5D4RA

Crystal structure of arar(dbd) in complex with operator ore1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
82
structure length
82
Chain Sequence
HLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Arabinose metabolism transcriptional repressor
publication title Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 22
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d4rA00
3QU6A 4M9XA 3GLXA 1UHWA 2YX7A 4IF4A 2DI3A 2R7DA 5CJ9A 3F22A 4YFNF 1O3QA 1FP1D 3HSEA 1J75A 1FBQA 4KN4X 3DPLC 3LWFA 2E7XA 1YLFA 1R1TA 4HBLA 3I53A 4ZZDA 5HDNA 1HKQA 2HGCA 2X4HA 1T98A 1U3EM 2KRFA 5F6FA 1T2KA 2CSOA 4FHTA 4PGGA 2ISZA 2E1NA 1YO5C 4UVCA 4OMZA 3T8RA 3TDUC 5BQTA 4AIJA 3ZN0A 3QAHA 1SAXA 1RIOH 1ZGAA 1YFHA 1NHAA 3VEPA 1TW3A 4EM1A 1ZG5A 4HF2A 2FBIA 3FXRA 4HYEA 2YU3A 2A61A 5D5WB 3LFKA 4I98B 3E5XA 2FEZA 3HRUA 3DF8A 3KP6A 3LA7A 4I02A 2A07F 3GWZA 1F1ZA 4KMFA 3HHHA 3K1NA 1USTA 3I59A 5ED4A 2FQ3A 4BXUA 2STTA 4XLPF 5LEJA 2KJCA 4CYDA 4M74A 5JVTA 2V1DA 4I09A 2HWVA 1WWXA 3KE2A 3C7JA 2HTJA 5FFZA 2OBPA 3ELKA 2ZNZA 3EQLF 1RUNA 3BP8A 4ZYGA 2ZO4A 2JRTA 3WODF 2V6CA 1BN5A 3F8BA 3K1PA 4S04A 5D6FA 3NRVA 2BE5F 5E20A 4XSXF 4JK1X 2FF4A 3KFWX 1I6XA 3NEUA 1XDSA 3CO7C 3CO6C 3FHZA 2M1BA 3ZMUA 3DPTA 4FT8A 1O3TA 2MLGA 4O5VA 3T0YA 2W25A 5H20A 1FYMA 5EEGA 2Z5UA 4ENMA 2Z99A 3N4MA 4EJVA 1REPC 1HSTA 2CYYA 1R22A 4G9YA 5L3DA 4I0BA 1DDNA 2ZFWA 2NAZA 2ADUA 3LQRA 1Z6TA 4HW0A 1ZRCA 1MJBA 2BYVE 2EV6A 2O6GE 5LHHA 4NB5A 5JFRA 3K1MA 3BY6A 1TBXA 3GZ6A 3WTVC 4KIGA 3WGGA 4Q48A 1P4XA 5DUIA 2QUFA 2QZ8A 2MH2A 2W84A 1MDMA 1B59A 3F8NA 5L3FA 3H3UA 3U1DA 3RDIA 1F5TA 1TW2A 2XKOA 2P6SA 2CG4A 5HDGA 3QRFF 4UNOA 3SHFA 3MFKA 1ZG3A 5J8CA 4M9SA 4A12A 3QPHA 1PDNC 5K5QA 3WG9A 2C6YA 2FSWA 2LDUA 3U9GA 2KIFA 3ZMDA 5ICFA 3BOQA 4UUVA 3RPUA 2Z33A 1ZARA 3I58A 2HDCA 1TNSA 4HQMA 5L3GA 2EB7A 3P9IA 4EVIA 4RAYA 1UCRA 2K27A 2H94A 1MGTA 3FMSA 1SD4A 3C18A 4ZYHA 3J80Z 4H0EA 4HAMA 4IRGA 3O6BB 3E6CC 1OMIA 3WE3A 3IL2A 1LDKB 3TO9A 1KQ0A 2NNYA 3W6JB 1SFUA 2PLYA 3J80K 1TQIA 1UHMA 4EM2A 4LB5A 5IT9K 4EJTA 2A68F 2WV0A 1LVAA 1T6SA 2K4JA 2VXZA 4AVPA 2JT1A 1T38A 1OR7A 2NYXA 2JSCA 2LF8A 3LA2A 1ONVA 1K7AA 1O57A 2FU4A 2QYOA 2ETHA 1U8RA 1SFXA 2FNAA 5D4SA 2RDPA 1KU2A 4HV6A 4L9NA 3F21A 5H6RA 2UXXA 1XGSA 2CO5A 3KP7A 4BHPA 5LGNA 1IXCA 1G3TA 4CO8A 3WTWC 4WXDA 5D8LB 3H92A 2MBFA 2HYGD 3QPTA 1K79A 2KIUA 2E7WA 2MA3A 2V1XA 3TDZC 3DKWA 5BPIA 4OINF 3KP3A 2GWRA 4RS8A 2OQGA 3SZPA 4O3MA 4QLCU 3HUGA 1I27A 2PMHA 2XVCA 2Q0OA 1KQ8A 2IT0A 3HIFA 3GYHX 2FE3A 4ENKA 4XRFA 1R1UA 4N9HA 4YG2F 4AWXB 2P5VA 3LQQA 3TO7A 2L02A 2VBWA 4KA4A 3FZVA 5DD8A 2K02A 3KLNA 2TDXA 4L9TA 4EGYA 2EFNA 2MH9A 2MLKA 2XAFA 5DUKA 3C3WA 3ZQ7A 2VOPA 4WCGA 3TGNA 5L3BA 3ULQB 3E97A 5DCMB 1XSDA 3FMRA 1PUEE 4G94A 1Q1HA 4ZYEA 2FBKA 2QWWA 5HLHA 5LHGA 4ZH4F 5CVJA 3JTHA 1AWCA 1IRFA 1MZBA 1UB9A 5FB2A 2M30A 4M72A 2NNNA 1FWZA 3V7RA 2WWYA 4LG0B 1IN5A 1P92A 1ODDA 3HRSA 4RGUA 3J81Z 2OZUA 1H9TA 4AIKA 4HX8A 3AAFA 3WTZA 2EV0A 4GGGA 3WU0A 3K69A 1R58A 3J81K 1I1SA 1Z6RA 1IN7A 3OV8A 3JW4A 5LBQA 3P9CA 5DDGA 6PAXA 1HQCA 4XBFA 4RGRA 1FBUA 1FBSA 3RYPA 4BQAA 2ESHA 4QWQA 2IA0A 4RB1A 2MD5A 4MTEA 5LRSA 3CUQB 4GXOA 5D8KB 2EFPA 2HKXA 2RN7A 4HDVA 1S29A 4EJWA 3FM5A 4KIBA 4A0XA 2HFHA 3G3ZA 1QQIA 5HS8A 4OIQF 2EWNA 4ENJA 1XGMA 2STWA 1B6AA 3TKYA 4DQ2A 3R61A 1AOYA 3GX4X 3WTYC 1ZRFA 1LEAA 1XB4A 2HTSA 1FYKA 1B9MA 2EV5A 2NS0A 2H27A 3R0AA 4KFCA 4WWCA 4WF2A 5KVRA 1BBYA 2YX4A 4G7ZF 1U2WA 2FNPA 1HXDA 1B1BA 4U7BA 1FT9A 5D5XB 1USSA 4JQFA 2CFXA 2PQ8A 4L5IA 3GFIA 2X0LA 1EH7A 3KETA 2GA2A 2FOKA 5FLXK 5E8IA 4XSZF 4MEXF 1BI3A 3EYIA 1W7PB 3ZN1A 4U0VA 2QVOA 1VTNC 4HA8A 1ZH5A 1TQMA 1H0MA 4BAYA 3WGIA 1QPMA 1QZZA 1Z91A 5AIPA 1R36A 3QU3A 2DTRA 1R1VA 1P4AA 2YPRA 1XCBA 3U2RA 2OA4A 4LFUA 3K0LA 2DAOA 2RVCA 3V8KA 5HS7A 4F7ZA 3SXYA 1HW5A 2GIVA 5ILUA 1XCVA 5ICGA 1FPQA 2LKPA 2QBYA 2VC1A 1X3UA 2G7HA 2IP2A 2ZCWA 2HQNA 3DXJF 4R8HA 4PGHA 1R23A 2VC0A 3PFIA 5CVVA 2FA5A 4MEYF 3V4GA 1P6RA 2FMLA 3OOPA 1YYVA 4ESJA 4YIIA 5DCMA 3BJAA 2FRHA 4HF1A 4P9FA 1IN8A 4BNCA 2YR2A 2P7CB 3BDDA 3BZ6A 1YS6A 3BJ6A 5CVRA 3IRQA 4KIFA 4WXCA 5CVIA 2QQ9A 3E6DA 5ERIA 3WU1B 1D5VA 4L18B 2GAUA 1O7LA 4A0YA 4KYWA 3MEXA 2LNBA 1WKMA 1A04A 3MZYA 1EH8A 3V8LA 2DPDA 4LGWA 2PMUA 1LDJA 4RB3C 4CDGA 2FBHA 1TNTA 3M8FA 1IAWA 4MHGA 1TQPA 4A0ZA 1U5TA 3RTRA 1Z7UA 3DP7A 1WI9A 2VBYA 3T8TA 1U5TC 1UFMA 5D5VB 2F5DA 1BIBA 1QGPA 3QP5A 4LJZF 3CUQA 2PEXA 3HHGA 4BYYA 4OU0A 1KQ9A 3CUQC 3P9KA 5CYVA 3E6MA 2DPUA 3FXQA 1FX7A 3V7SA 5ICCA 1XD7A 5TJJA 1CF7B 1I5ZA 1DPUA 2VOOA 2VT3A 4BHBA 1BI0A 3F6VA 2D1HA 4D0PA 3RI4A 4P9UA 4EMSA 3MAJA 3L2CA 1JGSA 2Y48A 5E8GA 1H9GA 1LJ9A 2RC4A 2P5LC 1FLIA 1GXPA 2H09A 2ZBKA 3ZMSA 4HDUA 1PP7U 3FM3A 4OMYA 1J5YA 1ON1A 1W7PD 1ZYRF 1R00A 3FF5A 4S05A 2KIMA 5H6QA 5FGMA 1BI1A 2VBZA 3L09A 3IKVA 3M9AA 1W7PA 2EFQA 4I2OA 4L5JA 2CW0F 4EQQA 3DFGA 5IT9Z 2W85A 2JPBA 1IUYA 1J7KA 3F3XA 2Q8KA 2VODA 1IN6A 1KU3A 1B9NA 5E1WA 2HEOA 1GVJA 4KN7X 1J9IA 1SFEA 4L0YB 5JHUA 2XRNA 4LB6B 3TOAA 4HF0A 3DEUA 4I01A 3R6SA 5BMZA 3HOTA 1LNWA 1F9NA 2DT5A 4A5NA 2XAHA 3F8MA 3WTTC 1QZYA 1ZLKA 3PQKA 4HZFA 3I4PA 1ZAOA 1XSXA 1G3WA 1SD6A 1YW8A 3EDPA 4GCVA 2OQRA 2L54A 1FNNA 2HYFA 1HW1A 3JTGA 3QOPA 4L9JA 1BIAA 1G3SA 4G6QA 3HSFA 4YFXF 2W57A 1E2XA 4CGZA 1LEBA 3LAPA 4KICA 2F5CA 4HX4A 4RGXA 4IRHA 2EA4A 2DK8A 4AIHA 3E5QA 2V79A 5E1ZB 1J2XA 5BS6A 4MQ9F 3R4KA 5D4RA 2A3SA 2Y0MA 1DP7P 4KMUX 2L3DA 2CWEA 5J8FA 2VE8A 5K5OA 2HS5A 3KP5A 2ZKZA 4LLGF 4HOBA 3SQNA 1FSHA 1SD7A 2VT2A 2IA2A 4JBAA 4PZJA 5L3CA 3RYRA 3T1BA 1D8KA 1QO0D 1Y0UA 4YIFA 2AXLA 1FZPB 2OD5A 3BROA 2HZTA 3REOA 2HOEA 1MJAA 1SMTA 5E1XA 4MTDA 3ROUA 1I1GA 3HRTA 3I59B 3EYYA 2JZYA 3F6OA 2XGXA 2ESNA 4RB2C 4IXAA 4LLNA 2ISYA 1IRGA 4FX0A 3I71A 5F64A 2GQQA 3GXOA 2P7VB 1K78B 3GFMA 5CVUA 5FO5A 1O3RA 4OIPF 3IC7A 1KYWA 4IVNA 3FMQA 4KUMA 1RUOA 2L4MA 3RIRA 1T0FA 2A6HF 3KEQA 1Z9CA 5K1YA 1BI2A 1J59A 1OKRA 2G9WA 3I0TA 2DO7A 2Y75A 1YW9A 2R7FA 1FSEA 2M45A 3WTSC 5CLSA 1U6GA 3GEZA 4Z2YA 1XSVA 5ICEA 2BEOA 3ABTA 3Q5FA 2VBXA 1R5GA 3ZPLA 3K2ZA 3P7NA 2O0YA 3LSTA 3WTUC 2LSOA 4K2EA 2XV4S 2ZMEB 3E3VA 3KP2A 2UZKA 2EJRA 4LK1F 4P5OA 1MJ9A 3BPXA 1D3YA 4EM0B 1ULYA 2W24A 4UVBA 2EA2A 5DEQA 2J5PA 1U78A 4PDKA 4UHTA 5LLQA 1E17A 2BBYA 3TQNA 2V9VA 3GFLA 2EK5A 1G4DA 1TLHB 1KGSA 2XROA 4I0AA 3GO5A 3MZHA 3RPQA 2VE9A 5FLXZ 2R3SA 1PP8F 2JTVA 2O03A 1ZREA 4ENNA 1G6NA 3RKXA 4IPAA 4Y15A 5LEKA 2DK5A 5KK1A 1YW7A 5DD4A 3F23A 2GXGA 2D45A 1ZLJA 2XAGA 1XGNA 4A2UA 2AS5F 5E18F 1MD0A 3GUDA 1L3LA 3J7AO 3NQOA 4M6XA 3HOSA 1STZA 4N9IA 5TRDA 1HSJA 3GFJA 2P5KA 2L01A 4HV5A 3IWZA 3QP6A 3IKTA 2RGVA 1O3SA 3D5LA 4CICA 1FYLA 4P55A 1OPCA 5DCFA 3KCCA 3ZP5A 4A6DA 2DLLA 2IJLA 1FY7A 2OAZA 3LA3A 2XASA 4B09A 2RNJA 2DQRA 3TOBA 5HLIA 2QQAA 2P4WA 2K86A 4KDPA 1Z1DA 1T39A 4M73A 2IVMA 1KA8A 5A2QZ 4YFKF 2A69F 3DQVC 3R60A 2RV8A 3RKYA 2KKOA 2A5YB 4O6JA 3SFZA 4RGSA 2BV6A 4MGRA 2ACJA 1XDUA 5A2QK 4P96A 1YTYA 3MWMA 2GA1A 3M1EA 2BGCA 1YIOA 3VODA 1SMYF 5LGTA 3HTUA 4E70A 1K78A 5D5UB 4U0WA 3TO6A 2RKHA 4GO1A 4MNUA 4A6EA 1W5TA 1LB2A 3HYIA 4WX9A 5LGUA 1BC7C 4ON0A 1W4MA 4LG0A 3ECOA 1HBXG 5AONA 4LLLA 3HRMA 3KZZA 1R5HA 1BC8C 2XKPA 1RI7A 3ZMZA 1LDDA 3LAJA 3F8FA 4LK0F 2V1UA 2IA1A 4Q5SF 2GZWA 3BPVA 4N0BA 2DU9A 4ESBA 3WTXC 4AD9A 1IF1A 2PFBA 2VN2A 1IXSB 3KLOA 1DPRA 4I7HA 3O2PE 3V8JA 5HDKA 2FMYA 4BHCA 2B0LA 3V7CA 5JR3A 2QQBA 3K9TA 1QNTA 4EJUA 2HR3A 5FD6A 2G7UA 2PBIA 2OZ6A 4OOIA 1ZRDA 2ZMEA 1MKMA 2FXAA 4WXHA 4IHTA 5K5RA 4M6YA 4KT5C 3DV8A 3R0JA 1Z05A 1ZG1A 3IRRA 2ZXJA 2VONA 1IXRC 3G73A 1L0OC 5HLGA 3IWFA 4ETSA 5JI6A 5FD5A 4NHJA 3I64A 1JXSA 1ZGJA 1OYWA 2MC3A 5BOXA 1XGOA 2P8TA 1JHFA 1RZ4A 3W6KB 4ASNA 4EGZA 3B73A 3JSOA 2Z9OA 4Y17A 1YS7A 3M8EA 4UV8A 3H3ZA 1ZN2A 5ILVA 1OYYA 3ZMVA 5AIQA 2DFIA 4GYIA 2PJPA 5E17F 2PG4A 4WK8F 5HVQC 1YQAA 4NQWA 2IRFG 3ISPA 2F5EA 1S7AA 2DW4A 4LD5A 2HKOA 3D0SA 3KEOA 3CJNA 2O8XA 5L3EA 3EUHA 3GF2A 3ECHA 1WQ2A 1K6OA 4UXNA 4KNYA 5BPDA 3MCZA 4CHUA 1HKSA 1G3YA 2WTEA 3RKWA 1IW7F 3L9FA 2CQKA 3L7WA 1XMAA 4G6DA 4U7DA 2YSRA 1XN7A 5DV5A 3VFZA 3T5XA 1JE8A 2ELHA 3F8CA 5J6XA 2ZNYA 4ESFA 4LMYA 4OIRF 4RB0A 1RNLA 4MQVA 3CTAA 1BM9A 3F72A 4TV7A 4CXFA 4R1HA 2IPQX 4L0ZB 2JPCA 1ON2A 4XLNF 3ABUA 2E1CA 1IN4A 2F5FA 4G8XA 1S8NA 2H6BA 1S6LA 5IT3A 3FWEA 4Q47A 1CGPA 3HSRA 1FC3A 1FP2A 1F4KA 1C0WA 2EFOA 4U88A 4A5MA 5F1RA 2DQLA 5FFXA 4DNCA 3CUOA 3SZTA 2CGPA 2UXNA 2K4BA 3CDHA 1P4WA 3VB2A 1S3JA 3HTSB 4BH9A 3KZYA 4HLXA 1XMKA 3WE2A 2KJBA 1B4AA 3JAMZ 3L00A 2F2EA 3N97A 2QM3A 4PCQA 3FXUA 1QBJA 4FX4A 3JAMK 4GYGA 3FX3A 3KP4A 2H6CA 3COAC 2DBBA 4UV9A 1SD5A 2UWMA 4L9VA 1V4RA 2GXBA 3I54A 4IJAA 1DUXC 4G7OF 2XAJA 4ZYDA 2OU2A 2COMA 3EETA 4Y13A 2A6EF 2M5WA 2ZJ2A 1P2FA 3RJPA 1BOAA 3ZMTA 5ILSA 4IHSA 2XHKA 2Q2EA 1KYZA 4HLYA 1D8JA 2HQRA 2QBYB 4HQEA 1CF7A 3BJOA 2NRAC 4Q4ZF 2XUBA 3PQJA 4IRIA 2M8EA 2K7LA 1HW2A 3MQ0A 2D1VA 1OYIA 2Z3YA 3GW2A 2J5OA 1O7FA 3CLOA 5DYMA 2QLZA 1WRJA 3I5UA 5LHIA 3C1DA 4U0YA 4CZZA 4M9ZA 3E5UA 1EH6A 2RQPA 3B02A 1W5SA 3ERED 3VOEA 2PN6A 1TTYA 4OIOF 2O61A 1EV7A 1V3FA 3ML6A 4RAZA 1HKTA 4UVAA 3GVAA 1KU7A 5D6EA 3JSPA 2M87A 1LQ1A 2IW5A 4EJOA 3M7GA 1ZHFA 1BJAA 1R7JA 4B8XA 1J0RA 3GZ5A 4HX7A 4M71A 1GHCA 2EFWA 5LRRA 5HOOA 3E6BA 1YG2A 2D2WA 2P6TA 1GXQA 1JHHA 4EV0A 1WSUA 2L4AA 3Q9VA 4G7HF 3IHUA 3Q9SA 2PI0A 1IZ1A 5HS9A 1KU9A 1S7OA 3S2WA 4R79A 2XIGA 4ZZLA 2XAQA 1U5TB 3O3KA 2O3FA 2QENA 3BWGA 1FOKA 2WC2A 1MDMB 5EEHA 2LF7A 3WGHA
chains in the Genus database with same CATH superfamily
3QU6A 4M9XA 2VKDA 3GLXA 1YJNI 1UHWA 4HG2A 4C2MJ 1U8BA 2L9SA 4E7HA 2YX7A 4N4NB 1R5ID 4YELA 4IF4A 4EEFG 1ZK8A 2DI3A 2MFZA 1H88C 4XR6A 2R7DA 3AG3H 5CJ9A 3F22A 1I3QJ 1W0UA 4YFNF 1O3QA 2BOLA 5EGOA 1FP1D 3HSEA 3NARA 1J75A 1FBQA 1QA6A 2BHZA 3OL3A 4KN4X 3O8HA 3DPLC 3JRDA 2IAIA 2ZJQF 3LWFA 3CZ6A 3W3CA 2E7XA 1RKTA 1YLFA 1R1TA 2V1NA 2XF7A 2WB1A 3CDIA 4HBLA 3I53A 1MW7A 4ZZDA 3GTMJ 4FE4A 3OIOA 5HDNA 3W2VA 1HKQA 2HGCA 2X4HA 1T98A 3CLQA 1U3EM 2STTA 4MIMA 2KRFA 3P5JA 4KISA 5F6FA 1T2KA 2CSOA 4FHTA 4PGGA 4JX5A 1XPXA 1YRNA 2ISZA 4CH7A 2R7ZJ 3HL2A 3ERMA 2E1NA 1YO5C 4UVCA 3QYBA 4OMZA 3T8RA 2ELJA 4XK4A 5J40A 1FTZA 3IAM2 1TL8A 2ID3A 1WJ5A 3TDUC 5FRNA 5BQTA 3O8GA 4XKCA 4LOCA 3FHNA 1W5CC 4JOMA 2F4IA 2W48A 4AIJA 3ZN0A 3QAHA 1SAXA 1RIOH 3BR0A 1ZGAA 1YFHA 1NHAA 3VEPA 1TW3A 3CF2A 2I10A 2ECCA 2KHMA 3OMYA 4EM1A 1ZG5A 5IP9J 4HF2A 2FBIA 1SVLA 2E1MB 3FXRA 4PJLA 4HYEA 2YU3A 4PFOA 1SC7A 2A61A 5D5WB 4IX7A 1WJDA 1S5LC 1NG6A 3LFKA 2KZGA 4I98B 4B43A 3E5XA 1JI8A 3FXMA 2FEZA 3HRUA 3DF8A 1IV6A 3KP6A 3LA7A 4I02A 2A07F 3VSLA 1QVUA 1BA5A 3GWZA 1F1ZA 1XMXA 4KMFA 3HHHA 1UG0A 3K1NA 1K4TA 1USTA 3I59A 2BY2A 1X1DA 2VB6A 4UUTA 2FQ3A 2ME6A 4BXUA 5ED4A 3OSFA 5IYCJ 4CCKA 1JTXA 5LEJA 4XLPF 2KJCA 1YIJI 2O5RA 4CYDA 2IS4A 5GAHJ 4M74A 3S32A 2XGEA 5JVTA 2V1DA 2FX0A 4CA0A 3CCSI 3W6VA 4I09A 2HWVA 1WWXA 3KE2A 2JRMA 1E3OC 3BZCA 3C7JA 3K4NA 4DBQA 4XORA 2HTJA 4MFEA 3GTPJ 5KCMA 5FFZA 2R5ZA 2OBPA 2E34A 2IEKA 3ELKA 2ZNZA 2DT6A 3EQLF 3BP8A 4ZYGA 1RUNA 2NVTJ 3PNVA 2ZO4A 2JRTA 3WODF 2V6CA 2IGNA 2VJIA 1BR1A 4RDUA 1Y0NA 2ZB9A 1RRJA 4UY8I 3L2WA 1BN5A 2VASA 2A05A 3F8BA 1TWAJ 3K1PA 1ACIA 4S04A 5D6FA 4A3BJ 5E3OA 2RQQA 2BE5F 3NRVA 4XSXF 1V55H 5E20A 4XQFA 2VJ4A 2FUG2 3VDXA 1MNDA 4JK1X 4BKXA 1VQ9I 2FF4A 3KFWX 5B66C 1I6XA 3NEUA 1XDSA 3CO7C 3CO6C 2X1DA 4E6KG 3FHZA 2M1BA 3ZMUA 3DPTA 1JJ6C 4FT8A 1VQ6I 1O3TA 1I6HJ 3BG3A 3LSMA 2MLGA 4O5VA 3T0YA 4IOCF 2W25A 3SDBA 5H20A 2M7BA 1FYMA 5EEGA 2Z5UA 1IGNA 4OAYA 4ENMA 2Z99A 3N4MA 4EJVA 4MFDA 3BR5A 1REPC 1HSTA 2CMPA 3CJQB 1X19A 4BXXJ 2CYYA 1R22A 1VQLI 1D1AA 2DN0A 2B9SA 1BR4A 2O7OA 3I4NJ 4BEHB 4G9YA 5L3DA 4I0BA 1DDNA 3HUGB 3HXLA 2ZFWA 3CD6I 1ZQ3P 2L7MP 2NAZA 2ADUA 2PMZN 1LFBA 3BC8A 3LQRA 1Z6TA 4HW0A 2HPIA 1ZRCA 1YX3A 1MJBA 1K61A 3AL0B 2BYVE 2EV6A 1LKXA 1TT0A 4J19A 2QKMB 3KEYA 2GLOA 1Y1WJ 2O6GE 4KT6A 5LHHA 4NB5A 5JFRA 3K1MA 3BY6A 1TBXA 4A3KJ 1FEXA 2NS8A 1GDTA 3GZ6A 2JVHA 3WTVC 4KIGA 1WGXA 1OCRH 3WGGA 4BBSJ 4Q48A 3LL7A 1P4XA 3OY9A 4DIQA 5DUIA 2QUFA 2QZ8A 3M4OJ 2L0KA 4PJ0C 2MH2A 4KJZA 5BNGA 2EINH 2W84A 2WY8Q 1ERDA 1MDMA 3VYTB 4BDZA 2G0EA 1B59A 3ZQGA 3GTKJ 3F8NA 5L3FA 3H3UA 3U1DA 3RDIA 5F0HA 1TWHJ 1F5TA 4B3XA 1VQKI 1TW2A 1MBHA 2XKOA 2P6SA 2CG4A 5HDGA 3QRFF 4UNOA 4RLFA 3SHFA 1V5FA 3MFKA 2VL8A 1POGA 5E3LA 1EKEA 1ZG3A 5J8CA 3K10A 2LLKA 3FIWA 4M9SA 1Y8RB 4RLQA 5CQGA 4A12A 3QPHA 3QYEA 1PDNC 2NVQJ 1ZR2A 4C2UA 3ZR8X 1GV5A 5GPAA 5K5QA 2HQ5A 3S16J 4IOAF 2HDWA 3L1PA 1VQ5I 3WG9A 3L2UA 3DBRB 2C6YA 2BZTA 2FSWA 2KL4A 4A3JJ 2I5UA 2LDUA 3U9GA 2JA7J 2WV1A 4XLHA 2KIFA 3ZMDA 5ICFA 3BOQA 1ORKA 4UUVA 1TP4A 3RPUA 1P7JA 4E7JA 3KX2A 2Z33A 1ZARA 3I58A 4BUPA 2HDCA 4XNFA 4IQJA 1TNSA 3CCYA 4W1UA 2XPWA 3K4BA 2JN6A 1PJRA 2KDOA 1ENHA 5C4JJ 2HOAA 4HQMA 2BVMA 5L3GA 3BG6A 2CQQA 1N78A 1G59A 4V2GA 2EB7A 3P9IA 4EVIA 2DT7B 1F36A 3LOCA 1VFCA 1EJ9A 4AVZA 4RAYA 2NVUB 2LK2A 3ZXSA 1UCRA 2K27A 1LFUP 2DOFA 2H94A 3HBLA 3PO3J 2OCEA 2OCCH 1R4MB 1XX5A 4D7MA 1MGTA 3FMSA 1QHGA 1SD4A 3C18A 4ZYHA 3J80Z 4H0EA 2CW8A 4HAMA 4IRGA 3O6BB 4A3LJ 3E6CC 1OMIA 2EZHA 3WE3A 3IL2A 3DBLB 1LDKB 3OYEA 2V26A 3TO9A 4M3FA 3I55I 2A6TA 1KQ0A 3K7AJ 2NNYA 3W6JB 4PJMA 1SFUA 4IHYA 2R7RA 2PLYA 2GIZA 3J80K 1TQIA 2HI3A 1UHMA 2K3PA 3OYLA 3ZQLA 3RQ4A 2M8GX 4EM2A 4ZDLA 1R49A 4LB5A 3ABMH 2VJJA 5IT9K 4EJTA 3QODA 4MLOA 2A68F 2WV0A 1LVAA 1T6SA 2K4JA 4CCOA 2ZXWH 2VXZA 4AVPA 1DGWY 2Y9YA 2JT1A 2LY2A 1T38A 1R71A 1OR7A 3PO2J 2NYXA 3FBIB 1ETQA 2JSCA 2LF8A 3AG1H 3LA2A 3NAUA 1OR7C 3QPSA 4FQGA 1ONVA 1K7AA 3CCJI 3SJMA 2ELKA 2ZJRF 4GDFA 1O57A 3S93A 4E7ZA 2FU4A 2QYOA 2ZXHA 2ETHA 1U8RA 3G6EI 1P9QC 1SFXA 4RMNA 2CV2A 2FNAA 4XL9A 5D4SA 4FETA 2X1CA 2RDPA 1KU2A 4AYBN 2X9DA 3KIOA 2VI6A 4HV6A 4ZYAA 4L9NA 3F21A 5H6RA 2UXXA 1XGSA 2BY3A 1HDPA 5B3SH 3H35A 1YX5A 2CO5A 3KP7A 4BHPA 5LGNA 4D7NA 4DYCA 1IXCA 1G3TA 3LSIA 4CO8A 3WTWC 3UNGC 2LBFA 3HDDA 4WXDA 3LMMA 5D8LB 4BY7J 3H92A 2MBFA 2HYGD 3QPTA 1K79A 5IY5H 2L9VA 2HPMA 3PFYA 3OYAA 2KIUA 4II3A 2HDDA 1EA3A 4RA2A 2E7WA 3CP2A 3FKIJ 1JTYA 1B72A 1KZHA 5HODA 2MA3A 2V1XA 1UAAA 3TDZC 3DKWA 5BPIA 1IC8A 3DPUA 2IS2A 3Q0UA 4OINF 3KP3A 2GWRA 2F4MB 4BEHA 4DBRA 4RS8A 2OQGA 3SZPA 4O3MA 4QLCU 3HGGA 3HUGA 4W97A 1I27A 5J4VA 2L7KA 4ZC3A 3L2VA 2PMHA 2XVCA 1JKOC 2Q0OA 1KQ8A 1YI2I 2IT0A 2M9HA 2Y69H 3HIFA 3GYHX 2FE3A 1IJWC 2QGUA 4ENKA 4XRFA 3TEDA 1R1UA 1VI0A 2KRCA 4N9HA 4YG2F 3OYMA 2PJRB 4AWXB 1PUFA 2P5VA 3LQQA 3TO7A 2FOWA 2L02A 5H2FC 2VBWA 3GLLA 4KA4A 1YITI 4AM3A 5LD2C 1WJBA 2LOOA 2R7OA 5B1AH 2DCEA 3I9V2 3FZVA 5DD8A 4BACA 4QPOA 2K02A 2Z16A 3QQAA 2LC2A 3KLNA 2TDXA 2JA6J 3A0HC 4L9TA 2EFNA 4EGYA 2MH9A 4A3EJ 3TP3A 5FKMA 2MLKA 1I50J 2XAFA 4F3QA 5DUKA 3OYIA 3C3WA 2R4GA 3ZQ7A 2VOPA 3BTIA 1K4SA 4Y4RA 3C2HA 4WCGA 1JJ8C 3HPGA 3TGNA 5L3BA 3ULQB 5DM6F 2MC4A 3E97A 2DMTA 5DCMB 3A4CA 1XSDA 3FMRA 1SVMA 1BL0A 1T95A 4G94A 1PUEE 3VWBA 1Q1HA 3CQZJ 4ZYEA 2OC6A 2FBKA 4Z6YA 2QWWA 5HLHA 2DMNA 5LHGA 4D9JA 4ZH4F 3F0CA 3JTHA 5CVJA 3I3LA 1AWCA 4CCJA 1IRFA 1A6QA 3PSFA 1MZBA 4F93B 4RAGA 1UB9A 2DA2A 3DEEA 5FB2A 2M30A 4M72A 3DWLE 2NNNA 1FWZA 2CFOA 5C44J 2CW7A 3V7RA 2WWYA 2VPLA 1AA7A 3GMEA 4LG0B 1UHSA 3KPHA 1IN5A 1P92A 1ODDA 3HRSA 4RGUA 5EZGA 3J81Z 1VF9A 2OZUA 1NK2P 2OPTA 4PJJA 1H9TA 1DU6A 4AIKA 2HYJA 4BJ6C 4HX8A 3AAFA 1ZELA 3HOUJ 3WTZA 3RSNA 2EV0A 4GGGA 1X1CA 3WU0A 1DP3A 1WH5A 3EPZA 3K69A 1WI3A 3PL8A 2WAQA 2OTLI 4DZPA 1R58A 3J81K 3A2KA 1I1SA 1Z6RA 2ZFUA 1IN7A 2E60A 3OV8A 2QA4I 3A03A 3JW4A 5LBQA 1RC9A 3OS2A 5J4YA 3P9CA 5DDGA 6PAXA 1HQCA 2JSPA 3CP8A 4XBFA 4RGRA 3TMOA 1FBUA 1FBSA 3RYPA 1FOXA 3OYHA 4BQAA 3LNQA 3ASNH 2EZLA 4JX4A 2DMUA 2ESHA 2CU7A 1GUUA 2Z1DA 2IA0A 3A1YA 4QWQA 4B3AA 3SEQA 2FQ4A 2WY7Q 5GAEJ 1Z0XA 2CQNA 4RB1A 2MD5A 4MTEA 3CUQB 5LRSA 1WPKA 4GXOA 5D8KB 2EFPA 3OYNA 2CS3A 2NXNB 2XPVA 2LREA 2HKXA 2JMWA 2RN7A 4HDVA 1S29A 3IH3A 2TRTA 4EJWA 2HOSA 3FM5A 4KIBA 4BXFA 3Q3SA 4A0XA 2MABA 2EIKH 2HFHA 3OR2C 5EZHA 3G3ZA 2V4JC 1IV8A 3AKZA 1QQIA 5HS8A 4U87A 3VYRB 4OIQF 1VNDA 2EWNA 3K6GA 4EATA 4ENJA 1SVOA 1U0JA 1XGMA 3SDGA 3EUKL 2STWA 1B6AA 3TKYA 4DQ2A 2EIMH 5HNHA 3R61A 5FRMA 1AOYA 3GX4X 5E79C 4H4KC 3WTYC 5GTHC 1SEUA 1ZRFA 1LEAA 1XB4A 2HTSA 1IRZA 5J3LA 1FYKA 1B9MA 2EV5A 2NS0A 2F6CA 2H27A 4HEA2 3R0AA 4KFCA 1RPWA 4WF2A 4WWCA 1S72I 3FXJA 5KVRA 1BBYA 2KPMA 2YX4A 4G7ZF 1U2WA 2FNPA 4ZJZA 1HXDA 1B1BA 4U7BA 2JA8J 1FT9A 1ZKGA 1HF0A 4F55A 5D5XB 3MVPA 1USSA 4NQWB 4JQFA 2CFXA 2LY9A 4E7SA 5KHDA 3ABLH 2VJ5A 2PQ8A 1MMAA 2UUZA 3GTOJ 4L5IA 2TCTA 5J1YA 2X0LA 1EH7A 3GFIA 2DA6A 3B6CA 3PSIA 2Y9ZA 3KETA 2GA2A 3OS0A 2FOKA 5FLXK 1ETOA 4XSZF 5E8IA 4MEXF 1Z67A 1BI3A 3OYKA 1VQMI 3EYIA 1W7PB 2LRDA 3ZN1A 4UB6C 4U0VA 2NVXJ 4IZZA 2QVOA 1VTNC 4XONA 4HA8A 3CMEI 1ZH5A 2DODA 1TQMA 1T56A 1H0MA 4BAYA 3WGIA 3IH2A 1X3WB 1QPMA 1QZZA 1VZ0A 3S8PA 2HVRA 1Z91A 5AIPA 3A01A 1VQ7I 1R36A 1MMDA 2DTRA 3QU3A 3DKXA 1R1VA 4UUSB 1P4AA 2YPRA 3K70D 4D5CA 2E5ZA 2K9NA 2VLAA 2E2HJ 1XCBA 3U2RA 1I39A 1G8XA 2OA4A 4LFUA 3K0LA 4HSRA 5M5XJ 2DAOA 3W2AA 1JUMA 2RVCA 3V8KA 3HOZJ 5HS7A 4F7ZA 2PJRA 4IEJA 1HW5A 3SXYA 3SYTA 4BQNA 3S17J 2GIVA 1H8AC 1TT5B 4A3CJ 1FIPA 5ILUA 2ZJPF 1XCVA 1JKQC 4PSWA 5ICGA 2X6WA 1FPQA 3LSHA 2LKPA 2QBYA 2K9LA 4IQ4A 3VYUB 1IO2A 4NUBA 1H89C 1TWCJ 1XG1A 3Q0VA 2VC1A 1X3UA 1WCMJ 2VQGA 2ZSHB 4BJTA 1QRYA 2G7HA 2IP2A 2HQNA 2ZCWA 3DXJF 4R8HA 4PGHA 1R23A 2VC0A 3PFIA 1MH3A 5CVVA 2FA5A 4MEYF 3V4GA 1P6RA 2FMLA 2LH9A 2HU9A 3OOPA 4A3MJ 2VQCA 1YYVA 4JP0A 4ESJA 2LY1A 4YIIA 3HOVJ 2V6EA 1XC5A 2VQLA 1S7EA 3HKZA 2NS7A 2R0QC 5DCMA 3BJAA 4BY1J 2FRHA 4HF1A 4P9FA 1IN8A 3BT9A 4BNCA 5C4XJ 2M4KA 2YR2A 2P7CB 4NBQA 5TISC 3OYBA 5K7ZA 4M3DA 4RM3A 2HNHA 3BDDA 3BZ6A 1YS6A 3BJ6A 2M3AA 2IS1A 1OFCX 1NH3A 5CVRA 3IRQA 4KIFA 2WB1N 1OLTA 3BG7A 1PVEA 1X2MA 4WXCA 5CVIA 2QQ9A 2M4GA 3E6DA 5ERIA 3WU1B 1D5VA 5F1JA 2LR8A 4XN3A 2LFBA 4L18B 2K85A 1SFKA 2GAUA 1O7LA 1VQ4I 4A0YA 3BLYA 4Y7NJ 4KYWA 3MEXA 1MMNA 3ASOH 1IUFA 4M3BA 2CQXA 3GTLJ 4D5FA 3RZOJ 2V9KA 2LNBA 1D0XA 4PK4A 1WKMA 2R7WA 1A04A 3MZYA 1EH8A 3V8LA 2K9MA 2DPDA 4LGWA 2PMUA 2DYSH 2E5NA 2DDBA 4IHWA 1LDJA 4QIWN 4RB3C 4CDGA 2CUFA 2FBHA 1TNTA 1V5GA 3M8FA 4UB8C 5CQEA 4BE1A 1IAWA 4MHGA 1TQPA 2W00A 5GP9A 3PM1A 4A0ZA 3BG9A 4GFBA 1U5TA 4V19K 3RTRA 1M1EB 4I6ZA 3S15J 1Z7UA 3DP7A 1WI9A 2VBYA 3T8TA 1U5TC 1U9OA 2DTZA 1UFMA 2EBIA 3W2WA 4HNTA 4LIUA 5D5VB 3S1RJ 4II2A 2F5DA 1BIBA 2R7SA 4XLEA 1QGPA 3QP5A 2H8RA 4BQOA 4LJZF 3CUQA 2PEXA 3HHGA 4A3DJ 4BYYA 3OIQA 4OU0A 5M3FJ 1KQ9A 1Z77A 2I8DA 2Q2EB 3CUQC 3P9KA 2IS6A 4AIDA 5CYVA 2DMPA 3E6MA 2DPUA 3FXQA 1FX7A 2VIXA 2BW3B 3V7SA 2Z2SB 1XD7A 5ICCA 5TJJA 1CF7B 4IHVA 1I5ZA 1DPUA 2VOOA 4BGDA 1XS9A 2HOTA 2VT3A 4M6VA 4X1EA 4BHBA 3BR3A 3F9KA 3WU2C 1BI0A 4DYRA 1UZCA 4ITVA 2QSGX 3CCVI 3DTEA 3F6VA 2D1HA 1WJEA 4D0PA 3RI4A 4P9UA 4I99C 4EMSA 3RZDJ 2HVQA 2WAEA 3MAJA 3L2CA 1JGSA 4CSWA 1E3PA 2X6XA 2Y48A 5E8GA 1H9GA 1LJ9A 4J00A 2RC4A 2P5LC 1D0YA 1MMGA 1OQYA 1FLIA 4FE7A 1RR8C 1GXPA 2H09A 2W82A 2ZBKA 3ZMSA 4HDUA 1PP7U 3WG7H 4ZTJA 1HOMA 3FM3A 5FROA 4OMYA 1J5YA 1ON1A 1W7PD 5K7HA 3ZQCA 1Z3YA 1R00A 1ZYRF 3FF5A 3FBNB 4BQQA 4S05A 4XLCA 1U9NA 2KIMA 5H6QA 5FGMA 3KYDB 2W1OA 1BI1A 2E2IJ 5EG0B 5DTDA 2EIJH 2VBZA 1YOVB 1OCCH 3BQYA 2B7EA 3L09A 2LVSA 3IKVA 2VUMJ 3HC7A 3OR1C 5F0FA 3M9AA 1W7PA 3H9GA 4IO9F 2EFQA 3CCUI 4I2OA 4Y33A 3MKWB 3OOUA 4J01A 2P0WA 4B48A 4L5JA 2CW0F 2JUGA 1R6RA 4XN0A 4EQQA 3DFGA 5IT9Z 2W85A 3CCQI 3V42A 2XB0X 2JPBA 2XF6A 5IPAA 1IUYA 1TC3C 1J7KA 3UKGA 4A93J 2M2EA 2E1MC 2NOGA 3F3XA 3DBHB 4A3IJ 2Q8KA 1WH7A 2VODA 1BJZA 1IN6A 1KU3A 1B9NA 1WVRA 5E1WA 2HEOA 1GVJA 4KN7X 1OCTC 4KITB 1J9IA 1R4NB 1SFEA 1X58A 3H5RA 4ABZA 5DM7F 4CYCB 2X51A 4L0YB 3ZCOA 1X1PA 5JHUA 5C3EJ 2XRNA 5B5EC 4XKBA 3Q0WA 4LB6B 1B8IB 3TOAA 4HF0A 4Y52J 3DEUA 4I01A 3JRAA 3R6SA 3H5NA 5BMZA 4A3GJ 3HOTA 1LNWA 1F9NA 4BL0B 2DT5A 4A5NA 2XAHA 3F8MA 3WTTC 1APLC 1N75A 1QZYA 2FD5A 1A5JA 2K3FA 2KRHA 3ZRGA 1ZLKA 1P7IA 3PQKA 3NWSA 1Z3XA 2R7UA 4HZFA 3I4PA 1ZAOA 1XSXA 4NNJA 1G3WA 1ETKA 1SD6A 2AHQA 3FXKA 3B6AA 4AC0A 1ZR4A 1YW8A 3CCRI 3EDPA 1OCZH 2KMUA 4GCVA 2OQRA 3D5SC 3OSGA 4F92B 2L54A 1FNNA 2HYFA 3TW6A 1HW1A 4DW6A 3ESWB 2GXAA 3JTGA 4DZJA 3QOPA 2LYCA 1R9TJ 1YE9A 4L9JA 1ZGWA 1BIAA 2CQ7A 1LVKA 1G3SA 4G6QA 2R92J 3HSFA 2R7TA 4YFXF 2W57A 2ZXIA 1E2XA 2ZC2A 2YUSA 3KZIC 4CGZA 2OV7A 4CUGA 5EF6A 1LEBA 1SAUA 4JX6A 3LAPA 1V5EA 2VKVA 3LSJA 4BDYA 4KICA 4G12A 2F5CA 4HX4A 4RGXA 2CUZA 3MN2A 4IRHA 2EA4A 2DK8A 4I76A 4AIHA 3WHCA 1X4OA 5IOYA 3FKJA 3E5QA 3IUOA 2BXZA 2V79A 5E1ZB 5FLVA 4XLAA 3KYCB 1J2XA 1I3AA 1YRNB 4XRMA 5EEAA 1UELB 5BS6A 4MQ9F 3BTCA 4XMYA 3E0JB 2IXSA 3R4KA 4C2TA 5D4RA 2A3SA 2Y0MA 1DP7P 4KMUX 2L3DA 2CWEA 3H36A 4AU7A 5J8FA 2Y0SA 2DMQA 2IGOA 1QHHD 3H5AA 3PNYA 3VPRA 2VE8A 5K5OA 1X3ZB 2HS5A 3KP5A 4YIRX 2ZKZA 3G1OA 4LLGF 4HOBA 3J7ZI 2OUMA 3SQNA 1FSHA 1SD7A 2VT2A 2HZDA 1NTCA 5B1BH 4BE2A 3DLAA 2YU9J 1V54H 3OWTA 1W36D 2IA2A 4JBAA 2H8WA 1ETVA 4PZJA 5L3CA 2VPRA 1TWGJ 2BXYA 3RYRA 2HQAA 3T1BA 1D8KA 1D1CA 3AL0C 1WFXA 5F04A 2M0CA 1QO0D 1Y0UA 4YIFA 2AXLA 1DU0A 3SFIA 1FZPB 3MKYB 4IKFA 2OD5A 3BROA 1PYVA 2HZTA 3REOA 1MNMC 3OS1A 1W1WE 3LSRA 2HOEA 1DGRM 3OYFA 4LITA 1MJAA 4B4CA 1SMTA 3M8JA 3K4CA 5KAIC 2DDAA 5E1XA 2MSYA 4MTDA 1E3HA 2QSFX 3BG5A 1I1GA 3MKLA 3HRTA 3DU5A 3ROUA 3ZQHA 1N25A 3I59B 3EYYA 2JZYA 3F6OA 2CUEA 2BY0A 5TGTA 2XGXA 2ESNA 3DU6A 4RB2C 1JT0A 4IXAA 4LLNA 2ISYA 1IRGA 1Y56A 1N77A 4FX0A 1FOYA 4PFPA 5JVGF 4YRVA 3I71A 3DEWA 5F64A 4D1QA 2GQQA 1QZEA 3GXOA 4E7LA 3E7LA 3PIOF 2P7VB 5K7FA 2R5ZB 4M3EA 2GOMA 5IP6A 3K4JA 4ZDPA 2LD5A 1K78B 3DKYA 1ETXA 3GFMA 1X1BA 5CVUA 5FO5A 3JRGA 1A6IA 1G2HA 2DJIA 1GT0C 1O3RA 4OIPF 4BS9A 4CZCA 3IC7A 1T08B 2D5VA 4QPQA 3VSKA 2Y2ZA 1KYWA 4IVNA 3FMQA 3TBIA 3K4KA 4KUMA 1RUOA 1K6YA 2KQRA 3CMMA 3MMYB 2L4MA 3RIRA 2R5YB 1JUSA 1T0FA 2A6HF 3HEFA 3BR1A 3KEQA 1Z9CA 5K1YA 1T0FC 1GV2A 1BI2A 1J59A 3PUFA 2VXDA 3S3NA 1HC8A 1OKRA 1F43A 1FTTA 2G9WA 3I0TA 1JKPC 2JK3A 2DO7A 2Y75A 5EG0A 1YW9A 2MD0A 1SANA 2R7FA 1E0EA 1FSEA 1X2NA 2M45A 1JUPA 3WTSC 3OYGA 4XKVA 5CLSA 4B44A 3CJTB 3L2RA 1U6GA 3GEZA 4Z2YA 1XSVA 5ICEA 3CF5F 2BEOA 4A69C 4C30A 4E4HA 5F0CA 3ABTA 3Q5FA 2VBXA 5FLMJ 1R5GA 2X85A 3ZPLA 3K2ZA 3P7NA 1VQNI 3DTIA 4OWRB 1K83J 2O0YA 3RKQA 2IGKA 5EDNA 3LSTA 1YHQI 3G1LA 3WTUC 2AQFA 2CRGA 3ZQFA 2LSOA 4K2EA 1MIJA 3A0BC 2XV4S 4HSTA 3FK6A 3ONQA 1NG7A 2ZMEB 3IP4B 3E3VA 2QCOA 3KP2A 2UZKA 2EJRA 4LK1F 4P5OA 2B63J 1MJ9A 3BPXA 3ZQQA 3SEZA 3RCOA 1MSEC 2P81A 2JWTA 1D3YA 4XLFA 4C9YA 2CV1A 4EM0B 3M1CA 2KT0A 1ULYA 2ICWG 2X1EA 2W24A 5E3NA 4UVBA 5J47A 2HXOA 1Z7LA 2ZSIB 1FMVA 4XICA 2EA2A 1S9HA 1Q1VA 5DEQA 2CUJA 4DYQA 3N05A 3IV5A 2J5PA 2H1LA 4PDKA 4RM2A 1U78A 1VQPI 4UHTA 4V2FA 5LLQA 1E17A 2BBYA 3TQNA 2V9VA 2EQRA 3GFLA 2EK5A 2MW8A 3H9QA 3KYLA 1QU3A 1G4DA 1BOBA 1TLHB 1KGSA 2BVLA 2XROA 5DS9A 4I0AA 3GO5A 3MZHA 3RPQA 2CJJA 2VE9A 5FLXZ 2R3SA 1DQUA 1PP8F 2JTVA 2O03A 1ZREA 4ENNA 1G6NA 3M07A 3RKXA 4IPAA 4Y15A 5LEKA 2CH0A 2DK5A 2EH3A 1LE8B 3JREA 1OCOH 5E3MA 5KK1A 2K40A 3QYFA 1FJLA 3CDLA 1YW7A 5DD4A 3F23A 2HXIA 2GXGA 2D45A 2DXIA 3U21A 1ZLJA 3I56I 2XAGA 1XGNA 1Z21A 2PMZA 1FMWA 4A2UA 2AS5F 5E18F 3D1NI 5M5YJ 4FTHA 1MD0A 3GUDA 1L3LA 3J7AO 4N4OB 3NQOA 4M6XA 3HOSA 3PJRA 3BTLA 1STZA 3S2DJ 2E71A 4N9IA 5TRDA 4F91B 1HSJA 2Y30A 3GFJA 2P5KA 2WA0A 2L01A 1W0TA 4HV5A 3IWZA 3QP6A 3IKTA 2RGVA 5HNFA 1T33A 1O3SA 1Y6IA 3D5LA 4CICA 1FYLA 4P55A 1OPCA 5DCFA 1RR7A 4FASD 3KCCA 3ZP5A 4A6DA 5IYDJ 1HA8A 2DLLA 3CESA 3JRIA 3CCMI 2IJLA 1UJ8A 1FY7A 2OAZA 2WAQN 3LA3A 2XASA 4B09A 2W7NA 1OCPA 2A5WA 2KFDA 2RNJA 5EJCA 2DQRA 3TOBA 3H3VK 2OTJI 5HLIA 2QQAA 3G2BA 3HOXJ 2P4WA 2K86A 4NC8A 4QTRA 3DLLF 4KDPA 1AU7A 1Z1DA 3WHBA 1T39A 4M73A 3K70C 2IVMA 4ZTFA 1KA8A 4G6TB 2LG4A 2DA4A 5A2QZ 2K9QA 4E7KA 4AUXA 4YFKF 5IOZA 2A69F 3UR3C 3DQVC 4BJ5C 3R60A 2RV8A 3RKYA 3ZQIA 2KKOA 3OYCA 2A5YB 4O6JA 1HCRA 3SFZA 4RGSA 2BV6A 2NOJB 4MGRA 1VQ8I 2L2OA 2ACJA 3K4MA 1XDUA 5A2QK 5FKNA 4P96A 1YTYA 3MWMA 2AXTC 2GA1A 1HDDC 3M1EA 3S1MJ 5IYBJ 4XOTA 2BGCA 3CJRB 1YIOA 3VODA 1SMYF 3HTUA 2K9SA 4E70A 5LGTA 3H9JA 1CQTA 2E2JJ 1K78A 5D5UB 4U0WA 3TO6A 4B1RA 2N8GA 2RKHA 4GO1A 1QPIA 4MNUA 2LTPA 4DOZA 2XF5A 2M34A 4A6EA 1W5TA 1LB2A 3FXLA 2UV1A 3CCLI 1WHUA 2XGCA 3HYIA 4WX9A 2M7AA 5LGUA 1BC7C 3SZGA 4ON0A 3JRFA 1W4MA 4LG0A 3ECOA 1HBXG 3S3OA 3CCEI 5AONA 2KDZA 2R5YA 4LLLA 2LBFB 3HRMA 3KZZA 1R5HA 2V7FA 5GPCA 1BC8C 4PUSA 4NDLA 2L9RA 1IDZA 2XC7A 3CC2I 2XKPA 1RI7A 3ZMZA 5JLXA 3IH4A 1LDDA 3LAJA 3F8FA 4LK0F 3HG9A 4S0HB 5J1RA 2V1UA 4ZDOA 2DJNA 2IA1A 1B72B 4Q5SF 2GZWA 3BPVA 4N0BA 5CPRB 2DU9A 4ESBA 3WTXC 4AD9A 1IF1A 2PFBA 2VN2A 3GTQJ 1IXSB 2EILH 1XTAA 3KLOA 1DPRA 3OYDA 2LKXA 3BCAA 4I7HA 3O2PE 5FKLA 5M5WJ 3V8JA 3VYSB 5HDKA 1J09A 2FMYA 3AG2H 4NC7A 1HLVA 4IHXA 1LPQA 3LFUA 2KISA 4BHCA 2ID6A 4XM3A 2B0LA 3V7CA 5JR3A 2PX9A 3OIPA 2QQBA 3K9TA 1QNTA 4LG3A 2EZIA 4EJUA 5HLTA 2HR3A 1JT6A 3ABKH 2XSDC 2R7QA 5FD6A 2EPFA 2G7UA 2PBIA 2OZ6A 3OL4A 4OOIA 4RBOA 1YJWI 1ZRDA 2R93J 2ZMEA 1MKMA 2FXAA 4WXHA 4IHTA 5K5RA 4M6YA 3H1CA 4KT5C 3DV8A 1PUFB 2QQ8A 2QSHX 2IBDA 4P1WA 3R0JA 2ZMEC 1Z05A 3JRBA 4Y3OA 1ZG1A 3IRRA 2ZXJA 2VONA 4FCYA 1IXRC 3G73A 1L0OC 2H1KA 5HLGA 5KAFC 3IWFA 4ETSA 5JI6A 5FD5A 2OF7A 4NHJA 4AYBA 3I64A 1RKWA 1D5YA 1JXSA 4GRIA 4A3FJ 3C2BA 4QSHA 3TW7A 1ZGJA 4C3JJ 1D0ZA 1OYWA 2MGQA 3WGHA 2MC3A 2COBA 5BOXA 1XGOA 3MZ8A 2P8TA 2VKEA 1JHFA 2JQ7A 4M3GA 4CCNA 1RZ4A 2LMDA 3W6KB 2JJ7A 3GZNB 3B73A 4ASNA 4EGZA 2F5VA 2R7VA 1WJCA 3JSOA 1YJ9I 3C2GA 4Y17A 2Z9OA 3M3YJ 1YS7A 1AKHB 3DCFA 2DFFA 3M8EA 4UV8A 3H3ZA 3K2AA 1ZN2A 3RQIA 5ILVA 1OYYA 2LKSA 3RPUD 3ZMVA 5AIQA 3H0GJ 2DFIA 4GYIA 1ETWA 2E35A 3AFHA 2PJPA 5E17F 2PG4A 4NC6A 4WK8F 5HVQC 1YQAA 1Y39A 1MMSA 2VQHA 4NQWA 1A31A 3X2QH 1LE8A 2IRFG 4LIVA 2EZKA 3ISPA 2QEXI 2F5EA 2DA7A 1T8IA 2GOXB 1S7AA 2DW4A 4LD5A 2HKOA 3HKZN 3D0SA 3KEOA 3CJNA 2O8XA 5L3EA 3G71I 1MBEA 3EUHA 1ZTRA 3HB9A 5CKTA 3GF2A 4B47A 4DJAA 3G1MA 1JGGA 3ECHA 4DGWB 1WQ2A 1VQOI 1K6OA 3EUHC 4OAZA 4HRIA 4UXNA 2DOEA 1WJFA 1LFPA 5JLWA 3PIPF 5BPDA 4KNYA 2DFHA 2DA1A 3MCZA 2AO9A 3LSGA 3S2HJ 3L2QA 4CHUA 1HKSA 1RESA 3LSPA 1G3YA 2WTEA 2L5QA 1IDYA 4UUSA 3GBGA 2DOAA 3RKWA 2O9LA 3CMYA 3G4SI 2KP6A 3HZJA 1ITYA 1IW7F 2BHYA 3ZGKA 1ETYA 2CQKA 3L7WA 3BZKA 3L9FA 1XMAA 1AHDP 2WADA 4G6DA 4U7DA 3S1NJ 2YSRA 1RETA 2WAFA 1XN7A 2Q1ZB 2DA5A 3PNTA 4YEJA 4RAFA 3ZOBA 3D5RC 4HNVA 5DV5A 2W4SA 3BR2A 3VFZA 3T5XA 1JE8A 2ELHA 3F8CA 5J1UA 5J6XA 2FJ1A 2ZNYA 4ESFA 4LMYA 4OIRF 4RB0A 1RNLA 2XPUA 5GAGJ 3OYJA 4MQVA 2X48A 3CTAA 2GBYA 1BM9A 4MO7A 3F72A 4TV7A 4CXFA 4R1HA 1X4PA 4CCMA 2MG4A 1IG7A 2IPQX 4L0ZB 2JPCA 1ON2A 5EGOB 1KONA 4XLNF 3ABUA 4C3IJ 2E1CA 3I4MJ 1IN4A 4BU2A 4L5EA 2F5FA 4G8XA 1S8NA 2L9NA 1A36A 2H6BA 1S6LA 5IT3A 3S1QJ 3FWEA 4Q47A 1CGPA 4X6AJ 3JCUC 3EUAA 3HSRA 1FC3A 4XOPA 1FP2A 2X6OA 3LSKA 1F4KA 1C0WA 2EFOA 4JYKA 4U88A 4A5MA 5F1RA 2DQLA 1OISA 2AQEA 2KLOA 5GADJ 2MYSA 1D1BA 5FFXA 4DNCA 3CUOA 3HM5A 2ECBA 2M0MA 3SZTA 2CGPA 1BW6A 2UXNA 2K4BA 3FXOA 3JRHA 3CDHA 3FDYA 2WBMA 1P4WA 2E19A 3VB2A 5LFAA 1SFOJ 1S3JA 2K5CA 3HTSB 4FISA 2QKLB 4BH9A 3KZYA 2XB5A 3TL4X 4HLXA 1JKRC 2LP0A 2KZVA 3FK7A 1XMKA 3WE2A 2RNGA 2KJBA 1BW5A 1BR2A 3QOEA 1B4AA 3JAMZ 3L00A 4E7IA 1FIAA 2F2EA 5FKKA 3FISA 3N97A 2QM3A 2XAUA 4PCQA 1QVTA 4XRSA 3FXUA 2L7FP 1QBJA 2VKHA 2YS9A 3QWLA 1MBKA 3JAMK 4FX4A 2O8KA 4GYGA 1TWFJ 3FX3A 1FOWA 3KP4A 2H6CA 3E1SA 2V9PA 3COAC 2RAEA 2DBBA 3A01B 4HPQA 4IL6C 3GTJJ 4UV9A 1SD5A 2UWMA 4L9VA 1V4RA 2GXBA 3I54A 3TP0A 4IJAA 1DUXC 4HNUA 3JRCA 5M3MJ 4G7OF 1Y1VJ 2XAJA 5FJ8J 4ZYDA 3CMAI 2OU2A 2COMA 1W36C 2E1OA 3EETA 5EYRA 4Y13A 2A6EF 5JHFA 2M5WA 2ZJ2A 1GVDA 1P2FA 3GCMA 1TZLA 3RJPA 1BOAA 1MBJA 3BTJA 3ZMTA 5ILSA 4ANJA 4IHSA 2XHKA 2JA5J 3BR6A 4PJNA 1A35A 2Q2EA 1KYZA 4HLYA 1Y8QB 3J7YJ 1D8JA 5F27A 2HQRA 3S3MA 2GM4A 3NWTA 2QBYB 4HQEA 2BW3A 2XRLA 1CF7A 2HVSA 3K4LA 3DTKA 3BJOA 4PSXA 2NRAC 4Q4ZF 2XUBA 3PQJA 3PUBA 4IRIA 3U1KA 2M8EA 5GTIC 2Y31A 2K7LA 1HW2A 3MQ0A 2D1VA 5KNLA 1OYIA 2Z3YA 3GW2A 4X0GA 2ME0A 2JA2A 2F4OB 2DYRH 3HJEA 2J5OA 2L7ZA 3HGYA 1O4XA 3HOYJ 3AG4H 1O7FA 3CLOA 5DYMA 1AKHA 2QLZA 1WRJA 3I5UA 5LHIA 1MH4A 2JVGA 1MBFA 3C1DA 2IGMA 4U0YA 2RREA 3S14J 4CZZA 3MKZA 4M9ZA 3E5UA 1EH6A 2RQPA 3B02A 1W5SA 2DFEA 3BCBA 3ERED 3VOEA 3CC7I 2BY1A 4BBRJ 1NK3P 2E36A 2PN6A 2KIQA 3MD2A 1X1AA 3JR9A 1TTYA 4OIOF 2O61A 1EV7A 1UMQA 1V3FA 1WJAA 3ML6A 4RAZA 1MSFC 1LUJB 2XSJC 3CC4I 1HKTA 4UVAA 3GVAA 1KU7A 5D6EA 3JSPA 2M87A 1LQ1A 2IW5A 4EJOA 3M7GA 1ZHFA 5IP7J 1IRXA 1BJAA 4C3HJ 1MBGA 4XIDA 1R7JA 2XDVA 1J0RA 4B8XA 3GTGJ 3GZ5A 2JUCA 4F52A 4HX7A 4M71A 4XRSG 2F48A 1GHCA 3QPLA 2EFWA 2X6YA 1WZ2A 5LRRA 5HOOA 3E6BA 2OJED 1YG2A 2D2WA 2P6TA 4XKWA 1EF4A 1GXQA 1UG2A 3A02A 4BE0A 1JHHA 4EV0A 1WSUA 3BQZA 2Y0SN 2L4AA 3Q9VA 4G7HF 3IHUA 1MNEA 1GLNA 1IZ1A 3Q9SA 3H0DA 2PI0A 3IAS2 5HS9A 1KU9A 1S7OA 4CCLA 4CYCA 2CV0A 2R7XA 3S2WA 4R79A 2XIGA 4ZZLA 5F08A 2XAQA 1U5TB 1B8IA 3HOWJ 3O3KA 2O3FA 2QENA 3BWGA 3HPHA 1FOKA 2XGDA 3J7AY 2DA3A 2WC2A 2NVYJ 1MDMB 9ANTA 2QF7A 5EEHA 1OJLA 2LF7A 5FKOA
chains in the Genus database with same CATH topology
3QU6A 4M9XA 3GLXA 1UHWA 2YX7A 4IF4A 2DI3A 2R7DA 5CJ9A 3F22A 4YFNF 1O3QA 1FP1D 3HSEA 1J75A 1FBQA 4KN4X 3DPLC 3LWFA 2E7XA 1YLFA 1R1TA 4HBLA 3I53A 4ZZDA 5HDNA 1HKQA 2HGCA 2X4HA 1T98A 1U3EM 2KRFA 5F6FA 1T2KA 2CSOA 4FHTA 4PGGA 2ISZA 2E1NA 1YO5C 4UVCA 4OMZA 3T8RA 3TDUC 5BQTA 4AIJA 3ZN0A 3QAHA 1SAXA 1RIOH 1ZGAA 1YFHA 1NHAA 3VEPA 1TW3A 4EM1A 1ZG5A 4HF2A 2FBIA 3FXRA 4HYEA 2YU3A 2A61A 5D5WB 3LFKA 4I98B 3E5XA 2FEZA 3HRUA 3DF8A 3KP6A 3LA7A 4I02A 2A07F 3GWZA 1F1ZA 4KMFA 3HHHA 3K1NA 1USTA 3I59A 5ED4A 2FQ3A 4BXUA 2STTA 4XLPF 5LEJA 2KJCA 4CYDA 4M74A 5JVTA 2V1DA 4I09A 2HWVA 1WWXA 3KE2A 3C7JA 2HTJA 5FFZA 2OBPA 3ELKA 2ZNZA 3EQLF 1RUNA 3BP8A 4ZYGA 2ZO4A 2JRTA 3WODF 2V6CA 1BN5A 3F8BA 3K1PA 4S04A 5D6FA 3NRVA 2BE5F 5E20A 4XSXF 4JK1X 2FF4A 3KFWX 1I6XA 3NEUA 1XDSA 3CO7C 3CO6C 3FHZA 2M1BA 3ZMUA 3DPTA 4FT8A 1O3TA 2MLGA 4O5VA 3T0YA 2W25A 5H20A 1FYMA 5EEGA 2Z5UA 4ENMA 2Z99A 3N4MA 4EJVA 1REPC 1HSTA 2CYYA 1R22A 4G9YA 5L3DA 4I0BA 1DDNA 2ZFWA 2NAZA 2ADUA 3LQRA 1Z6TA 4HW0A 1ZRCA 1MJBA 2BYVE 2EV6A 2O6GE 5LHHA 4NB5A 5JFRA 3K1MA 3BY6A 1TBXA 3GZ6A 3WTVC 4KIGA 3WGGA 4Q48A 1P4XA 5DUIA 2QUFA 2QZ8A 2MH2A 2W84A 1MDMA 1B59A 3F8NA 5L3FA 3H3UA 3U1DA 3RDIA 1F5TA 1TW2A 2XKOA 2P6SA 2CG4A 5HDGA 3QRFF 4UNOA 3SHFA 3MFKA 1ZG3A 5J8CA 4M9SA 4A12A 3QPHA 1PDNC 5K5QA 3WG9A 2C6YA 2FSWA 2LDUA 3U9GA 2KIFA 3ZMDA 5ICFA 3BOQA 4UUVA 3RPUA 2Z33A 1ZARA 3I58A 2HDCA 1TNSA 4HQMA 5L3GA 2EB7A 3P9IA 4EVIA 4RAYA 1UCRA 2K27A 2H94A 1MGTA 3FMSA 1SD4A 3C18A 4ZYHA 3J80Z 4H0EA 4HAMA 4IRGA 3O6BB 3E6CC 1OMIA 3WE3A 3IL2A 1LDKB 3TO9A 1KQ0A 2NNYA 3W6JB 1SFUA 2PLYA 3J80K 1TQIA 1UHMA 4EM2A 4LB5A 5IT9K 4EJTA 2A68F 2WV0A 1LVAA 1T6SA 2K4JA 2VXZA 4AVPA 2JT1A 1T38A 1OR7A 2NYXA 2JSCA 2LF8A 3LA2A 1ONVA 1K7AA 1O57A 2FU4A 2QYOA 2ETHA 1U8RA 1SFXA 2FNAA 5D4SA 2RDPA 1KU2A 4HV6A 4L9NA 3F21A 5H6RA 2UXXA 1XGSA 2CO5A 3KP7A 4BHPA 5LGNA 1IXCA 1G3TA 4CO8A 3WTWC 4WXDA 5D8LB 3H92A 2MBFA 2HYGD 3QPTA 1K79A 2KIUA 2E7WA 2MA3A 2V1XA 3TDZC 3DKWA 5BPIA 4OINF 3KP3A 2GWRA 4RS8A 2OQGA 3SZPA 4O3MA 4QLCU 3HUGA 1I27A 2PMHA 2XVCA 2Q0OA 1KQ8A 2IT0A 3HIFA 3GYHX 2FE3A 4ENKA 4XRFA 1R1UA 4N9HA 4YG2F 4AWXB 2P5VA 3LQQA 3TO7A 2L02A 2VBWA 4KA4A 3FZVA 5DD8A 2K02A 3KLNA 2TDXA 4L9TA 4EGYA 2EFNA 2MH9A 2MLKA 2XAFA 5DUKA 3C3WA 3ZQ7A 2VOPA 4WCGA 3TGNA 5L3BA 3ULQB 3E97A 5DCMB 1XSDA 3FMRA 1PUEE 4G94A 1Q1HA 4ZYEA 2FBKA 2QWWA 5HLHA 5LHGA 4ZH4F 5CVJA 3JTHA 1AWCA 1IRFA 1MZBA 1UB9A 5FB2A 2M30A 4M72A 2NNNA 1FWZA 3V7RA 2WWYA 4LG0B 1IN5A 1P92A 1ODDA 3HRSA 4RGUA 3J81Z 2OZUA 1H9TA 4AIKA 4HX8A 3AAFA 3WTZA 2EV0A 4GGGA 3WU0A 3K69A 1R58A 3J81K 1I1SA 1Z6RA 1IN7A 3OV8A 3JW4A 5LBQA 3P9CA 5DDGA 6PAXA 1HQCA 4XBFA 4RGRA 1FBUA 1FBSA 3RYPA 4BQAA 2ESHA 4QWQA 2IA0A 4RB1A 2MD5A 4MTEA 5LRSA 3CUQB 4GXOA 5D8KB 2EFPA 2HKXA 2RN7A 4HDVA 1S29A 4EJWA 3FM5A 4KIBA 4A0XA 2HFHA 3G3ZA 1QQIA 5HS8A 4OIQF 2EWNA 4ENJA 1XGMA 2STWA 1B6AA 3TKYA 4DQ2A 3R61A 1AOYA 3GX4X 3WTYC 1ZRFA 1LEAA 1XB4A 2HTSA 1FYKA 1B9MA 2EV5A 2NS0A 2H27A 3R0AA 4KFCA 4WWCA 4WF2A 5KVRA 1BBYA 2YX4A 4G7ZF 1U2WA 2FNPA 1HXDA 1B1BA 4U7BA 1FT9A 5D5XB 1USSA 4JQFA 2CFXA 2PQ8A 4L5IA 3GFIA 2X0LA 1EH7A 3KETA 2GA2A 2FOKA 5FLXK 5E8IA 4XSZF 4MEXF 1BI3A 3EYIA 1W7PB 3ZN1A 4U0VA 2QVOA 1VTNC 4HA8A 1ZH5A 1TQMA 1H0MA 4BAYA 3WGIA 1QPMA 1QZZA 1Z91A 5AIPA 1R36A 3QU3A 2DTRA 1R1VA 1P4AA 2YPRA 1XCBA 3U2RA 2OA4A 4LFUA 3K0LA 2DAOA 2RVCA 3V8KA 5HS7A 4F7ZA 3SXYA 1HW5A 2GIVA 5ILUA 1XCVA 5ICGA 1FPQA 2LKPA 2QBYA 2VC1A 1X3UA 2G7HA 2IP2A 2ZCWA 2HQNA 3DXJF 4R8HA 4PGHA 1R23A 2VC0A 3PFIA 5CVVA 2FA5A 4MEYF 3V4GA 1P6RA 2FMLA 3OOPA 1YYVA 4ESJA 4YIIA 5DCMA 3BJAA 2FRHA 4HF1A 4P9FA 1IN8A 4BNCA 2YR2A 2P7CB 3BDDA 3BZ6A 1YS6A 3BJ6A 5CVRA 3IRQA 4KIFA 4WXCA 5CVIA 2QQ9A 3E6DA 5ERIA 3WU1B 1D5VA 4L18B 2GAUA 1O7LA 4A0YA 4KYWA 3MEXA 2LNBA 1WKMA 1A04A 3MZYA 1EH8A 3V8LA 2DPDA 4LGWA 2PMUA 1LDJA 4RB3C 4CDGA 2FBHA 1TNTA 3M8FA 1IAWA 4MHGA 1TQPA 4A0ZA 1U5TA 3RTRA 1Z7UA 3DP7A 1WI9A 2VBYA 3T8TA 1U5TC 1UFMA 5D5VB 2F5DA 1BIBA 1QGPA 3QP5A 4LJZF 3CUQA 2PEXA 3HHGA 4BYYA 4OU0A 1KQ9A 3CUQC 3P9KA 5CYVA 3E6MA 2DPUA 3FXQA 1FX7A 3V7SA 5ICCA 1XD7A 5TJJA 1CF7B 1I5ZA 1DPUA 2VOOA 2VT3A 4BHBA 1BI0A 3F6VA 2D1HA 4D0PA 3RI4A 4P9UA 4EMSA 3MAJA 3L2CA 1JGSA 2Y48A 5E8GA 1H9GA 1LJ9A 2RC4A 2P5LC 1FLIA 1GXPA 2H09A 2ZBKA 3ZMSA 4HDUA 1PP7U 3FM3A 4OMYA 1J5YA 1ON1A 1W7PD 1ZYRF 1R00A 3FF5A 4S05A 2KIMA 5H6QA 5FGMA 1BI1A 2VBZA 3L09A 3IKVA 3M9AA 1W7PA 2EFQA 4I2OA 4L5JA 2CW0F 4EQQA 3DFGA 5IT9Z 2W85A 2JPBA 1IUYA 1J7KA 3F3XA 2Q8KA 2VODA 1IN6A 1KU3A 1B9NA 5E1WA 2HEOA 1GVJA 4KN7X 1J9IA 1SFEA 4L0YB 5JHUA 2XRNA 4LB6B 3TOAA 4HF0A 3DEUA 4I01A 3R6SA 5BMZA 3HOTA 1LNWA 1F9NA 2DT5A 4A5NA 2XAHA 3F8MA 3WTTC 1QZYA 1ZLKA 3PQKA 4HZFA 3I4PA 1ZAOA 1XSXA 1G3WA 1SD6A 1YW8A 3EDPA 4GCVA 2OQRA 2L54A 1FNNA 2HYFA 1HW1A 3JTGA 3QOPA 4L9JA 1BIAA 1G3SA 4G6QA 3HSFA 4YFXF 2W57A 1E2XA 4CGZA 1LEBA 3LAPA 4KICA 2F5CA 4HX4A 4RGXA 4IRHA 2EA4A 2DK8A 4AIHA 3E5QA 2V79A 5E1ZB 1J2XA 5BS6A 4MQ9F 3R4KA 5D4RA 2A3SA 2Y0MA 1DP7P 4KMUX 2L3DA 2CWEA 5J8FA 2VE8A 5K5OA 2HS5A 3KP5A 2ZKZA 4LLGF 4HOBA 3SQNA 1FSHA 1SD7A 2VT2A 2IA2A 4JBAA 4PZJA 5L3CA 3RYRA 3T1BA 1D8KA 1QO0D 1Y0UA 4YIFA 2AXLA 1FZPB 2OD5A 3BROA 2HZTA 3REOA 2HOEA 1MJAA 1SMTA 5E1XA 4MTDA 3ROUA 1I1GA 3HRTA 3I59B 3EYYA 2JZYA 3F6OA 2XGXA 2ESNA 4RB2C 4IXAA 4LLNA 2ISYA 1IRGA 4FX0A 3I71A 5F64A 2GQQA 3GXOA 2P7VB 1K78B 3GFMA 5CVUA 5FO5A 1O3RA 4OIPF 3IC7A 1KYWA 4IVNA 3FMQA 4KUMA 1RUOA 2L4MA 3RIRA 1T0FA 2A6HF 3KEQA 1Z9CA 5K1YA 1BI2A 1J59A 1OKRA 2G9WA 3I0TA 2DO7A 2Y75A 1YW9A 2R7FA 1FSEA 2M45A 3WTSC 5CLSA 1U6GA 3GEZA 4Z2YA 1XSVA 5ICEA 2BEOA 3ABTA 3Q5FA 2VBXA 1R5GA 3ZPLA 3K2ZA 3P7NA 2O0YA 3LSTA 3WTUC 2LSOA 4K2EA 2XV4S 2ZMEB 3E3VA 3KP2A 2UZKA 2EJRA 4LK1F 4P5OA 1MJ9A 3BPXA 1D3YA 4EM0B 1ULYA 2W24A 4UVBA 2EA2A 5DEQA 2J5PA 1U78A 4PDKA 4UHTA 5LLQA 1E17A 2BBYA 3TQNA 2V9VA 3GFLA 2EK5A 1G4DA 1TLHB 1KGSA 2XROA 4I0AA 3GO5A 3MZHA 3RPQA 2VE9A 5FLXZ 2R3SA 1PP8F 2JTVA 2O03A 1ZREA 4ENNA 1G6NA 3RKXA 4IPAA 4Y15A 5LEKA 2DK5A 5KK1A 1YW7A 5DD4A 3F23A 2GXGA 2D45A 1ZLJA 2XAGA 1XGNA 4A2UA 2AS5F 5E18F 1MD0A 3GUDA 1L3LA 3J7AO 3NQOA 4M6XA 3HOSA 1STZA 4N9IA 5TRDA 1HSJA 3GFJA 2P5KA 2L01A 4HV5A 3IWZA 3QP6A 3IKTA 2RGVA 1O3SA 3D5LA 4CICA 1FYLA 4P55A 1OPCA 5DCFA 3KCCA 3ZP5A 4A6DA 2DLLA 2IJLA 1FY7A 2OAZA 3LA3A 2XASA 4B09A 2RNJA 2DQRA 3TOBA 5HLIA 2QQAA 2P4WA 2K86A 4KDPA 1Z1DA 1T39A 4M73A 2IVMA 1KA8A 5A2QZ 4YFKF 2A69F 3DQVC 3R60A 2RV8A 3RKYA 2KKOA 2A5YB 4O6JA 3SFZA 4RGSA 2BV6A 4MGRA 2ACJA 1XDUA 5A2QK 4P96A 1YTYA 3MWMA 2GA1A 3M1EA 2BGCA 1YIOA 3VODA 1SMYF 5LGTA 3HTUA 4E70A 1K78A 5D5UB 4U0WA 3TO6A 2RKHA 4GO1A 4MNUA 4A6EA 1W5TA 1LB2A 3HYIA 4WX9A 5LGUA 1BC7C 4ON0A 1W4MA 4LG0A 3ECOA 1HBXG 5AONA 4LLLA 3HRMA 3KZZA 1R5HA 1BC8C 2XKPA 1RI7A 3ZMZA 1LDDA 3LAJA 3F8FA 4LK0F 2V1UA 2IA1A 4Q5SF 2GZWA 3BPVA 4N0BA 2DU9A 4ESBA 3WTXC 4AD9A 1IF1A 2PFBA 2VN2A 1IXSB 3KLOA 1DPRA 4I7HA 3O2PE 3V8JA 5HDKA 2FMYA 4BHCA 2B0LA 3V7CA 5JR3A 2QQBA 3K9TA 1QNTA 4EJUA 2HR3A 5FD6A 2G7UA 2PBIA 2OZ6A 4OOIA 1ZRDA 2ZMEA 1MKMA 2FXAA 4WXHA 4IHTA 5K5RA 4M6YA 4KT5C 3DV8A 3R0JA 1Z05A 1ZG1A 3IRRA 2ZXJA 2VONA 1IXRC 3G73A 1L0OC 5HLGA 3IWFA 4ETSA 5JI6A 5FD5A 4NHJA 3I64A 1JXSA 1ZGJA 1OYWA 2MC3A 5BOXA 1XGOA 2P8TA 1JHFA 1RZ4A 3W6KB 4ASNA 4EGZA 3B73A 3JSOA 2Z9OA 4Y17A 1YS7A 3M8EA 4UV8A 3H3ZA 1ZN2A 5ILVA 1OYYA 3ZMVA 5AIQA 2DFIA 4GYIA 2PJPA 5E17F 2PG4A 4WK8F 5HVQC 1YQAA 4NQWA 2IRFG 3ISPA 2F5EA 1S7AA 2DW4A 4LD5A 2HKOA 3D0SA 3KEOA 3CJNA 2O8XA 5L3EA 3EUHA 3GF2A 3ECHA 1WQ2A 1K6OA 4UXNA 4KNYA 5BPDA 3MCZA 4CHUA 1HKSA 1G3YA 2WTEA 3RKWA 1IW7F 3L9FA 2CQKA 3L7WA 1XMAA 4G6DA 4U7DA 2YSRA 1XN7A 5DV5A 3VFZA 3T5XA 1JE8A 2ELHA 3F8CA 5J6XA 2ZNYA 4ESFA 4LMYA 4OIRF 4RB0A 1RNLA 4MQVA 3CTAA 1BM9A 3F72A 4TV7A 4CXFA 4R1HA 2IPQX 4L0ZB 2JPCA 1ON2A 4XLNF 3ABUA 2E1CA 1IN4A 2F5FA 4G8XA 1S8NA 2H6BA 1S6LA 5IT3A 3FWEA 4Q47A 1CGPA 3HSRA 1FC3A 1FP2A 1F4KA 1C0WA 2EFOA 4U88A 4A5MA 5F1RA 2DQLA 5FFXA 4DNCA 3CUOA 3SZTA 2CGPA 2UXNA 2K4BA 3CDHA 1P4WA 3VB2A 1S3JA 3HTSB 4BH9A 3KZYA 4HLXA 1XMKA 3WE2A 2KJBA 1B4AA 3JAMZ 3L00A 2F2EA 3N97A 2QM3A 4PCQA 3FXUA 1QBJA 4FX4A 3JAMK 4GYGA 3FX3A 3KP4A 2H6CA 3COAC 2DBBA 4UV9A 1SD5A 2UWMA 4L9VA 1V4RA 2GXBA 3I54A 4IJAA 1DUXC 4G7OF 2XAJA 4ZYDA 2OU2A 2COMA 3EETA 4Y13A 2A6EF 2M5WA 2ZJ2A 1P2FA 3RJPA 1BOAA 3ZMTA 5ILSA 4IHSA 2XHKA 2Q2EA 1KYZA 4HLYA 1D8JA 2HQRA 2QBYB 4HQEA 1CF7A 3BJOA 2NRAC 4Q4ZF 2XUBA 3PQJA 4IRIA 2M8EA 2K7LA 1HW2A 3MQ0A 2D1VA 1OYIA 2Z3YA 3GW2A 2J5OA 1O7FA 3CLOA 5DYMA 2QLZA 1WRJA 3I5UA 5LHIA 3C1DA 4U0YA 4CZZA 4M9ZA 3E5UA 1EH6A 2RQPA 3B02A 1W5SA 3ERED 3VOEA 2PN6A 1TTYA 4OIOF 2O61A 1EV7A 1V3FA 3ML6A 4RAZA 1HKTA 4UVAA 3GVAA 1KU7A 5D6EA 3JSPA 2M87A 1LQ1A 2IW5A 4EJOA 3M7GA 1ZHFA 1BJAA 1R7JA 4B8XA 1J0RA 3GZ5A 4HX7A 4M71A 1GHCA 2EFWA 5LRRA 5HOOA 3E6BA 1YG2A 2D2WA 2P6TA 1GXQA 1JHHA 4EV0A 1WSUA 2L4AA 3Q9VA 4G7HF 3IHUA 3Q9SA 2PI0A 1IZ1A 5HS9A 1KU9A 1S7OA 3S2WA 4R79A 2XIGA 4ZZLA 2XAQA 1U5TB 3O3KA 2O3FA 2QENA 3BWGA 1FOKA 2WC2A 1MDMB 5EEHA 2LF7A 3WGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QU6 A;  4M9X A;  3GLX A;  1UHW A;  2YX7 A;  4IF4 A;  2DI3 A;  2R7D A;  5CJ9 A;  3F22 A;  4YFN F;  1O3Q A;  1FP1 D;  3HSE A;  1J75 A;  1FBQ A;  4KN4 X;  3DPL C;  3LWF A;  2E7X A;  1YLF A;  1R1T A;  4HBL A;  3I53 A;  4ZZD A;  5HDN A;  1HKQ A;  2HGC A;  2X4H A;  1T98 A;  1U3E M;  2KRF A;  5F6F A;  1T2K A;  2CSO A;  4FHT A;  4PGG A;  2ISZ A;  2E1N A;  1YO5 C;  4UVC A;  4OMZ A;  3T8R A;  3TDU C;  5BQT A;  4AIJ A;  3ZN0 A;  3QAH A;  1SAX A;  1RIO H;  1ZGA A;  1YFH A;  1NHA A;  3VEP A;  1TW3 A;  4EM1 A;  1ZG5 A;  4HF2 A;  2FBI A;  3FXR A;  4HYE A;  2YU3 A;  2A61 A;  5D5W B;  3LFK A;  4I98 B;  3E5X A;  2FEZ A;  3HRU A;  3DF8 A;  3KP6 A;  3LA7 A;  4I02 A;  2A07 F;  3GWZ A;  1F1Z A;  4KMF A;  3HHH A;  3K1N A;  1UST A;  3I59 A;  5ED4 A;  2FQ3 A;  4BXU A;  2STT A;  4XLP F;  5LEJ A;  2KJC A;  4CYD A;  4M74 A;  5JVT A;  2V1D A;  4I09 A;  2HWV A;  1WWX A;  3KE2 A;  3C7J A;  2HTJ A;  5FFZ A;  2OBP A;  3ELK A;  2ZNZ A;  3EQL F;  1RUN A;  3BP8 A;  4ZYG A;  2ZO4 A;  2JRT A;  3WOD F;  2V6C A;  1BN5 A;  3F8B A;  3K1P A;  4S04 A;  5D6F A;  3NRV A;  2BE5 F;  5E20 A;  4XSX F;  4JK1 X;  2FF4 A;  3KFW X;  1I6X A;  3NEU A;  1XDS A;  3CO7 C;  3CO6 C;  3FHZ A;  2M1B A;  3ZMU A;  3DPT A;  4FT8 A;  1O3T A;  2MLG A;  4O5V A;  3T0Y A;  2W25 A;  5H20 A;  1FYM A;  5EEG A;  2Z5U A;  4ENM A;  2Z99 A;  3N4M A;  4EJV A;  1REP C;  1HST A;  2CYY A;  1R22 A;  4G9Y A;  5L3D A;  4I0B A;  1DDN A;  2ZFW A;  2NAZ A;  2ADU A;  3LQR A;  1Z6T A;  4HW0 A;  1ZRC A;  1MJB A;  2BYV E;  2EV6 A;  2O6G E;  5LHH A;  4NB5 A;  5JFR A;  3K1M A;  3BY6 A;  1TBX A;  3GZ6 A;  3WTV C;  4KIG A;  3WGG A;  4Q48 A;  1P4X A;  5DUI A;  2QUF A;  2QZ8 A;  2MH2 A;  2W84 A;  1MDM A;  1B59 A;  3F8N A;  5L3F A;  3H3U A;  3U1D A;  3RDI A;  1F5T A;  1TW2 A;  2XKO A;  2P6S A;  2CG4 A;  5HDG A;  3QRF F;  4UNO A;  3SHF A;  3MFK A;  1ZG3 A;  5J8C A;  4M9S A;  4A12 A;  3QPH A;  1PDN C;  5K5Q A;  3WG9 A;  2C6Y A;  2FSW A;  2LDU A;  3U9G A;  2KIF A;  3ZMD A;  5ICF A;  3BOQ A;  4UUV A;  3RPU A;  2Z33 A;  1ZAR A;  3I58 A;  2HDC A;  1TNS A;  4HQM A;  5L3G A;  2EB7 A;  3P9I A;  4EVI A;  4RAY A;  1UCR A;  2K27 A;  2H94 A;  1MGT A;  3FMS A;  1SD4 A;  3C18 A;  4ZYH A;  3J80 Z;  4H0E A;  4HAM A;  4IRG A;  3O6B B;  3E6C C;  1OMI A;  3WE3 A;  3IL2 A;  1LDK B;  3TO9 A;  1KQ0 A;  2NNY A;  3W6J B;  1SFU A;  2PLY A;  3J80 K;  1TQI A;  1UHM A;  4EM2 A;  4LB5 A;  5IT9 K;  4EJT A;  2A68 F;  2WV0 A;  1LVA A;  1T6S A;  2K4J A;  2VXZ A;  4AVP A;  2JT1 A;  1T38 A;  1OR7 A;  2NYX A;  2JSC A;  2LF8 A;  3LA2 A;  1ONV A;  1K7A A;  1O57 A;  2FU4 A;  2QYO A;  2ETH A;  1U8R A;  1SFX A;  2FNA A;  5D4S A;  2RDP A;  1KU2 A;  4HV6 A;  4L9N A;  3F21 A;  5H6R A;  2UXX A;  1XGS A;  2CO5 A;  3KP7 A;  4BHP A;  5LGN A;  1IXC A;  1G3T A;  4CO8 A;  3WTW C;  4WXD A;  5D8L B;  3H92 A;  2MBF A;  2HYG D;  3QPT A;  1K79 A;  2KIU A;  2E7W A;  2MA3 A;  2V1X A;  3TDZ C;  3DKW A;  5BPI A;  4OIN F;  3KP3 A;  2GWR A;  4RS8 A;  2OQG A;  3SZP A;  4O3M A;  4QLC U;  3HUG A;  1I27 A;  2PMH A;  2XVC A;  2Q0O A;  1KQ8 A;  2IT0 A;  3HIF A;  3GYH X;  2FE3 A;  4ENK A;  4XRF A;  1R1U A;  4N9H A;  4YG2 F;  4AWX B;  2P5V A;  3LQQ A;  3TO7 A;  2L02 A;  2VBW A;  4KA4 A;  3FZV A;  5DD8 A;  2K02 A;  3KLN A;  2TDX A;  4L9T A;  4EGY A;  2EFN A;  2MH9 A;  2MLK A;  2XAF A;  5DUK A;  3C3W A;  3ZQ7 A;  2VOP A;  4WCG A;  3TGN A;  5L3B A;  3ULQ B;  3E97 A;  5DCM B;  1XSD A;  3FMR A;  1PUE E;  4G94 A;  1Q1H A;  4ZYE A;  2FBK A;  2QWW A;  5HLH A;  5LHG A;  4ZH4 F;  5CVJ A;  3JTH A;  1AWC A;  1IRF A;  1MZB A;  1UB9 A;  5FB2 A;  2M30 A;  4M72 A;  2NNN A;  1FWZ A;  3V7R A;  2WWY A;  4LG0 B;  1IN5 A;  1P92 A;  1ODD A;  3HRS A;  4RGU A;  3J81 Z;  2OZU A;  1H9T A;  4AIK A;  4HX8 A;  3AAF A;  3WTZ A;  2EV0 A;  4GGG A;  3WU0 A;  3K69 A;  1R58 A;  3J81 K;  1I1S A;  1Z6R A;  1IN7 A;  3OV8 A;  3JW4 A;  5LBQ A;  3P9C A;  5DDG A;  6PAX A;  1HQC A;  4XBF A;  4RGR A;  1FBU A;  1FBS A;  3RYP A;  4BQA A;  2ESH A;  4QWQ A;  2IA0 A;  4RB1 A;  2MD5 A;  4MTE A;  5LRS A;  3CUQ B;  4GXO A;  5D8K B;  2EFP A;  2HKX A;  2RN7 A;  4HDV A;  1S29 A;  4EJW A;  3FM5 A;  4KIB A;  4A0X A;  2HFH A;  3G3Z A;  1QQI A;  5HS8 A;  4OIQ F;  2EWN A;  4ENJ A;  1XGM A;  2STW A;  1B6A A;  3TKY A;  4DQ2 A;  3R61 A;  1AOY A;  3GX4 X;  3WTY C;  1ZRF A;  1LEA A;  1XB4 A;  2HTS A;  1FYK A;  1B9M A;  2EV5 A;  2NS0 A;  2H27 A;  3R0A A;  4KFC A;  4WWC A;  4WF2 A;  5KVR A;  1BBY A;  2YX4 A;  4G7Z F;  1U2W A;  2FNP A;  1HXD A;  1B1B A;  4U7B A;  1FT9 A;  5D5X B;  1USS A;  4JQF A;  2CFX A;  2PQ8 A;  4L5I A;  3GFI A;  2X0L A;  1EH7 A;  3KET A;  2GA2 A;  2FOK A;  5FLX K;  5E8I A;  4XSZ F;  4MEX F;  1BI3 A;  3EYI A;  1W7P B;  3ZN1 A;  4U0V A;  2QVO A;  1VTN C;  4HA8 A;  1ZH5 A;  1TQM A;  1H0M A;  4BAY A;  3WGI A;  1QPM A;  1QZZ A;  1Z91 A;  5AIP A;  1R36 A;  3QU3 A;  2DTR A;  1R1V A;  1P4A A;  2YPR A;  1XCB A;  3U2R A;  2OA4 A;  4LFU A;  3K0L A;  2DAO A;  2RVC A;  3V8K A;  5HS7 A;  4F7Z A;  3SXY A;  1HW5 A;  2GIV A;  5ILU A;  1XCV A;  5ICG A;  1FPQ A;  2LKP A;  2QBY A;  2VC1 A;  1X3U A;  2G7H A;  2IP2 A;  2ZCW A;  2HQN A;  3DXJ F;  4R8H A;  4PGH A;  1R23 A;  2VC0 A;  3PFI A;  5CVV A;  2FA5 A;  4MEY F;  3V4G A;  1P6R A;  2FML A;  3OOP A;  1YYV A;  4ESJ A;  4YII A;  5DCM A;  3BJA A;  2FRH A;  4HF1 A;  4P9F A;  1IN8 A;  4BNC A;  2YR2 A;  2P7C B;  3BDD A;  3BZ6 A;  1YS6 A;  3BJ6 A;  5CVR A;  3IRQ A;  4KIF A;  4WXC A;  5CVI A;  2QQ9 A;  3E6D A;  5ERI A;  3WU1 B;  1D5V A;  4L18 B;  2GAU A;  1O7L A;  4A0Y A;  4KYW A;  3MEX A;  2LNB A;  1WKM A;  1A04 A;  3MZY A;  1EH8 A;  3V8L A;  2DPD A;  4LGW A;  2PMU A;  1LDJ A;  4RB3 C;  4CDG A;  2FBH A;  1TNT A;  3M8F A;  1IAW A;  4MHG A;  1TQP A;  4A0Z A;  1U5T A;  3RTR A;  1Z7U A;  3DP7 A;  1WI9 A;  2VBY A;  3T8T A;  1U5T C;  1UFM A;  5D5V B;  2F5D A;  1BIB A;  1QGP A;  3QP5 A;  4LJZ F;  3CUQ A;  2PEX A;  3HHG A;  4BYY A;  4OU0 A;  1KQ9 A;  3CUQ C;  3P9K A;  5CYV A;  3E6M A;  2DPU A;  3FXQ A;  1FX7 A;  3V7S A;  5ICC A;  1XD7 A;  5TJJ A;  1CF7 B;  1I5Z A;  1DPU A;  2VOO A;  2VT3 A;  4BHB A;  1BI0 A;  3F6V A;  2D1H A;  4D0P A;  3RI4 A;  4P9U A;  4EMS A;  3MAJ A;  3L2C A;  1JGS A;  2Y48 A;  5E8G A;  1H9G A;  1LJ9 A;  2RC4 A;  2P5L C;  1FLI A;  1GXP A;  2H09 A;  2ZBK A;  3ZMS A;  4HDU A;  1PP7 U;  3FM3 A;  4OMY A;  1J5Y A;  1ON1 A;  1W7P D;  1ZYR F;  1R00 A;  3FF5 A;  4S05 A;  2KIM A;  5H6Q A;  5FGM A;  1BI1 A;  2VBZ A;  3L09 A;  3IKV A;  3M9A A;  1W7P A;  2EFQ A;  4I2O A;  4L5J A;  2CW0 F;  4EQQ A;  3DFG A;  5IT9 Z;  2W85 A;  2JPB A;  1IUY A;  1J7K A;  3F3X A;  2Q8K A;  2VOD A;  1IN6 A;  1KU3 A;  1B9N A;  5E1W A;  2HEO A;  1GVJ A;  4KN7 X;  1J9I A;  1SFE A;  4L0Y B;  5JHU A;  2XRN A;  4LB6 B;  3TOA A;  4HF0 A;  3DEU A;  4I01 A;  3R6S A;  5BMZ A;  3HOT A;  1LNW A;  1F9N A;  2DT5 A;  4A5N A;  2XAH A;  3F8M A;  3WTT C;  1QZY A;  1ZLK A;  3PQK A;  4HZF A;  3I4P A;  1ZAO A;  1XSX A;  1G3W A;  1SD6 A;  1YW8 A;  3EDP A;  4GCV A;  2OQR A;  2L54 A;  1FNN A;  2HYF A;  1HW1 A;  3JTG A;  3QOP A;  4L9J A;  1BIA A;  1G3S A;  4G6Q A;  3HSF A;  4YFX F;  2W57 A;  1E2X A;  4CGZ A;  1LEB A;  3LAP A;  4KIC A;  2F5C A;  4HX4 A;  4RGX A;  4IRH A;  2EA4 A;  2DK8 A;  4AIH A;  3E5Q A;  2V79 A;  5E1Z B;  1J2X A;  5BS6 A;  4MQ9 F;  3R4K A;  5D4R A;  2A3S A;  2Y0M A;  1DP7 P;  4KMU X;  2L3D A;  2CWE A;  5J8F A;  2VE8 A;  5K5O A;  2HS5 A;  3KP5 A;  2ZKZ A;  4LLG F;  4HOB A;  3SQN A;  1FSH A;  1SD7 A;  2VT2 A;  2IA2 A;  4JBA A;  4PZJ A;  5L3C A;  3RYR A;  3T1B A;  1D8K A;  1QO0 D;  1Y0U A;  4YIF A;  2AXL A;  1FZP B;  2OD5 A;  3BRO A;  2HZT A;  3REO A;  2HOE A;  1MJA A;  1SMT A;  5E1X A;  4MTD A;  3ROU A;  1I1G A;  3HRT A;  3I59 B;  3EYY A;  2JZY A;  3F6O A;  2XGX A;  2ESN A;  4RB2 C;  4IXA A;  4LLN A;  2ISY A;  1IRG A;  4FX0 A;  3I71 A;  5F64 A;  2GQQ A;  3GXO A;  2P7V B;  1K78 B;  3GFM A;  5CVU A;  5FO5 A;  1O3R A;  4OIP F;  3IC7 A;  1KYW A;  4IVN A;  3FMQ A;  4KUM A;  1RUO A;  2L4M A;  3RIR A;  1T0F A;  2A6H F;  3KEQ A;  1Z9C A;  5K1Y A;  1BI2 A;  1J59 A;  1OKR A;  2G9W A;  3I0T A;  2DO7 A;  2Y75 A;  1YW9 A;  2R7F A;  1FSE A;  2M45 A;  3WTS C;  5CLS A;  1U6G A;  3GEZ A;  4Z2Y A;  1XSV A;  5ICE A;  2BEO A;  3ABT A;  3Q5F A;  2VBX A;  1R5G A;  3ZPL A;  3K2Z A;  3P7N A;  2O0Y A;  3LST A;  3WTU C;  2LSO A;  4K2E A;  2XV4 S;  2ZME B;  3E3V A;  3KP2 A;  2UZK A;  2EJR A;  4LK1 F;  4P5O A;  1MJ9 A;  3BPX A;  1D3Y A;  4EM0 B;  1ULY A;  2W24 A;  4UVB A;  2EA2 A;  5DEQ A;  2J5P A;  1U78 A;  4PDK A;  4UHT A;  5LLQ A;  1E17 A;  2BBY A;  3TQN A;  2V9V A;  3GFL A;  2EK5 A;  1G4D A;  1TLH B;  1KGS A;  2XRO A;  4I0A A;  3GO5 A;  3MZH A;  3RPQ A;  2VE9 A;  5FLX Z;  2R3S A;  1PP8 F;  2JTV A;  2O03 A;  1ZRE A;  4ENN A;  1G6N A;  3RKX A;  4IPA A;  4Y15 A;  5LEK A;  2DK5 A;  5KK1 A;  1YW7 A;  5DD4 A;  3F23 A;  2GXG A;  2D45 A;  1ZLJ A;  2XAG A;  1XGN A;  4A2U A;  2AS5 F;  5E18 F;  1MD0 A;  3GUD A;  1L3L A;  3J7A O;  3NQO A;  4M6X A;  3HOS A;  1STZ A;  4N9I A;  5TRD A;  1HSJ A;  3GFJ A;  2P5K A;  2L01 A;  4HV5 A;  3IWZ A;  3QP6 A;  3IKT A;  2RGV A;  1O3S A;  3D5L A;  4CIC A;  1FYL A;  4P55 A;  1OPC A;  5DCF A;  3KCC A;  3ZP5 A;  4A6D A;  2DLL A;  2IJL A;  1FY7 A;  2OAZ A;  3LA3 A;  2XAS A;  4B09 A;  2RNJ A;  2DQR A;  3TOB A;  5HLI A;  2QQA A;  2P4W A;  2K86 A;  4KDP A;  1Z1D A;  1T39 A;  4M73 A;  2IVM A;  1KA8 A;  5A2Q Z;  4YFK F;  2A69 F;  3DQV C;  3R60 A;  2RV8 A;  3RKY A;  2KKO A;  2A5Y B;  4O6J A;  3SFZ A;  4RGS A;  2BV6 A;  4MGR A;  2ACJ A;  1XDU A;  5A2Q K;  4P96 A;  1YTY A;  3MWM A;  2GA1 A;  3M1E A;  2BGC A;  1YIO A;  3VOD A;  1SMY F;  5LGT A;  3HTU A;  4E70 A;  1K78 A;  5D5U B;  4U0W A;  3TO6 A;  2RKH A;  4GO1 A;  4MNU A;  4A6E A;  1W5T A;  1LB2 A;  3HYI A;  4WX9 A;  5LGU A;  1BC7 C;  4ON0 A;  1W4M A;  4LG0 A;  3ECO A;  1HBX G;  5AON A;  4LLL A;  3HRM A;  3KZZ A;  1R5H A;  1BC8 C;  2XKP A;  1RI7 A;  3ZMZ A;  1LDD A;  3LAJ A;  3F8F A;  4LK0 F;  2V1U A;  2IA1 A;  4Q5S F;  2GZW A;  3BPV A;  4N0B A;  2DU9 A;  4ESB A;  3WTX C;  4AD9 A;  1IF1 A;  2PFB A;  2VN2 A;  1IXS B;  3KLO A;  1DPR A;  4I7H A;  3O2P E;  3V8J A;  5HDK A;  2FMY A;  4BHC A;  2B0L A;  3V7C A;  5JR3 A;  2QQB A;  3K9T A;  1QNT A;  4EJU A;  2HR3 A;  5FD6 A;  2G7U A;  2PBI A;  2OZ6 A;  4OOI A;  1ZRD A;  2ZME A;  1MKM A;  2FXA A;  4WXH A;  4IHT A;  5K5R A;  4M6Y A;  4KT5 C;  3DV8 A;  3R0J A;  1Z05 A;  1ZG1 A;  3IRR A;  2ZXJ A;  2VON A;  1IXR C;  3G73 A;  1L0O C;  5HLG A;  3IWF A;  4ETS A;  5JI6 A;  5FD5 A;  4NHJ A;  3I64 A;  1JXS A;  1ZGJ A;  1OYW A;  2MC3 A;  5BOX A;  1XGO A;  2P8T A;  1JHF A;  1RZ4 A;  3W6K B;  4ASN A;  4EGZ A;  3B73 A;  3JSO A;  2Z9O A;  4Y17 A;  1YS7 A;  3M8E A;  4UV8 A;  3H3Z A;  1ZN2 A;  5ILV A;  1OYY A;  3ZMV A;  5AIQ A;  2DFI A;  4GYI A;  2PJP A;  5E17 F;  2PG4 A;  4WK8 F;  5HVQ C;  1YQA A;  4NQW A;  2IRF G;  3ISP A;  2F5E A;  1S7A A;  2DW4 A;  4LD5 A;  2HKO A;  3D0S A;  3KEO A;  3CJN A;  2O8X A;  5L3E A;  3EUH A;  3GF2 A;  3ECH A;  1WQ2 A;  1K6O A;  4UXN A;  4KNY A;  5BPD A;  3MCZ A;  4CHU A;  1HKS A;  1G3Y A;  2WTE A;  3RKW A;  1IW7 F;  3L9F A;  2CQK A;  3L7W A;  1XMA A;  4G6D A;  4U7D A;  2YSR A;  1XN7 A;  5DV5 A;  3VFZ A;  3T5X A;  1JE8 A;  2ELH A;  3F8C A;  5J6X A;  2ZNY A;  4ESF A;  4LMY A;  4OIR F;  4RB0 A;  1RNL A;  4MQV A;  3CTA A;  1BM9 A;  3F72 A;  4TV7 A;  4CXF A;  4R1H A;  2IPQ X;  4L0Z B;  2JPC A;  1ON2 A;  4XLN F;  3ABU A;  2E1C A;  1IN4 A;  2F5F A;  4G8X A;  1S8N A;  2H6B A;  1S6L A;  5IT3 A;  3FWE A;  4Q47 A;  1CGP A;  3HSR A;  1FC3 A;  1FP2 A;  1F4K A;  1C0W A;  2EFO A;  4U88 A;  4A5M A;  5F1R A;  2DQL A;  5FFX A;  4DNC A;  3CUO A;  3SZT A;  2CGP A;  2UXN A;  2K4B A;  3CDH A;  1P4W A;  3VB2 A;  1S3J A;  3HTS B;  4BH9 A;  3KZY A;  4HLX A;  1XMK A;  3WE2 A;  2KJB A;  1B4A A;  3JAM Z;  3L00 A;  2F2E A;  3N97 A;  2QM3 A;  4PCQ A;  3FXU A;  1QBJ A;  4FX4 A;  3JAM K;  4GYG A;  3FX3 A;  3KP4 A;  2H6C A;  3COA C;  2DBB A;  4UV9 A;  1SD5 A;  2UWM A;  4L9V A;  1V4R A;  2GXB A;  3I54 A;  4IJA A;  1DUX C;  4G7O F;  2XAJ A;  4ZYD A;  2OU2 A;  2COM A;  3EET A;  4Y13 A;  2A6E F;  2M5W A;  2ZJ2 A;  1P2F A;  3RJP A;  1BOA A;  3ZMT A;  5ILS A;  4IHS A;  2XHK A;  2Q2E A;  1KYZ A;  4HLY A;  1D8J A;  2HQR A;  2QBY B;  4HQE A;  1CF7 A;  3BJO A;  2NRA C;  4Q4Z F;  2XUB A;  3PQJ A;  4IRI A;  2M8E A;  2K7L A;  1HW2 A;  3MQ0 A;  2D1V A;  1OYI A;  2Z3Y A;  3GW2 A;  2J5O A;  1O7F A;  3CLO A;  5DYM A;  2QLZ A;  1WRJ A;  3I5U A;  5LHI A;  3C1D A;  4U0Y A;  4CZZ A;  4M9Z A;  3E5U A;  1EH6 A;  2RQP A;  3B02 A;  1W5S A;  3ERE D;  3VOE A;  2PN6 A;  1TTY A;  4OIO F;  2O61 A;  1EV7 A;  1V3F A;  3ML6 A;  4RAZ A;  1HKT A;  4UVA A;  3GVA A;  1KU7 A;  5D6E A;  3JSP A;  2M87 A;  1LQ1 A;  2IW5 A;  4EJO A;  3M7G A;  1ZHF A;  1BJA A;  1R7J A;  4B8X A;  1J0R A;  3GZ5 A;  4HX7 A;  4M71 A;  1GHC A;  2EFW A;  5LRR A;  5HOO A;  3E6B A;  1YG2 A;  2D2W A;  2P6T A;  1GXQ A;  1JHH A;  4EV0 A;  1WSU A;  2L4A A;  3Q9V A;  4G7H F;  3IHU A;  3Q9S A;  2PI0 A;  1IZ1 A;  5HS9 A;  1KU9 A;  1S7O A;  3S2W A;  4R79 A;  2XIG A;  4ZZL A;  2XAQ A;  1U5T B;  3O3K A;  2O3F A;  2QEN A;  3BWG A;  1FOK A;  2WC2 A;  1MDM B;  5EEH A;  2LF7 A;  3WGH A; 
#chains in the Genus database with same CATH topology
 3QU6 A;  4M9X A;  2VKD A;  3GLX A;  1YJN I;  1UHW A;  4HG2 A;  4C2M J;  1U8B A;  2L9S A;  4E7H A;  2YX7 A;  4N4N B;  1R5I D;  4YEL A;  4IF4 A;  4EEF G;  1ZK8 A;  2DI3 A;  2MFZ A;  1H88 C;  4XR6 A;  2R7D A;  3AG3 H;  5CJ9 A;  3F22 A;  1I3Q J;  1W0U A;  4YFN F;  1O3Q A;  2BOL A;  5EGO A;  1FP1 D;  3HSE A;  3NAR A;  1J75 A;  1FBQ A;  1QA6 A;  2BHZ A;  3OL3 A;  4KN4 X;  3O8H A;  3DPL C;  3JRD A;  2IAI A;  2ZJQ F;  3LWF A;  3CZ6 A;  3W3C A;  2E7X A;  1RKT A;  1YLF A;  1R1T A;  2V1N A;  2XF7 A;  2WB1 A;  3CDI A;  4HBL A;  3I53 A;  1MW7 A;  4ZZD A;  3GTM J;  4FE4 A;  3OIO A;  5HDN A;  3W2V A;  1HKQ A;  2HGC A;  2X4H A;  1T98 A;  3CLQ A;  1U3E M;  2STT A;  4MIM A;  2KRF A;  3P5J A;  4KIS A;  5F6F A;  1T2K A;  2CSO A;  4FHT A;  4PGG A;  4JX5 A;  1XPX A;  1YRN A;  2ISZ A;  4CH7 A;  2R7Z J;  3HL2 A;  3ERM A;  2E1N A;  1YO5 C;  4UVC A;  3QYB A;  4OMZ A;  3T8R A;  2ELJ A;  4XK4 A;  5J40 A;  1FTZ A;  3IAM 2;  1TL8 A;  2ID3 A;  1WJ5 A;  3TDU C;  5FRN A;  5BQT A;  3O8G A;  4XKC A;  4LOC A;  3FHN A;  1W5C C;  4JOM A;  2F4I A;  2W48 A;  4AIJ A;  3ZN0 A;  3QAH A;  1SAX A;  1RIO H;  3BR0 A;  1ZGA A;  1YFH A;  1NHA A;  3VEP A;  1TW3 A;  3CF2 A;  2I10 A;  2ECC A;  2KHM A;  3OMY A;  4EM1 A;  1ZG5 A;  5IP9 J;  4HF2 A;  2FBI A;  1SVL A;  2E1M B;  3FXR A;  4PJL A;  4HYE A;  2YU3 A;  4PFO A;  1SC7 A;  2A61 A;  5D5W B;  4IX7 A;  1WJD A;  1S5L C;  1NG6 A;  3LFK A;  2KZG A;  4I98 B;  4B43 A;  3E5X A;  1JI8 A;  3FXM A;  2FEZ A;  3HRU A;  3DF8 A;  1IV6 A;  3KP6 A;  3LA7 A;  4I02 A;  2A07 F;  3VSL A;  1QVU A;  1BA5 A;  3GWZ A;  1F1Z A;  1XMX A;  4KMF A;  3HHH A;  1UG0 A;  3K1N A;  1K4T A;  1UST A;  3I59 A;  2BY2 A;  1X1D A;  2VB6 A;  4UUT A;  2FQ3 A;  2ME6 A;  4BXU A;  5ED4 A;  3OSF A;  5IYC J;  4CCK A;  1JTX A;  5LEJ A;  4XLP F;  2KJC A;  1YIJ I;  2O5R A;  4CYD A;  2IS4 A;  5GAH J;  4M74 A;  3S32 A;  2XGE A;  5JVT A;  2V1D A;  2FX0 A;  4CA0 A;  3CCS I;  3W6V A;  4I09 A;  2HWV A;  1WWX A;  3KE2 A;  2JRM A;  1E3O C;  3BZC A;  3C7J A;  3K4N A;  4DBQ A;  4XOR A;  2HTJ A;  4MFE A;  3GTP J;  5KCM A;  5FFZ A;  2R5Z A;  2OBP A;  2E34 A;  2IEK A;  3ELK A;  2ZNZ A;  2DT6 A;  3EQL F;  3BP8 A;  4ZYG A;  1RUN A;  2NVT J;  3PNV A;  2ZO4 A;  2JRT A;  3WOD F;  2V6C A;  2IGN A;  2VJI A;  1BR1 A;  4RDU A;  1Y0N A;  2ZB9 A;  1RRJ A;  4UY8 I;  3L2W A;  1BN5 A;  2VAS A;  2A05 A;  3F8B A;  1TWA J;  3K1P A;  1ACI A;  4S04 A;  5D6F A;  4A3B J;  5E3O A;  2RQQ A;  2BE5 F;  3NRV A;  4XSX F;  1V55 H;  5E20 A;  4XQF A;  2VJ4 A;  2FUG 2;  3VDX A;  1MND A;  4JK1 X;  4BKX A;  1VQ9 I;  2FF4 A;  3KFW X;  5B66 C;  1I6X A;  3NEU A;  1XDS A;  3CO7 C;  3CO6 C;  2X1D A;  4E6K G;  3FHZ A;  2M1B A;  3ZMU A;  3DPT A;  1JJ6 C;  4FT8 A;  1VQ6 I;  1O3T A;  1I6H J;  3BG3 A;  3LSM A;  2MLG A;  4O5V A;  3T0Y A;  4IOC F;  2W25 A;  3SDB A;  5H20 A;  2M7B A;  1FYM A;  5EEG A;  2Z5U A;  1IGN A;  4OAY A;  4ENM A;  2Z99 A;  3N4M A;  4EJV A;  4MFD A;  3BR5 A;  1REP C;  1HST A;  2CMP A;  3CJQ B;  1X19 A;  4BXX J;  2CYY A;  1R22 A;  1VQL I;  1D1A A;  2DN0 A;  2B9S A;  1BR4 A;  2O7O A;  3I4N J;  4BEH B;  4G9Y A;  5L3D A;  4I0B A;  1DDN A;  3HUG B;  3HXL A;  2ZFW A;  3CD6 I;  1ZQ3 P;  2L7M P;  2NAZ A;  2ADU A;  2PMZ N;  1LFB A;  3BC8 A;  3LQR A;  1Z6T A;  4HW0 A;  2HPI A;  1ZRC A;  1YX3 A;  1MJB A;  1K61 A;  3AL0 B;  2BYV E;  2EV6 A;  1LKX A;  1TT0 A;  4J19 A;  2QKM B;  3KEY A;  2GLO A;  1Y1W J;  2O6G E;  4KT6 A;  5LHH A;  4NB5 A;  5JFR A;  3K1M A;  3BY6 A;  1TBX A;  4A3K J;  1FEX A;  2NS8 A;  1GDT A;  3GZ6 A;  2JVH A;  3WTV C;  4KIG A;  1WGX A;  1OCR H;  3WGG A;  4BBS J;  4Q48 A;  3LL7 A;  1P4X A;  3OY9 A;  4DIQ A;  5DUI A;  2QUF A;  2QZ8 A;  3M4O J;  2L0K A;  4PJ0 C;  2MH2 A;  4KJZ A;  5BNG A;  2EIN H;  2W84 A;  2WY8 Q;  1ERD A;  1MDM A;  3VYT B;  4BDZ A;  2G0E A;  1B59 A;  3ZQG A;  3GTK J;  3F8N A;  5L3F A;  3H3U A;  3U1D A;  3RDI A;  5F0H A;  1TWH J;  1F5T A;  4B3X A;  1VQK I;  1TW2 A;  1MBH A;  2XKO A;  2P6S A;  2CG4 A;  5HDG A;  3QRF F;  4UNO A;  4RLF A;  3SHF A;  1V5F A;  3MFK A;  2VL8 A;  1POG A;  5E3L A;  1EKE A;  1ZG3 A;  5J8C A;  3K10 A;  2LLK A;  3FIW A;  4M9S A;  1Y8R B;  4RLQ A;  5CQG A;  4A12 A;  3QPH A;  3QYE A;  1PDN C;  2NVQ J;  1ZR2 A;  4C2U A;  3ZR8 X;  1GV5 A;  5GPA A;  5K5Q A;  2HQ5 A;  3S16 J;  4IOA F;  2HDW A;  3L1P A;  1VQ5 I;  3WG9 A;  3L2U A;  3DBR B;  2C6Y A;  2BZT A;  2FSW A;  2KL4 A;  4A3J J;  2I5U A;  2LDU A;  3U9G A;  2JA7 J;  2WV1 A;  4XLH A;  2KIF A;  3ZMD A;  5ICF A;  3BOQ A;  1ORK A;  4UUV A;  1TP4 A;  3RPU A;  1P7J A;  4E7J A;  3KX2 A;  2Z33 A;  1ZAR A;  3I58 A;  4BUP A;  2HDC A;  4XNF A;  4IQJ A;  1TNS A;  3CCY A;  4W1U A;  2XPW A;  3K4B A;  2JN6 A;  1PJR A;  2KDO A;  1ENH A;  5C4J J;  2HOA A;  4HQM A;  2BVM A;  5L3G A;  3BG6 A;  2CQQ A;  1N78 A;  1G59 A;  4V2G A;  2EB7 A;  3P9I A;  4EVI A;  2DT7 B;  1F36 A;  3LOC A;  1VFC A;  1EJ9 A;  4AVZ A;  4RAY A;  2NVU B;  2LK2 A;  3ZXS A;  1UCR A;  2K27 A;  1LFU P;  2DOF A;  2H94 A;  3HBL A;  3PO3 J;  2OCE A;  2OCC H;  1R4M B;  1XX5 A;  4D7M A;  1MGT A;  3FMS A;  1QHG A;  1SD4 A;  3C18 A;  4ZYH A;  3J80 Z;  4H0E A;  2CW8 A;  4HAM A;  4IRG A;  3O6B B;  4A3L J;  3E6C C;  1OMI A;  2EZH A;  3WE3 A;  3IL2 A;  3DBL B;  1LDK B;  3OYE A;  2V26 A;  3TO9 A;  4M3F A;  3I55 I;  2A6T A;  1KQ0 A;  3K7A J;  2NNY A;  3W6J B;  4PJM A;  1SFU A;  4IHY A;  2R7R A;  2PLY A;  2GIZ A;  3J80 K;  1TQI A;  2HI3 A;  1UHM A;  2K3P A;  3OYL A;  3ZQL A;  3RQ4 A;  2M8G X;  4EM2 A;  4ZDL A;  1R49 A;  4LB5 A;  3ABM H;  2VJJ A;  5IT9 K;  4EJT A;  3QOD A;  4MLO A;  2A68 F;  2WV0 A;  1LVA A;  1T6S A;  2K4J A;  4CCO A;  2ZXW H;  2VXZ A;  4AVP A;  1DGW Y;  2Y9Y A;  2JT1 A;  2LY2 A;  1T38 A;  1R71 A;  1OR7 A;  3PO2 J;  2NYX A;  3FBI B;  1ETQ A;  2JSC A;  2LF8 A;  3AG1 H;  3LA2 A;  3NAU A;  1OR7 C;  3QPS A;  4FQG A;  1ONV A;  1K7A A;  3CCJ I;  3SJM A;  2ELK A;  2ZJR F;  4GDF A;  1O57 A;  3S93 A;  4E7Z A;  2FU4 A;  2QYO A;  2ZXH A;  2ETH A;  1U8R A;  3G6E I;  1P9Q C;  1SFX A;  4RMN A;  2CV2 A;  2FNA A;  4XL9 A;  5D4S A;  4FET A;  2X1C A;  2RDP A;  1KU2 A;  4AYB N;  2X9D A;  3KIO A;  2VI6 A;  4HV6 A;  4ZYA A;  4L9N A;  3F21 A;  5H6R A;  2UXX A;  1XGS A;  2BY3 A;  1HDP A;  5B3S H;  3H35 A;  1YX5 A;  2CO5 A;  3KP7 A;  4BHP A;  5LGN A;  4D7N A;  4DYC A;  1IXC A;  1G3T A;  3LSI A;  4CO8 A;  3WTW C;  3UNG C;  2LBF A;  3HDD A;  4WXD A;  3LMM A;  5D8L B;  4BY7 J;  3H92 A;  2MBF A;  2HYG D;  3QPT A;  1K79 A;  5IY5 H;  2L9V A;  2HPM A;  3PFY A;  3OYA A;  2KIU A;  4II3 A;  2HDD A;  1EA3 A;  4RA2 A;  2E7W A;  3CP2 A;  3FKI J;  1JTY A;  1B72 A;  1KZH A;  5HOD A;  2MA3 A;  2V1X A;  1UAA A;  3TDZ C;  3DKW A;  5BPI A;  1IC8 A;  3DPU A;  2IS2 A;  3Q0U A;  4OIN F;  3KP3 A;  2GWR A;  2F4M B;  4BEH A;  4DBR A;  4RS8 A;  2OQG A;  3SZP A;  4O3M A;  4QLC U;  3HGG A;  3HUG A;  4W97 A;  1I27 A;  5J4V A;  2L7K A;  4ZC3 A;  3L2V A;  2PMH A;  2XVC A;  1JKO C;  2Q0O A;  1KQ8 A;  1YI2 I;  2IT0 A;  2M9H A;  2Y69 H;  3HIF A;  3GYH X;  2FE3 A;  1IJW C;  2QGU A;  4ENK A;  4XRF A;  3TED A;  1R1U A;  1VI0 A;  2KRC A;  4N9H A;  4YG2 F;  3OYM A;  2PJR B;  4AWX B;  1PUF A;  2P5V A;  3LQQ A;  3TO7 A;  2FOW A;  2L02 A;  5H2F C;  2VBW A;  3GLL A;  4KA4 A;  1YIT I;  4AM3 A;  5LD2 C;  1WJB A;  2LOO A;  2R7O A;  5B1A H;  2DCE A;  3I9V 2;  3FZV A;  5DD8 A;  4BAC A;  4QPO A;  2K02 A;  2Z16 A;  3QQA A;  2LC2 A;  3KLN A;  2TDX A;  2JA6 J;  3A0H C;  4L9T A;  2EFN A;  4EGY A;  2MH9 A;  4A3E J;  3TP3 A;  5FKM A;  2MLK A;  1I50 J;  2XAF A;  4F3Q A;  5DUK A;  3OYI A;  3C3W A;  2R4G A;  3ZQ7 A;  2VOP A;  3BTI A;  1K4S A;  4Y4R A;  3C2H A;  4WCG A;  1JJ8 C;  3HPG A;  3TGN A;  5L3B A;  3ULQ B;  5DM6 F;  2MC4 A;  3E97 A;  2DMT A;  5DCM B;  3A4C A;  1XSD A;  3FMR A;  1SVM A;  1BL0 A;  1T95 A;  4G94 A;  1PUE E;  3VWB A;  1Q1H A;  3CQZ J;  4ZYE A;  2OC6 A;  2FBK A;  4Z6Y A;  2QWW A;  5HLH A;  2DMN A;  5LHG A;  4D9J A;  4ZH4 F;  3F0C A;  3JTH A;  5CVJ A;  3I3L A;  1AWC A;  4CCJ A;  1IRF A;  1A6Q A;  3PSF A;  1MZB A;  4F93 B;  4RAG A;  1UB9 A;  2DA2 A;  3DEE A;  5FB2 A;  2M30 A;  4M72 A;  3DWL E;  2NNN A;  1FWZ A;  2CFO A;  5C44 J;  2CW7 A;  3V7R A;  2WWY A;  2VPL A;  1AA7 A;  3GME A;  4LG0 B;  1UHS A;  3KPH A;  1IN5 A;  1P92 A;  1ODD A;  3HRS A;  4RGU A;  5EZG A;  3J81 Z;  1VF9 A;  2OZU A;  1NK2 P;  2OPT A;  4PJJ A;  1H9T A;  1DU6 A;  4AIK A;  2HYJ A;  4BJ6 C;  4HX8 A;  3AAF A;  1ZEL A;  3HOU J;  3WTZ A;  3RSN A;  2EV0 A;  4GGG A;  1X1C A;  3WU0 A;  1DP3 A;  1WH5 A;  3EPZ A;  3K69 A;  1WI3 A;  3PL8 A;  2WAQ A;  2OTL I;  4DZP A;  1R58 A;  3J81 K;  3A2K A;  1I1S A;  1Z6R A;  2ZFU A;  1IN7 A;  2E60 A;  3OV8 A;  2QA4 I;  3A03 A;  3JW4 A;  5LBQ A;  1RC9 A;  3OS2 A;  5J4Y A;  3P9C A;  5DDG A;  6PAX A;  1HQC A;  2JSP A;  3CP8 A;  4XBF A;  4RGR A;  3TMO A;  1FBU A;  1FBS A;  3RYP A;  1FOX A;  3OYH A;  4BQA A;  3LNQ A;  3ASN H;  2EZL A;  4JX4 A;  2DMU A;  2ESH A;  2CU7 A;  1GUU A;  2Z1D A;  2IA0 A;  3A1Y A;  4QWQ A;  4B3A A;  3SEQ A;  2FQ4 A;  2WY7 Q;  5GAE J;  1Z0X A;  2CQN A;  4RB1 A;  2MD5 A;  4MTE A;  3CUQ B;  5LRS A;  1WPK A;  4GXO A;  5D8K B;  2EFP A;  3OYN A;  2CS3 A;  2NXN B;  2XPV A;  2LRE A;  2HKX A;  2JMW A;  2RN7 A;  4HDV A;  1S29 A;  3IH3 A;  2TRT A;  4EJW A;  2HOS A;  3FM5 A;  4KIB A;  4BXF A;  3Q3S A;  4A0X A;  2MAB A;  2EIK H;  2HFH A;  3OR2 C;  5EZH A;  3G3Z A;  2V4J C;  1IV8 A;  3AKZ A;  1QQI A;  5HS8 A;  4U87 A;  3VYR B;  4OIQ F;  1VND A;  2EWN A;  3K6G A;  4EAT A;  4ENJ A;  1SVO A;  1U0J A;  1XGM A;  3SDG A;  3EUK L;  2STW A;  1B6A A;  3TKY A;  4DQ2 A;  2EIM H;  5HNH A;  3R61 A;  5FRM A;  1AOY A;  3GX4 X;  5E79 C;  4H4K C;  3WTY C;  5GTH C;  1SEU A;  1ZRF A;  1LEA A;  1XB4 A;  2HTS A;  1IRZ A;  5J3L A;  1FYK A;  1B9M A;  2EV5 A;  2NS0 A;  2F6C A;  2H27 A;  4HEA 2;  3R0A A;  4KFC A;  1RPW A;  4WF2 A;  4WWC A;  1S72 I;  3FXJ A;  5KVR A;  1BBY A;  2KPM A;  2YX4 A;  4G7Z F;  1U2W A;  2FNP A;  4ZJZ A;  1HXD A;  1B1B A;  4U7B A;  2JA8 J;  1FT9 A;  1ZKG A;  1HF0 A;  4F55 A;  5D5X B;  3MVP A;  1USS A;  4NQW B;  4JQF A;  2CFX A;  2LY9 A;  4E7S A;  5KHD A;  3ABL H;  2VJ5 A;  2PQ8 A;  1MMA A;  2UUZ A;  3GTO J;  4L5I A;  2TCT A;  5J1Y A;  2X0L A;  1EH7 A;  3GFI A;  2DA6 A;  3B6C A;  3PSI A;  2Y9Z A;  3KET A;  2GA2 A;  3OS0 A;  2FOK A;  5FLX K;  1ETO A;  4XSZ F;  5E8I A;  4MEX F;  1Z67 A;  1BI3 A;  3OYK A;  1VQM I;  3EYI A;  1W7P B;  2LRD A;  3ZN1 A;  4UB6 C;  4U0V A;  2NVX J;  4IZZ A;  2QVO A;  1VTN C;  4XON A;  4HA8 A;  3CME I;  1ZH5 A;  2DOD A;  1TQM A;  1T56 A;  1H0M A;  4BAY A;  3WGI A;  3IH2 A;  1X3W B;  1QPM A;  1QZZ A;  1VZ0 A;  3S8P A;  2HVR A;  1Z91 A;  5AIP A;  3A01 A;  1VQ7 I;  1R36 A;  1MMD A;  2DTR A;  3QU3 A;  3DKX A;  1R1V A;  4UUS B;  1P4A A;  2YPR A;  3K70 D;  4D5C A;  2E5Z A;  2K9N A;  2VLA A;  2E2H J;  1XCB A;  3U2R A;  1I39 A;  1G8X A;  2OA4 A;  4LFU A;  3K0L A;  4HSR A;  5M5X J;  2DAO A;  3W2A A;  1JUM A;  2RVC A;  3V8K A;  3HOZ J;  5HS7 A;  4F7Z A;  2PJR A;  4IEJ A;  1HW5 A;  3SXY A;  3SYT A;  4BQN A;  3S17 J;  2GIV A;  1H8A C;  1TT5 B;  4A3C J;  1FIP A;  5ILU A;  2ZJP F;  1XCV A;  1JKQ C;  4PSW A;  5ICG A;  2X6W A;  1FPQ A;  3LSH A;  2LKP A;  2QBY A;  2K9L A;  4IQ4 A;  3VYU B;  1IO2 A;  4NUB A;  1H89 C;  1TWC J;  1XG1 A;  3Q0V A;  2VC1 A;  1X3U A;  1WCM J;  2VQG A;  2ZSH B;  4BJT A;  1QRY A;  2G7H A;  2IP2 A;  2HQN A;  2ZCW A;  3DXJ F;  4R8H A;  4PGH A;  1R23 A;  2VC0 A;  3PFI A;  1MH3 A;  5CVV A;  2FA5 A;  4MEY F;  3V4G A;  1P6R A;  2FML A;  2LH9 A;  2HU9 A;  3OOP A;  4A3M J;  2VQC A;  1YYV A;  4JP0 A;  4ESJ A;  2LY1 A;  4YII A;  3HOV J;  2V6E A;  1XC5 A;  2VQL A;  1S7E A;  3HKZ A;  2NS7 A;  2R0Q C;  5DCM A;  3BJA A;  4BY1 J;  2FRH A;  4HF1 A;  4P9F A;  1IN8 A;  3BT9 A;  4BNC A;  5C4X J;  2M4K A;  2YR2 A;  2P7C B;  4NBQ A;  5TIS C;  3OYB A;  5K7Z A;  4M3D A;  4RM3 A;  2HNH A;  3BDD A;  3BZ6 A;  1YS6 A;  3BJ6 A;  2M3A A;  2IS1 A;  1OFC X;  1NH3 A;  5CVR A;  3IRQ A;  4KIF A;  2WB1 N;  1OLT A;  3BG7 A;  1PVE A;  1X2M A;  4WXC A;  5CVI A;  2QQ9 A;  2M4G A;  3E6D A;  5ERI A;  3WU1 B;  1D5V A;  5F1J A;  2LR8 A;  4XN3 A;  2LFB A;  4L18 B;  2K85 A;  1SFK A;  2GAU A;  1O7L A;  1VQ4 I;  4A0Y A;  3BLY A;  4Y7N J;  4KYW A;  3MEX A;  1MMN A;  3ASO H;  1IUF A;  4M3B A;  2CQX A;  3GTL J;  4D5F A;  3RZO J;  2V9K A;  2LNB A;  1D0X A;  4PK4 A;  1WKM A;  2R7W A;  1A04 A;  3MZY A;  1EH8 A;  3V8L A;  2K9M A;  2DPD A;  4LGW A;  2PMU A;  2DYS H;  2E5N A;  2DDB A;  4IHW A;  1LDJ A;  4QIW N;  4RB3 C;  4CDG A;  2CUF A;  2FBH A;  1TNT A;  1V5G A;  3M8F A;  4UB8 C;  5CQE A;  4BE1 A;  1IAW A;  4MHG A;  1TQP A;  2W00 A;  5GP9 A;  3PM1 A;  4A0Z A;  3BG9 A;  4GFB A;  1U5T A;  4V19 K;  3RTR A;  1M1E B;  4I6Z A;  3S15 J;  1Z7U A;  3DP7 A;  1WI9 A;  2VBY A;  3T8T A;  1U5T C;  1U9O A;  2DTZ A;  1UFM A;  2EBI A;  3W2W A;  4HNT A;  4LIU A;  5D5V B;  3S1R J;  4II2 A;  2F5D A;  1BIB A;  2R7S A;  4XLE A;  1QGP A;  3QP5 A;  2H8R A;  4BQO A;  4LJZ F;  3CUQ A;  2PEX A;  3HHG A;  4A3D J;  4BYY A;  3OIQ A;  4OU0 A;  5M3F J;  1KQ9 A;  1Z77 A;  2I8D A;  2Q2E B;  3CUQ C;  3P9K A;  2IS6 A;  4AID A;  5CYV A;  2DMP A;  3E6M A;  2DPU A;  3FXQ A;  1FX7 A;  2VIX A;  2BW3 B;  3V7S A;  2Z2S B;  1XD7 A;  5ICC A;  5TJJ A;  1CF7 B;  4IHV A;  1I5Z A;  1DPU A;  2VOO A;  4BGD A;  1XS9 A;  2HOT A;  2VT3 A;  4M6V A;  4X1E A;  4BHB A;  3BR3 A;  3F9K A;  3WU2 C;  1BI0 A;  4DYR A;  1UZC A;  4ITV A;  2QSG X;  3CCV I;  3DTE A;  3F6V A;  2D1H A;  1WJE A;  4D0P A;  3RI4 A;  4P9U A;  4I99 C;  4EMS A;  3RZD J;  2HVQ A;  2WAE A;  3MAJ A;  3L2C A;  1JGS A;  4CSW A;  1E3P A;  2X6X A;  2Y48 A;  5E8G A;  1H9G A;  1LJ9 A;  4J00 A;  2RC4 A;  2P5L C;  1D0Y A;  1MMG A;  1OQY A;  1FLI A;  4FE7 A;  1RR8 C;  1GXP A;  2H09 A;  2W82 A;  2ZBK A;  3ZMS A;  4HDU A;  1PP7 U;  3WG7 H;  4ZTJ A;  1HOM A;  3FM3 A;  5FRO A;  4OMY A;  1J5Y A;  1ON1 A;  1W7P D;  5K7H A;  3ZQC A;  1Z3Y A;  1R00 A;  1ZYR F;  3FF5 A;  3FBN B;  4BQQ A;  4S05 A;  4XLC A;  1U9N A;  2KIM A;  5H6Q A;  5FGM A;  3KYD B;  2W1O A;  1BI1 A;  2E2I J;  5EG0 B;  5DTD A;  2EIJ H;  2VBZ A;  1YOV B;  1OCC H;  3BQY A;  2B7E A;  3L09 A;  2LVS A;  3IKV A;  2VUM J;  3HC7 A;  3OR1 C;  5F0F A;  3M9A A;  1W7P A;  3H9G A;  4IO9 F;  2EFQ A;  3CCU I;  4I2O A;  4Y33 A;  3MKW B;  3OOU A;  4J01 A;  2P0W A;  4B48 A;  4L5J A;  2CW0 F;  2JUG A;  1R6R A;  4XN0 A;  4EQQ A;  3DFG A;  5IT9 Z;  2W85 A;  3CCQ I;  3V42 A;  2XB0 X;  2JPB A;  2XF6 A;  5IPA A;  1IUY A;  1TC3 C;  1J7K A;  3UKG A;  4A93 J;  2M2E A;  2E1M C;  2NOG A;  3F3X A;  3DBH B;  4A3I J;  2Q8K A;  1WH7 A;  2VOD A;  1BJZ A;  1IN6 A;  1KU3 A;  1B9N A;  1WVR A;  5E1W A;  2HEO A;  1GVJ A;  4KN7 X;  1OCT C;  4KIT B;  1J9I A;  1R4N B;  1SFE A;  1X58 A;  3H5R A;  4ABZ A;  5DM7 F;  4CYC B;  2X51 A;  4L0Y B;  3ZCO A;  1X1P A;  5JHU A;  5C3E J;  2XRN A;  5B5E C;  4XKB A;  3Q0W A;  4LB6 B;  1B8I B;  3TOA A;  4HF0 A;  4Y52 J;  3DEU A;  4I01 A;  3JRA A;  3R6S A;  3H5N A;  5BMZ A;  4A3G J;  3HOT A;  1LNW A;  1F9N A;  4BL0 B;  2DT5 A;  4A5N A;  2XAH A;  3F8M A;  3WTT C;  1APL C;  1N75 A;  1QZY A;  2FD5 A;  1A5J A;  2K3F A;  2KRH A;  3ZRG A;  1ZLK A;  1P7I A;  3PQK A;  3NWS A;  1Z3X A;  2R7U A;  4HZF A;  3I4P A;  1ZAO A;  1XSX A;  4NNJ A;  1G3W A;  1ETK A;  1SD6 A;  2AHQ A;  3FXK A;  3B6A A;  4AC0 A;  1ZR4 A;  1YW8 A;  3CCR I;  3EDP A;  1OCZ H;  2KMU A;  4GCV A;  2OQR A;  3D5S C;  3OSG A;  4F92 B;  2L54 A;  1FNN A;  2HYF A;  3TW6 A;  1HW1 A;  4DW6 A;  3ESW B;  2GXA A;  3JTG A;  4DZJ A;  3QOP A;  2LYC A;  1R9T J;  1YE9 A;  4L9J A;  1ZGW A;  1BIA A;  2CQ7 A;  1LVK A;  1G3S A;  4G6Q A;  2R92 J;  3HSF A;  2R7T A;  4YFX F;  2W57 A;  2ZXI A;  1E2X A;  2ZC2 A;  2YUS A;  3KZI C;  4CGZ A;  2OV7 A;  4CUG A;  5EF6 A;  1LEB A;  1SAU A;  4JX6 A;  3LAP A;  1V5E A;  2VKV A;  3LSJ A;  4BDY A;  4KIC A;  4G12 A;  2F5C A;  4HX4 A;  4RGX A;  2CUZ A;  3MN2 A;  4IRH A;  2EA4 A;  2DK8 A;  4I76 A;  4AIH A;  3WHC A;  1X4O A;  5IOY A;  3FKJ A;  3E5Q A;  3IUO A;  2BXZ A;  2V79 A;  5E1Z B;  5FLV A;  4XLA A;  3KYC B;  1J2X A;  1I3A A;  1YRN B;  4XRM A;  5EEA A;  1UEL B;  5BS6 A;  4MQ9 F;  3BTC A;  4XMY A;  3E0J B;  2IXS A;  3R4K A;  4C2T A;  5D4R A;  2A3S A;  2Y0M A;  1DP7 P;  4KMU X;  2L3D A;  2CWE A;  3H36 A;  4AU7 A;  5J8F A;  2Y0S A;  2DMQ A;  2IGO A;  1QHH D;  3H5A A;  3PNY A;  3VPR A;  2VE8 A;  5K5O A;  1X3Z B;  2HS5 A;  3KP5 A;  4YIR X;  2ZKZ A;  3G1O A;  4LLG F;  4HOB A;  3J7Z I;  2OUM A;  3SQN A;  1FSH A;  1SD7 A;  2VT2 A;  2HZD A;  1NTC A;  5B1B H;  4BE2 A;  3DLA A;  2YU9 J;  1V54 H;  3OWT A;  1W36 D;  2IA2 A;  4JBA A;  2H8W A;  1ETV A;  4PZJ A;  5L3C A;  2VPR A;  1TWG J;  2BXY A;  3RYR A;  2HQA A;  3T1B A;  1D8K A;  1D1C A;  3AL0 C;  1WFX A;  5F04 A;  2M0C A;  1QO0 D;  1Y0U A;  4YIF A;  2AXL A;  1DU0 A;  3SFI A;  1FZP B;  3MKY B;  4IKF A;  2OD5 A;  3BRO A;  1PYV A;  2HZT A;  3REO A;  1MNM C;  3OS1 A;  1W1W E;  3LSR A;  2HOE A;  1DGR M;  3OYF A;  4LIT A;  1MJA A;  4B4C A;  1SMT A;  3M8J A;  3K4C A;  5KAI C;  2DDA A;  5E1X A;  2MSY A;  4MTD A;  1E3H A;  2QSF X;  3BG5 A;  1I1G A;  3MKL A;  3HRT A;  3DU5 A;  3ROU A;  3ZQH A;  1N25 A;  3I59 B;  3EYY A;  2JZY A;  3F6O A;  2CUE A;  2BY0 A;  5TGT A;  2XGX A;  2ESN A;  3DU6 A;  4RB2 C;  1JT0 A;  4IXA A;  4LLN A;  2ISY A;  1IRG A;  1Y56 A;  1N77 A;  4FX0 A;  1FOY A;  4PFP A;  5JVG F;  4YRV A;  3I71 A;  3DEW A;  5F64 A;  4D1Q A;  2GQQ A;  1QZE A;  3GXO A;  4E7L A;  3E7L A;  3PIO F;  2P7V B;  5K7F A;  2R5Z B;  4M3E A;  2GOM A;  5IP6 A;  3K4J A;  4ZDP A;  2LD5 A;  1K78 B;  3DKY A;  1ETX A;  3GFM A;  1X1B A;  5CVU A;  5FO5 A;  3JRG A;  1A6I A;  1G2H A;  2DJI A;  1GT0 C;  1O3R A;  4OIP F;  4BS9 A;  4CZC A;  3IC7 A;  1T08 B;  2D5V A;  4QPQ A;  3VSK A;  2Y2Z A;  1KYW A;  4IVN A;  3FMQ A;  3TBI A;  3K4K A;  4KUM A;  1RUO A;  1K6Y A;  2KQR A;  3CMM A;  3MMY B;  2L4M A;  3RIR A;  2R5Y B;  1JUS A;  1T0F A;  2A6H F;  3HEF A;  3BR1 A;  3KEQ A;  1Z9C A;  5K1Y A;  1T0F C;  1GV2 A;  1BI2 A;  1J59 A;  3PUF A;  2VXD A;  3S3N A;  1HC8 A;  1OKR A;  1F43 A;  1FTT A;  2G9W A;  3I0T A;  1JKP C;  2JK3 A;  2DO7 A;  2Y75 A;  5EG0 A;  1YW9 A;  2MD0 A;  1SAN A;  2R7F A;  1E0E A;  1FSE A;  1X2N A;  2M45 A;  1JUP A;  3WTS C;  3OYG A;  4XKV A;  5CLS A;  4B44 A;  3CJT B;  3L2R A;  1U6G A;  3GEZ A;  4Z2Y A;  1XSV A;  5ICE A;  3CF5 F;  2BEO A;  4A69 C;  4C30 A;  4E4H A;  5F0C A;  3ABT A;  3Q5F A;  2VBX A;  5FLM J;  1R5G A;  2X85 A;  3ZPL A;  3K2Z A;  3P7N A;  1VQN I;  3DTI A;  4OWR B;  1K83 J;  2O0Y A;  3RKQ A;  2IGK A;  5EDN A;  3LST A;  1YHQ I;  3G1L A;  3WTU C;  2AQF A;  2CRG A;  3ZQF A;  2LSO A;  4K2E A;  1MIJ A;  3A0B C;  2XV4 S;  4HST A;  3FK6 A;  3ONQ A;  1NG7 A;  2ZME B;  3IP4 B;  3E3V A;  2QCO A;  3KP2 A;  2UZK A;  2EJR A;  4LK1 F;  4P5O A;  2B63 J;  1MJ9 A;  3BPX A;  3ZQQ A;  3SEZ A;  3RCO A;  1MSE C;  2P81 A;  2JWT A;  1D3Y A;  4XLF A;  4C9Y A;  2CV1 A;  4EM0 B;  3M1C A;  2KT0 A;  1ULY A;  2ICW G;  2X1E A;  2W24 A;  5E3N A;  4UVB A;  5J47 A;  2HXO A;  1Z7L A;  2ZSI B;  1FMV A;  4XIC A;  2EA2 A;  1S9H A;  1Q1V A;  5DEQ A;  2CUJ A;  4DYQ A;  3N05 A;  3IV5 A;  2J5P A;  2H1L A;  4PDK A;  4RM2 A;  1U78 A;  1VQP I;  4UHT A;  4V2F A;  5LLQ A;  1E17 A;  2BBY A;  3TQN A;  2V9V A;  2EQR A;  3GFL A;  2EK5 A;  2MW8 A;  3H9Q A;  3KYL A;  1QU3 A;  1G4D A;  1BOB A;  1TLH B;  1KGS A;  2BVL A;  2XRO A;  5DS9 A;  4I0A A;  3GO5 A;  3MZH A;  3RPQ A;  2CJJ A;  2VE9 A;  5FLX Z;  2R3S A;  1DQU A;  1PP8 F;  2JTV A;  2O03 A;  1ZRE A;  4ENN A;  1G6N A;  3M07 A;  3RKX A;  4IPA A;  4Y15 A;  5LEK A;  2CH0 A;  2DK5 A;  2EH3 A;  1LE8 B;  3JRE A;  1OCO H;  5E3M A;  5KK1 A;  2K40 A;  3QYF A;  1FJL A;  3CDL A;  1YW7 A;  5DD4 A;  3F23 A;  2HXI A;  2GXG A;  2D45 A;  2DXI A;  3U21 A;  1ZLJ A;  3I56 I;  2XAG A;  1XGN A;  1Z21 A;  2PMZ A;  1FMW A;  4A2U A;  2AS5 F;  5E18 F;  3D1N I;  5M5Y J;  4FTH A;  1MD0 A;  3GUD A;  1L3L A;  3J7A O;  4N4O B;  3NQO A;  4M6X A;  3HOS A;  3PJR A;  3BTL A;  1STZ A;  3S2D J;  2E71 A;  4N9I A;  5TRD A;  4F91 B;  1HSJ A;  2Y30 A;  3GFJ A;  2P5K A;  2WA0 A;  2L01 A;  1W0T A;  4HV5 A;  3IWZ A;  3QP6 A;  3IKT A;  2RGV A;  5HNF A;  1T33 A;  1O3S A;  1Y6I A;  3D5L A;  4CIC A;  1FYL A;  4P55 A;  1OPC A;  5DCF A;  1RR7 A;  4FAS D;  3KCC A;  3ZP5 A;  4A6D A;  5IYD J;  1HA8 A;  2DLL A;  3CES A;  3JRI A;  3CCM I;  2IJL A;  1UJ8 A;  1FY7 A;  2OAZ A;  2WAQ N;  3LA3 A;  2XAS A;  4B09 A;  2W7N A;  1OCP A;  2A5W A;  2KFD A;  2RNJ A;  5EJC A;  2DQR A;  3TOB A;  3H3V K;  2OTJ I;  5HLI A;  2QQA A;  3G2B A;  3HOX J;  2P4W A;  2K86 A;  4NC8 A;  4QTR A;  3DLL F;  4KDP A;  1AU7 A;  1Z1D A;  3WHB A;  1T39 A;  4M73 A;  3K70 C;  2IVM A;  4ZTF A;  1KA8 A;  4G6T B;  2LG4 A;  2DA4 A;  5A2Q Z;  2K9Q A;  4E7K A;  4AUX A;  4YFK F;  5IOZ A;  2A69 F;  3UR3 C;  3DQV C;  4BJ5 C;  3R60 A;  2RV8 A;  3RKY A;  3ZQI A;  2KKO A;  3OYC A;  2A5Y B;  4O6J A;  1HCR A;  3SFZ A;  4RGS A;  2BV6 A;  2NOJ B;  4MGR A;  1VQ8 I;  2L2O A;  2ACJ A;  3K4M A;  1XDU A;  5A2Q K;  5FKN A;  4P96 A;  1YTY A;  3MWM A;  2AXT C;  2GA1 A;  1HDD C;  3M1E A;  3S1M J;  5IYB J;  4XOT A;  2BGC A;  3CJR B;  1YIO A;  3VOD A;  1SMY F;  3HTU A;  2K9S A;  4E70 A;  5LGT A;  3H9J A;  1CQT A;  2E2J J;  1K78 A;  5D5U B;  4U0W A;  3TO6 A;  4B1R A;  2N8G A;  2RKH A;  4GO1 A;  1QPI A;  4MNU A;  2LTP A;  4DOZ A;  2XF5 A;  2M34 A;  4A6E A;  1W5T A;  1LB2 A;  3FXL A;  2UV1 A;  3CCL I;  1WHU A;  2XGC A;  3HYI A;  4WX9 A;  2M7A A;  5LGU A;  1BC7 C;  3SZG A;  4ON0 A;  3JRF A;  1W4M A;  4LG0 A;  3ECO A;  1HBX G;  3S3O A;  3CCE I;  5AON A;  2KDZ A;  2R5Y A;  4LLL A;  2LBF B;  3HRM A;  3KZZ A;  1R5H A;  2V7F A;  5GPC A;  1BC8 C;  4PUS A;  4NDL A;  2L9R A;  1IDZ A;  2XC7 A;  3CC2 I;  2XKP A;  1RI7 A;  3ZMZ A;  5JLX A;  3IH4 A;  1LDD A;  3LAJ A;  3F8F A;  4LK0 F;  3HG9 A;  4S0H B;  5J1R A;  2V1U A;  4ZDO A;  2DJN A;  2IA1 A;  1B72 B;  4Q5S F;  2GZW A;  3BPV A;  4N0B A;  5CPR B;  2DU9 A;  4ESB A;  3WTX C;  4AD9 A;  1IF1 A;  2PFB A;  2VN2 A;  3GTQ J;  1IXS B;  2EIL H;  1XTA A;  3KLO A;  1DPR A;  3OYD A;  2LKX A;  3BCA A;  4I7H A;  3O2P E;  5FKL A;  5M5W J;  3V8J A;  3VYS B;  5HDK A;  1J09 A;  2FMY A;  3AG2 H;  4NC7 A;  1HLV A;  4IHX A;  1LPQ A;  3LFU A;  2KIS A;  4BHC A;  2ID6 A;  4XM3 A;  2B0L A;  3V7C A;  5JR3 A;  2PX9 A;  3OIP A;  2QQB A;  3K9T A;  1QNT A;  4LG3 A;  2EZI A;  4EJU A;  5HLT A;  2HR3 A;  1JT6 A;  3ABK H;  2XSD C;  2R7Q A;  5FD6 A;  2EPF A;  2G7U A;  2PBI A;  2OZ6 A;  3OL4 A;  4OOI A;  4RBO A;  1YJW I;  1ZRD A;  2R93 J;  2ZME A;  1MKM A;  2FXA A;  4WXH A;  4IHT A;  5K5R A;  4M6Y A;  3H1C A;  4KT5 C;  3DV8 A;  1PUF B;  2QQ8 A;  2QSH X;  2IBD A;  4P1W A;  3R0J A;  2ZME C;  1Z05 A;  3JRB A;  4Y3O A;  1ZG1 A;  3IRR A;  2ZXJ A;  2VON A;  4FCY A;  1IXR C;  3G73 A;  1L0O C;  2H1K A;  5HLG A;  5KAF C;  3IWF A;  4ETS A;  5JI6 A;  5FD5 A;  2OF7 A;  4NHJ A;  4AYB A;  3I64 A;  1RKW A;  1D5Y A;  1JXS A;  4GRI A;  4A3F J;  3C2B A;  4QSH A;  3TW7 A;  1ZGJ A;  4C3J J;  1D0Z A;  1OYW A;  2MGQ A;  3WGH A;  2MC3 A;  2COB A;  5BOX A;  1XGO A;  3MZ8 A;  2P8T A;  2VKE A;  1JHF A;  2JQ7 A;  4M3G A;  4CCN A;  1RZ4 A;  2LMD A;  3W6K B;  2JJ7 A;  3GZN B;  3B73 A;  4ASN A;  4EGZ A;  2F5V A;  2R7V A;  1WJC A;  3JSO A;  1YJ9 I;  3C2G A;  4Y17 A;  2Z9O A;  3M3Y J;  1YS7 A;  1AKH B;  3DCF A;  2DFF A;  3M8E A;  4UV8 A;  3H3Z A;  3K2A A;  1ZN2 A;  3RQI A;  5ILV A;  1OYY A;  2LKS A;  3RPU D;  3ZMV A;  5AIQ A;  3H0G J;  2DFI A;  4GYI A;  1ETW A;  2E35 A;  3AFH A;  2PJP A;  5E17 F;  2PG4 A;  4NC6 A;  4WK8 F;  5HVQ C;  1YQA A;  1Y39 A;  1MMS A;  2VQH A;  4NQW A;  1A31 A;  3X2Q H;  1LE8 A;  2IRF G;  4LIV A;  2EZK A;  3ISP A;  2QEX I;  2F5E A;  2DA7 A;  1T8I A;  2GOX B;  1S7A A;  2DW4 A;  4LD5 A;  2HKO A;  3HKZ N;  3D0S A;  3KEO A;  3CJN A;  2O8X A;  5L3E A;  3G71 I;  1MBE A;  3EUH A;  1ZTR A;  3HB9 A;  5CKT A;  3GF2 A;  4B47 A;  4DJA A;  3G1M A;  1JGG A;  3ECH A;  4DGW B;  1WQ2 A;  1VQO I;  1K6O A;  3EUH C;  4OAZ A;  4HRI A;  4UXN A;  2DOE A;  1WJF A;  1LFP A;  5JLW A;  3PIP F;  5BPD A;  4KNY A;  2DFH A;  2DA1 A;  3MCZ A;  2AO9 A;  3LSG A;  3S2H J;  3L2Q A;  4CHU A;  1HKS A;  1RES A;  3LSP A;  1G3Y A;  2WTE A;  2L5Q A;  1IDY A;  4UUS A;  3GBG A;  2DOA A;  3RKW A;  2O9L A;  3CMY A;  3G4S I;  2KP6 A;  3HZJ A;  1ITY A;  1IW7 F;  2BHY A;  3ZGK A;  1ETY A;  2CQK A;  3L7W A;  3BZK A;  3L9F A;  1XMA A;  1AHD P;  2WAD A;  4G6D A;  4U7D A;  3S1N J;  2YSR A;  1RET A;  2WAF A;  1XN7 A;  2Q1Z B;  2DA5 A;  3PNT A;  4YEJ A;  4RAF A;  3ZOB A;  3D5R C;  4HNV A;  5DV5 A;  2W4S A;  3BR2 A;  3VFZ A;  3T5X A;  1JE8 A;  2ELH A;  3F8C A;  5J1U A;  5J6X A;  2FJ1 A;  2ZNY A;  4ESF A;  4LMY A;  4OIR F;  4RB0 A;  1RNL A;  2XPU A;  5GAG J;  3OYJ A;  4MQV A;  2X48 A;  3CTA A;  2GBY A;  1BM9 A;  4MO7 A;  3F72 A;  4TV7 A;  4CXF A;  4R1H A;  1X4P A;  4CCM A;  2MG4 A;  1IG7 A;  2IPQ X;  4L0Z B;  2JPC A;  1ON2 A;  5EGO B;  1KON A;  4XLN F;  3ABU A;  4C3I J;  2E1C A;  3I4M J;  1IN4 A;  4BU2 A;  4L5E A;  2F5F A;  4G8X A;  1S8N A;  2L9N A;  1A36 A;  2H6B A;  1S6L A;  5IT3 A;  3S1Q J;  3FWE A;  4Q47 A;  1CGP A;  4X6A J;  3JCU C;  3EUA A;  3HSR A;  1FC3 A;  4XOP A;  1FP2 A;  2X6O A;  3LSK A;  1F4K A;  1C0W A;  2EFO A;  4JYK A;  4U88 A;  4A5M A;  5F1R A;  2DQL A;  1OIS A;  2AQE A;  2KLO A;  5GAD J;  2MYS A;  1D1B A;  5FFX A;  4DNC A;  3CUO A;  3HM5 A;  2ECB A;  2M0M A;  3SZT A;  2CGP A;  1BW6 A;  2UXN A;  2K4B A;  3FXO A;  3JRH A;  3CDH A;  3FDY A;  2WBM A;  1P4W A;  2E19 A;  3VB2 A;  5LFA A;  1SFO J;  1S3J A;  2K5C A;  3HTS B;  4FIS A;  2QKL B;  4BH9 A;  3KZY A;  2XB5 A;  3TL4 X;  4HLX A;  1JKR C;  2LP0 A;  2KZV A;  3FK7 A;  1XMK A;  3WE2 A;  2RNG A;  2KJB A;  1BW5 A;  1BR2 A;  3QOE A;  1B4A A;  3JAM Z;  3L00 A;  4E7I A;  1FIA A;  2F2E A;  5FKK A;  3FIS A;  3N97 A;  2QM3 A;  2XAU A;  4PCQ A;  1QVT A;  4XRS A;  3FXU A;  2L7F P;  1QBJ A;  2VKH A;  2YS9 A;  3QWL A;  1MBK A;  3JAM K;  4FX4 A;  2O8K A;  4GYG A;  1TWF J;  3FX3 A;  1FOW A;  3KP4 A;  2H6C A;  3E1S A;  2V9P A;  3COA C;  2RAE A;  2DBB A;  3A01 B;  4HPQ A;  4IL6 C;  3GTJ J;  4UV9 A;  1SD5 A;  2UWM A;  4L9V A;  1V4R A;  2GXB A;  3I54 A;  3TP0 A;  4IJA A;  1DUX C;  4HNU A;  3JRC A;  5M3M J;  4G7O F;  1Y1V J;  2XAJ A;  5FJ8 J;  4ZYD A;  3CMA I;  2OU2 A;  2COM A;  1W36 C;  2E1O A;  3EET A;  5EYR A;  4Y13 A;  2A6E F;  5JHF A;  2M5W A;  2ZJ2 A;  1GVD A;  1P2F A;  3GCM A;  1TZL A;  3RJP A;  1BOA A;  1MBJ A;  3BTJ A;  3ZMT A;  5ILS A;  4ANJ A;  4IHS A;  2XHK A;  2JA5 J;  3BR6 A;  4PJN A;  1A35 A;  2Q2E A;  1KYZ A;  4HLY A;  1Y8Q B;  3J7Y J;  1D8J A;  5F27 A;  2HQR A;  3S3M A;  2GM4 A;  3NWT A;  2QBY B;  4HQE A;  2BW3 A;  2XRL A;  1CF7 A;  2HVS A;  3K4L A;  3DTK A;  3BJO A;  4PSX A;  2NRA C;  4Q4Z F;  2XUB A;  3PQJ A;  3PUB A;  4IRI A;  3U1K A;  2M8E A;  5GTI C;  2Y31 A;  2K7L A;  1HW2 A;  3MQ0 A;  2D1V A;  5KNL A;  1OYI A;  2Z3Y A;  3GW2 A;  4X0G A;  2ME0 A;  2JA2 A;  2F4O B;  2DYR H;  3HJE A;  2J5O A;  2L7Z A;  3HGY A;  1O4X A;  3HOY J;  3AG4 H;  1O7F A;  3CLO A;  5DYM A;  1AKH A;  2QLZ A;  1WRJ A;  3I5U A;  5LHI A;  1MH4 A;  2JVG A;  1MBF A;  3C1D A;  2IGM A;  4U0Y A;  2RRE A;  3S14 J;  4CZZ A;  3MKZ A;  4M9Z A;  3E5U A;  1EH6 A;  2RQP A;  3B02 A;  1W5S A;  2DFE A;  3BCB A;  3ERE D;  3VOE A;  3CC7 I;  2BY1 A;  4BBR J;  1NK3 P;  2E36 A;  2PN6 A;  2KIQ A;  3MD2 A;  1X1A A;  3JR9 A;  1TTY A;  4OIO F;  2O61 A;  1EV7 A;  1UMQ A;  1V3F A;  1WJA A;  3ML6 A;  4RAZ A;  1MSF C;  1LUJ B;  2XSJ C;  3CC4 I;  1HKT A;  4UVA A;  3GVA A;  1KU7 A;  5D6E A;  3JSP A;  2M87 A;  1LQ1 A;  2IW5 A;  4EJO A;  3M7G A;  1ZHF A;  5IP7 J;  1IRX A;  1BJA A;  4C3H J;  1MBG A;  4XID A;  1R7J A;  2XDV A;  1J0R A;  4B8X A;  3GTG J;  3GZ5 A;  2JUC A;  4F52 A;  4HX7 A;  4M71 A;  4XRS G;  2F48 A;  1GHC A;  3QPL A;  2EFW A;  2X6Y A;  1WZ2 A;  5LRR A;  5HOO A;  3E6B A;  2OJE D;  1YG2 A;  2D2W A;  2P6T A;  4XKW A;  1EF4 A;  1GXQ A;  1UG2 A;  3A02 A;  4BE0 A;  1JHH A;  4EV0 A;  1WSU A;  3BQZ A;  2Y0S N;  2L4A A;  3Q9V A;  4G7H F;  3IHU A;  1MNE A;  1GLN A;  1IZ1 A;  3Q9S A;  3H0D A;  2PI0 A;  3IAS 2;  5HS9 A;  1KU9 A;  1S7O A;  4CCL A;  4CYC A;  2CV0 A;  2R7X A;  3S2W A;  4R79 A;  2XIG A;  4ZZL A;  5F08 A;  2XAQ A;  1U5T B;  1B8I A;  3HOW J;  3O3K A;  2O3F A;  2QEN A;  3BWG A;  3HPH A;  1FOK A;  2XGD A;  3J7A Y;  2DA3 A;  2WC2 A;  2NVY J;  1MDM B;  9ANT A;  2QF7 A;  5EEH A;  1OJL A;  2LF7 A;  5FKO A; 
#chains in the Genus database with same CATH homology
 3QU6 A;  4M9X A;  3GLX A;  1UHW A;  2YX7 A;  4IF4 A;  2DI3 A;  2R7D A;  5CJ9 A;  3F22 A;  4YFN F;  1O3Q A;  1FP1 D;  3HSE A;  1J75 A;  1FBQ A;  4KN4 X;  3DPL C;  3LWF A;  2E7X A;  1YLF A;  1R1T A;  4HBL A;  3I53 A;  4ZZD A;  5HDN A;  1HKQ A;  2HGC A;  2X4H A;  1T98 A;  1U3E M;  2KRF A;  5F6F A;  1T2K A;  2CSO A;  4FHT A;  4PGG A;  2ISZ A;  2E1N A;  1YO5 C;  4UVC A;  4OMZ A;  3T8R A;  3TDU C;  5BQT A;  4AIJ A;  3ZN0 A;  3QAH A;  1SAX A;  1RIO H;  1ZGA A;  1YFH A;  1NHA A;  3VEP A;  1TW3 A;  4EM1 A;  1ZG5 A;  4HF2 A;  2FBI A;  3FXR A;  4HYE A;  2YU3 A;  2A61 A;  5D5W B;  3LFK A;  4I98 B;  3E5X A;  2FEZ A;  3HRU A;  3DF8 A;  3KP6 A;  3LA7 A;  4I02 A;  2A07 F;  3GWZ A;  1F1Z A;  4KMF A;  3HHH A;  3K1N A;  1UST A;  3I59 A;  5ED4 A;  2FQ3 A;  4BXU A;  2STT A;  4XLP F;  5LEJ A;  2KJC A;  4CYD A;  4M74 A;  5JVT A;  2V1D A;  4I09 A;  2HWV A;  1WWX A;  3KE2 A;  3C7J A;  2HTJ A;  5FFZ A;  2OBP A;  3ELK A;  2ZNZ A;  3EQL F;  1RUN A;  3BP8 A;  4ZYG A;  2ZO4 A;  2JRT A;  3WOD F;  2V6C A;  1BN5 A;  3F8B A;  3K1P A;  4S04 A;  5D6F A;  3NRV A;  2BE5 F;  5E20 A;  4XSX F;  4JK1 X;  2FF4 A;  3KFW X;  1I6X A;  3NEU A;  1XDS A;  3CO7 C;  3CO6 C;  3FHZ A;  2M1B A;  3ZMU A;  3DPT A;  4FT8 A;  1O3T A;  2MLG A;  4O5V A;  3T0Y A;  2W25 A;  5H20 A;  1FYM A;  5EEG A;  2Z5U A;  4ENM A;  2Z99 A;  3N4M A;  4EJV A;  1REP C;  1HST A;  2CYY A;  1R22 A;  4G9Y A;  5L3D A;  4I0B A;  1DDN A;  2ZFW A;  2NAZ A;  2ADU A;  3LQR A;  1Z6T A;  4HW0 A;  1ZRC A;  1MJB A;  2BYV E;  2EV6 A;  2O6G E;  5LHH A;  4NB5 A;  5JFR A;  3K1M A;  3BY6 A;  1TBX A;  3GZ6 A;  3WTV C;  4KIG A;  3WGG A;  4Q48 A;  1P4X A;  5DUI A;  2QUF A;  2QZ8 A;  2MH2 A;  2W84 A;  1MDM A;  1B59 A;  3F8N A;  5L3F A;  3H3U A;  3U1D A;  3RDI A;  1F5T A;  1TW2 A;  2XKO A;  2P6S A;  2CG4 A;  5HDG A;  3QRF F;  4UNO A;  3SHF A;  3MFK A;  1ZG3 A;  5J8C A;  4M9S A;  4A12 A;  3QPH A;  1PDN C;  5K5Q A;  3WG9 A;  2C6Y A;  2FSW A;  2LDU A;  3U9G A;  2KIF A;  3ZMD A;  5ICF A;  3BOQ A;  4UUV A;  3RPU A;  2Z33 A;  1ZAR A;  3I58 A;  2HDC A;  1TNS A;  4HQM A;  5L3G A;  2EB7 A;  3P9I A;  4EVI A;  4RAY A;  1UCR A;  2K27 A;  2H94 A;  1MGT A;  3FMS A;  1SD4 A;  3C18 A;  4ZYH A;  3J80 Z;  4H0E A;  4HAM A;  4IRG A;  3O6B B;  3E6C C;  1OMI A;  3WE3 A;  3IL2 A;  1LDK B;  3TO9 A;  1KQ0 A;  2NNY A;  3W6J B;  1SFU A;  2PLY A;  3J80 K;  1TQI A;  1UHM A;  4EM2 A;  4LB5 A;  5IT9 K;  4EJT A;  2A68 F;  2WV0 A;  1LVA A;  1T6S A;  2K4J A;  2VXZ A;  4AVP A;  2JT1 A;  1T38 A;  1OR7 A;  2NYX A;  2JSC A;  2LF8 A;  3LA2 A;  1ONV A;  1K7A A;  1O57 A;  2FU4 A;  2QYO A;  2ETH A;  1U8R A;  1SFX A;  2FNA A;  5D4S A;  2RDP A;  1KU2 A;  4HV6 A;  4L9N A;  3F21 A;  5H6R A;  2UXX A;  1XGS A;  2CO5 A;  3KP7 A;  4BHP A;  5LGN A;  1IXC A;  1G3T A;  4CO8 A;  3WTW C;  4WXD A;  5D8L B;  3H92 A;  2MBF A;  2HYG D;  3QPT A;  1K79 A;  2KIU A;  2E7W A;  2MA3 A;  2V1X A;  3TDZ C;  3DKW A;  5BPI A;  4OIN F;  3KP3 A;  2GWR A;  4RS8 A;  2OQG A;  3SZP A;  4O3M A;  4QLC U;  3HUG A;  1I27 A;  2PMH A;  2XVC A;  2Q0O A;  1KQ8 A;  2IT0 A;  3HIF A;  3GYH X;  2FE3 A;  4ENK A;  4XRF A;  1R1U A;  4N9H A;  4YG2 F;  4AWX B;  2P5V A;  3LQQ A;  3TO7 A;  2L02 A;  2VBW A;  4KA4 A;  3FZV A;  5DD8 A;  2K02 A;  3KLN A;  2TDX A;  4L9T A;  4EGY A;  2EFN A;  2MH9 A;  2MLK A;  2XAF A;  5DUK A;  3C3W A;  3ZQ7 A;  2VOP A;  4WCG A;  3TGN A;  5L3B A;  3ULQ B;  3E97 A;  5DCM B;  1XSD A;  3FMR A;  1PUE E;  4G94 A;  1Q1H A;  4ZYE A;  2FBK A;  2QWW A;  5HLH A;  5LHG A;  4ZH4 F;  5CVJ A;  3JTH A;  1AWC A;  1IRF A;  1MZB A;  1UB9 A;  5FB2 A;  2M30 A;  4M72 A;  2NNN A;  1FWZ A;  3V7R A;  2WWY A;  4LG0 B;  1IN5 A;  1P92 A;  1ODD A;  3HRS A;  4RGU A;  3J81 Z;  2OZU A;  1H9T A;  4AIK A;  4HX8 A;  3AAF A;  3WTZ A;  2EV0 A;  4GGG A;  3WU0 A;  3K69 A;  1R58 A;  3J81 K;  1I1S A;  1Z6R A;  1IN7 A;  3OV8 A;  3JW4 A;  5LBQ A;  3P9C A;  5DDG A;  6PAX A;  1HQC A;  4XBF A;  4RGR A;  1FBU A;  1FBS A;  3RYP A;  4BQA A;  2ESH A;  4QWQ A;  2IA0 A;  4RB1 A;  2MD5 A;  4MTE A;  5LRS A;  3CUQ B;  4GXO A;  5D8K B;  2EFP A;  2HKX A;  2RN7 A;  4HDV A;  1S29 A;  4EJW A;  3FM5 A;  4KIB A;  4A0X A;  2HFH A;  3G3Z A;  1QQI A;  5HS8 A;  4OIQ F;  2EWN A;  4ENJ A;  1XGM A;  2STW A;  1B6A A;  3TKY A;  4DQ2 A;  3R61 A;  1AOY A;  3GX4 X;  3WTY C;  1ZRF A;  1LEA A;  1XB4 A;  2HTS A;  1FYK A;  1B9M A;  2EV5 A;  2NS0 A;  2H27 A;  3R0A A;  4KFC A;  4WWC A;  4WF2 A;  5KVR A;  1BBY A;  2YX4 A;  4G7Z F;  1U2W A;  2FNP A;  1HXD A;  1B1B A;  4U7B A;  1FT9 A;  5D5X B;  1USS A;  4JQF A;  2CFX A;  2PQ8 A;  4L5I A;  3GFI A;  2X0L A;  1EH7 A;  3KET A;  2GA2 A;  2FOK A;  5FLX K;  5E8I A;  4XSZ F;  4MEX F;  1BI3 A;  3EYI A;  1W7P B;  3ZN1 A;  4U0V A;  2QVO A;  1VTN C;  4HA8 A;  1ZH5 A;  1TQM A;  1H0M A;  4BAY A;  3WGI A;  1QPM A;  1QZZ A;  1Z91 A;  5AIP A;  1R36 A;  3QU3 A;  2DTR A;  1R1V A;  1P4A A;  2YPR A;  1XCB A;  3U2R A;  2OA4 A;  4LFU A;  3K0L A;  2DAO A;  2RVC A;  3V8K A;  5HS7 A;  4F7Z A;  3SXY A;  1HW5 A;  2GIV A;  5ILU A;  1XCV A;  5ICG A;  1FPQ A;  2LKP A;  2QBY A;  2VC1 A;  1X3U A;  2G7H A;  2IP2 A;  2ZCW A;  2HQN A;  3DXJ F;  4R8H A;  4PGH A;  1R23 A;  2VC0 A;  3PFI A;  5CVV A;  2FA5 A;  4MEY F;  3V4G A;  1P6R A;  2FML A;  3OOP A;  1YYV A;  4ESJ A;  4YII A;  5DCM A;  3BJA A;  2FRH A;  4HF1 A;  4P9F A;  1IN8 A;  4BNC A;  2YR2 A;  2P7C B;  3BDD A;  3BZ6 A;  1YS6 A;  3BJ6 A;  5CVR A;  3IRQ A;  4KIF A;  4WXC A;  5CVI A;  2QQ9 A;  3E6D A;  5ERI A;  3WU1 B;  1D5V A;  4L18 B;  2GAU A;  1O7L A;  4A0Y A;  4KYW A;  3MEX A;  2LNB A;  1WKM A;  1A04 A;  3MZY A;  1EH8 A;  3V8L A;  2DPD A;  4LGW A;  2PMU A;  1LDJ A;  4RB3 C;  4CDG A;  2FBH A;  1TNT A;  3M8F A;  1IAW A;  4MHG A;  1TQP A;  4A0Z A;  1U5T A;  3RTR A;  1Z7U A;  3DP7 A;  1WI9 A;  2VBY A;  3T8T A;  1U5T C;  1UFM A;  5D5V B;  2F5D A;  1BIB A;  1QGP A;  3QP5 A;  4LJZ F;  3CUQ A;  2PEX A;  3HHG A;  4BYY A;  4OU0 A;  1KQ9 A;  3CUQ C;  3P9K A;  5CYV A;  3E6M A;  2DPU A;  3FXQ A;  1FX7 A;  3V7S A;  5ICC A;  1XD7 A;  5TJJ A;  1CF7 B;  1I5Z A;  1DPU A;  2VOO A;  2VT3 A;  4BHB A;  1BI0 A;  3F6V A;  2D1H A;  4D0P A;  3RI4 A;  4P9U A;  4EMS A;  3MAJ A;  3L2C A;  1JGS A;  2Y48 A;  5E8G A;  1H9G A;  1LJ9 A;  2RC4 A;  2P5L C;  1FLI A;  1GXP A;  2H09 A;  2ZBK A;  3ZMS A;  4HDU A;  1PP7 U;  3FM3 A;  4OMY A;  1J5Y A;  1ON1 A;  1W7P D;  1ZYR F;  1R00 A;  3FF5 A;  4S05 A;  2KIM A;  5H6Q A;  5FGM A;  1BI1 A;  2VBZ A;  3L09 A;  3IKV A;  3M9A A;  1W7P A;  2EFQ A;  4I2O A;  4L5J A;  2CW0 F;  4EQQ A;  3DFG A;  5IT9 Z;  2W85 A;  2JPB A;  1IUY A;  1J7K A;  3F3X A;  2Q8K A;  2VOD A;  1IN6 A;  1KU3 A;  1B9N A;  5E1W A;  2HEO A;  1GVJ A;  4KN7 X;  1J9I A;  1SFE A;  4L0Y B;  5JHU A;  2XRN A;  4LB6 B;  3TOA A;  4HF0 A;  3DEU A;  4I01 A;  3R6S A;  5BMZ A;  3HOT A;  1LNW A;  1F9N A;  2DT5 A;  4A5N A;  2XAH A;  3F8M A;  3WTT C;  1QZY A;  1ZLK A;  3PQK A;  4HZF A;  3I4P A;  1ZAO A;  1XSX A;  1G3W A;  1SD6 A;  1YW8 A;  3EDP A;  4GCV A;  2OQR A;  2L54 A;  1FNN A;  2HYF A;  1HW1 A;  3JTG A;  3QOP A;  4L9J A;  1BIA A;  1G3S A;  4G6Q A;  3HSF A;  4YFX F;  2W57 A;  1E2X A;  4CGZ A;  1LEB A;  3LAP A;  4KIC A;  2F5C A;  4HX4 A;  4RGX A;  4IRH A;  2EA4 A;  2DK8 A;  4AIH A;  3E5Q A;  2V79 A;  5E1Z B;  1J2X A;  5BS6 A;  4MQ9 F;  3R4K A;  5D4R A;  2A3S A;  2Y0M A;  1DP7 P;  4KMU X;  2L3D A;  2CWE A;  5J8F A;  2VE8 A;  5K5O A;  2HS5 A;  3KP5 A;  2ZKZ A;  4LLG F;  4HOB A;  3SQN A;  1FSH A;  1SD7 A;  2VT2 A;  2IA2 A;  4JBA A;  4PZJ A;  5L3C A;  3RYR A;  3T1B A;  1D8K A;  1QO0 D;  1Y0U A;  4YIF A;  2AXL A;  1FZP B;  2OD5 A;  3BRO A;  2HZT A;  3REO A;  2HOE A;  1MJA A;  1SMT A;  5E1X A;  4MTD A;  3ROU A;  1I1G A;  3HRT A;  3I59 B;  3EYY A;  2JZY A;  3F6O A;  2XGX A;  2ESN A;  4RB2 C;  4IXA A;  4LLN A;  2ISY A;  1IRG A;  4FX0 A;  3I71 A;  5F64 A;  2GQQ A;  3GXO A;  2P7V B;  1K78 B;  3GFM A;  5CVU A;  5FO5 A;  1O3R A;  4OIP F;  3IC7 A;  1KYW A;  4IVN A;  3FMQ A;  4KUM A;  1RUO A;  2L4M A;  3RIR A;  1T0F A;  2A6H F;  3KEQ A;  1Z9C A;  5K1Y A;  1BI2 A;  1J59 A;  1OKR A;  2G9W A;  3I0T A;  2DO7 A;  2Y75 A;  1YW9 A;  2R7F A;  1FSE A;  2M45 A;  3WTS C;  5CLS A;  1U6G A;  3GEZ A;  4Z2Y A;  1XSV A;  5ICE A;  2BEO A;  3ABT A;  3Q5F A;  2VBX A;  1R5G A;  3ZPL A;  3K2Z A;  3P7N A;  2O0Y A;  3LST A;  3WTU C;  2LSO A;  4K2E A;  2XV4 S;  2ZME B;  3E3V A;  3KP2 A;  2UZK A;  2EJR A;  4LK1 F;  4P5O A;  1MJ9 A;  3BPX A;  1D3Y A;  4EM0 B;  1ULY A;  2W24 A;  4UVB A;  2EA2 A;  5DEQ A;  2J5P A;  1U78 A;  4PDK A;  4UHT A;  5LLQ A;  1E17 A;  2BBY A;  3TQN A;  2V9V A;  3GFL A;  2EK5 A;  1G4D A;  1TLH B;  1KGS A;  2XRO A;  4I0A A;  3GO5 A;  3MZH A;  3RPQ A;  2VE9 A;  5FLX Z;  2R3S A;  1PP8 F;  2JTV A;  2O03 A;  1ZRE A;  4ENN A;  1G6N A;  3RKX A;  4IPA A;  4Y15 A;  5LEK A;  2DK5 A;  5KK1 A;  1YW7 A;  5DD4 A;  3F23 A;  2GXG A;  2D45 A;  1ZLJ A;  2XAG A;  1XGN A;  4A2U A;  2AS5 F;  5E18 F;  1MD0 A;  3GUD A;  1L3L A;  3J7A O;  3NQO A;  4M6X A;  3HOS A;  1STZ A;  4N9I A;  5TRD A;  1HSJ A;  3GFJ A;  2P5K A;  2L01 A;  4HV5 A;  3IWZ A;  3QP6 A;  3IKT A;  2RGV A;  1O3S A;  3D5L A;  4CIC A;  1FYL A;  4P55 A;  1OPC A;  5DCF A;  3KCC A;  3ZP5 A;  4A6D A;  2DLL A;  2IJL A;  1FY7 A;  2OAZ A;  3LA3 A;  2XAS A;  4B09 A;  2RNJ A;  2DQR A;  3TOB A;  5HLI A;  2QQA A;  2P4W A;  2K86 A;  4KDP A;  1Z1D A;  1T39 A;  4M73 A;  2IVM A;  1KA8 A;  5A2Q Z;  4YFK F;  2A69 F;  3DQV C;  3R60 A;  2RV8 A;  3RKY A;  2KKO A;  2A5Y B;  4O6J A;  3SFZ A;  4RGS A;  2BV6 A;  4MGR A;  2ACJ A;  1XDU A;  5A2Q K;  4P96 A;  1YTY A;  3MWM A;  2GA1 A;  3M1E A;  2BGC A;  1YIO A;  3VOD A;  1SMY F;  5LGT A;  3HTU A;  4E70 A;  1K78 A;  5D5U B;  4U0W A;  3TO6 A;  2RKH A;  4GO1 A;  4MNU A;  4A6E A;  1W5T A;  1LB2 A;  3HYI A;  4WX9 A;  5LGU A;  1BC7 C;  4ON0 A;  1W4M A;  4LG0 A;  3ECO A;  1HBX G;  5AON A;  4LLL A;  3HRM A;  3KZZ A;  1R5H A;  1BC8 C;  2XKP A;  1RI7 A;  3ZMZ A;  1LDD A;  3LAJ A;  3F8F A;  4LK0 F;  2V1U A;  2IA1 A;  4Q5S F;  2GZW A;  3BPV A;  4N0B A;  2DU9 A;  4ESB A;  3WTX C;  4AD9 A;  1IF1 A;  2PFB A;  2VN2 A;  1IXS B;  3KLO A;  1DPR A;  4I7H A;  3O2P E;  3V8J A;  5HDK A;  2FMY A;  4BHC A;  2B0L A;  3V7C A;  5JR3 A;  2QQB A;  3K9T A;  1QNT A;  4EJU A;  2HR3 A;  5FD6 A;  2G7U A;  2PBI A;  2OZ6 A;  4OOI A;  1ZRD A;  2ZME A;  1MKM A;  2FXA A;  4WXH A;  4IHT A;  5K5R A;  4M6Y A;  4KT5 C;  3DV8 A;  3R0J A;  1Z05 A;  1ZG1 A;  3IRR A;  2ZXJ A;  2VON A;  1IXR C;  3G73 A;  1L0O C;  5HLG A;  3IWF A;  4ETS A;  5JI6 A;  5FD5 A;  4NHJ A;  3I64 A;  1JXS A;  1ZGJ A;  1OYW A;  2MC3 A;  5BOX A;  1XGO A;  2P8T A;  1JHF A;  1RZ4 A;  3W6K B;  4ASN A;  4EGZ A;  3B73 A;  3JSO A;  2Z9O A;  4Y17 A;  1YS7 A;  3M8E A;  4UV8 A;  3H3Z A;  1ZN2 A;  5ILV A;  1OYY A;  3ZMV A;  5AIQ A;  2DFI A;  4GYI A;  2PJP A;  5E17 F;  2PG4 A;  4WK8 F;  5HVQ C;  1YQA A;  4NQW A;  2IRF G;  3ISP A;  2F5E A;  1S7A A;  2DW4 A;  4LD5 A;  2HKO A;  3D0S A;  3KEO A;  3CJN A;  2O8X A;  5L3E A;  3EUH A;  3GF2 A;  3ECH A;  1WQ2 A;  1K6O A;  4UXN A;  4KNY A;  5BPD A;  3MCZ A;  4CHU A;  1HKS A;  1G3Y A;  2WTE A;  3RKW A;  1IW7 F;  3L9F A;  2CQK A;  3L7W A;  1XMA A;  4G6D A;  4U7D A;  2YSR A;  1XN7 A;  5DV5 A;  3VFZ A;  3T5X A;  1JE8 A;  2ELH A;  3F8C A;  5J6X A;  2ZNY A;  4ESF A;  4LMY A;  4OIR F;  4RB0 A;  1RNL A;  4MQV A;  3CTA A;  1BM9 A;  3F72 A;  4TV7 A;  4CXF A;  4R1H A;  2IPQ X;  4L0Z B;  2JPC A;  1ON2 A;  4XLN F;  3ABU A;  2E1C A;  1IN4 A;  2F5F A;  4G8X A;  1S8N A;  2H6B A;  1S6L A;  5IT3 A;  3FWE A;  4Q47 A;  1CGP A;  3HSR A;  1FC3 A;  1FP2 A;  1F4K A;  1C0W A;  2EFO A;  4U88 A;  4A5M A;  5F1R A;  2DQL A;  5FFX A;  4DNC A;  3CUO A;  3SZT A;  2CGP A;  2UXN A;  2K4B A;  3CDH A;  1P4W A;  3VB2 A;  1S3J A;  3HTS B;  4BH9 A;  3KZY A;  4HLX A;  1XMK A;  3WE2 A;  2KJB A;  1B4A A;  3JAM Z;  3L00 A;  2F2E A;  3N97 A;  2QM3 A;  4PCQ A;  3FXU A;  1QBJ A;  4FX4 A;  3JAM K;  4GYG A;  3FX3 A;  3KP4 A;  2H6C A;  3COA C;  2DBB A;  4UV9 A;  1SD5 A;  2UWM A;  4L9V A;  1V4R A;  2GXB A;  3I54 A;  4IJA A;  1DUX C;  4G7O F;  2XAJ A;  4ZYD A;  2OU2 A;  2COM A;  3EET A;  4Y13 A;  2A6E F;  2M5W A;  2ZJ2 A;  1P2F A;  3RJP A;  1BOA A;  3ZMT A;  5ILS A;  4IHS A;  2XHK A;  2Q2E A;  1KYZ A;  4HLY A;  1D8J A;  2HQR A;  2QBY B;  4HQE A;  1CF7 A;  3BJO A;  2NRA C;  4Q4Z F;  2XUB A;  3PQJ A;  4IRI A;  2M8E A;  2K7L A;  1HW2 A;  3MQ0 A;  2D1V A;  1OYI A;  2Z3Y A;  3GW2 A;  2J5O A;  1O7F A;  3CLO A;  5DYM A;  2QLZ A;  1WRJ A;  3I5U A;  5LHI A;  3C1D A;  4U0Y A;  4CZZ A;  4M9Z A;  3E5U A;  1EH6 A;  2RQP A;  3B02 A;  1W5S A;  3ERE D;  3VOE A;  2PN6 A;  1TTY A;  4OIO F;  2O61 A;  1EV7 A;  1V3F A;  3ML6 A;  4RAZ A;  1HKT A;  4UVA A;  3GVA A;  1KU7 A;  5D6E A;  3JSP A;  2M87 A;  1LQ1 A;  2IW5 A;  4EJO A;  3M7G A;  1ZHF A;  1BJA A;  1R7J A;  4B8X A;  1J0R A;  3GZ5 A;  4HX7 A;  4M71 A;  1GHC A;  2EFW A;  5LRR A;  5HOO A;  3E6B A;  1YG2 A;  2D2W A;  2P6T A;  1GXQ A;  1JHH A;  4EV0 A;  1WSU A;  2L4A A;  3Q9V A;  4G7H F;  3IHU A;  3Q9S A;  2PI0 A;  1IZ1 A;  5HS9 A;  1KU9 A;  1S7O A;  3S2W A;  4R79 A;  2XIG A;  4ZZL A;  2XAQ A;  1U5T B;  3O3K A;  2O3F A;  2QEN A;  3BWG A;  1FOK A;  2WC2 A;  1MDM B;  5EEH A;  2LF7 A;  3WGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...