2EFWA

Crystal structure of the rtp:nrb complex from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An asymmetric structure of the Bacillus subtilis replication terminator protein in complex with DNA
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication/dna
molecule keywords DNA (5'-D(*DCP*DT*DAP*DTP*DGP*DTP*DAP*DCP*DCP*DAP*DAP*DAP*DT
total genus 40
structure length 115
sequence length 115
chains with identical sequence B, F, G
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2efwA00
1ZHFA 2K02A 2IA1A 2QYOA 3DQVC 3GF2A 3ZP5A 1UB9A 1V4RA 4EM2A 5ICFA 1HW2A 4HZFA 2XHKA 1HQCA 4Q4ZF 3I59B 5CVIA 2PJPA 4M9XA 1T38A 5E8GA 4IXAA 4DQ2A 3FXRA 3F8FA 2XAJA 3E97A 3RJPA 1B4AA 1HW5A 1I1SA 4M72A 4AIHA 4A5MA 3F22A 3F72A 1LEAA 1R1UA 3LSTA 1FX7A 5BMZA 4L18B 4G7OF 3WTXC 5CJ9A 4AVPA 3WTUC 2F5FA 4ENKA 3KZYA 5ICEA 2MA3A 1JGSA 1XD7A 4KN7X 1DPRA 2DTRA 4LG0B 2IRFG 2QQ9A 4S05A 1R1VA 4L9TA 2EA2A 1QBJA 1VTNC 3QPTA 5DUIA 1WKMA 1K6OA 3U9GA 2Z9OA 1QQIA 2CQKA 3LAJA 4I2OA 2O3FA 5H6QA 2WWYA 2E1NA 2HGCA 3FXUA 1HW1A 2LDUA 1Q1HA 1SAXA 2DK8A 3ULQB 2HYFA 1KU3A 5DCMB 2CYYA 4JBAA 2VC1A 3F6OA 3KETA 4HW0A 2HQNA 3T8RA 5J6XA 5JHUA 3GFJA 1SD5A 3IL2A 4KIGA 4FHTA 3MFKA 1BIAA 4RGRA 2EJRA 3RKWA 4F7ZA 2DI3A 1IAWA 3SHFA 2K7LA 5CVUA 5FO5A 3E3VA 2VE8A 5J8FA 2Z33A 1FWZA 1DP7P 2ISYA 2M1BA 4XLNF 1MDMB 1W5SA 2H6BA 1KGSA 2BBYA 4HOBA 1BC8C 2EFOA 1IN8A 4I0BA 3TOBA 1IZ1A 4KIBA 2GZWA 4KIFA 3ZMUA 3ZQ7A 1SFXA 4ASNA 5HDNA 1FYMA 1CGPA 1R00A 3ELKA 3ZMSA 1FBQA 3EETA 5K5OA 3M1EA 4PDKA 1KU2A 3M8EA 4R1HA 2JRTA 4WXCA 1EV7A 2P8TA 5D6FA 2FBHA 1FSEA 1S8NA 3M9AA 4A6EA 2F5DA 2IVMA 2KIUA 2P6SA 4RGXA 4HF2A 3I59A 4L9NA 2YU3A 2COMA 1R23A 4JK1X 1YYVA 3V7RA 2O6GE 4Y15A 3LAPA 1OMIA 4EVIA 4K2EA 4MTEA 3SXYA 4EV0A 1CF7B 4I7HA 5HS9A 4KNYA 2ZJ2A 5DV5A 1HSJA 2YPRA 5A2QZ 3TDUC 3FZVA 2XROA 4EGZA 2BGCA 2QM3A 3D0SA 1W7PA 2E1CA 4OIQF 2HKXA 2UZKA 2LF7A 2ZO4A 4OINF 4G9YA 3DV8A 4HLYA 2PQ8A 2QWWA 1QO0D 1IN6A 4OOIA 3ZMVA 1J0RA 2P7VB 4IRIA 2HDCA 1LDDA 4EJWA 2KIMA 4G6DA 3JAMK 4IJAA 1ZRCA 2JPBA 2FMYA 3I71A 2IJLA 3NEUA 5TRDA 1KQ8A 1JHHA 3GVAA 4BXUA 4GYIA 3BWGA 1MJBA 3TGNA 4WCGA 4OIRF 1FLIA 1D8JA 4AWXB 1XGNA 2ZNYA 5LRRA 4ZZDA 4I0AA 2HTJA 2XKOA 1AOYA 2DPUA 3FM3A 1QZYA 3P9CA 2EK5A 2FXAA 3IHUA 4HA8A 1P4WA 5CVRA 1YTYA 1BC7C 1QNTA 2P5KA 4G7ZF 1OYIA 2QLZA 2FBIA 1U5TA 1J59A 4YFNF 1JE8A 2FNAA 3T0YA 5D4RA 4H0EA 2OBPA 3WE3A 1W7PD 1UCRA 4KT5C 5F1RA 3I5UA 1CF7A 2DO7A 4MHGA 5FLXZ 3VEPA 1BI0A 4KFCA 2QVOA 4Q5SF 2PEXA 3R0AA 1H0MA 3KFWX 5CVJA 1Z05A 4HF1A 2XASA 1TQPA 1FYLA 2F2EA 2D45A 2HFHA 1Z1DA 1SD6A 3P9IA 3BPVA 5L3GA 2FU4A 2E7XA 2LSOA 3WTYC 4L5JA 2HZTA 2G9WA 1P6RA 2OD5A 1C0WA 1F9NA 3QRFF 2O03A 3GEZA 2R3SA 3GO5A 1R7JA 3GZ5A 4G8XA 4YFKF 2RNJA 1K79A 1TNSA 3I58A 2V79A 2OAZA 3V7SA 4FT8A 1EH6A 3RTRA 3O3KA 2OU2A 3EUHA 4G6QA 1MJ9A 3FWEA 1RUOA 2A5YB 1P4XA 2VOOA 1XSXA 1A04A 1BJAA 4RB1A 2DBBA 1AWCA 2NNYA 3O6BB 3K0LA 3E5QA 1YW7A 2MH9A 3B02A 3JTHA 4P55A 3J80K 4O5VA 1USTA 4U88A 1XMAA 1YS6A 2HOEA 3MEXA 3I53A 5ED4A 3KP6A 1RZ4A 2A6EF 3F8NA 3QP5A 5BPIA 2GA1A 5D6EA 2W24A 5D4SA 4U0VA 4LK0F 1SMYF 1WI9A 1J5YA 4IVNA 1FNNA 2STTA 1WRJA 3KP3A 4P5OA 3WGHA 1ZLJA 1IXCA 5DD8A 2FQ3A 3DXJF 2DK5A 3JSOA 2Q2EA 2AS5F 5DYMA 3R0JA 4KICA 5ILSA 3HHGA 3RYRA 4QWQA 1RUNA 4E70A 3RIRA 1MD0A 2NYXA 3Q9VA 2ZMEA 3FMQA 1T2KA 3J81K 4OU0A 4M9SA 3WE2A 1FY7A 1P2FA 3P7NA 2X4HA 1QZZA 4BYYA 2RKHA 3GLXA 3MZYA 1FYKA 3CJNA 3SFZA 5LRSA 3R4KA 2RVCA 1KU9A 1D3YA 1SFUA 3IRRA 4HX7A 2FBKA 1TQIA 4BAYA 2V9VA 2L3DA 2ACJA 1I1GA 2ZBKA 2V1DA 2ZFWA 5JVTA 1XGMA 4R79A 3CUOA 3ERED 5FD5A 1BN5A 1KYWA 3GWZA 4BQAA 2BE5F 2QENA 5DUKA 2HQRA 2NNNA 3HSEA 3KCCA 1TNTA 5BQTA 4LGWA 5ERIA 2P4WA 2FE3A 4MEXF 5FLXK 4ESBA 2R7FA 1RIOH 4LG0A 2QUFA 3TO6A 1MJAA 1FBUA 2FA5A 4BHBA 5EEHA 4XSXF 5F64A 3LWFA 3M8FA 4TV7A 2IPQX 5BOXA 1F5TA 4S04A 3HYIA 3KP2A 4EMSA 1BOAA 1QGPA 3I4PA 1ZYRF 1YW8A 3J80Z 1S6LA 2EA4A 4ETSA 3ZPLA 1YQAA 4ZYGA 5DCMA 4WX9A 2YX7A 2VOPA 1OR7A 3QPHA 5L3DA 4ZZLA 4IRHA 2ZMEB 4UHTA 5AONA 1X3UA 3TO9A 4CICA 2NS0A 1RI7A 4GXOA 2UXNA 3IKVA 3HRMA 4JQFA 1J7KA 4U0YA 5IT3A 1DUXC 5HS7A 2ELHA 2W57A 4YIIA 4GYGA 1F4KA 3NRVA 3TOAA 1PP8F 3CUQB 3BROA 4D0PA 2WTEA 1GVJA 1T0FA 2VXZA 5HS8A 3L00A 3CDHA 3F21A 2KJBA 4KN4X 2XAQA 3WTZA 4ZYEA 3ZMZA 2GA2A 1B6AA 2GIVA 4LB6B 4CYDA 4FX4A 4KDPA 2Z3YA 2ZNZA 1E17A 3I64A 4P9FA 5CYVA 2L4AA 3FX3A 1O3QA 5K1YA 2XVCA 2EFWA 3LQQA 4MQVA 3K2ZA 4G7HF 1W7PB 2RQPA 5KVRA 2FRHA 5KK1A 4A0ZA 3ECOA 2DFIA 2CG4A 2HTSA 1S7OA 5HDGA 1IXSB 3HUGA 2VBYA 3IWFA 2XAGA 5JFRA 2JTVA 4ZYHA 4XSZF 1S7AA 2H09A 3HTUA 3EYYA 3BJ6A 1BI1A 1KQ9A 1FP1D 2VN2A 3K9TA 2HS5A 2LNBA 3I0TA 4XLPF 1K7AA 1ZN2A 1OPCA 1IXRC 1EH7A 4QLCU 4I01A 3J81Z 2CGPA 2VC0A 3BOQA 5LEJA 2OZUA 1KA8A 5E8IA 4UVCA 4OIOF 3WU0A 3BDDA 3IWZA 5J8CA 4A6DA 1GXQA 1MGTA 3MWMA 1XDUA 2TDXA 1ZRFA 2EWNA 3HSRA 1G3YA 4DNCA 1RNLA 5E1XA 5FB2A 1GHCA 3RPQA 2IA0A 1LDJA 1USSA 2KIFA 1E2XA 1U8RA 3CUQC 2K4BA 2WC2A 1S29A 2NAZA 1MDMA 5JI6A 2W85A 3H3ZA 1TW2A 4BNCA 5LGTA 3N4MA 4O3MA 4M73A 4LD5A 5DD4A 3GW2A 4M9ZA 4EM0B 4LMYA 4RB3C 4HYEA 3CO7C 4GCVA 3S2WA 1B1BA 5E20A 1ZREA 4ENNA 3QOPA 1W4MA 4BHPA 3KEOA 1TLHB 4YIFA 2CWEA 1TQMA 3DPTA 3MZHA 3FF5A 3R60A 2GQQA 3RDIA 1ZGJA 2L4MA 3DPLC 3R61A 2NRAC 4PZJA 4L0YB 4RS8A 3TKYA 4HAMA 3KP4A 4NQWA 1U5TB 1U5TC 3C7JA 1XSVA 2H94A 3EYIA 1FSHA 3MCZA 3ZMTA 4LJZF 5IT9K 2F5EA 1XB4A 2JPCA 5LGUA 4M6XA 3KE2A 2VT3A 4L0ZB 1ODDA 4ENMA 4KMUX 3H92A 2DW4A 5HLGA 3HRUA 2B0LA 3NQOA 1O7FA 3JW4A 4PGGA 3G3ZA 1J9IA 3GFMA 4WXHA 4M6YA 2CSOA 3PFIA 5LHGA 1EH8A 1IRGA 2DAOA 1FT9A 3HOTA 2Z5UA 4B8XA 3C1DA 1LB2A 2HWVA 2EB7A 2QBYB 4CO8A 1KQ0A 3CO6C 4N9IA 3IC7A 5DCFA 5JR3A 5E18F 2ZCWA 5AIPA 4Q47A 2BV6A 3OV8A 1G3TA 4ON0A 2J5PA 4LFUA 5D5WB 3QU6A 4FX0A 3V4GA 2PMUA 4AIKA 1FC3A 1HKSA 5D5XB 5LLQA 4XRFA 1SFEA 3LA7A 1ZG5A 1GXPA 4RAYA 2MC3A 2O0YA 4HDUA 1YS7A 5TJJA 3DKWA 4UNOA 2GXGA 5D5UB 1YLFA 2M30A 3H3UA 2VBWA 4OIPF 3U2RA 1U2WA 1HSTA 2K27A 2D1VA 4GO1A 1U78A 3C18A 1IUYA 3G73A 1ONVA 1LVAA 3KLOA 1STZA 4NB5A 2JT1A 4IF4A 1Z9CA 4MGRA 4A0XA 4HLXA 2M8EA 3Q5FA 1L0OC 4ENJA 5HDKA 5CLSA 5AIQA 1XMKA 2Z99A 3VOEA 5FFXA 3W6KB 2A6HF 2PFBA 4R8HA 1R36A 4YG2F 2K86A 1P4AA 1WWXA 1TW3A 2JSCA 6PAXA 1FZPB 4BH9A 5HLIA 2G7HA 5LEKA 4HX4A 1Z7UA 1Z6TA 5ICGA 3HRSA 2QBYA 1K78B 2HKOA 3J7AO 2XAFA 1I5ZA 1XGSA 4UUVA 1R22A 2XKPA 3GUDA 3E5UA 3FMSA 3TQNA 4N0BA 4HQEA 5FFZA 2L02A 1T39A 2ZXJA 2YR2A 3WTVC 1F1ZA 3DEUA 2R7DA 3QP6A 4CDGA 2MLKA 1DPUA 2ETHA 3WGIA 1ZARA 4AD9A 1MZBA 2YSRA 1HKTA 4LB5A 4I98B 1TTYA 5DDGA 3ZN0A 3F23A 2O61A 1BM9A 4RAZA 3IRQA 1WQ2A 4B09A 3E6CC 2W25A 4IHSA 4L9JA 1REPC 4CZZA 3DF8A 1XSDA 4LLGF 3N97A 5LHIA 1HBXG 1XCBA 3KP5A 2Q8KA 3SZPA 5HVQC 3Q9SA 5F6FA 2XIGA 1O57A 1ZLKA 3K69A 4UXNA 4CXFA 1BI3A 3KZZA 4LK1F 2MH2A 3CLOA 4ESJA 3L09A 1YG2A 1Z6RA 4A12A 3F8MA 3L2CA 1IN5A 2PBIA 4EJOA 4WXDA 3D5LA 5LGNA 1OYWA 4HDVA 3F8BA 2QQAA 2V1UA 4PCQA 2KJCA 4I02A 4EJVA 4EM1A 4UVAA 1R1TA 2ISZA 1JHFA 2EV0A 5L3FA 3KEQA 1YW9A 2STWA 3P9KA 3K1MA 4BHCA 3T5XA 4CGZA 4L5IA 3FM5A 4RGSA 3AAFA 1G3WA 4M71A 3DFGA 2L54A 2Y0MA 5CVVA 2OZ6A 1I6XA 2EV5A 4IHTA 3I54A 1LJ9A 5BPDA 5ICCA 1ZH5A 4KA4A 2VT2A 4I09A 1R5HA 3BJAA 2HEOA 2XAHA 4N9HA 5H6RA 1O3RA 3WG9A 3BP8A 3LQRA 4EQQA 3IKTA 5D8KB 1ON2A 2OA4A 3ECHA 1IN4A 2XV4S 4A0YA 4HQMA 2P6TA 2GWRA 4RB2C 4IRGA 2M45A 3HOSA 4IPAA 1NHAA 3WODF 1D8KA 2FOKA 2ZKZA 2CFXA 3FHZA 3K1NA 4UV9A 2FNPA 2YX4A 3RKYA 5LHHA 2PG4A 3K1PA 1H9GA 2AXLA 2UWMA 3T1BA 3GX4X 4ZYDA 4AIJA 3SZTA 4A5NA 5IT9Z 2GAUA 2VE9A 3FXQA 1UHWA 4P9UA 4LLNA 2PN6A 5DEQA 4ZH4F 3CUQA 1JXSA 3E6DA 1UFMA 1B9MA 4UVBA 2W84A 1ULYA 2BEOA 1B9NA 1QPMA 2VBXA 2D2WA 2VBZA 2A07F 3RPUA 3WGGA 2Y48A 3LA3A 1LDKB 3C3WA 5FD6A 1DDNA 4HBLA 1H9TA 4OMZA 2V1XA 3OOPA 4EGYA 1Z91A 2IP2A 1YO5C 2KRFA 2IT0A 3TDZC 4EJUA 3WTSC 5HOOA 3E5XA 2KKOA 4MEYF 2G7UA 3BPXA 2VODA 3ISPA 4OMYA 3L9FA 5EEGA 4O6JA 3GXOA 2OQGA 4Q48A 5L3EA 2LKPA 3KP7A 1SMTA 1OYYA 3HHHA 1W5TA 2CW0F 3EDPA 2GXBA 2P5LC 4Y13A 1XDSA 4CHUA 4KYWA 2M87A 4U0WA 1Y0UA 4A2UA 1UHMA 1BIBA 4WWCA 3W6JB 2Q0OA 3ML6A 4U7DA 3GFIA 4L9VA 2FF4A 1TBXA 2BYVE 5BS6A 2QQBA 4HF0A 1D5VA 1KU7A 5LBQA 3E6MA 4PGHA 3F3XA 5HLHA 1O3SA 4P96A 4U7BA 1V3FA 3R6SA 3QU3A 3O2PE 3GYHX 1YFHA 4GGGA 3RI4A 2PLYA 5L3BA 2V6CA 2DQLA 4G94A 4KMFA 1PP7U 1HXDA 3REOA 3VB2A 3WU1B 2E7WA 1P92A 1XGOA 3BJOA 1SD7A 3ABUA 4HV5A 2RV8A 2MBFA 3L7WA 4RB0A 5A2QK 1K78A 2A3SA 2MLGA 2EV6A 5L3CA 2CO5A 2RC4A 5D8LB 2OQRA 5H20A 1XCVA 2PI0A 4NHJA 1FOKA 3PQKA 2RN7A 3HRTA 2JZYA 2WV0A 2D1HA 3MQ0A 4LLLA 2RDPA 1ZG3A 2P5VA 3HTSB 3F6VA 5FGMA 1J2XA 3LA2A 2DU9A 2F5CA 2HYGD 2XUBA 3ZMDA 4ESFA 2DT5A 3T8TA 4Z2YA 3WTTC 3RKXA 4HX8A 4MNUA 3PQJA 1J75A 3JAMZ 1HKQA 5E1ZB 2ESHA 1OKRA 3KLNA 3F8CA 1BI2A 1PDNC 3GZ6A 1I27A 4HV6A 2H6CA 3QAHA 2EFQA 1U3EM 2DQRA 2DLLA 1G6NA 4UV8A 1G4DA 3HSFA 2FSWA 2P7CB 1S3JA 1L3LA 2QZ8A 2K4JA 2ADUA 3V7CA 4Y17A 2O8XA 3WTWC 2XRNA 1IF1A 5E1WA 3DP7A 3MAJA 3B73A 4WK8F 3V8JA 2EFPA 2MD5A 2UXXA 3M7GA 2EFNA 1R5GA 1SD4A 3E6BA 3ROUA 4XBFA 1ZGAA 1XN7A 1IW7F 3TO7A 1G3SA 4WF2A 4KUMA 2DPDA 5ILUA 4RGUA 1LNWA 1O3TA 1FPQA 5ILVA 3U1DA 2RGVA 2J5OA 1ZRDA 3BZ6A 5K5RA 1T6SA 2IA2A 1IRFA 3VFZA 5K5QA 3ZN1A 1FP2A 1ZAOA 2C6YA 2FMLA 1BBYA 3GFLA 3HIFA 1FBSA 1LQ1A 4EJTA 1IN7A 2L01A 4YFXF 2HR3A 4M74A 3SQNA 3RYPA 1T98A 2H27A 3CTAA 3EQLF 3JSPA 5E17F 1ON1A 2FEZA 4MTDA 2A61A 3COAC 3FMRA 3BY6A 3VODA 2Y75A 2VONA 1U6GA 1B59A 1O7LA 3LFKA 1YIOA 1WSUA 2A69F 1MKMA 1ZG1A 4MQ9F 3V8LA 2ESNA 3JTGA 3V8KA 1R58A 2X0LA 2IW5A 2LF8A 2XGXA 3ABTA 2A68F 2M5WA 5D5VB 2PMHA 1LEBA 1KYZA 1PUEE
chains in the Genus database with same CATH superfamily
1ZHFA 2K02A 3BQZA 2IA1A 4N4NB 2QYOA 3DQVC 3GF2A 4KJZA 3ZP5A 1IO2A 1UB9A 2M4GA 1V4RA 4EM2A 5ICFA 5DS9A 1HW2A 2PMZA 4HZFA 2OCEA 1P9QC 3FISA 2XHKA 1HQCA 3HOWJ 1J09A 4XNFA 4NUBA 4Q4ZF 2FD5A 3I59B 4PFPA 5CVIA 2WY7Q 2PJPA 3RCOA 1OFCX 2DT7B 4M9XA 1T38A 5E8GA 4IXAA 4DQ2A 3FXRA 3OMYA 3F8FA 2V9KA 1XG1A 2XAJA 3PNYA 3E97A 3G1LA 3RJPA 1B4AA 2DFHA 1R4NB 1HW5A 1I1SA 1JKPC 1VQKI 2HNHA 4M72A 3G71I 4AIHA 4DYRA 3ESWB 4A5MA 3F22A 3F72A 1LEAA 1LKXA 1R1UA 3CP2A 2XSJC 4BY7J 3AG4H 3H9QA 2KHMA 3V42A 3RKQA 3LSTA 3BTJA 1FX7A 5BMZA 4L18B 4G7OF 3WTXC 5CJ9A 4AVPA 4DW6A 5IP9J 3WTUC 2F5FA 1AA7A 2ID6A 2K85A 1T8IA 4C3IJ 4ENKA 3KZYA 2XF7A 5ICEA 2MA3A 2L2OA 1JGSA 1PJRA 1XD7A 3DWLE 4KN7X 1VQNI 1DPRA 2DTRA 3S1MJ 4BBRJ 2BXYA 1LVKA 1YX3A 3IUOA 4RBOA 1TL8A 4LG0B 2IRFG 1ETYA 2QQ9A 4S05A 3HGGA 2JA8J 1R1VA 4L9TA 2EA2A 2K3FA 3H1CA 1QBJA 1VTNC 3QPTA 5DUIA 1WKMA 3FK6A 1K6OA 2RNGA 5E3MA 2L9VA 2DDBA 3U9GA 3S3NA 2DOAA 1QQIA 2CQKA 2Z9OA 3LAJA 5KHDA 4I2OA 2O3FA 2B9SA 5H6QA 5KAIC 1OQYA 3MKYB 3WG7H 2WWYA 2M7AA 2E1NA 3UNGC 1MMGA 2HGCA 3S93A 3G4SI 3FXUA 1HW1A 2LDUA 1Q1HA 1SAXA 3I56I 2VL8A 2DK8A 3ULQB 2HYFA 1KU3A 5DCMB 2CYYA 3LMMA 4JBAA 2VC1A 4F92B 3ASNH 3F6OA 4HW0A 2HQNA 3T8RA 3KETA 5J6XA 4F93B 5JHUA 3GFJA 4AIDA 5IYDJ 1SD5A 3IL2A 1IGNA 4KIGA 2VPRA 4FHTA 3MFKA 3Q0WA 3JREA 1BIAA 4YIRX 3QYEA 4RGRA 2EJRA 3RKWA 4DGWB 2BXZA 1V5GA 1IG7A 4C2UA 4F7ZA 1N25A 2IEKA 2DI3A 1IAWA 1OLTA 3TMOA 3SHFA 2K7LA 5CVUA 3D5RC 5FO5A 3E3VA 2CV0A 2VE8A 3OSFA 5J8FA 2Z33A 1FWZA 1DP7P 3TP0A 2ISYA 2JK3A 5JVGF 2KFDA 2M1BA 1OCPA 4XLNF 1MDMB 1W5SA 1WJAA 2H6BA 1KGSA 4XICA 1WGXA 1HCRA 2DDAA 2BBYA 2V26A 2ID3A 4HOBA 1BC8C 2EFOA 1APLC 1SEUA 2H8RA 1XPXA 1IN8A 4I0BA 4PJ0C 3TOBA 2JA7J 4QIWN 3D5SC 2CH0A 2HDDA 2KPMA 2K9MA 1Y8RB 1IZ1A 4KIBA 2GZWA 4KIFA 4J00A 3ZMUA 3ZQ7A 2RAEA 2Y30A 1SFXA 4ASNA 1ZGWA 2GLOA 5HDNA 3ABLH 1FYMA 1CGPA 1R00A 1V55H 2BVMA 3ELKA 2LY9A 3ZMSA 5B1AH 4FTHA 3VPRA 1TC3C 1FBQA 3EETA 2LP0A 5K5OA 3M1EA 2I10A 3OYAA 5FKNA 4PDKA 1KU2A 4A3BJ 2KMUA 2CQNA 1JJ8C 1WH7A 4IHVA 5CQGA 3FKIJ 5IOZA 1MMSA 1LUJB 3BR6A 3M8EA 1MBKA 4R1HA 2JRTA 4A3DJ 4WXCA 1EV7A 2P8TA 3BLYA 2WY8Q 1X3ZB 5D6FA 1RC9A 4LG3A 2FBHA 1NK3P 5M5XJ 1FSEA 1S8NA 3M9AA 3FXLA 2VKHA 2CFOA 4A6EA 2F5DA 2IVMA 2KIUA 2P6SA 4UUTA 4AC0A 4B3XA 4D1QA 2XSDC 1VQMI 3BG3A 4RGXA 1RETA 4XRSG 4HF2A 3I59A 2JA5J 4L9NA 3VSLA 3PO3J 2YU3A 3L2WA 2COMA 3LFUA 2VKVA 3BG6A 2IS4A 1ZQ3P 1R23A 1WHUA 1MMAA 1MBEA 2VJ4A 4PSXA 4JK1X 3CCMI 1YYVA 3V7RA 2O6GE 3SZGA 2HPIA 4Y15A 3LAPA 4X1EA 2OF7A 5HNHA 4A3MJ 4PK4A 3A2KA 1OMIA 4BUPA 2MD0A 4EVIA 2HU9A 4K2EA 4MTEA 3SXYA 4EV0A 1CF7B 2ZXWH 3W2VA 2E5ZA 4I7HA 5HS9A 4KNYA 2ZJ2A 1TWCJ 1NK2P 2WBMA 4CSWA 5DV5A 1HSJA 2E34A 3M1CA 2V6EA 3CCSI 2MFZA 2YPRA 5A2QZ 3TDUC 3D1NI 2DMPA 3FZVA 2DJNA 2HVQA 2XROA 4KITB 3ZQLA 3CQZJ 4EGZA 2BGCA 2QM3A 1W36D 3D0SA 3IP4B 1W7PA 2E1CA 2XGEA 1X4PA 2VQCA 5IP7J 4OIQF 3S32A 2HKXA 1FOXA 1UZCA 2CW7A 2QEXI 2UZKA 2LF7A 5E3OA 2BW3B 3GZNB 1PYVA 2ZO4A 2JVGA 4OINF 5FKMA 4G9YA 3DV8A 4HLYA 2PQ8A 2QWWA 1QO0D 1IN6A 4OOIA 4CCKA 3ZMVA 2F48A 2E60A 1MSEC 1J0RA 2P7VB 3OL3A 4IRIA 3FXKA 2HDCA 4BXFA 4E6KG 2LLKA 4YEJA 1LDDA 1HA8A 4EJWA 2E1OA 3KIOA 2KIMA 4G6DA 1SC7A 4HSTA 3JAMK 4IJAA 1ZRCA 3OYJA 2JJ7A 2JPBA 4AU7A 2FMYA 3BC8A 2CQXA 1ETXA 3I71A 2IJLA 3LNQA 3NEUA 5TRDA 2L7MP 2RQQA 1KQ8A 2CW8A 1JHHA 3QQAA 1QVUA 1UJ8A 3GVAA 4BXUA 3BWGA 4GYIA 3CCYA 1FTTA 3UR3C 4AM3A 1MJBA 3TGNA 4WCGA 4OIRF 4DJAA 3HOUJ 1FLIA 1D8JA 4AWXB 1XGNA 5IPAA 1PUFA 2VUMJ 2ZNYA 2X9DA 1YE9A 5LRRA 4ZZDA 4I0AA 4V19K 2HTJA 2KT0A 1MBJA 1NTCA 3K6GA 3FDYA 2XKOA 2K3PA 3S15J 1AOYA 1FOYA 4QSHA 3FM3A 1QZYA 1D1AA 2DPUA 1N77A 3P9CA 3FK7A 2EK5A 2FXAA 3IHUA 3DBRB 2F4IA 4HA8A 4ANJA 1P4WA 3SYTA 4CCOA 2XRLA 5CVRA 1ZR2A 2DMNA 1YTYA 1LE8B 1BC7C 1W0UA 2O9LA 1QNTA 3LL7A 2P5KA 4G7ZF 1OYIA 2QLZA 2FBIA 3KX2A 1U5TA 2N8GA 3S1RJ 1J59A 3LOCA 4YFNF 1JE8A 2FNAA 3T0YA 2OBPA 5D4RA 3WE3A 4H0EA 2V4JC 4F55A 1W7PD 1UCRA 2KP6A 4KT5C 3ZGKA 1AHDP 5FROA 3JRBA 2AO9A 5F1RA 3I5UA 2FQ4A 1CF7A 4I6ZA 4LOCA 2DO7A 4MHGA 5FLXZ 4BL0B 3VEPA 1BI0A 3ZQCA 4FCYA 4BE0A 4RAGA 4KFCA 2QVOA 4Q5SF 2OTJI 2PEXA 3R0AA 3LSMA 1H0MA 1RPWA 4A69C 1JT6A 3KFWX 3H0DA 2K9LA 2I8DA 1Z0XA 2YUSA 2KRCA 3ERMA 1Z05A 5CVJA 1X19A 1WI3A 2XASA 1TQPA 3KEYA 1FYLA 4HF1A 4X6AJ 2F2EA 5E3NA 2D45A 2M3AA 2HFHA 1Z1DA 2E36A 4C3HJ 2GM4A 2LBFA 3BG5A 1SD6A 2QF7A 3P9IA 5J1RA 3BPVA 3DTIA 2IGMA 5L3GA 2FU4A 4XLHA 1FIPA 2E7XA 2LSOA 3WTYC 2CUZA 4EEFG 1Z3YA 4L5JA 2Y0SA 5J4YA 3CESA 2GOMA 2HZTA 2G9WA 1P6RA 2WV1A 2OD5A 3OYFA 4W97A 3DLLF 1C0WA 1I3QJ 2B63J 2NVYJ 1QA6A 5C44J 1YOVB 4B44A 1F9NA 3QRFF 2JQ7A 2FUG2 2O03A 5FKKA 3G6EI 3GEZA 2R3SA 5K7HA 3GO5A 1R7JA 3GZ5A 4G8XA 4YFKF 2RNJA 2JA2A 1WJDA 2LYCA 1K79A 3J7ZI 3W2AA 1TNSA 1V5EA 3DKYA 3I58A 2V79A 2OAZA 3DU6A 3V7SA 5K7FA 2E71A 1EH6A 4FT8A 3RTRA 3FIWA 3O3KA 3OR1C 2OU2A 1TT5B 3EUHA 2COBA 4G6QA 1MJ9A 3FWEA 3S14J 1RUOA 1A6QA 2JVHA 3PUBA 1GV2A 1LFPA 2A5YB 1P4XA 4AVZA 2VOOA 2WAQN 1XSXA 1A04A 1BJAA 4RB1A 2DBBA 1AWCA 1HDPA 2NNYA 3O6BB 2DYRH 1UG2A 3K0LA 2BY3A 3E5QA 5EG0B 3CC7I 2VASA 1YW7A 2MH9A 3B02A 3ZQGA 3JTHA 4P55A 2NXNB 3J80K 4O5VA 2QCOA 2HYJA 1USTA 3CCQI 4U88A 3S16J 2FOWA 1XMAA 1YS6A 3S3OA 1T0FC 1YJWI 2MW8A 4BXXJ 1H89C 2VI6A 3GMEA 2HOEA 3RZDJ 3MEXA 2H1LA 3I53A 4F52A 3UKGA 4I76A 5ED4A 1VQ8I 3KP6A 4DBRA 3HOYJ 4E7JA 1FMWA 1RZ4A 2A6EF 3F8NA 3QP5A 3HL2A 5BPIA 2GA1A 2P0WA 5J1UA 3OS2A 5D6EA 2W24A 2DJIA 5D4SA 4U0VA 4LK0F 1SMYF 1WI9A 4BGDA 1J5YA 4IVNA 1FNNA 2BVLA 2JRMA 4D7MA 2STTA 1WRJA 3KP3A 4JX4A 4P5OA 3WGHA 1ZLJA 1IXCA 2CJJA 5DD8A 2XF6A 2FQ3A 3DXJF 2B7EA 1N78A 4HSRA 2DK5A 2R7OA 2IGNA 2Q2EA 3JSOA 2AS5F 2VIXA 5DYMA 3R0JA 4KICA 3AL0C 2W1OA 1JT0A 1JGGA 4YELA 5ILSA 3HHGA 3RYRA 4QWQA 1VQ5I 3PIPF 1RUNA 2MG4A 4E70A 2BHYA 3RIRA 1EKEA 1MD0A 3LSIA 2EQRA 3BCAA 3GTLJ 2NYXA 3Q9VA 2ZMEA 3FMQA 1T2KA 3J81K 4OU0A 4M9SA 3WE2A 2QKLB 1FY7A 3H5AA 1MBFA 1P2FA 3P7NA 2QSFX 2X4HA 3MVPA 1QZZA 4B1RA 4BYYA 3GTGJ 4RLQA 3LSKA 4P1WA 2HXOA 2KDOA 2RKHA 3GLXA 4PUSA 3SFIA 3MZYA 2LY1A 2X6WA 1FYKA 4XLCA 3CJNA 3SFZA 1Y1WJ 2ECCA 5LRSA 3R4KA 2RVCA 1KU9A 2JWTA 1D3YA 4IO9F 3U1KA 1SFUA 2LTPA 3IRRA 4HX7A 2FBKA 1TQIA 4BAYA 4Y4RA 4JX6A 2V9VA 1WJFA 2L3DA 2LD5A 2ACJA 1POGA 1I1GA 2ZBKA 1I3AA 2V1DA 2ZFWA 1QPIA 3HDDA 3AFHA 5JVTA 1XGMA 4R79A 3CUOA 3VYTB 2QQ8A 3ERED 4IKFA 5FD5A 1BN5A 4U87A 1KYWA 1WPKA 3GWZA 4BQAA 1S7EA 3GTOJ 4LITA 2BE5F 2QENA 2IS6A 1F43A 1D0YA 5DUKA 1S5LC 1F36A 2HQRA 3I4MJ 5GPCA 3HM5A 2NNNA 3HSEA 3KCCA 2MSYA 1TNTA 2G0EA 4XN0A 5BQTA 4LGWA 1WCMJ 3PNTA 5ERIA 1YJ9I 2P4WA 2FE3A 3DTEA 3H5NA 4MEXF 3CZ6A 4L5EA 5FRNA 5FLXK 4ESBA 2R7FA 2HPMA 4IEJA 4HG2A 1RIOH 1MBHA 4LG0A 2QUFA 2JUGA 3TO6A 1MJAA 2R7QA 1FBUA 4ABZA 2FA5A 2MABA 4BHBA 1EF4A 5EEHA 1P7JA 4XSXF 4I99C 5F64A 2EH3A 3LWFA 3M8FA 4OAZA 4TV7A 3HUGB 4Y7NJ 3ABKH 4BKXA 4HEA2 2IPQX 5BOXA 2DT6A 1F5TA 4S04A 1RKTA 5J1YA 3VYRB 2DFFA 4HRIA 3HYIA 3KP2A 4BU2A 3O8HA 4EMSA 1BOAA 1QGPA 3PNVA 3I4PA 1ZYRF 5J40A 1YW8A 4D9JA 5B5EC 3J80Z 5HLTA 1S6LA 2EA4A 4ETSA 4DBQA 1EJ9A 3ZPLA 2R93J 1TWFJ 2CV2A 1YQAA 2LOOA 4ZYGA 5DCMA 4WX9A 2HI3A 2YX7A 1BA5A 3DPUA 3PFYA 2VOPA 1OR7A 4BEHB 4RLFA 5K7ZA 3QPHA 2GXAA 5L3DA 1WH5A 3MMYB 3G1OA 4XM3A 2NVTJ 4ZZLA 4IRHA 2ZMEB 4UHTA 5AONA 1X3UA 1ETVA 4MO7A 1ACIA 3TO9A 4A3KJ 3OYLA 4CICA 3TL4X 3E7LA 2F6CA 1MSFC 2X48A 2NS0A 4LIVA 3NARA 4XR6A 5JLWA 4A3FJ 1RI7A 4GXOA 2UXNA 3IKVA 3HRMA 3KPHA 4JQFA 3FXOA 3CDIA 1J7KA 4U0YA 1DU6A 5IT3A 2ELJA 1DUXC 4ZYAA 5HS7A 2ELHA 5BNGA 2W57A 4YIIA 4GYGA 3OSGA 1F4KA 5EF6A 3NRVA 2KZGA 3TOAA 2LK2A 1PP8F 3CUQB 2IXSA 3BROA 1X4OA 2WTEA 4D0PA 1GVJA 1T0FA 2VXZA 5HS8A 3L00A 2CUEA 2OPTA 3CDHA 3F21A 2DMUA 1OCTC 3K4CA 2KJBA 1LE8A 2X6OA 4AYBN 3HC7A 4KN4X 3MZ8A 2XAQA 3BQYA 1DU0A 3WTZA 4ZYEA 3ZMZA 4E7IA 2GA2A 1B6AA 2GIVA 4LB6B 4CYDA 4FX4A 1R5ID 2UV1A 3NAUA 4KDPA 2Z3YA 3PJRA 3PL8A 2Y9YA 2ZNZA 1E17A 2KDZA 3I64A 2HQ5A 4P9FA 5CYVA 5C4JJ 1QU3A 1ZTRA 5GAHJ 2L4AA 3FX3A 1O3QA 3SEZA 2XVCA 5K1YA 2EFWA 3LQQA 4MQVA 1B72B 1TWAJ 2WAEA 3K2ZA 4G7HF 1JI8A 1E3PA 1W7PB 2HOTA 5CQEA 2RQPA 5KVRA 2FRHA 5KK1A 2VB6A 4JYKA 3ECOA 4A0ZA 3CCLI 2DFIA 3A03A 2E1MC 1X2NA 4LIUA 2CG4A 2HTSA 5DTDA 2TRTA 1S7OA 4E4HA 5HDGA 1EA3A 1ZKGA 2M2EA 3ZQQA 1BR1A 4BS9A 2ZMEC 1IXSB 3ZR8X 3HUGA 3GTJJ 1X2MA 2VBYA 3JRDA 2OC6A 3IWFA 2DTZA 2XAGA 3MKLA 5JFRA 2JTVA 3M07A 4ZYHA 4XSZF 2BY1A 4D5FA 1S7AA 2W7NA 2DYSH 1MMNA 1XMXA 2H09A 1X1DA 1UAAA 3HTUA 2OTLI 3EYYA 5F0FA 4B43A 3BJ6A 1BI1A 1Z67A 2HOSA 4RMNA 2ME6A 3WU2C 3L2QA 1ENHA 1KQ9A 1FP1D 1MNEA 1X1CA 2VN2A 3K9TA 1YI2I 2BY0A 4E7ZA 2HS5A 1SVOA 2HVSA 2LNBA 3I0TA 3VDXA 4XLPF 2CV1A 1K7AA 1BW5A 1ZN2A 2BY2A 1OPCA 4OAYA 3PM1A 3VYSB 1IXRC 1EH7A 2EIMH 2DODA 2JN6A 4QLCU 4I01A 3J81Z 3HPGA 3CJTB 2NS7A 3TW7A 2CGPA 2VC0A 3BOQA 1JUPA 5LEJA 2OZUA 4FASD 1KA8A 5E8IA 4UVCA 4OIOF 2X85A 3WU0A 3BDDA 3IWZA 5J8CA 4A6DA 3M4OJ 1GXQA 3OYIA 1MGTA 3MWMA 1XDUA 2TDXA 4A3LJ 1ZRFA 1DGRM 2VKEA 2EWNA 3HSRA 3BZCA 1G3YA 4DNCA 2ZC2A 2QKMB 5EGOA 1RNLA 5E1XA 3S17J 3ZRGA 5FB2A 4ZC3A 1HDDC 4NC6A 1RR7A 2X1EA 1GHCA 3RPQA 2KIQA 2IA0A 1TWHJ 1LDJA 1USSA 2KIFA 3EUAA 4NDLA 3NWSA 5GADJ 3K4KA 1E2XA 3A01A 1U8RA 2NOGA 3CUQC 3K4MA 3AG2H 2K4BA 3H35A 2LRDA 5FLMJ 2WC2A 4XIDA 3DU5A 3B6CA 1S29A 2LBFB 2L9SA 2NAZA 4Y3OA 1MDMA 5JI6A 1BL0A 2W85A 3H3ZA 5KCMA 3OYDA 1TW2A 5LGTA 4BNCA 3N4MA 3S2HJ 2LKSA 4O3MA 4M73A 4LD5A 5DD4A 3GW2A 3K70C 4M9ZA 4EM0B 3DTKA 4LMYA 4RB3C 3IAS2 2HDWA 2PMZN 4HYEA 4IQJA 5IP6A 3X2QH 2KL4A 3FXMA 5KNLA 3CO7C 4GCVA 3S2WA 1KZHA 3K7AJ 5FJ8J 3HPHA 1B1BA 1S72I 5HODA 5E20A 1ZREA 4ENNA 3BR0A 1XX5A 3QOPA 1W4MA 2E5NA 4BHPA 1OR7C 1MIJA 3KEOA 1TLHB 2EILH 4YIFA 2CWEA 2ZSHB 2HXIA 1TQMA 2KISA 3DPTA 1D0XA 1ZR4A 1E3OC 2Q1ZB 1RR8C 3MZHA 2OUMA 2DCEA 3FF5A 4HNVA 3DEEA 4XKWA 3R60A 2Y9ZA 2GQQA 2M34A 2NVXJ 3RDIA 1ZGJA 2L4MA 3DPLC 3VSKA 3R61A 4XRMA 2NRAC 2W82A 4PZJA 2M4KA 4L0YB 3O8GA 4M3DA 1FTZA 4RS8A 2L7FP 3TKYA 1R9TJ 4HAMA 1U9NA 4IQ4A 3KP4A 4D5CA 1T33A 2CMPA 4NQWA 1U5TB 4AUXA 2JSPA 1U5TC 3CCVI 3OWTA 1W1WE 3C7JA 5IOYA 3BG9A 4CYCB 1XSVA 3ZOBA 2H94A 3LSJA 3EYIA 4XLFA 9ANTA 2DFEA 4A3JJ 1FSHA 3MCZA 3ZMTA 2R4GA 2PJRA 4LJZF 3S1QJ 1SFKA 5IT9K 2F5EA 1U9OA 1NH3A 1XB4A 2W00A 2JPCA 5LGUA 3JRIA 2P81A 3HOVJ 4M6XA 1FEXA 1ETWA 1V54H 3N05A 3KE2A 3QPLA 2VT3A 3E1SA 4L0ZB 4BQQA 3HEFA 1ODDA 4ENMA 1K4TA 4KMUX 3IH2A 1ERDA 1XS9A 3HOZJ 3H92A 5J47A 5FLVA 2DW4A 5HLGA 1HOMA 1VQPI 3DCFA 2NOJB 4DOZA 3JRCA 1UG0A 1FOWA 3HRUA 2B0LA 4CCJA 3NQOA 1O7FA 3EPZA 3H9GA 2BW3A 3HBLA 2VPLA 4E7SA 3JW4A 4PGGA 3G3ZA 2CRGA 1J9IA 1OCOH 3GFMA 4WXHA 4M6YA 3I4NJ 2CSOA 3PFIA 3SDBA 5LHGA 1EH8A 3H3VK 1IRGA 3J7AY 2DAOA 1FT9A 4NNJA 1HF0A 3HOTA 2KLOA 4MFDA 4BJ5C 2Z5UA 5M5YJ 3IAM2 4B8XA 1A5JA 3C1DA 1LB2A 3CP8A 2HWVA 1QHHD 2EB7A 3BG7A 2QBYB 1W36C 2Q2EB 4CO8A 4CUGA 1KQ0A 2JUCA 2VQLA 2EIKH 5IYBJ 3CO6C 4N9IA 3PSIA 1QVTA 2WAFA 3IC7A 5DCFA 2DA4A 5JR3A 5E18F 2M0MA 2ZCWA 5AIPA 4Q47A 2BV6A 3OV8A 1G3TA 3Q3SA 1FJLA 4ON0A 2J5PA 4LFUA 5D5WB 3QU6A 4FX0A 3V4GA 2PMUA 1ZELA 1FC3A 4AIKA 1HKSA 5D5XB 4B4CA 5LLQA 3CMYA 4XRFA 1SFEA 2CQQA 3LA7A 3EUHC 5F0CA 2QA4I 1SVMA 1TT0A 1ZG5A 2M9HA 4XKCA 1GXPA 4RAYA 2MC3A 1W5CC 4JP0A 2R5ZB 5C4XJ 2L9RA 3FKJA 2O0YA 4HDUA 2M0CA 1VQOI 1YS7A 5TJJA 5IY5H 3DKWA 2EINH 3ASOH 3CDLA 1W0TA 3K4BA 4II3A 5M3FJ 3IH4A 4MFEA 1Y6IA 4UNOA 2WB1N 2GXGA 1WVRA 3OIQA 4DZJA 1BW6A 5D5UB 3AG1H 1SVLA 4F3QA 3OYCA 1YLFA 2M30A 5B66C 2R5YB 3H3UA 2VBWA 4XKBA 2VXDA 1P7IA 1T08B 2I5UA 3GTMJ 3HKZA 5KAFC 4FISA 4OIPF 3U2RA 1U2WA 1HSTA 2V9PA 2K27A 3BCBA 3QODA 4XK4A 2D1VA 1NG7A 1T95A 3F9KA 4GO1A 2PJRB 1VFCA 1U78A 1JKQC 3C18A 1IUYA 3G73A 1ONVA 4BQOA 1LVAA 2F4MB 3DEWA 3ZQHA 1YRNB 2KRHA 3LSGA 4XOPA 3K4NA 2XPVA 3KLOA 1BJZA 2H1KA 1STZA 2GBYA 4NB5A 2JT1A 4IF4A 1Z9CA 4MGRA 4DZPA 4A0XA 4HNUA 4HLXA 1I39A 2M8EA 3BZKA 3DBHB 2NVQJ 3Q5FA 3CMAI 2VQHA 1L0OC 5HNFA 4ENJA 4XRSA 4MIMA 5HDKA 3S1NJ 5CLSA 5AIQA 3FHNA 1XMKA 4GRIA 2Z99A 3QOEA 2ZSIB 4RAFA 3VOEA 3GLLA 5FFXA 3W3CA 3W6KB 3SJMA 2A6HF 1DGWY 2PFBA 1GV5A 4M3FA 4R8HA 1R36A 1JKOC 2CQ7A 4YG2F 4V2GA 2K86A 1P4AA 1WWXA 1TW3A 3TP3A 2JSCA 2X6YA 6PAXA 3K10A 3OYBA 1WFXA 3K70D 1IJWC 1FZPB 2UUZA 3AG3H 4BH9A 2E35A 2M7BA 4Y52J 4KT6A 2O5RA 5F27A 1PUFB 2LY2A 5HLIA 2G7HA 5DM6F 4G12A 5LEKA 4HX4A 1Z7UA 3JR9A 1Z6TA 5ICGA 3HRSA 1E3HA 2R7ZJ 2QBYA 1K78B 4RM2A 4HPQA 2HKOA 3J7AO 5C3EJ 1KONA 3JRGA 2XAFA 2GIZA 1I5ZA 1XGSA 4UUVA 1R22A 2XKPA 4J19A 3GUDA 3E5UA 4BBSJ 1IRZA 4CYCA 3FMSA 4M3EA 3AKZA 3TQNA 2HZDA 3BR5A 4N0BA 2LMDA 3ZQFA 1YJNI 1H8AC 4HQEA 2IGOA 5FFZA 2L02A 1T39A 2ZXJA 4IHXA 2YR2A 3WTVC 1F1ZA 3DEUA 1DP3A 4CZCA 1BR2A 3PUFA 2XAUA 1LFUP 2R7DA 3WHBA 4IHYA 3QP6A 4CDGA 1WJEA 1X58A 2MLKA 1DPUA 2ETHA 3KYCB 4A3IJ 3WGIA 1ZARA 2LREA 4AYBA 4H4KC 2A05A 3FBIB 4AD9A 4BE2A 4KISA 1MZBA 5E79C 5J3LA 1Y56A 3L2RA 3OS0A 2MC4A 2YSRA 4IZZA 2IBDA 4LB5A 1HKTA 4I98B 1TTYA 3HZJA 5DDGA 2YS9A 3ZN0A 3F23A 1NG6A 3OR2C 2O61A 5GTHC 2X1CA 1R71A 1BM9A 3OY9A 2X51A 4RAZA 3IRQA 1CQTA 2DA6A 1WQ2A 4B09A 3E6CC 2W25A 4IHSA 4L9JA 2OJED 4CZZA 1REPC 3DF8A 1XSDA 4LLGF 3N97A 5LHIA 1HBXG 5FRMA 1XCBA 1GLNA 4DIQA 2E19A 2VJ5A 3KP5A 1YRNA 2O7OA 2Q8KA 5GTIC 3OYNA 4B47A 3SZPA 3CMMA 5HVQC 4ZTJA 3Q9SA 5F6FA 1A36A 5CPRB 3M3YJ 2YU9J 1Y0NA 2DA3A 2XIGA 1O57A 4YRVA 1ZLKA 3K69A 4UXNA 2IAIA 4CXFA 4NC7A 4IX7A 2H8WA 1BI3A 2XB5A 3KZZA 4LK1F 2MH2A 3CLOA 3GTKJ 2VJJA 5JHFA 3L09A 1YG2A 1Z7LA 4XORA 1Z6RA 2XPUA 3JRHA 4ESJA 4A12A 3F8MA 3L2VA 2GOXB 3L2CA 1ZK8A 2XF5A 1IN5A 2PBIA 3P5JA 5GP9A 4EJOA 3KZIC 4WXDA 3D5LA 3H5RA 1OYWA 2ICWG 5LGNA 4HDVA 3OYGA 1GVDA 1BOBA 2XGCA 3F0CA 3F8BA 2QQAA 1SFOJ 2V1UA 1HC8A 2ELKA 4PCQA 2KJCA 4I02A 4EJVA 3CJRB 3CF2A 1VNDA 4EM1A 2ZFUA 1X1PA 1YIJI 5EZHA 4UVAA 1UHSA 4UY8I 4UUSA 1A35A 1R1TA 2ISZA 5H2FC 3GCMA 1JHFA 2EV0A 4Z6YA 5L3FA 3PO2J 3L2UA 1B8IA 3KEQA 1MH3A 3MKWB 1BR4A 2R7SA 1YW9A 4C30A 1Z21A 2QSGX 2STWA 3P9KA 3QYFA 3K1MA 4BHCA 5F08A 3T5XA 4CGZA 4L5IA 1WJ5A 4ITVA 3FM5A 3TEDA 4RGSA 3AAFA 1G3WA 4M71A 2ZXHA 1SAUA 3BTIA 3DFGA 1MMDA 2L54A 3TW6A 2Y0MA 2RREA 3QYBA 2L7ZA 5CVVA 2OZ6A 3CD6I 1I50J 1D1CA 1I6XA 2EV5A 4A3CJ 4IHTA 3A4CA 2A6TA 2EPFA 3OYEA 3I54A 3BTLA 2JA6J 4A3EJ 2LH9A 1LJ9A 5B3SH 5BPDA 1Y39A 2W4SA 5ICCA 4KA4A 1ZH5A 1QRYA 2VT2A 4I09A 3OS1A 2R7VA 1TWGJ 2K9NA 1R5HA 3BJAA 2HEOA 2XAHA 4N9HA 5H6RA 4E7LA 1O3RA 3WG9A 3BP8A 3LQRA 4EQQA 3IKTA 1AU7A 3ONQA 5D8KB 2WADA 3KYLA 1ON2A 2OA4A 3VWBA 2HOAA 3ECHA 1IN4A 2XV4S 4JOMA 4A0YA 4J01A 4HQMA 2KQRA 2P6TA 2GWRA 4RB2C 4IRGA 2M45A 3Q0UA 3HOSA 2AHQA 4IPAA 4MLOA 1MNMC 1NHAA 3WODF 4BDZA 1IV6A 1IUFA 1D8KA 3L1PA 3HG9A 4QPQA 2FOKA 1R6RA 2ZKZA 4FE7A 2CFXA 3K4JA 4NBQA 3FHZA 4BJ6C 1FMVA 1QHGA 2Y0SN 3K1NA 4UV9A 4XLAA 2FNPA 2YX4A 1OJLA 3RKYA 4FETA 5LHHA 3AL0B 1XTAA 1E0EA 4PJNA 2PG4A 3K1PA 2LG4A 2DA2A 3OL4A 4FQGA 1H9GA 2AXLA 3BR2A 2V7FA 5J4VA 2OCCH 2UWMA 4W1UA 3I3LA 3T1BA 3GX4X 4ZDPA 2IS1A 2R92J 3ZCOA 4ZYDA 4AIJA 3SZTA 3S3MA 4A5NA 5FKLA 2LVSA 4PJJA 3C2BA 5EDNA 3CLQA 5IT9Z 1MNDA 3WHCA 4DYCA 2ZB9A 3CCEI 2GAUA 2R5ZA 4XKVA 1U8BA 2VE9A 3FXQA 4NQWB 2OV7A 1UHWA 4P9UA 2XB0X 3C2GA 4LLNA 2PN6A 2F4OB 5DEQA 4ZH4F 5DM7F 1K6YA 3NWTA 4E7HA 3A01B 5EEAA 3CJQB 3ZXSA 3GTQJ 3CUQA 1JXSA 2L0KA 3LSPA 3E6DA 1UFMA 1B9MA 4UVBA 2W84A 5E3LA 2R5YA 3RZOJ 1ULYA 2BEOA 3BR3A 2MYSA 2X1DA 1RKWA 4C2TA 1B9NA 1QPMA 2VBXA 2D2WA 2K9QA 2IGKA 2VBZA 3I9V2 1IDZA 4DYQA 1AKHA 4CCLA 3CF5F 2A07F 3LSHA 4C9YA 2JMWA 3RPUA 3WGGA 3E0JB 2Y48A 5TISC 1Q1VA 3LA3A 1LDKB 3C3WA 3HXLA 3OOUA 5FD6A 4ZDOA 2R7UA 1DDNA 3A0BC 2VLAA 4HBLA 1H9TA 4BACA 4PSWA 3JRFA 1VI0A 3IH3A 1UELB 4OMZA 2V1XA 3FBNB 4CCMA 2EZIA 3OOPA 2D5VA 4ZTFA 4EGYA 1Z91A 3C2HA 2IP2A 2K5CA 1YO5C 2KRFA 2IT0A 3M8JA 3TDZC 4EJUA 4QPOA 1H88C 5GAEJ 5EYRA 3A02A 2X6XA 3WTSC 5HOOA 3E5XA 2KKOA 4MEYF 3I55I 3H0GJ 2G7UA 3BPXA 4JX5A 2VODA 4XOTA 3ISPA 4OMYA 3L9FA 5EEGA 4O6JA 1ORKA 1JUSA 3OIPA 3GXOA 2OQGA 4CCNA 4Q48A 1IRXA 1X3WB 5L3EA 1G8XA 2LKPA 3HOXJ 3KP7A 1SMTA 1OYYA 1OCCH 4ZJZA 1D5YA 3HHHA 1W5TA 1Y1VJ 2CW0F 1RESA 2F5VA 4IOCF 3EDPA 1VQLI 1X1AA 2GXBA 2ECBA 2P5LC 4Y13A 2R7XA 1R49A 3CC4I 1XDSA 3G2BA 4M6VA 4CHUA 4KYWA 2M87A 1GUUA 1LPQA 3QPSA 4U0WA 1Y0UA 2CU7A 4A2UA 3SEQA 3HB9A 1UHMA 1BIBA 1R4MB 2BZTA 3W6JB 2Q0OA 5IYCJ 4WWCA 3ML6A 4U7DA 3GFIA 2L9NA 4L9VA 2EZHA 2EZLA 4IHWA 1JTYA 2FF4A 3HGYA 1TBXA 1WJBA 1XC5A 2A5WA 2BYVE 4HNTA 3CCRI 5BS6A 1GT0C 2QGUA 1MW7A 4A3GJ 2K40A 3H36A 2QQBA 3EUKL 1U0JA 4HF0A 1OISA 4XN3A 1D5VA 4XONA 1KU7A 5LBQA 3E6MA 4PGHA 3FXJA 2DOEA 2E1MB 3F3XA 5HLHA 1HLVA 1O3SA 4P96A 2VKDA 4U7BA 1V3FA 5EJCA 3R6SA 3KYDB 1TP4A 3GBGA 3O2PE 3QU3A 3GYHX 1VQ7I 2ZJPF 1YFHA 4GGGA 3RI4A 2PLYA 2KZVA 5L3BA 2V6CA 2DQLA 5M5WJ 3GTPJ 2NS8A 2XPWA 4G94A 4KMFA 2AQFA 1PP7U 1HXDA 1VZ0A 1M1EB 3REOA 1OCZH 2LR8A 3H9JA 1ETQA 3VB2A 2ZJQF 2DMQA 4II2A 3WU1B 2E7WA 1P92A 3OYHA 1XGOA 3BJOA 5F1JA 1SD7A 3ABUA 1ETOA 1G59A 2Z16A 3U21A 4B48A 2DOFA 1IC8A 4HV5A 2RV8A 2MBFA 3L7WA 4RB0A 5A2QK 4G6TB 5F0HA 1K78A 2A3SA 2MLGA 2EV6A 5L3CA 3BT9A 3MD2A 4BE1A 4UB6C 2CO5A 4IL6C 2RC4A 4PFOA 5TGTA 3ABMH 2OQRA 5D8LB 3LSRA 5H20A 1XCVA 2PI0A 4NHJA 4D7NA 1Z3XA 1MH4A 2DXIA 1FOKA 3DBLB 3BR1A 3PQKA 2BOLA 2RN7A 3S2DJ 3W2WA 3HRTA 2FX0A 2JZYA 5LFAA 2R7WA 2WV0A 3A0HC 2D1HA 3MQ0A 4LLLA 2RDPA 2EIJH 1ZG3A 2P5VA 2HVRA 3HTSB 3F6VA 5FGMA 1J2XA 4M3GA 3LA2A 2DU9A 3SDGA 1ITYA 2F5CA 2HYGD 2XUBA 1IV8A 3ZMDA 1WJCA 2CUFA 2DA1A 3QWLA 3RPUD 4ESFA 3CCJI 3K2AA 2DT5A 2R7RA 3T8TA 2CS3A 1VQ9I 2QSHX 3RQIA 5JLXA 1JTXA 4Z2YA 2EBIA 2WA0A 3WTTC 5LD2C 3RKXA 2DA5A 5EGOB 4HX8A 4MNUA 3PQJA 1J75A 3JAMZ 1HKQA 5E1ZB 2ESHA 4RM3A 3PSFA 1OKRA 3KLNA 2Y2ZA 1AKHB 3F8CA 1BI2A 2Z1DA 1PDNC 3GZ6A 2MGQA 1I27A 1IDYA 4HV6A 3W6VA 1JKRC 4N4OB 2H6CA 1WZ2A 3QAHA 1SANA 2EFQA 3RQ4A 2VQGA 3S8PA 4NC8A 1U3EM 2DQRA 1X1BA 1D1BA 2DLLA 3PIOF 2WB1A 2Y69H 1G6NA 2EZKA 4UV8A 2TCTA 1G4DA 3HSFA 2K9SA 4IOAF 2R0QC 2FSWA 2P7CB 4BDYA 5GPAA 1S3JA 1N75A 1L3LA 4FE4A 4QTRA 4V2FA 2AQEA 2QZ8A 3IV5A 1O4XA 2K4JA 2ADUA 3Q0VA 3V7CA 4BQNA 4C2MJ 4Y17A 1TZLA 2O8XA 1A31A 5EZGA 3WTWC 2LKXA 2XRNA 1IF1A 1V5FA 5E1WA 3DP7A 4X0GA 2O8KA 3MAJA 3A1YA 1YHQI 1K4SA 4BY1J 3B73A 2DA7A 3VYUB 1T56A 2VJIA 2W48A 3V8JA 4WK8F 2EFPA 2MD5A 2R7TA 2UXXA 3G1MA 3M7GA 4XLEA 4M3BA 2EFNA 4B3AA 2PX9A 1YITI 1SD4A 1R5GA 3E6BA 3ROUA 4XBFA 1ZGAA 4ZDLA 1IW7F 1XN7A 1GDTA 4XQFA 5F04A 2DN0A 3TO7A 1G3SA 4WF2A 4XL9A 4BEHA 4KUMA 5B1BH 3OYMA 2DPDA 2E2JJ 5ILUA 1MBGA 3OYKA 1B8IB 4EATA 4RGUA 1LNWA 4PJLA 4GFBA 2LFBA 4A93J 2HQAA 1FPQA 5ILVA 1O3TA 3J7YJ 3U1DA 2RGVA 1LFBA 2J5OA 1ZRDA 1PVEA 3BZ6A 5K5RA 4GDFA 1VQ4I 4XMYA 5GAGJ 1QZEA 3B6AA 4RA2A 1T6SA 2Z2SB 2NVUB 3CC2I 3JCUC 2L7KA 2FJ1A 2IA2A 1RRJA 1IRFA 3VFZA 5K5QA 3ZN1A 1FP2A 3OIOA 1ZAOA 2FMLA 1BBYA 3GFLA 3HIFA 3HKZN 4CA0A 2C6YA 1JJ6C 1FBSA 3RSNA 1LQ1A 4EJTA 1IN7A 2L01A 4YFXF 3TBIA 3CCUI 1I6HJ 3BTCA 2HR3A 5EG0A 4M74A 3SQNA 1Y8QB 3RYPA 1T98A 1K61A 2H27A 4RDUA 1UMQA 3CTAA 1ETKA 3DKXA 3DLAA 3EQLF 4BJTA 3JRAA 2WAQA 1FIAA 2DMTA 3JSPA 5E17F 4E7KA 1Z77A 1ON1A 1A6IA 2FEZA 4OWRB 4Y33A 4MTDA 2E2IJ 2L5QA 1VF9A 2XC7A 2XGDA 2CUJA 1D0ZA 2A61A 5M3MJ 1YX5A 3COAC 2IS2A 3ZQIA 3FMRA 3BY6A 2E2HJ 1B72A 3VODA 2Y75A 3MN2A 2VONA 1U6GA 3MKZA 1B59A 1O7LA 2Y31A 3LFKA 2ZJRF 3HJEA 1YIOA 4C3JJ 1WSUA 1K83J 2A69F 4UB8C 1MKMA 4F91B 1ZG1A 1S9HA 2ME0A 4MQ9F 5CKTA 1OCRH 2V1NA 3V8LA 2ESNA 3JTGA 1JUMA 3V8KA 2AXTC 3CMEI 1R58A 4PJMA 1G2HA 5FKOA 1VQ6I 2X0LA 2IW5A 2LF8A 2BHZA 2XGXA 3ABTA 2XDVA 2ZXIA 4S0HB 4CH7A 2A68F 2LC2A 2M5WA 2M8GX 5D5VB 2PMHA 3K4LA 1LEBA 1KYZA 4UUSB 1DQUA 1PUEE
chains in the Genus database with same CATH topology
1ZHFA 2K02A 2IA1A 2QYOA 3DQVC 3GF2A 3ZP5A 1UB9A 1V4RA 4EM2A 5ICFA 1HW2A 4HZFA 2XHKA 1HQCA 4Q4ZF 3I59B 5CVIA 2PJPA 4M9XA 1T38A 5E8GA 4IXAA 4DQ2A 3FXRA 3F8FA 2XAJA 3E97A 3RJPA 1B4AA 1HW5A 1I1SA 4M72A 4AIHA 4A5MA 3F22A 3F72A 1LEAA 1R1UA 3LSTA 1FX7A 5BMZA 4L18B 4G7OF 3WTXC 5CJ9A 4AVPA 3WTUC 2F5FA 4ENKA 3KZYA 5ICEA 2MA3A 1JGSA 1XD7A 4KN7X 1DPRA 2DTRA 4LG0B 2IRFG 2QQ9A 4S05A 1R1VA 4L9TA 2EA2A 1QBJA 1VTNC 3QPTA 5DUIA 1WKMA 1K6OA 3U9GA 2Z9OA 1QQIA 2CQKA 3LAJA 4I2OA 2O3FA 5H6QA 2WWYA 2E1NA 2HGCA 3FXUA 1HW1A 2LDUA 1Q1HA 1SAXA 2DK8A 3ULQB 2HYFA 1KU3A 5DCMB 2CYYA 4JBAA 2VC1A 3F6OA 3KETA 4HW0A 2HQNA 3T8RA 5J6XA 5JHUA 3GFJA 1SD5A 3IL2A 4KIGA 4FHTA 3MFKA 1BIAA 4RGRA 2EJRA 3RKWA 4F7ZA 2DI3A 1IAWA 3SHFA 2K7LA 5CVUA 5FO5A 3E3VA 2VE8A 5J8FA 2Z33A 1FWZA 1DP7P 2ISYA 2M1BA 4XLNF 1MDMB 1W5SA 2H6BA 1KGSA 2BBYA 4HOBA 1BC8C 2EFOA 1IN8A 4I0BA 3TOBA 1IZ1A 4KIBA 2GZWA 4KIFA 3ZMUA 3ZQ7A 1SFXA 4ASNA 5HDNA 1FYMA 1CGPA 1R00A 3ELKA 3ZMSA 1FBQA 3EETA 5K5OA 3M1EA 4PDKA 1KU2A 3M8EA 4R1HA 2JRTA 4WXCA 1EV7A 2P8TA 5D6FA 2FBHA 1FSEA 1S8NA 3M9AA 4A6EA 2F5DA 2IVMA 2KIUA 2P6SA 4RGXA 4HF2A 3I59A 4L9NA 2YU3A 2COMA 1R23A 4JK1X 1YYVA 3V7RA 2O6GE 4Y15A 3LAPA 1OMIA 4EVIA 4K2EA 4MTEA 3SXYA 4EV0A 1CF7B 4I7HA 5HS9A 4KNYA 2ZJ2A 5DV5A 1HSJA 2YPRA 5A2QZ 3TDUC 3FZVA 2XROA 4EGZA 2BGCA 2QM3A 3D0SA 1W7PA 2E1CA 4OIQF 2HKXA 2UZKA 2LF7A 2ZO4A 4OINF 4G9YA 3DV8A 4HLYA 2PQ8A 2QWWA 1QO0D 1IN6A 4OOIA 3ZMVA 1J0RA 2P7VB 4IRIA 2HDCA 1LDDA 4EJWA 2KIMA 4G6DA 3JAMK 4IJAA 1ZRCA 2JPBA 2FMYA 3I71A 2IJLA 3NEUA 5TRDA 1KQ8A 1JHHA 3GVAA 4BXUA 4GYIA 3BWGA 1MJBA 3TGNA 4WCGA 4OIRF 1FLIA 1D8JA 4AWXB 1XGNA 2ZNYA 5LRRA 4ZZDA 4I0AA 2HTJA 2XKOA 1AOYA 2DPUA 3FM3A 1QZYA 3P9CA 2EK5A 2FXAA 3IHUA 4HA8A 1P4WA 5CVRA 1YTYA 1BC7C 1QNTA 2P5KA 4G7ZF 1OYIA 2QLZA 2FBIA 1U5TA 1J59A 4YFNF 1JE8A 2FNAA 3T0YA 5D4RA 4H0EA 2OBPA 3WE3A 1W7PD 1UCRA 4KT5C 5F1RA 3I5UA 1CF7A 2DO7A 4MHGA 5FLXZ 3VEPA 1BI0A 4KFCA 2QVOA 4Q5SF 2PEXA 3R0AA 1H0MA 3KFWX 5CVJA 1Z05A 4HF1A 2XASA 1TQPA 1FYLA 2F2EA 2D45A 2HFHA 1Z1DA 1SD6A 3P9IA 3BPVA 5L3GA 2FU4A 2E7XA 2LSOA 3WTYC 4L5JA 2HZTA 2G9WA 1P6RA 2OD5A 1C0WA 1F9NA 3QRFF 2O03A 3GEZA 2R3SA 3GO5A 1R7JA 3GZ5A 4G8XA 4YFKF 2RNJA 1K79A 1TNSA 3I58A 2V79A 2OAZA 3V7SA 4FT8A 1EH6A 3RTRA 3O3KA 2OU2A 3EUHA 4G6QA 1MJ9A 3FWEA 1RUOA 2A5YB 1P4XA 2VOOA 1XSXA 1A04A 1BJAA 4RB1A 2DBBA 1AWCA 2NNYA 3O6BB 3K0LA 3E5QA 1YW7A 2MH9A 3B02A 3JTHA 4P55A 3J80K 4O5VA 1USTA 4U88A 1XMAA 1YS6A 2HOEA 3MEXA 3I53A 5ED4A 3KP6A 1RZ4A 2A6EF 3F8NA 3QP5A 5BPIA 2GA1A 5D6EA 2W24A 5D4SA 4U0VA 4LK0F 1SMYF 1WI9A 1J5YA 4IVNA 1FNNA 2STTA 1WRJA 3KP3A 4P5OA 3WGHA 1ZLJA 1IXCA 5DD8A 2FQ3A 3DXJF 2DK5A 3JSOA 2Q2EA 2AS5F 5DYMA 3R0JA 4KICA 5ILSA 3HHGA 3RYRA 4QWQA 1RUNA 4E70A 3RIRA 1MD0A 2NYXA 3Q9VA 2ZMEA 3FMQA 1T2KA 3J81K 4OU0A 4M9SA 3WE2A 1FY7A 1P2FA 3P7NA 2X4HA 1QZZA 4BYYA 2RKHA 3GLXA 3MZYA 1FYKA 3CJNA 3SFZA 5LRSA 3R4KA 2RVCA 1KU9A 1D3YA 1SFUA 3IRRA 4HX7A 2FBKA 1TQIA 4BAYA 2V9VA 2L3DA 2ACJA 1I1GA 2ZBKA 2V1DA 2ZFWA 5JVTA 1XGMA 4R79A 3CUOA 3ERED 5FD5A 1BN5A 1KYWA 3GWZA 4BQAA 2BE5F 2QENA 5DUKA 2HQRA 2NNNA 3HSEA 3KCCA 1TNTA 5BQTA 4LGWA 5ERIA 2P4WA 2FE3A 4MEXF 5FLXK 4ESBA 2R7FA 1RIOH 4LG0A 2QUFA 3TO6A 1MJAA 1FBUA 2FA5A 4BHBA 5EEHA 4XSXF 5F64A 3LWFA 3M8FA 4TV7A 2IPQX 5BOXA 1F5TA 4S04A 3HYIA 3KP2A 4EMSA 1BOAA 1QGPA 3I4PA 1ZYRF 1YW8A 3J80Z 1S6LA 2EA4A 4ETSA 3ZPLA 1YQAA 4ZYGA 5DCMA 4WX9A 2YX7A 2VOPA 1OR7A 3QPHA 5L3DA 4ZZLA 4IRHA 2ZMEB 4UHTA 5AONA 1X3UA 3TO9A 4CICA 2NS0A 1RI7A 4GXOA 2UXNA 3IKVA 3HRMA 4JQFA 1J7KA 4U0YA 5IT3A 1DUXC 5HS7A 2ELHA 2W57A 4YIIA 4GYGA 1F4KA 3NRVA 3TOAA 1PP8F 3CUQB 3BROA 4D0PA 2WTEA 1GVJA 1T0FA 2VXZA 5HS8A 3L00A 3CDHA 3F21A 2KJBA 4KN4X 2XAQA 3WTZA 4ZYEA 3ZMZA 2GA2A 1B6AA 2GIVA 4LB6B 4CYDA 4FX4A 4KDPA 2Z3YA 2ZNZA 1E17A 3I64A 4P9FA 5CYVA 2L4AA 3FX3A 1O3QA 5K1YA 2XVCA 2EFWA 3LQQA 4MQVA 3K2ZA 4G7HF 1W7PB 2RQPA 5KVRA 2FRHA 5KK1A 4A0ZA 3ECOA 2DFIA 2CG4A 2HTSA 1S7OA 5HDGA 1IXSB 3HUGA 2VBYA 3IWFA 2XAGA 5JFRA 2JTVA 4ZYHA 4XSZF 1S7AA 2H09A 3HTUA 3EYYA 3BJ6A 1BI1A 1KQ9A 1FP1D 2VN2A 3K9TA 2HS5A 2LNBA 3I0TA 4XLPF 1K7AA 1ZN2A 1OPCA 1IXRC 1EH7A 4QLCU 4I01A 3J81Z 2CGPA 2VC0A 3BOQA 5LEJA 2OZUA 1KA8A 5E8IA 4UVCA 4OIOF 3WU0A 3BDDA 3IWZA 5J8CA 4A6DA 1GXQA 1MGTA 3MWMA 1XDUA 2TDXA 1ZRFA 2EWNA 3HSRA 1G3YA 4DNCA 1RNLA 5E1XA 5FB2A 1GHCA 3RPQA 2IA0A 1LDJA 1USSA 2KIFA 1E2XA 1U8RA 3CUQC 2K4BA 2WC2A 1S29A 2NAZA 1MDMA 5JI6A 2W85A 3H3ZA 1TW2A 4BNCA 5LGTA 3N4MA 4O3MA 4M73A 4LD5A 5DD4A 3GW2A 4M9ZA 4EM0B 4LMYA 4RB3C 4HYEA 3CO7C 4GCVA 3S2WA 1B1BA 5E20A 1ZREA 4ENNA 3QOPA 1W4MA 4BHPA 3KEOA 1TLHB 4YIFA 2CWEA 1TQMA 3DPTA 3MZHA 3FF5A 3R60A 2GQQA 3RDIA 1ZGJA 2L4MA 3DPLC 3R61A 2NRAC 4PZJA 4L0YB 4RS8A 3TKYA 4HAMA 3KP4A 4NQWA 1U5TB 1U5TC 3C7JA 1XSVA 2H94A 3EYIA 1FSHA 3MCZA 3ZMTA 4LJZF 5IT9K 2F5EA 1XB4A 2JPCA 5LGUA 4M6XA 3KE2A 2VT3A 4L0ZB 1ODDA 4ENMA 4KMUX 3H92A 2DW4A 5HLGA 3HRUA 2B0LA 3NQOA 1O7FA 3JW4A 4PGGA 3G3ZA 1J9IA 3GFMA 4WXHA 4M6YA 2CSOA 3PFIA 5LHGA 1EH8A 1IRGA 2DAOA 1FT9A 3HOTA 2Z5UA 4B8XA 3C1DA 1LB2A 2HWVA 2EB7A 2QBYB 4CO8A 1KQ0A 3CO6C 4N9IA 3IC7A 5DCFA 5JR3A 5E18F 2ZCWA 5AIPA 4Q47A 2BV6A 3OV8A 1G3TA 4ON0A 2J5PA 4LFUA 5D5WB 3QU6A 4FX0A 3V4GA 2PMUA 4AIKA 1FC3A 1HKSA 5D5XB 5LLQA 4XRFA 1SFEA 3LA7A 1ZG5A 1GXPA 4RAYA 2MC3A 2O0YA 4HDUA 1YS7A 5TJJA 3DKWA 4UNOA 2GXGA 5D5UB 1YLFA 2M30A 3H3UA 2VBWA 4OIPF 3U2RA 1U2WA 1HSTA 2K27A 2D1VA 4GO1A 1U78A 3C18A 1IUYA 3G73A 1ONVA 1LVAA 3KLOA 1STZA 4NB5A 2JT1A 4IF4A 1Z9CA 4MGRA 4A0XA 4HLXA 2M8EA 3Q5FA 1L0OC 4ENJA 5HDKA 5CLSA 5AIQA 1XMKA 2Z99A 3VOEA 5FFXA 3W6KB 2A6HF 2PFBA 4R8HA 1R36A 4YG2F 2K86A 1P4AA 1WWXA 1TW3A 2JSCA 6PAXA 1FZPB 4BH9A 5HLIA 2G7HA 5LEKA 4HX4A 1Z7UA 1Z6TA 5ICGA 3HRSA 2QBYA 1K78B 2HKOA 3J7AO 2XAFA 1I5ZA 1XGSA 4UUVA 1R22A 2XKPA 3GUDA 3E5UA 3FMSA 3TQNA 4N0BA 4HQEA 5FFZA 2L02A 1T39A 2ZXJA 2YR2A 3WTVC 1F1ZA 3DEUA 2R7DA 3QP6A 4CDGA 2MLKA 1DPUA 2ETHA 3WGIA 1ZARA 4AD9A 1MZBA 2YSRA 1HKTA 4LB5A 4I98B 1TTYA 5DDGA 3ZN0A 3F23A 2O61A 1BM9A 4RAZA 3IRQA 1WQ2A 4B09A 3E6CC 2W25A 4IHSA 4L9JA 1REPC 4CZZA 3DF8A 1XSDA 4LLGF 3N97A 5LHIA 1HBXG 1XCBA 3KP5A 2Q8KA 3SZPA 5HVQC 3Q9SA 5F6FA 2XIGA 1O57A 1ZLKA 3K69A 4UXNA 4CXFA 1BI3A 3KZZA 4LK1F 2MH2A 3CLOA 4ESJA 3L09A 1YG2A 1Z6RA 4A12A 3F8MA 3L2CA 1IN5A 2PBIA 4EJOA 4WXDA 3D5LA 5LGNA 1OYWA 4HDVA 3F8BA 2QQAA 2V1UA 4PCQA 2KJCA 4I02A 4EJVA 4EM1A 4UVAA 1R1TA 2ISZA 1JHFA 2EV0A 5L3FA 3KEQA 1YW9A 2STWA 3P9KA 3K1MA 4BHCA 3T5XA 4CGZA 4L5IA 3FM5A 4RGSA 3AAFA 1G3WA 4M71A 3DFGA 2L54A 2Y0MA 5CVVA 2OZ6A 1I6XA 2EV5A 4IHTA 3I54A 1LJ9A 5BPDA 5ICCA 1ZH5A 4KA4A 2VT2A 4I09A 1R5HA 3BJAA 2HEOA 2XAHA 4N9HA 5H6RA 1O3RA 3WG9A 3BP8A 3LQRA 4EQQA 3IKTA 5D8KB 1ON2A 2OA4A 3ECHA 1IN4A 2XV4S 4A0YA 4HQMA 2P6TA 2GWRA 4RB2C 4IRGA 2M45A 3HOSA 4IPAA 1NHAA 3WODF 1D8KA 2FOKA 2ZKZA 2CFXA 3FHZA 3K1NA 4UV9A 2FNPA 2YX4A 3RKYA 5LHHA 2PG4A 3K1PA 1H9GA 2AXLA 2UWMA 3T1BA 3GX4X 4ZYDA 4AIJA 3SZTA 4A5NA 5IT9Z 2GAUA 2VE9A 3FXQA 1UHWA 4P9UA 4LLNA 2PN6A 5DEQA 4ZH4F 3CUQA 1JXSA 3E6DA 1UFMA 1B9MA 4UVBA 2W84A 1ULYA 2BEOA 1B9NA 1QPMA 2VBXA 2D2WA 2VBZA 2A07F 3RPUA 3WGGA 2Y48A 3LA3A 1LDKB 3C3WA 5FD6A 1DDNA 4HBLA 1H9TA 4OMZA 2V1XA 3OOPA 4EGYA 1Z91A 2IP2A 1YO5C 2KRFA 2IT0A 3TDZC 4EJUA 3WTSC 5HOOA 3E5XA 2KKOA 4MEYF 2G7UA 3BPXA 2VODA 3ISPA 4OMYA 3L9FA 5EEGA 4O6JA 3GXOA 2OQGA 4Q48A 5L3EA 2LKPA 3KP7A 1SMTA 1OYYA 3HHHA 1W5TA 2CW0F 3EDPA 2GXBA 2P5LC 4Y13A 1XDSA 4CHUA 4KYWA 2M87A 4U0WA 1Y0UA 4A2UA 1UHMA 1BIBA 4WWCA 3W6JB 2Q0OA 3ML6A 4U7DA 3GFIA 4L9VA 2FF4A 1TBXA 2BYVE 5BS6A 2QQBA 4HF0A 1D5VA 1KU7A 5LBQA 3E6MA 4PGHA 3F3XA 5HLHA 1O3SA 4P96A 4U7BA 1V3FA 3R6SA 3QU3A 3O2PE 3GYHX 1YFHA 4GGGA 3RI4A 2PLYA 5L3BA 2V6CA 2DQLA 4G94A 4KMFA 1PP7U 1HXDA 3REOA 3VB2A 3WU1B 2E7WA 1P92A 1XGOA 3BJOA 1SD7A 3ABUA 4HV5A 2RV8A 2MBFA 3L7WA 4RB0A 5A2QK 1K78A 2A3SA 2MLGA 2EV6A 5L3CA 2CO5A 2RC4A 5D8LB 2OQRA 5H20A 1XCVA 2PI0A 4NHJA 1FOKA 3PQKA 2RN7A 3HRTA 2JZYA 2WV0A 2D1HA 3MQ0A 4LLLA 2RDPA 1ZG3A 2P5VA 3HTSB 3F6VA 5FGMA 1J2XA 3LA2A 2DU9A 2F5CA 2HYGD 2XUBA 3ZMDA 4ESFA 2DT5A 3T8TA 4Z2YA 3WTTC 3RKXA 4HX8A 4MNUA 3PQJA 1J75A 3JAMZ 1HKQA 5E1ZB 2ESHA 1OKRA 3KLNA 3F8CA 1BI2A 1PDNC 3GZ6A 1I27A 4HV6A 2H6CA 3QAHA 2EFQA 1U3EM 2DQRA 2DLLA 1G6NA 4UV8A 1G4DA 3HSFA 2FSWA 2P7CB 1S3JA 1L3LA 2QZ8A 2K4JA 2ADUA 3V7CA 4Y17A 2O8XA 3WTWC 2XRNA 1IF1A 5E1WA 3DP7A 3MAJA 3B73A 4WK8F 3V8JA 2EFPA 2MD5A 2UXXA 3M7GA 2EFNA 1R5GA 1SD4A 3E6BA 3ROUA 4XBFA 1ZGAA 1XN7A 1IW7F 3TO7A 1G3SA 4WF2A 4KUMA 2DPDA 5ILUA 4RGUA 1LNWA 1O3TA 1FPQA 5ILVA 3U1DA 2RGVA 2J5OA 1ZRDA 3BZ6A 5K5RA 1T6SA 2IA2A 1IRFA 3VFZA 5K5QA 3ZN1A 1FP2A 1ZAOA 2C6YA 2FMLA 1BBYA 3GFLA 3HIFA 1FBSA 1LQ1A 4EJTA 1IN7A 2L01A 4YFXF 2HR3A 4M74A 3SQNA 3RYPA 1T98A 2H27A 3CTAA 3EQLF 3JSPA 5E17F 1ON1A 2FEZA 4MTDA 2A61A 3COAC 3FMRA 3BY6A 3VODA 2Y75A 2VONA 1U6GA 1B59A 1O7LA 3LFKA 1YIOA 1WSUA 2A69F 1MKMA 1ZG1A 4MQ9F 3V8LA 2ESNA 3JTGA 3V8KA 1R58A 2X0LA 2IW5A 2LF8A 2XGXA 3ABTA 2A68F 2M5WA 5D5VB 2PMHA 1LEBA 1KYZA 1PUEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHF A;  2K02 A;  2IA1 A;  2QYO A;  3DQV C;  3GF2 A;  3ZP5 A;  1UB9 A;  1V4R A;  4EM2 A;  5ICF A;  1HW2 A;  4HZF A;  2XHK A;  1HQC A;  4Q4Z F;  3I59 B;  5CVI A;  2PJP A;  4M9X A;  1T38 A;  5E8G A;  4IXA A;  4DQ2 A;  3FXR A;  3F8F A;  2XAJ A;  3E97 A;  3RJP A;  1B4A A;  1HW5 A;  1I1S A;  4M72 A;  4AIH A;  4A5M A;  3F22 A;  3F72 A;  1LEA A;  1R1U A;  3LST A;  1FX7 A;  5BMZ A;  4L18 B;  4G7O F;  3WTX C;  5CJ9 A;  4AVP A;  3WTU C;  2F5F A;  4ENK A;  3KZY A;  5ICE A;  2MA3 A;  1JGS A;  1XD7 A;  4KN7 X;  1DPR A;  2DTR A;  4LG0 B;  2IRF G;  2QQ9 A;  4S05 A;  1R1V A;  4L9T A;  2EA2 A;  1QBJ A;  1VTN C;  3QPT A;  5DUI A;  1WKM A;  1K6O A;  3U9G A;  2Z9O A;  1QQI A;  2CQK A;  3LAJ A;  4I2O A;  2O3F A;  5H6Q A;  2WWY A;  2E1N A;  2HGC A;  3FXU A;  1HW1 A;  2LDU A;  1Q1H A;  1SAX A;  2DK8 A;  3ULQ B;  2HYF A;  1KU3 A;  5DCM B;  2CYY A;  4JBA A;  2VC1 A;  3F6O A;  3KET A;  4HW0 A;  2HQN A;  3T8R A;  5J6X A;  5JHU A;  3GFJ A;  1SD5 A;  3IL2 A;  4KIG A;  4FHT A;  3MFK A;  1BIA A;  4RGR A;  2EJR A;  3RKW A;  4F7Z A;  2DI3 A;  1IAW A;  3SHF A;  2K7L A;  5CVU A;  5FO5 A;  3E3V A;  2VE8 A;  5J8F A;  2Z33 A;  1FWZ A;  1DP7 P;  2ISY A;  2M1B A;  4XLN F;  1MDM B;  1W5S A;  2H6B A;  1KGS A;  2BBY A;  4HOB A;  1BC8 C;  2EFO A;  1IN8 A;  4I0B A;  3TOB A;  1IZ1 A;  4KIB A;  2GZW A;  4KIF A;  3ZMU A;  3ZQ7 A;  1SFX A;  4ASN A;  5HDN A;  1FYM A;  1CGP A;  1R00 A;  3ELK A;  3ZMS A;  1FBQ A;  3EET A;  5K5O A;  3M1E A;  4PDK A;  1KU2 A;  3M8E A;  4R1H A;  2JRT A;  4WXC A;  1EV7 A;  2P8T A;  5D6F A;  2FBH A;  1FSE A;  1S8N A;  3M9A A;  4A6E A;  2F5D A;  2IVM A;  2KIU A;  2P6S A;  4RGX A;  4HF2 A;  3I59 A;  4L9N A;  2YU3 A;  2COM A;  1R23 A;  4JK1 X;  1YYV A;  3V7R A;  2O6G E;  4Y15 A;  3LAP A;  1OMI A;  4EVI A;  4K2E A;  4MTE A;  3SXY A;  4EV0 A;  1CF7 B;  4I7H A;  5HS9 A;  4KNY A;  2ZJ2 A;  5DV5 A;  1HSJ A;  2YPR A;  5A2Q Z;  3TDU C;  3FZV A;  2XRO A;  4EGZ A;  2BGC A;  2QM3 A;  3D0S A;  1W7P A;  2E1C A;  4OIQ F;  2HKX A;  2UZK A;  2LF7 A;  2ZO4 A;  4OIN F;  4G9Y A;  3DV8 A;  4HLY A;  2PQ8 A;  2QWW A;  1QO0 D;  1IN6 A;  4OOI A;  3ZMV A;  1J0R A;  2P7V B;  4IRI A;  2HDC A;  1LDD A;  4EJW A;  2KIM A;  4G6D A;  3JAM K;  4IJA A;  1ZRC A;  2JPB A;  2FMY A;  3I71 A;  2IJL A;  3NEU A;  5TRD A;  1KQ8 A;  1JHH A;  3GVA A;  4BXU A;  4GYI A;  3BWG A;  1MJB A;  3TGN A;  4WCG A;  4OIR F;  1FLI A;  1D8J A;  4AWX B;  1XGN A;  2ZNY A;  5LRR A;  4ZZD A;  4I0A A;  2HTJ A;  2XKO A;  1AOY A;  2DPU A;  3FM3 A;  1QZY A;  3P9C A;  2EK5 A;  2FXA A;  3IHU A;  4HA8 A;  1P4W A;  5CVR A;  1YTY A;  1BC7 C;  1QNT A;  2P5K A;  4G7Z F;  1OYI A;  2QLZ A;  2FBI A;  1U5T A;  1J59 A;  4YFN F;  1JE8 A;  2FNA A;  3T0Y A;  5D4R A;  4H0E A;  2OBP A;  3WE3 A;  1W7P D;  1UCR A;  4KT5 C;  5F1R A;  3I5U A;  1CF7 A;  2DO7 A;  4MHG A;  5FLX Z;  3VEP A;  1BI0 A;  4KFC A;  2QVO A;  4Q5S F;  2PEX A;  3R0A A;  1H0M A;  3KFW X;  5CVJ A;  1Z05 A;  4HF1 A;  2XAS A;  1TQP A;  1FYL A;  2F2E A;  2D45 A;  2HFH A;  1Z1D A;  1SD6 A;  3P9I A;  3BPV A;  5L3G A;  2FU4 A;  2E7X A;  2LSO A;  3WTY C;  4L5J A;  2HZT A;  2G9W A;  1P6R A;  2OD5 A;  1C0W A;  1F9N A;  3QRF F;  2O03 A;  3GEZ A;  2R3S A;  3GO5 A;  1R7J A;  3GZ5 A;  4G8X A;  4YFK F;  2RNJ A;  1K79 A;  1TNS A;  3I58 A;  2V79 A;  2OAZ A;  3V7S A;  4FT8 A;  1EH6 A;  3RTR A;  3O3K A;  2OU2 A;  3EUH A;  4G6Q A;  1MJ9 A;  3FWE A;  1RUO A;  2A5Y B;  1P4X A;  2VOO A;  1XSX A;  1A04 A;  1BJA A;  4RB1 A;  2DBB A;  1AWC A;  2NNY A;  3O6B B;  3K0L A;  3E5Q A;  1YW7 A;  2MH9 A;  3B02 A;  3JTH A;  4P55 A;  3J80 K;  4O5V A;  1UST A;  4U88 A;  1XMA A;  1YS6 A;  2HOE A;  3MEX A;  3I53 A;  5ED4 A;  3KP6 A;  1RZ4 A;  2A6E F;  3F8N A;  3QP5 A;  5BPI A;  2GA1 A;  5D6E A;  2W24 A;  5D4S A;  4U0V A;  4LK0 F;  1SMY F;  1WI9 A;  1J5Y A;  4IVN A;  1FNN A;  2STT A;  1WRJ A;  3KP3 A;  4P5O A;  3WGH A;  1ZLJ A;  1IXC A;  5DD8 A;  2FQ3 A;  3DXJ F;  2DK5 A;  3JSO A;  2Q2E A;  2AS5 F;  5DYM A;  3R0J A;  4KIC A;  5ILS A;  3HHG A;  3RYR A;  4QWQ A;  1RUN A;  4E70 A;  3RIR A;  1MD0 A;  2NYX A;  3Q9V A;  2ZME A;  3FMQ A;  1T2K A;  3J81 K;  4OU0 A;  4M9S A;  3WE2 A;  1FY7 A;  1P2F A;  3P7N A;  2X4H A;  1QZZ A;  4BYY A;  2RKH A;  3GLX A;  3MZY A;  1FYK A;  3CJN A;  3SFZ A;  5LRS A;  3R4K A;  2RVC A;  1KU9 A;  1D3Y A;  1SFU A;  3IRR A;  4HX7 A;  2FBK A;  1TQI A;  4BAY A;  2V9V A;  2L3D A;  2ACJ A;  1I1G A;  2ZBK A;  2V1D A;  2ZFW A;  5JVT A;  1XGM A;  4R79 A;  3CUO A;  3ERE D;  5FD5 A;  1BN5 A;  1KYW A;  3GWZ A;  4BQA A;  2BE5 F;  2QEN A;  5DUK A;  2HQR A;  2NNN A;  3HSE A;  3KCC A;  1TNT A;  5BQT A;  4LGW A;  5ERI A;  2P4W A;  2FE3 A;  4MEX F;  5FLX K;  4ESB A;  2R7F A;  1RIO H;  4LG0 A;  2QUF A;  3TO6 A;  1MJA A;  1FBU A;  2FA5 A;  4BHB A;  5EEH A;  4XSX F;  5F64 A;  3LWF A;  3M8F A;  4TV7 A;  2IPQ X;  5BOX A;  1F5T A;  4S04 A;  3HYI A;  3KP2 A;  4EMS A;  1BOA A;  1QGP A;  3I4P A;  1ZYR F;  1YW8 A;  3J80 Z;  1S6L A;  2EA4 A;  4ETS A;  3ZPL A;  1YQA A;  4ZYG A;  5DCM A;  4WX9 A;  2YX7 A;  2VOP A;  1OR7 A;  3QPH A;  5L3D A;  4ZZL A;  4IRH A;  2ZME B;  4UHT A;  5AON A;  1X3U A;  3TO9 A;  4CIC A;  2NS0 A;  1RI7 A;  4GXO A;  2UXN A;  3IKV A;  3HRM A;  4JQF A;  1J7K A;  4U0Y A;  5IT3 A;  1DUX C;  5HS7 A;  2ELH A;  2W57 A;  4YII A;  4GYG A;  1F4K A;  3NRV A;  3TOA A;  1PP8 F;  3CUQ B;  3BRO A;  4D0P A;  2WTE A;  1GVJ A;  1T0F A;  2VXZ A;  5HS8 A;  3L00 A;  3CDH A;  3F21 A;  2KJB A;  4KN4 X;  2XAQ A;  3WTZ A;  4ZYE A;  3ZMZ A;  2GA2 A;  1B6A A;  2GIV A;  4LB6 B;  4CYD A;  4FX4 A;  4KDP A;  2Z3Y A;  2ZNZ A;  1E17 A;  3I64 A;  4P9F A;  5CYV A;  2L4A A;  3FX3 A;  1O3Q A;  5K1Y A;  2XVC A;  2EFW A;  3LQQ A;  4MQV A;  3K2Z A;  4G7H F;  1W7P B;  2RQP A;  5KVR A;  2FRH A;  5KK1 A;  4A0Z A;  3ECO A;  2DFI A;  2CG4 A;  2HTS A;  1S7O A;  5HDG A;  1IXS B;  3HUG A;  2VBY A;  3IWF A;  2XAG A;  5JFR A;  2JTV A;  4ZYH A;  4XSZ F;  1S7A A;  2H09 A;  3HTU A;  3EYY A;  3BJ6 A;  1BI1 A;  1KQ9 A;  1FP1 D;  2VN2 A;  3K9T A;  2HS5 A;  2LNB A;  3I0T A;  4XLP F;  1K7A A;  1ZN2 A;  1OPC A;  1IXR C;  1EH7 A;  4QLC U;  4I01 A;  3J81 Z;  2CGP A;  2VC0 A;  3BOQ A;  5LEJ A;  2OZU A;  1KA8 A;  5E8I A;  4UVC A;  4OIO F;  3WU0 A;  3BDD A;  3IWZ A;  5J8C A;  4A6D A;  1GXQ A;  1MGT A;  3MWM A;  1XDU A;  2TDX A;  1ZRF A;  2EWN A;  3HSR A;  1G3Y A;  4DNC A;  1RNL A;  5E1X A;  5FB2 A;  1GHC A;  3RPQ A;  2IA0 A;  1LDJ A;  1USS A;  2KIF A;  1E2X A;  1U8R A;  3CUQ C;  2K4B A;  2WC2 A;  1S29 A;  2NAZ A;  1MDM A;  5JI6 A;  2W85 A;  3H3Z A;  1TW2 A;  4BNC A;  5LGT A;  3N4M A;  4O3M A;  4M73 A;  4LD5 A;  5DD4 A;  3GW2 A;  4M9Z A;  4EM0 B;  4LMY A;  4RB3 C;  4HYE A;  3CO7 C;  4GCV A;  3S2W A;  1B1B A;  5E20 A;  1ZRE A;  4ENN A;  3QOP A;  1W4M A;  4BHP A;  3KEO A;  1TLH B;  4YIF A;  2CWE A;  1TQM A;  3DPT A;  3MZH A;  3FF5 A;  3R60 A;  2GQQ A;  3RDI A;  1ZGJ A;  2L4M A;  3DPL C;  3R61 A;  2NRA C;  4PZJ A;  4L0Y B;  4RS8 A;  3TKY A;  4HAM A;  3KP4 A;  4NQW A;  1U5T B;  1U5T C;  3C7J A;  1XSV A;  2H94 A;  3EYI A;  1FSH A;  3MCZ A;  3ZMT A;  4LJZ F;  5IT9 K;  2F5E A;  1XB4 A;  2JPC A;  5LGU A;  4M6X A;  3KE2 A;  2VT3 A;  4L0Z B;  1ODD A;  4ENM A;  4KMU X;  3H92 A;  2DW4 A;  5HLG A;  3HRU A;  2B0L A;  3NQO A;  1O7F A;  3JW4 A;  4PGG A;  3G3Z A;  1J9I A;  3GFM A;  4WXH A;  4M6Y A;  2CSO A;  3PFI A;  5LHG A;  1EH8 A;  1IRG A;  2DAO A;  1FT9 A;  3HOT A;  2Z5U A;  4B8X A;  3C1D A;  1LB2 A;  2HWV A;  2EB7 A;  2QBY B;  4CO8 A;  1KQ0 A;  3CO6 C;  4N9I A;  3IC7 A;  5DCF A;  5JR3 A;  5E18 F;  2ZCW A;  5AIP A;  4Q47 A;  2BV6 A;  3OV8 A;  1G3T A;  4ON0 A;  2J5P A;  4LFU A;  5D5W B;  3QU6 A;  4FX0 A;  3V4G A;  2PMU A;  4AIK A;  1FC3 A;  1HKS A;  5D5X B;  5LLQ A;  4XRF A;  1SFE A;  3LA7 A;  1ZG5 A;  1GXP A;  4RAY A;  2MC3 A;  2O0Y A;  4HDU A;  1YS7 A;  5TJJ A;  3DKW A;  4UNO A;  2GXG A;  5D5U B;  1YLF A;  2M30 A;  3H3U A;  2VBW A;  4OIP F;  3U2R A;  1U2W A;  1HST A;  2K27 A;  2D1V A;  4GO1 A;  1U78 A;  3C18 A;  1IUY A;  3G73 A;  1ONV A;  1LVA A;  3KLO A;  1STZ A;  4NB5 A;  2JT1 A;  4IF4 A;  1Z9C A;  4MGR A;  4A0X A;  4HLX A;  2M8E A;  3Q5F A;  1L0O C;  4ENJ A;  5HDK A;  5CLS A;  5AIQ A;  1XMK A;  2Z99 A;  3VOE A;  5FFX A;  3W6K B;  2A6H F;  2PFB A;  4R8H A;  1R36 A;  4YG2 F;  2K86 A;  1P4A A;  1WWX A;  1TW3 A;  2JSC A;  6PAX A;  1FZP B;  4BH9 A;  5HLI A;  2G7H A;  5LEK A;  4HX4 A;  1Z7U A;  1Z6T A;  5ICG A;  3HRS A;  2QBY A;  1K78 B;  2HKO A;  3J7A O;  2XAF A;  1I5Z A;  1XGS A;  4UUV A;  1R22 A;  2XKP A;  3GUD A;  3E5U A;  3FMS A;  3TQN A;  4N0B A;  4HQE A;  5FFZ A;  2L02 A;  1T39 A;  2ZXJ A;  2YR2 A;  3WTV C;  1F1Z A;  3DEU A;  2R7D A;  3QP6 A;  4CDG A;  2MLK A;  1DPU A;  2ETH A;  3WGI A;  1ZAR A;  4AD9 A;  1MZB A;  2YSR A;  1HKT A;  4LB5 A;  4I98 B;  1TTY A;  5DDG A;  3ZN0 A;  3F23 A;  2O61 A;  1BM9 A;  4RAZ A;  3IRQ A;  1WQ2 A;  4B09 A;  3E6C C;  2W25 A;  4IHS A;  4L9J A;  1REP C;  4CZZ A;  3DF8 A;  1XSD A;  4LLG F;  3N97 A;  5LHI A;  1HBX G;  1XCB A;  3KP5 A;  2Q8K A;  3SZP A;  5HVQ C;  3Q9S A;  5F6F A;  2XIG A;  1O57 A;  1ZLK A;  3K69 A;  4UXN A;  4CXF A;  1BI3 A;  3KZZ A;  4LK1 F;  2MH2 A;  3CLO A;  4ESJ A;  3L09 A;  1YG2 A;  1Z6R A;  4A12 A;  3F8M A;  3L2C A;  1IN5 A;  2PBI A;  4EJO A;  4WXD A;  3D5L A;  5LGN A;  1OYW A;  4HDV A;  3F8B A;  2QQA A;  2V1U A;  4PCQ A;  2KJC A;  4I02 A;  4EJV A;  4EM1 A;  4UVA A;  1R1T A;  2ISZ A;  1JHF A;  2EV0 A;  5L3F A;  3KEQ A;  1YW9 A;  2STW A;  3P9K A;  3K1M A;  4BHC A;  3T5X A;  4CGZ A;  4L5I A;  3FM5 A;  4RGS A;  3AAF A;  1G3W A;  4M71 A;  3DFG A;  2L54 A;  2Y0M A;  5CVV A;  2OZ6 A;  1I6X A;  2EV5 A;  4IHT A;  3I54 A;  1LJ9 A;  5BPD A;  5ICC A;  1ZH5 A;  4KA4 A;  2VT2 A;  4I09 A;  1R5H A;  3BJA A;  2HEO A;  2XAH A;  4N9H A;  5H6R A;  1O3R A;  3WG9 A;  3BP8 A;  3LQR A;  4EQQ A;  3IKT A;  5D8K B;  1ON2 A;  2OA4 A;  3ECH A;  1IN4 A;  2XV4 S;  4A0Y A;  4HQM A;  2P6T A;  2GWR A;  4RB2 C;  4IRG A;  2M45 A;  3HOS A;  4IPA A;  1NHA A;  3WOD F;  1D8K A;  2FOK A;  2ZKZ A;  2CFX A;  3FHZ A;  3K1N A;  4UV9 A;  2FNP A;  2YX4 A;  3RKY A;  5LHH A;  2PG4 A;  3K1P A;  1H9G A;  2AXL A;  2UWM A;  3T1B A;  3GX4 X;  4ZYD A;  4AIJ A;  3SZT A;  4A5N A;  5IT9 Z;  2GAU A;  2VE9 A;  3FXQ A;  1UHW A;  4P9U A;  4LLN A;  2PN6 A;  5DEQ A;  4ZH4 F;  3CUQ A;  1JXS A;  3E6D A;  1UFM A;  1B9M A;  4UVB A;  2W84 A;  1ULY A;  2BEO A;  1B9N A;  1QPM A;  2VBX A;  2D2W A;  2VBZ A;  2A07 F;  3RPU A;  3WGG A;  2Y48 A;  3LA3 A;  1LDK B;  3C3W A;  5FD6 A;  1DDN A;  4HBL A;  1H9T A;  4OMZ A;  2V1X A;  3OOP A;  4EGY A;  1Z91 A;  2IP2 A;  1YO5 C;  2KRF A;  2IT0 A;  3TDZ C;  4EJU A;  3WTS C;  5HOO A;  3E5X A;  2KKO A;  4MEY F;  2G7U A;  3BPX A;  2VOD A;  3ISP A;  4OMY A;  3L9F A;  5EEG A;  4O6J A;  3GXO A;  2OQG A;  4Q48 A;  5L3E A;  2LKP A;  3KP7 A;  1SMT A;  1OYY A;  3HHH A;  1W5T A;  2CW0 F;  3EDP A;  2GXB A;  2P5L C;  4Y13 A;  1XDS A;  4CHU A;  4KYW A;  2M87 A;  4U0W A;  1Y0U A;  4A2U A;  1UHM A;  1BIB A;  4WWC A;  3W6J B;  2Q0O A;  3ML6 A;  4U7D A;  3GFI A;  4L9V A;  2FF4 A;  1TBX A;  2BYV E;  5BS6 A;  2QQB A;  4HF0 A;  1D5V A;  1KU7 A;  5LBQ A;  3E6M A;  4PGH A;  3F3X A;  5HLH A;  1O3S A;  4P96 A;  4U7B A;  1V3F A;  3R6S A;  3QU3 A;  3O2P E;  3GYH X;  1YFH A;  4GGG A;  3RI4 A;  2PLY A;  5L3B A;  2V6C A;  2DQL A;  4G94 A;  4KMF A;  1PP7 U;  1HXD A;  3REO A;  3VB2 A;  3WU1 B;  2E7W A;  1P92 A;  1XGO A;  3BJO A;  1SD7 A;  3ABU A;  4HV5 A;  2RV8 A;  2MBF A;  3L7W A;  4RB0 A;  5A2Q K;  1K78 A;  2A3S A;  2MLG A;  2EV6 A;  5L3C A;  2CO5 A;  2RC4 A;  5D8L B;  2OQR A;  5H20 A;  1XCV A;  2PI0 A;  4NHJ A;  1FOK A;  3PQK A;  2RN7 A;  3HRT A;  2JZY A;  2WV0 A;  2D1H A;  3MQ0 A;  4LLL A;  2RDP A;  1ZG3 A;  2P5V A;  3HTS B;  3F6V A;  5FGM A;  1J2X A;  3LA2 A;  2DU9 A;  2F5C A;  2HYG D;  2XUB A;  3ZMD A;  4ESF A;  2DT5 A;  3T8T A;  4Z2Y A;  3WTT C;  3RKX A;  4HX8 A;  4MNU A;  3PQJ A;  1J75 A;  3JAM Z;  1HKQ A;  5E1Z B;  2ESH A;  1OKR A;  3KLN A;  3F8C A;  1BI2 A;  1PDN C;  3GZ6 A;  1I27 A;  4HV6 A;  2H6C A;  3QAH A;  2EFQ A;  1U3E M;  2DQR A;  2DLL A;  1G6N A;  4UV8 A;  1G4D A;  3HSF A;  2FSW A;  2P7C B;  1S3J A;  1L3L A;  2QZ8 A;  2K4J A;  2ADU A;  3V7C A;  4Y17 A;  2O8X A;  3WTW C;  2XRN A;  1IF1 A;  5E1W A;  3DP7 A;  3MAJ A;  3B73 A;  4WK8 F;  3V8J A;  2EFP A;  2MD5 A;  2UXX A;  3M7G A;  2EFN A;  1R5G A;  1SD4 A;  3E6B A;  3ROU A;  4XBF A;  1ZGA A;  1XN7 A;  1IW7 F;  3TO7 A;  1G3S A;  4WF2 A;  4KUM A;  2DPD A;  5ILU A;  4RGU A;  1LNW A;  1O3T A;  1FPQ A;  5ILV A;  3U1D A;  2RGV A;  2J5O A;  1ZRD A;  3BZ6 A;  5K5R A;  1T6S A;  2IA2 A;  1IRF A;  3VFZ A;  5K5Q A;  3ZN1 A;  1FP2 A;  1ZAO A;  2C6Y A;  2FML A;  1BBY A;  3GFL A;  3HIF A;  1FBS A;  1LQ1 A;  4EJT A;  1IN7 A;  2L01 A;  4YFX F;  2HR3 A;  4M74 A;  3SQN A;  3RYP A;  1T98 A;  2H27 A;  3CTA A;  3EQL F;  3JSP A;  5E17 F;  1ON1 A;  2FEZ A;  4MTD A;  2A61 A;  3COA C;  3FMR A;  3BY6 A;  3VOD A;  2Y75 A;  2VON A;  1U6G A;  1B59 A;  1O7L A;  3LFK A;  1YIO A;  1WSU A;  2A69 F;  1MKM A;  1ZG1 A;  4MQ9 F;  3V8L A;  2ESN A;  3JTG A;  3V8K A;  1R58 A;  2X0L A;  2IW5 A;  2LF8 A;  2XGX A;  3ABT A;  2A68 F;  2M5W A;  5D5V B;  2PMH A;  1LEB A;  1KYZ A;  1PUE E; 
#chains in the Genus database with same CATH topology
 1ZHF A;  2K02 A;  3BQZ A;  2IA1 A;  4N4N B;  2QYO A;  3DQV C;  3GF2 A;  4KJZ A;  3ZP5 A;  1IO2 A;  1UB9 A;  2M4G A;  1V4R A;  4EM2 A;  5ICF A;  5DS9 A;  1HW2 A;  2PMZ A;  4HZF A;  2OCE A;  1P9Q C;  3FIS A;  2XHK A;  1HQC A;  3HOW J;  1J09 A;  4XNF A;  4NUB A;  4Q4Z F;  2FD5 A;  3I59 B;  4PFP A;  5CVI A;  2WY7 Q;  2PJP A;  3RCO A;  1OFC X;  2DT7 B;  4M9X A;  1T38 A;  5E8G A;  4IXA A;  4DQ2 A;  3FXR A;  3OMY A;  3F8F A;  2V9K A;  1XG1 A;  2XAJ A;  3PNY A;  3E97 A;  3G1L A;  3RJP A;  1B4A A;  2DFH A;  1R4N B;  1HW5 A;  1I1S A;  1JKP C;  1VQK I;  2HNH A;  4M72 A;  3G71 I;  4AIH A;  4DYR A;  3ESW B;  4A5M A;  3F22 A;  3F72 A;  1LEA A;  1LKX A;  1R1U A;  3CP2 A;  2XSJ C;  4BY7 J;  3AG4 H;  3H9Q A;  2KHM A;  3V42 A;  3RKQ A;  3LST A;  3BTJ A;  1FX7 A;  5BMZ A;  4L18 B;  4G7O F;  3WTX C;  5CJ9 A;  4AVP A;  4DW6 A;  5IP9 J;  3WTU C;  2F5F A;  1AA7 A;  2ID6 A;  2K85 A;  1T8I A;  4C3I J;  4ENK A;  3KZY A;  2XF7 A;  5ICE A;  2MA3 A;  2L2O A;  1JGS A;  1PJR A;  1XD7 A;  3DWL E;  4KN7 X;  1VQN I;  1DPR A;  2DTR A;  3S1M J;  4BBR J;  2BXY A;  1LVK A;  1YX3 A;  3IUO A;  4RBO A;  1TL8 A;  4LG0 B;  2IRF G;  1ETY A;  2QQ9 A;  4S05 A;  3HGG A;  2JA8 J;  1R1V A;  4L9T A;  2EA2 A;  2K3F A;  3H1C A;  1QBJ A;  1VTN C;  3QPT A;  5DUI A;  1WKM A;  3FK6 A;  1K6O A;  2RNG A;  5E3M A;  2L9V A;  2DDB A;  3U9G A;  3S3N A;  2DOA A;  1QQI A;  2CQK A;  2Z9O A;  3LAJ A;  5KHD A;  4I2O A;  2O3F A;  2B9S A;  5H6Q A;  5KAI C;  1OQY A;  3MKY B;  3WG7 H;  2WWY A;  2M7A A;  2E1N A;  3UNG C;  1MMG A;  2HGC A;  3S93 A;  3G4S I;  3FXU A;  1HW1 A;  2LDU A;  1Q1H A;  1SAX A;  3I56 I;  2VL8 A;  2DK8 A;  3ULQ B;  2HYF A;  1KU3 A;  5DCM B;  2CYY A;  3LMM A;  4JBA A;  2VC1 A;  4F92 B;  3ASN H;  3F6O A;  4HW0 A;  2HQN A;  3T8R A;  3KET A;  5J6X A;  4F93 B;  5JHU A;  3GFJ A;  4AID A;  5IYD J;  1SD5 A;  3IL2 A;  1IGN A;  4KIG A;  2VPR A;  4FHT A;  3MFK A;  3Q0W A;  3JRE A;  1BIA A;  4YIR X;  3QYE A;  4RGR A;  2EJR A;  3RKW A;  4DGW B;  2BXZ A;  1V5G A;  1IG7 A;  4C2U A;  4F7Z A;  1N25 A;  2IEK A;  2DI3 A;  1IAW A;  1OLT A;  3TMO A;  3SHF A;  2K7L A;  5CVU A;  3D5R C;  5FO5 A;  3E3V A;  2CV0 A;  2VE8 A;  3OSF A;  5J8F A;  2Z33 A;  1FWZ A;  1DP7 P;  3TP0 A;  2ISY A;  2JK3 A;  5JVG F;  2KFD A;  2M1B A;  1OCP A;  4XLN F;  1MDM B;  1W5S A;  1WJA A;  2H6B A;  1KGS A;  4XIC A;  1WGX A;  1HCR A;  2DDA A;  2BBY A;  2V26 A;  2ID3 A;  4HOB A;  1BC8 C;  2EFO A;  1APL C;  1SEU A;  2H8R A;  1XPX A;  1IN8 A;  4I0B A;  4PJ0 C;  3TOB A;  2JA7 J;  4QIW N;  3D5S C;  2CH0 A;  2HDD A;  2KPM A;  2K9M A;  1Y8R B;  1IZ1 A;  4KIB A;  2GZW A;  4KIF A;  4J00 A;  3ZMU A;  3ZQ7 A;  2RAE A;  2Y30 A;  1SFX A;  4ASN A;  1ZGW A;  2GLO A;  5HDN A;  3ABL H;  1FYM A;  1CGP A;  1R00 A;  1V55 H;  2BVM A;  3ELK A;  2LY9 A;  3ZMS A;  5B1A H;  4FTH A;  3VPR A;  1TC3 C;  1FBQ A;  3EET A;  2LP0 A;  5K5O A;  3M1E A;  2I10 A;  3OYA A;  5FKN A;  4PDK A;  1KU2 A;  4A3B J;  2KMU A;  2CQN A;  1JJ8 C;  1WH7 A;  4IHV A;  5CQG A;  3FKI J;  5IOZ A;  1MMS A;  1LUJ B;  3BR6 A;  3M8E A;  1MBK A;  4R1H A;  2JRT A;  4A3D J;  4WXC A;  1EV7 A;  2P8T A;  3BLY A;  2WY8 Q;  1X3Z B;  5D6F A;  1RC9 A;  4LG3 A;  2FBH A;  1NK3 P;  5M5X J;  1FSE A;  1S8N A;  3M9A A;  3FXL A;  2VKH A;  2CFO A;  4A6E A;  2F5D A;  2IVM A;  2KIU A;  2P6S A;  4UUT A;  4AC0 A;  4B3X A;  4D1Q A;  2XSD C;  1VQM I;  3BG3 A;  4RGX A;  1RET A;  4XRS G;  4HF2 A;  3I59 A;  2JA5 J;  4L9N A;  3VSL A;  3PO3 J;  2YU3 A;  3L2W A;  2COM A;  3LFU A;  2VKV A;  3BG6 A;  2IS4 A;  1ZQ3 P;  1R23 A;  1WHU A;  1MMA A;  1MBE A;  2VJ4 A;  4PSX A;  4JK1 X;  3CCM I;  1YYV A;  3V7R A;  2O6G E;  3SZG A;  2HPI A;  4Y15 A;  3LAP A;  4X1E A;  2OF7 A;  5HNH A;  4A3M J;  4PK4 A;  3A2K A;  1OMI A;  4BUP A;  2MD0 A;  4EVI A;  2HU9 A;  4K2E A;  4MTE A;  3SXY A;  4EV0 A;  1CF7 B;  2ZXW H;  3W2V A;  2E5Z A;  4I7H A;  5HS9 A;  4KNY A;  2ZJ2 A;  1TWC J;  1NK2 P;  2WBM A;  4CSW A;  5DV5 A;  1HSJ A;  2E34 A;  3M1C A;  2V6E A;  3CCS I;  2MFZ A;  2YPR A;  5A2Q Z;  3TDU C;  3D1N I;  2DMP A;  3FZV A;  2DJN A;  2HVQ A;  2XRO A;  4KIT B;  3ZQL A;  3CQZ J;  4EGZ A;  2BGC A;  2QM3 A;  1W36 D;  3D0S A;  3IP4 B;  1W7P A;  2E1C A;  2XGE A;  1X4P A;  2VQC A;  5IP7 J;  4OIQ F;  3S32 A;  2HKX A;  1FOX A;  1UZC A;  2CW7 A;  2QEX I;  2UZK A;  2LF7 A;  5E3O A;  2BW3 B;  3GZN B;  1PYV A;  2ZO4 A;  2JVG A;  4OIN F;  5FKM A;  4G9Y A;  3DV8 A;  4HLY A;  2PQ8 A;  2QWW A;  1QO0 D;  1IN6 A;  4OOI A;  4CCK A;  3ZMV A;  2F48 A;  2E60 A;  1MSE C;  1J0R A;  2P7V B;  3OL3 A;  4IRI A;  3FXK A;  2HDC A;  4BXF A;  4E6K G;  2LLK A;  4YEJ A;  1LDD A;  1HA8 A;  4EJW A;  2E1O A;  3KIO A;  2KIM A;  4G6D A;  1SC7 A;  4HST A;  3JAM K;  4IJA A;  1ZRC A;  3OYJ A;  2JJ7 A;  2JPB A;  4AU7 A;  2FMY A;  3BC8 A;  2CQX A;  1ETX A;  3I71 A;  2IJL A;  3LNQ A;  3NEU A;  5TRD A;  2L7M P;  2RQQ A;  1KQ8 A;  2CW8 A;  1JHH A;  3QQA A;  1QVU A;  1UJ8 A;  3GVA A;  4BXU A;  3BWG A;  4GYI A;  3CCY A;  1FTT A;  3UR3 C;  4AM3 A;  1MJB A;  3TGN A;  4WCG A;  4OIR F;  4DJA A;  3HOU J;  1FLI A;  1D8J A;  4AWX B;  1XGN A;  5IPA A;  1PUF A;  2VUM J;  2ZNY A;  2X9D A;  1YE9 A;  5LRR A;  4ZZD A;  4I0A A;  4V19 K;  2HTJ A;  2KT0 A;  1MBJ A;  1NTC A;  3K6G A;  3FDY A;  2XKO A;  2K3P A;  3S15 J;  1AOY A;  1FOY A;  4QSH A;  3FM3 A;  1QZY A;  1D1A A;  2DPU A;  1N77 A;  3P9C A;  3FK7 A;  2EK5 A;  2FXA A;  3IHU A;  3DBR B;  2F4I A;  4HA8 A;  4ANJ A;  1P4W A;  3SYT A;  4CCO A;  2XRL A;  5CVR A;  1ZR2 A;  2DMN A;  1YTY A;  1LE8 B;  1BC7 C;  1W0U A;  2O9L A;  1QNT A;  3LL7 A;  2P5K A;  4G7Z F;  1OYI A;  2QLZ A;  2FBI A;  3KX2 A;  1U5T A;  2N8G A;  3S1R J;  1J59 A;  3LOC A;  4YFN F;  1JE8 A;  2FNA A;  3T0Y A;  2OBP A;  5D4R A;  3WE3 A;  4H0E A;  2V4J C;  4F55 A;  1W7P D;  1UCR A;  2KP6 A;  4KT5 C;  3ZGK A;  1AHD P;  5FRO A;  3JRB A;  2AO9 A;  5F1R A;  3I5U A;  2FQ4 A;  1CF7 A;  4I6Z A;  4LOC A;  2DO7 A;  4MHG A;  5FLX Z;  4BL0 B;  3VEP A;  1BI0 A;  3ZQC A;  4FCY A;  4BE0 A;  4RAG A;  4KFC A;  2QVO A;  4Q5S F;  2OTJ I;  2PEX A;  3R0A A;  3LSM A;  1H0M A;  1RPW A;  4A69 C;  1JT6 A;  3KFW X;  3H0D A;  2K9L A;  2I8D A;  1Z0X A;  2YUS A;  2KRC A;  3ERM A;  1Z05 A;  5CVJ A;  1X19 A;  1WI3 A;  2XAS A;  1TQP A;  3KEY A;  1FYL A;  4HF1 A;  4X6A J;  2F2E A;  5E3N A;  2D45 A;  2M3A A;  2HFH A;  1Z1D A;  2E36 A;  4C3H J;  2GM4 A;  2LBF A;  3BG5 A;  1SD6 A;  2QF7 A;  3P9I A;  5J1R A;  3BPV A;  3DTI A;  2IGM A;  5L3G A;  2FU4 A;  4XLH A;  1FIP A;  2E7X A;  2LSO A;  3WTY C;  2CUZ A;  4EEF G;  1Z3Y A;  4L5J A;  2Y0S A;  5J4Y A;  3CES A;  2GOM A;  2HZT A;  2G9W A;  1P6R A;  2WV1 A;  2OD5 A;  3OYF A;  4W97 A;  3DLL F;  1C0W A;  1I3Q J;  2B63 J;  2NVY J;  1QA6 A;  5C44 J;  1YOV B;  4B44 A;  1F9N A;  3QRF F;  2JQ7 A;  2FUG 2;  2O03 A;  5FKK A;  3G6E I;  3GEZ A;  2R3S A;  5K7H A;  3GO5 A;  1R7J A;  3GZ5 A;  4G8X A;  4YFK F;  2RNJ A;  2JA2 A;  1WJD A;  2LYC A;  1K79 A;  3J7Z I;  3W2A A;  1TNS A;  1V5E A;  3DKY A;  3I58 A;  2V79 A;  2OAZ A;  3DU6 A;  3V7S A;  5K7F A;  2E71 A;  1EH6 A;  4FT8 A;  3RTR A;  3FIW A;  3O3K A;  3OR1 C;  2OU2 A;  1TT5 B;  3EUH A;  2COB A;  4G6Q A;  1MJ9 A;  3FWE A;  3S14 J;  1RUO A;  1A6Q A;  2JVH A;  3PUB A;  1GV2 A;  1LFP A;  2A5Y B;  1P4X A;  4AVZ A;  2VOO A;  2WAQ N;  1XSX A;  1A04 A;  1BJA A;  4RB1 A;  2DBB A;  1AWC A;  1HDP A;  2NNY A;  3O6B B;  2DYR H;  1UG2 A;  3K0L A;  2BY3 A;  3E5Q A;  5EG0 B;  3CC7 I;  2VAS A;  1YW7 A;  2MH9 A;  3B02 A;  3ZQG A;  3JTH A;  4P55 A;  2NXN B;  3J80 K;  4O5V A;  2QCO A;  2HYJ A;  1UST A;  3CCQ I;  4U88 A;  3S16 J;  2FOW A;  1XMA A;  1YS6 A;  3S3O A;  1T0F C;  1YJW I;  2MW8 A;  4BXX J;  1H89 C;  2VI6 A;  3GME A;  2HOE A;  3RZD J;  3MEX A;  2H1L A;  3I53 A;  4F52 A;  3UKG A;  4I76 A;  5ED4 A;  1VQ8 I;  3KP6 A;  4DBR A;  3HOY J;  4E7J A;  1FMW A;  1RZ4 A;  2A6E F;  3F8N A;  3QP5 A;  3HL2 A;  5BPI A;  2GA1 A;  2P0W A;  5J1U A;  3OS2 A;  5D6E A;  2W24 A;  2DJI A;  5D4S A;  4U0V A;  4LK0 F;  1SMY F;  1WI9 A;  4BGD A;  1J5Y A;  4IVN A;  1FNN A;  2BVL A;  2JRM A;  4D7M A;  2STT A;  1WRJ A;  3KP3 A;  4JX4 A;  4P5O A;  3WGH A;  1ZLJ A;  1IXC A;  2CJJ A;  5DD8 A;  2XF6 A;  2FQ3 A;  3DXJ F;  2B7E A;  1N78 A;  4HSR A;  2DK5 A;  2R7O A;  2IGN A;  2Q2E A;  3JSO A;  2AS5 F;  2VIX A;  5DYM A;  3R0J A;  4KIC A;  3AL0 C;  2W1O A;  1JT0 A;  1JGG A;  4YEL A;  5ILS A;  3HHG A;  3RYR A;  4QWQ A;  1VQ5 I;  3PIP F;  1RUN A;  2MG4 A;  4E70 A;  2BHY A;  3RIR A;  1EKE A;  1MD0 A;  3LSI A;  2EQR A;  3BCA A;  3GTL J;  2NYX A;  3Q9V A;  2ZME A;  3FMQ A;  1T2K A;  3J81 K;  4OU0 A;  4M9S A;  3WE2 A;  2QKL B;  1FY7 A;  3H5A A;  1MBF A;  1P2F A;  3P7N A;  2QSF X;  2X4H A;  3MVP A;  1QZZ A;  4B1R A;  4BYY A;  3GTG J;  4RLQ A;  3LSK A;  4P1W A;  2HXO A;  2KDO A;  2RKH A;  3GLX A;  4PUS A;  3SFI A;  3MZY A;  2LY1 A;  2X6W A;  1FYK A;  4XLC A;  3CJN A;  3SFZ A;  1Y1W J;  2ECC A;  5LRS A;  3R4K A;  2RVC A;  1KU9 A;  2JWT A;  1D3Y A;  4IO9 F;  3U1K A;  1SFU A;  2LTP A;  3IRR A;  4HX7 A;  2FBK A;  1TQI A;  4BAY A;  4Y4R A;  4JX6 A;  2V9V A;  1WJF A;  2L3D A;  2LD5 A;  2ACJ A;  1POG A;  1I1G A;  2ZBK A;  1I3A A;  2V1D A;  2ZFW A;  1QPI A;  3HDD A;  3AFH A;  5JVT A;  1XGM A;  4R79 A;  3CUO A;  3VYT B;  2QQ8 A;  3ERE D;  4IKF A;  5FD5 A;  1BN5 A;  4U87 A;  1KYW A;  1WPK A;  3GWZ A;  4BQA A;  1S7E A;  3GTO J;  4LIT A;  2BE5 F;  2QEN A;  2IS6 A;  1F43 A;  1D0Y A;  5DUK A;  1S5L C;  1F36 A;  2HQR A;  3I4M J;  5GPC A;  3HM5 A;  2NNN A;  3HSE A;  3KCC A;  2MSY A;  1TNT A;  2G0E A;  4XN0 A;  5BQT A;  4LGW A;  1WCM J;  3PNT A;  5ERI A;  1YJ9 I;  2P4W A;  2FE3 A;  3DTE A;  3H5N A;  4MEX F;  3CZ6 A;  4L5E A;  5FRN A;  5FLX K;  4ESB A;  2R7F A;  2HPM A;  4IEJ A;  4HG2 A;  1RIO H;  1MBH A;  4LG0 A;  2QUF A;  2JUG A;  3TO6 A;  1MJA A;  2R7Q A;  1FBU A;  4ABZ A;  2FA5 A;  2MAB A;  4BHB A;  1EF4 A;  5EEH A;  1P7J A;  4XSX F;  4I99 C;  5F64 A;  2EH3 A;  3LWF A;  3M8F A;  4OAZ A;  4TV7 A;  3HUG B;  4Y7N J;  3ABK H;  4BKX A;  4HEA 2;  2IPQ X;  5BOX A;  2DT6 A;  1F5T A;  4S04 A;  1RKT A;  5J1Y A;  3VYR B;  2DFF A;  4HRI A;  3HYI A;  3KP2 A;  4BU2 A;  3O8H A;  4EMS A;  1BOA A;  1QGP A;  3PNV A;  3I4P A;  1ZYR F;  5J40 A;  1YW8 A;  4D9J A;  5B5E C;  3J80 Z;  5HLT A;  1S6L A;  2EA4 A;  4ETS A;  4DBQ A;  1EJ9 A;  3ZPL A;  2R93 J;  1TWF J;  2CV2 A;  1YQA A;  2LOO A;  4ZYG A;  5DCM A;  4WX9 A;  2HI3 A;  2YX7 A;  1BA5 A;  3DPU A;  3PFY A;  2VOP A;  1OR7 A;  4BEH B;  4RLF A;  5K7Z A;  3QPH A;  2GXA A;  5L3D A;  1WH5 A;  3MMY B;  3G1O A;  4XM3 A;  2NVT J;  4ZZL A;  4IRH A;  2ZME B;  4UHT A;  5AON A;  1X3U A;  1ETV A;  4MO7 A;  1ACI A;  3TO9 A;  4A3K J;  3OYL A;  4CIC A;  3TL4 X;  3E7L A;  2F6C A;  1MSF C;  2X48 A;  2NS0 A;  4LIV A;  3NAR A;  4XR6 A;  5JLW A;  4A3F J;  1RI7 A;  4GXO A;  2UXN A;  3IKV A;  3HRM A;  3KPH A;  4JQF A;  3FXO A;  3CDI A;  1J7K A;  4U0Y A;  1DU6 A;  5IT3 A;  2ELJ A;  1DUX C;  4ZYA A;  5HS7 A;  2ELH A;  5BNG A;  2W57 A;  4YII A;  4GYG A;  3OSG A;  1F4K A;  5EF6 A;  3NRV A;  2KZG A;  3TOA A;  2LK2 A;  1PP8 F;  3CUQ B;  2IXS A;  3BRO A;  1X4O A;  2WTE A;  4D0P A;  1GVJ A;  1T0F A;  2VXZ A;  5HS8 A;  3L00 A;  2CUE A;  2OPT A;  3CDH A;  3F21 A;  2DMU A;  1OCT C;  3K4C A;  2KJB A;  1LE8 A;  2X6O A;  4AYB N;  3HC7 A;  4KN4 X;  3MZ8 A;  2XAQ A;  3BQY A;  1DU0 A;  3WTZ A;  4ZYE A;  3ZMZ A;  4E7I A;  2GA2 A;  1B6A A;  2GIV A;  4LB6 B;  4CYD A;  4FX4 A;  1R5I D;  2UV1 A;  3NAU A;  4KDP A;  2Z3Y A;  3PJR A;  3PL8 A;  2Y9Y A;  2ZNZ A;  1E17 A;  2KDZ A;  3I64 A;  2HQ5 A;  4P9F A;  5CYV A;  5C4J J;  1QU3 A;  1ZTR A;  5GAH J;  2L4A A;  3FX3 A;  1O3Q A;  3SEZ A;  2XVC A;  5K1Y A;  2EFW A;  3LQQ A;  4MQV A;  1B72 B;  1TWA J;  2WAE A;  3K2Z A;  4G7H F;  1JI8 A;  1E3P A;  1W7P B;  2HOT A;  5CQE A;  2RQP A;  5KVR A;  2FRH A;  5KK1 A;  2VB6 A;  4JYK A;  3ECO A;  4A0Z A;  3CCL I;  2DFI A;  3A03 A;  2E1M C;  1X2N A;  4LIU A;  2CG4 A;  2HTS A;  5DTD A;  2TRT A;  1S7O A;  4E4H A;  5HDG A;  1EA3 A;  1ZKG A;  2M2E A;  3ZQQ A;  1BR1 A;  4BS9 A;  2ZME C;  1IXS B;  3ZR8 X;  3HUG A;  3GTJ J;  1X2M A;  2VBY A;  3JRD A;  2OC6 A;  3IWF A;  2DTZ A;  2XAG A;  3MKL A;  5JFR A;  2JTV A;  3M07 A;  4ZYH A;  4XSZ F;  2BY1 A;  4D5F A;  1S7A A;  2W7N A;  2DYS H;  1MMN A;  1XMX A;  2H09 A;  1X1D A;  1UAA A;  3HTU A;  2OTL I;  3EYY A;  5F0F A;  4B43 A;  3BJ6 A;  1BI1 A;  1Z67 A;  2HOS A;  4RMN A;  2ME6 A;  3WU2 C;  3L2Q A;  1ENH A;  1KQ9 A;  1FP1 D;  1MNE A;  1X1C A;  2VN2 A;  3K9T A;  1YI2 I;  2BY0 A;  4E7Z A;  2HS5 A;  1SVO A;  2HVS A;  2LNB A;  3I0T A;  3VDX A;  4XLP F;  2CV1 A;  1K7A A;  1BW5 A;  1ZN2 A;  2BY2 A;  1OPC A;  4OAY A;  3PM1 A;  3VYS B;  1IXR C;  1EH7 A;  2EIM H;  2DOD A;  2JN6 A;  4QLC U;  4I01 A;  3J81 Z;  3HPG A;  3CJT B;  2NS7 A;  3TW7 A;  2CGP A;  2VC0 A;  3BOQ A;  1JUP A;  5LEJ A;  2OZU A;  4FAS D;  1KA8 A;  5E8I A;  4UVC A;  4OIO F;  2X85 A;  3WU0 A;  3BDD A;  3IWZ A;  5J8C A;  4A6D A;  3M4O J;  1GXQ A;  3OYI A;  1MGT A;  3MWM A;  1XDU A;  2TDX A;  4A3L J;  1ZRF A;  1DGR M;  2VKE A;  2EWN A;  3HSR A;  3BZC A;  1G3Y A;  4DNC A;  2ZC2 A;  2QKM B;  5EGO A;  1RNL A;  5E1X A;  3S17 J;  3ZRG A;  5FB2 A;  4ZC3 A;  1HDD C;  4NC6 A;  1RR7 A;  2X1E A;  1GHC A;  3RPQ A;  2KIQ A;  2IA0 A;  1TWH J;  1LDJ A;  1USS A;  2KIF A;  3EUA A;  4NDL A;  3NWS A;  5GAD J;  3K4K A;  1E2X A;  3A01 A;  1U8R A;  2NOG A;  3CUQ C;  3K4M A;  3AG2 H;  2K4B A;  3H35 A;  2LRD A;  5FLM J;  2WC2 A;  4XID A;  3DU5 A;  3B6C A;  1S29 A;  2LBF B;  2L9S A;  2NAZ A;  4Y3O A;  1MDM A;  5JI6 A;  1BL0 A;  2W85 A;  3H3Z A;  5KCM A;  3OYD A;  1TW2 A;  5LGT A;  4BNC A;  3N4M A;  3S2H J;  2LKS A;  4O3M A;  4M73 A;  4LD5 A;  5DD4 A;  3GW2 A;  3K70 C;  4M9Z A;  4EM0 B;  3DTK A;  4LMY A;  4RB3 C;  3IAS 2;  2HDW A;  2PMZ N;  4HYE A;  4IQJ A;  5IP6 A;  3X2Q H;  2KL4 A;  3FXM A;  5KNL A;  3CO7 C;  4GCV A;  3S2W A;  1KZH A;  3K7A J;  5FJ8 J;  3HPH A;  1B1B A;  1S72 I;  5HOD A;  5E20 A;  1ZRE A;  4ENN A;  3BR0 A;  1XX5 A;  3QOP A;  1W4M A;  2E5N A;  4BHP A;  1OR7 C;  1MIJ A;  3KEO A;  1TLH B;  2EIL H;  4YIF A;  2CWE A;  2ZSH B;  2HXI A;  1TQM A;  2KIS A;  3DPT A;  1D0X A;  1ZR4 A;  1E3O C;  2Q1Z B;  1RR8 C;  3MZH A;  2OUM A;  2DCE A;  3FF5 A;  4HNV A;  3DEE A;  4XKW A;  3R60 A;  2Y9Z A;  2GQQ A;  2M34 A;  2NVX J;  3RDI A;  1ZGJ A;  2L4M A;  3DPL C;  3VSK A;  3R61 A;  4XRM A;  2NRA C;  2W82 A;  4PZJ A;  2M4K A;  4L0Y B;  3O8G A;  4M3D A;  1FTZ A;  4RS8 A;  2L7F P;  3TKY A;  1R9T J;  4HAM A;  1U9N A;  4IQ4 A;  3KP4 A;  4D5C A;  1T33 A;  2CMP A;  4NQW A;  1U5T B;  4AUX A;  2JSP A;  1U5T C;  3CCV I;  3OWT A;  1W1W E;  3C7J A;  5IOY A;  3BG9 A;  4CYC B;  1XSV A;  3ZOB A;  2H94 A;  3LSJ A;  3EYI A;  4XLF A;  9ANT A;  2DFE A;  4A3J J;  1FSH A;  3MCZ A;  3ZMT A;  2R4G A;  2PJR A;  4LJZ F;  3S1Q J;  1SFK A;  5IT9 K;  2F5E A;  1U9O A;  1NH3 A;  1XB4 A;  2W00 A;  2JPC A;  5LGU A;  3JRI A;  2P81 A;  3HOV J;  4M6X A;  1FEX A;  1ETW A;  1V54 H;  3N05 A;  3KE2 A;  3QPL A;  2VT3 A;  3E1S A;  4L0Z B;  4BQQ A;  3HEF A;  1ODD A;  4ENM A;  1K4T A;  4KMU X;  3IH2 A;  1ERD A;  1XS9 A;  3HOZ J;  3H92 A;  5J47 A;  5FLV A;  2DW4 A;  5HLG A;  1HOM A;  1VQP I;  3DCF A;  2NOJ B;  4DOZ A;  3JRC A;  1UG0 A;  1FOW A;  3HRU A;  2B0L A;  4CCJ A;  3NQO A;  1O7F A;  3EPZ A;  3H9G A;  2BW3 A;  3HBL A;  2VPL A;  4E7S A;  3JW4 A;  4PGG A;  3G3Z A;  2CRG A;  1J9I A;  1OCO H;  3GFM A;  4WXH A;  4M6Y A;  3I4N J;  2CSO A;  3PFI A;  3SDB A;  5LHG A;  1EH8 A;  3H3V K;  1IRG A;  3J7A Y;  2DAO A;  1FT9 A;  4NNJ A;  1HF0 A;  3HOT A;  2KLO A;  4MFD A;  4BJ5 C;  2Z5U A;  5M5Y J;  3IAM 2;  4B8X A;  1A5J A;  3C1D A;  1LB2 A;  3CP8 A;  2HWV A;  1QHH D;  2EB7 A;  3BG7 A;  2QBY B;  1W36 C;  2Q2E B;  4CO8 A;  4CUG A;  1KQ0 A;  2JUC A;  2VQL A;  2EIK H;  5IYB J;  3CO6 C;  4N9I A;  3PSI A;  1QVT A;  2WAF A;  3IC7 A;  5DCF A;  2DA4 A;  5JR3 A;  5E18 F;  2M0M A;  2ZCW A;  5AIP A;  4Q47 A;  2BV6 A;  3OV8 A;  1G3T A;  3Q3S A;  1FJL A;  4ON0 A;  2J5P A;  4LFU A;  5D5W B;  3QU6 A;  4FX0 A;  3V4G A;  2PMU A;  1ZEL A;  1FC3 A;  4AIK A;  1HKS A;  5D5X B;  4B4C A;  5LLQ A;  3CMY A;  4XRF A;  1SFE A;  2CQQ A;  3LA7 A;  3EUH C;  5F0C A;  2QA4 I;  1SVM A;  1TT0 A;  1ZG5 A;  2M9H A;  4XKC A;  1GXP A;  4RAY A;  2MC3 A;  1W5C C;  4JP0 A;  2R5Z B;  5C4X J;  2L9R A;  3FKJ A;  2O0Y A;  4HDU A;  2M0C A;  1VQO I;  1YS7 A;  5TJJ A;  5IY5 H;  3DKW A;  2EIN H;  3ASO H;  3CDL A;  1W0T A;  3K4B A;  4II3 A;  5M3F J;  3IH4 A;  4MFE A;  1Y6I A;  4UNO A;  2WB1 N;  2GXG A;  1WVR A;  3OIQ A;  4DZJ A;  1BW6 A;  5D5U B;  3AG1 H;  1SVL A;  4F3Q A;  3OYC A;  1YLF A;  2M30 A;  5B66 C;  2R5Y B;  3H3U A;  2VBW A;  4XKB A;  2VXD A;  1P7I A;  1T08 B;  2I5U A;  3GTM J;  3HKZ A;  5KAF C;  4FIS A;  4OIP F;  3U2R A;  1U2W A;  1HST A;  2V9P A;  2K27 A;  3BCB A;  3QOD A;  4XK4 A;  2D1V A;  1NG7 A;  1T95 A;  3F9K A;  4GO1 A;  2PJR B;  1VFC A;  1U78 A;  1JKQ C;  3C18 A;  1IUY A;  3G73 A;  1ONV A;  4BQO A;  1LVA A;  2F4M B;  3DEW A;  3ZQH A;  1YRN B;  2KRH A;  3LSG A;  4XOP A;  3K4N A;  2XPV A;  3KLO A;  1BJZ A;  2H1K A;  1STZ A;  2GBY A;  4NB5 A;  2JT1 A;  4IF4 A;  1Z9C A;  4MGR A;  4DZP A;  4A0X A;  4HNU A;  4HLX A;  1I39 A;  2M8E A;  3BZK A;  3DBH B;  2NVQ J;  3Q5F A;  3CMA I;  2VQH A;  1L0O C;  5HNF A;  4ENJ A;  4XRS A;  4MIM A;  5HDK A;  3S1N J;  5CLS A;  5AIQ A;  3FHN A;  1XMK A;  4GRI A;  2Z99 A;  3QOE A;  2ZSI B;  4RAF A;  3VOE A;  3GLL A;  5FFX A;  3W3C A;  3W6K B;  3SJM A;  2A6H F;  1DGW Y;  2PFB A;  1GV5 A;  4M3F A;  4R8H A;  1R36 A;  1JKO C;  2CQ7 A;  4YG2 F;  4V2G A;  2K86 A;  1P4A A;  1WWX A;  1TW3 A;  3TP3 A;  2JSC A;  2X6Y A;  6PAX A;  3K10 A;  3OYB A;  1WFX A;  3K70 D;  1IJW C;  1FZP B;  2UUZ A;  3AG3 H;  4BH9 A;  2E35 A;  2M7B A;  4Y52 J;  4KT6 A;  2O5R A;  5F27 A;  1PUF B;  2LY2 A;  5HLI A;  2G7H A;  5DM6 F;  4G12 A;  5LEK A;  4HX4 A;  1Z7U A;  3JR9 A;  1Z6T A;  5ICG A;  3HRS A;  1E3H A;  2R7Z J;  2QBY A;  1K78 B;  4RM2 A;  4HPQ A;  2HKO A;  3J7A O;  5C3E J;  1KON A;  3JRG A;  2XAF A;  2GIZ A;  1I5Z A;  1XGS A;  4UUV A;  1R22 A;  2XKP A;  4J19 A;  3GUD A;  3E5U A;  4BBS J;  1IRZ A;  4CYC A;  3FMS A;  4M3E A;  3AKZ A;  3TQN A;  2HZD A;  3BR5 A;  4N0B A;  2LMD A;  3ZQF A;  1YJN I;  1H8A C;  4HQE A;  2IGO A;  5FFZ A;  2L02 A;  1T39 A;  2ZXJ A;  4IHX A;  2YR2 A;  3WTV C;  1F1Z A;  3DEU A;  1DP3 A;  4CZC A;  1BR2 A;  3PUF A;  2XAU A;  1LFU P;  2R7D A;  3WHB A;  4IHY A;  3QP6 A;  4CDG A;  1WJE A;  1X58 A;  2MLK A;  1DPU A;  2ETH A;  3KYC B;  4A3I J;  3WGI A;  1ZAR A;  2LRE A;  4AYB A;  4H4K C;  2A05 A;  3FBI B;  4AD9 A;  4BE2 A;  4KIS A;  1MZB A;  5E79 C;  5J3L A;  1Y56 A;  3L2R A;  3OS0 A;  2MC4 A;  2YSR A;  4IZZ A;  2IBD A;  4LB5 A;  1HKT A;  4I98 B;  1TTY A;  3HZJ A;  5DDG A;  2YS9 A;  3ZN0 A;  3F23 A;  1NG6 A;  3OR2 C;  2O61 A;  5GTH C;  2X1C A;  1R71 A;  1BM9 A;  3OY9 A;  2X51 A;  4RAZ A;  3IRQ A;  1CQT A;  2DA6 A;  1WQ2 A;  4B09 A;  3E6C C;  2W25 A;  4IHS A;  4L9J A;  2OJE D;  4CZZ A;  1REP C;  3DF8 A;  1XSD A;  4LLG F;  3N97 A;  5LHI A;  1HBX G;  5FRM A;  1XCB A;  1GLN A;  4DIQ A;  2E19 A;  2VJ5 A;  3KP5 A;  1YRN A;  2O7O A;  2Q8K A;  5GTI C;  3OYN A;  4B47 A;  3SZP A;  3CMM A;  5HVQ C;  4ZTJ A;  3Q9S A;  5F6F A;  1A36 A;  5CPR B;  3M3Y J;  2YU9 J;  1Y0N A;  2DA3 A;  2XIG A;  1O57 A;  4YRV A;  1ZLK A;  3K69 A;  4UXN A;  2IAI A;  4CXF A;  4NC7 A;  4IX7 A;  2H8W A;  1BI3 A;  2XB5 A;  3KZZ A;  4LK1 F;  2MH2 A;  3CLO A;  3GTK J;  2VJJ A;  5JHF A;  3L09 A;  1YG2 A;  1Z7L A;  4XOR A;  1Z6R A;  2XPU A;  3JRH A;  4ESJ A;  4A12 A;  3F8M A;  3L2V A;  2GOX B;  3L2C A;  1ZK8 A;  2XF5 A;  1IN5 A;  2PBI A;  3P5J A;  5GP9 A;  4EJO A;  3KZI C;  4WXD A;  3D5L A;  3H5R A;  1OYW A;  2ICW G;  5LGN A;  4HDV A;  3OYG A;  1GVD A;  1BOB A;  2XGC A;  3F0C A;  3F8B A;  2QQA A;  1SFO J;  2V1U A;  1HC8 A;  2ELK A;  4PCQ A;  2KJC A;  4I02 A;  4EJV A;  3CJR B;  3CF2 A;  1VND A;  4EM1 A;  2ZFU A;  1X1P A;  1YIJ I;  5EZH A;  4UVA A;  1UHS A;  4UY8 I;  4UUS A;  1A35 A;  1R1T A;  2ISZ A;  5H2F C;  3GCM A;  1JHF A;  2EV0 A;  4Z6Y A;  5L3F A;  3PO2 J;  3L2U A;  1B8I A;  3KEQ A;  1MH3 A;  3MKW B;  1BR4 A;  2R7S A;  1YW9 A;  4C30 A;  1Z21 A;  2QSG X;  2STW A;  3P9K A;  3QYF A;  3K1M A;  4BHC A;  5F08 A;  3T5X A;  4CGZ A;  4L5I A;  1WJ5 A;  4ITV A;  3FM5 A;  3TED A;  4RGS A;  3AAF A;  1G3W A;  4M71 A;  2ZXH A;  1SAU A;  3BTI A;  3DFG A;  1MMD A;  2L54 A;  3TW6 A;  2Y0M A;  2RRE A;  3QYB A;  2L7Z A;  5CVV A;  2OZ6 A;  3CD6 I;  1I50 J;  1D1C A;  1I6X A;  2EV5 A;  4A3C J;  4IHT A;  3A4C A;  2A6T A;  2EPF A;  3OYE A;  3I54 A;  3BTL A;  2JA6 J;  4A3E J;  2LH9 A;  1LJ9 A;  5B3S H;  5BPD A;  1Y39 A;  2W4S A;  5ICC A;  4KA4 A;  1ZH5 A;  1QRY A;  2VT2 A;  4I09 A;  3OS1 A;  2R7V A;  1TWG J;  2K9N A;  1R5H A;  3BJA A;  2HEO A;  2XAH A;  4N9H A;  5H6R A;  4E7L A;  1O3R A;  3WG9 A;  3BP8 A;  3LQR A;  4EQQ A;  3IKT A;  1AU7 A;  3ONQ A;  5D8K B;  2WAD A;  3KYL A;  1ON2 A;  2OA4 A;  3VWB A;  2HOA A;  3ECH A;  1IN4 A;  2XV4 S;  4JOM A;  4A0Y A;  4J01 A;  4HQM A;  2KQR A;  2P6T A;  2GWR A;  4RB2 C;  4IRG A;  2M45 A;  3Q0U A;  3HOS A;  2AHQ A;  4IPA A;  4MLO A;  1MNM C;  1NHA A;  3WOD F;  4BDZ A;  1IV6 A;  1IUF A;  1D8K A;  3L1P A;  3HG9 A;  4QPQ A;  2FOK A;  1R6R A;  2ZKZ A;  4FE7 A;  2CFX A;  3K4J A;  4NBQ A;  3FHZ A;  4BJ6 C;  1FMV A;  1QHG A;  2Y0S N;  3K1N A;  4UV9 A;  4XLA A;  2FNP A;  2YX4 A;  1OJL A;  3RKY A;  4FET A;  5LHH A;  3AL0 B;  1XTA A;  1E0E A;  4PJN A;  2PG4 A;  3K1P A;  2LG4 A;  2DA2 A;  3OL4 A;  4FQG A;  1H9G A;  2AXL A;  3BR2 A;  2V7F A;  5J4V A;  2OCC H;  2UWM A;  4W1U A;  3I3L A;  3T1B A;  3GX4 X;  4ZDP A;  2IS1 A;  2R92 J;  3ZCO A;  4ZYD A;  4AIJ A;  3SZT A;  3S3M A;  4A5N A;  5FKL A;  2LVS A;  4PJJ A;  3C2B A;  5EDN A;  3CLQ A;  5IT9 Z;  1MND A;  3WHC A;  4DYC A;  2ZB9 A;  3CCE I;  2GAU A;  2R5Z A;  4XKV A;  1U8B A;  2VE9 A;  3FXQ A;  4NQW B;  2OV7 A;  1UHW A;  4P9U A;  2XB0 X;  3C2G A;  4LLN A;  2PN6 A;  2F4O B;  5DEQ A;  4ZH4 F;  5DM7 F;  1K6Y A;  3NWT A;  4E7H A;  3A01 B;  5EEA A;  3CJQ B;  3ZXS A;  3GTQ J;  3CUQ A;  1JXS A;  2L0K A;  3LSP A;  3E6D A;  1UFM A;  1B9M A;  4UVB A;  2W84 A;  5E3L A;  2R5Y A;  3RZO J;  1ULY A;  2BEO A;  3BR3 A;  2MYS A;  2X1D A;  1RKW A;  4C2T A;  1B9N A;  1QPM A;  2VBX A;  2D2W A;  2K9Q A;  2IGK A;  2VBZ A;  3I9V 2;  1IDZ A;  4DYQ A;  1AKH A;  4CCL A;  3CF5 F;  2A07 F;  3LSH A;  4C9Y A;  2JMW A;  3RPU A;  3WGG A;  3E0J B;  2Y48 A;  5TIS C;  1Q1V A;  3LA3 A;  1LDK B;  3C3W A;  3HXL A;  3OOU A;  5FD6 A;  4ZDO A;  2R7U A;  1DDN A;  3A0B C;  2VLA A;  4HBL A;  1H9T A;  4BAC A;  4PSW A;  3JRF A;  1VI0 A;  3IH3 A;  1UEL B;  4OMZ A;  2V1X A;  3FBN B;  4CCM A;  2EZI A;  3OOP A;  2D5V A;  4ZTF A;  4EGY A;  1Z91 A;  3C2H A;  2IP2 A;  2K5C A;  1YO5 C;  2KRF A;  2IT0 A;  3M8J A;  3TDZ C;  4EJU A;  4QPO A;  1H88 C;  5GAE J;  5EYR A;  3A02 A;  2X6X A;  3WTS C;  5HOO A;  3E5X A;  2KKO A;  4MEY F;  3I55 I;  3H0G J;  2G7U A;  3BPX A;  4JX5 A;  2VOD A;  4XOT A;  3ISP A;  4OMY A;  3L9F A;  5EEG A;  4O6J A;  1ORK A;  1JUS A;  3OIP A;  3GXO A;  2OQG A;  4CCN A;  4Q48 A;  1IRX A;  1X3W B;  5L3E A;  1G8X A;  2LKP A;  3HOX J;  3KP7 A;  1SMT A;  1OYY A;  1OCC H;  4ZJZ A;  1D5Y A;  3HHH A;  1W5T A;  1Y1V J;  2CW0 F;  1RES A;  2F5V A;  4IOC F;  3EDP A;  1VQL I;  1X1A A;  2GXB A;  2ECB A;  2P5L C;  4Y13 A;  2R7X A;  1R49 A;  3CC4 I;  1XDS A;  3G2B A;  4M6V A;  4CHU A;  4KYW A;  2M87 A;  1GUU A;  1LPQ A;  3QPS A;  4U0W A;  1Y0U A;  2CU7 A;  4A2U A;  3SEQ A;  3HB9 A;  1UHM A;  1BIB A;  1R4M B;  2BZT A;  3W6J B;  2Q0O A;  5IYC J;  4WWC A;  3ML6 A;  4U7D A;  3GFI A;  2L9N A;  4L9V A;  2EZH A;  2EZL A;  4IHW A;  1JTY A;  2FF4 A;  3HGY A;  1TBX A;  1WJB A;  1XC5 A;  2A5W A;  2BYV E;  4HNT A;  3CCR I;  5BS6 A;  1GT0 C;  2QGU A;  1MW7 A;  4A3G J;  2K40 A;  3H36 A;  2QQB A;  3EUK L;  1U0J A;  4HF0 A;  1OIS A;  4XN3 A;  1D5V A;  4XON A;  1KU7 A;  5LBQ A;  3E6M A;  4PGH A;  3FXJ A;  2DOE A;  2E1M B;  3F3X A;  5HLH A;  1HLV A;  1O3S A;  4P96 A;  2VKD A;  4U7B A;  1V3F A;  5EJC A;  3R6S A;  3KYD B;  1TP4 A;  3GBG A;  3O2P E;  3QU3 A;  3GYH X;  1VQ7 I;  2ZJP F;  1YFH A;  4GGG A;  3RI4 A;  2PLY A;  2KZV A;  5L3B A;  2V6C A;  2DQL A;  5M5W J;  3GTP J;  2NS8 A;  2XPW A;  4G94 A;  4KMF A;  2AQF A;  1PP7 U;  1HXD A;  1VZ0 A;  1M1E B;  3REO A;  1OCZ H;  2LR8 A;  3H9J A;  1ETQ A;  3VB2 A;  2ZJQ F;  2DMQ A;  4II2 A;  3WU1 B;  2E7W A;  1P92 A;  3OYH A;  1XGO A;  3BJO A;  5F1J A;  1SD7 A;  3ABU A;  1ETO A;  1G59 A;  2Z16 A;  3U21 A;  4B48 A;  2DOF A;  1IC8 A;  4HV5 A;  2RV8 A;  2MBF A;  3L7W A;  4RB0 A;  5A2Q K;  4G6T B;  5F0H A;  1K78 A;  2A3S A;  2MLG A;  2EV6 A;  5L3C A;  3BT9 A;  3MD2 A;  4BE1 A;  4UB6 C;  2CO5 A;  4IL6 C;  2RC4 A;  4PFO A;  5TGT A;  3ABM H;  2OQR A;  5D8L B;  3LSR A;  5H20 A;  1XCV A;  2PI0 A;  4NHJ A;  4D7N A;  1Z3X A;  1MH4 A;  2DXI A;  1FOK A;  3DBL B;  3BR1 A;  3PQK A;  2BOL A;  2RN7 A;  3S2D J;  3W2W A;  3HRT A;  2FX0 A;  2JZY A;  5LFA A;  2R7W A;  2WV0 A;  3A0H C;  2D1H A;  3MQ0 A;  4LLL A;  2RDP A;  2EIJ H;  1ZG3 A;  2P5V A;  2HVR A;  3HTS B;  3F6V A;  5FGM A;  1J2X A;  4M3G A;  3LA2 A;  2DU9 A;  3SDG A;  1ITY A;  2F5C A;  2HYG D;  2XUB A;  1IV8 A;  3ZMD A;  1WJC A;  2CUF A;  2DA1 A;  3QWL A;  3RPU D;  4ESF A;  3CCJ I;  3K2A A;  2DT5 A;  2R7R A;  3T8T A;  2CS3 A;  1VQ9 I;  2QSH X;  3RQI A;  5JLX A;  1JTX A;  4Z2Y A;  2EBI A;  2WA0 A;  3WTT C;  5LD2 C;  3RKX A;  2DA5 A;  5EGO B;  4HX8 A;  4MNU A;  3PQJ A;  1J75 A;  3JAM Z;  1HKQ A;  5E1Z B;  2ESH A;  4RM3 A;  3PSF A;  1OKR A;  3KLN A;  2Y2Z A;  1AKH B;  3F8C A;  1BI2 A;  2Z1D A;  1PDN C;  3GZ6 A;  2MGQ A;  1I27 A;  1IDY A;  4HV6 A;  3W6V A;  1JKR C;  4N4O B;  2H6C A;  1WZ2 A;  3QAH A;  1SAN A;  2EFQ A;  3RQ4 A;  2VQG A;  3S8P A;  4NC8 A;  1U3E M;  2DQR A;  1X1B A;  1D1B A;  2DLL A;  3PIO F;  2WB1 A;  2Y69 H;  1G6N A;  2EZK A;  4UV8 A;  2TCT A;  1G4D A;  3HSF A;  2K9S A;  4IOA F;  2R0Q C;  2FSW A;  2P7C B;  4BDY A;  5GPA A;  1S3J A;  1N75 A;  1L3L A;  4FE4 A;  4QTR A;  4V2F A;  2AQE A;  2QZ8 A;  3IV5 A;  1O4X A;  2K4J A;  2ADU A;  3Q0V A;  3V7C A;  4BQN A;  4C2M J;  4Y17 A;  1TZL A;  2O8X A;  1A31 A;  5EZG A;  3WTW C;  2LKX A;  2XRN A;  1IF1 A;  1V5F A;  5E1W A;  3DP7 A;  4X0G A;  2O8K A;  3MAJ A;  3A1Y A;  1YHQ I;  1K4S A;  4BY1 J;  3B73 A;  2DA7 A;  3VYU B;  1T56 A;  2VJI A;  2W48 A;  3V8J A;  4WK8 F;  2EFP A;  2MD5 A;  2R7T A;  2UXX A;  3G1M A;  3M7G A;  4XLE A;  4M3B A;  2EFN A;  4B3A A;  2PX9 A;  1YIT I;  1SD4 A;  1R5G A;  3E6B A;  3ROU A;  4XBF A;  1ZGA A;  4ZDL A;  1IW7 F;  1XN7 A;  1GDT A;  4XQF A;  5F04 A;  2DN0 A;  3TO7 A;  1G3S A;  4WF2 A;  4XL9 A;  4BEH A;  4KUM A;  5B1B H;  3OYM A;  2DPD A;  2E2J J;  5ILU A;  1MBG A;  3OYK A;  1B8I B;  4EAT A;  4RGU A;  1LNW A;  4PJL A;  4GFB A;  2LFB A;  4A93 J;  2HQA A;  1FPQ A;  5ILV A;  1O3T A;  3J7Y J;  3U1D A;  2RGV A;  1LFB A;  2J5O A;  1ZRD A;  1PVE A;  3BZ6 A;  5K5R A;  4GDF A;  1VQ4 I;  4XMY A;  5GAG J;  1QZE A;  3B6A A;  4RA2 A;  1T6S A;  2Z2S B;  2NVU B;  3CC2 I;  3JCU C;  2L7K A;  2FJ1 A;  2IA2 A;  1RRJ A;  1IRF A;  3VFZ A;  5K5Q A;  3ZN1 A;  1FP2 A;  3OIO A;  1ZAO A;  2FML A;  1BBY A;  3GFL A;  3HIF A;  3HKZ N;  4CA0 A;  2C6Y A;  1JJ6 C;  1FBS A;  3RSN A;  1LQ1 A;  4EJT A;  1IN7 A;  2L01 A;  4YFX F;  3TBI A;  3CCU I;  1I6H J;  3BTC A;  2HR3 A;  5EG0 A;  4M74 A;  3SQN A;  1Y8Q B;  3RYP A;  1T98 A;  1K61 A;  2H27 A;  4RDU A;  1UMQ A;  3CTA A;  1ETK A;  3DKX A;  3DLA A;  3EQL F;  4BJT A;  3JRA A;  2WAQ A;  1FIA A;  2DMT A;  3JSP A;  5E17 F;  4E7K A;  1Z77 A;  1ON1 A;  1A6I A;  2FEZ A;  4OWR B;  4Y33 A;  4MTD A;  2E2I J;  2L5Q A;  1VF9 A;  2XC7 A;  2XGD A;  2CUJ A;  1D0Z A;  2A61 A;  5M3M J;  1YX5 A;  3COA C;  2IS2 A;  3ZQI A;  3FMR A;  3BY6 A;  2E2H J;  1B72 A;  3VOD A;  2Y75 A;  3MN2 A;  2VON A;  1U6G A;  3MKZ A;  1B59 A;  1O7L A;  2Y31 A;  3LFK A;  2ZJR F;  3HJE A;  1YIO A;  4C3J J;  1WSU A;  1K83 J;  2A69 F;  4UB8 C;  1MKM A;  4F91 B;  1ZG1 A;  1S9H A;  2ME0 A;  4MQ9 F;  5CKT A;  1OCR H;  2V1N A;  3V8L A;  2ESN A;  3JTG A;  1JUM A;  3V8K A;  2AXT C;  3CME I;  1R58 A;  4PJM A;  1G2H A;  5FKO A;  1VQ6 I;  2X0L A;  2IW5 A;  2LF8 A;  2BHZ A;  2XGX A;  3ABT A;  2XDV A;  2ZXI A;  4S0H B;  4CH7 A;  2A68 F;  2LC2 A;  2M5W A;  2M8G X;  5D5V B;  2PMH A;  3K4L A;  1LEB A;  1KYZ A;  4UUS B;  1DQU A;  1PUE E; 
#chains in the Genus database with same CATH homology
 1ZHF A;  2K02 A;  2IA1 A;  2QYO A;  3DQV C;  3GF2 A;  3ZP5 A;  1UB9 A;  1V4R A;  4EM2 A;  5ICF A;  1HW2 A;  4HZF A;  2XHK A;  1HQC A;  4Q4Z F;  3I59 B;  5CVI A;  2PJP A;  4M9X A;  1T38 A;  5E8G A;  4IXA A;  4DQ2 A;  3FXR A;  3F8F A;  2XAJ A;  3E97 A;  3RJP A;  1B4A A;  1HW5 A;  1I1S A;  4M72 A;  4AIH A;  4A5M A;  3F22 A;  3F72 A;  1LEA A;  1R1U A;  3LST A;  1FX7 A;  5BMZ A;  4L18 B;  4G7O F;  3WTX C;  5CJ9 A;  4AVP A;  3WTU C;  2F5F A;  4ENK A;  3KZY A;  5ICE A;  2MA3 A;  1JGS A;  1XD7 A;  4KN7 X;  1DPR A;  2DTR A;  4LG0 B;  2IRF G;  2QQ9 A;  4S05 A;  1R1V A;  4L9T A;  2EA2 A;  1QBJ A;  1VTN C;  3QPT A;  5DUI A;  1WKM A;  1K6O A;  3U9G A;  2Z9O A;  1QQI A;  2CQK A;  3LAJ A;  4I2O A;  2O3F A;  5H6Q A;  2WWY A;  2E1N A;  2HGC A;  3FXU A;  1HW1 A;  2LDU A;  1Q1H A;  1SAX A;  2DK8 A;  3ULQ B;  2HYF A;  1KU3 A;  5DCM B;  2CYY A;  4JBA A;  2VC1 A;  3F6O A;  3KET A;  4HW0 A;  2HQN A;  3T8R A;  5J6X A;  5JHU A;  3GFJ A;  1SD5 A;  3IL2 A;  4KIG A;  4FHT A;  3MFK A;  1BIA A;  4RGR A;  2EJR A;  3RKW A;  4F7Z A;  2DI3 A;  1IAW A;  3SHF A;  2K7L A;  5CVU A;  5FO5 A;  3E3V A;  2VE8 A;  5J8F A;  2Z33 A;  1FWZ A;  1DP7 P;  2ISY A;  2M1B A;  4XLN F;  1MDM B;  1W5S A;  2H6B A;  1KGS A;  2BBY A;  4HOB A;  1BC8 C;  2EFO A;  1IN8 A;  4I0B A;  3TOB A;  1IZ1 A;  4KIB A;  2GZW A;  4KIF A;  3ZMU A;  3ZQ7 A;  1SFX A;  4ASN A;  5HDN A;  1FYM A;  1CGP A;  1R00 A;  3ELK A;  3ZMS A;  1FBQ A;  3EET A;  5K5O A;  3M1E A;  4PDK A;  1KU2 A;  3M8E A;  4R1H A;  2JRT A;  4WXC A;  1EV7 A;  2P8T A;  5D6F A;  2FBH A;  1FSE A;  1S8N A;  3M9A A;  4A6E A;  2F5D A;  2IVM A;  2KIU A;  2P6S A;  4RGX A;  4HF2 A;  3I59 A;  4L9N A;  2YU3 A;  2COM A;  1R23 A;  4JK1 X;  1YYV A;  3V7R A;  2O6G E;  4Y15 A;  3LAP A;  1OMI A;  4EVI A;  4K2E A;  4MTE A;  3SXY A;  4EV0 A;  1CF7 B;  4I7H A;  5HS9 A;  4KNY A;  2ZJ2 A;  5DV5 A;  1HSJ A;  2YPR A;  5A2Q Z;  3TDU C;  3FZV A;  2XRO A;  4EGZ A;  2BGC A;  2QM3 A;  3D0S A;  1W7P A;  2E1C A;  4OIQ F;  2HKX A;  2UZK A;  2LF7 A;  2ZO4 A;  4OIN F;  4G9Y A;  3DV8 A;  4HLY A;  2PQ8 A;  2QWW A;  1QO0 D;  1IN6 A;  4OOI A;  3ZMV A;  1J0R A;  2P7V B;  4IRI A;  2HDC A;  1LDD A;  4EJW A;  2KIM A;  4G6D A;  3JAM K;  4IJA A;  1ZRC A;  2JPB A;  2FMY A;  3I71 A;  2IJL A;  3NEU A;  5TRD A;  1KQ8 A;  1JHH A;  3GVA A;  4BXU A;  4GYI A;  3BWG A;  1MJB A;  3TGN A;  4WCG A;  4OIR F;  1FLI A;  1D8J A;  4AWX B;  1XGN A;  2ZNY A;  5LRR A;  4ZZD A;  4I0A A;  2HTJ A;  2XKO A;  1AOY A;  2DPU A;  3FM3 A;  1QZY A;  3P9C A;  2EK5 A;  2FXA A;  3IHU A;  4HA8 A;  1P4W A;  5CVR A;  1YTY A;  1BC7 C;  1QNT A;  2P5K A;  4G7Z F;  1OYI A;  2QLZ A;  2FBI A;  1U5T A;  1J59 A;  4YFN F;  1JE8 A;  2FNA A;  3T0Y A;  5D4R A;  4H0E A;  2OBP A;  3WE3 A;  1W7P D;  1UCR A;  4KT5 C;  5F1R A;  3I5U A;  1CF7 A;  2DO7 A;  4MHG A;  5FLX Z;  3VEP A;  1BI0 A;  4KFC A;  2QVO A;  4Q5S F;  2PEX A;  3R0A A;  1H0M A;  3KFW X;  5CVJ A;  1Z05 A;  4HF1 A;  2XAS A;  1TQP A;  1FYL A;  2F2E A;  2D45 A;  2HFH A;  1Z1D A;  1SD6 A;  3P9I A;  3BPV A;  5L3G A;  2FU4 A;  2E7X A;  2LSO A;  3WTY C;  4L5J A;  2HZT A;  2G9W A;  1P6R A;  2OD5 A;  1C0W A;  1F9N A;  3QRF F;  2O03 A;  3GEZ A;  2R3S A;  3GO5 A;  1R7J A;  3GZ5 A;  4G8X A;  4YFK F;  2RNJ A;  1K79 A;  1TNS A;  3I58 A;  2V79 A;  2OAZ A;  3V7S A;  4FT8 A;  1EH6 A;  3RTR A;  3O3K A;  2OU2 A;  3EUH A;  4G6Q A;  1MJ9 A;  3FWE A;  1RUO A;  2A5Y B;  1P4X A;  2VOO A;  1XSX A;  1A04 A;  1BJA A;  4RB1 A;  2DBB A;  1AWC A;  2NNY A;  3O6B B;  3K0L A;  3E5Q A;  1YW7 A;  2MH9 A;  3B02 A;  3JTH A;  4P55 A;  3J80 K;  4O5V A;  1UST A;  4U88 A;  1XMA A;  1YS6 A;  2HOE A;  3MEX A;  3I53 A;  5ED4 A;  3KP6 A;  1RZ4 A;  2A6E F;  3F8N A;  3QP5 A;  5BPI A;  2GA1 A;  5D6E A;  2W24 A;  5D4S A;  4U0V A;  4LK0 F;  1SMY F;  1WI9 A;  1J5Y A;  4IVN A;  1FNN A;  2STT A;  1WRJ A;  3KP3 A;  4P5O A;  3WGH A;  1ZLJ A;  1IXC A;  5DD8 A;  2FQ3 A;  3DXJ F;  2DK5 A;  3JSO A;  2Q2E A;  2AS5 F;  5DYM A;  3R0J A;  4KIC A;  5ILS A;  3HHG A;  3RYR A;  4QWQ A;  1RUN A;  4E70 A;  3RIR A;  1MD0 A;  2NYX A;  3Q9V A;  2ZME A;  3FMQ A;  1T2K A;  3J81 K;  4OU0 A;  4M9S A;  3WE2 A;  1FY7 A;  1P2F A;  3P7N A;  2X4H A;  1QZZ A;  4BYY A;  2RKH A;  3GLX A;  3MZY A;  1FYK A;  3CJN A;  3SFZ A;  5LRS A;  3R4K A;  2RVC A;  1KU9 A;  1D3Y A;  1SFU A;  3IRR A;  4HX7 A;  2FBK A;  1TQI A;  4BAY A;  2V9V A;  2L3D A;  2ACJ A;  1I1G A;  2ZBK A;  2V1D A;  2ZFW A;  5JVT A;  1XGM A;  4R79 A;  3CUO A;  3ERE D;  5FD5 A;  1BN5 A;  1KYW A;  3GWZ A;  4BQA A;  2BE5 F;  2QEN A;  5DUK A;  2HQR A;  2NNN A;  3HSE A;  3KCC A;  1TNT A;  5BQT A;  4LGW A;  5ERI A;  2P4W A;  2FE3 A;  4MEX F;  5FLX K;  4ESB A;  2R7F A;  1RIO H;  4LG0 A;  2QUF A;  3TO6 A;  1MJA A;  1FBU A;  2FA5 A;  4BHB A;  5EEH A;  4XSX F;  5F64 A;  3LWF A;  3M8F A;  4TV7 A;  2IPQ X;  5BOX A;  1F5T A;  4S04 A;  3HYI A;  3KP2 A;  4EMS A;  1BOA A;  1QGP A;  3I4P A;  1ZYR F;  1YW8 A;  3J80 Z;  1S6L A;  2EA4 A;  4ETS A;  3ZPL A;  1YQA A;  4ZYG A;  5DCM A;  4WX9 A;  2YX7 A;  2VOP A;  1OR7 A;  3QPH A;  5L3D A;  4ZZL A;  4IRH A;  2ZME B;  4UHT A;  5AON A;  1X3U A;  3TO9 A;  4CIC A;  2NS0 A;  1RI7 A;  4GXO A;  2UXN A;  3IKV A;  3HRM A;  4JQF A;  1J7K A;  4U0Y A;  5IT3 A;  1DUX C;  5HS7 A;  2ELH A;  2W57 A;  4YII A;  4GYG A;  1F4K A;  3NRV A;  3TOA A;  1PP8 F;  3CUQ B;  3BRO A;  4D0P A;  2WTE A;  1GVJ A;  1T0F A;  2VXZ A;  5HS8 A;  3L00 A;  3CDH A;  3F21 A;  2KJB A;  4KN4 X;  2XAQ A;  3WTZ A;  4ZYE A;  3ZMZ A;  2GA2 A;  1B6A A;  2GIV A;  4LB6 B;  4CYD A;  4FX4 A;  4KDP A;  2Z3Y A;  2ZNZ A;  1E17 A;  3I64 A;  4P9F A;  5CYV A;  2L4A A;  3FX3 A;  1O3Q A;  5K1Y A;  2XVC A;  2EFW A;  3LQQ A;  4MQV A;  3K2Z A;  4G7H F;  1W7P B;  2RQP A;  5KVR A;  2FRH A;  5KK1 A;  4A0Z A;  3ECO A;  2DFI A;  2CG4 A;  2HTS A;  1S7O A;  5HDG A;  1IXS B;  3HUG A;  2VBY A;  3IWF A;  2XAG A;  5JFR A;  2JTV A;  4ZYH A;  4XSZ F;  1S7A A;  2H09 A;  3HTU A;  3EYY A;  3BJ6 A;  1BI1 A;  1KQ9 A;  1FP1 D;  2VN2 A;  3K9T A;  2HS5 A;  2LNB A;  3I0T A;  4XLP F;  1K7A A;  1ZN2 A;  1OPC A;  1IXR C;  1EH7 A;  4QLC U;  4I01 A;  3J81 Z;  2CGP A;  2VC0 A;  3BOQ A;  5LEJ A;  2OZU A;  1KA8 A;  5E8I A;  4UVC A;  4OIO F;  3WU0 A;  3BDD A;  3IWZ A;  5J8C A;  4A6D A;  1GXQ A;  1MGT A;  3MWM A;  1XDU A;  2TDX A;  1ZRF A;  2EWN A;  3HSR A;  1G3Y A;  4DNC A;  1RNL A;  5E1X A;  5FB2 A;  1GHC A;  3RPQ A;  2IA0 A;  1LDJ A;  1USS A;  2KIF A;  1E2X A;  1U8R A;  3CUQ C;  2K4B A;  2WC2 A;  1S29 A;  2NAZ A;  1MDM A;  5JI6 A;  2W85 A;  3H3Z A;  1TW2 A;  4BNC A;  5LGT A;  3N4M A;  4O3M A;  4M73 A;  4LD5 A;  5DD4 A;  3GW2 A;  4M9Z A;  4EM0 B;  4LMY A;  4RB3 C;  4HYE A;  3CO7 C;  4GCV A;  3S2W A;  1B1B A;  5E20 A;  1ZRE A;  4ENN A;  3QOP A;  1W4M A;  4BHP A;  3KEO A;  1TLH B;  4YIF A;  2CWE A;  1TQM A;  3DPT A;  3MZH A;  3FF5 A;  3R60 A;  2GQQ A;  3RDI A;  1ZGJ A;  2L4M A;  3DPL C;  3R61 A;  2NRA C;  4PZJ A;  4L0Y B;  4RS8 A;  3TKY A;  4HAM A;  3KP4 A;  4NQW A;  1U5T B;  1U5T C;  3C7J A;  1XSV A;  2H94 A;  3EYI A;  1FSH A;  3MCZ A;  3ZMT A;  4LJZ F;  5IT9 K;  2F5E A;  1XB4 A;  2JPC A;  5LGU A;  4M6X A;  3KE2 A;  2VT3 A;  4L0Z B;  1ODD A;  4ENM A;  4KMU X;  3H92 A;  2DW4 A;  5HLG A;  3HRU A;  2B0L A;  3NQO A;  1O7F A;  3JW4 A;  4PGG A;  3G3Z A;  1J9I A;  3GFM A;  4WXH A;  4M6Y A;  2CSO A;  3PFI A;  5LHG A;  1EH8 A;  1IRG A;  2DAO A;  1FT9 A;  3HOT A;  2Z5U A;  4B8X A;  3C1D A;  1LB2 A;  2HWV A;  2EB7 A;  2QBY B;  4CO8 A;  1KQ0 A;  3CO6 C;  4N9I A;  3IC7 A;  5DCF A;  5JR3 A;  5E18 F;  2ZCW A;  5AIP A;  4Q47 A;  2BV6 A;  3OV8 A;  1G3T A;  4ON0 A;  2J5P A;  4LFU A;  5D5W B;  3QU6 A;  4FX0 A;  3V4G A;  2PMU A;  4AIK A;  1FC3 A;  1HKS A;  5D5X B;  5LLQ A;  4XRF A;  1SFE A;  3LA7 A;  1ZG5 A;  1GXP A;  4RAY A;  2MC3 A;  2O0Y A;  4HDU A;  1YS7 A;  5TJJ A;  3DKW A;  4UNO A;  2GXG A;  5D5U B;  1YLF A;  2M30 A;  3H3U A;  2VBW A;  4OIP F;  3U2R A;  1U2W A;  1HST A;  2K27 A;  2D1V A;  4GO1 A;  1U78 A;  3C18 A;  1IUY A;  3G73 A;  1ONV A;  1LVA A;  3KLO A;  1STZ A;  4NB5 A;  2JT1 A;  4IF4 A;  1Z9C A;  4MGR A;  4A0X A;  4HLX A;  2M8E A;  3Q5F A;  1L0O C;  4ENJ A;  5HDK A;  5CLS A;  5AIQ A;  1XMK A;  2Z99 A;  3VOE A;  5FFX A;  3W6K B;  2A6H F;  2PFB A;  4R8H A;  1R36 A;  4YG2 F;  2K86 A;  1P4A A;  1WWX A;  1TW3 A;  2JSC A;  6PAX A;  1FZP B;  4BH9 A;  5HLI A;  2G7H A;  5LEK A;  4HX4 A;  1Z7U A;  1Z6T A;  5ICG A;  3HRS A;  2QBY A;  1K78 B;  2HKO A;  3J7A O;  2XAF A;  1I5Z A;  1XGS A;  4UUV A;  1R22 A;  2XKP A;  3GUD A;  3E5U A;  3FMS A;  3TQN A;  4N0B A;  4HQE A;  5FFZ A;  2L02 A;  1T39 A;  2ZXJ A;  2YR2 A;  3WTV C;  1F1Z A;  3DEU A;  2R7D A;  3QP6 A;  4CDG A;  2MLK A;  1DPU A;  2ETH A;  3WGI A;  1ZAR A;  4AD9 A;  1MZB A;  2YSR A;  1HKT A;  4LB5 A;  4I98 B;  1TTY A;  5DDG A;  3ZN0 A;  3F23 A;  2O61 A;  1BM9 A;  4RAZ A;  3IRQ A;  1WQ2 A;  4B09 A;  3E6C C;  2W25 A;  4IHS A;  4L9J A;  1REP C;  4CZZ A;  3DF8 A;  1XSD A;  4LLG F;  3N97 A;  5LHI A;  1HBX G;  1XCB A;  3KP5 A;  2Q8K A;  3SZP A;  5HVQ C;  3Q9S A;  5F6F A;  2XIG A;  1O57 A;  1ZLK A;  3K69 A;  4UXN A;  4CXF A;  1BI3 A;  3KZZ A;  4LK1 F;  2MH2 A;  3CLO A;  4ESJ A;  3L09 A;  1YG2 A;  1Z6R A;  4A12 A;  3F8M A;  3L2C A;  1IN5 A;  2PBI A;  4EJO A;  4WXD A;  3D5L A;  5LGN A;  1OYW A;  4HDV A;  3F8B A;  2QQA A;  2V1U A;  4PCQ A;  2KJC A;  4I02 A;  4EJV A;  4EM1 A;  4UVA A;  1R1T A;  2ISZ A;  1JHF A;  2EV0 A;  5L3F A;  3KEQ A;  1YW9 A;  2STW A;  3P9K A;  3K1M A;  4BHC A;  3T5X A;  4CGZ A;  4L5I A;  3FM5 A;  4RGS A;  3AAF A;  1G3W A;  4M71 A;  3DFG A;  2L54 A;  2Y0M A;  5CVV A;  2OZ6 A;  1I6X A;  2EV5 A;  4IHT A;  3I54 A;  1LJ9 A;  5BPD A;  5ICC A;  1ZH5 A;  4KA4 A;  2VT2 A;  4I09 A;  1R5H A;  3BJA A;  2HEO A;  2XAH A;  4N9H A;  5H6R A;  1O3R A;  3WG9 A;  3BP8 A;  3LQR A;  4EQQ A;  3IKT A;  5D8K B;  1ON2 A;  2OA4 A;  3ECH A;  1IN4 A;  2XV4 S;  4A0Y A;  4HQM A;  2P6T A;  2GWR A;  4RB2 C;  4IRG A;  2M45 A;  3HOS A;  4IPA A;  1NHA A;  3WOD F;  1D8K A;  2FOK A;  2ZKZ A;  2CFX A;  3FHZ A;  3K1N A;  4UV9 A;  2FNP A;  2YX4 A;  3RKY A;  5LHH A;  2PG4 A;  3K1P A;  1H9G A;  2AXL A;  2UWM A;  3T1B A;  3GX4 X;  4ZYD A;  4AIJ A;  3SZT A;  4A5N A;  5IT9 Z;  2GAU A;  2VE9 A;  3FXQ A;  1UHW A;  4P9U A;  4LLN A;  2PN6 A;  5DEQ A;  4ZH4 F;  3CUQ A;  1JXS A;  3E6D A;  1UFM A;  1B9M A;  4UVB A;  2W84 A;  1ULY A;  2BEO A;  1B9N A;  1QPM A;  2VBX A;  2D2W A;  2VBZ A;  2A07 F;  3RPU A;  3WGG A;  2Y48 A;  3LA3 A;  1LDK B;  3C3W A;  5FD6 A;  1DDN A;  4HBL A;  1H9T A;  4OMZ A;  2V1X A;  3OOP A;  4EGY A;  1Z91 A;  2IP2 A;  1YO5 C;  2KRF A;  2IT0 A;  3TDZ C;  4EJU A;  3WTS C;  5HOO A;  3E5X A;  2KKO A;  4MEY F;  2G7U A;  3BPX A;  2VOD A;  3ISP A;  4OMY A;  3L9F A;  5EEG A;  4O6J A;  3GXO A;  2OQG A;  4Q48 A;  5L3E A;  2LKP A;  3KP7 A;  1SMT A;  1OYY A;  3HHH A;  1W5T A;  2CW0 F;  3EDP A;  2GXB A;  2P5L C;  4Y13 A;  1XDS A;  4CHU A;  4KYW A;  2M87 A;  4U0W A;  1Y0U A;  4A2U A;  1UHM A;  1BIB A;  4WWC A;  3W6J B;  2Q0O A;  3ML6 A;  4U7D A;  3GFI A;  4L9V A;  2FF4 A;  1TBX A;  2BYV E;  5BS6 A;  2QQB A;  4HF0 A;  1D5V A;  1KU7 A;  5LBQ A;  3E6M A;  4PGH A;  3F3X A;  5HLH A;  1O3S A;  4P96 A;  4U7B A;  1V3F A;  3R6S A;  3QU3 A;  3O2P E;  3GYH X;  1YFH A;  4GGG A;  3RI4 A;  2PLY A;  5L3B A;  2V6C A;  2DQL A;  4G94 A;  4KMF A;  1PP7 U;  1HXD A;  3REO A;  3VB2 A;  3WU1 B;  2E7W A;  1P92 A;  1XGO A;  3BJO A;  1SD7 A;  3ABU A;  4HV5 A;  2RV8 A;  2MBF A;  3L7W A;  4RB0 A;  5A2Q K;  1K78 A;  2A3S A;  2MLG A;  2EV6 A;  5L3C A;  2CO5 A;  2RC4 A;  5D8L B;  2OQR A;  5H20 A;  1XCV A;  2PI0 A;  4NHJ A;  1FOK A;  3PQK A;  2RN7 A;  3HRT A;  2JZY A;  2WV0 A;  2D1H A;  3MQ0 A;  4LLL A;  2RDP A;  1ZG3 A;  2P5V A;  3HTS B;  3F6V A;  5FGM A;  1J2X A;  3LA2 A;  2DU9 A;  2F5C A;  2HYG D;  2XUB A;  3ZMD A;  4ESF A;  2DT5 A;  3T8T A;  4Z2Y A;  3WTT C;  3RKX A;  4HX8 A;  4MNU A;  3PQJ A;  1J75 A;  3JAM Z;  1HKQ A;  5E1Z B;  2ESH A;  1OKR A;  3KLN A;  3F8C A;  1BI2 A;  1PDN C;  3GZ6 A;  1I27 A;  4HV6 A;  2H6C A;  3QAH A;  2EFQ A;  1U3E M;  2DQR A;  2DLL A;  1G6N A;  4UV8 A;  1G4D A;  3HSF A;  2FSW A;  2P7C B;  1S3J A;  1L3L A;  2QZ8 A;  2K4J A;  2ADU A;  3V7C A;  4Y17 A;  2O8X A;  3WTW C;  2XRN A;  1IF1 A;  5E1W A;  3DP7 A;  3MAJ A;  3B73 A;  4WK8 F;  3V8J A;  2EFP A;  2MD5 A;  2UXX A;  3M7G A;  2EFN A;  1R5G A;  1SD4 A;  3E6B A;  3ROU A;  4XBF A;  1ZGA A;  1XN7 A;  1IW7 F;  3TO7 A;  1G3S A;  4WF2 A;  4KUM A;  2DPD A;  5ILU A;  4RGU A;  1LNW A;  1O3T A;  1FPQ A;  5ILV A;  3U1D A;  2RGV A;  2J5O A;  1ZRD A;  3BZ6 A;  5K5R A;  1T6S A;  2IA2 A;  1IRF A;  3VFZ A;  5K5Q A;  3ZN1 A;  1FP2 A;  1ZAO A;  2C6Y A;  2FML A;  1BBY A;  3GFL A;  3HIF A;  1FBS A;  1LQ1 A;  4EJT A;  1IN7 A;  2L01 A;  4YFX F;  2HR3 A;  4M74 A;  3SQN A;  3RYP A;  1T98 A;  2H27 A;  3CTA A;  3EQL F;  3JSP A;  5E17 F;  1ON1 A;  2FEZ A;  4MTD A;  2A61 A;  3COA C;  3FMR A;  3BY6 A;  3VOD A;  2Y75 A;  2VON A;  1U6G A;  1B59 A;  1O7L A;  3LFK A;  1YIO A;  1WSU A;  2A69 F;  1MKM A;  1ZG1 A;  4MQ9 F;  3V8L A;  2ESN A;  3JTG A;  3V8K A;  1R58 A;  2X0L A;  2IW5 A;  2LF8 A;  2XGX A;  3ABT A;  2A68 F;  2M5W A;  5D5V B;  2PMH A;  1LEB A;  1KYZ A;  1PUE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...