2M87A

Structural basis of dna recognition by the effector domain of klebsiella pneumoniae pmra
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
103
structure length
103
Chain Sequence
NQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSWDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANNIDTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Transcriptional regulatory protein basR/pmrA
publication title Solution structure and tandem DNA recognition of the C-terminal effector domain of PmrA from Klebsiella pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 17
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m87A00
1B9MA 3CUQA 1IUYA 1KQ0A 3F23A 5K5OA 2QWWA 4JBAA 1ZRCA 3RKWA 3FF5A 1BIAA 1FY7A 2P6SA 4L18B 2DI3A 1LEAA 3HTSB 1J75A 5D4RA 2F5DA 3ZMZA 4S04A 3QU6A 3K9TA 4EQQA 3GZ6A 2G7UA 2G9WA 2A69F 5BPIA 4U88A 2ELHA 4HV5A 5H6QA 1KU9A 2JSCA 5ICFA 1Z7UA 2L54A 1Z6RA 1IN8A 1ONVA 2ZO4A 4MTEA 2Z5UA 2W24A 4BHBA 2H6CA 5EEGA 3F21A 5AONA 1T2KA 1IXRC 1XSXA 3WTZA 3L2CA 2JTVA 4QWQA 3JW4A 2GA2A 2NAZA 4GYIA 1YS6A 2FMYA 3DEUA 2V79A 3IKTA 5LRRA 1R36A 4CICA 4HQEA 2DO7A 4TV7A 5A2QK 1HKSA 3LA3A 2A07F 2BBYA 2XAHA 4WXHA 3C7JA 4RGUA 1OR7A 1EH8A 3DPTA 1IZ1A 3E97A 4BHCA 1IRFA 2CSOA 2LKPA 3TKYA 4I02A 2K27A 3EUHA 1WI9A 5FD5A 3CO6C 4EVIA 2PQ8A 3MWMA 3KEQA 3K69A 1SD4A 3RDIA 2VC1A 2RVCA 2HZTA 1Z6TA 3KP4A 1F1ZA 3HSEA 3ABUA 3FWEA 1YIOA 2CO5A 4L0ZB 4R79A 1OYYA 3M1EA 1OPCA 3KP3A 2QQBA 3BOQA 1LVAA 4HW0A 3W6KB 2ZNYA 3PFIA 5L3EA 2VN2A 3F6VA 4HDVA 1QNTA 1H0MA 2QQ9A 2ZFWA 1J0RA 3FMRA 2XV4S 3HOTA 1EV7A 4HX7A 4KUMA 3LQQA 3VOEA 2PEXA 1KA8A 4I0AA 2IA2A 3ZMVA 1FC3A 3TQNA 4AD9A 2VT3A 5JI6A 4HV6A 3GYHX 1YW7A 4EM1A 2O3FA 3DQVC 3KLNA 3MQ0A 3CUOA 3KP6A 3I59A 1R00A 3LSTA 4ENKA 1HQCA 4E70A 4IHTA 5CLSA 3V8LA 3GLXA 3HRUA 5L3BA 4PGHA 3E5QA 1XGNA 1R23A 3O3KA 4WWCA 2YX7A 3HOSA 3MEXA 1JGSA 3RPUA 2D1HA 2MBFA 4EMSA 5D6FA 1FPQA 4H0EA 3GF2A 3MZHA 3DF8A 1IXSB 3BWGA 2WC2A 3K1MA 2GA1A 3RYPA 1U3EM 2OZUA 4M71A 1SMTA 3LAJA 4CHUA 1BN5A 5J8CA 2QYOA 2P8TA 1XN7A 1MJ9A 2HOEA 2XROA 5ILUA 3RI4A 1YS7A 2ZJ2A 1RNLA 4GYGA 4KN4X 3E6MA 2GXBA 4HA8A 4L9JA 1B9NA 3ZQ7A 2L4AA 2FBHA 3KZZA 1USTA 3IRRA 2VODA 3WODF 1HKQA 2Q8KA 3RKYA 3WE2A 4Q48A 2K4JA 3QP6A 1G3SA 4N9IA 2HS5A 5TJJA 2Y48A 1E17A 3JAMK 2RDPA 3C1DA 3PQKA 4FHTA 2HTJA 3C18A 3I64A 1SAXA 2AXLA 1I1GA 1LJ9A 1F9NA 2KRFA 2K02A 4AIJA 3WE3A 3NRVA 4O3MA 2V1DA 3IKVA 5DEQA 3WTUC 4OIQF 3IL2A 4HF0A 2YPRA 4HDUA 3BROA 3V4GA 2BV6A 4M72A 4HF2A 4G7OF 2X4HA 1P2FA 4UVAA 2ZBKA 1R5GA 1H9GA 3R4KA 2IA0A 2HFHA 4IRHA 2VBXA 1UB9A 2O61A 3CTAA 4IRIA 4WCGA 4JQFA 3BP8A 2FNAA 1PDNC 5F64A 5FFZA 1LDDA 4HX8A 3OV8A 3REOA 2QUFA 2EV6A 4XLNF 4LB5A 1PP7U 3LA7A 2XRNA 2IRFG 2M45A 4KMUX 1RZ4A 2UXXA 4EV0A 2QENA 3SQNA 2ZMEA 1JHFA 1P92A 2NYXA 3WGGA 1BOAA 4NQWA 5E1ZB 2IW5A 4Z2YA 3P7NA 4BHPA 1G4DA 1T6SA 1KQ9A 2OQRA 4Q5SF 4GXOA 4CGZA 1U8RA 1IXCA 2V9VA 1MGTA 2YSRA 4MHGA 2O03A 1EH7A 5L3CA 4M74A 4KIFA 2BEOA 5E8IA 4UV9A 3QU3A 3ZP5A 4M9ZA 4YFNF 3J80K 4CO8A 3KP2A 3U9GA 1BI2A 1IAWA 2O8XA 4OINF 2NNNA 1MD0A 2YU3A 1R1TA 1F5TA 2V1XA 3J81K 5CJ9A 3SFZA 5JHUA 2VT2A 5FO5A 1K79A 1ZH5A 2J5PA 5FD6A 3K1NA 4FT8A 4KYWA 4ON0A 3EETA 2M8EA 3GXOA 3H3ZA 4G8XA 4EM0B 1HBXG 2DLLA 3WGIA 3I58A 1B4AA 1QPMA 4EJTA 4Y13A 4ENMA 3CUQC 5J6XA 3T8TA 2OBPA 4EJVA 4L9TA 2NNYA 3F8MA 1TNTA 2TDXA 2Y0MA 2EFNA 3KZYA 3ZN0A 1HSTA 4RS8A 5DDGA 1J2XA 2KKOA 1BI1A 2CQKA 2VE9A 3GX4X 2HYGD 1TBXA 2JPCA 2AS5F 1JHHA 3TO7A 3RYRA 2F5EA 2DTRA 4IXAA 1ZYRF 2F2EA 1RI7A 5FB2A 1BI3A 3HSFA 4LG0A 4HBLA 2DK5A 4K2EA 5DV5A 3M8EA 2IVMA 5F6FA 3W6JB 1YW8A 2KIMA 3I4PA 1ZLJA 2WV0A 2H94A 2HKOA 3K0LA 3F8FA 2DBBA 2KJCA 4I01A 1AOYA 1UCRA 2XIGA 3CDHA 3P9CA 3RTRA 5DD4A 5FLXK 1IW7F 3L9FA 4M6XA 3EDPA 1E2XA 1TQIA 4KICA 4A2UA 2ETHA 4IRGA 4OIOF 4ENNA 1VTNC 4A5MA 1ODDA 2FBKA 3H92A 5HOOA 1K78B 5D4SA 3V7CA 1RIOH 1MJAA 2EA2A 1HW2A 2QVOA 1ZREA 1TQPA 2H09A 4ASNA 5BMZA 2ZCWA 1U78A 1YTYA 2Q0OA 5CVIA 4O5VA 2PLYA 1YFHA 1R1UA 2A6HF 3C3WA 2PG4A 3HYIA 2FNPA 1BC7C 2FA5A 1HSJA 2VBZA 1BC8C 2C6YA 4AIHA 1LB2A 1LNWA 3CUQB 4L0YB 2RNJA 1T38A 2XKPA 1LQ1A 1FP2A 3HTUA 5E1XA 5F1RA 1P4XA 1V3FA 2PI0A 1MKMA 4HAMA 1P6RA 3R6SA 1WQ2A 1D8KA 4ZYEA 2HWVA 4BNCA 1O7FA 4RB0A 4LGWA 3CO7C 4KFCA 1BJAA 2EFOA 5DYMA 2ESHA 2K4BA 1YG2A 2WWYA 3EQLF 1XSDA 2ISZA 1D5VA 4U7DA 2PBIA 2XAQA 3G3ZA 5KK1A 1ZHFA 5LGNA 3JAMZ 1STZA 2VBWA 3DV8A 3COAC 4D0PA 4G9YA 1IRGA 3QRFF 2LNBA 4I2OA 2A5YB 1HW1A 1PUEE 3WG9A 5IT9Z 1J5YA 4A0ZA 1JE8A 1IN6A 4KIGA 1S3JA 4ZH4F 3JSPA 1GHCA 3I54A 3RIRA 4FX4A 3N4MA 3ZMDA 4ZZDA 4BH9A 2M30A 2KIFA 2E7XA 2KJBA 5LRSA 1W7PA 2V6CA 3Q9SA 3KFWX 1ZRFA 2NRAC 1W4MA 5DCMA 3JSOA 3KCCA 4KIBA 3KP5A 3E6BA 2L02A 1KU7A 5HDGA 4F7ZA 1SFXA 1QO0D 2E7WA 3I71A 3P9IA 2DK8A 3ZMTA 3BY6A 4IVNA 2DPDA 4GGGA 4YFKF 1UHWA 1Z1DA 3WTTC 2VBYA 1CF7A 2L3DA 1R7JA 1TNSA 3S2WA 1HXDA 1XDUA 3QPTA 2EK5A 2STTA 1WKMA 5ICGA 1XDSA 1U5TC 3ZMUA 4A6EA 2B0LA 2QBYA 4MQVA 2GAUA 5LBQA 1J9IA 4P96A 1TW3A 4A12A 4G7ZF 1FSEA 3CLOA 1NHAA 1IN7A 3GO5A 1Z9CA 3BZ6A 3I59B 2HQRA 3FM5A 3GFMA 4PGGA 1MDMA 3JTHA 3NEUA 5J8FA 3FXUA 4MNUA 5HLHA 3H3UA 2DT5A 4ZYDA 1RUOA 3J80Z 1MJBA 5H20A 2P5LC 4HLXA 1ON2A 2VXZA 2FXAA 1IF1A 3IWFA 1YLFA 3SHFA 4U0WA 3HRTA 1WSUA 5DCMB 1U5TA 3L09A 3R0JA 1KU3A 4WX9A 4UNOA 1R22A 1P4WA 5LHHA 2PN6A 4HX4A 3BDDA 1S6LA 5HS7A 2EA4A 2OU2A 2MA3A 1XMAA 2D2WA 1XSVA 4G7HF 3E5XA 5HS8A 2QM3A 4UXNA 2FQ3A 5BOXA 2F5CA 1XGMA 3GEZA 5EEHA 5H6RA 4G94A 4CDGA 3MZYA 2JT1A 1TQMA 2GXGA 4UV8A 1FOKA 4NB5A 2DU9A 1XCVA 5JFRA 1FBQA 4EJOA 2DQRA 1W5TA 3GUDA 3WU0A 3J7AO 1FBUA 2CG4A 4CZZA 1O3SA 1O3QA 1IN5A 2P7VB 2MH9A 2RQPA 3B02A 3DKWA 3M8FA 2XKOA 3E3VA 1OYIA 1FWZA 2STWA 1XGOA 2GIVA 3VB2A 1ULYA 4RB3C 5ILSA 2EFQA 2K7LA 3V8JA 1GXPA 4KA4A 3HHGA 3EYIA 4KT5C 5L3FA 1HKTA 4LFUA 1B1BA 2G7HA 3LA2A 3Q5FA 2XGXA 4B09A 2EFPA 4S05A 2FOKA 3E5UA 2UWMA 4LK0F 4OMYA 3D5LA 4BXUA 4XRFA 4YG2F 3GWZA 1AWCA 4AIKA 1T0FA 4ESBA 4N0BA 3ELKA 4ZZLA 2CW0F 1ZG1A 4A0YA 1G3TA 3ZPLA 1J7KA 5DCFA 2XASA 2CWEA 2XUBA 1FX7A 2J5OA 4MQ9F 3CJNA 1S8NA 3WU1B 3BJAA 4XLPF 3L7WA 1SD7A 2BE5F 2FE3A 2XAJA 5A2QZ 2D45A 5AIPA 1U6GA 3ABTA 2Z3YA 4P55A 2M87A 2XHKA 1G3WA 5HDNA 4WXCA 2YX4A 5ILVA 1DPUA 5JR3A 1EH6A 1UFMA 2OZ6A 2Z33A 2ZMEB 4BQAA 3BJOA 3ERED 3RJPA 3M7GA 2IPQX 1C0WA 1QQIA 5CVJA 3FXRA 1X3UA 3I5UA 4I0BA 2P5VA 4HF1A 2W85A 1L3LA 2IT0A 1XB4A 4XBFA 2NS0A 1T39A 5CVVA 3BPXA 3GFLA 2GZWA 1W7PD 2XVCA 4PCQA 1IN4A 3TO6A 2R7DA 3FXQA 2ZNZA 3U2RA 2V1UA 3ECHA 3VODA 3NQOA 3K2ZA 5FGMA 5D6EA 3KE2A 4WXDA 3ZMSA 1G6NA 2BGCA 5D5VB 3ECOA 4WK8F 1I1SA 3SZTA 3KP7A 2EV0A 5HDKA 3QOPA 3Q9VA 3M9AA 1I5ZA 3LFKA 1SMYF 2GWRA 3DP7A 1A04A 1BM9A 2D1VA 2Z9OA 3I0TA 4R1HA 2HTSA 2KIUA 1R1VA 5TRDA 4BYYA 1YYVA 3AAFA 3V7SA 3WTVC 3KETA 5E8GA 5CVRA 1H9TA 2P6TA 1FBSA 4CYDA 1O3RA 3IWZA 1R58A 3WGHA 1ZARA 2RGVA 3DPLC 1ON1A 2FU4A 5D5WB 1QGPA 5D8KB 1Y0UA 2QZ8A 2R3SA 2GQQA 5LLQA 2PMUA 3I53A 3HIFA 2YR2A 1SD6A 3SZPA 2COMA 4I7HA 3R0AA 1KQ8A 1LDJA 5ED4A 4RB2C 1LDKB 3F6OA 4O6JA 2EFWA 1OMIA 2CYYA 2P7CB 1ZGJA 1PP8F 4I09A 1YQAA 1R5HA 5AIQA 1O57A 1XGSA 2QQAA 3DXJF 5K1YA 4EGZA 2EV5A 5E1WA 1L0OC 3MCZA 2ADUA 2IP2A 2HEOA 3F8NA 4LG0B 2MC3A 2ESNA 3FMQA 4UHTA 2X0LA 3BPVA 4P9FA 1FYLA 3GZ5A 2OQGA 2BYVE 2OAZA 3L00A 3ULQB 2P4WA 2O6GE 2DW4A 3E6DA 3MAJA 4OOIA 1S29A 4HOBA 4MEYF 2DPUA 4N9HA 4RGRA 2QLZA 3T0YA 4HQMA 4XSZF 2M1BA 5HS9A 4PZJA 4UVBA 1P4AA 2UZKA 3TDZC 1YO5C 2MLKA 3RPQA 4QLCU 1USSA 4GCVA 2MH2A 3F22A 1O7LA 4XSXF 4LLGF 5HVQC 1B59A 1O3TA 1D3YA 2E1NA 3WTWC 2R7FA 1OKRA 3FHZA 4OU0A 1DUXC 5JVTA 2EJRA 1WWXA 2Q2EA 4IPAA 2XAFA 1FYMA 4M9XA 1CGPA 1ZLKA 3T8RA 1BIBA 3U1DA 4UVCA 2A3SA 2HQNA 2HDCA 4WF2A 4RB1A 2VOPA 4I98B 5D5UB 5ERIA 1LEBA 4YIIA 4MTDA 1UHMA 2VC0A 1REPC 4ESFA 1FT9A 2W25A 4BAYA 1DDNA 2ZXJA 4U0VA 5DUKA 4Y15A 5E20A 4LJZF 2CFXA 3T1BA 5ICEA 2PFBA 1S7AA 5E17F 4ETSA 2O0YA 4UUVA 2LSOA 3HUGA 4M6YA 2FBIA 4P9UA 3HSRA 2L01A 1V4RA 3TGNA 3TOAA 2JPBA 1GVJA 1D8JA 1XD7A 2RKHA 4LD5A 4FX0A 4DNCA 2M5WA 3ZN1A 4LB6B 1JXSA 4G6QA 1QBJA 3GFJA 2ISYA 4HYEA 4B8XA 4L5IA 3HRSA 2HGCA 1XMKA 1SFEA 3E6CC 2Y75A 2H6BA 4CXFA 1HW5A 2FEZA 1FYKA 1G3YA 5LHIA 4MGRA 2WTEA 4R8HA 2F5FA 2W57A 5BS6A 4KDPA 4YFXF 3WTXC 1S7OA 3WTYC 3LWFA 1K6OA 1W7PB 1WRJA 2PJPA 3TO9A 4PDKA 3V8KA 5IT3A 1SFUA 4KMFA 2UXNA 4LMYA 1FNNA 1KYWA 3EYYA 4M9SA 1FSHA 3J81Z 2FF4A 3K1PA 5FFXA 3PQJA 3O2PE 5BPDA 5BQTA 3LAPA 2MLGA 5DD8A 4IF4A 4ESJA 3V7RA 2FRHA 3R60A 4AWXB 4L9VA 1ZG3A 1CF7B 4JK1X 3HRMA 5HLIA 4OIRF 1I6XA 2H27A 1BI0A 5IT9K 5L3GA 2DFIA 1KU2A 2ZKZA 4RAZA 4L5JA 2QBYB 1ZGAA 2PMHA 3G73A 5DUIA 4MEXF 3GFIA 2OD5A 2DAOA 5LHGA 1GXQA 4ZYHA 3IC7A 2JZYA 1MDMB 2HYFA 2FMLA 1FP1D 1W5SA 3FMSA 3R61A 1DPRA 4G6DA 1K7AA 4RGXA 4LLNA 1BBYA 5ICCA 4RGSA 1QZZA 2VONA 2RC4A 1TW2A 2A61A 1I27A 4GO1A 1U5TB 1KGSA 2LF8A 2OA4A 3QP5A 6PAXA 1ZRDA 4P5OA 2P5KA 3B73A 3T5XA 5E18F 1RUNA 1ZG5A 4DQ2A 3HHHA 4OMZA 3F3XA 4Q47A 3P9KA 3N97A 2EWNA 2VE8A 2A68F 2HR3A 2XAGA 3SXYA 5FLXZ 3WTSC 3O6BB 4M73A 4A5NA 5HLGA 4EGYA 3F72A 2JRTA 1XCBA 2E1CA 1J59A 3IHUA 4U7BA 1TTYA 4LK1F 2IA1A 4OIPF 2L4MA 3GVAA 4LLLA 1T98A 2IJLA 1OYWA 3VFZA 4EJUA 4U0YA 3BJ6A 2LDUA 3VEPA 1QZYA 4A6DA 3FX3A 3F8CA 3OOPA 5L3DA 1FLIA 2K86A 4HLYA 1KYZA 3FZVA 3DFGA 3KLOA 4Q4ZF 4IHSA 5K5QA 4AVPA 5LGUA 4IJAA 4L9NA 1DP7P 2EB7A 5CYVA 5KVRA 3JTGA 1U2WA 3ISPA 3FM3A 4A0XA 3ML6A 4YIFA 4NHJA 4HZFA 1YW9A 5K5RA 1FZPB 2A6EF 4Y17A 5LGTA 1ZAOA 2HKXA 4RAYA 3ROUA 4ZYGA 2RV8A 2RN7A 4ENJA 3TOBA 4KNYA 2MD5A 5D5XB 1TLHB 1K78A 3QAHA 3F8BA 3KEOA 1B6AA 2Z99A 2LF7A 5CVUA 1SD5A 4EJWA 2FSWA 3RKXA 1Q1HA 3MFKA 3TDUC 5D8LB 1Z05A 1ZN2A 2VOOA 2ACJA 3GW2A 1Z91A 2DQLA 3IRQA 3D0SA 3LQRA 1MZBA 2CGPA 3QPHA 5LEJA 4EM2A 1F4KA 4KN7X 5LEKA 2W84A
chains in the Genus database with same CATH superfamily
1B9MA 3TMOA 1IV6A 1AKHB 1MMAA 1U9OA 3CUQA 4C3JJ 4II3A 1IUYA 1E3HA 1KQ0A 4Y33A 1JJ6C 3F23A 5K5OA 4UUTA 2QWWA 4JBAA 3CCYA 1ZRCA 1YIJI 1WH5A 2E1OA 3RKWA 3FK7A 2VKHA 3FF5A 1BIAA 1FY7A 2M0CA 2P6SA 4L18B 2DI3A 1LEAA 5J3LA 3HTSB 1G8XA 3AG4H 1J75A 2K9LA 5D4RA 2F5DA 3N05A 3ZMZA 1MBKA 4S04A 5FLVA 3QU6A 4RLFA 3K9TA 3B6AA 4EQQA 1B72B 3GZ6A 2OCCH 3OYMA 2G7UA 2LD5A 3ZQLA 2G9WA 2A69F 3HKZA 4BEHB 4U88A 1D0ZA 3CJQB 5BPIA 1ETXA 2ELHA 4HV5A 5H6QA 1KU9A 1Z3YA 2JSCA 5ICFA 1Z7UA 1VNDA 2VQLA 2D5VA 2IGMA 1Z6RA 2L54A 1IN8A 1ONVA 2M7AA 2K9QA 1OQYA 2ZO4A 1NK3P 1A35A 3Q0WA 4MTEA 2W1OA 2Z5UA 2W24A 4BHBA 2H6CA 5EEGA 1S9HA 2XGEA 5AONA 3F21A 5JVGF 5IYCJ 2KFDA 1T2KA 2VPRA 1IXRC 1XSXA 1UJ8A 5H2FC 1VI0A 1X2NA 3WTZA 3HB9A 3L2CA 2JTVA 2DA6A 3K6GA 2EIKH 4QWQA 3NARA 3JW4A 2GA2A 2NAZA 4GYIA 3SYTA 2AO9A 4IZZA 1YS6A 2FMYA 3DEUA 2V79A 3HM5A 3IKTA 4GDFA 2Y69H 5LRRA 1R36A 2M2EA 1MW7A 4CICA 4HQEA 2DO7A 4TV7A 3ZOBA 2LOOA 4YRVA 5A2QK 4UUSB 1HKSA 1WJCA 2K3FA 3LA3A 5F04A 1LPQA 4DBQA 2A07F 2BBYA 2Z1DA 2XAHA 4PK4A 4WXHA 1X4PA 3DU6A 3C7JA 4RGUA 1OR7A 3OYNA 2DA4A 2V4JC 1EH8A 3G71I 4C3HJ 4AM3A 4FE4A 2Y31A 3DEEA 3DPTA 1IZ1A 3AL0B 3E97A 3FHNA 4BHCA 2DCEA 4F91B 1P9QC 1GDTA 1IRFA 1ERDA 3IP4B 1UAAA 1MIJA 2CSOA 2F4OB 5J47A 3VWBA 2LKPA 1YE9A 1Y6IA 1NG7A 3W2WA 3TKYA 5F08A 4I02A 1UELB 3OIOA 2K27A 3EUHA 1WI9A 1Y56A 5FD5A 3BTIA 3C2BA 3CO6C 2CH0A 4EVIA 4NBQA 2PQ8A 3MWMA 3KEQA 1K4SA 1XC5A 3K69A 1SD4A 3RDIA 2VC1A 2RVCA 4IX7A 2HZTA 1Z6TA 1RR7A 3KP4A 1F1ZA 3HSEA 3ABUA 3FWEA 1YIOA 1KONA 2CO5A 2Y0SN 3RQIA 5E3OA 4L0ZB 1CQTA 4R79A 1OYYA 2R5YB 4CA0A 3M1EA 3I4NJ 5CQGA 2QSGX 1OPCA 3KP3A 2QQBA 2LKXA 4IL6C 3K4KA 2L9VA 3BOQA 1LVAA 4HW0A 3W6KB 2VQCA 1RETA 2ZNYA 3VPRA 1MBHA 3PFIA 3DTKA 1Y39A 5L3EA 2IGNA 2VN2A 4C30A 1TWHJ 3F6VA 4HDVA 1X1DA 1QNTA 2OJED 3A02A 1H0MA 2W48A 3CDLA 2XC7A 2QQ9A 4NC6A 3KZIC 1D0XA 4D1QA 4E7KA 2ZFWA 1J0RA 3FMRA 2XV4S 3HOTA 2AQEA 2EPFA 2E35A 1EV7A 2OV7A 5IOZA 5E3LA 4HG2A 4HX7A 3JRAA 3OMYA 2EIJH 4KUMA 3LQQA 4A3LJ 2BHYA 3VOEA 2PEXA 2V26A 3JRDA 4NNJA 1KA8A 4DGWB 4I0AA 2E1MC 2IA2A 3ZMVA 1FC3A 4DIQA 3TQNA 4AD9A 3RZDJ 4B44A 2VT3A 3H0GJ 2EINH 5JI6A 2OPTA 4HV6A 3GYHX 1YW7A 3Q0VA 4EM1A 2L2OA 2O3FA 3KYCB 3DQVC 3KLNA 1XS9A 3MKWB 3HOZJ 3MQ0A 2WAFA 3CUOA 4BDYA 1ZR2A 3KP6A 3I59A 1R00A 3LSTA 5F1JA 4ENKA 4KITB 4ZDPA 1HQCA 4E70A 4B43A 3A01B 4IHTA 1JT0A 1V54H 5KHDA 4LG3A 4E7HA 5CLSA 3V8LA 3L1PA 4LIUA 1EKEA 2ZJQF 3NWSA 3GLXA 3HRUA 3DKYA 5L3BA 5FKNA 4PGHA 3MMYB 3E5QA 1XGNA 3S17J 1R23A 3O3KA 4WWCA 3BZCA 2DA7A 2VKVA 2YX7A 3HOSA 3PSIA 3IAS2 3MEXA 4V2FA 1JGSA 3RPUA 3MD2A 2D1HA 4PJJA 4DOZA 2MBFA 1U9NA 4EMSA 3RCOA 1FMWA 5D6FA 2VUMJ 2X1DA 1FPQA 2DN0A 4XOTA 4H0EA 3GF2A 3MZHA 3DF8A 1IXSB 4BXFA 2CQ7A 3BWGA 1BA5A 2WC2A 3K1MA 2Q2EB 2GA1A 1JJ8C 3S3NA 2A05A 2P0WA 5DM7F 3QYBA 3RYPA 4RMNA 5LD2C 4XR6A 1U3EM 2GBYA 4P1WA 4BQQA 2HZDA 2HNHA 2OZUA 2EZHA 4M71A 5IOYA 1SMTA 3LAJA 3QODA 4CHUA 1BN5A 3A0HC 5J8CA 4D7MA 2QYOA 2CS3A 2P8TA 1XN7A 4UB8C 1MJ9A 2L7MP 2HOEA 4XLCA 3H5RA 2XROA 5ILUA 3RI4A 1YS7A 4ZDLA 4A3GJ 1IRXA 4QPQA 2ZJ2A 3DWLE 1RNLA 3KYLA 4GYGA 2LBFB 2E5NA 2E71A 4KN4X 2EH3A 5CQEA 3A2KA 1TWGJ 3E6MA 2DOEA 2BY1A 2GXBA 3ZGKA 3GTOJ 4HA8A 4L9JA 1B9NA 5FKMA 1RPWA 3ZQ7A 1TWCJ 4MFEA 2L4AA 3LSPA 2FBHA 3KZZA 2DOFA 5DTDA 4BKXA 2X1CA 2PJRA 1HDDC 1USTA 3IRRA 2VODA 5EGOA 3CD6I 3K4CA 2NXNB 3WODF 1HKQA 1X1AA 2Q8KA 3RKYA 3WE2A 4Q48A 1YJNI 2K4JA 3FKJA 3QP6A 1G3SA 4N9IA 1I6HJ 2HS5A 5TJJA 1XG1A 3HUGB 3ZQGA 2Y48A 2AXTC 1E17A 2XRLA 5IP9J 3LSJA 4B3XA 3QPSA 3JAMK 2Q1ZB 4AIDA 1VQPI 2RDPA 3C1DA 3PQKA 1RR8C 4FHTA 1FIPA 2HTJA 2L5QA 3C18A 4BY7J 2OTLI 1A6QA 3I64A 3RQ4A 1SAXA 2AXLA 2E1MB 2I5UA 1I1GA 3ZQIA 1YRNA 1LJ9A 3LOCA 5J4YA 5B5EC 1F9NA 4ZDOA 4XNFA 2ME6A 4A3FJ 2KRFA 2K02A 4AIJA 2XB0X 2KL4A 2IS1A 3K4LA 1JKRC 3WE3A 4XKWA 3CQZJ 2WV1A 2QA4I 3ZQCA 3NRVA 4HSTA 4ZJZA 3L2QA 4O3MA 2V1DA 3IKVA 5DEQA 5M3FJ 4IQ4A 2ID6A 3WTUC 2HDWA 2F5VA 4OIQF 3IL2A 4HF0A 2CUJA 1E3OC 1DGRM 3HJEA 2YPRA 4HDUA 1MSEC 3BROA 3V4GA 3VYRB 2BV6A 4M72A 4HF2A 4G7OF 4FETA 3IUOA 3MKYB 1ETOA 1LE8B 2PX9A 4IKFA 2EIMH 3PL8A 2DA1A 2X4HA 1P2FA 1ENHA 4UVAA 3OYDA 2ZBKA 1R5GA 1H9GA 3R4KA 2VB6A 4S0HB 2IA0A 2KDZA 4D9JA 2HFHA 4IRHA 3CCEI 1OCOH 1TT5B 2VBXA 1UB9A 4XMYA 5FKOA 2VJ4A 2JMWA 2O61A 3CTAA 1MSFC 2FOWA 4IRIA 4WCGA 4BY1J 2NVYJ 3PO3J 4JQFA 2HXIA 3BP8A 1W36C 2E5ZA 2FNAA 1PDNC 5F64A 4RDUA 5FFZA 2DJNA 4ABZA 1LDDA 4HX8A 3OV8A 1RKTA 1RKWA 3REOA 2QUFA 2EV6A 3FIWA 5FROA 4XLNF 4LB5A 1JTYA 2R7XA 5FKLA 1PP7U 2NVXJ 3GTMJ 3LA7A 4G12A 4PJMA 2XRNA 2IRFG 2M45A 2KRCA 1ORKA 2CUFA 2M34A 3HEFA 4KMUX 1RZ4A 2CQNA 2UXXA 1UG0A 4EV0A 2QENA 4A69C 3SQNA 2ZMEA 2YUSA 3K7AJ 3BCAA 1JHFA 1P92A 2NYXA 1TP4A 3S3OA 1E0EA 1X1PA 3WGGA 1ITYA 4C9YA 1BOAA 3AG1H 4NQWA 5E1ZB 3ZQHA 2IW5A 4Z2YA 3L2RA 3J7AY 2XAUA 3P7NA 1WJAA 5GP9A 1UHSA 4BHPA 1G4DA 1T6SA 2ID3A 1KQ9A 2OQRA 2V9KA 2CU7A 4Q5SF 2PMZA 4GXOA 1WJEA 4CGZA 1U8RA 1IXCA 2V9VA 1MGTA 3LMMA 2YSRA 4MHGA 1ZR4A 2E19A 2O03A 3OYKA 1EH7A 1F36A 3HDDA 3ZXSA 5L3CA 3A4CA 5GTHC 4M74A 3RKQA 3JCUC 1U8BA 4KIFA 1JKPC 2OUMA 2BEOA 5E8IA 4UV9A 1SVOA 2L9SA 3OYHA 1WZ2A 3QU3A 1EF4A 4RA2A 2LP0A 4YEJA 2FJ1A 1QPIA 3ZP5A 4M9ZA 5IY5H 4YFNF 2JRMA 2KP6A 3J80K 2X6YA 4CO8A 3KP2A 3U9GA 3PFYA 3GTJJ 4UY8I 1BI2A 3OSFA 1MH4A 2X9DA 4RAFA 1IAWA 2O8XA 3E7LA 4AC0A 4OINF 4BJTA 2JA2A 1MBJA 2NNNA 1MD0A 3GTGJ 2ZSHB 2YU3A 1R1TA 1F5TA 2V1XA 4B3AA 3J81K 5CJ9A 3SFZA 1JTXA 1OCCH 1WVRA 3NAUA 3OYBA 5JHUA 2VT2A 5FO5A 1MMGA 1K79A 1ZH5A 2J5PA 5FD6A 3SEZA 2BXYA 3UNGC 3OYFA 2R5ZA 3K1NA 1MNDA 2M9HA 4FT8A 4KYWA 3CLQA 4ON0A 3EETA 1OCZH 1RESA 1ZK8A 2M8EA 3GXOA 3H3ZA 1WJBA 4G8XA 2VQHA 2K9MA 4EM0B 1HBXG 3U21A 2R7SA 2DJIA 1TWAJ 2DLLA 3EPZA 4XICA 3WGIA 3I58A 2YS9A 1B4AA 2NS8A 4QTRA 3DTEA 3U1KA 2EZKA 2HPMA 1QPMA 3CCLI 4EJTA 2R92J 2IGOA 4Y13A 4ENMA 3CUQC 5J6XA 9ANTA 2NOGA 2R7OA 3T8TA 3HOYJ 3S2DJ 2OBPA 4EJVA 1ZKGA 2MC4A 4BQOA 3KIOA 3OL3A 2WY7Q 3VSKA 4L9TA 5KCMA 2NNYA 3F8MA 3RPUD 1TNTA 4F52A 2TDXA 1IV8A 2Y0MA 4XK4A 2EFNA 2LREA 3ERMA 3KZYA 3ZN0A 1HSTA 2K3PA 2IEKA 1IUFA 4RS8A 5DDGA 1G59A 2O8KA 1J2XA 1LFUP 1OISA 2DDAA 2EQRA 2KKOA 1BR1A 3SDGA 2VJ5A 4KJZA 1BI1A 4XN0A 3SZGA 2E2JJ 2CQKA 1OJLA 3ONQA 2VE9A 3GX4X 3FXJA 2HYGD 4HSRA 1TBXA 2JPCA 2AS5F 1JHHA 3TO7A 4PSXA 2XB5A 2M7BA 2A5WA 3RYRA 2F5EA 1K6YA 2DTRA 1SVLA 1SANA 1ZYRF 2HQ5A 2Y0SA 3O8HA 4IXAA 2F2EA 3RSNA 1RI7A 5FB2A 2HOTA 2R93J 1MNMC 1BI3A 1Q1VA 3HSFA 4LG0A 4HBLA 3AG3H 2DK5A 4K2EA 5DV5A 3M8EA 5B3SH 2IVMA 5F6FA 3W6JB 4CYCB 4E6KG 1BJZA 1YW8A 2KIMA 3I4PA 1ZLJA 2WV0A 2H94A 2HKOA 3K70C 3K0LA 3F8FA 2DMQA 2DBBA 1VQKI 3CF2A 2KJCA 2JA7J 4I01A 1AOYA 2A6TA 1UCRA 2XIGA 3CDHA 1OR7C 3P9CA 3AFHA 3RTRA 4BGDA 2R7QA 5DD4A 5FLXK 5IPAA 1IW7F 3L9FA 4M6XA 1H88C 1PVEA 2XGDA 3EDPA 1E2XA 2MFZA 1Z0XA 4GFBA 1TQIA 4KICA 4A2UA 2ETHA 4IRGA 4OIOF 1JUPA 3OL4A 4ENNA 1VTNC 4A5MA 2DMNA 1ODDA 4AUXA 2FBKA 2CW7A 3H92A 5HOOA 4IOCF 3BR3A 1K78B 3EUHC 3IV5A 5D4SA 3V7CA 2GM4A 3H9JA 1WHUA 2JA5J 3F0CA 1RIOH 1MJAA 2EA2A 4PFOA 1HW2A 4A93J 2QVOA 1ZREA 1TQPA 2H09A 2CFOA 4ASNA 3DCFA 5BMZA 4XKVA 2KPMA 2ZCWA 4Y52J 3LSMA 1U78A 1TZLA 1YTYA 2EILH 4IHWA 1YI2I 1X19A 2X6WA 2Q0OA 1S7EA 1T08B 5CVIA 3TP0A 3HZJA 1X1CA 4O5VA 3L2VA 2PLYA 1YFHA 4BBSJ 1R1UA 2A6HF 2UV1A 4JX5A 3WHCA 3C3WA 2PG4A 3HYIA 2FNPA 1BC7C 3ASOH 2FA5A 4IEJA 1HSJA 2W00A 2VBZA 1BC8C 2C6YA 3LL7A 4AIHA 1LB2A 1LNWA 3CUQB 4FCYA 2CW8A 2XGCA 4L0YB 2RNJA 3S3MA 2X6OA 3KX2A 4B4CA 3I55I 1T38A 2XKPA 1LQ1A 2ZC2A 3BG9A 1QA6A 4KT6A 1Z77A 2DDBA 3DTIA 2DODA 4FQGA 2VJIA 1N25A 3MKLA 1HA8A 1ZGWA 1FP2A 3HTUA 4QSHA 3GLLA 3M1CA 5E1XA 5F1RA 3BG7A 1P4XA 3HPGA 2F4MB 1ETQA 2M0MA 1V3FA 2CJJA 4ANJA 5M5YJ 2BZTA 2PI0A 5E79C 1FOXA 5GAHJ 1MKMA 4HAMA 2ELJA 3BR2A 1HOMA 1P6RA 3R6SA 1WQ2A 5KAFC 1D8KA 4J01A 1N77A 3PIOF 2BY3A 4PSWA 4ZYEA 1HC8A 2HWVA 4BNCA 1O7FA 4XOPA 1JGGA 4RB0A 3SDBA 4LGWA 3LSGA 3CO7C 4KFCA 1BJAA 2EFOA 5DYMA 3PJRA 2ESHA 3K4BA 2K4BA 1YG2A 2WWYA 3EQLF 2DA2A 1V5FA 1XSDA 2ISZA 2WADA 1D5VA 4U7DA 5K7FA 2PBIA 2XAQA 2LMDA 3G3ZA 5KK1A 1ZHFA 1FOYA 5LGNA 3JAMZ 2M3AA 3M4OJ 2ELKA 3A0BC 2B9SA 2DXIA 1A36A 1STZA 4BE2A 2VBWA 3DBRB 3DV8A 5IYBJ 3COAC 4D0PA 5FLMJ 1I39A 2IS2A 4G9YA 3VSLA 2R7WA 3CF5F 1IRGA 2V9PA 3QRFF 2LNBA 1A31A 3H5NA 4XRMA 2DFFA 4I2OA 1OFCX 3TW7A 2A5YB 1HW1A 1PUEE 3WG9A 2VPLA 1I3QJ 5IT9Z 2R7ZJ 1D0YA 5GAGJ 2G0EA 1J5YA 4A0ZA 1JE8A 2VQGA 1IN6A 4KIGA 5TGTA 3LSKA 2R7RA 1S3JA 5FJ8J 2VI6A 3BLYA 4XLHA 1VQLI 3I9V2 2JA6J 1N75A 4E4HA 4A3DJ 5J1YA 4ZH4F 3JSPA 2KQRA 1GHCA 2GLOA 3I54A 1AA7A 3RIRA 4IO9F 4FX4A 3N4MA 3ZMDA 2F4IA 2X1EA 4ZZDA 5HNHA 2DMUA 4LITA 1SAUA 1ACIA 1IG7A 2VKEA 1QVTA 3E1SA 3MVPA 4BH9A 2M30A 2KIFA 2I10A 2E7XA 2KJBA 1Y8RB 5EG0A 5LRSA 4RLQA 3HOVJ 2VASA 3HXLA 5GAEJ 1IGNA 4I99C 1W7PA 2CRGA 2LVSA 2BOLA 2V6CA 3Q9SA 5EJCA 3KFWX 2CUZA 2BVMA 2JVHA 1ZRFA 3JRFA 2NRAC 1W4MA 5K7ZA 5DCMA 3JSOA 3KCCA 5EEAA 4KIBA 2BW3A 3KP5A 4DYCA 3E6BA 2L02A 3JRBA 2GOMA 1KU7A 5HDGA 3S8PA 4F7ZA 4M3BA 2NS7A 1SFXA 4IHXA 2HOAA 1QO0D 2E7WA 3I71A 3HGYA 3P9IA 3WHBA 4X0GA 3PIPF 2DK8A 5J40A 3ZMTA 3BY6A 4IVNA 2DPDA 5C4XJ 4GGGA 4YFKF 1UZCA 3W2AA 1UHWA 1Z1DA 3HG9A 1MBGA 4BL0B 4CCKA 3WTTC 4I6ZA 2VBYA 1CF7A 2L3DA 1R7JA 3ABMH 1TNSA 2K85A 3S2WA 1HXDA 1XDUA 3QPTA 2EK5A 2STTA 4DZJA 5B66C 1WKMA 3DKXA 5ICGA 2DT6A 2M8GX 2TRTA 3F9KA 5C44J 1XDSA 1U5TC 3ZMUA 4CH7A 3CP8A 4A6EA 2B0LA 2QBYA 3TP3A 4MQVA 4V19K 2GAUA 5LBQA 1J9IA 3IH4A 2RREA 4HPQA 4P96A 1TW3A 4CZCA 4A12A 4G7ZF 1T8IA 2X85A 3GZNB 3OIQA 1FSEA 3CLOA 1NHAA 2FUG2 3L2UA 1LVKA 1IN7A 4E7SA 3CJTB 1VQMI 3GO5A 1Z9CA 3BZ6A 3I59B 3GTKJ 2HQRA 3FM5A 3GFMA 4PGGA 1MDMA 1IDZA 3JTHA 3NEUA 1TT0A 5J8FA 1FTZA 1VZ0A 4C3IJ 1NH3A 3FXUA 4MNUA 5HLHA 3H3UA 2DT5A 3OR2C 4ZYDA 1RUOA 3J80Z 2R4GA 1MJBA 4IOAF 3TW6A 5H20A 4BE1A 3OYEA 1F43A 2P5LC 4HLXA 1ON2A 2LRDA 1Y1VJ 2ZSIB 2VXZA 2FXAA 1VQNI 1IF1A 3IWFA 1YLFA 3SHFA 2Y9ZA 4U0WA 3HRTA 1R5ID 1WSUA 5DCMB 1U5TA 3CJRB 1K83J 3OYJA 1R71A 3L09A 3R0JA 1YX5A 3M3YJ 3OSGA 3J7YJ 2QSHX 1KU3A 1MBEA 4WX9A 4UNOA 1R22A 3OYLA 1P4WA 2LC2A 3GTPJ 5LHHA 1NTCA 3K4NA 2XF5A 2PN6A 4HX4A 1M1EB 3BDDA 1S6LA 5HS7A 4E7ZA 2EA4A 3JRCA 2ME0A 1ETKA 2OU2A 3CC2I 2MA3A 1XMAA 2X6XA 4HRIA 3OS0A 4G6TB 2D2WA 1XSVA 4Y4RA 4G7HF 3E5XA 5HS8A 4MO7A 2QM3A 4UXNA 5J1RA 4E7JA 2FQ3A 5BOXA 2F5CA 1XGMA 3GEZA 3S93A 4AYBA 3CMEI 2ZMEC 5EEHA 5H6RA 1QRYA 4G94A 4F3QA 4CDGA 3MZYA 2JT1A 1TQMA 2GXGA 2IS6A 4UV8A 1FOKA 4NB5A 3IAM2 1D5YA 2DU9A 1XCVA 5JLXA 5JFRA 3QYEA 3ASNH 2NVQJ 2JN6A 1FBQA 4EJOA 2DQRA 1W5TA 3WG7H 4M3FA 3PNTA 3GUDA 3WU0A 3DBHB 2JUGA 3J7AO 1FBUA 1ZTRA 2CG4A 3PM1A 4M6VA 3OS2A 2PJRB 4CZZA 1O3SA 1O3QA 1IN5A 2P7VB 2MH9A 5EGOB 3ZQFA 3K4MA 2CV1A 2RQPA 4DZPA 3B02A 3DKWA 3S15J 3M8FA 4M3GA 2GOXB 2XKOA 3E3VA 4M3EA 1OYIA 1FWZA 2VLAA 2AHQA 1XGOA 1D1CA 2BY2A 2MGQA 2STWA 2GIVA 5FRMA 3BG5A 1B8IA 3VB2A 2DTZA 4PJLA 3I4MJ 3G4SI 1ULYA 2E36A 4RB3C 2IGKA 5ILSA 1N78A 2EFQA 2K7LA 1O4XA 1MNEA 2CMPA 2MG4A 3V8JA 4C2TA 4DJAA 1GXPA 4KA4A 1YRNB 3HHGA 4GRIA 3D5RC 4KT5C 1WJFA 3EYIA 1JUMA 5L3FA 4LFUA 1YJWI 1HKTA 1ETYA 3JRHA 2V1NA 4XQFA 1B1BA 1VQ9I 2G7HA 3LA2A 3Q5FA 2XGXA 3DLAA 2OCEA 3ZQQA 4B09A 2EFPA 4S05A 2FOKA 3E5UA 2UWMA 4LK0F 1Y0NA 2R7TA 5F0CA 1HLVA 4OMYA 3HBLA 3D5LA 3PO2J 1QHGA 4BXUA 4XRFA 4BE0A 1PUFA 1QVUA 3K10A 4YG2F 3GWZA 4JX6A 1AWCA 4AIKA 3S32A 3SEQA 2L7ZA 1T0FA 1MMDA 4ESBA 5C3EJ 4N0BA 4B48A 3ELKA 1JKOC 4ZZLA 4E7IA 2CW0F 1Z3XA 1LUJB 1XX5A 4I76A 1ZG1A 4DYQA 1BW6A 2RQQA 3Q3SA 3CCJI 4A0YA 4RM3A 1G3TA 2MD0A 2VXDA 4XLEA 2RNGA 4AVZA 3ZPLA 1X4OA 1J7KA 5DCFA 2XASA 2CWEA 2XUBA 1FX7A 5E3MA 2WBMA 2J5OA 3PUBA 4AYBN 4MQ9F 2BY0A 3G2BA 3CJNA 1S8NA 3CC7I 3WU1B 3BJAA 4XLPF 3L7WA 5GADJ 2DYRH 1X3ZB 2K9NA 1SD7A 2BE5F 2FE3A 2XAJA 5A2QZ 2D45A 5AIPA 1U6GA 3ABTA 1T95A 2DFEA 2Z3YA 4P55A 2M87A 2NVTJ 2EZLA 2XHKA 1G3WA 3I3LA 5HDNA 4WXCA 2YX4A 5ILVA 1DPUA 1OCPA 5JR3A 1EH6A 3PNVA 1UFMA 3VYSB 4BQNA 2OZ6A 2Z33A 2ZMEB 4BQAA 3BJOA 1AKHA 1GT0C 2K9SA 3ERED 2Y2ZA 5F0FA 3RJPA 3M7GA 4QIWN 2IPQX 1C0WA 4JOMA 4A3KJ 1QQIA 2HOSA 5CVJA 3FXRA 1X3UA 3VDXA 4NQWB 3I5UA 2F6CA 2NVUB 4I0BA 2P5VA 3H1CA 3FXKA 1WJDA 4HF1A 1P7JA 2EBIA 2W85A 3CCUI 1MBFA 1YITI 1L3LA 2BHZA 2IT0A 1XB4A 2WY8Q 1I50J 4XLAA 4XBFA 2NS0A 4Y3OA 1T39A 1X3WB 2DT7B 5CVVA 3CCMI 3S1RJ 3BPXA 3GFLA 2GZWA 1W7PD 1WCMJ 2XVCA 4L5EA 2VIXA 1B72A 2R7VA 2JSPA 4FE7A 4PCQA 2WAQA 4BEHA 1IN4A 2DYSH 5E3NA 3CMMA 3TO6A 3PSFA 3H5AA 2R7DA 3FXQA 5C4JJ 3BR1A 2ZNZA 3U2RA 2V1UA 3ECHA 4E7LA 3VODA 3NQOA 3BZKA 3K2ZA 2QQ8A 5FGMA 2LTPA 1H8AC 1A5JA 1WI3A 4XKBA 4DBRA 5D6EA 3KE2A 4WXDA 3EUKL 4LIVA 3ZMSA 1G6NA 4D5FA 2XDVA 2BGCA 5D5VB 3ECOA 5F0HA 4WK8F 4XORA 1I1SA 4NUBA 3SZTA 1TC3C 3OYGA 2IXSA 4OWRB 3DU5A 4ZTJA 3KP7A 2WB1A 4XRSA 1VQ7I 5B1AH 2CUEA 2EV0A 4UUSA 2L7KA 1ETVA 5HDKA 3QOPA 3UKGA 1Z67A 3Q9VA 4U87A 1T33A 4XM3A 3M9AA 1I5ZA 3CP2A 5FKKA 3HGGA 3LFKA 1SMYF 2GWRA 3DP7A 1A04A 2R5ZB 4CSWA 1BM9A 2D1VA 2Z16A 2Z9OA 3I0TA 4R1HA 3CCVI 3S1QJ 3QOEA 2HTSA 2KIUA 1R1VA 1U0JA 1PJRA 3FBNB 5TRDA 4BYYA 1YYVA 2XPWA 3AAFA 1XMXA 2JVGA 2HPIA 3V7SA 4FTHA 3WTVC 5DS9A 3KETA 4FISA 5E8GA 4IQJA 5CVRA 2DA5A 4HNVA 4YIRX 1H9TA 4DYRA 3BQZA 2P6TA 5IP7J 1FBSA 1W1WE 4CYDA 4EEFG 2OF7A 2CQQA 3C2HA 1O3RA 3IWZA 1VQOI 2QSFX 3PNYA 1R58A 3WGHA 1ZARA 2X48A 2RGVA 3DPLC 3H36A 3LFUA 1ON1A 2FU4A 5D5WB 4F93B 4V2GA 1QGPA 2H8RA 1BR4A 2M4KA 5D8KB 2ZJRF 1Y0UA 2R5YA 4JYKA 2QZ8A 2HVSA 2R3SA 2GQQA 3KPHA 2AQFA 5LLQA 2PMUA 3I53A 3HIFA 2WAEA 2YR2A 4MIMA 4XRSG 1SD6A 3SZPA 2COMA 4I7HA 3IH2A 3R0AA 4N4NB 2LK2A 3DEWA 5IYDJ 1KQ8A 3DBLB 3FK6A 1LDJA 5ED4A 4RB2C 2QGUA 1LDKB 2N8GA 4C2MJ 3F6OA 1FMVA 4O6JA 3SFIA 2EFWA 1Y1WJ 5J1UA 2KZVA 1OMIA 2QKMB 2CYYA 2VKDA 4A3CJ 2P7CB 1ZGJA 1PP8F 2CV0A 3OS1A 2XF7A 2WAQN 3ESWB 4I09A 1SFKA 1YQAA 3JRGA 2RAEA 1GV2A 1R5HA 5AIQA 3IH3A 2HXOA 1VQ6I 2L9RA 1O57A 1A6IA 1XGSA 4XLFA 3JREA 2QQAA 3WU2C 3DXJF 1FOWA 5K1YA 4W97A 2P81A 5EDNA 4EGZA 2EV5A 5E1WA 1L0OC 3MCZA 3HL2A 2ADUA 2IP2A 2LY9A 2ECBA 3P5JA 2E2HJ 2HEOA 3F8NA 2ZXHA 4LG0B 2MC3A 2MABA 3VYUB 3BTLA 2ESNA 3FMQA 4UHTA 3BC8A 2X0LA 1R9TJ 2DMTA 2LG4A 3BPVA 3H9QA 4P9FA 2O9LA 2LFBA 5GTIC 3H3VK 1HDPA 1FYLA 3GZ5A 2OQGA 2BYVE 2OAZA 1G2HA 3L00A 3ULQB 1BL0A 1OLTA 1FJLA 3BG3A 2WB1N 2ZJPF 1D1AA 2P4WA 2O6GE 2DW4A 3QQAA 1H89C 3HPHA 2B7EA 3NWTA 3E6DA 3HOWJ 1FEXA 2Y30A 3MAJA 1XTAA 5EZHA 4OOIA 5EYRA 1S29A 4HOBA 2VJJA 4BJ5C 4MEYF 3A01A 3X2QH 2DPUA 4N9HA 4RGRA 1WPKA 2JQ7A 2QLZA 3T0YA 3OYIA 4HQMA 4XSZF 2M1BA 4IHYA 5HS9A 1K4TA 4PZJA 4UVBA 1P4AA 2CV2A 5HLTA 1R4MB 4AU7A 3B6CA 2UZKA 4CCOA 3C2GA 3TDZC 1YO5C 2QKLB 2MLKA 3W2VA 1HF0A 3RPQA 4QLCU 1UMQA 1USSA 3ABKH 4XONA 4A3BJ 4GCVA 2MH2A 1O7LA 3F22A 4XSXF 1POGA 2BVLA 4LLGF 5HVQC 1B59A 1MMNA 2I8DA 1O3TA 4RAGA 1D3YA 2E1NA 3BTJA 3WTWC 2R7FA 1OKRA 4ZTFA 3FHZA 4OU0A 3S1MJ 4D7NA 1BW5A 4HNTA 2XSDC 5DM6F 1DUXC 4XKCA 2BXZA 5JVTA 2EJRA 1WWXA 4OAZA 2Q2EA 4IPAA 3J7ZI 1QZEA 2XAFA 1FYMA 4M9XA 4A3MJ 1CGPA 3T8RA 4FASD 1ZLKA 3HKZN 2H8WA 2ZB9A 3EUAA 2R0QC 1AU7A 5JLWA 1BIBA 5BNGA 2DMPA 4JX4A 3U1DA 3OIPA 4UVCA 2HDDA 1Y8QB 2A3SA 1RRJA 2HQNA 2JUCA 2QF7A 4DW6A 1RC9A 2HDCA 4WF2A 4RB1A 3A03A 3VYTB 4CCLA 2VOPA 2KT0A 4XIDA 2M4GA 4Z6YA 1W36D 4I98B 5D5UB 1V5GA 3ZRGA 4EATA 4KISA 2MW8A 3FXOA 5ERIA 1LEBA 3CC4I 3LSRA 2KRHA 4MFDA 1D1BA 2QCOA 4PUSA 3W6VA 1ETWA 4YIIA 2HYJA 4MTDA 1MH3A 3BQYA 4HEA2 4CCNA 4F92B 1UHMA 2LBFA 3OYCA 1WH7A 2Z2SB 2VC0A 1REPC 4CCMA 4ESFA 1FT9A 2W25A 4CCJA 3GMEA 4BAYA 1DDNA 2ZXJA 4U0VA 1X2MA 5DUKA 1EJ9A 4BUPA 1VQ4I 2DOAA 4A3IJ 1IDYA 4Y15A 3S2HJ 5E20A 4LJZF 2KDOA 1E3PA 4Y7NJ 2CFXA 3T1BA 2ICWG 5ICEA 1T56A 1WGXA 4BACA 2F48A 2PFBA 1S7AA 5J4VA 5E17F 3BR6A 4ETSA 2O0YA 3JR9A 4UUVA 1SC7A 3K2AA 2JK3A 2HU9A 2LSOA 1BOBA 3HUGA 4M6YA 3I56I 3CMAI 2FBIA 4P9UA 2V7FA 3HSRA 2L01A 4NDLA 1V4RA 3TGNA 3TOAA 2JPBA 1GVJA 4N4OB 1D8JA 1XD7A 4OAYA 4RM2A 1GUUA 2RKHA 1GV5A 4LD5A 5F27A 4FX0A 1IO2A 5M5XJ 4QPOA 2KZGA 4DNCA 2M5WA 4PJ0C 3ZN1A 4LB6B 3HOUJ 1JXSA 4G6QA 1WJ5A 1QBJA 1K61A 3GTLJ 2KHMA 4ZYAA 3G1MA 3GFJA 3PUFA 1W0TA 4XL9A 4F55A 2ISYA 4C2UA 4HYEA 4B8XA 4L5IA 3HRSA 2HGCA 3FISA 3G1LA 2H1LA 1DGWY 1XMKA 1SFEA 3TEDA 2FQ4A 3E6CC 1JT6A 2Y75A 1QHHD 2H6BA 3LSIA 4M3DA 3KEYA 4CXFA 1HW5A 1LE8A 2FEZA 2KMUA 1FYKA 1GLNA 1G3YA 5LHIA 2OTJI 3D1NI 4MGRA 2WTEA 4R8HA 2F5FA 2W57A 5BS6A 3ZR8X 4KDPA 4YFXF 4CUGA 3SJMA 4BS9A 3WTXC 4J19A 3DPUA 2WA0A 1Z21A 1S7OA 3H35A 3CDIA 3WTYC 2O7OA 3CESA 5EG0B 3LWFA 1K6OA 4BDZA 1X1BA 1W7PB 1WRJA 5M3MJ 4X1EA 1X58A 3TO9A 2PJPA 4PDKA 4B47A 4ITVA 4ZC3A 3BG6A 4XN3A 3V8KA 3AKZA 5IT3A 1SFUA 4KMFA 2UXNA 1BR2A 1FNNA 1KYWA 2L9NA 4LMYA 5KNLA 3CMYA 2H1KA 5CKTA 3EYYA 4M9SA 4B1RA 3HC7A 5K7HA 1FSHA 2HQAA 5GPAA 1Z7LA 2BW3B 3J81Z 2FF4A 3K4JA 2XSJC 1NG6A 3K1PA 3ABLH 3OWTA 3AG2H 5FFXA 3PQJA 3O2PE 5BPDA 5BQTA 1HCRA 1DU0A 2K5CA 1DP3A 3LAPA 3BCBA 3H0DA 1R6RA 3OR1C 3CCSI 2MLGA 5DD8A 4IF4A 4ESJA 3V7RA 4PFPA 2FRHA 3GCMA 3FBIB 3R60A 4AWXB 3S14J 4L9VA 1ZG3A 1CF7B 4JK1X 3CCQI 2DFHA 1FIAA 5GPCA 3HRMA 5HLIA 4OIRF 3S1NJ 1OCTC 3W3CA 1I6XA 1YOVB 5EZGA 3HOXJ 2H27A 1BI0A 1V5EA 5IT9K 5L3GA 1YJ9I 2DFIA 1KU2A 4BXXJ 2ZKZA 3BT9A 4RAZA 4L5JA 3O8GA 1VQ5I 1JUSA 1YX3A 2QBYB 4UB6C 1ZGAA 3DLLF 4A3JJ 2PMHA 3G73A 1LFPA 3GBGA 3M07A 5DUIA 3OYAA 4MEXF 2V6EA 2OC6A 1SEUA 3GFIA 2OD5A 2LR8A 2DAOA 2NOJB 2UUZA 5LHGA 2HVQA 2ZXWH 1GXQA 2IAIA 5EF6A 2EZIA 5KAIC 4ZYHA 5B1BH 2LH9A 1LKXA 3Q0UA 3IC7A 2JZYA 1DU6A 1MDMB 2HYFA 2FMLA 1FP1D 3BTCA 1W5SA 3FMSA 3R61A 1DPRA 5HNFA 4G6DA 1XPXA 1K7AA 1JI8A 2O5RA 4RGXA 3CZ6A 4LLNA 1BBYA 2TCTA 3MKZA 1T0FC 5ICCA 4RGSA 2FX0A 1VFCA 1QZZA 2VONA 2RC4A 3FXMA 3K70D 1TW2A 2A61A 1I27A 4GO1A 1R4NB 1KGSA 1U5TB 2LF8A 3MN2A 2LLKA 5HODA 2ECCA 2OA4A 1S72I 4NC8A 1TL8A 1W0UA 3QP5A 3OOUA 6PAXA 1ZRDA 4P5OA 2LY1A 2XPUA 2P5KA 3D5SC 3B73A 2W7NA 1J09A 3T5XA 3OY9A 5E18F 1ZELA 1RUNA 4A3EJ 1ZG5A 4DQ2A 3HHHA 4OMZA 3F3XA 2FD5A 4Q47A 3P9KA 3N97A 2EWNA 2B63J 2VE8A 2A68F 4JP0A 2HR3A 2XAGA 4YELA 3SXYA 5FLXZ 2MYSA 3S16J 3WTSC 3TBIA 3JRIA 3O6BB 2KIQA 1DQUA 4M73A 4A5NA 5HLGA 2CQXA 4D5CA 4EGYA 1JKQC 2KISA 3F72A 2JRTA 1XCBA 2K40A 2E1CA 3CCRI 1J59A 3IHUA 1UG2A 5M5WJ 4U7BA 1TTYA 2LY2A 2E34A 4LK1F 2IA1A 4OIPF 2L4MA 3GVAA 5CPRB 4LLLA 1T98A 2HI3A 3L2WA 2IJLA 1OYWA 3VFZA 3QYFA 3G1OA 5TISC 3BJ6A 4EJUA 2LDUA 4U0YA 1FTTA 2VL8A 4W1UA 3VEPA 1QZYA 1IJWC 4A6DA 3FX3A 3F8CA 3OOPA 5L3DA 2GIZA 1FLIA 1R49A 2K86A 3GTQJ 2JA8J 4HLYA 2LYCA 1KYZA 2IS4A 4MLOA 4J00A 1LFBA 3FZVA 3DFGA 3QWLA 4BBRJ 3KLOA 1AHDP 3H9GA 2JJ7A 4Q4ZF 4IHSA 2E2IJ 5K5QA 4AVPA 5LGUA 2HVRA 4IJAA 1B8IB 1IC8A 4L9NA 5JHFA 1APLC 1DP7P 1P7IA 2EB7A 5CYVA 5KVRA 3JTGA 1U2WA 3ISPA 3A1YA 2COBA 3FM3A 1SFOJ 2Y9YA 4A0XA 5FRNA 4NC7A 4CYCA 2JWTA 2QEXI 2R7UA 3ML6A 1YHQI 4YIFA 3ZCOA 1OCRH 4PJNA 4NHJA 4HZFA 3LNQA 1YW9A 5K5RA 1FZPB 2LKSA 1QU3A 2L0KA 2W82A 1WFXA 3QPLA 2A6EF 4Y17A 5LGTA 1IRZA 4BJ6C 1ZAOA 1PUFB 3FDYA 2HKXA 4RAYA 2ZFUA 3ROUA 4ZYGA 1V55H 1VQ8I 2RV8A 3MZ8A 4II2A 3FXLA 3AL0C 2RN7A 4ENJA 1VF9A 3V42A 1NK2P 2IBDA 3TOBA 1SVMA 3BR5A 4KNYA 4X6AJ 2MD5A 5D5XB 1GVDA 2MSYA 3E0JB 1ZQ3P 1TLHB 3G6EI 5IP6A 1K78A 1EA3A 2DA3A 3QAHA 3F8BA 4H4KC 3KEOA 1B6AA 2E60A 2Z99A 2LF7A 5CVUA 2X51A 4RBOA 3TL4X 1SD5A 4EJWA 2ZXIA 2XF6A 2FSWA 2W4SA 1MMSA 3UR3C 1PYVA 3RKXA 1Q1HA 5LFAA 3MFKA 3TDUC 2XPVA 5D8LB 1W5CC 1Z05A 2L7FP 1S5LC 3KYDB 2GXAA 1ZN2A 2PMZN 2VOOA 2ACJA 4IHVA 3GW2A 3FKIJ 1Z91A 2DQLA 3M8JA 3IRQA 3D0SA 3RZOJ 3LSHA 3LQRA 1MZBA 4LOCA 4BU2A 2CGPA 2YU9J 4HNUA 3QPHA 3BR0A 1TWFJ 1I3AA 2KLOA 1KZHA 4EM2A 5LEJA 1F4KA 4KN7X 5LEKA 2W84A
chains in the Genus database with same CATH topology
1B9MA 3CUQA 1IUYA 1KQ0A 3F23A 5K5OA 2QWWA 4JBAA 1ZRCA 3RKWA 3FF5A 1BIAA 1FY7A 2P6SA 4L18B 2DI3A 1LEAA 3HTSB 1J75A 5D4RA 2F5DA 3ZMZA 4S04A 3QU6A 3K9TA 4EQQA 3GZ6A 2G7UA 2G9WA 2A69F 5BPIA 4U88A 2ELHA 4HV5A 5H6QA 1KU9A 2JSCA 5ICFA 1Z7UA 2L54A 1Z6RA 1IN8A 1ONVA 2ZO4A 4MTEA 2Z5UA 2W24A 4BHBA 2H6CA 5EEGA 3F21A 5AONA 1T2KA 1IXRC 1XSXA 3WTZA 3L2CA 2JTVA 4QWQA 3JW4A 2GA2A 2NAZA 4GYIA 1YS6A 2FMYA 3DEUA 2V79A 3IKTA 5LRRA 1R36A 4CICA 4HQEA 2DO7A 4TV7A 5A2QK 1HKSA 3LA3A 2A07F 2BBYA 2XAHA 4WXHA 3C7JA 4RGUA 1OR7A 1EH8A 3DPTA 1IZ1A 3E97A 4BHCA 1IRFA 2CSOA 2LKPA 3TKYA 4I02A 2K27A 3EUHA 1WI9A 5FD5A 3CO6C 4EVIA 2PQ8A 3MWMA 3KEQA 3K69A 1SD4A 3RDIA 2VC1A 2RVCA 2HZTA 1Z6TA 3KP4A 1F1ZA 3HSEA 3ABUA 3FWEA 1YIOA 2CO5A 4L0ZB 4R79A 1OYYA 3M1EA 1OPCA 3KP3A 2QQBA 3BOQA 1LVAA 4HW0A 3W6KB 2ZNYA 3PFIA 5L3EA 2VN2A 3F6VA 4HDVA 1QNTA 1H0MA 2QQ9A 2ZFWA 1J0RA 3FMRA 2XV4S 3HOTA 1EV7A 4HX7A 4KUMA 3LQQA 3VOEA 2PEXA 1KA8A 4I0AA 2IA2A 3ZMVA 1FC3A 3TQNA 4AD9A 2VT3A 5JI6A 4HV6A 3GYHX 1YW7A 4EM1A 2O3FA 3DQVC 3KLNA 3MQ0A 3CUOA 3KP6A 3I59A 1R00A 3LSTA 4ENKA 1HQCA 4E70A 4IHTA 5CLSA 3V8LA 3GLXA 3HRUA 5L3BA 4PGHA 3E5QA 1XGNA 1R23A 3O3KA 4WWCA 2YX7A 3HOSA 3MEXA 1JGSA 3RPUA 2D1HA 2MBFA 4EMSA 5D6FA 1FPQA 4H0EA 3GF2A 3MZHA 3DF8A 1IXSB 3BWGA 2WC2A 3K1MA 2GA1A 3RYPA 1U3EM 2OZUA 4M71A 1SMTA 3LAJA 4CHUA 1BN5A 5J8CA 2QYOA 2P8TA 1XN7A 1MJ9A 2HOEA 2XROA 5ILUA 3RI4A 1YS7A 2ZJ2A 1RNLA 4GYGA 4KN4X 3E6MA 2GXBA 4HA8A 4L9JA 1B9NA 3ZQ7A 2L4AA 2FBHA 3KZZA 1USTA 3IRRA 2VODA 3WODF 1HKQA 2Q8KA 3RKYA 3WE2A 4Q48A 2K4JA 3QP6A 1G3SA 4N9IA 2HS5A 5TJJA 2Y48A 1E17A 3JAMK 2RDPA 3C1DA 3PQKA 4FHTA 2HTJA 3C18A 3I64A 1SAXA 2AXLA 1I1GA 1LJ9A 1F9NA 2KRFA 2K02A 4AIJA 3WE3A 3NRVA 4O3MA 2V1DA 3IKVA 5DEQA 3WTUC 4OIQF 3IL2A 4HF0A 2YPRA 4HDUA 3BROA 3V4GA 2BV6A 4M72A 4HF2A 4G7OF 2X4HA 1P2FA 4UVAA 2ZBKA 1R5GA 1H9GA 3R4KA 2IA0A 2HFHA 4IRHA 2VBXA 1UB9A 2O61A 3CTAA 4IRIA 4WCGA 4JQFA 3BP8A 2FNAA 1PDNC 5F64A 5FFZA 1LDDA 4HX8A 3OV8A 3REOA 2QUFA 2EV6A 4XLNF 4LB5A 1PP7U 3LA7A 2XRNA 2IRFG 2M45A 4KMUX 1RZ4A 2UXXA 4EV0A 2QENA 3SQNA 2ZMEA 1JHFA 1P92A 2NYXA 3WGGA 1BOAA 4NQWA 5E1ZB 2IW5A 4Z2YA 3P7NA 4BHPA 1G4DA 1T6SA 1KQ9A 2OQRA 4Q5SF 4GXOA 4CGZA 1U8RA 1IXCA 2V9VA 1MGTA 2YSRA 4MHGA 2O03A 1EH7A 5L3CA 4M74A 4KIFA 2BEOA 5E8IA 4UV9A 3QU3A 3ZP5A 4M9ZA 4YFNF 3J80K 4CO8A 3KP2A 3U9GA 1BI2A 1IAWA 2O8XA 4OINF 2NNNA 1MD0A 2YU3A 1R1TA 1F5TA 2V1XA 3J81K 5CJ9A 3SFZA 5JHUA 2VT2A 5FO5A 1K79A 1ZH5A 2J5PA 5FD6A 3K1NA 4FT8A 4KYWA 4ON0A 3EETA 2M8EA 3GXOA 3H3ZA 4G8XA 4EM0B 1HBXG 2DLLA 3WGIA 3I58A 1B4AA 1QPMA 4EJTA 4Y13A 4ENMA 3CUQC 5J6XA 3T8TA 2OBPA 4EJVA 4L9TA 2NNYA 3F8MA 1TNTA 2TDXA 2Y0MA 2EFNA 3KZYA 3ZN0A 1HSTA 4RS8A 5DDGA 1J2XA 2KKOA 1BI1A 2CQKA 2VE9A 3GX4X 2HYGD 1TBXA 2JPCA 2AS5F 1JHHA 3TO7A 3RYRA 2F5EA 2DTRA 4IXAA 1ZYRF 2F2EA 1RI7A 5FB2A 1BI3A 3HSFA 4LG0A 4HBLA 2DK5A 4K2EA 5DV5A 3M8EA 2IVMA 5F6FA 3W6JB 1YW8A 2KIMA 3I4PA 1ZLJA 2WV0A 2H94A 2HKOA 3K0LA 3F8FA 2DBBA 2KJCA 4I01A 1AOYA 1UCRA 2XIGA 3CDHA 3P9CA 3RTRA 5DD4A 5FLXK 1IW7F 3L9FA 4M6XA 3EDPA 1E2XA 1TQIA 4KICA 4A2UA 2ETHA 4IRGA 4OIOF 4ENNA 1VTNC 4A5MA 1ODDA 2FBKA 3H92A 5HOOA 1K78B 5D4SA 3V7CA 1RIOH 1MJAA 2EA2A 1HW2A 2QVOA 1ZREA 1TQPA 2H09A 4ASNA 5BMZA 2ZCWA 1U78A 1YTYA 2Q0OA 5CVIA 4O5VA 2PLYA 1YFHA 1R1UA 2A6HF 3C3WA 2PG4A 3HYIA 2FNPA 1BC7C 2FA5A 1HSJA 2VBZA 1BC8C 2C6YA 4AIHA 1LB2A 1LNWA 3CUQB 4L0YB 2RNJA 1T38A 2XKPA 1LQ1A 1FP2A 3HTUA 5E1XA 5F1RA 1P4XA 1V3FA 2PI0A 1MKMA 4HAMA 1P6RA 3R6SA 1WQ2A 1D8KA 4ZYEA 2HWVA 4BNCA 1O7FA 4RB0A 4LGWA 3CO7C 4KFCA 1BJAA 2EFOA 5DYMA 2ESHA 2K4BA 1YG2A 2WWYA 3EQLF 1XSDA 2ISZA 1D5VA 4U7DA 2PBIA 2XAQA 3G3ZA 5KK1A 1ZHFA 5LGNA 3JAMZ 1STZA 2VBWA 3DV8A 3COAC 4D0PA 4G9YA 1IRGA 3QRFF 2LNBA 4I2OA 2A5YB 1HW1A 1PUEE 3WG9A 5IT9Z 1J5YA 4A0ZA 1JE8A 1IN6A 4KIGA 1S3JA 4ZH4F 3JSPA 1GHCA 3I54A 3RIRA 4FX4A 3N4MA 3ZMDA 4ZZDA 4BH9A 2M30A 2KIFA 2E7XA 2KJBA 5LRSA 1W7PA 2V6CA 3Q9SA 3KFWX 1ZRFA 2NRAC 1W4MA 5DCMA 3JSOA 3KCCA 4KIBA 3KP5A 3E6BA 2L02A 1KU7A 5HDGA 4F7ZA 1SFXA 1QO0D 2E7WA 3I71A 3P9IA 2DK8A 3ZMTA 3BY6A 4IVNA 2DPDA 4GGGA 4YFKF 1UHWA 1Z1DA 3WTTC 2VBYA 1CF7A 2L3DA 1R7JA 1TNSA 3S2WA 1HXDA 1XDUA 3QPTA 2EK5A 2STTA 1WKMA 5ICGA 1XDSA 1U5TC 3ZMUA 4A6EA 2B0LA 2QBYA 4MQVA 2GAUA 5LBQA 1J9IA 4P96A 1TW3A 4A12A 4G7ZF 1FSEA 3CLOA 1NHAA 1IN7A 3GO5A 1Z9CA 3BZ6A 3I59B 2HQRA 3FM5A 3GFMA 4PGGA 1MDMA 3JTHA 3NEUA 5J8FA 3FXUA 4MNUA 5HLHA 3H3UA 2DT5A 4ZYDA 1RUOA 3J80Z 1MJBA 5H20A 2P5LC 4HLXA 1ON2A 2VXZA 2FXAA 1IF1A 3IWFA 1YLFA 3SHFA 4U0WA 3HRTA 1WSUA 5DCMB 1U5TA 3L09A 3R0JA 1KU3A 4WX9A 4UNOA 1R22A 1P4WA 5LHHA 2PN6A 4HX4A 3BDDA 1S6LA 5HS7A 2EA4A 2OU2A 2MA3A 1XMAA 2D2WA 1XSVA 4G7HF 3E5XA 5HS8A 2QM3A 4UXNA 2FQ3A 5BOXA 2F5CA 1XGMA 3GEZA 5EEHA 5H6RA 4G94A 4CDGA 3MZYA 2JT1A 1TQMA 2GXGA 4UV8A 1FOKA 4NB5A 2DU9A 1XCVA 5JFRA 1FBQA 4EJOA 2DQRA 1W5TA 3GUDA 3WU0A 3J7AO 1FBUA 2CG4A 4CZZA 1O3SA 1O3QA 1IN5A 2P7VB 2MH9A 2RQPA 3B02A 3DKWA 3M8FA 2XKOA 3E3VA 1OYIA 1FWZA 2STWA 1XGOA 2GIVA 3VB2A 1ULYA 4RB3C 5ILSA 2EFQA 2K7LA 3V8JA 1GXPA 4KA4A 3HHGA 3EYIA 4KT5C 5L3FA 1HKTA 4LFUA 1B1BA 2G7HA 3LA2A 3Q5FA 2XGXA 4B09A 2EFPA 4S05A 2FOKA 3E5UA 2UWMA 4LK0F 4OMYA 3D5LA 4BXUA 4XRFA 4YG2F 3GWZA 1AWCA 4AIKA 1T0FA 4ESBA 4N0BA 3ELKA 4ZZLA 2CW0F 1ZG1A 4A0YA 1G3TA 3ZPLA 1J7KA 5DCFA 2XASA 2CWEA 2XUBA 1FX7A 2J5OA 4MQ9F 3CJNA 1S8NA 3WU1B 3BJAA 4XLPF 3L7WA 1SD7A 2BE5F 2FE3A 2XAJA 5A2QZ 2D45A 5AIPA 1U6GA 3ABTA 2Z3YA 4P55A 2M87A 2XHKA 1G3WA 5HDNA 4WXCA 2YX4A 5ILVA 1DPUA 5JR3A 1EH6A 1UFMA 2OZ6A 2Z33A 2ZMEB 4BQAA 3BJOA 3ERED 3RJPA 3M7GA 2IPQX 1C0WA 1QQIA 5CVJA 3FXRA 1X3UA 3I5UA 4I0BA 2P5VA 4HF1A 2W85A 1L3LA 2IT0A 1XB4A 4XBFA 2NS0A 1T39A 5CVVA 3BPXA 3GFLA 2GZWA 1W7PD 2XVCA 4PCQA 1IN4A 3TO6A 2R7DA 3FXQA 2ZNZA 3U2RA 2V1UA 3ECHA 3VODA 3NQOA 3K2ZA 5FGMA 5D6EA 3KE2A 4WXDA 3ZMSA 1G6NA 2BGCA 5D5VB 3ECOA 4WK8F 1I1SA 3SZTA 3KP7A 2EV0A 5HDKA 3QOPA 3Q9VA 3M9AA 1I5ZA 3LFKA 1SMYF 2GWRA 3DP7A 1A04A 1BM9A 2D1VA 2Z9OA 3I0TA 4R1HA 2HTSA 2KIUA 1R1VA 5TRDA 4BYYA 1YYVA 3AAFA 3V7SA 3WTVC 3KETA 5E8GA 5CVRA 1H9TA 2P6TA 1FBSA 4CYDA 1O3RA 3IWZA 1R58A 3WGHA 1ZARA 2RGVA 3DPLC 1ON1A 2FU4A 5D5WB 1QGPA 5D8KB 1Y0UA 2QZ8A 2R3SA 2GQQA 5LLQA 2PMUA 3I53A 3HIFA 2YR2A 1SD6A 3SZPA 2COMA 4I7HA 3R0AA 1KQ8A 1LDJA 5ED4A 4RB2C 1LDKB 3F6OA 4O6JA 2EFWA 1OMIA 2CYYA 2P7CB 1ZGJA 1PP8F 4I09A 1YQAA 1R5HA 5AIQA 1O57A 1XGSA 2QQAA 3DXJF 5K1YA 4EGZA 2EV5A 5E1WA 1L0OC 3MCZA 2ADUA 2IP2A 2HEOA 3F8NA 4LG0B 2MC3A 2ESNA 3FMQA 4UHTA 2X0LA 3BPVA 4P9FA 1FYLA 3GZ5A 2OQGA 2BYVE 2OAZA 3L00A 3ULQB 2P4WA 2O6GE 2DW4A 3E6DA 3MAJA 4OOIA 1S29A 4HOBA 4MEYF 2DPUA 4N9HA 4RGRA 2QLZA 3T0YA 4HQMA 4XSZF 2M1BA 5HS9A 4PZJA 4UVBA 1P4AA 2UZKA 3TDZC 1YO5C 2MLKA 3RPQA 4QLCU 1USSA 4GCVA 2MH2A 3F22A 1O7LA 4XSXF 4LLGF 5HVQC 1B59A 1O3TA 1D3YA 2E1NA 3WTWC 2R7FA 1OKRA 3FHZA 4OU0A 1DUXC 5JVTA 2EJRA 1WWXA 2Q2EA 4IPAA 2XAFA 1FYMA 4M9XA 1CGPA 1ZLKA 3T8RA 1BIBA 3U1DA 4UVCA 2A3SA 2HQNA 2HDCA 4WF2A 4RB1A 2VOPA 4I98B 5D5UB 5ERIA 1LEBA 4YIIA 4MTDA 1UHMA 2VC0A 1REPC 4ESFA 1FT9A 2W25A 4BAYA 1DDNA 2ZXJA 4U0VA 5DUKA 4Y15A 5E20A 4LJZF 2CFXA 3T1BA 5ICEA 2PFBA 1S7AA 5E17F 4ETSA 2O0YA 4UUVA 2LSOA 3HUGA 4M6YA 2FBIA 4P9UA 3HSRA 2L01A 1V4RA 3TGNA 3TOAA 2JPBA 1GVJA 1D8JA 1XD7A 2RKHA 4LD5A 4FX0A 4DNCA 2M5WA 3ZN1A 4LB6B 1JXSA 4G6QA 1QBJA 3GFJA 2ISYA 4HYEA 4B8XA 4L5IA 3HRSA 2HGCA 1XMKA 1SFEA 3E6CC 2Y75A 2H6BA 4CXFA 1HW5A 2FEZA 1FYKA 1G3YA 5LHIA 4MGRA 2WTEA 4R8HA 2F5FA 2W57A 5BS6A 4KDPA 4YFXF 3WTXC 1S7OA 3WTYC 3LWFA 1K6OA 1W7PB 1WRJA 2PJPA 3TO9A 4PDKA 3V8KA 5IT3A 1SFUA 4KMFA 2UXNA 4LMYA 1FNNA 1KYWA 3EYYA 4M9SA 1FSHA 3J81Z 2FF4A 3K1PA 5FFXA 3PQJA 3O2PE 5BPDA 5BQTA 3LAPA 2MLGA 5DD8A 4IF4A 4ESJA 3V7RA 2FRHA 3R60A 4AWXB 4L9VA 1ZG3A 1CF7B 4JK1X 3HRMA 5HLIA 4OIRF 1I6XA 2H27A 1BI0A 5IT9K 5L3GA 2DFIA 1KU2A 2ZKZA 4RAZA 4L5JA 2QBYB 1ZGAA 2PMHA 3G73A 5DUIA 4MEXF 3GFIA 2OD5A 2DAOA 5LHGA 1GXQA 4ZYHA 3IC7A 2JZYA 1MDMB 2HYFA 2FMLA 1FP1D 1W5SA 3FMSA 3R61A 1DPRA 4G6DA 1K7AA 4RGXA 4LLNA 1BBYA 5ICCA 4RGSA 1QZZA 2VONA 2RC4A 1TW2A 2A61A 1I27A 4GO1A 1U5TB 1KGSA 2LF8A 2OA4A 3QP5A 6PAXA 1ZRDA 4P5OA 2P5KA 3B73A 3T5XA 5E18F 1RUNA 1ZG5A 4DQ2A 3HHHA 4OMZA 3F3XA 4Q47A 3P9KA 3N97A 2EWNA 2VE8A 2A68F 2HR3A 2XAGA 3SXYA 5FLXZ 3WTSC 3O6BB 4M73A 4A5NA 5HLGA 4EGYA 3F72A 2JRTA 1XCBA 2E1CA 1J59A 3IHUA 4U7BA 1TTYA 4LK1F 2IA1A 4OIPF 2L4MA 3GVAA 4LLLA 1T98A 2IJLA 1OYWA 3VFZA 4EJUA 4U0YA 3BJ6A 2LDUA 3VEPA 1QZYA 4A6DA 3FX3A 3F8CA 3OOPA 5L3DA 1FLIA 2K86A 4HLYA 1KYZA 3FZVA 3DFGA 3KLOA 4Q4ZF 4IHSA 5K5QA 4AVPA 5LGUA 4IJAA 4L9NA 1DP7P 2EB7A 5CYVA 5KVRA 3JTGA 1U2WA 3ISPA 3FM3A 4A0XA 3ML6A 4YIFA 4NHJA 4HZFA 1YW9A 5K5RA 1FZPB 2A6EF 4Y17A 5LGTA 1ZAOA 2HKXA 4RAYA 3ROUA 4ZYGA 2RV8A 2RN7A 4ENJA 3TOBA 4KNYA 2MD5A 5D5XB 1TLHB 1K78A 3QAHA 3F8BA 3KEOA 1B6AA 2Z99A 2LF7A 5CVUA 1SD5A 4EJWA 2FSWA 3RKXA 1Q1HA 3MFKA 3TDUC 5D8LB 1Z05A 1ZN2A 2VOOA 2ACJA 3GW2A 1Z91A 2DQLA 3IRQA 3D0SA 3LQRA 1MZBA 2CGPA 3QPHA 5LEJA 4EM2A 1F4KA 4KN7X 5LEKA 2W84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9M A;  3CUQ A;  1IUY A;  1KQ0 A;  3F23 A;  5K5O A;  2QWW A;  4JBA A;  1ZRC A;  3RKW A;  3FF5 A;  1BIA A;  1FY7 A;  2P6S A;  4L18 B;  2DI3 A;  1LEA A;  3HTS B;  1J75 A;  5D4R A;  2F5D A;  3ZMZ A;  4S04 A;  3QU6 A;  3K9T A;  4EQQ A;  3GZ6 A;  2G7U A;  2G9W A;  2A69 F;  5BPI A;  4U88 A;  2ELH A;  4HV5 A;  5H6Q A;  1KU9 A;  2JSC A;  5ICF A;  1Z7U A;  2L54 A;  1Z6R A;  1IN8 A;  1ONV A;  2ZO4 A;  4MTE A;  2Z5U A;  2W24 A;  4BHB A;  2H6C A;  5EEG A;  3F21 A;  5AON A;  1T2K A;  1IXR C;  1XSX A;  3WTZ A;  3L2C A;  2JTV A;  4QWQ A;  3JW4 A;  2GA2 A;  2NAZ A;  4GYI A;  1YS6 A;  2FMY A;  3DEU A;  2V79 A;  3IKT A;  5LRR A;  1R36 A;  4CIC A;  4HQE A;  2DO7 A;  4TV7 A;  5A2Q K;  1HKS A;  3LA3 A;  2A07 F;  2BBY A;  2XAH A;  4WXH A;  3C7J A;  4RGU A;  1OR7 A;  1EH8 A;  3DPT A;  1IZ1 A;  3E97 A;  4BHC A;  1IRF A;  2CSO A;  2LKP A;  3TKY A;  4I02 A;  2K27 A;  3EUH A;  1WI9 A;  5FD5 A;  3CO6 C;  4EVI A;  2PQ8 A;  3MWM A;  3KEQ A;  3K69 A;  1SD4 A;  3RDI A;  2VC1 A;  2RVC A;  2HZT A;  1Z6T A;  3KP4 A;  1F1Z A;  3HSE A;  3ABU A;  3FWE A;  1YIO A;  2CO5 A;  4L0Z B;  4R79 A;  1OYY A;  3M1E A;  1OPC A;  3KP3 A;  2QQB A;  3BOQ A;  1LVA A;  4HW0 A;  3W6K B;  2ZNY A;  3PFI A;  5L3E A;  2VN2 A;  3F6V A;  4HDV A;  1QNT A;  1H0M A;  2QQ9 A;  2ZFW A;  1J0R A;  3FMR A;  2XV4 S;  3HOT A;  1EV7 A;  4HX7 A;  4KUM A;  3LQQ A;  3VOE A;  2PEX A;  1KA8 A;  4I0A A;  2IA2 A;  3ZMV A;  1FC3 A;  3TQN A;  4AD9 A;  2VT3 A;  5JI6 A;  4HV6 A;  3GYH X;  1YW7 A;  4EM1 A;  2O3F A;  3DQV C;  3KLN A;  3MQ0 A;  3CUO A;  3KP6 A;  3I59 A;  1R00 A;  3LST A;  4ENK A;  1HQC A;  4E70 A;  4IHT A;  5CLS A;  3V8L A;  3GLX A;  3HRU A;  5L3B A;  4PGH A;  3E5Q A;  1XGN A;  1R23 A;  3O3K A;  4WWC A;  2YX7 A;  3HOS A;  3MEX A;  1JGS A;  3RPU A;  2D1H A;  2MBF A;  4EMS A;  5D6F A;  1FPQ A;  4H0E A;  3GF2 A;  3MZH A;  3DF8 A;  1IXS B;  3BWG A;  2WC2 A;  3K1M A;  2GA1 A;  3RYP A;  1U3E M;  2OZU A;  4M71 A;  1SMT A;  3LAJ A;  4CHU A;  1BN5 A;  5J8C A;  2QYO A;  2P8T A;  1XN7 A;  1MJ9 A;  2HOE A;  2XRO A;  5ILU A;  3RI4 A;  1YS7 A;  2ZJ2 A;  1RNL A;  4GYG A;  4KN4 X;  3E6M A;  2GXB A;  4HA8 A;  4L9J A;  1B9N A;  3ZQ7 A;  2L4A A;  2FBH A;  3KZZ A;  1UST A;  3IRR A;  2VOD A;  3WOD F;  1HKQ A;  2Q8K A;  3RKY A;  3WE2 A;  4Q48 A;  2K4J A;  3QP6 A;  1G3S A;  4N9I A;  2HS5 A;  5TJJ A;  2Y48 A;  1E17 A;  3JAM K;  2RDP A;  3C1D A;  3PQK A;  4FHT A;  2HTJ A;  3C18 A;  3I64 A;  1SAX A;  2AXL A;  1I1G A;  1LJ9 A;  1F9N A;  2KRF A;  2K02 A;  4AIJ A;  3WE3 A;  3NRV A;  4O3M A;  2V1D A;  3IKV A;  5DEQ A;  3WTU C;  4OIQ F;  3IL2 A;  4HF0 A;  2YPR A;  4HDU A;  3BRO A;  3V4G A;  2BV6 A;  4M72 A;  4HF2 A;  4G7O F;  2X4H A;  1P2F A;  4UVA A;  2ZBK A;  1R5G A;  1H9G A;  3R4K A;  2IA0 A;  2HFH A;  4IRH A;  2VBX A;  1UB9 A;  2O61 A;  3CTA A;  4IRI A;  4WCG A;  4JQF A;  3BP8 A;  2FNA A;  1PDN C;  5F64 A;  5FFZ A;  1LDD A;  4HX8 A;  3OV8 A;  3REO A;  2QUF A;  2EV6 A;  4XLN F;  4LB5 A;  1PP7 U;  3LA7 A;  2XRN A;  2IRF G;  2M45 A;  4KMU X;  1RZ4 A;  2UXX A;  4EV0 A;  2QEN A;  3SQN A;  2ZME A;  1JHF A;  1P92 A;  2NYX A;  3WGG A;  1BOA A;  4NQW A;  5E1Z B;  2IW5 A;  4Z2Y A;  3P7N A;  4BHP A;  1G4D A;  1T6S A;  1KQ9 A;  2OQR A;  4Q5S F;  4GXO A;  4CGZ A;  1U8R A;  1IXC A;  2V9V A;  1MGT A;  2YSR A;  4MHG A;  2O03 A;  1EH7 A;  5L3C A;  4M74 A;  4KIF A;  2BEO A;  5E8I A;  4UV9 A;  3QU3 A;  3ZP5 A;  4M9Z A;  4YFN F;  3J80 K;  4CO8 A;  3KP2 A;  3U9G A;  1BI2 A;  1IAW A;  2O8X A;  4OIN F;  2NNN A;  1MD0 A;  2YU3 A;  1R1T A;  1F5T A;  2V1X A;  3J81 K;  5CJ9 A;  3SFZ A;  5JHU A;  2VT2 A;  5FO5 A;  1K79 A;  1ZH5 A;  2J5P A;  5FD6 A;  3K1N A;  4FT8 A;  4KYW A;  4ON0 A;  3EET A;  2M8E A;  3GXO A;  3H3Z A;  4G8X A;  4EM0 B;  1HBX G;  2DLL A;  3WGI A;  3I58 A;  1B4A A;  1QPM A;  4EJT A;  4Y13 A;  4ENM A;  3CUQ C;  5J6X A;  3T8T A;  2OBP A;  4EJV A;  4L9T A;  2NNY A;  3F8M A;  1TNT A;  2TDX A;  2Y0M A;  2EFN A;  3KZY A;  3ZN0 A;  1HST A;  4RS8 A;  5DDG A;  1J2X A;  2KKO A;  1BI1 A;  2CQK A;  2VE9 A;  3GX4 X;  2HYG D;  1TBX A;  2JPC A;  2AS5 F;  1JHH A;  3TO7 A;  3RYR A;  2F5E A;  2DTR A;  4IXA A;  1ZYR F;  2F2E A;  1RI7 A;  5FB2 A;  1BI3 A;  3HSF A;  4LG0 A;  4HBL A;  2DK5 A;  4K2E A;  5DV5 A;  3M8E A;  2IVM A;  5F6F A;  3W6J B;  1YW8 A;  2KIM A;  3I4P A;  1ZLJ A;  2WV0 A;  2H94 A;  2HKO A;  3K0L A;  3F8F A;  2DBB A;  2KJC A;  4I01 A;  1AOY A;  1UCR A;  2XIG A;  3CDH A;  3P9C A;  3RTR A;  5DD4 A;  5FLX K;  1IW7 F;  3L9F A;  4M6X A;  3EDP A;  1E2X A;  1TQI A;  4KIC A;  4A2U A;  2ETH A;  4IRG A;  4OIO F;  4ENN A;  1VTN C;  4A5M A;  1ODD A;  2FBK A;  3H92 A;  5HOO A;  1K78 B;  5D4S A;  3V7C A;  1RIO H;  1MJA A;  2EA2 A;  1HW2 A;  2QVO A;  1ZRE A;  1TQP A;  2H09 A;  4ASN A;  5BMZ A;  2ZCW A;  1U78 A;  1YTY A;  2Q0O A;  5CVI A;  4O5V A;  2PLY A;  1YFH A;  1R1U A;  2A6H F;  3C3W A;  2PG4 A;  3HYI A;  2FNP A;  1BC7 C;  2FA5 A;  1HSJ A;  2VBZ A;  1BC8 C;  2C6Y A;  4AIH A;  1LB2 A;  1LNW A;  3CUQ B;  4L0Y B;  2RNJ A;  1T38 A;  2XKP A;  1LQ1 A;  1FP2 A;  3HTU A;  5E1X A;  5F1R A;  1P4X A;  1V3F A;  2PI0 A;  1MKM A;  4HAM A;  1P6R A;  3R6S A;  1WQ2 A;  1D8K A;  4ZYE A;  2HWV A;  4BNC A;  1O7F A;  4RB0 A;  4LGW A;  3CO7 C;  4KFC A;  1BJA A;  2EFO A;  5DYM A;  2ESH A;  2K4B A;  1YG2 A;  2WWY A;  3EQL F;  1XSD A;  2ISZ A;  1D5V A;  4U7D A;  2PBI A;  2XAQ A;  3G3Z A;  5KK1 A;  1ZHF A;  5LGN A;  3JAM Z;  1STZ A;  2VBW A;  3DV8 A;  3COA C;  4D0P A;  4G9Y A;  1IRG A;  3QRF F;  2LNB A;  4I2O A;  2A5Y B;  1HW1 A;  1PUE E;  3WG9 A;  5IT9 Z;  1J5Y A;  4A0Z A;  1JE8 A;  1IN6 A;  4KIG A;  1S3J A;  4ZH4 F;  3JSP A;  1GHC A;  3I54 A;  3RIR A;  4FX4 A;  3N4M A;  3ZMD A;  4ZZD A;  4BH9 A;  2M30 A;  2KIF A;  2E7X A;  2KJB A;  5LRS A;  1W7P A;  2V6C A;  3Q9S A;  3KFW X;  1ZRF A;  2NRA C;  1W4M A;  5DCM A;  3JSO A;  3KCC A;  4KIB A;  3KP5 A;  3E6B A;  2L02 A;  1KU7 A;  5HDG A;  4F7Z A;  1SFX A;  1QO0 D;  2E7W A;  3I71 A;  3P9I A;  2DK8 A;  3ZMT A;  3BY6 A;  4IVN A;  2DPD A;  4GGG A;  4YFK F;  1UHW A;  1Z1D A;  3WTT C;  2VBY A;  1CF7 A;  2L3D A;  1R7J A;  1TNS A;  3S2W A;  1HXD A;  1XDU A;  3QPT A;  2EK5 A;  2STT A;  1WKM A;  5ICG A;  1XDS A;  1U5T C;  3ZMU A;  4A6E A;  2B0L A;  2QBY A;  4MQV A;  2GAU A;  5LBQ A;  1J9I A;  4P96 A;  1TW3 A;  4A12 A;  4G7Z F;  1FSE A;  3CLO A;  1NHA A;  1IN7 A;  3GO5 A;  1Z9C A;  3BZ6 A;  3I59 B;  2HQR A;  3FM5 A;  3GFM A;  4PGG A;  1MDM A;  3JTH A;  3NEU A;  5J8F A;  3FXU A;  4MNU A;  5HLH A;  3H3U A;  2DT5 A;  4ZYD A;  1RUO A;  3J80 Z;  1MJB A;  5H20 A;  2P5L C;  4HLX A;  1ON2 A;  2VXZ A;  2FXA A;  1IF1 A;  3IWF A;  1YLF A;  3SHF A;  4U0W A;  3HRT A;  1WSU A;  5DCM B;  1U5T A;  3L09 A;  3R0J A;  1KU3 A;  4WX9 A;  4UNO A;  1R22 A;  1P4W A;  5LHH A;  2PN6 A;  4HX4 A;  3BDD A;  1S6L A;  5HS7 A;  2EA4 A;  2OU2 A;  2MA3 A;  1XMA A;  2D2W A;  1XSV A;  4G7H F;  3E5X A;  5HS8 A;  2QM3 A;  4UXN A;  2FQ3 A;  5BOX A;  2F5C A;  1XGM A;  3GEZ A;  5EEH A;  5H6R A;  4G94 A;  4CDG A;  3MZY A;  2JT1 A;  1TQM A;  2GXG A;  4UV8 A;  1FOK A;  4NB5 A;  2DU9 A;  1XCV A;  5JFR A;  1FBQ A;  4EJO A;  2DQR A;  1W5T A;  3GUD A;  3WU0 A;  3J7A O;  1FBU A;  2CG4 A;  4CZZ A;  1O3S A;  1O3Q A;  1IN5 A;  2P7V B;  2MH9 A;  2RQP A;  3B02 A;  3DKW A;  3M8F A;  2XKO A;  3E3V A;  1OYI A;  1FWZ A;  2STW A;  1XGO A;  2GIV A;  3VB2 A;  1ULY A;  4RB3 C;  5ILS A;  2EFQ A;  2K7L A;  3V8J A;  1GXP A;  4KA4 A;  3HHG A;  3EYI A;  4KT5 C;  5L3F A;  1HKT A;  4LFU A;  1B1B A;  2G7H A;  3LA2 A;  3Q5F A;  2XGX A;  4B09 A;  2EFP A;  4S05 A;  2FOK A;  3E5U A;  2UWM A;  4LK0 F;  4OMY A;  3D5L A;  4BXU A;  4XRF A;  4YG2 F;  3GWZ A;  1AWC A;  4AIK A;  1T0F A;  4ESB A;  4N0B A;  3ELK A;  4ZZL A;  2CW0 F;  1ZG1 A;  4A0Y A;  1G3T A;  3ZPL A;  1J7K A;  5DCF A;  2XAS A;  2CWE A;  2XUB A;  1FX7 A;  2J5O A;  4MQ9 F;  3CJN A;  1S8N A;  3WU1 B;  3BJA A;  4XLP F;  3L7W A;  1SD7 A;  2BE5 F;  2FE3 A;  2XAJ A;  5A2Q Z;  2D45 A;  5AIP A;  1U6G A;  3ABT A;  2Z3Y A;  4P55 A;  2M87 A;  2XHK A;  1G3W A;  5HDN A;  4WXC A;  2YX4 A;  5ILV A;  1DPU A;  5JR3 A;  1EH6 A;  1UFM A;  2OZ6 A;  2Z33 A;  2ZME B;  4BQA A;  3BJO A;  3ERE D;  3RJP A;  3M7G A;  2IPQ X;  1C0W A;  1QQI A;  5CVJ A;  3FXR A;  1X3U A;  3I5U A;  4I0B A;  2P5V A;  4HF1 A;  2W85 A;  1L3L A;  2IT0 A;  1XB4 A;  4XBF A;  2NS0 A;  1T39 A;  5CVV A;  3BPX A;  3GFL A;  2GZW A;  1W7P D;  2XVC A;  4PCQ A;  1IN4 A;  3TO6 A;  2R7D A;  3FXQ A;  2ZNZ A;  3U2R A;  2V1U A;  3ECH A;  3VOD A;  3NQO A;  3K2Z A;  5FGM A;  5D6E A;  3KE2 A;  4WXD A;  3ZMS A;  1G6N A;  2BGC A;  5D5V B;  3ECO A;  4WK8 F;  1I1S A;  3SZT A;  3KP7 A;  2EV0 A;  5HDK A;  3QOP A;  3Q9V A;  3M9A A;  1I5Z A;  3LFK A;  1SMY F;  2GWR A;  3DP7 A;  1A04 A;  1BM9 A;  2D1V A;  2Z9O A;  3I0T A;  4R1H A;  2HTS A;  2KIU A;  1R1V A;  5TRD A;  4BYY A;  1YYV A;  3AAF A;  3V7S A;  3WTV C;  3KET A;  5E8G A;  5CVR A;  1H9T A;  2P6T A;  1FBS A;  4CYD A;  1O3R A;  3IWZ A;  1R58 A;  3WGH A;  1ZAR A;  2RGV A;  3DPL C;  1ON1 A;  2FU4 A;  5D5W B;  1QGP A;  5D8K B;  1Y0U A;  2QZ8 A;  2R3S A;  2GQQ A;  5LLQ A;  2PMU A;  3I53 A;  3HIF A;  2YR2 A;  1SD6 A;  3SZP A;  2COM A;  4I7H A;  3R0A A;  1KQ8 A;  1LDJ A;  5ED4 A;  4RB2 C;  1LDK B;  3F6O A;  4O6J A;  2EFW A;  1OMI A;  2CYY A;  2P7C B;  1ZGJ A;  1PP8 F;  4I09 A;  1YQA A;  1R5H A;  5AIQ A;  1O57 A;  1XGS A;  2QQA A;  3DXJ F;  5K1Y A;  4EGZ A;  2EV5 A;  5E1W A;  1L0O C;  3MCZ A;  2ADU A;  2IP2 A;  2HEO A;  3F8N A;  4LG0 B;  2MC3 A;  2ESN A;  3FMQ A;  4UHT A;  2X0L A;  3BPV A;  4P9F A;  1FYL A;  3GZ5 A;  2OQG A;  2BYV E;  2OAZ A;  3L00 A;  3ULQ B;  2P4W A;  2O6G E;  2DW4 A;  3E6D A;  3MAJ A;  4OOI A;  1S29 A;  4HOB A;  4MEY F;  2DPU A;  4N9H A;  4RGR A;  2QLZ A;  3T0Y A;  4HQM A;  4XSZ F;  2M1B A;  5HS9 A;  4PZJ A;  4UVB A;  1P4A A;  2UZK A;  3TDZ C;  1YO5 C;  2MLK A;  3RPQ A;  4QLC U;  1USS A;  4GCV A;  2MH2 A;  3F22 A;  1O7L A;  4XSX F;  4LLG F;  5HVQ C;  1B59 A;  1O3T A;  1D3Y A;  2E1N A;  3WTW C;  2R7F A;  1OKR A;  3FHZ A;  4OU0 A;  1DUX C;  5JVT A;  2EJR A;  1WWX A;  2Q2E A;  4IPA A;  2XAF A;  1FYM A;  4M9X A;  1CGP A;  1ZLK A;  3T8R A;  1BIB A;  3U1D A;  4UVC A;  2A3S A;  2HQN A;  2HDC A;  4WF2 A;  4RB1 A;  2VOP A;  4I98 B;  5D5U B;  5ERI A;  1LEB A;  4YII A;  4MTD A;  1UHM A;  2VC0 A;  1REP C;  4ESF A;  1FT9 A;  2W25 A;  4BAY A;  1DDN A;  2ZXJ A;  4U0V A;  5DUK A;  4Y15 A;  5E20 A;  4LJZ F;  2CFX A;  3T1B A;  5ICE A;  2PFB A;  1S7A A;  5E17 F;  4ETS A;  2O0Y A;  4UUV A;  2LSO A;  3HUG A;  4M6Y A;  2FBI A;  4P9U A;  3HSR A;  2L01 A;  1V4R A;  3TGN A;  3TOA A;  2JPB A;  1GVJ A;  1D8J A;  1XD7 A;  2RKH A;  4LD5 A;  4FX0 A;  4DNC A;  2M5W A;  3ZN1 A;  4LB6 B;  1JXS A;  4G6Q A;  1QBJ A;  3GFJ A;  2ISY A;  4HYE A;  4B8X A;  4L5I A;  3HRS A;  2HGC A;  1XMK A;  1SFE A;  3E6C C;  2Y75 A;  2H6B A;  4CXF A;  1HW5 A;  2FEZ A;  1FYK A;  1G3Y A;  5LHI A;  4MGR A;  2WTE A;  4R8H A;  2F5F A;  2W57 A;  5BS6 A;  4KDP A;  4YFX F;  3WTX C;  1S7O A;  3WTY C;  3LWF A;  1K6O A;  1W7P B;  1WRJ A;  2PJP A;  3TO9 A;  4PDK A;  3V8K A;  5IT3 A;  1SFU A;  4KMF A;  2UXN A;  4LMY A;  1FNN A;  1KYW A;  3EYY A;  4M9S A;  1FSH A;  3J81 Z;  2FF4 A;  3K1P A;  5FFX A;  3PQJ A;  3O2P E;  5BPD A;  5BQT A;  3LAP A;  2MLG A;  5DD8 A;  4IF4 A;  4ESJ A;  3V7R A;  2FRH A;  3R60 A;  4AWX B;  4L9V A;  1ZG3 A;  1CF7 B;  4JK1 X;  3HRM A;  5HLI A;  4OIR F;  1I6X A;  2H27 A;  1BI0 A;  5IT9 K;  5L3G A;  2DFI A;  1KU2 A;  2ZKZ A;  4RAZ A;  4L5J A;  2QBY B;  1ZGA A;  2PMH A;  3G73 A;  5DUI A;  4MEX F;  3GFI A;  2OD5 A;  2DAO A;  5LHG A;  1GXQ A;  4ZYH A;  3IC7 A;  2JZY A;  1MDM B;  2HYF A;  2FML A;  1FP1 D;  1W5S A;  3FMS A;  3R61 A;  1DPR A;  4G6D A;  1K7A A;  4RGX A;  4LLN A;  1BBY A;  5ICC A;  4RGS A;  1QZZ A;  2VON A;  2RC4 A;  1TW2 A;  2A61 A;  1I27 A;  4GO1 A;  1U5T B;  1KGS A;  2LF8 A;  2OA4 A;  3QP5 A;  6PAX A;  1ZRD A;  4P5O A;  2P5K A;  3B73 A;  3T5X A;  5E18 F;  1RUN A;  1ZG5 A;  4DQ2 A;  3HHH A;  4OMZ A;  3F3X A;  4Q47 A;  3P9K A;  3N97 A;  2EWN A;  2VE8 A;  2A68 F;  2HR3 A;  2XAG A;  3SXY A;  5FLX Z;  3WTS C;  3O6B B;  4M73 A;  4A5N A;  5HLG A;  4EGY A;  3F72 A;  2JRT A;  1XCB A;  2E1C A;  1J59 A;  3IHU A;  4U7B A;  1TTY A;  4LK1 F;  2IA1 A;  4OIP F;  2L4M A;  3GVA A;  4LLL A;  1T98 A;  2IJL A;  1OYW A;  3VFZ A;  4EJU A;  4U0Y A;  3BJ6 A;  2LDU A;  3VEP A;  1QZY A;  4A6D A;  3FX3 A;  3F8C A;  3OOP A;  5L3D A;  1FLI A;  2K86 A;  4HLY A;  1KYZ A;  3FZV A;  3DFG A;  3KLO A;  4Q4Z F;  4IHS A;  5K5Q A;  4AVP A;  5LGU A;  4IJA A;  4L9N A;  1DP7 P;  2EB7 A;  5CYV A;  5KVR A;  3JTG A;  1U2W A;  3ISP A;  3FM3 A;  4A0X A;  3ML6 A;  4YIF A;  4NHJ A;  4HZF A;  1YW9 A;  5K5R A;  1FZP B;  2A6E F;  4Y17 A;  5LGT A;  1ZAO A;  2HKX A;  4RAY A;  3ROU A;  4ZYG A;  2RV8 A;  2RN7 A;  4ENJ A;  3TOB A;  4KNY A;  2MD5 A;  5D5X B;  1TLH B;  1K78 A;  3QAH A;  3F8B A;  3KEO A;  1B6A A;  2Z99 A;  2LF7 A;  5CVU A;  1SD5 A;  4EJW A;  2FSW A;  3RKX A;  1Q1H A;  3MFK A;  3TDU C;  5D8L B;  1Z05 A;  1ZN2 A;  2VOO A;  2ACJ A;  3GW2 A;  1Z91 A;  2DQL A;  3IRQ A;  3D0S A;  3LQR A;  1MZB A;  2CGP A;  3QPH A;  5LEJ A;  4EM2 A;  1F4K A;  4KN7 X;  5LEK A;  2W84 A; 
#chains in the Genus database with same CATH topology
 1B9M A;  3TMO A;  1IV6 A;  1AKH B;  1MMA A;  1U9O A;  3CUQ A;  4C3J J;  4II3 A;  1IUY A;  1E3H A;  1KQ0 A;  4Y33 A;  1JJ6 C;  3F23 A;  5K5O A;  4UUT A;  2QWW A;  4JBA A;  3CCY A;  1ZRC A;  1YIJ I;  1WH5 A;  2E1O A;  3RKW A;  3FK7 A;  2VKH A;  3FF5 A;  1BIA A;  1FY7 A;  2M0C A;  2P6S A;  4L18 B;  2DI3 A;  1LEA A;  5J3L A;  3HTS B;  1G8X A;  3AG4 H;  1J75 A;  2K9L A;  5D4R A;  2F5D A;  3N05 A;  3ZMZ A;  1MBK A;  4S04 A;  5FLV A;  3QU6 A;  4RLF A;  3K9T A;  3B6A A;  4EQQ A;  1B72 B;  3GZ6 A;  2OCC H;  3OYM A;  2G7U A;  2LD5 A;  3ZQL A;  2G9W A;  2A69 F;  3HKZ A;  4BEH B;  4U88 A;  1D0Z A;  3CJQ B;  5BPI A;  1ETX A;  2ELH A;  4HV5 A;  5H6Q A;  1KU9 A;  1Z3Y A;  2JSC A;  5ICF A;  1Z7U A;  1VND A;  2VQL A;  2D5V A;  2IGM A;  1Z6R A;  2L54 A;  1IN8 A;  1ONV A;  2M7A A;  2K9Q A;  1OQY A;  2ZO4 A;  1NK3 P;  1A35 A;  3Q0W A;  4MTE A;  2W1O A;  2Z5U A;  2W24 A;  4BHB A;  2H6C A;  5EEG A;  1S9H A;  2XGE A;  5AON A;  3F21 A;  5JVG F;  5IYC J;  2KFD A;  1T2K A;  2VPR A;  1IXR C;  1XSX A;  1UJ8 A;  5H2F C;  1VI0 A;  1X2N A;  3WTZ A;  3HB9 A;  3L2C A;  2JTV A;  2DA6 A;  3K6G A;  2EIK H;  4QWQ A;  3NAR A;  3JW4 A;  2GA2 A;  2NAZ A;  4GYI A;  3SYT A;  2AO9 A;  4IZZ A;  1YS6 A;  2FMY A;  3DEU A;  2V79 A;  3HM5 A;  3IKT A;  4GDF A;  2Y69 H;  5LRR A;  1R36 A;  2M2E A;  1MW7 A;  4CIC A;  4HQE A;  2DO7 A;  4TV7 A;  3ZOB A;  2LOO A;  4YRV A;  5A2Q K;  4UUS B;  1HKS A;  1WJC A;  2K3F A;  3LA3 A;  5F04 A;  1LPQ A;  4DBQ A;  2A07 F;  2BBY A;  2Z1D A;  2XAH A;  4PK4 A;  4WXH A;  1X4P A;  3DU6 A;  3C7J A;  4RGU A;  1OR7 A;  3OYN A;  2DA4 A;  2V4J C;  1EH8 A;  3G71 I;  4C3H J;  4AM3 A;  4FE4 A;  2Y31 A;  3DEE A;  3DPT A;  1IZ1 A;  3AL0 B;  3E97 A;  3FHN A;  4BHC A;  2DCE A;  4F91 B;  1P9Q C;  1GDT A;  1IRF A;  1ERD A;  3IP4 B;  1UAA A;  1MIJ A;  2CSO A;  2F4O B;  5J47 A;  3VWB A;  2LKP A;  1YE9 A;  1Y6I A;  1NG7 A;  3W2W A;  3TKY A;  5F08 A;  4I02 A;  1UEL B;  3OIO A;  2K27 A;  3EUH A;  1WI9 A;  1Y56 A;  5FD5 A;  3BTI A;  3C2B A;  3CO6 C;  2CH0 A;  4EVI A;  4NBQ A;  2PQ8 A;  3MWM A;  3KEQ A;  1K4S A;  1XC5 A;  3K69 A;  1SD4 A;  3RDI A;  2VC1 A;  2RVC A;  4IX7 A;  2HZT A;  1Z6T A;  1RR7 A;  3KP4 A;  1F1Z A;  3HSE A;  3ABU A;  3FWE A;  1YIO A;  1KON A;  2CO5 A;  2Y0S N;  3RQI A;  5E3O A;  4L0Z B;  1CQT A;  4R79 A;  1OYY A;  2R5Y B;  4CA0 A;  3M1E A;  3I4N J;  5CQG A;  2QSG X;  1OPC A;  3KP3 A;  2QQB A;  2LKX A;  4IL6 C;  3K4K A;  2L9V A;  3BOQ A;  1LVA A;  4HW0 A;  3W6K B;  2VQC A;  1RET A;  2ZNY A;  3VPR A;  1MBH A;  3PFI A;  3DTK A;  1Y39 A;  5L3E A;  2IGN A;  2VN2 A;  4C30 A;  1TWH J;  3F6V A;  4HDV A;  1X1D A;  1QNT A;  2OJE D;  3A02 A;  1H0M A;  2W48 A;  3CDL A;  2XC7 A;  2QQ9 A;  4NC6 A;  3KZI C;  1D0X A;  4D1Q A;  4E7K A;  2ZFW A;  1J0R A;  3FMR A;  2XV4 S;  3HOT A;  2AQE A;  2EPF A;  2E35 A;  1EV7 A;  2OV7 A;  5IOZ A;  5E3L A;  4HG2 A;  4HX7 A;  3JRA A;  3OMY A;  2EIJ H;  4KUM A;  3LQQ A;  4A3L J;  2BHY A;  3VOE A;  2PEX A;  2V26 A;  3JRD A;  4NNJ A;  1KA8 A;  4DGW B;  4I0A A;  2E1M C;  2IA2 A;  3ZMV A;  1FC3 A;  4DIQ A;  3TQN A;  4AD9 A;  3RZD J;  4B44 A;  2VT3 A;  3H0G J;  2EIN H;  5JI6 A;  2OPT A;  4HV6 A;  3GYH X;  1YW7 A;  3Q0V A;  4EM1 A;  2L2O A;  2O3F A;  3KYC B;  3DQV C;  3KLN A;  1XS9 A;  3MKW B;  3HOZ J;  3MQ0 A;  2WAF A;  3CUO A;  4BDY A;  1ZR2 A;  3KP6 A;  3I59 A;  1R00 A;  3LST A;  5F1J A;  4ENK A;  4KIT B;  4ZDP A;  1HQC A;  4E70 A;  4B43 A;  3A01 B;  4IHT A;  1JT0 A;  1V54 H;  5KHD A;  4LG3 A;  4E7H A;  5CLS A;  3V8L A;  3L1P A;  4LIU A;  1EKE A;  2ZJQ F;  3NWS A;  3GLX A;  3HRU A;  3DKY A;  5L3B A;  5FKN A;  4PGH A;  3MMY B;  3E5Q A;  1XGN A;  3S17 J;  1R23 A;  3O3K A;  4WWC A;  3BZC A;  2DA7 A;  2VKV A;  2YX7 A;  3HOS A;  3PSI A;  3IAS 2;  3MEX A;  4V2F A;  1JGS A;  3RPU A;  3MD2 A;  2D1H A;  4PJJ A;  4DOZ A;  2MBF A;  1U9N A;  4EMS A;  3RCO A;  1FMW A;  5D6F A;  2VUM J;  2X1D A;  1FPQ A;  2DN0 A;  4XOT A;  4H0E A;  3GF2 A;  3MZH A;  3DF8 A;  1IXS B;  4BXF A;  2CQ7 A;  3BWG A;  1BA5 A;  2WC2 A;  3K1M A;  2Q2E B;  2GA1 A;  1JJ8 C;  3S3N A;  2A05 A;  2P0W A;  5DM7 F;  3QYB A;  3RYP A;  4RMN A;  5LD2 C;  4XR6 A;  1U3E M;  2GBY A;  4P1W A;  4BQQ A;  2HZD A;  2HNH A;  2OZU A;  2EZH A;  4M71 A;  5IOY A;  1SMT A;  3LAJ A;  3QOD A;  4CHU A;  1BN5 A;  3A0H C;  5J8C A;  4D7M A;  2QYO A;  2CS3 A;  2P8T A;  1XN7 A;  4UB8 C;  1MJ9 A;  2L7M P;  2HOE A;  4XLC A;  3H5R A;  2XRO A;  5ILU A;  3RI4 A;  1YS7 A;  4ZDL A;  4A3G J;  1IRX A;  4QPQ A;  2ZJ2 A;  3DWL E;  1RNL A;  3KYL A;  4GYG A;  2LBF B;  2E5N A;  2E71 A;  4KN4 X;  2EH3 A;  5CQE A;  3A2K A;  1TWG J;  3E6M A;  2DOE A;  2BY1 A;  2GXB A;  3ZGK A;  3GTO J;  4HA8 A;  4L9J A;  1B9N A;  5FKM A;  1RPW A;  3ZQ7 A;  1TWC J;  4MFE A;  2L4A A;  3LSP A;  2FBH A;  3KZZ A;  2DOF A;  5DTD A;  4BKX A;  2X1C A;  2PJR A;  1HDD C;  1UST A;  3IRR A;  2VOD A;  5EGO A;  3CD6 I;  3K4C A;  2NXN B;  3WOD F;  1HKQ A;  1X1A A;  2Q8K A;  3RKY A;  3WE2 A;  4Q48 A;  1YJN I;  2K4J A;  3FKJ A;  3QP6 A;  1G3S A;  4N9I A;  1I6H J;  2HS5 A;  5TJJ A;  1XG1 A;  3HUG B;  3ZQG A;  2Y48 A;  2AXT C;  1E17 A;  2XRL A;  5IP9 J;  3LSJ A;  4B3X A;  3QPS A;  3JAM K;  2Q1Z B;  4AID A;  1VQP I;  2RDP A;  3C1D A;  3PQK A;  1RR8 C;  4FHT A;  1FIP A;  2HTJ A;  2L5Q A;  3C18 A;  4BY7 J;  2OTL I;  1A6Q A;  3I64 A;  3RQ4 A;  1SAX A;  2AXL A;  2E1M B;  2I5U A;  1I1G A;  3ZQI A;  1YRN A;  1LJ9 A;  3LOC A;  5J4Y A;  5B5E C;  1F9N A;  4ZDO A;  4XNF A;  2ME6 A;  4A3F J;  2KRF A;  2K02 A;  4AIJ A;  2XB0 X;  2KL4 A;  2IS1 A;  3K4L A;  1JKR C;  3WE3 A;  4XKW A;  3CQZ J;  2WV1 A;  2QA4 I;  3ZQC A;  3NRV A;  4HST A;  4ZJZ A;  3L2Q A;  4O3M A;  2V1D A;  3IKV A;  5DEQ A;  5M3F J;  4IQ4 A;  2ID6 A;  3WTU C;  2HDW A;  2F5V A;  4OIQ F;  3IL2 A;  4HF0 A;  2CUJ A;  1E3O C;  1DGR M;  3HJE A;  2YPR A;  4HDU A;  1MSE C;  3BRO A;  3V4G A;  3VYR B;  2BV6 A;  4M72 A;  4HF2 A;  4G7O F;  4FET A;  3IUO A;  3MKY B;  1ETO A;  1LE8 B;  2PX9 A;  4IKF A;  2EIM H;  3PL8 A;  2DA1 A;  2X4H A;  1P2F A;  1ENH A;  4UVA A;  3OYD A;  2ZBK A;  1R5G A;  1H9G A;  3R4K A;  2VB6 A;  4S0H B;  2IA0 A;  2KDZ A;  4D9J A;  2HFH A;  4IRH A;  3CCE I;  1OCO H;  1TT5 B;  2VBX A;  1UB9 A;  4XMY A;  5FKO A;  2VJ4 A;  2JMW A;  2O61 A;  3CTA A;  1MSF C;  2FOW A;  4IRI A;  4WCG A;  4BY1 J;  2NVY J;  3PO3 J;  4JQF A;  2HXI A;  3BP8 A;  1W36 C;  2E5Z A;  2FNA A;  1PDN C;  5F64 A;  4RDU A;  5FFZ A;  2DJN A;  4ABZ A;  1LDD A;  4HX8 A;  3OV8 A;  1RKT A;  1RKW A;  3REO A;  2QUF A;  2EV6 A;  3FIW A;  5FRO A;  4XLN F;  4LB5 A;  1JTY A;  2R7X A;  5FKL A;  1PP7 U;  2NVX J;  3GTM J;  3LA7 A;  4G12 A;  4PJM A;  2XRN A;  2IRF G;  2M45 A;  2KRC A;  1ORK A;  2CUF A;  2M34 A;  3HEF A;  4KMU X;  1RZ4 A;  2CQN A;  2UXX A;  1UG0 A;  4EV0 A;  2QEN A;  4A69 C;  3SQN A;  2ZME A;  2YUS A;  3K7A J;  3BCA A;  1JHF A;  1P92 A;  2NYX A;  1TP4 A;  3S3O A;  1E0E A;  1X1P A;  3WGG A;  1ITY A;  4C9Y A;  1BOA A;  3AG1 H;  4NQW A;  5E1Z B;  3ZQH A;  2IW5 A;  4Z2Y A;  3L2R A;  3J7A Y;  2XAU A;  3P7N A;  1WJA A;  5GP9 A;  1UHS A;  4BHP A;  1G4D A;  1T6S A;  2ID3 A;  1KQ9 A;  2OQR A;  2V9K A;  2CU7 A;  4Q5S F;  2PMZ A;  4GXO A;  1WJE A;  4CGZ A;  1U8R A;  1IXC A;  2V9V A;  1MGT A;  3LMM A;  2YSR A;  4MHG A;  1ZR4 A;  2E19 A;  2O03 A;  3OYK A;  1EH7 A;  1F36 A;  3HDD A;  3ZXS A;  5L3C A;  3A4C A;  5GTH C;  4M74 A;  3RKQ A;  3JCU C;  1U8B A;  4KIF A;  1JKP C;  2OUM A;  2BEO A;  5E8I A;  4UV9 A;  1SVO A;  2L9S A;  3OYH A;  1WZ2 A;  3QU3 A;  1EF4 A;  4RA2 A;  2LP0 A;  4YEJ A;  2FJ1 A;  1QPI A;  3ZP5 A;  4M9Z A;  5IY5 H;  4YFN F;  2JRM A;  2KP6 A;  3J80 K;  2X6Y A;  4CO8 A;  3KP2 A;  3U9G A;  3PFY A;  3GTJ J;  4UY8 I;  1BI2 A;  3OSF A;  1MH4 A;  2X9D A;  4RAF A;  1IAW A;  2O8X A;  3E7L A;  4AC0 A;  4OIN F;  4BJT A;  2JA2 A;  1MBJ A;  2NNN A;  1MD0 A;  3GTG J;  2ZSH B;  2YU3 A;  1R1T A;  1F5T A;  2V1X A;  4B3A A;  3J81 K;  5CJ9 A;  3SFZ A;  1JTX A;  1OCC H;  1WVR A;  3NAU A;  3OYB A;  5JHU A;  2VT2 A;  5FO5 A;  1MMG A;  1K79 A;  1ZH5 A;  2J5P A;  5FD6 A;  3SEZ A;  2BXY A;  3UNG C;  3OYF A;  2R5Z A;  3K1N A;  1MND A;  2M9H A;  4FT8 A;  4KYW A;  3CLQ A;  4ON0 A;  3EET A;  1OCZ H;  1RES A;  1ZK8 A;  2M8E A;  3GXO A;  3H3Z A;  1WJB A;  4G8X A;  2VQH A;  2K9M A;  4EM0 B;  1HBX G;  3U21 A;  2R7S A;  2DJI A;  1TWA J;  2DLL A;  3EPZ A;  4XIC A;  3WGI A;  3I58 A;  2YS9 A;  1B4A A;  2NS8 A;  4QTR A;  3DTE A;  3U1K A;  2EZK A;  2HPM A;  1QPM A;  3CCL I;  4EJT A;  2R92 J;  2IGO A;  4Y13 A;  4ENM A;  3CUQ C;  5J6X A;  9ANT A;  2NOG A;  2R7O A;  3T8T A;  3HOY J;  3S2D J;  2OBP A;  4EJV A;  1ZKG A;  2MC4 A;  4BQO A;  3KIO A;  3OL3 A;  2WY7 Q;  3VSK A;  4L9T A;  5KCM A;  2NNY A;  3F8M A;  3RPU D;  1TNT A;  4F52 A;  2TDX A;  1IV8 A;  2Y0M A;  4XK4 A;  2EFN A;  2LRE A;  3ERM A;  3KZY A;  3ZN0 A;  1HST A;  2K3P A;  2IEK A;  1IUF A;  4RS8 A;  5DDG A;  1G59 A;  2O8K A;  1J2X A;  1LFU P;  1OIS A;  2DDA A;  2EQR A;  2KKO A;  1BR1 A;  3SDG A;  2VJ5 A;  4KJZ A;  1BI1 A;  4XN0 A;  3SZG A;  2E2J J;  2CQK A;  1OJL A;  3ONQ A;  2VE9 A;  3GX4 X;  3FXJ A;  2HYG D;  4HSR A;  1TBX A;  2JPC A;  2AS5 F;  1JHH A;  3TO7 A;  4PSX A;  2XB5 A;  2M7B A;  2A5W A;  3RYR A;  2F5E A;  1K6Y A;  2DTR A;  1SVL A;  1SAN A;  1ZYR F;  2HQ5 A;  2Y0S A;  3O8H A;  4IXA A;  2F2E A;  3RSN A;  1RI7 A;  5FB2 A;  2HOT A;  2R93 J;  1MNM C;  1BI3 A;  1Q1V A;  3HSF A;  4LG0 A;  4HBL A;  3AG3 H;  2DK5 A;  4K2E A;  5DV5 A;  3M8E A;  5B3S H;  2IVM A;  5F6F A;  3W6J B;  4CYC B;  4E6K G;  1BJZ A;  1YW8 A;  2KIM A;  3I4P A;  1ZLJ A;  2WV0 A;  2H94 A;  2HKO A;  3K70 C;  3K0L A;  3F8F A;  2DMQ A;  2DBB A;  1VQK I;  3CF2 A;  2KJC A;  2JA7 J;  4I01 A;  1AOY A;  2A6T A;  1UCR A;  2XIG A;  3CDH A;  1OR7 C;  3P9C A;  3AFH A;  3RTR A;  4BGD A;  2R7Q A;  5DD4 A;  5FLX K;  5IPA A;  1IW7 F;  3L9F A;  4M6X A;  1H88 C;  1PVE A;  2XGD A;  3EDP A;  1E2X A;  2MFZ A;  1Z0X A;  4GFB A;  1TQI A;  4KIC A;  4A2U A;  2ETH A;  4IRG A;  4OIO F;  1JUP A;  3OL4 A;  4ENN A;  1VTN C;  4A5M A;  2DMN A;  1ODD A;  4AUX A;  2FBK A;  2CW7 A;  3H92 A;  5HOO A;  4IOC F;  3BR3 A;  1K78 B;  3EUH C;  3IV5 A;  5D4S A;  3V7C A;  2GM4 A;  3H9J A;  1WHU A;  2JA5 J;  3F0C A;  1RIO H;  1MJA A;  2EA2 A;  4PFO A;  1HW2 A;  4A93 J;  2QVO A;  1ZRE A;  1TQP A;  2H09 A;  2CFO A;  4ASN A;  3DCF A;  5BMZ A;  4XKV A;  2KPM A;  2ZCW A;  4Y52 J;  3LSM A;  1U78 A;  1TZL A;  1YTY A;  2EIL H;  4IHW A;  1YI2 I;  1X19 A;  2X6W A;  2Q0O A;  1S7E A;  1T08 B;  5CVI A;  3TP0 A;  3HZJ A;  1X1C A;  4O5V A;  3L2V A;  2PLY A;  1YFH A;  4BBS J;  1R1U A;  2A6H F;  2UV1 A;  4JX5 A;  3WHC A;  3C3W A;  2PG4 A;  3HYI A;  2FNP A;  1BC7 C;  3ASO H;  2FA5 A;  4IEJ A;  1HSJ A;  2W00 A;  2VBZ A;  1BC8 C;  2C6Y A;  3LL7 A;  4AIH A;  1LB2 A;  1LNW A;  3CUQ B;  4FCY A;  2CW8 A;  2XGC A;  4L0Y B;  2RNJ A;  3S3M A;  2X6O A;  3KX2 A;  4B4C A;  3I55 I;  1T38 A;  2XKP A;  1LQ1 A;  2ZC2 A;  3BG9 A;  1QA6 A;  4KT6 A;  1Z77 A;  2DDB A;  3DTI A;  2DOD A;  4FQG A;  2VJI A;  1N25 A;  3MKL A;  1HA8 A;  1ZGW A;  1FP2 A;  3HTU A;  4QSH A;  3GLL A;  3M1C A;  5E1X A;  5F1R A;  3BG7 A;  1P4X A;  3HPG A;  2F4M B;  1ETQ A;  2M0M A;  1V3F A;  2CJJ A;  4ANJ A;  5M5Y J;  2BZT A;  2PI0 A;  5E79 C;  1FOX A;  5GAH J;  1MKM A;  4HAM A;  2ELJ A;  3BR2 A;  1HOM A;  1P6R A;  3R6S A;  1WQ2 A;  5KAF C;  1D8K A;  4J01 A;  1N77 A;  3PIO F;  2BY3 A;  4PSW A;  4ZYE A;  1HC8 A;  2HWV A;  4BNC A;  1O7F A;  4XOP A;  1JGG A;  4RB0 A;  3SDB A;  4LGW A;  3LSG A;  3CO7 C;  4KFC A;  1BJA A;  2EFO A;  5DYM A;  3PJR A;  2ESH A;  3K4B A;  2K4B A;  1YG2 A;  2WWY A;  3EQL F;  2DA2 A;  1V5F A;  1XSD A;  2ISZ A;  2WAD A;  1D5V A;  4U7D A;  5K7F A;  2PBI A;  2XAQ A;  2LMD A;  3G3Z A;  5KK1 A;  1ZHF A;  1FOY A;  5LGN A;  3JAM Z;  2M3A A;  3M4O J;  2ELK A;  3A0B C;  2B9S A;  2DXI A;  1A36 A;  1STZ A;  4BE2 A;  2VBW A;  3DBR B;  3DV8 A;  5IYB J;  3COA C;  4D0P A;  5FLM J;  1I39 A;  2IS2 A;  4G9Y A;  3VSL A;  2R7W A;  3CF5 F;  1IRG A;  2V9P A;  3QRF F;  2LNB A;  1A31 A;  3H5N A;  4XRM A;  2DFF A;  4I2O A;  1OFC X;  3TW7 A;  2A5Y B;  1HW1 A;  1PUE E;  3WG9 A;  2VPL A;  1I3Q J;  5IT9 Z;  2R7Z J;  1D0Y A;  5GAG J;  2G0E A;  1J5Y A;  4A0Z A;  1JE8 A;  2VQG A;  1IN6 A;  4KIG A;  5TGT A;  3LSK A;  2R7R A;  1S3J A;  5FJ8 J;  2VI6 A;  3BLY A;  4XLH A;  1VQL I;  3I9V 2;  2JA6 J;  1N75 A;  4E4H A;  4A3D J;  5J1Y A;  4ZH4 F;  3JSP A;  2KQR A;  1GHC A;  2GLO A;  3I54 A;  1AA7 A;  3RIR A;  4IO9 F;  4FX4 A;  3N4M A;  3ZMD A;  2F4I A;  2X1E A;  4ZZD A;  5HNH A;  2DMU A;  4LIT A;  1SAU A;  1ACI A;  1IG7 A;  2VKE A;  1QVT A;  3E1S A;  3MVP A;  4BH9 A;  2M30 A;  2KIF A;  2I10 A;  2E7X A;  2KJB A;  1Y8R B;  5EG0 A;  5LRS A;  4RLQ A;  3HOV J;  2VAS A;  3HXL A;  5GAE J;  1IGN A;  4I99 C;  1W7P A;  2CRG A;  2LVS A;  2BOL A;  2V6C A;  3Q9S A;  5EJC A;  3KFW X;  2CUZ A;  2BVM A;  2JVH A;  1ZRF A;  3JRF A;  2NRA C;  1W4M A;  5K7Z A;  5DCM A;  3JSO A;  3KCC A;  5EEA A;  4KIB A;  2BW3 A;  3KP5 A;  4DYC A;  3E6B A;  2L02 A;  3JRB A;  2GOM A;  1KU7 A;  5HDG A;  3S8P A;  4F7Z A;  4M3B A;  2NS7 A;  1SFX A;  4IHX A;  2HOA A;  1QO0 D;  2E7W A;  3I71 A;  3HGY A;  3P9I A;  3WHB A;  4X0G A;  3PIP F;  2DK8 A;  5J40 A;  3ZMT A;  3BY6 A;  4IVN A;  2DPD A;  5C4X J;  4GGG A;  4YFK F;  1UZC A;  3W2A A;  1UHW A;  1Z1D A;  3HG9 A;  1MBG A;  4BL0 B;  4CCK A;  3WTT C;  4I6Z A;  2VBY A;  1CF7 A;  2L3D A;  1R7J A;  3ABM H;  1TNS A;  2K85 A;  3S2W A;  1HXD A;  1XDU A;  3QPT A;  2EK5 A;  2STT A;  4DZJ A;  5B66 C;  1WKM A;  3DKX A;  5ICG A;  2DT6 A;  2M8G X;  2TRT A;  3F9K A;  5C44 J;  1XDS A;  1U5T C;  3ZMU A;  4CH7 A;  3CP8 A;  4A6E A;  2B0L A;  2QBY A;  3TP3 A;  4MQV A;  4V19 K;  2GAU A;  5LBQ A;  1J9I A;  3IH4 A;  2RRE A;  4HPQ A;  4P96 A;  1TW3 A;  4CZC A;  4A12 A;  4G7Z F;  1T8I A;  2X85 A;  3GZN B;  3OIQ A;  1FSE A;  3CLO A;  1NHA A;  2FUG 2;  3L2U A;  1LVK A;  1IN7 A;  4E7S A;  3CJT B;  1VQM I;  3GO5 A;  1Z9C A;  3BZ6 A;  3I59 B;  3GTK J;  2HQR A;  3FM5 A;  3GFM A;  4PGG A;  1MDM A;  1IDZ A;  3JTH A;  3NEU A;  1TT0 A;  5J8F A;  1FTZ A;  1VZ0 A;  4C3I J;  1NH3 A;  3FXU A;  4MNU A;  5HLH A;  3H3U A;  2DT5 A;  3OR2 C;  4ZYD A;  1RUO A;  3J80 Z;  2R4G A;  1MJB A;  4IOA F;  3TW6 A;  5H20 A;  4BE1 A;  3OYE A;  1F43 A;  2P5L C;  4HLX A;  1ON2 A;  2LRD A;  1Y1V J;  2ZSI B;  2VXZ A;  2FXA A;  1VQN I;  1IF1 A;  3IWF A;  1YLF A;  3SHF A;  2Y9Z A;  4U0W A;  3HRT A;  1R5I D;  1WSU A;  5DCM B;  1U5T A;  3CJR B;  1K83 J;  3OYJ A;  1R71 A;  3L09 A;  3R0J A;  1YX5 A;  3M3Y J;  3OSG A;  3J7Y J;  2QSH X;  1KU3 A;  1MBE A;  4WX9 A;  4UNO A;  1R22 A;  3OYL A;  1P4W A;  2LC2 A;  3GTP J;  5LHH A;  1NTC A;  3K4N A;  2XF5 A;  2PN6 A;  4HX4 A;  1M1E B;  3BDD A;  1S6L A;  5HS7 A;  4E7Z A;  2EA4 A;  3JRC A;  2ME0 A;  1ETK A;  2OU2 A;  3CC2 I;  2MA3 A;  1XMA A;  2X6X A;  4HRI A;  3OS0 A;  4G6T B;  2D2W A;  1XSV A;  4Y4R A;  4G7H F;  3E5X A;  5HS8 A;  4MO7 A;  2QM3 A;  4UXN A;  5J1R A;  4E7J A;  2FQ3 A;  5BOX A;  2F5C A;  1XGM A;  3GEZ A;  3S93 A;  4AYB A;  3CME I;  2ZME C;  5EEH A;  5H6R A;  1QRY A;  4G94 A;  4F3Q A;  4CDG A;  3MZY A;  2JT1 A;  1TQM A;  2GXG A;  2IS6 A;  4UV8 A;  1FOK A;  4NB5 A;  3IAM 2;  1D5Y A;  2DU9 A;  1XCV A;  5JLX A;  5JFR A;  3QYE A;  3ASN H;  2NVQ J;  2JN6 A;  1FBQ A;  4EJO A;  2DQR A;  1W5T A;  3WG7 H;  4M3F A;  3PNT A;  3GUD A;  3WU0 A;  3DBH B;  2JUG A;  3J7A O;  1FBU A;  1ZTR A;  2CG4 A;  3PM1 A;  4M6V A;  3OS2 A;  2PJR B;  4CZZ A;  1O3S A;  1O3Q A;  1IN5 A;  2P7V B;  2MH9 A;  5EGO B;  3ZQF A;  3K4M A;  2CV1 A;  2RQP A;  4DZP A;  3B02 A;  3DKW A;  3S15 J;  3M8F A;  4M3G A;  2GOX B;  2XKO A;  3E3V A;  4M3E A;  1OYI A;  1FWZ A;  2VLA A;  2AHQ A;  1XGO A;  1D1C A;  2BY2 A;  2MGQ A;  2STW A;  2GIV A;  5FRM A;  3BG5 A;  1B8I A;  3VB2 A;  2DTZ A;  4PJL A;  3I4M J;  3G4S I;  1ULY A;  2E36 A;  4RB3 C;  2IGK A;  5ILS A;  1N78 A;  2EFQ A;  2K7L A;  1O4X A;  1MNE A;  2CMP A;  2MG4 A;  3V8J A;  4C2T A;  4DJA A;  1GXP A;  4KA4 A;  1YRN B;  3HHG A;  4GRI A;  3D5R C;  4KT5 C;  1WJF A;  3EYI A;  1JUM A;  5L3F A;  4LFU A;  1YJW I;  1HKT A;  1ETY A;  3JRH A;  2V1N A;  4XQF A;  1B1B A;  1VQ9 I;  2G7H A;  3LA2 A;  3Q5F A;  2XGX A;  3DLA A;  2OCE A;  3ZQQ A;  4B09 A;  2EFP A;  4S05 A;  2FOK A;  3E5U A;  2UWM A;  4LK0 F;  1Y0N A;  2R7T A;  5F0C A;  1HLV A;  4OMY A;  3HBL A;  3D5L A;  3PO2 J;  1QHG A;  4BXU A;  4XRF A;  4BE0 A;  1PUF A;  1QVU A;  3K10 A;  4YG2 F;  3GWZ A;  4JX6 A;  1AWC A;  4AIK A;  3S32 A;  3SEQ A;  2L7Z A;  1T0F A;  1MMD A;  4ESB A;  5C3E J;  4N0B A;  4B48 A;  3ELK A;  1JKO C;  4ZZL A;  4E7I A;  2CW0 F;  1Z3X A;  1LUJ B;  1XX5 A;  4I76 A;  1ZG1 A;  4DYQ A;  1BW6 A;  2RQQ A;  3Q3S A;  3CCJ I;  4A0Y A;  4RM3 A;  1G3T A;  2MD0 A;  2VXD A;  4XLE A;  2RNG A;  4AVZ A;  3ZPL A;  1X4O A;  1J7K A;  5DCF A;  2XAS A;  2CWE A;  2XUB A;  1FX7 A;  5E3M A;  2WBM A;  2J5O A;  3PUB A;  4AYB N;  4MQ9 F;  2BY0 A;  3G2B A;  3CJN A;  1S8N A;  3CC7 I;  3WU1 B;  3BJA A;  4XLP F;  3L7W A;  5GAD J;  2DYR H;  1X3Z B;  2K9N A;  1SD7 A;  2BE5 F;  2FE3 A;  2XAJ A;  5A2Q Z;  2D45 A;  5AIP A;  1U6G A;  3ABT A;  1T95 A;  2DFE A;  2Z3Y A;  4P55 A;  2M87 A;  2NVT J;  2EZL A;  2XHK A;  1G3W A;  3I3L A;  5HDN A;  4WXC A;  2YX4 A;  5ILV A;  1DPU A;  1OCP A;  5JR3 A;  1EH6 A;  3PNV A;  1UFM A;  3VYS B;  4BQN A;  2OZ6 A;  2Z33 A;  2ZME B;  4BQA A;  3BJO A;  1AKH A;  1GT0 C;  2K9S A;  3ERE D;  2Y2Z A;  5F0F A;  3RJP A;  3M7G A;  4QIW N;  2IPQ X;  1C0W A;  4JOM A;  4A3K J;  1QQI A;  2HOS A;  5CVJ A;  3FXR A;  1X3U A;  3VDX A;  4NQW B;  3I5U A;  2F6C A;  2NVU B;  4I0B A;  2P5V A;  3H1C A;  3FXK A;  1WJD A;  4HF1 A;  1P7J A;  2EBI A;  2W85 A;  3CCU I;  1MBF A;  1YIT I;  1L3L A;  2BHZ A;  2IT0 A;  1XB4 A;  2WY8 Q;  1I50 J;  4XLA A;  4XBF A;  2NS0 A;  4Y3O A;  1T39 A;  1X3W B;  2DT7 B;  5CVV A;  3CCM I;  3S1R J;  3BPX A;  3GFL A;  2GZW A;  1W7P D;  1WCM J;  2XVC A;  4L5E A;  2VIX A;  1B72 A;  2R7V A;  2JSP A;  4FE7 A;  4PCQ A;  2WAQ A;  4BEH A;  1IN4 A;  2DYS H;  5E3N A;  3CMM A;  3TO6 A;  3PSF A;  3H5A A;  2R7D A;  3FXQ A;  5C4J J;  3BR1 A;  2ZNZ A;  3U2R A;  2V1U A;  3ECH A;  4E7L A;  3VOD A;  3NQO A;  3BZK A;  3K2Z A;  2QQ8 A;  5FGM A;  2LTP A;  1H8A C;  1A5J A;  1WI3 A;  4XKB A;  4DBR A;  5D6E A;  3KE2 A;  4WXD A;  3EUK L;  4LIV A;  3ZMS A;  1G6N A;  4D5F A;  2XDV A;  2BGC A;  5D5V B;  3ECO A;  5F0H A;  4WK8 F;  4XOR A;  1I1S A;  4NUB A;  3SZT A;  1TC3 C;  3OYG A;  2IXS A;  4OWR B;  3DU5 A;  4ZTJ A;  3KP7 A;  2WB1 A;  4XRS A;  1VQ7 I;  5B1A H;  2CUE A;  2EV0 A;  4UUS A;  2L7K A;  1ETV A;  5HDK A;  3QOP A;  3UKG A;  1Z67 A;  3Q9V A;  4U87 A;  1T33 A;  4XM3 A;  3M9A A;  1I5Z A;  3CP2 A;  5FKK A;  3HGG A;  3LFK A;  1SMY F;  2GWR A;  3DP7 A;  1A04 A;  2R5Z B;  4CSW A;  1BM9 A;  2D1V A;  2Z16 A;  2Z9O A;  3I0T A;  4R1H A;  3CCV I;  3S1Q J;  3QOE A;  2HTS A;  2KIU A;  1R1V A;  1U0J A;  1PJR A;  3FBN B;  5TRD A;  4BYY A;  1YYV A;  2XPW A;  3AAF A;  1XMX A;  2JVG A;  2HPI A;  3V7S A;  4FTH A;  3WTV C;  5DS9 A;  3KET A;  4FIS A;  5E8G A;  4IQJ A;  5CVR A;  2DA5 A;  4HNV A;  4YIR X;  1H9T A;  4DYR A;  3BQZ A;  2P6T A;  5IP7 J;  1FBS A;  1W1W E;  4CYD A;  4EEF G;  2OF7 A;  2CQQ A;  3C2H A;  1O3R A;  3IWZ A;  1VQO I;  2QSF X;  3PNY A;  1R58 A;  3WGH A;  1ZAR A;  2X48 A;  2RGV A;  3DPL C;  3H36 A;  3LFU A;  1ON1 A;  2FU4 A;  5D5W B;  4F93 B;  4V2G A;  1QGP A;  2H8R A;  1BR4 A;  2M4K A;  5D8K B;  2ZJR F;  1Y0U A;  2R5Y A;  4JYK A;  2QZ8 A;  2HVS A;  2R3S A;  2GQQ A;  3KPH A;  2AQF A;  5LLQ A;  2PMU A;  3I53 A;  3HIF A;  2WAE A;  2YR2 A;  4MIM A;  4XRS G;  1SD6 A;  3SZP A;  2COM A;  4I7H A;  3IH2 A;  3R0A A;  4N4N B;  2LK2 A;  3DEW A;  5IYD J;  1KQ8 A;  3DBL B;  3FK6 A;  1LDJ A;  5ED4 A;  4RB2 C;  2QGU A;  1LDK B;  2N8G A;  4C2M J;  3F6O A;  1FMV A;  4O6J A;  3SFI A;  2EFW A;  1Y1W J;  5J1U A;  2KZV A;  1OMI A;  2QKM B;  2CYY A;  2VKD A;  4A3C J;  2P7C B;  1ZGJ A;  1PP8 F;  2CV0 A;  3OS1 A;  2XF7 A;  2WAQ N;  3ESW B;  4I09 A;  1SFK A;  1YQA A;  3JRG A;  2RAE A;  1GV2 A;  1R5H A;  5AIQ A;  3IH3 A;  2HXO A;  1VQ6 I;  2L9R A;  1O57 A;  1A6I A;  1XGS A;  4XLF A;  3JRE A;  2QQA A;  3WU2 C;  3DXJ F;  1FOW A;  5K1Y A;  4W97 A;  2P81 A;  5EDN A;  4EGZ A;  2EV5 A;  5E1W A;  1L0O C;  3MCZ A;  3HL2 A;  2ADU A;  2IP2 A;  2LY9 A;  2ECB A;  3P5J A;  2E2H J;  2HEO A;  3F8N A;  2ZXH A;  4LG0 B;  2MC3 A;  2MAB A;  3VYU B;  3BTL A;  2ESN A;  3FMQ A;  4UHT A;  3BC8 A;  2X0L A;  1R9T J;  2DMT A;  2LG4 A;  3BPV A;  3H9Q A;  4P9F A;  2O9L A;  2LFB A;  5GTI C;  3H3V K;  1HDP A;  1FYL A;  3GZ5 A;  2OQG A;  2BYV E;  2OAZ A;  1G2H A;  3L00 A;  3ULQ B;  1BL0 A;  1OLT A;  1FJL A;  3BG3 A;  2WB1 N;  2ZJP F;  1D1A A;  2P4W A;  2O6G E;  2DW4 A;  3QQA A;  1H89 C;  3HPH A;  2B7E A;  3NWT A;  3E6D A;  3HOW J;  1FEX A;  2Y30 A;  3MAJ A;  1XTA A;  5EZH A;  4OOI A;  5EYR A;  1S29 A;  4HOB A;  2VJJ A;  4BJ5 C;  4MEY F;  3A01 A;  3X2Q H;  2DPU A;  4N9H A;  4RGR A;  1WPK A;  2JQ7 A;  2QLZ A;  3T0Y A;  3OYI A;  4HQM A;  4XSZ F;  2M1B A;  4IHY A;  5HS9 A;  1K4T A;  4PZJ A;  4UVB A;  1P4A A;  2CV2 A;  5HLT A;  1R4M B;  4AU7 A;  3B6C A;  2UZK A;  4CCO A;  3C2G A;  3TDZ C;  1YO5 C;  2QKL B;  2MLK A;  3W2V A;  1HF0 A;  3RPQ A;  4QLC U;  1UMQ A;  1USS A;  3ABK H;  4XON A;  4A3B J;  4GCV A;  2MH2 A;  1O7L A;  3F22 A;  4XSX F;  1POG A;  2BVL A;  4LLG F;  5HVQ C;  1B59 A;  1MMN A;  2I8D A;  1O3T A;  4RAG A;  1D3Y A;  2E1N A;  3BTJ A;  3WTW C;  2R7F A;  1OKR A;  4ZTF A;  3FHZ A;  4OU0 A;  3S1M J;  4D7N A;  1BW5 A;  4HNT A;  2XSD C;  5DM6 F;  1DUX C;  4XKC A;  2BXZ A;  5JVT A;  2EJR A;  1WWX A;  4OAZ A;  2Q2E A;  4IPA A;  3J7Z I;  1QZE A;  2XAF A;  1FYM A;  4M9X A;  4A3M J;  1CGP A;  3T8R A;  4FAS D;  1ZLK A;  3HKZ N;  2H8W A;  2ZB9 A;  3EUA A;  2R0Q C;  1AU7 A;  5JLW A;  1BIB A;  5BNG A;  2DMP A;  4JX4 A;  3U1D A;  3OIP A;  4UVC A;  2HDD A;  1Y8Q B;  2A3S A;  1RRJ A;  2HQN A;  2JUC A;  2QF7 A;  4DW6 A;  1RC9 A;  2HDC A;  4WF2 A;  4RB1 A;  3A03 A;  3VYT B;  4CCL A;  2VOP A;  2KT0 A;  4XID A;  2M4G A;  4Z6Y A;  1W36 D;  4I98 B;  5D5U B;  1V5G A;  3ZRG A;  4EAT A;  4KIS A;  2MW8 A;  3FXO A;  5ERI A;  1LEB A;  3CC4 I;  3LSR A;  2KRH A;  4MFD A;  1D1B A;  2QCO A;  4PUS A;  3W6V A;  1ETW A;  4YII A;  2HYJ A;  4MTD A;  1MH3 A;  3BQY A;  4HEA 2;  4CCN A;  4F92 B;  1UHM A;  2LBF A;  3OYC A;  1WH7 A;  2Z2S B;  2VC0 A;  1REP C;  4CCM A;  4ESF A;  1FT9 A;  2W25 A;  4CCJ A;  3GME A;  4BAY A;  1DDN A;  2ZXJ A;  4U0V A;  1X2M A;  5DUK A;  1EJ9 A;  4BUP A;  1VQ4 I;  2DOA A;  4A3I J;  1IDY A;  4Y15 A;  3S2H J;  5E20 A;  4LJZ F;  2KDO A;  1E3P A;  4Y7N J;  2CFX A;  3T1B A;  2ICW G;  5ICE A;  1T56 A;  1WGX A;  4BAC A;  2F48 A;  2PFB A;  1S7A A;  5J4V A;  5E17 F;  3BR6 A;  4ETS A;  2O0Y A;  3JR9 A;  4UUV A;  1SC7 A;  3K2A A;  2JK3 A;  2HU9 A;  2LSO A;  1BOB A;  3HUG A;  4M6Y A;  3I56 I;  3CMA I;  2FBI A;  4P9U A;  2V7F A;  3HSR A;  2L01 A;  4NDL A;  1V4R A;  3TGN A;  3TOA A;  2JPB A;  1GVJ A;  4N4O B;  1D8J A;  1XD7 A;  4OAY A;  4RM2 A;  1GUU A;  2RKH A;  1GV5 A;  4LD5 A;  5F27 A;  4FX0 A;  1IO2 A;  5M5X J;  4QPO A;  2KZG A;  4DNC A;  2M5W A;  4PJ0 C;  3ZN1 A;  4LB6 B;  3HOU J;  1JXS A;  4G6Q A;  1WJ5 A;  1QBJ A;  1K61 A;  3GTL J;  2KHM A;  4ZYA A;  3G1M A;  3GFJ A;  3PUF A;  1W0T A;  4XL9 A;  4F55 A;  2ISY A;  4C2U A;  4HYE A;  4B8X A;  4L5I A;  3HRS A;  2HGC A;  3FIS A;  3G1L A;  2H1L A;  1DGW Y;  1XMK A;  1SFE A;  3TED A;  2FQ4 A;  3E6C C;  1JT6 A;  2Y75 A;  1QHH D;  2H6B A;  3LSI A;  4M3D A;  3KEY A;  4CXF A;  1HW5 A;  1LE8 A;  2FEZ A;  2KMU A;  1FYK A;  1GLN A;  1G3Y A;  5LHI A;  2OTJ I;  3D1N I;  4MGR A;  2WTE A;  4R8H A;  2F5F A;  2W57 A;  5BS6 A;  3ZR8 X;  4KDP A;  4YFX F;  4CUG A;  3SJM A;  4BS9 A;  3WTX C;  4J19 A;  3DPU A;  2WA0 A;  1Z21 A;  1S7O A;  3H35 A;  3CDI A;  3WTY C;  2O7O A;  3CES A;  5EG0 B;  3LWF A;  1K6O A;  4BDZ A;  1X1B A;  1W7P B;  1WRJ A;  5M3M J;  4X1E A;  1X58 A;  3TO9 A;  2PJP A;  4PDK A;  4B47 A;  4ITV A;  4ZC3 A;  3BG6 A;  4XN3 A;  3V8K A;  3AKZ A;  5IT3 A;  1SFU A;  4KMF A;  2UXN A;  1BR2 A;  1FNN A;  1KYW A;  2L9N A;  4LMY A;  5KNL A;  3CMY A;  2H1K A;  5CKT A;  3EYY A;  4M9S A;  4B1R A;  3HC7 A;  5K7H A;  1FSH A;  2HQA A;  5GPA A;  1Z7L A;  2BW3 B;  3J81 Z;  2FF4 A;  3K4J A;  2XSJ C;  1NG6 A;  3K1P A;  3ABL H;  3OWT A;  3AG2 H;  5FFX A;  3PQJ A;  3O2P E;  5BPD A;  5BQT A;  1HCR A;  1DU0 A;  2K5C A;  1DP3 A;  3LAP A;  3BCB A;  3H0D A;  1R6R A;  3OR1 C;  3CCS I;  2MLG A;  5DD8 A;  4IF4 A;  4ESJ A;  3V7R A;  4PFP A;  2FRH A;  3GCM A;  3FBI B;  3R60 A;  4AWX B;  3S14 J;  4L9V A;  1ZG3 A;  1CF7 B;  4JK1 X;  3CCQ I;  2DFH A;  1FIA A;  5GPC A;  3HRM A;  5HLI A;  4OIR F;  3S1N J;  1OCT C;  3W3C A;  1I6X A;  1YOV B;  5EZG A;  3HOX J;  2H27 A;  1BI0 A;  1V5E A;  5IT9 K;  5L3G A;  1YJ9 I;  2DFI A;  1KU2 A;  4BXX J;  2ZKZ A;  3BT9 A;  4RAZ A;  4L5J A;  3O8G A;  1VQ5 I;  1JUS A;  1YX3 A;  2QBY B;  4UB6 C;  1ZGA A;  3DLL F;  4A3J J;  2PMH A;  3G73 A;  1LFP A;  3GBG A;  3M07 A;  5DUI A;  3OYA A;  4MEX F;  2V6E A;  2OC6 A;  1SEU A;  3GFI A;  2OD5 A;  2LR8 A;  2DAO A;  2NOJ B;  2UUZ A;  5LHG A;  2HVQ A;  2ZXW H;  1GXQ A;  2IAI A;  5EF6 A;  2EZI A;  5KAI C;  4ZYH A;  5B1B H;  2LH9 A;  1LKX A;  3Q0U A;  3IC7 A;  2JZY A;  1DU6 A;  1MDM B;  2HYF A;  2FML A;  1FP1 D;  3BTC A;  1W5S A;  3FMS A;  3R61 A;  1DPR A;  5HNF A;  4G6D A;  1XPX A;  1K7A A;  1JI8 A;  2O5R A;  4RGX A;  3CZ6 A;  4LLN A;  1BBY A;  2TCT A;  3MKZ A;  1T0F C;  5ICC A;  4RGS A;  2FX0 A;  1VFC A;  1QZZ A;  2VON A;  2RC4 A;  3FXM A;  3K70 D;  1TW2 A;  2A61 A;  1I27 A;  4GO1 A;  1R4N B;  1KGS A;  1U5T B;  2LF8 A;  3MN2 A;  2LLK A;  5HOD A;  2ECC A;  2OA4 A;  1S72 I;  4NC8 A;  1TL8 A;  1W0U A;  3QP5 A;  3OOU A;  6PAX A;  1ZRD A;  4P5O A;  2LY1 A;  2XPU A;  2P5K A;  3D5S C;  3B73 A;  2W7N A;  1J09 A;  3T5X A;  3OY9 A;  5E18 F;  1ZEL A;  1RUN A;  4A3E J;  1ZG5 A;  4DQ2 A;  3HHH A;  4OMZ A;  3F3X A;  2FD5 A;  4Q47 A;  3P9K A;  3N97 A;  2EWN A;  2B63 J;  2VE8 A;  2A68 F;  4JP0 A;  2HR3 A;  2XAG A;  4YEL A;  3SXY A;  5FLX Z;  2MYS A;  3S16 J;  3WTS C;  3TBI A;  3JRI A;  3O6B B;  2KIQ A;  1DQU A;  4M73 A;  4A5N A;  5HLG A;  2CQX A;  4D5C A;  4EGY A;  1JKQ C;  2KIS A;  3F72 A;  2JRT A;  1XCB A;  2K40 A;  2E1C A;  3CCR I;  1J59 A;  3IHU A;  1UG2 A;  5M5W J;  4U7B A;  1TTY A;  2LY2 A;  2E34 A;  4LK1 F;  2IA1 A;  4OIP F;  2L4M A;  3GVA A;  5CPR B;  4LLL A;  1T98 A;  2HI3 A;  3L2W A;  2IJL A;  1OYW A;  3VFZ A;  3QYF A;  3G1O A;  5TIS C;  3BJ6 A;  4EJU A;  2LDU A;  4U0Y A;  1FTT A;  2VL8 A;  4W1U A;  3VEP A;  1QZY A;  1IJW C;  4A6D A;  3FX3 A;  3F8C A;  3OOP A;  5L3D A;  2GIZ A;  1FLI A;  1R49 A;  2K86 A;  3GTQ J;  2JA8 J;  4HLY A;  2LYC A;  1KYZ A;  2IS4 A;  4MLO A;  4J00 A;  1LFB A;  3FZV A;  3DFG A;  3QWL A;  4BBR J;  3KLO A;  1AHD P;  3H9G A;  2JJ7 A;  4Q4Z F;  4IHS A;  2E2I J;  5K5Q A;  4AVP A;  5LGU A;  2HVR A;  4IJA A;  1B8I B;  1IC8 A;  4L9N A;  5JHF A;  1APL C;  1DP7 P;  1P7I A;  2EB7 A;  5CYV A;  5KVR A;  3JTG A;  1U2W A;  3ISP A;  3A1Y A;  2COB A;  3FM3 A;  1SFO J;  2Y9Y A;  4A0X A;  5FRN A;  4NC7 A;  4CYC A;  2JWT A;  2QEX I;  2R7U A;  3ML6 A;  1YHQ I;  4YIF A;  3ZCO A;  1OCR H;  4PJN A;  4NHJ A;  4HZF A;  3LNQ A;  1YW9 A;  5K5R A;  1FZP B;  2LKS A;  1QU3 A;  2L0K A;  2W82 A;  1WFX A;  3QPL A;  2A6E F;  4Y17 A;  5LGT A;  1IRZ A;  4BJ6 C;  1ZAO A;  1PUF B;  3FDY A;  2HKX A;  4RAY A;  2ZFU A;  3ROU A;  4ZYG A;  1V55 H;  1VQ8 I;  2RV8 A;  3MZ8 A;  4II2 A;  3FXL A;  3AL0 C;  2RN7 A;  4ENJ A;  1VF9 A;  3V42 A;  1NK2 P;  2IBD A;  3TOB A;  1SVM A;  3BR5 A;  4KNY A;  4X6A J;  2MD5 A;  5D5X B;  1GVD A;  2MSY A;  3E0J B;  1ZQ3 P;  1TLH B;  3G6E I;  5IP6 A;  1K78 A;  1EA3 A;  2DA3 A;  3QAH A;  3F8B A;  4H4K C;  3KEO A;  1B6A A;  2E60 A;  2Z99 A;  2LF7 A;  5CVU A;  2X51 A;  4RBO A;  3TL4 X;  1SD5 A;  4EJW A;  2ZXI A;  2XF6 A;  2FSW A;  2W4S A;  1MMS A;  3UR3 C;  1PYV A;  3RKX A;  1Q1H A;  5LFA A;  3MFK A;  3TDU C;  2XPV A;  5D8L B;  1W5C C;  1Z05 A;  2L7F P;  1S5L C;  3KYD B;  2GXA A;  1ZN2 A;  2PMZ N;  2VOO A;  2ACJ A;  4IHV A;  3GW2 A;  3FKI J;  1Z91 A;  2DQL A;  3M8J A;  3IRQ A;  3D0S A;  3RZO J;  3LSH A;  3LQR A;  1MZB A;  4LOC A;  4BU2 A;  2CGP A;  2YU9 J;  4HNU A;  3QPH A;  3BR0 A;  1TWF J;  1I3A A;  2KLO A;  1KZH A;  4EM2 A;  5LEJ A;  1F4K A;  4KN7 X;  5LEK A;  2W84 A; 
#chains in the Genus database with same CATH homology
 1B9M A;  3CUQ A;  1IUY A;  1KQ0 A;  3F23 A;  5K5O A;  2QWW A;  4JBA A;  1ZRC A;  3RKW A;  3FF5 A;  1BIA A;  1FY7 A;  2P6S A;  4L18 B;  2DI3 A;  1LEA A;  3HTS B;  1J75 A;  5D4R A;  2F5D A;  3ZMZ A;  4S04 A;  3QU6 A;  3K9T A;  4EQQ A;  3GZ6 A;  2G7U A;  2G9W A;  2A69 F;  5BPI A;  4U88 A;  2ELH A;  4HV5 A;  5H6Q A;  1KU9 A;  2JSC A;  5ICF A;  1Z7U A;  2L54 A;  1Z6R A;  1IN8 A;  1ONV A;  2ZO4 A;  4MTE A;  2Z5U A;  2W24 A;  4BHB A;  2H6C A;  5EEG A;  3F21 A;  5AON A;  1T2K A;  1IXR C;  1XSX A;  3WTZ A;  3L2C A;  2JTV A;  4QWQ A;  3JW4 A;  2GA2 A;  2NAZ A;  4GYI A;  1YS6 A;  2FMY A;  3DEU A;  2V79 A;  3IKT A;  5LRR A;  1R36 A;  4CIC A;  4HQE A;  2DO7 A;  4TV7 A;  5A2Q K;  1HKS A;  3LA3 A;  2A07 F;  2BBY A;  2XAH A;  4WXH A;  3C7J A;  4RGU A;  1OR7 A;  1EH8 A;  3DPT A;  1IZ1 A;  3E97 A;  4BHC A;  1IRF A;  2CSO A;  2LKP A;  3TKY A;  4I02 A;  2K27 A;  3EUH A;  1WI9 A;  5FD5 A;  3CO6 C;  4EVI A;  2PQ8 A;  3MWM A;  3KEQ A;  3K69 A;  1SD4 A;  3RDI A;  2VC1 A;  2RVC A;  2HZT A;  1Z6T A;  3KP4 A;  1F1Z A;  3HSE A;  3ABU A;  3FWE A;  1YIO A;  2CO5 A;  4L0Z B;  4R79 A;  1OYY A;  3M1E A;  1OPC A;  3KP3 A;  2QQB A;  3BOQ A;  1LVA A;  4HW0 A;  3W6K B;  2ZNY A;  3PFI A;  5L3E A;  2VN2 A;  3F6V A;  4HDV A;  1QNT A;  1H0M A;  2QQ9 A;  2ZFW A;  1J0R A;  3FMR A;  2XV4 S;  3HOT A;  1EV7 A;  4HX7 A;  4KUM A;  3LQQ A;  3VOE A;  2PEX A;  1KA8 A;  4I0A A;  2IA2 A;  3ZMV A;  1FC3 A;  3TQN A;  4AD9 A;  2VT3 A;  5JI6 A;  4HV6 A;  3GYH X;  1YW7 A;  4EM1 A;  2O3F A;  3DQV C;  3KLN A;  3MQ0 A;  3CUO A;  3KP6 A;  3I59 A;  1R00 A;  3LST A;  4ENK A;  1HQC A;  4E70 A;  4IHT A;  5CLS A;  3V8L A;  3GLX A;  3HRU A;  5L3B A;  4PGH A;  3E5Q A;  1XGN A;  1R23 A;  3O3K A;  4WWC A;  2YX7 A;  3HOS A;  3MEX A;  1JGS A;  3RPU A;  2D1H A;  2MBF A;  4EMS A;  5D6F A;  1FPQ A;  4H0E A;  3GF2 A;  3MZH A;  3DF8 A;  1IXS B;  3BWG A;  2WC2 A;  3K1M A;  2GA1 A;  3RYP A;  1U3E M;  2OZU A;  4M71 A;  1SMT A;  3LAJ A;  4CHU A;  1BN5 A;  5J8C A;  2QYO A;  2P8T A;  1XN7 A;  1MJ9 A;  2HOE A;  2XRO A;  5ILU A;  3RI4 A;  1YS7 A;  2ZJ2 A;  1RNL A;  4GYG A;  4KN4 X;  3E6M A;  2GXB A;  4HA8 A;  4L9J A;  1B9N A;  3ZQ7 A;  2L4A A;  2FBH A;  3KZZ A;  1UST A;  3IRR A;  2VOD A;  3WOD F;  1HKQ A;  2Q8K A;  3RKY A;  3WE2 A;  4Q48 A;  2K4J A;  3QP6 A;  1G3S A;  4N9I A;  2HS5 A;  5TJJ A;  2Y48 A;  1E17 A;  3JAM K;  2RDP A;  3C1D A;  3PQK A;  4FHT A;  2HTJ A;  3C18 A;  3I64 A;  1SAX A;  2AXL A;  1I1G A;  1LJ9 A;  1F9N A;  2KRF A;  2K02 A;  4AIJ A;  3WE3 A;  3NRV A;  4O3M A;  2V1D A;  3IKV A;  5DEQ A;  3WTU C;  4OIQ F;  3IL2 A;  4HF0 A;  2YPR A;  4HDU A;  3BRO A;  3V4G A;  2BV6 A;  4M72 A;  4HF2 A;  4G7O F;  2X4H A;  1P2F A;  4UVA A;  2ZBK A;  1R5G A;  1H9G A;  3R4K A;  2IA0 A;  2HFH A;  4IRH A;  2VBX A;  1UB9 A;  2O61 A;  3CTA A;  4IRI A;  4WCG A;  4JQF A;  3BP8 A;  2FNA A;  1PDN C;  5F64 A;  5FFZ A;  1LDD A;  4HX8 A;  3OV8 A;  3REO A;  2QUF A;  2EV6 A;  4XLN F;  4LB5 A;  1PP7 U;  3LA7 A;  2XRN A;  2IRF G;  2M45 A;  4KMU X;  1RZ4 A;  2UXX A;  4EV0 A;  2QEN A;  3SQN A;  2ZME A;  1JHF A;  1P92 A;  2NYX A;  3WGG A;  1BOA A;  4NQW A;  5E1Z B;  2IW5 A;  4Z2Y A;  3P7N A;  4BHP A;  1G4D A;  1T6S A;  1KQ9 A;  2OQR A;  4Q5S F;  4GXO A;  4CGZ A;  1U8R A;  1IXC A;  2V9V A;  1MGT A;  2YSR A;  4MHG A;  2O03 A;  1EH7 A;  5L3C A;  4M74 A;  4KIF A;  2BEO A;  5E8I A;  4UV9 A;  3QU3 A;  3ZP5 A;  4M9Z A;  4YFN F;  3J80 K;  4CO8 A;  3KP2 A;  3U9G A;  1BI2 A;  1IAW A;  2O8X A;  4OIN F;  2NNN A;  1MD0 A;  2YU3 A;  1R1T A;  1F5T A;  2V1X A;  3J81 K;  5CJ9 A;  3SFZ A;  5JHU A;  2VT2 A;  5FO5 A;  1K79 A;  1ZH5 A;  2J5P A;  5FD6 A;  3K1N A;  4FT8 A;  4KYW A;  4ON0 A;  3EET A;  2M8E A;  3GXO A;  3H3Z A;  4G8X A;  4EM0 B;  1HBX G;  2DLL A;  3WGI A;  3I58 A;  1B4A A;  1QPM A;  4EJT A;  4Y13 A;  4ENM A;  3CUQ C;  5J6X A;  3T8T A;  2OBP A;  4EJV A;  4L9T A;  2NNY A;  3F8M A;  1TNT A;  2TDX A;  2Y0M A;  2EFN A;  3KZY A;  3ZN0 A;  1HST A;  4RS8 A;  5DDG A;  1J2X A;  2KKO A;  1BI1 A;  2CQK A;  2VE9 A;  3GX4 X;  2HYG D;  1TBX A;  2JPC A;  2AS5 F;  1JHH A;  3TO7 A;  3RYR A;  2F5E A;  2DTR A;  4IXA A;  1ZYR F;  2F2E A;  1RI7 A;  5FB2 A;  1BI3 A;  3HSF A;  4LG0 A;  4HBL A;  2DK5 A;  4K2E A;  5DV5 A;  3M8E A;  2IVM A;  5F6F A;  3W6J B;  1YW8 A;  2KIM A;  3I4P A;  1ZLJ A;  2WV0 A;  2H94 A;  2HKO A;  3K0L A;  3F8F A;  2DBB A;  2KJC A;  4I01 A;  1AOY A;  1UCR A;  2XIG A;  3CDH A;  3P9C A;  3RTR A;  5DD4 A;  5FLX K;  1IW7 F;  3L9F A;  4M6X A;  3EDP A;  1E2X A;  1TQI A;  4KIC A;  4A2U A;  2ETH A;  4IRG A;  4OIO F;  4ENN A;  1VTN C;  4A5M A;  1ODD A;  2FBK A;  3H92 A;  5HOO A;  1K78 B;  5D4S A;  3V7C A;  1RIO H;  1MJA A;  2EA2 A;  1HW2 A;  2QVO A;  1ZRE A;  1TQP A;  2H09 A;  4ASN A;  5BMZ A;  2ZCW A;  1U78 A;  1YTY A;  2Q0O A;  5CVI A;  4O5V A;  2PLY A;  1YFH A;  1R1U A;  2A6H F;  3C3W A;  2PG4 A;  3HYI A;  2FNP A;  1BC7 C;  2FA5 A;  1HSJ A;  2VBZ A;  1BC8 C;  2C6Y A;  4AIH A;  1LB2 A;  1LNW A;  3CUQ B;  4L0Y B;  2RNJ A;  1T38 A;  2XKP A;  1LQ1 A;  1FP2 A;  3HTU A;  5E1X A;  5F1R A;  1P4X A;  1V3F A;  2PI0 A;  1MKM A;  4HAM A;  1P6R A;  3R6S A;  1WQ2 A;  1D8K A;  4ZYE A;  2HWV A;  4BNC A;  1O7F A;  4RB0 A;  4LGW A;  3CO7 C;  4KFC A;  1BJA A;  2EFO A;  5DYM A;  2ESH A;  2K4B A;  1YG2 A;  2WWY A;  3EQL F;  1XSD A;  2ISZ A;  1D5V A;  4U7D A;  2PBI A;  2XAQ A;  3G3Z A;  5KK1 A;  1ZHF A;  5LGN A;  3JAM Z;  1STZ A;  2VBW A;  3DV8 A;  3COA C;  4D0P A;  4G9Y A;  1IRG A;  3QRF F;  2LNB A;  4I2O A;  2A5Y B;  1HW1 A;  1PUE E;  3WG9 A;  5IT9 Z;  1J5Y A;  4A0Z A;  1JE8 A;  1IN6 A;  4KIG A;  1S3J A;  4ZH4 F;  3JSP A;  1GHC A;  3I54 A;  3RIR A;  4FX4 A;  3N4M A;  3ZMD A;  4ZZD A;  4BH9 A;  2M30 A;  2KIF A;  2E7X A;  2KJB A;  5LRS A;  1W7P A;  2V6C A;  3Q9S A;  3KFW X;  1ZRF A;  2NRA C;  1W4M A;  5DCM A;  3JSO A;  3KCC A;  4KIB A;  3KP5 A;  3E6B A;  2L02 A;  1KU7 A;  5HDG A;  4F7Z A;  1SFX A;  1QO0 D;  2E7W A;  3I71 A;  3P9I A;  2DK8 A;  3ZMT A;  3BY6 A;  4IVN A;  2DPD A;  4GGG A;  4YFK F;  1UHW A;  1Z1D A;  3WTT C;  2VBY A;  1CF7 A;  2L3D A;  1R7J A;  1TNS A;  3S2W A;  1HXD A;  1XDU A;  3QPT A;  2EK5 A;  2STT A;  1WKM A;  5ICG A;  1XDS A;  1U5T C;  3ZMU A;  4A6E A;  2B0L A;  2QBY A;  4MQV A;  2GAU A;  5LBQ A;  1J9I A;  4P96 A;  1TW3 A;  4A12 A;  4G7Z F;  1FSE A;  3CLO A;  1NHA A;  1IN7 A;  3GO5 A;  1Z9C A;  3BZ6 A;  3I59 B;  2HQR A;  3FM5 A;  3GFM A;  4PGG A;  1MDM A;  3JTH A;  3NEU A;  5J8F A;  3FXU A;  4MNU A;  5HLH A;  3H3U A;  2DT5 A;  4ZYD A;  1RUO A;  3J80 Z;  1MJB A;  5H20 A;  2P5L C;  4HLX A;  1ON2 A;  2VXZ A;  2FXA A;  1IF1 A;  3IWF A;  1YLF A;  3SHF A;  4U0W A;  3HRT A;  1WSU A;  5DCM B;  1U5T A;  3L09 A;  3R0J A;  1KU3 A;  4WX9 A;  4UNO A;  1R22 A;  1P4W A;  5LHH A;  2PN6 A;  4HX4 A;  3BDD A;  1S6L A;  5HS7 A;  2EA4 A;  2OU2 A;  2MA3 A;  1XMA A;  2D2W A;  1XSV A;  4G7H F;  3E5X A;  5HS8 A;  2QM3 A;  4UXN A;  2FQ3 A;  5BOX A;  2F5C A;  1XGM A;  3GEZ A;  5EEH A;  5H6R A;  4G94 A;  4CDG A;  3MZY A;  2JT1 A;  1TQM A;  2GXG A;  4UV8 A;  1FOK A;  4NB5 A;  2DU9 A;  1XCV A;  5JFR A;  1FBQ A;  4EJO A;  2DQR A;  1W5T A;  3GUD A;  3WU0 A;  3J7A O;  1FBU A;  2CG4 A;  4CZZ A;  1O3S A;  1O3Q A;  1IN5 A;  2P7V B;  2MH9 A;  2RQP A;  3B02 A;  3DKW A;  3M8F A;  2XKO A;  3E3V A;  1OYI A;  1FWZ A;  2STW A;  1XGO A;  2GIV A;  3VB2 A;  1ULY A;  4RB3 C;  5ILS A;  2EFQ A;  2K7L A;  3V8J A;  1GXP A;  4KA4 A;  3HHG A;  3EYI A;  4KT5 C;  5L3F A;  1HKT A;  4LFU A;  1B1B A;  2G7H A;  3LA2 A;  3Q5F A;  2XGX A;  4B09 A;  2EFP A;  4S05 A;  2FOK A;  3E5U A;  2UWM A;  4LK0 F;  4OMY A;  3D5L A;  4BXU A;  4XRF A;  4YG2 F;  3GWZ A;  1AWC A;  4AIK A;  1T0F A;  4ESB A;  4N0B A;  3ELK A;  4ZZL A;  2CW0 F;  1ZG1 A;  4A0Y A;  1G3T A;  3ZPL A;  1J7K A;  5DCF A;  2XAS A;  2CWE A;  2XUB A;  1FX7 A;  2J5O A;  4MQ9 F;  3CJN A;  1S8N A;  3WU1 B;  3BJA A;  4XLP F;  3L7W A;  1SD7 A;  2BE5 F;  2FE3 A;  2XAJ A;  5A2Q Z;  2D45 A;  5AIP A;  1U6G A;  3ABT A;  2Z3Y A;  4P55 A;  2M87 A;  2XHK A;  1G3W A;  5HDN A;  4WXC A;  2YX4 A;  5ILV A;  1DPU A;  5JR3 A;  1EH6 A;  1UFM A;  2OZ6 A;  2Z33 A;  2ZME B;  4BQA A;  3BJO A;  3ERE D;  3RJP A;  3M7G A;  2IPQ X;  1C0W A;  1QQI A;  5CVJ A;  3FXR A;  1X3U A;  3I5U A;  4I0B A;  2P5V A;  4HF1 A;  2W85 A;  1L3L A;  2IT0 A;  1XB4 A;  4XBF A;  2NS0 A;  1T39 A;  5CVV A;  3BPX A;  3GFL A;  2GZW A;  1W7P D;  2XVC A;  4PCQ A;  1IN4 A;  3TO6 A;  2R7D A;  3FXQ A;  2ZNZ A;  3U2R A;  2V1U A;  3ECH A;  3VOD A;  3NQO A;  3K2Z A;  5FGM A;  5D6E A;  3KE2 A;  4WXD A;  3ZMS A;  1G6N A;  2BGC A;  5D5V B;  3ECO A;  4WK8 F;  1I1S A;  3SZT A;  3KP7 A;  2EV0 A;  5HDK A;  3QOP A;  3Q9V A;  3M9A A;  1I5Z A;  3LFK A;  1SMY F;  2GWR A;  3DP7 A;  1A04 A;  1BM9 A;  2D1V A;  2Z9O A;  3I0T A;  4R1H A;  2HTS A;  2KIU A;  1R1V A;  5TRD A;  4BYY A;  1YYV A;  3AAF A;  3V7S A;  3WTV C;  3KET A;  5E8G A;  5CVR A;  1H9T A;  2P6T A;  1FBS A;  4CYD A;  1O3R A;  3IWZ A;  1R58 A;  3WGH A;  1ZAR A;  2RGV A;  3DPL C;  1ON1 A;  2FU4 A;  5D5W B;  1QGP A;  5D8K B;  1Y0U A;  2QZ8 A;  2R3S A;  2GQQ A;  5LLQ A;  2PMU A;  3I53 A;  3HIF A;  2YR2 A;  1SD6 A;  3SZP A;  2COM A;  4I7H A;  3R0A A;  1KQ8 A;  1LDJ A;  5ED4 A;  4RB2 C;  1LDK B;  3F6O A;  4O6J A;  2EFW A;  1OMI A;  2CYY A;  2P7C B;  1ZGJ A;  1PP8 F;  4I09 A;  1YQA A;  1R5H A;  5AIQ A;  1O57 A;  1XGS A;  2QQA A;  3DXJ F;  5K1Y A;  4EGZ A;  2EV5 A;  5E1W A;  1L0O C;  3MCZ A;  2ADU A;  2IP2 A;  2HEO A;  3F8N A;  4LG0 B;  2MC3 A;  2ESN A;  3FMQ A;  4UHT A;  2X0L A;  3BPV A;  4P9F A;  1FYL A;  3GZ5 A;  2OQG A;  2BYV E;  2OAZ A;  3L00 A;  3ULQ B;  2P4W A;  2O6G E;  2DW4 A;  3E6D A;  3MAJ A;  4OOI A;  1S29 A;  4HOB A;  4MEY F;  2DPU A;  4N9H A;  4RGR A;  2QLZ A;  3T0Y A;  4HQM A;  4XSZ F;  2M1B A;  5HS9 A;  4PZJ A;  4UVB A;  1P4A A;  2UZK A;  3TDZ C;  1YO5 C;  2MLK A;  3RPQ A;  4QLC U;  1USS A;  4GCV A;  2MH2 A;  3F22 A;  1O7L A;  4XSX F;  4LLG F;  5HVQ C;  1B59 A;  1O3T A;  1D3Y A;  2E1N A;  3WTW C;  2R7F A;  1OKR A;  3FHZ A;  4OU0 A;  1DUX C;  5JVT A;  2EJR A;  1WWX A;  2Q2E A;  4IPA A;  2XAF A;  1FYM A;  4M9X A;  1CGP A;  1ZLK A;  3T8R A;  1BIB A;  3U1D A;  4UVC A;  2A3S A;  2HQN A;  2HDC A;  4WF2 A;  4RB1 A;  2VOP A;  4I98 B;  5D5U B;  5ERI A;  1LEB A;  4YII A;  4MTD A;  1UHM A;  2VC0 A;  1REP C;  4ESF A;  1FT9 A;  2W25 A;  4BAY A;  1DDN A;  2ZXJ A;  4U0V A;  5DUK A;  4Y15 A;  5E20 A;  4LJZ F;  2CFX A;  3T1B A;  5ICE A;  2PFB A;  1S7A A;  5E17 F;  4ETS A;  2O0Y A;  4UUV A;  2LSO A;  3HUG A;  4M6Y A;  2FBI A;  4P9U A;  3HSR A;  2L01 A;  1V4R A;  3TGN A;  3TOA A;  2JPB A;  1GVJ A;  1D8J A;  1XD7 A;  2RKH A;  4LD5 A;  4FX0 A;  4DNC A;  2M5W A;  3ZN1 A;  4LB6 B;  1JXS A;  4G6Q A;  1QBJ A;  3GFJ A;  2ISY A;  4HYE A;  4B8X A;  4L5I A;  3HRS A;  2HGC A;  1XMK A;  1SFE A;  3E6C C;  2Y75 A;  2H6B A;  4CXF A;  1HW5 A;  2FEZ A;  1FYK A;  1G3Y A;  5LHI A;  4MGR A;  2WTE A;  4R8H A;  2F5F A;  2W57 A;  5BS6 A;  4KDP A;  4YFX F;  3WTX C;  1S7O A;  3WTY C;  3LWF A;  1K6O A;  1W7P B;  1WRJ A;  2PJP A;  3TO9 A;  4PDK A;  3V8K A;  5IT3 A;  1SFU A;  4KMF A;  2UXN A;  4LMY A;  1FNN A;  1KYW A;  3EYY A;  4M9S A;  1FSH A;  3J81 Z;  2FF4 A;  3K1P A;  5FFX A;  3PQJ A;  3O2P E;  5BPD A;  5BQT A;  3LAP A;  2MLG A;  5DD8 A;  4IF4 A;  4ESJ A;  3V7R A;  2FRH A;  3R60 A;  4AWX B;  4L9V A;  1ZG3 A;  1CF7 B;  4JK1 X;  3HRM A;  5HLI A;  4OIR F;  1I6X A;  2H27 A;  1BI0 A;  5IT9 K;  5L3G A;  2DFI A;  1KU2 A;  2ZKZ A;  4RAZ A;  4L5J A;  2QBY B;  1ZGA A;  2PMH A;  3G73 A;  5DUI A;  4MEX F;  3GFI A;  2OD5 A;  2DAO A;  5LHG A;  1GXQ A;  4ZYH A;  3IC7 A;  2JZY A;  1MDM B;  2HYF A;  2FML A;  1FP1 D;  1W5S A;  3FMS A;  3R61 A;  1DPR A;  4G6D A;  1K7A A;  4RGX A;  4LLN A;  1BBY A;  5ICC A;  4RGS A;  1QZZ A;  2VON A;  2RC4 A;  1TW2 A;  2A61 A;  1I27 A;  4GO1 A;  1U5T B;  1KGS A;  2LF8 A;  2OA4 A;  3QP5 A;  6PAX A;  1ZRD A;  4P5O A;  2P5K A;  3B73 A;  3T5X A;  5E18 F;  1RUN A;  1ZG5 A;  4DQ2 A;  3HHH A;  4OMZ A;  3F3X A;  4Q47 A;  3P9K A;  3N97 A;  2EWN A;  2VE8 A;  2A68 F;  2HR3 A;  2XAG A;  3SXY A;  5FLX Z;  3WTS C;  3O6B B;  4M73 A;  4A5N A;  5HLG A;  4EGY A;  3F72 A;  2JRT A;  1XCB A;  2E1C A;  1J59 A;  3IHU A;  4U7B A;  1TTY A;  4LK1 F;  2IA1 A;  4OIP F;  2L4M A;  3GVA A;  4LLL A;  1T98 A;  2IJL A;  1OYW A;  3VFZ A;  4EJU A;  4U0Y A;  3BJ6 A;  2LDU A;  3VEP A;  1QZY A;  4A6D A;  3FX3 A;  3F8C A;  3OOP A;  5L3D A;  1FLI A;  2K86 A;  4HLY A;  1KYZ A;  3FZV A;  3DFG A;  3KLO A;  4Q4Z F;  4IHS A;  5K5Q A;  4AVP A;  5LGU A;  4IJA A;  4L9N A;  1DP7 P;  2EB7 A;  5CYV A;  5KVR A;  3JTG A;  1U2W A;  3ISP A;  3FM3 A;  4A0X A;  3ML6 A;  4YIF A;  4NHJ A;  4HZF A;  1YW9 A;  5K5R A;  1FZP B;  2A6E F;  4Y17 A;  5LGT A;  1ZAO A;  2HKX A;  4RAY A;  3ROU A;  4ZYG A;  2RV8 A;  2RN7 A;  4ENJ A;  3TOB A;  4KNY A;  2MD5 A;  5D5X B;  1TLH B;  1K78 A;  3QAH A;  3F8B A;  3KEO A;  1B6A A;  2Z99 A;  2LF7 A;  5CVU A;  1SD5 A;  4EJW A;  2FSW A;  3RKX A;  1Q1H A;  3MFK A;  3TDU C;  5D8L B;  1Z05 A;  1ZN2 A;  2VOO A;  2ACJ A;  3GW2 A;  1Z91 A;  2DQL A;  3IRQ A;  3D0S A;  3LQR A;  1MZB A;  2CGP A;  3QPH A;  5LEJ A;  4EM2 A;  1F4K A;  4KN7 X;  5LEK A;  2W84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...