3CCSI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccsI00
1VQMI 2ZJQF 1YJNI 3CC2I 2ZJRF 1VQ9I 2QEXI 3CF5F 1VQ4I 1VQ6I 1FOWA 3CCJI 3CCVI 3CMEI 1YI2I 1YITI 2FOWA 5DM7F 1QA6A 1VQKI 3CCEI 3J7ZI 1VQLI 3CCLI 2QA4I 1YHQI 2E34A 3I56I 3CCRI 3CCMI 1VQOI 1S72I 2JQ7A 5GAEJ 2OTLI 3G4SI 3CC4I 4IOAF 2K3FA 1MMSA 3G71I 3J7YJ 1FOYA 3CMAI 3PIPF 1YJ9I 3G6EI 1VQ5I 3CJTB 2E35A 2H8WA 5GADJ 5DM6F 4UY8I 1FOXA 4IOCF 1VQ8I 2OTJI 3I55I 3CCUI 4IO9F 1YIJI 1VQNI 1HC8A 3CC7I 3PIOF 2ZJPF 3CCSI 2NXNB 3DLLF 1VQ7I 4V19K 1ACIA 5GAGJ 3CCQI 1Y39A 5GAHJ 1YJWI 2E36A 3CD6I 5JVGF 1VQPI
chains in the Genus database with same CATH superfamily
2HXIA 1IRZA 2QM3A 5E1WA 2ZJQF 1OYYA 5D8LB 2ZMEC 2CW0F 2ZJRF 4WK8F 5FRMA 3GCMA 2EB7A 3FISA 2CV2A 4ZDPA 1JKPC 2DFHA 3K69A 2X6OA 2A6EF 1RUNA 2WADA 2GA1A 3I9V2 3I4MJ 2A69F 2GAUA 2V9KA 2O6GE 1BR2A 4YG2F 4NB5A 4XKCA 5LRRA 1ETVA 4HSRA 3PM1A 2KIMA 4QPOA 3FHZA 3HSFA 4UVAA 4EM2A 5FO5A 3FM3A 2DLLA 4CCMA 3H3VK 1HW2A 4A0YA 2Q0OA 5HDKA 3DEWA 5J1YA 4ENMA 3IWZA 5DTDA 2P4WA 3H36A 2DA4A 1F9NA 4CCLA 3H9GA 3TL4X 2XIGA 2V9VA 2MC3A 3K4KA 1BR4A 1I1GA 2VJ4A 4UUSA 4AU7A 4LJZF 4ESBA 1LNWA 4IPAA 4XLPF 2NVYJ 2WA0A 1X1PA 4R8HA 2XUBA 2VOPA 3GBGA 1SFEA 3RQIA 2QF7A 4D0PA 2XGDA 2XPVA 1BM9A 3CCJI 1CGPA 1NK3P 3L2RA 2E2IJ 3BG3A 1D5YA 4AWXB 1XG1A 2JSPA 1HW1A 2CGPA 3FBNB 5FKKA 1MSEC 3BROA 1W0TA 1Z7LA 2L4MA 1KU9A 4A0ZA 2XROA 2VQLA 1WJAA 2JWTA 4I01A 2HQRA 3CQZJ 1RR7A 2KISA 2DO7A 2Z2SB 3LA7A 4LB6B 1HXDA 3ABUA 2VC1A 3LL7A 2EPFA 2CQ7A 4DQ2A 1J5YA 5CVIA 1EJ9A 1XMAA 3CMYA 3IKTA 3PO2J 1ETWA 5FJ8J 1A36A 4KISA 5FFXA 3DU5A 1WI9A 5EZGA 4NC6A 2EIKH 3NARA 4P96A 2BW3A 4XL9A 2BXZA 3OMYA 1FTZA 2Y69H 1R1UA 1B59A 3CUQA 2IXSA 2H8RA 2R7TA 4IHXA 4M6VA 1YS7A 2ZBKA 3MZYA 1Y8QB 3LAPA 3QYEA 3RZDJ 2GM4A 4OIQF 2ZC2A 4G6DA 4M3GA 1I6XA 2FOWA 1HSTA 2FUG2 4CXFA 3FDYA 3OYAA 1FT9A 2WWYA 2Q2EA 3RKXA 3E5XA 1K61A 2A5WA 3K6GA 3RKYA 4RBOA 1R7JA 2FOKA 2E2HJ 3NWTA 5FLMJ 1QZEA 1MH3A 2ELHA 4L9JA 4LITA 4MO7A 4Y7NJ 2DN0A 1OCTC 1R1TA 2JA2A 4LLGF 3VSKA 2YUSA 4JBAA 1BI2A 1O4XA 3J7AY 3KEQA 3HOXJ 3OYFA 4A3DJ 3SEZA 2EFNA 5ICEA 2M8GX 4FT8A 4M9SA 2E19A 4XLCA 1S72I 3FXJA 1B9MA 1LB2A 2WAQA 3I4NJ 1DGWY 1E3PA 1VI0A 2HYGD 3ASOH 5B1BH 1WVRA 9ANTA 5FD6A 5GAHJ 3GTGJ 3HXLA 5FRNA 2IGOA 3K0LA 3ECHA 4BXUA 4I7HA 4FQGA 3CF5F 2WB1N 2R7ZJ 4I0AA 4N9IA 2DFIA 2QGUA 1IDZA 1AWCA 5H6RA 2XB0X 3IH2A 2MG4A 5DCMB 3SXYA 2XAQA 1O3TA 2R5YA 1RUOA 4ZYAA 2JT1A 1Z3YA 4CHUA 3U2RA 1K78B 2IP2A 3OYBA 5FB2A 5HDGA 2V7FA 4LFUA 3JW4A 4LK1F 1XGOA 2DMQA 3WU2C 5D5VB 3J7AO 2FQ3A 3I53A 4WXHA 5EYRA 3TGNA 4BJ5C 4L5JA 1TWFJ 2V79A 1K4SA 3FMQA 1BC8C 2V1UA 3A2KA 3AG2H 1HDPA 3UNGC 1WHUA 3R0AA 2GXAA 3SFZA 4XR6A 2HPMA 2W1OA 1SANA 3KLNA 2VN2A 3BTIA 1LDJA 2XKPA 4WXDA 3SDBA 3WGGA 2DMPA 1XDSA 1SAXA 2K86A 3EYIA 3M7GA 4FETA 3OR2C 2W7NA 3HHHA 4A3KJ 2IGKA 4UVBA 1IN6A 5DEQA 3CLOA 5TRDA 5LD2C 4F55A 3T5XA 3HEFA 1BA5A 1IAWA 2WTEA 1S7EA 2M0CA 2CUFA 2HTSA 5TGTA 1FIPA 3OOUA 4XLAA 5EG0B 2LBFA 1W5CC 4LLNA 3OIOA 4XRSG 2ZO4A 5LRSA 3MEXA 5J6XA 1Z1DA 3RCOA 1YX5A 5DYMA 1MJAA 3HIFA 3ZN1A 4B4CA 2NNNA 1GLNA 3WTTC 1QBJA 4CCJA 2JA8J 2KDZA 2DPUA 1K83J 3J7YJ 3HL2A 4J01A 3ABMH 3LFUA 2EA2A 1FLIA 4MFEA 2M4KA 3MKZA 3K70D 1R4NB 5HODA 2CRGA 5CYVA 5IOZA 3HM5A 1OCCH 2E7WA 2F5CA 3BC8A 1IXCA 3BP8A 3I64A 2LRDA 4DJAA 3HRMA 2YU3A 3Q0VA 1Z77A 2PJPA 1KYWA 1E3HA 3Q9SA 2XAJA 2L5QA 4ZYEA 1IN7A 3N4MA 3F22A 1VFCA 1O3QA 2LF8A 1H9GA 2F4OB 2XAFA 2H1LA 2DA7A 5CJ9A 4EM1A 3CC4I 2ZXHA 3JRGA 3JREA 4BBRJ 1FOYA 3CDLA 2AXTC 2KQRA 3S3NA 4CYCB 3EUHA 5E3MA 1BIAA 3ZMUA 3QU6A 2A68F 2R0QC 4A3FJ 5GPCA 2KIQA 1JXSA 2M0MA 2CMPA 2FJ1A 2LBFB 3AL0C 1J59A 1ZGWA 2OZ6A 2RVCA 4J00A 2CW8A 1P4WA 3TOBA 2Y2ZA 2F6CA 4L5IA 1F1ZA 3BT9A 2M4GA 1TW2A 4A6DA 3U21A 1G4DA 1ZLKA 1XDUA 4HZFA 2JSCA 4I98B 4XSXF 5JVTA 4GXOA 2HYFA 1AHDP 4DYCA 4UV9A 4AVZA 2R7DA 3GTQJ 2DA3A 5FKLA 3GO5A 4AD9A 3ERED 3MN2A 3JRHA 1ACIA 1U3EM 4JX5A 4ESJA 2KIUA 2R7FA 1Y39A 1KQ8A 5HS9A 4C2UA 1GV5A 3FXOA 5DV5A 5J8CA 4LB5A 3H3UA 3BR0A 4ZTFA 4UNOA 1YI2I 2NS8A 3ZR8X 3ZXSA 3DQVC 2NOJB 2H6BA 5IT9Z 1UHSA 4XORA 1MBGA 5E3LA 3KYDB 3BCBA 4ZYHA 4FX4A 1SC7A 1CF7A 5FD5A 5LHIA 5E3NA 4XNFA 2O8KA 1UFMA 3TOAA 4WX9A 2M1BA 3OYCA 5BPDA 1YG2A 3FM5A 3C2GA 1LJ9A 4DOZA 3FKJA 2KFDA 2D1HA 5DD4A 4ZZDA 2NNYA 2IGMA 3OYHA 2VXDA 3OYDA 2L7ZA 4BNCA 2JVHA 5DCMA 4BL0B 2VL8A 4I76A 4IHTA 4RB1A 1VQ6I 3WHCA 2JJ7A 2F5FA 2RREA 3S3MA 3GTMJ 3CCYA 2OCCH 5IYDJ 2ADUA 4HQEA 1OMIA 1ZQ3P 4P9FA 1I39A 3OIPA 3RYPA 3LQRA 1ETYA 1W5SA 1ENHA 3QPTA 3GFIA 3PNTA 1BN5A 3QOPA 1ZGJA 4MFDA 1V3FA 3ZQIA 4KN4X 4WWCA 5FLVA 2CS3A 4Y3OA 2R7QA 1VNDA 3CC7I 2KZGA 2K40A 5F04A 1P2FA 3FK7A 4BYYA 2P0WA 2MLKA 1S5LC 1Z9CA 4F3QA 5E17F 2Y0MA 3SEQA 4PSWA 3BY6A 5M5WJ 3C1DA 3VEPA 1U78A 4I6ZA 4DBRA 1O57A 3EDPA 3V8JA 4M9XA 2VB6A 3GEZA 1B4AA 4GFBA 2HEOA 4ZC3A 1I50J 3K4CA 3T0YA 5EG0A 2OTLI 1OYIA 4P9UA 3FX3A 2LY2A 2X6XA 3H5RA 5F1RA 3DLAA 1S7AA 3JRBA 5K7ZA 2F5EA 2R7UA 1UMQA 1Z67A 1D1BA 1SFOJ 2B7EA 3A03A 4LOCA 2NRAC 2WAQN 1LVAA 2A61A 2EV5A 2VJ5A 1YIOA 1ETKA 5ICFA 5HNHA 1J09A 2HNHA 3FK6A 4HOBA 1YOVB 4HA8A 2XF7A 2Z1DA 2DTZA 2V26A 1KU7A 3M1CA 1T6SA 5E1XA 1YW9A 4QTRA 2ID3A 1PVEA 3ZMTA 2HXOA 4PJMA 2JPCA 3ULQB 3DU6A 3MKLA 4MQVA 2EIJH 5K7FA 2RAEA 2A6HF 2PQ8A 3OOPA 5M5XJ 1SFXA 1UB9A 4C3HJ 1TC3C 2DXIA 5F08A 5LLQA 2F2EA 2E36A 3EQLF 4NNJA 1Y1WJ 1GDTA 1KU3A 1XMKA 4AC0A 1V5GA 2BOLA 4E7ZA 1H88C 1FPQA 2FBIA 3DTKA 1ZELA 2O8XA 3K4JA 3GTLJ 3LSHA 2DCEA 4N4OB 4CDGA 2H6CA 2HYJA 4BY7J 3TMOA 4P55A 3DPLC 2VE8A 2IA1A 2FRHA 2UXXA 3GFLA 4AUXA 3OYJA 5D4SA 3UKGA 4MEXF 5J1UA 1HCRA 3KETA 1ZG1A 3TBIA 2E35A 4AYBA 5CLSA 2QBYB 1FYMA 2NVTJ 2KMUA 5IP7J 3AG3H 2FMLA 3OV8A 4RLQA 3RTRA 5M3MJ 1F4KA 3WG7H 2VOOA 5CVRA 1JUMA 2ZSHB 3CC2I 2P5KA 4ON0A 2L0KA 3H9QA 2IBDA 3MVPA 2Y9ZA 3JSPA 1FP2A 3DV8A 1LQ1A 1AKHA 3MZHA 2CV1A 2HQNA 4UHTA 4RGXA 1OISA 2EILH 2QZ8A 5F6FA 4CO8A 3H5AA 1Y8RB 3PQKA 4OMZA 1GT0C 4OIOF 3HTSB 2PBIA 2CH0A 4A3IJ 3PIPF 3BCAA 3WTUC 2V1DA 5E8IA 4IXAA 1YIJI 3TO9A 4HF1A 2J5PA 1VQ7I 3HOTA 1DU0A 3JRCA 1UHWA 3GYHX 4OMYA 3U1DA 3HOSA 2MW8A 2MBFA 4HW0A 4KIBA 3WTYC 2Z33A 2Z5UA 3S93A 1VQ4I 1I6HJ 1IV6A 1FOWA 2O5RA 4S05A 3TDZC 1Q1HA 4QIWN 3BPVA 3R60A 3BJAA 4MQ9F 2E34A 1RKTA 2K27A 2UXNA 3W6JB 3WGIA 4NDLA 5F0CA 1HA8A 2KPMA 5KAFC 5LGTA 3OYGA 3RKQA 2HVQA 1MMNA 2HDCA 4EQQA 2HKXA 3L2CA 1MNDA 3O2PE 1LFBA 4HNVA 3SZTA 1MMAA 1ZLJA 2DFFA 4KT6A 4E7LA 3PL8A 4A93J 2OQGA 4W97A 5DD8A 1BW6A 1QVTA 1VQPI 1MJBA 4OU0A 3OYLA 3BG9A 3OYKA 1P92A 2LKSA 1WJDA 3W6VA 3QP6A 3BTJA 4C2MJ 3H92A 3BQYA 3SYTA 3I4PA 2AHQA 2V4JC 4XRMA 3KE2A 2X85A 2ZXWH 1U9NA 1BOAA 3VSLA 1HKQA 3E7LA 1TNSA 4QSHA 5D4RA 4MNUA 3TEDA 1C0WA 2FF4A 2OUMA 3ZOBA 2EK5A 2EV6A 2IS1A 3F0CA 1YHQI 1T0FC 3KZYA 4EJOA 4BXXJ 4GYIA 4YELA 1WGXA 5LFAA 1B72B 4JX4A 4Z6YA 4NC7A 3S1RJ 3CCLI 2MGQA 5BPIA 3DPUA 4RAZA 3VOEA 2FD5A 3S17J 3J80Z 1FYKA 2HZDA 4ITVA 3KEOA 1RETA 1YJ9I 3SHFA 4EATA 2DFEA 2JRMA 1YW8A 2M7BA 1QGPA 3DBLB 3GW2A 2ISYA 3GWZA 4D5FA 2QLZA 3T1BA 3V7SA 1A6QA 1RZ4A 4E70A 2FU4A 2QEXI 5K7HA 4IHSA 2IJLA 1REPC 1KYZA 2CQQA 2L01A 3ZMVA 2K5CA 2DU9A 3RIRA 1MIJA 1OR7A 3WTWC 1T98A 1G3WA 5L3FA 1HKSA 2M7AA 4EGYA 3GFMA 1FP1D 2E71A 4A3EJ 2XRLA 4TV7A 2XC7A 4RAYA 4CSWA 1Y0UA 2AO9A 1XGNA 1KQ9A 1FWZA 2N8GA 2Y75A 4F93B 2L9VA 5HOOA 1YITI 1VQKI 1NK2P 4LG0B 3OS0A 2M87A 2G0EA 5HLGA 1J9IA 3NWSA 1P9QC 1QHHD 1OFCX 1QHGA 2R93J 2DA2A 4YFXF 2CV0A 2VIXA 3ABKH 4FISA 4HX7A 4XQFA 2KRHA 3MQ0A 1MMDA 2KZVA 1SVMA 3D5LA 3ROUA 2FSWA 3JRDA 1F36A 3KP6A 2HQAA 4LD5A 5TISC 2GIZA 2JTVA 3V7CA 2MD5A 4XLFA 5FLXK 3BZ6A 5IYBJ 3KZZA 1R1VA 4L0ZB 3HSRA 4CZZA 4YRVA 1B72A 2KL4A 4ZYDA 3HOWJ 3IH4A 1WJCA 5JR3A 3TW6A 3TP3A 1B9NA 2UUZA 3K1PA 3WTZA 2OD5A 1LDKB 1SVLA 3RKWA 5A2QK 3I0TA 1MZBA 2DJIA 1EF4A 1WSUA 1PUFB 1DP3A 4BHPA 1PP7U 2JA5J 1RR8C 4OAZA 4A3BJ 3RJPA 2DTRA 4EV0A 2JZYA 4A6EA 1JHFA 3WU0A 2EIMH 1TLHB 2OCEA 3IH3A 4BHBA 2RGVA 2PLYA 4IQ4A 1TW3A 2HWVA 1HF0A 3PFYA 3BPXA 3KFWX 2P81A 3DEUA 3S14J 2FE3A 3CJNA 3F6VA 3IAM2 5J40A 3OYNA 3UR3C 2STWA 2A5YB 4F52A 4BAYA 4AYBN 4OWRB 4B09A 3SZGA 2DT7B 3CCSI 3KX2A 4E7SA 2VC0A 4RAGA 1W7PB 4P5OA 1ZGAA 4I99C 3LSMA 2K4JA 4KITB 1IRXA 3PNYA 2NOGA 1RESA 1FZPB 5JHFA 5C44J 4M73A 3COAC 3CCRI 5IP9J 1JKQC 1RPWA 3RSNA 1S29A 4AM3A 4AIKA 2ZNYA 3GTJJ 4K2EA 2HOTA 1ONVA 4FX0A 2OJED 5F0HA 1XPXA 4HF2A 1TWAJ 1RI7A 4B8XA 1G3TA 2DODA 3VYUB 3PO3J 4LMYA 1X2MA 4I2OA 2JQ7A 3GTKJ 5LGNA 2KRCA 5D6FA 3CUQB 4BXFA 2ECCA 2NS0A 1EH8A 1AA7A 2G9WA 2E5ZA 2JMWA 1I1SA 3H35A 1T33A 3ZMDA 2Z99A 3LSKA 4M71A 2GA2A 3HB9A 2ZXIA 2IEKA 5DCFA 2P7VB 3PUBA 5HDNA 2Y0SN 2LF7A 3HYIA 3BLYA 1IDYA 1POGA 1TQPA 5EEGA 1EH7A 5CKTA 2KJCA 1BC7C 4U88A 2K02A 5HLIA 3GZNB 3E6DA 2GLOA 4C2TA 4DGWB 1XSVA 5FROA 3SZPA 1Y0NA 2WBMA 4CCKA 3L2WA 4Y52J 3Q3SA 5ICGA 2FX0A 3I59B 3F21A 2LLKA 3WG9A 4E4HA 5BOXA 2YPRA 2PJRB 5JI6A 2DT6A 3AL0B 3H0GJ 2KP6A 3O8GA 3VDXA 1HKTA 2XASA 3HG9A 4Y13A 3OY9A 3CCUI 1I5ZA 2K7LA 4ZTJA 2OZUA 3TO7A 4D7MA 1USSA 5EGOB 1ZKGA 2DMUA 1AU7A 1WWXA 3HC7A 2DW4A 2ME6A 2X1CA 3DEEA 2L4AA 4FE4A 2HI3A 5F64A 1ZG3A 1ON1A 3LMMA 3V8LA 5CVUA 2EV0A 1ORKA 5FKNA 4L0YB 4BQNA 3GXOA 3TQNA 5J4YA 2DJNA 2RKHA 4G7ZF 3V8KA 2K3PA 3F8CA 4XN3A 3LSIA 2FA5A 4QPQA 3PFIA 3EYYA 2PN6A 4RA2A 1U9OA 2AQFA 2ICWG 3CUQC 5DUKA 4EMSA 4QLCU 4HNTA 4IHWA 4QWQA 5L3DA 3N05A 4BU2A 3IWFA 1KA8A 2VONA 1MBFA 4XOTA 1UHMA 2W00A 4EGZA 5BNGA 4XMYA 2WV1A 4GO1A 3AG4H 1QZZA 1OCZH 2D1VA 3A1YA 4M6YA 3BTLA 1UG2A 3I58A 3E3VA 1UAAA 1FY7A 1E0EA 1GHCA 3GZ5A 1IZ1A 2ID6A 2XV4S 1QPMA 1XD7A 3RI4A 3KYLA 1JGGA 1ZN2A 4DIQA 1LFPA 3M8FA 1YE9A 4X1EA 2RDPA 2W85A 4RM2A 4RGRA 2CQKA 1IW7F 4AIHA 4ZZLA 4XBFA 1TT0A 1LPQA 3MFKA 2QQBA 2DBBA 2QCOA 3LWFA 3J81Z 2VJJA 5IT9K 1G3YA 2CFXA 4IOAF 4KNYA 2X48A 5L3GA 3OL3A 1FBUA 2EZIA 3H3ZA 5E8GA 4A2UA 3BOQA 1WZ2A 1D0ZA 2RQQA 3WTXC 2BV6A 3HUGA 3G73A 1LEAA 1OCOH 1XTAA 4P1WA 2ZJPF 5J8FA 2K9SA 4XLEA 4XM3A 2B9SA 4S0HB 3GTPJ 2M8EA 1Z6RA 1SMTA 5CQEA 5E1ZB 2GIVA 3VODA 2O3FA 4EVIA 1U6GA 4NC8A 3N97A 2XSJC 2QSHX 1QO0D 3R6SA 5IY5H 4CA0A 3K7AJ 2LC2A 2RNGA 2MC4A 4KMUX 1TWCJ 3I3LA 5K5RA 1PJRA 2HTJA 1EV7A 2VBYA 1H0MA 4HYEA 4E7HA 3D0SA 4MTEA 3B02A 1SFUA 2M45A 4HAMA 4DNCA 3K1NA 2BE5F 3GMEA 3HKZN 3EUKL 3OWTA 2EZKA 2L9NA 1JE8A 2F4MB 4XKBA 3G1OA 1NH3A 1D8KA 4EJTA 1J2XA 5E18F 2OC6A 3FMRA 5LHGA 1QQIA 2GXGA 3CP8A 3DTIA 3K4NA 5B66C 4HSTA 4PDKA 1HDDC 1R5ID 3HOYJ 2DK5A 1H8AC 4ANJA 1DUXC 2ZNZA 3L9FA 4OOIA 5D6EA 1ZAOA 2L9RA 1MKMA 3W2VA 3S2DJ 2JRTA 1U2WA 3QAHA 4GCVA 2CWEA 5GAGJ 1BIBA 3F72A 3HOZJ 2R4GA 1MNEA 1VQ9I 3PQJA 1B8IA 3MAJA 1DDNA 3VPRA 2VUMJ 4PK4A 1L0OC 4A3GJ 1WH7A 3RZOJ 2PMHA 4PFOA 2ZCWA 3L1PA 2OF7A 3FHNA 1G6NA 2H27A 1V54H 4HF0A 1P4AA 3ZPLA 1TWHJ 2X1DA 3CMAI 3FXRA 5LBQA 2RNJA 1VQ5I 1R23A 3RPUD 4G6TB 2H8WA 3GUDA 3VFZA 2STTA 1FBSA 3LSPA 3KP7A 1Q1VA 4Q47A 3DLLF 4BH9A 4M3DA 2VJIA 3Q0WA 2F48A 3EUHC 3H1CA 4BEHA 2WC2A 3QP5A 1F5TA 4IRHA 1IGNA 3F3XA 2BY3A 3QQAA 4C30A 2XVCA 1T8IA 4RLFA 3TW7A 2VE9A 1G59A 4WCGA 4G8XA 1WJ5A 4RGSA 1X3UA 3FKIJ 3P9CA 1YFHA 4IOCF 3S8PA 2KKOA 1PDNC 1T95A 4CCNA 2Z9OA 2VQCA 3EPZA 2C6YA 2YX4A 4W1UA 3PUFA 3M8JA 2LH9A 4D9JA 1EH6A 3DBRB 3E0JB 5DUIA 1FMWA 2FBKA 2NS7A 2TRTA 3IKVA 3J7ZI 2WAFA 3W2AA 2JPBA 3BWGA 1BOBA 2DDAA 2XGXA 5LEJA 3GLLA 2NYXA 2G7HA 2K85A 4EM0B 4ABZA 2W84A 3KYCB 5AIQA 3BDDA 3QRFF 4O5VA 2CFOA 2VBZA 3JSOA 2VKHA 4L9VA 4OIPF 2QVOA 4HDVA 2X1EA 2ZFUA 4G6QA 1D1AA 4IJAA 3W6KB 2GZWA 1TBXA 4IEJA 4HNUA 3CD6I 1SEUA 3QU3A 2WV0A 2UZKA 2VQGA 1X1DA 1Z3XA 1X19A 2ELKA 2LK2A 1OR7C 4KIGA 3A01B 2CSOA 1MMGA 2Y30A 1T38A 3PNVA 1B6AA 5KCMA 2AS5F 1MSFC 1RKWA 4L18B 1X1AA 4ENKA 5GAEJ 1IRGA 4OINF 3BR1A 2BXYA 3AG1H 2W4SA 5J4VA 3ABTA 1IXSB 5EF6A 1WH5A 2L7FP 2L54A 1X1CA 3DCFA 5JFRA 1KQ0A 1SVOA 2EQRA 1HC8A 3PIOF 2TDXA 1JKRC 2CUJA 5ERIA 1ZREA 2MD0A 3F8FA 4HV5A 5CPRB 3J81K 2PX9A 4KFCA 5L3EA 2NAZA 3WGHA 1RC9A 1XSXA 4IKFA 1HLVA 4BGDA 1K6OA 1B8IB 4F92B 4XKVA 2E7XA 2M5WA 1WKMA 2VBXA 2X0LA 2O7OA 3SJMA 4G7OF 3G1MA 4JX6A 5E20A 3ZQHA 2Q1ZB 5M3FJ 2H09A 1ZR4A 2IT0A 4V2GA 3F6OA 4HV6A 4HX8A 1J7KA 2ETHA 1R4MB 3BTCA 4HDUA 2FXAA 2K4BA 4XRFA 5EJCA 2IA2A 1XX5A 2DYSH 3HRUA 5GPAA 3P9IA 2DAOA 1G8XA 2BY1A 3EUAA 3OL4A 3QYFA 4KJZA 2HKOA 2JUGA 2QQ9A 1KZHA 1Y56A 2Y48A 1FOXA 4U87A 3OS1A 3CZ6A 3BG5A 1IF1A 3DWLE 2XPWA 1A31A 3G1LA 2Z16A 3HOUJ 2IPQX 1STZA 2YSRA 3CMMA 3LNQA 1ZH5A 4M6XA 3Q5FA 2JA6J 3JTHA 3M3YJ 4D1QA 1VF9A 3PSFA 4BHCA 2PG4A 4M3BA 4Q4ZF 2CU7A 1WCMJ 4DZPA 1D5VA 4RM3A 3K4MA 4S04A 2M9HA 2YU9J 2LSOA 2KLOA 1I3AA 1H89C 2M3AA 1N75A 2JK3A 4B43A 4A3CJ 2V9PA 3MCZA 3F8BA 2UWMA 1R49A 2R7RA 3K70C 3V42A 3BR5A 2HU9A 2B0LA 3ONQA 1FMVA 2PEXA 2DA6A 2VBWA 1MGTA 3AAFA 4AIJA 3V4GA 1E3OC 3E1SA 1L3LA 1NG6A 2L3DA 4ZDLA 2IA0A 3GTOJ 2OAZA 4GDFA 1JTYA 3QOEA 4PJJA 3OS2A 5M5YJ 3K4LA 3W2WA 3CJQB 5GTHC 4PJ0C 4HLYA 5IYCJ 1VQ8I 2E2JJ 2DMNA 1NTCA 1VQNI 2E60A 2W24A 3RPQA 2BHZA 4NQWB 2HQ5A 2NVUB 1WRJA 4M74A 3GLXA 5FLXZ 2FMYA 2RV8A 4XLNF 4ZJZA 4BEHB 5AIPA 3CDIA 1A04A 1D0XA 3DBHB 1DP7P 4XSZF 3CMEI 5CVVA 1JI8A 2HDDA 1U5TC 3AFHA 3DXJF 1ZG5A 2ZFWA 3NAUA 3HOVJ 2IS4A 3BR6A 4DYQA 1OKRA 3J80K 3R61A 2LDUA 3BJOA 5FFZA 1USTA 4CUGA 1WFXA 2ECBA 4CZCA 2LKXA 2DMTA 4H0EA 4DZJA 1SD5A 3HRSA 2L2OA 4IQJA 1OYWA 1AOYA 2XB5A 3Q9VA 4I0BA 2DOFA 2EZHA 2R3SA 4MTDA 4YFKF 2OQRA 2HOEA 4L9NA 1Z6TA 3RDIA 3CCVI 3K2AA 1R5GA 2M30A 2FNPA 2DA1A 4LK0F 3LAJA 1PP8F 1E2XA 4MLOA 1R00A 5BS6A 5D8KB 3S15J 3HDDA 4II3A 2COBA 2BVMA 2GBYA 2IAIA 2KDOA 2XDVA 1WJEA 3OYMA 2L7MP 4BJTA 1APLC 3LFKA 1TZLA 2VLAA 2P5LC 2P6TA 2PMZN 3WTVC 1FYLA 3LSJA 4FASD 4WF2A 1W1WE 4PSXA 1VQMI 4N9HA 3JAMZ 4JK1X 4CYCA 2R7WA 3VYRB 4KT5C 2E5NA 1JKOC 1FOKA 2FNAA 4HPQA 2QA4I 3L2QA 2LYCA 2EFPA 1R22A 5ILUA 1IXRC 2L9SA 1TTYA 4YEJA 3ABLH 4XICA 4UUTA 2VPRA 4IHYA 4A69C 2E1NA 4XRSA 1XMXA 3M4OJ 2VASA 2GOXB 4JP0A 4LGWA 2QYOA 4IO9F 4Q5SF 3OSFA 1RIOH 2R5YB 4V19K 1K79A 1ZHFA 3KP3A 4PUSA 1YRNB 4HX4A 5BQTA 2QWWA 3T8TA 3L2VA 5TJJA 1ETXA 4AVPA 1NHAA 4A3MJ 3A0HC 1V55H 4BJ6C 3SQNA 3FZVA 1QPIA 3WHBA 2ZSIB 3PSIA 2HFHA 4LG3A 3CO7C 1UZCA 1O7LA 1IN8A 2EFOA 3JRIA 3IHUA 1OCPA 3TKYA 2QKMB 2V1NA 2LOOA 1YW7A 1IUYA 1W36C 2COMA 4RS8A 5D5XB 1Z05A 3RPUA 4B44A 2A3SA 2OBPA 3HUGB 2XAGA 3BZCA 2ZXJA 3QWLA 3ZQ7A 2ESNA 1X2NA 1XCVA 3D5RC 3H0DA 2EJRA 1ETOA 2EFWA 2QSFX 1Y6IA 5F27A 4D7NA 1ETQA 2HPIA 1W7PD 2A05A 3I71A 3P9KA 4II2A 2DT5A 3ASNH 5JLXA 4XONA 4UUSB 1U0JA 2YX7A 3CTAA 1X3WB 3FWEA 3P5JA 3E6CC 3A01A 3TP0A 3KIOA 4YFNF 3GZ6A 2R7VA 1ZTRA 4YIFA 3NQOA 4ASNA 3FBIB 1HSJA 2BEOA 1IN4A 1WPKA 1D0YA 2DA5A 3MWMA 5CQGA 4NBQA 6PAXA 2R5ZA 2VODA 5D5UB 1TL8A 1DPUA 2LKPA 3BZKA 2Q8KA 1FJLA 3QPSA 3D1NI 3DTEA 4KN7X 3CO6C 4IRGA 1W4MA 2X9DA 2R5ZB 4IZZA 1P4XA 3ZQLA 1FSEA 3CLQA 2DQRA 4IX7A 3OYIA 3HBLA 1QU3A 2P8TA 1V4RA 5GP9A 2M34A 2K9NA 1IG7A 4OIRF 2FQ4A 2F5VA 1U5TB 5F1JA 3LOCA 1UJ8A 2YS9A 3GVAA 1YJNI 5JHUA 4KYWA 4LIVA 2PFBA 4B1RA 2WB1A 4UVCA 1YS6A 1O7FA 2IW5A 4XOPA 4HG2A 1BI1A 2DK8A 2O0YA 4A0XA 1AKHB 4M72A 1P7JA 4BE2A 1P6RA 4ENJA 1LE8A 4J19A 3U1KA 3JRAA 4RB2C 2X51A 1ITYA 4OAYA 3IL2A 3IAS2 2LR8A 3H9JA 1R71A 3OR1C 2XSDC 2VPLA 5F0FA 3WU1B 3CCQI 1BI0A 2IS2A 2QUFA 4N0BA 1SMYF 1BBYA 2MH9A 3TDUC 3LSRA 1J75A 5IPAA 4A12A 2BW3B 2XKOA 4Y17A 1XN7A 1CQTA 1IRFA 1QVUA 1I27A 4B3XA 3JRFA 2A6TA 4GGGA 4IHVA 1K4TA 4HRIA 2VT3A 3TO6A 4JQFA 4CYDA 5KHDA 1MBEA 4BDYA 1BW5A 1X1BA 5FKOA 2RN7A 2GQQA 2XRNA 1YYVA 4ZDOA 4KUMA 2PMZA 2HS5A 2BGCA 4L5EA 4BUPA 4C3IJ 2R7SA 1S6LA 4IVNA 3H5NA 3ML6A 2KT0A 1ZRDA 1YQAA 2D45A 3BG6A 5LHHA 2WAEA 2QBYA 4BE0A 1W5TA 4C3JJ 4G7HF 1JHHA 4MHGA 2Y0SA 1DGRM 3JR9A 2PJRA 1U8RA 4EJWA 2VT2A 2JN6A 1VQOI 3KLOA 2F5DA 3QPLA 2OA4A 1JGSA 2EZLA 2VKDA 3ZN0A 2Y9YA 4BS9A 3BR2A 2PMUA 1MBHA 4LG0A 1DPRA 2V6CA 3JAMK 1X4PA 4BE1A 3S1QJ 4FTHA 4B48A 3REOA 1EA3A 2Z3YA 3VWBA 2UV1A 5KK1A 4MGRA 3FXLA 4DYRA 3E6BA 4IL6C 3F9KA 2VQHA 5FGMA 1ZARA 4Y4RA 3K4BA 2E1OA 4BQAA 3C18A 4ENNA 1YX3A 1R36A 4X6AJ 3NEUA 1X58A 2HOSA 3ZQGA 1G3SA 1ZK8A 1Y1VJ 5GADJ 4RGUA 3I55I 2CUZA 3VB2A 1XGSA 3S1NJ 4KMFA 2XHKA 1J0RA 5ILVA 3MKYB 1JTXA 4E7IA 3JCUC 1HBXG 2EINH 3HZJA 3O6BB 3V7RA 3RQ4A 2DOEA 2M2EA 1FEXA 3OIQA 3FXQA 3C2BA 1Z21A 1U5TA 5EDNA 5C4JJ 2AQEA 3I5UA 3HSEA 5D5WB 2E1MC 3PJRA 4A5MA 2HR3A 2ZMEA 3C7JA 4FHTA 2DQLA 1SD4A 4BKXA 1GVJA 5DS9A 2GWRA 3B73A 2OU2A 5K5QA 2OTJI 3K10A 1T2KA 4A3LJ 5LGUA 3OYEA 2MA3A 2RC4A 1FX7A 3KP4A 3S32A 4KDPA 1MBKA 3L2UA 1UELB 2ME0A 1D1CA 2LD5A 1IUFA 2EA4A 3MKWB 1OJLA 2LG4A 3MMYB 2EBIA 3CCMI 1A5JA 3MZ8A 4MEYF 3F8MA 1JUSA 3HJEA 4CICA 2XAUA 4BACA 4U7DA 2E1CA 4RMNA 5L3BA 2LP0A 2MFZA 1EKEA 1YO5C 2K9LA 4YIIA 2ACJA 1WI3A 2GXBA 5AONA 2OPTA 2LMDA 3MD2A 4NHJA 3HGYA 2DDBA 3ZMZA 1JT6A 3M8EA 2WY8Q 1B1BA 4LIUA 1A35A 5EEAA 2HOAA 1QNTA 1LE8B 1N77A 1O3SA 4U0YA 1GVDA 3U9GA 1IV8A 1MDMB 2GOMA 3S1MJ 2BYVE 2XF5A 3K1MA 1WQ2A 1MBJA 1KGSA 3QODA 3KP5A 4BY1J 5B1AH 3CUOA 1JUPA 4PGHA 2DI3A 1LFUP 2ISZA 2CYYA 3IRRA 4R79A 1FBQA 4O3MA 1ULYA 4MIMA 1WJBA 3E5QA 1BJAA 4E6KG 2A07F 5C3EJ 2IGNA 1R5HA 3FF5A 4WXCA 4HBLA 3T8RA 4JYKA 4N4NB 1HOMA 2TCTA 3OSGA 3BG7A 1QZYA 3IUOA 3ZRGA 5EGOA 2QSGX 2DYRH 4UY8I 1T08B 3KCCA 1RNLA 2AXLA 2ESHA 3HTUA 2IS6A 1KONA 2HVRA 3CDHA 4M3FA 3ZGKA 3L7WA 2MH2A 1JJ8C 3KZIC 4I02A 1VTNC 5ED4A 2B63J 2V1XA 2O61A 1BR1A 3E6MA 1LDDA 1SAUA 3ZCOA 4G9YA 1SD6A 4PJLA 2H1KA 4GYGA 3FXMA 1LUJB 2FBHA 1N25A 2LNBA 1PUEE 1FTTA 3B6CA 1D3YA 1OQYA 3LSTA 2HVSA 2LTPA 2OV7A 2K9MA 3P7NA 4Y33A 4DW6A 1JJ6C 1GV2A 3GX4X 2IRFG 3CP2A 2R7OA 3ESWB 5L3CA 2NXNB 4AIDA 2L7KA 4XN0A 2E1MB 2I8DA 5DDGA 1LVKA 4V2FA 1TQIA 2XAHA 4L9TA 3IV5A 1FIAA 1YTYA 1S3JA 2ELJA 1E17A 4HQMA 3CJRB 5HLHA 3G4SI 5IT3A 4C9YA 3ZQFA 3ZQCA 2K3FA 3BR3A 3RYRA 3G71I 1XSDA 4RB0A 3NRVA 3ISPA 3FMSA 2JA7J 2CO5A 2BVLA 2VI6A 4Z2YA 3IC7A 5LEKA 5GTIC 4UB8C 1S7OA 2BY2A 1ZRCA 1H9TA 2MSYA 1R58A 4FE7A 1S8NA 2P5VA 5HLTA 4KA4A 5ILSA 1BJZA 1XB4A 3WE2A 3LSGA 5EEHA 2LREA 4UXNA 3S2WA 3SFIA 1SD7A 1ODDA 2I5UA 5E3OA 1T39A 2XGCA 2P7CB 3VYTB 3L09A 2BHYA 4IRIA 1MMSA 1PUFA 4F7ZA 2X6YA 3E97A 5HS7A 2LY1A 1XCBA 4XIDA 3DFGA 4XLHA 3VYSB 4G94A 1Z91A 2JVGA 1WJFA 3HPHA 5H2FC 5CVJA 4O6JA 3O8HA 3E5UA 2CG4A 1MJ9A 3B6AA 4PFPA 4GRIA 1MD0A 4PGGA 2K9QA 3SDGA 3F23A 3X2QH 3R0JA 2CJJA 3ELKA 2I10A 4EEFG 1OCRH 4DBQA 1CF7B 2O9LA 3K2ZA 4CGZA 4R1HA 3CJTB 5HVQC 2MLGA 3S16J 2Q2EB 4NQWA 4D5CA 4BQQA 4ZH4F 1TQMA 3M9AA 4BBSJ 3S2HJ 5K1YA 2YR2A 2CUEA 1W36D 1U8BA 2QQ8A 2NVXJ 3G2BA 1IJWC 3F8NA 3GF2A 1QRYA 4E7KA 3G3ZA 3FIWA 2CQXA 3KP2A 1DQUA 1TP4A 1K6YA 2QKLB 3ECOA 3KEYA 3WE3A 1GXPA 1K78A 1FC3A 1A6IA 3I59A 4XKWA 3JTGA 3I54A 4FCYA 5KVRA 1OPCA 2JUCA 1T56A 1TWGJ 2O03A 3LA2A 2ZB9A 4UV8A 3HGGA 3ZMSA 1ZRFA 4Q48A 2W57A 4H4KC 3D5SC 4HEA2 4B3AA 3AKZA 5E79C 1IC8A 3S3OA 4E7JA 1BL0A 4XK4A 1X3ZB 2P6SA 3HKZA 1LKXA 5EZHA 2XPUA 1S9HA 3FXKA 2HZTA 1MNMC 2FEZA 2W48A 1F43A 5J1RA 2MYSA 2HGCA 2XGEA 2R92J 2DOAA 4PCQA 3M07A 5ICCA 2LFBA 3W3CA 1O3RA 3C2HA 4M3EA 1FNNA 2BY0A 1D8JA 4U0WA 3QYBA 4NUBA 2VKEA 2X4HA 3LA3A 4HLXA 4CCOA 3ZQQA 3IP4B 1VZ0A 4BDZA 5IP6A 1W7PA 2CW7A 1VQLI 1XGMA 2DPDA 2D2WA 4I09A 2ZJ2A 4CH7A 4KIFA 3L00A 2X6WA 2H94A 3KPHA 4EJVA 2PI0A 2KJBA 3IRQA 3A02A 2XF6A 4U7BA 4ZYGA 4JOMA 5J3LA 4BQOA 2V6EA 1T0FA 3EETA 5H6QA 2G7UA 1XC5A 2EFQA 4LLLA 4RDUA 1YRNA 4RB3C 1N78A 3ZP5A 4U0VA 3A4CA 5JVGF 1ERDA 2ZKZA 5A2QZ 1V5EA 2BBYA 3ERMA 1G2HA 2KIFA 2W82A 4YIRX 1FSHA 1HQCA 1ZR2A 5DM7F 3CCEI 2QENA 2LVSA 2VXZA 4A3JJ 1GXQA 3A0BC 3HPGA 5B3SH 2D5VA 4X0GA 3LQQA 2NVQJ 1M1EB 3QPHA 5C4XJ 4Y15A 1GUUA 4PJNA 2EWNA 2MABA 4PZJA 4IF4A 1W0UA 3HHGA 5FKMA 1OLTA 3CESA 1MDMA 1UG0A 1P7IA 3CF2A 1K7AA 3Q0UA 4ESFA 1IN5A 5HNFA 1TT5B 4ETSA 1PYVA 4F91B 3G6EI 2KRFA 3DKXA 1YJWI 2RQPA 3DP7A 2KHMA 3BJ6A 4UUVA 5JLWA 1R9TJ 2W25A 1QA6A 5H20A 2J5OA 2IVMA 1RRJA 1DU6A 4A5NA 1JT0A 3M1EA 1SFKA 1R6RA 5J47A 3BQZA 3WTSC 2Y31A 3DKWA 3DF8A 5K5OA 4RAFA 4M9ZA 3O3KA 5KNLA 4KICA 1NG7A 1X4OA 3DPTA 1ON2A 5BMZA 5IOYA 5HS8A 1HW5A 3GFJA 2EH3A 3FXUA 3HRTA 2QQAA 3R4KA 1MH4A 2F4IA 1XS9A 1V5FA 2LY9A 2WY7Q 4B47A 2HDWA 2VKVA 3I56I 5KAIC 3DKYA 2L02A 1KU2A 2CQNA 3K9TA 5B5EC 1LEBA 2BZTA 3WODF 1YLFA 1I3QJ 1UCRA 2ZMEB 4EJUA 1Z7UA 5DM6F 1MW7A 2R7XA 1ZYRF 4UB6C 1TNTA 3C3WA 1Z0XA 1BI3A 4G12A 1IO2A
chains in the Genus database with same CATH topology
1VQMI 2ZJQF 1YJNI 3CC2I 2ZJRF 1VQ9I 2QEXI 3CF5F 1VQ4I 1VQ6I 1FOWA 3CCJI 3CCVI 3CMEI 1YI2I 1YITI 2FOWA 5DM7F 1QA6A 1VQKI 3CCEI 3J7ZI 1VQLI 3CCLI 2QA4I 1YHQI 2E34A 3I56I 3CCRI 3CCMI 1VQOI 1S72I 2JQ7A 5GAEJ 2OTLI 3G4SI 3CC4I 4IOAF 2K3FA 1MMSA 3G71I 3J7YJ 1FOYA 3CMAI 3PIPF 1YJ9I 3G6EI 1VQ5I 3CJTB 2E35A 2H8WA 5GADJ 5DM6F 4UY8I 1FOXA 4IOCF 1VQ8I 2OTJI 3I55I 3CCUI 4IO9F 1YIJI 1VQNI 1HC8A 3CC7I 3PIOF 2ZJPF 3CCSI 2NXNB 3DLLF 1VQ7I 4V19K 1ACIA 5GAGJ 3CCQI 1Y39A 5GAHJ 1YJWI 2E36A 3CD6I 5JVGF 1VQPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  2ZJQ F;  1YJN I;  3CC2 I;  2ZJR F;  1VQ9 I;  2QEX I;  3CF5 F;  1VQ4 I;  1VQ6 I;  1FOW A;  3CCJ I;  3CCV I;  3CME I;  1YI2 I;  1YIT I;  2FOW A;  5DM7 F;  1QA6 A;  1VQK I;  3CCE I;  3J7Z I;  1VQL I;  3CCL I;  2QA4 I;  1YHQ I;  2E34 A;  3I56 I;  3CCR I;  3CCM I;  1VQO I;  1S72 I;  2JQ7 A;  5GAE J;  2OTL I;  3G4S I;  3CC4 I;  4IOA F;  2K3F A;  1MMS A;  3G71 I;  3J7Y J;  1FOY A;  3CMA I;  3PIP F;  1YJ9 I;  3G6E I;  1VQ5 I;  3CJT B;  2E35 A;  2H8W A;  5GAD J;  5DM6 F;  4UY8 I;  1FOX A;  4IOC F;  1VQ8 I;  2OTJ I;  3I55 I;  3CCU I;  4IO9 F;  1YIJ I;  1VQN I;  1HC8 A;  3CC7 I;  3PIO F;  2ZJP F;  3CCS I;  2NXN B;  3DLL F;  1VQ7 I;  4V19 K;  1ACI A;  5GAG J;  3CCQ I;  1Y39 A;  5GAH J;  1YJW I;  2E36 A;  3CD6 I;  5JVG F;  1VQP I; 
#chains in the Genus database with same CATH topology
 2HXI A;  1IRZ A;  2QM3 A;  5E1W A;  2ZJQ F;  1OYY A;  5D8L B;  2ZME C;  2CW0 F;  2ZJR F;  4WK8 F;  5FRM A;  3GCM A;  2EB7 A;  3FIS A;  2CV2 A;  4ZDP A;  1JKP C;  2DFH A;  3K69 A;  2X6O A;  2A6E F;  1RUN A;  2WAD A;  2GA1 A;  3I9V 2;  3I4M J;  2A69 F;  2GAU A;  2V9K A;  2O6G E;  1BR2 A;  4YG2 F;  4NB5 A;  4XKC A;  5LRR A;  1ETV A;  4HSR A;  3PM1 A;  2KIM A;  4QPO A;  3FHZ A;  3HSF A;  4UVA A;  4EM2 A;  5FO5 A;  3FM3 A;  2DLL A;  4CCM A;  3H3V K;  1HW2 A;  4A0Y A;  2Q0O A;  5HDK A;  3DEW A;  5J1Y A;  4ENM A;  3IWZ A;  5DTD A;  2P4W A;  3H36 A;  2DA4 A;  1F9N A;  4CCL A;  3H9G A;  3TL4 X;  2XIG A;  2V9V A;  2MC3 A;  3K4K A;  1BR4 A;  1I1G A;  2VJ4 A;  4UUS A;  4AU7 A;  4LJZ F;  4ESB A;  1LNW A;  4IPA A;  4XLP F;  2NVY J;  2WA0 A;  1X1P A;  4R8H A;  2XUB A;  2VOP A;  3GBG A;  1SFE A;  3RQI A;  2QF7 A;  4D0P A;  2XGD A;  2XPV A;  1BM9 A;  3CCJ I;  1CGP A;  1NK3 P;  3L2R A;  2E2I J;  3BG3 A;  1D5Y A;  4AWX B;  1XG1 A;  2JSP A;  1HW1 A;  2CGP A;  3FBN B;  5FKK A;  1MSE C;  3BRO A;  1W0T A;  1Z7L A;  2L4M A;  1KU9 A;  4A0Z A;  2XRO A;  2VQL A;  1WJA A;  2JWT A;  4I01 A;  2HQR A;  3CQZ J;  1RR7 A;  2KIS A;  2DO7 A;  2Z2S B;  3LA7 A;  4LB6 B;  1HXD A;  3ABU A;  2VC1 A;  3LL7 A;  2EPF A;  2CQ7 A;  4DQ2 A;  1J5Y A;  5CVI A;  1EJ9 A;  1XMA A;  3CMY A;  3IKT A;  3PO2 J;  1ETW A;  5FJ8 J;  1A36 A;  4KIS A;  5FFX A;  3DU5 A;  1WI9 A;  5EZG A;  4NC6 A;  2EIK H;  3NAR A;  4P96 A;  2BW3 A;  4XL9 A;  2BXZ A;  3OMY A;  1FTZ A;  2Y69 H;  1R1U A;  1B59 A;  3CUQ A;  2IXS A;  2H8R A;  2R7T A;  4IHX A;  4M6V A;  1YS7 A;  2ZBK A;  3MZY A;  1Y8Q B;  3LAP A;  3QYE A;  3RZD J;  2GM4 A;  4OIQ F;  2ZC2 A;  4G6D A;  4M3G A;  1I6X A;  2FOW A;  1HST A;  2FUG 2;  4CXF A;  3FDY A;  3OYA A;  1FT9 A;  2WWY A;  2Q2E A;  3RKX A;  3E5X A;  1K61 A;  2A5W A;  3K6G A;  3RKY A;  4RBO A;  1R7J A;  2FOK A;  2E2H J;  3NWT A;  5FLM J;  1QZE A;  1MH3 A;  2ELH A;  4L9J A;  4LIT A;  4MO7 A;  4Y7N J;  2DN0 A;  1OCT C;  1R1T A;  2JA2 A;  4LLG F;  3VSK A;  2YUS A;  4JBA A;  1BI2 A;  1O4X A;  3J7A Y;  3KEQ A;  3HOX J;  3OYF A;  4A3D J;  3SEZ A;  2EFN A;  5ICE A;  2M8G X;  4FT8 A;  4M9S A;  2E19 A;  4XLC A;  1S72 I;  3FXJ A;  1B9M A;  1LB2 A;  2WAQ A;  3I4N J;  1DGW Y;  1E3P A;  1VI0 A;  2HYG D;  3ASO H;  5B1B H;  1WVR A;  9ANT A;  5FD6 A;  5GAH J;  3GTG J;  3HXL A;  5FRN A;  2IGO A;  3K0L A;  3ECH A;  4BXU A;  4I7H A;  4FQG A;  3CF5 F;  2WB1 N;  2R7Z J;  4I0A A;  4N9I A;  2DFI A;  2QGU A;  1IDZ A;  1AWC A;  5H6R A;  2XB0 X;  3IH2 A;  2MG4 A;  5DCM B;  3SXY A;  2XAQ A;  1O3T A;  2R5Y A;  1RUO A;  4ZYA A;  2JT1 A;  1Z3Y A;  4CHU A;  3U2R A;  1K78 B;  2IP2 A;  3OYB A;  5FB2 A;  5HDG A;  2V7F A;  4LFU A;  3JW4 A;  4LK1 F;  1XGO A;  2DMQ A;  3WU2 C;  5D5V B;  3J7A O;  2FQ3 A;  3I53 A;  4WXH A;  5EYR A;  3TGN A;  4BJ5 C;  4L5J A;  1TWF J;  2V79 A;  1K4S A;  3FMQ A;  1BC8 C;  2V1U A;  3A2K A;  3AG2 H;  1HDP A;  3UNG C;  1WHU A;  3R0A A;  2GXA A;  3SFZ A;  4XR6 A;  2HPM A;  2W1O A;  1SAN A;  3KLN A;  2VN2 A;  3BTI A;  1LDJ A;  2XKP A;  4WXD A;  3SDB A;  3WGG A;  2DMP A;  1XDS A;  1SAX A;  2K86 A;  3EYI A;  3M7G A;  4FET A;  3OR2 C;  2W7N A;  3HHH A;  4A3K J;  2IGK A;  4UVB A;  1IN6 A;  5DEQ A;  3CLO A;  5TRD A;  5LD2 C;  4F55 A;  3T5X A;  3HEF A;  1BA5 A;  1IAW A;  2WTE A;  1S7E A;  2M0C A;  2CUF A;  2HTS A;  5TGT A;  1FIP A;  3OOU A;  4XLA A;  5EG0 B;  2LBF A;  1W5C C;  4LLN A;  3OIO A;  4XRS G;  2ZO4 A;  5LRS A;  3MEX A;  5J6X A;  1Z1D A;  3RCO A;  1YX5 A;  5DYM A;  1MJA A;  3HIF A;  3ZN1 A;  4B4C A;  2NNN A;  1GLN A;  3WTT C;  1QBJ A;  4CCJ A;  2JA8 J;  2KDZ A;  2DPU A;  1K83 J;  3J7Y J;  3HL2 A;  4J01 A;  3ABM H;  3LFU A;  2EA2 A;  1FLI A;  4MFE A;  2M4K A;  3MKZ A;  3K70 D;  1R4N B;  5HOD A;  2CRG A;  5CYV A;  5IOZ A;  3HM5 A;  1OCC H;  2E7W A;  2F5C A;  3BC8 A;  1IXC A;  3BP8 A;  3I64 A;  2LRD A;  4DJA A;  3HRM A;  2YU3 A;  3Q0V A;  1Z77 A;  2PJP A;  1KYW A;  1E3H A;  3Q9S A;  2XAJ A;  2L5Q A;  4ZYE A;  1IN7 A;  3N4M A;  3F22 A;  1VFC A;  1O3Q A;  2LF8 A;  1H9G A;  2F4O B;  2XAF A;  2H1L A;  2DA7 A;  5CJ9 A;  4EM1 A;  3CC4 I;  2ZXH A;  3JRG A;  3JRE A;  4BBR J;  1FOY A;  3CDL A;  2AXT C;  2KQR A;  3S3N A;  4CYC B;  3EUH A;  5E3M A;  1BIA A;  3ZMU A;  3QU6 A;  2A68 F;  2R0Q C;  4A3F J;  5GPC A;  2KIQ A;  1JXS A;  2M0M A;  2CMP A;  2FJ1 A;  2LBF B;  3AL0 C;  1J59 A;  1ZGW A;  2OZ6 A;  2RVC A;  4J00 A;  2CW8 A;  1P4W A;  3TOB A;  2Y2Z A;  2F6C A;  4L5I A;  1F1Z A;  3BT9 A;  2M4G A;  1TW2 A;  4A6D A;  3U21 A;  1G4D A;  1ZLK A;  1XDU A;  4HZF A;  2JSC A;  4I98 B;  4XSX F;  5JVT A;  4GXO A;  2HYF A;  1AHD P;  4DYC A;  4UV9 A;  4AVZ A;  2R7D A;  3GTQ J;  2DA3 A;  5FKL A;  3GO5 A;  4AD9 A;  3ERE D;  3MN2 A;  3JRH A;  1ACI A;  1U3E M;  4JX5 A;  4ESJ A;  2KIU A;  2R7F A;  1Y39 A;  1KQ8 A;  5HS9 A;  4C2U A;  1GV5 A;  3FXO A;  5DV5 A;  5J8C A;  4LB5 A;  3H3U A;  3BR0 A;  4ZTF A;  4UNO A;  1YI2 I;  2NS8 A;  3ZR8 X;  3ZXS A;  3DQV C;  2NOJ B;  2H6B A;  5IT9 Z;  1UHS A;  4XOR A;  1MBG A;  5E3L A;  3KYD B;  3BCB A;  4ZYH A;  4FX4 A;  1SC7 A;  1CF7 A;  5FD5 A;  5LHI A;  5E3N A;  4XNF A;  2O8K A;  1UFM A;  3TOA A;  4WX9 A;  2M1B A;  3OYC A;  5BPD A;  1YG2 A;  3FM5 A;  3C2G A;  1LJ9 A;  4DOZ A;  3FKJ A;  2KFD A;  2D1H A;  5DD4 A;  4ZZD A;  2NNY A;  2IGM A;  3OYH A;  2VXD A;  3OYD A;  2L7Z A;  4BNC A;  2JVH A;  5DCM A;  4BL0 B;  2VL8 A;  4I76 A;  4IHT A;  4RB1 A;  1VQ6 I;  3WHC A;  2JJ7 A;  2F5F A;  2RRE A;  3S3M A;  3GTM J;  3CCY A;  2OCC H;  5IYD J;  2ADU A;  4HQE A;  1OMI A;  1ZQ3 P;  4P9F A;  1I39 A;  3OIP A;  3RYP A;  3LQR A;  1ETY A;  1W5S A;  1ENH A;  3QPT A;  3GFI A;  3PNT A;  1BN5 A;  3QOP A;  1ZGJ A;  4MFD A;  1V3F A;  3ZQI A;  4KN4 X;  4WWC A;  5FLV A;  2CS3 A;  4Y3O A;  2R7Q A;  1VND A;  3CC7 I;  2KZG A;  2K40 A;  5F04 A;  1P2F A;  3FK7 A;  4BYY A;  2P0W A;  2MLK A;  1S5L C;  1Z9C A;  4F3Q A;  5E17 F;  2Y0M A;  3SEQ A;  4PSW A;  3BY6 A;  5M5W J;  3C1D A;  3VEP A;  1U78 A;  4I6Z A;  4DBR A;  1O57 A;  3EDP A;  3V8J A;  4M9X A;  2VB6 A;  3GEZ A;  1B4A A;  4GFB A;  2HEO A;  4ZC3 A;  1I50 J;  3K4C A;  3T0Y A;  5EG0 A;  2OTL I;  1OYI A;  4P9U A;  3FX3 A;  2LY2 A;  2X6X A;  3H5R A;  5F1R A;  3DLA A;  1S7A A;  3JRB A;  5K7Z A;  2F5E A;  2R7U A;  1UMQ A;  1Z67 A;  1D1B A;  1SFO J;  2B7E A;  3A03 A;  4LOC A;  2NRA C;  2WAQ N;  1LVA A;  2A61 A;  2EV5 A;  2VJ5 A;  1YIO A;  1ETK A;  5ICF A;  5HNH A;  1J09 A;  2HNH A;  3FK6 A;  4HOB A;  1YOV B;  4HA8 A;  2XF7 A;  2Z1D A;  2DTZ A;  2V26 A;  1KU7 A;  3M1C A;  1T6S A;  5E1X A;  1YW9 A;  4QTR A;  2ID3 A;  1PVE A;  3ZMT A;  2HXO A;  4PJM A;  2JPC A;  3ULQ B;  3DU6 A;  3MKL A;  4MQV A;  2EIJ H;  5K7F A;  2RAE A;  2A6H F;  2PQ8 A;  3OOP A;  5M5X J;  1SFX A;  1UB9 A;  4C3H J;  1TC3 C;  2DXI A;  5F08 A;  5LLQ A;  2F2E A;  2E36 A;  3EQL F;  4NNJ A;  1Y1W J;  1GDT A;  1KU3 A;  1XMK A;  4AC0 A;  1V5G A;  2BOL A;  4E7Z A;  1H88 C;  1FPQ A;  2FBI A;  3DTK A;  1ZEL A;  2O8X A;  3K4J A;  3GTL J;  3LSH A;  2DCE A;  4N4O B;  4CDG A;  2H6C A;  2HYJ A;  4BY7 J;  3TMO A;  4P55 A;  3DPL C;  2VE8 A;  2IA1 A;  2FRH A;  2UXX A;  3GFL A;  4AUX A;  3OYJ A;  5D4S A;  3UKG A;  4MEX F;  5J1U A;  1HCR A;  3KET A;  1ZG1 A;  3TBI A;  2E35 A;  4AYB A;  5CLS A;  2QBY B;  1FYM A;  2NVT J;  2KMU A;  5IP7 J;  3AG3 H;  2FML A;  3OV8 A;  4RLQ A;  3RTR A;  5M3M J;  1F4K A;  3WG7 H;  2VOO A;  5CVR A;  1JUM A;  2ZSH B;  3CC2 I;  2P5K A;  4ON0 A;  2L0K A;  3H9Q A;  2IBD A;  3MVP A;  2Y9Z A;  3JSP A;  1FP2 A;  3DV8 A;  1LQ1 A;  1AKH A;  3MZH A;  2CV1 A;  2HQN A;  4UHT A;  4RGX A;  1OIS A;  2EIL H;  2QZ8 A;  5F6F A;  4CO8 A;  3H5A A;  1Y8R B;  3PQK A;  4OMZ A;  1GT0 C;  4OIO F;  3HTS B;  2PBI A;  2CH0 A;  4A3I J;  3PIP F;  3BCA A;  3WTU C;  2V1D A;  5E8I A;  4IXA A;  1YIJ I;  3TO9 A;  4HF1 A;  2J5P A;  1VQ7 I;  3HOT A;  1DU0 A;  3JRC A;  1UHW A;  3GYH X;  4OMY A;  3U1D A;  3HOS A;  2MW8 A;  2MBF A;  4HW0 A;  4KIB A;  3WTY C;  2Z33 A;  2Z5U A;  3S93 A;  1VQ4 I;  1I6H J;  1IV6 A;  1FOW A;  2O5R A;  4S05 A;  3TDZ C;  1Q1H A;  4QIW N;  3BPV A;  3R60 A;  3BJA A;  4MQ9 F;  2E34 A;  1RKT A;  2K27 A;  2UXN A;  3W6J B;  3WGI A;  4NDL A;  5F0C A;  1HA8 A;  2KPM A;  5KAF C;  5LGT A;  3OYG A;  3RKQ A;  2HVQ A;  1MMN A;  2HDC A;  4EQQ A;  2HKX A;  3L2C A;  1MND A;  3O2P E;  1LFB A;  4HNV A;  3SZT A;  1MMA A;  1ZLJ A;  2DFF A;  4KT6 A;  4E7L A;  3PL8 A;  4A93 J;  2OQG A;  4W97 A;  5DD8 A;  1BW6 A;  1QVT A;  1VQP I;  1MJB A;  4OU0 A;  3OYL A;  3BG9 A;  3OYK A;  1P92 A;  2LKS A;  1WJD A;  3W6V A;  3QP6 A;  3BTJ A;  4C2M J;  3H92 A;  3BQY A;  3SYT A;  3I4P A;  2AHQ A;  2V4J C;  4XRM A;  3KE2 A;  2X85 A;  2ZXW H;  1U9N A;  1BOA A;  3VSL A;  1HKQ A;  3E7L A;  1TNS A;  4QSH A;  5D4R A;  4MNU A;  3TED A;  1C0W A;  2FF4 A;  2OUM A;  3ZOB A;  2EK5 A;  2EV6 A;  2IS1 A;  3F0C A;  1YHQ I;  1T0F C;  3KZY A;  4EJO A;  4BXX J;  4GYI A;  4YEL A;  1WGX A;  5LFA A;  1B72 B;  4JX4 A;  4Z6Y A;  4NC7 A;  3S1R J;  3CCL I;  2MGQ A;  5BPI A;  3DPU A;  4RAZ A;  3VOE A;  2FD5 A;  3S17 J;  3J80 Z;  1FYK A;  2HZD A;  4ITV A;  3KEO A;  1RET A;  1YJ9 I;  3SHF A;  4EAT A;  2DFE A;  2JRM A;  1YW8 A;  2M7B A;  1QGP A;  3DBL B;  3GW2 A;  2ISY A;  3GWZ A;  4D5F A;  2QLZ A;  3T1B A;  3V7S A;  1A6Q A;  1RZ4 A;  4E70 A;  2FU4 A;  2QEX I;  5K7H A;  4IHS A;  2IJL A;  1REP C;  1KYZ A;  2CQQ A;  2L01 A;  3ZMV A;  2K5C A;  2DU9 A;  3RIR A;  1MIJ A;  1OR7 A;  3WTW C;  1T98 A;  1G3W A;  5L3F A;  1HKS A;  2M7A A;  4EGY A;  3GFM A;  1FP1 D;  2E71 A;  4A3E J;  2XRL A;  4TV7 A;  2XC7 A;  4RAY A;  4CSW A;  1Y0U A;  2AO9 A;  1XGN A;  1KQ9 A;  1FWZ A;  2N8G A;  2Y75 A;  4F93 B;  2L9V A;  5HOO A;  1YIT I;  1VQK I;  1NK2 P;  4LG0 B;  3OS0 A;  2M87 A;  2G0E A;  5HLG A;  1J9I A;  3NWS A;  1P9Q C;  1QHH D;  1OFC X;  1QHG A;  2R93 J;  2DA2 A;  4YFX F;  2CV0 A;  2VIX A;  3ABK H;  4FIS A;  4HX7 A;  4XQF A;  2KRH A;  3MQ0 A;  1MMD A;  2KZV A;  1SVM A;  3D5L A;  3ROU A;  2FSW A;  3JRD A;  1F36 A;  3KP6 A;  2HQA A;  4LD5 A;  5TIS C;  2GIZ A;  2JTV A;  3V7C A;  2MD5 A;  4XLF A;  5FLX K;  3BZ6 A;  5IYB J;  3KZZ A;  1R1V A;  4L0Z B;  3HSR A;  4CZZ A;  4YRV A;  1B72 A;  2KL4 A;  4ZYD A;  3HOW J;  3IH4 A;  1WJC A;  5JR3 A;  3TW6 A;  3TP3 A;  1B9N A;  2UUZ A;  3K1P A;  3WTZ A;  2OD5 A;  1LDK B;  1SVL A;  3RKW A;  5A2Q K;  3I0T A;  1MZB A;  2DJI A;  1EF4 A;  1WSU A;  1PUF B;  1DP3 A;  4BHP A;  1PP7 U;  2JA5 J;  1RR8 C;  4OAZ A;  4A3B J;  3RJP A;  2DTR A;  4EV0 A;  2JZY A;  4A6E A;  1JHF A;  3WU0 A;  2EIM H;  1TLH B;  2OCE A;  3IH3 A;  4BHB A;  2RGV A;  2PLY A;  4IQ4 A;  1TW3 A;  2HWV A;  1HF0 A;  3PFY A;  3BPX A;  3KFW X;  2P81 A;  3DEU A;  3S14 J;  2FE3 A;  3CJN A;  3F6V A;  3IAM 2;  5J40 A;  3OYN A;  3UR3 C;  2STW A;  2A5Y B;  4F52 A;  4BAY A;  4AYB N;  4OWR B;  4B09 A;  3SZG A;  2DT7 B;  3CCS I;  3KX2 A;  4E7S A;  2VC0 A;  4RAG A;  1W7P B;  4P5O A;  1ZGA A;  4I99 C;  3LSM A;  2K4J A;  4KIT B;  1IRX A;  3PNY A;  2NOG A;  1RES A;  1FZP B;  5JHF A;  5C44 J;  4M73 A;  3COA C;  3CCR I;  5IP9 J;  1JKQ C;  1RPW A;  3RSN A;  1S29 A;  4AM3 A;  4AIK A;  2ZNY A;  3GTJ J;  4K2E A;  2HOT A;  1ONV A;  4FX0 A;  2OJE D;  5F0H A;  1XPX A;  4HF2 A;  1TWA J;  1RI7 A;  4B8X A;  1G3T A;  2DOD A;  3VYU B;  3PO3 J;  4LMY A;  1X2M A;  4I2O A;  2JQ7 A;  3GTK J;  5LGN A;  2KRC A;  5D6F A;  3CUQ B;  4BXF A;  2ECC A;  2NS0 A;  1EH8 A;  1AA7 A;  2G9W A;  2E5Z A;  2JMW A;  1I1S A;  3H35 A;  1T33 A;  3ZMD A;  2Z99 A;  3LSK A;  4M71 A;  2GA2 A;  3HB9 A;  2ZXI A;  2IEK A;  5DCF A;  2P7V B;  3PUB A;  5HDN A;  2Y0S N;  2LF7 A;  3HYI A;  3BLY A;  1IDY A;  1POG A;  1TQP A;  5EEG A;  1EH7 A;  5CKT A;  2KJC A;  1BC7 C;  4U88 A;  2K02 A;  5HLI A;  3GZN B;  3E6D A;  2GLO A;  4C2T A;  4DGW B;  1XSV A;  5FRO A;  3SZP A;  1Y0N A;  2WBM A;  4CCK A;  3L2W A;  4Y52 J;  3Q3S A;  5ICG A;  2FX0 A;  3I59 B;  3F21 A;  2LLK A;  3WG9 A;  4E4H A;  5BOX A;  2YPR A;  2PJR B;  5JI6 A;  2DT6 A;  3AL0 B;  3H0G J;  2KP6 A;  3O8G A;  3VDX A;  1HKT A;  2XAS A;  3HG9 A;  4Y13 A;  3OY9 A;  3CCU I;  1I5Z A;  2K7L A;  4ZTJ A;  2OZU A;  3TO7 A;  4D7M A;  1USS A;  5EGO B;  1ZKG A;  2DMU A;  1AU7 A;  1WWX A;  3HC7 A;  2DW4 A;  2ME6 A;  2X1C A;  3DEE A;  2L4A A;  4FE4 A;  2HI3 A;  5F64 A;  1ZG3 A;  1ON1 A;  3LMM A;  3V8L A;  5CVU A;  2EV0 A;  1ORK A;  5FKN A;  4L0Y B;  4BQN A;  3GXO A;  3TQN A;  5J4Y A;  2DJN A;  2RKH A;  4G7Z F;  3V8K A;  2K3P A;  3F8C A;  4XN3 A;  3LSI A;  2FA5 A;  4QPQ A;  3PFI A;  3EYY A;  2PN6 A;  4RA2 A;  1U9O A;  2AQF A;  2ICW G;  3CUQ C;  5DUK A;  4EMS A;  4QLC U;  4HNT A;  4IHW A;  4QWQ A;  5L3D A;  3N05 A;  4BU2 A;  3IWF A;  1KA8 A;  2VON A;  1MBF A;  4XOT A;  1UHM A;  2W00 A;  4EGZ A;  5BNG A;  4XMY A;  2WV1 A;  4GO1 A;  3AG4 H;  1QZZ A;  1OCZ H;  2D1V A;  3A1Y A;  4M6Y A;  3BTL A;  1UG2 A;  3I58 A;  3E3V A;  1UAA A;  1FY7 A;  1E0E A;  1GHC A;  3GZ5 A;  1IZ1 A;  2ID6 A;  2XV4 S;  1QPM A;  1XD7 A;  3RI4 A;  3KYL A;  1JGG A;  1ZN2 A;  4DIQ A;  1LFP A;  3M8F A;  1YE9 A;  4X1E A;  2RDP A;  2W85 A;  4RM2 A;  4RGR A;  2CQK A;  1IW7 F;  4AIH A;  4ZZL A;  4XBF A;  1TT0 A;  1LPQ A;  3MFK A;  2QQB A;  2DBB A;  2QCO A;  3LWF A;  3J81 Z;  2VJJ A;  5IT9 K;  1G3Y A;  2CFX A;  4IOA F;  4KNY A;  2X48 A;  5L3G A;  3OL3 A;  1FBU A;  2EZI A;  3H3Z A;  5E8G A;  4A2U A;  3BOQ A;  1WZ2 A;  1D0Z A;  2RQQ A;  3WTX C;  2BV6 A;  3HUG A;  3G73 A;  1LEA A;  1OCO H;  1XTA A;  4P1W A;  2ZJP F;  5J8F A;  2K9S A;  4XLE A;  4XM3 A;  2B9S A;  4S0H B;  3GTP J;  2M8E A;  1Z6R A;  1SMT A;  5CQE A;  5E1Z B;  2GIV A;  3VOD A;  2O3F A;  4EVI A;  1U6G A;  4NC8 A;  3N97 A;  2XSJ C;  2QSH X;  1QO0 D;  3R6S A;  5IY5 H;  4CA0 A;  3K7A J;  2LC2 A;  2RNG A;  2MC4 A;  4KMU X;  1TWC J;  3I3L A;  5K5R A;  1PJR A;  2HTJ A;  1EV7 A;  2VBY A;  1H0M A;  4HYE A;  4E7H A;  3D0S A;  4MTE A;  3B02 A;  1SFU A;  2M45 A;  4HAM A;  4DNC A;  3K1N A;  2BE5 F;  3GME A;  3HKZ N;  3EUK L;  3OWT A;  2EZK A;  2L9N A;  1JE8 A;  2F4M B;  4XKB A;  3G1O A;  1NH3 A;  1D8K A;  4EJT A;  1J2X A;  5E18 F;  2OC6 A;  3FMR A;  5LHG A;  1QQI A;  2GXG A;  3CP8 A;  3DTI A;  3K4N A;  5B66 C;  4HST A;  4PDK A;  1HDD C;  1R5I D;  3HOY J;  2DK5 A;  1H8A C;  4ANJ A;  1DUX C;  2ZNZ A;  3L9F A;  4OOI A;  5D6E A;  1ZAO A;  2L9R A;  1MKM A;  3W2V A;  3S2D J;  2JRT A;  1U2W A;  3QAH A;  4GCV A;  2CWE A;  5GAG J;  1BIB A;  3F72 A;  3HOZ J;  2R4G A;  1MNE A;  1VQ9 I;  3PQJ A;  1B8I A;  3MAJ A;  1DDN A;  3VPR A;  2VUM J;  4PK4 A;  1L0O C;  4A3G J;  1WH7 A;  3RZO J;  2PMH A;  4PFO A;  2ZCW A;  3L1P A;  2OF7 A;  3FHN A;  1G6N A;  2H27 A;  1V54 H;  4HF0 A;  1P4A A;  3ZPL A;  1TWH J;  2X1D A;  3CMA I;  3FXR A;  5LBQ A;  2RNJ A;  1VQ5 I;  1R23 A;  3RPU D;  4G6T B;  2H8W A;  3GUD A;  3VFZ A;  2STT A;  1FBS A;  3LSP A;  3KP7 A;  1Q1V A;  4Q47 A;  3DLL F;  4BH9 A;  4M3D A;  2VJI A;  3Q0W A;  2F48 A;  3EUH C;  3H1C A;  4BEH A;  2WC2 A;  3QP5 A;  1F5T A;  4IRH A;  1IGN A;  3F3X A;  2BY3 A;  3QQA A;  4C30 A;  2XVC A;  1T8I A;  4RLF A;  3TW7 A;  2VE9 A;  1G59 A;  4WCG A;  4G8X A;  1WJ5 A;  4RGS A;  1X3U A;  3FKI J;  3P9C A;  1YFH A;  4IOC F;  3S8P A;  2KKO A;  1PDN C;  1T95 A;  4CCN A;  2Z9O A;  2VQC A;  3EPZ A;  2C6Y A;  2YX4 A;  4W1U A;  3PUF A;  3M8J A;  2LH9 A;  4D9J A;  1EH6 A;  3DBR B;  3E0J B;  5DUI A;  1FMW A;  2FBK A;  2NS7 A;  2TRT A;  3IKV A;  3J7Z I;  2WAF A;  3W2A A;  2JPB A;  3BWG A;  1BOB A;  2DDA A;  2XGX A;  5LEJ A;  3GLL A;  2NYX A;  2G7H A;  2K85 A;  4EM0 B;  4ABZ A;  2W84 A;  3KYC B;  5AIQ A;  3BDD A;  3QRF F;  4O5V A;  2CFO A;  2VBZ A;  3JSO A;  2VKH A;  4L9V A;  4OIP F;  2QVO A;  4HDV A;  2X1E A;  2ZFU A;  4G6Q A;  1D1A A;  4IJA A;  3W6K B;  2GZW A;  1TBX A;  4IEJ A;  4HNU A;  3CD6 I;  1SEU A;  3QU3 A;  2WV0 A;  2UZK A;  2VQG A;  1X1D A;  1Z3X A;  1X19 A;  2ELK A;  2LK2 A;  1OR7 C;  4KIG A;  3A01 B;  2CSO A;  1MMG A;  2Y30 A;  1T38 A;  3PNV A;  1B6A A;  5KCM A;  2AS5 F;  1MSF C;  1RKW A;  4L18 B;  1X1A A;  4ENK A;  5GAE J;  1IRG A;  4OIN F;  3BR1 A;  2BXY A;  3AG1 H;  2W4S A;  5J4V A;  3ABT A;  1IXS B;  5EF6 A;  1WH5 A;  2L7F P;  2L54 A;  1X1C A;  3DCF A;  5JFR A;  1KQ0 A;  1SVO A;  2EQR A;  1HC8 A;  3PIO F;  2TDX A;  1JKR C;  2CUJ A;  5ERI A;  1ZRE A;  2MD0 A;  3F8F A;  4HV5 A;  5CPR B;  3J81 K;  2PX9 A;  4KFC A;  5L3E A;  2NAZ A;  3WGH A;  1RC9 A;  1XSX A;  4IKF A;  1HLV A;  4BGD A;  1K6O A;  1B8I B;  4F92 B;  4XKV A;  2E7X A;  2M5W A;  1WKM A;  2VBX A;  2X0L A;  2O7O A;  3SJM A;  4G7O F;  3G1M A;  4JX6 A;  5E20 A;  3ZQH A;  2Q1Z B;  5M3F J;  2H09 A;  1ZR4 A;  2IT0 A;  4V2G A;  3F6O A;  4HV6 A;  4HX8 A;  1J7K A;  2ETH A;  1R4M B;  3BTC A;  4HDU A;  2FXA A;  2K4B A;  4XRF A;  5EJC A;  2IA2 A;  1XX5 A;  2DYS H;  3HRU A;  5GPA A;  3P9I A;  2DAO A;  1G8X A;  2BY1 A;  3EUA A;  3OL4 A;  3QYF A;  4KJZ A;  2HKO A;  2JUG A;  2QQ9 A;  1KZH A;  1Y56 A;  2Y48 A;  1FOX A;  4U87 A;  3OS1 A;  3CZ6 A;  3BG5 A;  1IF1 A;  3DWL E;  2XPW A;  1A31 A;  3G1L A;  2Z16 A;  3HOU J;  2IPQ X;  1STZ A;  2YSR A;  3CMM A;  3LNQ A;  1ZH5 A;  4M6X A;  3Q5F A;  2JA6 J;  3JTH A;  3M3Y J;  4D1Q A;  1VF9 A;  3PSF A;  4BHC A;  2PG4 A;  4M3B A;  4Q4Z F;  2CU7 A;  1WCM J;  4DZP A;  1D5V A;  4RM3 A;  3K4M A;  4S04 A;  2M9H A;  2YU9 J;  2LSO A;  2KLO A;  1I3A A;  1H89 C;  2M3A A;  1N75 A;  2JK3 A;  4B43 A;  4A3C J;  2V9P A;  3MCZ A;  3F8B A;  2UWM A;  1R49 A;  2R7R A;  3K70 C;  3V42 A;  3BR5 A;  2HU9 A;  2B0L A;  3ONQ A;  1FMV A;  2PEX A;  2DA6 A;  2VBW A;  1MGT A;  3AAF A;  4AIJ A;  3V4G A;  1E3O C;  3E1S A;  1L3L A;  1NG6 A;  2L3D A;  4ZDL A;  2IA0 A;  3GTO J;  2OAZ A;  4GDF A;  1JTY A;  3QOE A;  4PJJ A;  3OS2 A;  5M5Y J;  3K4L A;  3W2W A;  3CJQ B;  5GTH C;  4PJ0 C;  4HLY A;  5IYC J;  1VQ8 I;  2E2J J;  2DMN A;  1NTC A;  1VQN I;  2E60 A;  2W24 A;  3RPQ A;  2BHZ A;  4NQW B;  2HQ5 A;  2NVU B;  1WRJ A;  4M74 A;  3GLX A;  5FLX Z;  2FMY A;  2RV8 A;  4XLN F;  4ZJZ A;  4BEH B;  5AIP A;  3CDI A;  1A04 A;  1D0X A;  3DBH B;  1DP7 P;  4XSZ F;  3CME I;  5CVV A;  1JI8 A;  2HDD A;  1U5T C;  3AFH A;  3DXJ F;  1ZG5 A;  2ZFW A;  3NAU A;  3HOV J;  2IS4 A;  3BR6 A;  4DYQ A;  1OKR A;  3J80 K;  3R61 A;  2LDU A;  3BJO A;  5FFZ A;  1UST A;  4CUG A;  1WFX A;  2ECB A;  4CZC A;  2LKX A;  2DMT A;  4H0E A;  4DZJ A;  1SD5 A;  3HRS A;  2L2O A;  4IQJ A;  1OYW A;  1AOY A;  2XB5 A;  3Q9V A;  4I0B A;  2DOF A;  2EZH A;  2R3S A;  4MTD A;  4YFK F;  2OQR A;  2HOE A;  4L9N A;  1Z6T A;  3RDI A;  3CCV I;  3K2A A;  1R5G A;  2M30 A;  2FNP A;  2DA1 A;  4LK0 F;  3LAJ A;  1PP8 F;  1E2X A;  4MLO A;  1R00 A;  5BS6 A;  5D8K B;  3S15 J;  3HDD A;  4II3 A;  2COB A;  2BVM A;  2GBY A;  2IAI A;  2KDO A;  2XDV A;  1WJE A;  3OYM A;  2L7M P;  4BJT A;  1APL C;  3LFK A;  1TZL A;  2VLA A;  2P5L C;  2P6T A;  2PMZ N;  3WTV C;  1FYL A;  3LSJ A;  4FAS D;  4WF2 A;  1W1W E;  4PSX A;  1VQM I;  4N9H A;  3JAM Z;  4JK1 X;  4CYC A;  2R7W A;  3VYR B;  4KT5 C;  2E5N A;  1JKO C;  1FOK A;  2FNA A;  4HPQ A;  2QA4 I;  3L2Q A;  2LYC A;  2EFP A;  1R22 A;  5ILU A;  1IXR C;  2L9S A;  1TTY A;  4YEJ A;  3ABL H;  4XIC A;  4UUT A;  2VPR A;  4IHY A;  4A69 C;  2E1N A;  4XRS A;  1XMX A;  3M4O J;  2VAS A;  2GOX B;  4JP0 A;  4LGW A;  2QYO A;  4IO9 F;  4Q5S F;  3OSF A;  1RIO H;  2R5Y B;  4V19 K;  1K79 A;  1ZHF A;  3KP3 A;  4PUS A;  1YRN B;  4HX4 A;  5BQT A;  2QWW A;  3T8T A;  3L2V A;  5TJJ A;  1ETX A;  4AVP A;  1NHA A;  4A3M J;  3A0H C;  1V55 H;  4BJ6 C;  3SQN A;  3FZV A;  1QPI A;  3WHB A;  2ZSI B;  3PSI A;  2HFH A;  4LG3 A;  3CO7 C;  1UZC A;  1O7L A;  1IN8 A;  2EFO A;  3JRI A;  3IHU A;  1OCP A;  3TKY A;  2QKM B;  2V1N A;  2LOO A;  1YW7 A;  1IUY A;  1W36 C;  2COM A;  4RS8 A;  5D5X B;  1Z05 A;  3RPU A;  4B44 A;  2A3S A;  2OBP A;  3HUG B;  2XAG A;  3BZC A;  2ZXJ A;  3QWL A;  3ZQ7 A;  2ESN A;  1X2N A;  1XCV A;  3D5R C;  3H0D A;  2EJR A;  1ETO A;  2EFW A;  2QSF X;  1Y6I A;  5F27 A;  4D7N A;  1ETQ A;  2HPI A;  1W7P D;  2A05 A;  3I71 A;  3P9K A;  4II2 A;  2DT5 A;  3ASN H;  5JLX A;  4XON A;  4UUS B;  1U0J A;  2YX7 A;  3CTA A;  1X3W B;  3FWE A;  3P5J A;  3E6C C;  3A01 A;  3TP0 A;  3KIO A;  4YFN F;  3GZ6 A;  2R7V A;  1ZTR A;  4YIF A;  3NQO A;  4ASN A;  3FBI B;  1HSJ A;  2BEO A;  1IN4 A;  1WPK A;  1D0Y A;  2DA5 A;  3MWM A;  5CQG A;  4NBQ A;  6PAX A;  2R5Z A;  2VOD A;  5D5U B;  1TL8 A;  1DPU A;  2LKP A;  3BZK A;  2Q8K A;  1FJL A;  3QPS A;  3D1N I;  3DTE A;  4KN7 X;  3CO6 C;  4IRG A;  1W4M A;  2X9D A;  2R5Z B;  4IZZ A;  1P4X A;  3ZQL A;  1FSE A;  3CLQ A;  2DQR A;  4IX7 A;  3OYI A;  3HBL A;  1QU3 A;  2P8T A;  1V4R A;  5GP9 A;  2M34 A;  2K9N A;  1IG7 A;  4OIR F;  2FQ4 A;  2F5V A;  1U5T B;  5F1J A;  3LOC A;  1UJ8 A;  2YS9 A;  3GVA A;  1YJN I;  5JHU A;  4KYW A;  4LIV A;  2PFB A;  4B1R A;  2WB1 A;  4UVC A;  1YS6 A;  1O7F A;  2IW5 A;  4XOP A;  4HG2 A;  1BI1 A;  2DK8 A;  2O0Y A;  4A0X A;  1AKH B;  4M72 A;  1P7J A;  4BE2 A;  1P6R A;  4ENJ A;  1LE8 A;  4J19 A;  3U1K A;  3JRA A;  4RB2 C;  2X51 A;  1ITY A;  4OAY A;  3IL2 A;  3IAS 2;  2LR8 A;  3H9J A;  1R71 A;  3OR1 C;  2XSD C;  2VPL A;  5F0F A;  3WU1 B;  3CCQ I;  1BI0 A;  2IS2 A;  2QUF A;  4N0B A;  1SMY F;  1BBY A;  2MH9 A;  3TDU C;  3LSR A;  1J75 A;  5IPA A;  4A12 A;  2BW3 B;  2XKO A;  4Y17 A;  1XN7 A;  1CQT A;  1IRF A;  1QVU A;  1I27 A;  4B3X A;  3JRF A;  2A6T A;  4GGG A;  4IHV A;  1K4T A;  4HRI A;  2VT3 A;  3TO6 A;  4JQF A;  4CYD A;  5KHD A;  1MBE A;  4BDY A;  1BW5 A;  1X1B A;  5FKO A;  2RN7 A;  2GQQ A;  2XRN A;  1YYV A;  4ZDO A;  4KUM A;  2PMZ A;  2HS5 A;  2BGC A;  4L5E A;  4BUP A;  4C3I J;  2R7S A;  1S6L A;  4IVN A;  3H5N A;  3ML6 A;  2KT0 A;  1ZRD A;  1YQA A;  2D45 A;  3BG6 A;  5LHH A;  2WAE A;  2QBY A;  4BE0 A;  1W5T A;  4C3J J;  4G7H F;  1JHH A;  4MHG A;  2Y0S A;  1DGR M;  3JR9 A;  2PJR A;  1U8R A;  4EJW A;  2VT2 A;  2JN6 A;  1VQO I;  3KLO A;  2F5D A;  3QPL A;  2OA4 A;  1JGS A;  2EZL A;  2VKD A;  3ZN0 A;  2Y9Y A;  4BS9 A;  3BR2 A;  2PMU A;  1MBH A;  4LG0 A;  1DPR A;  2V6C A;  3JAM K;  1X4P A;  4BE1 A;  3S1Q J;  4FTH A;  4B48 A;  3REO A;  1EA3 A;  2Z3Y A;  3VWB A;  2UV1 A;  5KK1 A;  4MGR A;  3FXL A;  4DYR A;  3E6B A;  4IL6 C;  3F9K A;  2VQH A;  5FGM A;  1ZAR A;  4Y4R A;  3K4B A;  2E1O A;  4BQA A;  3C18 A;  4ENN A;  1YX3 A;  1R36 A;  4X6A J;  3NEU A;  1X58 A;  2HOS A;  3ZQG A;  1G3S A;  1ZK8 A;  1Y1V J;  5GAD J;  4RGU A;  3I55 I;  2CUZ A;  3VB2 A;  1XGS A;  3S1N J;  4KMF A;  2XHK A;  1J0R A;  5ILV A;  3MKY B;  1JTX A;  4E7I A;  3JCU C;  1HBX G;  2EIN H;  3HZJ A;  3O6B B;  3V7R A;  3RQ4 A;  2DOE A;  2M2E A;  1FEX A;  3OIQ A;  3FXQ A;  3C2B A;  1Z21 A;  1U5T A;  5EDN A;  5C4J J;  2AQE A;  3I5U A;  3HSE A;  5D5W B;  2E1M C;  3PJR A;  4A5M A;  2HR3 A;  2ZME A;  3C7J A;  4FHT A;  2DQL A;  1SD4 A;  4BKX A;  1GVJ A;  5DS9 A;  2GWR A;  3B73 A;  2OU2 A;  5K5Q A;  2OTJ I;  3K10 A;  1T2K A;  4A3L J;  5LGU A;  3OYE A;  2MA3 A;  2RC4 A;  1FX7 A;  3KP4 A;  3S32 A;  4KDP A;  1MBK A;  3L2U A;  1UEL B;  2ME0 A;  1D1C A;  2LD5 A;  1IUF A;  2EA4 A;  3MKW B;  1OJL A;  2LG4 A;  3MMY B;  2EBI A;  3CCM I;  1A5J A;  3MZ8 A;  4MEY F;  3F8M A;  1JUS A;  3HJE A;  4CIC A;  2XAU A;  4BAC A;  4U7D A;  2E1C A;  4RMN A;  5L3B A;  2LP0 A;  2MFZ A;  1EKE A;  1YO5 C;  2K9L A;  4YII A;  2ACJ A;  1WI3 A;  2GXB A;  5AON A;  2OPT A;  2LMD A;  3MD2 A;  4NHJ A;  3HGY A;  2DDB A;  3ZMZ A;  1JT6 A;  3M8E A;  2WY8 Q;  1B1B A;  4LIU A;  1A35 A;  5EEA A;  2HOA A;  1QNT A;  1LE8 B;  1N77 A;  1O3S A;  4U0Y A;  1GVD A;  3U9G A;  1IV8 A;  1MDM B;  2GOM A;  3S1M J;  2BYV E;  2XF5 A;  3K1M A;  1WQ2 A;  1MBJ A;  1KGS A;  3QOD A;  3KP5 A;  4BY1 J;  5B1A H;  3CUO A;  1JUP A;  4PGH A;  2DI3 A;  1LFU P;  2ISZ A;  2CYY A;  3IRR A;  4R79 A;  1FBQ A;  4O3M A;  1ULY A;  4MIM A;  1WJB A;  3E5Q A;  1BJA A;  4E6K G;  2A07 F;  5C3E J;  2IGN A;  1R5H A;  3FF5 A;  4WXC A;  4HBL A;  3T8R A;  4JYK A;  4N4N B;  1HOM A;  2TCT A;  3OSG A;  3BG7 A;  1QZY A;  3IUO A;  3ZRG A;  5EGO A;  2QSG X;  2DYR H;  4UY8 I;  1T08 B;  3KCC A;  1RNL A;  2AXL A;  2ESH A;  3HTU A;  2IS6 A;  1KON A;  2HVR A;  3CDH A;  4M3F A;  3ZGK A;  3L7W A;  2MH2 A;  1JJ8 C;  3KZI C;  4I02 A;  1VTN C;  5ED4 A;  2B63 J;  2V1X A;  2O61 A;  1BR1 A;  3E6M A;  1LDD A;  1SAU A;  3ZCO A;  4G9Y A;  1SD6 A;  4PJL A;  2H1K A;  4GYG A;  3FXM A;  1LUJ B;  2FBH A;  1N25 A;  2LNB A;  1PUE E;  1FTT A;  3B6C A;  1D3Y A;  1OQY A;  3LST A;  2HVS A;  2LTP A;  2OV7 A;  2K9M A;  3P7N A;  4Y33 A;  4DW6 A;  1JJ6 C;  1GV2 A;  3GX4 X;  2IRF G;  3CP2 A;  2R7O A;  3ESW B;  5L3C A;  2NXN B;  4AID A;  2L7K A;  4XN0 A;  2E1M B;  2I8D A;  5DDG A;  1LVK A;  4V2F A;  1TQI A;  2XAH A;  4L9T A;  3IV5 A;  1FIA A;  1YTY A;  1S3J A;  2ELJ A;  1E17 A;  4HQM A;  3CJR B;  5HLH A;  3G4S I;  5IT3 A;  4C9Y A;  3ZQF A;  3ZQC A;  2K3F A;  3BR3 A;  3RYR A;  3G71 I;  1XSD A;  4RB0 A;  3NRV A;  3ISP A;  3FMS A;  2JA7 J;  2CO5 A;  2BVL A;  2VI6 A;  4Z2Y A;  3IC7 A;  5LEK A;  5GTI C;  4UB8 C;  1S7O A;  2BY2 A;  1ZRC A;  1H9T A;  2MSY A;  1R58 A;  4FE7 A;  1S8N A;  2P5V A;  5HLT A;  4KA4 A;  5ILS A;  1BJZ A;  1XB4 A;  3WE2 A;  3LSG A;  5EEH A;  2LRE A;  4UXN A;  3S2W A;  3SFI A;  1SD7 A;  1ODD A;  2I5U A;  5E3O A;  1T39 A;  2XGC A;  2P7C B;  3VYT B;  3L09 A;  2BHY A;  4IRI A;  1MMS A;  1PUF A;  4F7Z A;  2X6Y A;  3E97 A;  5HS7 A;  2LY1 A;  1XCB A;  4XID A;  3DFG A;  4XLH A;  3VYS B;  4G94 A;  1Z91 A;  2JVG A;  1WJF A;  3HPH A;  5H2F C;  5CVJ A;  4O6J A;  3O8H A;  3E5U A;  2CG4 A;  1MJ9 A;  3B6A A;  4PFP A;  4GRI A;  1MD0 A;  4PGG A;  2K9Q A;  3SDG A;  3F23 A;  3X2Q H;  3R0J A;  2CJJ A;  3ELK A;  2I10 A;  4EEF G;  1OCR H;  4DBQ A;  1CF7 B;  2O9L A;  3K2Z A;  4CGZ A;  4R1H A;  3CJT B;  5HVQ C;  2MLG A;  3S16 J;  2Q2E B;  4NQW A;  4D5C A;  4BQQ A;  4ZH4 F;  1TQM A;  3M9A A;  4BBS J;  3S2H J;  5K1Y A;  2YR2 A;  2CUE A;  1W36 D;  1U8B A;  2QQ8 A;  2NVX J;  3G2B A;  1IJW C;  3F8N A;  3GF2 A;  1QRY A;  4E7K A;  3G3Z A;  3FIW A;  2CQX A;  3KP2 A;  1DQU A;  1TP4 A;  1K6Y A;  2QKL B;  3ECO A;  3KEY A;  3WE3 A;  1GXP A;  1K78 A;  1FC3 A;  1A6I A;  3I59 A;  4XKW A;  3JTG A;  3I54 A;  4FCY A;  5KVR A;  1OPC A;  2JUC A;  1T56 A;  1TWG J;  2O03 A;  3LA2 A;  2ZB9 A;  4UV8 A;  3HGG A;  3ZMS A;  1ZRF A;  4Q48 A;  2W57 A;  4H4K C;  3D5S C;  4HEA 2;  4B3A A;  3AKZ A;  5E79 C;  1IC8 A;  3S3O A;  4E7J A;  1BL0 A;  4XK4 A;  1X3Z B;  2P6S A;  3HKZ A;  1LKX A;  5EZH A;  2XPU A;  1S9H A;  3FXK A;  2HZT A;  1MNM C;  2FEZ A;  2W48 A;  1F43 A;  5J1R A;  2MYS A;  2HGC A;  2XGE A;  2R92 J;  2DOA A;  4PCQ A;  3M07 A;  5ICC A;  2LFB A;  3W3C A;  1O3R A;  3C2H A;  4M3E A;  1FNN A;  2BY0 A;  1D8J A;  4U0W A;  3QYB A;  4NUB A;  2VKE A;  2X4H A;  3LA3 A;  4HLX A;  4CCO A;  3ZQQ A;  3IP4 B;  1VZ0 A;  4BDZ A;  5IP6 A;  1W7P A;  2CW7 A;  1VQL I;  1XGM A;  2DPD A;  2D2W A;  4I09 A;  2ZJ2 A;  4CH7 A;  4KIF A;  3L00 A;  2X6W A;  2H94 A;  3KPH A;  4EJV A;  2PI0 A;  2KJB A;  3IRQ A;  3A02 A;  2XF6 A;  4U7B A;  4ZYG A;  4JOM A;  5J3L A;  4BQO A;  2V6E A;  1T0F A;  3EET A;  5H6Q A;  2G7U A;  1XC5 A;  2EFQ A;  4LLL A;  4RDU A;  1YRN A;  4RB3 C;  1N78 A;  3ZP5 A;  4U0V A;  3A4C A;  5JVG F;  1ERD A;  2ZKZ A;  5A2Q Z;  1V5E A;  2BBY A;  3ERM A;  1G2H A;  2KIF A;  2W82 A;  4YIR X;  1FSH A;  1HQC A;  1ZR2 A;  5DM7 F;  3CCE I;  2QEN A;  2LVS A;  2VXZ A;  4A3J J;  1GXQ A;  3A0B C;  3HPG A;  5B3S H;  2D5V A;  4X0G A;  3LQQ A;  2NVQ J;  1M1E B;  3QPH A;  5C4X J;  4Y15 A;  1GUU A;  4PJN A;  2EWN A;  2MAB A;  4PZJ A;  4IF4 A;  1W0U A;  3HHG A;  5FKM A;  1OLT A;  3CES A;  1MDM A;  1UG0 A;  1P7I A;  3CF2 A;  1K7A A;  3Q0U A;  4ESF A;  1IN5 A;  5HNF A;  1TT5 B;  4ETS A;  1PYV A;  4F91 B;  3G6E I;  2KRF A;  3DKX A;  1YJW I;  2RQP A;  3DP7 A;  2KHM A;  3BJ6 A;  4UUV A;  5JLW A;  1R9T J;  2W25 A;  1QA6 A;  5H20 A;  2J5O A;  2IVM A;  1RRJ A;  1DU6 A;  4A5N A;  1JT0 A;  3M1E A;  1SFK A;  1R6R A;  5J47 A;  3BQZ A;  3WTS C;  2Y31 A;  3DKW A;  3DF8 A;  5K5O A;  4RAF A;  4M9Z A;  3O3K A;  5KNL A;  4KIC A;  1NG7 A;  1X4O A;  3DPT A;  1ON2 A;  5BMZ A;  5IOY A;  5HS8 A;  1HW5 A;  3GFJ A;  2EH3 A;  3FXU A;  3HRT A;  2QQA A;  3R4K A;  1MH4 A;  2F4I A;  1XS9 A;  1V5F A;  2LY9 A;  2WY7 Q;  4B47 A;  2HDW A;  2VKV A;  3I56 I;  5KAI C;  3DKY A;  2L02 A;  1KU2 A;  2CQN A;  3K9T A;  5B5E C;  1LEB A;  2BZT A;  3WOD F;  1YLF A;  1I3Q J;  1UCR A;  2ZME B;  4EJU A;  1Z7U A;  5DM6 F;  1MW7 A;  2R7X A;  1ZYR F;  4UB6 C;  1TNT A;  3C3W A;  1Z0X A;  1BI3 A;  4G12 A;  1IO2 A; 
#chains in the Genus database with same CATH homology
 1VQM I;  2ZJQ F;  1YJN I;  3CC2 I;  2ZJR F;  1VQ9 I;  2QEX I;  3CF5 F;  1VQ4 I;  1VQ6 I;  1FOW A;  3CCJ I;  3CCV I;  3CME I;  1YI2 I;  1YIT I;  2FOW A;  5DM7 F;  1QA6 A;  1VQK I;  3CCE I;  3J7Z I;  1VQL I;  3CCL I;  2QA4 I;  1YHQ I;  2E34 A;  3I56 I;  3CCR I;  3CCM I;  1VQO I;  1S72 I;  2JQ7 A;  5GAE J;  2OTL I;  3G4S I;  3CC4 I;  4IOA F;  2K3F A;  1MMS A;  3G71 I;  3J7Y J;  1FOY A;  3CMA I;  3PIP F;  1YJ9 I;  3G6E I;  1VQ5 I;  3CJT B;  2E35 A;  2H8W A;  5GAD J;  5DM6 F;  4UY8 I;  1FOX A;  4IOC F;  1VQ8 I;  2OTJ I;  3I55 I;  3CCU I;  4IO9 F;  1YIJ I;  1VQN I;  1HC8 A;  3CC7 I;  3PIO F;  2ZJP F;  3CCS I;  2NXN B;  3DLL F;  1VQ7 I;  4V19 K;  1ACI A;  5GAG J;  3CCQ I;  1Y39 A;  5GAH J;  1YJW I;  2E36 A;  3CD6 I;  5JVG F;  1VQP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...