3CCSI

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3ccsI00
3J7ZI 1VQOI 5GAGJ 2NXNB 1VQPI 3CC2I 1HC8A 1YIJI 1ACIA 1FOYA 3DLLF 3CCUI 1MMSA 3CCSI 1Y39A 1VQ5I 1VQLI 3I56I 3CCEI 3CJTB 1VQ6I 1YJNI 2ZJRF 3CD6I 4IOAF 1VQMI 1S72I 3PIOF 2K3FA 1YJWI 5JVGF 1VQ7I 3CC7I 3CCMI 1VQNI 1YITI 4IO9F 3PIPF 2FOWA 1QA6A 2OTJI 3G71I 2QA4I 2OTLI 3CCLI 4V19K 2ZJQF 3I55I 2JQ7A 3CF5F 1FOXA 1FOWA 3CCQI 2E35A 5DM7F 3CMAI 1YJ9I 2E36A 1VQ4I 5DM6F 3CCRI 5GAEJ 1YI2I 5GAHJ 2ZJPF 3CC4I 3J7YJ 2QEXI 3CCJI 3G6EI 3G4SI 3CMEI 1VQ9I 3CCVI 1VQ8I 5GADJ 2H8WA 1VQKI 4UY8I 2E34A 1YHQI 4IOCF
chains in the Genus database with same CATH superfamily
1USSA 4EATA 1PUFB 4KIFA 3NAUA 1B1BA 5E8GA 2ID6A 3HYIA 4YG2F 1IN7A 3DTKA 2VC1A 3LMMA 4LFUA 1WFXA 4IF4A 2ZXIA 2R7DA 3IH3A 2JA5J 2G7HA 3TW7A 3R0AA 1B8IA 2OTJI 1IRZA 2LDUA 5D6FA 3FMSA 2HXIA 1D0XA 1HW2A 2L4AA 5BNGA 4FCYA 1N25A 3IUOA 2L0KA 1FYKA 2MFZA 4LOCA 2G9WA 2LH9A 4LK0F 1GXQA 2AXLA 3R6SA 2WWYA 1YS6A 4AUXA 1ZRCA 1ON2A 3IC7A 4GGGA 5JI6A 1REPC 2R7WA 3PFIA 3LOCA 3BY6A 3HPHA 3ABMH 3WE2A 3QAHA 4A3GJ 2L9VA 2V6EA 2R7QA 2VN2A 4D7NA 5HDNA 2FMLA 3FXLA 4N9IA 2O8KA 3E7LA 3HOYJ 3ASOH 4Z6YA 5IOZA 3DKXA 2Y69H 4BHBA 2XIGA 5K7ZA 3HOWJ 3KP4A 2DJIA 3VFZA 5HLTA 3GFIA 1G4DA 3JTHA 5CJ9A 1HW1A 2PQ8A 1U0JA 2VKDA 1MBFA 3FIWA 3C3WA 5HVQC 5AONA 4RGXA 4AC0A 2IT0A 4XLPF 3HOSA 1XN7A 1IW7F 2QWWA 5IP9J 3ZXSA 4MLOA 3E97A 2OUMA 5ICFA 3GTJJ 3IWFA 1IV8A 3N05A 3QQAA 1JTYA 2BBYA 4NHJA 4LK1F 4QPOA 3C7JA 1YFHA 2X6XA 3JRFA 2TCTA 4GCVA 2FXAA 2VXDA 5LEKA 2R7RA 2E71A 1WI3A 3L2VA 4FTHA 2FQ4A 4XSZF 3RQ4A 4PJJA 2RNJA 3WU2C 1XB4A 3WTVC 3SEZA 1SANA 4LLGF 2JRTA 1FTZA 1Z6RA 3WHCA 3MFKA 5FKKA 3HOZJ 5ILVA 3DU5A 3FM5A 3BZ6A 1MMDA 5FROA 4DJAA 1PP7U 3S1NJ 2O9LA 1AOYA 2PFBA 2IGMA 2RQPA 1UHWA 2STTA 4PUSA 4M72A 4UUVA 3AAFA 4LD5A 4NC6A 4RGRA 2ETHA 1XG1A 2NVUB 5J3LA 2CG4A 3B6CA 2K5CA 3P7NA 3RPQA 2JZYA 3TOAA 5F1RA 4AWXB 2QSGX 4E6KG 3L1PA 2M3AA 1Y56A 3PIPF 2DFEA 4WXCA 3CESA 3NWSA 4HDUA 3FKIJ 1IGNA 2O7OA 1MSFC 1HOMA 2QF7A 4G6DA 1G3YA 2ESNA 1TWHJ 2K9NA 4BAYA 3JAMZ 3VPRA 3LAPA 3L09A 1XX5A 1Y1WJ 1YW9A 2B7EA 1JT6A 4XRFA 3LA3A 5DEQA 1R1TA 3S14J 1J5YA 2VKEA 2XAUA 3FXMA 3KZIC 1T38A 3SYTA 3BTIA 4JYKA 2JTVA 1TW3A 3LFUA 1MIJA 1QA6A 1FP1D 2H27A 1XMXA 2RKHA 3HXLA 3OS0A 1X1AA 1QVTA 4W97A 1SAUA 2OZUA 4A69C 2DLLA 4OINF 1LB2A 2DA7A 5DUIA 3ZN1A 4X6AJ 5TGTA 1ACIA 2ZXJA 3H1CA 1BW6A 1WGXA 1J0RA 3QP6A 1Q1HA 1U8BA 1QO0D 1BI1A 1F36A 1QZZA 5F27A 3HRSA 4JX5A 2WAQA 2KIMA 1J9IA 2F4OB 2RVCA 2KISA 2OTLI 4CCMA 4S05A 5E8IA 5GTIC 3ZMTA 3JAMK 4R1HA 3J81Z 2AQFA 4UUSA 3DXJF 1LDDA 3FHNA 2GBYA 5K5QA 4RGSA 2GA2A 3PL8A 2B0LA 5HDGA 4YIFA 4XOPA 4ABZA 2STWA 2KKOA 1X58A 2H8RA 1IJWC 4HF1A 3ZMVA 3K4MA 2ICWG 3I5UA 1RR8C 1TBXA 3VYRB 4I0BA 4M3GA 3QODA 2O6GE 3P5JA 2ZXHA 1BR1A 3BJAA 3LNQA 2DXIA 5EGOA 3U2RA 1A36A 4X1EA 2GOXB 2R7OA 4BQNA 1XGNA 4IRGA 5LGTA 4IQJA 2WBMA 2PJRB 2R4GA 1BN5A 2H6BA 5FFXA 3CCRI 1ZK8A 2JA7J 4A5NA 4Q48A 3E0JB 3IKVA 4BJ5C 1Z3XA 2AQEA 2ZFUA 4B8XA 3ZQGA 3D5RC 1UG2A 4MTDA 4UB6C 3J7ZI 1H9TA 2QQAA 3K10A 4MNUA 2NVXJ 2X48A 1VQPI 1POGA 2LY9A 3C18A 5H6RA 1YYVA 1OR7C 1LFUP 1R6RA 1YX5A 2RAEA 3H0GJ 4D9JA 3I59B 2DMPA 3U1KA 2I8DA 3OL4A 4LG0A 1OCPA 3K2ZA 4DYCA 4AIHA 2OJED 4U7DA 1XGMA 1MMNA 3I71A 1FBSA 2WV0A 3FK7A 1NH3A 4ZTJA 1U5TB 4PFOA 3N97A 2VPRA 1TT5B 2PMHA 3C2BA 3AKZA 1K4TA 2BEOA 4E7IA 2Q1ZB 1KQ8A 1XC5A 3GUDA 4IHSA 3WU1B 2JUCA 5KAFC 1LKXA 1PUFA 5KK1A 2CQXA 4A6DA 3A0BC 3CCSI 1Y39A 4ZDOA 2MG4A 3QU6A 1ZG1A 4M74A 4KISA 2OA4A 1R1VA 4U7BA 4C30A 2Y2ZA 3SFZA 2QKLB 3ABLH 3U1DA 2L7FP 3DF8A 3J81K 1U78A 4JP0A 3MZ8A 4IQ4A 5C4XJ 1OCRH 2RN7A 4OOIA 5F0FA 3JTGA 3PQJA 4L5EA 2CQQA 3EUHA 4RLFA 3CMYA 1FMWA 4HSTA 2CV2A 4GYIA 4RBOA 4M3EA 3VOEA 3QP5A 3K1NA 3MD2A 3RZDJ 2EZIA 4ANJA 2VOPA 1X1BA 3S1RJ 3H0DA 2CV1A 1FX7A 2X0LA 4F3QA 1JKRC 1I6XA 2E19A 2EH3A 2PG4A 3M1EA 3UR3C 1TWFJ 2ECBA 2HOEA 5L3BA 3LSMA 2V9KA 4CHUA 1LQ1A 3FZVA 2W1OA 4II3A 5CQGA 3JRHA 2IEKA 2Z2SB 2IXSA 3WGHA 4I6ZA 5LRSA 3ELKA 3SHFA 3S15J 3CF2A 2O3FA 4MFEA 4DYQA 4HRIA 2L3DA 3H5RA 4JOMA 3MCZA 4RMNA 1XS9A 2DBBA 1YE9A 2ZCWA 1SAXA 4BNCA 1I1SA 5JR3A 2XAGA 2ZSHB 2M2EA 2MW8A 4MQ9F 2L9SA 1IZ1A 4CZCA 4J01A 4GFBA 3GXOA 4E7KA 2GQQA 3GLLA 3NEUA 4XLNF 3WG9A 3HOTA 2M8GX 3GW2A 4Q4ZF 2W82A 3TO7A 5LGUA 1BI2A 2A6TA 3HB9A 1OCOH 1VQOI 3H9JA 3CC2I 4EQQA 1Z21A 3KZYA 1D1AA 1WWXA 4B3XA 1R7JA 3CDIA 4Q47A 5E1XA 2BYVE 2HYJA 4X0GA 1O7FA 1UJ8A 3PUFA 3VSLA 2DPDA 5J1RA 1EA3A 2DQRA 4ENNA 1SVLA 2F48A 4HOBA 2OQRA 1HSTA 2L2OA 2YUSA 1JHFA 2JPCA 3BOQA 2HZTA 2VKVA 3A02A 1TQPA 3M9AA 2VXZA 4B44A 4KIBA 4RAFA 4CO8A 4RA2A 1QVUA 2J5OA 2RDPA 4PGHA 2EV5A 1VQKI 5DCMA 2XF5A 5HS9A 2Q2EB 1XMAA 1UELB 2H1LA 4BEHB 3K6GA 2BGCA 4ITVA 1BBYA 2QQ8A 1ODDA 2M87A 1BC8C 3REOA 3GX4X 2ZJRF 1KGSA 3D0SA 1XSDA 4A93J 1D0YA 1ONVA 2VPLA 5J8FA 1YRNB 2A61A 2EB7A 4AIDA 1A6QA 1WHUA 2KZGA 3KP3A 4RM2A 2E1NA 2K27A 1SFOJ 3CF5F 3PSIA 3HTSB 2IGKA 3ZGKA 2Z99A 3GF2A 1D8KA 3M8FA 2CRGA 4BHPA 2F4IA 1R36A 1RESA 1CF7A 2R5ZA 1IUYA 2HQ5A 2LREA 2F5FA 3BT9A 2CQ7A 4R8HA 4UVAA 3BR0A 3OYEA 3ZQQA 4J19A 2DTRA 2JVHA 1S6LA 3IP4B 1SD7A 4PFPA 2Y30A 4N4NB 1FNNA 4DZPA 5F0HA 1VI0A 4A3FJ 1TQMA 4AD9A 3IAS2 2KIUA 2M4KA 1EF4A 5EYRA 4E7JA 4CCJA 3S17J 5DM6F 1G59A 1ERDA 1NHAA 2LK2A 4PSWA 3AL0B 2Z1DA 1W36C 2HDWA 5K7HA 5E3OA 2BW3B 2P5KA 1AA7A 1PDNC 3HSRA 3IAM2 2R92J 2BVLA 4P9UA 1OCCH 1BOAA 3FX3A 4M6YA 5JVTA 1NG6A 1HW5A 1GVJA 3MQ0A 3W2WA 2PBIA 4HEA2 4HZFA 3OYLA 3WE3A 1QPMA 2ECCA 1K61A 3L2WA 3L2UA 5E18F 1LFPA 4MO7A 2R0QC 2L5QA 1F43A 1JE8A 3TQNA 3PJRA 2E2IJ 1ETVA 2BW3A 4ZYGA 4ENMA 3ZMSA 2BE5F 3ISPA 5BMZA 5D5UB 3T5XA 1YTYA 1Y8RB 1LDKB 5GAGJ 5JLWA 4BJ6C 3K1PA 3FM3A 4KIGA 1TWGJ 5M5YJ 4CYCA 3CJQB 2LMDA 2UZKA 3I53A 4BE2A 4A5MA 2OBPA 3QYFA 1LPQA 2W85A 1ZQ3P 3DTEA 3A2KA 2E1CA 1K79A 2XGEA 1WH5A 1WJCA 2DMQA 2OF7A 3Q0WA 1ZHFA 2X1CA 4RS8A 3WTWC 2QQ9A 4ETSA 2HXOA 2DOAA 3H36A 2K40A 4ASNA 2J5PA 2QBYA 2Y0SN 3R61A 2EFOA 1HSJA 5D5VB 4FHTA 2JSCA 2F5VA 3CDLA 3H35A 3OR2C 3ONQA 5C44J 3O3KA 1TLHB 2KHMA 2WB1N 3BDDA 1T39A 3FWEA 1T08B 4ZZLA 4F92B 3CMAI 1DU0A 3Q0UA 4B47A 3F21A 2Q0OA 5FLXZ 3CJNA 2KJBA 1W1WE 1IN4A 2DPUA 1I39A 1W4MA 3KPHA 4XKWA 1KU3A 2DAOA 3V7CA 2FNAA 3KEOA 4S0HB 4H0EA 3Q3SA 2AO9A 4RDUA 2X9DA 2FSWA 1VQ7I 4L18B 4KMUX 2M4GA 1N75A 3QU3A 1UCRA 3E1SA 3L00A 3WG7H 3HDDA 3HOUJ 3E6DA 2FX0A 3LWFA 1SD4A 2HDDA 4BQOA 1I3QJ 5FLVA 3JREA 1J7KA 4P5OA 1SFUA 2L9NA 4GXOA 4HV5A 3BR6A 2CS3A 3V8JA 4II2A 3HIFA 5A2QZ 4IOCF 3KFWX 1LFBA 1T0FC 1FP2A 4G7ZF 2V79A 2O0YA 5J1UA 5FB2A 2YS9A 3R4KA 3HRUA 3OY9A 5LHIA 4HNUA 1WCMJ 1R22A 2K9MA 4LMYA 4GO1A 1XSXA 2EPFA 3GTKJ 5L3GA 1STZA 3CLOA 2GAUA 2HOAA 4P9FA 2YX7A 1U9NA 5DM7F 2HVQA 4F55A 2V1XA 2ZFWA 4LITA 2I5UA 4PCQA 2QLZA 1VQ8I 3QYBA 4U0VA 2VE9A 2E34A 1O7LA 2BXYA 4B4CA 3M8JA 3QRFF 2DA6A 5AIQA 3GFMA 4BKXA 2DOFA 2CW7A 3FMQA 4LIUA 4CA0A 5K5RA 1TL8A 4B09A 2FNPA 4XOTA 3LSKA 1HDDC 2BZTA 5A2QK 4I2OA 2KDOA 2DFFA 3CDHA 3MKWB 3KCCA 4EJWA 2DW4A 2LSOA 3KP7A 4AVPA 4A0YA 2FOWA 3K9TA 3DV8A 4M73A 2UUZA 4RB3C 2ZMEB 3PNTA 1K78A 1X3WB 2VQHA 1Z77A 1GLNA 4IL6C 3W2VA 2L01A 2O5RA 1ETYA 5HDKA 3R60A 2YU9J 3QOPA 2BXZA 3BWGA 1K4SA 2OV7A 3RKYA 5LHGA 1IG7A 2HU9A 3JRBA 4A2UA 3CCUI 1JJ8C 1YLFA 2NNNA 1VQ5I 1ZGAA 3DKYA 1MKMA 1V5FA 3CUQA 4XLFA 1ZN2A 3ECHA 4PZJA 3ZMZA 4HX7A 1IXSB 2HQNA 1WRJA 3IHUA 3PNYA 1GUUA 2OCCH 3TDUC 2WADA 2M45A 4FQGA 5LGNA 1IRXA 3OYIA 4M3BA 1VQ4I 3LSGA 4DOZA 3PO3J 4XL9A 2Y0SA 1M1EB 3JRCA 1I3AA 2RNGA 3H5NA 4YFXF 4BL0B 4A3MJ 4C2TA 1Z3YA 1U5TA 4CYDA 1Z6TA 4XKBA 3VODA 4NDLA 4AYBN 4KJZA 2X6OA 5FD6A 1OLTA 1R1UA 4L5JA 1A6IA 4KN7X 1GHCA 3DEEA 4EGZA 5DD4A 4UV9A 3MKLA 1G2HA 2NS0A 1UZCA 3SJMA 4BBSJ 2CFOA 4DBRA 2VASA 1YI2I 2ZJPF 1XCVA 2R5YB 2QEXI 5CVVA 4WX9A 3J80Z 2H6CA 4YRVA 3GTLJ 2F4MB 3EETA 3TKYA 1J2XA 5KCMA 1KQ9A 4A0XA 4KITB 2EFNA 2EV0A 3FMRA 3ZRGA 1ENHA 1KONA 3CCEI 1W5CC 2FRHA 1ZTRA 2ELJA 4IHYA 2DCEA 4BACA 2R7ZJ 2BY0A 3C1DA 3HEFA 1MGTA 3K2AA 2XB5A 2DA5A 3V7RA 4XICA 4FASD 2MC3A 1LE8A 3L2CA 3S3OA 2M5WA 2FBIA 4WXDA 3BR2A 2EWNA 1DPRA 2VL8A 2ZMEC 3GFLA 2EQRA 4EM2A 4KUMA 1BJZA 2CQKA 5F04A 2JQ7A 4BU2A 4BXFA 4ZYHA 1O3SA 9ANTA 2EINH 1S29A 2VE8A 5ICGA 4L5IA 5LRRA 2HNHA 2QSHX 1OKRA 4Z2YA 3I59A 4CXFA 3RTRA 5FRNA 4B43A 4XBFA 3BTCA 1X3ZB 3CCLI 3BJOA 3BG3A 2NVTJ 3BCAA 4EJOA 4Y3OA 4LLNA 3O8HA 4M3FA 4M6XA 4OIRF 3HUGB 3CO6C 2A68F 4XLAA 3HPGA 1YRNA 3CMEI 3KYDB 4ESFA 2XB0X 1IO2A 2IA1A 1W7PD 1HKTA 1XMKA 2R7FA 5DUKA 2GIZA 2PMUA 4XLHA 3HZJA 5TISC 3L7WA 3WODF 4HDVA 1X19A 2K02A 3COAC 1YJNI 4YIIA 3G1MA 5D4SA 5HNFA 2HQRA 3EQLF 3WGIA 5JFRA 1KU2A 4OIQF 4AIJA 4CCOA 2LBFA 5D4RA 1HDPA 3OV8A 1CGPA 2PMZN 4V2GA 2EFPA 2GLOA 4XNFA 4HBLA 2A3SA 2WC2A 1FIAA 1MH4A 2W00A 3WHBA 3LFKA 3CCJI 1DP3A 2GWRA 4LJZF 4C9YA 1JXSA 4KN4X 1JUPA 4EV0A 1FPQA 3FK6A 2JA6J 3CJRB 4HNVA 2FA5A 3T8TA 4PK4A 1WJAA 1YJWI 1VQNI 3MMYB 5GTHC 4G94A 3SDBA 4XONA 5DS9A 1FJLA 1SD5A 3OIQA 1R5GA 3WTTC 1SVMA 3RKQA 5J6XA 4CGZA 3ULQB 1WJDA 3TP0A 2LG4A 3VYTB 4ENJA 2E7WA 2V1UA 3G6EI 2HWVA 4D1QA 4IX7A 1TNTA 2LRDA 3RCOA 3BG7A 4PJMA 1RIOH 1EH7A 4C3HJ 2CUJA 4OIPF 2KRFA 3JSOA 2FBHA 1T33A 3LQRA 5BPIA 3CJTB 2X51A 5TRDA 3CP2A 1E3HA 2A05A 2M7BA 1BIAA 2DMNA 2Z16A 4BJTA 3Q5FA 1Q1VA 4NBQA 1GT0C 3OSFA 3GTGJ 1OR7A 2XF7A 2W7NA 4IVNA 1MD0A 4N9HA 2P7CB 5M5XJ 2L4MA 5KHDA 1R9TJ 1AKHB 1WH7A 4A3KJ 4BDYA 1SC7A 4EJVA 2P6SA 1FT9A 3FXJA 1E3PA 3ABTA 1Z7UA 3NWTA 3DEUA 5GPAA 2IBDA 4IKFA 5ICCA 3UKGA 2KRCA 5D6EA 2DN0A 4TV7A 1FSHA 2JJ7A 4L9NA 3ZR8X 5D5WB 1RETA 3BZCA 2N8GA 5CQEA 2M0MA 2E35A 2MGQA 2E1OA 1UB9A 4HQMA 3GFJA 1FY7A 1S3JA 1ZKGA 4U87A 2FEZA 4A3BJ 1ETXA 1GV5A 3OYJA 3BG6A 1FTTA 5GADJ 3LQQA 1R00A 3H9QA 2NXNB 1T56A 5ICEA 2LVSA 1JKPC 2FJ1A 2CGPA 1MJAA 3OIPA 2PJPA 4AIKA 2VJJA 5ILSA 2CUFA 2Y9YA 2EFWA 4JQFA 3V4GA 2VJ5A 2HYGD 1P4AA 1EJ9A 1SMYF 2IW5A 1G3TA 3BC8A 1RUOA 4Y7NJ 1MH3A 2WY8Q 2XKPA 3M07A 3KYLA 3GTPJ 3ZOBA 1YHQI 5B3SH 3H92A 3HM5A 5CVUA 2VBXA 2ESHA 3A0HC 4HV6A 1IDYA 1ZG3A 3GO5A 2CQNA 2XVCA 5CKTA 2KIFA 1WJFA 4OMYA 4BUPA 4D5CA 1FBUA 2D5VA 3G73A 3LSPA 4A6EA 1E2XA 2BHYA 2LP0A 2ZXWH 2CWEA 2K4BA 1IN5A 4IRHA 2HVRA 3OOUA 5LBQA 1V55H 3UNGC 2DOEA 2H94A 4KT5C 2XC7A 3M4OJ 2XGDA 5CVJA 4GRIA 5EGOB 1X2NA 3JRIA 2A6HF 2KLOA 1W7PA 1Z1DA 1C0WA 3G2BA 5FLMJ 3DLAA 1R4NB 3LSHA 2F5DA 2AS5F 4B3AA 2K9QA 1WJ5A 2YR2A 2QM3A 3S2HJ 3A01A 1QHGA 3F8CA 2JK3A 2M8EA 1ZAOA 1UG0A 2Y0MA 3F0CA 2ELKA 3TO9A 3JSPA 3ML6A 2LFBA 2MC4A 4L9TA 3K70D 1JUMA 1E3OC 2ZNYA 2IA2A 2VI6A 2ZMEA 3F6OA 1R4MB 2KJCA 2QQBA 5C4JJ 3TDZC 2E2JJ 2DJNA 4Y13A 2ZB9A 1S7AA 2DK5A 3VYUB 3CC7I 3EYYA 4OMZA 3B02A 3WU0A 5HLHA 3L2QA 4RAGA 3B6AA 3IWZA 2VODA 2ELHA 1IAWA 3S2DJ 5E3MA 4EM1A 4EVIA 1D8JA 4P55A 3S3NA 1SVOA 2Z9OA 3OWTA 3OYBA 2MSYA 2XSDC 1Z9CA 1CF7B 1MNDA 3CO7C 2IPQX 3OL3A 4UY8I 1BI3A 2JRMA 3CTAA 5C3EJ 3JRDA 1FWZA 1D3YA 2X4HA 1IN6A 2E7XA 3FKJA 2HQAA 1ZG5A 3FXQA 2IS6A 1R23A 3T8RA 3J7AY 3MKYB 5DTDA 1FZPB 4CUGA 4H4KC 2DMUA 1OFCX 4L0YB 3ZQHA 4CCKA 4BXXJ 3HJEA 5EG0A 3OR1C 4IZZA 3VEPA 1SEUA 2KP6A 1HLVA 3KYCB 3DFGA 4Y33A 1BR4A 3GZ5A 5DCMB 1KYWA 4ZJZA 3KEQA 1B8IB 1FYMA 2HOTA 1HKSA 2COMA 3HGGA 1ZH5A 2EIKH 1YOVB 1OPCA 1MBHA 2JVGA 2EBIA 1NK3P 2JN6A 4BY1J 1RPWA 3MWMA 1F9NA 1IN8A 3HC7A 2Q2EA 1BOBA 4BEHA 1WVRA 4CH7A 2CJJA 3PSFA 3GTQJ 1D1CA 2K3FA 3OS2A 5FO5A 2M30A 2OCEA 3HGYA 4NUBA 3EDPA 4R79A 4PSXA 2ZO4A 4WF2A 3LL7A 3RIRA 1IUFA 3LSTA 3EUKL 5EEHA 3ZCOA 3O2PE 3SEQA 3WTYC 2EZLA 3AFHA 5JHFA 3GWZA 3ESWB 4M3DA 3ASNH 1ITYA 3HRMA 1WJBA 1H0MA 3K0LA 1SFEA 3LAJA 2KRHA 5E1ZB 2XROA 4A3CJ 4XQFA 2DU9A 1PJRA 3IRQA 2CYYA 1QHHD 3BR5A 4CZZA 2PN6A 3X2QH 1MMGA 1JKQC 4A3EJ 2CUZA 2MH2A 2M0CA 1CQTA 4XN3A 2FD5A 3I4NJ 2HGCA 4QPQA 5M5WJ 3W2AA 3U9GA 2H8WA 5CYVA 4NNJA 5IOYA 1F4KA 2QBYB 3FBNB 4A0ZA 3PNVA 1ZR4A 5F6FA 5ERIA 1VQLI 5FLXK 3I9V2 2Z33A 2MBFA 6PAXA 4DQ2A 1JUSA 2W48A 3KIOA 4XIDA 1G3SA 2HDCA 3JW4A 4L9VA 2HFHA 1APLC 1XPXA 1YIOA 1HXDA 1P7IA 3OIOA 1XCBA 3B73A 2OAZA 4F7ZA 1MJ9A 4ZYEA 2LKXA 2M9HA 4MEYF 1I5ZA 4ZH4F 4EJTA 3GMEA 2E36A 2R3SA 2BY1A 4BY7J 4U88A 1ZELA 3TP3A 4JX6A 3HTUA 5ILUA 5FFZA 2LNBA 1RKWA 1T98A 5E3NA 2DA3A 1HC8A 3H9GA 1PVEA 1ZR2A 2XPVA 3DU6A 4KA4A 5J4YA 3SZPA 5DDGA 1EH6A 3PIOF 3WTSC 3RYRA 2K9LA 2A5YB 5KNLA 1A31A 4HX4A 2VQCA 3A01B 4G8XA 1MJBA 3ZQFA 4I76A 1RR7A 4ZYAA 2KPMA 3SDGA 1O57A 2CFXA 2HKXA 5L3FA 4WCGA 4UVBA 5K7FA 4OIOF 2YX4A 2LF7A 3HBLA 3RKXA 3K70C 3I54A 4EM0B 3DBHB 3S16J 4A3IJ 3K69A 3F8MA 4CCNA 1XSVA 5K5OA 3TO6A 1QPIA 2RGVA 2HKOA 1IXRC 2QYOA 4KYWA 5B1BH 2WA0A 2FF4A 1TP4A 1BC7C 4BE0A 1H89C 3ROUA 3HKZA 4UXNA 1G3WA 3LSRA 4ZDLA 2E5ZA 5CPRB 2ME6A 3KETA 3QPHA 4D5FA 2JT1A 3BLYA 2H1KA 3H3UA 3K4CA 4V19K 1MSEC 2R5YA 4ZDPA 2K3PA 3WTXC 3H3VK 1GV2A 2HTSA 4PJNA 1K6OA 3FXRA 2L9RA 4U0YA 3S8PA 2W4SA 1G6NA 2TDXA 4YIRX 2HYFA 3CLQA 4CSWA 4IPAA 4QLCU 3GTMJ 2CH0A 1S5LC 2L02A 2GXGA 3OYGA 5IY5H 1TTYA 3GVAA 1FC3A 2IS1A 1DGWY 2Z3YA 1X3UA 1MDMA 3KZZA 3CCVI 1EKEA 2VBZA 3BR3A 3JRAA 1W36D 5H2FC 4Y4RA 1WQ2A 4FETA 2DFIA 3HHHA 2HZDA 2CMPA 3TGNA 3F3XA 3S2WA 1W7PB 2BHZA 3OSGA 4E7HA 1NG7A 4HLYA 2R7SA 4A3JJ 3BQZA 1X2MA 4DNCA 3HG9A 3ZQCA 3MAJA 4M9SA 2V1NA 2E5NA 3JRGA 2VKHA 3KLOA 3BPXA 3GLXA 1DGRM 2EV6A 1DQUA 1Y8QB 1K7AA 2YSRA 4MQVA 5TJJA 5CVIA 5JLXA 1O4XA 2LOOA 1LJ9A 3E5UA 3K4JA 4I99C 4RLQA 3M3YJ 4A3LJ 2OZ6A 2Y48A 2D1HA 3RDIA 2VJ4A 1AHDP 3LSIA 3KLNA 2AHQA 4LG3A 4UB8C 4YFNF 5FKMA 3BTJA 4BQAA 1YJ9I 2R7UA 2IRFG 2DT6A 4KICA 5BOXA 4DYRA 2X1EA 4BH9A 2CU7A 4KNYA 3FISA 1J09A 4ENKA 2JA8J 2XPUA 5HLGA 4HAMA 2P7VB 3GEZA 5D8LB 3TW6A 4HPQA 3E6BA 1LE8B 2WAQN 4OU0A 3RI4A 2FBKA 1YIJI 3VWBA 1O3RA 1F5TA 1LVKA 2RREA 1WKMA 2F5EA 1HCRA 4G7OF 2KMUA 1IV6A 4UVCA 4AM3A 2JPBA 2G7UA 3TBIA 3TEDA 4O3MA 5E79C 2V26A 3CUQC 2IGNA 1D0ZA 2VQLA 1ETKA 2LC2A 1FOXA 1X1CA 5LEJA 1IXCA 2XDVA 1QU3A 1R71A 5IYDJ 1YW8A 2DDBA 2JUGA 2VT3A 2QVOA 4HNTA 1R58A 2E60A 3NRVA 4OAYA 1VQ9I 3QPLA 1XDSA 1TQIA 2WAEA 2X85A 3H5AA 4M9XA 1KA8A 2UXXA 3RJPA 4DBQA 1U3EM 3A03A 2FUG2 3DTIA 3SZTA 3K7AJ 2K86A 4UV8A 1W0TA 3M7GA 1UHMA 5IT9K 3DQVC 2CSOA 1A35A 2XAFA 1ETWA 4PGGA 4E7LA 3E3VA 1BW5A 1UAAA 2XSJC 1SMTA 4RAZA 2C6YA 3DPUA 2PI0A 2NNYA 1AKHA 3M8EA 2FOKA 1MNEA 2LF8A 1W5TA 2RQQA 3PFYA 4PDKA 4F93B 4ESJA 3PQKA 4ZC3A 2ZC2A 3VDXA 5EG0B 3DKWA 3F8NA 1P7JA 4HYEA 1V4RA 1XDUA 1AU7A 2ZSIB 1OISA 2A6EF 4I02A 1A5JA 1TT0A 1HKQA 4CCLA 4E4HA 1T6SA 2NOJB 4FT8A 1Z05A 3JCUC 4U0WA 4MTEA 3CCQI 3BG5A 2X1DA 2NAZA 4HF0A 2A07F 4B1RA 2JSPA 3K4LA 1X1DA 2LLKA 2HR3A 1P6RA 2VQGA 5IT9Z 2BVMA 1I1GA 4EJUA 1DDNA 2BY2A 2PMZA 5H6QA 4BS9A 4BYYA 2F5CA 2Y31A 5E3LA 4XLCA 2QKMB 1BI0A 1S7OA 5F64A 2HVSA 3IL2A 1HBXG 1E17A 4DIQA 2O8XA 2VJIA 2AXTC 3OMYA 4RM3A 3OYHA 1Y0NA 2K7LA 3W6VA 2P0WA 1JTXA 1L0OC 2GIVA 3W6KB 1IRGA 3AG3H 3OYAA 4IOAF 5LHHA 1VQMI 3H3ZA 1BA5A 4LGWA 3BJ6A 3I0TA 1WI9A 1B9NA 4BDZA 1DUXC 1H88C 2MLGA 2V9VA 3DPTA 4N4OB 4CICA 2P5VA 3F6VA 1DP7P 3V7SA 4NB5A 3I64A 3P9KA 3BPVA 3T1BA 2COBA 5F08A 1IDZA 4D0PA 5DCFA 1FMVA 1VTNC 3HOXJ 3S32A 1BIBA 3C2GA 4V2FA 2FU4A 3MZYA 2QGUA 4D7MA 5EZGA 1K83J 5E17F 1IRFA 2LR8A 1B4AA 2YPRA 5HOOA 4F52A 1T8IA 3C2HA 3ECOA 5CLSA 1TNSA 3S3MA 2W84A 1U8RA 4BE1A 4ZTFA 4WXHA 4NC8A 4EEFG 5IP6A 4A12A 2QCOA 1W0UA 1N78A 4IHWA 2WY7Q 4XORA 3ZN0A 1IF1A 5FRMA 4NC7A 1LVAA 1SFKA 3I56I 4QWQA 3I4MJ 2V7FA 3BZKA 3BCBA 2P81A 1MBJA 3ERED 3HUGA 2VBYA 1R5ID 2NVQJ 1OMIA 2L7MP 5IPAA 2XGXA 2OC6A 3ZMDA 3IV5A 2XKOA 1ETQA 4XRSG 1ORKA 2KFDA 1K78B 4RAYA 5ED4A 4KDPA 5LLQA 1N77A 1Y1VJ 1U6GA 2QUFA 3TL4X 4EMSA 4LG0B 1RKTA 4HSRA 3ZQLA 2DA2A 3IH2A 3BG9A 1YX3A 1D1BA 5GP9A 2V1DA 1U2WA 2PEXA 4MHGA 2OD5A 2DK8A 4XSXF 2UWMA 3KP5A 5D8KB 2DMTA 5J47A 2PLYA 2QENA 2MABA 2DTZA 3GTOJ 4UHTA 4YFKF 5HODA 4IHTA 1RZ4A 3SXYA 2VOOA 4MGRA 3MN2A 2XGCA 2V6CA 3NQOA 2QSFX 5EDNA 1X4OA 1P4WA 2DT5A 4G6QA 4L0ZB 2IS4A 3VYSB 1EV7A 4O6JA 1BM9A 3F9KA 4I01A 2XASA 4HW0A 4BQQA 2CW0F 2MLKA 4I98B 4ZZDA 3QYEA 3F22A 5E20A 5H20A 4AVZA 1Y0UA 4XMYA 3ZQIA 5LD2C 1VNDA 4UUSB 1OJLA 2HPIA 3WGGA 3GBGA 1FBQA 1BR2A 2A5WA 3A4CA 2HOSA 1LNWA 1MBGA 1RI7A 3CQZJ 3RPUA 5EF6A 1YW7A 2EILH 1BJAA 5KAIC 4MEXF 3EYIA 1QNTA 5DD8A 2Z5UA 5J8CA 1V5GA 2IS2A 5FKLA 1U9OA 3F8BA 5EZHA 1MNMC 1VZ0A 2D45A 1I6HJ 1X1PA 1O3TA 5IP7J 4RGUA 3I58A 1ZLKA 3NARA 2NS7A 5IYBJ 3F8FA 1BL0A 1S8NA 1QQIA 2CW8A 3HRTA 3I55I 3E6CC 2FQ3A 2KT0A 1LDJA 3AG2H 4AYBA 4BHCA 2LKSA 4RB2C 5HLIA 4K2EA 3CUQB 1ZGJA 1XGOA 3FHZA 1E0EA 1IC8A 1JGGA 4IHVA 2DYRH 2L7KA 2ACJA 3DLLF 1D5YA 2FE3A 4HF2A 2GZWA 1TW2A 1YQAA 2DI3A 2MH9A 2TRTA 1F1ZA 3J7AO 1TWAJ 1EH8A 4N0BA 1V5EA 2EIJH 2RV8A 3MZHA 4W1UA 2VLAA 5J1YA 1UFMA 1S7EA 1V3FA 3V8LA 2DODA 3EUAA 1ON1A 4DGWB 2DDAA 3P9IA 4P96A 3ABKH 2XPWA 4KFCA 1FEXA 1O3QA 1R5HA 5FD5A 1HQCA 1NK2P 2NRAC 4IRIA 3ERMA 3F23A 1DPUA 3FXKA 2VBWA 5J4VA 3D1NI 2GXBA 3CD6I 2UV1A 2WTEA 4GYGA 4LIVA 2VC0A 5JVGF 3CCMI 1YITI 4P1WA 3BP8A 3RQIA 2R7TA 1W5SA 1D5VA 3I3LA 1FOWA 3KX2A 3WTZA 3IH4A 4XKVA 4OAZA 4QIWN 2HPMA 2X6WA 1MZBA 2DO7A 1T0FA 5GPCA 2MD5A 4IHXA 3E5QA 4RB0A 4E70A 2FMYA 2CO5A 2EFQA 3BR1A 3FXOA 4PJ0C 3OYFA 1FOKA 1ZREA 4C2UA 1P2FA 1ULYA 2P6TA 5M3FJ 4RB1A 2IVMA 3DP7A 3G1OA 2GM4A 2KQRA 3RYPA 3N4MA 3CMMA 4B48A 1L3LA 2GA1A 2V9PA 2GXAA 1KZHA 2M7AA 5IYCJ 5HS7A 3GYHX 1XTAA 1S9HA 4C3JJ 1Z0XA 2ZKZA 2LY1A 3DCFA 3R0JA 4JBAA 5FKNA 1P4XA 2GOMA 3OYKA 3PUBA 1HF0A 1AWCA 2DFHA 1YO5C 4E7ZA 5KVRA 3PM1A 2ME0A 4HG2A 3G4SI 3OS1A 4L9JA 4YEJA 2L54A 5K1YA 2V4JC 1RC9A 3KP2A 3HSEA 2IJLA 2EZKA 2ID3A 2P8TA 2EA2A 2G0EA 1OCZH 3D5LA 4IJAA 4JK1X 2OU2A 2DA4A 4CDGA 3E6MA 1ZRFA 3RSNA 2ISYA 4NQWA 2K9SA 3OOPA 4E7SA 4HX8A 3G71I 2XRLA 4LB6B 4FX4A 1T2KA 4Q5SF 2LY2A 1J75A 2WV1A 4JX4A 3HOVJ 5B66C 2DA1A 5B1AH 1FLIA 2JA2A 2ZJ2A 2M34A 2X6YA 2DQLA 3WTUC 2EJRA 4IEJA 3T0YA 3AG1H 2W25A 3QPTA 1A04A 1WPKA 3G1LA 2E1MC 1G8XA 3Q9SA 3QPSA 2XUBA 4IXAA 4M6VA 4QSHA 5L3DA 4ESBA 3LA7A 1LEBA 1KYZA 3LSJA 1PUEE 3GZNB 1SFXA 3MVPA 1TC3C 4EGYA 3PO2J 3FBIB 3RKWA 1K6YA 3K1MA 2LKPA 2CV0A 2Y75A 2LBFB 3VSKA 1ZYRF 3OYMA 1XGSA 1ETOA 3FXUA 2VUMJ 4AU7A 3J7YJ 1FYLA 3W6JB 3Q0VA 4IO9F 5J40A 4F91B 3OYDA 1P92A 1UHSA 4CYCB 4ON0A 3P9CA 5EJCA 4J00A 2XAJA 4I0AA 1U5TC 4UNOA 1H8AC 3FF5A 1ZARA 3M1CA 3CCYA 4BXUA 5F0CA 3CUOA 2YU3A 1I27A 4I09A 1YG2A 3IRRA 5BPDA 4XRMA 1B72A 5CVRA 2PX9A 1OYIA 2LYCA 2XAHA 2KZVA 3J80K 4OWRB 1ZRDA 3OYNA 1B9MA 1MMAA 5EEGA 5F1JA 4UUTA 2JWTA 1Y6IA 5EEAA 4G7HF 3S93A 1MMSA 1JKOC 2K4JA 2QZ8A 2MD0A 3DEWA 3LA2A 3EUHC 3L2RA 1USTA 3A1YA 1MBKA 4DZJA 2W57A 5FGMA 4O5VA 4BGDA 5LFAA 2MYSA 3GZ6A 2KIQA 3DBRB 2QA4I 3MKZA 3L9FA 4A3DJ 5IT3A 2HTJA 2ZNZA 3D5SC 2IA0A 1XD7A 2EZHA 2HS5A 1TZLA 4XLEA 3GCMA 2EK5A 2O03A 4XKCA 4MIMA 3KEYA 1MBEA 4XR6A 3W3CA 2LTPA 1FOYA 3JR9A 1ZGWA 4LB5A 2HI3A 3BROA 5B5EC 2XF6A 4MFDA 3HHGA 4HQEA 3CP8A 3O6BB 3HL2A 4LLLA 2R5ZB 1FSEA 5L3EA 4M71A 1Z67A 2P4WA 3Q9VA 1PP8F 1X4PA 1Z91A 1JGSA 2DYSH 2E1MB 4G12A 1SD6A 1QRYA 2P5LC 2WB1A 1V54H 3V8KA 5D5XB 1QZEA 3AG4H 3SQNA 3DWLE 5DYMA 2VIXA 2R7VA 1OCTC 4C2MJ 1VF9A 3K4BA 4HA8A 3K4KA 2F2EA 3O8GA 4G9YA 3U21A 2EIMH 2ISZA 4Y17A 2PJRA 5E1WA 3S1QJ 2D2WA 1B59A 3MEXA 1GDTA 4XM3A 2ZBKA 1VFCA 1VQ6I 4Y52J 2ADUA 1NTCA 3I4PA 2M1BA 1Z7LA 3G3ZA 5JHUA 3ZPLA 2NS8A 1OYWA 2LD5A 2W24A 3K4NA 4XN0A 3RPUD 3QOEA 2DT7B 3SZGA 5GAHJ 2VB6A 4FX0A 3VB2A 3TOBA 4YELA 2VONA 2A69F 4FE7A 5FKOA 2D1VA 2WAFA 5BS6A 5HNHA 1WSUA 1KU9A 1YS7A 1GXPA 3ABUA 3E5XA 3FDYA 4M9ZA 4ZYDA 1DU6A 1ZLJA 2EA4A 4BBRJ 1RUNA 4NQWB 1GVDA 2BY3A 3EPZA 2H09A 1FIPA 4XRSA 3HKZN 3F72A 2K85A 3BQYA 4FE4A 2ZJQF 1RRJA 1R49A 4C3IJ 4WWCA 2B63J 1OQYA 1HA8A 1TWCJ 1T95A 2Q8KA 1KU7A 2BV6A 3ZP5A 2B9SA 3CC4I 1KQ0A 1LEAA 3TMOA 5HS8A 1LUJB 2HEOA 2CUEA 1OYYA 1QGPA 4GDFA 2OQGA 5FJ8J 1JHHA 4XK4A 4DW6A 5M3MJ 1RNLA 4G6TB 2XRNA 1S72I 5BQTA 2Y9ZA 2E2HJ 2IAIA 1B6AA 1MW7A 2XHKA 1JJ6C 4KT6A 2R93J 2NOGA 5AIPA 3DPLC 4HLXA 3SFIA 3ZQ7A 5L3CA 4PJLA 1JT0A 5GAEJ 2OPTA 2JMWA 4KMFA 1MDMB 2O61A 2L7ZA 4Y15A 1H9GA 2RC4A 3BTLA 2F6CA 3IKTA 2XV4S 3KE2A 1UMQA 3ZMUA 2MA3A 2BOLA 3V42A 2NYXA 1QBJA 2IGOA 2VT2A 4WK8F 1WZ2A 4I7HA 2IP2A 3QWLA 2KDZA 3AL0C 1I50J 2XAQA 2UXNA 3S1MJ 3HSFA 1QZYA 1WJEA 1PYVA 4QTRA 1J59A 1P9QC 2R7XA 3DBLB 5DV5A 1B72B 4FISA 2KL4A 1JI8A 3CZ6A 2NVYJ 3OYCA 3RZOJ 2I10A 4S04A 3KP6A
chains in the Genus database with same CATH topology
3J7ZI 1VQOI 5GAGJ 2NXNB 1VQPI 3CC2I 1HC8A 1YIJI 1ACIA 1FOYA 3DLLF 3CCUI 1MMSA 3CCSI 1Y39A 1VQ5I 1VQLI 3I56I 3CCEI 3CJTB 1VQ6I 1YJNI 2ZJRF 3CD6I 4IOAF 1VQMI 1S72I 3PIOF 2K3FA 1YJWI 5JVGF 1VQ7I 3CC7I 3CCMI 1VQNI 1YITI 4IO9F 3PIPF 2FOWA 1QA6A 2OTJI 3G71I 2QA4I 2OTLI 3CCLI 4V19K 2ZJQF 3I55I 2JQ7A 3CF5F 1FOXA 1FOWA 3CCQI 2E35A 5DM7F 3CMAI 1YJ9I 2E36A 1VQ4I 5DM6F 3CCRI 5GAEJ 1YI2I 5GAHJ 2ZJPF 3CC4I 3J7YJ 2QEXI 3CCJI 3G6EI 3G4SI 3CMEI 1VQ9I 3CCVI 1VQ8I 5GADJ 2H8WA 1VQKI 4UY8I 2E34A 1YHQI 4IOCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z I;  1VQO I;  5GAG J;  2NXN B;  1VQP I;  3CC2 I;  1HC8 A;  1YIJ I;  1ACI A;  1FOY A;  3DLL F;  3CCU I;  1MMS A;  3CCS I;  1Y39 A;  1VQ5 I;  1VQL I;  3I56 I;  3CCE I;  3CJT B;  1VQ6 I;  1YJN I;  2ZJR F;  3CD6 I;  4IOA F;  1VQM I;  1S72 I;  3PIO F;  2K3F A;  1YJW I;  5JVG F;  1VQ7 I;  3CC7 I;  3CCM I;  1VQN I;  1YIT I;  4IO9 F;  3PIP F;  2FOW A;  1QA6 A;  2OTJ I;  3G71 I;  2QA4 I;  2OTL I;  3CCL I;  4V19 K;  2ZJQ F;  3I55 I;  2JQ7 A;  3CF5 F;  1FOX A;  1FOW A;  3CCQ I;  2E35 A;  5DM7 F;  3CMA I;  1YJ9 I;  2E36 A;  1VQ4 I;  5DM6 F;  3CCR I;  5GAE J;  1YI2 I;  5GAH J;  2ZJP F;  3CC4 I;  3J7Y J;  2QEX I;  3CCJ I;  3G6E I;  3G4S I;  3CME I;  1VQ9 I;  3CCV I;  1VQ8 I;  5GAD J;  2H8W A;  1VQK I;  4UY8 I;  2E34 A;  1YHQ I;  4IOC F; 
#chains in the Genus database with same CATH topology
 1USS A;  4EAT A;  1PUF B;  4KIF A;  3NAU A;  1B1B A;  5E8G A;  2ID6 A;  3HYI A;  4YG2 F;  1IN7 A;  3DTK A;  2VC1 A;  3LMM A;  4LFU A;  1WFX A;  4IF4 A;  2ZXI A;  2R7D A;  3IH3 A;  2JA5 J;  2G7H A;  3TW7 A;  3R0A A;  1B8I A;  2OTJ I;  1IRZ A;  2LDU A;  5D6F A;  3FMS A;  2HXI A;  1D0X A;  1HW2 A;  2L4A A;  5BNG A;  4FCY A;  1N25 A;  3IUO A;  2L0K A;  1FYK A;  2MFZ A;  4LOC A;  2G9W A;  2LH9 A;  4LK0 F;  1GXQ A;  2AXL A;  3R6S A;  2WWY A;  1YS6 A;  4AUX A;  1ZRC A;  1ON2 A;  3IC7 A;  4GGG A;  5JI6 A;  1REP C;  2R7W A;  3PFI A;  3LOC A;  3BY6 A;  3HPH A;  3ABM H;  3WE2 A;  3QAH A;  4A3G J;  2L9V A;  2V6E A;  2R7Q A;  2VN2 A;  4D7N A;  5HDN A;  2FML A;  3FXL A;  4N9I A;  2O8K A;  3E7L A;  3HOY J;  3ASO H;  4Z6Y A;  5IOZ A;  3DKX A;  2Y69 H;  4BHB A;  2XIG A;  5K7Z A;  3HOW J;  3KP4 A;  2DJI A;  3VFZ A;  5HLT A;  3GFI A;  1G4D A;  3JTH A;  5CJ9 A;  1HW1 A;  2PQ8 A;  1U0J A;  2VKD A;  1MBF A;  3FIW A;  3C3W A;  5HVQ C;  5AON A;  4RGX A;  4AC0 A;  2IT0 A;  4XLP F;  3HOS A;  1XN7 A;  1IW7 F;  2QWW A;  5IP9 J;  3ZXS A;  4MLO A;  3E97 A;  2OUM A;  5ICF A;  3GTJ J;  3IWF A;  1IV8 A;  3N05 A;  3QQA A;  1JTY A;  2BBY A;  4NHJ A;  4LK1 F;  4QPO A;  3C7J A;  1YFH A;  2X6X A;  3JRF A;  2TCT A;  4GCV A;  2FXA A;  2VXD A;  5LEK A;  2R7R A;  2E71 A;  1WI3 A;  3L2V A;  4FTH A;  2FQ4 A;  4XSZ F;  3RQ4 A;  4PJJ A;  2RNJ A;  3WU2 C;  1XB4 A;  3WTV C;  3SEZ A;  1SAN A;  4LLG F;  2JRT A;  1FTZ A;  1Z6R A;  3WHC A;  3MFK A;  5FKK A;  3HOZ J;  5ILV A;  3DU5 A;  3FM5 A;  3BZ6 A;  1MMD A;  5FRO A;  4DJA A;  1PP7 U;  3S1N J;  2O9L A;  1AOY A;  2PFB A;  2IGM A;  2RQP A;  1UHW A;  2STT A;  4PUS A;  4M72 A;  4UUV A;  3AAF A;  4LD5 A;  4NC6 A;  4RGR A;  2ETH A;  1XG1 A;  2NVU B;  5J3L A;  2CG4 A;  3B6C A;  2K5C A;  3P7N A;  3RPQ A;  2JZY A;  3TOA A;  5F1R A;  4AWX B;  2QSG X;  4E6K G;  3L1P A;  2M3A A;  1Y56 A;  3PIP F;  2DFE A;  4WXC A;  3CES A;  3NWS A;  4HDU A;  3FKI J;  1IGN A;  2O7O A;  1MSF C;  1HOM A;  2QF7 A;  4G6D A;  1G3Y A;  2ESN A;  1TWH J;  2K9N A;  4BAY A;  3JAM Z;  3VPR A;  3LAP A;  3L09 A;  1XX5 A;  1Y1W J;  1YW9 A;  2B7E A;  1JT6 A;  4XRF A;  3LA3 A;  5DEQ A;  1R1T A;  3S14 J;  1J5Y A;  2VKE A;  2XAU A;  3FXM A;  3KZI C;  1T38 A;  3SYT A;  3BTI A;  4JYK A;  2JTV A;  1TW3 A;  3LFU A;  1MIJ A;  1QA6 A;  1FP1 D;  2H27 A;  1XMX A;  2RKH A;  3HXL A;  3OS0 A;  1X1A A;  1QVT A;  4W97 A;  1SAU A;  2OZU A;  4A69 C;  2DLL A;  4OIN F;  1LB2 A;  2DA7 A;  5DUI A;  3ZN1 A;  4X6A J;  5TGT A;  1ACI A;  2ZXJ A;  3H1C A;  1BW6 A;  1WGX A;  1J0R A;  3QP6 A;  1Q1H A;  1U8B A;  1QO0 D;  1BI1 A;  1F36 A;  1QZZ A;  5F27 A;  3HRS A;  4JX5 A;  2WAQ A;  2KIM A;  1J9I A;  2F4O B;  2RVC A;  2KIS A;  2OTL I;  4CCM A;  4S05 A;  5E8I A;  5GTI C;  3ZMT A;  3JAM K;  4R1H A;  3J81 Z;  2AQF A;  4UUS A;  3DXJ F;  1LDD A;  3FHN A;  2GBY A;  5K5Q A;  4RGS A;  2GA2 A;  3PL8 A;  2B0L A;  5HDG A;  4YIF A;  4XOP A;  4ABZ A;  2STW A;  2KKO A;  1X58 A;  2H8R A;  1IJW C;  4HF1 A;  3ZMV A;  3K4M A;  2ICW G;  3I5U A;  1RR8 C;  1TBX A;  3VYR B;  4I0B A;  4M3G A;  3QOD A;  2O6G E;  3P5J A;  2ZXH A;  1BR1 A;  3BJA A;  3LNQ A;  2DXI A;  5EGO A;  3U2R A;  1A36 A;  4X1E A;  2GOX B;  2R7O A;  4BQN A;  1XGN A;  4IRG A;  5LGT A;  4IQJ A;  2WBM A;  2PJR B;  2R4G A;  1BN5 A;  2H6B A;  5FFX A;  3CCR I;  1ZK8 A;  2JA7 J;  4A5N A;  4Q48 A;  3E0J B;  3IKV A;  4BJ5 C;  1Z3X A;  2AQE A;  2ZFU A;  4B8X A;  3ZQG A;  3D5R C;  1UG2 A;  4MTD A;  4UB6 C;  3J7Z I;  1H9T A;  2QQA A;  3K10 A;  4MNU A;  2NVX J;  2X48 A;  1VQP I;  1POG A;  2LY9 A;  3C18 A;  5H6R A;  1YYV A;  1OR7 C;  1LFU P;  1R6R A;  1YX5 A;  2RAE A;  3H0G J;  4D9J A;  3I59 B;  2DMP A;  3U1K A;  2I8D A;  3OL4 A;  4LG0 A;  1OCP A;  3K2Z A;  4DYC A;  4AIH A;  2OJE D;  4U7D A;  1XGM A;  1MMN A;  3I71 A;  1FBS A;  2WV0 A;  3FK7 A;  1NH3 A;  4ZTJ A;  1U5T B;  4PFO A;  3N97 A;  2VPR A;  1TT5 B;  2PMH A;  3C2B A;  3AKZ A;  1K4T A;  2BEO A;  4E7I A;  2Q1Z B;  1KQ8 A;  1XC5 A;  3GUD A;  4IHS A;  3WU1 B;  2JUC A;  5KAF C;  1LKX A;  1PUF A;  5KK1 A;  2CQX A;  4A6D A;  3A0B C;  3CCS I;  1Y39 A;  4ZDO A;  2MG4 A;  3QU6 A;  1ZG1 A;  4M74 A;  4KIS A;  2OA4 A;  1R1V A;  4U7B A;  4C30 A;  2Y2Z A;  3SFZ A;  2QKL B;  3ABL H;  3U1D A;  2L7F P;  3DF8 A;  3J81 K;  1U78 A;  4JP0 A;  3MZ8 A;  4IQ4 A;  5C4X J;  1OCR H;  2RN7 A;  4OOI A;  5F0F A;  3JTG A;  3PQJ A;  4L5E A;  2CQQ A;  3EUH A;  4RLF A;  3CMY A;  1FMW A;  4HST A;  2CV2 A;  4GYI A;  4RBO A;  4M3E A;  3VOE A;  3QP5 A;  3K1N A;  3MD2 A;  3RZD J;  2EZI A;  4ANJ A;  2VOP A;  1X1B A;  3S1R J;  3H0D A;  2CV1 A;  1FX7 A;  2X0L A;  4F3Q A;  1JKR C;  1I6X A;  2E19 A;  2EH3 A;  2PG4 A;  3M1E A;  3UR3 C;  1TWF J;  2ECB A;  2HOE A;  5L3B A;  3LSM A;  2V9K A;  4CHU A;  1LQ1 A;  3FZV A;  2W1O A;  4II3 A;  5CQG A;  3JRH A;  2IEK A;  2Z2S B;  2IXS A;  3WGH A;  4I6Z A;  5LRS A;  3ELK A;  3SHF A;  3S15 J;  3CF2 A;  2O3F A;  4MFE A;  4DYQ A;  4HRI A;  2L3D A;  3H5R A;  4JOM A;  3MCZ A;  4RMN A;  1XS9 A;  2DBB A;  1YE9 A;  2ZCW A;  1SAX A;  4BNC A;  1I1S A;  5JR3 A;  2XAG A;  2ZSH B;  2M2E A;  2MW8 A;  4MQ9 F;  2L9S A;  1IZ1 A;  4CZC A;  4J01 A;  4GFB A;  3GXO A;  4E7K A;  2GQQ A;  3GLL A;  3NEU A;  4XLN F;  3WG9 A;  3HOT A;  2M8G X;  3GW2 A;  4Q4Z F;  2W82 A;  3TO7 A;  5LGU A;  1BI2 A;  2A6T A;  3HB9 A;  1OCO H;  1VQO I;  3H9J A;  3CC2 I;  4EQQ A;  1Z21 A;  3KZY A;  1D1A A;  1WWX A;  4B3X A;  1R7J A;  3CDI A;  4Q47 A;  5E1X A;  2BYV E;  2HYJ A;  4X0G A;  1O7F A;  1UJ8 A;  3PUF A;  3VSL A;  2DPD A;  5J1R A;  1EA3 A;  2DQR A;  4ENN A;  1SVL A;  2F48 A;  4HOB A;  2OQR A;  1HST A;  2L2O A;  2YUS A;  1JHF A;  2JPC A;  3BOQ A;  2HZT A;  2VKV A;  3A02 A;  1TQP A;  3M9A A;  2VXZ A;  4B44 A;  4KIB A;  4RAF A;  4CO8 A;  4RA2 A;  1QVU A;  2J5O A;  2RDP A;  4PGH A;  2EV5 A;  1VQK I;  5DCM A;  2XF5 A;  5HS9 A;  2Q2E B;  1XMA A;  1UEL B;  2H1L A;  4BEH B;  3K6G A;  2BGC A;  4ITV A;  1BBY A;  2QQ8 A;  1ODD A;  2M87 A;  1BC8 C;  3REO A;  3GX4 X;  2ZJR F;  1KGS A;  3D0S A;  1XSD A;  4A93 J;  1D0Y A;  1ONV A;  2VPL A;  5J8F A;  1YRN B;  2A61 A;  2EB7 A;  4AID A;  1A6Q A;  1WHU A;  2KZG A;  3KP3 A;  4RM2 A;  2E1N A;  2K27 A;  1SFO J;  3CF5 F;  3PSI A;  3HTS B;  2IGK A;  3ZGK A;  2Z99 A;  3GF2 A;  1D8K A;  3M8F A;  2CRG A;  4BHP A;  2F4I A;  1R36 A;  1RES A;  1CF7 A;  2R5Z A;  1IUY A;  2HQ5 A;  2LRE A;  2F5F A;  3BT9 A;  2CQ7 A;  4R8H A;  4UVA A;  3BR0 A;  3OYE A;  3ZQQ A;  4J19 A;  2DTR A;  2JVH A;  1S6L A;  3IP4 B;  1SD7 A;  4PFP A;  2Y30 A;  4N4N B;  1FNN A;  4DZP A;  5F0H A;  1VI0 A;  4A3F J;  1TQM A;  4AD9 A;  3IAS 2;  2KIU A;  2M4K A;  1EF4 A;  5EYR A;  4E7J A;  4CCJ A;  3S17 J;  5DM6 F;  1G59 A;  1ERD A;  1NHA A;  2LK2 A;  4PSW A;  3AL0 B;  2Z1D A;  1W36 C;  2HDW A;  5K7H A;  5E3O A;  2BW3 B;  2P5K A;  1AA7 A;  1PDN C;  3HSR A;  3IAM 2;  2R92 J;  2BVL A;  4P9U A;  1OCC H;  1BOA A;  3FX3 A;  4M6Y A;  5JVT A;  1NG6 A;  1HW5 A;  1GVJ A;  3MQ0 A;  3W2W A;  2PBI A;  4HEA 2;  4HZF A;  3OYL A;  3WE3 A;  1QPM A;  2ECC A;  1K61 A;  3L2W A;  3L2U A;  5E18 F;  1LFP A;  4MO7 A;  2R0Q C;  2L5Q A;  1F43 A;  1JE8 A;  3TQN A;  3PJR A;  2E2I J;  1ETV A;  2BW3 A;  4ZYG A;  4ENM A;  3ZMS A;  2BE5 F;  3ISP A;  5BMZ A;  5D5U B;  3T5X A;  1YTY A;  1Y8R B;  1LDK B;  5GAG J;  5JLW A;  4BJ6 C;  3K1P A;  3FM3 A;  4KIG A;  1TWG J;  5M5Y J;  4CYC A;  3CJQ B;  2LMD A;  2UZK A;  3I53 A;  4BE2 A;  4A5M A;  2OBP A;  3QYF A;  1LPQ A;  2W85 A;  1ZQ3 P;  3DTE A;  3A2K A;  2E1C A;  1K79 A;  2XGE A;  1WH5 A;  1WJC A;  2DMQ A;  2OF7 A;  3Q0W A;  1ZHF A;  2X1C A;  4RS8 A;  3WTW C;  2QQ9 A;  4ETS A;  2HXO A;  2DOA A;  3H36 A;  2K40 A;  4ASN A;  2J5P A;  2QBY A;  2Y0S N;  3R61 A;  2EFO A;  1HSJ A;  5D5V B;  4FHT A;  2JSC A;  2F5V A;  3CDL A;  3H35 A;  3OR2 C;  3ONQ A;  5C44 J;  3O3K A;  1TLH B;  2KHM A;  2WB1 N;  3BDD A;  1T39 A;  3FWE A;  1T08 B;  4ZZL A;  4F92 B;  3CMA I;  1DU0 A;  3Q0U A;  4B47 A;  3F21 A;  2Q0O A;  5FLX Z;  3CJN A;  2KJB A;  1W1W E;  1IN4 A;  2DPU A;  1I39 A;  1W4M A;  3KPH A;  4XKW A;  1KU3 A;  2DAO A;  3V7C A;  2FNA A;  3KEO A;  4S0H B;  4H0E A;  3Q3S A;  2AO9 A;  4RDU A;  2X9D A;  2FSW A;  1VQ7 I;  4L18 B;  4KMU X;  2M4G A;  1N75 A;  3QU3 A;  1UCR A;  3E1S A;  3L00 A;  3WG7 H;  3HDD A;  3HOU J;  3E6D A;  2FX0 A;  3LWF A;  1SD4 A;  2HDD A;  4BQO A;  1I3Q J;  5FLV A;  3JRE A;  1J7K A;  4P5O A;  1SFU A;  2L9N A;  4GXO A;  4HV5 A;  3BR6 A;  2CS3 A;  3V8J A;  4II2 A;  3HIF A;  5A2Q Z;  4IOC F;  3KFW X;  1LFB A;  1T0F C;  1FP2 A;  4G7Z F;  2V79 A;  2O0Y A;  5J1U A;  5FB2 A;  2YS9 A;  3R4K A;  3HRU A;  3OY9 A;  5LHI A;  4HNU A;  1WCM J;  1R22 A;  2K9M A;  4LMY A;  4GO1 A;  1XSX A;  2EPF A;  3GTK J;  5L3G A;  1STZ A;  3CLO A;  2GAU A;  2HOA A;  4P9F A;  2YX7 A;  1U9N A;  5DM7 F;  2HVQ A;  4F55 A;  2V1X A;  2ZFW A;  4LIT A;  2I5U A;  4PCQ A;  2QLZ A;  1VQ8 I;  3QYB A;  4U0V A;  2VE9 A;  2E34 A;  1O7L A;  2BXY A;  4B4C A;  3M8J A;  3QRF F;  2DA6 A;  5AIQ A;  3GFM A;  4BKX A;  2DOF A;  2CW7 A;  3FMQ A;  4LIU A;  4CA0 A;  5K5R A;  1TL8 A;  4B09 A;  2FNP A;  4XOT A;  3LSK A;  1HDD C;  2BZT A;  5A2Q K;  4I2O A;  2KDO A;  2DFF A;  3CDH A;  3MKW B;  3KCC A;  4EJW A;  2DW4 A;  2LSO A;  3KP7 A;  4AVP A;  4A0Y A;  2FOW A;  3K9T A;  3DV8 A;  4M73 A;  2UUZ A;  4RB3 C;  2ZME B;  3PNT A;  1K78 A;  1X3W B;  2VQH A;  1Z77 A;  1GLN A;  4IL6 C;  3W2V A;  2L01 A;  2O5R A;  1ETY A;  5HDK A;  3R60 A;  2YU9 J;  3QOP A;  2BXZ A;  3BWG A;  1K4S A;  2OV7 A;  3RKY A;  5LHG A;  1IG7 A;  2HU9 A;  3JRB A;  4A2U A;  3CCU I;  1JJ8 C;  1YLF A;  2NNN A;  1VQ5 I;  1ZGA A;  3DKY A;  1MKM A;  1V5F A;  3CUQ A;  4XLF A;  1ZN2 A;  3ECH A;  4PZJ A;  3ZMZ A;  4HX7 A;  1IXS B;  2HQN A;  1WRJ A;  3IHU A;  3PNY A;  1GUU A;  2OCC H;  3TDU C;  2WAD A;  2M45 A;  4FQG A;  5LGN A;  1IRX A;  3OYI A;  4M3B A;  1VQ4 I;  3LSG A;  4DOZ A;  3PO3 J;  4XL9 A;  2Y0S A;  1M1E B;  3JRC A;  1I3A A;  2RNG A;  3H5N A;  4YFX F;  4BL0 B;  4A3M J;  4C2T A;  1Z3Y A;  1U5T A;  4CYD A;  1Z6T A;  4XKB A;  3VOD A;  4NDL A;  4AYB N;  4KJZ A;  2X6O A;  5FD6 A;  1OLT A;  1R1U A;  4L5J A;  1A6I A;  4KN7 X;  1GHC A;  3DEE A;  4EGZ A;  5DD4 A;  4UV9 A;  3MKL A;  1G2H A;  2NS0 A;  1UZC A;  3SJM A;  4BBS J;  2CFO A;  4DBR A;  2VAS A;  1YI2 I;  2ZJP F;  1XCV A;  2R5Y B;  2QEX I;  5CVV A;  4WX9 A;  3J80 Z;  2H6C A;  4YRV A;  3GTL J;  2F4M B;  3EET A;  3TKY A;  1J2X A;  5KCM A;  1KQ9 A;  4A0X A;  4KIT B;  2EFN A;  2EV0 A;  3FMR A;  3ZRG A;  1ENH A;  1KON A;  3CCE I;  1W5C C;  2FRH A;  1ZTR A;  2ELJ A;  4IHY A;  2DCE A;  4BAC A;  2R7Z J;  2BY0 A;  3C1D A;  3HEF A;  1MGT A;  3K2A A;  2XB5 A;  2DA5 A;  3V7R A;  4XIC A;  4FAS D;  2MC3 A;  1LE8 A;  3L2C A;  3S3O A;  2M5W A;  2FBI A;  4WXD A;  3BR2 A;  2EWN A;  1DPR A;  2VL8 A;  2ZME C;  3GFL A;  2EQR A;  4EM2 A;  4KUM A;  1BJZ A;  2CQK A;  5F04 A;  2JQ7 A;  4BU2 A;  4BXF A;  4ZYH A;  1O3S A;  9ANT A;  2EIN H;  1S29 A;  2VE8 A;  5ICG A;  4L5I A;  5LRR A;  2HNH A;  2QSH X;  1OKR A;  4Z2Y A;  3I59 A;  4CXF A;  3RTR A;  5FRN A;  4B43 A;  4XBF A;  3BTC A;  1X3Z B;  3CCL I;  3BJO A;  3BG3 A;  2NVT J;  3BCA A;  4EJO A;  4Y3O A;  4LLN A;  3O8H A;  4M3F A;  4M6X A;  4OIR F;  3HUG B;  3CO6 C;  2A68 F;  4XLA A;  3HPG A;  1YRN A;  3CME I;  3KYD B;  4ESF A;  2XB0 X;  1IO2 A;  2IA1 A;  1W7P D;  1HKT A;  1XMK A;  2R7F A;  5DUK A;  2GIZ A;  2PMU A;  4XLH A;  3HZJ A;  5TIS C;  3L7W A;  3WOD F;  4HDV A;  1X19 A;  2K02 A;  3COA C;  1YJN I;  4YII A;  3G1M A;  5D4S A;  5HNF A;  2HQR A;  3EQL F;  3WGI A;  5JFR A;  1KU2 A;  4OIQ F;  4AIJ A;  4CCO A;  2LBF A;  5D4R A;  1HDP A;  3OV8 A;  1CGP A;  2PMZ N;  4V2G A;  2EFP A;  2GLO A;  4XNF A;  4HBL A;  2A3S A;  2WC2 A;  1FIA A;  1MH4 A;  2W00 A;  3WHB A;  3LFK A;  3CCJ I;  1DP3 A;  2GWR A;  4LJZ F;  4C9Y A;  1JXS A;  4KN4 X;  1JUP A;  4EV0 A;  1FPQ A;  3FK6 A;  2JA6 J;  3CJR B;  4HNV A;  2FA5 A;  3T8T A;  4PK4 A;  1WJA A;  1YJW I;  1VQN I;  3MMY B;  5GTH C;  4G94 A;  3SDB A;  4XON A;  5DS9 A;  1FJL A;  1SD5 A;  3OIQ A;  1R5G A;  3WTT C;  1SVM A;  3RKQ A;  5J6X A;  4CGZ A;  3ULQ B;  1WJD A;  3TP0 A;  2LG4 A;  3VYT B;  4ENJ A;  2E7W A;  2V1U A;  3G6E I;  2HWV A;  4D1Q A;  4IX7 A;  1TNT A;  2LRD A;  3RCO A;  3BG7 A;  4PJM A;  1RIO H;  1EH7 A;  4C3H J;  2CUJ A;  4OIP F;  2KRF A;  3JSO A;  2FBH A;  1T33 A;  3LQR A;  5BPI A;  3CJT B;  2X51 A;  5TRD A;  3CP2 A;  1E3H A;  2A05 A;  2M7B A;  1BIA A;  2DMN A;  2Z16 A;  4BJT A;  3Q5F A;  1Q1V A;  4NBQ A;  1GT0 C;  3OSF A;  3GTG J;  1OR7 A;  2XF7 A;  2W7N A;  4IVN A;  1MD0 A;  4N9H A;  2P7C B;  5M5X J;  2L4M A;  5KHD A;  1R9T J;  1AKH B;  1WH7 A;  4A3K J;  4BDY A;  1SC7 A;  4EJV A;  2P6S A;  1FT9 A;  3FXJ A;  1E3P A;  3ABT A;  1Z7U A;  3NWT A;  3DEU A;  5GPA A;  2IBD A;  4IKF A;  5ICC A;  3UKG A;  2KRC A;  5D6E A;  2DN0 A;  4TV7 A;  1FSH A;  2JJ7 A;  4L9N A;  3ZR8 X;  5D5W B;  1RET A;  3BZC A;  2N8G A;  5CQE A;  2M0M A;  2E35 A;  2MGQ A;  2E1O A;  1UB9 A;  4HQM A;  3GFJ A;  1FY7 A;  1S3J A;  1ZKG A;  4U87 A;  2FEZ A;  4A3B J;  1ETX A;  1GV5 A;  3OYJ A;  3BG6 A;  1FTT A;  5GAD J;  3LQQ A;  1R00 A;  3H9Q A;  2NXN B;  1T56 A;  5ICE A;  2LVS A;  1JKP C;  2FJ1 A;  2CGP A;  1MJA A;  3OIP A;  2PJP A;  4AIK A;  2VJJ A;  5ILS A;  2CUF A;  2Y9Y A;  2EFW A;  4JQF A;  3V4G A;  2VJ5 A;  2HYG D;  1P4A A;  1EJ9 A;  1SMY F;  2IW5 A;  1G3T A;  3BC8 A;  1RUO A;  4Y7N J;  1MH3 A;  2WY8 Q;  2XKP A;  3M07 A;  3KYL A;  3GTP J;  3ZOB A;  1YHQ I;  5B3S H;  3H92 A;  3HM5 A;  5CVU A;  2VBX A;  2ESH A;  3A0H C;  4HV6 A;  1IDY A;  1ZG3 A;  3GO5 A;  2CQN A;  2XVC A;  5CKT A;  2KIF A;  1WJF A;  4OMY A;  4BUP A;  4D5C A;  1FBU A;  2D5V A;  3G73 A;  3LSP A;  4A6E A;  1E2X A;  2BHY A;  2LP0 A;  2ZXW H;  2CWE A;  2K4B A;  1IN5 A;  4IRH A;  2HVR A;  3OOU A;  5LBQ A;  1V55 H;  3UNG C;  2DOE A;  2H94 A;  4KT5 C;  2XC7 A;  3M4O J;  2XGD A;  5CVJ A;  4GRI A;  5EGO B;  1X2N A;  3JRI A;  2A6H F;  2KLO A;  1W7P A;  1Z1D A;  1C0W A;  3G2B A;  5FLM J;  3DLA A;  1R4N B;  3LSH A;  2F5D A;  2AS5 F;  4B3A A;  2K9Q A;  1WJ5 A;  2YR2 A;  2QM3 A;  3S2H J;  3A01 A;  1QHG A;  3F8C A;  2JK3 A;  2M8E A;  1ZAO A;  1UG0 A;  2Y0M A;  3F0C A;  2ELK A;  3TO9 A;  3JSP A;  3ML6 A;  2LFB A;  2MC4 A;  4L9T A;  3K70 D;  1JUM A;  1E3O C;  2ZNY A;  2IA2 A;  2VI6 A;  2ZME A;  3F6O A;  1R4M B;  2KJC A;  2QQB A;  5C4J J;  3TDZ C;  2E2J J;  2DJN A;  4Y13 A;  2ZB9 A;  1S7A A;  2DK5 A;  3VYU B;  3CC7 I;  3EYY A;  4OMZ A;  3B02 A;  3WU0 A;  5HLH A;  3L2Q A;  4RAG A;  3B6A A;  3IWZ A;  2VOD A;  2ELH A;  1IAW A;  3S2D J;  5E3M A;  4EM1 A;  4EVI A;  1D8J A;  4P55 A;  3S3N A;  1SVO A;  2Z9O A;  3OWT A;  3OYB A;  2MSY A;  2XSD C;  1Z9C A;  1CF7 B;  1MND A;  3CO7 C;  2IPQ X;  3OL3 A;  4UY8 I;  1BI3 A;  2JRM A;  3CTA A;  5C3E J;  3JRD A;  1FWZ A;  1D3Y A;  2X4H A;  1IN6 A;  2E7X A;  3FKJ A;  2HQA A;  1ZG5 A;  3FXQ A;  2IS6 A;  1R23 A;  3T8R A;  3J7A Y;  3MKY B;  5DTD A;  1FZP B;  4CUG A;  4H4K C;  2DMU A;  1OFC X;  4L0Y B;  3ZQH A;  4CCK A;  4BXX J;  3HJE A;  5EG0 A;  3OR1 C;  4IZZ A;  3VEP A;  1SEU A;  2KP6 A;  1HLV A;  3KYC B;  3DFG A;  4Y33 A;  1BR4 A;  3GZ5 A;  5DCM B;  1KYW A;  4ZJZ A;  3KEQ A;  1B8I B;  1FYM A;  2HOT A;  1HKS A;  2COM A;  3HGG A;  1ZH5 A;  2EIK H;  1YOV B;  1OPC A;  1MBH A;  2JVG A;  2EBI A;  1NK3 P;  2JN6 A;  4BY1 J;  1RPW A;  3MWM A;  1F9N A;  1IN8 A;  3HC7 A;  2Q2E A;  1BOB A;  4BEH A;  1WVR A;  4CH7 A;  2CJJ A;  3PSF A;  3GTQ J;  1D1C A;  2K3F A;  3OS2 A;  5FO5 A;  2M30 A;  2OCE A;  3HGY A;  4NUB A;  3EDP A;  4R79 A;  4PSX A;  2ZO4 A;  4WF2 A;  3LL7 A;  3RIR A;  1IUF A;  3LST A;  3EUK L;  5EEH A;  3ZCO A;  3O2P E;  3SEQ A;  3WTY C;  2EZL A;  3AFH A;  5JHF A;  3GWZ A;  3ESW B;  4M3D A;  3ASN H;  1ITY A;  3HRM A;  1WJB A;  1H0M A;  3K0L A;  1SFE A;  3LAJ A;  2KRH A;  5E1Z B;  2XRO A;  4A3C J;  4XQF A;  2DU9 A;  1PJR A;  3IRQ A;  2CYY A;  1QHH D;  3BR5 A;  4CZZ A;  2PN6 A;  3X2Q H;  1MMG A;  1JKQ C;  4A3E J;  2CUZ A;  2MH2 A;  2M0C A;  1CQT A;  4XN3 A;  2FD5 A;  3I4N J;  2HGC A;  4QPQ A;  5M5W J;  3W2A A;  3U9G A;  2H8W A;  5CYV A;  4NNJ A;  5IOY A;  1F4K A;  2QBY B;  3FBN B;  4A0Z A;  3PNV A;  1ZR4 A;  5F6F A;  5ERI A;  1VQL I;  5FLX K;  3I9V 2;  2Z33 A;  2MBF A;  6PAX A;  4DQ2 A;  1JUS A;  2W48 A;  3KIO A;  4XID A;  1G3S A;  2HDC A;  3JW4 A;  4L9V A;  2HFH A;  1APL C;  1XPX A;  1YIO A;  1HXD A;  1P7I A;  3OIO A;  1XCB A;  3B73 A;  2OAZ A;  4F7Z A;  1MJ9 A;  4ZYE A;  2LKX A;  2M9H A;  4MEY F;  1I5Z A;  4ZH4 F;  4EJT A;  3GME A;  2E36 A;  2R3S A;  2BY1 A;  4BY7 J;  4U88 A;  1ZEL A;  3TP3 A;  4JX6 A;  3HTU A;  5ILU A;  5FFZ A;  2LNB A;  1RKW A;  1T98 A;  5E3N A;  2DA3 A;  1HC8 A;  3H9G A;  1PVE A;  1ZR2 A;  2XPV A;  3DU6 A;  4KA4 A;  5J4Y A;  3SZP A;  5DDG A;  1EH6 A;  3PIO F;  3WTS C;  3RYR A;  2K9L A;  2A5Y B;  5KNL A;  1A31 A;  4HX4 A;  2VQC A;  3A01 B;  4G8X A;  1MJB A;  3ZQF A;  4I76 A;  1RR7 A;  4ZYA A;  2KPM A;  3SDG A;  1O57 A;  2CFX A;  2HKX A;  5L3F A;  4WCG A;  4UVB A;  5K7F A;  4OIO F;  2YX4 A;  2LF7 A;  3HBL A;  3RKX A;  3K70 C;  3I54 A;  4EM0 B;  3DBH B;  3S16 J;  4A3I J;  3K69 A;  3F8M A;  4CCN A;  1XSV A;  5K5O A;  3TO6 A;  1QPI A;  2RGV A;  2HKO A;  1IXR C;  2QYO A;  4KYW A;  5B1B H;  2WA0 A;  2FF4 A;  1TP4 A;  1BC7 C;  4BE0 A;  1H89 C;  3ROU A;  3HKZ A;  4UXN A;  1G3W A;  3LSR A;  4ZDL A;  2E5Z A;  5CPR B;  2ME6 A;  3KET A;  3QPH A;  4D5F A;  2JT1 A;  3BLY A;  2H1K A;  3H3U A;  3K4C A;  4V19 K;  1MSE C;  2R5Y A;  4ZDP A;  2K3P A;  3WTX C;  3H3V K;  1GV2 A;  2HTS A;  4PJN A;  1K6O A;  3FXR A;  2L9R A;  4U0Y A;  3S8P A;  2W4S A;  1G6N A;  2TDX A;  4YIR X;  2HYF A;  3CLQ A;  4CSW A;  4IPA A;  4QLC U;  3GTM J;  2CH0 A;  1S5L C;  2L02 A;  2GXG A;  3OYG A;  5IY5 H;  1TTY A;  3GVA A;  1FC3 A;  2IS1 A;  1DGW Y;  2Z3Y A;  1X3U A;  1MDM A;  3KZZ A;  3CCV I;  1EKE A;  2VBZ A;  3BR3 A;  3JRA A;  1W36 D;  5H2F C;  4Y4R A;  1WQ2 A;  4FET A;  2DFI A;  3HHH A;  2HZD A;  2CMP A;  3TGN A;  3F3X A;  3S2W A;  1W7P B;  2BHZ A;  3OSG A;  4E7H A;  1NG7 A;  4HLY A;  2R7S A;  4A3J J;  3BQZ A;  1X2M A;  4DNC A;  3HG9 A;  3ZQC A;  3MAJ A;  4M9S A;  2V1N A;  2E5N A;  3JRG A;  2VKH A;  3KLO A;  3BPX A;  3GLX A;  1DGR M;  2EV6 A;  1DQU A;  1Y8Q B;  1K7A A;  2YSR A;  4MQV A;  5TJJ A;  5CVI A;  5JLX A;  1O4X A;  2LOO A;  1LJ9 A;  3E5U A;  3K4J A;  4I99 C;  4RLQ A;  3M3Y J;  4A3L J;  2OZ6 A;  2Y48 A;  2D1H A;  3RDI A;  2VJ4 A;  1AHD P;  3LSI A;  3KLN A;  2AHQ A;  4LG3 A;  4UB8 C;  4YFN F;  5FKM A;  3BTJ A;  4BQA A;  1YJ9 I;  2R7U A;  2IRF G;  2DT6 A;  4KIC A;  5BOX A;  4DYR A;  2X1E A;  4BH9 A;  2CU7 A;  4KNY A;  3FIS A;  1J09 A;  4ENK A;  2JA8 J;  2XPU A;  5HLG A;  4HAM A;  2P7V B;  3GEZ A;  5D8L B;  3TW6 A;  4HPQ A;  3E6B A;  1LE8 B;  2WAQ N;  4OU0 A;  3RI4 A;  2FBK A;  1YIJ I;  3VWB A;  1O3R A;  1F5T A;  1LVK A;  2RRE A;  1WKM A;  2F5E A;  1HCR A;  4G7O F;  2KMU A;  1IV6 A;  4UVC A;  4AM3 A;  2JPB A;  2G7U A;  3TBI A;  3TED A;  4O3M A;  5E79 C;  2V26 A;  3CUQ C;  2IGN A;  1D0Z A;  2VQL A;  1ETK A;  2LC2 A;  1FOX A;  1X1C A;  5LEJ A;  1IXC A;  2XDV A;  1QU3 A;  1R71 A;  5IYD J;  1YW8 A;  2DDB A;  2JUG A;  2VT3 A;  2QVO A;  4HNT A;  1R58 A;  2E60 A;  3NRV A;  4OAY A;  1VQ9 I;  3QPL A;  1XDS A;  1TQI A;  2WAE A;  2X85 A;  3H5A A;  4M9X A;  1KA8 A;  2UXX A;  3RJP A;  4DBQ A;  1U3E M;  3A03 A;  2FUG 2;  3DTI A;  3SZT A;  3K7A J;  2K86 A;  4UV8 A;  1W0T A;  3M7G A;  1UHM A;  5IT9 K;  3DQV C;  2CSO A;  1A35 A;  2XAF A;  1ETW A;  4PGG A;  4E7L A;  3E3V A;  1BW5 A;  1UAA A;  2XSJ C;  1SMT A;  4RAZ A;  2C6Y A;  3DPU A;  2PI0 A;  2NNY A;  1AKH A;  3M8E A;  2FOK A;  1MNE A;  2LF8 A;  1W5T A;  2RQQ A;  3PFY A;  4PDK A;  4F93 B;  4ESJ A;  3PQK A;  4ZC3 A;  2ZC2 A;  3VDX A;  5EG0 B;  3DKW A;  3F8N A;  1P7J A;  4HYE A;  1V4R A;  1XDU A;  1AU7 A;  2ZSI B;  1OIS A;  2A6E F;  4I02 A;  1A5J A;  1TT0 A;  1HKQ A;  4CCL A;  4E4H A;  1T6S A;  2NOJ B;  4FT8 A;  1Z05 A;  3JCU C;  4U0W A;  4MTE A;  3CCQ I;  3BG5 A;  2X1D A;  2NAZ A;  4HF0 A;  2A07 F;  4B1R A;  2JSP A;  3K4L A;  1X1D A;  2LLK A;  2HR3 A;  1P6R A;  2VQG A;  5IT9 Z;  2BVM A;  1I1G A;  4EJU A;  1DDN A;  2BY2 A;  2PMZ A;  5H6Q A;  4BS9 A;  4BYY A;  2F5C A;  2Y31 A;  5E3L A;  4XLC A;  2QKM B;  1BI0 A;  1S7O A;  5F64 A;  2HVS A;  3IL2 A;  1HBX G;  1E17 A;  4DIQ A;  2O8X A;  2VJI A;  2AXT C;  3OMY A;  4RM3 A;  3OYH A;  1Y0N A;  2K7L A;  3W6V A;  2P0W A;  1JTX A;  1L0O C;  2GIV A;  3W6K B;  1IRG A;  3AG3 H;  3OYA A;  4IOA F;  5LHH A;  1VQM I;  3H3Z A;  1BA5 A;  4LGW A;  3BJ6 A;  3I0T A;  1WI9 A;  1B9N A;  4BDZ A;  1DUX C;  1H88 C;  2MLG A;  2V9V A;  3DPT A;  4N4O B;  4CIC A;  2P5V A;  3F6V A;  1DP7 P;  3V7S A;  4NB5 A;  3I64 A;  3P9K A;  3BPV A;  3T1B A;  2COB A;  5F08 A;  1IDZ A;  4D0P A;  5DCF A;  1FMV A;  1VTN C;  3HOX J;  3S32 A;  1BIB A;  3C2G A;  4V2F A;  2FU4 A;  3MZY A;  2QGU A;  4D7M A;  5EZG A;  1K83 J;  5E17 F;  1IRF A;  2LR8 A;  1B4A A;  2YPR A;  5HOO A;  4F52 A;  1T8I A;  3C2H A;  3ECO A;  5CLS A;  1TNS A;  3S3M A;  2W84 A;  1U8R A;  4BE1 A;  4ZTF A;  4WXH A;  4NC8 A;  4EEF G;  5IP6 A;  4A12 A;  2QCO A;  1W0U A;  1N78 A;  4IHW A;  2WY7 Q;  4XOR A;  3ZN0 A;  1IF1 A;  5FRM A;  4NC7 A;  1LVA A;  1SFK A;  3I56 I;  4QWQ A;  3I4M J;  2V7F A;  3BZK A;  3BCB A;  2P81 A;  1MBJ A;  3ERE D;  3HUG A;  2VBY A;  1R5I D;  2NVQ J;  1OMI A;  2L7M P;  5IPA A;  2XGX A;  2OC6 A;  3ZMD A;  3IV5 A;  2XKO A;  1ETQ A;  4XRS G;  1ORK A;  2KFD A;  1K78 B;  4RAY A;  5ED4 A;  4KDP A;  5LLQ A;  1N77 A;  1Y1V J;  1U6G A;  2QUF A;  3TL4 X;  4EMS A;  4LG0 B;  1RKT A;  4HSR A;  3ZQL A;  2DA2 A;  3IH2 A;  3BG9 A;  1YX3 A;  1D1B A;  5GP9 A;  2V1D A;  1U2W A;  2PEX A;  4MHG A;  2OD5 A;  2DK8 A;  4XSX F;  2UWM A;  3KP5 A;  5D8K B;  2DMT A;  5J47 A;  2PLY A;  2QEN A;  2MAB A;  2DTZ A;  3GTO J;  4UHT A;  4YFK F;  5HOD A;  4IHT A;  1RZ4 A;  3SXY A;  2VOO A;  4MGR A;  3MN2 A;  2XGC A;  2V6C A;  3NQO A;  2QSF X;  5EDN A;  1X4O A;  1P4W A;  2DT5 A;  4G6Q A;  4L0Z B;  2IS4 A;  3VYS B;  1EV7 A;  4O6J A;  1BM9 A;  3F9K A;  4I01 A;  2XAS A;  4HW0 A;  4BQQ A;  2CW0 F;  2MLK A;  4I98 B;  4ZZD A;  3QYE A;  3F22 A;  5E20 A;  5H20 A;  4AVZ A;  1Y0U A;  4XMY A;  3ZQI A;  5LD2 C;  1VND A;  4UUS B;  1OJL A;  2HPI A;  3WGG A;  3GBG A;  1FBQ A;  1BR2 A;  2A5W A;  3A4C A;  2HOS A;  1LNW A;  1MBG A;  1RI7 A;  3CQZ J;  3RPU A;  5EF6 A;  1YW7 A;  2EIL H;  1BJA A;  5KAI C;  4MEX F;  3EYI A;  1QNT A;  5DD8 A;  2Z5U A;  5J8C A;  1V5G A;  2IS2 A;  5FKL A;  1U9O A;  3F8B A;  5EZH A;  1MNM C;  1VZ0 A;  2D45 A;  1I6H J;  1X1P A;  1O3T A;  5IP7 J;  4RGU A;  3I58 A;  1ZLK A;  3NAR A;  2NS7 A;  5IYB J;  3F8F A;  1BL0 A;  1S8N A;  1QQI A;  2CW8 A;  3HRT A;  3I55 I;  3E6C C;  2FQ3 A;  2KT0 A;  1LDJ A;  3AG2 H;  4AYB A;  4BHC A;  2LKS A;  4RB2 C;  5HLI A;  4K2E A;  3CUQ B;  1ZGJ A;  1XGO A;  3FHZ A;  1E0E A;  1IC8 A;  1JGG A;  4IHV A;  2DYR H;  2L7K A;  2ACJ A;  3DLL F;  1D5Y A;  2FE3 A;  4HF2 A;  2GZW A;  1TW2 A;  1YQA A;  2DI3 A;  2MH9 A;  2TRT A;  1F1Z A;  3J7A O;  1TWA J;  1EH8 A;  4N0B A;  1V5E A;  2EIJ H;  2RV8 A;  3MZH A;  4W1U A;  2VLA A;  5J1Y A;  1UFM A;  1S7E A;  1V3F A;  3V8L A;  2DOD A;  3EUA A;  1ON1 A;  4DGW B;  2DDA A;  3P9I A;  4P96 A;  3ABK H;  2XPW A;  4KFC A;  1FEX A;  1O3Q A;  1R5H A;  5FD5 A;  1HQC A;  1NK2 P;  2NRA C;  4IRI A;  3ERM A;  3F23 A;  1DPU A;  3FXK A;  2VBW A;  5J4V A;  3D1N I;  2GXB A;  3CD6 I;  2UV1 A;  2WTE A;  4GYG A;  4LIV A;  2VC0 A;  5JVG F;  3CCM I;  1YIT I;  4P1W A;  3BP8 A;  3RQI A;  2R7T A;  1W5S A;  1D5V A;  3I3L A;  1FOW A;  3KX2 A;  3WTZ A;  3IH4 A;  4XKV A;  4OAZ A;  4QIW N;  2HPM A;  2X6W A;  1MZB A;  2DO7 A;  1T0F A;  5GPC A;  2MD5 A;  4IHX A;  3E5Q A;  4RB0 A;  4E70 A;  2FMY A;  2CO5 A;  2EFQ A;  3BR1 A;  3FXO A;  4PJ0 C;  3OYF A;  1FOK A;  1ZRE A;  4C2U A;  1P2F A;  1ULY A;  2P6T A;  5M3F J;  4RB1 A;  2IVM A;  3DP7 A;  3G1O A;  2GM4 A;  2KQR A;  3RYP A;  3N4M A;  3CMM A;  4B48 A;  1L3L A;  2GA1 A;  2V9P A;  2GXA A;  1KZH A;  2M7A A;  5IYC J;  5HS7 A;  3GYH X;  1XTA A;  1S9H A;  4C3J J;  1Z0X A;  2ZKZ A;  2LY1 A;  3DCF A;  3R0J A;  4JBA A;  5FKN A;  1P4X A;  2GOM A;  3OYK A;  3PUB A;  1HF0 A;  1AWC A;  2DFH A;  1YO5 C;  4E7Z A;  5KVR A;  3PM1 A;  2ME0 A;  4HG2 A;  3G4S I;  3OS1 A;  4L9J A;  4YEJ A;  2L54 A;  5K1Y A;  2V4J C;  1RC9 A;  3KP2 A;  3HSE A;  2IJL A;  2EZK A;  2ID3 A;  2P8T A;  2EA2 A;  2G0E A;  1OCZ H;  3D5L A;  4IJA A;  4JK1 X;  2OU2 A;  2DA4 A;  4CDG A;  3E6M A;  1ZRF A;  3RSN A;  2ISY A;  4NQW A;  2K9S A;  3OOP A;  4E7S A;  4HX8 A;  3G71 I;  2XRL A;  4LB6 B;  4FX4 A;  1T2K A;  4Q5S F;  2LY2 A;  1J75 A;  2WV1 A;  4JX4 A;  3HOV J;  5B66 C;  2DA1 A;  5B1A H;  1FLI A;  2JA2 A;  2ZJ2 A;  2M34 A;  2X6Y A;  2DQL A;  3WTU C;  2EJR A;  4IEJ A;  3T0Y A;  3AG1 H;  2W25 A;  3QPT A;  1A04 A;  1WPK A;  3G1L A;  2E1M C;  1G8X A;  3Q9S A;  3QPS A;  2XUB A;  4IXA A;  4M6V A;  4QSH A;  5L3D A;  4ESB A;  3LA7 A;  1LEB A;  1KYZ A;  3LSJ A;  1PUE E;  3GZN B;  1SFX A;  3MVP A;  1TC3 C;  4EGY A;  3PO2 J;  3FBI B;  3RKW A;  1K6Y A;  3K1M A;  2LKP A;  2CV0 A;  2Y75 A;  2LBF B;  3VSK A;  1ZYR F;  3OYM A;  1XGS A;  1ETO A;  3FXU A;  2VUM J;  4AU7 A;  3J7Y J;  1FYL A;  3W6J B;  3Q0V A;  4IO9 F;  5J40 A;  4F91 B;  3OYD A;  1P92 A;  1UHS A;  4CYC B;  4ON0 A;  3P9C A;  5EJC A;  4J00 A;  2XAJ A;  4I0A A;  1U5T C;  4UNO A;  1H8A C;  3FF5 A;  1ZAR A;  3M1C A;  3CCY A;  4BXU A;  5F0C A;  3CUO A;  2YU3 A;  1I27 A;  4I09 A;  1YG2 A;  3IRR A;  5BPD A;  4XRM A;  1B72 A;  5CVR A;  2PX9 A;  1OYI A;  2LYC A;  2XAH A;  2KZV A;  3J80 K;  4OWR B;  1ZRD A;  3OYN A;  1B9M A;  1MMA A;  5EEG A;  5F1J A;  4UUT A;  2JWT A;  1Y6I A;  5EEA A;  4G7H F;  3S93 A;  1MMS A;  1JKO C;  2K4J A;  2QZ8 A;  2MD0 A;  3DEW A;  3LA2 A;  3EUH C;  3L2R A;  1UST A;  3A1Y A;  1MBK A;  4DZJ A;  2W57 A;  5FGM A;  4O5V A;  4BGD A;  5LFA A;  2MYS A;  3GZ6 A;  2KIQ A;  3DBR B;  2QA4 I;  3MKZ A;  3L9F A;  4A3D J;  5IT3 A;  2HTJ A;  2ZNZ A;  3D5S C;  2IA0 A;  1XD7 A;  2EZH A;  2HS5 A;  1TZL A;  4XLE A;  3GCM A;  2EK5 A;  2O03 A;  4XKC A;  4MIM A;  3KEY A;  1MBE A;  4XR6 A;  3W3C A;  2LTP A;  1FOY A;  3JR9 A;  1ZGW A;  4LB5 A;  2HI3 A;  3BRO A;  5B5E C;  2XF6 A;  4MFD A;  3HHG A;  4HQE A;  3CP8 A;  3O6B B;  3HL2 A;  4LLL A;  2R5Z B;  1FSE A;  5L3E A;  4M71 A;  1Z67 A;  2P4W A;  3Q9V A;  1PP8 F;  1X4P A;  1Z91 A;  1JGS A;  2DYS H;  2E1M B;  4G12 A;  1SD6 A;  1QRY A;  2P5L C;  2WB1 A;  1V54 H;  3V8K A;  5D5X B;  1QZE A;  3AG4 H;  3SQN A;  3DWL E;  5DYM A;  2VIX A;  2R7V A;  1OCT C;  4C2M J;  1VF9 A;  3K4B A;  4HA8 A;  3K4K A;  2F2E A;  3O8G A;  4G9Y A;  3U21 A;  2EIM H;  2ISZ A;  4Y17 A;  2PJR A;  5E1W A;  3S1Q J;  2D2W A;  1B59 A;  3MEX A;  1GDT A;  4XM3 A;  2ZBK A;  1VFC A;  1VQ6 I;  4Y52 J;  2ADU A;  1NTC A;  3I4P A;  2M1B A;  1Z7L A;  3G3Z A;  5JHU A;  3ZPL A;  2NS8 A;  1OYW A;  2LD5 A;  2W24 A;  3K4N A;  4XN0 A;  3RPU D;  3QOE A;  2DT7 B;  3SZG A;  5GAH J;  2VB6 A;  4FX0 A;  3VB2 A;  3TOB A;  4YEL A;  2VON A;  2A69 F;  4FE7 A;  5FKO A;  2D1V A;  2WAF A;  5BS6 A;  5HNH A;  1WSU A;  1KU9 A;  1YS7 A;  1GXP A;  3ABU A;  3E5X A;  3FDY A;  4M9Z A;  4ZYD A;  1DU6 A;  1ZLJ A;  2EA4 A;  4BBR J;  1RUN A;  4NQW B;  1GVD A;  2BY3 A;  3EPZ A;  2H09 A;  1FIP A;  4XRS A;  3HKZ N;  3F72 A;  2K85 A;  3BQY A;  4FE4 A;  2ZJQ F;  1RRJ A;  1R49 A;  4C3I J;  4WWC A;  2B63 J;  1OQY A;  1HA8 A;  1TWC J;  1T95 A;  2Q8K A;  1KU7 A;  2BV6 A;  3ZP5 A;  2B9S A;  3CC4 I;  1KQ0 A;  1LEA A;  3TMO A;  5HS8 A;  1LUJ B;  2HEO A;  2CUE A;  1OYY A;  1QGP A;  4GDF A;  2OQG A;  5FJ8 J;  1JHH A;  4XK4 A;  4DW6 A;  5M3M J;  1RNL A;  4G6T B;  2XRN A;  1S72 I;  5BQT A;  2Y9Z A;  2E2H J;  2IAI A;  1B6A A;  1MW7 A;  2XHK A;  1JJ6 C;  4KT6 A;  2R93 J;  2NOG A;  5AIP A;  3DPL C;  4HLX A;  3SFI A;  3ZQ7 A;  5L3C A;  4PJL A;  1JT0 A;  5GAE J;  2OPT A;  2JMW A;  4KMF A;  1MDM B;  2O61 A;  2L7Z A;  4Y15 A;  1H9G A;  2RC4 A;  3BTL A;  2F6C A;  3IKT A;  2XV4 S;  3KE2 A;  1UMQ A;  3ZMU A;  2MA3 A;  2BOL A;  3V42 A;  2NYX A;  1QBJ A;  2IGO A;  2VT2 A;  4WK8 F;  1WZ2 A;  4I7H A;  2IP2 A;  3QWL A;  2KDZ A;  3AL0 C;  1I50 J;  2XAQ A;  2UXN A;  3S1M J;  3HSF A;  1QZY A;  1WJE A;  1PYV A;  4QTR A;  1J59 A;  1P9Q C;  2R7X A;  3DBL B;  5DV5 A;  1B72 B;  4FIS A;  2KL4 A;  1JI8 A;  3CZ6 A;  2NVY J;  3OYC A;  3RZO J;  2I10 A;  4S04 A;  3KP6 A; 
#chains in the Genus database with same CATH homology
 3J7Z I;  1VQO I;  5GAG J;  2NXN B;  1VQP I;  3CC2 I;  1HC8 A;  1YIJ I;  1ACI A;  1FOY A;  3DLL F;  3CCU I;  1MMS A;  3CCS I;  1Y39 A;  1VQ5 I;  1VQL I;  3I56 I;  3CCE I;  3CJT B;  1VQ6 I;  1YJN I;  2ZJR F;  3CD6 I;  4IOA F;  1VQM I;  1S72 I;  3PIO F;  2K3F A;  1YJW I;  5JVG F;  1VQ7 I;  3CC7 I;  3CCM I;  1VQN I;  1YIT I;  4IO9 F;  3PIP F;  2FOW A;  1QA6 A;  2OTJ I;  3G71 I;  2QA4 I;  2OTL I;  3CCL I;  4V19 K;  2ZJQ F;  3I55 I;  2JQ7 A;  3CF5 F;  1FOX A;  1FOW A;  3CCQ I;  2E35 A;  5DM7 F;  3CMA I;  1YJ9 I;  2E36 A;  1VQ4 I;  5DM6 F;  3CCR I;  5GAE J;  1YI2 I;  5GAH J;  2ZJP F;  3CC4 I;  3J7Y J;  2QEX I;  3CCJ I;  3G6E I;  3G4S I;  3CME I;  1VQ9 I;  3CCV I;  1VQ8 I;  5GAD J;  2H8W A;  1VQK I;  4UY8 I;  2E34 A;  1YHQ I;  4IOC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...