2EFWA

Crystal structure of the rtp:nrb complex from bacillus subtilis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEVYRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVELDRSKKLIEKALSDNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*DCP*DT*DAP*DTP*DGP*DTP*DAP*DCP*DCP*DAP*DAP*DAP*DT
publication title An asymmetric structure of the Bacillus subtilis replication terminator protein in complex with DNA
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication/dna
total genus 40
structure length 115
sequence length 115
chains with identical sequence B, F, G
ec nomenclature
pdb deposition date 2007-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02334 RTP Replication terminator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2efwA00
1CGPA 4IF4A 2XHKA 2BGCA 2OQGA 2P6TA 5LEKA 5EEGA 3V7SA 1FC3A 3BPVA 4ENKA 3DXJF 1U6GA 1E2XA 3KP6A 4KT5C 5J6XA 5L3EA 3HOTA 2DFIA 3E6BA 2CSOA 3M8FA 4BQAA 2IA2A 4PDKA 4UVCA 3TO7A 2DBBA 1A04A 3QP6A 3HOSA 3GZ6A 2A6EF 1UB9A 1J5YA 3I59B 2QQBA 4EM2A 2X0LA 2M1BA 2D1VA 3JSOA 1KQ8A 1Z05A 5D4SA 1K6OA 2GA1A 3DEUA 4U88A 3T8TA 3L2CA 3ZMUA 5BQTA 1T98A 1T0FA 2VOOA 1FBSA 1R5HA 1SAXA 3RPQA 1KYZA 2P5LC 3KP4A 5ICFA 2BBYA 1TW2A 3CUQC 3QPTA 2M87A 4L9JA 2DK5A 1S8NA 2GZWA 2HDCA 2FU4A 5ICGA 3B73A 2O8XA 2DAOA 3KLNA 1RUOA 4YFKF 2IPQX 4QWQA 2ZXJA 4UVBA 1KU9A 1HBXG 1GXQA 3HRMA 1ON2A 2HWVA 1IXRC 4L18B 3BJ6A 3D0SA 1FY7A 4IXAA 4ZZLA 4HBLA 3E5QA 4KA4A 3LWFA 4A0XA 5E1ZB 4GYGA 1T39A 2L02A 4OU0A 5AONA 5K5OA 2J5PA 5DUKA 2L4AA 4LD5A 3M8EA 4Q4ZF 3HRTA 2ESHA 1ZG5A 3EDPA 1WWXA 4KN7X 3EYIA 2YX4A 2ETHA 3T0YA 2FOKA 5E8IA 2CW0F 1C0WA 2UXNA 2P5KA 4LK0F 2PI0A 2YR2A 2QQ9A 4CGZA 3DPTA 4OOIA 3R6SA 1QGPA 4G7OF 2VT2A 5J8FA 1HW1A 5E17F 3QU6A 1LB2A 1FX7A 3BPXA 4ESJA 5D5UB 3GLXA 4IJAA 2VXZA 3TOAA 2XV4S 3HHHA 1AOYA 3OOPA 3MQ0A 4R8HA 1FOKA 4EMSA 4UV9A 4RB3C 3F8MA 1K79A 4YIIA 3R4KA 3K0LA 5CYVA 1T38A 2QUFA 4MTDA 3CDHA 4A12A 2HKOA 3LAJA 3HTUA 4N9HA 4AVPA 2WTEA 4LB5A 1R7JA 1WI9A 3R60A 2FBHA 2PMHA 4HLXA 1OKRA 1S7OA 2O6GE 4FHTA 2W84A 3R61A 1YTYA 1SMTA 2QWWA 5FFXA 1MZBA 5H6QA 1QNTA 3GFIA 1BN5A 3U9GA 1SMYF 4UHTA 4UNOA 1IUYA 3KE2A 2Z5UA 4Y15A 5FD6A 3RKWA 3ZMVA 3I71A 2M30A 4DNCA 1IW7F 2OZUA 3WTZA 4PGHA 2F5DA 3M1EA 3NEUA 4MEYF 2FMLA 3GO5A 1T2KA 3H92A 5CVRA 1QPMA 2V79A 2VBYA 3F8FA 1TQIA 2AXLA 4B09A 1MJAA 2OQRA 1UHWA 3H3UA 1IAWA 2XAHA 3EYYA 1V3FA 4E70A 1U2WA 1IF1A 3CO6C 4ZYHA 3WU1B 1O3SA 3LSTA 3P7NA 2PN6A 4GGGA 1G4DA 3GF2A 2P6SA 4LMYA 2ZFWA 1TW3A 1TNTA 3BOQA 1K78A 1J2XA 2JSCA 1R1TA 1FNNA 1KU2A 4RGXA 1ZARA 1HSTA 4EJOA 3LFKA 4P5OA 2Z99A 2K7LA 2BE5F 1P6RA 5E18F 4CYDA 2GAUA 1JXSA 2CGPA 1LDKB 2CO5A 3F8NA 2H09A 2VOPA 2ADUA 2GXGA 4HA8A 2FSWA 2K27A 3MWMA 4WCGA 1PP7U 1ODDA 2MLKA 3QU3A 5LBQA 3GXOA 3TQNA 1EV7A 3HIFA 3ZPLA 3RPUA 1HXDA 3BJAA 3E5UA 3T1BA 3Q5FA 3BP8A 2R3SA 2ZBKA 3HSFA 1RI7A 1U8RA 4P55A 5BPDA 4RB1A 2R7DA 4LB6B 3IWZA 3K69A 2A68F 1OPCA 1F1ZA 5LLQA 4EJVA 2HGCA 5E8GA 2H27A 1CF7A 2HQNA 1BI2A 2XAGA 2EA4A 3LA3A 5JI6A 1B6AA 4HLYA 4B8XA 4M9ZA 1U3EM 2W85A 3RKYA 4CZZA 2BYVE 4EGYA 4M6XA 4WWCA 3CUQB 3GVAA 3WTXC 4TV7A 3BZ6A 4R1HA 1OYYA 4LLGF 3FF5A 2EFPA 1U5TC 1MKMA 2G7UA 3RJPA 3O6BB 3REOA 4FX4A 1ZRFA 2RKHA 2P7CB 3FXRA 1GHCA 3V8LA 1Q1HA 1O3TA 2RVCA 2ISZA 1O7FA 4Y17A 2COMA 2IA1A 2RV8A 4HV6A 4BHBA 4D0PA 1EH7A 5BPIA 4A2UA 5ILSA 5HDNA 4CICA 2LNBA 1W7PB 4I98B 2P7VB 2VC0A 5ICEA 1I27A 3F72A 3N4MA 2R7FA 4HF1A 3CO7C 2G9WA 1KQ9A 2EA2A 2AS5F 3E97A 4Q48A 5CLSA 5ICCA 1LDJA 3WTTC 2F5FA 1RZ4A 4GO1A 5FD5A 1D3YA 5JVTA 2X4HA 3F3XA 4EM1A 3KEOA 2QYOA 4NB5A 1H9GA 3K9TA 1G3TA 4EJUA 1K78B 3QPHA 3PQKA 3ML6A 2EFOA 2YX7A 1B4AA 4EM0B 3COAC 3B02A 2QBYB 3GFJA 4L9NA 4KDPA 1JHHA 1MDMA 1IN7A 1IXSB 3LQRA 3HRSA 4ENJA 3MCZA 5IT9K 3ZQ7A 2NAZA 1OMIA 4LLLA 4AIJA 1FYLA 3F21A 1I5ZA 5KVRA 5DDGA 4OMYA 2L54A 2DK8A 4LJZF 3FMQA 2XRNA 1ZGJA 1Y0UA 4F7ZA 6PAXA 2JPBA 1IN6A 3L9FA 1XGMA 2LF8A 3KP7A 1YW8A 2W25A 4RGRA 3IRQA 4EQQA 4A5MA 3ULQB 2DO7A 2EK5A 1KQ0A 4M71A 5IT9Z 3IWFA 4HF0A 4H0EA 2L01A 4YFNF 3K1MA 4HDUA 3PQJA 1L3LA 5K5QA 3P9IA 2OZ6A 3SXYA 3WGGA 4OIRF 1D8JA 2G7HA 3VODA 1CF7B 4N9IA 5L3BA 4KIFA 3L00A 3I64A 3ROUA 2FE3A 2JZYA 5L3FA 1KGSA 2Z9OA 3T5XA 4EVIA 2F2EA 3R0AA 4BAYA 1XCBA 1F9NA 4KMUX 3P9CA 5LHIA 4KFCA 4KN4X 2KIMA 4KIBA 3LA7A 3EQLF 1B1BA 4HW0A 1R23A 1I1SA 3IL2A 2XKPA 1ZGAA 2A6HF 1S29A 4OINF 1B9MA 5HLHA 1FZPB 3BY6A 5JHUA 4U7DA 3E3VA 1FYMA 4HAMA 3F6VA 4YG2F 3FXQA 1SFEA 4Q5SF 4FT8A 4PZJA 4P96A 5CVVA 3BWGA 3Q9VA 4WXDA 3E5XA 1BC8C 4RB0A 1ONVA 4Z2YA 4L0YB 1RNLA 3J80K 4ENNA 3PFIA 3D5LA 2YU3A 2EB7A 4FX0A 5ILVA 2LDUA 1Z9CA 2DLLA 4ZH4F 2A3SA 3V7CA 2IA0A 1SD7A 1WQ2A 1BI1A 1TNSA 4KIGA 2MC3A 4I7HA 1TBXA 3GW2A 3I53A 4K2EA 5BOXA 2OBPA 2XASA 2RQPA 1XB4A 1UCRA 4I0AA 1OR7A 4OMZA 4RB2C 3J80Z 4L0ZB 1KA8A 2FBIA 2STWA 1X3UA 5LHHA 4ESFA 1MDMB 1ZHFA 1R58A 2ZMEA 1FBUA 4WK8F 4M72A 5FGMA 3TDUC 2JT1A 5FLXK 2NNNA 3SZTA 5A2QK 4UUVA 3K1PA 4MHGA 2IRFG 3VEPA 5CJ9A 3ELKA 1HW2A 3BJOA 3SFZA 3GEZA 2M45A 3ABTA 1HKTA 4P9FA 1W5TA 3GYHX 3G73A 1ZN2A 3I5UA 3MEXA 2UXXA 1FBQA 2ELHA 3WG9A 1G3SA 4G94A 2JTVA 2MD5A 4PCQA 2L3DA 2PQ8A 2VE9A 5FLXZ 5A2QZ 3JAMK 3ZMZA 3CUQA 4AIKA 2TDXA 2MH9A 5LGUA 1F4KA 3CLOA 3WODF 5K5RA 2IW5A 4M74A 2CQKA 4G8XA 2HFHA 1P4WA 2EFWA 2CWEA 1S3JA 2ZKZA 3E6MA 1D8KA 2XROA 5AIPA 2DU9A 4L9VA 3JAMZ 3MAJA 4P9UA 3FMRA 4HOBA 3ZMSA 1I1GA 4CDGA 1BIAA 1W4MA 2QENA 3EUHA 1FYKA 1W7PA 1QQIA 3IKTA 4A5NA 2ZJ2A 2ZNYA 1GVJA 3JTGA 2VBXA 2UWMA 4I01A 4I02A 4MGRA 1MD0A 2HYGD 4A6DA 1SD4A 1XGSA 2B0LA 3Q9SA 1LEBA 2MLGA 2QBYA 4LFUA 1I6XA 1G3WA 2A61A 5HS9A 1R1VA 3LQQA 4HQMA 3VOEA 5F1RA 1WSUA 1XSVA 3ERED 2DTRA 1FT9A 3G3ZA 4S04A 2BV6A 5L3CA 2XAJA 3QOPA 1HW5A 2QVOA 2FMYA 2E1CA 4O3MA 3TDZC 3W6KB 1UHMA 3U2RA 3F8BA 2MA3A 1G6NA 1OYWA 2JPCA 2FXAA 2YPRA 3HSEA 1V4RA 2P8TA 1BI0A 3C7JA 4U0YA 2CG4A 2ZMEB 1LNWA 3DQVC 2H6CA 2DQLA 1U78A 3WTWC 3IC7A 1QZYA 4M6YA 4WXCA 4XLNF 4AIHA 3HSRA 1MJ9A 2E7WA 3W6JB 1XGNA 4HX7A 4RS8A 1HSJA 1ZYRF 4G7HF 3ZP5A 1P2FA 1W7PD 2NNYA 4Y13A 1IZ1A 4U0WA 3FMSA 3IHUA 1PP8F 3HRUA 2J5OA 4ON0A 3C3WA 2K4BA 2VODA 1R5GA 1FP2A 2PFBA 4BH9A 3LA2A 1S6LA 5D6FA 4IPAA 4M73A 2RNJA 2MBFA 3ZMDA 5HOOA 2Y0MA 2C6YA 3DKWA 5KK1A 1WKMA 1E17A 1UFMA 1IN4A 4JBAA 3DPLC 1REPC 2LKPA 4O5VA 5DYMA 4L5JA 4AD9A 5D5VB 1RIOH 3E6CC 1WRJA 2IVMA 1YW7A 4JQFA 3V8JA 4NQWA 5D6EA 4A0ZA 2O61A 3GUDA 1MJBA 1J75A 1S7AA 5ILUA 1USTA 1TQPA 2KRFA 2PG4A 3VB2A 4CHUA 4ETSA 2IP2A 5HLIA 5BS6A 2HR3A 3WTVC 1DPRA 5L3GA 4BNCA 3EETA 5D5XB 1EH8A 1USSA 4BHPA 3BROA 2FNAA 5D5WB 1DUXC 2FBKA 3L09A 2HKXA 4XSXF 3QAHA 2A5YB 4O6JA 3SHFA 4CO8A 1FLIA 1XCVA 2GIVA 5HS7A 2VN2A 2XAFA 3WGIA 5TRDA 3CTAA 3GFMA 4XLPF 4KMFA 1R36A 4A0YA 5IT3A 4I09A 1PUEE 4AWXB 5FO5A 1ON1A 4XBFA 1SD6A 3F22A 4EJTA 3RKXA 1IRFA 1ZH5A 4U7BA 4MEXF 4MNUA 2ZCWA 2XVCA 3J81K 2GA2A 2Q2EA 1XDSA 2RN7A 2O3FA 2A07F 1ZG1A 4HX4A 3IRRA 5DEQA 1LJ9A 4Q47A 1KYWA 1KU7A 3GFLA 5LGNA 5HDKA 2EV6A 2KJCA 3JW4A 3ZN1A 3KZYA 1Z6RA 3TGNA 5DD8A 4EGZA 5TJJA 1ZRDA 3KLOA 1QZZA 3J81Z 1STZA 4HX8A 2ACJA 2D45A 1U5TA 2P4WA 2QM3A 3RTRA 4GCVA 5ERIA 2RGVA 3KP3A 3SZPA 4M9SA 4RAYA 5F64A 1VTNC 3DP7A 4IHTA 3KP5A 4L5IA 4LG0A 3QRFF 2DPUA 4ZYEA 2ZNZA 1R00A 2D1HA 2PMUA 2WWYA 2HOEA 3F8CA 3GX4X 2NS0A 3WTYC 3ZN0A 1NHAA 4KUMA 4ASNA 3C1DA 1QBJA 2FQ3A 1XDUA 5HVQC 2ZO4A 2FEZA 3LAPA 1IN8A 5E20A 2PLYA 1R1UA 1H9TA 3MZYA 2VBZA 2W24A 3WTUC 2ISYA 4G7ZF 1YQAA 4MQ9F 5CVIA 2PBIA 5AIQA 1IRGA 3RIRA 3V7RA 1BBYA 2FF4A 3KETA 2EV0A 3HTSB 5JFRA 4OIOF 5H6RA 5D8KB 1O3RA 1O3QA 4UVAA 3AAFA 4LLNA 2QZ8A 4I0BA 1R22A 2LSOA 3OV8A 3K2ZA 2BEOA 2E7XA 3VFZA 4IRHA 3J7AO 4JK1X 1XMAA 4HQEA 2NYXA 3HUGA 5JR3A 3KFWX 3KEQA 1B9NA 2FRHA 4WXHA 2WV0A 2DPDA 2EWNA 4HV5A 5EEHA 3I4PA 2V1DA 2XKOA 2IT0A 1ZREA 5FFZA 5D8LB 2GWRA 2GQQA 1BI3A 3TO9A 1IXCA 3I58A 2STTA 2CYYA 2CFXA 3O3KA 4HYEA 2K4JA 3FM3A 3DF8A 1DP7P 3T8RA 2H6BA 1YLFA 1G3YA 4N0BA 3MFKA 2GXBA 3ABUA 5E1XA 4GXOA 1TTYA 4YIFA 3WTSC 2OD5A 4KICA 2V1UA 2KKOA 2DQRA 1KU3A 1TQMA 5BMZA 5DV5A 2H94A 5HS8A 1LQ1A 4S05A 1YS7A 1YS6A 3M7GA 2VC1A 1P92A 3HYIA 4MQVA 1AWCA 3DFGA 2W57A 3R0JA 1BIBA 2Z3YA 1ZG3A 3V4GA 5DCMA 4KNYA 3ECOA 3RYRA 1U5TB 1ZLJA 3KP2A 2Q8KA 2PJPA 3TKYA 1P4AA 2VE8A 4BYYA 1FSHA 3WGHA 3WE3A 5H20A 1Z7UA 5DD4A 3L7WA 4RGUA 1JGSA 4BHCA 4ESBA 4LG0B 1XGOA 3JSPA 3F23A 1OYIA 3WE2A 1FWZA 4U0VA 4NHJA 3H3ZA 1PDNC 1W5SA 1J0RA 2OA4A 1YFHA 2XGXA 3KZZA 4XSZF 2M5WA 2WC2A 2XIGA 2JRTA 2FNPA 1YO5C 3RDIA 2ESNA 4IHSA 1ZAOA 2K86A 2F5EA 2VONA 2D2WA 3IKVA 1T6SA 1D5VA 2LF7A 2A69F 3ECHA 2OAZA 1JE8A 1Z6TA 1LVAA 3NRVA 4RGSA 3SQNA 3ISPA 1O57A 1QO0D 4UXNA 1BC7C 4ZYDA 1MGTA 1LDDA 3TOBA 3V8KA 2DW4A 2XAQA 1F5TA 3NQOA 3GZ5A 4HZFA 1XMKA 1XSDA 1K7AA 5FB2A 3HHGA 2YSRA 1J7KA 4UV8A 2V1XA 3QP5A 3MZHA 4LK1F 4MTEA 3K1NA 4DQ2A 4WX9A 4BXUA 3FXUA 5D4RA 4OIPF 1BJAA 2QQAA 1J9IA 3I54A 5CVUA 3M9AA 5CVJA 1ULYA 4R79A 3JTHA 3DV8A 2Q0OA 4XRFA 2HZTA 2EV5A 4PGGA 4G9YA 1BOAA 4EJWA 2UZKA 3RI4A 2IJLA 2KIUA 3GWZA 2FA5A 4HF2A 4EV0A 5E1WA 1GXPA 1YYVA 4I2OA 4ZZDA 4KYWA 4WF2A 1P4XA 3I59A 3CUOA 2RC4A 1BM9A 2QLZA 2MH2A 5ED4A 5LRSA 1J59A 1O7LA 2VT3A 4G6QA 4OIQF 1SFXA 2V6CA 3FX3A 4IRIA 2HEOA 3FM5A 1TLHB 5DCMB 2K02A 1XSXA 4HDVA 3U1DA 5F6FA 4G6DA 2M8EA 4M9XA 1EH6A 4IRGA 3FHZA 2OU2A 5L3DA 2L4MA 1HKQA 2KIFA 2Y48A 1YG2A 3BDDA 1JHFA 2DT5A 5LHGA 1FSEA 1IN5A 1HQCA 3RYPA 1ZLKA 4ENMA 2E1NA 2VBWA 3WU0A 4LGWA 3E6DA 2HS5A 1SFUA 1B59A 5DUIA 5HDGA 2V9VA 1SD5A 3CJNA 2EJRA 1DDNA 4ZYGA 5LEJA 2KJBA 4A6EA 2NRAC 2PEXA 4GYIA 5HLGA 1Z91A 5K1YA 2Y75A 1YW9A 1Z1DA 3I0TA 1ZRCA 3C18A 4CXFA 2HTJA 2DI3A 3FWEA 1DPUA 4RAZA 5DCFA 1H0MA 3P9KA 4L9TA 2F5CA 5J8CA 1XN7A 4YFXF 3N97A 2O0YA 2XUBA 3F6OA 2EFQA 3O2PE 2HQRA 3FZVA 1RUNA 2O03A 1L0OC 2EFNA 4QLCU 3S2WA 3KCCA 1LEAA 1HKSA 2HYFA 1FPQA 5LRRA 1FP1D 1YIOA 2Z33A 2HTSA 2P5VA 3TO6A 2RDPA 4IVNA 5LGTA 1XD7A 3ZMTA
chains in the Genus database with same CATH superfamily
2E2IJ 1U9NA 1CGPA 2V7FA 4IF4A 2XHKA 2H8RA 2BGCA 2E1MB 2OQGA 2KZGA 1FMVA 4DJAA 1QA6A 3OS1A 2X85A 2P6TA 5LEKA 5EEGA 3V7SA 2L7ZA 2WA0A 3BG9A 1FC3A 1WJFA 4M3GA 3PIOF 3FHNA 3OIOA 2E34A 2HXOA 3BPVA 3BT9A 1N75A 1UELB 3GTKJ 1OR7C 4ENKA 2L2OA 1JTYA 3DXJF 1U6GA 1W36C 1E2XA 2DMQA 2LR8A 4AIDA 3KP6A 4KT5C 5J6XA 5L3EA 3HOTA 1MMDA 1YHQI 3CF5F 2DFIA 3E6BA 4P1WA 2CSOA 1G2HA 1X1AA 3M8FA 4BQAA 2IA2A 4PDKA 1SANA 4J00A 3UNGC 4UVCA 3TO7A 2DBBA 3LSJA 1A04A 3GTPJ 3QP6A 2ZMEC 3HOSA 5J1RA 3GZ6A 2A6EF 1UB9A 4ZJZA 1IUFA 3TEDA 1J5YA 3I59B 2ZXHA 3SJMA 2QQBA 4F91B 5F0CA 4EM2A 2X0LA 2CJJA 2M1BA 3BG7A 2MYSA 2OF7A 5E3OA 2D1VA 3JSOA 1KQ8A 1Z05A 5D4SA 3CESA 1LE8B 1K6OA 2GA1A 5FLMJ 1K83J 3DEUA 4U88A 3T8TA 3HOZJ 1HA8A 3L2CA 3FK6A 2KRCA 3ZMUA 5BQTA 4PJLA 4RLFA 1TWCJ 1T98A 3FXLA 4KT6A 1VQ7I 3BR6A 1IRZA 1YX5A 2VJJA 4IHVA 3RSNA 3ZXSA 4A3MJ 2E71A 1T0FA 3CP8A 2VJIA 2X6OA 3JRGA 1FMWA 2Y30A 1FBSA 2VOOA 1R5HA 2DA2A 1I3AA 1SAXA 3RPQA 1KYZA 3K4CA 2P5LC 1B8IB 4A3JJ 3CCQI 1VZ0A 3KP4A 3CCRI 3CCSI 3HM5A 1VI0A 1JKPC 2XGEA 5ICFA 1WVRA 4X6AJ 2BBYA 1TW2A 3CUQC 2Y2ZA 3QPTA 2LFBA 4BBRJ 4BKXA 2M87A 4L9JA 2DK5A 1A36A 1W1WE 1S8NA 2GZWA 2P81A 2HDCA 1UHSA 2FU4A 1TL8A 2V4JC 2RREA 4OAYA 3VPRA 5ICGA 3B73A 2O8XA 2DAOA 3KLNA 2BHZA 1RPWA 3A0BC 2VB6A 1RUOA 4YFKF 2IPQX 4QWQA 5EGOB 2ZXJA 1IV8A 4UVBA 1IV6A 3JRCA 1KU9A 4PJ0C 1HBXG 1GXQA 3KIOA 3PO3J 5EZGA 1LFBA 1X4PA 4DZPA 3HRMA 3JCUC 1ON2A 1GT0C 2HWVA 1IXRC 2DDBA 1ZR2A 1YI2I 1JJ6C 4L18B 3BJ6A 3D0SA 1FY7A 2K9MA 4CA0A 4IXAA 4ZZLA 4HBLA 1P7IA 4MFEA 3E5QA 1MH4A 3W2WA 5LFAA 3LWFA 2R5ZA 4KA4A 4GDFA 4A0XA 5E1ZB 4GYGA 1T39A 1Z3XA 2L02A 4OU0A 2NVQJ 5AONA 5K5OA 2J5PA 1N78A 5DUKA 1F43A 2L4AA 2DA7A 2EZIA 3EUHC 3PUFA 4LD5A 3M8EA 4E7HA 1ETWA 1MBKA 3O8GA 4Q4ZF 3HRTA 2QGUA 4M6VA 2DA5A 4BXXJ 4EATA 3DBHB 2ESHA 4IX7A 2K9SA 1ZG5A 3EDPA 2VIXA 4JX4A 1MNMC 1WWXA 2LK2A 4KN7X 3HG9A 2YX4A 1P7JA 1X1PA 2ZSIB 3M8JA 3EYIA 1ACIA 2ETHA 3T0YA 3A03A 4A3BJ 2FOKA 2UUZA 2L9NA 3GCMA 5GTIC 3D5RC 3IUOA 5E8IA 3CMEI 1E3HA 2CW0F 1C0WA 2UXNA 4C9YA 4D5CA 2HOSA 3ZQCA 2P5KA 4LK0F 2X6WA 2PI0A 4ABZA 2YR2A 2QQ9A 5JLWA 4CGZA 3DPTA 4OOIA 2NOJB 3R6SA 1QGPA 1AU7A 2DJIA 4G7OF 4RM2A 4A93J 2VT2A 5J8FA 1HW1A 5E17F 2AQFA 3E0JB 3QU6A 1GV5A 2EIJH 3S14J 1LB2A 1FX7A 3BPXA 3H5AA 5D5UB 4ESJA 3E7LA 5J4YA 3GLXA 4IJAA 3ZOBA 2VXZA 3TOAA 2XV4S 3H9JA 1Q1VA 3HHHA 3MZ8A 2LBFB 3OOPA 3OYIA 1AOYA 3MQ0A 4R8HA 1A6QA 4IOCF 1FOKA 4EMSA 4UV9A 4MIMA 4RB3C 3LSIA 3ZCOA 3F8MA 3CCMI 2ID6A 2R7TA 1K79A 5JHFA 4YIIA 2F5VA 3CC4I 2E60A 1DU0A 1EKEA 3R4KA 1VNDA 2OUMA 3K0LA 3B6AA 5CYVA 1T38A 1X3ZB 2BY3A 1Z7LA 3PFYA 2QUFA 4CCNA 4MTDA 3CDHA 4A12A 2HKOA 2PMZA 2LG4A 3LAJA 5B1AH 3HTUA 4N9HA 1H88C 2A05A 1VQKI 4AVPA 3I56I 2WTEA 3OOUA 1F36A 3QPSA 4LB5A 1R7JA 1WI9A 3R60A 1QVTA 2FBHA 2PMHA 3OY9A 3AG3H 4HLXA 1OKRA 1S7OA 2O6GE 4FHTA 2W84A 3DU6A 2EQRA 3PSIA 3R61A 1YTYA 5JVGF 4IQJA 1SMTA 2QWWA 2DMNA 5FFXA 1MZBA 3BCBA 5H6QA 2CUFA 2DTZA 2O7OA 4HRIA 1QNTA 3QYFA 3GFIA 1BN5A 3U9GA 1SMYF 4UHTA 4UNOA 1D1BA 2R0QC 1IUYA 1R9TJ 2LOOA 3KE2A 1IO2A 3BQYA 2Z5UA 2X1DA 4Y15A 5FD6A 4UUSA 1DQUA 4BEHA 3CZ6A 3RKWA 5K7HA 2IXSA 3BR3A 3ZMVA 1OCTC 2RNGA 3VSLA 3I71A 1LFUP 2M30A 2WBMA 4DNCA 1JTXA 2HVQA 2ZB9A 1IW7F 2OZUA 3EUAA 5TISC 3WTZA 1YIJI 3CCLI 2L9SA 4PGHA 5HNFA 3CJQB 2F5DA 3M1EA 2ICWG 3G2BA 2CUJA 5HLTA 3O8HA 3NEUA 4MEYF 2EIKH 3QWLA 1TT0A 1GLNA 2FMLA 5IOZA 3GO5A 3I3LA 2TRTA 5F08A 3KEYA 1T2KA 3H92A 2L9VA 4PSXA 3A01A 3A02A 1LPQA 5CVRA 1QPMA 2W4SA 2V79A 3SDGA 2VBYA 3F8FA 1I3QJ 1TQIA 2E19A 2BXZA 4N4NB 2AXLA 3FXKA 1U8BA 2VKHA 4B09A 1MJAA 2OQRA 2L7FP 1UHWA 1YRNA 3H3UA 1IAWA 2XAHA 3EYYA 1V3FA 1YX3A 3H9GA 2DDAA 4E70A 3LMMA 5F27A 1UZCA 3GMEA 2BY0A 1U2WA 1IF1A 3CO6C 2BOLA 4DZJA 4ZYHA 3WU1B 1O3SA 3LSTA 3P7NA 4D7MA 2PN6A 4XLHA 4GGGA 4M3FA 2E2JJ 5KCMA 1G4DA 3G1LA 1V54H 4XRSG 3GF2A 2P6SA 2OCEA 1EA3A 4LMYA 3KYDB 3VYTB 2ZFWA 1TW3A 1TNTA 3BOQA 1K78A 1FIAA 1J2XA 5B5EC 3IAS2 1ETXA 2JSCA 2DA4A 1R1TA 1FNNA 1KU2A 3MKYB 4RGXA 2QEXI 1ZARA 1HSTA 3HEFA 4EJOA 3LFKA 4P5OA 2Z99A 4IHYA 2K7LA 2BE5F 4AC0A 2FJ1A 3OYGA 1P6RA 1HDPA 1BR2A 5E18F 4JYKA 3ZQQA 4CYDA 2KISA 2GAUA 4MO7A 1APLC 1JXSA 1OQYA 1QRYA 2CGPA 1LDKB 2CO5A 3F8NA 3V42A 4D7NA 4PFPA 2H09A 4J19A 4FTHA 2JA7J 3PUBA 2KPMA 5EZHA 2IS4A 4ZDLA 5IP9J 2VOPA 2ADUA 2GXGA 4J01A 1FJLA 2JVHA 4HA8A 1VQNI 2FSWA 1GDTA 2JRMA 2K27A 2K40A 2O9LA 3NAUA 5E3NA 3Q0WA 5JLXA 3MWMA 4A3DJ 4WCGA 1PP7U 1ODDA 2MLKA 3MD2A 3QU3A 5LBQA 3GTLJ 3GXOA 5FRNA 4HEA2 3TQNA 1Y0NA 1EV7A 3LSPA 2EH3A 1BA5A 3AG4H 3HIFA 2DOFA 4E7SA 3KYLA 3L2UA 3ZPLA 3RPUA 2ZFUA 3GLLA 5J3LA 2PMZN 3LSKA 1X1DA 1HXDA 3BJAA 3E5UA 3T1BA 3Q5FA 1TWGJ 2CQNA 3BP8A 2XB5A 2R3SA 1VQ8I 2ZBKA 2AO9A 4II3A 4JOMA 3HSFA 1RI7A 1U8RA 2HDWA 3BG6A 4C3JJ 4P55A 3L2WA 5BPDA 4RB1A 2NXNB 2L0KA 2R7DA 2M3AA 4LB6B 3CMYA 4YEJA 3IWZA 3K69A 2A68F 3CJTB 3H1CA 4XLCA 3OYHA 1OPCA 3G71I 3OYMA 2CH0A 1F1ZA 2WAFA 2M4GA 1VQ4I 5LLQA 4EJVA 2MSYA 2HGCA 3DTKA 5E8GA 3W6VA 2H27A 1CF7A 2HQNA 2WADA 1BI2A 1PJRA 2XAGA 5FKOA 2EA4A 4Z6YA 3LA3A 2VQHA 3PJRA 5F1JA 5JI6A 3HL2A 3CC7I 1B6AA 3QODA 1PVEA 1NTCA 1SAUA 1B8IA 4HLYA 2OPTA 4B8XA 4M9ZA 5F0FA 1W0TA 4A3FJ 3CCYA 2DT6A 1VQ6I 3LSHA 1U3EM 2W85A 3RKYA 1XMXA 4CZZA 3OYBA 2BYVE 4EGYA 4M6XA 2LY2A 4BS9A 4WWCA 1XPXA 2VLAA 3CUQB 2OTJI 1ZR4A 3GVAA 3WTXC 2P0WA 3BZ6A 4TV7A 1GUUA 4R1HA 1OYYA 4LLGF 5K7ZA 1K4SA 1Z0XA 3FF5A 1A5JA 2EFPA 1U5TC 1MKMA 2G7UA 3RJPA 3O6BB 3REOA 4FX4A 3Q0UA 3TMOA 1ZRFA 3PM1A 1HOMA 4UUSB 4BEHB 2RKHA 3G4SI 2P7CB 1Z3YA 1V55H 3JREA 3FXRA 1GHCA 3V8LA 4IHXA 1MBFA 2VQGA 1Q1HA 1O3TA 2RVCA 2ISZA 4BACA 2E5ZA 4Y7NJ 1O7FA 2QSGX 4Y17A 3RQIA 5TGTA 1EF4A 2WAQA 2COMA 2IA1A 3L2QA 1ETKA 3OR2C 2OCCH 2RV8A 2BZTA 2A6TA 3S8PA 4HV6A 4BHBA 4ZTJA 1NK2P 5DM6F 4D0PA 1EH7A 5BPIA 4A2UA 4NC8A 2ZJRF 5ILSA 2EZHA 5HDNA 4IL6C 1ETQA 4CICA 2R7ZJ 2M9HA 4BXFA 4XM3A 5C44J 4Y52J 3K7AJ 1YRNB 2LNBA 1W7PB 4I98B 2P7VB 2ID3A 1ERDA 2VC0A 5ICEA 2JJ7A 2ZXIA 1ITYA 1I27A 3F72A 1WJEA 3N4MA 4XN0A 1TZLA 1XC5A 2R7FA 3SEZA 2HI3A 4HF1A 4QSHA 3CO7C 2G9WA 1Z77A 1KQ9A 1RC9A 2EA2A 3H0GJ 2HVSA 2AS5F 3E97A 4Q48A 5CLSA 5ICCA 3M3YJ 3S1MJ 1LDJA 3WTTC 2ELKA 2F5FA 1RZ4A 4GO1A 5FD5A 3IV5A 2VI6A 1VQPI 1D3YA 2JSPA 1NH3A 3ZGKA 5JVTA 2X4HA 3F3XA 3LSMA 4ZTFA 3GTJJ 4EM1A 3KEOA 4XMYA 5FKNA 2QQ8A 2QYOA 4NB5A 1H9GA 3K9TA 1G3TA 1Y6IA 4EJUA 1T56A 1Y39A 2DFHA 1K78B 2JWTA 2X6YA 3QPHA 3PQKA 3ML6A 1YITI 2EFOA 2YX7A 1B4AA 4EM0B 1OISA 3COAC 3B02A 2W1OA 2QBYB 3VYUB 2IEKA 1LKXA 5DM7F 3GFJA 4L9NA 4KDPA 4ZDOA 1JHHA 2GXAA 1MDMA 1MH3A 2DN0A 1IN7A 4FCYA 2IS1A 1IXSB 5H2FC 2H1LA 1DGWY 1KONA 3HRSA 3LQRA 3BR0A 2DOEA 3H9QA 4ENJA 3CMMA 3MCZA 5IT9K 4C2UA 3ZQ7A 3OS2A 2NAZA 4CUGA 3A2KA 1OMIA 4LLLA 4AIJA 1BR4A 2Y0SN 3F21A 1FYLA 1I5ZA 1WH5A 2VKVA 5KVRA 5DDGA 3GTGJ 3IP4B 4OMYA 3CDLA 2L54A 2DK8A 4LJZF 4I6ZA 2OV7A 3FMQA 4CZCA 2XRNA 1ZGJA 3FDYA 1Y0UA 4F7ZA 4XOPA 6PAXA 4FASD 2JPBA 1IN6A 3S3MA 3K4JA 3L9FA 1XGMA 2LF8A 3KP7A 1YW8A 4C3IJ 2W25A 1X1BA 5M5WJ 4RGRA 3IRQA 2NVUB 1RETA 1JUPA 4EQQA 1I39A 2JN6A 2EZLA 3ABLH 4A5MA 1JKOC 3ULQB 2DO7A 2EK5A 1KQ0A 2XPVA 2CRGA 3IWFA 4M71A 5IT9Z 4XQFA 4RMNA 4HF0A 2DA3A 4H0EA 1JKQC 2L01A 5FROA 4YFNF 2E35A 4QTRA 1Y56A 3K1MA 4PSWA 4HDUA 3PQJA 1L3LA 5K5QA 4MLOA 3P9IA 2OZ6A 3SXYA 3WGGA 4CCMA 4OIRF 3HOWJ 1D8JA 2G7HA 3VODA 2EINH 1ZELA 2MD0A 1CF7B 4N9IA 4NUBA 1K6YA 1Z21A 1MMGA 5L3BA 4KIFA 3L00A 3I64A 3ROUA 2FE3A 2OJED 2I10A 2JZYA 2B63J 5L3FA 1KGSA 5CPRB 3PNTA 2Z9OA 3T5XA 4EVIA 1P9QC 2F2EA 3R0AA 4BAYA 1F9NA 1XCBA 4KMUX 3P9CA 2DMTA 5LHIA 2HOTA 4KFCA 1FOXA 4KN4X 2KIMA 4KIBA 4DYRA 4RBOA 3LA7A 2WAQN 2VKEA 3EQLF 3LSRA 1B1BA 4HW0A 1R23A 1U0JA 3I4MJ 1UG2A 1VQLI 1I1SA 3IL2A 4BL0B 2XKPA 1ZGAA 2A6HF 1WI3A 1S29A 4OINF 1W5CC 2BXYA 1B9MA 3NARA 5HLHA 3OYDA 4BBSJ 4E4HA 1FZPB 4I99C 2CV2A 2R7OA 3ZRGA 3BY6A 5JHUA 1X4OA 1ETVA 2CQ7A 4U7DA 3HOYJ 2Q1ZB 3E3VA 3H36A 2LRDA 2H8WA 3K6GA 4HAMA 1FYMA 2IGOA 1FEXA 2GBYA 3F6VA 4YG2F 1BW5A 3ONQA 1NG6A 1SFEA 3FXQA 5FKLA 4Q5SF 4FT8A 1RR7A 2V26A 3OYAA 2N8GA 2EPFA 4PZJA 1JGGA 4P96A 1X58A 4BJ6C 5CVVA 3BWGA 3C2BA 1R71A 3Q9VA 1V5GA 3KYCB 4WXDA 1MBJA 1X2MA 3E5XA 1BC8C 4RB0A 1ONVA 2LC2A 4BY7J 4Z2YA 3HDDA 4L0YB 1RNLA 3J80K 3GTMJ 4ENNA 1JT6A 3PFIA 3D5LA 3QYBA 2X9DA 2EB7A 2YU3A 4FX0A 4U87A 5ILVA 2LDUA 1MMNA 1Z9CA 5IYDJ 2G0EA 3IH2A 3CQZJ 2DLLA 4ZH4F 4E7LA 2A3SA 1VQ9I 2JA8J 4F55A 3V7CA 4C2TA 2IA0A 5GAGJ 1SD7A 1WQ2A 3BTLA 4W1UA 1BI1A 1TNSA 2FOWA 4KJZA 4XKBA 4KIGA 2MC3A 3CCVI 2M8GX 4I7HA 1TBXA 3GW2A 3I53A 4K2EA 3PNYA 4DBRA 5BOXA 2OBPA 2MFZA 2XASA 2RQPA 4B44A 2E2HJ 1XB4A 5EDNA 1UCRA 2R7RA 2K3FA 4II2A 4I0AA 1OR7A 4OMZA 4RB2C 3JRBA 3FXJA 3J80Z 2W00A 1WHUA 4L0ZB 2EILH 2O5RA 3S3OA 1KA8A 2FBIA 3BG5A 1SFOJ 2STWA 1X3UA 1A6IA 4YELA 5LHHA 3A0HC 2ELJA 4D9JA 2L5QA 2CV1A 4ESFA 1MDMB 1ZHFA 3KZIC 1NK3P 1JT0A 1R58A 2ZMEA 4IO9F 4LIUA 1FBUA 1QHHD 2DMUA 3DU5A 3WHCA 4WK8F 4F92B 1MNEA 1UJ8A 4M72A 2CQQA 5FGMA 3TDUC 5J1UA 2JT1A 1WFXA 5FLXK 2NNNA 4Y33A 3SZTA 5A2QK 4UUVA 2F6CA 4S0HB 3K1PA 4RA2A 4MHGA 5IYCJ 4NC6A 2IRFG 3VEPA 4G6TB 2ZSHB 5CJ9A 5EG0B 3ELKA 4PJNA 5B66C 5J40A 1HW2A 3BJOA 3SFZA 3GEZA 2COBA 2M45A 3W2AA 3ABTA 2CU7A 5CKTA 3OYKA 2BW3A 1HKTA 4P9FA 2E1MC 1HLVA 2QF7A 5EEAA 1W5TA 3GYHX 3LL7A 2DXIA 3G73A 3BZKA 1BR1A 1XG1A 1ZN2A 2DYSH 3I5UA 4F52A 1LUJB 3MEXA 2UXXA 1FBQA 2ELHA 3WG9A 2XF6A 1N77A 2CFOA 1G3SA 2FD5A 4G94A 5KHDA 2JK3A 2JTVA 2KHMA 2MD5A 4PCQA 2L3DA 3L1PA 2PQ8A 5K7FA 5FLXZ 2AXTC 2VE9A 5A2QZ 3K4MA 3ZMZA 3JAMK 3CUQA 4FE7A 1R5ID 4AIKA 4RLQA 1MBHA 4E7ZA 2TDXA 2LY1A 2MH9A 1MSFC 2DA1A 5LGUA 1F4KA 2DOAA 3CLOA 1V5FA 3WODF 5K5RA 2R7QA 4M3BA 2IW5A 2E36A 4M74A 2CQKA 4V2FA 2HPMA 4G8XA 3JRFA 3CMAI 3S93A 4BE1A 2HZDA 2HFHA 1RESA 3BR2A 4XLAA 3J7YJ 1P4WA 2EFWA 2CWEA 3HGYA 1S3JA 2ZKZA 3E6MA 3G1MA 3K70D 1D5YA 3HBLA 4RM3A 1D8KA 4L5EA 4NNJA 1SVOA 2XROA 4BE2A 5CQGA 3FXMA 5AIPA 1S5LC 2DU9A 2PX9A 3CLQA 1OCRH 3M07A 4L9VA 3JAMZ 1D0YA 3MAJA 1AKHA 4IHWA 4P9UA 3FMRA 4HOBA 4XONA 5IP6A 3ZMSA 1I1GA 4LITA 4CDGA 3DBLB 1HCRA 1BIAA 1W4MA 5J47A 2IGKA 3HOXJ 2QENA 2HVRA 2CQXA 3EUHA 1FYKA 1W7PA 1QQIA 3IKTA 3S1RJ 4A5NA 2DFFA 2JQ7A 3CCEI 2ZJ2A 3BZCA 1FTZA 2VJ4A 2JVGA 2ZNYA 5HNHA 1GVJA 2L7KA 5IY5H 2R7XA 3JTGA 2VBXA 3F9KA 2UWMA 3CP2A 1FTTA 3OL4A 4I01A 3JRHA 4I02A 4MGRA 1MD0A 2ECCA 3RZDJ 3S3NA 2HYGD 5IPAA 3CF2A 1T08B 4A6DA 2M0CA 1SD4A 1SEUA 1XGSA 2B0LA 3Q9SA 2YU9J 3A4CA 2LKXA 1LEBA 3AG1H 4PFOA 4ANJA 2MLGA 3U1KA 2TCTA 2QBYA 4LFUA 1I6XA 4UB8C 1G3WA 2V1NA 1IDZA 3OIQA 4HSTA 1A31A 2A61A 5HS9A 1R1VA 3AG2H 3LQQA 4HQMA 2JMWA 3VOEA 2K85A 3DEWA 5F1RA 3K10A 5GTHC 1WSUA 4BDYA 1XSVA 3ERED 2DTRA 1FT9A 3G3ZA 2DJNA 2CW7A 1O4XA 1S9HA 4S04A 2BV6A 2HU9A 5L3CA 2XAJA 3QOPA 3MKLA 2E5NA 1Y1VJ 1HW5A 2QVOA 3TW6A 2FMYA 4OWRB 2E1CA 4O3MA 2LREA 3TDZC 3W6KB 4A3GJ 1UHMA 4H4KC 3DEEA 3U2RA 1MSEC 2F4IA 3F8BA 2R92J 2LYCA 2MA3A 1G6NA 1MW7A 2VXDA 1OYWA 1QZEA 4B3AA 2JPCA 3K4LA 2FXAA 2YPRA 2VPRA 2GM4A 3HSEA 1V4RA 2K9LA 2P8TA 1BI0A 4XK4A 3C7JA 4U0YA 3A1YA 2CG4A 2ZMEB 1LNWA 3DQVC 1VQ5I 1XS9A 1AA7A 2R7UA 4B1RA 4UUTA 2H6CA 1ETYA 2DQLA 1U78A 2AQEA 3WTWC 2K5CA 4W97A 4RAGA 1IC8A 1U9OA 3IC7A 3LFUA 1ORKA 1QZYA 4M6YA 4WXCA 4XLNF 4DOZA 4AIHA 2VASA 2EZKA 1TC3C 1WJBA 3HSRA 1MJ9A 5B1BH 2E7WA 3DLAA 3W6JB 1TWFJ 1SVLA 1JUMA 1XGNA 3OMYA 3BQZA 4ITVA 4HX7A 4RS8A 1HSJA 2BVLA 1ZYRF 4G7HF 3ZP5A 1P2FA 4UY8I 2VPLA 3FK7A 1W7PD 3H0DA 2BW3B 5IYBJ 1H8AC 2NNYA 2LKSA 3HZJA 4IEJA 4Y13A 1IZ1A 5M5YJ 1D0ZA 4U0WA 3FMSA 4IQ4A 3IHUA 3S1QJ 1TT5B 3WHBA 1Y8QB 2KT0A 1QVUA 3S32A 2DYRH 1LVKA 1J09A 2QA4I 5M3FJ 1PP8F 2R5YA 3HRUA 5GAEJ 2J5OA 4ON0A 3C3WA 2K4BA 2VODA 1R5GA 1WPKA 1FP2A 2PFBA 4BH9A 3LA2A 4QIWN 4A3LJ 1QPIA 1S6LA 5D6FA 1ZKGA 4IPAA 4M73A 2M34A 2RNJA 2MBFA 1D0XA 2CMPA 3ZMDA 2QKMB 5HOOA 2Y0MA 4F3QA 1FOYA 1WCMJ 2C6YA 3DKWA 5KK1A 5FJ8J 1T8IA 4FE4A 1WKMA 2YS9A 1E17A 1UFMA 2FQ4A 3SYTA 2KDZA 1IN4A 2M2EA 4JBAA 2IGNA 3S2HJ 3MKZA 2HQ5A 1VFCA 3DPLC 2RAEA 1REPC 4AVZA 3WU2C 2LKPA 4O5VA 5DYMA 4L5JA 4AD9A 5D5VB 1RIOH 3E6CC 3OYJA 1WRJA 3ZQHA 2WY7Q 2IVMA 3TW7A 1YW7A 4JQFA 3W3CA 3ERMA 1M1EB 5GPCA 3V8JA 3G6EI 4PUSA 1YJWI 4E7JA 4NQWA 5D6EA 4A0ZA 2HXIA 4CCJA 2O61A 3GUDA 2XC7A 1ZK8A 1AKHB 4HNVA 1MJBA 1J75A 1S7AA 5ILUA 1T0FC 1USTA 1HDDC 1TQPA 1PUFA 1X1CA 4B4CA 2LMDA 2KRFA 1MMSA 4EEFG 3TP3A 2PG4A 2DA6A 3VB2A 4CHUA 1MBEA 3M1CA 4ETSA 1WZ2A 2IP2A 2JA2A 5HLIA 2M7BA 5BS6A 3RPUD 1VQMI 2HR3A 3WTVC 1DPRA 5L3GA 2GOXB 4BNCA 3EETA 5D5XB 1EH8A 1USSA 2QCOA 2W7NA 4BHPA 1MNDA 2ZC2A 3BROA 2FNAA 3S16J 5FRMA 3OYEA 5D5WB 1DUXC 2FBKA 3L09A 2HKXA 1IJWC 2HOAA 4XSXF 3QAHA 4ZYAA 2VQCA 2A5YB 1OCPA 2BY2A 3ZQGA 4O6JA 3SHFA 4CO8A 1WJDA 4GRIA 1FLIA 2IGMA 1MBGA 2KIQA 1XCVA 2L7MP 2GIVA 5HS7A 2VN2A 5J4VA 2XAFA 3HPGA 3WGIA 5TRDA 1OFCX 3CTAA 3GFMA 4XLPF 2HDDA 1RKWA 4XN3A 2I8DA 1YJ9I 1R36A 4KMFA 4A0YA 5IT3A 2XSJC 2DT7B 4I09A 1WGXA 1RR8C 1PUEE 2Z2SB 1OCZH 4AWXB 2KQRA 5FO5A 1ON1A 1WJ5A 4JX5A 4M3DA 4XBFA 4DBQA 2ECBA 1SD6A 3QQAA 4YRVA 3RKXA 3F22A 4EJTA 1R49A 4V2GA 3N05A 5IOYA 2NVXJ 1IRFA 1ZH5A 3OYFA 4U7BA 4MEXF 4MNUA 2ZCWA 3G1OA 2XVCA 3ABMH 3J81K 2GA2A 2Q2EA 1XDSA 3K70C 3VWBA 3TP0A 2RN7A 2NOGA 2O3FA 3NWTA 2A07F 5EG0A 4CCLA 2CS3A 1ZG1A 4HX4A 3FKJA 4N4OB 4XKWA 3IRRA 5DEQA 3LOCA 1BL0A 5F04A 1LJ9A 1D1CA 2DCEA 3OIPA 1Y8RB 2X48A 4Q47A 4XLEA 3BR5A 4XKCA 1KYWA 4M3EA 1KU7A 4HNUA 3DTEA 3GFLA 5LGNA 3EPZA 5HDKA 2EV6A 2KJCA 2R93J 3JW4A 3ZN1A 2R7WA 3KZYA 3QYEA 4BGDA 1Z6RA 3TGNA 3CDIA 5DD8A 4XRSA 3X2QH 4EGZA 5TJJA 3W2VA 4E7IA 1ZRDA 3KLOA 3AKZA 1QZZA 3J81Z 3GBGA 1STZA 3J7ZI 2L9RA 2V9KA 3JRAA 2F4OB 4HX8A 3VSKA 2ACJA 2XDVA 3K4BA 3J7AY 2D45A 1U5TA 2P4WA 2QM3A 3RTRA 4AUXA 1YOVB 2X6XA 3D5SC 4BE0A 3OS0A 4GCVA 4DGWB 5ERIA 5EJCA 2RGVA 3C2HA 3KP3A 1VQOI 2HYJA 3DTIA 3SZPA 4AM3A 1BW6A 4M9SA 4RAYA 4C2MJ 3HXLA 3LNQA 4HNTA 3OSFA 5F64A 1VTNC 3DP7A 2XPUA 4IHTA 3KP5A 4L5IA 4LG0A 5BNGA 3QRFF 4C3HJ 2DPUA 2R5YB 3Q0VA 3SDBA 4ZYEA 3HKZA 2ZNZA 1R00A 3QOEA 5FKKA 3BLYA 9ANTA 4KITB 2D1HA 4LOCA 2PMUA 2WWYA 2HOEA 2KMUA 3F8CA 3GX4X 2NS0A 4LIVA 3WTYC 3ZN0A 1NHAA 4KUMA 4A3EJ 4V19K 2Z1DA 4ASNA 2F48A 3C1DA 5M5XJ 4XOTA 1QBJA 2FQ3A 3S1NJ 2MW8A 1XDUA 5HVQC 2ZO4A 4XIDA 2FEZA 2X51A 3LAPA 3BCAA 1IN8A 5E20A 2PLYA 1R1UA 1H9TA 3MZYA 2VBZA 2W24A 5GPAA 2EBIA 1S7EA 3WTUC 2ISYA 4QPOA 4G7ZF 1YQAA 2XAUA 3WG7H 1X19A 1I50J 4MQ9F 5CVIA 2PJRA 5KNLA 1MIJA 4Y4RA 2PBIA 5AIQA 1IRGA 3RIRA 3SZGA 3V7RA 3H3VK 4NC7A 3AL0C 3P5JA 1BBYA 2FF4A 2KFDA 3KETA 2XGDA 3RZOJ 2EV0A 3HTSB 2BY1A 5HODA 4NQWB 3CJRB 4AYBA 5JFRA 3CCJI 3FKIJ 4OIOF 5H6RA 5D8KB 1O3RA 1O3QA 2BHYA 3SFIA 4B48A 1PUFB 4DW6A 4UVAA 3BG3A 3AAFA 4LLNA 4CCKA 2QZ8A 4I0BA 2ZJQF 1R22A 2LSOA 3OV8A 3HB9A 1FIPA 3K2ZA 2BEOA 2E7XA 3DCFA 4B3XA 3VFZA 3HJEA 4IRHA 3J7AO 4JK1X 4BDZA 3CCUI 2LD5A 2MC4A 1XMAA 2Z16A 4HQEA 1JUSA 4X1EA 5C3EJ 1IG7A 2NYXA 3PO2J 3JRDA 4XORA 4A69C 2XSDC 3HUGA 1E3PA 5JR3A 4XICA 1UG0A 3KFWX 2XF7A 3KEQA 1B9NA 2FRHA 2ZXWH 3OWTA 2OTLI 4WXHA 2WV0A 4D5FA 3B6CA 3UKGA 2DPDA 2EWNA 2W48A 4HV5A 1WH7A 2W82A 1X2NA 3DWLE 3K2AA 4FETA 5EEHA 3FIWA 3I4PA 2V1DA 2XKOA 2IT0A 1ZREA 5FFZA 5D8LB 2GWRA 2FUG2 2GQQA 1BI3A 2K9NA 5DTDA 3TO9A 3OSGA 1IXCA 2IBDA 3I58A 3FBNB 2STTA 2CYYA 5EF6A 2CFXA 3O3KA 4HYEA 1N25A 2K4JA 2F4MB 4BY1J 3FM3A 3Q3SA 3DF8A 3F0CA 2LY9A 1DP7P 1UMQA 3CC2I 3T8RA 2H6BA 3S15J 1YLFA 4JX6A 4RAFA 1G3YA 1D1AA 2LVSA 4N0BA 3MFKA 2GXBA 2GOMA 3ABUA 1Y1WJ 5E1XA 4MFDA 4GXOA 2Q2EB 1TTYA 4CH7A 3RKQA 4YIFA 3WTSC 2OD5A 4KICA 2V1UA 1ENHA 2KKOA 2LLKA 2DQRA 4JP0A 1VF9A 3VYSB 1KU3A 1MMAA 4XL9A 1TQMA 2X1CA 5FKMA 5BMZA 5DV5A 2H94A 5HS8A 1LQ1A 4S05A 1YS7A 1YS6A 2M7AA 4XR6A 3M7GA 5B3SH 2VC1A 1P92A 2MG4A 3HYIA 4MQVA 3H5NA 1AWCA 3DFGA 3OYCA 2W57A 3HKZN 3ZQFA 3DBRB 2HNHA 3R0JA 1BIBA 2KZVA 2Z3YA 2IAIA 4I76A 1ZG3A 3S2DJ 3KPHA 3V4GA 5DCMA 2ME0A 1ZGWA 2XGCA 4KNYA 2KLOA 3H35A 2K3PA 3PL8A 2CW8A 3ECOA 3JRIA 3HC7A 3RYRA 2R7SA 1U5TB 1ZLJA 3KP2A 4Y3OA 2ME6A 1PYVA 2Q8KA 3TKYA 2PJPA 1LFPA 2RQQA 1P4AA 2VE8A 2V9PA 2Y69H 4BYYA 1FSHA 3WGHA 3WE3A 3TBIA 5H20A 1Z7UA 3BR1A 5DD4A 4IKFA 3BTCA 3L7WA 4RGUA 1JGSA 4BHCA 4ESBA 1UAAA 2WV1A 1IGNA 4LG0B 5KAIC 1XGOA 4ZC3A 3JSPA 3MVPA 3BTJA 3F23A 4FQGA 1B72A 1OYIA 3WE2A 1FWZA 4U0VA 3MMYB 4NHJA 3H3ZA 4IOAF 1T95A 3JR9A 1POGA 1G8XA 1ZTRA 1PDNC 1W5SA 3ABKH 1J0RA 2OA4A 4AYBN 2KL4A 1YFHA 4F93B 3D1NI 5EYRA 4PJMA 2XGXA 3KZZA 4XSZF 2M5WA 2WC2A 2XIGA 2JRTA 2FNPA 1YO5C 1W36D 2O8KA 3RDIA 2ESNA 2OC6A 3GZNB 2WB1A 5GAHJ 5J1YA 2QSFX 3OYLA 2ZJPF 4IHSA 1ZAOA 2JUCA 4B47A 2K86A 2F5EA 1TP4A 3VDXA 2D5VA 2PJRB 5KAFC 2VONA 2D2WA 3IKVA 1T6SA 1D5VA 1R4MB 2LF7A 2A69F 2EIMH 4CYCA 3DKYA 2OAZA 3ECHA 3CD6I 5E3MA 1JE8A 3LSGA 5E79C 1GVDA 2VUMJ 1R6RA 3HOUJ 1Z6TA 3I9V2 1LVAA 3NRVA 2YUSA 1SFKA 4RGSA 3SQNA 4HPQA 3ISPA 2JA6J 1O57A 1QO0D 1JKRC 2CUEA 4UXNA 1BC7C 2WY8Q 2XF5A 4LG3A 1MGTA 4ZYDA 1JI8A 1LDDA 3TOBA 2CV0A 5FLVA 3V8KA 2DW4A 2XAQA 4ZDPA 2VJ5A 3K4NA 1F5TA 3NQOA 3GZ5A 4HZFA 1XMKA 4IZZA 1XSDA 1K7AA 5FB2A 4XLFA 3HHGA 3VYRB 2YSRA 2AHQA 1J7KA 4HSRA 2R5ZB 4UV8A 2V1XA 3QP5A 3MZHA 4UB6C 3ESWB 4A3IJ 2KRHA 3KX2A 4LK1F 4MTEA 3HUGB 3K1NA 4D1QA 3MKWB 4DQ2A 4WX9A 1XX5A 4BXUA 1S72I 2VL8A 3FXUA 2R4GA 5D4RA 4OIPF 1BJAA 3DKXA 2QQAA 5C4JJ 3FISA 1E0EA 2NVYJ 3I54A 5CVUA 2Y9ZA 1J9IA 1A35A 1AHDP 3M9AA 5CVJA 1ULYA 3L2RA 4R79A 3JTHA 4E7KA 4BU2A 3DV8A 5C4XJ 2Q0OA 4XRFA 4KISA 2HZTA 2FX0A 4AU7A 3U21A 2EV5A 3SEQA 4PGGA 4G9YA 1BOAA 1RRJA 3ASNH 3MN2A 4EJWA 3S17J 1XTAA 2UZKA 3RI4A 5E3LA 4BQOA 2CUZA 3FBIB 1W0UA 2IJLA 2XB0X 3ZQIA 1HF0A 2GIZA 2KIUA 3GWZA 3ZR8X 3L2VA 4GFBA 1FOWA 2FA5A 4PK4A 3OYNA 4HF2A 4EV0A 1K61A 2DODA 2H1KA 5E1WA 4DIQA 3OR1C 3ASOH 1GXPA 1K4TA 1QU3A 2M0MA 1YYVA 1G59A 1ZQ3P 4I2OA 1BJZA 4ZZDA 3UR3C 2V6EA 2Y31A 3RCOA 4KYWA 4WF2A 1KZHA 4QPQA 4BQNA 1P4XA 1OLTA 3I59A 3GTQJ 3CUOA 2Y0SA 2RC4A 1BM9A 1WJCA 4PJJA 4A3KJ 2QLZA 2I5UA 1IRXA 1OCOH 4OAZA 2MH2A 1LE8A 2WAEA 1SVMA 1H89C 2A5WA 2DMPA 3IAM2 4XKVA 1NG7A 1YE9A 5ED4A 1RKTA 1JJ8C 4CCOA 5LRSA 1HC8A 1J59A 1O7LA 3IH4A 2VT3A 3FXOA 4G6QA 4OIQF 1SFXA 4A3CJ 2V6CA 3FX3A 4IRIA 5DS9A 2HEOA 2NS8A 3FM5A 1TLHB 2QKLB 2IS2A 3IH3A 5DCMB 5GADJ 2K02A 2NS7A 2VKDA 2GLOA 1T33A 1TWAJ 1XSXA 3QPLA 1BOBA 2HQAA 5CQEA 4HDVA 5LD2C 3U1DA 2NVTJ 5F6FA 4RDUA 4G6DA 2M8EA 4M9XA 1EH6A 4IRGA 2JUGA 3FHZA 3DPUA 2OU2A 2WB1N 5L3DA 2L4MA 1HKQA 2KIFA 2Y48A 1YG2A 3BDDA 1JHFA 2DT5A 3AL0B 5LHGA 2DFEA 4B43A 1YJNI 4G12A 4CSWA 1FSEA 3ZQLA 1IN5A 3HGGA 3HPHA 1QHGA 1HQCA 1B72B 3RYPA 1ZLKA 5EGOA 4ENMA 2E1NA 2VBWA 3WU0A 4LGWA 3E6DA 4BJTA 1DP3A 1EJ9A 2UV1A 3M4OJ 2JA5J 4C30A 1OCCH 1WJAA 3BC8A 2HS5A 3NWSA 1SFUA 2LH9A 2LTPA 1X3WB 1B59A 4DYQA 2R7VA 1DGRM 5IP7J 5DUIA 2KDOA 1Z67A 2V9VA 5HDGA 1SD5A 3CJNA 2EJRA 3AFHA 1SC7A 2X1EA 1DDNA 4ZYGA 5LEJA 3A01B 1DU6A 2KJBA 4A6EA 2KP6A 2NRAC 2PEXA 3PNVA 4GYIA 5HLGA 1Z91A 2XRLA 2B7EA 3HOVJ 1OJLA 4CYCB 5K1YA 1E3OC 2Y75A 1V5EA 1YW9A 3RQ4A 3EUKL 1Z1DA 3I0TA 1CQTA 1ZRCA 3C18A 4BJ5C 4E6KG 4CXFA 3DLLF 2XPWA 2HTJA 2K9QA 3BTIA 2DI3A 3FWEA 1DPUA 4RAZA 5DCFA 1H0MA 3P9KA 1TWHJ 4L9TA 1IDYA 2F5CA 5J8CA 1XN7A 3OL3A 2M4KA 5F0HA 2IS6A 4YFXF 2HPIA 4NDLA 2MGQA 3C2GA 4XNFA 4YIRX 3N97A 2BVMA 2O0YA 2XUBA 3PSFA 3F6OA 2EFQA 2B9SA 4HG2A 1I6HJ 4NBQA 3O2PE 3K4KA 2MABA 2HQRA 2Y9YA 3I55I 3FZVA 1RUNA 2O03A 2LP0A 1GV2A 2QSHX 1L0OC 2E1OA 2EFNA 4QLCU 3S2WA 4BUPA 4XRMA 3KCCA 3GTOJ 1LEAA 1HKSA 2HYFA 1FPQA 4DYCA 3TL4X 5LRRA 1FP1D 4X0GA 3E1SA 1YIOA 2Z33A 2HTSA 2P5VA 3TO6A 2VQLA 2RDPA 3H5RA 4IVNA 5GP9A 1ETOA 5LGTA 5M3MJ 1XD7A 4BQQA 1R4NB 3I4NJ 2LBFA 4FISA 3PIPF 3ZMTA
chains in the Genus database with same CATH topology
1CGPA 4IF4A 2XHKA 2BGCA 2OQGA 2P6TA 5LEKA 5EEGA 3V7SA 1FC3A 3BPVA 4ENKA 3DXJF 1U6GA 1E2XA 3KP6A 4KT5C 5J6XA 5L3EA 3HOTA 2DFIA 3E6BA 2CSOA 3M8FA 4BQAA 2IA2A 4PDKA 4UVCA 3TO7A 2DBBA 1A04A 3QP6A 3HOSA 3GZ6A 2A6EF 1UB9A 1J5YA 3I59B 2QQBA 4EM2A 2X0LA 2M1BA 2D1VA 3JSOA 1KQ8A 1Z05A 5D4SA 1K6OA 2GA1A 3DEUA 4U88A 3T8TA 3L2CA 3ZMUA 5BQTA 1T98A 1T0FA 2VOOA 1FBSA 1R5HA 1SAXA 3RPQA 1KYZA 2P5LC 3KP4A 5ICFA 2BBYA 1TW2A 3CUQC 3QPTA 2M87A 4L9JA 2DK5A 1S8NA 2GZWA 2HDCA 2FU4A 5ICGA 3B73A 2O8XA 2DAOA 3KLNA 1RUOA 4YFKF 2IPQX 4QWQA 2ZXJA 4UVBA 1KU9A 1HBXG 1GXQA 3HRMA 1ON2A 2HWVA 1IXRC 4L18B 3BJ6A 3D0SA 1FY7A 4IXAA 4ZZLA 4HBLA 3E5QA 4KA4A 3LWFA 4A0XA 5E1ZB 4GYGA 1T39A 2L02A 4OU0A 5AONA 5K5OA 2J5PA 5DUKA 2L4AA 4LD5A 3M8EA 4Q4ZF 3HRTA 2ESHA 1ZG5A 3EDPA 1WWXA 4KN7X 3EYIA 2YX4A 2ETHA 3T0YA 2FOKA 5E8IA 2CW0F 1C0WA 2UXNA 2P5KA 4LK0F 2PI0A 2YR2A 2QQ9A 4CGZA 3DPTA 4OOIA 3R6SA 1QGPA 4G7OF 2VT2A 5J8FA 1HW1A 5E17F 3QU6A 1LB2A 1FX7A 3BPXA 4ESJA 5D5UB 3GLXA 4IJAA 2VXZA 3TOAA 2XV4S 3HHHA 1AOYA 3OOPA 3MQ0A 4R8HA 1FOKA 4EMSA 4UV9A 4RB3C 3F8MA 1K79A 4YIIA 3R4KA 3K0LA 5CYVA 1T38A 2QUFA 4MTDA 3CDHA 4A12A 2HKOA 3LAJA 3HTUA 4N9HA 4AVPA 2WTEA 4LB5A 1R7JA 1WI9A 3R60A 2FBHA 2PMHA 4HLXA 1OKRA 1S7OA 2O6GE 4FHTA 2W84A 3R61A 1YTYA 1SMTA 2QWWA 5FFXA 1MZBA 5H6QA 1QNTA 3GFIA 1BN5A 3U9GA 1SMYF 4UHTA 4UNOA 1IUYA 3KE2A 2Z5UA 4Y15A 5FD6A 3RKWA 3ZMVA 3I71A 2M30A 4DNCA 1IW7F 2OZUA 3WTZA 4PGHA 2F5DA 3M1EA 3NEUA 4MEYF 2FMLA 3GO5A 1T2KA 3H92A 5CVRA 1QPMA 2V79A 2VBYA 3F8FA 1TQIA 2AXLA 4B09A 1MJAA 2OQRA 1UHWA 3H3UA 1IAWA 2XAHA 3EYYA 1V3FA 4E70A 1U2WA 1IF1A 3CO6C 4ZYHA 3WU1B 1O3SA 3LSTA 3P7NA 2PN6A 4GGGA 1G4DA 3GF2A 2P6SA 4LMYA 2ZFWA 1TW3A 1TNTA 3BOQA 1K78A 1J2XA 2JSCA 1R1TA 1FNNA 1KU2A 4RGXA 1ZARA 1HSTA 4EJOA 3LFKA 4P5OA 2Z99A 2K7LA 2BE5F 1P6RA 5E18F 4CYDA 2GAUA 1JXSA 2CGPA 1LDKB 2CO5A 3F8NA 2H09A 2VOPA 2ADUA 2GXGA 4HA8A 2FSWA 2K27A 3MWMA 4WCGA 1PP7U 1ODDA 2MLKA 3QU3A 5LBQA 3GXOA 3TQNA 1EV7A 3HIFA 3ZPLA 3RPUA 1HXDA 3BJAA 3E5UA 3T1BA 3Q5FA 3BP8A 2R3SA 2ZBKA 3HSFA 1RI7A 1U8RA 4P55A 5BPDA 4RB1A 2R7DA 4LB6B 3IWZA 3K69A 2A68F 1OPCA 1F1ZA 5LLQA 4EJVA 2HGCA 5E8GA 2H27A 1CF7A 2HQNA 1BI2A 2XAGA 2EA4A 3LA3A 5JI6A 1B6AA 4HLYA 4B8XA 4M9ZA 1U3EM 2W85A 3RKYA 4CZZA 2BYVE 4EGYA 4M6XA 4WWCA 3CUQB 3GVAA 3WTXC 4TV7A 3BZ6A 4R1HA 1OYYA 4LLGF 3FF5A 2EFPA 1U5TC 1MKMA 2G7UA 3RJPA 3O6BB 3REOA 4FX4A 1ZRFA 2RKHA 2P7CB 3FXRA 1GHCA 3V8LA 1Q1HA 1O3TA 2RVCA 2ISZA 1O7FA 4Y17A 2COMA 2IA1A 2RV8A 4HV6A 4BHBA 4D0PA 1EH7A 5BPIA 4A2UA 5ILSA 5HDNA 4CICA 2LNBA 1W7PB 4I98B 2P7VB 2VC0A 5ICEA 1I27A 3F72A 3N4MA 2R7FA 4HF1A 3CO7C 2G9WA 1KQ9A 2EA2A 2AS5F 3E97A 4Q48A 5CLSA 5ICCA 1LDJA 3WTTC 2F5FA 1RZ4A 4GO1A 5FD5A 1D3YA 5JVTA 2X4HA 3F3XA 4EM1A 3KEOA 2QYOA 4NB5A 1H9GA 3K9TA 1G3TA 4EJUA 1K78B 3QPHA 3PQKA 3ML6A 2EFOA 2YX7A 1B4AA 4EM0B 3COAC 3B02A 2QBYB 3GFJA 4L9NA 4KDPA 1JHHA 1MDMA 1IN7A 1IXSB 3LQRA 3HRSA 4ENJA 3MCZA 5IT9K 3ZQ7A 2NAZA 1OMIA 4LLLA 4AIJA 1FYLA 3F21A 1I5ZA 5KVRA 5DDGA 4OMYA 2L54A 2DK8A 4LJZF 3FMQA 2XRNA 1ZGJA 1Y0UA 4F7ZA 6PAXA 2JPBA 1IN6A 3L9FA 1XGMA 2LF8A 3KP7A 1YW8A 2W25A 4RGRA 3IRQA 4EQQA 4A5MA 3ULQB 2DO7A 2EK5A 1KQ0A 4M71A 5IT9Z 3IWFA 4HF0A 4H0EA 2L01A 4YFNF 3K1MA 4HDUA 3PQJA 1L3LA 5K5QA 3P9IA 2OZ6A 3SXYA 3WGGA 4OIRF 1D8JA 2G7HA 3VODA 1CF7B 4N9IA 5L3BA 4KIFA 3L00A 3I64A 3ROUA 2FE3A 2JZYA 5L3FA 1KGSA 2Z9OA 3T5XA 4EVIA 2F2EA 3R0AA 4BAYA 1XCBA 1F9NA 4KMUX 3P9CA 5LHIA 4KFCA 4KN4X 2KIMA 4KIBA 3LA7A 3EQLF 1B1BA 4HW0A 1R23A 1I1SA 3IL2A 2XKPA 1ZGAA 2A6HF 1S29A 4OINF 1B9MA 5HLHA 1FZPB 3BY6A 5JHUA 4U7DA 3E3VA 1FYMA 4HAMA 3F6VA 4YG2F 3FXQA 1SFEA 4Q5SF 4FT8A 4PZJA 4P96A 5CVVA 3BWGA 3Q9VA 4WXDA 3E5XA 1BC8C 4RB0A 1ONVA 4Z2YA 4L0YB 1RNLA 3J80K 4ENNA 3PFIA 3D5LA 2YU3A 2EB7A 4FX0A 5ILVA 2LDUA 1Z9CA 2DLLA 4ZH4F 2A3SA 3V7CA 2IA0A 1SD7A 1WQ2A 1BI1A 1TNSA 4KIGA 2MC3A 4I7HA 1TBXA 3GW2A 3I53A 4K2EA 5BOXA 2OBPA 2XASA 2RQPA 1XB4A 1UCRA 4I0AA 1OR7A 4OMZA 4RB2C 3J80Z 4L0ZB 1KA8A 2FBIA 2STWA 1X3UA 5LHHA 4ESFA 1MDMB 1ZHFA 1R58A 2ZMEA 1FBUA 4WK8F 4M72A 5FGMA 3TDUC 2JT1A 5FLXK 2NNNA 3SZTA 5A2QK 4UUVA 3K1PA 4MHGA 2IRFG 3VEPA 5CJ9A 3ELKA 1HW2A 3BJOA 3SFZA 3GEZA 2M45A 3ABTA 1HKTA 4P9FA 1W5TA 3GYHX 3G73A 1ZN2A 3I5UA 3MEXA 2UXXA 1FBQA 2ELHA 3WG9A 1G3SA 4G94A 2JTVA 2MD5A 4PCQA 2L3DA 2PQ8A 2VE9A 5FLXZ 5A2QZ 3JAMK 3ZMZA 3CUQA 4AIKA 2TDXA 2MH9A 5LGUA 1F4KA 3CLOA 3WODF 5K5RA 2IW5A 4M74A 2CQKA 4G8XA 2HFHA 1P4WA 2EFWA 2CWEA 1S3JA 2ZKZA 3E6MA 1D8KA 2XROA 5AIPA 2DU9A 4L9VA 3JAMZ 3MAJA 4P9UA 3FMRA 4HOBA 3ZMSA 1I1GA 4CDGA 1BIAA 1W4MA 2QENA 3EUHA 1FYKA 1W7PA 1QQIA 3IKTA 4A5NA 2ZJ2A 2ZNYA 1GVJA 3JTGA 2VBXA 2UWMA 4I01A 4I02A 4MGRA 1MD0A 2HYGD 4A6DA 1SD4A 1XGSA 2B0LA 3Q9SA 1LEBA 2MLGA 2QBYA 4LFUA 1I6XA 1G3WA 2A61A 5HS9A 1R1VA 3LQQA 4HQMA 3VOEA 5F1RA 1WSUA 1XSVA 3ERED 2DTRA 1FT9A 3G3ZA 4S04A 2BV6A 5L3CA 2XAJA 3QOPA 1HW5A 2QVOA 2FMYA 2E1CA 4O3MA 3TDZC 3W6KB 1UHMA 3U2RA 3F8BA 2MA3A 1G6NA 1OYWA 2JPCA 2FXAA 2YPRA 3HSEA 1V4RA 2P8TA 1BI0A 3C7JA 4U0YA 2CG4A 2ZMEB 1LNWA 3DQVC 2H6CA 2DQLA 1U78A 3WTWC 3IC7A 1QZYA 4M6YA 4WXCA 4XLNF 4AIHA 3HSRA 1MJ9A 2E7WA 3W6JB 1XGNA 4HX7A 4RS8A 1HSJA 1ZYRF 4G7HF 3ZP5A 1P2FA 1W7PD 2NNYA 4Y13A 1IZ1A 4U0WA 3FMSA 3IHUA 1PP8F 3HRUA 2J5OA 4ON0A 3C3WA 2K4BA 2VODA 1R5GA 1FP2A 2PFBA 4BH9A 3LA2A 1S6LA 5D6FA 4IPAA 4M73A 2RNJA 2MBFA 3ZMDA 5HOOA 2Y0MA 2C6YA 3DKWA 5KK1A 1WKMA 1E17A 1UFMA 1IN4A 4JBAA 3DPLC 1REPC 2LKPA 4O5VA 5DYMA 4L5JA 4AD9A 5D5VB 1RIOH 3E6CC 1WRJA 2IVMA 1YW7A 4JQFA 3V8JA 4NQWA 5D6EA 4A0ZA 2O61A 3GUDA 1MJBA 1J75A 1S7AA 5ILUA 1USTA 1TQPA 2KRFA 2PG4A 3VB2A 4CHUA 4ETSA 2IP2A 5HLIA 5BS6A 2HR3A 3WTVC 1DPRA 5L3GA 4BNCA 3EETA 5D5XB 1EH8A 1USSA 4BHPA 3BROA 2FNAA 5D5WB 1DUXC 2FBKA 3L09A 2HKXA 4XSXF 3QAHA 2A5YB 4O6JA 3SHFA 4CO8A 1FLIA 1XCVA 2GIVA 5HS7A 2VN2A 2XAFA 3WGIA 5TRDA 3CTAA 3GFMA 4XLPF 4KMFA 1R36A 4A0YA 5IT3A 4I09A 1PUEE 4AWXB 5FO5A 1ON1A 4XBFA 1SD6A 3F22A 4EJTA 3RKXA 1IRFA 1ZH5A 4U7BA 4MEXF 4MNUA 2ZCWA 2XVCA 3J81K 2GA2A 2Q2EA 1XDSA 2RN7A 2O3FA 2A07F 1ZG1A 4HX4A 3IRRA 5DEQA 1LJ9A 4Q47A 1KYWA 1KU7A 3GFLA 5LGNA 5HDKA 2EV6A 2KJCA 3JW4A 3ZN1A 3KZYA 1Z6RA 3TGNA 5DD8A 4EGZA 5TJJA 1ZRDA 3KLOA 1QZZA 3J81Z 1STZA 4HX8A 2ACJA 2D45A 1U5TA 2P4WA 2QM3A 3RTRA 4GCVA 5ERIA 2RGVA 3KP3A 3SZPA 4M9SA 4RAYA 5F64A 1VTNC 3DP7A 4IHTA 3KP5A 4L5IA 4LG0A 3QRFF 2DPUA 4ZYEA 2ZNZA 1R00A 2D1HA 2PMUA 2WWYA 2HOEA 3F8CA 3GX4X 2NS0A 3WTYC 3ZN0A 1NHAA 4KUMA 4ASNA 3C1DA 1QBJA 2FQ3A 1XDUA 5HVQC 2ZO4A 2FEZA 3LAPA 1IN8A 5E20A 2PLYA 1R1UA 1H9TA 3MZYA 2VBZA 2W24A 3WTUC 2ISYA 4G7ZF 1YQAA 4MQ9F 5CVIA 2PBIA 5AIQA 1IRGA 3RIRA 3V7RA 1BBYA 2FF4A 3KETA 2EV0A 3HTSB 5JFRA 4OIOF 5H6RA 5D8KB 1O3RA 1O3QA 4UVAA 3AAFA 4LLNA 2QZ8A 4I0BA 1R22A 2LSOA 3OV8A 3K2ZA 2BEOA 2E7XA 3VFZA 4IRHA 3J7AO 4JK1X 1XMAA 4HQEA 2NYXA 3HUGA 5JR3A 3KFWX 3KEQA 1B9NA 2FRHA 4WXHA 2WV0A 2DPDA 2EWNA 4HV5A 5EEHA 3I4PA 2V1DA 2XKOA 2IT0A 1ZREA 5FFZA 5D8LB 2GWRA 2GQQA 1BI3A 3TO9A 1IXCA 3I58A 2STTA 2CYYA 2CFXA 3O3KA 4HYEA 2K4JA 3FM3A 3DF8A 1DP7P 3T8RA 2H6BA 1YLFA 1G3YA 4N0BA 3MFKA 2GXBA 3ABUA 5E1XA 4GXOA 1TTYA 4YIFA 3WTSC 2OD5A 4KICA 2V1UA 2KKOA 2DQRA 1KU3A 1TQMA 5BMZA 5DV5A 2H94A 5HS8A 1LQ1A 4S05A 1YS7A 1YS6A 3M7GA 2VC1A 1P92A 3HYIA 4MQVA 1AWCA 3DFGA 2W57A 3R0JA 1BIBA 2Z3YA 1ZG3A 3V4GA 5DCMA 4KNYA 3ECOA 3RYRA 1U5TB 1ZLJA 3KP2A 2Q8KA 2PJPA 3TKYA 1P4AA 2VE8A 4BYYA 1FSHA 3WGHA 3WE3A 5H20A 1Z7UA 5DD4A 3L7WA 4RGUA 1JGSA 4BHCA 4ESBA 4LG0B 1XGOA 3JSPA 3F23A 1OYIA 3WE2A 1FWZA 4U0VA 4NHJA 3H3ZA 1PDNC 1W5SA 1J0RA 2OA4A 1YFHA 2XGXA 3KZZA 4XSZF 2M5WA 2WC2A 2XIGA 2JRTA 2FNPA 1YO5C 3RDIA 2ESNA 4IHSA 1ZAOA 2K86A 2F5EA 2VONA 2D2WA 3IKVA 1T6SA 1D5VA 2LF7A 2A69F 3ECHA 2OAZA 1JE8A 1Z6TA 1LVAA 3NRVA 4RGSA 3SQNA 3ISPA 1O57A 1QO0D 4UXNA 1BC7C 4ZYDA 1MGTA 1LDDA 3TOBA 3V8KA 2DW4A 2XAQA 1F5TA 3NQOA 3GZ5A 4HZFA 1XMKA 1XSDA 1K7AA 5FB2A 3HHGA 2YSRA 1J7KA 4UV8A 2V1XA 3QP5A 3MZHA 4LK1F 4MTEA 3K1NA 4DQ2A 4WX9A 4BXUA 3FXUA 5D4RA 4OIPF 1BJAA 2QQAA 1J9IA 3I54A 5CVUA 3M9AA 5CVJA 1ULYA 4R79A 3JTHA 3DV8A 2Q0OA 4XRFA 2HZTA 2EV5A 4PGGA 4G9YA 1BOAA 4EJWA 2UZKA 3RI4A 2IJLA 2KIUA 3GWZA 2FA5A 4HF2A 4EV0A 5E1WA 1GXPA 1YYVA 4I2OA 4ZZDA 4KYWA 4WF2A 1P4XA 3I59A 3CUOA 2RC4A 1BM9A 2QLZA 2MH2A 5ED4A 5LRSA 1J59A 1O7LA 2VT3A 4G6QA 4OIQF 1SFXA 2V6CA 3FX3A 4IRIA 2HEOA 3FM5A 1TLHB 5DCMB 2K02A 1XSXA 4HDVA 3U1DA 5F6FA 4G6DA 2M8EA 4M9XA 1EH6A 4IRGA 3FHZA 2OU2A 5L3DA 2L4MA 1HKQA 2KIFA 2Y48A 1YG2A 3BDDA 1JHFA 2DT5A 5LHGA 1FSEA 1IN5A 1HQCA 3RYPA 1ZLKA 4ENMA 2E1NA 2VBWA 3WU0A 4LGWA 3E6DA 2HS5A 1SFUA 1B59A 5DUIA 5HDGA 2V9VA 1SD5A 3CJNA 2EJRA 1DDNA 4ZYGA 5LEJA 2KJBA 4A6EA 2NRAC 2PEXA 4GYIA 5HLGA 1Z91A 5K1YA 2Y75A 1YW9A 1Z1DA 3I0TA 1ZRCA 3C18A 4CXFA 2HTJA 2DI3A 3FWEA 1DPUA 4RAZA 5DCFA 1H0MA 3P9KA 4L9TA 2F5CA 5J8CA 1XN7A 4YFXF 3N97A 2O0YA 2XUBA 3F6OA 2EFQA 3O2PE 2HQRA 3FZVA 1RUNA 2O03A 1L0OC 2EFNA 4QLCU 3S2WA 3KCCA 1LEAA 1HKSA 2HYFA 1FPQA 5LRRA 1FP1D 1YIOA 2Z33A 2HTSA 2P5VA 3TO6A 2RDPA 4IVNA 5LGTA 1XD7A 3ZMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CGP A;  4IF4 A;  2XHK A;  2BGC A;  2OQG A;  2P6T A;  5LEK A;  5EEG A;  3V7S A;  1FC3 A;  3BPV A;  4ENK A;  3DXJ F;  1U6G A;  1E2X A;  3KP6 A;  4KT5 C;  5J6X A;  5L3E A;  3HOT A;  2DFI A;  3E6B A;  2CSO A;  3M8F A;  4BQA A;  2IA2 A;  4PDK A;  4UVC A;  3TO7 A;  2DBB A;  1A04 A;  3QP6 A;  3HOS A;  3GZ6 A;  2A6E F;  1UB9 A;  1J5Y A;  3I59 B;  2QQB A;  4EM2 A;  2X0L A;  2M1B A;  2D1V A;  3JSO A;  1KQ8 A;  1Z05 A;  5D4S A;  1K6O A;  2GA1 A;  3DEU A;  4U88 A;  3T8T A;  3L2C A;  3ZMU A;  5BQT A;  1T98 A;  1T0F A;  2VOO A;  1FBS A;  1R5H A;  1SAX A;  3RPQ A;  1KYZ A;  2P5L C;  3KP4 A;  5ICF A;  2BBY A;  1TW2 A;  3CUQ C;  3QPT A;  2M87 A;  4L9J A;  2DK5 A;  1S8N A;  2GZW A;  2HDC A;  2FU4 A;  5ICG A;  3B73 A;  2O8X A;  2DAO A;  3KLN A;  1RUO A;  4YFK F;  2IPQ X;  4QWQ A;  2ZXJ A;  4UVB A;  1KU9 A;  1HBX G;  1GXQ A;  3HRM A;  1ON2 A;  2HWV A;  1IXR C;  4L18 B;  3BJ6 A;  3D0S A;  1FY7 A;  4IXA A;  4ZZL A;  4HBL A;  3E5Q A;  4KA4 A;  3LWF A;  4A0X A;  5E1Z B;  4GYG A;  1T39 A;  2L02 A;  4OU0 A;  5AON A;  5K5O A;  2J5P A;  5DUK A;  2L4A A;  4LD5 A;  3M8E A;  4Q4Z F;  3HRT A;  2ESH A;  1ZG5 A;  3EDP A;  1WWX A;  4KN7 X;  3EYI A;  2YX4 A;  2ETH A;  3T0Y A;  2FOK A;  5E8I A;  2CW0 F;  1C0W A;  2UXN A;  2P5K A;  4LK0 F;  2PI0 A;  2YR2 A;  2QQ9 A;  4CGZ A;  3DPT A;  4OOI A;  3R6S A;  1QGP A;  4G7O F;  2VT2 A;  5J8F A;  1HW1 A;  5E17 F;  3QU6 A;  1LB2 A;  1FX7 A;  3BPX A;  4ESJ A;  5D5U B;  3GLX A;  4IJA A;  2VXZ A;  3TOA A;  2XV4 S;  3HHH A;  1AOY A;  3OOP A;  3MQ0 A;  4R8H A;  1FOK A;  4EMS A;  4UV9 A;  4RB3 C;  3F8M A;  1K79 A;  4YII A;  3R4K A;  3K0L A;  5CYV A;  1T38 A;  2QUF A;  4MTD A;  3CDH A;  4A12 A;  2HKO A;  3LAJ A;  3HTU A;  4N9H A;  4AVP A;  2WTE A;  4LB5 A;  1R7J A;  1WI9 A;  3R60 A;  2FBH A;  2PMH A;  4HLX A;  1OKR A;  1S7O A;  2O6G E;  4FHT A;  2W84 A;  3R61 A;  1YTY A;  1SMT A;  2QWW A;  5FFX A;  1MZB A;  5H6Q A;  1QNT A;  3GFI A;  1BN5 A;  3U9G A;  1SMY F;  4UHT A;  4UNO A;  1IUY A;  3KE2 A;  2Z5U A;  4Y15 A;  5FD6 A;  3RKW A;  3ZMV A;  3I71 A;  2M30 A;  4DNC A;  1IW7 F;  2OZU A;  3WTZ A;  4PGH A;  2F5D A;  3M1E A;  3NEU A;  4MEY F;  2FML A;  3GO5 A;  1T2K A;  3H92 A;  5CVR A;  1QPM A;  2V79 A;  2VBY A;  3F8F A;  1TQI A;  2AXL A;  4B09 A;  1MJA A;  2OQR A;  1UHW A;  3H3U A;  1IAW A;  2XAH A;  3EYY A;  1V3F A;  4E70 A;  1U2W A;  1IF1 A;  3CO6 C;  4ZYH A;  3WU1 B;  1O3S A;  3LST A;  3P7N A;  2PN6 A;  4GGG A;  1G4D A;  3GF2 A;  2P6S A;  4LMY A;  2ZFW A;  1TW3 A;  1TNT A;  3BOQ A;  1K78 A;  1J2X A;  2JSC A;  1R1T A;  1FNN A;  1KU2 A;  4RGX A;  1ZAR A;  1HST A;  4EJO A;  3LFK A;  4P5O A;  2Z99 A;  2K7L A;  2BE5 F;  1P6R A;  5E18 F;  4CYD A;  2GAU A;  1JXS A;  2CGP A;  1LDK B;  2CO5 A;  3F8N A;  2H09 A;  2VOP A;  2ADU A;  2GXG A;  4HA8 A;  2FSW A;  2K27 A;  3MWM A;  4WCG A;  1PP7 U;  1ODD A;  2MLK A;  3QU3 A;  5LBQ A;  3GXO A;  3TQN A;  1EV7 A;  3HIF A;  3ZPL A;  3RPU A;  1HXD A;  3BJA A;  3E5U A;  3T1B A;  3Q5F A;  3BP8 A;  2R3S A;  2ZBK A;  3HSF A;  1RI7 A;  1U8R A;  4P55 A;  5BPD A;  4RB1 A;  2R7D A;  4LB6 B;  3IWZ A;  3K69 A;  2A68 F;  1OPC A;  1F1Z A;  5LLQ A;  4EJV A;  2HGC A;  5E8G A;  2H27 A;  1CF7 A;  2HQN A;  1BI2 A;  2XAG A;  2EA4 A;  3LA3 A;  5JI6 A;  1B6A A;  4HLY A;  4B8X A;  4M9Z A;  1U3E M;  2W85 A;  3RKY A;  4CZZ A;  2BYV E;  4EGY A;  4M6X A;  4WWC A;  3CUQ B;  3GVA A;  3WTX C;  4TV7 A;  3BZ6 A;  4R1H A;  1OYY A;  4LLG F;  3FF5 A;  2EFP A;  1U5T C;  1MKM A;  2G7U A;  3RJP A;  3O6B B;  3REO A;  4FX4 A;  1ZRF A;  2RKH A;  2P7C B;  3FXR A;  1GHC A;  3V8L A;  1Q1H A;  1O3T A;  2RVC A;  2ISZ A;  1O7F A;  4Y17 A;  2COM A;  2IA1 A;  2RV8 A;  4HV6 A;  4BHB A;  4D0P A;  1EH7 A;  5BPI A;  4A2U A;  5ILS A;  5HDN A;  4CIC A;  2LNB A;  1W7P B;  4I98 B;  2P7V B;  2VC0 A;  5ICE A;  1I27 A;  3F72 A;  3N4M A;  2R7F A;  4HF1 A;  3CO7 C;  2G9W A;  1KQ9 A;  2EA2 A;  2AS5 F;  3E97 A;  4Q48 A;  5CLS A;  5ICC A;  1LDJ A;  3WTT C;  2F5F A;  1RZ4 A;  4GO1 A;  5FD5 A;  1D3Y A;  5JVT A;  2X4H A;  3F3X A;  4EM1 A;  3KEO A;  2QYO A;  4NB5 A;  1H9G A;  3K9T A;  1G3T A;  4EJU A;  1K78 B;  3QPH A;  3PQK A;  3ML6 A;  2EFO A;  2YX7 A;  1B4A A;  4EM0 B;  3COA C;  3B02 A;  2QBY B;  3GFJ A;  4L9N A;  4KDP A;  1JHH A;  1MDM A;  1IN7 A;  1IXS B;  3LQR A;  3HRS A;  4ENJ A;  3MCZ A;  5IT9 K;  3ZQ7 A;  2NAZ A;  1OMI A;  4LLL A;  4AIJ A;  1FYL A;  3F21 A;  1I5Z A;  5KVR A;  5DDG A;  4OMY A;  2L54 A;  2DK8 A;  4LJZ F;  3FMQ A;  2XRN A;  1ZGJ A;  1Y0U A;  4F7Z A;  6PAX A;  2JPB A;  1IN6 A;  3L9F A;  1XGM A;  2LF8 A;  3KP7 A;  1YW8 A;  2W25 A;  4RGR A;  3IRQ A;  4EQQ A;  4A5M A;  3ULQ B;  2DO7 A;  2EK5 A;  1KQ0 A;  4M71 A;  5IT9 Z;  3IWF A;  4HF0 A;  4H0E A;  2L01 A;  4YFN F;  3K1M A;  4HDU A;  3PQJ A;  1L3L A;  5K5Q A;  3P9I A;  2OZ6 A;  3SXY A;  3WGG A;  4OIR F;  1D8J A;  2G7H A;  3VOD A;  1CF7 B;  4N9I A;  5L3B A;  4KIF A;  3L00 A;  3I64 A;  3ROU A;  2FE3 A;  2JZY A;  5L3F A;  1KGS A;  2Z9O A;  3T5X A;  4EVI A;  2F2E A;  3R0A A;  4BAY A;  1XCB A;  1F9N A;  4KMU X;  3P9C A;  5LHI A;  4KFC A;  4KN4 X;  2KIM A;  4KIB A;  3LA7 A;  3EQL F;  1B1B A;  4HW0 A;  1R23 A;  1I1S A;  3IL2 A;  2XKP A;  1ZGA A;  2A6H F;  1S29 A;  4OIN F;  1B9M A;  5HLH A;  1FZP B;  3BY6 A;  5JHU A;  4U7D A;  3E3V A;  1FYM A;  4HAM A;  3F6V A;  4YG2 F;  3FXQ A;  1SFE A;  4Q5S F;  4FT8 A;  4PZJ A;  4P96 A;  5CVV A;  3BWG A;  3Q9V A;  4WXD A;  3E5X A;  1BC8 C;  4RB0 A;  1ONV A;  4Z2Y A;  4L0Y B;  1RNL A;  3J80 K;  4ENN A;  3PFI A;  3D5L A;  2YU3 A;  2EB7 A;  4FX0 A;  5ILV A;  2LDU A;  1Z9C A;  2DLL A;  4ZH4 F;  2A3S A;  3V7C A;  2IA0 A;  1SD7 A;  1WQ2 A;  1BI1 A;  1TNS A;  4KIG A;  2MC3 A;  4I7H A;  1TBX A;  3GW2 A;  3I53 A;  4K2E A;  5BOX A;  2OBP A;  2XAS A;  2RQP A;  1XB4 A;  1UCR A;  4I0A A;  1OR7 A;  4OMZ A;  4RB2 C;  3J80 Z;  4L0Z B;  1KA8 A;  2FBI A;  2STW A;  1X3U A;  5LHH A;  4ESF A;  1MDM B;  1ZHF A;  1R58 A;  2ZME A;  1FBU A;  4WK8 F;  4M72 A;  5FGM A;  3TDU C;  2JT1 A;  5FLX K;  2NNN A;  3SZT A;  5A2Q K;  4UUV A;  3K1P A;  4MHG A;  2IRF G;  3VEP A;  5CJ9 A;  3ELK A;  1HW2 A;  3BJO A;  3SFZ A;  3GEZ A;  2M45 A;  3ABT A;  1HKT A;  4P9F A;  1W5T A;  3GYH X;  3G73 A;  1ZN2 A;  3I5U A;  3MEX A;  2UXX A;  1FBQ A;  2ELH A;  3WG9 A;  1G3S A;  4G94 A;  2JTV A;  2MD5 A;  4PCQ A;  2L3D A;  2PQ8 A;  2VE9 A;  5FLX Z;  5A2Q Z;  3JAM K;  3ZMZ A;  3CUQ A;  4AIK A;  2TDX A;  2MH9 A;  5LGU A;  1F4K A;  3CLO A;  3WOD F;  5K5R A;  2IW5 A;  4M74 A;  2CQK A;  4G8X A;  2HFH A;  1P4W A;  2EFW A;  2CWE A;  1S3J A;  2ZKZ A;  3E6M A;  1D8K A;  2XRO A;  5AIP A;  2DU9 A;  4L9V A;  3JAM Z;  3MAJ A;  4P9U A;  3FMR A;  4HOB A;  3ZMS A;  1I1G A;  4CDG A;  1BIA A;  1W4M A;  2QEN A;  3EUH A;  1FYK A;  1W7P A;  1QQI A;  3IKT A;  4A5N A;  2ZJ2 A;  2ZNY A;  1GVJ A;  3JTG A;  2VBX A;  2UWM A;  4I01 A;  4I02 A;  4MGR A;  1MD0 A;  2HYG D;  4A6D A;  1SD4 A;  1XGS A;  2B0L A;  3Q9S A;  1LEB A;  2MLG A;  2QBY A;  4LFU A;  1I6X A;  1G3W A;  2A61 A;  5HS9 A;  1R1V A;  3LQQ A;  4HQM A;  3VOE A;  5F1R A;  1WSU A;  1XSV A;  3ERE D;  2DTR A;  1FT9 A;  3G3Z A;  4S04 A;  2BV6 A;  5L3C A;  2XAJ A;  3QOP A;  1HW5 A;  2QVO A;  2FMY A;  2E1C A;  4O3M A;  3TDZ C;  3W6K B;  1UHM A;  3U2R A;  3F8B A;  2MA3 A;  1G6N A;  1OYW A;  2JPC A;  2FXA A;  2YPR A;  3HSE A;  1V4R A;  2P8T A;  1BI0 A;  3C7J A;  4U0Y A;  2CG4 A;  2ZME B;  1LNW A;  3DQV C;  2H6C A;  2DQL A;  1U78 A;  3WTW C;  3IC7 A;  1QZY A;  4M6Y A;  4WXC A;  4XLN F;  4AIH A;  3HSR A;  1MJ9 A;  2E7W A;  3W6J B;  1XGN A;  4HX7 A;  4RS8 A;  1HSJ A;  1ZYR F;  4G7H F;  3ZP5 A;  1P2F A;  1W7P D;  2NNY A;  4Y13 A;  1IZ1 A;  4U0W A;  3FMS A;  3IHU A;  1PP8 F;  3HRU A;  2J5O A;  4ON0 A;  3C3W A;  2K4B A;  2VOD A;  1R5G A;  1FP2 A;  2PFB A;  4BH9 A;  3LA2 A;  1S6L A;  5D6F A;  4IPA A;  4M73 A;  2RNJ A;  2MBF A;  3ZMD A;  5HOO A;  2Y0M A;  2C6Y A;  3DKW A;  5KK1 A;  1WKM A;  1E17 A;  1UFM A;  1IN4 A;  4JBA A;  3DPL C;  1REP C;  2LKP A;  4O5V A;  5DYM A;  4L5J A;  4AD9 A;  5D5V B;  1RIO H;  3E6C C;  1WRJ A;  2IVM A;  1YW7 A;  4JQF A;  3V8J A;  4NQW A;  5D6E A;  4A0Z A;  2O61 A;  3GUD A;  1MJB A;  1J75 A;  1S7A A;  5ILU A;  1UST A;  1TQP A;  2KRF A;  2PG4 A;  3VB2 A;  4CHU A;  4ETS A;  2IP2 A;  5HLI A;  5BS6 A;  2HR3 A;  3WTV C;  1DPR A;  5L3G A;  4BNC A;  3EET A;  5D5X B;  1EH8 A;  1USS A;  4BHP A;  3BRO A;  2FNA A;  5D5W B;  1DUX C;  2FBK A;  3L09 A;  2HKX A;  4XSX F;  3QAH A;  2A5Y B;  4O6J A;  3SHF A;  4CO8 A;  1FLI A;  1XCV A;  2GIV A;  5HS7 A;  2VN2 A;  2XAF A;  3WGI A;  5TRD A;  3CTA A;  3GFM A;  4XLP F;  4KMF A;  1R36 A;  4A0Y A;  5IT3 A;  4I09 A;  1PUE E;  4AWX B;  5FO5 A;  1ON1 A;  4XBF A;  1SD6 A;  3F22 A;  4EJT A;  3RKX A;  1IRF A;  1ZH5 A;  4U7B A;  4MEX F;  4MNU A;  2ZCW A;  2XVC A;  3J81 K;  2GA2 A;  2Q2E A;  1XDS A;  2RN7 A;  2O3F A;  2A07 F;  1ZG1 A;  4HX4 A;  3IRR A;  5DEQ A;  1LJ9 A;  4Q47 A;  1KYW A;  1KU7 A;  3GFL A;  5LGN A;  5HDK A;  2EV6 A;  2KJC A;  3JW4 A;  3ZN1 A;  3KZY A;  1Z6R A;  3TGN A;  5DD8 A;  4EGZ A;  5TJJ A;  1ZRD A;  3KLO A;  1QZZ A;  3J81 Z;  1STZ A;  4HX8 A;  2ACJ A;  2D45 A;  1U5T A;  2P4W A;  2QM3 A;  3RTR A;  4GCV A;  5ERI A;  2RGV A;  3KP3 A;  3SZP A;  4M9S A;  4RAY A;  5F64 A;  1VTN C;  3DP7 A;  4IHT A;  3KP5 A;  4L5I A;  4LG0 A;  3QRF F;  2DPU A;  4ZYE A;  2ZNZ A;  1R00 A;  2D1H A;  2PMU A;  2WWY A;  2HOE A;  3F8C A;  3GX4 X;  2NS0 A;  3WTY C;  3ZN0 A;  1NHA A;  4KUM A;  4ASN A;  3C1D A;  1QBJ A;  2FQ3 A;  1XDU A;  5HVQ C;  2ZO4 A;  2FEZ A;  3LAP A;  1IN8 A;  5E20 A;  2PLY A;  1R1U A;  1H9T A;  3MZY A;  2VBZ A;  2W24 A;  3WTU C;  2ISY A;  4G7Z F;  1YQA A;  4MQ9 F;  5CVI A;  2PBI A;  5AIQ A;  1IRG A;  3RIR A;  3V7R A;  1BBY A;  2FF4 A;  3KET A;  2EV0 A;  3HTS B;  5JFR A;  4OIO F;  5H6R A;  5D8K B;  1O3R A;  1O3Q A;  4UVA A;  3AAF A;  4LLN A;  2QZ8 A;  4I0B A;  1R22 A;  2LSO A;  3OV8 A;  3K2Z A;  2BEO A;  2E7X A;  3VFZ A;  4IRH A;  3J7A O;  4JK1 X;  1XMA A;  4HQE A;  2NYX A;  3HUG A;  5JR3 A;  3KFW X;  3KEQ A;  1B9N A;  2FRH A;  4WXH A;  2WV0 A;  2DPD A;  2EWN A;  4HV5 A;  5EEH A;  3I4P A;  2V1D A;  2XKO A;  2IT0 A;  1ZRE A;  5FFZ A;  5D8L B;  2GWR A;  2GQQ A;  1BI3 A;  3TO9 A;  1IXC A;  3I58 A;  2STT A;  2CYY A;  2CFX A;  3O3K A;  4HYE A;  2K4J A;  3FM3 A;  3DF8 A;  1DP7 P;  3T8R A;  2H6B A;  1YLF A;  1G3Y A;  4N0B A;  3MFK A;  2GXB A;  3ABU A;  5E1X A;  4GXO A;  1TTY A;  4YIF A;  3WTS C;  2OD5 A;  4KIC A;  2V1U A;  2KKO A;  2DQR A;  1KU3 A;  1TQM A;  5BMZ A;  5DV5 A;  2H94 A;  5HS8 A;  1LQ1 A;  4S05 A;  1YS7 A;  1YS6 A;  3M7G A;  2VC1 A;  1P92 A;  3HYI A;  4MQV A;  1AWC A;  3DFG A;  2W57 A;  3R0J A;  1BIB A;  2Z3Y A;  1ZG3 A;  3V4G A;  5DCM A;  4KNY A;  3ECO A;  3RYR A;  1U5T B;  1ZLJ A;  3KP2 A;  2Q8K A;  2PJP A;  3TKY A;  1P4A A;  2VE8 A;  4BYY A;  1FSH A;  3WGH A;  3WE3 A;  5H20 A;  1Z7U A;  5DD4 A;  3L7W A;  4RGU A;  1JGS A;  4BHC A;  4ESB A;  4LG0 B;  1XGO A;  3JSP A;  3F23 A;  1OYI A;  3WE2 A;  1FWZ A;  4U0V A;  4NHJ A;  3H3Z A;  1PDN C;  1W5S A;  1J0R A;  2OA4 A;  1YFH A;  2XGX A;  3KZZ A;  4XSZ F;  2M5W A;  2WC2 A;  2XIG A;  2JRT A;  2FNP A;  1YO5 C;  3RDI A;  2ESN A;  4IHS A;  1ZAO A;  2K86 A;  2F5E A;  2VON A;  2D2W A;  3IKV A;  1T6S A;  1D5V A;  2LF7 A;  2A69 F;  3ECH A;  2OAZ A;  1JE8 A;  1Z6T A;  1LVA A;  3NRV A;  4RGS A;  3SQN A;  3ISP A;  1O57 A;  1QO0 D;  4UXN A;  1BC7 C;  4ZYD A;  1MGT A;  1LDD A;  3TOB A;  3V8K A;  2DW4 A;  2XAQ A;  1F5T A;  3NQO A;  3GZ5 A;  4HZF A;  1XMK A;  1XSD A;  1K7A A;  5FB2 A;  3HHG A;  2YSR A;  1J7K A;  4UV8 A;  2V1X A;  3QP5 A;  3MZH A;  4LK1 F;  4MTE A;  3K1N A;  4DQ2 A;  4WX9 A;  4BXU A;  3FXU A;  5D4R A;  4OIP F;  1BJA A;  2QQA A;  1J9I A;  3I54 A;  5CVU A;  3M9A A;  5CVJ A;  1ULY A;  4R79 A;  3JTH A;  3DV8 A;  2Q0O A;  4XRF A;  2HZT A;  2EV5 A;  4PGG A;  4G9Y A;  1BOA A;  4EJW A;  2UZK A;  3RI4 A;  2IJL A;  2KIU A;  3GWZ A;  2FA5 A;  4HF2 A;  4EV0 A;  5E1W A;  1GXP A;  1YYV A;  4I2O A;  4ZZD A;  4KYW A;  4WF2 A;  1P4X A;  3I59 A;  3CUO A;  2RC4 A;  1BM9 A;  2QLZ A;  2MH2 A;  5ED4 A;  5LRS A;  1J59 A;  1O7L A;  2VT3 A;  4G6Q A;  4OIQ F;  1SFX A;  2V6C A;  3FX3 A;  4IRI A;  2HEO A;  3FM5 A;  1TLH B;  5DCM B;  2K02 A;  1XSX A;  4HDV A;  3U1D A;  5F6F A;  4G6D A;  2M8E A;  4M9X A;  1EH6 A;  4IRG A;  3FHZ A;  2OU2 A;  5L3D A;  2L4M A;  1HKQ A;  2KIF A;  2Y48 A;  1YG2 A;  3BDD A;  1JHF A;  2DT5 A;  5LHG A;  1FSE A;  1IN5 A;  1HQC A;  3RYP A;  1ZLK A;  4ENM A;  2E1N A;  2VBW A;  3WU0 A;  4LGW A;  3E6D A;  2HS5 A;  1SFU A;  1B59 A;  5DUI A;  5HDG A;  2V9V A;  1SD5 A;  3CJN A;  2EJR A;  1DDN A;  4ZYG A;  5LEJ A;  2KJB A;  4A6E A;  2NRA C;  2PEX A;  4GYI A;  5HLG A;  1Z91 A;  5K1Y A;  2Y75 A;  1YW9 A;  1Z1D A;  3I0T A;  1ZRC A;  3C18 A;  4CXF A;  2HTJ A;  2DI3 A;  3FWE A;  1DPU A;  4RAZ A;  5DCF A;  1H0M A;  3P9K A;  4L9T A;  2F5C A;  5J8C A;  1XN7 A;  4YFX F;  3N97 A;  2O0Y A;  2XUB A;  3F6O A;  2EFQ A;  3O2P E;  2HQR A;  3FZV A;  1RUN A;  2O03 A;  1L0O C;  2EFN A;  4QLC U;  3S2W A;  3KCC A;  1LEA A;  1HKS A;  2HYF A;  1FPQ A;  5LRR A;  1FP1 D;  1YIO A;  2Z33 A;  2HTS A;  2P5V A;  3TO6 A;  2RDP A;  4IVN A;  5LGT A;  1XD7 A;  3ZMT A; 
#chains in the Genus database with same CATH topology
 2E2I J;  1U9N A;  1CGP A;  2V7F A;  4IF4 A;  2XHK A;  2H8R A;  2BGC A;  2E1M B;  2OQG A;  2KZG A;  1FMV A;  4DJA A;  1QA6 A;  3OS1 A;  2X85 A;  2P6T A;  5LEK A;  5EEG A;  3V7S A;  2L7Z A;  2WA0 A;  3BG9 A;  1FC3 A;  1WJF A;  4M3G A;  3PIO F;  3FHN A;  3OIO A;  2E34 A;  2HXO A;  3BPV A;  3BT9 A;  1N75 A;  1UEL B;  3GTK J;  1OR7 C;  4ENK A;  2L2O A;  1JTY A;  3DXJ F;  1U6G A;  1W36 C;  1E2X A;  2DMQ A;  2LR8 A;  4AID A;  3KP6 A;  4KT5 C;  5J6X A;  5L3E A;  3HOT A;  1MMD A;  1YHQ I;  3CF5 F;  2DFI A;  3E6B A;  4P1W A;  2CSO A;  1G2H A;  1X1A A;  3M8F A;  4BQA A;  2IA2 A;  4PDK A;  1SAN A;  4J00 A;  3UNG C;  4UVC A;  3TO7 A;  2DBB A;  3LSJ A;  1A04 A;  3GTP J;  3QP6 A;  2ZME C;  3HOS A;  5J1R A;  3GZ6 A;  2A6E F;  1UB9 A;  4ZJZ A;  1IUF A;  3TED A;  1J5Y A;  3I59 B;  2ZXH A;  3SJM A;  2QQB A;  4F91 B;  5F0C A;  4EM2 A;  2X0L A;  2CJJ A;  2M1B A;  3BG7 A;  2MYS A;  2OF7 A;  5E3O A;  2D1V A;  3JSO A;  1KQ8 A;  1Z05 A;  5D4S A;  3CES A;  1LE8 B;  1K6O A;  2GA1 A;  5FLM J;  1K83 J;  3DEU A;  4U88 A;  3T8T A;  3HOZ J;  1HA8 A;  3L2C A;  3FK6 A;  2KRC A;  3ZMU A;  5BQT A;  4PJL A;  4RLF A;  1TWC J;  1T98 A;  3FXL A;  4KT6 A;  1VQ7 I;  3BR6 A;  1IRZ A;  1YX5 A;  2VJJ A;  4IHV A;  3RSN A;  3ZXS A;  4A3M J;  2E71 A;  1T0F A;  3CP8 A;  2VJI A;  2X6O A;  3JRG A;  1FMW A;  2Y30 A;  1FBS A;  2VOO A;  1R5H A;  2DA2 A;  1I3A A;  1SAX A;  3RPQ A;  1KYZ A;  3K4C A;  2P5L C;  1B8I B;  4A3J J;  3CCQ I;  1VZ0 A;  3KP4 A;  3CCR I;  3CCS I;  3HM5 A;  1VI0 A;  1JKP C;  2XGE A;  5ICF A;  1WVR A;  4X6A J;  2BBY A;  1TW2 A;  3CUQ C;  2Y2Z A;  3QPT A;  2LFB A;  4BBR J;  4BKX A;  2M87 A;  4L9J A;  2DK5 A;  1A36 A;  1W1W E;  1S8N A;  2GZW A;  2P81 A;  2HDC A;  1UHS A;  2FU4 A;  1TL8 A;  2V4J C;  2RRE A;  4OAY A;  3VPR A;  5ICG A;  3B73 A;  2O8X A;  2DAO A;  3KLN A;  2BHZ A;  1RPW A;  3A0B C;  2VB6 A;  1RUO A;  4YFK F;  2IPQ X;  4QWQ A;  5EGO B;  2ZXJ A;  1IV8 A;  4UVB A;  1IV6 A;  3JRC A;  1KU9 A;  4PJ0 C;  1HBX G;  1GXQ A;  3KIO A;  3PO3 J;  5EZG A;  1LFB A;  1X4P A;  4DZP A;  3HRM A;  3JCU C;  1ON2 A;  1GT0 C;  2HWV A;  1IXR C;  2DDB A;  1ZR2 A;  1YI2 I;  1JJ6 C;  4L18 B;  3BJ6 A;  3D0S A;  1FY7 A;  2K9M A;  4CA0 A;  4IXA A;  4ZZL A;  4HBL A;  1P7I A;  4MFE A;  3E5Q A;  1MH4 A;  3W2W A;  5LFA A;  3LWF A;  2R5Z A;  4KA4 A;  4GDF A;  4A0X A;  5E1Z B;  4GYG A;  1T39 A;  1Z3X A;  2L02 A;  4OU0 A;  2NVQ J;  5AON A;  5K5O A;  2J5P A;  1N78 A;  5DUK A;  1F43 A;  2L4A A;  2DA7 A;  2EZI A;  3EUH C;  3PUF A;  4LD5 A;  3M8E A;  4E7H A;  1ETW A;  1MBK A;  3O8G A;  4Q4Z F;  3HRT A;  2QGU A;  4M6V A;  2DA5 A;  4BXX J;  4EAT A;  3DBH B;  2ESH A;  4IX7 A;  2K9S A;  1ZG5 A;  3EDP A;  2VIX A;  4JX4 A;  1MNM C;  1WWX A;  2LK2 A;  4KN7 X;  3HG9 A;  2YX4 A;  1P7J A;  1X1P A;  2ZSI B;  3M8J A;  3EYI A;  1ACI A;  2ETH A;  3T0Y A;  3A03 A;  4A3B J;  2FOK A;  2UUZ A;  2L9N A;  3GCM A;  5GTI C;  3D5R C;  3IUO A;  5E8I A;  3CME I;  1E3H A;  2CW0 F;  1C0W A;  2UXN A;  4C9Y A;  4D5C A;  2HOS A;  3ZQC A;  2P5K A;  4LK0 F;  2X6W A;  2PI0 A;  4ABZ A;  2YR2 A;  2QQ9 A;  5JLW A;  4CGZ A;  3DPT A;  4OOI A;  2NOJ B;  3R6S A;  1QGP A;  1AU7 A;  2DJI A;  4G7O F;  4RM2 A;  4A93 J;  2VT2 A;  5J8F A;  1HW1 A;  5E17 F;  2AQF A;  3E0J B;  3QU6 A;  1GV5 A;  2EIJ H;  3S14 J;  1LB2 A;  1FX7 A;  3BPX A;  3H5A A;  5D5U B;  4ESJ A;  3E7L A;  5J4Y A;  3GLX A;  4IJA A;  3ZOB A;  2VXZ A;  3TOA A;  2XV4 S;  3H9J A;  1Q1V A;  3HHH A;  3MZ8 A;  2LBF B;  3OOP A;  3OYI A;  1AOY A;  3MQ0 A;  4R8H A;  1A6Q A;  4IOC F;  1FOK A;  4EMS A;  4UV9 A;  4MIM A;  4RB3 C;  3LSI A;  3ZCO A;  3F8M A;  3CCM I;  2ID6 A;  2R7T A;  1K79 A;  5JHF A;  4YII A;  2F5V A;  3CC4 I;  2E60 A;  1DU0 A;  1EKE A;  3R4K A;  1VND A;  2OUM A;  3K0L A;  3B6A A;  5CYV A;  1T38 A;  1X3Z B;  2BY3 A;  1Z7L A;  3PFY A;  2QUF A;  4CCN A;  4MTD A;  3CDH A;  4A12 A;  2HKO A;  2PMZ A;  2LG4 A;  3LAJ A;  5B1A H;  3HTU A;  4N9H A;  1H88 C;  2A05 A;  1VQK I;  4AVP A;  3I56 I;  2WTE A;  3OOU A;  1F36 A;  3QPS A;  4LB5 A;  1R7J A;  1WI9 A;  3R60 A;  1QVT A;  2FBH A;  2PMH A;  3OY9 A;  3AG3 H;  4HLX A;  1OKR A;  1S7O A;  2O6G E;  4FHT A;  2W84 A;  3DU6 A;  2EQR A;  3PSI A;  3R61 A;  1YTY A;  5JVG F;  4IQJ A;  1SMT A;  2QWW A;  2DMN A;  5FFX A;  1MZB A;  3BCB A;  5H6Q A;  2CUF A;  2DTZ A;  2O7O A;  4HRI A;  1QNT A;  3QYF A;  3GFI A;  1BN5 A;  3U9G A;  1SMY F;  4UHT A;  4UNO A;  1D1B A;  2R0Q C;  1IUY A;  1R9T J;  2LOO A;  3KE2 A;  1IO2 A;  3BQY A;  2Z5U A;  2X1D A;  4Y15 A;  5FD6 A;  4UUS A;  1DQU A;  4BEH A;  3CZ6 A;  3RKW A;  5K7H A;  2IXS A;  3BR3 A;  3ZMV A;  1OCT C;  2RNG A;  3VSL A;  3I71 A;  1LFU P;  2M30 A;  2WBM A;  4DNC A;  1JTX A;  2HVQ A;  2ZB9 A;  1IW7 F;  2OZU A;  3EUA A;  5TIS C;  3WTZ A;  1YIJ I;  3CCL I;  2L9S A;  4PGH A;  5HNF A;  3CJQ B;  2F5D A;  3M1E A;  2ICW G;  3G2B A;  2CUJ A;  5HLT A;  3O8H A;  3NEU A;  4MEY F;  2EIK H;  3QWL A;  1TT0 A;  1GLN A;  2FML A;  5IOZ A;  3GO5 A;  3I3L A;  2TRT A;  5F08 A;  3KEY A;  1T2K A;  3H92 A;  2L9V A;  4PSX A;  3A01 A;  3A02 A;  1LPQ A;  5CVR A;  1QPM A;  2W4S A;  2V79 A;  3SDG A;  2VBY A;  3F8F A;  1I3Q J;  1TQI A;  2E19 A;  2BXZ A;  4N4N B;  2AXL A;  3FXK A;  1U8B A;  2VKH A;  4B09 A;  1MJA A;  2OQR A;  2L7F P;  1UHW A;  1YRN A;  3H3U A;  1IAW A;  2XAH A;  3EYY A;  1V3F A;  1YX3 A;  3H9G A;  2DDA A;  4E70 A;  3LMM A;  5F27 A;  1UZC A;  3GME A;  2BY0 A;  1U2W A;  1IF1 A;  3CO6 C;  2BOL A;  4DZJ A;  4ZYH A;  3WU1 B;  1O3S A;  3LST A;  3P7N A;  4D7M A;  2PN6 A;  4XLH A;  4GGG A;  4M3F A;  2E2J J;  5KCM A;  1G4D A;  3G1L A;  1V54 H;  4XRS G;  3GF2 A;  2P6S A;  2OCE A;  1EA3 A;  4LMY A;  3KYD B;  3VYT B;  2ZFW A;  1TW3 A;  1TNT A;  3BOQ A;  1K78 A;  1FIA A;  1J2X A;  5B5E C;  3IAS 2;  1ETX A;  2JSC A;  2DA4 A;  1R1T A;  1FNN A;  1KU2 A;  3MKY B;  4RGX A;  2QEX I;  1ZAR A;  1HST A;  3HEF A;  4EJO A;  3LFK A;  4P5O A;  2Z99 A;  4IHY A;  2K7L A;  2BE5 F;  4AC0 A;  2FJ1 A;  3OYG A;  1P6R A;  1HDP A;  1BR2 A;  5E18 F;  4JYK A;  3ZQQ A;  4CYD A;  2KIS A;  2GAU A;  4MO7 A;  1APL C;  1JXS A;  1OQY A;  1QRY A;  2CGP A;  1LDK B;  2CO5 A;  3F8N A;  3V42 A;  4D7N A;  4PFP A;  2H09 A;  4J19 A;  4FTH A;  2JA7 J;  3PUB A;  2KPM A;  5EZH A;  2IS4 A;  4ZDL A;  5IP9 J;  2VOP A;  2ADU A;  2GXG A;  4J01 A;  1FJL A;  2JVH A;  4HA8 A;  1VQN I;  2FSW A;  1GDT A;  2JRM A;  2K27 A;  2K40 A;  2O9L A;  3NAU A;  5E3N A;  3Q0W A;  5JLX A;  3MWM A;  4A3D J;  4WCG A;  1PP7 U;  1ODD A;  2MLK A;  3MD2 A;  3QU3 A;  5LBQ A;  3GTL J;  3GXO A;  5FRN A;  4HEA 2;  3TQN A;  1Y0N A;  1EV7 A;  3LSP A;  2EH3 A;  1BA5 A;  3AG4 H;  3HIF A;  2DOF A;  4E7S A;  3KYL A;  3L2U A;  3ZPL A;  3RPU A;  2ZFU A;  3GLL A;  5J3L A;  2PMZ N;  3LSK A;  1X1D A;  1HXD A;  3BJA A;  3E5U A;  3T1B A;  3Q5F A;  1TWG J;  2CQN A;  3BP8 A;  2XB5 A;  2R3S A;  1VQ8 I;  2ZBK A;  2AO9 A;  4II3 A;  4JOM A;  3HSF A;  1RI7 A;  1U8R A;  2HDW A;  3BG6 A;  4C3J J;  4P55 A;  3L2W A;  5BPD A;  4RB1 A;  2NXN B;  2L0K A;  2R7D A;  2M3A A;  4LB6 B;  3CMY A;  4YEJ A;  3IWZ A;  3K69 A;  2A68 F;  3CJT B;  3H1C A;  4XLC A;  3OYH A;  1OPC A;  3G71 I;  3OYM A;  2CH0 A;  1F1Z A;  2WAF A;  2M4G A;  1VQ4 I;  5LLQ A;  4EJV A;  2MSY A;  2HGC A;  3DTK A;  5E8G A;  3W6V A;  2H27 A;  1CF7 A;  2HQN A;  2WAD A;  1BI2 A;  1PJR A;  2XAG A;  5FKO A;  2EA4 A;  4Z6Y A;  3LA3 A;  2VQH A;  3PJR A;  5F1J A;  5JI6 A;  3HL2 A;  3CC7 I;  1B6A A;  3QOD A;  1PVE A;  1NTC A;  1SAU A;  1B8I A;  4HLY A;  2OPT A;  4B8X A;  4M9Z A;  5F0F A;  1W0T A;  4A3F J;  3CCY A;  2DT6 A;  1VQ6 I;  3LSH A;  1U3E M;  2W85 A;  3RKY A;  1XMX A;  4CZZ A;  3OYB A;  2BYV E;  4EGY A;  4M6X A;  2LY2 A;  4BS9 A;  4WWC A;  1XPX A;  2VLA A;  3CUQ B;  2OTJ I;  1ZR4 A;  3GVA A;  3WTX C;  2P0W A;  3BZ6 A;  4TV7 A;  1GUU A;  4R1H A;  1OYY A;  4LLG F;  5K7Z A;  1K4S A;  1Z0X A;  3FF5 A;  1A5J A;  2EFP A;  1U5T C;  1MKM A;  2G7U A;  3RJP A;  3O6B B;  3REO A;  4FX4 A;  3Q0U A;  3TMO A;  1ZRF A;  3PM1 A;  1HOM A;  4UUS B;  4BEH B;  2RKH A;  3G4S I;  2P7C B;  1Z3Y A;  1V55 H;  3JRE A;  3FXR A;  1GHC A;  3V8L A;  4IHX A;  1MBF A;  2VQG A;  1Q1H A;  1O3T A;  2RVC A;  2ISZ A;  4BAC A;  2E5Z A;  4Y7N J;  1O7F A;  2QSG X;  4Y17 A;  3RQI A;  5TGT A;  1EF4 A;  2WAQ A;  2COM A;  2IA1 A;  3L2Q A;  1ETK A;  3OR2 C;  2OCC H;  2RV8 A;  2BZT A;  2A6T A;  3S8P A;  4HV6 A;  4BHB A;  4ZTJ A;  1NK2 P;  5DM6 F;  4D0P A;  1EH7 A;  5BPI A;  4A2U A;  4NC8 A;  2ZJR F;  5ILS A;  2EZH A;  5HDN A;  4IL6 C;  1ETQ A;  4CIC A;  2R7Z J;  2M9H A;  4BXF A;  4XM3 A;  5C44 J;  4Y52 J;  3K7A J;  1YRN B;  2LNB A;  1W7P B;  4I98 B;  2P7V B;  2ID3 A;  1ERD A;  2VC0 A;  5ICE A;  2JJ7 A;  2ZXI A;  1ITY A;  1I27 A;  3F72 A;  1WJE A;  3N4M A;  4XN0 A;  1TZL A;  1XC5 A;  2R7F A;  3SEZ A;  2HI3 A;  4HF1 A;  4QSH A;  3CO7 C;  2G9W A;  1Z77 A;  1KQ9 A;  1RC9 A;  2EA2 A;  3H0G J;  2HVS A;  2AS5 F;  3E97 A;  4Q48 A;  5CLS A;  5ICC A;  3M3Y J;  3S1M J;  1LDJ A;  3WTT C;  2ELK A;  2F5F A;  1RZ4 A;  4GO1 A;  5FD5 A;  3IV5 A;  2VI6 A;  1VQP I;  1D3Y A;  2JSP A;  1NH3 A;  3ZGK A;  5JVT A;  2X4H A;  3F3X A;  3LSM A;  4ZTF A;  3GTJ J;  4EM1 A;  3KEO A;  4XMY A;  5FKN A;  2QQ8 A;  2QYO A;  4NB5 A;  1H9G A;  3K9T A;  1G3T A;  1Y6I A;  4EJU A;  1T56 A;  1Y39 A;  2DFH A;  1K78 B;  2JWT A;  2X6Y A;  3QPH A;  3PQK A;  3ML6 A;  1YIT I;  2EFO A;  2YX7 A;  1B4A A;  4EM0 B;  1OIS A;  3COA C;  3B02 A;  2W1O A;  2QBY B;  3VYU B;  2IEK A;  1LKX A;  5DM7 F;  3GFJ A;  4L9N A;  4KDP A;  4ZDO A;  1JHH A;  2GXA A;  1MDM A;  1MH3 A;  2DN0 A;  1IN7 A;  4FCY A;  2IS1 A;  1IXS B;  5H2F C;  2H1L A;  1DGW Y;  1KON A;  3HRS A;  3LQR A;  3BR0 A;  2DOE A;  3H9Q A;  4ENJ A;  3CMM A;  3MCZ A;  5IT9 K;  4C2U A;  3ZQ7 A;  3OS2 A;  2NAZ A;  4CUG A;  3A2K A;  1OMI A;  4LLL A;  4AIJ A;  1BR4 A;  2Y0S N;  3F21 A;  1FYL A;  1I5Z A;  1WH5 A;  2VKV A;  5KVR A;  5DDG A;  3GTG J;  3IP4 B;  4OMY A;  3CDL A;  2L54 A;  2DK8 A;  4LJZ F;  4I6Z A;  2OV7 A;  3FMQ A;  4CZC A;  2XRN A;  1ZGJ A;  3FDY A;  1Y0U A;  4F7Z A;  4XOP A;  6PAX A;  4FAS D;  2JPB A;  1IN6 A;  3S3M A;  3K4J A;  3L9F A;  1XGM A;  2LF8 A;  3KP7 A;  1YW8 A;  4C3I J;  2W25 A;  1X1B A;  5M5W J;  4RGR A;  3IRQ A;  2NVU B;  1RET A;  1JUP A;  4EQQ A;  1I39 A;  2JN6 A;  2EZL A;  3ABL H;  4A5M A;  1JKO C;  3ULQ B;  2DO7 A;  2EK5 A;  1KQ0 A;  2XPV A;  2CRG A;  3IWF A;  4M71 A;  5IT9 Z;  4XQF A;  4RMN A;  4HF0 A;  2DA3 A;  4H0E A;  1JKQ C;  2L01 A;  5FRO A;  4YFN F;  2E35 A;  4QTR A;  1Y56 A;  3K1M A;  4PSW A;  4HDU A;  3PQJ A;  1L3L A;  5K5Q A;  4MLO A;  3P9I A;  2OZ6 A;  3SXY A;  3WGG A;  4CCM A;  4OIR F;  3HOW J;  1D8J A;  2G7H A;  3VOD A;  2EIN H;  1ZEL A;  2MD0 A;  1CF7 B;  4N9I A;  4NUB A;  1K6Y A;  1Z21 A;  1MMG A;  5L3B A;  4KIF A;  3L00 A;  3I64 A;  3ROU A;  2FE3 A;  2OJE D;  2I10 A;  2JZY A;  2B63 J;  5L3F A;  1KGS A;  5CPR B;  3PNT A;  2Z9O A;  3T5X A;  4EVI A;  1P9Q C;  2F2E A;  3R0A A;  4BAY A;  1F9N A;  1XCB A;  4KMU X;  3P9C A;  2DMT A;  5LHI A;  2HOT A;  4KFC A;  1FOX A;  4KN4 X;  2KIM A;  4KIB A;  4DYR A;  4RBO A;  3LA7 A;  2WAQ N;  2VKE A;  3EQL F;  3LSR A;  1B1B A;  4HW0 A;  1R23 A;  1U0J A;  3I4M J;  1UG2 A;  1VQL I;  1I1S A;  3IL2 A;  4BL0 B;  2XKP A;  1ZGA A;  2A6H F;  1WI3 A;  1S29 A;  4OIN F;  1W5C C;  2BXY A;  1B9M A;  3NAR A;  5HLH A;  3OYD A;  4BBS J;  4E4H A;  1FZP B;  4I99 C;  2CV2 A;  2R7O A;  3ZRG A;  3BY6 A;  5JHU A;  1X4O A;  1ETV A;  2CQ7 A;  4U7D A;  3HOY J;  2Q1Z B;  3E3V A;  3H36 A;  2LRD A;  2H8W A;  3K6G A;  4HAM A;  1FYM A;  2IGO A;  1FEX A;  2GBY A;  3F6V A;  4YG2 F;  1BW5 A;  3ONQ A;  1NG6 A;  1SFE A;  3FXQ A;  5FKL A;  4Q5S F;  4FT8 A;  1RR7 A;  2V26 A;  3OYA A;  2N8G A;  2EPF A;  4PZJ A;  1JGG A;  4P96 A;  1X58 A;  4BJ6 C;  5CVV A;  3BWG A;  3C2B A;  1R71 A;  3Q9V A;  1V5G A;  3KYC B;  4WXD A;  1MBJ A;  1X2M A;  3E5X A;  1BC8 C;  4RB0 A;  1ONV A;  2LC2 A;  4BY7 J;  4Z2Y A;  3HDD A;  4L0Y B;  1RNL A;  3J80 K;  3GTM J;  4ENN A;  1JT6 A;  3PFI A;  3D5L A;  3QYB A;  2X9D A;  2EB7 A;  2YU3 A;  4FX0 A;  4U87 A;  5ILV A;  2LDU A;  1MMN A;  1Z9C A;  5IYD J;  2G0E A;  3IH2 A;  3CQZ J;  2DLL A;  4ZH4 F;  4E7L A;  2A3S A;  1VQ9 I;  2JA8 J;  4F55 A;  3V7C A;  4C2T A;  2IA0 A;  5GAG J;  1SD7 A;  1WQ2 A;  3BTL A;  4W1U A;  1BI1 A;  1TNS A;  2FOW A;  4KJZ A;  4XKB A;  4KIG A;  2MC3 A;  3CCV I;  2M8G X;  4I7H A;  1TBX A;  3GW2 A;  3I53 A;  4K2E A;  3PNY A;  4DBR A;  5BOX A;  2OBP A;  2MFZ A;  2XAS A;  2RQP A;  4B44 A;  2E2H J;  1XB4 A;  5EDN A;  1UCR A;  2R7R A;  2K3F A;  4II2 A;  4I0A A;  1OR7 A;  4OMZ A;  4RB2 C;  3JRB A;  3FXJ A;  3J80 Z;  2W00 A;  1WHU A;  4L0Z B;  2EIL H;  2O5R A;  3S3O A;  1KA8 A;  2FBI A;  3BG5 A;  1SFO J;  2STW A;  1X3U A;  1A6I A;  4YEL A;  5LHH A;  3A0H C;  2ELJ A;  4D9J A;  2L5Q A;  2CV1 A;  4ESF A;  1MDM B;  1ZHF A;  3KZI C;  1NK3 P;  1JT0 A;  1R58 A;  2ZME A;  4IO9 F;  4LIU A;  1FBU A;  1QHH D;  2DMU A;  3DU5 A;  3WHC A;  4WK8 F;  4F92 B;  1MNE A;  1UJ8 A;  4M72 A;  2CQQ A;  5FGM A;  3TDU C;  5J1U A;  2JT1 A;  1WFX A;  5FLX K;  2NNN A;  4Y33 A;  3SZT A;  5A2Q K;  4UUV A;  2F6C A;  4S0H B;  3K1P A;  4RA2 A;  4MHG A;  5IYC J;  4NC6 A;  2IRF G;  3VEP A;  4G6T B;  2ZSH B;  5CJ9 A;  5EG0 B;  3ELK A;  4PJN A;  5B66 C;  5J40 A;  1HW2 A;  3BJO A;  3SFZ A;  3GEZ A;  2COB A;  2M45 A;  3W2A A;  3ABT A;  2CU7 A;  5CKT A;  3OYK A;  2BW3 A;  1HKT A;  4P9F A;  2E1M C;  1HLV A;  2QF7 A;  5EEA A;  1W5T A;  3GYH X;  3LL7 A;  2DXI A;  3G73 A;  3BZK A;  1BR1 A;  1XG1 A;  1ZN2 A;  2DYS H;  3I5U A;  4F52 A;  1LUJ B;  3MEX A;  2UXX A;  1FBQ A;  2ELH A;  3WG9 A;  2XF6 A;  1N77 A;  2CFO A;  1G3S A;  2FD5 A;  4G94 A;  5KHD A;  2JK3 A;  2JTV A;  2KHM A;  2MD5 A;  4PCQ A;  2L3D A;  3L1P A;  2PQ8 A;  5K7F A;  5FLX Z;  2AXT C;  2VE9 A;  5A2Q Z;  3K4M A;  3ZMZ A;  3JAM K;  3CUQ A;  4FE7 A;  1R5I D;  4AIK A;  4RLQ A;  1MBH A;  4E7Z A;  2TDX A;  2LY1 A;  2MH9 A;  1MSF C;  2DA1 A;  5LGU A;  1F4K A;  2DOA A;  3CLO A;  1V5F A;  3WOD F;  5K5R A;  2R7Q A;  4M3B A;  2IW5 A;  2E36 A;  4M74 A;  2CQK A;  4V2F A;  2HPM A;  4G8X A;  3JRF A;  3CMA I;  3S93 A;  4BE1 A;  2HZD A;  2HFH A;  1RES A;  3BR2 A;  4XLA A;  3J7Y J;  1P4W A;  2EFW A;  2CWE A;  3HGY A;  1S3J A;  2ZKZ A;  3E6M A;  3G1M A;  3K70 D;  1D5Y A;  3HBL A;  4RM3 A;  1D8K A;  4L5E A;  4NNJ A;  1SVO A;  2XRO A;  4BE2 A;  5CQG A;  3FXM A;  5AIP A;  1S5L C;  2DU9 A;  2PX9 A;  3CLQ A;  1OCR H;  3M07 A;  4L9V A;  3JAM Z;  1D0Y A;  3MAJ A;  1AKH A;  4IHW A;  4P9U A;  3FMR A;  4HOB A;  4XON A;  5IP6 A;  3ZMS A;  1I1G A;  4LIT A;  4CDG A;  3DBL B;  1HCR A;  1BIA A;  1W4M A;  5J47 A;  2IGK A;  3HOX J;  2QEN A;  2HVR A;  2CQX A;  3EUH A;  1FYK A;  1W7P A;  1QQI A;  3IKT A;  3S1R J;  4A5N A;  2DFF A;  2JQ7 A;  3CCE I;  2ZJ2 A;  3BZC A;  1FTZ A;  2VJ4 A;  2JVG A;  2ZNY A;  5HNH A;  1GVJ A;  2L7K A;  5IY5 H;  2R7X A;  3JTG A;  2VBX A;  3F9K A;  2UWM A;  3CP2 A;  1FTT A;  3OL4 A;  4I01 A;  3JRH A;  4I02 A;  4MGR A;  1MD0 A;  2ECC A;  3RZD J;  3S3N A;  2HYG D;  5IPA A;  3CF2 A;  1T08 B;  4A6D A;  2M0C A;  1SD4 A;  1SEU A;  1XGS A;  2B0L A;  3Q9S A;  2YU9 J;  3A4C A;  2LKX A;  1LEB A;  3AG1 H;  4PFO A;  4ANJ A;  2MLG A;  3U1K A;  2TCT A;  2QBY A;  4LFU A;  1I6X A;  4UB8 C;  1G3W A;  2V1N A;  1IDZ A;  3OIQ A;  4HST A;  1A31 A;  2A61 A;  5HS9 A;  1R1V A;  3AG2 H;  3LQQ A;  4HQM A;  2JMW A;  3VOE A;  2K85 A;  3DEW A;  5F1R A;  3K10 A;  5GTH C;  1WSU A;  4BDY A;  1XSV A;  3ERE D;  2DTR A;  1FT9 A;  3G3Z A;  2DJN A;  2CW7 A;  1O4X A;  1S9H A;  4S04 A;  2BV6 A;  2HU9 A;  5L3C A;  2XAJ A;  3QOP A;  3MKL A;  2E5N A;  1Y1V J;  1HW5 A;  2QVO A;  3TW6 A;  2FMY A;  4OWR B;  2E1C A;  4O3M A;  2LRE A;  3TDZ C;  3W6K B;  4A3G J;  1UHM A;  4H4K C;  3DEE A;  3U2R A;  1MSE C;  2F4I A;  3F8B A;  2R92 J;  2LYC A;  2MA3 A;  1G6N A;  1MW7 A;  2VXD A;  1OYW A;  1QZE A;  4B3A A;  2JPC A;  3K4L A;  2FXA A;  2YPR A;  2VPR A;  2GM4 A;  3HSE A;  1V4R A;  2K9L A;  2P8T A;  1BI0 A;  4XK4 A;  3C7J A;  4U0Y A;  3A1Y A;  2CG4 A;  2ZME B;  1LNW A;  3DQV C;  1VQ5 I;  1XS9 A;  1AA7 A;  2R7U A;  4B1R A;  4UUT A;  2H6C A;  1ETY A;  2DQL A;  1U78 A;  2AQE A;  3WTW C;  2K5C A;  4W97 A;  4RAG A;  1IC8 A;  1U9O A;  3IC7 A;  3LFU A;  1ORK A;  1QZY A;  4M6Y A;  4WXC A;  4XLN F;  4DOZ A;  4AIH A;  2VAS A;  2EZK A;  1TC3 C;  1WJB A;  3HSR A;  1MJ9 A;  5B1B H;  2E7W A;  3DLA A;  3W6J B;  1TWF J;  1SVL A;  1JUM A;  1XGN A;  3OMY A;  3BQZ A;  4ITV A;  4HX7 A;  4RS8 A;  1HSJ A;  2BVL A;  1ZYR F;  4G7H F;  3ZP5 A;  1P2F A;  4UY8 I;  2VPL A;  3FK7 A;  1W7P D;  3H0D A;  2BW3 B;  5IYB J;  1H8A C;  2NNY A;  2LKS A;  3HZJ A;  4IEJ A;  4Y13 A;  1IZ1 A;  5M5Y J;  1D0Z A;  4U0W A;  3FMS A;  4IQ4 A;  3IHU A;  3S1Q J;  1TT5 B;  3WHB A;  1Y8Q B;  2KT0 A;  1QVU A;  3S32 A;  2DYR H;  1LVK A;  1J09 A;  2QA4 I;  5M3F J;  1PP8 F;  2R5Y A;  3HRU A;  5GAE J;  2J5O A;  4ON0 A;  3C3W A;  2K4B A;  2VOD A;  1R5G A;  1WPK A;  1FP2 A;  2PFB A;  4BH9 A;  3LA2 A;  4QIW N;  4A3L J;  1QPI A;  1S6L A;  5D6F A;  1ZKG A;  4IPA A;  4M73 A;  2M34 A;  2RNJ A;  2MBF A;  1D0X A;  2CMP A;  3ZMD A;  2QKM B;  5HOO A;  2Y0M A;  4F3Q A;  1FOY A;  1WCM J;  2C6Y A;  3DKW A;  5KK1 A;  5FJ8 J;  1T8I A;  4FE4 A;  1WKM A;  2YS9 A;  1E17 A;  1UFM A;  2FQ4 A;  3SYT A;  2KDZ A;  1IN4 A;  2M2E A;  4JBA A;  2IGN A;  3S2H J;  3MKZ A;  2HQ5 A;  1VFC A;  3DPL C;  2RAE A;  1REP C;  4AVZ A;  3WU2 C;  2LKP A;  4O5V A;  5DYM A;  4L5J A;  4AD9 A;  5D5V B;  1RIO H;  3E6C C;  3OYJ A;  1WRJ A;  3ZQH A;  2WY7 Q;  2IVM A;  3TW7 A;  1YW7 A;  4JQF A;  3W3C A;  3ERM A;  1M1E B;  5GPC A;  3V8J A;  3G6E I;  4PUS A;  1YJW I;  4E7J A;  4NQW A;  5D6E A;  4A0Z A;  2HXI A;  4CCJ A;  2O61 A;  3GUD A;  2XC7 A;  1ZK8 A;  1AKH B;  4HNV A;  1MJB A;  1J75 A;  1S7A A;  5ILU A;  1T0F C;  1UST A;  1HDD C;  1TQP A;  1PUF A;  1X1C A;  4B4C A;  2LMD A;  2KRF A;  1MMS A;  4EEF G;  3TP3 A;  2PG4 A;  2DA6 A;  3VB2 A;  4CHU A;  1MBE A;  3M1C A;  4ETS A;  1WZ2 A;  2IP2 A;  2JA2 A;  5HLI A;  2M7B A;  5BS6 A;  3RPU D;  1VQM I;  2HR3 A;  3WTV C;  1DPR A;  5L3G A;  2GOX B;  4BNC A;  3EET A;  5D5X B;  1EH8 A;  1USS A;  2QCO A;  2W7N A;  4BHP A;  1MND A;  2ZC2 A;  3BRO A;  2FNA A;  3S16 J;  5FRM A;  3OYE A;  5D5W B;  1DUX C;  2FBK A;  3L09 A;  2HKX A;  1IJW C;  2HOA A;  4XSX F;  3QAH A;  4ZYA A;  2VQC A;  2A5Y B;  1OCP A;  2BY2 A;  3ZQG A;  4O6J A;  3SHF A;  4CO8 A;  1WJD A;  4GRI A;  1FLI A;  2IGM A;  1MBG A;  2KIQ A;  1XCV A;  2L7M P;  2GIV A;  5HS7 A;  2VN2 A;  5J4V A;  2XAF A;  3HPG A;  3WGI A;  5TRD A;  1OFC X;  3CTA A;  3GFM A;  4XLP F;  2HDD A;  1RKW A;  4XN3 A;  2I8D A;  1YJ9 I;  1R36 A;  4KMF A;  4A0Y A;  5IT3 A;  2XSJ C;  2DT7 B;  4I09 A;  1WGX A;  1RR8 C;  1PUE E;  2Z2S B;  1OCZ H;  4AWX B;  2KQR A;  5FO5 A;  1ON1 A;  1WJ5 A;  4JX5 A;  4M3D A;  4XBF A;  4DBQ A;  2ECB A;  1SD6 A;  3QQA A;  4YRV A;  3RKX A;  3F22 A;  4EJT A;  1R49 A;  4V2G A;  3N05 A;  5IOY A;  2NVX J;  1IRF A;  1ZH5 A;  3OYF A;  4U7B A;  4MEX F;  4MNU A;  2ZCW A;  3G1O A;  2XVC A;  3ABM H;  3J81 K;  2GA2 A;  2Q2E A;  1XDS A;  3K70 C;  3VWB A;  3TP0 A;  2RN7 A;  2NOG A;  2O3F A;  3NWT A;  2A07 F;  5EG0 A;  4CCL A;  2CS3 A;  1ZG1 A;  4HX4 A;  3FKJ A;  4N4O B;  4XKW A;  3IRR A;  5DEQ A;  3LOC A;  1BL0 A;  5F04 A;  1LJ9 A;  1D1C A;  2DCE A;  3OIP A;  1Y8R B;  2X48 A;  4Q47 A;  4XLE A;  3BR5 A;  4XKC A;  1KYW A;  4M3E A;  1KU7 A;  4HNU A;  3DTE A;  3GFL A;  5LGN A;  3EPZ A;  5HDK A;  2EV6 A;  2KJC A;  2R93 J;  3JW4 A;  3ZN1 A;  2R7W A;  3KZY A;  3QYE A;  4BGD A;  1Z6R A;  3TGN A;  3CDI A;  5DD8 A;  4XRS A;  3X2Q H;  4EGZ A;  5TJJ A;  3W2V A;  4E7I A;  1ZRD A;  3KLO A;  3AKZ A;  1QZZ A;  3J81 Z;  3GBG A;  1STZ A;  3J7Z I;  2L9R A;  2V9K A;  3JRA A;  2F4O B;  4HX8 A;  3VSK A;  2ACJ A;  2XDV A;  3K4B A;  3J7A Y;  2D45 A;  1U5T A;  2P4W A;  2QM3 A;  3RTR A;  4AUX A;  1YOV B;  2X6X A;  3D5S C;  4BE0 A;  3OS0 A;  4GCV A;  4DGW B;  5ERI A;  5EJC A;  2RGV A;  3C2H A;  3KP3 A;  1VQO I;  2HYJ A;  3DTI A;  3SZP A;  4AM3 A;  1BW6 A;  4M9S A;  4RAY A;  4C2M J;  3HXL A;  3LNQ A;  4HNT A;  3OSF A;  5F64 A;  1VTN C;  3DP7 A;  2XPU A;  4IHT A;  3KP5 A;  4L5I A;  4LG0 A;  5BNG A;  3QRF F;  4C3H J;  2DPU A;  2R5Y B;  3Q0V A;  3SDB A;  4ZYE A;  3HKZ A;  2ZNZ A;  1R00 A;  3QOE A;  5FKK A;  3BLY A;  9ANT A;  4KIT B;  2D1H A;  4LOC A;  2PMU A;  2WWY A;  2HOE A;  2KMU A;  3F8C A;  3GX4 X;  2NS0 A;  4LIV A;  3WTY C;  3ZN0 A;  1NHA A;  4KUM A;  4A3E J;  4V19 K;  2Z1D A;  4ASN A;  2F48 A;  3C1D A;  5M5X J;  4XOT A;  1QBJ A;  2FQ3 A;  3S1N J;  2MW8 A;  1XDU A;  5HVQ C;  2ZO4 A;  4XID A;  2FEZ A;  2X51 A;  3LAP A;  3BCA A;  1IN8 A;  5E20 A;  2PLY A;  1R1U A;  1H9T A;  3MZY A;  2VBZ A;  2W24 A;  5GPA A;  2EBI A;  1S7E A;  3WTU C;  2ISY A;  4QPO A;  4G7Z F;  1YQA A;  2XAU A;  3WG7 H;  1X19 A;  1I50 J;  4MQ9 F;  5CVI A;  2PJR A;  5KNL A;  1MIJ A;  4Y4R A;  2PBI A;  5AIQ A;  1IRG A;  3RIR A;  3SZG A;  3V7R A;  3H3V K;  4NC7 A;  3AL0 C;  3P5J A;  1BBY A;  2FF4 A;  2KFD A;  3KET A;  2XGD A;  3RZO J;  2EV0 A;  3HTS B;  2BY1 A;  5HOD A;  4NQW B;  3CJR B;  4AYB A;  5JFR A;  3CCJ I;  3FKI J;  4OIO F;  5H6R A;  5D8K B;  1O3R A;  1O3Q A;  2BHY A;  3SFI A;  4B48 A;  1PUF B;  4DW6 A;  4UVA A;  3BG3 A;  3AAF A;  4LLN A;  4CCK A;  2QZ8 A;  4I0B A;  2ZJQ F;  1R22 A;  2LSO A;  3OV8 A;  3HB9 A;  1FIP A;  3K2Z A;  2BEO A;  2E7X A;  3DCF A;  4B3X A;  3VFZ A;  3HJE A;  4IRH A;  3J7A O;  4JK1 X;  4BDZ A;  3CCU I;  2LD5 A;  2MC4 A;  1XMA A;  2Z16 A;  4HQE A;  1JUS A;  4X1E A;  5C3E J;  1IG7 A;  2NYX A;  3PO2 J;  3JRD A;  4XOR A;  4A69 C;  2XSD C;  3HUG A;  1E3P A;  5JR3 A;  4XIC A;  1UG0 A;  3KFW X;  2XF7 A;  3KEQ A;  1B9N A;  2FRH A;  2ZXW H;  3OWT A;  2OTL I;  4WXH A;  2WV0 A;  4D5F A;  3B6C A;  3UKG A;  2DPD A;  2EWN A;  2W48 A;  4HV5 A;  1WH7 A;  2W82 A;  1X2N A;  3DWL E;  3K2A A;  4FET A;  5EEH A;  3FIW A;  3I4P A;  2V1D A;  2XKO A;  2IT0 A;  1ZRE A;  5FFZ A;  5D8L B;  2GWR A;  2FUG 2;  2GQQ A;  1BI3 A;  2K9N A;  5DTD A;  3TO9 A;  3OSG A;  1IXC A;  2IBD A;  3I58 A;  3FBN B;  2STT A;  2CYY A;  5EF6 A;  2CFX A;  3O3K A;  4HYE A;  1N25 A;  2K4J A;  2F4M B;  4BY1 J;  3FM3 A;  3Q3S A;  3DF8 A;  3F0C A;  2LY9 A;  1DP7 P;  1UMQ A;  3CC2 I;  3T8R A;  2H6B A;  3S15 J;  1YLF A;  4JX6 A;  4RAF A;  1G3Y A;  1D1A A;  2LVS A;  4N0B A;  3MFK A;  2GXB A;  2GOM A;  3ABU A;  1Y1W J;  5E1X A;  4MFD A;  4GXO A;  2Q2E B;  1TTY A;  4CH7 A;  3RKQ A;  4YIF A;  3WTS C;  2OD5 A;  4KIC A;  2V1U A;  1ENH A;  2KKO A;  2LLK A;  2DQR A;  4JP0 A;  1VF9 A;  3VYS B;  1KU3 A;  1MMA A;  4XL9 A;  1TQM A;  2X1C A;  5FKM A;  5BMZ A;  5DV5 A;  2H94 A;  5HS8 A;  1LQ1 A;  4S05 A;  1YS7 A;  1YS6 A;  2M7A A;  4XR6 A;  3M7G A;  5B3S H;  2VC1 A;  1P92 A;  2MG4 A;  3HYI A;  4MQV A;  3H5N A;  1AWC A;  3DFG A;  3OYC A;  2W57 A;  3HKZ N;  3ZQF A;  3DBR B;  2HNH A;  3R0J A;  1BIB A;  2KZV A;  2Z3Y A;  2IAI A;  4I76 A;  1ZG3 A;  3S2D J;  3KPH A;  3V4G A;  5DCM A;  2ME0 A;  1ZGW A;  2XGC A;  4KNY A;  2KLO A;  3H35 A;  2K3P A;  3PL8 A;  2CW8 A;  3ECO A;  3JRI A;  3HC7 A;  3RYR A;  2R7S A;  1U5T B;  1ZLJ A;  3KP2 A;  4Y3O A;  2ME6 A;  1PYV A;  2Q8K A;  3TKY A;  2PJP A;  1LFP A;  2RQQ A;  1P4A A;  2VE8 A;  2V9P A;  2Y69 H;  4BYY A;  1FSH A;  3WGH A;  3WE3 A;  3TBI A;  5H20 A;  1Z7U A;  3BR1 A;  5DD4 A;  4IKF A;  3BTC A;  3L7W A;  4RGU A;  1JGS A;  4BHC A;  4ESB A;  1UAA A;  2WV1 A;  1IGN A;  4LG0 B;  5KAI C;  1XGO A;  4ZC3 A;  3JSP A;  3MVP A;  3BTJ A;  3F23 A;  4FQG A;  1B72 A;  1OYI A;  3WE2 A;  1FWZ A;  4U0V A;  3MMY B;  4NHJ A;  3H3Z A;  4IOA F;  1T95 A;  3JR9 A;  1POG A;  1G8X A;  1ZTR A;  1PDN C;  1W5S A;  3ABK H;  1J0R A;  2OA4 A;  4AYB N;  2KL4 A;  1YFH A;  4F93 B;  3D1N I;  5EYR A;  4PJM A;  2XGX A;  3KZZ A;  4XSZ F;  2M5W A;  2WC2 A;  2XIG A;  2JRT A;  2FNP A;  1YO5 C;  1W36 D;  2O8K A;  3RDI A;  2ESN A;  2OC6 A;  3GZN B;  2WB1 A;  5GAH J;  5J1Y A;  2QSF X;  3OYL A;  2ZJP F;  4IHS A;  1ZAO A;  2JUC A;  4B47 A;  2K86 A;  2F5E A;  1TP4 A;  3VDX A;  2D5V A;  2PJR B;  5KAF C;  2VON A;  2D2W A;  3IKV A;  1T6S A;  1D5V A;  1R4M B;  2LF7 A;  2A69 F;  2EIM H;  4CYC A;  3DKY A;  2OAZ A;  3ECH A;  3CD6 I;  5E3M A;  1JE8 A;  3LSG A;  5E79 C;  1GVD A;  2VUM J;  1R6R A;  3HOU J;  1Z6T A;  3I9V 2;  1LVA A;  3NRV A;  2YUS A;  1SFK A;  4RGS A;  3SQN A;  4HPQ A;  3ISP A;  2JA6 J;  1O57 A;  1QO0 D;  1JKR C;  2CUE A;  4UXN A;  1BC7 C;  2WY8 Q;  2XF5 A;  4LG3 A;  1MGT A;  4ZYD A;  1JI8 A;  1LDD A;  3TOB A;  2CV0 A;  5FLV A;  3V8K A;  2DW4 A;  2XAQ A;  4ZDP A;  2VJ5 A;  3K4N A;  1F5T A;  3NQO A;  3GZ5 A;  4HZF A;  1XMK A;  4IZZ A;  1XSD A;  1K7A A;  5FB2 A;  4XLF A;  3HHG A;  3VYR B;  2YSR A;  2AHQ A;  1J7K A;  4HSR A;  2R5Z B;  4UV8 A;  2V1X A;  3QP5 A;  3MZH A;  4UB6 C;  3ESW B;  4A3I J;  2KRH A;  3KX2 A;  4LK1 F;  4MTE A;  3HUG B;  3K1N A;  4D1Q A;  3MKW B;  4DQ2 A;  4WX9 A;  1XX5 A;  4BXU A;  1S72 I;  2VL8 A;  3FXU A;  2R4G A;  5D4R A;  4OIP F;  1BJA A;  3DKX A;  2QQA A;  5C4J J;  3FIS A;  1E0E A;  2NVY J;  3I54 A;  5CVU A;  2Y9Z A;  1J9I A;  1A35 A;  1AHD P;  3M9A A;  5CVJ A;  1ULY A;  3L2R A;  4R79 A;  3JTH A;  4E7K A;  4BU2 A;  3DV8 A;  5C4X J;  2Q0O A;  4XRF A;  4KIS A;  2HZT A;  2FX0 A;  4AU7 A;  3U21 A;  2EV5 A;  3SEQ A;  4PGG A;  4G9Y A;  1BOA A;  1RRJ A;  3ASN H;  3MN2 A;  4EJW A;  3S17 J;  1XTA A;  2UZK A;  3RI4 A;  5E3L A;  4BQO A;  2CUZ A;  3FBI B;  1W0U A;  2IJL A;  2XB0 X;  3ZQI A;  1HF0 A;  2GIZ A;  2KIU A;  3GWZ A;  3ZR8 X;  3L2V A;  4GFB A;  1FOW A;  2FA5 A;  4PK4 A;  3OYN A;  4HF2 A;  4EV0 A;  1K61 A;  2DOD A;  2H1K A;  5E1W A;  4DIQ A;  3OR1 C;  3ASO H;  1GXP A;  1K4T A;  1QU3 A;  2M0M A;  1YYV A;  1G59 A;  1ZQ3 P;  4I2O A;  1BJZ A;  4ZZD A;  3UR3 C;  2V6E A;  2Y31 A;  3RCO A;  4KYW A;  4WF2 A;  1KZH A;  4QPQ A;  4BQN A;  1P4X A;  1OLT A;  3I59 A;  3GTQ J;  3CUO A;  2Y0S A;  2RC4 A;  1BM9 A;  1WJC A;  4PJJ A;  4A3K J;  2QLZ A;  2I5U A;  1IRX A;  1OCO H;  4OAZ A;  2MH2 A;  1LE8 A;  2WAE A;  1SVM A;  1H89 C;  2A5W A;  2DMP A;  3IAM 2;  4XKV A;  1NG7 A;  1YE9 A;  5ED4 A;  1RKT A;  1JJ8 C;  4CCO A;  5LRS A;  1HC8 A;  1J59 A;  1O7L A;  3IH4 A;  2VT3 A;  3FXO A;  4G6Q A;  4OIQ F;  1SFX A;  4A3C J;  2V6C A;  3FX3 A;  4IRI A;  5DS9 A;  2HEO A;  2NS8 A;  3FM5 A;  1TLH B;  2QKL B;  2IS2 A;  3IH3 A;  5DCM B;  5GAD J;  2K02 A;  2NS7 A;  2VKD A;  2GLO A;  1T33 A;  1TWA J;  1XSX A;  3QPL A;  1BOB A;  2HQA A;  5CQE A;  4HDV A;  5LD2 C;  3U1D A;  2NVT J;  5F6F A;  4RDU A;  4G6D A;  2M8E A;  4M9X A;  1EH6 A;  4IRG A;  2JUG A;  3FHZ A;  3DPU A;  2OU2 A;  2WB1 N;  5L3D A;  2L4M A;  1HKQ A;  2KIF A;  2Y48 A;  1YG2 A;  3BDD A;  1JHF A;  2DT5 A;  3AL0 B;  5LHG A;  2DFE A;  4B43 A;  1YJN I;  4G12 A;  4CSW A;  1FSE A;  3ZQL A;  1IN5 A;  3HGG A;  3HPH A;  1QHG A;  1HQC A;  1B72 B;  3RYP A;  1ZLK A;  5EGO A;  4ENM A;  2E1N A;  2VBW A;  3WU0 A;  4LGW A;  3E6D A;  4BJT A;  1DP3 A;  1EJ9 A;  2UV1 A;  3M4O J;  2JA5 J;  4C30 A;  1OCC H;  1WJA A;  3BC8 A;  2HS5 A;  3NWS A;  1SFU A;  2LH9 A;  2LTP A;  1X3W B;  1B59 A;  4DYQ A;  2R7V A;  1DGR M;  5IP7 J;  5DUI A;  2KDO A;  1Z67 A;  2V9V A;  5HDG A;  1SD5 A;  3CJN A;  2EJR A;  3AFH A;  1SC7 A;  2X1E A;  1DDN A;  4ZYG A;  5LEJ A;  3A01 B;  1DU6 A;  2KJB A;  4A6E A;  2KP6 A;  2NRA C;  2PEX A;  3PNV A;  4GYI A;  5HLG A;  1Z91 A;  2XRL A;  2B7E A;  3HOV J;  1OJL A;  4CYC B;  5K1Y A;  1E3O C;  2Y75 A;  1V5E A;  1YW9 A;  3RQ4 A;  3EUK L;  1Z1D A;  3I0T A;  1CQT A;  1ZRC A;  3C18 A;  4BJ5 C;  4E6K G;  4CXF A;  3DLL F;  2XPW A;  2HTJ A;  2K9Q A;  3BTI A;  2DI3 A;  3FWE A;  1DPU A;  4RAZ A;  5DCF A;  1H0M A;  3P9K A;  1TWH J;  4L9T A;  1IDY A;  2F5C A;  5J8C A;  1XN7 A;  3OL3 A;  2M4K A;  5F0H A;  2IS6 A;  4YFX F;  2HPI A;  4NDL A;  2MGQ A;  3C2G A;  4XNF A;  4YIR X;  3N97 A;  2BVM A;  2O0Y A;  2XUB A;  3PSF A;  3F6O A;  2EFQ A;  2B9S A;  4HG2 A;  1I6H J;  4NBQ A;  3O2P E;  3K4K A;  2MAB A;  2HQR A;  2Y9Y A;  3I55 I;  3FZV A;  1RUN A;  2O03 A;  2LP0 A;  1GV2 A;  2QSH X;  1L0O C;  2E1O A;  2EFN A;  4QLC U;  3S2W A;  4BUP A;  4XRM A;  3KCC A;  3GTO J;  1LEA A;  1HKS A;  2HYF A;  1FPQ A;  4DYC A;  3TL4 X;  5LRR A;  1FP1 D;  4X0G A;  3E1S A;  1YIO A;  2Z33 A;  2HTS A;  2P5V A;  3TO6 A;  2VQL A;  2RDP A;  3H5R A;  4IVN A;  5GP9 A;  1ETO A;  5LGT A;  5M3M J;  1XD7 A;  4BQQ A;  1R4N B;  3I4N J;  2LBF A;  4FIS A;  3PIP F;  3ZMT A; 
#chains in the Genus database with same CATH homology
 1CGP A;  4IF4 A;  2XHK A;  2BGC A;  2OQG A;  2P6T A;  5LEK A;  5EEG A;  3V7S A;  1FC3 A;  3BPV A;  4ENK A;  3DXJ F;  1U6G A;  1E2X A;  3KP6 A;  4KT5 C;  5J6X A;  5L3E A;  3HOT A;  2DFI A;  3E6B A;  2CSO A;  3M8F A;  4BQA A;  2IA2 A;  4PDK A;  4UVC A;  3TO7 A;  2DBB A;  1A04 A;  3QP6 A;  3HOS A;  3GZ6 A;  2A6E F;  1UB9 A;  1J5Y A;  3I59 B;  2QQB A;  4EM2 A;  2X0L A;  2M1B A;  2D1V A;  3JSO A;  1KQ8 A;  1Z05 A;  5D4S A;  1K6O A;  2GA1 A;  3DEU A;  4U88 A;  3T8T A;  3L2C A;  3ZMU A;  5BQT A;  1T98 A;  1T0F A;  2VOO A;  1FBS A;  1R5H A;  1SAX A;  3RPQ A;  1KYZ A;  2P5L C;  3KP4 A;  5ICF A;  2BBY A;  1TW2 A;  3CUQ C;  3QPT A;  2M87 A;  4L9J A;  2DK5 A;  1S8N A;  2GZW A;  2HDC A;  2FU4 A;  5ICG A;  3B73 A;  2O8X A;  2DAO A;  3KLN A;  1RUO A;  4YFK F;  2IPQ X;  4QWQ A;  2ZXJ A;  4UVB A;  1KU9 A;  1HBX G;  1GXQ A;  3HRM A;  1ON2 A;  2HWV A;  1IXR C;  4L18 B;  3BJ6 A;  3D0S A;  1FY7 A;  4IXA A;  4ZZL A;  4HBL A;  3E5Q A;  4KA4 A;  3LWF A;  4A0X A;  5E1Z B;  4GYG A;  1T39 A;  2L02 A;  4OU0 A;  5AON A;  5K5O A;  2J5P A;  5DUK A;  2L4A A;  4LD5 A;  3M8E A;  4Q4Z F;  3HRT A;  2ESH A;  1ZG5 A;  3EDP A;  1WWX A;  4KN7 X;  3EYI A;  2YX4 A;  2ETH A;  3T0Y A;  2FOK A;  5E8I A;  2CW0 F;  1C0W A;  2UXN A;  2P5K A;  4LK0 F;  2PI0 A;  2YR2 A;  2QQ9 A;  4CGZ A;  3DPT A;  4OOI A;  3R6S A;  1QGP A;  4G7O F;  2VT2 A;  5J8F A;  1HW1 A;  5E17 F;  3QU6 A;  1LB2 A;  1FX7 A;  3BPX A;  4ESJ A;  5D5U B;  3GLX A;  4IJA A;  2VXZ A;  3TOA A;  2XV4 S;  3HHH A;  1AOY A;  3OOP A;  3MQ0 A;  4R8H A;  1FOK A;  4EMS A;  4UV9 A;  4RB3 C;  3F8M A;  1K79 A;  4YII A;  3R4K A;  3K0L A;  5CYV A;  1T38 A;  2QUF A;  4MTD A;  3CDH A;  4A12 A;  2HKO A;  3LAJ A;  3HTU A;  4N9H A;  4AVP A;  2WTE A;  4LB5 A;  1R7J A;  1WI9 A;  3R60 A;  2FBH A;  2PMH A;  4HLX A;  1OKR A;  1S7O A;  2O6G E;  4FHT A;  2W84 A;  3R61 A;  1YTY A;  1SMT A;  2QWW A;  5FFX A;  1MZB A;  5H6Q A;  1QNT A;  3GFI A;  1BN5 A;  3U9G A;  1SMY F;  4UHT A;  4UNO A;  1IUY A;  3KE2 A;  2Z5U A;  4Y15 A;  5FD6 A;  3RKW A;  3ZMV A;  3I71 A;  2M30 A;  4DNC A;  1IW7 F;  2OZU A;  3WTZ A;  4PGH A;  2F5D A;  3M1E A;  3NEU A;  4MEY F;  2FML A;  3GO5 A;  1T2K A;  3H92 A;  5CVR A;  1QPM A;  2V79 A;  2VBY A;  3F8F A;  1TQI A;  2AXL A;  4B09 A;  1MJA A;  2OQR A;  1UHW A;  3H3U A;  1IAW A;  2XAH A;  3EYY A;  1V3F A;  4E70 A;  1U2W A;  1IF1 A;  3CO6 C;  4ZYH A;  3WU1 B;  1O3S A;  3LST A;  3P7N A;  2PN6 A;  4GGG A;  1G4D A;  3GF2 A;  2P6S A;  4LMY A;  2ZFW A;  1TW3 A;  1TNT A;  3BOQ A;  1K78 A;  1J2X A;  2JSC A;  1R1T A;  1FNN A;  1KU2 A;  4RGX A;  1ZAR A;  1HST A;  4EJO A;  3LFK A;  4P5O A;  2Z99 A;  2K7L A;  2BE5 F;  1P6R A;  5E18 F;  4CYD A;  2GAU A;  1JXS A;  2CGP A;  1LDK B;  2CO5 A;  3F8N A;  2H09 A;  2VOP A;  2ADU A;  2GXG A;  4HA8 A;  2FSW A;  2K27 A;  3MWM A;  4WCG A;  1PP7 U;  1ODD A;  2MLK A;  3QU3 A;  5LBQ A;  3GXO A;  3TQN A;  1EV7 A;  3HIF A;  3ZPL A;  3RPU A;  1HXD A;  3BJA A;  3E5U A;  3T1B A;  3Q5F A;  3BP8 A;  2R3S A;  2ZBK A;  3HSF A;  1RI7 A;  1U8R A;  4P55 A;  5BPD A;  4RB1 A;  2R7D A;  4LB6 B;  3IWZ A;  3K69 A;  2A68 F;  1OPC A;  1F1Z A;  5LLQ A;  4EJV A;  2HGC A;  5E8G A;  2H27 A;  1CF7 A;  2HQN A;  1BI2 A;  2XAG A;  2EA4 A;  3LA3 A;  5JI6 A;  1B6A A;  4HLY A;  4B8X A;  4M9Z A;  1U3E M;  2W85 A;  3RKY A;  4CZZ A;  2BYV E;  4EGY A;  4M6X A;  4WWC A;  3CUQ B;  3GVA A;  3WTX C;  4TV7 A;  3BZ6 A;  4R1H A;  1OYY A;  4LLG F;  3FF5 A;  2EFP A;  1U5T C;  1MKM A;  2G7U A;  3RJP A;  3O6B B;  3REO A;  4FX4 A;  1ZRF A;  2RKH A;  2P7C B;  3FXR A;  1GHC A;  3V8L A;  1Q1H A;  1O3T A;  2RVC A;  2ISZ A;  1O7F A;  4Y17 A;  2COM A;  2IA1 A;  2RV8 A;  4HV6 A;  4BHB A;  4D0P A;  1EH7 A;  5BPI A;  4A2U A;  5ILS A;  5HDN A;  4CIC A;  2LNB A;  1W7P B;  4I98 B;  2P7V B;  2VC0 A;  5ICE A;  1I27 A;  3F72 A;  3N4M A;  2R7F A;  4HF1 A;  3CO7 C;  2G9W A;  1KQ9 A;  2EA2 A;  2AS5 F;  3E97 A;  4Q48 A;  5CLS A;  5ICC A;  1LDJ A;  3WTT C;  2F5F A;  1RZ4 A;  4GO1 A;  5FD5 A;  1D3Y A;  5JVT A;  2X4H A;  3F3X A;  4EM1 A;  3KEO A;  2QYO A;  4NB5 A;  1H9G A;  3K9T A;  1G3T A;  4EJU A;  1K78 B;  3QPH A;  3PQK A;  3ML6 A;  2EFO A;  2YX7 A;  1B4A A;  4EM0 B;  3COA C;  3B02 A;  2QBY B;  3GFJ A;  4L9N A;  4KDP A;  1JHH A;  1MDM A;  1IN7 A;  1IXS B;  3LQR A;  3HRS A;  4ENJ A;  3MCZ A;  5IT9 K;  3ZQ7 A;  2NAZ A;  1OMI A;  4LLL A;  4AIJ A;  1FYL A;  3F21 A;  1I5Z A;  5KVR A;  5DDG A;  4OMY A;  2L54 A;  2DK8 A;  4LJZ F;  3FMQ A;  2XRN A;  1ZGJ A;  1Y0U A;  4F7Z A;  6PAX A;  2JPB A;  1IN6 A;  3L9F A;  1XGM A;  2LF8 A;  3KP7 A;  1YW8 A;  2W25 A;  4RGR A;  3IRQ A;  4EQQ A;  4A5M A;  3ULQ B;  2DO7 A;  2EK5 A;  1KQ0 A;  4M71 A;  5IT9 Z;  3IWF A;  4HF0 A;  4H0E A;  2L01 A;  4YFN F;  3K1M A;  4HDU A;  3PQJ A;  1L3L A;  5K5Q A;  3P9I A;  2OZ6 A;  3SXY A;  3WGG A;  4OIR F;  1D8J A;  2G7H A;  3VOD A;  1CF7 B;  4N9I A;  5L3B A;  4KIF A;  3L00 A;  3I64 A;  3ROU A;  2FE3 A;  2JZY A;  5L3F A;  1KGS A;  2Z9O A;  3T5X A;  4EVI A;  2F2E A;  3R0A A;  4BAY A;  1XCB A;  1F9N A;  4KMU X;  3P9C A;  5LHI A;  4KFC A;  4KN4 X;  2KIM A;  4KIB A;  3LA7 A;  3EQL F;  1B1B A;  4HW0 A;  1R23 A;  1I1S A;  3IL2 A;  2XKP A;  1ZGA A;  2A6H F;  1S29 A;  4OIN F;  1B9M A;  5HLH A;  1FZP B;  3BY6 A;  5JHU A;  4U7D A;  3E3V A;  1FYM A;  4HAM A;  3F6V A;  4YG2 F;  3FXQ A;  1SFE A;  4Q5S F;  4FT8 A;  4PZJ A;  4P96 A;  5CVV A;  3BWG A;  3Q9V A;  4WXD A;  3E5X A;  1BC8 C;  4RB0 A;  1ONV A;  4Z2Y A;  4L0Y B;  1RNL A;  3J80 K;  4ENN A;  3PFI A;  3D5L A;  2YU3 A;  2EB7 A;  4FX0 A;  5ILV A;  2LDU A;  1Z9C A;  2DLL A;  4ZH4 F;  2A3S A;  3V7C A;  2IA0 A;  1SD7 A;  1WQ2 A;  1BI1 A;  1TNS A;  4KIG A;  2MC3 A;  4I7H A;  1TBX A;  3GW2 A;  3I53 A;  4K2E A;  5BOX A;  2OBP A;  2XAS A;  2RQP A;  1XB4 A;  1UCR A;  4I0A A;  1OR7 A;  4OMZ A;  4RB2 C;  3J80 Z;  4L0Z B;  1KA8 A;  2FBI A;  2STW A;  1X3U A;  5LHH A;  4ESF A;  1MDM B;  1ZHF A;  1R58 A;  2ZME A;  1FBU A;  4WK8 F;  4M72 A;  5FGM A;  3TDU C;  2JT1 A;  5FLX K;  2NNN A;  3SZT A;  5A2Q K;  4UUV A;  3K1P A;  4MHG A;  2IRF G;  3VEP A;  5CJ9 A;  3ELK A;  1HW2 A;  3BJO A;  3SFZ A;  3GEZ A;  2M45 A;  3ABT A;  1HKT A;  4P9F A;  1W5T A;  3GYH X;  3G73 A;  1ZN2 A;  3I5U A;  3MEX A;  2UXX A;  1FBQ A;  2ELH A;  3WG9 A;  1G3S A;  4G94 A;  2JTV A;  2MD5 A;  4PCQ A;  2L3D A;  2PQ8 A;  2VE9 A;  5FLX Z;  5A2Q Z;  3JAM K;  3ZMZ A;  3CUQ A;  4AIK A;  2TDX A;  2MH9 A;  5LGU A;  1F4K A;  3CLO A;  3WOD F;  5K5R A;  2IW5 A;  4M74 A;  2CQK A;  4G8X A;  2HFH A;  1P4W A;  2EFW A;  2CWE A;  1S3J A;  2ZKZ A;  3E6M A;  1D8K A;  2XRO A;  5AIP A;  2DU9 A;  4L9V A;  3JAM Z;  3MAJ A;  4P9U A;  3FMR A;  4HOB A;  3ZMS A;  1I1G A;  4CDG A;  1BIA A;  1W4M A;  2QEN A;  3EUH A;  1FYK A;  1W7P A;  1QQI A;  3IKT A;  4A5N A;  2ZJ2 A;  2ZNY A;  1GVJ A;  3JTG A;  2VBX A;  2UWM A;  4I01 A;  4I02 A;  4MGR A;  1MD0 A;  2HYG D;  4A6D A;  1SD4 A;  1XGS A;  2B0L A;  3Q9S A;  1LEB A;  2MLG A;  2QBY A;  4LFU A;  1I6X A;  1G3W A;  2A61 A;  5HS9 A;  1R1V A;  3LQQ A;  4HQM A;  3VOE A;  5F1R A;  1WSU A;  1XSV A;  3ERE D;  2DTR A;  1FT9 A;  3G3Z A;  4S04 A;  2BV6 A;  5L3C A;  2XAJ A;  3QOP A;  1HW5 A;  2QVO A;  2FMY A;  2E1C A;  4O3M A;  3TDZ C;  3W6K B;  1UHM A;  3U2R A;  3F8B A;  2MA3 A;  1G6N A;  1OYW A;  2JPC A;  2FXA A;  2YPR A;  3HSE A;  1V4R A;  2P8T A;  1BI0 A;  3C7J A;  4U0Y A;  2CG4 A;  2ZME B;  1LNW A;  3DQV C;  2H6C A;  2DQL A;  1U78 A;  3WTW C;  3IC7 A;  1QZY A;  4M6Y A;  4WXC A;  4XLN F;  4AIH A;  3HSR A;  1MJ9 A;  2E7W A;  3W6J B;  1XGN A;  4HX7 A;  4RS8 A;  1HSJ A;  1ZYR F;  4G7H F;  3ZP5 A;  1P2F A;  1W7P D;  2NNY A;  4Y13 A;  1IZ1 A;  4U0W A;  3FMS A;  3IHU A;  1PP8 F;  3HRU A;  2J5O A;  4ON0 A;  3C3W A;  2K4B A;  2VOD A;  1R5G A;  1FP2 A;  2PFB A;  4BH9 A;  3LA2 A;  1S6L A;  5D6F A;  4IPA A;  4M73 A;  2RNJ A;  2MBF A;  3ZMD A;  5HOO A;  2Y0M A;  2C6Y A;  3DKW A;  5KK1 A;  1WKM A;  1E17 A;  1UFM A;  1IN4 A;  4JBA A;  3DPL C;  1REP C;  2LKP A;  4O5V A;  5DYM A;  4L5J A;  4AD9 A;  5D5V B;  1RIO H;  3E6C C;  1WRJ A;  2IVM A;  1YW7 A;  4JQF A;  3V8J A;  4NQW A;  5D6E A;  4A0Z A;  2O61 A;  3GUD A;  1MJB A;  1J75 A;  1S7A A;  5ILU A;  1UST A;  1TQP A;  2KRF A;  2PG4 A;  3VB2 A;  4CHU A;  4ETS A;  2IP2 A;  5HLI A;  5BS6 A;  2HR3 A;  3WTV C;  1DPR A;  5L3G A;  4BNC A;  3EET A;  5D5X B;  1EH8 A;  1USS A;  4BHP A;  3BRO A;  2FNA A;  5D5W B;  1DUX C;  2FBK A;  3L09 A;  2HKX A;  4XSX F;  3QAH A;  2A5Y B;  4O6J A;  3SHF A;  4CO8 A;  1FLI A;  1XCV A;  2GIV A;  5HS7 A;  2VN2 A;  2XAF A;  3WGI A;  5TRD A;  3CTA A;  3GFM A;  4XLP F;  4KMF A;  1R36 A;  4A0Y A;  5IT3 A;  4I09 A;  1PUE E;  4AWX B;  5FO5 A;  1ON1 A;  4XBF A;  1SD6 A;  3F22 A;  4EJT A;  3RKX A;  1IRF A;  1ZH5 A;  4U7B A;  4MEX F;  4MNU A;  2ZCW A;  2XVC A;  3J81 K;  2GA2 A;  2Q2E A;  1XDS A;  2RN7 A;  2O3F A;  2A07 F;  1ZG1 A;  4HX4 A;  3IRR A;  5DEQ A;  1LJ9 A;  4Q47 A;  1KYW A;  1KU7 A;  3GFL A;  5LGN A;  5HDK A;  2EV6 A;  2KJC A;  3JW4 A;  3ZN1 A;  3KZY A;  1Z6R A;  3TGN A;  5DD8 A;  4EGZ A;  5TJJ A;  1ZRD A;  3KLO A;  1QZZ A;  3J81 Z;  1STZ A;  4HX8 A;  2ACJ A;  2D45 A;  1U5T A;  2P4W A;  2QM3 A;  3RTR A;  4GCV A;  5ERI A;  2RGV A;  3KP3 A;  3SZP A;  4M9S A;  4RAY A;  5F64 A;  1VTN C;  3DP7 A;  4IHT A;  3KP5 A;  4L5I A;  4LG0 A;  3QRF F;  2DPU A;  4ZYE A;  2ZNZ A;  1R00 A;  2D1H A;  2PMU A;  2WWY A;  2HOE A;  3F8C A;  3GX4 X;  2NS0 A;  3WTY C;  3ZN0 A;  1NHA A;  4KUM A;  4ASN A;  3C1D A;  1QBJ A;  2FQ3 A;  1XDU A;  5HVQ C;  2ZO4 A;  2FEZ A;  3LAP A;  1IN8 A;  5E20 A;  2PLY A;  1R1U A;  1H9T A;  3MZY A;  2VBZ A;  2W24 A;  3WTU C;  2ISY A;  4G7Z F;  1YQA A;  4MQ9 F;  5CVI A;  2PBI A;  5AIQ A;  1IRG A;  3RIR A;  3V7R A;  1BBY A;  2FF4 A;  3KET A;  2EV0 A;  3HTS B;  5JFR A;  4OIO F;  5H6R A;  5D8K B;  1O3R A;  1O3Q A;  4UVA A;  3AAF A;  4LLN A;  2QZ8 A;  4I0B A;  1R22 A;  2LSO A;  3OV8 A;  3K2Z A;  2BEO A;  2E7X A;  3VFZ A;  4IRH A;  3J7A O;  4JK1 X;  1XMA A;  4HQE A;  2NYX A;  3HUG A;  5JR3 A;  3KFW X;  3KEQ A;  1B9N A;  2FRH A;  4WXH A;  2WV0 A;  2DPD A;  2EWN A;  4HV5 A;  5EEH A;  3I4P A;  2V1D A;  2XKO A;  2IT0 A;  1ZRE A;  5FFZ A;  5D8L B;  2GWR A;  2GQQ A;  1BI3 A;  3TO9 A;  1IXC A;  3I58 A;  2STT A;  2CYY A;  2CFX A;  3O3K A;  4HYE A;  2K4J A;  3FM3 A;  3DF8 A;  1DP7 P;  3T8R A;  2H6B A;  1YLF A;  1G3Y A;  4N0B A;  3MFK A;  2GXB A;  3ABU A;  5E1X A;  4GXO A;  1TTY A;  4YIF A;  3WTS C;  2OD5 A;  4KIC A;  2V1U A;  2KKO A;  2DQR A;  1KU3 A;  1TQM A;  5BMZ A;  5DV5 A;  2H94 A;  5HS8 A;  1LQ1 A;  4S05 A;  1YS7 A;  1YS6 A;  3M7G A;  2VC1 A;  1P92 A;  3HYI A;  4MQV A;  1AWC A;  3DFG A;  2W57 A;  3R0J A;  1BIB A;  2Z3Y A;  1ZG3 A;  3V4G A;  5DCM A;  4KNY A;  3ECO A;  3RYR A;  1U5T B;  1ZLJ A;  3KP2 A;  2Q8K A;  2PJP A;  3TKY A;  1P4A A;  2VE8 A;  4BYY A;  1FSH A;  3WGH A;  3WE3 A;  5H20 A;  1Z7U A;  5DD4 A;  3L7W A;  4RGU A;  1JGS A;  4BHC A;  4ESB A;  4LG0 B;  1XGO A;  3JSP A;  3F23 A;  1OYI A;  3WE2 A;  1FWZ A;  4U0V A;  4NHJ A;  3H3Z A;  1PDN C;  1W5S A;  1J0R A;  2OA4 A;  1YFH A;  2XGX A;  3KZZ A;  4XSZ F;  2M5W A;  2WC2 A;  2XIG A;  2JRT A;  2FNP A;  1YO5 C;  3RDI A;  2ESN A;  4IHS A;  1ZAO A;  2K86 A;  2F5E A;  2VON A;  2D2W A;  3IKV A;  1T6S A;  1D5V A;  2LF7 A;  2A69 F;  3ECH A;  2OAZ A;  1JE8 A;  1Z6T A;  1LVA A;  3NRV A;  4RGS A;  3SQN A;  3ISP A;  1O57 A;  1QO0 D;  4UXN A;  1BC7 C;  4ZYD A;  1MGT A;  1LDD A;  3TOB A;  3V8K A;  2DW4 A;  2XAQ A;  1F5T A;  3NQO A;  3GZ5 A;  4HZF A;  1XMK A;  1XSD A;  1K7A A;  5FB2 A;  3HHG A;  2YSR A;  1J7K A;  4UV8 A;  2V1X A;  3QP5 A;  3MZH A;  4LK1 F;  4MTE A;  3K1N A;  4DQ2 A;  4WX9 A;  4BXU A;  3FXU A;  5D4R A;  4OIP F;  1BJA A;  2QQA A;  1J9I A;  3I54 A;  5CVU A;  3M9A A;  5CVJ A;  1ULY A;  4R79 A;  3JTH A;  3DV8 A;  2Q0O A;  4XRF A;  2HZT A;  2EV5 A;  4PGG A;  4G9Y A;  1BOA A;  4EJW A;  2UZK A;  3RI4 A;  2IJL A;  2KIU A;  3GWZ A;  2FA5 A;  4HF2 A;  4EV0 A;  5E1W A;  1GXP A;  1YYV A;  4I2O A;  4ZZD A;  4KYW A;  4WF2 A;  1P4X A;  3I59 A;  3CUO A;  2RC4 A;  1BM9 A;  2QLZ A;  2MH2 A;  5ED4 A;  5LRS A;  1J59 A;  1O7L A;  2VT3 A;  4G6Q A;  4OIQ F;  1SFX A;  2V6C A;  3FX3 A;  4IRI A;  2HEO A;  3FM5 A;  1TLH B;  5DCM B;  2K02 A;  1XSX A;  4HDV A;  3U1D A;  5F6F A;  4G6D A;  2M8E A;  4M9X A;  1EH6 A;  4IRG A;  3FHZ A;  2OU2 A;  5L3D A;  2L4M A;  1HKQ A;  2KIF A;  2Y48 A;  1YG2 A;  3BDD A;  1JHF A;  2DT5 A;  5LHG A;  1FSE A;  1IN5 A;  1HQC A;  3RYP A;  1ZLK A;  4ENM A;  2E1N A;  2VBW A;  3WU0 A;  4LGW A;  3E6D A;  2HS5 A;  1SFU A;  1B59 A;  5DUI A;  5HDG A;  2V9V A;  1SD5 A;  3CJN A;  2EJR A;  1DDN A;  4ZYG A;  5LEJ A;  2KJB A;  4A6E A;  2NRA C;  2PEX A;  4GYI A;  5HLG A;  1Z91 A;  5K1Y A;  2Y75 A;  1YW9 A;  1Z1D A;  3I0T A;  1ZRC A;  3C18 A;  4CXF A;  2HTJ A;  2DI3 A;  3FWE A;  1DPU A;  4RAZ A;  5DCF A;  1H0M A;  3P9K A;  4L9T A;  2F5C A;  5J8C A;  1XN7 A;  4YFX F;  3N97 A;  2O0Y A;  2XUB A;  3F6O A;  2EFQ A;  3O2P E;  2HQR A;  3FZV A;  1RUN A;  2O03 A;  1L0O C;  2EFN A;  4QLC U;  3S2W A;  3KCC A;  1LEA A;  1HKS A;  2HYF A;  1FPQ A;  5LRR A;  1FP1 D;  1YIO A;  2Z33 A;  2HTS A;  2P5V A;  3TO6 A;  2RDP A;  4IVN A;  5LGT A;  1XD7 A;  3ZMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...