3CCSI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccsI00
3DLLF 1ACIA 5DM7F 2NXNB 3CCMI 3J7YJ 1YJNI 3CC2I 3I56I 1Y39A 4UY8I 2E36A 1YIJI 1YI2I 2QEXI 1VQ5I 3CMEI 2QA4I 3G4SI 3CJTB 1YJ9I 1HC8A 1VQ8I 3CC4I 3CCUI 2K3FA 3CMAI 1MMSA 3CCEI 2ZJQF 1VQNI 3J7ZI 5JVGF 1VQMI 1YJWI 5GAGJ 3I55I 2ZJPF 1QA6A 1VQLI 5GADJ 3PIPF 3CD6I 4IOAF 5GAHJ 3CCQI 2H8WA 1VQ7I 2OTLI 3CCJI 3G71I 3CC7I 1VQ9I 3CCVI 2E34A 1VQ6I 4V19K 4IO9F 5DM6F 1FOYA 1VQPI 3PIOF 2OTJI 3CF5F 3G6EI 1VQOI 1YITI 1FOXA 5GAEJ 3CCRI 2E35A 3CCSI 1YHQI 2JQ7A 2FOWA 4IOCF 1FOWA 1VQ4I 3CCLI 1S72I 2ZJRF 1VQKI
chains in the Genus database with same CATH superfamily
4XNFA 1E3OC 1D0ZA 2LBFB 3T0YA 1XCVA 2WAQA 1MIJA 1SEUA 2G7UA 4BE0A 3PUBA 1IDYA 3K6GA 3H0GJ 5CPRB 2V26A 2WWYA 3CC2I 5KNLA 4E7SA 2YU3A 1TWGJ 3DPUA 3PSFA 1AU7A 4M6YA 2KMUA 2GM4A 3I4MJ 1O4XA 3L9FA 1R5HA 4CDGA 1YTYA 3GO5A 1OPCA 4XR6A 3OYBA 1H9TA 4KA4A 1JI8A 3WU2C 3ZCOA 4NB5A 2EV6A 3V7SA 1ZREA 5TGTA 2BVMA 2IA1A 2M4GA 2QA4I 4HSTA 3V4GA 4J01A 2DT7B 3I3LA 1SD4A 3ZQGA 1JE8A 1HC8A 2Z3YA 1VQ8I 4LMYA 4UV8A 5EF6A 2RQQA 4DGWB 2BW3B 2ELJA 2UZKA 1LE8A 2VJ5A 4AD9A 3CMAI 3RZOJ 3WGIA 2RREA 3LL7A 2UV1A 1IN8A 1GVJA 4V2GA 4BHBA 4H0EA 2HR3A 4HA8A 2EFQA 1V3FA 1OJLA 4A3MJ 2DTZA 2QQ9A 2RNJA 2Z33A 1F5TA 3FXLA 3UKGA 4A3CJ 2OJED 5DD4A 3ECOA 4L9TA 2PN6A 2HQ5A 2QYOA 2VT3A 3GZNB 1KYWA 2L02A 4HX8A 4D9JA 5IT9K 3BG3A 3CQZJ 2PQ8A 1KU2A 3ZQIA 1X1PA 3REOA 4BGDA 2H1LA 5F64A 2QF7A 4ZH4F 5K7HA 1F4KA 5IY5H 3G71I 5M5YJ 2R7SA 4IQJA 2ZSIB 3GFMA 9ANTA 5LHGA 4IXAA 5CVIA 2A6TA 1WFXA 1HW2A 2MH9A 5TJJA 2NYXA 1VQOI 4HNVA 1D1AA 1NK3P 1TBXA 1X1DA 2ZFWA 4E6KG 3FX3A 3N05A 2ZXJA 5H2FC 4PK4A 1JT6A 3M8EA 2ACJA 1RIOH 2DYSH 2JQ7A 1X3WB 2COMA 4RGUA 1YRNA 1CF7B 3SHFA 3RIRA 1LFUP 1JTXA 1YOVB 3ZMVA 3OYDA 4BQQA 2E19A 3SQNA 2R93J 4EEFG 1X58A 3F8MA 3H35A 2YS9A 1PP7U 2CQXA 1NG7A 1OLTA 1P4WA 3F3XA 4E70A 1S8NA 2P5VA 1TQPA 3HOVJ 1QVUA 1LVKA 2M9HA 3QPLA 2CQKA 2H09A 3I4PA 3PQJA 1KONA 3IH2A 3ZMZA 4OU0A 1H89C 3VPRA 5HDKA 3OYHA 5K5QA 1SANA 3WTUC 3PM1A 4PJNA 5E1XA 3HPHA 3ZN0A 2VUMJ 4NBQA 3WTXC 2ISZA 1D3YA 2DA2A 4Q5SF 4Z2YA 2K9QA 2W57A 4UB8C 1W5SA 2FBHA 3L2VA 1X4PA 4O5VA 3C18A 3Q9VA 2DQLA 3EUHC 4MQVA 1VF9A 4MEXF 2WV0A 2NNNA 3N4MA 2JSPA 2QSFX 3QOPA 4G6DA 2AHQA 2DDAA 1UG2A 4RM2A 4KUMA 3E6CC 1G8XA 4Y52J 4G9YA 2K3FA 4I98B 3HGGA 2ELKA 4NC7A 4ZYGA 4F52A 4U7DA 1J2XA 4ZJZA 2OZUA 5CQGA 5C3EJ 1WWXA 2K02A 1VTNC 4O3MA 4RMNA 3AL0B 5BMZA 1ZGJA 2F4OB 4BNCA 1LB2A 5EEGA 2ELHA 1SAXA 1MBJA 3PNVA 1FP1D 3UNGC 1Z1DA 3A1YA 1UHSA 3BR3A 3TO7A 4BEHB 4IRIA 4CA0A 1OYWA 2L3DA 3H3UA 4Y13A 3FM5A 1E17A 4IPAA 1H0MA 1WH7A 4G94A 4ENNA 1LVAA 2VBYA 4V2FA 2R5ZB 1OR7A 4G12A 1AWCA 3SFZA 3MKWB 4PZJA 2NVQJ 3KETA 4LG3A 2R5YB 2CUFA 2WAEA 2IS6A 2JMWA 2XAFA 4C30A 2ZC2A 5HS7A 3LMMA 4BAYA 1P7JA 2CUEA 2HGCA 1P4XA 5HNFA 1R5ID 1B9MA 2ISYA 4OIRF 3SFIA 3CF2A 3J80Z 1ETWA 3JRIA 4K2EA 4PJMA 2HDWA 4I0BA 3VODA 3A02A 3SDBA 5F04A 4ETSA 1FYMA 2M7BA 3EPZA 1JHFA 4RDUA 3IAS2 1VQ4I 4M6XA 3CCLI 4QIWN 2M8EA 5IOZA 5M3MJ 4I99C 2ZJRF 2ZBKA 1IXSB 2IGKA 4UVCA 4M6VA 2QZ8A 1YW8A 1ZGAA 2EH3A 1R23A 2CW0F 1BOAA 1NTCA 1LKXA 2XPUA 5AIPA 3OYJA 5A2QK 1OFCX 2QQBA 3QYFA 4BQAA 1BOBA 3IH4A 3HSEA 3WU1B 3TW7A 2VBXA 2STWA 3E5XA 2YR2A 5ED4A 2K85A 3BJ6A 3RPQA 1PUFB 4HYEA 1S3JA 4WXCA 1RKTA 3K7AJ 4A6DA 4F92B 4D5FA 1MNMC 2XAJA 2TRTA 3OOPA 4PFOA 2ZMEB 1BI3A 3MN2A 3E3VA 4AUXA 3LSPA 4GGGA 3FKJA 1R4NB 3RSNA 3IRQA 2TCTA 2IS2A 2GZWA 4XLHA 1YJ9I 4EQQA 3HOZJ 4LIVA 4DNCA 2BBYA 1LDJA 2A5WA 1XMAA 3HOSA 2XGCA 3SYTA 1IUFA 4QWQA 5FD6A 2B9SA 1R7JA 1O3TA 3OSGA 2K86A 3S32A 4A3DJ 2G9WA 3I0TA 3ABUA 4XM3A 3KYLA 1JKQC 2XROA 3HTUA 2V1XA 3K9TA 5F1JA 4PJLA 4HX7A 4LIUA 2XHKA 2PG4A 4PCQA 4XK4A 3HB9A 3LFKA 2HEOA 2CV0A 3VB2A 4UVBA 1TW2A 2DA7A 2CFXA 3LA3A 5GTHC 3GTJJ 3M8FA 4ENKA 3BROA 3OSFA 2KZGA 4NC6A 4G7ZF 3CTAA 1I1GA 2BHZA 4JP0A 4Y7NJ 2FQ3A 1PUEE 1RZ4A 5LFAA 1Y0UA 3ASOH 3LA7A 3PFYA 3GBGA 2HPMA 1B9NA 2VQGA 1IG7A 1ZARA 3ZMTA 1YS6A 4IHWA 3CCYA 4BHCA 5HLGA 5EDNA 3OY9A 2LD5A 3MZHA 1N78A 1D0XA 5H20A 5DDGA 1ZLJA 4XLFA 4V19K 3ULQB 1TQMA 1K4SA 4M71A 1IC8A 3M4OJ 5LBQA 4XKCA 1JJ6C 1T08B 4DJAA 2ZKZA 1J5YA 4OOIA 4XMYA 4ENJA 4M9SA 1FX7A 4I2OA 5KVRA 3TKYA 1T2KA 1T6SA 5L3FA 4BXFA 2VBZA 1X19A 2JVHA 1I39A 1RR7A 2DODA 2OAZA 2HDCA 4OINF 2HI3A 5CVJA 3F8CA 1HSTA 1N75A 1J7KA 5A2QZ 2BHYA 3TP0A 1USTA 3B6CA 2EZLA 5L3DA 5DEQA 1SFOJ 5EGOA 3O8HA 2WAQN 1MJBA 1JT0A 3MKZA 1Z21A 2QM3A 4XIDA 1Y56A 3J7AO 2Z9OA 4GRIA 1ZGWA 1U5TC 3R60A 1HLVA 3E6DA 3E7LA 1EKEA 1FIAA 1I27A 3T5XA 2K9NA 1ZK8A 1WCMJ 2EV0A 2DTRA 4RB0A 3K70D 4G6TB 4L5IA 2XF6A 2MLKA 5HODA 3TL4X 3OYAA 1UB9A 4P96A 4B47A 1Z91A 1BN5A 2VQCA 3HZJA 4W1UA 3L1PA 2VASA 3BG7A 1P9QC 2FQ4A 3S8PA 1ERDA 1I3QJ 5M3FJ 1SAUA 1VZ0A 2ZXIA 1BI0A 2A05A 3KP2A 4GFBA 1FPQA 2OQGA 4AC0A 2LSOA 1BR1A 2MD0A 2W84A 3J7AY 2E7XA 3I9V2 5KAIC 4M3GA 3JSOA 3PSIA 1SVOA 5DS9A 4F55A 3F22A 1K61A 2BXYA 2MSYA 3HIFA 1T8IA 1X4OA 2RQPA 4OIOF 2OBPA 3FZVA 3HRTA 4B4CA 4ZYEA 4A6EA 3IRRA 1G59A 1ITYA 3ZRGA 4EJWA 1VQNI 2O7OA 4KJZA 4LG0A 3G1OA 1A6IA 1R58A 4L9NA 5FKKA 1IJWC 1QA6A 4WXHA 2LOOA 5C4XJ 1FBQA 2BOLA 2IBDA 2VXZA 3K10A 1T0FA 2LY2A 5ICCA 1EV7A 1OQYA 2CG4A 2V1UA 2P8TA 2DMTA 3C2GA 4GDFA 4L5EA 2DYRH 3BC8A 3FF5A 3ZP5A 1T56A 2VPRA 2P5KA 4P1WA 2WY7Q 1TWHJ 4XL9A 2WC2A 2RN7A 4U0YA 4IO9F 4E7IA 4OIQF 1W7PB 4EVIA 4XBFA 2DFIA 4DQ2A 1SFKA 3GTOJ 4KT6A 3FHNA 1MBKA 3A03A 4B44A 1BIAA 4R1HA 1R36A 5B1AH 2E2JJ 3LSGA 2HKOA 5E8GA 1POGA 2E1MB 5CQEA 1DDNA 1IF1A 1WI9A 4OIPF 3VEPA 3E6MA 3RQ4A 2EZHA 1TTYA 1ON2A 1Z7UA 3H9QA 3HKZA 2EPFA 2DFEA 1R00A 1XTAA 5FLVA 1EA3A 2HZTA 2V1DA 4B09A 3OYKA 3C1DA 2JT1A 4NC8A 3TDZC 3QODA 4I0AA 3CMMA 1I5ZA 1MGTA 3C3WA 3J7YJ 1U3EM 2QKMB 4NNJA 1YJNI 3GTLJ 3FDYA 5K5RA 1KZHA 1IV6A 2DA5A 2CW7A 3JAMK 4HDVA 2NNYA 5E18F 5FB2A 2E36A 3GZ5A 3JRFA 3Q9SA 1DPUA 2GIVA 3S17J 4Y4RA 1QNTA 3SEZA 4N4NB 2LKSA 5B66C 1SFEA 1I50J 1SVLA 5EEHA 1ZR2A 1P2FA 2HKXA 3KFWX 2VT2A 2EWNA 4L9VA 4QPQA 3ZGKA 3BZKA 1K78B 2IA2A 5ILVA 1FLIA 2JA7J 1VI0A 3CMYA 1BBYA 4DW6A 1IRXA 4Q4ZF 4KIGA 2L9RA 1K4TA 3BP8A 4BXXJ 2VE8A 1QU3A 1OCPA 3EYIA 3MCZA 3D0SA 1T95A 1UG0A 2WB1N 2LTPA 3W6KB 4B3AA 1LFPA 1ZQ3P 1GLNA 4EM2A 1ZLKA 3DU5A 2LKXA 4NQWB 3BY6A 3GTQJ 3GLLA 1YE9A 3S3OA 3VYUB 5DV5A 2HZDA 3TO9A 2JJ7A 1MDMB 3CCJI 3CC7I 3M7GA 1HSJA 2ME0A 3GWZA 2A3SA 4KITB 4RB2C 3CCVI 3PO3J 1TP4A 3OMYA 2BZTA 2XF7A 3FMRA 4U0VA 4NDLA 1JKPC 4KN7X 1AA7A 1O7LA 1IN5A 3QWLA 1DP7P 1F9NA 2XV4S 2CW8A 1KA8A 3KZIC 1CF7A 4XONA 1ZN2A 3F6VA 2V6CA 2K9MA 4M3EA 3CO7C 3BPVA 4X0GA 2KFDA 4WCGA 3CCSI 3FXRA 3I71A 2PI0A 5LLQA 4O6JA 4C3HJ 1XD7A 5D6EA 3D5LA 3MAJA 2OU2A 1ZG5A 3FK7A 4HV6A 1IUYA 4X1EA 4JOMA 3WG7H 2ZNYA 3EUKL 3JAMZ 4IHSA 4JK1X 3M9AA 3T1BA 1UMQA 2ZO4A 4YFXF 4LLNA 4CCKA 2VN2A 3H9GA 1RRJA 1KQ8A 5IP6A 4ITVA 2L9VA 4RAFA 5H6QA 4ZYAA 3WTWC 2GXGA 4A0XA 4CYCB 2FMYA 2L4MA 2W85A 1D8JA 3CESA 3DEEA 4U7BA 3KPHA 5F0CA 4HG2A 2X6XA 2LG4A 3R4KA 1ETOA 3GF2A 4N9IA 4XSZF 2EJRA 4DZPA 1ZG3A 3MFKA 1V55H 1XGMA 2WA0A 2A69F 4CHUA 2Y48A 3QPHA 2CU7A 2H8RA 1IO2A 2VC1A 4JX5A 2I5UA 3C2HA 3LOCA 3EYYA 1T33A 2PJRB 1H9GA 1GXPA 4RS8A 5CLSA 2VBWA 4UUSB 1ZRFA 3KZYA 4BEHA 2JPBA 4C2MJ 5FFXA 5B3SH 1LDDA 3O6BB 4HLXA 1UCRA 2LKPA 5D6FA 4D7MA 1YX5A 3G1MA 3BT9A 2FBKA 4CH7A 2R5ZA 1FBUA 5IYBJ 4II3A 2NVUB 5FO5A 3O3KA 3WHBA 1FY7A 2KKOA 3S3NA 3MZYA 5J40A 4P9FA 5D5VB 5B5EC 2IVMA 3A01B 2HNHA 2R5YA 2OZ6A 4BQNA 1WI3A 2X9DA 3DTKA 3KCCA 5F0FA 2VJIA 4HAMA 4OAZA 4UUVA 2OTLI 2V7FA 2L7KA 1H88C 2NS8A 5EZGA 3LA2A 3DPLC 1JJ8C 2W24A 3OYIA 4W97A 4CCOA 5TRDA 2IAIA 3VSLA 4L5JA 3H3VK 4FQGA 3OWTA 2X0LA 3MMYB 2N8GA 3BTCA 1ZELA 3G6EI 3OYNA 2BY1A 2FMLA 2KP6A 3MVPA 1GV5A 2Q2EA 1XGNA 4U87A 3RQIA 4OMYA 4RGRA 2M0CA 1W5CC 2QQAA 1Q1HA 2WTEA 2X1DA 4HQEA 3DXJF 3K4BA 3WTZA 1L0OC 2RV8A 5DUIA 4MFEA 5KK1A 4ZZDA 3ISPA 4PFPA 1JXSA 3DLAA 1FOWA 2Y30A 4CCJA 2KDZA 2LK2A 1XX5A 4AYBA 1S72I 2COBA 1U78A 5BOXA 4A93J 1P7IA 2RVCA 4ZTJA 4EJVA 4FX0A 2GQQA 4A12A 1D0YA 4Q47A 2VLAA 2VQLA 1PUFA 1X2NA 4XLCA 2XC7A 5J47A 2XSDC 3I53A 1XGSA 1Y1VJ 4XLEA 1LQ1A 2ZMEA 3KP7A 5JLXA 5JHFA 1G2HA 4A0ZA 4I7HA 1U0JA 2O8KA 4E7LA 1WJCA 1P4AA 1HCRA 5E20A 2ICWG 2RDPA 2F4IA 2OA4A 3S2DJ 2VKVA 3BG5A 3J80K 2LP0A 4B43A 2F5FA 2FF4A 2K40A 3KYDB 2KDOA 2VKHA 3V7CA 1OCRH 3S1RJ 1QHGA 1GV2A 2CWEA 4EM0B 1SVMA 2KT0A 2R4GA 3FWEA 2QKLB 1S7OA 1R1TA 2FX0A 2MLGA 2PMHA 2EFWA 3OIQA 2O8XA 5EYRA 2GXAA 2OD5A 2W1OA 3OYLA 1B4AA 1ZHFA 1MJ9A 3L2RA 3VOEA 3GZ6A 2R7DA 2BY0A 2KPMA 3CUQA 2DPDA 1UELB 1UZCA 1IRZA 2DW4A 1QRYA 1G3SA 2DOFA 3QPSA 1YS7A 2DFFA 2H6BA 2XIGA 2HQNA 3E0JB 5F1RA 2DDBA 1TQIA 2XSJC 3R61A 4TV7A 2HFHA 5ILUA 1HF0A 4RGXA 3OL3A 2KLOA 2LLKA 4M73A 5GADJ 1XC5A 4EM1A 1KQ9A 1D5YA 3V7RA 4B48A 3I54A 2ESHA 3BQZA 2FJ1A 3NWTA 2ME6A 2WAFA 4P9UA 2X4HA 2F6CA 4IX7A 2EFPA 1RUNA 3I58A 2M30A 5E3LA 4ZDPA 1TWCJ 1MH3A 5JI6A 1WZ2A 2QBYB 4ZYHA 2F5CA 4FHTA 4M74A 1Z6RA 3RTRA 3K4KA 3FXMA 1IN6A 1L3LA 1JHHA 2E2IJ 2AQEA 4XQFA 4LJZF 3AG3H 2FNAA 2MG4A 2DPUA 1LFBA 2Y75A 4A2UA 1IAWA 1MMNA 2FEZA 1YITI 5H6RA 5GAEJ 2CJJA 5DCMA 3CLOA 2E35A 4XRSA 2WB1A 3HKZN 2E1NA 3W2WA 2XPWA 4OWRB 4EJTA 4HRIA 3DFGA 4S0HB 1Z67A 2VL8A 4CSWA 2DMQA 3FXKA 3D1NI 5KHDA 2KIFA 2R3SA 4XORA 4BE2A 2JN6A 2JTVA 2X6WA 1SD7A 1NHAA 4L9JA 3ROUA 3H1CA 3QRFF 3J81K 1S29A 4EGYA 1K79A 3IH3A 2O61A 1XDSA 1V5FA 4HNUA 2CUZA 3PL8A 4LGWA 1YW9A 1SMYF 3FMSA 5D5UB 2M5WA 3IV5A 2CUJA 3OV8A 4UY8I 4KYWA 5E79C 5ERIA 2Y0MA 4FE7A 5D8KB 2EB7A 1IW7F 5HDNA 1PYVA 2BVLA 2UUZA 3AL0C 4MQ9F 1AKHB 2H27A 3KP5A 1U9OA 4I01A 4JX6A 3TW6A 4CXFA 2VIXA 1IXRC 1LE8B 3KP6A 4BYYA 3DEWA 4DOZA 1BW6A 5L3EA 1TWFJ 3HOYJ 2OC6A 2XKOA 2R7OA 5DD8A 3BR1A 1XG1A 2M7AA 1HBXG 2Z2SB 2V9KA 2JUGA 4XICA 5FKNA 5LGUA 2QVOA 1JKRC 1K6OA 2Y2ZA 4HEA2 2QCOA 1OCOH 4N9HA 5HS9A 4E4HA 1MSEC 5K5OA 1ENHA 4AIHA 5GPCA 1V4RA 3M8JA 1IXCA 2ZJPF 2D1VA 1XMKA 2MYSA 5KCMA 2DU9A 2KIUA 1PP8F 1VQLI 2HOSA 4NHJA 3ECHA 2KRFA 4XRMA 1DGWY 5GAHJ 3R0AA 1WJEA 3CCQI 3OL4A 1WGXA 2LR8A 1KYZA 4FETA 3T8TA 1VNDA 1W7PA 4M72A 2CV1A 1YW7A 3QYEA 2RNGA 4RM3A 4IHVA 1Y0NA 1RKWA 1Y8QB 5AIQA 1DUXC 3TGNA 3M1CA 2HDDA 4LB6B 2Q8KA 2CV2A 4C9YA 1KU7A 1JGGA 2M8GX 2DA6A 3GCMA 2LY1A 2VODA 1FSHA 3H9JA 3R6SA 2R7UA 3VFZA 4Y17A 4XOTA 3HUGB 3J81Z 1I3AA 1CGPA 2XB0X 2QSHX 4A5NA 2LDUA 1FSEA 4A3GJ 2ADUA 2XVCA 2DK5A 2C6YA 1FIPA 3BZCA 3E6BA 5GP9A 1IGNA 1O3SA 3JRDA 4HPQA 3TOBA 4WK8F 5FD5A 4E7ZA 3GMEA 4EV0A 1U5TB 1BW5A 3K2AA 3BPXA 1UAAA 2P7VB 1XSVA 3ZR8X 2XKPA 2E1OA 1TLHB 4KFCA 5HVQC 2UXNA 2M45A 3ZXSA 4A3FJ 1FEXA 3F72A 2PFBA 2QENA 2YPRA 2V9VA 3LSIA 2OV7A 4MFDA 3HOWJ 5ICFA 1B1BA 4N0BA 1YX3A 4YFNF 3GEZA 2DA1A 1FZPB 1ZH5A 1E0EA 1FTZA 1Y8RB 2NS0A 1W0TA 3HC7A 1W1WE 1G3WA 1QZEA 2HYGD 2F48A 1QQIA 4HNTA 3CMEI 3OOUA 1UHWA 1XS9A 1K78A 2X48A 1MBGA 5IYCJ 3U9GA 2XAUA 2BYVE 3CUQC 1HQCA 1X3UA 4HOBA 3GTKJ 1HKTA 2K4BA 1P6RA 3K2ZA 2RC4A 1JTYA 2DO7A 3CC4I 5AONA 3ABTA 1KU3A 2M2EA 3HOXJ 4ENMA 3NRVA 3IKVA 3L00A 3AG4H 2DJNA 3HSRA 4XKBA 2J5OA 4AIKA 3RYRA 1S6LA 3F6OA 3J7ZI 2L7ZA 2GBYA 1K7AA 2CS3A 4NQWA 2HVSA 4MTDA 3E5UA 4B8XA 1O3QA 3F21A 2JA5J 2IRFG 1RUOA 3I55I 1WJDA 2GAUA 4RLFA 4ZC3A 5CVRA 2LC2A 4RLQA 2R7FA 3P9KA 3GTMJ 4AU7A 1LNWA 1XB4A 5DYMA 1BR4A 5LD2C 1MMDA 1U8BA 4BACA 2K9SA 2X1EA 2GOMA 3FXQA 4YELA 3SEQA 1FMWA 3FISA 5BQTA 5E3MA 3DTIA 3G1LA 4XOPA 5LRRA 2MC3A 2L01A 3QAHA 3IKTA 2ETHA 2X6OA 2PJPA 1QHHD 1OR7C 2HTSA 3COAC 2VKEA 3DWLE 3S2WA 4CZZA 5D8LB 2M0MA 5E3NA 2HXOA 3HHHA 3HBLA 1WKMA 4YG2F 2HOEA 3LSKA 1ON1A 4Q48A 1ZRCA 4RB1A 3JRHA 4XKWA 4D7NA 4L0YB 3HXLA 4AYBN 3PUFA 1IRGA 3MKYB 1LJ9A 2FOWA 1HW5A 2HVQA 2JA2A 4UXNA 3DP7A 1WH5A 1YLFA 4JYKA 2CYYA 1ETXA 4BBRJ 2A07F 1RETA 2JRTA 4F91B 3O2PE 3ZMUA 1MZBA 1OYYA 3NQOA 4EJOA 4PSXA 4IL6C 4J00A 1Z6TA 1EJ9A 2W4SA 2KHMA 1K6YA 3WTTC 1RC9A 1APLC 3BQYA 1ACIA 2DLLA 3F23A 2XAQA 2XB5A 2B0LA 5E8IA 2XRLA 4BXUA 4C2UA 4D1QA 1ZYRF 1QPMA 4GXOA 2EZIA 2D45A 2DMPA 2LBFA 1T38A 2GA2A 4CO8A 1WJAA 1YI2I 1TZLA 2P5LC 3BG9A 2X51A 4CCNA 1Y1WJ 3PO2J 3JTGA 1H8AC 2PJRA 2H1KA 3K1MA 3Q5FA 1X1CA 1ZAOA 4I76A 3CLQA 4RB3C 4UUSA 1A5JA 2LH9A 4LLLA 3VDXA 4J19A 2H6CA 3BTLA 1PJRA 4XLPF 2E71A 2ID3A 5E1WA 2EK5A 4ZDOA 2ECCA 2L9NA 1D1CA 1QZYA 4UVAA 4GYIA 4BKXA 4HF1A 3QQAA 4U0WA 2IW5A 1FNNA 2IS1A 1JUPA 4HDUA 3WTSC 1STZA 2Y31A 3X2QH 2F2EA 4FE4A 5FRMA 4Y33A 2VXDA 1SC7A 1AOYA 1ETQA 1MMGA 1VQMI 2R7TA 5LHHA 4CCMA 2BW3A 4GCVA 1C0WA 4ON0A 1A35A 4LLGF 3K4LA 2IGNA 3W6JB 3PIPF 1O7FA 1U8RA 4IKFA 3I59B 2CMPA 3PFIA 2FOKA 2IPQX 2CRGA 4RAGA 3HYIA 2LNBA 3FBIB 4ZTFA 3I64A 1D1BA 1OMIA 3BTJA 1LDKB 4EGZA 3LSHA 3DKXA 1BA5A 4F7ZA 4PUSA 2JPCA 3FM3A 1TT5B 2E34A 3HHGA 3RKWA 6PAXA 2HQRA 2Z16A 3QP5A 3S1QJ 2CGPA 1VQPI 3DU6A 3ZQHA 2BY3A 1O57A 3MEXA 5FLXK 1NG6A 5FKLA 2Y69H 1GVDA 2XAGA 2DCEA 3U1DA 1D5VA 4UHTA 4UUTA 2EILH 3LSMA 1ZG1A 4IHXA 5JHUA 5GTIC 1YHQI 2O03A 1MNDA 2DQRA 1WJBA 1NK2P 3HTSB 2JSCA 1WJ5A 3LSTA 4FISA 4G7HF 4A69C 2EIJH 1TW3A 2K4JA 3A2KA 2UXXA 1BI2A 4DBRA 3B73A 3CDIA 5M5XJ 3DLLF 3L09A 4AM3A 3BJAA 1DGRM 4XN3A 3MZ8A 2NXNB 4FTHA 4I6ZA 4DYQA 1DP3A 1BI1A 3BOQA 3HM5A 3A4CA 3K1PA 3LSJA 2FSWA 2IA0A 3R0JA 3I56I 3U21A 4DZJA 2GA1A 1MBHA 5BS6A 5HNHA 4ASNA 2D5VA 4CZCA 2QEXI 2VJ4A 1ZTRA 3EUHA 5BNGA 3QU3A 4AVZA 2OCEA 2KISA 3MWMA 4A0YA 2FA5A 5DCFA 2YX4A 2X6YA 3WGGA 1V5GA 2GOXB 2O5RA 1HOMA 2CQ7A 4P55A 2DMUA 3Q0UA 3NWSA 3A0BC 3JRGA 3I4NJ 4BJ5C 1X1BA 4JBAA 3HG9A 3TMOA 4H4KC 4R79A 4KMFA 5C4JJ 3KP3A 3OIOA 5E17F 1QVTA 3KEQA 4MIMA 2DT6A 5J1UA 3S93A 3ZN1A 4MNUA 3TO6A 5IP9J 2Y9ZA 5EJCA 2E60A 2A61A 5CVVA 5L3GA 3RKQA 2M1BA 3SDGA 2X85A 3M3YJ 2NVTJ 1B59A 4EMSA 4UV9A 1Q1VA 1QBJA 1FMVA 1HDPA 4WF2A 2HYJA 1W4MA 1YG2A 2DXIA 2KL4A 2EINH 2DN0A 3ABLH 1SD5A 4BS9A 2QBYA 2HXIA 4BU2A 1IV8A 4PJJA 3JTHA 1I6XA 2NS7A 4ESBA 5FLXZ 2K27A 1UFMA 2MGQA 3DF8A 4XRFA 5FLMJ 5HLTA 3SJMA 3B02A 1MBFA 3E1SA 3HRMA 3F9KA 1T0FC 5FGMA 1U2WA 3GW2A 1ODDA 1EH6A 3H5RA 4LK1F 1SD6A 1W7PD 2JA6J 2P0WA 1G4DA 3ESWB 2PLYA 1QGPA 4LK0F 2V9PA 2L7MP 2ZXWH 3GVAA 4AIDA 1S9HA 3PQKA 4MEYF 1HKQA 1BJAA 2I10A 1JUSA 2GLOA 4N4OB 3PJRA 2NOJB 1A04A 2DA4A 3IHUA 4IOCF 3FK6A 5EG0B 1RPWA 4DBQA 4QSHA 4IRGA 3GTPJ 3DKYA 3H36A 3TP3A 2ZB9A 2F5EA 3M07A 5LEKA 2MD5A 2KZVA 2OPTA 2BE5F 4S04A 2ECBA 2F5DA 3PNYA 3IWFA 4ESFA 1A6QA 5J8FA 3ZQ7A 3IL2A 2XGEA 1FT9A 3OR2C 3ABMH 1J75A 2VQHA 3HOTA 2A5YB 1BC7C 4G6QA 1HW1A 4PGHA 3GFIA 1AKHA 2A68F 1WSUA 3GX4X 2Y9YA 2ZXHA 4KT5C 1B72B 2IT0A 1WQ2A 3HRUA 3CP2A 3E97A 1TNSA 1FTTA 2EIMH 4HLYA 2VB6A 1B8IB 5HDGA 4EATA 2AS5F 2AXTC 3DCFA 3GLXA 4IQ4A 5L3CA 1Z3YA 2DAOA 2VC0A 2I8DA 1MKMA 4YIRX 3RKXA 1SFUA 1Y6IA 2P7CB 4GYGA 3H92A 2L0KA 2PX9A 1ULYA 1V5EA 1QZZA 4JQFA 2DFHA 2IGMA 3FXUA 1LEBA 5C44J 3G3ZA 2EA4A 4YRVA 5CKTA 3WG9A 1E2XA 4BY7J 2Y0SA 1R4MB 3BLYA 4D0PA 3RKYA 5GAGJ 2MABA 3BR0A 3D5SC 1X3ZB 2FNPA 4Z6YA 1TC3C 3ML6A 1ORKA 3K4JA 4MGRA 1QO0D 4IZZA 2CSOA 2D2WA 2TDXA 2E5ZA 3BZ6A 1BJZA 1WPKA 1IRFA 3VYTB 3VYRB 2W7NA 3KE2A 4BH9A 1YFHA 1GUUA 2HPIA 3BCAA 4U88A 4AIJA 1F1ZA 4A3IJ 3C7JA 2ZJ2A 3CO6C 4IHTA 1OKRA 2KIMA 3HUGA 1MW7A 4MO7A 4BBSJ 2R7QA 1T39A 1Z05A 2V6EA 3V42A 2VJJA 3ZMSA 1XN7A 3WTVC 2EA2A 1RI7A 2E5NA 2PMZN 3G73A 1EH7A 5E3OA 4UNOA 2UWMA 3IC7A 2VI6A 2L9SA 1U5TA 2DI3A 3ZQQA 1MNEA 4I09A 2LYCA 2BV6A 2BGCA 5J1YA 5FJ8J 4F93B 3ZOBA 4DYRA 3WE2A 1W36D 3S1NJ 2WV1A 4M3FA 2IEKA 4IRHA 4M9ZA 1A36A 2DA3A 3WTYC 2V1NA 4PJ0C 2DT5A 2GXBA 2JA8J 5JVTA 4JX4A 1TL8A 3FBNB 3KX2A 2WADA 5J6XA 3HL2A 1SMTA 3DBRB 3RCOA 3F8NA 3NARA 1GHCA 2K9LA 2LMDA 3RPUD 1Z3XA 2CFOA 4M3BA 3GYHX 3KLNA 2QLZA 3MKLA 5EZHA 4EJUA 4HF2A 3BCBA 3SZPA 5IT9Z 2ZCWA 4C3JJ 4LFUA 1IZ1A 2O3FA 3CJRB 3HEFA 1YQAA 2KJBA 4KMUX 5FKOA 2MA3A 2EFNA 1HKSA 4HF0A 2HVRA 4A3BJ 2JRMA 4ANJA 4XLAA 2YU9J 5D5WB 1D8KA 5IP7J 1J9IA 3LAPA 3K70C 3HSFA 1J0RA 1ONVA 2YX7A 1UJ8A 3CCUI 3ERMA 4A3JJ 3TEDA 4OAYA 2ZSHB 5J4VA 4XKVA 5LGNA 1XCBA 2IP2A 1MMSA 3F8BA 3BR2A 2MH2A 2L5QA 2A6EF 5J3LA 2M4KA 2XGDA 2HTJA 3AAFA 4B3XA 4CYDA 4LD5A 3OYMA 3ASNH 1FP2A 3I5UA 4XRSG 2X1CA 3TBIA 4FX4A 1TWAJ 2HOTA 1KQ0A 4R8HA 2EBIA 3LSRA 2R7RA 3BWGA 2G0EA 3D5RC 1IN7A 3H3ZA 5D5XB 1DU0A 3NAUA 1MBEA 2FU4A 3KP4A 2VKDA 2Q2EB 4HW0A 2DK8A 1VQ9I 1F43A 1XPXA 5LHIA 4I02A 3KLOA 1MD0A 3HDDA 3ZPLA 4MHGA 3EQLF 4GO1A 2H94A 2QUFA 2VE9A 3CF5F 3FMQA 4WX9A 2VOPA 5BPIA 1YO5C 1O3RA 3P7NA 4BDZA 1EF4A 2DMNA 3OR1C 3K4MA 1N25A 2D1HA 2VONA 5JR3A 4XLNF 2MBFA 1FYKA 3GUDA 1P92A 2K3PA 4RAZA 1XSDA 2M3AA 3SZTA 4KNYA 2EV5A 2LFBA 1LUJB 5F6FA 1B6AA 1YRNB 3TDUC 5E1ZB 2LREA 3T8RA 3L2UA 2OUMA 3GXOA 2LVSA 4L0ZB 1WHUA 3KYCB 2E2HJ 1BIBA 3S3MA 1CQTA 3M1EA 3IAM2 1FJLA 3BR5A 2CQNA 2V79A 1DU6A 3QYBA 3BJOA 1F36A 1R71A 1I1SA 3GFJA 4CUGA 5M5WJ 3IWZA 1LPQA 1TNTA 5ICGA 2LRDA 2ZMEC 1DPRA 3ONQA 2LF7A 1G3YA 3W6VA 3WE3A 3S2HJ 3W3CA 2W25A 4LOCA 2FBIA 3F8FA 4FT8A 5J8CA 3W2VA 3ZQLA 5ICEA 2HU9A 4B1RA 3EUAA 3CDHA 3CUQB 3RZDJ 4BHPA 3SZGA 3P5JA 3ZQFA 2B7EA 1WRJA 1G3TA 2F5VA 3Q0VA 3V8JA 2M87A 1K83J 1V54H 2HWVA 4XSXF 3VSKA 3OYFA 1REPC 3G2BA 4P5OA 5TISC 3K1NA 3CUOA 3IUOA 4YIIA 2JUCA 2XPVA 1SFXA 2XASA 5HLIA 4F3QA 1Z9CA 2VPLA 1OYIA 5B1BH 2ZJQF 1OCTC 3A0HC 3V8LA 2Q0OA 3I59A 3DV8A 1FBSA 4FCYA 2FUG2 3OS2A 1R9TJ 3NEUA 3E5QA 4X6AJ 1YJWI 4PSWA 5BPDA 1J59A 2CO5A 2XGXA 2L2OA 2L4AA 3P9CA 1E3PA 3CJNA 3C2BA 1BM9A 4QTRA 3KZZA 5FRNA 4KISA 4RAYA 3DBHB 5HLHA 1PVEA 4RGSA 5J4YA 1GDTA 3H5NA 4BQOA 5F0HA 5DCMB 4IEJA 3BR6A 4M9XA 2AO9A 3LAJA 1S7EA 2NAZA 1XSXA 3ERED 3JRBA 3DPTA 1MH4A 1UHMA 2JZYA 3L2WA 5K1YA 1FOYA 3PIOF 1W5TA 3OYEA 2QWWA 3RJPA 1X1AA 5LRSA 4A3LJ 2YSRA 3QPTA 4G7OF 3HRSA 1MDMA 1FOXA 1R1UA 4ZZLA 5KAFC 3OS0A 3FXOA 4XN0A 2HOAA 4BY1J 3LQRA 3H5AA 5JLWA 2DJIA 4C3IJ 2JVGA 3AG1H 3S15J 3AFHA 3JSPA 2XRNA 4S05A 4RA2A 3RYPA 1S5LC 1IDZA 5IOYA 2P81A 3EDPA 1A31A 1TT0A 3TOAA 4MTEA 2RAEA 5FROA 3JR9A 2GWRA 2P6SA 1M1EB 2IXSA 2Z5UA 2E1CA 3CZ6A 2F4MB 3F0CA 1ZR4A 5LGTA 3OYCA 4QLCU 3CCMI 3JW4A 1JKOC 2IS4A 1JGSA 2G7HA 3WGHA 1NH3A 1MSFC 2O9LA 5FFZA 4CICA 1OCZH 4KN4X 4M3DA 2KRCA 5K7ZA 1YIJI 1R6RA 4IHYA 1G6NA 1E3HA 2PMZA 2J5PA 2STTA 2E7WA 4YIFA 1VQ5I 1MJAA 4UB6C 1XGOA 3G4SI 1YYVA 3P9IA 3CJTB 4HX4A 4KIBA 3RPUA 1BC8C 2EZKA 1OISA 4CYCA 3QU6A 4BE1A 1W0UA 1ETYA 3WU0A 5GPAA 3AG2H 4Y3OA 1ZRDA 4HV5A 1WJFA 4II2A 3ZQCA 4KICA 2O6GE 2Y0SN 3FKIJ 3ELKA 3K4CA 2L54A 2HQAA 2BEOA 2EIKH 2RKHA 2P4WA 4HZFA 5F27A 3OYGA 3CCEI 1AHDP 3S14J 4AVPA 3BG6A 4YEJA 2NRAC 5JVGF 1XMXA 2PMUA 5K7FA 4PGGA 5J1RA 1YIOA 1WVRA 1U9NA 3CD6I 2QSGX 1ETVA 2AQFA 3LWFA 4YFKF 3L7WA 1XDUA 1VQ7I 5CJ9A 3JRAA 2NVXJ 4L18B 2LF8A 1J09A 1LEAA 1OCCH 1USSA 2IGOA 2P6TA 2QQ8A 3HJEA 1T98A 3FIWA 1GXQA 3H0DA 2M34A 2YUSA 3SXYA 2IJLA 5ILSA 1EH8A 3TQNA 2R7WA 5FKMA 3OS1A 4E7JA 2L7FP 2MW8A 3A01A 1Z77A 3HOUJ 1ETKA 4CGZA 1X2MA 3K69A 3DBLB 2WY8Q 3BDDA 4HSRA 3L2QA 2OTJI 3FHZA 4G8XA 2EQRA 3GTGJ 3DKWA 4BJTA 5EG0A 2K5CA 4BL0B 4KIFA 2PEXA 1VFCA 3VWBA 1FOKA 1R5GA 3EETA 2XUBA 2XAHA 4MLOA 2OQRA 2E1MC 3B6AA 3FXJA 2W48A 1S7AA 5CYVA 2FRHA 4HQMA 3CJQB 3K4NA 1FYLA 4LITA 4ESJA 3DEUA 4KDPA 5DTDA 3VYSB 3KEOA 5HS8A 1VQKI 1U6GA 1RR8C 5F08A 5L3BA 4E7KA 3Q3SA 4IF4A 1B72A 5EGOB 2FXAA 3UR3C 5DM7F 3OIPA 1MMAA 2O0YA 2R92J 3JRCA 1B8IA 2CQQA 3RI4A 3HPGA 4QPOA 3LNQA 3S1MJ 4A5MA 2LY9A 4WXDA 3AKZA 1Y39A 3GFLA 2CH0A 4RBOA 2DBBA 3RDIA 1I6HJ 2AXLA 5CVUA 4WWCA 4ABZA 1R49A 5IT3A 5D4RA 2ESNA 3JCUC 3K0LA 1KGSA 3Q0WA 2R0QC 1R22A 3U2RA 2PBIA 5IYDJ 3LQQA 3V8KA 5LEJA 1N77A 3WHCA 1PDNC 4OMZA 2WBMA 2ZNZA 3QP6A 3LFUA 5DUKA 5IPAA 3N97A 1DQUA 1RESA 3KIOA 2R7ZJ 3U1KA 3ZMDA 2MC4A 2V4JC 4IJAA 4D5CA 1JUMA 1ZKGA 2QGUA 2KRHA 3CDLA 2OCCH 3KEYA 1QPIA 2NVYJ 2JWTA 1KU9A 1Z0XA 4LB5A 5JFRA 2DOAA 3JREA 4Y15A 2W00A 2R7XA 1HXDA 2ID6A 4ZYDA 3MD2A 1BR2A 2B63J 4LG0B 4IOAF 4FASD 2H8WA 4NUBA 5D4SA 4A3KJ 4BUPA 1BL0A 2BY2A 2Q1ZB 3WODF 2NOGA 4AWXB 2K7LA 3CP8A 1HA8A 1IN4A 2KQRA 3MQ0A 4CCLA 4BDYA 2A6HF 2FD5A 3HGYA 4DIQA 2R7VA 3IP4B 2FE3A 2DOEA 2XF5A 1VQ6I 1Z7LA 2BXZA 4HBLA 4PDKA 2GIZA 2KJCA 2KIQA 2MFZA 5DM6F 2VOOA 2Z99A 3S16J 3DTEA 2HS5A 5EEAA 3W2AA 4DYCA 1FC3A 4BJ6C 4A3EJ 3DQVC 3O8GA 4ZDLA 3ABKH 2W82A 3CCRI 1R1VA 2ZFUA 2JK3A 3PNTA 3BTIA 2RGVA 1HDDC 2XDVA 4C2TA 4E7HA 5HOOA 4IVNA 3L2CA 1GT0C 1RNLA 3QOEA 2OF7A 2Z1DA 2HYFA 1W36C 2EFOA 1FWZA
chains in the Genus database with same CATH topology
3DLLF 1ACIA 5DM7F 2NXNB 3CCMI 3J7YJ 1YJNI 3CC2I 3I56I 1Y39A 4UY8I 2E36A 1YIJI 1YI2I 2QEXI 1VQ5I 3CMEI 2QA4I 3G4SI 3CJTB 1YJ9I 1HC8A 1VQ8I 3CC4I 3CCUI 2K3FA 3CMAI 1MMSA 3CCEI 2ZJQF 1VQNI 3J7ZI 5JVGF 1VQMI 1YJWI 5GAGJ 3I55I 2ZJPF 1QA6A 1VQLI 5GADJ 3PIPF 3CD6I 4IOAF 5GAHJ 3CCQI 2H8WA 1VQ7I 2OTLI 3CCJI 3G71I 3CC7I 1VQ9I 3CCVI 2E34A 1VQ6I 4V19K 4IO9F 5DM6F 1FOYA 1VQPI 3PIOF 2OTJI 3CF5F 3G6EI 1VQOI 1YITI 1FOXA 5GAEJ 3CCRI 2E35A 3CCSI 1YHQI 2JQ7A 2FOWA 4IOCF 1FOWA 1VQ4I 3CCLI 1S72I 2ZJRF 1VQKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL F;  1ACI A;  5DM7 F;  2NXN B;  3CCM I;  3J7Y J;  1YJN I;  3CC2 I;  3I56 I;  1Y39 A;  4UY8 I;  2E36 A;  1YIJ I;  1YI2 I;  2QEX I;  1VQ5 I;  3CME I;  2QA4 I;  3G4S I;  3CJT B;  1YJ9 I;  1HC8 A;  1VQ8 I;  3CC4 I;  3CCU I;  2K3F A;  3CMA I;  1MMS A;  3CCE I;  2ZJQ F;  1VQN I;  3J7Z I;  5JVG F;  1VQM I;  1YJW I;  5GAG J;  3I55 I;  2ZJP F;  1QA6 A;  1VQL I;  5GAD J;  3PIP F;  3CD6 I;  4IOA F;  5GAH J;  3CCQ I;  2H8W A;  1VQ7 I;  2OTL I;  3CCJ I;  3G71 I;  3CC7 I;  1VQ9 I;  3CCV I;  2E34 A;  1VQ6 I;  4V19 K;  4IO9 F;  5DM6 F;  1FOY A;  1VQP I;  3PIO F;  2OTJ I;  3CF5 F;  3G6E I;  1VQO I;  1YIT I;  1FOX A;  5GAE J;  3CCR I;  2E35 A;  3CCS I;  1YHQ I;  2JQ7 A;  2FOW A;  4IOC F;  1FOW A;  1VQ4 I;  3CCL I;  1S72 I;  2ZJR F;  1VQK I; 
#chains in the Genus database with same CATH topology
 4XNF A;  1E3O C;  1D0Z A;  2LBF B;  3T0Y A;  1XCV A;  2WAQ A;  1MIJ A;  1SEU A;  2G7U A;  4BE0 A;  3PUB A;  1IDY A;  3K6G A;  3H0G J;  5CPR B;  2V26 A;  2WWY A;  3CC2 I;  5KNL A;  4E7S A;  2YU3 A;  1TWG J;  3DPU A;  3PSF A;  1AU7 A;  4M6Y A;  2KMU A;  2GM4 A;  3I4M J;  1O4X A;  3L9F A;  1R5H A;  4CDG A;  1YTY A;  3GO5 A;  1OPC A;  4XR6 A;  3OYB A;  1H9T A;  4KA4 A;  1JI8 A;  3WU2 C;  3ZCO A;  4NB5 A;  2EV6 A;  3V7S A;  1ZRE A;  5TGT A;  2BVM A;  2IA1 A;  2M4G A;  2QA4 I;  4HST A;  3V4G A;  4J01 A;  2DT7 B;  3I3L A;  1SD4 A;  3ZQG A;  1JE8 A;  1HC8 A;  2Z3Y A;  1VQ8 I;  4LMY A;  4UV8 A;  5EF6 A;  2RQQ A;  4DGW B;  2BW3 B;  2ELJ A;  2UZK A;  1LE8 A;  2VJ5 A;  4AD9 A;  3CMA I;  3RZO J;  3WGI A;  2RRE A;  3LL7 A;  2UV1 A;  1IN8 A;  1GVJ A;  4V2G A;  4BHB A;  4H0E A;  2HR3 A;  4HA8 A;  2EFQ A;  1V3F A;  1OJL A;  4A3M J;  2DTZ A;  2QQ9 A;  2RNJ A;  2Z33 A;  1F5T A;  3FXL A;  3UKG A;  4A3C J;  2OJE D;  5DD4 A;  3ECO A;  4L9T A;  2PN6 A;  2HQ5 A;  2QYO A;  2VT3 A;  3GZN B;  1KYW A;  2L02 A;  4HX8 A;  4D9J A;  5IT9 K;  3BG3 A;  3CQZ J;  2PQ8 A;  1KU2 A;  3ZQI A;  1X1P A;  3REO A;  4BGD A;  2H1L A;  5F64 A;  2QF7 A;  4ZH4 F;  5K7H A;  1F4K A;  5IY5 H;  3G71 I;  5M5Y J;  2R7S A;  4IQJ A;  2ZSI B;  3GFM A;  9ANT A;  5LHG A;  4IXA A;  5CVI A;  2A6T A;  1WFX A;  1HW2 A;  2MH9 A;  5TJJ A;  2NYX A;  1VQO I;  4HNV A;  1D1A A;  1NK3 P;  1TBX A;  1X1D A;  2ZFW A;  4E6K G;  3FX3 A;  3N05 A;  2ZXJ A;  5H2F C;  4PK4 A;  1JT6 A;  3M8E A;  2ACJ A;  1RIO H;  2DYS H;  2JQ7 A;  1X3W B;  2COM A;  4RGU A;  1YRN A;  1CF7 B;  3SHF A;  3RIR A;  1LFU P;  1JTX A;  1YOV B;  3ZMV A;  3OYD A;  4BQQ A;  2E19 A;  3SQN A;  2R93 J;  4EEF G;  1X58 A;  3F8M A;  3H35 A;  2YS9 A;  1PP7 U;  2CQX A;  1NG7 A;  1OLT A;  1P4W A;  3F3X A;  4E70 A;  1S8N A;  2P5V A;  1TQP A;  3HOV J;  1QVU A;  1LVK A;  2M9H A;  3QPL A;  2CQK A;  2H09 A;  3I4P A;  3PQJ A;  1KON A;  3IH2 A;  3ZMZ A;  4OU0 A;  1H89 C;  3VPR A;  5HDK A;  3OYH A;  5K5Q A;  1SAN A;  3WTU C;  3PM1 A;  4PJN A;  5E1X A;  3HPH A;  3ZN0 A;  2VUM J;  4NBQ A;  3WTX C;  2ISZ A;  1D3Y A;  2DA2 A;  4Q5S F;  4Z2Y A;  2K9Q A;  2W57 A;  4UB8 C;  1W5S A;  2FBH A;  3L2V A;  1X4P A;  4O5V A;  3C18 A;  3Q9V A;  2DQL A;  3EUH C;  4MQV A;  1VF9 A;  4MEX F;  2WV0 A;  2NNN A;  3N4M A;  2JSP A;  2QSF X;  3QOP A;  4G6D A;  2AHQ A;  2DDA A;  1UG2 A;  4RM2 A;  4KUM A;  3E6C C;  1G8X A;  4Y52 J;  4G9Y A;  2K3F A;  4I98 B;  3HGG A;  2ELK A;  4NC7 A;  4ZYG A;  4F52 A;  4U7D A;  1J2X A;  4ZJZ A;  2OZU A;  5CQG A;  5C3E J;  1WWX A;  2K02 A;  1VTN C;  4O3M A;  4RMN A;  3AL0 B;  5BMZ A;  1ZGJ A;  2F4O B;  4BNC A;  1LB2 A;  5EEG A;  2ELH A;  1SAX A;  1MBJ A;  3PNV A;  1FP1 D;  3UNG C;  1Z1D A;  3A1Y A;  1UHS A;  3BR3 A;  3TO7 A;  4BEH B;  4IRI A;  4CA0 A;  1OYW A;  2L3D A;  3H3U A;  4Y13 A;  3FM5 A;  1E17 A;  4IPA A;  1H0M A;  1WH7 A;  4G94 A;  4ENN A;  1LVA A;  2VBY A;  4V2F A;  2R5Z B;  1OR7 A;  4G12 A;  1AWC A;  3SFZ A;  3MKW B;  4PZJ A;  2NVQ J;  3KET A;  4LG3 A;  2R5Y B;  2CUF A;  2WAE A;  2IS6 A;  2JMW A;  2XAF A;  4C30 A;  2ZC2 A;  5HS7 A;  3LMM A;  4BAY A;  1P7J A;  2CUE A;  2HGC A;  1P4X A;  5HNF A;  1R5I D;  1B9M A;  2ISY A;  4OIR F;  3SFI A;  3CF2 A;  3J80 Z;  1ETW A;  3JRI A;  4K2E A;  4PJM A;  2HDW A;  4I0B A;  3VOD A;  3A02 A;  3SDB A;  5F04 A;  4ETS A;  1FYM A;  2M7B A;  3EPZ A;  1JHF A;  4RDU A;  3IAS 2;  1VQ4 I;  4M6X A;  3CCL I;  4QIW N;  2M8E A;  5IOZ A;  5M3M J;  4I99 C;  2ZJR F;  2ZBK A;  1IXS B;  2IGK A;  4UVC A;  4M6V A;  2QZ8 A;  1YW8 A;  1ZGA A;  2EH3 A;  1R23 A;  2CW0 F;  1BOA A;  1NTC A;  1LKX A;  2XPU A;  5AIP A;  3OYJ A;  5A2Q K;  1OFC X;  2QQB A;  3QYF A;  4BQA A;  1BOB A;  3IH4 A;  3HSE A;  3WU1 B;  3TW7 A;  2VBX A;  2STW A;  3E5X A;  2YR2 A;  5ED4 A;  2K85 A;  3BJ6 A;  3RPQ A;  1PUF B;  4HYE A;  1S3J A;  4WXC A;  1RKT A;  3K7A J;  4A6D A;  4F92 B;  4D5F A;  1MNM C;  2XAJ A;  2TRT A;  3OOP A;  4PFO A;  2ZME B;  1BI3 A;  3MN2 A;  3E3V A;  4AUX A;  3LSP A;  4GGG A;  3FKJ A;  1R4N B;  3RSN A;  3IRQ A;  2TCT A;  2IS2 A;  2GZW A;  4XLH A;  1YJ9 I;  4EQQ A;  3HOZ J;  4LIV A;  4DNC A;  2BBY A;  1LDJ A;  2A5W A;  1XMA A;  3HOS A;  2XGC A;  3SYT A;  1IUF A;  4QWQ A;  5FD6 A;  2B9S A;  1R7J A;  1O3T A;  3OSG A;  2K86 A;  3S32 A;  4A3D J;  2G9W A;  3I0T A;  3ABU A;  4XM3 A;  3KYL A;  1JKQ C;  2XRO A;  3HTU A;  2V1X A;  3K9T A;  5F1J A;  4PJL A;  4HX7 A;  4LIU A;  2XHK A;  2PG4 A;  4PCQ A;  4XK4 A;  3HB9 A;  3LFK A;  2HEO A;  2CV0 A;  3VB2 A;  4UVB A;  1TW2 A;  2DA7 A;  2CFX A;  3LA3 A;  5GTH C;  3GTJ J;  3M8F A;  4ENK A;  3BRO A;  3OSF A;  2KZG A;  4NC6 A;  4G7Z F;  3CTA A;  1I1G A;  2BHZ A;  4JP0 A;  4Y7N J;  2FQ3 A;  1PUE E;  1RZ4 A;  5LFA A;  1Y0U A;  3ASO H;  3LA7 A;  3PFY A;  3GBG A;  2HPM A;  1B9N A;  2VQG A;  1IG7 A;  1ZAR A;  3ZMT A;  1YS6 A;  4IHW A;  3CCY A;  4BHC A;  5HLG A;  5EDN A;  3OY9 A;  2LD5 A;  3MZH A;  1N78 A;  1D0X A;  5H20 A;  5DDG A;  1ZLJ A;  4XLF A;  4V19 K;  3ULQ B;  1TQM A;  1K4S A;  4M71 A;  1IC8 A;  3M4O J;  5LBQ A;  4XKC A;  1JJ6 C;  1T08 B;  4DJA A;  2ZKZ A;  1J5Y A;  4OOI A;  4XMY A;  4ENJ A;  4M9S A;  1FX7 A;  4I2O A;  5KVR A;  3TKY A;  1T2K A;  1T6S A;  5L3F A;  4BXF A;  2VBZ A;  1X19 A;  2JVH A;  1I39 A;  1RR7 A;  2DOD A;  2OAZ A;  2HDC A;  4OIN F;  2HI3 A;  5CVJ A;  3F8C A;  1HST A;  1N75 A;  1J7K A;  5A2Q Z;  2BHY A;  3TP0 A;  1UST A;  3B6C A;  2EZL A;  5L3D A;  5DEQ A;  1SFO J;  5EGO A;  3O8H A;  2WAQ N;  1MJB A;  1JT0 A;  3MKZ A;  1Z21 A;  2QM3 A;  4XID A;  1Y56 A;  3J7A O;  2Z9O A;  4GRI A;  1ZGW A;  1U5T C;  3R60 A;  1HLV A;  3E6D A;  3E7L A;  1EKE A;  1FIA A;  1I27 A;  3T5X A;  2K9N A;  1ZK8 A;  1WCM J;  2EV0 A;  2DTR A;  4RB0 A;  3K70 D;  4G6T B;  4L5I A;  2XF6 A;  2MLK A;  5HOD A;  3TL4 X;  3OYA A;  1UB9 A;  4P96 A;  4B47 A;  1Z91 A;  1BN5 A;  2VQC A;  3HZJ A;  4W1U A;  3L1P A;  2VAS A;  3BG7 A;  1P9Q C;  2FQ4 A;  3S8P A;  1ERD A;  1I3Q J;  5M3F J;  1SAU A;  1VZ0 A;  2ZXI A;  1BI0 A;  2A05 A;  3KP2 A;  4GFB A;  1FPQ A;  2OQG A;  4AC0 A;  2LSO A;  1BR1 A;  2MD0 A;  2W84 A;  3J7A Y;  2E7X A;  3I9V 2;  5KAI C;  4M3G A;  3JSO A;  3PSI A;  1SVO A;  5DS9 A;  4F55 A;  3F22 A;  1K61 A;  2BXY A;  2MSY A;  3HIF A;  1T8I A;  1X4O A;  2RQP A;  4OIO F;  2OBP A;  3FZV A;  3HRT A;  4B4C A;  4ZYE A;  4A6E A;  3IRR A;  1G59 A;  1ITY A;  3ZRG A;  4EJW A;  1VQN I;  2O7O A;  4KJZ A;  4LG0 A;  3G1O A;  1A6I A;  1R58 A;  4L9N A;  5FKK A;  1IJW C;  1QA6 A;  4WXH A;  2LOO A;  5C4X J;  1FBQ A;  2BOL A;  2IBD A;  2VXZ A;  3K10 A;  1T0F A;  2LY2 A;  5ICC A;  1EV7 A;  1OQY A;  2CG4 A;  2V1U A;  2P8T A;  2DMT A;  3C2G A;  4GDF A;  4L5E A;  2DYR H;  3BC8 A;  3FF5 A;  3ZP5 A;  1T56 A;  2VPR A;  2P5K A;  4P1W A;  2WY7 Q;  1TWH J;  4XL9 A;  2WC2 A;  2RN7 A;  4U0Y A;  4IO9 F;  4E7I A;  4OIQ F;  1W7P B;  4EVI A;  4XBF A;  2DFI A;  4DQ2 A;  1SFK A;  3GTO J;  4KT6 A;  3FHN A;  1MBK A;  3A03 A;  4B44 A;  1BIA A;  4R1H A;  1R36 A;  5B1A H;  2E2J J;  3LSG A;  2HKO A;  5E8G A;  1POG A;  2E1M B;  5CQE A;  1DDN A;  1IF1 A;  1WI9 A;  4OIP F;  3VEP A;  3E6M A;  3RQ4 A;  2EZH A;  1TTY A;  1ON2 A;  1Z7U A;  3H9Q A;  3HKZ A;  2EPF A;  2DFE A;  1R00 A;  1XTA A;  5FLV A;  1EA3 A;  2HZT A;  2V1D A;  4B09 A;  3OYK A;  3C1D A;  2JT1 A;  4NC8 A;  3TDZ C;  3QOD A;  4I0A A;  3CMM A;  1I5Z A;  1MGT A;  3C3W A;  3J7Y J;  1U3E M;  2QKM B;  4NNJ A;  1YJN I;  3GTL J;  3FDY A;  5K5R A;  1KZH A;  1IV6 A;  2DA5 A;  2CW7 A;  3JAM K;  4HDV A;  2NNY A;  5E18 F;  5FB2 A;  2E36 A;  3GZ5 A;  3JRF A;  3Q9S A;  1DPU A;  2GIV A;  3S17 J;  4Y4R A;  1QNT A;  3SEZ A;  4N4N B;  2LKS A;  5B66 C;  1SFE A;  1I50 J;  1SVL A;  5EEH A;  1ZR2 A;  1P2F A;  2HKX A;  3KFW X;  2VT2 A;  2EWN A;  4L9V A;  4QPQ A;  3ZGK A;  3BZK A;  1K78 B;  2IA2 A;  5ILV A;  1FLI A;  2JA7 J;  1VI0 A;  3CMY A;  1BBY A;  4DW6 A;  1IRX A;  4Q4Z F;  4KIG A;  2L9R A;  1K4T A;  3BP8 A;  4BXX J;  2VE8 A;  1QU3 A;  1OCP A;  3EYI A;  3MCZ A;  3D0S A;  1T95 A;  1UG0 A;  2WB1 N;  2LTP A;  3W6K B;  4B3A A;  1LFP A;  1ZQ3 P;  1GLN A;  4EM2 A;  1ZLK A;  3DU5 A;  2LKX A;  4NQW B;  3BY6 A;  3GTQ J;  3GLL A;  1YE9 A;  3S3O A;  3VYU B;  5DV5 A;  2HZD A;  3TO9 A;  2JJ7 A;  1MDM B;  3CCJ I;  3CC7 I;  3M7G A;  1HSJ A;  2ME0 A;  3GWZ A;  2A3S A;  4KIT B;  4RB2 C;  3CCV I;  3PO3 J;  1TP4 A;  3OMY A;  2BZT A;  2XF7 A;  3FMR A;  4U0V A;  4NDL A;  1JKP C;  4KN7 X;  1AA7 A;  1O7L A;  1IN5 A;  3QWL A;  1DP7 P;  1F9N A;  2XV4 S;  2CW8 A;  1KA8 A;  3KZI C;  1CF7 A;  4XON A;  1ZN2 A;  3F6V A;  2V6C A;  2K9M A;  4M3E A;  3CO7 C;  3BPV A;  4X0G A;  2KFD A;  4WCG A;  3CCS I;  3FXR A;  3I71 A;  2PI0 A;  5LLQ A;  4O6J A;  4C3H J;  1XD7 A;  5D6E A;  3D5L A;  3MAJ A;  2OU2 A;  1ZG5 A;  3FK7 A;  4HV6 A;  1IUY A;  4X1E A;  4JOM A;  3WG7 H;  2ZNY A;  3EUK L;  3JAM Z;  4IHS A;  4JK1 X;  3M9A A;  3T1B A;  1UMQ A;  2ZO4 A;  4YFX F;  4LLN A;  4CCK A;  2VN2 A;  3H9G A;  1RRJ A;  1KQ8 A;  5IP6 A;  4ITV A;  2L9V A;  4RAF A;  5H6Q A;  4ZYA A;  3WTW C;  2GXG A;  4A0X A;  4CYC B;  2FMY A;  2L4M A;  2W85 A;  1D8J A;  3CES A;  3DEE A;  4U7B A;  3KPH A;  5F0C A;  4HG2 A;  2X6X A;  2LG4 A;  3R4K A;  1ETO A;  3GF2 A;  4N9I A;  4XSZ F;  2EJR A;  4DZP A;  1ZG3 A;  3MFK A;  1V55 H;  1XGM A;  2WA0 A;  2A69 F;  4CHU A;  2Y48 A;  3QPH A;  2CU7 A;  2H8R A;  1IO2 A;  2VC1 A;  4JX5 A;  2I5U A;  3C2H A;  3LOC A;  3EYY A;  1T33 A;  2PJR B;  1H9G A;  1GXP A;  4RS8 A;  5CLS A;  2VBW A;  4UUS B;  1ZRF A;  3KZY A;  4BEH A;  2JPB A;  4C2M J;  5FFX A;  5B3S H;  1LDD A;  3O6B B;  4HLX A;  1UCR A;  2LKP A;  5D6F A;  4D7M A;  1YX5 A;  3G1M A;  3BT9 A;  2FBK A;  4CH7 A;  2R5Z A;  1FBU A;  5IYB J;  4II3 A;  2NVU B;  5FO5 A;  3O3K A;  3WHB A;  1FY7 A;  2KKO A;  3S3N A;  3MZY A;  5J40 A;  4P9F A;  5D5V B;  5B5E C;  2IVM A;  3A01 B;  2HNH A;  2R5Y A;  2OZ6 A;  4BQN A;  1WI3 A;  2X9D A;  3DTK A;  3KCC A;  5F0F A;  2VJI A;  4HAM A;  4OAZ A;  4UUV A;  2OTL I;  2V7F A;  2L7K A;  1H88 C;  2NS8 A;  5EZG A;  3LA2 A;  3DPL C;  1JJ8 C;  2W24 A;  3OYI A;  4W97 A;  4CCO A;  5TRD A;  2IAI A;  3VSL A;  4L5J A;  3H3V K;  4FQG A;  3OWT A;  2X0L A;  3MMY B;  2N8G A;  3BTC A;  1ZEL A;  3G6E I;  3OYN A;  2BY1 A;  2FML A;  2KP6 A;  3MVP A;  1GV5 A;  2Q2E A;  1XGN A;  4U87 A;  3RQI A;  4OMY A;  4RGR A;  2M0C A;  1W5C C;  2QQA A;  1Q1H A;  2WTE A;  2X1D A;  4HQE A;  3DXJ F;  3K4B A;  3WTZ A;  1L0O C;  2RV8 A;  5DUI A;  4MFE A;  5KK1 A;  4ZZD A;  3ISP A;  4PFP A;  1JXS A;  3DLA A;  1FOW A;  2Y30 A;  4CCJ A;  2KDZ A;  2LK2 A;  1XX5 A;  4AYB A;  1S72 I;  2COB A;  1U78 A;  5BOX A;  4A93 J;  1P7I A;  2RVC A;  4ZTJ A;  4EJV A;  4FX0 A;  2GQQ A;  4A12 A;  1D0Y A;  4Q47 A;  2VLA A;  2VQL A;  1PUF A;  1X2N A;  4XLC A;  2XC7 A;  5J47 A;  2XSD C;  3I53 A;  1XGS A;  1Y1V J;  4XLE A;  1LQ1 A;  2ZME A;  3KP7 A;  5JLX A;  5JHF A;  1G2H A;  4A0Z A;  4I7H A;  1U0J A;  2O8K A;  4E7L A;  1WJC A;  1P4A A;  1HCR A;  5E20 A;  2ICW G;  2RDP A;  2F4I A;  2OA4 A;  3S2D J;  2VKV A;  3BG5 A;  3J80 K;  2LP0 A;  4B43 A;  2F5F A;  2FF4 A;  2K40 A;  3KYD B;  2KDO A;  2VKH A;  3V7C A;  1OCR H;  3S1R J;  1QHG A;  1GV2 A;  2CWE A;  4EM0 B;  1SVM A;  2KT0 A;  2R4G A;  3FWE A;  2QKL B;  1S7O A;  1R1T A;  2FX0 A;  2MLG A;  2PMH A;  2EFW A;  3OIQ A;  2O8X A;  5EYR A;  2GXA A;  2OD5 A;  2W1O A;  3OYL A;  1B4A A;  1ZHF A;  1MJ9 A;  3L2R A;  3VOE A;  3GZ6 A;  2R7D A;  2BY0 A;  2KPM A;  3CUQ A;  2DPD A;  1UEL B;  1UZC A;  1IRZ A;  2DW4 A;  1QRY A;  1G3S A;  2DOF A;  3QPS A;  1YS7 A;  2DFF A;  2H6B A;  2XIG A;  2HQN A;  3E0J B;  5F1R A;  2DDB A;  1TQI A;  2XSJ C;  3R61 A;  4TV7 A;  2HFH A;  5ILU A;  1HF0 A;  4RGX A;  3OL3 A;  2KLO A;  2LLK A;  4M73 A;  5GAD J;  1XC5 A;  4EM1 A;  1KQ9 A;  1D5Y A;  3V7R A;  4B48 A;  3I54 A;  2ESH A;  3BQZ A;  2FJ1 A;  3NWT A;  2ME6 A;  2WAF A;  4P9U A;  2X4H A;  2F6C A;  4IX7 A;  2EFP A;  1RUN A;  3I58 A;  2M30 A;  5E3L A;  4ZDP A;  1TWC J;  1MH3 A;  5JI6 A;  1WZ2 A;  2QBY B;  4ZYH A;  2F5C A;  4FHT A;  4M74 A;  1Z6R A;  3RTR A;  3K4K A;  3FXM A;  1IN6 A;  1L3L A;  1JHH A;  2E2I J;  2AQE A;  4XQF A;  4LJZ F;  3AG3 H;  2FNA A;  2MG4 A;  2DPU A;  1LFB A;  2Y75 A;  4A2U A;  1IAW A;  1MMN A;  2FEZ A;  1YIT I;  5H6R A;  5GAE J;  2CJJ A;  5DCM A;  3CLO A;  2E35 A;  4XRS A;  2WB1 A;  3HKZ N;  2E1N A;  3W2W A;  2XPW A;  4OWR B;  4EJT A;  4HRI A;  3DFG A;  4S0H B;  1Z67 A;  2VL8 A;  4CSW A;  2DMQ A;  3FXK A;  3D1N I;  5KHD A;  2KIF A;  2R3S A;  4XOR A;  4BE2 A;  2JN6 A;  2JTV A;  2X6W A;  1SD7 A;  1NHA A;  4L9J A;  3ROU A;  3H1C A;  3QRF F;  3J81 K;  1S29 A;  4EGY A;  1K79 A;  3IH3 A;  2O61 A;  1XDS A;  1V5F A;  4HNU A;  2CUZ A;  3PL8 A;  4LGW A;  1YW9 A;  1SMY F;  3FMS A;  5D5U B;  2M5W A;  3IV5 A;  2CUJ A;  3OV8 A;  4UY8 I;  4KYW A;  5E79 C;  5ERI A;  2Y0M A;  4FE7 A;  5D8K B;  2EB7 A;  1IW7 F;  5HDN A;  1PYV A;  2BVL A;  2UUZ A;  3AL0 C;  4MQ9 F;  1AKH B;  2H27 A;  3KP5 A;  1U9O A;  4I01 A;  4JX6 A;  3TW6 A;  4CXF A;  2VIX A;  1IXR C;  1LE8 B;  3KP6 A;  4BYY A;  3DEW A;  4DOZ A;  1BW6 A;  5L3E A;  1TWF J;  3HOY J;  2OC6 A;  2XKO A;  2R7O A;  5DD8 A;  3BR1 A;  1XG1 A;  2M7A A;  1HBX G;  2Z2S B;  2V9K A;  2JUG A;  4XIC A;  5FKN A;  5LGU A;  2QVO A;  1JKR C;  1K6O A;  2Y2Z A;  4HEA 2;  2QCO A;  1OCO H;  4N9H A;  5HS9 A;  4E4H A;  1MSE C;  5K5O A;  1ENH A;  4AIH A;  5GPC A;  1V4R A;  3M8J A;  1IXC A;  2ZJP F;  2D1V A;  1XMK A;  2MYS A;  5KCM A;  2DU9 A;  2KIU A;  1PP8 F;  1VQL I;  2HOS A;  4NHJ A;  3ECH A;  2KRF A;  4XRM A;  1DGW Y;  5GAH J;  3R0A A;  1WJE A;  3CCQ I;  3OL4 A;  1WGX A;  2LR8 A;  1KYZ A;  4FET A;  3T8T A;  1VND A;  1W7P A;  4M72 A;  2CV1 A;  1YW7 A;  3QYE A;  2RNG A;  4RM3 A;  4IHV A;  1Y0N A;  1RKW A;  1Y8Q B;  5AIQ A;  1DUX C;  3TGN A;  3M1C A;  2HDD A;  4LB6 B;  2Q8K A;  2CV2 A;  4C9Y A;  1KU7 A;  1JGG A;  2M8G X;  2DA6 A;  3GCM A;  2LY1 A;  2VOD A;  1FSH A;  3H9J A;  3R6S A;  2R7U A;  3VFZ A;  4Y17 A;  4XOT A;  3HUG B;  3J81 Z;  1I3A A;  1CGP A;  2XB0 X;  2QSH X;  4A5N A;  2LDU A;  1FSE A;  4A3G J;  2ADU A;  2XVC A;  2DK5 A;  2C6Y A;  1FIP A;  3BZC A;  3E6B A;  5GP9 A;  1IGN A;  1O3S A;  3JRD A;  4HPQ A;  3TOB A;  4WK8 F;  5FD5 A;  4E7Z A;  3GME A;  4EV0 A;  1U5T B;  1BW5 A;  3K2A A;  3BPX A;  1UAA A;  2P7V B;  1XSV A;  3ZR8 X;  2XKP A;  2E1O A;  1TLH B;  4KFC A;  5HVQ C;  2UXN A;  2M45 A;  3ZXS A;  4A3F J;  1FEX A;  3F72 A;  2PFB A;  2QEN A;  2YPR A;  2V9V A;  3LSI A;  2OV7 A;  4MFD A;  3HOW J;  5ICF A;  1B1B A;  4N0B A;  1YX3 A;  4YFN F;  3GEZ A;  2DA1 A;  1FZP B;  1ZH5 A;  1E0E A;  1FTZ A;  1Y8R B;  2NS0 A;  1W0T A;  3HC7 A;  1W1W E;  1G3W A;  1QZE A;  2HYG D;  2F48 A;  1QQI A;  4HNT A;  3CME I;  3OOU A;  1UHW A;  1XS9 A;  1K78 A;  2X48 A;  1MBG A;  5IYC J;  3U9G A;  2XAU A;  2BYV E;  3CUQ C;  1HQC A;  1X3U A;  4HOB A;  3GTK J;  1HKT A;  2K4B A;  1P6R A;  3K2Z A;  2RC4 A;  1JTY A;  2DO7 A;  3CC4 I;  5AON A;  3ABT A;  1KU3 A;  2M2E A;  3HOX J;  4ENM A;  3NRV A;  3IKV A;  3L00 A;  3AG4 H;  2DJN A;  3HSR A;  4XKB A;  2J5O A;  4AIK A;  3RYR A;  1S6L A;  3F6O A;  3J7Z I;  2L7Z A;  2GBY A;  1K7A A;  2CS3 A;  4NQW A;  2HVS A;  4MTD A;  3E5U A;  4B8X A;  1O3Q A;  3F21 A;  2JA5 J;  2IRF G;  1RUO A;  3I55 I;  1WJD A;  2GAU A;  4RLF A;  4ZC3 A;  5CVR A;  2LC2 A;  4RLQ A;  2R7F A;  3P9K A;  3GTM J;  4AU7 A;  1LNW A;  1XB4 A;  5DYM A;  1BR4 A;  5LD2 C;  1MMD A;  1U8B A;  4BAC A;  2K9S A;  2X1E A;  2GOM A;  3FXQ A;  4YEL A;  3SEQ A;  1FMW A;  3FIS A;  5BQT A;  5E3M A;  3DTI A;  3G1L A;  4XOP A;  5LRR A;  2MC3 A;  2L01 A;  3QAH A;  3IKT A;  2ETH A;  2X6O A;  2PJP A;  1QHH D;  1OR7 C;  2HTS A;  3COA C;  2VKE A;  3DWL E;  3S2W A;  4CZZ A;  5D8L B;  2M0M A;  5E3N A;  2HXO A;  3HHH A;  3HBL A;  1WKM A;  4YG2 F;  2HOE A;  3LSK A;  1ON1 A;  4Q48 A;  1ZRC A;  4RB1 A;  3JRH A;  4XKW A;  4D7N A;  4L0Y B;  3HXL A;  4AYB N;  3PUF A;  1IRG A;  3MKY B;  1LJ9 A;  2FOW A;  1HW5 A;  2HVQ A;  2JA2 A;  4UXN A;  3DP7 A;  1WH5 A;  1YLF A;  4JYK A;  2CYY A;  1ETX A;  4BBR J;  2A07 F;  1RET A;  2JRT A;  4F91 B;  3O2P E;  3ZMU A;  1MZB A;  1OYY A;  3NQO A;  4EJO A;  4PSX A;  4IL6 C;  4J00 A;  1Z6T A;  1EJ9 A;  2W4S A;  2KHM A;  1K6Y A;  3WTT C;  1RC9 A;  1APL C;  3BQY A;  1ACI A;  2DLL A;  3F23 A;  2XAQ A;  2XB5 A;  2B0L A;  5E8I A;  2XRL A;  4BXU A;  4C2U A;  4D1Q A;  1ZYR F;  1QPM A;  4GXO A;  2EZI A;  2D45 A;  2DMP A;  2LBF A;  1T38 A;  2GA2 A;  4CO8 A;  1WJA A;  1YI2 I;  1TZL A;  2P5L C;  3BG9 A;  2X51 A;  4CCN A;  1Y1W J;  3PO2 J;  3JTG A;  1H8A C;  2PJR A;  2H1K A;  3K1M A;  3Q5F A;  1X1C A;  1ZAO A;  4I76 A;  3CLQ A;  4RB3 C;  4UUS A;  1A5J A;  2LH9 A;  4LLL A;  3VDX A;  4J19 A;  2H6C A;  3BTL A;  1PJR A;  4XLP F;  2E71 A;  2ID3 A;  5E1W A;  2EK5 A;  4ZDO A;  2ECC A;  2L9N A;  1D1C A;  1QZY A;  4UVA A;  4GYI A;  4BKX A;  4HF1 A;  3QQA A;  4U0W A;  2IW5 A;  1FNN A;  2IS1 A;  1JUP A;  4HDU A;  3WTS C;  1STZ A;  2Y31 A;  3X2Q H;  2F2E A;  4FE4 A;  5FRM A;  4Y33 A;  2VXD A;  1SC7 A;  1AOY A;  1ETQ A;  1MMG A;  1VQM I;  2R7T A;  5LHH A;  4CCM A;  2BW3 A;  4GCV A;  1C0W A;  4ON0 A;  1A35 A;  4LLG F;  3K4L A;  2IGN A;  3W6J B;  3PIP F;  1O7F A;  1U8R A;  4IKF A;  3I59 B;  2CMP A;  3PFI A;  2FOK A;  2IPQ X;  2CRG A;  4RAG A;  3HYI A;  2LNB A;  3FBI B;  4ZTF A;  3I64 A;  1D1B A;  1OMI A;  3BTJ A;  1LDK B;  4EGZ A;  3LSH A;  3DKX A;  1BA5 A;  4F7Z A;  4PUS A;  2JPC A;  3FM3 A;  1TT5 B;  2E34 A;  3HHG A;  3RKW A;  6PAX A;  2HQR A;  2Z16 A;  3QP5 A;  3S1Q J;  2CGP A;  1VQP I;  3DU6 A;  3ZQH A;  2BY3 A;  1O57 A;  3MEX A;  5FLX K;  1NG6 A;  5FKL A;  2Y69 H;  1GVD A;  2XAG A;  2DCE A;  3U1D A;  1D5V A;  4UHT A;  4UUT A;  2EIL H;  3LSM A;  1ZG1 A;  4IHX A;  5JHU A;  5GTI C;  1YHQ I;  2O03 A;  1MND A;  2DQR A;  1WJB A;  1NK2 P;  3HTS B;  2JSC A;  1WJ5 A;  3LST A;  4FIS A;  4G7H F;  4A69 C;  2EIJ H;  1TW3 A;  2K4J A;  3A2K A;  2UXX A;  1BI2 A;  4DBR A;  3B73 A;  3CDI A;  5M5X J;  3DLL F;  3L09 A;  4AM3 A;  3BJA A;  1DGR M;  4XN3 A;  3MZ8 A;  2NXN B;  4FTH A;  4I6Z A;  4DYQ A;  1DP3 A;  1BI1 A;  3BOQ A;  3HM5 A;  3A4C A;  3K1P A;  3LSJ A;  2FSW A;  2IA0 A;  3R0J A;  3I56 I;  3U21 A;  4DZJ A;  2GA1 A;  1MBH A;  5BS6 A;  5HNH A;  4ASN A;  2D5V A;  4CZC A;  2QEX I;  2VJ4 A;  1ZTR A;  3EUH A;  5BNG A;  3QU3 A;  4AVZ A;  2OCE A;  2KIS A;  3MWM A;  4A0Y A;  2FA5 A;  5DCF A;  2YX4 A;  2X6Y A;  3WGG A;  1V5G A;  2GOX B;  2O5R A;  1HOM A;  2CQ7 A;  4P55 A;  2DMU A;  3Q0U A;  3NWS A;  3A0B C;  3JRG A;  3I4N J;  4BJ5 C;  1X1B A;  4JBA A;  3HG9 A;  3TMO A;  4H4K C;  4R79 A;  4KMF A;  5C4J J;  3KP3 A;  3OIO A;  5E17 F;  1QVT A;  3KEQ A;  4MIM A;  2DT6 A;  5J1U A;  3S93 A;  3ZN1 A;  4MNU A;  3TO6 A;  5IP9 J;  2Y9Z A;  5EJC A;  2E60 A;  2A61 A;  5CVV A;  5L3G A;  3RKQ A;  2M1B A;  3SDG A;  2X85 A;  3M3Y J;  2NVT J;  1B59 A;  4EMS A;  4UV9 A;  1Q1V A;  1QBJ A;  1FMV A;  1HDP A;  4WF2 A;  2HYJ A;  1W4M A;  1YG2 A;  2DXI A;  2KL4 A;  2EIN H;  2DN0 A;  3ABL H;  1SD5 A;  4BS9 A;  2QBY A;  2HXI A;  4BU2 A;  1IV8 A;  4PJJ A;  3JTH A;  1I6X A;  2NS7 A;  4ESB A;  5FLX Z;  2K27 A;  1UFM A;  2MGQ A;  3DF8 A;  4XRF A;  5FLM J;  5HLT A;  3SJM A;  3B02 A;  1MBF A;  3E1S A;  3HRM A;  3F9K A;  1T0F C;  5FGM A;  1U2W A;  3GW2 A;  1ODD A;  1EH6 A;  3H5R A;  4LK1 F;  1SD6 A;  1W7P D;  2JA6 J;  2P0W A;  1G4D A;  3ESW B;  2PLY A;  1QGP A;  4LK0 F;  2V9P A;  2L7M P;  2ZXW H;  3GVA A;  4AID A;  1S9H A;  3PQK A;  4MEY F;  1HKQ A;  1BJA A;  2I10 A;  1JUS A;  2GLO A;  4N4O B;  3PJR A;  2NOJ B;  1A04 A;  2DA4 A;  3IHU A;  4IOC F;  3FK6 A;  5EG0 B;  1RPW A;  4DBQ A;  4QSH A;  4IRG A;  3GTP J;  3DKY A;  3H36 A;  3TP3 A;  2ZB9 A;  2F5E A;  3M07 A;  5LEK A;  2MD5 A;  2KZV A;  2OPT A;  2BE5 F;  4S04 A;  2ECB A;  2F5D A;  3PNY A;  3IWF A;  4ESF A;  1A6Q A;  5J8F A;  3ZQ7 A;  3IL2 A;  2XGE A;  1FT9 A;  3OR2 C;  3ABM H;  1J75 A;  2VQH A;  3HOT A;  2A5Y B;  1BC7 C;  4G6Q A;  1HW1 A;  4PGH A;  3GFI A;  1AKH A;  2A68 F;  1WSU A;  3GX4 X;  2Y9Y A;  2ZXH A;  4KT5 C;  1B72 B;  2IT0 A;  1WQ2 A;  3HRU A;  3CP2 A;  3E97 A;  1TNS A;  1FTT A;  2EIM H;  4HLY A;  2VB6 A;  1B8I B;  5HDG A;  4EAT A;  2AS5 F;  2AXT C;  3DCF A;  3GLX A;  4IQ4 A;  5L3C A;  1Z3Y A;  2DAO A;  2VC0 A;  2I8D A;  1MKM A;  4YIR X;  3RKX A;  1SFU A;  1Y6I A;  2P7C B;  4GYG A;  3H92 A;  2L0K A;  2PX9 A;  1ULY A;  1V5E A;  1QZZ A;  4JQF A;  2DFH A;  2IGM A;  3FXU A;  1LEB A;  5C44 J;  3G3Z A;  2EA4 A;  4YRV A;  5CKT A;  3WG9 A;  1E2X A;  4BY7 J;  2Y0S A;  1R4M B;  3BLY A;  4D0P A;  3RKY A;  5GAG J;  2MAB A;  3BR0 A;  3D5S C;  1X3Z B;  2FNP A;  4Z6Y A;  1TC3 C;  3ML6 A;  1ORK A;  3K4J A;  4MGR A;  1QO0 D;  4IZZ A;  2CSO A;  2D2W A;  2TDX A;  2E5Z A;  3BZ6 A;  1BJZ A;  1WPK A;  1IRF A;  3VYT B;  3VYR B;  2W7N A;  3KE2 A;  4BH9 A;  1YFH A;  1GUU A;  2HPI A;  3BCA A;  4U88 A;  4AIJ A;  1F1Z A;  4A3I J;  3C7J A;  2ZJ2 A;  3CO6 C;  4IHT A;  1OKR A;  2KIM A;  3HUG A;  1MW7 A;  4MO7 A;  4BBS J;  2R7Q A;  1T39 A;  1Z05 A;  2V6E A;  3V42 A;  2VJJ A;  3ZMS A;  1XN7 A;  3WTV C;  2EA2 A;  1RI7 A;  2E5N A;  2PMZ N;  3G73 A;  1EH7 A;  5E3O A;  4UNO A;  2UWM A;  3IC7 A;  2VI6 A;  2L9S A;  1U5T A;  2DI3 A;  3ZQQ A;  1MNE A;  4I09 A;  2LYC A;  2BV6 A;  2BGC A;  5J1Y A;  5FJ8 J;  4F93 B;  3ZOB A;  4DYR A;  3WE2 A;  1W36 D;  3S1N J;  2WV1 A;  4M3F A;  2IEK A;  4IRH A;  4M9Z A;  1A36 A;  2DA3 A;  3WTY C;  2V1N A;  4PJ0 C;  2DT5 A;  2GXB A;  2JA8 J;  5JVT A;  4JX4 A;  1TL8 A;  3FBN B;  3KX2 A;  2WAD A;  5J6X A;  3HL2 A;  1SMT A;  3DBR B;  3RCO A;  3F8N A;  3NAR A;  1GHC A;  2K9L A;  2LMD A;  3RPU D;  1Z3X A;  2CFO A;  4M3B A;  3GYH X;  3KLN A;  2QLZ A;  3MKL A;  5EZH A;  4EJU A;  4HF2 A;  3BCB A;  3SZP A;  5IT9 Z;  2ZCW A;  4C3J J;  4LFU A;  1IZ1 A;  2O3F A;  3CJR B;  3HEF A;  1YQA A;  2KJB A;  4KMU X;  5FKO A;  2MA3 A;  2EFN A;  1HKS A;  4HF0 A;  2HVR A;  4A3B J;  2JRM A;  4ANJ A;  4XLA A;  2YU9 J;  5D5W B;  1D8K A;  5IP7 J;  1J9I A;  3LAP A;  3K70 C;  3HSF A;  1J0R A;  1ONV A;  2YX7 A;  1UJ8 A;  3CCU I;  3ERM A;  4A3J J;  3TED A;  4OAY A;  2ZSH B;  5J4V A;  4XKV A;  5LGN A;  1XCB A;  2IP2 A;  1MMS A;  3F8B A;  3BR2 A;  2MH2 A;  2L5Q A;  2A6E F;  5J3L A;  2M4K A;  2XGD A;  2HTJ A;  3AAF A;  4B3X A;  4CYD A;  4LD5 A;  3OYM A;  3ASN H;  1FP2 A;  3I5U A;  4XRS G;  2X1C A;  3TBI A;  4FX4 A;  1TWA J;  2HOT A;  1KQ0 A;  4R8H A;  2EBI A;  3LSR A;  2R7R A;  3BWG A;  2G0E A;  3D5R C;  1IN7 A;  3H3Z A;  5D5X B;  1DU0 A;  3NAU A;  1MBE A;  2FU4 A;  3KP4 A;  2VKD A;  2Q2E B;  4HW0 A;  2DK8 A;  1VQ9 I;  1F43 A;  1XPX A;  5LHI A;  4I02 A;  3KLO A;  1MD0 A;  3HDD A;  3ZPL A;  4MHG A;  3EQL F;  4GO1 A;  2H94 A;  2QUF A;  2VE9 A;  3CF5 F;  3FMQ A;  4WX9 A;  2VOP A;  5BPI A;  1YO5 C;  1O3R A;  3P7N A;  4BDZ A;  1EF4 A;  2DMN A;  3OR1 C;  3K4M A;  1N25 A;  2D1H A;  2VON A;  5JR3 A;  4XLN F;  2MBF A;  1FYK A;  3GUD A;  1P92 A;  2K3P A;  4RAZ A;  1XSD A;  2M3A A;  3SZT A;  4KNY A;  2EV5 A;  2LFB A;  1LUJ B;  5F6F A;  1B6A A;  1YRN B;  3TDU C;  5E1Z B;  2LRE A;  3T8R A;  3L2U A;  2OUM A;  3GXO A;  2LVS A;  4L0Z B;  1WHU A;  3KYC B;  2E2H J;  1BIB A;  3S3M A;  1CQT A;  3M1E A;  3IAM 2;  1FJL A;  3BR5 A;  2CQN A;  2V79 A;  1DU6 A;  3QYB A;  3BJO A;  1F36 A;  1R71 A;  1I1S A;  3GFJ A;  4CUG A;  5M5W J;  3IWZ A;  1LPQ A;  1TNT A;  5ICG A;  2LRD A;  2ZME C;  1DPR A;  3ONQ A;  2LF7 A;  1G3Y A;  3W6V A;  3WE3 A;  3S2H J;  3W3C A;  2W25 A;  4LOC A;  2FBI A;  3F8F A;  4FT8 A;  5J8C A;  3W2V A;  3ZQL A;  5ICE A;  2HU9 A;  4B1R A;  3EUA A;  3CDH A;  3CUQ B;  3RZD J;  4BHP A;  3SZG A;  3P5J A;  3ZQF A;  2B7E A;  1WRJ A;  1G3T A;  2F5V A;  3Q0V A;  3V8J A;  2M87 A;  1K83 J;  1V54 H;  2HWV A;  4XSX F;  3VSK A;  3OYF A;  1REP C;  3G2B A;  4P5O A;  5TIS C;  3K1N A;  3CUO A;  3IUO A;  4YII A;  2JUC A;  2XPV A;  1SFX A;  2XAS A;  5HLI A;  4F3Q A;  1Z9C A;  2VPL A;  1OYI A;  5B1B H;  2ZJQ F;  1OCT C;  3A0H C;  3V8L A;  2Q0O A;  3I59 A;  3DV8 A;  1FBS A;  4FCY A;  2FUG 2;  3OS2 A;  1R9T J;  3NEU A;  3E5Q A;  4X6A J;  1YJW I;  4PSW A;  5BPD A;  1J59 A;  2CO5 A;  2XGX A;  2L2O A;  2L4A A;  3P9C A;  1E3P A;  3CJN A;  3C2B A;  1BM9 A;  4QTR A;  3KZZ A;  5FRN A;  4KIS A;  4RAY A;  3DBH B;  5HLH A;  1PVE A;  4RGS A;  5J4Y A;  1GDT A;  3H5N A;  4BQO A;  5F0H A;  5DCM B;  4IEJ A;  3BR6 A;  4M9X A;  2AO9 A;  3LAJ A;  1S7E A;  2NAZ A;  1XSX A;  3ERE D;  3JRB A;  3DPT A;  1MH4 A;  1UHM A;  2JZY A;  3L2W A;  5K1Y A;  1FOY A;  3PIO F;  1W5T A;  3OYE A;  2QWW A;  3RJP A;  1X1A A;  5LRS A;  4A3L J;  2YSR A;  3QPT A;  4G7O F;  3HRS A;  1MDM A;  1FOX A;  1R1U A;  4ZZL A;  5KAF C;  3OS0 A;  3FXO A;  4XN0 A;  2HOA A;  4BY1 J;  3LQR A;  3H5A A;  5JLW A;  2DJI A;  4C3I J;  2JVG A;  3AG1 H;  3S15 J;  3AFH A;  3JSP A;  2XRN A;  4S05 A;  4RA2 A;  3RYP A;  1S5L C;  1IDZ A;  5IOY A;  2P81 A;  3EDP A;  1A31 A;  1TT0 A;  3TOA A;  4MTE A;  2RAE A;  5FRO A;  3JR9 A;  2GWR A;  2P6S A;  1M1E B;  2IXS A;  2Z5U A;  2E1C A;  3CZ6 A;  2F4M B;  3F0C A;  1ZR4 A;  5LGT A;  3OYC A;  4QLC U;  3CCM I;  3JW4 A;  1JKO C;  2IS4 A;  1JGS A;  2G7H A;  3WGH A;  1NH3 A;  1MSF C;  2O9L A;  5FFZ A;  4CIC A;  1OCZ H;  4KN4 X;  4M3D A;  2KRC A;  5K7Z A;  1YIJ I;  1R6R A;  4IHY A;  1G6N A;  1E3H A;  2PMZ A;  2J5P A;  2STT A;  2E7W A;  4YIF A;  1VQ5 I;  1MJA A;  4UB6 C;  1XGO A;  3G4S I;  1YYV A;  3P9I A;  3CJT B;  4HX4 A;  4KIB A;  3RPU A;  1BC8 C;  2EZK A;  1OIS A;  4CYC A;  3QU6 A;  4BE1 A;  1W0U A;  1ETY A;  3WU0 A;  5GPA A;  3AG2 H;  4Y3O A;  1ZRD A;  4HV5 A;  1WJF A;  4II2 A;  3ZQC A;  4KIC A;  2O6G E;  2Y0S N;  3FKI J;  3ELK A;  3K4C A;  2L54 A;  2HQA A;  2BEO A;  2EIK H;  2RKH A;  2P4W A;  4HZF A;  5F27 A;  3OYG A;  3CCE I;  1AHD P;  3S14 J;  4AVP A;  3BG6 A;  4YEJ A;  2NRA C;  5JVG F;  1XMX A;  2PMU A;  5K7F A;  4PGG A;  5J1R A;  1YIO A;  1WVR A;  1U9N A;  3CD6 I;  2QSG X;  1ETV A;  2AQF A;  3LWF A;  4YFK F;  3L7W A;  1XDU A;  1VQ7 I;  5CJ9 A;  3JRA A;  2NVX J;  4L18 B;  2LF8 A;  1J09 A;  1LEA A;  1OCC H;  1USS A;  2IGO A;  2P6T A;  2QQ8 A;  3HJE A;  1T98 A;  3FIW A;  1GXQ A;  3H0D A;  2M34 A;  2YUS A;  3SXY A;  2IJL A;  5ILS A;  1EH8 A;  3TQN A;  2R7W A;  5FKM A;  3OS1 A;  4E7J A;  2L7F P;  2MW8 A;  3A01 A;  1Z77 A;  3HOU J;  1ETK A;  4CGZ A;  1X2M A;  3K69 A;  3DBL B;  2WY8 Q;  3BDD A;  4HSR A;  3L2Q A;  2OTJ I;  3FHZ A;  4G8X A;  2EQR A;  3GTG J;  3DKW A;  4BJT A;  5EG0 A;  2K5C A;  4BL0 B;  4KIF A;  2PEX A;  1VFC A;  3VWB A;  1FOK A;  1R5G A;  3EET A;  2XUB A;  2XAH A;  4MLO A;  2OQR A;  2E1M C;  3B6A A;  3FXJ A;  2W48 A;  1S7A A;  5CYV A;  2FRH A;  4HQM A;  3CJQ B;  3K4N A;  1FYL A;  4LIT A;  4ESJ A;  3DEU A;  4KDP A;  5DTD A;  3VYS B;  3KEO A;  5HS8 A;  1VQK I;  1U6G A;  1RR8 C;  5F08 A;  5L3B A;  4E7K A;  3Q3S A;  4IF4 A;  1B72 A;  5EGO B;  2FXA A;  3UR3 C;  5DM7 F;  3OIP A;  1MMA A;  2O0Y A;  2R92 J;  3JRC A;  1B8I A;  2CQQ A;  3RI4 A;  3HPG A;  4QPO A;  3LNQ A;  3S1M J;  4A5M A;  2LY9 A;  4WXD A;  3AKZ A;  1Y39 A;  3GFL A;  2CH0 A;  4RBO A;  2DBB A;  3RDI A;  1I6H J;  2AXL A;  5CVU A;  4WWC A;  4ABZ A;  1R49 A;  5IT3 A;  5D4R A;  2ESN A;  3JCU C;  3K0L A;  1KGS A;  3Q0W A;  2R0Q C;  1R22 A;  3U2R A;  2PBI A;  5IYD J;  3LQQ A;  3V8K A;  5LEJ A;  1N77 A;  3WHC A;  1PDN C;  4OMZ A;  2WBM A;  2ZNZ A;  3QP6 A;  3LFU A;  5DUK A;  5IPA A;  3N97 A;  1DQU A;  1RES A;  3KIO A;  2R7Z J;  3U1K A;  3ZMD A;  2MC4 A;  2V4J C;  4IJA A;  4D5C A;  1JUM A;  1ZKG A;  2QGU A;  2KRH A;  3CDL A;  2OCC H;  3KEY A;  1QPI A;  2NVY J;  2JWT A;  1KU9 A;  1Z0X A;  4LB5 A;  5JFR A;  2DOA A;  3JRE A;  4Y15 A;  2W00 A;  2R7X A;  1HXD A;  2ID6 A;  4ZYD A;  3MD2 A;  1BR2 A;  2B63 J;  4LG0 B;  4IOA F;  4FAS D;  2H8W A;  4NUB A;  5D4S A;  4A3K J;  4BUP A;  1BL0 A;  2BY2 A;  2Q1Z B;  3WOD F;  2NOG A;  4AWX B;  2K7L A;  3CP8 A;  1HA8 A;  1IN4 A;  2KQR A;  3MQ0 A;  4CCL A;  4BDY A;  2A6H F;  2FD5 A;  3HGY A;  4DIQ A;  2R7V A;  3IP4 B;  2FE3 A;  2DOE A;  2XF5 A;  1VQ6 I;  1Z7L A;  2BXZ A;  4HBL A;  4PDK A;  2GIZ A;  2KJC A;  2KIQ A;  2MFZ A;  5DM6 F;  2VOO A;  2Z99 A;  3S16 J;  3DTE A;  2HS5 A;  5EEA A;  3W2A A;  4DYC A;  1FC3 A;  4BJ6 C;  4A3E J;  3DQV C;  3O8G A;  4ZDL A;  3ABK H;  2W82 A;  3CCR I;  1R1V A;  2ZFU A;  2JK3 A;  3PNT A;  3BTI A;  2RGV A;  1HDD C;  2XDV A;  4C2T A;  4E7H A;  5HOO A;  4IVN A;  3L2C A;  1GT0 C;  1RNL A;  3QOE A;  2OF7 A;  2Z1D A;  2HYF A;  1W36 C;  2EFO A;  1FWZ A; 
#chains in the Genus database with same CATH homology
 3DLL F;  1ACI A;  5DM7 F;  2NXN B;  3CCM I;  3J7Y J;  1YJN I;  3CC2 I;  3I56 I;  1Y39 A;  4UY8 I;  2E36 A;  1YIJ I;  1YI2 I;  2QEX I;  1VQ5 I;  3CME I;  2QA4 I;  3G4S I;  3CJT B;  1YJ9 I;  1HC8 A;  1VQ8 I;  3CC4 I;  3CCU I;  2K3F A;  3CMA I;  1MMS A;  3CCE I;  2ZJQ F;  1VQN I;  3J7Z I;  5JVG F;  1VQM I;  1YJW I;  5GAG J;  3I55 I;  2ZJP F;  1QA6 A;  1VQL I;  5GAD J;  3PIP F;  3CD6 I;  4IOA F;  5GAH J;  3CCQ I;  2H8W A;  1VQ7 I;  2OTL I;  3CCJ I;  3G71 I;  3CC7 I;  1VQ9 I;  3CCV I;  2E34 A;  1VQ6 I;  4V19 K;  4IO9 F;  5DM6 F;  1FOY A;  1VQP I;  3PIO F;  2OTJ I;  3CF5 F;  3G6E I;  1VQO I;  1YIT I;  1FOX A;  5GAE J;  3CCR I;  2E35 A;  3CCS I;  1YHQ I;  2JQ7 A;  2FOW A;  4IOC F;  1FOW A;  1VQ4 I;  3CCL I;  1S72 I;  2ZJR F;  1VQK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...