2KIFA

Solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O6-methylguanine-DNA methyltransferase
publication title Structural basis of O6-alkylguanine recognition by a bacterial alkyltransferase-like DNA repair protein.
pubmed doi rcsb
source organism Vibrio parahaemolyticus aq3810
total genus 29
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kifA00
5K5OA 4Q47A 1QGPA 1ZN2A 1YTYA 2AXLA 4UXNA 3DKWA 1TW2A 1BI0A 3JTGA 3REOA 4PZJA 2K86A 4EGZA 3R61A 3R60A 2O0YA 4UVBA 2RQPA 2GIVA 1IXSB 4DQ2A 3I71A 5HVQC 5FFZA 3LA3A 3GO5A 2KIFA 4WX9A 1H9GA 2HDCA 5IT9Z 2WV0A 2LNBA 2FMLA 4UV8A 2CG4A 5L3EA 3K1NA 3KP2A 4A0ZA 1R00A 1MZBA 4IHTA 2F5EA 2P7VB 4AIHA 3RPUA 1B1BA 2HR3A 5D5VB 4TV7A 1R58A 2A61A 1HQCA 4UVAA 1KYZA 3VODA 2ZBKA 3F72A 1JHHA 4A2UA 1AOYA 3TO7A 1QZYA 1KU3A 1CF7A 2FXAA 3WE2A 2CO5A 2OZ6A 1OYWA 2D1HA 2HWVA 1L0OC 4OMYA 2M1BA 3V7CA 2UZKA 2ZMEB 1KQ0A 1Z9CA 2P8TA 1O57A 2RGVA 1RUOA 1O3SA 3CUOA 4R1HA 4QLCU 1EH6A 1MGTA 3ZMVA 3SZTA 3TKYA 1WRJA 5LBQA 2EWNA 3N4MA 4MEXF 4G7ZF 1DP7P 3E6CC 1R1UA 4L9VA 1PP8F 5D8KB 2OBPA 1T2KA 1IXCA 2XV4S 1PUEE 3EETA 2PMHA 3ZMTA 2YSRA 3I64A 1ZRDA 1USSA 2W84A 4YFXF 2CGPA 4A0YA 5KVRA 2R3SA 5IT3A 2K27A 1FYKA 1ZRFA 5AIQA 4S05A 2QBYA 2PQ8A 3LAJA 2JT1A 5E1ZB 3VEPA 1TTYA 2IA0A 2UWMA 4RGXA 2D1VA 3BJOA 1BI3A 1XSDA 1WI9A 1B9NA 1YFHA 3FZVA 4I09A 4UVCA 4LD5A 2DT5A 3L09A 4IRIA 1IN5A 2EV6A 5K1YA 1BBYA 5E1WA 5K5RA 1JE8A 4KFCA 1XB4A 3O2PE 1G3WA 1ZGAA 2RNJA 4ENNA 2HYFA 2GA1A 3LA7A 3EYYA 5JR3A 3HRSA 5JVTA 2P5LC 1WSUA 4KICA 3MCZA 2HKOA 5D4RA 1KGSA 4Y13A 1FSEA 2O03A 3GFMA 3GF2A 3HIFA 3KP6A 3N97A 4I0BA 2MC3A 4LG0A 3PFIA 3VFZA 3RYRA 4ENJA 2HFHA 3F6OA 4KIBA 4RB0A 4GXOA 3WODF 5CYVA 1BI2A 5H6QA 2HGCA 1RZ4A 1XCVA 2JTVA 3E5QA 3RKYA 4ZZDA 2H94A 2ELHA 1Z91A 3HTUA 1WKMA 1JHFA 4HF1A 4BHCA 4BYYA 3L9FA 2O6GE 4CGZA 2W24A 1SMYF 5J8FA 1O3QA 3FM5A 2GXGA 2ZJ2A 3GEZA 1A04A 5D5WB 1LB2A 1F1ZA 3GXOA 4FX4A 2VT2A 3RJPA 2NNYA 2K4BA 3LA2A 3G73A 1HSTA 2PLYA 1STZA 4ENKA 2FSWA 4CHUA 2XAJA 2PBIA 2EK5A 1IRGA 4EGYA 3ECHA 3KZYA 3EDPA 3ULQB 1F9NA 4ESBA 2E1NA 2CWEA 1YYVA 2EA4A 4HZFA 1T6SA 2Z3YA 4BXUA 3HRUA 3Q9VA 1DPRA 5AIPA 2GAUA 3ISPA 2Q0OA 4EM0B 3J80K 3T8RA 1HKTA 5E17F 4HV5A 2P6TA 2FQ3A 4U7DA 4HX8A 4S04A 1GVJA 4MHGA 1JXSA 2L4MA 4CDGA 4M9ZA 3F8CA 1LVAA 4F7ZA 2Z9OA 2YU3A 5LRRA 3E97A 4KNYA 1HXDA 4Y17A 2ZCWA 1D8KA 1I6XA 4O6JA 2YR2A 2ZFWA 3BDDA 5H6RA 3MAJA 1USTA 4PGGA 3C1DA 3JSOA 1W7PA 2A69F 3GX4X 1V4RA 3E6BA 3TOAA 4IRGA 5E18F 4U0YA 2FBKA 4JQFA 5FGMA 3B73A 5TRDA 4JBAA 5JFRA 4B09A 2WTEA 2QUFA 1F4KA 3HSEA 5E20A 2YX7A 3DF8A 1SFUA 4OOIA 3T8TA 1MDMB 3CTAA 2COMA 1G3YA 2A68F 2EB7A 2M30A 2K4JA 2G7UA 1P4XA 1ZREA 2JRTA 2ADUA 2PFBA 2ACJA 3T1BA 4EQQA 2A3SA 4OIOF 1QO0D 2M87A 4KN4X 4YFKF 3ZN1A 4I01A 3FF5A 2HQNA 4ZYGA 3C18A 4OIQF 4EM2A 3M8FA 2HTSA 3IWFA 1FBSA 3VB2A 2W85A 3V8LA 3CO6C 4XSZF 2DK5A 2ESHA 4XBFA 1MDMA 3Q5FA 3K69A 2Y48A 2FBIA 2HOEA 4HA8A 5LGNA 3BY6A 6PAXA 2FEZA 1FBQA 1I5ZA 3KP7A 4KA4A 3I5UA 2O8XA 5BPDA 1SD5A 2Z33A 4RGSA 4KMUX 1FBUA 1YS6A 1BJAA 2QVOA 1ONVA 1SD7A 1B9MA 2L54A 1IZ1A 1I1GA 3T0YA 4IJAA 2VOPA 2A5YB 1OYYA 2R7DA 3I4PA 4EJUA 4EMSA 3B02A 3NQOA 1K6OA 2FE3A 1XCBA 2FMYA 3SFZA 2X0LA 4U0WA 4HQMA 3GFJA 3HTSB 1ZG3A 2DW4A 2P4WA 4MEYF 4HW0A 4RB3C 1MJAA 4M74A 1ODDA 3P9CA 2CSOA 5LHGA 2IA2A 4LFUA 3K9TA 1U5TC 4PCQA 4OIPF 3BOQA 4M71A 3LQQA 4G94A 2UXNA 4MQ9F 3F21A 5DUIA 4CZZA 2IP2A 2VN2A 2LKPA 4IRHA 5TJJA 3WTSC 1R1TA 4UV9A 4YFNF 1OPCA 4G8XA 1FP1D 5L3DA 4Q48A 1NHAA 2NAZA 3TDZC 4CYDA 4ZH4F 4NHJA 2YX4A 4EJTA 2PJPA 2EJRA 3KP4A 1R5HA 3H3UA 1G3TA 4N0BA 1KU9A 1ZARA 3QP6A 3M7GA 3L7WA 5E8IA 5F6FA 4HQEA 1CF7B 3TGNA 3U2RA 5EEGA 4M73A 3QRFF 3JAMK 1TQMA 2OZUA 1UHWA 5LGTA 1CGPA 5D6EA 2BYVE 5FD6A 1XSXA 2G7HA 2VC1A 2KIMA 4MNUA 1KYWA 2KJBA 3R0AA 4GGGA 5A2QZ 1ZG5A 5D5XB 3I0TA 4LB6B 4A12A 4L5IA 1K7AA 3KLOA 2GXBA 5HS7A 1DUXC 1S8NA 3GWZA 1YLFA 1UHMA 1I27A 5DCFA 2IW5A 2Z99A 1FP2A 5CLSA 5CJ9A 1MJBA 4G6DA 3DXJF 3HOTA 3H3ZA 2NS0A 5E1XA 5FLXK 3IWZA 4KIFA 3WE3A 3KLNA 1GHCA 1DDNA 5LHHA 2GWRA 2QBYB 3J81Z 4FX0A 3J7AO 4M6XA 3IRQA 3EYIA 2A07F 3HOSA 4U7BA 1IAWA 3I59A 3SHFA 5D6FA 1LJ9A 1WQ2A 3HSRA 4KIGA 5DDGA 2XASA 2Q2EA 3OV8A 2DQLA 1KU7A 1G4DA 3HSFA 4PGHA 3TQNA 2WWYA 1MKMA 2F5DA 1FNNA 2BEOA 1HSJA 2WC2A 4QWQA 2ZO4A 1LDJA 3FMQA 4CICA 5LGUA 5L3BA 2R7FA 3VOEA 1U78A 5DUKA 3EQLF 1SAXA 1O7LA 5KK1A 2L3DA 2XUBA 4B8XA 4XSXF 3CUQA 1O7FA 3F8FA 1Z1DA 3D5LA 3SZPA 4HX4A 1HKSA 5ICGA 3FMRA 2E1CA 4LG0B 4P9UA 4Q5SF 2HKXA 1GXPA 2HZTA 2P5VA 2FF4A 1Z6TA 4I0AA 2Z5UA 4BHBA 3ABUA 1KA8A 2MA3A 3WTYC 1YG2A 4JK1X 1U8RA 2HS5A 5FFXA 1D8JA 4AWXB 1YO5C 1ULYA 3DFGA 1V3FA 5CVVA 3BPXA 3J80Z 1ON1A 2KJCA 5A2QK 2D2WA 4WWCA 3CDHA 4BQAA 3DV8A 1XMAA 3ML6A 4HX7A 1TQPA 3E6DA 1FT9A 2GQQA 3GFIA 3RKWA 2JSCA 1GXQA 2A6EF 4HDVA 2IRFG 3ZMUA 3RPQA 2C6YA 2DI3A 3BJAA 2OQRA 2JPBA 3DPTA 2H09A 2E7WA 3QU6A 4HDUA 3J81K 3I53A 3ZP5A 3JTHA 3HHGA 2ZXJA 5DCMA 1ZLKA 4WXHA 3H92A 1IUYA 1G3SA 4BNCA 1SD4A 1ZYRF 1J5YA 2TDXA 4AD9A 1IN4A 1XDSA 2EA2A 1BC8C 3F8BA 1P92A 3DP7A 4YG2F 5ILVA 2DAOA 5ILSA 2M45A 3R6SA 2ZNYA 1Y0UA 5LEKA 2STWA 2H6BA 5BMZA 2BBYA 3GUDA 3KP3A 2XGXA 4I7HA 2XRNA 3TDUC 2JZYA 2VXZA 1J75A 2MBFA 2RC4A 2M5WA 2LF8A 1HKQA 1P4AA 4D0PA 2FNAA 2DBBA 2DK8A 1S3JA 4RAYA 1IF1A 1H9TA 3IHUA 2XKOA 4IPAA 2PN6A 3F8NA 5HOOA 1FSHA 4E70A 1ZLJA 2LSOA 1T38A 2FA5A 3P7NA 1T39A 1W7PB 4G7OF 1I1SA 2V6CA 5HDNA 3TO9A 5ED4A 2QLZA 3WU0A 1U5TA 3AAFA 4P5OA 4MTEA 3ERED 2W25A 4N9HA 1D3YA 4L9TA 4UUVA 3QPHA 2VT3A 2EV5A 2FBHA 3WTWC 3CUQC 4I02A 1F5TA 1EH8A 4I2OA 3WTXC 4OMZA 2RVCA 3ZMZA 1XGMA 3EUHA 3LSTA 2VC0A 2G9WA 1XD7A 4OIRF 1HW5A 2YPRA 2MD5A 2QQ9A 2ESNA 4EV0A 4LK1F 3IC7A 3ZQ7A 3FXRA 1KQ8A 1IW7F 2HEOA 2STTA 2K7LA 1ZRCA 3WU1B 3FXUA 4LB5A 1IRFA 3ZN0A 4CXFA 3SQNA 1XGSA 2J5PA 3W6JB 5BPIA 4L5JA 4LMYA 1B6AA 3RTRA 2DTRA 1FLIA 2O3FA 3ZPLA 3K1MA 2NYXA 3MEXA 3BROA 3ROUA 1YW7A 2XKPA 2HYGD 5L3GA 2VOOA 5E8GA 2MH9A 4BH9A 2XHKA 4XRFA 2BV6A 3LFKA 1RIOH 2EFOA 4KMFA 2V1UA 3W6KB 4GYGA 3P9KA 4H0EA 4Y15A 2P7CB 3KE2A 3NRVA 1W4MA 3GW2A 4GO1A 4G7HF 3JAMZ 3PQKA 5EEHA 2H27A 4AIKA 2B0LA 2V79A 4L0ZB 4ZZLA 3QPTA 1R1VA 4O3MA 1K78A 3E5XA 1FY7A 1FX7A 5HDKA 1ZH5A 2PEXA 1ZAOA 3O3KA 2PMUA 4IXAA 1HW1A 4LLGF 3G3ZA 5FO5A 3BP8A 2CFXA 3KEQA 1LEBA 2E7XA 3M9AA 4KYWA 5FLXZ 3C7JA 5D8LB 1JGSA 5FB2A 3MZYA 1OYIA 1BIAA 2W57A 2L4AA 3U9GA 2OD5A 3HUGA 1R5GA 3F23A 1B59A 4ZYDA 3M8EA 1Z6RA 1LQ1A 2VODA 5D5UB 3V8KA 1SFXA 1ON2A 2J5OA 3Q9SA 1Z7UA 2GZWA 3IKTA 2P5KA 1P4WA 5CVJA 5ICEA 4P9FA 2FU4A 1OR7A 4EJWA 2QM3A 1BI1A 3RKXA 1W5TA 3P9IA 4HYEA 2F5CA 1QZZA 3FHZA 4HF2A 3O6BB 4HOBA 2IA1A 1SFEA 2KKOA 3FXQA 1U6GA 2A6HF 3V7SA 3K2ZA 4M9SA 3T5XA 2DPUA 3ZMDA 1QPMA 2QWWA 1QNTA 2HTJA 4HLXA 4GYIA 5AONA 1R36A 3LAPA 1LDDA 3I59B 3WTVC 2NRAC 1HW2A 4A6EA 1YS7A 4AIJA 4IF4A 1B4AA 2LF7A 3HYIA 2CQKA 3HHHA 1YQAA 1J2XA 1X3UA 1XMKA 3GFLA 2ZNZA 3WGIA 4EJOA 5ERIA 2VBZA 4LLLA 1QQIA 2XIGA 2XAGA 1Z05A 1G6NA 3WGGA 4EM1A 5ICFA 1REPC 3QOPA 4R8HA 3V7RA 5LRSA 2CW0F 1XGNA 3CUQB 1RUNA 2V1XA 2DU9A 3QAHA 5DV5A 2OQGA 1U3EM 1LNWA 4A5NA 1TBXA 1PP7U 3TO6A 3FWEA 3GYHX 3QP5A 1R7JA 2M8EA 5DD4A 1XDUA 2VBYA 3E6MA 2IJLA 1TQIA 4R79A 1HBXG 2FRHA 2MLGA 4CO8A 1WWXA 2Y0MA 5BOXA 5LLQA 1UFMA 4Q4ZF 3FM3A 1IN6A 5HLGA 2ZMEA 2LDUA 4P55A 2Q8KA 1IN8A 3CLOA 3OOPA 3GZ6A 5LHIA 5L3CA 1FOKA 3M1EA 1VTNC 3ELKA 4HAMA 1IXRC 4XLPF 5D4SA 2DQRA 3MZHA 3C3WA 5IT9K 3L00A 2ETHA 3RYPA 2L02A 1TW3A 1R22A 5ICCA 1TNTA 1IN7A 2QQBA 5DCMB 4IVNA 3MWMA 3RI4A 4RS8A 2OAZA 5DYMA 4NB5A 4L9JA 3S2WA 4GCVA 2L01A 3NEUA 1DPUA 4A6DA 5CVRA 2PI0A 4RGUA 1UB9A 1W5SA 3F22A 2NNNA 5F64A 1J9IA 2K02A 4KT5C 1W7PD 4WXCA 5HLIA 1SMTA 1J7KA 3KZZA 1S29A 3ZMSA 1U2WA 4M72A 4L9NA 5JI6A 4EJVA 3KP5A 4BAYA 1BM9A 4P96A 1FYLA 3FX3A 5J8CA 1EV7A 1ZHFA 4A5MA 2XAHA 4XLNF 3WTZA 3F3XA 4WF2A 5HS9A 2CYYA 4RGRA 2IVMA 1OMIA 1P2FA 4FHTA 4KUMA 3JSPA 4N9IA 4ESFA 4OU0A 1Q1HA 4ON0A 5CVIA 1E17A 1YIOA 4ENMA 1FPQA 2Y75A 1U5TB 1QBJA 4I98B 3WTTC 2GA2A 3WGHA 4MTDA 3KETA 3E5UA 4WCGA 4ZYEA 3PQJA 1YW9A 4O5VA 1O3RA 2VBXA 2DLLA 5K5QA 5HDGA 3BJ6A 4U88A 3IRRA 2X4HA 1TNSA 2EV0A 3RIRA 2JPCA 5CVUA 4UHTA 2XROA 1EH7A 4YIIA 4G9YA 5ILUA 1BIBA 2ISZA 5H20A 2RN7A 1BOAA 2IPQX 3HRTA 1J59A 1LEAA 4LLNA 1ZGJA 1ZG1A 2OA4A 2RKHA 2OU2A 4RB1A 5HLHA 1R23A 3BZ6A 5LEJA 5DEQA 3D0SA 3I58A 3LQRA 3QU3A 2V9VA 3WTUC 2F5FA 3MQ0A 3CJNA 4L18B 1T98A 1KU2A 5JHUA 2EFPA 2EFNA 4LK0F 4A0XA 2BE5F 3L2CA 2MH2A 2QENA 3GZ5A 3E3VA 3I54A 2VONA 4HF0A 4MGRA 2BGCA 3K1PA 3K0LA 5F1RA 3KEOA 1PDNC 1UCRA 3R4KA 2QQAA 1S6LA 2HQRA 4Z2YA 3MFKA 4EVIA 3GLXA 1FYMA 5DD8A 1KQ9A 2O61A 4RAZA 2ZKZA 5J6XA 4HV6A 1C0WA 3CO7C 1FWZA 2H6CA 5FD5A 1SD6A 3RDIA 1BN5A 4ZYHA 3V4GA 3JW4A 2FOKA 3SXYA 2KIUA 3R0JA 3BWGA 5HS8A 2XAFA 3WG9A 1T0FA 3ABTA 1BC7C 3DEUA 1S7AA 1XN7A 2MLKA 4WXDA 4BHPA 1XSVA 1K78B 4WK8F 2EFQA 1RI7A 3FMSA 1MD0A 2AS5F 1K79A 2DO7A 2QYOA 1E2XA 2ISYA 2UXXA 4K2EA 4HBLA 2V1DA 1J0RA 4L0YB 4FT8A 4ASNA 2F2EA 3TOBA 4NQWA 1FC3A 3KCCA 1MJ9A 5L3FA 2D45A 4LGWA 2FNPA 4DNCA 4M6YA 3F8MA 1L3LA 3LWFA 2XVCA 3GVAA 2VE9A 4ESJA 1LDKB 3U1DA 2IT0A 1D5VA 3DQVC 1YW8A 2EFWA 2DFIA 1S7OA 4ETSA 5BS6A 3DPLC 2PG4A 4IHSA 3HRMA 1OKRA 4YIFA 1FZPB 2VBWA 4OINF 3KFWX 3BPVA 1O3TA 2DPDA 4RB2C 4U0VA 2KRFA 4LJZF 2VE8A 2RV8A 4KN7X 3COAC 4G6QA 4KDPA 2P6SA 4PDKA 4HLYA 3IL2A 3ECOA 1AWCA 1RNLA 2XAQA 3IKVA 1TLHB 4UNOA 4AVPA 1XGOA 5BQTA 2QZ8A 3F6VA 2RDPA 3V8JA 1H0MA 1P6RA 4MQVA 4M9XA
chains in the Genus database with same CATH superfamily
5K5OA 2E2HJ 4Q47A 4QTRA 1QGPA 1SAUA 1ZN2A 2BHZA 2AXLA 3H36A 1YTYA 4UXNA 3DKWA 1S7EA 1TW2A 4M3DA 1BI0A 2HQ5A 3JTGA 3REOA 2QGUA 4PZJA 1J09A 2K40A 3PIOF 4N4OB 2K86A 5E3LA 4EGZA 2XF6A 3H9QA 3R61A 3R60A 2O0YA 1AU7A 3OYFA 4UVBA 2OJED 2GIVA 2RQPA 1IXSB 2R7QA 4DQ2A 3I71A 3S32A 3K4LA 4BBRJ 5HVQC 1MMNA 5FFZA 1ZK8A 3K6GA 1QU3A 3LA3A 3CDLA 1NG7A 3GO5A 2KIFA 4WX9A 4BACA 1H9GA 1RETA 3ZCOA 2HDCA 4CCKA 2X6YA 2TCTA 2QF7A 2VUMJ 5IT9Z 2WV0A 3DKYA 2LNBA 3FKJA 2D5VA 3S15J 2FMLA 5FRNA 3OS0A 3AL0C 4UV8A 2CG4A 5L3EA 3K1NA 2V6EA 1T0FC 3KP2A 4A0ZA 1R00A 4MFEA 1MZBA 3LL7A 5M5YJ 5JHFA 4HPQA 1YI2I 1R4NB 2WBMA 3BCBA 4E7ZA 1U8BA 2JRMA 1VQMI 3IUOA 4IHTA 3CP2A 1LVKA 2F5EA 2WAFA 2P7VB 4AIHA 4DYCA 2DA4A 3RPUA 4DYRA 1B1BA 2HR3A 5D5VB 4TV7A 1R58A 2PJRA 2A61A 5E79C 2BW3B 1HQCA 4UVAA 1KYZA 3VODA 3OYHA 4A3IJ 2ZBKA 3F72A 1JHHA 4A2UA 1AOYA 3HG9A 3TO7A 1QZYA 1KU3A 1CF7A 4XORA 2FXAA 3FIWA 3WE2A 2DA5A 2CO5A 2HZDA 2OZ6A 1OYWA 2D1HA 2V4JC 2HWVA 3ZR8X 1L0OC 1YIJI 1F43A 3I55I 2HVQA 2ECBA 4B4CA 5FROA 2R0QC 2R7VA 4HSRA 4OMYA 2M1BA 3V7CA 2UZKA 2NS7A 4IOCF 2ZMEB 1N78A 1KQ0A 1Z9CA 3QWLA 4FETA 2P8TA 1O57A 5IYDJ 2RGVA 1RUOA 4RM2A 1O3SA 3PFYA 4CCNA 3CUOA 4R1HA 4QLCU 3S3OA 1HLVA 4BY1J 3G1MA 5EGOA 1T08B 1EH6A 1MGTA 2QA4I 3ZMVA 3HM5A 2RNGA 3SZTA 2CUZA 2N8GA 3CJRB 3TKYA 1WJBA 1WRJA 5LBQA 1MNDA 4M6VA 2EWNA 3N4MA 2CW7A 3K4NA 1EJ9A 2B63J 4MEXF 4G7ZF 1DP7P 3E6CC 1R1UA 2HOAA 2X9DA 4L9VA 1PP8F 5D8KB 2Y69H 2OBPA 3C2BA 4I99C 1T2KA 1QZEA 1IXCA 2XV4S 1PUEE 3EETA 3KZIC 4NC7A 1MMAA 2DODA 3MD2A 2PMHA 3ZMTA 3GTOJ 4ZJZA 2YSRA 2HYJA 3I64A 1ZRDA 1USSA 2LBFA 2W84A 3PSIA 3RCOA 4YFXF 2FD5A 4A0YA 2CGPA 3PM1A 5KVRA 2R3SA 4IQJA 5IT3A 2LD5A 2K27A 1WJCA 4XN3A 1FYKA 2M4GA 5EG0B 1ZRFA 3LSGA 3OSGA 4ZDOA 3DBRB 5AIQA 2ZC2A 4S05A 1TWAJ 4S0HB 2NVQJ 2QBYA 2PQ8A 3AKZA 3I9V2 3LAJA 2JT1A 5E1ZB 3LSPA 3VEPA 3H0DA 4B48A 2JSPA 1TTYA 2IA0A 2UWMA 4IL6C 2VI6A 4RGXA 2D1VA 2YUSA 3BJOA 1BI3A 1XSDA 1WI9A 1B9NA 1YFHA 3DBLB 3FZVA 2H8RA 4XN0A 4I09A 4UVCA 3L2UA 2K9MA 2JA6J 1KZHA 4LD5A 2DT5A 3L09A 4IRIA 1IN5A 2HPIA 4CA0A 3BZCA 2EV6A 3LSHA 2JA8J 4XLAA 5K1YA 3UKGA 1BBYA 5E1WA 5K5RA 4A3FJ 3G1LA 4ABZA 1JE8A 1OCTC 4KFCA 1XB4A 1E3PA 3RZOJ 3O2PE 2BY0A 1SC7A 2VQGA 1G3WA 4YEJA 2W82A 3L2RA 1ZGAA 2RNJA 2M8GX 4CSWA 4ENNA 3LSIA 1YJWI 2HYFA 4F3QA 2M7BA 2GA1A 3LA7A 2KDOA 3EYYA 3ZQFA 5JR3A 3HRSA 5JVTA 2P5LC 3SEQA 4RA2A 1VNDA 2R5ZA 1SFOJ 4E4HA 1WSUA 3PJRA 2CS3A 1QVUA 4KICA 3BTLA 4CCMA 3MCZA 1IRZA 2HKOA 5J1YA 5D4RA 1W5CC 1KGSA 4Y13A 2LY2A 1Y56A 1FSEA 3A03A 2O03A 3GFMA 3GF2A 3HIFA 3S2DJ 2EBIA 3KP6A 3N97A 3K4JA 2GBYA 4I0BA 2EIJH 2CW8A 2LP0A 2CU7A 2MC3A 4LG0A 3PFIA 3VFZA 3KIOA 4N4NB 4UUSA 2Y2ZA 3RYRA 3S1NJ 3C2GA 3LOCA 5J3LA 4ENJA 2HFHA 3F6OA 2JVHA 4KIBA 2K9LA 1MW7A 4C3JJ 3QYEA 5KNLA 3M4OJ 4RB0A 4GXOA 1YRNA 1V5FA 2KIQA 3WODF 2EZIA 5CYVA 3HOVJ 1WJDA 1BI2A 2QSFX 3BR1A 5H6QA 2HGCA 1RZ4A 1XCVA 2JTVA 3BTIA 3E5QA 2HDWA 5B3SH 2K85A 1DGWY 4BDZA 3RKYA 1K61A 4ZZDA 2H94A 5B5EC 2L7ZA 2ELHA 1Z0XA 5IP7J 3S2HJ 4B47A 2WADA 2O5RA 4A69C 1Z91A 3HTUA 1WKMA 4CCJA 2LY9A 3HOYJ 1JHFA 2EZKA 4HF1A 4CYCA 3SEZA 4BHCA 3ZQIA 1BR1A 3FKIJ 3L9FA 4BYYA 3GZNB 3HKZA 2O6GE 2W24A 4CGZA 1GV5A 1SMYF 3KPHA 5J8FA 3S3MA 3H35A 1O3QA 3FM5A 2GXGA 3MN2A 2ZJ2A 2EH3A 3KEYA 1UG0A 4W1UA 2IS6A 3CCVI 3GEZA 1A04A 5D5WB 1LB2A 1F1ZA 4PSWA 1WH5A 3GXOA 2OCCH 1H89C 4BQNA 3F0CA 5J1UA 1FOYA 2DMQA 3WHBA 4FX4A 2VT2A 3RJPA 3FBNB 3GMEA 2NNYA 5IYCJ 4ANJA 2K4BA 3LA2A 3W2VA 4BQOA 3IAM2 2LG4A 1GT0C 3SFIA 3VYRB 3G73A 2EZLA 2DOEA 1HSTA 3K4KA 2PLYA 1STZA 4HNVA 2FSWA 4ENKA 4CHUA 1P7JA 2XAJA 2PBIA 2EK5A 5GADJ 1IRGA 4EGYA 3ECHA 3S8PA 2XSJC 4HNTA 3KZYA 2ZSIB 3EDPA 2OCEA 3ULQB 4ZC3A 1F9NA 4ESBA 2E1NA 3MMYB 4PUSA 4PJ0C 4DOZA 3DTIA 2CWEA 1YYVA 2EA4A 4HZFA 1T6SA 2Z3YA 1JT0A 4BXUA 3ERMA 3HRUA 3Q9VA 2DMUA 1DPRA 1MBFA 5AIPA 2GAUA 3ISPA 2Q0OA 2VASA 4CH7A 1RPWA 4EM0B 2A6TA 4BE1A 2JA7J 4ZYAA 3J80K 3T8RA 2Z16A 2GM4A 5H2FC 5E17F 1WPKA 1HKTA 5DM6F 2XSDC 5B1AH 4HV5A 2P6TA 2FQ3A 4U7DA 4HX8A 2LTPA 4S04A 1GVJA 4MHGA 1IG7A 3SJMA 1JXSA 2V9KA 2L4MA 5F27A 4CDGA 1BL0A 4M9ZA 4MLOA 4RDUA 3SZGA 3GLLA 2AQEA 2O9LA 2G0EA 3F8CA 1LVAA 3S1RJ 4F7ZA 2Z9OA 4CCLA 5FLVA 3AL0B 5J4VA 2YU3A 3J7ZI 5LRRA 3E97A 4EATA 2VKVA 2EQRA 1TT0A 4P1WA 2GLOA 5B66C 4KNYA 1Z3YA 1HXDA 3NWTA 4Y17A 2ZCWA 2IGOA 1D8KA 2Y0SA 1I6XA 4O6JA 2YR2A 3BDDA 2ZFWA 5H6RA 3MAJA 1I3QJ 2HVSA 2ZJQF 1USTA 4PGGA 3OYBA 3C1DA 3JSOA 3S1QJ 1W7PA 2A69F 3FXOA 4XLEA 1D1AA 1V4RA 3E6BA 4BJ5C 3GX4X 3TOAA 1DU0A 3QYBA 3GTQJ 1TT5B 1YX3A 1LUJB 4IRGA 2V26A 5E18F 4U0YA 3RKQA 2NVXJ 4X1EA 2FBKA 3BR0A 2VQCA 1PVEA 4JQFA 2E60A 5FGMA 4NUBA 3B73A 1JTXA 4YRVA 2TRTA 5TRDA 1OFCX 4JBAA 1TL8A 5JFRA 1SVOA 2Y30A 4B09A 2WTEA 4XLCA 2QUFA 4B44A 2Y9YA 3BG9A 5CKTA 1F4KA 4XLHA 3HSEA 3OYLA 5E20A 2YX7A 1E0EA 4NQWB 2DMNA 3DF8A 2H8WA 1OCZH 1SFUA 4OOIA 3T8TA 1JKPC 2VIXA 2FX0A 1MDMB 3CTAA 2COMA 3BT9A 1HA8A 1G3YA 2A68F 2MABA 1OCRH 2EB7A 2M30A 3ZGKA 2K4JA 2G7UA 2L0KA 4A3MJ 2BY1A 1P4XA 1ZREA 2JRTA 2ADUA 2PFBA 2ACJA 1V5GA 2XB5A 2R7SA 5GAEJ 2LREA 1GLNA 3T1BA 5J47A 4UUTA 3TBIA 4D7MA 4EQQA 2H1LA 2A3SA 4OIOF 2KLOA 4BE2A 3ASNH 4AVZA 4II2A 1QO0D 2M87A 4KN4X 4YFKF 3ZN1A 4OAZA 4IKFA 2MD0A 3BR6A 3GTKJ 4KITB 4I01A 3CCUI 3FF5A 2HQNA 3ZQCA 4ZYGA 3C18A 3DTEA 1PYVA 4OIQF 4EM2A 3M8FA 2RAEA 3D5RC 5HNHA 1RRJA 2KPMA 2HTSA 3CESA 2UUZA 2NOJB 1FBSA 3IWFA 3VB2A 4Y52J 2W85A 3V8LA 3CO6C 4XSZF 2DK5A 2ESHA 2IS4A 2X6WA 4XBFA 1MDMA 3Q5FA 3K69A 2Y48A 2E2IJ 2FJ1A 1O4XA 2FBIA 1Y0NA 4JX6A 1OJLA 5KHDA 2HOEA 4HA8A 2QSHX 5LGNA 3BQZA 3CZ6A 3BY6A 6PAXA 1D0XA 2NVYJ 2FEZA 2HXIA 1FBQA 1I5ZA 3KP7A 2VJ5A 4KA4A 2XGCA 2XGDA 1ENHA 3A0BC 2BY2A 2W00A 3I5UA 3S16J 2O8XA 5BPDA 1SD5A 2E1MB 2Z33A 4RGSA 4KMUX 3VYUB 1FBUA 1YS6A 1BJAA 2QVOA 1ONVA 1JGGA 1SD7A 4RLQA 1B9MA 2L54A 1IZ1A 1I1GA 2BHYA 2CMPA 3T0YA 2LOOA 4IJAA 2CFOA 3L2VA 2E34A 4FE7A 2VOPA 3KYDB 2A5YB 1OYYA 2R7DA 2R7WA 3I4PA 3RZDJ 3O8HA 4EJUA 1VFCA 5E3OA 1JJ6C 2L7FP 5EZGA 4EMSA 5K7FA 2XGEA 3GTGJ 3B02A 1Z67A 3NQOA 1K6OA 3W2AA 2FE3A 1XCBA 2FMYA 3SFZA 3CCLI 2X0LA 1TZLA 4U0WA 4AU7A 4HQMA 3GFJA 3W6VA 1X1CA 2M7AA 3FXMA 2EPFA 4CCOA 3HTSB 1ZG3A 5JVGF 2DOAA 3HOXJ 2DW4A 2K5CA 3G1OA 2HXOA 2P4WA 1VQPI 4MEYF 2KMUA 4HW0A 3JREA 4RB3C 2HOSA 1MJAA 2XDVA 3OOUA 3IP4B 4M74A 2R7TA 4Y3OA 1ODDA 1EA3A 3ONQA 3P9CA 4Y33A 2BVMA 2CSOA 5LHGA 2IA2A 1WJEA 1HOMA 4LFUA 2YS9A 5M3MJ 3K9TA 1U5TC 4PCQA 1D1BA 4OWRB 3B6AA 4OIPF 1BA5A 1MBHA 3BOQA 3PL8A 3WHCA 3DU5A 4M71A 4M3BA 1IDYA 3LQQA 2E36A 5K7HA 2LY1A 4G94A 2UXNA 4MQ9F 3F21A 1R6RA 5DUIA 1X2MA 1FMWA 4CZZA 4DBRA 2IP2A 3OYNA 2VKEA 1DGRM 2VN2A 2M2EA 2LKPA 4IRHA 4ZTJA 5TJJA 3WTSC 4BL0B 1R1TA 4UV9A 1WCMJ 4YFNF 1NTCA 1OPCA 4G8XA 1FP1D 5L3DA 3EUHC 4Q48A 1NHAA 2NAZA 2ZXWH 2R7ZJ 3CCRI 1ZTRA 3TDZC 4CYDA 4QPOA 3FISA 1Y1WJ 4ZH4F 5FJ8J 4NHJA 4XRSA 2LYCA 2IBDA 2YX4A 4EJTA 4AIDA 2PJRB 2PJPA 3U1KA 2EJRA 3KP4A 1R5HA 3H3UA 1G3TA 4BY7J 2DMPA 4N0BA 1KU9A 1ZARA 3TEDA 3QP6A 4B43A 3M7GA 4QIWN 3L7WA 1XC5A 5E8IA 5F6FA 3Q3SA 4HQEA 1CF7B 3OYAA 3TGNA 3U2RA 5EEGA 3ZQGA 1G59A 2ZJPF 1OISA 4M73A 4C30A 1B72A 3QRFF 3JAMK 2DT7B 1TQMA 2RREA 2OZUA 2CV2A 4C9YA 1WJ5A 1UHWA 1YE9A 5LGTA 1CGPA 5D6EA 1WJFA 3HGGA 2BYVE 5FD6A 1XSXA 2G7HA 2VC1A 2ME6A 4GDFA 5FKOA 1IC8A 4RM3A 2KIMA 4MNUA 1KYWA 4A3LJ 2KJBA 1E3HA 3R0AA 3DLLF 4GGGA 2Y9ZA 5A2QZ 3SDGA 4L5EA 1ZG5A 5D5XB 3I0TA 4LB6B 5EGOB 4A12A 4DIQA 2M9HA 4L5IA 1K7AA 3KLOA 2DA7A 5HS7A 2GXBA 1DUXC 1JUSA 1S8NA 1X1AA 4CZCA 1MSEC 3GWZA 1YLFA 4FTHA 3GTLJ 2DFFA 4XICA 2QKMB 5CQEA 1UHMA 1I27A 4Y4RA 5DCFA 2IW5A 2Z99A 1FP2A 3VPRA 5CLSA 4PSXA 5CJ9A 3TP3A 1G2HA 1MJBA 4G6DA 3QOEA 1LFUP 5DS9A 3DXJF 2FQ4A 3ABMH 1W36D 1LFBA 3HOTA 3H3ZA 2E35A 2LBFB 2NS0A 2VXDA 3G4SI 5E1XA 4HRIA 5FLXK 3M07A 3IWZA 4KIFA 3WE3A 1Y8RB 3Q0UA 3KLNA 5LFAA 2OV7A 1ETKA 4BUPA 1GHCA 4X6AJ 1F36A 1DDNA 5LHHA 1RKWA 2GWRA 4KT6A 2QBYB 3J81Z 4FX0A 2JA2A 3A1YA 3JRFA 3J7AO 4J00A 4ZDLA 2OUMA 4M6XA 5IOYA 3LMMA 5CQGA 4FE4A 4PJLA 3IRQA 4BEHB 4V19K 3EYIA 3OWTA 2A07F 3HOSA 4U7BA 1RESA 1IAWA 3I59A 3SHFA 5D6FA 1LJ9A 1WQ2A 2ELKA 2JUCA 2E19A 1UJ8A 3HSRA 4KIGA 5DDGA 2XASA 2Q2EA 3OV8A 1JUPA 5IYBJ 2DQLA 4XRSG 3JRDA 1E3OC 1KU7A 1W1WE 1AKHA 1G4DA 3HSFA 2ID3A 4PGHA 3TQNA 2WWYA 4XLFA 1MKMA 2F5DA 1FNNA 2BEOA 3QODA 3QQAA 1WHUA 1HSJA 1POGA 2WC2A 4QWQA 2ZO4A 3LSRA 1S5LC 1LDJA 2B7EA 1I39A 2LKSA 2X6OA 2WAEA 3OYJA 3FMQA 4CICA 5LGUA 1MBGA 2LH9A 4LIUA 5L3BA 2R5ZB 2R7FA 1W0UA 2XPWA 3A2KA 3CJQB 3VOEA 5DM7F 2VPLA 1U78A 1YJNI 1EKEA 5DUKA 3EQLF 1SAXA 3OL3A 1O7LA 4BEHA 5KK1A 2L3DA 4NNJA 2XUBA 1H88C 1RKTA 2B9SA 3FXJA 4B8XA 4XSXF 3CUQA 3HBLA 1MMGA 1O7FA 3F8FA 1Z1DA 3D5LA 3SZPA 3U21A 4HX4A 1HKSA 5ICGA 2R7OA 3FMRA 5HNFA 3AFHA 2AXTC 4XOPA 2E1CA 2JMWA 4LG0B 4D5CA 4P9UA 4Q5SF 2HKXA 3JRBA 4DZJA 1GXPA 1VQ7I 2HZTA 2P5VA 4UUSB 2FF4A 1PUFA 3IH4A 3ASOH 1Z6TA 4I0AA 2Z5UA 3TW7A 1TC3C 3NWSA 4DYQA 3DBHB 2MGQA 4BHBA 5IP9J 3ABUA 3BG3A 1KA8A 2MA3A 3WTYC 1Y6IA 1YG2A 4JK1X 4D5FA 2HS5A 5FFXA 1U8RA 1D8JA 4AWXB 3I56I 1YO5C 1ULYA 1YRNB 3DFGA 3PO2J 2WY8Q 4MO7A 1V3FA 1V55H 5BNGA 4C2MJ 5CVVA 3BPXA 3KYCB 3OYCA 1FJLA 3CDIA 3J80Z 1ON1A 4E7KA 2KJCA 3CP8A 5A2QK 2D2WA 1IO2A 4WWCA 3CDHA 1K4TA 1BW6A 4BQAA 3DV8A 1XMAA 3GTJJ 1HC8A 2YU9J 3ML6A 3VWBA 4HX7A 3HJEA 4FQGA 3H9JA 1SVLA 1TQPA 2ID6A 3CCSI 4OAYA 3BG6A 3E6DA 1FT9A 2GQQA 3GFIA 2CV1A 3RKWA 2CUJA 2JSCA 1OR7C 1GXQA 2A6EF 4HDVA 2IRFG 3ZMUA 4JX5A 4CYCB 3RPQA 3GTPJ 2C6YA 4DBQA 1UHSA 3S17J 3K4CA 2E1OA 5HLTA 2DI3A 5F0FA 1NH3A 2EIKH 2L7MP 2LR8A 1I6HJ 3S1MJ 2CQ7A 5FKKA 4BE0A 3BJAA 2OQRA 4JX4A 2JPBA 3S93A 4U87A 2K9NA 1A6QA 3DPTA 2H09A 1GVDA 3RQ4A 9ANTA 2E7WA 3QU6A 2WB1N 4HDUA 1V5EA 4E7HA 1XG1A 5EDNA 3K2AA 3LSKA 4UB8C 4AUXA 3F9KA 3J81K 3I53A 4LIVA 3ZP5A 3JTHA 1WGXA 2ZXJA 2X48A 3HHGA 1IJWC 1ZQ3P 5DCMA 1ZLKA 4A3CJ 4WXHA 1U9NA 2ICWG 1MH4A 1A35A 5DTDA 3H92A 3MKLA 2VJJA 3UR3C 1G3SA 3LFUA 1IUYA 4BNCA 1SD4A 1ZYRF 5IOZA 1J5YA 2TDXA 4AD9A 3N05A 1IN4A 1XDSA 2EA2A 1QHGA 1BC8C 5EZHA 3F8BA 5J4YA 1VQOI 1P92A 1DQUA 3DP7A 3HPHA 3J7YJ 3ZQLA 4YG2F 1VQNI 5ILVA 2DAOA 5ILSA 3A01A 1A36A 4XIDA 1K4SA 2M45A 2P0WA 3R6SA 2ZNYA 1Y0UA 2GOMA 5LEKA 2STWA 3SYTA 2F48A 5B1BH 4IZZA 2H6BA 5BMZA 1QA6A 2BBYA 3GUDA 1IV6A 1XX5A 4E7IA 3DCFA 2L2OA 5F04A 1GUUA 3KP3A 3CMYA 1X1DA 3HXLA 3JRAA 2XGXA 4I7HA 2LMDA 1YOVB 2XRNA 3TDUC 2JZYA 2VXZA 1J75A 4Z6YA 2BZTA 2MBFA 2RC4A 2M5WA 2LF8A 5CPRB 3ZOBA 1HKQA 5FLMJ 2MSYA 3HPGA 3CCQI 1P4AA 1U9OA 4D0PA 1ETYA 2FNAA 1JKQC 2DBBA 3DKXA 2E5NA 2DK8A 1S3JA 4RAYA 4UY8I 2WV1A 1IF1A 1H9TA 3IHUA 1Z3XA 2XKOA 1QPIA 1NK2P 4X0GA 4IPAA 2PN6A 2BOLA 3F8NA 4F55A 5TISC 5GTHC 5HOOA 3NARA 2OF7A 1QRYA 1FSHA 4E70A 1CQTA 1FMVA 1ZLJA 2E5ZA 3HZJA 2LSOA 1T38A 2FA5A 4PFOA 2MYSA 3P7NA 3LSJA 3K7AJ 3ABKH 1T39A 3OS2A 4A3BJ 1W7PB 4G7OF 1I1SA 2V6CA 5HDNA 3TO9A 5ED4A 2QLZA 3WU0A 1U5TA 2HOTA 4J19A 1ZR4A 3AAFA 1K83J 3VYSB 4P5OA 4MTEA 2EZHA 3EPZA 2HPMA 2NVTJ 3ERED 4IHYA 2W25A 3K10A 4ZDPA 5IP6A 4PJNA 4N9HA 4IX7A 1D3YA 4L9TA 4UUVA 2ECCA 3QPHA 3CCMI 2VT3A 2EV5A 1UG2A 2FBHA 3WTWC 3CUQC 4MFDA 3H9GA 4I02A 3FBIB 1F5TA 1EH8A 3NAUA 4I2OA 3WTXC 1YITI 2FUG2 2ZFUA 1D5YA 2HDDA 3JCUC 3QPSA 3IV5A 4OMZA 2RVCA 3L1PA 1JKOC 2VQLA 2LKXA 3ZMZA 1P9QC 1WVRA 1XGMA 3EUHA 1S9HA 3LSTA 3MKYB 2QQ8A 2VC0A 2XF5A 2G9WA 3FXKA 1XD7A 2EIMH 4BBSJ 4OIRF 1HW5A 3OS1A 2YPRA 2MD5A 1VQKI 5K7ZA 2QQ9A 2ESNA 4EV0A 2DOFA 4LK1F 3IC7A 3M8JA 3ZQ7A 3FXRA 1KQ8A 4D7NA 3G71I 2VL8A 2ZXHA 1IW7F 4BKXA 2HEOA 2K7LA 3VSLA 1ZGWA 2STTA 1DU6A 1ZRCA 3WU1B 3FXUA 5TGTA 1R5ID 4LB5A 2XC7A 1IRFA 4IQ4A 3ZN0A 4CXFA 3SQNA 3PUBA 1XGSA 1JT6A 2J5PA 3K4MA 1R71A 4IHVA 3RQIA 3W6JB 5BPIA 2X85A 4L5JA 3CD6I 4RAFA 2CUEA 1MBEA 4LMYA 4QPQA 1B6AA 3UNGC 3RTRA 2DTRA 2XB0X 1ACIA 1FLIA 2O3FA 1ERDA 2I5UA 2L9RA 1LE8A 3ZPLA 4C2UA 2AQFA 3K1MA 2NYXA 4I6ZA 3MEXA 3IH2A 3BROA 3ROUA 1YW7A 2BY3A 1A6IA 4DW6A 2XKPA 3ZQQA 1IDZA 2HYGD 2VB6A 4YIRX 5L3GA 2VOOA 5E8GA 2MH9A 4BH9A 1Z77A 4IOAF 2XHKA 4XRFA 1X58A 2BV6A 3LFKA 2CV0A 4PFPA 2XAUA 5M3FJ 1RIOH 2EFOA 4KMFA 2V1UA 3B6CA 2ZJRF 3W6KB 3CQZJ 4GYGA 2DDBA 4ITVA 1VQ8I 3P9KA 1W36C 4H0EA 2M0MA 4Y15A 4RMNA 5FKLA 2P7CB 3OYDA 3A02A 3JRHA 3A0HC 2KT0A 3KE2A 4LG3A 2XRLA 4IEJA 3O8GA 2IXSA 2L9NA 3NRVA 1FOXA 1W4MA 1MH3A 3KX2A 3GW2A 4GO1A 1IGNA 2BXZA 4G7HF 4AC0A 3JAMZ 2JQ7A 3PQKA 5EEHA 4NC8A 2H27A 2X51A 4DJAA 3OYEA 3BC8A 4AIKA 2GOXB 2B0LA 2V79A 3BR3A 4L0ZB 2KZGA 3HEFA 4ZZLA 1T95A 1MSFC 2RQQA 3QPTA 3OIQA 1ETOA 1Y39A 1ETQA 3RSNA 1R1VA 4O3MA 4J01A 1K78A 3Q0VA 3E5XA 1FY7A 1FX7A 5HDKA 3WG7H 4XKWA 1VI0A 1ZH5A 4C2TA 3S14J 4BJTA 2PEXA 1ZAOA 3O3KA 2PMUA 2HNHA 3GBGA 4IXAA 3CMAI 1XMXA 1HW1A 4LLGF 3G3ZA 5FO5A 3BP8A 2AO9A 1D0ZA 2DMTA 3LNQA 2CFXA 3KEQA 5EYRA 1LEBA 2E7XA 3DPUA 3BLYA 3M9AA 3SDBA 1FTZA 4KYWA 2EINH 3E1SA 1VQ6I 5FLXZ 3C7JA 5D8LB 3CMEI 1JGSA 2JVGA 3MKWB 4M3FA 5FB2A 4QSHA 3MZYA 1OYIA 2DA3A 5F1JA 1BIAA 2W57A 1HCRA 2GXAA 2L4AA 3OYMA 2R5YA 3U9GA 2OD5A 2XF7A 2X1DA 1WI3A 3HUGA 5IPAA 1R5GA 3D1NI 3F23A 1B59A 1M1EB 4ZYDA 1SFKA 3M8EA 1FIPA 2LRDA 2JWTA 2BVLA 1Z6RA 4B1RA 1LQ1A 2VODA 4E7LA 5D5UB 3V8KA 1SFXA 1ON2A 5GPAA 2J5OA 3Q9SA 1ZELA 4HNUA 1Z7UA 1X3ZB 1G8XA 2GZWA 3M1CA 1B72B 3IKTA 2I10A 3IH3A 2P81A 1N75A 2P5KA 4A3JJ 3K4BA 1P4WA 1LPQA 1P7IA 4MIMA 3I4NJ 1VZ0A 5CVJA 5ICEA 4P9FA 2F4MB 2VQHA 1EF4A 2ZSHB 4KISA 1MBJA 2H1KA 5FRMA 4XNFA 4D1QA 3FK7A 2FU4A 3S3NA 1OR7A 3FDYA 1FTTA 3VSKA 1ORKA 4EJWA 4V2FA 2L7KA 3GTMJ 1WH7A 2DTZA 2QM3A 1BI1A 3RKXA 1XPXA 1W5TA 5JLXA 2COBA 2DYSH 3P9IA 4HYEA 2F5CA 3OSFA 1QZZA 3FHZA 2E71A 4HF2A 3O6BB 4HOBA 4DGWB 2IA1A 3OYIA 1SFEA 2KKOA 3FXQA 2R7RA 2DA6A 3K70D 1U6GA 3IAS2 2QCOA 2A6HF 1X4PA 3V7SA 3K2ZA 1I50J 2KDZA 3E0JB 3H0GJ 4M9SA 3T5XA 3X2QH 3DEEA 2DPUA 3ZMDA 5FKMA 1QPMA 4E6KG 1A5JA 2QWWA 2OC6A 1ZR2A 2VJIA 1R4MB 1QNTA 2CJJA 3VDXA 3Q0WA 1X1BA 2HTJA 4HLXA 4GYIA 5AONA 1R36A 1VF9A 3LAPA 4I76A 1LDDA 1FIAA 3MVPA 4BU2A 3I59B 4H4KC 3WTVC 2Q2EB 2NRAC 3CF2A 1HW2A 4A6EA 2FOWA 3CCYA 1YS7A 4AIJA 1AA7A 3V42A 1AKHB 2CUFA 3TL4X 1WZ2A 4A3GJ 1AHDP 4IF4A 1B4AA 2LF7A 3HYIA 2CQKA 2A05A 3ZQHA 3HHHA 4E7SA 1YQAA 1J2XA 2OTJI 1X3UA 2F5VA 1XMKA 2W4SA 2L9VA 3GFLA 2ZNZA 1OCCH 2VKHA 4D9JA 4EJOA 5ERIA 2VBZA 3WGIA 1T8IA 4LLLA 1LKXA 2CQNA 1QQIA 2XIGA 2XAGA 3D5SC 1Z05A 1G6NA 2R93J 2QSGX 3WGGA 2X6XA 4EM1A 2R7UA 3QPLA 5ICFA 1REPC 2DA1A 1SVMA 3HL2A 3QOPA 1N25A 2Y31A 4R8HA 3V7RA 1R49A 5LRSA 4IO9F 3CC7I 2CW0F 1XGNA 3CUQB 3JRGA 1RUNA 2V1XA 2DU9A 3QAHA 5DV5A 2OQGA 1U3EM 1LNWA 1KONA 3BG5A 4A5NA 4BS9A 1TBXA 2IEKA 3TO6A 1PP7U 3HOWJ 2CH0A 1ZKGA 5IY5H 3G2BA 2HU9A 1RC9A 3FWEA 1JI8A 3GYHX 1BR4A 3ABLH 3QP5A 1PUFB 1R7JA 2M8EA 3CMMA 4YELA 5DD4A 1XDUA 2VBYA 3E6MA 3PO3J 2IJLA 1TQIA 3KYLA 2BW3A 4PJMA 4R79A 3J7AY 3MZ8A 2HQAA 2M0CA 1HBXG 2ME0A 2Z1DA 2FRHA 5E3MA 2KFDA 2VJ4A 3PNVA 4BXXJ 2MLGA 4CO8A 3H5RA 1WWXA 1VQLI 2Y0MA 1K6YA 5BOXA 3HOUJ 3GCMA 5LLQA 2MG4A 3FHNA 3EUKL 1UFMA 4FASD 4Q4ZF 3H1CA 3FM3A 1X3WB 1IN6A 2M4KA 1S72I 3OY9A 2WAQN 5HLGA 2ZMEA 2LDUA 4P55A 2Q8KA 1IN8A 3CLOA 3OOPA 3GZ6A 5LHIA 5L3CA 2E1MC 1FOKA 3M1EA 2XPUA 2WAQA 1VTNC 2DDAA 1JTYA 3ELKA 4HAMA 1IXRC 3HC7A 1A31A 1SANA 4XKBA 4XLPF 5GAHJ 1B8IB 3CLQA 2CRGA 5D4SA 5KCMA 3CC4I 2DQRA 3MZHA 2PX9A 1YHQI 3C3WA 5GAGJ 5IT9K 3L00A 2ETHA 2JA5J 3RYPA 2L02A 1TW3A 3E7LA 1R22A 5ICCA 1TNTA 1IN7A 2QQBA 1H8AC 5C44J 5DCMB 4IVNA 2L9SA 4C3IJ 3MWMA 3RI4A 4BXFA 3CJTB 4RS8A 5C4XJ 2OAZA 5DYMA 5EG0A 1JJ8C 1BOBA 2MW8A 4NB5A 2OTLI 4L9JA 3S2WA 4GCVA 2L01A 2DA2A 1GV2A 1ETWA 3NEUA 1TP4A 1UZCA 2LK2A 1DPUA 2ZB9A 2KQRA 2UV1A 4A6DA 5CVRA 3A01B 5F0HA 2ZXIA 3I3LA 2PI0A 3L2QA 5F08A 1TWCJ 2DCEA 2NOGA 4RGUA 1UB9A 1W5SA 2NNNA 5F64A 3F22A 1SEUA 1B8IA 1J9IA 2K02A 4KT5C 1WJAA 4A3EJ 1W7PD 4WXCA 1Z7LA 2HI3A 3H5NA 5HLIA 1SMTA 1J7KA 3KZZA 3OR1C 1W0TA 1S29A 3ZMSA 1ETXA 1U2WA 4M3GA 3AG4H 1TWHJ 4M72A 4L9NA 5M5XJ 5JI6A 4FISA 3VYTB 3HB9A 4EJVA 2WB1A 1VQ5I 2K9QA 3A4CA 5J1RA 2KZVA 3KP5A 4BAYA 1TWGJ 3L2WA 2F4IA 1BM9A 4P96A 1FYLA 3FX3A 5J8CA 1ITYA 4HG2A 1EV7A 1ZHFA 4AYBN 4A5MA 2XAHA 3DWLE 2K3PA 4XLNF 5EJCA 3WTZA 3F3XA 3WU2C 3I4MJ 4WF2A 5HS9A 5EEAA 3ZRGA 2CYYA 4RGRA 2IVMA 4XMYA 3DTKA 4AYBA 3ESWB 1OCPA 5FKNA 2M3AA 1OMIA 2W1OA 1P2FA 4FHTA 4KUMA 1X4OA 1OQYA 2LLKA 3JSPA 3H5AA 3HKZN 1X1PA 2AHQA 4N9IA 4XQFA 4ESFA 4OU0A 4PJJA 3CCEI 4NBQA 1Q1HA 4ON0A 1MIJA 1UMQA 5CVIA 1E17A 5GPCA 1YIOA 4ENMA 2EILH 1FPQA 2Y75A 1U5TB 1QBJA 2NXNB 2VPRA 4HSTA 4LOCA 1MNEA 2DN0A 4I98B 3WTTC 3HOZJ 2O8KA 3CC2I 2GA2A 2JJ7A 3WGHA 3OIOA 3OL4A 4MTDA 1LFPA 3KETA 1MMSA 3E5UA 1JKRC 4A3KJ 4WCGA 4ZYEA 3PQJA 1YW9A 4O5VA 1O3RA 2VBXA 1YX5A 2QEXI 1MNMC 2DLLA 3PSFA 3BQYA 5K5QA 5HDGA 3BJ6A 1WFXA 4U88A 1FEXA 3IRRA 2X4HA 1TNSA 2EV0A 4RLFA 3RIRA 2JPCA 5CVUA 1Q1VA 4F52A 4UHTA 2XROA 1EH7A 4YIIA 4G9YA 5ILUA 2JN6A 1BIBA 2ISZA 5H20A 2RN7A 1UELB 4XKVA 3FXLA 5C3EJ 4RAGA 5KAIC 2Q1ZB 1BOAA 4NDLA 3PNTA 2IPQX 2NVUB 4C3HJ 3HRTA 1J59A 3DU6A 2HVRA 1LEAA 4F91B 4LLNA 3AG3H 5HODA 1ZGJA 1ZG1A 2OA4A 2DJIA 2RKHA 2IS1A 2OU2A 2V1NA 1GDTA 4RB1A 2QKLB 1R23A 3BZ6A 5HLHA 1R9TJ 3BG7A 5LEJA 1N77A 3AG2H 5DEQA 4GRIA 3D0SA 2X1EA 3I58A 3LQRA 3BR2A 3QU3A 2V9VA 2ELJA 3WTUC 2F5FA 2ZMEC 3MQ0A 5JLWA 3CJNA 2DFHA 1BJZA 2BXYA 4L18B 1T98A 3TMOA 1KU2A 3FK6A 1YJ9I 2EFPA 2KP6A 2EFNA 2GIZA 3BCAA 4LK0F 5JHUA 4A0XA 4GFBA 1HDPA 2K3FA 1MMDA 4IHXA 2BE5F 3OMYA 3L2CA 2MH2A 1LE8B 2QENA 3GZ5A 3E3VA 4CUGA 4E7JA 3I54A 2VONA 4HF0A 4II3A 3JRIA 3DEWA 1IUFA 4MGRA 2CQXA 2BGCA 3K1PA 4G12A 4BJ6C 1IV8A 3K0LA 5F1RA 2Y0SN 3MKZA 1BR2A 3OR2C 1RR7A 3KEOA 5C4JJ 1PDNC 1UCRA 2XPVA 3R4KA 4XKCA 1QHHD 2QQAA 1S6LA 2HQRA 4JOMA 1PJRA 4Z2YA 4EVIA 3GLXA 3MFKA 1Y1VJ 1MBKA 1FYMA 5DD8A 4EEFG 1XTAA 4F92B 1KQ9A 2JUGA 2O61A 4XONA 4BQQA 1UAAA 4RAZA 2ZKZA 2LC2A 1FOWA 4G6TB 5J6XA 3K70C 4ZTFA 4HV6A 1C0WA 3CO7C 4NC6A 1FWZA 2H6CA 5LD2C 2W7NA 5FD5A 1SD6A 3RDIA 3PIPF 1OLTA 2JK3A 4KJZA 2PMZN 2A5WA 1BN5A 4ZYHA 1RR8C 2DJNA 3V4GA 3DLAA 4BGDA 2K9SA 3JW4A 2FOKA 3SXYA 2KIUA 3OIPA 3R0JA 2PMZA 1X2NA 3BWGA 5HS8A 1APLC 4RBOA 2XAFA 5F0CA 3WG9A 1T0FA 3ABTA 1BC7C 3DEUA 1S7AA 1D0YA 1JUMA 1XN7A 2MLKA 4WXDA 1XSVA 2M34A 4W97A 4XOTA 4BHPA 1K78B 5GP9A 1T56A 1U0JA 2IAIA 4WK8F 2EFQA 2IS2A 1RI7A 4XR6A 3FMSA 1VQ9I 2MFZA 1MD0A 2AS5F 4Y7NJ 1K79A 1X19A 1Y8QB 2F6CA 2KHMA 2DO7A 2QYOA 3OYKA 3C2HA 3JRCA 1E2XA 2ISYA 2Z2SB 4DZPA 5E3NA 1VQ4I 2UXXA 2KISA 3G6EI 4UB6C 4K2EA 4HBLA 2V1DA 1J0RA 3LSMA 2I8DA 1V54H 4L0YB 2DYRH 2VKDA 4FT8A 3BTCA 4ASNA 2F2EA 3TOBA 3PUFA 2L5QA 1DP3A 3BTJA 4NQWA 1FC3A 2MC4A 3KCCA 1MJ9A 5EF6A 5L3FA 2D45A 4LGWA 3RPUD 2FNPA 2CQQA 3TW6A 4DNCA 1Z21A 2R5YB 3PNYA 4M6YA 3F8MA 5M5WJ 4AM3A 2KL4A 1L3LA 1QVTA 3LWFA 3BZKA 2IGMA 2XVCA 3GVAA 3HUGB 2VE9A 4ESJA 2VLAA 1LDKB 3U1DA 2IT0A 4XL9A 3HDDA 2R7XA 4LITA 1NK3P 4BDYA 1D5VA 1T33A 3DQVC 4A93J 1YW8A 2EFWA 3H3VK 2DXIA 4XM3A 2DFIA 2E2JJ 4JYKA 1S7OA 4ETSA 2V7FA 5BS6A 1ETVA 5J40A 3DPLC 2PG4A 4IHWA 3W2WA 4IHSA 2R92J 3HRMA 1OKRA 4B3XA 2X1CA 4YIFA 1FZPB 4B3AA 2VBWA 4OINF 3KFWX 1TWFJ 2IGNA 3BPVA 1XS9A 4V2GA 2OPTA 4FCYA 4JP0A 3ZXSA 1O3TA 2DPDA 4RB2C 2WA0A 4U0VA 2KRFA 4XK4A 4LJZF 3BR5A 5KAFC 2LVSA 2VE8A 2RV8A 2WY7Q 2KRCA 4KN7X 4XRMA 3HGYA 2W48A 2F4OB 3COAC 2IGKA 3TP0A 3EUAA 4G6QA 3AG1H 3CCJI 1D1CA 4HEA2 4KDPA 2P6SA 2LFBA 4PDKA 2R4GA 4HLYA 1BW5A 2V9PA 3P5JA 3IL2A 3ECOA 1AWCA 4A3DJ 4F93B 4M3EA 1RNLA 1OCOH 2XAQA 3M3YJ 3IKVA 2O7OA 2DT6A 2KRHA 4PK4A 1TLHB 3QYFA 1HF0A 5GTIC 4UNOA 4AVPA 1IRXA 3OYGA 3W3CA 1XGOA 1NG6A 5BQTA 2QZ8A 3F6VA 2RDPA 3JR9A 2DFEA 3CF5F 2NS8A 3V8JA 1H0MA 1I3AA 1P6RA 4MQVA 1HDDC 4M9XA
chains in the Genus database with same CATH topology
5K5OA 4Q47A 1QGPA 1ZN2A 1YTYA 2AXLA 4UXNA 3DKWA 1TW2A 1BI0A 3JTGA 3REOA 4PZJA 2K86A 4EGZA 3R61A 3R60A 2O0YA 4UVBA 2RQPA 2GIVA 1IXSB 4DQ2A 3I71A 5HVQC 5FFZA 3LA3A 3GO5A 2KIFA 4WX9A 1H9GA 2HDCA 5IT9Z 2WV0A 2LNBA 2FMLA 4UV8A 2CG4A 5L3EA 3K1NA 3KP2A 4A0ZA 1R00A 1MZBA 4IHTA 2F5EA 2P7VB 4AIHA 3RPUA 1B1BA 2HR3A 5D5VB 4TV7A 1R58A 2A61A 1HQCA 4UVAA 1KYZA 3VODA 2ZBKA 3F72A 1JHHA 4A2UA 1AOYA 3TO7A 1QZYA 1KU3A 1CF7A 2FXAA 3WE2A 2CO5A 2OZ6A 1OYWA 2D1HA 2HWVA 1L0OC 4OMYA 2M1BA 3V7CA 2UZKA 2ZMEB 1KQ0A 1Z9CA 2P8TA 1O57A 2RGVA 1RUOA 1O3SA 3CUOA 4R1HA 4QLCU 1EH6A 1MGTA 3ZMVA 3SZTA 3TKYA 1WRJA 5LBQA 2EWNA 3N4MA 4MEXF 4G7ZF 1DP7P 3E6CC 1R1UA 4L9VA 1PP8F 5D8KB 2OBPA 1T2KA 1IXCA 2XV4S 1PUEE 3EETA 2PMHA 3ZMTA 2YSRA 3I64A 1ZRDA 1USSA 2W84A 4YFXF 2CGPA 4A0YA 5KVRA 2R3SA 5IT3A 2K27A 1FYKA 1ZRFA 5AIQA 4S05A 2QBYA 2PQ8A 3LAJA 2JT1A 5E1ZB 3VEPA 1TTYA 2IA0A 2UWMA 4RGXA 2D1VA 3BJOA 1BI3A 1XSDA 1WI9A 1B9NA 1YFHA 3FZVA 4I09A 4UVCA 4LD5A 2DT5A 3L09A 4IRIA 1IN5A 2EV6A 5K1YA 1BBYA 5E1WA 5K5RA 1JE8A 4KFCA 1XB4A 3O2PE 1G3WA 1ZGAA 2RNJA 4ENNA 2HYFA 2GA1A 3LA7A 3EYYA 5JR3A 3HRSA 5JVTA 2P5LC 1WSUA 4KICA 3MCZA 2HKOA 5D4RA 1KGSA 4Y13A 1FSEA 2O03A 3GFMA 3GF2A 3HIFA 3KP6A 3N97A 4I0BA 2MC3A 4LG0A 3PFIA 3VFZA 3RYRA 4ENJA 2HFHA 3F6OA 4KIBA 4RB0A 4GXOA 3WODF 5CYVA 1BI2A 5H6QA 2HGCA 1RZ4A 1XCVA 2JTVA 3E5QA 3RKYA 4ZZDA 2H94A 2ELHA 1Z91A 3HTUA 1WKMA 1JHFA 4HF1A 4BHCA 4BYYA 3L9FA 2O6GE 4CGZA 2W24A 1SMYF 5J8FA 1O3QA 3FM5A 2GXGA 2ZJ2A 3GEZA 1A04A 5D5WB 1LB2A 1F1ZA 3GXOA 4FX4A 2VT2A 3RJPA 2NNYA 2K4BA 3LA2A 3G73A 1HSTA 2PLYA 1STZA 4ENKA 2FSWA 4CHUA 2XAJA 2PBIA 2EK5A 1IRGA 4EGYA 3ECHA 3KZYA 3EDPA 3ULQB 1F9NA 4ESBA 2E1NA 2CWEA 1YYVA 2EA4A 4HZFA 1T6SA 2Z3YA 4BXUA 3HRUA 3Q9VA 1DPRA 5AIPA 2GAUA 3ISPA 2Q0OA 4EM0B 3J80K 3T8RA 1HKTA 5E17F 4HV5A 2P6TA 2FQ3A 4U7DA 4HX8A 4S04A 1GVJA 4MHGA 1JXSA 2L4MA 4CDGA 4M9ZA 3F8CA 1LVAA 4F7ZA 2Z9OA 2YU3A 5LRRA 3E97A 4KNYA 1HXDA 4Y17A 2ZCWA 1D8KA 1I6XA 4O6JA 2YR2A 2ZFWA 3BDDA 5H6RA 3MAJA 1USTA 4PGGA 3C1DA 3JSOA 1W7PA 2A69F 3GX4X 1V4RA 3E6BA 3TOAA 4IRGA 5E18F 4U0YA 2FBKA 4JQFA 5FGMA 3B73A 5TRDA 4JBAA 5JFRA 4B09A 2WTEA 2QUFA 1F4KA 3HSEA 5E20A 2YX7A 3DF8A 1SFUA 4OOIA 3T8TA 1MDMB 3CTAA 2COMA 1G3YA 2A68F 2EB7A 2M30A 2K4JA 2G7UA 1P4XA 1ZREA 2JRTA 2ADUA 2PFBA 2ACJA 3T1BA 4EQQA 2A3SA 4OIOF 1QO0D 2M87A 4KN4X 4YFKF 3ZN1A 4I01A 3FF5A 2HQNA 4ZYGA 3C18A 4OIQF 4EM2A 3M8FA 2HTSA 3IWFA 1FBSA 3VB2A 2W85A 3V8LA 3CO6C 4XSZF 2DK5A 2ESHA 4XBFA 1MDMA 3Q5FA 3K69A 2Y48A 2FBIA 2HOEA 4HA8A 5LGNA 3BY6A 6PAXA 2FEZA 1FBQA 1I5ZA 3KP7A 4KA4A 3I5UA 2O8XA 5BPDA 1SD5A 2Z33A 4RGSA 4KMUX 1FBUA 1YS6A 1BJAA 2QVOA 1ONVA 1SD7A 1B9MA 2L54A 1IZ1A 1I1GA 3T0YA 4IJAA 2VOPA 2A5YB 1OYYA 2R7DA 3I4PA 4EJUA 4EMSA 3B02A 3NQOA 1K6OA 2FE3A 1XCBA 2FMYA 3SFZA 2X0LA 4U0WA 4HQMA 3GFJA 3HTSB 1ZG3A 2DW4A 2P4WA 4MEYF 4HW0A 4RB3C 1MJAA 4M74A 1ODDA 3P9CA 2CSOA 5LHGA 2IA2A 4LFUA 3K9TA 1U5TC 4PCQA 4OIPF 3BOQA 4M71A 3LQQA 4G94A 2UXNA 4MQ9F 3F21A 5DUIA 4CZZA 2IP2A 2VN2A 2LKPA 4IRHA 5TJJA 3WTSC 1R1TA 4UV9A 4YFNF 1OPCA 4G8XA 1FP1D 5L3DA 4Q48A 1NHAA 2NAZA 3TDZC 4CYDA 4ZH4F 4NHJA 2YX4A 4EJTA 2PJPA 2EJRA 3KP4A 1R5HA 3H3UA 1G3TA 4N0BA 1KU9A 1ZARA 3QP6A 3M7GA 3L7WA 5E8IA 5F6FA 4HQEA 1CF7B 3TGNA 3U2RA 5EEGA 4M73A 3QRFF 3JAMK 1TQMA 2OZUA 1UHWA 5LGTA 1CGPA 5D6EA 2BYVE 5FD6A 1XSXA 2G7HA 2VC1A 2KIMA 4MNUA 1KYWA 2KJBA 3R0AA 4GGGA 5A2QZ 1ZG5A 5D5XB 3I0TA 4LB6B 4A12A 4L5IA 1K7AA 3KLOA 2GXBA 5HS7A 1DUXC 1S8NA 3GWZA 1YLFA 1UHMA 1I27A 5DCFA 2IW5A 2Z99A 1FP2A 5CLSA 5CJ9A 1MJBA 4G6DA 3DXJF 3HOTA 3H3ZA 2NS0A 5E1XA 5FLXK 3IWZA 4KIFA 3WE3A 3KLNA 1GHCA 1DDNA 5LHHA 2GWRA 2QBYB 3J81Z 4FX0A 3J7AO 4M6XA 3IRQA 3EYIA 2A07F 3HOSA 4U7BA 1IAWA 3I59A 3SHFA 5D6FA 1LJ9A 1WQ2A 3HSRA 4KIGA 5DDGA 2XASA 2Q2EA 3OV8A 2DQLA 1KU7A 1G4DA 3HSFA 4PGHA 3TQNA 2WWYA 1MKMA 2F5DA 1FNNA 2BEOA 1HSJA 2WC2A 4QWQA 2ZO4A 1LDJA 3FMQA 4CICA 5LGUA 5L3BA 2R7FA 3VOEA 1U78A 5DUKA 3EQLF 1SAXA 1O7LA 5KK1A 2L3DA 2XUBA 4B8XA 4XSXF 3CUQA 1O7FA 3F8FA 1Z1DA 3D5LA 3SZPA 4HX4A 1HKSA 5ICGA 3FMRA 2E1CA 4LG0B 4P9UA 4Q5SF 2HKXA 1GXPA 2HZTA 2P5VA 2FF4A 1Z6TA 4I0AA 2Z5UA 4BHBA 3ABUA 1KA8A 2MA3A 3WTYC 1YG2A 4JK1X 1U8RA 2HS5A 5FFXA 1D8JA 4AWXB 1YO5C 1ULYA 3DFGA 1V3FA 5CVVA 3BPXA 3J80Z 1ON1A 2KJCA 5A2QK 2D2WA 4WWCA 3CDHA 4BQAA 3DV8A 1XMAA 3ML6A 4HX7A 1TQPA 3E6DA 1FT9A 2GQQA 3GFIA 3RKWA 2JSCA 1GXQA 2A6EF 4HDVA 2IRFG 3ZMUA 3RPQA 2C6YA 2DI3A 3BJAA 2OQRA 2JPBA 3DPTA 2H09A 2E7WA 3QU6A 4HDUA 3J81K 3I53A 3ZP5A 3JTHA 3HHGA 2ZXJA 5DCMA 1ZLKA 4WXHA 3H92A 1IUYA 1G3SA 4BNCA 1SD4A 1ZYRF 1J5YA 2TDXA 4AD9A 1IN4A 1XDSA 2EA2A 1BC8C 3F8BA 1P92A 3DP7A 4YG2F 5ILVA 2DAOA 5ILSA 2M45A 3R6SA 2ZNYA 1Y0UA 5LEKA 2STWA 2H6BA 5BMZA 2BBYA 3GUDA 3KP3A 2XGXA 4I7HA 2XRNA 3TDUC 2JZYA 2VXZA 1J75A 2MBFA 2RC4A 2M5WA 2LF8A 1HKQA 1P4AA 4D0PA 2FNAA 2DBBA 2DK8A 1S3JA 4RAYA 1IF1A 1H9TA 3IHUA 2XKOA 4IPAA 2PN6A 3F8NA 5HOOA 1FSHA 4E70A 1ZLJA 2LSOA 1T38A 2FA5A 3P7NA 1T39A 1W7PB 4G7OF 1I1SA 2V6CA 5HDNA 3TO9A 5ED4A 2QLZA 3WU0A 1U5TA 3AAFA 4P5OA 4MTEA 3ERED 2W25A 4N9HA 1D3YA 4L9TA 4UUVA 3QPHA 2VT3A 2EV5A 2FBHA 3WTWC 3CUQC 4I02A 1F5TA 1EH8A 4I2OA 3WTXC 4OMZA 2RVCA 3ZMZA 1XGMA 3EUHA 3LSTA 2VC0A 2G9WA 1XD7A 4OIRF 1HW5A 2YPRA 2MD5A 2QQ9A 2ESNA 4EV0A 4LK1F 3IC7A 3ZQ7A 3FXRA 1KQ8A 1IW7F 2HEOA 2STTA 2K7LA 1ZRCA 3WU1B 3FXUA 4LB5A 1IRFA 3ZN0A 4CXFA 3SQNA 1XGSA 2J5PA 3W6JB 5BPIA 4L5JA 4LMYA 1B6AA 3RTRA 2DTRA 1FLIA 2O3FA 3ZPLA 3K1MA 2NYXA 3MEXA 3BROA 3ROUA 1YW7A 2XKPA 2HYGD 5L3GA 2VOOA 5E8GA 2MH9A 4BH9A 2XHKA 4XRFA 2BV6A 3LFKA 1RIOH 2EFOA 4KMFA 2V1UA 3W6KB 4GYGA 3P9KA 4H0EA 4Y15A 2P7CB 3KE2A 3NRVA 1W4MA 3GW2A 4GO1A 4G7HF 3JAMZ 3PQKA 5EEHA 2H27A 4AIKA 2B0LA 2V79A 4L0ZB 4ZZLA 3QPTA 1R1VA 4O3MA 1K78A 3E5XA 1FY7A 1FX7A 5HDKA 1ZH5A 2PEXA 1ZAOA 3O3KA 2PMUA 4IXAA 1HW1A 4LLGF 3G3ZA 5FO5A 3BP8A 2CFXA 3KEQA 1LEBA 2E7XA 3M9AA 4KYWA 5FLXZ 3C7JA 5D8LB 1JGSA 5FB2A 3MZYA 1OYIA 1BIAA 2W57A 2L4AA 3U9GA 2OD5A 3HUGA 1R5GA 3F23A 1B59A 4ZYDA 3M8EA 1Z6RA 1LQ1A 2VODA 5D5UB 3V8KA 1SFXA 1ON2A 2J5OA 3Q9SA 1Z7UA 2GZWA 3IKTA 2P5KA 1P4WA 5CVJA 5ICEA 4P9FA 2FU4A 1OR7A 4EJWA 2QM3A 1BI1A 3RKXA 1W5TA 3P9IA 4HYEA 2F5CA 1QZZA 3FHZA 4HF2A 3O6BB 4HOBA 2IA1A 1SFEA 2KKOA 3FXQA 1U6GA 2A6HF 3V7SA 3K2ZA 4M9SA 3T5XA 2DPUA 3ZMDA 1QPMA 2QWWA 1QNTA 2HTJA 4HLXA 4GYIA 5AONA 1R36A 3LAPA 1LDDA 3I59B 3WTVC 2NRAC 1HW2A 4A6EA 1YS7A 4AIJA 4IF4A 1B4AA 2LF7A 3HYIA 2CQKA 3HHHA 1YQAA 1J2XA 1X3UA 1XMKA 3GFLA 2ZNZA 3WGIA 4EJOA 5ERIA 2VBZA 4LLLA 1QQIA 2XIGA 2XAGA 1Z05A 1G6NA 3WGGA 4EM1A 5ICFA 1REPC 3QOPA 4R8HA 3V7RA 5LRSA 2CW0F 1XGNA 3CUQB 1RUNA 2V1XA 2DU9A 3QAHA 5DV5A 2OQGA 1U3EM 1LNWA 4A5NA 1TBXA 1PP7U 3TO6A 3FWEA 3GYHX 3QP5A 1R7JA 2M8EA 5DD4A 1XDUA 2VBYA 3E6MA 2IJLA 1TQIA 4R79A 1HBXG 2FRHA 2MLGA 4CO8A 1WWXA 2Y0MA 5BOXA 5LLQA 1UFMA 4Q4ZF 3FM3A 1IN6A 5HLGA 2ZMEA 2LDUA 4P55A 2Q8KA 1IN8A 3CLOA 3OOPA 3GZ6A 5LHIA 5L3CA 1FOKA 3M1EA 1VTNC 3ELKA 4HAMA 1IXRC 4XLPF 5D4SA 2DQRA 3MZHA 3C3WA 5IT9K 3L00A 2ETHA 3RYPA 2L02A 1TW3A 1R22A 5ICCA 1TNTA 1IN7A 2QQBA 5DCMB 4IVNA 3MWMA 3RI4A 4RS8A 2OAZA 5DYMA 4NB5A 4L9JA 3S2WA 4GCVA 2L01A 3NEUA 1DPUA 4A6DA 5CVRA 2PI0A 4RGUA 1UB9A 1W5SA 3F22A 2NNNA 5F64A 1J9IA 2K02A 4KT5C 1W7PD 4WXCA 5HLIA 1SMTA 1J7KA 3KZZA 1S29A 3ZMSA 1U2WA 4M72A 4L9NA 5JI6A 4EJVA 3KP5A 4BAYA 1BM9A 4P96A 1FYLA 3FX3A 5J8CA 1EV7A 1ZHFA 4A5MA 2XAHA 4XLNF 3WTZA 3F3XA 4WF2A 5HS9A 2CYYA 4RGRA 2IVMA 1OMIA 1P2FA 4FHTA 4KUMA 3JSPA 4N9IA 4ESFA 4OU0A 1Q1HA 4ON0A 5CVIA 1E17A 1YIOA 4ENMA 1FPQA 2Y75A 1U5TB 1QBJA 4I98B 3WTTC 2GA2A 3WGHA 4MTDA 3KETA 3E5UA 4WCGA 4ZYEA 3PQJA 1YW9A 4O5VA 1O3RA 2VBXA 2DLLA 5K5QA 5HDGA 3BJ6A 4U88A 3IRRA 2X4HA 1TNSA 2EV0A 3RIRA 2JPCA 5CVUA 4UHTA 2XROA 1EH7A 4YIIA 4G9YA 5ILUA 1BIBA 2ISZA 5H20A 2RN7A 1BOAA 2IPQX 3HRTA 1J59A 1LEAA 4LLNA 1ZGJA 1ZG1A 2OA4A 2RKHA 2OU2A 4RB1A 5HLHA 1R23A 3BZ6A 5LEJA 5DEQA 3D0SA 3I58A 3LQRA 3QU3A 2V9VA 3WTUC 2F5FA 3MQ0A 3CJNA 4L18B 1T98A 1KU2A 5JHUA 2EFPA 2EFNA 4LK0F 4A0XA 2BE5F 3L2CA 2MH2A 2QENA 3GZ5A 3E3VA 3I54A 2VONA 4HF0A 4MGRA 2BGCA 3K1PA 3K0LA 5F1RA 3KEOA 1PDNC 1UCRA 3R4KA 2QQAA 1S6LA 2HQRA 4Z2YA 3MFKA 4EVIA 3GLXA 1FYMA 5DD8A 1KQ9A 2O61A 4RAZA 2ZKZA 5J6XA 4HV6A 1C0WA 3CO7C 1FWZA 2H6CA 5FD5A 1SD6A 3RDIA 1BN5A 4ZYHA 3V4GA 3JW4A 2FOKA 3SXYA 2KIUA 3R0JA 3BWGA 5HS8A 2XAFA 3WG9A 1T0FA 3ABTA 1BC7C 3DEUA 1S7AA 1XN7A 2MLKA 4WXDA 4BHPA 1XSVA 1K78B 4WK8F 2EFQA 1RI7A 3FMSA 1MD0A 2AS5F 1K79A 2DO7A 2QYOA 1E2XA 2ISYA 2UXXA 4K2EA 4HBLA 2V1DA 1J0RA 4L0YB 4FT8A 4ASNA 2F2EA 3TOBA 4NQWA 1FC3A 3KCCA 1MJ9A 5L3FA 2D45A 4LGWA 2FNPA 4DNCA 4M6YA 3F8MA 1L3LA 3LWFA 2XVCA 3GVAA 2VE9A 4ESJA 1LDKB 3U1DA 2IT0A 1D5VA 3DQVC 1YW8A 2EFWA 2DFIA 1S7OA 4ETSA 5BS6A 3DPLC 2PG4A 4IHSA 3HRMA 1OKRA 4YIFA 1FZPB 2VBWA 4OINF 3KFWX 3BPVA 1O3TA 2DPDA 4RB2C 4U0VA 2KRFA 4LJZF 2VE8A 2RV8A 4KN7X 3COAC 4G6QA 4KDPA 2P6SA 4PDKA 4HLYA 3IL2A 3ECOA 1AWCA 1RNLA 2XAQA 3IKVA 1TLHB 4UNOA 4AVPA 1XGOA 5BQTA 2QZ8A 3F6VA 2RDPA 3V8JA 1H0MA 1P6RA 4MQVA 4M9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K5O A;  4Q47 A;  1QGP A;  1ZN2 A;  1YTY A;  2AXL A;  4UXN A;  3DKW A;  1TW2 A;  1BI0 A;  3JTG A;  3REO A;  4PZJ A;  2K86 A;  4EGZ A;  3R61 A;  3R60 A;  2O0Y A;  4UVB A;  2RQP A;  2GIV A;  1IXS B;  4DQ2 A;  3I71 A;  5HVQ C;  5FFZ A;  3LA3 A;  3GO5 A;  2KIF A;  4WX9 A;  1H9G A;  2HDC A;  5IT9 Z;  2WV0 A;  2LNB A;  2FML A;  4UV8 A;  2CG4 A;  5L3E A;  3K1N A;  3KP2 A;  4A0Z A;  1R00 A;  1MZB A;  4IHT A;  2F5E A;  2P7V B;  4AIH A;  3RPU A;  1B1B A;  2HR3 A;  5D5V B;  4TV7 A;  1R58 A;  2A61 A;  1HQC A;  4UVA A;  1KYZ A;  3VOD A;  2ZBK A;  3F72 A;  1JHH A;  4A2U A;  1AOY A;  3TO7 A;  1QZY A;  1KU3 A;  1CF7 A;  2FXA A;  3WE2 A;  2CO5 A;  2OZ6 A;  1OYW A;  2D1H A;  2HWV A;  1L0O C;  4OMY A;  2M1B A;  3V7C A;  2UZK A;  2ZME B;  1KQ0 A;  1Z9C A;  2P8T A;  1O57 A;  2RGV A;  1RUO A;  1O3S A;  3CUO A;  4R1H A;  4QLC U;  1EH6 A;  1MGT A;  3ZMV A;  3SZT A;  3TKY A;  1WRJ A;  5LBQ A;  2EWN A;  3N4M A;  4MEX F;  4G7Z F;  1DP7 P;  3E6C C;  1R1U A;  4L9V A;  1PP8 F;  5D8K B;  2OBP A;  1T2K A;  1IXC A;  2XV4 S;  1PUE E;  3EET A;  2PMH A;  3ZMT A;  2YSR A;  3I64 A;  1ZRD A;  1USS A;  2W84 A;  4YFX F;  2CGP A;  4A0Y A;  5KVR A;  2R3S A;  5IT3 A;  2K27 A;  1FYK A;  1ZRF A;  5AIQ A;  4S05 A;  2QBY A;  2PQ8 A;  3LAJ A;  2JT1 A;  5E1Z B;  3VEP A;  1TTY A;  2IA0 A;  2UWM A;  4RGX A;  2D1V A;  3BJO A;  1BI3 A;  1XSD A;  1WI9 A;  1B9N A;  1YFH A;  3FZV A;  4I09 A;  4UVC A;  4LD5 A;  2DT5 A;  3L09 A;  4IRI A;  1IN5 A;  2EV6 A;  5K1Y A;  1BBY A;  5E1W A;  5K5R A;  1JE8 A;  4KFC A;  1XB4 A;  3O2P E;  1G3W A;  1ZGA A;  2RNJ A;  4ENN A;  2HYF A;  2GA1 A;  3LA7 A;  3EYY A;  5JR3 A;  3HRS A;  5JVT A;  2P5L C;  1WSU A;  4KIC A;  3MCZ A;  2HKO A;  5D4R A;  1KGS A;  4Y13 A;  1FSE A;  2O03 A;  3GFM A;  3GF2 A;  3HIF A;  3KP6 A;  3N97 A;  4I0B A;  2MC3 A;  4LG0 A;  3PFI A;  3VFZ A;  3RYR A;  4ENJ A;  2HFH A;  3F6O A;  4KIB A;  4RB0 A;  4GXO A;  3WOD F;  5CYV A;  1BI2 A;  5H6Q A;  2HGC A;  1RZ4 A;  1XCV A;  2JTV A;  3E5Q A;  3RKY A;  4ZZD A;  2H94 A;  2ELH A;  1Z91 A;  3HTU A;  1WKM A;  1JHF A;  4HF1 A;  4BHC A;  4BYY A;  3L9F A;  2O6G E;  4CGZ A;  2W24 A;  1SMY F;  5J8F A;  1O3Q A;  3FM5 A;  2GXG A;  2ZJ2 A;  3GEZ A;  1A04 A;  5D5W B;  1LB2 A;  1F1Z A;  3GXO A;  4FX4 A;  2VT2 A;  3RJP A;  2NNY A;  2K4B A;  3LA2 A;  3G73 A;  1HST A;  2PLY A;  1STZ A;  4ENK A;  2FSW A;  4CHU A;  2XAJ A;  2PBI A;  2EK5 A;  1IRG A;  4EGY A;  3ECH A;  3KZY A;  3EDP A;  3ULQ B;  1F9N A;  4ESB A;  2E1N A;  2CWE A;  1YYV A;  2EA4 A;  4HZF A;  1T6S A;  2Z3Y A;  4BXU A;  3HRU A;  3Q9V A;  1DPR A;  5AIP A;  2GAU A;  3ISP A;  2Q0O A;  4EM0 B;  3J80 K;  3T8R A;  1HKT A;  5E17 F;  4HV5 A;  2P6T A;  2FQ3 A;  4U7D A;  4HX8 A;  4S04 A;  1GVJ A;  4MHG A;  1JXS A;  2L4M A;  4CDG A;  4M9Z A;  3F8C A;  1LVA A;  4F7Z A;  2Z9O A;  2YU3 A;  5LRR A;  3E97 A;  4KNY A;  1HXD A;  4Y17 A;  2ZCW A;  1D8K A;  1I6X A;  4O6J A;  2YR2 A;  2ZFW A;  3BDD A;  5H6R A;  3MAJ A;  1UST A;  4PGG A;  3C1D A;  3JSO A;  1W7P A;  2A69 F;  3GX4 X;  1V4R A;  3E6B A;  3TOA A;  4IRG A;  5E18 F;  4U0Y A;  2FBK A;  4JQF A;  5FGM A;  3B73 A;  5TRD A;  4JBA A;  5JFR A;  4B09 A;  2WTE A;  2QUF A;  1F4K A;  3HSE A;  5E20 A;  2YX7 A;  3DF8 A;  1SFU A;  4OOI A;  3T8T A;  1MDM B;  3CTA A;  2COM A;  1G3Y A;  2A68 F;  2EB7 A;  2M30 A;  2K4J A;  2G7U A;  1P4X A;  1ZRE A;  2JRT A;  2ADU A;  2PFB A;  2ACJ A;  3T1B A;  4EQQ A;  2A3S A;  4OIO F;  1QO0 D;  2M87 A;  4KN4 X;  4YFK F;  3ZN1 A;  4I01 A;  3FF5 A;  2HQN A;  4ZYG A;  3C18 A;  4OIQ F;  4EM2 A;  3M8F A;  2HTS A;  3IWF A;  1FBS A;  3VB2 A;  2W85 A;  3V8L A;  3CO6 C;  4XSZ F;  2DK5 A;  2ESH A;  4XBF A;  1MDM A;  3Q5F A;  3K69 A;  2Y48 A;  2FBI A;  2HOE A;  4HA8 A;  5LGN A;  3BY6 A;  6PAX A;  2FEZ A;  1FBQ A;  1I5Z A;  3KP7 A;  4KA4 A;  3I5U A;  2O8X A;  5BPD A;  1SD5 A;  2Z33 A;  4RGS A;  4KMU X;  1FBU A;  1YS6 A;  1BJA A;  2QVO A;  1ONV A;  1SD7 A;  1B9M A;  2L54 A;  1IZ1 A;  1I1G A;  3T0Y A;  4IJA A;  2VOP A;  2A5Y B;  1OYY A;  2R7D A;  3I4P A;  4EJU A;  4EMS A;  3B02 A;  3NQO A;  1K6O A;  2FE3 A;  1XCB A;  2FMY A;  3SFZ A;  2X0L A;  4U0W A;  4HQM A;  3GFJ A;  3HTS B;  1ZG3 A;  2DW4 A;  2P4W A;  4MEY F;  4HW0 A;  4RB3 C;  1MJA A;  4M74 A;  1ODD A;  3P9C A;  2CSO A;  5LHG A;  2IA2 A;  4LFU A;  3K9T A;  1U5T C;  4PCQ A;  4OIP F;  3BOQ A;  4M71 A;  3LQQ A;  4G94 A;  2UXN A;  4MQ9 F;  3F21 A;  5DUI A;  4CZZ A;  2IP2 A;  2VN2 A;  2LKP A;  4IRH A;  5TJJ A;  3WTS C;  1R1T A;  4UV9 A;  4YFN F;  1OPC A;  4G8X A;  1FP1 D;  5L3D A;  4Q48 A;  1NHA A;  2NAZ A;  3TDZ C;  4CYD A;  4ZH4 F;  4NHJ A;  2YX4 A;  4EJT A;  2PJP A;  2EJR A;  3KP4 A;  1R5H A;  3H3U A;  1G3T A;  4N0B A;  1KU9 A;  1ZAR A;  3QP6 A;  3M7G A;  3L7W A;  5E8I A;  5F6F A;  4HQE A;  1CF7 B;  3TGN A;  3U2R A;  5EEG A;  4M73 A;  3QRF F;  3JAM K;  1TQM A;  2OZU A;  1UHW A;  5LGT A;  1CGP A;  5D6E A;  2BYV E;  5FD6 A;  1XSX A;  2G7H A;  2VC1 A;  2KIM A;  4MNU A;  1KYW A;  2KJB A;  3R0A A;  4GGG A;  5A2Q Z;  1ZG5 A;  5D5X B;  3I0T A;  4LB6 B;  4A12 A;  4L5I A;  1K7A A;  3KLO A;  2GXB A;  5HS7 A;  1DUX C;  1S8N A;  3GWZ A;  1YLF A;  1UHM A;  1I27 A;  5DCF A;  2IW5 A;  2Z99 A;  1FP2 A;  5CLS A;  5CJ9 A;  1MJB A;  4G6D A;  3DXJ F;  3HOT A;  3H3Z A;  2NS0 A;  5E1X A;  5FLX K;  3IWZ A;  4KIF A;  3WE3 A;  3KLN A;  1GHC A;  1DDN A;  5LHH A;  2GWR A;  2QBY B;  3J81 Z;  4FX0 A;  3J7A O;  4M6X A;  3IRQ A;  3EYI A;  2A07 F;  3HOS A;  4U7B A;  1IAW A;  3I59 A;  3SHF A;  5D6F A;  1LJ9 A;  1WQ2 A;  3HSR A;  4KIG A;  5DDG A;  2XAS A;  2Q2E A;  3OV8 A;  2DQL A;  1KU7 A;  1G4D A;  3HSF A;  4PGH A;  3TQN A;  2WWY A;  1MKM A;  2F5D A;  1FNN A;  2BEO A;  1HSJ A;  2WC2 A;  4QWQ A;  2ZO4 A;  1LDJ A;  3FMQ A;  4CIC A;  5LGU A;  5L3B A;  2R7F A;  3VOE A;  1U78 A;  5DUK A;  3EQL F;  1SAX A;  1O7L A;  5KK1 A;  2L3D A;  2XUB A;  4B8X A;  4XSX F;  3CUQ A;  1O7F A;  3F8F A;  1Z1D A;  3D5L A;  3SZP A;  4HX4 A;  1HKS A;  5ICG A;  3FMR A;  2E1C A;  4LG0 B;  4P9U A;  4Q5S F;  2HKX A;  1GXP A;  2HZT A;  2P5V A;  2FF4 A;  1Z6T A;  4I0A A;  2Z5U A;  4BHB A;  3ABU A;  1KA8 A;  2MA3 A;  3WTY C;  1YG2 A;  4JK1 X;  1U8R A;  2HS5 A;  5FFX A;  1D8J A;  4AWX B;  1YO5 C;  1ULY A;  3DFG A;  1V3F A;  5CVV A;  3BPX A;  3J80 Z;  1ON1 A;  2KJC A;  5A2Q K;  2D2W A;  4WWC A;  3CDH A;  4BQA A;  3DV8 A;  1XMA A;  3ML6 A;  4HX7 A;  1TQP A;  3E6D A;  1FT9 A;  2GQQ A;  3GFI A;  3RKW A;  2JSC A;  1GXQ A;  2A6E F;  4HDV A;  2IRF G;  3ZMU A;  3RPQ A;  2C6Y A;  2DI3 A;  3BJA A;  2OQR A;  2JPB A;  3DPT A;  2H09 A;  2E7W A;  3QU6 A;  4HDU A;  3J81 K;  3I53 A;  3ZP5 A;  3JTH A;  3HHG A;  2ZXJ A;  5DCM A;  1ZLK A;  4WXH A;  3H92 A;  1IUY A;  1G3S A;  4BNC A;  1SD4 A;  1ZYR F;  1J5Y A;  2TDX A;  4AD9 A;  1IN4 A;  1XDS A;  2EA2 A;  1BC8 C;  3F8B A;  1P92 A;  3DP7 A;  4YG2 F;  5ILV A;  2DAO A;  5ILS A;  2M45 A;  3R6S A;  2ZNY A;  1Y0U A;  5LEK A;  2STW A;  2H6B A;  5BMZ A;  2BBY A;  3GUD A;  3KP3 A;  2XGX A;  4I7H A;  2XRN A;  3TDU C;  2JZY A;  2VXZ A;  1J75 A;  2MBF A;  2RC4 A;  2M5W A;  2LF8 A;  1HKQ A;  1P4A A;  4D0P A;  2FNA A;  2DBB A;  2DK8 A;  1S3J A;  4RAY A;  1IF1 A;  1H9T A;  3IHU A;  2XKO A;  4IPA A;  2PN6 A;  3F8N A;  5HOO A;  1FSH A;  4E70 A;  1ZLJ A;  2LSO A;  1T38 A;  2FA5 A;  3P7N A;  1T39 A;  1W7P B;  4G7O F;  1I1S A;  2V6C A;  5HDN A;  3TO9 A;  5ED4 A;  2QLZ A;  3WU0 A;  1U5T A;  3AAF A;  4P5O A;  4MTE A;  3ERE D;  2W25 A;  4N9H A;  1D3Y A;  4L9T A;  4UUV A;  3QPH A;  2VT3 A;  2EV5 A;  2FBH A;  3WTW C;  3CUQ C;  4I02 A;  1F5T A;  1EH8 A;  4I2O A;  3WTX C;  4OMZ A;  2RVC A;  3ZMZ A;  1XGM A;  3EUH A;  3LST A;  2VC0 A;  2G9W A;  1XD7 A;  4OIR F;  1HW5 A;  2YPR A;  2MD5 A;  2QQ9 A;  2ESN A;  4EV0 A;  4LK1 F;  3IC7 A;  3ZQ7 A;  3FXR A;  1KQ8 A;  1IW7 F;  2HEO A;  2STT A;  2K7L A;  1ZRC A;  3WU1 B;  3FXU A;  4LB5 A;  1IRF A;  3ZN0 A;  4CXF A;  3SQN A;  1XGS A;  2J5P A;  3W6J B;  5BPI A;  4L5J A;  4LMY A;  1B6A A;  3RTR A;  2DTR A;  1FLI A;  2O3F A;  3ZPL A;  3K1M A;  2NYX A;  3MEX A;  3BRO A;  3ROU A;  1YW7 A;  2XKP A;  2HYG D;  5L3G A;  2VOO A;  5E8G A;  2MH9 A;  4BH9 A;  2XHK A;  4XRF A;  2BV6 A;  3LFK A;  1RIO H;  2EFO A;  4KMF A;  2V1U A;  3W6K B;  4GYG A;  3P9K A;  4H0E A;  4Y15 A;  2P7C B;  3KE2 A;  3NRV A;  1W4M A;  3GW2 A;  4GO1 A;  4G7H F;  3JAM Z;  3PQK A;  5EEH A;  2H27 A;  4AIK A;  2B0L A;  2V79 A;  4L0Z B;  4ZZL A;  3QPT A;  1R1V A;  4O3M A;  1K78 A;  3E5X A;  1FY7 A;  1FX7 A;  5HDK A;  1ZH5 A;  2PEX A;  1ZAO A;  3O3K A;  2PMU A;  4IXA A;  1HW1 A;  4LLG F;  3G3Z A;  5FO5 A;  3BP8 A;  2CFX A;  3KEQ A;  1LEB A;  2E7X A;  3M9A A;  4KYW A;  5FLX Z;  3C7J A;  5D8L B;  1JGS A;  5FB2 A;  3MZY A;  1OYI A;  1BIA A;  2W57 A;  2L4A A;  3U9G A;  2OD5 A;  3HUG A;  1R5G A;  3F23 A;  1B59 A;  4ZYD A;  3M8E A;  1Z6R A;  1LQ1 A;  2VOD A;  5D5U B;  3V8K A;  1SFX A;  1ON2 A;  2J5O A;  3Q9S A;  1Z7U A;  2GZW A;  3IKT A;  2P5K A;  1P4W A;  5CVJ A;  5ICE A;  4P9F A;  2FU4 A;  1OR7 A;  4EJW A;  2QM3 A;  1BI1 A;  3RKX A;  1W5T A;  3P9I A;  4HYE A;  2F5C A;  1QZZ A;  3FHZ A;  4HF2 A;  3O6B B;  4HOB A;  2IA1 A;  1SFE A;  2KKO A;  3FXQ A;  1U6G A;  2A6H F;  3V7S A;  3K2Z A;  4M9S A;  3T5X A;  2DPU A;  3ZMD A;  1QPM A;  2QWW A;  1QNT A;  2HTJ A;  4HLX A;  4GYI A;  5AON A;  1R36 A;  3LAP A;  1LDD A;  3I59 B;  3WTV C;  2NRA C;  1HW2 A;  4A6E A;  1YS7 A;  4AIJ A;  4IF4 A;  1B4A A;  2LF7 A;  3HYI A;  2CQK A;  3HHH A;  1YQA A;  1J2X A;  1X3U A;  1XMK A;  3GFL A;  2ZNZ A;  3WGI A;  4EJO A;  5ERI A;  2VBZ A;  4LLL A;  1QQI A;  2XIG A;  2XAG A;  1Z05 A;  1G6N A;  3WGG A;  4EM1 A;  5ICF A;  1REP C;  3QOP A;  4R8H A;  3V7R A;  5LRS A;  2CW0 F;  1XGN A;  3CUQ B;  1RUN A;  2V1X A;  2DU9 A;  3QAH A;  5DV5 A;  2OQG A;  1U3E M;  1LNW A;  4A5N A;  1TBX A;  1PP7 U;  3TO6 A;  3FWE A;  3GYH X;  3QP5 A;  1R7J A;  2M8E A;  5DD4 A;  1XDU A;  2VBY A;  3E6M A;  2IJL A;  1TQI A;  4R79 A;  1HBX G;  2FRH A;  2MLG A;  4CO8 A;  1WWX A;  2Y0M A;  5BOX A;  5LLQ A;  1UFM A;  4Q4Z F;  3FM3 A;  1IN6 A;  5HLG A;  2ZME A;  2LDU A;  4P55 A;  2Q8K A;  1IN8 A;  3CLO A;  3OOP A;  3GZ6 A;  5LHI A;  5L3C A;  1FOK A;  3M1E A;  1VTN C;  3ELK A;  4HAM A;  1IXR C;  4XLP F;  5D4S A;  2DQR A;  3MZH A;  3C3W A;  5IT9 K;  3L00 A;  2ETH A;  3RYP A;  2L02 A;  1TW3 A;  1R22 A;  5ICC A;  1TNT A;  1IN7 A;  2QQB A;  5DCM B;  4IVN A;  3MWM A;  3RI4 A;  4RS8 A;  2OAZ A;  5DYM A;  4NB5 A;  4L9J A;  3S2W A;  4GCV A;  2L01 A;  3NEU A;  1DPU A;  4A6D A;  5CVR A;  2PI0 A;  4RGU A;  1UB9 A;  1W5S A;  3F22 A;  2NNN A;  5F64 A;  1J9I A;  2K02 A;  4KT5 C;  1W7P D;  4WXC A;  5HLI A;  1SMT A;  1J7K A;  3KZZ A;  1S29 A;  3ZMS A;  1U2W A;  4M72 A;  4L9N A;  5JI6 A;  4EJV A;  3KP5 A;  4BAY A;  1BM9 A;  4P96 A;  1FYL A;  3FX3 A;  5J8C A;  1EV7 A;  1ZHF A;  4A5M A;  2XAH A;  4XLN F;  3WTZ A;  3F3X A;  4WF2 A;  5HS9 A;  2CYY A;  4RGR A;  2IVM A;  1OMI A;  1P2F A;  4FHT A;  4KUM A;  3JSP A;  4N9I A;  4ESF A;  4OU0 A;  1Q1H A;  4ON0 A;  5CVI A;  1E17 A;  1YIO A;  4ENM A;  1FPQ A;  2Y75 A;  1U5T B;  1QBJ A;  4I98 B;  3WTT C;  2GA2 A;  3WGH A;  4MTD A;  3KET A;  3E5U A;  4WCG A;  4ZYE A;  3PQJ A;  1YW9 A;  4O5V A;  1O3R A;  2VBX A;  2DLL A;  5K5Q A;  5HDG A;  3BJ6 A;  4U88 A;  3IRR A;  2X4H A;  1TNS A;  2EV0 A;  3RIR A;  2JPC A;  5CVU A;  4UHT A;  2XRO A;  1EH7 A;  4YII A;  4G9Y A;  5ILU A;  1BIB A;  2ISZ A;  5H20 A;  2RN7 A;  1BOA A;  2IPQ X;  3HRT A;  1J59 A;  1LEA A;  4LLN A;  1ZGJ A;  1ZG1 A;  2OA4 A;  2RKH A;  2OU2 A;  4RB1 A;  5HLH A;  1R23 A;  3BZ6 A;  5LEJ A;  5DEQ A;  3D0S A;  3I58 A;  3LQR A;  3QU3 A;  2V9V A;  3WTU C;  2F5F A;  3MQ0 A;  3CJN A;  4L18 B;  1T98 A;  1KU2 A;  5JHU A;  2EFP A;  2EFN A;  4LK0 F;  4A0X A;  2BE5 F;  3L2C A;  2MH2 A;  2QEN A;  3GZ5 A;  3E3V A;  3I54 A;  2VON A;  4HF0 A;  4MGR A;  2BGC A;  3K1P A;  3K0L A;  5F1R A;  3KEO A;  1PDN C;  1UCR A;  3R4K A;  2QQA A;  1S6L A;  2HQR A;  4Z2Y A;  3MFK A;  4EVI A;  3GLX A;  1FYM A;  5DD8 A;  1KQ9 A;  2O61 A;  4RAZ A;  2ZKZ A;  5J6X A;  4HV6 A;  1C0W A;  3CO7 C;  1FWZ A;  2H6C A;  5FD5 A;  1SD6 A;  3RDI A;  1BN5 A;  4ZYH A;  3V4G A;  3JW4 A;  2FOK A;  3SXY A;  2KIU A;  3R0J A;  3BWG A;  5HS8 A;  2XAF A;  3WG9 A;  1T0F A;  3ABT A;  1BC7 C;  3DEU A;  1S7A A;  1XN7 A;  2MLK A;  4WXD A;  4BHP A;  1XSV A;  1K78 B;  4WK8 F;  2EFQ A;  1RI7 A;  3FMS A;  1MD0 A;  2AS5 F;  1K79 A;  2DO7 A;  2QYO A;  1E2X A;  2ISY A;  2UXX A;  4K2E A;  4HBL A;  2V1D A;  1J0R A;  4L0Y B;  4FT8 A;  4ASN A;  2F2E A;  3TOB A;  4NQW A;  1FC3 A;  3KCC A;  1MJ9 A;  5L3F A;  2D45 A;  4LGW A;  2FNP A;  4DNC A;  4M6Y A;  3F8M A;  1L3L A;  3LWF A;  2XVC A;  3GVA A;  2VE9 A;  4ESJ A;  1LDK B;  3U1D A;  2IT0 A;  1D5V A;  3DQV C;  1YW8 A;  2EFW A;  2DFI A;  1S7O A;  4ETS A;  5BS6 A;  3DPL C;  2PG4 A;  4IHS A;  3HRM A;  1OKR A;  4YIF A;  1FZP B;  2VBW A;  4OIN F;  3KFW X;  3BPV A;  1O3T A;  2DPD A;  4RB2 C;  4U0V A;  2KRF A;  4LJZ F;  2VE8 A;  2RV8 A;  4KN7 X;  3COA C;  4G6Q A;  4KDP A;  2P6S A;  4PDK A;  4HLY A;  3IL2 A;  3ECO A;  1AWC A;  1RNL A;  2XAQ A;  3IKV A;  1TLH B;  4UNO A;  4AVP A;  1XGO A;  5BQT A;  2QZ8 A;  3F6V A;  2RDP A;  3V8J A;  1H0M A;  1P6R A;  4MQV A;  4M9X A; 
#chains in the Genus database with same CATH topology
 5K5O A;  2E2H J;  4Q47 A;  4QTR A;  1QGP A;  1SAU A;  1ZN2 A;  2BHZ A;  2AXL A;  3H36 A;  1YTY A;  4UXN A;  3DKW A;  1S7E A;  1TW2 A;  4M3D A;  1BI0 A;  2HQ5 A;  3JTG A;  3REO A;  2QGU A;  4PZJ A;  1J09 A;  2K40 A;  3PIO F;  4N4O B;  2K86 A;  5E3L A;  4EGZ A;  2XF6 A;  3H9Q A;  3R61 A;  3R60 A;  2O0Y A;  1AU7 A;  3OYF A;  4UVB A;  2OJE D;  2GIV A;  2RQP A;  1IXS B;  2R7Q A;  4DQ2 A;  3I71 A;  3S32 A;  3K4L A;  4BBR J;  5HVQ C;  1MMN A;  5FFZ A;  1ZK8 A;  3K6G A;  1QU3 A;  3LA3 A;  3CDL A;  1NG7 A;  3GO5 A;  2KIF A;  4WX9 A;  4BAC A;  1H9G A;  1RET A;  3ZCO A;  2HDC A;  4CCK A;  2X6Y A;  2TCT A;  2QF7 A;  2VUM J;  5IT9 Z;  2WV0 A;  3DKY A;  2LNB A;  3FKJ A;  2D5V A;  3S15 J;  2FML A;  5FRN A;  3OS0 A;  3AL0 C;  4UV8 A;  2CG4 A;  5L3E A;  3K1N A;  2V6E A;  1T0F C;  3KP2 A;  4A0Z A;  1R00 A;  4MFE A;  1MZB A;  3LL7 A;  5M5Y J;  5JHF A;  4HPQ A;  1YI2 I;  1R4N B;  2WBM A;  3BCB A;  4E7Z A;  1U8B A;  2JRM A;  1VQM I;  3IUO A;  4IHT A;  3CP2 A;  1LVK A;  2F5E A;  2WAF A;  2P7V B;  4AIH A;  4DYC A;  2DA4 A;  3RPU A;  4DYR A;  1B1B A;  2HR3 A;  5D5V B;  4TV7 A;  1R58 A;  2PJR A;  2A61 A;  5E79 C;  2BW3 B;  1HQC A;  4UVA A;  1KYZ A;  3VOD A;  3OYH A;  4A3I J;  2ZBK A;  3F72 A;  1JHH A;  4A2U A;  1AOY A;  3HG9 A;  3TO7 A;  1QZY A;  1KU3 A;  1CF7 A;  4XOR A;  2FXA A;  3FIW A;  3WE2 A;  2DA5 A;  2CO5 A;  2HZD A;  2OZ6 A;  1OYW A;  2D1H A;  2V4J C;  2HWV A;  3ZR8 X;  1L0O C;  1YIJ I;  1F43 A;  3I55 I;  2HVQ A;  2ECB A;  4B4C A;  5FRO A;  2R0Q C;  2R7V A;  4HSR A;  4OMY A;  2M1B A;  3V7C A;  2UZK A;  2NS7 A;  4IOC F;  2ZME B;  1N78 A;  1KQ0 A;  1Z9C A;  3QWL A;  4FET A;  2P8T A;  1O57 A;  5IYD J;  2RGV A;  1RUO A;  4RM2 A;  1O3S A;  3PFY A;  4CCN A;  3CUO A;  4R1H A;  4QLC U;  3S3O A;  1HLV A;  4BY1 J;  3G1M A;  5EGO A;  1T08 B;  1EH6 A;  1MGT A;  2QA4 I;  3ZMV A;  3HM5 A;  2RNG A;  3SZT A;  2CUZ A;  2N8G A;  3CJR B;  3TKY A;  1WJB A;  1WRJ A;  5LBQ A;  1MND A;  4M6V A;  2EWN A;  3N4M A;  2CW7 A;  3K4N A;  1EJ9 A;  2B63 J;  4MEX F;  4G7Z F;  1DP7 P;  3E6C C;  1R1U A;  2HOA A;  2X9D A;  4L9V A;  1PP8 F;  5D8K B;  2Y69 H;  2OBP A;  3C2B A;  4I99 C;  1T2K A;  1QZE A;  1IXC A;  2XV4 S;  1PUE E;  3EET A;  3KZI C;  4NC7 A;  1MMA A;  2DOD A;  3MD2 A;  2PMH A;  3ZMT A;  3GTO J;  4ZJZ A;  2YSR A;  2HYJ A;  3I64 A;  1ZRD A;  1USS A;  2LBF A;  2W84 A;  3PSI A;  3RCO A;  4YFX F;  2FD5 A;  4A0Y A;  2CGP A;  3PM1 A;  5KVR A;  2R3S A;  4IQJ A;  5IT3 A;  2LD5 A;  2K27 A;  1WJC A;  4XN3 A;  1FYK A;  2M4G A;  5EG0 B;  1ZRF A;  3LSG A;  3OSG A;  4ZDO A;  3DBR B;  5AIQ A;  2ZC2 A;  4S05 A;  1TWA J;  4S0H B;  2NVQ J;  2QBY A;  2PQ8 A;  3AKZ A;  3I9V 2;  3LAJ A;  2JT1 A;  5E1Z B;  3LSP A;  3VEP A;  3H0D A;  4B48 A;  2JSP A;  1TTY A;  2IA0 A;  2UWM A;  4IL6 C;  2VI6 A;  4RGX A;  2D1V A;  2YUS A;  3BJO A;  1BI3 A;  1XSD A;  1WI9 A;  1B9N A;  1YFH A;  3DBL B;  3FZV A;  2H8R A;  4XN0 A;  4I09 A;  4UVC A;  3L2U A;  2K9M A;  2JA6 J;  1KZH A;  4LD5 A;  2DT5 A;  3L09 A;  4IRI A;  1IN5 A;  2HPI A;  4CA0 A;  3BZC A;  2EV6 A;  3LSH A;  2JA8 J;  4XLA A;  5K1Y A;  3UKG A;  1BBY A;  5E1W A;  5K5R A;  4A3F J;  3G1L A;  4ABZ A;  1JE8 A;  1OCT C;  4KFC A;  1XB4 A;  1E3P A;  3RZO J;  3O2P E;  2BY0 A;  1SC7 A;  2VQG A;  1G3W A;  4YEJ A;  2W82 A;  3L2R A;  1ZGA A;  2RNJ A;  2M8G X;  4CSW A;  4ENN A;  3LSI A;  1YJW I;  2HYF A;  4F3Q A;  2M7B A;  2GA1 A;  3LA7 A;  2KDO A;  3EYY A;  3ZQF A;  5JR3 A;  3HRS A;  5JVT A;  2P5L C;  3SEQ A;  4RA2 A;  1VND A;  2R5Z A;  1SFO J;  4E4H A;  1WSU A;  3PJR A;  2CS3 A;  1QVU A;  4KIC A;  3BTL A;  4CCM A;  3MCZ A;  1IRZ A;  2HKO A;  5J1Y A;  5D4R A;  1W5C C;  1KGS A;  4Y13 A;  2LY2 A;  1Y56 A;  1FSE A;  3A03 A;  2O03 A;  3GFM A;  3GF2 A;  3HIF A;  3S2D J;  2EBI A;  3KP6 A;  3N97 A;  3K4J A;  2GBY A;  4I0B A;  2EIJ H;  2CW8 A;  2LP0 A;  2CU7 A;  2MC3 A;  4LG0 A;  3PFI A;  3VFZ A;  3KIO A;  4N4N B;  4UUS A;  2Y2Z A;  3RYR A;  3S1N J;  3C2G A;  3LOC A;  5J3L A;  4ENJ A;  2HFH A;  3F6O A;  2JVH A;  4KIB A;  2K9L A;  1MW7 A;  4C3J J;  3QYE A;  5KNL A;  3M4O J;  4RB0 A;  4GXO A;  1YRN A;  1V5F A;  2KIQ A;  3WOD F;  2EZI A;  5CYV A;  3HOV J;  1WJD A;  1BI2 A;  2QSF X;  3BR1 A;  5H6Q A;  2HGC A;  1RZ4 A;  1XCV A;  2JTV A;  3BTI A;  3E5Q A;  2HDW A;  5B3S H;  2K85 A;  1DGW Y;  4BDZ A;  3RKY A;  1K61 A;  4ZZD A;  2H94 A;  5B5E C;  2L7Z A;  2ELH A;  1Z0X A;  5IP7 J;  3S2H J;  4B47 A;  2WAD A;  2O5R A;  4A69 C;  1Z91 A;  3HTU A;  1WKM A;  4CCJ A;  2LY9 A;  3HOY J;  1JHF A;  2EZK A;  4HF1 A;  4CYC A;  3SEZ A;  4BHC A;  3ZQI A;  1BR1 A;  3FKI J;  3L9F A;  4BYY A;  3GZN B;  3HKZ A;  2O6G E;  2W24 A;  4CGZ A;  1GV5 A;  1SMY F;  3KPH A;  5J8F A;  3S3M A;  3H35 A;  1O3Q A;  3FM5 A;  2GXG A;  3MN2 A;  2ZJ2 A;  2EH3 A;  3KEY A;  1UG0 A;  4W1U A;  2IS6 A;  3CCV I;  3GEZ A;  1A04 A;  5D5W B;  1LB2 A;  1F1Z A;  4PSW A;  1WH5 A;  3GXO A;  2OCC H;  1H89 C;  4BQN A;  3F0C A;  5J1U A;  1FOY A;  2DMQ A;  3WHB A;  4FX4 A;  2VT2 A;  3RJP A;  3FBN B;  3GME A;  2NNY A;  5IYC J;  4ANJ A;  2K4B A;  3LA2 A;  3W2V A;  4BQO A;  3IAM 2;  2LG4 A;  1GT0 C;  3SFI A;  3VYR B;  3G73 A;  2EZL A;  2DOE A;  1HST A;  3K4K A;  2PLY A;  1STZ A;  4HNV A;  2FSW A;  4ENK A;  4CHU A;  1P7J A;  2XAJ A;  2PBI A;  2EK5 A;  5GAD J;  1IRG A;  4EGY A;  3ECH A;  3S8P A;  2XSJ C;  4HNT A;  3KZY A;  2ZSI B;  3EDP A;  2OCE A;  3ULQ B;  4ZC3 A;  1F9N A;  4ESB A;  2E1N A;  3MMY B;  4PUS A;  4PJ0 C;  4DOZ A;  3DTI A;  2CWE A;  1YYV A;  2EA4 A;  4HZF A;  1T6S A;  2Z3Y A;  1JT0 A;  4BXU A;  3ERM A;  3HRU A;  3Q9V A;  2DMU A;  1DPR A;  1MBF A;  5AIP A;  2GAU A;  3ISP A;  2Q0O A;  2VAS A;  4CH7 A;  1RPW A;  4EM0 B;  2A6T A;  4BE1 A;  2JA7 J;  4ZYA A;  3J80 K;  3T8R A;  2Z16 A;  2GM4 A;  5H2F C;  5E17 F;  1WPK A;  1HKT A;  5DM6 F;  2XSD C;  5B1A H;  4HV5 A;  2P6T A;  2FQ3 A;  4U7D A;  4HX8 A;  2LTP A;  4S04 A;  1GVJ A;  4MHG A;  1IG7 A;  3SJM A;  1JXS A;  2V9K A;  2L4M A;  5F27 A;  4CDG A;  1BL0 A;  4M9Z A;  4MLO A;  4RDU A;  3SZG A;  3GLL A;  2AQE A;  2O9L A;  2G0E A;  3F8C A;  1LVA A;  3S1R J;  4F7Z A;  2Z9O A;  4CCL A;  5FLV A;  3AL0 B;  5J4V A;  2YU3 A;  3J7Z I;  5LRR A;  3E97 A;  4EAT A;  2VKV A;  2EQR A;  1TT0 A;  4P1W A;  2GLO A;  5B66 C;  4KNY A;  1Z3Y A;  1HXD A;  3NWT A;  4Y17 A;  2ZCW A;  2IGO A;  1D8K A;  2Y0S A;  1I6X A;  4O6J A;  2YR2 A;  3BDD A;  2ZFW A;  5H6R A;  3MAJ A;  1I3Q J;  2HVS A;  2ZJQ F;  1UST A;  4PGG A;  3OYB A;  3C1D A;  3JSO A;  3S1Q J;  1W7P A;  2A69 F;  3FXO A;  4XLE A;  1D1A A;  1V4R A;  3E6B A;  4BJ5 C;  3GX4 X;  3TOA A;  1DU0 A;  3QYB A;  3GTQ J;  1TT5 B;  1YX3 A;  1LUJ B;  4IRG A;  2V26 A;  5E18 F;  4U0Y A;  3RKQ A;  2NVX J;  4X1E A;  2FBK A;  3BR0 A;  2VQC A;  1PVE A;  4JQF A;  2E60 A;  5FGM A;  4NUB A;  3B73 A;  1JTX A;  4YRV A;  2TRT A;  5TRD A;  1OFC X;  4JBA A;  1TL8 A;  5JFR A;  1SVO A;  2Y30 A;  4B09 A;  2WTE A;  4XLC A;  2QUF A;  4B44 A;  2Y9Y A;  3BG9 A;  5CKT A;  1F4K A;  4XLH A;  3HSE A;  3OYL A;  5E20 A;  2YX7 A;  1E0E A;  4NQW B;  2DMN A;  3DF8 A;  2H8W A;  1OCZ H;  1SFU A;  4OOI A;  3T8T A;  1JKP C;  2VIX A;  2FX0 A;  1MDM B;  3CTA A;  2COM A;  3BT9 A;  1HA8 A;  1G3Y A;  2A68 F;  2MAB A;  1OCR H;  2EB7 A;  2M30 A;  3ZGK A;  2K4J A;  2G7U A;  2L0K A;  4A3M J;  2BY1 A;  1P4X A;  1ZRE A;  2JRT A;  2ADU A;  2PFB A;  2ACJ A;  1V5G A;  2XB5 A;  2R7S A;  5GAE J;  2LRE A;  1GLN A;  3T1B A;  5J47 A;  4UUT A;  3TBI A;  4D7M A;  4EQQ A;  2H1L A;  2A3S A;  4OIO F;  2KLO A;  4BE2 A;  3ASN H;  4AVZ A;  4II2 A;  1QO0 D;  2M87 A;  4KN4 X;  4YFK F;  3ZN1 A;  4OAZ A;  4IKF A;  2MD0 A;  3BR6 A;  3GTK J;  4KIT B;  4I01 A;  3CCU I;  3FF5 A;  2HQN A;  3ZQC A;  4ZYG A;  3C18 A;  3DTE A;  1PYV A;  4OIQ F;  4EM2 A;  3M8F A;  2RAE A;  3D5R C;  5HNH A;  1RRJ A;  2KPM A;  2HTS A;  3CES A;  2UUZ A;  2NOJ B;  1FBS A;  3IWF A;  3VB2 A;  4Y52 J;  2W85 A;  3V8L A;  3CO6 C;  4XSZ F;  2DK5 A;  2ESH A;  2IS4 A;  2X6W A;  4XBF A;  1MDM A;  3Q5F A;  3K69 A;  2Y48 A;  2E2I J;  2FJ1 A;  1O4X A;  2FBI A;  1Y0N A;  4JX6 A;  1OJL A;  5KHD A;  2HOE A;  4HA8 A;  2QSH X;  5LGN A;  3BQZ A;  3CZ6 A;  3BY6 A;  6PAX A;  1D0X A;  2NVY J;  2FEZ A;  2HXI A;  1FBQ A;  1I5Z A;  3KP7 A;  2VJ5 A;  4KA4 A;  2XGC A;  2XGD A;  1ENH A;  3A0B C;  2BY2 A;  2W00 A;  3I5U A;  3S16 J;  2O8X A;  5BPD A;  1SD5 A;  2E1M B;  2Z33 A;  4RGS A;  4KMU X;  3VYU B;  1FBU A;  1YS6 A;  1BJA A;  2QVO A;  1ONV A;  1JGG A;  1SD7 A;  4RLQ A;  1B9M A;  2L54 A;  1IZ1 A;  1I1G A;  2BHY A;  2CMP A;  3T0Y A;  2LOO A;  4IJA A;  2CFO A;  3L2V A;  2E34 A;  4FE7 A;  2VOP A;  3KYD B;  2A5Y B;  1OYY A;  2R7D A;  2R7W A;  3I4P A;  3RZD J;  3O8H A;  4EJU A;  1VFC A;  5E3O A;  1JJ6 C;  2L7F P;  5EZG A;  4EMS A;  5K7F A;  2XGE A;  3GTG J;  3B02 A;  1Z67 A;  3NQO A;  1K6O A;  3W2A A;  2FE3 A;  1XCB A;  2FMY A;  3SFZ A;  3CCL I;  2X0L A;  1TZL A;  4U0W A;  4AU7 A;  4HQM A;  3GFJ A;  3W6V A;  1X1C A;  2M7A A;  3FXM A;  2EPF A;  4CCO A;  3HTS B;  1ZG3 A;  5JVG F;  2DOA A;  3HOX J;  2DW4 A;  2K5C A;  3G1O A;  2HXO A;  2P4W A;  1VQP I;  4MEY F;  2KMU A;  4HW0 A;  3JRE A;  4RB3 C;  2HOS A;  1MJA A;  2XDV A;  3OOU A;  3IP4 B;  4M74 A;  2R7T A;  4Y3O A;  1ODD A;  1EA3 A;  3ONQ A;  3P9C A;  4Y33 A;  2BVM A;  2CSO A;  5LHG A;  2IA2 A;  1WJE A;  1HOM A;  4LFU A;  2YS9 A;  5M3M J;  3K9T A;  1U5T C;  4PCQ A;  1D1B A;  4OWR B;  3B6A A;  4OIP F;  1BA5 A;  1MBH A;  3BOQ A;  3PL8 A;  3WHC A;  3DU5 A;  4M71 A;  4M3B A;  1IDY A;  3LQQ A;  2E36 A;  5K7H A;  2LY1 A;  4G94 A;  2UXN A;  4MQ9 F;  3F21 A;  1R6R A;  5DUI A;  1X2M A;  1FMW A;  4CZZ A;  4DBR A;  2IP2 A;  3OYN A;  2VKE A;  1DGR M;  2VN2 A;  2M2E A;  2LKP A;  4IRH A;  4ZTJ A;  5TJJ A;  3WTS C;  4BL0 B;  1R1T A;  4UV9 A;  1WCM J;  4YFN F;  1NTC A;  1OPC A;  4G8X A;  1FP1 D;  5L3D A;  3EUH C;  4Q48 A;  1NHA A;  2NAZ A;  2ZXW H;  2R7Z J;  3CCR I;  1ZTR A;  3TDZ C;  4CYD A;  4QPO A;  3FIS A;  1Y1W J;  4ZH4 F;  5FJ8 J;  4NHJ A;  4XRS A;  2LYC A;  2IBD A;  2YX4 A;  4EJT A;  4AID A;  2PJR B;  2PJP A;  3U1K A;  2EJR A;  3KP4 A;  1R5H A;  3H3U A;  1G3T A;  4BY7 J;  2DMP A;  4N0B A;  1KU9 A;  1ZAR A;  3TED A;  3QP6 A;  4B43 A;  3M7G A;  4QIW N;  3L7W A;  1XC5 A;  5E8I A;  5F6F A;  3Q3S A;  4HQE A;  1CF7 B;  3OYA A;  3TGN A;  3U2R A;  5EEG A;  3ZQG A;  1G59 A;  2ZJP F;  1OIS A;  4M73 A;  4C30 A;  1B72 A;  3QRF F;  3JAM K;  2DT7 B;  1TQM A;  2RRE A;  2OZU A;  2CV2 A;  4C9Y A;  1WJ5 A;  1UHW A;  1YE9 A;  5LGT A;  1CGP A;  5D6E A;  1WJF A;  3HGG A;  2BYV E;  5FD6 A;  1XSX A;  2G7H A;  2VC1 A;  2ME6 A;  4GDF A;  5FKO A;  1IC8 A;  4RM3 A;  2KIM A;  4MNU A;  1KYW A;  4A3L J;  2KJB A;  1E3H A;  3R0A A;  3DLL F;  4GGG A;  2Y9Z A;  5A2Q Z;  3SDG A;  4L5E A;  1ZG5 A;  5D5X B;  3I0T A;  4LB6 B;  5EGO B;  4A12 A;  4DIQ A;  2M9H A;  4L5I A;  1K7A A;  3KLO A;  2DA7 A;  5HS7 A;  2GXB A;  1DUX C;  1JUS A;  1S8N A;  1X1A A;  4CZC A;  1MSE C;  3GWZ A;  1YLF A;  4FTH A;  3GTL J;  2DFF A;  4XIC A;  2QKM B;  5CQE A;  1UHM A;  1I27 A;  4Y4R A;  5DCF A;  2IW5 A;  2Z99 A;  1FP2 A;  3VPR A;  5CLS A;  4PSX A;  5CJ9 A;  3TP3 A;  1G2H A;  1MJB A;  4G6D A;  3QOE A;  1LFU P;  5DS9 A;  3DXJ F;  2FQ4 A;  3ABM H;  1W36 D;  1LFB A;  3HOT A;  3H3Z A;  2E35 A;  2LBF B;  2NS0 A;  2VXD A;  3G4S I;  5E1X A;  4HRI A;  5FLX K;  3M07 A;  3IWZ A;  4KIF A;  3WE3 A;  1Y8R B;  3Q0U A;  3KLN A;  5LFA A;  2OV7 A;  1ETK A;  4BUP A;  1GHC A;  4X6A J;  1F36 A;  1DDN A;  5LHH A;  1RKW A;  2GWR A;  4KT6 A;  2QBY B;  3J81 Z;  4FX0 A;  2JA2 A;  3A1Y A;  3JRF A;  3J7A O;  4J00 A;  4ZDL A;  2OUM A;  4M6X A;  5IOY A;  3LMM A;  5CQG A;  4FE4 A;  4PJL A;  3IRQ A;  4BEH B;  4V19 K;  3EYI A;  3OWT A;  2A07 F;  3HOS A;  4U7B A;  1RES A;  1IAW A;  3I59 A;  3SHF A;  5D6F A;  1LJ9 A;  1WQ2 A;  2ELK A;  2JUC A;  2E19 A;  1UJ8 A;  3HSR A;  4KIG A;  5DDG A;  2XAS A;  2Q2E A;  3OV8 A;  1JUP A;  5IYB J;  2DQL A;  4XRS G;  3JRD A;  1E3O C;  1KU7 A;  1W1W E;  1AKH A;  1G4D A;  3HSF A;  2ID3 A;  4PGH A;  3TQN A;  2WWY A;  4XLF A;  1MKM A;  2F5D A;  1FNN A;  2BEO A;  3QOD A;  3QQA A;  1WHU A;  1HSJ A;  1POG A;  2WC2 A;  4QWQ A;  2ZO4 A;  3LSR A;  1S5L C;  1LDJ A;  2B7E A;  1I39 A;  2LKS A;  2X6O A;  2WAE A;  3OYJ A;  3FMQ A;  4CIC A;  5LGU A;  1MBG A;  2LH9 A;  4LIU A;  5L3B A;  2R5Z B;  2R7F A;  1W0U A;  2XPW A;  3A2K A;  3CJQ B;  3VOE A;  5DM7 F;  2VPL A;  1U78 A;  1YJN I;  1EKE A;  5DUK A;  3EQL F;  1SAX A;  3OL3 A;  1O7L A;  4BEH A;  5KK1 A;  2L3D A;  4NNJ A;  2XUB A;  1H88 C;  1RKT A;  2B9S A;  3FXJ A;  4B8X A;  4XSX F;  3CUQ A;  3HBL A;  1MMG A;  1O7F A;  3F8F A;  1Z1D A;  3D5L A;  3SZP A;  3U21 A;  4HX4 A;  1HKS A;  5ICG A;  2R7O A;  3FMR A;  5HNF A;  3AFH A;  2AXT C;  4XOP A;  2E1C A;  2JMW A;  4LG0 B;  4D5C A;  4P9U A;  4Q5S F;  2HKX A;  3JRB A;  4DZJ A;  1GXP A;  1VQ7 I;  2HZT A;  2P5V A;  4UUS B;  2FF4 A;  1PUF A;  3IH4 A;  3ASO H;  1Z6T A;  4I0A A;  2Z5U A;  3TW7 A;  1TC3 C;  3NWS A;  4DYQ A;  3DBH B;  2MGQ A;  4BHB A;  5IP9 J;  3ABU A;  3BG3 A;  1KA8 A;  2MA3 A;  3WTY C;  1Y6I A;  1YG2 A;  4JK1 X;  4D5F A;  2HS5 A;  5FFX A;  1U8R A;  1D8J A;  4AWX B;  3I56 I;  1YO5 C;  1ULY A;  1YRN B;  3DFG A;  3PO2 J;  2WY8 Q;  4MO7 A;  1V3F A;  1V55 H;  5BNG A;  4C2M J;  5CVV A;  3BPX A;  3KYC B;  3OYC A;  1FJL A;  3CDI A;  3J80 Z;  1ON1 A;  4E7K A;  2KJC A;  3CP8 A;  5A2Q K;  2D2W A;  1IO2 A;  4WWC A;  3CDH A;  1K4T A;  1BW6 A;  4BQA A;  3DV8 A;  1XMA A;  3GTJ J;  1HC8 A;  2YU9 J;  3ML6 A;  3VWB A;  4HX7 A;  3HJE A;  4FQG A;  3H9J A;  1SVL A;  1TQP A;  2ID6 A;  3CCS I;  4OAY A;  3BG6 A;  3E6D A;  1FT9 A;  2GQQ A;  3GFI A;  2CV1 A;  3RKW A;  2CUJ A;  2JSC A;  1OR7 C;  1GXQ A;  2A6E F;  4HDV A;  2IRF G;  3ZMU A;  4JX5 A;  4CYC B;  3RPQ A;  3GTP J;  2C6Y A;  4DBQ A;  1UHS A;  3S17 J;  3K4C A;  2E1O A;  5HLT A;  2DI3 A;  5F0F A;  1NH3 A;  2EIK H;  2L7M P;  2LR8 A;  1I6H J;  3S1M J;  2CQ7 A;  5FKK A;  4BE0 A;  3BJA A;  2OQR A;  4JX4 A;  2JPB A;  3S93 A;  4U87 A;  2K9N A;  1A6Q A;  3DPT A;  2H09 A;  1GVD A;  3RQ4 A;  9ANT A;  2E7W A;  3QU6 A;  2WB1 N;  4HDU A;  1V5E A;  4E7H A;  1XG1 A;  5EDN A;  3K2A A;  3LSK A;  4UB8 C;  4AUX A;  3F9K A;  3J81 K;  3I53 A;  4LIV A;  3ZP5 A;  3JTH A;  1WGX A;  2ZXJ A;  2X48 A;  3HHG A;  1IJW C;  1ZQ3 P;  5DCM A;  1ZLK A;  4A3C J;  4WXH A;  1U9N A;  2ICW G;  1MH4 A;  1A35 A;  5DTD A;  3H92 A;  3MKL A;  2VJJ A;  3UR3 C;  1G3S A;  3LFU A;  1IUY A;  4BNC A;  1SD4 A;  1ZYR F;  5IOZ A;  1J5Y A;  2TDX A;  4AD9 A;  3N05 A;  1IN4 A;  1XDS A;  2EA2 A;  1QHG A;  1BC8 C;  5EZH A;  3F8B A;  5J4Y A;  1VQO I;  1P92 A;  1DQU A;  3DP7 A;  3HPH A;  3J7Y J;  3ZQL A;  4YG2 F;  1VQN I;  5ILV A;  2DAO A;  5ILS A;  3A01 A;  1A36 A;  4XID A;  1K4S A;  2M45 A;  2P0W A;  3R6S A;  2ZNY A;  1Y0U A;  2GOM A;  5LEK A;  2STW A;  3SYT A;  2F48 A;  5B1B H;  4IZZ A;  2H6B A;  5BMZ A;  1QA6 A;  2BBY A;  3GUD A;  1IV6 A;  1XX5 A;  4E7I A;  3DCF A;  2L2O A;  5F04 A;  1GUU A;  3KP3 A;  3CMY A;  1X1D A;  3HXL A;  3JRA A;  2XGX A;  4I7H A;  2LMD A;  1YOV B;  2XRN A;  3TDU C;  2JZY A;  2VXZ A;  1J75 A;  4Z6Y A;  2BZT A;  2MBF A;  2RC4 A;  2M5W A;  2LF8 A;  5CPR B;  3ZOB A;  1HKQ A;  5FLM J;  2MSY A;  3HPG A;  3CCQ I;  1P4A A;  1U9O A;  4D0P A;  1ETY A;  2FNA A;  1JKQ C;  2DBB A;  3DKX A;  2E5N A;  2DK8 A;  1S3J A;  4RAY A;  4UY8 I;  2WV1 A;  1IF1 A;  1H9T A;  3IHU A;  1Z3X A;  2XKO A;  1QPI A;  1NK2 P;  4X0G A;  4IPA A;  2PN6 A;  2BOL A;  3F8N A;  4F55 A;  5TIS C;  5GTH C;  5HOO A;  3NAR A;  2OF7 A;  1QRY A;  1FSH A;  4E70 A;  1CQT A;  1FMV A;  1ZLJ A;  2E5Z A;  3HZJ A;  2LSO A;  1T38 A;  2FA5 A;  4PFO A;  2MYS A;  3P7N A;  3LSJ A;  3K7A J;  3ABK H;  1T39 A;  3OS2 A;  4A3B J;  1W7P B;  4G7O F;  1I1S A;  2V6C A;  5HDN A;  3TO9 A;  5ED4 A;  2QLZ A;  3WU0 A;  1U5T A;  2HOT A;  4J19 A;  1ZR4 A;  3AAF A;  1K83 J;  3VYS B;  4P5O A;  4MTE A;  2EZH A;  3EPZ A;  2HPM A;  2NVT J;  3ERE D;  4IHY A;  2W25 A;  3K10 A;  4ZDP A;  5IP6 A;  4PJN A;  4N9H A;  4IX7 A;  1D3Y A;  4L9T A;  4UUV A;  2ECC A;  3QPH A;  3CCM I;  2VT3 A;  2EV5 A;  1UG2 A;  2FBH A;  3WTW C;  3CUQ C;  4MFD A;  3H9G A;  4I02 A;  3FBI B;  1F5T A;  1EH8 A;  3NAU A;  4I2O A;  3WTX C;  1YIT I;  2FUG 2;  2ZFU A;  1D5Y A;  2HDD A;  3JCU C;  3QPS A;  3IV5 A;  4OMZ A;  2RVC A;  3L1P A;  1JKO C;  2VQL A;  2LKX A;  3ZMZ A;  1P9Q C;  1WVR A;  1XGM A;  3EUH A;  1S9H A;  3LST A;  3MKY B;  2QQ8 A;  2VC0 A;  2XF5 A;  2G9W A;  3FXK A;  1XD7 A;  2EIM H;  4BBS J;  4OIR F;  1HW5 A;  3OS1 A;  2YPR A;  2MD5 A;  1VQK I;  5K7Z A;  2QQ9 A;  2ESN A;  4EV0 A;  2DOF A;  4LK1 F;  3IC7 A;  3M8J A;  3ZQ7 A;  3FXR A;  1KQ8 A;  4D7N A;  3G71 I;  2VL8 A;  2ZXH A;  1IW7 F;  4BKX A;  2HEO A;  2K7L A;  3VSL A;  1ZGW A;  2STT A;  1DU6 A;  1ZRC A;  3WU1 B;  3FXU A;  5TGT A;  1R5I D;  4LB5 A;  2XC7 A;  1IRF A;  4IQ4 A;  3ZN0 A;  4CXF A;  3SQN A;  3PUB A;  1XGS A;  1JT6 A;  2J5P A;  3K4M A;  1R71 A;  4IHV A;  3RQI A;  3W6J B;  5BPI A;  2X85 A;  4L5J A;  3CD6 I;  4RAF A;  2CUE A;  1MBE A;  4LMY A;  4QPQ A;  1B6A A;  3UNG C;  3RTR A;  2DTR A;  2XB0 X;  1ACI A;  1FLI A;  2O3F A;  1ERD A;  2I5U A;  2L9R A;  1LE8 A;  3ZPL A;  4C2U A;  2AQF A;  3K1M A;  2NYX A;  4I6Z A;  3MEX A;  3IH2 A;  3BRO A;  3ROU A;  1YW7 A;  2BY3 A;  1A6I A;  4DW6 A;  2XKP A;  3ZQQ A;  1IDZ A;  2HYG D;  2VB6 A;  4YIR X;  5L3G A;  2VOO A;  5E8G A;  2MH9 A;  4BH9 A;  1Z77 A;  4IOA F;  2XHK A;  4XRF A;  1X58 A;  2BV6 A;  3LFK A;  2CV0 A;  4PFP A;  2XAU A;  5M3F J;  1RIO H;  2EFO A;  4KMF A;  2V1U A;  3B6C A;  2ZJR F;  3W6K B;  3CQZ J;  4GYG A;  2DDB A;  4ITV A;  1VQ8 I;  3P9K A;  1W36 C;  4H0E A;  2M0M A;  4Y15 A;  4RMN A;  5FKL A;  2P7C B;  3OYD A;  3A02 A;  3JRH A;  3A0H C;  2KT0 A;  3KE2 A;  4LG3 A;  2XRL A;  4IEJ A;  3O8G A;  2IXS A;  2L9N A;  3NRV A;  1FOX A;  1W4M A;  1MH3 A;  3KX2 A;  3GW2 A;  4GO1 A;  1IGN A;  2BXZ A;  4G7H F;  4AC0 A;  3JAM Z;  2JQ7 A;  3PQK A;  5EEH A;  4NC8 A;  2H27 A;  2X51 A;  4DJA A;  3OYE A;  3BC8 A;  4AIK A;  2GOX B;  2B0L A;  2V79 A;  3BR3 A;  4L0Z B;  2KZG A;  3HEF A;  4ZZL A;  1T95 A;  1MSF C;  2RQQ A;  3QPT A;  3OIQ A;  1ETO A;  1Y39 A;  1ETQ A;  3RSN A;  1R1V A;  4O3M A;  4J01 A;  1K78 A;  3Q0V A;  3E5X A;  1FY7 A;  1FX7 A;  5HDK A;  3WG7 H;  4XKW A;  1VI0 A;  1ZH5 A;  4C2T A;  3S14 J;  4BJT A;  2PEX A;  1ZAO A;  3O3K A;  2PMU A;  2HNH A;  3GBG A;  4IXA A;  3CMA I;  1XMX A;  1HW1 A;  4LLG F;  3G3Z A;  5FO5 A;  3BP8 A;  2AO9 A;  1D0Z A;  2DMT A;  3LNQ A;  2CFX A;  3KEQ A;  5EYR A;  1LEB A;  2E7X A;  3DPU A;  3BLY A;  3M9A A;  3SDB A;  1FTZ A;  4KYW A;  2EIN H;  3E1S A;  1VQ6 I;  5FLX Z;  3C7J A;  5D8L B;  3CME I;  1JGS A;  2JVG A;  3MKW B;  4M3F A;  5FB2 A;  4QSH A;  3MZY A;  1OYI A;  2DA3 A;  5F1J A;  1BIA A;  2W57 A;  1HCR A;  2GXA A;  2L4A A;  3OYM A;  2R5Y A;  3U9G A;  2OD5 A;  2XF7 A;  2X1D A;  1WI3 A;  3HUG A;  5IPA A;  1R5G A;  3D1N I;  3F23 A;  1B59 A;  1M1E B;  4ZYD A;  1SFK A;  3M8E A;  1FIP A;  2LRD A;  2JWT A;  2BVL A;  1Z6R A;  4B1R A;  1LQ1 A;  2VOD A;  4E7L A;  5D5U B;  3V8K A;  1SFX A;  1ON2 A;  5GPA A;  2J5O A;  3Q9S A;  1ZEL A;  4HNU A;  1Z7U A;  1X3Z B;  1G8X A;  2GZW A;  3M1C A;  1B72 B;  3IKT A;  2I10 A;  3IH3 A;  2P81 A;  1N75 A;  2P5K A;  4A3J J;  3K4B A;  1P4W A;  1LPQ A;  1P7I A;  4MIM A;  3I4N J;  1VZ0 A;  5CVJ A;  5ICE A;  4P9F A;  2F4M B;  2VQH A;  1EF4 A;  2ZSH B;  4KIS A;  1MBJ A;  2H1K A;  5FRM A;  4XNF A;  4D1Q A;  3FK7 A;  2FU4 A;  3S3N A;  1OR7 A;  3FDY A;  1FTT A;  3VSK A;  1ORK A;  4EJW A;  4V2F A;  2L7K A;  3GTM J;  1WH7 A;  2DTZ A;  2QM3 A;  1BI1 A;  3RKX A;  1XPX A;  1W5T A;  5JLX A;  2COB A;  2DYS H;  3P9I A;  4HYE A;  2F5C A;  3OSF A;  1QZZ A;  3FHZ A;  2E71 A;  4HF2 A;  3O6B B;  4HOB A;  4DGW B;  2IA1 A;  3OYI A;  1SFE A;  2KKO A;  3FXQ A;  2R7R A;  2DA6 A;  3K70 D;  1U6G A;  3IAS 2;  2QCO A;  2A6H F;  1X4P A;  3V7S A;  3K2Z A;  1I50 J;  2KDZ A;  3E0J B;  3H0G J;  4M9S A;  3T5X A;  3X2Q H;  3DEE A;  2DPU A;  3ZMD A;  5FKM A;  1QPM A;  4E6K G;  1A5J A;  2QWW A;  2OC6 A;  1ZR2 A;  2VJI A;  1R4M B;  1QNT A;  2CJJ A;  3VDX A;  3Q0W A;  1X1B A;  2HTJ A;  4HLX A;  4GYI A;  5AON A;  1R36 A;  1VF9 A;  3LAP A;  4I76 A;  1LDD A;  1FIA A;  3MVP A;  4BU2 A;  3I59 B;  4H4K C;  3WTV C;  2Q2E B;  2NRA C;  3CF2 A;  1HW2 A;  4A6E A;  2FOW A;  3CCY A;  1YS7 A;  4AIJ A;  1AA7 A;  3V42 A;  1AKH B;  2CUF A;  3TL4 X;  1WZ2 A;  4A3G J;  1AHD P;  4IF4 A;  1B4A A;  2LF7 A;  3HYI A;  2CQK A;  2A05 A;  3ZQH A;  3HHH A;  4E7S A;  1YQA A;  1J2X A;  2OTJ I;  1X3U A;  2F5V A;  1XMK A;  2W4S A;  2L9V A;  3GFL A;  2ZNZ A;  1OCC H;  2VKH A;  4D9J A;  4EJO A;  5ERI A;  2VBZ A;  3WGI A;  1T8I A;  4LLL A;  1LKX A;  2CQN A;  1QQI A;  2XIG A;  2XAG A;  3D5S C;  1Z05 A;  1G6N A;  2R93 J;  2QSG X;  3WGG A;  2X6X A;  4EM1 A;  2R7U A;  3QPL A;  5ICF A;  1REP C;  2DA1 A;  1SVM A;  3HL2 A;  3QOP A;  1N25 A;  2Y31 A;  4R8H A;  3V7R A;  1R49 A;  5LRS A;  4IO9 F;  3CC7 I;  2CW0 F;  1XGN A;  3CUQ B;  3JRG A;  1RUN A;  2V1X A;  2DU9 A;  3QAH A;  5DV5 A;  2OQG A;  1U3E M;  1LNW A;  1KON A;  3BG5 A;  4A5N A;  4BS9 A;  1TBX A;  2IEK A;  3TO6 A;  1PP7 U;  3HOW J;  2CH0 A;  1ZKG A;  5IY5 H;  3G2B A;  2HU9 A;  1RC9 A;  3FWE A;  1JI8 A;  3GYH X;  1BR4 A;  3ABL H;  3QP5 A;  1PUF B;  1R7J A;  2M8E A;  3CMM A;  4YEL A;  5DD4 A;  1XDU A;  2VBY A;  3E6M A;  3PO3 J;  2IJL A;  1TQI A;  3KYL A;  2BW3 A;  4PJM A;  4R79 A;  3J7A Y;  3MZ8 A;  2HQA A;  2M0C A;  1HBX G;  2ME0 A;  2Z1D A;  2FRH A;  5E3M A;  2KFD A;  2VJ4 A;  3PNV A;  4BXX J;  2MLG A;  4CO8 A;  3H5R A;  1WWX A;  1VQL I;  2Y0M A;  1K6Y A;  5BOX A;  3HOU J;  3GCM A;  5LLQ A;  2MG4 A;  3FHN A;  3EUK L;  1UFM A;  4FAS D;  4Q4Z F;  3H1C A;  3FM3 A;  1X3W B;  1IN6 A;  2M4K A;  1S72 I;  3OY9 A;  2WAQ N;  5HLG A;  2ZME A;  2LDU A;  4P55 A;  2Q8K A;  1IN8 A;  3CLO A;  3OOP A;  3GZ6 A;  5LHI A;  5L3C A;  2E1M C;  1FOK A;  3M1E A;  2XPU A;  2WAQ A;  1VTN C;  2DDA A;  1JTY A;  3ELK A;  4HAM A;  1IXR C;  3HC7 A;  1A31 A;  1SAN A;  4XKB A;  4XLP F;  5GAH J;  1B8I B;  3CLQ A;  2CRG A;  5D4S A;  5KCM A;  3CC4 I;  2DQR A;  3MZH A;  2PX9 A;  1YHQ I;  3C3W A;  5GAG J;  5IT9 K;  3L00 A;  2ETH A;  2JA5 J;  3RYP A;  2L02 A;  1TW3 A;  3E7L A;  1R22 A;  5ICC A;  1TNT A;  1IN7 A;  2QQB A;  1H8A C;  5C44 J;  5DCM B;  4IVN A;  2L9S A;  4C3I J;  3MWM A;  3RI4 A;  4BXF A;  3CJT B;  4RS8 A;  5C4X J;  2OAZ A;  5DYM A;  5EG0 A;  1JJ8 C;  1BOB A;  2MW8 A;  4NB5 A;  2OTL I;  4L9J A;  3S2W A;  4GCV A;  2L01 A;  2DA2 A;  1GV2 A;  1ETW A;  3NEU A;  1TP4 A;  1UZC A;  2LK2 A;  1DPU A;  2ZB9 A;  2KQR A;  2UV1 A;  4A6D A;  5CVR A;  3A01 B;  5F0H A;  2ZXI A;  3I3L A;  2PI0 A;  3L2Q A;  5F08 A;  1TWC J;  2DCE A;  2NOG A;  4RGU A;  1UB9 A;  1W5S A;  2NNN A;  5F64 A;  3F22 A;  1SEU A;  1B8I A;  1J9I A;  2K02 A;  4KT5 C;  1WJA A;  4A3E J;  1W7P D;  4WXC A;  1Z7L A;  2HI3 A;  3H5N A;  5HLI A;  1SMT A;  1J7K A;  3KZZ A;  3OR1 C;  1W0T A;  1S29 A;  3ZMS A;  1ETX A;  1U2W A;  4M3G A;  3AG4 H;  1TWH J;  4M72 A;  4L9N A;  5M5X J;  5JI6 A;  4FIS A;  3VYT B;  3HB9 A;  4EJV A;  2WB1 A;  1VQ5 I;  2K9Q A;  3A4C A;  5J1R A;  2KZV A;  3KP5 A;  4BAY A;  1TWG J;  3L2W A;  2F4I A;  1BM9 A;  4P96 A;  1FYL A;  3FX3 A;  5J8C A;  1ITY A;  4HG2 A;  1EV7 A;  1ZHF A;  4AYB N;  4A5M A;  2XAH A;  3DWL E;  2K3P A;  4XLN F;  5EJC A;  3WTZ A;  3F3X A;  3WU2 C;  3I4M J;  4WF2 A;  5HS9 A;  5EEA A;  3ZRG A;  2CYY A;  4RGR A;  2IVM A;  4XMY A;  3DTK A;  4AYB A;  3ESW B;  1OCP A;  5FKN A;  2M3A A;  1OMI A;  2W1O A;  1P2F A;  4FHT A;  4KUM A;  1X4O A;  1OQY A;  2LLK A;  3JSP A;  3H5A A;  3HKZ N;  1X1P A;  2AHQ A;  4N9I A;  4XQF A;  4ESF A;  4OU0 A;  4PJJ A;  3CCE I;  4NBQ A;  1Q1H A;  4ON0 A;  1MIJ A;  1UMQ A;  5CVI A;  1E17 A;  5GPC A;  1YIO A;  4ENM A;  2EIL H;  1FPQ A;  2Y75 A;  1U5T B;  1QBJ A;  2NXN B;  2VPR A;  4HST A;  4LOC A;  1MNE A;  2DN0 A;  4I98 B;  3WTT C;  3HOZ J;  2O8K A;  3CC2 I;  2GA2 A;  2JJ7 A;  3WGH A;  3OIO A;  3OL4 A;  4MTD A;  1LFP A;  3KET A;  1MMS A;  3E5U A;  1JKR C;  4A3K J;  4WCG A;  4ZYE A;  3PQJ A;  1YW9 A;  4O5V A;  1O3R A;  2VBX A;  1YX5 A;  2QEX I;  1MNM C;  2DLL A;  3PSF A;  3BQY A;  5K5Q A;  5HDG A;  3BJ6 A;  1WFX A;  4U88 A;  1FEX A;  3IRR A;  2X4H A;  1TNS A;  2EV0 A;  4RLF A;  3RIR A;  2JPC A;  5CVU A;  1Q1V A;  4F52 A;  4UHT A;  2XRO A;  1EH7 A;  4YII A;  4G9Y A;  5ILU A;  2JN6 A;  1BIB A;  2ISZ A;  5H20 A;  2RN7 A;  1UEL B;  4XKV A;  3FXL A;  5C3E J;  4RAG A;  5KAI C;  2Q1Z B;  1BOA A;  4NDL A;  3PNT A;  2IPQ X;  2NVU B;  4C3H J;  3HRT A;  1J59 A;  3DU6 A;  2HVR A;  1LEA A;  4F91 B;  4LLN A;  3AG3 H;  5HOD A;  1ZGJ A;  1ZG1 A;  2OA4 A;  2DJI A;  2RKH A;  2IS1 A;  2OU2 A;  2V1N A;  1GDT A;  4RB1 A;  2QKL B;  1R23 A;  3BZ6 A;  5HLH A;  1R9T J;  3BG7 A;  5LEJ A;  1N77 A;  3AG2 H;  5DEQ A;  4GRI A;  3D0S A;  2X1E A;  3I58 A;  3LQR A;  3BR2 A;  3QU3 A;  2V9V A;  2ELJ A;  3WTU C;  2F5F A;  2ZME C;  3MQ0 A;  5JLW A;  3CJN A;  2DFH A;  1BJZ A;  2BXY A;  4L18 B;  1T98 A;  3TMO A;  1KU2 A;  3FK6 A;  1YJ9 I;  2EFP A;  2KP6 A;  2EFN A;  2GIZ A;  3BCA A;  4LK0 F;  5JHU A;  4A0X A;  4GFB A;  1HDP A;  2K3F A;  1MMD A;  4IHX A;  2BE5 F;  3OMY A;  3L2C A;  2MH2 A;  1LE8 B;  2QEN A;  3GZ5 A;  3E3V A;  4CUG A;  4E7J A;  3I54 A;  2VON A;  4HF0 A;  4II3 A;  3JRI A;  3DEW A;  1IUF A;  4MGR A;  2CQX A;  2BGC A;  3K1P A;  4G12 A;  4BJ6 C;  1IV8 A;  3K0L A;  5F1R A;  2Y0S N;  3MKZ A;  1BR2 A;  3OR2 C;  1RR7 A;  3KEO A;  5C4J J;  1PDN C;  1UCR A;  2XPV A;  3R4K A;  4XKC A;  1QHH D;  2QQA A;  1S6L A;  2HQR A;  4JOM A;  1PJR A;  4Z2Y A;  4EVI A;  3GLX A;  3MFK A;  1Y1V J;  1MBK A;  1FYM A;  5DD8 A;  4EEF G;  1XTA A;  4F92 B;  1KQ9 A;  2JUG A;  2O61 A;  4XON A;  4BQQ A;  1UAA A;  4RAZ A;  2ZKZ A;  2LC2 A;  1FOW A;  4G6T B;  5J6X A;  3K70 C;  4ZTF A;  4HV6 A;  1C0W A;  3CO7 C;  4NC6 A;  1FWZ A;  2H6C A;  5LD2 C;  2W7N A;  5FD5 A;  1SD6 A;  3RDI A;  3PIP F;  1OLT A;  2JK3 A;  4KJZ A;  2PMZ N;  2A5W A;  1BN5 A;  4ZYH A;  1RR8 C;  2DJN A;  3V4G A;  3DLA A;  4BGD A;  2K9S A;  3JW4 A;  2FOK A;  3SXY A;  2KIU A;  3OIP A;  3R0J A;  2PMZ A;  1X2N A;  3BWG A;  5HS8 A;  1APL C;  4RBO A;  2XAF A;  5F0C A;  3WG9 A;  1T0F A;  3ABT A;  1BC7 C;  3DEU A;  1S7A A;  1D0Y A;  1JUM A;  1XN7 A;  2MLK A;  4WXD A;  1XSV A;  2M34 A;  4W97 A;  4XOT A;  4BHP A;  1K78 B;  5GP9 A;  1T56 A;  1U0J A;  2IAI A;  4WK8 F;  2EFQ A;  2IS2 A;  1RI7 A;  4XR6 A;  3FMS A;  1VQ9 I;  2MFZ A;  1MD0 A;  2AS5 F;  4Y7N J;  1K79 A;  1X19 A;  1Y8Q B;  2F6C A;  2KHM A;  2DO7 A;  2QYO A;  3OYK A;  3C2H A;  3JRC A;  1E2X A;  2ISY A;  2Z2S B;  4DZP A;  5E3N A;  1VQ4 I;  2UXX A;  2KIS A;  3G6E I;  4UB6 C;  4K2E A;  4HBL A;  2V1D A;  1J0R A;  3LSM A;  2I8D A;  1V54 H;  4L0Y B;  2DYR H;  2VKD A;  4FT8 A;  3BTC A;  4ASN A;  2F2E A;  3TOB A;  3PUF A;  2L5Q A;  1DP3 A;  3BTJ A;  4NQW A;  1FC3 A;  2MC4 A;  3KCC A;  1MJ9 A;  5EF6 A;  5L3F A;  2D45 A;  4LGW A;  3RPU D;  2FNP A;  2CQQ A;  3TW6 A;  4DNC A;  1Z21 A;  2R5Y B;  3PNY A;  4M6Y A;  3F8M A;  5M5W J;  4AM3 A;  2KL4 A;  1L3L A;  1QVT A;  3LWF A;  3BZK A;  2IGM A;  2XVC A;  3GVA A;  3HUG B;  2VE9 A;  4ESJ A;  2VLA A;  1LDK B;  3U1D A;  2IT0 A;  4XL9 A;  3HDD A;  2R7X A;  4LIT A;  1NK3 P;  4BDY A;  1D5V A;  1T33 A;  3DQV C;  4A93 J;  1YW8 A;  2EFW A;  3H3V K;  2DXI A;  4XM3 A;  2DFI A;  2E2J J;  4JYK A;  1S7O A;  4ETS A;  2V7F A;  5BS6 A;  1ETV A;  5J40 A;  3DPL C;  2PG4 A;  4IHW A;  3W2W A;  4IHS A;  2R92 J;  3HRM A;  1OKR A;  4B3X A;  2X1C A;  4YIF A;  1FZP B;  4B3A A;  2VBW A;  4OIN F;  3KFW X;  1TWF J;  2IGN A;  3BPV A;  1XS9 A;  4V2G A;  2OPT A;  4FCY A;  4JP0 A;  3ZXS A;  1O3T A;  2DPD A;  4RB2 C;  2WA0 A;  4U0V A;  2KRF A;  4XK4 A;  4LJZ F;  3BR5 A;  5KAF C;  2LVS A;  2VE8 A;  2RV8 A;  2WY7 Q;  2KRC A;  4KN7 X;  4XRM A;  3HGY A;  2W48 A;  2F4O B;  3COA C;  2IGK A;  3TP0 A;  3EUA A;  4G6Q A;  3AG1 H;  3CCJ I;  1D1C A;  4HEA 2;  4KDP A;  2P6S A;  2LFB A;  4PDK A;  2R4G A;  4HLY A;  1BW5 A;  2V9P A;  3P5J A;  3IL2 A;  3ECO A;  1AWC A;  4A3D J;  4F93 B;  4M3E A;  1RNL A;  1OCO H;  2XAQ A;  3M3Y J;  3IKV A;  2O7O A;  2DT6 A;  2KRH A;  4PK4 A;  1TLH B;  3QYF A;  1HF0 A;  5GTI C;  4UNO A;  4AVP A;  1IRX A;  3OYG A;  3W3C A;  1XGO A;  1NG6 A;  5BQT A;  2QZ8 A;  3F6V A;  2RDP A;  3JR9 A;  2DFE A;  3CF5 F;  2NS8 A;  3V8J A;  1H0M A;  1I3A A;  1P6R A;  4MQV A;  1HDD C;  4M9X A; 
#chains in the Genus database with same CATH homology
 5K5O A;  4Q47 A;  1QGP A;  1ZN2 A;  1YTY A;  2AXL A;  4UXN A;  3DKW A;  1TW2 A;  1BI0 A;  3JTG A;  3REO A;  4PZJ A;  2K86 A;  4EGZ A;  3R61 A;  3R60 A;  2O0Y A;  4UVB A;  2RQP A;  2GIV A;  1IXS B;  4DQ2 A;  3I71 A;  5HVQ C;  5FFZ A;  3LA3 A;  3GO5 A;  2KIF A;  4WX9 A;  1H9G A;  2HDC A;  5IT9 Z;  2WV0 A;  2LNB A;  2FML A;  4UV8 A;  2CG4 A;  5L3E A;  3K1N A;  3KP2 A;  4A0Z A;  1R00 A;  1MZB A;  4IHT A;  2F5E A;  2P7V B;  4AIH A;  3RPU A;  1B1B A;  2HR3 A;  5D5V B;  4TV7 A;  1R58 A;  2A61 A;  1HQC A;  4UVA A;  1KYZ A;  3VOD A;  2ZBK A;  3F72 A;  1JHH A;  4A2U A;  1AOY A;  3TO7 A;  1QZY A;  1KU3 A;  1CF7 A;  2FXA A;  3WE2 A;  2CO5 A;  2OZ6 A;  1OYW A;  2D1H A;  2HWV A;  1L0O C;  4OMY A;  2M1B A;  3V7C A;  2UZK A;  2ZME B;  1KQ0 A;  1Z9C A;  2P8T A;  1O57 A;  2RGV A;  1RUO A;  1O3S A;  3CUO A;  4R1H A;  4QLC U;  1EH6 A;  1MGT A;  3ZMV A;  3SZT A;  3TKY A;  1WRJ A;  5LBQ A;  2EWN A;  3N4M A;  4MEX F;  4G7Z F;  1DP7 P;  3E6C C;  1R1U A;  4L9V A;  1PP8 F;  5D8K B;  2OBP A;  1T2K A;  1IXC A;  2XV4 S;  1PUE E;  3EET A;  2PMH A;  3ZMT A;  2YSR A;  3I64 A;  1ZRD A;  1USS A;  2W84 A;  4YFX F;  2CGP A;  4A0Y A;  5KVR A;  2R3S A;  5IT3 A;  2K27 A;  1FYK A;  1ZRF A;  5AIQ A;  4S05 A;  2QBY A;  2PQ8 A;  3LAJ A;  2JT1 A;  5E1Z B;  3VEP A;  1TTY A;  2IA0 A;  2UWM A;  4RGX A;  2D1V A;  3BJO A;  1BI3 A;  1XSD A;  1WI9 A;  1B9N A;  1YFH A;  3FZV A;  4I09 A;  4UVC A;  4LD5 A;  2DT5 A;  3L09 A;  4IRI A;  1IN5 A;  2EV6 A;  5K1Y A;  1BBY A;  5E1W A;  5K5R A;  1JE8 A;  4KFC A;  1XB4 A;  3O2P E;  1G3W A;  1ZGA A;  2RNJ A;  4ENN A;  2HYF A;  2GA1 A;  3LA7 A;  3EYY A;  5JR3 A;  3HRS A;  5JVT A;  2P5L C;  1WSU A;  4KIC A;  3MCZ A;  2HKO A;  5D4R A;  1KGS A;  4Y13 A;  1FSE A;  2O03 A;  3GFM A;  3GF2 A;  3HIF A;  3KP6 A;  3N97 A;  4I0B A;  2MC3 A;  4LG0 A;  3PFI A;  3VFZ A;  3RYR A;  4ENJ A;  2HFH A;  3F6O A;  4KIB A;  4RB0 A;  4GXO A;  3WOD F;  5CYV A;  1BI2 A;  5H6Q A;  2HGC A;  1RZ4 A;  1XCV A;  2JTV A;  3E5Q A;  3RKY A;  4ZZD A;  2H94 A;  2ELH A;  1Z91 A;  3HTU A;  1WKM A;  1JHF A;  4HF1 A;  4BHC A;  4BYY A;  3L9F A;  2O6G E;  4CGZ A;  2W24 A;  1SMY F;  5J8F A;  1O3Q A;  3FM5 A;  2GXG A;  2ZJ2 A;  3GEZ A;  1A04 A;  5D5W B;  1LB2 A;  1F1Z A;  3GXO A;  4FX4 A;  2VT2 A;  3RJP A;  2NNY A;  2K4B A;  3LA2 A;  3G73 A;  1HST A;  2PLY A;  1STZ A;  4ENK A;  2FSW A;  4CHU A;  2XAJ A;  2PBI A;  2EK5 A;  1IRG A;  4EGY A;  3ECH A;  3KZY A;  3EDP A;  3ULQ B;  1F9N A;  4ESB A;  2E1N A;  2CWE A;  1YYV A;  2EA4 A;  4HZF A;  1T6S A;  2Z3Y A;  4BXU A;  3HRU A;  3Q9V A;  1DPR A;  5AIP A;  2GAU A;  3ISP A;  2Q0O A;  4EM0 B;  3J80 K;  3T8R A;  1HKT A;  5E17 F;  4HV5 A;  2P6T A;  2FQ3 A;  4U7D A;  4HX8 A;  4S04 A;  1GVJ A;  4MHG A;  1JXS A;  2L4M A;  4CDG A;  4M9Z A;  3F8C A;  1LVA A;  4F7Z A;  2Z9O A;  2YU3 A;  5LRR A;  3E97 A;  4KNY A;  1HXD A;  4Y17 A;  2ZCW A;  1D8K A;  1I6X A;  4O6J A;  2YR2 A;  2ZFW A;  3BDD A;  5H6R A;  3MAJ A;  1UST A;  4PGG A;  3C1D A;  3JSO A;  1W7P A;  2A69 F;  3GX4 X;  1V4R A;  3E6B A;  3TOA A;  4IRG A;  5E18 F;  4U0Y A;  2FBK A;  4JQF A;  5FGM A;  3B73 A;  5TRD A;  4JBA A;  5JFR A;  4B09 A;  2WTE A;  2QUF A;  1F4K A;  3HSE A;  5E20 A;  2YX7 A;  3DF8 A;  1SFU A;  4OOI A;  3T8T A;  1MDM B;  3CTA A;  2COM A;  1G3Y A;  2A68 F;  2EB7 A;  2M30 A;  2K4J A;  2G7U A;  1P4X A;  1ZRE A;  2JRT A;  2ADU A;  2PFB A;  2ACJ A;  3T1B A;  4EQQ A;  2A3S A;  4OIO F;  1QO0 D;  2M87 A;  4KN4 X;  4YFK F;  3ZN1 A;  4I01 A;  3FF5 A;  2HQN A;  4ZYG A;  3C18 A;  4OIQ F;  4EM2 A;  3M8F A;  2HTS A;  3IWF A;  1FBS A;  3VB2 A;  2W85 A;  3V8L A;  3CO6 C;  4XSZ F;  2DK5 A;  2ESH A;  4XBF A;  1MDM A;  3Q5F A;  3K69 A;  2Y48 A;  2FBI A;  2HOE A;  4HA8 A;  5LGN A;  3BY6 A;  6PAX A;  2FEZ A;  1FBQ A;  1I5Z A;  3KP7 A;  4KA4 A;  3I5U A;  2O8X A;  5BPD A;  1SD5 A;  2Z33 A;  4RGS A;  4KMU X;  1FBU A;  1YS6 A;  1BJA A;  2QVO A;  1ONV A;  1SD7 A;  1B9M A;  2L54 A;  1IZ1 A;  1I1G A;  3T0Y A;  4IJA A;  2VOP A;  2A5Y B;  1OYY A;  2R7D A;  3I4P A;  4EJU A;  4EMS A;  3B02 A;  3NQO A;  1K6O A;  2FE3 A;  1XCB A;  2FMY A;  3SFZ A;  2X0L A;  4U0W A;  4HQM A;  3GFJ A;  3HTS B;  1ZG3 A;  2DW4 A;  2P4W A;  4MEY F;  4HW0 A;  4RB3 C;  1MJA A;  4M74 A;  1ODD A;  3P9C A;  2CSO A;  5LHG A;  2IA2 A;  4LFU A;  3K9T A;  1U5T C;  4PCQ A;  4OIP F;  3BOQ A;  4M71 A;  3LQQ A;  4G94 A;  2UXN A;  4MQ9 F;  3F21 A;  5DUI A;  4CZZ A;  2IP2 A;  2VN2 A;  2LKP A;  4IRH A;  5TJJ A;  3WTS C;  1R1T A;  4UV9 A;  4YFN F;  1OPC A;  4G8X A;  1FP1 D;  5L3D A;  4Q48 A;  1NHA A;  2NAZ A;  3TDZ C;  4CYD A;  4ZH4 F;  4NHJ A;  2YX4 A;  4EJT A;  2PJP A;  2EJR A;  3KP4 A;  1R5H A;  3H3U A;  1G3T A;  4N0B A;  1KU9 A;  1ZAR A;  3QP6 A;  3M7G A;  3L7W A;  5E8I A;  5F6F A;  4HQE A;  1CF7 B;  3TGN A;  3U2R A;  5EEG A;  4M73 A;  3QRF F;  3JAM K;  1TQM A;  2OZU A;  1UHW A;  5LGT A;  1CGP A;  5D6E A;  2BYV E;  5FD6 A;  1XSX A;  2G7H A;  2VC1 A;  2KIM A;  4MNU A;  1KYW A;  2KJB A;  3R0A A;  4GGG A;  5A2Q Z;  1ZG5 A;  5D5X B;  3I0T A;  4LB6 B;  4A12 A;  4L5I A;  1K7A A;  3KLO A;  2GXB A;  5HS7 A;  1DUX C;  1S8N A;  3GWZ A;  1YLF A;  1UHM A;  1I27 A;  5DCF A;  2IW5 A;  2Z99 A;  1FP2 A;  5CLS A;  5CJ9 A;  1MJB A;  4G6D A;  3DXJ F;  3HOT A;  3H3Z A;  2NS0 A;  5E1X A;  5FLX K;  3IWZ A;  4KIF A;  3WE3 A;  3KLN A;  1GHC A;  1DDN A;  5LHH A;  2GWR A;  2QBY B;  3J81 Z;  4FX0 A;  3J7A O;  4M6X A;  3IRQ A;  3EYI A;  2A07 F;  3HOS A;  4U7B A;  1IAW A;  3I59 A;  3SHF A;  5D6F A;  1LJ9 A;  1WQ2 A;  3HSR A;  4KIG A;  5DDG A;  2XAS A;  2Q2E A;  3OV8 A;  2DQL A;  1KU7 A;  1G4D A;  3HSF A;  4PGH A;  3TQN A;  2WWY A;  1MKM A;  2F5D A;  1FNN A;  2BEO A;  1HSJ A;  2WC2 A;  4QWQ A;  2ZO4 A;  1LDJ A;  3FMQ A;  4CIC A;  5LGU A;  5L3B A;  2R7F A;  3VOE A;  1U78 A;  5DUK A;  3EQL F;  1SAX A;  1O7L A;  5KK1 A;  2L3D A;  2XUB A;  4B8X A;  4XSX F;  3CUQ A;  1O7F A;  3F8F A;  1Z1D A;  3D5L A;  3SZP A;  4HX4 A;  1HKS A;  5ICG A;  3FMR A;  2E1C A;  4LG0 B;  4P9U A;  4Q5S F;  2HKX A;  1GXP A;  2HZT A;  2P5V A;  2FF4 A;  1Z6T A;  4I0A A;  2Z5U A;  4BHB A;  3ABU A;  1KA8 A;  2MA3 A;  3WTY C;  1YG2 A;  4JK1 X;  1U8R A;  2HS5 A;  5FFX A;  1D8J A;  4AWX B;  1YO5 C;  1ULY A;  3DFG A;  1V3F A;  5CVV A;  3BPX A;  3J80 Z;  1ON1 A;  2KJC A;  5A2Q K;  2D2W A;  4WWC A;  3CDH A;  4BQA A;  3DV8 A;  1XMA A;  3ML6 A;  4HX7 A;  1TQP A;  3E6D A;  1FT9 A;  2GQQ A;  3GFI A;  3RKW A;  2JSC A;  1GXQ A;  2A6E F;  4HDV A;  2IRF G;  3ZMU A;  3RPQ A;  2C6Y A;  2DI3 A;  3BJA A;  2OQR A;  2JPB A;  3DPT A;  2H09 A;  2E7W A;  3QU6 A;  4HDU A;  3J81 K;  3I53 A;  3ZP5 A;  3JTH A;  3HHG A;  2ZXJ A;  5DCM A;  1ZLK A;  4WXH A;  3H92 A;  1IUY A;  1G3S A;  4BNC A;  1SD4 A;  1ZYR F;  1J5Y A;  2TDX A;  4AD9 A;  1IN4 A;  1XDS A;  2EA2 A;  1BC8 C;  3F8B A;  1P92 A;  3DP7 A;  4YG2 F;  5ILV A;  2DAO A;  5ILS A;  2M45 A;  3R6S A;  2ZNY A;  1Y0U A;  5LEK A;  2STW A;  2H6B A;  5BMZ A;  2BBY A;  3GUD A;  3KP3 A;  2XGX A;  4I7H A;  2XRN A;  3TDU C;  2JZY A;  2VXZ A;  1J75 A;  2MBF A;  2RC4 A;  2M5W A;  2LF8 A;  1HKQ A;  1P4A A;  4D0P A;  2FNA A;  2DBB A;  2DK8 A;  1S3J A;  4RAY A;  1IF1 A;  1H9T A;  3IHU A;  2XKO A;  4IPA A;  2PN6 A;  3F8N A;  5HOO A;  1FSH A;  4E70 A;  1ZLJ A;  2LSO A;  1T38 A;  2FA5 A;  3P7N A;  1T39 A;  1W7P B;  4G7O F;  1I1S A;  2V6C A;  5HDN A;  3TO9 A;  5ED4 A;  2QLZ A;  3WU0 A;  1U5T A;  3AAF A;  4P5O A;  4MTE A;  3ERE D;  2W25 A;  4N9H A;  1D3Y A;  4L9T A;  4UUV A;  3QPH A;  2VT3 A;  2EV5 A;  2FBH A;  3WTW C;  3CUQ C;  4I02 A;  1F5T A;  1EH8 A;  4I2O A;  3WTX C;  4OMZ A;  2RVC A;  3ZMZ A;  1XGM A;  3EUH A;  3LST A;  2VC0 A;  2G9W A;  1XD7 A;  4OIR F;  1HW5 A;  2YPR A;  2MD5 A;  2QQ9 A;  2ESN A;  4EV0 A;  4LK1 F;  3IC7 A;  3ZQ7 A;  3FXR A;  1KQ8 A;  1IW7 F;  2HEO A;  2STT A;  2K7L A;  1ZRC A;  3WU1 B;  3FXU A;  4LB5 A;  1IRF A;  3ZN0 A;  4CXF A;  3SQN A;  1XGS A;  2J5P A;  3W6J B;  5BPI A;  4L5J A;  4LMY A;  1B6A A;  3RTR A;  2DTR A;  1FLI A;  2O3F A;  3ZPL A;  3K1M A;  2NYX A;  3MEX A;  3BRO A;  3ROU A;  1YW7 A;  2XKP A;  2HYG D;  5L3G A;  2VOO A;  5E8G A;  2MH9 A;  4BH9 A;  2XHK A;  4XRF A;  2BV6 A;  3LFK A;  1RIO H;  2EFO A;  4KMF A;  2V1U A;  3W6K B;  4GYG A;  3P9K A;  4H0E A;  4Y15 A;  2P7C B;  3KE2 A;  3NRV A;  1W4M A;  3GW2 A;  4GO1 A;  4G7H F;  3JAM Z;  3PQK A;  5EEH A;  2H27 A;  4AIK A;  2B0L A;  2V79 A;  4L0Z B;  4ZZL A;  3QPT A;  1R1V A;  4O3M A;  1K78 A;  3E5X A;  1FY7 A;  1FX7 A;  5HDK A;  1ZH5 A;  2PEX A;  1ZAO A;  3O3K A;  2PMU A;  4IXA A;  1HW1 A;  4LLG F;  3G3Z A;  5FO5 A;  3BP8 A;  2CFX A;  3KEQ A;  1LEB A;  2E7X A;  3M9A A;  4KYW A;  5FLX Z;  3C7J A;  5D8L B;  1JGS A;  5FB2 A;  3MZY A;  1OYI A;  1BIA A;  2W57 A;  2L4A A;  3U9G A;  2OD5 A;  3HUG A;  1R5G A;  3F23 A;  1B59 A;  4ZYD A;  3M8E A;  1Z6R A;  1LQ1 A;  2VOD A;  5D5U B;  3V8K A;  1SFX A;  1ON2 A;  2J5O A;  3Q9S A;  1Z7U A;  2GZW A;  3IKT A;  2P5K A;  1P4W A;  5CVJ A;  5ICE A;  4P9F A;  2FU4 A;  1OR7 A;  4EJW A;  2QM3 A;  1BI1 A;  3RKX A;  1W5T A;  3P9I A;  4HYE A;  2F5C A;  1QZZ A;  3FHZ A;  4HF2 A;  3O6B B;  4HOB A;  2IA1 A;  1SFE A;  2KKO A;  3FXQ A;  1U6G A;  2A6H F;  3V7S A;  3K2Z A;  4M9S A;  3T5X A;  2DPU A;  3ZMD A;  1QPM A;  2QWW A;  1QNT A;  2HTJ A;  4HLX A;  4GYI A;  5AON A;  1R36 A;  3LAP A;  1LDD A;  3I59 B;  3WTV C;  2NRA C;  1HW2 A;  4A6E A;  1YS7 A;  4AIJ A;  4IF4 A;  1B4A A;  2LF7 A;  3HYI A;  2CQK A;  3HHH A;  1YQA A;  1J2X A;  1X3U A;  1XMK A;  3GFL A;  2ZNZ A;  3WGI A;  4EJO A;  5ERI A;  2VBZ A;  4LLL A;  1QQI A;  2XIG A;  2XAG A;  1Z05 A;  1G6N A;  3WGG A;  4EM1 A;  5ICF A;  1REP C;  3QOP A;  4R8H A;  3V7R A;  5LRS A;  2CW0 F;  1XGN A;  3CUQ B;  1RUN A;  2V1X A;  2DU9 A;  3QAH A;  5DV5 A;  2OQG A;  1U3E M;  1LNW A;  4A5N A;  1TBX A;  1PP7 U;  3TO6 A;  3FWE A;  3GYH X;  3QP5 A;  1R7J A;  2M8E A;  5DD4 A;  1XDU A;  2VBY A;  3E6M A;  2IJL A;  1TQI A;  4R79 A;  1HBX G;  2FRH A;  2MLG A;  4CO8 A;  1WWX A;  2Y0M A;  5BOX A;  5LLQ A;  1UFM A;  4Q4Z F;  3FM3 A;  1IN6 A;  5HLG A;  2ZME A;  2LDU A;  4P55 A;  2Q8K A;  1IN8 A;  3CLO A;  3OOP A;  3GZ6 A;  5LHI A;  5L3C A;  1FOK A;  3M1E A;  1VTN C;  3ELK A;  4HAM A;  1IXR C;  4XLP F;  5D4S A;  2DQR A;  3MZH A;  3C3W A;  5IT9 K;  3L00 A;  2ETH A;  3RYP A;  2L02 A;  1TW3 A;  1R22 A;  5ICC A;  1TNT A;  1IN7 A;  2QQB A;  5DCM B;  4IVN A;  3MWM A;  3RI4 A;  4RS8 A;  2OAZ A;  5DYM A;  4NB5 A;  4L9J A;  3S2W A;  4GCV A;  2L01 A;  3NEU A;  1DPU A;  4A6D A;  5CVR A;  2PI0 A;  4RGU A;  1UB9 A;  1W5S A;  3F22 A;  2NNN A;  5F64 A;  1J9I A;  2K02 A;  4KT5 C;  1W7P D;  4WXC A;  5HLI A;  1SMT A;  1J7K A;  3KZZ A;  1S29 A;  3ZMS A;  1U2W A;  4M72 A;  4L9N A;  5JI6 A;  4EJV A;  3KP5 A;  4BAY A;  1BM9 A;  4P96 A;  1FYL A;  3FX3 A;  5J8C A;  1EV7 A;  1ZHF A;  4A5M A;  2XAH A;  4XLN F;  3WTZ A;  3F3X A;  4WF2 A;  5HS9 A;  2CYY A;  4RGR A;  2IVM A;  1OMI A;  1P2F A;  4FHT A;  4KUM A;  3JSP A;  4N9I A;  4ESF A;  4OU0 A;  1Q1H A;  4ON0 A;  5CVI A;  1E17 A;  1YIO A;  4ENM A;  1FPQ A;  2Y75 A;  1U5T B;  1QBJ A;  4I98 B;  3WTT C;  2GA2 A;  3WGH A;  4MTD A;  3KET A;  3E5U A;  4WCG A;  4ZYE A;  3PQJ A;  1YW9 A;  4O5V A;  1O3R A;  2VBX A;  2DLL A;  5K5Q A;  5HDG A;  3BJ6 A;  4U88 A;  3IRR A;  2X4H A;  1TNS A;  2EV0 A;  3RIR A;  2JPC A;  5CVU A;  4UHT A;  2XRO A;  1EH7 A;  4YII A;  4G9Y A;  5ILU A;  1BIB A;  2ISZ A;  5H20 A;  2RN7 A;  1BOA A;  2IPQ X;  3HRT A;  1J59 A;  1LEA A;  4LLN A;  1ZGJ A;  1ZG1 A;  2OA4 A;  2RKH A;  2OU2 A;  4RB1 A;  5HLH A;  1R23 A;  3BZ6 A;  5LEJ A;  5DEQ A;  3D0S A;  3I58 A;  3LQR A;  3QU3 A;  2V9V A;  3WTU C;  2F5F A;  3MQ0 A;  3CJN A;  4L18 B;  1T98 A;  1KU2 A;  5JHU A;  2EFP A;  2EFN A;  4LK0 F;  4A0X A;  2BE5 F;  3L2C A;  2MH2 A;  2QEN A;  3GZ5 A;  3E3V A;  3I54 A;  2VON A;  4HF0 A;  4MGR A;  2BGC A;  3K1P A;  3K0L A;  5F1R A;  3KEO A;  1PDN C;  1UCR A;  3R4K A;  2QQA A;  1S6L A;  2HQR A;  4Z2Y A;  3MFK A;  4EVI A;  3GLX A;  1FYM A;  5DD8 A;  1KQ9 A;  2O61 A;  4RAZ A;  2ZKZ A;  5J6X A;  4HV6 A;  1C0W A;  3CO7 C;  1FWZ A;  2H6C A;  5FD5 A;  1SD6 A;  3RDI A;  1BN5 A;  4ZYH A;  3V4G A;  3JW4 A;  2FOK A;  3SXY A;  2KIU A;  3R0J A;  3BWG A;  5HS8 A;  2XAF A;  3WG9 A;  1T0F A;  3ABT A;  1BC7 C;  3DEU A;  1S7A A;  1XN7 A;  2MLK A;  4WXD A;  4BHP A;  1XSV A;  1K78 B;  4WK8 F;  2EFQ A;  1RI7 A;  3FMS A;  1MD0 A;  2AS5 F;  1K79 A;  2DO7 A;  2QYO A;  1E2X A;  2ISY A;  2UXX A;  4K2E A;  4HBL A;  2V1D A;  1J0R A;  4L0Y B;  4FT8 A;  4ASN A;  2F2E A;  3TOB A;  4NQW A;  1FC3 A;  3KCC A;  1MJ9 A;  5L3F A;  2D45 A;  4LGW A;  2FNP A;  4DNC A;  4M6Y A;  3F8M A;  1L3L A;  3LWF A;  2XVC A;  3GVA A;  2VE9 A;  4ESJ A;  1LDK B;  3U1D A;  2IT0 A;  1D5V A;  3DQV C;  1YW8 A;  2EFW A;  2DFI A;  1S7O A;  4ETS A;  5BS6 A;  3DPL C;  2PG4 A;  4IHS A;  3HRM A;  1OKR A;  4YIF A;  1FZP B;  2VBW A;  4OIN F;  3KFW X;  3BPV A;  1O3T A;  2DPD A;  4RB2 C;  4U0V A;  2KRF A;  4LJZ F;  2VE8 A;  2RV8 A;  4KN7 X;  3COA C;  4G6Q A;  4KDP A;  2P6S A;  4PDK A;  4HLY A;  3IL2 A;  3ECO A;  1AWC A;  1RNL A;  2XAQ A;  3IKV A;  1TLH B;  4UNO A;  4AVP A;  1XGO A;  5BQT A;  2QZ8 A;  3F6V A;  2RDP A;  3V8J A;  1H0M A;  1P6R A;  4MQV A;  4M9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...