2KIFA

Solution nmr structure of an o6-methylguanine dna methyltransferase family protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr247.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
102
structure length
102
Chain Sequence
b'MDQFLVQIFAVIHQIPKGKVSTYGEIAKMAGYPGYARHVGKALGNLPEGSKLPWFRVINSQGKISLKGRDLDRQKQKLEAEGIEVSEIGKIALRKYKWQPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O6-methylguanine-DNA methyltransferase
publication title Structural basis of O6-alkylguanine recognition by a bacterial alkyltransferase-like DNA repair protein.
pubmed doi rcsb
source organism Vibrio parahaemolyticus aq3810
molecule tags Transferase
total genus 29
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kifA00
2OA4A 2OAZA 1K79A 1EH6A 5ILSA 4EV0A 1SMTA 1IN4A 3IHUA 3CUQA 4LK0F 3RYRA 2QLZA 1TNSA 2A6HF 4UVAA 1Z91A 1KQ0A 2UXNA 1LEAA 1OKRA 1ZGAA 3QRFF 1Z05A 4RGRA 4JQFA 5DV5A 3I4PA 2O6GE 3I53A 1YS6A 4HZFA 2DFIA 2K4JA 1XMKA 3GZ5A 3R0JA 1G3TA 2GAUA 2PEXA 1IF1A 3KP6A 1SD6A 1ON1A 1HSTA 2NYXA 3BY6A 1ZARA 4IRIA 3K69A 4WCGA 1IXCA 5AIQA 3FXUA 4HA8A 2H94A 1G3SA 1O3TA 3J81K 3CO6C 4IJAA 1IN5A 4O5VA 4ZZLA 5E18F 1XD7A 2FBIA 2ZJ2A 3F72A 1BC7C 3WODF 1P4AA 2XAHA 3RKWA 2HYGD 2VONA 1KYWA 4RB0A 3J80K 2DBBA 3L7WA 2FF4A 1R1UA 2VE8A 1O3QA 1ONVA 1BI2A 5ERIA 1XGSA 5F64A 1FBUA 2HYFA 4RB1A 2CG4A 4I0BA 2Z9OA 4KMFA 3JAMK 4XBFA 4HBLA 3TO7A 2ZNZA 2RC4A 1SD7A 2A68F 3VFZA 2DQLA 1FBQA 4XRFA 4M72A 3GFIA 3MZYA 4UHTA 1LVAA 5DDGA 1MZBA 4KYWA 1GXPA 3GFMA 1X3UA 3M9AA 3N97A 5ICEA 2FMLA 3DP7A 3WU1B 3RI4A 2NRAC 3LQRA 2COMA 2GXGA 2K27A 3HHHA 4UVCA 3WTTC 2EV6A 2HS5A 3L09A 3Q5FA 2EV0A 1I27A 2XAFA 4HQEA 4P9FA 3E97A 3RJPA 1K6OA 1JGSA 1OMIA 1W7PA 4PDKA 4EM2A 4HDVA 2JPBA 1JXSA 3F8MA 3V4GA 1ZLKA 3IC7A 4M6YA 2OD5A 3BP8A 4FX4A 2M30A 1HQCA 4Q47A 4QWQA 2GXBA 4B09A 2X4HA 4I09A 2VBYA 2MH2A 3F8BA 3MCZA 3LA3A 2EFWA 2H6CA 3F3XA 4ZYDA 1LB2A 3FZVA 3R4KA 4RB2C 2OZUA 4LG0A 5ILVA 5LBQA 3MAJA 2JZYA 2Q8KA 2HKOA 5LLQA 1R00A 2FE3A 3RYPA 3H3UA 4YIFA 2C6YA 1BJAA 4RAYA 1AWCA 3BJAA 1TW2A 5L3FA 1QZZA 2Z99A 3V7SA 2WTEA 3SZTA 2BV6A 4JK1X 1D8JA 4ZYGA 2H6BA 1T0FA 3BOQA 3EDPA 3WU0A 2NNYA 1BC8C 3ECHA 3RKYA 1HW1A 3C1DA 4WK8F 2EFOA 5LEKA 3ERED 1QGPA 1B4AA 3RPQA 5DCMA 2UWMA 2RDPA 2L4AA 2FNPA 2M87A 3K9TA 1OYWA 1ZRDA 1XGNA 5L3BA 3HRUA 5CLSA 1G3YA 4GXOA 5KVRA 2OU2A 1R58A 2ESNA 3KLNA 4L0YB 1TQPA 5J8CA 3T8RA 1MD0A 3HSFA 3F21A 2OQRA 2F5EA 2J5PA 3WTWC 5BPDA 5LRRA 4ZYHA 5JFRA 3R60A 2CQKA 4KN7X 4KMUX 2MC3A 1IAWA 4EQQA 4OIPF 3VEPA 4L18B 4LMYA 1XDUA 3FWEA 4E70A 2FQ3A 3J81Z 1P92A 3ZMZA 1ZYRF 1EH7A 4HV6A 3KETA 3WE3A 2XHKA 4EM1A 4MTDA 1IRFA 3WTUC 3TO9A 1UCRA 1V4RA 3M1EA 4OU0A 1HKTA 2Z3YA 2XIGA 1FWZA 2G9WA 3MFKA 5CJ9A 2MLGA 1YFHA 2LF7A 1CGPA 5EEGA 4N9HA 2FRHA 2HQNA 2Y48A 1SD5A 3F22A 3KZYA 4IPAA 3T5XA 4P96A 3T8TA 4RGXA 4G6QA 2OQGA 2ZMEB 1WKMA 4A12A 1USTA 1QQIA 3WE2A 1WQ2A 1YTYA 4U88A 2ZNYA 3OV8A 1YW7A 4NB5A 1BI0A 2L02A 5D4SA 3R0AA 3BDDA 4A0ZA 3M7GA 1KYZA 2DLLA 4GCVA 1R1TA 1SD4A 2HTSA 1GHCA 4ENJA 3DQVC 3FHZA 4L5JA 1T6SA 4KN4X 5L3DA 4BQAA 4CO8A 5DD8A 1B59A 3NEUA 2Z5UA 2P7VB 2PQ8A 3HRMA 5H6QA 2F2EA 1MDMB 2KKOA 5D5UB 5TRDA 3HYIA 2XROA 2VBWA 2R3SA 1XGMA 4I2OA 1BIAA 2ACJA 4A6EA 1C0WA 4HX4A 2QENA 1I1GA 1TNTA 5FB2A 3G73A 1IRGA 4ENMA 1KU2A 2DW4A 1O7LA 2YX7A 1J5YA 1QZYA 3BJOA 1DDNA 1R36A 2P4WA 1UHWA 4KT5C 2EV5A 3LQQA 4EMSA 1DUXC 2FEZA 5HS9A 2EK5A 3WTZA 4WWCA 1XN7A 1RNLA 2CGPA 3R6SA 4K2EA 4ASNA 3ABUA 4PGHA 3QU3A 3TKYA 4ESJA 5K5RA 1RUOA 3R61A 4QLCU 2QUFA 3KZZA 1P6RA 4CICA 3SHFA 3KP4A 4XLPF 1ZG5A 2A07F 4O6JA 1T98A 4XSXF 3RIRA 4P55A 2PLYA 1Q1HA 1HXDA 2F5CA 2A61A 5LEJA 4D0PA 5CVJA 3O6BB 5BMZA 2EA2A 1Z7UA 3FX3A 3DPLC 1HW2A 1BI3A 2YPRA 2D2WA 4LLNA 2YX4A 3VB2A 4M73A 3WGGA 5LRSA 1IN8A 1A04A 1PDNC 4GO1A 2G7UA 5FO5A 4F7ZA 4UV9A 2E1NA 5FD5A 3KP7A 1S29A 2VE9A 1RUNA 4L5IA 2P6SA 4CYDA 1UFMA 1W5TA 2PN6A 2RQPA 4I98B 1BI1A 2VC1A 4BHCA 3LWFA 3WGHA 2LKPA 1J0RA 5EEHA 4KUMA 2K4BA 3EYYA 2IA1A 3PQJA 1XSXA 3KEOA 4RGUA 4P9UA 1WI9A 4BYYA 1IZ1A 2WWYA 4BAYA 1FPQA 1MJ9A 3E6DA 3V7RA 5E1ZB 5LHIA 4ENNA 3I59B 4AIHA 1ZH5A 2E1CA 4PZJA 3ULQB 4H0EA 3SXYA 3HOSA 1TQIA 3U9GA 1WRJA 4Y17A 4AVPA 3GVAA 1F5TA 5LHHA 4BHBA 2RGVA 4U7DA 5D5XB 4IF4A 3T1BA 3I5UA 3W6JB 3C3WA 2P6TA 2WC2A 4MHGA 3KE2A 3TDUC 3DEUA 2PFBA 4G9YA 4BXUA 2XASA 5D5VB 1KU9A 1LQ1A 3KLOA 2E7XA 2YSRA 5D4RA 3FMQA 2ZO4A 4FT8A 3GZ6A 1FX7A 1LEBA 1EH8A 1H9GA 1U5TB 2JT1A 2E7WA 1SFXA 3WTVC 4UUVA 1WSUA 1ZRFA 1LDDA 1R1VA 2ADUA 5F6FA 1I5ZA 2W57A 2XAJA 4AD9A 5F1RA 3J7AO 1G3WA 2FNAA 1G6NA 2CYYA 1USSA 1LDJA 4OIRF 2DPUA 4LLGF 2DTRA 3REOA 1ZN2A 2EA4A 2XVCA 2KIMA 3GX4X 4TV7A 3E5QA 5K1YA 3BJ6A 3AAFA 1STZA 2IPQX 2EWNA 2XV4S 2PG4A 2RKHA 4HV5A 2PJPA 1KQ9A 1FSHA 5H20A 4LLLA 2GWRA 5IT9K 2RV8A 2RNJA 3CDHA 1B9NA 1FYKA 2VT3A 1JHHA 3H92A 5HDNA 2FOKA 1O3RA 3TGNA 1T2KA 4A5NA 2UZKA 3ZN1A 2VN2A 5CVRA 2ISZA 2H27A 4HYEA 5L3EA 5DYMA 4HX7A 1MGTA 1HKQA 2P5VA 2ZMEA 1B1BA 3F8CA 4M9XA 3V8LA 3QOPA 1FT9A 4I01A 1UB9A 1O57A 1O7FA 5E20A 2QBYA 4LGWA 4KICA 4YFXF 5E8IA 3BWGA 1DPUA 2B0LA 2MH9A 4EJTA 2BEOA 2X0LA 2ZKZA 2LDUA 2HGCA 5AIPA 3ZP5A 5A2QZ 2W24A 1K78A 2EB7A 2ELHA 1U78A 5D6EA 2V1DA 1J75A 3L9FA 1YO5C 1TQMA 4KDPA 2J5OA 4YG2F 1Y0UA 2ISYA 1L0OC 4M71A 2F5FA 4MEYF 2WV0A 4G7HF 2VOPA 3BPXA 1YYVA 2R7DA 2FBHA 2M45A 2IRFG 2DT5A 2LNBA 2EFNA 4NHJA 3IWFA 1GVJA 1S8NA 2EFQA 4OOIA 5FFXA 1BOAA 4IHTA 3WG9A 4KFCA 3HTUA 4IRGA 1YG2A 5L3CA 1SFEA 4LB6B 4ESBA 1ZRCA 3ZQ7A 3E6CC 2QYOA 1ULYA 4EM0B 1NHAA 4ZYEA 3V8KA 3GEZA 2BYVE 1Z1DA 5CVVA 3IRQA 1TBXA 1ODDA 1R23A 2A3SA 2K86A 1V3FA 3DXJF 5ED4A 2BBYA 2HR3A 2QQBA 4B8XA 1LJ9A 2O03A 3G3ZA 1W5SA 4XSZF 3FM3A 3ZMDA 2ETHA 1ZREA 2VC0A 2HFHA 3D0SA 4KIGA 2L4MA 3KEQA 4Y13A 3J80Z 3KP5A 3T0YA 4EJWA 3ISPA 3H3ZA 5ILUA 3GO5A 2YU3A 1XSVA 4G6DA 1LNWA 3C18A 2ZFWA 3GF2A 2AS5F 3JAMZ 1OYYA 4EJOA 5L3GA 1W7PB 2JRTA 3ABTA 5DD4A 1ZAOA 2MD5A 4CDGA 1FLIA 5ICCA 1E17A 1CF7B 3GUDA 4YFNF 2IA2A 4LD5A 3HSEA 1P2FA 3QPHA 4Q5SF 3K1NA 3V7CA 4UV8A 4G7OF 4DQ2A 4EJUA 4WXCA 3HRSA 1R22A 3GWZA 1Z6TA 4BHPA 3BPVA 4LG0B 3RKXA 2GA1A 3TDZC 3JTHA 4LB5A 5IT9Z 4Z2YA 2STWA 5JHUA 4Q4ZF 5AONA 4HAMA 3I59A 5J8FA 3WTXC 3CTAA 3E5UA 2FMYA 1BIBA 3P9KA 2JTVA 1E2XA 4N0BA 2EJRA 3COAC 2PBIA 1ZLJA 3EQLF 3W6KB 5D5WB 5ICGA 1U6GA 4I02A 5HLIA 4KNYA 1LDKB 5LGTA 1XGOA 3GW2A 2DPDA 1ZG3A 3RDIA 1FBSA 5J6XA 5DUIA 4FHTA 3CUQC 2PI0A 2MBFA 2BGCA 4AWXB 1TLHB 5HS7A 2XGXA 1J2XA 5K5QA 1XDSA 1U5TA 3GFLA 2IA0A 2PMUA 2DU9A 5ICFA 1W7PD 2ESHA 2ZBKA 1HSJA 2P5KA 2FXAA 3RPUA 3ZN0A 4M9SA 1IW7F 2STTA 5HVQC 3DV8A 4HF1A 2CO5A 4MTEA 3N4MA 2W25A 3JW4A 3HRTA 3ZMTA 1R7JA 1FP1D 3P9CA 4IXAA 4Q48A 1QPMA 1U3EM 1TW3A 2XKPA 3U2RA 2L3DA 2EFPA 1IXRC 3WTSC 1ON2A 5HLGA 4G7ZF 1RI7A 4P5OA 1OPCA 5E8GA 4HF0A 3CJNA 1J7KA 3FMSA 4KA4A 4MGRA 5FGMA 2LSOA 5FD6A 3KP2A 3DFGA 3O3KA 2IP2A 3LAPA 3L00A 5CVUA 3HHGA 3CO7C 4ENKA 2DQRA 4WXDA 4BNCA 1D3YA 3IKTA 4KIBA 2ZXJA 4Y15A 2W85A 2Y75A 1S3JA 1J59A 4AIJA 1B6AA 2K7LA 1JHFA 2V6CA 1MJAA 3FMRA 4OINF 5LGUA 3MWMA 2BE5F 5BOXA 1BM9A 3GYHX 2DK5A 1H0MA 3ELKA 2M8EA 1QBJA 4S05A 1RZ4A 4A0YA 2CFXA 1KQ8A 2D45A 3WGIA 5IT3A 5HOOA 2K02A 4IVNA 1H9TA 3ECOA 2CW0F 1IN7A 1P4WA 2IJLA 3F8FA 2GA2A 4PCQA 4OIOF 3QP6A 4L9JA 3MQ0A 4EVIA 3D5LA 3DF8A 4O3MA 2TDXA 4CHUA 4M9ZA 1I6XA 2D1VA 4ESFA 2P5LC 2FBKA 3O2PE 5DUKA 4EJVA 3B73A 3JSOA 1FY7A 2QWWA 1KGSA 3TOAA 1S6LA 1KA8A 1F9NA 2HQRA 2R7FA 4WX9A 3K2ZA 3NQOA 3M8EA 3E5XA 2FSWA 4HLYA 4ZH4F 4RAZA 4G8XA 4U0YA 1YW9A 2KJBA 3SFZA 4GYGA 1AOYA 3PFIA 1Z6RA 3MEXA 3LSTA 1U2WA 5LGNA 3CUOA 1ZG1A 5TJJA 2KRFA 2XRNA 3HIFA 3ZPLA 2VOOA 4CGZA 4FX0A 2L01A 3BROA 3VOEA 4XLNF 2IW5A 2DI3A 4JBAA 2Q0OA 4I0AA 2UXXA 4U7BA 5HDGA 4M6XA 5HLHA 5FLXK 2Q2EA 3ZMVA 3P7NA 1EV7A 1MJBA 5E1WA 1QO0D 2OBPA 4NQWA 3GLXA 1DPRA 2NAZA 1CF7A 3CUQB 2G7HA 3I64A 2HOEA 3B02A 5BPIA 1Z9CA 1T39A 1HKSA 2HEOA 2XAGA 3F6VA 4HF2A 4L9TA 1XMAA 2O3FA 4UVBA 4WXHA 3Q9VA 3LA2A 2FU4A 1VTNC 2YR2A 1XB4A 2HKXA 4BH9A 2KIFA 3I0TA 2JSCA 4OIQF 4IHSA 4EGZA 5CVIA 1YS7A 3U1DA 1L3LA 4U0VA 3V8JA 4HOBA 2ZCWA 3EYIA 2OZ6A 2W84A 1OR7A 2O0YA 1FNNA 1MDMA 1P4XA 5KK1A 1KU3A 1D5VA 2F5DA 3ML6A 1TTYA 3ZMSA 4MEXF 1SAXA 2DAOA 4ZZDA 4A5MA 1FYLA 3FXQA 1K7AA 2FA5A 1FC3A 2HWVA 2M1BA 3LA7A 3IKVA 4N9IA 4AIKA 3C7JA 1R5GA 1SFUA 3NRVA 3TO6A 3FF5A 5E17F 2NS0A 4CZZA 3F8NA 5BQTA 4A6DA 1F1ZA 3GXOA 3M8FA 2A69F 1HW5A 4RB3C 1FYMA 2QZ8A 1JE8A 2KJCA 5FFZA 3E6BA 3OOPA 2XUBA 3P9IA 3F6OA 3SZPA 1IUYA 5HS8A 2V9VA 5LHGA 3PQKA 3QP5A 3HUGA 4PGGA 5D8KB 5D6FA 4LJZF 2V1XA 3S2WA 3HSRA 4DNCA 4LK1F 4U0WA 2MA3A 2P8TA 3MZHA 4L9NA 1GXQA 2IVMA 2QQ9A 5JR3A 4YFKF 1FSEA 2CWEA 2AXLA 2HZTA 4R8HA 3L2CA 1KU7A 1IXSB 1O3SA 1YW8A 1R5HA 1FP2A 3E3VA 5CYVA 3GFJA 4ETSA 1YIOA 3JTGA 2IT0A 3Q9SA 2GIVA 2VBXA 4MNUA 3DKWA 3LFKA 1U5TC 3K1MA 1XCBA 1ZHFA 4MQ9F 1UHMA 1G4DA 1I1SA 1SMYF 2GQQA 1S7OA 2L54A 3E6MA 4IRHA 2XAQA 3IWZA 4R1HA 3WTYC 1PP7U 2QBYB 3QAHA 1OYIA 2P7CB 2A5YB 3FM5A 4CXFA 2HDCA 5K5OA 2LF8A 1QNTA 5JI6A 2QVOA 5E1XA 4GGGA 2D1HA 2JPCA 4L9VA 4HX8A 2XKOA 2VXZA 2KIUA 3QU6A 4WF2A 1S7AA 4G94A 4HLXA 1K78B 4L0ZB 5H6RA 1J9IA 4YIIA 5FLXZ 1RIOH 3TOBA 2DK8A 3QPTA 3EUHA 5JVTA 2V79A 4I7HA 2PMHA 3ZMUA 4HQMA 3HTSB 1REPC 3K1PA 4OMYA 3TQNA 5BS6A 3EETA 3VODA 1FZPB 4MQVA 5DCMB 3DPTA 1BN5A 1U8RA 1ZGJA 2VODA 3JSPA 5HDKA 1FOKA 4GYIA 2Z33A 4OMZA 4R79A 1IN6A 1YQAA 2DO7A 4S04A 1DP7P 3I54A 4M74A 2CSOA 3SQNA 4HW0A 3KCCA 3K0LA 4A0XA 3F23A 3KP3A 3RTRA 2M5WA 1HBXG 5DEQA 2MLKA 1T38A 1WWXA 3HOTA 1B9MA 1F4KA 2HTJA 2O8XA 1XCVA 2Y0MA 3IL2A 1W4MA 3CLOA 1YLFA 4RGSA 2QM3A 1BBYA 4UXNA 3I71A 2NNNA 2VT2A 4HDUA 2O61A 2H09A 1XSDA 6PAXA 2GZWA 1PP8F 2QQAA 4RS8A 2V1UA 3ROUA 2VBZA 2RVCA 3LAJA 3IRRA 2RN7A 4A2UA 3FXRA 1PUEE 1MKMA 5D8LB 4UNOA 4ON0A 1D8KA 5A2QK 3I58A 3KFWX 4EGYA 4KIFA 4LFUA 3BZ6A 2A6EF 5DCFA
chains in the Genus database with same CATH superfamily
1FMVA 2OA4A 1OISA 2OAZA 1MH3A 1K79A 2ZSIB 1EH6A 5ILSA 4XQFA 4EV0A 3UR3C 1IV8A 1X4OA 1SMTA 2W1OA 1IN4A 3IHUA 3CUQA 4LK0F 3RYRA 2QLZA 1T8IA 1MSEC 3NWSA 3DU5A 4C30A 1TNSA 4ZDOA 3NAUA 1RETA 2A6HF 2ELKA 4UVAA 1Z91A 4LIVA 2KIQA 1KQ0A 3BTCA 4NUBA 4B43A 3FKIJ 3HOXJ 4A3IJ 2UXNA 1LEAA 1YX3A 5EEAA 4AM3A 1OKRA 2LRDA 3CP2A 5IP6A 4E7HA 3JRGA 1ZGAA 3QRFF 4M3BA 1U9NA 1Z05A 2OUMA 4RGRA 1VQLI 4QPQA 2EILH 3C2BA 4JQFA 2R92J 5DV5A 3ESWB 3I4PA 2O6GE 3I53A 1YS6A 4HZFA 1EF4A 2E71A 2DFIA 2K4JA 1XMKA 1VQ8I 3GZ5A 4Z6YA 3R0JA 4BACA 3PO2J 4QTRA 1Y1WJ 4A3GJ 1G3TA 2PX9A 2CU7A 4U87A 2GAUA 2PEXA 1IF1A 3S14J 1S72I 3H9JA 2WAEA 3KP6A 1SD6A 1ON1A 4IQ4A 1HSTA 3KEYA 2NYXA 3MKYB 3CQZJ 3BY6A 2LD5A 1ZARA 4LG3A 1OJLA 3H5RA 4IRIA 3K69A 1MSFC 4WCGA 2CJJA 1IXCA 5FROA 5AIQA 2VJ4A 3FXUA 4EATA 1OCTC 4UUSB 2VKHA 3VPRA 3VYRB 4HA8A 2H94A 1G3SA 1O3TA 3J81K 3ZQCA 1A5JA 3CO6C 2ZMEC 3OYBA 4IJAA 1IN5A 4O5VA 4ZZLA 5E18F 1XD7A 3I55I 2FBIA 2ZJ2A 3F72A 1A31A 1BC7C 3WODF 2HXIA 1P4AA 2XAHA 4HEA2 4BL0B 3FK6A 3RKWA 2HYGD 2L7KA 2HI3A 4NBQA 1ZQ3P 2VONA 2R7TA 3ZQFA 1KYWA 1WJ5A 2BY2A 4RB0A 3J80K 3ZQLA 4LOCA 2DBBA 5KAFC 3DLAA 2R4GA 3X2QH 3L7WA 2FF4A 1R1UA 2VE8A 3K4CA 1O3QA 1ONVA 1BI2A 3S17J 2DMPA 5ERIA 1XGSA 2R93J 5F64A 4XR6A 1FBUA 2HYFA 4RB1A 2CG4A 4I0BA 4CCMA 2Z9OA 2R7XA 4KMFA 3JAMK 3OMYA 1OCRH 4BXFA 4II2A 2KT0A 4XBFA 4PK4A 1SC7A 2V9PA 4HBLA 2KISA 3TO7A 1RR8C 4W97A 3S3MA 4A93J 2ZNZA 2IGNA 2R5ZB 3PM1A 3HBLA 2RC4A 1I50J 3JREA 2KDOA 1SD7A 2A68F 3VFZA 2DQLA 2DT7B 3CCYA 1FBQA 5IYDJ 4XRFA 5M5YJ 1N25A 4M72A 5LFAA 3TP3A 3RSNA 3GFIA 1WZ2A 3MZYA 4UHTA 1LVAA 5DDGA 1LKXA 4MLOA 2ZXWH 3DTEA 1MZBA 3QYEA 4KYWA 5EYRA 1GXPA 3GFMA 1X3UA 4UY8I 1RRJA 3M9AA 3N97A 5ICEA 2FMLA 3DP7A 4F92B 3WU1B 4FASD 3RI4A 2M0MA 2NRAC 1BR2A 5K7HA 1X1PA 3LQRA 3CMEI 1SFKA 3S2HJ 2E5ZA 4BE2A 2COMA 3BG5A 2HPMA 1B8IB 2NVTJ 2GXGA 2K27A 3HHHA 1JUSA 4UVCA 1TT0A 3WTTC 3P5JA 3OSFA 2ZSHB 3S93A 5J4YA 2DJIA 3FXLA 1B72B 2EV6A 2HS5A 3L09A 2VJ5A 3G4SI 3Q5FA 2EV0A 1I27A 2XAFA 4HNVA 4HQEA 4P9FA 3E97A 3RJPA 1K6OA 1JGSA 1OMIA 1W7PA 4PDKA 4EM2A 1OFCX 1LPQA 1LFBA 2JPBA 4HDVA 1JXSA 3F8MA 3V4GA 5GADJ 2YU9J 4Y7NJ 4Y33A 3HKZN 4GFBA 1APLC 2E2IJ 1ZLKA 3IC7A 2XPWA 3S1RJ 4M6YA 2OD5A 4AYBA 1HCRA 3BP8A 4FX4A 1ETWA 3CCEI 2M30A 1HQCA 4Q47A 2DA5A 5FRMA 2QGUA 4QWQA 2ZJQF 1NK3P 3OIQA 2GXBA 4YRVA 4B09A 1Y1VJ 2X4HA 4I09A 3S32A 2VBYA 2MH2A 2LY9A 3F8BA 4NC7A 3MCZA 1QRYA 3LA3A 2EFWA 3W3CA 3CCLI 1BA5A 3KYDB 2H6CA 2JVGA 3HPHA 2KRHA 3F3XA 2R7WA 1NG7A 4ZYDA 4UUTA 3M4OJ 3G6EI 1T33A 3FZVA 1LB2A 3R4KA 5C44J 2KFDA 4RB2C 3MKWB 2OZUA 4LG0A 4JX5A 5ILVA 1P9QC 2XSJC 4A3LJ 3F0CA 3BG3A 1R4NB 2K5CA 5LBQA 2EZIA 2WAFA 2VJJA 3M07A 3MAJA 2E1MC 2JZYA 2Q8KA 2HKOA 5LLQA 1R00A 2FE3A 3RYPA 3H3UA 1R5ID 3E1SA 2W00A 4YIFA 2C6YA 1BJAA 4RAYA 1AWCA 3BJAA 1MBFA 1TW2A 4FQGA 4GDFA 5L3FA 3GLLA 5J47A 2EZHA 1QZZA 2QA4I 2Z99A 3V7SA 2WTEA 2NS8A 3SZTA 3IH3A 2BV6A 3BTJA 4JK1X 1D8JA 5DM7F 3BR2A 2HVQA 2R7RA 3RPUD 3CMYA 2V1NA 4ZYGA 3HOUJ 2H6BA 3J7AY 1T0FA 3BOQA 2JA2A 3BTLA 3EDPA 3WU0A 2NNYA 3PNVA 2K9LA 1K6YA 4IOCF 1BC8C 3ECHA 3RKYA 1HW1A 3C1DA 3CMMA 3FXKA 4LIUA 3BZKA 4WK8F 4XICA 1JJ8C 2EFOA 5LEKA 3ERED 2WA0A 1QGPA 5J1UA 1B4AA 3NWTA 2MW8A 3RPQA 5DCMA 2L5QA 2UWMA 2XF7A 2RDPA 2L4AA 4IHVA 2FNPA 1A6QA 2M87A 3K9TA 2BHZA 1OYWA 2AHQA 3ABKH 2LKSA 2I5UA 2JWTA 1ZRDA 2RNGA 1XGNA 3KX2A 2DYSH 3B6AA 5L3BA 3HRUA 4CCNA 5CLSA 1G3YA 1MW7A 4GXOA 1BL0A 5KVRA 2PJRB 2KZVA 5J1RA 2OU2A 5M5WJ 1R58A 2ESNA 3KLNA 4L0YB 3PIPF 1TQPA 3S15J 2MD0A 5J8CA 3CMAI 1YJWI 5CQGA 3T8RA 1MD0A 3BCBA 4BE0A 3HSFA 2LR8A 3F21A 2OQRA 2F5EA 2J5PA 3WTWC 5BPDA 3SYTA 1X4PA 3CC2I 5LRRA 1X3WB 2LREA 2OC6A 4ZYHA 1R4MB 1G8XA 1X1BA 3R60A 5JFRA 4PJLA 2CQKA 3HB9A 1QHHD 4KN7X 4KMUX 2O9LA 2MC3A 1IAWA 2X1CA 2DA1A 4EQQA 4OIPF 3VEPA 2V9KA 4L18B 3ASOH 3LOCA 4LMYA 1XDUA 1WVRA 3FWEA 4E70A 2GM4A 5J4VA 2H1LA 3CF5F 2O7OA 3G1OA 3LSMA 5FKNA 3WHCA 2FQ3A 3J81Z 1P92A 3ZMZA 1MNMC 3W2WA 3HL2A 1ZYRF 2M2EA 1EH7A 1E3OC 4HV6A 4XLEA 4BBRJ 3WE3A 3KETA 2I8DA 2XHKA 5M3MJ 4EM1A 4MTDA 3FKJA 3HDDA 1IRFA 2GBYA 4A3KJ 1VQ4I 3WTUC 2M3AA 3TO9A 1UCRA 1V4RA 1MMGA 1QZEA 3M1EA 4OU0A 1HKTA 2Z3YA 2XIGA 4OAZA 1FWZA 4CZCA 2X6OA 2DA2A 2G9WA 3MFKA 5CJ9A 4F3QA 2MLGA 5C3EJ 2LF7A 1YFHA 1WJFA 5EEGA 4N9HA 1CGPA 2FRHA 2HQNA 4C2TA 2DA4A 2Y48A 3A01A 1SD5A 2D5VA 1F43A 3O8GA 1EJ9A 3F22A 3S1QJ 1PUFB 3KZYA 3I3LA 4BQQA 4IPAA 5K7FA 3T5XA 4ZYAA 4P96A 3T8TA 5J40A 2VKVA 1WFXA 3ABLH 4RGXA 2UUZA 4G6QA 3K4JA 4BY1J 2OQGA 2JA7J 3CDLA 2ZMEB 1H88C 3TW7A 1WJAA 3S3NA 1WKMA 4A12A 1USTA 3IV5A 1BOBA 1QQIA 3WE2A 2L9SA 1WQ2A 4CUGA 1YTYA 4U88A 2ZNYA 3OV8A 1IGNA 3MD2A 3VSKA 3OYJA 2NVQJ 1V5FA 3LSIA 2HOAA 2DMNA 1VNDA 4QIWN 1YW7A 4NB5A 4IHYA 1BI0A 1P7JA 2L02A 3TMOA 5D4SA 3ZQGA 3OYCA 3R0AA 5IYCJ 3BDDA 4A0ZA 2PMZA 1YITI 3M7GA 1A36A 1KYZA 3DLLF 2DLLA 4XN3A 4GCVA 2KL4A 1H89C 3CCMI 1R1TA 4PJNA 1SD4A 2CW8A 4HNTA 2HTSA 1GHCA 5EG0B 4ENJA 3DQVC 2EIMH 3FHZA 4YELA 3FIWA 2JA5J 4L5JA 5M5XJ 1T6SA 4KN4X 5L3DA 3LFUA 4AC0A 5E3NA 4BQAA 2O5RA 4QPOA 2EZLA 1U9OA 4Y4RA 4CO8A 3O8HA 5DD8A 1B59A 2IEKA 3NEUA 3ONQA 2Z5UA 2P7VB 2PQ8A 2LC2A 4GRIA 3HRMA 5H6QA 2WAQA 2ID3A 5F0HA 4C3IJ 2F2EA 1YJNI 4D5FA 1MDMB 2KKOA 2VQLA 5D5UB 4PFPA 5TRDA 3HYIA 1ETQA 1BW5A 1I3QJ 2XROA 2VBWA 5HNFA 2R3SA 2R7QA 3UNGC 1XGMA 1FIAA 1MMNA 4I2OA 1BIAA 5JLWA 4CH7A 2ACJA 4A6EA 1C0WA 2MGQA 2QSGX 4HX4A 5EDNA 2QENA 1Z3XA 1I1GA 4A3BJ 2LK2A 1TNTA 5FB2A 3G73A 4UUSA 1IRGA 3QYBA 4ENMA 1KU2A 3OL3A 5TISC 2DW4A 2E5NA 1TWAJ 1O7LA 4HSRA 2YX7A 1J5YA 5KNLA 3BR1A 3RCOA 4X0GA 1QZYA 2I10A 3BJOA 1DDNA 1R36A 1TT5B 1IV6A 1G2HA 2P4WA 4XKCA 4D7NA 2L7MP 1UHWA 3OR1C 1U0JA 4E7JA 1IG7A 4X6AJ 4KT5C 2EV5A 3LQQA 1Z7LA 4EMSA 1DUXC 2FEZA 5HS9A 1S7EA 4DYQA 4IX7A 4RM3A 3DTKA 5HNHA 2EK5A 3WTZA 4WWCA 1XN7A 4DYRA 3ASNH 1RNLA 2VASA 2CGPA 1YIJI 3FBNB 3R6SA 4K2EA 4ASNA 2V6EA 3ABUA 4PGHA 3QU3A 3TKYA 3PIOF 4ESJA 5K5RA 1RUOA 3LSPA 1E3PA 3R61A 4QLCU 2NOGA 2VKDA 1GV5A 2QUFA 2MYSA 4XMYA 4F52A 3D5SC 3SDBA 3KZZA 5DTDA 1P6RA 4XK4A 4E6KG 2M4KA 4CICA 1ETOA 3SHFA 3W6VA 4XRSA 3OYNA 4XKWA 3ERMA 4CSWA 3KP4A 4XLPF 3OS0A 1ZG5A 5HODA 3ZGKA 2CV2A 3BR6A 2F5VA 2A07F 2GLOA 4O6JA 1T98A 1Z3YA 2Y0SA 3L1PA 2GOMA 4XSXF 3RIRA 4RDUA 1IDYA 3OWTA 2ZJRF 4ZDLA 3GCMA 4P55A 2E1MB 3HGGA 2PLYA 1Q1HA 1HXDA 2F5CA 2A61A 1RKWA 4E4HA 4D0PA 2CRGA 5LEJA 5CVJA 3O6BB 3OYMA 5BMZA 2EA2A 3BR0A 3CD6I 1Z7UA 3FX3A 2HZDA 3DPLC 1HW2A 1BI3A 1T08B 2DMQA 1B8IA 2YPRA 2D2WA 1Y39A 4DBQA 4LLNA 2YX4A 2KP6A 4MFEA 3VB2A 2RREA 4M73A 3WGGA 5LRSA 1IN8A 1A04A 2WB1N 4FETA 5IYBJ 2QEXI 5E3OA 1B72A 1PDNC 4GO1A 3CJRB 2G7UA 5FO5A 4F7ZA 3H9QA 4UV9A 2E1NA 5FD5A 4F55A 3KP7A 1S29A 2VE9A 1RUNA 3BLYA 3I4NJ 4L5IA 1OCPA 2P6SA 2AO9A 4CYDA 1UFMA 2B7EA 4DIQA 1W5TA 2PN6A 4PSWA 2TCTA 3I56I 1F36A 2FQ4A 2RQPA 4I98B 1BI1A 2VC1A 2XPUA 1MMDA 1GUUA 1QVUA 2LBFB 4ZJZA 1JGGA 4BHCA 2X48A 3LWFA 3WGHA 4PUSA 2LKPA 1J0RA 1FEXA 4BY7J 5EEHA 4KUMA 3L2UA 3DPUA 2CMPA 2K4BA 3OYFA 1X2NA 1CQTA 2E36A 3TW6A 3EYYA 2LTPA 2IA1A 3VSLA 3PQJA 5FKKA 1XSXA 1BJZA 1IC8A 3KEOA 4RGUA 4P9UA 2IXSA 3VDXA 5IP7J 4V2GA 2LOOA 1RKTA 2JQ7A 1WI9A 4BYYA 1IZ1A 2WWYA 2VJIA 2R0QC 4BAYA 2JUCA 1FPQA 1RPWA 1MJ9A 3E6DA 3V7RA 5IPAA 2NVUB 5E1ZB 5LHIA 2HOSA 2YS9A 4ENNA 3I59B 3AL0C 4AIHA 1ZH5A 2E1CA 2EINH 4PZJA 4CYCA 3EUKL 1LFUP 3ULQB 2Z1DA 1SVMA 4XM3A 1PVEA 3SXYA 1TQIA 3HOSA 1Z67A 4G12A 3U9GA 1WRJA 4MFDA 4Y17A 4AVPA 3GVAA 1JKPC 1F5TA 5LHHA 2CQQA 2LKXA 4BHBA 2RGVA 4U7DA 5D5XB 3K4MA 4IF4A 5FKLA 3ABMH 3JRDA 2BXZA 3T1BA 2ME6A 3I5UA 3W6JB 5F1JA 3C3WA 2P6TA 5KAIC 2WC2A 4MHGA 1WJEA 3KE2A 3TDUC 3ZRGA 3DEUA 5FLVA 2PFBA 4G9YA 3A2KA 1ETXA 4JOMA 1ZR4A 5F0CA 4BXUA 2XASA 1QVTA 5D5VB 1KU9A 3L2WA 2KLOA 1LQ1A 3KLOA 1R9TJ 3L2QA 1NTCA 2E7XA 2YSRA 1UHSA 4IZZA 5D4RA 3FMQA 3HXLA 2ZO4A 2LMDA 4FT8A 3GZ6A 2L2OA 1DU0A 2AXTC 2DYRH 1W0UA 3LSJA 1FX7A 4CCJA 2GIZA 2MABA 1LE8B 1LEBA 1EH8A 3ZOBA 1YHQI 1H9GA 1U5TB 2QCOA 1JTXA 2JT1A 2E7WA 2VIXA 1SFXA 3PSIA 3WTVC 4UUVA 1WSUA 1ZRFA 2DA7A 1LDDA 2VQCA 5J1YA 1R1VA 3K4BA 2ADUA 3FK7A 5F6FA 1I5ZA 2W57A 2XAJA 4AD9A 5GAGJ 1JUPA 5F1RA 5GAHJ 4J00A 3J7AO 2VPLA 1G3WA 2FNAA 1G6NA 4C9YA 4ZC3A 2CYYA 1USSA 3MMYB 3GTMJ 1LDJA 4OIRF 3ZR8X 3DEWA 4DZJA 2DPUA 4LLGF 3GTQJ 2DTRA 4XNFA 4B4CA 2BW3A 3LSKA 3REOA 4E7LA 1ZN2A 4FCYA 4KITB 2EA4A 2Q1ZB 3KYLA 1OR7C 2XVCA 2HNHA 1E3HA 2L0KA 1D0XA 2KIMA 3DU6A 3GX4X 2VQGA 2LFBA 4TV7A 1ITYA 3S3OA 3CLQA 3CC7I 3E5QA 5K1YA 1VZ0A 3BJ6A 5EGOB 3AAFA 1STZA 3CESA 2IPQX 3SEZA 2EWNA 4S0HB 2XV4S 2QF7A 1TWGJ 4Y3OA 2EPFA 2PG4A 4I6ZA 4N4OB 1D0ZA 1ZK8A 3TBIA 4JX4A 2RKHA 3OYEA 2HDDA 4HV5A 4YEJA 2NXNB 1K4SA 2PJPA 3ZCOA 3OYLA 1KQ9A 3WHBA 1MBEA 1FSHA 3WU2C 1FTZA 5H20A 4QSHA 1MMAA 3LL7A 4LLLA 2GWRA 5IT9K 2Z16A 1S5LC 4BQOA 2DOEA 2RV8A 2RNJA 3CDHA 2FOWA 1B9NA 1FYKA 2VT3A 3HJEA 1JHHA 1TWFJ 3H92A 1MNEA 2CFOA 5HDNA 1MIJA 2FOKA 4XLAA 2HOTA 3GMEA 3TGNA 4DGWB 1O3RA 1T2KA 4A5NA 1XX5A 2UZKA 1H8AC 3ZN1A 2VN2A 5CVRA 1PUFA 1AKHB 2ISZA 2H27A 4FE7A 4HYEA 3KYCB 5L3EA 3FXJA 4B48A 5DYMA 2VPRA 2IBDA 4G6TB 1MGTA 4HX7A 1K83J 1HKQA 2P5VA 2HU9A 2ZMEA 1B1BA 3F8CA 4M9XA 2IS4A 3V8LA 3QOPA 4H0EA 1HDPA 2Y30A 2W4SA 1D1BA 3RZDJ 1FT9A 3BR3A 2JMWA 4I01A 1UB9A 4KJZA 3ZQHA 3PO3J 1O57A 1O7FA 2XB5A 5B3SH 3EUAA 5E20A 5GTHC 2QBYA 3S1MJ 4LGWA 1VI0A 4KICA 1R49A 3KPHA 4YFXF 1JUMA 1TL8A 1U8BA 2H8RA 4ABZA 5E8IA 3BWGA 2Y9ZA 2B0LA 2MH9A 4AYBN 1DPUA 4EJTA 1IUFA 2BEOA 2CUJA 3OS2A 1IJWC 2X0LA 3OIOA 4C2MJ 4IO9F 2ZKZA 1UAAA 3A1YA 3H0GJ 2LDUA 2KQRA 2HGCA 2XF5A 3U21A 5AIPA 4V19K 3ZP5A 5A2QZ 1WJCA 3OS1A 3S2DJ 2ECCA 2XF6A 2W24A 3BC8A 1K78A 4AIDA 2EB7A 2ELHA 1U78A 5D6EA 3FXOA 2V1DA 5GPCA 4YIRX 1YI2I 4P1WA 2KMUA 1J75A 2GOXB 3L9FA 1YO5C 3RZOJ 5E3LA 1TQMA 5E3MA 4KDPA 2J5OA 2WY8Q 4YG2F 1Y0UA 3QOEA 2ISYA 2X9DA 1L0OC 2EIJH 3K4LA 4M71A 2F5FA 4MEYF 2WV0A 4G7HF 4BUPA 2VOPA 2MC4A 3BPXA 3HOYJ 2A5WA 1XMXA 3HPGA 1YYVA 2R7DA 3QQAA 2FBHA 3WG7H 2M45A 2VQHA 4RAGA 2IRFG 4IL6C 2DT5A 4BDZA 3Q0VA 5B5EC 2LNBA 2EFNA 4NHJA 2W7NA 3IWFA 1GVJA 1IRZA 1S8NA 2EFQA 4OOIA 3EPZA 3IH2A 1ZTRA 4CA0A 3QPLA 5FFXA 1BOAA 4IHTA 3WG9A 4IHWA 4KFCA 2IAIA 3UKGA 3HTUA 4IRGA 1N78A 1YG2A 2E1OA 3M8JA 5L3CA 1SFEA 2R7OA 4C3HJ 4J19A 2F6CA 1XC5A 4LB6B 4ZDPA 4ESBA 1ZRCA 3ZQ7A 2M7BA 3E6CC 2QYOA 4BJTA 2DJNA 1MBKA 1Z21A 3H9GA 1ULYA 2ME0A 4EM0B 1NHAA 4ANJA 4ZYEA 3V8KA 3GEZA 1QU3A 2BYVE 3B6CA 3HZJA 2FD5A 1VQ9I 1Z1DA 5CVVA 2FJ1A 2MSYA 2DCEA 3IRQA 4XOPA 1TBXA 1ODDA 1R23A 2A3SA 2K86A 1V3FA 1IRXA 3DXJF 5ED4A 2BBYA 2HR3A 2QQBA 1X58A 1PYVA 4B8XA 1LJ9A 3CF2A 2ID6A 3MN2A 2O03A 3G3ZA 1OLTA 1W5SA 2X85A 4XSZF 3CCUI 3J7YJ 3H0DA 3FM3A 4B3AA 3HOZJ 3ZMDA 1MBJA 2ETHA 1ZREA 2K9QA 3EUHC 3HOWJ 2VC0A 2HFHA 3D0SA 3IH4A 4KIGA 1W1WE 3FDYA 2L4MA 3I9V2 3M3YJ 3KEQA 4Y13A 3AL0B 4NDLA 3J80Z 3DEEA 3KP5A 1HLVA 3T0YA 4EJWA 3CDIA 2B63J 2KPMA 2LLKA 3H3ZA 3ISPA 5ILUA 2N8GA 1GDTA 3GO5A 2LP0A 2YU3A 1XSVA 1BR1A 1V55H 2CH0A 2E2HJ 4HG2A 2OCCH 4G6DA 3JRCA 1LNWA 3PSFA 1LVKA 3C18A 2ZFWA 4EEFG 3GF2A 2R5YB 2WV1A 3U1KA 2QSFX 1JJ6C 2AS5F 3JAMZ 1OYYA 1X1DA 1VQMI 4EJOA 5L3GA 1W7PB 1ETVA 2JRTA 2DFHA 3ABTA 1SEUA 5DD4A 2Q2EB 1ZAOA 2MD5A 4CDGA 5IP9J 2XC7A 1FLIA 3SFIA 5ICCA 1E17A 3DCFA 3OSGA 2M4GA 4NQWB 1CF7B 1MBGA 2F4MB 2HVRA 3GUDA 4YFNF 2LG4A 2IA2A 1I6HJ 4UB6C 4XKVA 4LD5A 3HSEA 4E7KA 1P2FA 2EBIA 2NS7A 3QPHA 2AQEA 2LBFA 3K1NA 3OOUA 5IOZA 4Q5SF 3V7CA 4UV8A 2JJ7A 3DBHB 4G7OF 4DQ2A 4DBRA 4EJUA 2Y31A 4WXCA 4FTHA 3HRSA 2JN6A 1R22A 2P0WA 3GWZA 1Z6TA 2CUZA 4XLCA 3J7ZI 1R71A 2HXOA 4BHPA 3BPVA 3VYUB 2DOAA 2E35A 3A4CA 3JRHA 3OYKA 4LG0B 2YUSA 3RKXA 4JX6A 3BQZA 2GA1A 3TDZC 1Y56A 2HPIA 5J3LA 1UZCA 3JTHA 4LB5A 5IT9Z 4Z2YA 2STWA 4ZTFA 5JHUA 1ZELA 4Q4ZF 2VI6A 5AONA 4HAMA 5GTIC 1YX5A 3PUFA 3D5RC 2PMZN 3I59A 4DZPA 4NC8A 1ENHA 3FISA 5J8FA 3WTXC 2R7VA 1HA8A 3CTAA 3E5UA 2IS2A 2FMYA 5K7ZA 2DDBA 1RC9A 1JKOC 2ELJA 1BIBA 2DODA 4LITA 3P9KA 2JTVA 3K2AA 1E2XA 1S9HA 2VL8A 5H2FC 2WY7Q 4N0BA 3A0BC 2EJRA 4FE4A 3CCQI 3COAC 4M3GA 2PBIA 2OPTA 1ZLJA 3EQLF 3W6KB 5D5WB 3DWLE 5ICGA 3BG6A 1U6GA 3MKZA 4Y52J 4I02A 5HLIA 4KNYA 1D0YA 3G2BA 1K61A 3OYHA 3MKLA 1LDKB 4D9JA 2WAQN 5FKOA 5LGTA 1XGOA 3GW2A 2DPDA 1ZG3A 4HPQA 3RDIA 1FBSA 5J6XA 5DUIA 2OTLI 2XSDC 4FHTA 3HC7A 3CUQC 2PI0A 2MBFA 2BGCA 4MIMA 4BJ5C 2Y69H 4AWXB 1TLHB 5HS7A 2XGXA 1J2XA 2XGEA 5K5QA 2BVMA 1XDSA 1U5TA 3GFLA 3OYAA 3PNYA 1BR4A 1VF9A 1G59A 2R7UA 1D1AA 2IA0A 2PMUA 4XONA 3SJMA 2DU9A 5ICFA 3ZXSA 3PL8A 4XLHA 2DXIA 1W7PD 2ESHA 3TL4X 2ZBKA 1HSJA 2K3PA 2P5KA 2DMUA 2R5ZA 2FXAA 4B44A 1V5GA 3RPUA 2W48A 3ZN0A 1FOXA 1A6IA 4M9SA 4BKXA 1IW7F 3HUGB 2STTA 5HVQC 3DV8A 4HF1A 2CO5A 4MTEA 5TGTA 4PJ0C 3ZQQA 2DTZA 2QKLB 2UV1A 3N4MA 2W25A 1WH7A 2ZXHA 3JW4A 5EGOA 2K3FA 3PUBA 4JP0A 1FOYA 4BJ6C 1UELB 3HRTA 1GLNA 3ZMTA 2ECBA 1R7JA 1RESA 3NARA 3GTLJ 3I4MJ 1FP1D 3P9CA 4IXAA 4XRMA 3DBLB 4Q48A 3JCUC 1ORKA 1QPMA 1U3EM 2X51A 3K10A 1UG0A 1TW3A 3SEQA 2XKPA 3U2RA 3JRBA 3RQ4A 2X1DA 2L3DA 4L5EA 3A0HC 2EFPA 4BDYA 2Y0SN 1IXRC 4DJAA 1UG2A 1DGWY 3WTSC 1ON2A 5HLGA 4G7ZF 1RI7A 2M8GX 4P5OA 1OPCA 1RR7A 5E8GA 5JLXA 2A6TA 4HF0A 2L9VA 1HDDC 3CJNA 3D1NI 1J7KA 3FMSA 4BEHB 4MGRA 4KA4A 5EZHA 1AKHA 5FGMA 2LSOA 4RMNA 5FD6A 3KP2A 3DFGA 1W36C 3O3KA 1KONA 1FJLA 2IP2A 2IS6A 1QPIA 4F91B 4D5CA 3LAPA 3L00A 5CVUA 2VXDA 1HC8A 3Q3SA 3HHGA 3CO7C 4ENKA 4A3JJ 5CKTA 3AG4H 1AHDP 1JKRC 3PFYA 1SFOJ 2DQRA 4WXDA 1OCCH 4BNCA 1D3YA 3IKTA 3K70C 4KIBA 2JRMA 2ZXJA 4XL9A 2W85A 4Y15A 2GXAA 1Y6IA 2CQNA 2Y75A 1S3JA 1YJ9I 1J59A 4OAYA 1B6AA 4AIJA 2K7LA 4F93B 1JHFA 2V6CA 4ITVA 4W1UA 4BQNA 1MJAA 3FMRA 4V2FA 4OINF 5LGUA 3HM5A 3MWMA 1T95A 3SZGA 2BE5F 5KCMA 1DGRM 4XRSG 4XORA 1WI3A 3PNTA 2COBA 5BOXA 1BM9A 3GYHX 2DK5A 1Z77A 3BG7A 1H0MA 3BCAA 2EQRA 3ELKA 5FKMA 2M8EA 1QBJA 4S05A 2K9MA 4E7ZA 2OV7A 1SVLA 1RZ4A 1A35A 4A0YA 3OYGA 2E2JJ 4DOZA 5B66C 1WH5A 1WGXA 2CFXA 3BQYA 1KQ8A 2M7AA 2NOJB 1YE9A 3S8PA 3PJRA 1AA7A 3H36A 2D45A 1LFPA 2P81A 3WGIA 2BY0A 5IT3A 5HOOA 2NVYJ 2HDWA 3V42A 2K02A 1O4XA 2DFFA 2FX0A 4IVNA 1H9TA 1D1CA 3ECOA 2EH3A 4RLFA 2CW0F 5F27A 1IN7A 1P4WA 2IJLA 3F8FA 3RQIA 2GA2A 3OIPA 4PCQA 2G0EA 2IGMA 1OCOH 3IUOA 4RLQA 2V26A 4MO7A 4OIOF 1TWCJ 4BU2A 3QP6A 3G1LA 4L9JA 3MQ0A 4EVIA 3C2HA 3D5LA 3DF8A 4O3MA 1FOWA 2TDXA 1FTTA 3CZ6A 2ZC2A 4CHUA 4M9ZA 2PJRA 1I6XA 2HQ5A 3MVPA 2LH9A 2D1VA 2TRTA 4ESFA 3TP0A 4IKFA 2P5LC 2FBKA 3O2PE 1V5EA 4CCKA 4A3CJ 5DUKA 2MG4A 4EJVA 3B73A 1YRNB 3GTJJ 3CCJI 3F9KA 5DM6F 3JSOA 2K40A 1IO2A 4ZTJA 2JA8J 3HOVJ 3OYIA 3CCRI 4XN0A 3IP4B 1FY7A 2BVLA 3CJQB 4CCOA 4RM2A 1J09A 2K85A 2QWWA 1KGSA 2JK3A 1S6LA 3TOAA 4BGDA 2RQQA 4C3JJ 1KA8A 1F9NA 2HQRA 2R7FA 3BTIA 1R6RA 2JVHA 4WX9A 3K2ZA 3NQOA 1Y8RB 3A03A 2CS3A 3M8EA 2JUGA 1OQYA 3E5XA 2FSWA 1N77A 4M3DA 1V54H 4HLYA 1T0FC 4ZH4F 4RAZA 3GTKJ 1NH3A 4G8XA 2OJED 4U0YA 2QKMB 1YW9A 2KJBA 3SFZA 3HKZA 4GYGA 1AOYA 3H1CA 3PFIA 1Z6RA 5EJCA 3MEXA 4FISA 5M3FJ 3LSTA 1U2WA 4D1QA 2VLAA 1SVOA 3LNQA 5LGNA 3K7AJ 5CPRB 2HVSA 4AVZA 2ICWG 1VQ6I 3VYSB 3CUOA 1ZG1A 2CQXA 5TJJA 2KRFA 5KHDA 9ANTA 4BE1A 2XRNA 3HIFA 3ZPLA 2VOOA 2X6YA 4CGZA 4FX0A 2L01A 4HRIA 3BROA 3VOEA 4I76A 4XLNF 2DA3A 2IW5A 2R5YA 2DI3A 5DS9A 4JBAA 1K4TA 2Q0OA 5CQEA 4I0AA 2UXXA 4U7BA 5HDGA 4M6XA 5HLHA 3HG9A 5FLXK 1WJBA 2F48A 2Q2EA 1VQ5I 3ZMVA 3P7NA 3CP8A 3AKZA 1EV7A 3KIOA 1MJBA 2XGCA 5E1WA 1QO0D 2OBPA 2XGDA 3GLXA 4NQWA 1DPRA 2BXYA 2KZGA 2NAZA 1CF7A 4KISA 1Q1VA 3CUQB 2G7HA 1FIPA 3OY9A 4NNJA 1I3AA 3I64A 2HOEA 2XPVA 3B02A 3OYDA 5BPIA 1Z9CA 1T39A 1HKSA 2OCEA 2XAGA 1QA6A 2HEOA 3F6VA 4XKBA 4HF2A 4L9TA 1XMAA 2O3FA 1GV2A 4UVBA 4WXHA 3Q9VA 5C4JJ 1ZKGA 3LA2A 2FU4A 5EG0A 1VTNC 2YR2A 1XB4A 2HKXA 4BH9A 2VUMJ 4J01A 2KIFA 3I0TA 2JSCA 4OIQF 2R7ZJ 4IHSA 3ZQIA 2ZFUA 1JTYA 4EGZA 4XOTA 5CVIA 4C2UA 1YS7A 1ETKA 3U1DA 1L3LA 4U0VA 4CYCB 1JT0A 2FUG2 3V8JA 1JKQC 2DT6A 2XAUA 1JT6A 2HYJA 4HOBA 2ZCWA 3EYIA 3H5AA 2OZ6A 5LD2C 2W84A 1OR7A 5HLTA 2O0YA 1FNNA 1MDMA 1P4XA 5KK1A 4HSTA 1PJRA 1UJ8A 2WADA 2X1EA 4AUXA 4E7SA 4AU7A 1KU3A 1D5VA 2F5DA 3ML6A 2QSHX 1I39A 2QQ8A 3VWBA 2EIKH 1GT0C 1TTYA 4UB8C 3ZMSA 4BS9A 4MEXF 2BHYA 3AG2H 1SAXA 3N05A 2DAOA 4ZZDA 4A5MA 1FYLA 3FXQA 1K7AA 2FA5A 1FC3A 2HWVA 2M1BA 3LA7A 2CW7A 5EZGA 3IKVA 3MZ8A 1MH4A 2BOLA 2DA6A 1HOMA 4M3FA 4N9IA 4AIKA 3C7JA 1R5GA 2L9NA 3DTIA 3GTPJ 3K4KA 1SFUA 2Y9YA 3NRVA 1X19A 3TO6A 3JR9A 3GZNB 3FF5A 5E17F 2NS0A 5F0FA 3DBRB 4CZZA 2V7FA 4XIDA 2VB6A 2M34A 3QYFA 1XS9A 3G1MA 3F8NA 1XPXA 4KT6A 5BQTA 4A6DA 2O8KA 2F4IA 1F1ZA 3GXOA 3M8FA 4D7MA 3TEDA 2A69F 1HW5A 4RB3C 2DDAA 4JYKA 1FYMA 2QZ8A 3LSHA 1JE8A 2KJCA 2V4JC 5FFZA 4A69C 2BW3B 3H5NA 4X1EA 3E6BA 2JA6J 2AQFA 3OOPA 2XUBA 3P9IA 1ZGWA 4BXXJ 3F6OA 2KHMA 3E7LA 1SAUA 1NG6A 3SZPA 1IUYA 3Q0UA 5B1AH 5HS8A 1XG1A 2V9VA 5LHGA 3PQKA 4A3DJ 3QP5A 2CV0A 2K9NA 2KRCA 3HUGA 4PGGA 5D8KB 5D6FA 2Y2ZA 1VQOI 1MBHA 4LJZF 2V1XA 3KZIC 3S2WA 3HEFA 3HSRA 5GPAA 4DNCA 3LSRA 4LK1F 4U0WA 2MA3A 2P8TA 3MZHA 4L9NA 1GXQA 2BY3A 2IVMA 2QQ9A 5JR3A 4YFKF 3GTGJ 3H35A 2VKEA 2JSPA 1FSEA 2CWEA 2ZJPF 1LUJB 2AXLA 2HZTA 3VYTB 4R8HA 4IQJA 3L2CA 1KU7A 1WCMJ 3S16J 3SDGA 1IXSB 1O3SA 5JHFA 1YW8A 2E19A 1M1EB 1R5HA 1KZHA 1FP2A 2LY1A 3E3VA 1IDZA 1UMQA 5IY5H 5B1BH 2H8WA 1X1CA 4M6VA 3JRFA 5CYVA 3GFJA 3K6GA 4E7IA 1EKEA 4ETSA 1YIOA 3JTGA 4M3EA 3Q9SA 2IT0A 2GIVA 2VBXA 3AFHA 4MNUA 3DKWA 1ZR2A 2OTJI 3LFKA 3Q0WA 1U5TC 2B9SA 3K1MA 1XCBA 1ZHFA 1XTAA 2F4OB 4MQ9F 5IOYA 5FLMJ 5GP9A 1UHMA 1G4DA 1I1SA 1SMYF 3CCVI 2NVXJ 2GQQA 1S7OA 4BEHA 3FBIB 2L54A 1QHGA 1W0TA 4RA2A 1POGA 2IS1A 2Z2SB 3E6MA 4IRHA 4I99C 3E0JB 3L2VA 1ETYA 2XAQA 3IWZA 4R1HA 1N75A 3WTYC 2OF7A 1PP7U 4H4KC 2QBYB 1TZLA 2K9SA 4A3FJ 4A3MJ 3QAHA 1OYIA 5FRNA 1WJDA 2P7CB 2A5YB 3FM5A 4CXFA 2HDCA 5K5OA 4PJJA 2LF8A 1QNTA 5JI6A 2QVOA 5E1XA 3W2AA 3G71I 1DQUA 1Y8QB 4GGGA 2D1HA 2JPCA 4L9VA 2M9HA 4HX8A 1JI8A 1BW6A 2XDVA 4A3EJ 2XKOA 2MFZA 1EA3A 1MNDA 4B3XA 1WPKA 2LY2A 2VXZA 2KIUA 3QU6A 4WF2A 1S7AA 2LVSA 4G94A 1W36D 1DP3A 2L9RA 4HLXA 1K78B 4L0ZB 3GTOJ 1HF0A 2X6WA 3A02A 5H6RA 3OR2C 1J9IA 4YIIA 2RAEA 4NC6A 1E0EA 4HNUA 3IAM2 5FLXZ 1RIOH 3TOBA 2DK8A 3QPTA 3EUHA 3AG1H 4DW6A 5JVTA 3K70D 2V79A 4I7HA 2PMHA 3ZMUA 1VQ7I 1X1AA 4HQMA 3HTSB 3BR5A 2W82A 3DKXA 3AG3H 3K1PA 3W2VA 1VQPI 1REPC 4RBOA 3TQNA 4OMYA 1TWHJ 2L7FP 5BS6A 3EETA 3CCSI 3VODA 4N4NB 4MQVA 5DCMB 3DPTA 1BN5A 1FZPB 1TP4A 1U8RA 3CC4I 4OWRB 1ZGJA 3RKQA 2VODA 3JSPA 5HDKA 1AU7A 1FOKA 3QODA 4GYIA 2DOFA 4OMZA 2Z33A 4CCLA 3QWLA 4RAFA 1LE8A 2CQ7A 4R79A 2E60A 1IN6A 1YQAA 1X2MA 2DO7A 5F04A 4S04A 1DP7P 3FHNA 3I54A 4IHXA 4M74A 2CSOA 3OL4A 5F08A 3SQNA 1TC3C 2LYCA 3LSGA 4HW0A 1VQKI 2L7ZA 3KCCA 2CV1A 3K0LA 1GVDA 3BG9A 1VQNI 5BNGA 1SANA 4A0XA 5EF6A 5FJ8J 3F23A 3KP3A 3RTRA 1WHUA 2M5WA 4PFOA 2CUEA 5DEQA 1HBXG 2MLKA 1YRNA 4BBSJ 1Z0XA 3HGYA 3QPSA 1T38A 1WWXA 3HOTA 3FXMA 3H3VK 5JVGF 2HQAA 1B9MA 4B47A 2BZTA 1F4KA 4DYCA 2HTJA 2O8XA 2R7SA 3IAS2 1P7IA 5DCFA 1XCVA 2ZB9A 4XLFA 2XRLA 2WBMA 3JRIA 2WB1A 1YOVB 2Y0MA 3IL2A 1W4MA 3CLOA 1DU6A 2DMTA 2M0CA 3CJTB 2X6XA 1YLFA 4RGSA 4B1RA 2IGOA 3JRAA 1ACIA 1VFCA 2QM3A 1BBYA 3LMMA 4UXNA 1W5CC 1D5YA 3I71A 3DKYA 2NNNA 2VT2A 4HDUA 2EZKA 2E34A 2IGKA 2O61A 2H09A 1XSDA 6PAXA 2GZWA 3A01B 1ERDA 3L2RA 1X3ZB 4IEJA 3BT9A 2ZXIA 1PP8F 2QQAA 4RS8A 2V1UA 3ROUA 3C2GA 3BZCA 4PSXA 2VBZA 1MMSA 2RVCA 3LAJA 1T56A 3IRRA 2RN7A 4A2UA 3FXRA 1PUEE 1MKMA 2DFEA 5D8LB 4UNOA 4ON0A 1NK2P 1D8KA 4IOAF 5A2QK 5E79C 3S1NJ 3GBGA 2BY1A 3I58A 3KFWX 1Y0NA 4EGYA 4KIFA 4II3A 2XB0X 4PJMA 1FMWA 5C4XJ 4LFUA 3BZ6A 2H1KA 2KDZA 5GAEJ 2A6EF 2CUFA 3M1CA 2DN0A 2A05A 3K4NA 1OCZH
chains in the Genus database with same CATH topology
2OA4A 2OAZA 1K79A 1EH6A 5ILSA 4EV0A 1SMTA 1IN4A 3IHUA 3CUQA 4LK0F 3RYRA 2QLZA 1TNSA 2A6HF 4UVAA 1Z91A 1KQ0A 2UXNA 1LEAA 1OKRA 1ZGAA 3QRFF 1Z05A 4RGRA 4JQFA 5DV5A 3I4PA 2O6GE 3I53A 1YS6A 4HZFA 2DFIA 2K4JA 1XMKA 3GZ5A 3R0JA 1G3TA 2GAUA 2PEXA 1IF1A 3KP6A 1SD6A 1ON1A 1HSTA 2NYXA 3BY6A 1ZARA 4IRIA 3K69A 4WCGA 1IXCA 5AIQA 3FXUA 4HA8A 2H94A 1G3SA 1O3TA 3J81K 3CO6C 4IJAA 1IN5A 4O5VA 4ZZLA 5E18F 1XD7A 2FBIA 2ZJ2A 3F72A 1BC7C 3WODF 1P4AA 2XAHA 3RKWA 2HYGD 2VONA 1KYWA 4RB0A 3J80K 2DBBA 3L7WA 2FF4A 1R1UA 2VE8A 1O3QA 1ONVA 1BI2A 5ERIA 1XGSA 5F64A 1FBUA 2HYFA 4RB1A 2CG4A 4I0BA 2Z9OA 4KMFA 3JAMK 4XBFA 4HBLA 3TO7A 2ZNZA 2RC4A 1SD7A 2A68F 3VFZA 2DQLA 1FBQA 4XRFA 4M72A 3GFIA 3MZYA 4UHTA 1LVAA 5DDGA 1MZBA 4KYWA 1GXPA 3GFMA 1X3UA 3M9AA 3N97A 5ICEA 2FMLA 3DP7A 3WU1B 3RI4A 2NRAC 3LQRA 2COMA 2GXGA 2K27A 3HHHA 4UVCA 3WTTC 2EV6A 2HS5A 3L09A 3Q5FA 2EV0A 1I27A 2XAFA 4HQEA 4P9FA 3E97A 3RJPA 1K6OA 1JGSA 1OMIA 1W7PA 4PDKA 4EM2A 4HDVA 2JPBA 1JXSA 3F8MA 3V4GA 1ZLKA 3IC7A 4M6YA 2OD5A 3BP8A 4FX4A 2M30A 1HQCA 4Q47A 4QWQA 2GXBA 4B09A 2X4HA 4I09A 2VBYA 2MH2A 3F8BA 3MCZA 3LA3A 2EFWA 2H6CA 3F3XA 4ZYDA 1LB2A 3FZVA 3R4KA 4RB2C 2OZUA 4LG0A 5ILVA 5LBQA 3MAJA 2JZYA 2Q8KA 2HKOA 5LLQA 1R00A 2FE3A 3RYPA 3H3UA 4YIFA 2C6YA 1BJAA 4RAYA 1AWCA 3BJAA 1TW2A 5L3FA 1QZZA 2Z99A 3V7SA 2WTEA 3SZTA 2BV6A 4JK1X 1D8JA 4ZYGA 2H6BA 1T0FA 3BOQA 3EDPA 3WU0A 2NNYA 1BC8C 3ECHA 3RKYA 1HW1A 3C1DA 4WK8F 2EFOA 5LEKA 3ERED 1QGPA 1B4AA 3RPQA 5DCMA 2UWMA 2RDPA 2L4AA 2FNPA 2M87A 3K9TA 1OYWA 1ZRDA 1XGNA 5L3BA 3HRUA 5CLSA 1G3YA 4GXOA 5KVRA 2OU2A 1R58A 2ESNA 3KLNA 4L0YB 1TQPA 5J8CA 3T8RA 1MD0A 3HSFA 3F21A 2OQRA 2F5EA 2J5PA 3WTWC 5BPDA 5LRRA 4ZYHA 5JFRA 3R60A 2CQKA 4KN7X 4KMUX 2MC3A 1IAWA 4EQQA 4OIPF 3VEPA 4L18B 4LMYA 1XDUA 3FWEA 4E70A 2FQ3A 3J81Z 1P92A 3ZMZA 1ZYRF 1EH7A 4HV6A 3KETA 3WE3A 2XHKA 4EM1A 4MTDA 1IRFA 3WTUC 3TO9A 1UCRA 1V4RA 3M1EA 4OU0A 1HKTA 2Z3YA 2XIGA 1FWZA 2G9WA 3MFKA 5CJ9A 2MLGA 1YFHA 2LF7A 1CGPA 5EEGA 4N9HA 2FRHA 2HQNA 2Y48A 1SD5A 3F22A 3KZYA 4IPAA 3T5XA 4P96A 3T8TA 4RGXA 4G6QA 2OQGA 2ZMEB 1WKMA 4A12A 1USTA 1QQIA 3WE2A 1WQ2A 1YTYA 4U88A 2ZNYA 3OV8A 1YW7A 4NB5A 1BI0A 2L02A 5D4SA 3R0AA 3BDDA 4A0ZA 3M7GA 1KYZA 2DLLA 4GCVA 1R1TA 1SD4A 2HTSA 1GHCA 4ENJA 3DQVC 3FHZA 4L5JA 1T6SA 4KN4X 5L3DA 4BQAA 4CO8A 5DD8A 1B59A 3NEUA 2Z5UA 2P7VB 2PQ8A 3HRMA 5H6QA 2F2EA 1MDMB 2KKOA 5D5UB 5TRDA 3HYIA 2XROA 2VBWA 2R3SA 1XGMA 4I2OA 1BIAA 2ACJA 4A6EA 1C0WA 4HX4A 2QENA 1I1GA 1TNTA 5FB2A 3G73A 1IRGA 4ENMA 1KU2A 2DW4A 1O7LA 2YX7A 1J5YA 1QZYA 3BJOA 1DDNA 1R36A 2P4WA 1UHWA 4KT5C 2EV5A 3LQQA 4EMSA 1DUXC 2FEZA 5HS9A 2EK5A 3WTZA 4WWCA 1XN7A 1RNLA 2CGPA 3R6SA 4K2EA 4ASNA 3ABUA 4PGHA 3QU3A 3TKYA 4ESJA 5K5RA 1RUOA 3R61A 4QLCU 2QUFA 3KZZA 1P6RA 4CICA 3SHFA 3KP4A 4XLPF 1ZG5A 2A07F 4O6JA 1T98A 4XSXF 3RIRA 4P55A 2PLYA 1Q1HA 1HXDA 2F5CA 2A61A 5LEJA 4D0PA 5CVJA 3O6BB 5BMZA 2EA2A 1Z7UA 3FX3A 3DPLC 1HW2A 1BI3A 2YPRA 2D2WA 4LLNA 2YX4A 3VB2A 4M73A 3WGGA 5LRSA 1IN8A 1A04A 1PDNC 4GO1A 2G7UA 5FO5A 4F7ZA 4UV9A 2E1NA 5FD5A 3KP7A 1S29A 2VE9A 1RUNA 4L5IA 2P6SA 4CYDA 1UFMA 1W5TA 2PN6A 2RQPA 4I98B 1BI1A 2VC1A 4BHCA 3LWFA 3WGHA 2LKPA 1J0RA 5EEHA 4KUMA 2K4BA 3EYYA 2IA1A 3PQJA 1XSXA 3KEOA 4RGUA 4P9UA 1WI9A 4BYYA 1IZ1A 2WWYA 4BAYA 1FPQA 1MJ9A 3E6DA 3V7RA 5E1ZB 5LHIA 4ENNA 3I59B 4AIHA 1ZH5A 2E1CA 4PZJA 3ULQB 4H0EA 3SXYA 3HOSA 1TQIA 3U9GA 1WRJA 4Y17A 4AVPA 3GVAA 1F5TA 5LHHA 4BHBA 2RGVA 4U7DA 5D5XB 4IF4A 3T1BA 3I5UA 3W6JB 3C3WA 2P6TA 2WC2A 4MHGA 3KE2A 3TDUC 3DEUA 2PFBA 4G9YA 4BXUA 2XASA 5D5VB 1KU9A 1LQ1A 3KLOA 2E7XA 2YSRA 5D4RA 3FMQA 2ZO4A 4FT8A 3GZ6A 1FX7A 1LEBA 1EH8A 1H9GA 1U5TB 2JT1A 2E7WA 1SFXA 3WTVC 4UUVA 1WSUA 1ZRFA 1LDDA 1R1VA 2ADUA 5F6FA 1I5ZA 2W57A 2XAJA 4AD9A 5F1RA 3J7AO 1G3WA 2FNAA 1G6NA 2CYYA 1USSA 1LDJA 4OIRF 2DPUA 4LLGF 2DTRA 3REOA 1ZN2A 2EA4A 2XVCA 2KIMA 3GX4X 4TV7A 3E5QA 5K1YA 3BJ6A 3AAFA 1STZA 2IPQX 2EWNA 2XV4S 2PG4A 2RKHA 4HV5A 2PJPA 1KQ9A 1FSHA 5H20A 4LLLA 2GWRA 5IT9K 2RV8A 2RNJA 3CDHA 1B9NA 1FYKA 2VT3A 1JHHA 3H92A 5HDNA 2FOKA 1O3RA 3TGNA 1T2KA 4A5NA 2UZKA 3ZN1A 2VN2A 5CVRA 2ISZA 2H27A 4HYEA 5L3EA 5DYMA 4HX7A 1MGTA 1HKQA 2P5VA 2ZMEA 1B1BA 3F8CA 4M9XA 3V8LA 3QOPA 1FT9A 4I01A 1UB9A 1O57A 1O7FA 5E20A 2QBYA 4LGWA 4KICA 4YFXF 5E8IA 3BWGA 1DPUA 2B0LA 2MH9A 4EJTA 2BEOA 2X0LA 2ZKZA 2LDUA 2HGCA 5AIPA 3ZP5A 5A2QZ 2W24A 1K78A 2EB7A 2ELHA 1U78A 5D6EA 2V1DA 1J75A 3L9FA 1YO5C 1TQMA 4KDPA 2J5OA 4YG2F 1Y0UA 2ISYA 1L0OC 4M71A 2F5FA 4MEYF 2WV0A 4G7HF 2VOPA 3BPXA 1YYVA 2R7DA 2FBHA 2M45A 2IRFG 2DT5A 2LNBA 2EFNA 4NHJA 3IWFA 1GVJA 1S8NA 2EFQA 4OOIA 5FFXA 1BOAA 4IHTA 3WG9A 4KFCA 3HTUA 4IRGA 1YG2A 5L3CA 1SFEA 4LB6B 4ESBA 1ZRCA 3ZQ7A 3E6CC 2QYOA 1ULYA 4EM0B 1NHAA 4ZYEA 3V8KA 3GEZA 2BYVE 1Z1DA 5CVVA 3IRQA 1TBXA 1ODDA 1R23A 2A3SA 2K86A 1V3FA 3DXJF 5ED4A 2BBYA 2HR3A 2QQBA 4B8XA 1LJ9A 2O03A 3G3ZA 1W5SA 4XSZF 3FM3A 3ZMDA 2ETHA 1ZREA 2VC0A 2HFHA 3D0SA 4KIGA 2L4MA 3KEQA 4Y13A 3J80Z 3KP5A 3T0YA 4EJWA 3ISPA 3H3ZA 5ILUA 3GO5A 2YU3A 1XSVA 4G6DA 1LNWA 3C18A 2ZFWA 3GF2A 2AS5F 3JAMZ 1OYYA 4EJOA 5L3GA 1W7PB 2JRTA 3ABTA 5DD4A 1ZAOA 2MD5A 4CDGA 1FLIA 5ICCA 1E17A 1CF7B 3GUDA 4YFNF 2IA2A 4LD5A 3HSEA 1P2FA 3QPHA 4Q5SF 3K1NA 3V7CA 4UV8A 4G7OF 4DQ2A 4EJUA 4WXCA 3HRSA 1R22A 3GWZA 1Z6TA 4BHPA 3BPVA 4LG0B 3RKXA 2GA1A 3TDZC 3JTHA 4LB5A 5IT9Z 4Z2YA 2STWA 5JHUA 4Q4ZF 5AONA 4HAMA 3I59A 5J8FA 3WTXC 3CTAA 3E5UA 2FMYA 1BIBA 3P9KA 2JTVA 1E2XA 4N0BA 2EJRA 3COAC 2PBIA 1ZLJA 3EQLF 3W6KB 5D5WB 5ICGA 1U6GA 4I02A 5HLIA 4KNYA 1LDKB 5LGTA 1XGOA 3GW2A 2DPDA 1ZG3A 3RDIA 1FBSA 5J6XA 5DUIA 4FHTA 3CUQC 2PI0A 2MBFA 2BGCA 4AWXB 1TLHB 5HS7A 2XGXA 1J2XA 5K5QA 1XDSA 1U5TA 3GFLA 2IA0A 2PMUA 2DU9A 5ICFA 1W7PD 2ESHA 2ZBKA 1HSJA 2P5KA 2FXAA 3RPUA 3ZN0A 4M9SA 1IW7F 2STTA 5HVQC 3DV8A 4HF1A 2CO5A 4MTEA 3N4MA 2W25A 3JW4A 3HRTA 3ZMTA 1R7JA 1FP1D 3P9CA 4IXAA 4Q48A 1QPMA 1U3EM 1TW3A 2XKPA 3U2RA 2L3DA 2EFPA 1IXRC 3WTSC 1ON2A 5HLGA 4G7ZF 1RI7A 4P5OA 1OPCA 5E8GA 4HF0A 3CJNA 1J7KA 3FMSA 4KA4A 4MGRA 5FGMA 2LSOA 5FD6A 3KP2A 3DFGA 3O3KA 2IP2A 3LAPA 3L00A 5CVUA 3HHGA 3CO7C 4ENKA 2DQRA 4WXDA 4BNCA 1D3YA 3IKTA 4KIBA 2ZXJA 4Y15A 2W85A 2Y75A 1S3JA 1J59A 4AIJA 1B6AA 2K7LA 1JHFA 2V6CA 1MJAA 3FMRA 4OINF 5LGUA 3MWMA 2BE5F 5BOXA 1BM9A 3GYHX 2DK5A 1H0MA 3ELKA 2M8EA 1QBJA 4S05A 1RZ4A 4A0YA 2CFXA 1KQ8A 2D45A 3WGIA 5IT3A 5HOOA 2K02A 4IVNA 1H9TA 3ECOA 2CW0F 1IN7A 1P4WA 2IJLA 3F8FA 2GA2A 4PCQA 4OIOF 3QP6A 4L9JA 3MQ0A 4EVIA 3D5LA 3DF8A 4O3MA 2TDXA 4CHUA 4M9ZA 1I6XA 2D1VA 4ESFA 2P5LC 2FBKA 3O2PE 5DUKA 4EJVA 3B73A 3JSOA 1FY7A 2QWWA 1KGSA 3TOAA 1S6LA 1KA8A 1F9NA 2HQRA 2R7FA 4WX9A 3K2ZA 3NQOA 3M8EA 3E5XA 2FSWA 4HLYA 4ZH4F 4RAZA 4G8XA 4U0YA 1YW9A 2KJBA 3SFZA 4GYGA 1AOYA 3PFIA 1Z6RA 3MEXA 3LSTA 1U2WA 5LGNA 3CUOA 1ZG1A 5TJJA 2KRFA 2XRNA 3HIFA 3ZPLA 2VOOA 4CGZA 4FX0A 2L01A 3BROA 3VOEA 4XLNF 2IW5A 2DI3A 4JBAA 2Q0OA 4I0AA 2UXXA 4U7BA 5HDGA 4M6XA 5HLHA 5FLXK 2Q2EA 3ZMVA 3P7NA 1EV7A 1MJBA 5E1WA 1QO0D 2OBPA 4NQWA 3GLXA 1DPRA 2NAZA 1CF7A 3CUQB 2G7HA 3I64A 2HOEA 3B02A 5BPIA 1Z9CA 1T39A 1HKSA 2HEOA 2XAGA 3F6VA 4HF2A 4L9TA 1XMAA 2O3FA 4UVBA 4WXHA 3Q9VA 3LA2A 2FU4A 1VTNC 2YR2A 1XB4A 2HKXA 4BH9A 2KIFA 3I0TA 2JSCA 4OIQF 4IHSA 4EGZA 5CVIA 1YS7A 3U1DA 1L3LA 4U0VA 3V8JA 4HOBA 2ZCWA 3EYIA 2OZ6A 2W84A 1OR7A 2O0YA 1FNNA 1MDMA 1P4XA 5KK1A 1KU3A 1D5VA 2F5DA 3ML6A 1TTYA 3ZMSA 4MEXF 1SAXA 2DAOA 4ZZDA 4A5MA 1FYLA 3FXQA 1K7AA 2FA5A 1FC3A 2HWVA 2M1BA 3LA7A 3IKVA 4N9IA 4AIKA 3C7JA 1R5GA 1SFUA 3NRVA 3TO6A 3FF5A 5E17F 2NS0A 4CZZA 3F8NA 5BQTA 4A6DA 1F1ZA 3GXOA 3M8FA 2A69F 1HW5A 4RB3C 1FYMA 2QZ8A 1JE8A 2KJCA 5FFZA 3E6BA 3OOPA 2XUBA 3P9IA 3F6OA 3SZPA 1IUYA 5HS8A 2V9VA 5LHGA 3PQKA 3QP5A 3HUGA 4PGGA 5D8KB 5D6FA 4LJZF 2V1XA 3S2WA 3HSRA 4DNCA 4LK1F 4U0WA 2MA3A 2P8TA 3MZHA 4L9NA 1GXQA 2IVMA 2QQ9A 5JR3A 4YFKF 1FSEA 2CWEA 2AXLA 2HZTA 4R8HA 3L2CA 1KU7A 1IXSB 1O3SA 1YW8A 1R5HA 1FP2A 3E3VA 5CYVA 3GFJA 4ETSA 1YIOA 3JTGA 2IT0A 3Q9SA 2GIVA 2VBXA 4MNUA 3DKWA 3LFKA 1U5TC 3K1MA 1XCBA 1ZHFA 4MQ9F 1UHMA 1G4DA 1I1SA 1SMYF 2GQQA 1S7OA 2L54A 3E6MA 4IRHA 2XAQA 3IWZA 4R1HA 3WTYC 1PP7U 2QBYB 3QAHA 1OYIA 2P7CB 2A5YB 3FM5A 4CXFA 2HDCA 5K5OA 2LF8A 1QNTA 5JI6A 2QVOA 5E1XA 4GGGA 2D1HA 2JPCA 4L9VA 4HX8A 2XKOA 2VXZA 2KIUA 3QU6A 4WF2A 1S7AA 4G94A 4HLXA 1K78B 4L0ZB 5H6RA 1J9IA 4YIIA 5FLXZ 1RIOH 3TOBA 2DK8A 3QPTA 3EUHA 5JVTA 2V79A 4I7HA 2PMHA 3ZMUA 4HQMA 3HTSB 1REPC 3K1PA 4OMYA 3TQNA 5BS6A 3EETA 3VODA 1FZPB 4MQVA 5DCMB 3DPTA 1BN5A 1U8RA 1ZGJA 2VODA 3JSPA 5HDKA 1FOKA 4GYIA 2Z33A 4OMZA 4R79A 1IN6A 1YQAA 2DO7A 4S04A 1DP7P 3I54A 4M74A 2CSOA 3SQNA 4HW0A 3KCCA 3K0LA 4A0XA 3F23A 3KP3A 3RTRA 2M5WA 1HBXG 5DEQA 2MLKA 1T38A 1WWXA 3HOTA 1B9MA 1F4KA 2HTJA 2O8XA 1XCVA 2Y0MA 3IL2A 1W4MA 3CLOA 1YLFA 4RGSA 2QM3A 1BBYA 4UXNA 3I71A 2NNNA 2VT2A 4HDUA 2O61A 2H09A 1XSDA 6PAXA 2GZWA 1PP8F 2QQAA 4RS8A 2V1UA 3ROUA 2VBZA 2RVCA 3LAJA 3IRRA 2RN7A 4A2UA 3FXRA 1PUEE 1MKMA 5D8LB 4UNOA 4ON0A 1D8KA 5A2QK 3I58A 3KFWX 4EGYA 4KIFA 4LFUA 3BZ6A 2A6EF 5DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OA4 A;  2OAZ A;  1K79 A;  1EH6 A;  5ILS A;  4EV0 A;  1SMT A;  1IN4 A;  3IHU A;  3CUQ A;  4LK0 F;  3RYR A;  2QLZ A;  1TNS A;  2A6H F;  4UVA A;  1Z91 A;  1KQ0 A;  2UXN A;  1LEA A;  1OKR A;  1ZGA A;  3QRF F;  1Z05 A;  4RGR A;  4JQF A;  5DV5 A;  3I4P A;  2O6G E;  3I53 A;  1YS6 A;  4HZF A;  2DFI A;  2K4J A;  1XMK A;  3GZ5 A;  3R0J A;  1G3T A;  2GAU A;  2PEX A;  1IF1 A;  3KP6 A;  1SD6 A;  1ON1 A;  1HST A;  2NYX A;  3BY6 A;  1ZAR A;  4IRI A;  3K69 A;  4WCG A;  1IXC A;  5AIQ A;  3FXU A;  4HA8 A;  2H94 A;  1G3S A;  1O3T A;  3J81 K;  3CO6 C;  4IJA A;  1IN5 A;  4O5V A;  4ZZL A;  5E18 F;  1XD7 A;  2FBI A;  2ZJ2 A;  3F72 A;  1BC7 C;  3WOD F;  1P4A A;  2XAH A;  3RKW A;  2HYG D;  2VON A;  1KYW A;  4RB0 A;  3J80 K;  2DBB A;  3L7W A;  2FF4 A;  1R1U A;  2VE8 A;  1O3Q A;  1ONV A;  1BI2 A;  5ERI A;  1XGS A;  5F64 A;  1FBU A;  2HYF A;  4RB1 A;  2CG4 A;  4I0B A;  2Z9O A;  4KMF A;  3JAM K;  4XBF A;  4HBL A;  3TO7 A;  2ZNZ A;  2RC4 A;  1SD7 A;  2A68 F;  3VFZ A;  2DQL A;  1FBQ A;  4XRF A;  4M72 A;  3GFI A;  3MZY A;  4UHT A;  1LVA A;  5DDG A;  1MZB A;  4KYW A;  1GXP A;  3GFM A;  1X3U A;  3M9A A;  3N97 A;  5ICE A;  2FML A;  3DP7 A;  3WU1 B;  3RI4 A;  2NRA C;  3LQR A;  2COM A;  2GXG A;  2K27 A;  3HHH A;  4UVC A;  3WTT C;  2EV6 A;  2HS5 A;  3L09 A;  3Q5F A;  2EV0 A;  1I27 A;  2XAF A;  4HQE A;  4P9F A;  3E97 A;  3RJP A;  1K6O A;  1JGS A;  1OMI A;  1W7P A;  4PDK A;  4EM2 A;  4HDV A;  2JPB A;  1JXS A;  3F8M A;  3V4G A;  1ZLK A;  3IC7 A;  4M6Y A;  2OD5 A;  3BP8 A;  4FX4 A;  2M30 A;  1HQC A;  4Q47 A;  4QWQ A;  2GXB A;  4B09 A;  2X4H A;  4I09 A;  2VBY A;  2MH2 A;  3F8B A;  3MCZ A;  3LA3 A;  2EFW A;  2H6C A;  3F3X A;  4ZYD A;  1LB2 A;  3FZV A;  3R4K A;  4RB2 C;  2OZU A;  4LG0 A;  5ILV A;  5LBQ A;  3MAJ A;  2JZY A;  2Q8K A;  2HKO A;  5LLQ A;  1R00 A;  2FE3 A;  3RYP A;  3H3U A;  4YIF A;  2C6Y A;  1BJA A;  4RAY A;  1AWC A;  3BJA A;  1TW2 A;  5L3F A;  1QZZ A;  2Z99 A;  3V7S A;  2WTE A;  3SZT A;  2BV6 A;  4JK1 X;  1D8J A;  4ZYG A;  2H6B A;  1T0F A;  3BOQ A;  3EDP A;  3WU0 A;  2NNY A;  1BC8 C;  3ECH A;  3RKY A;  1HW1 A;  3C1D A;  4WK8 F;  2EFO A;  5LEK A;  3ERE D;  1QGP A;  1B4A A;  3RPQ A;  5DCM A;  2UWM A;  2RDP A;  2L4A A;  2FNP A;  2M87 A;  3K9T A;  1OYW A;  1ZRD A;  1XGN A;  5L3B A;  3HRU A;  5CLS A;  1G3Y A;  4GXO A;  5KVR A;  2OU2 A;  1R58 A;  2ESN A;  3KLN A;  4L0Y B;  1TQP A;  5J8C A;  3T8R A;  1MD0 A;  3HSF A;  3F21 A;  2OQR A;  2F5E A;  2J5P A;  3WTW C;  5BPD A;  5LRR A;  4ZYH A;  5JFR A;  3R60 A;  2CQK A;  4KN7 X;  4KMU X;  2MC3 A;  1IAW A;  4EQQ A;  4OIP F;  3VEP A;  4L18 B;  4LMY A;  1XDU A;  3FWE A;  4E70 A;  2FQ3 A;  3J81 Z;  1P92 A;  3ZMZ A;  1ZYR F;  1EH7 A;  4HV6 A;  3KET A;  3WE3 A;  2XHK A;  4EM1 A;  4MTD A;  1IRF A;  3WTU C;  3TO9 A;  1UCR A;  1V4R A;  3M1E A;  4OU0 A;  1HKT A;  2Z3Y A;  2XIG A;  1FWZ A;  2G9W A;  3MFK A;  5CJ9 A;  2MLG A;  1YFH A;  2LF7 A;  1CGP A;  5EEG A;  4N9H A;  2FRH A;  2HQN A;  2Y48 A;  1SD5 A;  3F22 A;  3KZY A;  4IPA A;  3T5X A;  4P96 A;  3T8T A;  4RGX A;  4G6Q A;  2OQG A;  2ZME B;  1WKM A;  4A12 A;  1UST A;  1QQI A;  3WE2 A;  1WQ2 A;  1YTY A;  4U88 A;  2ZNY A;  3OV8 A;  1YW7 A;  4NB5 A;  1BI0 A;  2L02 A;  5D4S A;  3R0A A;  3BDD A;  4A0Z A;  3M7G A;  1KYZ A;  2DLL A;  4GCV A;  1R1T A;  1SD4 A;  2HTS A;  1GHC A;  4ENJ A;  3DQV C;  3FHZ A;  4L5J A;  1T6S A;  4KN4 X;  5L3D A;  4BQA A;  4CO8 A;  5DD8 A;  1B59 A;  3NEU A;  2Z5U A;  2P7V B;  2PQ8 A;  3HRM A;  5H6Q A;  2F2E A;  1MDM B;  2KKO A;  5D5U B;  5TRD A;  3HYI A;  2XRO A;  2VBW A;  2R3S A;  1XGM A;  4I2O A;  1BIA A;  2ACJ A;  4A6E A;  1C0W A;  4HX4 A;  2QEN A;  1I1G A;  1TNT A;  5FB2 A;  3G73 A;  1IRG A;  4ENM A;  1KU2 A;  2DW4 A;  1O7L A;  2YX7 A;  1J5Y A;  1QZY A;  3BJO A;  1DDN A;  1R36 A;  2P4W A;  1UHW A;  4KT5 C;  2EV5 A;  3LQQ A;  4EMS A;  1DUX C;  2FEZ A;  5HS9 A;  2EK5 A;  3WTZ A;  4WWC A;  1XN7 A;  1RNL A;  2CGP A;  3R6S A;  4K2E A;  4ASN A;  3ABU A;  4PGH A;  3QU3 A;  3TKY A;  4ESJ A;  5K5R A;  1RUO A;  3R61 A;  4QLC U;  2QUF A;  3KZZ A;  1P6R A;  4CIC A;  3SHF A;  3KP4 A;  4XLP F;  1ZG5 A;  2A07 F;  4O6J A;  1T98 A;  4XSX F;  3RIR A;  4P55 A;  2PLY A;  1Q1H A;  1HXD A;  2F5C A;  2A61 A;  5LEJ A;  4D0P A;  5CVJ A;  3O6B B;  5BMZ A;  2EA2 A;  1Z7U A;  3FX3 A;  3DPL C;  1HW2 A;  1BI3 A;  2YPR A;  2D2W A;  4LLN A;  2YX4 A;  3VB2 A;  4M73 A;  3WGG A;  5LRS A;  1IN8 A;  1A04 A;  1PDN C;  4GO1 A;  2G7U A;  5FO5 A;  4F7Z A;  4UV9 A;  2E1N A;  5FD5 A;  3KP7 A;  1S29 A;  2VE9 A;  1RUN A;  4L5I A;  2P6S A;  4CYD A;  1UFM A;  1W5T A;  2PN6 A;  2RQP A;  4I98 B;  1BI1 A;  2VC1 A;  4BHC A;  3LWF A;  3WGH A;  2LKP A;  1J0R A;  5EEH A;  4KUM A;  2K4B A;  3EYY A;  2IA1 A;  3PQJ A;  1XSX A;  3KEO A;  4RGU A;  4P9U A;  1WI9 A;  4BYY A;  1IZ1 A;  2WWY A;  4BAY A;  1FPQ A;  1MJ9 A;  3E6D A;  3V7R A;  5E1Z B;  5LHI A;  4ENN A;  3I59 B;  4AIH A;  1ZH5 A;  2E1C A;  4PZJ A;  3ULQ B;  4H0E A;  3SXY A;  3HOS A;  1TQI A;  3U9G A;  1WRJ A;  4Y17 A;  4AVP A;  3GVA A;  1F5T A;  5LHH A;  4BHB A;  2RGV A;  4U7D A;  5D5X B;  4IF4 A;  3T1B A;  3I5U A;  3W6J B;  3C3W A;  2P6T A;  2WC2 A;  4MHG A;  3KE2 A;  3TDU C;  3DEU A;  2PFB A;  4G9Y A;  4BXU A;  2XAS A;  5D5V B;  1KU9 A;  1LQ1 A;  3KLO A;  2E7X A;  2YSR A;  5D4R A;  3FMQ A;  2ZO4 A;  4FT8 A;  3GZ6 A;  1FX7 A;  1LEB A;  1EH8 A;  1H9G A;  1U5T B;  2JT1 A;  2E7W A;  1SFX A;  3WTV C;  4UUV A;  1WSU A;  1ZRF A;  1LDD A;  1R1V A;  2ADU A;  5F6F A;  1I5Z A;  2W57 A;  2XAJ A;  4AD9 A;  5F1R A;  3J7A O;  1G3W A;  2FNA A;  1G6N A;  2CYY A;  1USS A;  1LDJ A;  4OIR F;  2DPU A;  4LLG F;  2DTR A;  3REO A;  1ZN2 A;  2EA4 A;  2XVC A;  2KIM A;  3GX4 X;  4TV7 A;  3E5Q A;  5K1Y A;  3BJ6 A;  3AAF A;  1STZ A;  2IPQ X;  2EWN A;  2XV4 S;  2PG4 A;  2RKH A;  4HV5 A;  2PJP A;  1KQ9 A;  1FSH A;  5H20 A;  4LLL A;  2GWR A;  5IT9 K;  2RV8 A;  2RNJ A;  3CDH A;  1B9N A;  1FYK A;  2VT3 A;  1JHH A;  3H92 A;  5HDN A;  2FOK A;  1O3R A;  3TGN A;  1T2K A;  4A5N A;  2UZK A;  3ZN1 A;  2VN2 A;  5CVR A;  2ISZ A;  2H27 A;  4HYE A;  5L3E A;  5DYM A;  4HX7 A;  1MGT A;  1HKQ A;  2P5V A;  2ZME A;  1B1B A;  3F8C A;  4M9X A;  3V8L A;  3QOP A;  1FT9 A;  4I01 A;  1UB9 A;  1O57 A;  1O7F A;  5E20 A;  2QBY A;  4LGW A;  4KIC A;  4YFX F;  5E8I A;  3BWG A;  1DPU A;  2B0L A;  2MH9 A;  4EJT A;  2BEO A;  2X0L A;  2ZKZ A;  2LDU A;  2HGC A;  5AIP A;  3ZP5 A;  5A2Q Z;  2W24 A;  1K78 A;  2EB7 A;  2ELH A;  1U78 A;  5D6E A;  2V1D A;  1J75 A;  3L9F A;  1YO5 C;  1TQM A;  4KDP A;  2J5O A;  4YG2 F;  1Y0U A;  2ISY A;  1L0O C;  4M71 A;  2F5F A;  4MEY F;  2WV0 A;  4G7H F;  2VOP A;  3BPX A;  1YYV A;  2R7D A;  2FBH A;  2M45 A;  2IRF G;  2DT5 A;  2LNB A;  2EFN A;  4NHJ A;  3IWF A;  1GVJ A;  1S8N A;  2EFQ A;  4OOI A;  5FFX A;  1BOA A;  4IHT A;  3WG9 A;  4KFC A;  3HTU A;  4IRG A;  1YG2 A;  5L3C A;  1SFE A;  4LB6 B;  4ESB A;  1ZRC A;  3ZQ7 A;  3E6C C;  2QYO A;  1ULY A;  4EM0 B;  1NHA A;  4ZYE A;  3V8K A;  3GEZ A;  2BYV E;  1Z1D A;  5CVV A;  3IRQ A;  1TBX A;  1ODD A;  1R23 A;  2A3S A;  2K86 A;  1V3F A;  3DXJ F;  5ED4 A;  2BBY A;  2HR3 A;  2QQB A;  4B8X A;  1LJ9 A;  2O03 A;  3G3Z A;  1W5S A;  4XSZ F;  3FM3 A;  3ZMD A;  2ETH A;  1ZRE A;  2VC0 A;  2HFH A;  3D0S A;  4KIG A;  2L4M A;  3KEQ A;  4Y13 A;  3J80 Z;  3KP5 A;  3T0Y A;  4EJW A;  3ISP A;  3H3Z A;  5ILU A;  3GO5 A;  2YU3 A;  1XSV A;  4G6D A;  1LNW A;  3C18 A;  2ZFW A;  3GF2 A;  2AS5 F;  3JAM Z;  1OYY A;  4EJO A;  5L3G A;  1W7P B;  2JRT A;  3ABT A;  5DD4 A;  1ZAO A;  2MD5 A;  4CDG A;  1FLI A;  5ICC A;  1E17 A;  1CF7 B;  3GUD A;  4YFN F;  2IA2 A;  4LD5 A;  3HSE A;  1P2F A;  3QPH A;  4Q5S F;  3K1N A;  3V7C A;  4UV8 A;  4G7O F;  4DQ2 A;  4EJU A;  4WXC A;  3HRS A;  1R22 A;  3GWZ A;  1Z6T A;  4BHP A;  3BPV A;  4LG0 B;  3RKX A;  2GA1 A;  3TDZ C;  3JTH A;  4LB5 A;  5IT9 Z;  4Z2Y A;  2STW A;  5JHU A;  4Q4Z F;  5AON A;  4HAM A;  3I59 A;  5J8F A;  3WTX C;  3CTA A;  3E5U A;  2FMY A;  1BIB A;  3P9K A;  2JTV A;  1E2X A;  4N0B A;  2EJR A;  3COA C;  2PBI A;  1ZLJ A;  3EQL F;  3W6K B;  5D5W B;  5ICG A;  1U6G A;  4I02 A;  5HLI A;  4KNY A;  1LDK B;  5LGT A;  1XGO A;  3GW2 A;  2DPD A;  1ZG3 A;  3RDI A;  1FBS A;  5J6X A;  5DUI A;  4FHT A;  3CUQ C;  2PI0 A;  2MBF A;  2BGC A;  4AWX B;  1TLH B;  5HS7 A;  2XGX A;  1J2X A;  5K5Q A;  1XDS A;  1U5T A;  3GFL A;  2IA0 A;  2PMU A;  2DU9 A;  5ICF A;  1W7P D;  2ESH A;  2ZBK A;  1HSJ A;  2P5K A;  2FXA A;  3RPU A;  3ZN0 A;  4M9S A;  1IW7 F;  2STT A;  5HVQ C;  3DV8 A;  4HF1 A;  2CO5 A;  4MTE A;  3N4M A;  2W25 A;  3JW4 A;  3HRT A;  3ZMT A;  1R7J A;  1FP1 D;  3P9C A;  4IXA A;  4Q48 A;  1QPM A;  1U3E M;  1TW3 A;  2XKP A;  3U2R A;  2L3D A;  2EFP A;  1IXR C;  3WTS C;  1ON2 A;  5HLG A;  4G7Z F;  1RI7 A;  4P5O A;  1OPC A;  5E8G A;  4HF0 A;  3CJN A;  1J7K A;  3FMS A;  4KA4 A;  4MGR A;  5FGM A;  2LSO A;  5FD6 A;  3KP2 A;  3DFG A;  3O3K A;  2IP2 A;  3LAP A;  3L00 A;  5CVU A;  3HHG A;  3CO7 C;  4ENK A;  2DQR A;  4WXD A;  4BNC A;  1D3Y A;  3IKT A;  4KIB A;  2ZXJ A;  4Y15 A;  2W85 A;  2Y75 A;  1S3J A;  1J59 A;  4AIJ A;  1B6A A;  2K7L A;  1JHF A;  2V6C A;  1MJA A;  3FMR A;  4OIN F;  5LGU A;  3MWM A;  2BE5 F;  5BOX A;  1BM9 A;  3GYH X;  2DK5 A;  1H0M A;  3ELK A;  2M8E A;  1QBJ A;  4S05 A;  1RZ4 A;  4A0Y A;  2CFX A;  1KQ8 A;  2D45 A;  3WGI A;  5IT3 A;  5HOO A;  2K02 A;  4IVN A;  1H9T A;  3ECO A;  2CW0 F;  1IN7 A;  1P4W A;  2IJL A;  3F8F A;  2GA2 A;  4PCQ A;  4OIO F;  3QP6 A;  4L9J A;  3MQ0 A;  4EVI A;  3D5L A;  3DF8 A;  4O3M A;  2TDX A;  4CHU A;  4M9Z A;  1I6X A;  2D1V A;  4ESF A;  2P5L C;  2FBK A;  3O2P E;  5DUK A;  4EJV A;  3B73 A;  3JSO A;  1FY7 A;  2QWW A;  1KGS A;  3TOA A;  1S6L A;  1KA8 A;  1F9N A;  2HQR A;  2R7F A;  4WX9 A;  3K2Z A;  3NQO A;  3M8E A;  3E5X A;  2FSW A;  4HLY A;  4ZH4 F;  4RAZ A;  4G8X A;  4U0Y A;  1YW9 A;  2KJB A;  3SFZ A;  4GYG A;  1AOY A;  3PFI A;  1Z6R A;  3MEX A;  3LST A;  1U2W A;  5LGN A;  3CUO A;  1ZG1 A;  5TJJ A;  2KRF A;  2XRN A;  3HIF A;  3ZPL A;  2VOO A;  4CGZ A;  4FX0 A;  2L01 A;  3BRO A;  3VOE A;  4XLN F;  2IW5 A;  2DI3 A;  4JBA A;  2Q0O A;  4I0A A;  2UXX A;  4U7B A;  5HDG A;  4M6X A;  5HLH A;  5FLX K;  2Q2E A;  3ZMV A;  3P7N A;  1EV7 A;  1MJB A;  5E1W A;  1QO0 D;  2OBP A;  4NQW A;  3GLX A;  1DPR A;  2NAZ A;  1CF7 A;  3CUQ B;  2G7H A;  3I64 A;  2HOE A;  3B02 A;  5BPI A;  1Z9C A;  1T39 A;  1HKS A;  2HEO A;  2XAG A;  3F6V A;  4HF2 A;  4L9T A;  1XMA A;  2O3F A;  4UVB A;  4WXH A;  3Q9V A;  3LA2 A;  2FU4 A;  1VTN C;  2YR2 A;  1XB4 A;  2HKX A;  4BH9 A;  2KIF A;  3I0T A;  2JSC A;  4OIQ F;  4IHS A;  4EGZ A;  5CVI A;  1YS7 A;  3U1D A;  1L3L A;  4U0V A;  3V8J A;  4HOB A;  2ZCW A;  3EYI A;  2OZ6 A;  2W84 A;  1OR7 A;  2O0Y A;  1FNN A;  1MDM A;  1P4X A;  5KK1 A;  1KU3 A;  1D5V A;  2F5D A;  3ML6 A;  1TTY A;  3ZMS A;  4MEX F;  1SAX A;  2DAO A;  4ZZD A;  4A5M A;  1FYL A;  3FXQ A;  1K7A A;  2FA5 A;  1FC3 A;  2HWV A;  2M1B A;  3LA7 A;  3IKV A;  4N9I A;  4AIK A;  3C7J A;  1R5G A;  1SFU A;  3NRV A;  3TO6 A;  3FF5 A;  5E17 F;  2NS0 A;  4CZZ A;  3F8N A;  5BQT A;  4A6D A;  1F1Z A;  3GXO A;  3M8F A;  2A69 F;  1HW5 A;  4RB3 C;  1FYM A;  2QZ8 A;  1JE8 A;  2KJC A;  5FFZ A;  3E6B A;  3OOP A;  2XUB A;  3P9I A;  3F6O A;  3SZP A;  1IUY A;  5HS8 A;  2V9V A;  5LHG A;  3PQK A;  3QP5 A;  3HUG A;  4PGG A;  5D8K B;  5D6F A;  4LJZ F;  2V1X A;  3S2W A;  3HSR A;  4DNC A;  4LK1 F;  4U0W A;  2MA3 A;  2P8T A;  3MZH A;  4L9N A;  1GXQ A;  2IVM A;  2QQ9 A;  5JR3 A;  4YFK F;  1FSE A;  2CWE A;  2AXL A;  2HZT A;  4R8H A;  3L2C A;  1KU7 A;  1IXS B;  1O3S A;  1YW8 A;  1R5H A;  1FP2 A;  3E3V A;  5CYV A;  3GFJ A;  4ETS A;  1YIO A;  3JTG A;  2IT0 A;  3Q9S A;  2GIV A;  2VBX A;  4MNU A;  3DKW A;  3LFK A;  1U5T C;  3K1M A;  1XCB A;  1ZHF A;  4MQ9 F;  1UHM A;  1G4D A;  1I1S A;  1SMY F;  2GQQ A;  1S7O A;  2L54 A;  3E6M A;  4IRH A;  2XAQ A;  3IWZ A;  4R1H A;  3WTY C;  1PP7 U;  2QBY B;  3QAH A;  1OYI A;  2P7C B;  2A5Y B;  3FM5 A;  4CXF A;  2HDC A;  5K5O A;  2LF8 A;  1QNT A;  5JI6 A;  2QVO A;  5E1X A;  4GGG A;  2D1H A;  2JPC A;  4L9V A;  4HX8 A;  2XKO A;  2VXZ A;  2KIU A;  3QU6 A;  4WF2 A;  1S7A A;  4G94 A;  4HLX A;  1K78 B;  4L0Z B;  5H6R A;  1J9I A;  4YII A;  5FLX Z;  1RIO H;  3TOB A;  2DK8 A;  3QPT A;  3EUH A;  5JVT A;  2V79 A;  4I7H A;  2PMH A;  3ZMU A;  4HQM A;  3HTS B;  1REP C;  3K1P A;  4OMY A;  3TQN A;  5BS6 A;  3EET A;  3VOD A;  1FZP B;  4MQV A;  5DCM B;  3DPT A;  1BN5 A;  1U8R A;  1ZGJ A;  2VOD A;  3JSP A;  5HDK A;  1FOK A;  4GYI A;  2Z33 A;  4OMZ A;  4R79 A;  1IN6 A;  1YQA A;  2DO7 A;  4S04 A;  1DP7 P;  3I54 A;  4M74 A;  2CSO A;  3SQN A;  4HW0 A;  3KCC A;  3K0L A;  4A0X A;  3F23 A;  3KP3 A;  3RTR A;  2M5W A;  1HBX G;  5DEQ A;  2MLK A;  1T38 A;  1WWX A;  3HOT A;  1B9M A;  1F4K A;  2HTJ A;  2O8X A;  1XCV A;  2Y0M A;  3IL2 A;  1W4M A;  3CLO A;  1YLF A;  4RGS A;  2QM3 A;  1BBY A;  4UXN A;  3I71 A;  2NNN A;  2VT2 A;  4HDU A;  2O61 A;  2H09 A;  1XSD A;  6PAX A;  2GZW A;  1PP8 F;  2QQA A;  4RS8 A;  2V1U A;  3ROU A;  2VBZ A;  2RVC A;  3LAJ A;  3IRR A;  2RN7 A;  4A2U A;  3FXR A;  1PUE E;  1MKM A;  5D8L B;  4UNO A;  4ON0 A;  1D8K A;  5A2Q K;  3I58 A;  3KFW X;  4EGY A;  4KIF A;  4LFU A;  3BZ6 A;  2A6E F;  5DCF A; 
#chains in the Genus database with same CATH topology
 1FMV A;  2OA4 A;  1OIS A;  2OAZ A;  1MH3 A;  1K79 A;  2ZSI B;  1EH6 A;  5ILS A;  4XQF A;  4EV0 A;  3UR3 C;  1IV8 A;  1X4O A;  1SMT A;  2W1O A;  1IN4 A;  3IHU A;  3CUQ A;  4LK0 F;  3RYR A;  2QLZ A;  1T8I A;  1MSE C;  3NWS A;  3DU5 A;  4C30 A;  1TNS A;  4ZDO A;  3NAU A;  1RET A;  2A6H F;  2ELK A;  4UVA A;  1Z91 A;  4LIV A;  2KIQ A;  1KQ0 A;  3BTC A;  4NUB A;  4B43 A;  3FKI J;  3HOX J;  4A3I J;  2UXN A;  1LEA A;  1YX3 A;  5EEA A;  4AM3 A;  1OKR A;  2LRD A;  3CP2 A;  5IP6 A;  4E7H A;  3JRG A;  1ZGA A;  3QRF F;  4M3B A;  1U9N A;  1Z05 A;  2OUM A;  4RGR A;  1VQL I;  4QPQ A;  2EIL H;  3C2B A;  4JQF A;  2R92 J;  5DV5 A;  3ESW B;  3I4P A;  2O6G E;  3I53 A;  1YS6 A;  4HZF A;  1EF4 A;  2E71 A;  2DFI A;  2K4J A;  1XMK A;  1VQ8 I;  3GZ5 A;  4Z6Y A;  3R0J A;  4BAC A;  3PO2 J;  4QTR A;  1Y1W J;  4A3G J;  1G3T A;  2PX9 A;  2CU7 A;  4U87 A;  2GAU A;  2PEX A;  1IF1 A;  3S14 J;  1S72 I;  3H9J A;  2WAE A;  3KP6 A;  1SD6 A;  1ON1 A;  4IQ4 A;  1HST A;  3KEY A;  2NYX A;  3MKY B;  3CQZ J;  3BY6 A;  2LD5 A;  1ZAR A;  4LG3 A;  1OJL A;  3H5R A;  4IRI A;  3K69 A;  1MSF C;  4WCG A;  2CJJ A;  1IXC A;  5FRO A;  5AIQ A;  2VJ4 A;  3FXU A;  4EAT A;  1OCT C;  4UUS B;  2VKH A;  3VPR A;  3VYR B;  4HA8 A;  2H94 A;  1G3S A;  1O3T A;  3J81 K;  3ZQC A;  1A5J A;  3CO6 C;  2ZME C;  3OYB A;  4IJA A;  1IN5 A;  4O5V A;  4ZZL A;  5E18 F;  1XD7 A;  3I55 I;  2FBI A;  2ZJ2 A;  3F72 A;  1A31 A;  1BC7 C;  3WOD F;  2HXI A;  1P4A A;  2XAH A;  4HEA 2;  4BL0 B;  3FK6 A;  3RKW A;  2HYG D;  2L7K A;  2HI3 A;  4NBQ A;  1ZQ3 P;  2VON A;  2R7T A;  3ZQF A;  1KYW A;  1WJ5 A;  2BY2 A;  4RB0 A;  3J80 K;  3ZQL A;  4LOC A;  2DBB A;  5KAF C;  3DLA A;  2R4G A;  3X2Q H;  3L7W A;  2FF4 A;  1R1U A;  2VE8 A;  3K4C A;  1O3Q A;  1ONV A;  1BI2 A;  3S17 J;  2DMP A;  5ERI A;  1XGS A;  2R93 J;  5F64 A;  4XR6 A;  1FBU A;  2HYF A;  4RB1 A;  2CG4 A;  4I0B A;  4CCM A;  2Z9O A;  2R7X A;  4KMF A;  3JAM K;  3OMY A;  1OCR H;  4BXF A;  4II2 A;  2KT0 A;  4XBF A;  4PK4 A;  1SC7 A;  2V9P A;  4HBL A;  2KIS A;  3TO7 A;  1RR8 C;  4W97 A;  3S3M A;  4A93 J;  2ZNZ A;  2IGN A;  2R5Z B;  3PM1 A;  3HBL A;  2RC4 A;  1I50 J;  3JRE A;  2KDO A;  1SD7 A;  2A68 F;  3VFZ A;  2DQL A;  2DT7 B;  3CCY A;  1FBQ A;  5IYD J;  4XRF A;  5M5Y J;  1N25 A;  4M72 A;  5LFA A;  3TP3 A;  3RSN A;  3GFI A;  1WZ2 A;  3MZY A;  4UHT A;  1LVA A;  5DDG A;  1LKX A;  4MLO A;  2ZXW H;  3DTE A;  1MZB A;  3QYE A;  4KYW A;  5EYR A;  1GXP A;  3GFM A;  1X3U A;  4UY8 I;  1RRJ A;  3M9A A;  3N97 A;  5ICE A;  2FML A;  3DP7 A;  4F92 B;  3WU1 B;  4FAS D;  3RI4 A;  2M0M A;  2NRA C;  1BR2 A;  5K7H A;  1X1P A;  3LQR A;  3CME I;  1SFK A;  3S2H J;  2E5Z A;  4BE2 A;  2COM A;  3BG5 A;  2HPM A;  1B8I B;  2NVT J;  2GXG A;  2K27 A;  3HHH A;  1JUS A;  4UVC A;  1TT0 A;  3WTT C;  3P5J A;  3OSF A;  2ZSH B;  3S93 A;  5J4Y A;  2DJI A;  3FXL A;  1B72 B;  2EV6 A;  2HS5 A;  3L09 A;  2VJ5 A;  3G4S I;  3Q5F A;  2EV0 A;  1I27 A;  2XAF A;  4HNV A;  4HQE A;  4P9F A;  3E97 A;  3RJP A;  1K6O A;  1JGS A;  1OMI A;  1W7P A;  4PDK A;  4EM2 A;  1OFC X;  1LPQ A;  1LFB A;  2JPB A;  4HDV A;  1JXS A;  3F8M A;  3V4G A;  5GAD J;  2YU9 J;  4Y7N J;  4Y33 A;  3HKZ N;  4GFB A;  1APL C;  2E2I J;  1ZLK A;  3IC7 A;  2XPW A;  3S1R J;  4M6Y A;  2OD5 A;  4AYB A;  1HCR A;  3BP8 A;  4FX4 A;  1ETW A;  3CCE I;  2M30 A;  1HQC A;  4Q47 A;  2DA5 A;  5FRM A;  2QGU A;  4QWQ A;  2ZJQ F;  1NK3 P;  3OIQ A;  2GXB A;  4YRV A;  4B09 A;  1Y1V J;  2X4H A;  4I09 A;  3S32 A;  2VBY A;  2MH2 A;  2LY9 A;  3F8B A;  4NC7 A;  3MCZ A;  1QRY A;  3LA3 A;  2EFW A;  3W3C A;  3CCL I;  1BA5 A;  3KYD B;  2H6C A;  2JVG A;  3HPH A;  2KRH A;  3F3X A;  2R7W A;  1NG7 A;  4ZYD A;  4UUT A;  3M4O J;  3G6E I;  1T33 A;  3FZV A;  1LB2 A;  3R4K A;  5C44 J;  2KFD A;  4RB2 C;  3MKW B;  2OZU A;  4LG0 A;  4JX5 A;  5ILV A;  1P9Q C;  2XSJ C;  4A3L J;  3F0C A;  3BG3 A;  1R4N B;  2K5C A;  5LBQ A;  2EZI A;  2WAF A;  2VJJ A;  3M07 A;  3MAJ A;  2E1M C;  2JZY A;  2Q8K A;  2HKO A;  5LLQ A;  1R00 A;  2FE3 A;  3RYP A;  3H3U A;  1R5I D;  3E1S A;  2W00 A;  4YIF A;  2C6Y A;  1BJA A;  4RAY A;  1AWC A;  3BJA A;  1MBF A;  1TW2 A;  4FQG A;  4GDF A;  5L3F A;  3GLL A;  5J47 A;  2EZH A;  1QZZ A;  2QA4 I;  2Z99 A;  3V7S A;  2WTE A;  2NS8 A;  3SZT A;  3IH3 A;  2BV6 A;  3BTJ A;  4JK1 X;  1D8J A;  5DM7 F;  3BR2 A;  2HVQ A;  2R7R A;  3RPU D;  3CMY A;  2V1N A;  4ZYG A;  3HOU J;  2H6B A;  3J7A Y;  1T0F A;  3BOQ A;  2JA2 A;  3BTL A;  3EDP A;  3WU0 A;  2NNY A;  3PNV A;  2K9L A;  1K6Y A;  4IOC F;  1BC8 C;  3ECH A;  3RKY A;  1HW1 A;  3C1D A;  3CMM A;  3FXK A;  4LIU A;  3BZK A;  4WK8 F;  4XIC A;  1JJ8 C;  2EFO A;  5LEK A;  3ERE D;  2WA0 A;  1QGP A;  5J1U A;  1B4A A;  3NWT A;  2MW8 A;  3RPQ A;  5DCM A;  2L5Q A;  2UWM A;  2XF7 A;  2RDP A;  2L4A A;  4IHV A;  2FNP A;  1A6Q A;  2M87 A;  3K9T A;  2BHZ A;  1OYW A;  2AHQ A;  3ABK H;  2LKS A;  2I5U A;  2JWT A;  1ZRD A;  2RNG A;  1XGN A;  3KX2 A;  2DYS H;  3B6A A;  5L3B A;  3HRU A;  4CCN A;  5CLS A;  1G3Y A;  1MW7 A;  4GXO A;  1BL0 A;  5KVR A;  2PJR B;  2KZV A;  5J1R A;  2OU2 A;  5M5W J;  1R58 A;  2ESN A;  3KLN A;  4L0Y B;  3PIP F;  1TQP A;  3S15 J;  2MD0 A;  5J8C A;  3CMA I;  1YJW I;  5CQG A;  3T8R A;  1MD0 A;  3BCB A;  4BE0 A;  3HSF A;  2LR8 A;  3F21 A;  2OQR A;  2F5E A;  2J5P A;  3WTW C;  5BPD A;  3SYT A;  1X4P A;  3CC2 I;  5LRR A;  1X3W B;  2LRE A;  2OC6 A;  4ZYH A;  1R4M B;  1G8X A;  1X1B A;  3R60 A;  5JFR A;  4PJL A;  2CQK A;  3HB9 A;  1QHH D;  4KN7 X;  4KMU X;  2O9L A;  2MC3 A;  1IAW A;  2X1C A;  2DA1 A;  4EQQ A;  4OIP F;  3VEP A;  2V9K A;  4L18 B;  3ASO H;  3LOC A;  4LMY A;  1XDU A;  1WVR A;  3FWE A;  4E70 A;  2GM4 A;  5J4V A;  2H1L A;  3CF5 F;  2O7O A;  3G1O A;  3LSM A;  5FKN A;  3WHC A;  2FQ3 A;  3J81 Z;  1P92 A;  3ZMZ A;  1MNM C;  3W2W A;  3HL2 A;  1ZYR F;  2M2E A;  1EH7 A;  1E3O C;  4HV6 A;  4XLE A;  4BBR J;  3WE3 A;  3KET A;  2I8D A;  2XHK A;  5M3M J;  4EM1 A;  4MTD A;  3FKJ A;  3HDD A;  1IRF A;  2GBY A;  4A3K J;  1VQ4 I;  3WTU C;  2M3A A;  3TO9 A;  1UCR A;  1V4R A;  1MMG A;  1QZE A;  3M1E A;  4OU0 A;  1HKT A;  2Z3Y A;  2XIG A;  4OAZ A;  1FWZ A;  4CZC A;  2X6O A;  2DA2 A;  2G9W A;  3MFK A;  5CJ9 A;  4F3Q A;  2MLG A;  5C3E J;  2LF7 A;  1YFH A;  1WJF A;  5EEG A;  4N9H A;  1CGP A;  2FRH A;  2HQN A;  4C2T A;  2DA4 A;  2Y48 A;  3A01 A;  1SD5 A;  2D5V A;  1F43 A;  3O8G A;  1EJ9 A;  3F22 A;  3S1Q J;  1PUF B;  3KZY A;  3I3L A;  4BQQ A;  4IPA A;  5K7F A;  3T5X A;  4ZYA A;  4P96 A;  3T8T A;  5J40 A;  2VKV A;  1WFX A;  3ABL H;  4RGX A;  2UUZ A;  4G6Q A;  3K4J A;  4BY1 J;  2OQG A;  2JA7 J;  3CDL A;  2ZME B;  1H88 C;  3TW7 A;  1WJA A;  3S3N A;  1WKM A;  4A12 A;  1UST A;  3IV5 A;  1BOB A;  1QQI A;  3WE2 A;  2L9S A;  1WQ2 A;  4CUG A;  1YTY A;  4U88 A;  2ZNY A;  3OV8 A;  1IGN A;  3MD2 A;  3VSK A;  3OYJ A;  2NVQ J;  1V5F A;  3LSI A;  2HOA A;  2DMN A;  1VND A;  4QIW N;  1YW7 A;  4NB5 A;  4IHY A;  1BI0 A;  1P7J A;  2L02 A;  3TMO A;  5D4S A;  3ZQG A;  3OYC A;  3R0A A;  5IYC J;  3BDD A;  4A0Z A;  2PMZ A;  1YIT I;  3M7G A;  1A36 A;  1KYZ A;  3DLL F;  2DLL A;  4XN3 A;  4GCV A;  2KL4 A;  1H89 C;  3CCM I;  1R1T A;  4PJN A;  1SD4 A;  2CW8 A;  4HNT A;  2HTS A;  1GHC A;  5EG0 B;  4ENJ A;  3DQV C;  2EIM H;  3FHZ A;  4YEL A;  3FIW A;  2JA5 J;  4L5J A;  5M5X J;  1T6S A;  4KN4 X;  5L3D A;  3LFU A;  4AC0 A;  5E3N A;  4BQA A;  2O5R A;  4QPO A;  2EZL A;  1U9O A;  4Y4R A;  4CO8 A;  3O8H A;  5DD8 A;  1B59 A;  2IEK A;  3NEU A;  3ONQ A;  2Z5U A;  2P7V B;  2PQ8 A;  2LC2 A;  4GRI A;  3HRM A;  5H6Q A;  2WAQ A;  2ID3 A;  5F0H A;  4C3I J;  2F2E A;  1YJN I;  4D5F A;  1MDM B;  2KKO A;  2VQL A;  5D5U B;  4PFP A;  5TRD A;  3HYI A;  1ETQ A;  1BW5 A;  1I3Q J;  2XRO A;  2VBW A;  5HNF A;  2R3S A;  2R7Q A;  3UNG C;  1XGM A;  1FIA A;  1MMN A;  4I2O A;  1BIA A;  5JLW A;  4CH7 A;  2ACJ A;  4A6E A;  1C0W A;  2MGQ A;  2QSG X;  4HX4 A;  5EDN A;  2QEN A;  1Z3X A;  1I1G A;  4A3B J;  2LK2 A;  1TNT A;  5FB2 A;  3G73 A;  4UUS A;  1IRG A;  3QYB A;  4ENM A;  1KU2 A;  3OL3 A;  5TIS C;  2DW4 A;  2E5N A;  1TWA J;  1O7L A;  4HSR A;  2YX7 A;  1J5Y A;  5KNL A;  3BR1 A;  3RCO A;  4X0G A;  1QZY A;  2I10 A;  3BJO A;  1DDN A;  1R36 A;  1TT5 B;  1IV6 A;  1G2H A;  2P4W A;  4XKC A;  4D7N A;  2L7M P;  1UHW A;  3OR1 C;  1U0J A;  4E7J A;  1IG7 A;  4X6A J;  4KT5 C;  2EV5 A;  3LQQ A;  1Z7L A;  4EMS A;  1DUX C;  2FEZ A;  5HS9 A;  1S7E A;  4DYQ A;  4IX7 A;  4RM3 A;  3DTK A;  5HNH A;  2EK5 A;  3WTZ A;  4WWC A;  1XN7 A;  4DYR A;  3ASN H;  1RNL A;  2VAS A;  2CGP A;  1YIJ I;  3FBN B;  3R6S A;  4K2E A;  4ASN A;  2V6E A;  3ABU A;  4PGH A;  3QU3 A;  3TKY A;  3PIO F;  4ESJ A;  5K5R A;  1RUO A;  3LSP A;  1E3P A;  3R61 A;  4QLC U;  2NOG A;  2VKD A;  1GV5 A;  2QUF A;  2MYS A;  4XMY A;  4F52 A;  3D5S C;  3SDB A;  3KZZ A;  5DTD A;  1P6R A;  4XK4 A;  4E6K G;  2M4K A;  4CIC A;  1ETO A;  3SHF A;  3W6V A;  4XRS A;  3OYN A;  4XKW A;  3ERM A;  4CSW A;  3KP4 A;  4XLP F;  3OS0 A;  1ZG5 A;  5HOD A;  3ZGK A;  2CV2 A;  3BR6 A;  2F5V A;  2A07 F;  2GLO A;  4O6J A;  1T98 A;  1Z3Y A;  2Y0S A;  3L1P A;  2GOM A;  4XSX F;  3RIR A;  4RDU A;  1IDY A;  3OWT A;  2ZJR F;  4ZDL A;  3GCM A;  4P55 A;  2E1M B;  3HGG A;  2PLY A;  1Q1H A;  1HXD A;  2F5C A;  2A61 A;  1RKW A;  4E4H A;  4D0P A;  2CRG A;  5LEJ A;  5CVJ A;  3O6B B;  3OYM A;  5BMZ A;  2EA2 A;  3BR0 A;  3CD6 I;  1Z7U A;  3FX3 A;  2HZD A;  3DPL C;  1HW2 A;  1BI3 A;  1T08 B;  2DMQ A;  1B8I A;  2YPR A;  2D2W A;  1Y39 A;  4DBQ A;  4LLN A;  2YX4 A;  2KP6 A;  4MFE A;  3VB2 A;  2RRE A;  4M73 A;  3WGG A;  5LRS A;  1IN8 A;  1A04 A;  2WB1 N;  4FET A;  5IYB J;  2QEX I;  5E3O A;  1B72 A;  1PDN C;  4GO1 A;  3CJR B;  2G7U A;  5FO5 A;  4F7Z A;  3H9Q A;  4UV9 A;  2E1N A;  5FD5 A;  4F55 A;  3KP7 A;  1S29 A;  2VE9 A;  1RUN A;  3BLY A;  3I4N J;  4L5I A;  1OCP A;  2P6S A;  2AO9 A;  4CYD A;  1UFM A;  2B7E A;  4DIQ A;  1W5T A;  2PN6 A;  4PSW A;  2TCT A;  3I56 I;  1F36 A;  2FQ4 A;  2RQP A;  4I98 B;  1BI1 A;  2VC1 A;  2XPU A;  1MMD A;  1GUU A;  1QVU A;  2LBF B;  4ZJZ A;  1JGG A;  4BHC A;  2X48 A;  3LWF A;  3WGH A;  4PUS A;  2LKP A;  1J0R A;  1FEX A;  4BY7 J;  5EEH A;  4KUM A;  3L2U A;  3DPU A;  2CMP A;  2K4B A;  3OYF A;  1X2N A;  1CQT A;  2E36 A;  3TW6 A;  3EYY A;  2LTP A;  2IA1 A;  3VSL A;  3PQJ A;  5FKK A;  1XSX A;  1BJZ A;  1IC8 A;  3KEO A;  4RGU A;  4P9U A;  2IXS A;  3VDX A;  5IP7 J;  4V2G A;  2LOO A;  1RKT A;  2JQ7 A;  1WI9 A;  4BYY A;  1IZ1 A;  2WWY A;  2VJI A;  2R0Q C;  4BAY A;  2JUC A;  1FPQ A;  1RPW A;  1MJ9 A;  3E6D A;  3V7R A;  5IPA A;  2NVU B;  5E1Z B;  5LHI A;  2HOS A;  2YS9 A;  4ENN A;  3I59 B;  3AL0 C;  4AIH A;  1ZH5 A;  2E1C A;  2EIN H;  4PZJ A;  4CYC A;  3EUK L;  1LFU P;  3ULQ B;  2Z1D A;  1SVM A;  4XM3 A;  1PVE A;  3SXY A;  1TQI A;  3HOS A;  1Z67 A;  4G12 A;  3U9G A;  1WRJ A;  4MFD A;  4Y17 A;  4AVP A;  3GVA A;  1JKP C;  1F5T A;  5LHH A;  2CQQ A;  2LKX A;  4BHB A;  2RGV A;  4U7D A;  5D5X B;  3K4M A;  4IF4 A;  5FKL A;  3ABM H;  3JRD A;  2BXZ A;  3T1B A;  2ME6 A;  3I5U A;  3W6J B;  5F1J A;  3C3W A;  2P6T A;  5KAI C;  2WC2 A;  4MHG A;  1WJE A;  3KE2 A;  3TDU C;  3ZRG A;  3DEU A;  5FLV A;  2PFB A;  4G9Y A;  3A2K A;  1ETX A;  4JOM A;  1ZR4 A;  5F0C A;  4BXU A;  2XAS A;  1QVT A;  5D5V B;  1KU9 A;  3L2W A;  2KLO A;  1LQ1 A;  3KLO A;  1R9T J;  3L2Q A;  1NTC A;  2E7X A;  2YSR A;  1UHS A;  4IZZ A;  5D4R A;  3FMQ A;  3HXL A;  2ZO4 A;  2LMD A;  4FT8 A;  3GZ6 A;  2L2O A;  1DU0 A;  2AXT C;  2DYR H;  1W0U A;  3LSJ A;  1FX7 A;  4CCJ A;  2GIZ A;  2MAB A;  1LE8 B;  1LEB A;  1EH8 A;  3ZOB A;  1YHQ I;  1H9G A;  1U5T B;  2QCO A;  1JTX A;  2JT1 A;  2E7W A;  2VIX A;  1SFX A;  3PSI A;  3WTV C;  4UUV A;  1WSU A;  1ZRF A;  2DA7 A;  1LDD A;  2VQC A;  5J1Y A;  1R1V A;  3K4B A;  2ADU A;  3FK7 A;  5F6F A;  1I5Z A;  2W57 A;  2XAJ A;  4AD9 A;  5GAG J;  1JUP A;  5F1R A;  5GAH J;  4J00 A;  3J7A O;  2VPL A;  1G3W A;  2FNA A;  1G6N A;  4C9Y A;  4ZC3 A;  2CYY A;  1USS A;  3MMY B;  3GTM J;  1LDJ A;  4OIR F;  3ZR8 X;  3DEW A;  4DZJ A;  2DPU A;  4LLG F;  3GTQ J;  2DTR A;  4XNF A;  4B4C A;  2BW3 A;  3LSK A;  3REO A;  4E7L A;  1ZN2 A;  4FCY A;  4KIT B;  2EA4 A;  2Q1Z B;  3KYL A;  1OR7 C;  2XVC A;  2HNH A;  1E3H A;  2L0K A;  1D0X A;  2KIM A;  3DU6 A;  3GX4 X;  2VQG A;  2LFB A;  4TV7 A;  1ITY A;  3S3O A;  3CLQ A;  3CC7 I;  3E5Q A;  5K1Y A;  1VZ0 A;  3BJ6 A;  5EGO B;  3AAF A;  1STZ A;  3CES A;  2IPQ X;  3SEZ A;  2EWN A;  4S0H B;  2XV4 S;  2QF7 A;  1TWG J;  4Y3O A;  2EPF A;  2PG4 A;  4I6Z A;  4N4O B;  1D0Z A;  1ZK8 A;  3TBI A;  4JX4 A;  2RKH A;  3OYE A;  2HDD A;  4HV5 A;  4YEJ A;  2NXN B;  1K4S A;  2PJP A;  3ZCO A;  3OYL A;  1KQ9 A;  3WHB A;  1MBE A;  1FSH A;  3WU2 C;  1FTZ A;  5H20 A;  4QSH A;  1MMA A;  3LL7 A;  4LLL A;  2GWR A;  5IT9 K;  2Z16 A;  1S5L C;  4BQO A;  2DOE A;  2RV8 A;  2RNJ A;  3CDH A;  2FOW A;  1B9N A;  1FYK A;  2VT3 A;  3HJE A;  1JHH A;  1TWF J;  3H92 A;  1MNE A;  2CFO A;  5HDN A;  1MIJ A;  2FOK A;  4XLA A;  2HOT A;  3GME A;  3TGN A;  4DGW B;  1O3R A;  1T2K A;  4A5N A;  1XX5 A;  2UZK A;  1H8A C;  3ZN1 A;  2VN2 A;  5CVR A;  1PUF A;  1AKH B;  2ISZ A;  2H27 A;  4FE7 A;  4HYE A;  3KYC B;  5L3E A;  3FXJ A;  4B48 A;  5DYM A;  2VPR A;  2IBD A;  4G6T B;  1MGT A;  4HX7 A;  1K83 J;  1HKQ A;  2P5V A;  2HU9 A;  2ZME A;  1B1B A;  3F8C A;  4M9X A;  2IS4 A;  3V8L A;  3QOP A;  4H0E A;  1HDP A;  2Y30 A;  2W4S A;  1D1B A;  3RZD J;  1FT9 A;  3BR3 A;  2JMW A;  4I01 A;  1UB9 A;  4KJZ A;  3ZQH A;  3PO3 J;  1O57 A;  1O7F A;  2XB5 A;  5B3S H;  3EUA A;  5E20 A;  5GTH C;  2QBY A;  3S1M J;  4LGW A;  1VI0 A;  4KIC A;  1R49 A;  3KPH A;  4YFX F;  1JUM A;  1TL8 A;  1U8B A;  2H8R A;  4ABZ A;  5E8I A;  3BWG A;  2Y9Z A;  2B0L A;  2MH9 A;  4AYB N;  1DPU A;  4EJT A;  1IUF A;  2BEO A;  2CUJ A;  3OS2 A;  1IJW C;  2X0L A;  3OIO A;  4C2M J;  4IO9 F;  2ZKZ A;  1UAA A;  3A1Y A;  3H0G J;  2LDU A;  2KQR A;  2HGC A;  2XF5 A;  3U21 A;  5AIP A;  4V19 K;  3ZP5 A;  5A2Q Z;  1WJC A;  3OS1 A;  3S2D J;  2ECC A;  2XF6 A;  2W24 A;  3BC8 A;  1K78 A;  4AID A;  2EB7 A;  2ELH A;  1U78 A;  5D6E A;  3FXO A;  2V1D A;  5GPC A;  4YIR X;  1YI2 I;  4P1W A;  2KMU A;  1J75 A;  2GOX B;  3L9F A;  1YO5 C;  3RZO J;  5E3L A;  1TQM A;  5E3M A;  4KDP A;  2J5O A;  2WY8 Q;  4YG2 F;  1Y0U A;  3QOE A;  2ISY A;  2X9D A;  1L0O C;  2EIJ H;  3K4L A;  4M71 A;  2F5F A;  4MEY F;  2WV0 A;  4G7H F;  4BUP A;  2VOP A;  2MC4 A;  3BPX A;  3HOY J;  2A5W A;  1XMX A;  3HPG A;  1YYV A;  2R7D A;  3QQA A;  2FBH A;  3WG7 H;  2M45 A;  2VQH A;  4RAG A;  2IRF G;  4IL6 C;  2DT5 A;  4BDZ A;  3Q0V A;  5B5E C;  2LNB A;  2EFN A;  4NHJ A;  2W7N A;  3IWF A;  1GVJ A;  1IRZ A;  1S8N A;  2EFQ A;  4OOI A;  3EPZ A;  3IH2 A;  1ZTR A;  4CA0 A;  3QPL A;  5FFX A;  1BOA A;  4IHT A;  3WG9 A;  4IHW A;  4KFC A;  2IAI A;  3UKG A;  3HTU A;  4IRG A;  1N78 A;  1YG2 A;  2E1O A;  3M8J A;  5L3C A;  1SFE A;  2R7O A;  4C3H J;  4J19 A;  2F6C A;  1XC5 A;  4LB6 B;  4ZDP A;  4ESB A;  1ZRC A;  3ZQ7 A;  2M7B A;  3E6C C;  2QYO A;  4BJT A;  2DJN A;  1MBK A;  1Z21 A;  3H9G A;  1ULY A;  2ME0 A;  4EM0 B;  1NHA A;  4ANJ A;  4ZYE A;  3V8K A;  3GEZ A;  1QU3 A;  2BYV E;  3B6C A;  3HZJ A;  2FD5 A;  1VQ9 I;  1Z1D A;  5CVV A;  2FJ1 A;  2MSY A;  2DCE A;  3IRQ A;  4XOP A;  1TBX A;  1ODD A;  1R23 A;  2A3S A;  2K86 A;  1V3F A;  1IRX A;  3DXJ F;  5ED4 A;  2BBY A;  2HR3 A;  2QQB A;  1X58 A;  1PYV A;  4B8X A;  1LJ9 A;  3CF2 A;  2ID6 A;  3MN2 A;  2O03 A;  3G3Z A;  1OLT A;  1W5S A;  2X85 A;  4XSZ F;  3CCU I;  3J7Y J;  3H0D A;  3FM3 A;  4B3A A;  3HOZ J;  3ZMD A;  1MBJ A;  2ETH A;  1ZRE A;  2K9Q A;  3EUH C;  3HOW J;  2VC0 A;  2HFH A;  3D0S A;  3IH4 A;  4KIG A;  1W1W E;  3FDY A;  2L4M A;  3I9V 2;  3M3Y J;  3KEQ A;  4Y13 A;  3AL0 B;  4NDL A;  3J80 Z;  3DEE A;  3KP5 A;  1HLV A;  3T0Y A;  4EJW A;  3CDI A;  2B63 J;  2KPM A;  2LLK A;  3H3Z A;  3ISP A;  5ILU A;  2N8G A;  1GDT A;  3GO5 A;  2LP0 A;  2YU3 A;  1XSV A;  1BR1 A;  1V55 H;  2CH0 A;  2E2H J;  4HG2 A;  2OCC H;  4G6D A;  3JRC A;  1LNW A;  3PSF A;  1LVK A;  3C18 A;  2ZFW A;  4EEF G;  3GF2 A;  2R5Y B;  2WV1 A;  3U1K A;  2QSF X;  1JJ6 C;  2AS5 F;  3JAM Z;  1OYY A;  1X1D A;  1VQM I;  4EJO A;  5L3G A;  1W7P B;  1ETV A;  2JRT A;  2DFH A;  3ABT A;  1SEU A;  5DD4 A;  2Q2E B;  1ZAO A;  2MD5 A;  4CDG A;  5IP9 J;  2XC7 A;  1FLI A;  3SFI A;  5ICC A;  1E17 A;  3DCF A;  3OSG A;  2M4G A;  4NQW B;  1CF7 B;  1MBG A;  2F4M B;  2HVR A;  3GUD A;  4YFN F;  2LG4 A;  2IA2 A;  1I6H J;  4UB6 C;  4XKV A;  4LD5 A;  3HSE A;  4E7K A;  1P2F A;  2EBI A;  2NS7 A;  3QPH A;  2AQE A;  2LBF A;  3K1N A;  3OOU A;  5IOZ A;  4Q5S F;  3V7C A;  4UV8 A;  2JJ7 A;  3DBH B;  4G7O F;  4DQ2 A;  4DBR A;  4EJU A;  2Y31 A;  4WXC A;  4FTH A;  3HRS A;  2JN6 A;  1R22 A;  2P0W A;  3GWZ A;  1Z6T A;  2CUZ A;  4XLC A;  3J7Z I;  1R71 A;  2HXO A;  4BHP A;  3BPV A;  3VYU B;  2DOA A;  2E35 A;  3A4C A;  3JRH A;  3OYK A;  4LG0 B;  2YUS A;  3RKX A;  4JX6 A;  3BQZ A;  2GA1 A;  3TDZ C;  1Y56 A;  2HPI A;  5J3L A;  1UZC A;  3JTH A;  4LB5 A;  5IT9 Z;  4Z2Y A;  2STW A;  4ZTF A;  5JHU A;  1ZEL A;  4Q4Z F;  2VI6 A;  5AON A;  4HAM A;  5GTI C;  1YX5 A;  3PUF A;  3D5R C;  2PMZ N;  3I59 A;  4DZP A;  4NC8 A;  1ENH A;  3FIS A;  5J8F A;  3WTX C;  2R7V A;  1HA8 A;  3CTA A;  3E5U A;  2IS2 A;  2FMY A;  5K7Z A;  2DDB A;  1RC9 A;  1JKO C;  2ELJ A;  1BIB A;  2DOD A;  4LIT A;  3P9K A;  2JTV A;  3K2A A;  1E2X A;  1S9H A;  2VL8 A;  5H2F C;  2WY7 Q;  4N0B A;  3A0B C;  2EJR A;  4FE4 A;  3CCQ I;  3COA C;  4M3G A;  2PBI A;  2OPT A;  1ZLJ A;  3EQL F;  3W6K B;  5D5W B;  3DWL E;  5ICG A;  3BG6 A;  1U6G A;  3MKZ A;  4Y52 J;  4I02 A;  5HLI A;  4KNY A;  1D0Y A;  3G2B A;  1K61 A;  3OYH A;  3MKL A;  1LDK B;  4D9J A;  2WAQ N;  5FKO A;  5LGT A;  1XGO A;  3GW2 A;  2DPD A;  1ZG3 A;  4HPQ A;  3RDI A;  1FBS A;  5J6X A;  5DUI A;  2OTL I;  2XSD C;  4FHT A;  3HC7 A;  3CUQ C;  2PI0 A;  2MBF A;  2BGC A;  4MIM A;  4BJ5 C;  2Y69 H;  4AWX B;  1TLH B;  5HS7 A;  2XGX A;  1J2X A;  2XGE A;  5K5Q A;  2BVM A;  1XDS A;  1U5T A;  3GFL A;  3OYA A;  3PNY A;  1BR4 A;  1VF9 A;  1G59 A;  2R7U A;  1D1A A;  2IA0 A;  2PMU A;  4XON A;  3SJM A;  2DU9 A;  5ICF A;  3ZXS A;  3PL8 A;  4XLH A;  2DXI A;  1W7P D;  2ESH A;  3TL4 X;  2ZBK A;  1HSJ A;  2K3P A;  2P5K A;  2DMU A;  2R5Z A;  2FXA A;  4B44 A;  1V5G A;  3RPU A;  2W48 A;  3ZN0 A;  1FOX A;  1A6I A;  4M9S A;  4BKX A;  1IW7 F;  3HUG B;  2STT A;  5HVQ C;  3DV8 A;  4HF1 A;  2CO5 A;  4MTE A;  5TGT A;  4PJ0 C;  3ZQQ A;  2DTZ A;  2QKL B;  2UV1 A;  3N4M A;  2W25 A;  1WH7 A;  2ZXH A;  3JW4 A;  5EGO A;  2K3F A;  3PUB A;  4JP0 A;  1FOY A;  4BJ6 C;  1UEL B;  3HRT A;  1GLN A;  3ZMT A;  2ECB A;  1R7J A;  1RES A;  3NAR A;  3GTL J;  3I4M J;  1FP1 D;  3P9C A;  4IXA A;  4XRM A;  3DBL B;  4Q48 A;  3JCU C;  1ORK A;  1QPM A;  1U3E M;  2X51 A;  3K10 A;  1UG0 A;  1TW3 A;  3SEQ A;  2XKP A;  3U2R A;  3JRB A;  3RQ4 A;  2X1D A;  2L3D A;  4L5E A;  3A0H C;  2EFP A;  4BDY A;  2Y0S N;  1IXR C;  4DJA A;  1UG2 A;  1DGW Y;  3WTS C;  1ON2 A;  5HLG A;  4G7Z F;  1RI7 A;  2M8G X;  4P5O A;  1OPC A;  1RR7 A;  5E8G A;  5JLX A;  2A6T A;  4HF0 A;  2L9V A;  1HDD C;  3CJN A;  3D1N I;  1J7K A;  3FMS A;  4BEH B;  4MGR A;  4KA4 A;  5EZH A;  1AKH A;  5FGM A;  2LSO A;  4RMN A;  5FD6 A;  3KP2 A;  3DFG A;  1W36 C;  3O3K A;  1KON A;  1FJL A;  2IP2 A;  2IS6 A;  1QPI A;  4F91 B;  4D5C A;  3LAP A;  3L00 A;  5CVU A;  2VXD A;  1HC8 A;  3Q3S A;  3HHG A;  3CO7 C;  4ENK A;  4A3J J;  5CKT A;  3AG4 H;  1AHD P;  1JKR C;  3PFY A;  1SFO J;  2DQR A;  4WXD A;  1OCC H;  4BNC A;  1D3Y A;  3IKT A;  3K70 C;  4KIB A;  2JRM A;  2ZXJ A;  4XL9 A;  2W85 A;  4Y15 A;  2GXA A;  1Y6I A;  2CQN A;  2Y75 A;  1S3J A;  1YJ9 I;  1J59 A;  4OAY A;  1B6A A;  4AIJ A;  2K7L A;  4F93 B;  1JHF A;  2V6C A;  4ITV A;  4W1U A;  4BQN A;  1MJA A;  3FMR A;  4V2F A;  4OIN F;  5LGU A;  3HM5 A;  3MWM A;  1T95 A;  3SZG A;  2BE5 F;  5KCM A;  1DGR M;  4XRS G;  4XOR A;  1WI3 A;  3PNT A;  2COB A;  5BOX A;  1BM9 A;  3GYH X;  2DK5 A;  1Z77 A;  3BG7 A;  1H0M A;  3BCA A;  2EQR A;  3ELK A;  5FKM A;  2M8E A;  1QBJ A;  4S05 A;  2K9M A;  4E7Z A;  2OV7 A;  1SVL A;  1RZ4 A;  1A35 A;  4A0Y A;  3OYG A;  2E2J J;  4DOZ A;  5B66 C;  1WH5 A;  1WGX A;  2CFX A;  3BQY A;  1KQ8 A;  2M7A A;  2NOJ B;  1YE9 A;  3S8P A;  3PJR A;  1AA7 A;  3H36 A;  2D45 A;  1LFP A;  2P81 A;  3WGI A;  2BY0 A;  5IT3 A;  5HOO A;  2NVY J;  2HDW A;  3V42 A;  2K02 A;  1O4X A;  2DFF A;  2FX0 A;  4IVN A;  1H9T A;  1D1C A;  3ECO A;  2EH3 A;  4RLF A;  2CW0 F;  5F27 A;  1IN7 A;  1P4W A;  2IJL A;  3F8F A;  3RQI A;  2GA2 A;  3OIP A;  4PCQ A;  2G0E A;  2IGM A;  1OCO H;  3IUO A;  4RLQ A;  2V26 A;  4MO7 A;  4OIO F;  1TWC J;  4BU2 A;  3QP6 A;  3G1L A;  4L9J A;  3MQ0 A;  4EVI A;  3C2H A;  3D5L A;  3DF8 A;  4O3M A;  1FOW A;  2TDX A;  1FTT A;  3CZ6 A;  2ZC2 A;  4CHU A;  4M9Z A;  2PJR A;  1I6X A;  2HQ5 A;  3MVP A;  2LH9 A;  2D1V A;  2TRT A;  4ESF A;  3TP0 A;  4IKF A;  2P5L C;  2FBK A;  3O2P E;  1V5E A;  4CCK A;  4A3C J;  5DUK A;  2MG4 A;  4EJV A;  3B73 A;  1YRN B;  3GTJ J;  3CCJ I;  3F9K A;  5DM6 F;  3JSO A;  2K40 A;  1IO2 A;  4ZTJ A;  2JA8 J;  3HOV J;  3OYI A;  3CCR I;  4XN0 A;  3IP4 B;  1FY7 A;  2BVL A;  3CJQ B;  4CCO A;  4RM2 A;  1J09 A;  2K85 A;  2QWW A;  1KGS A;  2JK3 A;  1S6L A;  3TOA A;  4BGD A;  2RQQ A;  4C3J J;  1KA8 A;  1F9N A;  2HQR A;  2R7F A;  3BTI A;  1R6R A;  2JVH A;  4WX9 A;  3K2Z A;  3NQO A;  1Y8R B;  3A03 A;  2CS3 A;  3M8E A;  2JUG A;  1OQY A;  3E5X A;  2FSW A;  1N77 A;  4M3D A;  1V54 H;  4HLY A;  1T0F C;  4ZH4 F;  4RAZ A;  3GTK J;  1NH3 A;  4G8X A;  2OJE D;  4U0Y A;  2QKM B;  1YW9 A;  2KJB A;  3SFZ A;  3HKZ A;  4GYG A;  1AOY A;  3H1C A;  3PFI A;  1Z6R A;  5EJC A;  3MEX A;  4FIS A;  5M3F J;  3LST A;  1U2W A;  4D1Q A;  2VLA A;  1SVO A;  3LNQ A;  5LGN A;  3K7A J;  5CPR B;  2HVS A;  4AVZ A;  2ICW G;  1VQ6 I;  3VYS B;  3CUO A;  1ZG1 A;  2CQX A;  5TJJ A;  2KRF A;  5KHD A;  9ANT A;  4BE1 A;  2XRN A;  3HIF A;  3ZPL A;  2VOO A;  2X6Y A;  4CGZ A;  4FX0 A;  2L01 A;  4HRI A;  3BRO A;  3VOE A;  4I76 A;  4XLN F;  2DA3 A;  2IW5 A;  2R5Y A;  2DI3 A;  5DS9 A;  4JBA A;  1K4T A;  2Q0O A;  5CQE A;  4I0A A;  2UXX A;  4U7B A;  5HDG A;  4M6X A;  5HLH A;  3HG9 A;  5FLX K;  1WJB A;  2F48 A;  2Q2E A;  1VQ5 I;  3ZMV A;  3P7N A;  3CP8 A;  3AKZ A;  1EV7 A;  3KIO A;  1MJB A;  2XGC A;  5E1W A;  1QO0 D;  2OBP A;  2XGD A;  3GLX A;  4NQW A;  1DPR A;  2BXY A;  2KZG A;  2NAZ A;  1CF7 A;  4KIS A;  1Q1V A;  3CUQ B;  2G7H A;  1FIP A;  3OY9 A;  4NNJ A;  1I3A A;  3I64 A;  2HOE A;  2XPV A;  3B02 A;  3OYD A;  5BPI A;  1Z9C A;  1T39 A;  1HKS A;  2OCE A;  2XAG A;  1QA6 A;  2HEO A;  3F6V A;  4XKB A;  4HF2 A;  4L9T A;  1XMA A;  2O3F A;  1GV2 A;  4UVB A;  4WXH A;  3Q9V A;  5C4J J;  1ZKG A;  3LA2 A;  2FU4 A;  5EG0 A;  1VTN C;  2YR2 A;  1XB4 A;  2HKX A;  4BH9 A;  2VUM J;  4J01 A;  2KIF A;  3I0T A;  2JSC A;  4OIQ F;  2R7Z J;  4IHS A;  3ZQI A;  2ZFU A;  1JTY A;  4EGZ A;  4XOT A;  5CVI A;  4C2U A;  1YS7 A;  1ETK A;  3U1D A;  1L3L A;  4U0V A;  4CYC B;  1JT0 A;  2FUG 2;  3V8J A;  1JKQ C;  2DT6 A;  2XAU A;  1JT6 A;  2HYJ A;  4HOB A;  2ZCW A;  3EYI A;  3H5A A;  2OZ6 A;  5LD2 C;  2W84 A;  1OR7 A;  5HLT A;  2O0Y A;  1FNN A;  1MDM A;  1P4X A;  5KK1 A;  4HST A;  1PJR A;  1UJ8 A;  2WAD A;  2X1E A;  4AUX A;  4E7S A;  4AU7 A;  1KU3 A;  1D5V A;  2F5D A;  3ML6 A;  2QSH X;  1I39 A;  2QQ8 A;  3VWB A;  2EIK H;  1GT0 C;  1TTY A;  4UB8 C;  3ZMS A;  4BS9 A;  4MEX F;  2BHY A;  3AG2 H;  1SAX A;  3N05 A;  2DAO A;  4ZZD A;  4A5M A;  1FYL A;  3FXQ A;  1K7A A;  2FA5 A;  1FC3 A;  2HWV A;  2M1B A;  3LA7 A;  2CW7 A;  5EZG A;  3IKV A;  3MZ8 A;  1MH4 A;  2BOL A;  2DA6 A;  1HOM A;  4M3F A;  4N9I A;  4AIK A;  3C7J A;  1R5G A;  2L9N A;  3DTI A;  3GTP J;  3K4K A;  1SFU A;  2Y9Y A;  3NRV A;  1X19 A;  3TO6 A;  3JR9 A;  3GZN B;  3FF5 A;  5E17 F;  2NS0 A;  5F0F A;  3DBR B;  4CZZ A;  2V7F A;  4XID A;  2VB6 A;  2M34 A;  3QYF A;  1XS9 A;  3G1M A;  3F8N A;  1XPX A;  4KT6 A;  5BQT A;  4A6D A;  2O8K A;  2F4I A;  1F1Z A;  3GXO A;  3M8F A;  4D7M A;  3TED A;  2A69 F;  1HW5 A;  4RB3 C;  2DDA A;  4JYK A;  1FYM A;  2QZ8 A;  3LSH A;  1JE8 A;  2KJC A;  2V4J C;  5FFZ A;  4A69 C;  2BW3 B;  3H5N A;  4X1E A;  3E6B A;  2JA6 J;  2AQF A;  3OOP A;  2XUB A;  3P9I A;  1ZGW A;  4BXX J;  3F6O A;  2KHM A;  3E7L A;  1SAU A;  1NG6 A;  3SZP A;  1IUY A;  3Q0U A;  5B1A H;  5HS8 A;  1XG1 A;  2V9V A;  5LHG A;  3PQK A;  4A3D J;  3QP5 A;  2CV0 A;  2K9N A;  2KRC A;  3HUG A;  4PGG A;  5D8K B;  5D6F A;  2Y2Z A;  1VQO I;  1MBH A;  4LJZ F;  2V1X A;  3KZI C;  3S2W A;  3HEF A;  3HSR A;  5GPA A;  4DNC A;  3LSR A;  4LK1 F;  4U0W A;  2MA3 A;  2P8T A;  3MZH A;  4L9N A;  1GXQ A;  2BY3 A;  2IVM A;  2QQ9 A;  5JR3 A;  4YFK F;  3GTG J;  3H35 A;  2VKE A;  2JSP A;  1FSE A;  2CWE A;  2ZJP F;  1LUJ B;  2AXL A;  2HZT A;  3VYT B;  4R8H A;  4IQJ A;  3L2C A;  1KU7 A;  1WCM J;  3S16 J;  3SDG A;  1IXS B;  1O3S A;  5JHF A;  1YW8 A;  2E19 A;  1M1E B;  1R5H A;  1KZH A;  1FP2 A;  2LY1 A;  3E3V A;  1IDZ A;  1UMQ A;  5IY5 H;  5B1B H;  2H8W A;  1X1C A;  4M6V A;  3JRF A;  5CYV A;  3GFJ A;  3K6G A;  4E7I A;  1EKE A;  4ETS A;  1YIO A;  3JTG A;  4M3E A;  3Q9S A;  2IT0 A;  2GIV A;  2VBX A;  3AFH A;  4MNU A;  3DKW A;  1ZR2 A;  2OTJ I;  3LFK A;  3Q0W A;  1U5T C;  2B9S A;  3K1M A;  1XCB A;  1ZHF A;  1XTA A;  2F4O B;  4MQ9 F;  5IOY A;  5FLM J;  5GP9 A;  1UHM A;  1G4D A;  1I1S A;  1SMY F;  3CCV I;  2NVX J;  2GQQ A;  1S7O A;  4BEH A;  3FBI B;  2L54 A;  1QHG A;  1W0T A;  4RA2 A;  1POG A;  2IS1 A;  2Z2S B;  3E6M A;  4IRH A;  4I99 C;  3E0J B;  3L2V A;  1ETY A;  2XAQ A;  3IWZ A;  4R1H A;  1N75 A;  3WTY C;  2OF7 A;  1PP7 U;  4H4K C;  2QBY B;  1TZL A;  2K9S A;  4A3F J;  4A3M J;  3QAH A;  1OYI A;  5FRN A;  1WJD A;  2P7C B;  2A5Y B;  3FM5 A;  4CXF A;  2HDC A;  5K5O A;  4PJJ A;  2LF8 A;  1QNT A;  5JI6 A;  2QVO A;  5E1X A;  3W2A A;  3G71 I;  1DQU A;  1Y8Q B;  4GGG A;  2D1H A;  2JPC A;  4L9V A;  2M9H A;  4HX8 A;  1JI8 A;  1BW6 A;  2XDV A;  4A3E J;  2XKO A;  2MFZ A;  1EA3 A;  1MND A;  4B3X A;  1WPK A;  2LY2 A;  2VXZ A;  2KIU A;  3QU6 A;  4WF2 A;  1S7A A;  2LVS A;  4G94 A;  1W36 D;  1DP3 A;  2L9R A;  4HLX A;  1K78 B;  4L0Z B;  3GTO J;  1HF0 A;  2X6W A;  3A02 A;  5H6R A;  3OR2 C;  1J9I A;  4YII A;  2RAE A;  4NC6 A;  1E0E A;  4HNU A;  3IAM 2;  5FLX Z;  1RIO H;  3TOB A;  2DK8 A;  3QPT A;  3EUH A;  3AG1 H;  4DW6 A;  5JVT A;  3K70 D;  2V79 A;  4I7H A;  2PMH A;  3ZMU A;  1VQ7 I;  1X1A A;  4HQM A;  3HTS B;  3BR5 A;  2W82 A;  3DKX A;  3AG3 H;  3K1P A;  3W2V A;  1VQP I;  1REP C;  4RBO A;  3TQN A;  4OMY A;  1TWH J;  2L7F P;  5BS6 A;  3EET A;  3CCS I;  3VOD A;  4N4N B;  4MQV A;  5DCM B;  3DPT A;  1BN5 A;  1FZP B;  1TP4 A;  1U8R A;  3CC4 I;  4OWR B;  1ZGJ A;  3RKQ A;  2VOD A;  3JSP A;  5HDK A;  1AU7 A;  1FOK A;  3QOD A;  4GYI A;  2DOF A;  4OMZ A;  2Z33 A;  4CCL A;  3QWL A;  4RAF A;  1LE8 A;  2CQ7 A;  4R79 A;  2E60 A;  1IN6 A;  1YQA A;  1X2M A;  2DO7 A;  5F04 A;  4S04 A;  1DP7 P;  3FHN A;  3I54 A;  4IHX A;  4M74 A;  2CSO A;  3OL4 A;  5F08 A;  3SQN A;  1TC3 C;  2LYC A;  3LSG A;  4HW0 A;  1VQK I;  2L7Z A;  3KCC A;  2CV1 A;  3K0L A;  1GVD A;  3BG9 A;  1VQN I;  5BNG A;  1SAN A;  4A0X A;  5EF6 A;  5FJ8 J;  3F23 A;  3KP3 A;  3RTR A;  1WHU A;  2M5W A;  4PFO A;  2CUE A;  5DEQ A;  1HBX G;  2MLK A;  1YRN A;  4BBS J;  1Z0X A;  3HGY A;  3QPS A;  1T38 A;  1WWX A;  3HOT A;  3FXM A;  3H3V K;  5JVG F;  2HQA A;  1B9M A;  4B47 A;  2BZT A;  1F4K A;  4DYC A;  2HTJ A;  2O8X A;  2R7S A;  3IAS 2;  1P7I A;  5DCF A;  1XCV A;  2ZB9 A;  4XLF A;  2XRL A;  2WBM A;  3JRI A;  2WB1 A;  1YOV B;  2Y0M A;  3IL2 A;  1W4M A;  3CLO A;  1DU6 A;  2DMT A;  2M0C A;  3CJT B;  2X6X A;  1YLF A;  4RGS A;  4B1R A;  2IGO A;  3JRA A;  1ACI A;  1VFC A;  2QM3 A;  1BBY A;  3LMM A;  4UXN A;  1W5C C;  1D5Y A;  3I71 A;  3DKY A;  2NNN A;  2VT2 A;  4HDU A;  2EZK A;  2E34 A;  2IGK A;  2O61 A;  2H09 A;  1XSD A;  6PAX A;  2GZW A;  3A01 B;  1ERD A;  3L2R A;  1X3Z B;  4IEJ A;  3BT9 A;  2ZXI A;  1PP8 F;  2QQA A;  4RS8 A;  2V1U A;  3ROU A;  3C2G A;  3BZC A;  4PSX A;  2VBZ A;  1MMS A;  2RVC A;  3LAJ A;  1T56 A;  3IRR A;  2RN7 A;  4A2U A;  3FXR A;  1PUE E;  1MKM A;  2DFE A;  5D8L B;  4UNO A;  4ON0 A;  1NK2 P;  1D8K A;  4IOA F;  5A2Q K;  5E79 C;  3S1N J;  3GBG A;  2BY1 A;  3I58 A;  3KFW X;  1Y0N A;  4EGY A;  4KIF A;  4II3 A;  2XB0 X;  4PJM A;  1FMW A;  5C4X J;  4LFU A;  3BZ6 A;  2H1K A;  2KDZ A;  5GAE J;  2A6E F;  2CUF A;  3M1C A;  2DN0 A;  2A05 A;  3K4N A;  1OCZ H; 
#chains in the Genus database with same CATH homology
 2OA4 A;  2OAZ A;  1K79 A;  1EH6 A;  5ILS A;  4EV0 A;  1SMT A;  1IN4 A;  3IHU A;  3CUQ A;  4LK0 F;  3RYR A;  2QLZ A;  1TNS A;  2A6H F;  4UVA A;  1Z91 A;  1KQ0 A;  2UXN A;  1LEA A;  1OKR A;  1ZGA A;  3QRF F;  1Z05 A;  4RGR A;  4JQF A;  5DV5 A;  3I4P A;  2O6G E;  3I53 A;  1YS6 A;  4HZF A;  2DFI A;  2K4J A;  1XMK A;  3GZ5 A;  3R0J A;  1G3T A;  2GAU A;  2PEX A;  1IF1 A;  3KP6 A;  1SD6 A;  1ON1 A;  1HST A;  2NYX A;  3BY6 A;  1ZAR A;  4IRI A;  3K69 A;  4WCG A;  1IXC A;  5AIQ A;  3FXU A;  4HA8 A;  2H94 A;  1G3S A;  1O3T A;  3J81 K;  3CO6 C;  4IJA A;  1IN5 A;  4O5V A;  4ZZL A;  5E18 F;  1XD7 A;  2FBI A;  2ZJ2 A;  3F72 A;  1BC7 C;  3WOD F;  1P4A A;  2XAH A;  3RKW A;  2HYG D;  2VON A;  1KYW A;  4RB0 A;  3J80 K;  2DBB A;  3L7W A;  2FF4 A;  1R1U A;  2VE8 A;  1O3Q A;  1ONV A;  1BI2 A;  5ERI A;  1XGS A;  5F64 A;  1FBU A;  2HYF A;  4RB1 A;  2CG4 A;  4I0B A;  2Z9O A;  4KMF A;  3JAM K;  4XBF A;  4HBL A;  3TO7 A;  2ZNZ A;  2RC4 A;  1SD7 A;  2A68 F;  3VFZ A;  2DQL A;  1FBQ A;  4XRF A;  4M72 A;  3GFI A;  3MZY A;  4UHT A;  1LVA A;  5DDG A;  1MZB A;  4KYW A;  1GXP A;  3GFM A;  1X3U A;  3M9A A;  3N97 A;  5ICE A;  2FML A;  3DP7 A;  3WU1 B;  3RI4 A;  2NRA C;  3LQR A;  2COM A;  2GXG A;  2K27 A;  3HHH A;  4UVC A;  3WTT C;  2EV6 A;  2HS5 A;  3L09 A;  3Q5F A;  2EV0 A;  1I27 A;  2XAF A;  4HQE A;  4P9F A;  3E97 A;  3RJP A;  1K6O A;  1JGS A;  1OMI A;  1W7P A;  4PDK A;  4EM2 A;  4HDV A;  2JPB A;  1JXS A;  3F8M A;  3V4G A;  1ZLK A;  3IC7 A;  4M6Y A;  2OD5 A;  3BP8 A;  4FX4 A;  2M30 A;  1HQC A;  4Q47 A;  4QWQ A;  2GXB A;  4B09 A;  2X4H A;  4I09 A;  2VBY A;  2MH2 A;  3F8B A;  3MCZ A;  3LA3 A;  2EFW A;  2H6C A;  3F3X A;  4ZYD A;  1LB2 A;  3FZV A;  3R4K A;  4RB2 C;  2OZU A;  4LG0 A;  5ILV A;  5LBQ A;  3MAJ A;  2JZY A;  2Q8K A;  2HKO A;  5LLQ A;  1R00 A;  2FE3 A;  3RYP A;  3H3U A;  4YIF A;  2C6Y A;  1BJA A;  4RAY A;  1AWC A;  3BJA A;  1TW2 A;  5L3F A;  1QZZ A;  2Z99 A;  3V7S A;  2WTE A;  3SZT A;  2BV6 A;  4JK1 X;  1D8J A;  4ZYG A;  2H6B A;  1T0F A;  3BOQ A;  3EDP A;  3WU0 A;  2NNY A;  1BC8 C;  3ECH A;  3RKY A;  1HW1 A;  3C1D A;  4WK8 F;  2EFO A;  5LEK A;  3ERE D;  1QGP A;  1B4A A;  3RPQ A;  5DCM A;  2UWM A;  2RDP A;  2L4A A;  2FNP A;  2M87 A;  3K9T A;  1OYW A;  1ZRD A;  1XGN A;  5L3B A;  3HRU A;  5CLS A;  1G3Y A;  4GXO A;  5KVR A;  2OU2 A;  1R58 A;  2ESN A;  3KLN A;  4L0Y B;  1TQP A;  5J8C A;  3T8R A;  1MD0 A;  3HSF A;  3F21 A;  2OQR A;  2F5E A;  2J5P A;  3WTW C;  5BPD A;  5LRR A;  4ZYH A;  5JFR A;  3R60 A;  2CQK A;  4KN7 X;  4KMU X;  2MC3 A;  1IAW A;  4EQQ A;  4OIP F;  3VEP A;  4L18 B;  4LMY A;  1XDU A;  3FWE A;  4E70 A;  2FQ3 A;  3J81 Z;  1P92 A;  3ZMZ A;  1ZYR F;  1EH7 A;  4HV6 A;  3KET A;  3WE3 A;  2XHK A;  4EM1 A;  4MTD A;  1IRF A;  3WTU C;  3TO9 A;  1UCR A;  1V4R A;  3M1E A;  4OU0 A;  1HKT A;  2Z3Y A;  2XIG A;  1FWZ A;  2G9W A;  3MFK A;  5CJ9 A;  2MLG A;  1YFH A;  2LF7 A;  1CGP A;  5EEG A;  4N9H A;  2FRH A;  2HQN A;  2Y48 A;  1SD5 A;  3F22 A;  3KZY A;  4IPA A;  3T5X A;  4P96 A;  3T8T A;  4RGX A;  4G6Q A;  2OQG A;  2ZME B;  1WKM A;  4A12 A;  1UST A;  1QQI A;  3WE2 A;  1WQ2 A;  1YTY A;  4U88 A;  2ZNY A;  3OV8 A;  1YW7 A;  4NB5 A;  1BI0 A;  2L02 A;  5D4S A;  3R0A A;  3BDD A;  4A0Z A;  3M7G A;  1KYZ A;  2DLL A;  4GCV A;  1R1T A;  1SD4 A;  2HTS A;  1GHC A;  4ENJ A;  3DQV C;  3FHZ A;  4L5J A;  1T6S A;  4KN4 X;  5L3D A;  4BQA A;  4CO8 A;  5DD8 A;  1B59 A;  3NEU A;  2Z5U A;  2P7V B;  2PQ8 A;  3HRM A;  5H6Q A;  2F2E A;  1MDM B;  2KKO A;  5D5U B;  5TRD A;  3HYI A;  2XRO A;  2VBW A;  2R3S A;  1XGM A;  4I2O A;  1BIA A;  2ACJ A;  4A6E A;  1C0W A;  4HX4 A;  2QEN A;  1I1G A;  1TNT A;  5FB2 A;  3G73 A;  1IRG A;  4ENM A;  1KU2 A;  2DW4 A;  1O7L A;  2YX7 A;  1J5Y A;  1QZY A;  3BJO A;  1DDN A;  1R36 A;  2P4W A;  1UHW A;  4KT5 C;  2EV5 A;  3LQQ A;  4EMS A;  1DUX C;  2FEZ A;  5HS9 A;  2EK5 A;  3WTZ A;  4WWC A;  1XN7 A;  1RNL A;  2CGP A;  3R6S A;  4K2E A;  4ASN A;  3ABU A;  4PGH A;  3QU3 A;  3TKY A;  4ESJ A;  5K5R A;  1RUO A;  3R61 A;  4QLC U;  2QUF A;  3KZZ A;  1P6R A;  4CIC A;  3SHF A;  3KP4 A;  4XLP F;  1ZG5 A;  2A07 F;  4O6J A;  1T98 A;  4XSX F;  3RIR A;  4P55 A;  2PLY A;  1Q1H A;  1HXD A;  2F5C A;  2A61 A;  5LEJ A;  4D0P A;  5CVJ A;  3O6B B;  5BMZ A;  2EA2 A;  1Z7U A;  3FX3 A;  3DPL C;  1HW2 A;  1BI3 A;  2YPR A;  2D2W A;  4LLN A;  2YX4 A;  3VB2 A;  4M73 A;  3WGG A;  5LRS A;  1IN8 A;  1A04 A;  1PDN C;  4GO1 A;  2G7U A;  5FO5 A;  4F7Z A;  4UV9 A;  2E1N A;  5FD5 A;  3KP7 A;  1S29 A;  2VE9 A;  1RUN A;  4L5I A;  2P6S A;  4CYD A;  1UFM A;  1W5T A;  2PN6 A;  2RQP A;  4I98 B;  1BI1 A;  2VC1 A;  4BHC A;  3LWF A;  3WGH A;  2LKP A;  1J0R A;  5EEH A;  4KUM A;  2K4B A;  3EYY A;  2IA1 A;  3PQJ A;  1XSX A;  3KEO A;  4RGU A;  4P9U A;  1WI9 A;  4BYY A;  1IZ1 A;  2WWY A;  4BAY A;  1FPQ A;  1MJ9 A;  3E6D A;  3V7R A;  5E1Z B;  5LHI A;  4ENN A;  3I59 B;  4AIH A;  1ZH5 A;  2E1C A;  4PZJ A;  3ULQ B;  4H0E A;  3SXY A;  3HOS A;  1TQI A;  3U9G A;  1WRJ A;  4Y17 A;  4AVP A;  3GVA A;  1F5T A;  5LHH A;  4BHB A;  2RGV A;  4U7D A;  5D5X B;  4IF4 A;  3T1B A;  3I5U A;  3W6J B;  3C3W A;  2P6T A;  2WC2 A;  4MHG A;  3KE2 A;  3TDU C;  3DEU A;  2PFB A;  4G9Y A;  4BXU A;  2XAS A;  5D5V B;  1KU9 A;  1LQ1 A;  3KLO A;  2E7X A;  2YSR A;  5D4R A;  3FMQ A;  2ZO4 A;  4FT8 A;  3GZ6 A;  1FX7 A;  1LEB A;  1EH8 A;  1H9G A;  1U5T B;  2JT1 A;  2E7W A;  1SFX A;  3WTV C;  4UUV A;  1WSU A;  1ZRF A;  1LDD A;  1R1V A;  2ADU A;  5F6F A;  1I5Z A;  2W57 A;  2XAJ A;  4AD9 A;  5F1R A;  3J7A O;  1G3W A;  2FNA A;  1G6N A;  2CYY A;  1USS A;  1LDJ A;  4OIR F;  2DPU A;  4LLG F;  2DTR A;  3REO A;  1ZN2 A;  2EA4 A;  2XVC A;  2KIM A;  3GX4 X;  4TV7 A;  3E5Q A;  5K1Y A;  3BJ6 A;  3AAF A;  1STZ A;  2IPQ X;  2EWN A;  2XV4 S;  2PG4 A;  2RKH A;  4HV5 A;  2PJP A;  1KQ9 A;  1FSH A;  5H20 A;  4LLL A;  2GWR A;  5IT9 K;  2RV8 A;  2RNJ A;  3CDH A;  1B9N A;  1FYK A;  2VT3 A;  1JHH A;  3H92 A;  5HDN A;  2FOK A;  1O3R A;  3TGN A;  1T2K A;  4A5N A;  2UZK A;  3ZN1 A;  2VN2 A;  5CVR A;  2ISZ A;  2H27 A;  4HYE A;  5L3E A;  5DYM A;  4HX7 A;  1MGT A;  1HKQ A;  2P5V A;  2ZME A;  1B1B A;  3F8C A;  4M9X A;  3V8L A;  3QOP A;  1FT9 A;  4I01 A;  1UB9 A;  1O57 A;  1O7F A;  5E20 A;  2QBY A;  4LGW A;  4KIC A;  4YFX F;  5E8I A;  3BWG A;  1DPU A;  2B0L A;  2MH9 A;  4EJT A;  2BEO A;  2X0L A;  2ZKZ A;  2LDU A;  2HGC A;  5AIP A;  3ZP5 A;  5A2Q Z;  2W24 A;  1K78 A;  2EB7 A;  2ELH A;  1U78 A;  5D6E A;  2V1D A;  1J75 A;  3L9F A;  1YO5 C;  1TQM A;  4KDP A;  2J5O A;  4YG2 F;  1Y0U A;  2ISY A;  1L0O C;  4M71 A;  2F5F A;  4MEY F;  2WV0 A;  4G7H F;  2VOP A;  3BPX A;  1YYV A;  2R7D A;  2FBH A;  2M45 A;  2IRF G;  2DT5 A;  2LNB A;  2EFN A;  4NHJ A;  3IWF A;  1GVJ A;  1S8N A;  2EFQ A;  4OOI A;  5FFX A;  1BOA A;  4IHT A;  3WG9 A;  4KFC A;  3HTU A;  4IRG A;  1YG2 A;  5L3C A;  1SFE A;  4LB6 B;  4ESB A;  1ZRC A;  3ZQ7 A;  3E6C C;  2QYO A;  1ULY A;  4EM0 B;  1NHA A;  4ZYE A;  3V8K A;  3GEZ A;  2BYV E;  1Z1D A;  5CVV A;  3IRQ A;  1TBX A;  1ODD A;  1R23 A;  2A3S A;  2K86 A;  1V3F A;  3DXJ F;  5ED4 A;  2BBY A;  2HR3 A;  2QQB A;  4B8X A;  1LJ9 A;  2O03 A;  3G3Z A;  1W5S A;  4XSZ F;  3FM3 A;  3ZMD A;  2ETH A;  1ZRE A;  2VC0 A;  2HFH A;  3D0S A;  4KIG A;  2L4M A;  3KEQ A;  4Y13 A;  3J80 Z;  3KP5 A;  3T0Y A;  4EJW A;  3ISP A;  3H3Z A;  5ILU A;  3GO5 A;  2YU3 A;  1XSV A;  4G6D A;  1LNW A;  3C18 A;  2ZFW A;  3GF2 A;  2AS5 F;  3JAM Z;  1OYY A;  4EJO A;  5L3G A;  1W7P B;  2JRT A;  3ABT A;  5DD4 A;  1ZAO A;  2MD5 A;  4CDG A;  1FLI A;  5ICC A;  1E17 A;  1CF7 B;  3GUD A;  4YFN F;  2IA2 A;  4LD5 A;  3HSE A;  1P2F A;  3QPH A;  4Q5S F;  3K1N A;  3V7C A;  4UV8 A;  4G7O F;  4DQ2 A;  4EJU A;  4WXC A;  3HRS A;  1R22 A;  3GWZ A;  1Z6T A;  4BHP A;  3BPV A;  4LG0 B;  3RKX A;  2GA1 A;  3TDZ C;  3JTH A;  4LB5 A;  5IT9 Z;  4Z2Y A;  2STW A;  5JHU A;  4Q4Z F;  5AON A;  4HAM A;  3I59 A;  5J8F A;  3WTX C;  3CTA A;  3E5U A;  2FMY A;  1BIB A;  3P9K A;  2JTV A;  1E2X A;  4N0B A;  2EJR A;  3COA C;  2PBI A;  1ZLJ A;  3EQL F;  3W6K B;  5D5W B;  5ICG A;  1U6G A;  4I02 A;  5HLI A;  4KNY A;  1LDK B;  5LGT A;  1XGO A;  3GW2 A;  2DPD A;  1ZG3 A;  3RDI A;  1FBS A;  5J6X A;  5DUI A;  4FHT A;  3CUQ C;  2PI0 A;  2MBF A;  2BGC A;  4AWX B;  1TLH B;  5HS7 A;  2XGX A;  1J2X A;  5K5Q A;  1XDS A;  1U5T A;  3GFL A;  2IA0 A;  2PMU A;  2DU9 A;  5ICF A;  1W7P D;  2ESH A;  2ZBK A;  1HSJ A;  2P5K A;  2FXA A;  3RPU A;  3ZN0 A;  4M9S A;  1IW7 F;  2STT A;  5HVQ C;  3DV8 A;  4HF1 A;  2CO5 A;  4MTE A;  3N4M A;  2W25 A;  3JW4 A;  3HRT A;  3ZMT A;  1R7J A;  1FP1 D;  3P9C A;  4IXA A;  4Q48 A;  1QPM A;  1U3E M;  1TW3 A;  2XKP A;  3U2R A;  2L3D A;  2EFP A;  1IXR C;  3WTS C;  1ON2 A;  5HLG A;  4G7Z F;  1RI7 A;  4P5O A;  1OPC A;  5E8G A;  4HF0 A;  3CJN A;  1J7K A;  3FMS A;  4KA4 A;  4MGR A;  5FGM A;  2LSO A;  5FD6 A;  3KP2 A;  3DFG A;  3O3K A;  2IP2 A;  3LAP A;  3L00 A;  5CVU A;  3HHG A;  3CO7 C;  4ENK A;  2DQR A;  4WXD A;  4BNC A;  1D3Y A;  3IKT A;  4KIB A;  2ZXJ A;  4Y15 A;  2W85 A;  2Y75 A;  1S3J A;  1J59 A;  4AIJ A;  1B6A A;  2K7L A;  1JHF A;  2V6C A;  1MJA A;  3FMR A;  4OIN F;  5LGU A;  3MWM A;  2BE5 F;  5BOX A;  1BM9 A;  3GYH X;  2DK5 A;  1H0M A;  3ELK A;  2M8E A;  1QBJ A;  4S05 A;  1RZ4 A;  4A0Y A;  2CFX A;  1KQ8 A;  2D45 A;  3WGI A;  5IT3 A;  5HOO A;  2K02 A;  4IVN A;  1H9T A;  3ECO A;  2CW0 F;  1IN7 A;  1P4W A;  2IJL A;  3F8F A;  2GA2 A;  4PCQ A;  4OIO F;  3QP6 A;  4L9J A;  3MQ0 A;  4EVI A;  3D5L A;  3DF8 A;  4O3M A;  2TDX A;  4CHU A;  4M9Z A;  1I6X A;  2D1V A;  4ESF A;  2P5L C;  2FBK A;  3O2P E;  5DUK A;  4EJV A;  3B73 A;  3JSO A;  1FY7 A;  2QWW A;  1KGS A;  3TOA A;  1S6L A;  1KA8 A;  1F9N A;  2HQR A;  2R7F A;  4WX9 A;  3K2Z A;  3NQO A;  3M8E A;  3E5X A;  2FSW A;  4HLY A;  4ZH4 F;  4RAZ A;  4G8X A;  4U0Y A;  1YW9 A;  2KJB A;  3SFZ A;  4GYG A;  1AOY A;  3PFI A;  1Z6R A;  3MEX A;  3LST A;  1U2W A;  5LGN A;  3CUO A;  1ZG1 A;  5TJJ A;  2KRF A;  2XRN A;  3HIF A;  3ZPL A;  2VOO A;  4CGZ A;  4FX0 A;  2L01 A;  3BRO A;  3VOE A;  4XLN F;  2IW5 A;  2DI3 A;  4JBA A;  2Q0O A;  4I0A A;  2UXX A;  4U7B A;  5HDG A;  4M6X A;  5HLH A;  5FLX K;  2Q2E A;  3ZMV A;  3P7N A;  1EV7 A;  1MJB A;  5E1W A;  1QO0 D;  2OBP A;  4NQW A;  3GLX A;  1DPR A;  2NAZ A;  1CF7 A;  3CUQ B;  2G7H A;  3I64 A;  2HOE A;  3B02 A;  5BPI A;  1Z9C A;  1T39 A;  1HKS A;  2HEO A;  2XAG A;  3F6V A;  4HF2 A;  4L9T A;  1XMA A;  2O3F A;  4UVB A;  4WXH A;  3Q9V A;  3LA2 A;  2FU4 A;  1VTN C;  2YR2 A;  1XB4 A;  2HKX A;  4BH9 A;  2KIF A;  3I0T A;  2JSC A;  4OIQ F;  4IHS A;  4EGZ A;  5CVI A;  1YS7 A;  3U1D A;  1L3L A;  4U0V A;  3V8J A;  4HOB A;  2ZCW A;  3EYI A;  2OZ6 A;  2W84 A;  1OR7 A;  2O0Y A;  1FNN A;  1MDM A;  1P4X A;  5KK1 A;  1KU3 A;  1D5V A;  2F5D A;  3ML6 A;  1TTY A;  3ZMS A;  4MEX F;  1SAX A;  2DAO A;  4ZZD A;  4A5M A;  1FYL A;  3FXQ A;  1K7A A;  2FA5 A;  1FC3 A;  2HWV A;  2M1B A;  3LA7 A;  3IKV A;  4N9I A;  4AIK A;  3C7J A;  1R5G A;  1SFU A;  3NRV A;  3TO6 A;  3FF5 A;  5E17 F;  2NS0 A;  4CZZ A;  3F8N A;  5BQT A;  4A6D A;  1F1Z A;  3GXO A;  3M8F A;  2A69 F;  1HW5 A;  4RB3 C;  1FYM A;  2QZ8 A;  1JE8 A;  2KJC A;  5FFZ A;  3E6B A;  3OOP A;  2XUB A;  3P9I A;  3F6O A;  3SZP A;  1IUY A;  5HS8 A;  2V9V A;  5LHG A;  3PQK A;  3QP5 A;  3HUG A;  4PGG A;  5D8K B;  5D6F A;  4LJZ F;  2V1X A;  3S2W A;  3HSR A;  4DNC A;  4LK1 F;  4U0W A;  2MA3 A;  2P8T A;  3MZH A;  4L9N A;  1GXQ A;  2IVM A;  2QQ9 A;  5JR3 A;  4YFK F;  1FSE A;  2CWE A;  2AXL A;  2HZT A;  4R8H A;  3L2C A;  1KU7 A;  1IXS B;  1O3S A;  1YW8 A;  1R5H A;  1FP2 A;  3E3V A;  5CYV A;  3GFJ A;  4ETS A;  1YIO A;  3JTG A;  2IT0 A;  3Q9S A;  2GIV A;  2VBX A;  4MNU A;  3DKW A;  3LFK A;  1U5T C;  3K1M A;  1XCB A;  1ZHF A;  4MQ9 F;  1UHM A;  1G4D A;  1I1S A;  1SMY F;  2GQQ A;  1S7O A;  2L54 A;  3E6M A;  4IRH A;  2XAQ A;  3IWZ A;  4R1H A;  3WTY C;  1PP7 U;  2QBY B;  3QAH A;  1OYI A;  2P7C B;  2A5Y B;  3FM5 A;  4CXF A;  2HDC A;  5K5O A;  2LF8 A;  1QNT A;  5JI6 A;  2QVO A;  5E1X A;  4GGG A;  2D1H A;  2JPC A;  4L9V A;  4HX8 A;  2XKO A;  2VXZ A;  2KIU A;  3QU6 A;  4WF2 A;  1S7A A;  4G94 A;  4HLX A;  1K78 B;  4L0Z B;  5H6R A;  1J9I A;  4YII A;  5FLX Z;  1RIO H;  3TOB A;  2DK8 A;  3QPT A;  3EUH A;  5JVT A;  2V79 A;  4I7H A;  2PMH A;  3ZMU A;  4HQM A;  3HTS B;  1REP C;  3K1P A;  4OMY A;  3TQN A;  5BS6 A;  3EET A;  3VOD A;  1FZP B;  4MQV A;  5DCM B;  3DPT A;  1BN5 A;  1U8R A;  1ZGJ A;  2VOD A;  3JSP A;  5HDK A;  1FOK A;  4GYI A;  2Z33 A;  4OMZ A;  4R79 A;  1IN6 A;  1YQA A;  2DO7 A;  4S04 A;  1DP7 P;  3I54 A;  4M74 A;  2CSO A;  3SQN A;  4HW0 A;  3KCC A;  3K0L A;  4A0X A;  3F23 A;  3KP3 A;  3RTR A;  2M5W A;  1HBX G;  5DEQ A;  2MLK A;  1T38 A;  1WWX A;  3HOT A;  1B9M A;  1F4K A;  2HTJ A;  2O8X A;  1XCV A;  2Y0M A;  3IL2 A;  1W4M A;  3CLO A;  1YLF A;  4RGS A;  2QM3 A;  1BBY A;  4UXN A;  3I71 A;  2NNN A;  2VT2 A;  4HDU A;  2O61 A;  2H09 A;  1XSD A;  6PAX A;  2GZW A;  1PP8 F;  2QQA A;  4RS8 A;  2V1U A;  3ROU A;  2VBZ A;  2RVC A;  3LAJ A;  3IRR A;  2RN7 A;  4A2U A;  3FXR A;  1PUE E;  1MKM A;  5D8L B;  4UNO A;  4ON0 A;  1D8K A;  5A2Q K;  3I58 A;  3KFW X;  4EGY A;  4KIF A;  4LFU A;  3BZ6 A;  2A6E F;  5DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...