3CCSI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccsI00
2FOWA 2QEXI 4IO9F 4IOCF 5GAHJ 3CCJI 2E35A 2E34A 4IOAF 3CCLI 1VQ7I 3CJTB 2ZJPF 1VQNI 1QA6A 1VQLI 3CCQI 5DM7F 3G4SI 2H8WA 3CCRI 1YJ9I 1YI2I 3CD6I 1HC8A 5JVGF 3CF5F 2QA4I 3CMAI 3CCSI 1VQ5I 3DLLF 5GAEJ 1YJWI 2ZJQF 1FOWA 1FOXA 3CC4I 5GADJ 3J7ZI 3I55I 1VQMI 2K3FA 1S72I 2JQ7A 3CMEI 1VQ8I 3PIOF 1YHQI 2NXNB 1ACIA 3CCEI 3G6EI 3CC7I 1YIJI 2OTLI 4V19K 3J7YJ 1YJNI 3CCMI 4UY8I 1VQ4I 3I56I 1VQ9I 1VQKI 1VQ6I 1VQOI 3CCUI 2ZJRF 3PIPF 1MMSA 5DM6F 3CCVI 1VQPI 1Y39A 3G71I 2E36A 1FOYA 5GAGJ 1YITI 3CC2I 2OTJI
chains in the Genus database with same CATH superfamily
5E1WA 2CWEA 1FYMA 4RGXA 2A68F 2Q1ZB 3KX2A 4DBQA 1VQ7I 2O3FA 2IS6A 2ECCA 2V9VA 2NVTJ 1CGPA 1QPIA 2M30A 1NG7A 4I7HA 3HDDA 1RETA 1XSVA 2BOLA 2QSFX 3E7LA 5DM7F 3GYHX 2IS4A 3HXLA 3LOCA 3MKZA 5K7ZA 4ABZA 2EFWA 1YJ9I 2X6OA 4HSTA 2EA2A 2DAOA 1S8NA 3E5QA 1FTTA 4EQQA 4ENKA 1WPKA 5HLTA 3WG9A 2IGMA 1IDZA 4OOIA 3QPHA 4QPQA 2LH9A 3TW6A 1X2MA 2BW3B 3DLLF 4MO7A 2M1BA 4XSZF 3PO3J 1T0FA 4ESJA 2ADUA 2I5UA 1YFHA 3J81Z 2D5VA 4KISA 4PFOA 1R9TJ 2FBKA 3S2HJ 3ABLH 3CQZJ 5FKOA 1FSHA 1S5LC 3AL0B 2FU4A 1I5ZA 5CVRA 3OYDA 1W7PA 1TP4A 5JI6A 5LFAA 1RESA 3S17J 3QOEA 3CZ6A 3RKWA 3H3ZA 1F43A 2E1MB 2GIVA 3K1NA 1EH7A 3LA7A 3PIOF 2FUG2 1ZRDA 1P6RA 2QBYB 5HDKA 3HPGA 3VYRB 1TLHB 2JRTA 1WVRA 2BEOA 3FXKA 4HPQA 1IN7A 1WKMA 3GXOA 3M1EA 2IA2A 3D5LA 1EJ9A 4MIMA 2CG4A 1BW6A 2O5RA 4L9TA 3PL8A 5HS9A 1Z6RA 3OS0A 2DCEA 4HSRA 1HW2A 4FQGA 3F3XA 2WB1A 5EZGA 5A2QZ 3WTVC 1OKRA 2W00A 3HRUA 1IN5A 1O3SA 3H1CA 3ML6A 4LG0A 3PIPF 4LGWA 1OCZH 3GUDA 2KRHA 2BY3A 1OCTC 1VQPI 5F6FA 2V1NA 2E36A 2O0YA 1O7LA 3S8PA 4HLYA 1UCRA 1KONA 4UUSA 1BR1A 2Y69H 2AXTC 2XAUA 3OS1A 3QP5A 4C3HJ 1OFCX 3ROUA 4JX5A 4XK4A 3S3MA 4ZJZA 1FZPB 2BV6A 2E71A 2Y0MA 2RVCA 3TP3A 1BR4A 1IRGA 3BR3A 3FIWA 4EGZA 2L7ZA 1FBSA 4IEJA 1LNWA 3DV8A 5ICCA 3RIRA 1T33A 3WTWC 2X1DA 2CV0A 2YU9J 5FKLA 1C0WA 1XB4A 3BT9A 2HQAA 3IV5A 2EILH 2VJ5A 2IS1A 1ZGJA 1TZLA 3F6VA 4BE1A 1RIOH 1FMWA 3CUQC 3MWMA 2HXIA 3SHFA 1N75A 3H5RA 2DDAA 1TW3A 4XKWA 5DDGA 3TL4X 3E1SA 1B4AA 2OA4A 3BTLA 3C18A 1DUXC 2EWNA 1MSEC 1MDMA 4YFKF 4E7SA 1R5GA 4D0PA 2VPRA 2VL8A 1MBKA 4DNCA 3P9IA 1Y56A 2WAQA 1D8KA 4BACA 2DTRA 1MNMC 5F08A 3O8GA 3H9QA 1I1GA 2DA6A 4BE2A 1MBJA 5HS8A 1IGNA 2JPCA 4C2TA 4NC6A 4RLQA 4IHWA 1SVOA 2BHYA 3KZZA 2JWTA 1MJBA 4MQVA 2ZSIB 2DOAA 1YLFA 2E7WA 4KN7X 5GADJ 3J7ZI 3HOYJ 2TCTA 1YRNB 1SVLA 2W7NA 2CQKA 4NC8A 1UHSA 4H0EA 1YS6A 2FD5A 2D2WA 3KYCB 5JLWA 3W6VA 2P7CB 4IQ4A 2L9RA 3SEQA 3L2CA 4RGSA 5DEQA 2H27A 2XKPA 2QQ8A 5K5OA 3R0AA 4O3MA 3GTJJ 2K9QA 1JTXA 4AUXA 2CFXA 5DUKA 5FLVA 3ERMA 1U5TA 4DOZA 2CYYA 1SVMA 2LF8A 2R93J 4MEXF 1TNSA 3HZJA 1A36A 4EJTA 5F04A 4NBQA 4IHXA 3GTQJ 3K7AJ 2EJRA 1SC7A 5JFRA 3KP2A 2GLOA 2VBXA 3COAC 5DUIA 3IH4A 1VQ9I 3ONQA 5HOOA 1VQ6I 2J5OA 4BH9A 5H6RA 5CJ9A 2HPMA 2CFOA 5DTDA 1M1EB 2O03A 3B02A 3BG3A 4PCQA 2WAEA 3VYTB 4RM2A 1I3AA 4A0ZA 3OYAA 3KP5A 4BYYA 2ZXIA 3K4JA 1O3TA 4AC0A 2K9LA 2GAUA 1LE8A 1NK2P 2BE5F 3A2KA 1ZRFA 2GM4A 4EJVA 3HM5A 1HSJA 3OV8A 1W36C 2OTJI 2KDOA 4ASNA 3MCZA 4CUGA 3WTSC 3JREA 1S29A 2CMPA 3GTLJ 4KT6A 3RJPA 3LA3A 4KITB 1N78A 2CUJA 2KZVA 1T38A 2E1NA 3B73A 1LVKA 2QQBA 1PVEA 5LGUA 3I59A 3SDBA 1S7OA 2M45A 2NS0A 1W7PD 2R7WA 1VI0A 1AOYA 3AG2H 2ID6A 2DBBA 3WU1B 3CCRI 3K1PA 3F8CA 2H8RA 3QPTA 1TT5B 1BJZA 3I0TA 3FDYA 4N4NB 3H5AA 2IA0A 2ECBA 1GVDA 2NOGA 3SFZA 1K78A 1TTYA 1Z77A 1MJ9A 4G6QA 2GXBA 3M3YJ 2K5CA 3CUQB 3M8EA 5E8GA 5M3FJ 2HQ5A 3DTEA 1R4NB 2LKXA 2DO7A 4OINF 3BPVA 1OCRH 4CDGA 2JA2A 3RZDJ 4D1QA 2IGOA 2V79A 1CF7A 2W4SA 3K2AA 2NNYA 2OC6A 5HNFA 2JRMA 1YW9A 2DQRA 1WGXA 3ABUA 4Y4RA 5KK1A 2VQCA 5E3NA 2LF7A 2OBPA 1KA8A 1KGSA 2NVYJ 2GA2A 3FKJA 4RAYA 3IH3A 4Y17A 1ETXA 1WRJA 1B9MA 3NRVA 2JJ7A 4OMZA 1QZZA 3HL2A 1UG2A 5K7HA 1Z3XA 2YX4A 1BOAA 1BI2A 4G6DA 4XICA 2ZBKA 1U9NA 4BXXJ 2HWVA 2M34A 1B8IA 4IX7A 2NVQJ 4Q47A 2W25A 2VQGA 5LRSA 4OWRB 2YU3A 2K40A 2R7ZJ 4D7NA 2XIGA 3ZQQA 2OTLI 1OMIA 2EFNA 1QU3A 4UUTA 3GTGJ 3K9TA 2CUZA 2P6SA 2ZNYA 4UVAA 4P9FA 3UNGC 4V2GA 3E3VA 2CQNA 2GWRA 2P7VB 3TP0A 2R5ZB 1HCRA 2ETHA 3EYYA 3DQVC 4RS8A 5E8IA 2V26A 2DYRH 3ZMSA 3E6CC 1GUUA 1WSUA 1QPMA 2PJRA 3NQOA 1X19A 5FKNA 2OQRA 5DM6F 1WHUA 1K79A 3G71I 2MH2A 3LNQA 5JHUA 3N97A 5EJCA 5M3MJ 5DCMA 1RNLA 2XRLA 2VPLA 3CMEI 5FKKA 1IRZA 4HF1A 2P5KA 1H88C 2JA5J 3H0DA 2R3SA 2IW5A 1KZHA 2LY2A 5D5XB 2I10A 4X0GA 1FP1D 2KRFA 4GYGA 3S1MJ 3L7WA 1EH6A 2Z33A 2Z9OA 4UV8A 1EH8A 4L9VA 2W48A 2M9HA 2H8WA 1JI8A 2XAQA 4EVIA 1X1BA 2F5CA 1XG1A 3HG9A 4XLCA 3M1CA 2O8XA 1Z3YA 2QF7A 2VE9A 2L7MP 3ZOBA 4N0BA 2ISYA 1ETKA 1P7IA 3E97A 3FWEA 1FNNA 1X3UA 2DMTA 5LHHA 4IQJA 2F4OB 1DGWY 3CJRB 3IUOA 3K0LA 3M4OJ 1WJ5A 3WGHA 1R58A 1K6OA 5FJ8J 2QKMB 1E3OC 2OCCH 2CU7A 3R6SA 3C2GA 4PJJA 3L2WA 1TBXA 2FBIA 2RNJA 4JQFA 1WJCA 1SFKA 1W7PB 4KUMA 1GHCA 5IOZA 2ZXWH 1U5TC 2PEXA 4C2UA 1POGA 2QGUA 1ZK8A 1FOWA 1X3WB 3LSTA 4A5NA 4XN3A 5GPCA 3I4NJ 4AU7A 4M9SA 2BY1A 2NS8A 2WAFA 2P81A 4A6EA 3TO7A 3GW2A 5DD8A 3HHHA 2OCEA 4DW6A 5C4JJ 1BI3A 2VOOA 1U3EM 2NXNB 3JRFA 3BP8A 3F6OA 4II3A 2HZDA 5BPIA 4WXHA 1NH3A 2M8GX 3ZQLA 2XKOA 1SFUA 1ON2A 2ZMEC 3NAUA 1XC5A 4JOMA 4G7HF 4NC7A 3HKZN 5KAIC 1VF9A 4IL6C 1L3LA 4Q48A 1BI1A 1XS9A 2V4JC 2M87A 2ME0A 2P6TA 3CCMI 1SANA 4Y33A 3W6KB 2L7KA 2DK8A 3EDPA 4CXFA 2HVSA 3ZMZA 3QP6A 2BY0A 4XMYA 2DXIA 1ZH5A 2FX0A 2CGPA 1SMTA 3T8TA 2ZCWA 1MMSA 3W2WA 4NDLA 4XNFA 3U1KA 4UUSB 2IRFG 4BUPA 2CJJA 2R7FA 3OYGA 4ZTFA 2CV2A 2ICWG 1JKOC 5L3DA 2COMA 1Z21A 3KE2A 4FETA 3H92A 1OCCH 4FT8A 3DXJF 4JYKA 2JA7J 1XSXA 3LQQA 1ZN2A 3K4NA 1Y8QB 4PJMA 3WODF 2HTSA 5GAHJ 1I50J 4UVCA 3PSFA 4MFDA 3S3NA 3DBLB 5C3EJ 3K69A 2ZJPF 2NVUB 2K02A 4B09A 2OPTA 2R7DA 3PM1A 1QA6A 2NYXA 2O7OA 5F64A 2HQNA 4DQ2A 1IO2A 2A05A 1Z91A 4LLLA 1HKQA 1VTNC 3G4SI 1VZ0A 3P7NA 1IXRC 1MDMB 3DPUA 2DU9A 4CCMA 1HC8A 4PJ0C 5JVGF 4U7BA 1ZG3A 1V3FA 2WBMA 3ECHA 3QPLA 1J7KA 5LBQA 2V1UA 3GLXA 4AYBA 1MKMA 5IPAA 2A6TA 2IXSA 3CF2A 1GXQA 5FFZA 3FMRA 5EDNA 3DEEA 1G3WA 1HW1A 3DEUA 3HYIA 4GYIA 1XD7A 4G6TB 3HSFA 3SZPA 1STZA 2BGCA 2Y2ZA 2QYOA 1ETOA 1J09A 4HEA2 1GDTA 1FOXA 3QOPA 3RTRA 2XAHA 3LSGA 3SZTA 4ANJA 2NAZA 5FLXZ 3HOUJ 3ESWB 1XDSA 2WY8Q 1BBYA 1TWHJ 2LLKA 3DLAA 1R49A 2WB1N 3VSLA 1K61A 1MNDA 3TW7A 3UR3C 3OWTA 4MEYF 3J80Z 3H35A 3NEUA 1ORKA 2OD5A 5FROA 1OCPA 2W24A 2ZC2A 4ZZDA 2XC7A 1R5ID 2F5VA 3PNYA 3BR5A 1A5JA 3HB9A 4XN0A 5H6QA 1WI3A 4BY1J 3TGNA 4YFNF 2HXOA 4KJZA 2VBWA 4A69C 2UZKA 3OIQA 5L3GA 3HOSA 3HOTA 1LDDA 4BQAA 4FE7A 4BHPA 4A5MA 3FXJA 2VKHA 1MH3A 3F8FA 4BNCA 4XM3A 3V8LA 4A3GJ 4AD9A 2HKOA 3H36A 2ZJRF 1LE8B 4EGYA 1FIPA 1JUSA 3Q5FA 4U0VA 3PUBA 3CCVI 3RZOJ 4X6AJ 5BOXA 1DPRA 2EV6A 3LSHA 1MGTA 4N4OB 1Y39A 3TDUC 2WADA 3IC7A 1WQ2A 2XF7A 4UXNA 1EV7A 1P2FA 2XB5A 2X6YA 2FQ4A 4ZDPA 1YS7A 2XF6A 2LMDA 4XORA 4IOAF 2KP6A 4BQOA 3OYEA 2HS5A 2Q2EA 2EBIA 4LJZF 4GXOA 3T0YA 1ZG1A 4AIJA 3Q9SA 4J01A 3OOUA 4CCOA 2LBFA 4A3JJ 2JPBA 3ABTA 3QQAA 1P9QC 4A3IJ 3CP8A 1QZYA 1U6GA 4I02A 2J5PA 1Z7LA 2H6CA 5FD5A 1APLC 5CPRB 1HKTA 2EFOA 1UMQA 1U78A 1KQ8A 2QM3A 2E5NA 1OLTA 4D7MA 2HOSA 1MMAA 2PX9A 2PI0A 1QHHD 2MSYA 3CJQB 3D0SA 5F27A 3H3VK 1UB9A 2M5WA 4HNVA 2K9NA 1JHHA 4KIBA 4XRFA 5CLSA 4LB6B 4MTEA 5FFXA 1K7AA 3NARA 3CCSI 3W2AA 1D0ZA 1E17A 1J75A 3OY9A 1K4SA 4MGRA 4R8HA 1I6HJ 1GT0C 1CF7B 1UJ8A 3U9GA 4BQQA 3GZ6A 2P0WA 3FMQA 2EFQA 3I58A 1D3YA 3SZGA 4PSWA 2MG4A 3FX3A 2DOEA 2W1OA 5EEAA 3S1RJ 3L2UA 3CC4I 4ZH4F 5EGOA 1UHMA 2HDWA 2PG4A 4IRGA 2ZB9A 2FXAA 2BVMA 3M8JA 3RYPA 2LVSA 3RPUA 2HTJA 4RA2A 3PFIA 2PMHA 2NRAC 3JAMZ 4QSHA 3LL7A 1TQIA 1B8IB 2KPMA 3CLOA 1S9HA 4HZFA 3CCYA 1JT6A 1TC3C 3KZYA 2EZIA 4AWXB 1WJEA 3AG3H 2HDDA 2E7XA 2Y30A 3IL2A 3K2ZA 3LSIA 4KT5C 1HBXG 1UZCA 4H4KC 3BG6A 2KDZA 2JSPA 5KHDA 4ETSA 2LC2A 3VDXA 3G3ZA 4P96A 1LB2A 1HW5A 4BBRJ 4S05A 1YJNI 3I4PA 2OF7A 3ZN1A 4UY8I 4HLXA 5EEHA 3V42A 2KFDA 2PJRB 1AKHB 4ESBA 3F0CA 2F5DA 4E6KG 1YOVB 2CQ7A 1ZARA 2ZJ2A 1P4AA 1TWAJ 3DU6A 3ZR8X 1SD5A 3DKXA 2RQPA 3RYRA 5EG0A 2KQRA 3OSGA 1R00A 1KQ0A 3PO2J 3D5SC 1HKSA 2VQLA 5DCMB 3MVPA 1DP7P 1OYWA 1E0EA 5AIPA 1Z6TA 3IRQA 3LSJA 3E5UA 1MMNA 4HAMA 1DP3A 4F91B 1E3HA 5FRNA 4C2MJ 1O4XA 4M71A 4PJNA 4WF2A 2E35A 4EJUA 2L4MA 4LFUA 3HC7A 3OIPA 3CUOA 4HF2A 1OYIA 4MQ9F 1RKTA 3V7SA 2B7EA 4HQMA 4RLFA 1ETVA 1A6QA 3QYBA 3WGGA 2FSWA 4I0BA 3BDDA 4LB5A 3S2DJ 3I53A 3HGGA 3R0JA 3GBGA 4C30A 1ZHFA 2E1OA 2JUCA 4BGDA 3JRGA 3QU6A 4HX7A 1QVUA 2DI3A 1P4XA 1WFXA 1OQYA 2VT3A 4FE4A 3JRBA 2V6EA 3GTKJ 3GTOJ 4M3DA 4NHJA 4I99C 1FX7A 2LOOA 2Y0SN 3L2VA 3VOEA 3Q9VA 4KICA 2AHQA 2PMUA 4Z2YA 3SDGA 2OU2A 2FEZA 1I3QJ 5LLQA 3HOXJ 3D1NI 2ISZA 1D8JA 3VEPA 3SQNA 2DMNA 3RQ4A 4CYCA 1G3TA 1IXCA 4BKXA 2R7RA 2LY1A 2OV7A 3U21A 3HUGA 1G2HA 2EPFA 1SD4A 5CQEA 2VJIA 1D0XA 4BJ5C 2XRNA 1SEUA 3Q3SA 3VB2A 2X9DA 3MN2A 2Z99A 1YTYA 3DEWA 4LD5A 2ZO4A 3LWFA 4LK0F 5F0FA 3JSPA 2KMUA 4PGHA 4XONA 5D8LB 3OR1C 2E2HJ 1Q1HA 2NS7A 3BWGA 2KISA 4EM2A 1S6LA 2MC3A 2EA4A 4RAZA 4GO1A 1X1CA 1TNTA 1ODDA 4A3DJ 5B1BH 4RB0A 3ZMDA 2M7BA 4A3LJ 3FHNA 2HKXA 5LGNA 2M4GA 1JUMA 3IP4B 1B59A 4IHTA 5CYVA 4WXCA 3FISA 3HSRA 4FISA 3LAPA 3CDLA 5KNLA 3BJOA 3L1PA 3E6MA 1ZR2A 2XSJC 2IT0A 1YIJI 4I0AA 4N9IA 4YEJA 2Z2SB 2OUMA 3GX4X 2JN6A 2KJCA 3FM3A 4L0YB 3C3WA 3BLYA 1O3RA 5J6XA 3IRRA 1QRYA 3DFGA 1W5TA 5F1RA 3F22A 3KP6A 2DFFA 1V54H 4F52A 2CUFA 3L9FA 3BR1A 1ZGAA 4I09A 3I56I 2VLAA 4CZCA 1VQKI 1Y0NA 2RAEA 2XAFA 4KDPA 1X3ZB 1IV6A 3ZRGA 4KFCA 4CZZA 1D5YA 2E60A 5TISC 2DT7B 2GZWA 3NWSA 4TV7A 1MBGA 2K86A 2CO5A 2B9SA 2E2JJ 4F92B 2VKVA 2D1VA 4A3CJ 3ERED 9ANTA 3K70C 3BTJA 3TEDA 2FBHA 2LFBA 2R0QC 3V7CA 2GA1A 4UNOA 3C2HA 2LD5A 1W36D 1VQLI 1R5HA 4AIKA 4W97A 4BAYA 1X4PA 2ZMEA 5GPAA 5E1XA 3F23A 3MMYB 4XBFA 5ICGA 2GXGA 3KEYA 3HJEA 3PQJA 4U0WA 2PBIA 5LEKA 1T39A 3DU5A 1FIAA 1BL0A 3DKYA 4X1EA 1XMKA 5FLMJ 3KCCA 4XRMA 3KLNA 4PK4A 4RGUA 4DJAA 3VYUB 3JAMK 2OZ6A 4IHVA 2R7SA 2PFBA 1JKPC 3ABMH 2VBZA 1B1BA 1FY7A 2X1EA 2R7OA 3HOVJ 2IVMA 5BS6A 2VOPA 3DPTA 2UXNA 3BPXA 1RR8C 1TWGJ 1V5EA 5L3FA 3J81K 3BCBA 1D0YA 2RNGA 2UXXA 2EK5A 1ZREA 2EFPA 3L2RA 3L09A 3J7AY 1F36A 1X1AA 3ASOH 1VQMI 1LFPA 1YX3A 2K3FA 3AAFA 1H0MA 2IAIA 3GVAA 3QAHA 5FGMA 1FYKA 2WV0A 4M72A 3X2QH 3TOAA 5HNHA 1UFMA 2DYSH 3GWZA 3L00A 4CCNA 4KA4A 1K6YA 4NUBA 4PSXA 1ZQ3P 1LEBA 1Z7UA 4HW0A 4FHTA 4Z6YA 3QYEA 3M8FA 5ILUA 4I01A 4BXUA 3BTIA 2KRCA 2Y0SA 3IWZA 4WXDA 1W0UA 3RQIA 3RPQA 1V55H 2XUBA 5A2QK 3OYMA 2DN0A 4KMFA 1QQIA 2K9MA 1W0TA 3VYSB 1RRJA 2YX7A 1G3YA 2K27A 5LGTA 3JR9A 3OL4A 4E7JA 1FOYA 2D45A 3FHZA 2E2IJ 1KU3A 2Q2EB 1DDNA 1PJRA 3BZKA 4N9HA 1PUFA 4ITVA 2LBFB 1QNTA 2EZKA 2ZNZA 2W84A 2XPUA 2X1CA 2XVCA 1FMVA 4M3EA 3SYTA 4YELA 1REPC 2LK2A 4AYBN 3KP3A 2R5YA 2LY9A 2FJ1A 1X58A 2BW3A 2FE3A 4M74A 1ZG5A 1J2XA 2VC0A 2JZYA 1LJ9A 5D4SA 3BQZA 3B6CA 3RKYA 2ELKA 4XR6A 4B48A 4Y7NJ 1FP2A 1D1AA 1G4DA 1UG0A 1B9NA 5EZHA 1KYWA 2Q8KA 2A07F 4UUVA 1FOKA 2IEKA 4BBSJ 3IAM2 5DYMA 2QVOA 2X85A 5IP6A 4P1WA 5D4RA 1U8BA 4Y15A 5LRRA 1V5FA 3T5XA 3KZIC 4L5IA 3BCAA 1HSTA 5IT9Z 2COBA 3DPLC 2DMQA 3BC8A 4DZJA 2QBYA 2CQXA 2AS5F 1J59A 3FXRA 2HU9A 4AIHA 3LQRA 5EGOB 2GOMA 4RBOA 3BR2A 3MZHA 1O3QA 1LDJA 2ACJA 2R92J 5HLIA 5E17F 1KU2A 2BBYA 4QTRA 3EPZA 3MEXA 2A3SA 1XCVA 4CO8A 5BQTA 2DOFA 2EIKH 3IHUA 4BEHA 2XGEA 4D9JA 4S0HB 1AHDP 5BMZA 4A6DA 2XPWA 2MGQA 1MBHA 2GQQA 1FJLA 3M9AA 1HDPA 5J4VA 1YE9A 2VC1A 4HV5A 3OYLA 5TGTA 3F8MA 4QPOA 3O6BB 2HQRA 3SFIA 3ZMTA 1Q1VA 4C9YA 2LYCA 3T1BA 4EJOA 1B6AA 1RZ4A 1IUFA 3MAJA 3IWFA 2G7UA 1S3JA 2O61A 5F1JA 3G1OA 3FM5A 4Y13A 2GBYA 4E70A 3OYIA 4YFXF 3DKWA 4BDYA 1BC8C 3CTAA 1MBFA 1W5SA 2BZTA 5EG0B 4I6ZA 3GEZA 3M07A 2QLZA 4M9ZA 1XX5A 4WCGA 1VQOI 2L7FP 1XGMA 1UHWA 2R7XA 3FXLA 1VNDA 3V8KA 2BXYA 3EETA 2H6BA 1G6NA 2DJIA 4HG2A 1F5TA 5IP9J 1TQPA 2DODA 2KHMA 3I71A 3CMYA 3WE3A 1DGRM 4E7HA 2LREA 2XV4S 2P5VA 4EV0A 4OU0A 4IOCF 2IGNA 2JSCA 2HNHA 1T08B 1SMYF 3I9V2 3ZQ7A 3GCMA 3HRMA 5E79C 4LG0B 1LFUP 4RM3A 3BJAA 4EM0B 4M3FA 2X51A 3CCQI 1FBQA 3TOBA 1XN7A 3CO6C 2MD0A 5L3EA 3FBIB 4DGWB 3LSKA 4CA0A 2DA3A 2M0CA 2O8KA 3TBIA 1XGNA 3VPRA 4YG2F 3OMYA 1QVTA 1R7JA 4JK1X 1LKXA 1T56A 4LLGF 4CYCB 4ENMA 3KETA 1YRNA 4GCVA 4XLPF 2DTZA 3HUGB 1RUNA 2DMPA 2EH3A 2L2OA 3RCOA 1LQ1A 3C2BA 2A5WA 2XGXA 2QCOA 4JX4A 4ZDLA 4L5JA 3DWLE 4PZJA 3QYFA 2ID3A 3PJRA 2DT6A 3V4GA 5AONA 2VE8A 3TMOA 4R1HA 2Y9ZA 2JUGA 2UWMA 2XB0X 3BZ6A 2VXDA 1MJAA 3JW4A 2ESHA 3A02A 2L3DA 3ASNH 3GZ5A 3LFKA 2A61A 4EMSA 3TDZC 3FZVA 3ZQIA 3DBHB 4YRVA 2CV1A 5DS9A 4L0ZB 4HNTA 2HPIA 4LITA 3ZQCA 2QSGX 4ZYEA 2CW0F 4L9JA 4BJ6C 3ZCOA 3T8RA 1IUYA 3H5NA 3LSMA 3Q0UA 5FO5A 4V19K 3A0HC 2KIMA 2IPQX 3EYIA 3D5RC 3S1NJ 4C3IJ 1T6SA 1BI0A 3N05A 2QSHX 1O7FA 4XRSA 2L9NA 3HOZJ 1VQ4I 4IRIA 1PUEE 1DU6A 2Y9YA 3A01A 1YIOA 1WH7A 2OJED 2R7TA 2CW8A 5M5XJ 2Q0OA 4F55A 3BJ6A 4G9YA 4LIUA 1U5TB 1XSDA 2P8TA 5IY5H 3HIFA 3QRFF 1VFCA 2VUMJ 2H1KA 3BZCA 3QODA 4BJTA 2W85A 2ZXHA 1QHGA 3GF2A 2DFIA 2QENA 3A1YA 1JJ8C 2Z1DA 2FOWA 4IHSA 2AO9A 3OYKA 3ABKH 4XLAA 4OIRF 3KEOA 3AL0C 2HVQA 4DYQA 1PDNC 3DP7A 2DA4A 2TRTA 3B6AA 2EQRA 3C7JA 2KLOA 3MZ8A 1MBEA 4BHCA 3CJTB 3JRHA 5ILSA 4GFBA 2CH0A 1ONVA 1VQNI 2A5YB 2XPVA 3IKVA 1U8RA 2ZMEB 2XHKA 4BU2A 2VONA 2E1MC 4NNJA 5HVQC 2YR2A 4LG3A 5J3LA 4HYEA 4WK8F 4DBRA 2CRGA 5BPDA 3LFUA 3I64A 2HI3A 4L9NA 2KZGA 1MMDA 2ZFWA 5FD6A 5E3OA 4EEFG 4IF4A 3AFHA 1EA3A 4BHBA 3VODA 3S14J 4XKVA 4HBLA 4UHTA 4CCJA 2F48A 5C4XJ 1AA7A 4XLEA 3I59B 1BIAA 1KYZA 2FF4A 3EUAA 2HVRA 1RR7A 4XLHA 4B1RA 2RGVA 1X4OA 4CYDA 3MKLA 3CO7C 5GAEJ 2DT5A 1U2WA 5EF6A 2NVXJ 2VASA 3GZNB 3KYLA 3MQ0A 2ZJQF 3N4MA 4KYWA 4LK1F 4LMYA 4U7DA 3QWLA 3TKYA 5H2FC 3FKIJ 1T98A 4U87A 2HFHA 2PQ8A 3ZN0A 1MZBA 3BG9A 4QIWN 2L9SA 4QLCU 5J1YA 1K78B 1IG7A 1LEAA 2FQ3A 3HOWJ 1ZKGA 3C1DA 3MFKA 4AVZA 4A3EJ 1MW7A 1IAWA 2MBFA 2HYGD 4IHYA 1P4WA 4UVBA 5CQGA 3TO9A 3WGIA 2ZSHB 3MD2A 5H20A 1XMXA 1ACIA 5FRMA 2IP2A 1UELB 2XROA 2FOKA 3GTMJ 1XGSA 3OOPA 4G8XA 2R7VA 4F93B 4Q5SF 5B3SH 2XSDC 4IKFA 3AKZA 1IRFA 2JMWA 4O6JA 2IJLA 1S7EA 4W1UA 3HPHA 4G12A 4PGGA 1MIJA 1WCMJ 4MLOA 2X6XA 3FXMA 5E20A 1JE8A 1J9IA 2PLYA 1WJDA 5HS7A 1G59A 2YSRA 3W2VA 1F4KA 2VQHA 3E6DA 1R1UA 2LNBA 1Z1DA 5D5WB 2RDPA 1F1ZA 3S32A 4HDVA 2K3PA 3GLLA 3PNVA 5DCFA 3GFIA 1KQ9A 2WC2A 4B3AA 5KCMA 3E6BA 1SD7A 2YS9A 2V9PA 1YITI 4EM1A 2MD5A 1PUFB 4WWCA 3FF5A 2CUEA 6PAXA 2EV0A 2HEOA 2L02A 2DK5A 2TDXA 3ZQFA 1HA8A 2FNPA 3CCJI 2XGCA 4HNUA 3GTPJ 2R5YB 3GMEA 1HF0A 2EV5A 4KMUX 4G94A 5ED4A 1TQMA 5D6FA 3IKTA 2STTA 2UV1A 4A3MJ 1OR7A 3RKXA 1JJ6C 5CVUA 2UUZA 1IZ1A 2WA0A 3A0BC 2DA2A 3QPSA 1Z05A 3FBNB 2E5ZA 2DW4A 2LR8A 3I54A 5ERIA 3RSNA 3GO5A 2EZHA 3CD6I 2MC4A 3REOA 5IYDJ 4GRIA 4J00A 1FSEA 2LDUA 1SFOJ 3CF5F 3BR0A 3S2WA 2P5LC 2M2EA 4AM3A 1OPCA 4RDUA 1E2XA 2KT0A 1LPQA 1LUJB 3EUHA 4G7OF 1VQ5I 5EYRA 1Y6IA 3G1LA 4M3BA 5M5WJ 1JKQC 2DFEA 2Y48A 2QZ8A 5CVJA 4ENJA 4OIOF 3U1DA 4BS9A 4MNUA 2VKDA 4OMYA 4R79A 1S7AA 4BEHB 1B72A 2M7AA 3MKYB 2DMUA 3LMMA 4A0YA 4A2UA 2H94A 5E3MA 2DPDA 5FLXK 5DV5A 5IOYA 3S15J 4HF0A 2KJBA 5J8CA 1RUOA 2MFZA 4B8XA 2RN7A 1AWCA 4XOTA 1DU0A 1CQTA 4DZPA 2WY7Q 3J80K 1FEXA 3HSEA 2DJNA 3WTYC 2QQ9A 1ZLJA 2YUSA 1ULYA 5M5YJ 3F9KA 3ZP5A 3WE2A 1DPUA 3P9CA 2D1HA 3P9KA 1N77A 4E7ZA 2IS2A 4GDFA 1OYYA 4IJAA 1ITYA 2AXLA 4B43A 5J8FA 3SXYA 4BDZA 2K85A 1TWCJ 4L18B 4JP0A 2RC4A 2L01A 2F5FA 2VBYA 2HR3A 2X0LA 2DA5A 3FXUA 3KP4A 3O2PE 4CHUA 1LFBA 1USSA 4QWQA 2C6YA 2MLGA 2JVHA 5JHFA 3K4KA 1D1BA 1BW5A 3WHCA 2H09A 3R61A 3MKWB 3GFJA 2V1DA 3JTGA 3QU3A 3JRIA 1X1DA 4ESFA 3L2QA 1JHFA 1FWZA 1R1VA 1ZTRA 5LD2C 2MW8A 4Q4ZF 1WWXA 1XMAA 2JVGA 3WTZA 1QO0D 3BY6A 4DIQA 4JX6A 2QKLB 5ILVA 3K70D 3DTIA 2IA1A 3SJMA 2FA5A 1YW8A 2PN6A 1A35A 4LLNA 2WV1A 2CQQA 2V6CA 1ZELA 3F21A 1JTYA 5BNGA 4FASD 1FPQA 1IN6A 2PMZN 1IW7F 2JA6J 2JK3A 1UAAA 1SFXA 2NOJB 4ZC3A 1NK3P 3LSRA 2VN2A 1ZRCA 3ECOA 1BR2A 4NQWA 4YIIA 2ME6A 1D5VA 1X2NA 2XDVA 3CLQA 1IRXA 2DPUA 1WH5A 4F3QA 4ZDOA 1H8AC 3G1MA 2HZTA 1IV8A 2H1LA 1TL8A 3CMMA 4CGZA 3BG7A 3FMSA 4A3BJ 3ZGKA 3UKGA 3LA2A 2Y75A 2A6HF 3I5UA 3MZYA 4E7IA 1Y8RB 5CVIA 3RPUD 4OAYA 3OYBA 1Y0UA 5K5RA 2VT2A 2OQGA 2W57A 1FC3A 3S1QJ 2F6CA 1LVAA 3FK7A 1P92A 4RAFA 4HOBA 3GFLA 1S72I 1K83J 2LG4A 3JRAA 2RV8A 3JRDA 2VXZA 4XIDA 4U0YA 2VIXA 3KFWX 5L3BA 2JA8J 1Z0XA 3RI4A 4M9XA 3CCEI 1P7JA 4XL9A 2GOXB 4PFPA 3W6JB 4BL0B 1PP8F 4M6XA 3S93A 3CC7I 3CDIA 3KYDB 1K4TA 2R4GA 2IBDA 2MABA 4ZYGA 3HTUA 3A01B 1DQUA 1USTA 2ESNA 1XPXA 3BTCA 4UB8C 5D6EA 3G73A 4IZZA 4JBAA 2WTEA 3H9GA 4E4HA 2XF5A 4FCYA 3OYHA 1OR7C 4B44A 1AU7A 1RPWA 5CVVA 1T0FC 1OCOH 4XLNF 1BC7C 2QUFA 1XCBA 1Y1VJ 1J0RA 5LHIA 1TWFJ 1KU7A 1SFEA 2LTPA 3HRTA 3JTHA 2QEXI 4IO9F 3Q0WA 2ELHA 2Z16A 5EEGA 4HDUA 1I27A 5GTIC 1X1PA 1H9GA 2HYJA 5CKTA 1D1CA 1F9NA 4DYRA 4A93J 1JT0A 3EUHC 1I1SA 3O3KA 4RAGA 1JGGA 1JGSA 3H9JA 4RGRA 3E0JB 1JKRC 3RKQA 3AG4H 2F5EA 4PUSA 5GP9A 2HOTA 2CW7A 1U9OA 3OIOA 1GV5A 3CDHA 2OZUA 3JCUC 5HDGA 4A0XA 1O57A 3CJNA 2XGDA 3IH2A 1YI2I 3HTSB 5ICFA 3WHBA 1R4MB 2QA4I 4FX0A 1ZR4A 4OIPF 5L3CA 1MSFC 2M4KA 1L0OC 1YG2A 1HOMA 1PP7U 2RQQA 2XASA 4AVPA 5B1AH 5J4YA 2FNAA 4KN4X 4DYCA 2ZKZA 5FB2A 2IGKA 1V5GA 2K4JA 2Y31A 1TT0A 4P55A 1IF1A 2HOAA 1G3SA 3BR6A 4Y3OA 3PUFA 1GV2A 1HQCA 3R4KA 1ZLKA 3K4CA 1W4MA 4M3GA 4ENNA 1G8XA 1YYVA 3VSKA 4S04A 4IVNA 4RB1A 2PJPA 2VJ4A 1FT9A 1AKHA 4OIQF 2V9KA 1SAUA 4M73A 1IXSB 1EF4A 2DQLA 1YQAA 4NB5A 1MNEA 2CSOA 5KAFC 2RREA 3G6EI 2FRHA 4MTDA 1BA5A 2JTVA 5JVTA 2HOEA 3JSOA 2A69F 5J40A 5K7FA 3A4CA 2PMZA 5HODA 4G7ZF 3ELKA 3J7YJ 3OSFA 2VODA 1XGOA 3OYCA 5IP7J 2GIZA 2X6WA 1KU9A 4HX8A 3HEFA 2YPRA 5DD4A 5JLXA 3OYFA 1PYVA 1GVJA 3R60A 3BROA 1A6IA 5HLHA 1HXDA 2VJJA 2X48A 3HGYA 3A03A 4ZZLA 2L5QA 2R7QA 1I6XA 4UV9A 4XQFA 1ZGWA 4I98B 4CICA 5K1YA 3M7GA 2Z5UA 2LP0A 1A31A 1FYLA 1W1WE 2V1XA 1E3PA 1JXSA 4E7KA 5GAGJ 4RMNA 5J1UA 3F8BA 1YO5C 3W3CA 3ZPLA 1MD0A 1OISA 4D5CA 2F4MB 3BOQA 1IN8A 2FMLA 3PNTA 2BY2A 3CCLI 5HDNA 5ICEA 3V8JA 2KIQA 5D5VB 2A6EF 1ZAOA 5TJJA 1WJAA 1GLNA 1RKWA 3K10A 1YW7A 4U88A 5F0HA 3DCFA 4IXAA 3OYNA 1Z67A 3VWBA 2G9WA 2HGCA 2L9VA 4K2EA 3TQNA 1BJAA 2L0KA 2LRDA 3ZQHA 4HV6A 2O6GE 2BVLA 1QBJA 1ERDA 3FXQA 3FXOA 5IT3A 4EATA 2B0LA 2E1CA 4A3FJ 1TW2A 4I2OA 5GTHC 3WTUC 3CMAI 5AIQA 1T2KA 2ZXJA 4C3JJ 1Y1WJ 1ON1A 1JUPA 3ZXSA 1FLIA 1R71A 4UB6C 4XKCA 2KL4A 2M3AA 2EIMH 3CESA 2BXZA 1A04A 2DDBA 4P5OA 1ETWA 1YX5A 5F0CA 2L4AA 2OAZA 4J19A 2MYSA 1B72B 1BM9A 1N25A 3K6GA 1MMGA 4IPAA 2L54A 3RDIA 3K4BA 4IRHA 4YIFA 1HDDC 3PSIA 4F7ZA 3JRCA 5B66C 4BQNA 4ON0A 5IYBJ 1NTCA 2DLLA 2I8DA 1VQ8I 5K5QA 2XAJA 4KIGA 1YHQI 4OAZA 2B63J 4MHGA 3IAS2 4KIFA 4PDKA 3SEZA 3I3LA 5E18F 4II2A 5J1RA 3H0GJ 5KVRA 1NHAA 1ETQA 5D5UB 5D8KB 4LOCA 1HLVA 4WX9A 1R36A 2CS3A 2EZLA 2V7FA 2W82A 1T95A 3WTTC 5HLGA 4D5FA 4ZYAA 4BXFA 1H9TA 3E5XA 4E7LA 4EJWA 2KIFA 3V7RA 2EB7A 3PQKA 2VB6A 1MH4A 5J47A 2HDCA 4M6YA 3LSPA 4GGGA 3BG5A 2VI6A 3CCUI 4CH7A 2QQAA 4Y52J 4XKBA 3Q0VA 3S3OA 1NG6A 1WZ2A 4M6VA 3GFMA 3EUKL 4P9UA 2BHZA 2LKPA 3HBLA 3U2RA 3KLOA 1FBUA 3VFZA 2WWYA 3KP7A 4BY7J 1OJLA 1WJFA 3WG7H 1J5YA 2Z3YA 4HQEA 3HRSA 1BIBA 3KEQA 3NWTA 2ELJA 2E34A 4CCLA 2JT1A 3S16J 2LKSA 2G7HA 5LEJA 1V4RA 3F8NA 1QZEA 4O5VA 3OS2A 2K7LA 2BYVE 1R23A 3K4LA 4I76A 3O8HA 3WU0A 2DA1A 4MFEA 3K1MA 2N8GA 5TRDA 5IYCJ 1ETYA 1IJWC 4ZTJA 4NQWB 1QGPA 1ENHA 1XTAA 5FKMA 3CP2A 4B4CA 5E3LA 2MH9A 2VKEA 2EINH 5E1ZB 3F72A 2QWWA 3H3UA 4PJLA 4CCKA 4HA8A 2LSOA 1BOBA 3OL3A 3I4MJ 1LDKB 3KPHA 1T8IA 5IT9K 4RB3C 3ISPA 1R22A 2MLKA 2P4WA 2RKHA 3CUQA 3PFYA 4V2FA 3OYJA 2AQFA 1YJWI 1FTZA 2M8EA 1RI7A 1XDUA 2MA3A 1GXPA 1WJBA 1R6RA 2KKOA 4XSXF 4BE0A 3K4MA 3I55I 2GXAA 4CSWA 4B3XA 2R7UA 4KNYA 4AIDA 4ZYHA 4RB2C 2JQ7A 2E19A 5LHGA 1U0JA 4A12A 4XOPA 1WI9A 3WU2C 1BN5A 1EKEA 2F4IA 3DTKA 3DF8A 1SD6A 4XLFA 4L5EA 1ZYRF 2K9SA 2STWA 2G0EA 4HRIA 3EQLF 2NNNA 1I39A 2EIJH 3DBRB 1SAXA 2KIUA 2O9LA 2DA7A 5JR3A 3FK6A 3J7AO 3ZMUA 5C44J 3ZMVA 3P5JA 3LAJA 5B5EC 2X4HA 4ZYDA 3TO6A 4XRSG 2DFHA 3ZQGA 1IC8A 3OR2C 3G2BA 1RC9A 2F2EA 2ZFUA 3BQYA 3ULQB 2HYFA 4YIRX 4B47A 3WTXC 2WAQN 2R5ZA 1H89C 2XAGA 4FTHA 4A3KJ 1IN4A 2K4BA 3HHGA 1R1TA 2AQEA 1W5CC 4HX4A 4FX4A 1Z9CA 3HKZA 2FMYA 2M0MA 4LIVA 3KIOA 3AG1H 3CC2I 1IDYA
chains in the Genus database with same CATH topology
2FOWA 2QEXI 4IO9F 4IOCF 5GAHJ 3CCJI 2E35A 2E34A 4IOAF 3CCLI 1VQ7I 3CJTB 2ZJPF 1VQNI 1QA6A 1VQLI 3CCQI 5DM7F 3G4SI 2H8WA 3CCRI 1YJ9I 1YI2I 3CD6I 1HC8A 5JVGF 3CF5F 2QA4I 3CMAI 3CCSI 1VQ5I 3DLLF 5GAEJ 1YJWI 2ZJQF 1FOWA 1FOXA 3CC4I 5GADJ 3J7ZI 3I55I 1VQMI 2K3FA 1S72I 2JQ7A 3CMEI 1VQ8I 3PIOF 1YHQI 2NXNB 1ACIA 3CCEI 3G6EI 3CC7I 1YIJI 2OTLI 4V19K 3J7YJ 1YJNI 3CCMI 4UY8I 1VQ4I 3I56I 1VQ9I 1VQKI 1VQ6I 1VQOI 3CCUI 2ZJRF 3PIPF 1MMSA 5DM6F 3CCVI 1VQPI 1Y39A 3G71I 2E36A 1FOYA 5GAGJ 1YITI 3CC2I 2OTJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOW A;  2QEX I;  4IO9 F;  4IOC F;  5GAH J;  3CCJ I;  2E35 A;  2E34 A;  4IOA F;  3CCL I;  1VQ7 I;  3CJT B;  2ZJP F;  1VQN I;  1QA6 A;  1VQL I;  3CCQ I;  5DM7 F;  3G4S I;  2H8W A;  3CCR I;  1YJ9 I;  1YI2 I;  3CD6 I;  1HC8 A;  5JVG F;  3CF5 F;  2QA4 I;  3CMA I;  3CCS I;  1VQ5 I;  3DLL F;  5GAE J;  1YJW I;  2ZJQ F;  1FOW A;  1FOX A;  3CC4 I;  5GAD J;  3J7Z I;  3I55 I;  1VQM I;  2K3F A;  1S72 I;  2JQ7 A;  3CME I;  1VQ8 I;  3PIO F;  1YHQ I;  2NXN B;  1ACI A;  3CCE I;  3G6E I;  3CC7 I;  1YIJ I;  2OTL I;  4V19 K;  3J7Y J;  1YJN I;  3CCM I;  4UY8 I;  1VQ4 I;  3I56 I;  1VQ9 I;  1VQK I;  1VQ6 I;  1VQO I;  3CCU I;  2ZJR F;  3PIP F;  1MMS A;  5DM6 F;  3CCV I;  1VQP I;  1Y39 A;  3G71 I;  2E36 A;  1FOY A;  5GAG J;  1YIT I;  3CC2 I;  2OTJ I; 
#chains in the Genus database with same CATH topology
 5E1W A;  2CWE A;  1FYM A;  4RGX A;  2A68 F;  2Q1Z B;  3KX2 A;  4DBQ A;  1VQ7 I;  2O3F A;  2IS6 A;  2ECC A;  2V9V A;  2NVT J;  1CGP A;  1QPI A;  2M30 A;  1NG7 A;  4I7H A;  3HDD A;  1RET A;  1XSV A;  2BOL A;  2QSF X;  3E7L A;  5DM7 F;  3GYH X;  2IS4 A;  3HXL A;  3LOC A;  3MKZ A;  5K7Z A;  4ABZ A;  2EFW A;  1YJ9 I;  2X6O A;  4HST A;  2EA2 A;  2DAO A;  1S8N A;  3E5Q A;  1FTT A;  4EQQ A;  4ENK A;  1WPK A;  5HLT A;  3WG9 A;  2IGM A;  1IDZ A;  4OOI A;  3QPH A;  4QPQ A;  2LH9 A;  3TW6 A;  1X2M A;  2BW3 B;  3DLL F;  4MO7 A;  2M1B A;  4XSZ F;  3PO3 J;  1T0F A;  4ESJ A;  2ADU A;  2I5U A;  1YFH A;  3J81 Z;  2D5V A;  4KIS A;  4PFO A;  1R9T J;  2FBK A;  3S2H J;  3ABL H;  3CQZ J;  5FKO A;  1FSH A;  1S5L C;  3AL0 B;  2FU4 A;  1I5Z A;  5CVR A;  3OYD A;  1W7P A;  1TP4 A;  5JI6 A;  5LFA A;  1RES A;  3S17 J;  3QOE A;  3CZ6 A;  3RKW A;  3H3Z A;  1F43 A;  2E1M B;  2GIV A;  3K1N A;  1EH7 A;  3LA7 A;  3PIO F;  2FUG 2;  1ZRD A;  1P6R A;  2QBY B;  5HDK A;  3HPG A;  3VYR B;  1TLH B;  2JRT A;  1WVR A;  2BEO A;  3FXK A;  4HPQ A;  1IN7 A;  1WKM A;  3GXO A;  3M1E A;  2IA2 A;  3D5L A;  1EJ9 A;  4MIM A;  2CG4 A;  1BW6 A;  2O5R A;  4L9T A;  3PL8 A;  5HS9 A;  1Z6R A;  3OS0 A;  2DCE A;  4HSR A;  1HW2 A;  4FQG A;  3F3X A;  2WB1 A;  5EZG A;  5A2Q Z;  3WTV C;  1OKR A;  2W00 A;  3HRU A;  1IN5 A;  1O3S A;  3H1C A;  3ML6 A;  4LG0 A;  3PIP F;  4LGW A;  1OCZ H;  3GUD A;  2KRH A;  2BY3 A;  1OCT C;  1VQP I;  5F6F A;  2V1N A;  2E36 A;  2O0Y A;  1O7L A;  3S8P A;  4HLY A;  1UCR A;  1KON A;  4UUS A;  1BR1 A;  2Y69 H;  2AXT C;  2XAU A;  3OS1 A;  3QP5 A;  4C3H J;  1OFC X;  3ROU A;  4JX5 A;  4XK4 A;  3S3M A;  4ZJZ A;  1FZP B;  2BV6 A;  2E71 A;  2Y0M A;  2RVC A;  3TP3 A;  1BR4 A;  1IRG A;  3BR3 A;  3FIW A;  4EGZ A;  2L7Z A;  1FBS A;  4IEJ A;  1LNW A;  3DV8 A;  5ICC A;  3RIR A;  1T33 A;  3WTW C;  2X1D A;  2CV0 A;  2YU9 J;  5FKL A;  1C0W A;  1XB4 A;  3BT9 A;  2HQA A;  3IV5 A;  2EIL H;  2VJ5 A;  2IS1 A;  1ZGJ A;  1TZL A;  3F6V A;  4BE1 A;  1RIO H;  1FMW A;  3CUQ C;  3MWM A;  2HXI A;  3SHF A;  1N75 A;  3H5R A;  2DDA A;  1TW3 A;  4XKW A;  5DDG A;  3TL4 X;  3E1S A;  1B4A A;  2OA4 A;  3BTL A;  3C18 A;  1DUX C;  2EWN A;  1MSE C;  1MDM A;  4YFK F;  4E7S A;  1R5G A;  4D0P A;  2VPR A;  2VL8 A;  1MBK A;  4DNC A;  3P9I A;  1Y56 A;  2WAQ A;  1D8K A;  4BAC A;  2DTR A;  1MNM C;  5F08 A;  3O8G A;  3H9Q A;  1I1G A;  2DA6 A;  4BE2 A;  1MBJ A;  5HS8 A;  1IGN A;  2JPC A;  4C2T A;  4NC6 A;  4RLQ A;  4IHW A;  1SVO A;  2BHY A;  3KZZ A;  2JWT A;  1MJB A;  4MQV A;  2ZSI B;  2DOA A;  1YLF A;  2E7W A;  4KN7 X;  5GAD J;  3J7Z I;  3HOY J;  2TCT A;  1YRN B;  1SVL A;  2W7N A;  2CQK A;  4NC8 A;  1UHS A;  4H0E A;  1YS6 A;  2FD5 A;  2D2W A;  3KYC B;  5JLW A;  3W6V A;  2P7C B;  4IQ4 A;  2L9R A;  3SEQ A;  3L2C A;  4RGS A;  5DEQ A;  2H27 A;  2XKP A;  2QQ8 A;  5K5O A;  3R0A A;  4O3M A;  3GTJ J;  2K9Q A;  1JTX A;  4AUX A;  2CFX A;  5DUK A;  5FLV A;  3ERM A;  1U5T A;  4DOZ A;  2CYY A;  1SVM A;  2LF8 A;  2R93 J;  4MEX F;  1TNS A;  3HZJ A;  1A36 A;  4EJT A;  5F04 A;  4NBQ A;  4IHX A;  3GTQ J;  3K7A J;  2EJR A;  1SC7 A;  5JFR A;  3KP2 A;  2GLO A;  2VBX A;  3COA C;  5DUI A;  3IH4 A;  1VQ9 I;  3ONQ A;  5HOO A;  1VQ6 I;  2J5O A;  4BH9 A;  5H6R A;  5CJ9 A;  2HPM A;  2CFO A;  5DTD A;  1M1E B;  2O03 A;  3B02 A;  3BG3 A;  4PCQ A;  2WAE A;  3VYT B;  4RM2 A;  1I3A A;  4A0Z A;  3OYA A;  3KP5 A;  4BYY A;  2ZXI A;  3K4J A;  1O3T A;  4AC0 A;  2K9L A;  2GAU A;  1LE8 A;  1NK2 P;  2BE5 F;  3A2K A;  1ZRF A;  2GM4 A;  4EJV A;  3HM5 A;  1HSJ A;  3OV8 A;  1W36 C;  2OTJ I;  2KDO A;  4ASN A;  3MCZ A;  4CUG A;  3WTS C;  3JRE A;  1S29 A;  2CMP A;  3GTL J;  4KT6 A;  3RJP A;  3LA3 A;  4KIT B;  1N78 A;  2CUJ A;  2KZV A;  1T38 A;  2E1N A;  3B73 A;  1LVK A;  2QQB A;  1PVE A;  5LGU A;  3I59 A;  3SDB A;  1S7O A;  2M45 A;  2NS0 A;  1W7P D;  2R7W A;  1VI0 A;  1AOY A;  3AG2 H;  2ID6 A;  2DBB A;  3WU1 B;  3CCR I;  3K1P A;  3F8C A;  2H8R A;  3QPT A;  1TT5 B;  1BJZ A;  3I0T A;  3FDY A;  4N4N B;  3H5A A;  2IA0 A;  2ECB A;  1GVD A;  2NOG A;  3SFZ A;  1K78 A;  1TTY A;  1Z77 A;  1MJ9 A;  4G6Q A;  2GXB A;  3M3Y J;  2K5C A;  3CUQ B;  3M8E A;  5E8G A;  5M3F J;  2HQ5 A;  3DTE A;  1R4N B;  2LKX A;  2DO7 A;  4OIN F;  3BPV A;  1OCR H;  4CDG A;  2JA2 A;  3RZD J;  4D1Q A;  2IGO A;  2V79 A;  1CF7 A;  2W4S A;  3K2A A;  2NNY A;  2OC6 A;  5HNF A;  2JRM A;  1YW9 A;  2DQR A;  1WGX A;  3ABU A;  4Y4R A;  5KK1 A;  2VQC A;  5E3N A;  2LF7 A;  2OBP A;  1KA8 A;  1KGS A;  2NVY J;  2GA2 A;  3FKJ A;  4RAY A;  3IH3 A;  4Y17 A;  1ETX A;  1WRJ A;  1B9M A;  3NRV A;  2JJ7 A;  4OMZ A;  1QZZ A;  3HL2 A;  1UG2 A;  5K7H A;  1Z3X A;  2YX4 A;  1BOA A;  1BI2 A;  4G6D A;  4XIC A;  2ZBK A;  1U9N A;  4BXX J;  2HWV A;  2M34 A;  1B8I A;  4IX7 A;  2NVQ J;  4Q47 A;  2W25 A;  2VQG A;  5LRS A;  4OWR B;  2YU3 A;  2K40 A;  2R7Z J;  4D7N A;  2XIG A;  3ZQQ A;  2OTL I;  1OMI A;  2EFN A;  1QU3 A;  4UUT A;  3GTG J;  3K9T A;  2CUZ A;  2P6S A;  2ZNY A;  4UVA A;  4P9F A;  3UNG C;  4V2G A;  3E3V A;  2CQN A;  2GWR A;  2P7V B;  3TP0 A;  2R5Z B;  1HCR A;  2ETH A;  3EYY A;  3DQV C;  4RS8 A;  5E8I A;  2V26 A;  2DYR H;  3ZMS A;  3E6C C;  1GUU A;  1WSU A;  1QPM A;  2PJR A;  3NQO A;  1X19 A;  5FKN A;  2OQR A;  5DM6 F;  1WHU A;  1K79 A;  3G71 I;  2MH2 A;  3LNQ A;  5JHU A;  3N97 A;  5EJC A;  5M3M J;  5DCM A;  1RNL A;  2XRL A;  2VPL A;  3CME I;  5FKK A;  1IRZ A;  4HF1 A;  2P5K A;  1H88 C;  2JA5 J;  3H0D A;  2R3S A;  2IW5 A;  1KZH A;  2LY2 A;  5D5X B;  2I10 A;  4X0G A;  1FP1 D;  2KRF A;  4GYG A;  3S1M J;  3L7W A;  1EH6 A;  2Z33 A;  2Z9O A;  4UV8 A;  1EH8 A;  4L9V A;  2W48 A;  2M9H A;  2H8W A;  1JI8 A;  2XAQ A;  4EVI A;  1X1B A;  2F5C A;  1XG1 A;  3HG9 A;  4XLC A;  3M1C A;  2O8X A;  1Z3Y A;  2QF7 A;  2VE9 A;  2L7M P;  3ZOB A;  4N0B A;  2ISY A;  1ETK A;  1P7I A;  3E97 A;  3FWE A;  1FNN A;  1X3U A;  2DMT A;  5LHH A;  4IQJ A;  2F4O B;  1DGW Y;  3CJR B;  3IUO A;  3K0L A;  3M4O J;  1WJ5 A;  3WGH A;  1R58 A;  1K6O A;  5FJ8 J;  2QKM B;  1E3O C;  2OCC H;  2CU7 A;  3R6S A;  3C2G A;  4PJJ A;  3L2W A;  1TBX A;  2FBI A;  2RNJ A;  4JQF A;  1WJC A;  1SFK A;  1W7P B;  4KUM A;  1GHC A;  5IOZ A;  2ZXW H;  1U5T C;  2PEX A;  4C2U A;  1POG A;  2QGU A;  1ZK8 A;  1FOW A;  1X3W B;  3LST A;  4A5N A;  4XN3 A;  5GPC A;  3I4N J;  4AU7 A;  4M9S A;  2BY1 A;  2NS8 A;  2WAF A;  2P81 A;  4A6E A;  3TO7 A;  3GW2 A;  5DD8 A;  3HHH A;  2OCE A;  4DW6 A;  5C4J J;  1BI3 A;  2VOO A;  1U3E M;  2NXN B;  3JRF A;  3BP8 A;  3F6O A;  4II3 A;  2HZD A;  5BPI A;  4WXH A;  1NH3 A;  2M8G X;  3ZQL A;  2XKO A;  1SFU A;  1ON2 A;  2ZME C;  3NAU A;  1XC5 A;  4JOM A;  4G7H F;  4NC7 A;  3HKZ N;  5KAI C;  1VF9 A;  4IL6 C;  1L3L A;  4Q48 A;  1BI1 A;  1XS9 A;  2V4J C;  2M87 A;  2ME0 A;  2P6T A;  3CCM I;  1SAN A;  4Y33 A;  3W6K B;  2L7K A;  2DK8 A;  3EDP A;  4CXF A;  2HVS A;  3ZMZ A;  3QP6 A;  2BY0 A;  4XMY A;  2DXI A;  1ZH5 A;  2FX0 A;  2CGP A;  1SMT A;  3T8T A;  2ZCW A;  1MMS A;  3W2W A;  4NDL A;  4XNF A;  3U1K A;  4UUS B;  2IRF G;  4BUP A;  2CJJ A;  2R7F A;  3OYG A;  4ZTF A;  2CV2 A;  2ICW G;  1JKO C;  5L3D A;  2COM A;  1Z21 A;  3KE2 A;  4FET A;  3H92 A;  1OCC H;  4FT8 A;  3DXJ F;  4JYK A;  2JA7 J;  1XSX A;  3LQQ A;  1ZN2 A;  3K4N A;  1Y8Q B;  4PJM A;  3WOD F;  2HTS A;  5GAH J;  1I50 J;  4UVC A;  3PSF A;  4MFD A;  3S3N A;  3DBL B;  5C3E J;  3K69 A;  2ZJP F;  2NVU B;  2K02 A;  4B09 A;  2OPT A;  2R7D A;  3PM1 A;  1QA6 A;  2NYX A;  2O7O A;  5F64 A;  2HQN A;  4DQ2 A;  1IO2 A;  2A05 A;  1Z91 A;  4LLL A;  1HKQ A;  1VTN C;  3G4S I;  1VZ0 A;  3P7N A;  1IXR C;  1MDM B;  3DPU A;  2DU9 A;  4CCM A;  1HC8 A;  4PJ0 C;  5JVG F;  4U7B A;  1ZG3 A;  1V3F A;  2WBM A;  3ECH A;  3QPL A;  1J7K A;  5LBQ A;  2V1U A;  3GLX A;  4AYB A;  1MKM A;  5IPA A;  2A6T A;  2IXS A;  3CF2 A;  1GXQ A;  5FFZ A;  3FMR A;  5EDN A;  3DEE A;  1G3W A;  1HW1 A;  3DEU A;  3HYI A;  4GYI A;  1XD7 A;  4G6T B;  3HSF A;  3SZP A;  1STZ A;  2BGC A;  2Y2Z A;  2QYO A;  1ETO A;  1J09 A;  4HEA 2;  1GDT A;  1FOX A;  3QOP A;  3RTR A;  2XAH A;  3LSG A;  3SZT A;  4ANJ A;  2NAZ A;  5FLX Z;  3HOU J;  3ESW B;  1XDS A;  2WY8 Q;  1BBY A;  1TWH J;  2LLK A;  3DLA A;  1R49 A;  2WB1 N;  3VSL A;  1K61 A;  1MND A;  3TW7 A;  3UR3 C;  3OWT A;  4MEY F;  3J80 Z;  3H35 A;  3NEU A;  1ORK A;  2OD5 A;  5FRO A;  1OCP A;  2W24 A;  2ZC2 A;  4ZZD A;  2XC7 A;  1R5I D;  2F5V A;  3PNY A;  3BR5 A;  1A5J A;  3HB9 A;  4XN0 A;  5H6Q A;  1WI3 A;  4BY1 J;  3TGN A;  4YFN F;  2HXO A;  4KJZ A;  2VBW A;  4A69 C;  2UZK A;  3OIQ A;  5L3G A;  3HOS A;  3HOT A;  1LDD A;  4BQA A;  4FE7 A;  4BHP A;  4A5M A;  3FXJ A;  2VKH A;  1MH3 A;  3F8F A;  4BNC A;  4XM3 A;  3V8L A;  4A3G J;  4AD9 A;  2HKO A;  3H36 A;  2ZJR F;  1LE8 B;  4EGY A;  1FIP A;  1JUS A;  3Q5F A;  4U0V A;  3PUB A;  3CCV I;  3RZO J;  4X6A J;  5BOX A;  1DPR A;  2EV6 A;  3LSH A;  1MGT A;  4N4O B;  1Y39 A;  3TDU C;  2WAD A;  3IC7 A;  1WQ2 A;  2XF7 A;  4UXN A;  1EV7 A;  1P2F A;  2XB5 A;  2X6Y A;  2FQ4 A;  4ZDP A;  1YS7 A;  2XF6 A;  2LMD A;  4XOR A;  4IOA F;  2KP6 A;  4BQO A;  3OYE A;  2HS5 A;  2Q2E A;  2EBI A;  4LJZ F;  4GXO A;  3T0Y A;  1ZG1 A;  4AIJ A;  3Q9S A;  4J01 A;  3OOU A;  4CCO A;  2LBF A;  4A3J J;  2JPB A;  3ABT A;  3QQA A;  1P9Q C;  4A3I J;  3CP8 A;  1QZY A;  1U6G A;  4I02 A;  2J5P A;  1Z7L A;  2H6C A;  5FD5 A;  1APL C;  5CPR B;  1HKT A;  2EFO A;  1UMQ A;  1U78 A;  1KQ8 A;  2QM3 A;  2E5N A;  1OLT A;  4D7M A;  2HOS A;  1MMA A;  2PX9 A;  2PI0 A;  1QHH D;  2MSY A;  3CJQ B;  3D0S A;  5F27 A;  3H3V K;  1UB9 A;  2M5W A;  4HNV A;  2K9N A;  1JHH A;  4KIB A;  4XRF A;  5CLS A;  4LB6 B;  4MTE A;  5FFX A;  1K7A A;  3NAR A;  3CCS I;  3W2A A;  1D0Z A;  1E17 A;  1J75 A;  3OY9 A;  1K4S A;  4MGR A;  4R8H A;  1I6H J;  1GT0 C;  1CF7 B;  1UJ8 A;  3U9G A;  4BQQ A;  3GZ6 A;  2P0W A;  3FMQ A;  2EFQ A;  3I58 A;  1D3Y A;  3SZG A;  4PSW A;  2MG4 A;  3FX3 A;  2DOE A;  2W1O A;  5EEA A;  3S1R J;  3L2U A;  3CC4 I;  4ZH4 F;  5EGO A;  1UHM A;  2HDW A;  2PG4 A;  4IRG A;  2ZB9 A;  2FXA A;  2BVM A;  3M8J A;  3RYP A;  2LVS A;  3RPU A;  2HTJ A;  4RA2 A;  3PFI A;  2PMH A;  2NRA C;  3JAM Z;  4QSH A;  3LL7 A;  1TQI A;  1B8I B;  2KPM A;  3CLO A;  1S9H A;  4HZF A;  3CCY A;  1JT6 A;  1TC3 C;  3KZY A;  2EZI A;  4AWX B;  1WJE A;  3AG3 H;  2HDD A;  2E7X A;  2Y30 A;  3IL2 A;  3K2Z A;  3LSI A;  4KT5 C;  1HBX G;  1UZC A;  4H4K C;  3BG6 A;  2KDZ A;  2JSP A;  5KHD A;  4ETS A;  2LC2 A;  3VDX A;  3G3Z A;  4P96 A;  1LB2 A;  1HW5 A;  4BBR J;  4S05 A;  1YJN I;  3I4P A;  2OF7 A;  3ZN1 A;  4UY8 I;  4HLX A;  5EEH A;  3V42 A;  2KFD A;  2PJR B;  1AKH B;  4ESB A;  3F0C A;  2F5D A;  4E6K G;  1YOV B;  2CQ7 A;  1ZAR A;  2ZJ2 A;  1P4A A;  1TWA J;  3DU6 A;  3ZR8 X;  1SD5 A;  3DKX A;  2RQP A;  3RYR A;  5EG0 A;  2KQR A;  3OSG A;  1R00 A;  1KQ0 A;  3PO2 J;  3D5S C;  1HKS A;  2VQL A;  5DCM B;  3MVP A;  1DP7 P;  1OYW A;  1E0E A;  5AIP A;  1Z6T A;  3IRQ A;  3LSJ A;  3E5U A;  1MMN A;  4HAM A;  1DP3 A;  4F91 B;  1E3H A;  5FRN A;  4C2M J;  1O4X A;  4M71 A;  4PJN A;  4WF2 A;  2E35 A;  4EJU A;  2L4M A;  4LFU A;  3HC7 A;  3OIP A;  3CUO A;  4HF2 A;  1OYI A;  4MQ9 F;  1RKT A;  3V7S A;  2B7E A;  4HQM A;  4RLF A;  1ETV A;  1A6Q A;  3QYB A;  3WGG A;  2FSW A;  4I0B A;  3BDD A;  4LB5 A;  3S2D J;  3I53 A;  3HGG A;  3R0J A;  3GBG A;  4C30 A;  1ZHF A;  2E1O A;  2JUC A;  4BGD A;  3JRG A;  3QU6 A;  4HX7 A;  1QVU A;  2DI3 A;  1P4X A;  1WFX A;  1OQY A;  2VT3 A;  4FE4 A;  3JRB A;  2V6E A;  3GTK J;  3GTO J;  4M3D A;  4NHJ A;  4I99 C;  1FX7 A;  2LOO A;  2Y0S N;  3L2V A;  3VOE A;  3Q9V A;  4KIC A;  2AHQ A;  2PMU A;  4Z2Y A;  3SDG A;  2OU2 A;  2FEZ A;  1I3Q J;  5LLQ A;  3HOX J;  3D1N I;  2ISZ A;  1D8J A;  3VEP A;  3SQN A;  2DMN A;  3RQ4 A;  4CYC A;  1G3T A;  1IXC A;  4BKX A;  2R7R A;  2LY1 A;  2OV7 A;  3U21 A;  3HUG A;  1G2H A;  2EPF A;  1SD4 A;  5CQE A;  2VJI A;  1D0X A;  4BJ5 C;  2XRN A;  1SEU A;  3Q3S A;  3VB2 A;  2X9D A;  3MN2 A;  2Z99 A;  1YTY A;  3DEW A;  4LD5 A;  2ZO4 A;  3LWF A;  4LK0 F;  5F0F A;  3JSP A;  2KMU A;  4PGH A;  4XON A;  5D8L B;  3OR1 C;  2E2H J;  1Q1H A;  2NS7 A;  3BWG A;  2KIS A;  4EM2 A;  1S6L A;  2MC3 A;  2EA4 A;  4RAZ A;  4GO1 A;  1X1C A;  1TNT A;  1ODD A;  4A3D J;  5B1B H;  4RB0 A;  3ZMD A;  2M7B A;  4A3L J;  3FHN A;  2HKX A;  5LGN A;  2M4G A;  1JUM A;  3IP4 B;  1B59 A;  4IHT A;  5CYV A;  4WXC A;  3FIS A;  3HSR A;  4FIS A;  3LAP A;  3CDL A;  5KNL A;  3BJO A;  3L1P A;  3E6M A;  1ZR2 A;  2XSJ C;  2IT0 A;  1YIJ I;  4I0A A;  4N9I A;  4YEJ A;  2Z2S B;  2OUM A;  3GX4 X;  2JN6 A;  2KJC A;  3FM3 A;  4L0Y B;  3C3W A;  3BLY A;  1O3R A;  5J6X A;  3IRR A;  1QRY A;  3DFG A;  1W5T A;  5F1R A;  3F22 A;  3KP6 A;  2DFF A;  1V54 H;  4F52 A;  2CUF A;  3L9F A;  3BR1 A;  1ZGA A;  4I09 A;  3I56 I;  2VLA A;  4CZC A;  1VQK I;  1Y0N A;  2RAE A;  2XAF A;  4KDP A;  1X3Z B;  1IV6 A;  3ZRG A;  4KFC A;  4CZZ A;  1D5Y A;  2E60 A;  5TIS C;  2DT7 B;  2GZW A;  3NWS A;  4TV7 A;  1MBG A;  2K86 A;  2CO5 A;  2B9S A;  2E2J J;  4F92 B;  2VKV A;  2D1V A;  4A3C J;  3ERE D;  9ANT A;  3K70 C;  3BTJ A;  3TED A;  2FBH A;  2LFB A;  2R0Q C;  3V7C A;  2GA1 A;  4UNO A;  3C2H A;  2LD5 A;  1W36 D;  1VQL I;  1R5H A;  4AIK A;  4W97 A;  4BAY A;  1X4P A;  2ZME A;  5GPA A;  5E1X A;  3F23 A;  3MMY B;  4XBF A;  5ICG A;  2GXG A;  3KEY A;  3HJE A;  3PQJ A;  4U0W A;  2PBI A;  5LEK A;  1T39 A;  3DU5 A;  1FIA A;  1BL0 A;  3DKY A;  4X1E A;  1XMK A;  5FLM J;  3KCC A;  4XRM A;  3KLN A;  4PK4 A;  4RGU A;  4DJA A;  3VYU B;  3JAM K;  2OZ6 A;  4IHV A;  2R7S A;  2PFB A;  1JKP C;  3ABM H;  2VBZ A;  1B1B A;  1FY7 A;  2X1E A;  2R7O A;  3HOV J;  2IVM A;  5BS6 A;  2VOP A;  3DPT A;  2UXN A;  3BPX A;  1RR8 C;  1TWG J;  1V5E A;  5L3F A;  3J81 K;  3BCB A;  1D0Y A;  2RNG A;  2UXX A;  2EK5 A;  1ZRE A;  2EFP A;  3L2R A;  3L09 A;  3J7A Y;  1F36 A;  1X1A A;  3ASO H;  1VQM I;  1LFP A;  1YX3 A;  2K3F A;  3AAF A;  1H0M A;  2IAI A;  3GVA A;  3QAH A;  5FGM A;  1FYK A;  2WV0 A;  4M72 A;  3X2Q H;  3TOA A;  5HNH A;  1UFM A;  2DYS H;  3GWZ A;  3L00 A;  4CCN A;  4KA4 A;  1K6Y A;  4NUB A;  4PSX A;  1ZQ3 P;  1LEB A;  1Z7U A;  4HW0 A;  4FHT A;  4Z6Y A;  3QYE A;  3M8F A;  5ILU A;  4I01 A;  4BXU A;  3BTI A;  2KRC A;  2Y0S A;  3IWZ A;  4WXD A;  1W0U A;  3RQI A;  3RPQ A;  1V55 H;  2XUB A;  5A2Q K;  3OYM A;  2DN0 A;  4KMF A;  1QQI A;  2K9M A;  1W0T A;  3VYS B;  1RRJ A;  2YX7 A;  1G3Y A;  2K27 A;  5LGT A;  3JR9 A;  3OL4 A;  4E7J A;  1FOY A;  2D45 A;  3FHZ A;  2E2I J;  1KU3 A;  2Q2E B;  1DDN A;  1PJR A;  3BZK A;  4N9H A;  1PUF A;  4ITV A;  2LBF B;  1QNT A;  2EZK A;  2ZNZ A;  2W84 A;  2XPU A;  2X1C A;  2XVC A;  1FMV A;  4M3E A;  3SYT A;  4YEL A;  1REP C;  2LK2 A;  4AYB N;  3KP3 A;  2R5Y A;  2LY9 A;  2FJ1 A;  1X58 A;  2BW3 A;  2FE3 A;  4M74 A;  1ZG5 A;  1J2X A;  2VC0 A;  2JZY A;  1LJ9 A;  5D4S A;  3BQZ A;  3B6C A;  3RKY A;  2ELK A;  4XR6 A;  4B48 A;  4Y7N J;  1FP2 A;  1D1A A;  1G4D A;  1UG0 A;  1B9N A;  5EZH A;  1KYW A;  2Q8K A;  2A07 F;  4UUV A;  1FOK A;  2IEK A;  4BBS J;  3IAM 2;  5DYM A;  2QVO A;  2X85 A;  5IP6 A;  4P1W A;  5D4R A;  1U8B A;  4Y15 A;  5LRR A;  1V5F A;  3T5X A;  3KZI C;  4L5I A;  3BCA A;  1HST A;  5IT9 Z;  2COB A;  3DPL C;  2DMQ A;  3BC8 A;  4DZJ A;  2QBY A;  2CQX A;  2AS5 F;  1J59 A;  3FXR A;  2HU9 A;  4AIH A;  3LQR A;  5EGO B;  2GOM A;  4RBO A;  3BR2 A;  3MZH A;  1O3Q A;  1LDJ A;  2ACJ A;  2R92 J;  5HLI A;  5E17 F;  1KU2 A;  2BBY A;  4QTR A;  3EPZ A;  3MEX A;  2A3S A;  1XCV A;  4CO8 A;  5BQT A;  2DOF A;  2EIK H;  3IHU A;  4BEH A;  2XGE A;  4D9J A;  4S0H B;  1AHD P;  5BMZ A;  4A6D A;  2XPW A;  2MGQ A;  1MBH A;  2GQQ A;  1FJL A;  3M9A A;  1HDP A;  5J4V A;  1YE9 A;  2VC1 A;  4HV5 A;  3OYL A;  5TGT A;  3F8M A;  4QPO A;  3O6B B;  2HQR A;  3SFI A;  3ZMT A;  1Q1V A;  4C9Y A;  2LYC A;  3T1B A;  4EJO A;  1B6A A;  1RZ4 A;  1IUF A;  3MAJ A;  3IWF A;  2G7U A;  1S3J A;  2O61 A;  5F1J A;  3G1O A;  3FM5 A;  4Y13 A;  2GBY A;  4E70 A;  3OYI A;  4YFX F;  3DKW A;  4BDY A;  1BC8 C;  3CTA A;  1MBF A;  1W5S A;  2BZT A;  5EG0 B;  4I6Z A;  3GEZ A;  3M07 A;  2QLZ A;  4M9Z A;  1XX5 A;  4WCG A;  1VQO I;  2L7F P;  1XGM A;  1UHW A;  2R7X A;  3FXL A;  1VND A;  3V8K A;  2BXY A;  3EET A;  2H6B A;  1G6N A;  2DJI A;  4HG2 A;  1F5T A;  5IP9 J;  1TQP A;  2DOD A;  2KHM A;  3I71 A;  3CMY A;  3WE3 A;  1DGR M;  4E7H A;  2LRE A;  2XV4 S;  2P5V A;  4EV0 A;  4OU0 A;  4IOC F;  2IGN A;  2JSC A;  2HNH A;  1T08 B;  1SMY F;  3I9V 2;  3ZQ7 A;  3GCM A;  3HRM A;  5E79 C;  4LG0 B;  1LFU P;  4RM3 A;  3BJA A;  4EM0 B;  4M3F A;  2X51 A;  3CCQ I;  1FBQ A;  3TOB A;  1XN7 A;  3CO6 C;  2MD0 A;  5L3E A;  3FBI B;  4DGW B;  3LSK A;  4CA0 A;  2DA3 A;  2M0C A;  2O8K A;  3TBI A;  1XGN A;  3VPR A;  4YG2 F;  3OMY A;  1QVT A;  1R7J A;  4JK1 X;  1LKX A;  1T56 A;  4LLG F;  4CYC B;  4ENM A;  3KET A;  1YRN A;  4GCV A;  4XLP F;  2DTZ A;  3HUG B;  1RUN A;  2DMP A;  2EH3 A;  2L2O A;  3RCO A;  1LQ1 A;  3C2B A;  2A5W A;  2XGX A;  2QCO A;  4JX4 A;  4ZDL A;  4L5J A;  3DWL E;  4PZJ A;  3QYF A;  2ID3 A;  3PJR A;  2DT6 A;  3V4G A;  5AON A;  2VE8 A;  3TMO A;  4R1H A;  2Y9Z A;  2JUG A;  2UWM A;  2XB0 X;  3BZ6 A;  2VXD A;  1MJA A;  3JW4 A;  2ESH A;  3A02 A;  2L3D A;  3ASN H;  3GZ5 A;  3LFK A;  2A61 A;  4EMS A;  3TDZ C;  3FZV A;  3ZQI A;  3DBH B;  4YRV A;  2CV1 A;  5DS9 A;  4L0Z B;  4HNT A;  2HPI A;  4LIT A;  3ZQC A;  2QSG X;  4ZYE A;  2CW0 F;  4L9J A;  4BJ6 C;  3ZCO A;  3T8R A;  1IUY A;  3H5N A;  3LSM A;  3Q0U A;  5FO5 A;  4V19 K;  3A0H C;  2KIM A;  2IPQ X;  3EYI A;  3D5R C;  3S1N J;  4C3I J;  1T6S A;  1BI0 A;  3N05 A;  2QSH X;  1O7F A;  4XRS A;  2L9N A;  3HOZ J;  1VQ4 I;  4IRI A;  1PUE E;  1DU6 A;  2Y9Y A;  3A01 A;  1YIO A;  1WH7 A;  2OJE D;  2R7T A;  2CW8 A;  5M5X J;  2Q0O A;  4F55 A;  3BJ6 A;  4G9Y A;  4LIU A;  1U5T B;  1XSD A;  2P8T A;  5IY5 H;  3HIF A;  3QRF F;  1VFC A;  2VUM J;  2H1K A;  3BZC A;  3QOD A;  4BJT A;  2W85 A;  2ZXH A;  1QHG A;  3GF2 A;  2DFI A;  2QEN A;  3A1Y A;  1JJ8 C;  2Z1D A;  2FOW A;  4IHS A;  2AO9 A;  3OYK A;  3ABK H;  4XLA A;  4OIR F;  3KEO A;  3AL0 C;  2HVQ A;  4DYQ A;  1PDN C;  3DP7 A;  2DA4 A;  2TRT A;  3B6A A;  2EQR A;  3C7J A;  2KLO A;  3MZ8 A;  1MBE A;  4BHC A;  3CJT B;  3JRH A;  5ILS A;  4GFB A;  2CH0 A;  1ONV A;  1VQN I;  2A5Y B;  2XPV A;  3IKV A;  1U8R A;  2ZME B;  2XHK A;  4BU2 A;  2VON A;  2E1M C;  4NNJ A;  5HVQ C;  2YR2 A;  4LG3 A;  5J3L A;  4HYE A;  4WK8 F;  4DBR A;  2CRG A;  5BPD A;  3LFU A;  3I64 A;  2HI3 A;  4L9N A;  2KZG A;  1MMD A;  2ZFW A;  5FD6 A;  5E3O A;  4EEF G;  4IF4 A;  3AFH A;  1EA3 A;  4BHB A;  3VOD A;  3S14 J;  4XKV A;  4HBL A;  4UHT A;  4CCJ A;  2F48 A;  5C4X J;  1AA7 A;  4XLE A;  3I59 B;  1BIA A;  1KYZ A;  2FF4 A;  3EUA A;  2HVR A;  1RR7 A;  4XLH A;  4B1R A;  2RGV A;  1X4O A;  4CYD A;  3MKL A;  3CO7 C;  5GAE J;  2DT5 A;  1U2W A;  5EF6 A;  2NVX J;  2VAS A;  3GZN B;  3KYL A;  3MQ0 A;  2ZJQ F;  3N4M A;  4KYW A;  4LK1 F;  4LMY A;  4U7D A;  3QWL A;  3TKY A;  5H2F C;  3FKI J;  1T98 A;  4U87 A;  2HFH A;  2PQ8 A;  3ZN0 A;  1MZB A;  3BG9 A;  4QIW N;  2L9S A;  4QLC U;  5J1Y A;  1K78 B;  1IG7 A;  1LEA A;  2FQ3 A;  3HOW J;  1ZKG A;  3C1D A;  3MFK A;  4AVZ A;  4A3E J;  1MW7 A;  1IAW A;  2MBF A;  2HYG D;  4IHY A;  1P4W A;  4UVB A;  5CQG A;  3TO9 A;  3WGI A;  2ZSH B;  3MD2 A;  5H20 A;  1XMX A;  1ACI A;  5FRM A;  2IP2 A;  1UEL B;  2XRO A;  2FOK A;  3GTM J;  1XGS A;  3OOP A;  4G8X A;  2R7V A;  4F93 B;  4Q5S F;  5B3S H;  2XSD C;  4IKF A;  3AKZ A;  1IRF A;  2JMW A;  4O6J A;  2IJL A;  1S7E A;  4W1U A;  3HPH A;  4G12 A;  4PGG A;  1MIJ A;  1WCM J;  4MLO A;  2X6X A;  3FXM A;  5E20 A;  1JE8 A;  1J9I A;  2PLY A;  1WJD A;  5HS7 A;  1G59 A;  2YSR A;  3W2V A;  1F4K A;  2VQH A;  3E6D A;  1R1U A;  2LNB A;  1Z1D A;  5D5W B;  2RDP A;  1F1Z A;  3S32 A;  4HDV A;  2K3P A;  3GLL A;  3PNV A;  5DCF A;  3GFI A;  1KQ9 A;  2WC2 A;  4B3A A;  5KCM A;  3E6B A;  1SD7 A;  2YS9 A;  2V9P A;  1YIT I;  4EM1 A;  2MD5 A;  1PUF B;  4WWC A;  3FF5 A;  2CUE A;  6PAX A;  2EV0 A;  2HEO A;  2L02 A;  2DK5 A;  2TDX A;  3ZQF A;  1HA8 A;  2FNP A;  3CCJ I;  2XGC A;  4HNU A;  3GTP J;  2R5Y B;  3GME A;  1HF0 A;  2EV5 A;  4KMU X;  4G94 A;  5ED4 A;  1TQM A;  5D6F A;  3IKT A;  2STT A;  2UV1 A;  4A3M J;  1OR7 A;  3RKX A;  1JJ6 C;  5CVU A;  2UUZ A;  1IZ1 A;  2WA0 A;  3A0B C;  2DA2 A;  3QPS A;  1Z05 A;  3FBN B;  2E5Z A;  2DW4 A;  2LR8 A;  3I54 A;  5ERI A;  3RSN A;  3GO5 A;  2EZH A;  3CD6 I;  2MC4 A;  3REO A;  5IYD J;  4GRI A;  4J00 A;  1FSE A;  2LDU A;  1SFO J;  3CF5 F;  3BR0 A;  3S2W A;  2P5L C;  2M2E A;  4AM3 A;  1OPC A;  4RDU A;  1E2X A;  2KT0 A;  1LPQ A;  1LUJ B;  3EUH A;  4G7O F;  1VQ5 I;  5EYR A;  1Y6I A;  3G1L A;  4M3B A;  5M5W J;  1JKQ C;  2DFE A;  2Y48 A;  2QZ8 A;  5CVJ A;  4ENJ A;  4OIO F;  3U1D A;  4BS9 A;  4MNU A;  2VKD A;  4OMY A;  4R79 A;  1S7A A;  4BEH B;  1B72 A;  2M7A A;  3MKY B;  2DMU A;  3LMM A;  4A0Y A;  4A2U A;  2H94 A;  5E3M A;  2DPD A;  5FLX K;  5DV5 A;  5IOY A;  3S15 J;  4HF0 A;  2KJB A;  5J8C A;  1RUO A;  2MFZ A;  4B8X A;  2RN7 A;  1AWC A;  4XOT A;  1DU0 A;  1CQT A;  4DZP A;  2WY7 Q;  3J80 K;  1FEX A;  3HSE A;  2DJN A;  3WTY C;  2QQ9 A;  1ZLJ A;  2YUS A;  1ULY A;  5M5Y J;  3F9K A;  3ZP5 A;  3WE2 A;  1DPU A;  3P9C A;  2D1H A;  3P9K A;  1N77 A;  4E7Z A;  2IS2 A;  4GDF A;  1OYY A;  4IJA A;  1ITY A;  2AXL A;  4B43 A;  5J8F A;  3SXY A;  4BDZ A;  2K85 A;  1TWC J;  4L18 B;  4JP0 A;  2RC4 A;  2L01 A;  2F5F A;  2VBY A;  2HR3 A;  2X0L A;  2DA5 A;  3FXU A;  3KP4 A;  3O2P E;  4CHU A;  1LFB A;  1USS A;  4QWQ A;  2C6Y A;  2MLG A;  2JVH A;  5JHF A;  3K4K A;  1D1B A;  1BW5 A;  3WHC A;  2H09 A;  3R61 A;  3MKW B;  3GFJ A;  2V1D A;  3JTG A;  3QU3 A;  3JRI A;  1X1D A;  4ESF A;  3L2Q A;  1JHF A;  1FWZ A;  1R1V A;  1ZTR A;  5LD2 C;  2MW8 A;  4Q4Z F;  1WWX A;  1XMA A;  2JVG A;  3WTZ A;  1QO0 D;  3BY6 A;  4DIQ A;  4JX6 A;  2QKL B;  5ILV A;  3K70 D;  3DTI A;  2IA1 A;  3SJM A;  2FA5 A;  1YW8 A;  2PN6 A;  1A35 A;  4LLN A;  2WV1 A;  2CQQ A;  2V6C A;  1ZEL A;  3F21 A;  1JTY A;  5BNG A;  4FAS D;  1FPQ A;  1IN6 A;  2PMZ N;  1IW7 F;  2JA6 J;  2JK3 A;  1UAA A;  1SFX A;  2NOJ B;  4ZC3 A;  1NK3 P;  3LSR A;  2VN2 A;  1ZRC A;  3ECO A;  1BR2 A;  4NQW A;  4YII A;  2ME6 A;  1D5V A;  1X2N A;  2XDV A;  3CLQ A;  1IRX A;  2DPU A;  1WH5 A;  4F3Q A;  4ZDO A;  1H8A C;  3G1M A;  2HZT A;  1IV8 A;  2H1L A;  1TL8 A;  3CMM A;  4CGZ A;  3BG7 A;  3FMS A;  4A3B J;  3ZGK A;  3UKG A;  3LA2 A;  2Y75 A;  2A6H F;  3I5U A;  3MZY A;  4E7I A;  1Y8R B;  5CVI A;  3RPU D;  4OAY A;  3OYB A;  1Y0U A;  5K5R A;  2VT2 A;  2OQG A;  2W57 A;  1FC3 A;  3S1Q J;  2F6C A;  1LVA A;  3FK7 A;  1P92 A;  4RAF A;  4HOB A;  3GFL A;  1S72 I;  1K83 J;  2LG4 A;  3JRA A;  2RV8 A;  3JRD A;  2VXZ A;  4XID A;  4U0Y A;  2VIX A;  3KFW X;  5L3B A;  2JA8 J;  1Z0X A;  3RI4 A;  4M9X A;  3CCE I;  1P7J A;  4XL9 A;  2GOX B;  4PFP A;  3W6J B;  4BL0 B;  1PP8 F;  4M6X A;  3S93 A;  3CC7 I;  3CDI A;  3KYD B;  1K4T A;  2R4G A;  2IBD A;  2MAB A;  4ZYG A;  3HTU A;  3A01 B;  1DQU A;  1UST A;  2ESN A;  1XPX A;  3BTC A;  4UB8 C;  5D6E A;  3G73 A;  4IZZ A;  4JBA A;  2WTE A;  3H9G A;  4E4H A;  2XF5 A;  4FCY A;  3OYH A;  1OR7 C;  4B44 A;  1AU7 A;  1RPW A;  5CVV A;  1T0F C;  1OCO H;  4XLN F;  1BC7 C;  2QUF A;  1XCB A;  1Y1V J;  1J0R A;  5LHI A;  1TWF J;  1KU7 A;  1SFE A;  2LTP A;  3HRT A;  3JTH A;  2QEX I;  4IO9 F;  3Q0W A;  2ELH A;  2Z16 A;  5EEG A;  4HDU A;  1I27 A;  5GTI C;  1X1P A;  1H9G A;  2HYJ A;  5CKT A;  1D1C A;  1F9N A;  4DYR A;  4A93 J;  1JT0 A;  3EUH C;  1I1S A;  3O3K A;  4RAG A;  1JGG A;  1JGS A;  3H9J A;  4RGR A;  3E0J B;  1JKR C;  3RKQ A;  3AG4 H;  2F5E A;  4PUS A;  5GP9 A;  2HOT A;  2CW7 A;  1U9O A;  3OIO A;  1GV5 A;  3CDH A;  2OZU A;  3JCU C;  5HDG A;  4A0X A;  1O57 A;  3CJN A;  2XGD A;  3IH2 A;  1YI2 I;  3HTS B;  5ICF A;  3WHB A;  1R4M B;  2QA4 I;  4FX0 A;  1ZR4 A;  4OIP F;  5L3C A;  1MSF C;  2M4K A;  1L0O C;  1YG2 A;  1HOM A;  1PP7 U;  2RQQ A;  2XAS A;  4AVP A;  5B1A H;  5J4Y A;  2FNA A;  4KN4 X;  4DYC A;  2ZKZ A;  5FB2 A;  2IGK A;  1V5G A;  2K4J A;  2Y31 A;  1TT0 A;  4P55 A;  1IF1 A;  2HOA A;  1G3S A;  3BR6 A;  4Y3O A;  3PUF A;  1GV2 A;  1HQC A;  3R4K A;  1ZLK A;  3K4C A;  1W4M A;  4M3G A;  4ENN A;  1G8X A;  1YYV A;  3VSK A;  4S04 A;  4IVN A;  4RB1 A;  2PJP A;  2VJ4 A;  1FT9 A;  1AKH A;  4OIQ F;  2V9K A;  1SAU A;  4M73 A;  1IXS B;  1EF4 A;  2DQL A;  1YQA A;  4NB5 A;  1MNE A;  2CSO A;  5KAF C;  2RRE A;  3G6E I;  2FRH A;  4MTD A;  1BA5 A;  2JTV A;  5JVT A;  2HOE A;  3JSO A;  2A69 F;  5J40 A;  5K7F A;  3A4C A;  2PMZ A;  5HOD A;  4G7Z F;  3ELK A;  3J7Y J;  3OSF A;  2VOD A;  1XGO A;  3OYC A;  5IP7 J;  2GIZ A;  2X6W A;  1KU9 A;  4HX8 A;  3HEF A;  2YPR A;  5DD4 A;  5JLX A;  3OYF A;  1PYV A;  1GVJ A;  3R60 A;  3BRO A;  1A6I A;  5HLH A;  1HXD A;  2VJJ A;  2X48 A;  3HGY A;  3A03 A;  4ZZL A;  2L5Q A;  2R7Q A;  1I6X A;  4UV9 A;  4XQF A;  1ZGW A;  4I98 B;  4CIC A;  5K1Y A;  3M7G A;  2Z5U A;  2LP0 A;  1A31 A;  1FYL A;  1W1W E;  2V1X A;  1E3P A;  1JXS A;  4E7K A;  5GAG J;  4RMN A;  5J1U A;  3F8B A;  1YO5 C;  3W3C A;  3ZPL A;  1MD0 A;  1OIS A;  4D5C A;  2F4M B;  3BOQ A;  1IN8 A;  2FML A;  3PNT A;  2BY2 A;  3CCL I;  5HDN A;  5ICE A;  3V8J A;  2KIQ A;  5D5V B;  2A6E F;  1ZAO A;  5TJJ A;  1WJA A;  1GLN A;  1RKW A;  3K10 A;  1YW7 A;  4U88 A;  5F0H A;  3DCF A;  4IXA A;  3OYN A;  1Z67 A;  3VWB A;  2G9W A;  2HGC A;  2L9V A;  4K2E A;  3TQN A;  1BJA A;  2L0K A;  2LRD A;  3ZQH A;  4HV6 A;  2O6G E;  2BVL A;  1QBJ A;  1ERD A;  3FXQ A;  3FXO A;  5IT3 A;  4EAT A;  2B0L A;  2E1C A;  4A3F J;  1TW2 A;  4I2O A;  5GTH C;  3WTU C;  3CMA I;  5AIQ A;  1T2K A;  2ZXJ A;  4C3J J;  1Y1W J;  1ON1 A;  1JUP A;  3ZXS A;  1FLI A;  1R71 A;  4UB6 C;  4XKC A;  2KL4 A;  2M3A A;  2EIM H;  3CES A;  2BXZ A;  1A04 A;  2DDB A;  4P5O A;  1ETW A;  1YX5 A;  5F0C A;  2L4A A;  2OAZ A;  4J19 A;  2MYS A;  1B72 B;  1BM9 A;  1N25 A;  3K6G A;  1MMG A;  4IPA A;  2L54 A;  3RDI A;  3K4B A;  4IRH A;  4YIF A;  1HDD C;  3PSI A;  4F7Z A;  3JRC A;  5B66 C;  4BQN A;  4ON0 A;  5IYB J;  1NTC A;  2DLL A;  2I8D A;  1VQ8 I;  5K5Q A;  2XAJ A;  4KIG A;  1YHQ I;  4OAZ A;  2B63 J;  4MHG A;  3IAS 2;  4KIF A;  4PDK A;  3SEZ A;  3I3L A;  5E18 F;  4II2 A;  5J1R A;  3H0G J;  5KVR A;  1NHA A;  1ETQ A;  5D5U B;  5D8K B;  4LOC A;  1HLV A;  4WX9 A;  1R36 A;  2CS3 A;  2EZL A;  2V7F A;  2W82 A;  1T95 A;  3WTT C;  5HLG A;  4D5F A;  4ZYA A;  4BXF A;  1H9T A;  3E5X A;  4E7L A;  4EJW A;  2KIF A;  3V7R A;  2EB7 A;  3PQK A;  2VB6 A;  1MH4 A;  5J47 A;  2HDC A;  4M6Y A;  3LSP A;  4GGG A;  3BG5 A;  2VI6 A;  3CCU I;  4CH7 A;  2QQA A;  4Y52 J;  4XKB A;  3Q0V A;  3S3O A;  1NG6 A;  1WZ2 A;  4M6V A;  3GFM A;  3EUK L;  4P9U A;  2BHZ A;  2LKP A;  3HBL A;  3U2R A;  3KLO A;  1FBU A;  3VFZ A;  2WWY A;  3KP7 A;  4BY7 J;  1OJL A;  1WJF A;  3WG7 H;  1J5Y A;  2Z3Y A;  4HQE A;  3HRS A;  1BIB A;  3KEQ A;  3NWT A;  2ELJ A;  2E34 A;  4CCL A;  2JT1 A;  3S16 J;  2LKS A;  2G7H A;  5LEJ A;  1V4R A;  3F8N A;  1QZE A;  4O5V A;  3OS2 A;  2K7L A;  2BYV E;  1R23 A;  3K4L A;  4I76 A;  3O8H A;  3WU0 A;  2DA1 A;  4MFE A;  3K1M A;  2N8G A;  5TRD A;  5IYC J;  1ETY A;  1IJW C;  4ZTJ A;  4NQW B;  1QGP A;  1ENH A;  1XTA A;  5FKM A;  3CP2 A;  4B4C A;  5E3L A;  2MH9 A;  2VKE A;  2EIN H;  5E1Z B;  3F72 A;  2QWW A;  3H3U A;  4PJL A;  4CCK A;  4HA8 A;  2LSO A;  1BOB A;  3OL3 A;  3I4M J;  1LDK B;  3KPH A;  1T8I A;  5IT9 K;  4RB3 C;  3ISP A;  1R22 A;  2MLK A;  2P4W A;  2RKH A;  3CUQ A;  3PFY A;  4V2F A;  3OYJ A;  2AQF A;  1YJW I;  1FTZ A;  2M8E A;  1RI7 A;  1XDU A;  2MA3 A;  1GXP A;  1WJB A;  1R6R A;  2KKO A;  4XSX F;  4BE0 A;  3K4M A;  3I55 I;  2GXA A;  4CSW A;  4B3X A;  2R7U A;  4KNY A;  4AID A;  4ZYH A;  4RB2 C;  2JQ7 A;  2E19 A;  5LHG A;  1U0J A;  4A12 A;  4XOP A;  1WI9 A;  3WU2 C;  1BN5 A;  1EKE A;  2F4I A;  3DTK A;  3DF8 A;  1SD6 A;  4XLF A;  4L5E A;  1ZYR F;  2K9S A;  2STW A;  2G0E A;  4HRI A;  3EQL F;  2NNN A;  1I39 A;  2EIJ H;  3DBR B;  1SAX A;  2KIU A;  2O9L A;  2DA7 A;  5JR3 A;  3FK6 A;  3J7A O;  3ZMU A;  5C44 J;  3ZMV A;  3P5J A;  3LAJ A;  5B5E C;  2X4H A;  4ZYD A;  3TO6 A;  4XRS G;  2DFH A;  3ZQG A;  1IC8 A;  3OR2 C;  3G2B A;  1RC9 A;  2F2E A;  2ZFU A;  3BQY A;  3ULQ B;  2HYF A;  4YIR X;  4B47 A;  3WTX C;  2WAQ N;  2R5Z A;  1H89 C;  2XAG A;  4FTH A;  4A3K J;  1IN4 A;  2K4B A;  3HHG A;  1R1T A;  2AQE A;  1W5C C;  4HX4 A;  4FX4 A;  1Z9C A;  3HKZ A;  2FMY A;  2M0M A;  4LIV A;  3KIO A;  3AG1 H;  3CC2 I;  1IDY A; 
#chains in the Genus database with same CATH homology
 2FOW A;  2QEX I;  4IO9 F;  4IOC F;  5GAH J;  3CCJ I;  2E35 A;  2E34 A;  4IOA F;  3CCL I;  1VQ7 I;  3CJT B;  2ZJP F;  1VQN I;  1QA6 A;  1VQL I;  3CCQ I;  5DM7 F;  3G4S I;  2H8W A;  3CCR I;  1YJ9 I;  1YI2 I;  3CD6 I;  1HC8 A;  5JVG F;  3CF5 F;  2QA4 I;  3CMA I;  3CCS I;  1VQ5 I;  3DLL F;  5GAE J;  1YJW I;  2ZJQ F;  1FOW A;  1FOX A;  3CC4 I;  5GAD J;  3J7Z I;  3I55 I;  1VQM I;  2K3F A;  1S72 I;  2JQ7 A;  3CME I;  1VQ8 I;  3PIO F;  1YHQ I;  2NXN B;  1ACI A;  3CCE I;  3G6E I;  3CC7 I;  1YIJ I;  2OTL I;  4V19 K;  3J7Y J;  1YJN I;  3CCM I;  4UY8 I;  1VQ4 I;  3I56 I;  1VQ9 I;  1VQK I;  1VQ6 I;  1VQO I;  3CCU I;  2ZJR F;  3PIP F;  1MMS A;  5DM6 F;  3CCV I;  1VQP I;  1Y39 A;  3G71 I;  2E36 A;  1FOY A;  5GAG J;  1YIT I;  3CC2 I;  2OTJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...