3A4CA

Crystal structure of cdt1 c terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
RCPEQELRLQRLERLPELARVLRNVFVSERKPALTMEVVCARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLHRIRTDTYVKLDKAVDLAGLTARLAHHVHAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle, replication
molecule keywords DNA replication factor Cdt1
publication title Structure of the Cdt1 C-terminal domain: Conservation of the winged helix fold in replication licensing factors
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1420 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3a4cA00
2KLOA 2RQQA 3A4CA
chains in the Genus database with same CATH superfamily
1VQNI 2ID3A 4BEHA 1IGNA 2X6WA 5D8LB 5JLWA 1WFXA 5BNGA 1VQ6I 3UNGC 2LNBA 2XF6A 3K1PA 2ID6A 4BXUA 2HZDA 4C2MJ 3W3CA 4RB2C 2FBIA 3OIQA 5CYVA 2VKDA 1MMAA 3HPGA 3PIOF 3CCYA 4WCGA 1ETXA 2IGNA 2EBIA 2PN6A 5FGMA 3S1NJ 1ZTRA 3FMSA 3A03A 2W1OA 3S32A 5DCFA 3S2HJ 1ZAOA 3ZR8X 4KN4X 4ZYAA 3RTRA 1U5TA 4A12A 3ABTA 4OINF 1B9MA 5M3FJ 2E1CA 2P7VB 2X1CA 1MBKA 1ZN2A 2GOXB 4AIKA 3ZQLA 1RR8C 1E17A 1Z1DA 5GP9A 1ZG1A 4BNCA 5BMZA 1RNLA 5C3EJ 1J0RA 2GAUA 5CKTA 5F1RA 4ANJA 2FX0A 2A61A 3NARA 3RZDJ 4RGRA 1R4MB 2HGCA 2NYXA 3GXOA 2K9QA 3VFZA 2RC4A 4JOMA 4ZZDA 1G2HA 1QHHD 4HF1A 2EIKH 1OPCA 3H5AA 1O3TA 3KEQA 2DA7A 2IPQX 2CO5A 2FXAA 2BY1A 5L3GA 4KMFA 2QZ8A 3CC2I 3Q9VA 4R1HA 4C2UA 2PJRB 1R58A 2RNGA 4PJLA 2JSCA 1PUFA 4L9JA 2D45A 1B1BA 5B66C 1KU7A 2L0KA 2HR3A 1HDDC 2FNAA 4EGYA 1YLFA 3QRFF 3CDIA 2O61A 4A6EA 3K1MA 2EH3A 3G1OA 3FXRA 1A6QA 2LC2A 3H3ZA 5E3NA 4MTEA 1RUNA 2DMPA 4YFXF 4MNUA 4OIRF 2KIMA 2DU9A 1BC7C 3KEYA 4L5JA 1A35A 2V6EA 1MD0A 5JHUA 1WRJA 1SC7A 2JSPA 1DU0A 4XR6A 3I64A 3PJRA 3HOXJ 3FX3A 3I5UA 2Y2ZA 3WTSC 1N77A 5J40A 4AC0A 1BI1A 3ONQA 2HXIA 3QPLA 3QP6A 1G3WA 2I8DA 2DI3A 2PMZA 3J7YJ 5J8CA 2IW5A 5LFAA 2HYJA 2QVOA 1TWFJ 2DA6A 1X1PA 3OYKA 3D5LA 3JRGA 4HG2A 3WGGA 1W36D 4N4NB 2JWTA 2VBZA 3SZPA 4IHVA 5BQTA 3M1EA 3Q5FA 1OQYA 1WPKA 1S7AA 1USTA 1WJEA 2EFOA 2EQRA 2KPMA 5DYMA 1GDTA 3W2WA 4X0GA 1MMSA 2RREA 3HTSB 3HDDA 3KETA 2F4OB 2GA2A 5EDNA 4IF4A 4FX4A 3PQKA 4KIFA 3OIPA 2K5CA 1PVEA 1MH4A 1ZKGA 4IEJA 2PEXA 1XB4A 3L2RA 2CQNA 2KLOA 2OF7A 3CCRI 3L00A 1H89C 4LIUA 2RVCA 3TOAA 5J6XA 2M2EA 4HRIA 4WF2A 2JA8J 3C2HA 5DTDA 1H9GA 2HXOA 1FY7A 4A0ZA 4LD5A 3TL4X 4DBRA 1X1CA 2HTSA 1T39A 4LGWA 3I53A 2FOKA 4A3MJ 3V7CA 2DXIA 3BJ6A 3NEUA 4PDKA 2F5EA 3ZN0A 3PFIA 3G4SI 2L9SA 4ZYDA 1W7PA 1ZRCA 4MQVA 5J1UA 1B59A 1EH6A 3ZRGA 2BGCA 1N78A 2L7KA 5EYRA 4BHPA 2F48A 3J81Z 3ZQHA 3GTLJ 5DD4A 1X3UA 1BR4A 2MH9A 2CUZA 3K6GA 5CJ9A 4CH7A 1RR7A 5IPAA 2ZKZA 4ZTJA 4UV9A 3A01B 5DD8A 1LDKB 3TEDA 2QQAA 2KZGA 4F55A 2P5LC 1I3AA 3GFJA 3HGYA 5D4SA 1FOWA 1VQ7I 1ETQA 3S3OA 1NG7A 2O3FA 2XPVA 2F2EA 2DOFA 1GVJA 3PIPF 4UUSB 4I0AA 2XKOA 3WODF 3TW6A 3JRIA 1EH7A 3KPHA 5EEHA 2VC1A 3H3UA 2NNNA 1ON2A 4PJJA 1HKSA 4RS8A 2JA2A 3S93A 2MABA 2IBDA 3GO5A 3SYTA 3K4CA 4QSHA 3CC7I 3QODA 1Z3YA 1EF4A 2X85A 4BHCA 2JTVA 2QKLB 3KYDB 1SANA 2O0YA 4AU7A 5D5VB 5IYBJ 3DCFA 1X2MA 3IL2A 3EUHC 4GFBA 4KT5C 3RKYA 4EGZA 4F7ZA 1QRYA 4XOTA 1U8BA 5IP7J 4HQEA 1MBFA 4A3IJ 4EMSA 1R23A 2YU9J 1SD5A 1CGPA 2STTA 2X6OA 5KK1A 2JUGA 1AKHB 1VQKI 2DYRH 3HM5A 1YX3A 4L5IA 2O03A 2CFXA 3K4BA 2NVXJ 1FYMA 4YRVA 4NDLA 1B72B 4BJ6C 5H2FC 4R79A 3TOBA 2JMWA 3S16J 2W24A 2M7BA 1FBSA 4UB8C 4BBSJ 1Z91A 2DA2A 2CQ7A 3F6OA 4UHTA 5LGUA 2E5NA 2JVHA 4CZCA 4A6DA 4L0ZB 2Y0SA 2K4BA 3KLNA 4A69C 3H5RA 2VUMJ 3PNYA 4I7HA 2RN7A 3ZQFA 2ELHA 3MKWB 1U5TB 3AG1H 3B02A 5HS7A 5J4VA 1LFPA 5TISC 3S8PA 5HNHA 3UKGA 3V7RA 1MDMB 5LEKA 2IA1A 5CPRB 3LSPA 3NWTA 5C4XJ 3DKWA 1LPQA 4OWRB 3BPVA 1QGPA 4L5EA 5CLSA 2HQ5A 2XRLA 2QF7A 4AYBN 3QWLA 1ZRDA 3ZPLA 2R7VA 2X6YA 4DYRA 3OYIA 2R7XA 4ENMA 1IN4A 3FK6A 3BZKA 3JW4A 4LOCA 2CW8A 3GFLA 3VB2A 4XKWA 1YRNB 1TQMA 3CCSI 1P2FA 4IHXA 1ZGWA 2VI6A 4I98B 4EATA 1SD4A 1PDNC 2HDCA 2M9HA 3LAJA 1F43A 3SZTA 1MKMA 1NK2P 4XLEA 1Z21A 3DBLB 3NRVA 2GXAA 2ECCA 5B1AH 2IRFG 5M3MJ 1LE8B 3OS0A 5HODA 1OISA 3Q9SA 2MC3A 4UY8I 4B47A 3PO2J 1ZLJA 1VI0A 3M8EA 3V42A 2GOMA 3CESA 3K1NA 2GIVA 2JRMA 2CWEA 1MMNA 2OJED 3EUHA 3GTOJ 2ME6A 4EM1A 1R36A 1F1ZA 2MFZA 3ABUA 2EJRA 2VKHA 3DKYA 3L2WA 1M1EB 2WWYA 5GAGJ 2L4AA 3VEPA 5DV5A 1R1VA 1LQ1A 1CF7A 1H0MA 2KIUA 3F3XA 1JTYA 2WAEA 3DEUA 4G6QA 4PUSA 4BUPA 4M74A 2VLAA 4IO9F 2ZXHA 3VPRA 3IAS2 2GA1A 1TT0A 3HC7A 4F91B 3OR2C 1XGMA 3OOPA 1BW6A 3GW2A 4XKBA 1UELB 1G6NA 3WG7H 1SEUA 3V8KA 5ILVA 2WAFA 5EEAA 4ESJA 2R5ZB 2EA4A 3K2ZA 2DTRA 3ZOBA 1XSDA 1KU2A 4XRSA 4M3FA 1FZPB 3DPUA 4NNJA 4EJWA 4OIPF 2LP0A 2A6EF 3OYFA 3VDXA 3GTQJ 2DA1A 1MSEC 2F4MB 5E1ZB 4QWQA 2L7FP 3ZMUA 5CVIA 5H6RA 5GPCA 1KQ0A 2UWMA 2YS9A 1JUMA 3FXQA 4YFKF 1V5GA 2FJ1A 3IRRA 3HYIA 3T5XA 1D1CA 3W2VA 3DXJF 3HHGA 3U9GA 1FOKA 4KISA 2QSHX 3WU2C 3KFWX 3E3VA 2VOOA 3OYDA 2JT1A 2QUFA 2KMUA 4NBQA 4ZH4F 5E8IA 3I3LA 1NHAA 1XSXA 2CG4A 2KDOA 4BYYA 1ITYA 2DAOA 3H9GA 4AM3A 2BV6A 2EFNA 2VQGA 1GXQA 2G7UA 1RC9A 2DPUA 4IRHA 1QZEA 2Y9YA 3QQAA 3AFHA 3HTUA 2YSRA 4JK1X 2BOLA 2OQGA 3HSFA 3GFIA 4JBAA 5FRMA 3G73A 4WXDA 3ABKH 2MD5A 1R49A 1BOBA 1OLTA 3GMEA 1Z6RA 2F5FA 2XAJA 2PJRA 2IP2A 3A0BC 4HEA2 1FOYA 3LSIA 3REOA 3B6CA 1D8KA 2Z33A 3I58A 2LY1A 4M9SA 2AQEA 4EV0A 1OCOH 3KE2A 1J5YA 3FWEA 1FTZA 3CF2A 3BQZA 1VQOI 3TKYA 2DPDA 1HSTA 2ZSIB 3K70D 4XKCA 4C3JJ 3S3NA 1LUJB 1OR7C 2DMUA 2IS4A 4XN0A 3KP4A 1D1BA 1YYVA 2OAZA 2DDBA 1QVUA 2UXNA 4XL9A 5F0CA 2FU4A 4KT6A 4ZYGA 4DNCA 5GPAA 3QOEA 4YIIA 5E20A 5F08A 3BCAA 3ZMZA 3MFKA 2H8WA 2HVQA 1XN7A 3BG3A 3R61A 4HAMA 4XLPF 2QM3A 3I4MJ 3RPQA 4BH9A 1KYZA 2X9DA 4WXHA 4HDUA 3K4KA 4U88A 1BN5A 1I39A 1Z77A 2IJLA 2R7RA 2X51A 3CCEI 1Z7LA 2K9SA 1IXRC 4BGDA 2Q8KA 4CCLA 3KCCA 3I4NJ 2VODA 3M4OJ 2W85A 3IP4B 4KYWA 2JA6J 4QIWN 1QHGA 1FTTA 1V3FA 3TDZC 1VFCA 2Y69H 1HA8A 3OOUA 4DGWB 3SDGA 4V2GA 4U0YA 2L54A 3CP8A 4M9ZA 4UUTA 5FKKA 3S1QJ 1HW5A 1TW3A 1WJFA 2ZSHB 3TDUC 3CUOA 3ULQB 1X58A 1IUFA 1IN7A 1IN6A 3ZQGA 1SVOA 1D3YA 1LDDA 2FOWA 2R5YB 3MKYB 2IS1A 2CQKA 4B3XA 3NWSA 2M0CA 3VSLA 3S15J 4HZFA 2HPIA 2DT6A 1VQ5I 2OPTA 2XAQA 3QYBA 1X19A 2FUG2 4XM3A 1ERDA 1HKTA 1R7JA 1ZG3A 3L2CA 1SFEA 3K4NA 3HOUJ 4U87A 4L9NA 2YX4A 2IGMA 3CLQA 2Y48A 2QENA 1TWAJ 2I5UA 1EJ9A 4M3GA 4C9YA 1YW9A 5D5UB 2DA5A 2DW4A 1FSEA 4BU2A 3J80K 4O5VA 1TTYA 5F0FA 1QQIA 2HTJA 1XDSA 1SD7A 2MLGA 3R0JA 4IJAA 1ZHFA 1OR7A 2J5PA 2R7TA 2OQRA 2R7FA 2WB1A 4MFDA 2MLKA 4UB6C 5IOZA 3PUBA 1JHFA 4LK1F 1UHSA 3A01A 2XF5A 4EVIA 2NOJB 1QBJA 4V2FA 3F8NA 3FXLA 2K9NA 4DJAA 2YX7A 2XV4S 1OCTC 4HLXA 3T0YA 1F4KA 3DEWA 4M73A 4DQ2A 2GXBA 2XF7A 2E2JJ 1W5TA 1F36A 1XSVA 2BW3B 3K69A 1A5JA 2D2WA 2D1VA 4ZYHA 2AXLA 4L9VA 4UVAA 3DP7A 2V26A 3GLLA 3L1PA 2WV0A 2K9LA 3K70C 5D5WB 3R4KA 3H36A 2BVMA 1ZARA 1X4PA 3R6SA 4ESFA 1BI3A 1JUPA 5LEJA 2K40A 1E2XA 1TQIA 2CV2A 2VE9A 3JAMZ 3FXMA 2Q2EA 3G2BA 3LA7A 2DYSH 3E6DA 2ETHA 5IOYA 2BHZA 3DPLC 2FA5A 4I2OA 1NG6A 1XCBA 4XMYA 1ZR2A 5F1JA 5EJCA 2HVSA 1Y39A 4W97A 1AKHA 5KAFC 1O3RA 3ZP5A 4P1WA 3QU3A 4HX7A 3HB9A 3GX4X 1DGWY 1G59A 3BLYA 3G1LA 3E5QA 1MNMC 3BR3A 2QEXI 5AONA 3RQ4A 3VYUB 1B72A 3IUOA 4AUXA 2K27A 1UMQA 4CCNA 2R7OA 1B8IB 3P5JA 2PG4A 4N9HA 2JA5J 1LEAA 1ZG5A 2HDDA 2DFIA 2XDVA 3IH3A 5K7FA 3QPHA 5K5OA 2P0WA 2PQ8A 4XIDA 4KITB 2V1NA 3E6CC 3G3ZA 4AIDA 5LBQA 1RETA 2LKSA 2WAQA 4LFUA 1ZELA 2MA3A 4S05A 1KA8A 4A3KJ 1MDMA 2RNJA 2HU9A 3FKJA 2VC0A 3AG2H 3OR1C 2DDAA 2L01A 5FKMA 1W0UA 3HOYJ 1V55H 3LSHA 3FXOA 3EYIA 4UNOA 2XIGA 1R9TJ 4XK4A 1FMVA 1SVLA 1ZK8A 4IOCF 3OMYA 3LMMA 5DCMB 2R93J 3WGHA 2LKXA 4JX4A 4ON0A 1IZ1A 3VSKA 2OCEA 1PP7U 3Q0VA 4UVBA 2ZFWA 3BR0A 2PI0A 2X0LA 1YRNA 3BROA 1WVRA 3HKZA 3ERMA 2HNHA 1S72I 2OU2A 9ANTA 4HV5A 3BJAA 4GXOA 1F5TA 1YW7A 3BR6A 2CQQA 2HOTA 2WV1A 4W1UA 4D0PA 2K86A 3VWBA 1V54H 5D5XB 2LBFA 3IKVA 1LE8A 4UUVA 3LA3A 1KZHA 3OYBA 4ENJA 5JVTA 1XGSA 5IYDJ 2NVYJ 4XICA 4A0YA 4ZZLA 1V4RA 4OOIA 4RGUA 3O8GA 2HOEA 2XAHA 1QPIA 2EPFA 3RZOJ 1UCRA 1WJCA 2P6TA 2HQRA 2PMZN 3LSTA 2CQXA 4L9TA 4X1EA 3KZIC 1NK3P 2DMNA 2KKOA 2NXNB 2QSFX 3FMRA 2NVTJ 1TL8A 4AIHA 2HOAA 2JRTA 2HVRA 3MAJA 2FE3A 4G6DA 3CF5F 3N4MA 3HSRA 2JPCA 1IXCA 2LK2A 2W57A 2COMA 1JT6A 3RKWA 3M1CA 4LLGF 4QPOA 2V9PA 1GV2A 4IQJA 2N8GA 3EYYA 3RQIA 4HYEA 2VIXA 1IRXA 2RV8A 3ZGKA 1SAXA 4MLOA 4CDGA 2D1HA 2PFBA 2QQ9A 4C3HJ 1I1GA 3G1MA 4D5CA 5B1BH 2R5ZA 4NQWB 1JXSA 1AHDP 5E18F 2P81A 1HF0A 3V7SA 1ON1A 4BY1J 1D0XA 3OYNA 3BJOA 5TGTA 2VN2A 3MCZA 5DDGA 2GWRA 3VYRB 1OJLA 4N4OB 3ZMTA 1K83J 1JKQC 1TNTA 1IV6A 2IS6A 4PSXA 3DEEA 2LF7A 4DZJA 2FNPA 1OKRA 3RIRA 2E5ZA 4RB1A 3C3WA 6PAXA 2DODA 3DTEA 1WJDA 4PK4A 1VQPI 3RKXA 4HLYA 1MBHA 2UXXA 3CP2A 3CUQC 4LJZF 5EZGA 1K61A 1LFBA 2A5WA 1MJBA 1V5EA 2H27A 4LB5A 2F4IA 3CQZJ 4G7HF 3KEOA 1W4MA 3CJTB 4HPQA 2M34A 1IC8A 1YITI 1J09A 3U21A 2L2OA 1USSA 2COBA 4XN3A 3R60A 2PJPA 4U0VA 1U8RA 1HC8A 5JHFA 5J47A 4U7DA 1DP3A 4BJ5C 5J8FA 3CJRB 4R8HA 4ITVA 2FBKA 2MD0A 3ELKA 3LL7A 3D0SA 3WTUC 2KQRA 1UJ8A 1Y8RB 2HI3A 3BT9A 1WKMA 4PCQA 4S04A 3N97A 4A3JJ 3BZ6A 3JRBA 4H4KC 2F5CA 1HSJA 4OMZA 1IV8A 1XMXA 3KX2A 1GT0C 5BPIA 2ME0A 2Y31A 4DZPA 1FIPA 4XLNF 2OUMA 2G9WA 2I10A 3DQVC 5TJJA 4RBOA 3BDDA 3CO6C 4RB0A 3F8MA 3O6BB 2A68F 4XLAA 5L3BA 1FBUA 1PYVA 2ZJQF 1T2KA 3MKZA 2XPUA 3FHZA 2P7CB 2E7WA 1LVKA 4HNVA 2UZKA 3OYCA 2K4JA 4M3DA 5ICGA 1VQMI 3IAM2 2ICWG 1R71A 1MNEA 1DPUA 2DOEA 2HFHA 3ABLH 3C2BA 3LOCA 3PSIA 4MIMA 2H8RA 2OZUA 1VF9A 1HDPA 5HS8A 2VQCA 3QOPA 1SAUA 1VQ9I 2Y30A 2O7OA 1FPQA 4G7ZF 1ZH5A 4J19A 2NS8A 1TQPA 2F6CA 2EV0A 4Y4RA 4RM3A 3U1DA 2BY3A 3CCQI 3ABMH 2Q0OA 3PFYA 2G7HA 2FSWA 4BBRJ 5HLIA 4I99C 2DT7B 3FIWA 2BXZA 5IT3A 4BJTA 2Q2EB 4AIJA 4HDVA 1D0ZA 5FFXA 1NTCA 2E1MC 3TQNA 1VQLI 2XASA 2H94A 2M5WA 2F5VA 2GM4A 3MZ8A 1ZRFA 2F5DA 3ASOH 3EQLF 5E17F 2HYFA 2EIMH 2MC4A 4MO7A 1S7OA 5AIPA 2VQHA 3HRUA 5BOXA 1GVDA 2RKHA 1RKTA 3JTGA 1WZ2A 2V9VA 4BDYA 5BS6A 3DWLE 2Y0SN 3CUQA 2IAIA 3E1SA 3SEZA 3DTKA 3GCMA 2R3SA 1X2NA 2XGDA 3KP3A 3TO9A 4WWCA 1UHMA 1XD7A 2EIJH 2ZMEB 2CFOA 2OZ6A 2KFDA 2QBYA 1Y0NA 2GZWA 1A36A 1HLVA 1FNNA 1KONA 1GHCA 5FLMJ 4FTHA 3S3MA 1BBYA 1WCMJ 3JCUC 3ZQCA 1R5HA 2R5YA 5JI6A 5JR3A 1ETVA 3E6BA 2FRHA 2R7SA 3VOEA 4P5OA 1HCRA 5L3DA 3CO7C 2DCEA 4P9FA 5KCMA 3U1KA 4IHTA 4YEJA 3WU0A 4E7KA 3HOTA 1PP8F 4A3GJ 5BPDA 3FZVA 1TP4A 2M3AA 1Z3XA 1REPC 4V19K 2L5QA 2X6XA 2LREA 4KIGA 4O6JA 2FQ3A 4CA0A 2ZJRF 2QLZA 1XDUA 1G3SA 1LVAA 3RYPA 1T56A 2H09A 1MMGA 2HDWA 2PX9A 2Z3YA 3F6VA 3IKTA 2V4JC 1TWGJ 3RDIA 3CJQB 3ASNH 4CYDA 1BIAA 4IKFA 1IJWC 4FETA 3L09A 2P5VA 3ISPA 1BJZA 1JHHA 4IZZA 4MEXF 1D5VA 2VPRA 3H1CA 2FF4A 2EFPA 1U78A 1MNDA 2EFWA 1Y8QB 4XSXF 5J1RA 4I6ZA 3ZN1A 3M7GA 4RAFA 4IQ4A 1LFUP 4G9YA 3ZXSA 3E0JB 5FRNA 2K9MA 2X48A 4XLFA 3NAUA 1BL0A 1MGTA 5ILUA 2VOPA 1ZREA 1O57A 4U0WA 3QPTA 1TZLA 2LBFB 3CCJI 3PO3J 1JJ6C 2BVLA 4FE7A 2PMUA 2XSDC 3OL4A 2BW3A 5FD6A 4E7LA 2AHQA 2V6CA 3VYSB 4BQNA 1ETKA 3RI4A 4KUMA 3TMOA 2M8EA 3RKQA 5E1WA 5E8GA 1K4TA 4A3LJ 5FROA 1VTNC 2HKXA 1XMAA 4AYBA 3I55I 5HLTA 5IT9K 5JLXA 2K3FA 4D7MA 1WH7A 5F64A 2NOGA 2KZVA 3F9KA 3CMYA 1ZR4A 2ISZA 2KISA 4C30A 2Y9ZA 4FT8A 2K7LA 5IYCJ 1YW8A 2GIZA 4BE2A 2A07F 2CMPA 1I50J 2XSJC 3E5XA 4I76A 2EV5A 1JKOC 1P4XA 3WTXC 2BXYA 1YOVB 5KNLA 1APLC 4A5MA 4GYGA 1TC3C 4I09A 4FX0A 1U0JA 2O9LA 2Q1ZB 4E7JA 2Z2SB 1ODDA 4JYKA 3M3YJ 1YJNI 4EM0B 3GZ5A 3LSKA 3MQ0A 1QZYA 1L3LA 2GBYA 3VYTB 1DU6A 1QNTA 2V1XA 2WY7Q 4CCJA 3RYRA 1FWZA 4HBLA 1ORKA 2YU3A 3GTJJ 1H8AC 1YG2A 1A31A 3BZCA 4FASD 1B8IA 3HSEA 2XAFA 3BTJA 3T8TA 5C44J 2VJJA 5DM6F 4LITA 1X3ZB 3FM5A 4A3DJ 3A4CA 3CCUI 3LA2A 2G0EA 2W84A 3TGNA 1ZLKA 1YX5A 4HQMA 5HLGA 3HOWJ 5F04A 4DYCA 2L7ZA 2V7FA 2YUSA 1IN5A 1WSUA 3QAHA 1A6IA 1R6RA 1IW7F 2ADUA 4CHUA 2KIFA 5EZHA 2DO7A 3KP2A 4MFEA 2VBXA 1U9NA 2VE8A 5B3SH 2AO9A 5FD5A 1T38A 5D4RA 2LSOA 3ZQIA 3O2PE 5DCMA 4C3IJ 2QGUA 1BI2A 3SDBA 3OYGA 4BDZA 2BY2A 1R22A 2IS2A 2FQ4A 5EGOB 1TT5B 2L02A 2ELKA 1ZYRF 2JVGA 4Y3OA 3ZMDA 3BTIA 4LG3A 2VT3A 2MW8A 4MHGA 2VB6A 4ENKA 1J59A 3GTMJ 1XCVA 2R4GA 4B8XA 1AU7A 2L9RA 3E5UA 5L3CA 1J75A 1K6YA 2CW7A 3H9JA 3OYJA 1FJLA 1O7FA 2DMTA 3F8BA 1TNSA 2L3DA 2ZO4A 4OMYA 3HOZJ 3GYHX 4XRFA 2M7AA 1IF1A 2YPRA 4ZTFA 4Z2YA 5HDNA 2LRDA 1KQ8A 2XUBA 4N0BA 2VJ5A 2FMYA 2OD5A 3GF2A 3K4LA 3GWZA 4YG2F 3TO6A 1HOMA 3ZQQA 4AWXB 2D5VA 3BWGA 4E6KG 2MBFA 1S9HA 2XAGA 4XLCA 4HNUA 2L4MA 3JRFA 1Z9CA 1ETOA 1D8JA 2KRCA 3Q0WA 3K0LA 4NC8A 4QTRA 2CS3A 4WK8F 4II3A 2GQQA 1W1WE 4LK0F 4EM2A 5F0HA 1O7LA 3OL3A 1GLNA 1T98A 3JRDA 3BG7A 1K7AA 3V8JA 3BR5A 2P5KA 4IRIA 3KYCB 1IRGA 2NNYA 2ZB9A 1DPRA 3SHFA 1YFHA 5ILSA 1AWCA 3F8CA 1KYWA 4XRMA 3F22A 1K4SA 4RM2A 1RUOA 3B6AA 4NQWA 1WJ5A 3CUQB 2GLOA 4IXAA 4FE4A 1U3EM 2V79A 4A3BJ 5F27A 2K02A 2KP6A 2K3PA 2LH9A 2QBYB 3LWFA 1N75A 3SZGA 1ULYA 2WY8Q 3H0GJ 2L9NA 4OIQF 1UG0A 1Z67A 1SFKA 4AVPA 4D7NA 5K7ZA 3H0DA 1MBJA 1RZ4A 4NUBA 2TCTA 3PM1A 4BY7J 3JRAA 2ESHA 2ZMEC 2EILH 2BHYA 1IRZA 2VPLA 2DA4A 1WJAA 2DBBA 1IO2A 3W6KB 1ACIA 3JSPA 5KVRA 3WHCA 3HG9A 1KU3A 1Y56A 1YQAA 4JX6A 4KIBA 2OBPA 2PLYA 3O3KA 2B0LA 2WB1N 3MN2A 4UXNA 3J80Z 1FMWA 2JK3A 1UB9A 3P9IA 3I4PA 2E7XA 1ETWA 3E7LA 4EJUA 1SD6A 3OSGA 4A93J 1GUUA 2QWWA 4CYCA 4CUGA 1Z7UA 3OYMA 3CDHA 2C6YA 3HRTA 4HA8A 2E1NA 2P6SA 1XPXA 1DGRM 1IUYA 2XB5A 2HZTA 1YIJI 5FLVA 3C18A 2TRTA 4II2A 1SMYF 1YHQI 3HHHA 4IVNA 5JVGF 2LDUA 5GADJ 4BL0B 2XROA 4B43A 1H88C 3K7AJ 1OYYA 2GXGA 2OV7A 4RLQA 4Q5SF 1JI8A 2XKPA 3I71A 5HDKA 3V4GA 4BS9A 1MW7A 1T8IA 2DK5A 2IVMA 4GCVA 4B48A 4CXFA 2EZKA 2E1MB 3PSFA 1MMDA 5GAEJ 3HL2A 2RAEA 4GYIA 1WH5A 1S8NA 2X1EA 1GV5A 3BOQA 4PFOA 3H3VK 1NH3A 1R1TA 1QZZA 1RESA 4BXXJ 4M6XA 1LDJA 3DU5A 3JRHA 4D9JA 2M30A 2M8GX 3H92A 1YJ9I 3CD6I 3CCVI 3PNVA 1JKRC 1B4AA 3HIFA 5IP9J 1P6RA 4EEFG 3WGIA 1FP1D 5B5EC 4ZDPA 2HS5A 3COAC 1YTYA 2VQLA 4ABZA 2XGCA 1YE9A 4F52A 1Y1VJ 1T95A 4MEYF 3N05A 1HQCA 2VT2A 3AAFA 2IA2A 4LB6B 1UHWA 2Z1DA 2AXTC 4CGZA 2WTEA 2LKPA 2JN6A 4E7SA 2STWA 3Q0UA 4P96A 2ZMEA 5TRDA 2E71A 2ZC2A 3J7ZI 4XLHA 3W2AA 3P9CA 2WAQN 2MH2A 3C2GA 3E6MA 1D0YA 2LF8A 3WTZA 1BR2A 1R5ID 2EB7A 2NVQJ 5FB2A 2KRFA 4LG0B 2AQFA 3FK7A 2ZJPF 4E7ZA 3D1NI 2DK8A 5LRRA 3M8JA 3FXKA 5H20A 4LIVA 1W0TA 3TBIA 1FYKA 2ZBKA 2VXDA 5LGNA 3S2DJ 1BOAA 2WADA 3CMAI 3OSFA 2LTPA 3BC8A 3CMMA 3SQNA 1XGOA 5CVJA 3L2QA 3HPHA 3PNTA 2EZIA 2AS5F 5ICCA 1UAAA 3M07A 2OCCH 3C1DA 4E7IA 3HKZN 4M6YA 2BE5F 2H6BA 1HKQA 1ZGJA 2ZNZA 2JA7J 5LLQA 2M0MA 2DA3A 3A0HC 4RGXA 2W82A 4TV7A 3DPTA 3LSGA 1E3HA 3HUGB 4PSWA 5LGTA 3QYFA 1FLIA 3WTTC 2RGVA 3IHUA 2PBIA 2R7ZJ 2MGQA 1BA5A 3RJPA 3WE3A 2R0QC 3U2RA 2XHKA 4X6AJ 4Y15A 5E3LA 3OS2A 1TBXA 4ESBA 5GTIC 1OCZH 3WG9A 5E3OA 2LY9A 2ZXJA 1Q1VA 4XBFA 3OYAA 1T6SA 4YIFA 2KHMA 2ELJA 3LQQA 2W7NA 2W48A 4CCKA 2HEOA 1UG2A 4G6TB 3FXJA 2E19A 2P8TA 1P9QC 1R4NB 1S6LA 3FBIB 3CLOA 2M87A 3BG9A 1K79A 4BQOA 2M1BA 3ERED 4LLNA 4IX7A 4I0BA 3FKIJ 1SVMA 2XRNA 3CDLA 3K9TA 1JT0A 2FD5A 2V1UA 1U2WA 4J01A 2E35A 3A2KA 1BIBA 4CSWA 1S7EA 2CV1A 5ICEA 4BE0A 1D1AA 5CVUA 2CGPA 2E34A 3LFKA 3PL8A 4BE1A 1E0EA 2CSOA 2LLKA 1PJRA 1MBGA 4IPAA 2PMHA 1JUSA 1BW5A 3HGGA 3SJMA 4Y13A 2DT5A 2A6TA 3JTHA 3M8FA 4JQFA 2CUJA 3L9FA 2OA4A 2BEOA 1O3QA 4IRGA 1XX5A 5L3EA 3RPUD 5K7HA 5HDGA 3DTIA 2VJ4A 4IL6C 2L9VA 2R7QA 3DKXA 4A3CJ 4B1RA 4DYQA 1I6XA 3L2UA 3CJNA 2A6HF 4Y17A 3MWMA 1O4XA 3FBNB 2B7EA 1FOXA 2VONA 3AL0C 5LHHA 2CRGA 4Z6YA 5DEQA 2NS0A 3KZYA 1TLHB 1IN8A 4RLFA 3RCOA 1YO5C 4ZJZA 1J7KA 2VBYA 2V9KA 5ICFA 5EG0A 3HOSA 1S3JA 1WI9A 2EV6A 3R0AA 5GTHC 2JUCA 2IGKA 1P7JA 1X1AA 2QQBA 2LFBA 1W5SA 3JSOA 4U7BA 4BKXA 1T0FC 3KIOA 3E97A 5H6QA 2W4SA 2O6GE 3LSJA 3ECHA 3I0TA 4OAYA 4UV8A 4CYCB 5DS9A 3FF5A 5EGOA 1T33A 3HRSA 1HXDA 4KJZA 4OIOF 3MKLA 3MZYA 3G6EI 4P55A 1XG1A 5J3LA 1KU9A 3M9AA 5KHDA 2DTZA 2EINH 3K4JA 3AG4H 2ZXIA 3V8LA 3CC4I 3AG3H 3HJEA 1Y1WJ 2DN0A 4YFNF 3F21A 3HXLA 1FSHA 2ZJ2A 1LB2A 4XRSG 4M3EA 2DLLA 3IWZA 2VL8A 1EV7A 1WWXA 5J4YA 1QPMA 1OMIA 3G71I 5LRSA 2ACJA 2R7UA 3TP3A 3FHNA 4QPQA 4KMUX 3J81K 4Y33A 1Z0XA 3IRQA 2CW0F 5GAHJ 2VJIA 2H1LA 1K78B 3J7AY 2DQRA 4HSRA 3OS1A 3I56I 3IH2A 3KP6A 1OYIA 3WE2A 2UUZA 3QU6A 4ASNA 1J9IA 2ISYA 3DBHB 3F8FA 3LFUA 4OU0A 2BY0A 2O8XA 1BM9A 2XAUA 4B09A 3WTYC 1X1BA 4Y52J 2R92J 5DUIA 3PQJA 4PJNA 4O3MA 1OCCH 2JQ7A 4CO8A 4PGGA 3W6VA 2WC2A 1B6AA 2DFHA 4E70A 2YR2A 1YIOA 1R00A 1T08B 1EKEA 2KJCA 2L7MP 3FM3A 3GUDA 4D1QA 1FBQA 2VXZA 4GRIA 5ERIA 1RKWA 3GTKJ 5M5XJ 1MBEA 4NC7A 3EUAA 4LMYA 1ETYA 3KZZA 2A05A 4G8XA 3FMQA 1IDYA 2KRHA 2QQ8A 3HBLA 2VKEA 5J1YA 3S17J 3ZMVA 1X4OA 1ENHA 4S0HB 3LNQA 4E7HA 1E3PA 4DOZA 4G7OF 5EEGA 1T0FA 4BEHB 3CMEI 4IOAF 5FLXZ 3O8HA 1JJ8C 2FEZA 4DBQA 3ZQ7A 4ZYEA 1W36C 3HEFA 2ZFUA 3GTGJ 1I1SA 3FISA 2KJBA 3BQYA 4IHYA 3OYLA 4BAYA 5FLXK 2QCOA 1OCRH 4XONA 3P7NA 2OTJI 2CYYA 2VBWA 3H9QA 4M3BA 4G94A 1FYLA 2O8KA 1O3SA 1RI7A 3EETA 1G3YA 4BACA 4E4HA 1DDNA 1C0WA 3B73A 4N9IA 1A04A 3MD2A 1QU3A 4RAYA 2KT0A 2MYSA 2DFFA 2QKMB 2E1OA 1P92A 1N25A 4PZJA 2X1DA 5KAIC 4EJVA 2B9SA 2DJNA 3GVAA 3OWTA 1OCPA 3T8RA 1AA7A 4GO1A 2H6CA 2Z9OA 3A02A 1P4AA 1EA3A 3I54A 1KQ9A 1EH8A 4KDPA 2JJ7A 4BXFA 5K5RA 3DLLF 4M6VA 3AKZA 1BI0A 2HQAA 5FKOA 5FKNA 4DIQA 1IRFA 3VODA 1LNWA 4KN7X 1P4WA 1UZCA 1I6HJ 3FDYA 4RDUA 1FT9A 1LJ9A 2CJJA 1W5CC 1VNDA 2P4WA 3OYHA 1MIJA 2W25A 4FCYA 4AVZA 1ZQ3P 2Z16A 5CVRA 1WGXA 3KYLA 4NHJA 3WU1B 1JTXA 1IDZA 4DW6A 4BQAA 2QA4I 4HF0A 1UFMA 1G3TA 3SEQA 3ZMSA 5IT9Z 3J7AO 1MSFC 1Y0UA 2A69F 4Q4ZF 1PUFB 1J2XA 4L0YB 4AD9A 2E36A 1XMKA 2KL4A 4WXCA 2XPWA 4P9UA 3BR1A 5FKLA 3BCBA 4IHWA 5JFRA 3PUFA 2WA0A 1FX7A 2JPBA 3GFMA 2Y75A 3I59A 5K5QA 4A5NA 4IHSA 1D5YA 1Q1HA 4MGRA 1ONVA 5E79C 1HBXG 3GEZA 2IT0A 1I5ZA 1FP2A 4BHBA 3GZNB 1KGSA 3RPUA 2XC7A 1RIOH 1S5LC 5HLHA 3IC7A 5LD2C 4Y7NJ 2NS7A 3ML6A 2KIQA 1SFUA 5D6FA 1MZBA 2HQNA 3SFZA 4MTDA 5HVQC 2Z99A 3JRCA 1SFXA 2EK5A 4I01A 4LG0A 4LLLA 2J5OA 2LR8A 2Z5UA 2BBYA 4HF2A 2ESNA 3HOVJ 4OAZA 2Y0MA 4PGHA 2IXSA 2A3SA 3QPSA 5LHIA 3KP5A 2UV1A 3BG6A 1IXSB 3A1YA 5A2QZ 3CTAA 3DLAA 3CCLI 5F6FA 1H9TA 1LEBA 3F0CA 5EF6A 3GZ6A 3GBGA 5M5YJ 5A2QK 3MVPA 3LAPA 4HV6A 1QVTA 3BG5A 1F9NA 5C4JJ 5EG0B 2ZXWH 3JREA 3CCMI 2EZLA 2HOSA 2XGXA 1DUXC 5FJ8J 5HOOA 2CH0A 4A0XA 1XS9A 4XQFA 4HNTA 2WBMA 4WX9A 4FHTA 1CQTA 3QP5A 1G8XA 1VQ8I 5HS9A 1WQ2A 3HUGA 3C7JA 2R7DA 3KP7A 1FIAA 3D5SC 3WHBA 2E2HJ 5IP6A 3DBRB 3GLXA 2MSYA 4F93B 3OY9A 1X3WB 2O5RA 3MZHA 1WJBA 2RQPA 3LQRA 4GGGA 1POGA 3DU6A 3L7WA 4A2UA 3IV5A 2X4HA 5D6EA 4UVCA 3S1MJ 3OV8A 2E60A 4RMNA 2M45A 4KNYA 4M9XA 4C2TA 3L2VA 4YELA 1W7PB 5FO5A 4JX5A 1YJWI 4CCOA 3LSRA 4J00A 1IAWA 1I3QJ 1S29A 3S14J 3K2AA 1HW1A 2RQQA 1XC5A 1R1UA 1WI3A 3BTCA 3BP8A 2OTLI 1G4DA 4M71A 1TWCJ 1MJAA 1FEXA 4NC6A 1U9OA 1PUEE 1Y6IA 4KA4A 4RA2A 4YIRX 1STZA 2HKOA 2BYVE 3H35A 2QYOA 3I9V2 3S2WA 3BPXA 4ENNA 1LKXA 3DV8A 4QLCU 1JGSA 2DFEA 2B63J 3T1BA 2ECBA 4H0EA 3MEXA 2MG4A 3D5RC 4RB3C 3ESWB 3IWFA 4ZDLA 4M72A 3RSNA 4ETSA 4ZDOA 4HOBA 3EDPA 4XKVA 4B3AA 2EFQA 4XNFA 3GTPJ 5FFZA 1VQ4I 1YI2I 3AL0B 4KFCA 3OIOA 1XTAA 1RPWA 3HRMA 2DOAA 1XGNA 2JZYA 2V1DA 3TP0A 1YS7A 4G12A 2XB0X 4CCMA 4CICA 4B44A 2IA0A 1X1DA 4CZZA 2HWVA 5CQGA 4F3QA 1QA6A 2XGEA 2EWNA 1I27A 2BZTA 4Q48A 4B4CA 3IH4A 2CUEA 2LOOA 3K4MA 4D5FA 4HX4A 1RRJA 1P7IA 2IEKA 1JE8A 3MMYB 2H1KA 1WHUA 4K2EA 5K1YA 2CV0A 1BC8C 2R7WA 3WTVC 5IY5H 5LHGA 2W00A 2VKVA 4HX8A 1HW2A 1U6GA 4FQGA 2OC6A 2QSGX 1SMTA 4RGSA 2CUFA 4Q47A 4KICA 3EUKL 1FC3A 5DM7F 2LYCA 1SFOJ 3P9KA 1DP7P 4PJ0C 2K85A 3S1RJ 2IGOA 4MQ9F 2EA2A 1MH3A 3LSMA 1OFCX 2NRAC 3KLOA 3F72A 4L18B 1TW2A 4I02A 4GDFA 3ECOA 2VASA 3BTLA 3HZJA 4HW0A 4JP0A 5M5WJ 2M4GA 1AOYA 1OYWA 1YS6A 4NB5A 2DMQA 4EJTA 3Q3SA 1U5TC 2LMDA 2LVSA 2NAZA 2XVCA 4RAZA 4EJOA 4RAGA 5DUKA 1IG7A 3QYEA 4F92B 1W7PD 4XOPA 4XSZF 1K6OA 1TWHJ 4ZC3A 1QO0D 5D8KB 1VZ0A 2EZHA 3WTWC 3FXUA 5CVVA 1K78A 5E3MA 5L3FA 3F23A 5E1XA 4FISA 5HNFA 4PFPA 1V5FA 3TO7A 3JR9A 3H5NA 4BQQA 2A5YB 4HSTA 2HYGD 4XORA 2M4KA 2FBHA 4A3FJ 5CQEA 2ZCWA 4UUSA 3ROUA 2FMLA 1BR1A 2LD5A 3NQOA 1MJ9A 3I59B 3UR3C 1BJAA 2DQLA 2TDXA 1R5GA 2LG4A 3SXYA 5ED4A 1B9NA 3CZ6A 3SFIA 2CU7A 3K10A 4PJMA 3X2QH 1GXPA 2E2IJ 4A3EJ 1DQUA 2DJIA 3DF8A 3EPZA 5AIQA 3DFGA 1JKPC 3BR2A 4EQQA 1E3OC 1JGGA 2LY2A 2HPMA 1CF7B 1ZGAA 2KDZA 1Z6TA 3JAMK 3OYEA 2RDPA 3BY6A 1L0OC 2NVUB 2ZNYA 3W6JB 3ZCOA 1Z05A 3TW7A
chains in the Genus database with same CATH topology
2IGKA 1X1AA 4XL9A 4KT6A 4U7BA 1T0FC 3QOEA 4BEHA 3ZXSA 3E0JB 2X6WA 2K9MA 5FRNA 4XLFA 2W4SA 1WFXA 3BCAA 3UNGC 2HVQA 2XF6A 1TZLA 2HZDA 2LBFB 4OAYA 2BVLA 3W3CA 3K4KA 3OL4A 2BW3A 3OIQA 4E7LA 4KJZA 2R7RA 2VKDA 1MMAA 2X51A 3HPGA 1Z7LA 3VYSB 4BQNA 4BGDA 3TMOA 2IGNA 4CCLA 5KHDA 3K4JA 2W1OA 3S32A 3IP4B 2ZXIA 1QHGA 5FROA 3ZR8X 4ZYAA 4AYBA 5HLTA 3RTRA 1HA8A 3OOUA 4DGWB 3HXLA 3F9KA 2KZVA 3CP8A 2X1CA 4C30A 4BE2A 2VL8A 2GOXB 1WJFA 2ZSHB 2CMPA 2XSJC 2R7UA 3FHNA 5CKTA 4QPQA 4ANJA 4Y33A 5KNLA 2VJIA 3J7AY 1U0JA 3MKYB 2IS1A 2Q1ZB 4B3XA 4E7JA 4HSRA 2Z2SB 3NWSA 3OS1A 3VSLA 3LSKA 2UUZA 2HPIA 3VYTB 2DT6A 3LFUA 4CCJA 2WY7Q 4JOMA 1QHHD 3QYBA 1X19A 2FUG2 4XM3A 3H5AA 2XAUA 1ERDA 1X1BA 3K4NA 4FASD 4U87A 4PJNA 4C2UA 2PJRB 2IGMA 2RNGA 4PJLA 2VJJA 4C9YA 4LITA 3A4CA 4BU2A 4D1QA 2VXZA 4GRIA 1YX5A 2LC2A 2V7FA 3EUAA 4NC7A 2R7TA 1R6RA 2WB1A 2KRHA 3KEYA 3PUBA 2V6EA 1X4OA 2XF5A 4E7HA 2NOJB 4DOZA 4BEHB 4DJAA 2JSPA 4XR6A 3PJRA 4DBQA 1W36C 1N77A 2ZFUA 4BDZA 2XF7A 3SDBA 3OYGA 3ONQA 3OYLA 2IS2A 2BW3B 4XONA 2I8DA 2PMZA 2JVGA 4Y3OA 5LFAA 4LG3A 2V26A 3H9QA 2VB6A 3OYKA 3D5LA 2K9LA 4HG2A 1W36D 2R4GA 3K70C 4N4NB 1K6YA 2CW7A 2BVMA 4BACA 3H9JA 4E4HA 1X4PA 3OYJA 3MD2A 1QU3A 1WJEA 2KPMA 2MYSA 2QKMB 2CV2A 3W2WA 4X0GA 2X1DA 2RREA 3G2BA 3OWTA 2M7AA 1AA7A 4ZTFA 2LRDA 3DPLC 1NG6A 3OIPA 2VJ5A 3K4LA 2K5CA 1EA3A 4XMYA 3ZQQA 4BXFA 2HVSA 3L2RA 2KLOA 4E6KG 3AKZA 1S9HA 2HQAA 4XLCA 4HNUA 4P1WA 4LIUA 4DIQA 2KRCA 4HRIA 1DGWY 3FDYA 3C2HA 1G59A 3BLYA 4NC8A 3OYHA 2CS3A 4II3A 4AVZA 3TL4X 2Z16A 3RQ4A 3VYUB 4DBRA 3OL3A 3KYLA 1X1CA 3IUOA 1GLNA 3BG7A 4CCNA 2R7OA 2DXIA 2XDVA 2P0WA 2KL4A 2L9SA 4RM2A 3ZRGA 2V1NA 4KITB 1WJ5A 1N78A 3BCBA 2L7KA 2WAQA 1ZELA 2KP6A 2WA0A 2K3PA 2HU9A 2LH9A 3FKJA 1BR4A 3OR1C 1N75A 2CUZA 3SZGA 3K6GA 2WY8Q 4CH7A 3LSHA 2L9NA 1UG0A 4ZTJA 1SFKA 1LDKB 3H0DA 1FMVA 2XC7A 4NUBA 3OMYA 3LMMA 4F55A 5LD2C 3S3OA 1NG7A 3VSKA 2VPLA 1WJAA 5HVQC 3HKZA 2HNHA 3HG9A 1Y56A 4OAZA 1FMWA 2IXSA 4PJJA 2JA2A 2UV1A 3S93A 2MABA 3BG6A 3VWBA 3A1YA 3DLAA 2LBFA 3SYTA 3K4CA 3QODA 1Z3YA 4CUGA 3OYBA 2X85A 2QKLB 3GBGA 3OYMA 4AU7A 3EUHC 1DGRM 1WJCA 5HOOA 4XOTA 2CH0A 4II2A 4XQFA 4HNTA 2WBMA 4BL0B 2JUGA 4B43A 1G8XA 1YX3A 2OV7A 4RLQA 1JI8A 2HVRA 3D5SC 3K4BA 4BS9A 1MW7A 3OY9A 4B48A 4F93B 4YRVA 2O5RA 1WJBA 2E1MB 4BJ6C 4R79A 3PSFA 1MMDA 3M1CA 3HL2A 2M7BA 2X1EA 3DU6A 4QPOA 4PFOA 4IQJA 2E5NA 2JVHA 2VIXA 1IRXA 4CZCA 2Y0SA 3ZGKA 2E60A 4RMNA 4MLOA 3DU5A 3H5RA 4D9JA 4C2TA 3L2VA 3PNYA 4YELA 3MKWB 3PNVA 4NQWB 4CCOA 4J00A 1LFPA 3S8PA 5HNHA 1D0XA 3OYNA 5TGTA 2RQQA 5CPRB 4ZDPA 3VYRB 4N4OB 3NWTA 2IS6A 4PSXA 3DEEA 2VQLA 1YE9A 4F52A 2E5ZA 1T95A 4OWRB 3DTEA 1Y6IA 1WJDA 4PK4A 3N05A 3H35A 2Z1DA 3CP2A 3I9V2 2A5WA 1V5EA 2R7VA 2F4IA 4E7SA 1LKXA 2X6YA 3OYIA 4HPQA 2R7XA 4XLHA 1J09A 3W2AA 2CW8A 3C2GA 3U21A 2L2OA 4XKWA 1D0YA 4XN3A 1BR2A 4EATA 3D5RC 5JHFA 2AQFA 4E7ZA 1DP3A 4ZDLA 3RSNA 4BJ5C 3CJRB 4XLEA 4ITVA 2MD0A 3LL7A 3M8JA 1Z21A 4ZDOA 2KQRA 4LIVA 3TBIA 4XKVA 4XNFA 2VXDA 2WADA 3OS0A 4H4KC 3BC8A 3CMMA 3AL0B 3KX2A 4B47A 3L2QA 3HPHA 3PNTA 3V42A 2GOMA 3CESA 2DOAA 1UAAA 2OUMA 1MMNA 3DQVC 4E7IA 4CCMA 4B44A 1X1DA 5CQGA 4F3QA 4XLAA 1PYVA 3MKZA 2M0MA 2W82A 2LOOA 2MFZA 1LVKA 3DPTA 3K4MA 3OYCA 3DKYA 3LSGA 2VKHA 3L2WA 3IAM2 3HUGB 1MNEA 3MMYB 4PSWA 3QYFA 2CV0A 3PSIA 4PUSA 2R7WA 2WAEA 4BUPA 2VLAA 2ZXHA 2VQCA 2W00A 1SAUA 3IAS2 2OC6A 1TT0A 3HC7A 4F91B 3OR2C 3OS2A 2F6CA 4Y4RA 3EUKL 4RM3A 4XKBA 1UELB 2LYCA 3PFYA 3OYAA 2KHMA 2ELJA 2W7NA 2WAFA 2IGOA 2DT7B 4BJTA 2Q2EB 4CCKA 3LSMA 1D0ZA 4G6TB 2E1MC 3DPUA 1P9QC 4NNJA 2F5VA 3OYFA 3FBIB 3VDXA 2VASA 4BQOA 2M4GA 2MC4A 4IX7A 2VQHA 2UWMA 1V5GA 4BDYA 3DWLE 4J01A 3E1SA 3SEZA 3A2KA 3DTKA 4CSWA 1D1CA 3W2VA 2CV1A 4BE0A 1D1AA 4KISA 2CFOA 3OYDA 2KMUA 3QYEA 3PL8A 4F92B 3I3LA 4XOPA 1KONA 4ZC3A 4BE1A 1E0EA 2KDOA 1VZ0A 3H9GA 3S3MA 2VQGA 1PJRA 5HNFA 4PFPA 1V5FA 2R7SA 3H5NA 4BQQA 4P5OA 4HSTA 2DCEA 5KCMA 2A6TA 4YEJA 3AFHA 4XORA 2M4KA 4E7KA 4JQFA 3HOTA 2BOLA 5CQEA 2CUJA 2M3AA 5FRMA 1Z3XA 2L5QA 2X6XA 2LREA 4CA0A 1BOBA 1BR1A 3RPUD 1OLTA 3UR3C 2PJRA 3DTIA 2LG4A 4HEA2 2VJ4A 1MMGA 2HDWA 2R7QA 3CZ6A 3DKXA 3LSIA 2V4JC 3L2UA 3K10A 4PJMA 3CJQB 4IKFA 2LY1A 1DQUA 2AQEA 2DJIA 3EPZA 3FBNB 4FETA 3AL0C 4IZZA 3CF2A 4RLFA 3RCOA 2LY2A 2ZSIB 4ZJZA 3K70D 2V9KA 2HPMA 4XKCA 3S3NA 1MNDA 1OR7C 3OYEA 3HOSA 4XN0A 2IS4A 3ZCOA 1D1BA 3SEQA 4IQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLO A;  2RQQ A;  3A4C A; 
#chains in the Genus database with same CATH topology
 1VQN I;  2ID3 A;  4BEH A;  1IGN A;  2X6W A;  5D8L B;  5JLW A;  1WFX A;  5BNG A;  1VQ6 I;  3UNG C;  2LNB A;  2XF6 A;  3K1P A;  2ID6 A;  4BXU A;  2HZD A;  4C2M J;  3W3C A;  4RB2 C;  2FBI A;  3OIQ A;  5CYV A;  2VKD A;  1MMA A;  3HPG A;  3PIO F;  3CCY A;  4WCG A;  1ETX A;  2IGN A;  2EBI A;  2PN6 A;  5FGM A;  3S1N J;  1ZTR A;  3FMS A;  3A03 A;  2W1O A;  3S32 A;  5DCF A;  3S2H J;  1ZAO A;  3ZR8 X;  4KN4 X;  4ZYA A;  3RTR A;  1U5T A;  4A12 A;  3ABT A;  4OIN F;  1B9M A;  5M3F J;  2E1C A;  2P7V B;  2X1C A;  1MBK A;  1ZN2 A;  2GOX B;  4AIK A;  3ZQL A;  1RR8 C;  1E17 A;  1Z1D A;  5GP9 A;  1ZG1 A;  4BNC A;  5BMZ A;  1RNL A;  5C3E J;  1J0R A;  2GAU A;  5CKT A;  5F1R A;  4ANJ A;  2FX0 A;  2A61 A;  3NAR A;  3RZD J;  4RGR A;  1R4M B;  2HGC A;  2NYX A;  3GXO A;  2K9Q A;  3VFZ A;  2RC4 A;  4JOM A;  4ZZD A;  1G2H A;  1QHH D;  4HF1 A;  2EIK H;  1OPC A;  3H5A A;  1O3T A;  3KEQ A;  2DA7 A;  2IPQ X;  2CO5 A;  2FXA A;  2BY1 A;  5L3G A;  4KMF A;  2QZ8 A;  3CC2 I;  3Q9V A;  4R1H A;  4C2U A;  2PJR B;  1R58 A;  2RNG A;  4PJL A;  2JSC A;  1PUF A;  4L9J A;  2D45 A;  1B1B A;  5B66 C;  1KU7 A;  2L0K A;  2HR3 A;  1HDD C;  2FNA A;  4EGY A;  1YLF A;  3QRF F;  3CDI A;  2O61 A;  4A6E A;  3K1M A;  2EH3 A;  3G1O A;  3FXR A;  1A6Q A;  2LC2 A;  3H3Z A;  5E3N A;  4MTE A;  1RUN A;  2DMP A;  4YFX F;  4MNU A;  4OIR F;  2KIM A;  2DU9 A;  1BC7 C;  3KEY A;  4L5J A;  1A35 A;  2V6E A;  1MD0 A;  5JHU A;  1WRJ A;  1SC7 A;  2JSP A;  1DU0 A;  4XR6 A;  3I64 A;  3PJR A;  3HOX J;  3FX3 A;  3I5U A;  2Y2Z A;  3WTS C;  1N77 A;  5J40 A;  4AC0 A;  1BI1 A;  3ONQ A;  2HXI A;  3QPL A;  3QP6 A;  1G3W A;  2I8D A;  2DI3 A;  2PMZ A;  3J7Y J;  5J8C A;  2IW5 A;  5LFA A;  2HYJ A;  2QVO A;  1TWF J;  2DA6 A;  1X1P A;  3OYK A;  3D5L A;  3JRG A;  4HG2 A;  3WGG A;  1W36 D;  4N4N B;  2JWT A;  2VBZ A;  3SZP A;  4IHV A;  5BQT A;  3M1E A;  3Q5F A;  1OQY A;  1WPK A;  1S7A A;  1UST A;  1WJE A;  2EFO A;  2EQR A;  2KPM A;  5DYM A;  1GDT A;  3W2W A;  4X0G A;  1MMS A;  2RRE A;  3HTS B;  3HDD A;  3KET A;  2F4O B;  2GA2 A;  5EDN A;  4IF4 A;  4FX4 A;  3PQK A;  4KIF A;  3OIP A;  2K5C A;  1PVE A;  1MH4 A;  1ZKG A;  4IEJ A;  2PEX A;  1XB4 A;  3L2R A;  2CQN A;  2KLO A;  2OF7 A;  3CCR I;  3L00 A;  1H89 C;  4LIU A;  2RVC A;  3TOA A;  5J6X A;  2M2E A;  4HRI A;  4WF2 A;  2JA8 J;  3C2H A;  5DTD A;  1H9G A;  2HXO A;  1FY7 A;  4A0Z A;  4LD5 A;  3TL4 X;  4DBR A;  1X1C A;  2HTS A;  1T39 A;  4LGW A;  3I53 A;  2FOK A;  4A3M J;  3V7C A;  2DXI A;  3BJ6 A;  3NEU A;  4PDK A;  2F5E A;  3ZN0 A;  3PFI A;  3G4S I;  2L9S A;  4ZYD A;  1W7P A;  1ZRC A;  4MQV A;  5J1U A;  1B59 A;  1EH6 A;  3ZRG A;  2BGC A;  1N78 A;  2L7K A;  5EYR A;  4BHP A;  2F48 A;  3J81 Z;  3ZQH A;  3GTL J;  5DD4 A;  1X3U A;  1BR4 A;  2MH9 A;  2CUZ A;  3K6G A;  5CJ9 A;  4CH7 A;  1RR7 A;  5IPA A;  2ZKZ A;  4ZTJ A;  4UV9 A;  3A01 B;  5DD8 A;  1LDK B;  3TED A;  2QQA A;  2KZG A;  4F55 A;  2P5L C;  1I3A A;  3GFJ A;  3HGY A;  5D4S A;  1FOW A;  1VQ7 I;  1ETQ A;  3S3O A;  1NG7 A;  2O3F A;  2XPV A;  2F2E A;  2DOF A;  1GVJ A;  3PIP F;  4UUS B;  4I0A A;  2XKO A;  3WOD F;  3TW6 A;  3JRI A;  1EH7 A;  3KPH A;  5EEH A;  2VC1 A;  3H3U A;  2NNN A;  1ON2 A;  4PJJ A;  1HKS A;  4RS8 A;  2JA2 A;  3S93 A;  2MAB A;  2IBD A;  3GO5 A;  3SYT A;  3K4C A;  4QSH A;  3CC7 I;  3QOD A;  1Z3Y A;  1EF4 A;  2X85 A;  4BHC A;  2JTV A;  2QKL B;  3KYD B;  1SAN A;  2O0Y A;  4AU7 A;  5D5V B;  5IYB J;  3DCF A;  1X2M A;  3IL2 A;  3EUH C;  4GFB A;  4KT5 C;  3RKY A;  4EGZ A;  4F7Z A;  1QRY A;  4XOT A;  1U8B A;  5IP7 J;  4HQE A;  1MBF A;  4A3I J;  4EMS A;  1R23 A;  2YU9 J;  1SD5 A;  1CGP A;  2STT A;  2X6O A;  5KK1 A;  2JUG A;  1AKH B;  1VQK I;  2DYR H;  3HM5 A;  1YX3 A;  4L5I A;  2O03 A;  2CFX A;  3K4B A;  2NVX J;  1FYM A;  4YRV A;  4NDL A;  1B72 B;  4BJ6 C;  5H2F C;  4R79 A;  3TOB A;  2JMW A;  3S16 J;  2W24 A;  2M7B A;  1FBS A;  4UB8 C;  4BBS J;  1Z91 A;  2DA2 A;  2CQ7 A;  3F6O A;  4UHT A;  5LGU A;  2E5N A;  2JVH A;  4CZC A;  4A6D A;  4L0Z B;  2Y0S A;  2K4B A;  3KLN A;  4A69 C;  3H5R A;  2VUM J;  3PNY A;  4I7H A;  2RN7 A;  3ZQF A;  2ELH A;  3MKW B;  1U5T B;  3AG1 H;  3B02 A;  5HS7 A;  5J4V A;  1LFP A;  5TIS C;  3S8P A;  5HNH A;  3UKG A;  3V7R A;  1MDM B;  5LEK A;  2IA1 A;  5CPR B;  3LSP A;  3NWT A;  5C4X J;  3DKW A;  1LPQ A;  4OWR B;  3BPV A;  1QGP A;  4L5E A;  5CLS A;  2HQ5 A;  2XRL A;  2QF7 A;  4AYB N;  3QWL A;  1ZRD A;  3ZPL A;  2R7V A;  2X6Y A;  4DYR A;  3OYI A;  2R7X A;  4ENM A;  1IN4 A;  3FK6 A;  3BZK A;  3JW4 A;  4LOC A;  2CW8 A;  3GFL A;  3VB2 A;  4XKW A;  1YRN B;  1TQM A;  3CCS I;  1P2F A;  4IHX A;  1ZGW A;  2VI6 A;  4I98 B;  4EAT A;  1SD4 A;  1PDN C;  2HDC A;  2M9H A;  3LAJ A;  1F43 A;  3SZT A;  1MKM A;  1NK2 P;  4XLE A;  1Z21 A;  3DBL B;  3NRV A;  2GXA A;  2ECC A;  5B1A H;  2IRF G;  5M3M J;  1LE8 B;  3OS0 A;  5HOD A;  1OIS A;  3Q9S A;  2MC3 A;  4UY8 I;  4B47 A;  3PO2 J;  1ZLJ A;  1VI0 A;  3M8E A;  3V42 A;  2GOM A;  3CES A;  3K1N A;  2GIV A;  2JRM A;  2CWE A;  1MMN A;  2OJE D;  3EUH A;  3GTO J;  2ME6 A;  4EM1 A;  1R36 A;  1F1Z A;  2MFZ A;  3ABU A;  2EJR A;  2VKH A;  3DKY A;  3L2W A;  1M1E B;  2WWY A;  5GAG J;  2L4A A;  3VEP A;  5DV5 A;  1R1V A;  1LQ1 A;  1CF7 A;  1H0M A;  2KIU A;  3F3X A;  1JTY A;  2WAE A;  3DEU A;  4G6Q A;  4PUS A;  4BUP A;  4M74 A;  2VLA A;  4IO9 F;  2ZXH A;  3VPR A;  3IAS 2;  2GA1 A;  1TT0 A;  3HC7 A;  4F91 B;  3OR2 C;  1XGM A;  3OOP A;  1BW6 A;  3GW2 A;  4XKB A;  1UEL B;  1G6N A;  3WG7 H;  1SEU A;  3V8K A;  5ILV A;  2WAF A;  5EEA A;  4ESJ A;  2R5Z B;  2EA4 A;  3K2Z A;  2DTR A;  3ZOB A;  1XSD A;  1KU2 A;  4XRS A;  4M3F A;  1FZP B;  3DPU A;  4NNJ A;  4EJW A;  4OIP F;  2LP0 A;  2A6E F;  3OYF A;  3VDX A;  3GTQ J;  2DA1 A;  1MSE C;  2F4M B;  5E1Z B;  4QWQ A;  2L7F P;  3ZMU A;  5CVI A;  5H6R A;  5GPC A;  1KQ0 A;  2UWM A;  2YS9 A;  1JUM A;  3FXQ A;  4YFK F;  1V5G A;  2FJ1 A;  3IRR A;  3HYI A;  3T5X A;  1D1C A;  3W2V A;  3DXJ F;  3HHG A;  3U9G A;  1FOK A;  4KIS A;  2QSH X;  3WU2 C;  3KFW X;  3E3V A;  2VOO A;  3OYD A;  2JT1 A;  2QUF A;  2KMU A;  4NBQ A;  4ZH4 F;  5E8I A;  3I3L A;  1NHA A;  1XSX A;  2CG4 A;  2KDO A;  4BYY A;  1ITY A;  2DAO A;  3H9G A;  4AM3 A;  2BV6 A;  2EFN A;  2VQG A;  1GXQ A;  2G7U A;  1RC9 A;  2DPU A;  4IRH A;  1QZE A;  2Y9Y A;  3QQA A;  3AFH A;  3HTU A;  2YSR A;  4JK1 X;  2BOL A;  2OQG A;  3HSF A;  3GFI A;  4JBA A;  5FRM A;  3G73 A;  4WXD A;  3ABK H;  2MD5 A;  1R49 A;  1BOB A;  1OLT A;  3GME A;  1Z6R A;  2F5F A;  2XAJ A;  2PJR A;  2IP2 A;  3A0B C;  4HEA 2;  1FOY A;  3LSI A;  3REO A;  3B6C A;  1D8K A;  2Z33 A;  3I58 A;  2LY1 A;  4M9S A;  2AQE A;  4EV0 A;  1OCO H;  3KE2 A;  1J5Y A;  3FWE A;  1FTZ A;  3CF2 A;  3BQZ A;  1VQO I;  3TKY A;  2DPD A;  1HST A;  2ZSI B;  3K70 D;  4XKC A;  4C3J J;  3S3N A;  1LUJ B;  1OR7 C;  2DMU A;  2IS4 A;  4XN0 A;  3KP4 A;  1D1B A;  1YYV A;  2OAZ A;  2DDB A;  1QVU A;  2UXN A;  4XL9 A;  5F0C A;  2FU4 A;  4KT6 A;  4ZYG A;  4DNC A;  5GPA A;  3QOE A;  4YII A;  5E20 A;  5F08 A;  3BCA A;  3ZMZ A;  3MFK A;  2H8W A;  2HVQ A;  1XN7 A;  3BG3 A;  3R61 A;  4HAM A;  4XLP F;  2QM3 A;  3I4M J;  3RPQ A;  4BH9 A;  1KYZ A;  2X9D A;  4WXH A;  4HDU A;  3K4K A;  4U88 A;  1BN5 A;  1I39 A;  1Z77 A;  2IJL A;  2R7R A;  2X51 A;  3CCE I;  1Z7L A;  2K9S A;  1IXR C;  4BGD A;  2Q8K A;  4CCL A;  3KCC A;  3I4N J;  2VOD A;  3M4O J;  2W85 A;  3IP4 B;  4KYW A;  2JA6 J;  4QIW N;  1QHG A;  1FTT A;  1V3F A;  3TDZ C;  1VFC A;  2Y69 H;  1HA8 A;  3OOU A;  4DGW B;  3SDG A;  4V2G A;  4U0Y A;  2L54 A;  3CP8 A;  4M9Z A;  4UUT A;  5FKK A;  3S1Q J;  1HW5 A;  1TW3 A;  1WJF A;  2ZSH B;  3TDU C;  3CUO A;  3ULQ B;  1X58 A;  1IUF A;  1IN7 A;  1IN6 A;  3ZQG A;  1SVO A;  1D3Y A;  1LDD A;  2FOW A;  2R5Y B;  3MKY B;  2IS1 A;  2CQK A;  4B3X A;  3NWS A;  2M0C A;  3VSL A;  3S15 J;  4HZF A;  2HPI A;  2DT6 A;  1VQ5 I;  2OPT A;  2XAQ A;  3QYB A;  1X19 A;  2FUG 2;  4XM3 A;  1ERD A;  1HKT A;  1R7J A;  1ZG3 A;  3L2C A;  1SFE A;  3K4N A;  3HOU J;  4U87 A;  4L9N A;  2YX4 A;  2IGM A;  3CLQ A;  2Y48 A;  2QEN A;  1TWA J;  2I5U A;  1EJ9 A;  4M3G A;  4C9Y A;  1YW9 A;  5D5U B;  2DA5 A;  2DW4 A;  1FSE A;  4BU2 A;  3J80 K;  4O5V A;  1TTY A;  5F0F A;  1QQI A;  2HTJ A;  1XDS A;  1SD7 A;  2MLG A;  3R0J A;  4IJA A;  1ZHF A;  1OR7 A;  2J5P A;  2R7T A;  2OQR A;  2R7F A;  2WB1 A;  4MFD A;  2MLK A;  4UB6 C;  5IOZ A;  3PUB A;  1JHF A;  4LK1 F;  1UHS A;  3A01 A;  2XF5 A;  4EVI A;  2NOJ B;  1QBJ A;  4V2F A;  3F8N A;  3FXL A;  2K9N A;  4DJA A;  2YX7 A;  2XV4 S;  1OCT C;  4HLX A;  3T0Y A;  1F4K A;  3DEW A;  4M73 A;  4DQ2 A;  2GXB A;  2XF7 A;  2E2J J;  1W5T A;  1F36 A;  1XSV A;  2BW3 B;  3K69 A;  1A5J A;  2D2W A;  2D1V A;  4ZYH A;  2AXL A;  4L9V A;  4UVA A;  3DP7 A;  2V26 A;  3GLL A;  3L1P A;  2WV0 A;  2K9L A;  3K70 C;  5D5W B;  3R4K A;  3H36 A;  2BVM A;  1ZAR A;  1X4P A;  3R6S A;  4ESF A;  1BI3 A;  1JUP A;  5LEJ A;  2K40 A;  1E2X A;  1TQI A;  2CV2 A;  2VE9 A;  3JAM Z;  3FXM A;  2Q2E A;  3G2B A;  3LA7 A;  2DYS H;  3E6D A;  2ETH A;  5IOY A;  2BHZ A;  3DPL C;  2FA5 A;  4I2O A;  1NG6 A;  1XCB A;  4XMY A;  1ZR2 A;  5F1J A;  5EJC A;  2HVS A;  1Y39 A;  4W97 A;  1AKH A;  5KAF C;  1O3R A;  3ZP5 A;  4P1W A;  3QU3 A;  4HX7 A;  3HB9 A;  3GX4 X;  1DGW Y;  1G59 A;  3BLY A;  3G1L A;  3E5Q A;  1MNM C;  3BR3 A;  2QEX I;  5AON A;  3RQ4 A;  3VYU B;  1B72 A;  3IUO A;  4AUX A;  2K27 A;  1UMQ A;  4CCN A;  2R7O A;  1B8I B;  3P5J A;  2PG4 A;  4N9H A;  2JA5 J;  1LEA A;  1ZG5 A;  2HDD A;  2DFI A;  2XDV A;  3IH3 A;  5K7F A;  3QPH A;  5K5O A;  2P0W A;  2PQ8 A;  4XID A;  4KIT B;  2V1N A;  3E6C C;  3G3Z A;  4AID A;  5LBQ A;  1RET A;  2LKS A;  2WAQ A;  4LFU A;  1ZEL A;  2MA3 A;  4S05 A;  1KA8 A;  4A3K J;  1MDM A;  2RNJ A;  2HU9 A;  3FKJ A;  2VC0 A;  3AG2 H;  3OR1 C;  2DDA A;  2L01 A;  5FKM A;  1W0U A;  3HOY J;  1V55 H;  3LSH A;  3FXO A;  3EYI A;  4UNO A;  2XIG A;  1R9T J;  4XK4 A;  1FMV A;  1SVL A;  1ZK8 A;  4IOC F;  3OMY A;  3LMM A;  5DCM B;  2R93 J;  3WGH A;  2LKX A;  4JX4 A;  4ON0 A;  1IZ1 A;  3VSK A;  2OCE A;  1PP7 U;  3Q0V A;  4UVB A;  2ZFW A;  3BR0 A;  2PI0 A;  2X0L A;  1YRN A;  3BRO A;  1WVR A;  3HKZ A;  3ERM A;  2HNH A;  1S72 I;  2OU2 A;  9ANT A;  4HV5 A;  3BJA A;  4GXO A;  1F5T A;  1YW7 A;  3BR6 A;  2CQQ A;  2HOT A;  2WV1 A;  4W1U A;  4D0P A;  2K86 A;  3VWB A;  1V54 H;  5D5X B;  2LBF A;  3IKV A;  1LE8 A;  4UUV A;  3LA3 A;  1KZH A;  3OYB A;  4ENJ A;  5JVT A;  1XGS A;  5IYD J;  2NVY J;  4XIC A;  4A0Y A;  4ZZL A;  1V4R A;  4OOI A;  4RGU A;  3O8G A;  2HOE A;  2XAH A;  1QPI A;  2EPF A;  3RZO J;  1UCR A;  1WJC A;  2P6T A;  2HQR A;  2PMZ N;  3LST A;  2CQX A;  4L9T A;  4X1E A;  3KZI C;  1NK3 P;  2DMN A;  2KKO A;  2NXN B;  2QSF X;  3FMR A;  2NVT J;  1TL8 A;  4AIH A;  2HOA A;  2JRT A;  2HVR A;  3MAJ A;  2FE3 A;  4G6D A;  3CF5 F;  3N4M A;  3HSR A;  2JPC A;  1IXC A;  2LK2 A;  2W57 A;  2COM A;  1JT6 A;  3RKW A;  3M1C A;  4LLG F;  4QPO A;  2V9P A;  1GV2 A;  4IQJ A;  2N8G A;  3EYY A;  3RQI A;  4HYE A;  2VIX A;  1IRX A;  2RV8 A;  3ZGK A;  1SAX A;  4MLO A;  4CDG A;  2D1H A;  2PFB A;  2QQ9 A;  4C3H J;  1I1G A;  3G1M A;  4D5C A;  5B1B H;  2R5Z A;  4NQW B;  1JXS A;  1AHD P;  5E18 F;  2P81 A;  1HF0 A;  3V7S A;  1ON1 A;  4BY1 J;  1D0X A;  3OYN A;  3BJO A;  5TGT A;  2VN2 A;  3MCZ A;  5DDG A;  2GWR A;  3VYR B;  1OJL A;  4N4O B;  3ZMT A;  1K83 J;  1JKQ C;  1TNT A;  1IV6 A;  2IS6 A;  4PSX A;  3DEE A;  2LF7 A;  4DZJ A;  2FNP A;  1OKR A;  3RIR A;  2E5Z A;  4RB1 A;  3C3W A;  6PAX A;  2DOD A;  3DTE A;  1WJD A;  4PK4 A;  1VQP I;  3RKX A;  4HLY A;  1MBH A;  2UXX A;  3CP2 A;  3CUQ C;  4LJZ F;  5EZG A;  1K61 A;  1LFB A;  2A5W A;  1MJB A;  1V5E A;  2H27 A;  4LB5 A;  2F4I A;  3CQZ J;  4G7H F;  3KEO A;  1W4M A;  3CJT B;  4HPQ A;  2M34 A;  1IC8 A;  1YIT I;  1J09 A;  3U21 A;  2L2O A;  1USS A;  2COB A;  4XN3 A;  3R60 A;  2PJP A;  4U0V A;  1U8R A;  1HC8 A;  5JHF A;  5J47 A;  4U7D A;  1DP3 A;  4BJ5 C;  5J8F A;  3CJR B;  4R8H A;  4ITV A;  2FBK A;  2MD0 A;  3ELK A;  3LL7 A;  3D0S A;  3WTU C;  2KQR A;  1UJ8 A;  1Y8R B;  2HI3 A;  3BT9 A;  1WKM A;  4PCQ A;  4S04 A;  3N97 A;  4A3J J;  3BZ6 A;  3JRB A;  4H4K C;  2F5C A;  1HSJ A;  4OMZ A;  1IV8 A;  1XMX A;  3KX2 A;  1GT0 C;  5BPI A;  2ME0 A;  2Y31 A;  4DZP A;  1FIP A;  4XLN F;  2OUM A;  2G9W A;  2I10 A;  3DQV C;  5TJJ A;  4RBO A;  3BDD A;  3CO6 C;  4RB0 A;  3F8M A;  3O6B B;  2A68 F;  4XLA A;  5L3B A;  1FBU A;  1PYV A;  2ZJQ F;  1T2K A;  3MKZ A;  2XPU A;  3FHZ A;  2P7C B;  2E7W A;  1LVK A;  4HNV A;  2UZK A;  3OYC A;  2K4J A;  4M3D A;  5ICG A;  1VQM I;  3IAM 2;  2ICW G;  1R71 A;  1MNE A;  1DPU A;  2DOE A;  2HFH A;  3ABL H;  3C2B A;  3LOC A;  3PSI A;  4MIM A;  2H8R A;  2OZU A;  1VF9 A;  1HDP A;  5HS8 A;  2VQC A;  3QOP A;  1SAU A;  1VQ9 I;  2Y30 A;  2O7O A;  1FPQ A;  4G7Z F;  1ZH5 A;  4J19 A;  2NS8 A;  1TQP A;  2F6C A;  2EV0 A;  4Y4R A;  4RM3 A;  3U1D A;  2BY3 A;  3CCQ I;  3ABM H;  2Q0O A;  3PFY A;  2G7H A;  2FSW A;  4BBR J;  5HLI A;  4I99 C;  2DT7 B;  3FIW A;  2BXZ A;  5IT3 A;  4BJT A;  2Q2E B;  4AIJ A;  4HDV A;  1D0Z A;  5FFX A;  1NTC A;  2E1M C;  3TQN A;  1VQL I;  2XAS A;  2H94 A;  2M5W A;  2F5V A;  2GM4 A;  3MZ8 A;  1ZRF A;  2F5D A;  3ASO H;  3EQL F;  5E17 F;  2HYF A;  2EIM H;  2MC4 A;  4MO7 A;  1S7O A;  5AIP A;  2VQH A;  3HRU A;  5BOX A;  1GVD A;  2RKH A;  1RKT A;  3JTG A;  1WZ2 A;  2V9V A;  4BDY A;  5BS6 A;  3DWL E;  2Y0S N;  3CUQ A;  2IAI A;  3E1S A;  3SEZ A;  3DTK A;  3GCM A;  2R3S A;  1X2N A;  2XGD A;  3KP3 A;  3TO9 A;  4WWC A;  1UHM A;  1XD7 A;  2EIJ H;  2ZME B;  2CFO A;  2OZ6 A;  2KFD A;  2QBY A;  1Y0N A;  2GZW A;  1A36 A;  1HLV A;  1FNN A;  1KON A;  1GHC A;  5FLM J;  4FTH A;  3S3M A;  1BBY A;  1WCM J;  3JCU C;  3ZQC A;  1R5H A;  2R5Y A;  5JI6 A;  5JR3 A;  1ETV A;  3E6B A;  2FRH A;  2R7S A;  3VOE A;  4P5O A;  1HCR A;  5L3D A;  3CO7 C;  2DCE A;  4P9F A;  5KCM A;  3U1K A;  4IHT A;  4YEJ A;  3WU0 A;  4E7K A;  3HOT A;  1PP8 F;  4A3G J;  5BPD A;  3FZV A;  1TP4 A;  2M3A A;  1Z3X A;  1REP C;  4V19 K;  2L5Q A;  2X6X A;  2LRE A;  4KIG A;  4O6J A;  2FQ3 A;  4CA0 A;  2ZJR F;  2QLZ A;  1XDU A;  1G3S A;  1LVA A;  3RYP A;  1T56 A;  2H09 A;  1MMG A;  2HDW A;  2PX9 A;  2Z3Y A;  3F6V A;  3IKT A;  2V4J C;  1TWG J;  3RDI A;  3CJQ B;  3ASN H;  4CYD A;  1BIA A;  4IKF A;  1IJW C;  4FET A;  3L09 A;  2P5V A;  3ISP A;  1BJZ A;  1JHH A;  4IZZ A;  4MEX F;  1D5V A;  2VPR A;  3H1C A;  2FF4 A;  2EFP A;  1U78 A;  1MND A;  2EFW A;  1Y8Q B;  4XSX F;  5J1R A;  4I6Z A;  3ZN1 A;  3M7G A;  4RAF A;  4IQ4 A;  1LFU P;  4G9Y A;  3ZXS A;  3E0J B;  5FRN A;  2K9M A;  2X48 A;  4XLF A;  3NAU A;  1BL0 A;  1MGT A;  5ILU A;  2VOP A;  1ZRE A;  1O57 A;  4U0W A;  3QPT A;  1TZL A;  2LBF B;  3CCJ I;  3PO3 J;  1JJ6 C;  2BVL A;  4FE7 A;  2PMU A;  2XSD C;  3OL4 A;  2BW3 A;  5FD6 A;  4E7L A;  2AHQ A;  2V6C A;  3VYS B;  4BQN A;  1ETK A;  3RI4 A;  4KUM A;  3TMO A;  2M8E A;  3RKQ A;  5E1W A;  5E8G A;  1K4T A;  4A3L J;  5FRO A;  1VTN C;  2HKX A;  1XMA A;  4AYB A;  3I55 I;  5HLT A;  5IT9 K;  5JLX A;  2K3F A;  4D7M A;  1WH7 A;  5F64 A;  2NOG A;  2KZV A;  3F9K A;  3CMY A;  1ZR4 A;  2ISZ A;  2KIS A;  4C30 A;  2Y9Z A;  4FT8 A;  2K7L A;  5IYC J;  1YW8 A;  2GIZ A;  4BE2 A;  2A07 F;  2CMP A;  1I50 J;  2XSJ C;  3E5X A;  4I76 A;  2EV5 A;  1JKO C;  1P4X A;  3WTX C;  2BXY A;  1YOV B;  5KNL A;  1APL C;  4A5M A;  4GYG A;  1TC3 C;  4I09 A;  4FX0 A;  1U0J A;  2O9L A;  2Q1Z B;  4E7J A;  2Z2S B;  1ODD A;  4JYK A;  3M3Y J;  1YJN I;  4EM0 B;  3GZ5 A;  3LSK A;  3MQ0 A;  1QZY A;  1L3L A;  2GBY A;  3VYT B;  1DU6 A;  1QNT A;  2V1X A;  2WY7 Q;  4CCJ A;  3RYR A;  1FWZ A;  4HBL A;  1ORK A;  2YU3 A;  3GTJ J;  1H8A C;  1YG2 A;  1A31 A;  3BZC A;  4FAS D;  1B8I A;  3HSE A;  2XAF A;  3BTJ A;  3T8T A;  5C44 J;  2VJJ A;  5DM6 F;  4LIT A;  1X3Z B;  3FM5 A;  4A3D J;  3A4C A;  3CCU I;  3LA2 A;  2G0E A;  2W84 A;  3TGN A;  1ZLK A;  1YX5 A;  4HQM A;  5HLG A;  3HOW J;  5F04 A;  4DYC A;  2L7Z A;  2V7F A;  2YUS A;  1IN5 A;  1WSU A;  3QAH A;  1A6I A;  1R6R A;  1IW7 F;  2ADU A;  4CHU A;  2KIF A;  5EZH A;  2DO7 A;  3KP2 A;  4MFE A;  2VBX A;  1U9N A;  2VE8 A;  5B3S H;  2AO9 A;  5FD5 A;  1T38 A;  5D4R A;  2LSO A;  3ZQI A;  3O2P E;  5DCM A;  4C3I J;  2QGU A;  1BI2 A;  3SDB A;  3OYG A;  4BDZ A;  2BY2 A;  1R22 A;  2IS2 A;  2FQ4 A;  5EGO B;  1TT5 B;  2L02 A;  2ELK A;  1ZYR F;  2JVG A;  4Y3O A;  3ZMD A;  3BTI A;  4LG3 A;  2VT3 A;  2MW8 A;  4MHG A;  2VB6 A;  4ENK A;  1J59 A;  3GTM J;  1XCV A;  2R4G A;  4B8X A;  1AU7 A;  2L9R A;  3E5U A;  5L3C A;  1J75 A;  1K6Y A;  2CW7 A;  3H9J A;  3OYJ A;  1FJL A;  1O7F A;  2DMT A;  3F8B A;  1TNS A;  2L3D A;  2ZO4 A;  4OMY A;  3HOZ J;  3GYH X;  4XRF A;  2M7A A;  1IF1 A;  2YPR A;  4ZTF A;  4Z2Y A;  5HDN A;  2LRD A;  1KQ8 A;  2XUB A;  4N0B A;  2VJ5 A;  2FMY A;  2OD5 A;  3GF2 A;  3K4L A;  3GWZ A;  4YG2 F;  3TO6 A;  1HOM A;  3ZQQ A;  4AWX B;  2D5V A;  3BWG A;  4E6K G;  2MBF A;  1S9H A;  2XAG A;  4XLC A;  4HNU A;  2L4M A;  3JRF A;  1Z9C A;  1ETO A;  1D8J A;  2KRC A;  3Q0W A;  3K0L A;  4NC8 A;  4QTR A;  2CS3 A;  4WK8 F;  4II3 A;  2GQQ A;  1W1W E;  4LK0 F;  4EM2 A;  5F0H A;  1O7L A;  3OL3 A;  1GLN A;  1T98 A;  3JRD A;  3BG7 A;  1K7A A;  3V8J A;  3BR5 A;  2P5K A;  4IRI A;  3KYC B;  1IRG A;  2NNY A;  2ZB9 A;  1DPR A;  3SHF A;  1YFH A;  5ILS A;  1AWC A;  3F8C A;  1KYW A;  4XRM A;  3F22 A;  1K4S A;  4RM2 A;  1RUO A;  3B6A A;  4NQW A;  1WJ5 A;  3CUQ B;  2GLO A;  4IXA A;  4FE4 A;  1U3E M;  2V79 A;  4A3B J;  5F27 A;  2K02 A;  2KP6 A;  2K3P A;  2LH9 A;  2QBY B;  3LWF A;  1N75 A;  3SZG A;  1ULY A;  2WY8 Q;  3H0G J;  2L9N A;  4OIQ F;  1UG0 A;  1Z67 A;  1SFK A;  4AVP A;  4D7N A;  5K7Z A;  3H0D A;  1MBJ A;  1RZ4 A;  4NUB A;  2TCT A;  3PM1 A;  4BY7 J;  3JRA A;  2ESH A;  2ZME C;  2EIL H;  2BHY A;  1IRZ A;  2VPL A;  2DA4 A;  1WJA A;  2DBB A;  1IO2 A;  3W6K B;  1ACI A;  3JSP A;  5KVR A;  3WHC A;  3HG9 A;  1KU3 A;  1Y56 A;  1YQA A;  4JX6 A;  4KIB A;  2OBP A;  2PLY A;  3O3K A;  2B0L A;  2WB1 N;  3MN2 A;  4UXN A;  3J80 Z;  1FMW A;  2JK3 A;  1UB9 A;  3P9I A;  3I4P A;  2E7X A;  1ETW A;  3E7L A;  4EJU A;  1SD6 A;  3OSG A;  4A93 J;  1GUU A;  2QWW A;  4CYC A;  4CUG A;  1Z7U A;  3OYM A;  3CDH A;  2C6Y A;  3HRT A;  4HA8 A;  2E1N A;  2P6S A;  1XPX A;  1DGR M;  1IUY A;  2XB5 A;  2HZT A;  1YIJ I;  5FLV A;  3C18 A;  2TRT A;  4II2 A;  1SMY F;  1YHQ I;  3HHH A;  4IVN A;  5JVG F;  2LDU A;  5GAD J;  4BL0 B;  2XRO A;  4B43 A;  1H88 C;  3K7A J;  1OYY A;  2GXG A;  2OV7 A;  4RLQ A;  4Q5S F;  1JI8 A;  2XKP A;  3I71 A;  5HDK A;  3V4G A;  4BS9 A;  1MW7 A;  1T8I A;  2DK5 A;  2IVM A;  4GCV A;  4B48 A;  4CXF A;  2EZK A;  2E1M B;  3PSF A;  1MMD A;  5GAE J;  3HL2 A;  2RAE A;  4GYI A;  1WH5 A;  1S8N A;  2X1E A;  1GV5 A;  3BOQ A;  4PFO A;  3H3V K;  1NH3 A;  1R1T A;  1QZZ A;  1RES A;  4BXX J;  4M6X A;  1LDJ A;  3DU5 A;  3JRH A;  4D9J A;  2M30 A;  2M8G X;  3H92 A;  1YJ9 I;  3CD6 I;  3CCV I;  3PNV A;  1JKR C;  1B4A A;  3HIF A;  5IP9 J;  1P6R A;  4EEF G;  3WGI A;  1FP1 D;  5B5E C;  4ZDP A;  2HS5 A;  3COA C;  1YTY A;  2VQL A;  4ABZ A;  2XGC A;  1YE9 A;  4F52 A;  1Y1V J;  1T95 A;  4MEY F;  3N05 A;  1HQC A;  2VT2 A;  3AAF A;  2IA2 A;  4LB6 B;  1UHW A;  2Z1D A;  2AXT C;  4CGZ A;  2WTE A;  2LKP A;  2JN6 A;  4E7S A;  2STW A;  3Q0U A;  4P96 A;  2ZME A;  5TRD A;  2E71 A;  2ZC2 A;  3J7Z I;  4XLH A;  3W2A A;  3P9C A;  2WAQ N;  2MH2 A;  3C2G A;  3E6M A;  1D0Y A;  2LF8 A;  3WTZ A;  1BR2 A;  1R5I D;  2EB7 A;  2NVQ J;  5FB2 A;  2KRF A;  4LG0 B;  2AQF A;  3FK7 A;  2ZJP F;  4E7Z A;  3D1N I;  2DK8 A;  5LRR A;  3M8J A;  3FXK A;  5H20 A;  4LIV A;  1W0T A;  3TBI A;  1FYK A;  2ZBK A;  2VXD A;  5LGN A;  3S2D J;  1BOA A;  2WAD A;  3CMA I;  3OSF A;  2LTP A;  3BC8 A;  3CMM A;  3SQN A;  1XGO A;  5CVJ A;  3L2Q A;  3HPH A;  3PNT A;  2EZI A;  2AS5 F;  5ICC A;  1UAA A;  3M07 A;  2OCC H;  3C1D A;  4E7I A;  3HKZ N;  4M6Y A;  2BE5 F;  2H6B A;  1HKQ A;  1ZGJ A;  2ZNZ A;  2JA7 J;  5LLQ A;  2M0M A;  2DA3 A;  3A0H C;  4RGX A;  2W82 A;  4TV7 A;  3DPT A;  3LSG A;  1E3H A;  3HUG B;  4PSW A;  5LGT A;  3QYF A;  1FLI A;  3WTT C;  2RGV A;  3IHU A;  2PBI A;  2R7Z J;  2MGQ A;  1BA5 A;  3RJP A;  3WE3 A;  2R0Q C;  3U2R A;  2XHK A;  4X6A J;  4Y15 A;  5E3L A;  3OS2 A;  1TBX A;  4ESB A;  5GTI C;  1OCZ H;  3WG9 A;  5E3O A;  2LY9 A;  2ZXJ A;  1Q1V A;  4XBF A;  3OYA A;  1T6S A;  4YIF A;  2KHM A;  2ELJ A;  3LQQ A;  2W7N A;  2W48 A;  4CCK A;  2HEO A;  1UG2 A;  4G6T B;  3FXJ A;  2E19 A;  2P8T A;  1P9Q C;  1R4N B;  1S6L A;  3FBI B;  3CLO A;  2M87 A;  3BG9 A;  1K79 A;  4BQO A;  2M1B A;  3ERE D;  4LLN A;  4IX7 A;  4I0B A;  3FKI J;  1SVM A;  2XRN A;  3CDL A;  3K9T A;  1JT0 A;  2FD5 A;  2V1U A;  1U2W A;  4J01 A;  2E35 A;  3A2K A;  1BIB A;  4CSW A;  1S7E A;  2CV1 A;  5ICE A;  4BE0 A;  1D1A A;  5CVU A;  2CGP A;  2E34 A;  3LFK A;  3PL8 A;  4BE1 A;  1E0E A;  2CSO A;  2LLK A;  1PJR A;  1MBG A;  4IPA A;  2PMH A;  1JUS A;  1BW5 A;  3HGG A;  3SJM A;  4Y13 A;  2DT5 A;  2A6T A;  3JTH A;  3M8F A;  4JQF A;  2CUJ A;  3L9F A;  2OA4 A;  2BEO A;  1O3Q A;  4IRG A;  1XX5 A;  5L3E A;  3RPU D;  5K7H A;  5HDG A;  3DTI A;  2VJ4 A;  4IL6 C;  2L9V A;  2R7Q A;  3DKX A;  4A3C J;  4B1R A;  4DYQ A;  1I6X A;  3L2U A;  3CJN A;  2A6H F;  4Y17 A;  3MWM A;  1O4X A;  3FBN B;  2B7E A;  1FOX A;  2VON A;  3AL0 C;  5LHH A;  2CRG A;  4Z6Y A;  5DEQ A;  2NS0 A;  3KZY A;  1TLH B;  1IN8 A;  4RLF A;  3RCO A;  1YO5 C;  4ZJZ A;  1J7K A;  2VBY A;  2V9K A;  5ICF A;  5EG0 A;  3HOS A;  1S3J A;  1WI9 A;  2EV6 A;  3R0A A;  5GTH C;  2JUC A;  2IGK A;  1P7J A;  1X1A A;  2QQB A;  2LFB A;  1W5S A;  3JSO A;  4U7B A;  4BKX A;  1T0F C;  3KIO A;  3E97 A;  5H6Q A;  2W4S A;  2O6G E;  3LSJ A;  3ECH A;  3I0T A;  4OAY A;  4UV8 A;  4CYC B;  5DS9 A;  3FF5 A;  5EGO A;  1T33 A;  3HRS A;  1HXD A;  4KJZ A;  4OIO F;  3MKL A;  3MZY A;  3G6E I;  4P55 A;  1XG1 A;  5J3L A;  1KU9 A;  3M9A A;  5KHD A;  2DTZ A;  2EIN H;  3K4J A;  3AG4 H;  2ZXI A;  3V8L A;  3CC4 I;  3AG3 H;  3HJE A;  1Y1W J;  2DN0 A;  4YFN F;  3F21 A;  3HXL A;  1FSH A;  2ZJ2 A;  1LB2 A;  4XRS G;  4M3E A;  2DLL A;  3IWZ A;  2VL8 A;  1EV7 A;  1WWX A;  5J4Y A;  1QPM A;  1OMI A;  3G71 I;  5LRS A;  2ACJ A;  2R7U A;  3TP3 A;  3FHN A;  4QPQ A;  4KMU X;  3J81 K;  4Y33 A;  1Z0X A;  3IRQ A;  2CW0 F;  5GAH J;  2VJI A;  2H1L A;  1K78 B;  3J7A Y;  2DQR A;  4HSR A;  3OS1 A;  3I56 I;  3IH2 A;  3KP6 A;  1OYI A;  3WE2 A;  2UUZ A;  3QU6 A;  4ASN A;  1J9I A;  2ISY A;  3DBH B;  3F8F A;  3LFU A;  4OU0 A;  2BY0 A;  2O8X A;  1BM9 A;  2XAU A;  4B09 A;  3WTY C;  1X1B A;  4Y52 J;  2R92 J;  5DUI A;  3PQJ A;  4PJN A;  4O3M A;  1OCC H;  2JQ7 A;  4CO8 A;  4PGG A;  3W6V A;  2WC2 A;  1B6A A;  2DFH A;  4E70 A;  2YR2 A;  1YIO A;  1R00 A;  1T08 B;  1EKE A;  2KJC A;  2L7M P;  3FM3 A;  3GUD A;  4D1Q A;  1FBQ A;  2VXZ A;  4GRI A;  5ERI A;  1RKW A;  3GTK J;  5M5X J;  1MBE A;  4NC7 A;  3EUA A;  4LMY A;  1ETY A;  3KZZ A;  2A05 A;  4G8X A;  3FMQ A;  1IDY A;  2KRH A;  2QQ8 A;  3HBL A;  2VKE A;  5J1Y A;  3S17 J;  3ZMV A;  1X4O A;  1ENH A;  4S0H B;  3LNQ A;  4E7H A;  1E3P A;  4DOZ A;  4G7O F;  5EEG A;  1T0F A;  4BEH B;  3CME I;  4IOA F;  5FLX Z;  3O8H A;  1JJ8 C;  2FEZ A;  4DBQ A;  3ZQ7 A;  4ZYE A;  1W36 C;  3HEF A;  2ZFU A;  3GTG J;  1I1S A;  3FIS A;  2KJB A;  3BQY A;  4IHY A;  3OYL A;  4BAY A;  5FLX K;  2QCO A;  1OCR H;  4XON A;  3P7N A;  2OTJ I;  2CYY A;  2VBW A;  3H9Q A;  4M3B A;  4G94 A;  1FYL A;  2O8K A;  1O3S A;  1RI7 A;  3EET A;  1G3Y A;  4BAC A;  4E4H A;  1DDN A;  1C0W A;  3B73 A;  4N9I A;  1A04 A;  3MD2 A;  1QU3 A;  4RAY A;  2KT0 A;  2MYS A;  2DFF A;  2QKM B;  2E1O A;  1P92 A;  1N25 A;  4PZJ A;  2X1D A;  5KAI C;  4EJV A;  2B9S A;  2DJN A;  3GVA A;  3OWT A;  1OCP A;  3T8R A;  1AA7 A;  4GO1 A;  2H6C A;  2Z9O A;  3A02 A;  1P4A A;  1EA3 A;  3I54 A;  1KQ9 A;  1EH8 A;  4KDP A;  2JJ7 A;  4BXF A;  5K5R A;  3DLL F;  4M6V A;  3AKZ A;  1BI0 A;  2HQA A;  5FKO A;  5FKN A;  4DIQ A;  1IRF A;  3VOD A;  1LNW A;  4KN7 X;  1P4W A;  1UZC A;  1I6H J;  3FDY A;  4RDU A;  1FT9 A;  1LJ9 A;  2CJJ A;  1W5C C;  1VND A;  2P4W A;  3OYH A;  1MIJ A;  2W25 A;  4FCY A;  4AVZ A;  1ZQ3 P;  2Z16 A;  5CVR A;  1WGX A;  3KYL A;  4NHJ A;  3WU1 B;  1JTX A;  1IDZ A;  4DW6 A;  4BQA A;  2QA4 I;  4HF0 A;  1UFM A;  1G3T A;  3SEQ A;  3ZMS A;  5IT9 Z;  3J7A O;  1MSF C;  1Y0U A;  2A69 F;  4Q4Z F;  1PUF B;  1J2X A;  4L0Y B;  4AD9 A;  2E36 A;  1XMK A;  2KL4 A;  4WXC A;  2XPW A;  4P9U A;  3BR1 A;  5FKL A;  3BCB A;  4IHW A;  5JFR A;  3PUF A;  2WA0 A;  1FX7 A;  2JPB A;  3GFM A;  2Y75 A;  3I59 A;  5K5Q A;  4A5N A;  4IHS A;  1D5Y A;  1Q1H A;  4MGR A;  1ONV A;  5E79 C;  1HBX G;  3GEZ A;  2IT0 A;  1I5Z A;  1FP2 A;  4BHB A;  3GZN B;  1KGS A;  3RPU A;  2XC7 A;  1RIO H;  1S5L C;  5HLH A;  3IC7 A;  5LD2 C;  4Y7N J;  2NS7 A;  3ML6 A;  2KIQ A;  1SFU A;  5D6F A;  1MZB A;  2HQN A;  3SFZ A;  4MTD A;  5HVQ C;  2Z99 A;  3JRC A;  1SFX A;  2EK5 A;  4I01 A;  4LG0 A;  4LLL A;  2J5O A;  2LR8 A;  2Z5U A;  2BBY A;  4HF2 A;  2ESN A;  3HOV J;  4OAZ A;  2Y0M A;  4PGH A;  2IXS A;  2A3S A;  3QPS A;  5LHI A;  3KP5 A;  2UV1 A;  3BG6 A;  1IXS B;  3A1Y A;  5A2Q Z;  3CTA A;  3DLA A;  3CCL I;  5F6F A;  1H9T A;  1LEB A;  3F0C A;  5EF6 A;  3GZ6 A;  3GBG A;  5M5Y J;  5A2Q K;  3MVP A;  3LAP A;  4HV6 A;  1QVT A;  3BG5 A;  1F9N A;  5C4J J;  5EG0 B;  2ZXW H;  3JRE A;  3CCM I;  2EZL A;  2HOS A;  2XGX A;  1DUX C;  5FJ8 J;  5HOO A;  2CH0 A;  4A0X A;  1XS9 A;  4XQF A;  4HNT A;  2WBM A;  4WX9 A;  4FHT A;  1CQT A;  3QP5 A;  1G8X A;  1VQ8 I;  5HS9 A;  1WQ2 A;  3HUG A;  3C7J A;  2R7D A;  3KP7 A;  1FIA A;  3D5S C;  3WHB A;  2E2H J;  5IP6 A;  3DBR B;  3GLX A;  2MSY A;  4F93 B;  3OY9 A;  1X3W B;  2O5R A;  3MZH A;  1WJB A;  2RQP A;  3LQR A;  4GGG A;  1POG A;  3DU6 A;  3L7W A;  4A2U A;  3IV5 A;  2X4H A;  5D6E A;  4UVC A;  3S1M J;  3OV8 A;  2E60 A;  4RMN A;  2M45 A;  4KNY A;  4M9X A;  4C2T A;  3L2V A;  4YEL A;  1W7P B;  5FO5 A;  4JX5 A;  1YJW I;  4CCO A;  3LSR A;  4J00 A;  1IAW A;  1I3Q J;  1S29 A;  3S14 J;  3K2A A;  1HW1 A;  2RQQ A;  1XC5 A;  1R1U A;  1WI3 A;  3BTC A;  3BP8 A;  2OTL I;  1G4D A;  4M71 A;  1TWC J;  1MJA A;  1FEX A;  4NC6 A;  1U9O A;  1PUE E;  1Y6I A;  4KA4 A;  4RA2 A;  4YIR X;  1STZ A;  2HKO A;  2BYV E;  3H35 A;  2QYO A;  3I9V 2;  3S2W A;  3BPX A;  4ENN A;  1LKX A;  3DV8 A;  4QLC U;  1JGS A;  2DFE A;  2B63 J;  3T1B A;  2ECB A;  4H0E A;  3MEX A;  2MG4 A;  3D5R C;  4RB3 C;  3ESW B;  3IWF A;  4ZDL A;  4M72 A;  3RSN A;  4ETS A;  4ZDO A;  4HOB A;  3EDP A;  4XKV A;  4B3A A;  2EFQ A;  4XNF A;  3GTP J;  5FFZ A;  1VQ4 I;  1YI2 I;  3AL0 B;  4KFC A;  3OIO A;  1XTA A;  1RPW A;  3HRM A;  2DOA A;  1XGN A;  2JZY A;  2V1D A;  3TP0 A;  1YS7 A;  4G12 A;  2XB0 X;  4CCM A;  4CIC A;  4B44 A;  2IA0 A;  1X1D A;  4CZZ A;  2HWV A;  5CQG A;  4F3Q A;  1QA6 A;  2XGE A;  2EWN A;  1I27 A;  2BZT A;  4Q48 A;  4B4C A;  3IH4 A;  2CUE A;  2LOO A;  3K4M A;  4D5F A;  4HX4 A;  1RRJ A;  1P7I A;  2IEK A;  1JE8 A;  3MMY B;  2H1K A;  1WHU A;  4K2E A;  5K1Y A;  2CV0 A;  1BC8 C;  2R7W A;  3WTV C;  5IY5 H;  5LHG A;  2W00 A;  2VKV A;  4HX8 A;  1HW2 A;  1U6G A;  4FQG A;  2OC6 A;  2QSG X;  1SMT A;  4RGS A;  2CUF A;  4Q47 A;  4KIC A;  3EUK L;  1FC3 A;  5DM7 F;  2LYC A;  1SFO J;  3P9K A;  1DP7 P;  4PJ0 C;  2K85 A;  3S1R J;  2IGO A;  4MQ9 F;  2EA2 A;  1MH3 A;  3LSM A;  1OFC X;  2NRA C;  3KLO A;  3F72 A;  4L18 B;  1TW2 A;  4I02 A;  4GDF A;  3ECO A;  2VAS A;  3BTL A;  3HZJ A;  4HW0 A;  4JP0 A;  5M5W J;  2M4G A;  1AOY A;  1OYW A;  1YS6 A;  4NB5 A;  2DMQ A;  4EJT A;  3Q3S A;  1U5T C;  2LMD A;  2LVS A;  2NAZ A;  2XVC A;  4RAZ A;  4EJO A;  4RAG A;  5DUK A;  1IG7 A;  3QYE A;  4F92 B;  1W7P D;  4XOP A;  4XSZ F;  1K6O A;  1TWH J;  4ZC3 A;  1QO0 D;  5D8K B;  1VZ0 A;  2EZH A;  3WTW C;  3FXU A;  5CVV A;  1K78 A;  5E3M A;  5L3F A;  3F23 A;  5E1X A;  4FIS A;  5HNF A;  4PFP A;  1V5F A;  3TO7 A;  3JR9 A;  3H5N A;  4BQQ A;  2A5Y B;  4HST A;  2HYG D;  4XOR A;  2M4K A;  2FBH A;  4A3F J;  5CQE A;  2ZCW A;  4UUS A;  3ROU A;  2FML A;  1BR1 A;  2LD5 A;  3NQO A;  1MJ9 A;  3I59 B;  3UR3 C;  1BJA A;  2DQL A;  2TDX A;  1R5G A;  2LG4 A;  3SXY A;  5ED4 A;  1B9N A;  3CZ6 A;  3SFI A;  2CU7 A;  3K10 A;  4PJM A;  3X2Q H;  1GXP A;  2E2I J;  4A3E J;  1DQU A;  2DJI A;  3DF8 A;  3EPZ A;  5AIQ A;  3DFG A;  1JKP C;  3BR2 A;  4EQQ A;  1E3O C;  1JGG A;  2LY2 A;  2HPM A;  1CF7 B;  1ZGA A;  2KDZ A;  1Z6T A;  3JAM K;  3OYE A;  2RDP A;  3BY6 A;  1L0O C;  2NVU B;  2ZNY A;  3W6J B;  3ZCO A;  1Z05 A;  3TW7 A; 
#chains in the Genus database with same CATH homology
 2IGK A;  1X1A A;  4XL9 A;  4KT6 A;  4U7B A;  1T0F C;  3QOE A;  4BEH A;  3ZXS A;  3E0J B;  2X6W A;  2K9M A;  5FRN A;  4XLF A;  2W4S A;  1WFX A;  3BCA A;  3UNG C;  2HVQ A;  2XF6 A;  1TZL A;  2HZD A;  2LBF B;  4OAY A;  2BVL A;  3W3C A;  3K4K A;  3OL4 A;  2BW3 A;  3OIQ A;  4E7L A;  4KJZ A;  2R7R A;  2VKD A;  1MMA A;  2X51 A;  3HPG A;  1Z7L A;  3VYS B;  4BQN A;  4BGD A;  3TMO A;  2IGN A;  4CCL A;  5KHD A;  3K4J A;  2W1O A;  3S32 A;  3IP4 B;  2ZXI A;  1QHG A;  5FRO A;  3ZR8 X;  4ZYA A;  4AYB A;  5HLT A;  3RTR A;  1HA8 A;  3OOU A;  4DGW B;  3HXL A;  3F9K A;  2KZV A;  3CP8 A;  2X1C A;  4C30 A;  4BE2 A;  2VL8 A;  2GOX B;  1WJF A;  2ZSH B;  2CMP A;  2XSJ C;  2R7U A;  3FHN A;  5CKT A;  4QPQ A;  4ANJ A;  4Y33 A;  5KNL A;  2VJI A;  3J7A Y;  1U0J A;  3MKY B;  2IS1 A;  2Q1Z B;  4B3X A;  4E7J A;  4HSR A;  2Z2S B;  3NWS A;  3OS1 A;  3VSL A;  3LSK A;  2UUZ A;  2HPI A;  3VYT B;  2DT6 A;  3LFU A;  4CCJ A;  2WY7 Q;  4JOM A;  1QHH D;  3QYB A;  1X19 A;  2FUG 2;  4XM3 A;  3H5A A;  2XAU A;  1ERD A;  1X1B A;  3K4N A;  4FAS D;  4U87 A;  4PJN A;  4C2U A;  2PJR B;  2IGM A;  2RNG A;  4PJL A;  2VJJ A;  4C9Y A;  4LIT A;  3A4C A;  4BU2 A;  4D1Q A;  2VXZ A;  4GRI A;  1YX5 A;  2LC2 A;  2V7F A;  3EUA A;  4NC7 A;  2R7T A;  1R6R A;  2WB1 A;  2KRH A;  3KEY A;  3PUB A;  2V6E A;  1X4O A;  2XF5 A;  4E7H A;  2NOJ B;  4DOZ A;  4BEH B;  4DJA A;  2JSP A;  4XR6 A;  3PJR A;  4DBQ A;  1W36 C;  1N77 A;  2ZFU A;  4BDZ A;  2XF7 A;  3SDB A;  3OYG A;  3ONQ A;  3OYL A;  2IS2 A;  2BW3 B;  4XON A;  2I8D A;  2PMZ A;  2JVG A;  4Y3O A;  5LFA A;  4LG3 A;  2V26 A;  3H9Q A;  2VB6 A;  3OYK A;  3D5L A;  2K9L A;  4HG2 A;  1W36 D;  2R4G A;  3K70 C;  4N4N B;  1K6Y A;  2CW7 A;  2BVM A;  4BAC A;  3H9J A;  4E4H A;  1X4P A;  3OYJ A;  3MD2 A;  1QU3 A;  1WJE A;  2KPM A;  2MYS A;  2QKM B;  2CV2 A;  3W2W A;  4X0G A;  2X1D A;  2RRE A;  3G2B A;  3OWT A;  2M7A A;  1AA7 A;  4ZTF A;  2LRD A;  3DPL C;  1NG6 A;  3OIP A;  2VJ5 A;  3K4L A;  2K5C A;  1EA3 A;  4XMY A;  3ZQQ A;  4BXF A;  2HVS A;  3L2R A;  2KLO A;  4E6K G;  3AKZ A;  1S9H A;  2HQA A;  4XLC A;  4HNU A;  4P1W A;  4LIU A;  4DIQ A;  2KRC A;  4HRI A;  1DGW Y;  3FDY A;  3C2H A;  1G59 A;  3BLY A;  4NC8 A;  3OYH A;  2CS3 A;  4II3 A;  4AVZ A;  3TL4 X;  2Z16 A;  3RQ4 A;  3VYU B;  4DBR A;  3OL3 A;  3KYL A;  1X1C A;  3IUO A;  1GLN A;  3BG7 A;  4CCN A;  2R7O A;  2DXI A;  2XDV A;  2P0W A;  2KL4 A;  2L9S A;  4RM2 A;  3ZRG A;  2V1N A;  4KIT B;  1WJ5 A;  1N78 A;  3BCB A;  2L7K A;  2WAQ A;  1ZEL A;  2KP6 A;  2WA0 A;  2K3P A;  2HU9 A;  2LH9 A;  3FKJ A;  1BR4 A;  3OR1 C;  1N75 A;  2CUZ A;  3SZG A;  3K6G A;  2WY8 Q;  4CH7 A;  3LSH A;  2L9N A;  1UG0 A;  4ZTJ A;  1SFK A;  1LDK B;  3H0D A;  1FMV A;  2XC7 A;  4NUB A;  3OMY A;  3LMM A;  4F55 A;  5LD2 C;  3S3O A;  1NG7 A;  3VSK A;  2VPL A;  1WJA A;  5HVQ C;  3HKZ A;  2HNH A;  3HG9 A;  1Y56 A;  4OAZ A;  1FMW A;  2IXS A;  4PJJ A;  2JA2 A;  2UV1 A;  3S93 A;  2MAB A;  3BG6 A;  3VWB A;  3A1Y A;  3DLA A;  2LBF A;  3SYT A;  3K4C A;  3QOD A;  1Z3Y A;  4CUG A;  3OYB A;  2X85 A;  2QKL B;  3GBG A;  3OYM A;  4AU7 A;  3EUH C;  1DGR M;  1WJC A;  5HOO A;  4XOT A;  2CH0 A;  4II2 A;  4XQF A;  4HNT A;  2WBM A;  4BL0 B;  2JUG A;  4B43 A;  1G8X A;  1YX3 A;  2OV7 A;  4RLQ A;  1JI8 A;  2HVR A;  3D5S C;  3K4B A;  4BS9 A;  1MW7 A;  3OY9 A;  4B48 A;  4F93 B;  4YRV A;  2O5R A;  1WJB A;  2E1M B;  4BJ6 C;  4R79 A;  3PSF A;  1MMD A;  3M1C A;  3HL2 A;  2M7B A;  2X1E A;  3DU6 A;  4QPO A;  4PFO A;  4IQJ A;  2E5N A;  2JVH A;  2VIX A;  1IRX A;  4CZC A;  2Y0S A;  3ZGK A;  2E60 A;  4RMN A;  4MLO A;  3DU5 A;  3H5R A;  4D9J A;  4C2T A;  3L2V A;  3PNY A;  4YEL A;  3MKW B;  3PNV A;  4NQW B;  4CCO A;  4J00 A;  1LFP A;  3S8P A;  5HNH A;  1D0X A;  3OYN A;  5TGT A;  2RQQ A;  5CPR B;  4ZDP A;  3VYR B;  4N4O B;  3NWT A;  2IS6 A;  4PSX A;  3DEE A;  2VQL A;  1YE9 A;  4F52 A;  2E5Z A;  1T95 A;  4OWR B;  3DTE A;  1Y6I A;  1WJD A;  4PK4 A;  3N05 A;  3H35 A;  2Z1D A;  3CP2 A;  3I9V 2;  2A5W A;  1V5E A;  2R7V A;  2F4I A;  4E7S A;  1LKX A;  2X6Y A;  3OYI A;  4HPQ A;  2R7X A;  4XLH A;  1J09 A;  3W2A A;  2CW8 A;  3C2G A;  3U21 A;  2L2O A;  4XKW A;  1D0Y A;  4XN3 A;  1BR2 A;  4EAT A;  3D5R C;  5JHF A;  2AQF A;  4E7Z A;  1DP3 A;  4ZDL A;  3RSN A;  4BJ5 C;  3CJR B;  4XLE A;  4ITV A;  2MD0 A;  3LL7 A;  3M8J A;  1Z21 A;  4ZDO A;  2KQR A;  4LIV A;  3TBI A;  4XKV A;  4XNF A;  2VXD A;  2WAD A;  3OS0 A;  4H4K C;  3BC8 A;  3CMM A;  3AL0 B;  3KX2 A;  4B47 A;  3L2Q A;  3HPH A;  3PNT A;  3V42 A;  2GOM A;  3CES A;  2DOA A;  1UAA A;  2OUM A;  1MMN A;  3DQV C;  4E7I A;  4CCM A;  4B44 A;  1X1D A;  5CQG A;  4F3Q A;  4XLA A;  1PYV A;  3MKZ A;  2M0M A;  2W82 A;  2LOO A;  2MFZ A;  1LVK A;  3DPT A;  3K4M A;  3OYC A;  3DKY A;  3LSG A;  2VKH A;  3L2W A;  3IAM 2;  3HUG B;  1MNE A;  3MMY B;  4PSW A;  3QYF A;  2CV0 A;  3PSI A;  4PUS A;  2R7W A;  2WAE A;  4BUP A;  2VLA A;  2ZXH A;  2VQC A;  2W00 A;  1SAU A;  3IAS 2;  2OC6 A;  1TT0 A;  3HC7 A;  4F91 B;  3OR2 C;  3OS2 A;  2F6C A;  4Y4R A;  3EUK L;  4RM3 A;  4XKB A;  1UEL B;  2LYC A;  3PFY A;  3OYA A;  2KHM A;  2ELJ A;  2W7N A;  2WAF A;  2IGO A;  2DT7 B;  4BJT A;  2Q2E B;  4CCK A;  3LSM A;  1D0Z A;  4G6T B;  2E1M C;  3DPU A;  1P9Q C;  4NNJ A;  2F5V A;  3OYF A;  3FBI B;  3VDX A;  2VAS A;  4BQO A;  2M4G A;  2MC4 A;  4IX7 A;  2VQH A;  2UWM A;  1V5G A;  4BDY A;  3DWL E;  4J01 A;  3E1S A;  3SEZ A;  3A2K A;  3DTK A;  4CSW A;  1D1C A;  3W2V A;  2CV1 A;  4BE0 A;  1D1A A;  4KIS A;  2CFO A;  3OYD A;  2KMU A;  3QYE A;  3PL8 A;  4F92 B;  3I3L A;  4XOP A;  1KON A;  4ZC3 A;  4BE1 A;  1E0E A;  2KDO A;  1VZ0 A;  3H9G A;  3S3M A;  2VQG A;  1PJR A;  5HNF A;  4PFP A;  1V5F A;  2R7S A;  3H5N A;  4BQQ A;  4P5O A;  4HST A;  2DCE A;  5KCM A;  2A6T A;  4YEJ A;  3AFH A;  4XOR A;  2M4K A;  4E7K A;  4JQF A;  3HOT A;  2BOL A;  5CQE A;  2CUJ A;  2M3A A;  5FRM A;  1Z3X A;  2L5Q A;  2X6X A;  2LRE A;  4CA0 A;  1BOB A;  1BR1 A;  3RPU D;  1OLT A;  3UR3 C;  2PJR A;  3DTI A;  2LG4 A;  4HEA 2;  2VJ4 A;  1MMG A;  2HDW A;  2R7Q A;  3CZ6 A;  3DKX A;  3LSI A;  2V4J C;  3L2U A;  3K10 A;  4PJM A;  3CJQ B;  4IKF A;  2LY1 A;  1DQU A;  2AQE A;  2DJI A;  3EPZ A;  3FBN B;  4FET A;  3AL0 C;  4IZZ A;  3CF2 A;  4RLF A;  3RCO A;  2LY2 A;  2ZSI B;  4ZJZ A;  3K70 D;  2V9K A;  2HPM A;  4XKC A;  3S3N A;  1MND A;  1OR7 C;  3OYE A;  3HOS A;  4XN0 A;  2IS4 A;  3ZCO A;  1D1B A;  3SEQ A;  4IQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...