5D4RA

Crystal structure of arar(dbd) in complex with operator ore1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
HLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Transcription/dna
molecule keywords Arabinose metabolism transcriptional repressor
total genus 22
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d4rA00
3F8BA 1OKRA 3WU1B 3E6MA 1MZBA 3LFKA 1B59A 1LNWA 3W6JB 3V7SA 4IJAA 1EV7A 3QAHA 4U0WA 1BI1A 3LQQA 4YG2F 2VT3A 5DD8A 4ETSA 4R1HA 1TQMA 2HTJA 1R5HA 4I01A 1W7PB 4HF0A 1ZARA 2A07F 4EJOA 2A3SA 2H09A 3ZPLA 3GX4X 3I4PA 3O6BB 1P4XA 3E6DA 2O03A 3F8CA 4A5MA 3WTZA 1IUYA 4LFUA 3J80Z 1TNTA 1T38A 2D45A 2TDXA 3QRFF 2GA2A 1KU3A 4ESFA 3KZYA 5LEJA 2HYFA 1I1SA 4IRHA 3LA2A 2PMUA 3HRTA 2GQQA 3VEPA 1YO5C 1D8JA 3E97A 1K78A 1IN8A 4KIFA 3WGHA 2GA1A 5A2QZ 1WSUA 5E8GA 2R3SA 4FT8A 2CYYA 1IN5A 3DQVC 1UB9A 5ICGA 2A5YB 2OBPA 2HOEA 4KNYA 2HKOA 3O2PE 1ZRFA 3LAPA 5KVRA 3IWZA 1D5VA 3BP8A 4HZFA 2K02A 1FSHA 4JK1X 4H0EA 2DK8A 3VB2A 3HYIA 1RUNA 2GZWA 4HLYA 3M8FA 2VBYA 2NNYA 2LNBA 4HDUA 3BWGA 3GYHX 2PMHA 3RI4A 4ESJA 2ETHA 2ZCWA 2XAQA 2VOPA 5K5QA 2P5VA 2ESHA 2XASA 4L5JA 4KMFA 4IVNA 4GO1A 3IHUA 4EJTA 2FF4A 2DT5A 4HW0A 1ON1A 4EQQA 5JHUA 4CHUA 5L3GA 3DPTA 1EH8A 1YIOA 5AIPA 4G94A 2FNPA 4YFNF 4M6XA 2CSOA 3O3KA 3L00A 1R00A 1J59A 3MWMA 2OD5A 4RB1A 1BJAA 1KU9A 4LG0B 4L9NA 4UVAA 4ZYGA 4WWCA 2EWNA 4IHSA 2DPDA 2OU2A 4HX7A 4G9YA 2FOKA 3CLOA 4ZYEA 4OINF 4EM2A 5L3EA 3LQRA 4KIGA 1FZPB 1IAWA 3KE2A 2Y0MA 3FM3A 1ZG1A 4ZH4F 4FX4A 3R60A 1IN7A 1R1VA 3ZQ7A 2JTVA 4MQ9F 3PQKA 3BZ6A 4P9UA 3IKTA 2NNNA 1DUXC 3JAMZ 4ENMA 1JHHA 1GXPA 1ZHFA 1XMAA 4N9HA 4A2UA 3FMQA 3T8TA 2IPQX 3HTUA 1FY7A 5HLGA 4WX9A 3ZMVA 2ZO4A 3CO6C 4EVIA 5F6FA 4L0ZB 1P6RA 4AIJA 3GXOA 3SFZA 3G3ZA 2EFQA 3F6VA 5BOXA 1XGSA 5EEGA 1Z1DA 4LJZF 4MGRA 2FQ3A 2DAOA 3KEOA 2QQAA 5LEKA 3F72A 4PZJA 3D0SA 3ZMDA 4ENJA 2COMA 3JTHA 2HDCA 2RGVA 2A61A 4LG0A 2VN2A 3L7WA 4ENNA 2Y75A 4RGXA 2D1HA 3HSRA 3DF8A 2V1UA 2VOOA 5FLXK 2NS0A 4S04A 3V7RA 3GFIA 4QWQA 4OIPF 1OYYA 1MJAA 3KP5A 3DP7A 2BBYA 1LVAA 5AONA 1H0MA 3KLNA 4Q4ZF 5CJ9A 5ERIA 4RB2C 5E8IA 1J0RA 1LJ9A 2XKPA 3TO9A 3QOPA 2IRFG 5LRRA 4A6EA 3V8JA 4ZYHA 1XMKA 3KEQA 1DDNA 1B1BA 1ODDA 1ZGJA 4MEXF 3KP4A 5DV5A 1S29A 5HS9A 1OPCA 2FEZA 5H20A 2R7DA 3FM5A 4AIKA 1HW2A 2OA4A 1FWZA 3AAFA 1S6LA 2IVMA 4HQMA 2DBBA 2P4WA 1KYWA 4MHGA 4EGYA 1TNSA 1KQ0A 2ZJ2A 3E3VA 4L9TA 3F8MA 1J75A 1TBXA 1SFUA 3ML6A 2L01A 3K69A 1ZRDA 2L3DA 4Q5SF 2DPUA 3R0JA 1XSXA 3QP5A 3JSOA 4RGUA 1Z05A 1XSVA 2BE5F 1WWXA 3U2RA 2IA0A 3SHFA 4NQWA 3SZPA 1Z6TA 5FD5A 4R8HA 1EH7A 2F5DA 4PCQA 2V6CA 5LRSA 3NRVA 1ZH5A 3GW2A 2FE3A 5J6XA 4GGGA 4GXOA 3PFIA 4YIIA 3T0YA 1W7PA 1G3SA 3FF5A 5DCFA 4IHTA 1XD7A 5D6FA 4WXHA 1FBSA 2P6SA 3F6OA 3ULQB 2M87A 1T0FA 3CUQB 3I71A 2E1CA 1FT9A 1S8NA 1HBXG 3ROUA 2IA2A 3BPVA 5DD4A 2IW5A 4G6DA 3NEUA 2E1NA 4EV0A 2CO5A 2DU9A 2STWA 1IXSB 2C6YA 4EJWA 4G7OF 2EA2A 3GZ6A 4A5NA 1IRGA 3H3ZA 3I0TA 1ZGAA 4DQ2A 3WE2A 4LK1F 2O6GE 3REOA 2KIUA 4YIFA 2VXZA 2W24A 3ZMSA 3RPQA 2G7HA 2OQRA 1OMIA 1YG2A 3ZMZA 3F8FA 3D5LA 2VODA 1STZA 3L2CA 2B0LA 2Q8KA 2J5OA 2XHKA 4NB5A 2ADUA 2RVCA 1V4RA 3J7AO 1JHFA 1SFEA 3CUQC 3EYYA 6PAXA 2KIMA 1JGSA 2ZFWA 1R22A 3GLXA 3K2ZA 3RPUA 2PG4A 3TGNA 2FXAA 4ZYDA 2WWYA 1B4AA 3FMRA 4CXFA 2FBKA 3EYIA 3HSFA 3BROA 4KA4A 4HF1A 5E1WA 1MD0A 4KT5C 1PP8F 2F5EA 1IRFA 3HRMA 3MZYA 1LQ1A 4M73A 1AWCA 2PN6A 4AD9A 5FFZA 1XGOA 1FP2A 3I64A 3FHZA 5HDKA 2K7LA 5BMZA 3ISPA 3QPTA 1LEBA 1TQIA 1HSJA 1MGTA 3C3WA 4Y15A 2Y48A 1ONVA 2EJRA 2K4BA 2P7CB 3GZ5A 5DCMB 1SMYF 3HHHA 2STTA 3KP7A 1R1UA 3QP6A 3LAJA 5DUIA 2HFHA 4K2EA 4I09A 2JT1A 3BJ6A 4B09A 3DEUA 3WTVC 3M9AA 3FXRA 2JRTA 2QLZA 3L09A 3QPHA 4OMYA 4TV7A 3HRSA 1FYMA 5L3FA 2MC3A 3ECHA 2MA3A 1HQCA 3ABUA 3DPLC 1YTYA 2ZXJA 5CLSA 2VONA 3MFKA 1CGPA 4YFXF 2FA5A 1PDNC 5D4RA 2QBYB 2FRHA 1HW1A 4AVPA 3SXYA 2XGXA 5FLXZ 1FLIA 2AXLA 1GVJA 5JFRA 4U0VA 3CUQA 1K79A 3CDHA 1YYVA 2KRFA 1V3FA 2EV0A 2IA1A 4UXNA 2HEOA 1JE8A 4A0ZA 1WI9A 1O3RA 1TLHB 2RQPA 3BJAA 1CF7B 2XRNA 5F64A 2EFNA 4RB3C 2XROA 4PGHA 2FBIA 4P96A 1S3JA 5K5RA 1QZZA 3I53A 4IPAA 2VBWA 5ILSA 4M9ZA 3HOTA 2HS5A 5D8KB 4MTEA 1KU7A 3FXQA 1GXQA 1XN7A 5BPDA 2Z5UA 4S05A 3GFJA 1BIBA 1KGSA 3BY6A 2FSWA 4M72A 3G73A 4GYGA 4KN7X 1IZ1A 2XAHA 5LBQA 3GUDA 4HV5A 2F2EA 3W6KB 3LWFA 2HYGD 1XGMA 3KLOA 3TDUC 1BI0A 1R23A 2GXBA 4I7HA 1R1TA 2IJLA 1Y0UA 1QNTA 4IF4A 2G7UA 1TW2A 4A12A 2PQ8A 3KETA 1VTNC 2J5PA 3ABTA 1H9GA 2PEXA 2RDPA 1U2WA 3CUOA 3F8NA 5D5XB 4AWXB 2A6EF 1Z9CA 2ZNZA 3U1DA 3LSTA 1G3YA 3RKXA 3DV8A 3E5QA 2VBXA 1O3SA 2CQKA 2HGCA 3B02A 4HX4A 1L3LA 2X4HA 1FYKA 2G9WA 4CO8A 2KJBA 3P7NA 1USTA 2FU4A 2O0YA 2E7XA 1BC8C 2V1DA 5IT9K 2F5CA 3RYPA 5IT9Z 1W5TA 3LA7A 1FP1D 1FYLA 3KP3A 1KU2A 3E6CC 1CF7A 2VC1A 2W57A 3BJOA 1FC3A 2EK5A 1QO0D 1UHMA 4MEYF 2YPRA 4ENKA 1TW3A 2XAJA 1YW7A 4G8XA 3M1EA 1D3YA 1TTYA 1O7FA 3HIFA 2QYOA 4ASNA 2LKPA 2L4MA 2RNJA 3RTRA 2A68F 4KN4X 4Q47A 4G7ZF 5D5VB 5D6EA 1O3TA 1EH6A 5CVRA 3F3XA 3HRUA 2M1BA 5JR3A 2ELHA 3RKYA 2LSOA 1HKQA 2H94A 4JQFA 3E5XA 3WG9A 3I58A 4UVBA 4GCVA 1D8KA 2MLGA 4NHJA 1UCRA 5CVIA 5J8CA 1SD7A 2WTEA 4HA8A 3WU0A 5HS8A 1YS7A 1Q1HA 4ZZLA 3CTAA 1P4WA 5HOOA 2VBZA 4I0AA 1RI7A 1UFMA 2R7FA 4RGRA 1FPQA 3WTSC 3KZZA 4HAMA 1IN4A 3GFMA 4A0XA 3KCCA 2OZ6A 4ZZDA 4BH9A 1YFHA 3GO5A 1OR7A 3IL2A 2ZMEB 5LHGA 2BV6A 1K78B 2BGCA 1S7OA 1B9MA 4IRGA 4D0PA 5BPIA 1QPMA 3I59A 4AIHA 2YSRA 3K9TA 5D5UB 1QZYA 5ICCA 1I5ZA 5E1ZB 1PUEE 2DO7A 3FMSA 5DDGA 4UNOA 3TOAA 4RAYA 3BPXA 3OV8A 3GF2A 2OQGA 1WQ2A 1RNLA 5L3CA 4P5OA 4L9JA 2JPCA 1RZ4A 3WTXC 5LLQA 2HKXA 2BEOA 4P9FA 4WF2A 5DYMA 2YU3A 1G3TA 3QU3A 4LD5A 3RIRA 1KQ8A 1E2XA 1DPRA 4IRIA 1KA8A 4XLPF 2IT0A 4JBAA 1ZYRF 5H6RA 4M6YA 3J81Z 4WXDA 1F5TA 2YX4A 5HVQC 2BYVE 2P7VB 3I54A 3MQ0A 1U8RA 2XVCA 1XCBA 2KJCA 2DI3A 2L02A 3WTUC 3I5UA 3R0AA 4XSXF 2PFBA 2PJPA 1ZAOA 3V8KA 3GVAA 2MH9A 5D4SA 3ELKA 4HX8A 3ZN1A 5LGNA 1O3QA 3HHGA 4HBLA 3BOQA 3V7CA 1BN5A 2ZMEA 3I59B 5D5WB 4BHCA 1LDKB 1MKMA 4BQAA 1T6SA 1IN6A 3B73A 4RGSA 5J8FA 4I98B 1BOAA 2K4JA 1J7KA 4BNCA 4LMYA 5IT3A 1TQPA 3FXUA 4I0BA 5FGMA 3S2WA 3ZMTA 2ISYA 3JSPA 3VFZA 1QGPA 4XRFA 2WC2A 1FNNA 3V8LA 3BDDA 4HDVA 2EV5A 5BQTA 2L4AA 2DLLA 2AS5F 2L54A 1HXDA 1LEAA 2MBFA 5E1XA 3F21A 3M7GA 2UWMA 1SD5A 1MDMA 1K7AA 2DK5A 3K0LA 2FNAA 4EM0B 1G6NA 3H92A 4LB5A 5LHIA 4PGGA 1P4AA 1X3UA 3CO7C 2CWEA 1C0WA 3DFGA 2KKOA 4N0BA 2PLYA 2JZYA 1JXSA 2VC0A 2MD5A 1R5GA 2JSCA 2K86A 2ZNYA 3E6BA 2EFWA 1MJ9A 5TRDA 3P9KA 3EUHA 2W85A 3GWZA 2ISZA 1IF1A 2QQBA 3V4GA 1MDMB 4LLNA 5HLIA 1ZG3A 2MLKA 1LB2A 1KQ9A 1YQAA 4KUMA 1W4MA 1LDDA 4EJVA 1F4KA 3VOEA 4L9VA 1LDJA 5DCMA 1XGNA 4RS8A 3M8EA 2XKOA 1P2FA 3SQNA 3WE3A 5TJJA 3HTSB 2RC4A 4RB0A 1YW9A 2ESNA 2CW0F 3EQLF 1U5TA 2VT2A 1J5YA 1K6OA 1BBYA 4UHTA 1XB4A 3LA3A 4CYDA 4XLNF 4BAYA 2UXXA 2YX7A 3SZTA 4L18B 4UUVA 2XIGA 5LHHA 2H27A 1I6XA 1G3WA 2GWRA 3U9GA 4M9SA 1ZG5A 2ACJA 3EETA 1AOYA 1ZRCA 3HSEA 2Z9OA 1U5TB 4EJUA 2Q2EA 2PBIA 5CVVA 5DEQA 3NQOA 2UZKA 3T1BA 1SMTA 1BI3A 2EB7A 1HW5A 4WK8F 2EA4A 4O5VA 4OMZA 1F9NA 2V79A 1S7AA 3ZP5A 1FOKA 5L3BA 3IWFA 3R6SA 1MJBA 4F7ZA 5JVTA 2LF8A 4LB6B 1GHCA 3VODA 4IXAA 1A04A 4LGWA 5FB2A 1B9NA 2XUBA 1I27A 2QBYA 5DUKA 3JAMK 3RKWA 2QQ9A 3QU6A 4G7HF 4PDKA 3P9IA 3GFLA 4LLLA 1QBJA 4OIOF 1KYZA 4E70A 3MCZA 2V9VA 2D2WA 5HLHA 5ICEA 4A6DA 4HF2A 2XAFA 2A6HF 5CVUA 1QQIA 4Y17A 4U7DA 1USSA 4GYIA 2Z99A 4CGZA 4UV9A 5E17F 1DPUA 3JTGA 5H6QA 2CG4A 3FZVA 4B8XA 3N97A 2OAZA 3WGGA 2M5WA 3HOSA 3HUGA 2E7WA 3PQJA 1IXRC 4QLCU 4M9XA 1T39A 4ON0A 4U7BA 4Q48A 2IP2A 3IKVA 3Q5FA 4L5IA 5JI6A 2P6TA 2O61A 3MAJA 2NRAC 1WKMA 3COAC 5L3DA 4ESBA 1ZLJA 4FHTA 1BC7C 1XCVA 2QWWA 1E17A 1F1ZA 2GXGA 3IRQA 1SFXA 2M45A 5BS6A 2RN7A 1YS6A 2OZUA 3IRRA 4HOBA 2X0LA 3H3UA 2A69F 4XSZF 2KIFA 2EFPA 3L9FA 3Q9VA 5ED4A 4BXUA 2F5FA 4I2OA 1ON2A 5K1YA 5KK1A 3K1MA 3RYRA 1L0OC 1O57A 3IC7A 2Z33A 1U5TC 5D8LB 2HTSA 1HKSA 4LLGF 2FMYA 2ZBKA 2D1VA 2LDUA 2QENA 2K27A 4HQEA 2WV0A 2DFIA 5E18F 1ULYA 3KP6A 3TOBA 1RUOA 4OIRF 3P9CA 3F23A 4EMSA 2HWVA 4OOIA 1Z91A 3WGIA 2W25A 1B6AA 3C7JA 5HDNA 1FX7A 3E5UA 4EM1A 4KICA 4CDGA 3WODF 1IXCA 3FWEA 3N4MA 2V1XA 1XDUA 5HS7A 3ZMUA 1BIAA 3F22A 4KDPA 2RKHA 1HKTA 5EEHA 2O8XA 2H6CA 4LK0F 5ICFA 2EV6A 2VE8A 1R58A 1SD6A 3DXJF 3TDZC 3CJNA 3WTYC 4U88A 2QVOA 1U6GA 5ILVA 5F1RA 3KP2A 5FFXA 1R7JA 2XAGA 4KMUX 5A2QK 5CYVA 4WCGA 4BHBA 1NHAA 1Z7UA 4HV6A 3MEXA 1RIOH 2PI0A 2M30A 3ERED 2DQLA 3K1PA 3EDPA 2CFXA 2P5LC 1I1GA 2Q0OA 1O7LA 2FBHA 2H6BA 2Z3YA 3WTWC 2DQRA 3RDIA 4BYYA 4MNUA 2JPBA 4A0YA 3RJPA 1FBQA 3WTTC 3T5XA 2YR2A 1G4DA 2VE9A 1YLFA 1FSEA 4KFCA 3OOPA 3GEZA 4CICA 5CVJA 5HDGA 3TQNA 1BI2A 4R79A 5ILUA 3J80K 4UV8A 4WXCA 2EFOA 5AIQA 3ECOA 1XSDA 2XV4S 2NYXA 1WRJA 1YW8A 4Z2YA 2NAZA 1T2KA 1UHWA 2GIVA 4L0YB 2CGPA 2UXNA 4G6QA 5LGUA 3R4KA 2MH2A 5FO5A 4BHPA 2P5KA 2FMLA 3FX3A 4XBFA 4RAZA 5LGTA 1SD4A 3MZHA 4O6JA 4O3MA 4P55A 1H9TA 2P8TA 1PP7U 1REPC 3T8RA 2O3FA 1BM9A 1FBUA 4HLXA 4N9IA 2HZTA 3R61A 5K5OA 1HSTA 1SAXA 4HYEA 3JW4A 4Y13A 3TKYA 1U78A 4UVCA 1OYIA 3ZN0A 2ZKZA 3J81K 1IW7F 2DTRA 1W7PD 4FX0A 1OYWA 4I02A 3C1DA 4M71A 1ZN2A 3Q9SA 4MQVA 5FD6A 1XDSA 2M8EA 3K1NA 1P92A 2HQNA 2DW4A 2RV8A 2QZ8A 2W84A 2QM3A 3TO7A 2HQRA 3TO6A 1U3EM 1ZREA 5E20A 2HR3A 1ZLKA 4M74A 2LF7A 4KYWA 1Z6RA 1T98A 4OIQF 4KIBA 3C18A 4U0YA 4OU0A 4MTDA 1R36A 1W5SA 2QUFA 4DNCA 4EGZA 3DKWA 4YFKF 2GAUA 3KFWX 1J9IA 4CZZA 1DP7P 1J2XA
chains in the Genus database with same CATH superfamily
2V9PA 2CV0A 3F8BA 3ASNH 3FXOA 1OKRA 3HOVJ 3WU1B 1V55H 1D0ZA 1MZBA 3E6MA 3FBIB 3LFKA 1KZHA 1B59A 1LNWA 2DA3A 3W6JB 3V7SA 4IJAA 1EV7A 1QRYA 3H9QA 3QAHA 2MW8A 2Y0SA 2K9NA 4U0WA 1BI1A 3LQQA 1V5FA 4YG2F 4MIMA 3GTKJ 3OYBA 2VT3A 5DD8A 1X1PA 4ETSA 2R93J 4R1HA 1TQMA 2JVGA 2HTJA 1R5HA 4I01A 5H2FC 1D1AA 1S72I 1W7PB 4HF0A 4BE2A 4EATA 1ZARA 4IO9F 2A07F 4HNTA 4BY7J 4EJOA 2A3SA 2H09A 2MG4A 1LFBA 1N25A 3ZPLA 3S2DJ 2Y9YA 3H1CA 4XORA 3RQIA 3GX4X 3I4PA 3O6BB 1P4XA 3E6DA 2O03A 3F8CA 4A5MA 3BG6A 3WTZA 3F9KA 5IYDJ 1IUYA 4LFUA 4Y52J 3J80Z 1E0EA 1TNTA 4M3BA 1T38A 2D45A 1CQTA 2TDXA 3QRFF 4Y7NJ 2GA2A 1KU3A 1UAAA 1VQOI 5FKNA 3BT9A 3PNTA 4ESFA 3KZYA 5LEJA 3K70D 1W0UA 2F4MB 2VL8A 2HYFA 4UUTA 1I1SA 4IRHA 3LA2A 2PMUA 3HRTA 2GQQA 3VEPA 1YO5C 1D8JA 3E97A 4BU2A 1K78A 2IAIA 1IN8A 4KIFA 5GAEJ 5IOZA 3WGHA 2GA1A 2QEXI 1QVUA 1Z67A 5A2QZ 1WSUA 5E8GA 2R3SA 2K3PA 4FT8A 3FBNB 2CYYA 1IN5A 3DQVC 1UB9A 2KHMA 2A5YB 5ICGA 3IH3A 2OBPA 2HOEA 3S17J 3K4BA 4KNYA 2HKOA 5F0HA 3O2PE 1ZRFA 3LAPA 5KVRA 1Z77A 1MIJA 3IWZA 2OPTA 1D5VA 2M7BA 3KYCB 3BP8A 4HZFA 2K02A 3PJRA 1ETOA 4N4NB 1FSHA 2DA1A 4JK1X 1TWAJ 4H0EA 2HOAA 4E7KA 2DK8A 5EJCA 3HYIA 3VB2A 3ZQQA 1RUNA 3HXLA 2OF7A 2GZWA 1WCMJ 4HLYA 3M8FA 2VBYA 2NNYA 2LNBA 4HDUA 4XR6A 2LG4A 3OYDA 3BWGA 3GYHX 2PMHA 2ZSHB 3RI4A 4ESJA 1K4SA 3KX2A 2ETHA 2ZCWA 2QGUA 2ZXIA 2XAQA 5F27A 2VOPA 5K5QA 2P5VA 1H8AC 3OSGA 4BE0A 4XLAA 2ESHA 2XASA 4L5JA 4PK4A 5LD2C 4A3BJ 4P1WA 2LBFB 4V2GA 4KMFA 4IVNA 2EZLA 2FUG2 2HOSA 4GO1A 3IHUA 2MABA 4EJTA 2RAEA 3OYEA 2FF4A 4OAYA 2DT5A 4HW0A 2CUJA 1AHDP 1ON1A 4EQQA 3OYFA 4ANJA 5JHUA 4CHUA 2DOAA 5L3GA 3DPTA 1EH8A 1FEXA 4A3LJ 1YIOA 2DDAA 3CCRI 4BBRJ 4LIVA 1ITYA 2LFBA 4NDLA 3IH2A 5AIPA 3BTCA 2R7VA 4X0GA 2FQ4A 2JUGA 4G94A 3TBIA 4AM3A 2FNPA 1T08B 4YFNF 4XLEA 4ABZA 4M6XA 2CSOA 1VQ8I 3O3KA 2R7XA 3KPHA 5K7FA 3IH4A 3L00A 1R00A 1J59A 1IG7A 2HXIA 2ME0A 1BJZA 3MWMA 2OD5A 4RB1A 4CCLA 1BJAA 4BXXJ 1KU9A 2VLAA 4L9NA 4UVAA 4LG0B 4ZYGA 4BJ6C 4WWCA 2EWNA 4IHSA 2DPDA 2OU2A 4HX7A 2BXZA 3OMYA 2FOKA 4G9YA 3CLOA 4ZYEA 4OINF 4EM2A 5L3EA 3LQRA 4KJZA 4KIGA 4XK4A 1FZPB 3QYFA 3S2HJ 2CMPA 5B1AH 3PM1A 2EINH 1IAWA 1OFCX 2OV7A 1HC8A 1X4PA 3KE2A 1UHSA 2Y0MA 3FM3A 3RCOA 1ZG1A 4ZH4F 4FX4A 1QA6A 3SYTA 3BR0A 2Y31A 3R60A 1IN7A 1R1VA 3ZQ7A 2CQXA 4E7HA 4UB6C 4DOZA 3OS2A 2JTVA 4MQ9F 3PQKA 3BZ6A 3BCAA 2HVRA 1QPIA 4YEJA 4P9UA 2DMUA 1IGNA 3IKTA 3G1MA 2NXNB 2NNNA 1MSEC 2WV1A 1DUXC 3AL0C 2H8RA 3JAMZ 3DEEA 4ENMA 1D0XA 2B63J 1JHHA 1GXPA 1ZHFA 1XMAA 4N9HA 4A2UA 3FMQA 2KDOA 3P5JA 4DGWB 4RAGA 1JTYA 1XPXA 3ZR8X 2W48A 2IBDA 3T8TA 1P7IA 2IPQX 5J4YA 3HTUA 2Y69H 3A02A 5KNLA 5M3MJ 1FY7A 4M3GA 5HLGA 4WX9A 3ZMVA 3FKJA 2ZO4A 3HOZJ 2DCEA 3CO6C 4EVIA 1RR8C 2K5CA 4FETA 4XRSG 5F6FA 1FTZA 2LY2A 4L0ZB 1P6RA 1X58A 4AIJA 3GXOA 3SFZA 3G3ZA 1U0JA 3F6VA 2EFQA 5BOXA 3L2UA 1XGSA 5EEGA 5FKOA 1TL8A 5IY5H 1Z1DA 4E7SA 4LJZF 4MGRA 2FQ3A 1DGWY 2X6XA 2DAOA 3KEOA 2IGMA 3DBHB 2QQAA 1DU6A 4IQ4A 5LEKA 3F72A 4W1UA 4PZJA 3HB9A 3D0SA 3ZMDA 2BVLA 4ENJA 3W2WA 5CPRB 2ELJA 2E2IJ 1MNEA 3S93A 3K4JA 2COMA 3JTHA 2HDCA 2RGVA 4XOPA 3PSFA 3DWLE 3I3LA 2A61A 3GTMJ 4LG0A 2OCCH 2VN2A 5TISC 3L7WA 1TWCJ 3X2QH 5C4XJ 4ENNA 2Y75A 4QPOA 5E3MA 4RGXA 2D1HA 3HSRA 3HOYJ 2M7AA 1QVTA 1S7EA 3DF8A 1HDPA 2KP6A 2V1UA 2VOOA 5FLXK 3GCMA 4D9JA 2NS0A 2M9HA 4S04A 3V7RA 4UB8C 3GFIA 1MMNA 2AQFA 4QWQA 4OIPF 1VQ6I 2E35A 1OYYA 4A3KJ 1MJAA 1RKTA 2X85A 4NQWB 2XSJC 3KP5A 1DQUA 3DP7A 2BBYA 1LVAA 4M3EA 5GADJ 5AONA 1H0MA 3KLNA 4Q4ZF 1IRZA 5CJ9A 2I5UA 5FKLA 1DP3A 4RA2A 5ERIA 1LUJB 3WHCA 4RB2C 4XKWA 1NG6A 4BY1J 4CH7A 2FOWA 3LL7A 2XSDC 5E8IA 1J0RA 1LJ9A 2XKPA 2GOXB 2A5WA 3TO9A 2R7WA 1ETVA 4II2A 5M5XJ 1Y1WJ 3QOPA 2XB0X 2IRFG 5LRRA 4A6EA 3V8JA 2AO9A 2XGDA 4ZYHA 1XMKA 2E2JJ 3KEQA 4FE7A 1DDNA 3I4MJ 1B1BA 2CV1A 1VF9A 3ABKH 1HA8A 1ODDA 1QZEA 2JA5J 1ZGJA 2X1DA 3ZRGA 1Z3YA 4MEXF 2LH9A 1A5JA 3KP4A 1HDDC 1E3PA 1S29A 2DMQA 5DV5A 5HS9A 1OPCA 2FEZA 2H1LA 2Y9ZA 2M2EA 1ETWA 2YUSA 1WVRA 5H20A 2R7DA 1VFCA 4G6TB 3BG5A 3FM5A 3PIPF 4AIKA 2I10A 4A3DJ 2RREA 1HW2A 2OA4A 1WH7A 3OWTA 1FWZA 2O7OA 4NC7A 3AAFA 3L1PA 1GDTA 5EZHA 1S6LA 2R5ZA 2PJRA 2IVMA 3L2WA 4HQMA 5B5EC 2DBBA 1YRNB 3BR5A 2P4WA 2R7TA 1KYWA 4MHGA 3PSIA 2E1MC 4IZZA 4Y3OA 4EGYA 5HNFA 4JOMA 1SEUA 1TNSA 2E5NA 1KQ0A 2CV2A 2ZJ2A 1BR4A 3E3VA 1W36C 4FQGA 2CFOA 4L9TA 3F8MA 2F4IA 1TBXA 1SFUA 1J75A 4D5CA 2CQNA 3A01A 3ML6A 2IS1A 2L01A 3K69A 3VWBA 1ZRDA 2W4SA 1W1WE 2L3DA 4Q5SF 2DPUA 2VI6A 2NVUB 2VKVA 3M3YJ 3R0JA 1XSXA 3QP5A 1QU3A 3JSOA 4RGUA 4IHVA 1Z05A 2I8DA 1XSVA 2BE5F 1WWXA 2WY7Q 1VQ7I 3CCYA 2LYCA 3U2RA 1SAUA 2IA0A 3ESWB 3SHFA 1ZR2A 3GTLJ 4NQWA 2L5QA 3SZPA 1Z6TA 5FD5A 3LNQA 4R8HA 1IDYA 1EH7A 2VQLA 5FROA 4E4HA 2F5DA 2BY0A 1TP4A 4PCQA 5B3SH 2V6CA 4BXFA 3NRVA 5LRSA 1ZH5A 3GW2A 2FE3A 2VQGA 5J6XA 3J7YJ 3ZXSA 2E1OA 3CCLI 1Y8QB 2ZB9A 4AVZA 4GGGA 4GXOA 3AG1H 3RZOJ 2V7FA 3PFIA 4YIIA 3T0YA 1W7PA 1G3SA 3JRBA 2JQ7A 3Q3SA 3FF5A 3IP4B 4ITVA 1O4XA 1I6HJ 4YRVA 2DJNA 2LKSA 5DCFA 4IHTA 1XD7A 1XTAA 5D6FA 4WXHA 1FBSA 2A6TA 1WPKA 2E71A 2P6SA 3F6OA 1SFOJ 3ULQB 2M87A 2E1MB 1T0FA 3PUBA 3CUQB 3JRGA 3BR1A 3I71A 3QPLA 2VUMJ 5JHFA 2LD5A 2E1CA 1SFKA 2LY1A 1FT9A 1S8NA 1HBXG 3S8PA 3ROUA 3J7AY 2IA2A 3BPVA 3HM5A 5DD4A 1WJEA 2IW5A 4G6DA 3LMMA 4CA0A 3NEUA 2E1NA 4EV0A 2KIQA 2CO5A 2DU9A 3LSGA 2STWA 1IXSB 2C6YA 4EJWA 4G7OF 1YRNA 1UMQA 2EA2A 1NTCA 3CCEI 3GZ6A 3TW6A 2MC4A 4A5NA 1IRGA 3H3ZA 4JX4A 2MYSA 3I0TA 1ZGAA 4DQ2A 3S1NJ 4DBRA 3OYCA 4LG3A 1OCCH 3WE2A 4LK1F 2O6GE 3REOA 3OS0A 2KIUA 4Y4RA 3K70C 1VQMI 4YIFA 2E2HJ 2Z1DA 1VQ5I 1R4NB 2VXZA 2W24A 3ZMSA 1MMGA 3RPQA 2G7HA 4II3A 2OQRA 1OMIA 1YJNI 1YG2A 1R6RA 3S14J 3ZMZA 3CJRB 3F8FA 3D5LA 2VODA 1STZA 3SEZA 3L2CA 3HGYA 1MBJA 2ZFUA 1I3AA 4PJLA 2B0LA 4BQQA 2Q8KA 2J5OA 1VQ4I 4CCKA 3GTQJ 1XX5A 2XHKA 5FKKA 4NB5A 2ADUA 3ZQLA 2RVCA 1MMDA 1V4RA 3J7AO 1JHFA 1SFEA 3CUQC 3EYYA 6PAXA 2TRTA 1MMSA 2CQ7A 1FJLA 3U1KA 1U8BA 4E7ZA 2KIMA 1JKPC 1JGSA 4XRSA 3LSPA 3BR2A 3B6AA 3OYMA 2ZFWA 1R22A 3DEWA 3GLXA 3OYLA 3K2ZA 3H9JA 2LKXA 3RPUA 2PG4A 5IYCJ 3TGNA 2FXAA 4ZYDA 1OCRH 5FRMA 3CCVI 2WWYA 1B4AA 3FMRA 5IP7J 4CXFA 2FBKA 4A69C 3EYIA 5EDNA 2E36A 3HSFA 3BROA 4KA4A 4HF1A 5JVGF 3CDLA 3K2AA 5E1WA 1MD0A 1X1DA 4BJ5C 4KT5C 2KDZA 1PP8F 2M8GX 2F5EA 3AG3H 1VQNI 1IRFA 3HRMA 3MZYA 1LQ1A 2BZTA 3AG4H 3OIOA 4M73A 1X1BA 2XPWA 1AWCA 5E3NA 2WAFA 1WGXA 2HI3A 2PN6A 3GBGA 4AD9A 3DU5A 1LFPA 5FFZA 2HZDA 5EG0B 2HVSA 3CZ6A 2BHYA 3OL4A 1YOVB 3SEQA 1XGOA 4MFEA 1FP2A 3I64A 3FHZA 5HDKA 2K7LA 3HEFA 5BMZA 3ISPA 2QSFX 3QPTA 1LEBA 1TQIA 1HSJA 1MGTA 2DFFA 1GLNA 4XICA 3C3WA 4XMYA 5J47A 4Y15A 2Y48A 3OR1C 4DIQA 5KAIC 1ONVA 2EJRA 1ZKGA 3BG7A 1M1EB 2K4BA 2P7CB 2VASA 3GZ5A 4HG2A 2XGCA 5DCMB 2F48A 2V26A 1SMYF 3BR3A 4AC0A 3VPRA 3HHHA 2P0WA 2STTA 1X2MA 3KP7A 1NK2P 5F0CA 1R1UA 3QP6A 3LAJA 2HDWA 5DUIA 2HFHA 4UY8I 4K2EA 2ZC2A 5HNHA 4I09A 2L9RA 3CMYA 2DA2A 2JT1A 1OISA 1ERDA 3BJ6A 4B09A 4BDZA 3U21A 3W2AA 3DEUA 3WTVC 1YX3A 2Y0SN 3M9AA 3MKZA 5K7HA 3FXRA 1Y56A 4EEFG 2JRTA 3ABLH 2QLZA 3L09A 4CCNA 4XRMA 1IRXA 5HODA 3CJQB 3QPHA 4OMYA 1MBHA 4TV7A 4A93J 4L5EA 3S1MJ 3HRSA 4F52A 4PSWA 1B8IB 1FYMA 2R92J 5L3FA 5KCMA 1I50J 2MC3A 3K4LA 3ECHA 2MA3A 1ZR4A 3G71I 1HQCA 3ASOH 3HKZN 3FISA 3ABUA 1WFXA 2DA6A 4AU7A 3DPLC 2ZXJA 3WHBA 1YTYA 5CLSA 4IOAF 3VYTB 4D5FA 3CESA 2VONA 3MFKA 1W0TA 3HDDA 3RKQA 1CGPA 4YFXF 2FA5A 2R7ZJ 1PDNC 3S15J 5IPAA 4XKBA 4A3GJ 2ME6A 2VQCA 1JKRC 5D4RA 2QBYB 2FRHA 1HW1A 4AVPA 3HOXJ 3SXYA 2XGXA 5F04A 1B8IA 4BEHB 3A03A 4MFDA 2KRHA 5FLXZ 3JREA 2ZJPF 1FLIA 2AXLA 3CJTB 4NBQA 1GVJA 5JFRA 1XC5A 3CUQA 4OAZA 4U0VA 1K79A 3CDHA 4B44A 1VQKI 4UUSA 1YYVA 2KRFA 1V3FA 2EV0A 1X2NA 1WHUA 4E6KG 3M07A 4CYCB 2IA1A 4PJ0C 4UXNA 1JE8A 2K9MA 4A0ZA 2HEOA 1WI9A 1O3RA 4BKXA 1TLHB 2RQPA 3WU2C 3TP3A 3BJAA 1CF7B 2P81A 3A0BC 3FK6A 3I56I 1Y6IA 2XRNA 4DZJA 4Z6YA 2V6EA 3CC7I 5F64A 5EYRA 2EFNA 4RB3C 2XROA 4PGHA 2GBYA 2FBIA 4P96A 5M5WJ 1S3JA 2L9NA 3KYDB 3S3OA 1V5EA 5K5RA 2HXOA 1QZZA 1ETXA 3I53A 4CCOA 4IHYA 4IPAA 2R7UA 1JI8A 3H5RA 1FMWA 1JUSA 1WJCA 2K9SA 2VBWA 5ILSA 1YJWI 4M9ZA 3HOTA 2HS5A 3S3MA 1SVOA 5D8KB 4MTEA 1KU7A 4RLQA 2R7QA 3FXQA 1GXQA 1RR7A 2EPFA 2EZIA 1R71A 1XN7A 1P7JA 5BPDA 2YS9A 2Z5UA 1ETYA 2KT0A 3GFJA 4YELA 3ZQGA 1BIBA 1KGSA 4S05A 1Z21A 3BY6A 2FSWA 4M72A 4HNVA 2WY8Q 3G73A 3QWLA 4HNUA 1LE8B 4GYGA 1OCOH 4H4KC 4KN7X 1IZ1A 2XAHA 5LBQA 3GUDA 4HV5A 2F2EA 3W6KB 3LWFA 2Z16A 2HYGD 2WAQN 1XGMA 3KLOA 3TDUC 1JJ6C 1BI0A 1PUFB 1R23A 4LITA 2GXBA 4I7HA 2ZJRF 3MMYB 3EUAA 4F3QA 1R1TA 2IJLA 3NARA 1Y0UA 3SZGA 1QNTA 4PJMA 4IF4A 2G7UA 4FTHA 3WG7H 1TW2A 4A12A 3GTPJ 2PQ8A 4C3IJ 3KETA 1VTNC 3BTJA 3SDBA 2J5PA 3ABTA 3CQZJ 2EZKA 3CCUI 1ACIA 5BNGA 1H9GA 4RBOA 2PEXA 4XIDA 2JA2A 2RDPA 4BUPA 2F5VA 1U2WA 5EF6A 3CUOA 1X3WB 3LSJA 4QSHA 3H3VK 1I3QJ 3F8NA 5D5XB 1RETA 4AWXB 3G4SI 2YU9J 2A6EF 1Z9CA 2ZNZA 3U1DA 1WJFA 3LSTA 1G3YA 3NAUA 3RKXA 2EIKH 2W7NA 2XPUA 1RRJA 3DV8A 5DM6F 3E5QA 2Q1ZB 4XONA 3SFIA 2VBXA 2ZXHA 1O3SA 2CQKA 2BOLA 2HGCA 3B02A 4HX4A 2DOEA 2QQ8A 2W00A 1L3LA 4JX6A 2X4HA 4NUBA 2G9WA 1MNDA 2KMUA 1FYKA 3P7NA 2KJBA 4CO8A 1USTA 2FU4A 2O0YA 2E7XA 4XNFA 1B72B 1BC8C 2V1DA 5IT9K 3I55I 4KISA 2F5CA 3RYPA 5IT9Z 2R5YA 5CQGA 1W5TA 2E60A 3LA7A 1FP1D 5E3LA 1FYLA 1IUFA 1BOBA 2XF5A 3KP3A 1OR7C 1KU2A 4JP0A 3E6CC 4E7IA 2M34A 1YIJI 1CF7A 2VC1A 2W57A 4CUGA 3BJOA 1FC3A 2R0QC 1NK3P 2EK5A 4XLHA 1QO0D 1UHMA 1N75A 2BXYA 2WBMA 4MEYF 2YPRA 3CCSI 4ENKA 1TW3A 2XAJA 1YW7A 4G8XA 2VKHA 3HZJA 3M1EA 2X6OA 2PMZA 1D3YA 1TTYA 1O7FA 2AQEA 3HIFA 2CRGA 1MH4A 1EA3A 2QYOA 1T8IA 1JT0A 5M3FJ 5F08A 2DJIA 3JCUC 3EUKL 5FLMJ 3ONQA 2CW8A 4BEHA 2HDDA 4ASNA 2LKPA 2L4MA 3PFYA 2RNJA 3RTRA 2A68F 4KN4X 1VNDA 4Q47A 1FOYA 4RDUA 4G7ZF 4NC6A 3PUFA 5D5VB 2R5YB 2OJED 4A3JJ 2W1OA 5D6EA 3MD2A 1HF0A 1B72A 2B7EA 1LVKA 1O3TA 3GTGJ 3RZDJ 1EH6A 1YX5A 2DFHA 5CVRA 2LRDA 1Y1VJ 1YITI 4JYKA 3F3XA 3HRUA 4RM3A 1EKEA 2G0EA 2M1BA 5JR3A 3S1RJ 1EJ9A 2CU7A 3BTIA 2ZJQF 1P9QC 1ZGWA 2GM4A 4XQFA 4F93B 2ELHA 1T33A 3RKYA 2LSOA 1HKQA 2H94A 2VPRA 4JQFA 2M3AA 4RAFA 2NS7A 3E5XA 2ECBA 3WG9A 5J40A 2ZMEC 3I58A 4UVBA 1MSFC 4GCVA 1D8KA 2MLGA 4NHJA 1UCRA 5CVIA 1RKWA 1SD7A 5J8CA 2WTEA 4XM3A 2HU9A 3BTLA 4HA8A 3WU0A 3CCMI 5HS8A 3OYIA 4C9YA 1YS7A 2DYRH 5EGOA 1N78A 3A4CA 1Q1HA 3L2RA 4ZZLA 4JX5A 3CTAA 1P4WA 4PSXA 5HOOA 4HRIA 1MBFA 2VBZA 4I0AA 1RI7A 1UFMA 2R7FA 4RGRA 1FPQA 3WTSC 1ZQ3P 3KZZA 3K4KA 4HAMA 2QSHX 2OTJI 2KPMA 1IN4A 3GFMA 4A0XA 3KCCA 2OZ6A 4ZZDA 1SVLA 3OYGA 4I76A 2W82A 3HUGB 4BH9A 1YFHA 2WAQA 3GO5A 3I9V2 1OR7A 4I99C 2ZMEB 3FXMA 3IL2A 4DBQA 5LHGA 2BV6A 2CUFA 1K78B 2BGCA 2UV1A 1S7OA 1BL0A 1B9MA 4IRGA 4D0PA 1YJ9I 5BPIA 3VYSB 1QPMA 2RNGA 3I59A 4AIHA 1SVMA 2YSRA 4Y33A 3K9TA 5D5UB 3A2KA 2EIMH 1QZYA 5ICCA 2MD0A 2KRCA 1I5ZA 4IEJA 3FHNA 2LLKA 5E1ZB 1PUEE 2JWTA 2CH0A 2DO7A 2JK3A 3H0GJ 3FMSA 5DDGA 3HOWJ 3Q0UA 3JRFA 4UNOA 3TOAA 3FXLA 4RAYA 9ANTA 1WJDA 3BPXA 3OV8A 1D5YA 3EUHC 4F91B 2DN0A 3E1SA 2EQRA 3GF2A 2V4JC 2OQGA 3OR2C 1WQ2A 2V9KA 3LSMA 1OJLA 1RNLA 2IGKA 3FKIJ 5L3CA 1UG2A 4P5OA 4L9JA 5GAHJ 3ABMH 2JPCA 2MSYA 3M4OJ 1RZ4A 1TC3C 1JUPA 3WTXC 5LLQA 2XPVA 3Q0WA 1K83J 1YE9A 2HKXA 2BEOA 4P9FA 2KL4A 4WF2A 2K40A 5DYMA 1BA5A 2YU3A 1G3TA 1RESA 3QU3A 4BQNA 4NNJA 4MO7A 4LD5A 3OIQA 3HC7A 4CSWA 3ERMA 3RIRA 1KQ8A 1OCTC 1A35A 3B6CA 5F1JA 2EH3A 3HKZA 1E2XA 4YIRX 1DPRA 4IRIA 1KA8A 4XLPF 3W2VA 4FE4A 5EGOB 3TEDA 1AKHA 2XC7A 4BL0B 1LE8A 2IT0A 2DTZA 4ZC3A 4JBAA 2BY3A 1ZYRF 1FIAA 1X1AA 3QPSA 5H6RA 4B1RA 4M6YA 2QSGX 5IP9J 3J81Z 4WXDA 2R7RA 1J09A 4FCYA 1F5TA 2YX4A 5EZGA 1ZTRA 3K4NA 5HVQC 3CCQI 1TT0A 1A6IA 2BYVE 4A3IJ 3H0DA 1FIPA 3DPUA 2M0CA 3C2BA 1FMVA 1V5GA 3L2VA 1LPQA 2P7VB 4CCJA 3I54A 2L7MP 3MQ0A 1U8RA 2IS4A 2XVCA 3OYJA 1EF4A 1XCBA 3FXJA 3HJEA 3HL2A 2KJCA 2CJJA 4ZDPA 2DI3A 3IUOA 1OCZH 3E7LA 4AUXA 2L02A 1SC7A 3H5NA 1VQPI 5EG0A 3WTUC 1Z0XA 3I5UA 3R0AA 4XSXF 3TW7A 3S1QJ 2PFBA 2PJPA 5LFAA 1ZAOA 2M4KA 3V8KA 3GVAA 2NVYJ 4C2TA 3OL3A 2MH9A 5D4SA 4AYBN 5IOYA 4QPQA 3ELKA 4E7LA 4HX8A 3QQAA 3BQZA 3ZN1A 2HYJA 5LGNA 1O3QA 3HHGA 3W6VA 2IEKA 4HBLA 3BOQA 3DKYA 3V7CA 2X48A 4A3CJ 1BN5A 2ZMEA 1GT0C 3I59B 1A31A 5D5WB 2DMPA 2VIXA 1VI0A 4BHCA 1LDKB 1MKMA 4BQAA 1T6SA 3RQ4A 1IN6A 3B73A 4RGSA 5J1UA 5J8FA 1LKXA 3GLLA 4I98B 1BOAA 4M6VA 2K4JA 1J7KA 4BNCA 3HOUJ 3KYLA 5C3EJ 4LMYA 5IT3A 1TQPA 3BC8A 3BQYA 3FXUA 3VDXA 1JKOC 1WJ5A 3HPHA 1X3ZB 4I0BA 3C2GA 5FGMA 2ISYA 3S2WA 3ZMTA 3JSPA 3VFZA 4E7JA 1QGPA 4XRFA 2HNHA 3F0CA 2WC2A 3SJMA 1FNNA 3V8LA 3BDDA 3CMAI 2CUEA 1JJ8C 2HQ5A 3BR6A 2NOJB 2EV5A 5BQTA 4HDVA 2JA8J 1R5ID 1N77A 2L4AA 2DLLA 2AS5F 2LTPA 2WB1N 2JVHA 2PX9A 3O8HA 2OUMA 4IKFA 2ZXWH 2L54A 1HXDA 1LEAA 2MBFA 1Z3XA 5E1XA 1A36A 3F21A 3M7GA 2UWMA 1WH5A 3IAM2 5B66C 1SD5A 1MDMA 1K7AA 4HPQA 3JRIA 2ZSIB 2DK5A 2KFDA 3K0LA 5E3OA 2FNAA 5IYBJ 4EM0B 1G6NA 4D7NA 4HSRA 3H92A 4LB5A 4DJAA 5LHIA 1OCPA 1A6QA 2IS6A 4PGGA 2XAUA 2LK2A 1P4AA 2LR8A 3A1YA 1VQLI 3GMEA 1X3UA 2VPLA 2ECCA 3CO7C 1V54H 2CWEA 3CMMA 1C0WA 3DFGA 2KKOA 4N0BA 2XF7A 2PLYA 2JZYA 3M1CA 3D5RC 2RQQA 2EBIA 1JXSA 2DMTA 3JRDA 4IQJA 2M0MA 2VC0A 2MD5A 1R5GA 2XGEA 2JSCA 3CP2A 2K86A 4LIUA 1K61A 2ZNYA 3E6BA 4ZJZA 2QCOA 4MLOA 2EFWA 5IP6A 1MJ9A 3PNYA 5TRDA 3P9KA 3EUHA 2W85A 2L7FP 3GWZA 1IF1A 2ISZA 2QQBA 4C2MJ 1T0FC 4DYQA 3V4GA 3PNVA 5DTDA 1H88C 3DTKA 1PYVA 1MDMB 2GLOA 2L7KA 4LLNA 3OOUA 5K7ZA 1F36A 1POGA 5F0FA 5HLIA 5C4JJ 4V2FA 1ZG3A 3FXKA 2MLKA 2NS8A 2R5ZB 1SANA 1LFUP 5E79C 4J01A 1LB2A 1D0YA 3MKWB 1KQ9A 2MGQA 1YQAA 4KUMA 1G8XA 4XOTA 1Q1VA 3UKGA 1W4MA 1LDDA 3OSFA 2XRLA 4EJVA 1F4KA 3VOEA 4L9VA 1GV2A 1LDJA 5DCMA 1MW7A 3QYEA 4S0HB 4X6AJ 1XGNA 4RS8A 3TP0A 3LSRA 3CDIA 3M8EA 2L9SA 2R7OA 2XKOA 3VSLA 1P2FA 4C30A 2EIJH 3SQNA 3H5AA 4XLCA 3WE3A 5TJJA 1D1CA 2RC4A 3HTSB 4GDFA 4RB0A 1YW9A 3DLLF 4A3FJ 2ESNA 2KLOA 2CW0F 3EQLF 4RMNA 2HQAA 1GUUA 1U5TA 2VT2A 3W3CA 4KITB 1J5YA 2DT7B 1K6OA 5J1YA 1BBYA 3DCFA 2DXIA 3RPUD 2DODA 4UHTA 3HG9A 1XB4A 3LA3A 4CYDA 4XLNF 1T56A 4BAYA 2UXXA 2YX7A 4C2UA 3SZTA 3K4MA 4L18B 4UUVA 2XIGA 3V42A 5LHHA 2H27A 1I6XA 1G3WA 2GWRA 3U9GA 1IDZA 2F6CA 4M9SA 1ZG5A 1W5CC 2DA5A 2ACJA 1X4OA 2VQHA 3EETA 3BLYA 1AOYA 3HSEA 1ZRCA 3JRHA 2Z9OA 1U5TB 3OS1A 4D1QA 1QHGA 2VXDA 3G1LA 4QIWN 4EJUA 2Q2EA 2PBIA 5CVVA 2KISA 5DEQA 3NQOA 1HLVA 1JTXA 2UZKA 1MBEA 3T1BA 1UZCA 2GOMA 1UG0A 1SMTA 2JRMA 1UJ8A 4M3FA 1KONA 1BI3A 2EB7A 1PVEA 1AA7A 1HW5A 4WK8F 2EA4A 3OYNA 2EZHA 1PUFA 4O5VA 4OMZA 1F9NA 2V79A 2X9DA 1TT5B 3KZIC 1S7AA 1G59A 3ZP5A 1FOKA 5L3BA 3IWFA 3R6SA 1MJBA 4F7ZA 1MBGA 5JVTA 3CP8A 1YHQI 2IGNA 2LF8A 3DKXA 4LB6B 1MBKA 4V19K 3K6GA 1GHCA 3VODA 4IXAA 1A04A 1BW6A 4LGWA 5FB2A 3AG2H 1B9NA 2XUBA 3OYKA 1I27A 2QBYA 3K7AJ 3MVPA 5DUKA 2JMWA 4J00A 3JAMK 2WADA 2O8KA 3KEYA 3RKWA 1XMXA 2DMNA 2QQ9A 3QU6A 2VJ5A 4G7HF 3GTOJ 4PDKA 3P9IA 2JA6J 3M8JA 3GFLA 1NG7A 2HVQA 3RSNA 1Z7LA 2WAEA 3S16J 1IC8A 4BDYA 4LLLA 1QBJA 1RC9A 4OIOF 4BGDA 2IXSA 1KYZA 2LOOA 2M4GA 4E70A 1IO2A 2CQQA 3MCZA 2V9VA 2VKEA 2D2WA 3JRCA 4X1EA 1T95A 2KQRA 1K4TA 1QHHD 5HLHA 5ICEA 4XN3A 4A6DA 2BHZA 5B1BH 2XAFA 4HF2A 1K6YA 5CQEA 1F43A 2A6HF 5CVUA 1QQIA 2VJIA 2CS3A 4Y17A 4U7DA 2N8GA 1USSA 2D5VA 2VKDA 2EILH 4GYIA 2QF7A 4N4OB 4ZTFA 2Z99A 4CGZA 2R7SA 3CD6I 3IAS2 2VJ4A 4UV9A 3ZGKA 5E17F 3TMOA 2Y30A 3JTGA 1DPUA 1DGRM 1S5LC 5H6QA 1I39A 4ZYAA 2CG4A 3FZVA 4B8XA 3N97A 4BE1A 2OAZA 1RPWA 3NWSA 3WGGA 2M5WA 4C3HJ 3HOSA 3HUGA 2E7WA 2QKMB 3PQJA 1XG1A 1IXRC 4QLCU 3ZQFA 4M9XA 1T39A 4ON0A 4U7BA 3G6EI 4Q48A 2IP2A 3IKVA 3OIPA 3ZOBA 1FOXA 4NC8A 3Q5FA 4L5IA 3ZQHA 5JI6A 2P6TA 2BY2A 2O61A 2PJRB 3MAJA 2NRAC 4AIDA 1WKMA 2KZGA 3G1OA 3COAC 2X51A 2VB6A 5L3DA 3LSIA 3GZNB 4ESBA 4F55A 1ZLJA 3E0JB 4FHTA 3CF5F 3EPZA 1XCVA 1BC7C 3PL8A 2ID3A 2QWWA 1E17A 3DU6A 1F1ZA 2GXGA 3IRQA 1SFXA 4FASD 5FJ8J 2M45A 2H8WA 5BS6A 1ZELA 2RN7A 1YS6A 2OZUA 4PFPA 5GTHC 2K3FA 3IRRA 2WB1A 4HOBA 2OCEA 4BS9A 3CF2A 3LSKA 2X0LA 5DM7F 3H3UA 3MKLA 4LOCA 2A69F 4I6ZA 4XSZF 2KIFA 1APLC 2EFPA 4M3DA 3L9FA 3ZCOA 3Q9VA 2DT6A 4DW6A 5ED4A 1U9OA 2K85A 4BXUA 2F5FA 4HSTA 1E3OC 2X6YA 2JN6A 4I2OA 1ON2A 1AU7A 4PJJA 5K1YA 3H35A 1IJWC 3DBRB 5KK1A 4XLFA 4B48A 2ID6A 3K1MA 3RYRA 1L0OC 1O57A 3C2HA 3IC7A 2Z33A 2GXAA 5GTIC 2LMDA 5J1RA 2LVSA 1NH3A 2UUZA 1U5TC 2COBA 5D8LB 2L9VA 2HTSA 3H9GA 4XN0A 1HKSA 4LLGF 4A3MJ 1R4MB 2FMYA 2ZBKA 2D1VA 2LDUA 2QENA 3AKZA 2FD5A 2K27A 5C44J 2WV0A 4HQEA 3BZCA 1AKHB 1U9NA 2HPMA 2DFIA 3VSKA 5E18F 1VQ9I 1ULYA 3KP6A 4RLFA 2KZVA 3TOBA 1RUOA 4OWRB 3P9CA 4OIRF 3F23A 2ICWG 4EMSA 3OY9A 2HWVA 2VJJA 4OOIA 2IS2A 3PO2J 2Y2ZA 1Z91A 1TWGJ 3N05A 2OTLI 3SDGA 4CZCA 3WGIA 1BR1A 3BG3A 4DYRA 2W25A 1B6AA 3C7JA 5HDNA 1FX7A 4IOCF 3E5UA 3J7ZI 3ZQIA 5FLVA 4B3AA 1ORKA 4EM1A 2K9QA 1FOWA 1BW5A 4KICA 4CDGA 3MKYB 3WODF 1IXCA 3FWEA 3N4MA 1GV5A 4B4CA 1Y39A 2V1XA 4KT6A 1XDUA 5HS7A 2L2OA 2H1KA 1IV8A 3ZMUA 1BIAA 4ZDLA 3F22A 4KDPA 2RKHA 3DTEA 1DU0A 4CYCA 1HKTA 3CMEI 1R49A 3PO3J 3UNGC 2ELKA 5EEHA 3LOCA 2O8XA 2H6CA 1R9TJ 2WA0A 4LK0F 1H89C 5ICFA 2EV6A 2VE8A 1WJAA 1R58A 3HBLA 1WI3A 3ZQCA 1SD6A 3DXJF 3TDZC 3CJNA 3WTYC 4U88A 1X19A 2QVOA 4DZPA 1U6GA 2XDVA 3AL0B 3S3NA 3QYBA 5ILVA 5F1RA 3K4CA 5TGTA 3KP2A 5FFXA 4DYCA 4C3JJ 3IV5A 2OC6A 1E3HA 1R7JA 1GVDA 2XAGA 4KMUX 4XKVA 5A2QK 2HOTA 5CYVA 4WCGA 3OYAA 3LFUA 3A01B 4BHBA 1NHAA 1VZ0A 2B9SA 1Z7UA 4HV6A 3MEXA 5J3LA 1RIOH 2PI0A 2M30A 3ERED 3GTJJ 2JUCA 4XKCA 3JR9A 4F92B 2DQLA 2O9LA 3K1PA 5KHDA 1TWHJ 3EDPA 2CFXA 2P5LC 3TL4X 1I1GA 4PFOA 2HPIA 2Q0OA 1MMAA 1BR2A 1XS9A 1O7LA 2FBHA 2H6BA 2Z3YA 3MN2A 1X1CA 3WTWC 2DQRA 4PJNA 2AHQA 3RDIA 2CUZA 5KAFC 2LREA 4BYYA 4J19A 3LSHA 1FTTA 4MNUA 2DA4A 2E5ZA 3H36A 5JLXA 2JPBA 2E34A 4BQOA 2X6WA 5GPCA 4A0YA 1YI2I 4ZTJA 3RJPA 2O5RA 1FBQA 3WTTC 2IGOA 3A0HC 4B3XA 5GP9A 3T5XA 1IV6A 2YR2A 1G4DA 1JKQC 2BW3A 3K10A 2VE9A 2A05A 3DLAA 1S9HA 2XF6A 2XB5A 1YLFA 1FSEA 4KFCA 1G2HA 2AXTC 2LY9A 1WZ2A 3OOPA 3GEZA 4PUSA 1Y0NA 3BCBA 2F4OB 4CICA 1ETKA 3D1NI 5CVJA 5HDGA 4IHXA 3TQNA 1BI2A 4R79A 1HOMA 5ILUA 3J80K 4D7MA 2Z2SB 2X1EA 4QTRA 4UV8A 1HCRA 4WXCA 2EFOA 5FKMA 5AIQA 1OLTA 2Q2EB 3ECOA 3AFHA 3JRAA 1XSDA 3DTIA 3FK7A 2JJ7A 3VYRB 2XV4S 2DYSH 4BJTA 1JGGA 2NYXA 1WRJA 1YW8A 1ZK8A 1WJBA 4Z2YA 4ZDOA 1D1BA 2NAZA 2QKLB 5JLWA 1T2KA 1OQYA 1UHWA 3Q0VA 3CLQA 2GIVA 2TCTA 3BG9A 4L0YB 2CGPA 2UXNA 4G6QA 4IX7A 5LGUA 3I4NJ 3QOEA 4XL9A 3R4KA 2X1CA 2MH2A 5FO5A 4BHPA 5DS9A 2P5KA 1Y8RB 2FMLA 3FX3A 3CC2I 2NVTJ 4XBFA 2BY1A 3D5SC 2NOGA 4RAZA 5LGTA 2L7ZA 1SD4A 3MZHA 4O6JA 2V1NA 3G2BA 4O3MA 5CKTA 4P55A 2FX0A 3CC4I 1TZLA 1H9TA 5J4VA 2P8TA 1MNMC 1PP7U 1REPC 3T8RA 2O3FA 2PMZN 2JA7J 1BM9A 1FBUA 4HLXA 2LC2A 5GPAA 4B43A 4FISA 2DA7A 4N9IA 2L0KA 4U87A 1PJRA 2HZTA 3MZ8A 3R61A 3S32A 3CCJI 4BBSJ 5K5OA 3UR3C 4IL6C 2CW7A 1HSTA 1SAXA 4HYEA 3OYHA 3JW4A 4Y13A 1W36D 3TKYA 4B47A 3HPGA 3DBLB 1U78A 4UVCA 2DDBA 1OYIA 2GIZA 2LBFA 3PIOF 1TWFJ 4HEA2 3ZN0A 2ZKZA 3HGGA 1ETQA 4G12A 4GRIA 4RM2A 1IW7F 2DTRA 3J81K 1W7PD 2R4GA 1OYWA 4FX0A 3L2QA 5M5YJ 4GFBA 4I02A 3C1DA 4M71A 1ENHA 1ZN2A 2DFEA 2MFZA 5FRNA 4A3EJ 3Q9SA 4MQVA 5FD6A 1XDSA 3FDYA 4UUSB 2M8EA 3K1NA 1P92A 2HQNA 2DW4A 2RV8A 3NWTA 5GAGJ 5EEAA 2QZ8A 3VYUB 4W97A 2W84A 2BW3B 2QM3A 3BZKA 3TO7A 2HQRA 1UELB 3TO6A 1U3EM 1JUMA 2JSPA 1JT6A 1ZREA 5E20A 2HR3A 1ZLKA 4M74A 2LF7A 4KYWA 5HLTA 1Z6RA 3QODA 1T98A 4AYBA 4OIQF 2BVMA 4KIBA 4CCMA 2K9LA 4IHWA 3C18A 4U0YA 4OU0A 4BACA 2FJ1A 4MTDA 3O8GA 1MH3A 1R36A 3KIOA 1W5SA 2QUFA 3FIWA 2E19A 4DNCA 4EGZA 3DKWA 2LP0A 4YFKF 2GAUA 3KFWX 2NVXJ 2NVQJ 2DOFA 1J9IA 4CZZA 2QA4I 1DP7P 1J2XA
chains in the Genus database with same CATH topology
3F8BA 1OKRA 3WU1B 3E6MA 1MZBA 3LFKA 1B59A 1LNWA 3W6JB 3V7SA 4IJAA 1EV7A 3QAHA 4U0WA 1BI1A 3LQQA 4YG2F 2VT3A 5DD8A 4ETSA 4R1HA 1TQMA 2HTJA 1R5HA 4I01A 1W7PB 4HF0A 1ZARA 2A07F 4EJOA 2A3SA 2H09A 3ZPLA 3GX4X 3I4PA 3O6BB 1P4XA 3E6DA 2O03A 3F8CA 4A5MA 3WTZA 1IUYA 4LFUA 3J80Z 1TNTA 1T38A 2D45A 2TDXA 3QRFF 2GA2A 1KU3A 4ESFA 3KZYA 5LEJA 2HYFA 1I1SA 4IRHA 3LA2A 2PMUA 3HRTA 2GQQA 3VEPA 1YO5C 1D8JA 3E97A 1K78A 1IN8A 4KIFA 3WGHA 2GA1A 5A2QZ 1WSUA 5E8GA 2R3SA 4FT8A 2CYYA 1IN5A 3DQVC 1UB9A 5ICGA 2A5YB 2OBPA 2HOEA 4KNYA 2HKOA 3O2PE 1ZRFA 3LAPA 5KVRA 3IWZA 1D5VA 3BP8A 4HZFA 2K02A 1FSHA 4JK1X 4H0EA 2DK8A 3VB2A 3HYIA 1RUNA 2GZWA 4HLYA 3M8FA 2VBYA 2NNYA 2LNBA 4HDUA 3BWGA 3GYHX 2PMHA 3RI4A 4ESJA 2ETHA 2ZCWA 2XAQA 2VOPA 5K5QA 2P5VA 2ESHA 2XASA 4L5JA 4KMFA 4IVNA 4GO1A 3IHUA 4EJTA 2FF4A 2DT5A 4HW0A 1ON1A 4EQQA 5JHUA 4CHUA 5L3GA 3DPTA 1EH8A 1YIOA 5AIPA 4G94A 2FNPA 4YFNF 4M6XA 2CSOA 3O3KA 3L00A 1R00A 1J59A 3MWMA 2OD5A 4RB1A 1BJAA 1KU9A 4LG0B 4L9NA 4UVAA 4ZYGA 4WWCA 2EWNA 4IHSA 2DPDA 2OU2A 4HX7A 4G9YA 2FOKA 3CLOA 4ZYEA 4OINF 4EM2A 5L3EA 3LQRA 4KIGA 1FZPB 1IAWA 3KE2A 2Y0MA 3FM3A 1ZG1A 4ZH4F 4FX4A 3R60A 1IN7A 1R1VA 3ZQ7A 2JTVA 4MQ9F 3PQKA 3BZ6A 4P9UA 3IKTA 2NNNA 1DUXC 3JAMZ 4ENMA 1JHHA 1GXPA 1ZHFA 1XMAA 4N9HA 4A2UA 3FMQA 3T8TA 2IPQX 3HTUA 1FY7A 5HLGA 4WX9A 3ZMVA 2ZO4A 3CO6C 4EVIA 5F6FA 4L0ZB 1P6RA 4AIJA 3GXOA 3SFZA 3G3ZA 2EFQA 3F6VA 5BOXA 1XGSA 5EEGA 1Z1DA 4LJZF 4MGRA 2FQ3A 2DAOA 3KEOA 2QQAA 5LEKA 3F72A 4PZJA 3D0SA 3ZMDA 4ENJA 2COMA 3JTHA 2HDCA 2RGVA 2A61A 4LG0A 2VN2A 3L7WA 4ENNA 2Y75A 4RGXA 2D1HA 3HSRA 3DF8A 2V1UA 2VOOA 5FLXK 2NS0A 4S04A 3V7RA 3GFIA 4QWQA 4OIPF 1OYYA 1MJAA 3KP5A 3DP7A 2BBYA 1LVAA 5AONA 1H0MA 3KLNA 4Q4ZF 5CJ9A 5ERIA 4RB2C 5E8IA 1J0RA 1LJ9A 2XKPA 3TO9A 3QOPA 2IRFG 5LRRA 4A6EA 3V8JA 4ZYHA 1XMKA 3KEQA 1DDNA 1B1BA 1ODDA 1ZGJA 4MEXF 3KP4A 5DV5A 1S29A 5HS9A 1OPCA 2FEZA 5H20A 2R7DA 3FM5A 4AIKA 1HW2A 2OA4A 1FWZA 3AAFA 1S6LA 2IVMA 4HQMA 2DBBA 2P4WA 1KYWA 4MHGA 4EGYA 1TNSA 1KQ0A 2ZJ2A 3E3VA 4L9TA 3F8MA 1J75A 1TBXA 1SFUA 3ML6A 2L01A 3K69A 1ZRDA 2L3DA 4Q5SF 2DPUA 3R0JA 1XSXA 3QP5A 3JSOA 4RGUA 1Z05A 1XSVA 2BE5F 1WWXA 3U2RA 2IA0A 3SHFA 4NQWA 3SZPA 1Z6TA 5FD5A 4R8HA 1EH7A 2F5DA 4PCQA 2V6CA 5LRSA 3NRVA 1ZH5A 3GW2A 2FE3A 5J6XA 4GGGA 4GXOA 3PFIA 4YIIA 3T0YA 1W7PA 1G3SA 3FF5A 5DCFA 4IHTA 1XD7A 5D6FA 4WXHA 1FBSA 2P6SA 3F6OA 3ULQB 2M87A 1T0FA 3CUQB 3I71A 2E1CA 1FT9A 1S8NA 1HBXG 3ROUA 2IA2A 3BPVA 5DD4A 2IW5A 4G6DA 3NEUA 2E1NA 4EV0A 2CO5A 2DU9A 2STWA 1IXSB 2C6YA 4EJWA 4G7OF 2EA2A 3GZ6A 4A5NA 1IRGA 3H3ZA 3I0TA 1ZGAA 4DQ2A 3WE2A 4LK1F 2O6GE 3REOA 2KIUA 4YIFA 2VXZA 2W24A 3ZMSA 3RPQA 2G7HA 2OQRA 1OMIA 1YG2A 3ZMZA 3F8FA 3D5LA 2VODA 1STZA 3L2CA 2B0LA 2Q8KA 2J5OA 2XHKA 4NB5A 2ADUA 2RVCA 1V4RA 3J7AO 1JHFA 1SFEA 3CUQC 3EYYA 6PAXA 2KIMA 1JGSA 2ZFWA 1R22A 3GLXA 3K2ZA 3RPUA 2PG4A 3TGNA 2FXAA 4ZYDA 2WWYA 1B4AA 3FMRA 4CXFA 2FBKA 3EYIA 3HSFA 3BROA 4KA4A 4HF1A 5E1WA 1MD0A 4KT5C 1PP8F 2F5EA 1IRFA 3HRMA 3MZYA 1LQ1A 4M73A 1AWCA 2PN6A 4AD9A 5FFZA 1XGOA 1FP2A 3I64A 3FHZA 5HDKA 2K7LA 5BMZA 3ISPA 3QPTA 1LEBA 1TQIA 1HSJA 1MGTA 3C3WA 4Y15A 2Y48A 1ONVA 2EJRA 2K4BA 2P7CB 3GZ5A 5DCMB 1SMYF 3HHHA 2STTA 3KP7A 1R1UA 3QP6A 3LAJA 5DUIA 2HFHA 4K2EA 4I09A 2JT1A 3BJ6A 4B09A 3DEUA 3WTVC 3M9AA 3FXRA 2JRTA 2QLZA 3L09A 3QPHA 4OMYA 4TV7A 3HRSA 1FYMA 5L3FA 2MC3A 3ECHA 2MA3A 1HQCA 3ABUA 3DPLC 1YTYA 2ZXJA 5CLSA 2VONA 3MFKA 1CGPA 4YFXF 2FA5A 1PDNC 5D4RA 2QBYB 2FRHA 1HW1A 4AVPA 3SXYA 2XGXA 5FLXZ 1FLIA 2AXLA 1GVJA 5JFRA 4U0VA 3CUQA 1K79A 3CDHA 1YYVA 2KRFA 1V3FA 2EV0A 2IA1A 4UXNA 2HEOA 1JE8A 4A0ZA 1WI9A 1O3RA 1TLHB 2RQPA 3BJAA 1CF7B 2XRNA 5F64A 2EFNA 4RB3C 2XROA 4PGHA 2FBIA 4P96A 1S3JA 5K5RA 1QZZA 3I53A 4IPAA 2VBWA 5ILSA 4M9ZA 3HOTA 2HS5A 5D8KB 4MTEA 1KU7A 3FXQA 1GXQA 1XN7A 5BPDA 2Z5UA 4S05A 3GFJA 1BIBA 1KGSA 3BY6A 2FSWA 4M72A 3G73A 4GYGA 4KN7X 1IZ1A 2XAHA 5LBQA 3GUDA 4HV5A 2F2EA 3W6KB 3LWFA 2HYGD 1XGMA 3KLOA 3TDUC 1BI0A 1R23A 2GXBA 4I7HA 1R1TA 2IJLA 1Y0UA 1QNTA 4IF4A 2G7UA 1TW2A 4A12A 2PQ8A 3KETA 1VTNC 2J5PA 3ABTA 1H9GA 2PEXA 2RDPA 1U2WA 3CUOA 3F8NA 5D5XB 4AWXB 2A6EF 1Z9CA 2ZNZA 3U1DA 3LSTA 1G3YA 3RKXA 3DV8A 3E5QA 2VBXA 1O3SA 2CQKA 2HGCA 3B02A 4HX4A 1L3LA 2X4HA 1FYKA 2G9WA 4CO8A 2KJBA 3P7NA 1USTA 2FU4A 2O0YA 2E7XA 1BC8C 2V1DA 5IT9K 2F5CA 3RYPA 5IT9Z 1W5TA 3LA7A 1FP1D 1FYLA 3KP3A 1KU2A 3E6CC 1CF7A 2VC1A 2W57A 3BJOA 1FC3A 2EK5A 1QO0D 1UHMA 4MEYF 2YPRA 4ENKA 1TW3A 2XAJA 1YW7A 4G8XA 3M1EA 1D3YA 1TTYA 1O7FA 3HIFA 2QYOA 4ASNA 2LKPA 2L4MA 2RNJA 3RTRA 2A68F 4KN4X 4Q47A 4G7ZF 5D5VB 5D6EA 1O3TA 1EH6A 5CVRA 3F3XA 3HRUA 2M1BA 5JR3A 2ELHA 3RKYA 2LSOA 1HKQA 2H94A 4JQFA 3E5XA 3WG9A 3I58A 4UVBA 4GCVA 1D8KA 2MLGA 4NHJA 1UCRA 5CVIA 5J8CA 1SD7A 2WTEA 4HA8A 3WU0A 5HS8A 1YS7A 1Q1HA 4ZZLA 3CTAA 1P4WA 5HOOA 2VBZA 4I0AA 1RI7A 1UFMA 2R7FA 4RGRA 1FPQA 3WTSC 3KZZA 4HAMA 1IN4A 3GFMA 4A0XA 3KCCA 2OZ6A 4ZZDA 4BH9A 1YFHA 3GO5A 1OR7A 3IL2A 2ZMEB 5LHGA 2BV6A 1K78B 2BGCA 1S7OA 1B9MA 4IRGA 4D0PA 5BPIA 1QPMA 3I59A 4AIHA 2YSRA 3K9TA 5D5UB 1QZYA 5ICCA 1I5ZA 5E1ZB 1PUEE 2DO7A 3FMSA 5DDGA 4UNOA 3TOAA 4RAYA 3BPXA 3OV8A 3GF2A 2OQGA 1WQ2A 1RNLA 5L3CA 4P5OA 4L9JA 2JPCA 1RZ4A 3WTXC 5LLQA 2HKXA 2BEOA 4P9FA 4WF2A 5DYMA 2YU3A 1G3TA 3QU3A 4LD5A 3RIRA 1KQ8A 1E2XA 1DPRA 4IRIA 1KA8A 4XLPF 2IT0A 4JBAA 1ZYRF 5H6RA 4M6YA 3J81Z 4WXDA 1F5TA 2YX4A 5HVQC 2BYVE 2P7VB 3I54A 3MQ0A 1U8RA 2XVCA 1XCBA 2KJCA 2DI3A 2L02A 3WTUC 3I5UA 3R0AA 4XSXF 2PFBA 2PJPA 1ZAOA 3V8KA 3GVAA 2MH9A 5D4SA 3ELKA 4HX8A 3ZN1A 5LGNA 1O3QA 3HHGA 4HBLA 3BOQA 3V7CA 1BN5A 2ZMEA 3I59B 5D5WB 4BHCA 1LDKB 1MKMA 4BQAA 1T6SA 1IN6A 3B73A 4RGSA 5J8FA 4I98B 1BOAA 2K4JA 1J7KA 4BNCA 4LMYA 5IT3A 1TQPA 3FXUA 4I0BA 5FGMA 3S2WA 3ZMTA 2ISYA 3JSPA 3VFZA 1QGPA 4XRFA 2WC2A 1FNNA 3V8LA 3BDDA 4HDVA 2EV5A 5BQTA 2L4AA 2DLLA 2AS5F 2L54A 1HXDA 1LEAA 2MBFA 5E1XA 3F21A 3M7GA 2UWMA 1SD5A 1MDMA 1K7AA 2DK5A 3K0LA 2FNAA 4EM0B 1G6NA 3H92A 4LB5A 5LHIA 4PGGA 1P4AA 1X3UA 3CO7C 2CWEA 1C0WA 3DFGA 2KKOA 4N0BA 2PLYA 2JZYA 1JXSA 2VC0A 2MD5A 1R5GA 2JSCA 2K86A 2ZNYA 3E6BA 2EFWA 1MJ9A 5TRDA 3P9KA 3EUHA 2W85A 3GWZA 2ISZA 1IF1A 2QQBA 3V4GA 1MDMB 4LLNA 5HLIA 1ZG3A 2MLKA 1LB2A 1KQ9A 1YQAA 4KUMA 1W4MA 1LDDA 4EJVA 1F4KA 3VOEA 4L9VA 1LDJA 5DCMA 1XGNA 4RS8A 3M8EA 2XKOA 1P2FA 3SQNA 3WE3A 5TJJA 3HTSB 2RC4A 4RB0A 1YW9A 2ESNA 2CW0F 3EQLF 1U5TA 2VT2A 1J5YA 1K6OA 1BBYA 4UHTA 1XB4A 3LA3A 4CYDA 4XLNF 4BAYA 2UXXA 2YX7A 3SZTA 4L18B 4UUVA 2XIGA 5LHHA 2H27A 1I6XA 1G3WA 2GWRA 3U9GA 4M9SA 1ZG5A 2ACJA 3EETA 1AOYA 1ZRCA 3HSEA 2Z9OA 1U5TB 4EJUA 2Q2EA 2PBIA 5CVVA 5DEQA 3NQOA 2UZKA 3T1BA 1SMTA 1BI3A 2EB7A 1HW5A 4WK8F 2EA4A 4O5VA 4OMZA 1F9NA 2V79A 1S7AA 3ZP5A 1FOKA 5L3BA 3IWFA 3R6SA 1MJBA 4F7ZA 5JVTA 2LF8A 4LB6B 1GHCA 3VODA 4IXAA 1A04A 4LGWA 5FB2A 1B9NA 2XUBA 1I27A 2QBYA 5DUKA 3JAMK 3RKWA 2QQ9A 3QU6A 4G7HF 4PDKA 3P9IA 3GFLA 4LLLA 1QBJA 4OIOF 1KYZA 4E70A 3MCZA 2V9VA 2D2WA 5HLHA 5ICEA 4A6DA 4HF2A 2XAFA 2A6HF 5CVUA 1QQIA 4Y17A 4U7DA 1USSA 4GYIA 2Z99A 4CGZA 4UV9A 5E17F 1DPUA 3JTGA 5H6QA 2CG4A 3FZVA 4B8XA 3N97A 2OAZA 3WGGA 2M5WA 3HOSA 3HUGA 2E7WA 3PQJA 1IXRC 4QLCU 4M9XA 1T39A 4ON0A 4U7BA 4Q48A 2IP2A 3IKVA 3Q5FA 4L5IA 5JI6A 2P6TA 2O61A 3MAJA 2NRAC 1WKMA 3COAC 5L3DA 4ESBA 1ZLJA 4FHTA 1BC7C 1XCVA 2QWWA 1E17A 1F1ZA 2GXGA 3IRQA 1SFXA 2M45A 5BS6A 2RN7A 1YS6A 2OZUA 3IRRA 4HOBA 2X0LA 3H3UA 2A69F 4XSZF 2KIFA 2EFPA 3L9FA 3Q9VA 5ED4A 4BXUA 2F5FA 4I2OA 1ON2A 5K1YA 5KK1A 3K1MA 3RYRA 1L0OC 1O57A 3IC7A 2Z33A 1U5TC 5D8LB 2HTSA 1HKSA 4LLGF 2FMYA 2ZBKA 2D1VA 2LDUA 2QENA 2K27A 4HQEA 2WV0A 2DFIA 5E18F 1ULYA 3KP6A 3TOBA 1RUOA 4OIRF 3P9CA 3F23A 4EMSA 2HWVA 4OOIA 1Z91A 3WGIA 2W25A 1B6AA 3C7JA 5HDNA 1FX7A 3E5UA 4EM1A 4KICA 4CDGA 3WODF 1IXCA 3FWEA 3N4MA 2V1XA 1XDUA 5HS7A 3ZMUA 1BIAA 3F22A 4KDPA 2RKHA 1HKTA 5EEHA 2O8XA 2H6CA 4LK0F 5ICFA 2EV6A 2VE8A 1R58A 1SD6A 3DXJF 3TDZC 3CJNA 3WTYC 4U88A 2QVOA 1U6GA 5ILVA 5F1RA 3KP2A 5FFXA 1R7JA 2XAGA 4KMUX 5A2QK 5CYVA 4WCGA 4BHBA 1NHAA 1Z7UA 4HV6A 3MEXA 1RIOH 2PI0A 2M30A 3ERED 2DQLA 3K1PA 3EDPA 2CFXA 2P5LC 1I1GA 2Q0OA 1O7LA 2FBHA 2H6BA 2Z3YA 3WTWC 2DQRA 3RDIA 4BYYA 4MNUA 2JPBA 4A0YA 3RJPA 1FBQA 3WTTC 3T5XA 2YR2A 1G4DA 2VE9A 1YLFA 1FSEA 4KFCA 3OOPA 3GEZA 4CICA 5CVJA 5HDGA 3TQNA 1BI2A 4R79A 5ILUA 3J80K 4UV8A 4WXCA 2EFOA 5AIQA 3ECOA 1XSDA 2XV4S 2NYXA 1WRJA 1YW8A 4Z2YA 2NAZA 1T2KA 1UHWA 2GIVA 4L0YB 2CGPA 2UXNA 4G6QA 5LGUA 3R4KA 2MH2A 5FO5A 4BHPA 2P5KA 2FMLA 3FX3A 4XBFA 4RAZA 5LGTA 1SD4A 3MZHA 4O6JA 4O3MA 4P55A 1H9TA 2P8TA 1PP7U 1REPC 3T8RA 2O3FA 1BM9A 1FBUA 4HLXA 4N9IA 2HZTA 3R61A 5K5OA 1HSTA 1SAXA 4HYEA 3JW4A 4Y13A 3TKYA 1U78A 4UVCA 1OYIA 3ZN0A 2ZKZA 3J81K 1IW7F 2DTRA 1W7PD 4FX0A 1OYWA 4I02A 3C1DA 4M71A 1ZN2A 3Q9SA 4MQVA 5FD6A 1XDSA 2M8EA 3K1NA 1P92A 2HQNA 2DW4A 2RV8A 2QZ8A 2W84A 2QM3A 3TO7A 2HQRA 3TO6A 1U3EM 1ZREA 5E20A 2HR3A 1ZLKA 4M74A 2LF7A 4KYWA 1Z6RA 1T98A 4OIQF 4KIBA 3C18A 4U0YA 4OU0A 4MTDA 1R36A 1W5SA 2QUFA 4DNCA 4EGZA 3DKWA 4YFKF 2GAUA 3KFWX 1J9IA 4CZZA 1DP7P 1J2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8B A;  1OKR A;  3WU1 B;  3E6M A;  1MZB A;  3LFK A;  1B59 A;  1LNW A;  3W6J B;  3V7S A;  4IJA A;  1EV7 A;  3QAH A;  4U0W A;  1BI1 A;  3LQQ A;  4YG2 F;  2VT3 A;  5DD8 A;  4ETS A;  4R1H A;  1TQM A;  2HTJ A;  1R5H A;  4I01 A;  1W7P B;  4HF0 A;  1ZAR A;  2A07 F;  4EJO A;  2A3S A;  2H09 A;  3ZPL A;  3GX4 X;  3I4P A;  3O6B B;  1P4X A;  3E6D A;  2O03 A;  3F8C A;  4A5M A;  3WTZ A;  1IUY A;  4LFU A;  3J80 Z;  1TNT A;  1T38 A;  2D45 A;  2TDX A;  3QRF F;  2GA2 A;  1KU3 A;  4ESF A;  3KZY A;  5LEJ A;  2HYF A;  1I1S A;  4IRH A;  3LA2 A;  2PMU A;  3HRT A;  2GQQ A;  3VEP A;  1YO5 C;  1D8J A;  3E97 A;  1K78 A;  1IN8 A;  4KIF A;  3WGH A;  2GA1 A;  5A2Q Z;  1WSU A;  5E8G A;  2R3S A;  4FT8 A;  2CYY A;  1IN5 A;  3DQV C;  1UB9 A;  5ICG A;  2A5Y B;  2OBP A;  2HOE A;  4KNY A;  2HKO A;  3O2P E;  1ZRF A;  3LAP A;  5KVR A;  3IWZ A;  1D5V A;  3BP8 A;  4HZF A;  2K02 A;  1FSH A;  4JK1 X;  4H0E A;  2DK8 A;  3VB2 A;  3HYI A;  1RUN A;  2GZW A;  4HLY A;  3M8F A;  2VBY A;  2NNY A;  2LNB A;  4HDU A;  3BWG A;  3GYH X;  2PMH A;  3RI4 A;  4ESJ A;  2ETH A;  2ZCW A;  2XAQ A;  2VOP A;  5K5Q A;  2P5V A;  2ESH A;  2XAS A;  4L5J A;  4KMF A;  4IVN A;  4GO1 A;  3IHU A;  4EJT A;  2FF4 A;  2DT5 A;  4HW0 A;  1ON1 A;  4EQQ A;  5JHU A;  4CHU A;  5L3G A;  3DPT A;  1EH8 A;  1YIO A;  5AIP A;  4G94 A;  2FNP A;  4YFN F;  4M6X A;  2CSO A;  3O3K A;  3L00 A;  1R00 A;  1J59 A;  3MWM A;  2OD5 A;  4RB1 A;  1BJA A;  1KU9 A;  4LG0 B;  4L9N A;  4UVA A;  4ZYG A;  4WWC A;  2EWN A;  4IHS A;  2DPD A;  2OU2 A;  4HX7 A;  4G9Y A;  2FOK A;  3CLO A;  4ZYE A;  4OIN F;  4EM2 A;  5L3E A;  3LQR A;  4KIG A;  1FZP B;  1IAW A;  3KE2 A;  2Y0M A;  3FM3 A;  1ZG1 A;  4ZH4 F;  4FX4 A;  3R60 A;  1IN7 A;  1R1V A;  3ZQ7 A;  2JTV A;  4MQ9 F;  3PQK A;  3BZ6 A;  4P9U A;  3IKT A;  2NNN A;  1DUX C;  3JAM Z;  4ENM A;  1JHH A;  1GXP A;  1ZHF A;  1XMA A;  4N9H A;  4A2U A;  3FMQ A;  3T8T A;  2IPQ X;  3HTU A;  1FY7 A;  5HLG A;  4WX9 A;  3ZMV A;  2ZO4 A;  3CO6 C;  4EVI A;  5F6F A;  4L0Z B;  1P6R A;  4AIJ A;  3GXO A;  3SFZ A;  3G3Z A;  2EFQ A;  3F6V A;  5BOX A;  1XGS A;  5EEG A;  1Z1D A;  4LJZ F;  4MGR A;  2FQ3 A;  2DAO A;  3KEO A;  2QQA A;  5LEK A;  3F72 A;  4PZJ A;  3D0S A;  3ZMD A;  4ENJ A;  2COM A;  3JTH A;  2HDC A;  2RGV A;  2A61 A;  4LG0 A;  2VN2 A;  3L7W A;  4ENN A;  2Y75 A;  4RGX A;  2D1H A;  3HSR A;  3DF8 A;  2V1U A;  2VOO A;  5FLX K;  2NS0 A;  4S04 A;  3V7R A;  3GFI A;  4QWQ A;  4OIP F;  1OYY A;  1MJA A;  3KP5 A;  3DP7 A;  2BBY A;  1LVA A;  5AON A;  1H0M A;  3KLN A;  4Q4Z F;  5CJ9 A;  5ERI A;  4RB2 C;  5E8I A;  1J0R A;  1LJ9 A;  2XKP A;  3TO9 A;  3QOP A;  2IRF G;  5LRR A;  4A6E A;  3V8J A;  4ZYH A;  1XMK A;  3KEQ A;  1DDN A;  1B1B A;  1ODD A;  1ZGJ A;  4MEX F;  3KP4 A;  5DV5 A;  1S29 A;  5HS9 A;  1OPC A;  2FEZ A;  5H20 A;  2R7D A;  3FM5 A;  4AIK A;  1HW2 A;  2OA4 A;  1FWZ A;  3AAF A;  1S6L A;  2IVM A;  4HQM A;  2DBB A;  2P4W A;  1KYW A;  4MHG A;  4EGY A;  1TNS A;  1KQ0 A;  2ZJ2 A;  3E3V A;  4L9T A;  3F8M A;  1J75 A;  1TBX A;  1SFU A;  3ML6 A;  2L01 A;  3K69 A;  1ZRD A;  2L3D A;  4Q5S F;  2DPU A;  3R0J A;  1XSX A;  3QP5 A;  3JSO A;  4RGU A;  1Z05 A;  1XSV A;  2BE5 F;  1WWX A;  3U2R A;  2IA0 A;  3SHF A;  4NQW A;  3SZP A;  1Z6T A;  5FD5 A;  4R8H A;  1EH7 A;  2F5D A;  4PCQ A;  2V6C A;  5LRS A;  3NRV A;  1ZH5 A;  3GW2 A;  2FE3 A;  5J6X A;  4GGG A;  4GXO A;  3PFI A;  4YII A;  3T0Y A;  1W7P A;  1G3S A;  3FF5 A;  5DCF A;  4IHT A;  1XD7 A;  5D6F A;  4WXH A;  1FBS A;  2P6S A;  3F6O A;  3ULQ B;  2M87 A;  1T0F A;  3CUQ B;  3I71 A;  2E1C A;  1FT9 A;  1S8N A;  1HBX G;  3ROU A;  2IA2 A;  3BPV A;  5DD4 A;  2IW5 A;  4G6D A;  3NEU A;  2E1N A;  4EV0 A;  2CO5 A;  2DU9 A;  2STW A;  1IXS B;  2C6Y A;  4EJW A;  4G7O F;  2EA2 A;  3GZ6 A;  4A5N A;  1IRG A;  3H3Z A;  3I0T A;  1ZGA A;  4DQ2 A;  3WE2 A;  4LK1 F;  2O6G E;  3REO A;  2KIU A;  4YIF A;  2VXZ A;  2W24 A;  3ZMS A;  3RPQ A;  2G7H A;  2OQR A;  1OMI A;  1YG2 A;  3ZMZ A;  3F8F A;  3D5L A;  2VOD A;  1STZ A;  3L2C A;  2B0L A;  2Q8K A;  2J5O A;  2XHK A;  4NB5 A;  2ADU A;  2RVC A;  1V4R A;  3J7A O;  1JHF A;  1SFE A;  3CUQ C;  3EYY A;  6PAX A;  2KIM A;  1JGS A;  2ZFW A;  1R22 A;  3GLX A;  3K2Z A;  3RPU A;  2PG4 A;  3TGN A;  2FXA A;  4ZYD A;  2WWY A;  1B4A A;  3FMR A;  4CXF A;  2FBK A;  3EYI A;  3HSF A;  3BRO A;  4KA4 A;  4HF1 A;  5E1W A;  1MD0 A;  4KT5 C;  1PP8 F;  2F5E A;  1IRF A;  3HRM A;  3MZY A;  1LQ1 A;  4M73 A;  1AWC A;  2PN6 A;  4AD9 A;  5FFZ A;  1XGO A;  1FP2 A;  3I64 A;  3FHZ A;  5HDK A;  2K7L A;  5BMZ A;  3ISP A;  3QPT A;  1LEB A;  1TQI A;  1HSJ A;  1MGT A;  3C3W A;  4Y15 A;  2Y48 A;  1ONV A;  2EJR A;  2K4B A;  2P7C B;  3GZ5 A;  5DCM B;  1SMY F;  3HHH A;  2STT A;  3KP7 A;  1R1U A;  3QP6 A;  3LAJ A;  5DUI A;  2HFH A;  4K2E A;  4I09 A;  2JT1 A;  3BJ6 A;  4B09 A;  3DEU A;  3WTV C;  3M9A A;  3FXR A;  2JRT A;  2QLZ A;  3L09 A;  3QPH A;  4OMY A;  4TV7 A;  3HRS A;  1FYM A;  5L3F A;  2MC3 A;  3ECH A;  2MA3 A;  1HQC A;  3ABU A;  3DPL C;  1YTY A;  2ZXJ A;  5CLS A;  2VON A;  3MFK A;  1CGP A;  4YFX F;  2FA5 A;  1PDN C;  5D4R A;  2QBY B;  2FRH A;  1HW1 A;  4AVP A;  3SXY A;  2XGX A;  5FLX Z;  1FLI A;  2AXL A;  1GVJ A;  5JFR A;  4U0V A;  3CUQ A;  1K79 A;  3CDH A;  1YYV A;  2KRF A;  1V3F A;  2EV0 A;  2IA1 A;  4UXN A;  2HEO A;  1JE8 A;  4A0Z A;  1WI9 A;  1O3R A;  1TLH B;  2RQP A;  3BJA A;  1CF7 B;  2XRN A;  5F64 A;  2EFN A;  4RB3 C;  2XRO A;  4PGH A;  2FBI A;  4P96 A;  1S3J A;  5K5R A;  1QZZ A;  3I53 A;  4IPA A;  2VBW A;  5ILS A;  4M9Z A;  3HOT A;  2HS5 A;  5D8K B;  4MTE A;  1KU7 A;  3FXQ A;  1GXQ A;  1XN7 A;  5BPD A;  2Z5U A;  4S05 A;  3GFJ A;  1BIB A;  1KGS A;  3BY6 A;  2FSW A;  4M72 A;  3G73 A;  4GYG A;  4KN7 X;  1IZ1 A;  2XAH A;  5LBQ A;  3GUD A;  4HV5 A;  2F2E A;  3W6K B;  3LWF A;  2HYG D;  1XGM A;  3KLO A;  3TDU C;  1BI0 A;  1R23 A;  2GXB A;  4I7H A;  1R1T A;  2IJL A;  1Y0U A;  1QNT A;  4IF4 A;  2G7U A;  1TW2 A;  4A12 A;  2PQ8 A;  3KET A;  1VTN C;  2J5P A;  3ABT A;  1H9G A;  2PEX A;  2RDP A;  1U2W A;  3CUO A;  3F8N A;  5D5X B;  4AWX B;  2A6E F;  1Z9C A;  2ZNZ A;  3U1D A;  3LST A;  1G3Y A;  3RKX A;  3DV8 A;  3E5Q A;  2VBX A;  1O3S A;  2CQK A;  2HGC A;  3B02 A;  4HX4 A;  1L3L A;  2X4H A;  1FYK A;  2G9W A;  4CO8 A;  2KJB A;  3P7N A;  1UST A;  2FU4 A;  2O0Y A;  2E7X A;  1BC8 C;  2V1D A;  5IT9 K;  2F5C A;  3RYP A;  5IT9 Z;  1W5T A;  3LA7 A;  1FP1 D;  1FYL A;  3KP3 A;  1KU2 A;  3E6C C;  1CF7 A;  2VC1 A;  2W57 A;  3BJO A;  1FC3 A;  2EK5 A;  1QO0 D;  1UHM A;  4MEY F;  2YPR A;  4ENK A;  1TW3 A;  2XAJ A;  1YW7 A;  4G8X A;  3M1E A;  1D3Y A;  1TTY A;  1O7F A;  3HIF A;  2QYO A;  4ASN A;  2LKP A;  2L4M A;  2RNJ A;  3RTR A;  2A68 F;  4KN4 X;  4Q47 A;  4G7Z F;  5D5V B;  5D6E A;  1O3T A;  1EH6 A;  5CVR A;  3F3X A;  3HRU A;  2M1B A;  5JR3 A;  2ELH A;  3RKY A;  2LSO A;  1HKQ A;  2H94 A;  4JQF A;  3E5X A;  3WG9 A;  3I58 A;  4UVB A;  4GCV A;  1D8K A;  2MLG A;  4NHJ A;  1UCR A;  5CVI A;  5J8C A;  1SD7 A;  2WTE A;  4HA8 A;  3WU0 A;  5HS8 A;  1YS7 A;  1Q1H A;  4ZZL A;  3CTA A;  1P4W A;  5HOO A;  2VBZ A;  4I0A A;  1RI7 A;  1UFM A;  2R7F A;  4RGR A;  1FPQ A;  3WTS C;  3KZZ A;  4HAM A;  1IN4 A;  3GFM A;  4A0X A;  3KCC A;  2OZ6 A;  4ZZD A;  4BH9 A;  1YFH A;  3GO5 A;  1OR7 A;  3IL2 A;  2ZME B;  5LHG A;  2BV6 A;  1K78 B;  2BGC A;  1S7O A;  1B9M A;  4IRG A;  4D0P A;  5BPI A;  1QPM A;  3I59 A;  4AIH A;  2YSR A;  3K9T A;  5D5U B;  1QZY A;  5ICC A;  1I5Z A;  5E1Z B;  1PUE E;  2DO7 A;  3FMS A;  5DDG A;  4UNO A;  3TOA A;  4RAY A;  3BPX A;  3OV8 A;  3GF2 A;  2OQG A;  1WQ2 A;  1RNL A;  5L3C A;  4P5O A;  4L9J A;  2JPC A;  1RZ4 A;  3WTX C;  5LLQ A;  2HKX A;  2BEO A;  4P9F A;  4WF2 A;  5DYM A;  2YU3 A;  1G3T A;  3QU3 A;  4LD5 A;  3RIR A;  1KQ8 A;  1E2X A;  1DPR A;  4IRI A;  1KA8 A;  4XLP F;  2IT0 A;  4JBA A;  1ZYR F;  5H6R A;  4M6Y A;  3J81 Z;  4WXD A;  1F5T A;  2YX4 A;  5HVQ C;  2BYV E;  2P7V B;  3I54 A;  3MQ0 A;  1U8R A;  2XVC A;  1XCB A;  2KJC A;  2DI3 A;  2L02 A;  3WTU C;  3I5U A;  3R0A A;  4XSX F;  2PFB A;  2PJP A;  1ZAO A;  3V8K A;  3GVA A;  2MH9 A;  5D4S A;  3ELK A;  4HX8 A;  3ZN1 A;  5LGN A;  1O3Q A;  3HHG A;  4HBL A;  3BOQ A;  3V7C A;  1BN5 A;  2ZME A;  3I59 B;  5D5W B;  4BHC A;  1LDK B;  1MKM A;  4BQA A;  1T6S A;  1IN6 A;  3B73 A;  4RGS A;  5J8F A;  4I98 B;  1BOA A;  2K4J A;  1J7K A;  4BNC A;  4LMY A;  5IT3 A;  1TQP A;  3FXU A;  4I0B A;  5FGM A;  3S2W A;  3ZMT A;  2ISY A;  3JSP A;  3VFZ A;  1QGP A;  4XRF A;  2WC2 A;  1FNN A;  3V8L A;  3BDD A;  4HDV A;  2EV5 A;  5BQT A;  2L4A A;  2DLL A;  2AS5 F;  2L54 A;  1HXD A;  1LEA A;  2MBF A;  5E1X A;  3F21 A;  3M7G A;  2UWM A;  1SD5 A;  1MDM A;  1K7A A;  2DK5 A;  3K0L A;  2FNA A;  4EM0 B;  1G6N A;  3H92 A;  4LB5 A;  5LHI A;  4PGG A;  1P4A A;  1X3U A;  3CO7 C;  2CWE A;  1C0W A;  3DFG A;  2KKO A;  4N0B A;  2PLY A;  2JZY A;  1JXS A;  2VC0 A;  2MD5 A;  1R5G A;  2JSC A;  2K86 A;  2ZNY A;  3E6B A;  2EFW A;  1MJ9 A;  5TRD A;  3P9K A;  3EUH A;  2W85 A;  3GWZ A;  2ISZ A;  1IF1 A;  2QQB A;  3V4G A;  1MDM B;  4LLN A;  5HLI A;  1ZG3 A;  2MLK A;  1LB2 A;  1KQ9 A;  1YQA A;  4KUM A;  1W4M A;  1LDD A;  4EJV A;  1F4K A;  3VOE A;  4L9V A;  1LDJ A;  5DCM A;  1XGN A;  4RS8 A;  3M8E A;  2XKO A;  1P2F A;  3SQN A;  3WE3 A;  5TJJ A;  3HTS B;  2RC4 A;  4RB0 A;  1YW9 A;  2ESN A;  2CW0 F;  3EQL F;  1U5T A;  2VT2 A;  1J5Y A;  1K6O A;  1BBY A;  4UHT A;  1XB4 A;  3LA3 A;  4CYD A;  4XLN F;  4BAY A;  2UXX A;  2YX7 A;  3SZT A;  4L18 B;  4UUV A;  2XIG A;  5LHH A;  2H27 A;  1I6X A;  1G3W A;  2GWR A;  3U9G A;  4M9S A;  1ZG5 A;  2ACJ A;  3EET A;  1AOY A;  1ZRC A;  3HSE A;  2Z9O A;  1U5T B;  4EJU A;  2Q2E A;  2PBI A;  5CVV A;  5DEQ A;  3NQO A;  2UZK A;  3T1B A;  1SMT A;  1BI3 A;  2EB7 A;  1HW5 A;  4WK8 F;  2EA4 A;  4O5V A;  4OMZ A;  1F9N A;  2V79 A;  1S7A A;  3ZP5 A;  1FOK A;  5L3B A;  3IWF A;  3R6S A;  1MJB A;  4F7Z A;  5JVT A;  2LF8 A;  4LB6 B;  1GHC A;  3VOD A;  4IXA A;  1A04 A;  4LGW A;  5FB2 A;  1B9N A;  2XUB A;  1I27 A;  2QBY A;  5DUK A;  3JAM K;  3RKW A;  2QQ9 A;  3QU6 A;  4G7H F;  4PDK A;  3P9I A;  3GFL A;  4LLL A;  1QBJ A;  4OIO F;  1KYZ A;  4E70 A;  3MCZ A;  2V9V A;  2D2W A;  5HLH A;  5ICE A;  4A6D A;  4HF2 A;  2XAF A;  2A6H F;  5CVU A;  1QQI A;  4Y17 A;  4U7D A;  1USS A;  4GYI A;  2Z99 A;  4CGZ A;  4UV9 A;  5E17 F;  1DPU A;  3JTG A;  5H6Q A;  2CG4 A;  3FZV A;  4B8X A;  3N97 A;  2OAZ A;  3WGG A;  2M5W A;  3HOS A;  3HUG A;  2E7W A;  3PQJ A;  1IXR C;  4QLC U;  4M9X A;  1T39 A;  4ON0 A;  4U7B A;  4Q48 A;  2IP2 A;  3IKV A;  3Q5F A;  4L5I A;  5JI6 A;  2P6T A;  2O61 A;  3MAJ A;  2NRA C;  1WKM A;  3COA C;  5L3D A;  4ESB A;  1ZLJ A;  4FHT A;  1BC7 C;  1XCV A;  2QWW A;  1E17 A;  1F1Z A;  2GXG A;  3IRQ A;  1SFX A;  2M45 A;  5BS6 A;  2RN7 A;  1YS6 A;  2OZU A;  3IRR A;  4HOB A;  2X0L A;  3H3U A;  2A69 F;  4XSZ F;  2KIF A;  2EFP A;  3L9F A;  3Q9V A;  5ED4 A;  4BXU A;  2F5F A;  4I2O A;  1ON2 A;  5K1Y A;  5KK1 A;  3K1M A;  3RYR A;  1L0O C;  1O57 A;  3IC7 A;  2Z33 A;  1U5T C;  5D8L B;  2HTS A;  1HKS A;  4LLG F;  2FMY A;  2ZBK A;  2D1V A;  2LDU A;  2QEN A;  2K27 A;  4HQE A;  2WV0 A;  2DFI A;  5E18 F;  1ULY A;  3KP6 A;  3TOB A;  1RUO A;  4OIR F;  3P9C A;  3F23 A;  4EMS A;  2HWV A;  4OOI A;  1Z91 A;  3WGI A;  2W25 A;  1B6A A;  3C7J A;  5HDN A;  1FX7 A;  3E5U A;  4EM1 A;  4KIC A;  4CDG A;  3WOD F;  1IXC A;  3FWE A;  3N4M A;  2V1X A;  1XDU A;  5HS7 A;  3ZMU A;  1BIA A;  3F22 A;  4KDP A;  2RKH A;  1HKT A;  5EEH A;  2O8X A;  2H6C A;  4LK0 F;  5ICF A;  2EV6 A;  2VE8 A;  1R58 A;  1SD6 A;  3DXJ F;  3TDZ C;  3CJN A;  3WTY C;  4U88 A;  2QVO A;  1U6G A;  5ILV A;  5F1R A;  3KP2 A;  5FFX A;  1R7J A;  2XAG A;  4KMU X;  5A2Q K;  5CYV A;  4WCG A;  4BHB A;  1NHA A;  1Z7U A;  4HV6 A;  3MEX A;  1RIO H;  2PI0 A;  2M30 A;  3ERE D;  2DQL A;  3K1P A;  3EDP A;  2CFX A;  2P5L C;  1I1G A;  2Q0O A;  1O7L A;  2FBH A;  2H6B A;  2Z3Y A;  3WTW C;  2DQR A;  3RDI A;  4BYY A;  4MNU A;  2JPB A;  4A0Y A;  3RJP A;  1FBQ A;  3WTT C;  3T5X A;  2YR2 A;  1G4D A;  2VE9 A;  1YLF A;  1FSE A;  4KFC A;  3OOP A;  3GEZ A;  4CIC A;  5CVJ A;  5HDG A;  3TQN A;  1BI2 A;  4R79 A;  5ILU A;  3J80 K;  4UV8 A;  4WXC A;  2EFO A;  5AIQ A;  3ECO A;  1XSD A;  2XV4 S;  2NYX A;  1WRJ A;  1YW8 A;  4Z2Y A;  2NAZ A;  1T2K A;  1UHW A;  2GIV A;  4L0Y B;  2CGP A;  2UXN A;  4G6Q A;  5LGU A;  3R4K A;  2MH2 A;  5FO5 A;  4BHP A;  2P5K A;  2FML A;  3FX3 A;  4XBF A;  4RAZ A;  5LGT A;  1SD4 A;  3MZH A;  4O6J A;  4O3M A;  4P55 A;  1H9T A;  2P8T A;  1PP7 U;  1REP C;  3T8R A;  2O3F A;  1BM9 A;  1FBU A;  4HLX A;  4N9I A;  2HZT A;  3R61 A;  5K5O A;  1HST A;  1SAX A;  4HYE A;  3JW4 A;  4Y13 A;  3TKY A;  1U78 A;  4UVC A;  1OYI A;  3ZN0 A;  2ZKZ A;  3J81 K;  1IW7 F;  2DTR A;  1W7P D;  4FX0 A;  1OYW A;  4I02 A;  3C1D A;  4M71 A;  1ZN2 A;  3Q9S A;  4MQV A;  5FD6 A;  1XDS A;  2M8E A;  3K1N A;  1P92 A;  2HQN A;  2DW4 A;  2RV8 A;  2QZ8 A;  2W84 A;  2QM3 A;  3TO7 A;  2HQR A;  3TO6 A;  1U3E M;  1ZRE A;  5E20 A;  2HR3 A;  1ZLK A;  4M74 A;  2LF7 A;  4KYW A;  1Z6R A;  1T98 A;  4OIQ F;  4KIB A;  3C18 A;  4U0Y A;  4OU0 A;  4MTD A;  1R36 A;  1W5S A;  2QUF A;  4DNC A;  4EGZ A;  3DKW A;  4YFK F;  2GAU A;  3KFW X;  1J9I A;  4CZZ A;  1DP7 P;  1J2X A; 
#chains in the Genus database with same CATH topology
 2V9P A;  2CV0 A;  3F8B A;  3ASN H;  3FXO A;  1OKR A;  3HOV J;  3WU1 B;  1V55 H;  1D0Z A;  1MZB A;  3E6M A;  3FBI B;  3LFK A;  1KZH A;  1B59 A;  1LNW A;  2DA3 A;  3W6J B;  3V7S A;  4IJA A;  1EV7 A;  1QRY A;  3H9Q A;  3QAH A;  2MW8 A;  2Y0S A;  2K9N A;  4U0W A;  1BI1 A;  3LQQ A;  1V5F A;  4YG2 F;  4MIM A;  3GTK J;  3OYB A;  2VT3 A;  5DD8 A;  1X1P A;  4ETS A;  2R93 J;  4R1H A;  1TQM A;  2JVG A;  2HTJ A;  1R5H A;  4I01 A;  5H2F C;  1D1A A;  1S72 I;  1W7P B;  4HF0 A;  4BE2 A;  4EAT A;  1ZAR A;  4IO9 F;  2A07 F;  4HNT A;  4BY7 J;  4EJO A;  2A3S A;  2H09 A;  2MG4 A;  1LFB A;  1N25 A;  3ZPL A;  3S2D J;  2Y9Y A;  3H1C A;  4XOR A;  3RQI A;  3GX4 X;  3I4P A;  3O6B B;  1P4X A;  3E6D A;  2O03 A;  3F8C A;  4A5M A;  3BG6 A;  3WTZ A;  3F9K A;  5IYD J;  1IUY A;  4LFU A;  4Y52 J;  3J80 Z;  1E0E A;  1TNT A;  4M3B A;  1T38 A;  2D45 A;  1CQT A;  2TDX A;  3QRF F;  4Y7N J;  2GA2 A;  1KU3 A;  1UAA A;  1VQO I;  5FKN A;  3BT9 A;  3PNT A;  4ESF A;  3KZY A;  5LEJ A;  3K70 D;  1W0U A;  2F4M B;  2VL8 A;  2HYF A;  4UUT A;  1I1S A;  4IRH A;  3LA2 A;  2PMU A;  3HRT A;  2GQQ A;  3VEP A;  1YO5 C;  1D8J A;  3E97 A;  4BU2 A;  1K78 A;  2IAI A;  1IN8 A;  4KIF A;  5GAE J;  5IOZ A;  3WGH A;  2GA1 A;  2QEX I;  1QVU A;  1Z67 A;  5A2Q Z;  1WSU A;  5E8G A;  2R3S A;  2K3P A;  4FT8 A;  3FBN B;  2CYY A;  1IN5 A;  3DQV C;  1UB9 A;  2KHM A;  2A5Y B;  5ICG A;  3IH3 A;  2OBP A;  2HOE A;  3S17 J;  3K4B A;  4KNY A;  2HKO A;  5F0H A;  3O2P E;  1ZRF A;  3LAP A;  5KVR A;  1Z77 A;  1MIJ A;  3IWZ A;  2OPT A;  1D5V A;  2M7B A;  3KYC B;  3BP8 A;  4HZF A;  2K02 A;  3PJR A;  1ETO A;  4N4N B;  1FSH A;  2DA1 A;  4JK1 X;  1TWA J;  4H0E A;  2HOA A;  4E7K A;  2DK8 A;  5EJC A;  3HYI A;  3VB2 A;  3ZQQ A;  1RUN A;  3HXL A;  2OF7 A;  2GZW A;  1WCM J;  4HLY A;  3M8F A;  2VBY A;  2NNY A;  2LNB A;  4HDU A;  4XR6 A;  2LG4 A;  3OYD A;  3BWG A;  3GYH X;  2PMH A;  2ZSH B;  3RI4 A;  4ESJ A;  1K4S A;  3KX2 A;  2ETH A;  2ZCW A;  2QGU A;  2ZXI A;  2XAQ A;  5F27 A;  2VOP A;  5K5Q A;  2P5V A;  1H8A C;  3OSG A;  4BE0 A;  4XLA A;  2ESH A;  2XAS A;  4L5J A;  4PK4 A;  5LD2 C;  4A3B J;  4P1W A;  2LBF B;  4V2G A;  4KMF A;  4IVN A;  2EZL A;  2FUG 2;  2HOS A;  4GO1 A;  3IHU A;  2MAB A;  4EJT A;  2RAE A;  3OYE A;  2FF4 A;  4OAY A;  2DT5 A;  4HW0 A;  2CUJ A;  1AHD P;  1ON1 A;  4EQQ A;  3OYF A;  4ANJ A;  5JHU A;  4CHU A;  2DOA A;  5L3G A;  3DPT A;  1EH8 A;  1FEX A;  4A3L J;  1YIO A;  2DDA A;  3CCR I;  4BBR J;  4LIV A;  1ITY A;  2LFB A;  4NDL A;  3IH2 A;  5AIP A;  3BTC A;  2R7V A;  4X0G A;  2FQ4 A;  2JUG A;  4G94 A;  3TBI A;  4AM3 A;  2FNP A;  1T08 B;  4YFN F;  4XLE A;  4ABZ A;  4M6X A;  2CSO A;  1VQ8 I;  3O3K A;  2R7X A;  3KPH A;  5K7F A;  3IH4 A;  3L00 A;  1R00 A;  1J59 A;  1IG7 A;  2HXI A;  2ME0 A;  1BJZ A;  3MWM A;  2OD5 A;  4RB1 A;  4CCL A;  1BJA A;  4BXX J;  1KU9 A;  2VLA A;  4L9N A;  4UVA A;  4LG0 B;  4ZYG A;  4BJ6 C;  4WWC A;  2EWN A;  4IHS A;  2DPD A;  2OU2 A;  4HX7 A;  2BXZ A;  3OMY A;  2FOK A;  4G9Y A;  3CLO A;  4ZYE A;  4OIN F;  4EM2 A;  5L3E A;  3LQR A;  4KJZ A;  4KIG A;  4XK4 A;  1FZP B;  3QYF A;  3S2H J;  2CMP A;  5B1A H;  3PM1 A;  2EIN H;  1IAW A;  1OFC X;  2OV7 A;  1HC8 A;  1X4P A;  3KE2 A;  1UHS A;  2Y0M A;  3FM3 A;  3RCO A;  1ZG1 A;  4ZH4 F;  4FX4 A;  1QA6 A;  3SYT A;  3BR0 A;  2Y31 A;  3R60 A;  1IN7 A;  1R1V A;  3ZQ7 A;  2CQX A;  4E7H A;  4UB6 C;  4DOZ A;  3OS2 A;  2JTV A;  4MQ9 F;  3PQK A;  3BZ6 A;  3BCA A;  2HVR A;  1QPI A;  4YEJ A;  4P9U A;  2DMU A;  1IGN A;  3IKT A;  3G1M A;  2NXN B;  2NNN A;  1MSE C;  2WV1 A;  1DUX C;  3AL0 C;  2H8R A;  3JAM Z;  3DEE A;  4ENM A;  1D0X A;  2B63 J;  1JHH A;  1GXP A;  1ZHF A;  1XMA A;  4N9H A;  4A2U A;  3FMQ A;  2KDO A;  3P5J A;  4DGW B;  4RAG A;  1JTY A;  1XPX A;  3ZR8 X;  2W48 A;  2IBD A;  3T8T A;  1P7I A;  2IPQ X;  5J4Y A;  3HTU A;  2Y69 H;  3A02 A;  5KNL A;  5M3M J;  1FY7 A;  4M3G A;  5HLG A;  4WX9 A;  3ZMV A;  3FKJ A;  2ZO4 A;  3HOZ J;  2DCE A;  3CO6 C;  4EVI A;  1RR8 C;  2K5C A;  4FET A;  4XRS G;  5F6F A;  1FTZ A;  2LY2 A;  4L0Z B;  1P6R A;  1X58 A;  4AIJ A;  3GXO A;  3SFZ A;  3G3Z A;  1U0J A;  3F6V A;  2EFQ A;  5BOX A;  3L2U A;  1XGS A;  5EEG A;  5FKO A;  1TL8 A;  5IY5 H;  1Z1D A;  4E7S A;  4LJZ F;  4MGR A;  2FQ3 A;  1DGW Y;  2X6X A;  2DAO A;  3KEO A;  2IGM A;  3DBH B;  2QQA A;  1DU6 A;  4IQ4 A;  5LEK A;  3F72 A;  4W1U A;  4PZJ A;  3HB9 A;  3D0S A;  3ZMD A;  2BVL A;  4ENJ A;  3W2W A;  5CPR B;  2ELJ A;  2E2I J;  1MNE A;  3S93 A;  3K4J A;  2COM A;  3JTH A;  2HDC A;  2RGV A;  4XOP A;  3PSF A;  3DWL E;  3I3L A;  2A61 A;  3GTM J;  4LG0 A;  2OCC H;  2VN2 A;  5TIS C;  3L7W A;  1TWC J;  3X2Q H;  5C4X J;  4ENN A;  2Y75 A;  4QPO A;  5E3M A;  4RGX A;  2D1H A;  3HSR A;  3HOY J;  2M7A A;  1QVT A;  1S7E A;  3DF8 A;  1HDP A;  2KP6 A;  2V1U A;  2VOO A;  5FLX K;  3GCM A;  4D9J A;  2NS0 A;  2M9H A;  4S04 A;  3V7R A;  4UB8 C;  3GFI A;  1MMN A;  2AQF A;  4QWQ A;  4OIP F;  1VQ6 I;  2E35 A;  1OYY A;  4A3K J;  1MJA A;  1RKT A;  2X85 A;  4NQW B;  2XSJ C;  3KP5 A;  1DQU A;  3DP7 A;  2BBY A;  1LVA A;  4M3E A;  5GAD J;  5AON A;  1H0M A;  3KLN A;  4Q4Z F;  1IRZ A;  5CJ9 A;  2I5U A;  5FKL A;  1DP3 A;  4RA2 A;  5ERI A;  1LUJ B;  3WHC A;  4RB2 C;  4XKW A;  1NG6 A;  4BY1 J;  4CH7 A;  2FOW A;  3LL7 A;  2XSD C;  5E8I A;  1J0R A;  1LJ9 A;  2XKP A;  2GOX B;  2A5W A;  3TO9 A;  2R7W A;  1ETV A;  4II2 A;  5M5X J;  1Y1W J;  3QOP A;  2XB0 X;  2IRF G;  5LRR A;  4A6E A;  3V8J A;  2AO9 A;  2XGD A;  4ZYH A;  1XMK A;  2E2J J;  3KEQ A;  4FE7 A;  1DDN A;  3I4M J;  1B1B A;  2CV1 A;  1VF9 A;  3ABK H;  1HA8 A;  1ODD A;  1QZE A;  2JA5 J;  1ZGJ A;  2X1D A;  3ZRG A;  1Z3Y A;  4MEX F;  2LH9 A;  1A5J A;  3KP4 A;  1HDD C;  1E3P A;  1S29 A;  2DMQ A;  5DV5 A;  5HS9 A;  1OPC A;  2FEZ A;  2H1L A;  2Y9Z A;  2M2E A;  1ETW A;  2YUS A;  1WVR A;  5H20 A;  2R7D A;  1VFC A;  4G6T B;  3BG5 A;  3FM5 A;  3PIP F;  4AIK A;  2I10 A;  4A3D J;  2RRE A;  1HW2 A;  2OA4 A;  1WH7 A;  3OWT A;  1FWZ A;  2O7O A;  4NC7 A;  3AAF A;  3L1P A;  1GDT A;  5EZH A;  1S6L A;  2R5Z A;  2PJR A;  2IVM A;  3L2W A;  4HQM A;  5B5E C;  2DBB A;  1YRN B;  3BR5 A;  2P4W A;  2R7T A;  1KYW A;  4MHG A;  3PSI A;  2E1M C;  4IZZ A;  4Y3O A;  4EGY A;  5HNF A;  4JOM A;  1SEU A;  1TNS A;  2E5N A;  1KQ0 A;  2CV2 A;  2ZJ2 A;  1BR4 A;  3E3V A;  1W36 C;  4FQG A;  2CFO A;  4L9T A;  3F8M A;  2F4I A;  1TBX A;  1SFU A;  1J75 A;  4D5C A;  2CQN A;  3A01 A;  3ML6 A;  2IS1 A;  2L01 A;  3K69 A;  3VWB A;  1ZRD A;  2W4S A;  1W1W E;  2L3D A;  4Q5S F;  2DPU A;  2VI6 A;  2NVU B;  2VKV A;  3M3Y J;  3R0J A;  1XSX A;  3QP5 A;  1QU3 A;  3JSO A;  4RGU A;  4IHV A;  1Z05 A;  2I8D A;  1XSV A;  2BE5 F;  1WWX A;  2WY7 Q;  1VQ7 I;  3CCY A;  2LYC A;  3U2R A;  1SAU A;  2IA0 A;  3ESW B;  3SHF A;  1ZR2 A;  3GTL J;  4NQW A;  2L5Q A;  3SZP A;  1Z6T A;  5FD5 A;  3LNQ A;  4R8H A;  1IDY A;  1EH7 A;  2VQL A;  5FRO A;  4E4H A;  2F5D A;  2BY0 A;  1TP4 A;  4PCQ A;  5B3S H;  2V6C A;  4BXF A;  3NRV A;  5LRS A;  1ZH5 A;  3GW2 A;  2FE3 A;  2VQG A;  5J6X A;  3J7Y J;  3ZXS A;  2E1O A;  3CCL I;  1Y8Q B;  2ZB9 A;  4AVZ A;  4GGG A;  4GXO A;  3AG1 H;  3RZO J;  2V7F A;  3PFI A;  4YII A;  3T0Y A;  1W7P A;  1G3S A;  3JRB A;  2JQ7 A;  3Q3S A;  3FF5 A;  3IP4 B;  4ITV A;  1O4X A;  1I6H J;  4YRV A;  2DJN A;  2LKS A;  5DCF A;  4IHT A;  1XD7 A;  1XTA A;  5D6F A;  4WXH A;  1FBS A;  2A6T A;  1WPK A;  2E71 A;  2P6S A;  3F6O A;  1SFO J;  3ULQ B;  2M87 A;  2E1M B;  1T0F A;  3PUB A;  3CUQ B;  3JRG A;  3BR1 A;  3I71 A;  3QPL A;  2VUM J;  5JHF A;  2LD5 A;  2E1C A;  1SFK A;  2LY1 A;  1FT9 A;  1S8N A;  1HBX G;  3S8P A;  3ROU A;  3J7A Y;  2IA2 A;  3BPV A;  3HM5 A;  5DD4 A;  1WJE A;  2IW5 A;  4G6D A;  3LMM A;  4CA0 A;  3NEU A;  2E1N A;  4EV0 A;  2KIQ A;  2CO5 A;  2DU9 A;  3LSG A;  2STW A;  1IXS B;  2C6Y A;  4EJW A;  4G7O F;  1YRN A;  1UMQ A;  2EA2 A;  1NTC A;  3CCE I;  3GZ6 A;  3TW6 A;  2MC4 A;  4A5N A;  1IRG A;  3H3Z A;  4JX4 A;  2MYS A;  3I0T A;  1ZGA A;  4DQ2 A;  3S1N J;  4DBR A;  3OYC A;  4LG3 A;  1OCC H;  3WE2 A;  4LK1 F;  2O6G E;  3REO A;  3OS0 A;  2KIU A;  4Y4R A;  3K70 C;  1VQM I;  4YIF A;  2E2H J;  2Z1D A;  1VQ5 I;  1R4N B;  2VXZ A;  2W24 A;  3ZMS A;  1MMG A;  3RPQ A;  2G7H A;  4II3 A;  2OQR A;  1OMI A;  1YJN I;  1YG2 A;  1R6R A;  3S14 J;  3ZMZ A;  3CJR B;  3F8F A;  3D5L A;  2VOD A;  1STZ A;  3SEZ A;  3L2C A;  3HGY A;  1MBJ A;  2ZFU A;  1I3A A;  4PJL A;  2B0L A;  4BQQ A;  2Q8K A;  2J5O A;  1VQ4 I;  4CCK A;  3GTQ J;  1XX5 A;  2XHK A;  5FKK A;  4NB5 A;  2ADU A;  3ZQL A;  2RVC A;  1MMD A;  1V4R A;  3J7A O;  1JHF A;  1SFE A;  3CUQ C;  3EYY A;  6PAX A;  2TRT A;  1MMS A;  2CQ7 A;  1FJL A;  3U1K A;  1U8B A;  4E7Z A;  2KIM A;  1JKP C;  1JGS A;  4XRS A;  3LSP A;  3BR2 A;  3B6A A;  3OYM A;  2ZFW A;  1R22 A;  3DEW A;  3GLX A;  3OYL A;  3K2Z A;  3H9J A;  2LKX A;  3RPU A;  2PG4 A;  5IYC J;  3TGN A;  2FXA A;  4ZYD A;  1OCR H;  5FRM A;  3CCV I;  2WWY A;  1B4A A;  3FMR A;  5IP7 J;  4CXF A;  2FBK A;  4A69 C;  3EYI A;  5EDN A;  2E36 A;  3HSF A;  3BRO A;  4KA4 A;  4HF1 A;  5JVG F;  3CDL A;  3K2A A;  5E1W A;  1MD0 A;  1X1D A;  4BJ5 C;  4KT5 C;  2KDZ A;  1PP8 F;  2M8G X;  2F5E A;  3AG3 H;  1VQN I;  1IRF A;  3HRM A;  3MZY A;  1LQ1 A;  2BZT A;  3AG4 H;  3OIO A;  4M73 A;  1X1B A;  2XPW A;  1AWC A;  5E3N A;  2WAF A;  1WGX A;  2HI3 A;  2PN6 A;  3GBG A;  4AD9 A;  3DU5 A;  1LFP A;  5FFZ A;  2HZD A;  5EG0 B;  2HVS A;  3CZ6 A;  2BHY A;  3OL4 A;  1YOV B;  3SEQ A;  1XGO A;  4MFE A;  1FP2 A;  3I64 A;  3FHZ A;  5HDK A;  2K7L A;  3HEF A;  5BMZ A;  3ISP A;  2QSF X;  3QPT A;  1LEB A;  1TQI A;  1HSJ A;  1MGT A;  2DFF A;  1GLN A;  4XIC A;  3C3W A;  4XMY A;  5J47 A;  4Y15 A;  2Y48 A;  3OR1 C;  4DIQ A;  5KAI C;  1ONV A;  2EJR A;  1ZKG A;  3BG7 A;  1M1E B;  2K4B A;  2P7C B;  2VAS A;  3GZ5 A;  4HG2 A;  2XGC A;  5DCM B;  2F48 A;  2V26 A;  1SMY F;  3BR3 A;  4AC0 A;  3VPR A;  3HHH A;  2P0W A;  2STT A;  1X2M A;  3KP7 A;  1NK2 P;  5F0C A;  1R1U A;  3QP6 A;  3LAJ A;  2HDW A;  5DUI A;  2HFH A;  4UY8 I;  4K2E A;  2ZC2 A;  5HNH A;  4I09 A;  2L9R A;  3CMY A;  2DA2 A;  2JT1 A;  1OIS A;  1ERD A;  3BJ6 A;  4B09 A;  4BDZ A;  3U21 A;  3W2A A;  3DEU A;  3WTV C;  1YX3 A;  2Y0S N;  3M9A A;  3MKZ A;  5K7H A;  3FXR A;  1Y56 A;  4EEF G;  2JRT A;  3ABL H;  2QLZ A;  3L09 A;  4CCN A;  4XRM A;  1IRX A;  5HOD A;  3CJQ B;  3QPH A;  4OMY A;  1MBH A;  4TV7 A;  4A93 J;  4L5E A;  3S1M J;  3HRS A;  4F52 A;  4PSW A;  1B8I B;  1FYM A;  2R92 J;  5L3F A;  5KCM A;  1I50 J;  2MC3 A;  3K4L A;  3ECH A;  2MA3 A;  1ZR4 A;  3G71 I;  1HQC A;  3ASO H;  3HKZ N;  3FIS A;  3ABU A;  1WFX A;  2DA6 A;  4AU7 A;  3DPL C;  2ZXJ A;  3WHB A;  1YTY A;  5CLS A;  4IOA F;  3VYT B;  4D5F A;  3CES A;  2VON A;  3MFK A;  1W0T A;  3HDD A;  3RKQ A;  1CGP A;  4YFX F;  2FA5 A;  2R7Z J;  1PDN C;  3S15 J;  5IPA A;  4XKB A;  4A3G J;  2ME6 A;  2VQC A;  1JKR C;  5D4R A;  2QBY B;  2FRH A;  1HW1 A;  4AVP A;  3HOX J;  3SXY A;  2XGX A;  5F04 A;  1B8I A;  4BEH B;  3A03 A;  4MFD A;  2KRH A;  5FLX Z;  3JRE A;  2ZJP F;  1FLI A;  2AXL A;  3CJT B;  4NBQ A;  1GVJ A;  5JFR A;  1XC5 A;  3CUQ A;  4OAZ A;  4U0V A;  1K79 A;  3CDH A;  4B44 A;  1VQK I;  4UUS A;  1YYV A;  2KRF A;  1V3F A;  2EV0 A;  1X2N A;  1WHU A;  4E6K G;  3M07 A;  4CYC B;  2IA1 A;  4PJ0 C;  4UXN A;  1JE8 A;  2K9M A;  4A0Z A;  2HEO A;  1WI9 A;  1O3R A;  4BKX A;  1TLH B;  2RQP A;  3WU2 C;  3TP3 A;  3BJA A;  1CF7 B;  2P81 A;  3A0B C;  3FK6 A;  3I56 I;  1Y6I A;  2XRN A;  4DZJ A;  4Z6Y A;  2V6E A;  3CC7 I;  5F64 A;  5EYR A;  2EFN A;  4RB3 C;  2XRO A;  4PGH A;  2GBY A;  2FBI A;  4P96 A;  5M5W J;  1S3J A;  2L9N A;  3KYD B;  3S3O A;  1V5E A;  5K5R A;  2HXO A;  1QZZ A;  1ETX A;  3I53 A;  4CCO A;  4IHY A;  4IPA A;  2R7U A;  1JI8 A;  3H5R A;  1FMW A;  1JUS A;  1WJC A;  2K9S A;  2VBW A;  5ILS A;  1YJW I;  4M9Z A;  3HOT A;  2HS5 A;  3S3M A;  1SVO A;  5D8K B;  4MTE A;  1KU7 A;  4RLQ A;  2R7Q A;  3FXQ A;  1GXQ A;  1RR7 A;  2EPF A;  2EZI A;  1R71 A;  1XN7 A;  1P7J A;  5BPD A;  2YS9 A;  2Z5U A;  1ETY A;  2KT0 A;  3GFJ A;  4YEL A;  3ZQG A;  1BIB A;  1KGS A;  4S05 A;  1Z21 A;  3BY6 A;  2FSW A;  4M72 A;  4HNV A;  2WY8 Q;  3G73 A;  3QWL A;  4HNU A;  1LE8 B;  4GYG A;  1OCO H;  4H4K C;  4KN7 X;  1IZ1 A;  2XAH A;  5LBQ A;  3GUD A;  4HV5 A;  2F2E A;  3W6K B;  3LWF A;  2Z16 A;  2HYG D;  2WAQ N;  1XGM A;  3KLO A;  3TDU C;  1JJ6 C;  1BI0 A;  1PUF B;  1R23 A;  4LIT A;  2GXB A;  4I7H A;  2ZJR F;  3MMY B;  3EUA A;  4F3Q A;  1R1T A;  2IJL A;  3NAR A;  1Y0U A;  3SZG A;  1QNT A;  4PJM A;  4IF4 A;  2G7U A;  4FTH A;  3WG7 H;  1TW2 A;  4A12 A;  3GTP J;  2PQ8 A;  4C3I J;  3KET A;  1VTN C;  3BTJ A;  3SDB A;  2J5P A;  3ABT A;  3CQZ J;  2EZK A;  3CCU I;  1ACI A;  5BNG A;  1H9G A;  4RBO A;  2PEX A;  4XID A;  2JA2 A;  2RDP A;  4BUP A;  2F5V A;  1U2W A;  5EF6 A;  3CUO A;  1X3W B;  3LSJ A;  4QSH A;  3H3V K;  1I3Q J;  3F8N A;  5D5X B;  1RET A;  4AWX B;  3G4S I;  2YU9 J;  2A6E F;  1Z9C A;  2ZNZ A;  3U1D A;  1WJF A;  3LST A;  1G3Y A;  3NAU A;  3RKX A;  2EIK H;  2W7N A;  2XPU A;  1RRJ A;  3DV8 A;  5DM6 F;  3E5Q A;  2Q1Z B;  4XON A;  3SFI A;  2VBX A;  2ZXH A;  1O3S A;  2CQK A;  2BOL A;  2HGC A;  3B02 A;  4HX4 A;  2DOE A;  2QQ8 A;  2W00 A;  1L3L A;  4JX6 A;  2X4H A;  4NUB A;  2G9W A;  1MND A;  2KMU A;  1FYK A;  3P7N A;  2KJB A;  4CO8 A;  1UST A;  2FU4 A;  2O0Y A;  2E7X A;  4XNF A;  1B72 B;  1BC8 C;  2V1D A;  5IT9 K;  3I55 I;  4KIS A;  2F5C A;  3RYP A;  5IT9 Z;  2R5Y A;  5CQG A;  1W5T A;  2E60 A;  3LA7 A;  1FP1 D;  5E3L A;  1FYL A;  1IUF A;  1BOB A;  2XF5 A;  3KP3 A;  1OR7 C;  1KU2 A;  4JP0 A;  3E6C C;  4E7I A;  2M34 A;  1YIJ I;  1CF7 A;  2VC1 A;  2W57 A;  4CUG A;  3BJO A;  1FC3 A;  2R0Q C;  1NK3 P;  2EK5 A;  4XLH A;  1QO0 D;  1UHM A;  1N75 A;  2BXY A;  2WBM A;  4MEY F;  2YPR A;  3CCS I;  4ENK A;  1TW3 A;  2XAJ A;  1YW7 A;  4G8X A;  2VKH A;  3HZJ A;  3M1E A;  2X6O A;  2PMZ A;  1D3Y A;  1TTY A;  1O7F A;  2AQE A;  3HIF A;  2CRG A;  1MH4 A;  1EA3 A;  2QYO A;  1T8I A;  1JT0 A;  5M3F J;  5F08 A;  2DJI A;  3JCU C;  3EUK L;  5FLM J;  3ONQ A;  2CW8 A;  4BEH A;  2HDD A;  4ASN A;  2LKP A;  2L4M A;  3PFY A;  2RNJ A;  3RTR A;  2A68 F;  4KN4 X;  1VND A;  4Q47 A;  1FOY A;  4RDU A;  4G7Z F;  4NC6 A;  3PUF A;  5D5V B;  2R5Y B;  2OJE D;  4A3J J;  2W1O A;  5D6E A;  3MD2 A;  1HF0 A;  1B72 A;  2B7E A;  1LVK A;  1O3T A;  3GTG J;  3RZD J;  1EH6 A;  1YX5 A;  2DFH A;  5CVR A;  2LRD A;  1Y1V J;  1YIT I;  4JYK A;  3F3X A;  3HRU A;  4RM3 A;  1EKE A;  2G0E A;  2M1B A;  5JR3 A;  3S1R J;  1EJ9 A;  2CU7 A;  3BTI A;  2ZJQ F;  1P9Q C;  1ZGW A;  2GM4 A;  4XQF A;  4F93 B;  2ELH A;  1T33 A;  3RKY A;  2LSO A;  1HKQ A;  2H94 A;  2VPR A;  4JQF A;  2M3A A;  4RAF A;  2NS7 A;  3E5X A;  2ECB A;  3WG9 A;  5J40 A;  2ZME C;  3I58 A;  4UVB A;  1MSF C;  4GCV A;  1D8K A;  2MLG A;  4NHJ A;  1UCR A;  5CVI A;  1RKW A;  1SD7 A;  5J8C A;  2WTE A;  4XM3 A;  2HU9 A;  3BTL A;  4HA8 A;  3WU0 A;  3CCM I;  5HS8 A;  3OYI A;  4C9Y A;  1YS7 A;  2DYR H;  5EGO A;  1N78 A;  3A4C A;  1Q1H A;  3L2R A;  4ZZL A;  4JX5 A;  3CTA A;  1P4W A;  4PSX A;  5HOO A;  4HRI A;  1MBF A;  2VBZ A;  4I0A A;  1RI7 A;  1UFM A;  2R7F A;  4RGR A;  1FPQ A;  3WTS C;  1ZQ3 P;  3KZZ A;  3K4K A;  4HAM A;  2QSH X;  2OTJ I;  2KPM A;  1IN4 A;  3GFM A;  4A0X A;  3KCC A;  2OZ6 A;  4ZZD A;  1SVL A;  3OYG A;  4I76 A;  2W82 A;  3HUG B;  4BH9 A;  1YFH A;  2WAQ A;  3GO5 A;  3I9V 2;  1OR7 A;  4I99 C;  2ZME B;  3FXM A;  3IL2 A;  4DBQ A;  5LHG A;  2BV6 A;  2CUF A;  1K78 B;  2BGC A;  2UV1 A;  1S7O A;  1BL0 A;  1B9M A;  4IRG A;  4D0P A;  1YJ9 I;  5BPI A;  3VYS B;  1QPM A;  2RNG A;  3I59 A;  4AIH A;  1SVM A;  2YSR A;  4Y33 A;  3K9T A;  5D5U B;  3A2K A;  2EIM H;  1QZY A;  5ICC A;  2MD0 A;  2KRC A;  1I5Z A;  4IEJ A;  3FHN A;  2LLK A;  5E1Z B;  1PUE E;  2JWT A;  2CH0 A;  2DO7 A;  2JK3 A;  3H0G J;  3FMS A;  5DDG A;  3HOW J;  3Q0U A;  3JRF A;  4UNO A;  3TOA A;  3FXL A;  4RAY A;  9ANT A;  1WJD A;  3BPX A;  3OV8 A;  1D5Y A;  3EUH C;  4F91 B;  2DN0 A;  3E1S A;  2EQR A;  3GF2 A;  2V4J C;  2OQG A;  3OR2 C;  1WQ2 A;  2V9K A;  3LSM A;  1OJL A;  1RNL A;  2IGK A;  3FKI J;  5L3C A;  1UG2 A;  4P5O A;  4L9J A;  5GAH J;  3ABM H;  2JPC A;  2MSY A;  3M4O J;  1RZ4 A;  1TC3 C;  1JUP A;  3WTX C;  5LLQ A;  2XPV A;  3Q0W A;  1K83 J;  1YE9 A;  2HKX A;  2BEO A;  4P9F A;  2KL4 A;  4WF2 A;  2K40 A;  5DYM A;  1BA5 A;  2YU3 A;  1G3T A;  1RES A;  3QU3 A;  4BQN A;  4NNJ A;  4MO7 A;  4LD5 A;  3OIQ A;  3HC7 A;  4CSW A;  3ERM A;  3RIR A;  1KQ8 A;  1OCT C;  1A35 A;  3B6C A;  5F1J A;  2EH3 A;  3HKZ A;  1E2X A;  4YIR X;  1DPR A;  4IRI A;  1KA8 A;  4XLP F;  3W2V A;  4FE4 A;  5EGO B;  3TED A;  1AKH A;  2XC7 A;  4BL0 B;  1LE8 A;  2IT0 A;  2DTZ A;  4ZC3 A;  4JBA A;  2BY3 A;  1ZYR F;  1FIA A;  1X1A A;  3QPS A;  5H6R A;  4B1R A;  4M6Y A;  2QSG X;  5IP9 J;  3J81 Z;  4WXD A;  2R7R A;  1J09 A;  4FCY A;  1F5T A;  2YX4 A;  5EZG A;  1ZTR A;  3K4N A;  5HVQ C;  3CCQ I;  1TT0 A;  1A6I A;  2BYV E;  4A3I J;  3H0D A;  1FIP A;  3DPU A;  2M0C A;  3C2B A;  1FMV A;  1V5G A;  3L2V A;  1LPQ A;  2P7V B;  4CCJ A;  3I54 A;  2L7M P;  3MQ0 A;  1U8R A;  2IS4 A;  2XVC A;  3OYJ A;  1EF4 A;  1XCB A;  3FXJ A;  3HJE A;  3HL2 A;  2KJC A;  2CJJ A;  4ZDP A;  2DI3 A;  3IUO A;  1OCZ H;  3E7L A;  4AUX A;  2L02 A;  1SC7 A;  3H5N A;  1VQP I;  5EG0 A;  3WTU C;  1Z0X A;  3I5U A;  3R0A A;  4XSX F;  3TW7 A;  3S1Q J;  2PFB A;  2PJP A;  5LFA A;  1ZAO A;  2M4K A;  3V8K A;  3GVA A;  2NVY J;  4C2T A;  3OL3 A;  2MH9 A;  5D4S A;  4AYB N;  5IOY A;  4QPQ A;  3ELK A;  4E7L A;  4HX8 A;  3QQA A;  3BQZ A;  3ZN1 A;  2HYJ A;  5LGN A;  1O3Q A;  3HHG A;  3W6V A;  2IEK A;  4HBL A;  3BOQ A;  3DKY A;  3V7C A;  2X48 A;  4A3C J;  1BN5 A;  2ZME A;  1GT0 C;  3I59 B;  1A31 A;  5D5W B;  2DMP A;  2VIX A;  1VI0 A;  4BHC A;  1LDK B;  1MKM A;  4BQA A;  1T6S A;  3RQ4 A;  1IN6 A;  3B73 A;  4RGS A;  5J1U A;  5J8F A;  1LKX A;  3GLL A;  4I98 B;  1BOA A;  4M6V A;  2K4J A;  1J7K A;  4BNC A;  3HOU J;  3KYL A;  5C3E J;  4LMY A;  5IT3 A;  1TQP A;  3BC8 A;  3BQY A;  3FXU A;  3VDX A;  1JKO C;  1WJ5 A;  3HPH A;  1X3Z B;  4I0B A;  3C2G A;  5FGM A;  2ISY A;  3S2W A;  3ZMT A;  3JSP A;  3VFZ A;  4E7J A;  1QGP A;  4XRF A;  2HNH A;  3F0C A;  2WC2 A;  3SJM A;  1FNN A;  3V8L A;  3BDD A;  3CMA I;  2CUE A;  1JJ8 C;  2HQ5 A;  3BR6 A;  2NOJ B;  2EV5 A;  5BQT A;  4HDV A;  2JA8 J;  1R5I D;  1N77 A;  2L4A A;  2DLL A;  2AS5 F;  2LTP A;  2WB1 N;  2JVH A;  2PX9 A;  3O8H A;  2OUM A;  4IKF A;  2ZXW H;  2L54 A;  1HXD A;  1LEA A;  2MBF A;  1Z3X A;  5E1X A;  1A36 A;  3F21 A;  3M7G A;  2UWM A;  1WH5 A;  3IAM 2;  5B66 C;  1SD5 A;  1MDM A;  1K7A A;  4HPQ A;  3JRI A;  2ZSI B;  2DK5 A;  2KFD A;  3K0L A;  5E3O A;  2FNA A;  5IYB J;  4EM0 B;  1G6N A;  4D7N A;  4HSR A;  3H92 A;  4LB5 A;  4DJA A;  5LHI A;  1OCP A;  1A6Q A;  2IS6 A;  4PGG A;  2XAU A;  2LK2 A;  1P4A A;  2LR8 A;  3A1Y A;  1VQL I;  3GME A;  1X3U A;  2VPL A;  2ECC A;  3CO7 C;  1V54 H;  2CWE A;  3CMM A;  1C0W A;  3DFG A;  2KKO A;  4N0B A;  2XF7 A;  2PLY A;  2JZY A;  3M1C A;  3D5R C;  2RQQ A;  2EBI A;  1JXS A;  2DMT A;  3JRD A;  4IQJ A;  2M0M A;  2VC0 A;  2MD5 A;  1R5G A;  2XGE A;  2JSC A;  3CP2 A;  2K86 A;  4LIU A;  1K61 A;  2ZNY A;  3E6B A;  4ZJZ A;  2QCO A;  4MLO A;  2EFW A;  5IP6 A;  1MJ9 A;  3PNY A;  5TRD A;  3P9K A;  3EUH A;  2W85 A;  2L7F P;  3GWZ A;  1IF1 A;  2ISZ A;  2QQB A;  4C2M J;  1T0F C;  4DYQ A;  3V4G A;  3PNV A;  5DTD A;  1H88 C;  3DTK A;  1PYV A;  1MDM B;  2GLO A;  2L7K A;  4LLN A;  3OOU A;  5K7Z A;  1F36 A;  1POG A;  5F0F A;  5HLI A;  5C4J J;  4V2F A;  1ZG3 A;  3FXK A;  2MLK A;  2NS8 A;  2R5Z B;  1SAN A;  1LFU P;  5E79 C;  4J01 A;  1LB2 A;  1D0Y A;  3MKW B;  1KQ9 A;  2MGQ A;  1YQA A;  4KUM A;  1G8X A;  4XOT A;  1Q1V A;  3UKG A;  1W4M A;  1LDD A;  3OSF A;  2XRL A;  4EJV A;  1F4K A;  3VOE A;  4L9V A;  1GV2 A;  1LDJ A;  5DCM A;  1MW7 A;  3QYE A;  4S0H B;  4X6A J;  1XGN A;  4RS8 A;  3TP0 A;  3LSR A;  3CDI A;  3M8E A;  2L9S A;  2R7O A;  2XKO A;  3VSL A;  1P2F A;  4C30 A;  2EIJ H;  3SQN A;  3H5A A;  4XLC A;  3WE3 A;  5TJJ A;  1D1C A;  2RC4 A;  3HTS B;  4GDF A;  4RB0 A;  1YW9 A;  3DLL F;  4A3F J;  2ESN A;  2KLO A;  2CW0 F;  3EQL F;  4RMN A;  2HQA A;  1GUU A;  1U5T A;  2VT2 A;  3W3C A;  4KIT B;  1J5Y A;  2DT7 B;  1K6O A;  5J1Y A;  1BBY A;  3DCF A;  2DXI A;  3RPU D;  2DOD A;  4UHT A;  3HG9 A;  1XB4 A;  3LA3 A;  4CYD A;  4XLN F;  1T56 A;  4BAY A;  2UXX A;  2YX7 A;  4C2U A;  3SZT A;  3K4M A;  4L18 B;  4UUV A;  2XIG A;  3V42 A;  5LHH A;  2H27 A;  1I6X A;  1G3W A;  2GWR A;  3U9G A;  1IDZ A;  2F6C A;  4M9S A;  1ZG5 A;  1W5C C;  2DA5 A;  2ACJ A;  1X4O A;  2VQH A;  3EET A;  3BLY A;  1AOY A;  3HSE A;  1ZRC A;  3JRH A;  2Z9O A;  1U5T B;  3OS1 A;  4D1Q A;  1QHG A;  2VXD A;  3G1L A;  4QIW N;  4EJU A;  2Q2E A;  2PBI A;  5CVV A;  2KIS A;  5DEQ A;  3NQO A;  1HLV A;  1JTX A;  2UZK A;  1MBE A;  3T1B A;  1UZC A;  2GOM A;  1UG0 A;  1SMT A;  2JRM A;  1UJ8 A;  4M3F A;  1KON A;  1BI3 A;  2EB7 A;  1PVE A;  1AA7 A;  1HW5 A;  4WK8 F;  2EA4 A;  3OYN A;  2EZH A;  1PUF A;  4O5V A;  4OMZ A;  1F9N A;  2V79 A;  2X9D A;  1TT5 B;  3KZI C;  1S7A A;  1G59 A;  3ZP5 A;  1FOK A;  5L3B A;  3IWF A;  3R6S A;  1MJB A;  4F7Z A;  1MBG A;  5JVT A;  3CP8 A;  1YHQ I;  2IGN A;  2LF8 A;  3DKX A;  4LB6 B;  1MBK A;  4V19 K;  3K6G A;  1GHC A;  3VOD A;  4IXA A;  1A04 A;  1BW6 A;  4LGW A;  5FB2 A;  3AG2 H;  1B9N A;  2XUB A;  3OYK A;  1I27 A;  2QBY A;  3K7A J;  3MVP A;  5DUK A;  2JMW A;  4J00 A;  3JAM K;  2WAD A;  2O8K A;  3KEY A;  3RKW A;  1XMX A;  2DMN A;  2QQ9 A;  3QU6 A;  2VJ5 A;  4G7H F;  3GTO J;  4PDK A;  3P9I A;  2JA6 J;  3M8J A;  3GFL A;  1NG7 A;  2HVQ A;  3RSN A;  1Z7L A;  2WAE A;  3S16 J;  1IC8 A;  4BDY A;  4LLL A;  1QBJ A;  1RC9 A;  4OIO F;  4BGD A;  2IXS A;  1KYZ A;  2LOO A;  2M4G A;  4E70 A;  1IO2 A;  2CQQ A;  3MCZ A;  2V9V A;  2VKE A;  2D2W A;  3JRC A;  4X1E A;  1T95 A;  2KQR A;  1K4T A;  1QHH D;  5HLH A;  5ICE A;  4XN3 A;  4A6D A;  2BHZ A;  5B1B H;  2XAF A;  4HF2 A;  1K6Y A;  5CQE A;  1F43 A;  2A6H F;  5CVU A;  1QQI A;  2VJI A;  2CS3 A;  4Y17 A;  4U7D A;  2N8G A;  1USS A;  2D5V A;  2VKD A;  2EIL H;  4GYI A;  2QF7 A;  4N4O B;  4ZTF A;  2Z99 A;  4CGZ A;  2R7S A;  3CD6 I;  3IAS 2;  2VJ4 A;  4UV9 A;  3ZGK A;  5E17 F;  3TMO A;  2Y30 A;  3JTG A;  1DPU A;  1DGR M;  1S5L C;  5H6Q A;  1I39 A;  4ZYA A;  2CG4 A;  3FZV A;  4B8X A;  3N97 A;  4BE1 A;  2OAZ A;  1RPW A;  3NWS A;  3WGG A;  2M5W A;  4C3H J;  3HOS A;  3HUG A;  2E7W A;  2QKM B;  3PQJ A;  1XG1 A;  1IXR C;  4QLC U;  3ZQF A;  4M9X A;  1T39 A;  4ON0 A;  4U7B A;  3G6E I;  4Q48 A;  2IP2 A;  3IKV A;  3OIP A;  3ZOB A;  1FOX A;  4NC8 A;  3Q5F A;  4L5I A;  3ZQH A;  5JI6 A;  2P6T A;  2BY2 A;  2O61 A;  2PJR B;  3MAJ A;  2NRA C;  4AID A;  1WKM A;  2KZG A;  3G1O A;  3COA C;  2X51 A;  2VB6 A;  5L3D A;  3LSI A;  3GZN B;  4ESB A;  4F55 A;  1ZLJ A;  3E0J B;  4FHT A;  3CF5 F;  3EPZ A;  1XCV A;  1BC7 C;  3PL8 A;  2ID3 A;  2QWW A;  1E17 A;  3DU6 A;  1F1Z A;  2GXG A;  3IRQ A;  1SFX A;  4FAS D;  5FJ8 J;  2M45 A;  2H8W A;  5BS6 A;  1ZEL A;  2RN7 A;  1YS6 A;  2OZU A;  4PFP A;  5GTH C;  2K3F A;  3IRR A;  2WB1 A;  4HOB A;  2OCE A;  4BS9 A;  3CF2 A;  3LSK A;  2X0L A;  5DM7 F;  3H3U A;  3MKL A;  4LOC A;  2A69 F;  4I6Z A;  4XSZ F;  2KIF A;  1APL C;  2EFP A;  4M3D A;  3L9F A;  3ZCO A;  3Q9V A;  2DT6 A;  4DW6 A;  5ED4 A;  1U9O A;  2K85 A;  4BXU A;  2F5F A;  4HST A;  1E3O C;  2X6Y A;  2JN6 A;  4I2O A;  1ON2 A;  1AU7 A;  4PJJ A;  5K1Y A;  3H35 A;  1IJW C;  3DBR B;  5KK1 A;  4XLF A;  4B48 A;  2ID6 A;  3K1M A;  3RYR A;  1L0O C;  1O57 A;  3C2H A;  3IC7 A;  2Z33 A;  2GXA A;  5GTI C;  2LMD A;  5J1R A;  2LVS A;  1NH3 A;  2UUZ A;  1U5T C;  2COB A;  5D8L B;  2L9V A;  2HTS A;  3H9G A;  4XN0 A;  1HKS A;  4LLG F;  4A3M J;  1R4M B;  2FMY A;  2ZBK A;  2D1V A;  2LDU A;  2QEN A;  3AKZ A;  2FD5 A;  2K27 A;  5C44 J;  2WV0 A;  4HQE A;  3BZC A;  1AKH B;  1U9N A;  2HPM A;  2DFI A;  3VSK A;  5E18 F;  1VQ9 I;  1ULY A;  3KP6 A;  4RLF A;  2KZV A;  3TOB A;  1RUO A;  4OWR B;  3P9C A;  4OIR F;  3F23 A;  2ICW G;  4EMS A;  3OY9 A;  2HWV A;  2VJJ A;  4OOI A;  2IS2 A;  3PO2 J;  2Y2Z A;  1Z91 A;  1TWG J;  3N05 A;  2OTL I;  3SDG A;  4CZC A;  3WGI A;  1BR1 A;  3BG3 A;  4DYR A;  2W25 A;  1B6A A;  3C7J A;  5HDN A;  1FX7 A;  4IOC F;  3E5U A;  3J7Z I;  3ZQI A;  5FLV A;  4B3A A;  1ORK A;  4EM1 A;  2K9Q A;  1FOW A;  1BW5 A;  4KIC A;  4CDG A;  3MKY B;  3WOD F;  1IXC A;  3FWE A;  3N4M A;  1GV5 A;  4B4C A;  1Y39 A;  2V1X A;  4KT6 A;  1XDU A;  5HS7 A;  2L2O A;  2H1K A;  1IV8 A;  3ZMU A;  1BIA A;  4ZDL A;  3F22 A;  4KDP A;  2RKH A;  3DTE A;  1DU0 A;  4CYC A;  1HKT A;  3CME I;  1R49 A;  3PO3 J;  3UNG C;  2ELK A;  5EEH A;  3LOC A;  2O8X A;  2H6C A;  1R9T J;  2WA0 A;  4LK0 F;  1H89 C;  5ICF A;  2EV6 A;  2VE8 A;  1WJA A;  1R58 A;  3HBL A;  1WI3 A;  3ZQC A;  1SD6 A;  3DXJ F;  3TDZ C;  3CJN A;  3WTY C;  4U88 A;  1X19 A;  2QVO A;  4DZP A;  1U6G A;  2XDV A;  3AL0 B;  3S3N A;  3QYB A;  5ILV A;  5F1R A;  3K4C A;  5TGT A;  3KP2 A;  5FFX A;  4DYC A;  4C3J J;  3IV5 A;  2OC6 A;  1E3H A;  1R7J A;  1GVD A;  2XAG A;  4KMU X;  4XKV A;  5A2Q K;  2HOT A;  5CYV A;  4WCG A;  3OYA A;  3LFU A;  3A01 B;  4BHB A;  1NHA A;  1VZ0 A;  2B9S A;  1Z7U A;  4HV6 A;  3MEX A;  5J3L A;  1RIO H;  2PI0 A;  2M30 A;  3ERE D;  3GTJ J;  2JUC A;  4XKC A;  3JR9 A;  4F92 B;  2DQL A;  2O9L A;  3K1P A;  5KHD A;  1TWH J;  3EDP A;  2CFX A;  2P5L C;  3TL4 X;  1I1G A;  4PFO A;  2HPI A;  2Q0O A;  1MMA A;  1BR2 A;  1XS9 A;  1O7L A;  2FBH A;  2H6B A;  2Z3Y A;  3MN2 A;  1X1C A;  3WTW C;  2DQR A;  4PJN A;  2AHQ A;  3RDI A;  2CUZ A;  5KAF C;  2LRE A;  4BYY A;  4J19 A;  3LSH A;  1FTT A;  4MNU A;  2DA4 A;  2E5Z A;  3H36 A;  5JLX A;  2JPB A;  2E34 A;  4BQO A;  2X6W A;  5GPC A;  4A0Y A;  1YI2 I;  4ZTJ A;  3RJP A;  2O5R A;  1FBQ A;  3WTT C;  2IGO A;  3A0H C;  4B3X A;  5GP9 A;  3T5X A;  1IV6 A;  2YR2 A;  1G4D A;  1JKQ C;  2BW3 A;  3K10 A;  2VE9 A;  2A05 A;  3DLA A;  1S9H A;  2XF6 A;  2XB5 A;  1YLF A;  1FSE A;  4KFC A;  1G2H A;  2AXT C;  2LY9 A;  1WZ2 A;  3OOP A;  3GEZ A;  4PUS A;  1Y0N A;  3BCB A;  2F4O B;  4CIC A;  1ETK A;  3D1N I;  5CVJ A;  5HDG A;  4IHX A;  3TQN A;  1BI2 A;  4R79 A;  1HOM A;  5ILU A;  3J80 K;  4D7M A;  2Z2S B;  2X1E A;  4QTR A;  4UV8 A;  1HCR A;  4WXC A;  2EFO A;  5FKM A;  5AIQ A;  1OLT A;  2Q2E B;  3ECO A;  3AFH A;  3JRA A;  1XSD A;  3DTI A;  3FK7 A;  2JJ7 A;  3VYR B;  2XV4 S;  2DYS H;  4BJT A;  1JGG A;  2NYX A;  1WRJ A;  1YW8 A;  1ZK8 A;  1WJB A;  4Z2Y A;  4ZDO A;  1D1B A;  2NAZ A;  2QKL B;  5JLW A;  1T2K A;  1OQY A;  1UHW A;  3Q0V A;  3CLQ A;  2GIV A;  2TCT A;  3BG9 A;  4L0Y B;  2CGP A;  2UXN A;  4G6Q A;  4IX7 A;  5LGU A;  3I4N J;  3QOE A;  4XL9 A;  3R4K A;  2X1C A;  2MH2 A;  5FO5 A;  4BHP A;  5DS9 A;  2P5K A;  1Y8R B;  2FML A;  3FX3 A;  3CC2 I;  2NVT J;  4XBF A;  2BY1 A;  3D5S C;  2NOG A;  4RAZ A;  5LGT A;  2L7Z A;  1SD4 A;  3MZH A;  4O6J A;  2V1N A;  3G2B A;  4O3M A;  5CKT A;  4P55 A;  2FX0 A;  3CC4 I;  1TZL A;  1H9T A;  5J4V A;  2P8T A;  1MNM C;  1PP7 U;  1REP C;  3T8R A;  2O3F A;  2PMZ N;  2JA7 J;  1BM9 A;  1FBU A;  4HLX A;  2LC2 A;  5GPA A;  4B43 A;  4FIS A;  2DA7 A;  4N9I A;  2L0K A;  4U87 A;  1PJR A;  2HZT A;  3MZ8 A;  3R61 A;  3S32 A;  3CCJ I;  4BBS J;  5K5O A;  3UR3 C;  4IL6 C;  2CW7 A;  1HST A;  1SAX A;  4HYE A;  3OYH A;  3JW4 A;  4Y13 A;  1W36 D;  3TKY A;  4B47 A;  3HPG A;  3DBL B;  1U78 A;  4UVC A;  2DDB A;  1OYI A;  2GIZ A;  2LBF A;  3PIO F;  1TWF J;  4HEA 2;  3ZN0 A;  2ZKZ A;  3HGG A;  1ETQ A;  4G12 A;  4GRI A;  4RM2 A;  1IW7 F;  2DTR A;  3J81 K;  1W7P D;  2R4G A;  1OYW A;  4FX0 A;  3L2Q A;  5M5Y J;  4GFB A;  4I02 A;  3C1D A;  4M71 A;  1ENH A;  1ZN2 A;  2DFE A;  2MFZ A;  5FRN A;  4A3E J;  3Q9S A;  4MQV A;  5FD6 A;  1XDS A;  3FDY A;  4UUS B;  2M8E A;  3K1N A;  1P92 A;  2HQN A;  2DW4 A;  2RV8 A;  3NWT A;  5GAG J;  5EEA A;  2QZ8 A;  3VYU B;  4W97 A;  2W84 A;  2BW3 B;  2QM3 A;  3BZK A;  3TO7 A;  2HQR A;  1UEL B;  3TO6 A;  1U3E M;  1JUM A;  2JSP A;  1JT6 A;  1ZRE A;  5E20 A;  2HR3 A;  1ZLK A;  4M74 A;  2LF7 A;  4KYW A;  5HLT A;  1Z6R A;  3QOD A;  1T98 A;  4AYB A;  4OIQ F;  2BVM A;  4KIB A;  4CCM A;  2K9L A;  4IHW A;  3C18 A;  4U0Y A;  4OU0 A;  4BAC A;  2FJ1 A;  4MTD A;  3O8G A;  1MH3 A;  1R36 A;  3KIO A;  1W5S A;  2QUF A;  3FIW A;  2E19 A;  4DNC A;  4EGZ A;  3DKW A;  2LP0 A;  4YFK F;  2GAU A;  3KFW X;  2NVX J;  2NVQ J;  2DOF A;  1J9I A;  4CZZ A;  2QA4 I;  1DP7 P;  1J2X A; 
#chains in the Genus database with same CATH homology
 3F8B A;  1OKR A;  3WU1 B;  3E6M A;  1MZB A;  3LFK A;  1B59 A;  1LNW A;  3W6J B;  3V7S A;  4IJA A;  1EV7 A;  3QAH A;  4U0W A;  1BI1 A;  3LQQ A;  4YG2 F;  2VT3 A;  5DD8 A;  4ETS A;  4R1H A;  1TQM A;  2HTJ A;  1R5H A;  4I01 A;  1W7P B;  4HF0 A;  1ZAR A;  2A07 F;  4EJO A;  2A3S A;  2H09 A;  3ZPL A;  3GX4 X;  3I4P A;  3O6B B;  1P4X A;  3E6D A;  2O03 A;  3F8C A;  4A5M A;  3WTZ A;  1IUY A;  4LFU A;  3J80 Z;  1TNT A;  1T38 A;  2D45 A;  2TDX A;  3QRF F;  2GA2 A;  1KU3 A;  4ESF A;  3KZY A;  5LEJ A;  2HYF A;  1I1S A;  4IRH A;  3LA2 A;  2PMU A;  3HRT A;  2GQQ A;  3VEP A;  1YO5 C;  1D8J A;  3E97 A;  1K78 A;  1IN8 A;  4KIF A;  3WGH A;  2GA1 A;  5A2Q Z;  1WSU A;  5E8G A;  2R3S A;  4FT8 A;  2CYY A;  1IN5 A;  3DQV C;  1UB9 A;  5ICG A;  2A5Y B;  2OBP A;  2HOE A;  4KNY A;  2HKO A;  3O2P E;  1ZRF A;  3LAP A;  5KVR A;  3IWZ A;  1D5V A;  3BP8 A;  4HZF A;  2K02 A;  1FSH A;  4JK1 X;  4H0E A;  2DK8 A;  3VB2 A;  3HYI A;  1RUN A;  2GZW A;  4HLY A;  3M8F A;  2VBY A;  2NNY A;  2LNB A;  4HDU A;  3BWG A;  3GYH X;  2PMH A;  3RI4 A;  4ESJ A;  2ETH A;  2ZCW A;  2XAQ A;  2VOP A;  5K5Q A;  2P5V A;  2ESH A;  2XAS A;  4L5J A;  4KMF A;  4IVN A;  4GO1 A;  3IHU A;  4EJT A;  2FF4 A;  2DT5 A;  4HW0 A;  1ON1 A;  4EQQ A;  5JHU A;  4CHU A;  5L3G A;  3DPT A;  1EH8 A;  1YIO A;  5AIP A;  4G94 A;  2FNP A;  4YFN F;  4M6X A;  2CSO A;  3O3K A;  3L00 A;  1R00 A;  1J59 A;  3MWM A;  2OD5 A;  4RB1 A;  1BJA A;  1KU9 A;  4LG0 B;  4L9N A;  4UVA A;  4ZYG A;  4WWC A;  2EWN A;  4IHS A;  2DPD A;  2OU2 A;  4HX7 A;  4G9Y A;  2FOK A;  3CLO A;  4ZYE A;  4OIN F;  4EM2 A;  5L3E A;  3LQR A;  4KIG A;  1FZP B;  1IAW A;  3KE2 A;  2Y0M A;  3FM3 A;  1ZG1 A;  4ZH4 F;  4FX4 A;  3R60 A;  1IN7 A;  1R1V A;  3ZQ7 A;  2JTV A;  4MQ9 F;  3PQK A;  3BZ6 A;  4P9U A;  3IKT A;  2NNN A;  1DUX C;  3JAM Z;  4ENM A;  1JHH A;  1GXP A;  1ZHF A;  1XMA A;  4N9H A;  4A2U A;  3FMQ A;  3T8T A;  2IPQ X;  3HTU A;  1FY7 A;  5HLG A;  4WX9 A;  3ZMV A;  2ZO4 A;  3CO6 C;  4EVI A;  5F6F A;  4L0Z B;  1P6R A;  4AIJ A;  3GXO A;  3SFZ A;  3G3Z A;  2EFQ A;  3F6V A;  5BOX A;  1XGS A;  5EEG A;  1Z1D A;  4LJZ F;  4MGR A;  2FQ3 A;  2DAO A;  3KEO A;  2QQA A;  5LEK A;  3F72 A;  4PZJ A;  3D0S A;  3ZMD A;  4ENJ A;  2COM A;  3JTH A;  2HDC A;  2RGV A;  2A61 A;  4LG0 A;  2VN2 A;  3L7W A;  4ENN A;  2Y75 A;  4RGX A;  2D1H A;  3HSR A;  3DF8 A;  2V1U A;  2VOO A;  5FLX K;  2NS0 A;  4S04 A;  3V7R A;  3GFI A;  4QWQ A;  4OIP F;  1OYY A;  1MJA A;  3KP5 A;  3DP7 A;  2BBY A;  1LVA A;  5AON A;  1H0M A;  3KLN A;  4Q4Z F;  5CJ9 A;  5ERI A;  4RB2 C;  5E8I A;  1J0R A;  1LJ9 A;  2XKP A;  3TO9 A;  3QOP A;  2IRF G;  5LRR A;  4A6E A;  3V8J A;  4ZYH A;  1XMK A;  3KEQ A;  1DDN A;  1B1B A;  1ODD A;  1ZGJ A;  4MEX F;  3KP4 A;  5DV5 A;  1S29 A;  5HS9 A;  1OPC A;  2FEZ A;  5H20 A;  2R7D A;  3FM5 A;  4AIK A;  1HW2 A;  2OA4 A;  1FWZ A;  3AAF A;  1S6L A;  2IVM A;  4HQM A;  2DBB A;  2P4W A;  1KYW A;  4MHG A;  4EGY A;  1TNS A;  1KQ0 A;  2ZJ2 A;  3E3V A;  4L9T A;  3F8M A;  1J75 A;  1TBX A;  1SFU A;  3ML6 A;  2L01 A;  3K69 A;  1ZRD A;  2L3D A;  4Q5S F;  2DPU A;  3R0J A;  1XSX A;  3QP5 A;  3JSO A;  4RGU A;  1Z05 A;  1XSV A;  2BE5 F;  1WWX A;  3U2R A;  2IA0 A;  3SHF A;  4NQW A;  3SZP A;  1Z6T A;  5FD5 A;  4R8H A;  1EH7 A;  2F5D A;  4PCQ A;  2V6C A;  5LRS A;  3NRV A;  1ZH5 A;  3GW2 A;  2FE3 A;  5J6X A;  4GGG A;  4GXO A;  3PFI A;  4YII A;  3T0Y A;  1W7P A;  1G3S A;  3FF5 A;  5DCF A;  4IHT A;  1XD7 A;  5D6F A;  4WXH A;  1FBS A;  2P6S A;  3F6O A;  3ULQ B;  2M87 A;  1T0F A;  3CUQ B;  3I71 A;  2E1C A;  1FT9 A;  1S8N A;  1HBX G;  3ROU A;  2IA2 A;  3BPV A;  5DD4 A;  2IW5 A;  4G6D A;  3NEU A;  2E1N A;  4EV0 A;  2CO5 A;  2DU9 A;  2STW A;  1IXS B;  2C6Y A;  4EJW A;  4G7O F;  2EA2 A;  3GZ6 A;  4A5N A;  1IRG A;  3H3Z A;  3I0T A;  1ZGA A;  4DQ2 A;  3WE2 A;  4LK1 F;  2O6G E;  3REO A;  2KIU A;  4YIF A;  2VXZ A;  2W24 A;  3ZMS A;  3RPQ A;  2G7H A;  2OQR A;  1OMI A;  1YG2 A;  3ZMZ A;  3F8F A;  3D5L A;  2VOD A;  1STZ A;  3L2C A;  2B0L A;  2Q8K A;  2J5O A;  2XHK A;  4NB5 A;  2ADU A;  2RVC A;  1V4R A;  3J7A O;  1JHF A;  1SFE A;  3CUQ C;  3EYY A;  6PAX A;  2KIM A;  1JGS A;  2ZFW A;  1R22 A;  3GLX A;  3K2Z A;  3RPU A;  2PG4 A;  3TGN A;  2FXA A;  4ZYD A;  2WWY A;  1B4A A;  3FMR A;  4CXF A;  2FBK A;  3EYI A;  3HSF A;  3BRO A;  4KA4 A;  4HF1 A;  5E1W A;  1MD0 A;  4KT5 C;  1PP8 F;  2F5E A;  1IRF A;  3HRM A;  3MZY A;  1LQ1 A;  4M73 A;  1AWC A;  2PN6 A;  4AD9 A;  5FFZ A;  1XGO A;  1FP2 A;  3I64 A;  3FHZ A;  5HDK A;  2K7L A;  5BMZ A;  3ISP A;  3QPT A;  1LEB A;  1TQI A;  1HSJ A;  1MGT A;  3C3W A;  4Y15 A;  2Y48 A;  1ONV A;  2EJR A;  2K4B A;  2P7C B;  3GZ5 A;  5DCM B;  1SMY F;  3HHH A;  2STT A;  3KP7 A;  1R1U A;  3QP6 A;  3LAJ A;  5DUI A;  2HFH A;  4K2E A;  4I09 A;  2JT1 A;  3BJ6 A;  4B09 A;  3DEU A;  3WTV C;  3M9A A;  3FXR A;  2JRT A;  2QLZ A;  3L09 A;  3QPH A;  4OMY A;  4TV7 A;  3HRS A;  1FYM A;  5L3F A;  2MC3 A;  3ECH A;  2MA3 A;  1HQC A;  3ABU A;  3DPL C;  1YTY A;  2ZXJ A;  5CLS A;  2VON A;  3MFK A;  1CGP A;  4YFX F;  2FA5 A;  1PDN C;  5D4R A;  2QBY B;  2FRH A;  1HW1 A;  4AVP A;  3SXY A;  2XGX A;  5FLX Z;  1FLI A;  2AXL A;  1GVJ A;  5JFR A;  4U0V A;  3CUQ A;  1K79 A;  3CDH A;  1YYV A;  2KRF A;  1V3F A;  2EV0 A;  2IA1 A;  4UXN A;  2HEO A;  1JE8 A;  4A0Z A;  1WI9 A;  1O3R A;  1TLH B;  2RQP A;  3BJA A;  1CF7 B;  2XRN A;  5F64 A;  2EFN A;  4RB3 C;  2XRO A;  4PGH A;  2FBI A;  4P96 A;  1S3J A;  5K5R A;  1QZZ A;  3I53 A;  4IPA A;  2VBW A;  5ILS A;  4M9Z A;  3HOT A;  2HS5 A;  5D8K B;  4MTE A;  1KU7 A;  3FXQ A;  1GXQ A;  1XN7 A;  5BPD A;  2Z5U A;  4S05 A;  3GFJ A;  1BIB A;  1KGS A;  3BY6 A;  2FSW A;  4M72 A;  3G73 A;  4GYG A;  4KN7 X;  1IZ1 A;  2XAH A;  5LBQ A;  3GUD A;  4HV5 A;  2F2E A;  3W6K B;  3LWF A;  2HYG D;  1XGM A;  3KLO A;  3TDU C;  1BI0 A;  1R23 A;  2GXB A;  4I7H A;  1R1T A;  2IJL A;  1Y0U A;  1QNT A;  4IF4 A;  2G7U A;  1TW2 A;  4A12 A;  2PQ8 A;  3KET A;  1VTN C;  2J5P A;  3ABT A;  1H9G A;  2PEX A;  2RDP A;  1U2W A;  3CUO A;  3F8N A;  5D5X B;  4AWX B;  2A6E F;  1Z9C A;  2ZNZ A;  3U1D A;  3LST A;  1G3Y A;  3RKX A;  3DV8 A;  3E5Q A;  2VBX A;  1O3S A;  2CQK A;  2HGC A;  3B02 A;  4HX4 A;  1L3L A;  2X4H A;  1FYK A;  2G9W A;  4CO8 A;  2KJB A;  3P7N A;  1UST A;  2FU4 A;  2O0Y A;  2E7X A;  1BC8 C;  2V1D A;  5IT9 K;  2F5C A;  3RYP A;  5IT9 Z;  1W5T A;  3LA7 A;  1FP1 D;  1FYL A;  3KP3 A;  1KU2 A;  3E6C C;  1CF7 A;  2VC1 A;  2W57 A;  3BJO A;  1FC3 A;  2EK5 A;  1QO0 D;  1UHM A;  4MEY F;  2YPR A;  4ENK A;  1TW3 A;  2XAJ A;  1YW7 A;  4G8X A;  3M1E A;  1D3Y A;  1TTY A;  1O7F A;  3HIF A;  2QYO A;  4ASN A;  2LKP A;  2L4M A;  2RNJ A;  3RTR A;  2A68 F;  4KN4 X;  4Q47 A;  4G7Z F;  5D5V B;  5D6E A;  1O3T A;  1EH6 A;  5CVR A;  3F3X A;  3HRU A;  2M1B A;  5JR3 A;  2ELH A;  3RKY A;  2LSO A;  1HKQ A;  2H94 A;  4JQF A;  3E5X A;  3WG9 A;  3I58 A;  4UVB A;  4GCV A;  1D8K A;  2MLG A;  4NHJ A;  1UCR A;  5CVI A;  5J8C A;  1SD7 A;  2WTE A;  4HA8 A;  3WU0 A;  5HS8 A;  1YS7 A;  1Q1H A;  4ZZL A;  3CTA A;  1P4W A;  5HOO A;  2VBZ A;  4I0A A;  1RI7 A;  1UFM A;  2R7F A;  4RGR A;  1FPQ A;  3WTS C;  3KZZ A;  4HAM A;  1IN4 A;  3GFM A;  4A0X A;  3KCC A;  2OZ6 A;  4ZZD A;  4BH9 A;  1YFH A;  3GO5 A;  1OR7 A;  3IL2 A;  2ZME B;  5LHG A;  2BV6 A;  1K78 B;  2BGC A;  1S7O A;  1B9M A;  4IRG A;  4D0P A;  5BPI A;  1QPM A;  3I59 A;  4AIH A;  2YSR A;  3K9T A;  5D5U B;  1QZY A;  5ICC A;  1I5Z A;  5E1Z B;  1PUE E;  2DO7 A;  3FMS A;  5DDG A;  4UNO A;  3TOA A;  4RAY A;  3BPX A;  3OV8 A;  3GF2 A;  2OQG A;  1WQ2 A;  1RNL A;  5L3C A;  4P5O A;  4L9J A;  2JPC A;  1RZ4 A;  3WTX C;  5LLQ A;  2HKX A;  2BEO A;  4P9F A;  4WF2 A;  5DYM A;  2YU3 A;  1G3T A;  3QU3 A;  4LD5 A;  3RIR A;  1KQ8 A;  1E2X A;  1DPR A;  4IRI A;  1KA8 A;  4XLP F;  2IT0 A;  4JBA A;  1ZYR F;  5H6R A;  4M6Y A;  3J81 Z;  4WXD A;  1F5T A;  2YX4 A;  5HVQ C;  2BYV E;  2P7V B;  3I54 A;  3MQ0 A;  1U8R A;  2XVC A;  1XCB A;  2KJC A;  2DI3 A;  2L02 A;  3WTU C;  3I5U A;  3R0A A;  4XSX F;  2PFB A;  2PJP A;  1ZAO A;  3V8K A;  3GVA A;  2MH9 A;  5D4S A;  3ELK A;  4HX8 A;  3ZN1 A;  5LGN A;  1O3Q A;  3HHG A;  4HBL A;  3BOQ A;  3V7C A;  1BN5 A;  2ZME A;  3I59 B;  5D5W B;  4BHC A;  1LDK B;  1MKM A;  4BQA A;  1T6S A;  1IN6 A;  3B73 A;  4RGS A;  5J8F A;  4I98 B;  1BOA A;  2K4J A;  1J7K A;  4BNC A;  4LMY A;  5IT3 A;  1TQP A;  3FXU A;  4I0B A;  5FGM A;  3S2W A;  3ZMT A;  2ISY A;  3JSP A;  3VFZ A;  1QGP A;  4XRF A;  2WC2 A;  1FNN A;  3V8L A;  3BDD A;  4HDV A;  2EV5 A;  5BQT A;  2L4A A;  2DLL A;  2AS5 F;  2L54 A;  1HXD A;  1LEA A;  2MBF A;  5E1X A;  3F21 A;  3M7G A;  2UWM A;  1SD5 A;  1MDM A;  1K7A A;  2DK5 A;  3K0L A;  2FNA A;  4EM0 B;  1G6N A;  3H92 A;  4LB5 A;  5LHI A;  4PGG A;  1P4A A;  1X3U A;  3CO7 C;  2CWE A;  1C0W A;  3DFG A;  2KKO A;  4N0B A;  2PLY A;  2JZY A;  1JXS A;  2VC0 A;  2MD5 A;  1R5G A;  2JSC A;  2K86 A;  2ZNY A;  3E6B A;  2EFW A;  1MJ9 A;  5TRD A;  3P9K A;  3EUH A;  2W85 A;  3GWZ A;  2ISZ A;  1IF1 A;  2QQB A;  3V4G A;  1MDM B;  4LLN A;  5HLI A;  1ZG3 A;  2MLK A;  1LB2 A;  1KQ9 A;  1YQA A;  4KUM A;  1W4M A;  1LDD A;  4EJV A;  1F4K A;  3VOE A;  4L9V A;  1LDJ A;  5DCM A;  1XGN A;  4RS8 A;  3M8E A;  2XKO A;  1P2F A;  3SQN A;  3WE3 A;  5TJJ A;  3HTS B;  2RC4 A;  4RB0 A;  1YW9 A;  2ESN A;  2CW0 F;  3EQL F;  1U5T A;  2VT2 A;  1J5Y A;  1K6O A;  1BBY A;  4UHT A;  1XB4 A;  3LA3 A;  4CYD A;  4XLN F;  4BAY A;  2UXX A;  2YX7 A;  3SZT A;  4L18 B;  4UUV A;  2XIG A;  5LHH A;  2H27 A;  1I6X A;  1G3W A;  2GWR A;  3U9G A;  4M9S A;  1ZG5 A;  2ACJ A;  3EET A;  1AOY A;  1ZRC A;  3HSE A;  2Z9O A;  1U5T B;  4EJU A;  2Q2E A;  2PBI A;  5CVV A;  5DEQ A;  3NQO A;  2UZK A;  3T1B A;  1SMT A;  1BI3 A;  2EB7 A;  1HW5 A;  4WK8 F;  2EA4 A;  4O5V A;  4OMZ A;  1F9N A;  2V79 A;  1S7A A;  3ZP5 A;  1FOK A;  5L3B A;  3IWF A;  3R6S A;  1MJB A;  4F7Z A;  5JVT A;  2LF8 A;  4LB6 B;  1GHC A;  3VOD A;  4IXA A;  1A04 A;  4LGW A;  5FB2 A;  1B9N A;  2XUB A;  1I27 A;  2QBY A;  5DUK A;  3JAM K;  3RKW A;  2QQ9 A;  3QU6 A;  4G7H F;  4PDK A;  3P9I A;  3GFL A;  4LLL A;  1QBJ A;  4OIO F;  1KYZ A;  4E70 A;  3MCZ A;  2V9V A;  2D2W A;  5HLH A;  5ICE A;  4A6D A;  4HF2 A;  2XAF A;  2A6H F;  5CVU A;  1QQI A;  4Y17 A;  4U7D A;  1USS A;  4GYI A;  2Z99 A;  4CGZ A;  4UV9 A;  5E17 F;  1DPU A;  3JTG A;  5H6Q A;  2CG4 A;  3FZV A;  4B8X A;  3N97 A;  2OAZ A;  3WGG A;  2M5W A;  3HOS A;  3HUG A;  2E7W A;  3PQJ A;  1IXR C;  4QLC U;  4M9X A;  1T39 A;  4ON0 A;  4U7B A;  4Q48 A;  2IP2 A;  3IKV A;  3Q5F A;  4L5I A;  5JI6 A;  2P6T A;  2O61 A;  3MAJ A;  2NRA C;  1WKM A;  3COA C;  5L3D A;  4ESB A;  1ZLJ A;  4FHT A;  1BC7 C;  1XCV A;  2QWW A;  1E17 A;  1F1Z A;  2GXG A;  3IRQ A;  1SFX A;  2M45 A;  5BS6 A;  2RN7 A;  1YS6 A;  2OZU A;  3IRR A;  4HOB A;  2X0L A;  3H3U A;  2A69 F;  4XSZ F;  2KIF A;  2EFP A;  3L9F A;  3Q9V A;  5ED4 A;  4BXU A;  2F5F A;  4I2O A;  1ON2 A;  5K1Y A;  5KK1 A;  3K1M A;  3RYR A;  1L0O C;  1O57 A;  3IC7 A;  2Z33 A;  1U5T C;  5D8L B;  2HTS A;  1HKS A;  4LLG F;  2FMY A;  2ZBK A;  2D1V A;  2LDU A;  2QEN A;  2K27 A;  4HQE A;  2WV0 A;  2DFI A;  5E18 F;  1ULY A;  3KP6 A;  3TOB A;  1RUO A;  4OIR F;  3P9C A;  3F23 A;  4EMS A;  2HWV A;  4OOI A;  1Z91 A;  3WGI A;  2W25 A;  1B6A A;  3C7J A;  5HDN A;  1FX7 A;  3E5U A;  4EM1 A;  4KIC A;  4CDG A;  3WOD F;  1IXC A;  3FWE A;  3N4M A;  2V1X A;  1XDU A;  5HS7 A;  3ZMU A;  1BIA A;  3F22 A;  4KDP A;  2RKH A;  1HKT A;  5EEH A;  2O8X A;  2H6C A;  4LK0 F;  5ICF A;  2EV6 A;  2VE8 A;  1R58 A;  1SD6 A;  3DXJ F;  3TDZ C;  3CJN A;  3WTY C;  4U88 A;  2QVO A;  1U6G A;  5ILV A;  5F1R A;  3KP2 A;  5FFX A;  1R7J A;  2XAG A;  4KMU X;  5A2Q K;  5CYV A;  4WCG A;  4BHB A;  1NHA A;  1Z7U A;  4HV6 A;  3MEX A;  1RIO H;  2PI0 A;  2M30 A;  3ERE D;  2DQL A;  3K1P A;  3EDP A;  2CFX A;  2P5L C;  1I1G A;  2Q0O A;  1O7L A;  2FBH A;  2H6B A;  2Z3Y A;  3WTW C;  2DQR A;  3RDI A;  4BYY A;  4MNU A;  2JPB A;  4A0Y A;  3RJP A;  1FBQ A;  3WTT C;  3T5X A;  2YR2 A;  1G4D A;  2VE9 A;  1YLF A;  1FSE A;  4KFC A;  3OOP A;  3GEZ A;  4CIC A;  5CVJ A;  5HDG A;  3TQN A;  1BI2 A;  4R79 A;  5ILU A;  3J80 K;  4UV8 A;  4WXC A;  2EFO A;  5AIQ A;  3ECO A;  1XSD A;  2XV4 S;  2NYX A;  1WRJ A;  1YW8 A;  4Z2Y A;  2NAZ A;  1T2K A;  1UHW A;  2GIV A;  4L0Y B;  2CGP A;  2UXN A;  4G6Q A;  5LGU A;  3R4K A;  2MH2 A;  5FO5 A;  4BHP A;  2P5K A;  2FML A;  3FX3 A;  4XBF A;  4RAZ A;  5LGT A;  1SD4 A;  3MZH A;  4O6J A;  4O3M A;  4P55 A;  1H9T A;  2P8T A;  1PP7 U;  1REP C;  3T8R A;  2O3F A;  1BM9 A;  1FBU A;  4HLX A;  4N9I A;  2HZT A;  3R61 A;  5K5O A;  1HST A;  1SAX A;  4HYE A;  3JW4 A;  4Y13 A;  3TKY A;  1U78 A;  4UVC A;  1OYI A;  3ZN0 A;  2ZKZ A;  3J81 K;  1IW7 F;  2DTR A;  1W7P D;  4FX0 A;  1OYW A;  4I02 A;  3C1D A;  4M71 A;  1ZN2 A;  3Q9S A;  4MQV A;  5FD6 A;  1XDS A;  2M8E A;  3K1N A;  1P92 A;  2HQN A;  2DW4 A;  2RV8 A;  2QZ8 A;  2W84 A;  2QM3 A;  3TO7 A;  2HQR A;  3TO6 A;  1U3E M;  1ZRE A;  5E20 A;  2HR3 A;  1ZLK A;  4M74 A;  2LF7 A;  4KYW A;  1Z6R A;  1T98 A;  4OIQ F;  4KIB A;  3C18 A;  4U0Y A;  4OU0 A;  4MTD A;  1R36 A;  1W5S A;  2QUF A;  4DNC A;  4EGZ A;  3DKW A;  4YFK F;  2GAU A;  3KFW X;  1J9I A;  4CZZ A;  1DP7 P;  1J2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...