4GGGA

Crystal structure of v66a/l68v czra in the zn(ii)bound state.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
DTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSAHVVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Repressor protein
publication title Allosteric inhibition of a zinc-sensing transcriptional repressor: insights into the arsenic repressor (ArsR) family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 34
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gggA00
1O3RA 3FM5A 1R58A 1OKRA 3F22A 3KZYA 4KUMA 1MJBA 1DUXC 5J8FA 3SHFA 1MGTA 3JTHA 4G7HF 2NS0A 3L09A 2OQGA 1G3TA 3E5XA 4L18B 1DPUA 4ESBA 2DFIA 4Q4ZF 2MBFA 3KP5A 4LK0F 3WTTC 3GLXA 1U5TA 2J5PA 4HW0A 4PDKA 3DFGA 3HOSA 1XGMA 1U8RA 4CICA 4A0YA 2ADUA 1U6GA 4LMYA 4U0WA 4IVNA 1B9NA 3T1BA 1BIBA 2BEOA 1P92A 1LDJA 3FX3A 2V1UA 2K86A 1QQIA 2CQKA 4FT8A 4ASNA 3TDZC 3TGNA 4LFUA 3I53A 4OIPF 4OU0A 2V79A 5DUKA 3WGHA 3QU3A 5BQTA 4WXCA 3I5UA 1S8NA 3BWGA 2A5YB 1HSTA 2RN7A 3O6BB 5DDGA 1I27A 2O6GE 2X0LA 4LB6B 2CGPA 2DBBA 2VONA 3V4GA 5JVTA 2VBWA 2M5WA 4HF0A 1B4AA 2W85A 4EM2A 5D6EA 4UVAA 1UHWA 3P9CA 1W5SA 2IW5A 4IJAA 4BHBA 2K02A 1XSXA 3GFLA 1G3SA 2RVCA 1UFMA 2XKOA 4UVBA 2JTVA 3PFIA 3KETA 5D6FA 3K1PA 4EJVA 4G9YA 4AIHA 1F5TA 1L3LA 5CLSA 1XGOA 5J8CA 1RUNA 1PDNC 2HKOA 2L01A 4EJOA 2DPUA 3CLOA 4OOIA 1C0WA 4RGRA 4ZYHA 2YPRA 2VE9A 2UXNA 3F72A 3L7WA 3CO7C 1HW2A 2PBIA 4RB2C 5A2QZ 5DV5A 3FXQA 1IRFA 3REOA 2GZWA 2ZXJA 3AAFA 3ROUA 3TO6A 5DEQA 1TW3A 1TQMA 2QBYA 1ZYRF 2XIGA 2EA4A 2UXXA 2Z33A 3CTAA 5F1RA 3LFKA 5FLXK 2LF8A 3MZYA 2A68F 5JHUA 2ELHA 3E5QA 1X3UA 1SMYF 3EYIA 3WTWC 2V1XA 2A69F 1UCRA 2YX7A 3M1EA 2EFQA 4I2OA 1CF7B 5LHGA 4S04A 4GYGA 3N97A 5L3GA 1ZG1A 3ZMVA 5D5UB 4EM1A 2VT2A 3V7SA 1K79A 3HTSB 1HSJA 2Z99A 2IJLA 1D8KA 3JW4A 2Y0MA 3C18A 4WK8F 3K1NA 1EH8A 3GZ6A 3F6OA 3RYRA 5LHIA 2ZNYA 3K9TA 3ABUA 4EJTA 4KIBA 1HW5A 3GX4X 5L3CA 1WSUA 2NAZA 5D4SA 3F3XA 2BGCA 1D5VA 4Y17A 3EETA 1ZRDA 3RPQA 4FHTA 1S3JA 4LLGF 2FE3A 1YTYA 1IXRC 5FD5A 2EWNA 4OMYA 2KIUA 4B8XA 3F23A 1HKSA 5L3FA 2XHKA 1BN5A 4LG0A 3CDHA 1R5GA 4KIGA 4ZZDA 2DAOA 2EK5A 1R23A 2Y75A 2RNJA 1LDKB 4ZYGA 1KQ8A 1ZRFA 3T8TA 4KFCA 1SD4A 3VFZA 2B0LA 2Z9OA 2IP2A 4O5VA 4O6JA 1QZZA 4HYEA 2GIVA 4Y13A 5DCFA 5D8KB 1LVAA 5BPIA 3VOEA 2H27A 3NEUA 4HAMA 3FM3A 3FXRA 2DK8A 1MKMA 4DNCA 2RV8A 4IHTA 3ULQB 2FA5A 2QM3A 3VEPA 3GEZA 1ON1A 3FHZA 3WGGA 1I1SA 4KN7X 2P6TA 3K69A 2W84A 3E3VA 4HF2A 2XROA 3RPUA 1XD7A 4GYIA 2QQBA 3PQKA 1G6NA 1BIAA 1G3WA 4EMSA 1XGSA 2DTRA 5K1YA 3QAHA 1HKTA 2JRTA 3K1MA 3BPXA 4BH9A 3FXUA 4ENJA 3ZN1A 1SD7A 4G7ZF 2F5DA 3LAJA 3WU0A 5HS8A 3LAPA 2QQAA 4PGHA 4XSZF 1REPC 1R7JA 5CJ9A 3U1DA 2PEXA 1HBXG 5ICFA 3SFZA 4RB3C 1MDMA 4QWQA 5D4RA 2D2WA 1U5TC 5CVUA 4B09A 5BOXA 4HLXA 3WTXC 4PGGA 1DPRA 1ZHFA 3BPVA 4A6EA 5ERIA 4AWXB 3HSEA 2H09A 4R1HA 2XGXA 2XAGA 2MH9A 4XLPF 4GXOA 4LD5A 4HDVA 1FY7A 3MAJA 4WX9A 5LRRA 2ZKZA 2P5VA 2WTEA 2TDXA 1FLIA 2VOPA 3R61A 2E7WA 1XDSA 3JAMZ 2D1HA 5D5WB 3HRTA 4L9JA 1VTNC 1HW1A 3FMRA 1IAWA 3C3WA 4Q5SF 4HF1A 1BI2A 1FYMA 1U5TB 3C7JA 4YG2F 2QVOA 2W57A 4OIRF 1LNWA 3KP6A 1B9MA 5DCMA 4ENKA 3GXOA 3F8NA 3BROA 4ESJA 2KKOA 5HS9A 5EEGA 1U3EM 5FB2A 1TQPA 2HEOA 5BMZA 1T98A 3EDPA 3CJNA 5BS6A 2HYGD 4I09A 4JBAA 1JHHA 2IA2A 4A0XA 1O3TA 1PP7U 2VBYA 2DO7A 2VE8A 3V8LA 4KA4A 4L0YB 2LDUA 5L3BA 3E6DA 3TKYA 3WTSC 2PJPA 4A12A 1GXQA 2AS5F 2EFPA 2F5EA 3RIRA 2CW0F 4UHTA 5LEKA 2P7VB 2H94A 2XKPA 2XUBA 4MEXF 2KJCA 2CFXA 3HHGA 4L5IA 2VC1A 2XAHA 4HOBA 2M45A 5TRDA 2O8XA 3KP2A 4ZH4F 2FNAA 3GFMA 3BOQA 2IT0A 4BQAA 3KEOA 2E1NA 5E1ZB 1R36A 3KLOA 1QNTA 4IPAA 3COAC 2ETHA 1H9TA 1ONVA 2STWA 4EM0B 3TO7A 3MCZA 2QBYB 2H6BA 4EGYA 2HQRA 2ESNA 2L4MA 1H0MA 2P6SA 3BDDA 2MH2A 2IRFG 1YW8A 1YG2A 2GWRA 3M9AA 3U9GA 1GHCA 1R5HA 2EJRA 4LLNA 3Q9VA 2DPDA 1IN4A 4IRIA 2H6CA 3TOAA 4Y15A 1U2WA 3RDIA 4GGGA 3EUHA 1YW9A 1LJ9A 1B6AA 2ZNZA 2QZ8A 3F8MA 2QWWA 3O3KA 1YW7A 3E6CC 3CUQA 4CDGA 1IF1A 1V3FA 4GCVA 2FBIA 1P4XA 1Z9CA 1YYVA 3J81Z 3BJ6A 4CYDA 2RQPA 2MC3A 3SZPA 1Z05A 1SFXA 4A5NA 1SFUA 2WWYA 1XGNA 4HDUA 3F6VA 1P2FA 3VB2A 4MTDA 1IN6A 4P9FA 1BI3A 2RGVA 2VC0A 2L3DA 3ZP5A 3P9IA 1ODDA 4DQ2A 4HX4A 1TNSA 4RGUA 2MD5A 2HTSA 1IUYA 2A6HF 3IRRA 3J7AO 1EH6A 2A6EF 4MEYF 3M7GA 5CVVA 1T39A 1IZ1A 2DLLA 2IA0A 5E17F 4YIIA 2A07F 3R60A 3WODF 2L02A 2ACJA 4M72A 3B73A 3PQJA 2WV0A 2Z5UA 5HOOA 1K7AA 4KDPA 2QENA 1KU2A 3ISPA 2OBPA 1T6SA 3ECHA 1UB9A 1Z91A 4AVPA 3LWFA 4NQWA 2OZ6A 3U2RA 1ZG5A 1J75A 1B1BA 2O61A 4AIJA 3HIFA 2HR3A 1GVJA 4A5MA 5E1XA 3MFKA 3ELKA 2BV6A 3S2WA 4MQ9F 3IL2A 1ZREA 1K78B 1Z6RA 1F1ZA 4BNCA 1T0FA 3IWFA 3QP5A 2FMYA 3V8KA 1SD6A 4KNYA 2Y48A 1S7OA 2COMA 4M6XA 3JTGA 4HX7A 4UV8A 2ZMEB 3KCCA 5K5RA 3ZMDA 3ABTA 2FBKA 2HFHA 1WWXA 4WWCA 5EEHA 1J59A 4P55A 1MDMB 2C6YA 1O3QA 2IPQX 3P9KA 4M73A 2M8EA 4BAYA 3LA3A 4RB1A 3MEXA 1DP7P 2HZTA 1O7LA 4Z2YA 3TOBA 3V7CA 2F5FA 1S6LA 3WE3A 3FWEA 3GW2A 3GZ5A 3KEQA 4PZJA 3WE2A 1FZPB 2HKXA 2M30A 2ISYA 4IHSA 4I0AA 4L0ZB 1A04A 1XCVA 1LB2A 5FLXZ 3ZN0A 1DDNA 4KYWA 2K4JA 1J2XA 1RIOH 1FSHA 1P6RA 5LGUA 3OOPA 3I59A 3G73A 1HKQA 4GO1A 2AXLA 4KICA 3T5XA 4HQMA 1FNNA 2Q0OA 2JPCA 4BHCA 5DCMB 1K6OA 3H3ZA 3TQNA 3HSFA 3SQNA 2FF4A 2V1DA 3WTUC 3O2PE 2DT5A 2XAFA 4XBFA 4ENMA 2Q8KA 3J80K 1AWCA 5ILVA 4U7BA 1PUEE 4MHGA 1JHFA 4BYYA 1Y0UA 4XLNF 2E1CA 2R3SA 2JSCA 4ENNA 4HV5A 2CO5A 3I64A 2QLZA 4BXUA 3ML6A 1YO5C 3GO5A 4Q48A 2G7UA 1SFEA 4UV9A 1Z1DA 3MWMA 3E5UA 1NHAA 1KU7A 2OU2A 2X4HA 2YSRA 4L9VA 2FMLA 4IF4A 2VXZA 3L2CA 4N9IA 1SMTA 1O3SA 1ZN2A 4U88A 5CYVA 4R8HA 2MLGA 4I98B 5HS7A 5ICGA 5ILUA 2UZKA 1FP2A 1YS6A 1G3YA 2RC4A 5FFXA 1J5YA 3IKTA 2VOOA 2QYOA 2OQRA 4AIKA 1ZGJA 3F8CA 1BM9A 3JSOA 3DPLC 2PI0A 1I1GA 3LA7A 5AIPA 1KA8A 2OZUA 4KMUX 3I71A 4RB0A 2HGCA 2DQLA 2R7FA 2FXAA 4M9ZA 4NHJA 1FWZA 1RI7A 2M87A 2XVCA 4CXFA 1FBUA 1YQAA 5KVRA 3V7RA 2DW4A 1ZGAA 2G9WA 4IRGA 4H0EA 3DV8A 1GXPA 1ON2A 2P4WA 3GF2A 5DD8A 1R1VA 2XV4S 4G6DA 2VBXA 1O7FA 4JQFA 1W7PA 4F7ZA 4U0YA 3ERED 3B02A 3I0TA 3VODA 5HDNA 2CWEA 5LRSA 1T38A 1J0RA 4IXAA 2HOEA 2DQRA 1TBXA 2ZJ2A 4K2EA 2LKPA 5E8IA 2DK5A 2GXBA 4N9HA 1J9IA 2PN6A 1OPCA 4LK1F 2HTJA 1FBSA 2Q2EA 2FQ3A 5KK1A 3BJAA 1Q1HA 3Q9SA 5CVIA 3GWZA 3JSPA 2P8TA 1OMIA 1Z6TA 3KP4A 5D5VB 5LGTA 1KYWA 4CZZA 3T8RA 4EGZA 2BBYA 4HBLA 6PAXA 5HVQC 4ZYEA 4S05A 3R4KA 1LQ1A 1WRJA 3E6MA 3E97A 1QGPA 1S7AA 5HLGA 1O57A 4ZYDA 3ZMSA 4LLLA 3KP7A 3QPHA 1CGPA 5CVRA 1OYYA 1R00A 1P4WA 1ZAOA 4M74A 3CO6C 3GVAA 2Z3YA 4R79A 2HWVA 2K27A 1IXCA 5BPDA 3HHHA 5FO5A 1F4KA 1EV7A 3F21A 1FC3A 1YLFA 1BC8C 4M9XA 3KP3A 5JR3A 4YFXF 2PG4A 3QRFF 3ECOA 5F64A 1XCBA 3K0LA 4L5JA 1H9GA 5DD4A 2L4AA 3HYIA 1FOKA 2FU4A 2UWMA 5DYMA 2FRHA 1OYIA 1RUOA 5E18F 4E70A 2HDCA 5L3DA 1Z7UA 1QZYA 3IC7A 3DEUA 2V6CA 2QUFA 5HDKA 2VT3A 2P7CB 3DP7A 5K5QA 4UXNA 2HS5A 2JPBA 3ZMZA 4HV6A 5H20A 1FYKA 5A2QK 4QLCU 1KU9A 4ZZLA 4P9UA 3ZPLA 4EV0A 3ZMUA 3RKYA 5LLQA 3OV8A 2ZFWA 2ISZA 4A6DA 1IN8A 2PLYA 4XRFA 3DPTA 4G7OF 1HQCA 4LJZF 1UHMA 4HX8A 4Q47A 4RGSA 2YX4A 2ESHA 3WG9A 4HQEA 1LEBA 4OINF 2WC2A 1XN7A 3KLNA 1HXDA 4LG0B 3HSRA 1YS7A 3TO9A 4EVIA 4I02A 4NB5A 1ULYA 3H92A 5D8LB 4EQQA 4MQVA 3MQ0A 1F9NA 2EV5A 1TQIA 2FOKA 5JFRA 3BZ6A 3I59B 3NQOA 3WGIA 4PCQA 4CHUA 3CUOA 1E17A 2XRNA 3Q5FA 1IRGA 5LGNA 2GA2A 2E7XA 1ZLJA 3GYHX 2QQ9A 5H6RA 4UUVA 4HA8A 2XAQA 1R1UA 4LB5A 5JI6A 1ZG3A 3IWZA 2EFOA 1IW7F 2NNYA 3DQVC 3WU1B 3QU6A 1G4DA 1FBQA 4A0ZA 5HLHA 2MLKA 3RYPA 1FP1D 5ICCA 3LSTA 2YR2A 1XMKA 4FX4A 1ZARA 5ILSA 4RAYA 1PP8F 2VBZA 2PFBA 3I54A 3C1DA 3QOPA 1YFHA 5IT9K 2EV0A 2RKHA 3F8BA 2A61A 4OMZA 2O3FA 3RKXA 1L0OC 4P96A 3QP6A 2OD5A 3I4PA 1ZH5A 1LDDA 2MA3A 5FFZA 3L00A 5FGMA 2DI3A 2VN2A 4RS8A 4AD9A 3BP8A 3HRSA 1XSDA 4MGRA 5ICEA 1V4RA 4M71A 4KMFA 1W4MA 5L3EA 3HUGA 5K5OA 4JK1X 4L9NA 2F2EA 1BBYA 1FX7A 1TW2A 1E2XA 5HLIA 2R7DA 4HLYA 2EB7A 3T0YA 4IRHA 3FF5A 3NRVA 1D3YA 5DUIA 1I5ZA 1STZA 2FSWA 2GQQA 1KYZA 2XAJA 3RTRA 3I58A 4EJWA 2FNPA 3W6JB 5TJJA 4RGXA 4WXDA 2F5CA 2PQ8A 3MZHA 3FMSA 1U78A 1J7KA 3G3ZA 3KE2A 5E20A 4U0VA 4CGZA 1USSA 2CSOA 2EA2A 2J5OA 2V9VA 1W7PB 2W25A 2IVMA 2P5KA 3DKWA 4BHPA 2NYXA 5IT9Z 1FSEA 1KQ9A 1XDUA 2HYFA 3SXYA 2NRAC 2K7LA 2KRFA 4U7DA 1BI1A 3LA2A 3IKVA 4TV7A 2IA1A 5FD6A 1T2KA 5D5XB 2O0YA 3QPTA 4YFKF 1MZBA 1S29A 1RNLA 1SD5A 4O3MA 2ZCWA 3R6SA 1JXSA 5AONA 4YIFA 1BJAA 3JAMK 1BOAA 2LNBA 2ZO4A 2BE5F 5IT3A 3WTYC 4WF2A 5E8GA 1AOYA 4RAZA 4MNUA 2D45A 3WTVC 3H3UA 3TDUC 1MJ9A 1CF7A 5E1WA 1XSVA 2STTA 1K78A 3IHUA 2YU3A 1R1TA 1I6XA 3RI4A 1XMAA 1JE8A 4I0BA 3EYYA 1WQ2A 4FX0A 4UVCA 2G7HA 3GFIA 1LEAA 3GUDA 2ZMEA 3SZTA 1XB4A 2PMUA 1SAXA 3FMQA 2A3SA 3LQRA 3R0AA 1IN5A 2XASA 1KU3A 3KFWX 4KT5C 3LQQA 1W7PD 3J80Z 3CUQC 4G8XA 1WKMA 2EV6A 4M6YA 3D0SA 4M9SA 4P5OA 1USTA 4ETSA 4I7HA 2GA1A 4ESFA 1TNTA 2LSOA 1R22A 3ZQ7A 5ED4A 2DU9A 1KGSA 3V8JA 1WI9A 5AIQA 2L54A 2JT1A 3KZZA 4XSXF 3RJPA 3M8FA 1BI0A 1YIOA 1TLHB 2CG4A 2ZBKA 2RDPA 3DF8A 4WCGA 2PMHA 4A2UA 5LEJA 4ON0A 1QBJA 4I01A 3IRQA 1QPMA 3HRUA 2LF7A 3CUQB 3RKWA 1QO0D 1IN7A 1OYWA 1RZ4A 3BY6A 2P5LC 4N0BA 4YFNF 2W24A 3HOTA 3W6KB 1KQ0A 4KN4X 1ZLKA 1B59A 4MTEA 4EJUA 4G94A 2D1VA 4OIOF 2KIFA 2GAUA 2HQNA 2JZYA 5HDGA 5H6QA 1W5TA 4KIFA 1TTYA 1FPQA 4L9TA 2VODA 3HRMA 1OR7A 1IXSB 2KIMA 4HZFA 3R0JA 2GXGA 2FEZA 1JGSA 3WTZA 1EH7A 3HTUA 2NNNA 5CVJA 2K4BA 2EFWA 5F6FA 4LGWA 1BC7C 2OAZA 3N4MA 4UNOA 2M1BA 3BJOA 2BYVE 3L9FA 3J81K 3K2ZA 1MJAA 3GFJA 4OIQF 4G6QA 2FBHA 3ZMTA 3EQLF 3FZVA 2CYYA 2KJBA 1ZRCA 1FT9A 3DXJF 1D8JA 2OA4A 5LHHA 1FYLA 3D5LA 4D0PA 1MD0A 5LBQA 2O03A 4CO8A 2EFNA 3M8EA 4WXHA 1P4AA 5J6XA 3F8FA 3P7NA 3E6BA
chains in the Genus database with same CATH superfamily
4PSXA 1O3RA 3FM5A 1R58A 1FEXA 1OKRA 3F22A 3KZYA 3IH2A 4KUMA 1MJBA 5IYBJ 1DUXC 5J8FA 3SHFA 4IL6C 1MGTA 3JTHA 3OS0A 4G7HF 4A3KJ 4QIWN 2NS0A 3LSKA 3I56I 3L09A 2OQGA 1G3TA 3E5XA 4L18B 1DPUA 1IV6A 4ESBA 2DFIA 2HNHA 4Q4ZF 2MBFA 3QODA 3CCMI 3KP5A 4HPQA 4LK0F 4E4HA 3PJRA 3WTTC 1S7EA 3GLXA 1U5TA 2J5PA 3G6EI 4HW0A 4PDKA 2NS8A 3ZOBA 3A01B 3DFGA 3ZRGA 3HOSA 1XGMA 1U8RA 4QSHA 4CICA 2P0WA 4A0YA 4BE0A 4NDLA 2ADUA 1U6GA 4LMYA 4C3JJ 1TT5B 4U0WA 3CMMA 4IVNA 1YI2I 3HDDA 2JRMA 1DP3A 3VSKA 1B9NA 4C3IJ 1IJWC 1FOYA 3T1BA 2IBDA 1BIBA 5J4VA 2BEOA 2Y0SA 3WG7H 1P92A 1LDJA 3FX3A 4C3HJ 2V1UA 2K86A 1OQYA 1QQIA 2CQKA 3CC4I 4FT8A 4ASNA 3TDZC 2FX0A 4BEHA 3TGNA 5J1YA 4LFUA 3AFHA 3I53A 3H0DA 4OIPF 2OCEA 2DFFA 3K4LA 4OU0A 2V79A 5DUKA 3WGHA 3QU3A 5EZHA 3MVPA 3P5JA 5BQTA 1W0UA 4WXCA 4A93J 3I5UA 1S8NA 3LMMA 3KEYA 3BWGA 4C9YA 5JLWA 1IG7A 4LIUA 2A5YB 5J4YA 4XLHA 1YJNI 1HSTA 2RN7A 2JVHA 2HOSA 3O6BB 5DDGA 1I27A 2O6GE 2X0LA 3DKXA 4LB6B 2CGPA 2DBBA 4HEA2 4ZTJA 3I55I 2VONA 3BR6A 3RKQA 3ABMH 3V4GA 2MSYA 5F27A 2VBWA 5JVTA 2M5WA 4HF0A 3IAM2 1B4AA 2W85A 4EM2A 5D6EA 4UVAA 1UHWA 1UELB 2OTJI 4I99C 3P9CA 4M3BA 1W5SA 2IW5A 4IJAA 4BHBA 2MW8A 2K02A 1MMDA 1XSXA 3GFLA 1G3SA 1OFCX 2R7UA 4RAGA 2RVCA 1UFMA 5DS9A 4BE1A 2XKOA 4UVBA 3PNYA 1WZ2A 2JTVA 3PFIA 3KETA 5D6FA 2RQQA 3K1PA 4G9YA 4EJVA 4AIHA 1F5TA 1L3LA 2HZDA 5CLSA 1XGOA 5J8CA 1RUNA 1PDNC 2HKOA 2DMQA 2L01A 4EJOA 2DPUA 3CLOA 2ZC2A 4OOIA 2CS3A 1C0WA 2KRHA 1LPQA 4RGRA 3HOVJ 3ASNH 4ZYHA 1SFKA 2CV0A 2YPRA 4XK4A 2VE9A 2JQ7A 2UXNA 1MBJA 3F72A 3L7WA 1RETA 3CO7C 1HW2A 2PBIA 4RB2C 2RNGA 5A2QZ 5DV5A 5F0FA 3FXQA 4IOCF 1IRFA 2VPRA 2OV7A 3REOA 2BW3A 3BG7A 2GZWA 2ZXJA 3AAFA 3ROUA 3TO6A 5DEQA 1TW3A 4FTHA 1G2HA 3CCUI 1TQMA 1CQTA 2GLOA 5GPAA 2QBYA 1ZYRF 3ABLH 2M3AA 2XIGA 2EA4A 2UXXA 3S3MA 2Z33A 3CTAA 5F1RA 3GTGJ 2JA5J 3LFKA 5FLXK 1VQOI 2LF8A 3S8PA 3MZYA 2A68F 2WY7Q 4XOPA 2V7FA 5JHUA 4KISA 2ELHA 3E5QA 2KFDA 5FJ8J 1X3UA 1SMYF 2DA1A 3EYIA 3WTWC 1TP4A 2V1XA 2A69F 1UCRA 2HOTA 2YX7A 3M1EA 2EFQA 3CJQB 4YRVA 3I3LA 4I2OA 1CF7B 5LHGA 4S04A 2ZXIA 3PM1A 3VDXA 3OIOA 3PUFA 4NC6A 4E7HA 4GYGA 4IHYA 3KZIC 3IV5A 3N97A 5L3GA 2CUZA 1ZTRA 5GP9A 1B8IA 2DFHA 2W00A 1X1BA 1IGNA 2EPFA 4MO7A 3ZMVA 1ZG1A 2DJNA 2VJ5A 5D5UB 4EM1A 4BS9A 2VT2A 3V7SA 5B1AH 1K79A 3HTSB 2XGDA 4C2UA 1HSJA 2Z99A 5FROA 3FISA 1VF9A 1BW5A 2IJLA 1D8KA 3JW4A 2Y0MA 3C18A 4ZDOA 1Y1VJ 4WK8F 1I50J 4UB8C 3K1NA 1JJ8C 1EH8A 2E34A 3OSGA 3D5SC 3GZ6A 2QSHX 3F6OA 1W1WE 3RYRA 4DGWB 1LVKA 2OF7A 1YE9A 2VQCA 1VQ6I 5LHIA 2ZNYA 3K9TA 2R7OA 2HXIA 1YRNB 1OCPA 3ABUA 4EJTA 2CJJA 4KIBA 1HW5A 3GX4X 5L3CA 3EUAA 1WSUA 2BXZA 2NAZA 4ZDLA 5D4SA 4M3GA 3F3XA 2BGCA 1D5VA 5HNHA 1P7JA 2DMUA 3EETA 4Y17A 1ZRDA 3RPQA 3Q0UA 4FHTA 1S3JA 4FQGA 4LLGF 2FE3A 4II2A 3WHBA 1YTYA 1IXRC 5FD5A 2EWNA 2IAIA 4OMYA 2KIUA 4B8XA 3F23A 1HKSA 5L3FA 3FXLA 3L2RA 2XHKA 2A05A 1BN5A 1BA5A 4LG0A 3CDHA 5K7FA 1LE8A 2R5YA 1R5GA 4KIGA 3HM5A 4ZZDA 2DAOA 4QPOA 3ZQCA 2EK5A 1E3HA 1RRJA 3DPUA 1Y8QB 3MZ8A 3JRHA 1ZQ3P 5GPCA 1R23A 2Y75A 2RNJA 4NNJA 2R7QA 1LDKB 2XGCA 4ZYGA 1ETQA 2FJ1A 3RQIA 1OR7C 3MKLA 1HDDC 4A3EJ 1KQ8A 1ZRFA 2MD0A 3T8TA 3ZCOA 4KFCA 1SD4A 3QYEA 3BG9A 3VFZA 2Z16A 4AUXA 4F92B 2B0LA 2IS4A 2Z9OA 2JMWA 2IP2A 2UUZA 4O5VA 1AKHB 4O6JA 2HYJA 1QZZA 4HYEA 2R4GA 2GIVA 3SEZA 1VQ8I 4Y13A 5DCFA 2OTLI 1PUFA 5D8KB 1LVAA 5BPIA 1AU7A 3VOEA 1BR1A 1UJ8A 2H27A 2VJ4A 3NEUA 4HAMA 5GAEJ 3FM3A 2R7VA 3FXRA 3BQYA 3OYCA 2DK8A 1MKMA 4DNCA 2RV8A 2B7EA 1WH7A 3JRIA 4IHTA 3ULQB 1QHGA 2FA5A 2QM3A 4XRSG 2EINH 5EEAA 3VEPA 3DEWA 5CQEA 2BY0A 1KZHA 1DU6A 3A02A 2FUG2 3GEZA 1ON1A 3FHZA 3WGGA 1A6IA 1UMQA 1I1SA 1TWHJ 4KN7X 2P6TA 3K69A 4BJTA 2W84A 5F04A 2AQFA 2X1DA 3E3VA 1X58A 4HF2A 1JKQC 2XROA 1W5CC 3RPUA 1NK2P 2W82A 2WV1A 1XD7A 4GYIA 2QQBA 2E35A 3PQKA 5EGOA 2DT6A 1JTXA 1G6NA 5J40A 2PMZA 1F43A 1BIAA 1G3WA 4EMSA 1XGSA 1MMNA 1X19A 2DTRA 5K1YA 2WY8Q 3WU2C 3QAHA 3VYRB 4AU7A 1SANA 1HKTA 2JRTA 2V6EA 2VQLA 2L5QA 3K1MA 3I4MJ 3BPXA 3G1MA 2E36A 4BH9A 3FXUA 4C2TA 4ENJA 3ZN1A 4IX7A 1UZCA 1SD7A 2ICWG 4MFDA 4G7ZF 4UB6C 2F5DA 4BQQA 3LAJA 3WU0A 1JUMA 5HS8A 1ETXA 4XN0A 3LAPA 2QQAA 4PGHA 4XSZF 4OWRB 2HU9A 1REPC 1R7JA 4DZPA 4L5EA 5CJ9A 3U1DA 2PEXA 3AG3H 1OCTC 1HBXG 5ICFA 3SFZA 5TGTA 4B47A 3OL4A 3CJRB 4RB3C 2DDBA 1MDMA 1N77A 2W4SA 3S32A 4QWQA 5D4RA 3CD6I 2D2WA 1U5TC 3AG4H 5EYRA 5CVUA 4B09A 5BOXA 4HLXA 3WTXC 1Y56A 1DGRM 1MIJA 3ZQIA 2DYRH 4PGGA 1DPRA 1ZHFA 4EATA 3L2VA 3BPVA 2VLAA 4A6EA 1OLTA 5ERIA 4AWXB 3BZCA 2NS7A 3HSEA 1A36A 2RAEA 2H09A 4E7LA 4R1HA 2XGXA 2XAGA 2MH9A 2B9SA 4XLPF 4NC8A 4GXOA 5FKNA 3OL3A 3JREA 1Y39A 4LD5A 4CCMA 4HDVA 3W2AA 1FY7A 2CQNA 3MAJA 4WX9A 5LRRA 2XF7A 2P5VA 2WTEA 2ZKZA 1VQ7I 3H3VK 2TDXA 4DJAA 2LK2A 4XLAA 5IP6A 2M4GA 1FLIA 2VOPA 3R61A 2E7WA 4JX4A 2DOEA 1XDSA 3JAMZ 1Z3YA 2D1HA 1EJ9A 3K4MA 2LKXA 2ZFUA 5D5WB 3LSIA 3HRTA 3HPHA 4L9JA 5E79C 2HDWA 1MBEA 2KQRA 1HA8A 5FRMA 1VTNC 1HW1A 4E7IA 3H9JA 3FMRA 1IAWA 3C3WA 4JOMA 4Q5SF 2WAEA 4HF1A 4CZCA 1ZR2A 1A31A 1BI2A 3W3CA 1FYMA 1U5TB 3ZGKA 3C7JA 1D0ZA 3C2BA 4YG2F 2QVOA 3K4NA 2W57A 1LFBA 3PNVA 2AO9A 4OIRF 1LNWA 2CV1A 4A3DJ 3KP6A 4BXXJ 1B9MA 5DCMA 1JI8A 4ENKA 3GXOA 3BT9A 3F8NA 2GXAA 3LSHA 3ZQGA 4A3MJ 3BROA 4ESJA 3ERMA 2KKOA 5HS9A 1ZR4A 1OCZH 2M7BA 5EEGA 4DBQA 1U3EM 5FB2A 4XLFA 1R49A 1TQPA 3HG9A 2HEOA 3M3YJ 5BMZA 1T98A 2GBYA 3EDPA 3CJNA 5BS6A 2HYGD 4RAFA 4I09A 4JBAA 2M34A 1JHHA 2BXYA 2E19A 2IA2A 4A0XA 3L2WA 1PP7U 3K7AJ 5JVGF 1VQPI 1O3TA 4XL9A 3K2AA 2VBYA 2DO7A 3HKZN 2VE8A 4XKVA 2R5ZB 5GAGJ 3V8LA 4KA4A 2ZJRF 4L0YB 2LDUA 1R4NB 2OUMA 3J7AY 5L3BA 2DA3A 2M7AA 3E6DA 3TKYA 3WHCA 3WTSC 2LY1A 2PJPA 2ID6A 2VUMJ 4A12A 3DBLB 1GXQA 2K9QA 3OYGA 4M3EA 2AS5F 2EFPA 3DU6A 2F5EA 3RIRA 5KAIC 2CW0F 1WPKA 4UHTA 5LEKA 1XX5A 2P7VB 2ID3A 4AYBA 2LYCA 4E7SA 2H94A 2TCTA 2XKPA 2ELJA 2XUBA 5E3NA 4MEXF 3ZQFA 3FK7A 2KJCA 2CFXA 5BNGA 9ANTA 3HHGA 5DM6F 2L7FP 4L5IA 1FTZA 2VC1A 2XAHA 4HOBA 3S1MJ 2QEXI 1XS9A 4F93B 2M45A 5TRDA 1VQ5I 2O8XA 2VKVA 3KP2A 4ZH4F 1IV8A 1MW7A 4NUBA 2FNAA 3GFMA 4DOZA 2WAQA 2HPIA 3N05A 3BOQA 1R4MB 2IT0A 4BQAA 3KEOA 5CPRB 2YU9J 2CUJA 1P7IA 1TL8A 2E1NA 1N25A 1AHDP 3VYSB 3CESA 1UG0A 5E1ZB 4OAZA 3LFUA 2O8KA 1R36A 2E2IJ 4Z6YA 3KLOA 1MSEC 1QNTA 4IPAA 3COAC 2CU7A 4IQ4A 2ETHA 2HOAA 3E7LA 1H9TA 1I6HJ 1Q1VA 1ONVA 2VJJA 4EM0B 2STWA 4KITB 3TO7A 2K85A 5EG0A 3MCZA 2QBYB 1N75A 3OIPA 2H6BA 3H5AA 4EGYA 3F9KA 1ZGWA 2HQRA 1Y0NA 2ESNA 5DTDA 5HNFA 3BR0A 2WBMA 1HOMA 2CRGA 2L4MA 1H0MA 3SFIA 1X4OA 2Y9ZA 2KPMA 2P6SA 3BDDA 3S15J 5C4JJ 2MH2A 2IRFG 1YW8A 1Z7LA 2RREA 3PNTA 2HPMA 1YG2A 2GWRA 1S9HA 2E5ZA 3M9AA 5FKOA 3U9GA 5B1BH 5E3LA 1GHCA 1R5HA 2EJRA 4LLNA 3Q9VA 5CKTA 1IDZA 1Y1WJ 2DPDA 1YX5A 2BZTA 1IN4A 3EPZA 1Z67A 4YEJA 4A3JJ 1IC8A 4IRIA 2H6CA 2X6WA 3TOAA 4Y15A 1U2WA 3RDIA 2H1KA 1R6RA 1MNEA 4GGGA 2R7TA 3EUHA 3HUGB 3VYUB 4RDUA 2XPVA 1YW9A 1LJ9A 4UUSB 1W36C 1B6AA 3C2GA 1ZKGA 2ZNZA 1H88C 2QZ8A 3F8MA 1U8BA 4BL0B 2X48A 1IO2A 2QWWA 3O3KA 1YW7A 3E6CC 1V54H 5HODA 3Q0VA 2VQHA 3CUQA 5EDNA 4CDGA 3IH4A 3D1NI 3HPGA 1IF1A 1V3FA 4M3FA 2H1LA 2K3PA 4GCVA 2FBIA 1P4XA 1Z9CA 2LRDA 1YYVA 3J81Z 1ORKA 1D0XA 1VQNI 4ITVA 1RKWA 4JP0A 3K70C 3A2KA 1JTYA 3BJ6A 4CYDA 4PK4A 2RQPA 2MC3A 3SZPA 3AKZA 1K4SA 3S93A 3H0GJ 1QZEA 1Z05A 3MD2A 1SFXA 4A5NA 2ZSIB 2WWYA 1SFUA 3HEFA 1XGNA 2DODA 2M9HA 4V2GA 2ECCA 4JX5A 4HDUA 3RSNA 3F6VA 1P2FA 5FLVA 2L9VA 1V5GA 4A3GJ 3OSFA 1LE8B 2R5YB 3NAUA 3VB2A 4MTDA 2K9LA 1IN6A 4P9FA 1BI3A 2RGVA 2BVMA 2VC0A 2L3DA 4OAYA 4F3QA 2CUFA 3ZP5A 1HLVA 3P9IA 3VPRA 1ODDA 4DQ2A 4HX4A 3BG6A 1TNSA 3CCYA 2MD5A 4RGUA 2HTSA 3CJTB 1IUYA 2A6HF 3IRRA 3J7AO 3S1NJ 1EH6A 4CYCA 3RZDJ 3SEQA 2A6EF 1BR2A 4MEYF 2X51A 3M7GA 3AL0C 5CVVA 1T39A 1IZ1A 3W2WA 2DLLA 2IA0A 5KAFC 4YIIA 5E17F 2A07F 3ASOH 2KL4A 3R60A 3WODF 2L02A 1JKPC 2R7SA 2ACJA 4M72A 3B73A 3PQJA 1V5EA 2WV0A 2Z5UA 5HOOA 2ELKA 4DYQA 1K7AA 4KDPA 2QENA 1KU2A 3ISPA 3PIPF 2OBPA 2CQ7A 2ZMEC 4A3CJ 4B48A 1T6SA 3ECHA 1UB9A 1IDYA 1OCCH 1Z91A 4AVPA 3LWFA 2E71A 3S1RJ 4NQWA 3Q3SA 3GTLJ 2OZ6A 3U2RA 2F4MB 1ZG5A 1J75A 1B1BA 3UR3C 2MGQA 2O61A 2EH3A 2LLKA 4D5CA 4AIJA 3HIFA 2HR3A 3CZ6A 4N4OB 3LL7A 1S72I 3CCRI 1GVJA 3DTEA 4A5MA 3H36A 4B1RA 5E1XA 3OYJA 3MFKA 2KDOA 3ELKA 2BV6A 4XLEA 2IEKA 3S2WA 4MQ9F 4LIVA 5EGOB 2JUGA 2BY3A 1GDTA 3AL0B 1GT0C 3GMEA 5B5EC 3IL2A 1ZREA 3OR1C 3BCAA 1K78B 1Z6RA 4NBQA 1F1ZA 4BNCA 1T0FA 3IWFA 3QP5A 1U9NA 2FMYA 4PSWA 4A3LJ 3V8KA 2KZVA 1SD6A 2CH0A 4CCLA 3BC8A 4KNYA 3K4CA 2Y48A 1MBGA 2LREA 1MBFA 1S7OA 2COMA 4M6XA 3JTGA 1Z0XA 4HX7A 2DCEA 4UV8A 2KT0A 2ZMEB 3KCCA 5K5RA 3ZMDA 3GTOJ 1WJFA 1V55H 2D5VA 3ABTA 2WB1N 4BBRJ 2FBKA 1RPWA 4B4CA 2HFHA 1WWXA 3OWTA 5EEHA 4BQOA 4WWCA 1J59A 3GCMA 1D1AA 4P55A 4ABZA 4XM3A 1MDMB 4W1UA 4AVZA 1NG7A 2C6YA 1O3QA 3PIOF 1OCRH 2F4OB 2IPQX 3K4JA 1TWFJ 3SDGA 3P9KA 4M73A 2PJRB 2M8EA 4BAYA 4KT6A 2B63J 1W36D 3LA3A 2DA6A 4RB1A 3MEXA 1FOWA 1DP7P 2HZTA 4PJLA 1O7LA 1XMXA 4Z2YA 2X6XA 3CMYA 3TOBA 3V7CA 2L7ZA 2F5FA 1S6LA 3AG1H 3WE3A 3FWEA 3GW2A 2LD5A 1N78A 3GTQJ 2XPUA 2DA4A 3GZ5A 3KEQA 3IP4B 4PZJA 3WE2A 3OYFA 2DXIA 4Y7NJ 3PFYA 4BDYA 1ETOA 2V26A 3OYBA 3FXKA 1FZPB 2HKXA 3CDIA 4MFEA 4XKWA 2LBFB 1VZ0A 1JT0A 3K70D 2M30A 4FASD 2ISYA 4IHSA 4I0AA 4L0ZB 3H9GA 1A04A 4AIDA 1EF4A 5E3OA 1XCVA 3CCSI 2R7WA 2L7MP 1LB2A 1WVRA 5FLXZ 3ZN0A 1ZK8A 1DDNA 4BKXA 5IPAA 4D5FA 4KYWA 2K4JA 3FBNB 1J2XA 1RIOH 1A35A 3D5RC 1U9OA 1FSHA 1P6RA 1Y8RB 5LGUA 1J09A 3OOPA 1P9QC 5M5XJ 3I59A 1O4XA 2BY2A 1HKQA 4GO1A 3G73A 2CFOA 4XQFA 2AXLA 1YHQI 5F0CA 3OR2C 4KICA 2E1OA 3T5XA 4HQMA 2XSDC 1FNNA 2Q0OA 2JPCA 4BHCA 5B66C 4KJZA 5DCMB 2XGEA 1K6OA 3H3ZA 3RPUD 3TQNA 2F48A 3HSFA 3SQNA 2FF4A 1PYVA 3CCQI 1JUSA 1SEUA 2V1DA 3WTUC 1YOVB 3O2PE 2DT5A 2XAFA 1KONA 2UV1A 4XBFA 2XC7A 4ENMA 2E1MC 1ETKA 2Q8KA 3J80K 3S1QJ 2MFZA 1Z77A 1AWCA 1VQ9I 3M8JA 3HL2A 2V4JC 5ILVA 4U7BA 1PUEE 4MHGA 4DIQA 5K7ZA 4IHVA 2ECBA 1JHFA 2VIXA 4BYYA 2IGKA 1Y0UA 4XLNF 3GLLA 2E1CA 2R3SA 2JA6J 2JSCA 4ENNA 3FDYA 1VQMI 3M07A 2ZB9A 5KHDA 2CW8A 4XORA 4HV5A 3CCEI 2OJED 3CF5F 3UNGC 2CO5A 3I64A 2X85A 2QLZA 3B6CA 4BXUA 3ML6A 3PUBA 3TBIA 4CCJA 1YO5C 3GO5A 4Q48A 4XRMA 2G7UA 1SFEA 2JA7J 2OC6A 4II3A 2O5RA 1LFPA 3DBHB 4JYKA 1Z1DA 4UV9A 3MWMA 2CV2A 2MC4A 3DWLE 3E5UA 1OISA 2R7RA 1NHAA 1KU7A 1PJRA 2OU2A 2X4HA 4BACA 2YSRA 4FETA 3RQ4A 4L9VA 2FMLA 2IS1A 1WJ5A 4IF4A 2OPTA 2VXZA 2E1MB 1ETYA 2M0MA 2MABA 1WHUA 1SMTA 4N9IA 2NVYJ 3L2CA 1ZN2A 1O3SA 4U88A 1APLC 5CYVA 2R7XA 4R8HA 1Y6IA 2MLGA 2NVXJ 1NK3P 4I98B 1Z21A 5HS7A 5ICGA 5ILUA 2UZKA 1HC8A 1FP2A 3PSIA 1YS6A 3FKIJ 1BR4A 1G3YA 2RC4A 5FFXA 1IUFA 1UAAA 1J5YA 1WJAA 2NVUB 3IKTA 2VOOA 4HSRA 1YX3A 2QYOA 2G0EA 2OQRA 3H9QA 2TRTA 2WADA 1X1AA 3HGYA 3OYHA 4AIKA 1ZGJA 3F8CA 1BM9A 5B3SH 3JSOA 5FKKA 3CDLA 3DPLC 1UG2A 2PI0A 1X4PA 1I1GA 3LA7A 2VASA 5AIPA 1KA8A 3CLQA 3BR3A 3KYDB 4BUPA 3ZQHA 1E3PA 2OZUA 4KMUX 3I71A 4RB0A 2DA7A 3FXOA 4H4KC 2HGCA 2DQLA 2R7FA 2FXAA 4M9ZA 2IS2A 4NHJA 1FWZA 1RI7A 2I10A 3JRDA 2M87A 4D7MA 2XVCA 4CXFA 2CUEA 3BR2A 1FBUA 3GBGA 2KP6A 1YQAA 3SZGA 5KVRA 3V7RA 2DW4A 3BG5A 1ZGAA 5CQGA 3QWLA 4U87A 2G9WA 2YS9A 4IRGA 1SVLA 4XONA 3DV8A 4D7NA 4H0EA 1K61A 1GXPA 1ON2A 2DJIA 2P4WA 3GF2A 4P1WA 1R1VA 5DD8A 3CC2I 2XV4S 2DT7B 1R5ID 3S2HJ 4G6DA 2VBXA 2V1NA 1FMVA 1O7FA 4JQFA 4AYBN 5JHFA 2L9NA 4XN3A 2VI6A 1W7PA 1R71A 4F7ZA 2EZLA 2HI3A 5M3FJ 4U0YA 3CQZJ 3ERED 2EZKA 3B02A 3I0TA 3VODA 4A69C 5HDNA 1V5FA 3V42A 2M0CA 2CWEA 4DBRA 5TISC 5LRSA 1T38A 1J0RA 2NVQJ 2X6YA 4IXAA 2HOEA 2DQRA 2LC2A 1TBXA 2ZJ2A 2AQEA 2VXDA 4K2EA 2LKPA 5E8IA 1NG6A 1WI3A 2FD5A 2DK5A 4ZYAA 2DFEA 2GXBA 3ZR8X 1AKHA 4N9HA 1J9IA 3KPHA 4BEHB 2PN6A 2E2HJ 3KYLA 1K4TA 2KMUA 3K4KA 1MMGA 3G1OA 1OPCA 4LK1F 3A1YA 4XNFA 2HTJA 1FBSA 1FTTA 3K10A 2Q2EA 2FQ3A 2LY2A 5IOZA 2HDDA 5HLTA 2W7NA 1FIPA 3GTPJ 5KK1A 3GTKJ 3BJAA 3W6VA 1Q1HA 2E5NA 3MKZA 3CC7I 1OCOH 3OYNA 3Q9SA 5CVIA 4JX6A 2DOAA 1T95A 2XF6A 1X2NA 3GWZA 3LNQA 3JSPA 4IQJA 2P8TA 2R92J 1I3QJ 3I9V2 1OMIA 1Z6TA 3H1CA 3KP4A 4RA2A 5D5VB 1B72A 5LGTA 1SVMA 1KYWA 4CZZA 3T8RA 2ZJPF 4RLQA 3BTCA 4PJJA 4EGZA 2BBYA 2O7OA 3HOWJ 5H2FC 2ZSHB 4HBLA 6PAXA 1ENHA 5HVQC 3L1PA 3PO2J 2NXNB 4ZYEA 4S05A 4IOAF 2LR8A 3R4KA 1LQ1A 1WRJA 1JGGA 2ZJQF 3E6MA 3E97A 4E7ZA 1QGPA 1S7AA 1JJ6C 3S16J 2I8DA 5HLGA 1O57A 4ZYDA 3ZMSA 4LLLA 2GOMA 5KCMA 4MIMA 4C30A 3CCVI 3KP7A 3QPHA 4CYCB 4MLOA 4HNVA 5EF6A 1CGPA 1TWCJ 4B44A 5CVRA 1OYYA 1U0JA 1R00A 3VWBA 3OS1A 1P4WA 1X3WB 1ZAOA 4M74A 1TZLA 2EQRA 4DZJA 3PO3J 3CO6C 1SAUA 1DGWY 1T0FC 1H8AC 1F36A 3GVAA 3TEDA 2Z3YA 4R79A 2DOFA 2HWVA 4RBOA 5M5YJ 3BTJA 1MH3A 2K27A 1IXCA 2W48A 2WAFA 3HB9A 3JRFA 5BPDA 3HHHA 4XR6A 3HBLA 5FO5A 1JKRC 4BY1J 1F4KA 4BU2A 1MMSA 1EV7A 3F21A 2BW3B 2VL8A 2Y0SN 1MH4A 1FC3A 1YLFA 2H8WA 2L9SA 4FISA 3MMYB 1QA6A 3ZXSA 1BC8C 3JCUC 2IS6A 3ESWB 2DDAA 3DTKA 5IY5H 1X2MA 3S14J 4M9XA 3KP3A 4C2MJ 5IOYA 5JR3A 3JRBA 2X9DA 3S17J 4LOCA 2QGUA 4YELA 4YFXF 4RMNA 4E7KA 2PG4A 3ABKH 2CMPA 2GIZA 2E2JJ 3QRFF 2IGMA 3FHNA 3ECOA 5F64A 5DM7F 5C4XJ 1LUJB 1XCBA 5EZGA 3K0LA 4L5JA 1H9GA 5DD4A 2L4AA 3HYIA 1FOKA 2FU4A 2UWMA 1JT6A 5K7HA 1G8XA 5DYMA 1B8IB 2FRHA 1OYIA 2DA2A 1RUOA 5E18F 4E70A 2YUSA 4X6AJ 2VJIA 1X1PA 3VSLA 2HDCA 5L3DA 1Z7UA 4BJ6C 1QZYA 3IC7A 5LD2C 3HGGA 3DEUA 4J01A 2V6CA 1T8IA 2JA8J 2QUFA 2QKMB 5HDKA 2CQXA 2VT3A 2P7CB 4BXFA 3DP7A 5K5QA 4UXNA 3BG3A 2HS5A 2CW7A 2JPBA 3KX2A 3ZMZA 2ZXHA 4HV6A 5H20A 3QOEA 1FYKA 5A2QK 4QLCU 1KU9A 4ZZLA 4P9UA 4ZTFA 3QPSA 3ZPLA 4EV0A 3ZMUA 1LKXA 3GTMJ 3RKYA 5LLQA 3OV8A 2DMPA 2ZFWA 3JRGA 2ISZA 4A6DA 1IN8A 2PLYA 4XRFA 3DPTA 4G7OF 1HQCA 3M4OJ 4LJZF 1UHMA 4HX8A 4Q47A 4RGSA 2YX4A 2JJ7A 2ESHA 3A03A 3WG9A 4B3AA 4HQEA 1LEBA 1LFUP 2HVSA 2XSJC 3FXJA 4PJMA 4OINF 2WC2A 1XN7A 3KLNA 1HXDA 3BZKA 4LG0B 2R5ZA 4AM3A 3X2QH 3HSRA 1YS7A 3IUOA 4F52A 3OYDA 2E60A 3CP2A 2Y30A 3TO9A 2KLOA 4CUGA 2QA4I 2BOLA 4EVIA 4I02A 4NB5A 1FJLA 1MMAA 1ULYA 3H92A 2X1EA 5D8LB 4B43A 4DW6A 4HRIA 3BTIA 4EQQA 4MQVA 3MQ0A 2GM4A 3MKYB 1F9NA 2EV5A 1T08B 4BE2A 1T56A 1TQIA 4CA0A 4A3FJ 2IGNA 2FOKA 5JFRA 3BZ6A 3I59B 1RR7A 3NQOA 3NARA 3WGIA 3UKGA 5FRNA 3SYTA 1FMWA 4PCQA 4D1QA 4CHUA 3CUOA 3K4BA 1E17A 3TP0A 3ZQLA 2XRNA 3Q5FA 2K40A 1IRGA 1PUFB 3EUKL 5LGNA 3HJEA 2QQ8A 3TW7A 2GA2A 4BJ5C 4HSTA 2E7XA 1ZLJA 2JUCA 4BDZA 5J1RA 4S0HB 3GYHX 2QQ9A 5H6RA 2KISA 4UUVA 1K83J 2XAQA 4HA8A 5KNLA 4M3DA 1R1UA 4LB5A 4FE4A 1HCRA 1M1EB 5JI6A 2Y9YA 1ZG3A 1S5LC 2I5UA 3IWZA 5IP7J 1BW6A 1ETWA 3OIQA 4XICA 2EFOA 1IW7F 1GVDA 1ZELA 2VB6A 3K6GA 3DQVC 2NNYA 4UY8I 4CCNA 3JR9A 3WU1B 3QU6A 4IHXA 4NC7A 1G4DA 1FBQA 2Z1DA 4A0ZA 5F0HA 1UHSA 5HLHA 2MLKA 2L9RA 4V2FA 3RYPA 4F55A 1FP1D 2QSFX 3HOZJ 3A4CA 5ICCA 1WFXA 2LMDA 3LSTA 1YIJI 4ZDPA 1YJWI 2YR2A 4B3XA 4V19K 1XTAA 4LITA 1XMKA 2XB5A 3ZQQA 4FX4A 1XC5A 3E1SA 3CCLI 2XB0X 1ZARA 1RESA 5ILSA 4RAYA 2EBIA 1WGXA 1PP8F 2F5VA 1GUUA 2VBZA 2PFBA 3I54A 3C1DA 1SC7A 1BL0A 3QOPA 1YFHA 5IT9K 4FCYA 2EV0A 2RKHA 3F8BA 2MYSA 3QQAA 2A61A 3OY9A 4OMZA 1JUPA 2O3FA 1DU0A 3RKXA 2XAUA 4XOTA 2JK3A 2L2OA 2BVLA 1L0OC 4P96A 3QP6A 2OD5A 3H35A 1X3ZB 3I4PA 1ZH5A 1LDDA 2MA3A 5C44J 3LSRA 4A3IJ 3J7YJ 3DEEA 5FFZA 3L00A 3O8HA 5FGMA 2DI3A 2VN2A 4RS8A 2LY9A 4PJ0C 4AD9A 3BP8A 4IO9F 2BHZA 3HRSA 4GDFA 1XSDA 4MGRA 2X1CA 3OS2A 3A01A 5ICEA 1V4RA 3SDBA 4M71A 5GTHC 4KMFA 1W4MA 3OYMA 5L3EA 3HUGA 5JLXA 5K5OA 4JK1X 4UUSA 4L9NA 2F2EA 1BBYA 1FX7A 1TW2A 3OYKA 1E2XA 2ME6A 1E3OC 5HLIA 1W0TA 2R7DA 3FK6A 4HLYA 2Y69H 4A3BJ 2EB7A 2K9MA 2ME0A 5M3MJ 3T0YA 4IRHA 3DU5A 3OOUA 3RCOA 3FF5A 3NRVA 1D3YA 4G12A 3CMEI 5DUIA 4CCOA 3BCBA 1I5ZA 1STZA 2FSWA 3FIWA 2GQQA 1KYZA 3TP3A 5GADJ 3G4SI 2XAJA 3HXLA 2PX9A 3J7ZI 3LSJA 2COBA 3RZOJ 1NTCA 3RTRA 4XKBA 4XKCA 3I58A 4EJWA 2FNPA 4GFBA 3LSGA 3W6JB 5TJJA 1ERDA 4RGXA 4WXDA 2F5CA 4DYRA 1VNDA 1VQKI 2PQ8A 2XPWA 3AG2H 3MZHA 3FMSA 1U78A 1J7KA 1MBKA 3B6AA 3G3ZA 3KE2A 4RM3A 3CMAI 5E20A 4U0VA 4PFOA 4BQNA 3BTLA 2PMZN 2F4IA 2VKHA 4ZJZA 4CGZA 1USSA 2EIKH 1RKTA 1MNDA 2CSOA 2EA2A 2QKLB 2J5OA 3I4NJ 2V9VA 1W7PB 2HVRA 2W25A 4PJNA 4FE7A 2IVMA 3G2BA 2HVQA 4PUSA 1PVEA 2P5KA 3JRAA 3DKWA 4BHPA 4CH7A 2NYXA 1R9TJ 5IT9Z 3FBIB 1FSEA 2F6CA 2L7KA 2MG4A 2EIJH 1KQ9A 1XDUA 3F0CA 2HYFA 2M8GX 2WB1A 2ZXWH 5J1UA 3SXYA 2NRAC 2VKEA 3FKJA 2K7LA 2EIMH 2A5WA 2LH9A 1GLNA 2KRFA 1QPIA 4U7DA 1BI1A 3LA2A 3CCJI 3IKVA 2EZIA 4TV7A 1GV2A 2R0QC 4E7JA 1TWAJ 2IA1A 5FD6A 1T2KA 5D5XB 4EEFG 2O0YA 3QPTA 4YFKF 2Q2EB 2Y31A 1D0YA 1MZBA 1S29A 2GOXB 4Y52J 5IYDJ 3DCFA 1RNLA 1SD5A 1D5YA 4O3MA 2ZCWA 3R6SA 1JXSA 1ETVA 5AONA 3U1KA 1WJBA 4HG2A 3BLYA 4YIFA 1BJAA 2M4KA 2JSPA 1K6YA 3JAMK 2LP0A 4N4NB 1VFCA 4M6VA 2JA2A 3G1LA 1B72B 1BOAA 2LNBA 2ZO4A 3HC7A 2IGOA 2FQ4A 1OJLA 2BE5F 1I3AA 5FKMA 5IT3A 4CCKA 3WTYC 3LOCA 2JVGA 3LSMA 1QVUA 3A0HC 4WF2A 1ITYA 5E8GA 1AOYA 4RAZA 1QVTA 1WCMJ 4MNUA 2N8GA 2D45A 3WTVC 3H3UA 3TDUC 3DLLF 1MJ9A 5GTIC 3PSFA 3L2UA 1CF7A 5E1WA 1XSVA 3BQZA 3OYIA 4G6TB 2STTA 1K78A 1AA7A 3IHUA 5FKLA 2YU3A 4F91B 2JWTA 2K3FA 3HOUJ 3TMOA 1R1TA 1EKEA 2K9NA 1I6XA 3RI4A 2XRLA 3OYAA 4RM2A 1YJ9I 2R7ZJ 4BY7J 1XMAA 1JE8A 4I0BA 3EYYA 1WQ2A 4FX0A 2CQQA 4IKFA 4UVCA 2G7HA 2OCCH 3W2VA 3GFIA 1BOBA 1LEAA 3GUDA 1SVOA 2ZMEA 1VI0A 2KZGA 3QYFA 3SZTA 5GAHJ 1XB4A 1FOXA 2PMUA 4X0GA 1SAXA 2LG4A 2AXTC 4J00A 3FMQA 4Y4RA 4Y33A 2A3SA 3EUHC 3HOYJ 3LQRA 3R0AA 2K5CA 1IN5A 4UUTA 2XASA 1A6QA 2KRCA 3U21A 5EG0B 1ACIA 1KU3A 4XRSA 3H5NA 3KFWX 4KT5C 3LQQA 1W7PD 1H89C 1YRNA 2PJRA 4BBSJ 2WA0A 5M5WJ 5EJCA 3IAS2 4ANJA 3CUQC 3J80Z 4G8XA 1WKMA 3Q0WA 1MSFC 2EV6A 4M6YA 3D0SA 2DN0A 4M9SA 2XF5A 4P5OA 1USTA 5J47A 1VQ4I 1WJCA 3FXMA 3A0BC 4ETSA 5C3EJ 2EZHA 4I7HA 2GA1A 4X1EA 4XLCA 4ESFA 1HF0A 3E0JB 5J3LA 2KIQA 3SJMA 2X6OA 1TNTA 2LSOA 3MN2A 1R22A 1IRXA 2VQGA 1BJZA 3ZQ7A 2L0KA 4Y3OA 5ED4A 2LBFA 2DU9A 5F08A 2DMTA 1KGSA 3V8JA 2DMNA 1WI9A 1Z3XA 1GV5A 2HQ5A 4AC0A 5AIQA 2L54A 2JT1A 3OYLA 2V9KA 3KZZA 4XSXF 2NOGA 3NWSA 3RJPA 3M8FA 4QTRA 2BHYA 1BI0A 2Y2ZA 1E0EA 1YIOA 1TLHB 2CG4A 2ZBKA 2RDPA 2FOWA 3DF8A 4WCGA 2QF7A 3TW6A 2PMHA 2O9LA 4A2UA 5LEJA 4ON0A 2WAQN 1QBJA 3G71I 4I01A 4XIDA 3IRQA 1QPMA 3NWTA 2K9SA 3HRUA 3O8GA 2LF7A 3CUQB 3RKWA 1I39A 1G59A 1QO0D 1QRYA 2VPLA 2DTZA 2KHMA 3GZNB 1X1CA 3S2DJ 4DYCA 4CSWA 1VQLI 1IN7A 4QPQA 1RZ4A 1OYWA 2LOOA 3BY6A 3CF2A 4XMYA 2P5LC 3KYCB 1SFOJ 1EA3A 4N0BA 4YFNF 4YIRX 3TL4X 2W24A 3H5RA 3HOTA 2JN6A 3W6KB 1KQ0A 4KN4X 1ZLKA 1B59A 4MTEA 3OMYA 2EILH 1MNMC 1QU3A 4EJUA 1NH3A 1IRZA 4G94A 2D1VA 1POGA 2QCOA 4OIOF 2KIFA 2GAUA 2HQNA 3BR5A 2JZYA 3ONQA 4I76A 3IH3A 5HDGA 5H6QA 3JRCA 3M1CA 4LG3A 1W5TA 3S3OA 4KIFA 1TTYA 1FPQA 4I6ZA 4L9TA 2VODA 3S3NA 2LFBA 5IP9J 3HRMA 1OR7A 2IXSA 3CP8A 1IXSB 2KIMA 4HZFA 1D1CA 2LTPA 1YITI 2AHQA 2BY1A 3R0JA 3DLAA 5IYCJ 2R93J 1FIAA 2GXGA 1D1BA 4HNTA 4HNUA 2FEZA 1RC9A 1JGSA 3WTZA 1EH7A 3GTJJ 3HTUA 1MBHA 2NOJB 3QPLA 2NNNA 1JKOC 1TWGJ 5CVJA 4J19A 3DTIA 2K4BA 2EFWA 2LKSA 5F6FA 4BGDA 4LGWA 1BC7C 3OYEA 2OAZA 2NVTJ 5FLMJ 2M2EA 3N4MA 4UNOA 5F1JA 3KIOA 2QSGX 4RLFA 3HOXJ 2HXOA 2W1OA 1HDPA 2M1BA 3BJOA 5E3MA 2BYVE 4ZC3A 2KDZA 3L9FA 5LFAA 1A5JA 3J81K 3MKWB 3HZJA 3K2ZA 1MJAA 1WJEA 2VKDA 4IEJA 1X1DA 3L2QA 4IZZA 3DBRB 3GFJA 4OIQF 4G6QA 1T33A 2DA5A 4NQWB 3VYTB 1XPXA 2FBHA 2LVSA 2A6TA 3EQLF 3FZVA 3ZMTA 2CYYA 3HKZA 2KJBA 1TT0A 2XDVA 1ZRCA 4E6KG 2HQAA 3DKYA 4W97A 1FT9A 3DXJF 1D8JA 2OA4A 4D9JA 2V9PA 3QYBA 4IHWA 5LHHA 1FYLA 3BR1A 2Q1ZB 3D5LA 2H8RA 4D0PA 1TC3C 3LSPA 1MD0A 5LBQA 3C2HA 1DQUA 2O03A 1XG1A 2P81A 4CO8A 2EFNA 3M8EA 4WXHA 3PL8A 1P4AA 1WH5A 5J6XA 1RR8C 3F8FA 1QHHD 1WJDA 4PFPA 3P7NA 2DYSH 2Z2SB 3E6BA 4GRIA
chains in the Genus database with same CATH topology
1O3RA 3FM5A 1R58A 1OKRA 3F22A 3KZYA 4KUMA 1MJBA 1DUXC 5J8FA 3SHFA 1MGTA 3JTHA 4G7HF 2NS0A 3L09A 2OQGA 1G3TA 3E5XA 4L18B 1DPUA 4ESBA 2DFIA 4Q4ZF 2MBFA 3KP5A 4LK0F 3WTTC 3GLXA 1U5TA 2J5PA 4HW0A 4PDKA 3DFGA 3HOSA 1XGMA 1U8RA 4CICA 4A0YA 2ADUA 1U6GA 4LMYA 4U0WA 4IVNA 1B9NA 3T1BA 1BIBA 2BEOA 1P92A 1LDJA 3FX3A 2V1UA 2K86A 1QQIA 2CQKA 4FT8A 4ASNA 3TDZC 3TGNA 4LFUA 3I53A 4OIPF 4OU0A 2V79A 5DUKA 3WGHA 3QU3A 5BQTA 4WXCA 3I5UA 1S8NA 3BWGA 2A5YB 1HSTA 2RN7A 3O6BB 5DDGA 1I27A 2O6GE 2X0LA 4LB6B 2CGPA 2DBBA 2VONA 3V4GA 5JVTA 2VBWA 2M5WA 4HF0A 1B4AA 2W85A 4EM2A 5D6EA 4UVAA 1UHWA 3P9CA 1W5SA 2IW5A 4IJAA 4BHBA 2K02A 1XSXA 3GFLA 1G3SA 2RVCA 1UFMA 2XKOA 4UVBA 2JTVA 3PFIA 3KETA 5D6FA 3K1PA 4EJVA 4G9YA 4AIHA 1F5TA 1L3LA 5CLSA 1XGOA 5J8CA 1RUNA 1PDNC 2HKOA 2L01A 4EJOA 2DPUA 3CLOA 4OOIA 1C0WA 4RGRA 4ZYHA 2YPRA 2VE9A 2UXNA 3F72A 3L7WA 3CO7C 1HW2A 2PBIA 4RB2C 5A2QZ 5DV5A 3FXQA 1IRFA 3REOA 2GZWA 2ZXJA 3AAFA 3ROUA 3TO6A 5DEQA 1TW3A 1TQMA 2QBYA 1ZYRF 2XIGA 2EA4A 2UXXA 2Z33A 3CTAA 5F1RA 3LFKA 5FLXK 2LF8A 3MZYA 2A68F 5JHUA 2ELHA 3E5QA 1X3UA 1SMYF 3EYIA 3WTWC 2V1XA 2A69F 1UCRA 2YX7A 3M1EA 2EFQA 4I2OA 1CF7B 5LHGA 4S04A 4GYGA 3N97A 5L3GA 1ZG1A 3ZMVA 5D5UB 4EM1A 2VT2A 3V7SA 1K79A 3HTSB 1HSJA 2Z99A 2IJLA 1D8KA 3JW4A 2Y0MA 3C18A 4WK8F 3K1NA 1EH8A 3GZ6A 3F6OA 3RYRA 5LHIA 2ZNYA 3K9TA 3ABUA 4EJTA 4KIBA 1HW5A 3GX4X 5L3CA 1WSUA 2NAZA 5D4SA 3F3XA 2BGCA 1D5VA 4Y17A 3EETA 1ZRDA 3RPQA 4FHTA 1S3JA 4LLGF 2FE3A 1YTYA 1IXRC 5FD5A 2EWNA 4OMYA 2KIUA 4B8XA 3F23A 1HKSA 5L3FA 2XHKA 1BN5A 4LG0A 3CDHA 1R5GA 4KIGA 4ZZDA 2DAOA 2EK5A 1R23A 2Y75A 2RNJA 1LDKB 4ZYGA 1KQ8A 1ZRFA 3T8TA 4KFCA 1SD4A 3VFZA 2B0LA 2Z9OA 2IP2A 4O5VA 4O6JA 1QZZA 4HYEA 2GIVA 4Y13A 5DCFA 5D8KB 1LVAA 5BPIA 3VOEA 2H27A 3NEUA 4HAMA 3FM3A 3FXRA 2DK8A 1MKMA 4DNCA 2RV8A 4IHTA 3ULQB 2FA5A 2QM3A 3VEPA 3GEZA 1ON1A 3FHZA 3WGGA 1I1SA 4KN7X 2P6TA 3K69A 2W84A 3E3VA 4HF2A 2XROA 3RPUA 1XD7A 4GYIA 2QQBA 3PQKA 1G6NA 1BIAA 1G3WA 4EMSA 1XGSA 2DTRA 5K1YA 3QAHA 1HKTA 2JRTA 3K1MA 3BPXA 4BH9A 3FXUA 4ENJA 3ZN1A 1SD7A 4G7ZF 2F5DA 3LAJA 3WU0A 5HS8A 3LAPA 2QQAA 4PGHA 4XSZF 1REPC 1R7JA 5CJ9A 3U1DA 2PEXA 1HBXG 5ICFA 3SFZA 4RB3C 1MDMA 4QWQA 5D4RA 2D2WA 1U5TC 5CVUA 4B09A 5BOXA 4HLXA 3WTXC 4PGGA 1DPRA 1ZHFA 3BPVA 4A6EA 5ERIA 4AWXB 3HSEA 2H09A 4R1HA 2XGXA 2XAGA 2MH9A 4XLPF 4GXOA 4LD5A 4HDVA 1FY7A 3MAJA 4WX9A 5LRRA 2ZKZA 2P5VA 2WTEA 2TDXA 1FLIA 2VOPA 3R61A 2E7WA 1XDSA 3JAMZ 2D1HA 5D5WB 3HRTA 4L9JA 1VTNC 1HW1A 3FMRA 1IAWA 3C3WA 4Q5SF 4HF1A 1BI2A 1FYMA 1U5TB 3C7JA 4YG2F 2QVOA 2W57A 4OIRF 1LNWA 3KP6A 1B9MA 5DCMA 4ENKA 3GXOA 3F8NA 3BROA 4ESJA 2KKOA 5HS9A 5EEGA 1U3EM 5FB2A 1TQPA 2HEOA 5BMZA 1T98A 3EDPA 3CJNA 5BS6A 2HYGD 4I09A 4JBAA 1JHHA 2IA2A 4A0XA 1O3TA 1PP7U 2VBYA 2DO7A 2VE8A 3V8LA 4KA4A 4L0YB 2LDUA 5L3BA 3E6DA 3TKYA 3WTSC 2PJPA 4A12A 1GXQA 2AS5F 2EFPA 2F5EA 3RIRA 2CW0F 4UHTA 5LEKA 2P7VB 2H94A 2XKPA 2XUBA 4MEXF 2KJCA 2CFXA 3HHGA 4L5IA 2VC1A 2XAHA 4HOBA 2M45A 5TRDA 2O8XA 3KP2A 4ZH4F 2FNAA 3GFMA 3BOQA 2IT0A 4BQAA 3KEOA 2E1NA 5E1ZB 1R36A 3KLOA 1QNTA 4IPAA 3COAC 2ETHA 1H9TA 1ONVA 2STWA 4EM0B 3TO7A 3MCZA 2QBYB 2H6BA 4EGYA 2HQRA 2ESNA 2L4MA 1H0MA 2P6SA 3BDDA 2MH2A 2IRFG 1YW8A 1YG2A 2GWRA 3M9AA 3U9GA 1GHCA 1R5HA 2EJRA 4LLNA 3Q9VA 2DPDA 1IN4A 4IRIA 2H6CA 3TOAA 4Y15A 1U2WA 3RDIA 4GGGA 3EUHA 1YW9A 1LJ9A 1B6AA 2ZNZA 2QZ8A 3F8MA 2QWWA 3O3KA 1YW7A 3E6CC 3CUQA 4CDGA 1IF1A 1V3FA 4GCVA 2FBIA 1P4XA 1Z9CA 1YYVA 3J81Z 3BJ6A 4CYDA 2RQPA 2MC3A 3SZPA 1Z05A 1SFXA 4A5NA 1SFUA 2WWYA 1XGNA 4HDUA 3F6VA 1P2FA 3VB2A 4MTDA 1IN6A 4P9FA 1BI3A 2RGVA 2VC0A 2L3DA 3ZP5A 3P9IA 1ODDA 4DQ2A 4HX4A 1TNSA 4RGUA 2MD5A 2HTSA 1IUYA 2A6HF 3IRRA 3J7AO 1EH6A 2A6EF 4MEYF 3M7GA 5CVVA 1T39A 1IZ1A 2DLLA 2IA0A 5E17F 4YIIA 2A07F 3R60A 3WODF 2L02A 2ACJA 4M72A 3B73A 3PQJA 2WV0A 2Z5UA 5HOOA 1K7AA 4KDPA 2QENA 1KU2A 3ISPA 2OBPA 1T6SA 3ECHA 1UB9A 1Z91A 4AVPA 3LWFA 4NQWA 2OZ6A 3U2RA 1ZG5A 1J75A 1B1BA 2O61A 4AIJA 3HIFA 2HR3A 1GVJA 4A5MA 5E1XA 3MFKA 3ELKA 2BV6A 3S2WA 4MQ9F 3IL2A 1ZREA 1K78B 1Z6RA 1F1ZA 4BNCA 1T0FA 3IWFA 3QP5A 2FMYA 3V8KA 1SD6A 4KNYA 2Y48A 1S7OA 2COMA 4M6XA 3JTGA 4HX7A 4UV8A 2ZMEB 3KCCA 5K5RA 3ZMDA 3ABTA 2FBKA 2HFHA 1WWXA 4WWCA 5EEHA 1J59A 4P55A 1MDMB 2C6YA 1O3QA 2IPQX 3P9KA 4M73A 2M8EA 4BAYA 3LA3A 4RB1A 3MEXA 1DP7P 2HZTA 1O7LA 4Z2YA 3TOBA 3V7CA 2F5FA 1S6LA 3WE3A 3FWEA 3GW2A 3GZ5A 3KEQA 4PZJA 3WE2A 1FZPB 2HKXA 2M30A 2ISYA 4IHSA 4I0AA 4L0ZB 1A04A 1XCVA 1LB2A 5FLXZ 3ZN0A 1DDNA 4KYWA 2K4JA 1J2XA 1RIOH 1FSHA 1P6RA 5LGUA 3OOPA 3I59A 3G73A 1HKQA 4GO1A 2AXLA 4KICA 3T5XA 4HQMA 1FNNA 2Q0OA 2JPCA 4BHCA 5DCMB 1K6OA 3H3ZA 3TQNA 3HSFA 3SQNA 2FF4A 2V1DA 3WTUC 3O2PE 2DT5A 2XAFA 4XBFA 4ENMA 2Q8KA 3J80K 1AWCA 5ILVA 4U7BA 1PUEE 4MHGA 1JHFA 4BYYA 1Y0UA 4XLNF 2E1CA 2R3SA 2JSCA 4ENNA 4HV5A 2CO5A 3I64A 2QLZA 4BXUA 3ML6A 1YO5C 3GO5A 4Q48A 2G7UA 1SFEA 4UV9A 1Z1DA 3MWMA 3E5UA 1NHAA 1KU7A 2OU2A 2X4HA 2YSRA 4L9VA 2FMLA 4IF4A 2VXZA 3L2CA 4N9IA 1SMTA 1O3SA 1ZN2A 4U88A 5CYVA 4R8HA 2MLGA 4I98B 5HS7A 5ICGA 5ILUA 2UZKA 1FP2A 1YS6A 1G3YA 2RC4A 5FFXA 1J5YA 3IKTA 2VOOA 2QYOA 2OQRA 4AIKA 1ZGJA 3F8CA 1BM9A 3JSOA 3DPLC 2PI0A 1I1GA 3LA7A 5AIPA 1KA8A 2OZUA 4KMUX 3I71A 4RB0A 2HGCA 2DQLA 2R7FA 2FXAA 4M9ZA 4NHJA 1FWZA 1RI7A 2M87A 2XVCA 4CXFA 1FBUA 1YQAA 5KVRA 3V7RA 2DW4A 1ZGAA 2G9WA 4IRGA 4H0EA 3DV8A 1GXPA 1ON2A 2P4WA 3GF2A 5DD8A 1R1VA 2XV4S 4G6DA 2VBXA 1O7FA 4JQFA 1W7PA 4F7ZA 4U0YA 3ERED 3B02A 3I0TA 3VODA 5HDNA 2CWEA 5LRSA 1T38A 1J0RA 4IXAA 2HOEA 2DQRA 1TBXA 2ZJ2A 4K2EA 2LKPA 5E8IA 2DK5A 2GXBA 4N9HA 1J9IA 2PN6A 1OPCA 4LK1F 2HTJA 1FBSA 2Q2EA 2FQ3A 5KK1A 3BJAA 1Q1HA 3Q9SA 5CVIA 3GWZA 3JSPA 2P8TA 1OMIA 1Z6TA 3KP4A 5D5VB 5LGTA 1KYWA 4CZZA 3T8RA 4EGZA 2BBYA 4HBLA 6PAXA 5HVQC 4ZYEA 4S05A 3R4KA 1LQ1A 1WRJA 3E6MA 3E97A 1QGPA 1S7AA 5HLGA 1O57A 4ZYDA 3ZMSA 4LLLA 3KP7A 3QPHA 1CGPA 5CVRA 1OYYA 1R00A 1P4WA 1ZAOA 4M74A 3CO6C 3GVAA 2Z3YA 4R79A 2HWVA 2K27A 1IXCA 5BPDA 3HHHA 5FO5A 1F4KA 1EV7A 3F21A 1FC3A 1YLFA 1BC8C 4M9XA 3KP3A 5JR3A 4YFXF 2PG4A 3QRFF 3ECOA 5F64A 1XCBA 3K0LA 4L5JA 1H9GA 5DD4A 2L4AA 3HYIA 1FOKA 2FU4A 2UWMA 5DYMA 2FRHA 1OYIA 1RUOA 5E18F 4E70A 2HDCA 5L3DA 1Z7UA 1QZYA 3IC7A 3DEUA 2V6CA 2QUFA 5HDKA 2VT3A 2P7CB 3DP7A 5K5QA 4UXNA 2HS5A 2JPBA 3ZMZA 4HV6A 5H20A 1FYKA 5A2QK 4QLCU 1KU9A 4ZZLA 4P9UA 3ZPLA 4EV0A 3ZMUA 3RKYA 5LLQA 3OV8A 2ZFWA 2ISZA 4A6DA 1IN8A 2PLYA 4XRFA 3DPTA 4G7OF 1HQCA 4LJZF 1UHMA 4HX8A 4Q47A 4RGSA 2YX4A 2ESHA 3WG9A 4HQEA 1LEBA 4OINF 2WC2A 1XN7A 3KLNA 1HXDA 4LG0B 3HSRA 1YS7A 3TO9A 4EVIA 4I02A 4NB5A 1ULYA 3H92A 5D8LB 4EQQA 4MQVA 3MQ0A 1F9NA 2EV5A 1TQIA 2FOKA 5JFRA 3BZ6A 3I59B 3NQOA 3WGIA 4PCQA 4CHUA 3CUOA 1E17A 2XRNA 3Q5FA 1IRGA 5LGNA 2GA2A 2E7XA 1ZLJA 3GYHX 2QQ9A 5H6RA 4UUVA 4HA8A 2XAQA 1R1UA 4LB5A 5JI6A 1ZG3A 3IWZA 2EFOA 1IW7F 2NNYA 3DQVC 3WU1B 3QU6A 1G4DA 1FBQA 4A0ZA 5HLHA 2MLKA 3RYPA 1FP1D 5ICCA 3LSTA 2YR2A 1XMKA 4FX4A 1ZARA 5ILSA 4RAYA 1PP8F 2VBZA 2PFBA 3I54A 3C1DA 3QOPA 1YFHA 5IT9K 2EV0A 2RKHA 3F8BA 2A61A 4OMZA 2O3FA 3RKXA 1L0OC 4P96A 3QP6A 2OD5A 3I4PA 1ZH5A 1LDDA 2MA3A 5FFZA 3L00A 5FGMA 2DI3A 2VN2A 4RS8A 4AD9A 3BP8A 3HRSA 1XSDA 4MGRA 5ICEA 1V4RA 4M71A 4KMFA 1W4MA 5L3EA 3HUGA 5K5OA 4JK1X 4L9NA 2F2EA 1BBYA 1FX7A 1TW2A 1E2XA 5HLIA 2R7DA 4HLYA 2EB7A 3T0YA 4IRHA 3FF5A 3NRVA 1D3YA 5DUIA 1I5ZA 1STZA 2FSWA 2GQQA 1KYZA 2XAJA 3RTRA 3I58A 4EJWA 2FNPA 3W6JB 5TJJA 4RGXA 4WXDA 2F5CA 2PQ8A 3MZHA 3FMSA 1U78A 1J7KA 3G3ZA 3KE2A 5E20A 4U0VA 4CGZA 1USSA 2CSOA 2EA2A 2J5OA 2V9VA 1W7PB 2W25A 2IVMA 2P5KA 3DKWA 4BHPA 2NYXA 5IT9Z 1FSEA 1KQ9A 1XDUA 2HYFA 3SXYA 2NRAC 2K7LA 2KRFA 4U7DA 1BI1A 3LA2A 3IKVA 4TV7A 2IA1A 5FD6A 1T2KA 5D5XB 2O0YA 3QPTA 4YFKF 1MZBA 1S29A 1RNLA 1SD5A 4O3MA 2ZCWA 3R6SA 1JXSA 5AONA 4YIFA 1BJAA 3JAMK 1BOAA 2LNBA 2ZO4A 2BE5F 5IT3A 3WTYC 4WF2A 5E8GA 1AOYA 4RAZA 4MNUA 2D45A 3WTVC 3H3UA 3TDUC 1MJ9A 1CF7A 5E1WA 1XSVA 2STTA 1K78A 3IHUA 2YU3A 1R1TA 1I6XA 3RI4A 1XMAA 1JE8A 4I0BA 3EYYA 1WQ2A 4FX0A 4UVCA 2G7HA 3GFIA 1LEAA 3GUDA 2ZMEA 3SZTA 1XB4A 2PMUA 1SAXA 3FMQA 2A3SA 3LQRA 3R0AA 1IN5A 2XASA 1KU3A 3KFWX 4KT5C 3LQQA 1W7PD 3J80Z 3CUQC 4G8XA 1WKMA 2EV6A 4M6YA 3D0SA 4M9SA 4P5OA 1USTA 4ETSA 4I7HA 2GA1A 4ESFA 1TNTA 2LSOA 1R22A 3ZQ7A 5ED4A 2DU9A 1KGSA 3V8JA 1WI9A 5AIQA 2L54A 2JT1A 3KZZA 4XSXF 3RJPA 3M8FA 1BI0A 1YIOA 1TLHB 2CG4A 2ZBKA 2RDPA 3DF8A 4WCGA 2PMHA 4A2UA 5LEJA 4ON0A 1QBJA 4I01A 3IRQA 1QPMA 3HRUA 2LF7A 3CUQB 3RKWA 1QO0D 1IN7A 1OYWA 1RZ4A 3BY6A 2P5LC 4N0BA 4YFNF 2W24A 3HOTA 3W6KB 1KQ0A 4KN4X 1ZLKA 1B59A 4MTEA 4EJUA 4G94A 2D1VA 4OIOF 2KIFA 2GAUA 2HQNA 2JZYA 5HDGA 5H6QA 1W5TA 4KIFA 1TTYA 1FPQA 4L9TA 2VODA 3HRMA 1OR7A 1IXSB 2KIMA 4HZFA 3R0JA 2GXGA 2FEZA 1JGSA 3WTZA 1EH7A 3HTUA 2NNNA 5CVJA 2K4BA 2EFWA 5F6FA 4LGWA 1BC7C 2OAZA 3N4MA 4UNOA 2M1BA 3BJOA 2BYVE 3L9FA 3J81K 3K2ZA 1MJAA 3GFJA 4OIQF 4G6QA 2FBHA 3ZMTA 3EQLF 3FZVA 2CYYA 2KJBA 1ZRCA 1FT9A 3DXJF 1D8JA 2OA4A 5LHHA 1FYLA 3D5LA 4D0PA 1MD0A 5LBQA 2O03A 4CO8A 2EFNA 3M8EA 4WXHA 1P4AA 5J6XA 3F8FA 3P7NA 3E6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3R A;  3FM5 A;  1R58 A;  1OKR A;  3F22 A;  3KZY A;  4KUM A;  1MJB A;  1DUX C;  5J8F A;  3SHF A;  1MGT A;  3JTH A;  4G7H F;  2NS0 A;  3L09 A;  2OQG A;  1G3T A;  3E5X A;  4L18 B;  1DPU A;  4ESB A;  2DFI A;  4Q4Z F;  2MBF A;  3KP5 A;  4LK0 F;  3WTT C;  3GLX A;  1U5T A;  2J5P A;  4HW0 A;  4PDK A;  3DFG A;  3HOS A;  1XGM A;  1U8R A;  4CIC A;  4A0Y A;  2ADU A;  1U6G A;  4LMY A;  4U0W A;  4IVN A;  1B9N A;  3T1B A;  1BIB A;  2BEO A;  1P92 A;  1LDJ A;  3FX3 A;  2V1U A;  2K86 A;  1QQI A;  2CQK A;  4FT8 A;  4ASN A;  3TDZ C;  3TGN A;  4LFU A;  3I53 A;  4OIP F;  4OU0 A;  2V79 A;  5DUK A;  3WGH A;  3QU3 A;  5BQT A;  4WXC A;  3I5U A;  1S8N A;  3BWG A;  2A5Y B;  1HST A;  2RN7 A;  3O6B B;  5DDG A;  1I27 A;  2O6G E;  2X0L A;  4LB6 B;  2CGP A;  2DBB A;  2VON A;  3V4G A;  5JVT A;  2VBW A;  2M5W A;  4HF0 A;  1B4A A;  2W85 A;  4EM2 A;  5D6E A;  4UVA A;  1UHW A;  3P9C A;  1W5S A;  2IW5 A;  4IJA A;  4BHB A;  2K02 A;  1XSX A;  3GFL A;  1G3S A;  2RVC A;  1UFM A;  2XKO A;  4UVB A;  2JTV A;  3PFI A;  3KET A;  5D6F A;  3K1P A;  4EJV A;  4G9Y A;  4AIH A;  1F5T A;  1L3L A;  5CLS A;  1XGO A;  5J8C A;  1RUN A;  1PDN C;  2HKO A;  2L01 A;  4EJO A;  2DPU A;  3CLO A;  4OOI A;  1C0W A;  4RGR A;  4ZYH A;  2YPR A;  2VE9 A;  2UXN A;  3F72 A;  3L7W A;  3CO7 C;  1HW2 A;  2PBI A;  4RB2 C;  5A2Q Z;  5DV5 A;  3FXQ A;  1IRF A;  3REO A;  2GZW A;  2ZXJ A;  3AAF A;  3ROU A;  3TO6 A;  5DEQ A;  1TW3 A;  1TQM A;  2QBY A;  1ZYR F;  2XIG A;  2EA4 A;  2UXX A;  2Z33 A;  3CTA A;  5F1R A;  3LFK A;  5FLX K;  2LF8 A;  3MZY A;  2A68 F;  5JHU A;  2ELH A;  3E5Q A;  1X3U A;  1SMY F;  3EYI A;  3WTW C;  2V1X A;  2A69 F;  1UCR A;  2YX7 A;  3M1E A;  2EFQ A;  4I2O A;  1CF7 B;  5LHG A;  4S04 A;  4GYG A;  3N97 A;  5L3G A;  1ZG1 A;  3ZMV A;  5D5U B;  4EM1 A;  2VT2 A;  3V7S A;  1K79 A;  3HTS B;  1HSJ A;  2Z99 A;  2IJL A;  1D8K A;  3JW4 A;  2Y0M A;  3C18 A;  4WK8 F;  3K1N A;  1EH8 A;  3GZ6 A;  3F6O A;  3RYR A;  5LHI A;  2ZNY A;  3K9T A;  3ABU A;  4EJT A;  4KIB A;  1HW5 A;  3GX4 X;  5L3C A;  1WSU A;  2NAZ A;  5D4S A;  3F3X A;  2BGC A;  1D5V A;  4Y17 A;  3EET A;  1ZRD A;  3RPQ A;  4FHT A;  1S3J A;  4LLG F;  2FE3 A;  1YTY A;  1IXR C;  5FD5 A;  2EWN A;  4OMY A;  2KIU A;  4B8X A;  3F23 A;  1HKS A;  5L3F A;  2XHK A;  1BN5 A;  4LG0 A;  3CDH A;  1R5G A;  4KIG A;  4ZZD A;  2DAO A;  2EK5 A;  1R23 A;  2Y75 A;  2RNJ A;  1LDK B;  4ZYG A;  1KQ8 A;  1ZRF A;  3T8T A;  4KFC A;  1SD4 A;  3VFZ A;  2B0L A;  2Z9O A;  2IP2 A;  4O5V A;  4O6J A;  1QZZ A;  4HYE A;  2GIV A;  4Y13 A;  5DCF A;  5D8K B;  1LVA A;  5BPI A;  3VOE A;  2H27 A;  3NEU A;  4HAM A;  3FM3 A;  3FXR A;  2DK8 A;  1MKM A;  4DNC A;  2RV8 A;  4IHT A;  3ULQ B;  2FA5 A;  2QM3 A;  3VEP A;  3GEZ A;  1ON1 A;  3FHZ A;  3WGG A;  1I1S A;  4KN7 X;  2P6T A;  3K69 A;  2W84 A;  3E3V A;  4HF2 A;  2XRO A;  3RPU A;  1XD7 A;  4GYI A;  2QQB A;  3PQK A;  1G6N A;  1BIA A;  1G3W A;  4EMS A;  1XGS A;  2DTR A;  5K1Y A;  3QAH A;  1HKT A;  2JRT A;  3K1M A;  3BPX A;  4BH9 A;  3FXU A;  4ENJ A;  3ZN1 A;  1SD7 A;  4G7Z F;  2F5D A;  3LAJ A;  3WU0 A;  5HS8 A;  3LAP A;  2QQA A;  4PGH A;  4XSZ F;  1REP C;  1R7J A;  5CJ9 A;  3U1D A;  2PEX A;  1HBX G;  5ICF A;  3SFZ A;  4RB3 C;  1MDM A;  4QWQ A;  5D4R A;  2D2W A;  1U5T C;  5CVU A;  4B09 A;  5BOX A;  4HLX A;  3WTX C;  4PGG A;  1DPR A;  1ZHF A;  3BPV A;  4A6E A;  5ERI A;  4AWX B;  3HSE A;  2H09 A;  4R1H A;  2XGX A;  2XAG A;  2MH9 A;  4XLP F;  4GXO A;  4LD5 A;  4HDV A;  1FY7 A;  3MAJ A;  4WX9 A;  5LRR A;  2ZKZ A;  2P5V A;  2WTE A;  2TDX A;  1FLI A;  2VOP A;  3R61 A;  2E7W A;  1XDS A;  3JAM Z;  2D1H A;  5D5W B;  3HRT A;  4L9J A;  1VTN C;  1HW1 A;  3FMR A;  1IAW A;  3C3W A;  4Q5S F;  4HF1 A;  1BI2 A;  1FYM A;  1U5T B;  3C7J A;  4YG2 F;  2QVO A;  2W57 A;  4OIR F;  1LNW A;  3KP6 A;  1B9M A;  5DCM A;  4ENK A;  3GXO A;  3F8N A;  3BRO A;  4ESJ A;  2KKO A;  5HS9 A;  5EEG A;  1U3E M;  5FB2 A;  1TQP A;  2HEO A;  5BMZ A;  1T98 A;  3EDP A;  3CJN A;  5BS6 A;  2HYG D;  4I09 A;  4JBA A;  1JHH A;  2IA2 A;  4A0X A;  1O3T A;  1PP7 U;  2VBY A;  2DO7 A;  2VE8 A;  3V8L A;  4KA4 A;  4L0Y B;  2LDU A;  5L3B A;  3E6D A;  3TKY A;  3WTS C;  2PJP A;  4A12 A;  1GXQ A;  2AS5 F;  2EFP A;  2F5E A;  3RIR A;  2CW0 F;  4UHT A;  5LEK A;  2P7V B;  2H94 A;  2XKP A;  2XUB A;  4MEX F;  2KJC A;  2CFX A;  3HHG A;  4L5I A;  2VC1 A;  2XAH A;  4HOB A;  2M45 A;  5TRD A;  2O8X A;  3KP2 A;  4ZH4 F;  2FNA A;  3GFM A;  3BOQ A;  2IT0 A;  4BQA A;  3KEO A;  2E1N A;  5E1Z B;  1R36 A;  3KLO A;  1QNT A;  4IPA A;  3COA C;  2ETH A;  1H9T A;  1ONV A;  2STW A;  4EM0 B;  3TO7 A;  3MCZ A;  2QBY B;  2H6B A;  4EGY A;  2HQR A;  2ESN A;  2L4M A;  1H0M A;  2P6S A;  3BDD A;  2MH2 A;  2IRF G;  1YW8 A;  1YG2 A;  2GWR A;  3M9A A;  3U9G A;  1GHC A;  1R5H A;  2EJR A;  4LLN A;  3Q9V A;  2DPD A;  1IN4 A;  4IRI A;  2H6C A;  3TOA A;  4Y15 A;  1U2W A;  3RDI A;  4GGG A;  3EUH A;  1YW9 A;  1LJ9 A;  1B6A A;  2ZNZ A;  2QZ8 A;  3F8M A;  2QWW A;  3O3K A;  1YW7 A;  3E6C C;  3CUQ A;  4CDG A;  1IF1 A;  1V3F A;  4GCV A;  2FBI A;  1P4X A;  1Z9C A;  1YYV A;  3J81 Z;  3BJ6 A;  4CYD A;  2RQP A;  2MC3 A;  3SZP A;  1Z05 A;  1SFX A;  4A5N A;  1SFU A;  2WWY A;  1XGN A;  4HDU A;  3F6V A;  1P2F A;  3VB2 A;  4MTD A;  1IN6 A;  4P9F A;  1BI3 A;  2RGV A;  2VC0 A;  2L3D A;  3ZP5 A;  3P9I A;  1ODD A;  4DQ2 A;  4HX4 A;  1TNS A;  4RGU A;  2MD5 A;  2HTS A;  1IUY A;  2A6H F;  3IRR A;  3J7A O;  1EH6 A;  2A6E F;  4MEY F;  3M7G A;  5CVV A;  1T39 A;  1IZ1 A;  2DLL A;  2IA0 A;  5E17 F;  4YII A;  2A07 F;  3R60 A;  3WOD F;  2L02 A;  2ACJ A;  4M72 A;  3B73 A;  3PQJ A;  2WV0 A;  2Z5U A;  5HOO A;  1K7A A;  4KDP A;  2QEN A;  1KU2 A;  3ISP A;  2OBP A;  1T6S A;  3ECH A;  1UB9 A;  1Z91 A;  4AVP A;  3LWF A;  4NQW A;  2OZ6 A;  3U2R A;  1ZG5 A;  1J75 A;  1B1B A;  2O61 A;  4AIJ A;  3HIF A;  2HR3 A;  1GVJ A;  4A5M A;  5E1X A;  3MFK A;  3ELK A;  2BV6 A;  3S2W A;  4MQ9 F;  3IL2 A;  1ZRE A;  1K78 B;  1Z6R A;  1F1Z A;  4BNC A;  1T0F A;  3IWF A;  3QP5 A;  2FMY A;  3V8K A;  1SD6 A;  4KNY A;  2Y48 A;  1S7O A;  2COM A;  4M6X A;  3JTG A;  4HX7 A;  4UV8 A;  2ZME B;  3KCC A;  5K5R A;  3ZMD A;  3ABT A;  2FBK A;  2HFH A;  1WWX A;  4WWC A;  5EEH A;  1J59 A;  4P55 A;  1MDM B;  2C6Y A;  1O3Q A;  2IPQ X;  3P9K A;  4M73 A;  2M8E A;  4BAY A;  3LA3 A;  4RB1 A;  3MEX A;  1DP7 P;  2HZT A;  1O7L A;  4Z2Y A;  3TOB A;  3V7C A;  2F5F A;  1S6L A;  3WE3 A;  3FWE A;  3GW2 A;  3GZ5 A;  3KEQ A;  4PZJ A;  3WE2 A;  1FZP B;  2HKX A;  2M30 A;  2ISY A;  4IHS A;  4I0A A;  4L0Z B;  1A04 A;  1XCV A;  1LB2 A;  5FLX Z;  3ZN0 A;  1DDN A;  4KYW A;  2K4J A;  1J2X A;  1RIO H;  1FSH A;  1P6R A;  5LGU A;  3OOP A;  3I59 A;  3G73 A;  1HKQ A;  4GO1 A;  2AXL A;  4KIC A;  3T5X A;  4HQM A;  1FNN A;  2Q0O A;  2JPC A;  4BHC A;  5DCM B;  1K6O A;  3H3Z A;  3TQN A;  3HSF A;  3SQN A;  2FF4 A;  2V1D A;  3WTU C;  3O2P E;  2DT5 A;  2XAF A;  4XBF A;  4ENM A;  2Q8K A;  3J80 K;  1AWC A;  5ILV A;  4U7B A;  1PUE E;  4MHG A;  1JHF A;  4BYY A;  1Y0U A;  4XLN F;  2E1C A;  2R3S A;  2JSC A;  4ENN A;  4HV5 A;  2CO5 A;  3I64 A;  2QLZ A;  4BXU A;  3ML6 A;  1YO5 C;  3GO5 A;  4Q48 A;  2G7U A;  1SFE A;  4UV9 A;  1Z1D A;  3MWM A;  3E5U A;  1NHA A;  1KU7 A;  2OU2 A;  2X4H A;  2YSR A;  4L9V A;  2FML A;  4IF4 A;  2VXZ A;  3L2C A;  4N9I A;  1SMT A;  1O3S A;  1ZN2 A;  4U88 A;  5CYV A;  4R8H A;  2MLG A;  4I98 B;  5HS7 A;  5ICG A;  5ILU A;  2UZK A;  1FP2 A;  1YS6 A;  1G3Y A;  2RC4 A;  5FFX A;  1J5Y A;  3IKT A;  2VOO A;  2QYO A;  2OQR A;  4AIK A;  1ZGJ A;  3F8C A;  1BM9 A;  3JSO A;  3DPL C;  2PI0 A;  1I1G A;  3LA7 A;  5AIP A;  1KA8 A;  2OZU A;  4KMU X;  3I71 A;  4RB0 A;  2HGC A;  2DQL A;  2R7F A;  2FXA A;  4M9Z A;  4NHJ A;  1FWZ A;  1RI7 A;  2M87 A;  2XVC A;  4CXF A;  1FBU A;  1YQA A;  5KVR A;  3V7R A;  2DW4 A;  1ZGA A;  2G9W A;  4IRG A;  4H0E A;  3DV8 A;  1GXP A;  1ON2 A;  2P4W A;  3GF2 A;  5DD8 A;  1R1V A;  2XV4 S;  4G6D A;  2VBX A;  1O7F A;  4JQF A;  1W7P A;  4F7Z A;  4U0Y A;  3ERE D;  3B02 A;  3I0T A;  3VOD A;  5HDN A;  2CWE A;  5LRS A;  1T38 A;  1J0R A;  4IXA A;  2HOE A;  2DQR A;  1TBX A;  2ZJ2 A;  4K2E A;  2LKP A;  5E8I A;  2DK5 A;  2GXB A;  4N9H A;  1J9I A;  2PN6 A;  1OPC A;  4LK1 F;  2HTJ A;  1FBS A;  2Q2E A;  2FQ3 A;  5KK1 A;  3BJA A;  1Q1H A;  3Q9S A;  5CVI A;  3GWZ A;  3JSP A;  2P8T A;  1OMI A;  1Z6T A;  3KP4 A;  5D5V B;  5LGT A;  1KYW A;  4CZZ A;  3T8R A;  4EGZ A;  2BBY A;  4HBL A;  6PAX A;  5HVQ C;  4ZYE A;  4S05 A;  3R4K A;  1LQ1 A;  1WRJ A;  3E6M A;  3E97 A;  1QGP A;  1S7A A;  5HLG A;  1O57 A;  4ZYD A;  3ZMS A;  4LLL A;  3KP7 A;  3QPH A;  1CGP A;  5CVR A;  1OYY A;  1R00 A;  1P4W A;  1ZAO A;  4M74 A;  3CO6 C;  3GVA A;  2Z3Y A;  4R79 A;  2HWV A;  2K27 A;  1IXC A;  5BPD A;  3HHH A;  5FO5 A;  1F4K A;  1EV7 A;  3F21 A;  1FC3 A;  1YLF A;  1BC8 C;  4M9X A;  3KP3 A;  5JR3 A;  4YFX F;  2PG4 A;  3QRF F;  3ECO A;  5F64 A;  1XCB A;  3K0L A;  4L5J A;  1H9G A;  5DD4 A;  2L4A A;  3HYI A;  1FOK A;  2FU4 A;  2UWM A;  5DYM A;  2FRH A;  1OYI A;  1RUO A;  5E18 F;  4E70 A;  2HDC A;  5L3D A;  1Z7U A;  1QZY A;  3IC7 A;  3DEU A;  2V6C A;  2QUF A;  5HDK A;  2VT3 A;  2P7C B;  3DP7 A;  5K5Q A;  4UXN A;  2HS5 A;  2JPB A;  3ZMZ A;  4HV6 A;  5H20 A;  1FYK A;  5A2Q K;  4QLC U;  1KU9 A;  4ZZL A;  4P9U A;  3ZPL A;  4EV0 A;  3ZMU A;  3RKY A;  5LLQ A;  3OV8 A;  2ZFW A;  2ISZ A;  4A6D A;  1IN8 A;  2PLY A;  4XRF A;  3DPT A;  4G7O F;  1HQC A;  4LJZ F;  1UHM A;  4HX8 A;  4Q47 A;  4RGS A;  2YX4 A;  2ESH A;  3WG9 A;  4HQE A;  1LEB A;  4OIN F;  2WC2 A;  1XN7 A;  3KLN A;  1HXD A;  4LG0 B;  3HSR A;  1YS7 A;  3TO9 A;  4EVI A;  4I02 A;  4NB5 A;  1ULY A;  3H92 A;  5D8L B;  4EQQ A;  4MQV A;  3MQ0 A;  1F9N A;  2EV5 A;  1TQI A;  2FOK A;  5JFR A;  3BZ6 A;  3I59 B;  3NQO A;  3WGI A;  4PCQ A;  4CHU A;  3CUO A;  1E17 A;  2XRN A;  3Q5F A;  1IRG A;  5LGN A;  2GA2 A;  2E7X A;  1ZLJ A;  3GYH X;  2QQ9 A;  5H6R A;  4UUV A;  4HA8 A;  2XAQ A;  1R1U A;  4LB5 A;  5JI6 A;  1ZG3 A;  3IWZ A;  2EFO A;  1IW7 F;  2NNY A;  3DQV C;  3WU1 B;  3QU6 A;  1G4D A;  1FBQ A;  4A0Z A;  5HLH A;  2MLK A;  3RYP A;  1FP1 D;  5ICC A;  3LST A;  2YR2 A;  1XMK A;  4FX4 A;  1ZAR A;  5ILS A;  4RAY A;  1PP8 F;  2VBZ A;  2PFB A;  3I54 A;  3C1D A;  3QOP A;  1YFH A;  5IT9 K;  2EV0 A;  2RKH A;  3F8B A;  2A61 A;  4OMZ A;  2O3F A;  3RKX A;  1L0O C;  4P96 A;  3QP6 A;  2OD5 A;  3I4P A;  1ZH5 A;  1LDD A;  2MA3 A;  5FFZ A;  3L00 A;  5FGM A;  2DI3 A;  2VN2 A;  4RS8 A;  4AD9 A;  3BP8 A;  3HRS A;  1XSD A;  4MGR A;  5ICE A;  1V4R A;  4M71 A;  4KMF A;  1W4M A;  5L3E A;  3HUG A;  5K5O A;  4JK1 X;  4L9N A;  2F2E A;  1BBY A;  1FX7 A;  1TW2 A;  1E2X A;  5HLI A;  2R7D A;  4HLY A;  2EB7 A;  3T0Y A;  4IRH A;  3FF5 A;  3NRV A;  1D3Y A;  5DUI A;  1I5Z A;  1STZ A;  2FSW A;  2GQQ A;  1KYZ A;  2XAJ A;  3RTR A;  3I58 A;  4EJW A;  2FNP A;  3W6J B;  5TJJ A;  4RGX A;  4WXD A;  2F5C A;  2PQ8 A;  3MZH A;  3FMS A;  1U78 A;  1J7K A;  3G3Z A;  3KE2 A;  5E20 A;  4U0V A;  4CGZ A;  1USS A;  2CSO A;  2EA2 A;  2J5O A;  2V9V A;  1W7P B;  2W25 A;  2IVM A;  2P5K A;  3DKW A;  4BHP A;  2NYX A;  5IT9 Z;  1FSE A;  1KQ9 A;  1XDU A;  2HYF A;  3SXY A;  2NRA C;  2K7L A;  2KRF A;  4U7D A;  1BI1 A;  3LA2 A;  3IKV A;  4TV7 A;  2IA1 A;  5FD6 A;  1T2K A;  5D5X B;  2O0Y A;  3QPT A;  4YFK F;  1MZB A;  1S29 A;  1RNL A;  1SD5 A;  4O3M A;  2ZCW A;  3R6S A;  1JXS A;  5AON A;  4YIF A;  1BJA A;  3JAM K;  1BOA A;  2LNB A;  2ZO4 A;  2BE5 F;  5IT3 A;  3WTY C;  4WF2 A;  5E8G A;  1AOY A;  4RAZ A;  4MNU A;  2D45 A;  3WTV C;  3H3U A;  3TDU C;  1MJ9 A;  1CF7 A;  5E1W A;  1XSV A;  2STT A;  1K78 A;  3IHU A;  2YU3 A;  1R1T A;  1I6X A;  3RI4 A;  1XMA A;  1JE8 A;  4I0B A;  3EYY A;  1WQ2 A;  4FX0 A;  4UVC A;  2G7H A;  3GFI A;  1LEA A;  3GUD A;  2ZME A;  3SZT A;  1XB4 A;  2PMU A;  1SAX A;  3FMQ A;  2A3S A;  3LQR A;  3R0A A;  1IN5 A;  2XAS A;  1KU3 A;  3KFW X;  4KT5 C;  3LQQ A;  1W7P D;  3J80 Z;  3CUQ C;  4G8X A;  1WKM A;  2EV6 A;  4M6Y A;  3D0S A;  4M9S A;  4P5O A;  1UST A;  4ETS A;  4I7H A;  2GA1 A;  4ESF A;  1TNT A;  2LSO A;  1R22 A;  3ZQ7 A;  5ED4 A;  2DU9 A;  1KGS A;  3V8J A;  1WI9 A;  5AIQ A;  2L54 A;  2JT1 A;  3KZZ A;  4XSX F;  3RJP A;  3M8F A;  1BI0 A;  1YIO A;  1TLH B;  2CG4 A;  2ZBK A;  2RDP A;  3DF8 A;  4WCG A;  2PMH A;  4A2U A;  5LEJ A;  4ON0 A;  1QBJ A;  4I01 A;  3IRQ A;  1QPM A;  3HRU A;  2LF7 A;  3CUQ B;  3RKW A;  1QO0 D;  1IN7 A;  1OYW A;  1RZ4 A;  3BY6 A;  2P5L C;  4N0B A;  4YFN F;  2W24 A;  3HOT A;  3W6K B;  1KQ0 A;  4KN4 X;  1ZLK A;  1B59 A;  4MTE A;  4EJU A;  4G94 A;  2D1V A;  4OIO F;  2KIF A;  2GAU A;  2HQN A;  2JZY A;  5HDG A;  5H6Q A;  1W5T A;  4KIF A;  1TTY A;  1FPQ A;  4L9T A;  2VOD A;  3HRM A;  1OR7 A;  1IXS B;  2KIM A;  4HZF A;  3R0J A;  2GXG A;  2FEZ A;  1JGS A;  3WTZ A;  1EH7 A;  3HTU A;  2NNN A;  5CVJ A;  2K4B A;  2EFW A;  5F6F A;  4LGW A;  1BC7 C;  2OAZ A;  3N4M A;  4UNO A;  2M1B A;  3BJO A;  2BYV E;  3L9F A;  3J81 K;  3K2Z A;  1MJA A;  3GFJ A;  4OIQ F;  4G6Q A;  2FBH A;  3ZMT A;  3EQL F;  3FZV A;  2CYY A;  2KJB A;  1ZRC A;  1FT9 A;  3DXJ F;  1D8J A;  2OA4 A;  5LHH A;  1FYL A;  3D5L A;  4D0P A;  1MD0 A;  5LBQ A;  2O03 A;  4CO8 A;  2EFN A;  3M8E A;  4WXH A;  1P4A A;  5J6X A;  3F8F A;  3P7N A;  3E6B A; 
#chains in the Genus database with same CATH topology
 4PSX A;  1O3R A;  3FM5 A;  1R58 A;  1FEX A;  1OKR A;  3F22 A;  3KZY A;  3IH2 A;  4KUM A;  1MJB A;  5IYB J;  1DUX C;  5J8F A;  3SHF A;  4IL6 C;  1MGT A;  3JTH A;  3OS0 A;  4G7H F;  4A3K J;  4QIW N;  2NS0 A;  3LSK A;  3I56 I;  3L09 A;  2OQG A;  1G3T A;  3E5X A;  4L18 B;  1DPU A;  1IV6 A;  4ESB A;  2DFI A;  2HNH A;  4Q4Z F;  2MBF A;  3QOD A;  3CCM I;  3KP5 A;  4HPQ A;  4LK0 F;  4E4H A;  3PJR A;  3WTT C;  1S7E A;  3GLX A;  1U5T A;  2J5P A;  3G6E I;  4HW0 A;  4PDK A;  2NS8 A;  3ZOB A;  3A01 B;  3DFG A;  3ZRG A;  3HOS A;  1XGM A;  1U8R A;  4QSH A;  4CIC A;  2P0W A;  4A0Y A;  4BE0 A;  4NDL A;  2ADU A;  1U6G A;  4LMY A;  4C3J J;  1TT5 B;  4U0W A;  3CMM A;  4IVN A;  1YI2 I;  3HDD A;  2JRM A;  1DP3 A;  3VSK A;  1B9N A;  4C3I J;  1IJW C;  1FOY A;  3T1B A;  2IBD A;  1BIB A;  5J4V A;  2BEO A;  2Y0S A;  3WG7 H;  1P92 A;  1LDJ A;  3FX3 A;  4C3H J;  2V1U A;  2K86 A;  1OQY A;  1QQI A;  2CQK A;  3CC4 I;  4FT8 A;  4ASN A;  3TDZ C;  2FX0 A;  4BEH A;  3TGN A;  5J1Y A;  4LFU A;  3AFH A;  3I53 A;  3H0D A;  4OIP F;  2OCE A;  2DFF A;  3K4L A;  4OU0 A;  2V79 A;  5DUK A;  3WGH A;  3QU3 A;  5EZH A;  3MVP A;  3P5J A;  5BQT A;  1W0U A;  4WXC A;  4A93 J;  3I5U A;  1S8N A;  3LMM A;  3KEY A;  3BWG A;  4C9Y A;  5JLW A;  1IG7 A;  4LIU A;  2A5Y B;  5J4Y A;  4XLH A;  1YJN I;  1HST A;  2RN7 A;  2JVH A;  2HOS A;  3O6B B;  5DDG A;  1I27 A;  2O6G E;  2X0L A;  3DKX A;  4LB6 B;  2CGP A;  2DBB A;  4HEA 2;  4ZTJ A;  3I55 I;  2VON A;  3BR6 A;  3RKQ A;  3ABM H;  3V4G A;  2MSY A;  5F27 A;  2VBW A;  5JVT A;  2M5W A;  4HF0 A;  3IAM 2;  1B4A A;  2W85 A;  4EM2 A;  5D6E A;  4UVA A;  1UHW A;  1UEL B;  2OTJ I;  4I99 C;  3P9C A;  4M3B A;  1W5S A;  2IW5 A;  4IJA A;  4BHB A;  2MW8 A;  2K02 A;  1MMD A;  1XSX A;  3GFL A;  1G3S A;  1OFC X;  2R7U A;  4RAG A;  2RVC A;  1UFM A;  5DS9 A;  4BE1 A;  2XKO A;  4UVB A;  3PNY A;  1WZ2 A;  2JTV A;  3PFI A;  3KET A;  5D6F A;  2RQQ A;  3K1P A;  4G9Y A;  4EJV A;  4AIH A;  1F5T A;  1L3L A;  2HZD A;  5CLS A;  1XGO A;  5J8C A;  1RUN A;  1PDN C;  2HKO A;  2DMQ A;  2L01 A;  4EJO A;  2DPU A;  3CLO A;  2ZC2 A;  4OOI A;  2CS3 A;  1C0W A;  2KRH A;  1LPQ A;  4RGR A;  3HOV J;  3ASN H;  4ZYH A;  1SFK A;  2CV0 A;  2YPR A;  4XK4 A;  2VE9 A;  2JQ7 A;  2UXN A;  1MBJ A;  3F72 A;  3L7W A;  1RET A;  3CO7 C;  1HW2 A;  2PBI A;  4RB2 C;  2RNG A;  5A2Q Z;  5DV5 A;  5F0F A;  3FXQ A;  4IOC F;  1IRF A;  2VPR A;  2OV7 A;  3REO A;  2BW3 A;  3BG7 A;  2GZW A;  2ZXJ A;  3AAF A;  3ROU A;  3TO6 A;  5DEQ A;  1TW3 A;  4FTH A;  1G2H A;  3CCU I;  1TQM A;  1CQT A;  2GLO A;  5GPA A;  2QBY A;  1ZYR F;  3ABL H;  2M3A A;  2XIG A;  2EA4 A;  2UXX A;  3S3M A;  2Z33 A;  3CTA A;  5F1R A;  3GTG J;  2JA5 J;  3LFK A;  5FLX K;  1VQO I;  2LF8 A;  3S8P A;  3MZY A;  2A68 F;  2WY7 Q;  4XOP A;  2V7F A;  5JHU A;  4KIS A;  2ELH A;  3E5Q A;  2KFD A;  5FJ8 J;  1X3U A;  1SMY F;  2DA1 A;  3EYI A;  3WTW C;  1TP4 A;  2V1X A;  2A69 F;  1UCR A;  2HOT A;  2YX7 A;  3M1E A;  2EFQ A;  3CJQ B;  4YRV A;  3I3L A;  4I2O A;  1CF7 B;  5LHG A;  4S04 A;  2ZXI A;  3PM1 A;  3VDX A;  3OIO A;  3PUF A;  4NC6 A;  4E7H A;  4GYG A;  4IHY A;  3KZI C;  3IV5 A;  3N97 A;  5L3G A;  2CUZ A;  1ZTR A;  5GP9 A;  1B8I A;  2DFH A;  2W00 A;  1X1B A;  1IGN A;  2EPF A;  4MO7 A;  3ZMV A;  1ZG1 A;  2DJN A;  2VJ5 A;  5D5U B;  4EM1 A;  4BS9 A;  2VT2 A;  3V7S A;  5B1A H;  1K79 A;  3HTS B;  2XGD A;  4C2U A;  1HSJ A;  2Z99 A;  5FRO A;  3FIS A;  1VF9 A;  1BW5 A;  2IJL A;  1D8K A;  3JW4 A;  2Y0M A;  3C18 A;  4ZDO A;  1Y1V J;  4WK8 F;  1I50 J;  4UB8 C;  3K1N A;  1JJ8 C;  1EH8 A;  2E34 A;  3OSG A;  3D5S C;  3GZ6 A;  2QSH X;  3F6O A;  1W1W E;  3RYR A;  4DGW B;  1LVK A;  2OF7 A;  1YE9 A;  2VQC A;  1VQ6 I;  5LHI A;  2ZNY A;  3K9T A;  2R7O A;  2HXI A;  1YRN B;  1OCP A;  3ABU A;  4EJT A;  2CJJ A;  4KIB A;  1HW5 A;  3GX4 X;  5L3C A;  3EUA A;  1WSU A;  2BXZ A;  2NAZ A;  4ZDL A;  5D4S A;  4M3G A;  3F3X A;  2BGC A;  1D5V A;  5HNH A;  1P7J A;  2DMU A;  3EET A;  4Y17 A;  1ZRD A;  3RPQ A;  3Q0U A;  4FHT A;  1S3J A;  4FQG A;  4LLG F;  2FE3 A;  4II2 A;  3WHB A;  1YTY A;  1IXR C;  5FD5 A;  2EWN A;  2IAI A;  4OMY A;  2KIU A;  4B8X A;  3F23 A;  1HKS A;  5L3F A;  3FXL A;  3L2R A;  2XHK A;  2A05 A;  1BN5 A;  1BA5 A;  4LG0 A;  3CDH A;  5K7F A;  1LE8 A;  2R5Y A;  1R5G A;  4KIG A;  3HM5 A;  4ZZD A;  2DAO A;  4QPO A;  3ZQC A;  2EK5 A;  1E3H A;  1RRJ A;  3DPU A;  1Y8Q B;  3MZ8 A;  3JRH A;  1ZQ3 P;  5GPC A;  1R23 A;  2Y75 A;  2RNJ A;  4NNJ A;  2R7Q A;  1LDK B;  2XGC A;  4ZYG A;  1ETQ A;  2FJ1 A;  3RQI A;  1OR7 C;  3MKL A;  1HDD C;  4A3E J;  1KQ8 A;  1ZRF A;  2MD0 A;  3T8T A;  3ZCO A;  4KFC A;  1SD4 A;  3QYE A;  3BG9 A;  3VFZ A;  2Z16 A;  4AUX A;  4F92 B;  2B0L A;  2IS4 A;  2Z9O A;  2JMW A;  2IP2 A;  2UUZ A;  4O5V A;  1AKH B;  4O6J A;  2HYJ A;  1QZZ A;  4HYE A;  2R4G A;  2GIV A;  3SEZ A;  1VQ8 I;  4Y13 A;  5DCF A;  2OTL I;  1PUF A;  5D8K B;  1LVA A;  5BPI A;  1AU7 A;  3VOE A;  1BR1 A;  1UJ8 A;  2H27 A;  2VJ4 A;  3NEU A;  4HAM A;  5GAE J;  3FM3 A;  2R7V A;  3FXR A;  3BQY A;  3OYC A;  2DK8 A;  1MKM A;  4DNC A;  2RV8 A;  2B7E A;  1WH7 A;  3JRI A;  4IHT A;  3ULQ B;  1QHG A;  2FA5 A;  2QM3 A;  4XRS G;  2EIN H;  5EEA A;  3VEP A;  3DEW A;  5CQE A;  2BY0 A;  1KZH A;  1DU6 A;  3A02 A;  2FUG 2;  3GEZ A;  1ON1 A;  3FHZ A;  3WGG A;  1A6I A;  1UMQ A;  1I1S A;  1TWH J;  4KN7 X;  2P6T A;  3K69 A;  4BJT A;  2W84 A;  5F04 A;  2AQF A;  2X1D A;  3E3V A;  1X58 A;  4HF2 A;  1JKQ C;  2XRO A;  1W5C C;  3RPU A;  1NK2 P;  2W82 A;  2WV1 A;  1XD7 A;  4GYI A;  2QQB A;  2E35 A;  3PQK A;  5EGO A;  2DT6 A;  1JTX A;  1G6N A;  5J40 A;  2PMZ A;  1F43 A;  1BIA A;  1G3W A;  4EMS A;  1XGS A;  1MMN A;  1X19 A;  2DTR A;  5K1Y A;  2WY8 Q;  3WU2 C;  3QAH A;  3VYR B;  4AU7 A;  1SAN A;  1HKT A;  2JRT A;  2V6E A;  2VQL A;  2L5Q A;  3K1M A;  3I4M J;  3BPX A;  3G1M A;  2E36 A;  4BH9 A;  3FXU A;  4C2T A;  4ENJ A;  3ZN1 A;  4IX7 A;  1UZC A;  1SD7 A;  2ICW G;  4MFD A;  4G7Z F;  4UB6 C;  2F5D A;  4BQQ A;  3LAJ A;  3WU0 A;  1JUM A;  5HS8 A;  1ETX A;  4XN0 A;  3LAP A;  2QQA A;  4PGH A;  4XSZ F;  4OWR B;  2HU9 A;  1REP C;  1R7J A;  4DZP A;  4L5E A;  5CJ9 A;  3U1D A;  2PEX A;  3AG3 H;  1OCT C;  1HBX G;  5ICF A;  3SFZ A;  5TGT A;  4B47 A;  3OL4 A;  3CJR B;  4RB3 C;  2DDB A;  1MDM A;  1N77 A;  2W4S A;  3S32 A;  4QWQ A;  5D4R A;  3CD6 I;  2D2W A;  1U5T C;  3AG4 H;  5EYR A;  5CVU A;  4B09 A;  5BOX A;  4HLX A;  3WTX C;  1Y56 A;  1DGR M;  1MIJ A;  3ZQI A;  2DYR H;  4PGG A;  1DPR A;  1ZHF A;  4EAT A;  3L2V A;  3BPV A;  2VLA A;  4A6E A;  1OLT A;  5ERI A;  4AWX B;  3BZC A;  2NS7 A;  3HSE A;  1A36 A;  2RAE A;  2H09 A;  4E7L A;  4R1H A;  2XGX A;  2XAG A;  2MH9 A;  2B9S A;  4XLP F;  4NC8 A;  4GXO A;  5FKN A;  3OL3 A;  3JRE A;  1Y39 A;  4LD5 A;  4CCM A;  4HDV A;  3W2A A;  1FY7 A;  2CQN A;  3MAJ A;  4WX9 A;  5LRR A;  2XF7 A;  2P5V A;  2WTE A;  2ZKZ A;  1VQ7 I;  3H3V K;  2TDX A;  4DJA A;  2LK2 A;  4XLA A;  5IP6 A;  2M4G A;  1FLI A;  2VOP A;  3R61 A;  2E7W A;  4JX4 A;  2DOE A;  1XDS A;  3JAM Z;  1Z3Y A;  2D1H A;  1EJ9 A;  3K4M A;  2LKX A;  2ZFU A;  5D5W B;  3LSI A;  3HRT A;  3HPH A;  4L9J A;  5E79 C;  2HDW A;  1MBE A;  2KQR A;  1HA8 A;  5FRM A;  1VTN C;  1HW1 A;  4E7I A;  3H9J A;  3FMR A;  1IAW A;  3C3W A;  4JOM A;  4Q5S F;  2WAE A;  4HF1 A;  4CZC A;  1ZR2 A;  1A31 A;  1BI2 A;  3W3C A;  1FYM A;  1U5T B;  3ZGK A;  3C7J A;  1D0Z A;  3C2B A;  4YG2 F;  2QVO A;  3K4N A;  2W57 A;  1LFB A;  3PNV A;  2AO9 A;  4OIR F;  1LNW A;  2CV1 A;  4A3D J;  3KP6 A;  4BXX J;  1B9M A;  5DCM A;  1JI8 A;  4ENK A;  3GXO A;  3BT9 A;  3F8N A;  2GXA A;  3LSH A;  3ZQG A;  4A3M J;  3BRO A;  4ESJ A;  3ERM A;  2KKO A;  5HS9 A;  1ZR4 A;  1OCZ H;  2M7B A;  5EEG A;  4DBQ A;  1U3E M;  5FB2 A;  4XLF A;  1R49 A;  1TQP A;  3HG9 A;  2HEO A;  3M3Y J;  5BMZ A;  1T98 A;  2GBY A;  3EDP A;  3CJN A;  5BS6 A;  2HYG D;  4RAF A;  4I09 A;  4JBA A;  2M34 A;  1JHH A;  2BXY A;  2E19 A;  2IA2 A;  4A0X A;  3L2W A;  1PP7 U;  3K7A J;  5JVG F;  1VQP I;  1O3T A;  4XL9 A;  3K2A A;  2VBY A;  2DO7 A;  3HKZ N;  2VE8 A;  4XKV A;  2R5Z B;  5GAG J;  3V8L A;  4KA4 A;  2ZJR F;  4L0Y B;  2LDU A;  1R4N B;  2OUM A;  3J7A Y;  5L3B A;  2DA3 A;  2M7A A;  3E6D A;  3TKY A;  3WHC A;  3WTS C;  2LY1 A;  2PJP A;  2ID6 A;  2VUM J;  4A12 A;  3DBL B;  1GXQ A;  2K9Q A;  3OYG A;  4M3E A;  2AS5 F;  2EFP A;  3DU6 A;  2F5E A;  3RIR A;  5KAI C;  2CW0 F;  1WPK A;  4UHT A;  5LEK A;  1XX5 A;  2P7V B;  2ID3 A;  4AYB A;  2LYC A;  4E7S A;  2H94 A;  2TCT A;  2XKP A;  2ELJ A;  2XUB A;  5E3N A;  4MEX F;  3ZQF A;  3FK7 A;  2KJC A;  2CFX A;  5BNG A;  9ANT A;  3HHG A;  5DM6 F;  2L7F P;  4L5I A;  1FTZ A;  2VC1 A;  2XAH A;  4HOB A;  3S1M J;  2QEX I;  1XS9 A;  4F93 B;  2M45 A;  5TRD A;  1VQ5 I;  2O8X A;  2VKV A;  3KP2 A;  4ZH4 F;  1IV8 A;  1MW7 A;  4NUB A;  2FNA A;  3GFM A;  4DOZ A;  2WAQ A;  2HPI A;  3N05 A;  3BOQ A;  1R4M B;  2IT0 A;  4BQA A;  3KEO A;  5CPR B;  2YU9 J;  2CUJ A;  1P7I A;  1TL8 A;  2E1N A;  1N25 A;  1AHD P;  3VYS B;  3CES A;  1UG0 A;  5E1Z B;  4OAZ A;  3LFU A;  2O8K A;  1R36 A;  2E2I J;  4Z6Y A;  3KLO A;  1MSE C;  1QNT A;  4IPA A;  3COA C;  2CU7 A;  4IQ4 A;  2ETH A;  2HOA A;  3E7L A;  1H9T A;  1I6H J;  1Q1V A;  1ONV A;  2VJJ A;  4EM0 B;  2STW A;  4KIT B;  3TO7 A;  2K85 A;  5EG0 A;  3MCZ A;  2QBY B;  1N75 A;  3OIP A;  2H6B A;  3H5A A;  4EGY A;  3F9K A;  1ZGW A;  2HQR A;  1Y0N A;  2ESN A;  5DTD A;  5HNF A;  3BR0 A;  2WBM A;  1HOM A;  2CRG A;  2L4M A;  1H0M A;  3SFI A;  1X4O A;  2Y9Z A;  2KPM A;  2P6S A;  3BDD A;  3S15 J;  5C4J J;  2MH2 A;  2IRF G;  1YW8 A;  1Z7L A;  2RRE A;  3PNT A;  2HPM A;  1YG2 A;  2GWR A;  1S9H A;  2E5Z A;  3M9A A;  5FKO A;  3U9G A;  5B1B H;  5E3L A;  1GHC A;  1R5H A;  2EJR A;  4LLN A;  3Q9V A;  5CKT A;  1IDZ A;  1Y1W J;  2DPD A;  1YX5 A;  2BZT A;  1IN4 A;  3EPZ A;  1Z67 A;  4YEJ A;  4A3J J;  1IC8 A;  4IRI A;  2H6C A;  2X6W A;  3TOA A;  4Y15 A;  1U2W A;  3RDI A;  2H1K A;  1R6R A;  1MNE A;  4GGG A;  2R7T A;  3EUH A;  3HUG B;  3VYU B;  4RDU A;  2XPV A;  1YW9 A;  1LJ9 A;  4UUS B;  1W36 C;  1B6A A;  3C2G A;  1ZKG A;  2ZNZ A;  1H88 C;  2QZ8 A;  3F8M A;  1U8B A;  4BL0 B;  2X48 A;  1IO2 A;  2QWW A;  3O3K A;  1YW7 A;  3E6C C;  1V54 H;  5HOD A;  3Q0V A;  2VQH A;  3CUQ A;  5EDN A;  4CDG A;  3IH4 A;  3D1N I;  3HPG A;  1IF1 A;  1V3F A;  4M3F A;  2H1L A;  2K3P A;  4GCV A;  2FBI A;  1P4X A;  1Z9C A;  2LRD A;  1YYV A;  3J81 Z;  1ORK A;  1D0X A;  1VQN I;  4ITV A;  1RKW A;  4JP0 A;  3K70 C;  3A2K A;  1JTY A;  3BJ6 A;  4CYD A;  4PK4 A;  2RQP A;  2MC3 A;  3SZP A;  3AKZ A;  1K4S A;  3S93 A;  3H0G J;  1QZE A;  1Z05 A;  3MD2 A;  1SFX A;  4A5N A;  2ZSI B;  2WWY A;  1SFU A;  3HEF A;  1XGN A;  2DOD A;  2M9H A;  4V2G A;  2ECC A;  4JX5 A;  4HDU A;  3RSN A;  3F6V A;  1P2F A;  5FLV A;  2L9V A;  1V5G A;  4A3G J;  3OSF A;  1LE8 B;  2R5Y B;  3NAU A;  3VB2 A;  4MTD A;  2K9L A;  1IN6 A;  4P9F A;  1BI3 A;  2RGV A;  2BVM A;  2VC0 A;  2L3D A;  4OAY A;  4F3Q A;  2CUF A;  3ZP5 A;  1HLV A;  3P9I A;  3VPR A;  1ODD A;  4DQ2 A;  4HX4 A;  3BG6 A;  1TNS A;  3CCY A;  2MD5 A;  4RGU A;  2HTS A;  3CJT B;  1IUY A;  2A6H F;  3IRR A;  3J7A O;  3S1N J;  1EH6 A;  4CYC A;  3RZD J;  3SEQ A;  2A6E F;  1BR2 A;  4MEY F;  2X51 A;  3M7G A;  3AL0 C;  5CVV A;  1T39 A;  1IZ1 A;  3W2W A;  2DLL A;  2IA0 A;  5KAF C;  4YII A;  5E17 F;  2A07 F;  3ASO H;  2KL4 A;  3R60 A;  3WOD F;  2L02 A;  1JKP C;  2R7S A;  2ACJ A;  4M72 A;  3B73 A;  3PQJ A;  1V5E A;  2WV0 A;  2Z5U A;  5HOO A;  2ELK A;  4DYQ A;  1K7A A;  4KDP A;  2QEN A;  1KU2 A;  3ISP A;  3PIP F;  2OBP A;  2CQ7 A;  2ZME C;  4A3C J;  4B48 A;  1T6S A;  3ECH A;  1UB9 A;  1IDY A;  1OCC H;  1Z91 A;  4AVP A;  3LWF A;  2E71 A;  3S1R J;  4NQW A;  3Q3S A;  3GTL J;  2OZ6 A;  3U2R A;  2F4M B;  1ZG5 A;  1J75 A;  1B1B A;  3UR3 C;  2MGQ A;  2O61 A;  2EH3 A;  2LLK A;  4D5C A;  4AIJ A;  3HIF A;  2HR3 A;  3CZ6 A;  4N4O B;  3LL7 A;  1S72 I;  3CCR I;  1GVJ A;  3DTE A;  4A5M A;  3H36 A;  4B1R A;  5E1X A;  3OYJ A;  3MFK A;  2KDO A;  3ELK A;  2BV6 A;  4XLE A;  2IEK A;  3S2W A;  4MQ9 F;  4LIV A;  5EGO B;  2JUG A;  2BY3 A;  1GDT A;  3AL0 B;  1GT0 C;  3GME A;  5B5E C;  3IL2 A;  1ZRE A;  3OR1 C;  3BCA A;  1K78 B;  1Z6R A;  4NBQ A;  1F1Z A;  4BNC A;  1T0F A;  3IWF A;  3QP5 A;  1U9N A;  2FMY A;  4PSW A;  4A3L J;  3V8K A;  2KZV A;  1SD6 A;  2CH0 A;  4CCL A;  3BC8 A;  4KNY A;  3K4C A;  2Y48 A;  1MBG A;  2LRE A;  1MBF A;  1S7O A;  2COM A;  4M6X A;  3JTG A;  1Z0X A;  4HX7 A;  2DCE A;  4UV8 A;  2KT0 A;  2ZME B;  3KCC A;  5K5R A;  3ZMD A;  3GTO J;  1WJF A;  1V55 H;  2D5V A;  3ABT A;  2WB1 N;  4BBR J;  2FBK A;  1RPW A;  4B4C A;  2HFH A;  1WWX A;  3OWT A;  5EEH A;  4BQO A;  4WWC A;  1J59 A;  3GCM A;  1D1A A;  4P55 A;  4ABZ A;  4XM3 A;  1MDM B;  4W1U A;  4AVZ A;  1NG7 A;  2C6Y A;  1O3Q A;  3PIO F;  1OCR H;  2F4O B;  2IPQ X;  3K4J A;  1TWF J;  3SDG A;  3P9K A;  4M73 A;  2PJR B;  2M8E A;  4BAY A;  4KT6 A;  2B63 J;  1W36 D;  3LA3 A;  2DA6 A;  4RB1 A;  3MEX A;  1FOW A;  1DP7 P;  2HZT A;  4PJL A;  1O7L A;  1XMX A;  4Z2Y A;  2X6X A;  3CMY A;  3TOB A;  3V7C A;  2L7Z A;  2F5F A;  1S6L A;  3AG1 H;  3WE3 A;  3FWE A;  3GW2 A;  2LD5 A;  1N78 A;  3GTQ J;  2XPU A;  2DA4 A;  3GZ5 A;  3KEQ A;  3IP4 B;  4PZJ A;  3WE2 A;  3OYF A;  2DXI A;  4Y7N J;  3PFY A;  4BDY A;  1ETO A;  2V26 A;  3OYB A;  3FXK A;  1FZP B;  2HKX A;  3CDI A;  4MFE A;  4XKW A;  2LBF B;  1VZ0 A;  1JT0 A;  3K70 D;  2M30 A;  4FAS D;  2ISY A;  4IHS A;  4I0A A;  4L0Z B;  3H9G A;  1A04 A;  4AID A;  1EF4 A;  5E3O A;  1XCV A;  3CCS I;  2R7W A;  2L7M P;  1LB2 A;  1WVR A;  5FLX Z;  3ZN0 A;  1ZK8 A;  1DDN A;  4BKX A;  5IPA A;  4D5F A;  4KYW A;  2K4J A;  3FBN B;  1J2X A;  1RIO H;  1A35 A;  3D5R C;  1U9O A;  1FSH A;  1P6R A;  1Y8R B;  5LGU A;  1J09 A;  3OOP A;  1P9Q C;  5M5X J;  3I59 A;  1O4X A;  2BY2 A;  1HKQ A;  4GO1 A;  3G73 A;  2CFO A;  4XQF A;  2AXL A;  1YHQ I;  5F0C A;  3OR2 C;  4KIC A;  2E1O A;  3T5X A;  4HQM A;  2XSD C;  1FNN A;  2Q0O A;  2JPC A;  4BHC A;  5B66 C;  4KJZ A;  5DCM B;  2XGE A;  1K6O A;  3H3Z A;  3RPU D;  3TQN A;  2F48 A;  3HSF A;  3SQN A;  2FF4 A;  1PYV A;  3CCQ I;  1JUS A;  1SEU A;  2V1D A;  3WTU C;  1YOV B;  3O2P E;  2DT5 A;  2XAF A;  1KON A;  2UV1 A;  4XBF A;  2XC7 A;  4ENM A;  2E1M C;  1ETK A;  2Q8K A;  3J80 K;  3S1Q J;  2MFZ A;  1Z77 A;  1AWC A;  1VQ9 I;  3M8J A;  3HL2 A;  2V4J C;  5ILV A;  4U7B A;  1PUE E;  4MHG A;  4DIQ A;  5K7Z A;  4IHV A;  2ECB A;  1JHF A;  2VIX A;  4BYY A;  2IGK A;  1Y0U A;  4XLN F;  3GLL A;  2E1C A;  2R3S A;  2JA6 J;  2JSC A;  4ENN A;  3FDY A;  1VQM I;  3M07 A;  2ZB9 A;  5KHD A;  2CW8 A;  4XOR A;  4HV5 A;  3CCE I;  2OJE D;  3CF5 F;  3UNG C;  2CO5 A;  3I64 A;  2X85 A;  2QLZ A;  3B6C A;  4BXU A;  3ML6 A;  3PUB A;  3TBI A;  4CCJ A;  1YO5 C;  3GO5 A;  4Q48 A;  4XRM A;  2G7U A;  1SFE A;  2JA7 J;  2OC6 A;  4II3 A;  2O5R A;  1LFP A;  3DBH B;  4JYK A;  1Z1D A;  4UV9 A;  3MWM A;  2CV2 A;  2MC4 A;  3DWL E;  3E5U A;  1OIS A;  2R7R A;  1NHA A;  1KU7 A;  1PJR A;  2OU2 A;  2X4H A;  4BAC A;  2YSR A;  4FET A;  3RQ4 A;  4L9V A;  2FML A;  2IS1 A;  1WJ5 A;  4IF4 A;  2OPT A;  2VXZ A;  2E1M B;  1ETY A;  2M0M A;  2MAB A;  1WHU A;  1SMT A;  4N9I A;  2NVY J;  3L2C A;  1ZN2 A;  1O3S A;  4U88 A;  1APL C;  5CYV A;  2R7X A;  4R8H A;  1Y6I A;  2MLG A;  2NVX J;  1NK3 P;  4I98 B;  1Z21 A;  5HS7 A;  5ICG A;  5ILU A;  2UZK A;  1HC8 A;  1FP2 A;  3PSI A;  1YS6 A;  3FKI J;  1BR4 A;  1G3Y A;  2RC4 A;  5FFX A;  1IUF A;  1UAA A;  1J5Y A;  1WJA A;  2NVU B;  3IKT A;  2VOO A;  4HSR A;  1YX3 A;  2QYO A;  2G0E A;  2OQR A;  3H9Q A;  2TRT A;  2WAD A;  1X1A A;  3HGY A;  3OYH A;  4AIK A;  1ZGJ A;  3F8C A;  1BM9 A;  5B3S H;  3JSO A;  5FKK A;  3CDL A;  3DPL C;  1UG2 A;  2PI0 A;  1X4P A;  1I1G A;  3LA7 A;  2VAS A;  5AIP A;  1KA8 A;  3CLQ A;  3BR3 A;  3KYD B;  4BUP A;  3ZQH A;  1E3P A;  2OZU A;  4KMU X;  3I71 A;  4RB0 A;  2DA7 A;  3FXO A;  4H4K C;  2HGC A;  2DQL A;  2R7F A;  2FXA A;  4M9Z A;  2IS2 A;  4NHJ A;  1FWZ A;  1RI7 A;  2I10 A;  3JRD A;  2M87 A;  4D7M A;  2XVC A;  4CXF A;  2CUE A;  3BR2 A;  1FBU A;  3GBG A;  2KP6 A;  1YQA A;  3SZG A;  5KVR A;  3V7R A;  2DW4 A;  3BG5 A;  1ZGA A;  5CQG A;  3QWL A;  4U87 A;  2G9W A;  2YS9 A;  4IRG A;  1SVL A;  4XON A;  3DV8 A;  4D7N A;  4H0E A;  1K61 A;  1GXP A;  1ON2 A;  2DJI A;  2P4W A;  3GF2 A;  4P1W A;  1R1V A;  5DD8 A;  3CC2 I;  2XV4 S;  2DT7 B;  1R5I D;  3S2H J;  4G6D A;  2VBX A;  2V1N A;  1FMV A;  1O7F A;  4JQF A;  4AYB N;  5JHF A;  2L9N A;  4XN3 A;  2VI6 A;  1W7P A;  1R71 A;  4F7Z A;  2EZL A;  2HI3 A;  5M3F J;  4U0Y A;  3CQZ J;  3ERE D;  2EZK A;  3B02 A;  3I0T A;  3VOD A;  4A69 C;  5HDN A;  1V5F A;  3V42 A;  2M0C A;  2CWE A;  4DBR A;  5TIS C;  5LRS A;  1T38 A;  1J0R A;  2NVQ J;  2X6Y A;  4IXA A;  2HOE A;  2DQR A;  2LC2 A;  1TBX A;  2ZJ2 A;  2AQE A;  2VXD A;  4K2E A;  2LKP A;  5E8I A;  1NG6 A;  1WI3 A;  2FD5 A;  2DK5 A;  4ZYA A;  2DFE A;  2GXB A;  3ZR8 X;  1AKH A;  4N9H A;  1J9I A;  3KPH A;  4BEH B;  2PN6 A;  2E2H J;  3KYL A;  1K4T A;  2KMU A;  3K4K A;  1MMG A;  3G1O A;  1OPC A;  4LK1 F;  3A1Y A;  4XNF A;  2HTJ A;  1FBS A;  1FTT A;  3K10 A;  2Q2E A;  2FQ3 A;  2LY2 A;  5IOZ A;  2HDD A;  5HLT A;  2W7N A;  1FIP A;  3GTP J;  5KK1 A;  3GTK J;  3BJA A;  3W6V A;  1Q1H A;  2E5N A;  3MKZ A;  3CC7 I;  1OCO H;  3OYN A;  3Q9S A;  5CVI A;  4JX6 A;  2DOA A;  1T95 A;  2XF6 A;  1X2N A;  3GWZ A;  3LNQ A;  3JSP A;  4IQJ A;  2P8T A;  2R92 J;  1I3Q J;  3I9V 2;  1OMI A;  1Z6T A;  3H1C A;  3KP4 A;  4RA2 A;  5D5V B;  1B72 A;  5LGT A;  1SVM A;  1KYW A;  4CZZ A;  3T8R A;  2ZJP F;  4RLQ A;  3BTC A;  4PJJ A;  4EGZ A;  2BBY A;  2O7O A;  3HOW J;  5H2F C;  2ZSH B;  4HBL A;  6PAX A;  1ENH A;  5HVQ C;  3L1P A;  3PO2 J;  2NXN B;  4ZYE A;  4S05 A;  4IOA F;  2LR8 A;  3R4K A;  1LQ1 A;  1WRJ A;  1JGG A;  2ZJQ F;  3E6M A;  3E97 A;  4E7Z A;  1QGP A;  1S7A A;  1JJ6 C;  3S16 J;  2I8D A;  5HLG A;  1O57 A;  4ZYD A;  3ZMS A;  4LLL A;  2GOM A;  5KCM A;  4MIM A;  4C30 A;  3CCV I;  3KP7 A;  3QPH A;  4CYC B;  4MLO A;  4HNV A;  5EF6 A;  1CGP A;  1TWC J;  4B44 A;  5CVR A;  1OYY A;  1U0J A;  1R00 A;  3VWB A;  3OS1 A;  1P4W A;  1X3W B;  1ZAO A;  4M74 A;  1TZL A;  2EQR A;  4DZJ A;  3PO3 J;  3CO6 C;  1SAU A;  1DGW Y;  1T0F C;  1H8A C;  1F36 A;  3GVA A;  3TED A;  2Z3Y A;  4R79 A;  2DOF A;  2HWV A;  4RBO A;  5M5Y J;  3BTJ A;  1MH3 A;  2K27 A;  1IXC A;  2W48 A;  2WAF A;  3HB9 A;  3JRF A;  5BPD A;  3HHH A;  4XR6 A;  3HBL A;  5FO5 A;  1JKR C;  4BY1 J;  1F4K A;  4BU2 A;  1MMS A;  1EV7 A;  3F21 A;  2BW3 B;  2VL8 A;  2Y0S N;  1MH4 A;  1FC3 A;  1YLF A;  2H8W A;  2L9S A;  4FIS A;  3MMY B;  1QA6 A;  3ZXS A;  1BC8 C;  3JCU C;  2IS6 A;  3ESW B;  2DDA A;  3DTK A;  5IY5 H;  1X2M A;  3S14 J;  4M9X A;  3KP3 A;  4C2M J;  5IOY A;  5JR3 A;  3JRB A;  2X9D A;  3S17 J;  4LOC A;  2QGU A;  4YEL A;  4YFX F;  4RMN A;  4E7K A;  2PG4 A;  3ABK H;  2CMP A;  2GIZ A;  2E2J J;  3QRF F;  2IGM A;  3FHN A;  3ECO A;  5F64 A;  5DM7 F;  5C4X J;  1LUJ B;  1XCB A;  5EZG A;  3K0L A;  4L5J A;  1H9G A;  5DD4 A;  2L4A A;  3HYI A;  1FOK A;  2FU4 A;  2UWM A;  1JT6 A;  5K7H A;  1G8X A;  5DYM A;  1B8I B;  2FRH A;  1OYI A;  2DA2 A;  1RUO A;  5E18 F;  4E70 A;  2YUS A;  4X6A J;  2VJI A;  1X1P A;  3VSL A;  2HDC A;  5L3D A;  1Z7U A;  4BJ6 C;  1QZY A;  3IC7 A;  5LD2 C;  3HGG A;  3DEU A;  4J01 A;  2V6C A;  1T8I A;  2JA8 J;  2QUF A;  2QKM B;  5HDK A;  2CQX A;  2VT3 A;  2P7C B;  4BXF A;  3DP7 A;  5K5Q A;  4UXN A;  3BG3 A;  2HS5 A;  2CW7 A;  2JPB A;  3KX2 A;  3ZMZ A;  2ZXH A;  4HV6 A;  5H20 A;  3QOE A;  1FYK A;  5A2Q K;  4QLC U;  1KU9 A;  4ZZL A;  4P9U A;  4ZTF A;  3QPS A;  3ZPL A;  4EV0 A;  3ZMU A;  1LKX A;  3GTM J;  3RKY A;  5LLQ A;  3OV8 A;  2DMP A;  2ZFW A;  3JRG A;  2ISZ A;  4A6D A;  1IN8 A;  2PLY A;  4XRF A;  3DPT A;  4G7O F;  1HQC A;  3M4O J;  4LJZ F;  1UHM A;  4HX8 A;  4Q47 A;  4RGS A;  2YX4 A;  2JJ7 A;  2ESH A;  3A03 A;  3WG9 A;  4B3A A;  4HQE A;  1LEB A;  1LFU P;  2HVS A;  2XSJ C;  3FXJ A;  4PJM A;  4OIN F;  2WC2 A;  1XN7 A;  3KLN A;  1HXD A;  3BZK A;  4LG0 B;  2R5Z A;  4AM3 A;  3X2Q H;  3HSR A;  1YS7 A;  3IUO A;  4F52 A;  3OYD A;  2E60 A;  3CP2 A;  2Y30 A;  3TO9 A;  2KLO A;  4CUG A;  2QA4 I;  2BOL A;  4EVI A;  4I02 A;  4NB5 A;  1FJL A;  1MMA A;  1ULY A;  3H92 A;  2X1E A;  5D8L B;  4B43 A;  4DW6 A;  4HRI A;  3BTI A;  4EQQ A;  4MQV A;  3MQ0 A;  2GM4 A;  3MKY B;  1F9N A;  2EV5 A;  1T08 B;  4BE2 A;  1T56 A;  1TQI A;  4CA0 A;  4A3F J;  2IGN A;  2FOK A;  5JFR A;  3BZ6 A;  3I59 B;  1RR7 A;  3NQO A;  3NAR A;  3WGI A;  3UKG A;  5FRN A;  3SYT A;  1FMW A;  4PCQ A;  4D1Q A;  4CHU A;  3CUO A;  3K4B A;  1E17 A;  3TP0 A;  3ZQL A;  2XRN A;  3Q5F A;  2K40 A;  1IRG A;  1PUF B;  3EUK L;  5LGN A;  3HJE A;  2QQ8 A;  3TW7 A;  2GA2 A;  4BJ5 C;  4HST A;  2E7X A;  1ZLJ A;  2JUC A;  4BDZ A;  5J1R A;  4S0H B;  3GYH X;  2QQ9 A;  5H6R A;  2KIS A;  4UUV A;  1K83 J;  2XAQ A;  4HA8 A;  5KNL A;  4M3D A;  1R1U A;  4LB5 A;  4FE4 A;  1HCR A;  1M1E B;  5JI6 A;  2Y9Y A;  1ZG3 A;  1S5L C;  2I5U A;  3IWZ A;  5IP7 J;  1BW6 A;  1ETW A;  3OIQ A;  4XIC A;  2EFO A;  1IW7 F;  1GVD A;  1ZEL A;  2VB6 A;  3K6G A;  3DQV C;  2NNY A;  4UY8 I;  4CCN A;  3JR9 A;  3WU1 B;  3QU6 A;  4IHX A;  4NC7 A;  1G4D A;  1FBQ A;  2Z1D A;  4A0Z A;  5F0H A;  1UHS A;  5HLH A;  2MLK A;  2L9R A;  4V2F A;  3RYP A;  4F55 A;  1FP1 D;  2QSF X;  3HOZ J;  3A4C A;  5ICC A;  1WFX A;  2LMD A;  3LST A;  1YIJ I;  4ZDP A;  1YJW I;  2YR2 A;  4B3X A;  4V19 K;  1XTA A;  4LIT A;  1XMK A;  2XB5 A;  3ZQQ A;  4FX4 A;  1XC5 A;  3E1S A;  3CCL I;  2XB0 X;  1ZAR A;  1RES A;  5ILS A;  4RAY A;  2EBI A;  1WGX A;  1PP8 F;  2F5V A;  1GUU A;  2VBZ A;  2PFB A;  3I54 A;  3C1D A;  1SC7 A;  1BL0 A;  3QOP A;  1YFH A;  5IT9 K;  4FCY A;  2EV0 A;  2RKH A;  3F8B A;  2MYS A;  3QQA A;  2A61 A;  3OY9 A;  4OMZ A;  1JUP A;  2O3F A;  1DU0 A;  3RKX A;  2XAU A;  4XOT A;  2JK3 A;  2L2O A;  2BVL A;  1L0O C;  4P96 A;  3QP6 A;  2OD5 A;  3H35 A;  1X3Z B;  3I4P A;  1ZH5 A;  1LDD A;  2MA3 A;  5C44 J;  3LSR A;  4A3I J;  3J7Y J;  3DEE A;  5FFZ A;  3L00 A;  3O8H A;  5FGM A;  2DI3 A;  2VN2 A;  4RS8 A;  2LY9 A;  4PJ0 C;  4AD9 A;  3BP8 A;  4IO9 F;  2BHZ A;  3HRS A;  4GDF A;  1XSD A;  4MGR A;  2X1C A;  3OS2 A;  3A01 A;  5ICE A;  1V4R A;  3SDB A;  4M71 A;  5GTH C;  4KMF A;  1W4M A;  3OYM A;  5L3E A;  3HUG A;  5JLX A;  5K5O A;  4JK1 X;  4UUS A;  4L9N A;  2F2E A;  1BBY A;  1FX7 A;  1TW2 A;  3OYK A;  1E2X A;  2ME6 A;  1E3O C;  5HLI A;  1W0T A;  2R7D A;  3FK6 A;  4HLY A;  2Y69 H;  4A3B J;  2EB7 A;  2K9M A;  2ME0 A;  5M3M J;  3T0Y A;  4IRH A;  3DU5 A;  3OOU A;  3RCO A;  3FF5 A;  3NRV A;  1D3Y A;  4G12 A;  3CME I;  5DUI A;  4CCO A;  3BCB A;  1I5Z A;  1STZ A;  2FSW A;  3FIW A;  2GQQ A;  1KYZ A;  3TP3 A;  5GAD J;  3G4S I;  2XAJ A;  3HXL A;  2PX9 A;  3J7Z I;  3LSJ A;  2COB A;  3RZO J;  1NTC A;  3RTR A;  4XKB A;  4XKC A;  3I58 A;  4EJW A;  2FNP A;  4GFB A;  3LSG A;  3W6J B;  5TJJ A;  1ERD A;  4RGX A;  4WXD A;  2F5C A;  4DYR A;  1VND A;  1VQK I;  2PQ8 A;  2XPW A;  3AG2 H;  3MZH A;  3FMS A;  1U78 A;  1J7K A;  1MBK A;  3B6A A;  3G3Z A;  3KE2 A;  4RM3 A;  3CMA I;  5E20 A;  4U0V A;  4PFO A;  4BQN A;  3BTL A;  2PMZ N;  2F4I A;  2VKH A;  4ZJZ A;  4CGZ A;  1USS A;  2EIK H;  1RKT A;  1MND A;  2CSO A;  2EA2 A;  2QKL B;  2J5O A;  3I4N J;  2V9V A;  1W7P B;  2HVR A;  2W25 A;  4PJN A;  4FE7 A;  2IVM A;  3G2B A;  2HVQ A;  4PUS A;  1PVE A;  2P5K A;  3JRA A;  3DKW A;  4BHP A;  4CH7 A;  2NYX A;  1R9T J;  5IT9 Z;  3FBI B;  1FSE A;  2F6C A;  2L7K A;  2MG4 A;  2EIJ H;  1KQ9 A;  1XDU A;  3F0C A;  2HYF A;  2M8G X;  2WB1 A;  2ZXW H;  5J1U A;  3SXY A;  2NRA C;  2VKE A;  3FKJ A;  2K7L A;  2EIM H;  2A5W A;  2LH9 A;  1GLN A;  2KRF A;  1QPI A;  4U7D A;  1BI1 A;  3LA2 A;  3CCJ I;  3IKV A;  2EZI A;  4TV7 A;  1GV2 A;  2R0Q C;  4E7J A;  1TWA J;  2IA1 A;  5FD6 A;  1T2K A;  5D5X B;  4EEF G;  2O0Y A;  3QPT A;  4YFK F;  2Q2E B;  2Y31 A;  1D0Y A;  1MZB A;  1S29 A;  2GOX B;  4Y52 J;  5IYD J;  3DCF A;  1RNL A;  1SD5 A;  1D5Y A;  4O3M A;  2ZCW A;  3R6S A;  1JXS A;  1ETV A;  5AON A;  3U1K A;  1WJB A;  4HG2 A;  3BLY A;  4YIF A;  1BJA A;  2M4K A;  2JSP A;  1K6Y A;  3JAM K;  2LP0 A;  4N4N B;  1VFC A;  4M6V A;  2JA2 A;  3G1L A;  1B72 B;  1BOA A;  2LNB A;  2ZO4 A;  3HC7 A;  2IGO A;  2FQ4 A;  1OJL A;  2BE5 F;  1I3A A;  5FKM A;  5IT3 A;  4CCK A;  3WTY C;  3LOC A;  2JVG A;  3LSM A;  1QVU A;  3A0H C;  4WF2 A;  1ITY A;  5E8G A;  1AOY A;  4RAZ A;  1QVT A;  1WCM J;  4MNU A;  2N8G A;  2D45 A;  3WTV C;  3H3U A;  3TDU C;  3DLL F;  1MJ9 A;  5GTI C;  3PSF A;  3L2U A;  1CF7 A;  5E1W A;  1XSV A;  3BQZ A;  3OYI A;  4G6T B;  2STT A;  1K78 A;  1AA7 A;  3IHU A;  5FKL A;  2YU3 A;  4F91 B;  2JWT A;  2K3F A;  3HOU J;  3TMO A;  1R1T A;  1EKE A;  2K9N A;  1I6X A;  3RI4 A;  2XRL A;  3OYA A;  4RM2 A;  1YJ9 I;  2R7Z J;  4BY7 J;  1XMA A;  1JE8 A;  4I0B A;  3EYY A;  1WQ2 A;  4FX0 A;  2CQQ A;  4IKF A;  4UVC A;  2G7H A;  2OCC H;  3W2V A;  3GFI A;  1BOB A;  1LEA A;  3GUD A;  1SVO A;  2ZME A;  1VI0 A;  2KZG A;  3QYF A;  3SZT A;  5GAH J;  1XB4 A;  1FOX A;  2PMU A;  4X0G A;  1SAX A;  2LG4 A;  2AXT C;  4J00 A;  3FMQ A;  4Y4R A;  4Y33 A;  2A3S A;  3EUH C;  3HOY J;  3LQR A;  3R0A A;  2K5C A;  1IN5 A;  4UUT A;  2XAS A;  1A6Q A;  2KRC A;  3U21 A;  5EG0 B;  1ACI A;  1KU3 A;  4XRS A;  3H5N A;  3KFW X;  4KT5 C;  3LQQ A;  1W7P D;  1H89 C;  1YRN A;  2PJR A;  4BBS J;  2WA0 A;  5M5W J;  5EJC A;  3IAS 2;  4ANJ A;  3CUQ C;  3J80 Z;  4G8X A;  1WKM A;  3Q0W A;  1MSF C;  2EV6 A;  4M6Y A;  3D0S A;  2DN0 A;  4M9S A;  2XF5 A;  4P5O A;  1UST A;  5J47 A;  1VQ4 I;  1WJC A;  3FXM A;  3A0B C;  4ETS A;  5C3E J;  2EZH A;  4I7H A;  2GA1 A;  4X1E A;  4XLC A;  4ESF A;  1HF0 A;  3E0J B;  5J3L A;  2KIQ A;  3SJM A;  2X6O A;  1TNT A;  2LSO A;  3MN2 A;  1R22 A;  1IRX A;  2VQG A;  1BJZ A;  3ZQ7 A;  2L0K A;  4Y3O A;  5ED4 A;  2LBF A;  2DU9 A;  5F08 A;  2DMT A;  1KGS A;  3V8J A;  2DMN A;  1WI9 A;  1Z3X A;  1GV5 A;  2HQ5 A;  4AC0 A;  5AIQ A;  2L54 A;  2JT1 A;  3OYL A;  2V9K A;  3KZZ A;  4XSX F;  2NOG A;  3NWS A;  3RJP A;  3M8F A;  4QTR A;  2BHY A;  1BI0 A;  2Y2Z A;  1E0E A;  1YIO A;  1TLH B;  2CG4 A;  2ZBK A;  2RDP A;  2FOW A;  3DF8 A;  4WCG A;  2QF7 A;  3TW6 A;  2PMH A;  2O9L A;  4A2U A;  5LEJ A;  4ON0 A;  2WAQ N;  1QBJ A;  3G71 I;  4I01 A;  4XID A;  3IRQ A;  1QPM A;  3NWT A;  2K9S A;  3HRU A;  3O8G A;  2LF7 A;  3CUQ B;  3RKW A;  1I39 A;  1G59 A;  1QO0 D;  1QRY A;  2VPL A;  2DTZ A;  2KHM A;  3GZN B;  1X1C A;  3S2D J;  4DYC A;  4CSW A;  1VQL I;  1IN7 A;  4QPQ A;  1RZ4 A;  1OYW A;  2LOO A;  3BY6 A;  3CF2 A;  4XMY A;  2P5L C;  3KYC B;  1SFO J;  1EA3 A;  4N0B A;  4YFN F;  4YIR X;  3TL4 X;  2W24 A;  3H5R A;  3HOT A;  2JN6 A;  3W6K B;  1KQ0 A;  4KN4 X;  1ZLK A;  1B59 A;  4MTE A;  3OMY A;  2EIL H;  1MNM C;  1QU3 A;  4EJU A;  1NH3 A;  1IRZ A;  4G94 A;  2D1V A;  1POG A;  2QCO A;  4OIO F;  2KIF A;  2GAU A;  2HQN A;  3BR5 A;  2JZY A;  3ONQ A;  4I76 A;  3IH3 A;  5HDG A;  5H6Q A;  3JRC A;  3M1C A;  4LG3 A;  1W5T A;  3S3O A;  4KIF A;  1TTY A;  1FPQ A;  4I6Z A;  4L9T A;  2VOD A;  3S3N A;  2LFB A;  5IP9 J;  3HRM A;  1OR7 A;  2IXS A;  3CP8 A;  1IXS B;  2KIM A;  4HZF A;  1D1C A;  2LTP A;  1YIT I;  2AHQ A;  2BY1 A;  3R0J A;  3DLA A;  5IYC J;  2R93 J;  1FIA A;  2GXG A;  1D1B A;  4HNT A;  4HNU A;  2FEZ A;  1RC9 A;  1JGS A;  3WTZ A;  1EH7 A;  3GTJ J;  3HTU A;  1MBH A;  2NOJ B;  3QPL A;  2NNN A;  1JKO C;  1TWG J;  5CVJ A;  4J19 A;  3DTI A;  2K4B A;  2EFW A;  2LKS A;  5F6F A;  4BGD A;  4LGW A;  1BC7 C;  3OYE A;  2OAZ A;  2NVT J;  5FLM J;  2M2E A;  3N4M A;  4UNO A;  5F1J A;  3KIO A;  2QSG X;  4RLF A;  3HOX J;  2HXO A;  2W1O A;  1HDP A;  2M1B A;  3BJO A;  5E3M A;  2BYV E;  4ZC3 A;  2KDZ A;  3L9F A;  5LFA A;  1A5J A;  3J81 K;  3MKW B;  3HZJ A;  3K2Z A;  1MJA A;  1WJE A;  2VKD A;  4IEJ A;  1X1D A;  3L2Q A;  4IZZ A;  3DBR B;  3GFJ A;  4OIQ F;  4G6Q A;  1T33 A;  2DA5 A;  4NQW B;  3VYT B;  1XPX A;  2FBH A;  2LVS A;  2A6T A;  3EQL F;  3FZV A;  3ZMT A;  2CYY A;  3HKZ A;  2KJB A;  1TT0 A;  2XDV A;  1ZRC A;  4E6K G;  2HQA A;  3DKY A;  4W97 A;  1FT9 A;  3DXJ F;  1D8J A;  2OA4 A;  4D9J A;  2V9P A;  3QYB A;  4IHW A;  5LHH A;  1FYL A;  3BR1 A;  2Q1Z B;  3D5L A;  2H8R A;  4D0P A;  1TC3 C;  3LSP A;  1MD0 A;  5LBQ A;  3C2H A;  1DQU A;  2O03 A;  1XG1 A;  2P81 A;  4CO8 A;  2EFN A;  3M8E A;  4WXH A;  3PL8 A;  1P4A A;  1WH5 A;  5J6X A;  1RR8 C;  3F8F A;  1QHH D;  1WJD A;  4PFP A;  3P7N A;  2DYS H;  2Z2S B;  3E6B A;  4GRI A; 
#chains in the Genus database with same CATH homology
 1O3R A;  3FM5 A;  1R58 A;  1OKR A;  3F22 A;  3KZY A;  4KUM A;  1MJB A;  1DUX C;  5J8F A;  3SHF A;  1MGT A;  3JTH A;  4G7H F;  2NS0 A;  3L09 A;  2OQG A;  1G3T A;  3E5X A;  4L18 B;  1DPU A;  4ESB A;  2DFI A;  4Q4Z F;  2MBF A;  3KP5 A;  4LK0 F;  3WTT C;  3GLX A;  1U5T A;  2J5P A;  4HW0 A;  4PDK A;  3DFG A;  3HOS A;  1XGM A;  1U8R A;  4CIC A;  4A0Y A;  2ADU A;  1U6G A;  4LMY A;  4U0W A;  4IVN A;  1B9N A;  3T1B A;  1BIB A;  2BEO A;  1P92 A;  1LDJ A;  3FX3 A;  2V1U A;  2K86 A;  1QQI A;  2CQK A;  4FT8 A;  4ASN A;  3TDZ C;  3TGN A;  4LFU A;  3I53 A;  4OIP F;  4OU0 A;  2V79 A;  5DUK A;  3WGH A;  3QU3 A;  5BQT A;  4WXC A;  3I5U A;  1S8N A;  3BWG A;  2A5Y B;  1HST A;  2RN7 A;  3O6B B;  5DDG A;  1I27 A;  2O6G E;  2X0L A;  4LB6 B;  2CGP A;  2DBB A;  2VON A;  3V4G A;  5JVT A;  2VBW A;  2M5W A;  4HF0 A;  1B4A A;  2W85 A;  4EM2 A;  5D6E A;  4UVA A;  1UHW A;  3P9C A;  1W5S A;  2IW5 A;  4IJA A;  4BHB A;  2K02 A;  1XSX A;  3GFL A;  1G3S A;  2RVC A;  1UFM A;  2XKO A;  4UVB A;  2JTV A;  3PFI A;  3KET A;  5D6F A;  3K1P A;  4EJV A;  4G9Y A;  4AIH A;  1F5T A;  1L3L A;  5CLS A;  1XGO A;  5J8C A;  1RUN A;  1PDN C;  2HKO A;  2L01 A;  4EJO A;  2DPU A;  3CLO A;  4OOI A;  1C0W A;  4RGR A;  4ZYH A;  2YPR A;  2VE9 A;  2UXN A;  3F72 A;  3L7W A;  3CO7 C;  1HW2 A;  2PBI A;  4RB2 C;  5A2Q Z;  5DV5 A;  3FXQ A;  1IRF A;  3REO A;  2GZW A;  2ZXJ A;  3AAF A;  3ROU A;  3TO6 A;  5DEQ A;  1TW3 A;  1TQM A;  2QBY A;  1ZYR F;  2XIG A;  2EA4 A;  2UXX A;  2Z33 A;  3CTA A;  5F1R A;  3LFK A;  5FLX K;  2LF8 A;  3MZY A;  2A68 F;  5JHU A;  2ELH A;  3E5Q A;  1X3U A;  1SMY F;  3EYI A;  3WTW C;  2V1X A;  2A69 F;  1UCR A;  2YX7 A;  3M1E A;  2EFQ A;  4I2O A;  1CF7 B;  5LHG A;  4S04 A;  4GYG A;  3N97 A;  5L3G A;  1ZG1 A;  3ZMV A;  5D5U B;  4EM1 A;  2VT2 A;  3V7S A;  1K79 A;  3HTS B;  1HSJ A;  2Z99 A;  2IJL A;  1D8K A;  3JW4 A;  2Y0M A;  3C18 A;  4WK8 F;  3K1N A;  1EH8 A;  3GZ6 A;  3F6O A;  3RYR A;  5LHI A;  2ZNY A;  3K9T A;  3ABU A;  4EJT A;  4KIB A;  1HW5 A;  3GX4 X;  5L3C A;  1WSU A;  2NAZ A;  5D4S A;  3F3X A;  2BGC A;  1D5V A;  4Y17 A;  3EET A;  1ZRD A;  3RPQ A;  4FHT A;  1S3J A;  4LLG F;  2FE3 A;  1YTY A;  1IXR C;  5FD5 A;  2EWN A;  4OMY A;  2KIU A;  4B8X A;  3F23 A;  1HKS A;  5L3F A;  2XHK A;  1BN5 A;  4LG0 A;  3CDH A;  1R5G A;  4KIG A;  4ZZD A;  2DAO A;  2EK5 A;  1R23 A;  2Y75 A;  2RNJ A;  1LDK B;  4ZYG A;  1KQ8 A;  1ZRF A;  3T8T A;  4KFC A;  1SD4 A;  3VFZ A;  2B0L A;  2Z9O A;  2IP2 A;  4O5V A;  4O6J A;  1QZZ A;  4HYE A;  2GIV A;  4Y13 A;  5DCF A;  5D8K B;  1LVA A;  5BPI A;  3VOE A;  2H27 A;  3NEU A;  4HAM A;  3FM3 A;  3FXR A;  2DK8 A;  1MKM A;  4DNC A;  2RV8 A;  4IHT A;  3ULQ B;  2FA5 A;  2QM3 A;  3VEP A;  3GEZ A;  1ON1 A;  3FHZ A;  3WGG A;  1I1S A;  4KN7 X;  2P6T A;  3K69 A;  2W84 A;  3E3V A;  4HF2 A;  2XRO A;  3RPU A;  1XD7 A;  4GYI A;  2QQB A;  3PQK A;  1G6N A;  1BIA A;  1G3W A;  4EMS A;  1XGS A;  2DTR A;  5K1Y A;  3QAH A;  1HKT A;  2JRT A;  3K1M A;  3BPX A;  4BH9 A;  3FXU A;  4ENJ A;  3ZN1 A;  1SD7 A;  4G7Z F;  2F5D A;  3LAJ A;  3WU0 A;  5HS8 A;  3LAP A;  2QQA A;  4PGH A;  4XSZ F;  1REP C;  1R7J A;  5CJ9 A;  3U1D A;  2PEX A;  1HBX G;  5ICF A;  3SFZ A;  4RB3 C;  1MDM A;  4QWQ A;  5D4R A;  2D2W A;  1U5T C;  5CVU A;  4B09 A;  5BOX A;  4HLX A;  3WTX C;  4PGG A;  1DPR A;  1ZHF A;  3BPV A;  4A6E A;  5ERI A;  4AWX B;  3HSE A;  2H09 A;  4R1H A;  2XGX A;  2XAG A;  2MH9 A;  4XLP F;  4GXO A;  4LD5 A;  4HDV A;  1FY7 A;  3MAJ A;  4WX9 A;  5LRR A;  2ZKZ A;  2P5V A;  2WTE A;  2TDX A;  1FLI A;  2VOP A;  3R61 A;  2E7W A;  1XDS A;  3JAM Z;  2D1H A;  5D5W B;  3HRT A;  4L9J A;  1VTN C;  1HW1 A;  3FMR A;  1IAW A;  3C3W A;  4Q5S F;  4HF1 A;  1BI2 A;  1FYM A;  1U5T B;  3C7J A;  4YG2 F;  2QVO A;  2W57 A;  4OIR F;  1LNW A;  3KP6 A;  1B9M A;  5DCM A;  4ENK A;  3GXO A;  3F8N A;  3BRO A;  4ESJ A;  2KKO A;  5HS9 A;  5EEG A;  1U3E M;  5FB2 A;  1TQP A;  2HEO A;  5BMZ A;  1T98 A;  3EDP A;  3CJN A;  5BS6 A;  2HYG D;  4I09 A;  4JBA A;  1JHH A;  2IA2 A;  4A0X A;  1O3T A;  1PP7 U;  2VBY A;  2DO7 A;  2VE8 A;  3V8L A;  4KA4 A;  4L0Y B;  2LDU A;  5L3B A;  3E6D A;  3TKY A;  3WTS C;  2PJP A;  4A12 A;  1GXQ A;  2AS5 F;  2EFP A;  2F5E A;  3RIR A;  2CW0 F;  4UHT A;  5LEK A;  2P7V B;  2H94 A;  2XKP A;  2XUB A;  4MEX F;  2KJC A;  2CFX A;  3HHG A;  4L5I A;  2VC1 A;  2XAH A;  4HOB A;  2M45 A;  5TRD A;  2O8X A;  3KP2 A;  4ZH4 F;  2FNA A;  3GFM A;  3BOQ A;  2IT0 A;  4BQA A;  3KEO A;  2E1N A;  5E1Z B;  1R36 A;  3KLO A;  1QNT A;  4IPA A;  3COA C;  2ETH A;  1H9T A;  1ONV A;  2STW A;  4EM0 B;  3TO7 A;  3MCZ A;  2QBY B;  2H6B A;  4EGY A;  2HQR A;  2ESN A;  2L4M A;  1H0M A;  2P6S A;  3BDD A;  2MH2 A;  2IRF G;  1YW8 A;  1YG2 A;  2GWR A;  3M9A A;  3U9G A;  1GHC A;  1R5H A;  2EJR A;  4LLN A;  3Q9V A;  2DPD A;  1IN4 A;  4IRI A;  2H6C A;  3TOA A;  4Y15 A;  1U2W A;  3RDI A;  4GGG A;  3EUH A;  1YW9 A;  1LJ9 A;  1B6A A;  2ZNZ A;  2QZ8 A;  3F8M A;  2QWW A;  3O3K A;  1YW7 A;  3E6C C;  3CUQ A;  4CDG A;  1IF1 A;  1V3F A;  4GCV A;  2FBI A;  1P4X A;  1Z9C A;  1YYV A;  3J81 Z;  3BJ6 A;  4CYD A;  2RQP A;  2MC3 A;  3SZP A;  1Z05 A;  1SFX A;  4A5N A;  1SFU A;  2WWY A;  1XGN A;  4HDU A;  3F6V A;  1P2F A;  3VB2 A;  4MTD A;  1IN6 A;  4P9F A;  1BI3 A;  2RGV A;  2VC0 A;  2L3D A;  3ZP5 A;  3P9I A;  1ODD A;  4DQ2 A;  4HX4 A;  1TNS A;  4RGU A;  2MD5 A;  2HTS A;  1IUY A;  2A6H F;  3IRR A;  3J7A O;  1EH6 A;  2A6E F;  4MEY F;  3M7G A;  5CVV A;  1T39 A;  1IZ1 A;  2DLL A;  2IA0 A;  5E17 F;  4YII A;  2A07 F;  3R60 A;  3WOD F;  2L02 A;  2ACJ A;  4M72 A;  3B73 A;  3PQJ A;  2WV0 A;  2Z5U A;  5HOO A;  1K7A A;  4KDP A;  2QEN A;  1KU2 A;  3ISP A;  2OBP A;  1T6S A;  3ECH A;  1UB9 A;  1Z91 A;  4AVP A;  3LWF A;  4NQW A;  2OZ6 A;  3U2R A;  1ZG5 A;  1J75 A;  1B1B A;  2O61 A;  4AIJ A;  3HIF A;  2HR3 A;  1GVJ A;  4A5M A;  5E1X A;  3MFK A;  3ELK A;  2BV6 A;  3S2W A;  4MQ9 F;  3IL2 A;  1ZRE A;  1K78 B;  1Z6R A;  1F1Z A;  4BNC A;  1T0F A;  3IWF A;  3QP5 A;  2FMY A;  3V8K A;  1SD6 A;  4KNY A;  2Y48 A;  1S7O A;  2COM A;  4M6X A;  3JTG A;  4HX7 A;  4UV8 A;  2ZME B;  3KCC A;  5K5R A;  3ZMD A;  3ABT A;  2FBK A;  2HFH A;  1WWX A;  4WWC A;  5EEH A;  1J59 A;  4P55 A;  1MDM B;  2C6Y A;  1O3Q A;  2IPQ X;  3P9K A;  4M73 A;  2M8E A;  4BAY A;  3LA3 A;  4RB1 A;  3MEX A;  1DP7 P;  2HZT A;  1O7L A;  4Z2Y A;  3TOB A;  3V7C A;  2F5F A;  1S6L A;  3WE3 A;  3FWE A;  3GW2 A;  3GZ5 A;  3KEQ A;  4PZJ A;  3WE2 A;  1FZP B;  2HKX A;  2M30 A;  2ISY A;  4IHS A;  4I0A A;  4L0Z B;  1A04 A;  1XCV A;  1LB2 A;  5FLX Z;  3ZN0 A;  1DDN A;  4KYW A;  2K4J A;  1J2X A;  1RIO H;  1FSH A;  1P6R A;  5LGU A;  3OOP A;  3I59 A;  3G73 A;  1HKQ A;  4GO1 A;  2AXL A;  4KIC A;  3T5X A;  4HQM A;  1FNN A;  2Q0O A;  2JPC A;  4BHC A;  5DCM B;  1K6O A;  3H3Z A;  3TQN A;  3HSF A;  3SQN A;  2FF4 A;  2V1D A;  3WTU C;  3O2P E;  2DT5 A;  2XAF A;  4XBF A;  4ENM A;  2Q8K A;  3J80 K;  1AWC A;  5ILV A;  4U7B A;  1PUE E;  4MHG A;  1JHF A;  4BYY A;  1Y0U A;  4XLN F;  2E1C A;  2R3S A;  2JSC A;  4ENN A;  4HV5 A;  2CO5 A;  3I64 A;  2QLZ A;  4BXU A;  3ML6 A;  1YO5 C;  3GO5 A;  4Q48 A;  2G7U A;  1SFE A;  4UV9 A;  1Z1D A;  3MWM A;  3E5U A;  1NHA A;  1KU7 A;  2OU2 A;  2X4H A;  2YSR A;  4L9V A;  2FML A;  4IF4 A;  2VXZ A;  3L2C A;  4N9I A;  1SMT A;  1O3S A;  1ZN2 A;  4U88 A;  5CYV A;  4R8H A;  2MLG A;  4I98 B;  5HS7 A;  5ICG A;  5ILU A;  2UZK A;  1FP2 A;  1YS6 A;  1G3Y A;  2RC4 A;  5FFX A;  1J5Y A;  3IKT A;  2VOO A;  2QYO A;  2OQR A;  4AIK A;  1ZGJ A;  3F8C A;  1BM9 A;  3JSO A;  3DPL C;  2PI0 A;  1I1G A;  3LA7 A;  5AIP A;  1KA8 A;  2OZU A;  4KMU X;  3I71 A;  4RB0 A;  2HGC A;  2DQL A;  2R7F A;  2FXA A;  4M9Z A;  4NHJ A;  1FWZ A;  1RI7 A;  2M87 A;  2XVC A;  4CXF A;  1FBU A;  1YQA A;  5KVR A;  3V7R A;  2DW4 A;  1ZGA A;  2G9W A;  4IRG A;  4H0E A;  3DV8 A;  1GXP A;  1ON2 A;  2P4W A;  3GF2 A;  5DD8 A;  1R1V A;  2XV4 S;  4G6D A;  2VBX A;  1O7F A;  4JQF A;  1W7P A;  4F7Z A;  4U0Y A;  3ERE D;  3B02 A;  3I0T A;  3VOD A;  5HDN A;  2CWE A;  5LRS A;  1T38 A;  1J0R A;  4IXA A;  2HOE A;  2DQR A;  1TBX A;  2ZJ2 A;  4K2E A;  2LKP A;  5E8I A;  2DK5 A;  2GXB A;  4N9H A;  1J9I A;  2PN6 A;  1OPC A;  4LK1 F;  2HTJ A;  1FBS A;  2Q2E A;  2FQ3 A;  5KK1 A;  3BJA A;  1Q1H A;  3Q9S A;  5CVI A;  3GWZ A;  3JSP A;  2P8T A;  1OMI A;  1Z6T A;  3KP4 A;  5D5V B;  5LGT A;  1KYW A;  4CZZ A;  3T8R A;  4EGZ A;  2BBY A;  4HBL A;  6PAX A;  5HVQ C;  4ZYE A;  4S05 A;  3R4K A;  1LQ1 A;  1WRJ A;  3E6M A;  3E97 A;  1QGP A;  1S7A A;  5HLG A;  1O57 A;  4ZYD A;  3ZMS A;  4LLL A;  3KP7 A;  3QPH A;  1CGP A;  5CVR A;  1OYY A;  1R00 A;  1P4W A;  1ZAO A;  4M74 A;  3CO6 C;  3GVA A;  2Z3Y A;  4R79 A;  2HWV A;  2K27 A;  1IXC A;  5BPD A;  3HHH A;  5FO5 A;  1F4K A;  1EV7 A;  3F21 A;  1FC3 A;  1YLF A;  1BC8 C;  4M9X A;  3KP3 A;  5JR3 A;  4YFX F;  2PG4 A;  3QRF F;  3ECO A;  5F64 A;  1XCB A;  3K0L A;  4L5J A;  1H9G A;  5DD4 A;  2L4A A;  3HYI A;  1FOK A;  2FU4 A;  2UWM A;  5DYM A;  2FRH A;  1OYI A;  1RUO A;  5E18 F;  4E70 A;  2HDC A;  5L3D A;  1Z7U A;  1QZY A;  3IC7 A;  3DEU A;  2V6C A;  2QUF A;  5HDK A;  2VT3 A;  2P7C B;  3DP7 A;  5K5Q A;  4UXN A;  2HS5 A;  2JPB A;  3ZMZ A;  4HV6 A;  5H20 A;  1FYK A;  5A2Q K;  4QLC U;  1KU9 A;  4ZZL A;  4P9U A;  3ZPL A;  4EV0 A;  3ZMU A;  3RKY A;  5LLQ A;  3OV8 A;  2ZFW A;  2ISZ A;  4A6D A;  1IN8 A;  2PLY A;  4XRF A;  3DPT A;  4G7O F;  1HQC A;  4LJZ F;  1UHM A;  4HX8 A;  4Q47 A;  4RGS A;  2YX4 A;  2ESH A;  3WG9 A;  4HQE A;  1LEB A;  4OIN F;  2WC2 A;  1XN7 A;  3KLN A;  1HXD A;  4LG0 B;  3HSR A;  1YS7 A;  3TO9 A;  4EVI A;  4I02 A;  4NB5 A;  1ULY A;  3H92 A;  5D8L B;  4EQQ A;  4MQV A;  3MQ0 A;  1F9N A;  2EV5 A;  1TQI A;  2FOK A;  5JFR A;  3BZ6 A;  3I59 B;  3NQO A;  3WGI A;  4PCQ A;  4CHU A;  3CUO A;  1E17 A;  2XRN A;  3Q5F A;  1IRG A;  5LGN A;  2GA2 A;  2E7X A;  1ZLJ A;  3GYH X;  2QQ9 A;  5H6R A;  4UUV A;  4HA8 A;  2XAQ A;  1R1U A;  4LB5 A;  5JI6 A;  1ZG3 A;  3IWZ A;  2EFO A;  1IW7 F;  2NNY A;  3DQV C;  3WU1 B;  3QU6 A;  1G4D A;  1FBQ A;  4A0Z A;  5HLH A;  2MLK A;  3RYP A;  1FP1 D;  5ICC A;  3LST A;  2YR2 A;  1XMK A;  4FX4 A;  1ZAR A;  5ILS A;  4RAY A;  1PP8 F;  2VBZ A;  2PFB A;  3I54 A;  3C1D A;  3QOP A;  1YFH A;  5IT9 K;  2EV0 A;  2RKH A;  3F8B A;  2A61 A;  4OMZ A;  2O3F A;  3RKX A;  1L0O C;  4P96 A;  3QP6 A;  2OD5 A;  3I4P A;  1ZH5 A;  1LDD A;  2MA3 A;  5FFZ A;  3L00 A;  5FGM A;  2DI3 A;  2VN2 A;  4RS8 A;  4AD9 A;  3BP8 A;  3HRS A;  1XSD A;  4MGR A;  5ICE A;  1V4R A;  4M71 A;  4KMF A;  1W4M A;  5L3E A;  3HUG A;  5K5O A;  4JK1 X;  4L9N A;  2F2E A;  1BBY A;  1FX7 A;  1TW2 A;  1E2X A;  5HLI A;  2R7D A;  4HLY A;  2EB7 A;  3T0Y A;  4IRH A;  3FF5 A;  3NRV A;  1D3Y A;  5DUI A;  1I5Z A;  1STZ A;  2FSW A;  2GQQ A;  1KYZ A;  2XAJ A;  3RTR A;  3I58 A;  4EJW A;  2FNP A;  3W6J B;  5TJJ A;  4RGX A;  4WXD A;  2F5C A;  2PQ8 A;  3MZH A;  3FMS A;  1U78 A;  1J7K A;  3G3Z A;  3KE2 A;  5E20 A;  4U0V A;  4CGZ A;  1USS A;  2CSO A;  2EA2 A;  2J5O A;  2V9V A;  1W7P B;  2W25 A;  2IVM A;  2P5K A;  3DKW A;  4BHP A;  2NYX A;  5IT9 Z;  1FSE A;  1KQ9 A;  1XDU A;  2HYF A;  3SXY A;  2NRA C;  2K7L A;  2KRF A;  4U7D A;  1BI1 A;  3LA2 A;  3IKV A;  4TV7 A;  2IA1 A;  5FD6 A;  1T2K A;  5D5X B;  2O0Y A;  3QPT A;  4YFK F;  1MZB A;  1S29 A;  1RNL A;  1SD5 A;  4O3M A;  2ZCW A;  3R6S A;  1JXS A;  5AON A;  4YIF A;  1BJA A;  3JAM K;  1BOA A;  2LNB A;  2ZO4 A;  2BE5 F;  5IT3 A;  3WTY C;  4WF2 A;  5E8G A;  1AOY A;  4RAZ A;  4MNU A;  2D45 A;  3WTV C;  3H3U A;  3TDU C;  1MJ9 A;  1CF7 A;  5E1W A;  1XSV A;  2STT A;  1K78 A;  3IHU A;  2YU3 A;  1R1T A;  1I6X A;  3RI4 A;  1XMA A;  1JE8 A;  4I0B A;  3EYY A;  1WQ2 A;  4FX0 A;  4UVC A;  2G7H A;  3GFI A;  1LEA A;  3GUD A;  2ZME A;  3SZT A;  1XB4 A;  2PMU A;  1SAX A;  3FMQ A;  2A3S A;  3LQR A;  3R0A A;  1IN5 A;  2XAS A;  1KU3 A;  3KFW X;  4KT5 C;  3LQQ A;  1W7P D;  3J80 Z;  3CUQ C;  4G8X A;  1WKM A;  2EV6 A;  4M6Y A;  3D0S A;  4M9S A;  4P5O A;  1UST A;  4ETS A;  4I7H A;  2GA1 A;  4ESF A;  1TNT A;  2LSO A;  1R22 A;  3ZQ7 A;  5ED4 A;  2DU9 A;  1KGS A;  3V8J A;  1WI9 A;  5AIQ A;  2L54 A;  2JT1 A;  3KZZ A;  4XSX F;  3RJP A;  3M8F A;  1BI0 A;  1YIO A;  1TLH B;  2CG4 A;  2ZBK A;  2RDP A;  3DF8 A;  4WCG A;  2PMH A;  4A2U A;  5LEJ A;  4ON0 A;  1QBJ A;  4I01 A;  3IRQ A;  1QPM A;  3HRU A;  2LF7 A;  3CUQ B;  3RKW A;  1QO0 D;  1IN7 A;  1OYW A;  1RZ4 A;  3BY6 A;  2P5L C;  4N0B A;  4YFN F;  2W24 A;  3HOT A;  3W6K B;  1KQ0 A;  4KN4 X;  1ZLK A;  1B59 A;  4MTE A;  4EJU A;  4G94 A;  2D1V A;  4OIO F;  2KIF A;  2GAU A;  2HQN A;  2JZY A;  5HDG A;  5H6Q A;  1W5T A;  4KIF A;  1TTY A;  1FPQ A;  4L9T A;  2VOD A;  3HRM A;  1OR7 A;  1IXS B;  2KIM A;  4HZF A;  3R0J A;  2GXG A;  2FEZ A;  1JGS A;  3WTZ A;  1EH7 A;  3HTU A;  2NNN A;  5CVJ A;  2K4B A;  2EFW A;  5F6F A;  4LGW A;  1BC7 C;  2OAZ A;  3N4M A;  4UNO A;  2M1B A;  3BJO A;  2BYV E;  3L9F A;  3J81 K;  3K2Z A;  1MJA A;  3GFJ A;  4OIQ F;  4G6Q A;  2FBH A;  3ZMT A;  3EQL F;  3FZV A;  2CYY A;  2KJB A;  1ZRC A;  1FT9 A;  3DXJ F;  1D8J A;  2OA4 A;  5LHH A;  1FYL A;  3D5L A;  4D0P A;  1MD0 A;  5LBQ A;  2O03 A;  4CO8 A;  2EFN A;  3M8E A;  4WXH A;  1P4A A;  5J6X A;  3F8F A;  3P7N A;  3E6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...