2KIFA

Solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-methylguanine-DNA methyltransferase
publication title Structural basis of O6-alkylguanine recognition by a bacterial alkyltransferase-like DNA repair protein.
pubmed doi rcsb
source organism Vibrio parahaemolyticus aq3810
molecule tags Transferase
total genus 29
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kifA00
1TLHB 2FOKA 1UB9A 4HF0A 2O6GE 4UVCA 1HW2A 1S7AA 2XROA 2QM3A 4U88A 2OA4A 3T8TA 1BIBA 1W5TA 4L5IA 3KP4A 3O3KA 3ZP5A 2YR2A 5EEHA 5A2QZ 1LEBA 2P5VA 1IN4A 1R1TA 2HGCA 3K69A 1DUXC 4Z2YA 1J0RA 4KIGA 3V8KA 1SD7A 3D0SA 2FRHA 3WGHA 1L0OC 3MEXA 2PJPA 1FY7A 1I27A 4ENJA 2MBFA 1IN6A 3PQKA 4I09A 5L3BA 1PUEE 4L0ZB 2ZO4A 1Z6RA 2DTRA 5J8CA 4BHPA 2RGVA 2O03A 3JAMK 3K1MA 2XRNA 1U5TB 3HSRA 2JSCA 4S05A 4G7HF 2O3FA 2L3DA 2QQBA 4LLNA 2P4WA 5FB2A 1ZN2A 5LEJA 4OIPF 3KLOA 1FWZA 3B02A 1Z05A 5IT3A 1TQMA 5D4RA 4UUVA 1O3TA 1D3YA 5LHHA 1FP1D 4FX4A 1ZG1A 4JBAA 4PZJA 2W25A 3LWFA 2QZ8A 4RAZA 1XSDA 3V7CA 2EWNA 2R3SA 2FBHA 5CVVA 2O61A 2MD5A 2D2WA 1Z91A 3E6MA 3LQRA 2DQLA 2Y48A 1DP7P 1S29A 1FSHA 2PI0A 2MLKA 5HVQC 1O7LA 4LJZF 1IN8A 5DEQA 3H3UA 1HW1A 1CGPA 4EM1A 5DUKA 2EV0A 5ICEA 3U2RA 1SMYF 4UVAA 3KZYA 3ZMUA 4EV0A 1YLFA 2HWVA 4ETSA 1MGTA 4MGRA 1EV7A 3ZMZA 4EJWA 1YG2A 2D1VA 4A2UA 3ZQ7A 1U3EM 3ML6A 4QLCU 1R36A 3E97A 4LG0B 1LDJA 4M72A 4RAYA 2VE8A 4CZZA 2MH9A 2CO5A 3TDZC 2ZFWA 4IRGA 3F8NA 2DAOA 3PFIA 4FT8A 1ZLKA 5FO5A 4BAYA 1H9GA 2A69F 1KGSA 1W4MA 1T38A 3RTRA 4RB1A 3GZ6A 5BPIA 3M1EA 2FXAA 2UWMA 4EVIA 1LB2A 4UV8A 2GZWA 2DW4A 1REPC 1IRGA 3WTSC 3B73A 4Q47A 4LK1F 3TOAA 3JSPA 1OYWA 1U5TA 2M87A 2WWYA 4HYEA 4AD9A 3QOPA 2CQKA 4I01A 3MZHA 2IW5A 4LLLA 4YIFA 1BC8C 1U78A 3RI4A 2ISYA 3BJAA 1P92A 3ABTA 3P9KA 5HS9A 2MLGA 3T0YA 2ETHA 2AS5F 4WK8F 4ZH4F 3HTUA 1R5HA 4WXCA 2UZKA 2PG4A 2NNNA 3HHHA 2EA2A 2H6BA 5HDGA 3CO7C 3WTUC 1K78B 5DDGA 2OZUA 3MFKA 3ZMTA 4G8XA 1OKRA 5K1YA 3FM5A 4LB5A 3C18A 3BP8A 3VOEA 1F4KA 2IPQX 4CO8A 3LA7A 2DBBA 1R7JA 4YFKF 4WCGA 4KA4A 3E6CC 4O5VA 3J80K 1MJBA 2JTVA 1BJAA 3WTTC 5FD5A 5LHGA 2IVMA 2RC4A 3RPQA 4IHTA 2V1UA 3ISPA 2QQAA 2EFPA 3T8RA 2FBIA 2BBYA 2JPBA 2Z5UA 3TO6A 5ICCA 2YSRA 2XV4S 3R0JA 4RGSA 3J81Z 1FZPB 2XAJA 1AWCA 2HYFA 1Z9CA 1ON2A 2A07F 4KDPA 1S6LA 4BNCA 3HIFA 2DLLA 5ILUA 4LG0A 2CSOA 3HOTA 1XDUA 3WU0A 3JAMZ 5AIPA 2XGXA 4LD5A 5DCMA 3K1NA 3WGIA 3AAFA 4NB5A 3WE3A 2VXZA 1I6XA 4EJUA 3GF2A 4UNOA 4KT5C 2V1XA 2XAQA 4G6QA 2QBYB 3BOQA 1EH6A 2KIUA 1HKTA 2KRFA 3ULQB 2HOEA 1D5VA 1XSXA 4GYGA 1O3QA 2OZ6A 4EM0B 4JK1X 1O3RA 4Y15A 1JHHA 2CG4A 2HS5A 2VT3A 1O7FA 1FC3A 3I53A 3SZTA 2VC1A 2ADUA 3M7GA 1ZYRF 1KU3A 3RKWA 2DPUA 2E7WA 3E6DA 5L3CA 4EQQA 1ZRCA 5D8KB 2Q8KA 2D1HA 3LA2A 2G9WA 3F8MA 3FMRA 2VOOA 3NEUA 3P7NA 4UHTA 1YW7A 1G3WA 2DFIA 1RI7A 2F5CA 1K78A 3CUQB 1G3YA 3L00A 3PQJA 1J2XA 3LSTA 3H92A 2QUFA 1WQ2A 2RKHA 2VE9A 4FX0A 5E17F 4JQFA 2HFHA 1HSTA 4P5OA 3HYIA 1ZHFA 5BS6A 2BGCA 5FFZA 2OU2A 1ULYA 3SFZA 4Q48A 3F3XA 1QPMA 3FMQA 4GYIA 4HV6A 2W24A 3Q9VA 2P6SA 5KK1A 1FX7A 3CUQC 1IZ1A 4U7BA 2FMLA 4MQVA 1XDSA 2M30A 2CW0F 1ZRFA 4M74A 2PLYA 1JGSA 1L3LA 3JTHA 2JT1A 5E18F 1MDMB 1A04A 4P9FA 2M8EA 1S7OA 3BROA 4M6YA 2XKOA 3GWZA 4OU0A 2EV5A 2K02A 4HX4A 1R22A 1XD7A 4A6DA 5FFXA 3FXQA 1F5TA 3NQOA 2QBYA 2ACJA 1FOKA 3GXOA 4ESJA 3T5XA 1XCBA 2K86A 4U0VA 4P55A 2DI3A 3IWZA 2VN2A 4UXNA 4EJVA 2J5OA 3WU1B 1TQIA 5L3FA 3IKTA 1T39A 1BN5A 2ZKZA 3LA3A 4HV5A 3HOSA 4H0EA 2A5YB 1SAXA 2CYYA 1MD0A 1G6NA 2PEXA 3P9CA 3WE2A 2FU4A 1BI2A 4HDVA 5DUIA 1D8JA 4D0PA 2XAFA 1FYLA 1LDKB 1LNWA 3FM3A 2TDXA 5JFRA 1P4WA 2GXGA 2VBZA 3J80Z 4ZZLA 2XASA 2O8XA 1FYMA 5LLQA 4YIIA 5H6QA 1MKMA 4Y17A 2HQRA 4WF2A 4UV9A 5D8LB 3COAC 3CUQA 1SD5A 3J81K 2VOPA 1I1SA 4HZFA 4CXFA 2M5WA 1EH7A 1U6GA 1GXQA 5JVTA 5KVRA 2YPRA 3CDHA 1SFEA 2EFOA 4HX8A 2DK8A 2PN6A 3I5UA 2NAZA 5HLGA 3IRQA 2IJLA 2XKPA 1B9NA 5ICFA 4ZYDA 1PDNC 2HYGD 3CO6C 1ZRDA 3ZPLA 1RZ4A 3WTWC 3KP3A 3RPUA 4KICA 4GCVA 1LVAA 2L4AA 3GFLA 1LQ1A 3GFIA 4A0XA 3MQ0A 3BZ6A 4KYWA 2L02A 2PMUA 3GLXA 1MDMA 4ZYGA 2RNJA 3HRSA 1U5TC 1JXSA 1YW8A 5DD4A 3R6SA 1USTA 4I98B 2BE5F 2EFNA 3TGNA 4MTEA 2G7UA 1BBYA 4RGUA 1LDDA 3RYRA 2XHKA 5F6FA 3EYYA 1V3FA 2K4JA 1WRJA 1AOYA 1FBSA 5JI6A 3W6JB 2V6CA 4IPAA 5D5WB 3F21A 1SFXA 2COMA 1R00A 4HBLA 3QU6A 1SFUA 1RIOH 2E1NA 1T0FA 4RGXA 4HF2A 5FGMA 3DFGA 1F9NA 1IAWA 4WX9A 5IT9Z 1OPCA 3W6KB 2HKXA 2QWWA 4MEXF 5F1RA 4KMUX 3M8EA 4OINF 1O57A 4M9XA 5CVJA 4KUMA 1PP7U 1B1BA 4M9SA 1G4DA 1GVJA 2O0YA 1YTYA 1RUNA 1XMKA 2QQ9A 1FLIA 4M6XA 4L18B 1MJ9A 4DQ2A 4EGZA 2STWA 4Q5SF 2NNYA 2VBYA 2H09A 5CVRA 4AWXB 5L3EA 4LLGF 1FT9A 3K1PA 1KYZA 5D4SA 3BDDA 3KP7A 1KU9A 3RKXA 1IXCA 3SXYA 1SMTA 2F2EA 4RB0A 2AXLA 4PGGA 2KJCA 4IVNA 3T1BA 5E1ZB 2VODA 2ESNA 4XSZF 5E20A 4EGYA 1ZGJA 3DPTA 1BI3A 3IKVA 2LKPA 3RIRA 5HDNA 3SHFA 4N9IA 1UHWA 2E7XA 3D5LA 4KFCA 2BV6A 2Q2EA 3GW2A 1XB4A 4HDUA 3QP5A 5DD8A 2EV6A 4HQMA 3WODF 1SD6A 1KQ0A 3M9AA 3R0AA 5E8GA 3HUGA 1FP2A 1R58A 1P4AA 2LF7A 1BI0A 1ZG5A 2HKOA 3BJ6A 4AIJA 2GIVA 2FEZA 1QZZA 2EJRA 4N9HA 2GA1A 4A6EA 3FHZA 5FLXK 4TV7A 5HS7A 1QNTA 2V79A 4XLNF 3IL2A 2NS0A 4I0BA 1TNTA 4R1HA 4KMFA 5LGTA 3HRMA 4OIQF 4N0BA 1HSJA 3EDPA 4BQAA 1QQIA 3E6BA 1E17A 2Y0MA 3F23A 4IXAA 3HSFA 3MCZA 1O3SA 4CDGA 4EJOA 2YX7A 4IRIA 2PBIA 2P5KA 5BQTA 2FF4A 5LBQA 3C7JA 3Q5FA 4NQWA 4P96A 5K5RA 2Z33A 1DDNA 2ZNZA 1F1ZA 2GAUA 4HF1A 1WWXA 4PGHA 2P5LC 2RV8A 3QAHA 5EEGA 4G7ZF 3DP7A 5K5OA 5ICGA 1ZREA 2FQ3A 3FF5A 3C1DA 2JPCA 1IN7A 2K4BA 2OBPA 1DPUA 3O6BB 1OR7A 3WTXC 5AONA 5D5UB 4KIFA 5H6RA 3L7WA 1I5ZA 4PDKA 4PCQA 3IRRA 4IJAA 3I4PA 2YU3A 1CF7B 1W5SA 1H9TA 1UCRA 5CVUA 1IXSB 1B59A 4IRHA 4ESFA 3RJPA 3QPTA 1Y0UA 3FWEA 2IA2A 3QPHA 2H94A 1BIAA 1QZYA 2QLZA 5LRSA 4ENNA 2YX4A 2BYVE 3KE2A 3RKYA 2R7DA 5IT9K 2LSOA 3ZMDA 1BM9A 3BPXA 5JR3A 5HOOA 1GXPA 4UVBA 5D6FA 2W85A 1G3TA 2CFXA 1YO5C 4KN7X 1PP8F 3ZMVA 3KETA 2D45A 3DKWA 3F6OA 3DEUA 3ROUA 4CGZA 5ED4A 4LB6B 1QGPA 3IWFA 4L9NA 2UXNA 1V4RA 2XAHA 1TBXA 1OYYA 2CWEA 3V8JA 2LDUA 1BOAA 1HBXG 4ZZDA 2K7LA 2HEOA 3I54A 4HLXA 2W84A 1T98A 3HSEA 1DPRA 1OYIA 1H0MA 2HTSA 1TQPA 1JE8A 5D6EA 3EYIA 1KU2A 2ZMEB 2IP2A 1Z1DA 1FYKA 1LEAA 4A0YA 5L3GA 2EA4A 1ONVA 3HHGA 1TW3A 1HQCA 1SD4A 3LQQA 5L3DA 4WXDA 2RDPA 3L2CA 5E8IA 1WKMA 1NHAA 4LK0F 1ON1A 2EFQA 4O3MA 1YFHA 3OOPA 1S3JA 4HQEA 1W7PB 3F8BA 5E1XA 2P7CB 4BHCA 1ZLJA 1VTNC 5ILSA 2ZNYA 1ZH5A 1CF7A 4E70A 2K27A 1XSVA 3O2PE 2EB7A 2EK5A 5D5VB 3I64A 3K0LA 1T2KA 3HRUA 2W57A 2PFBA 1YQAA 5FLXZ 5LRRA 3KP2A 1IW7F 4DNCA 1XCVA 4A5MA 3VODA 2FE3A 3DXJF 2F5DA 2FNPA 5BPDA 1J59A 5DCFA 1U8RA 4RB3C 5HDKA 3IHUA 1MJAA 5CVIA 1YYVA 2Z99A 5HS8A 2PQ8A 2HTJA 1R23A 2Z9OA 4BYYA 1OMIA 2VT2A 3HRTA 3G73A 4HLYA 1R1UA 2H27A 4ZYEA 1E2XA 3MWMA 2WV0A 4MTDA 1WI9A 4R8HA 1IN5A 4ENMA 3QU3A 2MH2A 5AIQA 3TDUC 4LMYA 1YW9A 1J75A 2ZJ2A 3BPVA 2ESHA 4L9JA 3KP5A 3DV8A 1HW5A 3GO5A 1KA8A 1RNLA 2IRFG 3WTVC 5LGUA 4EJTA 4G7OF 1ODDA 1KQ8A 1D8KA 3RYPA 4B8XA 3HTSB 2ZMEA 2X0LA 4XLPF 2IT0A 3FX3A 3ECOA 5LHIA 2CGPA 1HKQA 4OIRF 1J5YA 3L09A 1HKSA 4B09A 2DU9A 2EFWA 1XGNA 4MHGA 1B6AA 4XBFA 3M8FA 1B9MA 2P6TA 4EM2A 4OIOF 2DQRA 2KIMA 3WGGA 3JW4A 2MA3A 2HQNA 5TJJA 3E5XA 1W7PA 3FZVA 4M71A 2KKOA 3BY6A 1S8NA 4CHUA 4AIKA 2WC2A 1K6OA 3CUOA 4A0ZA 2GXBA 2VBXA 4G6DA 4G9YA 2P7VB 4GGGA 2G7HA 2A6HF 5DYMA 3NRVA 3KEOA 3P9IA 3FXUA 2OD5A 3JTGA 2RN7A 2IA1A 3L9FA 1J9IA 2M45A 3F8FA 3GEZA 2XVCA 2DK5A 5BMZA 3WTYC 4M9ZA 4ON0A 1QO0D 2STTA 2MC3A 4ENKA 1UFMA 1RUOA 1P6RA 4A5NA 4IF4A 1C0WA 3EETA 3TO9A 4NHJA 2F5FA 5LEKA 1YS6A 4G94A 4A12A 3KCCA 4U7DA 5DCMB 2L54A 2L01A 3CJNA 1I1GA 1KYWA 4Q4ZF 3I0TA 4ESBA 3JSOA 1FBUA 1R5GA 1IXRC 1ZG3A 3I71A 2KJBA 2QVOA 3GVAA 3ECHA 3V7RA 2V9VA 2Y75A 2GWRA 2VONA 1KU7A 3IC7A 3KLNA 2H6CA 4U0WA 4MQ9F 1HXDA 3ZMSA 2C6YA 2RVCA 4QWQA 4L9VA 4CICA 5BOXA 4I7HA 3N4MA 1TW2A 2QYOA 4YFXF 3EUHA 4O6JA 4XRFA 1YS7A 4AIHA 4ASNA 1IF1A 2A61A 2IA0A 3S2WA 1TNSA 4RGRA 1XN7A 4R79A 1BI1A 2VC0A 3ELKA 4KN4X 3H3ZA 1Q1HA 2HR3A 1FBQA 2FSWA 4LFUA 2A3SA 2HZTA 4WXHA 4P9UA 3WTZA 3F72A 3DQVC 3VFZA 2ZCWA 3VEPA 3KFWX 1XMAA 1XGMA 2LNBA 5DV5A 2UXXA 5E1WA 4FHTA 2XUBA 2FNAA 3U1DA 2F5EA 2JRTA 3MAJA 5HLHA 1Z7UA 2Z3YA 4WWCA 3F6VA 3OV8A 4BXUA 3MZYA 2XIGA 1P2FA 5A2QK 1FPQA 1UHMA 3U9GA 3GFJA 4MEYF 2JZYA 1XGOA 3F22A 4F7ZA 4EMSA 4S04A 1B4AA 3QRFF 3TKYA 5TRDA 2FBKA 2X4HA 4KNYA 2OQGA 4HOBA 2WTEA 4RB2C 1ZARA 3GZ5A 5FD6A 1KQ9A 4BHBA 1IUYA 2LF8A 5CJ9A 1K7AA 1U2WA 3I58A 3J7AO 1FSEA 4XSXF 3I59B 3E3VA 5J6XA 1Z6TA 1YIOA 1J7KA 4AVPA 3VB2A 3DPLC 2A6EF 2NRAC 1WSUA 3GX4X 4MNUA 5F64A 3C3WA 2QENA 4HW0A 4U0YA 1QBJA 4K2EA 3FMSA 5H20A 2GA2A 2OAZA 4HA8A 3K9TA 3K2ZA 3QP6A 2FA5A 5K5QA 1GHCA 4GXOA 5CYVA 2HDCA 3GFMA 3CTAA 4OOIA 3WG9A 3Q9SA 3KEQA 1XGSA 4BH9A 3FXRA 3DF8A 1STZA 3ABUA 2ZBKA 2FMYA 4L0YB 3SQNA 1FNNA 2L4MA 4HAMA 1K79A 3GUDA 3KZZA 3LFKA 3V8LA 4GO1A 1EH8A 3R4KA 4YG2F 3N97A 1TTYA 4I02A 3SZPA 3R60A 1BC7C 2Q0OA 3ERED 1X3UA 2E1CA 1LJ9A 2OQRA 2GQQA 3F8CA 4I0AA 4KIBA 3CLOA 3E5UA 1MZBA 3TQNA 5JHUA 1R1VA 4M73A 2P8TA 5J8FA 5HLIA 3BJOA 3ZN1A 5CLSA 1USSA 4RS8A 4L5JA 3EQLF 4IHSA 6PAXA 4OMZA 3E5QA 2BEOA 2ISZA 2ELHA 4OMYA 4YFNF 3KP6A 2J5PA 4CYDA 2DT5A 2ZXJA 2A68F 5ERIA 4LGWA 2NYXA 3I59A 2M1BA 5D5XB 3LAPA 2XAGA 1ZGAA 3RDIA 2V1DA 3LAJA 4Y13A 1ZAOA 2RQPA 3R61A 2PMHA 3REOA 4ZYHA 1G3SA 4L9TA 3V7SA 3BWGA 5ILVA 2DPDA 1P4XA 3ZN0A 3TO7A 1IRFA 4I2OA 2DO7A 5LGNA 4HX7A 2KIFA 1JHFA 1T6SA 2B0LA 2VBWA 3TOBA 3V4GA 1W7PD 3G3ZA 2R7FA 3GYHX
chains in the Genus database with same CATH superfamily
1TLHB 4CYCA 2FOKA 1UB9A 4HF0A 3ZGKA 4D7MA 2O6GE 4UVCA 1HW2A 2LY1A 2VKVA 1S7AA 4CCKA 1PYVA 2XROA 2QM3A 2LREA 4LOCA 4U88A 5J3LA 2OA4A 1UG2A 3T8TA 1BIBA 2L9RA 4IHVA 1W5TA 4L5IA 3KP4A 3O3KA 3ZP5A 1Y39A 2YR2A 4IX7A 5EEHA 4UUSB 5A2QZ 1WJDA 2P5VA 2MC4A 1LEBA 4J00A 1IN4A 1R1TA 2HGCA 3K69A 3NARA 1DUXC 4Z2YA 1J0RA 4KIGA 3V8KA 1SD7A 3D0SA 5KAIC 2FRHA 3WGHA 4FASD 4PK4A 4KITB 2M34A 1WH7A 1L0OC 3MEXA 2PJPA 4XLCA 1FY7A 1G8XA 4DZPA 1I27A 1HC8A 4ENJA 3SZGA 2NS8A 2MBFA 1IN6A 2DDAA 3DBLB 3CZ6A 3PQKA 4I09A 5L3BA 1PUEE 4L0ZB 2ZO4A 4DYQA 4D7NA 2R7XA 5E3MA 3FXJA 1Z6RA 5B1BH 2JVGA 2KZGA 4DOZA 1VQ6I 3AL0C 1IGNA 2DTRA 3BG5A 5J8CA 4BHPA 2GIZA 2WAEA 2KDZA 2BY0A 2RGVA 3BQZA 3H36A 4XNFA 4AYBN 2OCEA 2O03A 3K4CA 3K1MA 4S0HB 3JAMK 2XRNA 1U5TB 3PJRA 3HKZN 3L2RA 2BVLA 1D5YA 3HSRA 3CC2I 1K61A 2JSCA 4S05A 4G7HF 1X2MA 3DTEA 1JTYA 3FK7A 2O3FA 2L3DA 2QQBA 4A3KJ 2HPMA 4LLNA 2P4WA 5FB2A 2R7RA 1ZN2A 1X4PA 2FOWA 5LEJA 4OIPF 1ETXA 2FUG2 3KLOA 3I55I 1Y0NA 5FKMA 1E3PA 1FWZA 4XICA 3B02A 1X58A 1Z05A 5IT3A 1TQMA 4M3FA 1AHDP 4N4OB 5D4RA 1O3TA 1D3YA 5LHHA 4UUVA 1FP1D 3W3CA 4FX4A 2K9QA 1ZG1A 4JBAA 4PZJA 3M1CA 3ZQCA 2W25A 1YJNI 2R4GA 4IHYA 3LWFA 2QZ8A 4RAZA 1XSDA 1D0ZA 1DQUA 1F36A 3V7CA 2EWNA 2CUZA 5DTDA 1VQ4I 2R3SA 3OYAA 5GTHC 1VNDA 1W1WE 2FBHA 3BZKA 3CCQI 4UY8I 3FXMA 1FEXA 1W5CC 3HB9A 3BC8A 5CVVA 3EUHC 3GBGA 5CKTA 1RRJA 2ZJRF 3OMYA 2O61A 3AG3H 2MD5A 2D2WA 3CJRB 3H3VK 1K83J 1Z91A 3A0BC 3IH3A 3E6MA 3LQRA 1R9TJ 2DQLA 1YX3A 2Y48A 4G6TB 1I3QJ 1DP7P 4E4HA 2KFDA 2XB5A 1S29A 1FSHA 2PI0A 2MLKA 5HVQC 1O7LA 3BCAA 4LJZF 1TP4A 2DXIA 1IN8A 5DEQA 3U21A 3H3UA 1HW1A 1QA6A 1JJ8C 4EM1A 5IY5H 5E3NA 5DUKA 2EV0A 4BEHA 1CGPA 5ICEA 3U2RA 4YEJA 1SMYF 2HXOA 3DLAA 1FJLA 1ETVA 3OWTA 4UVAA 4XKWA 3KZYA 3ZMUA 3CMYA 1BW6A 4EV0A 3ZCOA 1YLFA 4OAYA 2HWVA 1D1BA 4ETSA 1DGRM 1MGTA 2HDDA 4MGRA 2JA5J 2JQ7A 1EV7A 3ZMZA 4EJWA 1OCRH 1YG2A 2D1VA 4A2UA 3ZQ7A 1U3EM 1MBFA 1XMXA 1VI0A 2F5VA 1QHHD 3LSGA 3ML6A 3S15J 3G1LA 3J7AY 5GPAA 3CCJI 1HLVA 1MSEC 4QLCU 2ELJA 5IYBJ 1R36A 5EJCA 3E97A 2XB0X 4LG0B 3KZIC 4E7HA 1LDJA 4UUSA 5GTIC 4M72A 4RAYA 2ECCA 2VE8A 4F55A 4M3DA 4CZZA 5KAFC 2MH9A 2CO5A 3TDZC 2IBDA 2ZFWA 4IRGA 3F8NA 2DAOA 3PFIA 1MBKA 3QYFA 1NG7A 4FT8A 1ZLKA 5FO5A 4BAYA 3J7ZI 2VJJA 4W1UA 1H9GA 1YI2I 4A3DJ 2A69F 1KGSA 2CS3A 4RDUA 3K6GA 1W4MA 3MKYB 1BL0A 4KISA 1A36A 2E2HJ 2KPMA 2ZSIB 1T38A 3RTRA 4B3AA 2AHQA 3I4NJ 2DMNA 4RB1A 3GZ6A 3OS2A 5BPIA 1WZ2A 3M1EA 2FXAA 2UWMA 4EVIA 2R7QA 1A31A 5E79C 1R5ID 4UV8A 1LB2A 4II2A 2GZWA 1MNDA 2DW4A 2XRLA 3LSIA 1REPC 4V19K 1IRGA 2OPTA 3FXOA 4CCJA 3WTSC 3JRCA 3B73A 4E7JA 4Q47A 2BW3B 4LK1F 3TOAA 3JSPA 1OYWA 2VXDA 1U5TA 3NAUA 2M87A 3DBHB 1ACIA 2WWYA 1HDPA 4HYEA 4AD9A 3KEYA 3GTOJ 3QOPA 4LIVA 3C2GA 2CQKA 2EZHA 4I01A 3MZHA 2IW5A 4LLLA 4YIFA 3MKLA 1BC8C 1T08B 4NUBA 2YS9A 3RI4A 1U78A 3TEDA 2ISYA 3BJAA 1P92A 3IAM2 3ABTA 3P9KA 5HS9A 2MLGA 3T0YA 4RM3A 1MH4A 2ETHA 2AS5F 2HI3A 4WK8F 2M0MA 2XSJC 4ZH4F 3HTUA 1R5HA 4DW6A 4WXCA 2UZKA 2PG4A 2NNNA 3CMAI 3HHHA 3JCUC 2EA2A 2H6BA 5HDGA 3CO7C 4HPQA 2LY2A 3WTUC 1K78B 5DDGA 2OZUA 3MFKA 2KRCA 3ZMTA 4G8XA 2KHMA 1OKRA 1P9QC 3CC4I 5K1YA 3OYLA 3FM5A 4LB5A 2DTZA 3U1KA 3EUKL 3C18A 3L2QA 5HNHA 3PFYA 1LFPA 1PJRA 3BP8A 3VOEA 1F4KA 2IPQX 4XORA 4CO8A 2LR8A 3GTQJ 3LA7A 2DBBA 1R7JA 4YFKF 4WCGA 4KA4A 2UV1A 5IPAA 2E60A 3E6CC 3ZQHA 1ENHA 4O5VA 3J80K 1JTXA 3S3NA 4A3BJ 1MJBA 3DPUA 2JTVA 1BJAA 3WTTC 1ITYA 5FD5A 5LHGA 4BGDA 2LY9A 3RQ4A 2IVMA 2RC4A 3RPQA 3MZ8A 3VYSB 1XS9A 4IHTA 1UMQA 3H9JA 2V1UA 3ISPA 2QQAA 2Y2ZA 4AC0A 2L5QA 4XRSG 2LK2A 4XRMA 1OCTC 2EFPA 3D5RC 3T8RA 5B1AH 2FBIA 1QHGA 2BBYA 2JPBA 2HYJA 4BKXA 2TRTA 2Z5UA 3TO6A 2K9MA 5ICCA 1RPWA 2DA2A 2L7MP 2YSRA 2XV4S 3R0JA 4RGSA 4BBRJ 3ZRGA 3J81Z 2XAJA 1FZPB 2JUCA 4HNVA 4M6VA 1AWCA 5FLVA 2HYFA 1JJ6C 1Z9CA 1ON2A 2A07F 4KDPA 1S6LA 4NC6A 2EQRA 4BNCA 3HIFA 4E7SA 2H8WA 1TT0A 3I4MJ 2DLLA 2IS1A 5CQEA 2W4SA 5ILUA 4ZTFA 3SYTA 2Y69H 2DMTA 2EINH 3QWLA 3RCOA 4LG0A 2KP6A 3K4NA 2CSOA 3HOTA 1XDUA 1N77A 4BL0B 1ERDA 3WU0A 3JAMZ 2E2JJ 3RZDJ 3OYFA 5AIPA 2Z1DA 4ZC3A 4B44A 2XGXA 3FK6A 2CUJA 4LD5A 5DCMA 3K1NA 2QA4I 3WGIA 3AAFA 4NB5A 2VKHA 3WE3A 2VXZA 4BJTA 1I6XA 2MW8A 4EJUA 1V55H 3GF2A 3SDGA 1A6QA 4ABZA 4P1WA 4UNOA 4KT5C 2V1XA 2XAQA 4G6QA 2QBYB 3BOQA 1FTZA 1EH6A 2KIUA 1HKTA 3LMMA 2KRFA 3CJQB 5IP9J 3ULQB 2HOEA 1I50J 2JWTA 1D5VA 1XSXA 4HNUA 2DCEA 3S17J 3DU6A 2KQRA 4GYGA 2X1CA 1O3QA 1POGA 2OZ6A 2CQQA 4EM0B 1MMSA 3GMEA 1T56A 4JK1X 4XKVA 1O3RA 2BW3A 4YRVA 3FHNA 4Y15A 1JHHA 5JLXA 4X0GA 2CG4A 2WADA 2HS5A 3E1SA 3KPHA 2VT3A 5M3MJ 3HOWJ 2XGDA 3HGYA 5FROA 1O7FA 2HDWA 1FC3A 2L7FP 3I53A 3SZTA 2VC1A 2ADUA 3M7GA 2WB1A 1ZYRF 2LFBA 3DTIA 4MLOA 3ZQGA 2W00A 3H5AA 1RR8C 3PSFA 1KU3A 3RKWA 3S1RJ 2IS4A 3OS0A 2DPUA 2E7WA 5F0FA 1O4XA 2QSHX 5IYCJ 3E6DA 5L3CA 4D9JA 3PIPF 4CH7A 4EQQA 2BY1A 1ZRCA 5FLMJ 2X6YA 2XF6A 5D8KB 2Q8KA 1FTTA 4M3GA 2LRDA 2DA7A 1ZR4A 4A3CJ 2X51A 2D1HA 3LA2A 2G9WA 3F8MA 3FMRA 2VOOA 3NEUA 3P7NA 2F48A 1YW7A 4UHTA 1G3WA 3WG7H 2DFIA 1RI7A 4ZDLA 2F5CA 2DODA 1K78A 1OCZH 3CUQB 1G3YA 2R92J 2BXYA 3L00A 3PQJA 1MNMC 1J2XA 3LSTA 3H92A 2IS6A 2QUFA 3GCMA 1WQ2A 2RKHA 3KX2A 4CCMA 1X2NA 2VE9A 1F43A 4FX0A 5E17F 4JQFA 1QVTA 2HFHA 1HSTA 4P5OA 2CV1A 4HNTA 2YUSA 3HYIA 3FKJA 2W7NA 1ZHFA 5BS6A 2BGCA 2JUGA 1IV6A 1EF4A 2W1OA 3GTKJ 2IXSA 4HG2A 2R7OA 1S9HA 1LFUP 4V2FA 2HZDA 5FFZA 2OU2A 1ULYA 2HXIA 2KISA 3SFZA 4Q48A 4C2UA 3F3XA 1QPMA 2L9SA 3FMQA 1V5GA 4GYIA 1N75A 4BJ5C 4HV6A 2W24A 3Q9VA 2P6SA 4CZCA 5KK1A 3S2HJ 1FX7A 3CUQC 1IZ1A 4U7BA 2BHZA 2K5CA 3ONQA 3H5RA 5B5EC 1FMVA 2DA6A 2FMLA 1A5JA 4MQVA 4BDYA 4FE4A 1XDSA 2M30A 2R7TA 2CW0F 4NC8A 1ZRFA 1FMWA 2XGCA 1WH5A 2EIMH 4M74A 1JGSA 5EZGA 4Y33A 2PLYA 1VQKI 1L3LA 3JTHA 5J1UA 2JT1A 4ZJZA 1MH3A 3WHCA 3CCRI 5E18F 1MDMB 1A04A 4P9FA 4I76A 2M8EA 1S7OA 3BROA 2JA7J 4M6YA 2XKOA 2NOJB 3GWZA 4OU0A 2EV5A 4XOPA 4Y7NJ 2DFFA 4CA0A 2K02A 2YU9J 4HX4A 1R22A 3H0DA 1XD7A 4A6DA 3V42A 5FFXA 3FXQA 1F5TA 3NQOA 2MABA 2XF7A 2JJ7A 2QBYA 3G1MA 2EBIA 3ESWB 2ME6A 3VSLA 2ACJA 1FOKA 3GXOA 4ESJA 3FBNB 3T5XA 4ZDPA 1XCBA 4JYKA 2K86A 2CMPA 4U0VA 4P55A 4XOTA 1IG7A 2DI3A 3IWZA 5F08A 2BVMA 2VN2A 4UXNA 2E19A 2J5OA 4EJVA 1MBGA 1ZELA 3WU1B 4E7LA 2V6EA 2WAQA 1TQIA 3M3YJ 5L3FA 4BU2A 3IKTA 1T39A 1BN5A 2CW8A 2ZKZA 1MMNA 3LA3A 3WHBA 4I6ZA 4HV5A 2LOOA 3HOSA 5E3LA 4H0EA 1KZHA 4IL6C 2V9KA 3UNGC 3QYEA 1VQ8I 2A5YB 1SAXA 2CYYA 1MD0A 2FX0A 1G6NA 4IHXA 2PEXA 3VYUB 3P9CA 1SFKA 2DFHA 1RKTA 1BR2A 2BOLA 3WE2A 3PSIA 2FU4A 1BI2A 4HDVA 3BR5A 5DUIA 1D8JA 1X1DA 4D0PA 4DYCA 2XAFA 1R49A 1FYLA 1LDKB 1IJWC 1H88C 3OYIA 1LNWA 3FM3A 2BZTA 2TDXA 5JFRA 1P4WA 3K4JA 4QSHA 2GXGA 1WFXA 2VBZA 3SEZA 4XQFA 3J80Z 1PVEA 4ZZLA 2XASA 2O8XA 3W2AA 1FYMA 1NK3P 3CCUI 1GUUA 3ZQLA 1OCOH 5LLQA 1MMDA 4YIIA 2VQHA 4A3IJ 2EIKH 5H6QA 1MKMA 3K4KA 4Y17A 1OLTA 1TWHJ 3IP4B 2HQRA 4WF2A 4UV9A 2K40A 1T0FC 2M0CA 5D8LB 3COAC 3CUQA 1SD5A 3A03A 4DGWB 3J81K 5JLWA 2VOPA 1LE8B 2HOTA 1I1SA 2I10A 4HZFA 1ETYA 2IGOA 2Y0SA 2JSPA 4CXFA 2M5WA 1EH7A 3KIOA 1U6GA 1GXQA 2GBYA 3D5SC 3KYLA 4A93J 5F04A 3Q0VA 3ABKH 5JVTA 5KVRA 2DDBA 3PUBA 1S72I 1ZQ3P 2LYCA 2YPRA 2W82A 2P81A 3CDHA 4XLEA 1SFEA 2EFOA 4HX8A 2DK8A 2Q1ZB 2PX9A 2PN6A 3S32A 2MSYA 3JREA 1U9NA 4LITA 1I39A 2PMZN 3I5UA 2NAZA 2XPVA 3MVPA 5HLGA 2IJLA 2XKPA 1B9NA 5ICFA 3IRQA 4C2TA 4ZYDA 5H2FC 1PDNC 2HYGD 3CO6C 3H1CA 1ZRDA 3ZPLA 1RZ4A 4G12A 3WTWC 1CQTA 3KP3A 3RPUA 2NS7A 1SEUA 4KICA 2Q2EB 4GCVA 1LVAA 4GDFA 2L4AA 4GRIA 1TWFJ 2DT6A 3GFLA 1LQ1A 3GFIA 3DWLE 4LG3A 4A0XA 2E36A 3MQ0A 2M7BA 3BZ6A 4XR6A 2E71A 2L02A 2PMUA 3PUFA 3GLXA 1WJCA 1ZKGA 3WU2C 1PUFB 4KYWA 1MDMA 3HUGB 4ZYGA 2RNJA 4XIDA 3HRSA 4PJ0C 1U5TC 1JXSA 1FIPA 3S1MJ 1YW8A 5DD4A 3PO3J 3R6SA 1USTA 4I98B 4E7KA 3ZQQA 2BE5F 5LFAA 2EFNA 3TGNA 4MTEA 2G7UA 3BQYA 1TL8A 1BBYA 4RGUA 4UB6C 1LDDA 2VUMJ 3RYRA 1WI3A 1MW7A 2XHKA 5F6FA 2VKDA 3EYYA 1V3FA 2K4JA 1WRJA 3PM1A 1FBSA 4XM3A 5JI6A 2NVQJ 1AOYA 2XSDC 3W6JB 2V6CA 1HA8A 5FKKA 3ZOBA 2DMPA 4IPAA 4RBOA 5D5WB 3F21A 3P5JA 1SFXA 2COMA 3OY9A 3OSGA 4AM3A 2ZB9A 1B8IB 1R00A 4HBLA 3QU6A 1SFUA 1RIOH 2E1NA 1T0FA 4RGXA 4HF2A 1MBEA 5FGMA 2EILH 4MFDA 3DFGA 1F9NA 1IAWA 1GV2A 4WX9A 1OPCA 5IT9Z 3VYTB 1Y8QB 5KHDA 2RNGA 3W6KB 1VQNI 4D1QA 2HKXA 2Y31A 2QWWA 4MEXF 5F1RA 4KMUX 4II3A 3M8EA 4OINF 1O57A 4M9XA 5CVJA 4KUMA 1VQ7I 1WHUA 3CD6I 1PP7U 1B1BA 3BTJA 1JI8A 2VQLA 4M9SA 2R5ZB 1G4DA 2X6OA 2R7ZJ 1BR1A 1GVJA 2O0YA 4BS9A 3OL4A 1IC8A 1YTYA 1RUNA 1XMKA 2QQ9A 4X6AJ 1FLIA 4M6XA 4L18B 1MJ9A 2QKLB 1JT6A 3OOUA 4DQ2A 4EGZA 2STWA 2NNYA 4IQJA 4Q5SF 3LSJA 2O8KA 2VBYA 4NQWB 1N25A 1FOWA 2H09A 3C2BA 1X1BA 5CVRA 4AWXB 2VLAA 2WAQN 3TL4X 5L3EA 4LLGF 5FKNA 1FT9A 3K1PA 3L2UA 3HOUJ 1KYZA 3CCLI 2HOAA 5D4SA 3AG2H 3BDDA 3KP7A 2ICWG 4JX6A 1KU9A 1LE8A 3RKXA 1N78A 1IXCA 3SXYA 4Z6YA 1K6YA 4IOAF 1WJFA 1HOMA 4U87A 4EATA 1SMTA 2F2EA 3LNQA 4RB0A 4XN0A 2ELKA 1AKHB 3MMYB 3QPSA 4IZZA 2HVQA 2AXLA 1JKPC 3K70D 4HSTA 4RM2A 4PGGA 2KJCA 4IVNA 3OSFA 2FJ1A 3T1BA 2TCTA 5E1ZB 2VODA 2QGUA 3SDBA 1MMAA 3ZR8X 1QPIA 2ESNA 4XSZF 3CJTB 1IUFA 5E20A 2VJ5A 4EGYA 4FETA 1ZGJA 3DPTA 4DZJA 2K3FA 1BI3A 2LC2A 3IKVA 3K70C 4OWRB 2LKPA 3RIRA 5KNLA 4FE7A 2BY2A 5HDNA 3SHFA 2CQXA 4N9IA 1UHWA 2GOXB 3DKXA 2E7XA 3D5LA 4KFCA 2BV6A 2Q2EA 3GW2A 4RAGA 1XB4A 2ZC2A 1Z21A 4HDUA 1S5LC 3QP5A 2Y0SN 5DD8A 2EV6A 4HQMA 3I9V2 1P7IA 3WODF 3FKIJ 4B3XA 1SD6A 3CMEI 1KQ0A 2X6XA 3M9AA 3R0AA 4CCNA 5E8GA 1OR7C 1YHQI 1PUFA 4CSWA 3HUGA 2Z16A 1FP2A 2IGNA 1X1PA 4YIRX 1R58A 3BR6A 3VDXA 2NOGA 4DJAA 1P4AA 2LF7A 3ERMA 5J4YA 4IQ4A 1BI0A 1GDTA 1ZG5A 1Y1VJ 5EYRA 3CDLA 3DCFA 5F0CA 4CCOA 2HKOA 3BJ6A 4AIJA 5J4VA 2I5UA 2GIVA 2FEZA 1QZZA 2EJRA 2QSGX 4N9HA 5M5WJ 2HNHA 2O5RA 2GA1A 4A6EA 1D0XA 3FHZA 3OYKA 5FLXK 2GLOA 5BNGA 3FXKA 3BT9A 4TV7A 5HS7A 2M2EA 1QNTA 2V79A 4FTHA 2ZXHA 4XLNF 2W48A 3HEFA 4JOMA 2X1DA 3IL2A 1B8IA 2NS0A 1IRXA 5HODA 4I0BA 5HLTA 3BTCA 4XK4A 1TNTA 4R1HA 4XLHA 5DM6F 3D1NI 5LGTA 5EGOB 4KMFA 3HRMA 4HRIA 5F27A 4OIQF 4N0BA 1IDYA 4IOCF 1HSJA 3EDPA 1UAAA 3S1QJ 1E3OC 2LH9A 4BQAA 1X3ZB 1QQIA 3E6BA 2DA3A 2V1NA 4HSRA 2LLKA 1E17A 1Y8RB 2Y0MA 2X6WA 2ID6A 3IH4A 3B6CA 4ITVA 3F23A 4IXAA 4BACA 2DOEA 3HSFA 3MCZA 2R5ZA 1O3SA 4CDGA 4EJOA 5IP6A 2YX7A 4IRIA 1Y1WJ 2F4MB 2PBIA 2P5KA 2Z2SB 1IDZA 5BQTA 3JR9A 2FF4A 3JRDA 4Y4RA 1D1AA 2CRGA 5LBQA 4DBQA 3C7JA 5C4JJ 3Q5FA 4JP0A 5IOZA 2OTJI 3QQAA 3W6VA 4NQWA 4PUSA 4P96A 2LKXA 2R7WA 5K5RA 2Z33A 1DDNA 2ZNZA 1F1ZA 2GAUA 2NVXJ 4HF1A 1WWXA 2JA2A 3EPZA 4BY7J 4PGHA 2P5LC 2RV8A 1RR7A 1DGWY 4PFPA 3QAHA 5EEGA 4G7ZF 3DP7A 2DN0A 5K7ZA 5K5OA 2CQ7A 2E34A 3E0JB 5ICGA 1IV8A 1LKXA 2RAEA 1ZREA 4V2GA 2FQ3A 3FF5A 3C1DA 2JPCA 3GTPJ 2AQFA 1IN7A 2K4BA 1AKHA 2A5WA 2ME0A 2OBPA 1DPUA 1TZLA 3O6BB 4NDLA 2M4GA 2V26A 1OR7A 2QCOA 3WTXC 3VWBA 5AONA 4B47A 1MMGA 2B63J 5D5UB 4KIFA 1VFCA 2DA4A 5H6RA 4X1EA 3CP8A 3F9KA 3L7WA 1I5ZA 3JRHA 2CU7A 4PDKA 4PCQA 2NVUB 3IRRA 3MKZA 4IJAA 2VI6A 3I4PA 1TC3C 3ASOH 2YU3A 2EPFA 1CF7B 1W5SA 1H9TA 1UCRA 1FOXA 5CVUA 5GP9A 5KCMA 1IXSB 1B59A 4IRHA 2CFOA 4B1RA 4ESFA 1H8AC 3RJPA 1YE9A 4PSWA 3QPTA 2X9DA 1I6HJ 1Y0UA 3FWEA 2IA2A 3QPHA 3HOYJ 2H94A 1BIAA 3TMOA 1QZYA 1RETA 3MN2A 2QLZA 3TW7A 2K9NA 3GZNB 4Y3OA 2E1OA 5J40A 5LRSA 4ENNA 1T8IA 2YX4A 2KLOA 2BYVE 3KE2A 3CF5F 3C2HA 3RKYA 3BLYA 2R7DA 4AYBA 5IT9K 3BZCA 2LSOA 1MSFC 3RQIA 5FJ8J 2V4JC 3ZMDA 3HKZA 3CCVI 1BM9A 2CQNA 3BPXA 5JR3A 3QPLA 4BQNA 3HC7A 3A4CA 5HOOA 4UVBA 1GXPA 4M3BA 5D6FA 2W85A 1G3TA 2VQCA 4BQOA 5GAHJ 4BXFA 3OYCA 4XL9A 4PJMA 2LP0A 3OYJA 2CFXA 1M1EB 1YO5C 4KN7X 1PP8F 2LG4A 3HGGA 3ZMVA 3LFUA 3AKZA 3S1NJ 3KETA 2D45A 3HXLA 3DKWA 3F6OA 4OAZA 1SVMA 3DEUA 4UUTA 2ZJQF 3ROUA 4CGZA 5ED4A 1H89C 4LB6B 1QGPA 3IWFA 3BTLA 4L9NA 2UXNA 1V4RA 1SVLA 3E7LA 1ZTRA 2XAHA 1VQMI 2X48A 5B3SH 1TBXA 1UZCA 5EGOA 3RSNA 4NBQA 2OTLI 1OYYA 1IO2A 3PNVA 2CWEA 3V8JA 2LDUA 1BOAA 1X3WB 1HBXG 4ZZDA 3HOXJ 2VQGA 3Q0UA 5HNFA 1WPKA 3CQZJ 2K7LA 2HEOA 3I54A 4HLXA 1A35A 3TBIA 3RKQA 2W84A 1T98A 2XPWA 3HSEA 2BY3A 3W2VA 4NC7A 1DPRA 3IUOA 1OYIA 1H0MA 1MBJA 2HTSA 1TQPA 2LD5A 1JE8A 1WJEA 5D6EA 3EYIA 1KU2A 2JN6A 1ZGWA 2ZMEB 5GADJ 2IP2A 1Z1DA 1FYKA 1LEAA 3G4SI 4A0YA 5L3GA 5EG0B 1ONVA 2EA4A 1XPXA 3HHGA 1W0TA 1W36D 1TW3A 1A6IA 1HQCA 1IRZA 3BR3A 1SD4A 1SFOJ 1TWAJ 3RPUD 3LQQA 3CMMA 2LVSA 2ZXWH 5L3DA 4WXDA 4AVZA 2RDPA 2ZSHB 3L2CA 1W36C 5E8IA 1WKMA 1NHAA 4LK0F 1MNEA 1ON1A 3BG6A 1X19A 2H1KA 2EFQA 1X4OA 2AXTC 3MD2A 4O3MA 1YFHA 3OOPA 1E0EA 5JVGF 2JA6J 1YOVB 1S3JA 4HQEA 1T33A 4C3JJ 2E5ZA 2LMDA 1W7PB 5K7HA 2WAFA 3F8BA 2M3AA 5E1XA 2ZMEC 1AU7A 2P7CB 1UJ8A 4BHCA 2N8GA 2WY8Q 1OCCH 2IEKA 1TWGJ 1ZLJA 4XLAA 1VTNC 2GXAA 3H9QA 5ILSA 4F92B 2ZNYA 3FDYA 1VZ0A 2KRHA 1ZH5A 1CF7A 2VIXA 4D5FA 3JRBA 4E70A 1VQLI 2L9VA 2L9NA 3CCEI 2K27A 1TT5B 1XSVA 3O2PE 2EB7A 4BY1J 2EK5A 5D5VB 3I64A 3K0LA 1YRNB 1T2KA 3HRUA 2W57A 2PFBA 1YQAA 3VYRB 5FLXZ 4FISA 5LRRA 2O7OA 3KP2A 4IKFA 3NWSA 1Z67A 2XAUA 2HVSA 1IW7F 4DNCA 2WV1A 1XCVA 3SEQA 4A5MA 3VODA 2FE3A 4F91B 1J09A 3AL0B 1D1CA 2CW7A 4YELA 5EZHA 3BR2A 3K4LA 1JKOC 5GAGJ 3DXJF 3GTJJ 2F5DA 5M3FJ 2FNPA 5BPDA 1J59A 5DCFA 3H9GA 5E3OA 2MGQA 1V5EA 1U8RA 5GPCA 5IYDJ 3K2AA 4RB3C 2F4IA 3DKYA 2V9PA 3OIQA 1RKWA 1EKEA 2HQ5A 4RLQA 1K4TA 2FQ4A 2VKEA 3IHUA 5HDKA 1MJAA 5CVIA 1YYVA 3LSPA 2WB1N 2Z99A 3K4MA 5HS8A 3N05A 1ORKA 2PQ8A 2HTJA 1R23A 2Z9OA 2HQAA 4BYYA 1OMIA 2VT2A 3HRTA 3G73A 1WGXA 4HLYA 5LD2C 4KJZA 1D0YA 4PJNA 1DP3A 3IV5A 1WCMJ 1R71A 4BDZA 1R1UA 2H27A 1NG6A 1E2XA 4ZYEA 2XPUA 3HBLA 3MWMA 1LFBA 2WV0A 4MTDA 3OYBA 1WI9A 2DYRH 4FQGA 4R8HA 1IN5A 2VJIA 3QU3A 3OYEA 3KYDB 4ENMA 2DOFA 3KYCB 1EJ9A 2MH2A 5AIQA 3TDUC 1S7EA 4LMYA 1BA5A 1YW9A 4DBRA 1QU3A 1J75A 2ZJ2A 2XC7A 1W0UA 3BPVA 3DTKA 2ESHA 4L9JA 2DYSH 4DIQA 1EA3A 3KP5A 3DV8A 4M3EA 1LPQA 1HW5A 3GO5A 1KA8A 4EEFG 2L2OA 1FOYA 4QPOA 1P7JA 2X1EA 1RNLA 2H1LA 2RQQA 2IRFG 2A05A 3WTVC 5LGUA 3H0GJ 4EJTA 4G7OF 1ODDA 2COBA 1KQ8A 3JRGA 2QEXI 1D8KA 3RYPA 2LKSA 1WJBA 4B8XA 1NH3A 3HTSB 2ZMEA 2X0LA 2R0QC 4XLPF 4A69C 5EG0A 2GM4A 2IT0A 3FX3A 2B7EA 2K3PA 4QIWN 4A3FJ 3ECOA 5LHIA 1HCRA 3EUAA 2CGPA 1HKQA 2G0EA 3G71I 4OIRF 4A3JJ 1X1AA 2QSFX 1KONA 1XX5A 1J5YA 2DT7B 3L09A 1HKSA 5B66C 4KT6A 2Y9YA 4B09A 2DU9A 2EFWA 2V7FA 4XN3A 1XGNA 4MHGA 1B6AA 4XBFA 3M8FA 1VQ9I 1B9MA 2P6TA 4EM2A 4OIOF 5FRNA 2DQRA 3HM5A 3PO2J 2KIMA 1GV5A 3WGGA 5DS9A 4BE1A 3JW4A 2KMUA 2JK3A 3HG9A 2XGEA 3I3LA 2MA3A 2HQNA 5TJJA 3OYNA 3E5XA 3Q3SA 1W7PA 3FZVA 3A01B 3LSMA 4FCYA 1YITI 3PIOF 4MIMA 4XMYA 4M71A 2NVTJ 2KKOA 3BY6A 4AIDA 2E35A 2PJRB 1S8NA 3J7YJ 4CHUA 4AIKA 2B9SA 2WC2A 3M8JA 1K6OA 9ANTA 4C3IJ 3CUOA 2KDOA 4A0ZA 5GAEJ 3L2VA 3HPHA 2VBXA 4G6DA 4G9YA 3X2QH 2GXBA 3HPGA 2EZIA 2P7VB 3DEWA 4GGGA 4XKCA 1JUPA 2G7HA 5K7FA 2A6HF 5DYMA 3A2KA 3NRVA 3KEOA 4F52A 1B72B 3P9IA 3FXUA 2OD5A 3JTGA 4XONA 2F6CA 2RN7A 3M4OJ 2IA1A 3L1PA 2ZFUA 1YRNA 3O8HA 4MO7A 3L9FA 3S14J 5C3EJ 1J9IA 2M45A 3F8FA 4JX5A 2ZXIA 3GEZA 1E3HA 1YJWI 2XVCA 2DK5A 2Y9ZA 3S16J 5BMZA 3WTYC 2Y30A 3UKGA 2R7VA 1SVOA 4M9ZA 4ON0A 1QO0D 2STTA 2MC3A 4RLFA 2OV7A 2E2IJ 3OS1A 1XG1A 4ENKA 1UFMA 1XTAA 2QQ8A 3TP3A 2VB6A 1RUOA 2BHYA 1P6RA 4QTRA 2VPRA 4A5NA 1LUJB 1OFCX 3CCSI 4IF4A 1C0WA 3EETA 4J01A 3TO9A 4NHJA 5C4XJ 2F5FA 2CH0A 5LEKA 2DMQA 2JVHA 3BTIA 1MBHA 2XDVA 5J1YA 1YS6A 4G94A 4A12A 1GVDA 3OR2C 1RC9A 3KCCA 2F4OB 3I56I 4U7DA 1Q1VA 5DCMB 2L54A 2L01A 2OJED 3CJNA 4JX4A 1I1GA 1KYWA 4Q4ZF 3I0TA 2KZVA 1QZEA 4ESBA 2L7ZA 3JSOA 1FBUA 1R5GA 2EZLA 1IXRC 1ZG3A 3I71A 2KJBA 2OUMA 2QVOA 3GVAA 3ECHA 4PJLA 3V7RA 2V9VA 2HU9A 2Y75A 1Z0XA 2IGMA 3BR1A 3CCMI 2GWRA 1JKQC 1KU7A 2VONA 1XC5A 1OJLA 3IC7A 4ZYAA 5M5XJ 3SJMA 3KLNA 2MFZA 3OR1C 1LVKA 1BJZA 2H6CA 4U0WA 3CDIA 4MQ9F 2JMWA 1HXDA 3ZMSA 3PNTA 3O8GA 2RVCA 5FKOA 2C6YA 1JKRC 2CUFA 4QWQA 4L9VA 4XLFA 4CICA 5BOXA 4AUXA 2RREA 2VASA 4I7HA 1YJ9I 2E5NA 3N4MA 1TW2A 2QYOA 2R93J 3IAS2 4YFXF 3EUHA 3CESA 4O6JA 4XRFA 2R7UA 4B48A 2IGKA 1YS7A 2M9HA 4AIHA 1V5FA 4ASNA 3GLLA 1IF1A 2A61A 2DA1A 5J47A 2IA0A 3S2WA 4IEJA 2JRMA 1TNSA 4RGRA 1DU6A 1U8BA 1XN7A 1TWCJ 3PL8A 1UG0A 1R4MB 2EZKA 4R79A 4XKBA 1BI1A 2VC0A 2IAIA 3ELKA 4KN4X 1WJ5A 3H3ZA 2HVRA 1Q1HA 2HR3A 4H4KC 4NNJA 1FBQA 2FSWA 3FBIB 4LFUA 1Y56A 4J19A 1G2HA 2NXNB 2A3SA 2HZTA 4WXHA 1JUMA 2NVYJ 5F1JA 4P9UA 3WTZA 3F72A 3A01A 3DQVC 3VFZA 3VPRA 1Z3YA 2ZCWA 1VQPI 2CJJA 3KFWX 3VEPA 3H5NA 1XMAA 4BQQA 1XGMA 2LNBA 4HEA2 2UXXA 5DV5A 5E1WA 4FHTA 2PJRA 2XUBA 2FNAA 3U1DA 2VJ4A 4ZTJA 2F5EA 1FIAA 2JRTA 3MAJA 5HLHA 1Z7UA 2Z3YA 1K4SA 4BUPA 3FISA 2AO9A 4WWCA 3F6VA 3CCYA 3OV8A 4BXUA 4IHWA 3F0CA 3LSKA 2XIGA 3MZYA 1P2FA 5A2QK 1FPQA 1UHMA 2WY7Q 3U9GA 1B72A 3GFJA 4MEYF 2JZYA 1XGOA 3CF2A 4UB8C 4F7ZA 3F22A 4EMSA 4S04A 1B4AA 3QRFF 4A3GJ 3TKYA 3S2DJ 3BG9A 3AG1H 2FD5A 5TRDA 1JT0A 4A3LJ 3W2WA 2FBKA 2X4HA 5CQGA 3TP0A 4KNYA 3DLLF 2OQGA 4HOBA 1BOBA 2WTEA 4RB2C 1ZARA 3G6EI 2JA8J 3GZ5A 1BW5A 5FD6A 1KQ9A 4BHBA 2QF7A 2WBMA 5F0HA 4QPQA 1ZR2A 4DYRA 1IUYA 5TGTA 2LF8A 5CJ9A 1K7AA 5IOYA 1HDDC 1U2WA 3I58A 3J7AO 1FSEA 4XSXF 3I59B 5FRMA 4PSXA 3S3MA 3E3VA 2GOMA 5J6XA 1Z6TA 3OL3A 1YIOA 4BXXJ 3G2BA 4I99C 4E7IA 1JUSA 4L5EA 3JRIA 1J7KA 4AVPA 3VB2A 3DPLC 2XF5A 1APLC 3OIOA 1X1CA 2A6EF 2NRAC 2OC6A 2M7AA 1ETQA 1WSUA 3GX4X 4W97A 1SC7A 3Q0WA 3OYHA 2A6TA 4MNUA 3QYBA 4F93B 5F64A 1T95A 3DEEA 3C3WA 2QENA 1JGGA 4HW0A 4U0YA 2DJIA 1QBJA 4XRSA 1MIJA 4K2EA 3FMSA 2OF7A 3A1YA 5H20A 4MFEA 3M07A 3AFHA 3OYDA 1AA7A 3CP2A 3S3OA 1QRYA 2GA2A 3HJEA 2OAZA 1NTCA 3HOZJ 3MKWB 1R4NB 5FKLA 2R5YB 4HA8A 2EH3A 3K9TA 1DU0A 4E6KG 3K2ZA 3QP6A 2FA5A 3QOEA 5K5QA 1GHCA 4GXOA 2DMUA 2VPLA 5CYVA 1UELB 2HDCA 3GFMA 3CTAA 4OOIA 3WG9A 3Q9SA 3KEQA 3GTLJ 5C44J 2ID3A 4PJJA 4C3HJ 2LBFB 1XGSA 3GYHX 3L2WA 4BH9A 3FXRA 3A0HC 2ZJPF 3DF8A 1STZA 4BJ6C 3ABUA 3BG7A 4CYCB 3JRFA 1QVUA 4C30A 3BG3A 1SANA 2ZBKA 2FMYA 2AQEA 2K85A 1U0JA 3DU5A 4L0YB 3SQNA 1FNNA 4AU7A 2L4MA 4HAMA 1K79A 1OISA 3HL2A 3K4BA 1ETWA 2K9LA 3GUDA 2H8RA 5EF6A 3S8PA 2MD0A 3ABMH 3KZZA 3LFKA 2DOAA 5TISC 5J1RA 3V8LA 4GO1A 1EH8A 3R4KA 3HOVJ 4YG2F 2PMZA 3N97A 1R6RA 1TTYA 4CCLA 2LTPA 1HF0A 4I02A 1SAUA 3SZPA 3R60A 1G59A 3K7AJ 5DM7F 1WJAA 3ZXSA 5IP7J 3B6AA 1BC7C 4D5CA 2Q0OA 3ERED 2IS2A 4BE0A 2KT0A 1VF9A 4RA2A 1X3UA 4LIUA 2KL4A 5EDNA 4CUGA 2E1CA 1LJ9A 2OQRA 3LSRA 2GQQA 2K9SA 3OYMA 4Y52J 4ZDOA 3K10A 3F8CA 1NK2P 2L0KA 4I0AA 4KIBA 2QKMB 1YX5A 4A3EJ 2M4KA 3BCBA 3CLOA 2KIQA 3E5UA 1MZBA 3QODA 1VQOI 3GTGJ 1Z7LA 3TQNA 5JHUA 1OQYA 1R1VA 3OIPA 4M73A 2P8TA 3CLQA 5CPRB 1VQ5I 5J8FA 3ZQFA 5HLIA 2WA0A 3BR0A 4GFBA 3VSKA 3BJOA 3ASNH 5EEAA 3ZN1A 5CLSA 1USSA 4BE2A 2E1MB 4RS8A 4L5JA 1ETOA 2P0WA 3EQLF 1YIJI 1GT0C 3CC7I 4IHSA 2O9LA 4B43A 6PAXA 4OMZA 3A02A 3E5QA 2BEOA 3FIWA 2ISZA 3FXLA 3LSHA 4PFOA 3HDDA 1Y6IA 2ELHA 1WVRA 2DFEA 4OMYA 2L7KA 3OYGA 1Z77A 1V54H 4YFNF 3NWTA 2OCCH 3JRAA 3KP6A 2ECBA 2J5PA 4CYDA 2M8GX 2DT5A 3UR3C 2ZXJA 2R7SA 2A68F 5ERIA 4LGWA 2UUZA 4F3QA 2NYXA 3I59A 2M1BA 5D5XB 4C2MJ 2VL8A 2CV0A 3LAPA 2XAGA 1ZGAA 3G1OA 3IH2A 3RDIA 2V1DA 1I3AA 3LAJA 3DBRB 2CV2A 3ABLH 3RZOJ 4Y13A 1GLNA 3LOCA 4N4NB 1ZAOA 2RQPA 3R61A 4RAFA 2DJNA 3S93A 2EIJH 2PMHA 3TW6A 3REOA 4ZYHA 2E1MC 1G3SA 4L9TA 3V7SA 3ZQIA 3HZJA 2CUEA 1U9OA 3BWGA 5ILVA 4IO9F 2DPDA 2MG4A 1P4XA 4E7ZA 3H35A 4B4CA 3ZN0A 4BBSJ 3TO7A 1IRFA 2BXZA 5JHFA 4I2OA 2DO7A 2HOSA 1UHSA 2X85A 4ANJA 5LGNA 1BR4A 4HX7A 2KIFA 1JHFA 2I8DA 3PNYA 1T6SA 2B0LA 3SFIA 2R5YA 4BEHB 2VBWA 2HPIA 3TOBA 2D5VA 4RMNA 3V4GA 1W7PD 2MYSA 3GTMJ 3AG4H 1OCPA 5M5YJ 3G3ZA 3LL7A 1ZK8A 4A3MJ 2R7FA 2LBFA 1RESA 2DA5A 1ETKA 4C9YA 1Z3XA
chains in the Genus database with same CATH topology
1TLHB 2FOKA 1UB9A 4HF0A 2O6GE 4UVCA 1HW2A 1S7AA 2XROA 2QM3A 4U88A 2OA4A 3T8TA 1BIBA 1W5TA 4L5IA 3KP4A 3O3KA 3ZP5A 2YR2A 5EEHA 5A2QZ 1LEBA 2P5VA 1IN4A 1R1TA 2HGCA 3K69A 1DUXC 4Z2YA 1J0RA 4KIGA 3V8KA 1SD7A 3D0SA 2FRHA 3WGHA 1L0OC 3MEXA 2PJPA 1FY7A 1I27A 4ENJA 2MBFA 1IN6A 3PQKA 4I09A 5L3BA 1PUEE 4L0ZB 2ZO4A 1Z6RA 2DTRA 5J8CA 4BHPA 2RGVA 2O03A 3JAMK 3K1MA 2XRNA 1U5TB 3HSRA 2JSCA 4S05A 4G7HF 2O3FA 2L3DA 2QQBA 4LLNA 2P4WA 5FB2A 1ZN2A 5LEJA 4OIPF 3KLOA 1FWZA 3B02A 1Z05A 5IT3A 1TQMA 5D4RA 4UUVA 1O3TA 1D3YA 5LHHA 1FP1D 4FX4A 1ZG1A 4JBAA 4PZJA 2W25A 3LWFA 2QZ8A 4RAZA 1XSDA 3V7CA 2EWNA 2R3SA 2FBHA 5CVVA 2O61A 2MD5A 2D2WA 1Z91A 3E6MA 3LQRA 2DQLA 2Y48A 1DP7P 1S29A 1FSHA 2PI0A 2MLKA 5HVQC 1O7LA 4LJZF 1IN8A 5DEQA 3H3UA 1HW1A 1CGPA 4EM1A 5DUKA 2EV0A 5ICEA 3U2RA 1SMYF 4UVAA 3KZYA 3ZMUA 4EV0A 1YLFA 2HWVA 4ETSA 1MGTA 4MGRA 1EV7A 3ZMZA 4EJWA 1YG2A 2D1VA 4A2UA 3ZQ7A 1U3EM 3ML6A 4QLCU 1R36A 3E97A 4LG0B 1LDJA 4M72A 4RAYA 2VE8A 4CZZA 2MH9A 2CO5A 3TDZC 2ZFWA 4IRGA 3F8NA 2DAOA 3PFIA 4FT8A 1ZLKA 5FO5A 4BAYA 1H9GA 2A69F 1KGSA 1W4MA 1T38A 3RTRA 4RB1A 3GZ6A 5BPIA 3M1EA 2FXAA 2UWMA 4EVIA 1LB2A 4UV8A 2GZWA 2DW4A 1REPC 1IRGA 3WTSC 3B73A 4Q47A 4LK1F 3TOAA 3JSPA 1OYWA 1U5TA 2M87A 2WWYA 4HYEA 4AD9A 3QOPA 2CQKA 4I01A 3MZHA 2IW5A 4LLLA 4YIFA 1BC8C 1U78A 3RI4A 2ISYA 3BJAA 1P92A 3ABTA 3P9KA 5HS9A 2MLGA 3T0YA 2ETHA 2AS5F 4WK8F 4ZH4F 3HTUA 1R5HA 4WXCA 2UZKA 2PG4A 2NNNA 3HHHA 2EA2A 2H6BA 5HDGA 3CO7C 3WTUC 1K78B 5DDGA 2OZUA 3MFKA 3ZMTA 4G8XA 1OKRA 5K1YA 3FM5A 4LB5A 3C18A 3BP8A 3VOEA 1F4KA 2IPQX 4CO8A 3LA7A 2DBBA 1R7JA 4YFKF 4WCGA 4KA4A 3E6CC 4O5VA 3J80K 1MJBA 2JTVA 1BJAA 3WTTC 5FD5A 5LHGA 2IVMA 2RC4A 3RPQA 4IHTA 2V1UA 3ISPA 2QQAA 2EFPA 3T8RA 2FBIA 2BBYA 2JPBA 2Z5UA 3TO6A 5ICCA 2YSRA 2XV4S 3R0JA 4RGSA 3J81Z 1FZPB 2XAJA 1AWCA 2HYFA 1Z9CA 1ON2A 2A07F 4KDPA 1S6LA 4BNCA 3HIFA 2DLLA 5ILUA 4LG0A 2CSOA 3HOTA 1XDUA 3WU0A 3JAMZ 5AIPA 2XGXA 4LD5A 5DCMA 3K1NA 3WGIA 3AAFA 4NB5A 3WE3A 2VXZA 1I6XA 4EJUA 3GF2A 4UNOA 4KT5C 2V1XA 2XAQA 4G6QA 2QBYB 3BOQA 1EH6A 2KIUA 1HKTA 2KRFA 3ULQB 2HOEA 1D5VA 1XSXA 4GYGA 1O3QA 2OZ6A 4EM0B 4JK1X 1O3RA 4Y15A 1JHHA 2CG4A 2HS5A 2VT3A 1O7FA 1FC3A 3I53A 3SZTA 2VC1A 2ADUA 3M7GA 1ZYRF 1KU3A 3RKWA 2DPUA 2E7WA 3E6DA 5L3CA 4EQQA 1ZRCA 5D8KB 2Q8KA 2D1HA 3LA2A 2G9WA 3F8MA 3FMRA 2VOOA 3NEUA 3P7NA 4UHTA 1YW7A 1G3WA 2DFIA 1RI7A 2F5CA 1K78A 3CUQB 1G3YA 3L00A 3PQJA 1J2XA 3LSTA 3H92A 2QUFA 1WQ2A 2RKHA 2VE9A 4FX0A 5E17F 4JQFA 2HFHA 1HSTA 4P5OA 3HYIA 1ZHFA 5BS6A 2BGCA 5FFZA 2OU2A 1ULYA 3SFZA 4Q48A 3F3XA 1QPMA 3FMQA 4GYIA 4HV6A 2W24A 3Q9VA 2P6SA 5KK1A 1FX7A 3CUQC 1IZ1A 4U7BA 2FMLA 4MQVA 1XDSA 2M30A 2CW0F 1ZRFA 4M74A 2PLYA 1JGSA 1L3LA 3JTHA 2JT1A 5E18F 1MDMB 1A04A 4P9FA 2M8EA 1S7OA 3BROA 4M6YA 2XKOA 3GWZA 4OU0A 2EV5A 2K02A 4HX4A 1R22A 1XD7A 4A6DA 5FFXA 3FXQA 1F5TA 3NQOA 2QBYA 2ACJA 1FOKA 3GXOA 4ESJA 3T5XA 1XCBA 2K86A 4U0VA 4P55A 2DI3A 3IWZA 2VN2A 4UXNA 4EJVA 2J5OA 3WU1B 1TQIA 5L3FA 3IKTA 1T39A 1BN5A 2ZKZA 3LA3A 4HV5A 3HOSA 4H0EA 2A5YB 1SAXA 2CYYA 1MD0A 1G6NA 2PEXA 3P9CA 3WE2A 2FU4A 1BI2A 4HDVA 5DUIA 1D8JA 4D0PA 2XAFA 1FYLA 1LDKB 1LNWA 3FM3A 2TDXA 5JFRA 1P4WA 2GXGA 2VBZA 3J80Z 4ZZLA 2XASA 2O8XA 1FYMA 5LLQA 4YIIA 5H6QA 1MKMA 4Y17A 2HQRA 4WF2A 4UV9A 5D8LB 3COAC 3CUQA 1SD5A 3J81K 2VOPA 1I1SA 4HZFA 4CXFA 2M5WA 1EH7A 1U6GA 1GXQA 5JVTA 5KVRA 2YPRA 3CDHA 1SFEA 2EFOA 4HX8A 2DK8A 2PN6A 3I5UA 2NAZA 5HLGA 3IRQA 2IJLA 2XKPA 1B9NA 5ICFA 4ZYDA 1PDNC 2HYGD 3CO6C 1ZRDA 3ZPLA 1RZ4A 3WTWC 3KP3A 3RPUA 4KICA 4GCVA 1LVAA 2L4AA 3GFLA 1LQ1A 3GFIA 4A0XA 3MQ0A 3BZ6A 4KYWA 2L02A 2PMUA 3GLXA 1MDMA 4ZYGA 2RNJA 3HRSA 1U5TC 1JXSA 1YW8A 5DD4A 3R6SA 1USTA 4I98B 2BE5F 2EFNA 3TGNA 4MTEA 2G7UA 1BBYA 4RGUA 1LDDA 3RYRA 2XHKA 5F6FA 3EYYA 1V3FA 2K4JA 1WRJA 1AOYA 1FBSA 5JI6A 3W6JB 2V6CA 4IPAA 5D5WB 3F21A 1SFXA 2COMA 1R00A 4HBLA 3QU6A 1SFUA 1RIOH 2E1NA 1T0FA 4RGXA 4HF2A 5FGMA 3DFGA 1F9NA 1IAWA 4WX9A 5IT9Z 1OPCA 3W6KB 2HKXA 2QWWA 4MEXF 5F1RA 4KMUX 3M8EA 4OINF 1O57A 4M9XA 5CVJA 4KUMA 1PP7U 1B1BA 4M9SA 1G4DA 1GVJA 2O0YA 1YTYA 1RUNA 1XMKA 2QQ9A 1FLIA 4M6XA 4L18B 1MJ9A 4DQ2A 4EGZA 2STWA 4Q5SF 2NNYA 2VBYA 2H09A 5CVRA 4AWXB 5L3EA 4LLGF 1FT9A 3K1PA 1KYZA 5D4SA 3BDDA 3KP7A 1KU9A 3RKXA 1IXCA 3SXYA 1SMTA 2F2EA 4RB0A 2AXLA 4PGGA 2KJCA 4IVNA 3T1BA 5E1ZB 2VODA 2ESNA 4XSZF 5E20A 4EGYA 1ZGJA 3DPTA 1BI3A 3IKVA 2LKPA 3RIRA 5HDNA 3SHFA 4N9IA 1UHWA 2E7XA 3D5LA 4KFCA 2BV6A 2Q2EA 3GW2A 1XB4A 4HDUA 3QP5A 5DD8A 2EV6A 4HQMA 3WODF 1SD6A 1KQ0A 3M9AA 3R0AA 5E8GA 3HUGA 1FP2A 1R58A 1P4AA 2LF7A 1BI0A 1ZG5A 2HKOA 3BJ6A 4AIJA 2GIVA 2FEZA 1QZZA 2EJRA 4N9HA 2GA1A 4A6EA 3FHZA 5FLXK 4TV7A 5HS7A 1QNTA 2V79A 4XLNF 3IL2A 2NS0A 4I0BA 1TNTA 4R1HA 4KMFA 5LGTA 3HRMA 4OIQF 4N0BA 1HSJA 3EDPA 4BQAA 1QQIA 3E6BA 1E17A 2Y0MA 3F23A 4IXAA 3HSFA 3MCZA 1O3SA 4CDGA 4EJOA 2YX7A 4IRIA 2PBIA 2P5KA 5BQTA 2FF4A 5LBQA 3C7JA 3Q5FA 4NQWA 4P96A 5K5RA 2Z33A 1DDNA 2ZNZA 1F1ZA 2GAUA 4HF1A 1WWXA 4PGHA 2P5LC 2RV8A 3QAHA 5EEGA 4G7ZF 3DP7A 5K5OA 5ICGA 1ZREA 2FQ3A 3FF5A 3C1DA 2JPCA 1IN7A 2K4BA 2OBPA 1DPUA 3O6BB 1OR7A 3WTXC 5AONA 5D5UB 4KIFA 5H6RA 3L7WA 1I5ZA 4PDKA 4PCQA 3IRRA 4IJAA 3I4PA 2YU3A 1CF7B 1W5SA 1H9TA 1UCRA 5CVUA 1IXSB 1B59A 4IRHA 4ESFA 3RJPA 3QPTA 1Y0UA 3FWEA 2IA2A 3QPHA 2H94A 1BIAA 1QZYA 2QLZA 5LRSA 4ENNA 2YX4A 2BYVE 3KE2A 3RKYA 2R7DA 5IT9K 2LSOA 3ZMDA 1BM9A 3BPXA 5JR3A 5HOOA 1GXPA 4UVBA 5D6FA 2W85A 1G3TA 2CFXA 1YO5C 4KN7X 1PP8F 3ZMVA 3KETA 2D45A 3DKWA 3F6OA 3DEUA 3ROUA 4CGZA 5ED4A 4LB6B 1QGPA 3IWFA 4L9NA 2UXNA 1V4RA 2XAHA 1TBXA 1OYYA 2CWEA 3V8JA 2LDUA 1BOAA 1HBXG 4ZZDA 2K7LA 2HEOA 3I54A 4HLXA 2W84A 1T98A 3HSEA 1DPRA 1OYIA 1H0MA 2HTSA 1TQPA 1JE8A 5D6EA 3EYIA 1KU2A 2ZMEB 2IP2A 1Z1DA 1FYKA 1LEAA 4A0YA 5L3GA 2EA4A 1ONVA 3HHGA 1TW3A 1HQCA 1SD4A 3LQQA 5L3DA 4WXDA 2RDPA 3L2CA 5E8IA 1WKMA 1NHAA 4LK0F 1ON1A 2EFQA 4O3MA 1YFHA 3OOPA 1S3JA 4HQEA 1W7PB 3F8BA 5E1XA 2P7CB 4BHCA 1ZLJA 1VTNC 5ILSA 2ZNYA 1ZH5A 1CF7A 4E70A 2K27A 1XSVA 3O2PE 2EB7A 2EK5A 5D5VB 3I64A 3K0LA 1T2KA 3HRUA 2W57A 2PFBA 1YQAA 5FLXZ 5LRRA 3KP2A 1IW7F 4DNCA 1XCVA 4A5MA 3VODA 2FE3A 3DXJF 2F5DA 2FNPA 5BPDA 1J59A 5DCFA 1U8RA 4RB3C 5HDKA 3IHUA 1MJAA 5CVIA 1YYVA 2Z99A 5HS8A 2PQ8A 2HTJA 1R23A 2Z9OA 4BYYA 1OMIA 2VT2A 3HRTA 3G73A 4HLYA 1R1UA 2H27A 4ZYEA 1E2XA 3MWMA 2WV0A 4MTDA 1WI9A 4R8HA 1IN5A 4ENMA 3QU3A 2MH2A 5AIQA 3TDUC 4LMYA 1YW9A 1J75A 2ZJ2A 3BPVA 2ESHA 4L9JA 3KP5A 3DV8A 1HW5A 3GO5A 1KA8A 1RNLA 2IRFG 3WTVC 5LGUA 4EJTA 4G7OF 1ODDA 1KQ8A 1D8KA 3RYPA 4B8XA 3HTSB 2ZMEA 2X0LA 4XLPF 2IT0A 3FX3A 3ECOA 5LHIA 2CGPA 1HKQA 4OIRF 1J5YA 3L09A 1HKSA 4B09A 2DU9A 2EFWA 1XGNA 4MHGA 1B6AA 4XBFA 3M8FA 1B9MA 2P6TA 4EM2A 4OIOF 2DQRA 2KIMA 3WGGA 3JW4A 2MA3A 2HQNA 5TJJA 3E5XA 1W7PA 3FZVA 4M71A 2KKOA 3BY6A 1S8NA 4CHUA 4AIKA 2WC2A 1K6OA 3CUOA 4A0ZA 2GXBA 2VBXA 4G6DA 4G9YA 2P7VB 4GGGA 2G7HA 2A6HF 5DYMA 3NRVA 3KEOA 3P9IA 3FXUA 2OD5A 3JTGA 2RN7A 2IA1A 3L9FA 1J9IA 2M45A 3F8FA 3GEZA 2XVCA 2DK5A 5BMZA 3WTYC 4M9ZA 4ON0A 1QO0D 2STTA 2MC3A 4ENKA 1UFMA 1RUOA 1P6RA 4A5NA 4IF4A 1C0WA 3EETA 3TO9A 4NHJA 2F5FA 5LEKA 1YS6A 4G94A 4A12A 3KCCA 4U7DA 5DCMB 2L54A 2L01A 3CJNA 1I1GA 1KYWA 4Q4ZF 3I0TA 4ESBA 3JSOA 1FBUA 1R5GA 1IXRC 1ZG3A 3I71A 2KJBA 2QVOA 3GVAA 3ECHA 3V7RA 2V9VA 2Y75A 2GWRA 2VONA 1KU7A 3IC7A 3KLNA 2H6CA 4U0WA 4MQ9F 1HXDA 3ZMSA 2C6YA 2RVCA 4QWQA 4L9VA 4CICA 5BOXA 4I7HA 3N4MA 1TW2A 2QYOA 4YFXF 3EUHA 4O6JA 4XRFA 1YS7A 4AIHA 4ASNA 1IF1A 2A61A 2IA0A 3S2WA 1TNSA 4RGRA 1XN7A 4R79A 1BI1A 2VC0A 3ELKA 4KN4X 3H3ZA 1Q1HA 2HR3A 1FBQA 2FSWA 4LFUA 2A3SA 2HZTA 4WXHA 4P9UA 3WTZA 3F72A 3DQVC 3VFZA 2ZCWA 3VEPA 3KFWX 1XMAA 1XGMA 2LNBA 5DV5A 2UXXA 5E1WA 4FHTA 2XUBA 2FNAA 3U1DA 2F5EA 2JRTA 3MAJA 5HLHA 1Z7UA 2Z3YA 4WWCA 3F6VA 3OV8A 4BXUA 3MZYA 2XIGA 1P2FA 5A2QK 1FPQA 1UHMA 3U9GA 3GFJA 4MEYF 2JZYA 1XGOA 3F22A 4F7ZA 4EMSA 4S04A 1B4AA 3QRFF 3TKYA 5TRDA 2FBKA 2X4HA 4KNYA 2OQGA 4HOBA 2WTEA 4RB2C 1ZARA 3GZ5A 5FD6A 1KQ9A 4BHBA 1IUYA 2LF8A 5CJ9A 1K7AA 1U2WA 3I58A 3J7AO 1FSEA 4XSXF 3I59B 3E3VA 5J6XA 1Z6TA 1YIOA 1J7KA 4AVPA 3VB2A 3DPLC 2A6EF 2NRAC 1WSUA 3GX4X 4MNUA 5F64A 3C3WA 2QENA 4HW0A 4U0YA 1QBJA 4K2EA 3FMSA 5H20A 2GA2A 2OAZA 4HA8A 3K9TA 3K2ZA 3QP6A 2FA5A 5K5QA 1GHCA 4GXOA 5CYVA 2HDCA 3GFMA 3CTAA 4OOIA 3WG9A 3Q9SA 3KEQA 1XGSA 4BH9A 3FXRA 3DF8A 1STZA 3ABUA 2ZBKA 2FMYA 4L0YB 3SQNA 1FNNA 2L4MA 4HAMA 1K79A 3GUDA 3KZZA 3LFKA 3V8LA 4GO1A 1EH8A 3R4KA 4YG2F 3N97A 1TTYA 4I02A 3SZPA 3R60A 1BC7C 2Q0OA 3ERED 1X3UA 2E1CA 1LJ9A 2OQRA 2GQQA 3F8CA 4I0AA 4KIBA 3CLOA 3E5UA 1MZBA 3TQNA 5JHUA 1R1VA 4M73A 2P8TA 5J8FA 5HLIA 3BJOA 3ZN1A 5CLSA 1USSA 4RS8A 4L5JA 3EQLF 4IHSA 6PAXA 4OMZA 3E5QA 2BEOA 2ISZA 2ELHA 4OMYA 4YFNF 3KP6A 2J5PA 4CYDA 2DT5A 2ZXJA 2A68F 5ERIA 4LGWA 2NYXA 3I59A 2M1BA 5D5XB 3LAPA 2XAGA 1ZGAA 3RDIA 2V1DA 3LAJA 4Y13A 1ZAOA 2RQPA 3R61A 2PMHA 3REOA 4ZYHA 1G3SA 4L9TA 3V7SA 3BWGA 5ILVA 2DPDA 1P4XA 3ZN0A 3TO7A 1IRFA 4I2OA 2DO7A 5LGNA 4HX7A 2KIFA 1JHFA 1T6SA 2B0LA 2VBWA 3TOBA 3V4GA 1W7PD 3G3ZA 2R7FA 3GYHX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TLH B;  2FOK A;  1UB9 A;  4HF0 A;  2O6G E;  4UVC A;  1HW2 A;  1S7A A;  2XRO A;  2QM3 A;  4U88 A;  2OA4 A;  3T8T A;  1BIB A;  1W5T A;  4L5I A;  3KP4 A;  3O3K A;  3ZP5 A;  2YR2 A;  5EEH A;  5A2Q Z;  1LEB A;  2P5V A;  1IN4 A;  1R1T A;  2HGC A;  3K69 A;  1DUX C;  4Z2Y A;  1J0R A;  4KIG A;  3V8K A;  1SD7 A;  3D0S A;  2FRH A;  3WGH A;  1L0O C;  3MEX A;  2PJP A;  1FY7 A;  1I27 A;  4ENJ A;  2MBF A;  1IN6 A;  3PQK A;  4I09 A;  5L3B A;  1PUE E;  4L0Z B;  2ZO4 A;  1Z6R A;  2DTR A;  5J8C A;  4BHP A;  2RGV A;  2O03 A;  3JAM K;  3K1M A;  2XRN A;  1U5T B;  3HSR A;  2JSC A;  4S05 A;  4G7H F;  2O3F A;  2L3D A;  2QQB A;  4LLN A;  2P4W A;  5FB2 A;  1ZN2 A;  5LEJ A;  4OIP F;  3KLO A;  1FWZ A;  3B02 A;  1Z05 A;  5IT3 A;  1TQM A;  5D4R A;  4UUV A;  1O3T A;  1D3Y A;  5LHH A;  1FP1 D;  4FX4 A;  1ZG1 A;  4JBA A;  4PZJ A;  2W25 A;  3LWF A;  2QZ8 A;  4RAZ A;  1XSD A;  3V7C A;  2EWN A;  2R3S A;  2FBH A;  5CVV A;  2O61 A;  2MD5 A;  2D2W A;  1Z91 A;  3E6M A;  3LQR A;  2DQL A;  2Y48 A;  1DP7 P;  1S29 A;  1FSH A;  2PI0 A;  2MLK A;  5HVQ C;  1O7L A;  4LJZ F;  1IN8 A;  5DEQ A;  3H3U A;  1HW1 A;  1CGP A;  4EM1 A;  5DUK A;  2EV0 A;  5ICE A;  3U2R A;  1SMY F;  4UVA A;  3KZY A;  3ZMU A;  4EV0 A;  1YLF A;  2HWV A;  4ETS A;  1MGT A;  4MGR A;  1EV7 A;  3ZMZ A;  4EJW A;  1YG2 A;  2D1V A;  4A2U A;  3ZQ7 A;  1U3E M;  3ML6 A;  4QLC U;  1R36 A;  3E97 A;  4LG0 B;  1LDJ A;  4M72 A;  4RAY A;  2VE8 A;  4CZZ A;  2MH9 A;  2CO5 A;  3TDZ C;  2ZFW A;  4IRG A;  3F8N A;  2DAO A;  3PFI A;  4FT8 A;  1ZLK A;  5FO5 A;  4BAY A;  1H9G A;  2A69 F;  1KGS A;  1W4M A;  1T38 A;  3RTR A;  4RB1 A;  3GZ6 A;  5BPI A;  3M1E A;  2FXA A;  2UWM A;  4EVI A;  1LB2 A;  4UV8 A;  2GZW A;  2DW4 A;  1REP C;  1IRG A;  3WTS C;  3B73 A;  4Q47 A;  4LK1 F;  3TOA A;  3JSP A;  1OYW A;  1U5T A;  2M87 A;  2WWY A;  4HYE A;  4AD9 A;  3QOP A;  2CQK A;  4I01 A;  3MZH A;  2IW5 A;  4LLL A;  4YIF A;  1BC8 C;  1U78 A;  3RI4 A;  2ISY A;  3BJA A;  1P92 A;  3ABT A;  3P9K A;  5HS9 A;  2MLG A;  3T0Y A;  2ETH A;  2AS5 F;  4WK8 F;  4ZH4 F;  3HTU A;  1R5H A;  4WXC A;  2UZK A;  2PG4 A;  2NNN A;  3HHH A;  2EA2 A;  2H6B A;  5HDG A;  3CO7 C;  3WTU C;  1K78 B;  5DDG A;  2OZU A;  3MFK A;  3ZMT A;  4G8X A;  1OKR A;  5K1Y A;  3FM5 A;  4LB5 A;  3C18 A;  3BP8 A;  3VOE A;  1F4K A;  2IPQ X;  4CO8 A;  3LA7 A;  2DBB A;  1R7J A;  4YFK F;  4WCG A;  4KA4 A;  3E6C C;  4O5V A;  3J80 K;  1MJB A;  2JTV A;  1BJA A;  3WTT C;  5FD5 A;  5LHG A;  2IVM A;  2RC4 A;  3RPQ A;  4IHT A;  2V1U A;  3ISP A;  2QQA A;  2EFP A;  3T8R A;  2FBI A;  2BBY A;  2JPB A;  2Z5U A;  3TO6 A;  5ICC A;  2YSR A;  2XV4 S;  3R0J A;  4RGS A;  3J81 Z;  1FZP B;  2XAJ A;  1AWC A;  2HYF A;  1Z9C A;  1ON2 A;  2A07 F;  4KDP A;  1S6L A;  4BNC A;  3HIF A;  2DLL A;  5ILU A;  4LG0 A;  2CSO A;  3HOT A;  1XDU A;  3WU0 A;  3JAM Z;  5AIP A;  2XGX A;  4LD5 A;  5DCM A;  3K1N A;  3WGI A;  3AAF A;  4NB5 A;  3WE3 A;  2VXZ A;  1I6X A;  4EJU A;  3GF2 A;  4UNO A;  4KT5 C;  2V1X A;  2XAQ A;  4G6Q A;  2QBY B;  3BOQ A;  1EH6 A;  2KIU A;  1HKT A;  2KRF A;  3ULQ B;  2HOE A;  1D5V A;  1XSX A;  4GYG A;  1O3Q A;  2OZ6 A;  4EM0 B;  4JK1 X;  1O3R A;  4Y15 A;  1JHH A;  2CG4 A;  2HS5 A;  2VT3 A;  1O7F A;  1FC3 A;  3I53 A;  3SZT A;  2VC1 A;  2ADU A;  3M7G A;  1ZYR F;  1KU3 A;  3RKW A;  2DPU A;  2E7W A;  3E6D A;  5L3C A;  4EQQ A;  1ZRC A;  5D8K B;  2Q8K A;  2D1H A;  3LA2 A;  2G9W A;  3F8M A;  3FMR A;  2VOO A;  3NEU A;  3P7N A;  4UHT A;  1YW7 A;  1G3W A;  2DFI A;  1RI7 A;  2F5C A;  1K78 A;  3CUQ B;  1G3Y A;  3L00 A;  3PQJ A;  1J2X A;  3LST A;  3H92 A;  2QUF A;  1WQ2 A;  2RKH A;  2VE9 A;  4FX0 A;  5E17 F;  4JQF A;  2HFH A;  1HST A;  4P5O A;  3HYI A;  1ZHF A;  5BS6 A;  2BGC A;  5FFZ A;  2OU2 A;  1ULY A;  3SFZ A;  4Q48 A;  3F3X A;  1QPM A;  3FMQ A;  4GYI A;  4HV6 A;  2W24 A;  3Q9V A;  2P6S A;  5KK1 A;  1FX7 A;  3CUQ C;  1IZ1 A;  4U7B A;  2FML A;  4MQV A;  1XDS A;  2M30 A;  2CW0 F;  1ZRF A;  4M74 A;  2PLY A;  1JGS A;  1L3L A;  3JTH A;  2JT1 A;  5E18 F;  1MDM B;  1A04 A;  4P9F A;  2M8E A;  1S7O A;  3BRO A;  4M6Y A;  2XKO A;  3GWZ A;  4OU0 A;  2EV5 A;  2K02 A;  4HX4 A;  1R22 A;  1XD7 A;  4A6D A;  5FFX A;  3FXQ A;  1F5T A;  3NQO A;  2QBY A;  2ACJ A;  1FOK A;  3GXO A;  4ESJ A;  3T5X A;  1XCB A;  2K86 A;  4U0V A;  4P55 A;  2DI3 A;  3IWZ A;  2VN2 A;  4UXN A;  4EJV A;  2J5O A;  3WU1 B;  1TQI A;  5L3F A;  3IKT A;  1T39 A;  1BN5 A;  2ZKZ A;  3LA3 A;  4HV5 A;  3HOS A;  4H0E A;  2A5Y B;  1SAX A;  2CYY A;  1MD0 A;  1G6N A;  2PEX A;  3P9C A;  3WE2 A;  2FU4 A;  1BI2 A;  4HDV A;  5DUI A;  1D8J A;  4D0P A;  2XAF A;  1FYL A;  1LDK B;  1LNW A;  3FM3 A;  2TDX A;  5JFR A;  1P4W A;  2GXG A;  2VBZ A;  3J80 Z;  4ZZL A;  2XAS A;  2O8X A;  1FYM A;  5LLQ A;  4YII A;  5H6Q A;  1MKM A;  4Y17 A;  2HQR A;  4WF2 A;  4UV9 A;  5D8L B;  3COA C;  3CUQ A;  1SD5 A;  3J81 K;  2VOP A;  1I1S A;  4HZF A;  4CXF A;  2M5W A;  1EH7 A;  1U6G A;  1GXQ A;  5JVT A;  5KVR A;  2YPR A;  3CDH A;  1SFE A;  2EFO A;  4HX8 A;  2DK8 A;  2PN6 A;  3I5U A;  2NAZ A;  5HLG A;  3IRQ A;  2IJL A;  2XKP A;  1B9N A;  5ICF A;  4ZYD A;  1PDN C;  2HYG D;  3CO6 C;  1ZRD A;  3ZPL A;  1RZ4 A;  3WTW C;  3KP3 A;  3RPU A;  4KIC A;  4GCV A;  1LVA A;  2L4A A;  3GFL A;  1LQ1 A;  3GFI A;  4A0X A;  3MQ0 A;  3BZ6 A;  4KYW A;  2L02 A;  2PMU A;  3GLX A;  1MDM A;  4ZYG A;  2RNJ A;  3HRS A;  1U5T C;  1JXS A;  1YW8 A;  5DD4 A;  3R6S A;  1UST A;  4I98 B;  2BE5 F;  2EFN A;  3TGN A;  4MTE A;  2G7U A;  1BBY A;  4RGU A;  1LDD A;  3RYR A;  2XHK A;  5F6F A;  3EYY A;  1V3F A;  2K4J A;  1WRJ A;  1AOY A;  1FBS A;  5JI6 A;  3W6J B;  2V6C A;  4IPA A;  5D5W B;  3F21 A;  1SFX A;  2COM A;  1R00 A;  4HBL A;  3QU6 A;  1SFU A;  1RIO H;  2E1N A;  1T0F A;  4RGX A;  4HF2 A;  5FGM A;  3DFG A;  1F9N A;  1IAW A;  4WX9 A;  5IT9 Z;  1OPC A;  3W6K B;  2HKX A;  2QWW A;  4MEX F;  5F1R A;  4KMU X;  3M8E A;  4OIN F;  1O57 A;  4M9X A;  5CVJ A;  4KUM A;  1PP7 U;  1B1B A;  4M9S A;  1G4D A;  1GVJ A;  2O0Y A;  1YTY A;  1RUN A;  1XMK A;  2QQ9 A;  1FLI A;  4M6X A;  4L18 B;  1MJ9 A;  4DQ2 A;  4EGZ A;  2STW A;  4Q5S F;  2NNY A;  2VBY A;  2H09 A;  5CVR A;  4AWX B;  5L3E A;  4LLG F;  1FT9 A;  3K1P A;  1KYZ A;  5D4S A;  3BDD A;  3KP7 A;  1KU9 A;  3RKX A;  1IXC A;  3SXY A;  1SMT A;  2F2E A;  4RB0 A;  2AXL A;  4PGG A;  2KJC A;  4IVN A;  3T1B A;  5E1Z B;  2VOD A;  2ESN A;  4XSZ F;  5E20 A;  4EGY A;  1ZGJ A;  3DPT A;  1BI3 A;  3IKV A;  2LKP A;  3RIR A;  5HDN A;  3SHF A;  4N9I A;  1UHW A;  2E7X A;  3D5L A;  4KFC A;  2BV6 A;  2Q2E A;  3GW2 A;  1XB4 A;  4HDU A;  3QP5 A;  5DD8 A;  2EV6 A;  4HQM A;  3WOD F;  1SD6 A;  1KQ0 A;  3M9A A;  3R0A A;  5E8G A;  3HUG A;  1FP2 A;  1R58 A;  1P4A A;  2LF7 A;  1BI0 A;  1ZG5 A;  2HKO A;  3BJ6 A;  4AIJ A;  2GIV A;  2FEZ A;  1QZZ A;  2EJR A;  4N9H A;  2GA1 A;  4A6E A;  3FHZ A;  5FLX K;  4TV7 A;  5HS7 A;  1QNT A;  2V79 A;  4XLN F;  3IL2 A;  2NS0 A;  4I0B A;  1TNT A;  4R1H A;  4KMF A;  5LGT A;  3HRM A;  4OIQ F;  4N0B A;  1HSJ A;  3EDP A;  4BQA A;  1QQI A;  3E6B A;  1E17 A;  2Y0M A;  3F23 A;  4IXA A;  3HSF A;  3MCZ A;  1O3S A;  4CDG A;  4EJO A;  2YX7 A;  4IRI A;  2PBI A;  2P5K A;  5BQT A;  2FF4 A;  5LBQ A;  3C7J A;  3Q5F A;  4NQW A;  4P96 A;  5K5R A;  2Z33 A;  1DDN A;  2ZNZ A;  1F1Z A;  2GAU A;  4HF1 A;  1WWX A;  4PGH A;  2P5L C;  2RV8 A;  3QAH A;  5EEG A;  4G7Z F;  3DP7 A;  5K5O A;  5ICG A;  1ZRE A;  2FQ3 A;  3FF5 A;  3C1D A;  2JPC A;  1IN7 A;  2K4B A;  2OBP A;  1DPU A;  3O6B B;  1OR7 A;  3WTX C;  5AON A;  5D5U B;  4KIF A;  5H6R A;  3L7W A;  1I5Z A;  4PDK A;  4PCQ A;  3IRR A;  4IJA A;  3I4P A;  2YU3 A;  1CF7 B;  1W5S A;  1H9T A;  1UCR A;  5CVU A;  1IXS B;  1B59 A;  4IRH A;  4ESF A;  3RJP A;  3QPT A;  1Y0U A;  3FWE A;  2IA2 A;  3QPH A;  2H94 A;  1BIA A;  1QZY A;  2QLZ A;  5LRS A;  4ENN A;  2YX4 A;  2BYV E;  3KE2 A;  3RKY A;  2R7D A;  5IT9 K;  2LSO A;  3ZMD A;  1BM9 A;  3BPX A;  5JR3 A;  5HOO A;  1GXP A;  4UVB A;  5D6F A;  2W85 A;  1G3T A;  2CFX A;  1YO5 C;  4KN7 X;  1PP8 F;  3ZMV A;  3KET A;  2D45 A;  3DKW A;  3F6O A;  3DEU A;  3ROU A;  4CGZ A;  5ED4 A;  4LB6 B;  1QGP A;  3IWF A;  4L9N A;  2UXN A;  1V4R A;  2XAH A;  1TBX A;  1OYY A;  2CWE A;  3V8J A;  2LDU A;  1BOA A;  1HBX G;  4ZZD A;  2K7L A;  2HEO A;  3I54 A;  4HLX A;  2W84 A;  1T98 A;  3HSE A;  1DPR A;  1OYI A;  1H0M A;  2HTS A;  1TQP A;  1JE8 A;  5D6E A;  3EYI A;  1KU2 A;  2ZME B;  2IP2 A;  1Z1D A;  1FYK A;  1LEA A;  4A0Y A;  5L3G A;  2EA4 A;  1ONV A;  3HHG A;  1TW3 A;  1HQC A;  1SD4 A;  3LQQ A;  5L3D A;  4WXD A;  2RDP A;  3L2C A;  5E8I A;  1WKM A;  1NHA A;  4LK0 F;  1ON1 A;  2EFQ A;  4O3M A;  1YFH A;  3OOP A;  1S3J A;  4HQE A;  1W7P B;  3F8B A;  5E1X A;  2P7C B;  4BHC A;  1ZLJ A;  1VTN C;  5ILS A;  2ZNY A;  1ZH5 A;  1CF7 A;  4E70 A;  2K27 A;  1XSV A;  3O2P E;  2EB7 A;  2EK5 A;  5D5V B;  3I64 A;  3K0L A;  1T2K A;  3HRU A;  2W57 A;  2PFB A;  1YQA A;  5FLX Z;  5LRR A;  3KP2 A;  1IW7 F;  4DNC A;  1XCV A;  4A5M A;  3VOD A;  2FE3 A;  3DXJ F;  2F5D A;  2FNP A;  5BPD A;  1J59 A;  5DCF A;  1U8R A;  4RB3 C;  5HDK A;  3IHU A;  1MJA A;  5CVI A;  1YYV A;  2Z99 A;  5HS8 A;  2PQ8 A;  2HTJ A;  1R23 A;  2Z9O A;  4BYY A;  1OMI A;  2VT2 A;  3HRT A;  3G73 A;  4HLY A;  1R1U A;  2H27 A;  4ZYE A;  1E2X A;  3MWM A;  2WV0 A;  4MTD A;  1WI9 A;  4R8H A;  1IN5 A;  4ENM A;  3QU3 A;  2MH2 A;  5AIQ A;  3TDU C;  4LMY A;  1YW9 A;  1J75 A;  2ZJ2 A;  3BPV A;  2ESH A;  4L9J A;  3KP5 A;  3DV8 A;  1HW5 A;  3GO5 A;  1KA8 A;  1RNL A;  2IRF G;  3WTV C;  5LGU A;  4EJT A;  4G7O F;  1ODD A;  1KQ8 A;  1D8K A;  3RYP A;  4B8X A;  3HTS B;  2ZME A;  2X0L A;  4XLP F;  2IT0 A;  3FX3 A;  3ECO A;  5LHI A;  2CGP A;  1HKQ A;  4OIR F;  1J5Y A;  3L09 A;  1HKS A;  4B09 A;  2DU9 A;  2EFW A;  1XGN A;  4MHG A;  1B6A A;  4XBF A;  3M8F A;  1B9M A;  2P6T A;  4EM2 A;  4OIO F;  2DQR A;  2KIM A;  3WGG A;  3JW4 A;  2MA3 A;  2HQN A;  5TJJ A;  3E5X A;  1W7P A;  3FZV A;  4M71 A;  2KKO A;  3BY6 A;  1S8N A;  4CHU A;  4AIK A;  2WC2 A;  1K6O A;  3CUO A;  4A0Z A;  2GXB A;  2VBX A;  4G6D A;  4G9Y A;  2P7V B;  4GGG A;  2G7H A;  2A6H F;  5DYM A;  3NRV A;  3KEO A;  3P9I A;  3FXU A;  2OD5 A;  3JTG A;  2RN7 A;  2IA1 A;  3L9F A;  1J9I A;  2M45 A;  3F8F A;  3GEZ A;  2XVC A;  2DK5 A;  5BMZ A;  3WTY C;  4M9Z A;  4ON0 A;  1QO0 D;  2STT A;  2MC3 A;  4ENK A;  1UFM A;  1RUO A;  1P6R A;  4A5N A;  4IF4 A;  1C0W A;  3EET A;  3TO9 A;  4NHJ A;  2F5F A;  5LEK A;  1YS6 A;  4G94 A;  4A12 A;  3KCC A;  4U7D A;  5DCM B;  2L54 A;  2L01 A;  3CJN A;  1I1G A;  1KYW A;  4Q4Z F;  3I0T A;  4ESB A;  3JSO A;  1FBU A;  1R5G A;  1IXR C;  1ZG3 A;  3I71 A;  2KJB A;  2QVO A;  3GVA A;  3ECH A;  3V7R A;  2V9V A;  2Y75 A;  2GWR A;  2VON A;  1KU7 A;  3IC7 A;  3KLN A;  2H6C A;  4U0W A;  4MQ9 F;  1HXD A;  3ZMS A;  2C6Y A;  2RVC A;  4QWQ A;  4L9V A;  4CIC A;  5BOX A;  4I7H A;  3N4M A;  1TW2 A;  2QYO A;  4YFX F;  3EUH A;  4O6J A;  4XRF A;  1YS7 A;  4AIH A;  4ASN A;  1IF1 A;  2A61 A;  2IA0 A;  3S2W A;  1TNS A;  4RGR A;  1XN7 A;  4R79 A;  1BI1 A;  2VC0 A;  3ELK A;  4KN4 X;  3H3Z A;  1Q1H A;  2HR3 A;  1FBQ A;  2FSW A;  4LFU A;  2A3S A;  2HZT A;  4WXH A;  4P9U A;  3WTZ A;  3F72 A;  3DQV C;  3VFZ A;  2ZCW A;  3VEP A;  3KFW X;  1XMA A;  1XGM A;  2LNB A;  5DV5 A;  2UXX A;  5E1W A;  4FHT A;  2XUB A;  2FNA A;  3U1D A;  2F5E A;  2JRT A;  3MAJ A;  5HLH A;  1Z7U A;  2Z3Y A;  4WWC A;  3F6V A;  3OV8 A;  4BXU A;  3MZY A;  2XIG A;  1P2F A;  5A2Q K;  1FPQ A;  1UHM A;  3U9G A;  3GFJ A;  4MEY F;  2JZY A;  1XGO A;  3F22 A;  4F7Z A;  4EMS A;  4S04 A;  1B4A A;  3QRF F;  3TKY A;  5TRD A;  2FBK A;  2X4H A;  4KNY A;  2OQG A;  4HOB A;  2WTE A;  4RB2 C;  1ZAR A;  3GZ5 A;  5FD6 A;  1KQ9 A;  4BHB A;  1IUY A;  2LF8 A;  5CJ9 A;  1K7A A;  1U2W A;  3I58 A;  3J7A O;  1FSE A;  4XSX F;  3I59 B;  3E3V A;  5J6X A;  1Z6T A;  1YIO A;  1J7K A;  4AVP A;  3VB2 A;  3DPL C;  2A6E F;  2NRA C;  1WSU A;  3GX4 X;  4MNU A;  5F64 A;  3C3W A;  2QEN A;  4HW0 A;  4U0Y A;  1QBJ A;  4K2E A;  3FMS A;  5H20 A;  2GA2 A;  2OAZ A;  4HA8 A;  3K9T A;  3K2Z A;  3QP6 A;  2FA5 A;  5K5Q A;  1GHC A;  4GXO A;  5CYV A;  2HDC A;  3GFM A;  3CTA A;  4OOI A;  3WG9 A;  3Q9S A;  3KEQ A;  1XGS A;  4BH9 A;  3FXR A;  3DF8 A;  1STZ A;  3ABU A;  2ZBK A;  2FMY A;  4L0Y B;  3SQN A;  1FNN A;  2L4M A;  4HAM A;  1K79 A;  3GUD A;  3KZZ A;  3LFK A;  3V8L A;  4GO1 A;  1EH8 A;  3R4K A;  4YG2 F;  3N97 A;  1TTY A;  4I02 A;  3SZP A;  3R60 A;  1BC7 C;  2Q0O A;  3ERE D;  1X3U A;  2E1C A;  1LJ9 A;  2OQR A;  2GQQ A;  3F8C A;  4I0A A;  4KIB A;  3CLO A;  3E5U A;  1MZB A;  3TQN A;  5JHU A;  1R1V A;  4M73 A;  2P8T A;  5J8F A;  5HLI A;  3BJO A;  3ZN1 A;  5CLS A;  1USS A;  4RS8 A;  4L5J A;  3EQL F;  4IHS A;  6PAX A;  4OMZ A;  3E5Q A;  2BEO A;  2ISZ A;  2ELH A;  4OMY A;  4YFN F;  3KP6 A;  2J5P A;  4CYD A;  2DT5 A;  2ZXJ A;  2A68 F;  5ERI A;  4LGW A;  2NYX A;  3I59 A;  2M1B A;  5D5X B;  3LAP A;  2XAG A;  1ZGA A;  3RDI A;  2V1D A;  3LAJ A;  4Y13 A;  1ZAO A;  2RQP A;  3R61 A;  2PMH A;  3REO A;  4ZYH A;  1G3S A;  4L9T A;  3V7S A;  3BWG A;  5ILV A;  2DPD A;  1P4X A;  3ZN0 A;  3TO7 A;  1IRF A;  4I2O A;  2DO7 A;  5LGN A;  4HX7 A;  2KIF A;  1JHF A;  1T6S A;  2B0L A;  2VBW A;  3TOB A;  3V4G A;  1W7P D;  3G3Z A;  2R7F A;  3GYH X; 
#chains in the Genus database with same CATH topology
 1TLH B;  4CYC A;  2FOK A;  1UB9 A;  4HF0 A;  3ZGK A;  4D7M A;  2O6G E;  4UVC A;  1HW2 A;  2LY1 A;  2VKV A;  1S7A A;  4CCK A;  1PYV A;  2XRO A;  2QM3 A;  2LRE A;  4LOC A;  4U88 A;  5J3L A;  2OA4 A;  1UG2 A;  3T8T A;  1BIB A;  2L9R A;  4IHV A;  1W5T A;  4L5I A;  3KP4 A;  3O3K A;  3ZP5 A;  1Y39 A;  2YR2 A;  4IX7 A;  5EEH A;  4UUS B;  5A2Q Z;  1WJD A;  2P5V A;  2MC4 A;  1LEB A;  4J00 A;  1IN4 A;  1R1T A;  2HGC A;  3K69 A;  3NAR A;  1DUX C;  4Z2Y A;  1J0R A;  4KIG A;  3V8K A;  1SD7 A;  3D0S A;  5KAI C;  2FRH A;  3WGH A;  4FAS D;  4PK4 A;  4KIT B;  2M34 A;  1WH7 A;  1L0O C;  3MEX A;  2PJP A;  4XLC A;  1FY7 A;  1G8X A;  4DZP A;  1I27 A;  1HC8 A;  4ENJ A;  3SZG A;  2NS8 A;  2MBF A;  1IN6 A;  2DDA A;  3DBL B;  3CZ6 A;  3PQK A;  4I09 A;  5L3B A;  1PUE E;  4L0Z B;  2ZO4 A;  4DYQ A;  4D7N A;  2R7X A;  5E3M A;  3FXJ A;  1Z6R A;  5B1B H;  2JVG A;  2KZG A;  4DOZ A;  1VQ6 I;  3AL0 C;  1IGN A;  2DTR A;  3BG5 A;  5J8C A;  4BHP A;  2GIZ A;  2WAE A;  2KDZ A;  2BY0 A;  2RGV A;  3BQZ A;  3H36 A;  4XNF A;  4AYB N;  2OCE A;  2O03 A;  3K4C A;  3K1M A;  4S0H B;  3JAM K;  2XRN A;  1U5T B;  3PJR A;  3HKZ N;  3L2R A;  2BVL A;  1D5Y A;  3HSR A;  3CC2 I;  1K61 A;  2JSC A;  4S05 A;  4G7H F;  1X2M A;  3DTE A;  1JTY A;  3FK7 A;  2O3F A;  2L3D A;  2QQB A;  4A3K J;  2HPM A;  4LLN A;  2P4W A;  5FB2 A;  2R7R A;  1ZN2 A;  1X4P A;  2FOW A;  5LEJ A;  4OIP F;  1ETX A;  2FUG 2;  3KLO A;  3I55 I;  1Y0N A;  5FKM A;  1E3P A;  1FWZ A;  4XIC A;  3B02 A;  1X58 A;  1Z05 A;  5IT3 A;  1TQM A;  4M3F A;  1AHD P;  4N4O B;  5D4R A;  1O3T A;  1D3Y A;  5LHH A;  4UUV A;  1FP1 D;  3W3C A;  4FX4 A;  2K9Q A;  1ZG1 A;  4JBA A;  4PZJ A;  3M1C A;  3ZQC A;  2W25 A;  1YJN I;  2R4G A;  4IHY A;  3LWF A;  2QZ8 A;  4RAZ A;  1XSD A;  1D0Z A;  1DQU A;  1F36 A;  3V7C A;  2EWN A;  2CUZ A;  5DTD A;  1VQ4 I;  2R3S A;  3OYA A;  5GTH C;  1VND A;  1W1W E;  2FBH A;  3BZK A;  3CCQ I;  4UY8 I;  3FXM A;  1FEX A;  1W5C C;  3HB9 A;  3BC8 A;  5CVV A;  3EUH C;  3GBG A;  5CKT A;  1RRJ A;  2ZJR F;  3OMY A;  2O61 A;  3AG3 H;  2MD5 A;  2D2W A;  3CJR B;  3H3V K;  1K83 J;  1Z91 A;  3A0B C;  3IH3 A;  3E6M A;  3LQR A;  1R9T J;  2DQL A;  1YX3 A;  2Y48 A;  4G6T B;  1I3Q J;  1DP7 P;  4E4H A;  2KFD A;  2XB5 A;  1S29 A;  1FSH A;  2PI0 A;  2MLK A;  5HVQ C;  1O7L A;  3BCA A;  4LJZ F;  1TP4 A;  2DXI A;  1IN8 A;  5DEQ A;  3U21 A;  3H3U A;  1HW1 A;  1QA6 A;  1JJ8 C;  4EM1 A;  5IY5 H;  5E3N A;  5DUK A;  2EV0 A;  4BEH A;  1CGP A;  5ICE A;  3U2R A;  4YEJ A;  1SMY F;  2HXO A;  3DLA A;  1FJL A;  1ETV A;  3OWT A;  4UVA A;  4XKW A;  3KZY A;  3ZMU A;  3CMY A;  1BW6 A;  4EV0 A;  3ZCO A;  1YLF A;  4OAY A;  2HWV A;  1D1B A;  4ETS A;  1DGR M;  1MGT A;  2HDD A;  4MGR A;  2JA5 J;  2JQ7 A;  1EV7 A;  3ZMZ A;  4EJW A;  1OCR H;  1YG2 A;  2D1V A;  4A2U A;  3ZQ7 A;  1U3E M;  1MBF A;  1XMX A;  1VI0 A;  2F5V A;  1QHH D;  3LSG A;  3ML6 A;  3S15 J;  3G1L A;  3J7A Y;  5GPA A;  3CCJ I;  1HLV A;  1MSE C;  4QLC U;  2ELJ A;  5IYB J;  1R36 A;  5EJC A;  3E97 A;  2XB0 X;  4LG0 B;  3KZI C;  4E7H A;  1LDJ A;  4UUS A;  5GTI C;  4M72 A;  4RAY A;  2ECC A;  2VE8 A;  4F55 A;  4M3D A;  4CZZ A;  5KAF C;  2MH9 A;  2CO5 A;  3TDZ C;  2IBD A;  2ZFW A;  4IRG A;  3F8N A;  2DAO A;  3PFI A;  1MBK A;  3QYF A;  1NG7 A;  4FT8 A;  1ZLK A;  5FO5 A;  4BAY A;  3J7Z I;  2VJJ A;  4W1U A;  1H9G A;  1YI2 I;  4A3D J;  2A69 F;  1KGS A;  2CS3 A;  4RDU A;  3K6G A;  1W4M A;  3MKY B;  1BL0 A;  4KIS A;  1A36 A;  2E2H J;  2KPM A;  2ZSI B;  1T38 A;  3RTR A;  4B3A A;  2AHQ A;  3I4N J;  2DMN A;  4RB1 A;  3GZ6 A;  3OS2 A;  5BPI A;  1WZ2 A;  3M1E A;  2FXA A;  2UWM A;  4EVI A;  2R7Q A;  1A31 A;  5E79 C;  1R5I D;  4UV8 A;  1LB2 A;  4II2 A;  2GZW A;  1MND A;  2DW4 A;  2XRL A;  3LSI A;  1REP C;  4V19 K;  1IRG A;  2OPT A;  3FXO A;  4CCJ A;  3WTS C;  3JRC A;  3B73 A;  4E7J A;  4Q47 A;  2BW3 B;  4LK1 F;  3TOA A;  3JSP A;  1OYW A;  2VXD A;  1U5T A;  3NAU A;  2M87 A;  3DBH B;  1ACI A;  2WWY A;  1HDP A;  4HYE A;  4AD9 A;  3KEY A;  3GTO J;  3QOP A;  4LIV A;  3C2G A;  2CQK A;  2EZH A;  4I01 A;  3MZH A;  2IW5 A;  4LLL A;  4YIF A;  3MKL A;  1BC8 C;  1T08 B;  4NUB A;  2YS9 A;  3RI4 A;  1U78 A;  3TED A;  2ISY A;  3BJA A;  1P92 A;  3IAM 2;  3ABT A;  3P9K A;  5HS9 A;  2MLG A;  3T0Y A;  4RM3 A;  1MH4 A;  2ETH A;  2AS5 F;  2HI3 A;  4WK8 F;  2M0M A;  2XSJ C;  4ZH4 F;  3HTU A;  1R5H A;  4DW6 A;  4WXC A;  2UZK A;  2PG4 A;  2NNN A;  3CMA I;  3HHH A;  3JCU C;  2EA2 A;  2H6B A;  5HDG A;  3CO7 C;  4HPQ A;  2LY2 A;  3WTU C;  1K78 B;  5DDG A;  2OZU A;  3MFK A;  2KRC A;  3ZMT A;  4G8X A;  2KHM A;  1OKR A;  1P9Q C;  3CC4 I;  5K1Y A;  3OYL A;  3FM5 A;  4LB5 A;  2DTZ A;  3U1K A;  3EUK L;  3C18 A;  3L2Q A;  5HNH A;  3PFY A;  1LFP A;  1PJR A;  3BP8 A;  3VOE A;  1F4K A;  2IPQ X;  4XOR A;  4CO8 A;  2LR8 A;  3GTQ J;  3LA7 A;  2DBB A;  1R7J A;  4YFK F;  4WCG A;  4KA4 A;  2UV1 A;  5IPA A;  2E60 A;  3E6C C;  3ZQH A;  1ENH A;  4O5V A;  3J80 K;  1JTX A;  3S3N A;  4A3B J;  1MJB A;  3DPU A;  2JTV A;  1BJA A;  3WTT C;  1ITY A;  5FD5 A;  5LHG A;  4BGD A;  2LY9 A;  3RQ4 A;  2IVM A;  2RC4 A;  3RPQ A;  3MZ8 A;  3VYS B;  1XS9 A;  4IHT A;  1UMQ A;  3H9J A;  2V1U A;  3ISP A;  2QQA A;  2Y2Z A;  4AC0 A;  2L5Q A;  4XRS G;  2LK2 A;  4XRM A;  1OCT C;  2EFP A;  3D5R C;  3T8R A;  5B1A H;  2FBI A;  1QHG A;  2BBY A;  2JPB A;  2HYJ A;  4BKX A;  2TRT A;  2Z5U A;  3TO6 A;  2K9M A;  5ICC A;  1RPW A;  2DA2 A;  2L7M P;  2YSR A;  2XV4 S;  3R0J A;  4RGS A;  4BBR J;  3ZRG A;  3J81 Z;  2XAJ A;  1FZP B;  2JUC A;  4HNV A;  4M6V A;  1AWC A;  5FLV A;  2HYF A;  1JJ6 C;  1Z9C A;  1ON2 A;  2A07 F;  4KDP A;  1S6L A;  4NC6 A;  2EQR A;  4BNC A;  3HIF A;  4E7S A;  2H8W A;  1TT0 A;  3I4M J;  2DLL A;  2IS1 A;  5CQE A;  2W4S A;  5ILU A;  4ZTF A;  3SYT A;  2Y69 H;  2DMT A;  2EIN H;  3QWL A;  3RCO A;  4LG0 A;  2KP6 A;  3K4N A;  2CSO A;  3HOT A;  1XDU A;  1N77 A;  4BL0 B;  1ERD A;  3WU0 A;  3JAM Z;  2E2J J;  3RZD J;  3OYF A;  5AIP A;  2Z1D A;  4ZC3 A;  4B44 A;  2XGX A;  3FK6 A;  2CUJ A;  4LD5 A;  5DCM A;  3K1N A;  2QA4 I;  3WGI A;  3AAF A;  4NB5 A;  2VKH A;  3WE3 A;  2VXZ A;  4BJT A;  1I6X A;  2MW8 A;  4EJU A;  1V55 H;  3GF2 A;  3SDG A;  1A6Q A;  4ABZ A;  4P1W A;  4UNO A;  4KT5 C;  2V1X A;  2XAQ A;  4G6Q A;  2QBY B;  3BOQ A;  1FTZ A;  1EH6 A;  2KIU A;  1HKT A;  3LMM A;  2KRF A;  3CJQ B;  5IP9 J;  3ULQ B;  2HOE A;  1I50 J;  2JWT A;  1D5V A;  1XSX A;  4HNU A;  2DCE A;  3S17 J;  3DU6 A;  2KQR A;  4GYG A;  2X1C A;  1O3Q A;  1POG A;  2OZ6 A;  2CQQ A;  4EM0 B;  1MMS A;  3GME A;  1T56 A;  4JK1 X;  4XKV A;  1O3R A;  2BW3 A;  4YRV A;  3FHN A;  4Y15 A;  1JHH A;  5JLX A;  4X0G A;  2CG4 A;  2WAD A;  2HS5 A;  3E1S A;  3KPH A;  2VT3 A;  5M3M J;  3HOW J;  2XGD A;  3HGY A;  5FRO A;  1O7F A;  2HDW A;  1FC3 A;  2L7F P;  3I53 A;  3SZT A;  2VC1 A;  2ADU A;  3M7G A;  2WB1 A;  1ZYR F;  2LFB A;  3DTI A;  4MLO A;  3ZQG A;  2W00 A;  3H5A A;  1RR8 C;  3PSF A;  1KU3 A;  3RKW A;  3S1R J;  2IS4 A;  3OS0 A;  2DPU A;  2E7W A;  5F0F A;  1O4X A;  2QSH X;  5IYC J;  3E6D A;  5L3C A;  4D9J A;  3PIP F;  4CH7 A;  4EQQ A;  2BY1 A;  1ZRC A;  5FLM J;  2X6Y A;  2XF6 A;  5D8K B;  2Q8K A;  1FTT A;  4M3G A;  2LRD A;  2DA7 A;  1ZR4 A;  4A3C J;  2X51 A;  2D1H A;  3LA2 A;  2G9W A;  3F8M A;  3FMR A;  2VOO A;  3NEU A;  3P7N A;  2F48 A;  1YW7 A;  4UHT A;  1G3W A;  3WG7 H;  2DFI A;  1RI7 A;  4ZDL A;  2F5C A;  2DOD A;  1K78 A;  1OCZ H;  3CUQ B;  1G3Y A;  2R92 J;  2BXY A;  3L00 A;  3PQJ A;  1MNM C;  1J2X A;  3LST A;  3H92 A;  2IS6 A;  2QUF A;  3GCM A;  1WQ2 A;  2RKH A;  3KX2 A;  4CCM A;  1X2N A;  2VE9 A;  1F43 A;  4FX0 A;  5E17 F;  4JQF A;  1QVT A;  2HFH A;  1HST A;  4P5O A;  2CV1 A;  4HNT A;  2YUS A;  3HYI A;  3FKJ A;  2W7N A;  1ZHF A;  5BS6 A;  2BGC A;  2JUG A;  1IV6 A;  1EF4 A;  2W1O A;  3GTK J;  2IXS A;  4HG2 A;  2R7O A;  1S9H A;  1LFU P;  4V2F A;  2HZD A;  5FFZ A;  2OU2 A;  1ULY A;  2HXI A;  2KIS A;  3SFZ A;  4Q48 A;  4C2U A;  3F3X A;  1QPM A;  2L9S A;  3FMQ A;  1V5G A;  4GYI A;  1N75 A;  4BJ5 C;  4HV6 A;  2W24 A;  3Q9V A;  2P6S A;  4CZC A;  5KK1 A;  3S2H J;  1FX7 A;  3CUQ C;  1IZ1 A;  4U7B A;  2BHZ A;  2K5C A;  3ONQ A;  3H5R A;  5B5E C;  1FMV A;  2DA6 A;  2FML A;  1A5J A;  4MQV A;  4BDY A;  4FE4 A;  1XDS A;  2M30 A;  2R7T A;  2CW0 F;  4NC8 A;  1ZRF A;  1FMW A;  2XGC A;  1WH5 A;  2EIM H;  4M74 A;  1JGS A;  5EZG A;  4Y33 A;  2PLY A;  1VQK I;  1L3L A;  3JTH A;  5J1U A;  2JT1 A;  4ZJZ A;  1MH3 A;  3WHC A;  3CCR I;  5E18 F;  1MDM B;  1A04 A;  4P9F A;  4I76 A;  2M8E A;  1S7O A;  3BRO A;  2JA7 J;  4M6Y A;  2XKO A;  2NOJ B;  3GWZ A;  4OU0 A;  2EV5 A;  4XOP A;  4Y7N J;  2DFF A;  4CA0 A;  2K02 A;  2YU9 J;  4HX4 A;  1R22 A;  3H0D A;  1XD7 A;  4A6D A;  3V42 A;  5FFX A;  3FXQ A;  1F5T A;  3NQO A;  2MAB A;  2XF7 A;  2JJ7 A;  2QBY A;  3G1M A;  2EBI A;  3ESW B;  2ME6 A;  3VSL A;  2ACJ A;  1FOK A;  3GXO A;  4ESJ A;  3FBN B;  3T5X A;  4ZDP A;  1XCB A;  4JYK A;  2K86 A;  2CMP A;  4U0V A;  4P55 A;  4XOT A;  1IG7 A;  2DI3 A;  3IWZ A;  5F08 A;  2BVM A;  2VN2 A;  4UXN A;  2E19 A;  2J5O A;  4EJV A;  1MBG A;  1ZEL A;  3WU1 B;  4E7L A;  2V6E A;  2WAQ A;  1TQI A;  3M3Y J;  5L3F A;  4BU2 A;  3IKT A;  1T39 A;  1BN5 A;  2CW8 A;  2ZKZ A;  1MMN A;  3LA3 A;  3WHB A;  4I6Z A;  4HV5 A;  2LOO A;  3HOS A;  5E3L A;  4H0E A;  1KZH A;  4IL6 C;  2V9K A;  3UNG C;  3QYE A;  1VQ8 I;  2A5Y B;  1SAX A;  2CYY A;  1MD0 A;  2FX0 A;  1G6N A;  4IHX A;  2PEX A;  3VYU B;  3P9C A;  1SFK A;  2DFH A;  1RKT A;  1BR2 A;  2BOL A;  3WE2 A;  3PSI A;  2FU4 A;  1BI2 A;  4HDV A;  3BR5 A;  5DUI A;  1D8J A;  1X1D A;  4D0P A;  4DYC A;  2XAF A;  1R49 A;  1FYL A;  1LDK B;  1IJW C;  1H88 C;  3OYI A;  1LNW A;  3FM3 A;  2BZT A;  2TDX A;  5JFR A;  1P4W A;  3K4J A;  4QSH A;  2GXG A;  1WFX A;  2VBZ A;  3SEZ A;  4XQF A;  3J80 Z;  1PVE A;  4ZZL A;  2XAS A;  2O8X A;  3W2A A;  1FYM A;  1NK3 P;  3CCU I;  1GUU A;  3ZQL A;  1OCO H;  5LLQ A;  1MMD A;  4YII A;  2VQH A;  4A3I J;  2EIK H;  5H6Q A;  1MKM A;  3K4K A;  4Y17 A;  1OLT A;  1TWH J;  3IP4 B;  2HQR A;  4WF2 A;  4UV9 A;  2K40 A;  1T0F C;  2M0C A;  5D8L B;  3COA C;  3CUQ A;  1SD5 A;  3A03 A;  4DGW B;  3J81 K;  5JLW A;  2VOP A;  1LE8 B;  2HOT A;  1I1S A;  2I10 A;  4HZF A;  1ETY A;  2IGO A;  2Y0S A;  2JSP A;  4CXF A;  2M5W A;  1EH7 A;  3KIO A;  1U6G A;  1GXQ A;  2GBY A;  3D5S C;  3KYL A;  4A93 J;  5F04 A;  3Q0V A;  3ABK H;  5JVT A;  5KVR A;  2DDB A;  3PUB A;  1S72 I;  1ZQ3 P;  2LYC A;  2YPR A;  2W82 A;  2P81 A;  3CDH A;  4XLE A;  1SFE A;  2EFO A;  4HX8 A;  2DK8 A;  2Q1Z B;  2PX9 A;  2PN6 A;  3S32 A;  2MSY A;  3JRE A;  1U9N A;  4LIT A;  1I39 A;  2PMZ N;  3I5U A;  2NAZ A;  2XPV A;  3MVP A;  5HLG A;  2IJL A;  2XKP A;  1B9N A;  5ICF A;  3IRQ A;  4C2T A;  4ZYD A;  5H2F C;  1PDN C;  2HYG D;  3CO6 C;  3H1C A;  1ZRD A;  3ZPL A;  1RZ4 A;  4G12 A;  3WTW C;  1CQT A;  3KP3 A;  3RPU A;  2NS7 A;  1SEU A;  4KIC A;  2Q2E B;  4GCV A;  1LVA A;  4GDF A;  2L4A A;  4GRI A;  1TWF J;  2DT6 A;  3GFL A;  1LQ1 A;  3GFI A;  3DWL E;  4LG3 A;  4A0X A;  2E36 A;  3MQ0 A;  2M7B A;  3BZ6 A;  4XR6 A;  2E71 A;  2L02 A;  2PMU A;  3PUF A;  3GLX A;  1WJC A;  1ZKG A;  3WU2 C;  1PUF B;  4KYW A;  1MDM A;  3HUG B;  4ZYG A;  2RNJ A;  4XID A;  3HRS A;  4PJ0 C;  1U5T C;  1JXS A;  1FIP A;  3S1M J;  1YW8 A;  5DD4 A;  3PO3 J;  3R6S A;  1UST A;  4I98 B;  4E7K A;  3ZQQ A;  2BE5 F;  5LFA A;  2EFN A;  3TGN A;  4MTE A;  2G7U A;  3BQY A;  1TL8 A;  1BBY A;  4RGU A;  4UB6 C;  1LDD A;  2VUM J;  3RYR A;  1WI3 A;  1MW7 A;  2XHK A;  5F6F A;  2VKD A;  3EYY A;  1V3F A;  2K4J A;  1WRJ A;  3PM1 A;  1FBS A;  4XM3 A;  5JI6 A;  2NVQ J;  1AOY A;  2XSD C;  3W6J B;  2V6C A;  1HA8 A;  5FKK A;  3ZOB A;  2DMP A;  4IPA A;  4RBO A;  5D5W B;  3F21 A;  3P5J A;  1SFX A;  2COM A;  3OY9 A;  3OSG A;  4AM3 A;  2ZB9 A;  1B8I B;  1R00 A;  4HBL A;  3QU6 A;  1SFU A;  1RIO H;  2E1N A;  1T0F A;  4RGX A;  4HF2 A;  1MBE A;  5FGM A;  2EIL H;  4MFD A;  3DFG A;  1F9N A;  1IAW A;  1GV2 A;  4WX9 A;  1OPC A;  5IT9 Z;  3VYT B;  1Y8Q B;  5KHD A;  2RNG A;  3W6K B;  1VQN I;  4D1Q A;  2HKX A;  2Y31 A;  2QWW A;  4MEX F;  5F1R A;  4KMU X;  4II3 A;  3M8E A;  4OIN F;  1O57 A;  4M9X A;  5CVJ A;  4KUM A;  1VQ7 I;  1WHU A;  3CD6 I;  1PP7 U;  1B1B A;  3BTJ A;  1JI8 A;  2VQL A;  4M9S A;  2R5Z B;  1G4D A;  2X6O A;  2R7Z J;  1BR1 A;  1GVJ A;  2O0Y A;  4BS9 A;  3OL4 A;  1IC8 A;  1YTY A;  1RUN A;  1XMK A;  2QQ9 A;  4X6A J;  1FLI A;  4M6X A;  4L18 B;  1MJ9 A;  2QKL B;  1JT6 A;  3OOU A;  4DQ2 A;  4EGZ A;  2STW A;  2NNY A;  4IQJ A;  4Q5S F;  3LSJ A;  2O8K A;  2VBY A;  4NQW B;  1N25 A;  1FOW A;  2H09 A;  3C2B A;  1X1B A;  5CVR A;  4AWX B;  2VLA A;  2WAQ N;  3TL4 X;  5L3E A;  4LLG F;  5FKN A;  1FT9 A;  3K1P A;  3L2U A;  3HOU J;  1KYZ A;  3CCL I;  2HOA A;  5D4S A;  3AG2 H;  3BDD A;  3KP7 A;  2ICW G;  4JX6 A;  1KU9 A;  1LE8 A;  3RKX A;  1N78 A;  1IXC A;  3SXY A;  4Z6Y A;  1K6Y A;  4IOA F;  1WJF A;  1HOM A;  4U87 A;  4EAT A;  1SMT A;  2F2E A;  3LNQ A;  4RB0 A;  4XN0 A;  2ELK A;  1AKH B;  3MMY B;  3QPS A;  4IZZ A;  2HVQ A;  2AXL A;  1JKP C;  3K70 D;  4HST A;  4RM2 A;  4PGG A;  2KJC A;  4IVN A;  3OSF A;  2FJ1 A;  3T1B A;  2TCT A;  5E1Z B;  2VOD A;  2QGU A;  3SDB A;  1MMA A;  3ZR8 X;  1QPI A;  2ESN A;  4XSZ F;  3CJT B;  1IUF A;  5E20 A;  2VJ5 A;  4EGY A;  4FET A;  1ZGJ A;  3DPT A;  4DZJ A;  2K3F A;  1BI3 A;  2LC2 A;  3IKV A;  3K70 C;  4OWR B;  2LKP A;  3RIR A;  5KNL A;  4FE7 A;  2BY2 A;  5HDN A;  3SHF A;  2CQX A;  4N9I A;  1UHW A;  2GOX B;  3DKX A;  2E7X A;  3D5L A;  4KFC A;  2BV6 A;  2Q2E A;  3GW2 A;  4RAG A;  1XB4 A;  2ZC2 A;  1Z21 A;  4HDU A;  1S5L C;  3QP5 A;  2Y0S N;  5DD8 A;  2EV6 A;  4HQM A;  3I9V 2;  1P7I A;  3WOD F;  3FKI J;  4B3X A;  1SD6 A;  3CME I;  1KQ0 A;  2X6X A;  3M9A A;  3R0A A;  4CCN A;  5E8G A;  1OR7 C;  1YHQ I;  1PUF A;  4CSW A;  3HUG A;  2Z16 A;  1FP2 A;  2IGN A;  1X1P A;  4YIR X;  1R58 A;  3BR6 A;  3VDX A;  2NOG A;  4DJA A;  1P4A A;  2LF7 A;  3ERM A;  5J4Y A;  4IQ4 A;  1BI0 A;  1GDT A;  1ZG5 A;  1Y1V J;  5EYR A;  3CDL A;  3DCF A;  5F0C A;  4CCO A;  2HKO A;  3BJ6 A;  4AIJ A;  5J4V A;  2I5U A;  2GIV A;  2FEZ A;  1QZZ A;  2EJR A;  2QSG X;  4N9H A;  5M5W J;  2HNH A;  2O5R A;  2GA1 A;  4A6E A;  1D0X A;  3FHZ A;  3OYK A;  5FLX K;  2GLO A;  5BNG A;  3FXK A;  3BT9 A;  4TV7 A;  5HS7 A;  2M2E A;  1QNT A;  2V79 A;  4FTH A;  2ZXH A;  4XLN F;  2W48 A;  3HEF A;  4JOM A;  2X1D A;  3IL2 A;  1B8I A;  2NS0 A;  1IRX A;  5HOD A;  4I0B A;  5HLT A;  3BTC A;  4XK4 A;  1TNT A;  4R1H A;  4XLH A;  5DM6 F;  3D1N I;  5LGT A;  5EGO B;  4KMF A;  3HRM A;  4HRI A;  5F27 A;  4OIQ F;  4N0B A;  1IDY A;  4IOC F;  1HSJ A;  3EDP A;  1UAA A;  3S1Q J;  1E3O C;  2LH9 A;  4BQA A;  1X3Z B;  1QQI A;  3E6B A;  2DA3 A;  2V1N A;  4HSR A;  2LLK A;  1E17 A;  1Y8R B;  2Y0M A;  2X6W A;  2ID6 A;  3IH4 A;  3B6C A;  4ITV A;  3F23 A;  4IXA A;  4BAC A;  2DOE A;  3HSF A;  3MCZ A;  2R5Z A;  1O3S A;  4CDG A;  4EJO A;  5IP6 A;  2YX7 A;  4IRI A;  1Y1W J;  2F4M B;  2PBI A;  2P5K A;  2Z2S B;  1IDZ A;  5BQT A;  3JR9 A;  2FF4 A;  3JRD A;  4Y4R A;  1D1A A;  2CRG A;  5LBQ A;  4DBQ A;  3C7J A;  5C4J J;  3Q5F A;  4JP0 A;  5IOZ A;  2OTJ I;  3QQA A;  3W6V A;  4NQW A;  4PUS A;  4P96 A;  2LKX A;  2R7W A;  5K5R A;  2Z33 A;  1DDN A;  2ZNZ A;  1F1Z A;  2GAU A;  2NVX J;  4HF1 A;  1WWX A;  2JA2 A;  3EPZ A;  4BY7 J;  4PGH A;  2P5L C;  2RV8 A;  1RR7 A;  1DGW Y;  4PFP A;  3QAH A;  5EEG A;  4G7Z F;  3DP7 A;  2DN0 A;  5K7Z A;  5K5O A;  2CQ7 A;  2E34 A;  3E0J B;  5ICG A;  1IV8 A;  1LKX A;  2RAE A;  1ZRE A;  4V2G A;  2FQ3 A;  3FF5 A;  3C1D A;  2JPC A;  3GTP J;  2AQF A;  1IN7 A;  2K4B A;  1AKH A;  2A5W A;  2ME0 A;  2OBP A;  1DPU A;  1TZL A;  3O6B B;  4NDL A;  2M4G A;  2V26 A;  1OR7 A;  2QCO A;  3WTX C;  3VWB A;  5AON A;  4B47 A;  1MMG A;  2B63 J;  5D5U B;  4KIF A;  1VFC A;  2DA4 A;  5H6R A;  4X1E A;  3CP8 A;  3F9K A;  3L7W A;  1I5Z A;  3JRH A;  2CU7 A;  4PDK A;  4PCQ A;  2NVU B;  3IRR A;  3MKZ A;  4IJA A;  2VI6 A;  3I4P A;  1TC3 C;  3ASO H;  2YU3 A;  2EPF A;  1CF7 B;  1W5S A;  1H9T A;  1UCR A;  1FOX A;  5CVU A;  5GP9 A;  5KCM A;  1IXS B;  1B59 A;  4IRH A;  2CFO A;  4B1R A;  4ESF A;  1H8A C;  3RJP A;  1YE9 A;  4PSW A;  3QPT A;  2X9D A;  1I6H J;  1Y0U A;  3FWE A;  2IA2 A;  3QPH A;  3HOY J;  2H94 A;  1BIA A;  3TMO A;  1QZY A;  1RET A;  3MN2 A;  2QLZ A;  3TW7 A;  2K9N A;  3GZN B;  4Y3O A;  2E1O A;  5J40 A;  5LRS A;  4ENN A;  1T8I A;  2YX4 A;  2KLO A;  2BYV E;  3KE2 A;  3CF5 F;  3C2H A;  3RKY A;  3BLY A;  2R7D A;  4AYB A;  5IT9 K;  3BZC A;  2LSO A;  1MSF C;  3RQI A;  5FJ8 J;  2V4J C;  3ZMD A;  3HKZ A;  3CCV I;  1BM9 A;  2CQN A;  3BPX A;  5JR3 A;  3QPL A;  4BQN A;  3HC7 A;  3A4C A;  5HOO A;  4UVB A;  1GXP A;  4M3B A;  5D6F A;  2W85 A;  1G3T A;  2VQC A;  4BQO A;  5GAH J;  4BXF A;  3OYC A;  4XL9 A;  4PJM A;  2LP0 A;  3OYJ A;  2CFX A;  1M1E B;  1YO5 C;  4KN7 X;  1PP8 F;  2LG4 A;  3HGG A;  3ZMV A;  3LFU A;  3AKZ A;  3S1N J;  3KET A;  2D45 A;  3HXL A;  3DKW A;  3F6O A;  4OAZ A;  1SVM A;  3DEU A;  4UUT A;  2ZJQ F;  3ROU A;  4CGZ A;  5ED4 A;  1H89 C;  4LB6 B;  1QGP A;  3IWF A;  3BTL A;  4L9N A;  2UXN A;  1V4R A;  1SVL A;  3E7L A;  1ZTR A;  2XAH A;  1VQM I;  2X48 A;  5B3S H;  1TBX A;  1UZC A;  5EGO A;  3RSN A;  4NBQ A;  2OTL I;  1OYY A;  1IO2 A;  3PNV A;  2CWE A;  3V8J A;  2LDU A;  1BOA A;  1X3W B;  1HBX G;  4ZZD A;  3HOX J;  2VQG A;  3Q0U A;  5HNF A;  1WPK A;  3CQZ J;  2K7L A;  2HEO A;  3I54 A;  4HLX A;  1A35 A;  3TBI A;  3RKQ A;  2W84 A;  1T98 A;  2XPW A;  3HSE A;  2BY3 A;  3W2V A;  4NC7 A;  1DPR A;  3IUO A;  1OYI A;  1H0M A;  1MBJ A;  2HTS A;  1TQP A;  2LD5 A;  1JE8 A;  1WJE A;  5D6E A;  3EYI A;  1KU2 A;  2JN6 A;  1ZGW A;  2ZME B;  5GAD J;  2IP2 A;  1Z1D A;  1FYK A;  1LEA A;  3G4S I;  4A0Y A;  5L3G A;  5EG0 B;  1ONV A;  2EA4 A;  1XPX A;  3HHG A;  1W0T A;  1W36 D;  1TW3 A;  1A6I A;  1HQC A;  1IRZ A;  3BR3 A;  1SD4 A;  1SFO J;  1TWA J;  3RPU D;  3LQQ A;  3CMM A;  2LVS A;  2ZXW H;  5L3D A;  4WXD A;  4AVZ A;  2RDP A;  2ZSH B;  3L2C A;  1W36 C;  5E8I A;  1WKM A;  1NHA A;  4LK0 F;  1MNE A;  1ON1 A;  3BG6 A;  1X19 A;  2H1K A;  2EFQ A;  1X4O A;  2AXT C;  3MD2 A;  4O3M A;  1YFH A;  3OOP A;  1E0E A;  5JVG F;  2JA6 J;  1YOV B;  1S3J A;  4HQE A;  1T33 A;  4C3J J;  2E5Z A;  2LMD A;  1W7P B;  5K7H A;  2WAF A;  3F8B A;  2M3A A;  5E1X A;  2ZME C;  1AU7 A;  2P7C B;  1UJ8 A;  4BHC A;  2N8G A;  2WY8 Q;  1OCC H;  2IEK A;  1TWG J;  1ZLJ A;  4XLA A;  1VTN C;  2GXA A;  3H9Q A;  5ILS A;  4F92 B;  2ZNY A;  3FDY A;  1VZ0 A;  2KRH A;  1ZH5 A;  1CF7 A;  2VIX A;  4D5F A;  3JRB A;  4E70 A;  1VQL I;  2L9V A;  2L9N A;  3CCE I;  2K27 A;  1TT5 B;  1XSV A;  3O2P E;  2EB7 A;  4BY1 J;  2EK5 A;  5D5V B;  3I64 A;  3K0L A;  1YRN B;  1T2K A;  3HRU A;  2W57 A;  2PFB A;  1YQA A;  3VYR B;  5FLX Z;  4FIS A;  5LRR A;  2O7O A;  3KP2 A;  4IKF A;  3NWS A;  1Z67 A;  2XAU A;  2HVS A;  1IW7 F;  4DNC A;  2WV1 A;  1XCV A;  3SEQ A;  4A5M A;  3VOD A;  2FE3 A;  4F91 B;  1J09 A;  3AL0 B;  1D1C A;  2CW7 A;  4YEL A;  5EZH A;  3BR2 A;  3K4L A;  1JKO C;  5GAG J;  3DXJ F;  3GTJ J;  2F5D A;  5M3F J;  2FNP A;  5BPD A;  1J59 A;  5DCF A;  3H9G A;  5E3O A;  2MGQ A;  1V5E A;  1U8R A;  5GPC A;  5IYD J;  3K2A A;  4RB3 C;  2F4I A;  3DKY A;  2V9P A;  3OIQ A;  1RKW A;  1EKE A;  2HQ5 A;  4RLQ A;  1K4T A;  2FQ4 A;  2VKE A;  3IHU A;  5HDK A;  1MJA A;  5CVI A;  1YYV A;  3LSP A;  2WB1 N;  2Z99 A;  3K4M A;  5HS8 A;  3N05 A;  1ORK A;  2PQ8 A;  2HTJ A;  1R23 A;  2Z9O A;  2HQA A;  4BYY A;  1OMI A;  2VT2 A;  3HRT A;  3G73 A;  1WGX A;  4HLY A;  5LD2 C;  4KJZ A;  1D0Y A;  4PJN A;  1DP3 A;  3IV5 A;  1WCM J;  1R71 A;  4BDZ A;  1R1U A;  2H27 A;  1NG6 A;  1E2X A;  4ZYE A;  2XPU A;  3HBL A;  3MWM A;  1LFB A;  2WV0 A;  4MTD A;  3OYB A;  1WI9 A;  2DYR H;  4FQG A;  4R8H A;  1IN5 A;  2VJI A;  3QU3 A;  3OYE A;  3KYD B;  4ENM A;  2DOF A;  3KYC B;  1EJ9 A;  2MH2 A;  5AIQ A;  3TDU C;  1S7E A;  4LMY A;  1BA5 A;  1YW9 A;  4DBR A;  1QU3 A;  1J75 A;  2ZJ2 A;  2XC7 A;  1W0U A;  3BPV A;  3DTK A;  2ESH A;  4L9J A;  2DYS H;  4DIQ A;  1EA3 A;  3KP5 A;  3DV8 A;  4M3E A;  1LPQ A;  1HW5 A;  3GO5 A;  1KA8 A;  4EEF G;  2L2O A;  1FOY A;  4QPO A;  1P7J A;  2X1E A;  1RNL A;  2H1L A;  2RQQ A;  2IRF G;  2A05 A;  3WTV C;  5LGU A;  3H0G J;  4EJT A;  4G7O F;  1ODD A;  2COB A;  1KQ8 A;  3JRG A;  2QEX I;  1D8K A;  3RYP A;  2LKS A;  1WJB A;  4B8X A;  1NH3 A;  3HTS B;  2ZME A;  2X0L A;  2R0Q C;  4XLP F;  4A69 C;  5EG0 A;  2GM4 A;  2IT0 A;  3FX3 A;  2B7E A;  2K3P A;  4QIW N;  4A3F J;  3ECO A;  5LHI A;  1HCR A;  3EUA A;  2CGP A;  1HKQ A;  2G0E A;  3G71 I;  4OIR F;  4A3J J;  1X1A A;  2QSF X;  1KON A;  1XX5 A;  1J5Y A;  2DT7 B;  3L09 A;  1HKS A;  5B66 C;  4KT6 A;  2Y9Y A;  4B09 A;  2DU9 A;  2EFW A;  2V7F A;  4XN3 A;  1XGN A;  4MHG A;  1B6A A;  4XBF A;  3M8F A;  1VQ9 I;  1B9M A;  2P6T A;  4EM2 A;  4OIO F;  5FRN A;  2DQR A;  3HM5 A;  3PO2 J;  2KIM A;  1GV5 A;  3WGG A;  5DS9 A;  4BE1 A;  3JW4 A;  2KMU A;  2JK3 A;  3HG9 A;  2XGE A;  3I3L A;  2MA3 A;  2HQN A;  5TJJ A;  3OYN A;  3E5X A;  3Q3S A;  1W7P A;  3FZV A;  3A01 B;  3LSM A;  4FCY A;  1YIT I;  3PIO F;  4MIM A;  4XMY A;  4M71 A;  2NVT J;  2KKO A;  3BY6 A;  4AID A;  2E35 A;  2PJR B;  1S8N A;  3J7Y J;  4CHU A;  4AIK A;  2B9S A;  2WC2 A;  3M8J A;  1K6O A;  9ANT A;  4C3I J;  3CUO A;  2KDO A;  4A0Z A;  5GAE J;  3L2V A;  3HPH A;  2VBX A;  4G6D A;  4G9Y A;  3X2Q H;  2GXB A;  3HPG A;  2EZI A;  2P7V B;  3DEW A;  4GGG A;  4XKC A;  1JUP A;  2G7H A;  5K7F A;  2A6H F;  5DYM A;  3A2K A;  3NRV A;  3KEO A;  4F52 A;  1B72 B;  3P9I A;  3FXU A;  2OD5 A;  3JTG A;  4XON A;  2F6C A;  2RN7 A;  3M4O J;  2IA1 A;  3L1P A;  2ZFU A;  1YRN A;  3O8H A;  4MO7 A;  3L9F A;  3S14 J;  5C3E J;  1J9I A;  2M45 A;  3F8F A;  4JX5 A;  2ZXI A;  3GEZ A;  1E3H A;  1YJW I;  2XVC A;  2DK5 A;  2Y9Z A;  3S16 J;  5BMZ A;  3WTY C;  2Y30 A;  3UKG A;  2R7V A;  1SVO A;  4M9Z A;  4ON0 A;  1QO0 D;  2STT A;  2MC3 A;  4RLF A;  2OV7 A;  2E2I J;  3OS1 A;  1XG1 A;  4ENK A;  1UFM A;  1XTA A;  2QQ8 A;  3TP3 A;  2VB6 A;  1RUO A;  2BHY A;  1P6R A;  4QTR A;  2VPR A;  4A5N A;  1LUJ B;  1OFC X;  3CCS I;  4IF4 A;  1C0W A;  3EET A;  4J01 A;  3TO9 A;  4NHJ A;  5C4X J;  2F5F A;  2CH0 A;  5LEK A;  2DMQ A;  2JVH A;  3BTI A;  1MBH A;  2XDV A;  5J1Y A;  1YS6 A;  4G94 A;  4A12 A;  1GVD A;  3OR2 C;  1RC9 A;  3KCC A;  2F4O B;  3I56 I;  4U7D A;  1Q1V A;  5DCM B;  2L54 A;  2L01 A;  2OJE D;  3CJN A;  4JX4 A;  1I1G A;  1KYW A;  4Q4Z F;  3I0T A;  2KZV A;  1QZE A;  4ESB A;  2L7Z A;  3JSO A;  1FBU A;  1R5G A;  2EZL A;  1IXR C;  1ZG3 A;  3I71 A;  2KJB A;  2OUM A;  2QVO A;  3GVA A;  3ECH A;  4PJL A;  3V7R A;  2V9V A;  2HU9 A;  2Y75 A;  1Z0X A;  2IGM A;  3BR1 A;  3CCM I;  2GWR A;  1JKQ C;  1KU7 A;  2VON A;  1XC5 A;  1OJL A;  3IC7 A;  4ZYA A;  5M5X J;  3SJM A;  3KLN A;  2MFZ A;  3OR1 C;  1LVK A;  1BJZ A;  2H6C A;  4U0W A;  3CDI A;  4MQ9 F;  2JMW A;  1HXD A;  3ZMS A;  3PNT A;  3O8G A;  2RVC A;  5FKO A;  2C6Y A;  1JKR C;  2CUF A;  4QWQ A;  4L9V A;  4XLF A;  4CIC A;  5BOX A;  4AUX A;  2RRE A;  2VAS A;  4I7H A;  1YJ9 I;  2E5N A;  3N4M A;  1TW2 A;  2QYO A;  2R93 J;  3IAS 2;  4YFX F;  3EUH A;  3CES A;  4O6J A;  4XRF A;  2R7U A;  4B48 A;  2IGK A;  1YS7 A;  2M9H A;  4AIH A;  1V5F A;  4ASN A;  3GLL A;  1IF1 A;  2A61 A;  2DA1 A;  5J47 A;  2IA0 A;  3S2W A;  4IEJ A;  2JRM A;  1TNS A;  4RGR A;  1DU6 A;  1U8B A;  1XN7 A;  1TWC J;  3PL8 A;  1UG0 A;  1R4M B;  2EZK A;  4R79 A;  4XKB A;  1BI1 A;  2VC0 A;  2IAI A;  3ELK A;  4KN4 X;  1WJ5 A;  3H3Z A;  2HVR A;  1Q1H A;  2HR3 A;  4H4K C;  4NNJ A;  1FBQ A;  2FSW A;  3FBI B;  4LFU A;  1Y56 A;  4J19 A;  1G2H A;  2NXN B;  2A3S A;  2HZT A;  4WXH A;  1JUM A;  2NVY J;  5F1J A;  4P9U A;  3WTZ A;  3F72 A;  3A01 A;  3DQV C;  3VFZ A;  3VPR A;  1Z3Y A;  2ZCW A;  1VQP I;  2CJJ A;  3KFW X;  3VEP A;  3H5N A;  1XMA A;  4BQQ A;  1XGM A;  2LNB A;  4HEA 2;  2UXX A;  5DV5 A;  5E1W A;  4FHT A;  2PJR A;  2XUB A;  2FNA A;  3U1D A;  2VJ4 A;  4ZTJ A;  2F5E A;  1FIA A;  2JRT A;  3MAJ A;  5HLH A;  1Z7U A;  2Z3Y A;  1K4S A;  4BUP A;  3FIS A;  2AO9 A;  4WWC A;  3F6V A;  3CCY A;  3OV8 A;  4BXU A;  4IHW A;  3F0C A;  3LSK A;  2XIG A;  3MZY A;  1P2F A;  5A2Q K;  1FPQ A;  1UHM A;  2WY7 Q;  3U9G A;  1B72 A;  3GFJ A;  4MEY F;  2JZY A;  1XGO A;  3CF2 A;  4UB8 C;  4F7Z A;  3F22 A;  4EMS A;  4S04 A;  1B4A A;  3QRF F;  4A3G J;  3TKY A;  3S2D J;  3BG9 A;  3AG1 H;  2FD5 A;  5TRD A;  1JT0 A;  4A3L J;  3W2W A;  2FBK A;  2X4H A;  5CQG A;  3TP0 A;  4KNY A;  3DLL F;  2OQG A;  4HOB A;  1BOB A;  2WTE A;  4RB2 C;  1ZAR A;  3G6E I;  2JA8 J;  3GZ5 A;  1BW5 A;  5FD6 A;  1KQ9 A;  4BHB A;  2QF7 A;  2WBM A;  5F0H A;  4QPQ A;  1ZR2 A;  4DYR A;  1IUY A;  5TGT A;  2LF8 A;  5CJ9 A;  1K7A A;  5IOY A;  1HDD C;  1U2W A;  3I58 A;  3J7A O;  1FSE A;  4XSX F;  3I59 B;  5FRM A;  4PSX A;  3S3M A;  3E3V A;  2GOM A;  5J6X A;  1Z6T A;  3OL3 A;  1YIO A;  4BXX J;  3G2B A;  4I99 C;  4E7I A;  1JUS A;  4L5E A;  3JRI A;  1J7K A;  4AVP A;  3VB2 A;  3DPL C;  2XF5 A;  1APL C;  3OIO A;  1X1C A;  2A6E F;  2NRA C;  2OC6 A;  2M7A A;  1ETQ A;  1WSU A;  3GX4 X;  4W97 A;  1SC7 A;  3Q0W A;  3OYH A;  2A6T A;  4MNU A;  3QYB A;  4F93 B;  5F64 A;  1T95 A;  3DEE A;  3C3W A;  2QEN A;  1JGG A;  4HW0 A;  4U0Y A;  2DJI A;  1QBJ A;  4XRS A;  1MIJ A;  4K2E A;  3FMS A;  2OF7 A;  3A1Y A;  5H20 A;  4MFE A;  3M07 A;  3AFH A;  3OYD A;  1AA7 A;  3CP2 A;  3S3O A;  1QRY A;  2GA2 A;  3HJE A;  2OAZ A;  1NTC A;  3HOZ J;  3MKW B;  1R4N B;  5FKL A;  2R5Y B;  4HA8 A;  2EH3 A;  3K9T A;  1DU0 A;  4E6K G;  3K2Z A;  3QP6 A;  2FA5 A;  3QOE A;  5K5Q A;  1GHC A;  4GXO A;  2DMU A;  2VPL A;  5CYV A;  1UEL B;  2HDC A;  3GFM A;  3CTA A;  4OOI A;  3WG9 A;  3Q9S A;  3KEQ A;  3GTL J;  5C44 J;  2ID3 A;  4PJJ A;  4C3H J;  2LBF B;  1XGS A;  3GYH X;  3L2W A;  4BH9 A;  3FXR A;  3A0H C;  2ZJP F;  3DF8 A;  1STZ A;  4BJ6 C;  3ABU A;  3BG7 A;  4CYC B;  3JRF A;  1QVU A;  4C30 A;  3BG3 A;  1SAN A;  2ZBK A;  2FMY A;  2AQE A;  2K85 A;  1U0J A;  3DU5 A;  4L0Y B;  3SQN A;  1FNN A;  4AU7 A;  2L4M A;  4HAM A;  1K79 A;  1OIS A;  3HL2 A;  3K4B A;  1ETW A;  2K9L A;  3GUD A;  2H8R A;  5EF6 A;  3S8P A;  2MD0 A;  3ABM H;  3KZZ A;  3LFK A;  2DOA A;  5TIS C;  5J1R A;  3V8L A;  4GO1 A;  1EH8 A;  3R4K A;  3HOV J;  4YG2 F;  2PMZ A;  3N97 A;  1R6R A;  1TTY A;  4CCL A;  2LTP A;  1HF0 A;  4I02 A;  1SAU A;  3SZP A;  3R60 A;  1G59 A;  3K7A J;  5DM7 F;  1WJA A;  3ZXS A;  5IP7 J;  3B6A A;  1BC7 C;  4D5C A;  2Q0O A;  3ERE D;  2IS2 A;  4BE0 A;  2KT0 A;  1VF9 A;  4RA2 A;  1X3U A;  4LIU A;  2KL4 A;  5EDN A;  4CUG A;  2E1C A;  1LJ9 A;  2OQR A;  3LSR A;  2GQQ A;  2K9S A;  3OYM A;  4Y52 J;  4ZDO A;  3K10 A;  3F8C A;  1NK2 P;  2L0K A;  4I0A A;  4KIB A;  2QKM B;  1YX5 A;  4A3E J;  2M4K A;  3BCB A;  3CLO A;  2KIQ A;  3E5U A;  1MZB A;  3QOD A;  1VQO I;  3GTG J;  1Z7L A;  3TQN A;  5JHU A;  1OQY A;  1R1V A;  3OIP A;  4M73 A;  2P8T A;  3CLQ A;  5CPR B;  1VQ5 I;  5J8F A;  3ZQF A;  5HLI A;  2WA0 A;  3BR0 A;  4GFB A;  3VSK A;  3BJO A;  3ASN H;  5EEA A;  3ZN1 A;  5CLS A;  1USS A;  4BE2 A;  2E1M B;  4RS8 A;  4L5J A;  1ETO A;  2P0W A;  3EQL F;  1YIJ I;  1GT0 C;  3CC7 I;  4IHS A;  2O9L A;  4B43 A;  6PAX A;  4OMZ A;  3A02 A;  3E5Q A;  2BEO A;  3FIW A;  2ISZ A;  3FXL A;  3LSH A;  4PFO A;  3HDD A;  1Y6I A;  2ELH A;  1WVR A;  2DFE A;  4OMY A;  2L7K A;  3OYG A;  1Z77 A;  1V54 H;  4YFN F;  3NWT A;  2OCC H;  3JRA A;  3KP6 A;  2ECB A;  2J5P A;  4CYD A;  2M8G X;  2DT5 A;  3UR3 C;  2ZXJ A;  2R7S A;  2A68 F;  5ERI A;  4LGW A;  2UUZ A;  4F3Q A;  2NYX A;  3I59 A;  2M1B A;  5D5X B;  4C2M J;  2VL8 A;  2CV0 A;  3LAP A;  2XAG A;  1ZGA A;  3G1O A;  3IH2 A;  3RDI A;  2V1D A;  1I3A A;  3LAJ A;  3DBR B;  2CV2 A;  3ABL H;  3RZO J;  4Y13 A;  1GLN A;  3LOC A;  4N4N B;  1ZAO A;  2RQP A;  3R61 A;  4RAF A;  2DJN A;  3S93 A;  2EIJ H;  2PMH A;  3TW6 A;  3REO A;  4ZYH A;  2E1M C;  1G3S A;  4L9T A;  3V7S A;  3ZQI A;  3HZJ A;  2CUE A;  1U9O A;  3BWG A;  5ILV A;  4IO9 F;  2DPD A;  2MG4 A;  1P4X A;  4E7Z A;  3H35 A;  4B4C A;  3ZN0 A;  4BBS J;  3TO7 A;  1IRF A;  2BXZ A;  5JHF A;  4I2O A;  2DO7 A;  2HOS A;  1UHS A;  2X85 A;  4ANJ A;  5LGN A;  1BR4 A;  4HX7 A;  2KIF A;  1JHF A;  2I8D A;  3PNY A;  1T6S A;  2B0L A;  3SFI A;  2R5Y A;  4BEH B;  2VBW A;  2HPI A;  3TOB A;  2D5V A;  4RMN A;  3V4G A;  1W7P D;  2MYS A;  3GTM J;  3AG4 H;  1OCP A;  5M5Y J;  3G3Z A;  3LL7 A;  1ZK8 A;  4A3M J;  2R7F A;  2LBF A;  1RES A;  2DA5 A;  1ETK A;  4C9Y A;  1Z3X A; 
#chains in the Genus database with same CATH homology
 1TLH B;  2FOK A;  1UB9 A;  4HF0 A;  2O6G E;  4UVC A;  1HW2 A;  1S7A A;  2XRO A;  2QM3 A;  4U88 A;  2OA4 A;  3T8T A;  1BIB A;  1W5T A;  4L5I A;  3KP4 A;  3O3K A;  3ZP5 A;  2YR2 A;  5EEH A;  5A2Q Z;  1LEB A;  2P5V A;  1IN4 A;  1R1T A;  2HGC A;  3K69 A;  1DUX C;  4Z2Y A;  1J0R A;  4KIG A;  3V8K A;  1SD7 A;  3D0S A;  2FRH A;  3WGH A;  1L0O C;  3MEX A;  2PJP A;  1FY7 A;  1I27 A;  4ENJ A;  2MBF A;  1IN6 A;  3PQK A;  4I09 A;  5L3B A;  1PUE E;  4L0Z B;  2ZO4 A;  1Z6R A;  2DTR A;  5J8C A;  4BHP A;  2RGV A;  2O03 A;  3JAM K;  3K1M A;  2XRN A;  1U5T B;  3HSR A;  2JSC A;  4S05 A;  4G7H F;  2O3F A;  2L3D A;  2QQB A;  4LLN A;  2P4W A;  5FB2 A;  1ZN2 A;  5LEJ A;  4OIP F;  3KLO A;  1FWZ A;  3B02 A;  1Z05 A;  5IT3 A;  1TQM A;  5D4R A;  4UUV A;  1O3T A;  1D3Y A;  5LHH A;  1FP1 D;  4FX4 A;  1ZG1 A;  4JBA A;  4PZJ A;  2W25 A;  3LWF A;  2QZ8 A;  4RAZ A;  1XSD A;  3V7C A;  2EWN A;  2R3S A;  2FBH A;  5CVV A;  2O61 A;  2MD5 A;  2D2W A;  1Z91 A;  3E6M A;  3LQR A;  2DQL A;  2Y48 A;  1DP7 P;  1S29 A;  1FSH A;  2PI0 A;  2MLK A;  5HVQ C;  1O7L A;  4LJZ F;  1IN8 A;  5DEQ A;  3H3U A;  1HW1 A;  1CGP A;  4EM1 A;  5DUK A;  2EV0 A;  5ICE A;  3U2R A;  1SMY F;  4UVA A;  3KZY A;  3ZMU A;  4EV0 A;  1YLF A;  2HWV A;  4ETS A;  1MGT A;  4MGR A;  1EV7 A;  3ZMZ A;  4EJW A;  1YG2 A;  2D1V A;  4A2U A;  3ZQ7 A;  1U3E M;  3ML6 A;  4QLC U;  1R36 A;  3E97 A;  4LG0 B;  1LDJ A;  4M72 A;  4RAY A;  2VE8 A;  4CZZ A;  2MH9 A;  2CO5 A;  3TDZ C;  2ZFW A;  4IRG A;  3F8N A;  2DAO A;  3PFI A;  4FT8 A;  1ZLK A;  5FO5 A;  4BAY A;  1H9G A;  2A69 F;  1KGS A;  1W4M A;  1T38 A;  3RTR A;  4RB1 A;  3GZ6 A;  5BPI A;  3M1E A;  2FXA A;  2UWM A;  4EVI A;  1LB2 A;  4UV8 A;  2GZW A;  2DW4 A;  1REP C;  1IRG A;  3WTS C;  3B73 A;  4Q47 A;  4LK1 F;  3TOA A;  3JSP A;  1OYW A;  1U5T A;  2M87 A;  2WWY A;  4HYE A;  4AD9 A;  3QOP A;  2CQK A;  4I01 A;  3MZH A;  2IW5 A;  4LLL A;  4YIF A;  1BC8 C;  1U78 A;  3RI4 A;  2ISY A;  3BJA A;  1P92 A;  3ABT A;  3P9K A;  5HS9 A;  2MLG A;  3T0Y A;  2ETH A;  2AS5 F;  4WK8 F;  4ZH4 F;  3HTU A;  1R5H A;  4WXC A;  2UZK A;  2PG4 A;  2NNN A;  3HHH A;  2EA2 A;  2H6B A;  5HDG A;  3CO7 C;  3WTU C;  1K78 B;  5DDG A;  2OZU A;  3MFK A;  3ZMT A;  4G8X A;  1OKR A;  5K1Y A;  3FM5 A;  4LB5 A;  3C18 A;  3BP8 A;  3VOE A;  1F4K A;  2IPQ X;  4CO8 A;  3LA7 A;  2DBB A;  1R7J A;  4YFK F;  4WCG A;  4KA4 A;  3E6C C;  4O5V A;  3J80 K;  1MJB A;  2JTV A;  1BJA A;  3WTT C;  5FD5 A;  5LHG A;  2IVM A;  2RC4 A;  3RPQ A;  4IHT A;  2V1U A;  3ISP A;  2QQA A;  2EFP A;  3T8R A;  2FBI A;  2BBY A;  2JPB A;  2Z5U A;  3TO6 A;  5ICC A;  2YSR A;  2XV4 S;  3R0J A;  4RGS A;  3J81 Z;  1FZP B;  2XAJ A;  1AWC A;  2HYF A;  1Z9C A;  1ON2 A;  2A07 F;  4KDP A;  1S6L A;  4BNC A;  3HIF A;  2DLL A;  5ILU A;  4LG0 A;  2CSO A;  3HOT A;  1XDU A;  3WU0 A;  3JAM Z;  5AIP A;  2XGX A;  4LD5 A;  5DCM A;  3K1N A;  3WGI A;  3AAF A;  4NB5 A;  3WE3 A;  2VXZ A;  1I6X A;  4EJU A;  3GF2 A;  4UNO A;  4KT5 C;  2V1X A;  2XAQ A;  4G6Q A;  2QBY B;  3BOQ A;  1EH6 A;  2KIU A;  1HKT A;  2KRF A;  3ULQ B;  2HOE A;  1D5V A;  1XSX A;  4GYG A;  1O3Q A;  2OZ6 A;  4EM0 B;  4JK1 X;  1O3R A;  4Y15 A;  1JHH A;  2CG4 A;  2HS5 A;  2VT3 A;  1O7F A;  1FC3 A;  3I53 A;  3SZT A;  2VC1 A;  2ADU A;  3M7G A;  1ZYR F;  1KU3 A;  3RKW A;  2DPU A;  2E7W A;  3E6D A;  5L3C A;  4EQQ A;  1ZRC A;  5D8K B;  2Q8K A;  2D1H A;  3LA2 A;  2G9W A;  3F8M A;  3FMR A;  2VOO A;  3NEU A;  3P7N A;  4UHT A;  1YW7 A;  1G3W A;  2DFI A;  1RI7 A;  2F5C A;  1K78 A;  3CUQ B;  1G3Y A;  3L00 A;  3PQJ A;  1J2X A;  3LST A;  3H92 A;  2QUF A;  1WQ2 A;  2RKH A;  2VE9 A;  4FX0 A;  5E17 F;  4JQF A;  2HFH A;  1HST A;  4P5O A;  3HYI A;  1ZHF A;  5BS6 A;  2BGC A;  5FFZ A;  2OU2 A;  1ULY A;  3SFZ A;  4Q48 A;  3F3X A;  1QPM A;  3FMQ A;  4GYI A;  4HV6 A;  2W24 A;  3Q9V A;  2P6S A;  5KK1 A;  1FX7 A;  3CUQ C;  1IZ1 A;  4U7B A;  2FML A;  4MQV A;  1XDS A;  2M30 A;  2CW0 F;  1ZRF A;  4M74 A;  2PLY A;  1JGS A;  1L3L A;  3JTH A;  2JT1 A;  5E18 F;  1MDM B;  1A04 A;  4P9F A;  2M8E A;  1S7O A;  3BRO A;  4M6Y A;  2XKO A;  3GWZ A;  4OU0 A;  2EV5 A;  2K02 A;  4HX4 A;  1R22 A;  1XD7 A;  4A6D A;  5FFX A;  3FXQ A;  1F5T A;  3NQO A;  2QBY A;  2ACJ A;  1FOK A;  3GXO A;  4ESJ A;  3T5X A;  1XCB A;  2K86 A;  4U0V A;  4P55 A;  2DI3 A;  3IWZ A;  2VN2 A;  4UXN A;  4EJV A;  2J5O A;  3WU1 B;  1TQI A;  5L3F A;  3IKT A;  1T39 A;  1BN5 A;  2ZKZ A;  3LA3 A;  4HV5 A;  3HOS A;  4H0E A;  2A5Y B;  1SAX A;  2CYY A;  1MD0 A;  1G6N A;  2PEX A;  3P9C A;  3WE2 A;  2FU4 A;  1BI2 A;  4HDV A;  5DUI A;  1D8J A;  4D0P A;  2XAF A;  1FYL A;  1LDK B;  1LNW A;  3FM3 A;  2TDX A;  5JFR A;  1P4W A;  2GXG A;  2VBZ A;  3J80 Z;  4ZZL A;  2XAS A;  2O8X A;  1FYM A;  5LLQ A;  4YII A;  5H6Q A;  1MKM A;  4Y17 A;  2HQR A;  4WF2 A;  4UV9 A;  5D8L B;  3COA C;  3CUQ A;  1SD5 A;  3J81 K;  2VOP A;  1I1S A;  4HZF A;  4CXF A;  2M5W A;  1EH7 A;  1U6G A;  1GXQ A;  5JVT A;  5KVR A;  2YPR A;  3CDH A;  1SFE A;  2EFO A;  4HX8 A;  2DK8 A;  2PN6 A;  3I5U A;  2NAZ A;  5HLG A;  3IRQ A;  2IJL A;  2XKP A;  1B9N A;  5ICF A;  4ZYD A;  1PDN C;  2HYG D;  3CO6 C;  1ZRD A;  3ZPL A;  1RZ4 A;  3WTW C;  3KP3 A;  3RPU A;  4KIC A;  4GCV A;  1LVA A;  2L4A A;  3GFL A;  1LQ1 A;  3GFI A;  4A0X A;  3MQ0 A;  3BZ6 A;  4KYW A;  2L02 A;  2PMU A;  3GLX A;  1MDM A;  4ZYG A;  2RNJ A;  3HRS A;  1U5T C;  1JXS A;  1YW8 A;  5DD4 A;  3R6S A;  1UST A;  4I98 B;  2BE5 F;  2EFN A;  3TGN A;  4MTE A;  2G7U A;  1BBY A;  4RGU A;  1LDD A;  3RYR A;  2XHK A;  5F6F A;  3EYY A;  1V3F A;  2K4J A;  1WRJ A;  1AOY A;  1FBS A;  5JI6 A;  3W6J B;  2V6C A;  4IPA A;  5D5W B;  3F21 A;  1SFX A;  2COM A;  1R00 A;  4HBL A;  3QU6 A;  1SFU A;  1RIO H;  2E1N A;  1T0F A;  4RGX A;  4HF2 A;  5FGM A;  3DFG A;  1F9N A;  1IAW A;  4WX9 A;  5IT9 Z;  1OPC A;  3W6K B;  2HKX A;  2QWW A;  4MEX F;  5F1R A;  4KMU X;  3M8E A;  4OIN F;  1O57 A;  4M9X A;  5CVJ A;  4KUM A;  1PP7 U;  1B1B A;  4M9S A;  1G4D A;  1GVJ A;  2O0Y A;  1YTY A;  1RUN A;  1XMK A;  2QQ9 A;  1FLI A;  4M6X A;  4L18 B;  1MJ9 A;  4DQ2 A;  4EGZ A;  2STW A;  4Q5S F;  2NNY A;  2VBY A;  2H09 A;  5CVR A;  4AWX B;  5L3E A;  4LLG F;  1FT9 A;  3K1P A;  1KYZ A;  5D4S A;  3BDD A;  3KP7 A;  1KU9 A;  3RKX A;  1IXC A;  3SXY A;  1SMT A;  2F2E A;  4RB0 A;  2AXL A;  4PGG A;  2KJC A;  4IVN A;  3T1B A;  5E1Z B;  2VOD A;  2ESN A;  4XSZ F;  5E20 A;  4EGY A;  1ZGJ A;  3DPT A;  1BI3 A;  3IKV A;  2LKP A;  3RIR A;  5HDN A;  3SHF A;  4N9I A;  1UHW A;  2E7X A;  3D5L A;  4KFC A;  2BV6 A;  2Q2E A;  3GW2 A;  1XB4 A;  4HDU A;  3QP5 A;  5DD8 A;  2EV6 A;  4HQM A;  3WOD F;  1SD6 A;  1KQ0 A;  3M9A A;  3R0A A;  5E8G A;  3HUG A;  1FP2 A;  1R58 A;  1P4A A;  2LF7 A;  1BI0 A;  1ZG5 A;  2HKO A;  3BJ6 A;  4AIJ A;  2GIV A;  2FEZ A;  1QZZ A;  2EJR A;  4N9H A;  2GA1 A;  4A6E A;  3FHZ A;  5FLX K;  4TV7 A;  5HS7 A;  1QNT A;  2V79 A;  4XLN F;  3IL2 A;  2NS0 A;  4I0B A;  1TNT A;  4R1H A;  4KMF A;  5LGT A;  3HRM A;  4OIQ F;  4N0B A;  1HSJ A;  3EDP A;  4BQA A;  1QQI A;  3E6B A;  1E17 A;  2Y0M A;  3F23 A;  4IXA A;  3HSF A;  3MCZ A;  1O3S A;  4CDG A;  4EJO A;  2YX7 A;  4IRI A;  2PBI A;  2P5K A;  5BQT A;  2FF4 A;  5LBQ A;  3C7J A;  3Q5F A;  4NQW A;  4P96 A;  5K5R A;  2Z33 A;  1DDN A;  2ZNZ A;  1F1Z A;  2GAU A;  4HF1 A;  1WWX A;  4PGH A;  2P5L C;  2RV8 A;  3QAH A;  5EEG A;  4G7Z F;  3DP7 A;  5K5O A;  5ICG A;  1ZRE A;  2FQ3 A;  3FF5 A;  3C1D A;  2JPC A;  1IN7 A;  2K4B A;  2OBP A;  1DPU A;  3O6B B;  1OR7 A;  3WTX C;  5AON A;  5D5U B;  4KIF A;  5H6R A;  3L7W A;  1I5Z A;  4PDK A;  4PCQ A;  3IRR A;  4IJA A;  3I4P A;  2YU3 A;  1CF7 B;  1W5S A;  1H9T A;  1UCR A;  5CVU A;  1IXS B;  1B59 A;  4IRH A;  4ESF A;  3RJP A;  3QPT A;  1Y0U A;  3FWE A;  2IA2 A;  3QPH A;  2H94 A;  1BIA A;  1QZY A;  2QLZ A;  5LRS A;  4ENN A;  2YX4 A;  2BYV E;  3KE2 A;  3RKY A;  2R7D A;  5IT9 K;  2LSO A;  3ZMD A;  1BM9 A;  3BPX A;  5JR3 A;  5HOO A;  1GXP A;  4UVB A;  5D6F A;  2W85 A;  1G3T A;  2CFX A;  1YO5 C;  4KN7 X;  1PP8 F;  3ZMV A;  3KET A;  2D45 A;  3DKW A;  3F6O A;  3DEU A;  3ROU A;  4CGZ A;  5ED4 A;  4LB6 B;  1QGP A;  3IWF A;  4L9N A;  2UXN A;  1V4R A;  2XAH A;  1TBX A;  1OYY A;  2CWE A;  3V8J A;  2LDU A;  1BOA A;  1HBX G;  4ZZD A;  2K7L A;  2HEO A;  3I54 A;  4HLX A;  2W84 A;  1T98 A;  3HSE A;  1DPR A;  1OYI A;  1H0M A;  2HTS A;  1TQP A;  1JE8 A;  5D6E A;  3EYI A;  1KU2 A;  2ZME B;  2IP2 A;  1Z1D A;  1FYK A;  1LEA A;  4A0Y A;  5L3G A;  2EA4 A;  1ONV A;  3HHG A;  1TW3 A;  1HQC A;  1SD4 A;  3LQQ A;  5L3D A;  4WXD A;  2RDP A;  3L2C A;  5E8I A;  1WKM A;  1NHA A;  4LK0 F;  1ON1 A;  2EFQ A;  4O3M A;  1YFH A;  3OOP A;  1S3J A;  4HQE A;  1W7P B;  3F8B A;  5E1X A;  2P7C B;  4BHC A;  1ZLJ A;  1VTN C;  5ILS A;  2ZNY A;  1ZH5 A;  1CF7 A;  4E70 A;  2K27 A;  1XSV A;  3O2P E;  2EB7 A;  2EK5 A;  5D5V B;  3I64 A;  3K0L A;  1T2K A;  3HRU A;  2W57 A;  2PFB A;  1YQA A;  5FLX Z;  5LRR A;  3KP2 A;  1IW7 F;  4DNC A;  1XCV A;  4A5M A;  3VOD A;  2FE3 A;  3DXJ F;  2F5D A;  2FNP A;  5BPD A;  1J59 A;  5DCF A;  1U8R A;  4RB3 C;  5HDK A;  3IHU A;  1MJA A;  5CVI A;  1YYV A;  2Z99 A;  5HS8 A;  2PQ8 A;  2HTJ A;  1R23 A;  2Z9O A;  4BYY A;  1OMI A;  2VT2 A;  3HRT A;  3G73 A;  4HLY A;  1R1U A;  2H27 A;  4ZYE A;  1E2X A;  3MWM A;  2WV0 A;  4MTD A;  1WI9 A;  4R8H A;  1IN5 A;  4ENM A;  3QU3 A;  2MH2 A;  5AIQ A;  3TDU C;  4LMY A;  1YW9 A;  1J75 A;  2ZJ2 A;  3BPV A;  2ESH A;  4L9J A;  3KP5 A;  3DV8 A;  1HW5 A;  3GO5 A;  1KA8 A;  1RNL A;  2IRF G;  3WTV C;  5LGU A;  4EJT A;  4G7O F;  1ODD A;  1KQ8 A;  1D8K A;  3RYP A;  4B8X A;  3HTS B;  2ZME A;  2X0L A;  4XLP F;  2IT0 A;  3FX3 A;  3ECO A;  5LHI A;  2CGP A;  1HKQ A;  4OIR F;  1J5Y A;  3L09 A;  1HKS A;  4B09 A;  2DU9 A;  2EFW A;  1XGN A;  4MHG A;  1B6A A;  4XBF A;  3M8F A;  1B9M A;  2P6T A;  4EM2 A;  4OIO F;  2DQR A;  2KIM A;  3WGG A;  3JW4 A;  2MA3 A;  2HQN A;  5TJJ A;  3E5X A;  1W7P A;  3FZV A;  4M71 A;  2KKO A;  3BY6 A;  1S8N A;  4CHU A;  4AIK A;  2WC2 A;  1K6O A;  3CUO A;  4A0Z A;  2GXB A;  2VBX A;  4G6D A;  4G9Y A;  2P7V B;  4GGG A;  2G7H A;  2A6H F;  5DYM A;  3NRV A;  3KEO A;  3P9I A;  3FXU A;  2OD5 A;  3JTG A;  2RN7 A;  2IA1 A;  3L9F A;  1J9I A;  2M45 A;  3F8F A;  3GEZ A;  2XVC A;  2DK5 A;  5BMZ A;  3WTY C;  4M9Z A;  4ON0 A;  1QO0 D;  2STT A;  2MC3 A;  4ENK A;  1UFM A;  1RUO A;  1P6R A;  4A5N A;  4IF4 A;  1C0W A;  3EET A;  3TO9 A;  4NHJ A;  2F5F A;  5LEK A;  1YS6 A;  4G94 A;  4A12 A;  3KCC A;  4U7D A;  5DCM B;  2L54 A;  2L01 A;  3CJN A;  1I1G A;  1KYW A;  4Q4Z F;  3I0T A;  4ESB A;  3JSO A;  1FBU A;  1R5G A;  1IXR C;  1ZG3 A;  3I71 A;  2KJB A;  2QVO A;  3GVA A;  3ECH A;  3V7R A;  2V9V A;  2Y75 A;  2GWR A;  2VON A;  1KU7 A;  3IC7 A;  3KLN A;  2H6C A;  4U0W A;  4MQ9 F;  1HXD A;  3ZMS A;  2C6Y A;  2RVC A;  4QWQ A;  4L9V A;  4CIC A;  5BOX A;  4I7H A;  3N4M A;  1TW2 A;  2QYO A;  4YFX F;  3EUH A;  4O6J A;  4XRF A;  1YS7 A;  4AIH A;  4ASN A;  1IF1 A;  2A61 A;  2IA0 A;  3S2W A;  1TNS A;  4RGR A;  1XN7 A;  4R79 A;  1BI1 A;  2VC0 A;  3ELK A;  4KN4 X;  3H3Z A;  1Q1H A;  2HR3 A;  1FBQ A;  2FSW A;  4LFU A;  2A3S A;  2HZT A;  4WXH A;  4P9U A;  3WTZ A;  3F72 A;  3DQV C;  3VFZ A;  2ZCW A;  3VEP A;  3KFW X;  1XMA A;  1XGM A;  2LNB A;  5DV5 A;  2UXX A;  5E1W A;  4FHT A;  2XUB A;  2FNA A;  3U1D A;  2F5E A;  2JRT A;  3MAJ A;  5HLH A;  1Z7U A;  2Z3Y A;  4WWC A;  3F6V A;  3OV8 A;  4BXU A;  3MZY A;  2XIG A;  1P2F A;  5A2Q K;  1FPQ A;  1UHM A;  3U9G A;  3GFJ A;  4MEY F;  2JZY A;  1XGO A;  3F22 A;  4F7Z A;  4EMS A;  4S04 A;  1B4A A;  3QRF F;  3TKY A;  5TRD A;  2FBK A;  2X4H A;  4KNY A;  2OQG A;  4HOB A;  2WTE A;  4RB2 C;  1ZAR A;  3GZ5 A;  5FD6 A;  1KQ9 A;  4BHB A;  1IUY A;  2LF8 A;  5CJ9 A;  1K7A A;  1U2W A;  3I58 A;  3J7A O;  1FSE A;  4XSX F;  3I59 B;  3E3V A;  5J6X A;  1Z6T A;  1YIO A;  1J7K A;  4AVP A;  3VB2 A;  3DPL C;  2A6E F;  2NRA C;  1WSU A;  3GX4 X;  4MNU A;  5F64 A;  3C3W A;  2QEN A;  4HW0 A;  4U0Y A;  1QBJ A;  4K2E A;  3FMS A;  5H20 A;  2GA2 A;  2OAZ A;  4HA8 A;  3K9T A;  3K2Z A;  3QP6 A;  2FA5 A;  5K5Q A;  1GHC A;  4GXO A;  5CYV A;  2HDC A;  3GFM A;  3CTA A;  4OOI A;  3WG9 A;  3Q9S A;  3KEQ A;  1XGS A;  4BH9 A;  3FXR A;  3DF8 A;  1STZ A;  3ABU A;  2ZBK A;  2FMY A;  4L0Y B;  3SQN A;  1FNN A;  2L4M A;  4HAM A;  1K79 A;  3GUD A;  3KZZ A;  3LFK A;  3V8L A;  4GO1 A;  1EH8 A;  3R4K A;  4YG2 F;  3N97 A;  1TTY A;  4I02 A;  3SZP A;  3R60 A;  1BC7 C;  2Q0O A;  3ERE D;  1X3U A;  2E1C A;  1LJ9 A;  2OQR A;  2GQQ A;  3F8C A;  4I0A A;  4KIB A;  3CLO A;  3E5U A;  1MZB A;  3TQN A;  5JHU A;  1R1V A;  4M73 A;  2P8T A;  5J8F A;  5HLI A;  3BJO A;  3ZN1 A;  5CLS A;  1USS A;  4RS8 A;  4L5J A;  3EQL F;  4IHS A;  6PAX A;  4OMZ A;  3E5Q A;  2BEO A;  2ISZ A;  2ELH A;  4OMY A;  4YFN F;  3KP6 A;  2J5P A;  4CYD A;  2DT5 A;  2ZXJ A;  2A68 F;  5ERI A;  4LGW A;  2NYX A;  3I59 A;  2M1B A;  5D5X B;  3LAP A;  2XAG A;  1ZGA A;  3RDI A;  2V1D A;  3LAJ A;  4Y13 A;  1ZAO A;  2RQP A;  3R61 A;  2PMH A;  3REO A;  4ZYH A;  1G3S A;  4L9T A;  3V7S A;  3BWG A;  5ILV A;  2DPD A;  1P4X A;  3ZN0 A;  3TO7 A;  1IRF A;  4I2O A;  2DO7 A;  5LGN A;  4HX7 A;  2KIF A;  1JHF A;  1T6S A;  2B0L A;  2VBW A;  3TOB A;  3V4G A;  1W7P D;  3G3Z A;  2R7F A;  3GYH X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...