;  2LH9 A;  1NG6 A;  1T98 A;  1U9O A;  2XGC A;  3E6B A;  2VE8 A;  3EUH A;  2CH0 A;  1NK2 P;  3RKQ A;  3HOW J;  1FBU A;  5M3M J;  1MBK A;  1UST A;  4JYK A;  4CXF A;  4EM2 A;  3RPU D;  4UVC A;  3LFK A;  4HX4 A;  5LRR A;  3CP8 A;  3B6A A;  4M72 A;  4QLC U;  4IXA A;  4XSX F;  5IYC J;  2K9L A;  3O3K A;  1SD5 A;  4BXF A;  4C9Y A;  3HOV J;  2R0Q C;  1D8J A;  1BJA A;  4XLC A;  1A04 A;  2ZXI A;  4BY1 J;  4G6T B;  1GHC A;  4HNV A;  1T56 A;  3P7N A;  1TQM A;  2QKM B;  1LNW A;  4LLG F;  2M4G A;  3HPG A;  4HV6 A;  3GLL A;  2HZT A;  2MAB A;  1U8B A;  4FIS A;  1JKQ C;  2VJ5 A;  3CCQ I;  2LR8 A;  3AG3 H;  2IP2 A;  4BHC A;  2F5F A;  2EH3 A;  1FC3 A;  3JAM Z;  4BXX J;  5J47 A;  1O4X A;  3DU6 A;  1IAW A;  4LGW A;  1R49 A;  3M07 A;  4CDG A;  4IZZ A;  1LUJ B;  2EZL A;  4I09 A;  2H94 A;  4OIR F;  1XSX A;  3HKZ A;  2DPU A;  5JHF A;  3T0Y A;  3D5L A;  5F64 A;  4A6D A;  1GUU A;  2XSD C;  4J01 A;  3J80 K;  3AAF A;  2VAS A;  3ZQL A;  4L18 B;  3PSI A;  1W0T A;  1UB9 A;  3FM5 A;  3S93 A;  5D8K B;  3BJ6 A;  3EET A;  5HDK A;  2HDD A;  4XLA A;  5L3B A;  3K6G A;  2LBF A;  4XR6 A;  2XRN A;  5GAD J;  1ZRC A;  2DQR A;  1R5H A;  1TQI A;  2RVC A;  3HUG A;  3DEW A;  3WGH A;  3BQZ A;  4EV0 A;  3WTZ A;  3VOD A;  1LEA A;  2DT6 A;  3AG1 H;  1AHD P;  1YE9 A;  4K2E A;  1QBJ A;  2R92 J;  2QCO A;  3QOE A;  5KAI C;  1JKO C;  4L5I A;  5F1R A;  2QQ8 A;  4A69 C;  2OC6 A;  1YO5 C;  2E2I J;  1IN8 A;  2DOF A;  4N4N B;  2P5K A;  1EF4 A;  1Y0U A;  3NWS A;  1XDU A;  2Y75 A;  2LP0 A;  5FB2 A;  1X3Z B;  4D9J A;  3N05 A;  1O3Q A;  1SMT A;  1TLH B;  3ZN1 A;  5B1A H;  4CO8 A;  2FRH A;  3KZZ A;  3ZOB A;  3WTY C;  1FY7 A;  1MW7 A;  1GDT A;  2OQR A;  1TWF J;  3KP5 A;  3R6S A;  5BNG A;  4PSX A;  2M8E A;  3WTU C;  5LHH A;  4P5O A;  3Q0U A;  1DGR M;  3X2Q H;  2GIZ A;  5F1J A;  3LOC A;  3BY6 A;  1ZQ3 P;  4KMU X;  2FBI A;  1OKR A;  2PEX A;  3KCC A;  1MSF C;  4PFO A;  2PG4 A;  3U9G A;  1JTX A;  3BZC A;  3FK7 A;  2P5V A;  4BBS J;  3GME A;  1F1Z A;  1Y39 A;  4IHT A;  2P6S A;  5ILV A;  2EIL H;  1IUF A;  1TWC J;  2HXO A;  5FLX K;  5JFR A;  5DDG A;  1Z77 A;  2DMQ A;  3S15 J;  3BR2 A;  2OBP A;  2R7F A;  3W6V A;  1ZG3 A;  4ZYG A;  1K7A A;  4XOT A;  2ISY A;  1WJC A;  5HOO A;  3M8F A;  4HOB A;  4M73 A;  3ZN0 A;  5FRN A;  4A3K J;  2O8X A;  2ZME B;  1ZLK A;  1O7L A;  1OCO H;  4IRG A;  4YFX F;  5EGO B;  1TNS A;  4KFC A;  4G9Y A;  5TIS C;  3KEO A;  4A3F J;  4OU0 A;  2Q2E A;  3A0H C;  4XL9 A;  5A2Q Z;  4M3F A;  2LSO A;  4E4H A;  1AKH A;  5CVJ A;  4NQW B;  1YS6 A;  1FYK A;  3MD2 A;  3CMA I;  3ERE D;  3JR9 A;  3TGN A;  3AKZ A;  2QBY A;  2R7S A;  5K5O A;  1WH7 A;  2BGC A;  2CV0 A;  1OJL A;  5HLG A;  2CS3 A;  2VT3 A;  3SZP A;  2KIM A;  2R5Z A;  2H27 A;  1UEL B;  4B47 A;  3AG2 H;  2N8G A;  3WTT C;  3PIP F;  1WJA A;  2XAJ A;  5BOX A;  2PI0 A;  3FXR A;  4JX6 A;  4A3C J;  2R7D A;  3CQZ J;  2LTP A;  3PUB A;  3HRM A;  1H89 C;  2VON A;  2WY7 Q;  2ELK A;  1POG A;  5F04 A;  3W3C A;  3QU3 A;  1T39 A;  1LB2 A;  3CZ6 A;  2Z5U A;  1D1C A;  2QWW A;  1YRN A;  3OS2 A;  3ONQ A;  4ZDP A;  4N9H A;  2V6E A;  1RKW A;  2DOD A;  2M3A A;  2IA1 A;  3BJO A;  4JOM A;  1TL8 A;  1W7P B;  1DP7 P;  2A3S A;  1GVJ A;  2OUM A;  2KRC A;  3EUH C;  1MBJ A;  4GYI A;  2MLG A;  1Z21 A;  3ZP5 A;  3KE2 A;  4IHS A;  3JTH A;  2DAO A;  2X4H A;  1BI1 A;  4B1R A;  2W4S A;  4UVB A;  1MKM A;  4XN0 A;  1IO2 A;  2D5V A;  4M6X A;  3ABL H;  1YIO A;  3PIO F;  5DCM A;  2W1O A;  2HQR A;  3D0S A;  5DM7 F;  4IOA F;  2EQR A;  2L4A A;  3FX3 A;  4W1U A;  4BHP A;  5L3F A;  4LG3 A;  1TP4 A;  2OCC H;  3WU1 B;  2KDZ A;  3F8B A;  4LIU A;  5E3N A;  3GFM A;  4IL6 C;  5HS8 A;  3QWL A;  3H3U A;  2F5C A;  1ORK A;  2ZFU A;  3CLO A;  2VPR A;  1VQN I;  5B3S H;  2CSO A;  3ZQC A;  2CQQ A;  3HRT A;  3S2H J;  2NYX A;  2JA7 J;  4CCJ A;  2E1N A;  1S6L A;  3OOU A;  1IDZ A;  4RMN A;  1ITY A;  2V9K A;  3I64 A;  2HS5 A;  1HA8 A;  2LY9 A;  3S2W A;  5C3E J;  3FK6 A;  3PM1 A;  2WB1 A;  5DEQ A;  2BZT A;  3A2K A;  1ZGJ A;  1VQL I;  3H5R A;  2XUB A;  4BUP A;  3SJM A;  1WH5 A;  2EIK H;  4KNY A;  5L3G A;  3EYI A;  4BHB A;  4YII A;  1APL C;  3RKX A;  5IY5 H;  3KLN A;  3CCM I;  4EJU A;  2VE9 A;  2BY3 A;  3CD6 I;  5LLQ A;  1Y1V J;  4X0G A;  4X1E A;  4W97 A;  4AU7 A;  3OYI A;  3CUQ B;  3D5S C;  1BOB A;  2E7X A;  3KYD B;  3G73 A;  1C0W A;  3ABT A;  1R1T A;  1W5C C;  3DBL B;  2GA2 A;  3TKY A;  2V9P A;  1ODD A;  2COM A;  4LIV A;  4I0A A;  4NUB A;  2A68 F;  5HS9 A;  3GFL A;  2QUF A;  3K7A J;  2Y9Z A;  1LKX A;  1RUN A;  2OTJ I;  4RAG A;  3W6K B;  3FMR A;  1X2M A;  1K4S A;  5LGU A;  4UXN A;  1I3Q J;  4BDZ A;  1F36 A;  1N25 A;  9ANT A;  1SFO J;  2VBW A;  2YPR A;  4EM1 A;  2MGQ A;  5J1R A;  2B9S A;  4LG0 B;  2MFZ A;  3IAM 2;  1W1W E;  3KP7 A;  4PZJ A;  2XC7 A;  5KVR A;  1HOM A;  3PSF A;  3VOE A;  3IKT A;  1K4T A;  3H0G J;  1RR7 A;  1QHG A;  2CU7 A;  2GQQ A;  2IA2 A;  3I58 A;  2W84 A;  5JLX A;  4A3J J;  3PQK A;  1K6O A;  3BTI A;  3GEZ A;  2IT0 A;  3HIF A;  2JTV A;  5E3O A;  3R60 A;  2YUS A;  3ZQF A;  1ZGW A;  3CDI A;  1R4M B;  4G7H F;  1IGN A;  4GO1 A;  1ERD A;  2VQC A;  4S04 A;  1XX5 A;  2CQX A;  2CFX A;  2RNJ A;  2HYJ A;  2RC4 A;  3CCR I;  4LB5 A;  2Y0M A;  1ZN2 A;  2IS2 A;  3BCA A;  2DMT A;  3CJR B;  3FXO A;  2OAZ A;  2K9S A;  2PMZ N;  4PGG A;  2WAF A;  1R4N B;  2YX4 A;  1A31 A;  2R93 J;  2R5Y A;  1Z91 A;  1JTY A;  2JRM A;  2HOT A;  1T38 A;  3COA C;  2W24 A;  5ILU A;  4YFN F;  1S8N A;  4QWQ A;  1MGT A;  3H9G A;  1VND A;  3JRE A;  1DU0 A;  3ZXS A;  1PUE E;  4BEH A;  4FCY A;  1T95 A;  5FKN A;  5TGT A;  3VDX A;  2ELH A;  4CCM A;  1IXS B;  1ZAR A;  4FET A;  1VQO I;  2WY8 Q;  4M3E A;  4I01 A;  2O61 A;  2DK5 A;  3DEE A;  3ZQH A;  1D0Y A;  3UKG A;  3FXM A;  2DA5 A;  3VYR B;  3GUD A;  4M6V A;  2ME6 A;  3CF5 F;  4C2M J;  3F9K A;  3K4N A;  4CYC B;  1IRX A;  3K70 C;  1EJ9 A;  2JWT A;  1SD4 A;  3OL4 A;  2KMU A;  2MA3 A;  4TV7 A;  3B6C A;  1FTZ A;  1XC5 A;  2EJR A;  1P7I A;  2O3F A;  3BTC A;  3V4G A;  3GTP J;  2XV4 S;  4M6Y A;  1DP3 A;  4Y15 A;  2FXA A;  1JGG A;  5JLW A;  3J80 Z;  4R8H A;  1UZC A;  3OYE A;  4Q48 A;  1RES A;  3RQ4 A;  2ECB A;  3RZO J;  3CDH A;  5FFZ A;  1O3T A;  1IXC A;  2ZJ2 A;  3OS1 A;  4DQ2 A;  4DYQ A;  4ZDL A;  1FT9 A;  4KIC A;  1G3W A;  5HDG A;  2E5N A;  4N4O B;  2XSJ C;  3RKY A;  4IPA A;  2OA4 A;  1X3W B;  1STZ A;  4WXC A;  2YR2 A;  2M7B A;  2XIG A;  2G7H A;  1WJ5 A;  2AO9 A;  4Z2Y A;  3I4M J;  2E71 A;  1XGS A;  1P4X A;  1VF9 A;  1X1P A;  1ETY A;  4DBR A;  5F6F A;  1U5T A;  1EV7 A;  4A6E A;  3T5X A;  5AIP A;  3DQV C;  1XSV A;  1RC9 A;  2R7R A;  4KIT B;  2EV5 A;  3OYB A;  1YLF A;  1R1V A;  3BG3 A;  3IRQ A;  3C2G A;  2E34 A;  2XGX A;  5D6E A;  4CCK A;  1SAN A;  2IAI A;  4PJM A;  2VC0 A;  1DUX C;  5CQE A;  2LBF B;  3SZT A;  2QSH X;  4CYD A;  3QP5 A;  1F9N A;  1V55 H;  2W57 A;  1SFU A;  5KK1 A;  5JVT A;  2V26 A;  3KX2 A;  1JHF A;  3WTW C;  2V6C A;  1UJ8 A;  2W82 A;  3HRS A;  4YRV A;  2L7K A;  2V1D A;  1QVU A;  5LBQ A;  3CO7 C;  3OWT A;  3Q0W A;  2ZCW A;  3RCO A;  2DA6 A;  5GP9 A;  1Z0X A;  4IO9 F;  3DPT A;  4RGR A;  2GBY A;  2QEX I;  4HAM A;  4EJW A;  3E7L A;  3ROU A;  5HVQ C;  2CV1 A;  4XKB A;  4GFB A;  3B73 A;  1QQI A;  3WHC A;  4AIK A;  1NK3 P;  3TED A;  2E1M B;  4XLP F;  4X6A J;  1EKE A;  1CF7 A;  3GWZ A;  4PDK A;  4KIF A;  5F0C A;  3IRR A;  3GTO J;  1XN7 A;  2A61 A;  2BBY A;  3K10 A;  1YIT I;  1FIP A;  1H9T A;  1S9H A;  4XLN F;  1IV6 A;  2BVL A;  3MEX A;  3W2V A;  2VQG A;  2DDB A;  3DBH B;  4XM3 A;  2W48 A;  4CUG A;  3G6E I;  5FRM A;  3O2P E;  2VLA A;  1XB4 A;  1RRJ A;  1U78 A;  2NS0 A;  2JA8 J;  1HXD A;  2K3F A;  3E97 A;  1F5T A;  2HPM A;  3FF5 A;  3OIO A;  3C3W A;  3V8K A;  1EA3 A;  2KJB A;  3GXO A;  3DEU A;  1YW8 A;  2L9N A;  2RN7 A;  1VQ7 I;  2EFN A;  4IHX A;  1FOY A;  3ZQI A;  3HSR A;  2G9W A;  4Z6Y A;  1G4D A;  2K4J A;  2XKO A;  5IOY A;  2GXG A;  3C1D A;  2R7W A;  4M9X A;  4E7J A;  1KYW A;  2LDU A;  2NVU B;  2VC1 A;  4ZDO A;  2AXL A;  3RQI A;  2DMP A;  2NAZ A;  3BCB A;  3M1C A;  1HW1 A;  1F43 A;  1YG2 A;  3IV5 A;  4MQ9 F;  3WE3 A;  4BY7 J;  3CP2 A;  3PJR A;  1HC8 A;  4QIW N;  3RPQ A;  5KAF C;  4JQF A;  1WJD A;  5EDN A;  1AU7 A;  3S3O A;  2DO7 A;  3L2U A;  5FKK A;  4KN7 X;  1V3F A;  2IGK A;  1QZZ A;  1J09 A;  2NNY A;  1LQ1 A;  5HNH A;  3EUA A;  2R5Z B;  5GTH C;  4HX8 A;  1BOA A;  4NC8 A;  1YQA A;  2F2E A;  1JHH A;  2B63 J;  2GZW A;  2Y0S A;  4UV9 A;  4OIP F;  3DTK A;  3F23 A;  4P9U A;  5EG0 A;  4RB1 A;  1BA5 A;  1U0J A;  2K5C A;  1PUF A;  4KIB A;  3JSP A;  5D6F A;  3O6B B;  3G4S I;  5E8I A;  4CHU A;  2XF7 A;  2A07 F;  3WU2 C;  2LRE A;  2WC2 A;  2QVO A;  4EVI A;  3LWF A;  4LD5 A;  3EYY A;  4M9S A;  2UUZ A;  1WSU A;  2KHM A;  3OYM A;  1QPM A;  3PO3 J;  2A6H F;  4HF0 A;  2XF6 A;  2ZNZ A;  1VQP I;  2EWN A;  2EPF A;  4L9N A;  2UV1 A;  4IHV A;  1N77 A;  4HBL A;  2XPU A;  3A03 A;  2WBM A;  4BKX A;  1E3H A;  4BQA A;  2HVR A;  2JUG A;  4B8X A;  3C7J A;  2D2W A;  4PK4 A;  2XGD A;  3KP6 A;  3LA7 A;  4PCQ A;  5DS9 A;  3RPU A;  5LEK A;  3MWM A;  2I10 A;  2B0L A;  5EJC A;  3TDU C;  2R4G A;  2V79 A;  4UY8 I;  3J81 K;  4GCV A;  1R6R A;  4I98 B;  1KU3 A;  2ZSI B;  3SEQ A;  2MD5 A;  3QP6 A;  1PDN C;  1WPK A;  3ABU A;  1HKQ A;  1U5T C;  2XGE A;  4KYW A;  4MEY F;  2C6Y A;  3CES A;  1ONV A;  1VQ8 I;  2HVS A;  4Y52 J;  2FBK A;  2HZD A;  2IS1 A;  4PJ0 C;  1YJ9 I;  1XS9 A;  1FBQ A;  2R7X A;  1YOV B;  2MYS A;  1SVM A;  3VFZ A;  1MH4 A;  1G6N A;  1WI9 A;  5AON A;  2XVC A;  1P6R A;  5CLS A;  4ZTJ A;  3CC7 I;  4A3M J;  1LFU P;  2MC4 A;  3W6J B;  2W00 A;  4N0B A;  2L9V A;  3F0C A;  3OL3 A;  1FSE A;  2ME0 A;  1XG1 A;  1E3P A;  2JSC A;  4RLF A;  3MVP A;  5FKL A;  4A0X A;  4U7D A;  4ESJ A;  5LD2 C;  1S7O A;  2DDA A;  2BW3 A;  2V7F A;  2G0E A;  2A6T A;  2NOG A;  2Q8K A;  1MBF A;  4NDL A;  2YS9 A;  1P92 A;  3BR1 A;  4BYY A;  4UHT A;  2VBY A;  3IH3 A;  2Z99 A;  2FF4 A;  3CJQ B;  3CCU I;  1IC8 A;  4HF2 A;  2VUM J;  2HGC A;  1BM9 A;  1WI3 A;  3K1M A;  4RLQ A;  3OYJ A;  2ICW G;  2M30 A;  3ELK A;  2D45 A;  2IEK A;  1H88 C;  3Q9S A;  5GAG J;  3OYN A;  1YJN I;  3GZN B;  4KIG A;  5IOZ A;  5DYM A;  1D0Z A;  5D4R A;  4DZJ A;  1FLI A;  1YI2 I;  1TWA J;  1Z05 A;  3HTS B;  2OZU A;  3JW4 A;  3LFU A;  1LJ9 A;  4QPO A;  4PFP A;  1J2X A;  3J7Z I;  2LMD A;  3OIQ A;  3Q9V A;  1EH8 A;  3LSK A;  1SFE A;  1TTY A;  3ML6 A;  4PUS A;  5HDN A;  1WZ2 A;  2EBI A;  3DCF A;  3ZQ7 A;  4II3 A;  2KRH A;  3LA2 A;  4D0P A;  1JUS A;  2CUE A;  2K4B A;  2HPI A;  4A3I J;  1NH3 A;  1D1A A;  3AL0 C;  1GXQ A;  1UFM A;  3FXQ A;  2HKX A;  3PFI A;  4ENK A;  2CFO A;  3DPU A;  2A6E F;  1GLN A;  1XPX A;  5H6Q A;  3LA3 A;  2BYV E;  4BEH B;  4ENN A;  3RI4 A;  1XD7 A;  4A0Y A;  1MBE A;  1HW5 A;  2BVM A;  4KN4 X;  2M4K A;  3HC7 A;  2PBI A;  3TDZ C;  3QOD A;  3FXU A;  4U7B A;  2L2O A;  1O3R A;  4G8X A;  3LSJ A;  4PJN A;  2ZO4 A;  2B7E A;  3HOS A;  2JRT A;  3HOZ J;  1DPU A;  3I5U A;  3MCZ A;  1MDM B;  1IN4 A;  2VB6 A;  3ZQQ A;  1RUO A;  3CMM A;  5CVI A;  4F93 B;  3GX4 X;  2ADU A;  2ID6 A;  4CIC A;  3ECH A;  2VKE A;  4O3M A;  3LMM A;  4CGZ A;  1FSH A;  3DFG A;  3H36 A;  2PMU A;  1FPQ A;  3E6D A;  5J1Y A;  1XMX A;  4XKV A;  1H0M A;  3AFH A;  4IQ4 A;  1WHU A;  2RQP A;  2Q1Z B;  3IC7 A;  1SVL A;  2HR3 A;  3IH4 A;  1WJF A;  1A36 A;  3BR0 A;  2BXZ A;  2PJP A;  2DFE A;  3TO6 A;  1X3U A;  3KP4 A;  3V7C A;  2JPC A;  4MTE A;  2FEZ A;  1OQY A;  2M7A A;  3BPV A;  3VSK A;  3QAH A;  1NHA A;  3MZ8 A;  4GXO A;  3K4C A;  1I1G A;  3C2H A;  5FJ8 J;  2W7N A;  1U8R A;  2PLY A;  5GTI C;  1BR4 A;  4D5C A;  2K7L A;  2YSR A;  2LC2 A;  1I1S A;  2AQE A;  4PJL A;  4GGG A;  4ZYH A;  4RGU A;  4UV8 A;  3L2W A;  2Z16 A;  1LFB A;  3LAP A;  1R58 A;  1RNL A;  3SQN A;  1WRJ A;  5ILS A;  2KL4 A;  2H1L A;  1UCR A;  2JZY A;  3WHB A;  2OU2 A;  3BZK A;  3ZMV A;  1E17 A;  4G7Z F;  2O8K A;  4HNT A;  1GT0 C;  2PMZ A;  3D5R C;  2K02 A;  4WWC A;  1RR8 C;  1Z6T A;  3F3X A;  2ZC2 A;  2M45 A;  2ELJ A;  2NNN A;  1ETW A;  2Z1D A;  3LST A;  2K27 A;  5LFA A;  2F5V A;  1Y8Q B;  3CCJ I;  1HBX G;  3GTL J;  3BLY A;  1J7K A;  2K3P A;  3DKX A;  3BQY A;  1YTY A;  2E1C A;  2QF7 A;  1R1U A;  2RDP A;  4CCO A;  5CVU A;  4XQF A;  4D1Q A;  1Z6R A;  5L3C A;  2EIM H;  5ICE A;  3M3Y J;  2K85 A;  3RYP A;  3A1Y A;  4RB3 C;  3KEQ A;  4A3E J;  2L02 A;  2Y48 A;  4WX9 A;  4L9T A;  2GOM A;  4HPQ A;  1CF7 B;  2JVH A;  1TQP A;  3BR5 A;  4ESF A;  2VT2 A;  4BAC A;  1JE8 A;  1FOK A;  5BPD A;  5LEJ A;  2ZJP F;  1X58 A;  4IRH A;  1U2W A;  2IJL A;  5JVG F;  1LDD A;  2IXS A;  3TOA A;  1P4A A;  2VJ4 A;  1FEX A;  5FO5 A;  3TP0 A;  2IVM A;  3LL7 A;  1XMA A;  4WK8 F;  2PJR A;  2OCE A;  2WAQ A;  2XRO A;  2JK3 A;  2KIU A;  3FMQ A;  1R5G A;  2V4J C;  2Z33 A;  2ZXH A;  2LLK A;  3FWE A;  4EGZ A;  1GV5 A;  3ULQ B;  1ZTR A;  3DTE A;  1KON A;  4LK0 F;  3SEZ A;  3HGG A;  3Q0V A;  4M9Z A;  1MMN A;  4F91 B;  4HDV A;  1MIJ A;  4BH9 A;  2XB0 X;  4YEL A;  3E6C C;  5ICG A;  3GTM J;  1KU9 A;  2YX7 A;  2O6G E;  1U9N A;  4BJ6 C;  3O8G A;  2O03 A;  2WAE A;  4I76 A;  3T8R A;  2E36 A;  3JRH A;  4ETS A;  4IHW A;  4A3L J;  3I59 B;  3L09 A;  4M3B A;  3V7R A;  2QYO A;  4F55 A;  3HHH A;  3MKY B;  1X4O A;  3S1N J;  4XLE A;  1OIS A;  3HDD A;  4EJV A;  2V1N A;  4I0B A;  1R22 A;  2VKH A;  3CJT B;  4L9V A;  3U21 A;  2A5Y B;  2MSY A;  2KIS A;  3H3V K;  4AC0 A;  3VYS B;  2VBX A;  4B3A A;  3HG9 A;  1SFK A;  3TW7 A;  1X4P A;  5L3E A;  2GOX B;  2MBF A;  1TW3 A;  3GVA A;  3PFY A;  1Q1V A;  4IF4 A;  3HL2 A;  5JR3 A;  3HEF A;  2J5O A;  2JSP A;  2Y2Z A;  3DXJ F;  1MSE C;  2NRA C;  1JT6 A;  2R7T A;  3KFW X;  1MJB A;  3HKZ N;  3I3L A;  5EG0 B;  2KLO A;  3PL8 A;  3I71 A;  3S14 J;  2VBZ A;  3HSE A;  1BW5 A;  1MBH A;  2R3S A;  2IGO A;  1BN5 A;  2CQ7 A;  3K2Z A;  1VTN C;  2F6C A;  4E7S A;  3A01 A;  3DLA A;  1IDY A;  4HLY A;  3V7S A;  4XK4 A;  4LJZ F;  3J81 Z;  2DLL A;  1K83 J;  2NOJ B;  2NXN B;  4N9I A;  2ZFW A;  4XSZ F;  3M8E A;  4MIM A;  3CF2 A;  1UHW A;  4O6J A;  2LF7 A;  1HST A;  1Y56 A;  4HYE A;  3L2V A;  3ERM A;  4A0Z A;  1OLT A;  4FAS D;  1SC7 A;  4JP0 A;  2KPM A;  1HKT A;  3RIR A;  1G2H A;  2D1H A;  1E2X A;  2JUC A;  4M74 A;  4AYB A;  2BY0 A;  4FX0 A;  4U0Y A;  3HOU J;  2KQR A;  4UVA A;  2MC3 A;  4JBA A;  4EEF G;  1VQ4 I;  2L9S A;  2HTS A;  2R7O A;  1VQ5 I;  1ZLJ A;  3K4J A;  4DJA A;  2QEN A;  3GCM A;  4QSH A;  4NNJ A;  3K4M A;  1O57 A;  2F48 A;  1VQ9 I;  3EQL F;  3BT9 A;  4ESB A;  3BG7 A;  3M8J A;  3MKW B;  1R36 A;  1Q1H A;  1MH3 A;  3JRA A;  2Y31 A;  2Y30 A;  1JXS A;  1QO0 D;  4LB6 B;  3IAS 2;  4GYG A;  1B59 A;  4EM0 B;  2DK8 A;  2H8R A;  3WGG A;  2HFH A;  1ZKG A;  5E17 F;  4FT8 A;  1FIA A;  3TO9 A;  4G7O F;  1IRF A;  3G2B A;  4PGH A;  4BAY A;  1TWH J;  5CQG A;  1CQT A;  3NQO A;  3FBI B;  3VPR A;  4AIH A;  1S7A A;  4RAF A;  4CZZ A;  5DD4 A;  5BS6 A;  1F4K A;  4ASN A;  3D1N I;  2CUF A;  5FGM A;  2XRL A;  3G1O A;  5E79 C;  1ZRD A;  3R0A A;  3G1L A;  4MQV A;  3ZMS A;  2DBB A;  2FA5 A;  2RV8 A;  2VKD A;  4FX4 A;  2ZJR F;  5J3L A;  3K0L A;  4E7I A;  2VPL A;  2IBD A;  3KP2 A;  1S72 I;  3BDD A;  1ZGA A;  1UHS A;  4RB2 C;  4RAY A;  3BZ6 A;  3KEY A;  2FQ4 A;  3QU6 A;  3N97 A;  5IP7 J;  4L5E A;  3LQR A;  4MNU A;  1ENH A;  1I39 A;  2LKP A;  3FXL A;  2XF5 A;  5KCM A;  2LVS A;  4MO7 A;  4RBO A;  1RKT A;  4V2G A;  4EAT A;  1IN6 A;  5E1X A;  1MMS A;  3W2A A;  3BPX A;  1YFH A;  3WG7 H;  3TOB A;  2VJJ A;  4E70 A;  3OR2 C;  3SFZ A;  4UNO A;  4P55 A;  3H92 A;  3MAJ A;  3IWZ A;  4B09 A;  3QYB A;  1L0O C;  3WGI A;  1U3E M;  4E7H A;  2DT7 B;  3O8H A;  3WG9 A;  2E2H J;  4A93 J;  3MMY B;  3MFK A;  1T8I A;  2HTJ A;  4ZZL A;  4XIC A;  1KU7 A;  4UUT A;  2DYR H;  2DJN A;  3HOT A;  5FKO A;  3GTK J;  3F8M A;  4HF1 A;  1V5E A;  2UXX A;  2M8G X;  2KZV A;  1FWZ A;  5J8C A;  1PP8 F;  3J7Y J;  2VXZ A;  3CJN A;  2V1X A;  2O0Y A;  5M3F J;  1BIA A;  2K86 A;  2F4I A;  4NC6 A;  5FD6 A;  1TT0 A;  1I3A A;  2FMY A;  4G94 A;  1IRZ A;  2LOO A;  5J1U A;  1RET A;  3HTU A;  3LNQ A;  1BC8 C;  3CCY A;  2FOW A;  3HUG B;  4Y7N J;  3HYI A;  1VQK I;  3WOD F;  2H6B A;  2J5P A;  4D5F A;  3RZD J;  2K9M A;  4XRM A;  2CGP A;  4HW0 A;  2OF7 A;  5GPC A;  2E2J J;  4XLF A;  4NB5 A;  1WKM A;  3ZPL A;  4OAZ A;  2QSG X;  3QPL A;  3CUO A;  1J75 A;  1E0E A;  4ZYE A;  2ZME A;  5EGO A;  4IHY A;  3ABK H;  2IGM A;  2BY1 A;  2DFH A;  2HVQ A;  3OYD A;  1SFX A;  2VKV A;  4AUX A;  5F0H A;  5D5W B;  2KDO A;  1LDJ A;  1MMA A;  1MMG A;  4XID A;  1B9M A;  1XDS A;  1Z9C A;  4IQJ A;  1Y8R B;  4XKW A;  1V4R A;  4I6Z A;  1IF1 A;  3BJA A;  4XON A;  1OYY A;  3KP3 A;  4ENM A;  3FIW A;  4BS9 A;  3TL4 X;  2EZH A;  3DP7 A;  2DFF A;  5C4X J;  5IT3 A;  1KU2 A;  5B66 C;  1JJ6 C;  1WCM J;  4XOP A;  2XAQ A;  3SDG A;  3OY9 A;  5J6X A;  4C3J J;  4YG2 F;  2DQL A;  2DXI A;  3ZMZ A;  4A12 A;  4YFK F;  1OYI A;  4B4C A;  1FYM A;  1W7P A;  2DT5 A;  3FM3 A;  2KIF A;  2LRD A;  5K7Z A;  2EZI A;  4ZYD A;  1AWC A;  2FX0 A;  2BHZ A;  1JKR C;  5GAE J;  4HEA 2;  4OMY A;  1XTA A;  4U87 A;  4XKC A;  1O7F A;  4BL0 B;  2F5D A;  2X6O A;  3F8F A;  2Q2E B;  3GZ5 A;  1TBX A;  1AKH B;  3FDY A;  2ISZ A;  2G7U A;  2DPD A;  2P6T A;  4B48 A;  4F52 A;  4BNC A;  3SYT A;  1T2K A;  4OIN F;  3H1C A;  2TDX A;  2QBY B;  1ZG5 A;  2FNP A;  2MD0 A;  2ESN A;  4RS8 A;  1K78 A;  1IZ1 A;  3WTS C;  2WAD A;  3CTA A;  4BXU A;  3HSF A;  1IW7 F;  4BJ5 C;  3P9I A;  4CCL A;  2WV1 A;  1SD7 A;  1V5G A;  5LGN A;  3S32 A;  2IW5 A;  3E5Q A;  4V2F A;  2P0W A;  2XAS A;  1YRN B;  3FHZ A;  1Z7L A;  1D8K A;  4B3X A;  4IRI A;  3KET A;  1ETK A;  1W0U A;  1WJE A;  1HSJ A;  5C4J J;  1G3Y A;  1TNT A;  3GW2 A;  3QYF A;  2GAU A;  2X0L A;  4EMS A;  3OSF A;  1W7P D;  2ZXJ A;  1VI0 A;  2Z2S B;  3L2C A;  1T0F A;  4DBQ A;  4BQO A;  1B6A A;  5DM6 F;  1IUY A;  3CUQ A;  1B9N A;  3H3Z A;  3HOY J;  4A3D J;  3VB2 A;  4BJT A;  5CVV A;  4MHG A;  2M2E A;  2VJI A;  5DCM B;  1SAX A;  5FFX A;  1ON1 A;  2OPT A;  5CPR B;  1H9G A;  4GRI A;  4NHJ A;  2HU9 A;  2KFD A;  5EZH A;  2EFW A;  1IRG A;  4DW6 A;  3ZMU A;  3OR1 C;  2KKO A;  2HOA A;  4AIJ A;  2HQA A;  4II2 A;  3OIP A;  5HLH A;  2PFB A;  1USS A;  2UZK A;  3OYL A;  3JRF A;  1S7E A;  3F72 A;  3REO A;  3TW6 A;  1Z1D A;  4FE7 A;  2LFB A;  3OMY A;  3CO6 C;  3K1P A;  3CC4 I;  4HLX A;  3ZMT A;  2XDV A;  5H2F C;  2MH9 A;  3LSG A;  4FQG A;  4A3B J;  2ETH A;  1B72 A;  4BU2 A;  3GFI A;  1FBS A;  4KUM A;  2W25 A;  4F7Z A;  3UR3 C;  2ZB9 A;  2OTL I;  4Y17 A;  1ZHF A;  4EJT A;  2P7C B;  3S8P A;  2CQN A;  1NG7 A;  3ASN H;  1MND A;  3OYK A;  2VOD A;  2DU9 A;  3PO2 J;  3VWB A;  2LD5 A;  1DU6 A;  1LFP A;  4BDY A;  4DOZ A;  1O3S A;  2F4O B;  3SZG A;  4EQQ A;  3H5N A;  2L5Q A;  4M3D A;  3DLL F;  1RI7 A;  1Y0N A;  2R7V A;  4P96 A;  3A0B C;  3LAJ A;  2RAE A;  3CDL A;  4RM3 A;  2DA1 A;  2CJJ A;  4J19 A;  5DTD A;  5H20 A;  2CW8 A;  2ZME C;  1HLV A;  2P4W A;  1H8A C;  1BI0 A;  4GDF A;  1X2N A;  1IXR C;  2QQ9 A;  2AXT C;  1UG2 A;  2FJ1 A;  2F5E A;  2DN0 A;  1FX7 A;  2NVQ J;  3HJE A;  1DGW Y;  1T08 B;  5F0F A;  3CCS I;  3LSH A;  3ZCO A;  4KIS A;  2VOP A;  4CYC A;  3F21 A;  2O9L A;  1D5Y A;  3V8J A;  3BC8 A;  3M7G A;  4RAZ A;  2E60 A;  3BP8 A;  4MTD A;  4CSW A;  3JRG A;  3FIS A;  3CCE I;  3DV8 A;  3L1P A;  3OV8 A;  5GPA A;  2FE3 A;  2A69 F;  3LSR A;  4BE0 A;  2FU4 A;  5DUI A;  2ZXW H;  2HWV A;  3P5J A;  1VQM I;  3G1M A;  1R5I D;  4DNC A;  4KMF A;  4KT6 A;  4XRF A;  5BPI A;  3I55 I;  1AA7 A;  2ECC A;  2R5Y B;  4LLN A;  3H35 A;  4G6Q A;  5ICF A;  2RGV A;  3M4O J;  1ACI A;  1VQ6 I;  4A5N A;  4MFD A;  3ISP A;  4HST A;  4A5M A;  4ZJZ A;  1FOX A;  4B43 A;  3JSO A;  5HS7 A;  4BE1 A;  3E3V A;  1FP1 D;  2IRF G;  4E7L A;  2IS6 A;  2ACJ A;  1YIJ I;  3JRI A;  3NRV A;  1LE8 A;  4ENJ A;  1MNE A;  4FE4 A;  1XCV A;  1IJW C;  3SHF A;  5IYB J;  3RTR A;  3SXY A;  2GM4 A;  3HOX J;  2Z9O A;  3F8N A;  1SEU A;  3K1N A;  2L01 A;  3FHN A;  4E7Z A;  3M1E A;  2LKS A;  4WCG A;  4D7N A;  4E6K G;  4DIQ A;  2X51 A;  2R7Q A;  2P8T A;  1WQ2 A;  2M34 A;  3S17 J;  2GIV A;  3ZGK A;  4MLO A;  5CYV A;  5K5Q A;  1ETO A;  4IOC F;  3U1D A;  1U6G A;  3EDP A;  5DUK A;  2UXN A;  1FTT A;  2TCT A;  4LOC A;  1OYW A;  2QM3 A;  5D8L B;  5DV5 A;  3KYL A;  3B02 A;  3TQN A;  5D5U B;  2DA7 A;  2Y0S N;  1R9T J;  1Z3X A;  2L9R A;  1LDK B;  4LIT A;  2KP6 A;  3ZRG A;  1IN5 A;  1T33 A;  2HNH A;  2DOE A;  2O5R A;  4DGW B;  3OYC A;  4IX7 A;  2GXA A;  3NAR A;  5KNL A;  2BEO A;  1PYV A;  4I7H A;  1T0F C;  2MH2 A;  1E3O C;  1TZL A;  3IHU A;  1P4W A;  4IEJ A;  4LK1 F;  3CUQ C;  1MJ9 A;  2L54 A;  3V8L A;  3C2B A;  2KRF A;  2GXB A;  2HYF A;  4LLL A;  3I56 I;  1AOY A;  1MMD A;  2VL8 A;  5BMZ A;  1U5T B;  2COB A;  3I4P A;  2OD5 A;  1P9Q C;  1SAU A;  1G8X A;  2K9N A;  4HSR A;  4ZYA A;  1Z3Y A;  3S1M J;  1OFC X;  2MLK A;  2HDW A;  4I02 A;  3MQ0 A;  1KYZ A;  4Y4R A;  1IN7 A;  2NS8 A;  1HKS A;  3BTL A;  2W85 A;  4YIF A;  4H4K C;  3WE2 A;  1GXP A;  3PUF A;  4AD9 A;  5M5Y J;  5FRO A;  2KJC A;  2H1K A;  1MNM C;  2R7U A;  3H9Q A;  3NWT A;  1V54 H;  2EZK A;  2IA0 A;  5JHU A;  3S3M A;  1HW2 A;  1BC7 C;  4JK1 X;  4YIR X;  4UB6 C;  4ON0 A;  3DTI A;  1WVR A;  1XGO A;  3C18 A;  2VI6 A;  3IL2 A;  2HXI A;  2PX9 A;  2XPV A;  3ECO A;  3HRU A;  3QPS A;  2EA4 A;  2HQ5 A;  4WF2 A;  2X1E A;  4XOR A;  5AIQ A;  1KQ8 A;  3GO5 A;  1D5V A;  5HLI A;  5EEH A;  1HCR A;  4KDP A;  2OV7 A;  5E3M A;  2LYC A;  4L9J A;  3RKW A;  2IS4 A;  3TP3 A;  2X9D A;  3DKW A;  3U2R A;  2ZSH B;  2AS5 F;  1TWG J;  3BG6 A;  1RIO H;  5IT9 K;  1X1C A;  4IVN A;  1SD6 A;  5FD5 A;  1Y6I A;  2R7Z J;  4QPQ A;  2K9Q A;  2L7Z A;  3P9C A;  3QPT A;  1V5F A;  1ZH5 A;  1HQC A;  1VFC A;  4AVZ A;  1S5L C;  2XAF A;  5F27 A;  5LRS A;  4S05 A;  3KIO A;  4UUS A;  1ULY A;  3K4L A;  4G6D A;  2RKH A;  3PNV A;  4P9F A;  1DPR A;  2RQQ A;  3S2D J;  3DPL C;  4PSW A;  2QSF X;  3L7W A;  1EH6 A;  3KZI C;  4G12 A;  1G3T A;  3A4C A;  2VOO A;  3K9T A;  2DI3 A;  4RB0 A;  4L5J A;  2NS7 A;  2ZJQ F;  5LHG A;  2ZBK A;  2IPQ X;  2L3D A;  4WXD A;  1N75 A;  3M9A A;  3QYE A;  3OOP A;  3BTJ A;  2LY2 A;  4O5V A;  4XLH A;  5M5X J;  5H6R A;  1Y1W J;  1D3Y A;  3AL0 B;  1A35 A;  3EPZ A;  1ZG1 A;  5B1B H;  1I6H J;  3GTG J;  3MZY A;  4QTR A;  2H6C A;  1JKP C;  1FZP B;  1X1D A;  4ABZ A;  2ZKZ A;  5ED4 A;  3AG4 H;  2DA4 A;  5K7F A;  2HDC A;  1BR2 A;  1KZH A;  1QZY A;  3A02 A;  1P2F A;  2Z3Y A;  4KA4 A;  4JX5 A;  3P9K A;  3VYU B;  1OCP A;  2X1C A;  1FJL A;  1XGM A;  1UG0 A;  2TRT A;  4AM3 A;  2XHK A;  2EV6 A;  2WV0 A;  2X6X A;  3U1K A;  1JGS A;  1W5S A;  4IKF A;  2HQN A;  2JQ7 A;  1XSD A;  5FKM A;  2WWY A;  3F22 A;  5J40 A;  5IYD J;  4PJJ A;  4CH7 A;  1LVA A;  4ANJ A;  3OYG A;  2HOS A;  4U0W A;  1K78 B;  2BHY A;  3VEP A;  4OIO F;  3K70 D;  4L0Y B;  3I4N J;  2MW8 A;  2P5L C;  1DQU A;  5E1W A;  2BXY A;  2CYY A;  4Q47 A;  2BV6 A;  2DTZ A;  4C3I J;  2HOE A;  2OZ6 A;  3PQJ A;  3ZMD A;  3GTJ J;  3N4M A;  3KYC B;  1YYV A;  1BW6 A;  5CKT A;  4MFE A;  1PUF B;  2JT1 A;  2XAH A;  5IP9 J;  2QQB A;  3SFI A;  3L2Q A;  3FXJ A;  3MZH A;  3QPH A;  3VSL A;  4IJA A;  4DYR A;  3Q5F A;  2DMN A;  3WTV C;  3OYF A;  4KJZ A;  4Y3O A;  2WA0 A;  1ZK8 A;  3K4K A;  1DDN A;  4Q4Z F;  2V9V A;  1REP C;  1KA8 A;  1QRY A;  2Q0O A;  4F3Q A;  2HYG D;  2CWE A;  2STT A;  3S1R J;  3BR3 A;  1OCR H;  3E6M A;  3OSG A;  3R0J A;  3FBN B;  2F4M B;  1ON2 A;  2CW0 F;  2LK2 A;  5DD8 A;  2PN6 A;  5HLT A;  1YW7 A;  1IV8 A;  1VZ0 A;  5EF6 A;  3GBG A;  1UMQ A;  1D1B A;  2HKO A;  2M9H A;  4XRS G;  2VQL A;  1BBY A;  2CUZ A;  5E3L A;  4AWX B;  1OR7 A;  5LGT A;  1B8I A;  2X48 A;  3ESW B;  2BE5 F;  4R79 A;  1R23 A;  2P81 A;  3GF2 A;  1FMV A;  2E1M C;  3LQQ A;  5LHI A;  4CCN A;  1WJB A;  2DFI A;  3L9F A;  1A5J A;  2DCE A;  5CVR A;  3PNY A;  3KZY A;  3SDB A;  3OS0 A;  3WU0 A;  3H0D A;  4DYC A;  2FD5 A;  4CA0 A;  2AQF A;  3S3N A;  4NC7 A;  2X1D A;  4EGY A;  1OPC A;  1B72 B;  3GFJ A;  2Y69 H;  4HDU A;  4F92 B;  2NVT J;  4HZF A;  4C2T A;  2LG4 A;  2JMW A;  2LY1 A;  2V1U A;  5JI6 A;  5IP6 A;  3FMS A;  3IH2 A;  2FQ3 A;  1MZB A;  5K1Y A;  1JJ8 C;  3E5U A;  3MKL A;  3JRB A;  3FXK A;  5L3D A;  1JUM A;  1SMY F;  4S0H B;  2BW3 B;  2EA2 A;  1QZE A;  2RNG A;  1QGP A;  4KT5 C;  3CC2 I;  1S29 A;  4ITV A;  3V42 A;  4FTH A;  2DA2 A;  3FZV A;  4A3G J;  2OJE D;  3K2A A;  3I54 A;  2L4M A;  4R1H A;  1ZEL A;  1XGN A;  2E19 A;  3HHG A;  2CG4 A;  1BIB A;  1FP2 A;  1FNN A;  1SVO A;  2XAU A;  1KQ9 A;  2EFP A;  1ZR4 A;  2ESH A;  3JAM K;  2XKP A;  5EYR A;  1QVT A;  1MDM A;  1K6Y A;  1TW2 A;  1R71 A;  1QU3 A;  2EFQ A;  3WTX C;  3IWF A;  3BG5 A;  3R61 A;  3FKJ A;  1MD0 A;  2PQ8 A;  1M1E B;  4MEX F;  1WWX A;  3NEU A;  2YU9 J;  2QLZ A;  4RGS A;  4H0E A;  3IKV A;  1KGS A;  4OWR B;  3CME I;  1LVK A;  2KZG A;  3NAU A;  2MG4 A;  3IUO A;  4C2U A;  2KIQ A;  3CCL I;  2H09 A;  5HNF A;  3HM5 A;  2VQH A;  2E35 A;  2GWR A;  4ZTF A;  2JA6 J;  2M0C A;  3RYR A;  1JT0 A;  2WAQ N;  4C3H J;  4E7K A;  1MBG A;  3I9V 2;  1YJW I;  5DCF A;  2AHQ A;  2FOK A;  3TMO A;  3Q3S A;  3GYH X;  3ABM H;  3G71 I;  2STW A;  3GLX A;  4U0V A;  4DZP A;  4RM2 A;  1P7J A;  2VN2 A;  3TBI A;  3E5X A;  1HDP A;  5FLM J;  3LSM A;  1QHH D;  4HQE A;  1BR1 A;  4UB8 C;  1W4M A;  2DOA A;  1LE8 B;  4I99 C;  4J00 A;  1R00 A;  2CO5 A;  2RRE A;  2NVY J;  6PAX A;  3VYT B;  1HDD C;  2K40 A;  1FYL A;  3L2R A;  2E7W A;  3JCU C;  1MJA A;  4ZH4 F;  5D5X B;  2X6Y A;  2NVX J;  4AID A;  3PNT A;  1GVD A;  2EIN H;  3BRO A;  4EJO A;  4RDU A;  1KQ0 A;  3HBL A;  1T6S A;  1BI3 A;  4Y13 A;  3ASO H;  1ZRF A;  1TC3 C;  4LMY A;  5B5E C;  2YU3 A;  2WTE A;  1W36 D;  3RSN A;  4C30 A;  2WB1 N;  5D5V B;  4Q5S F;  4NQW A;  4OAY A;  5K7H A;  3CLQ A;  3I53 A;  4OIQ F;  3I0T A;  1WGX A;  2I5U A;  4A2U A;  3JRD A;  1B1B A;  1ZRE A;  3HZJ A;  4V19 K;  4BQN A;  3UNG C;  3BR6 A;  1ETQ A;  2H8W A;  2O7O A;  3HB9 A;  5D4S A;  3S16 J;  1ETX A;  1FOW A;  2XB5 A;  1J59 A;  4I2O A;  5FLX Z;  4M71 A;  2HI3 A;  4XMY A;  1YW9 A;  2GLO A;  2CRG A;  3K4B A;  1I5Z A;  1UHM A;  1BI2 A;  3MKZ A;  2X6W A;  1A6Q A;  5A2Q K;  5C44 J;  1K61 A;  1GV2 A;  1OR7 C;  2DW4 A;  1QA6 A;  5IPA A;  1JI8 A;  1RZ4 A;  4OOI A;  5E1Z B;  5ERI A;  1X1B A;  4HQM A;  5E20 A;  1OCC H;  2VXD A;  3H5A A;  2XPW A;  3RJP A;  5FLV A;  5IT9 Z;  3F8C A;  4JX4 A;  2ZNY A;  4AYB N;  4HX7 A;  5J4Y A;  2A05 A;  4HRI A;  2JA5 J;  4NBQ A;  4BQQ A;  2EB7 A;  1D0X A;  2BY2 A;  3S1Q J;  2L0K A;  3HXL A;  2CV2 A;  1J0R A;  1S3J A;  1Z7U A;  2JA2 A;  4XN3 A;  1OMI A;  2FBH A;  1A6I A;  3R4K A;  3T1B A;  4D7M A;  3DWL E;  1YHQ I;  2QGU A;  5TRD A;  1BJZ A;  3I59 A;  4WXH A;  4MGR A;  4RGX A;  3J7A Y;  1OCT C;  1J9I A;  3KPH A;  2L7M P;  5J8F A;  5EEG A;  1I50 J;  5CJ9 A;  3L00 A;  3JRC A;  5F08 A;  3HGY A;  2KT0 A;  3QQA A;  2DYS H;  2E1O A;  1LPQ A;  3EUK L;  2DA3 A;  1K79 A;  2P7V B;  2A5W A;  4ZZD A;  4CZC A;  3BG9 A;  2GA1 A;  2CQK A;  3G3Z A;  2UWM A;  4UUS B;  1X1A A;  2M1B A;  3CMY A;  2I8D A;  2QKL B;  2FML A;  1JUP A;  1RPW A;  2L7F P;  2PJR B;  3RDI A;  3H9J A;  4BGD A;  1FMW A;  1UAA A;  4HG2 A;  5E8G A;  3KLO A;  2BOL A;  2CMP A;  5K5R A;  4RA2 A;  2FSW A;  2M87 A;  2JJ7 A;  4HA8 A;  4OMZ A;  3TO7 A;  5EZG A;  2E5Z A;  3MN2 A;  3ZQG A;  2M0M A;  2DMU A;  1PJR A;  3W2W A;  5ICC A;  2EFO A;  3HPH A;  3LSI A;  4P1W A;  2QQA A;  1PP7 U;  5GAH J;  2Y9Y A;  3ZR8 X;  4U88 A;  2EV0 A;  3BWG A;  3JTG A;  1QPI A;  4B44 A;  1W36 C;  2QZ8 A;  2JVG A;  1N78 A;  1ETV A;  4XNF A;  4LFU A;  3F6O A;  4M3G A;  1ZAO A;  2VIX A;  3CCV I;  1OCZ H;  4LG0 A;  1IG7 A;  1G59 A;  1NTC A;  3T8T A;  1YS7 A;  2DTR A;  1L3L A;  2X85 A;  5HOD A;  4FHT A;  5KHD A;  1XCB A;  5BQT A;  2PMH A;  3FKI J;  1YX5 A;  4BE2 A;  2LNB A;  5M5W J;  1B4A A;  4YEJ A;  1I6X A;  3E1S A;  1HF0 A;  1YX3 A;  4ZC3 A;  4UUV A;  1G3S A;  1EH7 A;  1X19 A;  1CGP A;  2HEO A;  4Y33 A;  5TJJ A;  2EK5 A;  1ZR2 A;  1WFX A;  1I27 A;  2EIJ H;  2JN6 A;  5E18 F;  2IGN A;  2LKX A;  3F6V A;  2ID3 A;  2FUG 2;  3DBR B; 
#chains in the Genus database with same CATH homology
 4XBF A;  1ZYR F;  2JPB A;  1R7J A;  2D1V A;  3QOP A;  1J5Y A;  4L0Z B;  4AVP A;  2OQG A;  3BOQ A;  3QRF F;  1W5T A;  3K69 A;  3DF8 A;  3GZ6 A;  1LEB A;  2FNA A;  1XMK A;  2XAG A;  3J7A O;  2LF8 A;  4HV5 A;  1QNT A;  2M5W A;  3E6B A;  1T98 A;  3EUH A;  2VE8 A;  1FBU A;  1UST A;  4CXF A;  4EM2 A;  4UVC A;  3LFK A;  4HX4 A;  5LRR A;  4M72 A;  4QLC U;  4IXA A;  4XSX F;  3O3K A;  1SD5 A;  1D8J A;  1BJA A;  1A04 A;  1GHC A;  3P7N A;  1TQM A;  4LLG F;  1LNW A;  4HV6 A;  2HZT A;  2IP2 A;  4BHC A;  2F5F A;  1FC3 A;  3JAM Z;  1IAW A;  4LGW A;  4CDG A;  4I09 A;  2H94 A;  4OIR F;  1XSX A;  2DPU A;  3T0Y A;  3D5L A;  5F64 A;  4A6D A;  3J80 K;  3AAF A;  4L18 B;  1UB9 A;  3FM5 A;  5D8K B;  3BJ6 A;  3EET A;  5HDK A;  5L3B A;  2XRN A;  1ZRC A;  2DQR A;  1R5H A;  1TQI A;  2RVC A;  3HUG A;  3WGH A;  4EV0 A;  3WTZ A;  3VOD A;  1LEA A;  4K2E A;  1QBJ A;  4L5I A;  5F1R A;  1YO5 C;  1IN8 A;  2P5K A;  1Y0U A;  1XDU A;  2Y75 A;  5FB2 A;  1O3Q A;  1SMT A;  1TLH B;  3ZN1 A;  4CO8 A;  2FRH A;  3KZZ A;  3WTY C;  1FY7 A;  2OQR A;  3KP5 A;  3R6S A;  3WTU C;  2M8E A;  5LHH A;  4P5O A;  3BY6 A;  4KMU X;  2FBI A;  1OKR A;  2PEX A;  3KCC A;  2PG4 A;  3U9G A;  2P5V A;  1F1Z A;  4IHT A;  2P6S A;  5ILV A;  5FLX K;  5JFR A;  5DDG A;  2OBP A;  2R7F A;  1ZG3 A;  4ZYG A;  1K7A A;  2ISY A;  5HOO A;  3M8F A;  4HOB A;  4M73 A;  3ZN0 A;  2O8X A;  2ZME B;  1ZLK A;  1O7L A;  4IRG A;  4YFX F;  1TNS A;  4KFC A;  4G9Y A;  3KEO A;  4OU0 A;  2Q2E A;  5A2Q Z;  2LSO A;  5CVJ A;  1YS6 A;  1FYK A;  3ERE D;  3TGN A;  2QBY A;  5K5O A;  2BGC A;  5HLG A;  2VT3 A;  3SZP A;  2KIM A;  2H27 A;  3WTT C;  2XAJ A;  5BOX A;  2PI0 A;  3FXR A;  2R7D A;  2VON A;  3HRM A;  1T39 A;  1LB2 A;  3QU3 A;  2Z5U A;  2QWW A;  4N9H A;  3BJO A;  2IA1 A;  1W7P B;  1DP7 P;  2A3S A;  1GVJ A;  4GYI A;  2MLG A;  3ZP5 A;  3KE2 A;  4IHS A;  3JTH A;  2DAO A;  2X4H A;  1BI1 A;  4UVB A;  1MKM A;  4M6X A;  1YIO A;  5DCM A;  2HQR A;  3D0S A;  2L4A A;  3FX3 A;  4BHP A;  5L3F A;  3WU1 B;  3F8B A;  3GFM A;  5HS8 A;  3H3U A;  2F5C A;  3CLO A;  2CSO A;  3HRT A;  2NYX A;  2E1N A;  1S6L A;  3I64 A;  2HS5 A;  3S2W A;  5DEQ A;  1ZGJ A;  2XUB A;  4KNY A;  5L3G A;  3EYI A;  4BHB A;  4YII A;  3RKX A;  3KLN A;  4EJU A;  2VE9 A;  5LLQ A;  3CUQ B;  2E7X A;  3G73 A;  1C0W A;  3ABT A;  1R1T A;  2GA2 A;  3TKY A;  1ODD A;  2COM A;  4I0A A;  2A68 F;  5HS9 A;  3GFL A;  2QUF A;  1RUN A;  3W6K B;  3FMR A;  5LGU A;  4UXN A;  2VBW A;  2YPR A;  4EM1 A;  4LG0 B;  3KP7 A;  4PZJ A;  5KVR A;  3VOE A;  3IKT A;  2GQQ A;  2IA2 A;  3I58 A;  2W84 A;  1K6O A;  3PQK A;  3GEZ A;  2IT0 A;  3HIF A;  2JTV A;  3R60 A;  4G7H F;  4GO1 A;  4S04 A;  2RNJ A;  2CFX A;  2RC4 A;  4LB5 A;  2Y0M A;  1ZN2 A;  2OAZ A;  4PGG A;  2YX4 A;  1Z91 A;  1T38 A;  3COA C;  2W24 A;  5ILU A;  4YFN F;  1S8N A;  4QWQ A;  1MGT A;  1PUE E;  2ELH A;  1IXS B;  1ZAR A;  4I01 A;  2O61 A;  2DK5 A;  3GUD A;  1SD4 A;  2MA3 A;  4TV7 A;  2EJR A;  3V4G A;  2O3F A;  2XV4 S;  4M6Y A;  4Y15 A;  2FXA A;  3J80 Z;  4R8H A;  4Q48 A;  3CDH A;  5FFZ A;  1O3T A;  1IXC A;  2ZJ2 A;  4DQ2 A;  1FT9 A;  4KIC A;  1G3W A;  5HDG A;  3RKY A;  4IPA A;  2OA4 A;  4WXC A;  1STZ A;  2YR2 A;  2XIG A;  2G7H A;  4Z2Y A;  1XGS A;  1P4X A;  5F6F A;  1U5T A;  1EV7 A;  4A6E A;  3T5X A;  5AIP A;  3DQV C;  1XSV A;  2EV5 A;  1YLF A;  1R1V A;  3IRQ A;  2XGX A;  5D6E A;  2VC0 A;  1DUX C;  3SZT A;  4CYD A;  3QP5 A;  1F9N A;  2W57 A;  1SFU A;  5KK1 A;  5JVT A;  3WTW C;  1JHF A;  2V6C A;  3HRS A;  2V1D A;  5LBQ A;  3CO7 C;  2ZCW A;  3DPT A;  4RGR A;  4HAM A;  4EJW A;  3ROU A;  5HVQ C;  3B73 A;  1QQI A;  4AIK A;  4XLP F;  1CF7 A;  3GWZ A;  4PDK A;  4KIF A;  3IRR A;  1XN7 A;  2A61 A;  2BBY A;  1H9T A;  4XLN F;  3MEX A;  3O2P E;  1XB4 A;  1U78 A;  2NS0 A;  1HXD A;  1F5T A;  3E97 A;  3FF5 A;  3C3W A;  3V8K A;  2KJB A;  3GXO A;  3DEU A;  1YW8 A;  2RN7 A;  2EFN A;  3HSR A;  2G9W A;  1G4D A;  2K4J A;  2XKO A;  2GXG A;  3C1D A;  4M9X A;  1KYW A;  2LDU A;  2VC1 A;  2AXL A;  2NAZ A;  1HW1 A;  1YG2 A;  4MQ9 F;  3WE3 A;  3RPQ A;  4JQF A;  2DO7 A;  4KN7 X;  1V3F A;  1QZZ A;  2NNY A;  1LQ1 A;  4HX8 A;  1BOA A;  1YQA A;  2F2E A;  1JHH A;  2GZW A;  4UV9 A;  4OIP F;  3F23 A;  4P9U A;  4RB1 A;  3JSP A;  4KIB A;  5D6F A;  3O6B B;  5E8I A;  4CHU A;  2A07 F;  2WC2 A;  2QVO A;  4EVI A;  3LWF A;  4LD5 A;  3EYY A;  4M9S A;  1WSU A;  1QPM A;  2A6H F;  4HF0 A;  2ZNZ A;  2EWN A;  4L9N A;  4HBL A;  4BQA A;  4B8X A;  3C7J A;  2D2W A;  3KP6 A;  3LA7 A;  4PCQ A;  3RPU A;  5LEK A;  3MWM A;  2B0L A;  3TDU C;  2V79 A;  3J81 K;  4GCV A;  4I98 B;  1KU3 A;  2MD5 A;  3QP6 A;  1PDN C;  3ABU A;  1HKQ A;  1U5T C;  4KYW A;  4MEY F;  2C6Y A;  1ONV A;  2FBK A;  1FBQ A;  3VFZ A;  1G6N A;  1WI9 A;  5AON A;  2XVC A;  1P6R A;  5CLS A;  3W6J B;  4N0B A;  1FSE A;  2JSC A;  4A0X A;  4U7D A;  4ESJ A;  1S7O A;  2Q8K A;  1P92 A;  4BYY A;  4UHT A;  2VBY A;  2Z99 A;  2FF4 A;  4HF2 A;  2HGC A;  1BM9 A;  3K1M A;  2M30 A;  3ELK A;  2D45 A;  3Q9S A;  4KIG A;  5DYM A;  5D4R A;  1FLI A;  1Z05 A;  3HTS B;  2OZU A;  3JW4 A;  1LJ9 A;  1J2X A;  3Q9V A;  1EH8 A;  1SFE A;  1TTY A;  3ML6 A;  5HDN A;  3ZQ7 A;  3LA2 A;  4D0P A;  2K4B A;  1GXQ A;  1UFM A;  3FXQ A;  2HKX A;  3PFI A;  4ENK A;  2A6E F;  5H6Q A;  3LA3 A;  2BYV E;  4ENN A;  3RI4 A;  1XD7 A;  4A0Y A;  1HW5 A;  4KN4 X;  2PBI A;  3TDZ C;  3FXU A;  4U7B A;  1O3R A;  4G8X A;  2ZO4 A;  3HOS A;  2JRT A;  1DPU A;  3I5U A;  3MCZ A;  1MDM B;  1IN4 A;  1RUO A;  5CVI A;  3GX4 X;  2ADU A;  4CIC A;  3ECH A;  4O3M A;  1FSH A;  3DFG A;  2PMU A;  1FPQ A;  3E6D A;  1H0M A;  2RQP A;  3IC7 A;  2HR3 A;  2PJP A;  3TO6 A;  1X3U A;  3KP4 A;  3V7C A;  2JPC A;  4MTE A;  2FEZ A;  3BPV A;  3QAH A;  1NHA A;  4GXO A;  1I1G A;  1U8R A;  2PLY A;  2K7L A;  2YSR A;  1I1S A;  4GGG A;  4ZYH A;  4RGU A;  4UV8 A;  3LAP A;  1R58 A;  1RNL A;  3SQN A;  1WRJ A;  5ILS A;  1UCR A;  2JZY A;  2OU2 A;  3ZMV A;  1E17 A;  4G7Z F;  2K02 A;  4WWC A;  1Z6T A;  3F3X A;  2M45 A;  2NNN A;  3LST A;  2K27 A;  1HBX G;  1J7K A;  1YTY A;  2E1C A;  1R1U A;  2RDP A;  5CVU A;  1Z6R A;  5L3C A;  5ICE A;  3RYP A;  4RB3 C;  3KEQ A;  2L02 A;  2Y48 A;  4WX9 A;  4L9T A;  1CF7 B;  1TQP A;  4ESF A;  2VT2 A;  1JE8 A;  1FOK A;  5BPD A;  5LEJ A;  4IRH A;  1U2W A;  2IJL A;  1LDD A;  3TOA A;  1P4A A;  5FO5 A;  2IVM A;  1XMA A;  4WK8 F;  2XRO A;  2KIU A;  3FMQ A;  1R5G A;  2Z33 A;  3FWE A;  4EGZ A;  3ULQ B;  4LK0 F;  4M9Z A;  4HDV A;  4BH9 A;  3E6C C;  5ICG A;  1KU9 A;  2YX7 A;  2O6G E;  2O03 A;  3T8R A;  4ETS A;  3I59 B;  3L09 A;  3V7R A;  2QYO A;  3HHH A;  4EJV A;  4I0B A;  1R22 A;  4L9V A;  2A5Y B;  2VBX A;  5L3E A;  2MBF A;  1TW3 A;  3GVA A;  4IF4 A;  5JR3 A;  2J5O A;  3DXJ F;  2NRA C;  3KFW X;  1MJB A;  3I71 A;  2VBZ A;  3HSE A;  2R3S A;  1BN5 A;  3K2Z A;  1VTN C;  4HLY A;  3V7S A;  4LJZ F;  3J81 Z;  2DLL A;  4N9I A;  4XSZ F;  2ZFW A;  3M8E A;  1UHW A;  4O6J A;  1HST A;  2LF7 A;  4HYE A;  4A0Z A;  1HKT A;  3RIR A;  4U0Y A;  2D1H A;  1E2X A;  4M74 A;  4FX0 A;  4UVA A;  2MC3 A;  4JBA A;  2HTS A;  1ZLJ A;  2QEN A;  1O57 A;  3EQL F;  4ESB A;  1R36 A;  1Q1H A;  1JXS A;  1QO0 D;  4LB6 B;  4GYG A;  4EM0 B;  1B59 A;  2DK8 A;  5E17 F;  3WGG A;  2HFH A;  4FT8 A;  3TO9 A;  4G7O F;  1IRF A;  4PGH A;  4BAY A;  3NQO A;  4AIH A;  1S7A A;  4CZZ A;  5DD4 A;  5BS6 A;  1F4K A;  4ASN A;  5FGM A;  1ZRD A;  3R0A A;  4MQV A;  3ZMS A;  2DBB A;  2FA5 A;  2RV8 A;  4FX4 A;  3K0L A;  3KP2 A;  3BDD A;  1ZGA A;  4RB2 C;  4RAY A;  3BZ6 A;  3QU6 A;  3N97 A;  4MNU A;  3LQR A;  2LKP A;  1IN6 A;  5E1X A;  3BPX A;  1YFH A;  3TOB A;  4E70 A;  3SFZ A;  4UNO A;  4P55 A;  3H92 A;  3MAJ A;  3IWZ A;  4B09 A;  3WGI A;  1L0O C;  1U3E M;  3WG9 A;  3MFK A;  2HTJ A;  4ZZL A;  1KU7 A;  3HOT A;  3F8M A;  4HF1 A;  2UXX A;  1FWZ A;  5J8C A;  1PP8 F;  2VXZ A;  3CJN A;  2V1X A;  2O0Y A;  1BIA A;  2K86 A;  5FD6 A;  2FMY A;  4G94 A;  3HTU A;  1BC8 C;  3HYI A;  3WOD F;  2H6B A;  2J5P A;  2CGP A;  4HW0 A;  4NB5 A;  1WKM A;  3ZPL A;  3CUO A;  1J75 A;  4ZYE A;  2ZME A;  1SFX A;  5D5W B;  1LDJ A;  1B9M A;  1XDS A;  1Z9C A;  1V4R A;  1IF1 A;  3BJA A;  1OYY A;  3KP3 A;  4ENM A;  3DP7 A;  5IT3 A;  1KU2 A;  2XAQ A;  5J6X A;  4YG2 F;  2DQL A;  3ZMZ A;  4A12 A;  4YFK F;  1OYI A;  1FYM A;  1W7P A;  2DT5 A;  3FM3 A;  2KIF A;  1AWC A;  4ZYD A;  4OMY A;  1O7F A;  2F5D A;  3F8F A;  3GZ5 A;  1TBX A;  2ISZ A;  2G7U A;  2DPD A;  2P6T A;  4BNC A;  1T2K A;  4OIN F;  2QBY B;  2TDX A;  1ZG5 A;  2FNP A;  2ESN A;  4RS8 A;  1K78 A;  1IZ1 A;  3WTS C;  3CTA A;  4BXU A;  3HSF A;  1IW7 F;  3P9I A;  1SD7 A;  5LGN A;  2IW5 A;  3E5Q A;  2XAS A;  3FHZ A;  1D8K A;  4IRI A;  3KET A;  1HSJ A;  1G3Y A;  1TNT A;  3GW2 A;  2GAU A;  2X0L A;  4EMS A;  1W7P D;  2ZXJ A;  3L2C A;  1T0F A;  1B6A A;  1IUY A;  3CUQ A;  1B9N A;  3H3Z A;  3VB2 A;  5CVV A;  4MHG A;  5DCM B;  1SAX A;  5FFX A;  1ON1 A;  1H9G A;  4NHJ A;  2EFW A;  1IRG A;  3ZMU A;  2KKO A;  4AIJ A;  5HLH A;  2PFB A;  1USS A;  2UZK A;  3F72 A;  3REO A;  1Z1D A;  3CO6 C;  3K1P A;  4HLX A;  3ZMT A;  2MH9 A;  2ETH A;  3GFI A;  1FBS A;  4KUM A;  2W25 A;  4F7Z A;  4Y17 A;  1ZHF A;  4EJT A;  2P7C B;  2VOD A;  2DU9 A;  1O3S A;  4EQQ A;  1RI7 A;  4P96 A;  3LAJ A;  5H20 A;  2P4W A;  1BI0 A;  1IXR C;  2QQ9 A;  2F5E A;  1FX7 A;  2VOP A;  3F21 A;  3V8J A;  3M7G A;  4RAZ A;  3BP8 A;  4MTD A;  3DV8 A;  3OV8 A;  2FE3 A;  2A69 F;  2FU4 A;  5DUI A;  2HWV A;  4DNC A;  4KMF A;  4XRF A;  5BPI A;  4LLN A;  4G6Q A;  5ICF A;  2RGV A;  4A5N A;  3ISP A;  4A5M A;  3JSO A;  5HS7 A;  3E3V A;  1FP1 D;  2IRF G;  2ACJ A;  3NRV A;  4ENJ A;  1XCV A;  3SHF A;  3RTR A;  3SXY A;  2Z9O A;  3F8N A;  3K1N A;  2L01 A;  3M1E A;  4WCG A;  2P8T A;  1WQ2 A;  2GIV A;  5CYV A;  5K5Q A;  3U1D A;  1U6G A;  3EDP A;  5DUK A;  2UXN A;  1OYW A;  2QM3 A;  5D8L B;  5DV5 A;  3B02 A;  3TQN A;  5D5U B;  1LDK B;  1IN5 A;  2BEO A;  4I7H A;  2MH2 A;  3IHU A;  1P4W A;  4LK1 F;  3V8L A;  3CUQ C;  1MJ9 A;  2L54 A;  2GXB A;  2KRF A;  1AOY A;  2HYF A;  4LLL A;  5BMZ A;  1U5T B;  3I4P A;  2OD5 A;  2MLK A;  4I02 A;  3MQ0 A;  1KYZ A;  1IN7 A;  1HKS A;  2W85 A;  4YIF A;  3WE2 A;  1GXP A;  4AD9 A;  2KJC A;  2IA0 A;  5JHU A;  1HW2 A;  1BC7 C;  4JK1 X;  4ON0 A;  1XGO A;  3C18 A;  3IL2 A;  3ECO A;  3HRU A;  2EA4 A;  4WF2 A;  5AIQ A;  1KQ8 A;  3GO5 A;  1D5V A;  5HLI A;  5EEH A;  4KDP A;  3RKW A;  4L9J A;  3DKW A;  3U2R A;  2AS5 F;  1RIO H;  5IT9 K;  4IVN A;  1SD6 A;  5FD5 A;  3P9C A;  3QPT A;  1ZH5 A;  1HQC A;  2XAF A;  5LRS A;  4S05 A;  1ULY A;  4G6D A;  2RKH A;  4P9F A;  1DPR A;  3DPL C;  3L7W A;  1EH6 A;  1G3T A;  2VOO A;  3K9T A;  2DI3 A;  4RB0 A;  4L5J A;  5LHG A;  2ZBK A;  2IPQ X;  2L3D A;  4WXD A;  3M9A A;  3OOP A;  4O5V A;  5H6R A;  1D3Y A;  1ZG1 A;  3MZY A;  2H6C A;  1FZP B;  5ED4 A;  2ZKZ A;  2HDC A;  1QZY A;  1P2F A;  2Z3Y A;  4KA4 A;  3P9K A;  1XGM A;  2XHK A;  2EV6 A;  2WV0 A;  1JGS A;  1W5S A;  2HQN A;  1XSD A;  2WWY A;  3F22 A;  1LVA A;  4U0W A;  1K78 B;  3VEP A;  4OIO F;  4L0Y B;  2P5L C;  5E1W A;  4CGZ A;  2CYY A;  3N4M A;  2BV6 A;  4Q47 A;  2HOE A;  2OZ6 A;  3PQJ A;  3ZMD A;  1YYV A;  2JT1 A;  2XAH A;  2QQB A;  3MZH A;  3QPH A;  4IJA A;  3Q5F A;  3WTV C;  1DDN A;  4Q4Z F;  2V9V A;  1REP C;  1KA8 A;  2Q0O A;  2HYG D;  2CWE A;  2STT A;  3E6M A;  3R0J A;  1ON2 A;  2CW0 F;  5DD8 A;  2PN6 A;  1YW7 A;  2HKO A;  1BBY A;  4AWX B;  5LGT A;  1OR7 A;  2BE5 F;  4R79 A;  1R23 A;  3GF2 A;  3LQQ A;  5LHI A;  2DFI A;  3L9F A;  5CVR A;  3KZY A;  3WU0 A;  4EGY A;  1OPC A;  3GFJ A;  4HDU A;  4HZF A;  2V1U A;  5JI6 A;  3FMS A;  2FQ3 A;  1MZB A;  5K1Y A;  3E5U A;  5L3D A;  1SMY F;  2EA2 A;  1QGP A;  4KT5 C;  1S29 A;  3FZV A;  3I54 A;  2L4M A;  4R1H A;  1XGN A;  3HHG A;  2CG4 A;  1BIB A;  1FP2 A;  1FNN A;  1KQ9 A;  2EFP A;  2ESH A;  3JAM K;  2XKP A;  1MDM A;  1TW2 A;  2EFQ A;  3WTX C;  3IWF A;  3R61 A;  1MD0 A;  2PQ8 A;  4MEX F;  1WWX A;  3NEU A;  2QLZ A;  4RGS A;  4H0E A;  3IKV A;  1KGS A;  2H09 A;  2GWR A;  3RYR A;  5DCF A;  2FOK A;  3GYH X;  2STW A;  3GLX A;  4U0V A;  2VN2 A;  3E5X A;  4HQE A;  1W4M A;  1R00 A;  2CO5 A;  6PAX A;  1FYL A;  2E7W A;  4ZH4 F;  1MJA A;  5D5X B;  3BRO A;  4EJO A;  1KQ0 A;  1T6S A;  1BI3 A;  4Y13 A;  1ZRF A;  4LMY A;  2YU3 A;  2WTE A;  5D5V B;  4Q5S F;  4NQW A;  3I53 A;  4OIQ F;  3I0T A;  4A2U A;  1ZRE A;  1B1B A;  5D4S A;  1J59 A;  4I2O A;  5FLX Z;  4M71 A;  1YW9 A;  1I5Z A;  1UHM A;  1BI2 A;  5A2Q K;  2DW4 A;  1RZ4 A;  4OOI A;  5E1Z B;  5ERI A;  4HQM A;  5E20 A;  3RJP A;  5IT9 Z;  3F8C A;  2ZNY A;  4HX7 A;  2EB7 A;  1J0R A;  1S3J A;  1Z7U A;  1OMI A;  2FBH A;  3R4K A;  3T1B A;  5TRD A;  3I59 A;  4WXH A;  4MGR A;  4RGX A;  1J9I A;  5J8F A;  5EEG A;  5CJ9 A;  3L00 A;  1K79 A;  2P7V B;  4ZZD A;  2GA1 A;  2CQK A;  3G3Z A;  2UWM A;  2M1B A;  2FML A;  3RDI A;  5E8G A;  3KLO A;  5K5R A;  2FSW A;  2M87 A;  4HA8 A;  4OMZ A;  3TO7 A;  5ICC A;  2EFO A;  2QQA A;  1PP7 U;  4U88 A;  3JTG A;  2EV0 A;  3BWG A;  2QZ8 A;  4LFU A;  3F6O A;  1ZAO A;  4LG0 A;  3T8T A;  1YS7 A;  2DTR A;  1L3L A;  4FHT A;  1XCB A;  5BQT A;  2PMH A;  2LNB A;  1B4A A;  1I6X A;  4UUV A;  1G3S A;  1EH7 A;  1CGP A;  2HEO A;  5TJJ A;  2EK5 A;  5E18 F;  3F6V A;  1I27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...