3CCSI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccsI00
1VQMI 5DM6F 1VQ4I 2E35A 1VQ7I 5JVGF 1VQ8I 3I56I 3PIOF 1VQNI 5GADJ 3CCUI 2E34A 1YJNI 2E36A 2QEXI 3CCLI 2OTLI 1YJ9I 5GAGJ 1VQ9I 3G6EI 1VQLI 1FOXA 2QA4I 3CF5F 3CCVI 1HC8A 3CMAI 1YJWI 5GAEJ 2ZJRF 4IOCF 4IO9F 3CC4I 1VQ5I 1ACIA 5DM7F 2OTJI 3CCJI 3J7YJ 1QA6A 3CCMI 2FOWA 1FOWA 1FOYA 3G71I 2H8WA 1YIJI 1VQOI 1VQ6I 3CCSI 1Y39A 1S72I 1VQKI 3CCEI 1YHQI 3CCRI 2JQ7A 2NXNB 3CC7I 3CMEI 3CCQI 3J7ZI 3G4SI 4UY8I 1MMSA 3CD6I 4V19K 3I55I 5GAHJ 3PIPF 2ZJPF 2ZJQF 1VQPI 3CC2I 3DLLF 4IOAF 3CJTB 2K3FA 1YI2I 1YITI
chains in the Genus database with same CATH superfamily
1X3WB 4HSTA 1HCRA 4B47A 3QP5A 2QBYB 2XRNA 1NHAA 1K4TA 2MLKA 4M6VA 1HBXG 4A3GJ 1HW5A 4IHWA 3JW4A 4PJNA 3M4OJ 2PG4A 2YSRA 3D5RC 4MTEA 1FBQA 1KU7A 1FPQA 1P9QC 3CO7C 5M5YJ 5HLHA 2JK3A 2MBFA 4U88A 4N9HA 2IS6A 1VQ9I 2TDXA 1FOXA 3HBLA 3ROUA 4YRVA 3CF5F 1K79A 2L2OA 1R1VA 3K4NA 3CDIA 2PMZA 1QHHD 5C4JJ 3VYRB 4GCVA 3COAC 2A61A 3UR3C 4MLOA 1WI3A 1OLTA 3ZN1A 4EGYA 2IRFG 2VBWA 3GZNB 3CCJI 3ZRGA 5GTHC 3WTTC 4AVZA 2HTJA 3GLLA 4M71A 3H0DA 1QA6A 2CW7A 2Y75A 3GFIA 1BJZA 5J1UA 1EKEA 3MD2A 1ETKA 2E7WA 1T38A 1LUJB 1OQYA 2OF7A 2ZSIB 3HHGA 2JVHA 3BR1A 3CCYA 4H0EA 1RZ4A 3BG6A 4KUMA 2E1MC 2GOXB 3AG4H 3DEUA 1FTTA 4ESJA 1YHQI 4LMYA 2L01A 1R5HA 3LAJA 4MEXF 2DQLA 1WFXA 1O4XA 4EJVA 4XLNF 1STZA 4CYDA 4UB6C 3GTMJ 2C6YA 1WJEA 3ZQ7A 4XK4A 4WWCA 2R7TA 3BZCA 5JLXA 2XKOA 2Y9ZA 1MIJA 2BE5F 4A0YA 3DKWA 5D5XB 1W5SA 4BKXA 5J47A 2M30A 3U1DA 4BACA 1MMSA 5FFZA 1T2KA 4L9JA 5GPCA 1LEBA 2LR8A 3VSKA 1IN7A 2HXOA 4DYQA 1B9NA 2ISZA 4C9YA 3EYIA 3H35A 3BROA 2KMUA 3N05A 3WE2A 3W2AA 1LEAA 1ON1A 3R0AA 4ZDPA 2OZ6A 4XOTA 2V9PA 1IV8A 1F5TA 1T98A 3F8NA 3ZXSA 4DIQA 3FXUA 1N77A 5DCMB 3DEWA 3NEUA 4IKFA 1HF0A 2PMZN 4IRGA 2L7KA 3IH2A 3OYGA 3VSLA 1VQMI 3I64A 4M74A 1S7OA 2Z3YA 4XN3A 5LEJA 3HRTA 1QVTA 3S8PA 1V5FA 3F8BA 2DMPA 2L7MP 4AIHA 1AWCA 5CPRB 5JHFA 5DYMA 2PLYA 1VQNI 2DA3A 2XAGA 2STWA 2QKLB 2F4IA 2WTEA 2XAQA 5LBQA 1E17A 2VJIA 5M3MJ 4U0YA 3QU3A 4Q47A 1P6RA 3K1NA 1XTAA 3EPZA 1OCOH 1I5ZA 1IRXA 3KCCA 4ZJZA 3P7NA 4F3QA 2BY1A 2QENA 5GAGJ 1BI1A 3D5LA 4RDUA 2DTRA 1K78A 3IAS2 3QYEA 5CQGA 3BR6A 3BT9A 1ZR4A 4PSXA 1AHDP 1H9GA 3RZDJ 2UZKA 2DMQA 3R61A 2LLKA 1ZK8A 5E8IA 4IHXA 2OJED 4BHCA 1Y0UA 3CJRB 1ZGJA 1SD4A 3F72A 1D8JA 1ETXA 2BVMA 5FLMJ 3RKWA 2X51A 2GLOA 5DS9A 4U7DA 5J4VA 2VL8A 3EQLF 5K7FA 1AU7A 1GDTA 1PVEA 4EATA 1GUUA 3FIWA 1YW9A 1T33A 1S29A 3ZR8X 1LKXA 2VN2A 3P9KA 3ERED 3M8EA 3VFZA 4IXAA 2HPMA 1DP3A 2HZDA 5HS7A 2EZKA 2DPUA 1D5YA 1FOYA 2K9NA 1FEXA 2ME0A 3OYNA 2XAUA 3S3NA 4HEA2 2BGCA 4FE4A 3IV5A 3CESA 1K61A 3BOQA 2QVOA 2P0WA 2W85A 1WVRA 1FBUA 3PJRA 2JN6A 3SYTA 2CYYA 1FBSA 1LFUP 1IG7A 4BQNA 3LQQA 3LL7A 2DO7A 5F04A 1HW2A 3JR9A 1I6XA 2DYRH 3TDUC 4HF2A 2QUFA 3CC7I 1IZ1A 4CICA 1TBXA 4OINF 1UMQA 3TO9A 2BV6A 3ZQFA 3OYEA 3OYBA 1D8KA 3FXMA 4X6AJ 1GXPA 5ILSA 5CYVA 1OCTC 1I6HJ 2WAFA 5EZGA 2ZFWA 1A6IA 3ABLH 4M3FA 4X1EA 3PIPF 4LG0B 4EJUA 3F6OA 1DGWY 2QZ8A 4L9NA 4QSHA 1Z3YA 3CC2I 1U5TB 4KYWA 3HOYJ 5HNHA 3T8TA 2A5WA 2CFXA 2E2IJ 2VKVA 4OAZA 4W97A 5AIQA 4O5VA 4XKCA 4XBFA 3L09A 2IA2A 5KK1A 3RIRA 4GXOA 2XGEA 1Y8QB 2K5CA 2V4JC 1POGA 1LDJA 3QYFA 2DOFA 4NHJA 5E1XA 2WA0A 1MSFC 2JZYA 3M8FA 4YELA 3MKZA 2D45A 1J5YA 2XSJC 2X6YA 1B8IB 1YS7A 4BE0A 2W82A 2BVLA 5E3MA 1S7AA 2KT0A 2BBYA 3B6CA 5KHDA 4OIQF 2X48A 1H9TA 3K6GA 4HW0A 2EINH 1Z05A 1IXSB 5D5UB 1GT0C 4AWXB 3HOSA 1RKWA 3MEXA 5IT9Z 3CCVI 2ZMEA 1JGSA 2EJRA 3ZMZA 1IAWA 3I71A 1VNDA 3O8GA 1JKPC 1DPRA 3V42A 3QU6A 2DCEA 2OCEA 2KRHA 2ZNYA 1ONVA 1S7EA 3A03A 1HSTA 4UUVA 3H0GJ 1RPWA 2KIMA 1B4AA 1WI9A 4QPOA 2R5ZA 4IO9F 1LDKB 2JA6J 5DM7F 1LQ1A 1A36A 2W4SA 1UG2A 1KZHA 1SFXA 2XB5A 3CCMI 4F7ZA 4CYCA 2EFNA 4GYIA 4Y4RA 4I0AA 5TRDA 3HB9A 3K10A 4A69C 2H8WA 1UAAA 2B0LA 5FKNA 3DFGA 4UVAA 5HS9A 1H89C 3LA2A 2KIQA 1O3QA 3JRHA 3U2RA 1MJBA 2YPRA 3NWTA 3BJOA 4RB0A 5L3EA 2PJPA 4C3IJ 3GCMA 3AG1H 3FXRA 2XRLA 3OYIA 3OYCA 4GFBA 4E7KA 3JSPA 4DOZA 4FISA 3SFIA 5F08A 4U87A 2RV8A 2R93J 4YG2F 4EJOA 2EWNA 2M34A 3CCQI 3GFLA 2IEKA 2L9NA 1SEUA 2ZMEC 3GW2A 2M2EA 4J01A 3E6MA 2X4HA 1Z6RA 4P55A 4E7IA 2X0LA 5CVIA 3VEPA 4OIPF 1S8NA 3LFUA 5JLWA 3WG7H 2P7VB 2HS5A 3UNGC 1XDUA 1FZPB 2IGNA 2K9MA 2XPVA 2V1XA 5LRSA 4II2A 3A01B 2IT0A 3E1SA 4YIFA 4A6DA 4DJAA 3ASOH 4FE7A 1OISA 3WTUC 3BJAA 1XD7A 3J80K 4IX7A 2HNHA 1M1EB 2L5QA 2D1HA 1IRFA 2P6TA 2G0EA 3T8RA 4OMYA 3H5NA 1I1GA 1O57A 2P8TA 2CV2A 2XSDC 1ZG3A 2EV5A 4PJJA 3TOBA 3QPHA 2KDOA 3QPLA 3ZQQA 3OYLA 2FUG2 3DF8A 1ZN2A 4I01A 4KMFA 2B9SA 3F22A 1G3WA 2F5FA 3S2HJ 3F8FA 4HG2A 2V1NA 4RGUA 4CA0A 5EGOA 3L2UA 1Z0XA 4IQ4A 1YE9A 2NVTJ 3GTKJ 3LA3A 1MBEA 2X9DA 3MZHA 3KZIC 3ZOBA 1U8BA 1FJLA 1UHWA 3DV8A 4XIDA 3L1PA 3IAM2 2JUCA 2IS1A 2WV0A 2K9QA 1TW3A 3SDBA 1FMVA 1B72A 1I3AA 1E0EA 3CP8A 2QSFX 3O8HA 3CUOA 2FOKA 4A6EA 3J81Z 2KRFA 5EG0A 3ZP5A 3WODF 3OSFA 1R1TA 1V5GA 1NG7A 3C7JA 4KICA 1MDMB 1R00A 5D6FA 2HYJA 2DA4A 1IF1A 2VUMJ 1QZZA 3CJQB 4XLCA 3P5JA 4AIDA 3DPLC 3HRUA 3CCEI 3KP2A 1BOBA 2LG4A 2ZXIA 4NQWA 4PGHA 2IGMA 3BC8A 1YW7A 4FETA 6PAXA 4MQ9F 1TQPA 2CUZA 1WJAA 4GRIA 1BR1A 3C2HA 1ZRCA 2VBZA 3TW7A 3H1CA 3HEFA 4M9SA 4M3GA 1F36A 1R5GA 4BHBA 3J7ZI 3FX3A 2XHKA 5J3LA 3G4SI 4A3MJ 2N8GA 2R4GA 2HDDA 1S3JA 4U0WA 3RYRA 1X2MA 3CD6I 4JBAA 5FROA 4M3BA 4LJZF 3JAMK 4EGZA 1WSUA 3LSRA 2ZFUA 2OC6A 4HYEA 1UJ8A 2O7OA 4M9XA 3QPTA 3CDLA 4PDKA 4KT5C 3OYMA 2HYFA 3GMEA 4KISA 1BIBA 3ZMTA 3RI4A 4W1UA 1LE8B 2CU7A 3TW6A 3BR3A 3K9TA 1B1BA 4XLAA 2DPDA 4L5EA 4XKVA 4D9JA 3NQOA 2HOTA 3SEZA 1ZLKA 2LP0A 2VJJA 2CJJA 4K2EA 1Z67A 2DODA 4FTHA 2V1UA 1W7PA 1MMDA 2CUFA 4EMSA 1ZG1A 4FX4A 1D1AA 1W0TA 2CMPA 4LLGF 3D5SC 4IF4A 4O3MA 5H6QA 2DFIA 2M9HA 1YX3A 2NVYJ 3I4MJ 2R92J 1HDPA 5EZHA 3BZ6A 4Y33A 3M07A 5F1RA 3F8MA 2CQNA 1UHSA 4RAFA 4KDPA 4NC8A 5A2QK 3FKJA 3BPVA 2QQ9A 1HC8A 5LEKA 2WB1A 5D4RA 1DUXC 2RNGA 1UHMA 3L7WA 3I4NJ 5FRMA 1MMGA 3IH3A 1X1AA 1KONA 2FBIA 2HU9A 4LLLA 2CV0A 3OIOA 2OPTA 2QQ8A 4P1WA 2WC2A 1VQ5I 3TOAA 2UXNA 4JYKA 4MHGA 1HKQA 3SEQA 5HNFA 4E4HA 3AFHA 4A3CJ 4A3IJ 1MD0A 2QCOA 1XN7A 3S1RJ 2HPIA 2L9VA 1TP4A 2Y48A 4A3LJ 1DDNA 1OCPA 3E0JB 5E3NA 1T0FA 1I39A 3GBGA 1YOVB 5H6RA 4ENJA 5B1BH 1X2NA 3JRGA 5ED4A 4XN0A 4KFCA 3HSEA 3F9KA 4EM1A 4WX9A 3OS1A 4B44A 5E3OA 4U7BA 3M7GA 2BY3A 2K85A 3MCZA 4E70A 2VKEA 4ZC3A 3MN2A 5J40A 1IO2A 1D0YA 1BL0A 3JRBA 2FD5A 1IC8A 2UWMA 2E1CA 1T6SA 3OY9A 1JKRC 1GV2A 2EK5A 3SHFA 4ZYAA 2HDWA 4CZCA 3GUDA 3HOZJ 4BL0B 1YQAA 3S17J 2UXXA 2GXBA 2L02A 2CV1A 4R79A 3V7RA 4IHSA 2RC4A 3EDPA 2DI3A 2MW8A 2X1DA 5E3LA 4CXFA 1LJ9A 2WB1N 2ZO4A 1E3OC 3E6BA 2LBFB 2R7UA 2P6SA 1RRJA 4J00A 3R4KA 2DYSH 3BTCA 3KP3A 1TL8A 1TW2A 1T0FC 3JTHA 4E7JA 2Q8KA 2F5CA 1E3PA 3K4CA 4YFXF 2Z33A 2DT6A 1OCZH 3OIPA 2WY8Q 1DGRM 4RAGA 1KQ0A 3E6DA 5CVVA 5E20A 2OUMA 2G7HA 2K9LA 2LY2A 1LVAA 5HDNA 2Y31A 3ABMH 2LMDA 1ZR2A 2W84A 3FXLA 1SD5A 3E5QA 4NC6A 2F5VA 4BQOA 4XKBA 1SFUA 1T39A 3E7LA 1VQLI 3R60A 3ZN0A 1OYWA 1LVKA 3HC7A 3WTZA 3V8KA 3QRFF 3FHZA 1FMWA 2ELHA 3DEEA 2VPLA 2FX0A 3MKYB 3JTGA 4NBQA 1YYVA 3FXKA 3DPUA 3HOVJ 1XGMA 2BW3B 4ENNA 2KFDA 4GO1A 1TWCJ 2LTPA 3FKIJ 2HVRA 1ACIA 1IDZA 3TBIA 1EH8A 4M6XA 3TQNA 4BGDA 4B43A 1GVJA 4S04A 3K4BA 5HLIA 5H20A 2FJ1A 4MGRA 3A0HC 1O7FA 2LH9A 4QTRA 4BBSJ 5FLVA 2QQBA 2P5KA 9ANTA 4BDZA 3J7AO 4RGSA 5BQTA 1VQ6I 1YTYA 2JMWA 2HVSA 3FXJA 4R8HA 1S72I 2L3DA 1MMNA 5JVTA 2GIVA 4L0YB 2VXZA 4MFEA 1LFBA 3OV8A 2R7ZJ 3L2RA 1ZAOA 2YX4A 4IPAA 3ELKA 3SZGA 5HDGA 1FIAA 2G9WA 1XX5A 2JPBA 1XMAA 4HX4A 2RVCA 1TNSA 1V5EA 1IXCA 2CH0A 2LY9A 3G73A 2WV1A 1B59A 4BQQA 3ZGKA 1PP8F 3LSHA 1HKSA 4QWQA 3V4GA 5ICEA 4RB2C 1G3TA 5AIPA 2E60A 4DGWB 5IPAA 1REPC 4Y7NJ 4RA2A 1Z7LA 3AG2H 1YFHA 1FYKA 5KNLA 2YUSA 4UVCA 2KISA 1IJWC 5FRNA 3HIFA 4M9ZA 2NYXA 4DBRA 2ZJQF 2LFBA 3BQYA 2MH9A 2VASA 3OL3A 1G4DA 4IEJA 1RR8C 1W5TA 2H6CA 4A3BJ 1MMAA 3FDYA 2FQ3A 3I0TA 2BY2A 3KX2A 3BTLA 1SFOJ 3HYIA 4B4CA 2O3FA 3LAPA 1A31A 2CRGA 3DKYA 3HOXJ 4RB3C 1D3YA 3G1LA 3KYCB 1ZKGA 4JP0A 2RNJA 3ZQCA 3Q5FA 3WGHA 5FKLA 4KT6A 2VE9A 4XSXF 4KIBA 3HRSA 1O7LA 5IP6A 3KLNA 2ZCWA 2MABA 2Q2EB 1X3ZB 1RIOH 3A1YA 1KYZA 1JUPA 1YJNI 1MH4A 2WAEA 4BU2A 1BI2A 2JRTA 3KP6A 2QEXI 3ESWB 1BN5A 1TQIA 3VOEA 2IPQX 3P9CA 4YFKF 3GYHX 1SVLA 2CG4A 4EM0B 2E2JJ 1YS6A 2AO9A 3TO7A 1WJDA 2MYSA 5EEHA 2V6EA 3HJEA 3SZTA 5LHHA 1R71A 1W36C 4MIMA 1SD7A 2ZSHB 2WAQA 3ABKH 1UB9A 5HOOA 3KYLA 5CQEA 4XICA 1JT6A 2KPMA 2VT2A 4GYGA 1T08B 5GPAA 2IP2A 2OD5A 2EZLA 1MGTA 4UNOA 1WJFA 2ESNA 3RKXA 4ZDLA 4NUBA 1ETQA 4LIUA 3TEDA 3K4MA 3CJNA 1Y6IA 2VLAA 4CHUA 1TT5B 2FF4A 4C3HJ 4LK0F 3FISA 3CTAA 1MNEA 4PK4A 4XLHA 3EETA 2E1MB 1RI7A 2D1VA 2DA2A 1KU2A 3T0YA 3GEZA 3RZOJ 2DT5A 3C2BA 1IN4A 2EV6A 2XDVA 3OIQA 3T5XA 2ZKZA 2RQQA 1BA5A 1FLIA 5ICGA 5JFRA 4KA4A 1JTYA 2VI6A 1P7JA 2AXTC 1FX7A 1PUFA 5DTDA 4ANJA 5GTIC 4A2UA 2X6WA 4CO8A 2VQHA 3O6BB 1JT0A 2RGVA 1BR2A 1MH3A 4BEHA 4CCKA 2DTZA 2K40A 3IP4B 2NAZA 3E5UA 1XC5A 4PJ0C 2UUZA 4RB1A 1L3LA 3SXYA 1RNLA 1ZRFA 2DU9A 3RSNA 2ZXWH 2DMNA 1V54H 3IC7A 2FEZA 3FBIB 2OQRA 4YIIA 3LSMA 2LNBA 5D5WB 3W3CA 1Z6TA 3RPUA 4XLPF 3WGGA 5L3CA 3ECHA 3RCOA 1K6OA 2MD0A 3DQVC 4DW6A 1OCRH 1G3YA 2PJRA 2WAQN 3Q3SA 2DFEA 3LSPA 3GTPJ 2O6GE 1JXSA 2H27A 3RPQA 3PFYA 2DJIA 3I56I 4XRSG 1P4XA 3G1OA 3HPGA 3I54A 1GXQA 5M5XJ 3BZKA 3KZYA 4KN4X 3WGIA 3BTIA 4LG3A 2QSHX 1U2WA 2E34A 5L3BA 2JSPA 5HODA 2KLOA 4ZDOA 1IDYA 1U9OA 1BC7C 3ZMDA 3R0JA 2KJBA 1YIOA 4LIVA 2F48A 4KNYA 3W6VA 3L00A 2M1BA 4YFNF 3MVPA 4G12A 3I59A 5GP9A 5ICCA 3FXQA 1PDNC 2QA4I 5F27A 2EFOA 2XC7A 1ZLJA 4A3DJ 2HFHA 1LB2A 4AVPA 2QSGX 2XIGA 3K2AA 3CMAI 4PZJA 1YJWI 1QQIA 1BW6A 3WTYC 2GBYA 3L2QA 5DV5A 3A2KA 4L9VA 1P4AA 2ELJA 1ORKA 1IUFA 3GX4X 4D7MA 4LOCA 5FD5A 1AKHA 1X58A 1RESA 2LOOA 2GXGA 1SMTA 3GZ5A 2X85A 3CMYA 4F55A 1BR4A 1ZGAA 1FC3A 1YIJI 4AM3A 1QNTA 2R7FA 1ZQ3P 3BJ6A 3CCSI 1WZ2A 3TGNA 1G59A 3CQZJ 4HX7A 4XNFA 2M8EA 5K5QA 4HNVA 5LD2C 3N97A 3VDXA 1USTA 3HOUJ 4RLQA 2HQNA 4E7LA 2VC1A 4P5OA 4ESFA 1K78B 4BY7J 1QZEA 3H9JA 2XAHA 4ETSA 4CH7A 2DMTA 2B7EA 2ID6A 2XASA 4I09A 3OS0A 5FLXZ 4E7HA 3W6JB 2JJ7A 1GHCA 1FP1D 1XMXA 5L3GA 1MSEC 3RTRA 2EILH 1XGNA 3DBHB 4HV6A 2RKHA 2Z2SB 3H9QA 3LSJA 4H4KC 4NNJA 3HOTA 1FYMA 3PQJA 3CZ6A 3I55I 3DCFA 2A6EF 4J19A 1EA3A 2H1LA 5TGTA 1BIAA 4WXCA 5LGUA 2XKPA 3S3OA 4ZZLA 3ECOA 4N4NB 1SD6A 3KYDB 4XLFA 4LD5A 3GZ6A 4II3A 1FNNA 4XONA 2DXIA 1TLHB 1WH7A 3JCUC 2MC3A 2CQQA 5CVRA 5DUKA 1WHUA 4BXFA 3PNVA 2JT1A 4KN7X 2R7DA 2R7XA 3BLYA 4ENKA 4GGGA 2R7RA 1U78A 1G2HA 2L9SA 3IH4A 4B1RA 1NK3P 2V1DA 2KRCA 2XV4S 2VT3A 2DN0A 2EBIA 3ABUA 1W7PD 3CUQA 3QQAA 5ERIA 3F3XA 3ONQA 1QU3A 3K2ZA 1F9NA 4RAZA 3R6SA 3H36A 4CCOA 4JX4A 2OTLI 4JX5A 1YJ9I 3WHCA 1LE8A 2WY7Q 3S1QJ 3ZQHA 4HBLA 5BNGA 3X2QH 1ZRDA 1FIPA 2P5VA 4L5JA 4HX8A 2FMYA 1A35A 3ERMA 3ZMVA 3Q0UA 3S93A 5B66C 5LLQA 1Z21A 3JRAA 1B6AA 2F6CA 2M4KA 2IS4A 2O0YA 2QF7A 4BJ6C 3Q9VA 4B8XA 1YRNA 2M3AA 2ZB9A 3OR2C 2OV7A 4BY1J 2VB6A 1XCVA 2JA7J 3BG9A 2E71A 4HA8A 3OYHA 4OIRF 4OU0A 1HXDA 4XLEA 2GZWA 3FHNA 4FASD 4L18B 3EUHA 4LITA 4MTDA 2QGUA 3H92A 2V7FA 1ZHFA 2E7XA 4CDGA 2A3SA 3I53A 3K1PA 2EIJH 1SC7A 2FSWA 4HNTA 5EF6A 3DBRB 3CUQC 3DP7A 4FT8A 2V9KA 2JTVA 3OR1C 2M4GA 5E17F 3VPRA 4DZJA 3HPHA 4I0BA 2BXYA 2IA0A 4BUPA 5HLGA 2JQ7A 3VYUB 2IAIA 3IKTA 2Z1DA 2ZMEB 3QODA 4D1QA 4KIFA 4CSWA 1U8RA 2LKPA 3HM5A 2DDBA 3RQIA 3VYTB 3CO6C 3D0SA 3Q0VA 2M7AA 4M3DA 4B09A 1PYVA 4DQ2A 4A3FJ 2FMLA 2R5ZB 4OAYA 5GAHJ 1H8AC 3S15J 2HKXA 2EA2A 1QPIA 4HDUA 3B73A 1B9MA 4A5MA 1XB4A 5DDGA 2NNNA 3K70C 1S5LC 2M87A 5FKMA 1R49A 4BXXJ 2J5OA 4CYCB 5H2FC 3CJTB 2FRHA 3HUGA 2E1OA 2J5PA 4JQFA 1USSA 2F5EA 3ZCOA 2BHZA 1SVOA 1QGPA 2XPUA 3EUHC 3HL2A 2EFPA 3BG3A 2HI3A 2H94A 4N9IA 2VKDA 3ULQB 5B1AH 4MO7A 3PIOF 2VXDA 4AYBA 1EJ9A 3Q9SA 2EZIA 1F43A 3KETA 3WHBA 1KYWA 1Y1VJ 2DFHA 2K4JA 3WTXC 4C2TA 3PFIA 1AOYA 3GLXA 2YX7A 3CCLI 5IOYA 1W0UA 2O03A 1X1BA 1K7AA 3HKZA 4PGGA 5KVRA 4AU7A 2CS3A 3F6VA 3G6EI 3MFKA 5C4XJ 1N78A 5LRRA 4KJZA 3BY6A 2R0QC 2H1KA 1OMIA 1O3TA 5HDKA 3TO6A 4JOMA 2FA5A 2K86A 2V26A 4PJMA 1OKRA 5DCFA 1XSVA 5EDNA 1D5VA 1TWFJ 2LY1A 1SFEA 1FT9A 1XCBA 5GAEJ 1XSDA 3OYDA 2OZUA 3DXJF 4MFDA 2NRAC 1CF7A 3C2GA 1IV6A 2IGOA 5FO5A 5E1ZB 4UUSA 2MA3A 2FXAA 4HV5A 3DKXA 3S16J 3IL2A 3NWSA 1C0WA 3LSIA 2IXSA 1FOWA 2HEOA 1WH5A 1D0ZA 1TTYA 2ID3A 2Y0MA 3L9FA 2DT7B 1Z1DA 2NOJB 3FZVA 2WWYA 4IQJA 2W48A 4B3AA 3OWTA 1VQOI 3KEOA 3S2DJ 1Y39A 3J7AY 1X3UA 2EPFA 2LF8A 3I58A 3J81K 1RUOA 2QBYA 4P9FA 2MH2A 3CP2A 3FK6A 1YW8A 5B5EC 2LDUA 4HOBA 1XS9A 3I5UA 4EJTA 4B3XA 5F6FA 3KE2A 4A0ZA 2R7QA 2ECBA 3AL0C 1TQMA 5EGOB 2W1OA 1N75A 1ZELA 4QLCU 2A6HF 4AYBN 3RJPA 4ZYHA 2KL4A 1Z91A 2LVSA 2M5WA 3IWFA 4KMUX 2VBXA 3JSOA 2BYVE 2L9RA 3RQ4A 1RC9A 4P9UA 1U6GA 2LYCA 4V2GA 1JI8A 3AAFA 1GV5A 2HQ5A 2XVCA 3DU6A 3PO3J 1B72B 2JWTA 5FD6A 2Y0SA 3C18A 2VE8A 3HKZN 2X1CA 5CKTA 2LSOA 1U9NA 1OR7A 4I7HA 2AHQA 3DPTA 2IVMA 2R3SA 2JRMA 4WXHA 1DU6A 4OOIA 5EG0B 4D0PA 1BW5A 2EFWA 3HGGA 4FX0A 2RN7A 2VONA 2JA2A 3OL4A 1YI2I 2NVXJ 2D5VA 4Y17A 2Y30A 2V79A 4OWRB 2Y9YA 3JRDA 3PM1A 1VF9A 5FFXA 3VYSB 4RLFA 3SQNA 2ZC2A 1UCRA 2K9SA 2IW5A 4NQWB 4BQAA 2EV0A 2KKOA 4RM2A 3V8LA 2DA1A 1S6LA 2OQGA 1Z77A 4IHYA 4G6QA 1TC3C 2WADA 1P7IA 2GWRA 1R7JA 2ME6A 2STTA 1ETVA 2RREA 4PCQA 2H6BA 1KQ9A 1KQ8A 2KIUA 5ICFA 4Q4ZF 2HZTA 3ABTA 1ZYRF 4ASNA 1ULYA 1A6QA 2KZVA 4XRSA 3K4LA 2EFQA 1F1ZA 4I02A 3HSRA 1ZREA 3KP7A 3ZPLA 1IN8A 2EQRA 3JRFA 3BG7A 1OR7C 1IUYA 1IW7F 2HKOA 4BNCA 2QKMB 3PL8A 3HGYA 2A68F 3GFJA 1P92A 1D1CA 1HDDC 5IOZA 3GXOA 2OTJI 4HLXA 3J7YJ 4DZPA 2Y0SN 1Y56A 2FOWA 5K7ZA 1RR7A 1LFPA 1XDSA 1W7PB 4RM3A 5F0HA 1LNWA 3RDIA 1OYIA 3A4CA 4PJLA 1UFMA 5DCMA 1K83J 5IP7J 5HLTA 3OYKA 5EEAA 1TT0A 1JUSA 2BHYA 1AA7A 1HW1A 1R6RA 2G7UA 1R4MB 5K5RA 4PSWA 1VQKI 2R5YB 2BZTA 5KAIC 4BJTA 4L5IA 1QRYA 5J1RA 5IYDJ 2E5ZA 3JRCA 3MAJA 3TL4X 2Q1ZB 1YX5A 2YS9A 3QOPA 4L0ZB 2I10A 1WWXA 2CUJA 4UV8A 1CQTA 1TZLA 3FXOA 4AUXA 2R7OA 1O3SA 1DPUA 2NXNB 5CLSA 5B3SH 4WK8F 1EF4A 1NK2P 1WJCA 2PI0A 4Z6YA 3BQZA 4Q5SF 4F91B 1Y8RB 2DOAA 1Y1WJ 4Q48A 1TWAJ 2JPCA 3EUAA 3P9IA 5D4SA 2B63J 4XRMA 4I99C 1MBFA 2HQAA 3BG5A 3IKVA 2M8GX 2L7ZA 4Z2YA 2HOAA 2AS5F 2HTSA 2V6CA 2COMA 4RGXA 3QAHA 1I50J 1JUMA 3RPUD 2XB0X 4Y13A 3ZMUA 4UB8C 1QVUA 2ISYA 5DM6F 1K4SA 1SVMA 1VQ8I 1L0OC 4HQEA 4LK1F 3OOUA 4BXUA 2GA2A 1ZARA 4IJAA 3GTQJ 5FB2A 1VTNC 4D7NA 1MKMA 1GLNA 1QPMA 2PEXA 1UG0A 2E36A 4L9TA 3VB2A 1NH3A 2VOOA 3TP3A 3HTUA 4F52A 1X1CA 2VQCA 2V9VA 3W2WA 2MFZA 3OMYA 2XROA 2BEOA 3L2WA 1QZYA 4ABZA 4WF2A 3S1MJ 2CW0F 2W24A 5JR3A 3WU2C 1WCMJ 2EIKH 4YIRX 4TV7A 3BWGA 4IHVA 1R22A 5AONA 3ZQIA 4WXDA 3B02A 2FQ4A 1SAXA 2COBA 5DD4A 1MBHA 4ZYGA 2RQPA 4HSRA 1D1BA 1ZGWA 4LG0A 1W5CC 1SMYF 1MJAA 4XKWA 3IRQA 1U5TA 3DTIA 3JREA 3H3VK 3LSGA 4XOPA 3L2CA 2R7WA 2O61A 2IA1A 3U21A 3K4JA 4IVNA 2X6OA 1MZBA 2A07F 1JJ6C 5IYCJ 2CSOA 4A12A 5BPIA 1VZ0A 3KFWX 5IY5H 1WQ2A 4RMNA 2FBKA 5L3FA 4UHTA 2M45A 1WGXA 3G2BA 4NDLA 5BS6A 3OYJA 2MD5A 2DAOA 3ZMSA 2ECCA 2PMUA 3MQ0A 1B8IA 2VOPA 2GOMA 1Z9CA 2QQAA 2PQ8A 5EJCA 4CCJA 2PX9A 2L4AA 1YG2A 1BC8C 1NTCA 2AQEA 4BE1A 1MBJA 2HQRA 4NC7A 3KPHA 1APLC 3WU1B 4F92B 1E2XA 3WG9A 1K6YA 2YR2A 4FQGA 2ZJPF 1Q1VA 3QP6A 1UELB 3FM5A 3MZYA 3FMSA 3K69A 3HDDA 1U5TC 5IT3A 1TWGJ 1RUNA 2NVQJ 1RETA 3M9AA 4M72A 2F4MB 3HRMA 3RKQA 2L4MA 1J2XA 3PUBA 4I76A 4C30A 3PSFA 1VQ4I 3FWEA 5JVGF 1IXRC 1WKMA 1ODDA 2XF7A 4Y3OA 1PJRA 4ON0A 1JJ8C 2P81A 4QIWN 3OYAA 1JGGA 2UV1A 1IN5A 3LOCA 2W57A 2VQGA 3TP0A 5HS8A 2DFFA 2HWVA 4M73A 1ZTRA 3V7CA 1WJBA 4RGRA 2VBYA 4AIJA 1ENHA 4EV0A 3IHUA 3DU5A 1NG6A 4C2MJ 4R1HA 5ILVA 1W4MA 2XGCA 2E19A 5J8CA 3FMQA 1ETOA 3S3MA 2ETHA 4HLYA 1ZG5A 1OYYA 3WU0A 3KEYA 2DBBA 3FMRA 2XPWA 3M8JA 2HOSA 3MKLA 1J09A 3F8CA 2YU9J 1BI0A 2Y69H 3H9GA 2NNYA 2W00A 3C3WA 1R9TJ 4IZZA 2LD5A 4OMZA 4A3EJ 1I27A 1BBYA 2O8XA 2DA5A 4UUTA 4AC0A 2KQRA 4DBQA 4I6ZA 2MSYA 1FTZA 3W2VA 3K4KA 2DLLA 2RDPA 4KIGA 3DLAA 3LSTA 1ITYA 3A01A 1ERDA 3K70D 3M1CA 4G6DA 2DQRA 4U0VA 4HAMA 2JVGA 3G71I 3U1KA 3BTJA 2HXIA 2DOEA 3NRVA 3RYPA 4MEYF 4ITVA 3ASNH 3RKYA 5E18F 1E3HA 1JHFA 4A3KJ 2QLZA 3A0BC 3GWZA 2XF5A 1F4KA 3GFMA 1ZH5A 4HF0A 1FYLA 3CCRI 5F64A 3GTJJ 3HTSB 2K27A 5K1YA 3D1NI 1HSJA 2FU4A 2ESHA 1QO0D 2LKXA 4BAYA 1UZCA 2XF6A 2NOGA 2E2HJ 1T56A 2HOEA 4M3EA 2DW4A 1TNTA 3O2PE 2KP6A 2NVUB 3J80Z 4HRIA 1LPQA 2P4WA 1VQPI 2OAZA 2HDCA 1XSXA 5LGNA 3I9V2 1O3RA 3GVAA 4UV9A 3SFZA 2Z16A 1YO5C 3B6AA 2HR3A 1Z3XA 3AG3H 5E1WA 2K3FA 3S2WA 3PUFA 1J59A 3O3KA 1X1DA 3OS2A 2E1NA 4KITB 1MJ9A 1YLFA 3QPSA 2IGKA 3S14J 1MDMA 4IRIA 1EV7A 5FGMA 2JUGA 1IGNA 2Z9OA 1KU9A 3K0LA 3BR5A 3UKGA 4ENMA 5FJ8J 1MW7A 3TDZC 2M0CA 5D5VB 4WCGA 2FBHA 3WTWC 1PUFB 1Q1HA 4HZFA 2KJCA 2K4BA 1WRJA 5K7HA 1XG1A 2L54A 2KIFA 2TRTA 1QBJA 4BEHB 2MC4A 2NS8A 3ISPA 2VJ4A 4ZYEA 5ILUA 1DQUA 4OIOF 5E8GA 2IS2A 2VIXA 2FNPA 3BCAA 3W6KB 3GO5A 2CQKA 3FBNB 3LMMA 4EM2A 4Y52J 3QWLA 1P4WA 2HYGD 1MBGA 3BP8A 3DBLB 2CQ7A 2QYOA 2XAJA 5J4YA 4FCYA 2ZNZA 1JKQC 2EIMH 5FKOA 1U0JA 3LQRA 4HDVA 3HG9A 3KP5A 2OBPA 2DMUA 2VJ5A 2CFOA 1G6NA 1R5ID 2M7BA 2YU3A 2PJRB 3PO2J 3Q0WA 1ON2A 3U9GA 2Q0OA 1WJ5A 2K7LA 3MMYB 4G9YA 3BCBA 3DTEA 3LA7A 1R4NB 2NS0A 2VQLA 3F23A 2KDZA 5L3DA 3IWZA 3H5RA 1HLVA 4I98B 3QYBA 4BBRJ 3F0CA 2O8KA 3WTSC 4LGWA 2CO5A 3PNYA 4G6TB 3S32A 3LNQA 2LF7A 3EUKL 3IRRA 2LK2A 3CLQA 2EB7A 3MKWB 1SFKA 3GTLJ 2QM3A 3I59B 3JAMZ 5IT9K 4ZZDA 1EH6A 3QOEA 1J9IA 3H5AA 4AD9A 1OJLA 3KEQA 5DEQA 2I5UA 3KIOA 4DYRA 2W7NA 4IHTA 4XR6A 2ICWG 2ELKA 1FWZA 2PMHA 4LFUA 3DTKA 1VFCA 2H09A 3GF2A 2ZBKA 4JK1X 5EYRA 1X4OA 2WBMA 3FK7A 3BR0A 2GM4A 5FLXK 1XGSA 1SAUA 1AKHB 1KU3A 5CVJA 2OU2A 3BDDA 2JA5J 4CGZA 1A5JA 1H0MA 3LFKA 1R23A 2E5NA 2GAUA 5M5WJ 4X0GA 2PFBA 4EEFG 2QWWA 2EZHA 3NARA 2EH3A 5D8KB 1YITI 1HKTA 3ML6A 4A3JJ 1R36A 4LB6B 3ZQGA 4BE2A 5IP9J 1PUEE 2PBIA 2VODA 2CWEA 1WPKA 4D5FA 5LHIA 4ZYDA 1N25A 3HHHA 1DP7P 2FE3A 3NAUA 1FY7A 4XORA 3ZQLA 4G7OF 3A02A 2VC0A 4G94A 5A2QZ 4N0BA 3L2VA 2CQXA 4HF1A 1T8IA 3SJMA 4XSZF 5K5OA 3TKYA 2O5RA 2VPRA 2KZGA 3KLOA 3PQKA 3T1BA 4XL9A 4CCMA 2AXLA 1ETYA 4UXNA 5LFAA 1D0XA 3CF2A 2LC2A 3H3UA 2ADUA 4A0XA 2DK5A 3I4PA 4HNUA 3CMMA 2P5LC 1JTXA 2A05A 4IRHA 2F4OB 1BJAA 3HZJA 2M0MA 3C1DA 3SDGA 4ZH4F 4G7HF 2DK8A 4E6KG 4RBOA 5F0CA 5KAFC 4LLNA 3LSKA 4DYCA 2ZJ2A 2LREA 2R7SA 4RAYA 2FNAA 2BY0A 1KA8A 2P7CB 3MZ8A 2D2WA 1V4RA 2LBFA 1FSEA 4CCNA 2I8DA 4D5CA 2OCCH 3E3VA 2GXAA 1BOAA 1KGSA 3CUQB 4RS8A 1X19A 3V7SA 5DD8A 2W25A 4CCLA 3FM3A 4UVBA 1G3SA 2HVQA 2XAFA 2CW8A 4A5NA 4CUGA 2RAEA 3FF5A 5F0FA 3OYFA 2BOLA 4MNUA 4XQFA 1OCCH 4DNCA 2H8RA 1Z7UA 3K1MA 3CMEI 4BDYA 4EVIA 4UY8I 5E79C 4PFPA 3GTGJ 1H88C 2L0KA 4O6JA 3IUOA 2CGPA 5JHUA 5BMZA 3VWBA 1V55H 3E6CC 5D6EA 4B48A 1X4PA 3I3LA 1YRNB 1IRZA 2DJNA 1R58A 4Y15A 5TISC 1JHHA 3REOA 5JI6A 3BR2A 4ESBA 1S9HA 3S1NJ 3DLLF 5J1YA 2R5YA 2BW3A 4IOAF 2JA8J 1RKTA 3G3ZA 4I2OA 2A5YB 1GVDA 2KHMA 1V3FA 2A69F 5KCMA 2LKSA 2XGXA 2ACJA 2L7FP 4G7ZF 5CJ9A 4S0HB 4CZZA 2E35A 1VQ7I 1I1SA 1HOMA 4JX6A 2MG4A 1R1UA 1LDDA 1EH7A 1XGOA 5LGTA 5J6XA 4HPQA 5GADJ 3WTVC 5IYBJ 1W1WE 1OFCX 3CCUI 3OSGA 1P2FA 3HXLA 1U3EM 1IRGA 4M6YA 3HOWJ 3M3YJ 1SANA 1HQCA 2JSCA 3LWFA 3VODA 2GIZA 2EA4A 3WE3A 3G1MA 1W36D 3EYYA 2Y2ZA 1OPCA 1J75A 1J7KA 2DDAA 3MWMA 2X6XA 4PFOA 4QPQA 4GDFA 1VI0A 1IN6A 4G8XA 1FOKA 1G8XA 3HSFA 3K7AJ 3M1EA 5HVQC 4MQVA 4A93J 5BOXA 4BH9A 5D8LB 2TCTA 4EQQA 1I3QJ 4S05A 4P96A 2O9LA 1A04A 2AQFA 2ZJRF 4IOCF 1QHGA 3HUGB 4BS9A 3CC4I 2BXZA 1ETWA 4EJWA 4BHPA 2VKHA 3DWLE 3N4MA 3BPXA 5DUIA 2XUBA 3F21A 2IBDA 5FKKA 4YEJA 1Y0NA 2PN6A 5J8FA 4FHTA 4XRFA 1T95A 3E5XA 1XMKA 1BM9A 2ZXHA 3H3ZA 2F2EA 4HQMA 1FSHA 3E97A 4BYYA 5M3FJ 3AL0B 2GQQA 1FP2A 1TWHJ 2DA6A 4XM3A 5CVUA 4V2FA 2GA1A 2Q2EA 3SZPA 1MNDA 1X1PA 2K3PA 5EEGA 1XPXA 4LB5A 3KP4A 1BI3A 2R7VA 2XGDA 2IJLA 4F93B 2CUEA 4N4OB 2MLGA 4AIKA 5C44J 3AKZA 2F5DA 4C3JJ 5F1JA 4ZTFA 3TMOA 4V19K 2K02A 1MBKA 5BPDA 1JKOC 1CGPA 2Z5UA 3PSIA 3KZZA 1CF7B 4NB5A 4ZTJA 1DU0A 4IL6C 2LRDA 2OA4A 1HA8A 3CDHA 4UUSB 5LHGA 2X1EA 2Z99A 1PP7U 4XMYA 2HGCA 4E7SA 3PNTA 4PUSA 1J0RA 2NS7A 3GTOJ 2ZXJA 5C3EJ 3JRIA 4E7ZA 2DA7A 3OOPA 4BJ5C 4C2UA 5TJJA 3CLOA 1MNMC 1JE8A 2MGQA 2A6TA 3V8JA
chains in the Genus database with same CATH topology
1VQMI 5DM6F 1VQ4I 2E35A 1VQ7I 5JVGF 1VQ8I 3I56I 3PIOF 1VQNI 5GADJ 3CCUI 2E34A 1YJNI 2E36A 2QEXI 3CCLI 2OTLI 1YJ9I 5GAGJ 1VQ9I 3G6EI 1VQLI 1FOXA 2QA4I 3CF5F 3CCVI 1HC8A 3CMAI 1YJWI 5GAEJ 2ZJRF 4IOCF 4IO9F 3CC4I 1VQ5I 1ACIA 5DM7F 2OTJI 3CCJI 3J7YJ 1QA6A 3CCMI 2FOWA 1FOWA 1FOYA 3G71I 2H8WA 1YIJI 1VQOI 1VQ6I 3CCSI 1Y39A 1S72I 1VQKI 3CCEI 1YHQI 3CCRI 2JQ7A 2NXNB 3CC7I 3CMEI 3CCQI 3J7ZI 3G4SI 4UY8I 1MMSA 3CD6I 4V19K 3I55I 5GAHJ 3PIPF 2ZJPF 2ZJQF 1VQPI 3CC2I 3DLLF 4IOAF 3CJTB 2K3FA 1YI2I 1YITI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  5DM6 F;  1VQ4 I;  2E35 A;  1VQ7 I;  5JVG F;  1VQ8 I;  3I56 I;  3PIO F;  1VQN I;  5GAD J;  3CCU I;  2E34 A;  1YJN I;  2E36 A;  2QEX I;  3CCL I;  2OTL I;  1YJ9 I;  5GAG J;  1VQ9 I;  3G6E I;  1VQL I;  1FOX A;  2QA4 I;  3CF5 F;  3CCV I;  1HC8 A;  3CMA I;  1YJW I;  5GAE J;  2ZJR F;  4IOC F;  4IO9 F;  3CC4 I;  1VQ5 I;  1ACI A;  5DM7 F;  2OTJ I;  3CCJ I;  3J7Y J;  1QA6 A;  3CCM I;  2FOW A;  1FOW A;  1FOY A;  3G71 I;  2H8W A;  1YIJ I;  1VQO I;  1VQ6 I;  3CCS I;  1Y39 A;  1S72 I;  1VQK I;  3CCE I;  1YHQ I;  3CCR I;  2JQ7 A;  2NXN B;  3CC7 I;  3CME I;  3CCQ I;  3J7Z I;  3G4S I;  4UY8 I;  1MMS A;  3CD6 I;  4V19 K;  3I55 I;  5GAH J;  3PIP F;  2ZJP F;  2ZJQ F;  1VQP I;  3CC2 I;  3DLL F;  4IOA F;  3CJT B;  2K3F A;  1YI2 I;  1YIT I; 
#chains in the Genus database with same CATH topology
 1X3W B;  4HST A;  1HCR A;  4B47 A;  3QP5 A;  2QBY B;  2XRN A;  1NHA A;  1K4T A;  2MLK A;  4M6V A;  1HBX G;  4A3G J;  1HW5 A;  4IHW A;  3JW4 A;  4PJN A;  3M4O J;  2PG4 A;  2YSR A;  3D5R C;  4MTE A;  1FBQ A;  1KU7 A;  1FPQ A;  1P9Q C;  3CO7 C;  5M5Y J;  5HLH A;  2JK3 A;  2MBF A;  4U88 A;  4N9H A;  2IS6 A;  1VQ9 I;  2TDX A;  1FOX A;  3HBL A;  3ROU A;  4YRV A;  3CF5 F;  1K79 A;  2L2O A;  1R1V A;  3K4N A;  3CDI A;  2PMZ A;  1QHH D;  5C4J J;  3VYR B;  4GCV A;  3COA C;  2A61 A;  3UR3 C;  4MLO A;  1WI3 A;  1OLT A;  3ZN1 A;  4EGY A;  2IRF G;  2VBW A;  3GZN B;  3CCJ I;  3ZRG A;  5GTH C;  3WTT C;  4AVZ A;  2HTJ A;  3GLL A;  4M71 A;  3H0D A;  1QA6 A;  2CW7 A;  2Y75 A;  3GFI A;  1BJZ A;  5J1U A;  1EKE A;  3MD2 A;  1ETK A;  2E7W A;  1T38 A;  1LUJ B;  1OQY A;  2OF7 A;  2ZSI B;  3HHG A;  2JVH A;  3BR1 A;  3CCY A;  4H0E A;  1RZ4 A;  3BG6 A;  4KUM A;  2E1M C;  2GOX B;  3AG4 H;  3DEU A;  1FTT A;  4ESJ A;  1YHQ I;  4LMY A;  2L01 A;  1R5H A;  3LAJ A;  4MEX F;  2DQL A;  1WFX A;  1O4X A;  4EJV A;  4XLN F;  1STZ A;  4CYD A;  4UB6 C;  3GTM J;  2C6Y A;  1WJE A;  3ZQ7 A;  4XK4 A;  4WWC A;  2R7T A;  3BZC A;  5JLX A;  2XKO A;  2Y9Z A;  1MIJ A;  2BE5 F;  4A0Y A;  3DKW A;  5D5X B;  1W5S A;  4BKX A;  5J47 A;  2M30 A;  3U1D A;  4BAC A;  1MMS A;  5FFZ A;  1T2K A;  4L9J A;  5GPC A;  1LEB A;  2LR8 A;  3VSK A;  1IN7 A;  2HXO A;  4DYQ A;  1B9N A;  2ISZ A;  4C9Y A;  3EYI A;  3H35 A;  3BRO A;  2KMU A;  3N05 A;  3WE2 A;  3W2A A;  1LEA A;  1ON1 A;  3R0A A;  4ZDP A;  2OZ6 A;  4XOT A;  2V9P A;  1IV8 A;  1F5T A;  1T98 A;  3F8N A;  3ZXS A;  4DIQ A;  3FXU A;  1N77 A;  5DCM B;  3DEW A;  3NEU A;  4IKF A;  1HF0 A;  2PMZ N;  4IRG A;  2L7K A;  3IH2 A;  3OYG A;  3VSL A;  1VQM I;  3I64 A;  4M74 A;  1S7O A;  2Z3Y A;  4XN3 A;  5LEJ A;  3HRT A;  1QVT A;  3S8P A;  1V5F A;  3F8B A;  2DMP A;  2L7M P;  4AIH A;  1AWC A;  5CPR B;  5JHF A;  5DYM A;  2PLY A;  1VQN I;  2DA3 A;  2XAG A;  2STW A;  2QKL B;  2F4I A;  2WTE A;  2XAQ A;  5LBQ A;  1E17 A;  2VJI A;  5M3M J;  4U0Y A;  3QU3 A;  4Q47 A;  1P6R A;  3K1N A;  1XTA A;  3EPZ A;  1OCO H;  1I5Z A;  1IRX A;  3KCC A;  4ZJZ A;  3P7N A;  4F3Q A;  2BY1 A;  2QEN A;  5GAG J;  1BI1 A;  3D5L A;  4RDU A;  2DTR A;  1K78 A;  3IAS 2;  3QYE A;  5CQG A;  3BR6 A;  3BT9 A;  1ZR4 A;  4PSX A;  1AHD P;  1H9G A;  3RZD J;  2UZK A;  2DMQ A;  3R61 A;  2LLK A;  1ZK8 A;  5E8I A;  4IHX A;  2OJE D;  4BHC A;  1Y0U A;  3CJR B;  1ZGJ A;  1SD4 A;  3F72 A;  1D8J A;  1ETX A;  2BVM A;  5FLM J;  3RKW A;  2X51 A;  2GLO A;  5DS9 A;  4U7D A;  5J4V A;  2VL8 A;  3EQL F;  5K7F A;  1AU7 A;  1GDT A;  1PVE A;  4EAT A;  1GUU A;  3FIW A;  1YW9 A;  1T33 A;  1S29 A;  3ZR8 X;  1LKX A;  2VN2 A;  3P9K A;  3ERE D;  3M8E A;  3VFZ A;  4IXA A;  2HPM A;  1DP3 A;  2HZD A;  5HS7 A;  2EZK A;  2DPU A;  1D5Y A;  1FOY A;  2K9N A;  1FEX A;  2ME0 A;  3OYN A;  2XAU A;  3S3N A;  4HEA 2;  2BGC A;  4FE4 A;  3IV5 A;  3CES A;  1K61 A;  3BOQ A;  2QVO A;  2P0W A;  2W85 A;  1WVR A;  1FBU A;  3PJR A;  2JN6 A;  3SYT A;  2CYY A;  1FBS A;  1LFU P;  1IG7 A;  4BQN A;  3LQQ A;  3LL7 A;  2DO7 A;  5F04 A;  1HW2 A;  3JR9 A;  1I6X A;  2DYR H;  3TDU C;  4HF2 A;  2QUF A;  3CC7 I;  1IZ1 A;  4CIC A;  1TBX A;  4OIN F;  1UMQ A;  3TO9 A;  2BV6 A;  3ZQF A;  3OYE A;  3OYB A;  1D8K A;  3FXM A;  4X6A J;  1GXP A;  5ILS A;  5CYV A;  1OCT C;  1I6H J;  2WAF A;  5EZG A;  2ZFW A;  1A6I A;  3ABL H;  4M3F A;  4X1E A;  3PIP F;  4LG0 B;  4EJU A;  3F6O A;  1DGW Y;  2QZ8 A;  4L9N A;  4QSH A;  1Z3Y A;  3CC2 I;  1U5T B;  4KYW A;  3HOY J;  5HNH A;  3T8T A;  2A5W A;  2CFX A;  2E2I J;  2VKV A;  4OAZ A;  4W97 A;  5AIQ A;  4O5V A;  4XKC A;  4XBF A;  3L09 A;  2IA2 A;  5KK1 A;  3RIR A;  4GXO A;  2XGE A;  1Y8Q B;  2K5C A;  2V4J C;  1POG A;  1LDJ A;  3QYF A;  2DOF A;  4NHJ A;  5E1X A;  2WA0 A;  1MSF C;  2JZY A;  3M8F A;  4YEL A;  3MKZ A;  2D45 A;  1J5Y A;  2XSJ C;  2X6Y A;  1B8I B;  1YS7 A;  4BE0 A;  2W82 A;  2BVL A;  5E3M A;  1S7A A;  2KT0 A;  2BBY A;  3B6C A;  5KHD A;  4OIQ F;  2X48 A;  1H9T A;  3K6G A;  4HW0 A;  2EIN H;  1Z05 A;  1IXS B;  5D5U B;  1GT0 C;  4AWX B;  3HOS A;  1RKW A;  3MEX A;  5IT9 Z;  3CCV I;  2ZME A;  1JGS A;  2EJR A;  3ZMZ A;  1IAW A;  3I71 A;  1VND A;  3O8G A;  1JKP C;  1DPR A;  3V42 A;  3QU6 A;  2DCE A;  2OCE A;  2KRH A;  2ZNY A;  1ONV A;  1S7E A;  3A03 A;  1HST A;  4UUV A;  3H0G J;  1RPW A;  2KIM A;  1B4A A;  1WI9 A;  4QPO A;  2R5Z A;  4IO9 F;  1LDK B;  2JA6 J;  5DM7 F;  1LQ1 A;  1A36 A;  2W4S A;  1UG2 A;  1KZH A;  1SFX A;  2XB5 A;  3CCM I;  4F7Z A;  4CYC A;  2EFN A;  4GYI A;  4Y4R A;  4I0A A;  5TRD A;  3HB9 A;  3K10 A;  4A69 C;  2H8W A;  1UAA A;  2B0L A;  5FKN A;  3DFG A;  4UVA A;  5HS9 A;  1H89 C;  3LA2 A;  2KIQ A;  1O3Q A;  3JRH A;  3U2R A;  1MJB A;  2YPR A;  3NWT A;  3BJO A;  4RB0 A;  5L3E A;  2PJP A;  4C3I J;  3GCM A;  3AG1 H;  3FXR A;  2XRL A;  3OYI A;  3OYC A;  4GFB A;  4E7K A;  3JSP A;  4DOZ A;  4FIS A;  3SFI A;  5F08 A;  4U87 A;  2RV8 A;  2R93 J;  4YG2 F;  4EJO A;  2EWN A;  2M34 A;  3CCQ I;  3GFL A;  2IEK A;  2L9N A;  1SEU A;  2ZME C;  3GW2 A;  2M2E A;  4J01 A;  3E6M A;  2X4H A;  1Z6R A;  4P55 A;  4E7I A;  2X0L A;  5CVI A;  3VEP A;  4OIP F;  1S8N A;  3LFU A;  5JLW A;  3WG7 H;  2P7V B;  2HS5 A;  3UNG C;  1XDU A;  1FZP B;  2IGN A;  2K9M A;  2XPV A;  2V1X A;  5LRS A;  4II2 A;  3A01 B;  2IT0 A;  3E1S A;  4YIF A;  4A6D A;  4DJA A;  3ASO H;  4FE7 A;  1OIS A;  3WTU C;  3BJA A;  1XD7 A;  3J80 K;  4IX7 A;  2HNH A;  1M1E B;  2L5Q A;  2D1H A;  1IRF A;  2P6T A;  2G0E A;  3T8R A;  4OMY A;  3H5N A;  1I1G A;  1O57 A;  2P8T A;  2CV2 A;  2XSD C;  1ZG3 A;  2EV5 A;  4PJJ A;  3TOB A;  3QPH A;  2KDO A;  3QPL A;  3ZQQ A;  3OYL A;  2FUG 2;  3DF8 A;  1ZN2 A;  4I01 A;  4KMF A;  2B9S A;  3F22 A;  1G3W A;  2F5F A;  3S2H J;  3F8F A;  4HG2 A;  2V1N A;  4RGU A;  4CA0 A;  5EGO A;  3L2U A;  1Z0X A;  4IQ4 A;  1YE9 A;  2NVT J;  3GTK J;  3LA3 A;  1MBE A;  2X9D A;  3MZH A;  3KZI C;  3ZOB A;  1U8B A;  1FJL A;  1UHW A;  3DV8 A;  4XID A;  3L1P A;  3IAM 2;  2JUC A;  2IS1 A;  2WV0 A;  2K9Q A;  1TW3 A;  3SDB A;  1FMV A;  1B72 A;  1I3A A;  1E0E A;  3CP8 A;  2QSF X;  3O8H A;  3CUO A;  2FOK A;  4A6E A;  3J81 Z;  2KRF A;  5EG0 A;  3ZP5 A;  3WOD F;  3OSF A;  1R1T A;  1V5G A;  1NG7 A;  3C7J A;  4KIC A;  1MDM B;  1R00 A;  5D6F A;  2HYJ A;  2DA4 A;  1IF1 A;  2VUM J;  1QZZ A;  3CJQ B;  4XLC A;  3P5J A;  4AID A;  3DPL C;  3HRU A;  3CCE I;  3KP2 A;  1BOB A;  2LG4 A;  2ZXI A;  4NQW A;  4PGH A;  2IGM A;  3BC8 A;  1YW7 A;  4FET A;  6PAX A;  4MQ9 F;  1TQP A;  2CUZ A;  1WJA A;  4GRI A;  1BR1 A;  3C2H A;  1ZRC A;  2VBZ A;  3TW7 A;  3H1C A;  3HEF A;  4M9S A;  4M3G A;  1F36 A;  1R5G A;  4BHB A;  3J7Z I;  3FX3 A;  2XHK A;  5J3L A;  3G4S I;  4A3M J;  2N8G A;  2R4G A;  2HDD A;  1S3J A;  4U0W A;  3RYR A;  1X2M A;  3CD6 I;  4JBA A;  5FRO A;  4M3B A;  4LJZ F;  3JAM K;  4EGZ A;  1WSU A;  3LSR A;  2ZFU A;  2OC6 A;  4HYE A;  1UJ8 A;  2O7O A;  4M9X A;  3QPT A;  3CDL A;  4PDK A;  4KT5 C;  3OYM A;  2HYF A;  3GME A;  4KIS A;  1BIB A;  3ZMT A;  3RI4 A;  4W1U A;  1LE8 B;  2CU7 A;  3TW6 A;  3BR3 A;  3K9T A;  1B1B A;  4XLA A;  2DPD A;  4L5E A;  4XKV A;  4D9J A;  3NQO A;  2HOT A;  3SEZ A;  1ZLK A;  2LP0 A;  2VJJ A;  2CJJ A;  4K2E A;  1Z67 A;  2DOD A;  4FTH A;  2V1U A;  1W7P A;  1MMD A;  2CUF A;  4EMS A;  1ZG1 A;  4FX4 A;  1D1A A;  1W0T A;  2CMP A;  4LLG F;  3D5S C;  4IF4 A;  4O3M A;  5H6Q A;  2DFI A;  2M9H A;  1YX3 A;  2NVY J;  3I4M J;  2R92 J;  1HDP A;  5EZH A;  3BZ6 A;  4Y33 A;  3M07 A;  5F1R A;  3F8M A;  2CQN A;  1UHS A;  4RAF A;  4KDP A;  4NC8 A;  5A2Q K;  3FKJ A;  3BPV A;  2QQ9 A;  1HC8 A;  5LEK A;  2WB1 A;  5D4R A;  1DUX C;  2RNG A;  1UHM A;  3L7W A;  3I4N J;  5FRM A;  1MMG A;  3IH3 A;  1X1A A;  1KON A;  2FBI A;  2HU9 A;  4LLL A;  2CV0 A;  3OIO A;  2OPT A;  2QQ8 A;  4P1W A;  2WC2 A;  1VQ5 I;  3TOA A;  2UXN A;  4JYK A;  4MHG A;  1HKQ A;  3SEQ A;  5HNF A;  4E4H A;  3AFH A;  4A3C J;  4A3I J;  1MD0 A;  2QCO A;  1XN7 A;  3S1R J;  2HPI A;  2L9V A;  1TP4 A;  2Y48 A;  4A3L J;  1DDN A;  1OCP A;  3E0J B;  5E3N A;  1T0F A;  1I39 A;  3GBG A;  1YOV B;  5H6R A;  4ENJ A;  5B1B H;  1X2N A;  3JRG A;  5ED4 A;  4XN0 A;  4KFC A;  3HSE A;  3F9K A;  4EM1 A;  4WX9 A;  3OS1 A;  4B44 A;  5E3O A;  4U7B A;  3M7G A;  2BY3 A;  2K85 A;  3MCZ A;  4E70 A;  2VKE A;  4ZC3 A;  3MN2 A;  5J40 A;  1IO2 A;  1D0Y A;  1BL0 A;  3JRB A;  2FD5 A;  1IC8 A;  2UWM A;  2E1C A;  1T6S A;  3OY9 A;  1JKR C;  1GV2 A;  2EK5 A;  3SHF A;  4ZYA A;  2HDW A;  4CZC A;  3GUD A;  3HOZ J;  4BL0 B;  1YQA A;  3S17 J;  2UXX A;  2GXB A;  2L02 A;  2CV1 A;  4R79 A;  3V7R A;  4IHS A;  2RC4 A;  3EDP A;  2DI3 A;  2MW8 A;  2X1D A;  5E3L A;  4CXF A;  1LJ9 A;  2WB1 N;  2ZO4 A;  1E3O C;  3E6B A;  2LBF B;  2R7U A;  2P6S A;  1RRJ A;  4J00 A;  3R4K A;  2DYS H;  3BTC A;  3KP3 A;  1TL8 A;  1TW2 A;  1T0F C;  3JTH A;  4E7J A;  2Q8K A;  2F5C A;  1E3P A;  3K4C A;  4YFX F;  2Z33 A;  2DT6 A;  1OCZ H;  3OIP A;  2WY8 Q;  1DGR M;  4RAG A;  1KQ0 A;  3E6D A;  5CVV A;  5E20 A;  2OUM A;  2G7H A;  2K9L A;  2LY2 A;  1LVA A;  5HDN A;  2Y31 A;  3ABM H;  2LMD A;  1ZR2 A;  2W84 A;  3FXL A;  1SD5 A;  3E5Q A;  4NC6 A;  2F5V A;  4BQO A;  4XKB A;  1SFU A;  1T39 A;  3E7L A;  1VQL I;  3R60 A;  3ZN0 A;  1OYW A;  1LVK A;  3HC7 A;  3WTZ A;  3V8K A;  3QRF F;  3FHZ A;  1FMW A;  2ELH A;  3DEE A;  2VPL A;  2FX0 A;  3MKY B;  3JTG A;  4NBQ A;  1YYV A;  3FXK A;  3DPU A;  3HOV J;  1XGM A;  2BW3 B;  4ENN A;  2KFD A;  4GO1 A;  1TWC J;  2LTP A;  3FKI J;  2HVR A;  1ACI A;  1IDZ A;  3TBI A;  1EH8 A;  4M6X A;  3TQN A;  4BGD A;  4B43 A;  1GVJ A;  4S04 A;  3K4B A;  5HLI A;  5H20 A;  2FJ1 A;  4MGR A;  3A0H C;  1O7F A;  2LH9 A;  4QTR A;  4BBS J;  5FLV A;  2QQB A;  2P5K A;  9ANT A;  4BDZ A;  3J7A O;  4RGS A;  5BQT A;  1VQ6 I;  1YTY A;  2JMW A;  2HVS A;  3FXJ A;  4R8H A;  1S72 I;  2L3D A;  1MMN A;  5JVT A;  2GIV A;  4L0Y B;  2VXZ A;  4MFE A;  1LFB A;  3OV8 A;  2R7Z J;  3L2R A;  1ZAO A;  2YX4 A;  4IPA A;  3ELK A;  3SZG A;  5HDG A;  1FIA A;  2G9W A;  1XX5 A;  2JPB A;  1XMA A;  4HX4 A;  2RVC A;  1TNS A;  1V5E A;  1IXC A;  2CH0 A;  2LY9 A;  3G73 A;  2WV1 A;  1B59 A;  4BQQ A;  3ZGK A;  1PP8 F;  3LSH A;  1HKS A;  4QWQ A;  3V4G A;  5ICE A;  4RB2 C;  1G3T A;  5AIP A;  2E60 A;  4DGW B;  5IPA A;  1REP C;  4Y7N J;  4RA2 A;  1Z7L A;  3AG2 H;  1YFH A;  1FYK A;  5KNL A;  2YUS A;  4UVC A;  2KIS A;  1IJW C;  5FRN A;  3HIF A;  4M9Z A;  2NYX A;  4DBR A;  2ZJQ F;  2LFB A;  3BQY A;  2MH9 A;  2VAS A;  3OL3 A;  1G4D A;  4IEJ A;  1RR8 C;  1W5T A;  2H6C A;  4A3B J;  1MMA A;  3FDY A;  2FQ3 A;  3I0T A;  2BY2 A;  3KX2 A;  3BTL A;  1SFO J;  3HYI A;  4B4C A;  2O3F A;  3LAP A;  1A31 A;  2CRG A;  3DKY A;  3HOX J;  4RB3 C;  1D3Y A;  3G1L A;  3KYC B;  1ZKG A;  4JP0 A;  2RNJ A;  3ZQC A;  3Q5F A;  3WGH A;  5FKL A;  4KT6 A;  2VE9 A;  4XSX F;  4KIB A;  3HRS A;  1O7L A;  5IP6 A;  3KLN A;  2ZCW A;  2MAB A;  2Q2E B;  1X3Z B;  1RIO H;  3A1Y A;  1KYZ A;  1JUP A;  1YJN I;  1MH4 A;  2WAE A;  4BU2 A;  1BI2 A;  2JRT A;  3KP6 A;  2QEX I;  3ESW B;  1BN5 A;  1TQI A;  3VOE A;  2IPQ X;  3P9C A;  4YFK F;  3GYH X;  1SVL A;  2CG4 A;  4EM0 B;  2E2J J;  1YS6 A;  2AO9 A;  3TO7 A;  1WJD A;  2MYS A;  5EEH A;  2V6E A;  3HJE A;  3SZT A;  5LHH A;  1R71 A;  1W36 C;  4MIM A;  1SD7 A;  2ZSH B;  2WAQ A;  3ABK H;  1UB9 A;  5HOO A;  3KYL A;  5CQE A;  4XIC A;  1JT6 A;  2KPM A;  2VT2 A;  4GYG A;  1T08 B;  5GPA A;  2IP2 A;  2OD5 A;  2EZL A;  1MGT A;  4UNO A;  1WJF A;  2ESN A;  3RKX A;  4ZDL A;  4NUB A;  1ETQ A;  4LIU A;  3TED A;  3K4M A;  3CJN A;  1Y6I A;  2VLA A;  4CHU A;  1TT5 B;  2FF4 A;  4C3H J;  4LK0 F;  3FIS A;  3CTA A;  1MNE A;  4PK4 A;  4XLH A;  3EET A;  2E1M B;  1RI7 A;  2D1V A;  2DA2 A;  1KU2 A;  3T0Y A;  3GEZ A;  3RZO J;  2DT5 A;  3C2B A;  1IN4 A;  2EV6 A;  2XDV A;  3OIQ A;  3T5X A;  2ZKZ A;  2RQQ A;  1BA5 A;  1FLI A;  5ICG A;  5JFR A;  4KA4 A;  1JTY A;  2VI6 A;  1P7J A;  2AXT C;  1FX7 A;  1PUF A;  5DTD A;  4ANJ A;  5GTI C;  4A2U A;  2X6W A;  4CO8 A;  2VQH A;  3O6B B;  1JT0 A;  2RGV A;  1BR2 A;  1MH3 A;  4BEH A;  4CCK A;  2DTZ A;  2K40 A;  3IP4 B;  2NAZ A;  3E5U A;  1XC5 A;  4PJ0 C;  2UUZ A;  4RB1 A;  1L3L A;  3SXY A;  1RNL A;  1ZRF A;  2DU9 A;  3RSN A;  2ZXW H;  2DMN A;  1V54 H;  3IC7 A;  2FEZ A;  3FBI B;  2OQR A;  4YII A;  3LSM A;  2LNB A;  5D5W B;  3W3C A;  1Z6T A;  3RPU A;  4XLP F;  3WGG A;  5L3C A;  3ECH A;  3RCO A;  1K6O A;  2MD0 A;  3DQV C;  4DW6 A;  1OCR H;  1G3Y A;  2PJR A;  2WAQ N;  3Q3S A;  2DFE A;  3LSP A;  3GTP J;  2O6G E;  1JXS A;  2H27 A;  3RPQ A;  3PFY A;  2DJI A;  3I56 I;  4XRS G;  1P4X A;  3G1O A;  3HPG A;  3I54 A;  1GXQ A;  5M5X J;  3BZK A;  3KZY A;  4KN4 X;  3WGI A;  3BTI A;  4LG3 A;  2QSH X;  1U2W A;  2E34 A;  5L3B A;  2JSP A;  5HOD A;  2KLO A;  4ZDO A;  1IDY A;  1U9O A;  1BC7 C;  3ZMD A;  3R0J A;  2KJB A;  1YIO A;  4LIV A;  2F48 A;  4KNY A;  3W6V A;  3L00 A;  2M1B A;  4YFN F;  3MVP A;  4G12 A;  3I59 A;  5GP9 A;  5ICC A;  3FXQ A;  1PDN C;  2QA4 I;  5F27 A;  2EFO A;  2XC7 A;  1ZLJ A;  4A3D J;  2HFH A;  1LB2 A;  4AVP A;  2QSG X;  2XIG A;  3K2A A;  3CMA I;  4PZJ A;  1YJW I;  1QQI A;  1BW6 A;  3WTY C;  2GBY A;  3L2Q A;  5DV5 A;  3A2K A;  4L9V A;  1P4A A;  2ELJ A;  1ORK A;  1IUF A;  3GX4 X;  4D7M A;  4LOC A;  5FD5 A;  1AKH A;  1X58 A;  1RES A;  2LOO A;  2GXG A;  1SMT A;  3GZ5 A;  2X85 A;  3CMY A;  4F55 A;  1BR4 A;  1ZGA A;  1FC3 A;  1YIJ I;  4AM3 A;  1QNT A;  2R7F A;  1ZQ3 P;  3BJ6 A;  3CCS I;  1WZ2 A;  3TGN A;  1G59 A;  3CQZ J;  4HX7 A;  4XNF A;  2M8E A;  5K5Q A;  4HNV A;  5LD2 C;  3N97 A;  3VDX A;  1UST A;  3HOU J;  4RLQ A;  2HQN A;  4E7L A;  2VC1 A;  4P5O A;  4ESF A;  1K78 B;  4BY7 J;  1QZE A;  3H9J A;  2XAH A;  4ETS A;  4CH7 A;  2DMT A;  2B7E A;  2ID6 A;  2XAS A;  4I09 A;  3OS0 A;  5FLX Z;  4E7H A;  3W6J B;  2JJ7 A;  1GHC A;  1FP1 D;  1XMX A;  5L3G A;  1MSE C;  3RTR A;  2EIL H;  1XGN A;  3DBH B;  4HV6 A;  2RKH A;  2Z2S B;  3H9Q A;  3LSJ A;  4H4K C;  4NNJ A;  3HOT A;  1FYM A;  3PQJ A;  3CZ6 A;  3I55 I;  3DCF A;  2A6E F;  4J19 A;  1EA3 A;  2H1L A;  5TGT A;  1BIA A;  4WXC A;  5LGU A;  2XKP A;  3S3O A;  4ZZL A;  3ECO A;  4N4N B;  1SD6 A;  3KYD B;  4XLF A;  4LD5 A;  3GZ6 A;  4II3 A;  1FNN A;  4XON A;  2DXI A;  1TLH B;  1WH7 A;  3JCU C;  2MC3 A;  2CQQ A;  5CVR A;  5DUK A;  1WHU A;  4BXF A;  3PNV A;  2JT1 A;  4KN7 X;  2R7D A;  2R7X A;  3BLY A;  4ENK A;  4GGG A;  2R7R A;  1U78 A;  1G2H A;  2L9S A;  3IH4 A;  4B1R A;  1NK3 P;  2V1D A;  2KRC A;  2XV4 S;  2VT3 A;  2DN0 A;  2EBI A;  3ABU A;  1W7P D;  3CUQ A;  3QQA A;  5ERI A;  3F3X A;  3ONQ A;  1QU3 A;  3K2Z A;  1F9N A;  4RAZ A;  3R6S A;  3H36 A;  4CCO A;  4JX4 A;  2OTL I;  4JX5 A;  1YJ9 I;  3WHC A;  1LE8 A;  2WY7 Q;  3S1Q J;  3ZQH A;  4HBL A;  5BNG A;  3X2Q H;  1ZRD A;  1FIP A;  2P5V A;  4L5J A;  4HX8 A;  2FMY A;  1A35 A;  3ERM A;  3ZMV A;  3Q0U A;  3S93 A;  5B66 C;  5LLQ A;  1Z21 A;  3JRA A;  1B6A A;  2F6C A;  2M4K A;  2IS4 A;  2O0Y A;  2QF7 A;  4BJ6 C;  3Q9V A;  4B8X A;  1YRN A;  2M3A A;  2ZB9 A;  3OR2 C;  2OV7 A;  4BY1 J;  2VB6 A;  1XCV A;  2JA7 J;  3BG9 A;  2E71 A;  4HA8 A;  3OYH A;  4OIR F;  4OU0 A;  1HXD A;  4XLE A;  2GZW A;  3FHN A;  4FAS D;  4L18 B;  3EUH A;  4LIT A;  4MTD A;  2QGU A;  3H92 A;  2V7F A;  1ZHF A;  2E7X A;  4CDG A;  2A3S A;  3I53 A;  3K1P A;  2EIJ H;  1SC7 A;  2FSW A;  4HNT A;  5EF6 A;  3DBR B;  3CUQ C;  3DP7 A;  4FT8 A;  2V9K A;  2JTV A;  3OR1 C;  2M4G A;  5E17 F;  3VPR A;  4DZJ A;  3HPH A;  4I0B A;  2BXY A;  2IA0 A;  4BUP A;  5HLG A;  2JQ7 A;  3VYU B;  2IAI A;  3IKT A;  2Z1D A;  2ZME B;  3QOD A;  4D1Q A;  4KIF A;  4CSW A;  1U8R A;  2LKP A;  3HM5 A;  2DDB A;  3RQI A;  3VYT B;  3CO6 C;  3D0S A;  3Q0V A;  2M7A A;  4M3D A;  4B09 A;  1PYV A;  4DQ2 A;  4A3F J;  2FML A;  2R5Z B;  4OAY A;  5GAH J;  1H8A C;  3S15 J;  2HKX A;  2EA2 A;  1QPI A;  4HDU A;  3B73 A;  1B9M A;  4A5M A;  1XB4 A;  5DDG A;  2NNN A;  3K70 C;  1S5L C;  2M87 A;  5FKM A;  1R49 A;  4BXX J;  2J5O A;  4CYC B;  5H2F C;  3CJT B;  2FRH A;  3HUG A;  2E1O A;  2J5P A;  4JQF A;  1USS A;  2F5E A;  3ZCO A;  2BHZ A;  1SVO A;  1QGP A;  2XPU A;  3EUH C;  3HL2 A;  2EFP A;  3BG3 A;  2HI3 A;  2H94 A;  4N9I A;  2VKD A;  3ULQ B;  5B1A H;  4MO7 A;  3PIO F;  2VXD A;  4AYB A;  1EJ9 A;  3Q9S A;  2EZI A;  1F43 A;  3KET A;  3WHB A;  1KYW A;  1Y1V J;  2DFH A;  2K4J A;  3WTX C;  4C2T A;  3PFI A;  1AOY A;  3GLX A;  2YX7 A;  3CCL I;  5IOY A;  1W0U A;  2O03 A;  1X1B A;  1K7A A;  3HKZ A;  4PGG A;  5KVR A;  4AU7 A;  2CS3 A;  3F6V A;  3G6E I;  3MFK A;  5C4X J;  1N78 A;  5LRR A;  4KJZ A;  3BY6 A;  2R0Q C;  2H1K A;  1OMI A;  1O3T A;  5HDK A;  3TO6 A;  4JOM A;  2FA5 A;  2K86 A;  2V26 A;  4PJM A;  1OKR A;  5DCF A;  1XSV A;  5EDN A;  1D5V A;  1TWF J;  2LY1 A;  1SFE A;  1FT9 A;  1XCB A;  5GAE J;  1XSD A;  3OYD A;  2OZU A;  3DXJ F;  4MFD A;  2NRA C;  1CF7 A;  3C2G A;  1IV6 A;  2IGO A;  5FO5 A;  5E1Z B;  4UUS A;  2MA3 A;  2FXA A;  4HV5 A;  3DKX A;  3S16 J;  3IL2 A;  3NWS A;  1C0W A;  3LSI A;  2IXS A;  1FOW A;  2HEO A;  1WH5 A;  1D0Z A;  1TTY A;  2ID3 A;  2Y0M A;  3L9F A;  2DT7 B;  1Z1D A;  2NOJ B;  3FZV A;  2WWY A;  4IQJ A;  2W48 A;  4B3A A;  3OWT A;  1VQO I;  3KEO A;  3S2D J;  1Y39 A;  3J7A Y;  1X3U A;  2EPF A;  2LF8 A;  3I58 A;  3J81 K;  1RUO A;  2QBY A;  4P9F A;  2MH2 A;  3CP2 A;  3FK6 A;  1YW8 A;  5B5E C;  2LDU A;  4HOB A;  1XS9 A;  3I5U A;  4EJT A;  4B3X A;  5F6F A;  3KE2 A;  4A0Z A;  2R7Q A;  2ECB A;  3AL0 C;  1TQM A;  5EGO B;  2W1O A;  1N75 A;  1ZEL A;  4QLC U;  2A6H F;  4AYB N;  3RJP A;  4ZYH A;  2KL4 A;  1Z91 A;  2LVS A;  2M5W A;  3IWF A;  4KMU X;  2VBX A;  3JSO A;  2BYV E;  2L9R A;  3RQ4 A;  1RC9 A;  4P9U A;  1U6G A;  2LYC A;  4V2G A;  1JI8 A;  3AAF A;  1GV5 A;  2HQ5 A;  2XVC A;  3DU6 A;  3PO3 J;  1B72 B;  2JWT A;  5FD6 A;  2Y0S A;  3C18 A;  2VE8 A;  3HKZ N;  2X1C A;  5CKT A;  2LSO A;  1U9N A;  1OR7 A;  4I7H A;  2AHQ A;  3DPT A;  2IVM A;  2R3S A;  2JRM A;  4WXH A;  1DU6 A;  4OOI A;  5EG0 B;  4D0P A;  1BW5 A;  2EFW A;  3HGG A;  4FX0 A;  2RN7 A;  2VON A;  2JA2 A;  3OL4 A;  1YI2 I;  2NVX J;  2D5V A;  4Y17 A;  2Y30 A;  2V79 A;  4OWR B;  2Y9Y A;  3JRD A;  3PM1 A;  1VF9 A;  5FFX A;  3VYS B;  4RLF A;  3SQN A;  2ZC2 A;  1UCR A;  2K9S A;  2IW5 A;  4NQW B;  4BQA A;  2EV0 A;  2KKO A;  4RM2 A;  3V8L A;  2DA1 A;  1S6L A;  2OQG A;  1Z77 A;  4IHY A;  4G6Q A;  1TC3 C;  2WAD A;  1P7I A;  2GWR A;  1R7J A;  2ME6 A;  2STT A;  1ETV A;  2RRE A;  4PCQ A;  2H6B A;  1KQ9 A;  1KQ8 A;  2KIU A;  5ICF A;  4Q4Z F;  2HZT A;  3ABT A;  1ZYR F;  4ASN A;  1ULY A;  1A6Q A;  2KZV A;  4XRS A;  3K4L A;  2EFQ A;  1F1Z A;  4I02 A;  3HSR A;  1ZRE A;  3KP7 A;  3ZPL A;  1IN8 A;  2EQR A;  3JRF A;  3BG7 A;  1OR7 C;  1IUY A;  1IW7 F;  2HKO A;  4BNC A;  2QKM B;  3PL8 A;  3HGY A;  2A68 F;  3GFJ A;  1P92 A;  1D1C A;  1HDD C;  5IOZ A;  3GXO A;  2OTJ I;  4HLX A;  3J7Y J;  4DZP A;  2Y0S N;  1Y56 A;  2FOW A;  5K7Z A;  1RR7 A;  1LFP A;  1XDS A;  1W7P B;  4RM3 A;  5F0H A;  1LNW A;  3RDI A;  1OYI A;  3A4C A;  4PJL A;  1UFM A;  5DCM A;  1K83 J;  5IP7 J;  5HLT A;  3OYK A;  5EEA A;  1TT0 A;  1JUS A;  2BHY A;  1AA7 A;  1HW1 A;  1R6R A;  2G7U A;  1R4M B;  5K5R A;  4PSW A;  1VQK I;  2R5Y B;  2BZT A;  5KAI C;  4BJT A;  4L5I A;  1QRY A;  5J1R A;  5IYD J;  2E5Z A;  3JRC A;  3MAJ A;  3TL4 X;  2Q1Z B;  1YX5 A;  2YS9 A;  3QOP A;  4L0Z B;  2I10 A;  1WWX A;  2CUJ A;  4UV8 A;  1CQT A;  1TZL A;  3FXO A;  4AUX A;  2R7O A;  1O3S A;  1DPU A;  2NXN B;  5CLS A;  5B3S H;  4WK8 F;  1EF4 A;  1NK2 P;  1WJC A;  2PI0 A;  4Z6Y A;  3BQZ A;  4Q5S F;  4F91 B;  1Y8R B;  2DOA A;  1Y1W J;  4Q48 A;  1TWA J;  2JPC A;  3EUA A;  3P9I A;  5D4S A;  2B63 J;  4XRM A;  4I99 C;  1MBF A;  2HQA A;  3BG5 A;  3IKV A;  2M8G X;  2L7Z A;  4Z2Y A;  2HOA A;  2AS5 F;  2HTS A;  2V6C A;  2COM A;  4RGX A;  3QAH A;  1I50 J;  1JUM A;  3RPU D;  2XB0 X;  4Y13 A;  3ZMU A;  4UB8 C;  1QVU A;  2ISY A;  5DM6 F;  1K4S A;  1SVM A;  1VQ8 I;  1L0O C;  4HQE A;  4LK1 F;  3OOU A;  4BXU A;  2GA2 A;  1ZAR A;  4IJA A;  3GTQ J;  5FB2 A;  1VTN C;  4D7N A;  1MKM A;  1GLN A;  1QPM A;  2PEX A;  1UG0 A;  2E36 A;  4L9T A;  3VB2 A;  1NH3 A;  2VOO A;  3TP3 A;  3HTU A;  4F52 A;  1X1C A;  2VQC A;  2V9V A;  3W2W A;  2MFZ A;  3OMY A;  2XRO A;  2BEO A;  3L2W A;  1QZY A;  4ABZ A;  4WF2 A;  3S1M J;  2CW0 F;  2W24 A;  5JR3 A;  3WU2 C;  1WCM J;  2EIK H;  4YIR X;  4TV7 A;  3BWG A;  4IHV A;  1R22 A;  5AON A;  3ZQI A;  4WXD A;  3B02 A;  2FQ4 A;  1SAX A;  2COB A;  5DD4 A;  1MBH A;  4ZYG A;  2RQP A;  4HSR A;  1D1B A;  1ZGW A;  4LG0 A;  1W5C C;  1SMY F;  1MJA A;  4XKW A;  3IRQ A;  1U5T A;  3DTI A;  3JRE A;  3H3V K;  3LSG A;  4XOP A;  3L2C A;  2R7W A;  2O61 A;  2IA1 A;  3U21 A;  3K4J A;  4IVN A;  2X6O A;  1MZB A;  2A07 F;  1JJ6 C;  5IYC J;  2CSO A;  4A12 A;  5BPI A;  1VZ0 A;  3KFW X;  5IY5 H;  1WQ2 A;  4RMN A;  2FBK A;  5L3F A;  4UHT A;  2M45 A;  1WGX A;  3G2B A;  4NDL A;  5BS6 A;  3OYJ A;  2MD5 A;  2DAO A;  3ZMS A;  2ECC A;  2PMU A;  3MQ0 A;  1B8I A;  2VOP A;  2GOM A;  1Z9C A;  2QQA A;  2PQ8 A;  5EJC A;  4CCJ A;  2PX9 A;  2L4A A;  1YG2 A;  1BC8 C;  1NTC A;  2AQE A;  4BE1 A;  1MBJ A;  2HQR A;  4NC7 A;  3KPH A;  1APL C;  3WU1 B;  4F92 B;  1E2X A;  3WG9 A;  1K6Y A;  2YR2 A;  4FQG A;  2ZJP F;  1Q1V A;  3QP6 A;  1UEL B;  3FM5 A;  3MZY A;  3FMS A;  3K69 A;  3HDD A;  1U5T C;  5IT3 A;  1TWG J;  1RUN A;  2NVQ J;  1RET A;  3M9A A;  4M72 A;  2F4M B;  3HRM A;  3RKQ A;  2L4M A;  1J2X A;  3PUB A;  4I76 A;  4C30 A;  3PSF A;  1VQ4 I;  3FWE A;  5JVG F;  1IXR C;  1WKM A;  1ODD A;  2XF7 A;  4Y3O A;  1PJR A;  4ON0 A;  1JJ8 C;  2P81 A;  4QIW N;  3OYA A;  1JGG A;  2UV1 A;  1IN5 A;  3LOC A;  2W57 A;  2VQG A;  3TP0 A;  5HS8 A;  2DFF A;  2HWV A;  4M73 A;  1ZTR A;  3V7C A;  1WJB A;  4RGR A;  2VBY A;  4AIJ A;  1ENH A;  4EV0 A;  3IHU A;  3DU5 A;  1NG6 A;  4C2M J;  4R1H A;  5ILV A;  1W4M A;  2XGC A;  2E19 A;  5J8C A;  3FMQ A;  1ETO A;  3S3M A;  2ETH A;  4HLY A;  1ZG5 A;  1OYY A;  3WU0 A;  3KEY A;  2DBB A;  3FMR A;  2XPW A;  3M8J A;  2HOS A;  3MKL A;  1J09 A;  3F8C A;  2YU9 J;  1BI0 A;  2Y69 H;  3H9G A;  2NNY A;  2W00 A;  3C3W A;  1R9T J;  4IZZ A;  2LD5 A;  4OMZ A;  4A3E J;  1I27 A;  1BBY A;  2O8X A;  2DA5 A;  4UUT A;  4AC0 A;  2KQR A;  4DBQ A;  4I6Z A;  2MSY A;  1FTZ A;  3W2V A;  3K4K A;  2DLL A;  2RDP A;  4KIG A;  3DLA A;  3LST A;  1ITY A;  3A01 A;  1ERD A;  3K70 D;  3M1C A;  4G6D A;  2DQR A;  4U0V A;  4HAM A;  2JVG A;  3G71 I;  3U1K A;  3BTJ A;  2HXI A;  2DOE A;  3NRV A;  3RYP A;  4MEY F;  4ITV A;  3ASN H;  3RKY A;  5E18 F;  1E3H A;  1JHF A;  4A3K J;  2QLZ A;  3A0B C;  3GWZ A;  2XF5 A;  1F4K A;  3GFM A;  1ZH5 A;  4HF0 A;  1FYL A;  3CCR I;  5F64 A;  3GTJ J;  3HTS B;  2K27 A;  5K1Y A;  3D1N I;  1HSJ A;  2FU4 A;  2ESH A;  1QO0 D;  2LKX A;  4BAY A;  1UZC A;  2XF6 A;  2NOG A;  2E2H J;  1T56 A;  2HOE A;  4M3E A;  2DW4 A;  1TNT A;  3O2P E;  2KP6 A;  2NVU B;  3J80 Z;  4HRI A;  1LPQ A;  2P4W A;  1VQP I;  2OAZ A;  2HDC A;  1XSX A;  5LGN A;  3I9V 2;  1O3R A;  3GVA A;  4UV9 A;  3SFZ A;  2Z16 A;  1YO5 C;  3B6A A;  2HR3 A;  1Z3X A;  3AG3 H;  5E1W A;  2K3F A;  3S2W A;  3PUF A;  1J59 A;  3O3K A;  1X1D A;  3OS2 A;  2E1N A;  4KIT B;  1MJ9 A;  1YLF A;  3QPS A;  2IGK A;  3S14 J;  1MDM A;  4IRI A;  1EV7 A;  5FGM A;  2JUG A;  1IGN A;  2Z9O A;  1KU9 A;  3K0L A;  3BR5 A;  3UKG A;  4ENM A;  5FJ8 J;  1MW7 A;  3TDZ C;  2M0C A;  5D5V B;  4WCG A;  2FBH A;  3WTW C;  1PUF B;  1Q1H A;  4HZF A;  2KJC A;  2K4B A;  1WRJ A;  5K7H A;  1XG1 A;  2L54 A;  2KIF A;  2TRT A;  1QBJ A;  4BEH B;  2MC4 A;  2NS8 A;  3ISP A;  2VJ4 A;  4ZYE A;  5ILU A;  1DQU A;  4OIO F;  5E8G A;  2IS2 A;  2VIX A;  2FNP A;  3BCA A;  3W6K B;  3GO5 A;  2CQK A;  3FBN B;  3LMM A;  4EM2 A;  4Y52 J;  3QWL A;  1P4W A;  2HYG D;  1MBG A;  3BP8 A;  3DBL B;  2CQ7 A;  2QYO A;  2XAJ A;  5J4Y A;  4FCY A;  2ZNZ A;  1JKQ C;  2EIM H;  5FKO A;  1U0J A;  3LQR A;  4HDV A;  3HG9 A;  3KP5 A;  2OBP A;  2DMU A;  2VJ5 A;  2CFO A;  1G6N A;  1R5I D;  2M7B A;  2YU3 A;  2PJR B;  3PO2 J;  3Q0W A;  1ON2 A;  3U9G A;  2Q0O A;  1WJ5 A;  2K7L A;  3MMY B;  4G9Y A;  3BCB A;  3DTE A;  3LA7 A;  1R4N B;  2NS0 A;  2VQL A;  3F23 A;  2KDZ A;  5L3D A;  3IWZ A;  3H5R A;  1HLV A;  4I98 B;  3QYB A;  4BBR J;  3F0C A;  2O8K A;  3WTS C;  4LGW A;  2CO5 A;  3PNY A;  4G6T B;  3S32 A;  3LNQ A;  2LF7 A;  3EUK L;  3IRR A;  2LK2 A;  3CLQ A;  2EB7 A;  3MKW B;  1SFK A;  3GTL J;  2QM3 A;  3I59 B;  3JAM Z;  5IT9 K;  4ZZD A;  1EH6 A;  3QOE A;  1J9I A;  3H5A A;  4AD9 A;  1OJL A;  3KEQ A;  5DEQ A;  2I5U A;  3KIO A;  4DYR A;  2W7N A;  4IHT A;  4XR6 A;  2ICW G;  2ELK A;  1FWZ A;  2PMH A;  4LFU A;  3DTK A;  1VFC A;  2H09 A;  3GF2 A;  2ZBK A;  4JK1 X;  5EYR A;  1X4O A;  2WBM A;  3FK7 A;  3BR0 A;  2GM4 A;  5FLX K;  1XGS A;  1SAU A;  1AKH B;  1KU3 A;  5CVJ A;  2OU2 A;  3BDD A;  2JA5 J;  4CGZ A;  1A5J A;  1H0M A;  3LFK A;  1R23 A;  2E5N A;  2GAU A;  5M5W J;  4X0G A;  2PFB A;  4EEF G;  2QWW A;  2EZH A;  3NAR A;  2EH3 A;  5D8K B;  1YIT I;  1HKT A;  3ML6 A;  4A3J J;  1R36 A;  4LB6 B;  3ZQG A;  4BE2 A;  5IP9 J;  1PUE E;  2PBI A;  2VOD A;  2CWE A;  1WPK A;  4D5F A;  5LHI A;  4ZYD A;  1N25 A;  3HHH A;  1DP7 P;  2FE3 A;  3NAU A;  1FY7 A;  4XOR A;  3ZQL A;  4G7O F;  3A02 A;  2VC0 A;  4G94 A;  5A2Q Z;  4N0B A;  3L2V A;  2CQX A;  4HF1 A;  1T8I A;  3SJM A;  4XSZ F;  5K5O A;  3TKY A;  2O5R A;  2VPR A;  2KZG A;  3KLO A;  3PQK A;  3T1B A;  4XL9 A;  4CCM A;  2AXL A;  1ETY A;  4UXN A;  5LFA A;  1D0X A;  3CF2 A;  2LC2 A;  3H3U A;  2ADU A;  4A0X A;  2DK5 A;  3I4P A;  4HNU A;  3CMM A;  2P5L C;  1JTX A;  2A05 A;  4IRH A;  2F4O B;  1BJA A;  3HZJ A;  2M0M A;  3C1D A;  3SDG A;  4ZH4 F;  4G7H F;  2DK8 A;  4E6K G;  4RBO A;  5F0C A;  5KAF C;  4LLN A;  3LSK A;  4DYC A;  2ZJ2 A;  2LRE A;  2R7S A;  4RAY A;  2FNA A;  2BY0 A;  1KA8 A;  2P7C B;  3MZ8 A;  2D2W A;  1V4R A;  2LBF A;  1FSE A;  4CCN A;  2I8D A;  4D5C A;  2OCC H;  3E3V A;  2GXA A;  1BOA A;  1KGS A;  3CUQ B;  4RS8 A;  1X19 A;  3V7S A;  5DD8 A;  2W25 A;  4CCL A;  3FM3 A;  4UVB A;  1G3S A;  2HVQ A;  2XAF A;  2CW8 A;  4A5N A;  4CUG A;  2RAE A;  3FF5 A;  5F0F A;  3OYF A;  2BOL A;  4MNU A;  4XQF A;  1OCC H;  4DNC A;  2H8R A;  1Z7U A;  3K1M A;  3CME I;  4BDY A;  4EVI A;  4UY8 I;  5E79 C;  4PFP A;  3GTG J;  1H88 C;  2L0K A;  4O6J A;  3IUO A;  2CGP A;  5JHU A;  5BMZ A;  3VWB A;  1V55 H;  3E6C C;  5D6E A;  4B48 A;  1X4P A;  3I3L A;  1YRN B;  1IRZ A;  2DJN A;  1R58 A;  4Y15 A;  5TIS C;  1JHH A;  3REO A;  5JI6 A;  3BR2 A;  4ESB A;  1S9H A;  3S1N J;  3DLL F;  5J1Y A;  2R5Y A;  2BW3 A;  4IOA F;  2JA8 J;  1RKT A;  3G3Z A;  4I2O A;  2A5Y B;  1GVD A;  2KHM A;  1V3F A;  2A69 F;  5KCM A;  2LKS A;  2XGX A;  2ACJ A;  2L7F P;  4G7Z F;  5CJ9 A;  4S0H B;  4CZZ A;  2E35 A;  1VQ7 I;  1I1S A;  1HOM A;  4JX6 A;  2MG4 A;  1R1U A;  1LDD A;  1EH7 A;  1XGO A;  5LGT A;  5J6X A;  4HPQ A;  5GAD J;  3WTV C;  5IYB J;  1W1W E;  1OFC X;  3CCU I;  3OSG A;  1P2F A;  3HXL A;  1U3E M;  1IRG A;  4M6Y A;  3HOW J;  3M3Y J;  1SAN A;  1HQC A;  2JSC A;  3LWF A;  3VOD A;  2GIZ A;  2EA4 A;  3WE3 A;  3G1M A;  1W36 D;  3EYY A;  2Y2Z A;  1OPC A;  1J75 A;  1J7K A;  2DDA A;  3MWM A;  2X6X A;  4PFO A;  4QPQ A;  4GDF A;  1VI0 A;  1IN6 A;  4G8X A;  1FOK A;  1G8X A;  3HSF A;  3K7A J;  3M1E A;  5HVQ C;  4MQV A;  4A93 J;  5BOX A;  4BH9 A;  5D8L B;  2TCT A;  4EQQ A;  1I3Q J;  4S05 A;  4P96 A;  2O9L A;  1A04 A;  2AQF A;  2ZJR F;  4IOC F;  1QHG A;  3HUG B;  4BS9 A;  3CC4 I;  2BXZ A;  1ETW A;  4EJW A;  4BHP A;  2VKH A;  3DWL E;  3N4M A;  3BPX A;  5DUI A;  2XUB A;  3F21 A;  2IBD A;  5FKK A;  4YEJ A;  1Y0N A;  2PN6 A;  5J8F A;  4FHT A;  4XRF A;  1T95 A;  3E5X A;  1XMK A;  1BM9 A;  2ZXH A;  3H3Z A;  2F2E A;  4HQM A;  1FSH A;  3E97 A;  4BYY A;  5M3F J;  3AL0 B;  2GQQ A;  1FP2 A;  1TWH J;  2DA6 A;  4XM3 A;  5CVU A;  4V2F A;  2GA1 A;  2Q2E A;  3SZP A;  1MND A;  1X1P A;  2K3P A;  5EEG A;  1XPX A;  4LB5 A;  3KP4 A;  1BI3 A;  2R7V A;  2XGD A;  2IJL A;  4F93 B;  2CUE A;  4N4O B;  2MLG A;  4AIK A;  5C44 J;  3AKZ A;  2F5D A;  4C3J J;  5F1J A;  4ZTF A;  3TMO A;  4V19 K;  2K02 A;  1MBK A;  5BPD A;  1JKO C;  1CGP A;  2Z5U A;  3PSI A;  3KZZ A;  1CF7 B;  4NB5 A;  4ZTJ A;  1DU0 A;  4IL6 C;  2LRD A;  2OA4 A;  1HA8 A;  3CDH A;  4UUS B;  5LHG A;  2X1E A;  2Z99 A;  1PP7 U;  4XMY A;  2HGC A;  4E7S A;  3PNT A;  4PUS A;  1J0R A;  2NS7 A;  3GTO J;  2ZXJ A;  5C3E J;  3JRI A;  4E7Z A;  2DA7 A;  3OOP A;  4BJ5 C;  4C2U A;  5TJJ A;  3CLO A;  1MNM C;  1JE8 A;  2MGQ A;  2A6T A;  3V8J A; 
#chains in the Genus database with same CATH homology
 1VQM I;  5DM6 F;  1VQ4 I;  2E35 A;  1VQ7 I;  5JVG F;  1VQ8 I;  3I56 I;  3PIO F;  1VQN I;  5GAD J;  3CCU I;  2E34 A;  1YJN I;  2E36 A;  2QEX I;  3CCL I;  2OTL I;  1YJ9 I;  5GAG J;  1VQ9 I;  3G6E I;  1VQL I;  1FOX A;  2QA4 I;  3CF5 F;  3CCV I;  1HC8 A;  3CMA I;  1YJW I;  5GAE J;  2ZJR F;  4IOC F;  4IO9 F;  3CC4 I;  1VQ5 I;  1ACI A;  5DM7 F;  2OTJ I;  3CCJ I;  3J7Y J;  1QA6 A;  3CCM I;  2FOW A;  1FOW A;  1FOY A;  3G71 I;  2H8W A;  1YIJ I;  1VQO I;  1VQ6 I;  3CCS I;  1Y39 A;  1S72 I;  1VQK I;  3CCE I;  1YHQ I;  3CCR I;  2JQ7 A;  2NXN B;  3CC7 I;  3CME I;  3CCQ I;  3J7Z I;  3G4S I;  4UY8 I;  1MMS A;  3CD6 I;  4V19 K;  3I55 I;  5GAH J;  3PIP F;  2ZJP F;  2ZJQ F;  1VQP I;  3CC2 I;  3DLL F;  4IOA F;  3CJT B;  2K3F A;  1YI2 I;  1YIT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...