2KIFA

Solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-methylguanine-DNA methyltransferase
publication title Structural basis of O6-alkylguanine recognition by a bacterial alkyltransferase-like DNA repair protein.
pubmed doi rcsb
source organism Vibrio parahaemolyticus aq3810
molecule tags Transferase
total genus 29
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kifA00
1B59A 3E6DA 2ZO4A 3ISPA 1B6AA 2O61A 4RB0A 3U9GA 4ZYDA 4L5JA 3GYHX 3RIRA 1SAXA 3R60A 1RUOA 1Z05A 4EQQA 3R0JA 1R36A 2ZCWA 5CVRA 2LF7A 3FZVA 4HW0A 1CF7B 4ENJA 2RQPA 3C1DA 3DKWA 3LAPA 1JHHA 2FMYA 1MDMB 2Z99A 1J59A 2GWRA 2QLZA 4JK1X 1GVJA 1HSTA 1P92A 1G6NA 4Q48A 3SZPA 5ICEA 1KGSA 4G94A 4UVBA 2H27A 2DU9A 1K7AA 4A5NA 2E1NA 1EH7A 3J80Z 3P7NA 3LA3A 3K0LA 3EYYA 5D8LB 3ZPLA 4CXFA 1W7PD 4Z2YA 2O0YA 2Q8KA 2DI3A 1RZ4A 1ONVA 2KKOA 4UV8A 2YSRA 2ZMEB 2RV8A 3ZP5A 3NRVA 4EMSA 2QWWA 1PP7U 2JTVA 1VTNC 2ACJA 3MQ0A 2DO7A 2A3SA 1OPCA 2D1HA 5ED4A 3HRSA 2ELHA 4YFNF 3KLOA 4AIJA 3HRTA 4ESFA 3O2PE 1DUXC 2ADUA 3M1EA 1O57A 4OMZA 5FFXA 1ZRDA 2ESNA 1UCRA 3BPVA 5JHUA 5ICCA 1FBQA 3BJOA 5FLXK 5E20A 4LB6B 4XLNF 5HLIA 1Z9CA 2EV0A 5BPDA 3ABUA 2XAFA 1BI1A 4HF0A 1T2KA 1O3RA 3QRFF 5CLSA 4LJZF 2AS5F 5LGUA 4I09A 3L09A 3SXYA 3QPTA 3HUGA 1XCBA 2HGCA 4BQAA 2DLLA 3ZMTA 2BV6A 3ERED 1P6RA 2HFHA 4M9SA 1R5GA 2O3FA 2F2EA 1R1TA 1PP8F 3WTVC 1FYKA 4LLLA 1SD5A 5JVTA 2Q0OA 4M9XA 1CGPA 2OD5A 3F21A 2FXAA 1PDNC 3VODA 1IZ1A 3J7AO 3QOPA 5KVRA 3GZ5A 2EFQA 2FOKA 4PDKA 1AWCA 1D5VA 2EWNA 3Q9VA 3WE2A 1MKMA 2MLKA 5D6EA 2VBYA 3RI4A 2FE3A 4HV5A 3U2RA 3WTUC 3QAHA 5K5RA 1IF1A 2QBYB 1H9TA 1Z1DA 4ASNA 1LNWA 2GA1A 2WV0A 2J5PA 1ZG5A 3DF8A 2X4HA 3I71A 1OKRA 2M45A 3BY6A 2ZKZA 1FLIA 2CGPA 5A2QK 3QPHA 3KP4A 2M8EA 1O3TA 3RYPA 2DK8A 4N9HA 1QQIA 4BHCA 3N4MA 4OU0A 1WRJA 4IHSA 2XASA 4ENNA 3D5LA 5E1XA 2E7WA 4S04A 3BJ6A 3R0AA 1KU9A 2ESHA 4CYDA 2KRFA 2R7FA 3L9FA 1TNTA 1XGMA 4H0EA 1WQ2A 5LBQA 3HYIA 3I0TA 4KMUX 2BGCA 4CO8A 3TO6A 2UXNA 2K4JA 1MJAA 1ZYRF 3JW4A 3BROA 3FXUA 3T0YA 3DP7A 4EJUA 3B02A 2CO5A 2HDCA 1J75A 2OU2A 2RGVA 4KUMA 1IRFA 1XGNA 1YIOA 4JQFA 1IUYA 2A68F 1T38A 4G9YA 2CYYA 3LWFA 1ZAOA 1FSEA 1R22A 4M73A 4U0VA 1ZGAA 3TGNA 3TQNA 4WXCA 2VBXA 5HLGA 4ZH4F 4K2EA 4HX7A 1JE8A 1DDNA 1JHFA 4I2OA 2B0LA 1QBJA 5HS7A 3D0SA 1YQAA 3KP6A 1SFEA 5F1RA 4TV7A 1L0OC 5DCMB 1KYWA 4RGUA 3KE2A 3KCCA 3VFZA 5D5XB 1DPUA 2IA1A 5FGMA 4FX4A 4IF4A 1J7KA 3I53A 1TQPA 5LEJA 4KN4X 1LEAA 2XHKA 5JI6A 1YW7A 1W7PA 2OZUA 3WTXC 2O03A 2OBPA 1SFXA 3IL2A 4KNYA 2XAHA 3F3XA 5FLXZ 2XV4S 1BIBA 1GXPA 1Y0UA 2QVOA 1FX7A 1IN5A 4KIFA 2PQ8A 4P9UA 2JSCA 2VT2A 4HAMA 3Q5FA 4EJVA 1FYLA 5L3DA 4HF2A 5H6QA 3KFWX 3CDHA 2F5EA 4GYGA 4M9ZA 1FOKA 1MJ9A 3R6SA 1ZHFA 1GXQA 5LHIA 2DK5A 3ZMSA 2ZNYA 2K4BA 1S7AA 2HZTA 5AIPA 2DTRA 4L5IA 4EJOA 4GO1A 4LFUA 3WTTC 1FBUA 4RB2C 5CVUA 4L0ZB 1P4XA 2HYGD 3EDPA 2GZWA 2LF8A 4MEXF 4Q47A 4RB1A 1SMYF 2MH2A 1IN4A 3TDZC 3RYRA 2RN7A 2A61A 2LKPA 1SD6A 1YTYA 1TNSA 3FMSA 4AIKA 2IRFG 5D5VB 2V1DA 4HLXA 1FP2A 3GW2A 1MJBA 1ZLKA 4I0BA 4N9IA 1F4KA 2STWA 3V8LA 1HW2A 2JPCA 1YW9A 2HWVA 2P5LC 5HDKA 1F9NA 1I6XA 5A2QZ 2W25A 1IW7F 2WC2A 4OIOF 4FX0A 3GUDA 4QLCU 4RGSA 3LA2A 5J6XA 1YS6A 3ECOA 4HDUA 1O3SA 5L3BA 2L3DA 3I59A 3LA7A 4IXAA 2BYVE 3RPUA 1Q1HA 4ON0A 1U2WA 2ZJ2A 5D8KB 1ON1A 1P4WA 3RTRA 3ZMUA 5E8IA 3CUOA 1ZN2A 3V8JA 4IRGA 4XLPF 4DNCA 2L4MA 4LLNA 4U7BA 2PG4A 2H94A 3M8EA 4WXHA 3W6JB 4IRIA 3RKYA 2QYOA 5FB2A 3GO5A 1QGPA 4FT8A 5LLQA 4AIHA 2G9WA 4MHGA 4O5VA 2K86A 3S2WA 2FNAA 1KU3A 2KIMA 2XRNA 2ZXJA 3I4PA 4KA4A 3VEPA 4GGGA 4R8HA 3ZN1A 4A12A 2HQRA 1E2XA 5H20A 3BJAA 3EQLF 2V9VA 1UHWA 3RJPA 2P5VA 1T98A 3MZHA 2CFXA 2PN6A 3I58A 2VE9A 2ISYA 3GFJA 2E1CA 1T6SA 1K78A 1BIAA 2STTA 3QU6A 1LVAA 1UFMA 4YG2F 1QPMA 1D3YA 1FC3A 5ICFA 1O7FA 2HS5A 4HX4A 2YR2A 2GQQA 2Y75A 4ZYGA 3EYIA 3VOEA 5DDGA 2DFIA 3OV8A 4R1HA 3C18A 4I02A 1QNTA 2PBIA 1BC8C 4I7HA 5ILSA 3VB2A 1ZG3A 4L9VA 1S6LA 4U88A 1LQ1A 1FP1D 2O8XA 3QP5A 5HS9A 3PQKA 1D8KA 4HV6A 1S3JA 1CF7A 2W85A 3TOBA 1FYMA 5F64A 3NQOA 1IN6A 1I1GA 1MDMA 4EGZA 4EVIA 4ZZDA 5DUIA 2L02A 3E97A 3DPTA 2PI0A 1V4RA 2WTEA 2HKOA 4WCGA 2HR3A 5E8GA 2CSOA 4F7ZA 2IW5A 3FM5A 2NRAC 4N0BA 4KIBA 2A6HF 4ZYHA 3MCZA 5E1ZB 1R1UA 2JT1A 4EV0A 5DV5A 3H3UA 2FU4A 3G3ZA 4G6QA 2A5YB 4M74A 3G73A 1RIOH 1YS7A 3BPXA 3JTHA 3V7SA 3IHUA 2YPRA 4L9TA 1K6OA 4A0XA 4OMYA 3KEQA 4Q5SF 4UVAA 3E6MA 3JAMK 4EM2A 4WF2A 3I64A 2ZMEA 4WXDA 1T0FA 3GLXA 2OQGA 1O3QA 1BI2A 2IA0A 3JTGA 1ZREA 2IT0A 1HQCA 1SD7A 1TQMA 4OIRF 2F5CA 1SFUA 2OAZA 5TJJA 3R4KA 3IC7A 2A6EF 2PLYA 4LGWA 5BOXA 4A6EA 5HDNA 3F8MA 3U1DA 1P2FA 5L3EA 1QZZA 1YFHA 4ESJA 2Z9OA 4L18B 3BWGA 3P9IA 3DV8A 4XRFA 3W6KB 2FBKA 2JPBA 4L9JA 2EV6A 4U7DA 2QENA 1J0RA 5DCFA 3T8TA 3SZTA 4BYYA 4ETSA 2FNPA 1IN7A 2QQBA 3CO6C 3WGIA 1KQ8A 2H09A 4EGYA 5AIQA 1FT9A 3FHZA 1YO5C 3GF2A 1O7LA 2YX4A 1KA8A 1Z7UA 1TW2A 2EA2A 3KP3A 1RUNA 3K2ZA 1TTYA 4M72A 4EJWA 4GCVA 3F23A 1R23A 1BOAA 2H6BA 2RC4A 1S8NA 3ZMZA 3SQNA 4PGGA 2QQ9A 3WU1B 1DP7P 2VBZA 3FMQA 2QBYA 5JR3A 3GFLA 1LDJA 2ZFWA 1HKSA 4UXNA 3TDUC 4PCQA 4RB3C 2Q2EA 2V6CA 3L00A 2UZKA 5JFRA 1J9IA 2F5FA 5CVVA 1H0MA 3ELKA 2XGXA 4XSZF 2V79A 1ULYA 2AXLA 3FWEA 5LEKA 1L3LA 3WGHA 4Y15A 5TRDA 5F6FA 1E17A 3WGGA 4Q4ZF 2MA3A 5K5QA 3HSRA 4MEYF 1FY7A 4L9NA 3F72A 3IWFA 1MD0A 4NQWA 3V4GA 2CG4A 2EJRA 3BZ6A 4M71A 3F8FA 1U5TB 5DD4A 1TBXA 3EUHA 5KK1A 1SMTA 4LG0B 3WG9A 4RAZA 4P5OA 5E1WA 3J81K 4YIFA 6PAXA 1W5SA 2R3SA 4BHBA 3H3ZA 3M7GA 3GXOA 2EFPA 4A2UA 2ISZA 5L3GA 1JGSA 3WTSC 2G7UA 5LRSA 3SHFA 1U78A 3TKYA 2F5DA 4JBAA 1V3FA 5LRRA 3KLNA 2HQNA 4HDVA 2DPUA 3E5UA 5LHHA 4M6XA 3I5UA 3LQRA 2WWYA 4LK0F 1FNNA 4I0AA 2EFOA 2P8TA 2MH9A 2L54A 2PMUA 3NEUA 1BC7C 2RNJA 2EFNA 2Z3YA 1D8JA 3L2CA 3KP5A 3F6VA 1W4MA 1F1ZA 5CVIA 2A07F 4RAYA 2XKPA 3KZYA 3ECHA 2L01A 4MTEA 5LHGA 1C0WA 1OYYA 4R79A 1B9NA 4M6YA 1OYWA 3JAMZ 1NHAA 5DCMA 1B4AA 1P4AA 1S7OA 4A0YA 4ZYEA 3GWZA 2KIFA 4HF1A 1I1SA 5J8FA 2GXBA 4PZJA 1G3YA 2PJPA 1KU7A 1XDSA 1QO0D 2DQLA 1HW5A 3ZQ7A 3QU3A 2ZBKA 3TO7A 2COMA 4GXOA 4ENMA 2HEOA 1W5TA 3CUQB 2DBBA 3FF5A 2IPQX 2NYXA 1REPC 4P96A 5BPIA 3BDDA 1R5HA 4MGRA 5HLHA 1LDDA 2H6CA 1HKTA 2M87A 3WTYC 2G7HA 2QUFA 2NAZA 3COAC 4G7ZF 2RKHA 4OIQF 1KU2A 4AVPA 4YFKF 4CICA 1YYVA 3ZMVA 2MBFA 1ZRCA 4HQMA 5ICGA 1UB9A 1Z6RA 3H92A 3TOAA 4YIIA 3MEXA 4UUVA 3WODF 3C3WA 1U6GA 2P6SA 4L0YB 2VC0A 1ZARA 1XB4A 1MZBA 4HLYA 2DPDA 3BOQA 1XSVA 4U0YA 2HOEA 1S29A 5K1YA 2UWMA 3ZN0A 5CVJA 2MD5A 2VBWA 4BH9A 1WI9A 4LB5A 2VE8A 2DT5A 1WWXA 3E5QA 4NHJA 5ERIA 3IWZA 5LGTA 3E6BA 1IN8A 5ILUA 4MTDA 1XCVA 3M9AA 4A6DA 3EETA 5EEGA 4ESBA 1FBSA 4AD9A 4G7HF 4KICA 1BI3A 5LGNA 3HRUA 3GX4X 1U3EM 5FO5A 1BI0A 3MFKA 3K69A 4IVNA 1U8RA 1WSUA 3N97A 2EA4A 1EH8A 3M8FA 4A5MA 1X3UA 2FA5A 3HHGA 2XUBA 5H6RA 4B09A 2VODA 1T39A 3HRMA 3K1MA 3DXJF 3FM3A 4UV9A 3BP8A 2JZYA 2XKOA 1KYZA 1YW8A 2EB7A 3E3VA 3HTSB 2A69F 1QZYA 3HIFA 3ZMDA 1IXRC 2GIVA 3J81Z 4BAYA 4S05A 3WTWC 3LQQA 3IKVA 3FMRA 3GVAA 1IXCA 2W84A 5E17F 3MAJA 5HOOA 4HYEA 3DEUA 2W24A 2VOOA 1XGSA 2NNYA 2GA2A 4CZZA 5FD6A 2C6YA 2Y0MA 1UHMA 3CUQC 1XSXA 3V8KA 1B1BA 3K1NA 2FMLA 4G6DA 1HXDA 1HW1A 5HDGA 4A0ZA 3K1PA 2DQRA 1YG2A 1I27A 3Q9SA 4UHTA 3MWMA 2YU3A 2YX7A 2D45A 3ULQB 2R7DA 3HSFA 4DQ2A 4RS8A 4AWXB 4HQEA 2EV5A 2FRHA 2OA4A 2FQ3A 2BEOA 4EJTA 2IJLA 2XAQA 1HSJA 2CW0F 1ZG1A 3ABTA 2P5KA 2LNBA 3WTZA 3KP7A 1ZH5A 3E5XA 2QZ8A 1BJAA 3HSEA 5IT9K 3P9KA 5BS6A 2HTJA 3QP6A 2QM3A 3LSTA 2VN2A 1JXSA 3L7WA 2VOPA 5L3CA 1K79A 3IRQA 3FX3A 4XSXF 3GFMA 4Y17A 4NB5A 4LK1F 2IA2A 5D4SA 3O6BB 1WKMA 1YLFA 5IT3A 4I01A 2Y48A 2DAOA 1KQ9A 2CWEA 2OZ6A 3F8BA 1PUEE 3OOPA 2UXXA 4MQVA 3DQVC 2PEXA 5BMZA 2P4WA 1OMIA 4GYIA 4YFXF 1TQIA 3C7JA 5HS8A 2ZNZA 1XN7A 2XAJA 3MZYA 3F8CA 4BXUA 1J2XA 2FF4A 2VONA 2M5WA 3T5XA 5ILVA 4UVCA 3HHHA 2XROA 4OINF 2P6TA 3DPLC 4LLGF 1LDKB 3RKWA 2VC1A 1G3TA 4WWCA 4RGXA 2D2WA 3WE3A 3ML6A 2P7CB 4CHUA 4D0PA 1HKQA 3GEZA 1R00A 5K5OA 4LMYA 4UNOA 1ZLJA 5DEQA 3HOSA 3CJNA 3O3KA 4KDPA 1LB2A 2TDXA 2E7XA 3V7RA 1G3SA 3HTUA 1LEBA 2GXGA 3PFIA 2PFBA 2VXZA 2HTSA 5CJ9A 2D1VA 1STZA 3RPQA 3F6OA 3GFIA 2MLGA 2K02A 2QQAA 5EEHA 1TW3A 2PMHA 4OIPF 3CLOA 2RDPA 3FXQA 1ZGJA 1W7PB 4P55A 4KYWA 4EM1A 5BQTA 3JSPA 3IKTA 2EK5A 2KIUA 1ON2A 5FFZA 1XMAA 2NNNA 3IRRA 1TLHB 4PGHA 1Z6TA 3LAJA 2BE5F 1SD4A 5D5WB 3TO9A 2OQRA 4MNUA 3J80K 4G7OF 2M30A 4IRHA 4XBFA 1FZPB 4O6JA 2L4AA 4KIGA 3B73A 5DUKA 1FWZA 1R7JA 4HBLA 2VT3A 3HOTA 4KN7X 1USSA 4EM0B 5L3FA 1EH6A 2XIGA 4E70A 1MGTA 4KMFA 2Z5UA 3REOA 3CTAA 1A04A 4KT5C 3AAFA 2KJCA 2BBYA 4O3MA 1XGOA 5D4RA 4HA8A 1RNLA 5DYMA 2HKXA 3JSOA 2FSWA 1AOYA 5HVQC 4HOBA 5J8CA 1XD7A 5AONA 2EFWA 5D6FA 2KJBA 2P7VB 1LJ9A 1GHCA 4I98B 4BNCA 1XSDA 3E6CC 2HYFA 3I54A 5FD5A 4IJAA 1H9GA 3CO7C 2IVMA 1KQ0A 2LSOA 2NS0A 4KFCA 2LDUA 1FPQA 1OR7A 3GZ6A 1XMKA 5CYVA 4WK8F 3F8NA 1U5TA 2MC3A 1HBXG 3K9TA 4LG0A 4IHTA 4FHTA 3T8RA 1IAWA 3T1BA 2XVCA 1OYIA 4OOIA 1USTA 3KETA 4ZZLA 2Z33A 2W57A 2K27A 1XDUA 2M1BA 1I5ZA 3I59B 1ODDA 2O6GE 4B8XA 4P9FA 3F22A 1ZRFA 5DD8A 3DFGA 4IPAA 4BHPA 3RDIA 4RGRA 5IT9Z 3LFKA 1F5TA 2FEZA 1BBYA 4LD5A 1R58A 1FSHA 2IP2A 4MQ9F 2ETHA 2DW4A 3RKXA 5D5UB 1B9MA 2K7LA 3P9CA 3V7CA 4QWQA 3ROUA 2FBHA 1Z91A 4G8XA 1BM9A 4HX8A 4CGZA 1BN5A 4WX9A 1R1VA 4U0WA 2JRTA 3KP2A 1EV7A 3WU0A 3SFZA 2GAUA 3KEOA 4ENKA 4CDGA 4HZFA 3KZZA 1DPRA 2FBIA 1J5YA 2RVCA 2V1XA 1K78B 3FXRA 1IXSB 3R61A 2V1UA 1RI7A 2J5OA 4Y13A 1G3WA 3PQJA 5E18F 1U5TC 2CQKA 3CUQA 1G4DA 2X0LA 1IRGA 2XAGA
chains in the Genus database with same CATH superfamily
3OS0A 1B59A 3E6DA 2ZO4A 3ISPA 1B6AA 3IUOA 4DZPA 1LFBA 2O61A 4RB0A 4C2MJ 3U9GA 1JKPC 4ZYDA 4L5JA 3GYHX 2DYRH 3RIRA 2R7SA 2JVHA 1SAXA 1LPQA 3R60A 1RUOA 1Z05A 1W5CC 2EQRA 3R0JA 4EQQA 3WHBA 1R36A 2CMPA 1TWAJ 2ZCWA 3JRBA 2B7EA 1BA5A 5CVRA 3ZR8X 2LF7A 3FZVA 4HW0A 1CF7B 4ENJA 2RQPA 3QYBA 2RQQA 3C1DA 4ITVA 1YIJI 3DKWA 4MFDA 3OYKA 3OIQA 1RKTA 4MIMA 2XSJC 1JHHA 2FMYA 1X1AA 3LAPA 1MDMB 2Z99A 4AC0A 2OCCH 2X6YA 1VF9A 1JJ6C 3N05A 1J59A 2GWRA 2QLZA 5F0CA 1TC3C 4JK1X 2VJ5A 1NG6A 4XKBA 4X0GA 4BDZA 3H9QA 1NG7A 1MNMC 1GVJA 4II3A 2VL8A 4XL9A 1HSTA 1P92A 2NVTJ 1IG7A 1G6NA 4Q48A 3PUBA 3SZPA 5ICEA 1KGSA 4G94A 1FMVA 4UVBA 5M5YJ 2H27A 2DU9A 2M0CA 1K7AA 3QYEA 4A5NA 2E1NA 1EH7A 3J80Z 3P7NA 3LA3A 2K9NA 1VQOI 3K0LA 3EYYA 5D8LB 3ZPLA 3BTJA 1XC5A 4CXFA 1VQLI 1W7PD 5GAEJ 4PSXA 4XKWA 2EBIA 4E6KG 4Z2YA 2O0YA 4AUXA 2Q8KA 2DI3A 1RZ4A 1U9OA 3A01B 4AYBN 5DS9A 1ONVA 1DGRM 2KKOA 1D0ZA 4UV8A 4QPQA 1W0TA 2YSRA 2ZMEB 2RV8A 3ZP5A 3NRVA 2L7KA 2QWWA 4EMSA 4XNFA 1PP7U 1YJNI 2JTVA 4B48A 3BLYA 2Z16A 1VTNC 3MQ0A 2ACJA 2HOTA 2VQCA 2A3SA 2DO7A 1OPCA 4NC7A 2D1HA 5ED4A 3HRSA 2ELHA 1Z67A 3BTIA 3ABMH 3QQAA 4YFNF 3KLOA 4AIJA 3HRTA 5J4VA 1W36D 5J1RA 1A6QA 2TCTA 3H0GJ 1VI0A 4PJJA 4ESFA 2DOAA 3O2PE 3S2DJ 1DUXC 2ADUA 2R7QA 3M1EA 1O57A 4OMZA 3TEDA 4D5FA 3H35A 4B3AA 5FFXA 1ZRDA 3L1PA 1YHQI 2ESNA 4XRSA 1UCRA 3BPVA 2VASA 3K4CA 1R49A 1WHUA 5JHUA 5ICCA 1AA7A 4UB8C 1FBQA 3BJOA 4MO7A 4M3EA 5JLWA 5FLXK 4PJ0C 2IGKA 3G6EI 5E20A 4LB6B 3DPUA 4XLNF 2CV2A 5HLIA 1TT5B 1Z9CA 2EV0A 5BPDA 2PJRA 3ABUA 1OCTC 2XAFA 1BI1A 4HF0A 3BCAA 3TP0A 1T2KA 3QRFF 1O3RA 5FKKA 4AU7A 5CLSA 1JKOC 3FBIB 4ZC3A 2KFDA 4LJZF 2AS5F 5LGUA 3ZOBA 4I09A 3L09A 3SXYA 3QPTA 2OTJI 1ETXA 3SJMA 3HUGA 1XCBA 3CF2A 2HGCA 2XGEA 1P7JA 4BQAA 1WCMJ 2DLLA 4ZDPA 3CJQB 3ZMTA 2BV6A 3ERED 2LBFB 3HJEA 1P6RA 2LRDA 3LMMA 2UUZA 5TGTA 2HFHA 4M9SA 4D9JA 4FCYA 3K4MA 1K4SA 1R5GA 2O3FA 4BJ6C 4XOPA 4IHWA 1Y8QB 2F2EA 2WAQA 1R1TA 1PP8F 2E5NA 3M4OJ 4QTRA 2KT0A 3MN2A 4XIDA 4ZDOA 2X85A 3WTVC 1FYKA 2MSYA 1X3WB 3BQYA 5HNFA 4LLLA 1SD5A 2HXOA 4V19K 3LFUA 3AG2H 3U1KA 1MBFA 3S3NA 4XLEA 5JVTA 1FEXA 2MC4A 4RM3A 3OSGA 1JTYA 5IYBJ 2Q0OA 3OYBA 4M9XA 1CGPA 2NOGA 2OD5A 3F21A 2FXAA 1PDNC 3VODA 3PO2J 1IZ1A 3IV5A 4XLCA 3BR3A 3J7AO 3JREA 4DYCA 2BOLA 3QOPA 5KVRA 2XB0X 3GZ5A 2EFQA 2FOKA 4PDKA 4Y4RA 1AWCA 3RQ4A 1D5VA 2EWNA 2E35A 3Q9VA 2W00A 1VQ9I 1G59A 1T08B 3WE2A 3GCMA 3H36A 1MKMA 2MLKA 2DJIA 5D6EA 2HU9A 4IX7A 4XM3A 3OR1C 4AM3A 2VBYA 3RI4A 2FE3A 4HV5A 3U2RA 3HKZA 3WTUC 3QAHA 5K5RA 1IF1A 1LE8B 2QBYB 2VKDA 3KYDB 1H9TA 1Z1DA 1ENHA 4ASNA 1U9NA 3OYHA 1LNWA 2GA1A 2PMZN 4XORA 5EG0B 1SVOA 2WV0A 2Q2EB 2J5PA 4J00A 1ZG5A 4BQNA 3DF8A 2X4HA 3DCFA 1SAUA 3I71A 1OKRA 2M45A 3BY6A 2ZKZA 1FLIA 2CGPA 5A2QK 3QPHA 4N4OB 3KP4A 2M8EA 1O3TA 5GTHC 3RYPA 1FTZA 3K4BA 4JX6A 4ZJZA 4QPOA 1Y0NA 4BQQA 4E7HA 4JX4A 1E0EA 2W4SA 1FJLA 1ZQ3P 3LSMA 3U21A 1XX5A 1PUFA 1A35A 2DK8A 4N9HA 3FXMA 3ZQFA 1MNEA 2L9NA 1MBGA 1QQIA 2CU7A 1T56A 1RR8C 4RAGA 3W3CA 4BHCA 4BXFA 3N4MA 4OU0A 5IYCJ 2LD5A 4NQWB 1WRJA 4IHSA 3E7LA 2XASA 4DYRA 4ENNA 2HYJA 3D5LA 4IKFA 2QGUA 4NUBA 3AKZA 5E1XA 3IAS2 3CCQI 3FDYA 2E7WA 4S04A 3BJ6A 3R0AA 3TMOA 1KU9A 2ESHA 5BNGA 4C3JJ 3GTPJ 1VQNI 3UR3C 4CYDA 2KRFA 3QODA 5KCMA 4A3EJ 2WAFA 1RETA 2R4GA 1QPIA 2H8WA 3JR9A 2R7FA 2X1DA 3L9FA 3ESWB 4M3FA 1TNTA 1XGMA 4H0EA 1WQ2A 3M1CA 3K70C 1IUFA 5LBQA 3HYIA 3I0TA 2ZMEC 2JA7J 4KMUX 4X6AJ 1ERDA 1T0FC 2L9VA 1E3HA 2BGCA 4CO8A 3TO6A 4PFOA 2H1KA 2UXNA 2IXSA 2K4JA 1MJAA 3VYUB 2FJ1A 3ASOH 5GP9A 3ZQHA 1ZYRF 3BR2A 1IRXA 1WJDA 3CF5F 2IEKA 3JW4A 3S93A 1W1WE 3BROA 2DTZA 3FXUA 3T0YA 3DP7A 4EJUA 1GVDA 2EPFA 2DCEA 3B02A 2CO5A 1B8IB 5K7HA 2L7FP 2EINH 2AHQA 1QHHD 1J75A 2HDCA 2OU2A 2RGVA 1LVKA 3GMEA 1R9TJ 4KUMA 1IRFA 1XGNA 1VZ0A 1YIOA 4JQFA 3LSRA 2LY1A 1IUYA 2A68F 1T38A 4G9YA 2CYYA 3DKYA 4ANJA 3JRAA 3LWFA 1GT0C 3ABLH 3BR0A 2OUMA 1ZAOA 4JOMA 3TL4X 1FSEA 1R22A 4M73A 3ASNH 4U0VA 1ZGAA 3TGNA 3TQNA 2GXAA 4WXCA 2VBXA 3CJRB 5HLGA 2DFEA 2QSHX 3FXKA 4ZH4F 3DTIA 3M07A 2LVSA 4K2EA 4HX7A 1JE8A 1DDNA 1JHFA 5F04A 4UY8I 4I2OA 1WPKA 4IL6C 2EZIA 2WV1A 1PVEA 5JHFA 2B0LA 1QBJA 5HS7A 3D0SA 5IP6A 1MMGA 1YQAA 1JUMA 3BG7A 3KP6A 1SFEA 3OIOA 5F1RA 1VQ6I 3LSHA 4TV7A 1L0OC 5DCMB 2Y9YA 2LFBA 4IO9F 3GTOJ 1KYWA 2ZFUA 4RGUA 3KE2A 5FKNA 3KCCA 3VFZA 2LYCA 5D5XB 4A3LJ 1DPUA 2IA1A 4DBQA 5FGMA 4FX4A 1WJCA 4IF4A 1J7KA 3I53A 1JI8A 4CCNA 3KEYA 4PK4A 4B3XA 3RZOJ 1TQPA 4CZCA 5LEJA 2K9QA 4KN4X 1LEAA 2XHKA 5JI6A 1YW7A 4NNJA 1W7PA 2OZUA 3WTXC 5IP9J 2O03A 2OBPA 1SFXA 1B8IA 4RA2A 3IL2A 2JUCA 1N25A 2XAHA 3L2WA 4KNYA 4FE4A 2XGDA 3F3XA 5FLXZ 4IOCF 2XV4S 1BIBA 4PUSA 1Y0UA 1D0XA 4G12A 4RLQA 2ZJQF 1GXPA 2QVOA 1FX7A 1IN5A 1ITYA 4BGDA 1QHGA 1S72I 4KIFA 2JA2A 2PQ8A 4P9UA 3HB9A 2JSCA 3SEZA 2VT2A 3FK6A 4HAMA 1F36A 3Q5FA 1D1CA 1BR2A 4EJVA 1WJEA 2R0QC 1FYLA 5L3DA 3HL2A 4HF2A 5H6QA 3KFWX 3NWTA 4DYQA 4CCJA 3CDHA 3JRDA 2F5EA 2MG4A 2XF7A 4GYGA 4M9ZA 1Z3YA 1FOKA 1MJ9A 2R5ZA 3R6SA 1ZHFA 1GXQA 2L0KA 2Y69H 5LHIA 2DK5A 3ZMSA 2JA5J 2ZNYA 3QWLA 3HOXJ 1Z21A 2K4BA 1S7AA 2HOSA 3A4CA 2HZTA 1R6RA 5AIPA 2DTRA 2DA6A 4Y33A 3ZQIA 4L5IA 1QRYA 2M4GA 4EJOA 1IGNA 4GO1A 1BR1A 4PJMA 4LFUA 3ZCOA 3WTTC 1YRNB 5FJ8J 4BEHB 1MBKA 1X2MA 4GFBA 1FOYA 5EYRA 2ZXHA 1HLVA 3AG4H 1FBUA 2VB6A 2DDAA 4RB2C 1YX5A 5B5EC 5CVUA 1HF0A 3DLAA 3OSFA 5F0HA 1P4XA 2HYGD 3EDPA 3ERMA 5IOZA 4L0ZB 3PJRA 2KIQA 4W1UA 2GZWA 2LF8A 3PO3J 2Y9ZA 4MEXF 4Q47A 1SVLA 4RB1A 3MD2A 1SMYF 2WB1N 2LG4A 2MH2A 1IN4A 2FOWA 2DT6A 2LMDA 3TDZC 3MMYB 4DJAA 5IP7J 3RYRA 2DOFA 4M3BA 3EUHC 2JUGA 1BW5A 2RN7A 3A03A 1EJ9A 1R4NB 2FQ4A 4JX5A 2A61A 2LKPA 2JSPA 2X6OA 1SD6A 1YTYA 1TNSA 2HDDA 3FMSA 4AIKA 2IRFG 5D5VB 5C3EJ 2V1DA 4B4CA 4HLXA 2E5ZA 1FP2A 3GW2A 1BJZA 4RMNA 2JA8J 1MJBA 1ZLKA 4I0BA 4N9IA 2M8GX 1F4KA 1DP3A 2KMUA 1IO2A 1X1DA 2STWA 3V8LA 1G8XA 3I9V2 1HW2A 2JPCA 1YW9A 1JT6A 1OLTA 2HWVA 2P5LC 4XRMA 3SEQA 5HDKA 1VFCA 2M7BA 1F9NA 1VNDA 4C3IJ 5HLTA 3K4KA 1I6XA 1TZLA 4Z6YA 5A2QZ 2QSGX 2CRGA 2W25A 1LKXA 1IW7F 3CQZJ 1KONA 3BG6A 3CCEI 2WC2A 4OIOF 3MKWB 3OYCA 3DWLE 2DOEA 1Y8RB 3GUDA 4FX0A 1QVTA 4QLCU 4RGSA 3LA2A 3PNYA 4M6VA 1YS6A 5J6XA 3ECOA 1QVUA 4HDUA 1O3SA 3CC4I 5L3BA 3HDDA 3OMYA 2L3DA 3I59A 3LA7A 4IXAA 4V2GA 1MH4A 2BYVE 2HPIA 3RPUA 3OYIA 1Q1HA 4ON0A 4BUPA 4J01A 1U2WA 1VQKI 2ZJ2A 2EIJH 5D8KB 1A6IA 2CFOA 1ON1A 5EEAA 3DLLF 5J1YA 1P4WA 3RTRA 3ZMUA 2KRCA 5E8IA 3CUOA 1ZN2A 2ME6A 3V8JA 4IRGA 4XLPF 4DNCA 4B47A 2E2JJ 2L4MA 4LLNA 1I50J 4U7BA 2AQEA 2DODA 3S8PA 2PG4A 2H94A 2UV1A 3M8EA 1MSFC 4WXHA 3W6JB 2F5VA 4IRIA 4KISA 3RKYA 2QYOA 5FB2A 3GO5A 1UJ8A 5EZHA 1XG1A 5DTDA 2W7NA 2IS4A 1QGPA 4FT8A 1VQ8I 4LG3A 2DMQA 5LLQA 3CCUI 1R5ID 2G9WA 4AIHA 4MHGA 4O5VA 5M5XJ 2K86A 2RAEA 3F0CA 4HG2A 2FNAA 2KIMA 2XDVA 2XRNA 1KU3A 2ZXJA 3I4PA 3S2WA 4KA4A 4A3KJ 3VEPA 2CH0A 4GGGA 4R8HA 3ZN1A 2DFHA 4A12A 2HQRA 2D5VA 3O8GA 3BG5A 1E2XA 2LLKA 3BZCA 3Q0UA 5H20A 3BJAA 5F08A 5C4XJ 3QPLA 3EQLF 1HCRA 2V9VA 1UHWA 3RJPA 1Z3XA 2P5VA 4C30A 1T98A 3ABKH 3AG1H 3MZHA 2CFXA 2PN6A 3WHCA 3I58A 5EF6A 2VE9A 4C9YA 2ISYA 1UMQA 2FX0A 3IH4A 2IBDA 4I99C 5B1AH 3GFJA 2VQHA 3HOYJ 2E1CA 1T6SA 5GAHJ 3G4SI 4D7NA 2ZJPF 1K78A 2R5YB 1BIAA 1T95A 2STTA 3A0BC 2R7ZJ 3QU6A 1LVAA 1UFMA 4YG2F 3E0JB 1QPMA 2AXTC 2JVGA 1D3YA 3PNTA 2V9PA 1T33A 1FC3A 1X1BA 5ICFA 2BW3A 1O7FA 3ZQGA 4BBRJ 2HS5A 3CP2A 1APLC 4HX4A 2YR2A 2QEXI 3TW7A 2GQQA 5IPAA 4CYCB 3I4MJ 2GOMA 2Y75A 3IP4B 3SZGA 4ZYGA 3EYIA 1FOXA 1BL0A 3VOEA 2K85A 2F4MB 2JRMA 5DDGA 2DFIA 3OV8A 4R1HA 3C18A 4FTHA 1N77A 4YIRX 4HSRA 4I02A 1QNTA 2PBIA 1BC8C 2G0EA 3FIWA 4I7HA 5ILSA 3VB2A 3W6VA 1ZG3A 1HA8A 2IS1A 4L9VA 1D1BA 1WJBA 1S6LA 4U88A 1LQ1A 3ZQQA 1JGGA 2OV7A 3OYGA 1FP1D 2O8XA 3QP5A 5HS9A 3PQKA 1D8KA 4HV6A 1S3JA 4MLOA 1CF7A 4RBOA 1MMSA 2KP6A 2W85A 3TOBA 4F93B 5F64A 1FYMA 3NQOA 2VPLA 3IAM2 3KZIC 1IN6A 1I1GA 1MDMA 4EGZA 3OL3A 4EVIA 2JJ7A 4ZZDA 3BQZA 1FIAA 2XGCA 5DUIA 2L02A 3E97A 3DPTA 2CW7A 1V4RA 4NDLA 2WTEA 2VJJA 3A1YA 2HKOA 2PI0A 1P7IA 2E19A 1HOMA 2OPTA 2DFFA 4WCGA 2HR3A 5E8GA 5JVGF 2CSOA 1DQUA 3PL8A 3FM5A 2IW5A 2MGQA 4F7ZA 4N0BA 4KIBA 2NRAC 2A6HF 2WBMA 4ZYHA 3MCZA 5E1ZB 3OIPA 1R1UA 2JT1A 2KPMA 4EV0A 2OCEA 1P9QC 5DV5A 3EUAA 3H3UA 2FU4A 3G3ZA 4E7LA 4G6QA 2A5YB 4XK4A 4IQ4A 1UG2A 4M74A 3G73A 2H8RA 1RIOH 3VSKA 1NTCA 2XAUA 1S5LC 1YS7A 3BPXA 1Y6IA 3JTHA 3IHUA 3V7SA 2BY3A 2YPRA 4L9TA 1TL8A 1K6OA 4A0XA 4OMYA 3KEQA 4ZYAA 4Q5SF 4UVAA 3E6MA 3LSKA 1D1AA 3A01A 3JAMK 4NC8A 4EM2A 4CYCA 3BR5A 4WF2A 3I64A 2ZMEA 4WXDA 1T0FA 3GLXA 4B1RA 2OQGA 4BACA 5KNLA 2F4OB 3OYFA 3OYJA 1O3QA 1D0YA 2HZDA 1BI2A 2IA0A 2DA5A 2Y30A 5CPRB 3JTGA 1ZREA 2XPVA 4RDUA 1MIJA 3ZQLA 4FQGA 4CSWA 1FTTA 3SDBA 2IT0A 4FE7A 3CESA 1HQCA 1F43A 1SD7A 2ELJA 5K7ZA 1I6HJ 1TQMA 4OIRF 3BTCA 2F5CA 1WFXA 3DBRB 1SFUA 2NVQJ 2OAZA 2TRTA 3H5RA 5TJJA 2V7FA 4J19A 4HSTA 3GTMJ 3R4KA 3IC7A 2A6EF 1B72B 2EIKH 2VKVA 2PLYA 3TW6A 4LGWA 5BOXA 2YUSA 4A6EA 2VQGA 1WJFA 2K3PA 1HC8A 5HDNA 4BE2A 3VWBA 1IRZA 5KAIC 3F8MA 1VQ4I 3U1DA 4DIQA 3VYSB 1P2FA 5E3NA 1YJWI 1WJAA 5L3EA 1QZZA 1YFHA 2CS3A 4ESJA 2Z9OA 2F4IA 1MSEC 2LY2A 1IV8A 3CDIA 4L18B 1JUSA 2MYSA 3BWGA 2ZXIA 3HZJA 4CH7A 2DA7A 3CCSI 5CKTA 3HC7A 3P9IA 2R7VA 3DV8A 5B66C 2WAQN 4XRFA 3W6KB 2E1OA 2GLOA 2OC6A 4W97A 2LBFA 2FBKA 2JPBA 1GLNA 4L9JA 1AKHB 2EV6A 4U7DA 2HI3A 4BE1A 2QENA 1J0RA 3BR1A 5DCFA 3T8TA 5DM6F 3SZTA 4BYYA 5GAGJ 5HNHA 4ETSA 2FNPA 1IN7A 1JKQC 2QQBA 2RREA 3A0HC 3CO6C 3WGIA 1KQ8A 5DM7F 2H09A 1ZGWA 4EGYA 5AIQA 1FT9A 1UELB 2A05A 3H5AA 3JRFA 3FHZA 3I56I 3I55I 1YO5C 3GF2A 1O7LA 2YX4A 1KA8A 1Z7UA 1TW2A 3C2GA 4LIUA 3HG9A 2EA2A 3KP3A 1RUNA 3K2ZA 5GPCA 2L9SA 1TTYA 1K83J 4M72A 3RSNA 4EJWA 4GCVA 3F23A 1BR4A 1R23A 3FBNB 3G2BA 1ZTRA 1SEUA 1BOAA 1Z77A 4AVZA 3HKZN 3DKXA 2H6BA 2HDWA 2RC4A 1S8NA 4M3DA 4BXXJ 3CMYA 3AG3H 3ZMZA 4IOAF 3SQNA 2A6TA 4PGGA 2QQ9A 3WU1B 4H4KC 1DP7P 2VBZA 1EF4A 3FMQA 3OR2C 1MMNA 3QPSA 1OCZH 2AQFA 2GBYA 2WA0A 1LE8A 2QBYA 3JCUC 2CUZA 5JR3A 3GFLA 3HOZJ 4E7KA 1LDJA 2ZFWA 1HKSA 4UXNA 3TDUC 4ZTFA 2BVLA 4PCQA 4RB3C 2HVSA 4L5EA 5EG0A 2Q2EA 2V6CA 5JLXA 2R7RA 1ZKGA 3L00A 5J47A 2UZKA 5JFRA 1J9IA 2F5FA 1RR7A 5CVVA 2IGMA 3FKJA 1H0MA 3ELKA 2XGXA 3L2RA 4XSZF 4BY1J 3OS1A 2V79A 2VPRA 3MKLA 1ULYA 5B3SH 2ID3A 3HBLA 4M3GA 4AIDA 3QYFA 2AXLA 2DT7B 3FWEA 2Z1DA 3K4NA 4OAYA 3OYMA 1DU6A 1KZHA 5EGOB 1TP4A 5LEKA 1L3LA 3WGHA 4Y15A 5TRDA 5F6FA 1E17A 3SDGA 2QSFX 2HVQA 3WGGA 2R7TA 4Q4ZF 1X1PA 2MA3A 4UUSB 5K5QA 3HSRA 4MEYF 3BTLA 1K4TA 1FY7A 3VPRA 4IZZA 3CMEI 2JK3A 4L9NA 3F72A 3IWFA 2DMUA 1MD0A 4NQWA 2K3FA 3I3LA 3IH2A 4XMYA 3V4GA 2CG4A 2EJRA 2E2IJ 3BZ6A 4M71A 3C2BA 3F8FA 4A3IJ 3EPZA 5TISC 2VKEA 5M5WJ 1U5TB 5DD4A 3G1LA 2KZVA 1TBXA 3EUHA 5KK1A 3EUKL 2Y2ZA 2K9MA 1AU7A 1SMTA 1U8BA 4LG0B 5CQGA 2R93J 1MW7A 3WG9A 4RAZA 4P5OA 4BE0A 3CJTB 5E1WA 3KX2A 4JP0A 3J81K 4YIFA 1OCRH 1W5SA 6PAXA 1PJRA 2R3SA 4BHBA 4E7ZA 3H3ZA 3M7GA 4DGWB 3BG9A 1ETWA 2EFPA 3GXOA 4A2UA 2ISZA 5L3GA 1JGSA 3CP8A 1X19A 3WTSC 2G7UA 5LRSA 4A3MJ 3SHFA 3WU2C 1U78A 3TKYA 3HM5A 2F5DA 3PM1A 1V3FA 4JBAA 4BKXA 3S16J 5LRRA 3BT9A 4C3HJ 2X51A 3KLNA 4XKVA 1AHDP 2HQNA 1VQ7I 4HDVA 2FUG2 4OAZA 3CC2I 3IH3A 2IS2A 2VIXA 1WGXA 2DPUA 1LUJB 3J7AY 1ORKA 1TWCJ 1HDDC 2M7AA 3E5UA 5LHHA 2R92J 3UKGA 3K4JA 1TWHJ 4M6XA 3MZ8A 3SFIA 3I5UA 3LQRA 2WWYA 5K7FA 4LK0F 1FNNA 2EZHA 4I0AA 2EFOA 2P8TA 2MH9A 2L54A 3S1NJ 4XLHA 2PMUA 2XF5A 4G6TB 3NEUA 1BC7C 2VI6A 1RC9A 2RNJA 4PJNA 1N78A 2EFNA 4Y7NJ 2Z3YA 2KHMA 1D8JA 2WADA 3L2CA 3KP5A 2KL4A 5KHDA 3F6VA 3KIOA 1W4MA 1F1ZA 3BR6A 5CVIA 1O4XA 2V9KA 2A07F 4RAYA 2CV1A 2XKPA 3KZYA 2M3AA 2GIZA 3ECHA 2L01A 2CQ7A 4MTEA 2IS6A 5LHGA 2ICWG 1C0WA 1OYYA 2VXDA 3GLLA 4R79A 1B9NA 4M6YA 1OYWA 3JAMZ 1NHAA 2O8KA 1BOBA 4I6ZA 5DCMA 1B4AA 1P4AA 2O9LA 3J7YJ 2X6XA 1S7OA 4I76A 4A0YA 2F6CA 4HEA2 4ZYEA 5EZGA 2VJIA 5GPAA 1IDYA 3GWZA 2KIFA 4F91B 4HF1A 2V6EA 1I1SA 5J8FA 2GXBA 4PZJA 1G3YA 3HGGA 2PJPA 1KU7A 1XDSA 4PJLA 1QO0D 5FKMA 2DQLA 1HW5A 3LOCA 3ZQ7A 3QU3A 2ZBKA 3TO7A 4CUGA 2COMA 4GXOA 4ENMA 2HEOA 1W5TA 3CUQB 3RCOA 4XLAA 1YITI 1EKEA 4A3FJ 2DBBA 2K9SA 3FF5A 3LSGA 3OWTA 2IPQX 3KYCB 2NYXA 3DTKA 3Q3SA 1REPC 4F3QA 4P96A 4KT6A 1YOVB 5BPIA 3BDDA 4FISA 1R5HA 4MGRA 1X4OA 2R7WA 4B44A 1RPWA 1VQMI 3W2WA 1UHSA 5IYDJ 3H9JA 3C2HA 5HLHA 1LDDA 1XS9A 3AL0B 2H6CA 1HKTA 1V55H 2E71A 2E36A 2M87A 3FKIJ 4PFPA 3WTYC 4XLFA 5C4JJ 2G7HA 5IOYA 4CCLA 2QUFA 2NAZA 2YU9J 3COAC 4G7ZF 2ZC2A 3HOVJ 1UG0A 2L9RA 2RKHA 4OIQF 3CMMA 4A3BJ 1KU2A 4HNTA 4AVPA 2XSDC 4E7SA 4YFKF 1JUPA 3K7AJ 3NARA 4CICA 4NBQA 1YYVA 4E4HA 3ZMVA 3CD6I 2EIMH 2E1MB 3M8JA 4II2A 1A36A 2MBFA 1POGA 2I5UA 4U87A 1ZRCA 4HQMA 5ICGA 1UB9A 3GTQJ 2DYSH 1Z6RA 3H92A 3H9GA 3TOAA 2EZKA 4YIIA 3MEXA 3CZ6A 1YRNA 4UUVA 1X4PA 4BEHA 3FXLA 3TP3A 3WODF 3C3WA 1IJWC 1Z0XA 1U6GA 2P6SA 2A5WA 4L0YB 4F55A 1JKRC 2VC0A 1ZARA 1XB4A 1MZBA 2KLOA 4HLYA 4BDYA 3FK7A 2DPDA 3BOQA 1XSVA 4U0YA 2HOEA 1S29A 3OY9A 5K1YA 4FASD 4UB6C 3LNQA 3MKZA 2I10A 2UWMA 5J4YA 3HOWJ 3ZN0A 5CVJA 2MD5A 2VBWA 1MMAA 1OR7C 3FISA 4BH9A 5E79C 2I8DA 1WI9A 3H1CA 4LB5A 3PNVA 3K2AA 2VE8A 3HEFA 2DT5A 5FROA 1WWXA 3NAUA 3E5QA 1H8AC 4NHJA 1IV6A 5ERIA 1GV5A 3IWZA 1PYVA 4MFEA 2K5CA 5LGTA 5EJCA 4BL0B 1X3ZB 1IN8A 3E6BA 5ILUA 3ONQA 2XPUA 4MTDA 1XCVA 3M9AA 4A6DA 3EETA 5EEGA 4AYBA 3L2UA 1X58A 4ESBA 2KQRA 2M0MA 4EEFG 1FBSA 5FRMA 4AD9A 4G7HF 1X1CA 4KICA 1BI3A 4HNUA 5LGNA 3HRUA 1VQ5I 1UZCA 3GX4X 2FD5A 2RNGA 5FKOA 1U3EM 3Q0VA 5FO5A 2X48A 1BI0A 2IGNA 3HGYA 3K69A 3MFKA 3H0DA 2JWTA 4IVNA 1U8RA 1WSUA 2L7ZA 4XICA 3PUFA 3N97A 2EA4A 4F52A 1EH8A 1EA3A 2LR8A 1TWFJ 1MMDA 2CJJA 3AFHA 3M8FA 4C2TA 2CW8A 4A5MA 1X3UA 2FA5A 3HHGA 2XUBA 5H6RA 4B09A 4BQOA 2VODA 4B43A 1T39A 3CCYA 3HRMA 2ECCA 1S7EA 2PJRB 4IEJA 3S32A 4C2UA 3K1MA 3DXJF 4BS9A 4D5CA 3L2VA 4A69C 1YX3A 3FM3A 3W2VA 3BCBA 4UV9A 3VYTB 2CQQA 1ACIA 2Z2SB 3D5RC 3HUGB 4BY7J 2QKLB 3BP8A 5KAFC 2JZYA 1ZR2A 3W2AA 2XKOA 1KYZA 2W82A 1YW8A 1TWGJ 2EB7A 3E3VA 3GTKJ 3HTSB 1Z7LA 2LY9A 3B6CA 2P81A 4A93J 2A69F 2ZSHB 1QZYA 3HIFA 3ZMDA 1IC8A 1IXRC 2GIVA 3J81Z 4BAYA 2ZJRF 5C44J 1E3PA 4S05A 4YRVA 3GTLJ 2K9LA 3WTWC 1I3QJ 3LQQA 3IKVA 1Y39A 1WJ5A 1LFUP 3FMRA 1W0UA 3GVAA 4FETA 2NVYJ 1Y1VJ 1IXCA 4HPQA 2XRLA 2W84A 5E17F 3MAJA 5HOOA 4HYEA 2XC7A 3ZQCA 3RQIA 4XKCA 2BVMA 1OCPA 3DEUA 1GDTA 2W24A 2WY7Q 2VOOA 1XGSA 3LSPA 4CZZA 2GA2A 2NNYA 5FD6A 2ID6A 2C6YA 2Y0MA 5F0FA 2OJED 1UHMA 4IHYA 3CUQC 1V5FA 1XSXA 3V8KA 3MKYB 1B1BA 1I3AA 2DMTA 4KJZA 3K1NA 1WH5A 2FMLA 4G6DA 1V5GA 2P0WA 2X1EA 1HXDA 3K10A 1HW1A 1J09A 5HDGA 4A0ZA 2HXIA 3K1PA 2H1LA 2R7OA 1RKWA 1Q1VA 2DQRA 1YG2A 3CCVI 1I27A 3Q9SA 1SC7A 4Y3OA 4UHTA 4D7MA 3AL0C 1TT0A 2R5YA 3S1RJ 3MWMA 2YU3A 3OYLA 4BJTA 2YX7A 2HOAA 2Y31A 2D45A 2KZGA 3ULQB 3LSJA 1Y1WJ 2R7DA 4XN3A 2MABA 3HSFA 1JJ8C 4DQ2A 3HOUJ 1SFOJ 3KPHA 4RS8A 4UUTA 3D1NI 4AWXB 2W48A 4HQEA 3CLQA 1T8IA 2PMZA 2BY0A 4HNVA 2EV5A 2CUJA 2FRHA 3UNGC 2OA4A 2W1OA 2FQ3A 2BEOA 4EJTA 2E1MC 2IJLA 2XAQA 1HSJA 2CW0F 2CQNA 4P1WA 1ZG1A 1PUFB 3VYRB 3ABTA 3JRHA 3JRCA 4IHVA 1H88C 2VJ4A 1NK3P 2P5KA 2L5QA 2NVXJ 2LNBA 3WTZA 3KP7A 3DU6A 3HXLA 2DN0A 4LITA 4S0HB 1ZH5A 5J1UA 1A5JA 1OCOH 2LP0A 3JRIA 2E2HJ 2JA6J 3B6AA 4N4NB 4XOTA 4CCKA 2NS7A 3E5XA 2L7MP 2QZ8A 1BJAA 3HSEA 5IT9K 2LK2A 3P9KA 4RAFA 5BS6A 2HTJA 2O7OA 3QP6A 2R7UA 2R7XA 1ZELA 3GBGA 2BZTA 2QM3A 1ETQA 2BY1A 3LSTA 2VN2A 1JXSA 3L7WA 2VOPA 2ELKA 5L3CA 1XTAA 2EILH 4ZTJA 2MW8A 1FIPA 4JYKA 1K79A 3IRQA 3FX3A 5GTIC 4XSXF 3GFMA 1OQYA 4Y17A 4NB5A 4DZJA 4LK1F 2IA2A 5D4SA 2O5RA 2B63J 3O6BB 3S15J 1WKMA 4IHXA 1YLFA 5IT3A 4I01A 3CCJI 3OOUA 2Y48A 2DAOA 4CCOA 5J40A 1IDZA 1KQ9A 1DGWY 2NXNB 2CWEA 2GM4A 5M3MJ 1XMXA 2X9DA 2OZ6A 2EZLA 3F8BA 1PUEE 3OOPA 4DOZA 1MBJA 2UXXA 1WI3A 4MQVA 3GTJJ 3DQVC 2PEXA 5BMZA 1ZK8A 2DA1A 1R4MB 2P4WA 3RPUD 1OMIA 2NS8A 4GYIA 5IY5H 2KISA 4YFXF 9ANTA 1TQIA 3C7JA 1G2HA 2Y0SA 1XPXA 3MVPA 2MFZA 5HS8A 2ZNZA 4Y52J 2DMNA 1XN7A 2XAJA 3PFYA 3MZYA 3F8CA 4DBRA 4KITB 3KYLA 4BXUA 1J2XA 1FOWA 2FF4A 3DBLB 2YS9A 2M5WA 2X6WA 2VONA 3T5XA 4E7IA 5ILVA 4UVCA 2DA4A 4XR6A 3HHHA 2COBA 2XROA 4OINF 3H3VK 2P6TA 2K40A 3DPLC 3GZNB 4LLGF 1LDKB 5E3MA 4IQJA 2ZB9A 1GV2A 2DA2A 2XF6A 3L2QA 3TBIA 3K6GA 3RKWA 3VSLA 2VC1A 2PX9A 3FXOA 3S17J 1G3TA 4WWCA 4RGXA 3RZDJ 2D2WA 3WE3A 1QZEA 1YI2I 3ML6A 1M1EB 2P7CB 2DDBA 4CHUA 4D0PA 1HKQA 1B72A 3GEZA 1JTXA 4EATA 2DMPA 1R00A 3PIPF 1HDPA 2MD0A 5K5OA 1H89C 1BW6A 2X1CA 4LMYA 4UNOA 3LSIA 1ZLJA 5DEQA 2QA4I 3HOSA 3CJNA 1MNDA 3O3KA 3K4LA 1LB2A 2TDXA 3OYNA 4KDPA 3LL7A 3ZXSA 2E7XA 2VUMJ 3V7RA 4XONA 5FLMJ 1G3SA 3HTUA 1LEBA 2GXGA 2DXIA 2E34A 3PFIA 2LKSA 2PFBA 2VXZA 2HTSA 2ECBA 5CJ9A 1OISA 2D1VA 1STZA 3RPQA 3F6OA 3BG3A 3GFIA 5HODA 2MLGA 3S14J 1RRJA 2K02A 3QOEA 2QQAA 4GRIA 1MH3A 5EEHA 1SFKA 3JRGA 2KDZA 1TW3A 2Y0SN 2PMHA 1VQPI 4OIPF 3G1OA 2ZSIB 3CLOA 1YJ9I 1CQTA 1NH3A 2RDPA 3FXQA 2ME0A 1ZGJA 1W7PB 2KRHA 1AKHA 3J7ZI 4P55A 4KYWA 4EM1A 1K61A 5BQTA 2OTLI 3JSPA 3NWSA 3ZRGA 3IKTA 2EK5A 2KIUA 1ON2A 4CCMA 5FFZA 5CQEA 1XMAA 2LH9A 2NNNA 1ETOA 3IRRA 1FMWA 1ETKA 5FLVA 4XRSG 1TLHB 3P5JA 1UAAA 1V5EA 4PGHA 1Z6TA 3HPGA 3LAJA 2HQAA 2BE5F 1SD4A 5B1BH 5D5WB 4X1EA 3TO9A 2OQRA 4MNUA 2EH3A 3S2HJ 3J80K 3CCLI 2WY8Q 4G7OF 3BZKA 2M30A 4IRHA 4XBFA 3S1QJ 1FZPB 4O6JA 2L4AA 2Q1ZB 4KIGA 3B73A 5DUKA 3OS2A 3V42A 2R5ZB 1SVMA 2BHZA 1FWZA 1R7JA 4E7JA 3I4NJ 4OWRB 2V4JC 4D1QA 4HBLA 2VT3A 3HOTA 4KN7X 1USSA 4QSHA 1NK2P 1JT0A 4EM0B 5L3FA 2QQ8A 5E3LA 1WVRA 1EH6A 2XIGA 4E70A 1V54H 1MGTA 4KMFA 2Z5UA 3REOA 3CTAA 1A04A 4KT5C 1U0JA 2IAIA 2KJCA 3AAFA 3PSFA 4A3JJ 1QA6A 2BBYA 5FKLA 4CA0A 2BY2A 2HNHA 4F92B 2N8GA 4O3MA 1XGOA 1RESA 3CDLA 4HA8A 5D4RA 1RNLA 5DYMA 1SANA 4A3CJ 4BJ5C 3DU5A 2HKXA 3X2QH 3JSOA 3GTGJ 2FSWA 3VDXA 1AOYA 1K6YA 5HVQC 3S3MA 3G1MA 3S3OA 4HOBA 5J8CA 2JQ7A 1Y56A 1XD7A 5AONA 3BC8A 2EFWA 2HVRA 5D6FA 4ABZA 2VQLA 3OL4A 5EGOA 2KJBA 2P7VB 2CUFA 3K70D 3D5SC 1LJ9A 1GHCA 4I98B 4BNCA 2WB1A 3FHNA 3H5NA 4UUSA 1XSDA 3E6CC 2HYFA 1X2NA 3I54A 5FD5A 4XQFA 2BXZA 1H9GA 2LREA 4IJAA 3RKQA 3CO7C 2IVMA 2NVUB 2VLAA 1KQ0A 2LSOA 3OYAA 4A3GJ 2NS0A 4KFCA 2LDUA 1FPQA 1OR7A 3GZ6A 1XMKA 5CYVA 5F27A 4WK8F 1I39A 1YE9A 3F8NA 1MBEA 1U5TA 2MC3A 1HBXG 1WZ2A 2AO9A 5LFAA 1GUUA 3K9TA 4LG0A 5H2FC 1E3OC 4IHTA 2V1NA 1ETYA 2KDOA 3A02A 4FHTA 3T8RA 1IAWA 3T1BA 2XVCA 2V26A 1R71A 1OYIA 3Q0WA 3S1MJ 2B9SA 2QF7A 4OOIA 2QCOA 4HRIA 1USTA 4ZDLA 3KETA 2HPMA 3PSIA 4ZZLA 3SYTA 2W57A 2Z33A 2K27A 3DTEA 1XDUA 5J3LA 2M1BA 4NC6A 1I5ZA 2IGOA 2BHYA 3I59B 1ODDA 2O6GE 4B8XA 1QU3A 4P9FA 3F22A 1ZRFA 3HPHA 5DD8A 5M3FJ 1OCCH 3CMAI 3PIOF 3DFGA 4IPAA 1S9HA 4BHPA 5E3OA 2M2EA 4V2FA 2LOOA 3RDIA 4RGRA 5IT9Z 3LFKA 1ZR4A 3DBHB 2CQXA 4RLFA 1F5TA 2FEZA 1ETVA 1BBYA 2DA3A 2JMWA 4LD5A 1R58A 2M34A 1FSHA 2F48A 2IP2A 4MQ9F 4BU2A 2ETHA 3FXJA 2DW4A 3RKXA 5D5UB 1B9MA 3M3YJ 2LTPA 2K7LA 3P9CA 4DW6A 2QKMB 3V7CA 4LOCA 2ZXWH 4QWQA 3ROUA 2DJNA 2E60A 1Z91A 2FBHA 4G8XA 4RM2A 2BXYA 3DEEA 1BM9A 2WAEA 3DEWA 4A3DJ 1OFCX 3CCRI 2M9HA 4HX8A 4CGZA 2XB5A 4PSWA 1BN5A 4WX9A 1R1VA 1N75A 4YELA 3OYDA 2M4KA 5EDNA 4U0WA 2JRTA 4GDFA 3KP2A 4XN0A 1EV7A 4BBSJ 3WU0A 4QIWN 3F9KA 3SFZA 2GAUA 3G71I 3KEOA 4YEJA 2LKXA 5LD2C 2OF7A 4ENKA 3A2KA 2HQ5A 4LIVA 5F1JA 3O8HA 3WG7H 1DU0A 4CDGA 4HZFA 3ZGKA 1A31A 3KZZA 1DPRA 2FBIA 2VKHA 1MBHA 1J5YA 2NOJB 2RVCA 1D5YA 2V1XA 2L2OA 1K78B 2CUEA 2LC2A 2XPWA 3FXRA 2JN6A 5GADJ 1WH7A 3OYEA 1IXSB 5FRNA 3CCMI 2GOXB 3CC7I 1OJLA 3R61A 2V1UA 1RI7A 2J5OA 4Y13A 1G3WA 2BW3B 3PQJA 5E18F 3E1SA 1W36C 1U5TC 2CQKA 2CV0A 3CUQA 1G4DA 2X0LA 1LFPA 1IRGA 2XAGA
chains in the Genus database with same CATH topology
1B59A 3E6DA 2ZO4A 3ISPA 1B6AA 2O61A 4RB0A 3U9GA 4ZYDA 4L5JA 3GYHX 3RIRA 1SAXA 3R60A 1RUOA 1Z05A 4EQQA 3R0JA 1R36A 2ZCWA 5CVRA 2LF7A 3FZVA 4HW0A 1CF7B 4ENJA 2RQPA 3C1DA 3DKWA 3LAPA 1JHHA 2FMYA 1MDMB 2Z99A 1J59A 2GWRA 2QLZA 4JK1X 1GVJA 1HSTA 1P92A 1G6NA 4Q48A 3SZPA 5ICEA 1KGSA 4G94A 4UVBA 2H27A 2DU9A 1K7AA 4A5NA 2E1NA 1EH7A 3J80Z 3P7NA 3LA3A 3K0LA 3EYYA 5D8LB 3ZPLA 4CXFA 1W7PD 4Z2YA 2O0YA 2Q8KA 2DI3A 1RZ4A 1ONVA 2KKOA 4UV8A 2YSRA 2ZMEB 2RV8A 3ZP5A 3NRVA 4EMSA 2QWWA 1PP7U 2JTVA 1VTNC 2ACJA 3MQ0A 2DO7A 2A3SA 1OPCA 2D1HA 5ED4A 3HRSA 2ELHA 4YFNF 3KLOA 4AIJA 3HRTA 4ESFA 3O2PE 1DUXC 2ADUA 3M1EA 1O57A 4OMZA 5FFXA 1ZRDA 2ESNA 1UCRA 3BPVA 5JHUA 5ICCA 1FBQA 3BJOA 5FLXK 5E20A 4LB6B 4XLNF 5HLIA 1Z9CA 2EV0A 5BPDA 3ABUA 2XAFA 1BI1A 4HF0A 1T2KA 1O3RA 3QRFF 5CLSA 4LJZF 2AS5F 5LGUA 4I09A 3L09A 3SXYA 3QPTA 3HUGA 1XCBA 2HGCA 4BQAA 2DLLA 3ZMTA 2BV6A 3ERED 1P6RA 2HFHA 4M9SA 1R5GA 2O3FA 2F2EA 1R1TA 1PP8F 3WTVC 1FYKA 4LLLA 1SD5A 5JVTA 2Q0OA 4M9XA 1CGPA 2OD5A 3F21A 2FXAA 1PDNC 3VODA 1IZ1A 3J7AO 3QOPA 5KVRA 3GZ5A 2EFQA 2FOKA 4PDKA 1AWCA 1D5VA 2EWNA 3Q9VA 3WE2A 1MKMA 2MLKA 5D6EA 2VBYA 3RI4A 2FE3A 4HV5A 3U2RA 3WTUC 3QAHA 5K5RA 1IF1A 2QBYB 1H9TA 1Z1DA 4ASNA 1LNWA 2GA1A 2WV0A 2J5PA 1ZG5A 3DF8A 2X4HA 3I71A 1OKRA 2M45A 3BY6A 2ZKZA 1FLIA 2CGPA 5A2QK 3QPHA 3KP4A 2M8EA 1O3TA 3RYPA 2DK8A 4N9HA 1QQIA 4BHCA 3N4MA 4OU0A 1WRJA 4IHSA 2XASA 4ENNA 3D5LA 5E1XA 2E7WA 4S04A 3BJ6A 3R0AA 1KU9A 2ESHA 4CYDA 2KRFA 2R7FA 3L9FA 1TNTA 1XGMA 4H0EA 1WQ2A 5LBQA 3HYIA 3I0TA 4KMUX 2BGCA 4CO8A 3TO6A 2UXNA 2K4JA 1MJAA 1ZYRF 3JW4A 3BROA 3FXUA 3T0YA 3DP7A 4EJUA 3B02A 2CO5A 2HDCA 1J75A 2OU2A 2RGVA 4KUMA 1IRFA 1XGNA 1YIOA 4JQFA 1IUYA 2A68F 1T38A 4G9YA 2CYYA 3LWFA 1ZAOA 1FSEA 1R22A 4M73A 4U0VA 1ZGAA 3TGNA 3TQNA 4WXCA 2VBXA 5HLGA 4ZH4F 4K2EA 4HX7A 1JE8A 1DDNA 1JHFA 4I2OA 2B0LA 1QBJA 5HS7A 3D0SA 1YQAA 3KP6A 1SFEA 5F1RA 4TV7A 1L0OC 5DCMB 1KYWA 4RGUA 3KE2A 3KCCA 3VFZA 5D5XB 1DPUA 2IA1A 5FGMA 4FX4A 4IF4A 1J7KA 3I53A 1TQPA 5LEJA 4KN4X 1LEAA 2XHKA 5JI6A 1YW7A 1W7PA 2OZUA 3WTXC 2O03A 2OBPA 1SFXA 3IL2A 4KNYA 2XAHA 3F3XA 5FLXZ 2XV4S 1BIBA 1GXPA 1Y0UA 2QVOA 1FX7A 1IN5A 4KIFA 2PQ8A 4P9UA 2JSCA 2VT2A 4HAMA 3Q5FA 4EJVA 1FYLA 5L3DA 4HF2A 5H6QA 3KFWX 3CDHA 2F5EA 4GYGA 4M9ZA 1FOKA 1MJ9A 3R6SA 1ZHFA 1GXQA 5LHIA 2DK5A 3ZMSA 2ZNYA 2K4BA 1S7AA 2HZTA 5AIPA 2DTRA 4L5IA 4EJOA 4GO1A 4LFUA 3WTTC 1FBUA 4RB2C 5CVUA 4L0ZB 1P4XA 2HYGD 3EDPA 2GZWA 2LF8A 4MEXF 4Q47A 4RB1A 1SMYF 2MH2A 1IN4A 3TDZC 3RYRA 2RN7A 2A61A 2LKPA 1SD6A 1YTYA 1TNSA 3FMSA 4AIKA 2IRFG 5D5VB 2V1DA 4HLXA 1FP2A 3GW2A 1MJBA 1ZLKA 4I0BA 4N9IA 1F4KA 2STWA 3V8LA 1HW2A 2JPCA 1YW9A 2HWVA 2P5LC 5HDKA 1F9NA 1I6XA 5A2QZ 2W25A 1IW7F 2WC2A 4OIOF 4FX0A 3GUDA 4QLCU 4RGSA 3LA2A 5J6XA 1YS6A 3ECOA 4HDUA 1O3SA 5L3BA 2L3DA 3I59A 3LA7A 4IXAA 2BYVE 3RPUA 1Q1HA 4ON0A 1U2WA 2ZJ2A 5D8KB 1ON1A 1P4WA 3RTRA 3ZMUA 5E8IA 3CUOA 1ZN2A 3V8JA 4IRGA 4XLPF 4DNCA 2L4MA 4LLNA 4U7BA 2PG4A 2H94A 3M8EA 4WXHA 3W6JB 4IRIA 3RKYA 2QYOA 5FB2A 3GO5A 1QGPA 4FT8A 5LLQA 4AIHA 2G9WA 4MHGA 4O5VA 2K86A 3S2WA 2FNAA 1KU3A 2KIMA 2XRNA 2ZXJA 3I4PA 4KA4A 3VEPA 4GGGA 4R8HA 3ZN1A 4A12A 2HQRA 1E2XA 5H20A 3BJAA 3EQLF 2V9VA 1UHWA 3RJPA 2P5VA 1T98A 3MZHA 2CFXA 2PN6A 3I58A 2VE9A 2ISYA 3GFJA 2E1CA 1T6SA 1K78A 1BIAA 2STTA 3QU6A 1LVAA 1UFMA 4YG2F 1QPMA 1D3YA 1FC3A 5ICFA 1O7FA 2HS5A 4HX4A 2YR2A 2GQQA 2Y75A 4ZYGA 3EYIA 3VOEA 5DDGA 2DFIA 3OV8A 4R1HA 3C18A 4I02A 1QNTA 2PBIA 1BC8C 4I7HA 5ILSA 3VB2A 1ZG3A 4L9VA 1S6LA 4U88A 1LQ1A 1FP1D 2O8XA 3QP5A 5HS9A 3PQKA 1D8KA 4HV6A 1S3JA 1CF7A 2W85A 3TOBA 1FYMA 5F64A 3NQOA 1IN6A 1I1GA 1MDMA 4EGZA 4EVIA 4ZZDA 5DUIA 2L02A 3E97A 3DPTA 2PI0A 1V4RA 2WTEA 2HKOA 4WCGA 2HR3A 5E8GA 2CSOA 4F7ZA 2IW5A 3FM5A 2NRAC 4N0BA 4KIBA 2A6HF 4ZYHA 3MCZA 5E1ZB 1R1UA 2JT1A 4EV0A 5DV5A 3H3UA 2FU4A 3G3ZA 4G6QA 2A5YB 4M74A 3G73A 1RIOH 1YS7A 3BPXA 3JTHA 3V7SA 3IHUA 2YPRA 4L9TA 1K6OA 4A0XA 4OMYA 3KEQA 4Q5SF 4UVAA 3E6MA 3JAMK 4EM2A 4WF2A 3I64A 2ZMEA 4WXDA 1T0FA 3GLXA 2OQGA 1O3QA 1BI2A 2IA0A 3JTGA 1ZREA 2IT0A 1HQCA 1SD7A 1TQMA 4OIRF 2F5CA 1SFUA 2OAZA 5TJJA 3R4KA 3IC7A 2A6EF 2PLYA 4LGWA 5BOXA 4A6EA 5HDNA 3F8MA 3U1DA 1P2FA 5L3EA 1QZZA 1YFHA 4ESJA 2Z9OA 4L18B 3BWGA 3P9IA 3DV8A 4XRFA 3W6KB 2FBKA 2JPBA 4L9JA 2EV6A 4U7DA 2QENA 1J0RA 5DCFA 3T8TA 3SZTA 4BYYA 4ETSA 2FNPA 1IN7A 2QQBA 3CO6C 3WGIA 1KQ8A 2H09A 4EGYA 5AIQA 1FT9A 3FHZA 1YO5C 3GF2A 1O7LA 2YX4A 1KA8A 1Z7UA 1TW2A 2EA2A 3KP3A 1RUNA 3K2ZA 1TTYA 4M72A 4EJWA 4GCVA 3F23A 1R23A 1BOAA 2H6BA 2RC4A 1S8NA 3ZMZA 3SQNA 4PGGA 2QQ9A 3WU1B 1DP7P 2VBZA 3FMQA 2QBYA 5JR3A 3GFLA 1LDJA 2ZFWA 1HKSA 4UXNA 3TDUC 4PCQA 4RB3C 2Q2EA 2V6CA 3L00A 2UZKA 5JFRA 1J9IA 2F5FA 5CVVA 1H0MA 3ELKA 2XGXA 4XSZF 2V79A 1ULYA 2AXLA 3FWEA 5LEKA 1L3LA 3WGHA 4Y15A 5TRDA 5F6FA 1E17A 3WGGA 4Q4ZF 2MA3A 5K5QA 3HSRA 4MEYF 1FY7A 4L9NA 3F72A 3IWFA 1MD0A 4NQWA 3V4GA 2CG4A 2EJRA 3BZ6A 4M71A 3F8FA 1U5TB 5DD4A 1TBXA 3EUHA 5KK1A 1SMTA 4LG0B 3WG9A 4RAZA 4P5OA 5E1WA 3J81K 4YIFA 6PAXA 1W5SA 2R3SA 4BHBA 3H3ZA 3M7GA 3GXOA 2EFPA 4A2UA 2ISZA 5L3GA 1JGSA 3WTSC 2G7UA 5LRSA 3SHFA 1U78A 3TKYA 2F5DA 4JBAA 1V3FA 5LRRA 3KLNA 2HQNA 4HDVA 2DPUA 3E5UA 5LHHA 4M6XA 3I5UA 3LQRA 2WWYA 4LK0F 1FNNA 4I0AA 2EFOA 2P8TA 2MH9A 2L54A 2PMUA 3NEUA 1BC7C 2RNJA 2EFNA 2Z3YA 1D8JA 3L2CA 3KP5A 3F6VA 1W4MA 1F1ZA 5CVIA 2A07F 4RAYA 2XKPA 3KZYA 3ECHA 2L01A 4MTEA 5LHGA 1C0WA 1OYYA 4R79A 1B9NA 4M6YA 1OYWA 3JAMZ 1NHAA 5DCMA 1B4AA 1P4AA 1S7OA 4A0YA 4ZYEA 3GWZA 2KIFA 4HF1A 1I1SA 5J8FA 2GXBA 4PZJA 1G3YA 2PJPA 1KU7A 1XDSA 1QO0D 2DQLA 1HW5A 3ZQ7A 3QU3A 2ZBKA 3TO7A 2COMA 4GXOA 4ENMA 2HEOA 1W5TA 3CUQB 2DBBA 3FF5A 2IPQX 2NYXA 1REPC 4P96A 5BPIA 3BDDA 1R5HA 4MGRA 5HLHA 1LDDA 2H6CA 1HKTA 2M87A 3WTYC 2G7HA 2QUFA 2NAZA 3COAC 4G7ZF 2RKHA 4OIQF 1KU2A 4AVPA 4YFKF 4CICA 1YYVA 3ZMVA 2MBFA 1ZRCA 4HQMA 5ICGA 1UB9A 1Z6RA 3H92A 3TOAA 4YIIA 3MEXA 4UUVA 3WODF 3C3WA 1U6GA 2P6SA 4L0YB 2VC0A 1ZARA 1XB4A 1MZBA 4HLYA 2DPDA 3BOQA 1XSVA 4U0YA 2HOEA 1S29A 5K1YA 2UWMA 3ZN0A 5CVJA 2MD5A 2VBWA 4BH9A 1WI9A 4LB5A 2VE8A 2DT5A 1WWXA 3E5QA 4NHJA 5ERIA 3IWZA 5LGTA 3E6BA 1IN8A 5ILUA 4MTDA 1XCVA 3M9AA 4A6DA 3EETA 5EEGA 4ESBA 1FBSA 4AD9A 4G7HF 4KICA 1BI3A 5LGNA 3HRUA 3GX4X 1U3EM 5FO5A 1BI0A 3MFKA 3K69A 4IVNA 1U8RA 1WSUA 3N97A 2EA4A 1EH8A 3M8FA 4A5MA 1X3UA 2FA5A 3HHGA 2XUBA 5H6RA 4B09A 2VODA 1T39A 3HRMA 3K1MA 3DXJF 3FM3A 4UV9A 3BP8A 2JZYA 2XKOA 1KYZA 1YW8A 2EB7A 3E3VA 3HTSB 2A69F 1QZYA 3HIFA 3ZMDA 1IXRC 2GIVA 3J81Z 4BAYA 4S05A 3WTWC 3LQQA 3IKVA 3FMRA 3GVAA 1IXCA 2W84A 5E17F 3MAJA 5HOOA 4HYEA 3DEUA 2W24A 2VOOA 1XGSA 2NNYA 2GA2A 4CZZA 5FD6A 2C6YA 2Y0MA 1UHMA 3CUQC 1XSXA 3V8KA 1B1BA 3K1NA 2FMLA 4G6DA 1HXDA 1HW1A 5HDGA 4A0ZA 3K1PA 2DQRA 1YG2A 1I27A 3Q9SA 4UHTA 3MWMA 2YU3A 2YX7A 2D45A 3ULQB 2R7DA 3HSFA 4DQ2A 4RS8A 4AWXB 4HQEA 2EV5A 2FRHA 2OA4A 2FQ3A 2BEOA 4EJTA 2IJLA 2XAQA 1HSJA 2CW0F 1ZG1A 3ABTA 2P5KA 2LNBA 3WTZA 3KP7A 1ZH5A 3E5XA 2QZ8A 1BJAA 3HSEA 5IT9K 3P9KA 5BS6A 2HTJA 3QP6A 2QM3A 3LSTA 2VN2A 1JXSA 3L7WA 2VOPA 5L3CA 1K79A 3IRQA 3FX3A 4XSXF 3GFMA 4Y17A 4NB5A 4LK1F 2IA2A 5D4SA 3O6BB 1WKMA 1YLFA 5IT3A 4I01A 2Y48A 2DAOA 1KQ9A 2CWEA 2OZ6A 3F8BA 1PUEE 3OOPA 2UXXA 4MQVA 3DQVC 2PEXA 5BMZA 2P4WA 1OMIA 4GYIA 4YFXF 1TQIA 3C7JA 5HS8A 2ZNZA 1XN7A 2XAJA 3MZYA 3F8CA 4BXUA 1J2XA 2FF4A 2VONA 2M5WA 3T5XA 5ILVA 4UVCA 3HHHA 2XROA 4OINF 2P6TA 3DPLC 4LLGF 1LDKB 3RKWA 2VC1A 1G3TA 4WWCA 4RGXA 2D2WA 3WE3A 3ML6A 2P7CB 4CHUA 4D0PA 1HKQA 3GEZA 1R00A 5K5OA 4LMYA 4UNOA 1ZLJA 5DEQA 3HOSA 3CJNA 3O3KA 4KDPA 1LB2A 2TDXA 2E7XA 3V7RA 1G3SA 3HTUA 1LEBA 2GXGA 3PFIA 2PFBA 2VXZA 2HTSA 5CJ9A 2D1VA 1STZA 3RPQA 3F6OA 3GFIA 2MLGA 2K02A 2QQAA 5EEHA 1TW3A 2PMHA 4OIPF 3CLOA 2RDPA 3FXQA 1ZGJA 1W7PB 4P55A 4KYWA 4EM1A 5BQTA 3JSPA 3IKTA 2EK5A 2KIUA 1ON2A 5FFZA 1XMAA 2NNNA 3IRRA 1TLHB 4PGHA 1Z6TA 3LAJA 2BE5F 1SD4A 5D5WB 3TO9A 2OQRA 4MNUA 3J80K 4G7OF 2M30A 4IRHA 4XBFA 1FZPB 4O6JA 2L4AA 4KIGA 3B73A 5DUKA 1FWZA 1R7JA 4HBLA 2VT3A 3HOTA 4KN7X 1USSA 4EM0B 5L3FA 1EH6A 2XIGA 4E70A 1MGTA 4KMFA 2Z5UA 3REOA 3CTAA 1A04A 4KT5C 3AAFA 2KJCA 2BBYA 4O3MA 1XGOA 5D4RA 4HA8A 1RNLA 5DYMA 2HKXA 3JSOA 2FSWA 1AOYA 5HVQC 4HOBA 5J8CA 1XD7A 5AONA 2EFWA 5D6FA 2KJBA 2P7VB 1LJ9A 1GHCA 4I98B 4BNCA 1XSDA 3E6CC 2HYFA 3I54A 5FD5A 4IJAA 1H9GA 3CO7C 2IVMA 1KQ0A 2LSOA 2NS0A 4KFCA 2LDUA 1FPQA 1OR7A 3GZ6A 1XMKA 5CYVA 4WK8F 3F8NA 1U5TA 2MC3A 1HBXG 3K9TA 4LG0A 4IHTA 4FHTA 3T8RA 1IAWA 3T1BA 2XVCA 1OYIA 4OOIA 1USTA 3KETA 4ZZLA 2Z33A 2W57A 2K27A 1XDUA 2M1BA 1I5ZA 3I59B 1ODDA 2O6GE 4B8XA 4P9FA 3F22A 1ZRFA 5DD8A 3DFGA 4IPAA 4BHPA 3RDIA 4RGRA 5IT9Z 3LFKA 1F5TA 2FEZA 1BBYA 4LD5A 1R58A 1FSHA 2IP2A 4MQ9F 2ETHA 2DW4A 3RKXA 5D5UB 1B9MA 2K7LA 3P9CA 3V7CA 4QWQA 3ROUA 2FBHA 1Z91A 4G8XA 1BM9A 4HX8A 4CGZA 1BN5A 4WX9A 1R1VA 4U0WA 2JRTA 3KP2A 1EV7A 3WU0A 3SFZA 2GAUA 3KEOA 4ENKA 4CDGA 4HZFA 3KZZA 1DPRA 2FBIA 1J5YA 2RVCA 2V1XA 1K78B 3FXRA 1IXSB 3R61A 2V1UA 1RI7A 2J5OA 4Y13A 1G3WA 3PQJA 5E18F 1U5TC 2CQKA 3CUQA 1G4DA 2X0LA 1IRGA 2XAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B59 A;  3E6D A;  2ZO4 A;  3ISP A;  1B6A A;  2O61 A;  4RB0 A;  3U9G A;  4ZYD A;  4L5J A;  3GYH X;  3RIR A;  1SAX A;  3R60 A;  1RUO A;  1Z05 A;  4EQQ A;  3R0J A;  1R36 A;  2ZCW A;  5CVR A;  2LF7 A;  3FZV A;  4HW0 A;  1CF7 B;  4ENJ A;  2RQP A;  3C1D A;  3DKW A;  3LAP A;  1JHH A;  2FMY A;  1MDM B;  2Z99 A;  1J59 A;  2GWR A;  2QLZ A;  4JK1 X;  1GVJ A;  1HST A;  1P92 A;  1G6N A;  4Q48 A;  3SZP A;  5ICE A;  1KGS A;  4G94 A;  4UVB A;  2H27 A;  2DU9 A;  1K7A A;  4A5N A;  2E1N A;  1EH7 A;  3J80 Z;  3P7N A;  3LA3 A;  3K0L A;  3EYY A;  5D8L B;  3ZPL A;  4CXF A;  1W7P D;  4Z2Y A;  2O0Y A;  2Q8K A;  2DI3 A;  1RZ4 A;  1ONV A;  2KKO A;  4UV8 A;  2YSR A;  2ZME B;  2RV8 A;  3ZP5 A;  3NRV A;  4EMS A;  2QWW A;  1PP7 U;  2JTV A;  1VTN C;  2ACJ A;  3MQ0 A;  2DO7 A;  2A3S A;  1OPC A;  2D1H A;  5ED4 A;  3HRS A;  2ELH A;  4YFN F;  3KLO A;  4AIJ A;  3HRT A;  4ESF A;  3O2P E;  1DUX C;  2ADU A;  3M1E A;  1O57 A;  4OMZ A;  5FFX A;  1ZRD A;  2ESN A;  1UCR A;  3BPV A;  5JHU A;  5ICC A;  1FBQ A;  3BJO A;  5FLX K;  5E20 A;  4LB6 B;  4XLN F;  5HLI A;  1Z9C A;  2EV0 A;  5BPD A;  3ABU A;  2XAF A;  1BI1 A;  4HF0 A;  1T2K A;  1O3R A;  3QRF F;  5CLS A;  4LJZ F;  2AS5 F;  5LGU A;  4I09 A;  3L09 A;  3SXY A;  3QPT A;  3HUG A;  1XCB A;  2HGC A;  4BQA A;  2DLL A;  3ZMT A;  2BV6 A;  3ERE D;  1P6R A;  2HFH A;  4M9S A;  1R5G A;  2O3F A;  2F2E A;  1R1T A;  1PP8 F;  3WTV C;  1FYK A;  4LLL A;  1SD5 A;  5JVT A;  2Q0O A;  4M9X A;  1CGP A;  2OD5 A;  3F21 A;  2FXA A;  1PDN C;  3VOD A;  1IZ1 A;  3J7A O;  3QOP A;  5KVR A;  3GZ5 A;  2EFQ A;  2FOK A;  4PDK A;  1AWC A;  1D5V A;  2EWN A;  3Q9V A;  3WE2 A;  1MKM A;  2MLK A;  5D6E A;  2VBY A;  3RI4 A;  2FE3 A;  4HV5 A;  3U2R A;  3WTU C;  3QAH A;  5K5R A;  1IF1 A;  2QBY B;  1H9T A;  1Z1D A;  4ASN A;  1LNW A;  2GA1 A;  2WV0 A;  2J5P A;  1ZG5 A;  3DF8 A;  2X4H A;  3I71 A;  1OKR A;  2M45 A;  3BY6 A;  2ZKZ A;  1FLI A;  2CGP A;  5A2Q K;  3QPH A;  3KP4 A;  2M8E A;  1O3T A;  3RYP A;  2DK8 A;  4N9H A;  1QQI A;  4BHC A;  3N4M A;  4OU0 A;  1WRJ A;  4IHS A;  2XAS A;  4ENN A;  3D5L A;  5E1X A;  2E7W A;  4S04 A;  3BJ6 A;  3R0A A;  1KU9 A;  2ESH A;  4CYD A;  2KRF A;  2R7F A;  3L9F A;  1TNT A;  1XGM A;  4H0E A;  1WQ2 A;  5LBQ A;  3HYI A;  3I0T A;  4KMU X;  2BGC A;  4CO8 A;  3TO6 A;  2UXN A;  2K4J A;  1MJA A;  1ZYR F;  3JW4 A;  3BRO A;  3FXU A;  3T0Y A;  3DP7 A;  4EJU A;  3B02 A;  2CO5 A;  2HDC A;  1J75 A;  2OU2 A;  2RGV A;  4KUM A;  1IRF A;  1XGN A;  1YIO A;  4JQF A;  1IUY A;  2A68 F;  1T38 A;  4G9Y A;  2CYY A;  3LWF A;  1ZAO A;  1FSE A;  1R22 A;  4M73 A;  4U0V A;  1ZGA A;  3TGN A;  3TQN A;  4WXC A;  2VBX A;  5HLG A;  4ZH4 F;  4K2E A;  4HX7 A;  1JE8 A;  1DDN A;  1JHF A;  4I2O A;  2B0L A;  1QBJ A;  5HS7 A;  3D0S A;  1YQA A;  3KP6 A;  1SFE A;  5F1R A;  4TV7 A;  1L0O C;  5DCM B;  1KYW A;  4RGU A;  3KE2 A;  3KCC A;  3VFZ A;  5D5X B;  1DPU A;  2IA1 A;  5FGM A;  4FX4 A;  4IF4 A;  1J7K A;  3I53 A;  1TQP A;  5LEJ A;  4KN4 X;  1LEA A;  2XHK A;  5JI6 A;  1YW7 A;  1W7P A;  2OZU A;  3WTX C;  2O03 A;  2OBP A;  1SFX A;  3IL2 A;  4KNY A;  2XAH A;  3F3X A;  5FLX Z;  2XV4 S;  1BIB A;  1GXP A;  1Y0U A;  2QVO A;  1FX7 A;  1IN5 A;  4KIF A;  2PQ8 A;  4P9U A;  2JSC A;  2VT2 A;  4HAM A;  3Q5F A;  4EJV A;  1FYL A;  5L3D A;  4HF2 A;  5H6Q A;  3KFW X;  3CDH A;  2F5E A;  4GYG A;  4M9Z A;  1FOK A;  1MJ9 A;  3R6S A;  1ZHF A;  1GXQ A;  5LHI A;  2DK5 A;  3ZMS A;  2ZNY A;  2K4B A;  1S7A A;  2HZT A;  5AIP A;  2DTR A;  4L5I A;  4EJO A;  4GO1 A;  4LFU A;  3WTT C;  1FBU A;  4RB2 C;  5CVU A;  4L0Z B;  1P4X A;  2HYG D;  3EDP A;  2GZW A;  2LF8 A;  4MEX F;  4Q47 A;  4RB1 A;  1SMY F;  2MH2 A;  1IN4 A;  3TDZ C;  3RYR A;  2RN7 A;  2A61 A;  2LKP A;  1SD6 A;  1YTY A;  1TNS A;  3FMS A;  4AIK A;  2IRF G;  5D5V B;  2V1D A;  4HLX A;  1FP2 A;  3GW2 A;  1MJB A;  1ZLK A;  4I0B A;  4N9I A;  1F4K A;  2STW A;  3V8L A;  1HW2 A;  2JPC A;  1YW9 A;  2HWV A;  2P5L C;  5HDK A;  1F9N A;  1I6X A;  5A2Q Z;  2W25 A;  1IW7 F;  2WC2 A;  4OIO F;  4FX0 A;  3GUD A;  4QLC U;  4RGS A;  3LA2 A;  5J6X A;  1YS6 A;  3ECO A;  4HDU A;  1O3S A;  5L3B A;  2L3D A;  3I59 A;  3LA7 A;  4IXA A;  2BYV E;  3RPU A;  1Q1H A;  4ON0 A;  1U2W A;  2ZJ2 A;  5D8K B;  1ON1 A;  1P4W A;  3RTR A;  3ZMU A;  5E8I A;  3CUO A;  1ZN2 A;  3V8J A;  4IRG A;  4XLP F;  4DNC A;  2L4M A;  4LLN A;  4U7B A;  2PG4 A;  2H94 A;  3M8E A;  4WXH A;  3W6J B;  4IRI A;  3RKY A;  2QYO A;  5FB2 A;  3GO5 A;  1QGP A;  4FT8 A;  5LLQ A;  4AIH A;  2G9W A;  4MHG A;  4O5V A;  2K86 A;  3S2W A;  2FNA A;  1KU3 A;  2KIM A;  2XRN A;  2ZXJ A;  3I4P A;  4KA4 A;  3VEP A;  4GGG A;  4R8H A;  3ZN1 A;  4A12 A;  2HQR A;  1E2X A;  5H20 A;  3BJA A;  3EQL F;  2V9V A;  1UHW A;  3RJP A;  2P5V A;  1T98 A;  3MZH A;  2CFX A;  2PN6 A;  3I58 A;  2VE9 A;  2ISY A;  3GFJ A;  2E1C A;  1T6S A;  1K78 A;  1BIA A;  2STT A;  3QU6 A;  1LVA A;  1UFM A;  4YG2 F;  1QPM A;  1D3Y A;  1FC3 A;  5ICF A;  1O7F A;  2HS5 A;  4HX4 A;  2YR2 A;  2GQQ A;  2Y75 A;  4ZYG A;  3EYI A;  3VOE A;  5DDG A;  2DFI A;  3OV8 A;  4R1H A;  3C18 A;  4I02 A;  1QNT A;  2PBI A;  1BC8 C;  4I7H A;  5ILS A;  3VB2 A;  1ZG3 A;  4L9V A;  1S6L A;  4U88 A;  1LQ1 A;  1FP1 D;  2O8X A;  3QP5 A;  5HS9 A;  3PQK A;  1D8K A;  4HV6 A;  1S3J A;  1CF7 A;  2W85 A;  3TOB A;  1FYM A;  5F64 A;  3NQO A;  1IN6 A;  1I1G A;  1MDM A;  4EGZ A;  4EVI A;  4ZZD A;  5DUI A;  2L02 A;  3E97 A;  3DPT A;  2PI0 A;  1V4R A;  2WTE A;  2HKO A;  4WCG A;  2HR3 A;  5E8G A;  2CSO A;  4F7Z A;  2IW5 A;  3FM5 A;  2NRA C;  4N0B A;  4KIB A;  2A6H F;  4ZYH A;  3MCZ A;  5E1Z B;  1R1U A;  2JT1 A;  4EV0 A;  5DV5 A;  3H3U A;  2FU4 A;  3G3Z A;  4G6Q A;  2A5Y B;  4M74 A;  3G73 A;  1RIO H;  1YS7 A;  3BPX A;  3JTH A;  3V7S A;  3IHU A;  2YPR A;  4L9T A;  1K6O A;  4A0X A;  4OMY A;  3KEQ A;  4Q5S F;  4UVA A;  3E6M A;  3JAM K;  4EM2 A;  4WF2 A;  3I64 A;  2ZME A;  4WXD A;  1T0F A;  3GLX A;  2OQG A;  1O3Q A;  1BI2 A;  2IA0 A;  3JTG A;  1ZRE A;  2IT0 A;  1HQC A;  1SD7 A;  1TQM A;  4OIR F;  2F5C A;  1SFU A;  2OAZ A;  5TJJ A;  3R4K A;  3IC7 A;  2A6E F;  2PLY A;  4LGW A;  5BOX A;  4A6E A;  5HDN A;  3F8M A;  3U1D A;  1P2F A;  5L3E A;  1QZZ A;  1YFH A;  4ESJ A;  2Z9O A;  4L18 B;  3BWG A;  3P9I A;  3DV8 A;  4XRF A;  3W6K B;  2FBK A;  2JPB A;  4L9J A;  2EV6 A;  4U7D A;  2QEN A;  1J0R A;  5DCF A;  3T8T A;  3SZT A;  4BYY A;  4ETS A;  2FNP A;  1IN7 A;  2QQB A;  3CO6 C;  3WGI A;  1KQ8 A;  2H09 A;  4EGY A;  5AIQ A;  1FT9 A;  3FHZ A;  1YO5 C;  3GF2 A;  1O7L A;  2YX4 A;  1KA8 A;  1Z7U A;  1TW2 A;  2EA2 A;  3KP3 A;  1RUN A;  3K2Z A;  1TTY A;  4M72 A;  4EJW A;  4GCV A;  3F23 A;  1R23 A;  1BOA A;  2H6B A;  2RC4 A;  1S8N A;  3ZMZ A;  3SQN A;  4PGG A;  2QQ9 A;  3WU1 B;  1DP7 P;  2VBZ A;  3FMQ A;  2QBY A;  5JR3 A;  3GFL A;  1LDJ A;  2ZFW A;  1HKS A;  4UXN A;  3TDU C;  4PCQ A;  4RB3 C;  2Q2E A;  2V6C A;  3L00 A;  2UZK A;  5JFR A;  1J9I A;  2F5F A;  5CVV A;  1H0M A;  3ELK A;  2XGX A;  4XSZ F;  2V79 A;  1ULY A;  2AXL A;  3FWE A;  5LEK A;  1L3L A;  3WGH A;  4Y15 A;  5TRD A;  5F6F A;  1E17 A;  3WGG A;  4Q4Z F;  2MA3 A;  5K5Q A;  3HSR A;  4MEY F;  1FY7 A;  4L9N A;  3F72 A;  3IWF A;  1MD0 A;  4NQW A;  3V4G A;  2CG4 A;  2EJR A;  3BZ6 A;  4M71 A;  3F8F A;  1U5T B;  5DD4 A;  1TBX A;  3EUH A;  5KK1 A;  1SMT A;  4LG0 B;  3WG9 A;  4RAZ A;  4P5O A;  5E1W A;  3J81 K;  4YIF A;  6PAX A;  1W5S A;  2R3S A;  4BHB A;  3H3Z A;  3M7G A;  3GXO A;  2EFP A;  4A2U A;  2ISZ A;  5L3G A;  1JGS A;  3WTS C;  2G7U A;  5LRS A;  3SHF A;  1U78 A;  3TKY A;  2F5D A;  4JBA A;  1V3F A;  5LRR A;  3KLN A;  2HQN A;  4HDV A;  2DPU A;  3E5U A;  5LHH A;  4M6X A;  3I5U A;  3LQR A;  2WWY A;  4LK0 F;  1FNN A;  4I0A A;  2EFO A;  2P8T A;  2MH9 A;  2L54 A;  2PMU A;  3NEU A;  1BC7 C;  2RNJ A;  2EFN A;  2Z3Y A;  1D8J A;  3L2C A;  3KP5 A;  3F6V A;  1W4M A;  1F1Z A;  5CVI A;  2A07 F;  4RAY A;  2XKP A;  3KZY A;  3ECH A;  2L01 A;  4MTE A;  5LHG A;  1C0W A;  1OYY A;  4R79 A;  1B9N A;  4M6Y A;  1OYW A;  3JAM Z;  1NHA A;  5DCM A;  1B4A A;  1P4A A;  1S7O A;  4A0Y A;  4ZYE A;  3GWZ A;  2KIF A;  4HF1 A;  1I1S A;  5J8F A;  2GXB A;  4PZJ A;  1G3Y A;  2PJP A;  1KU7 A;  1XDS A;  1QO0 D;  2DQL A;  1HW5 A;  3ZQ7 A;  3QU3 A;  2ZBK A;  3TO7 A;  2COM A;  4GXO A;  4ENM A;  2HEO A;  1W5T A;  3CUQ B;  2DBB A;  3FF5 A;  2IPQ X;  2NYX A;  1REP C;  4P96 A;  5BPI A;  3BDD A;  1R5H A;  4MGR A;  5HLH A;  1LDD A;  2H6C A;  1HKT A;  2M87 A;  3WTY C;  2G7H A;  2QUF A;  2NAZ A;  3COA C;  4G7Z F;  2RKH A;  4OIQ F;  1KU2 A;  4AVP A;  4YFK F;  4CIC A;  1YYV A;  3ZMV A;  2MBF A;  1ZRC A;  4HQM A;  5ICG A;  1UB9 A;  1Z6R A;  3H92 A;  3TOA A;  4YII A;  3MEX A;  4UUV A;  3WOD F;  3C3W A;  1U6G A;  2P6S A;  4L0Y B;  2VC0 A;  1ZAR A;  1XB4 A;  1MZB A;  4HLY A;  2DPD A;  3BOQ A;  1XSV A;  4U0Y A;  2HOE A;  1S29 A;  5K1Y A;  2UWM A;  3ZN0 A;  5CVJ A;  2MD5 A;  2VBW A;  4BH9 A;  1WI9 A;  4LB5 A;  2VE8 A;  2DT5 A;  1WWX A;  3E5Q A;  4NHJ A;  5ERI A;  3IWZ A;  5LGT A;  3E6B A;  1IN8 A;  5ILU A;  4MTD A;  1XCV A;  3M9A A;  4A6D A;  3EET A;  5EEG A;  4ESB A;  1FBS A;  4AD9 A;  4G7H F;  4KIC A;  1BI3 A;  5LGN A;  3HRU A;  3GX4 X;  1U3E M;  5FO5 A;  1BI0 A;  3MFK A;  3K69 A;  4IVN A;  1U8R A;  1WSU A;  3N97 A;  2EA4 A;  1EH8 A;  3M8F A;  4A5M A;  1X3U A;  2FA5 A;  3HHG A;  2XUB A;  5H6R A;  4B09 A;  2VOD A;  1T39 A;  3HRM A;  3K1M A;  3DXJ F;  3FM3 A;  4UV9 A;  3BP8 A;  2JZY A;  2XKO A;  1KYZ A;  1YW8 A;  2EB7 A;  3E3V A;  3HTS B;  2A69 F;  1QZY A;  3HIF A;  3ZMD A;  1IXR C;  2GIV A;  3J81 Z;  4BAY A;  4S05 A;  3WTW C;  3LQQ A;  3IKV A;  3FMR A;  3GVA A;  1IXC A;  2W84 A;  5E17 F;  3MAJ A;  5HOO A;  4HYE A;  3DEU A;  2W24 A;  2VOO A;  1XGS A;  2NNY A;  2GA2 A;  4CZZ A;  5FD6 A;  2C6Y A;  2Y0M A;  1UHM A;  3CUQ C;  1XSX A;  3V8K A;  1B1B A;  3K1N A;  2FML A;  4G6D A;  1HXD A;  1HW1 A;  5HDG A;  4A0Z A;  3K1P A;  2DQR A;  1YG2 A;  1I27 A;  3Q9S A;  4UHT A;  3MWM A;  2YU3 A;  2YX7 A;  2D45 A;  3ULQ B;  2R7D A;  3HSF A;  4DQ2 A;  4RS8 A;  4AWX B;  4HQE A;  2EV5 A;  2FRH A;  2OA4 A;  2FQ3 A;  2BEO A;  4EJT A;  2IJL A;  2XAQ A;  1HSJ A;  2CW0 F;  1ZG1 A;  3ABT A;  2P5K A;  2LNB A;  3WTZ A;  3KP7 A;  1ZH5 A;  3E5X A;  2QZ8 A;  1BJA A;  3HSE A;  5IT9 K;  3P9K A;  5BS6 A;  2HTJ A;  3QP6 A;  2QM3 A;  3LST A;  2VN2 A;  1JXS A;  3L7W A;  2VOP A;  5L3C A;  1K79 A;  3IRQ A;  3FX3 A;  4XSX F;  3GFM A;  4Y17 A;  4NB5 A;  4LK1 F;  2IA2 A;  5D4S A;  3O6B B;  1WKM A;  1YLF A;  5IT3 A;  4I01 A;  2Y48 A;  2DAO A;  1KQ9 A;  2CWE A;  2OZ6 A;  3F8B A;  1PUE E;  3OOP A;  2UXX A;  4MQV A;  3DQV C;  2PEX A;  5BMZ A;  2P4W A;  1OMI A;  4GYI A;  4YFX F;  1TQI A;  3C7J A;  5HS8 A;  2ZNZ A;  1XN7 A;  2XAJ A;  3MZY A;  3F8C A;  4BXU A;  1J2X A;  2FF4 A;  2VON A;  2M5W A;  3T5X A;  5ILV A;  4UVC A;  3HHH A;  2XRO A;  4OIN F;  2P6T A;  3DPL C;  4LLG F;  1LDK B;  3RKW A;  2VC1 A;  1G3T A;  4WWC A;  4RGX A;  2D2W A;  3WE3 A;  3ML6 A;  2P7C B;  4CHU A;  4D0P A;  1HKQ A;  3GEZ A;  1R00 A;  5K5O A;  4LMY A;  4UNO A;  1ZLJ A;  5DEQ A;  3HOS A;  3CJN A;  3O3K A;  4KDP A;  1LB2 A;  2TDX A;  2E7X A;  3V7R A;  1G3S A;  3HTU A;  1LEB A;  2GXG A;  3PFI A;  2PFB A;  2VXZ A;  2HTS A;  5CJ9 A;  2D1V A;  1STZ A;  3RPQ A;  3F6O A;  3GFI A;  2MLG A;  2K02 A;  2QQA A;  5EEH A;  1TW3 A;  2PMH A;  4OIP F;  3CLO A;  2RDP A;  3FXQ A;  1ZGJ A;  1W7P B;  4P55 A;  4KYW A;  4EM1 A;  5BQT A;  3JSP A;  3IKT A;  2EK5 A;  2KIU A;  1ON2 A;  5FFZ A;  1XMA A;  2NNN A;  3IRR A;  1TLH B;  4PGH A;  1Z6T A;  3LAJ A;  2BE5 F;  1SD4 A;  5D5W B;  3TO9 A;  2OQR A;  4MNU A;  3J80 K;  4G7O F;  2M30 A;  4IRH A;  4XBF A;  1FZP B;  4O6J A;  2L4A A;  4KIG A;  3B73 A;  5DUK A;  1FWZ A;  1R7J A;  4HBL A;  2VT3 A;  3HOT A;  4KN7 X;  1USS A;  4EM0 B;  5L3F A;  1EH6 A;  2XIG A;  4E70 A;  1MGT A;  4KMF A;  2Z5U A;  3REO A;  3CTA A;  1A04 A;  4KT5 C;  3AAF A;  2KJC A;  2BBY A;  4O3M A;  1XGO A;  5D4R A;  4HA8 A;  1RNL A;  5DYM A;  2HKX A;  3JSO A;  2FSW A;  1AOY A;  5HVQ C;  4HOB A;  5J8C A;  1XD7 A;  5AON A;  2EFW A;  5D6F A;  2KJB A;  2P7V B;  1LJ9 A;  1GHC A;  4I98 B;  4BNC A;  1XSD A;  3E6C C;  2HYF A;  3I54 A;  5FD5 A;  4IJA A;  1H9G A;  3CO7 C;  2IVM A;  1KQ0 A;  2LSO A;  2NS0 A;  4KFC A;  2LDU A;  1FPQ A;  1OR7 A;  3GZ6 A;  1XMK A;  5CYV A;  4WK8 F;  3F8N A;  1U5T A;  2MC3 A;  1HBX G;  3K9T A;  4LG0 A;  4IHT A;  4FHT A;  3T8R A;  1IAW A;  3T1B A;  2XVC A;  1OYI A;  4OOI A;  1UST A;  3KET A;  4ZZL A;  2Z33 A;  2W57 A;  2K27 A;  1XDU A;  2M1B A;  1I5Z A;  3I59 B;  1ODD A;  2O6G E;  4B8X A;  4P9F A;  3F22 A;  1ZRF A;  5DD8 A;  3DFG A;  4IPA A;  4BHP A;  3RDI A;  4RGR A;  5IT9 Z;  3LFK A;  1F5T A;  2FEZ A;  1BBY A;  4LD5 A;  1R58 A;  1FSH A;  2IP2 A;  4MQ9 F;  2ETH A;  2DW4 A;  3RKX A;  5D5U B;  1B9M A;  2K7L A;  3P9C A;  3V7C A;  4QWQ A;  3ROU A;  2FBH A;  1Z91 A;  4G8X A;  1BM9 A;  4HX8 A;  4CGZ A;  1BN5 A;  4WX9 A;  1R1V A;  4U0W A;  2JRT A;  3KP2 A;  1EV7 A;  3WU0 A;  3SFZ A;  2GAU A;  3KEO A;  4ENK A;  4CDG A;  4HZF A;  3KZZ A;  1DPR A;  2FBI A;  1J5Y A;  2RVC A;  2V1X A;  1K78 B;  3FXR A;  1IXS B;  3R61 A;  2V1U A;  1RI7 A;  2J5O A;  4Y13 A;  1G3W A;  3PQJ A;  5E18 F;  1U5T C;  2CQK A;  3CUQ A;  1G4D A;  2X0L A;  1IRG A;  2XAG A; 
#chains in the Genus database with same CATH topology
 3OS0 A;  1B59 A;  3E6D A;  2ZO4 A;  3ISP A;  1B6A A;  3IUO A;  4DZP A;  1LFB A;  2O61 A;  4RB0 A;  4C2M J;  3U9G A;  1JKP C;  4ZYD A;  4L5J A;  3GYH X;  2DYR H;  3RIR A;  2R7S A;  2JVH A;  1SAX A;  1LPQ A;  3R60 A;  1RUO A;  1Z05 A;  1W5C C;  2EQR A;  3R0J A;  4EQQ A;  3WHB A;  1R36 A;  2CMP A;  1TWA J;  2ZCW A;  3JRB A;  2B7E A;  1BA5 A;  5CVR A;  3ZR8 X;  2LF7 A;  3FZV A;  4HW0 A;  1CF7 B;  4ENJ A;  2RQP A;  3QYB A;  2RQQ A;  3C1D A;  4ITV A;  1YIJ I;  3DKW A;  4MFD A;  3OYK A;  3OIQ A;  1RKT A;  4MIM A;  2XSJ C;  1JHH A;  2FMY A;  1X1A A;  3LAP A;  1MDM B;  2Z99 A;  4AC0 A;  2OCC H;  2X6Y A;  1VF9 A;  1JJ6 C;  3N05 A;  1J59 A;  2GWR A;  2QLZ A;  5F0C A;  1TC3 C;  4JK1 X;  2VJ5 A;  1NG6 A;  4XKB A;  4X0G A;  4BDZ A;  3H9Q A;  1NG7 A;  1MNM C;  1GVJ A;  4II3 A;  2VL8 A;  4XL9 A;  1HST A;  1P92 A;  2NVT J;  1IG7 A;  1G6N A;  4Q48 A;  3PUB A;  3SZP A;  5ICE A;  1KGS A;  4G94 A;  1FMV A;  4UVB A;  5M5Y J;  2H27 A;  2DU9 A;  2M0C A;  1K7A A;  3QYE A;  4A5N A;  2E1N A;  1EH7 A;  3J80 Z;  3P7N A;  3LA3 A;  2K9N A;  1VQO I;  3K0L A;  3EYY A;  5D8L B;  3ZPL A;  3BTJ A;  1XC5 A;  4CXF A;  1VQL I;  1W7P D;  5GAE J;  4PSX A;  4XKW A;  2EBI A;  4E6K G;  4Z2Y A;  2O0Y A;  4AUX A;  2Q8K A;  2DI3 A;  1RZ4 A;  1U9O A;  3A01 B;  4AYB N;  5DS9 A;  1ONV A;  1DGR M;  2KKO A;  1D0Z A;  4UV8 A;  4QPQ A;  1W0T A;  2YSR A;  2ZME B;  2RV8 A;  3ZP5 A;  3NRV A;  2L7K A;  2QWW A;  4EMS A;  4XNF A;  1PP7 U;  1YJN I;  2JTV A;  4B48 A;  3BLY A;  2Z16 A;  1VTN C;  3MQ0 A;  2ACJ A;  2HOT A;  2VQC A;  2A3S A;  2DO7 A;  1OPC A;  4NC7 A;  2D1H A;  5ED4 A;  3HRS A;  2ELH A;  1Z67 A;  3BTI A;  3ABM H;  3QQA A;  4YFN F;  3KLO A;  4AIJ A;  3HRT A;  5J4V A;  1W36 D;  5J1R A;  1A6Q A;  2TCT A;  3H0G J;  1VI0 A;  4PJJ A;  4ESF A;  2DOA A;  3O2P E;  3S2D J;  1DUX C;  2ADU A;  2R7Q A;  3M1E A;  1O57 A;  4OMZ A;  3TED A;  4D5F A;  3H35 A;  4B3A A;  5FFX A;  1ZRD A;  3L1P A;  1YHQ I;  2ESN A;  4XRS A;  1UCR A;  3BPV A;  2VAS A;  3K4C A;  1R49 A;  1WHU A;  5JHU A;  5ICC A;  1AA7 A;  4UB8 C;  1FBQ A;  3BJO A;  4MO7 A;  4M3E A;  5JLW A;  5FLX K;  4PJ0 C;  2IGK A;  3G6E I;  5E20 A;  4LB6 B;  3DPU A;  4XLN F;  2CV2 A;  5HLI A;  1TT5 B;  1Z9C A;  2EV0 A;  5BPD A;  2PJR A;  3ABU A;  1OCT C;  2XAF A;  1BI1 A;  4HF0 A;  3BCA A;  3TP0 A;  1T2K A;  3QRF F;  1O3R A;  5FKK A;  4AU7 A;  5CLS A;  1JKO C;  3FBI B;  4ZC3 A;  2KFD A;  4LJZ F;  2AS5 F;  5LGU A;  3ZOB A;  4I09 A;  3L09 A;  3SXY A;  3QPT A;  2OTJ I;  1ETX A;  3SJM A;  3HUG A;  1XCB A;  3CF2 A;  2HGC A;  2XGE A;  1P7J A;  4BQA A;  1WCM J;  2DLL A;  4ZDP A;  3CJQ B;  3ZMT A;  2BV6 A;  3ERE D;  2LBF B;  3HJE A;  1P6R A;  2LRD A;  3LMM A;  2UUZ A;  5TGT A;  2HFH A;  4M9S A;  4D9J A;  4FCY A;  3K4M A;  1K4S A;  1R5G A;  2O3F A;  4BJ6 C;  4XOP A;  4IHW A;  1Y8Q B;  2F2E A;  2WAQ A;  1R1T A;  1PP8 F;  2E5N A;  3M4O J;  4QTR A;  2KT0 A;  3MN2 A;  4XID A;  4ZDO A;  2X85 A;  3WTV C;  1FYK A;  2MSY A;  1X3W B;  3BQY A;  5HNF A;  4LLL A;  1SD5 A;  2HXO A;  4V19 K;  3LFU A;  3AG2 H;  3U1K A;  1MBF A;  3S3N A;  4XLE A;  5JVT A;  1FEX A;  2MC4 A;  4RM3 A;  3OSG A;  1JTY A;  5IYB J;  2Q0O A;  3OYB A;  4M9X A;  1CGP A;  2NOG A;  2OD5 A;  3F21 A;  2FXA A;  1PDN C;  3VOD A;  3PO2 J;  1IZ1 A;  3IV5 A;  4XLC A;  3BR3 A;  3J7A O;  3JRE A;  4DYC A;  2BOL A;  3QOP A;  5KVR A;  2XB0 X;  3GZ5 A;  2EFQ A;  2FOK A;  4PDK A;  4Y4R A;  1AWC A;  3RQ4 A;  1D5V A;  2EWN A;  2E35 A;  3Q9V A;  2W00 A;  1VQ9 I;  1G59 A;  1T08 B;  3WE2 A;  3GCM A;  3H36 A;  1MKM A;  2MLK A;  2DJI A;  5D6E A;  2HU9 A;  4IX7 A;  4XM3 A;  3OR1 C;  4AM3 A;  2VBY A;  3RI4 A;  2FE3 A;  4HV5 A;  3U2R A;  3HKZ A;  3WTU C;  3QAH A;  5K5R A;  1IF1 A;  1LE8 B;  2QBY B;  2VKD A;  3KYD B;  1H9T A;  1Z1D A;  1ENH A;  4ASN A;  1U9N A;  3OYH A;  1LNW A;  2GA1 A;  2PMZ N;  4XOR A;  5EG0 B;  1SVO A;  2WV0 A;  2Q2E B;  2J5P A;  4J00 A;  1ZG5 A;  4BQN A;  3DF8 A;  2X4H A;  3DCF A;  1SAU A;  3I71 A;  1OKR A;  2M45 A;  3BY6 A;  2ZKZ A;  1FLI A;  2CGP A;  5A2Q K;  3QPH A;  4N4O B;  3KP4 A;  2M8E A;  1O3T A;  5GTH C;  3RYP A;  1FTZ A;  3K4B A;  4JX6 A;  4ZJZ A;  4QPO A;  1Y0N A;  4BQQ A;  4E7H A;  4JX4 A;  1E0E A;  2W4S A;  1FJL A;  1ZQ3 P;  3LSM A;  3U21 A;  1XX5 A;  1PUF A;  1A35 A;  2DK8 A;  4N9H A;  3FXM A;  3ZQF A;  1MNE A;  2L9N A;  1MBG A;  1QQI A;  2CU7 A;  1T56 A;  1RR8 C;  4RAG A;  3W3C A;  4BHC A;  4BXF A;  3N4M A;  4OU0 A;  5IYC J;  2LD5 A;  4NQW B;  1WRJ A;  4IHS A;  3E7L A;  2XAS A;  4DYR A;  4ENN A;  2HYJ A;  3D5L A;  4IKF A;  2QGU A;  4NUB A;  3AKZ A;  5E1X A;  3IAS 2;  3CCQ I;  3FDY A;  2E7W A;  4S04 A;  3BJ6 A;  3R0A A;  3TMO A;  1KU9 A;  2ESH A;  5BNG A;  4C3J J;  3GTP J;  1VQN I;  3UR3 C;  4CYD A;  2KRF A;  3QOD A;  5KCM A;  4A3E J;  2WAF A;  1RET A;  2R4G A;  1QPI A;  2H8W A;  3JR9 A;  2R7F A;  2X1D A;  3L9F A;  3ESW B;  4M3F A;  1TNT A;  1XGM A;  4H0E A;  1WQ2 A;  3M1C A;  3K70 C;  1IUF A;  5LBQ A;  3HYI A;  3I0T A;  2ZME C;  2JA7 J;  4KMU X;  4X6A J;  1ERD A;  1T0F C;  2L9V A;  1E3H A;  2BGC A;  4CO8 A;  3TO6 A;  4PFO A;  2H1K A;  2UXN A;  2IXS A;  2K4J A;  1MJA A;  3VYU B;  2FJ1 A;  3ASO H;  5GP9 A;  3ZQH A;  1ZYR F;  3BR2 A;  1IRX A;  1WJD A;  3CF5 F;  2IEK A;  3JW4 A;  3S93 A;  1W1W E;  3BRO A;  2DTZ A;  3FXU A;  3T0Y A;  3DP7 A;  4EJU A;  1GVD A;  2EPF A;  2DCE A;  3B02 A;  2CO5 A;  1B8I B;  5K7H A;  2L7F P;  2EIN H;  2AHQ A;  1QHH D;  1J75 A;  2HDC A;  2OU2 A;  2RGV A;  1LVK A;  3GME A;  1R9T J;  4KUM A;  1IRF A;  1XGN A;  1VZ0 A;  1YIO A;  4JQF A;  3LSR A;  2LY1 A;  1IUY A;  2A68 F;  1T38 A;  4G9Y A;  2CYY A;  3DKY A;  4ANJ A;  3JRA A;  3LWF A;  1GT0 C;  3ABL H;  3BR0 A;  2OUM A;  1ZAO A;  4JOM A;  3TL4 X;  1FSE A;  1R22 A;  4M73 A;  3ASN H;  4U0V A;  1ZGA A;  3TGN A;  3TQN A;  2GXA A;  4WXC A;  2VBX A;  3CJR B;  5HLG A;  2DFE A;  2QSH X;  3FXK A;  4ZH4 F;  3DTI A;  3M07 A;  2LVS A;  4K2E A;  4HX7 A;  1JE8 A;  1DDN A;  1JHF A;  5F04 A;  4UY8 I;  4I2O A;  1WPK A;  4IL6 C;  2EZI A;  2WV1 A;  1PVE A;  5JHF A;  2B0L A;  1QBJ A;  5HS7 A;  3D0S A;  5IP6 A;  1MMG A;  1YQA A;  1JUM A;  3BG7 A;  3KP6 A;  1SFE A;  3OIO A;  5F1R A;  1VQ6 I;  3LSH A;  4TV7 A;  1L0O C;  5DCM B;  2Y9Y A;  2LFB A;  4IO9 F;  3GTO J;  1KYW A;  2ZFU A;  4RGU A;  3KE2 A;  5FKN A;  3KCC A;  3VFZ A;  2LYC A;  5D5X B;  4A3L J;  1DPU A;  2IA1 A;  4DBQ A;  5FGM A;  4FX4 A;  1WJC A;  4IF4 A;  1J7K A;  3I53 A;  1JI8 A;  4CCN A;  3KEY A;  4PK4 A;  4B3X A;  3RZO J;  1TQP A;  4CZC A;  5LEJ A;  2K9Q A;  4KN4 X;  1LEA A;  2XHK A;  5JI6 A;  1YW7 A;  4NNJ A;  1W7P A;  2OZU A;  3WTX C;  5IP9 J;  2O03 A;  2OBP A;  1SFX A;  1B8I A;  4RA2 A;  3IL2 A;  2JUC A;  1N25 A;  2XAH A;  3L2W A;  4KNY A;  4FE4 A;  2XGD A;  3F3X A;  5FLX Z;  4IOC F;  2XV4 S;  1BIB A;  4PUS A;  1Y0U A;  1D0X A;  4G12 A;  4RLQ A;  2ZJQ F;  1GXP A;  2QVO A;  1FX7 A;  1IN5 A;  1ITY A;  4BGD A;  1QHG A;  1S72 I;  4KIF A;  2JA2 A;  2PQ8 A;  4P9U A;  3HB9 A;  2JSC A;  3SEZ A;  2VT2 A;  3FK6 A;  4HAM A;  1F36 A;  3Q5F A;  1D1C A;  1BR2 A;  4EJV A;  1WJE A;  2R0Q C;  1FYL A;  5L3D A;  3HL2 A;  4HF2 A;  5H6Q A;  3KFW X;  3NWT A;  4DYQ A;  4CCJ A;  3CDH A;  3JRD A;  2F5E A;  2MG4 A;  2XF7 A;  4GYG A;  4M9Z A;  1Z3Y A;  1FOK A;  1MJ9 A;  2R5Z A;  3R6S A;  1ZHF A;  1GXQ A;  2L0K A;  2Y69 H;  5LHI A;  2DK5 A;  3ZMS A;  2JA5 J;  2ZNY A;  3QWL A;  3HOX J;  1Z21 A;  2K4B A;  1S7A A;  2HOS A;  3A4C A;  2HZT A;  1R6R A;  5AIP A;  2DTR A;  2DA6 A;  4Y33 A;  3ZQI A;  4L5I A;  1QRY A;  2M4G A;  4EJO A;  1IGN A;  4GO1 A;  1BR1 A;  4PJM A;  4LFU A;  3ZCO A;  3WTT C;  1YRN B;  5FJ8 J;  4BEH B;  1MBK A;  1X2M A;  4GFB A;  1FOY A;  5EYR A;  2ZXH A;  1HLV A;  3AG4 H;  1FBU A;  2VB6 A;  2DDA A;  4RB2 C;  1YX5 A;  5B5E C;  5CVU A;  1HF0 A;  3DLA A;  3OSF A;  5F0H A;  1P4X A;  2HYG D;  3EDP A;  3ERM A;  5IOZ A;  4L0Z B;  3PJR A;  2KIQ A;  4W1U A;  2GZW A;  2LF8 A;  3PO3 J;  2Y9Z A;  4MEX F;  4Q47 A;  1SVL A;  4RB1 A;  3MD2 A;  1SMY F;  2WB1 N;  2LG4 A;  2MH2 A;  1IN4 A;  2FOW A;  2DT6 A;  2LMD A;  3TDZ C;  3MMY B;  4DJA A;  5IP7 J;  3RYR A;  2DOF A;  4M3B A;  3EUH C;  2JUG A;  1BW5 A;  2RN7 A;  3A03 A;  1EJ9 A;  1R4N B;  2FQ4 A;  4JX5 A;  2A61 A;  2LKP A;  2JSP A;  2X6O A;  1SD6 A;  1YTY A;  1TNS A;  2HDD A;  3FMS A;  4AIK A;  2IRF G;  5D5V B;  5C3E J;  2V1D A;  4B4C A;  4HLX A;  2E5Z A;  1FP2 A;  3GW2 A;  1BJZ A;  4RMN A;  2JA8 J;  1MJB A;  1ZLK A;  4I0B A;  4N9I A;  2M8G X;  1F4K A;  1DP3 A;  2KMU A;  1IO2 A;  1X1D A;  2STW A;  3V8L A;  1G8X A;  3I9V 2;  1HW2 A;  2JPC A;  1YW9 A;  1JT6 A;  1OLT A;  2HWV A;  2P5L C;  4XRM A;  3SEQ A;  5HDK A;  1VFC A;  2M7B A;  1F9N A;  1VND A;  4C3I J;  5HLT A;  3K4K A;  1I6X A;  1TZL A;  4Z6Y A;  5A2Q Z;  2QSG X;  2CRG A;  2W25 A;  1LKX A;  1IW7 F;  3CQZ J;  1KON A;  3BG6 A;  3CCE I;  2WC2 A;  4OIO F;  3MKW B;  3OYC A;  3DWL E;  2DOE A;  1Y8R B;  3GUD A;  4FX0 A;  1QVT A;  4QLC U;  4RGS A;  3LA2 A;  3PNY A;  4M6V A;  1YS6 A;  5J6X A;  3ECO A;  1QVU A;  4HDU A;  1O3S A;  3CC4 I;  5L3B A;  3HDD A;  3OMY A;  2L3D A;  3I59 A;  3LA7 A;  4IXA A;  4V2G A;  1MH4 A;  2BYV E;  2HPI A;  3RPU A;  3OYI A;  1Q1H A;  4ON0 A;  4BUP A;  4J01 A;  1U2W A;  1VQK I;  2ZJ2 A;  2EIJ H;  5D8K B;  1A6I A;  2CFO A;  1ON1 A;  5EEA A;  3DLL F;  5J1Y A;  1P4W A;  3RTR A;  3ZMU A;  2KRC A;  5E8I A;  3CUO A;  1ZN2 A;  2ME6 A;  3V8J A;  4IRG A;  4XLP F;  4DNC A;  4B47 A;  2E2J J;  2L4M A;  4LLN A;  1I50 J;  4U7B A;  2AQE A;  2DOD A;  3S8P A;  2PG4 A;  2H94 A;  2UV1 A;  3M8E A;  1MSF C;  4WXH A;  3W6J B;  2F5V A;  4IRI A;  4KIS A;  3RKY A;  2QYO A;  5FB2 A;  3GO5 A;  1UJ8 A;  5EZH A;  1XG1 A;  5DTD A;  2W7N A;  2IS4 A;  1QGP A;  4FT8 A;  1VQ8 I;  4LG3 A;  2DMQ A;  5LLQ A;  3CCU I;  1R5I D;  2G9W A;  4AIH A;  4MHG A;  4O5V A;  5M5X J;  2K86 A;  2RAE A;  3F0C A;  4HG2 A;  2FNA A;  2KIM A;  2XDV A;  2XRN A;  1KU3 A;  2ZXJ A;  3I4P A;  3S2W A;  4KA4 A;  4A3K J;  3VEP A;  2CH0 A;  4GGG A;  4R8H A;  3ZN1 A;  2DFH A;  4A12 A;  2HQR A;  2D5V A;  3O8G A;  3BG5 A;  1E2X A;  2LLK A;  3BZC A;  3Q0U A;  5H20 A;  3BJA A;  5F08 A;  5C4X J;  3QPL A;  3EQL F;  1HCR A;  2V9V A;  1UHW A;  3RJP A;  1Z3X A;  2P5V A;  4C30 A;  1T98 A;  3ABK H;  3AG1 H;  3MZH A;  2CFX A;  2PN6 A;  3WHC A;  3I58 A;  5EF6 A;  2VE9 A;  4C9Y A;  2ISY A;  1UMQ A;  2FX0 A;  3IH4 A;  2IBD A;  4I99 C;  5B1A H;  3GFJ A;  2VQH A;  3HOY J;  2E1C A;  1T6S A;  5GAH J;  3G4S I;  4D7N A;  2ZJP F;  1K78 A;  2R5Y B;  1BIA A;  1T95 A;  2STT A;  3A0B C;  2R7Z J;  3QU6 A;  1LVA A;  1UFM A;  4YG2 F;  3E0J B;  1QPM A;  2AXT C;  2JVG A;  1D3Y A;  3PNT A;  2V9P A;  1T33 A;  1FC3 A;  1X1B A;  5ICF A;  2BW3 A;  1O7F A;  3ZQG A;  4BBR J;  2HS5 A;  3CP2 A;  1APL C;  4HX4 A;  2YR2 A;  2QEX I;  3TW7 A;  2GQQ A;  5IPA A;  4CYC B;  3I4M J;  2GOM A;  2Y75 A;  3IP4 B;  3SZG A;  4ZYG A;  3EYI A;  1FOX A;  1BL0 A;  3VOE A;  2K85 A;  2F4M B;  2JRM A;  5DDG A;  2DFI A;  3OV8 A;  4R1H A;  3C18 A;  4FTH A;  1N77 A;  4YIR X;  4HSR A;  4I02 A;  1QNT A;  2PBI A;  1BC8 C;  2G0E A;  3FIW A;  4I7H A;  5ILS A;  3VB2 A;  3W6V A;  1ZG3 A;  1HA8 A;  2IS1 A;  4L9V A;  1D1B A;  1WJB A;  1S6L A;  4U88 A;  1LQ1 A;  3ZQQ A;  1JGG A;  2OV7 A;  3OYG A;  1FP1 D;  2O8X A;  3QP5 A;  5HS9 A;  3PQK A;  1D8K A;  4HV6 A;  1S3J A;  4MLO A;  1CF7 A;  4RBO A;  1MMS A;  2KP6 A;  2W85 A;  3TOB A;  4F93 B;  5F64 A;  1FYM A;  3NQO A;  2VPL A;  3IAM 2;  3KZI C;  1IN6 A;  1I1G A;  1MDM A;  4EGZ A;  3OL3 A;  4EVI A;  2JJ7 A;  4ZZD A;  3BQZ A;  1FIA A;  2XGC A;  5DUI A;  2L02 A;  3E97 A;  3DPT A;  2CW7 A;  1V4R A;  4NDL A;  2WTE A;  2VJJ A;  3A1Y A;  2HKO A;  2PI0 A;  1P7I A;  2E19 A;  1HOM A;  2OPT A;  2DFF A;  4WCG A;  2HR3 A;  5E8G A;  5JVG F;  2CSO A;  1DQU A;  3PL8 A;  3FM5 A;  2IW5 A;  2MGQ A;  4F7Z A;  4N0B A;  4KIB A;  2NRA C;  2A6H F;  2WBM A;  4ZYH A;  3MCZ A;  5E1Z B;  3OIP A;  1R1U A;  2JT1 A;  2KPM A;  4EV0 A;  2OCE A;  1P9Q C;  5DV5 A;  3EUA A;  3H3U A;  2FU4 A;  3G3Z A;  4E7L A;  4G6Q A;  2A5Y B;  4XK4 A;  4IQ4 A;  1UG2 A;  4M74 A;  3G73 A;  2H8R A;  1RIO H;  3VSK A;  1NTC A;  2XAU A;  1S5L C;  1YS7 A;  3BPX A;  1Y6I A;  3JTH A;  3IHU A;  3V7S A;  2BY3 A;  2YPR A;  4L9T A;  1TL8 A;  1K6O A;  4A0X A;  4OMY A;  3KEQ A;  4ZYA A;  4Q5S F;  4UVA A;  3E6M A;  3LSK A;  1D1A A;  3A01 A;  3JAM K;  4NC8 A;  4EM2 A;  4CYC A;  3BR5 A;  4WF2 A;  3I64 A;  2ZME A;  4WXD A;  1T0F A;  3GLX A;  4B1R A;  2OQG A;  4BAC A;  5KNL A;  2F4O B;  3OYF A;  3OYJ A;  1O3Q A;  1D0Y A;  2HZD A;  1BI2 A;  2IA0 A;  2DA5 A;  2Y30 A;  5CPR B;  3JTG A;  1ZRE A;  2XPV A;  4RDU A;  1MIJ A;  3ZQL A;  4FQG A;  4CSW A;  1FTT A;  3SDB A;  2IT0 A;  4FE7 A;  3CES A;  1HQC A;  1F43 A;  1SD7 A;  2ELJ A;  5K7Z A;  1I6H J;  1TQM A;  4OIR F;  3BTC A;  2F5C A;  1WFX A;  3DBR B;  1SFU A;  2NVQ J;  2OAZ A;  2TRT A;  3H5R A;  5TJJ A;  2V7F A;  4J19 A;  4HST A;  3GTM J;  3R4K A;  3IC7 A;  2A6E F;  1B72 B;  2EIK H;  2VKV A;  2PLY A;  3TW6 A;  4LGW A;  5BOX A;  2YUS A;  4A6E A;  2VQG A;  1WJF A;  2K3P A;  1HC8 A;  5HDN A;  4BE2 A;  3VWB A;  1IRZ A;  5KAI C;  3F8M A;  1VQ4 I;  3U1D A;  4DIQ A;  3VYS B;  1P2F A;  5E3N A;  1YJW I;  1WJA A;  5L3E A;  1QZZ A;  1YFH A;  2CS3 A;  4ESJ A;  2Z9O A;  2F4I A;  1MSE C;  2LY2 A;  1IV8 A;  3CDI A;  4L18 B;  1JUS A;  2MYS A;  3BWG A;  2ZXI A;  3HZJ A;  4CH7 A;  2DA7 A;  3CCS I;  5CKT A;  3HC7 A;  3P9I A;  2R7V A;  3DV8 A;  5B66 C;  2WAQ N;  4XRF A;  3W6K B;  2E1O A;  2GLO A;  2OC6 A;  4W97 A;  2LBF A;  2FBK A;  2JPB A;  1GLN A;  4L9J A;  1AKH B;  2EV6 A;  4U7D A;  2HI3 A;  4BE1 A;  2QEN A;  1J0R A;  3BR1 A;  5DCF A;  3T8T A;  5DM6 F;  3SZT A;  4BYY A;  5GAG J;  5HNH A;  4ETS A;  2FNP A;  1IN7 A;  1JKQ C;  2QQB A;  2RRE A;  3A0H C;  3CO6 C;  3WGI A;  1KQ8 A;  5DM7 F;  2H09 A;  1ZGW A;  4EGY A;  5AIQ A;  1FT9 A;  1UEL B;  2A05 A;  3H5A A;  3JRF A;  3FHZ A;  3I56 I;  3I55 I;  1YO5 C;  3GF2 A;  1O7L A;  2YX4 A;  1KA8 A;  1Z7U A;  1TW2 A;  3C2G A;  4LIU A;  3HG9 A;  2EA2 A;  3KP3 A;  1RUN A;  3K2Z A;  5GPC A;  2L9S A;  1TTY A;  1K83 J;  4M72 A;  3RSN A;  4EJW A;  4GCV A;  3F23 A;  1BR4 A;  1R23 A;  3FBN B;  3G2B A;  1ZTR A;  1SEU A;  1BOA A;  1Z77 A;  4AVZ A;  3HKZ N;  3DKX A;  2H6B A;  2HDW A;  2RC4 A;  1S8N A;  4M3D A;  4BXX J;  3CMY A;  3AG3 H;  3ZMZ A;  4IOA F;  3SQN A;  2A6T A;  4PGG A;  2QQ9 A;  3WU1 B;  4H4K C;  1DP7 P;  2VBZ A;  1EF4 A;  3FMQ A;  3OR2 C;  1MMN A;  3QPS A;  1OCZ H;  2AQF A;  2GBY A;  2WA0 A;  1LE8 A;  2QBY A;  3JCU C;  2CUZ A;  5JR3 A;  3GFL A;  3HOZ J;  4E7K A;  1LDJ A;  2ZFW A;  1HKS A;  4UXN A;  3TDU C;  4ZTF A;  2BVL A;  4PCQ A;  4RB3 C;  2HVS A;  4L5E A;  5EG0 A;  2Q2E A;  2V6C A;  5JLX A;  2R7R A;  1ZKG A;  3L00 A;  5J47 A;  2UZK A;  5JFR A;  1J9I A;  2F5F A;  1RR7 A;  5CVV A;  2IGM A;  3FKJ A;  1H0M A;  3ELK A;  2XGX A;  3L2R A;  4XSZ F;  4BY1 J;  3OS1 A;  2V79 A;  2VPR A;  3MKL A;  1ULY A;  5B3S H;  2ID3 A;  3HBL A;  4M3G A;  4AID A;  3QYF A;  2AXL A;  2DT7 B;  3FWE A;  2Z1D A;  3K4N A;  4OAY A;  3OYM A;  1DU6 A;  1KZH A;  5EGO B;  1TP4 A;  5LEK A;  1L3L A;  3WGH A;  4Y15 A;  5TRD A;  5F6F A;  1E17 A;  3SDG A;  2QSF X;  2HVQ A;  3WGG A;  2R7T A;  4Q4Z F;  1X1P A;  2MA3 A;  4UUS B;  5K5Q A;  3HSR A;  4MEY F;  3BTL A;  1K4T A;  1FY7 A;  3VPR A;  4IZZ A;  3CME I;  2JK3 A;  4L9N A;  3F72 A;  3IWF A;  2DMU A;  1MD0 A;  4NQW A;  2K3F A;  3I3L A;  3IH2 A;  4XMY A;  3V4G A;  2CG4 A;  2EJR A;  2E2I J;  3BZ6 A;  4M71 A;  3C2B A;  3F8F A;  4A3I J;  3EPZ A;  5TIS C;  2VKE A;  5M5W J;  1U5T B;  5DD4 A;  3G1L A;  2KZV A;  1TBX A;  3EUH A;  5KK1 A;  3EUK L;  2Y2Z A;  2K9M A;  1AU7 A;  1SMT A;  1U8B A;  4LG0 B;  5CQG A;  2R93 J;  1MW7 A;  3WG9 A;  4RAZ A;  4P5O A;  4BE0 A;  3CJT B;  5E1W A;  3KX2 A;  4JP0 A;  3J81 K;  4YIF A;  1OCR H;  1W5S A;  6PAX A;  1PJR A;  2R3S A;  4BHB A;  4E7Z A;  3H3Z A;  3M7G A;  4DGW B;  3BG9 A;  1ETW A;  2EFP A;  3GXO A;  4A2U A;  2ISZ A;  5L3G A;  1JGS A;  3CP8 A;  1X19 A;  3WTS C;  2G7U A;  5LRS A;  4A3M J;  3SHF A;  3WU2 C;  1U78 A;  3TKY A;  3HM5 A;  2F5D A;  3PM1 A;  1V3F A;  4JBA A;  4BKX A;  3S16 J;  5LRR A;  3BT9 A;  4C3H J;  2X51 A;  3KLN A;  4XKV A;  1AHD P;  2HQN A;  1VQ7 I;  4HDV A;  2FUG 2;  4OAZ A;  3CC2 I;  3IH3 A;  2IS2 A;  2VIX A;  1WGX A;  2DPU A;  1LUJ B;  3J7A Y;  1ORK A;  1TWC J;  1HDD C;  2M7A A;  3E5U A;  5LHH A;  2R92 J;  3UKG A;  3K4J A;  1TWH J;  4M6X A;  3MZ8 A;  3SFI A;  3I5U A;  3LQR A;  2WWY A;  5K7F A;  4LK0 F;  1FNN A;  2EZH A;  4I0A A;  2EFO A;  2P8T A;  2MH9 A;  2L54 A;  3S1N J;  4XLH A;  2PMU A;  2XF5 A;  4G6T B;  3NEU A;  1BC7 C;  2VI6 A;  1RC9 A;  2RNJ A;  4PJN A;  1N78 A;  2EFN A;  4Y7N J;  2Z3Y A;  2KHM A;  1D8J A;  2WAD A;  3L2C A;  3KP5 A;  2KL4 A;  5KHD A;  3F6V A;  3KIO A;  1W4M A;  1F1Z A;  3BR6 A;  5CVI A;  1O4X A;  2V9K A;  2A07 F;  4RAY A;  2CV1 A;  2XKP A;  3KZY A;  2M3A A;  2GIZ A;  3ECH A;  2L01 A;  2CQ7 A;  4MTE A;  2IS6 A;  5LHG A;  2ICW G;  1C0W A;  1OYY A;  2VXD A;  3GLL A;  4R79 A;  1B9N A;  4M6Y A;  1OYW A;  3JAM Z;  1NHA A;  2O8K A;  1BOB A;  4I6Z A;  5DCM A;  1B4A A;  1P4A A;  2O9L A;  3J7Y J;  2X6X A;  1S7O A;  4I76 A;  4A0Y A;  2F6C A;  4HEA 2;  4ZYE A;  5EZG A;  2VJI A;  5GPA A;  1IDY A;  3GWZ A;  2KIF A;  4F91 B;  4HF1 A;  2V6E A;  1I1S A;  5J8F A;  2GXB A;  4PZJ A;  1G3Y A;  3HGG A;  2PJP A;  1KU7 A;  1XDS A;  4PJL A;  1QO0 D;  5FKM A;  2DQL A;  1HW5 A;  3LOC A;  3ZQ7 A;  3QU3 A;  2ZBK A;  3TO7 A;  4CUG A;  2COM A;  4GXO A;  4ENM A;  2HEO A;  1W5T A;  3CUQ B;  3RCO A;  4XLA A;  1YIT I;  1EKE A;  4A3F J;  2DBB A;  2K9S A;  3FF5 A;  3LSG A;  3OWT A;  2IPQ X;  3KYC B;  2NYX A;  3DTK A;  3Q3S A;  1REP C;  4F3Q A;  4P96 A;  4KT6 A;  1YOV B;  5BPI A;  3BDD A;  4FIS A;  1R5H A;  4MGR A;  1X4O A;  2R7W A;  4B44 A;  1RPW A;  1VQM I;  3W2W A;  1UHS A;  5IYD J;  3H9J A;  3C2H A;  5HLH A;  1LDD A;  1XS9 A;  3AL0 B;  2H6C A;  1HKT A;  1V55 H;  2E71 A;  2E36 A;  2M87 A;  3FKI J;  4PFP A;  3WTY C;  4XLF A;  5C4J J;  2G7H A;  5IOY A;  4CCL A;  2QUF A;  2NAZ A;  2YU9 J;  3COA C;  4G7Z F;  2ZC2 A;  3HOV J;  1UG0 A;  2L9R A;  2RKH A;  4OIQ F;  3CMM A;  4A3B J;  1KU2 A;  4HNT A;  4AVP A;  2XSD C;  4E7S A;  4YFK F;  1JUP A;  3K7A J;  3NAR A;  4CIC A;  4NBQ A;  1YYV A;  4E4H A;  3ZMV A;  3CD6 I;  2EIM H;  2E1M B;  3M8J A;  4II2 A;  1A36 A;  2MBF A;  1POG A;  2I5U A;  4U87 A;  1ZRC A;  4HQM A;  5ICG A;  1UB9 A;  3GTQ J;  2DYS H;  1Z6R A;  3H92 A;  3H9G A;  3TOA A;  2EZK A;  4YII A;  3MEX A;  3CZ6 A;  1YRN A;  4UUV A;  1X4P A;  4BEH A;  3FXL A;  3TP3 A;  3WOD F;  3C3W A;  1IJW C;  1Z0X A;  1U6G A;  2P6S A;  2A5W A;  4L0Y B;  4F55 A;  1JKR C;  2VC0 A;  1ZAR A;  1XB4 A;  1MZB A;  2KLO A;  4HLY A;  4BDY A;  3FK7 A;  2DPD A;  3BOQ A;  1XSV A;  4U0Y A;  2HOE A;  1S29 A;  3OY9 A;  5K1Y A;  4FAS D;  4UB6 C;  3LNQ A;  3MKZ A;  2I10 A;  2UWM A;  5J4Y A;  3HOW J;  3ZN0 A;  5CVJ A;  2MD5 A;  2VBW A;  1MMA A;  1OR7 C;  3FIS A;  4BH9 A;  5E79 C;  2I8D A;  1WI9 A;  3H1C A;  4LB5 A;  3PNV A;  3K2A A;  2VE8 A;  3HEF A;  2DT5 A;  5FRO A;  1WWX A;  3NAU A;  3E5Q A;  1H8A C;  4NHJ A;  1IV6 A;  5ERI A;  1GV5 A;  3IWZ A;  1PYV A;  4MFE A;  2K5C A;  5LGT A;  5EJC A;  4BL0 B;  1X3Z B;  1IN8 A;  3E6B A;  5ILU A;  3ONQ A;  2XPU A;  4MTD A;  1XCV A;  3M9A A;  4A6D A;  3EET A;  5EEG A;  4AYB A;  3L2U A;  1X58 A;  4ESB A;  2KQR A;  2M0M A;  4EEF G;  1FBS A;  5FRM A;  4AD9 A;  4G7H F;  1X1C A;  4KIC A;  1BI3 A;  4HNU A;  5LGN A;  3HRU A;  1VQ5 I;  1UZC A;  3GX4 X;  2FD5 A;  2RNG A;  5FKO A;  1U3E M;  3Q0V A;  5FO5 A;  2X48 A;  1BI0 A;  2IGN A;  3HGY A;  3K69 A;  3MFK A;  3H0D A;  2JWT A;  4IVN A;  1U8R A;  1WSU A;  2L7Z A;  4XIC A;  3PUF A;  3N97 A;  2EA4 A;  4F52 A;  1EH8 A;  1EA3 A;  2LR8 A;  1TWF J;  1MMD A;  2CJJ A;  3AFH A;  3M8F A;  4C2T A;  2CW8 A;  4A5M A;  1X3U A;  2FA5 A;  3HHG A;  2XUB A;  5H6R A;  4B09 A;  4BQO A;  2VOD A;  4B43 A;  1T39 A;  3CCY A;  3HRM A;  2ECC A;  1S7E A;  2PJR B;  4IEJ A;  3S32 A;  4C2U A;  3K1M A;  3DXJ F;  4BS9 A;  4D5C A;  3L2V A;  4A69 C;  1YX3 A;  3FM3 A;  3W2V A;  3BCB A;  4UV9 A;  3VYT B;  2CQQ A;  1ACI A;  2Z2S B;  3D5R C;  3HUG B;  4BY7 J;  2QKL B;  3BP8 A;  5KAF C;  2JZY A;  1ZR2 A;  3W2A A;  2XKO A;  1KYZ A;  2W82 A;  1YW8 A;  1TWG J;  2EB7 A;  3E3V A;  3GTK J;  3HTS B;  1Z7L A;  2LY9 A;  3B6C A;  2P81 A;  4A93 J;  2A69 F;  2ZSH B;  1QZY A;  3HIF A;  3ZMD A;  1IC8 A;  1IXR C;  2GIV A;  3J81 Z;  4BAY A;  2ZJR F;  5C44 J;  1E3P A;  4S05 A;  4YRV A;  3GTL J;  2K9L A;  3WTW C;  1I3Q J;  3LQQ A;  3IKV A;  1Y39 A;  1WJ5 A;  1LFU P;  3FMR A;  1W0U A;  3GVA A;  4FET A;  2NVY J;  1Y1V J;  1IXC A;  4HPQ A;  2XRL A;  2W84 A;  5E17 F;  3MAJ A;  5HOO A;  4HYE A;  2XC7 A;  3ZQC A;  3RQI A;  4XKC A;  2BVM A;  1OCP A;  3DEU A;  1GDT A;  2W24 A;  2WY7 Q;  2VOO A;  1XGS A;  3LSP A;  4CZZ A;  2GA2 A;  2NNY A;  5FD6 A;  2ID6 A;  2C6Y A;  2Y0M A;  5F0F A;  2OJE D;  1UHM A;  4IHY A;  3CUQ C;  1V5F A;  1XSX A;  3V8K A;  3MKY B;  1B1B A;  1I3A A;  2DMT A;  4KJZ A;  3K1N A;  1WH5 A;  2FML A;  4G6D A;  1V5G A;  2P0W A;  2X1E A;  1HXD A;  3K10 A;  1HW1 A;  1J09 A;  5HDG A;  4A0Z A;  2HXI A;  3K1P A;  2H1L A;  2R7O A;  1RKW A;  1Q1V A;  2DQR A;  1YG2 A;  3CCV I;  1I27 A;  3Q9S A;  1SC7 A;  4Y3O A;  4UHT A;  4D7M A;  3AL0 C;  1TT0 A;  2R5Y A;  3S1R J;  3MWM A;  2YU3 A;  3OYL A;  4BJT A;  2YX7 A;  2HOA A;  2Y31 A;  2D45 A;  2KZG A;  3ULQ B;  3LSJ A;  1Y1W J;  2R7D A;  4XN3 A;  2MAB A;  3HSF A;  1JJ8 C;  4DQ2 A;  3HOU J;  1SFO J;  3KPH A;  4RS8 A;  4UUT A;  3D1N I;  4AWX B;  2W48 A;  4HQE A;  3CLQ A;  1T8I A;  2PMZ A;  2BY0 A;  4HNV A;  2EV5 A;  2CUJ A;  2FRH A;  3UNG C;  2OA4 A;  2W1O A;  2FQ3 A;  2BEO A;  4EJT A;  2E1M C;  2IJL A;  2XAQ A;  1HSJ A;  2CW0 F;  2CQN A;  4P1W A;  1ZG1 A;  1PUF B;  3VYR B;  3ABT A;  3JRH A;  3JRC A;  4IHV A;  1H88 C;  2VJ4 A;  1NK3 P;  2P5K A;  2L5Q A;  2NVX J;  2LNB A;  3WTZ A;  3KP7 A;  3DU6 A;  3HXL A;  2DN0 A;  4LIT A;  4S0H B;  1ZH5 A;  5J1U A;  1A5J A;  1OCO H;  2LP0 A;  3JRI A;  2E2H J;  2JA6 J;  3B6A A;  4N4N B;  4XOT A;  4CCK A;  2NS7 A;  3E5X A;  2L7M P;  2QZ8 A;  1BJA A;  3HSE A;  5IT9 K;  2LK2 A;  3P9K A;  4RAF A;  5BS6 A;  2HTJ A;  2O7O A;  3QP6 A;  2R7U A;  2R7X A;  1ZEL A;  3GBG A;  2BZT A;  2QM3 A;  1ETQ A;  2BY1 A;  3LST A;  2VN2 A;  1JXS A;  3L7W A;  2VOP A;  2ELK A;  5L3C A;  1XTA A;  2EIL H;  4ZTJ A;  2MW8 A;  1FIP A;  4JYK A;  1K79 A;  3IRQ A;  3FX3 A;  5GTI C;  4XSX F;  3GFM A;  1OQY A;  4Y17 A;  4NB5 A;  4DZJ A;  4LK1 F;  2IA2 A;  5D4S A;  2O5R A;  2B63 J;  3O6B B;  3S15 J;  1WKM A;  4IHX A;  1YLF A;  5IT3 A;  4I01 A;  3CCJ I;  3OOU A;  2Y48 A;  2DAO A;  4CCO A;  5J40 A;  1IDZ A;  1KQ9 A;  1DGW Y;  2NXN B;  2CWE A;  2GM4 A;  5M3M J;  1XMX A;  2X9D A;  2OZ6 A;  2EZL A;  3F8B A;  1PUE E;  3OOP A;  4DOZ A;  1MBJ A;  2UXX A;  1WI3 A;  4MQV A;  3GTJ J;  3DQV C;  2PEX A;  5BMZ A;  1ZK8 A;  2DA1 A;  1R4M B;  2P4W A;  3RPU D;  1OMI A;  2NS8 A;  4GYI A;  5IY5 H;  2KIS A;  4YFX F;  9ANT A;  1TQI A;  3C7J A;  1G2H A;  2Y0S A;  1XPX A;  3MVP A;  2MFZ A;  5HS8 A;  2ZNZ A;  4Y52 J;  2DMN A;  1XN7 A;  2XAJ A;  3PFY A;  3MZY A;  3F8C A;  4DBR A;  4KIT B;  3KYL A;  4BXU A;  1J2X A;  1FOW A;  2FF4 A;  3DBL B;  2YS9 A;  2M5W A;  2X6W A;  2VON A;  3T5X A;  4E7I A;  5ILV A;  4UVC A;  2DA4 A;  4XR6 A;  3HHH A;  2COB A;  2XRO A;  4OIN F;  3H3V K;  2P6T A;  2K40 A;  3DPL C;  3GZN B;  4LLG F;  1LDK B;  5E3M A;  4IQJ A;  2ZB9 A;  1GV2 A;  2DA2 A;  2XF6 A;  3L2Q A;  3TBI A;  3K6G A;  3RKW A;  3VSL A;  2VC1 A;  2PX9 A;  3FXO A;  3S17 J;  1G3T A;  4WWC A;  4RGX A;  3RZD J;  2D2W A;  3WE3 A;  1QZE A;  1YI2 I;  3ML6 A;  1M1E B;  2P7C B;  2DDB A;  4CHU A;  4D0P A;  1HKQ A;  1B72 A;  3GEZ A;  1JTX A;  4EAT A;  2DMP A;  1R00 A;  3PIP F;  1HDP A;  2MD0 A;  5K5O A;  1H89 C;  1BW6 A;  2X1C A;  4LMY A;  4UNO A;  3LSI A;  1ZLJ A;  5DEQ A;  2QA4 I;  3HOS A;  3CJN A;  1MND A;  3O3K A;  3K4L A;  1LB2 A;  2TDX A;  3OYN A;  4KDP A;  3LL7 A;  3ZXS A;  2E7X A;  2VUM J;  3V7R A;  4XON A;  5FLM J;  1G3S A;  3HTU A;  1LEB A;  2GXG A;  2DXI A;  2E34 A;  3PFI A;  2LKS A;  2PFB A;  2VXZ A;  2HTS A;  2ECB A;  5CJ9 A;  1OIS A;  2D1V A;  1STZ A;  3RPQ A;  3F6O A;  3BG3 A;  3GFI A;  5HOD A;  2MLG A;  3S14 J;  1RRJ A;  2K02 A;  3QOE A;  2QQA A;  4GRI A;  1MH3 A;  5EEH A;  1SFK A;  3JRG A;  2KDZ A;  1TW3 A;  2Y0S N;  2PMH A;  1VQP I;  4OIP F;  3G1O A;  2ZSI B;  3CLO A;  1YJ9 I;  1CQT A;  1NH3 A;  2RDP A;  3FXQ A;  2ME0 A;  1ZGJ A;  1W7P B;  2KRH A;  1AKH A;  3J7Z I;  4P55 A;  4KYW A;  4EM1 A;  1K61 A;  5BQT A;  2OTL I;  3JSP A;  3NWS A;  3ZRG A;  3IKT A;  2EK5 A;  2KIU A;  1ON2 A;  4CCM A;  5FFZ A;  5CQE A;  1XMA A;  2LH9 A;  2NNN A;  1ETO A;  3IRR A;  1FMW A;  1ETK A;  5FLV A;  4XRS G;  1TLH B;  3P5J A;  1UAA A;  1V5E A;  4PGH A;  1Z6T A;  3HPG A;  3LAJ A;  2HQA A;  2BE5 F;  1SD4 A;  5B1B H;  5D5W B;  4X1E A;  3TO9 A;  2OQR A;  4MNU A;  2EH3 A;  3S2H J;  3J80 K;  3CCL I;  2WY8 Q;  4G7O F;  3BZK A;  2M30 A;  4IRH A;  4XBF A;  3S1Q J;  1FZP B;  4O6J A;  2L4A A;  2Q1Z B;  4KIG A;  3B73 A;  5DUK A;  3OS2 A;  3V42 A;  2R5Z B;  1SVM A;  2BHZ A;  1FWZ A;  1R7J A;  4E7J A;  3I4N J;  4OWR B;  2V4J C;  4D1Q A;  4HBL A;  2VT3 A;  3HOT A;  4KN7 X;  1USS A;  4QSH A;  1NK2 P;  1JT0 A;  4EM0 B;  5L3F A;  2QQ8 A;  5E3L A;  1WVR A;  1EH6 A;  2XIG A;  4E70 A;  1V54 H;  1MGT A;  4KMF A;  2Z5U A;  3REO A;  3CTA A;  1A04 A;  4KT5 C;  1U0J A;  2IAI A;  2KJC A;  3AAF A;  3PSF A;  4A3J J;  1QA6 A;  2BBY A;  5FKL A;  4CA0 A;  2BY2 A;  2HNH A;  4F92 B;  2N8G A;  4O3M A;  1XGO A;  1RES A;  3CDL A;  4HA8 A;  5D4R A;  1RNL A;  5DYM A;  1SAN A;  4A3C J;  4BJ5 C;  3DU5 A;  2HKX A;  3X2Q H;  3JSO A;  3GTG J;  2FSW A;  3VDX A;  1AOY A;  1K6Y A;  5HVQ C;  3S3M A;  3G1M A;  3S3O A;  4HOB A;  5J8C A;  2JQ7 A;  1Y56 A;  1XD7 A;  5AON A;  3BC8 A;  2EFW A;  2HVR A;  5D6F A;  4ABZ A;  2VQL A;  3OL4 A;  5EGO A;  2KJB A;  2P7V B;  2CUF A;  3K70 D;  3D5S C;  1LJ9 A;  1GHC A;  4I98 B;  4BNC A;  2WB1 A;  3FHN A;  3H5N A;  4UUS A;  1XSD A;  3E6C C;  2HYF A;  1X2N A;  3I54 A;  5FD5 A;  4XQF A;  2BXZ A;  1H9G A;  2LRE A;  4IJA A;  3RKQ A;  3CO7 C;  2IVM A;  2NVU B;  2VLA A;  1KQ0 A;  2LSO A;  3OYA A;  4A3G J;  2NS0 A;  4KFC A;  2LDU A;  1FPQ A;  1OR7 A;  3GZ6 A;  1XMK A;  5CYV A;  5F27 A;  4WK8 F;  1I39 A;  1YE9 A;  3F8N A;  1MBE A;  1U5T A;  2MC3 A;  1HBX G;  1WZ2 A;  2AO9 A;  5LFA A;  1GUU A;  3K9T A;  4LG0 A;  5H2F C;  1E3O C;  4IHT A;  2V1N A;  1ETY A;  2KDO A;  3A02 A;  4FHT A;  3T8R A;  1IAW A;  3T1B A;  2XVC A;  2V26 A;  1R71 A;  1OYI A;  3Q0W A;  3S1M J;  2B9S A;  2QF7 A;  4OOI A;  2QCO A;  4HRI A;  1UST A;  4ZDL A;  3KET A;  2HPM A;  3PSI A;  4ZZL A;  3SYT A;  2W57 A;  2Z33 A;  2K27 A;  3DTE A;  1XDU A;  5J3L A;  2M1B A;  4NC6 A;  1I5Z A;  2IGO A;  2BHY A;  3I59 B;  1ODD A;  2O6G E;  4B8X A;  1QU3 A;  4P9F A;  3F22 A;  1ZRF A;  3HPH A;  5DD8 A;  5M3F J;  1OCC H;  3CMA I;  3PIO F;  3DFG A;  4IPA A;  1S9H A;  4BHP A;  5E3O A;  2M2E A;  4V2F A;  2LOO A;  3RDI A;  4RGR A;  5IT9 Z;  3LFK A;  1ZR4 A;  3DBH B;  2CQX A;  4RLF A;  1F5T A;  2FEZ A;  1ETV A;  1BBY A;  2DA3 A;  2JMW A;  4LD5 A;  1R58 A;  2M34 A;  1FSH A;  2F48 A;  2IP2 A;  4MQ9 F;  4BU2 A;  2ETH A;  3FXJ A;  2DW4 A;  3RKX A;  5D5U B;  1B9M A;  3M3Y J;  2LTP A;  2K7L A;  3P9C A;  4DW6 A;  2QKM B;  3V7C A;  4LOC A;  2ZXW H;  4QWQ A;  3ROU A;  2DJN A;  2E60 A;  1Z91 A;  2FBH A;  4G8X A;  4RM2 A;  2BXY A;  3DEE A;  1BM9 A;  2WAE A;  3DEW A;  4A3D J;  1OFC X;  3CCR I;  2M9H A;  4HX8 A;  4CGZ A;  2XB5 A;  4PSW A;  1BN5 A;  4WX9 A;  1R1V A;  1N75 A;  4YEL A;  3OYD A;  2M4K A;  5EDN A;  4U0W A;  2JRT A;  4GDF A;  3KP2 A;  4XN0 A;  1EV7 A;  4BBS J;  3WU0 A;  4QIW N;  3F9K A;  3SFZ A;  2GAU A;  3G71 I;  3KEO A;  4YEJ A;  2LKX A;  5LD2 C;  2OF7 A;  4ENK A;  3A2K A;  2HQ5 A;  4LIV A;  5F1J A;  3O8H A;  3WG7 H;  1DU0 A;  4CDG A;  4HZF A;  3ZGK A;  1A31 A;  3KZZ A;  1DPR A;  2FBI A;  2VKH A;  1MBH A;  1J5Y A;  2NOJ B;  2RVC A;  1D5Y A;  2V1X A;  2L2O A;  1K78 B;  2CUE A;  2LC2 A;  2XPW A;  3FXR A;  2JN6 A;  5GAD J;  1WH7 A;  3OYE A;  1IXS B;  5FRN A;  3CCM I;  2GOX B;  3CC7 I;  1OJL A;  3R61 A;  2V1U A;  1RI7 A;  2J5O A;  4Y13 A;  1G3W A;  2BW3 B;  3PQJ A;  5E18 F;  3E1S A;  1W36 C;  1U5T C;  2CQK A;  2CV0 A;  3CUQ A;  1G4D A;  2X0L A;  1LFP A;  1IRG A;  2XAG A; 
#chains in the Genus database with same CATH homology
 1B59 A;  3E6D A;  2ZO4 A;  3ISP A;  1B6A A;  2O61 A;  4RB0 A;  3U9G A;  4ZYD A;  4L5J A;  3GYH X;  3RIR A;  1SAX A;  3R60 A;  1RUO A;  1Z05 A;  4EQQ A;  3R0J A;  1R36 A;  2ZCW A;  5CVR A;  2LF7 A;  3FZV A;  4HW0 A;  1CF7 B;  4ENJ A;  2RQP A;  3C1D A;  3DKW A;  3LAP A;  1JHH A;  2FMY A;  1MDM B;  2Z99 A;  1J59 A;  2GWR A;  2QLZ A;  4JK1 X;  1GVJ A;  1HST A;  1P92 A;  1G6N A;  4Q48 A;  3SZP A;  5ICE A;  1KGS A;  4G94 A;  4UVB A;  2H27 A;  2DU9 A;  1K7A A;  4A5N A;  2E1N A;  1EH7 A;  3J80 Z;  3P7N A;  3LA3 A;  3K0L A;  3EYY A;  5D8L B;  3ZPL A;  4CXF A;  1W7P D;  4Z2Y A;  2O0Y A;  2Q8K A;  2DI3 A;  1RZ4 A;  1ONV A;  2KKO A;  4UV8 A;  2YSR A;  2ZME B;  2RV8 A;  3ZP5 A;  3NRV A;  4EMS A;  2QWW A;  1PP7 U;  2JTV A;  1VTN C;  2ACJ A;  3MQ0 A;  2DO7 A;  2A3S A;  1OPC A;  2D1H A;  5ED4 A;  3HRS A;  2ELH A;  4YFN F;  3KLO A;  4AIJ A;  3HRT A;  4ESF A;  3O2P E;  1DUX C;  2ADU A;  3M1E A;  1O57 A;  4OMZ A;  5FFX A;  1ZRD A;  2ESN A;  1UCR A;  3BPV A;  5JHU A;  5ICC A;  1FBQ A;  3BJO A;  5FLX K;  5E20 A;  4LB6 B;  4XLN F;  5HLI A;  1Z9C A;  2EV0 A;  5BPD A;  3ABU A;  2XAF A;  1BI1 A;  4HF0 A;  1T2K A;  1O3R A;  3QRF F;  5CLS A;  4LJZ F;  2AS5 F;  5LGU A;  4I09 A;  3L09 A;  3SXY A;  3QPT A;  3HUG A;  1XCB A;  2HGC A;  4BQA A;  2DLL A;  3ZMT A;  2BV6 A;  3ERE D;  1P6R A;  2HFH A;  4M9S A;  1R5G A;  2O3F A;  2F2E A;  1R1T A;  1PP8 F;  3WTV C;  1FYK A;  4LLL A;  1SD5 A;  5JVT A;  2Q0O A;  4M9X A;  1CGP A;  2OD5 A;  3F21 A;  2FXA A;  1PDN C;  3VOD A;  1IZ1 A;  3J7A O;  3QOP A;  5KVR A;  3GZ5 A;  2EFQ A;  2FOK A;  4PDK A;  1AWC A;  1D5V A;  2EWN A;  3Q9V A;  3WE2 A;  1MKM A;  2MLK A;  5D6E A;  2VBY A;  3RI4 A;  2FE3 A;  4HV5 A;  3U2R A;  3WTU C;  3QAH A;  5K5R A;  1IF1 A;  2QBY B;  1H9T A;  1Z1D A;  4ASN A;  1LNW A;  2GA1 A;  2WV0 A;  2J5P A;  1ZG5 A;  3DF8 A;  2X4H A;  3I71 A;  1OKR A;  2M45 A;  3BY6 A;  2ZKZ A;  1FLI A;  2CGP A;  5A2Q K;  3QPH A;  3KP4 A;  2M8E A;  1O3T A;  3RYP A;  2DK8 A;  4N9H A;  1QQI A;  4BHC A;  3N4M A;  4OU0 A;  1WRJ A;  4IHS A;  2XAS A;  4ENN A;  3D5L A;  5E1X A;  2E7W A;  4S04 A;  3BJ6 A;  3R0A A;  1KU9 A;  2ESH A;  4CYD A;  2KRF A;  2R7F A;  3L9F A;  1TNT A;  1XGM A;  4H0E A;  1WQ2 A;  5LBQ A;  3HYI A;  3I0T A;  4KMU X;  2BGC A;  4CO8 A;  3TO6 A;  2UXN A;  2K4J A;  1MJA A;  1ZYR F;  3JW4 A;  3BRO A;  3FXU A;  3T0Y A;  3DP7 A;  4EJU A;  3B02 A;  2CO5 A;  2HDC A;  1J75 A;  2OU2 A;  2RGV A;  4KUM A;  1IRF A;  1XGN A;  1YIO A;  4JQF A;  1IUY A;  2A68 F;  1T38 A;  4G9Y A;  2CYY A;  3LWF A;  1ZAO A;  1FSE A;  1R22 A;  4M73 A;  4U0V A;  1ZGA A;  3TGN A;  3TQN A;  4WXC A;  2VBX A;  5HLG A;  4ZH4 F;  4K2E A;  4HX7 A;  1JE8 A;  1DDN A;  1JHF A;  4I2O A;  2B0L A;  1QBJ A;  5HS7 A;  3D0S A;  1YQA A;  3KP6 A;  1SFE A;  5F1R A;  4TV7 A;  1L0O C;  5DCM B;  1KYW A;  4RGU A;  3KE2 A;  3KCC A;  3VFZ A;  5D5X B;  1DPU A;  2IA1 A;  5FGM A;  4FX4 A;  4IF4 A;  1J7K A;  3I53 A;  1TQP A;  5LEJ A;  4KN4 X;  1LEA A;  2XHK A;  5JI6 A;  1YW7 A;  1W7P A;  2OZU A;  3WTX C;  2O03 A;  2OBP A;  1SFX A;  3IL2 A;  4KNY A;  2XAH A;  3F3X A;  5FLX Z;  2XV4 S;  1BIB A;  1GXP A;  1Y0U A;  2QVO A;  1FX7 A;  1IN5 A;  4KIF A;  2PQ8 A;  4P9U A;  2JSC A;  2VT2 A;  4HAM A;  3Q5F A;  4EJV A;  1FYL A;  5L3D A;  4HF2 A;  5H6Q A;  3KFW X;  3CDH A;  2F5E A;  4GYG A;  4M9Z A;  1FOK A;  1MJ9 A;  3R6S A;  1ZHF A;  1GXQ A;  5LHI A;  2DK5 A;  3ZMS A;  2ZNY A;  2K4B A;  1S7A A;  2HZT A;  5AIP A;  2DTR A;  4L5I A;  4EJO A;  4GO1 A;  4LFU A;  3WTT C;  1FBU A;  4RB2 C;  5CVU A;  4L0Z B;  1P4X A;  2HYG D;  3EDP A;  2GZW A;  2LF8 A;  4MEX F;  4Q47 A;  4RB1 A;  1SMY F;  2MH2 A;  1IN4 A;  3TDZ C;  3RYR A;  2RN7 A;  2A61 A;  2LKP A;  1SD6 A;  1YTY A;  1TNS A;  3FMS A;  4AIK A;  2IRF G;  5D5V B;  2V1D A;  4HLX A;  1FP2 A;  3GW2 A;  1MJB A;  1ZLK A;  4I0B A;  4N9I A;  1F4K A;  2STW A;  3V8L A;  1HW2 A;  2JPC A;  1YW9 A;  2HWV A;  2P5L C;  5HDK A;  1F9N A;  1I6X A;  5A2Q Z;  2W25 A;  1IW7 F;  2WC2 A;  4OIO F;  4FX0 A;  3GUD A;  4QLC U;  4RGS A;  3LA2 A;  5J6X A;  1YS6 A;  3ECO A;  4HDU A;  1O3S A;  5L3B A;  2L3D A;  3I59 A;  3LA7 A;  4IXA A;  2BYV E;  3RPU A;  1Q1H A;  4ON0 A;  1U2W A;  2ZJ2 A;  5D8K B;  1ON1 A;  1P4W A;  3RTR A;  3ZMU A;  5E8I A;  3CUO A;  1ZN2 A;  3V8J A;  4IRG A;  4XLP F;  4DNC A;  2L4M A;  4LLN A;  4U7B A;  2PG4 A;  2H94 A;  3M8E A;  4WXH A;  3W6J B;  4IRI A;  3RKY A;  2QYO A;  5FB2 A;  3GO5 A;  1QGP A;  4FT8 A;  5LLQ A;  4AIH A;  2G9W A;  4MHG A;  4O5V A;  2K86 A;  3S2W A;  2FNA A;  1KU3 A;  2KIM A;  2XRN A;  2ZXJ A;  3I4P A;  4KA4 A;  3VEP A;  4GGG A;  4R8H A;  3ZN1 A;  4A12 A;  2HQR A;  1E2X A;  5H20 A;  3BJA A;  3EQL F;  2V9V A;  1UHW A;  3RJP A;  2P5V A;  1T98 A;  3MZH A;  2CFX A;  2PN6 A;  3I58 A;  2VE9 A;  2ISY A;  3GFJ A;  2E1C A;  1T6S A;  1K78 A;  1BIA A;  2STT A;  3QU6 A;  1LVA A;  1UFM A;  4YG2 F;  1QPM A;  1D3Y A;  1FC3 A;  5ICF A;  1O7F A;  2HS5 A;  4HX4 A;  2YR2 A;  2GQQ A;  2Y75 A;  4ZYG A;  3EYI A;  3VOE A;  5DDG A;  2DFI A;  3OV8 A;  4R1H A;  3C18 A;  4I02 A;  1QNT A;  2PBI A;  1BC8 C;  4I7H A;  5ILS A;  3VB2 A;  1ZG3 A;  4L9V A;  1S6L A;  4U88 A;  1LQ1 A;  1FP1 D;  2O8X A;  3QP5 A;  5HS9 A;  3PQK A;  1D8K A;  4HV6 A;  1S3J A;  1CF7 A;  2W85 A;  3TOB A;  1FYM A;  5F64 A;  3NQO A;  1IN6 A;  1I1G A;  1MDM A;  4EGZ A;  4EVI A;  4ZZD A;  5DUI A;  2L02 A;  3E97 A;  3DPT A;  2PI0 A;  1V4R A;  2WTE A;  2HKO A;  4WCG A;  2HR3 A;  5E8G A;  2CSO A;  4F7Z A;  2IW5 A;  3FM5 A;  2NRA C;  4N0B A;  4KIB A;  2A6H F;  4ZYH A;  3MCZ A;  5E1Z B;  1R1U A;  2JT1 A;  4EV0 A;  5DV5 A;  3H3U A;  2FU4 A;  3G3Z A;  4G6Q A;  2A5Y B;  4M74 A;  3G73 A;  1RIO H;  1YS7 A;  3BPX A;  3JTH A;  3V7S A;  3IHU A;  2YPR A;  4L9T A;  1K6O A;  4A0X A;  4OMY A;  3KEQ A;  4Q5S F;  4UVA A;  3E6M A;  3JAM K;  4EM2 A;  4WF2 A;  3I64 A;  2ZME A;  4WXD A;  1T0F A;  3GLX A;  2OQG A;  1O3Q A;  1BI2 A;  2IA0 A;  3JTG A;  1ZRE A;  2IT0 A;  1HQC A;  1SD7 A;  1TQM A;  4OIR F;  2F5C A;  1SFU A;  2OAZ A;  5TJJ A;  3R4K A;  3IC7 A;  2A6E F;  2PLY A;  4LGW A;  5BOX A;  4A6E A;  5HDN A;  3F8M A;  3U1D A;  1P2F A;  5L3E A;  1QZZ A;  1YFH A;  4ESJ A;  2Z9O A;  4L18 B;  3BWG A;  3P9I A;  3DV8 A;  4XRF A;  3W6K B;  2FBK A;  2JPB A;  4L9J A;  2EV6 A;  4U7D A;  2QEN A;  1J0R A;  5DCF A;  3T8T A;  3SZT A;  4BYY A;  4ETS A;  2FNP A;  1IN7 A;  2QQB A;  3CO6 C;  3WGI A;  1KQ8 A;  2H09 A;  4EGY A;  5AIQ A;  1FT9 A;  3FHZ A;  1YO5 C;  3GF2 A;  1O7L A;  2YX4 A;  1KA8 A;  1Z7U A;  1TW2 A;  2EA2 A;  3KP3 A;  1RUN A;  3K2Z A;  1TTY A;  4M72 A;  4EJW A;  4GCV A;  3F23 A;  1R23 A;  1BOA A;  2H6B A;  2RC4 A;  1S8N A;  3ZMZ A;  3SQN A;  4PGG A;  2QQ9 A;  3WU1 B;  1DP7 P;  2VBZ A;  3FMQ A;  2QBY A;  5JR3 A;  3GFL A;  1LDJ A;  2ZFW A;  1HKS A;  4UXN A;  3TDU C;  4PCQ A;  4RB3 C;  2Q2E A;  2V6C A;  3L00 A;  2UZK A;  5JFR A;  1J9I A;  2F5F A;  5CVV A;  1H0M A;  3ELK A;  2XGX A;  4XSZ F;  2V79 A;  1ULY A;  2AXL A;  3FWE A;  5LEK A;  1L3L A;  3WGH A;  4Y15 A;  5TRD A;  5F6F A;  1E17 A;  3WGG A;  4Q4Z F;  2MA3 A;  5K5Q A;  3HSR A;  4MEY F;  1FY7 A;  4L9N A;  3F72 A;  3IWF A;  1MD0 A;  4NQW A;  3V4G A;  2CG4 A;  2EJR A;  3BZ6 A;  4M71 A;  3F8F A;  1U5T B;  5DD4 A;  1TBX A;  3EUH A;  5KK1 A;  1SMT A;  4LG0 B;  3WG9 A;  4RAZ A;  4P5O A;  5E1W A;  3J81 K;  4YIF A;  6PAX A;  1W5S A;  2R3S A;  4BHB A;  3H3Z A;  3M7G A;  3GXO A;  2EFP A;  4A2U A;  2ISZ A;  5L3G A;  1JGS A;  3WTS C;  2G7U A;  5LRS A;  3SHF A;  1U78 A;  3TKY A;  2F5D A;  4JBA A;  1V3F A;  5LRR A;  3KLN A;  2HQN A;  4HDV A;  2DPU A;  3E5U A;  5LHH A;  4M6X A;  3I5U A;  3LQR A;  2WWY A;  4LK0 F;  1FNN A;  4I0A A;  2EFO A;  2P8T A;  2MH9 A;  2L54 A;  2PMU A;  3NEU A;  1BC7 C;  2RNJ A;  2EFN A;  2Z3Y A;  1D8J A;  3L2C A;  3KP5 A;  3F6V A;  1W4M A;  1F1Z A;  5CVI A;  2A07 F;  4RAY A;  2XKP A;  3KZY A;  3ECH A;  2L01 A;  4MTE A;  5LHG A;  1C0W A;  1OYY A;  4R79 A;  1B9N A;  4M6Y A;  1OYW A;  3JAM Z;  1NHA A;  5DCM A;  1B4A A;  1P4A A;  1S7O A;  4A0Y A;  4ZYE A;  3GWZ A;  2KIF A;  4HF1 A;  1I1S A;  5J8F A;  2GXB A;  4PZJ A;  1G3Y A;  2PJP A;  1KU7 A;  1XDS A;  1QO0 D;  2DQL A;  1HW5 A;  3ZQ7 A;  3QU3 A;  2ZBK A;  3TO7 A;  2COM A;  4GXO A;  4ENM A;  2HEO A;  1W5T A;  3CUQ B;  2DBB A;  3FF5 A;  2IPQ X;  2NYX A;  1REP C;  4P96 A;  5BPI A;  3BDD A;  1R5H A;  4MGR A;  5HLH A;  1LDD A;  2H6C A;  1HKT A;  2M87 A;  3WTY C;  2G7H A;  2QUF A;  2NAZ A;  3COA C;  4G7Z F;  2RKH A;  4OIQ F;  1KU2 A;  4AVP A;  4YFK F;  4CIC A;  1YYV A;  3ZMV A;  2MBF A;  1ZRC A;  4HQM A;  5ICG A;  1UB9 A;  1Z6R A;  3H92 A;  3TOA A;  4YII A;  3MEX A;  4UUV A;  3WOD F;  3C3W A;  1U6G A;  2P6S A;  4L0Y B;  2VC0 A;  1ZAR A;  1XB4 A;  1MZB A;  4HLY A;  2DPD A;  3BOQ A;  1XSV A;  4U0Y A;  2HOE A;  1S29 A;  5K1Y A;  2UWM A;  3ZN0 A;  5CVJ A;  2MD5 A;  2VBW A;  4BH9 A;  1WI9 A;  4LB5 A;  2VE8 A;  2DT5 A;  1WWX A;  3E5Q A;  4NHJ A;  5ERI A;  3IWZ A;  5LGT A;  3E6B A;  1IN8 A;  5ILU A;  4MTD A;  1XCV A;  3M9A A;  4A6D A;  3EET A;  5EEG A;  4ESB A;  1FBS A;  4AD9 A;  4G7H F;  4KIC A;  1BI3 A;  5LGN A;  3HRU A;  3GX4 X;  1U3E M;  5FO5 A;  1BI0 A;  3MFK A;  3K69 A;  4IVN A;  1U8R A;  1WSU A;  3N97 A;  2EA4 A;  1EH8 A;  3M8F A;  4A5M A;  1X3U A;  2FA5 A;  3HHG A;  2XUB A;  5H6R A;  4B09 A;  2VOD A;  1T39 A;  3HRM A;  3K1M A;  3DXJ F;  3FM3 A;  4UV9 A;  3BP8 A;  2JZY A;  2XKO A;  1KYZ A;  1YW8 A;  2EB7 A;  3E3V A;  3HTS B;  2A69 F;  1QZY A;  3HIF A;  3ZMD A;  1IXR C;  2GIV A;  3J81 Z;  4BAY A;  4S05 A;  3WTW C;  3LQQ A;  3IKV A;  3FMR A;  3GVA A;  1IXC A;  2W84 A;  5E17 F;  3MAJ A;  5HOO A;  4HYE A;  3DEU A;  2W24 A;  2VOO A;  1XGS A;  2NNY A;  2GA2 A;  4CZZ A;  5FD6 A;  2C6Y A;  2Y0M A;  1UHM A;  3CUQ C;  1XSX A;  3V8K A;  1B1B A;  3K1N A;  2FML A;  4G6D A;  1HXD A;  1HW1 A;  5HDG A;  4A0Z A;  3K1P A;  2DQR A;  1YG2 A;  1I27 A;  3Q9S A;  4UHT A;  3MWM A;  2YU3 A;  2YX7 A;  2D45 A;  3ULQ B;  2R7D A;  3HSF A;  4DQ2 A;  4RS8 A;  4AWX B;  4HQE A;  2EV5 A;  2FRH A;  2OA4 A;  2FQ3 A;  2BEO A;  4EJT A;  2IJL A;  2XAQ A;  1HSJ A;  2CW0 F;  1ZG1 A;  3ABT A;  2P5K A;  2LNB A;  3WTZ A;  3KP7 A;  1ZH5 A;  3E5X A;  2QZ8 A;  1BJA A;  3HSE A;  5IT9 K;  3P9K A;  5BS6 A;  2HTJ A;  3QP6 A;  2QM3 A;  3LST A;  2VN2 A;  1JXS A;  3L7W A;  2VOP A;  5L3C A;  1K79 A;  3IRQ A;  3FX3 A;  4XSX F;  3GFM A;  4Y17 A;  4NB5 A;  4LK1 F;  2IA2 A;  5D4S A;  3O6B B;  1WKM A;  1YLF A;  5IT3 A;  4I01 A;  2Y48 A;  2DAO A;  1KQ9 A;  2CWE A;  2OZ6 A;  3F8B A;  1PUE E;  3OOP A;  2UXX A;  4MQV A;  3DQV C;  2PEX A;  5BMZ A;  2P4W A;  1OMI A;  4GYI A;  4YFX F;  1TQI A;  3C7J A;  5HS8 A;  2ZNZ A;  1XN7 A;  2XAJ A;  3MZY A;  3F8C A;  4BXU A;  1J2X A;  2FF4 A;  2VON A;  2M5W A;  3T5X A;  5ILV A;  4UVC A;  3HHH A;  2XRO A;  4OIN F;  2P6T A;  3DPL C;  4LLG F;  1LDK B;  3RKW A;  2VC1 A;  1G3T A;  4WWC A;  4RGX A;  2D2W A;  3WE3 A;  3ML6 A;  2P7C B;  4CHU A;  4D0P A;  1HKQ A;  3GEZ A;  1R00 A;  5K5O A;  4LMY A;  4UNO A;  1ZLJ A;  5DEQ A;  3HOS A;  3CJN A;  3O3K A;  4KDP A;  1LB2 A;  2TDX A;  2E7X A;  3V7R A;  1G3S A;  3HTU A;  1LEB A;  2GXG A;  3PFI A;  2PFB A;  2VXZ A;  2HTS A;  5CJ9 A;  2D1V A;  1STZ A;  3RPQ A;  3F6O A;  3GFI A;  2MLG A;  2K02 A;  2QQA A;  5EEH A;  1TW3 A;  2PMH A;  4OIP F;  3CLO A;  2RDP A;  3FXQ A;  1ZGJ A;  1W7P B;  4P55 A;  4KYW A;  4EM1 A;  5BQT A;  3JSP A;  3IKT A;  2EK5 A;  2KIU A;  1ON2 A;  5FFZ A;  1XMA A;  2NNN A;  3IRR A;  1TLH B;  4PGH A;  1Z6T A;  3LAJ A;  2BE5 F;  1SD4 A;  5D5W B;  3TO9 A;  2OQR A;  4MNU A;  3J80 K;  4G7O F;  2M30 A;  4IRH A;  4XBF A;  1FZP B;  4O6J A;  2L4A A;  4KIG A;  3B73 A;  5DUK A;  1FWZ A;  1R7J A;  4HBL A;  2VT3 A;  3HOT A;  4KN7 X;  1USS A;  4EM0 B;  5L3F A;  1EH6 A;  2XIG A;  4E70 A;  1MGT A;  4KMF A;  2Z5U A;  3REO A;  3CTA A;  1A04 A;  4KT5 C;  3AAF A;  2KJC A;  2BBY A;  4O3M A;  1XGO A;  5D4R A;  4HA8 A;  1RNL A;  5DYM A;  2HKX A;  3JSO A;  2FSW A;  1AOY A;  5HVQ C;  4HOB A;  5J8C A;  1XD7 A;  5AON A;  2EFW A;  5D6F A;  2KJB A;  2P7V B;  1LJ9 A;  1GHC A;  4I98 B;  4BNC A;  1XSD A;  3E6C C;  2HYF A;  3I54 A;  5FD5 A;  4IJA A;  1H9G A;  3CO7 C;  2IVM A;  1KQ0 A;  2LSO A;  2NS0 A;  4KFC A;  2LDU A;  1FPQ A;  1OR7 A;  3GZ6 A;  1XMK A;  5CYV A;  4WK8 F;  3F8N A;  1U5T A;  2MC3 A;  1HBX G;  3K9T A;  4LG0 A;  4IHT A;  4FHT A;  3T8R A;  1IAW A;  3T1B A;  2XVC A;  1OYI A;  4OOI A;  1UST A;  3KET A;  4ZZL A;  2Z33 A;  2W57 A;  2K27 A;  1XDU A;  2M1B A;  1I5Z A;  3I59 B;  1ODD A;  2O6G E;  4B8X A;  4P9F A;  3F22 A;  1ZRF A;  5DD8 A;  3DFG A;  4IPA A;  4BHP A;  3RDI A;  4RGR A;  5IT9 Z;  3LFK A;  1F5T A;  2FEZ A;  1BBY A;  4LD5 A;  1R58 A;  1FSH A;  2IP2 A;  4MQ9 F;  2ETH A;  2DW4 A;  3RKX A;  5D5U B;  1B9M A;  2K7L A;  3P9C A;  3V7C A;  4QWQ A;  3ROU A;  2FBH A;  1Z91 A;  4G8X A;  1BM9 A;  4HX8 A;  4CGZ A;  1BN5 A;  4WX9 A;  1R1V A;  4U0W A;  2JRT A;  3KP2 A;  1EV7 A;  3WU0 A;  3SFZ A;  2GAU A;  3KEO A;  4ENK A;  4CDG A;  4HZF A;  3KZZ A;  1DPR A;  2FBI A;  1J5Y A;  2RVC A;  2V1X A;  1K78 B;  3FXR A;  1IXS B;  3R61 A;  2V1U A;  1RI7 A;  2J5O A;  4Y13 A;  1G3W A;  3PQJ A;  5E18 F;  1U5T C;  2CQK A;  3CUQ A;  1G4D A;  2X0L A;  1IRG A;  2XAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...