4GGGA

Crystal structure of v66a/l68v czra in the zn(ii)bound state.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
DTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSAHVVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric inhibition of a zinc-sensing transcriptional repressor: insights into the arsenic repressor (ArsR) family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transcription regulator
molecule keywords Repressor protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gggA00
2EA2A 1U2WA 1H9GA 1ZG5A 4I2OA 5DCMB 1PP7U 3KETA 1WQ2A 2FBKA 1USTA 4GGGA 3BWGA 3MAJA 3IC7A 1BBYA 2J5OA 3L09A 4IRHA 4A2UA 2BYVE 2LNBA 2IA0A 1T2KA 1ZN2A 1TQIA 2G7HA 1KU9A 2BE5F 3M9AA 3I64A 3SXYA 2XAGA 2CG4A 1ON1A 4M6YA 5H6QA 3QRFF 5LGNA 4OMYA 1HXDA 4A5MA 3WGIA 2V6CA 5FB2A 4G8XA 2QQ9A 3RKWA 3U1DA 4NHJA 3T8TA 4R79A 1V3FA 2EFWA 4B09A 3GX4X 1DPUA 1O3QA 5TRDA 3WTSC 2FEZA 1SFXA 2V79A 4MGRA 2Z99A 2O8XA 3EYIA 3EUHA 4AIHA 3BJ6A 2FXAA 1RI7A 1FYMA 4MEYF 5E20A 3CTAA 2XUBA 1IF1A 4UVCA 2NNYA 4MQVA 1QPMA 1TQMA 1T0FA 2IJLA 4BYYA 4OIQF 1HBXG 1BIBA 3O3KA 4ZYDA 6PAXA 5F1RA 2UWMA 2IP2A 1IAWA 2QBYA 4HX8A 4Y13A 4EJWA 2A6HF 3M8EA 3ZP5A 2DPUA 2HR3A 4N9HA 3BJOA 3GFIA 1TQPA 2HOEA 2KRFA 2HS5A 2MA3A 1H0MA 2XHKA 3K9TA 1WSUA 2EFNA 4OMZA 4RB0A 1FWZA 2Z33A 4LGWA 5LLQA 2ZXJA 1D8JA 1W5SA 1LVAA 1LJ9A 3K1MA 2XKOA 2MD5A 2R3SA 1RIOH 4KA4A 1LDJA 1J7KA 3NEUA 4G7ZF 1B59A 1QZYA 2GQQA 5ED4A 5J8FA 1G3YA 1FPQA 3F8NA 1IXSB 3K1PA 3TOAA 3HRMA 4HAMA 1I1SA 2XGXA 4Y17A 2BBYA 1ZYRF 1XGOA 1SMYF 5D6EA 4I02A 2MLGA 3EETA 3ULQB 5DD4A 4BHBA 2MBFA 2K4JA 3DP7A 4ESBA 5BS6A 4LK1F 3DPLC 4GO1A 3KE2A 1UHWA 3BP8A 3RKXA 4P9FA 2DPDA 3EYYA 3H3ZA 2M1BA 2M8EA 2MLKA 1QGPA 1R36A 3MQ0A 2KIFA 1HSJA 4N0BA 4RGSA 1KYZA 2HKXA 5LHGA 2OBPA 2IA1A 1WI9A 1R7JA 4AD9A 1LQ1A 5KVRA 1XGMA 4M72A 2PMHA 3MEXA 3HRSA 2XAQA 4OIOF 5LEJA 4ASNA 3WTVC 3T0YA 4A5NA 1BJAA 1PDNC 4G6DA 3ECHA 3H92A 2HKOA 3RI4A 5ICFA 2EA4A 3SHFA 2IT0A 4RB1A 1FT9A 3E6BA 1LNWA 4GXOA 2QBYB 5E1ZB 3C3WA 4Q5SF 1IN8A 1EH7A 4ON0A 2P7VB 5JHUA 5HDKA 4IJAA 2O3FA 4EMSA 2W84A 5H20A 2ZBKA 4DQ2A 2UXNA 3ZMSA 1Z7UA 1MD0A 5EEHA 4A6DA 1TW3A 2HWVA 3PFIA 3MCZA 4HBLA 3P7NA 2PI0A 3HTSB 2X4HA 4HX4A 5D4SA 5J6XA 2IA2A 2JTVA 5L3EA 1KQ9A 4ZYHA 1BIAA 2LKPA 1RZ4A 2LDUA 4XSZF 5HDGA 2CSOA 1T38A 4KMFA 4LK0F 1CF7B 1KQ0A 1G4DA 3FMQA 3E5XA 4LD5A 3CJNA 2V1DA 3ZMVA 2D45A 3RPUA 3WTXC 4EJVA 4JQFA 3GXOA 2F5DA 4WF2A 4A0XA 4AVPA 4WCGA 3HSFA 1XGNA 1IN4A 2IVMA 3LQQA 2FBIA 3R0JA 2L01A 5CYVA 5JVTA 2EWNA 3ZMUA 5K5OA 2XKPA 1Q1HA 1BC7C 3DF8A 2OA4A 4BNCA 3WODF 3IWFA 3D5LA 2EV0A 4ENMA 4UV8A 1HKSA 3I59B 2AS5F 4PGHA 4AIJA 4XSXF 5DV5A 2QZ8A 2A69F 4UNOA 1I6XA 2RV8A 4HA8A 4IVNA 5BOXA 3I53A 2VXZA 4KT5C 1J2XA 3L2CA 1S29A 3SQNA 3WE3A 2RNJA 2H6BA 5A2QZ 1WWXA 3E6CC 5FD5A 2GAUA 2ZMEA 5LBQA 4HZFA 1J59A 1F4KA 1V4RA 5L3GA 2Q2EA 2P6TA 2VBWA 2FBHA 1MJBA 4Q48A 4XRFA 2FNPA 4ZYGA 2LF8A 2ZFWA 3V8JA 4KICA 1OPCA 1I5ZA 1YW7A 1HSTA 2O6GE 4ENKA 5FLXZ 4I0AA 3LQRA 3WTTC 2M5WA 5ILVA 3QPTA 4AIKA 1FYKA 5CJ9A 1WKMA 1GHCA 1P4XA 3RYRA 2XAHA 3BROA 2FE3A 1ODDA 2ACJA 3J7AO 3QU6A 5JFRA 2VT3A 3F6VA 1L3LA 1C0WA 4Y15A 1OYWA 2OAZA 1R1UA 3C18A 3BOQA 1OYYA 4KYWA 3CUOA 3MZHA 1CF7A 2G9WA 2W24A 1XCBA 3L00A 3DQVC 4S04A 2K27A 1SFEA 2VODA 2JZYA 4HDVA 1R58A 2K86A 1NHAA 3IRQA 4ESJA 1E17A 3SZPA 1RNLA 1BI0A 4EVIA 5JI6A 1QNTA 2DTRA 4BHPA 3GUDA 3HRUA 1MDMB 3DEUA 3TO7A 1BM9A 1UHMA 1XDSA 2L4MA 1YS7A 5DCFA 3IWZA 1XB4A 1A04A 1I1GA 2CWEA 2RC4A 2V9VA 1R00A 1LEBA 5CLSA 4LB5A 4WXDA 4EM0B 3I59A 3ZN1A 3ZMDA 1IN5A 1G6NA 1HKTA 4KDPA 4RGUA 2FSWA 3R4KA 3PQJA 2ESNA 3ML6A 1JHFA 2F5CA 2QQBA 1FP1D 3RIRA 4EGZA 3ECOA 3FM3A 2JSCA 2Y48A 4KN7X 4FX0A 2R7FA 3ZMZA 1P6RA 1KGSA 4S05A 2ZMEB 2LF7A 2QVOA 4BQAA 4B8XA 3E5UA 1FY7A 4LLGF 1QO0D 1R22A 3ABTA 2O0YA 5IT9Z 1BC8C 4O3MA 3ROUA 3GYHX 2ELHA 3GZ6A 2QENA 2D2WA 2KJBA 4L9JA 1D8KA 2A68F 3P9KA 3GW2A 1IW7F 1IZ1A 4CDGA 1MJ9A 1LDDA 1O7FA 2V1XA 3CUQC 2UZKA 3Q9VA 4O5VA 2F2EA 2EV6A 3J80Z 5D8LB 4N9IA 2Y0MA 1U6GA 2VC0A 5DYMA 3P9IA 2COMA 2IRFG 3HYIA 1U5TA 3TKYA 3WU1B 4U7BA 3GF2A 2G7UA 1P2FA 3M1EA 3G3ZA 2A3SA 1OR7A 4IPAA 2HQRA 3V7CA 2FMYA 2EK5A 1XMKA 5BPIA 4RAZA 2JT1A 4ZZLA 4KMUX 3EQLF 2E7XA 1YYVA 2HQNA 3C1DA 2O61A 1JHHA 2DK5A 4M9SA 4I98B 5HS9A 5HLHA 1F1ZA 3FXQA 2WTEA 3J81K 4MHGA 2HZTA 3BJAA 3WGHA 2PEXA 1AWCA 2ZNYA 5E1XA 1Z1DA 3VB2A 3TO6A 1S7AA 5E8GA 5FLXK 3FMRA 2E1CA 1R5HA 2A07F 3BZ6A 4OOIA 1VTNC 4CICA 3HOSA 3ABUA 1XN7A 3KZZA 4GCVA 2A5YB 5E17F 3KP2A 4ESFA 3Q5FA 4BAYA 2XROA 5HS7A 4EJTA 1ZGJA 5LEKA 5HLIA 2QM3A 2JPCA 5CVRA 3D0SA 3FMSA 5FGMA 3R0AA 4PZJA 1D5VA 2FQ3A 3J80K 1F9NA 1JXSA 1FBSA 1ZG3A 1H9TA 4ENNA 5K1YA 2EFPA 1STZA 1J9IA 1ZLKA 2XV4S 2LSOA 5DUIA 4RAYA 1GVJA 3ZN0A 5K5RA 5FO5A 3I0TA 1OYIA 4A0ZA 4IHSA 1Z6TA 3L7WA 1K7AA 2DU9A 3DFGA 3JAMZ 1FSHA 1L0OC 1FLIA 2EV5A 2QLZA 1KYWA 2R7DA 4EJUA 4KIFA 1K6OA 2PQ8A 4OIRF 2OZUA 4R8HA 4I09A 1FSEA 4A12A 1R1VA 2IW5A 1O3SA 3V8KA 3W6KB 3GFMA 2XAFA 2L4AA 5F6FA 4WWCA 4R1HA 1ZHFA 4YIIA 1UFMA 1ZRDA 2JRTA 2YPRA 1Z91A 2PBIA 5DD8A 1ZH5A 1BOAA 2F5FA 3HIFA 4U7DA 2RGVA 2QUFA 1KA8A 3G73A 4LFUA 4HOBA 4MNUA 4PCQA 2XIGA 2FOKA 1MGTA 3T5XA 1FC3A 3WGGA 4CYDA 2FF4A 4IRIA 5HOOA 1MJAA 2VC1A 4RB3C 1YW9A 2GXBA 3K1NA 2VN2A 3LA7A 4XLPF 1G3SA 1ZARA 4LG0A 2GA1A 5BQTA 4UXNA 2BV6A 2HTJA 3REOA 5BPDA 1W5TA 5D5VB 4HDUA 4L5JA 3JAMK 1PP8F 5H6RA 1YQAA 3I54A 3QP5A 1J0RA 5FD6A 4NQWA 1IXCA 1SD4A 2HGCA 1HW2A 2W57A 5EEGA 5E1WA 1K78B 2KIMA 1U5TC 1E2XA 2NRAC 3VEPA 3BDDA 3F3XA 3CO6C 1HQCA 3BY6A 2AXLA 3QAHA 1QBJA 1Y0UA 5LHIA 3P9CA 4EM1A 3KLNA 1UCRA 2Q0OA 3GO5A 3I58A 3F72A 3J81Z 5L3FA 5D8KB 4M74A 4Z2YA 4L5IA 1AOYA 4HQMA 5ILUA 2CQKA 1YFHA 3JTHA 5LGUA 2MH2A 4BHCA 4BXUA 1TNTA 3DPTA 4K2EA 4M6XA 1O3RA 2JPBA 5AIPA 2FU4A 2E7WA 5J8CA 1EH8A 2KIUA 4HF2A 1Z05A 4G6QA 1IXRC 2ZJ2A 1K79A 2RN7A 5FFXA 1T39A 4H0EA 1W7PB 1ZG1A 2FMLA 5FFZA 3KLOA 2OQRA 3TOBA 3U9GA 2DT5A 2Z9OA 3DV8A 4L9NA 4U0VA 2XVCA 3AAFA 5DCMA 1O57A 3H3UA 3L9FA 4P55A 1B6AA 2V1UA 1QZZA 1GXQA 2GXGA 4ENJA 2DBBA 4I7HA 1FBUA 2OZ6A 4HV5A 5F64A 2P8TA 2VE8A 3QPHA 1JGSA 2BEOA 1YIOA 3HTUA 1FYLA 1WRJA 4G7OF 4ETSA 1CGPA 3I4PA 4PDKA 3NQOA 5HLGA 3WG9A 3TO9A 2W25A 1DP7P 5D5UB 4LLLA 5L3DA 3CLOA 2M45A 4HW0A 3F21A 4GYGA 2H09A 2ZKZA 3HSRA 4KUMA 4I01A 2YX4A 1FX7A 1TLHB 2UXXA 4IF4A 4L9VA 2NYXA 1SAXA 3LFKA 1W7PD 4U0YA 1QQIA 5CVUA 4YFXF 5CVJA 1D3YA 2DAOA 2YSRA 2P7CB 4P96A 1B9NA 5TJJA 1KQ8A 1F5TA 4MTDA 3GVAA 5E18F 2FNAA 1T98A 1FOKA 3LSTA 3T8RA 2K02A 2W85A 2WC2A 1SMTA 3TQNA 2DFIA 4L18B 3HUGA 3COAC 3E6DA 1JE8A 1P4AA 2HYFA 1BI1A 1IRFA 2L54A 3C7JA 2H6CA 3M7GA 4U88A 4UVBA 3WTZA 2DLLA 4MEXF 3GZ5A 3K69A 4D0PA 2L02A 2L3DA 2RQPA 2Y75A 2HFHA 3KEOA 1HW1A 5KK1A 4ZZDA 3WTYC 3E5QA 1W7PA 3E3VA 3FX3A 5CVIA 4UUVA 3KCCA 1ZRCA 1KU2A 1YW8A 2DK8A 4CXFA 3MZYA 1I27A 2CYYA 4RB2C 4M73A 4WXHA 3V8LA 2CGPA 3KP5A 4A0YA 3MWMA 3B73A 1T6SA 1UB9A 3V7RA 4CO8A 4EV0A 3ZPLA 2P5VA 4UV9A 1ULYA 3KP6A 5CVVA 1SD6A 1IN7A 2Q8KA 1YG2A 1USSA 2HDCA 1J5YA 2DQLA 1YLFA 4M9ZA 4G9YA 4LJZF 1S3JA 4M71A 3N97A 2PLYA 4CHUA 5ICEA 5BMZA 3F23A 1YS6A 5LRSA 2EFQA 1YTYA 4JK1X 4HLXA 1MZBA 3DXJF 1EV7A 3ISPA 4QLCU 2CO5A 5DEQA 4FHTA 2STTA 2QWWA 3F22A 1SFUA 3SZTA 4I0BA 5D6FA 2IPQX 4L9TA 1XSXA 3U2RA 3HHGA 5AONA 3IKVA 1MKMA 2VBZA 1ZREA 1W4MA 1FBQA 2FA5A 2Z5UA 1P4WA 3WU0A 5LGTA 2NNNA 2PN6A 3LAJA 4FT8A 2E1NA 4WK8F 3NRVA 2ISZA 2VBXA 3TDUC 5D4RA 3CUQB 4TV7A 3TGNA 2F5EA 4O6JA 3OV8A 3ZQ7A 2HTSA 4PGGA 1U8RA 4HQEA 3KZYA 2RKHA 4ZYEA 2TDXA 3TDZC 3QU3A 4YIFA 4P5OA 2GWRA 1HW5A 1YO5C 3MFKA 3F8BA 3JSPA 3FXRA 2K7LA 1XDUA 1GXPA 4OIPF 3GEZA 2GIVA 3QP6A 2VT2A 2YR2A 2DI3A 1FNNA 5D5WB 1RUNA 4ZH4F 3I5UA 1G3TA 4YFKF 2XRNA 4QWQA 5A2QK 2EJRA 3N4MA 3F8FA 2EB7A 3W6JB 3LA3A 2FRHA 5IT9K 1BN5A 1BI3A 2QYOA 2MH9A 1B4AA 2MC3A 3KFWX 2A61A 3IKTA 3JW4A 5HVQC 1XSDA 4OINF 1IRGA 2PFBA 2M30A 3CDHA 4KFCA 1BI2A 2XAJA 2Z3YA 4IHTA 5ILSA 2BGCA 3IHUA 5LRRA 4OU0A 3O6BB 3RPQA 1SD7A 2KJCA 3WTUC 3FZVA 2VE9A 2GA2A 2OQGA 3KP4A 2PG4A 4Q47A 1OKRA 2KKOA 4HX7A 2WWYA 4M9XA 1ON2A 2RVCA 4EQQA 3V4GA 2A6EF 2D1HA 3ZMTA 5L3BA 4RS8A 3LAPA 1EH6A 1Z6RA 1Z9CA 1KU3A 4CGZA 1X3UA 2P6SA 3WTWC 5DUKA 5HDNA 4EGYA 3Q9SA 4MTEA 1IN6A 1XD7A 3F8CA 1TW2A 4RGRA 2YU3A 1U3EM 3KP3A 1S8NA 1J75A 2X0LA 2D1VA 1U78A 3F6OA 2GZWA 4YFNF 3R61A 1ZAOA 1B1BA 2ZO4A 4EM2A 3CO7C 4KN4X 1O7LA 4AWXB 2HEOA 2O03A 4KIBA 1KU7A 4WX9A 3BPXA 3CUQA 2HYGD 4YG2F 2ISYA 1REPC 5L3CA 3FWEA 4JBAA 3B02A 3FF5A 2STWA 3RTRA 3V7SA 2XASA 3HSEA 3M8FA 2ETHA 3FHZA 1S7OA 3T1BA 4LMYA 1TNSA 4HLYA 1ZGAA 3S2WA 4KNYA 4LB6B 1R1TA 4CZZA 4NB5A 4HYEA 1LB2A 1RUOA 4HF1A 2P5LC 4LLNA 3IRRA 1TBXA 1XCVA 4IRGA 2K4BA 5HS8A 3K0LA 3RYPA 3K2ZA 3GFLA 2M87A 4L0ZB 3QOPA 2VONA 4GYIA 4XBFA 1MDMA 3KEQA 4KIGA 1TTYA 4HF0A 5IT3A 3GLXA 4FX4A 3R6SA 4F7ZA 1B9MA 3GWZA 2C6YA 1FP2A 4IXAA 5D5XB 1ZLJA 2B0LA 1G3WA 3E97A 2PJPA 4XLNF 1DPRA 3LWFA 1PUEE 3HRTA 1LDKB 1S6LA 3IL2A 1ZRFA 2ADUA 4G94A 5ICGA 1XMAA 2PMUA 4P9UA 1P92A 3F8MA 4UVAA 3RDIA 1DUXC 4LG0B 2ZNZA 2EFOA 2DQRA 1OMIA 3R60A 3WE2A 2ESHA 3OOPA 4RGXA 4BH9A 1HKQA 5ERIA 3E6MA 2H94A 4HV6A 4EJOA 5DDGA 3ELKA 3BPVA 4L0YB 2ZCWA 3VODA 1K78A 3SFZA 2J5PA 4G7HF 3JSOA 3DKWA 2CFXA 1R23A 5K5QA 4WXCA 2OD5A 3I71A 2VOOA 5ICCA 2WV0A 4Q4ZF 3HOTA 1DDNA 1LEAA 4U0WA 1R5GA 2NS0A 2DO7A 4A6EA 5E8IA 2OU2A 2VOPA 2VBYA 3ERED 2H27A 3FM5A 3VFZA 2QQAA 3EDPA 5JR3A 2P4WA 1ONVA 1IUYA 1SD5A 4MQ9F 4E70A 3PQKA 3RKYA 2CW0F 1U5TB 2DW4A 3HHHA 3O2PE 3VOEA 3JTGA 1XGSA 2RDPA 2YX7A 2NAZA 5AIQA 1XSVA 2P5KA 3FXUA 1O3TA 4DNCA 5LHHA 3KP7A 3LA2A 4UHTA 3GFJA 3RJPA 1FZPB
chains in the Genus database with same CATH superfamily
2EA2A 1U2WA 3OYNA 1H9GA 1ZG5A 4I2OA 3J7AY 2LK2A 5DCMB 2M34A 4I99C 1PJRA 1PP7U 3KETA 1RKWA 1WQ2A 1XX5A 2FBKA 3P5JA 1SFKA 4FE4A 3AFHA 4CA0A 2MW8A 4CCNA 1USTA 2R7SA 4CCMA 3PNTA 4GGGA 4F91B 3BWGA 3MAJA 4BU2A 3IC7A 3CC4I 1BBYA 2DOAA 2J5OA 3L09A 4IRHA 3OIOA 4A2UA 2BYVE 2LNBA 5EYRA 2IA0A 1T2KA 1ZN2A 1TQIA 2G7HA 1KU9A 2BE5F 3M9AA 3OIQA 2XC7A 2AXTC 3I64A 3SXYA 2XAGA 2CG4A 1ON1A 1T33A 4M6YA 2KRHA 4IEJA 4C2TA 5H6QA 4X1EA 3PSFA 3QRFF 5JLXA 5LGNA 4OMYA 1YIJI 1QRYA 1HXDA 4M3BA 5GPAA 2D5VA 4A5MA 3PNYA 3WGIA 2V6CA 4A3JJ 3CMAI 5FB2A 3ZXSA 1ZKGA 3OYMA 4G8XA 2QQ9A 2L9VA 3RKWA 3U1DA 4NHJA 3T8TA 4R79A 1V3FA 4B3AA 1I3AA 2EFWA 4A3LJ 3DEEA 4B09A 3F0CA 3GX4X 1DPUA 1O3QA 5TRDA 1U8BA 3WTSC 4CH7A 3H0GJ 2FEZA 1SFXA 4J01A 2V79A 3CZ6A 2Z99A 4MGRA 1ORKA 1IRZA 2O8XA 2OF7A 3EUHA 4AIHA 4D5FA 3EYIA 3BJ6A 2FXAA 4W1UA 1RI7A 2ZJRF 1FYMA 3BR0A 5F1JA 3G4SI 2E36A 3JCUC 4MEYF 4NDLA 5E20A 3CTAA 4UUSB 3BG3A 1FIAA 2XUBA 1HLVA 4UVCA 3OYAA 1IF1A 2NNYA 2EIJH 4MQVA 1IC8A 1EKEA 1R5ID 3QYBA 1QPMA 2MSYA 1TQMA 1T0FA 1VQKI 2IJLA 4BYYA 1D0YA 4DYCA 4OIQF 1HBXG 1BIBA 1X1BA 2OC6A 1J75A 1ETXA 3O3KA 3K70C 2FQ4A 4ZYDA 5F0FA 6PAXA 5GAEJ 5F1RA 2UWMA 2IP2A 1IAWA 2QBYA 4F55A 2V1NA 3GTMJ 1DP3A 2WB1N 4HX8A 1YJNI 3RZDJ 4Y13A 4EJWA 2RNGA 1I50J 2E60A 3KYLA 2HQAA 2A6HF 1Y6IA 3M8EA 1X58A 2E2IJ 3ZP5A 2DPUA 1X4PA 1D5YA 1MW7A 2HR3A 4N9HA 3QYFA 5DTDA 5IOYA 2QSGX 3DPUA 2XB5A 5J4YA 1OCZH 1TWFJ 3DLAA 2Z1DA 3BJOA 3BQZA 3GFIA 1TQPA 5GAHJ 2HOEA 3CJRB 3DTKA 1Z3YA 2KRFA 4G6TB 2HS5A 2MA3A 1H0MA 5IYDJ 2ZXWH 1RR7A 2WBMA 2XHKA 1Y8QB 3K4BA 3K9TA 5FLMJ 2EFNA 1WSUA 2XPVA 4OMZA 4RB0A 1FWZA 2Z33A 2DMQA 4LGWA 5LLQA 3LSMA 4B44A 1JT0A 2ZXJA 1D8JA 1W5SA 2KLOA 1LVAA 1LJ9A 3K1MA 2XKOA 4C2MJ 2MD5A 2R3SA 1RIOH 3S2DJ 4KA4A 1LDJA 1SAUA 1J7KA 3NEUA 4G7ZF 1B59A 4MO7A 2NVYJ 4CCJA 1QZYA 2GQQA 2R7OA 5ED4A 2R92J 5J8FA 2QGUA 1O4XA 2DMPA 3W2AA 1YX3A 1G3YA 1MMNA 4FE7A 2DA5A 4LIVA 1FPQA 4XORA 3PO3J 3F8NA 4AU7A 2QF7A 5FJ8J 2W48A 1IXSB 1Y0NA 3K1PA 3TOAA 3HRMA 2ID3A 2LMDA 3EUKL 4HAMA 2XGXA 4Y17A 4BGDA 1I1SA 1HA8A 4ITVA 2EZKA 2BBYA 2JVHA 4CUGA 1ZYRF 1XGOA 1SMYF 5D6EA 1MBGA 4I02A 1PYVA 2CQQA 2MLGA 3M3YJ 3EETA 1WHUA 3S32A 3ULQB 5DD4A 4BHBA 1WJAA 1W36D 1S5LC 2X6YA 2Z2SB 3UR3C 4XRSG 1VF9A 2MBFA 2K4JA 3DP7A 4ESBA 5BS6A 2IS4A 4XKBA 4LK1F 3DPLC 2DFHA 4GO1A 2UV1A 4V2FA 4IZZA 1JJ6C 3KE2A 1UHWA 3BP8A 2X1CA 3D5RC 2Y30A 3RKXA 4P9FA 3J7ZI 2DPDA 3EYYA 2B63J 1OQYA 3H3ZA 2M1BA 2M8EA 2MLKA 3EUHC 2R5ZA 2IGOA 3FXKA 1QGPA 2EIMH 3OYDA 3L2WA 1R36A 3MQ0A 2KIFA 1HSJA 4N0BA 4RGSA 5IP6A 2PJRA 1KYZA 2HKXA 2VASA 5LHGA 2OBPA 2IA1A 4KITB 1ETYA 2E34A 1AKHA 1WI9A 2E35A 4A3CJ 1BW5A 3A0HC 1R7JA 4AD9A 4GDFA 5E3MA 1LQ1A 4PUSA 3A02A 1AHDP 5KVRA 3WU2C 1FOXA 1XGMA 4JP0A 4M72A 2PMHA 3MEXA 5M3FJ 2M3AA 3HRSA 2XAQA 4YRVA 2XGCA 4OIOF 2LBFB 5LEJA 4ASNA 2VKVA 4XM3A 3WTVC 1ERDA 3T0YA 2VL8A 4IL6C 2HOSA 4CYCA 2DT6A 4A5NA 1BJAA 1PDNC 2XF5A 4G6DA 4RAGA 3ECHA 3JRBA 1Z67A 3H92A 4BKXA 1R4MB 2HKOA 3BZCA 3ASNH 4FCYA 3RI4A 5IOZA 2M7AA 2EA4A 5ICFA 3SHFA 4ZTJA 2IT0A 4RB1A 1N75A 1FT9A 3E6BA 5EDNA 4XMYA 1LNWA 4GXOA 3RPUD 2QBYB 5E1ZB 3C3WA 4Q5SF 4GFBA 1VQ5I 3S14J 2G0EA 1IN8A 1EH7A 4ON0A 3AL0B 2P81A 2NOGA 2P7VB 3BR1A 3HOYJ 5JHUA 2CS3A 4A3GJ 2K40A 3JR9A 3S3NA 5HDKA 4IJAA 4XOPA 2K3FA 2O3FA 4EMSA 1MBKA 2W84A 4NC7A 5H20A 2ZBKA 2IGNA 4DQ2A 2UXNA 3ZMSA 2QEXI 2OJED 1Z7UA 3TP3A 1MD0A 5EEHA 4A6DA 1TW3A 2HWVA 3PFIA 5GPCA 3MCZA 1F36A 3P7NA 4HBLA 2PI0A 5DM7F 1UZCA 2XSDC 2CU7A 3HTSB 3MMYB 2X4HA 4HX4A 5D4SA 4V2GA 5J6XA 3VPRA 2IA2A 2JTVA 5L3EA 4DGWB 2EPFA 4FTHA 1KQ9A 2KHMA 3OSGA 1BIAA 2LKPA 3IUOA 4ZYHA 2V9KA 1RZ4A 2MC4A 4DW6A 3D5SC 2LDUA 3OYLA 3CCJI 3KZIC 5EG0B 4XSZF 5EJCA 3BG5A 1NG6A 2X1DA 4RMNA 1X1CA 5HDGA 2CSOA 4FETA 2EQRA 3IAS2 2R7TA 3AG4H 1T38A 4HG2A 4KMFA 1TP4A 2HNHA 4JX6A 4LK0F 1CF7B 3BR5A 4NC6A 2R7WA 1KQ0A 1G4DA 3FMQA 2LH9A 2EH3A 3E5XA 2CW7A 1IRXA 3CC2I 4LD5A 1WJFA 3CJNA 1E0EA 2V1DA 5IYCJ 3ZMVA 2D45A 5FKNA 1ENHA 3OYGA 3RPUA 3ZGKA 3WTXC 2ZMEC 2VLAA 4EJVA 3I4MJ 3S1NJ 2M9HA 2VPLA 2DOEA 4FQGA 4JQFA 2X51A 4PFOA 3GXOA 3SEQA 2F5DA 3OMYA 4WF2A 2XAUA 4A0XA 2RQQA 4AVPA 3HSFA 4WCGA 1XGNA 4BQOA 4YIRX 1IN4A 4CSWA 2IVMA 3LQQA 2FBIA 4M3DA 1XS9A 2KZGA 3R0JA 2L01A 3ZQHA 3LSRA 2BHYA 5CYVA 1P7IA 1D1AA 5JVTA 1Y56A 3TL4X 3CD6I 2EWNA 3ZMUA 4A3KJ 1IV6A 3E1SA 1FMWA 2X48A 5K5OA 2XKPA 1Q1HA 2R7RA 2R5ZB 1BC7C 4DBQA 3DF8A 2GLOA 2IGKA 3LSPA 2OA4A 4BNCA 2GOXB 1VQNI 5B3SH 1D1BA 3IWFA 3WODF 3D5LA 4PSXA 3OYBA 5TISC 3BG7A 2LY2A 4A3MJ 2EV0A 3CP2A 2QKLB 4ENMA 2HVQA 4UV8A 3GTQJ 1HKSA 3I59B 2X1EA 2AS5F 1JKPC 4PGHA 4AIJA 4XSXF 5DV5A 2QZ8A 2A69F 3LL7A 5CKTA 3ZQIA 4BBRJ 4UNOA 1I6XA 4XKCA 2RV8A 3DTIA 1JUSA 1OFCX 4HA8A 4IVNA 3LFUA 5BOXA 3I53A 2VXZA 2NVXJ 4RA2A 2K9SA 1A5JA 4KT5C 1J2XA 3L2CA 1S29A 3A03A 3SQNA 3WE3A 1JKOC 4HEA2 2RNJA 3Q0WA 1YE9A 2DJIA 2H6BA 4MFEA 5A2QZ 2DFFA 1WWXA 4Z6YA 4C3IJ 1BA5A 3E6CC 5E3OA 2LY9A 5FD5A 2GAUA 3IH2A 2NVTJ 1Y1WJ 2ZMEA 1FTTA 5LBQA 4HZFA 2M7BA 3S3MA 1J59A 2JUGA 1F4KA 1G8XA 1V4RA 3FXMA 5L3GA 2Q2EA 2P6TA 2VBWA 2FBHA 3DBLB 3GLLA 1MJBA 3KX2A 4Q48A 2L5QA 4XRFA 2FNPA 4XKWA 3ABMH 4ZYGA 5HNFA 4BACA 2LF8A 2ZFWA 3V8JA 2GOMA 1OPCA 4H4KC 4KICA 1I5ZA 1YW7A 4E4HA 1HSTA 4XLCA 2O6GE 4ENKA 5FLXZ 4I0AA 3ERMA 2ZXIA 3LQRA 1W36C 4DBRA 3WTTC 1SEUA 2M5WA 3ZQGA 4ZJZA 1WGXA 5ILVA 3QPTA 4HSTA 2JRMA 4AIKA 5CJ9A 1WKMA 3OSFA 1FYKA 1GHCA 3FIWA 4RBOA 1P4XA 1S7EA 4LG3A 3RYRA 2XAHA 3BROA 2MGQA 4X6AJ 2FE3A 2OCEA 1ODDA 2YS9A 2ACJA 3J7AO 3QU6A 4ZDOA 5JFRA 2VT3A 3F6VA 5KAFC 1OCCH 1LFBA 3CCEI 3X2QH 5EGOB 2UUZA 3K4JA 1L3LA 1C0WA 4Y15A 3JRAA 1OYWA 1BR1A 2OAZA 1R1UA 3E0JB 2F4IA 3C18A 3BOQA 2JK3A 2MYSA 3H1CA 1R49A 1OYYA 4KYWA 2R7QA 4C30A 4RM3A 3CUOA 3G2BA 3MZHA 1T0FC 4IOAF 3OOUA 1RESA 1CF7A 2G9WA 4E7JA 2W24A 3C2HA 1XCBA 1SANA 1DGWY 4XONA 3TMOA 3L00A 2OTLI 3DQVC 4CCOA 4S04A 1D0ZA 2K27A 1SFEA 3A0BC 3NAUA 2VODA 1K4TA 2JZYA 4HDVA 1R58A 2K86A 3GTJJ 1NHAA 5EZHA 3SZGA 3IRQA 5E3LA 2W1OA 5GAGJ 4ESJA 1ZK8A 1E17A 2DMNA 4BS9A 3K4MA 4A3DJ 5E3NA 4OWRB 3SZPA 5B66C 1RNLA 1BI0A 4EVIA 2BW3B 3S3OA 5JI6A 1QNTA 3CCYA 2I10A 2DTRA 2NOJB 3CMYA 4BHPA 4DOZA 3GUDA 3HRUA 3S16J 3OL4A 3DEUA 1MDMB 1K4SA 2W00A 1X1PA 3TO7A 4J00A 2Q1ZB 1N25A 3VDXA 3CC7I 1BM9A 1UHMA 1XDSA 2L9SA 2L4MA 1YS7A 1IUFA 4C2UA 3SYTA 4XOTA 2BXZA 5DCFA 2NXNB 2HZDA 4PJJA 4S0HB 3IWZA 1ZR4A 3K4KA 2HDDA 2Y31A 2K9NA 1XB4A 5J4VA 3S15J 2HI3A 1A04A 1I1GA 1IDYA 3N05A 4BY7J 2CWEA 3HKZN 2RC4A 4XN0A 2V9VA 1R00A 1UELB 2ZC2A 4PSWA 1LEBA 5CLSA 3AG1H 3AL0C 4LB5A 4AC0A 1V5GA 2TRTA 2E2JJ 4WXDA 2LC2A 4EM0B 3I59A 3ZN1A 3ZMDA 1IN5A 1V5FA 5KCMA 1G6NA 1HKTA 3ZQQA 1B8IA 1MMGA 2K85A 4KDPA 3OYCA 4RGUA 2FSWA 3R4KA 3PQJA 1WJ5A 4DYQA 1BL0A 1OCRH 2ESNA 2X9DA 2L7MP 3ML6A 1JHFA 2ZB9A 2F5CA 2QQBA 1FP1D 3BT9A 3RIRA 4EGZA 2O8KA 1GV2A 3W3CA 3ECOA 3FM3A 3PL8A 2JSCA 4IKFA 2Y48A 1JKRC 4KN7X 1UMQA 4FX0A 2R7FA 4NNJA 3ZMZA 1FTZA 1P6RA 1KGSA 4S05A 1H8AC 3Q0VA 2IXSA 2ZMEB 2FX0A 4P1WA 1WFXA 4F3QA 5J1YA 4A3EJ 2O5RA 4DYRA 3AG3H 2LF7A 2QVOA 3A01B 1W0TA 4BQAA 2DCEA 5J1RA 5EZGA 4B8XA 3E5UA 3ZQFA 1FY7A 2VKDA 3HXLA 4LLGF 1QO0D 1R22A 3ZQLA 1HDDC 4II2A 1A6IA 3ABTA 2O0YA 2CQNA 5IT9Z 5J3LA 1BC8C 4O3MA 3ROUA 3GYHX 2ELHA 3CESA 1JT6A 1HDPA 3GZ6A 2QENA 2D2WA 2KJBA 1JUPA 1D0XA 2QCOA 4L9JA 1D8KA 1BJZA 2A68F 2IS6A 3P9KA 2KT0A 3GW2A 4MLOA 4RAFA 2DXIA 1IW7F 3K4NA 5JHFA 4LITA 3GBGA 1IZ1A 4CDGA 4QIWN 1MJ9A 2JUCA 1LDDA 1O7FA 3CUQC 2V1XA 2UZKA 3Q9VA 1PVEA 2XPWA 3CMMA 3QYEA 5IP7J 4O5VA 2RAEA 2VJ4A 5EGOA 2F2EA 1U9NA 2EV6A 4XIDA 3J80Z 5D8LB 4KISA 2V26A 1OISA 4N9IA 3BTCA 2HOTA 2Y0MA 1U6GA 1Z7LA 2VC0A 3CCUI 3PUBA 5DYMA 3TW6A 2LP0A 5K7ZA 2K5CA 3P9IA 2Y2ZA 2COMA 4B3XA 2IRFG 1ETVA 3HYIA 1U5TA 3TKYA 3WU1B 3HOXJ 4U7BA 1VQ4I 2AO9A 3GF2A 3MD2A 2G7UA 5K7FA 1P2FA 1ETWA 3M1EA 3G3ZA 4D9JA 2A3SA 1OR7A 4J19A 4IPAA 1IG7A 1P7JA 2HQRA 3CF2A 3V7CA 2FMYA 3HC7A 2EK5A 1XMKA 3MN2A 5BPIA 4RAZA 2JT1A 4ZZLA 1MMAA 5B1BH 1YRNA 1X1DA 5DM6F 2EIKH 1ZELA 2XF7A 3OS1A 4KMUX 1QPIA 5IP9J 3EQLF 2R7XA 2E7XA 5JLWA 1YYVA 2HQNA 3C1DA 2O61A 4M3EA 1JHHA 2DK5A 2XPUA 4HSRA 4M9SA 2LTPA 4I98B 5HS9A 5HLHA 1TWGJ 1F1ZA 3KPHA 3FXQA 2WTEA 3J81K 4MHGA 4Y3OA 2HZTA 3BJAA 4RM2A 3WGHA 4CCLA 4B43A 1T95A 1M1EB 1T56A 3G6EI 4F52A 2MD0A 2PEXA 1AWCA 4NC8A 2ZNYA 5E1XA 1Z1DA 3VB2A 2VQLA 4FISA 3TO6A 1S7AA 2DOFA 5E8GA 1ZR2A 5FLXK 4XRMA 1T08B 3FMRA 3LMMA 2E1CA 1R5HA 2A07F 3BZ6A 4OOIA 1VTNC 4CICA 1VQ6I 1B8IB 3HOSA 1APLC 3ABUA 1XN7A 2Y0SA 1YX5A 3KZZA 1TWAJ 3JRCA 4GCVA 3HL2A 2A5YB 4QPQA 1LKXA 3AKZA 5E17F 5HLTA 1LFPA 3BR6A 4M6VA 3KP2A 5E79C 4ESFA 3S1RJ 1A35A 3Q5FA 4BAYA 4I76A 4A69C 4RLFA 2E1MB 5HS7A 2XROA 4XRSA 4EJTA 1LFUP 5EF6A 1ZGJA 5LEKA 2A5WA 5HLIA 2M8GX 3G71I 2QM3A 2JPCA 2W7NA 3JRFA 3SJMA 5CVRA 3D0SA 2P0WA 3FMSA 3CF5F 3BCAA 1P9QC 4HNVA 5FGMA 3R0AA 4PZJA 1D5VA 2CQ7A 1OCTC 2FQ3A 3J80K 3KYCB 4UUSA 1F9NA 1JXSA 3L2QA 1FBSA 1ZG3A 1H9TA 4ENNA 3ASOH 2B7EA 3CLQA 5K1YA 2EFPA 1STZA 3S17J 1J9IA 2HXOA 5FLVA 3M1CA 1ZLKA 2V6EA 2XV4S 2LSOA 2R93J 5DUIA 1FEXA 4RAYA 3H5RA 1GVJA 3TEDA 1LE8A 2AQEA 3ZN0A 5F27A 3H9GA 5K5RA 4XNFA 2VJIA 2DA6A 3I0TA 5FO5A 3I4NJ 3S1MJ 2KRCA 1OYIA 3GTLJ 4A0ZA 3HB9A 4EEFG 3VSKA 4IHSA 1Z6TA 3L7WA 2M0CA 2CQXA 3HM5A 1K7AA 2DU9A 3DFGA 3JAMZ 1FSHA 1L0OC 4E7ZA 5CQGA 2LR8A 3MKYB 4IHXA 1FLIA 4PJMA 4NUBA 2EV5A 3C2BA 2QLZA 1JTXA 3HGYA 4BJTA 1KYWA 2R7DA 1WJDA 1K61A 3QPLA 1X4OA 2I5UA 4CCKA 1XC5A 4EJUA 1ZQ3P 4KIFA 2ECBA 2KZVA 1K6OA 2PQ8A 2XGEA 3HPHA 2OZUA 4LIUA 4OIRF 3PJRA 3K4CA 4R8HA 3OYKA 2R4GA 4I09A 1FSEA 4A12A 2OCCH 1R1VA 2E5NA 5IY5H 2R7UA 1X3WB 5EEAA 2IW5A 3TW7A 1X2MA 1O3SA 3V8KA 4HPQA 3VSLA 2DN0A 3W6KB 3GFMA 2XAFA 2L4AA 2XRLA 5F6FA 4WWCA 4R1HA 2L7KA 4UUTA 2BOLA 1RKTA 1ZHFA 3MVPA 4YIIA 3EUAA 1YRNB 1UFMA 1ZRDA 2ZSIB 1JTYA 2ELJA 2JRTA 2YPRA 1Z91A 2PBIA 5DD8A 1ZH5A 1BOAA 1KZHA 2F5FA 5M3MJ 2JQ7A 2O7OA 3W6VA 3HIFA 3W2WA 1RR8C 4U7DA 2RGVA 3FKJA 4IX7A 2QUFA 1KA8A 3G73A 2DYSH 2WAQA 4E7KA 2O9LA 3NWSA 1Y8RB 4LFUA 4HRIA 4HOBA 4N4OB 4MNUA 2DJNA 4PCQA 1H89C 2XIGA 2FOKA 1MGTA 3CCLI 3T5XA 1TL8A 2X6WA 1ZGWA 3WG7H 5IPAA 2BY2A 1K6YA 3FISA 1FC3A 3WGGA 4CYDA 4HNTA 2FF4A 4IRIA 2F4MB 5HOOA 1X3ZB 1BW6A 4E6KG 1MJAA 2VC1A 1BR2A 4RB3C 5FRMA 3FXOA 1YW9A 2GXBA 3K1NA 2VQCA 2VN2A 3LA7A 2LLKA 3G1OA 4XLPF 2LY1A 1G3SA 3DLLF 1ZARA 4LG0A 1GLNA 3FBNB 1TWCJ 3JRDA 2GA1A 2PJRB 1X2NA 3HKZA 5BQTA 3B6AA 2BV6A 4UXNA 1VQ7I 2HTJA 2DYRH 3BCBA 3REOA 1GDTA 1JUMA 5BPDA 4XK4A 2KPMA 1VI0A 1W5TA 5D5VB 1QVTA 4IHYA 2M4GA 4HDUA 4L5JA 3JAMK 1PP8F 5H6RA 4CZCA 1YQAA 3I54A 3QP5A 3LSGA 2LBFA 2WY8Q 1J0RA 1OLTA 1X19A 4XLAA 5FD6A 4NQWA 4JX5A 1IGNA 1VQLI 2QKMB 4E7HA 3HOZJ 1IXCA 2L9NA 1SD4A 2HGCA 1HOMA 1HW2A 2W57A 1W0UA 4CYCB 1TT0A 5EEGA 3PSIA 5E1WA 1K78B 2X6XA 4BL0B 3QQAA 2VJJA 4B4CA 1I3QJ 2KIMA 1DU6A 3CDLA 4JOMA 1U5TC 2V7FA 2EBIA 1QA6A 1E2XA 1N78A 2NRAC 1YITI 3VEPA 3BDDA 3F3XA 2LYCA 1HQCA 3HGGA 3CO6C 1LE8B 4IQJA 3BY6A 3I9V2 2AXLA 4BEHB 3QAHA 1QBJA 2HXIA 1JKQC 1Y0UA 3BLYA 5LHIA 3P9CA 4EM1A 3KLNA 1UCRA 2Q0OA 3GO5A 2CV0A 4BXFA 3VYSB 3I58A 3F72A 2OTJI 1IO2A 3HOUJ 3J81Z 3HUGB 5L3FA 5GTIC 3U1KA 5D8KB 4M74A 3S8PA 4Z2YA 4L5IA 1AOYA 2MFZA 2HYJA 1YJWI 1SVLA 2HQ5A 4HQMA 5ILUA 2CQKA 1AA7A 3JTHA 5LGUA 2QA4I 3DBRB 1YFHA 2MH2A 2V4JC 3G1LA 4BHCA 4BXUA 5GADJ 3MKZA 3O8GA 3EPZA 1TNTA 3DPTA 4K2EA 4M6XA 1O3RA 1YOVB 2JPBA 2CW8A 1UG0A 2OUMA 5AIPA 2FU4A 2E7WA 1DGRM 2BHZA 1MMDA 5J8CA 3CDIA 1EH8A 2KIUA 1J09A 3FHNA 5GP9A 2K9MA 3JRHA 1Z05A 4HF2A 5IYBJ 1MBEA 2E1MC 3K4LA 4G6QA 1IXRC 1HC8A 1Y1VJ 2ZJ2A 4OAYA 4M3GA 4D1QA 2NS7A 1K79A 1VQPI 2BZTA 2JWTA 2RN7A 3CCRI 5FFXA 4BXXJ 5H2FC 1T39A 4H0EA 3RKQA 1HF0A 2JA7J 4XLEA 1W7PB 2ZXHA 4JX4A 2HPMA 1ZG1A 2FMLA 1FJLA 5FFZA 3KLOA 2OQRA 4ZYAA 2JVGA 3ZOBA 3TOBA 3OWTA 3U9GA 1FIPA 1E3HA 1WVRA 2WA0A 1NH3A 4V19K 2DT5A 3L1PA 1QU3A 3DV8A 2CUFA 4L9NA 4U0VA 2XVCA 3AAFA 5DCMA 3V42A 1O57A 2Z9OA 1ITYA 3H3UA 2BY3A 3L9FA 3OY9A 4P55A 3RCOA 3IV5A 2E5ZA 1B6AA 4E7LA 2V1UA 1QZZA 2IS2A 1GXQA 1WH5A 5B5EC 4QTRA 2HU9A 4QPOA 2GXGA 3QPSA 4ENJA 2DBBA 4I7HA 1FBUA 2OZ6A 4HV5A 5F64A 2P8TA 3OR2C 2VE8A 1POGA 3QPHA 1NK2P 1JGSA 2BEOA 2FD5A 2X85A 4ZTFA 1UG2A 3BR3A 2YU9J 1RRJA 1XPXA 1YIOA 3HTUA 3M8JA 1FYLA 2AQFA 3LSJA 1WRJA 4G7OF 4Y7NJ 4XICA 3HG9A 4ETSA 1CGPA 3I4PA 4XQFA 4PDKA 3NQOA 5HODA 3RQIA 2EILH 5HLGA 1WJEA 3VYTB 3OYEA 3WG9A 3TO9A 2W25A 1R6RA 3H5NA 1DP7P 4AM3A 1A31A 5D5UB 4LLLA 4BJ6C 5L3DA 3CLOA 3JRIA 1VFCA 2M45A 2VJ5A 1U0JA 3NARA 2BY1A 4HW0A 3F21A 4GYGA 2KL4A 3I56I 2H09A 1XTAA 2ZKZA 2L9RA 3HSRA 4UB8C 2LD5A 1MNEA 4KUMA 1JJ8C 2R7ZJ 3DCFA 4I01A 2YX4A 2BVMA 1FMVA 1FX7A 2GBYA 1TLHB 2UXXA 4IF4A 3HEFA 4C9YA 1YJ9I 3U21A 3LSKA 2FUG2 2H8WA 4L9VA 1GT0C 3IH4A 1WCMJ 2NYXA 2E71A 1SAXA 3LFKA 1W7PD 4U0YA 4F93B 2ID6A 1QQIA 5CVUA 4YFXF 2KMUA 5CVJA 1D3YA 2DAOA 4BE1A 5LFAA 3GTOJ 2YSRA 2P7CB 4P96A 1B9NA 5TJJA 2FJ1A 5KAIC 1KQ8A 3L2VA 4BJ5C 2VB6A 4PJNA 1DU0A 1Z77A 2JSPA 3F9KA 5GTHC 1F5TA 2M2EA 4MTDA 3GVAA 2EZIA 5E18F 3MZ8A 2NVUB 2FNAA 1UHSA 1T98A 5CQEA 4AYBN 1FOKA 3LSTA 3T8RA 2Q2EB 2K02A 2W85A 3TP0A 4BQQA 3QOEA 1B72B 3JRGA 4D7MA 2WC2A 1SMTA 1UAAA 2L7FP 3TQNA 2DFIA 3ABLH 2Y9YA 4L18B 3HUGA 1A36A 1OJLA 3DBHB 3COAC 3E6DA 5C44J 1JE8A 1P4AA 2HYFA 1K83J 1BI1A 1IRFA 2ECCA 2IS1A 1W1WE 3SDBA 4AUXA 2L54A 3C7JA 5F0CA 2KQRA 3H5AA 1W5CC 3FBIB 2H6CA 3M7GA 4U88A 5HNHA 4PFPA 4NBQA 4UVBA 5FKOA 5JVGF 3WTZA 2DLLA 3M4OJ 3Q0UA 4MEXF 3GZ5A 3K69A 4D0PA 2L02A 2JMWA 1LVKA 2KIQA 2L3DA 3PNVA 4BE0A 1XG1A 2RQPA 2KISA 2Y75A 1HCRA 1WJBA 3BTJA 2HFHA 1R4NB 3KEOA 1HW1A 5KK1A 1GVDA 3DKXA 4ZZDA 3WTYC 1D1CA 3E5QA 1W7PA 3E3VA 3FX3A 2M4KA 4UB6C 4DZJA 3L2RA 2DT7B 5CVIA 4UUVA 2F4OB 3KCCA 4AYBA 2KDZA 3ZQCA 1KU2A 1ZRCA 4BE2A 1YW8A 2DK8A 4CXFA 1G59A 3GTKJ 1FOYA 2RREA 3MZYA 2JN6A 1I27A 2CYYA 3BTLA 1SFOJ 3BR2A 1IDZA 4RB2C 9ANTA 3OYHA 4M73A 4OAZA 2VQGA 4WXHA 3V8LA 2CGPA 3KP5A 3C2GA 4A0YA 3MWMA 2R5YA 4YELA 1Z0XA 3B73A 2CV2A 2B9SA 2IBDA 1T6SA 3PUFA 5C4XJ 4B48A 1UB9A 3V7RA 4CO8A 1ZTRA 4EV0A 4I6ZA 3H9QA 3ZPLA 2P5VA 2H8RA 4UV9A 5BNGA 2DA4A 1ULYA 1QHGA 3KP6A 5CVVA 1AU7A 1SD6A 1NG7A 1IN7A 1RC9A 1N77A 2Q8KA 1YG2A 3QODA 1USSA 4ZC3A 1Z21A 2HDCA 3DEWA 1J5YA 4A93J 2DQLA 1YLFA 4MFDA 2F5VA 4M9ZA 3PFYA 4G9YA 2W82A 4LJZF 2LKXA 1XMXA 3O8HA 4C3JJ 1S3JA 4M71A 4QSHA 3JREA 3N97A 1AKHB 1I6HJ 1R71A 2PLYA 4PJLA 3LNQA 4CHUA 5ICEA 5BMZA 3F23A 1YS6A 1NTCA 5LRSA 3Q3SA 2HOAA 2R0QC 2DMUA 2EFQA 4C3HJ 1YTYA 4JK1X 4HLXA 1S9HA 1MZBA 2XGDA 2WAQN 3ZR8X 3DXJF 1IJWC 1EV7A 1KONA 1G2HA 3ISPA 2BXYA 4QLCU 2CO5A 3BC8A 3FXJA 5DEQA 4FHTA 2DA1A 2I8DA 1RPWA 4XR6A 2STTA 2QWWA 3F22A 1SFUA 3SZTA 4I0BA 2VUMJ 5D6FA 2IPQX 4L9TA 1XSXA 4IHVA 3U2RA 3HHGA 1X1AA 5AONA 3IKVA 1MKMA 1GV5A 5KNLA 2VBZA 1B72A 1W4MA 4YEJA 4BDYA 2LREA 1FBQA 2VKHA 3DU6A 1ZREA 2FA5A 2Z5UA 1P4WA 3HZJA 3WU0A 2X6OA 3OIPA 5LGTA 2NNNA 2VIXA 2PN6A 3LAJA 3GTGJ 3VYRB 4FT8A 2E1NA 4WK8F 1MNMC 4DIQA 4ABZA 3D1NI 3NRVA 2LFBA 1JGGA 2M0MA 2E2HJ 2ISZA 2VBXA 4M3FA 2H1KA 3TDUC 5D4RA 3CUQB 4TV7A 3TGNA 3RJPA 2F5EA 4DZPA 2CUJA 3A1YA 1WPKA 4O6JA 3OV8A 5C3EJ 4Y4RA 3ZQ7A 3B6CA 2HTSA 4PGGA 3GZNB 3WHBA 1U8RA 2VQHA 3MKWB 5EG0A 4HQEA 3KZYA 2RKHA 1WJCA 4ZYEA 2TDXA 2DFEA 5F04A 3QU3A 3TDZC 2H1LA 2QSHX 4YIFA 5J1UA 4P5OA 3LSIA 3CMEI 2GWRA 5K7HA 1HW5A 1VZ0A 3VYUB 2JA5J 2R7VA 1YO5C 3MFKA 3F8BA 4ZDPA 3JSPA 3HJEA 3FXRA 2K7LA 1SC7A 3UKGA 1XDUA 1GXPA 4OIPF 3GEZA 2GIVA 1YI2I 3QP6A 2VT2A 1JI8A 2YR2A 2DI3A 1TWHJ 2DODA 1FNNA 3A4CA 5D5WB 1RUNA 3FKIJ 1WH7A 5FKKA 2VI6A 5KHDA 2MABA 3RSNA 4ZH4F 3I5UA 1G3TA 4XLHA 2XRNA 4BUPA 4YFKF 4QWQA 5A2QK 4E7IA 2GM4A 2EJRA 2XSJC 3FDYA 1NK3P 3N4MA 3F8FA 2EB7A 3ZRGA 4MIMA 5FROA 2R5YB 2VXDA 3W6JB 3HOVJ 2KDOA 3LA3A 4U87A 3NWTA 2FRHA 5IT9K 1BN5A 4D7NA 1BI3A 1I39A 3SEZA 2OPTA 2QYOA 1DQUA 2Z16A 2MH9A 1B4AA 2MC3A 3KFWX 2A61A 3IKTA 3IP4B 3JW4A 5HVQC 2DDBA 2EINH 1XSDA 4OINF 3FK7A 4RDUA 2ZJPF 3HDDA 1IRGA 2PFBA 2M30A 1VQMI 3CDHA 3RQ4A 1V55H 2QQ8A 4KFCA 1BI2A 2XAJA 2Z3YA 4IHTA 5ILSA 3BZKA 3OYJA 4XLFA 5B1AH 2BGCA 2F48A 1MBFA 3IHUA 5LRRA 3L2UA 4OU0A 3O6BB 1SD7A 2KJCA 3RPQA 3WTUC 1S72I 3FZVA 2EZLA 1TC3C 3S1QJ 2VE9A 2GA2A 2OQGA 4XKVA 3CCSI 3KP4A 1VQ9I 2PG4A 3BG6A 4ANJA 4Q47A 1OKRA 2KKOA 4HX7A 2WWYA 4M9XA 2COBA 1ON2A 2RVCA 4EQQA 3V4GA 4W97A 2A6EF 4AVZA 2D1HA 3ZMTA 2DA7A 5L3BA 4HNUA 4RS8A 3LAPA 1EH6A 1Z6RA 2ICWG 2PX9A 1Z9CA 2JA8J 1KU3A 4A3IJ 1E3OC 2JJ7A 4CGZA 1X3UA 4Y33A 3GTPJ 2P6SA 3K6GA 1Y39A 2CV1A 2NVQJ 1FOWA 2ZJQF 3WTWC 1MBHA 5DUKA 2LVSA 2E1OA 5HDNA 4EGYA 3Q9SA 4MTEA 3K70D 1IN6A 1XD7A 1OCPA 3F8CA 1TW2A 2ME0A 4RGRA 2DMTA 2HDWA 3ZCOA 2YU3A 2CUZA 2XB0X 1PUFA 1U3EM 3QWLA 1EF4A 3KP3A 1S8NA 5FRNA 4B1RA 2X0LA 2D1VA 2JA2A 1U78A 1OCOH 2LOOA 2GZWA 3F6OA 4ZDLA 4YFNF 1QHHD 3R61A 1ZAOA 1B1BA 2ZO4A 4EM2A 2AHQA 4GRIA 1V54H 3S93A 1Z3XA 1ACIA 3CO7C 4KN4X 1O7LA 4AWXB 2HEOA 2O03A 3KYDB 1VQOI 1SVMA 3PM1A 2LG4A 4KIBA 3SDGA 4XN3A 1KU7A 4WX9A 2WADA 3BPXA 3CUQA 2HYGD 3PO2J 4YG2F 1LPQA 2ISYA 1LUJB 1REPC 5L3CA 3FWEA 3MKLA 4JBAA 3B02A 3FF5A 2K9QA 2STWA 1F43A 3RTRA 3V7SA 2XASA 4BDZA 1ETQA 3HSEA 3RZOJ 2GIZA 4LOCA 2ZSHB 3M8FA 3DWLE 3BTIA 2ETHA 3CCVI 3FHZA 1S7OA 1R9TJ 3T1BA 2DA3A 2L0KA 4LMYA 2N8GA 5LD2C 2JA6J 1TNSA 4HLYA 4X0GA 3IAM2 1ZGAA 4BQNA 3S2WA 2ZFUA 5CPRB 1MIJA 4KT6A 2K3PA 4KNYA 2DA2A 4F92B 4LB6B 1R1TA 4CZZA 2LKSA 4NB5A 2FOWA 4HYEA 1LB2A 2IAIA 1RUOA 4BBSJ 2V9PA 1VQ8I 4HF1A 2P5LC 3CCQI 3DKYA 1UJ8A 1EJ9A 1WI3A 4LLNA 4FASD 3IRRA 1TBXA 1XCVA 4JYKA 1QVUA 5C4JJ 4IRGA 2K4BA 5HS8A 3K0LA 3RYPA 3S2HJ 3OR1C 3K2ZA 3H0DA 2BW3A 3GFLA 1H88C 2M87A 4L0ZB 3QOPA 2VONA 4GYIA 3ABKH 2ME6A 2K9LA 3TBIA 4XBFA 2LRDA 1MDMA 3KEQA 3OS2A 4KIGA 2OV7A 1TTYA 5DS9A 4BY1J 3OS0A 4IOCF 4HF0A 4PJ0C 1TT5B 3IH3A 5IT3A 3FXLA 2BY0A 3GLXA 4FX4A 3H36A 4XL9A 3R6SA 4F7ZA 1B9MA 3H3VK 4A3FJ 3GWZA 2C6YA 3ESWB 2F6CA 1FP2A 4IXAA 3HPGA 5D5XB 2CRGA 4IHWA 1T8IA 1ZLJA 2CJJA 1MSFC 3HBLA 2HVRA 3A2KA 2KP6A 5FKLA 2B0LA 1G3WA 3E97A 2PJPA 4XLNF 1DPRA 3LWFA 3I55I 1PUEE 3HRTA 1LDKB 3K2AA 1S6LA 2WAEA 2WY7Q 5M5YJ 3IL2A 1ZRFA 5F0HA 4UY8I 2ADUA 3BG9A 4G94A 2HVSA 5ICGA 1XMAA 1MH3A 3W2VA 2PMUA 4P9UA 1P92A 4B47A 3F8MA 3PIPF 1IV8A 3CCMI 1BR4A 3GMEA 3K10A 2PMZN 4IQ4A 2MG4A 4UVAA 3RDIA 2Y9ZA 1YHQI 1MSEC 1DUXC 4A3BJ 4Y52J 4LG0B 2EZHA 2WV1A 1MMSA 2CMPA 3CJQB 1SVOA 2ZNZA 1EA3A 3J7YJ 2HPIA 2EFOA 2VPRA 2DQRA 3SFIA 1OMIA 3R60A 3WE2A 2ESHA 3WHCA 1ETKA 3OOPA 2CUEA 2W4SA 2CFOA 4RGXA 4BH9A 1HKQA 3LOCA 5M5XJ 1BOBA 1GUUA 1MH4A 1MBJA 5ERIA 3KIOA 1PUFB 2QSFX 2KFDA 3PIOF 3E6MA 2H94A 3A01A 4HV6A 4EJOA 2DDAA 1MNDA 3AG2H 3CJTB 4NQWB 4RLQA 5DDGA 3E7LA 3ELKA 3BPVA 2ELKA 5TGTA 4L0YB 2IGMA 2ZCWA 3VODA 1A6QA 1K78A 3VWBA 1U9OA 3SFZA 1V5EA 2J5PA 4G7HF 2L7ZA 4G12A 3M07A 3JSOA 3DKWA 1CQTA 4D5CA 4PK4A 3LSHA 4BEHA 1E3PA 2CFXA 1R23A 5K5QA 4N4NB 4WXCA 2OD5A 2BVLA 3G1MA 3I71A 2XF6A 2VOOA 5ICCA 2WV0A 3CQZJ 4IO9F 4EATA 4Q4ZF 2CH0A 3HOTA 1DDNA 3DTEA 2Y69H 3ONQA 1LEAA 1QZEA 3K7AJ 4U0WA 1R5GA 2NS0A 2GXAA 3FK6A 2DO7A 2TCTA 3I3LA 3DU5A 4A6EA 5E8IA 2OU2A 2VOPA 2VBYA 3ERED 2XDVA 2H27A 3FM5A 3GCMA 2QQAA 3EDPA 3H9JA 5FKMA 5J40A 3VFZA 5JR3A 2P4WA 1ONVA 1IUYA 4E7SA 1SD5A 3H35A 1O3TA 4AIDA 3KEYA 5F08A 4DJAA 1OR7C 2NS8A 4MQ9F 4E70A 2WB1A 1Q1VA 3PQKA 3RKYA 5M5WJ 3CP8A 2CW0F 1U5TB 3BQYA 2DW4A 2Y0SN 2IEKA 2DTZA 3HHHA 3O2PE 3OL3A 3HOWJ 3VOEA 3OYIA 3JTGA 2L2OA 1XGSA 2RDPA 2YX7A 4L5EA 1WZ2A 2PMZA 1TZLA 2A6TA 2NAZA 4KJZA 5AIQA 3OYFA 1XSVA 2YUSA 1RETA 2P5KA 2VKEA 3FXUA 1VNDA 4DNCA 4UHTA 3KP7A 5LHHA 3LA2A 4II3A 2WAFA 1ETOA 3GFJA 5J47A 3UNGC 2A05A 2E19A 1FZPB
chains in the Genus database with same CATH topology
2EA2A 1U2WA 1H9GA 1ZG5A 4I2OA 5DCMB 1PP7U 3KETA 1WQ2A 2FBKA 1USTA 4GGGA 3BWGA 3MAJA 3IC7A 1BBYA 2J5OA 3L09A 4IRHA 4A2UA 2BYVE 2LNBA 2IA0A 1T2KA 1ZN2A 1TQIA 2G7HA 1KU9A 2BE5F 3M9AA 3I64A 3SXYA 2XAGA 2CG4A 1ON1A 4M6YA 5H6QA 3QRFF 5LGNA 4OMYA 1HXDA 4A5MA 3WGIA 2V6CA 5FB2A 4G8XA 2QQ9A 3RKWA 3U1DA 4NHJA 3T8TA 4R79A 1V3FA 2EFWA 4B09A 3GX4X 1DPUA 1O3QA 5TRDA 3WTSC 2FEZA 1SFXA 2V79A 4MGRA 2Z99A 2O8XA 3EYIA 3EUHA 4AIHA 3BJ6A 2FXAA 1RI7A 1FYMA 4MEYF 5E20A 3CTAA 2XUBA 1IF1A 4UVCA 2NNYA 4MQVA 1QPMA 1TQMA 1T0FA 2IJLA 4BYYA 4OIQF 1HBXG 1BIBA 3O3KA 4ZYDA 6PAXA 5F1RA 2UWMA 2IP2A 1IAWA 2QBYA 4HX8A 4Y13A 4EJWA 2A6HF 3M8EA 3ZP5A 2DPUA 2HR3A 4N9HA 3BJOA 3GFIA 1TQPA 2HOEA 2KRFA 2HS5A 2MA3A 1H0MA 2XHKA 3K9TA 1WSUA 2EFNA 4OMZA 4RB0A 1FWZA 2Z33A 4LGWA 5LLQA 2ZXJA 1D8JA 1W5SA 1LVAA 1LJ9A 3K1MA 2XKOA 2MD5A 2R3SA 1RIOH 4KA4A 1LDJA 1J7KA 3NEUA 4G7ZF 1B59A 1QZYA 2GQQA 5ED4A 5J8FA 1G3YA 1FPQA 3F8NA 1IXSB 3K1PA 3TOAA 3HRMA 4HAMA 1I1SA 2XGXA 4Y17A 2BBYA 1ZYRF 1XGOA 1SMYF 5D6EA 4I02A 2MLGA 3EETA 3ULQB 5DD4A 4BHBA 2MBFA 2K4JA 3DP7A 4ESBA 5BS6A 4LK1F 3DPLC 4GO1A 3KE2A 1UHWA 3BP8A 3RKXA 4P9FA 2DPDA 3EYYA 3H3ZA 2M1BA 2M8EA 2MLKA 1QGPA 1R36A 3MQ0A 2KIFA 1HSJA 4N0BA 4RGSA 1KYZA 2HKXA 5LHGA 2OBPA 2IA1A 1WI9A 1R7JA 4AD9A 1LQ1A 5KVRA 1XGMA 4M72A 2PMHA 3MEXA 3HRSA 2XAQA 4OIOF 5LEJA 4ASNA 3WTVC 3T0YA 4A5NA 1BJAA 1PDNC 4G6DA 3ECHA 3H92A 2HKOA 3RI4A 5ICFA 2EA4A 3SHFA 2IT0A 4RB1A 1FT9A 3E6BA 1LNWA 4GXOA 2QBYB 5E1ZB 3C3WA 4Q5SF 1IN8A 1EH7A 4ON0A 2P7VB 5JHUA 5HDKA 4IJAA 2O3FA 4EMSA 2W84A 5H20A 2ZBKA 4DQ2A 2UXNA 3ZMSA 1Z7UA 1MD0A 5EEHA 4A6DA 1TW3A 2HWVA 3PFIA 3MCZA 4HBLA 3P7NA 2PI0A 3HTSB 2X4HA 4HX4A 5D4SA 5J6XA 2IA2A 2JTVA 5L3EA 1KQ9A 4ZYHA 1BIAA 2LKPA 1RZ4A 2LDUA 4XSZF 5HDGA 2CSOA 1T38A 4KMFA 4LK0F 1CF7B 1KQ0A 1G4DA 3FMQA 3E5XA 4LD5A 3CJNA 2V1DA 3ZMVA 2D45A 3RPUA 3WTXC 4EJVA 4JQFA 3GXOA 2F5DA 4WF2A 4A0XA 4AVPA 4WCGA 3HSFA 1XGNA 1IN4A 2IVMA 3LQQA 2FBIA 3R0JA 2L01A 5CYVA 5JVTA 2EWNA 3ZMUA 5K5OA 2XKPA 1Q1HA 1BC7C 3DF8A 2OA4A 4BNCA 3WODF 3IWFA 3D5LA 2EV0A 4ENMA 4UV8A 1HKSA 3I59B 2AS5F 4PGHA 4AIJA 4XSXF 5DV5A 2QZ8A 2A69F 4UNOA 1I6XA 2RV8A 4HA8A 4IVNA 5BOXA 3I53A 2VXZA 4KT5C 1J2XA 3L2CA 1S29A 3SQNA 3WE3A 2RNJA 2H6BA 5A2QZ 1WWXA 3E6CC 5FD5A 2GAUA 2ZMEA 5LBQA 4HZFA 1J59A 1F4KA 1V4RA 5L3GA 2Q2EA 2P6TA 2VBWA 2FBHA 1MJBA 4Q48A 4XRFA 2FNPA 4ZYGA 2LF8A 2ZFWA 3V8JA 4KICA 1OPCA 1I5ZA 1YW7A 1HSTA 2O6GE 4ENKA 5FLXZ 4I0AA 3LQRA 3WTTC 2M5WA 5ILVA 3QPTA 4AIKA 1FYKA 5CJ9A 1WKMA 1GHCA 1P4XA 3RYRA 2XAHA 3BROA 2FE3A 1ODDA 2ACJA 3J7AO 3QU6A 5JFRA 2VT3A 3F6VA 1L3LA 1C0WA 4Y15A 1OYWA 2OAZA 1R1UA 3C18A 3BOQA 1OYYA 4KYWA 3CUOA 3MZHA 1CF7A 2G9WA 2W24A 1XCBA 3L00A 3DQVC 4S04A 2K27A 1SFEA 2VODA 2JZYA 4HDVA 1R58A 2K86A 1NHAA 3IRQA 4ESJA 1E17A 3SZPA 1RNLA 1BI0A 4EVIA 5JI6A 1QNTA 2DTRA 4BHPA 3GUDA 3HRUA 1MDMB 3DEUA 3TO7A 1BM9A 1UHMA 1XDSA 2L4MA 1YS7A 5DCFA 3IWZA 1XB4A 1A04A 1I1GA 2CWEA 2RC4A 2V9VA 1R00A 1LEBA 5CLSA 4LB5A 4WXDA 4EM0B 3I59A 3ZN1A 3ZMDA 1IN5A 1G6NA 1HKTA 4KDPA 4RGUA 2FSWA 3R4KA 3PQJA 2ESNA 3ML6A 1JHFA 2F5CA 2QQBA 1FP1D 3RIRA 4EGZA 3ECOA 3FM3A 2JSCA 2Y48A 4KN7X 4FX0A 2R7FA 3ZMZA 1P6RA 1KGSA 4S05A 2ZMEB 2LF7A 2QVOA 4BQAA 4B8XA 3E5UA 1FY7A 4LLGF 1QO0D 1R22A 3ABTA 2O0YA 5IT9Z 1BC8C 4O3MA 3ROUA 3GYHX 2ELHA 3GZ6A 2QENA 2D2WA 2KJBA 4L9JA 1D8KA 2A68F 3P9KA 3GW2A 1IW7F 1IZ1A 4CDGA 1MJ9A 1LDDA 1O7FA 2V1XA 3CUQC 2UZKA 3Q9VA 4O5VA 2F2EA 2EV6A 3J80Z 5D8LB 4N9IA 2Y0MA 1U6GA 2VC0A 5DYMA 3P9IA 2COMA 2IRFG 3HYIA 1U5TA 3TKYA 3WU1B 4U7BA 3GF2A 2G7UA 1P2FA 3M1EA 3G3ZA 2A3SA 1OR7A 4IPAA 2HQRA 3V7CA 2FMYA 2EK5A 1XMKA 5BPIA 4RAZA 2JT1A 4ZZLA 4KMUX 3EQLF 2E7XA 1YYVA 2HQNA 3C1DA 2O61A 1JHHA 2DK5A 4M9SA 4I98B 5HS9A 5HLHA 1F1ZA 3FXQA 2WTEA 3J81K 4MHGA 2HZTA 3BJAA 3WGHA 2PEXA 1AWCA 2ZNYA 5E1XA 1Z1DA 3VB2A 3TO6A 1S7AA 5E8GA 5FLXK 3FMRA 2E1CA 1R5HA 2A07F 3BZ6A 4OOIA 1VTNC 4CICA 3HOSA 3ABUA 1XN7A 3KZZA 4GCVA 2A5YB 5E17F 3KP2A 4ESFA 3Q5FA 4BAYA 2XROA 5HS7A 4EJTA 1ZGJA 5LEKA 5HLIA 2QM3A 2JPCA 5CVRA 3D0SA 3FMSA 5FGMA 3R0AA 4PZJA 1D5VA 2FQ3A 3J80K 1F9NA 1JXSA 1FBSA 1ZG3A 1H9TA 4ENNA 5K1YA 2EFPA 1STZA 1J9IA 1ZLKA 2XV4S 2LSOA 5DUIA 4RAYA 1GVJA 3ZN0A 5K5RA 5FO5A 3I0TA 1OYIA 4A0ZA 4IHSA 1Z6TA 3L7WA 1K7AA 2DU9A 3DFGA 3JAMZ 1FSHA 1L0OC 1FLIA 2EV5A 2QLZA 1KYWA 2R7DA 4EJUA 4KIFA 1K6OA 2PQ8A 4OIRF 2OZUA 4R8HA 4I09A 1FSEA 4A12A 1R1VA 2IW5A 1O3SA 3V8KA 3W6KB 3GFMA 2XAFA 2L4AA 5F6FA 4WWCA 4R1HA 1ZHFA 4YIIA 1UFMA 1ZRDA 2JRTA 2YPRA 1Z91A 2PBIA 5DD8A 1ZH5A 1BOAA 2F5FA 3HIFA 4U7DA 2RGVA 2QUFA 1KA8A 3G73A 4LFUA 4HOBA 4MNUA 4PCQA 2XIGA 2FOKA 1MGTA 3T5XA 1FC3A 3WGGA 4CYDA 2FF4A 4IRIA 5HOOA 1MJAA 2VC1A 4RB3C 1YW9A 2GXBA 3K1NA 2VN2A 3LA7A 4XLPF 1G3SA 1ZARA 4LG0A 2GA1A 5BQTA 4UXNA 2BV6A 2HTJA 3REOA 5BPDA 1W5TA 5D5VB 4HDUA 4L5JA 3JAMK 1PP8F 5H6RA 1YQAA 3I54A 3QP5A 1J0RA 5FD6A 4NQWA 1IXCA 1SD4A 2HGCA 1HW2A 2W57A 5EEGA 5E1WA 1K78B 2KIMA 1U5TC 1E2XA 2NRAC 3VEPA 3BDDA 3F3XA 3CO6C 1HQCA 3BY6A 2AXLA 3QAHA 1QBJA 1Y0UA 5LHIA 3P9CA 4EM1A 3KLNA 1UCRA 2Q0OA 3GO5A 3I58A 3F72A 3J81Z 5L3FA 5D8KB 4M74A 4Z2YA 4L5IA 1AOYA 4HQMA 5ILUA 2CQKA 1YFHA 3JTHA 5LGUA 2MH2A 4BHCA 4BXUA 1TNTA 3DPTA 4K2EA 4M6XA 1O3RA 2JPBA 5AIPA 2FU4A 2E7WA 5J8CA 1EH8A 2KIUA 4HF2A 1Z05A 4G6QA 1IXRC 2ZJ2A 1K79A 2RN7A 5FFXA 1T39A 4H0EA 1W7PB 1ZG1A 2FMLA 5FFZA 3KLOA 2OQRA 3TOBA 3U9GA 2DT5A 2Z9OA 3DV8A 4L9NA 4U0VA 2XVCA 3AAFA 5DCMA 1O57A 3H3UA 3L9FA 4P55A 1B6AA 2V1UA 1QZZA 1GXQA 2GXGA 4ENJA 2DBBA 4I7HA 1FBUA 2OZ6A 4HV5A 5F64A 2P8TA 2VE8A 3QPHA 1JGSA 2BEOA 1YIOA 3HTUA 1FYLA 1WRJA 4G7OF 4ETSA 1CGPA 3I4PA 4PDKA 3NQOA 5HLGA 3WG9A 3TO9A 2W25A 1DP7P 5D5UB 4LLLA 5L3DA 3CLOA 2M45A 4HW0A 3F21A 4GYGA 2H09A 2ZKZA 3HSRA 4KUMA 4I01A 2YX4A 1FX7A 1TLHB 2UXXA 4IF4A 4L9VA 2NYXA 1SAXA 3LFKA 1W7PD 4U0YA 1QQIA 5CVUA 4YFXF 5CVJA 1D3YA 2DAOA 2YSRA 2P7CB 4P96A 1B9NA 5TJJA 1KQ8A 1F5TA 4MTDA 3GVAA 5E18F 2FNAA 1T98A 1FOKA 3LSTA 3T8RA 2K02A 2W85A 2WC2A 1SMTA 3TQNA 2DFIA 4L18B 3HUGA 3COAC 3E6DA 1JE8A 1P4AA 2HYFA 1BI1A 1IRFA 2L54A 3C7JA 2H6CA 3M7GA 4U88A 4UVBA 3WTZA 2DLLA 4MEXF 3GZ5A 3K69A 4D0PA 2L02A 2L3DA 2RQPA 2Y75A 2HFHA 3KEOA 1HW1A 5KK1A 4ZZDA 3WTYC 3E5QA 1W7PA 3E3VA 3FX3A 5CVIA 4UUVA 3KCCA 1ZRCA 1KU2A 1YW8A 2DK8A 4CXFA 3MZYA 1I27A 2CYYA 4RB2C 4M73A 4WXHA 3V8LA 2CGPA 3KP5A 4A0YA 3MWMA 3B73A 1T6SA 1UB9A 3V7RA 4CO8A 4EV0A 3ZPLA 2P5VA 4UV9A 1ULYA 3KP6A 5CVVA 1SD6A 1IN7A 2Q8KA 1YG2A 1USSA 2HDCA 1J5YA 2DQLA 1YLFA 4M9ZA 4G9YA 4LJZF 1S3JA 4M71A 3N97A 2PLYA 4CHUA 5ICEA 5BMZA 3F23A 1YS6A 5LRSA 2EFQA 1YTYA 4JK1X 4HLXA 1MZBA 3DXJF 1EV7A 3ISPA 4QLCU 2CO5A 5DEQA 4FHTA 2STTA 2QWWA 3F22A 1SFUA 3SZTA 4I0BA 5D6FA 2IPQX 4L9TA 1XSXA 3U2RA 3HHGA 5AONA 3IKVA 1MKMA 2VBZA 1ZREA 1W4MA 1FBQA 2FA5A 2Z5UA 1P4WA 3WU0A 5LGTA 2NNNA 2PN6A 3LAJA 4FT8A 2E1NA 4WK8F 3NRVA 2ISZA 2VBXA 3TDUC 5D4RA 3CUQB 4TV7A 3TGNA 2F5EA 4O6JA 3OV8A 3ZQ7A 2HTSA 4PGGA 1U8RA 4HQEA 3KZYA 2RKHA 4ZYEA 2TDXA 3TDZC 3QU3A 4YIFA 4P5OA 2GWRA 1HW5A 1YO5C 3MFKA 3F8BA 3JSPA 3FXRA 2K7LA 1XDUA 1GXPA 4OIPF 3GEZA 2GIVA 3QP6A 2VT2A 2YR2A 2DI3A 1FNNA 5D5WB 1RUNA 4ZH4F 3I5UA 1G3TA 4YFKF 2XRNA 4QWQA 5A2QK 2EJRA 3N4MA 3F8FA 2EB7A 3W6JB 3LA3A 2FRHA 5IT9K 1BN5A 1BI3A 2QYOA 2MH9A 1B4AA 2MC3A 3KFWX 2A61A 3IKTA 3JW4A 5HVQC 1XSDA 4OINF 1IRGA 2PFBA 2M30A 3CDHA 4KFCA 1BI2A 2XAJA 2Z3YA 4IHTA 5ILSA 2BGCA 3IHUA 5LRRA 4OU0A 3O6BB 3RPQA 1SD7A 2KJCA 3WTUC 3FZVA 2VE9A 2GA2A 2OQGA 3KP4A 2PG4A 4Q47A 1OKRA 2KKOA 4HX7A 2WWYA 4M9XA 1ON2A 2RVCA 4EQQA 3V4GA 2A6EF 2D1HA 3ZMTA 5L3BA 4RS8A 3LAPA 1EH6A 1Z6RA 1Z9CA 1KU3A 4CGZA 1X3UA 2P6SA 3WTWC 5DUKA 5HDNA 4EGYA 3Q9SA 4MTEA 1IN6A 1XD7A 3F8CA 1TW2A 4RGRA 2YU3A 1U3EM 3KP3A 1S8NA 1J75A 2X0LA 2D1VA 1U78A 3F6OA 2GZWA 4YFNF 3R61A 1ZAOA 1B1BA 2ZO4A 4EM2A 3CO7C 4KN4X 1O7LA 4AWXB 2HEOA 2O03A 4KIBA 1KU7A 4WX9A 3BPXA 3CUQA 2HYGD 4YG2F 2ISYA 1REPC 5L3CA 3FWEA 4JBAA 3B02A 3FF5A 2STWA 3RTRA 3V7SA 2XASA 3HSEA 3M8FA 2ETHA 3FHZA 1S7OA 3T1BA 4LMYA 1TNSA 4HLYA 1ZGAA 3S2WA 4KNYA 4LB6B 1R1TA 4CZZA 4NB5A 4HYEA 1LB2A 1RUOA 4HF1A 2P5LC 4LLNA 3IRRA 1TBXA 1XCVA 4IRGA 2K4BA 5HS8A 3K0LA 3RYPA 3K2ZA 3GFLA 2M87A 4L0ZB 3QOPA 2VONA 4GYIA 4XBFA 1MDMA 3KEQA 4KIGA 1TTYA 4HF0A 5IT3A 3GLXA 4FX4A 3R6SA 4F7ZA 1B9MA 3GWZA 2C6YA 1FP2A 4IXAA 5D5XB 1ZLJA 2B0LA 1G3WA 3E97A 2PJPA 4XLNF 1DPRA 3LWFA 1PUEE 3HRTA 1LDKB 1S6LA 3IL2A 1ZRFA 2ADUA 4G94A 5ICGA 1XMAA 2PMUA 4P9UA 1P92A 3F8MA 4UVAA 3RDIA 1DUXC 4LG0B 2ZNZA 2EFOA 2DQRA 1OMIA 3R60A 3WE2A 2ESHA 3OOPA 4RGXA 4BH9A 1HKQA 5ERIA 3E6MA 2H94A 4HV6A 4EJOA 5DDGA 3ELKA 3BPVA 4L0YB 2ZCWA 3VODA 1K78A 3SFZA 2J5PA 4G7HF 3JSOA 3DKWA 2CFXA 1R23A 5K5QA 4WXCA 2OD5A 3I71A 2VOOA 5ICCA 2WV0A 4Q4ZF 3HOTA 1DDNA 1LEAA 4U0WA 1R5GA 2NS0A 2DO7A 4A6EA 5E8IA 2OU2A 2VOPA 2VBYA 3ERED 2H27A 3FM5A 3VFZA 2QQAA 3EDPA 5JR3A 2P4WA 1ONVA 1IUYA 1SD5A 4MQ9F 4E70A 3PQKA 3RKYA 2CW0F 1U5TB 2DW4A 3HHHA 3O2PE 3VOEA 3JTGA 1XGSA 2RDPA 2YX7A 2NAZA 5AIQA 1XSVA 2P5KA 3FXUA 1O3TA 4DNCA 5LHHA 3KP7A 3LA2A 4UHTA 3GFJA 3RJPA 1FZPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA2 A;  1U2W A;  1H9G A;  1ZG5 A;  4I2O A;  5DCM B;  1PP7 U;  3KET A;  1WQ2 A;  2FBK A;  1UST A;  4GGG A;  3BWG A;  3MAJ A;  3IC7 A;  1BBY A;  2J5O A;  3L09 A;  4IRH A;  4A2U A;  2BYV E;  2LNB A;  2IA0 A;  1T2K A;  1ZN2 A;  1TQI A;  2G7H A;  1KU9 A;  2BE5 F;  3M9A A;  3I64 A;  3SXY A;  2XAG A;  2CG4 A;  1ON1 A;  4M6Y A;  5H6Q A;  3QRF F;  5LGN A;  4OMY A;  1HXD A;  4A5M A;  3WGI A;  2V6C A;  5FB2 A;  4G8X A;  2QQ9 A;  3RKW A;  3U1D A;  4NHJ A;  3T8T A;  4R79 A;  1V3F A;  2EFW A;  4B09 A;  3GX4 X;  1DPU A;  1O3Q A;  5TRD A;  3WTS C;  2FEZ A;  1SFX A;  2V79 A;  4MGR A;  2Z99 A;  2O8X A;  3EYI A;  3EUH A;  4AIH A;  3BJ6 A;  2FXA A;  1RI7 A;  1FYM A;  4MEY F;  5E20 A;  3CTA A;  2XUB A;  1IF1 A;  4UVC A;  2NNY A;  4MQV A;  1QPM A;  1TQM A;  1T0F A;  2IJL A;  4BYY A;  4OIQ F;  1HBX G;  1BIB A;  3O3K A;  4ZYD A;  6PAX A;  5F1R A;  2UWM A;  2IP2 A;  1IAW A;  2QBY A;  4HX8 A;  4Y13 A;  4EJW A;  2A6H F;  3M8E A;  3ZP5 A;  2DPU A;  2HR3 A;  4N9H A;  3BJO A;  3GFI A;  1TQP A;  2HOE A;  2KRF A;  2HS5 A;  2MA3 A;  1H0M A;  2XHK A;  3K9T A;  1WSU A;  2EFN A;  4OMZ A;  4RB0 A;  1FWZ A;  2Z33 A;  4LGW A;  5LLQ A;  2ZXJ A;  1D8J A;  1W5S A;  1LVA A;  1LJ9 A;  3K1M A;  2XKO A;  2MD5 A;  2R3S A;  1RIO H;  4KA4 A;  1LDJ A;  1J7K A;  3NEU A;  4G7Z F;  1B59 A;  1QZY A;  2GQQ A;  5ED4 A;  5J8F A;  1G3Y A;  1FPQ A;  3F8N A;  1IXS B;  3K1P A;  3TOA A;  3HRM A;  4HAM A;  1I1S A;  2XGX A;  4Y17 A;  2BBY A;  1ZYR F;  1XGO A;  1SMY F;  5D6E A;  4I02 A;  2MLG A;  3EET A;  3ULQ B;  5DD4 A;  4BHB A;  2MBF A;  2K4J A;  3DP7 A;  4ESB A;  5BS6 A;  4LK1 F;  3DPL C;  4GO1 A;  3KE2 A;  1UHW A;  3BP8 A;  3RKX A;  4P9F A;  2DPD A;  3EYY A;  3H3Z A;  2M1B A;  2M8E A;  2MLK A;  1QGP A;  1R36 A;  3MQ0 A;  2KIF A;  1HSJ A;  4N0B A;  4RGS A;  1KYZ A;  2HKX A;  5LHG A;  2OBP A;  2IA1 A;  1WI9 A;  1R7J A;  4AD9 A;  1LQ1 A;  5KVR A;  1XGM A;  4M72 A;  2PMH A;  3MEX A;  3HRS A;  2XAQ A;  4OIO F;  5LEJ A;  4ASN A;  3WTV C;  3T0Y A;  4A5N A;  1BJA A;  1PDN C;  4G6D A;  3ECH A;  3H92 A;  2HKO A;  3RI4 A;  5ICF A;  2EA4 A;  3SHF A;  2IT0 A;  4RB1 A;  1FT9 A;  3E6B A;  1LNW A;  4GXO A;  2QBY B;  5E1Z B;  3C3W A;  4Q5S F;  1IN8 A;  1EH7 A;  4ON0 A;  2P7V B;  5JHU A;  5HDK A;  4IJA A;  2O3F A;  4EMS A;  2W84 A;  5H20 A;  2ZBK A;  4DQ2 A;  2UXN A;  3ZMS A;  1Z7U A;  1MD0 A;  5EEH A;  4A6D A;  1TW3 A;  2HWV A;  3PFI A;  3MCZ A;  4HBL A;  3P7N A;  2PI0 A;  3HTS B;  2X4H A;  4HX4 A;  5D4S A;  5J6X A;  2IA2 A;  2JTV A;  5L3E A;  1KQ9 A;  4ZYH A;  1BIA A;  2LKP A;  1RZ4 A;  2LDU A;  4XSZ F;  5HDG A;  2CSO A;  1T38 A;  4KMF A;  4LK0 F;  1CF7 B;  1KQ0 A;  1G4D A;  3FMQ A;  3E5X A;  4LD5 A;  3CJN A;  2V1D A;  3ZMV A;  2D45 A;  3RPU A;  3WTX C;  4EJV A;  4JQF A;  3GXO A;  2F5D A;  4WF2 A;  4A0X A;  4AVP A;  4WCG A;  3HSF A;  1XGN A;  1IN4 A;  2IVM A;  3LQQ A;  2FBI A;  3R0J A;  2L01 A;  5CYV A;  5JVT A;  2EWN A;  3ZMU A;  5K5O A;  2XKP A;  1Q1H A;  1BC7 C;  3DF8 A;  2OA4 A;  4BNC A;  3WOD F;  3IWF A;  3D5L A;  2EV0 A;  4ENM A;  4UV8 A;  1HKS A;  3I59 B;  2AS5 F;  4PGH A;  4AIJ A;  4XSX F;  5DV5 A;  2QZ8 A;  2A69 F;  4UNO A;  1I6X A;  2RV8 A;  4HA8 A;  4IVN A;  5BOX A;  3I53 A;  2VXZ A;  4KT5 C;  1J2X A;  3L2C A;  1S29 A;  3SQN A;  3WE3 A;  2RNJ A;  2H6B A;  5A2Q Z;  1WWX A;  3E6C C;  5FD5 A;  2GAU A;  2ZME A;  5LBQ A;  4HZF A;  1J59 A;  1F4K A;  1V4R A;  5L3G A;  2Q2E A;  2P6T A;  2VBW A;  2FBH A;  1MJB A;  4Q48 A;  4XRF A;  2FNP A;  4ZYG A;  2LF8 A;  2ZFW A;  3V8J A;  4KIC A;  1OPC A;  1I5Z A;  1YW7 A;  1HST A;  2O6G E;  4ENK A;  5FLX Z;  4I0A A;  3LQR A;  3WTT C;  2M5W A;  5ILV A;  3QPT A;  4AIK A;  1FYK A;  5CJ9 A;  1WKM A;  1GHC A;  1P4X A;  3RYR A;  2XAH A;  3BRO A;  2FE3 A;  1ODD A;  2ACJ A;  3J7A O;  3QU6 A;  5JFR A;  2VT3 A;  3F6V A;  1L3L A;  1C0W A;  4Y15 A;  1OYW A;  2OAZ A;  1R1U A;  3C18 A;  3BOQ A;  1OYY A;  4KYW A;  3CUO A;  3MZH A;  1CF7 A;  2G9W A;  2W24 A;  1XCB A;  3L00 A;  3DQV C;  4S04 A;  2K27 A;  1SFE A;  2VOD A;  2JZY A;  4HDV A;  1R58 A;  2K86 A;  1NHA A;  3IRQ A;  4ESJ A;  1E17 A;  3SZP A;  1RNL A;  1BI0 A;  4EVI A;  5JI6 A;  1QNT A;  2DTR A;  4BHP A;  3GUD A;  3HRU A;  1MDM B;  3DEU A;  3TO7 A;  1BM9 A;  1UHM A;  1XDS A;  2L4M A;  1YS7 A;  5DCF A;  3IWZ A;  1XB4 A;  1A04 A;  1I1G A;  2CWE A;  2RC4 A;  2V9V A;  1R00 A;  1LEB A;  5CLS A;  4LB5 A;  4WXD A;  4EM0 B;  3I59 A;  3ZN1 A;  3ZMD A;  1IN5 A;  1G6N A;  1HKT A;  4KDP A;  4RGU A;  2FSW A;  3R4K A;  3PQJ A;  2ESN A;  3ML6 A;  1JHF A;  2F5C A;  2QQB A;  1FP1 D;  3RIR A;  4EGZ A;  3ECO A;  3FM3 A;  2JSC A;  2Y48 A;  4KN7 X;  4FX0 A;  2R7F A;  3ZMZ A;  1P6R A;  1KGS A;  4S05 A;  2ZME B;  2LF7 A;  2QVO A;  4BQA A;  4B8X A;  3E5U A;  1FY7 A;  4LLG F;  1QO0 D;  1R22 A;  3ABT A;  2O0Y A;  5IT9 Z;  1BC8 C;  4O3M A;  3ROU A;  3GYH X;  2ELH A;  3GZ6 A;  2QEN A;  2D2W A;  2KJB A;  4L9J A;  1D8K A;  2A68 F;  3P9K A;  3GW2 A;  1IW7 F;  1IZ1 A;  4CDG A;  1MJ9 A;  1LDD A;  1O7F A;  2V1X A;  3CUQ C;  2UZK A;  3Q9V A;  4O5V A;  2F2E A;  2EV6 A;  3J80 Z;  5D8L B;  4N9I A;  2Y0M A;  1U6G A;  2VC0 A;  5DYM A;  3P9I A;  2COM A;  2IRF G;  3HYI A;  1U5T A;  3TKY A;  3WU1 B;  4U7B A;  3GF2 A;  2G7U A;  1P2F A;  3M1E A;  3G3Z A;  2A3S A;  1OR7 A;  4IPA A;  2HQR A;  3V7C A;  2FMY A;  2EK5 A;  1XMK A;  5BPI A;  4RAZ A;  2JT1 A;  4ZZL A;  4KMU X;  3EQL F;  2E7X A;  1YYV A;  2HQN A;  3C1D A;  2O61 A;  1JHH A;  2DK5 A;  4M9S A;  4I98 B;  5HS9 A;  5HLH A;  1F1Z A;  3FXQ A;  2WTE A;  3J81 K;  4MHG A;  2HZT A;  3BJA A;  3WGH A;  2PEX A;  1AWC A;  2ZNY A;  5E1X A;  1Z1D A;  3VB2 A;  3TO6 A;  1S7A A;  5E8G A;  5FLX K;  3FMR A;  2E1C A;  1R5H A;  2A07 F;  3BZ6 A;  4OOI A;  1VTN C;  4CIC A;  3HOS A;  3ABU A;  1XN7 A;  3KZZ A;  4GCV A;  2A5Y B;  5E17 F;  3KP2 A;  4ESF A;  3Q5F A;  4BAY A;  2XRO A;  5HS7 A;  4EJT A;  1ZGJ A;  5LEK A;  5HLI A;  2QM3 A;  2JPC A;  5CVR A;  3D0S A;  3FMS A;  5FGM A;  3R0A A;  4PZJ A;  1D5V A;  2FQ3 A;  3J80 K;  1F9N A;  1JXS A;  1FBS A;  1ZG3 A;  1H9T A;  4ENN A;  5K1Y A;  2EFP A;  1STZ A;  1J9I A;  1ZLK A;  2XV4 S;  2LSO A;  5DUI A;  4RAY A;  1GVJ A;  3ZN0 A;  5K5R A;  5FO5 A;  3I0T A;  1OYI A;  4A0Z A;  4IHS A;  1Z6T A;  3L7W A;  1K7A A;  2DU9 A;  3DFG A;  3JAM Z;  1FSH A;  1L0O C;  1FLI A;  2EV5 A;  2QLZ A;  1KYW A;  2R7D A;  4EJU A;  4KIF A;  1K6O A;  2PQ8 A;  4OIR F;  2OZU A;  4R8H A;  4I09 A;  1FSE A;  4A12 A;  1R1V A;  2IW5 A;  1O3S A;  3V8K A;  3W6K B;  3GFM A;  2XAF A;  2L4A A;  5F6F A;  4WWC A;  4R1H A;  1ZHF A;  4YII A;  1UFM A;  1ZRD A;  2JRT A;  2YPR A;  1Z91 A;  2PBI A;  5DD8 A;  1ZH5 A;  1BOA A;  2F5F A;  3HIF A;  4U7D A;  2RGV A;  2QUF A;  1KA8 A;  3G73 A;  4LFU A;  4HOB A;  4MNU A;  4PCQ A;  2XIG A;  2FOK A;  1MGT A;  3T5X A;  1FC3 A;  3WGG A;  4CYD A;  2FF4 A;  4IRI A;  5HOO A;  1MJA A;  2VC1 A;  4RB3 C;  1YW9 A;  2GXB A;  3K1N A;  2VN2 A;  3LA7 A;  4XLP F;  1G3S A;  1ZAR A;  4LG0 A;  2GA1 A;  5BQT A;  4UXN A;  2BV6 A;  2HTJ A;  3REO A;  5BPD A;  1W5T A;  5D5V B;  4HDU A;  4L5J A;  3JAM K;  1PP8 F;  5H6R A;  1YQA A;  3I54 A;  3QP5 A;  1J0R A;  5FD6 A;  4NQW A;  1IXC A;  1SD4 A;  2HGC A;  1HW2 A;  2W57 A;  5EEG A;  5E1W A;  1K78 B;  2KIM A;  1U5T C;  1E2X A;  2NRA C;  3VEP A;  3BDD A;  3F3X A;  3CO6 C;  1HQC A;  3BY6 A;  2AXL A;  3QAH A;  1QBJ A;  1Y0U A;  5LHI A;  3P9C A;  4EM1 A;  3KLN A;  1UCR A;  2Q0O A;  3GO5 A;  3I58 A;  3F72 A;  3J81 Z;  5L3F A;  5D8K B;  4M74 A;  4Z2Y A;  4L5I A;  1AOY A;  4HQM A;  5ILU A;  2CQK A;  1YFH A;  3JTH A;  5LGU A;  2MH2 A;  4BHC A;  4BXU A;  1TNT A;  3DPT A;  4K2E A;  4M6X A;  1O3R A;  2JPB A;  5AIP A;  2FU4 A;  2E7W A;  5J8C A;  1EH8 A;  2KIU A;  4HF2 A;  1Z05 A;  4G6Q A;  1IXR C;  2ZJ2 A;  1K79 A;  2RN7 A;  5FFX A;  1T39 A;  4H0E A;  1W7P B;  1ZG1 A;  2FML A;  5FFZ A;  3KLO A;  2OQR A;  3TOB A;  3U9G A;  2DT5 A;  2Z9O A;  3DV8 A;  4L9N A;  4U0V A;  2XVC A;  3AAF A;  5DCM A;  1O57 A;  3H3U A;  3L9F A;  4P55 A;  1B6A A;  2V1U A;  1QZZ A;  1GXQ A;  2GXG A;  4ENJ A;  2DBB A;  4I7H A;  1FBU A;  2OZ6 A;  4HV5 A;  5F64 A;  2P8T A;  2VE8 A;  3QPH A;  1JGS A;  2BEO A;  1YIO A;  3HTU A;  1FYL A;  1WRJ A;  4G7O F;  4ETS A;  1CGP A;  3I4P A;  4PDK A;  3NQO A;  5HLG A;  3WG9 A;  3TO9 A;  2W25 A;  1DP7 P;  5D5U B;  4LLL A;  5L3D A;  3CLO A;  2M45 A;  4HW0 A;  3F21 A;  4GYG A;  2H09 A;  2ZKZ A;  3HSR A;  4KUM A;  4I01 A;  2YX4 A;  1FX7 A;  1TLH B;  2UXX A;  4IF4 A;  4L9V A;  2NYX A;  1SAX A;  3LFK A;  1W7P D;  4U0Y A;  1QQI A;  5CVU A;  4YFX F;  5CVJ A;  1D3Y A;  2DAO A;  2YSR A;  2P7C B;  4P96 A;  1B9N A;  5TJJ A;  1KQ8 A;  1F5T A;  4MTD A;  3GVA A;  5E18 F;  2FNA A;  1T98 A;  1FOK A;  3LST A;  3T8R A;  2K02 A;  2W85 A;  2WC2 A;  1SMT A;  3TQN A;  2DFI A;  4L18 B;  3HUG A;  3COA C;  3E6D A;  1JE8 A;  1P4A A;  2HYF A;  1BI1 A;  1IRF A;  2L54 A;  3C7J A;  2H6C A;  3M7G A;  4U88 A;  4UVB A;  3WTZ A;  2DLL A;  4MEX F;  3GZ5 A;  3K69 A;  4D0P A;  2L02 A;  2L3D A;  2RQP A;  2Y75 A;  2HFH A;  3KEO A;  1HW1 A;  5KK1 A;  4ZZD A;  3WTY C;  3E5Q A;  1W7P A;  3E3V A;  3FX3 A;  5CVI A;  4UUV A;  3KCC A;  1ZRC A;  1KU2 A;  1YW8 A;  2DK8 A;  4CXF A;  3MZY A;  1I27 A;  2CYY A;  4RB2 C;  4M73 A;  4WXH A;  3V8L A;  2CGP A;  3KP5 A;  4A0Y A;  3MWM A;  3B73 A;  1T6S A;  1UB9 A;  3V7R A;  4CO8 A;  4EV0 A;  3ZPL A;  2P5V A;  4UV9 A;  1ULY A;  3KP6 A;  5CVV A;  1SD6 A;  1IN7 A;  2Q8K A;  1YG2 A;  1USS A;  2HDC A;  1J5Y A;  2DQL A;  1YLF A;  4M9Z A;  4G9Y A;  4LJZ F;  1S3J A;  4M71 A;  3N97 A;  2PLY A;  4CHU A;  5ICE A;  5BMZ A;  3F23 A;  1YS6 A;  5LRS A;  2EFQ A;  1YTY A;  4JK1 X;  4HLX A;  1MZB A;  3DXJ F;  1EV7 A;  3ISP A;  4QLC U;  2CO5 A;  5DEQ A;  4FHT A;  2STT A;  2QWW A;  3F22 A;  1SFU A;  3SZT A;  4I0B A;  5D6F A;  2IPQ X;  4L9T A;  1XSX A;  3U2R A;  3HHG A;  5AON A;  3IKV A;  1MKM A;  2VBZ A;  1ZRE A;  1W4M A;  1FBQ A;  2FA5 A;  2Z5U A;  1P4W A;  3WU0 A;  5LGT A;  2NNN A;  2PN6 A;  3LAJ A;  4FT8 A;  2E1N A;  4WK8 F;  3NRV A;  2ISZ A;  2VBX A;  3TDU C;  5D4R A;  3CUQ B;  4TV7 A;  3TGN A;  2F5E A;  4O6J A;  3OV8 A;  3ZQ7 A;  2HTS A;  4PGG A;  1U8R A;  4HQE A;  3KZY A;  2RKH A;  4ZYE A;  2TDX A;  3TDZ C;  3QU3 A;  4YIF A;  4P5O A;  2GWR A;  1HW5 A;  1YO5 C;  3MFK A;  3F8B A;  3JSP A;  3FXR A;  2K7L A;  1XDU A;  1GXP A;  4OIP F;  3GEZ A;  2GIV A;  3QP6 A;  2VT2 A;  2YR2 A;  2DI3 A;  1FNN A;  5D5W B;  1RUN A;  4ZH4 F;  3I5U A;  1G3T A;  4YFK F;  2XRN A;  4QWQ A;  5A2Q K;  2EJR A;  3N4M A;  3F8F A;  2EB7 A;  3W6J B;  3LA3 A;  2FRH A;  5IT9 K;  1BN5 A;  1BI3 A;  2QYO A;  2MH9 A;  1B4A A;  2MC3 A;  3KFW X;  2A61 A;  3IKT A;  3JW4 A;  5HVQ C;  1XSD A;  4OIN F;  1IRG A;  2PFB A;  2M30 A;  3CDH A;  4KFC A;  1BI2 A;  2XAJ A;  2Z3Y A;  4IHT A;  5ILS A;  2BGC A;  3IHU A;  5LRR A;  4OU0 A;  3O6B B;  3RPQ A;  1SD7 A;  2KJC A;  3WTU C;  3FZV A;  2VE9 A;  2GA2 A;  2OQG A;  3KP4 A;  2PG4 A;  4Q47 A;  1OKR A;  2KKO A;  4HX7 A;  2WWY A;  4M9X A;  1ON2 A;  2RVC A;  4EQQ A;  3V4G A;  2A6E F;  2D1H A;  3ZMT A;  5L3B A;  4RS8 A;  3LAP A;  1EH6 A;  1Z6R A;  1Z9C A;  1KU3 A;  4CGZ A;  1X3U A;  2P6S A;  3WTW C;  5DUK A;  5HDN A;  4EGY A;  3Q9S A;  4MTE A;  1IN6 A;  1XD7 A;  3F8C A;  1TW2 A;  4RGR A;  2YU3 A;  1U3E M;  3KP3 A;  1S8N A;  1J75 A;  2X0L A;  2D1V A;  1U78 A;  3F6O A;  2GZW A;  4YFN F;  3R61 A;  1ZAO A;  1B1B A;  2ZO4 A;  4EM2 A;  3CO7 C;  4KN4 X;  1O7L A;  4AWX B;  2HEO A;  2O03 A;  4KIB A;  1KU7 A;  4WX9 A;  3BPX A;  3CUQ A;  2HYG D;  4YG2 F;  2ISY A;  1REP C;  5L3C A;  3FWE A;  4JBA A;  3B02 A;  3FF5 A;  2STW A;  3RTR A;  3V7S A;  2XAS A;  3HSE A;  3M8F A;  2ETH A;  3FHZ A;  1S7O A;  3T1B A;  4LMY A;  1TNS A;  4HLY A;  1ZGA A;  3S2W A;  4KNY A;  4LB6 B;  1R1T A;  4CZZ A;  4NB5 A;  4HYE A;  1LB2 A;  1RUO A;  4HF1 A;  2P5L C;  4LLN A;  3IRR A;  1TBX A;  1XCV A;  4IRG A;  2K4B A;  5HS8 A;  3K0L A;  3RYP A;  3K2Z A;  3GFL A;  2M87 A;  4L0Z B;  3QOP A;  2VON A;  4GYI A;  4XBF A;  1MDM A;  3KEQ A;  4KIG A;  1TTY A;  4HF0 A;  5IT3 A;  3GLX A;  4FX4 A;  3R6S A;  4F7Z A;  1B9M A;  3GWZ A;  2C6Y A;  1FP2 A;  4IXA A;  5D5X B;  1ZLJ A;  2B0L A;  1G3W A;  3E97 A;  2PJP A;  4XLN F;  1DPR A;  3LWF A;  1PUE E;  3HRT A;  1LDK B;  1S6L A;  3IL2 A;  1ZRF A;  2ADU A;  4G94 A;  5ICG A;  1XMA A;  2PMU A;  4P9U A;  1P92 A;  3F8M A;  4UVA A;  3RDI A;  1DUX C;  4LG0 B;  2ZNZ A;  2EFO A;  2DQR A;  1OMI A;  3R60 A;  3WE2 A;  2ESH A;  3OOP A;  4RGX A;  4BH9 A;  1HKQ A;  5ERI A;  3E6M A;  2H94 A;  4HV6 A;  4EJO A;  5DDG A;  3ELK A;  3BPV A;  4L0Y B;  2ZCW A;  3VOD A;  1K78 A;  3SFZ A;  2J5P A;  4G7H F;  3JSO A;  3DKW A;  2CFX A;  1R23 A;  5K5Q A;  4WXC A;  2OD5 A;  3I71 A;  2VOO A;  5ICC A;  2WV0 A;  4Q4Z F;  3HOT A;  1DDN A;  1LEA A;  4U0W A;  1R5G A;  2NS0 A;  2DO7 A;  4A6E A;  5E8I A;  2OU2 A;  2VOP A;  2VBY A;  3ERE D;  2H27 A;  3FM5 A;  3VFZ A;  2QQA A;  3EDP A;  5JR3 A;  2P4W A;  1ONV A;  1IUY A;  1SD5 A;  4MQ9 F;  4E70 A;  3PQK A;  3RKY A;  2CW0 F;  1U5T B;  2DW4 A;  3HHH A;  3O2P E;  3VOE A;  3JTG A;  1XGS A;  2RDP A;  2YX7 A;  2NAZ A;  5AIQ A;  1XSV A;  2P5K A;  3FXU A;  1O3T A;  4DNC A;  5LHH A;  3KP7 A;  3LA2 A;  4UHT A;  3GFJ A;  3RJP A;  1FZP B; 
#chains in the Genus database with same CATH topology
 2EA2 A;  1U2W A;  3OYN A;  1H9G A;  1ZG5 A;  4I2O A;  3J7A Y;  2LK2 A;  5DCM B;  2M34 A;  4I99 C;  1PJR A;  1PP7 U;  3KET A;  1RKW A;  1WQ2 A;  1XX5 A;  2FBK A;  3P5J A;  1SFK A;  4FE4 A;  3AFH A;  4CA0 A;  2MW8 A;  4CCN A;  1UST A;  2R7S A;  4CCM A;  3PNT A;  4GGG A;  4F91 B;  3BWG A;  3MAJ A;  4BU2 A;  3IC7 A;  3CC4 I;  1BBY A;  2DOA A;  2J5O A;  3L09 A;  4IRH A;  3OIO A;  4A2U A;  2BYV E;  2LNB A;  5EYR A;  2IA0 A;  1T2K A;  1ZN2 A;  1TQI A;  2G7H A;  1KU9 A;  2BE5 F;  3M9A A;  3OIQ A;  2XC7 A;  2AXT C;  3I64 A;  3SXY A;  2XAG A;  2CG4 A;  1ON1 A;  1T33 A;  4M6Y A;  2KRH A;  4IEJ A;  4C2T A;  5H6Q A;  4X1E A;  3PSF A;  3QRF F;  5JLX A;  5LGN A;  4OMY A;  1YIJ I;  1QRY A;  1HXD A;  4M3B A;  5GPA A;  2D5V A;  4A5M A;  3PNY A;  3WGI A;  2V6C A;  4A3J J;  3CMA I;  5FB2 A;  3ZXS A;  1ZKG A;  3OYM A;  4G8X A;  2QQ9 A;  2L9V A;  3RKW A;  3U1D A;  4NHJ A;  3T8T A;  4R79 A;  1V3F A;  4B3A A;  1I3A A;  2EFW A;  4A3L J;  3DEE A;  4B09 A;  3F0C A;  3GX4 X;  1DPU A;  1O3Q A;  5TRD A;  1U8B A;  3WTS C;  4CH7 A;  3H0G J;  2FEZ A;  1SFX A;  4J01 A;  2V79 A;  3CZ6 A;  2Z99 A;  4MGR A;  1ORK A;  1IRZ A;  2O8X A;  2OF7 A;  3EUH A;  4AIH A;  4D5F A;  3EYI A;  3BJ6 A;  2FXA A;  4W1U A;  1RI7 A;  2ZJR F;  1FYM A;  3BR0 A;  5F1J A;  3G4S I;  2E36 A;  3JCU C;  4MEY F;  4NDL A;  5E20 A;  3CTA A;  4UUS B;  3BG3 A;  1FIA A;  2XUB A;  1HLV A;  4UVC A;  3OYA A;  1IF1 A;  2NNY A;  2EIJ H;  4MQV A;  1IC8 A;  1EKE A;  1R5I D;  3QYB A;  1QPM A;  2MSY A;  1TQM A;  1T0F A;  1VQK I;  2IJL A;  4BYY A;  1D0Y A;  4DYC A;  4OIQ F;  1HBX G;  1BIB A;  1X1B A;  2OC6 A;  1J75 A;  1ETX A;  3O3K A;  3K70 C;  2FQ4 A;  4ZYD A;  5F0F A;  6PAX A;  5GAE J;  5F1R A;  2UWM A;  2IP2 A;  1IAW A;  2QBY A;  4F55 A;  2V1N A;  3GTM J;  1DP3 A;  2WB1 N;  4HX8 A;  1YJN I;  3RZD J;  4Y13 A;  4EJW A;  2RNG A;  1I50 J;  2E60 A;  3KYL A;  2HQA A;  2A6H F;  1Y6I A;  3M8E A;  1X58 A;  2E2I J;  3ZP5 A;  2DPU A;  1X4P A;  1D5Y A;  1MW7 A;  2HR3 A;  4N9H A;  3QYF A;  5DTD A;  5IOY A;  2QSG X;  3DPU A;  2XB5 A;  5J4Y A;  1OCZ H;  1TWF J;  3DLA A;  2Z1D A;  3BJO A;  3BQZ A;  3GFI A;  1TQP A;  5GAH J;  2HOE A;  3CJR B;  3DTK A;  1Z3Y A;  2KRF A;  4G6T B;  2HS5 A;  2MA3 A;  1H0M A;  5IYD J;  2ZXW H;  1RR7 A;  2WBM A;  2XHK A;  1Y8Q B;  3K4B A;  3K9T A;  5FLM J;  2EFN A;  1WSU A;  2XPV A;  4OMZ A;  4RB0 A;  1FWZ A;  2Z33 A;  2DMQ A;  4LGW A;  5LLQ A;  3LSM A;  4B44 A;  1JT0 A;  2ZXJ A;  1D8J A;  1W5S A;  2KLO A;  1LVA A;  1LJ9 A;  3K1M A;  2XKO A;  4C2M J;  2MD5 A;  2R3S A;  1RIO H;  3S2D J;  4KA4 A;  1LDJ A;  1SAU A;  1J7K A;  3NEU A;  4G7Z F;  1B59 A;  4MO7 A;  2NVY J;  4CCJ A;  1QZY A;  2GQQ A;  2R7O A;  5ED4 A;  2R92 J;  5J8F A;  2QGU A;  1O4X A;  2DMP A;  3W2A A;  1YX3 A;  1G3Y A;  1MMN A;  4FE7 A;  2DA5 A;  4LIV A;  1FPQ A;  4XOR A;  3PO3 J;  3F8N A;  4AU7 A;  2QF7 A;  5FJ8 J;  2W48 A;  1IXS B;  1Y0N A;  3K1P A;  3TOA A;  3HRM A;  2ID3 A;  2LMD A;  3EUK L;  4HAM A;  2XGX A;  4Y17 A;  4BGD A;  1I1S A;  1HA8 A;  4ITV A;  2EZK A;  2BBY A;  2JVH A;  4CUG A;  1ZYR F;  1XGO A;  1SMY F;  5D6E A;  1MBG A;  4I02 A;  1PYV A;  2CQQ A;  2MLG A;  3M3Y J;  3EET A;  1WHU A;  3S32 A;  3ULQ B;  5DD4 A;  4BHB A;  1WJA A;  1W36 D;  1S5L C;  2X6Y A;  2Z2S B;  3UR3 C;  4XRS G;  1VF9 A;  2MBF A;  2K4J A;  3DP7 A;  4ESB A;  5BS6 A;  2IS4 A;  4XKB A;  4LK1 F;  3DPL C;  2DFH A;  4GO1 A;  2UV1 A;  4V2F A;  4IZZ A;  1JJ6 C;  3KE2 A;  1UHW A;  3BP8 A;  2X1C A;  3D5R C;  2Y30 A;  3RKX A;  4P9F A;  3J7Z I;  2DPD A;  3EYY A;  2B63 J;  1OQY A;  3H3Z A;  2M1B A;  2M8E A;  2MLK A;  3EUH C;  2R5Z A;  2IGO A;  3FXK A;  1QGP A;  2EIM H;  3OYD A;  3L2W A;  1R36 A;  3MQ0 A;  2KIF A;  1HSJ A;  4N0B A;  4RGS A;  5IP6 A;  2PJR A;  1KYZ A;  2HKX A;  2VAS A;  5LHG A;  2OBP A;  2IA1 A;  4KIT B;  1ETY A;  2E34 A;  1AKH A;  1WI9 A;  2E35 A;  4A3C J;  1BW5 A;  3A0H C;  1R7J A;  4AD9 A;  4GDF A;  5E3M A;  1LQ1 A;  4PUS A;  3A02 A;  1AHD P;  5KVR A;  3WU2 C;  1FOX A;  1XGM A;  4JP0 A;  4M72 A;  2PMH A;  3MEX A;  5M3F J;  2M3A A;  3HRS A;  2XAQ A;  4YRV A;  2XGC A;  4OIO F;  2LBF B;  5LEJ A;  4ASN A;  2VKV A;  4XM3 A;  3WTV C;  1ERD A;  3T0Y A;  2VL8 A;  4IL6 C;  2HOS A;  4CYC A;  2DT6 A;  4A5N A;  1BJA A;  1PDN C;  2XF5 A;  4G6D A;  4RAG A;  3ECH A;  3JRB A;  1Z67 A;  3H92 A;  4BKX A;  1R4M B;  2HKO A;  3BZC A;  3ASN H;  4FCY A;  3RI4 A;  5IOZ A;  2M7A A;  2EA4 A;  5ICF A;  3SHF A;  4ZTJ A;  2IT0 A;  4RB1 A;  1N75 A;  1FT9 A;  3E6B A;  5EDN A;  4XMY A;  1LNW A;  4GXO A;  3RPU D;  2QBY B;  5E1Z B;  3C3W A;  4Q5S F;  4GFB A;  1VQ5 I;  3S14 J;  2G0E A;  1IN8 A;  1EH7 A;  4ON0 A;  3AL0 B;  2P81 A;  2NOG A;  2P7V B;  3BR1 A;  3HOY J;  5JHU A;  2CS3 A;  4A3G J;  2K40 A;  3JR9 A;  3S3N A;  5HDK A;  4IJA A;  4XOP A;  2K3F A;  2O3F A;  4EMS A;  1MBK A;  2W84 A;  4NC7 A;  5H20 A;  2ZBK A;  2IGN A;  4DQ2 A;  2UXN A;  3ZMS A;  2QEX I;  2OJE D;  1Z7U A;  3TP3 A;  1MD0 A;  5EEH A;  4A6D A;  1TW3 A;  2HWV A;  3PFI A;  5GPC A;  3MCZ A;  1F36 A;  3P7N A;  4HBL A;  2PI0 A;  5DM7 F;  1UZC A;  2XSD C;  2CU7 A;  3HTS B;  3MMY B;  2X4H A;  4HX4 A;  5D4S A;  4V2G A;  5J6X A;  3VPR A;  2IA2 A;  2JTV A;  5L3E A;  4DGW B;  2EPF A;  4FTH A;  1KQ9 A;  2KHM A;  3OSG A;  1BIA A;  2LKP A;  3IUO A;  4ZYH A;  2V9K A;  1RZ4 A;  2MC4 A;  4DW6 A;  3D5S C;  2LDU A;  3OYL A;  3CCJ I;  3KZI C;  5EG0 B;  4XSZ F;  5EJC A;  3BG5 A;  1NG6 A;  2X1D A;  4RMN A;  1X1C A;  5HDG A;  2CSO A;  4FET A;  2EQR A;  3IAS 2;  2R7T A;  3AG4 H;  1T38 A;  4HG2 A;  4KMF A;  1TP4 A;  2HNH A;  4JX6 A;  4LK0 F;  1CF7 B;  3BR5 A;  4NC6 A;  2R7W A;  1KQ0 A;  1G4D A;  3FMQ A;  2LH9 A;  2EH3 A;  3E5X A;  2CW7 A;  1IRX A;  3CC2 I;  4LD5 A;  1WJF A;  3CJN A;  1E0E A;  2V1D A;  5IYC J;  3ZMV A;  2D45 A;  5FKN A;  1ENH A;  3OYG A;  3RPU A;  3ZGK A;  3WTX C;  2ZME C;  2VLA A;  4EJV A;  3I4M J;  3S1N J;  2M9H A;  2VPL A;  2DOE A;  4FQG A;  4JQF A;  2X51 A;  4PFO A;  3GXO A;  3SEQ A;  2F5D A;  3OMY A;  4WF2 A;  2XAU A;  4A0X A;  2RQQ A;  4AVP A;  3HSF A;  4WCG A;  1XGN A;  4BQO A;  4YIR X;  1IN4 A;  4CSW A;  2IVM A;  3LQQ A;  2FBI A;  4M3D A;  1XS9 A;  2KZG A;  3R0J A;  2L01 A;  3ZQH A;  3LSR A;  2BHY A;  5CYV A;  1P7I A;  1D1A A;  5JVT A;  1Y56 A;  3TL4 X;  3CD6 I;  2EWN A;  3ZMU A;  4A3K J;  1IV6 A;  3E1S A;  1FMW A;  2X48 A;  5K5O A;  2XKP A;  1Q1H A;  2R7R A;  2R5Z B;  1BC7 C;  4DBQ A;  3DF8 A;  2GLO A;  2IGK A;  3LSP A;  2OA4 A;  4BNC A;  2GOX B;  1VQN I;  5B3S H;  1D1B A;  3IWF A;  3WOD F;  3D5L A;  4PSX A;  3OYB A;  5TIS C;  3BG7 A;  2LY2 A;  4A3M J;  2EV0 A;  3CP2 A;  2QKL B;  4ENM A;  2HVQ A;  4UV8 A;  3GTQ J;  1HKS A;  3I59 B;  2X1E A;  2AS5 F;  1JKP C;  4PGH A;  4AIJ A;  4XSX F;  5DV5 A;  2QZ8 A;  2A69 F;  3LL7 A;  5CKT A;  3ZQI A;  4BBR J;  4UNO A;  1I6X A;  4XKC A;  2RV8 A;  3DTI A;  1JUS A;  1OFC X;  4HA8 A;  4IVN A;  3LFU A;  5BOX A;  3I53 A;  2VXZ A;  2NVX J;  4RA2 A;  2K9S A;  1A5J A;  4KT5 C;  1J2X A;  3L2C A;  1S29 A;  3A03 A;  3SQN A;  3WE3 A;  1JKO C;  4HEA 2;  2RNJ A;  3Q0W A;  1YE9 A;  2DJI A;  2H6B A;  4MFE A;  5A2Q Z;  2DFF A;  1WWX A;  4Z6Y A;  4C3I J;  1BA5 A;  3E6C C;  5E3O A;  2LY9 A;  5FD5 A;  2GAU A;  3IH2 A;  2NVT J;  1Y1W J;  2ZME A;  1FTT A;  5LBQ A;  4HZF A;  2M7B A;  3S3M A;  1J59 A;  2JUG A;  1F4K A;  1G8X A;  1V4R A;  3FXM A;  5L3G A;  2Q2E A;  2P6T A;  2VBW A;  2FBH A;  3DBL B;  3GLL A;  1MJB A;  3KX2 A;  4Q48 A;  2L5Q A;  4XRF A;  2FNP A;  4XKW A;  3ABM H;  4ZYG A;  5HNF A;  4BAC A;  2LF8 A;  2ZFW A;  3V8J A;  2GOM A;  1OPC A;  4H4K C;  4KIC A;  1I5Z A;  1YW7 A;  4E4H A;  1HST A;  4XLC A;  2O6G E;  4ENK A;  5FLX Z;  4I0A A;  3ERM A;  2ZXI A;  3LQR A;  1W36 C;  4DBR A;  3WTT C;  1SEU A;  2M5W A;  3ZQG A;  4ZJZ A;  1WGX A;  5ILV A;  3QPT A;  4HST A;  2JRM A;  4AIK A;  5CJ9 A;  1WKM A;  3OSF A;  1FYK A;  1GHC A;  3FIW A;  4RBO A;  1P4X A;  1S7E A;  4LG3 A;  3RYR A;  2XAH A;  3BRO A;  2MGQ A;  4X6A J;  2FE3 A;  2OCE A;  1ODD A;  2YS9 A;  2ACJ A;  3J7A O;  3QU6 A;  4ZDO A;  5JFR A;  2VT3 A;  3F6V A;  5KAF C;  1OCC H;  1LFB A;  3CCE I;  3X2Q H;  5EGO B;  2UUZ A;  3K4J A;  1L3L A;  1C0W A;  4Y15 A;  3JRA A;  1OYW A;  1BR1 A;  2OAZ A;  1R1U A;  3E0J B;  2F4I A;  3C18 A;  3BOQ A;  2JK3 A;  2MYS A;  3H1C A;  1R49 A;  1OYY A;  4KYW A;  2R7Q A;  4C30 A;  4RM3 A;  3CUO A;  3G2B A;  3MZH A;  1T0F C;  4IOA F;  3OOU A;  1RES A;  1CF7 A;  2G9W A;  4E7J A;  2W24 A;  3C2H A;  1XCB A;  1SAN A;  1DGW Y;  4XON A;  3TMO A;  3L00 A;  2OTL I;  3DQV C;  4CCO A;  4S04 A;  1D0Z A;  2K27 A;  1SFE A;  3A0B C;  3NAU A;  2VOD A;  1K4T A;  2JZY A;  4HDV A;  1R58 A;  2K86 A;  3GTJ J;  1NHA A;  5EZH A;  3SZG A;  3IRQ A;  5E3L A;  2W1O A;  5GAG J;  4ESJ A;  1ZK8 A;  1E17 A;  2DMN A;  4BS9 A;  3K4M A;  4A3D J;  5E3N A;  4OWR B;  3SZP A;  5B66 C;  1RNL A;  1BI0 A;  4EVI A;  2BW3 B;  3S3O A;  5JI6 A;  1QNT A;  3CCY A;  2I10 A;  2DTR A;  2NOJ B;  3CMY A;  4BHP A;  4DOZ A;  3GUD A;  3HRU A;  3S16 J;  3OL4 A;  3DEU A;  1MDM B;  1K4S A;  2W00 A;  1X1P A;  3TO7 A;  4J00 A;  2Q1Z B;  1N25 A;  3VDX A;  3CC7 I;  1BM9 A;  1UHM A;  1XDS A;  2L9S A;  2L4M A;  1YS7 A;  1IUF A;  4C2U A;  3SYT A;  4XOT A;  2BXZ A;  5DCF A;  2NXN B;  2HZD A;  4PJJ A;  4S0H B;  3IWZ A;  1ZR4 A;  3K4K A;  2HDD A;  2Y31 A;  2K9N A;  1XB4 A;  5J4V A;  3S15 J;  2HI3 A;  1A04 A;  1I1G A;  1IDY A;  3N05 A;  4BY7 J;  2CWE A;  3HKZ N;  2RC4 A;  4XN0 A;  2V9V A;  1R00 A;  1UEL B;  2ZC2 A;  4PSW A;  1LEB A;  5CLS A;  3AG1 H;  3AL0 C;  4LB5 A;  4AC0 A;  1V5G A;  2TRT A;  2E2J J;  4WXD A;  2LC2 A;  4EM0 B;  3I59 A;  3ZN1 A;  3ZMD A;  1IN5 A;  1V5F A;  5KCM A;  1G6N A;  1HKT A;  3ZQQ A;  1B8I A;  1MMG A;  2K85 A;  4KDP A;  3OYC A;  4RGU A;  2FSW A;  3R4K A;  3PQJ A;  1WJ5 A;  4DYQ A;  1BL0 A;  1OCR H;  2ESN A;  2X9D A;  2L7M P;  3ML6 A;  1JHF A;  2ZB9 A;  2F5C A;  2QQB A;  1FP1 D;  3BT9 A;  3RIR A;  4EGZ A;  2O8K A;  1GV2 A;  3W3C A;  3ECO A;  3FM3 A;  3PL8 A;  2JSC A;  4IKF A;  2Y48 A;  1JKR C;  4KN7 X;  1UMQ A;  4FX0 A;  2R7F A;  4NNJ A;  3ZMZ A;  1FTZ A;  1P6R A;  1KGS A;  4S05 A;  1H8A C;  3Q0V A;  2IXS A;  2ZME B;  2FX0 A;  4P1W A;  1WFX A;  4F3Q A;  5J1Y A;  4A3E J;  2O5R A;  4DYR A;  3AG3 H;  2LF7 A;  2QVO A;  3A01 B;  1W0T A;  4BQA A;  2DCE A;  5J1R A;  5EZG A;  4B8X A;  3E5U A;  3ZQF A;  1FY7 A;  2VKD A;  3HXL A;  4LLG F;  1QO0 D;  1R22 A;  3ZQL A;  1HDD C;  4II2 A;  1A6I A;  3ABT A;  2O0Y A;  2CQN A;  5IT9 Z;  5J3L A;  1BC8 C;  4O3M A;  3ROU A;  3GYH X;  2ELH A;  3CES A;  1JT6 A;  1HDP A;  3GZ6 A;  2QEN A;  2D2W A;  2KJB A;  1JUP A;  1D0X A;  2QCO A;  4L9J A;  1D8K A;  1BJZ A;  2A68 F;  2IS6 A;  3P9K A;  2KT0 A;  3GW2 A;  4MLO A;  4RAF A;  2DXI A;  1IW7 F;  3K4N A;  5JHF A;  4LIT A;  3GBG A;  1IZ1 A;  4CDG A;  4QIW N;  1MJ9 A;  2JUC A;  1LDD A;  1O7F A;  3CUQ C;  2V1X A;  2UZK A;  3Q9V A;  1PVE A;  2XPW A;  3CMM A;  3QYE A;  5IP7 J;  4O5V A;  2RAE A;  2VJ4 A;  5EGO A;  2F2E A;  1U9N A;  2EV6 A;  4XID A;  3J80 Z;  5D8L B;  4KIS A;  2V26 A;  1OIS A;  4N9I A;  3BTC A;  2HOT A;  2Y0M A;  1U6G A;  1Z7L A;  2VC0 A;  3CCU I;  3PUB A;  5DYM A;  3TW6 A;  2LP0 A;  5K7Z A;  2K5C A;  3P9I A;  2Y2Z A;  2COM A;  4B3X A;  2IRF G;  1ETV A;  3HYI A;  1U5T A;  3TKY A;  3WU1 B;  3HOX J;  4U7B A;  1VQ4 I;  2AO9 A;  3GF2 A;  3MD2 A;  2G7U A;  5K7F A;  1P2F A;  1ETW A;  3M1E A;  3G3Z A;  4D9J A;  2A3S A;  1OR7 A;  4J19 A;  4IPA A;  1IG7 A;  1P7J A;  2HQR A;  3CF2 A;  3V7C A;  2FMY A;  3HC7 A;  2EK5 A;  1XMK A;  3MN2 A;  5BPI A;  4RAZ A;  2JT1 A;  4ZZL A;  1MMA A;  5B1B H;  1YRN A;  1X1D A;  5DM6 F;  2EIK H;  1ZEL A;  2XF7 A;  3OS1 A;  4KMU X;  1QPI A;  5IP9 J;  3EQL F;  2R7X A;  2E7X A;  5JLW A;  1YYV A;  2HQN A;  3C1D A;  2O61 A;  4M3E A;  1JHH A;  2DK5 A;  2XPU A;  4HSR A;  4M9S A;  2LTP A;  4I98 B;  5HS9 A;  5HLH A;  1TWG J;  1F1Z A;  3KPH A;  3FXQ A;  2WTE A;  3J81 K;  4MHG A;  4Y3O A;  2HZT A;  3BJA A;  4RM2 A;  3WGH A;  4CCL A;  4B43 A;  1T95 A;  1M1E B;  1T56 A;  3G6E I;  4F52 A;  2MD0 A;  2PEX A;  1AWC A;  4NC8 A;  2ZNY A;  5E1X A;  1Z1D A;  3VB2 A;  2VQL A;  4FIS A;  3TO6 A;  1S7A A;  2DOF A;  5E8G A;  1ZR2 A;  5FLX K;  4XRM A;  1T08 B;  3FMR A;  3LMM A;  2E1C A;  1R5H A;  2A07 F;  3BZ6 A;  4OOI A;  1VTN C;  4CIC A;  1VQ6 I;  1B8I B;  3HOS A;  1APL C;  3ABU A;  1XN7 A;  2Y0S A;  1YX5 A;  3KZZ A;  1TWA J;  3JRC A;  4GCV A;  3HL2 A;  2A5Y B;  4QPQ A;  1LKX A;  3AKZ A;  5E17 F;  5HLT A;  1LFP A;  3BR6 A;  4M6V A;  3KP2 A;  5E79 C;  4ESF A;  3S1R J;  1A35 A;  3Q5F A;  4BAY A;  4I76 A;  4A69 C;  4RLF A;  2E1M B;  5HS7 A;  2XRO A;  4XRS A;  4EJT A;  1LFU P;  5EF6 A;  1ZGJ A;  5LEK A;  2A5W A;  5HLI A;  2M8G X;  3G71 I;  2QM3 A;  2JPC A;  2W7N A;  3JRF A;  3SJM A;  5CVR A;  3D0S A;  2P0W A;  3FMS A;  3CF5 F;  3BCA A;  1P9Q C;  4HNV A;  5FGM A;  3R0A A;  4PZJ A;  1D5V A;  2CQ7 A;  1OCT C;  2FQ3 A;  3J80 K;  3KYC B;  4UUS A;  1F9N A;  1JXS A;  3L2Q A;  1FBS A;  1ZG3 A;  1H9T A;  4ENN A;  3ASO H;  2B7E A;  3CLQ A;  5K1Y A;  2EFP A;  1STZ A;  3S17 J;  1J9I A;  2HXO A;  5FLV A;  3M1C A;  1ZLK A;  2V6E A;  2XV4 S;  2LSO A;  2R93 J;  5DUI A;  1FEX A;  4RAY A;  3H5R A;  1GVJ A;  3TED A;  1LE8 A;  2AQE A;  3ZN0 A;  5F27 A;  3H9G A;  5K5R A;  4XNF A;  2VJI A;  2DA6 A;  3I0T A;  5FO5 A;  3I4N J;  3S1M J;  2KRC A;  1OYI A;  3GTL J;  4A0Z A;  3HB9 A;  4EEF G;  3VSK A;  4IHS A;  1Z6T A;  3L7W A;  2M0C A;  2CQX A;  3HM5 A;  1K7A A;  2DU9 A;  3DFG A;  3JAM Z;  1FSH A;  1L0O C;  4E7Z A;  5CQG A;  2LR8 A;  3MKY B;  4IHX A;  1FLI A;  4PJM A;  4NUB A;  2EV5 A;  3C2B A;  2QLZ A;  1JTX A;  3HGY A;  4BJT A;  1KYW A;  2R7D A;  1WJD A;  1K61 A;  3QPL A;  1X4O A;  2I5U A;  4CCK A;  1XC5 A;  4EJU A;  1ZQ3 P;  4KIF A;  2ECB A;  2KZV A;  1K6O A;  2PQ8 A;  2XGE A;  3HPH A;  2OZU A;  4LIU A;  4OIR F;  3PJR A;  3K4C A;  4R8H A;  3OYK A;  2R4G A;  4I09 A;  1FSE A;  4A12 A;  2OCC H;  1R1V A;  2E5N A;  5IY5 H;  2R7U A;  1X3W B;  5EEA A;  2IW5 A;  3TW7 A;  1X2M A;  1O3S A;  3V8K A;  4HPQ A;  3VSL A;  2DN0 A;  3W6K B;  3GFM A;  2XAF A;  2L4A A;  2XRL A;  5F6F A;  4WWC A;  4R1H A;  2L7K A;  4UUT A;  2BOL A;  1RKT A;  1ZHF A;  3MVP A;  4YII A;  3EUA A;  1YRN B;  1UFM A;  1ZRD A;  2ZSI B;  1JTY A;  2ELJ A;  2JRT A;  2YPR A;  1Z91 A;  2PBI A;  5DD8 A;  1ZH5 A;  1BOA A;  1KZH A;  2F5F A;  5M3M J;  2JQ7 A;  2O7O A;  3W6V A;  3HIF A;  3W2W A;  1RR8 C;  4U7D A;  2RGV A;  3FKJ A;  4IX7 A;  2QUF A;  1KA8 A;  3G73 A;  2DYS H;  2WAQ A;  4E7K A;  2O9L A;  3NWS A;  1Y8R B;  4LFU A;  4HRI A;  4HOB A;  4N4O B;  4MNU A;  2DJN A;  4PCQ A;  1H89 C;  2XIG A;  2FOK A;  1MGT A;  3CCL I;  3T5X A;  1TL8 A;  2X6W A;  1ZGW A;  3WG7 H;  5IPA A;  2BY2 A;  1K6Y A;  3FIS A;  1FC3 A;  3WGG A;  4CYD A;  4HNT A;  2FF4 A;  4IRI A;  2F4M B;  5HOO A;  1X3Z B;  1BW6 A;  4E6K G;  1MJA A;  2VC1 A;  1BR2 A;  4RB3 C;  5FRM A;  3FXO A;  1YW9 A;  2GXB A;  3K1N A;  2VQC A;  2VN2 A;  3LA7 A;  2LLK A;  3G1O A;  4XLP F;  2LY1 A;  1G3S A;  3DLL F;  1ZAR A;  4LG0 A;  1GLN A;  3FBN B;  1TWC J;  3JRD A;  2GA1 A;  2PJR B;  1X2N A;  3HKZ A;  5BQT A;  3B6A A;  2BV6 A;  4UXN A;  1VQ7 I;  2HTJ A;  2DYR H;  3BCB A;  3REO A;  1GDT A;  1JUM A;  5BPD A;  4XK4 A;  2KPM A;  1VI0 A;  1W5T A;  5D5V B;  1QVT A;  4IHY A;  2M4G A;  4HDU A;  4L5J A;  3JAM K;  1PP8 F;  5H6R A;  4CZC A;  1YQA A;  3I54 A;  3QP5 A;  3LSG A;  2LBF A;  2WY8 Q;  1J0R A;  1OLT A;  1X19 A;  4XLA A;  5FD6 A;  4NQW A;  4JX5 A;  1IGN A;  1VQL I;  2QKM B;  4E7H A;  3HOZ J;  1IXC A;  2L9N A;  1SD4 A;  2HGC A;  1HOM A;  1HW2 A;  2W57 A;  1W0U A;  4CYC B;  1TT0 A;  5EEG A;  3PSI A;  5E1W A;  1K78 B;  2X6X A;  4BL0 B;  3QQA A;  2VJJ A;  4B4C A;  1I3Q J;  2KIM A;  1DU6 A;  3CDL A;  4JOM A;  1U5T C;  2V7F A;  2EBI A;  1QA6 A;  1E2X A;  1N78 A;  2NRA C;  1YIT I;  3VEP A;  3BDD A;  3F3X A;  2LYC A;  1HQC A;  3HGG A;  3CO6 C;  1LE8 B;  4IQJ A;  3BY6 A;  3I9V 2;  2AXL A;  4BEH B;  3QAH A;  1QBJ A;  2HXI A;  1JKQ C;  1Y0U A;  3BLY A;  5LHI A;  3P9C A;  4EM1 A;  3KLN A;  1UCR A;  2Q0O A;  3GO5 A;  2CV0 A;  4BXF A;  3VYS B;  3I58 A;  3F72 A;  2OTJ I;  1IO2 A;  3HOU J;  3J81 Z;  3HUG B;  5L3F A;  5GTI C;  3U1K A;  5D8K B;  4M74 A;  3S8P A;  4Z2Y A;  4L5I A;  1AOY A;  2MFZ A;  2HYJ A;  1YJW I;  1SVL A;  2HQ5 A;  4HQM A;  5ILU A;  2CQK A;  1AA7 A;  3JTH A;  5LGU A;  2QA4 I;  3DBR B;  1YFH A;  2MH2 A;  2V4J C;  3G1L A;  4BHC A;  4BXU A;  5GAD J;  3MKZ A;  3O8G A;  3EPZ A;  1TNT A;  3DPT A;  4K2E A;  4M6X A;  1O3R A;  1YOV B;  2JPB A;  2CW8 A;  1UG0 A;  2OUM A;  5AIP A;  2FU4 A;  2E7W A;  1DGR M;  2BHZ A;  1MMD A;  5J8C A;  3CDI A;  1EH8 A;  2KIU A;  1J09 A;  3FHN A;  5GP9 A;  2K9M A;  3JRH A;  1Z05 A;  4HF2 A;  5IYB J;  1MBE A;  2E1M C;  3K4L A;  4G6Q A;  1IXR C;  1HC8 A;  1Y1V J;  2ZJ2 A;  4OAY A;  4M3G A;  4D1Q A;  2NS7 A;  1K79 A;  1VQP I;  2BZT A;  2JWT A;  2RN7 A;  3CCR I;  5FFX A;  4BXX J;  5H2F C;  1T39 A;  4H0E A;  3RKQ A;  1HF0 A;  2JA7 J;  4XLE A;  1W7P B;  2ZXH A;  4JX4 A;  2HPM A;  1ZG1 A;  2FML A;  1FJL A;  5FFZ A;  3KLO A;  2OQR A;  4ZYA A;  2JVG A;  3ZOB A;  3TOB A;  3OWT A;  3U9G A;  1FIP A;  1E3H A;  1WVR A;  2WA0 A;  1NH3 A;  4V19 K;  2DT5 A;  3L1P A;  1QU3 A;  3DV8 A;  2CUF A;  4L9N A;  4U0V A;  2XVC A;  3AAF A;  5DCM A;  3V42 A;  1O57 A;  2Z9O A;  1ITY A;  3H3U A;  2BY3 A;  3L9F A;  3OY9 A;  4P55 A;  3RCO A;  3IV5 A;  2E5Z A;  1B6A A;  4E7L A;  2V1U A;  1QZZ A;  2IS2 A;  1GXQ A;  1WH5 A;  5B5E C;  4QTR A;  2HU9 A;  4QPO A;  2GXG A;  3QPS A;  4ENJ A;  2DBB A;  4I7H A;  1FBU A;  2OZ6 A;  4HV5 A;  5F64 A;  2P8T A;  3OR2 C;  2VE8 A;  1POG A;  3QPH A;  1NK2 P;  1JGS A;  2BEO A;  2FD5 A;  2X85 A;  4ZTF A;  1UG2 A;  3BR3 A;  2YU9 J;  1RRJ A;  1XPX A;  1YIO A;  3HTU A;  3M8J A;  1FYL A;  2AQF A;  3LSJ A;  1WRJ A;  4G7O F;  4Y7N J;  4XIC A;  3HG9 A;  4ETS A;  1CGP A;  3I4P A;  4XQF A;  4PDK A;  3NQO A;  5HOD A;  3RQI A;  2EIL H;  5HLG A;  1WJE A;  3VYT B;  3OYE A;  3WG9 A;  3TO9 A;  2W25 A;  1R6R A;  3H5N A;  1DP7 P;  4AM3 A;  1A31 A;  5D5U B;  4LLL A;  4BJ6 C;  5L3D A;  3CLO A;  3JRI A;  1VFC A;  2M45 A;  2VJ5 A;  1U0J A;  3NAR A;  2BY1 A;  4HW0 A;  3F21 A;  4GYG A;  2KL4 A;  3I56 I;  2H09 A;  1XTA A;  2ZKZ A;  2L9R A;  3HSR A;  4UB8 C;  2LD5 A;  1MNE A;  4KUM A;  1JJ8 C;  2R7Z J;  3DCF A;  4I01 A;  2YX4 A;  2BVM A;  1FMV A;  1FX7 A;  2GBY A;  1TLH B;  2UXX A;  4IF4 A;  3HEF A;  4C9Y A;  1YJ9 I;  3U21 A;  3LSK A;  2FUG 2;  2H8W A;  4L9V A;  1GT0 C;  3IH4 A;  1WCM J;  2NYX A;  2E71 A;  1SAX A;  3LFK A;  1W7P D;  4U0Y A;  4F93 B;  2ID6 A;  1QQI A;  5CVU A;  4YFX F;  2KMU A;  5CVJ A;  1D3Y A;  2DAO A;  4BE1 A;  5LFA A;  3GTO J;  2YSR A;  2P7C B;  4P96 A;  1B9N A;  5TJJ A;  2FJ1 A;  5KAI C;  1KQ8 A;  3L2V A;  4BJ5 C;  2VB6 A;  4PJN A;  1DU0 A;  1Z77 A;  2JSP A;  3F9K A;  5GTH C;  1F5T A;  2M2E A;  4MTD A;  3GVA A;  2EZI A;  5E18 F;  3MZ8 A;  2NVU B;  2FNA A;  1UHS A;  1T98 A;  5CQE A;  4AYB N;  1FOK A;  3LST A;  3T8R A;  2Q2E B;  2K02 A;  2W85 A;  3TP0 A;  4BQQ A;  3QOE A;  1B72 B;  3JRG A;  4D7M A;  2WC2 A;  1SMT A;  1UAA A;  2L7F P;  3TQN A;  2DFI A;  3ABL H;  2Y9Y A;  4L18 B;  3HUG A;  1A36 A;  1OJL A;  3DBH B;  3COA C;  3E6D A;  5C44 J;  1JE8 A;  1P4A A;  2HYF A;  1K83 J;  1BI1 A;  1IRF A;  2ECC A;  2IS1 A;  1W1W E;  3SDB A;  4AUX A;  2L54 A;  3C7J A;  5F0C A;  2KQR A;  3H5A A;  1W5C C;  3FBI B;  2H6C A;  3M7G A;  4U88 A;  5HNH A;  4PFP A;  4NBQ A;  4UVB A;  5FKO A;  5JVG F;  3WTZ A;  2DLL A;  3M4O J;  3Q0U A;  4MEX F;  3GZ5 A;  3K69 A;  4D0P A;  2L02 A;  2JMW A;  1LVK A;  2KIQ A;  2L3D A;  3PNV A;  4BE0 A;  1XG1 A;  2RQP A;  2KIS A;  2Y75 A;  1HCR A;  1WJB A;  3BTJ A;  2HFH A;  1R4N B;  3KEO A;  1HW1 A;  5KK1 A;  1GVD A;  3DKX A;  4ZZD A;  3WTY C;  1D1C A;  3E5Q A;  1W7P A;  3E3V A;  3FX3 A;  2M4K A;  4UB6 C;  4DZJ A;  3L2R A;  2DT7 B;  5CVI A;  4UUV A;  2F4O B;  3KCC A;  4AYB A;  2KDZ A;  3ZQC A;  1KU2 A;  1ZRC A;  4BE2 A;  1YW8 A;  2DK8 A;  4CXF A;  1G59 A;  3GTK J;  1FOY A;  2RRE A;  3MZY A;  2JN6 A;  1I27 A;  2CYY A;  3BTL A;  1SFO J;  3BR2 A;  1IDZ A;  4RB2 C;  9ANT A;  3OYH A;  4M73 A;  4OAZ A;  2VQG A;  4WXH A;  3V8L A;  2CGP A;  3KP5 A;  3C2G A;  4A0Y A;  3MWM A;  2R5Y A;  4YEL A;  1Z0X A;  3B73 A;  2CV2 A;  2B9S A;  2IBD A;  1T6S A;  3PUF A;  5C4X J;  4B48 A;  1UB9 A;  3V7R A;  4CO8 A;  1ZTR A;  4EV0 A;  4I6Z A;  3H9Q A;  3ZPL A;  2P5V A;  2H8R A;  4UV9 A;  5BNG A;  2DA4 A;  1ULY A;  1QHG A;  3KP6 A;  5CVV A;  1AU7 A;  1SD6 A;  1NG7 A;  1IN7 A;  1RC9 A;  1N77 A;  2Q8K A;  1YG2 A;  3QOD A;  1USS A;  4ZC3 A;  1Z21 A;  2HDC A;  3DEW A;  1J5Y A;  4A93 J;  2DQL A;  1YLF A;  4MFD A;  2F5V A;  4M9Z A;  3PFY A;  4G9Y A;  2W82 A;  4LJZ F;  2LKX A;  1XMX A;  3O8H A;  4C3J J;  1S3J A;  4M71 A;  4QSH A;  3JRE A;  3N97 A;  1AKH B;  1I6H J;  1R71 A;  2PLY A;  4PJL A;  3LNQ A;  4CHU A;  5ICE A;  5BMZ A;  3F23 A;  1YS6 A;  1NTC A;  5LRS A;  3Q3S A;  2HOA A;  2R0Q C;  2DMU A;  2EFQ A;  4C3H J;  1YTY A;  4JK1 X;  4HLX A;  1S9H A;  1MZB A;  2XGD A;  2WAQ N;  3ZR8 X;  3DXJ F;  1IJW C;  1EV7 A;  1KON A;  1G2H A;  3ISP A;  2BXY A;  4QLC U;  2CO5 A;  3BC8 A;  3FXJ A;  5DEQ A;  4FHT A;  2DA1 A;  2I8D A;  1RPW A;  4XR6 A;  2STT A;  2QWW A;  3F22 A;  1SFU A;  3SZT A;  4I0B A;  2VUM J;  5D6F A;  2IPQ X;  4L9T A;  1XSX A;  4IHV A;  3U2R A;  3HHG A;  1X1A A;  5AON A;  3IKV A;  1MKM A;  1GV5 A;  5KNL A;  2VBZ A;  1B72 A;  1W4M A;  4YEJ A;  4BDY A;  2LRE A;  1FBQ A;  2VKH A;  3DU6 A;  1ZRE A;  2FA5 A;  2Z5U A;  1P4W A;  3HZJ A;  3WU0 A;  2X6O A;  3OIP A;  5LGT A;  2NNN A;  2VIX A;  2PN6 A;  3LAJ A;  3GTG J;  3VYR B;  4FT8 A;  2E1N A;  4WK8 F;  1MNM C;  4DIQ A;  4ABZ A;  3D1N I;  3NRV A;  2LFB A;  1JGG A;  2M0M A;  2E2H J;  2ISZ A;  2VBX A;  4M3F A;  2H1K A;  3TDU C;  5D4R A;  3CUQ B;  4TV7 A;  3TGN A;  3RJP A;  2F5E A;  4DZP A;  2CUJ A;  3A1Y A;  1WPK A;  4O6J A;  3OV8 A;  5C3E J;  4Y4R A;  3ZQ7 A;  3B6C A;  2HTS A;  4PGG A;  3GZN B;  3WHB A;  1U8R A;  2VQH A;  3MKW B;  5EG0 A;  4HQE A;  3KZY A;  2RKH A;  1WJC A;  4ZYE A;  2TDX A;  2DFE A;  5F04 A;  3QU3 A;  3TDZ C;  2H1L A;  2QSH X;  4YIF A;  5J1U A;  4P5O A;  3LSI A;  3CME I;  2GWR A;  5K7H A;  1HW5 A;  1VZ0 A;  3VYU B;  2JA5 J;  2R7V A;  1YO5 C;  3MFK A;  3F8B A;  4ZDP A;  3JSP A;  3HJE A;  3FXR A;  2K7L A;  1SC7 A;  3UKG A;  1XDU A;  1GXP A;  4OIP F;  3GEZ A;  2GIV A;  1YI2 I;  3QP6 A;  2VT2 A;  1JI8 A;  2YR2 A;  2DI3 A;  1TWH J;  2DOD A;  1FNN A;  3A4C A;  5D5W B;  1RUN A;  3FKI J;  1WH7 A;  5FKK A;  2VI6 A;  5KHD A;  2MAB A;  3RSN A;  4ZH4 F;  3I5U A;  1G3T A;  4XLH A;  2XRN A;  4BUP A;  4YFK F;  4QWQ A;  5A2Q K;  4E7I A;  2GM4 A;  2EJR A;  2XSJ C;  3FDY A;  1NK3 P;  3N4M A;  3F8F A;  2EB7 A;  3ZRG A;  4MIM A;  5FRO A;  2R5Y B;  2VXD A;  3W6J B;  3HOV J;  2KDO A;  3LA3 A;  4U87 A;  3NWT A;  2FRH A;  5IT9 K;  1BN5 A;  4D7N A;  1BI3 A;  1I39 A;  3SEZ A;  2OPT A;  2QYO A;  1DQU A;  2Z16 A;  2MH9 A;  1B4A A;  2MC3 A;  3KFW X;  2A61 A;  3IKT A;  3IP4 B;  3JW4 A;  5HVQ C;  2DDB A;  2EIN H;  1XSD A;  4OIN F;  3FK7 A;  4RDU A;  2ZJP F;  3HDD A;  1IRG A;  2PFB A;  2M30 A;  1VQM I;  3CDH A;  3RQ4 A;  1V55 H;  2QQ8 A;  4KFC A;  1BI2 A;  2XAJ A;  2Z3Y A;  4IHT A;  5ILS A;  3BZK A;  3OYJ A;  4XLF A;  5B1A H;  2BGC A;  2F48 A;  1MBF A;  3IHU A;  5LRR A;  3L2U A;  4OU0 A;  3O6B B;  1SD7 A;  2KJC A;  3RPQ A;  3WTU C;  1S72 I;  3FZV A;  2EZL A;  1TC3 C;  3S1Q J;  2VE9 A;  2GA2 A;  2OQG A;  4XKV A;  3CCS I;  3KP4 A;  1VQ9 I;  2PG4 A;  3BG6 A;  4ANJ A;  4Q47 A;  1OKR A;  2KKO A;  4HX7 A;  2WWY A;  4M9X A;  2COB A;  1ON2 A;  2RVC A;  4EQQ A;  3V4G A;  4W97 A;  2A6E F;  4AVZ A;  2D1H A;  3ZMT A;  2DA7 A;  5L3B A;  4HNU A;  4RS8 A;  3LAP A;  1EH6 A;  1Z6R A;  2ICW G;  2PX9 A;  1Z9C A;  2JA8 J;  1KU3 A;  4A3I J;  1E3O C;  2JJ7 A;  4CGZ A;  1X3U A;  4Y33 A;  3GTP J;  2P6S A;  3K6G A;  1Y39 A;  2CV1 A;  2NVQ J;  1FOW A;  2ZJQ F;  3WTW C;  1MBH A;  5DUK A;  2LVS A;  2E1O A;  5HDN A;  4EGY A;  3Q9S A;  4MTE A;  3K70 D;  1IN6 A;  1XD7 A;  1OCP A;  3F8C A;  1TW2 A;  2ME0 A;  4RGR A;  2DMT A;  2HDW A;  3ZCO A;  2YU3 A;  2CUZ A;  2XB0 X;  1PUF A;  1U3E M;  3QWL A;  1EF4 A;  3KP3 A;  1S8N A;  5FRN A;  4B1R A;  2X0L A;  2D1V A;  2JA2 A;  1U78 A;  1OCO H;  2LOO A;  2GZW A;  3F6O A;  4ZDL A;  4YFN F;  1QHH D;  3R61 A;  1ZAO A;  1B1B A;  2ZO4 A;  4EM2 A;  2AHQ A;  4GRI A;  1V54 H;  3S93 A;  1Z3X A;  1ACI A;  3CO7 C;  4KN4 X;  1O7L A;  4AWX B;  2HEO A;  2O03 A;  3KYD B;  1VQO I;  1SVM A;  3PM1 A;  2LG4 A;  4KIB A;  3SDG A;  4XN3 A;  1KU7 A;  4WX9 A;  2WAD A;  3BPX A;  3CUQ A;  2HYG D;  3PO2 J;  4YG2 F;  1LPQ A;  2ISY A;  1LUJ B;  1REP C;  5L3C A;  3FWE A;  3MKL A;  4JBA A;  3B02 A;  3FF5 A;  2K9Q A;  2STW A;  1F43 A;  3RTR A;  3V7S A;  2XAS A;  4BDZ A;  1ETQ A;  3HSE A;  3RZO J;  2GIZ A;  4LOC A;  2ZSH B;  3M8F A;  3DWL E;  3BTI A;  2ETH A;  3CCV I;  3FHZ A;  1S7O A;  1R9T J;  3T1B A;  2DA3 A;  2L0K A;  4LMY A;  2N8G A;  5LD2 C;  2JA6 J;  1TNS A;  4HLY A;  4X0G A;  3IAM 2;  1ZGA A;  4BQN A;  3S2W A;  2ZFU A;  5CPR B;  1MIJ A;  4KT6 A;  2K3P A;  4KNY A;  2DA2 A;  4F92 B;  4LB6 B;  1R1T A;  4CZZ A;  2LKS A;  4NB5 A;  2FOW A;  4HYE A;  1LB2 A;  2IAI A;  1RUO A;  4BBS J;  2V9P A;  1VQ8 I;  4HF1 A;  2P5L C;  3CCQ I;  3DKY A;  1UJ8 A;  1EJ9 A;  1WI3 A;  4LLN A;  4FAS D;  3IRR A;  1TBX A;  1XCV A;  4JYK A;  1QVU A;  5C4J J;  4IRG A;  2K4B A;  5HS8 A;  3K0L A;  3RYP A;  3S2H J;  3OR1 C;  3K2Z A;  3H0D A;  2BW3 A;  3GFL A;  1H88 C;  2M87 A;  4L0Z B;  3QOP A;  2VON A;  4GYI A;  3ABK H;  2ME6 A;  2K9L A;  3TBI A;  4XBF A;  2LRD A;  1MDM A;  3KEQ A;  3OS2 A;  4KIG A;  2OV7 A;  1TTY A;  5DS9 A;  4BY1 J;  3OS0 A;  4IOC F;  4HF0 A;  4PJ0 C;  1TT5 B;  3IH3 A;  5IT3 A;  3FXL A;  2BY0 A;  3GLX A;  4FX4 A;  3H36 A;  4XL9 A;  3R6S A;  4F7Z A;  1B9M A;  3H3V K;  4A3F J;  3GWZ A;  2C6Y A;  3ESW B;  2F6C A;  1FP2 A;  4IXA A;  3HPG A;  5D5X B;  2CRG A;  4IHW A;  1T8I A;  1ZLJ A;  2CJJ A;  1MSF C;  3HBL A;  2HVR A;  3A2K A;  2KP6 A;  5FKL A;  2B0L A;  1G3W A;  3E97 A;  2PJP A;  4XLN F;  1DPR A;  3LWF A;  3I55 I;  1PUE E;  3HRT A;  1LDK B;  3K2A A;  1S6L A;  2WAE A;  2WY7 Q;  5M5Y J;  3IL2 A;  1ZRF A;  5F0H A;  4UY8 I;  2ADU A;  3BG9 A;  4G94 A;  2HVS A;  5ICG A;  1XMA A;  1MH3 A;  3W2V A;  2PMU A;  4P9U A;  1P92 A;  4B47 A;  3F8M A;  3PIP F;  1IV8 A;  3CCM I;  1BR4 A;  3GME A;  3K10 A;  2PMZ N;  4IQ4 A;  2MG4 A;  4UVA A;  3RDI A;  2Y9Z A;  1YHQ I;  1MSE C;  1DUX C;  4A3B J;  4Y52 J;  4LG0 B;  2EZH A;  2WV1 A;  1MMS A;  2CMP A;  3CJQ B;  1SVO A;  2ZNZ A;  1EA3 A;  3J7Y J;  2HPI A;  2EFO A;  2VPR A;  2DQR A;  3SFI A;  1OMI A;  3R60 A;  3WE2 A;  2ESH A;  3WHC A;  1ETK A;  3OOP A;  2CUE A;  2W4S A;  2CFO A;  4RGX A;  4BH9 A;  1HKQ A;  3LOC A;  5M5X J;  1BOB A;  1GUU A;  1MH4 A;  1MBJ A;  5ERI A;  3KIO A;  1PUF B;  2QSF X;  2KFD A;  3PIO F;  3E6M A;  2H94 A;  3A01 A;  4HV6 A;  4EJO A;  2DDA A;  1MND A;  3AG2 H;  3CJT B;  4NQW B;  4RLQ A;  5DDG A;  3E7L A;  3ELK A;  3BPV A;  2ELK A;  5TGT A;  4L0Y B;  2IGM A;  2ZCW A;  3VOD A;  1A6Q A;  1K78 A;  3VWB A;  1U9O A;  3SFZ A;  1V5E A;  2J5P A;  4G7H F;  2L7Z A;  4G12 A;  3M07 A;  3JSO A;  3DKW A;  1CQT A;  4D5C A;  4PK4 A;  3LSH A;  4BEH A;  1E3P A;  2CFX A;  1R23 A;  5K5Q A;  4N4N B;  4WXC A;  2OD5 A;  2BVL A;  3G1M A;  3I71 A;  2XF6 A;  2VOO A;  5ICC A;  2WV0 A;  3CQZ J;  4IO9 F;  4EAT A;  4Q4Z F;  2CH0 A;  3HOT A;  1DDN A;  3DTE A;  2Y69 H;  3ONQ A;  1LEA A;  1QZE A;  3K7A J;  4U0W A;  1R5G A;  2NS0 A;  2GXA A;  3FK6 A;  2DO7 A;  2TCT A;  3I3L A;  3DU5 A;  4A6E A;  5E8I A;  2OU2 A;  2VOP A;  2VBY A;  3ERE D;  2XDV A;  2H27 A;  3FM5 A;  3GCM A;  2QQA A;  3EDP A;  3H9J A;  5FKM A;  5J40 A;  3VFZ A;  5JR3 A;  2P4W A;  1ONV A;  1IUY A;  4E7S A;  1SD5 A;  3H35 A;  1O3T A;  4AID A;  3KEY A;  5F08 A;  4DJA A;  1OR7 C;  2NS8 A;  4MQ9 F;  4E70 A;  2WB1 A;  1Q1V A;  3PQK A;  3RKY A;  5M5W J;  3CP8 A;  2CW0 F;  1U5T B;  3BQY A;  2DW4 A;  2Y0S N;  2IEK A;  2DTZ A;  3HHH A;  3O2P E;  3OL3 A;  3HOW J;  3VOE A;  3OYI A;  3JTG A;  2L2O A;  1XGS A;  2RDP A;  2YX7 A;  4L5E A;  1WZ2 A;  2PMZ A;  1TZL A;  2A6T A;  2NAZ A;  4KJZ A;  5AIQ A;  3OYF A;  1XSV A;  2YUS A;  1RET A;  2P5K A;  2VKE A;  3FXU A;  1VND A;  4DNC A;  4UHT A;  3KP7 A;  5LHH A;  3LA2 A;  4II3 A;  2WAF A;  1ETO A;  3GFJ A;  5J47 A;  3UNG C;  2A05 A;  2E19 A;  1FZP B; 
#chains in the Genus database with same CATH homology
 2EA2 A;  1U2W A;  1H9G A;  1ZG5 A;  4I2O A;  5DCM B;  1PP7 U;  3KET A;  1WQ2 A;  2FBK A;  1UST A;  4GGG A;  3BWG A;  3MAJ A;  3IC7 A;  1BBY A;  2J5O A;  3L09 A;  4IRH A;  4A2U A;  2BYV E;  2LNB A;  2IA0 A;  1T2K A;  1ZN2 A;  1TQI A;  2G7H A;  1KU9 A;  2BE5 F;  3M9A A;  3I64 A;  3SXY A;  2XAG A;  2CG4 A;  1ON1 A;  4M6Y A;  5H6Q A;  3QRF F;  5LGN A;  4OMY A;  1HXD A;  4A5M A;  3WGI A;  2V6C A;  5FB2 A;  4G8X A;  2QQ9 A;  3RKW A;  3U1D A;  4NHJ A;  3T8T A;  4R79 A;  1V3F A;  2EFW A;  4B09 A;  3GX4 X;  1DPU A;  1O3Q A;  5TRD A;  3WTS C;  2FEZ A;  1SFX A;  2V79 A;  4MGR A;  2Z99 A;  2O8X A;  3EYI A;  3EUH A;  4AIH A;  3BJ6 A;  2FXA A;  1RI7 A;  1FYM A;  4MEY F;  5E20 A;  3CTA A;  2XUB A;  1IF1 A;  4UVC A;  2NNY A;  4MQV A;  1QPM A;  1TQM A;  1T0F A;  2IJL A;  4BYY A;  4OIQ F;  1HBX G;  1BIB A;  3O3K A;  4ZYD A;  6PAX A;  5F1R A;  2UWM A;  2IP2 A;  1IAW A;  2QBY A;  4HX8 A;  4Y13 A;  4EJW A;  2A6H F;  3M8E A;  3ZP5 A;  2DPU A;  2HR3 A;  4N9H A;  3BJO A;  3GFI A;  1TQP A;  2HOE A;  2KRF A;  2HS5 A;  2MA3 A;  1H0M A;  2XHK A;  3K9T A;  1WSU A;  2EFN A;  4OMZ A;  4RB0 A;  1FWZ A;  2Z33 A;  4LGW A;  5LLQ A;  2ZXJ A;  1D8J A;  1W5S A;  1LVA A;  1LJ9 A;  3K1M A;  2XKO A;  2MD5 A;  2R3S A;  1RIO H;  4KA4 A;  1LDJ A;  1J7K A;  3NEU A;  4G7Z F;  1B59 A;  1QZY A;  2GQQ A;  5ED4 A;  5J8F A;  1G3Y A;  1FPQ A;  3F8N A;  1IXS B;  3K1P A;  3TOA A;  3HRM A;  4HAM A;  1I1S A;  2XGX A;  4Y17 A;  2BBY A;  1ZYR F;  1XGO A;  1SMY F;  5D6E A;  4I02 A;  2MLG A;  3EET A;  3ULQ B;  5DD4 A;  4BHB A;  2MBF A;  2K4J A;  3DP7 A;  4ESB A;  5BS6 A;  4LK1 F;  3DPL C;  4GO1 A;  3KE2 A;  1UHW A;  3BP8 A;  3RKX A;  4P9F A;  2DPD A;  3EYY A;  3H3Z A;  2M1B A;  2M8E A;  2MLK A;  1QGP A;  1R36 A;  3MQ0 A;  2KIF A;  1HSJ A;  4N0B A;  4RGS A;  1KYZ A;  2HKX A;  5LHG A;  2OBP A;  2IA1 A;  1WI9 A;  1R7J A;  4AD9 A;  1LQ1 A;  5KVR A;  1XGM A;  4M72 A;  2PMH A;  3MEX A;  3HRS A;  2XAQ A;  4OIO F;  5LEJ A;  4ASN A;  3WTV C;  3T0Y A;  4A5N A;  1BJA A;  1PDN C;  4G6D A;  3ECH A;  3H92 A;  2HKO A;  3RI4 A;  5ICF A;  2EA4 A;  3SHF A;  2IT0 A;  4RB1 A;  1FT9 A;  3E6B A;  1LNW A;  4GXO A;  2QBY B;  5E1Z B;  3C3W A;  4Q5S F;  1IN8 A;  1EH7 A;  4ON0 A;  2P7V B;  5JHU A;  5HDK A;  4IJA A;  2O3F A;  4EMS A;  2W84 A;  5H20 A;  2ZBK A;  4DQ2 A;  2UXN A;  3ZMS A;  1Z7U A;  1MD0 A;  5EEH A;  4A6D A;  1TW3 A;  2HWV A;  3PFI A;  3MCZ A;  4HBL A;  3P7N A;  2PI0 A;  3HTS B;  2X4H A;  4HX4 A;  5D4S A;  5J6X A;  2IA2 A;  2JTV A;  5L3E A;  1KQ9 A;  4ZYH A;  1BIA A;  2LKP A;  1RZ4 A;  2LDU A;  4XSZ F;  5HDG A;  2CSO A;  1T38 A;  4KMF A;  4LK0 F;  1CF7 B;  1KQ0 A;  1G4D A;  3FMQ A;  3E5X A;  4LD5 A;  3CJN A;  2V1D A;  3ZMV A;  2D45 A;  3RPU A;  3WTX C;  4EJV A;  4JQF A;  3GXO A;  2F5D A;  4WF2 A;  4A0X A;  4AVP A;  4WCG A;  3HSF A;  1XGN A;  1IN4 A;  2IVM A;  3LQQ A;  2FBI A;  3R0J A;  2L01 A;  5CYV A;  5JVT A;  2EWN A;  3ZMU A;  5K5O A;  2XKP A;  1Q1H A;  1BC7 C;  3DF8 A;  2OA4 A;  4BNC A;  3WOD F;  3IWF A;  3D5L A;  2EV0 A;  4ENM A;  4UV8 A;  1HKS A;  3I59 B;  2AS5 F;  4PGH A;  4AIJ A;  4XSX F;  5DV5 A;  2QZ8 A;  2A69 F;  4UNO A;  1I6X A;  2RV8 A;  4HA8 A;  4IVN A;  5BOX A;  3I53 A;  2VXZ A;  4KT5 C;  1J2X A;  3L2C A;  1S29 A;  3SQN A;  3WE3 A;  2RNJ A;  2H6B A;  5A2Q Z;  1WWX A;  3E6C C;  5FD5 A;  2GAU A;  2ZME A;  5LBQ A;  4HZF A;  1J59 A;  1F4K A;  1V4R A;  5L3G A;  2Q2E A;  2P6T A;  2VBW A;  2FBH A;  1MJB A;  4Q48 A;  4XRF A;  2FNP A;  4ZYG A;  2LF8 A;  2ZFW A;  3V8J A;  4KIC A;  1OPC A;  1I5Z A;  1YW7 A;  1HST A;  2O6G E;  4ENK A;  5FLX Z;  4I0A A;  3LQR A;  3WTT C;  2M5W A;  5ILV A;  3QPT A;  4AIK A;  1FYK A;  5CJ9 A;  1WKM A;  1GHC A;  1P4X A;  3RYR A;  2XAH A;  3BRO A;  2FE3 A;  1ODD A;  2ACJ A;  3J7A O;  3QU6 A;  5JFR A;  2VT3 A;  3F6V A;  1L3L A;  1C0W A;  4Y15 A;  1OYW A;  2OAZ A;  1R1U A;  3C18 A;  3BOQ A;  1OYY A;  4KYW A;  3CUO A;  3MZH A;  1CF7 A;  2G9W A;  2W24 A;  1XCB A;  3L00 A;  3DQV C;  4S04 A;  2K27 A;  1SFE A;  2VOD A;  2JZY A;  4HDV A;  1R58 A;  2K86 A;  1NHA A;  3IRQ A;  4ESJ A;  1E17 A;  3SZP A;  1RNL A;  1BI0 A;  4EVI A;  5JI6 A;  1QNT A;  2DTR A;  4BHP A;  3GUD A;  3HRU A;  1MDM B;  3DEU A;  3TO7 A;  1BM9 A;  1UHM A;  1XDS A;  2L4M A;  1YS7 A;  5DCF A;  3IWZ A;  1XB4 A;  1A04 A;  1I1G A;  2CWE A;  2RC4 A;  2V9V A;  1R00 A;  1LEB A;  5CLS A;  4LB5 A;  4WXD A;  4EM0 B;  3I59 A;  3ZN1 A;  3ZMD A;  1IN5 A;  1G6N A;  1HKT A;  4KDP A;  4RGU A;  2FSW A;  3R4K A;  3PQJ A;  2ESN A;  3ML6 A;  1JHF A;  2F5C A;  2QQB A;  1FP1 D;  3RIR A;  4EGZ A;  3ECO A;  3FM3 A;  2JSC A;  2Y48 A;  4KN7 X;  4FX0 A;  2R7F A;  3ZMZ A;  1P6R A;  1KGS A;  4S05 A;  2ZME B;  2LF7 A;  2QVO A;  4BQA A;  4B8X A;  3E5U A;  1FY7 A;  4LLG F;  1QO0 D;  1R22 A;  3ABT A;  2O0Y A;  5IT9 Z;  1BC8 C;  4O3M A;  3ROU A;  3GYH X;  2ELH A;  3GZ6 A;  2QEN A;  2D2W A;  2KJB A;  4L9J A;  1D8K A;  2A68 F;  3P9K A;  3GW2 A;  1IW7 F;  1IZ1 A;  4CDG A;  1MJ9 A;  1LDD A;  1O7F A;  2V1X A;  3CUQ C;  2UZK A;  3Q9V A;  4O5V A;  2F2E A;  2EV6 A;  3J80 Z;  5D8L B;  4N9I A;  2Y0M A;  1U6G A;  2VC0 A;  5DYM A;  3P9I A;  2COM A;  2IRF G;  3HYI A;  1U5T A;  3TKY A;  3WU1 B;  4U7B A;  3GF2 A;  2G7U A;  1P2F A;  3M1E A;  3G3Z A;  2A3S A;  1OR7 A;  4IPA A;  2HQR A;  3V7C A;  2FMY A;  2EK5 A;  1XMK A;  5BPI A;  4RAZ A;  2JT1 A;  4ZZL A;  4KMU X;  3EQL F;  2E7X A;  1YYV A;  2HQN A;  3C1D A;  2O61 A;  1JHH A;  2DK5 A;  4M9S A;  4I98 B;  5HS9 A;  5HLH A;  1F1Z A;  3FXQ A;  2WTE A;  3J81 K;  4MHG A;  2HZT A;  3BJA A;  3WGH A;  2PEX A;  1AWC A;  2ZNY A;  5E1X A;  1Z1D A;  3VB2 A;  3TO6 A;  1S7A A;  5E8G A;  5FLX K;  3FMR A;  2E1C A;  1R5H A;  2A07 F;  3BZ6 A;  4OOI A;  1VTN C;  4CIC A;  3HOS A;  3ABU A;  1XN7 A;  3KZZ A;  4GCV A;  2A5Y B;  5E17 F;  3KP2 A;  4ESF A;  3Q5F A;  4BAY A;  2XRO A;  5HS7 A;  4EJT A;  1ZGJ A;  5LEK A;  5HLI A;  2QM3 A;  2JPC A;  5CVR A;  3D0S A;  3FMS A;  5FGM A;  3R0A A;  4PZJ A;  1D5V A;  2FQ3 A;  3J80 K;  1F9N A;  1JXS A;  1FBS A;  1ZG3 A;  1H9T A;  4ENN A;  5K1Y A;  2EFP A;  1STZ A;  1J9I A;  1ZLK A;  2XV4 S;  2LSO A;  5DUI A;  4RAY A;  1GVJ A;  3ZN0 A;  5K5R A;  5FO5 A;  3I0T A;  1OYI A;  4A0Z A;  4IHS A;  1Z6T A;  3L7W A;  1K7A A;  2DU9 A;  3DFG A;  3JAM Z;  1FSH A;  1L0O C;  1FLI A;  2EV5 A;  2QLZ A;  1KYW A;  2R7D A;  4EJU A;  4KIF A;  1K6O A;  2PQ8 A;  4OIR F;  2OZU A;  4R8H A;  4I09 A;  1FSE A;  4A12 A;  1R1V A;  2IW5 A;  1O3S A;  3V8K A;  3W6K B;  3GFM A;  2XAF A;  2L4A A;  5F6F A;  4WWC A;  4R1H A;  1ZHF A;  4YII A;  1UFM A;  1ZRD A;  2JRT A;  2YPR A;  1Z91 A;  2PBI A;  5DD8 A;  1ZH5 A;  1BOA A;  2F5F A;  3HIF A;  4U7D A;  2RGV A;  2QUF A;  1KA8 A;  3G73 A;  4LFU A;  4HOB A;  4MNU A;  4PCQ A;  2XIG A;  2FOK A;  1MGT A;  3T5X A;  1FC3 A;  3WGG A;  4CYD A;  2FF4 A;  4IRI A;  5HOO A;  1MJA A;  2VC1 A;  4RB3 C;  1YW9 A;  2GXB A;  3K1N A;  2VN2 A;  3LA7 A;  4XLP F;  1G3S A;  1ZAR A;  4LG0 A;  2GA1 A;  5BQT A;  4UXN A;  2BV6 A;  2HTJ A;  3REO A;  5BPD A;  1W5T A;  5D5V B;  4HDU A;  4L5J A;  3JAM K;  1PP8 F;  5H6R A;  1YQA A;  3I54 A;  3QP5 A;  1J0R A;  5FD6 A;  4NQW A;  1IXC A;  1SD4 A;  2HGC A;  1HW2 A;  2W57 A;  5EEG A;  5E1W A;  1K78 B;  2KIM A;  1U5T C;  1E2X A;  2NRA C;  3VEP A;  3BDD A;  3F3X A;  3CO6 C;  1HQC A;  3BY6 A;  2AXL A;  3QAH A;  1QBJ A;  1Y0U A;  5LHI A;  3P9C A;  4EM1 A;  3KLN A;  1UCR A;  2Q0O A;  3GO5 A;  3I58 A;  3F72 A;  3J81 Z;  5L3F A;  5D8K B;  4M74 A;  4Z2Y A;  4L5I A;  1AOY A;  4HQM A;  5ILU A;  2CQK A;  1YFH A;  3JTH A;  5LGU A;  2MH2 A;  4BHC A;  4BXU A;  1TNT A;  3DPT A;  4K2E A;  4M6X A;  1O3R A;  2JPB A;  5AIP A;  2FU4 A;  2E7W A;  5J8C A;  1EH8 A;  2KIU A;  4HF2 A;  1Z05 A;  4G6Q A;  1IXR C;  2ZJ2 A;  1K79 A;  2RN7 A;  5FFX A;  1T39 A;  4H0E A;  1W7P B;  1ZG1 A;  2FML A;  5FFZ A;  3KLO A;  2OQR A;  3TOB A;  3U9G A;  2DT5 A;  2Z9O A;  3DV8 A;  4L9N A;  4U0V A;  2XVC A;  3AAF A;  5DCM A;  1O57 A;  3H3U A;  3L9F A;  4P55 A;  1B6A A;  2V1U A;  1QZZ A;  1GXQ A;  2GXG A;  4ENJ A;  2DBB A;  4I7H A;  1FBU A;  2OZ6 A;  4HV5 A;  5F64 A;  2P8T A;  2VE8 A;  3QPH A;  1JGS A;  2BEO A;  1YIO A;  3HTU A;  1FYL A;  1WRJ A;  4G7O F;  4ETS A;  1CGP A;  3I4P A;  4PDK A;  3NQO A;  5HLG A;  3WG9 A;  3TO9 A;  2W25 A;  1DP7 P;  5D5U B;  4LLL A;  5L3D A;  3CLO A;  2M45 A;  4HW0 A;  3F21 A;  4GYG A;  2H09 A;  2ZKZ A;  3HSR A;  4KUM A;  4I01 A;  2YX4 A;  1FX7 A;  1TLH B;  2UXX A;  4IF4 A;  4L9V A;  2NYX A;  1SAX A;  3LFK A;  1W7P D;  4U0Y A;  1QQI A;  5CVU A;  4YFX F;  5CVJ A;  1D3Y A;  2DAO A;  2YSR A;  2P7C B;  4P96 A;  1B9N A;  5TJJ A;  1KQ8 A;  1F5T A;  4MTD A;  3GVA A;  5E18 F;  2FNA A;  1T98 A;  1FOK A;  3LST A;  3T8R A;  2K02 A;  2W85 A;  2WC2 A;  1SMT A;  3TQN A;  2DFI A;  4L18 B;  3HUG A;  3COA C;  3E6D A;  1JE8 A;  1P4A A;  2HYF A;  1BI1 A;  1IRF A;  2L54 A;  3C7J A;  2H6C A;  3M7G A;  4U88 A;  4UVB A;  3WTZ A;  2DLL A;  4MEX F;  3GZ5 A;  3K69 A;  4D0P A;  2L02 A;  2L3D A;  2RQP A;  2Y75 A;  2HFH A;  3KEO A;  1HW1 A;  5KK1 A;  4ZZD A;  3WTY C;  3E5Q A;  1W7P A;  3E3V A;  3FX3 A;  5CVI A;  4UUV A;  3KCC A;  1ZRC A;  1KU2 A;  1YW8 A;  2DK8 A;  4CXF A;  3MZY A;  1I27 A;  2CYY A;  4RB2 C;  4M73 A;  4WXH A;  3V8L A;  2CGP A;  3KP5 A;  4A0Y A;  3MWM A;  3B73 A;  1T6S A;  1UB9 A;  3V7R A;  4CO8 A;  4EV0 A;  3ZPL A;  2P5V A;  4UV9 A;  1ULY A;  3KP6 A;  5CVV A;  1SD6 A;  1IN7 A;  2Q8K A;  1YG2 A;  1USS A;  2HDC A;  1J5Y A;  2DQL A;  1YLF A;  4M9Z A;  4G9Y A;  4LJZ F;  1S3J A;  4M71 A;  3N97 A;  2PLY A;  4CHU A;  5ICE A;  5BMZ A;  3F23 A;  1YS6 A;  5LRS A;  2EFQ A;  1YTY A;  4JK1 X;  4HLX A;  1MZB A;  3DXJ F;  1EV7 A;  3ISP A;  4QLC U;  2CO5 A;  5DEQ A;  4FHT A;  2STT A;  2QWW A;  3F22 A;  1SFU A;  3SZT A;  4I0B A;  5D6F A;  2IPQ X;  4L9T A;  1XSX A;  3U2R A;  3HHG A;  5AON A;  3IKV A;  1MKM A;  2VBZ A;  1ZRE A;  1W4M A;  1FBQ A;  2FA5 A;  2Z5U A;  1P4W A;  3WU0 A;  5LGT A;  2NNN A;  2PN6 A;  3LAJ A;  4FT8 A;  2E1N A;  4WK8 F;  3NRV A;  2ISZ A;  2VBX A;  3TDU C;  5D4R A;  3CUQ B;  4TV7 A;  3TGN A;  2F5E A;  4O6J A;  3OV8 A;  3ZQ7 A;  2HTS A;  4PGG A;  1U8R A;  4HQE A;  3KZY A;  2RKH A;  4ZYE A;  2TDX A;  3TDZ C;  3QU3 A;  4YIF A;  4P5O A;  2GWR A;  1HW5 A;  1YO5 C;  3MFK A;  3F8B A;  3JSP A;  3FXR A;  2K7L A;  1XDU A;  1GXP A;  4OIP F;  3GEZ A;  2GIV A;  3QP6 A;  2VT2 A;  2YR2 A;  2DI3 A;  1FNN A;  5D5W B;  1RUN A;  4ZH4 F;  3I5U A;  1G3T A;  4YFK F;  2XRN A;  4QWQ A;  5A2Q K;  2EJR A;  3N4M A;  3F8F A;  2EB7 A;  3W6J B;  3LA3 A;  2FRH A;  5IT9 K;  1BN5 A;  1BI3 A;  2QYO A;  2MH9 A;  1B4A A;  2MC3 A;  3KFW X;  2A61 A;  3IKT A;  3JW4 A;  5HVQ C;  1XSD A;  4OIN F;  1IRG A;  2PFB A;  2M30 A;  3CDH A;  4KFC A;  1BI2 A;  2XAJ A;  2Z3Y A;  4IHT A;  5ILS A;  2BGC A;  3IHU A;  5LRR A;  4OU0 A;  3O6B B;  3RPQ A;  1SD7 A;  2KJC A;  3WTU C;  3FZV A;  2VE9 A;  2GA2 A;  2OQG A;  3KP4 A;  2PG4 A;  4Q47 A;  1OKR A;  2KKO A;  4HX7 A;  2WWY A;  4M9X A;  1ON2 A;  2RVC A;  4EQQ A;  3V4G A;  2A6E F;  2D1H A;  3ZMT A;  5L3B A;  4RS8 A;  3LAP A;  1EH6 A;  1Z6R A;  1Z9C A;  1KU3 A;  4CGZ A;  1X3U A;  2P6S A;  3WTW C;  5DUK A;  5HDN A;  4EGY A;  3Q9S A;  4MTE A;  1IN6 A;  1XD7 A;  3F8C A;  1TW2 A;  4RGR A;  2YU3 A;  1U3E M;  3KP3 A;  1S8N A;  1J75 A;  2X0L A;  2D1V A;  1U78 A;  3F6O A;  2GZW A;  4YFN F;  3R61 A;  1ZAO A;  1B1B A;  2ZO4 A;  4EM2 A;  3CO7 C;  4KN4 X;  1O7L A;  4AWX B;  2HEO A;  2O03 A;  4KIB A;  1KU7 A;  4WX9 A;  3BPX A;  3CUQ A;  2HYG D;  4YG2 F;  2ISY A;  1REP C;  5L3C A;  3FWE A;  4JBA A;  3B02 A;  3FF5 A;  2STW A;  3RTR A;  3V7S A;  2XAS A;  3HSE A;  3M8F A;  2ETH A;  3FHZ A;  1S7O A;  3T1B A;  4LMY A;  1TNS A;  4HLY A;  1ZGA A;  3S2W A;  4KNY A;  4LB6 B;  1R1T A;  4CZZ A;  4NB5 A;  4HYE A;  1LB2 A;  1RUO A;  4HF1 A;  2P5L C;  4LLN A;  3IRR A;  1TBX A;  1XCV A;  4IRG A;  2K4B A;  5HS8 A;  3K0L A;  3RYP A;  3K2Z A;  3GFL A;  2M87 A;  4L0Z B;  3QOP A;  2VON A;  4GYI A;  4XBF A;  1MDM A;  3KEQ A;  4KIG A;  1TTY A;  4HF0 A;  5IT3 A;  3GLX A;  4FX4 A;  3R6S A;  4F7Z A;  1B9M A;  3GWZ A;  2C6Y A;  1FP2 A;  4IXA A;  5D5X B;  1ZLJ A;  2B0L A;  1G3W A;  3E97 A;  2PJP A;  4XLN F;  1DPR A;  3LWF A;  1PUE E;  3HRT A;  1LDK B;  1S6L A;  3IL2 A;  1ZRF A;  2ADU A;  4G94 A;  5ICG A;  1XMA A;  2PMU A;  4P9U A;  1P92 A;  3F8M A;  4UVA A;  3RDI A;  1DUX C;  4LG0 B;  2ZNZ A;  2EFO A;  2DQR A;  1OMI A;  3R60 A;  3WE2 A;  2ESH A;  3OOP A;  4RGX A;  4BH9 A;  1HKQ A;  5ERI A;  3E6M A;  2H94 A;  4HV6 A;  4EJO A;  5DDG A;  3ELK A;  3BPV A;  4L0Y B;  2ZCW A;  3VOD A;  1K78 A;  3SFZ A;  2J5P A;  4G7H F;  3JSO A;  3DKW A;  2CFX A;  1R23 A;  5K5Q A;  4WXC A;  2OD5 A;  3I71 A;  2VOO A;  5ICC A;  2WV0 A;  4Q4Z F;  3HOT A;  1DDN A;  1LEA A;  4U0W A;  1R5G A;  2NS0 A;  2DO7 A;  4A6E A;  5E8I A;  2OU2 A;  2VOP A;  2VBY A;  3ERE D;  2H27 A;  3FM5 A;  3VFZ A;  2QQA A;  3EDP A;  5JR3 A;  2P4W A;  1ONV A;  1IUY A;  1SD5 A;  4MQ9 F;  4E70 A;  3PQK A;  3RKY A;  2CW0 F;  1U5T B;  2DW4 A;  3HHH A;  3O2P E;  3VOE A;  3JTG A;  1XGS A;  2RDP A;  2YX7 A;  2NAZ A;  5AIQ A;  1XSV A;  2P5K A;  3FXU A;  1O3T A;  4DNC A;  5LHH A;  3KP7 A;  3LA2 A;  4UHT A;  3GFJ A;  3RJP A;  1FZP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...