2M87A

Structural basis of dna recognition by the effector domain of klebsiella pneumoniae pmra
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
103
structure length
103
Chain Sequence
NQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSWDNEPATNTLEVHIHNLREKIGKSRIRTVRGFGYMLANNIDTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and tandem DNA recognition of the C-terminal effector domain of PmrA from Klebsiella pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Signaling protein
molecule keywords Transcriptional regulatory protein basR/pmrA
total genus 17
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m87A00
3C1DA 3J81K 2ZBKA 1QPMA 4E70A 3H3UA 1TQMA 3QOPA 4KIBA 2V1XA 1JXSA 1J59A 1YO5C 3KETA 2ZKZA 4UUVA 3R60A 2NNNA 3IHUA 3NEUA 1KA8A 1F1ZA 5HS9A 5LHGA 2EA2A 1WSUA 2EK5A 3J81Z 1T6SA 3BJ6A 2PEXA 4WX9A 2J5OA 1UHWA 4YFXF 4ZZLA 3TDUC 3J80Z 2QBYB 1F4KA 2VXZA 4ZYGA 4EM1A 1ON1A 1I5ZA 3MAJA 2ESNA 4G7ZF 2O61A 1BN5A 3V8LA 3F8BA 1T98A 2MA3A 1IN7A 2DT5A 2FBKA 1LDKB 2L01A 5E1WA 1AOYA 4FT8A 1DP7P 1B9NA 2OQGA 3RPUA 4EJWA 3GEZA 1SD6A 5HLGA 3WTYC 2LF8A 2ZMEA 5CVIA 3EYIA 1RZ4A 2EFPA 3ELKA 4UXNA 3BP8A 1SD4A 4D0PA 2ZMEB 2QQBA 4G6QA 5J8FA 3RYRA 2W25A 2Q0OA 3F8NA 3K9TA 1P4WA 4MEYF 3BY6A 1MKMA 4WWCA 3LQQA 3QU6A 3HOTA 1XMAA 1LQ1A 5HDNA 1XDSA 1FY7A 2XAFA 4S05A 1BBYA 1KYWA 3O2PE 1U78A 4ZZDA 2YSRA 3TQNA 1FLIA 3F23A 2W24A 1UCRA 1Z9CA 4I0AA 3QPTA 4HLYA 2F5CA 3HOSA 4GXOA 1KGSA 2RV8A 3R4KA 4CZZA 2O6GE 2HOEA 2HR3A 3JSOA 4RGSA 4KIFA 2K86A 3GFLA 1JE8A 1MZBA 1K6OA 1SD5A 2RKHA 5FB2A 1XGOA 2VBYA 3GLXA 3IRRA 5JHUA 1R36A 2IA1A 3HTUA 5LRSA 2JSCA 2K27A 3P9IA 2MC3A 3I54A 2X4HA 2QBYA 2OU2A 2DBBA 1FBSA 5L3GA 4U0YA 5HLIA 2R7FA 5BPIA 1SAXA 1A04A 2ELHA 4XLNF 4RGRA 4U0WA 4RGXA 1IUYA 1IXRC 3CUQA 3GXOA 2ZNZA 2JZYA 1IW7F 1QZYA 4EM0B 3CUQC 4MHGA 4HF2A 2P8TA 3QPHA 3VFZA 3M1EA 4HA8A 2E7XA 2R7DA 4UVAA 4KA4A 1G3TA 1T2KA 1HKSA 2XASA 2LNBA 5BMZA 1FYKA 1FC3A 3HRMA 2DK5A 2L4MA 1S29A 4RB3C 3EDPA 3ABUA 1XN7A 1ZG3A 2M5WA 1U3EM 5D4RA 3REOA 4KIGA 5LHHA 1DDNA 4UNOA 3RKYA 2FA5A 1U5TA 2BYVE 3WU1B 2G7HA 3GW2A 4A5MA 1XSXA 3H92A 4YIIA 1ZYRF 3LFKA 3ZPLA 1VTNC 2L54A 1S3JA 3V7SA 4FX0A 2L4AA 1FSHA 1QQIA 1ZREA 4EJOA 3P9KA 2M30A 2GXGA 3BDDA 1Z6TA 1TTYA 2PQ8A 1XSVA 1O3QA 1IXSB 1IAWA 2GIVA 3QP6A 2RVCA 2YX4A 5KVRA 4KDPA 3T1BA 3JW4A 3P9CA 1O7LA 5ICCA 3ZQ7A 3ZN1A 4JQFA 5JVTA 1RUOA 1R7JA 4ESJA 1BI1A 4KMUX 3R6SA 1KQ9A 3D0SA 4YIFA 1O3SA 1R5HA 2O8XA 3Q9SA 3GVAA 4O5VA 2EFWA 1UB9A 4TV7A 1IN4A 2ZJ2A 5LGTA 1W5TA 3HIFA 5IT9K 4UVCA 3FXQA 4HX8A 1B6AA 2IJLA 2A69F 3LA3A 1YW8A 5DUKA 1R00A 2K7LA 3DP7A 2E1NA 1Q1HA 4XSXF 4U88A 3R0JA 2RQPA 4MTEA 3DFGA 5LLQA 5JFRA 3CO7C 3DPTA 3E3VA 4U7DA 3BOQA 3S2WA 2IRFG 4PGGA 1OYIA 2CG4A 1R1UA 2LF7A 5EEGA 3WODF 3TGNA 1B59A 2FMLA 2HKXA 3LAPA 5HDGA 4IPAA 5FLXZ 2QENA 2QWWA 3QRFF 4OINF 1JGSA 5E17F 1GXQA 5ERIA 1PDNC 2A6EF 3C7JA 1WI9A 1XDUA 3WGIA 3GO5A 4OMYA 4L5IA 2ZO4A 4WXCA 5DCMA 5D5UB 2V9VA 1XMKA 2XGXA 5D5XB 4L18B 1LB2A 3IL2A 1OKRA 1KQ0A 1LEAA 3I53A 4IRHA 3SHFA 5AONA 2PBIA 3TO7A 3WTZA 1S7OA 1PP7U 3I4PA 4P9FA 3OV8A 2Z99A 4ZH4F 4A2UA 3FZVA 2EA4A 3C18A 3ISPA 5DV5A 1USTA 2H6BA 1KYZA 3J80K 5CYVA 1W7PD 4CICA 1BC7C 3MFKA 4IXAA 2YR2A 2P4WA 4MGRA 1WRJA 3FWEA 4A6DA 4L9TA 4BAYA 4R79A 4HDVA 1FZPB 3RDIA 3Q5FA 2CFXA 4JBAA 4RB1A 3FMSA 1S6LA 4LK1F 3HTSB 2CSOA 2BE5F 1XD7A 3LA7A 1OR7A 2H94A 3HRSA 4BNCA 5D6EA 3LAJA 1WKMA 1PUEE 2GQQA 1PP8F 2ZNYA 4BHPA 3FMRA 2XUBA 4QLCU 2IPQX 1FYMA 4I2OA 2XHKA 1YTYA 3CJNA 1GXPA 2PFBA 2EV6A 3F3XA 5L3BA 4DNCA 2CQKA 4KUMA 3ECOA 2FNPA 2M8EA 2XKOA 4M73A 1CGPA 4CYDA 2GWRA 4HAMA 3NRVA 1JHHA 4CGZA 4G8XA 2OQRA 2D45A 5D8KB 2WC2A 5CVVA 1FP1D 2CWEA 5F64A 3LWFA 2HYFA 5FD6A 3DPLC 5DCFA 5LEJA 2EB7A 2UXXA 3I0TA 2CYYA 3V8JA 1WQ2A 2VC1A 4ESFA 2X0LA 2RNJA 5E1XA 2AS5F 1YQAA 3M8FA 1XGNA 2COMA 2PMHA 4G9YA 4XLPF 4KN4X 4S04A 2FNAA 4XRFA 3O3KA 2DQRA 5CVJA 4ZYEA 1JHFA 5BS6A 2P7VB 3G3ZA 2EJRA 4LMYA 3VOEA 4M9XA 1IN5A 1J9IA 1D5VA 1KQ8A 4EV0A 2MH9A 4G7OF 4IRGA 1TNSA 3F8FA 3HHHA 3F6VA 4Y13A 3PQJA 4LGWA 2HKOA 3HSEA 1IRFA 1X3UA 3Q9VA 3GWZA 5BPDA 1D8KA 1P4XA 5HS7A 3KEOA 3B02A 4AIHA 1KU3A 2QVOA 4KFCA 3U1DA 2HZTA 3TDZC 2RDPA 2PMUA 3M7GA 2XAHA 1C0WA 1TLHB 4EJUA 5J8CA 4EVIA 2HYGD 4LD5A 4CDGA 3F8MA 3R0AA 3DF8A 3FMQA 4L9JA 3IKTA 1QO0D 1FSEA 4PDKA 1YW9A 1Z1DA 5ILVA 4I01A 5D5WB 3LSTA 2C6YA 2VOPA 1L0OC 4WXHA 1R5GA 3VODA 4HF1A 3W6JB 1NHAA 2V79A 2XROA 1K7AA 4HDUA 5L3CA 1BC8C 2Y0MA 3HRTA 4EMSA 2ISZA 2GZWA 2OD5A 2TDXA 4A6EA 5D4SA 2O3FA 2A5YB 1UFMA 4MQ9F 4OIQF 4WXDA 2ISYA 3V8KA 1U5TB 1BJAA 4GO1A 1BI3A 3L9FA 2NS0A 4HQMA 1WWXA 3WE3A 2A68F 4AIJA 1HBXG 3MZYA 1ZLKA 2QM3A 1ZH5A 4M6YA 5F1RA 5K1YA 5TJJA 2HQNA 5HS8A 1ZARA 2DU9A 2KRFA 2FRHA 2NRAC 3U9GA 4ZYDA 2XAQA 4Z2YA 5H6RA 5A2QK 2OAZA 1O57A 3V7CA 2A6HF 3KP2A 3KEQA 3HSFA 4N0BA 3VB2A 3CUQB 4HZFA 2DAOA 2VN2A 5L3DA 3KP4A 2DW4A 4H0EA 1E2XA 1ZRFA 3I59A 2NAZA 3BZ6A 4IHSA 2XIGA 3IWFA 3L7WA 2Q8KA 1EV7A 3CO6C 4HOBA 3I71A 4KICA 4HV5A 4LG0B 4LLGF 1U5TC 1ZRCA 2PN6A 3I59B 3BROA 3DV8A 4HV6A 4A0XA 1B1BA 1TNTA 3ZP5A 1DPUA 1OPCA 4Q47A 1MD0A 2ADUA 3V7RA 3ERED 2KIFA 3JTGA 1RI7A 1DPRA 4A0YA 5DDGA 3L00A 3IWZA 3TKYA 2RC4A 3WGHA 2MH2A 1BIBA 3CLOA 5DD8A 3ZMTA 1U6GA 4XSZF 1G4DA 2M45A 4RB0A 2P7CB 1J5YA 2IA2A 3L2CA 2FSWA 4OIPF 3ROUA 2DI3A 3PQKA 2D1HA 3TOBA 1SMTA 3K0LA 4P96A 2CGPA 3DKWA 1T0FA 3TO9A 2DLLA 4RAYA 3PFIA 2FF4A 5CLSA 3BPXA 3ZN0A 1R58A 3CTAA 2IA0A 3MCZA 3SFZA 1W4MA 2F2EA 3N4MA 3BWGA 4O3MA 2DPDA 5LBQA 5IT9Z 3K2ZA 4IF4A 4KN7X 3HHGA 4MNUA 2BV6A 3M8EA 5FFXA 2L3DA 1EH8A 1TQIA 3CDHA 1QZZA 3GUDA 1V4RA 4HYEA 2VE8A 2KJBA 1B9MA 4Y17A 1I1GA 5DYMA 4L9NA 3JAMZ 1LJ9A 3G73A 2ACJA 3KE2A 2K4BA 2XRNA 2FE3A 2Y75A 3RYPA 4L0YB 1R1VA 4U7BA 3CUOA 1YS7A 4R8HA 1GVJA 2Y48A 1YYVA 2NNYA 4B8XA 1HKQA 1LDDA 3F6OA 4P9UA 1HW2A 2HGCA 3W6KB 1ZGJA 4YFNF 1UHMA 2IVMA 2XKPA 2PJPA 4M72A 2PLYA 3EYYA 3TO6A 2Z33A 4LK0F 5K5QA 1GHCA 3EQLF 1F9NA 1G3YA 3E6MA 1J0RA 4BH9A 4EGZA 3FHZA 3ZMZA 3DQVC 1T38A 1XCBA 3RTRA 1ULYA 6PAXA 5E8GA 2JPBA 5HDKA 3WE2A 3E5UA 1BOAA 1QGPA 3KLOA 5D8LB 4ESBA 1IN6A 4LB5A 1J2XA 1Z7UA 1BM9A 2WWYA 1W7PB 4IRIA 2YPRA 2MD5A 1KU9A 3KP5A 4AVPA 5LGUA 3KZYA 1STZA 3VEPA 4ASNA 3GFJA 1TQPA 2WV0A 2Z9OA 2FXAA 4PZJA 4CO8A 3KZZA 1YG2A 4I02A 4U0VA 2LSOA 2CO5A 3MEXA 3KFWX 1SFEA 4UV9A 4N9IA 3FM3A 4ENNA 2XAGA 2QQ9A 2FEZA 2OBPA 3WTSC 3RI4A 1LEBA 3U2RA 3OOPA 1F5TA 1H0MA 4LG0A 1P2FA 3ML6A 2F5EA 2HWVA 2DK8A 1R1TA 2HEOA 3FXUA 2H09A 1FYLA 1CF7B 4ON0A 3DXJF 2HTJA 4ENKA 3KP6A 4ENMA 2HQRA 3ZMSA 3B73A 4Y15A 2P5VA 1BI0A 5E1ZB 3IRQA 4XBFA 5L3EA 1IXCA 1V3FA 2P5KA 4KT5C 3IC7A 4HW0A 3WU0A 3K1MA 3E6CC 4A12A 2KKOA 2QYOA 2YX7A 2LKPA 4M6XA 5H20A 1RIOH 2EFNA 2Z3YA 5JI6A 2KJCA 2BGCA 3F21A 2HDCA 3F22A 1P4AA 2GA1A 2OZ6A 2VBXA 3AAFA 1E17A 5LEKA 1FOKA 2DPUA 5EEHA 5D5VB 4OOIA 4EJTA 4AWXB 4F7ZA 2BBYA 3JAMK 2GA2A 2M87A 1ZN2A 5DCMB 4NB5A 5LHIA 5CVUA 2HFHA 2O0YA 3KP3A 2P5LC 1KU7A 1SMYF 3GZ5A 2ETHA 3T5XA 5LGNA 2VT2A 3ABTA 4GGGA 1HW1A 3SZTA 4KNYA 1L3LA 4AIKA 2PI0A 5FO5A 4ETSA 3NQOA 1Z91A 1U8RA 4IHTA 2K02A 4L9VA 1RUNA 2VT3A 3SQNA 2P6TA 4NQWA 5ILSA 4WCGA 4A0ZA 3RPQA 3JTHA 1R23A 2G9WA 1ONVA 2K4JA 2ESHA 2CW0F 3GX4X 5ED4A 2A3SA 3T8RA 3J7AO 1MJBA 2MLGA 2XAJA 2R3SA 3FXRA 4EQQA 4BHBA 1HSTA 2JT1A 1OYYA 1H9GA 2BEOA 2Q2EA 3ZMDA 5ICEA 2FBIA 2F5DA 1P6RA 2QUFA 4WK8F 2OZUA 5FFZA 3ULQB 1BIAA 1MDMB 1Y0UA 3BJAA 2QLZA 3SZPA 3QP5A 1W5SA 5ICGA 2JRTA 2ZXJA 5DUIA 4B09A 2WTEA 4LLNA 4BHCA 1OMIA 4OIRF 1YS6A 1MDMA 1Z05A 1ZG5A 5ICFA 3EETA 2EFOA 4IVNA 3GF2A 2VBZA 4GCVA 5IT3A 2FQ3A 1G3WA 1FX7A 4UVBA 4MQVA 4KMFA 5BQTA 3QAHA 2EWNA 1ZG1A 3F72A 1SFUA 2UXNA 4P55A 1ZRDA 1HXDA 3N97A 5CJ9A 3O6BB 2OA4A 2IW5A 2XVCA 3RKXA 3WTUC 4DQ2A 3IKVA 3D5LA 4YG2F 5E8IA 2RGVA 1MJ9A 2VODA 1KU2A 2DO7A 3V4GA 4L5JA 1SD7A 1MJAA 4QWQA 1SFXA 3FF5A 1O3RA 5K5RA 5E18F 2MBFA 2QZ8A 2M1BA 2V1DA 4I98B 2HS5A 1LVAA 1HQCA 4Q48A 3K1NA 1U2WA 3EUHA 3ECHA 1D3YA 3GFMA 2IP2A 4GYGA 3K1PA 1CF7A 4I09A 3DEUA 3MQ0A 4EM2A 1YLFA 4MEXF 4OIOF 5LRRA 3E5QA 4BYYA 3ZMUA 2ZFWA 3JSPA 2DTRA 4HQEA 3BPVA 1REPC 2VONA 5AIPA 5D6FA 4G94A 3I5UA 3KCCA 2E1CA 4IJAA 3TOAA 4LJZF 3RJPA 1HW5A 1I27A 2XV4S 1P92A 3K69A 3MWMA 5F6FA 1FT9A 3T8TA 2RN7A 2F5FA 3GYHX 1H9TA 3GFIA 4JK1X 2EFQA 3WG9A 2ZCWA 2YU3A 2J5PA 5HLHA 2JPCA 1T39A 5E20A 3FM5A 2O03A 1LDJA 1FP2A 3H3ZA 4WF2A 4KYWA 1YW7A 3C3WA 4R1HA 2AXLA 4BXUA 1YFHA 4LB6B 4N9HA 3F8CA 4RGUA 4A5NA 4P5OA 1XB4A 4UV8A 2MLKA 3RIRA 1S8NA 3E6DA 1K78B 2P6SA 1USSA 1FNNA 4K2EA 4HF0A 4EGYA 1MGTA 1IRGA 5K5OA 5AIQA 1I6XA 3WTXC 1Z6RA 4M74A 1FWZA 4ENJA 5HOOA 4HBLA 2QQAA 4RB2C 3KLNA 1IF1A 2UZKA 2VOOA 2STWA 4M9ZA 4NHJA 1B4AA 4OU0A 2FU4A 5FGMA 4RS8A 2STTA 1IZ1A 1S7AA 4ZYHA 2V1UA 1W7PA 3HUGA 1D8JA 2HTSA 2H27A 5A2QZ 1R22A 2KIUA 3E5XA 1YIOA 3COAC 2L02A 4MTDA 3M9AA 4I7HA 3I64A 2DFIA 5ILUA 4HX7A 4FHTA 4L0ZB 1DUXC 4OMZA 1I1SA 5J6XA 2GAUA 5TRDA 1ZHFA 1ZAOA 2W84A 1QBJA 4EJVA 1XGSA 1RNLA 5JR3A 1OYWA 3E97A 2FOKA 4CXFA 2FBHA 1LNWA 1FBQA 3T0YA 5L3FA 2W57A 2B0LA 3P7NA 2D2WA 3WTWC 1TBXA 5HVQC 3WTTC 4Q5SF 1HKTA 5FD5A 4CHUA 2JTVA 4M71A 3LQRA 4FX4A 2G7UA 2DQLA 5KK1A 1XCVA 3RKWA 4BQAA 2KIMA 4HLXA 1HSJA 1ON2A 1EH6A 3QU3A 3GZ6A 1ZGAA 1TW3A 2A61A 1ODDA 1O7FA 2EV0A 4I0BA 4LLLA 4GYIA 1XSDA 1J75A 1O3TA 3BJOA 3HSRA 4LFUA 1QNTA 3ZMVA 4PCQA 2LDUA 3L09A 2UWMA 1G3SA 2H6CA 4M9SA 5FLXK 2VBWA 2NYXA 2W85A 4HX4A 3HYIA 2A07F 5CVRA 5H6QA 1FBUA 4O6JA 1FPQA 3FX3A 4PGHA 1BI2A 5BOXA 2FMYA 3MZHA 2IT0A 3R61A 2GXBA 3KP7A 2Z5UA 3WTVC 5DEQA 3E6BA 2EV5A 4Q4ZF 3LA2A 1J7KA 4G7HF 2V6CA 1AWCA 4YFKF 3HRUA 2VC0A 1XGMA 1TW2A 2D1VA 1ZLJA 5DD4A 4RAZA 1K78A 1K79A 3I58A 2E7WA 2PG4A 3WGGA 4UHTA 4G6DA 1G6NA 3SXYA 4AD9A 1IN8A 2VE9A 1EH7A
chains in the Genus database with same CATH superfamily
3C1DA 2QSFX 3J81K 4IQJA 2ZBKA 5EG0A 1X1DA 1QPMA 4E70A 3H3UA 3D1NI 1TQMA 3QOPA 3U21A 1ENHA 1JT0A 1FOXA 2ZMEC 4KIBA 1OJLA 2V1XA 3CF2A 2X48A 4UUSB 3HB9A 1JXSA 1A31A 1J59A 1YO5C 3HGYA 2VJ4A 3KETA 2ZKZA 4UUVA 2IS6A 5EGOB 2DA6A 3R60A 2NNNA 2KL4A 3A02A 3IHUA 3NEUA 1UZCA 4XM3A 1ACIA 3NARA 4M3EA 1MBJA 3BTCA 4I76A 1KA8A 1F1ZA 5HS9A 3HUGB 5LHGA 2EA2A 1WSUA 2EK5A 2O7OA 2ZJRF 3J81Z 1T6SA 5KAIC 3BJ6A 2PEXA 4WX9A 2J5OA 2BY2A 4OAYA 1UHWA 4YFXF 4BDZA 5LD2C 2O8KA 3S32A 4ZZLA 3TDUC 1VFCA 5B5EC 1BR2A 3J80Z 2QBYB 1F4KA 3OYFA 2VXZA 4ZDLA 4ZYGA 3H5RA 4EM1A 1ON1A 1I5ZA 3MAJA 2ESNA 3PIPF 4G7ZF 2E35A 2K9SA 2YUSA 1T95A 2O61A 1BN5A 2E36A 3V8LA 3F8BA 1T98A 2MA3A 1NG7A 5FROA 1IN7A 2DT5A 4IQ4A 3CCUI 3H9QA 2MFZA 1MSFC 3K4KA 2FBKA 3K10A 1LDKB 2L01A 5E1WA 2EIKH 1YE9A 1AOYA 4FT8A 5J1RA 1B9NA 2ZXWH 1PUFB 2OQGA 1DP7P 4F92B 3RPUA 1OQYA 4EJWA 3K4BA 3GEZA 2UUZA 5JVGF 1SD6A 1M1EB 5HLGA 1ETVA 3L2QA 1JKPC 3WTYC 2LF8A 5GADJ 4Y52J 2ZMEA 4XLCA 5CVIA 1GDTA 3EYIA 2A6TA 1HC8A 2LFBA 3PO2J 1RZ4A 4C9YA 2EFPA 3ELKA 1TWFJ 1UG2A 5M3FJ 1RR8C 4UXNA 3IV5A 1S9HA 4CUGA 3BP8A 2WY8Q 3VYRB 1IRXA 1SD4A 4D0PA 3S14J 2ZMEB 4P1WA 2QQBA 2VASA 4G6QA 5CQGA 1OCOH 3ZQHA 5J8FA 2OCEA 2W25A 4NC8A 3RYRA 1B8IB 1FOWA 2Q0OA 3F8NA 3K9TA 4FCYA 3DKXA 1P4WA 4MEYF 2HQAA 3BY6A 5CKTA 1MKMA 2L7KA 4WWCA 3LQQA 3QU6A 2JJ7A 3HOTA 2V9KA 1XMAA 1LQ1A 5HDNA 1XDSA 3LSGA 2GBYA 2QKMB 4D7NA 1FY7A 2BW3B 1VQ5I 4KT6A 2XAFA 2X9DA 2I10A 4S05A 3JRFA 3M1CA 1BBYA 1KYWA 1OCCH 2W48A 3O2PE 3BZKA 1U78A 4GFBA 1X2MA 1WVRA 2DDBA 2HVSA 2VQHA 2YSRA 4ZZDA 1Y1VJ 3TQNA 1FLIA 3BTJA 4E7IA 2M4KA 3F23A 4DW6A 2E19A 2W24A 1ETKA 1X58A 3HOYJ 4BE2A 4PFPA 1UCRA 3S8PA 2WAQN 1K4SA 1QVTA 1DU6A 1Z9CA 3MKZA 4I0AA 3QPTA 4HLYA 2F5CA 2IEKA 3HOSA 2ZXIA 4GXOA 3VWBA 1KGSA 2RV8A 3R4KA 2FUG2 5K7HA 4CZZA 2O6GE 1QRYA 2HOEA 2HR3A 1I50J 3JSOA 4RGSA 4KIFA 1HDPA 4X6AJ 2K86A 1D1AA 1GLNA 1Y56A 4ITVA 3GFLA 5M5WJ 1JE8A 1MZBA 1K6OA 4D1QA 3HPHA 5FKMA 3ZQCA 1SD5A 2RKHA 2NVXJ 5DM6F 1XC5A 1VQMI 5FB2A 4N4NB 5K7ZA 1N78A 1XGOA 2VBYA 3WHBA 3GLXA 3IRRA 1QHHD 3DLAA 4A69C 5JHUA 2ZJPF 1R36A 1AU7A 2IA1A 3HTUA 5LRSA 2JSCA 2K27A 3P9IA 4IHYA 3QPLA 2MC3A 3I54A 2X4HA 2QBYA 2OU2A 2DBBA 1T0FC 1FBSA 5L3GA 3CDLA 3TW7A 4A3JJ 3TP3A 2EINH 3QOEA 4BBSJ 4IZZA 1BOBA 1UHSA 3EUKL 1GUUA 4U0YA 1QZEA 2WV1A 2R7FA 5HLIA 3TBIA 5BPIA 1SAXA 2XB0X 3GZNB 1A04A 4DGWB 2ELHA 4XLNF 1VQKI 4RGRA 4G6TB 4U0WA 4RGXA 2NVQJ 1DP3A 1IUYA 1IXRC 3ASNH 3CUQA 3ZOBA 2DYRH 2PMZA 3GXOA 2ZNZA 2JZYA 1IW7F 2E34A 1MMAA 1QZYA 1HDDC 3RPUD 1YJWI 1S5LC 2XDVA 4EM0B 3BR3A 4Y3OA 2CQ7A 3CUQC 4BJ5C 4MHGA 4HF2A 2MABA 2P8TA 3QPHA 3VFZA 3M1EA 4HA8A 4A3KJ 2JVHA 2E7XA 4I6ZA 3K70D 2H8RA 2QSHX 2R7DA 3MKWB 4UVAA 4KA4A 1G3TA 4HNVA 3CJRB 1T2KA 1FJLA 1HKSA 2XASA 1VQ9I 1ZKGA 1BR4A 1ZTRA 2Q1ZB 2LNBA 3DEEA 5BMZA 3KEYA 1R4NB 2JA8J 4II3A 4FASD 4UUTA 2D5VA 3CCVI 1FYKA 4XK4A 1FC3A 3HRMA 2DK5A 3SFIA 2L4MA 1S29A 4RB3C 3EDPA 3ABUA 1XN7A 1ZG3A 2M5WA 1U3EM 5D4RA 5IP6A 3REOA 3CLQA 4KIGA 1XMXA 5LHHA 1DDNA 2EQRA 4UNOA 2VJ5A 1HF0A 3L2WA 1D5YA 4BXFA 4AM3A 3HZJA 3RKYA 2FA5A 2R7TA 5HODA 1U5TA 2EIJH 2BYVE 3WU1B 4LIUA 2G7HA 1VF9A 2E1MC 5GAEJ 3ZQQA 3GW2A 4A5MA 1BA5A 2L9VA 1PUFA 1XSXA 2E1MB 2K40A 3JRIA 4A3DJ 3H92A 2M9HA 4YIIA 1ZYRF 3LFKA 4NDLA 3ZPLA 1VTNC 2L54A 1S3JA 3V7SA 2QCOA 4FX0A 4JYKA 2L4AA 4BJ6C 4C3IJ 1FSHA 2R7OA 1QQIA 4F3QA 1ZREA 2HQ5A 2CV2A 3EUAA 2E5ZA 4EJOA 3P9KA 4D5FA 3PNYA 1I6HJ 4AC0A 3OIOA 3BR1A 5J1YA 3GBGA 2M30A 2ZB9A 2XC7A 2GXGA 2RQQA 2VQCA 3W2VA 3BDDA 1WZ2A 1Z6TA 1TTYA 3ABLH 5IPAA 2PJRB 2PQ8A 1XSVA 2EZHA 1O3QA 3SEQA 1IXSB 3OSGA 2GIVA 1IAWA 2HDDA 1OCRH 3QP6A 2I8DA 4QPOA 2YX4A 2RVCA 4RBOA 2M3AA 3F0CA 5KVRA 3T1BA 4KDPA 3HXLA 3JW4A 3P9CA 1O7LA 4DOZA 1Z77A 5FLMJ 5ICCA 3ZQ7A 3ZN1A 4JQFA 2JA2A 4XKCA 5JVTA 3O8HA 2W00A 3OYCA 1RUOA 1R7JA 3VSLA 1BI1A 1PVEA 4KMUX 3R6SA 1KQ9A 3D0SA 4ABZA 4YIFA 2NS7A 4ESJA 1O3SA 4EEFG 1UMQA 3J7YJ 1R5HA 2O8XA 2LD5A 3Q9SA 3GVAA 4CCJA 4UUSA 3CJTB 4O5VA 2EFWA 2NVUB 4Y33A 4C2MJ 4PUSA 1YJNI 3CCQI 1UB9A 1TZLA 4TV7A 5LFAA 1IN4A 2LOOA 3RKQA 2ZJ2A 5LGTA 1W5TA 3FKIJ 3HIFA 3G4SI 3TW6A 1YX3A 2Z1DA 5IT9K 4UVCA 3ZRGA 3FXQA 4HX8A 1B6AA 2IJLA 3BR2A 4PJJA 2A69F 1TT5B 3LA3A 1YW8A 5DUKA 1R00A 2DCEA 2K7LA 3DP7A 2BOLA 2E1NA 1Q1HA 3DWLE 4XSXF 4U88A 3R0JA 2AQFA 2RQPA 4MTEA 3DFGA 5C4XJ 5LLQA 5JFRA 3CO7C 4KJZA 3CC7I 1YRNB 2DDAA 3DPTA 4BBRJ 3E3VA 2HXOA 4ZJZA 4U7DA 3BOQA 3S2WA 3CESA 1XPXA 5HNHA 3ZGKA 2XAUA 3BG9A 5F0CA 2IRFG 4PGGA 1OYIA 2CG4A 4DZJA 4A3EJ 3H35A 1R1UA 2LF7A 5EEGA 5EEAA 3CMMA 1DQUA 3WODF 4IX7A 3W2AA 3TGNA 4D5CA 1NTCA 4Y7NJ 2LC2A 1B59A 1VQNI 2FMLA 3RZDJ 1R4MB 2HKXA 3LAPA 3JCUC 5HDGA 4IPAA 5FLXZ 3D5SC 1NH3A 2QENA 2GOMA 2QWWA 3QRFF 2K9NA 4OINF 3QPSA 3MMYB 3PNVA 1ETXA 1JGSA 5EYRA 5E17F 3PO3J 1X3ZB 2NXNB 1A6QA 2P0WA 2X51A 1E0EA 2DMPA 1GXQA 5ERIA 3GTQJ 1PDNC 4XR6A 2A6EF 1ETOA 3KYLA 2DJNA 3C7JA 1WI9A 1XDUA 3AG1H 3WGIA 2M8GX 3GO5A 4OMYA 3H0GJ 3Q0WA 2M4GA 4L5IA 2ZO4A 4WXCA 5DCMA 5D5UB 2V9VA 1XMKA 2AXTC 2XGXA 5D5XB 4HSRA 1ZR2A 2NVTJ 1OFCX 4L18B 3HM5A 1LB2A 2MW8A 3Q3SA 4J00A 2DMNA 3PUFA 1WJAA 3IL2A 1OKRA 1PYVA 1KQ0A 1LEAA 1BW5A 3I53A 4C30A 5J47A 4IRHA 2CH0A 3HG9A 1VQ8I 3SHFA 5AONA 2PBIA 3TO7A 3BZCA 2KP6A 3WTZA 1S7OA 1PP7U 1R5ID 4CCOA 1APLC 3I4PA 4P9FA 3OV8A 2CJJA 2Z99A 2VKVA 4HEA2 4ZH4F 3HPGA 2JA6J 4A2UA 2CW8A 2EA4A 3FZVA 3FBNB 3C18A 3ISPA 2R7RA 5DV5A 1USTA 2H6BA 1KYZA 3J80K 1A36A 1W1WE 1W7PD 5CYVA 2GXAA 2OJED 4CICA 1R49A 2A5WA 1BC7C 1UELB 3HBLA 2CS3A 3MFKA 4IXAA 4E7ZA 2YR2A 2R5YA 2DOEA 2P4WA 4MGRA 1WRJA 3FWEA 3PJRA 4A6DA 4DZPA 1QVUA 2DMTA 4L9TA 4BAYA 4R79A 4HDVA 3PNTA 4S0HB 1LFUP 1G8XA 1FZPB 3RDIA 2F6CA 1MBKA 3Q5FA 1P7IA 2CFXA 3OYMA 4JBAA 4RB1A 1NK3P 1AA7A 3AL0C 3FMSA 1S6LA 4LK1F 3HTSB 2CSOA 2W7NA 1X4OA 2DA5A 2BE5F 2L5QA 2LKSA 1XD7A 1JUMA 5E79C 3LA7A 1OR7A 3MVPA 2H94A 5IP9J 3HRSA 2BVMA 5EZGA 4BNCA 1VNDA 2B63J 5D6EA 3OMYA 4C3JJ 5C4JJ 1WKMA 3LAJA 2OC6A 2GQQA 1NK2P 1PUEE 1PP8F 5DS9A 2ZNYA 4BHPA 1G2HA 1E3PA 3FMRA 2XUBA 2PX9A 3H5AA 4BEHA 2GIZA 4DBQA 4QLCU 1EA3A 4H4KC 1IC8A 2HPMA 2V4JC 2IPQX 4V19K 1FYMA 2CRGA 2R4GA 3C2BA 3BG6A 3B6AA 4I2OA 2XHKA 1YTYA 3CJNA 1GXPA 3AKZA 3A1YA 3BR5A 2PFBA 2EV6A 1RESA 1Y6IA 2XF7A 3F3XA 3K4CA 5L3BA 1Z3YA 1MMGA 3CP8A 3BG3A 4HG2A 4DNCA 2CQKA 4KUMA 3ECOA 2FNPA 2VPRA 2M8EA 2XKOA 4M73A 1CGPA 4CYDA 2GWRA 3HKZN 2LK2A 2Q2EB 2JUGA 1U0JA 1Z0XA 2VKDA 4HAMA 3NRVA 2DTZA 1JHHA 2RREA 4G8XA 4CGZA 2WAEA 2OQRA 3LSJA 1MBGA 3JRHA 2Z2SB 2D45A 3FXMA 5D8KB 2WC2A 1FTZA 5CVVA 3SDGA 1FP1D 1JTYA 3OYAA 3CCYA 2CWEA 3BCAA 5F64A 3S93A 5IY5H 4A93J 2IGOA 3ESWB 1K61A 3LWFA 1JKOC 2HYFA 5FD6A 3DPLC 2CV1A 5DCFA 5LEJA 2EBIA 2EB7A 3M8JA 2UXXA 4L5EA 3I0TA 2ELJA 1MBFA 2CYYA 3V8JA 2ELKA 3BTIA 1WQ2A 2VC1A 4ESFA 2X0LA 2RNJA 5E1XA 2AS5F 1YQAA 3K7AJ 3M8FA 1XGNA 4BE0A 5EZHA 2WB1A 2COMA 2PMHA 4G9YA 4XLPF 5J4VA 2R93J 4KN4X 3MKYB 4S04A 1SFOJ 1E3HA 2FNAA 4XRFA 1KZHA 2EH3A 3O3KA 5E3LA 4EATA 2DQRA 4M3BA 5CVJA 2VJJA 4ZYEA 1WJBA 2XSDC 4RLQA 1JHFA 5BS6A 2P7VB 5IYDJ 3G3ZA 2XGDA 1AHDP 2EJRA 2TRTA 4LMYA 1OLTA 3VOEA 1RR7A 3G1MA 2YU9J 4YIRX 4M9XA 1IN5A 2BY1A 1J9IA 1U8BA 2CMPA 1D5VA 3FHNA 1KQ8A 4EV0A 2VJIA 3PIOF 4E4HA 1F43A 2MH9A 4G7OF 4IRGA 1TNSA 3F8FA 4A3MJ 3HHHA 1VQOI 3F6VA 1OISA 4BEHB 4Y13A 2B7EA 3PQJA 2W82A 4LGWA 3OYJA 3K4LA 2I5UA 4X0GA 2Z16A 2NOJB 1D0XA 2HKOA 2LRDA 3HSEA 1IRFA 1X3UA 3K70C 3Q9VA 3GWZA 3JRCA 5BPDA 1D8KA 1P4XA 1SAUA 5HS7A 2HPIA 1LFBA 3EPZA 3KEOA 2X85A 3DU5A 4AIDA 1CQTA 3B02A 3DTKA 1MBHA 1Y1WJ 4AIHA 2WBMA 1W36D 1ITYA 1KU3A 2ME6A 2PMZN 3OL4A 2QVOA 2ZSHB 3QQAA 5IOYA 4KFCA 4UY8I 2Y69H 4F55A 4DBRA 2K3PA 2ID6A 3U1DA 5J40A 2HZTA 5J1UA 3TDZC 2RDPA 2QA4I 2X6OA 2KDOA 2EZKA 2PMUA 3M7GA 4U87A 2DYSH 2L9NA 3AFHA 2XAHA 4IL6C 1C0WA 2KZVA 1TLHB 4XRMA 4EJUA 5J8CA 1T33A 4EVIA 2H8WA 2HYGD 1ZR4A 4BQNA 4LD5A 3E7LA 3LSIA 4CDGA 3F8MA 3R0AA 3DF8A 2OCCH 3FMQA 2L7MP 4PSXA 1S7EA 4L9JA 1T56A 3IKTA 1RKWA 1QO0D 1FSEA 1Y0NA 4PDKA 3GMEA 1YW9A 2WAFA 4XLHA 1Z1DA 5ILVA 4I01A 2HOTA 4V2GA 4GDFA 2LVSA 5D5WB 3LSTA 1QPIA 2C6YA 2VOPA 1L0OC 4WXHA 1R5GA 2CUJA 3VODA 4HF1A 3W6JB 1NHAA 2V79A 3JRBA 3DKYA 2XROA 2XF6A 4JOMA 1K7AA 2DT7B 4HDUA 1GV2A 2CQNA 3O8GA 4CH7A 2HZDA 3ERMA 5L3CA 3H9GA 2M34A 2W1OA 1BC8C 4IO9F 1QU3A 1WPKA 2Y0MA 1B8IA 3S2DJ 3HRTA 4EMSA 3QYFA 1D1BA 2ISZA 2GZWA 2OD5A 2TDXA 4FETA 4A6EA 5D4SA 4B4CA 2O3FA 3CCJI 1LE8B 3A4CA 1JUPA 2A5YB 1TWGJ 2V6EA 1UFMA 4XNFA 4MQ9F 4OIQF 4WXDA 2ISYA 3V8KA 1U5TB 1BJAA 4GO1A 1JUSA 1BI3A 3L9FA 1R71A 2R5ZA 2NS0A 3X2QH 2LY9A 1W5CC 4HQMA 2LBFA 2JK3A 3W2WA 5GTIC 1WWXA 3S15J 2K85A 3WE3A 4PSWA 4XORA 1X19A 2LTPA 4AYBN 2A68F 4AIJA 1HBXG 3MZYA 2CUFA 2AQEA 2KQRA 1ZLKA 5F0HA 2QM3A 1ZH5A 4M6YA 2R7VA 5F1RA 1X3WB 3OYKA 3PFYA 5K1YA 3LFUA 5TJJA 1K4TA 2HQNA 4PJ0C 2VXDA 4B44A 2HU9A 5HS8A 1ZARA 4UB6C 2DU9A 2KRFA 2FRHA 2E2IJ 2Y9YA 3S1RJ 3W6VA 3HOZJ 3ABKH 2NRAC 3OYGA 4E7JA 3TEDA 3U9GA 4XOTA 4ZYDA 2XAQA 3QWLA 4Z2YA 5H6RA 5A2QK 1YIJI 2IAIA 2OAZA 1O57A 3V7CA 2A6HF 3KP2A 4DYQA 3KEQA 3HSFA 4N0BA 3VB2A 2DXIA 3L1PA 3CUQB 3CF5F 4ZDOA 2TCTA 1YJ9I 4MFEA 4HZFA 2DAOA 2VN2A 5L3DA 3KP4A 2DW4A 4H0EA 4NNJA 1E2XA 1A6IA 4BQOA 3BG5A 1ZRFA 2F4OB 5FKLA 1W0TA 3FDYA 3G71I 3I59A 2NAZA 3BZ6A 2DT6A 4IHSA 2XIGA 3IWFA 2XGEA 3L7WA 3HOWJ 3HKZA 4GRIA 2LP0A 2LY1A 2Q8KA 2IGMA 2AO9A 1EV7A 4G12A 1LUJB 3CO6C 4HOBA 1V55H 3I71A 4KICA 2EZIA 4HV5A 2F4IA 4LLGF 4LG0B 1ZK8A 2E2JJ 1V5EA 1U5TC 2O5RA 1ZRCA 2PN6A 3D5RC 3I59B 3BROA 3DV8A 4HV6A 4A0XA 2FOWA 2BY0A 3PSIA 1B1BA 1BW6A 1MNDA 2XPUA 1TNTA 4LITA 4CZCA 3ZP5A 2BXYA 4BGDA 2KMUA 1DPUA 1OPCA 2DOFA 4Q47A 1IV8A 5E3OA 3CCMI 5M5YJ 2JQ7A 3BG7A 1MD0A 2ADUA 3WG7H 2VQLA 2VL8A 3V7RA 1SEUA 3ERED 2KIFA 3PM1A 3JTGA 3VYUB 1RI7A 3QODA 1DPRA 4A0YA 4W97A 5JHFA 4HNTA 4PJMA 5DDGA 2Y31A 3K4MA 5FJ8J 2JMWA 3L00A 3IWZA 3ONQA 2GOXB 3TKYA 2RC4A 3WGHA 2AHQA 1IUFA 1R6RA 2MH2A 3UNGC 1BIBA 2R7XA 3CLOA 2RNGA 3CMEI 5DD8A 2BY3A 3ZMTA 2R5YB 3HJEA 2ZJQF 1U6GA 4XSZF 1XX5A 1G4DA 3Q0UA 2M45A 4RB0A 5K7FA 3S3NA 3ASOH 4E6KG 2P7CB 1J5YA 3S1NJ 2IA2A 4BKXA 3L2CA 1QHGA 2FSWA 3KZIC 4OIPF 3ROUA 1FIAA 3SZGA 4X1EA 2DI3A 3PQKA 1XTAA 3RQIA 4BL0B 4CA0A 2E1OA 4HNUA 1YITI 3JRDA 2D1HA 2EZLA 3TOBA 3ZQFA 2HNHA 4FE4A 1SMTA 3K0LA 1JT6A 2DFEA 4P96A 2CGPA 3DKWA 1T0FA 1SFKA 3TO9A 1YRNA 2DLLA 4RAYA 1ETYA 3PFIA 4JX6A 2E71A 5GAHJ 2FF4A 2XSJC 3BPXA 5CLSA 1MNMC 4ZDPA 2HVQA 4M3FA 3H3VK 3ZN0A 2KHMA 1R58A 3CTAA 2IA0A 1UAAA 3MCZA 3SFZA 2X1EA 2R7UA 1W4MA 1N25A 4FTHA 1VQ4I 2F2EA 3N4MA 2ZFUA 4V2FA 3BWGA 3I9V2 3TL4X 3H0DA 2L9RA 3L2VA 2F48A 4O3MA 2DPDA 3AL0B 2BHYA 1OCZH 3A0BC 5FKNA 3IAS2 5LBQA 5IT9Z 5DM7F 1PJRA 3K2ZA 4IF4A 1POGA 9ANTA 4KN7X 3G1LA 3HHGA 2BV6A 4MNUA 4QSHA 4QTRA 3M8EA 5FFXA 4KISA 2L3DA 1EH8A 4PFOA 1TQIA 3CDHA 1QZZA 2LLKA 4AU7A 1DGWY 1SVOA 1FEXA 3GUDA 3H9JA 1V4RA 5C3EJ 4HYEA 2VE8A 4RM3A 1VQ7I 2KJBA 1B9MA 4Y17A 2R7SA 1I1GA 4N4OB 5DYMA 3HOUJ 4L9NA 3JAMZ 1LJ9A 3G73A 4BS9A 4BY1J 2ACJA 3I4MJ 3KE2A 2K4BA 2XRNA 2FE3A 2X6XA 2Y75A 3RYPA 4L0YB 1HCRA 2MG4A 2X1DA 1R1VA 1G59A 4U7BA 1XG1A 2HYJA 2K9LA 3KYCB 3OYNA 4MLOA 3M4OJ 3C2HA 2L7ZA 4B43A 2M0MA 2O9LA 3CUOA 1YS7A 2L0KA 3CMYA 4A3CJ 3JRGA 4R8HA 3V42A 2JUCA 1GVJA 3TP0A 4BU2A 2Y48A 1YYVA 2HVRA 5H2FC 2NNYA 4M3GA 2LH9A 3GLLA 4B8XA 2LREA 2IGNA 1HKQA 1LDDA 3F6OA 4P9UA 1T8IA 2P81A 1J09A 1HW2A 3FXOA 3DCFA 3N05A 2HGCA 3S2HJ 4Y4RA 3KPHA 3W6KB 3OYIA 3SJMA 1FMWA 1ZGJA 4YFNF 3FKJA 1UHMA 4RA2A 2WY7Q 1B72B 2IVMA 1RRJA 2XKPA 2PJPA 3J7ZI 4IHVA 4M72A 1N75A 2PLYA 3EYYA 3TO6A 2Z33A 5DTDA 1IRZA 4LK0F 5EGOA 5K5QA 2FQ4A 2FJ1A 1GHCA 3EQLF 1F9NA 1G3YA 1X1CA 2EPFA 3E6MA 4RM2A 1J0RA 5FRMA 4BH9A 4EGZA 1H88C 3HL2A 3FHZA 3ZMZA 3DQVC 2IS4A 1XCBA 1T38A 3RTRA 1ULYA 4IEJA 4CYCA 3DBLB 4D9JA 6PAXA 5FKKA 5E8GA 4YELA 2JPBA 5HDKA 3ZCOA 3WE2A 3E5UA 1BOAA 1U9NA 2MGQA 4J01A 2B9SA 1QGPA 2F4MB 5B3SH 3DPUA 3KLOA 5D8LB 4ESBA 1IN6A 1WHUA 3DLLF 4LB5A 1J2XA 3I3LA 1XS9A 1Z7UA 2DA7A 4F52A 5GPCA 1BM9A 4PK4A 2WWYA 3CC4I 3A2KA 3PUBA 1W7PB 4IRIA 1BJZA 2YPRA 1TWCJ 2MD5A 1EH7A 2LYCA 1KU9A 1TC3C 2ICWG 3KP5A 4AVPA 1FIPA 4XN0A 2DMUA 5LGUA 3A01B 1IGNA 2K3FA 3KZYA 1STZA 3S16J 2DN0A 3VEPA 4ASNA 3GFJA 3TMOA 3SDBA 3OYEA 1AKHA 1TQPA 3OWTA 2WV0A 2Z9OA 2VPLA 3U1KA 4XICA 2FXAA 1EKEA 4PZJA 3NWTA 4XKVA 4CO8A 2IGKA 3RZOJ 3LOCA 4BDYA 2EIMH 4AUXA 3CCLI 3KZZA 2R7ZJ 2UV1A 1MMSA 1YG2A 4I02A 5FKOA 4RAGA 5F08A 4U0VA 2LSOA 2CO5A 2DA2A 3KFWX 3MEXA 3PL8A 3RSNA 1SFEA 3I56I 4UV9A 2IS2A 2V1NA 4N9IA 3FM3A 4BUPA 2QEXI 4BY7J 4ENNA 2XAGA 3CD6I 5GP9A 2QQ9A 2FEZA 2OBPA 3WTSC 3RI4A 4OWRB 3K2AA 2BHZA 1LEBA 3U2RA 3OOPA 2M0CA 1F5TA 2WA0A 1H0MA 4LG0A 4NC6A 1P2FA 1WH5A 2YS9A 3ML6A 2NS8A 5IOZA 2F5EA 3OYBA 1WFXA 2HWVA 4JX4A 2DK8A 1R1TA 2HEOA 3FXUA 1GT0C 2QKLB 2H09A 3F9KA 1FYLA 3H36A 1CF7B 4ON0A 1JTXA 3DXJF 1JJ8C 2OTLI 2HTJA 4ENKA 3KP6A 1Q1VA 4ENMA 2H1KA 2MSYA 2BXZA 2HQRA 3ZMSA 3B73A 4Y15A 2P5VA 2CUZA 1BI0A 5E1ZB 3IRQA 2E5NA 2LBFB 4XBFA 2V26A 5L3EA 1IXCA 1V3FA 2P5KA 1X1BA 3IC7A 4KT5C 3OOUA 4M3DA 4A3GJ 3Q0VA 4HW0A 4NC7A 2JWTA 2GM4A 3WU0A 4DYCA 3K1MA 3E6CC 4A12A 3K4JA 2KKOA 2QYOA 1MH3A 2KT0A 3OYLA 1FTTA 2YX7A 2OF7A 2XPWA 4A3BJ 3JREA 1I3AA 3M3YJ 4A3LJ 2LKPA 2ZXHA 5IYBJ 3JRAA 4M6XA 5H20A 1RIOH 2EFNA 2Z3YA 5JI6A 2KJCA 2BGCA 3E0JB 4RAFA 3G1OA 3F21A 1FOYA 2HDCA 2COBA 1B72A 4M6VA 1ORKA 3F22A 1P4AA 2GA1A 2OZ6A 4MIMA 5BNGA 2JA7J 2VBXA 3GTOJ 4XRSA 3AAFA 1E3OC 3HOVJ 1E17A 5LEKA 3OL3A 1FOKA 3OR1C 2DPUA 5EEHA 4RMNA 1X2NA 1RPWA 3VYSB 5D5VB 4OOIA 4EJTA 3HEFA 4AWXB 4CCMA 4F7ZA 2BBYA 3JAMK 2GA2A 2RAEA 2M87A 1ZN2A 2X6YA 5B1BH 5DCMB 3S1MJ 3NAUA 2HDWA 4NB5A 1WH7A 3CQZJ 5CVUA 3VDXA 5LHIA 3L2RA 5FLVA 2HFHA 2O0YA 3KP3A 5GTHC 2P5LC 1KU7A 1SMYF 3GZ5A 2VUMJ 3BC8A 2FD5A 1LE8A 2ETHA 2GLOA 5KCMA 3IP4B 3S3OA 2MC4A 2E60A 3T5XA 5LGNA 2VT2A 1DGRM 1I39A 3ABTA 4GGGA 5KNLA 3GTLJ 2BZTA 1HW1A 3MD2A 1Z3XA 3SZTA 4KNYA 1L3LA 4AIKA 4HPQA 2PI0A 5FO5A 4QPQA 1F36A 1IG7A 4ETSA 3NQOA 2DFHA 2L9SA 1Z91A 1U8RA 4IHTA 5M3MJ 2L7FP 2K02A 1LPQA 1JGGA 4L9VA 1RUNA 2VT3A 2V7FA 1AKHB 4LG3A 3SQNA 2P6TA 4NQWA 5ILSA 1FMVA 1YOVB 3OS2A 4BQQA 1YI2I 4B48A 2H1LA 2BW3A 3AG2H 3GTGJ 4WCGA 4B3XA 4A0ZA 3JTHA 3RPQA 1R23A 1SC7A 4BACA 2G9WA 1ONVA 2DFFA 2K4JA 2ESHA 2M7AA 3CJQB 2BVLA 2CW0F 4B3AA 5HLTA 3GX4X 5ED4A 1D0YA 3LL7A 2A3SA 1K83J 3T8RA 3J7AO 5J3LA 1MJBA 2MLGA 4II2A 2WAQA 2XAJA 3FXRA 2R3SA 4EQQA 1U9OA 2FX0A 3HGGA 4BHBA 1HSTA 4XLFA 5B1AH 4XIDA 4KITB 1JKRC 1X1PA 2JT1A 3HDDA 5TGTA 4IOAF 1OYYA 2XRLA 3WU2C 5HNFA 1WCMJ 3OR2C 2M7BA 3FXJA 3NWSA 2KDZA 1H89C 1H9GA 2BEOA 2Q2EA 3ZMDA 1RC9A 1T08B 5ICEA 2FBIA 2CQXA 1MBEA 2F5DA 3CC2I 1P6RA 2QUFA 4NUBA 1EJ9A 4WK8F 1X4PA 4XLAA 4F91B 4B1RA 2OZUA 2QSGX 5FFZA 3ULQB 1BIAA 2HOSA 1MDMB 1GV5A 1Y0UA 3ZXSA 3BJAA 2QLZA 3DBHB 1ETWA 3SZPA 3QP5A 1W5SA 3IUOA 5F04A 4E7SA 5GAGJ 5ICGA 3OSFA 1OR7C 2JRTA 1JI8A 2ZXJA 5DUIA 1WI3A 4B09A 1YX5A 2WTEA 1WGXA 4LLNA 3LSKA 4BHCA 1OMIA 2VIXA 4OIRF 3P5JA 1YS6A 4I99C 4JX5A 1MDMA 1Z05A 1ZG5A 2Y2ZA 5ICFA 3IH3A 3EETA 3GCMA 3L2UA 5JLXA 2R0QC 2EFOA 1TT0A 4IVNA 3GF2A 2VBZA 4GCVA 5IT3A 2FQ3A 4IKFA 1G3WA 3ZQGA 2E2HJ 1FX7A 4UVBA 1YHQI 2OPTA 4MQVA 2CUEA 1Y39A 2DA1A 5BQTA 4KMFA 1IV6A 2DODA 3CMAI 3ZQLA 3QAHA 5KHDA 2EWNA 1ZG1A 3F72A 4E7HA 3JR9A 3KYDB 1K6YA 3RCOA 1SFUA 2PJRA 2UXNA 2JSPA 4P55A 4XL9A 3UKGA 1IJWC 1Z21A 1ZRDA 4B47A 3KX2A 1HXDA 3HOXJ 4XONA 5F27A 4CCKA 5J4YA 3N97A 2XGCA 5CJ9A 3O6BB 2OA4A 2IW5A 2XVCA 3RKXA 3WTUC 4DQ2A 3IKVA 3D5LA 4YG2F 5E8IA 2RGVA 1MJ9A 2VODA 1KU2A 2DO7A 3LMMA 1ERDA 1D1CA 3V4GA 4L5JA 1H8AC 1HOMA 1SD7A 1MJAA 4QWQA 1SFXA 3FF5A 1O3RA 5K5RA 2VQGA 2DJIA 5E18F 2MBFA 4XOPA 2QZ8A 2V9PA 2M1BA 2V1DA 1TP4A 3DTIA 4I98B 2HS5A 2MD0A 5TISC 2OV7A 1LVAA 1HQCA 4Q48A 3K1NA 3LSRA 1U2WA 3EUHA 3HC7A 2L2OA 3CCEI 4DYRA 1I3QJ 1MSEC 3ECHA 3A0HC 2CQQA 1D3YA 2DOAA 3GFMA 2IP2A 4GYGA 3K1PA 3CP2A 1CF7A 1QA6A 1A5JA 4I09A 3BCBA 4NBQA 3DEUA 1W36C 3MQ0A 4EM2A 2LKXA 1YLFA 4IOCF 4MEXF 4OIOF 5LRRA 3E5QA 2HI3A 4BYYA 1ZQ3P 3ZMUA 2F5VA 3BT9A 2N8GA 1ZGWA 1ETQA 2ZFWA 3JSPA 5F0FA 2DTRA 3ABMH 4HQEA 4XKWA 3BPVA 1V5FA 1REPC 3MKLA 2VONA 5AIPA 5D6FA 1Z67A 4G94A 2VI6A 3I5UA 1HLVA 3AG3H 3IAM2 3BTLA 3KCCA 3VPRA 3OS1A 2E1CA 4IJAA 2VB6A 3TOAA 2LR8A 1MW7A 3A01A 4LJZF 3SYTA 3RJPA 2CU7A 2QGUA 4YEJA 1WJCA 4CCNA 1HW5A 1I27A 1VQPI 3GTKJ 1LKXA 2XV4S 3OY9A 3CCSI 1P92A 3K69A 4LIVA 3MWMA 5F6FA 2A05A 1FT9A 3T8TA 3ZR8X 5EG0B 2RN7A 2F5FA 3GYHX 4AYBA 3GTJJ 1H9TA 3GFIA 4JK1X 2EFQA 3WG9A 1RKTA 2ZCWA 2YU3A 3E1SA 2KZGA 1WJFA 2J5PA 5HLHA 2JPCA 1O4XA 2ECBA 1VZ0A 1UJ8A 2K9MA 3WHCA 1T39A 3EUHC 1JJ6C 5E20A 3FM5A 2O03A 4CSWA 1LDJA 1FP2A 3H3ZA 3BQYA 4ZYAA 4WF2A 4KYWA 1WJDA 1YW7A 3C3WA 3LSHA 2DA4A 4R1HA 2R5ZB 1S72I 1N77A 1SVLA 4AVZA 4CCLA 3S1QJ 1MH4A 4D7MA 1JKQC 2AXLA 4HRIA 4BXUA 1YFHA 2Y0SA 2VLAA 2JN6A 2IS1A 4LB6B 5KAFC 4N9HA 3K4NA 3F8CA 4RGUA 4A5NA 4P5OA 1XB4A 4UV8A 2ECCA 1IDZA 1Y8RB 2MLKA 4C2TA 1WJEA 1S8NA 3E6DA 3C2GA 3RIRA 1K78B 5E3MA 2P6SA 4XKBA 5CQEA 3CZ6A 1USSA 2X1CA 3S3MA 2ID3A 1FNNA 3CDIA 4K2EA 5IYCJ 1V5GA 5EDNA 5CPRB 4HF0A 4EGYA 1MGTA 3LSMA 3PSFA 3KIOA 5K5OA 1IRGA 5AIQA 1I6XA 2JVGA 2Y0SN 4A3FJ 2IXSA 1DU0A 2KFDA 4XRSG 3WTXC 1Z6RA 4M74A 1FWZA 5HOOA 4ENJA 4RLFA 3ZQIA 4HBLA 4XLEA 2QQAA 2CW7A 4RB2C 3GTPJ 3KLNA 5M5XJ 3OIQA 1IF1A 2UZKA 3FXLA 2VOOA 2STWA 4CYCB 4M9ZA 4NHJA 1B4AA 5IP7J 2R92J 2CFOA 2NOGA 4DIQA 4OU0A 4J19A 2FU4A 4Z6YA 2Y9ZA 5FGMA 2LG4A 4RS8A 2STTA 1SANA 3MZ8A 1IZ1A 4ZTJA 3QYBA 1S7AA 1MMDA 2KRHA 4ZYHA 1TL8A 2JRMA 1VQ6I 2V1UA 1W7PA 1TWHJ 5GPAA 3HUGA 3LSPA 1D8JA 2HTSA 4XQFA 1MNEA 2H27A 3G6EI 5A2QZ 1R22A 5FRNA 3SEZA 2KIUA 3E5XA 1YIOA 3UR3C 3COAC 2KRCA 3OYHA 4DJAA 2L02A 3FIWA 4MTDA 3M9AA 4LOCA 3I55I 3M07A 1LVKA 3DBRB 4I7HA 3I64A 1VQLI 2DFIA 2QF7A 5ILUA 4HX7A 4FHTA 3W3CA 2LMDA 4L0ZB 2MYSA 1DUXC 4F93B 4OMZA 4C3HJ 2CV0A 5F1JA 1I1SA 5J6XA 2GAUA 4JP0A 5TRDA 1ZHFA 1ZAOA 2W84A 1QBJA 1V54H 4EJVA 1XGSA 1RNLA 4HSTA 4NQWB 5JR3A 3IH2A 1OYWA 3E97A 1ZELA 2FOKA 4CXFA 1MMNA 4PJLA 4YRVA 1HA8A 4IHXA 2FBHA 3H1CA 2WB1N 1LNWA 1OCTC 1FBQA 1GVDA 2KLOA 4A3IJ 4UB8C 3T0YA 2ZSIB 5L3FA 1X1AA 2W57A 2LY2A 5C44J 2B0LA 3P7NA 2D2WA 4W1UA 1BR1A 3WTWC 1TBXA 5HVQC 3WTTC 4Q5SF 2IBDA 1A35A 1UG0A 1HKTA 2QQ8A 5FD5A 2JA5J 2ZC2A 1BL0A 4CHUA 2JTVA 3RQ4A 3OYDA 4BXXJ 4M71A 1IO2A 4ANJA 3LQRA 2X6WA 5E3NA 4FX4A 2G7UA 2DQLA 5KK1A 1XCVA 3RKWA 4BQAA 2KIMA 3DU6A 3MN2A 2EILH 3FXKA 4HLXA 4PJNA 3CCRI 1HSJA 2KIQA 1ON2A 1EH6A 4IHWA 3QU3A 3S17J 3AG4H 3GZ6A 1ZGAA 4XN3A 1SVMA 1TW3A 2A61A 1ODDA 1O7FA 2EV0A 2K9QA 4I0BA 4LLLA 4GYIA 4BJTA 1XSDA 1J75A 5B66C 2Y30A 1O3TA 3BJOA 3HSRA 4E7LA 2NVYJ 4LFUA 1QNTA 1IDYA 3GTMJ 3ZMVA 1P9QC 2OUMA 3B6CA 3BQZA 4PCQA 2LDUA 3FBIB 3L09A 4XMYA 3BR0A 1MIJA 2XF5A 2UWMA 1G3SA 2H6CA 2WADA 1VI0A 4FISA 2VBWA 4M9SA 3IH4A 5FLXK 1KONA 3H5NA 3I4NJ 3BLYA 4MFDA 2NYXA 2R7QA 3VSKA 2W85A 4HX4A 1Z7LA 3DTEA 3LNQA 4BE1A 3HYIA 3BR6A 1R9TJ 2A07F 5CVRA 2DA3A 3DEWA 1WJ5A 5H6QA 3A03A 1FBUA 4O6JA 1FPQA 3FX3A 4PGHA 2W4SA 1BI2A 5BOXA 2FMYA 4C2UA 1LFPA 3MZHA 2VKHA 3K6GA 2R7WA 1Y8QB 3R61A 4MO7A 2IT0A 2GXBA 3G2BA 3KP7A 2Z5UA 2KPMA 2OTJI 2DMQA 2VKEA 5DEQA 3E6BA 3WTVC 2EV5A 3FK6A 4Q4ZF 2K5CA 4RDUA 3LA2A 5EJCA 3VYTB 1NG6A 4OAZA 3J7AY 1J7KA 4G7HF 2V6CA 1AWCA 4YFKF 3HRUA 4QIWN 2VC0A 1XGMA 1TW2A 2D1VA 1ZLJA 5DD4A 4E7KA 4RAZA 1K78A 3OIPA 1K79A 4ZTFA 2KISA 4FQGA 3I58A 5EF6A 1W0UA 1TWAJ 1D0ZA 2ME0A 3FK7A 2E7WA 2HXIA 4ZC3A 1P7JA 3QYEA 2PG4A 3WGGA 4UHTA 2XPVA 4G6DA 2HOAA 1OCPA 2M2EA 4FE7A 1G6NA 3SXYA 3OS0A 4AD9A 1IN8A 1RETA 5JLWA 2G0EA 2VE9A 1EF4A 3FISA 2XB5A
chains in the Genus database with same CATH topology
3C1DA 3J81K 2ZBKA 1QPMA 4E70A 3H3UA 1TQMA 3QOPA 4KIBA 2V1XA 1JXSA 1J59A 1YO5C 3KETA 2ZKZA 4UUVA 3R60A 2NNNA 3IHUA 3NEUA 1KA8A 1F1ZA 5HS9A 5LHGA 2EA2A 1WSUA 2EK5A 3J81Z 1T6SA 3BJ6A 2PEXA 4WX9A 2J5OA 1UHWA 4YFXF 4ZZLA 3TDUC 3J80Z 2QBYB 1F4KA 2VXZA 4ZYGA 4EM1A 1ON1A 1I5ZA 3MAJA 2ESNA 4G7ZF 2O61A 1BN5A 3V8LA 3F8BA 1T98A 2MA3A 1IN7A 2DT5A 2FBKA 1LDKB 2L01A 5E1WA 1AOYA 4FT8A 1DP7P 1B9NA 2OQGA 3RPUA 4EJWA 3GEZA 1SD6A 5HLGA 3WTYC 2LF8A 2ZMEA 5CVIA 3EYIA 1RZ4A 2EFPA 3ELKA 4UXNA 3BP8A 1SD4A 4D0PA 2ZMEB 2QQBA 4G6QA 5J8FA 3RYRA 2W25A 2Q0OA 3F8NA 3K9TA 1P4WA 4MEYF 3BY6A 1MKMA 4WWCA 3LQQA 3QU6A 3HOTA 1XMAA 1LQ1A 5HDNA 1XDSA 1FY7A 2XAFA 4S05A 1BBYA 1KYWA 3O2PE 1U78A 4ZZDA 2YSRA 3TQNA 1FLIA 3F23A 2W24A 1UCRA 1Z9CA 4I0AA 3QPTA 4HLYA 2F5CA 3HOSA 4GXOA 1KGSA 2RV8A 3R4KA 4CZZA 2O6GE 2HOEA 2HR3A 3JSOA 4RGSA 4KIFA 2K86A 3GFLA 1JE8A 1MZBA 1K6OA 1SD5A 2RKHA 5FB2A 1XGOA 2VBYA 3GLXA 3IRRA 5JHUA 1R36A 2IA1A 3HTUA 5LRSA 2JSCA 2K27A 3P9IA 2MC3A 3I54A 2X4HA 2QBYA 2OU2A 2DBBA 1FBSA 5L3GA 4U0YA 5HLIA 2R7FA 5BPIA 1SAXA 1A04A 2ELHA 4XLNF 4RGRA 4U0WA 4RGXA 1IUYA 1IXRC 3CUQA 3GXOA 2ZNZA 2JZYA 1IW7F 1QZYA 4EM0B 3CUQC 4MHGA 4HF2A 2P8TA 3QPHA 3VFZA 3M1EA 4HA8A 2E7XA 2R7DA 4UVAA 4KA4A 1G3TA 1T2KA 1HKSA 2XASA 2LNBA 5BMZA 1FYKA 1FC3A 3HRMA 2DK5A 2L4MA 1S29A 4RB3C 3EDPA 3ABUA 1XN7A 1ZG3A 2M5WA 1U3EM 5D4RA 3REOA 4KIGA 5LHHA 1DDNA 4UNOA 3RKYA 2FA5A 1U5TA 2BYVE 3WU1B 2G7HA 3GW2A 4A5MA 1XSXA 3H92A 4YIIA 1ZYRF 3LFKA 3ZPLA 1VTNC 2L54A 1S3JA 3V7SA 4FX0A 2L4AA 1FSHA 1QQIA 1ZREA 4EJOA 3P9KA 2M30A 2GXGA 3BDDA 1Z6TA 1TTYA 2PQ8A 1XSVA 1O3QA 1IXSB 1IAWA 2GIVA 3QP6A 2RVCA 2YX4A 5KVRA 4KDPA 3T1BA 3JW4A 3P9CA 1O7LA 5ICCA 3ZQ7A 3ZN1A 4JQFA 5JVTA 1RUOA 1R7JA 4ESJA 1BI1A 4KMUX 3R6SA 1KQ9A 3D0SA 4YIFA 1O3SA 1R5HA 2O8XA 3Q9SA 3GVAA 4O5VA 2EFWA 1UB9A 4TV7A 1IN4A 2ZJ2A 5LGTA 1W5TA 3HIFA 5IT9K 4UVCA 3FXQA 4HX8A 1B6AA 2IJLA 2A69F 3LA3A 1YW8A 5DUKA 1R00A 2K7LA 3DP7A 2E1NA 1Q1HA 4XSXF 4U88A 3R0JA 2RQPA 4MTEA 3DFGA 5LLQA 5JFRA 3CO7C 3DPTA 3E3VA 4U7DA 3BOQA 3S2WA 2IRFG 4PGGA 1OYIA 2CG4A 1R1UA 2LF7A 5EEGA 3WODF 3TGNA 1B59A 2FMLA 2HKXA 3LAPA 5HDGA 4IPAA 5FLXZ 2QENA 2QWWA 3QRFF 4OINF 1JGSA 5E17F 1GXQA 5ERIA 1PDNC 2A6EF 3C7JA 1WI9A 1XDUA 3WGIA 3GO5A 4OMYA 4L5IA 2ZO4A 4WXCA 5DCMA 5D5UB 2V9VA 1XMKA 2XGXA 5D5XB 4L18B 1LB2A 3IL2A 1OKRA 1KQ0A 1LEAA 3I53A 4IRHA 3SHFA 5AONA 2PBIA 3TO7A 3WTZA 1S7OA 1PP7U 3I4PA 4P9FA 3OV8A 2Z99A 4ZH4F 4A2UA 3FZVA 2EA4A 3C18A 3ISPA 5DV5A 1USTA 2H6BA 1KYZA 3J80K 5CYVA 1W7PD 4CICA 1BC7C 3MFKA 4IXAA 2YR2A 2P4WA 4MGRA 1WRJA 3FWEA 4A6DA 4L9TA 4BAYA 4R79A 4HDVA 1FZPB 3RDIA 3Q5FA 2CFXA 4JBAA 4RB1A 3FMSA 1S6LA 4LK1F 3HTSB 2CSOA 2BE5F 1XD7A 3LA7A 1OR7A 2H94A 3HRSA 4BNCA 5D6EA 3LAJA 1WKMA 1PUEE 2GQQA 1PP8F 2ZNYA 4BHPA 3FMRA 2XUBA 4QLCU 2IPQX 1FYMA 4I2OA 2XHKA 1YTYA 3CJNA 1GXPA 2PFBA 2EV6A 3F3XA 5L3BA 4DNCA 2CQKA 4KUMA 3ECOA 2FNPA 2M8EA 2XKOA 4M73A 1CGPA 4CYDA 2GWRA 4HAMA 3NRVA 1JHHA 4CGZA 4G8XA 2OQRA 2D45A 5D8KB 2WC2A 5CVVA 1FP1D 2CWEA 5F64A 3LWFA 2HYFA 5FD6A 3DPLC 5DCFA 5LEJA 2EB7A 2UXXA 3I0TA 2CYYA 3V8JA 1WQ2A 2VC1A 4ESFA 2X0LA 2RNJA 5E1XA 2AS5F 1YQAA 3M8FA 1XGNA 2COMA 2PMHA 4G9YA 4XLPF 4KN4X 4S04A 2FNAA 4XRFA 3O3KA 2DQRA 5CVJA 4ZYEA 1JHFA 5BS6A 2P7VB 3G3ZA 2EJRA 4LMYA 3VOEA 4M9XA 1IN5A 1J9IA 1D5VA 1KQ8A 4EV0A 2MH9A 4G7OF 4IRGA 1TNSA 3F8FA 3HHHA 3F6VA 4Y13A 3PQJA 4LGWA 2HKOA 3HSEA 1IRFA 1X3UA 3Q9VA 3GWZA 5BPDA 1D8KA 1P4XA 5HS7A 3KEOA 3B02A 4AIHA 1KU3A 2QVOA 4KFCA 3U1DA 2HZTA 3TDZC 2RDPA 2PMUA 3M7GA 2XAHA 1C0WA 1TLHB 4EJUA 5J8CA 4EVIA 2HYGD 4LD5A 4CDGA 3F8MA 3R0AA 3DF8A 3FMQA 4L9JA 3IKTA 1QO0D 1FSEA 4PDKA 1YW9A 1Z1DA 5ILVA 4I01A 5D5WB 3LSTA 2C6YA 2VOPA 1L0OC 4WXHA 1R5GA 3VODA 4HF1A 3W6JB 1NHAA 2V79A 2XROA 1K7AA 4HDUA 5L3CA 1BC8C 2Y0MA 3HRTA 4EMSA 2ISZA 2GZWA 2OD5A 2TDXA 4A6EA 5D4SA 2O3FA 2A5YB 1UFMA 4MQ9F 4OIQF 4WXDA 2ISYA 3V8KA 1U5TB 1BJAA 4GO1A 1BI3A 3L9FA 2NS0A 4HQMA 1WWXA 3WE3A 2A68F 4AIJA 1HBXG 3MZYA 1ZLKA 2QM3A 1ZH5A 4M6YA 5F1RA 5K1YA 5TJJA 2HQNA 5HS8A 1ZARA 2DU9A 2KRFA 2FRHA 2NRAC 3U9GA 4ZYDA 2XAQA 4Z2YA 5H6RA 5A2QK 2OAZA 1O57A 3V7CA 2A6HF 3KP2A 3KEQA 3HSFA 4N0BA 3VB2A 3CUQB 4HZFA 2DAOA 2VN2A 5L3DA 3KP4A 2DW4A 4H0EA 1E2XA 1ZRFA 3I59A 2NAZA 3BZ6A 4IHSA 2XIGA 3IWFA 3L7WA 2Q8KA 1EV7A 3CO6C 4HOBA 3I71A 4KICA 4HV5A 4LG0B 4LLGF 1U5TC 1ZRCA 2PN6A 3I59B 3BROA 3DV8A 4HV6A 4A0XA 1B1BA 1TNTA 3ZP5A 1DPUA 1OPCA 4Q47A 1MD0A 2ADUA 3V7RA 3ERED 2KIFA 3JTGA 1RI7A 1DPRA 4A0YA 5DDGA 3L00A 3IWZA 3TKYA 2RC4A 3WGHA 2MH2A 1BIBA 3CLOA 5DD8A 3ZMTA 1U6GA 4XSZF 1G4DA 2M45A 4RB0A 2P7CB 1J5YA 2IA2A 3L2CA 2FSWA 4OIPF 3ROUA 2DI3A 3PQKA 2D1HA 3TOBA 1SMTA 3K0LA 4P96A 2CGPA 3DKWA 1T0FA 3TO9A 2DLLA 4RAYA 3PFIA 2FF4A 5CLSA 3BPXA 3ZN0A 1R58A 3CTAA 2IA0A 3MCZA 3SFZA 1W4MA 2F2EA 3N4MA 3BWGA 4O3MA 2DPDA 5LBQA 5IT9Z 3K2ZA 4IF4A 4KN7X 3HHGA 4MNUA 2BV6A 3M8EA 5FFXA 2L3DA 1EH8A 1TQIA 3CDHA 1QZZA 3GUDA 1V4RA 4HYEA 2VE8A 2KJBA 1B9MA 4Y17A 1I1GA 5DYMA 4L9NA 3JAMZ 1LJ9A 3G73A 2ACJA 3KE2A 2K4BA 2XRNA 2FE3A 2Y75A 3RYPA 4L0YB 1R1VA 4U7BA 3CUOA 1YS7A 4R8HA 1GVJA 2Y48A 1YYVA 2NNYA 4B8XA 1HKQA 1LDDA 3F6OA 4P9UA 1HW2A 2HGCA 3W6KB 1ZGJA 4YFNF 1UHMA 2IVMA 2XKPA 2PJPA 4M72A 2PLYA 3EYYA 3TO6A 2Z33A 4LK0F 5K5QA 1GHCA 3EQLF 1F9NA 1G3YA 3E6MA 1J0RA 4BH9A 4EGZA 3FHZA 3ZMZA 3DQVC 1T38A 1XCBA 3RTRA 1ULYA 6PAXA 5E8GA 2JPBA 5HDKA 3WE2A 3E5UA 1BOAA 1QGPA 3KLOA 5D8LB 4ESBA 1IN6A 4LB5A 1J2XA 1Z7UA 1BM9A 2WWYA 1W7PB 4IRIA 2YPRA 2MD5A 1KU9A 3KP5A 4AVPA 5LGUA 3KZYA 1STZA 3VEPA 4ASNA 3GFJA 1TQPA 2WV0A 2Z9OA 2FXAA 4PZJA 4CO8A 3KZZA 1YG2A 4I02A 4U0VA 2LSOA 2CO5A 3MEXA 3KFWX 1SFEA 4UV9A 4N9IA 3FM3A 4ENNA 2XAGA 2QQ9A 2FEZA 2OBPA 3WTSC 3RI4A 1LEBA 3U2RA 3OOPA 1F5TA 1H0MA 4LG0A 1P2FA 3ML6A 2F5EA 2HWVA 2DK8A 1R1TA 2HEOA 3FXUA 2H09A 1FYLA 1CF7B 4ON0A 3DXJF 2HTJA 4ENKA 3KP6A 4ENMA 2HQRA 3ZMSA 3B73A 4Y15A 2P5VA 1BI0A 5E1ZB 3IRQA 4XBFA 5L3EA 1IXCA 1V3FA 2P5KA 4KT5C 3IC7A 4HW0A 3WU0A 3K1MA 3E6CC 4A12A 2KKOA 2QYOA 2YX7A 2LKPA 4M6XA 5H20A 1RIOH 2EFNA 2Z3YA 5JI6A 2KJCA 2BGCA 3F21A 2HDCA 3F22A 1P4AA 2GA1A 2OZ6A 2VBXA 3AAFA 1E17A 5LEKA 1FOKA 2DPUA 5EEHA 5D5VB 4OOIA 4EJTA 4AWXB 4F7ZA 2BBYA 3JAMK 2GA2A 2M87A 1ZN2A 5DCMB 4NB5A 5LHIA 5CVUA 2HFHA 2O0YA 3KP3A 2P5LC 1KU7A 1SMYF 3GZ5A 2ETHA 3T5XA 5LGNA 2VT2A 3ABTA 4GGGA 1HW1A 3SZTA 4KNYA 1L3LA 4AIKA 2PI0A 5FO5A 4ETSA 3NQOA 1Z91A 1U8RA 4IHTA 2K02A 4L9VA 1RUNA 2VT3A 3SQNA 2P6TA 4NQWA 5ILSA 4WCGA 4A0ZA 3RPQA 3JTHA 1R23A 2G9WA 1ONVA 2K4JA 2ESHA 2CW0F 3GX4X 5ED4A 2A3SA 3T8RA 3J7AO 1MJBA 2MLGA 2XAJA 2R3SA 3FXRA 4EQQA 4BHBA 1HSTA 2JT1A 1OYYA 1H9GA 2BEOA 2Q2EA 3ZMDA 5ICEA 2FBIA 2F5DA 1P6RA 2QUFA 4WK8F 2OZUA 5FFZA 3ULQB 1BIAA 1MDMB 1Y0UA 3BJAA 2QLZA 3SZPA 3QP5A 1W5SA 5ICGA 2JRTA 2ZXJA 5DUIA 4B09A 2WTEA 4LLNA 4BHCA 1OMIA 4OIRF 1YS6A 1MDMA 1Z05A 1ZG5A 5ICFA 3EETA 2EFOA 4IVNA 3GF2A 2VBZA 4GCVA 5IT3A 2FQ3A 1G3WA 1FX7A 4UVBA 4MQVA 4KMFA 5BQTA 3QAHA 2EWNA 1ZG1A 3F72A 1SFUA 2UXNA 4P55A 1ZRDA 1HXDA 3N97A 5CJ9A 3O6BB 2OA4A 2IW5A 2XVCA 3RKXA 3WTUC 4DQ2A 3IKVA 3D5LA 4YG2F 5E8IA 2RGVA 1MJ9A 2VODA 1KU2A 2DO7A 3V4GA 4L5JA 1SD7A 1MJAA 4QWQA 1SFXA 3FF5A 1O3RA 5K5RA 5E18F 2MBFA 2QZ8A 2M1BA 2V1DA 4I98B 2HS5A 1LVAA 1HQCA 4Q48A 3K1NA 1U2WA 3EUHA 3ECHA 1D3YA 3GFMA 2IP2A 4GYGA 3K1PA 1CF7A 4I09A 3DEUA 3MQ0A 4EM2A 1YLFA 4MEXF 4OIOF 5LRRA 3E5QA 4BYYA 3ZMUA 2ZFWA 3JSPA 2DTRA 4HQEA 3BPVA 1REPC 2VONA 5AIPA 5D6FA 4G94A 3I5UA 3KCCA 2E1CA 4IJAA 3TOAA 4LJZF 3RJPA 1HW5A 1I27A 2XV4S 1P92A 3K69A 3MWMA 5F6FA 1FT9A 3T8TA 2RN7A 2F5FA 3GYHX 1H9TA 3GFIA 4JK1X 2EFQA 3WG9A 2ZCWA 2YU3A 2J5PA 5HLHA 2JPCA 1T39A 5E20A 3FM5A 2O03A 1LDJA 1FP2A 3H3ZA 4WF2A 4KYWA 1YW7A 3C3WA 4R1HA 2AXLA 4BXUA 1YFHA 4LB6B 4N9HA 3F8CA 4RGUA 4A5NA 4P5OA 1XB4A 4UV8A 2MLKA 3RIRA 1S8NA 3E6DA 1K78B 2P6SA 1USSA 1FNNA 4K2EA 4HF0A 4EGYA 1MGTA 1IRGA 5K5OA 5AIQA 1I6XA 3WTXC 1Z6RA 4M74A 1FWZA 4ENJA 5HOOA 4HBLA 2QQAA 4RB2C 3KLNA 1IF1A 2UZKA 2VOOA 2STWA 4M9ZA 4NHJA 1B4AA 4OU0A 2FU4A 5FGMA 4RS8A 2STTA 1IZ1A 1S7AA 4ZYHA 2V1UA 1W7PA 3HUGA 1D8JA 2HTSA 2H27A 5A2QZ 1R22A 2KIUA 3E5XA 1YIOA 3COAC 2L02A 4MTDA 3M9AA 4I7HA 3I64A 2DFIA 5ILUA 4HX7A 4FHTA 4L0ZB 1DUXC 4OMZA 1I1SA 5J6XA 2GAUA 5TRDA 1ZHFA 1ZAOA 2W84A 1QBJA 4EJVA 1XGSA 1RNLA 5JR3A 1OYWA 3E97A 2FOKA 4CXFA 2FBHA 1LNWA 1FBQA 3T0YA 5L3FA 2W57A 2B0LA 3P7NA 2D2WA 3WTWC 1TBXA 5HVQC 3WTTC 4Q5SF 1HKTA 5FD5A 4CHUA 2JTVA 4M71A 3LQRA 4FX4A 2G7UA 2DQLA 5KK1A 1XCVA 3RKWA 4BQAA 2KIMA 4HLXA 1HSJA 1ON2A 1EH6A 3QU3A 3GZ6A 1ZGAA 1TW3A 2A61A 1ODDA 1O7FA 2EV0A 4I0BA 4LLLA 4GYIA 1XSDA 1J75A 1O3TA 3BJOA 3HSRA 4LFUA 1QNTA 3ZMVA 4PCQA 2LDUA 3L09A 2UWMA 1G3SA 2H6CA 4M9SA 5FLXK 2VBWA 2NYXA 2W85A 4HX4A 3HYIA 2A07F 5CVRA 5H6QA 1FBUA 4O6JA 1FPQA 3FX3A 4PGHA 1BI2A 5BOXA 2FMYA 3MZHA 2IT0A 3R61A 2GXBA 3KP7A 2Z5UA 3WTVC 5DEQA 3E6BA 2EV5A 4Q4ZF 3LA2A 1J7KA 4G7HF 2V6CA 1AWCA 4YFKF 3HRUA 2VC0A 1XGMA 1TW2A 2D1VA 1ZLJA 5DD4A 4RAZA 1K78A 1K79A 3I58A 2E7WA 2PG4A 3WGGA 4UHTA 4G6DA 1G6NA 3SXYA 4AD9A 1IN8A 2VE9A 1EH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1D A;  3J81 K;  2ZBK A;  1QPM A;  4E70 A;  3H3U A;  1TQM A;  3QOP A;  4KIB A;  2V1X A;  1JXS A;  1J59 A;  1YO5 C;  3KET A;  2ZKZ A;  4UUV A;  3R60 A;  2NNN A;  3IHU A;  3NEU A;  1KA8 A;  1F1Z A;  5HS9 A;  5LHG A;  2EA2 A;  1WSU A;  2EK5 A;  3J81 Z;  1T6S A;  3BJ6 A;  2PEX A;  4WX9 A;  2J5O A;  1UHW A;  4YFX F;  4ZZL A;  3TDU C;  3J80 Z;  2QBY B;  1F4K A;  2VXZ A;  4ZYG A;  4EM1 A;  1ON1 A;  1I5Z A;  3MAJ A;  2ESN A;  4G7Z F;  2O61 A;  1BN5 A;  3V8L A;  3F8B A;  1T98 A;  2MA3 A;  1IN7 A;  2DT5 A;  2FBK A;  1LDK B;  2L01 A;  5E1W A;  1AOY A;  4FT8 A;  1DP7 P;  1B9N A;  2OQG A;  3RPU A;  4EJW A;  3GEZ A;  1SD6 A;  5HLG A;  3WTY C;  2LF8 A;  2ZME A;  5CVI A;  3EYI A;  1RZ4 A;  2EFP A;  3ELK A;  4UXN A;  3BP8 A;  1SD4 A;  4D0P A;  2ZME B;  2QQB A;  4G6Q A;  5J8F A;  3RYR A;  2W25 A;  2Q0O A;  3F8N A;  3K9T A;  1P4W A;  4MEY F;  3BY6 A;  1MKM A;  4WWC A;  3LQQ A;  3QU6 A;  3HOT A;  1XMA A;  1LQ1 A;  5HDN A;  1XDS A;  1FY7 A;  2XAF A;  4S05 A;  1BBY A;  1KYW A;  3O2P E;  1U78 A;  4ZZD A;  2YSR A;  3TQN A;  1FLI A;  3F23 A;  2W24 A;  1UCR A;  1Z9C A;  4I0A A;  3QPT A;  4HLY A;  2F5C A;  3HOS A;  4GXO A;  1KGS A;  2RV8 A;  3R4K A;  4CZZ A;  2O6G E;  2HOE A;  2HR3 A;  3JSO A;  4RGS A;  4KIF A;  2K86 A;  3GFL A;  1JE8 A;  1MZB A;  1K6O A;  1SD5 A;  2RKH A;  5FB2 A;  1XGO A;  2VBY A;  3GLX A;  3IRR A;  5JHU A;  1R36 A;  2IA1 A;  3HTU A;  5LRS A;  2JSC A;  2K27 A;  3P9I A;  2MC3 A;  3I54 A;  2X4H A;  2QBY A;  2OU2 A;  2DBB A;  1FBS A;  5L3G A;  4U0Y A;  5HLI A;  2R7F A;  5BPI A;  1SAX A;  1A04 A;  2ELH A;  4XLN F;  4RGR A;  4U0W A;  4RGX A;  1IUY A;  1IXR C;  3CUQ A;  3GXO A;  2ZNZ A;  2JZY A;  1IW7 F;  1QZY A;  4EM0 B;  3CUQ C;  4MHG A;  4HF2 A;  2P8T A;  3QPH A;  3VFZ A;  3M1E A;  4HA8 A;  2E7X A;  2R7D A;  4UVA A;  4KA4 A;  1G3T A;  1T2K A;  1HKS A;  2XAS A;  2LNB A;  5BMZ A;  1FYK A;  1FC3 A;  3HRM A;  2DK5 A;  2L4M A;  1S29 A;  4RB3 C;  3EDP A;  3ABU A;  1XN7 A;  1ZG3 A;  2M5W A;  1U3E M;  5D4R A;  3REO A;  4KIG A;  5LHH A;  1DDN A;  4UNO A;  3RKY A;  2FA5 A;  1U5T A;  2BYV E;  3WU1 B;  2G7H A;  3GW2 A;  4A5M A;  1XSX A;  3H92 A;  4YII A;  1ZYR F;  3LFK A;  3ZPL A;  1VTN C;  2L54 A;  1S3J A;  3V7S A;  4FX0 A;  2L4A A;  1FSH A;  1QQI A;  1ZRE A;  4EJO A;  3P9K A;  2M30 A;  2GXG A;  3BDD A;  1Z6T A;  1TTY A;  2PQ8 A;  1XSV A;  1O3Q A;  1IXS B;  1IAW A;  2GIV A;  3QP6 A;  2RVC A;  2YX4 A;  5KVR A;  4KDP A;  3T1B A;  3JW4 A;  3P9C A;  1O7L A;  5ICC A;  3ZQ7 A;  3ZN1 A;  4JQF A;  5JVT A;  1RUO A;  1R7J A;  4ESJ A;  1BI1 A;  4KMU X;  3R6S A;  1KQ9 A;  3D0S A;  4YIF A;  1O3S A;  1R5H A;  2O8X A;  3Q9S A;  3GVA A;  4O5V A;  2EFW A;  1UB9 A;  4TV7 A;  1IN4 A;  2ZJ2 A;  5LGT A;  1W5T A;  3HIF A;  5IT9 K;  4UVC A;  3FXQ A;  4HX8 A;  1B6A A;  2IJL A;  2A69 F;  3LA3 A;  1YW8 A;  5DUK A;  1R00 A;  2K7L A;  3DP7 A;  2E1N A;  1Q1H A;  4XSX F;  4U88 A;  3R0J A;  2RQP A;  4MTE A;  3DFG A;  5LLQ A;  5JFR A;  3CO7 C;  3DPT A;  3E3V A;  4U7D A;  3BOQ A;  3S2W A;  2IRF G;  4PGG A;  1OYI A;  2CG4 A;  1R1U A;  2LF7 A;  5EEG A;  3WOD F;  3TGN A;  1B59 A;  2FML A;  2HKX A;  3LAP A;  5HDG A;  4IPA A;  5FLX Z;  2QEN A;  2QWW A;  3QRF F;  4OIN F;  1JGS A;  5E17 F;  1GXQ A;  5ERI A;  1PDN C;  2A6E F;  3C7J A;  1WI9 A;  1XDU A;  3WGI A;  3GO5 A;  4OMY A;  4L5I A;  2ZO4 A;  4WXC A;  5DCM A;  5D5U B;  2V9V A;  1XMK A;  2XGX A;  5D5X B;  4L18 B;  1LB2 A;  3IL2 A;  1OKR A;  1KQ0 A;  1LEA A;  3I53 A;  4IRH A;  3SHF A;  5AON A;  2PBI A;  3TO7 A;  3WTZ A;  1S7O A;  1PP7 U;  3I4P A;  4P9F A;  3OV8 A;  2Z99 A;  4ZH4 F;  4A2U A;  3FZV A;  2EA4 A;  3C18 A;  3ISP A;  5DV5 A;  1UST A;  2H6B A;  1KYZ A;  3J80 K;  5CYV A;  1W7P D;  4CIC A;  1BC7 C;  3MFK A;  4IXA A;  2YR2 A;  2P4W A;  4MGR A;  1WRJ A;  3FWE A;  4A6D A;  4L9T A;  4BAY A;  4R79 A;  4HDV A;  1FZP B;  3RDI A;  3Q5F A;  2CFX A;  4JBA A;  4RB1 A;  3FMS A;  1S6L A;  4LK1 F;  3HTS B;  2CSO A;  2BE5 F;  1XD7 A;  3LA7 A;  1OR7 A;  2H94 A;  3HRS A;  4BNC A;  5D6E A;  3LAJ A;  1WKM A;  1PUE E;  2GQQ A;  1PP8 F;  2ZNY A;  4BHP A;  3FMR A;  2XUB A;  4QLC U;  2IPQ X;  1FYM A;  4I2O A;  2XHK A;  1YTY A;  3CJN A;  1GXP A;  2PFB A;  2EV6 A;  3F3X A;  5L3B A;  4DNC A;  2CQK A;  4KUM A;  3ECO A;  2FNP A;  2M8E A;  2XKO A;  4M73 A;  1CGP A;  4CYD A;  2GWR A;  4HAM A;  3NRV A;  1JHH A;  4CGZ A;  4G8X A;  2OQR A;  2D45 A;  5D8K B;  2WC2 A;  5CVV A;  1FP1 D;  2CWE A;  5F64 A;  3LWF A;  2HYF A;  5FD6 A;  3DPL C;  5DCF A;  5LEJ A;  2EB7 A;  2UXX A;  3I0T A;  2CYY A;  3V8J A;  1WQ2 A;  2VC1 A;  4ESF A;  2X0L A;  2RNJ A;  5E1X A;  2AS5 F;  1YQA A;  3M8F A;  1XGN A;  2COM A;  2PMH A;  4G9Y A;  4XLP F;  4KN4 X;  4S04 A;  2FNA A;  4XRF A;  3O3K A;  2DQR A;  5CVJ A;  4ZYE A;  1JHF A;  5BS6 A;  2P7V B;  3G3Z A;  2EJR A;  4LMY A;  3VOE A;  4M9X A;  1IN5 A;  1J9I A;  1D5V A;  1KQ8 A;  4EV0 A;  2MH9 A;  4G7O F;  4IRG A;  1TNS A;  3F8F A;  3HHH A;  3F6V A;  4Y13 A;  3PQJ A;  4LGW A;  2HKO A;  3HSE A;  1IRF A;  1X3U A;  3Q9V A;  3GWZ A;  5BPD A;  1D8K A;  1P4X A;  5HS7 A;  3KEO A;  3B02 A;  4AIH A;  1KU3 A;  2QVO A;  4KFC A;  3U1D A;  2HZT A;  3TDZ C;  2RDP A;  2PMU A;  3M7G A;  2XAH A;  1C0W A;  1TLH B;  4EJU A;  5J8C A;  4EVI A;  2HYG D;  4LD5 A;  4CDG A;  3F8M A;  3R0A A;  3DF8 A;  3FMQ A;  4L9J A;  3IKT A;  1QO0 D;  1FSE A;  4PDK A;  1YW9 A;  1Z1D A;  5ILV A;  4I01 A;  5D5W B;  3LST A;  2C6Y A;  2VOP A;  1L0O C;  4WXH A;  1R5G A;  3VOD A;  4HF1 A;  3W6J B;  1NHA A;  2V79 A;  2XRO A;  1K7A A;  4HDU A;  5L3C A;  1BC8 C;  2Y0M A;  3HRT A;  4EMS A;  2ISZ A;  2GZW A;  2OD5 A;  2TDX A;  4A6E A;  5D4S A;  2O3F A;  2A5Y B;  1UFM A;  4MQ9 F;  4OIQ F;  4WXD A;  2ISY A;  3V8K A;  1U5T B;  1BJA A;  4GO1 A;  1BI3 A;  3L9F A;  2NS0 A;  4HQM A;  1WWX A;  3WE3 A;  2A68 F;  4AIJ A;  1HBX G;  3MZY A;  1ZLK A;  2QM3 A;  1ZH5 A;  4M6Y A;  5F1R A;  5K1Y A;  5TJJ A;  2HQN A;  5HS8 A;  1ZAR A;  2DU9 A;  2KRF A;  2FRH A;  2NRA C;  3U9G A;  4ZYD A;  2XAQ A;  4Z2Y A;  5H6R A;  5A2Q K;  2OAZ A;  1O57 A;  3V7C A;  2A6H F;  3KP2 A;  3KEQ A;  3HSF A;  4N0B A;  3VB2 A;  3CUQ B;  4HZF A;  2DAO A;  2VN2 A;  5L3D A;  3KP4 A;  2DW4 A;  4H0E A;  1E2X A;  1ZRF A;  3I59 A;  2NAZ A;  3BZ6 A;  4IHS A;  2XIG A;  3IWF A;  3L7W A;  2Q8K A;  1EV7 A;  3CO6 C;  4HOB A;  3I71 A;  4KIC A;  4HV5 A;  4LG0 B;  4LLG F;  1U5T C;  1ZRC A;  2PN6 A;  3I59 B;  3BRO A;  3DV8 A;  4HV6 A;  4A0X A;  1B1B A;  1TNT A;  3ZP5 A;  1DPU A;  1OPC A;  4Q47 A;  1MD0 A;  2ADU A;  3V7R A;  3ERE D;  2KIF A;  3JTG A;  1RI7 A;  1DPR A;  4A0Y A;  5DDG A;  3L00 A;  3IWZ A;  3TKY A;  2RC4 A;  3WGH A;  2MH2 A;  1BIB A;  3CLO A;  5DD8 A;  3ZMT A;  1U6G A;  4XSZ F;  1G4D A;  2M45 A;  4RB0 A;  2P7C B;  1J5Y A;  2IA2 A;  3L2C A;  2FSW A;  4OIP F;  3ROU A;  2DI3 A;  3PQK A;  2D1H A;  3TOB A;  1SMT A;  3K0L A;  4P96 A;  2CGP A;  3DKW A;  1T0F A;  3TO9 A;  2DLL A;  4RAY A;  3PFI A;  2FF4 A;  5CLS A;  3BPX A;  3ZN0 A;  1R58 A;  3CTA A;  2IA0 A;  3MCZ A;  3SFZ A;  1W4M A;  2F2E A;  3N4M A;  3BWG A;  4O3M A;  2DPD A;  5LBQ A;  5IT9 Z;  3K2Z A;  4IF4 A;  4KN7 X;  3HHG A;  4MNU A;  2BV6 A;  3M8E A;  5FFX A;  2L3D A;  1EH8 A;  1TQI A;  3CDH A;  1QZZ A;  3GUD A;  1V4R A;  4HYE A;  2VE8 A;  2KJB A;  1B9M A;  4Y17 A;  1I1G A;  5DYM A;  4L9N A;  3JAM Z;  1LJ9 A;  3G73 A;  2ACJ A;  3KE2 A;  2K4B A;  2XRN A;  2FE3 A;  2Y75 A;  3RYP A;  4L0Y B;  1R1V A;  4U7B A;  3CUO A;  1YS7 A;  4R8H A;  1GVJ A;  2Y48 A;  1YYV A;  2NNY A;  4B8X A;  1HKQ A;  1LDD A;  3F6O A;  4P9U A;  1HW2 A;  2HGC A;  3W6K B;  1ZGJ A;  4YFN F;  1UHM A;  2IVM A;  2XKP A;  2PJP A;  4M72 A;  2PLY A;  3EYY A;  3TO6 A;  2Z33 A;  4LK0 F;  5K5Q A;  1GHC A;  3EQL F;  1F9N A;  1G3Y A;  3E6M A;  1J0R A;  4BH9 A;  4EGZ A;  3FHZ A;  3ZMZ A;  3DQV C;  1T38 A;  1XCB A;  3RTR A;  1ULY A;  6PAX A;  5E8G A;  2JPB A;  5HDK A;  3WE2 A;  3E5U A;  1BOA A;  1QGP A;  3KLO A;  5D8L B;  4ESB A;  1IN6 A;  4LB5 A;  1J2X A;  1Z7U A;  1BM9 A;  2WWY A;  1W7P B;  4IRI A;  2YPR A;  2MD5 A;  1KU9 A;  3KP5 A;  4AVP A;  5LGU A;  3KZY A;  1STZ A;  3VEP A;  4ASN A;  3GFJ A;  1TQP A;  2WV0 A;  2Z9O A;  2FXA A;  4PZJ A;  4CO8 A;  3KZZ A;  1YG2 A;  4I02 A;  4U0V A;  2LSO A;  2CO5 A;  3MEX A;  3KFW X;  1SFE A;  4UV9 A;  4N9I A;  3FM3 A;  4ENN A;  2XAG A;  2QQ9 A;  2FEZ A;  2OBP A;  3WTS C;  3RI4 A;  1LEB A;  3U2R A;  3OOP A;  1F5T A;  1H0M A;  4LG0 A;  1P2F A;  3ML6 A;  2F5E A;  2HWV A;  2DK8 A;  1R1T A;  2HEO A;  3FXU A;  2H09 A;  1FYL A;  1CF7 B;  4ON0 A;  3DXJ F;  2HTJ A;  4ENK A;  3KP6 A;  4ENM A;  2HQR A;  3ZMS A;  3B73 A;  4Y15 A;  2P5V A;  1BI0 A;  5E1Z B;  3IRQ A;  4XBF A;  5L3E A;  1IXC A;  1V3F A;  2P5K A;  4KT5 C;  3IC7 A;  4HW0 A;  3WU0 A;  3K1M A;  3E6C C;  4A12 A;  2KKO A;  2QYO A;  2YX7 A;  2LKP A;  4M6X A;  5H20 A;  1RIO H;  2EFN A;  2Z3Y A;  5JI6 A;  2KJC A;  2BGC A;  3F21 A;  2HDC A;  3F22 A;  1P4A A;  2GA1 A;  2OZ6 A;  2VBX A;  3AAF A;  1E17 A;  5LEK A;  1FOK A;  2DPU A;  5EEH A;  5D5V B;  4OOI A;  4EJT A;  4AWX B;  4F7Z A;  2BBY A;  3JAM K;  2GA2 A;  2M87 A;  1ZN2 A;  5DCM B;  4NB5 A;  5LHI A;  5CVU A;  2HFH A;  2O0Y A;  3KP3 A;  2P5L C;  1KU7 A;  1SMY F;  3GZ5 A;  2ETH A;  3T5X A;  5LGN A;  2VT2 A;  3ABT A;  4GGG A;  1HW1 A;  3SZT A;  4KNY A;  1L3L A;  4AIK A;  2PI0 A;  5FO5 A;  4ETS A;  3NQO A;  1Z91 A;  1U8R A;  4IHT A;  2K02 A;  4L9V A;  1RUN A;  2VT3 A;  3SQN A;  2P6T A;  4NQW A;  5ILS A;  4WCG A;  4A0Z A;  3RPQ A;  3JTH A;  1R23 A;  2G9W A;  1ONV A;  2K4J A;  2ESH A;  2CW0 F;  3GX4 X;  5ED4 A;  2A3S A;  3T8R A;  3J7A O;  1MJB A;  2MLG A;  2XAJ A;  2R3S A;  3FXR A;  4EQQ A;  4BHB A;  1HST A;  2JT1 A;  1OYY A;  1H9G A;  2BEO A;  2Q2E A;  3ZMD A;  5ICE A;  2FBI A;  2F5D A;  1P6R A;  2QUF A;  4WK8 F;  2OZU A;  5FFZ A;  3ULQ B;  1BIA A;  1MDM B;  1Y0U A;  3BJA A;  2QLZ A;  3SZP A;  3QP5 A;  1W5S A;  5ICG A;  2JRT A;  2ZXJ A;  5DUI A;  4B09 A;  2WTE A;  4LLN A;  4BHC A;  1OMI A;  4OIR F;  1YS6 A;  1MDM A;  1Z05 A;  1ZG5 A;  5ICF A;  3EET A;  2EFO A;  4IVN A;  3GF2 A;  2VBZ A;  4GCV A;  5IT3 A;  2FQ3 A;  1G3W A;  1FX7 A;  4UVB A;  4MQV A;  4KMF A;  5BQT A;  3QAH A;  2EWN A;  1ZG1 A;  3F72 A;  1SFU A;  2UXN A;  4P55 A;  1ZRD A;  1HXD A;  3N97 A;  5CJ9 A;  3O6B B;  2OA4 A;  2IW5 A;  2XVC A;  3RKX A;  3WTU C;  4DQ2 A;  3IKV A;  3D5L A;  4YG2 F;  5E8I A;  2RGV A;  1MJ9 A;  2VOD A;  1KU2 A;  2DO7 A;  3V4G A;  4L5J A;  1SD7 A;  1MJA A;  4QWQ A;  1SFX A;  3FF5 A;  1O3R A;  5K5R A;  5E18 F;  2MBF A;  2QZ8 A;  2M1B A;  2V1D A;  4I98 B;  2HS5 A;  1LVA A;  1HQC A;  4Q48 A;  3K1N A;  1U2W A;  3EUH A;  3ECH A;  1D3Y A;  3GFM A;  2IP2 A;  4GYG A;  3K1P A;  1CF7 A;  4I09 A;  3DEU A;  3MQ0 A;  4EM2 A;  1YLF A;  4MEX F;  4OIO F;  5LRR A;  3E5Q A;  4BYY A;  3ZMU A;  2ZFW A;  3JSP A;  2DTR A;  4HQE A;  3BPV A;  1REP C;  2VON A;  5AIP A;  5D6F A;  4G94 A;  3I5U A;  3KCC A;  2E1C A;  4IJA A;  3TOA A;  4LJZ F;  3RJP A;  1HW5 A;  1I27 A;  2XV4 S;  1P92 A;  3K69 A;  3MWM A;  5F6F A;  1FT9 A;  3T8T A;  2RN7 A;  2F5F A;  3GYH X;  1H9T A;  3GFI A;  4JK1 X;  2EFQ A;  3WG9 A;  2ZCW A;  2YU3 A;  2J5P A;  5HLH A;  2JPC A;  1T39 A;  5E20 A;  3FM5 A;  2O03 A;  1LDJ A;  1FP2 A;  3H3Z A;  4WF2 A;  4KYW A;  1YW7 A;  3C3W A;  4R1H A;  2AXL A;  4BXU A;  1YFH A;  4LB6 B;  4N9H A;  3F8C A;  4RGU A;  4A5N A;  4P5O A;  1XB4 A;  4UV8 A;  2MLK A;  3RIR A;  1S8N A;  3E6D A;  1K78 B;  2P6S A;  1USS A;  1FNN A;  4K2E A;  4HF0 A;  4EGY A;  1MGT A;  1IRG A;  5K5O A;  5AIQ A;  1I6X A;  3WTX C;  1Z6R A;  4M74 A;  1FWZ A;  4ENJ A;  5HOO A;  4HBL A;  2QQA A;  4RB2 C;  3KLN A;  1IF1 A;  2UZK A;  2VOO A;  2STW A;  4M9Z A;  4NHJ A;  1B4A A;  4OU0 A;  2FU4 A;  5FGM A;  4RS8 A;  2STT A;  1IZ1 A;  1S7A A;  4ZYH A;  2V1U A;  1W7P A;  3HUG A;  1D8J A;  2HTS A;  2H27 A;  5A2Q Z;  1R22 A;  2KIU A;  3E5X A;  1YIO A;  3COA C;  2L02 A;  4MTD A;  3M9A A;  4I7H A;  3I64 A;  2DFI A;  5ILU A;  4HX7 A;  4FHT A;  4L0Z B;  1DUX C;  4OMZ A;  1I1S A;  5J6X A;  2GAU A;  5TRD A;  1ZHF A;  1ZAO A;  2W84 A;  1QBJ A;  4EJV A;  1XGS A;  1RNL A;  5JR3 A;  1OYW A;  3E97 A;  2FOK A;  4CXF A;  2FBH A;  1LNW A;  1FBQ A;  3T0Y A;  5L3F A;  2W57 A;  2B0L A;  3P7N A;  2D2W A;  3WTW C;  1TBX A;  5HVQ C;  3WTT C;  4Q5S F;  1HKT A;  5FD5 A;  4CHU A;  2JTV A;  4M71 A;  3LQR A;  4FX4 A;  2G7U A;  2DQL A;  5KK1 A;  1XCV A;  3RKW A;  4BQA A;  2KIM A;  4HLX A;  1HSJ A;  1ON2 A;  1EH6 A;  3QU3 A;  3GZ6 A;  1ZGA A;  1TW3 A;  2A61 A;  1ODD A;  1O7F A;  2EV0 A;  4I0B A;  4LLL A;  4GYI A;  1XSD A;  1J75 A;  1O3T A;  3BJO A;  3HSR A;  4LFU A;  1QNT A;  3ZMV A;  4PCQ A;  2LDU A;  3L09 A;  2UWM A;  1G3S A;  2H6C A;  4M9S A;  5FLX K;  2VBW A;  2NYX A;  2W85 A;  4HX4 A;  3HYI A;  2A07 F;  5CVR A;  5H6Q A;  1FBU A;  4O6J A;  1FPQ A;  3FX3 A;  4PGH A;  1BI2 A;  5BOX A;  2FMY A;  3MZH A;  2IT0 A;  3R61 A;  2GXB A;  3KP7 A;  2Z5U A;  3WTV C;  5DEQ A;  3E6B A;  2EV5 A;  4Q4Z F;  3LA2 A;  1J7K A;  4G7H F;  2V6C A;  1AWC A;  4YFK F;  3HRU A;  2VC0 A;  1XGM A;  1TW2 A;  2D1V A;  1ZLJ A;  5DD4 A;  4RAZ A;  1K78 A;  1K79 A;  3I58 A;  2E7W A;  2PG4 A;  3WGG A;  4UHT A;  4G6D A;  1G6N A;  3SXY A;  4AD9 A;  1IN8 A;  2VE9 A;  1EH7 A; 
#chains in the Genus database with same CATH topology
 3C1D A;  2QSF X;  3J81 K;  4IQJ A;  2ZBK A;  5EG0 A;  1X1D A;  1QPM A;  4E70 A;  3H3U A;  3D1N I;  1TQM A;  3QOP A;  3U21 A;  1ENH A;  1JT0 A;  1FOX A;  2ZME C;  4KIB A;  1OJL A;  2V1X A;  3CF2 A;  2X48 A;  4UUS B;  3HB9 A;  1JXS A;  1A31 A;  1J59 A;  1YO5 C;  3HGY A;  2VJ4 A;  3KET A;  2ZKZ A;  4UUV A;  2IS6 A;  5EGO B;  2DA6 A;  3R60 A;  2NNN A;  2KL4 A;  3A02 A;  3IHU A;  3NEU A;  1UZC A;  4XM3 A;  1ACI A;  3NAR A;  4M3E A;  1MBJ A;  3BTC A;  4I76 A;  1KA8 A;  1F1Z A;  5HS9 A;  3HUG B;  5LHG A;  2EA2 A;  1WSU A;  2EK5 A;  2O7O A;  2ZJR F;  3J81 Z;  1T6S A;  5KAI C;  3BJ6 A;  2PEX A;  4WX9 A;  2J5O A;  2BY2 A;  4OAY A;  1UHW A;  4YFX F;  4BDZ A;  5LD2 C;  2O8K A;  3S32 A;  4ZZL A;  3TDU C;  1VFC A;  5B5E C;  1BR2 A;  3J80 Z;  2QBY B;  1F4K A;  3OYF A;  2VXZ A;  4ZDL A;  4ZYG A;  3H5R A;  4EM1 A;  1ON1 A;  1I5Z A;  3MAJ A;  2ESN A;  3PIP F;  4G7Z F;  2E35 A;  2K9S A;  2YUS A;  1T95 A;  2O61 A;  1BN5 A;  2E36 A;  3V8L A;  3F8B A;  1T98 A;  2MA3 A;  1NG7 A;  5FRO A;  1IN7 A;  2DT5 A;  4IQ4 A;  3CCU I;  3H9Q A;  2MFZ A;  1MSF C;  3K4K A;  2FBK A;  3K10 A;  1LDK B;  2L01 A;  5E1W A;  2EIK H;  1YE9 A;  1AOY A;  4FT8 A;  5J1R A;  1B9N A;  2ZXW H;  1PUF B;  2OQG A;  1DP7 P;  4F92 B;  3RPU A;  1OQY A;  4EJW A;  3K4B A;  3GEZ A;  2UUZ A;  5JVG F;  1SD6 A;  1M1E B;  5HLG A;  1ETV A;  3L2Q A;  1JKP C;  3WTY C;  2LF8 A;  5GAD J;  4Y52 J;  2ZME A;  4XLC A;  5CVI A;  1GDT A;  3EYI A;  2A6T A;  1HC8 A;  2LFB A;  3PO2 J;  1RZ4 A;  4C9Y A;  2EFP A;  3ELK A;  1TWF J;  1UG2 A;  5M3F J;  1RR8 C;  4UXN A;  3IV5 A;  1S9H A;  4CUG A;  3BP8 A;  2WY8 Q;  3VYR B;  1IRX A;  1SD4 A;  4D0P A;  3S14 J;  2ZME B;  4P1W A;  2QQB A;  2VAS A;  4G6Q A;  5CQG A;  1OCO H;  3ZQH A;  5J8F A;  2OCE A;  2W25 A;  4NC8 A;  3RYR A;  1B8I B;  1FOW A;  2Q0O A;  3F8N A;  3K9T A;  4FCY A;  3DKX A;  1P4W A;  4MEY F;  2HQA A;  3BY6 A;  5CKT A;  1MKM A;  2L7K A;  4WWC A;  3LQQ A;  3QU6 A;  2JJ7 A;  3HOT A;  2V9K A;  1XMA A;  1LQ1 A;  5HDN A;  1XDS A;  3LSG A;  2GBY A;  2QKM B;  4D7N A;  1FY7 A;  2BW3 B;  1VQ5 I;  4KT6 A;  2XAF A;  2X9D A;  2I10 A;  4S05 A;  3JRF A;  3M1C A;  1BBY A;  1KYW A;  1OCC H;  2W48 A;  3O2P E;  3BZK A;  1U78 A;  4GFB A;  1X2M A;  1WVR A;  2DDB A;  2HVS A;  2VQH A;  2YSR A;  4ZZD A;  1Y1V J;  3TQN A;  1FLI A;  3BTJ A;  4E7I A;  2M4K A;  3F23 A;  4DW6 A;  2E19 A;  2W24 A;  1ETK A;  1X58 A;  3HOY J;  4BE2 A;  4PFP A;  1UCR A;  3S8P A;  2WAQ N;  1K4S A;  1QVT A;  1DU6 A;  1Z9C A;  3MKZ A;  4I0A A;  3QPT A;  4HLY A;  2F5C A;  2IEK A;  3HOS A;  2ZXI A;  4GXO A;  3VWB A;  1KGS A;  2RV8 A;  3R4K A;  2FUG 2;  5K7H A;  4CZZ A;  2O6G E;  1QRY A;  2HOE A;  2HR3 A;  1I50 J;  3JSO A;  4RGS A;  4KIF A;  1HDP A;  4X6A J;  2K86 A;  1D1A A;  1GLN A;  1Y56 A;  4ITV A;  3GFL A;  5M5W J;  1JE8 A;  1MZB A;  1K6O A;  4D1Q A;  3HPH A;  5FKM A;  3ZQC A;  1SD5 A;  2RKH A;  2NVX J;  5DM6 F;  1XC5 A;  1VQM I;  5FB2 A;  4N4N B;  5K7Z A;  1N78 A;  1XGO A;  2VBY A;  3WHB A;  3GLX A;  3IRR A;  1QHH D;  3DLA A;  4A69 C;  5JHU A;  2ZJP F;  1R36 A;  1AU7 A;  2IA1 A;  3HTU A;  5LRS A;  2JSC A;  2K27 A;  3P9I A;  4IHY A;  3QPL A;  2MC3 A;  3I54 A;  2X4H A;  2QBY A;  2OU2 A;  2DBB A;  1T0F C;  1FBS A;  5L3G A;  3CDL A;  3TW7 A;  4A3J J;  3TP3 A;  2EIN H;  3QOE A;  4BBS J;  4IZZ A;  1BOB A;  1UHS A;  3EUK L;  1GUU A;  4U0Y A;  1QZE A;  2WV1 A;  2R7F A;  5HLI A;  3TBI A;  5BPI A;  1SAX A;  2XB0 X;  3GZN B;  1A04 A;  4DGW B;  2ELH A;  4XLN F;  1VQK I;  4RGR A;  4G6T B;  4U0W A;  4RGX A;  2NVQ J;  1DP3 A;  1IUY A;  1IXR C;  3ASN H;  3CUQ A;  3ZOB A;  2DYR H;  2PMZ A;  3GXO A;  2ZNZ A;  2JZY A;  1IW7 F;  2E34 A;  1MMA A;  1QZY A;  1HDD C;  3RPU D;  1YJW I;  1S5L C;  2XDV A;  4EM0 B;  3BR3 A;  4Y3O A;  2CQ7 A;  3CUQ C;  4BJ5 C;  4MHG A;  4HF2 A;  2MAB A;  2P8T A;  3QPH A;  3VFZ A;  3M1E A;  4HA8 A;  4A3K J;  2JVH A;  2E7X A;  4I6Z A;  3K70 D;  2H8R A;  2QSH X;  2R7D A;  3MKW B;  4UVA A;  4KA4 A;  1G3T A;  4HNV A;  3CJR B;  1T2K A;  1FJL A;  1HKS A;  2XAS A;  1VQ9 I;  1ZKG A;  1BR4 A;  1ZTR A;  2Q1Z B;  2LNB A;  3DEE A;  5BMZ A;  3KEY A;  1R4N B;  2JA8 J;  4II3 A;  4FAS D;  4UUT A;  2D5V A;  3CCV I;  1FYK A;  4XK4 A;  1FC3 A;  3HRM A;  2DK5 A;  3SFI A;  2L4M A;  1S29 A;  4RB3 C;  3EDP A;  3ABU A;  1XN7 A;  1ZG3 A;  2M5W A;  1U3E M;  5D4R A;  5IP6 A;  3REO A;  3CLQ A;  4KIG A;  1XMX A;  5LHH A;  1DDN A;  2EQR A;  4UNO A;  2VJ5 A;  1HF0 A;  3L2W A;  1D5Y A;  4BXF A;  4AM3 A;  3HZJ A;  3RKY A;  2FA5 A;  2R7T A;  5HOD A;  1U5T A;  2EIJ H;  2BYV E;  3WU1 B;  4LIU A;  2G7H A;  1VF9 A;  2E1M C;  5GAE J;  3ZQQ A;  3GW2 A;  4A5M A;  1BA5 A;  2L9V A;  1PUF A;  1XSX A;  2E1M B;  2K40 A;  3JRI A;  4A3D J;  3H92 A;  2M9H A;  4YII A;  1ZYR F;  3LFK A;  4NDL A;  3ZPL A;  1VTN C;  2L54 A;  1S3J A;  3V7S A;  2QCO A;  4FX0 A;  4JYK A;  2L4A A;  4BJ6 C;  4C3I J;  1FSH A;  2R7O A;  1QQI A;  4F3Q A;  1ZRE A;  2HQ5 A;  2CV2 A;  3EUA A;  2E5Z A;  4EJO A;  3P9K A;  4D5F A;  3PNY A;  1I6H J;  4AC0 A;  3OIO A;  3BR1 A;  5J1Y A;  3GBG A;  2M30 A;  2ZB9 A;  2XC7 A;  2GXG A;  2RQQ A;  2VQC A;  3W2V A;  3BDD A;  1WZ2 A;  1Z6T A;  1TTY A;  3ABL H;  5IPA A;  2PJR B;  2PQ8 A;  1XSV A;  2EZH A;  1O3Q A;  3SEQ A;  1IXS B;  3OSG A;  2GIV A;  1IAW A;  2HDD A;  1OCR H;  3QP6 A;  2I8D A;  4QPO A;  2YX4 A;  2RVC A;  4RBO A;  2M3A A;  3F0C A;  5KVR A;  3T1B A;  4KDP A;  3HXL A;  3JW4 A;  3P9C A;  1O7L A;  4DOZ A;  1Z77 A;  5FLM J;  5ICC A;  3ZQ7 A;  3ZN1 A;  4JQF A;  2JA2 A;  4XKC A;  5JVT A;  3O8H A;  2W00 A;  3OYC A;  1RUO A;  1R7J A;  3VSL A;  1BI1 A;  1PVE A;  4KMU X;  3R6S A;  1KQ9 A;  3D0S A;  4ABZ A;  4YIF A;  2NS7 A;  4ESJ A;  1O3S A;  4EEF G;  1UMQ A;  3J7Y J;  1R5H A;  2O8X A;  2LD5 A;  3Q9S A;  3GVA A;  4CCJ A;  4UUS A;  3CJT B;  4O5V A;  2EFW A;  2NVU B;  4Y33 A;  4C2M J;  4PUS A;  1YJN I;  3CCQ I;  1UB9 A;  1TZL A;  4TV7 A;  5LFA A;  1IN4 A;  2LOO A;  3RKQ A;  2ZJ2 A;  5LGT A;  1W5T A;  3FKI J;  3HIF A;  3G4S I;  3TW6 A;  1YX3 A;  2Z1D A;  5IT9 K;  4UVC A;  3ZRG A;  3FXQ A;  4HX8 A;  1B6A A;  2IJL A;  3BR2 A;  4PJJ A;  2A69 F;  1TT5 B;  3LA3 A;  1YW8 A;  5DUK A;  1R00 A;  2DCE A;  2K7L A;  3DP7 A;  2BOL A;  2E1N A;  1Q1H A;  3DWL E;  4XSX F;  4U88 A;  3R0J A;  2AQF A;  2RQP A;  4MTE A;  3DFG A;  5C4X J;  5LLQ A;  5JFR A;  3CO7 C;  4KJZ A;  3CC7 I;  1YRN B;  2DDA A;  3DPT A;  4BBR J;  3E3V A;  2HXO A;  4ZJZ A;  4U7D A;  3BOQ A;  3S2W A;  3CES A;  1XPX A;  5HNH A;  3ZGK A;  2XAU A;  3BG9 A;  5F0C A;  2IRF G;  4PGG A;  1OYI A;  2CG4 A;  4DZJ A;  4A3E J;  3H35 A;  1R1U A;  2LF7 A;  5EEG A;  5EEA A;  3CMM A;  1DQU A;  3WOD F;  4IX7 A;  3W2A A;  3TGN A;  4D5C A;  1NTC A;  4Y7N J;  2LC2 A;  1B59 A;  1VQN I;  2FML A;  3RZD J;  1R4M B;  2HKX A;  3LAP A;  3JCU C;  5HDG A;  4IPA A;  5FLX Z;  3D5S C;  1NH3 A;  2QEN A;  2GOM A;  2QWW A;  3QRF F;  2K9N A;  4OIN F;  3QPS A;  3MMY B;  3PNV A;  1ETX A;  1JGS A;  5EYR A;  5E17 F;  3PO3 J;  1X3Z B;  2NXN B;  1A6Q A;  2P0W A;  2X51 A;  1E0E A;  2DMP A;  1GXQ A;  5ERI A;  3GTQ J;  1PDN C;  4XR6 A;  2A6E F;  1ETO A;  3KYL A;  2DJN A;  3C7J A;  1WI9 A;  1XDU A;  3AG1 H;  3WGI A;  2M8G X;  3GO5 A;  4OMY A;  3H0G J;  3Q0W A;  2M4G A;  4L5I A;  2ZO4 A;  4WXC A;  5DCM A;  5D5U B;  2V9V A;  1XMK A;  2AXT C;  2XGX A;  5D5X B;  4HSR A;  1ZR2 A;  2NVT J;  1OFC X;  4L18 B;  3HM5 A;  1LB2 A;  2MW8 A;  3Q3S A;  4J00 A;  2DMN A;  3PUF A;  1WJA A;  3IL2 A;  1OKR A;  1PYV A;  1KQ0 A;  1LEA A;  1BW5 A;  3I53 A;  4C30 A;  5J47 A;  4IRH A;  2CH0 A;  3HG9 A;  1VQ8 I;  3SHF A;  5AON A;  2PBI A;  3TO7 A;  3BZC A;  2KP6 A;  3WTZ A;  1S7O A;  1PP7 U;  1R5I D;  4CCO A;  1APL C;  3I4P A;  4P9F A;  3OV8 A;  2CJJ A;  2Z99 A;  2VKV A;  4HEA 2;  4ZH4 F;  3HPG A;  2JA6 J;  4A2U A;  2CW8 A;  2EA4 A;  3FZV A;  3FBN B;  3C18 A;  3ISP A;  2R7R A;  5DV5 A;  1UST A;  2H6B A;  1KYZ A;  3J80 K;  1A36 A;  1W1W E;  1W7P D;  5CYV A;  2GXA A;  2OJE D;  4CIC A;  1R49 A;  2A5W A;  1BC7 C;  1UEL B;  3HBL A;  2CS3 A;  3MFK A;  4IXA A;  4E7Z A;  2YR2 A;  2R5Y A;  2DOE A;  2P4W A;  4MGR A;  1WRJ A;  3FWE A;  3PJR A;  4A6D A;  4DZP A;  1QVU A;  2DMT A;  4L9T A;  4BAY A;  4R79 A;  4HDV A;  3PNT A;  4S0H B;  1LFU P;  1G8X A;  1FZP B;  3RDI A;  2F6C A;  1MBK A;  3Q5F A;  1P7I A;  2CFX A;  3OYM A;  4JBA A;  4RB1 A;  1NK3 P;  1AA7 A;  3AL0 C;  3FMS A;  1S6L A;  4LK1 F;  3HTS B;  2CSO A;  2W7N A;  1X4O A;  2DA5 A;  2BE5 F;  2L5Q A;  2LKS A;  1XD7 A;  1JUM A;  5E79 C;  3LA7 A;  1OR7 A;  3MVP A;  2H94 A;  5IP9 J;  3HRS A;  2BVM A;  5EZG A;  4BNC A;  1VND A;  2B63 J;  5D6E A;  3OMY A;  4C3J J;  5C4J J;  1WKM A;  3LAJ A;  2OC6 A;  2GQQ A;  1NK2 P;  1PUE E;  1PP8 F;  5DS9 A;  2ZNY A;  4BHP A;  1G2H A;  1E3P A;  3FMR A;  2XUB A;  2PX9 A;  3H5A A;  4BEH A;  2GIZ A;  4DBQ A;  4QLC U;  1EA3 A;  4H4K C;  1IC8 A;  2HPM A;  2V4J C;  2IPQ X;  4V19 K;  1FYM A;  2CRG A;  2R4G A;  3C2B A;  3BG6 A;  3B6A A;  4I2O A;  2XHK A;  1YTY A;  3CJN A;  1GXP A;  3AKZ A;  3A1Y A;  3BR5 A;  2PFB A;  2EV6 A;  1RES A;  1Y6I A;  2XF7 A;  3F3X A;  3K4C A;  5L3B A;  1Z3Y A;  1MMG A;  3CP8 A;  3BG3 A;  4HG2 A;  4DNC A;  2CQK A;  4KUM A;  3ECO A;  2FNP A;  2VPR A;  2M8E A;  2XKO A;  4M73 A;  1CGP A;  4CYD A;  2GWR A;  3HKZ N;  2LK2 A;  2Q2E B;  2JUG A;  1U0J A;  1Z0X A;  2VKD A;  4HAM A;  3NRV A;  2DTZ A;  1JHH A;  2RRE A;  4G8X A;  4CGZ A;  2WAE A;  2OQR A;  3LSJ A;  1MBG A;  3JRH A;  2Z2S B;  2D45 A;  3FXM A;  5D8K B;  2WC2 A;  1FTZ A;  5CVV A;  3SDG A;  1FP1 D;  1JTY A;  3OYA A;  3CCY A;  2CWE A;  3BCA A;  5F64 A;  3S93 A;  5IY5 H;  4A93 J;  2IGO A;  3ESW B;  1K61 A;  3LWF A;  1JKO C;  2HYF A;  5FD6 A;  3DPL C;  2CV1 A;  5DCF A;  5LEJ A;  2EBI A;  2EB7 A;  3M8J A;  2UXX A;  4L5E A;  3I0T A;  2ELJ A;  1MBF A;  2CYY A;  3V8J A;  2ELK A;  3BTI A;  1WQ2 A;  2VC1 A;  4ESF A;  2X0L A;  2RNJ A;  5E1X A;  2AS5 F;  1YQA A;  3K7A J;  3M8F A;  1XGN A;  4BE0 A;  5EZH A;  2WB1 A;  2COM A;  2PMH A;  4G9Y A;  4XLP F;  5J4V A;  2R93 J;  4KN4 X;  3MKY B;  4S04 A;  1SFO J;  1E3H A;  2FNA A;  4XRF A;  1KZH A;  2EH3 A;  3O3K A;  5E3L A;  4EAT A;  2DQR A;  4M3B A;  5CVJ A;  2VJJ A;  4ZYE A;  1WJB A;  2XSD C;  4RLQ A;  1JHF A;  5BS6 A;  2P7V B;  5IYD J;  3G3Z A;  2XGD A;  1AHD P;  2EJR A;  2TRT A;  4LMY A;  1OLT A;  3VOE A;  1RR7 A;  3G1M A;  2YU9 J;  4YIR X;  4M9X A;  1IN5 A;  2BY1 A;  1J9I A;  1U8B A;  2CMP A;  1D5V A;  3FHN A;  1KQ8 A;  4EV0 A;  2VJI A;  3PIO F;  4E4H A;  1F43 A;  2MH9 A;  4G7O F;  4IRG A;  1TNS A;  3F8F A;  4A3M J;  3HHH A;  1VQO I;  3F6V A;  1OIS A;  4BEH B;  4Y13 A;  2B7E A;  3PQJ A;  2W82 A;  4LGW A;  3OYJ A;  3K4L A;  2I5U A;  4X0G A;  2Z16 A;  2NOJ B;  1D0X A;  2HKO A;  2LRD A;  3HSE A;  1IRF A;  1X3U A;  3K70 C;  3Q9V A;  3GWZ A;  3JRC A;  5BPD A;  1D8K A;  1P4X A;  1SAU A;  5HS7 A;  2HPI A;  1LFB A;  3EPZ A;  3KEO A;  2X85 A;  3DU5 A;  4AID A;  1CQT A;  3B02 A;  3DTK A;  1MBH A;  1Y1W J;  4AIH A;  2WBM A;  1W36 D;  1ITY A;  1KU3 A;  2ME6 A;  2PMZ N;  3OL4 A;  2QVO A;  2ZSH B;  3QQA A;  5IOY A;  4KFC A;  4UY8 I;  2Y69 H;  4F55 A;  4DBR A;  2K3P A;  2ID6 A;  3U1D A;  5J40 A;  2HZT A;  5J1U A;  3TDZ C;  2RDP A;  2QA4 I;  2X6O A;  2KDO A;  2EZK A;  2PMU A;  3M7G A;  4U87 A;  2DYS H;  2L9N A;  3AFH A;  2XAH A;  4IL6 C;  1C0W A;  2KZV A;  1TLH B;  4XRM A;  4EJU A;  5J8C A;  1T33 A;  4EVI A;  2H8W A;  2HYG D;  1ZR4 A;  4BQN A;  4LD5 A;  3E7L A;  3LSI A;  4CDG A;  3F8M A;  3R0A A;  3DF8 A;  2OCC H;  3FMQ A;  2L7M P;  4PSX A;  1S7E A;  4L9J A;  1T56 A;  3IKT A;  1RKW A;  1QO0 D;  1FSE A;  1Y0N A;  4PDK A;  3GME A;  1YW9 A;  2WAF A;  4XLH A;  1Z1D A;  5ILV A;  4I01 A;  2HOT A;  4V2G A;  4GDF A;  2LVS A;  5D5W B;  3LST A;  1QPI A;  2C6Y A;  2VOP A;  1L0O C;  4WXH A;  1R5G A;  2CUJ A;  3VOD A;  4HF1 A;  3W6J B;  1NHA A;  2V79 A;  3JRB A;  3DKY A;  2XRO A;  2XF6 A;  4JOM A;  1K7A A;  2DT7 B;  4HDU A;  1GV2 A;  2CQN A;  3O8G A;  4CH7 A;  2HZD A;  3ERM A;  5L3C A;  3H9G A;  2M34 A;  2W1O A;  1BC8 C;  4IO9 F;  1QU3 A;  1WPK A;  2Y0M A;  1B8I A;  3S2D J;  3HRT A;  4EMS A;  3QYF A;  1D1B A;  2ISZ A;  2GZW A;  2OD5 A;  2TDX A;  4FET A;  4A6E A;  5D4S A;  4B4C A;  2O3F A;  3CCJ I;  1LE8 B;  3A4C A;  1JUP A;  2A5Y B;  1TWG J;  2V6E A;  1UFM A;  4XNF A;  4MQ9 F;  4OIQ F;  4WXD A;  2ISY A;  3V8K A;  1U5T B;  1BJA A;  4GO1 A;  1JUS A;  1BI3 A;  3L9F A;  1R71 A;  2R5Z A;  2NS0 A;  3X2Q H;  2LY9 A;  1W5C C;  4HQM A;  2LBF A;  2JK3 A;  3W2W A;  5GTI C;  1WWX A;  3S15 J;  2K85 A;  3WE3 A;  4PSW A;  4XOR A;  1X19 A;  2LTP A;  4AYB N;  2A68 F;  4AIJ A;  1HBX G;  3MZY A;  2CUF A;  2AQE A;  2KQR A;  1ZLK A;  5F0H A;  2QM3 A;  1ZH5 A;  4M6Y A;  2R7V A;  5F1R A;  1X3W B;  3OYK A;  3PFY A;  5K1Y A;  3LFU A;  5TJJ A;  1K4T A;  2HQN A;  4PJ0 C;  2VXD A;  4B44 A;  2HU9 A;  5HS8 A;  1ZAR A;  4UB6 C;  2DU9 A;  2KRF A;  2FRH A;  2E2I J;  2Y9Y A;  3S1R J;  3W6V A;  3HOZ J;  3ABK H;  2NRA C;  3OYG A;  4E7J A;  3TED A;  3U9G A;  4XOT A;  4ZYD A;  2XAQ A;  3QWL A;  4Z2Y A;  5H6R A;  5A2Q K;  1YIJ I;  2IAI A;  2OAZ A;  1O57 A;  3V7C A;  2A6H F;  3KP2 A;  4DYQ A;  3KEQ A;  3HSF A;  4N0B A;  3VB2 A;  2DXI A;  3L1P A;  3CUQ B;  3CF5 F;  4ZDO A;  2TCT A;  1YJ9 I;  4MFE A;  4HZF A;  2DAO A;  2VN2 A;  5L3D A;  3KP4 A;  2DW4 A;  4H0E A;  4NNJ A;  1E2X A;  1A6I A;  4BQO A;  3BG5 A;  1ZRF A;  2F4O B;  5FKL A;  1W0T A;  3FDY A;  3G71 I;  3I59 A;  2NAZ A;  3BZ6 A;  2DT6 A;  4IHS A;  2XIG A;  3IWF A;  2XGE A;  3L7W A;  3HOW J;  3HKZ A;  4GRI A;  2LP0 A;  2LY1 A;  2Q8K A;  2IGM A;  2AO9 A;  1EV7 A;  4G12 A;  1LUJ B;  3CO6 C;  4HOB A;  1V55 H;  3I71 A;  4KIC A;  2EZI A;  4HV5 A;  2F4I A;  4LLG F;  4LG0 B;  1ZK8 A;  2E2J J;  1V5E A;  1U5T C;  2O5R A;  1ZRC A;  2PN6 A;  3D5R C;  3I59 B;  3BRO A;  3DV8 A;  4HV6 A;  4A0X A;  2FOW A;  2BY0 A;  3PSI A;  1B1B A;  1BW6 A;  1MND A;  2XPU A;  1TNT A;  4LIT A;  4CZC A;  3ZP5 A;  2BXY A;  4BGD A;  2KMU A;  1DPU A;  1OPC A;  2DOF A;  4Q47 A;  1IV8 A;  5E3O A;  3CCM I;  5M5Y J;  2JQ7 A;  3BG7 A;  1MD0 A;  2ADU A;  3WG7 H;  2VQL A;  2VL8 A;  3V7R A;  1SEU A;  3ERE D;  2KIF A;  3PM1 A;  3JTG A;  3VYU B;  1RI7 A;  3QOD A;  1DPR A;  4A0Y A;  4W97 A;  5JHF A;  4HNT A;  4PJM A;  5DDG A;  2Y31 A;  3K4M A;  5FJ8 J;  2JMW A;  3L00 A;  3IWZ A;  3ONQ A;  2GOX B;  3TKY A;  2RC4 A;  3WGH A;  2AHQ A;  1IUF A;  1R6R A;  2MH2 A;  3UNG C;  1BIB A;  2R7X A;  3CLO A;  2RNG A;  3CME I;  5DD8 A;  2BY3 A;  3ZMT A;  2R5Y B;  3HJE A;  2ZJQ F;  1U6G A;  4XSZ F;  1XX5 A;  1G4D A;  3Q0U A;  2M45 A;  4RB0 A;  5K7F A;  3S3N A;  3ASO H;  4E6K G;  2P7C B;  1J5Y A;  3S1N J;  2IA2 A;  4BKX A;  3L2C A;  1QHG A;  2FSW A;  3KZI C;  4OIP F;  3ROU A;  1FIA A;  3SZG A;  4X1E A;  2DI3 A;  3PQK A;  1XTA A;  3RQI A;  4BL0 B;  4CA0 A;  2E1O A;  4HNU A;  1YIT I;  3JRD A;  2D1H A;  2EZL A;  3TOB A;  3ZQF A;  2HNH A;  4FE4 A;  1SMT A;  3K0L A;  1JT6 A;  2DFE A;  4P96 A;  2CGP A;  3DKW A;  1T0F A;  1SFK A;  3TO9 A;  1YRN A;  2DLL A;  4RAY A;  1ETY A;  3PFI A;  4JX6 A;  2E71 A;  5GAH J;  2FF4 A;  2XSJ C;  3BPX A;  5CLS A;  1MNM C;  4ZDP A;  2HVQ A;  4M3F A;  3H3V K;  3ZN0 A;  2KHM A;  1R58 A;  3CTA A;  2IA0 A;  1UAA A;  3MCZ A;  3SFZ A;  2X1E A;  2R7U A;  1W4M A;  1N25 A;  4FTH A;  1VQ4 I;  2F2E A;  3N4M A;  2ZFU A;  4V2F A;  3BWG A;  3I9V 2;  3TL4 X;  3H0D A;  2L9R A;  3L2V A;  2F48 A;  4O3M A;  2DPD A;  3AL0 B;  2BHY A;  1OCZ H;  3A0B C;  5FKN A;  3IAS 2;  5LBQ A;  5IT9 Z;  5DM7 F;  1PJR A;  3K2Z A;  4IF4 A;  1POG A;  9ANT A;  4KN7 X;  3G1L A;  3HHG A;  2BV6 A;  4MNU A;  4QSH A;  4QTR A;  3M8E A;  5FFX A;  4KIS A;  2L3D A;  1EH8 A;  4PFO A;  1TQI A;  3CDH A;  1QZZ A;  2LLK A;  4AU7 A;  1DGW Y;  1SVO A;  1FEX A;  3GUD A;  3H9J A;  1V4R A;  5C3E J;  4HYE A;  2VE8 A;  4RM3 A;  1VQ7 I;  2KJB A;  1B9M A;  4Y17 A;  2R7S A;  1I1G A;  4N4O B;  5DYM A;  3HOU J;  4L9N A;  3JAM Z;  1LJ9 A;  3G73 A;  4BS9 A;  4BY1 J;  2ACJ A;  3I4M J;  3KE2 A;  2K4B A;  2XRN A;  2FE3 A;  2X6X A;  2Y75 A;  3RYP A;  4L0Y B;  1HCR A;  2MG4 A;  2X1D A;  1R1V A;  1G59 A;  4U7B A;  1XG1 A;  2HYJ A;  2K9L A;  3KYC B;  3OYN A;  4MLO A;  3M4O J;  3C2H A;  2L7Z A;  4B43 A;  2M0M A;  2O9L A;  3CUO A;  1YS7 A;  2L0K A;  3CMY A;  4A3C J;  3JRG A;  4R8H A;  3V42 A;  2JUC A;  1GVJ A;  3TP0 A;  4BU2 A;  2Y48 A;  1YYV A;  2HVR A;  5H2F C;  2NNY A;  4M3G A;  2LH9 A;  3GLL A;  4B8X A;  2LRE A;  2IGN A;  1HKQ A;  1LDD A;  3F6O A;  4P9U A;  1T8I A;  2P81 A;  1J09 A;  1HW2 A;  3FXO A;  3DCF A;  3N05 A;  2HGC A;  3S2H J;  4Y4R A;  3KPH A;  3W6K B;  3OYI A;  3SJM A;  1FMW A;  1ZGJ A;  4YFN F;  3FKJ A;  1UHM A;  4RA2 A;  2WY7 Q;  1B72 B;  2IVM A;  1RRJ A;  2XKP A;  2PJP A;  3J7Z I;  4IHV A;  4M72 A;  1N75 A;  2PLY A;  3EYY A;  3TO6 A;  2Z33 A;  5DTD A;  1IRZ A;  4LK0 F;  5EGO A;  5K5Q A;  2FQ4 A;  2FJ1 A;  1GHC A;  3EQL F;  1F9N A;  1G3Y A;  1X1C A;  2EPF A;  3E6M A;  4RM2 A;  1J0R A;  5FRM A;  4BH9 A;  4EGZ A;  1H88 C;  3HL2 A;  3FHZ A;  3ZMZ A;  3DQV C;  2IS4 A;  1XCB A;  1T38 A;  3RTR A;  1ULY A;  4IEJ A;  4CYC A;  3DBL B;  4D9J A;  6PAX A;  5FKK A;  5E8G A;  4YEL A;  2JPB A;  5HDK A;  3ZCO A;  3WE2 A;  3E5U A;  1BOA A;  1U9N A;  2MGQ A;  4J01 A;  2B9S A;  1QGP A;  2F4M B;  5B3S H;  3DPU A;  3KLO A;  5D8L B;  4ESB A;  1IN6 A;  1WHU A;  3DLL F;  4LB5 A;  1J2X A;  3I3L A;  1XS9 A;  1Z7U A;  2DA7 A;  4F52 A;  5GPC A;  1BM9 A;  4PK4 A;  2WWY A;  3CC4 I;  3A2K A;  3PUB A;  1W7P B;  4IRI A;  1BJZ A;  2YPR A;  1TWC J;  2MD5 A;  1EH7 A;  2LYC A;  1KU9 A;  1TC3 C;  2ICW G;  3KP5 A;  4AVP A;  1FIP A;  4XN0 A;  2DMU A;  5LGU A;  3A01 B;  1IGN A;  2K3F A;  3KZY A;  1STZ A;  3S16 J;  2DN0 A;  3VEP A;  4ASN A;  3GFJ A;  3TMO A;  3SDB A;  3OYE A;  1AKH A;  1TQP A;  3OWT A;  2WV0 A;  2Z9O A;  2VPL A;  3U1K A;  4XIC A;  2FXA A;  1EKE A;  4PZJ A;  3NWT A;  4XKV A;  4CO8 A;  2IGK A;  3RZO J;  3LOC A;  4BDY A;  2EIM H;  4AUX A;  3CCL I;  3KZZ A;  2R7Z J;  2UV1 A;  1MMS A;  1YG2 A;  4I02 A;  5FKO A;  4RAG A;  5F08 A;  4U0V A;  2LSO A;  2CO5 A;  2DA2 A;  3KFW X;  3MEX A;  3PL8 A;  3RSN A;  1SFE A;  3I56 I;  4UV9 A;  2IS2 A;  2V1N A;  4N9I A;  3FM3 A;  4BUP A;  2QEX I;  4BY7 J;  4ENN A;  2XAG A;  3CD6 I;  5GP9 A;  2QQ9 A;  2FEZ A;  2OBP A;  3WTS C;  3RI4 A;  4OWR B;  3K2A A;  2BHZ A;  1LEB A;  3U2R A;  3OOP A;  2M0C A;  1F5T A;  2WA0 A;  1H0M A;  4LG0 A;  4NC6 A;  1P2F A;  1WH5 A;  2YS9 A;  3ML6 A;  2NS8 A;  5IOZ A;  2F5E A;  3OYB A;  1WFX A;  2HWV A;  4JX4 A;  2DK8 A;  1R1T A;  2HEO A;  3FXU A;  1GT0 C;  2QKL B;  2H09 A;  3F9K A;  1FYL A;  3H36 A;  1CF7 B;  4ON0 A;  1JTX A;  3DXJ F;  1JJ8 C;  2OTL I;  2HTJ A;  4ENK A;  3KP6 A;  1Q1V A;  4ENM A;  2H1K A;  2MSY A;  2BXZ A;  2HQR A;  3ZMS A;  3B73 A;  4Y15 A;  2P5V A;  2CUZ A;  1BI0 A;  5E1Z B;  3IRQ A;  2E5N A;  2LBF B;  4XBF A;  2V26 A;  5L3E A;  1IXC A;  1V3F A;  2P5K A;  1X1B A;  3IC7 A;  4KT5 C;  3OOU A;  4M3D A;  4A3G J;  3Q0V A;  4HW0 A;  4NC7 A;  2JWT A;  2GM4 A;  3WU0 A;  4DYC A;  3K1M A;  3E6C C;  4A12 A;  3K4J A;  2KKO A;  2QYO A;  1MH3 A;  2KT0 A;  3OYL A;  1FTT A;  2YX7 A;  2OF7 A;  2XPW A;  4A3B J;  3JRE A;  1I3A A;  3M3Y J;  4A3L J;  2LKP A;  2ZXH A;  5IYB J;  3JRA A;  4M6X A;  5H20 A;  1RIO H;  2EFN A;  2Z3Y A;  5JI6 A;  2KJC A;  2BGC A;  3E0J B;  4RAF A;  3G1O A;  3F21 A;  1FOY A;  2HDC A;  2COB A;  1B72 A;  4M6V A;  1ORK A;  3F22 A;  1P4A A;  2GA1 A;  2OZ6 A;  4MIM A;  5BNG A;  2JA7 J;  2VBX A;  3GTO J;  4XRS A;  3AAF A;  1E3O C;  3HOV J;  1E17 A;  5LEK A;  3OL3 A;  1FOK A;  3OR1 C;  2DPU A;  5EEH A;  4RMN A;  1X2N A;  1RPW A;  3VYS B;  5D5V B;  4OOI A;  4EJT A;  3HEF A;  4AWX B;  4CCM A;  4F7Z A;  2BBY A;  3JAM K;  2GA2 A;  2RAE A;  2M87 A;  1ZN2 A;  2X6Y A;  5B1B H;  5DCM B;  3S1M J;  3NAU A;  2HDW A;  4NB5 A;  1WH7 A;  3CQZ J;  5CVU A;  3VDX A;  5LHI A;  3L2R A;  5FLV A;  2HFH A;  2O0Y A;  3KP3 A;  5GTH C;  2P5L C;  1KU7 A;  1SMY F;  3GZ5 A;  2VUM J;  3BC8 A;  2FD5 A;  1LE8 A;  2ETH A;  2GLO A;  5KCM A;  3IP4 B;  3S3O A;  2MC4 A;  2E60 A;  3T5X A;  5LGN A;  2VT2 A;  1DGR M;  1I39 A;  3ABT A;  4GGG A;  5KNL A;  3GTL J;  2BZT A;  1HW1 A;  3MD2 A;  1Z3X A;  3SZT A;  4KNY A;  1L3L A;  4AIK A;  4HPQ A;  2PI0 A;  5FO5 A;  4QPQ A;  1F36 A;  1IG7 A;  4ETS A;  3NQO A;  2DFH A;  2L9S A;  1Z91 A;  1U8R A;  4IHT A;  5M3M J;  2L7F P;  2K02 A;  1LPQ A;  1JGG A;  4L9V A;  1RUN A;  2VT3 A;  2V7F A;  1AKH B;  4LG3 A;  3SQN A;  2P6T A;  4NQW A;  5ILS A;  1FMV A;  1YOV B;  3OS2 A;  4BQQ A;  1YI2 I;  4B48 A;  2H1L A;  2BW3 A;  3AG2 H;  3GTG J;  4WCG A;  4B3X A;  4A0Z A;  3JTH A;  3RPQ A;  1R23 A;  1SC7 A;  4BAC A;  2G9W A;  1ONV A;  2DFF A;  2K4J A;  2ESH A;  2M7A A;  3CJQ B;  2BVL A;  2CW0 F;  4B3A A;  5HLT A;  3GX4 X;  5ED4 A;  1D0Y A;  3LL7 A;  2A3S A;  1K83 J;  3T8R A;  3J7A O;  5J3L A;  1MJB A;  2MLG A;  4II2 A;  2WAQ A;  2XAJ A;  3FXR A;  2R3S A;  4EQQ A;  1U9O A;  2FX0 A;  3HGG A;  4BHB A;  1HST A;  4XLF A;  5B1A H;  4XID A;  4KIT B;  1JKR C;  1X1P A;  2JT1 A;  3HDD A;  5TGT A;  4IOA F;  1OYY A;  2XRL A;  3WU2 C;  5HNF A;  1WCM J;  3OR2 C;  2M7B A;  3FXJ A;  3NWS A;  2KDZ A;  1H89 C;  1H9G A;  2BEO A;  2Q2E A;  3ZMD A;  1RC9 A;  1T08 B;  5ICE A;  2FBI A;  2CQX A;  1MBE A;  2F5D A;  3CC2 I;  1P6R A;  2QUF A;  4NUB A;  1EJ9 A;  4WK8 F;  1X4P A;  4XLA A;  4F91 B;  4B1R A;  2OZU A;  2QSG X;  5FFZ A;  3ULQ B;  1BIA A;  2HOS A;  1MDM B;  1GV5 A;  1Y0U A;  3ZXS A;  3BJA A;  2QLZ A;  3DBH B;  1ETW A;  3SZP A;  3QP5 A;  1W5S A;  3IUO A;  5F04 A;  4E7S A;  5GAG J;  5ICG A;  3OSF A;  1OR7 C;  2JRT A;  1JI8 A;  2ZXJ A;  5DUI A;  1WI3 A;  4B09 A;  1YX5 A;  2WTE A;  1WGX A;  4LLN A;  3LSK A;  4BHC A;  1OMI A;  2VIX A;  4OIR F;  3P5J A;  1YS6 A;  4I99 C;  4JX5 A;  1MDM A;  1Z05 A;  1ZG5 A;  2Y2Z A;  5ICF A;  3IH3 A;  3EET A;  3GCM A;  3L2U A;  5JLX A;  2R0Q C;  2EFO A;  1TT0 A;  4IVN A;  3GF2 A;  2VBZ A;  4GCV A;  5IT3 A;  2FQ3 A;  4IKF A;  1G3W A;  3ZQG A;  2E2H J;  1FX7 A;  4UVB A;  1YHQ I;  2OPT A;  4MQV A;  2CUE A;  1Y39 A;  2DA1 A;  5BQT A;  4KMF A;  1IV6 A;  2DOD A;  3CMA I;  3ZQL A;  3QAH A;  5KHD A;  2EWN A;  1ZG1 A;  3F72 A;  4E7H A;  3JR9 A;  3KYD B;  1K6Y A;  3RCO A;  1SFU A;  2PJR A;  2UXN A;  2JSP A;  4P55 A;  4XL9 A;  3UKG A;  1IJW C;  1Z21 A;  1ZRD A;  4B47 A;  3KX2 A;  1HXD A;  3HOX J;  4XON A;  5F27 A;  4CCK A;  5J4Y A;  3N97 A;  2XGC A;  5CJ9 A;  3O6B B;  2OA4 A;  2IW5 A;  2XVC A;  3RKX A;  3WTU C;  4DQ2 A;  3IKV A;  3D5L A;  4YG2 F;  5E8I A;  2RGV A;  1MJ9 A;  2VOD A;  1KU2 A;  2DO7 A;  3LMM A;  1ERD A;  1D1C A;  3V4G A;  4L5J A;  1H8A C;  1HOM A;  1SD7 A;  1MJA A;  4QWQ A;  1SFX A;  3FF5 A;  1O3R A;  5K5R A;  2VQG A;  2DJI A;  5E18 F;  2MBF A;  4XOP A;  2QZ8 A;  2V9P A;  2M1B A;  2V1D A;  1TP4 A;  3DTI A;  4I98 B;  2HS5 A;  2MD0 A;  5TIS C;  2OV7 A;  1LVA A;  1HQC A;  4Q48 A;  3K1N A;  3LSR A;  1U2W A;  3EUH A;  3HC7 A;  2L2O A;  3CCE I;  4DYR A;  1I3Q J;  1MSE C;  3ECH A;  3A0H C;  2CQQ A;  1D3Y A;  2DOA A;  3GFM A;  2IP2 A;  4GYG A;  3K1P A;  3CP2 A;  1CF7 A;  1QA6 A;  1A5J A;  4I09 A;  3BCB A;  4NBQ A;  3DEU A;  1W36 C;  3MQ0 A;  4EM2 A;  2LKX A;  1YLF A;  4IOC F;  4MEX F;  4OIO F;  5LRR A;  3E5Q A;  2HI3 A;  4BYY A;  1ZQ3 P;  3ZMU A;  2F5V A;  3BT9 A;  2N8G A;  1ZGW A;  1ETQ A;  2ZFW A;  3JSP A;  5F0F A;  2DTR A;  3ABM H;  4HQE A;  4XKW A;  3BPV A;  1V5F A;  1REP C;  3MKL A;  2VON A;  5AIP A;  5D6F A;  1Z67 A;  4G94 A;  2VI6 A;  3I5U A;  1HLV A;  3AG3 H;  3IAM 2;  3BTL A;  3KCC A;  3VPR A;  3OS1 A;  2E1C A;  4IJA A;  2VB6 A;  3TOA A;  2LR8 A;  1MW7 A;  3A01 A;  4LJZ F;  3SYT A;  3RJP A;  2CU7 A;  2QGU A;  4YEJ A;  1WJC A;  4CCN A;  1HW5 A;  1I27 A;  1VQP I;  3GTK J;  1LKX A;  2XV4 S;  3OY9 A;  3CCS I;  1P92 A;  3K69 A;  4LIV A;  3MWM A;  5F6F A;  2A05 A;  1FT9 A;  3T8T A;  3ZR8 X;  5EG0 B;  2RN7 A;  2F5F A;  3GYH X;  4AYB A;  3GTJ J;  1H9T A;  3GFI A;  4JK1 X;  2EFQ A;  3WG9 A;  1RKT A;  2ZCW A;  2YU3 A;  3E1S A;  2KZG A;  1WJF A;  2J5P A;  5HLH A;  2JPC A;  1O4X A;  2ECB A;  1VZ0 A;  1UJ8 A;  2K9M A;  3WHC A;  1T39 A;  3EUH C;  1JJ6 C;  5E20 A;  3FM5 A;  2O03 A;  4CSW A;  1LDJ A;  1FP2 A;  3H3Z A;  3BQY A;  4ZYA A;  4WF2 A;  4KYW A;  1WJD A;  1YW7 A;  3C3W A;  3LSH A;  2DA4 A;  4R1H A;  2R5Z B;  1S72 I;  1N77 A;  1SVL A;  4AVZ A;  4CCL A;  3S1Q J;  1MH4 A;  4D7M A;  1JKQ C;  2AXL A;  4HRI A;  4BXU A;  1YFH A;  2Y0S A;  2VLA A;  2JN6 A;  2IS1 A;  4LB6 B;  5KAF C;  4N9H A;  3K4N A;  3F8C A;  4RGU A;  4A5N A;  4P5O A;  1XB4 A;  4UV8 A;  2ECC A;  1IDZ A;  1Y8R B;  2MLK A;  4C2T A;  1WJE A;  1S8N A;  3E6D A;  3C2G A;  3RIR A;  1K78 B;  5E3M A;  2P6S A;  4XKB A;  5CQE A;  3CZ6 A;  1USS A;  2X1C A;  3S3M A;  2ID3 A;  1FNN A;  3CDI A;  4K2E A;  5IYC J;  1V5G A;  5EDN A;  5CPR B;  4HF0 A;  4EGY A;  1MGT A;  3LSM A;  3PSF A;  3KIO A;  5K5O A;  1IRG A;  5AIQ A;  1I6X A;  2JVG A;  2Y0S N;  4A3F J;  2IXS A;  1DU0 A;  2KFD A;  4XRS G;  3WTX C;  1Z6R A;  4M74 A;  1FWZ A;  5HOO A;  4ENJ A;  4RLF A;  3ZQI A;  4HBL A;  4XLE A;  2QQA A;  2CW7 A;  4RB2 C;  3GTP J;  3KLN A;  5M5X J;  3OIQ A;  1IF1 A;  2UZK A;  3FXL A;  2VOO A;  2STW A;  4CYC B;  4M9Z A;  4NHJ A;  1B4A A;  5IP7 J;  2R92 J;  2CFO A;  2NOG A;  4DIQ A;  4OU0 A;  4J19 A;  2FU4 A;  4Z6Y A;  2Y9Z A;  5FGM A;  2LG4 A;  4RS8 A;  2STT A;  1SAN A;  3MZ8 A;  1IZ1 A;  4ZTJ A;  3QYB A;  1S7A A;  1MMD A;  2KRH A;  4ZYH A;  1TL8 A;  2JRM A;  1VQ6 I;  2V1U A;  1W7P A;  1TWH J;  5GPA A;  3HUG A;  3LSP A;  1D8J A;  2HTS A;  4XQF A;  1MNE A;  2H27 A;  3G6E I;  5A2Q Z;  1R22 A;  5FRN A;  3SEZ A;  2KIU A;  3E5X A;  1YIO A;  3UR3 C;  3COA C;  2KRC A;  3OYH A;  4DJA A;  2L02 A;  3FIW A;  4MTD A;  3M9A A;  4LOC A;  3I55 I;  3M07 A;  1LVK A;  3DBR B;  4I7H A;  3I64 A;  1VQL I;  2DFI A;  2QF7 A;  5ILU A;  4HX7 A;  4FHT A;  3W3C A;  2LMD A;  4L0Z B;  2MYS A;  1DUX C;  4F93 B;  4OMZ A;  4C3H J;  2CV0 A;  5F1J A;  1I1S A;  5J6X A;  2GAU A;  4JP0 A;  5TRD A;  1ZHF A;  1ZAO A;  2W84 A;  1QBJ A;  1V54 H;  4EJV A;  1XGS A;  1RNL A;  4HST A;  4NQW B;  5JR3 A;  3IH2 A;  1OYW A;  3E97 A;  1ZEL A;  2FOK A;  4CXF A;  1MMN A;  4PJL A;  4YRV A;  1HA8 A;  4IHX A;  2FBH A;  3H1C A;  2WB1 N;  1LNW A;  1OCT C;  1FBQ A;  1GVD A;  2KLO A;  4A3I J;  4UB8 C;  3T0Y A;  2ZSI B;  5L3F A;  1X1A A;  2W57 A;  2LY2 A;  5C44 J;  2B0L A;  3P7N A;  2D2W A;  4W1U A;  1BR1 A;  3WTW C;  1TBX A;  5HVQ C;  3WTT C;  4Q5S F;  2IBD A;  1A35 A;  1UG0 A;  1HKT A;  2QQ8 A;  5FD5 A;  2JA5 J;  2ZC2 A;  1BL0 A;  4CHU A;  2JTV A;  3RQ4 A;  3OYD A;  4BXX J;  4M71 A;  1IO2 A;  4ANJ A;  3LQR A;  2X6W A;  5E3N A;  4FX4 A;  2G7U A;  2DQL A;  5KK1 A;  1XCV A;  3RKW A;  4BQA A;  2KIM A;  3DU6 A;  3MN2 A;  2EIL H;  3FXK A;  4HLX A;  4PJN A;  3CCR I;  1HSJ A;  2KIQ A;  1ON2 A;  1EH6 A;  4IHW A;  3QU3 A;  3S17 J;  3AG4 H;  3GZ6 A;  1ZGA A;  4XN3 A;  1SVM A;  1TW3 A;  2A61 A;  1ODD A;  1O7F A;  2EV0 A;  2K9Q A;  4I0B A;  4LLL A;  4GYI A;  4BJT A;  1XSD A;  1J75 A;  5B66 C;  2Y30 A;  1O3T A;  3BJO A;  3HSR A;  4E7L A;  2NVY J;  4LFU A;  1QNT A;  1IDY A;  3GTM J;  3ZMV A;  1P9Q C;  2OUM A;  3B6C A;  3BQZ A;  4PCQ A;  2LDU A;  3FBI B;  3L09 A;  4XMY A;  3BR0 A;  1MIJ A;  2XF5 A;  2UWM A;  1G3S A;  2H6C A;  2WAD A;  1VI0 A;  4FIS A;  2VBW A;  4M9S A;  3IH4 A;  5FLX K;  1KON A;  3H5N A;  3I4N J;  3BLY A;  4MFD A;  2NYX A;  2R7Q A;  3VSK A;  2W85 A;  4HX4 A;  1Z7L A;  3DTE A;  3LNQ A;  4BE1 A;  3HYI A;  3BR6 A;  1R9T J;  2A07 F;  5CVR A;  2DA3 A;  3DEW A;  1WJ5 A;  5H6Q A;  3A03 A;  1FBU A;  4O6J A;  1FPQ A;  3FX3 A;  4PGH A;  2W4S A;  1BI2 A;  5BOX A;  2FMY A;  4C2U A;  1LFP A;  3MZH A;  2VKH A;  3K6G A;  2R7W A;  1Y8Q B;  3R61 A;  4MO7 A;  2IT0 A;  2GXB A;  3G2B A;  3KP7 A;  2Z5U A;  2KPM A;  2OTJ I;  2DMQ A;  2VKE A;  5DEQ A;  3E6B A;  3WTV C;  2EV5 A;  3FK6 A;  4Q4Z F;  2K5C A;  4RDU A;  3LA2 A;  5EJC A;  3VYT B;  1NG6 A;  4OAZ A;  3J7A Y;  1J7K A;  4G7H F;  2V6C A;  1AWC A;  4YFK F;  3HRU A;  4QIW N;  2VC0 A;  1XGM A;  1TW2 A;  2D1V A;  1ZLJ A;  5DD4 A;  4E7K A;  4RAZ A;  1K78 A;  3OIP A;  1K79 A;  4ZTF A;  2KIS A;  4FQG A;  3I58 A;  5EF6 A;  1W0U A;  1TWA J;  1D0Z A;  2ME0 A;  3FK7 A;  2E7W A;  2HXI A;  4ZC3 A;  1P7J A;  3QYE A;  2PG4 A;  3WGG A;  4UHT A;  2XPV A;  4G6D A;  2HOA A;  1OCP A;  2M2E A;  4FE7 A;  1G6N A;  3SXY A;  3OS0 A;  4AD9 A;  1IN8 A;  1RET A;  5JLW A;  2G0E A;  2VE9 A;  1EF4 A;  3FIS A;  2XB5 A; 
#chains in the Genus database with same CATH homology
 3C1D A;  3J81 K;  2ZBK A;  1QPM A;  4E70 A;  3H3U A;  1TQM A;  3QOP A;  4KIB A;  2V1X A;  1JXS A;  1J59 A;  1YO5 C;  3KET A;  2ZKZ A;  4UUV A;  3R60 A;  2NNN A;  3IHU A;  3NEU A;  1KA8 A;  1F1Z A;  5HS9 A;  5LHG A;  2EA2 A;  1WSU A;  2EK5 A;  3J81 Z;  1T6S A;  3BJ6 A;  2PEX A;  4WX9 A;  2J5O A;  1UHW A;  4YFX F;  4ZZL A;  3TDU C;  3J80 Z;  2QBY B;  1F4K A;  2VXZ A;  4ZYG A;  4EM1 A;  1ON1 A;  1I5Z A;  3MAJ A;  2ESN A;  4G7Z F;  2O61 A;  1BN5 A;  3V8L A;  3F8B A;  1T98 A;  2MA3 A;  1IN7 A;  2DT5 A;  2FBK A;  1LDK B;  2L01 A;  5E1W A;  1AOY A;  4FT8 A;  1DP7 P;  1B9N A;  2OQG A;  3RPU A;  4EJW A;  3GEZ A;  1SD6 A;  5HLG A;  3WTY C;  2LF8 A;  2ZME A;  5CVI A;  3EYI A;  1RZ4 A;  2EFP A;  3ELK A;  4UXN A;  3BP8 A;  1SD4 A;  4D0P A;  2ZME B;  2QQB A;  4G6Q A;  5J8F A;  3RYR A;  2W25 A;  2Q0O A;  3F8N A;  3K9T A;  1P4W A;  4MEY F;  3BY6 A;  1MKM A;  4WWC A;  3LQQ A;  3QU6 A;  3HOT A;  1XMA A;  1LQ1 A;  5HDN A;  1XDS A;  1FY7 A;  2XAF A;  4S05 A;  1BBY A;  1KYW A;  3O2P E;  1U78 A;  4ZZD A;  2YSR A;  3TQN A;  1FLI A;  3F23 A;  2W24 A;  1UCR A;  1Z9C A;  4I0A A;  3QPT A;  4HLY A;  2F5C A;  3HOS A;  4GXO A;  1KGS A;  2RV8 A;  3R4K A;  4CZZ A;  2O6G E;  2HOE A;  2HR3 A;  3JSO A;  4RGS A;  4KIF A;  2K86 A;  3GFL A;  1JE8 A;  1MZB A;  1K6O A;  1SD5 A;  2RKH A;  5FB2 A;  1XGO A;  2VBY A;  3GLX A;  3IRR A;  5JHU A;  1R36 A;  2IA1 A;  3HTU A;  5LRS A;  2JSC A;  2K27 A;  3P9I A;  2MC3 A;  3I54 A;  2X4H A;  2QBY A;  2OU2 A;  2DBB A;  1FBS A;  5L3G A;  4U0Y A;  5HLI A;  2R7F A;  5BPI A;  1SAX A;  1A04 A;  2ELH A;  4XLN F;  4RGR A;  4U0W A;  4RGX A;  1IUY A;  1IXR C;  3CUQ A;  3GXO A;  2ZNZ A;  2JZY A;  1IW7 F;  1QZY A;  4EM0 B;  3CUQ C;  4MHG A;  4HF2 A;  2P8T A;  3QPH A;  3VFZ A;  3M1E A;  4HA8 A;  2E7X A;  2R7D A;  4UVA A;  4KA4 A;  1G3T A;  1T2K A;  1HKS A;  2XAS A;  2LNB A;  5BMZ A;  1FYK A;  1FC3 A;  3HRM A;  2DK5 A;  2L4M A;  1S29 A;  4RB3 C;  3EDP A;  3ABU A;  1XN7 A;  1ZG3 A;  2M5W A;  1U3E M;  5D4R A;  3REO A;  4KIG A;  5LHH A;  1DDN A;  4UNO A;  3RKY A;  2FA5 A;  1U5T A;  2BYV E;  3WU1 B;  2G7H A;  3GW2 A;  4A5M A;  1XSX A;  3H92 A;  4YII A;  1ZYR F;  3LFK A;  3ZPL A;  1VTN C;  2L54 A;  1S3J A;  3V7S A;  4FX0 A;  2L4A A;  1FSH A;  1QQI A;  1ZRE A;  4EJO A;  3P9K A;  2M30 A;  2GXG A;  3BDD A;  1Z6T A;  1TTY A;  2PQ8 A;  1XSV A;  1O3Q A;  1IXS B;  1IAW A;  2GIV A;  3QP6 A;  2RVC A;  2YX4 A;  5KVR A;  4KDP A;  3T1B A;  3JW4 A;  3P9C A;  1O7L A;  5ICC A;  3ZQ7 A;  3ZN1 A;  4JQF A;  5JVT A;  1RUO A;  1R7J A;  4ESJ A;  1BI1 A;  4KMU X;  3R6S A;  1KQ9 A;  3D0S A;  4YIF A;  1O3S A;  1R5H A;  2O8X A;  3Q9S A;  3GVA A;  4O5V A;  2EFW A;  1UB9 A;  4TV7 A;  1IN4 A;  2ZJ2 A;  5LGT A;  1W5T A;  3HIF A;  5IT9 K;  4UVC A;  3FXQ A;  4HX8 A;  1B6A A;  2IJL A;  2A69 F;  3LA3 A;  1YW8 A;  5DUK A;  1R00 A;  2K7L A;  3DP7 A;  2E1N A;  1Q1H A;  4XSX F;  4U88 A;  3R0J A;  2RQP A;  4MTE A;  3DFG A;  5LLQ A;  5JFR A;  3CO7 C;  3DPT A;  3E3V A;  4U7D A;  3BOQ A;  3S2W A;  2IRF G;  4PGG A;  1OYI A;  2CG4 A;  1R1U A;  2LF7 A;  5EEG A;  3WOD F;  3TGN A;  1B59 A;  2FML A;  2HKX A;  3LAP A;  5HDG A;  4IPA A;  5FLX Z;  2QEN A;  2QWW A;  3QRF F;  4OIN F;  1JGS A;  5E17 F;  1GXQ A;  5ERI A;  1PDN C;  2A6E F;  3C7J A;  1WI9 A;  1XDU A;  3WGI A;  3GO5 A;  4OMY A;  4L5I A;  2ZO4 A;  4WXC A;  5DCM A;  5D5U B;  2V9V A;  1XMK A;  2XGX A;  5D5X B;  4L18 B;  1LB2 A;  3IL2 A;  1OKR A;  1KQ0 A;  1LEA A;  3I53 A;  4IRH A;  3SHF A;  5AON A;  2PBI A;  3TO7 A;  3WTZ A;  1S7O A;  1PP7 U;  3I4P A;  4P9F A;  3OV8 A;  2Z99 A;  4ZH4 F;  4A2U A;  3FZV A;  2EA4 A;  3C18 A;  3ISP A;  5DV5 A;  1UST A;  2H6B A;  1KYZ A;  3J80 K;  5CYV A;  1W7P D;  4CIC A;  1BC7 C;  3MFK A;  4IXA A;  2YR2 A;  2P4W A;  4MGR A;  1WRJ A;  3FWE A;  4A6D A;  4L9T A;  4BAY A;  4R79 A;  4HDV A;  1FZP B;  3RDI A;  3Q5F A;  2CFX A;  4JBA A;  4RB1 A;  3FMS A;  1S6L A;  4LK1 F;  3HTS B;  2CSO A;  2BE5 F;  1XD7 A;  3LA7 A;  1OR7 A;  2H94 A;  3HRS A;  4BNC A;  5D6E A;  3LAJ A;  1WKM A;  1PUE E;  2GQQ A;  1PP8 F;  2ZNY A;  4BHP A;  3FMR A;  2XUB A;  4QLC U;  2IPQ X;  1FYM A;  4I2O A;  2XHK A;  1YTY A;  3CJN A;  1GXP A;  2PFB A;  2EV6 A;  3F3X A;  5L3B A;  4DNC A;  2CQK A;  4KUM A;  3ECO A;  2FNP A;  2M8E A;  2XKO A;  4M73 A;  1CGP A;  4CYD A;  2GWR A;  4HAM A;  3NRV A;  1JHH A;  4CGZ A;  4G8X A;  2OQR A;  2D45 A;  5D8K B;  2WC2 A;  5CVV A;  1FP1 D;  2CWE A;  5F64 A;  3LWF A;  2HYF A;  5FD6 A;  3DPL C;  5DCF A;  5LEJ A;  2EB7 A;  2UXX A;  3I0T A;  2CYY A;  3V8J A;  1WQ2 A;  2VC1 A;  4ESF A;  2X0L A;  2RNJ A;  5E1X A;  2AS5 F;  1YQA A;  3M8F A;  1XGN A;  2COM A;  2PMH A;  4G9Y A;  4XLP F;  4KN4 X;  4S04 A;  2FNA A;  4XRF A;  3O3K A;  2DQR A;  5CVJ A;  4ZYE A;  1JHF A;  5BS6 A;  2P7V B;  3G3Z A;  2EJR A;  4LMY A;  3VOE A;  4M9X A;  1IN5 A;  1J9I A;  1D5V A;  1KQ8 A;  4EV0 A;  2MH9 A;  4G7O F;  4IRG A;  1TNS A;  3F8F A;  3HHH A;  3F6V A;  4Y13 A;  3PQJ A;  4LGW A;  2HKO A;  3HSE A;  1IRF A;  1X3U A;  3Q9V A;  3GWZ A;  5BPD A;  1D8K A;  1P4X A;  5HS7 A;  3KEO A;  3B02 A;  4AIH A;  1KU3 A;  2QVO A;  4KFC A;  3U1D A;  2HZT A;  3TDZ C;  2RDP A;  2PMU A;  3M7G A;  2XAH A;  1C0W A;  1TLH B;  4EJU A;  5J8C A;  4EVI A;  2HYG D;  4LD5 A;  4CDG A;  3F8M A;  3R0A A;  3DF8 A;  3FMQ A;  4L9J A;  3IKT A;  1QO0 D;  1FSE A;  4PDK A;  1YW9 A;  1Z1D A;  5ILV A;  4I01 A;  5D5W B;  3LST A;  2C6Y A;  2VOP A;  1L0O C;  4WXH A;  1R5G A;  3VOD A;  4HF1 A;  3W6J B;  1NHA A;  2V79 A;  2XRO A;  1K7A A;  4HDU A;  5L3C A;  1BC8 C;  2Y0M A;  3HRT A;  4EMS A;  2ISZ A;  2GZW A;  2OD5 A;  2TDX A;  4A6E A;  5D4S A;  2O3F A;  2A5Y B;  1UFM A;  4MQ9 F;  4OIQ F;  4WXD A;  2ISY A;  3V8K A;  1U5T B;  1BJA A;  4GO1 A;  1BI3 A;  3L9F A;  2NS0 A;  4HQM A;  1WWX A;  3WE3 A;  2A68 F;  4AIJ A;  1HBX G;  3MZY A;  1ZLK A;  2QM3 A;  1ZH5 A;  4M6Y A;  5F1R A;  5K1Y A;  5TJJ A;  2HQN A;  5HS8 A;  1ZAR A;  2DU9 A;  2KRF A;  2FRH A;  2NRA C;  3U9G A;  4ZYD A;  2XAQ A;  4Z2Y A;  5H6R A;  5A2Q K;  2OAZ A;  1O57 A;  3V7C A;  2A6H F;  3KP2 A;  3KEQ A;  3HSF A;  4N0B A;  3VB2 A;  3CUQ B;  4HZF A;  2DAO A;  2VN2 A;  5L3D A;  3KP4 A;  2DW4 A;  4H0E A;  1E2X A;  1ZRF A;  3I59 A;  2NAZ A;  3BZ6 A;  4IHS A;  2XIG A;  3IWF A;  3L7W A;  2Q8K A;  1EV7 A;  3CO6 C;  4HOB A;  3I71 A;  4KIC A;  4HV5 A;  4LG0 B;  4LLG F;  1U5T C;  1ZRC A;  2PN6 A;  3I59 B;  3BRO A;  3DV8 A;  4HV6 A;  4A0X A;  1B1B A;  1TNT A;  3ZP5 A;  1DPU A;  1OPC A;  4Q47 A;  1MD0 A;  2ADU A;  3V7R A;  3ERE D;  2KIF A;  3JTG A;  1RI7 A;  1DPR A;  4A0Y A;  5DDG A;  3L00 A;  3IWZ A;  3TKY A;  2RC4 A;  3WGH A;  2MH2 A;  1BIB A;  3CLO A;  5DD8 A;  3ZMT A;  1U6G A;  4XSZ F;  1G4D A;  2M45 A;  4RB0 A;  2P7C B;  1J5Y A;  2IA2 A;  3L2C A;  2FSW A;  4OIP F;  3ROU A;  2DI3 A;  3PQK A;  2D1H A;  3TOB A;  1SMT A;  3K0L A;  4P96 A;  2CGP A;  3DKW A;  1T0F A;  3TO9 A;  2DLL A;  4RAY A;  3PFI A;  2FF4 A;  5CLS A;  3BPX A;  3ZN0 A;  1R58 A;  3CTA A;  2IA0 A;  3MCZ A;  3SFZ A;  1W4M A;  2F2E A;  3N4M A;  3BWG A;  4O3M A;  2DPD A;  5LBQ A;  5IT9 Z;  3K2Z A;  4IF4 A;  4KN7 X;  3HHG A;  4MNU A;  2BV6 A;  3M8E A;  5FFX A;  2L3D A;  1EH8 A;  1TQI A;  3CDH A;  1QZZ A;  3GUD A;  1V4R A;  4HYE A;  2VE8 A;  2KJB A;  1B9M A;  4Y17 A;  1I1G A;  5DYM A;  4L9N A;  3JAM Z;  1LJ9 A;  3G73 A;  2ACJ A;  3KE2 A;  2K4B A;  2XRN A;  2FE3 A;  2Y75 A;  3RYP A;  4L0Y B;  1R1V A;  4U7B A;  3CUO A;  1YS7 A;  4R8H A;  1GVJ A;  2Y48 A;  1YYV A;  2NNY A;  4B8X A;  1HKQ A;  1LDD A;  3F6O A;  4P9U A;  1HW2 A;  2HGC A;  3W6K B;  1ZGJ A;  4YFN F;  1UHM A;  2IVM A;  2XKP A;  2PJP A;  4M72 A;  2PLY A;  3EYY A;  3TO6 A;  2Z33 A;  4LK0 F;  5K5Q A;  1GHC A;  3EQL F;  1F9N A;  1G3Y A;  3E6M A;  1J0R A;  4BH9 A;  4EGZ A;  3FHZ A;  3ZMZ A;  3DQV C;  1T38 A;  1XCB A;  3RTR A;  1ULY A;  6PAX A;  5E8G A;  2JPB A;  5HDK A;  3WE2 A;  3E5U A;  1BOA A;  1QGP A;  3KLO A;  5D8L B;  4ESB A;  1IN6 A;  4LB5 A;  1J2X A;  1Z7U A;  1BM9 A;  2WWY A;  1W7P B;  4IRI A;  2YPR A;  2MD5 A;  1KU9 A;  3KP5 A;  4AVP A;  5LGU A;  3KZY A;  1STZ A;  3VEP A;  4ASN A;  3GFJ A;  1TQP A;  2WV0 A;  2Z9O A;  2FXA A;  4PZJ A;  4CO8 A;  3KZZ A;  1YG2 A;  4I02 A;  4U0V A;  2LSO A;  2CO5 A;  3MEX A;  3KFW X;  1SFE A;  4UV9 A;  4N9I A;  3FM3 A;  4ENN A;  2XAG A;  2QQ9 A;  2FEZ A;  2OBP A;  3WTS C;  3RI4 A;  1LEB A;  3U2R A;  3OOP A;  1F5T A;  1H0M A;  4LG0 A;  1P2F A;  3ML6 A;  2F5E A;  2HWV A;  2DK8 A;  1R1T A;  2HEO A;  3FXU A;  2H09 A;  1FYL A;  1CF7 B;  4ON0 A;  3DXJ F;  2HTJ A;  4ENK A;  3KP6 A;  4ENM A;  2HQR A;  3ZMS A;  3B73 A;  4Y15 A;  2P5V A;  1BI0 A;  5E1Z B;  3IRQ A;  4XBF A;  5L3E A;  1IXC A;  1V3F A;  2P5K A;  4KT5 C;  3IC7 A;  4HW0 A;  3WU0 A;  3K1M A;  3E6C C;  4A12 A;  2KKO A;  2QYO A;  2YX7 A;  2LKP A;  4M6X A;  5H20 A;  1RIO H;  2EFN A;  2Z3Y A;  5JI6 A;  2KJC A;  2BGC A;  3F21 A;  2HDC A;  3F22 A;  1P4A A;  2GA1 A;  2OZ6 A;  2VBX A;  3AAF A;  1E17 A;  5LEK A;  1FOK A;  2DPU A;  5EEH A;  5D5V B;  4OOI A;  4EJT A;  4AWX B;  4F7Z A;  2BBY A;  3JAM K;  2GA2 A;  2M87 A;  1ZN2 A;  5DCM B;  4NB5 A;  5LHI A;  5CVU A;  2HFH A;  2O0Y A;  3KP3 A;  2P5L C;  1KU7 A;  1SMY F;  3GZ5 A;  2ETH A;  3T5X A;  5LGN A;  2VT2 A;  3ABT A;  4GGG A;  1HW1 A;  3SZT A;  4KNY A;  1L3L A;  4AIK A;  2PI0 A;  5FO5 A;  4ETS A;  3NQO A;  1Z91 A;  1U8R A;  4IHT A;  2K02 A;  4L9V A;  1RUN A;  2VT3 A;  3SQN A;  2P6T A;  4NQW A;  5ILS A;  4WCG A;  4A0Z A;  3RPQ A;  3JTH A;  1R23 A;  2G9W A;  1ONV A;  2K4J A;  2ESH A;  2CW0 F;  3GX4 X;  5ED4 A;  2A3S A;  3T8R A;  3J7A O;  1MJB A;  2MLG A;  2XAJ A;  2R3S A;  3FXR A;  4EQQ A;  4BHB A;  1HST A;  2JT1 A;  1OYY A;  1H9G A;  2BEO A;  2Q2E A;  3ZMD A;  5ICE A;  2FBI A;  2F5D A;  1P6R A;  2QUF A;  4WK8 F;  2OZU A;  5FFZ A;  3ULQ B;  1BIA A;  1MDM B;  1Y0U A;  3BJA A;  2QLZ A;  3SZP A;  3QP5 A;  1W5S A;  5ICG A;  2JRT A;  2ZXJ A;  5DUI A;  4B09 A;  2WTE A;  4LLN A;  4BHC A;  1OMI A;  4OIR F;  1YS6 A;  1MDM A;  1Z05 A;  1ZG5 A;  5ICF A;  3EET A;  2EFO A;  4IVN A;  3GF2 A;  2VBZ A;  4GCV A;  5IT3 A;  2FQ3 A;  1G3W A;  1FX7 A;  4UVB A;  4MQV A;  4KMF A;  5BQT A;  3QAH A;  2EWN A;  1ZG1 A;  3F72 A;  1SFU A;  2UXN A;  4P55 A;  1ZRD A;  1HXD A;  3N97 A;  5CJ9 A;  3O6B B;  2OA4 A;  2IW5 A;  2XVC A;  3RKX A;  3WTU C;  4DQ2 A;  3IKV A;  3D5L A;  4YG2 F;  5E8I A;  2RGV A;  1MJ9 A;  2VOD A;  1KU2 A;  2DO7 A;  3V4G A;  4L5J A;  1SD7 A;  1MJA A;  4QWQ A;  1SFX A;  3FF5 A;  1O3R A;  5K5R A;  5E18 F;  2MBF A;  2QZ8 A;  2M1B A;  2V1D A;  4I98 B;  2HS5 A;  1LVA A;  1HQC A;  4Q48 A;  3K1N A;  1U2W A;  3EUH A;  3ECH A;  1D3Y A;  3GFM A;  2IP2 A;  4GYG A;  3K1P A;  1CF7 A;  4I09 A;  3DEU A;  3MQ0 A;  4EM2 A;  1YLF A;  4MEX F;  4OIO F;  5LRR A;  3E5Q A;  4BYY A;  3ZMU A;  2ZFW A;  3JSP A;  2DTR A;  4HQE A;  3BPV A;  1REP C;  2VON A;  5AIP A;  5D6F A;  4G94 A;  3I5U A;  3KCC A;  2E1C A;  4IJA A;  3TOA A;  4LJZ F;  3RJP A;  1HW5 A;  1I27 A;  2XV4 S;  1P92 A;  3K69 A;  3MWM A;  5F6F A;  1FT9 A;  3T8T A;  2RN7 A;  2F5F A;  3GYH X;  1H9T A;  3GFI A;  4JK1 X;  2EFQ A;  3WG9 A;  2ZCW A;  2YU3 A;  2J5P A;  5HLH A;  2JPC A;  1T39 A;  5E20 A;  3FM5 A;  2O03 A;  1LDJ A;  1FP2 A;  3H3Z A;  4WF2 A;  4KYW A;  1YW7 A;  3C3W A;  4R1H A;  2AXL A;  4BXU A;  1YFH A;  4LB6 B;  4N9H A;  3F8C A;  4RGU A;  4A5N A;  4P5O A;  1XB4 A;  4UV8 A;  2MLK A;  3RIR A;  1S8N A;  3E6D A;  1K78 B;  2P6S A;  1USS A;  1FNN A;  4K2E A;  4HF0 A;  4EGY A;  1MGT A;  1IRG A;  5K5O A;  5AIQ A;  1I6X A;  3WTX C;  1Z6R A;  4M74 A;  1FWZ A;  4ENJ A;  5HOO A;  4HBL A;  2QQA A;  4RB2 C;  3KLN A;  1IF1 A;  2UZK A;  2VOO A;  2STW A;  4M9Z A;  4NHJ A;  1B4A A;  4OU0 A;  2FU4 A;  5FGM A;  4RS8 A;  2STT A;  1IZ1 A;  1S7A A;  4ZYH A;  2V1U A;  1W7P A;  3HUG A;  1D8J A;  2HTS A;  2H27 A;  5A2Q Z;  1R22 A;  2KIU A;  3E5X A;  1YIO A;  3COA C;  2L02 A;  4MTD A;  3M9A A;  4I7H A;  3I64 A;  2DFI A;  5ILU A;  4HX7 A;  4FHT A;  4L0Z B;  1DUX C;  4OMZ A;  1I1S A;  5J6X A;  2GAU A;  5TRD A;  1ZHF A;  1ZAO A;  2W84 A;  1QBJ A;  4EJV A;  1XGS A;  1RNL A;  5JR3 A;  1OYW A;  3E97 A;  2FOK A;  4CXF A;  2FBH A;  1LNW A;  1FBQ A;  3T0Y A;  5L3F A;  2W57 A;  2B0L A;  3P7N A;  2D2W A;  3WTW C;  1TBX A;  5HVQ C;  3WTT C;  4Q5S F;  1HKT A;  5FD5 A;  4CHU A;  2JTV A;  4M71 A;  3LQR A;  4FX4 A;  2G7U A;  2DQL A;  5KK1 A;  1XCV A;  3RKW A;  4BQA A;  2KIM A;  4HLX A;  1HSJ A;  1ON2 A;  1EH6 A;  3QU3 A;  3GZ6 A;  1ZGA A;  1TW3 A;  2A61 A;  1ODD A;  1O7F A;  2EV0 A;  4I0B A;  4LLL A;  4GYI A;  1XSD A;  1J75 A;  1O3T A;  3BJO A;  3HSR A;  4LFU A;  1QNT A;  3ZMV A;  4PCQ A;  2LDU A;  3L09 A;  2UWM A;  1G3S A;  2H6C A;  4M9S A;  5FLX K;  2VBW A;  2NYX A;  2W85 A;  4HX4 A;  3HYI A;  2A07 F;  5CVR A;  5H6Q A;  1FBU A;  4O6J A;  1FPQ A;  3FX3 A;  4PGH A;  1BI2 A;  5BOX A;  2FMY A;  3MZH A;  2IT0 A;  3R61 A;  2GXB A;  3KP7 A;  2Z5U A;  3WTV C;  5DEQ A;  3E6B A;  2EV5 A;  4Q4Z F;  3LA2 A;  1J7K A;  4G7H F;  2V6C A;  1AWC A;  4YFK F;  3HRU A;  2VC0 A;  1XGM A;  1TW2 A;  2D1V A;  1ZLJ A;  5DD4 A;  4RAZ A;  1K78 A;  1K79 A;  3I58 A;  2E7W A;  2PG4 A;  3WGG A;  4UHT A;  4G6D A;  1G6N A;  3SXY A;  4AD9 A;  1IN8 A;  2VE9 A;  1EH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...