3A4CA

Crystal structure of cdt1 c terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
RCPEQELRLQRLERLPELARVLRNVFVSERKPALTMEVVCARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLHRIRTDTYVKLDKAVDLAGLTARLAHHVHAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Cdt1 C-terminal domain: Conservation of the winged helix fold in replication licensing factors
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle, replication
molecule keywords DNA replication factor Cdt1
total genus 34
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1420 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3a4cA00
2KLOA 3A4CA 2RQQA
chains in the Genus database with same CATH superfamily
2MG4A 4ESJA 4U0VA 2VJJA 1K78A 3LSPA 4HRIA 1R1TA 2OZ6A 2P6SA 5HNHA 3MD2A 2PQ8A 3EUHA 1T95A 3HG9A 1IF1A 1Y8RB 4YG2F 2P5LC 3TKYA 2E1OA 3VFZA 5EEAA 2L01A 2E60A 4LG3A 5EYRA 3IRRA 5B5EC 2M9HA 2O61A 4IHYA 1GUUA 4UXNA 2MSYA 3NQOA 3H9GA 3VSLA 2LY9A 1MD0A 4XSXF 1IV8A 3L2CA 4XRSA 1S72I 3HRTA 3I56I 3DLLF 4A3DJ 3CCSI 3JAMZ 3MAJA 1JUSA 1R5GA 2BW3A 1YW8A 2VQLA 2BYVE 1MJBA 5JI6A 1UG0A 2DFEA 1SMTA 3FMQA 2H6BA 4EATA 3C2GA 4I01A 5EZHA 5EGOB 4RDUA 1MBFA 2XPVA 2Y30A 1JKOC 1SFEA 4C3IJ 1FJLA 2WY7Q 3X2QH 4QLCU 2CQKA 4OOIA 2BW3B 2XF5A 4UUTA 3ABKH 3E5QA 4UY8I 3MKWB 3QPSA 1MMNA 1X3ZB 1YJ9I 4EGYA 1YS7A 3ZMSA 4DYRA 5LLQA 3HPGA 3QPTA 4BACA 1Z21A 3DPTA 2QBYB 2HEOA 4AIHA 2CH0A 2A6TA 3GX4X 5J4YA 1B72B 3O8HA 2PMZA 2XASA 1VQKI 3RPUD 4M72A 3HSEA 1G2HA 1R00A 2P5KA 3WG9A 1QHHD 2A5YB 2GXAA 3LA3A 3TO7A 3WTTC 2B9SA 2E19A 5H20A 4D9JA 2LFBA 1HKTA 3PSFA 3F3XA 3LSIA 3OYAA 2CSOA 4XKCA 4M6XA 2E71A 1R71A 4CGZA 3FIWA 1B9MA 2RN7A 3ZGKA 3BTLA 2K4BA 2PFBA 1W1WE 2QENA 1OCPA 1WWXA 4HAMA 3K4KA 5CVUA 2LDUA 4Y17A 1IC8A 4LD5A 3OY9A 1QZYA 3CDIA 3DBHB 2O0YA 1D0XA 1AKHB 2Z16A 5L3DA 4WK8F 1FOYA 3V42A 5IPAA 2VOPA 4OAYA 4JX6A 3WGHA 1Y6IA 4F92B 2B7EA 3DKWA 3VYRB 2E5ZA 3BR1A 4O6JA 2COBA 4WCGA 4FX0A 5TGTA 2VT2A 3M9AA 1R5ID 2Y9ZA 4FISA 1W36D 2RNJA 4UB6C 2QCOA 2XAJA 1YTYA 4IO9F 4E7ZA 1VQMI 3RKYA 3PIPF 3FF5A 3CUQC 3ELKA 1HW5A 3GTLJ 2DW4A 3PQJA 4E6KG 2HXOA 3D5SC 4CZCA 3Q9SA 2KDZA 4A0XA 1MMDA 1OCZH 4IXAA 5FRNA 2M7AA 1YHQI 2R7DA 4MFDA 5CVRA 2BV6A 3HPHA 1SVOA 1X58A 3KYLA 2JSPA 2W24A 3DKXA 4XRMA 3FBIB 3I0TA 4AIKA 2GLOA 3CC4I 4YEJA 1FC3A 1R1UA 3G6EI 1BR2A 2DT5A 2LYCA 1KYWA 3L2QA 2DI3A 3OL4A 2LOOA 1ETKA 4HSRA 5KK1A 1FT9A 5E8IA 3G73A 1S5LC 1PUEE 3W6JB 5J4VA 2KT0A 1YQAA 4Q47A 1TT5B 3P5JA 1LDDA 2EA2A 3HHGA 3S2WA 2HQRA 3L00A 1LPQA 5BOXA 2D2WA 3S3NA 1IDZA 1ENHA 1KA8A 3CDHA 1QPIA 3LMMA 2A07F 1UMQA 2ZSIB 2HVQA 4HG2A 4XORA 4LB5A 4KA4A 2DBBA 3HRMA 1R58A 4I76A 4A93J 1HOMA 4KDPA 1Z7LA 1S8NA 2DLLA 1Z6TA 3ZQQA 1SAUA 5HDNA 4R8HA 3WTUC 1FIPA 4HZFA 4RAYA 4E7LA 4XONA 3GZ6A 1MMGA 1ZELA 4XSZF 2ZXWH 1UHSA 1EH8A 3K9TA 1J9IA 3LSGA 2E2HJ 5CKTA 1BL0A 3LSHA 2JTVA 4RB2C 2GA2A 3J7YJ 3GMEA 2KL4A 3L2UA 3LQRA 2HKXA 4HNVA 1VTNC 3KP6A 3CMAI 2A68F 5HDGA 1BJAA 3MVPA 3FHZA 3V8KA 2ETHA 2DYRH 3KZYA 3BROA 4L9JA 1WHUA 3OYIA 2RKHA 2W25A 3TP3A 3GYHX 4EV0A 1XMKA 3ML6A 3K4LA 2QUFA 4A12A 3RZOJ 3QYBA 2NRAC 2FD5A 3E6DA 2XF7A 2R7VA 2KJCA 1BW6A 1YX3A 3E6BA 4NUBA 5GPCA 2NS0A 2IS2A 5DD8A 2LY2A 1DU0A 1WI3A 4RBOA 3I53A 3H35A 4KN4X 3WGIA 4BQOA 5IYDJ 3WE2A 1PVEA 1B8IA 3NEUA 5JLWA 1O3SA 3CCLI 1MBEA 5IY5H 3AG2H 4BEHB 1BA5A 5FKOA 5BPDA 1D1BA 5K5OA 3QU6A 2M0CA 1ETVA 2NS7A 1XGSA 1VQNI 3VWBA 5E18F 1UAAA 4ENNA 1U9OA 2P81A 3UR3C 3QQAA 4IVNA 4KT6A 4A5MA 4E4HA 2JA7J 1E3HA 5DYMA 4D5FA 1LUJB 3H9JA 2K40A 5L3FA 4LIVA 4CA0A 2HOEA 1FTTA 4NB5A 5M3MJ 6PAXA 1UHMA 3TEDA 1T6SA 1VF9A 3AG3H 2ID3A 1RESA 4DBRA 2JK3A 3OMYA 5DD4A 4A3LJ 3K1MA 1JGSA 2DPUA 3H3ZA 3PO2J 1WJEA 1UCRA 1QBJA 4BQAA 4C30A 1O3TA 1YLFA 4DIQA 1CQTA 3AAFA 1LEAA 3FK6A 4A6DA 1FY7A 3ZMDA 2ELKA 2BGCA 2Q2EA 4M74A 2CWEA 1JXSA 4XQFA 3DU6A 4NNJA 4MGRA 2PJPA 1I3AA 2K3FA 4BS9A 1W36C 4M3FA 2VASA 3OSFA 2E5NA 2QGUA 3JSPA 2VODA 2GOXB 1FP1D 2IAIA 4NQWA 4ESFA 5L3GA 4C9YA 3VPRA 4E7IA 4ZDLA 1E0EA 2PG4A 4ENKA 4ZYDA 3JSOA 2AQEA 3J7AY 3KIOA 4C2UA 3DP7A 3QAHA 1MNDA 2LF7A 2XROA 2P8TA 3AG1H 4I7HA 4RAZA 5LFAA 5F1RA 2R7WA 3J81K 4D7NA 3E5XA 2R3SA 4CYCB 2WAFA 3Q0UA 4WWCA 5FFZA 1XDUA 4BXFA 2YPRA 3LNQA 3ECOA 2F4MB 2KQRA 1ZK8A 2F5CA 3H0DA 1YITI 3W2WA 3TO6A 1B4AA 5IOZA 3I9V2 3HOWJ 1T08B 4MO7A 2QBYA 4DYCA 2LK2A 2LTPA 3TMOA 3L9FA 3HUGA 3K4BA 2K27A 1GHCA 1IDYA 4FETA 4YIRX 5JR3A 3ABUA 5HS8A 3P7NA 4YIFA 2K9NA 3FHNA 4S0HB 3AG4H 3TBIA 1TQMA 3VODA 3I54A 4YFKF 4I6ZA 1VI0A 2UXXA 3RZDJ 3WTYC 4L0YB 1QRYA 2P5VA 3DBRB 1FSEA 5FLXZ 2Z99A 4A3BJ 2LR8A 1S7EA 1W5TA 1I5ZA 2L3DA 2VXZA 2ECBA 5FJ8J 3IAS2 1OJLA 1TW3A 3L2WA 2QQ8A 1LFBA 4FTHA 3IWFA 1FOXA 3GO5A 2HNHA 4PFOA 4LG0B 4UVBA 1QGPA 3HSRA 3SJMA 1OYIA 3OYNA 2LG4A 3L1PA 1RUNA 1I1SA 4UHTA 1BC7C 5F08A 3AFHA 1LVKA 1PP8F 4L9TA 1QA6A 5F0CA 2XAHA 3KETA 2LVSA 3HOTA 1E3PA 3PNTA 4EJOA 4B8XA 4Q5SF 4C2TA 2CUZA 5K7FA 2V6CA 4LLNA 1OPCA 1K6YA 1WJDA 3JTHA 2ESNA 1NH3A 1S7OA 2CQNA 1H89C 1S3JA 4XNFA 1AHDP 2HI3A 2XB5A 3TDUC 3EYYA 3AL0B 1IUYA 1BI1A 4G9YA 1IRXA 4BQQA 3WU2C 1DP7P 3MZ8A 4AC0A 2GQQA 5F0FA 1G4DA 1HXDA 2CS3A 2HWVA 1DUXC 1MBGA 1O7FA 2P7VB 3K6GA 5KNLA 4DJAA 1EH7A 4Q4ZF 4I0AA 2NXNB 5HODA 2JRTA 2EFPA 3EUAA 3H1CA 2XSJC 4S05A 2E1NA 2QQBA 3ZMZA 1C0WA 3VYUB 2EV5A 2Z5UA 3LFKA 4DQ2A 1BBYA 4RGXA 2DMNA 1I39A 5BPIA 2Q1ZB 2Z2SB 2M1BA 2IP2A 4CSWA 3IHUA 4HV5A 4ZYGA 1OCTC 1HQCA 3P9CA 2OPTA 5ICGA 2WY8Q 1ZREA 3J7ZI 5J8FA 1HKSA 3QP6A 4HV6A 3VEPA 3BR5A 4LIUA 3BZCA 4BDZA 2JA6J 2EFNA 2XF6A 4EJWA 4IX7A 2Y31A 3CESA 1GVDA 1BM9A 5FKNA 3M3YJ 4U87A 2O9LA 5C4XJ 2HOTA 1ORKA 1USSA 2VKHA 5ILUA 2YU3A 2A05A 3CMEI 2UUZA 1ZR4A 5E79C 1D8JA 2L0KA 3GFJA 2OZUA 2HQAA 4JP0A 4Y13A 1KU9A 3WE3A 2R5ZB 3KEOA 3F8BA 1IGNA 1V54H 5H2FC 3K1PA 1D1CA 1Y39A 4ETSA 4IHVA 2ZJRF 4A3IJ 3U9GA 3FXLA 2F5DA 5JVGF 1YJNI 4HX7A 2H6CA 3BP8A 3PNVA 4BY7J 2NVTJ 1S7AA 3OS2A 2D45A 4BYYA 5EGOA 2XDVA 2HQ5A 3KYCB 4BBRJ 3D5LA 3SDBA 3G2BA 5IP9J 4ANJA 1GV5A 3CJTB 5K7HA 2DMQA 2DU9A 3JAMK 3I5UA 4XBFA 1TWFJ 1YIOA 4IRGA 2EIKH 1WKMA 1HC8A 2V79A 2HOSA 3RJPA 1U2WA 5FO5A 4DBQA 1Z1DA 4GGGA 1JJ6C 5IT9Z 1ETOA 2NOJB 4QIWN 2GAUA 2YS9A 2KIMA 3IH4A 3MKLA 4B09A 3CZ6A 3MQ0A 3W2AA 4ZYEA 2MLGA 2MD0A 3A02A 3PIOF 2XPUA 3BG5A 2KKOA 3VYTB 1Y0NA 3G1OA 4C3JJ 2ZMEB 3BLYA 3EQLF 4M71A 2ME0A 2WTEA 4BHCA 4LFUA 3MCZA 3GZ5A 2V9KA 2ZJPF 4HF1A 2DA2A 2DYSH 1EJ9A 3HTUA 3GFMA 2CQXA 1U0JA 3LOCA 5FB2A 1HF0A 2L9RA 4ZC3A 1MDMB 2FUG2 3IC7A 3V7SA 1A04A 2DFFA 4L9NA 4FCYA 1TL8A 2E35A 3VSKA 1RI7A 2QSFX 3HZJA 3W3CA 3RI4A 1NK2P 4IJAA 3U2RA 4KFCA 1O57A 1XGOA 4PSXA 4R1HA 1W7PA 2EK5A 4N0BA 2V1DA 4B3AA 2ICWG 2NS8A 3BWGA 4P1WA 3OYBA 2VIXA 4EM0B 2JPCA 2W48A 3TO9A 4F7ZA 4AIJA 1R22A 3PUFA 1YW9A 2CQ7A 4X6AJ 1WFXA 2M30A 3ESWB 3CC7I 1W5CC 1H9GA 4GO1A 2FA5A 2L9VA 4Y7NJ 2Q0OA 1RPWA 2V9VA 5CJ9A 5ERIA 4KUMA 1BR1A 3KYDB 1SFUA 1UG2A 4BL0B 1YI2I 2FX0A 3DKYA 2BEOA 2K02A 5IT9K 1TP4A 1XDSA 4D0PA 3F72A 3CJNA 4XKVA 3EYIA 4JK1X 3IWZA 2FQ4A 1T56A 3PJRA 1FNNA 3FK7A 4HX4A 1HW2A 2AQFA 2QLZA 3LAJA 1TNTA 5FLXK 1X1PA 2QZ8A 3S3OA 2R7SA 3BG9A 3OYHA 4MIMA 2FSWA 2LKSA 4Y15A 4H0EA 1W4MA 3ZQLA 3PUBA 2RQPA 1V4RA 2JSCA 3TP0A 2LKXA 3QYFA 2Y75A 2CO5A 2Y0MA 5LBQA 4LK0F 1LFUP 2OCEA 2ZB9A 3SFIA 3GFLA 1ITYA 5JFRA 2BOLA 5ICCA 3RQ4A 4BEHA 2HDDA 4AM3A 2BY2A 2VI6A 2ISYA 2L54A 2FNAA 4AVZA 1RKTA 3LSRA 1N75A 4M3BA 2ZBKA 2LKPA 3IH2A 3REOA 4XL9A 3ZR8X 4PJLA 3GTJJ 1K7AA 4B4CA 3DCFA 1VQ9I 4PSWA 4IPAA 3HOVJ 2EBIA 2H8RA 3G1MA 1U9NA 4M9XA 3MKYB 1GV2A 2IS4A 3SXYA 4GYGA 3CP8A 3OR2C 1ZN2A 3OYLA 2Z1DA 1ZARA 3HOYJ 4L5EA 3K70C 2WAQA 4FE4A 2R7FA 1FWZA 2MC3A 4ASNA 2X6OA 1ZGAA 1E2XA 3HIFA 4XN0A 3UNGC 4N9HA 4E70A 4G6DA 2AS5F 4RM3A 2D1HA 3VDXA 1XN7A 2Y48A 1V5EA 3L7WA 1SFOJ 2Q2EB 5F04A 3WG7H 2DQLA 1R9TJ 2EILH 4XLCA 4CCLA 1G3WA 2VN2A 2XUBA 3KP4A 4DOZA 3S93A 1IUFA 2VQCA 3HXLA 4P9UA 2AHQA 2E1MB 1JHFA 4U7DA 3M1EA 1SD4A 2W4SA 1HSJA 2O6GE 3CP2A 5IT3A 1UFMA 1SD6A 5F64A 2FMYA 1RR8C 3LSJA 1IN8A 2HOAA 3CJQB 4XK4A 5HNFA 3BOQA 2UWMA 2BXYA 3KLOA 2C6YA 5KCMA 5HLHA 2FRHA 2A6HF 2M8GX 3Q9VA 1MBJA 1YG2A 2RV8A 2HDCA 1LKXA 2OBPA 3H36A 4BJ6C 3HGGA 3MN2A 1YOVB 2WV0A 3K2ZA 3I64A 5L3CA 5JHFA 3BTJA 3KEQA 1IRZA 4RAGA 2CW0F 1P2FA 4XR6A 1U3EM 3CDLA 2HR3A 2YX4A 4YRVA 1L0OC 2WAQN 4CCKA 4Z6YA 3TW6A 3CO7C 3C3WA 2EIMH 3QOPA 2VC0A 2EWNA 2M7BA 1ZR2A 1YIJI 3FXMA 2R92J 1NTCA 2DTZA 4HBLA 2IBDA 5H6QA 2QKMB 1SAXA 3I55I 5IOYA 3KP3A 3QU3A 4GYIA 1QZEA 4HW0A 3FXQA 3M8JA 1O3QA 4MEYF 2JPBA 1ZG1A 2IT0A 5FLMJ 4J19A 3K4CA 2EJRA 2JVHA 4C3HJ 1VQ5I 3CCYA 4YFXF 1W7PD 5ICFA 5FGMA 2PMZN 4WXCA 3GTGJ 5E8GA 3GTQJ 2R5ZA 4NC8A 2ZXJA 2VKEA 3ZXSA 3KX2A 4F55A 1H88C 3ZN0A 3KZZA 3RYRA 1MJ9A 4A0ZA 3TQNA 4J00A 4KYWA 3GUDA 1E3OC 2WC2A 1X4PA 4MLOA 5AONA 3ZP5A 3I3LA 5BNGA 2LC2A 2FOKA 1Z9CA 1SC7A 4IRIA 4G7ZF 4G7OF 3LWFA 5EZGA 5GADJ 3BT9A 3TDZC 4DNCA 3KCCA 3S8PA 1WJFA 4A6EA 2HZDA 3PNYA 5FROA 4BU2A 4LMYA 3H9QA 4A5NA 1T8IA 2DCEA 2DOAA 2OQGA 1P7IA 2A3SA 1OCCH 4NC6A 4HDUA 2QWWA 5LHIA 2KP6A 4BDYA 3K4NA 5D6FA 3MZYA 1Z77A 1U6GA 2BY1A 1WJAA 2XRLA 1NG7A 2YU9J 3JRCA 4RGSA 3KP7A 2TRTA 3B02A 4FX4A 4IL6C 2O5RA 2F4OB 2GZWA 5IP7J 5LRSA 2R7RA 1PUFA 4AWXB 2NAZA 2IGMA 3E3VA 2O7OA 4EJVA 2ID6A 2COMA 4FASD 3ERMA 3BJOA 2F4IA 3GXOA 1KU2A 4UUSB 4JX4A 1FYLA 1RUOA 2R93J 4IHWA 2MD5A 2LNBA 3C7JA 1ZGJA 1BN5A 3PL8A 3UKGA 1EKEA 1W7PB 1WQ2A 5F6FA 4KNYA 3MEXA 2JT1A 4EMSA 3A01A 1HDPA 2CRGA 2XGDA 3I58A 1TW2A 1X2MA 3ABTA 1KU7A 2G7UA 4LITA 3W6VA 4N9IA 3B73A 1KU3A 2DA5A 3O6BB 1ZYRF 4B3XA 3A01B 3B6AA 2GIZA 5DCMA 3OYEA 1G3SA 4EVIA 1LJ9A 1XC5A 2HDWA 1HW1A 2XKOA 2HZTA 3F8CA 3HKZN 1V5FA 4CUGA 3R0JA 4XIDA 3ZMTA 3QPLA 2R7UA 4BH9A 1I1GA 2XAUA 1BOAA 2HFHA 2BY3A 3ZQHA 4D5CA 2BE5F 4W1UA 4XOTA 2PEXA 3DXJF 2CUJA 4NDLA 2MA3A 1EF4A 4CCJA 2FQ3A 3OWTA 1MW7A 1KYZA 4L5JA 4B47A 4L9VA 4AVPA 4OMYA 4R79A 3FMRA 1KGSA 2WADA 2O8KA 2DA7A 3F8NA 1E17A 1K83J 3F8MA 1OKRA 3KFWX 2VQHA 1X19A 3QPHA 2X4HA 2X1CA 2HU9A 1VNDA 4LK1F 4RMNA 2GBYA 4B1RA 3F9KA 5CQEA 3L2RA 2JRMA 2KPMA 2K9LA 3QRFF 2EIJH 3COAC 3ZN1A 3IAM2 2ZNYA 2UV1A 1A31A 4A3JJ 2OTLI 1JJ8C 3JTGA 3HSFA 1TWGJ 5EDNA 3CC2I 3SZPA 2W1OA 1F9NA 2PJRA 3BQYA 1SEUA 4LOCA 4JOMA 1ZHFA 1IXSB 4MHGA 1I27A 2E1MC 2PJRB 2EPFA 2FF4A 2VLAA 3ZQ7A 1Q1HA 2X0LA 2XVCA 1J59A 3T1BA 1KQ9A 2E7XA 1ULYA 1FMWA 9ANTA 1UELB 3D5RC 3CCMI 4XICA 3A0HC 3BCAA 3SZTA 3IL2A 1ZTRA 1DGRM 2H8WA 4WX9A 2ME6A 2ZJ2A 2DA1A 1X3WB 2E34A 1FZPB 5FLVA 3WTZA 4LB6B 1TZLA 2OJED 3Q0WA 5HVQC 1K61A 2R7ZJ 3R0AA 3GW2A 1DGWY 1TBXA 2WA0A 4MEXF 1AWCA 2IGKA 3M8FA 1A6QA 2MGQA 2L4MA 3RDIA 5C4JJ 3K2AA 4Y4RA 4L18B 2M4GA 3W6KB 3Q5FA 2RQQA 1WRJA 5GAEJ 4PJJA 4I02A 1B1BA 4LLLA 3RPQA 4KMFA 2Y0SA 3GVAA 4YIIA 2OCCH 4F52A 1T33A 2MW8A 2QKLB 1OQYA 5M5WJ 4I98B 1F1ZA 1GXQA 3ZQGA 4RA2A 1X1DA 3ROUA 1XMAA 5DCFA 2PBIA 4MNUA 4FHTA 2EZIA 3JCUC 5DEQA 2XHKA 3DFGA 4X0GA 2RAEA 3BTCA 1RRJA 1REPC 1JI8A 2F6CA 3LSKA 4FQGA 4WXDA 2LREA 2VC1A 2DJNA 2ZSHB 1VFCA 3N97A 2FOWA 2TCTA 2XGCA 1Q1VA 3V7CA 2K7LA 4P9FA 3FX3A 2WB1N 4ITVA 4CH7A 1PDNC 3I59B 3JRHA 5EF6A 2X6YA 3T8RA 2HXIA 5L3EA 1BIBA 2JA2A 5ILSA 1JUPA 3LAPA 3A1YA 4K2EA 1HLVA 1R36A 3M07A 1BOBA 4G12A 3QWLA 3A4CA 3GTKJ 5LGUA 2B0LA 1LE8B 2CYYA 3NWTA 1JUMA 2KIUA 1T0FA 2QSHX 3HOSA 5BQTA 5D4RA 1LFPA 2R7OA 5D8KB 5M5YJ 3G4SI 4M3GA 4DZPA 2P7CB 3GLLA 2V7FA 4CXFA 4E7JA 2L7ZA 4MTDA 4H4KC 1JKRC 1UHWA 4QSHA 3MMYB 2K4JA 5D6EA 3KP5A 5B1BH 1FYMA 1V55H 2HVSA 1Y1WJ 2QEXI 1VQ6I 2DT7B 3K4JA 4ESBA 2DOEA 5GP9A 4HA8A 2M8EA 2DTRA 3T8TA 2HPMA 4PJNA 2CG4A 1YE9A 2CW8A 4RGRA 5FKLA 2GM4A 5GTIC 2EV6A 2W57A 1SVMA 2XIGA 1SD7A 1LDJA 2R7TA 1R23A 1XGNA 5GPAA 5KAFC 1B8IB 5ED4A 2OA4A 3L2VA 2MH2A 2RREA 2XPWA 4LGWA 1D0ZA 3H92A 2HTSA 4II3A 4IF4A 4ZDPA 5BMZA 4IEJA 2E36A 2MFZA 3F22A 4EJUA 1Y0UA 2EQRA 2FBHA 2EZLA 2W85A 2CW7A 2NVUB 4HNUA 2PN6A 5K5RA 1GVJA 5HS7A 4CCNA 3S16J 1UB9A 1PUFB 1IXRC 2G0EA 3HL2A 2W7NA 4CO8A 3OIQA 5E3NA 3H0GJ 2F5VA 2OQRA 2HYJA 1D0YA 3PQKA 4PZJA 1K78B 3I4MJ 1BW5A 3O2PE 2TDXA 1AOYA 2LBFB 3K1NA 1WPKA 1OMIA 4LLGF 2OF7A 5M3FJ 1IN6A 2V26A 2E2JJ 4OINF 5J1YA 5JHUA 5A2QZ 2R4GA 5J6XA 2L02A 2QSGX 3C1DA 2L7KA 1LNWA 2ADUA 3MKZA 1VQ7I 1RETA 1D8KA 3DU5A 2LBFA 5FKKA 2QQAA 2WV1A 1HCRA 3K7AJ 5TISC 3C18A 4P5OA 4IHXA 3N4MA 4E7KA 4CYCA 3D0SA 4N4OB 2XC7A 3A2KA 2HGCA 2EFQA 1JKQC 3ONQA 3HOUJ 4OAZA 2CUFA 2FBKA 5DCMB 4DW6A 3RPUA 4A2UA 1X1BA 2IGOA 3F0CA 3R6SA 4IHTA 3QYEA 1FSHA 3E5UA 1TLHB 3CCEI 4HLYA 3OSGA 5E3LA 2Y2ZA 2VBZA 4XLFA 3DBLB 5GAGJ 1R4NB 1ZGWA 1FBUA 1OISA 3LFUA 1MBKA 4XM3A 2ZMEC 2XAQA 2G7HA 4XN3A 1WSUA 1IV6A 1IRGA 2DO7A 2L7MP 4DZJA 5TRDA 2CJJA 2EZHA 3HDDA 3BG7A 1Z3YA 1BI0A 3CCJI 1ETXA 1LDKB 1ZH5A 4MQVA 4W97A 1D5YA 1JHHA 5ILVA 1HA8A 1SVLA 3MFKA 2ZKZA 3CMMA 1XD7A 3HUGB 1JTYA 2DT6A 4HYEA 1EA3A 1IN7A 1D3YA 4GDFA 3FM3A 3LSTA 2VJ4A 3O8GA 2K9MA 4E7SA 2DAOA 4KIGA 4IQ4A 1WJ5A 5HLTA 5HLIA 3DTEA 2BHYA 4PJMA 3WU0A 3CD6I 3ZRGA 1G6NA 4PJ0C 2NVQJ 2O03A 1TQPA 2JMWA 3GZNB 2ECCA 5F1JA 4IOAF 2A61A 1R6RA 3K69A 4NC7A 1R49A 1ZLKA 2DFIA 3EPZA 1X3UA 1Z6RA 4LG0A 2H27A 3S15J 1DP3A 2ZCWA 2VJIA 3VB2A 2DJIA 5K1YA 2CV2A 2M4KA 4ENMA 3DPLC 3ASNH 3PFYA 1B59A 1SFKA 2FU4A 4YFNF 1V5GA 4NBQA 4P96A 5IYCJ 5EG0B 2N8GA 4RM2A 2XRNA 4Y33A 1B6AA 4P55A 3JW4A 2I10A 1DU6A 4KN7X 4Q48A 2NVYJ 3S32A 5KVRA 3GCMA 2WAEA 1P4AA 2GA1A 2EH3A 1STZA 1Z05A 3E6MA 5C44J 3I4NJ 3O3KA 2Z3YA 4WF2A 3HEFA 1QZZA 4RAFA 3J81Z 3LSMA 2LY1A 3ERED 1YRNB 1WI9A 2PX9A 3U21A 1X4OA 1APLC 3CMYA 4UNOA 4QPQA 2XV4S 1WZ2A 2XAFA 4HF2A 2CU7A 4QWQA 3KPHA 1VQ4I 4UV9A 2AXLA 2XB0X 3M4OJ 2KZGA 1MZBA 2X1EA 3NWSA 1FOWA 3HJEA 2V4JC 3OR1C 1ERDA 1KONA 3WTVC 2JJ7A 1ETWA 2IW5A 1QVUA 2VPLA 2FXAA 2DMUA 1AA7A 4G7HF 3OYMA 2VBWA 2CQQA 4RLQA 3V7RA 5L3BA 2RDPA 3CF2A 3KE2A 2BXZA 3S1RJ 2NYXA 3S14J 2OC6A 1XMXA 1FMVA 1UZCA 3ZQIA 1JKPC 3OYCA 2IA2A 3BR3A 3PFIA 1BJZA 2H94A 2OAZA 1P92A 4O3MA 4AUXA 3BZKA 2CUEA 4EM1A 2HKOA 3FZVA 1XS9A 2PLYA 3S2HJ 1ODDA 3KLNA 1AKHA 2JA5J 1A5JA 1VQOI 3HBLA 5DV5A 2F2EA 4BHPA 3HTSB 3GTMJ 3BQZA 5EEHA 2DA3A 2IEKA 1IO2A 3BTIA 3EDPA 1W5SA 3TW7A 3TOBA 5JLXA 3SHFA 1TNSA 2M5WA 3C2HA 3OYDA 2IRFG 4XRSG 4A0YA 4IZZA 3SEQA 1R4MB 5CVIA 3LQQA 1T98A 2WB1A 1NK3P 2J5PA 4XRFA 3FM5A 1IRFA 5HS9A 3JRFA 2IPQX 2NNNA 3GF2A 1XCBA 5E3OA 5LD2C 2HTJA 4BAYA 2MABA 3CLOA 2XKPA 3ULQB 5CPRB 2EB7A 2ZXHA 1U8BA 1FBQA 1FPQA 1N77A 1G3TA 1IN5A 1GT0C 1P7JA 4XLAA 4FT8A 1G8XA 5CLSA 5CVVA 3HC7A 4MTEA 1T2KA 2FE3A 2DMTA 1ZG5A 5J1RA 3NRVA 2DN0A 2ZNZA 2VONA 3GLXA 1P6RA 1HBXG 3OIOA 1WGXA 3ZMUA 4KIBA 2VL8A 4ON0A 3SZGA 2KDOA 4UUVA 1VQ8I 1IXCA 2M87A 4HLXA 4Z2YA 4HX8A 3J80Z 5D5WB 1MDMA 4KITB 1VQLI 3KEYA 4M9ZA 2R0QC 2DODA 5B3SH 3QP5A 4M6YA 3BY6A 4AYBN 1JE8A 4LJZF 3SEZA 2OU2A 1XX5A 2D1VA 1YYVA 3OYKA 3FBNB 1F43A 3CCVI 5EEGA 2IS6A 1WVRA 4ZJZA 3FKIJ 1LQ1A 3CCQI 2IA0A 3GTPJ 1T38A 5FD5A 1MSEC 4F93B 1R7JA 2CFOA 2QQ9A 3OOUA 4E7HA 3F8FA 3HOZJ 3S2DJ 2LD5A 3GEZA 1ETYA 4KISA 3N05A 1RNLA 2CV0A 2IJLA 4G8XA 3CCRI 1ZLJA 4U0WA 2ESHA 3WODF 2P6TA 5D8LB 1U5TB 3S3MA 1Z0XA 1F36A 3P9KA 1TWAJ 2V1UA 3R61A 4FE7A 2VE8A 3L09A 2YR2A 4TV7A 2DDBA 1U8RA 2X9DA 3K70D 3FKJA 1YO5C 3HRSA 2KZVA 3RSNA 2X48A 1IAWA 1J5YA 2Z9OA 3K10A 3H5RA 4U7BA 4UB8C 1CF7A 5HDKA 2KRCA 2BY0A 5E1XA 1HDDC 2PI0A 1Y56A 3IP4B 1B9NA 2DOFA 2ELJA 2X6WA 2BVMA 4M6VA 3CTAA 2VB6A 3C2BA 3KP2A 3DPUA 4OIPF 5F27A 4NQWB 4CCMA 3E7LA 1ZAOA 4ZYHA 4ENJA 1CGPA 1PJRA 4B48A 5FRMA 4KT5C 1XSXA 1DPUA 4JBAA 1DQUA 3U1KA 5LEKA 1SFXA 3EUHC 1ZRFA 2JA8J 2H1LA 3ZQFA 4A3FJ 1IZ1A 3DTKA 4M73A 2MBFA 3KZIC 2KFDA 2YUSA 3ABLH 5BS6A 3H5AA 2OD5A 1KZHA 2B63J 5K7ZA 3E97A 3DEWA 3RIRA 2STWA 4B44A 3HRUA 3ISPA 5LRRA 5ICEA 1YX5A 1ON1A 3R60A 1ZRCA 3CJRB 2A5WA 3M1CA 4BE1A 3OIPA 1IJWC 2DPDA 2A69F 3OV8A 5A2QK 3BR6A 1OLTA 4CYDA 2WWYA 5LGNA 1UJ8A 3JR9A 3BG6A 4ZDOA 5B66C 1PP7U 1XTAA 4M3EA 4KIFA 1DDNA 4EGZA 1W0TA 1ZKGA 3CO6C 2F5EA 4HQMA 2GIVA 2EZKA 3R4KA 1JT6A 2KISA 1GDTA 1I6XA 2O8XA 1BIAA 5LGTA 3A03A 2VOOA 2X85A 2JQ7A 4BNCA 4HQEA 5E17F 2EV0A 4RGUA 1A36A 1QNTA 1MSFC 2JN6A 3HGYA 4CICA 4GCVA 1SANA 2V1XA 2STTA 4HOBA 2E2IJ 4A3GJ 4BJTA 1MBHA 2JVGA 1BI2A 3BR2A 5DM7F 3ECHA 3OOPA 4PGHA 2DA6A 4A69C 5EG0A 1ZQ3P 3TOAA 3WTWC 4A3CJ 1J7KA 1I50J 1MIJA 1K4TA 3D1NI 3ZQCA 3BDDA 1J0RA 2JWTA 4NHJA 3LL7A 4JYKA 5K5QA 1YW7A 3I71A 1Z3XA 1XB4A 4G94A 2BVLA 5F0HA 3E1SA 2DXIA 1WH7A 2MLKA 4PCQA 2R7QA 1RIOH 1MMAA 5LHGA 2LLKA 1S29A 4Y52J 2BZTA 3RYPA 2LH9A 4CDGA 1BR4A 1HSTA 2VXDA 1ON2A 1RR7A 4ABZA 2L7FP 3ABMH 2P0WA 1G3YA 2O3FA 2DK8A 2AXTC 2EINH 3FMSA 4PK4A 5KHDA 5HOOA 5D5UB 2ACJA 3RKWA 1QU3A 3OL3A 2VQGA 4HDVA 4MFEA 2FNPA 3HYIA 4I09A 4A3KJ 2KJBA 2M45A 2CGPA 3M8EA 1B72A 1FBSA 1FYKA 1HKQA 1TTYA 1JT0A 3K4MA 2NVXJ 3ZPLA 4OWRB 2YX7A 3IUOA 5TJJA 4G6TB 3RTRA 4M3DA 3WGGA 3PO3J 4V2FA 3FDYA 5J40A 2NOGA 2RGVA 4PGGA 3CUQA 3IV5A 1BI3A 2HVRA 2VKDA 1P4WA 3CUOA 4I99C 4II2A 4CHUA 1LVAA 4HF0A 1OCOH 2P4WA 3HM5A 3T0YA 2K85A 3F6OA 5CYVA 3CUQB 2W84A 2WBMA 1XSVA 1D1AA 1FX7A 4XKWA 3JREA 5GTHC 3DWLE 1WJBA 4KJZA 2FJ1A 1T0FC 2K9SA 3U1DA 2OTJI 3GBGA 2DA4A 3J80K 2LSOA 3Q3SA 3WTSC 2E7WA 2A6EF 4EQQA 2XAGA 3PSIA 3A0BC 2V6EA 2LF8A 4KICA 1O4XA 1X1AA 4ZZLA 4BHBA 4N4NB 2LP0A 5AIPA 3JRDA 3CQZJ 2VUMJ 3JRIA 2I5UA 1U78A 2OV7A 3GTOJ 3CF5F 4V2GA 4U88A 4F3QA 1VQPI 1K4SA 2L9SA 2QVOA 2CV1A 3DEEA 1DPRA 4BY1J 4S04A 3GWZA 4OU0A 1NG6A 3TGNA 3BPVA 2LMDA 2K5CA 4MQ9F 3B6CA 4XLNF 2L5QA 2KIQA 2KHMA 2L4AA 2D5VA 1Z67A 1YS6A 2BBYA 4J01A 3FXOA 2R5YB 5E1WA 3FXRA 4AU7A 2HPIA 4EJTA 2Y9YA 4PFPA 2OUMA 1U5TC 2ZMEA 4BE2A 2IGNA 4RS8A 5IYBJ 3SDGA 1TC3C 3ZOBA 1OR7A 2ZFUA 2DMPA 4UVAA 1K6OA 1WCMJ 4M9SA 2RNGA 3M7GA 1Z91A 5CVJA 3V8JA 4JQFA 2DDAA 2R7XA 3QODA 4XLHA 5E3MA 4BJ5C 1IN4A 2K86A 2Y69H 3DEUA 5CQGA 4RB1A 4HNTA 1P4XA 3RCOA 4I0BA 3H3VK 5M5XJ 2IS1A 4XKBA 1MJAA 2VJ5A 2VT3A 1QHGA 3DTIA 4KMUX 5FFXA 2M34A 2V1NA 2UXNA 3H3UA 5FKMA 1L3LA 2GXBA 4XLEA 3JRAA 3WHBA 4U0YA 1OYYA 4ZZDA 1MKMA 1XG1A 2PMHA 3DV8A 2QM3A 1VZ0A 2I8DA 3BJ6A 3S1NJ 4HPQA 2G9WA 3OYJA 3RKQA 1O7LA 1ZG3A 1YRNA 3EUKL 5C3EJ 2Q8KA 2DQRA 5J47A 1TWHJ 3J7AO 1MNEA 4XLPF 4BKXA 5HLGA 3BCBA 1FTZA 5DUIA 2DFHA 3EETA 1CF7B 4PDKA 1X1CA 3MWMA 1JGGA 3HB9A 5DDGA 2J5OA 1GLNA 2GWRA 1T39A 1RZ4A 3AL0C 4B43A 1H8AC 4F91B 1A6IA 1XGMA 2PMUA 4XOPA 5D5VB 1O3RA 2ELHA 1WH5A 1M1EB 3OS1A 2VE9A 3FISA 2VBYA 3FXJA 1TWCJ 2JUGA 1V3FA 1POGA 5E20A 1X2NA 2QF7A 3V4GA 4BGDA 2YSRA 3TL4X 2K9QA 2ZFWA 2IVMA 3ZMVA 3W2VA 5GAHJ 2ISZA 3FWEA 2KMUA 4XMYA 1FLIA 2K3PA 2QYOA 3V8LA 3OS0A 1Y8QB 1N78A 4BE0A 3DLAA 5DTDA 4L5IA 3DF8A 2FBIA 1IW7F 2LRDA 3CLQA 3S1QJ 1TQIA 4GXOA 4HEA2 4YELA 1YFHA 1A35A 1FOKA 3LA2A 2L2OA 5EJCA 2X6XA 4UVCA 2V9PA 4EM2A 3JRGA 5AIQA 4AYBA 2L9NA 1EV7A 5JVTA 3SYTA 3BG3A 2CFXA 2XGEA 1LB2A 1OYWA 1H9TA 2M3AA 1J09A 1K79A 1ZRDA 1TT0A 2H09A 4AIDA 4V19K 2ZXIA 4OIRF 4RLFA 4ZTFA 3FXKA 5KAIC 1QPMA 3NAUA 3E6CC 4RB3C 3MZHA 3PM1A 2W82A 4RB0A 2EFOA 4OIQF 4UV8A 1Y1VJ 1S9HA 1R1VA 3ZCOA 3VOEA 2F48A 3Q0VA 1I3QJ 1XPXA 2Y0SN 2KRFA 3S1MJ 4D7MA 1G59A 1BC8C 3BJAA 2M0MA 3IRQA 5B1AH 5J3LA 3NARA 3BR0A 2FEZA 1LEBA 2AO9A 3S17J 2X51A 1MH4A 2E1CA 2MC4A 5DUKA 3QOEA 3VYSB 4BUPA 4BBSJ 1F5TA 5E1ZB 5FD6A 5D5XB 1S6LA 4HSTA 3HHHA 2HYFA 1IG7A 3WHCA 1R5HA 1Z7UA 3WU1B 4ZTJA 1USTA 4OMZA 1YJWI 2VKVA 4AD9A 2VBXA 2VPRA 4DGWB 2JUCA 3G3ZA 3BC8A 4D1QA 5DS9A 5D4SA 3RKXA 3OYFA 2MYSA 1FP2A 2GXGA 1MMSA 2ZO4A 4A3EJ 1FIAA 1H0MA 2KIFA 1LE8A 4C2MJ 4WXHA 3I4PA 1ETQA 2F5FA 1RC9A 4Y3OA 3I59A 4ZH4F 2FMLA 1NHAA 2ZC2A 3LA7A 2H1KA 2HYGD 1U5TA 1D5VA 1KQ8A 3ASOH 2HQNA 4CCOA 3FXUA 3SFZA 2BHZA 1N25A 1OCRH 3GFIA 1OR7C 4IRHA 2ZJQF 1I6HJ 3K0LA 1ACIA 4EEFG 5IP6A 3IH3A 4BXXJ 4IHSA 2IA1A 3OYGA 3BZ6A 2DK5A 2UZKA 5J8CA 2CMPA 3BPXA 4IKFA 3WTXC 1QVTA 3IKTA 2KLOA 3HOXJ 1EH6A 3T5XA 1XCVA 2X1DA 2NNYA 2GOMA 3E0JB 3SQNA 5LEJA 1W0UA 3IKVA 3H5NA 4A3MJ 3G1LA 1J75A 1MGTA 2M2EA 3F21A 3HKZA 2RC4A 4QTRA 1OFCX 1RKWA 5DM6F 1KQ0A 3F6VA 2EA4A 5LHHA 1AU7A 1JTXA 2MH9A 4G6QA 4I2OA 2W00A 2EFWA 1QQIA 3P9IA 2XSDC 3AKZA 1XSDA 1MNMC 4IQJA 2JZYA 1F4KA 4GRIA 4QPOA 4JX5A 5J1UA 4PUSA 4BQNA 1J2XA 1MH3A 3JRBA 1ONVA 1P9QC 4X1EA 4DYQA 2QA4I 2HS5A 4IOCF 3RQIA 4GFBA 2KRHA 3G71I 2XGXA 3F23A 1WJCA 2IXSA 1SD5A 4L0ZB 2Z33A 1GXPA 4O5VA 4BXUA 4CZZA 3CCUI 1FEXA 4ZYAA 4OIOF 4UUSA 2R5YA 2RVCA 5H6RA 1SMYF 1QO0D 1PYVA 3DQVC
chains in the Genus database with same CATH topology
2VJJA 3PNVA 3DTKA 4Y4RA 2M4GA 3OS2A 2RQQA 2XDVA 3H5AA 4HRIA 4PJJA 3D5LA 3SDBA 3G2BA 4ANJA 5HNHA 3MD2A 1T95A 4B44A 2Y0SA 3HG9A 1YX5A 4F52A 2QKLB 3CJRB 2A5WA 3M1CA 4BE1A 2E60A 3OIPA 4LG3A 4DBQA 1OLTA 1X1DA 2NOJB 3H9GA 3BG6A 3VSLA 4ZDOA 4X0GA 3CZ6A 3W2AA 1JI8A 2F6CA 2MD0A 3LSKA 2LREA 3VYTB 2ZSHB 2BW3A 3BLYA 2VQLA 1UG0A 4ITVA 4CH7A 2V9KA 4EATA 2X85A 3C2GA 2X6YA 1U0JA 2WY7Q 2BW3B 2JA2A 2XF5A 4ZC3A 3A1YA 2FUG2 3MKWB 1BOBA 1MMNA 4BJTA 3VSKA 2JVGA 3W3CA 3A4CA 3HPGA 4BACA 1Z21A 3DPTA 2CH0A 4PSXA 2A6TA 3NWTA 2PMZA 3HOSA 3RPUD 4P1WA 1LFPA 2R7OA 3LL7A 3OYBA 2VIXA 1QHHD 1Z3XA 2V7FA 2BVLA 4E7JA 3E1SA 2DXIA 4H4KC 1WFXA 4D9JA 2R7QA 3MMYB 1MMAA 2HVSA 3PSFA 2DT7B 3K4JA 2LH9A 3LSIA 3OYAA 1BR4A 4XKCA 2VXDA 2HPMA 4PJNA 1BR1A 2P0WA 4BL0B 5KHDA 4PK4A 1YE9A 2CW8A 3DKYA 3ZGKA 5HOOA 1QU3A 3OL3A 2VQGA 4XKVA 3K4KA 2R7TA 3PJRA 3OY9A 1D0XA 3L2VA 2AQFA 2Z16A 2RREA 3V42A 4OAYA 3K4MA 3S3OA 4OWRB 2R7SA 1Y6IA 1D0ZA 4II3A 4ZDPA 3IUOA 4F92B 3OYHA 4G6TB 3RTRA 2MFZA 3VYRB 3FDYA 3PUBA 2E5ZA 5TGTA 2HVRA 2VKDA 1W36D 2CW7A 3QYFA 4HNUA 4II2A 4CCNA 4E7ZA 3HL2A 2W7NA 3OIQA 2F5VA 2BOLA 4E6KG 2WBMA 1D0YA 3D5SC 3RQ4A 4BEHA 4CZCA 1D1AA 4XKWA 2LBFB 2V26A 3DWLE 1WJBA 4KJZA 1MMDA 4AVZA 5FRNA 2R4GA 1N75A 1T0FC 2M7AA 4XL9A 3ZR8X 3GBGA 4PJLA 2L7KA 3HPHA 3MKZA 3KYLA 2JSPA 3PSIA 3DKXA 3DU5A 4PSWA 2V6EA 2LBFA 3FBIB 1X1AA 4P5OA 4N4NB 4YEJA 4E7KA 1BR2A 2LYCA 3MKYB 4N4OB 2XC7A 3L2QA 3A2KA 2IS4A 3ONQA 3OL4A 4OAZA 2OV7A 2LOOA 3CP8A 3OR2C 4F3QA 3OYLA 4HSRA 2Z1DA 1X1BA 2IGOA 3K70C 2L9SA 2WAQA 3QYEA 2CV1A 3DEEA 4XLFA 3S3NA 1NG6A 4XN0A 3UNGC 3LMMA 2ZSIB 2HVQA 2K5CA 4HG2A 4XORA 3LFUA 4XM3A 2L5QA 2KHMA 4RM3A 1Z7LA 3VDXA 4XN3A 3ZQQA 1SAUA 1V5EA 2Q2EB 4J01A 4E7LA 4XONA 4XLCA 1MMGA 4AU7A 1ZELA 2HPIA 4CCLA 4PFPA 2OUMA 4DOZA 3BG7A 3S93A 3HXLA 2VQCA 1Z3YA 2E1MB 3LSGA 4BE2A 1LDKB 2IGNA 5CKTA 3LSHA 2KL4A 3L2UA 2ZFUA 1HA8A 2W4SA 3CP2A 2RNGA 4JQFA 3CMMA 3CJQB 3HUGB 5HNFA 3QODA 2R7XA 4XLHA 2UWMA 4BJ5C 5KCMA 2DT6A 5CQGA 3OYIA 4HNTA 1EA3A 3RCOA 3K4LA 1LKXA 2IS1A 2VJ4A 4XKBA 2VJ5A 3DTIA 3QYBA 1QHGA 4BJ6C 2K9MA 4E7SA 2V1NA 2XF7A 2R7VA 4IQ4A 1WJ5A 5JHFA 4XLEA 5HLTA 3DTEA 1YX3A 4PJMA 4NUBA 2IS2A 4XR6A 2LY2A 4YRVA 1VZ0A 2I8DA 3ZRGA 3H35A 4BQOA 4HPQA 4CCKA 3OYJA 4NC7A 1R6RA 3EUKL 3EPZA 1DP3A 1MNEA 2M7BA 4BEHB 2VJIA 1D1BA 3BCBA 2DJIA 2CV2A 2M4KA 1X1CA 2QKMB 1GLNA 3DPLC 3PFYA 3AL0C 1SFKA 4B43A 3M8JA 4F91B 1UAAA 3VWBA 1V5GA 4XOPA 3UR3C 3K4CA 2JVHA 4RM2A 4Y33A 3OS1A 4KT6A 4E4HA 3S32A 2JUGA 2WAEA 3H9JA 4LIVA 4NC8A 4CA0A 3ZXSA 3KX2A 4F55A 4BGDA 3TL4X 3W2VA 3LSMA 2KMUA 4XMYA 2LY1A 4J00A 4DBRA 2K3PA 3OMYA 3U21A 3OS0A 1X4OA 1N78A 4BE0A 1WJEA 3DLAA 4C30A 4QPQA 1X4PA 4MLOA 4DIQA 3I3LA 2LC2A 2LRDA 4HEA2 4YELA 2X1EA 3NWSA 4XQFA 2L2OA 2X6XA 3DU6A 4NNJA 3OR1C 2V4JC 3S8PA 1ERDA 1KONA 1WJFA 4BS9A 1W36C 2HZDA 3PNYA 5FROA 2VASA 4BU2A 2VPLA 3H9QA 2E5NA 2DCEA 2GOXB 4AYBA 1AA7A 2DOAA 3OYMA 4C9YA 2L9NA 1E0EA 4RLQA 4ZDLA 4E7IA 2AQEA 3J7AY 3CF2A 3SYTA 4C2UA 1MNDA 2KP6A 4BDYA 3K4NA 2M3AA 1J09A 5LFAA 2OC6A 2R7WA 1FMVA 1TT0A 1WJAA 1NG7A 3OYCA 2ZXIA 2WAFA 4RLFA 4ZTFA 2O5RA 2R7RA 4BXFA 2W82A 2IGMA 2KQRA 4FASD 3H0DA 1S9HA 3W2WA 3ZCOA 2F4IA 1G59A 3I9V2 2M0MA 3TMOA 3K4BA 3PL8A 2X51A 4FETA 3C2HA 2MC4A 3QOEA 3OYDA 3VYSB 3FHNA 4BUPA 4IZZA 3SEQA 3TBIA 2WB1A 4HSTA 4LITA 5LD2C 4ZTJA 4B3XA 2MABA 3OYEA 2VXZA 5CPRB 2ZXHA 3IAS2 4DGWB 2HDWA 3L2WA 3BC8A 4D1QA 4CUGA 1V5FA 1N77A 3OYFA 2R7UA 2MYSA 2HNHA 4PFOA 4XLAA 2XAUA 1G8XA 3HC7A 3OYNA 2LG4A 4XOTA 2CUJA 3AFHA 1LVKA 4CCJA 3OWTA 1MW7A 4Y3OA 4B47A 3HOTA 2VL8A 3PNTA 3SZGA 2KDOA 4R79A 4C2TA 2CUZA 2WADA 4CCOA 1K6YA 4KITB 1WJDA 3KEYA 2VQHA 1X19A 1OR7C 4XNFA 3AL0B 2X1CA 2HU9A 4RMNA 1IRXA 4BQQA 3SEZA 3F9KA 5CQEA 3L2RA 3OYKA 2KPMA 3FBNB 2K9LA 2CS3A 3K6GA 5KNLA 3IAM2 2IS6A 3OYGA 2UV1A 4DJAA 4ZJZA 3EUAA 2CMPA 2XSJC 4IKFA 4F93B 2CFOA 4E7HA 3OOUA 2PJRA 2W1OA 3VYUB 2KLOA 4KISA 3N05A 2CV0A 2X1DA 2GOMA 3E0JB 2Q1ZB 2Z2SB 4JOMA 3S3MA 3H5NA 3HKZA 2E1MC 4CSWA 2PJRB 2VLAA 3K70D 2WY8Q 3FKJA 2KZVA 3RSNA 2W00A 1FMWA 3AKZA 3K10A 1UELB 3H5RA 4LIUA 3D5RC 4U7BA 4IQJA 4BDZA 2XF6A 4IX7A 3BCAA 3CESA 4GRIA 4QPOA 2KRCA 4U87A 4PUSA 4BQNA 1DGRM 1Y56A 3IP4B 2VKHA 1P9QC 2ELJA 2X6WA 2BVMA 2UUZA 2KRHA 2VB6A 3DPUA 1WJCA 1TZLA 2IXSA 2HQAA 5HVQC 4NQWB 4CCMA 1DGWY 2WA0A 4ZYAA 1PJRA 4B48A 2IGKA 1D1CA 5FRMA 1DQUA 3EUHC 1PYVA 3DQVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLO A;  3A4C A;  2RQQ A; 
#chains in the Genus database with same CATH topology
 2MG4 A;  4ESJ A;  4U0V A;  2VJJ A;  1K78 A;  3LSP A;  4HRI A;  1R1T A;  2OZ6 A;  2P6S A;  5HNH A;  3MD2 A;  2PQ8 A;  3EUH A;  1T95 A;  3HG9 A;  1IF1 A;  1Y8R B;  4YG2 F;  2P5L C;  3TKY A;  2E1O A;  3VFZ A;  5EEA A;  2L01 A;  2E60 A;  4LG3 A;  5EYR A;  3IRR A;  5B5E C;  2M9H A;  2O61 A;  4IHY A;  1GUU A;  4UXN A;  2MSY A;  3NQO A;  3H9G A;  3VSL A;  2LY9 A;  1MD0 A;  4XSX F;  1IV8 A;  3L2C A;  4XRS A;  1S72 I;  3HRT A;  3I56 I;  3DLL F;  4A3D J;  3CCS I;  3JAM Z;  3MAJ A;  1JUS A;  1R5G A;  2BW3 A;  1YW8 A;  2VQL A;  2BYV E;  1MJB A;  5JI6 A;  1UG0 A;  2DFE A;  1SMT A;  3FMQ A;  2H6B A;  4EAT A;  3C2G A;  4I01 A;  5EZH A;  5EGO B;  4RDU A;  1MBF A;  2XPV A;  2Y30 A;  1JKO C;  1SFE A;  4C3I J;  1FJL A;  2WY7 Q;  3X2Q H;  4QLC U;  2CQK A;  4OOI A;  2BW3 B;  2XF5 A;  4UUT A;  3ABK H;  3E5Q A;  4UY8 I;  3MKW B;  3QPS A;  1MMN A;  1X3Z B;  1YJ9 I;  4EGY A;  1YS7 A;  3ZMS A;  4DYR A;  5LLQ A;  3HPG A;  3QPT A;  4BAC A;  1Z21 A;  3DPT A;  2QBY B;  2HEO A;  4AIH A;  2CH0 A;  2A6T A;  3GX4 X;  5J4Y A;  1B72 B;  3O8H A;  2PMZ A;  2XAS A;  1VQK I;  3RPU D;  4M72 A;  3HSE A;  1G2H A;  1R00 A;  2P5K A;  3WG9 A;  1QHH D;  2A5Y B;  2GXA A;  3LA3 A;  3TO7 A;  3WTT C;  2B9S A;  2E19 A;  5H20 A;  4D9J A;  2LFB A;  1HKT A;  3PSF A;  3F3X A;  3LSI A;  3OYA A;  2CSO A;  4XKC A;  4M6X A;  2E71 A;  1R71 A;  4CGZ A;  3FIW A;  1B9M A;  2RN7 A;  3ZGK A;  3BTL A;  2K4B A;  2PFB A;  1W1W E;  2QEN A;  1OCP A;  1WWX A;  4HAM A;  3K4K A;  5CVU A;  2LDU A;  4Y17 A;  1IC8 A;  4LD5 A;  3OY9 A;  1QZY A;  3CDI A;  3DBH B;  2O0Y A;  1D0X A;  1AKH B;  2Z16 A;  5L3D A;  4WK8 F;  1FOY A;  3V42 A;  5IPA A;  2VOP A;  4OAY A;  4JX6 A;  3WGH A;  1Y6I A;  4F92 B;  2B7E A;  3DKW A;  3VYR B;  2E5Z A;  3BR1 A;  4O6J A;  2COB A;  4WCG A;  4FX0 A;  5TGT A;  2VT2 A;  3M9A A;  1R5I D;  2Y9Z A;  4FIS A;  1W36 D;  2RNJ A;  4UB6 C;  2QCO A;  2XAJ A;  1YTY A;  4IO9 F;  4E7Z A;  1VQM I;  3RKY A;  3PIP F;  3FF5 A;  3CUQ C;  3ELK A;  1HW5 A;  3GTL J;  2DW4 A;  3PQJ A;  4E6K G;  2HXO A;  3D5S C;  4CZC A;  3Q9S A;  2KDZ A;  4A0X A;  1MMD A;  1OCZ H;  4IXA A;  5FRN A;  2M7A A;  1YHQ I;  2R7D A;  4MFD A;  5CVR A;  2BV6 A;  3HPH A;  1SVO A;  1X58 A;  3KYL A;  2JSP A;  2W24 A;  3DKX A;  4XRM A;  3FBI B;  3I0T A;  4AIK A;  2GLO A;  3CC4 I;  4YEJ A;  1FC3 A;  1R1U A;  3G6E I;  1BR2 A;  2DT5 A;  2LYC A;  1KYW A;  3L2Q A;  2DI3 A;  3OL4 A;  2LOO A;  1ETK A;  4HSR A;  5KK1 A;  1FT9 A;  5E8I A;  3G73 A;  1S5L C;  1PUE E;  3W6J B;  5J4V A;  2KT0 A;  1YQA A;  4Q47 A;  1TT5 B;  3P5J A;  1LDD A;  2EA2 A;  3HHG A;  3S2W A;  2HQR A;  3L00 A;  1LPQ A;  5BOX A;  2D2W A;  3S3N A;  1IDZ A;  1ENH A;  1KA8 A;  3CDH A;  1QPI A;  3LMM A;  2A07 F;  1UMQ A;  2ZSI B;  2HVQ A;  4HG2 A;  4XOR A;  4LB5 A;  4KA4 A;  2DBB A;  3HRM A;  1R58 A;  4I76 A;  4A93 J;  1HOM A;  4KDP A;  1Z7L A;  1S8N A;  2DLL A;  1Z6T A;  3ZQQ A;  1SAU A;  5HDN A;  4R8H A;  3WTU C;  1FIP A;  4HZF A;  4RAY A;  4E7L A;  4XON A;  3GZ6 A;  1MMG A;  1ZEL A;  4XSZ F;  2ZXW H;  1UHS A;  1EH8 A;  3K9T A;  1J9I A;  3LSG A;  2E2H J;  5CKT A;  1BL0 A;  3LSH A;  2JTV A;  4RB2 C;  2GA2 A;  3J7Y J;  3GME A;  2KL4 A;  3L2U A;  3LQR A;  2HKX A;  4HNV A;  1VTN C;  3KP6 A;  3CMA I;  2A68 F;  5HDG A;  1BJA A;  3MVP A;  3FHZ A;  3V8K A;  2ETH A;  2DYR H;  3KZY A;  3BRO A;  4L9J A;  1WHU A;  3OYI A;  2RKH A;  2W25 A;  3TP3 A;  3GYH X;  4EV0 A;  1XMK A;  3ML6 A;  3K4L A;  2QUF A;  4A12 A;  3RZO J;  3QYB A;  2NRA C;  2FD5 A;  3E6D A;  2XF7 A;  2R7V A;  2KJC A;  1BW6 A;  1YX3 A;  3E6B A;  4NUB A;  5GPC A;  2NS0 A;  2IS2 A;  5DD8 A;  2LY2 A;  1DU0 A;  1WI3 A;  4RBO A;  3I53 A;  3H35 A;  4KN4 X;  3WGI A;  4BQO A;  5IYD J;  3WE2 A;  1PVE A;  1B8I A;  3NEU A;  5JLW A;  1O3S A;  3CCL I;  1MBE A;  5IY5 H;  3AG2 H;  4BEH B;  1BA5 A;  5FKO A;  5BPD A;  1D1B A;  5K5O A;  3QU6 A;  2M0C A;  1ETV A;  2NS7 A;  1XGS A;  1VQN I;  3VWB A;  5E18 F;  1UAA A;  4ENN A;  1U9O A;  2P81 A;  3UR3 C;  3QQA A;  4IVN A;  4KT6 A;  4A5M A;  4E4H A;  2JA7 J;  1E3H A;  5DYM A;  4D5F A;  1LUJ B;  3H9J A;  2K40 A;  5L3F A;  4LIV A;  4CA0 A;  2HOE A;  1FTT A;  4NB5 A;  5M3M J;  6PAX A;  1UHM A;  3TED A;  1T6S A;  1VF9 A;  3AG3 H;  2ID3 A;  1RES A;  4DBR A;  2JK3 A;  3OMY A;  5DD4 A;  4A3L J;  3K1M A;  1JGS A;  2DPU A;  3H3Z A;  3PO2 J;  1WJE A;  1UCR A;  1QBJ A;  4BQA A;  4C30 A;  1O3T A;  1YLF A;  4DIQ A;  1CQT A;  3AAF A;  1LEA A;  3FK6 A;  4A6D A;  1FY7 A;  3ZMD A;  2ELK A;  2BGC A;  2Q2E A;  4M74 A;  2CWE A;  1JXS A;  4XQF A;  3DU6 A;  4NNJ A;  4MGR A;  2PJP A;  1I3A A;  2K3F A;  4BS9 A;  1W36 C;  4M3F A;  2VAS A;  3OSF A;  2E5N A;  2QGU A;  3JSP A;  2VOD A;  2GOX B;  1FP1 D;  2IAI A;  4NQW A;  4ESF A;  5L3G A;  4C9Y A;  3VPR A;  4E7I A;  4ZDL A;  1E0E A;  2PG4 A;  4ENK A;  4ZYD A;  3JSO A;  2AQE A;  3J7A Y;  3KIO A;  4C2U A;  3DP7 A;  3QAH A;  1MND A;  2LF7 A;  2XRO A;  2P8T A;  3AG1 H;  4I7H A;  4RAZ A;  5LFA A;  5F1R A;  2R7W A;  3J81 K;  4D7N A;  3E5X A;  2R3S A;  4CYC B;  2WAF A;  3Q0U A;  4WWC A;  5FFZ A;  1XDU A;  4BXF A;  2YPR A;  3LNQ A;  3ECO A;  2F4M B;  2KQR A;  1ZK8 A;  2F5C A;  3H0D A;  1YIT I;  3W2W A;  3TO6 A;  1B4A A;  5IOZ A;  3I9V 2;  3HOW J;  1T08 B;  4MO7 A;  2QBY A;  4DYC A;  2LK2 A;  2LTP A;  3TMO A;  3L9F A;  3HUG A;  3K4B A;  2K27 A;  1GHC A;  1IDY A;  4FET A;  4YIR X;  5JR3 A;  3ABU A;  5HS8 A;  3P7N A;  4YIF A;  2K9N A;  3FHN A;  4S0H B;  3AG4 H;  3TBI A;  1TQM A;  3VOD A;  3I54 A;  4YFK F;  4I6Z A;  1VI0 A;  2UXX A;  3RZD J;  3WTY C;  4L0Y B;  1QRY A;  2P5V A;  3DBR B;  1FSE A;  5FLX Z;  2Z99 A;  4A3B J;  2LR8 A;  1S7E A;  1W5T A;  1I5Z A;  2L3D A;  2VXZ A;  2ECB A;  5FJ8 J;  3IAS 2;  1OJL A;  1TW3 A;  3L2W A;  2QQ8 A;  1LFB A;  4FTH A;  3IWF A;  1FOX A;  3GO5 A;  2HNH A;  4PFO A;  4LG0 B;  4UVB A;  1QGP A;  3HSR A;  3SJM A;  1OYI A;  3OYN A;  2LG4 A;  3L1P A;  1RUN A;  1I1S A;  4UHT A;  1BC7 C;  5F08 A;  3AFH A;  1LVK A;  1PP8 F;  4L9T A;  1QA6 A;  5F0C A;  2XAH A;  3KET A;  2LVS A;  3HOT A;  1E3P A;  3PNT A;  4EJO A;  4B8X A;  4Q5S F;  4C2T A;  2CUZ A;  5K7F A;  2V6C A;  4LLN A;  1OPC A;  1K6Y A;  1WJD A;  3JTH A;  2ESN A;  1NH3 A;  1S7O A;  2CQN A;  1H89 C;  1S3J A;  4XNF A;  1AHD P;  2HI3 A;  2XB5 A;  3TDU C;  3EYY A;  3AL0 B;  1IUY A;  1BI1 A;  4G9Y A;  1IRX A;  4BQQ A;  3WU2 C;  1DP7 P;  3MZ8 A;  4AC0 A;  2GQQ A;  5F0F A;  1G4D A;  1HXD A;  2CS3 A;  2HWV A;  1DUX C;  1MBG A;  1O7F A;  2P7V B;  3K6G A;  5KNL A;  4DJA A;  1EH7 A;  4Q4Z F;  4I0A A;  2NXN B;  5HOD A;  2JRT A;  2EFP A;  3EUA A;  3H1C A;  2XSJ C;  4S05 A;  2E1N A;  2QQB A;  3ZMZ A;  1C0W A;  3VYU B;  2EV5 A;  2Z5U A;  3LFK A;  4DQ2 A;  1BBY A;  4RGX A;  2DMN A;  1I39 A;  5BPI A;  2Q1Z B;  2Z2S B;  2M1B A;  2IP2 A;  4CSW A;  3IHU A;  4HV5 A;  4ZYG A;  1OCT C;  1HQC A;  3P9C A;  2OPT A;  5ICG A;  2WY8 Q;  1ZRE A;  3J7Z I;  5J8F A;  1HKS A;  3QP6 A;  4HV6 A;  3VEP A;  3BR5 A;  4LIU A;  3BZC A;  4BDZ A;  2JA6 J;  2EFN A;  2XF6 A;  4EJW A;  4IX7 A;  2Y31 A;  3CES A;  1GVD A;  1BM9 A;  5FKN A;  3M3Y J;  4U87 A;  2O9L A;  5C4X J;  2HOT A;  1ORK A;  1USS A;  2VKH A;  5ILU A;  2YU3 A;  2A05 A;  3CME I;  2UUZ A;  1ZR4 A;  5E79 C;  1D8J A;  2L0K A;  3GFJ A;  2OZU A;  2HQA A;  4JP0 A;  4Y13 A;  1KU9 A;  3WE3 A;  2R5Z B;  3KEO A;  3F8B A;  1IGN A;  1V54 H;  5H2F C;  3K1P A;  1D1C A;  1Y39 A;  4ETS A;  4IHV A;  2ZJR F;  4A3I J;  3U9G A;  3FXL A;  2F5D A;  5JVG F;  1YJN I;  4HX7 A;  2H6C A;  3BP8 A;  3PNV A;  4BY7 J;  2NVT J;  1S7A A;  3OS2 A;  2D45 A;  4BYY A;  5EGO A;  2XDV A;  2HQ5 A;  3KYC B;  4BBR J;  3D5L A;  3SDB A;  3G2B A;  5IP9 J;  4ANJ A;  1GV5 A;  3CJT B;  5K7H A;  2DMQ A;  2DU9 A;  3JAM K;  3I5U A;  4XBF A;  1TWF J;  1YIO A;  4IRG A;  2EIK H;  1WKM A;  1HC8 A;  2V79 A;  2HOS A;  3RJP A;  1U2W A;  5FO5 A;  4DBQ A;  1Z1D A;  4GGG A;  1JJ6 C;  5IT9 Z;  1ETO A;  2NOJ B;  4QIW N;  2GAU A;  2YS9 A;  2KIM A;  3IH4 A;  3MKL A;  4B09 A;  3CZ6 A;  3MQ0 A;  3W2A A;  4ZYE A;  2MLG A;  2MD0 A;  3A02 A;  3PIO F;  2XPU A;  3BG5 A;  2KKO A;  3VYT B;  1Y0N A;  3G1O A;  4C3J J;  2ZME B;  3BLY A;  3EQL F;  4M71 A;  2ME0 A;  2WTE A;  4BHC A;  4LFU A;  3MCZ A;  3GZ5 A;  2V9K A;  2ZJP F;  4HF1 A;  2DA2 A;  2DYS H;  1EJ9 A;  3HTU A;  3GFM A;  2CQX A;  1U0J A;  3LOC A;  5FB2 A;  1HF0 A;  2L9R A;  4ZC3 A;  1MDM B;  2FUG 2;  3IC7 A;  3V7S A;  1A04 A;  2DFF A;  4L9N A;  4FCY A;  1TL8 A;  2E35 A;  3VSK A;  1RI7 A;  2QSF X;  3HZJ A;  3W3C A;  3RI4 A;  1NK2 P;  4IJA A;  3U2R A;  4KFC A;  1O57 A;  1XGO A;  4PSX A;  4R1H A;  1W7P A;  2EK5 A;  4N0B A;  2V1D A;  4B3A A;  2ICW G;  2NS8 A;  3BWG A;  4P1W A;  3OYB A;  2VIX A;  4EM0 B;  2JPC A;  2W48 A;  3TO9 A;  4F7Z A;  4AIJ A;  1R22 A;  3PUF A;  1YW9 A;  2CQ7 A;  4X6A J;  1WFX A;  2M30 A;  3ESW B;  3CC7 I;  1W5C C;  1H9G A;  4GO1 A;  2FA5 A;  2L9V A;  4Y7N J;  2Q0O A;  1RPW A;  2V9V A;  5CJ9 A;  5ERI A;  4KUM A;  1BR1 A;  3KYD B;  1SFU A;  1UG2 A;  4BL0 B;  1YI2 I;  2FX0 A;  3DKY A;  2BEO A;  2K02 A;  5IT9 K;  1TP4 A;  1XDS A;  4D0P A;  3F72 A;  3CJN A;  4XKV A;  3EYI A;  4JK1 X;  3IWZ A;  2FQ4 A;  1T56 A;  3PJR A;  1FNN A;  3FK7 A;  4HX4 A;  1HW2 A;  2AQF A;  2QLZ A;  3LAJ A;  1TNT A;  5FLX K;  1X1P A;  2QZ8 A;  3S3O A;  2R7S A;  3BG9 A;  3OYH A;  4MIM A;  2FSW A;  2LKS A;  4Y15 A;  4H0E A;  1W4M A;  3ZQL A;  3PUB A;  2RQP A;  1V4R A;  2JSC A;  3TP0 A;  2LKX A;  3QYF A;  2Y75 A;  2CO5 A;  2Y0M A;  5LBQ A;  4LK0 F;  1LFU P;  2OCE A;  2ZB9 A;  3SFI A;  3GFL A;  1ITY A;  5JFR A;  2BOL A;  5ICC A;  3RQ4 A;  4BEH A;  2HDD A;  4AM3 A;  2BY2 A;  2VI6 A;  2ISY A;  2L54 A;  2FNA A;  4AVZ A;  1RKT A;  3LSR A;  1N75 A;  4M3B A;  2ZBK A;  2LKP A;  3IH2 A;  3REO A;  4XL9 A;  3ZR8 X;  4PJL A;  3GTJ J;  1K7A A;  4B4C A;  3DCF A;  1VQ9 I;  4PSW A;  4IPA A;  3HOV J;  2EBI A;  2H8R A;  3G1M A;  1U9N A;  4M9X A;  3MKY B;  1GV2 A;  2IS4 A;  3SXY A;  4GYG A;  3CP8 A;  3OR2 C;  1ZN2 A;  3OYL A;  2Z1D A;  1ZAR A;  3HOY J;  4L5E A;  3K70 C;  2WAQ A;  4FE4 A;  2R7F A;  1FWZ A;  2MC3 A;  4ASN A;  2X6O A;  1ZGA A;  1E2X A;  3HIF A;  4XN0 A;  3UNG C;  4N9H A;  4E70 A;  4G6D A;  2AS5 F;  4RM3 A;  2D1H A;  3VDX A;  1XN7 A;  2Y48 A;  1V5E A;  3L7W A;  1SFO J;  2Q2E B;  5F04 A;  3WG7 H;  2DQL A;  1R9T J;  2EIL H;  4XLC A;  4CCL A;  1G3W A;  2VN2 A;  2XUB A;  3KP4 A;  4DOZ A;  3S93 A;  1IUF A;  2VQC A;  3HXL A;  4P9U A;  2AHQ A;  2E1M B;  1JHF A;  4U7D A;  3M1E A;  1SD4 A;  2W4S A;  1HSJ A;  2O6G E;  3CP2 A;  5IT3 A;  1UFM A;  1SD6 A;  5F64 A;  2FMY A;  1RR8 C;  3LSJ A;  1IN8 A;  2HOA A;  3CJQ B;  4XK4 A;  5HNF A;  3BOQ A;  2UWM A;  2BXY A;  3KLO A;  2C6Y A;  5KCM A;  5HLH A;  2FRH A;  2A6H F;  2M8G X;  3Q9V A;  1MBJ A;  1YG2 A;  2RV8 A;  2HDC A;  1LKX A;  2OBP A;  3H36 A;  4BJ6 C;  3HGG A;  3MN2 A;  1YOV B;  2WV0 A;  3K2Z A;  3I64 A;  5L3C A;  5JHF A;  3BTJ A;  3KEQ A;  1IRZ A;  4RAG A;  2CW0 F;  1P2F A;  4XR6 A;  1U3E M;  3CDL A;  2HR3 A;  2YX4 A;  4YRV A;  1L0O C;  2WAQ N;  4CCK A;  4Z6Y A;  3TW6 A;  3CO7 C;  3C3W A;  2EIM H;  3QOP A;  2VC0 A;  2EWN A;  2M7B A;  1ZR2 A;  1YIJ I;  3FXM A;  2R92 J;  1NTC A;  2DTZ A;  4HBL A;  2IBD A;  5H6Q A;  2QKM B;  1SAX A;  3I55 I;  5IOY A;  3KP3 A;  3QU3 A;  4GYI A;  1QZE A;  4HW0 A;  3FXQ A;  3M8J A;  1O3Q A;  4MEY F;  2JPB A;  1ZG1 A;  2IT0 A;  5FLM J;  4J19 A;  3K4C A;  2EJR A;  2JVH A;  4C3H J;  1VQ5 I;  3CCY A;  4YFX F;  1W7P D;  5ICF A;  5FGM A;  2PMZ N;  4WXC A;  3GTG J;  5E8G A;  3GTQ J;  2R5Z A;  4NC8 A;  2ZXJ A;  2VKE A;  3ZXS A;  3KX2 A;  4F55 A;  1H88 C;  3ZN0 A;  3KZZ A;  3RYR A;  1MJ9 A;  4A0Z A;  3TQN A;  4J00 A;  4KYW A;  3GUD A;  1E3O C;  2WC2 A;  1X4P A;  4MLO A;  5AON A;  3ZP5 A;  3I3L A;  5BNG A;  2LC2 A;  2FOK A;  1Z9C A;  1SC7 A;  4IRI A;  4G7Z F;  4G7O F;  3LWF A;  5EZG A;  5GAD J;  3BT9 A;  3TDZ C;  4DNC A;  3KCC A;  3S8P A;  1WJF A;  4A6E A;  2HZD A;  3PNY A;  5FRO A;  4BU2 A;  4LMY A;  3H9Q A;  4A5N A;  1T8I A;  2DCE A;  2DOA A;  2OQG A;  1P7I A;  2A3S A;  1OCC H;  4NC6 A;  4HDU A;  2QWW A;  5LHI A;  2KP6 A;  4BDY A;  3K4N A;  5D6F A;  3MZY A;  1Z77 A;  1U6G A;  2BY1 A;  1WJA A;  2XRL A;  1NG7 A;  2YU9 J;  3JRC A;  4RGS A;  3KP7 A;  2TRT A;  3B02 A;  4FX4 A;  4IL6 C;  2O5R A;  2F4O B;  2GZW A;  5IP7 J;  5LRS A;  2R7R A;  1PUF A;  4AWX B;  2NAZ A;  2IGM A;  3E3V A;  2O7O A;  4EJV A;  2ID6 A;  2COM A;  4FAS D;  3ERM A;  3BJO A;  2F4I A;  3GXO A;  1KU2 A;  4UUS B;  4JX4 A;  1FYL A;  1RUO A;  2R93 J;  4IHW A;  2MD5 A;  2LNB A;  3C7J A;  1ZGJ A;  1BN5 A;  3PL8 A;  3UKG A;  1EKE A;  1W7P B;  1WQ2 A;  5F6F A;  4KNY A;  3MEX A;  2JT1 A;  4EMS A;  3A01 A;  1HDP A;  2CRG A;  2XGD A;  3I58 A;  1TW2 A;  1X2M A;  3ABT A;  1KU7 A;  2G7U A;  4LIT A;  3W6V A;  4N9I A;  3B73 A;  1KU3 A;  2DA5 A;  3O6B B;  1ZYR F;  4B3X A;  3A01 B;  3B6A A;  2GIZ A;  5DCM A;  3OYE A;  1G3S A;  4EVI A;  1LJ9 A;  1XC5 A;  2HDW A;  1HW1 A;  2XKO A;  2HZT A;  3F8C A;  3HKZ N;  1V5F A;  4CUG A;  3R0J A;  4XID A;  3ZMT A;  3QPL A;  2R7U A;  4BH9 A;  1I1G A;  2XAU A;  1BOA A;  2HFH A;  2BY3 A;  3ZQH A;  4D5C A;  2BE5 F;  4W1U A;  4XOT A;  2PEX A;  3DXJ F;  2CUJ A;  4NDL A;  2MA3 A;  1EF4 A;  4CCJ A;  2FQ3 A;  3OWT A;  1MW7 A;  1KYZ A;  4L5J A;  4B47 A;  4L9V A;  4AVP A;  4OMY A;  4R79 A;  3FMR A;  1KGS A;  2WAD A;  2O8K A;  2DA7 A;  3F8N A;  1E17 A;  1K83 J;  3F8M A;  1OKR A;  3KFW X;  2VQH A;  1X19 A;  3QPH A;  2X4H A;  2X1C A;  2HU9 A;  1VND A;  4LK1 F;  4RMN A;  2GBY A;  4B1R A;  3F9K A;  5CQE A;  3L2R A;  2JRM A;  2KPM A;  2K9L A;  3QRF F;  2EIJ H;  3COA C;  3ZN1 A;  3IAM 2;  2ZNY A;  2UV1 A;  1A31 A;  4A3J J;  2OTL I;  1JJ8 C;  3JTG A;  3HSF A;  1TWG J;  5EDN A;  3CC2 I;  3SZP A;  2W1O A;  1F9N A;  2PJR A;  3BQY A;  1SEU A;  4LOC A;  4JOM A;  1ZHF A;  1IXS B;  4MHG A;  1I27 A;  2E1M C;  2PJR B;  2EPF A;  2FF4 A;  2VLA A;  3ZQ7 A;  1Q1H A;  2X0L A;  2XVC A;  1J59 A;  3T1B A;  1KQ9 A;  2E7X A;  1ULY A;  1FMW A;  9ANT A;  1UEL B;  3D5R C;  3CCM I;  4XIC A;  3A0H C;  3BCA A;  3SZT A;  3IL2 A;  1ZTR A;  1DGR M;  2H8W A;  4WX9 A;  2ME6 A;  2ZJ2 A;  2DA1 A;  1X3W B;  2E34 A;  1FZP B;  5FLV A;  3WTZ A;  4LB6 B;  1TZL A;  2OJE D;  3Q0W A;  5HVQ C;  1K61 A;  2R7Z J;  3R0A A;  3GW2 A;  1DGW Y;  1TBX A;  2WA0 A;  4MEX F;  1AWC A;  2IGK A;  3M8F A;  1A6Q A;  2MGQ A;  2L4M A;  3RDI A;  5C4J J;  3K2A A;  4Y4R A;  4L18 B;  2M4G A;  3W6K B;  3Q5F A;  2RQQ A;  1WRJ A;  5GAE J;  4PJJ A;  4I02 A;  1B1B A;  4LLL A;  3RPQ A;  4KMF A;  2Y0S A;  3GVA A;  4YII A;  2OCC H;  4F52 A;  1T33 A;  2MW8 A;  2QKL B;  1OQY A;  5M5W J;  4I98 B;  1F1Z A;  1GXQ A;  3ZQG A;  4RA2 A;  1X1D A;  3ROU A;  1XMA A;  5DCF A;  2PBI A;  4MNU A;  4FHT A;  2EZI A;  3JCU C;  5DEQ A;  2XHK A;  3DFG A;  4X0G A;  2RAE A;  3BTC A;  1RRJ A;  1REP C;  1JI8 A;  2F6C A;  3LSK A;  4FQG A;  4WXD A;  2LRE A;  2VC1 A;  2DJN A;  2ZSH B;  1VFC A;  3N97 A;  2FOW A;  2TCT A;  2XGC A;  1Q1V A;  3V7C A;  2K7L A;  4P9F A;  3FX3 A;  2WB1 N;  4ITV A;  4CH7 A;  1PDN C;  3I59 B;  3JRH A;  5EF6 A;  2X6Y A;  3T8R A;  2HXI A;  5L3E A;  1BIB A;  2JA2 A;  5ILS A;  1JUP A;  3LAP A;  3A1Y A;  4K2E A;  1HLV A;  1R36 A;  3M07 A;  1BOB A;  4G12 A;  3QWL A;  3A4C A;  3GTK J;  5LGU A;  2B0L A;  1LE8 B;  2CYY A;  3NWT A;  1JUM A;  2KIU A;  1T0F A;  2QSH X;  3HOS A;  5BQT A;  5D4R A;  1LFP A;  2R7O A;  5D8K B;  5M5Y J;  3G4S I;  4M3G A;  4DZP A;  2P7C B;  3GLL A;  2V7F A;  4CXF A;  4E7J A;  2L7Z A;  4MTD A;  4H4K C;  1JKR C;  1UHW A;  4QSH A;  3MMY B;  2K4J A;  5D6E A;  3KP5 A;  5B1B H;  1FYM A;  1V55 H;  2HVS A;  1Y1W J;  2QEX I;  1VQ6 I;  2DT7 B;  3K4J A;  4ESB A;  2DOE A;  5GP9 A;  4HA8 A;  2M8E A;  2DTR A;  3T8T A;  2HPM A;  4PJN A;  2CG4 A;  1YE9 A;  2CW8 A;  4RGR A;  5FKL A;  2GM4 A;  5GTI C;  2EV6 A;  2W57 A;  1SVM A;  2XIG A;  1SD7 A;  1LDJ A;  2R7T A;  1R23 A;  1XGN A;  5GPA A;  5KAF C;  1B8I B;  5ED4 A;  2OA4 A;  3L2V A;  2MH2 A;  2RRE A;  2XPW A;  4LGW A;  1D0Z A;  3H92 A;  2HTS A;  4II3 A;  4IF4 A;  4ZDP A;  5BMZ A;  4IEJ A;  2E36 A;  2MFZ A;  3F22 A;  4EJU A;  1Y0U A;  2EQR A;  2FBH A;  2EZL A;  2W85 A;  2CW7 A;  2NVU B;  4HNU A;  2PN6 A;  5K5R A;  1GVJ A;  5HS7 A;  4CCN A;  3S16 J;  1UB9 A;  1PUF B;  1IXR C;  2G0E A;  3HL2 A;  2W7N A;  4CO8 A;  3OIQ A;  5E3N A;  3H0G J;  2F5V A;  2OQR A;  2HYJ A;  1D0Y A;  3PQK A;  4PZJ A;  1K78 B;  3I4M J;  1BW5 A;  3O2P E;  2TDX A;  1AOY A;  2LBF B;  3K1N A;  1WPK A;  1OMI A;  4LLG F;  2OF7 A;  5M3F J;  1IN6 A;  2V26 A;  2E2J J;  4OIN F;  5J1Y A;  5JHU A;  5A2Q Z;  2R4G A;  5J6X A;  2L02 A;  2QSG X;  3C1D A;  2L7K A;  1LNW A;  2ADU A;  3MKZ A;  1VQ7 I;  1RET A;  1D8K A;  3DU5 A;  2LBF A;  5FKK A;  2QQA A;  2WV1 A;  1HCR A;  3K7A J;  5TIS C;  3C18 A;  4P5O A;  4IHX A;  3N4M A;  4E7K A;  4CYC A;  3D0S A;  4N4O B;  2XC7 A;  3A2K A;  2HGC A;  2EFQ A;  1JKQ C;  3ONQ A;  3HOU J;  4OAZ A;  2CUF A;  2FBK A;  5DCM B;  4DW6 A;  3RPU A;  4A2U A;  1X1B A;  2IGO A;  3F0C A;  3R6S A;  4IHT A;  3QYE A;  1FSH A;  3E5U A;  1TLH B;  3CCE I;  4HLY A;  3OSG A;  5E3L A;  2Y2Z A;  2VBZ A;  4XLF A;  3DBL B;  5GAG J;  1R4N B;  1ZGW A;  1FBU A;  1OIS A;  3LFU A;  1MBK A;  4XM3 A;  2ZME C;  2XAQ A;  2G7H A;  4XN3 A;  1WSU A;  1IV6 A;  1IRG A;  2DO7 A;  2L7M P;  4DZJ A;  5TRD A;  2CJJ A;  2EZH A;  3HDD A;  3BG7 A;  1Z3Y A;  1BI0 A;  3CCJ I;  1ETX A;  1LDK B;  1ZH5 A;  4MQV A;  4W97 A;  1D5Y A;  1JHH A;  5ILV A;  1HA8 A;  1SVL A;  3MFK A;  2ZKZ A;  3CMM A;  1XD7 A;  3HUG B;  1JTY A;  2DT6 A;  4HYE A;  1EA3 A;  1IN7 A;  1D3Y A;  4GDF A;  3FM3 A;  3LST A;  2VJ4 A;  3O8G A;  2K9M A;  4E7S A;  2DAO A;  4KIG A;  4IQ4 A;  1WJ5 A;  5HLT A;  5HLI A;  3DTE A;  2BHY A;  4PJM A;  3WU0 A;  3CD6 I;  3ZRG A;  1G6N A;  4PJ0 C;  2NVQ J;  2O03 A;  1TQP A;  2JMW A;  3GZN B;  2ECC A;  5F1J A;  4IOA F;  2A61 A;  1R6R A;  3K69 A;  4NC7 A;  1R49 A;  1ZLK A;  2DFI A;  3EPZ A;  1X3U A;  1Z6R A;  4LG0 A;  2H27 A;  3S15 J;  1DP3 A;  2ZCW A;  2VJI A;  3VB2 A;  2DJI A;  5K1Y A;  2CV2 A;  2M4K A;  4ENM A;  3DPL C;  3ASN H;  3PFY A;  1B59 A;  1SFK A;  2FU4 A;  4YFN F;  1V5G A;  4NBQ A;  4P96 A;  5IYC J;  5EG0 B;  2N8G A;  4RM2 A;  2XRN A;  4Y33 A;  1B6A A;  4P55 A;  3JW4 A;  2I10 A;  1DU6 A;  4KN7 X;  4Q48 A;  2NVY J;  3S32 A;  5KVR A;  3GCM A;  2WAE A;  1P4A A;  2GA1 A;  2EH3 A;  1STZ A;  1Z05 A;  3E6M A;  5C44 J;  3I4N J;  3O3K A;  2Z3Y A;  4WF2 A;  3HEF A;  1QZZ A;  4RAF A;  3J81 Z;  3LSM A;  2LY1 A;  3ERE D;  1YRN B;  1WI9 A;  2PX9 A;  3U21 A;  1X4O A;  1APL C;  3CMY A;  4UNO A;  4QPQ A;  2XV4 S;  1WZ2 A;  2XAF A;  4HF2 A;  2CU7 A;  4QWQ A;  3KPH A;  1VQ4 I;  4UV9 A;  2AXL A;  2XB0 X;  3M4O J;  2KZG A;  1MZB A;  2X1E A;  3NWS A;  1FOW A;  3HJE A;  2V4J C;  3OR1 C;  1ERD A;  1KON A;  3WTV C;  2JJ7 A;  1ETW A;  2IW5 A;  1QVU A;  2VPL A;  2FXA A;  2DMU A;  1AA7 A;  4G7H F;  3OYM A;  2VBW A;  2CQQ A;  4RLQ A;  3V7R A;  5L3B A;  2RDP A;  3CF2 A;  3KE2 A;  2BXZ A;  3S1R J;  2NYX A;  3S14 J;  2OC6 A;  1XMX A;  1FMV A;  1UZC A;  3ZQI A;  1JKP C;  3OYC A;  2IA2 A;  3BR3 A;  3PFI A;  1BJZ A;  2H94 A;  2OAZ A;  1P92 A;  4O3M A;  4AUX A;  3BZK A;  2CUE A;  4EM1 A;  2HKO A;  3FZV A;  1XS9 A;  2PLY A;  3S2H J;  1ODD A;  3KLN A;  1AKH A;  2JA5 J;  1A5J A;  1VQO I;  3HBL A;  5DV5 A;  2F2E A;  4BHP A;  3HTS B;  3GTM J;  3BQZ A;  5EEH A;  2DA3 A;  2IEK A;  1IO2 A;  3BTI A;  3EDP A;  1W5S A;  3TW7 A;  3TOB A;  5JLX A;  3SHF A;  1TNS A;  2M5W A;  3C2H A;  3OYD A;  2IRF G;  4XRS G;  4A0Y A;  4IZZ A;  3SEQ A;  1R4M B;  5CVI A;  3LQQ A;  1T98 A;  2WB1 A;  1NK3 P;  2J5P A;  4XRF A;  3FM5 A;  1IRF A;  5HS9 A;  3JRF A;  2IPQ X;  2NNN A;  3GF2 A;  1XCB A;  5E3O A;  5LD2 C;  2HTJ A;  4BAY A;  2MAB A;  3CLO A;  2XKP A;  3ULQ B;  5CPR B;  2EB7 A;  2ZXH A;  1U8B A;  1FBQ A;  1FPQ A;  1N77 A;  1G3T A;  1IN5 A;  1GT0 C;  1P7J A;  4XLA A;  4FT8 A;  1G8X A;  5CLS A;  5CVV A;  3HC7 A;  4MTE A;  1T2K A;  2FE3 A;  2DMT A;  1ZG5 A;  5J1R A;  3NRV A;  2DN0 A;  2ZNZ A;  2VON A;  3GLX A;  1P6R A;  1HBX G;  3OIO A;  1WGX A;  3ZMU A;  4KIB A;  2VL8 A;  4ON0 A;  3SZG A;  2KDO A;  4UUV A;  1VQ8 I;  1IXC A;  2M87 A;  4HLX A;  4Z2Y A;  4HX8 A;  3J80 Z;  5D5W B;  1MDM A;  4KIT B;  1VQL I;  3KEY A;  4M9Z A;  2R0Q C;  2DOD A;  5B3S H;  3QP5 A;  4M6Y A;  3BY6 A;  4AYB N;  1JE8 A;  4LJZ F;  3SEZ A;  2OU2 A;  1XX5 A;  2D1V A;  1YYV A;  3OYK A;  3FBN B;  1F43 A;  3CCV I;  5EEG A;  2IS6 A;  1WVR A;  4ZJZ A;  3FKI J;  1LQ1 A;  3CCQ I;  2IA0 A;  3GTP J;  1T38 A;  5FD5 A;  1MSE C;  4F93 B;  1R7J A;  2CFO A;  2QQ9 A;  3OOU A;  4E7H A;  3F8F A;  3HOZ J;  3S2D J;  2LD5 A;  3GEZ A;  1ETY A;  4KIS A;  3N05 A;  1RNL A;  2CV0 A;  2IJL A;  4G8X A;  3CCR I;  1ZLJ A;  4U0W A;  2ESH A;  3WOD F;  2P6T A;  5D8L B;  1U5T B;  3S3M A;  1Z0X A;  1F36 A;  3P9K A;  1TWA J;  2V1U A;  3R61 A;  4FE7 A;  2VE8 A;  3L09 A;  2YR2 A;  4TV7 A;  2DDB A;  1U8R A;  2X9D A;  3K70 D;  3FKJ A;  1YO5 C;  3HRS A;  2KZV A;  3RSN A;  2X48 A;  1IAW A;  1J5Y A;  2Z9O A;  3K10 A;  3H5R A;  4U7B A;  4UB8 C;  1CF7 A;  5HDK A;  2KRC A;  2BY0 A;  5E1X A;  1HDD C;  2PI0 A;  1Y56 A;  3IP4 B;  1B9N A;  2DOF A;  2ELJ A;  2X6W A;  2BVM A;  4M6V A;  3CTA A;  2VB6 A;  3C2B A;  3KP2 A;  3DPU A;  4OIP F;  5F27 A;  4NQW B;  4CCM A;  3E7L A;  1ZAO A;  4ZYH A;  4ENJ A;  1CGP A;  1PJR A;  4B48 A;  5FRM A;  4KT5 C;  1XSX A;  1DPU A;  4JBA A;  1DQU A;  3U1K A;  5LEK A;  1SFX A;  3EUH C;  1ZRF A;  2JA8 J;  2H1L A;  3ZQF A;  4A3F J;  1IZ1 A;  3DTK A;  4M73 A;  2MBF A;  3KZI C;  2KFD A;  2YUS A;  3ABL H;  5BS6 A;  3H5A A;  2OD5 A;  1KZH A;  2B63 J;  5K7Z A;  3E97 A;  3DEW A;  3RIR A;  2STW A;  4B44 A;  3HRU A;  3ISP A;  5LRR A;  5ICE A;  1YX5 A;  1ON1 A;  3R60 A;  1ZRC A;  3CJR B;  2A5W A;  3M1C A;  4BE1 A;  3OIP A;  1IJW C;  2DPD A;  2A69 F;  3OV8 A;  5A2Q K;  3BR6 A;  1OLT A;  4CYD A;  2WWY A;  5LGN A;  1UJ8 A;  3JR9 A;  3BG6 A;  4ZDO A;  5B66 C;  1PP7 U;  1XTA A;  4M3E A;  4KIF A;  1DDN A;  4EGZ A;  1W0T A;  1ZKG A;  3CO6 C;  2F5E A;  4HQM A;  2GIV A;  2EZK A;  3R4K A;  1JT6 A;  2KIS A;  1GDT A;  1I6X A;  2O8X A;  1BIA A;  5LGT A;  3A03 A;  2VOO A;  2X85 A;  2JQ7 A;  4BNC A;  4HQE A;  5E17 F;  2EV0 A;  4RGU A;  1A36 A;  1QNT A;  1MSF C;  2JN6 A;  3HGY A;  4CIC A;  4GCV A;  1SAN A;  2V1X A;  2STT A;  4HOB A;  2E2I J;  4A3G J;  4BJT A;  1MBH A;  2JVG A;  1BI2 A;  3BR2 A;  5DM7 F;  3ECH A;  3OOP A;  4PGH A;  2DA6 A;  4A69 C;  5EG0 A;  1ZQ3 P;  3TOA A;  3WTW C;  4A3C J;  1J7K A;  1I50 J;  1MIJ A;  1K4T A;  3D1N I;  3ZQC A;  3BDD A;  1J0R A;  2JWT A;  4NHJ A;  3LL7 A;  4JYK A;  5K5Q A;  1YW7 A;  3I71 A;  1Z3X A;  1XB4 A;  4G94 A;  2BVL A;  5F0H A;  3E1S A;  2DXI A;  1WH7 A;  2MLK A;  4PCQ A;  2R7Q A;  1RIO H;  1MMA A;  5LHG A;  2LLK A;  1S29 A;  4Y52 J;  2BZT A;  3RYP A;  2LH9 A;  4CDG A;  1BR4 A;  1HST A;  2VXD A;  1ON2 A;  1RR7 A;  4ABZ A;  2L7F P;  3ABM H;  2P0W A;  1G3Y A;  2O3F A;  2DK8 A;  2AXT C;  2EIN H;  3FMS A;  4PK4 A;  5KHD A;  5HOO A;  5D5U B;  2ACJ A;  3RKW A;  1QU3 A;  3OL3 A;  2VQG A;  4HDV A;  4MFE A;  2FNP A;  3HYI A;  4I09 A;  4A3K J;  2KJB A;  2M45 A;  2CGP A;  3M8E A;  1B72 A;  1FBS A;  1FYK A;  1HKQ A;  1TTY A;  1JT0 A;  3K4M A;  2NVX J;  3ZPL A;  4OWR B;  2YX7 A;  3IUO A;  5TJJ A;  4G6T B;  3RTR A;  4M3D A;  3WGG A;  3PO3 J;  4V2F A;  3FDY A;  5J40 A;  2NOG A;  2RGV A;  4PGG A;  3CUQ A;  3IV5 A;  1BI3 A;  2HVR A;  2VKD A;  1P4W A;  3CUO A;  4I99 C;  4II2 A;  4CHU A;  1LVA A;  4HF0 A;  1OCO H;  2P4W A;  3HM5 A;  3T0Y A;  2K85 A;  3F6O A;  5CYV A;  3CUQ B;  2W84 A;  2WBM A;  1XSV A;  1D1A A;  1FX7 A;  4XKW A;  3JRE A;  5GTH C;  3DWL E;  1WJB A;  4KJZ A;  2FJ1 A;  1T0F C;  2K9S A;  3U1D A;  2OTJ I;  3GBG A;  2DA4 A;  3J80 K;  2LSO A;  3Q3S A;  3WTS C;  2E7W A;  2A6E F;  4EQQ A;  2XAG A;  3PSI A;  3A0B C;  2V6E A;  2LF8 A;  4KIC A;  1O4X A;  1X1A A;  4ZZL A;  4BHB A;  4N4N B;  2LP0 A;  5AIP A;  3JRD A;  3CQZ J;  2VUM J;  3JRI A;  2I5U A;  1U78 A;  2OV7 A;  3GTO J;  3CF5 F;  4V2G A;  4U88 A;  4F3Q A;  1VQP I;  1K4S A;  2L9S A;  2QVO A;  2CV1 A;  3DEE A;  1DPR A;  4BY1 J;  4S04 A;  3GWZ A;  4OU0 A;  1NG6 A;  3TGN A;  3BPV A;  2LMD A;  2K5C A;  4MQ9 F;  3B6C A;  4XLN F;  2L5Q A;  2KIQ A;  2KHM A;  2L4A A;  2D5V A;  1Z67 A;  1YS6 A;  2BBY A;  4J01 A;  3FXO A;  2R5Y B;  5E1W A;  3FXR A;  4AU7 A;  2HPI A;  4EJT A;  2Y9Y A;  4PFP A;  2OUM A;  1U5T C;  2ZME A;  4BE2 A;  2IGN A;  4RS8 A;  5IYB J;  3SDG A;  1TC3 C;  3ZOB A;  1OR7 A;  2ZFU A;  2DMP A;  4UVA A;  1K6O A;  1WCM J;  4M9S A;  2RNG A;  3M7G A;  1Z91 A;  5CVJ A;  3V8J A;  4JQF A;  2DDA A;  2R7X A;  3QOD A;  4XLH A;  5E3M A;  4BJ5 C;  1IN4 A;  2K86 A;  2Y69 H;  3DEU A;  5CQG A;  4RB1 A;  4HNT A;  1P4X A;  3RCO A;  4I0B A;  3H3V K;  5M5X J;  2IS1 A;  4XKB A;  1MJA A;  2VJ5 A;  2VT3 A;  1QHG A;  3DTI A;  4KMU X;  5FFX A;  2M34 A;  2V1N A;  2UXN A;  3H3U A;  5FKM A;  1L3L A;  2GXB A;  4XLE A;  3JRA A;  3WHB A;  4U0Y A;  1OYY A;  4ZZD A;  1MKM A;  1XG1 A;  2PMH A;  3DV8 A;  2QM3 A;  1VZ0 A;  2I8D A;  3BJ6 A;  3S1N J;  4HPQ A;  2G9W A;  3OYJ A;  3RKQ A;  1O7L A;  1ZG3 A;  1YRN A;  3EUK L;  5C3E J;  2Q8K A;  2DQR A;  5J47 A;  1TWH J;  3J7A O;  1MNE A;  4XLP F;  4BKX A;  5HLG A;  3BCB A;  1FTZ A;  5DUI A;  2DFH A;  3EET A;  1CF7 B;  4PDK A;  1X1C A;  3MWM A;  1JGG A;  3HB9 A;  5DDG A;  2J5O A;  1GLN A;  2GWR A;  1T39 A;  1RZ4 A;  3AL0 C;  4B43 A;  1H8A C;  4F91 B;  1A6I A;  1XGM A;  2PMU A;  4XOP A;  5D5V B;  1O3R A;  2ELH A;  1WH5 A;  1M1E B;  3OS1 A;  2VE9 A;  3FIS A;  2VBY A;  3FXJ A;  1TWC J;  2JUG A;  1V3F A;  1POG A;  5E20 A;  1X2N A;  2QF7 A;  3V4G A;  4BGD A;  2YSR A;  3TL4 X;  2K9Q A;  2ZFW A;  2IVM A;  3ZMV A;  3W2V A;  5GAH J;  2ISZ A;  3FWE A;  2KMU A;  4XMY A;  1FLI A;  2K3P A;  2QYO A;  3V8L A;  3OS0 A;  1Y8Q B;  1N78 A;  4BE0 A;  3DLA A;  5DTD A;  4L5I A;  3DF8 A;  2FBI A;  1IW7 F;  2LRD A;  3CLQ A;  3S1Q J;  1TQI A;  4GXO A;  4HEA 2;  4YEL A;  1YFH A;  1A35 A;  1FOK A;  3LA2 A;  2L2O A;  5EJC A;  2X6X A;  4UVC A;  2V9P A;  4EM2 A;  3JRG A;  5AIQ A;  4AYB A;  2L9N A;  1EV7 A;  5JVT A;  3SYT A;  3BG3 A;  2CFX A;  2XGE A;  1LB2 A;  1OYW A;  1H9T A;  2M3A A;  1J09 A;  1K79 A;  1ZRD A;  1TT0 A;  2H09 A;  4AID A;  4V19 K;  2ZXI A;  4OIR F;  4RLF A;  4ZTF A;  3FXK A;  5KAI C;  1QPM A;  3NAU A;  3E6C C;  4RB3 C;  3MZH A;  3PM1 A;  2W82 A;  4RB0 A;  2EFO A;  4OIQ F;  4UV8 A;  1Y1V J;  1S9H A;  1R1V A;  3ZCO A;  3VOE A;  2F48 A;  3Q0V A;  1I3Q J;  1XPX A;  2Y0S N;  2KRF A;  3S1M J;  4D7M A;  1G59 A;  1BC8 C;  3BJA A;  2M0M A;  3IRQ A;  5B1A H;  5J3L A;  3NAR A;  3BR0 A;  2FEZ A;  1LEB A;  2AO9 A;  3S17 J;  2X51 A;  1MH4 A;  2E1C A;  2MC4 A;  5DUK A;  3QOE A;  3VYS B;  4BUP A;  4BBS J;  1F5T A;  5E1Z B;  5FD6 A;  5D5X B;  1S6L A;  4HST A;  3HHH A;  2HYF A;  1IG7 A;  3WHC A;  1R5H A;  1Z7U A;  3WU1 B;  4ZTJ A;  1UST A;  4OMZ A;  1YJW I;  2VKV A;  4AD9 A;  2VBX A;  2VPR A;  4DGW B;  2JUC A;  3G3Z A;  3BC8 A;  4D1Q A;  5DS9 A;  5D4S A;  3RKX A;  3OYF A;  2MYS A;  1FP2 A;  2GXG A;  1MMS A;  2ZO4 A;  4A3E J;  1FIA A;  1H0M A;  2KIF A;  1LE8 A;  4C2M J;  4WXH A;  3I4P A;  1ETQ A;  2F5F A;  1RC9 A;  4Y3O A;  3I59 A;  4ZH4 F;  2FML A;  1NHA A;  2ZC2 A;  3LA7 A;  2H1K A;  2HYG D;  1U5T A;  1D5V A;  1KQ8 A;  3ASO H;  2HQN A;  4CCO A;  3FXU A;  3SFZ A;  2BHZ A;  1N25 A;  1OCR H;  3GFI A;  1OR7 C;  4IRH A;  2ZJQ F;  1I6H J;  3K0L A;  1ACI A;  4EEF G;  5IP6 A;  3IH3 A;  4BXX J;  4IHS A;  2IA1 A;  3OYG A;  3BZ6 A;  2DK5 A;  2UZK A;  5J8C A;  2CMP A;  3BPX A;  4IKF A;  3WTX C;  1QVT A;  3IKT A;  2KLO A;  3HOX J;  1EH6 A;  3T5X A;  1XCV A;  2X1D A;  2NNY A;  2GOM A;  3E0J B;  3SQN A;  5LEJ A;  1W0U A;  3IKV A;  3H5N A;  4A3M J;  3G1L A;  1J75 A;  1MGT A;  2M2E A;  3F21 A;  3HKZ A;  2RC4 A;  4QTR A;  1OFC X;  1RKW A;  5DM6 F;  1KQ0 A;  3F6V A;  2EA4 A;  5LHH A;  1AU7 A;  1JTX A;  2MH9 A;  4G6Q A;  4I2O A;  2W00 A;  2EFW A;  1QQI A;  3P9I A;  2XSD C;  3AKZ A;  1XSD A;  1MNM C;  4IQJ A;  2JZY A;  1F4K A;  4GRI A;  4QPO A;  4JX5 A;  5J1U A;  4PUS A;  4BQN A;  1J2X A;  1MH3 A;  3JRB A;  1ONV A;  1P9Q C;  4X1E A;  4DYQ A;  2QA4 I;  2HS5 A;  4IOC F;  3RQI A;  4GFB A;  2KRH A;  3G71 I;  2XGX A;  3F23 A;  1WJC A;  2IXS A;  1SD5 A;  4L0Z B;  2Z33 A;  1GXP A;  4O5V A;  4BXU A;  4CZZ A;  3CCU I;  1FEX A;  4ZYA A;  4OIO F;  4UUS A;  2R5Y A;  2RVC A;  5H6R A;  1SMY F;  1QO0 D;  1PYV A;  3DQV C; 
#chains in the Genus database with same CATH homology
 2VJJ A;  3PNV A;  3DTK A;  4Y4R A;  2M4G A;  3OS2 A;  2RQQ A;  2XDV A;  3H5A A;  4HRI A;  4PJJ A;  3D5L A;  3SDB A;  3G2B A;  4ANJ A;  5HNH A;  3MD2 A;  1T95 A;  4B44 A;  2Y0S A;  3HG9 A;  1YX5 A;  4F52 A;  2QKL B;  3CJR B;  2A5W A;  3M1C A;  4BE1 A;  2E60 A;  3OIP A;  4LG3 A;  4DBQ A;  1OLT A;  1X1D A;  2NOJ B;  3H9G A;  3BG6 A;  3VSL A;  4ZDO A;  4X0G A;  3CZ6 A;  3W2A A;  1JI8 A;  2F6C A;  2MD0 A;  3LSK A;  2LRE A;  3VYT B;  2ZSH B;  2BW3 A;  3BLY A;  2VQL A;  1UG0 A;  4ITV A;  4CH7 A;  2V9K A;  4EAT A;  2X85 A;  3C2G A;  2X6Y A;  1U0J A;  2WY7 Q;  2BW3 B;  2JA2 A;  2XF5 A;  4ZC3 A;  3A1Y A;  2FUG 2;  3MKW B;  1BOB A;  1MMN A;  4BJT A;  3VSK A;  2JVG A;  3W3C A;  3A4C A;  3HPG A;  4BAC A;  1Z21 A;  3DPT A;  2CH0 A;  4PSX A;  2A6T A;  3NWT A;  2PMZ A;  3HOS A;  3RPU D;  4P1W A;  1LFP A;  2R7O A;  3LL7 A;  3OYB A;  2VIX A;  1QHH D;  1Z3X A;  2V7F A;  2BVL A;  4E7J A;  3E1S A;  2DXI A;  4H4K C;  1WFX A;  4D9J A;  2R7Q A;  3MMY B;  1MMA A;  2HVS A;  3PSF A;  2DT7 B;  3K4J A;  2LH9 A;  3LSI A;  3OYA A;  1BR4 A;  4XKC A;  2VXD A;  2HPM A;  4PJN A;  1BR1 A;  2P0W A;  4BL0 B;  5KHD A;  4PK4 A;  1YE9 A;  2CW8 A;  3DKY A;  3ZGK A;  5HOO A;  1QU3 A;  3OL3 A;  2VQG A;  4XKV A;  3K4K A;  2R7T A;  3PJR A;  3OY9 A;  1D0X A;  3L2V A;  2AQF A;  2Z16 A;  2RRE A;  3V42 A;  4OAY A;  3K4M A;  3S3O A;  4OWR B;  2R7S A;  1Y6I A;  1D0Z A;  4II3 A;  4ZDP A;  3IUO A;  4F92 B;  3OYH A;  4G6T B;  3RTR A;  2MFZ A;  3VYR B;  3FDY A;  3PUB A;  2E5Z A;  5TGT A;  2HVR A;  2VKD A;  1W36 D;  2CW7 A;  3QYF A;  4HNU A;  4II2 A;  4CCN A;  4E7Z A;  3HL2 A;  2W7N A;  3OIQ A;  2F5V A;  2BOL A;  4E6K G;  2WBM A;  1D0Y A;  3D5S C;  3RQ4 A;  4BEH A;  4CZC A;  1D1A A;  4XKW A;  2LBF B;  2V26 A;  3DWL E;  1WJB A;  4KJZ A;  1MMD A;  4AVZ A;  5FRN A;  2R4G A;  1N75 A;  1T0F C;  2M7A A;  4XL9 A;  3ZR8 X;  3GBG A;  4PJL A;  2L7K A;  3HPH A;  3MKZ A;  3KYL A;  2JSP A;  3PSI A;  3DKX A;  3DU5 A;  4PSW A;  2V6E A;  2LBF A;  3FBI B;  1X1A A;  4P5O A;  4N4N B;  4YEJ A;  4E7K A;  1BR2 A;  2LYC A;  3MKY B;  4N4O B;  2XC7 A;  3L2Q A;  3A2K A;  2IS4 A;  3ONQ A;  3OL4 A;  4OAZ A;  2OV7 A;  2LOO A;  3CP8 A;  3OR2 C;  4F3Q A;  3OYL A;  4HSR A;  2Z1D A;  1X1B A;  2IGO A;  3K70 C;  2L9S A;  2WAQ A;  3QYE A;  2CV1 A;  3DEE A;  4XLF A;  3S3N A;  1NG6 A;  4XN0 A;  3UNG C;  3LMM A;  2ZSI B;  2HVQ A;  2K5C A;  4HG2 A;  4XOR A;  3LFU A;  4XM3 A;  2L5Q A;  2KHM A;  4RM3 A;  1Z7L A;  3VDX A;  4XN3 A;  3ZQQ A;  1SAU A;  1V5E A;  2Q2E B;  4J01 A;  4E7L A;  4XON A;  4XLC A;  1MMG A;  4AU7 A;  1ZEL A;  2HPI A;  4CCL A;  4PFP A;  2OUM A;  4DOZ A;  3BG7 A;  3S93 A;  3HXL A;  2VQC A;  1Z3Y A;  2E1M B;  3LSG A;  4BE2 A;  1LDK B;  2IGN A;  5CKT A;  3LSH A;  2KL4 A;  3L2U A;  2ZFU A;  1HA8 A;  2W4S A;  3CP2 A;  2RNG A;  4JQF A;  3CMM A;  3CJQ B;  3HUG B;  5HNF A;  3QOD A;  2R7X A;  4XLH A;  2UWM A;  4BJ5 C;  5KCM A;  2DT6 A;  5CQG A;  3OYI A;  4HNT A;  1EA3 A;  3RCO A;  3K4L A;  1LKX A;  2IS1 A;  2VJ4 A;  4XKB A;  2VJ5 A;  3DTI A;  3QYB A;  1QHG A;  4BJ6 C;  2K9M A;  4E7S A;  2V1N A;  2XF7 A;  2R7V A;  4IQ4 A;  1WJ5 A;  5JHF A;  4XLE A;  5HLT A;  3DTE A;  1YX3 A;  4PJM A;  4NUB A;  2IS2 A;  4XR6 A;  2LY2 A;  4YRV A;  1VZ0 A;  2I8D A;  3ZRG A;  3H35 A;  4BQO A;  4HPQ A;  4CCK A;  3OYJ A;  4NC7 A;  1R6R A;  3EUK L;  3EPZ A;  1DP3 A;  1MNE A;  2M7B A;  4BEH B;  2VJI A;  1D1B A;  3BCB A;  2DJI A;  2CV2 A;  2M4K A;  1X1C A;  2QKM B;  1GLN A;  3DPL C;  3PFY A;  3AL0 C;  1SFK A;  4B43 A;  3M8J A;  4F91 B;  1UAA A;  3VWB A;  1V5G A;  4XOP A;  3UR3 C;  3K4C A;  2JVH A;  4RM2 A;  4Y33 A;  3OS1 A;  4KT6 A;  4E4H A;  3S32 A;  2JUG A;  2WAE A;  3H9J A;  4LIV A;  4NC8 A;  4CA0 A;  3ZXS A;  3KX2 A;  4F55 A;  4BGD A;  3TL4 X;  3W2V A;  3LSM A;  2KMU A;  4XMY A;  2LY1 A;  4J00 A;  4DBR A;  2K3P A;  3OMY A;  3U21 A;  3OS0 A;  1X4O A;  1N78 A;  4BE0 A;  1WJE A;  3DLA A;  4C30 A;  4QPQ A;  1X4P A;  4MLO A;  4DIQ A;  3I3L A;  2LC2 A;  2LRD A;  4HEA 2;  4YEL A;  2X1E A;  3NWS A;  4XQF A;  2L2O A;  2X6X A;  3DU6 A;  4NNJ A;  3OR1 C;  2V4J C;  3S8P A;  1ERD A;  1KON A;  1WJF A;  4BS9 A;  1W36 C;  2HZD A;  3PNY A;  5FRO A;  2VAS A;  4BU2 A;  2VPL A;  3H9Q A;  2E5N A;  2DCE A;  2GOX B;  4AYB A;  1AA7 A;  2DOA A;  3OYM A;  4C9Y A;  2L9N A;  1E0E A;  4RLQ A;  4ZDL A;  4E7I A;  2AQE A;  3J7A Y;  3CF2 A;  3SYT A;  4C2U A;  1MND A;  2KP6 A;  4BDY A;  3K4N A;  2M3A A;  1J09 A;  5LFA A;  2OC6 A;  2R7W A;  1FMV A;  1TT0 A;  1WJA A;  1NG7 A;  3OYC A;  2ZXI A;  2WAF A;  4RLF A;  4ZTF A;  2O5R A;  2R7R A;  4BXF A;  2W82 A;  2IGM A;  2KQR A;  4FAS D;  3H0D A;  1S9H A;  3W2W A;  3ZCO A;  2F4I A;  1G59 A;  3I9V 2;  2M0M A;  3TMO A;  3K4B A;  3PL8 A;  2X51 A;  4FET A;  3C2H A;  2MC4 A;  3QOE A;  3OYD A;  3VYS B;  3FHN A;  4BUP A;  4IZZ A;  3SEQ A;  3TBI A;  2WB1 A;  4HST A;  4LIT A;  5LD2 C;  4ZTJ A;  4B3X A;  2MAB A;  3OYE A;  2VXZ A;  5CPR B;  2ZXH A;  3IAS 2;  4DGW B;  2HDW A;  3L2W A;  3BC8 A;  4D1Q A;  4CUG A;  1V5F A;  1N77 A;  3OYF A;  2R7U A;  2MYS A;  2HNH A;  4PFO A;  4XLA A;  2XAU A;  1G8X A;  3HC7 A;  3OYN A;  2LG4 A;  4XOT A;  2CUJ A;  3AFH A;  1LVK A;  4CCJ A;  3OWT A;  1MW7 A;  4Y3O A;  4B47 A;  3HOT A;  2VL8 A;  3PNT A;  3SZG A;  2KDO A;  4R79 A;  4C2T A;  2CUZ A;  2WAD A;  4CCO A;  1K6Y A;  4KIT B;  1WJD A;  3KEY A;  2VQH A;  1X19 A;  1OR7 C;  4XNF A;  3AL0 B;  2X1C A;  2HU9 A;  4RMN A;  1IRX A;  4BQQ A;  3SEZ A;  3F9K A;  5CQE A;  3L2R A;  3OYK A;  2KPM A;  3FBN B;  2K9L A;  2CS3 A;  3K6G A;  5KNL A;  3IAM 2;  2IS6 A;  3OYG A;  2UV1 A;  4DJA A;  4ZJZ A;  3EUA A;  2CMP A;  2XSJ C;  4IKF A;  4F93 B;  2CFO A;  4E7H A;  3OOU A;  2PJR A;  2W1O A;  3VYU B;  2KLO A;  4KIS A;  3N05 A;  2CV0 A;  2X1D A;  2GOM A;  3E0J B;  2Q1Z B;  2Z2S B;  4JOM A;  3S3M A;  3H5N A;  3HKZ A;  2E1M C;  4CSW A;  2PJR B;  2VLA A;  3K70 D;  2WY8 Q;  3FKJ A;  2KZV A;  3RSN A;  2W00 A;  1FMW A;  3AKZ A;  3K10 A;  1UEL B;  3H5R A;  4LIU A;  3D5R C;  4U7B A;  4IQJ A;  4BDZ A;  2XF6 A;  4IX7 A;  3BCA A;  3CES A;  4GRI A;  4QPO A;  2KRC A;  4U87 A;  4PUS A;  4BQN A;  1DGR M;  1Y56 A;  3IP4 B;  2VKH A;  1P9Q C;  2ELJ A;  2X6W A;  2BVM A;  2UUZ A;  2KRH A;  2VB6 A;  3DPU A;  1WJC A;  1TZL A;  2IXS A;  2HQA A;  5HVQ C;  4NQW B;  4CCM A;  1DGW Y;  2WA0 A;  4ZYA A;  1PJR A;  4B48 A;  2IGK A;  1D1C A;  5FRM A;  1DQU A;  3EUH C;  1PYV A;  3DQV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...