4ZYAA

The n-terminal extension domain of human asparaginyl-trna synthetase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
69
Chain Sequence
MAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSRWNVISKSQLKNIKKMWHREQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Asparagine--tRNA ligase, cytoplasmic
publication title Unique N-terminal extension domain of human asparaginyl-tRNA synthetase elicits CCR3-mediated chemokine activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 69
sequence length 74
chains with identical sequence B
ec nomenclature ec 6.1.1.22: Asparagine--tRNA ligase.
pdb deposition date 2015-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4zyaA00
2KQRA 4ZYAA
chains in the Genus database with same CATH superfamily
1QVUA 1U0JA 3GFLA 4ETSA 3DKWA 3I9V2 4KT6A 4F92B 3CCEI 3W6KB 1FOXA 1HDDC 1IRFA 4I7HA 4LG3A 1XB4A 3DTEA 5KHDA 2JMWA 5FLVA 3JREA 2OZ6A 1VQ5I 3EUKL 2F5EA 1JKQC 2DA2A 4ANJA 1ZTRA 4E6KG 1IZ1A 1QZZA 1I5ZA 3WHCA 2FOWA 3QU3A 4UV9A 4B47A 1OCOH 5DS9A 3S1RJ 1R22A 1WKMA 2AQFA 1OYYA 4I99C 1ZN2A 4AU7A 2R0QC 3CCSI 1IDZA 2IS4A 4BDZA 4UHTA 5F27A 3M07A 4CH7A 4BXFA 4JOMA 1Y0UA 1BIAA 5LD2C 4DNCA 2DT7B 2VC0A 2JA5J 4KN4X 2LBFB 5FJ8J 2DK5A 2CQNA 2HVRA 2IXSA 3I5UA 3MCZA 4N0BA 1V54H 5KCMA 1ZG5A 5EGOA 4JX5A 3MZ8A 1NK3P 3OS1A 3IWZA 4M9SA 5GPAA 1VTNC 1F43A 4WXCA 4FT8A 4UUSA 4BHPA 1FIPA 2GM4A 3EQLF 2YU3A 2QKLB 5LGUA 3CUQC 1IRXA 1FSEA 3RYPA 4D7MA 4EJTA 3C2HA 1R36A 3LSRA 2XHKA 4HF2A 2VT2A 2X6YA 1BJAA 2L7KA 2STTA 2AO9A 2ZMEC 2PX9A 2JJ7A 2W24A 4NNJA 4BGDA 1VFCA 2QQ8A 1JUMA 5LRSA 3GYHX 1AKHA 4HX4A 4XSZF 1Z3XA 2XF6A 3F8BA 5ICEA 3QP6A 2FJ1A 3ZOBA 1SVLA 1WWXA 4RA2A 1FYMA 4CSWA 4ESJA 3KEYA 2YSRA 3A0HC 5JHFA 2E71A 2OQRA 4LITA 2H1KA 4ESFA 3Q9SA 2HQRA 3T1BA 2V7FA 1ZK8A 3OV8A 4AIKA 2KISA 3HKZA 1OCZH 3UR3C 3GMEA 2GA2A 3RPUA 2R7UA 1JI8A 2DODA 4F55A 3RJPA 1KU9A 2M1BA 1EH6A 3H92A 4O6JA 3VSKA 1JE8A 2VKHA 2QEXI 2HOTA 4OINF 2Y0SA 1JHFA 3ABKH 4X1EA 2O8XA 2W1OA 1SC7A 3HHGA 2W82A 4A3MJ 4MQVA 2QLZA 2D1VA 2DT5A 2NRAC 1LUJB 2DFFA 5D4SA 4QLCU 5K1YA 4JK1X 2K40A 4HLYA 4I02A 1BC8C 3ZMTA 1UG2A 2E5ZA 2BGCA 3E1SA 3DPUA 2LBFA 2QA4I 2NVYJ 2GIVA 1YIJI 2A68F 2AHQA 3T0YA 2Y69H 3F8CA 1MZBA 3F8FA 2HWVA 2PJRB 2HYFA 1R5GA 3NARA 2CYYA 3HOTA 1JHHA 3HOYJ 2H8RA 3TO6A 4A3JJ 4ZZLA 4I0AA 2R7ZJ 5ERIA 5FRMA 1ITYA 3VYTB 1JUPA 2LNBA 3ASNH 2XGCA 3KX2A 1YIOA 2IS1A 3TOBA 5FGMA 2E2IJ 1MJ9A 1WPKA 3CDLA 2BV6A 2H6BA 2KDZA 1XMXA 2X85A 2LF8A 1GDTA 4E7HA 1MJAA 3N97A 4XLNF 3CCJI 1MDMB 3A0BC 2K9MA 1CGPA 1PUEE 1R5HA 3BOQA 4HG2A 3CLQA 2IGMA 3KFWX 3LQRA 5EDNA 1D1AA 1HDPA 1G3WA 4DZPA 2IT0A 4HZFA 1RR7A 1W36D 2R92J 2IGKA 2RKHA 2K3FA 4DIQA 1X4OA 1D0YA 2FBIA 3GZNB 5D8LB 2V1UA 1GXQA 3E6BA 1F36A 3MKLA 4PK4A 3B73A 4BJTA 2EV5A 2I5UA 4P5OA 1NH3A 3TO9A 4LK0F 4A0YA 1MBKA 2MABA 3HG9A 2DO7A 1HSJA 3HYIA 2AQEA 3L9FA 1FOWA 4UUTA 1R1VA 4W97A 1F4KA 4LLNA 5M3FJ 2LSOA 3FK6A 3FMQA 3DU5A 2XASA 3WU2C 5CVVA 2O3FA 3CDHA 4Y17A 1NTCA 5J4VA 4CCOA 5HNFA 2QENA 3LAPA 1ACIA 1E2XA 2ACJA 2KZVA 3F72A 2PJRA 2BHYA 4KIGA 4FISA 5FLXK 3ZR8X 3FXKA 3KETA 1XG1A 1K6YA 2L2OA 2ETHA 2Y0MA 3V8KA 3OS0A 2FU4A 4FHTA 3WODF 1V3FA 3SEZA 2RQPA 4MTEA 3VSLA 2L9RA 3LSTA 5E3NA 1VI0A 3HL2A 2WAFA 5BPIA 2HYJA 2GXGA 4CYCB 5IPAA 3KP6A 3G3ZA 3E5QA 2MSYA 1SD5A 5DM7F 1BI2A 2XAJA 1UAAA 1MDMA 1SMYF 3PUBA 2MFZA 3ELKA 1B59A 1XPXA 3FM5A 3R6SA 1MNEA 1LFBA 1RC9A 3RKWA 4S05A 3X2QH 4ZDPA 1P4AA 4FETA 2F5DA 4BQAA 2XAQA 5HLTA 2L54A 4HNVA 2K9QA 4BEHB 1WH7A 2G9WA 3MQ0A 2EINH 3RPUD 2VONA 2BHZA 3G1OA 3GLXA 3CDIA 4XKWA 2EIJH 4ABZA 4L5JA 2M3AA 3ABMH 2K7LA 1YO5C 2ID6A 2Y30A 2DTRA 3MMYB 2M30A 1Y39A 2E35A 4D0PA 5IYBJ 5E18F 5D4RA 1WQ2A 1SANA 1W5SA 1ORKA 1OLTA 3W2WA 2BY1A 3K10A 2LF7A 4IF4A 4BDYA 3SXYA 1YRNB 1SFUA 5DYMA 4ENKA 4EJUA 2MG4A 3OYCA 2DCEA 2GOXB 1MBFA 1O7LA 3CUOA 4H0EA 4HQEA 5FO5A 1LEBA 2VN2A 4CCMA 4IVNA 3HOVJ 4OWRB 5TJJA 1GV5A 4CGZA 1WJCA 1Q1VA 2MA3A 4CCNA 2M45A 3AG2H 3GF2A 3UKGA 4OAYA 1YJ9I 4CYCA 2NS0A 3C2BA 1JTYA 1MJBA 2ID3A 3SFZA 2JA7J 1UHWA 4MEXF 2JRTA 3H5RA 3HRUA 2YX4A 3BR1A 2PQ8A 5IT3A 4OIRF 2HOSA 2Z33A 3WHBA 1LDKB 4XRMA 2VLAA 3C2GA 1QZEA 2OA4A 3PJRA 2ECBA 3TW7A 1I1SA 3CMYA 3OWTA 1HXDA 4RLFA 2BVLA 3I55I 1HA8A 3I54A 3DPTA 4IOAF 3UNGC 3M1CA 4RB3C 4BEHA 1HF0A 4UB8C 3DBHB 3R61A 1X3ZB 1TC3C 2E2JJ 2Q8KA 4C9YA 3S1MJ 2FMYA 2IS2A 2A6EF 5IP7J 4YRVA 2LK2A 2LC2A 3BZ6A 3ERED 3OYHA 4FE4A 2ZJQF 2ZSIB 1D0ZA 2OU2A 4F93B 4DYQA 4MQ9F 3OOPA 1WI9A 1X3UA 4HF1A 3M8FA 2E1NA 1IN7A 4IOCF 2X1CA 3HOXJ 1JT0A 3CJNA 2HKXA 2J5OA 3J81Z 1YRNA 2CFXA 5DM6F 3C3WA 5CVRA 5IT9Z 3ZQHA 3AFHA 1WZ2A 4IEJA 1FTTA 3DCFA 3DFGA 5HS8A 3F3XA 1EH7A 5E1ZB 3CCLI 2M87A 2P7CB 1OMIA 2FNPA 2GAUA 2GXAA 3ERMA 2V6CA 4QTRA 1NHAA 2DQRA 2QSGX 1BR4A 3PFIA 3M3YJ 2L01A 4E4HA 4A2UA 2VKDA 4YFXF 4Q47A 2X6XA 3E3VA 2Q2EB 4BXUA 3ABLH 4D5FA 3GTPJ 4BYYA 2ECCA 1MMDA 2FD5A 2CWEA 4A3EJ 2OPTA 2WAQN 4L18B 2JZYA 5H20A 3JSOA 1BOBA 3D1NI 2NVUB 1ULYA 4I76A 1KYWA 2KIMA 1KZHA 1U9NA 1IXCA 3DEUA 5CVJA 1PP7U 3OSGA 2G7UA 1OR7A 1TNTA 4J01A 3T8TA 2ZJPF 4AVZA 3DBLB 3OYJA 2PI0A 3OYFA 2K85A 2KRFA 3I4PA 1T33A 3GTGJ 3PO3J 2JVGA 2CMPA 5EG0B 5KVRA 3J81K 5JHUA 4A3KJ 3I53A 4TV7A 2V9PA 3GZ5A 3IRRA 2IA2A 5IT9K 3CO7C 3BTCA 3U1KA 1H9GA 3FIWA 1MD0A 2UUZA 1RR8C 3RDIA 1I39A 5L3BA 5C4JJ 2VJJA 4F3QA 1JJ6C 2EZIA 4E7ZA 3TP3A 4BKXA 4Z6YA 2O6GE 2Q1ZB 4EEFG 5E3MA 4ZYAA 2ZB9A 1TQPA 2DFHA 2HR3A 5J1UA 2DA7A 3KP5A 5L3FA 4AD9A 4NB5A 2ZNYA 2NVTJ 4G94A 4KMUX 4RAFA 4RGSA 3HM5A 2JPCA 3MAJA 3GBGA 1A6IA 3WTVC 3QYBA 4FTHA 4P9UA 1RESA 4QSHA 2ELJA 4IRGA 5EYRA 2ZO4A 5HODA 4IHVA 2Z3YA 4L9VA 1WHUA 4RGUA 1UELB 1TW3A 4M6XA 1Y56A 3E5XA 3W6VA 3IWFA 4EJVA 2L7ZA 3E6CC 3NAUA 2LR8A 4BH9A 3E6MA 4Y33A 4UVAA 2FA5A 1Z77A 1WI3A 1Q1HA 5CJ9A 2R3SA 1FYKA 1PP8F 1ZGJA 1IV6A 2FXAA 4CUGA 4D5CA 4OOIA 2Q2EA 1G2HA 3I4MJ 2P6SA 5AONA 2X51A 1NG6A 3JRCA 2DJNA 3ECOA 3DKXA 1LDDA 3I0TA 3K1PA 3IP4B 4A93J 1Z6RA 5IOZA 3VWBA 3ZQIA 3QODA 1V55H 3R60A 3EUHC 4KJZA 1JKOC 4CYDA 1QNTA 5FFXA 3OMYA 4ZC3A 2XRNA 4B1RA 1YYVA 3ZQFA 2W85A 2QBYB 4RM2A 4YELA 4RGRA 1ETOA 1O57A 2L4MA 1ZGAA 5EG0A 5FKLA 3QWLA 3OYEA 3M7GA 5E17F 1KQ9A 4HX8A 3OYKA 3K2AA 2KIUA 1TP4A 1QU3A 2G0EA 4UY8I 3JR9A 3SQNA 1S6LA 3CF5F 5HDKA 2M8GX 1O3TA 3QPTA 3VODA 4MLOA 3KYDB 3ASOH 1YS6A 3Q9VA 1FTZA 3N4MA 1QA6A 3O2PE 4NUBA 5GADJ 3NQOA 1DU0A 2GWRA 5EZHA 2W57A 4HX7A 1MBEA 1ENHA 2LY1A 4XL9A 4EM0B 5ILVA 4XLCA 5H6QA 5B3SH 1BJZA 1HBXG 5HLIA 2JN6A 3ISPA 4M6YA 1WH5A 2M7AA 4PJMA 5J3LA 3A01B 1HW2A 2QSHX 5HDGA 1FX7A 5EZGA 5IYCJ 3K4KA 2ZXHA 4IKFA 3RCOA 4LFUA 1BM9A 5FKKA 1KA8A 1IO2A 5DCMB 1VQ4I 3VYSB 2CQKA 3G1MA 1WCMJ 4DQ2A 2UV1A 1FJLA 2LY9A 2HDWA 1U6GA 4GXOA 2K4BA 2CS3A 2ZJRF 1R71A 3TOAA 3PIOF 2RDPA 1T6SA 2WWYA 5LGTA 4N4NB 1BI1A 4DBRA 3H5NA 4ASNA 1QBJA 4H4KC 3FXUA 4DYCA 3E0JB 2QBYA 2ESNA 2V1NA 4A5NA 2VE8A 1DQUA 3QQAA 5GTIC 3CUQB 1YG2A 1RKTA 2QQAA 4HAMA 4XLHA 5K7ZA 2E1OA 2XAGA 1YS7A 5D5XB 2E60A 1Y8RB 2ZMEB 1RI7A 1R6RA 1WJ5A 1Y8QB 2IA0A 5HDNA 4EQQA 4MEYF 2R7VA 1ZHFA 2M2EA 2PMZN 2O61A 1OCCH 2E1MC 1MIJA 3KYCB 1D1CA 3BPXA 1YI2I 4I6ZA 1HQCA 3CCQI 2EZKA 4BHCA 4XK4A 4EATA 3KZYA 1HW5A 4C2TA 1NK2P 3EDPA 1T2KA 2E5NA 2HNHA 1MMSA 3HPHA 1IN8A 4PZJA 2ICWG 3W2VA 3OYDA 1TZLA 2V4JC 2QM3A 4M72A 3DP7A 3CJQB 5IP6A 3A01A 4XKBA 4NQWB 4DJAA 5BOXA 4XRSA 1S29A 2QYOA 1BR1A 4IL6C 3ROUA 3ZMVA 3J80Z 3S3OA 1J5YA 5DCMA 3RI4A 1W36C 1OCTC 3PIPF 4PGGA 2OV7A 4Y7NJ 4ZYEA 2EV6A 1N25A 2DOFA 3A1YA 3BDDA 3OYLA 2EZLA 2VB6A 3DQVC 3DEEA 1G6NA 3S17J 5M5YJ 1AU7A 1DPRA 4A12A 2VQHA 2HYGD 1S7EA 3DKYA 3K4BA 4CDGA 3HZJA 2ME0A 1MSEC 1TNSA 4U7DA 1I27A 1KU7A 1XMAA 2F4OB 5JR3A 3U21A 2L02A 4YEJA 2OTJI 3SDBA 3CUQA 1Z21A 3R0JA 4YFNF 1P2FA 2VJIA 1W5TA 1YOVB 2DPDA 1J2XA 3HXLA 3DTKA 4BQQA 2DOEA 3FBIB 3HTUA 4I01A 4A6EA 2V26A 3K4LA 3IAS2 1RNLA 4ZYHA 2ZMEA 3ZMDA 4XOTA 4C2MJ 2XSJC 4CZCA 2XPWA 4XLEA 2KJBA 2F5VA 2ZJ2A 1A36A 3HRTA 1HKSA 3QP5A 3J80K 2P5KA 2DFIA 2ADUA 3CC4I 3H3UA 1EKEA 2JSCA 3GTQJ 1BBYA 4BE0A 2HVQA 3JCUC 5FB2A 1Y1WJ 1JT6A 2KKOA 3HB9A 3MKWB 2R7FA 4M3FA 3J7ZI 4B44A 4PUSA 4NQWA 4R79A 1ZG1A 5B1BH 4NHJA 1HOMA 5HNHA 2RV8A 1KU2A 4QPOA 2IEKA 2QCOA 5FKMA 2JUGA 4YIFA 3IKVA 1IXSB 2F4IA 3QU6A 2TDXA 1KQ8A 3EETA 3ZN1A 3H36A 2EA2A 4RB0A 3OYMA 5BPDA 2LMDA 3SHFA 2Z9OA 5EEAA 5F0CA 2O5RA 2KIFA 4BY1J 3BC8A 4G6DA 2E1CA 1LNWA 2DAOA 3FMSA 1K4SA 1VQPI 1FOKA 1MBGA 5GAGJ 4XLFA 3P5JA 2DK8A 1I3QJ 4LLGF 1DUXC 2ZC2A 3RTRA 4E7KA 2XPUA 1LB2A 4GRIA 2CU7A 2KQRA 1TWAJ 1FWZA 2HQ5A 3JW4A 1SEUA 3J7YJ 3CC7I 4AIHA 4DGWB 2R7TA 3BTLA 3Q0WA 4AVPA 2MD5A 3CJRB 5BQTA 1S72I 3QRFF 1JKPC 3FXMA 3IAM2 4C3JJ 4IJAA 2IBDA 2YR2A 3WE2A 1ZLKA 3GTLJ 2DJIA 4OIQF 5IY5H 1FBQA 5J1YA 1H9TA 3ABTA 3S1QJ 3DV8A 2CV0A 2BY2A 2UXNA 1VQMI 4A3GJ 1D1BA 1OYWA 4UB6C 3PNVA 3IH2A 5L3GA 4E7SA 5JFRA 2IS6A 2RNJA 3O3KA 2KHMA 1E3HA 2DMNA 2M4KA 4P55A 3HHHA 5F64A 2R5ZB 2L3DA 4G9YA 4LOCA 3IKTA 1FMWA 4BAYA 3SEQA 3BP8A 3OL3A 1SFKA 1A6QA 1BIBA 1P4XA 4BJ6C 4IHWA 1TWFJ 5TISC 4ZH4F 1VQKI 2Z2SB 4ZDOA 1JGSA 1TBXA 5J4YA 5D5WB 1GT0C 2DMTA 1TWHJ 1MH3A 2GIZA 2XAUA 4MHGA 3G2BA 2LFBA 3Q0VA 3RKXA 2HPMA 3K1MA 1GVJA 1YW9A 3V8JA 5CYVA 3ZQ7A 3FXOA 4WXHA 1A31A 1BI0A 4GDFA 3BTIA 4EGYA 1TWGJ 3TO7A 1CQTA 2HDDA 1X2NA 1IF1A 1OPCA 4GFBA 4A3DJ 1BW5A 1WVRA 3HTSB 4S04A 1VQLI 3BR0A 4ZTJA 1FC3A 1N78A 5EJCA 1XN7A 2WY7Q 1ZQ3P 3FXRA 4B3XA 4YIRX 2K4JA 1X1BA 5CLSA 1K79A 3GTKJ 3CMEI 2RGVA 4KFCA 2F4MB 5F08A 3VFZA 5LHHA 2CUZA 1ETVA 4D9JA 4Y4RA 3D5SC 1X1PA 1GXPA 3DBRB 1Z67A 2X4HA 2QF7A 5GPCA 1H8AC 3S1NJ 5F0FA 3LSIA 2R5ZA 2HQAA 3DEWA 2HTSA 1STZA 2M4GA 3KLNA 4EMSA 4V2GA 2MLKA 4M9ZA 2X0LA 3ZMSA 1X58A 3F6VA 4P9FA 5C44J 1XSVA 3EYIA 3ML6A 3NEUA 4IRHA 2ZXJA 2OTLI 1H0MA 5E3LA 3LNQA 3ONQA 5D8KB 5FROA 1K6OA 5K7FA 3I56I 3QOPA 1VNDA 1W7PB 1REPC 2NOJB 1T39A 4M3GA 4B48A 3JRDA 3I3LA 3Q0UA 5F1JA 4HW0A 2A61A 2STWA 3D5LA 5J6XA 3LSGA 1BOAA 4CHUA 2WC2A 3FM3A 1S7OA 4I0BA 2CQ7A 3SJMA 2IW5A 4M3EA 1IN5A 5BNGA 3M4OJ 1H89C 2PLYA 2E19A 2L4AA 3FXQA 3VB2A 2LDUA 3FWEA 3FISA 4M74A 4D7NA 3L2VA 2XROA 2XKOA 3H1CA 4OIOF 3LMMA 1K7AA 2O03A 5F0HA 4IX7A 1H88C 3KE2A 1POGA 2OQGA 5BS6A 5LBQA 4IQJA 3S8PA 2DI3A 3PO2J 1XGSA 1J59A 3OIPA 4DOZA 4GYGA 3JRFA 3TEDA 2EFOA 5J40A 3V7RA 3QPSA 3HGYA 2QQ9A 3QYFA 4EVIA 4RMNA 3JTGA 3K9TA 3H3ZA 3MVPA 4L5IA 3HOUJ 1DU6A 3MEXA 3COAC 4BE1A 1K78B 1R7JA 1SAUA 4QPQA 3JSPA 3HSEA 2VJ5A 2EFQA 3K4JA 1U8RA 1UG0A 1IDYA 2R7XA 2DFEA 3S93A 2M0MA 2MLGA 4NDLA 4A6DA 2P6TA 2IVMA 1R23A 4Y52J 2EFNA 3OYBA 4J00A 3OOUA 1QQIA 1RRJA 3SZGA 4L5EA 3CLOA 5LHIA 5DD8A 3DU6A 3K0LA 1DP7P 1DGWY 2H1LA 4NC6A 3H9QA 2P8TA 1W7PA 3GCMA 3PUFA 2DN0A 1IN4A 4CO8A 2DOAA 4CA0A 1JGGA 1UHMA 4KN7X 5JVTA 4JX6A 3HSFA 2HFHA 3HGGA 2H6CA 5D6EA 3OL4A 5E1XA 2DA1A 3RQIA 1F1ZA 4AYBN 1AOYA 1FEXA 5M5XJ 2DQLA 2CQXA 2LLKA 4L9JA 5FRNA 1ZREA 3LOCA 4R8HA 2PG4A 2CV1A 3DXJF 2RQQA 1KONA 4XMYA 4C3HJ 3ZQLA 3FDYA 5IOYA 5JVGF 5GTHC 1FY7A 2RREA 1QGPA 1FP2A 1UHSA 2OAZA 2R5YB 5J47A 5ICFA 1FIAA 2AXTC 2XC7A 2X1DA 4AWXB 3G73A 5FD5A 5HLGA 2M7BA 2CSOA 2X48A 1OFCX 2IP2A 1ON1A 2LD5A 1VQ9I 3G1LA 3E5UA 3FF5A 4C3IJ 4XRFA 3S14J 2B9SA 5LEKA 3AG3H 3JRAA 2M5WA 2P4WA 5L3EA 3MWMA 2JUCA 3S32A 4NC7A 1GLNA 2JT1A 1LFPA 4XN0A 1V5EA 1SD7A 1MGTA 2MGQA 2K9NA 4M3DA 1RPWA 2XKPA 2YPRA 4JBAA 1K78A 1QPIA 2Y9YA 3HBLA 2ZSHB 4CXFA 3K70D 3CCYA 2E34A 1DGRM 1E3OC 4PFPA 3CF2A 4YIIA 4XKVA 2Q0OA 4II3A 2M9HA 2OF7A 4P1WA 1XSXA 1G3YA 4XM3A 1XMKA 2VBXA 2DTZA 2HGCA 3A02A 1DDNA 1QO0D 4KIBA 3F8NA 2NS7A 2QUFA 4OIPF 2P5VA 4WXDA 2K9LA 2A07F 2LKXA 3GTMJ 3WTWC 1XX5A 5D6FA 3WTUC 4U0WA 2ISZA 5D5VB 2DT6A 2LG4A 2BXZA 3QOEA 3TGNA 3CC2I 5A2QZ 1N75A 3M1EA 4JQFA 2R7WA 2HVSA 1KQ0A 3EUAA 3N05A 4PJNA 3L2UA 4Q5SF 1I6HJ 3P9CA 4N9HA 2O9LA 3AAFA 4IRIA 2CRGA 4FCYA 5LEJA 4XIDA 3CZ6A 2FSWA 1P9QC 2L5QA 4QIWN 3BJ6A 1OCPA 2FEZA 3BQYA 4A69C 1X19A 2DA5A 4IHXA 4IQ4A 3TL4X 3I58A 4I09A 1MMAA 1QPMA 3FXLA 2JA2A 2LKPA 2R5YA 2B63J 5M5WJ 1IRGA 4XRSG 3KP4A 2BXYA 4RGXA 4WF2A 3CO6C 2H94A 2XDVA 2QZ8A 4X6AJ 2BE5F 1O3QA 3AL0C 3GXOA 1ZAOA 3WG7H 4CZZA 1ETKA 1ON2A 4U88A 3ZMZA 4MFDA 4PSXA 5J1RA 4A3LJ 5J8CA 3TDUC 4WWCA 1T08B 1AHDP 4IXAA 2ZKZA 4J19A 4HV6A 2JQ7A 2F2EA 3TBIA 1ZYRF 2XGEA 2QSFX 3L2WA 2OBPA 1UZCA 3CD6I 2NVXJ 3BJAA 2HTJA 2A6HF 4PSWA 3EUHA 3CP2A 5AIQA 5CKTA 3G4SI 1S9HA 4LG0B 1XGNA 4B8XA 1ERDA 3KLOA 2A05A 2V9KA 1D5VA 4V2FA 5FLMJ 4O5VA 2ZCWA 5JLWA 4ON0A 3TKYA 9ANTA 3CCVI 4W1UA 5HVQC 5H6RA 1R4NB 1K61A 3H0GJ 4KUMA 2MC4A 5K5QA 5HS7A 1WJFA 3QPLA 2X6WA 1PUFB 4BHBA 5E8IA 2IGNA 1W4MA 3FKJA 1A35A 1R9TJ 2QVOA 1RETA 1FSHA 1U5TC 1D8JA 1T0FC 1X1AA 2DA6A 3RQ4A 3CCRI 1YW8A 3K1NA 3HRMA 4WK8F 1Y6IA 2E1MB 4LK1F 1USTA 3I64A 1IUFA 3S3MA 3KEQA 2A5WA 1Z91A 2Y48A 1J75A 1TLHB 1W7PD 2K02A 2H27A 3OYIA 2OJED 1FT9A 2BEOA 2COBA 2KL4A 1OQYA 3KPHA 4HSTA 2W7NA 2MW8A 2AXLA 1B4AA 2CUEA 4Z2YA 5E3OA 2CQQA 3IL2A 4HF0A 1Y1VJ 3ZPLA 1U3EM 2D2WA 5E1WA 3H5AA 3ZP5A 2LRDA 1BC7C 4LD5A 3KP2A 1UFMA 3HDDA 2KRCA 1WJDA 2FOKA 5B1AH 1K83J 1LEAA 3S3NA 3SFIA 2WV1A 4XLAA 5ILUA 4XQFA 1BI3A 1T8IA 1TT5B 2WAQA 3I59B 3L09A 4JX4A 3K6GA 1D8KA 2FMLA 3K4CA 5CQEA 2H09A 5CQGA 1D5YA 3J7AY 3O8GA 2MH2A 3L1PA 2Z1DA 2UXXA 4MFEA 3PSFA 4R1HA 1LPQA 1VQOI 2OZUA 2VPRA 3G6EI 3F8MA 3HRSA 4HV5A 4B4CA 1K4TA 1JJ8C 2LYCA 4II2A 4HEA2 1S8NA 1FZPB 3GVAA 1LVAA 1Z7LA 2LP0A 2Z16A 1OISA 4LG0A 1B9MA 4M9XA 1MMNA 3WGHA 5H2FC 3C18A 4EJWA 3DLLF 2WADA 2PN6A 2ZFUA 4E70A 3LFUA 4GGGA 3CJTB 2L9SA 4KA4A 3HKZN 2PFBA 3GFMA 4O3MA 4MNUA 2DMUA 3PNYA 1PUFA 3BLYA 4E7IA 3GX4X 1DPUA 4PJJA 3Q3SA 2IGOA 1A04A 2Y0SN 1XGMA 1EJ9A 2FNAA 3O6BB 1B6AA 2V6EA 2ZBKA 4U87A 2DPUA 3W6JB 2EQRA 1Z3YA 3OYAA 3L2CA 1DP3A 3RIRA 2OC6A 1LVKA 1EV7A 5CPRB 2MD0A 2QWWA 3J7AO 3S2HJ 5GAHJ 2VKVA 2JTVA 3PFYA 1YW7A 1U2WA 1P7JA 2V9VA 3CTAA 2D45A 4A5MA 1X2MA 2FQ3A 3V4GA 4ESBA 2KT0A 3DF8A 2LH9A 1AKHB 1X1CA 3HOZJ 1R1TA 3BR3A 3ZMUA 2P5LC 1ZR4A 5C4XJ 3BR6A 4IZZA 2VJ4A 1BA5A 4XOPA 3P9KA 4LB5A 3I59A 3I71A 4L9TA 4PJLA 4RLQA 1FP1D 1BW6A 3EPZA 1F5TA 1S5LC 2A5YB 1N77A 4LMYA 1W5CC 4BL0B 1GHCA 2BY0A 2JRMA 3NRVA 4M71A 4LB6B 3WG9A 1G8XA 2BYVE 4G7OF 5C3EJ 4ITVA 4EGZA 5FKNA 4ZTFA 4V19K 3S2DJ 1IUYA 4UUVA 2VBYA 2HZTA 3JTHA 3L00A 1YJWI 2ELHA 3LSPA 3CMAI 5B5EC 1ZG3A 2WB1A 2V1XA 5DV5A 3B6AA 3QAHA 2CG4A 4LGWA 4D1QA 4AUXA 3F21A 4G6TB 1YHQI 3EYYA 4UVBA 2XAHA 4LJZF 4LIUA 2MH9A 1WGXA 1MH4A 5ICGA 4HLXA 4XSXF 2DBBA 3LSMA 1UJ8A 2HS5A 2KLOA 3E7LA 3BG5A 1FBSA 3G71I 1PYVA 1VQ7I 2K3PA 3HEFA 4HDUA 3ZGKA 5FD6A 4BJ5C 3FHNA 4F91B 2VASA 2O8KA 3FK7A 4L0YB 5DUKA 5LLQA 3WE3A 3CCUI 1P6RA 2OD5A 3GO5A 3WTYC 1YLFA 4KNYA 3LA3A 3ZQGA 1MBJA 1HC8A 5L3CA 1E17A 4QWQA 1O4XA 2RC4A 3RKQA 3FBNB 3O8HA 3V7SA 2O0YA 3GFJA 3GTJJ 1Z7UA 3M8EA 1IW7F 3IRQA 3HIFA 3ABUA 5E79C 3IUOA 4PGHA 5M3MJ 2DA3A 2D5VA 4KISA 2Y2ZA 2TRTA 2HZDA 2NXNB 5LGNA 2VUMJ 5LHGA 1IC8A 2N8GA 3BPVA 4FASD 3R0AA 3DTIA 1X1DA 5GAEJ 4RBOA 4G12A 4RDUA 3OYNA 3TQNA 1OCRH 4AIDA 1VZ0A 1ZLJA 3RPQA 2EB7A 3IC7A 4U0VA 3TW6A 4CCJA 3JRGA 3K7AJ 3FX3A 2KDOA 3BR2A 1TQMA 3MKYB 2EWNA 1J7KA 3F22A 1SFEA 2CV2A 4HPQA 4CCLA 2MBFA 3PQJA 2IPQX 2HQNA 2XPVA 4Q48A 4L9NA 2E7XA 3WTTC 1G4DA 5FKOA 2GLOA 2P0WA 2PMZA 1Z1DA 1XGOA 4RAYA 3WTSC 1LKXA 3IHUA 1IAWA 2ESHA 3F9KA 3ZN0A 2NNYA 1ZARA 4S0HB 4ENNA 4UNOA 4Q4ZF 3REOA 2DDAA 1YTYA 2PEXA 1YE9A 3BQZA 5CVIA 1HKQA 3NWSA 4PDKA 3P9IA 2KMUA 3RSNA 1IG7A 4IHTA 3E6DA 1TW2A 3BY6A 5DDGA 2VIXA 4KDPA 1ZRFA 2CUJA 4HA8A 3KCCA 5KNLA 5K7HA 1U8BA 1M1EB 3IH3A 1G3TA 2GA1A 4MTDA 1SFOJ 2GBYA 2V1DA 4G6QA 4C30A 1Z6TA 2ZFWA 4HRIA 1XSDA 1XCVA 3MKZA 1ETQA 4BACA 3LWFA 4B09A 3BCAA 2EBIA 5FLXZ 2YX7A 4EV0A 3CP8A 3D0SA 4EM2A 3GTOJ 3HPGA 2LKSA 1E3PA 1V4RA 3FXJA 2F6CA 5E20A 2VE9A 2VOPA 1I50J 2K5CA 5J8FA 4NBQA 3RZDJ 2EZHA 2YUSA 5ICCA 1FYLA 4PFOA 2CO5A 2BZTA 2KPMA 2L9NA 1XCBA 2PMUA 2XF5A 3PM1A 4GO1A 4ZYGA 1VQ6I 2OCCH 2BBYA 2L0KA 2LOOA 3B6CA 2FX0A 2HDCA 2OUMA 3SZPA 3JRBA 1HCRA 2NAZA 5LRRA 2JPBA 1Z9CA 4MO7A 5E8GA 5L3DA 3OS2A 2R4GA 1LE8B 2RNGA 3MN2A 3CCMI 2JK3A 4M3BA 4RS8A 1MNDA 3ULQB 2VODA 2XIGA 2QQBA 5KAIC 1ETWA 4KITB 2G7HA 1T95A 1OJLA 3GLLA 1JKRC 2JWTA 1B72B 2EFWA 1MMGA 2HXIA 3TMOA 3DPLC 1TWCJ 3V42A 1FMVA 2VQGA 5DEQA 1MNMC 3OR1C 2KIQA 4U0YA 3DLAA 4KT5C 3M9AA 3I4NJ 1P92A 3OSFA 2VBWA 3GFIA 2GZWA 4Y13A 2EK5A 2EIKH 3PQKA 2DXIA 2NYXA 2EFPA 4HSRA 2PBIA 2ME6A 4XBFA 1D3YA 4Y3OA 1WSUA 4UVCA 5KAFC 3K70C 3AKZA 3D5RC 2WA0A 2R7QA 3SYTA 3V7CA 2W25A 3K4NA 3KZZA 1L3LA 4ZJZA 2Y31A 4HQMA 4FE7A 3LA7A 5HOOA 2PMHA 2FQ4A 3H9GA 2FRHA 3QPHA 4N9IA 2B7EA 1XDUA 2EV0A 3KIOA 4BY7J 2CH0A 1KGSA 1IRZA 2NOGA 3LSJA 2KFDA 3JRIA 3HOWJ 1YITI 3IV5A 3TDZC 4BU2A 3BZCA 2P81A 2CJJA 3BG9A 2VPLA 3HOSA 2FUG2 1SVMA 3LAJA 1FPQA 2QKMB 5F6FA 3U9GA 2YU9J 2JA8J 5JLXA 3KYLA 1T56A 2VQLA 1QZYA 2E2HJ 2DDBA 2UZKA 1LDJA 2VT3A 3IH4A 5GP9A 1PDNC 4HDVA 2YS9A 3AG4H 1IGNA 4OU0A 5CVUA 1LE8A 4BUPA 4RAGA 3H9JA 2X9DA 1MBHA 1VF9A 4A0ZA 4E7LA 1E0EA 3BJOA 3C1DA 1WFXA 3CMMA 3T8RA 3MZYA 1O3RA 3KZIC 1QHHD 3ESWB 4FX4A 2ZXIA 4BBRJ 1B72A 1RUNA 1MSFC 3WGIA 2JVHA 2L7MP 2DW4A 2R7RA 5IYDJ 2WV0A 3JAMZ 1QRYA 3C7JA 3KEOA 4FX0A 2VOOA 3PNTA 1RUOA 2EH3A 1APLC 2F5CA 4IO9F 1I6XA 5HS9A 1YJNI 2XAFA 3VYRB 5EEGA 1X4PA 2HPIA 3GEZA 2EILH 2HXOA 4ENJA 3U2RA 4N4OB 4NC8A 5JI6A 1J0RA 3A2KA 1IN6A 1SVOA 5D5UB 2XRLA 3WTXC 3BG3A 1JUSA 1J9IA 2A6TA 2A3SA 2FF4A 2K27A 2IJLA 4DBQA 1EF4A 2ELKA 4HYEA 1Z0XA 2RAEA 2XB5A 4DYRA 1UMQA 4EJOA 5K5RA 2LVSA 5F1RA 2VL8A 4DZJA 2XGXA 4WCGA 1FBUA 1OKRA 4JP0A 4I2OA 1O7FA 1R5ID 2BY3A 3HC7A 3GWZA 1HKTA 2H8WA 2MYSA 3WU1B 4IHSA 1QHGA 1L0OC 3BCBA 1GV2A 2A69F 3VPRA 3MD2A 2MC3A 4JYKA 3K4MA 2FBHA 2CGPA 2IAIA 2DMQA 4HNUA 1USSA 4I98B 3H3VK 1T38A 3Q5FA 2I8DA 3F0CA 3S2WA 4G7HF 4RAZA 4CICA 2W84A 3NWTA 1R58A 2C6YA 4ZYDA 3AL0B 3OY9A 3JAMK 1U9OA 1FLIA 1AWCA 5ED4A 1R00A 2DU9A 4HOBA 4RM3A 4BS9A 4ENMA 1S3JA 4U7BA 2XV4S 1YX3A 4AC0A 2EPFA 4L0ZB 3F6OA 1B9NA 4GCVA 5IP9J 4IHYA 1BR2A 3LL7A 4P96A 4BQOA 4C2UA 3TP0A 3LSHA 3GW2A 1P4WA 1V5GA 4G7ZF 2LTPA 4ZZDA 2ZNZA 4DW6A 1R1UA 2L7FP 3SZTA 4A3BJ 1J09A 4YG2F 2HKOA 1ONVA 3VOEA 1F9NA 2I10A 1UCRA 5B66C 1SMTA 3RKYA 1TL8A 1D0XA 2XUBA 1KU3A 1ZRCA 4YFKF 4IPAA 3BG6A 4XNFA 1ETXA 1GVDA 5ILSA 1W0TA 2HI3A 2DMPA 3A03A 1NG7A 4XORA 3SDGA 1U5TB 2CFOA 4HNTA 3BT9A 2TCTA 3VYUB 4MIMA 2DLLA 3HJEA 1IJWC 1OR7C 3H35A 3LQQA 4XICA 1TTYA 3WU0A 1YX5A 1W0UA 2KJCA 2EA4A 2M8EA 2RVCA 4B3AA 3KP7A 1XDSA 3RYRA 3ECHA 2IA1A 2VKEA 3FMRA 2OCEA 2VBZA 2W48A 1BL0A 3HUGB 4KMFA 2GQQA 2AS5F 3M8JA 3R4KA 5TRDA 1S7AA 2F48A 2FBKA 2CW0F 4PCQA 1R49A 2WTEA 3W3CA 2ZXWH 3QYEA 1AA7A 2W00A 2RN7A 5DCFA 3T5XA 1CF7B 4A3FJ 3OIOA 1KYZA 2BOLA 2XVCA 1YQAA 3LSKA 3WGGA 1O3SA 2UWMA 1EH8A 1ZR2A 1MKMA 4XKCA 5DTDA 3MZHA 2ISYA 4KIFA 2VC1A 4MGRA 4WX9A 5FFZA 1SD6A 2XSDC 5DD4A 1BN5A 4BNCA 6PAXA 3LA2A 3KP3A 3JRHA 4A3CJ 2DYSH 5F04A 2PJPA 3E97A 1VQ8I 5A2QK 4BBSJ 4BQNA 2F5FA 2E7WA 4AM3A 3CQZJ 3BR5A 1V5FA 4Y15A 2WAEA 1MW7A 4AYBA 1XTAA 4E7JA 1GUUA 3V8LA 3U1DA 1U5TA 1HSTA 1T0FA 1WJEA 3A4CA 2V79A 4ZDLA 4F52A 3RZOJ 1UB9A 1ZELA 1W1WE 3BTJA 2HOEA 4UV8A 2Y75A 1B1BA 1JXSA 1U78A 1A5JA 3CESA 1EA3A 4GYIA 4F7ZA 2HU9A 1Y0NA 4OAZA 4LIVA 4A0XA 4BE2A 2P7VB 3BZKA 2CW7A 3WTZA 1C0WA 1R4MB 2W4SA 4XR6A 2L9VA 3PSIA 5K5OA 2JA6J 2K86A 2IRFG 2CUFA 1B8IB 3HUGA 1XD7A 2Z99A 2R7SA 1RIOH 3B02A 3FKIJ 3DWLE 4K2EA 3GZ6A 1SD4A 1I3AA 2WB1N 3P7NA 1G59A 2NNNA 4KICA 2E36A 4BXXJ 2WY8Q 2EJRA 1X3WB 2WBMA 3OIQA 1P7IA 3L2QA 3ZXSA 2X1EA 1WJAA 2XB0X 3K2ZA 4X0GA 3GUDA 3K69A 2R7DA 1CF7A 2Z5UA 1TT0A 2VQCA 2XF7A 1JTXA 2BW3B 4UXNA 2GOMA 5DUIA 4OMYA 2X6OA 1OYIA 1LJ9A 3FZVA 3FHZA 2COMA 2HOAA 2VI6A 5LFAA 5KK1A 1VQNI 1ZH5A 4CCKA 2FE3A 3BG7A 4XONA 2Y9ZA 1ETYA 3L7WA 1RZ4A 3ZQQA 3VDXA 2HEOA 1LFUP 1FNNA 2O7OA 4LLLA 2LY2A 3ZRGA 1SAXA 3S15J 4RB2C 2B0LA 4XN3A 1ZRDA 2CW8A 1SFXA 1IXRC 2JSPA 2BVMA 2VXZA 1Z05A 1T98A 1WRJA 2K9SA 4M73A 1PVEA 2KP6A 4PJ0C 5BMZA 4KYWA 3LFKA 2NS8A 5TGTA 1G3SA 4G8XA 1HLVA 3ZQCA 4A3IJ 5EGOB 2VXDA 3AG1H 2M0CA 3H0DA 2XGDA 3F23A 3BWGA 2D1HA 4HBLA 2LREA 1IV8A 2DYRH 4EM1A 1ZKGA 4UUSB 3VEPA 2GXBA 2DA4A 2EIMH 1XS9A 4AIJA 1FOYA 4B43A 4OMZA 1YFHA 3MFKA 2R7OA 3OR2C 2R93J 1B8IA 1WJBA 1LQ1A 5EF6A 3ZCOA 2KZGA 1I1GA 1ODDA 1TQIA 1QVTA 1RKWA 2KRHA 1PJRA 1XC5A 5HLHA 3S16J 2M34A 1HW1A 3OYGA 1ZGWA 2NVQJ 3HSRA 4RB1A 2J5PA 3PL8A 5EEHA 4FQGA 3W2AA 2QGUA 5AIPA 4XLPF 3BROA 3L2RA 4M6VA 2BW3A
chains in the Genus database with same CATH topology
1U0JA 3QYFA 4RMNA 3I9V2 4KT6A 4Y33A 4F92B 4HRIA 3MKZA 4LG3A 4BACA 3DTEA 5KHDA 3BCAA 4BE1A 1SAUA 3EUKL 4QPQA 3CP8A 4CUGA 2VJ5A 4ANJA 3HPGA 2X51A 1NG6A 4E6KG 3K4JA 2F6CA 3DKXA 1UG0A 2R7XA 3IP4B 2K5CA 3S93A 4B47A 2M0MA 3VWBA 2AQFA 3QODA 4AU7A 3EUHC 4KJZA 4PFOA 3OYBA 4J00A 3OOUA 4BDZA 2KPMA 3SZGA 2IS4A 3OMYA 2L9NA 4ZC3A 4CH7A 4BXFA 4JOMA 5LD2C 3DU6A 1DGWY 4RM2A 3H9QA 2DT7B 2XF5A 4YELA 2LBFB 2HVRA 2DOAA 2IXSA 5KCMA 4CA0A 3OYEA 3OYKA 3OL4A 2LOOA 3OS1A 1QU3A 5FRNA 2OUMA 2CV1A 2RQQA 1KONA 4XMYA 3FDYA 3OS2A 2R4GA 2RNGA 2QKLB 4MLOA 1IRXA 2RREA 1MNDA 3C2HA 4NUBA 2X6YA 2XC7A 2L7KA 2X1DA 2M7BA 4NNJA 4KITB 4BGDA 1T95A 4XL9A 2LY1A 4XLCA 1Z3XA 1MMGA 2XF6A 3TMOA 3DPLC 3S32A 3V42A 4NC7A 2VQGA 1FMVA 1GLNA 2M7AA 1LFPA 4PJMA 3KEYA 4XN0A 4CSWA 1V5EA 3OR1C 5JHFA 4LITA 3DLAA 3K4KA 2ZXHA 4IKFA 2V7FA 3RCOA 3HKZA 2DXIA 3UR3C 2ZSHB 4HSRA 3K70D 4Y3OA 3VYSB 1DGRM 3K70C 4PFPA 3AKZA 3CF2A 3D5RC 2R7UA 2WA0A 2UV1A 2R7QA 4XKVA 3SYTA 3K4NA 1JI8A 4II3A 4F55A 2HDWA 4ZJZA 4P1WA 2CS3A 4XM3A 3VSKA 5HOOA 2VKHA 2Y0SA 4N4NB 3H9GA 2W1OA 4DBRA 3H5NA 2W82A 2CH0A 2K9LA 4H4KC 3E0JB 4BU2A 2V1NA 2E5ZA 3E1SA 2VPLA 3DPUA 2DT6A 1DQUA 2LBFA 3HOSA 2FUG2 2LG4A 3QOEA 2QKMB 1N75A 3KYLA 4JQFA 4XLHA 2R7WA 2HVSA 2VQLA 3EUAA 3N05A 4PJNA 3L2UA 2PJRB 2E60A 1R6RA 3HOTA 1WJ5A 3CZ6A 1P9QC 2L5QA 2R7VA 4BUPA 1X19A 2E1MC 3H9JA 4IQ4A 1D1CA 3TL4X 5FRMA 3VYTB 1MMAA 2JA2A 3KX2A 4EATA 4E7LA 2IS1A 1E0EA 2XDVA 4C2TA 1WFXA 3CMMA 3AL0C 2E5NA 2HNHA 3HPHA 1QHHD 2X85A 4PSXA 2ZXIA 3W2VA 4E7HA 3OYDA 1TZLA 2JVHA 2V4JC 2R7RA 3TBIA 3CJQB 3PNTA 4XKBA 4NQWB 2K9MA 3L2WA 4DJAA 4HG2A 1BR1A 2IGMA 3VYRB 1D1AA 4PSWA 3CP2A 3S3OA 1X4PA 1W36D 2HPIA 2IGKA 5CKTA 1S9HA 1W36C 4N4OB 2OV7A 4NC8A 4DIQA 1X4OA 3A1YA 3OYLA 1D0YA 3A2KA 1ERDA 2VB6A 2V9KA 3DQVC 3DEEA 2A6TA 4PK4A 4BJTA 4DBQA 4P5OA 2VQHA 5HVQC 3DKYA 3K4BA 2MABA 2MC4A 3HG9A 2VL8A 1WJFA 2X6WA 2AQEA 2IGNA 3FKJA 3HC7A 1T0FC 1X1AA 2MYSA 3RQ4A 1QHGA 3DU5A 3U21A 3BCBA 4YEJA 1Y6IA 2E1MB 3MD2A 3SDBA 3S3MA 1Z21A 3K4MA 2VJIA 2A5WA 4HNUA 3HXLA 3DTKA 4BQQA 4CCOA 5HNFA 3FBIB 2I8DA 2KZVA 3OYIA 2PJRA 2V26A 3K4LA 3IAS2 2KL4A 3NWTA 3ZR8X 4HSTA 3AL0B 2W7NA 4XOTA 3OY9A 2XSJC 4CZCA 1K6YA 2L2OA 4RM3A 4BS9A 4XLEA 3OS0A 2F5VA 4U7BA 3SEZA 3H5AA 2LRDA 1YX3A 2KRCA 1WJDA 3VSLA 3S3NA 3HL2A 4XLAA 4XQFA 2WAFA 2WAQA 1BR2A 3LL7A 4BQOA 4C2UA 3K6GA 3K4CA 5CQEA 3LSHA 2HVQA 4BE0A 5CQGA 1V5GA 3MKWB 3J7AY 2Z1DA 3PSFA 1J09A 1UAAA 4B44A 4PUSA 3PUBA 4R79A 2MFZA 5HNHA 2LYCA 4QPOA 4II2A 4HEA2 1D0XA 1MNEA 2JUGA 1Z7LA 2Z16A 2F4IA 4ZDPA 3BG6A 4XNFA 4FETA 1MMNA 2WADA 5HLTA 2ZFUA 1NG7A 4XORA 4HNTA 3OYMA 2CFOA 3LFUA 4BEHB 2L9SA 3VYUB 2O5RA 3BC8A 3RPUD 4XKWA 2M3AA 3PNYA 1OR7C 3H35A 3BLYA 4E7IA 3MMYB 4PJJA 1YX5A 4XLFA 2IGOA 3RTRA 4E7KA 4GRIA 2KQRA 2V6EA 4U87A 4DGWB 2R7TA 3HUGB 1OLTA 3W2WA 3OYAA 1DP3A 1Z3YA 3K10A 4BDYA 3M8JA 2OC6A 1LVKA 5CPRB 2MD0A 3CJRB 3W3CA 3IAM2 3OYCA 2DCEA 2GOXB 1AA7A 2W00A 3QYEA 2DJIA 3PFYA 4CCMA 2BOLA 3LSKA 2UWMA 4OWRB 4XKCA 2LH9A 1WJCA 1X1CA 2CV0A 4IZZA 2VJ4A 1D1BA 4XOPA 4CCNA 3PNVA 4E7SA 4OAYA 4PJLA 2IS6A 2KHMA 2M4KA 4RLQA 3EPZA 3H5RA 1FMWA 3SEQA 1N77A 4BL0B 4BQNA 3OL3A 1SFKA 1LDKB 2VLAA 1V5FA 1G8XA 3C2GA 4BJ6C 2WAEA 3PJRA 4ITVA 1MW7A 4AYBA 4ZTFA 3OWTA 4E7JA 4RLFA 2Z2SB 2BVLA 4ZDOA 1HA8A 3DPTA 3UNGC 3M1CA 4BEHA 1WJEA 3A4CA 4ZDLA 4F52A 2WB1A 1ZELA 2XAUA 3G2BA 4C9YA 2HPMA 4D1QA 2IS2A 4YRVA 4G6TB 2LC2A 3CESA 1EA3A 3OYHA 2HU9A 2ZSIB 1D0ZA 4LIUA 4LIVA 4OAZA 4BE2A 4F93B 2CW7A 2W4SA 4XR6A 3PSIA 3LSMA 2KLOA 1PYVA 2X1CA 2K3PA 2R7SA 3ZGKA 3DWLE 4BJ5C 1G59A 3FHNA 2WY8Q 2VASA 4F91B 2WBMA 3AFHA 3OIQA 4ZTJA 1N78A 3L2QA 3ZXSA 2X1EA 1WJAA 4X0GA 2WY7Q 4B3XA 1X1BA 1TT0A 2VQCA 3FBNB 2XF7A 2BW3B 2GOMA 1BR4A 4E4HA 2CUZA 4D9JA 3IUOA 3D5SC 4Y4RA 5LFAA 4KISA 2VKDA 4CCKA 2HZDA 2X6XA 3BG7A 4XONA 2Q2EB 3LSIA 4FASD 3ZQQA 2HQAA 3DTIA 3VDXA 1X1DA 3OYNA 1MMDA 3L2RA 2M4GA 1VZ0A 2LY2A 3ZRGA 1BOBA 4CCJA 4XN3A 2CW8A 2KDOA 3MKYB 3ONQA 2JSPA 2BVMA 2VXZA 5FROA 4J01A 4AVZA 3OYJA 2CV2A 2KP6A 4HPQA 4CCLA 2NOJB 3OYFA 4B48A 5TGTA 2JVGA 2CMPA 3I3LA 3D5LA 2VXDA 3LSGA 2P0WA 2PMZA 3H0DA 2UUZA 2LREA 1LKXA 3F9KA 2VJJA 4F3QA 4E7ZA 2Q1ZB 4B43A 4ZYAA 3L2VA 1YE9A 2R7OA 3OR2C 3LMMA 4IX7A 3NWSA 1WJBA 3ZCOA 2KMUA 3RSNA 2KRHA 1PJRA 3GBGA 3OYGA 4IQJA 3QYBA 2VIXA 3S8PA 2ELJA 2CUJA 3PL8A 5KNLA 3W2AA 1UELB 1Y56A 3OIPA 4DOZA 4C30A 2BW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQR A;  4ZYA A; 
#chains in the Genus database with same CATH topology
 1QVU A;  1U0J A;  3GFL A;  4ETS A;  3DKW A;  3I9V 2;  4KT6 A;  4F92 B;  3CCE I;  3W6K B;  1FOX A;  1HDD C;  1IRF A;  4I7H A;  4LG3 A;  1XB4 A;  3DTE A;  5KHD A;  2JMW A;  5FLV A;  3JRE A;  2OZ6 A;  1VQ5 I;  3EUK L;  2F5E A;  1JKQ C;  2DA2 A;  4ANJ A;  1ZTR A;  4E6K G;  1IZ1 A;  1QZZ A;  1I5Z A;  3WHC A;  2FOW A;  3QU3 A;  4UV9 A;  4B47 A;  1OCO H;  5DS9 A;  3S1R J;  1R22 A;  1WKM A;  2AQF A;  1OYY A;  4I99 C;  1ZN2 A;  4AU7 A;  2R0Q C;  3CCS I;  1IDZ A;  2IS4 A;  4BDZ A;  4UHT A;  5F27 A;  3M07 A;  4CH7 A;  4BXF A;  4JOM A;  1Y0U A;  1BIA A;  5LD2 C;  4DNC A;  2DT7 B;  2VC0 A;  2JA5 J;  4KN4 X;  2LBF B;  5FJ8 J;  2DK5 A;  2CQN A;  2HVR A;  2IXS A;  3I5U A;  3MCZ A;  4N0B A;  1V54 H;  5KCM A;  1ZG5 A;  5EGO A;  4JX5 A;  3MZ8 A;  1NK3 P;  3OS1 A;  3IWZ A;  4M9S A;  5GPA A;  1VTN C;  1F43 A;  4WXC A;  4FT8 A;  4UUS A;  4BHP A;  1FIP A;  2GM4 A;  3EQL F;  2YU3 A;  2QKL B;  5LGU A;  3CUQ C;  1IRX A;  1FSE A;  3RYP A;  4D7M A;  4EJT A;  3C2H A;  1R36 A;  3LSR A;  2XHK A;  4HF2 A;  2VT2 A;  2X6Y A;  1BJA A;  2L7K A;  2STT A;  2AO9 A;  2ZME C;  2PX9 A;  2JJ7 A;  2W24 A;  4NNJ A;  4BGD A;  1VFC A;  2QQ8 A;  1JUM A;  5LRS A;  3GYH X;  1AKH A;  4HX4 A;  4XSZ F;  1Z3X A;  2XF6 A;  3F8B A;  5ICE A;  3QP6 A;  2FJ1 A;  3ZOB A;  1SVL A;  1WWX A;  4RA2 A;  1FYM A;  4CSW A;  4ESJ A;  3KEY A;  2YSR A;  3A0H C;  5JHF A;  2E71 A;  2OQR A;  4LIT A;  2H1K A;  4ESF A;  3Q9S A;  2HQR A;  3T1B A;  2V7F A;  1ZK8 A;  3OV8 A;  4AIK A;  2KIS A;  3HKZ A;  1OCZ H;  3UR3 C;  3GME A;  2GA2 A;  3RPU A;  2R7U A;  1JI8 A;  2DOD A;  4F55 A;  3RJP A;  1KU9 A;  2M1B A;  1EH6 A;  3H92 A;  4O6J A;  3VSK A;  1JE8 A;  2VKH A;  2QEX I;  2HOT A;  4OIN F;  2Y0S A;  1JHF A;  3ABK H;  4X1E A;  2O8X A;  2W1O A;  1SC7 A;  3HHG A;  2W82 A;  4A3M J;  4MQV A;  2QLZ A;  2D1V A;  2DT5 A;  2NRA C;  1LUJ B;  2DFF A;  5D4S A;  4QLC U;  5K1Y A;  4JK1 X;  2K40 A;  4HLY A;  4I02 A;  1BC8 C;  3ZMT A;  1UG2 A;  2E5Z A;  2BGC A;  3E1S A;  3DPU A;  2LBF A;  2QA4 I;  2NVY J;  2GIV A;  1YIJ I;  2A68 F;  2AHQ A;  3T0Y A;  2Y69 H;  3F8C A;  1MZB A;  3F8F A;  2HWV A;  2PJR B;  2HYF A;  1R5G A;  3NAR A;  2CYY A;  3HOT A;  1JHH A;  3HOY J;  2H8R A;  3TO6 A;  4A3J J;  4ZZL A;  4I0A A;  2R7Z J;  5ERI A;  5FRM A;  1ITY A;  3VYT B;  1JUP A;  2LNB A;  3ASN H;  2XGC A;  3KX2 A;  1YIO A;  2IS1 A;  3TOB A;  5FGM A;  2E2I J;  1MJ9 A;  1WPK A;  3CDL A;  2BV6 A;  2H6B A;  2KDZ A;  1XMX A;  2X85 A;  2LF8 A;  1GDT A;  4E7H A;  1MJA A;  3N97 A;  4XLN F;  3CCJ I;  1MDM B;  3A0B C;  2K9M A;  1CGP A;  1PUE E;  1R5H A;  3BOQ A;  4HG2 A;  3CLQ A;  2IGM A;  3KFW X;  3LQR A;  5EDN A;  1D1A A;  1HDP A;  1G3W A;  4DZP A;  2IT0 A;  4HZF A;  1RR7 A;  1W36 D;  2R92 J;  2IGK A;  2RKH A;  2K3F A;  4DIQ A;  1X4O A;  1D0Y A;  2FBI A;  3GZN B;  5D8L B;  2V1U A;  1GXQ A;  3E6B A;  1F36 A;  3MKL A;  4PK4 A;  3B73 A;  4BJT A;  2EV5 A;  2I5U A;  4P5O A;  1NH3 A;  3TO9 A;  4LK0 F;  4A0Y A;  1MBK A;  2MAB A;  3HG9 A;  2DO7 A;  1HSJ A;  3HYI A;  2AQE A;  3L9F A;  1FOW A;  4UUT A;  1R1V A;  4W97 A;  1F4K A;  4LLN A;  5M3F J;  2LSO A;  3FK6 A;  3FMQ A;  3DU5 A;  2XAS A;  3WU2 C;  5CVV A;  2O3F A;  3CDH A;  4Y17 A;  1NTC A;  5J4V A;  4CCO A;  5HNF A;  2QEN A;  3LAP A;  1ACI A;  1E2X A;  2ACJ A;  2KZV A;  3F72 A;  2PJR A;  2BHY A;  4KIG A;  4FIS A;  5FLX K;  3ZR8 X;  3FXK A;  3KET A;  1XG1 A;  1K6Y A;  2L2O A;  2ETH A;  2Y0M A;  3V8K A;  3OS0 A;  2FU4 A;  4FHT A;  3WOD F;  1V3F A;  3SEZ A;  2RQP A;  4MTE A;  3VSL A;  2L9R A;  3LST A;  5E3N A;  1VI0 A;  3HL2 A;  2WAF A;  5BPI A;  2HYJ A;  2GXG A;  4CYC B;  5IPA A;  3KP6 A;  3G3Z A;  3E5Q A;  2MSY A;  1SD5 A;  5DM7 F;  1BI2 A;  2XAJ A;  1UAA A;  1MDM A;  1SMY F;  3PUB A;  2MFZ A;  3ELK A;  1B59 A;  1XPX A;  3FM5 A;  3R6S A;  1MNE A;  1LFB A;  1RC9 A;  3RKW A;  4S05 A;  3X2Q H;  4ZDP A;  1P4A A;  4FET A;  2F5D A;  4BQA A;  2XAQ A;  5HLT A;  2L54 A;  4HNV A;  2K9Q A;  4BEH B;  1WH7 A;  2G9W A;  3MQ0 A;  2EIN H;  3RPU D;  2VON A;  2BHZ A;  3G1O A;  3GLX A;  3CDI A;  4XKW A;  2EIJ H;  4ABZ A;  4L5J A;  2M3A A;  3ABM H;  2K7L A;  1YO5 C;  2ID6 A;  2Y30 A;  2DTR A;  3MMY B;  2M30 A;  1Y39 A;  2E35 A;  4D0P A;  5IYB J;  5E18 F;  5D4R A;  1WQ2 A;  1SAN A;  1W5S A;  1ORK A;  1OLT A;  3W2W A;  2BY1 A;  3K10 A;  2LF7 A;  4IF4 A;  4BDY A;  3SXY A;  1YRN B;  1SFU A;  5DYM A;  4ENK A;  4EJU A;  2MG4 A;  3OYC A;  2DCE A;  2GOX B;  1MBF A;  1O7L A;  3CUO A;  4H0E A;  4HQE A;  5FO5 A;  1LEB A;  2VN2 A;  4CCM A;  4IVN A;  3HOV J;  4OWR B;  5TJJ A;  1GV5 A;  4CGZ A;  1WJC A;  1Q1V A;  2MA3 A;  4CCN A;  2M45 A;  3AG2 H;  3GF2 A;  3UKG A;  4OAY A;  1YJ9 I;  4CYC A;  2NS0 A;  3C2B A;  1JTY A;  1MJB A;  2ID3 A;  3SFZ A;  2JA7 J;  1UHW A;  4MEX F;  2JRT A;  3H5R A;  3HRU A;  2YX4 A;  3BR1 A;  2PQ8 A;  5IT3 A;  4OIR F;  2HOS A;  2Z33 A;  3WHB A;  1LDK B;  4XRM A;  2VLA A;  3C2G A;  1QZE A;  2OA4 A;  3PJR A;  2ECB A;  3TW7 A;  1I1S A;  3CMY A;  3OWT A;  1HXD A;  4RLF A;  2BVL A;  3I55 I;  1HA8 A;  3I54 A;  3DPT A;  4IOA F;  3UNG C;  3M1C A;  4RB3 C;  4BEH A;  1HF0 A;  4UB8 C;  3DBH B;  3R61 A;  1X3Z B;  1TC3 C;  2E2J J;  2Q8K A;  4C9Y A;  3S1M J;  2FMY A;  2IS2 A;  2A6E F;  5IP7 J;  4YRV A;  2LK2 A;  2LC2 A;  3BZ6 A;  3ERE D;  3OYH A;  4FE4 A;  2ZJQ F;  2ZSI B;  1D0Z A;  2OU2 A;  4F93 B;  4DYQ A;  4MQ9 F;  3OOP A;  1WI9 A;  1X3U A;  4HF1 A;  3M8F A;  2E1N A;  1IN7 A;  4IOC F;  2X1C A;  3HOX J;  1JT0 A;  3CJN A;  2HKX A;  2J5O A;  3J81 Z;  1YRN A;  2CFX A;  5DM6 F;  3C3W A;  5CVR A;  5IT9 Z;  3ZQH A;  3AFH A;  1WZ2 A;  4IEJ A;  1FTT A;  3DCF A;  3DFG A;  5HS8 A;  3F3X A;  1EH7 A;  5E1Z B;  3CCL I;  2M87 A;  2P7C B;  1OMI A;  2FNP A;  2GAU A;  2GXA A;  3ERM A;  2V6C A;  4QTR A;  1NHA A;  2DQR A;  2QSG X;  1BR4 A;  3PFI A;  3M3Y J;  2L01 A;  4E4H A;  4A2U A;  2VKD A;  4YFX F;  4Q47 A;  2X6X A;  3E3V A;  2Q2E B;  4BXU A;  3ABL H;  4D5F A;  3GTP J;  4BYY A;  2ECC A;  1MMD A;  2FD5 A;  2CWE A;  4A3E J;  2OPT A;  2WAQ N;  4L18 B;  2JZY A;  5H20 A;  3JSO A;  1BOB A;  3D1N I;  2NVU B;  1ULY A;  4I76 A;  1KYW A;  2KIM A;  1KZH A;  1U9N A;  1IXC A;  3DEU A;  5CVJ A;  1PP7 U;  3OSG A;  2G7U A;  1OR7 A;  1TNT A;  4J01 A;  3T8T A;  2ZJP F;  4AVZ A;  3DBL B;  3OYJ A;  2PI0 A;  3OYF A;  2K85 A;  2KRF A;  3I4P A;  1T33 A;  3GTG J;  3PO3 J;  2JVG A;  2CMP A;  5EG0 B;  5KVR A;  3J81 K;  5JHU A;  4A3K J;  3I53 A;  4TV7 A;  2V9P A;  3GZ5 A;  3IRR A;  2IA2 A;  5IT9 K;  3CO7 C;  3BTC A;  3U1K A;  1H9G A;  3FIW A;  1MD0 A;  2UUZ A;  1RR8 C;  3RDI A;  1I39 A;  5L3B A;  5C4J J;  2VJJ A;  4F3Q A;  1JJ6 C;  2EZI A;  4E7Z A;  3TP3 A;  4BKX A;  4Z6Y A;  2O6G E;  2Q1Z B;  4EEF G;  5E3M A;  4ZYA A;  2ZB9 A;  1TQP A;  2DFH A;  2HR3 A;  5J1U A;  2DA7 A;  3KP5 A;  5L3F A;  4AD9 A;  4NB5 A;  2ZNY A;  2NVT J;  4G94 A;  4KMU X;  4RAF A;  4RGS A;  3HM5 A;  2JPC A;  3MAJ A;  3GBG A;  1A6I A;  3WTV C;  3QYB A;  4FTH A;  4P9U A;  1RES A;  4QSH A;  2ELJ A;  4IRG A;  5EYR A;  2ZO4 A;  5HOD A;  4IHV A;  2Z3Y A;  4L9V A;  1WHU A;  4RGU A;  1UEL B;  1TW3 A;  4M6X A;  1Y56 A;  3E5X A;  3W6V A;  3IWF A;  4EJV A;  2L7Z A;  3E6C C;  3NAU A;  2LR8 A;  4BH9 A;  3E6M A;  4Y33 A;  4UVA A;  2FA5 A;  1Z77 A;  1WI3 A;  1Q1H A;  5CJ9 A;  2R3S A;  1FYK A;  1PP8 F;  1ZGJ A;  1IV6 A;  2FXA A;  4CUG A;  4D5C A;  4OOI A;  2Q2E A;  1G2H A;  3I4M J;  2P6S A;  5AON A;  2X51 A;  1NG6 A;  3JRC A;  2DJN A;  3ECO A;  3DKX A;  1LDD A;  3I0T A;  3K1P A;  3IP4 B;  4A93 J;  1Z6R A;  5IOZ A;  3VWB A;  3ZQI A;  3QOD A;  1V55 H;  3R60 A;  3EUH C;  4KJZ A;  1JKO C;  4CYD A;  1QNT A;  5FFX A;  3OMY A;  4ZC3 A;  2XRN A;  4B1R A;  1YYV A;  3ZQF A;  2W85 A;  2QBY B;  4RM2 A;  4YEL A;  4RGR A;  1ETO A;  1O57 A;  2L4M A;  1ZGA A;  5EG0 A;  5FKL A;  3QWL A;  3OYE A;  3M7G A;  5E17 F;  1KQ9 A;  4HX8 A;  3OYK A;  3K2A A;  2KIU A;  1TP4 A;  1QU3 A;  2G0E A;  4UY8 I;  3JR9 A;  3SQN A;  1S6L A;  3CF5 F;  5HDK A;  2M8G X;  1O3T A;  3QPT A;  3VOD A;  4MLO A;  3KYD B;  3ASO H;  1YS6 A;  3Q9V A;  1FTZ A;  3N4M A;  1QA6 A;  3O2P E;  4NUB A;  5GAD J;  3NQO A;  1DU0 A;  2GWR A;  5EZH A;  2W57 A;  4HX7 A;  1MBE A;  1ENH A;  2LY1 A;  4XL9 A;  4EM0 B;  5ILV A;  4XLC A;  5H6Q A;  5B3S H;  1BJZ A;  1HBX G;  5HLI A;  2JN6 A;  3ISP A;  4M6Y A;  1WH5 A;  2M7A A;  4PJM A;  5J3L A;  3A01 B;  1HW2 A;  2QSH X;  5HDG A;  1FX7 A;  5EZG A;  5IYC J;  3K4K A;  2ZXH A;  4IKF A;  3RCO A;  4LFU A;  1BM9 A;  5FKK A;  1KA8 A;  1IO2 A;  5DCM B;  1VQ4 I;  3VYS B;  2CQK A;  3G1M A;  1WCM J;  4DQ2 A;  2UV1 A;  1FJL A;  2LY9 A;  2HDW A;  1U6G A;  4GXO A;  2K4B A;  2CS3 A;  2ZJR F;  1R71 A;  3TOA A;  3PIO F;  2RDP A;  1T6S A;  2WWY A;  5LGT A;  4N4N B;  1BI1 A;  4DBR A;  3H5N A;  4ASN A;  1QBJ A;  4H4K C;  3FXU A;  4DYC A;  3E0J B;  2QBY A;  2ESN A;  2V1N A;  4A5N A;  2VE8 A;  1DQU A;  3QQA A;  5GTI C;  3CUQ B;  1YG2 A;  1RKT A;  2QQA A;  4HAM A;  4XLH A;  5K7Z A;  2E1O A;  2XAG A;  1YS7 A;  5D5X B;  2E60 A;  1Y8R B;  2ZME B;  1RI7 A;  1R6R A;  1WJ5 A;  1Y8Q B;  2IA0 A;  5HDN A;  4EQQ A;  4MEY F;  2R7V A;  1ZHF A;  2M2E A;  2PMZ N;  2O61 A;  1OCC H;  2E1M C;  1MIJ A;  3KYC B;  1D1C A;  3BPX A;  1YI2 I;  4I6Z A;  1HQC A;  3CCQ I;  2EZK A;  4BHC A;  4XK4 A;  4EAT A;  3KZY A;  1HW5 A;  4C2T A;  1NK2 P;  3EDP A;  1T2K A;  2E5N A;  2HNH A;  1MMS A;  3HPH A;  1IN8 A;  4PZJ A;  2ICW G;  3W2V A;  3OYD A;  1TZL A;  2V4J C;  2QM3 A;  4M72 A;  3DP7 A;  3CJQ B;  5IP6 A;  3A01 A;  4XKB A;  4NQW B;  4DJA A;  5BOX A;  4XRS A;  1S29 A;  2QYO A;  1BR1 A;  4IL6 C;  3ROU A;  3ZMV A;  3J80 Z;  3S3O A;  1J5Y A;  5DCM A;  3RI4 A;  1W36 C;  1OCT C;  3PIP F;  4PGG A;  2OV7 A;  4Y7N J;  4ZYE A;  2EV6 A;  1N25 A;  2DOF A;  3A1Y A;  3BDD A;  3OYL A;  2EZL A;  2VB6 A;  3DQV C;  3DEE A;  1G6N A;  3S17 J;  5M5Y J;  1AU7 A;  1DPR A;  4A12 A;  2VQH A;  2HYG D;  1S7E A;  3DKY A;  3K4B A;  4CDG A;  3HZJ A;  2ME0 A;  1MSE C;  1TNS A;  4U7D A;  1I27 A;  1KU7 A;  1XMA A;  2F4O B;  5JR3 A;  3U21 A;  2L02 A;  4YEJ A;  2OTJ I;  3SDB A;  3CUQ A;  1Z21 A;  3R0J A;  4YFN F;  1P2F A;  2VJI A;  1W5T A;  1YOV B;  2DPD A;  1J2X A;  3HXL A;  3DTK A;  4BQQ A;  2DOE A;  3FBI B;  3HTU A;  4I01 A;  4A6E A;  2V26 A;  3K4L A;  3IAS 2;  1RNL A;  4ZYH A;  2ZME A;  3ZMD A;  4XOT A;  4C2M J;  2XSJ C;  4CZC A;  2XPW A;  4XLE A;  2KJB A;  2F5V A;  2ZJ2 A;  1A36 A;  3HRT A;  1HKS A;  3QP5 A;  3J80 K;  2P5K A;  2DFI A;  2ADU A;  3CC4 I;  3H3U A;  1EKE A;  2JSC A;  3GTQ J;  1BBY A;  4BE0 A;  2HVQ A;  3JCU C;  5FB2 A;  1Y1W J;  1JT6 A;  2KKO A;  3HB9 A;  3MKW B;  2R7F A;  4M3F A;  3J7Z I;  4B44 A;  4PUS A;  4NQW A;  4R79 A;  1ZG1 A;  5B1B H;  4NHJ A;  1HOM A;  5HNH A;  2RV8 A;  1KU2 A;  4QPO A;  2IEK A;  2QCO A;  5FKM A;  2JUG A;  4YIF A;  3IKV A;  1IXS B;  2F4I A;  3QU6 A;  2TDX A;  1KQ8 A;  3EET A;  3ZN1 A;  3H36 A;  2EA2 A;  4RB0 A;  3OYM A;  5BPD A;  2LMD A;  3SHF A;  2Z9O A;  5EEA A;  5F0C A;  2O5R A;  2KIF A;  4BY1 J;  3BC8 A;  4G6D A;  2E1C A;  1LNW A;  2DAO A;  3FMS A;  1K4S A;  1VQP I;  1FOK A;  1MBG A;  5GAG J;  4XLF A;  3P5J A;  2DK8 A;  1I3Q J;  4LLG F;  1DUX C;  2ZC2 A;  3RTR A;  4E7K A;  2XPU A;  1LB2 A;  4GRI A;  2CU7 A;  2KQR A;  1TWA J;  1FWZ A;  2HQ5 A;  3JW4 A;  1SEU A;  3J7Y J;  3CC7 I;  4AIH A;  4DGW B;  2R7T A;  3BTL A;  3Q0W A;  4AVP A;  2MD5 A;  3CJR B;  5BQT A;  1S72 I;  3QRF F;  1JKP C;  3FXM A;  3IAM 2;  4C3J J;  4IJA A;  2IBD A;  2YR2 A;  3WE2 A;  1ZLK A;  3GTL J;  2DJI A;  4OIQ F;  5IY5 H;  1FBQ A;  5J1Y A;  1H9T A;  3ABT A;  3S1Q J;  3DV8 A;  2CV0 A;  2BY2 A;  2UXN A;  1VQM I;  4A3G J;  1D1B A;  1OYW A;  4UB6 C;  3PNV A;  3IH2 A;  5L3G A;  4E7S A;  5JFR A;  2IS6 A;  2RNJ A;  3O3K A;  2KHM A;  1E3H A;  2DMN A;  2M4K A;  4P55 A;  3HHH A;  5F64 A;  2R5Z B;  2L3D A;  4G9Y A;  4LOC A;  3IKT A;  1FMW A;  4BAY A;  3SEQ A;  3BP8 A;  3OL3 A;  1SFK A;  1A6Q A;  1BIB A;  1P4X A;  4BJ6 C;  4IHW A;  1TWF J;  5TIS C;  4ZH4 F;  1VQK I;  2Z2S B;  4ZDO A;  1JGS A;  1TBX A;  5J4Y A;  5D5W B;  1GT0 C;  2DMT A;  1TWH J;  1MH3 A;  2GIZ A;  2XAU A;  4MHG A;  3G2B A;  2LFB A;  3Q0V A;  3RKX A;  2HPM A;  3K1M A;  1GVJ A;  1YW9 A;  3V8J A;  5CYV A;  3ZQ7 A;  3FXO A;  4WXH A;  1A31 A;  1BI0 A;  4GDF A;  3BTI A;  4EGY A;  1TWG J;  3TO7 A;  1CQT A;  2HDD A;  1X2N A;  1IF1 A;  1OPC A;  4GFB A;  4A3D J;  1BW5 A;  1WVR A;  3HTS B;  4S04 A;  1VQL I;  3BR0 A;  4ZTJ A;  1FC3 A;  1N78 A;  5EJC A;  1XN7 A;  2WY7 Q;  1ZQ3 P;  3FXR A;  4B3X A;  4YIR X;  2K4J A;  1X1B A;  5CLS A;  1K79 A;  3GTK J;  3CME I;  2RGV A;  4KFC A;  2F4M B;  5F08 A;  3VFZ A;  5LHH A;  2CUZ A;  1ETV A;  4D9J A;  4Y4R A;  3D5S C;  1X1P A;  1GXP A;  3DBR B;  1Z67 A;  2X4H A;  2QF7 A;  5GPC A;  1H8A C;  3S1N J;  5F0F A;  3LSI A;  2R5Z A;  2HQA A;  3DEW A;  2HTS A;  1STZ A;  2M4G A;  3KLN A;  4EMS A;  4V2G A;  2MLK A;  4M9Z A;  2X0L A;  3ZMS A;  1X58 A;  3F6V A;  4P9F A;  5C44 J;  1XSV A;  3EYI A;  3ML6 A;  3NEU A;  4IRH A;  2ZXJ A;  2OTL I;  1H0M A;  5E3L A;  3LNQ A;  3ONQ A;  5D8K B;  5FRO A;  1K6O A;  5K7F A;  3I56 I;  3QOP A;  1VND A;  1W7P B;  1REP C;  2NOJ B;  1T39 A;  4M3G A;  4B48 A;  3JRD A;  3I3L A;  3Q0U A;  5F1J A;  4HW0 A;  2A61 A;  2STW A;  3D5L A;  5J6X A;  3LSG A;  1BOA A;  4CHU A;  2WC2 A;  3FM3 A;  1S7O A;  4I0B A;  2CQ7 A;  3SJM A;  2IW5 A;  4M3E A;  1IN5 A;  5BNG A;  3M4O J;  1H89 C;  2PLY A;  2E19 A;  2L4A A;  3FXQ A;  3VB2 A;  2LDU A;  3FWE A;  3FIS A;  4M74 A;  4D7N A;  3L2V A;  2XRO A;  2XKO A;  3H1C A;  4OIO F;  3LMM A;  1K7A A;  2O03 A;  5F0H A;  4IX7 A;  1H88 C;  3KE2 A;  1POG A;  2OQG A;  5BS6 A;  5LBQ A;  4IQJ A;  3S8P A;  2DI3 A;  3PO2 J;  1XGS A;  1J59 A;  3OIP A;  4DOZ A;  4GYG A;  3JRF A;  3TED A;  2EFO A;  5J40 A;  3V7R A;  3QPS A;  3HGY A;  2QQ9 A;  3QYF A;  4EVI A;  4RMN A;  3JTG A;  3K9T A;  3H3Z A;  3MVP A;  4L5I A;  3HOU J;  1DU6 A;  3MEX A;  3COA C;  4BE1 A;  1K78 B;  1R7J A;  1SAU A;  4QPQ A;  3JSP A;  3HSE A;  2VJ5 A;  2EFQ A;  3K4J A;  1U8R A;  1UG0 A;  1IDY A;  2R7X A;  2DFE A;  3S93 A;  2M0M A;  2MLG A;  4NDL A;  4A6D A;  2P6T A;  2IVM A;  1R23 A;  4Y52 J;  2EFN A;  3OYB A;  4J00 A;  3OOU A;  1QQI A;  1RRJ A;  3SZG A;  4L5E A;  3CLO A;  5LHI A;  5DD8 A;  3DU6 A;  3K0L A;  1DP7 P;  1DGW Y;  2H1L A;  4NC6 A;  3H9Q A;  2P8T A;  1W7P A;  3GCM A;  3PUF A;  2DN0 A;  1IN4 A;  4CO8 A;  2DOA A;  4CA0 A;  1JGG A;  1UHM A;  4KN7 X;  5JVT A;  4JX6 A;  3HSF A;  2HFH A;  3HGG A;  2H6C A;  5D6E A;  3OL4 A;  5E1X A;  2DA1 A;  3RQI A;  1F1Z A;  4AYB N;  1AOY A;  1FEX A;  5M5X J;  2DQL A;  2CQX A;  2LLK A;  4L9J A;  5FRN A;  1ZRE A;  3LOC A;  4R8H A;  2PG4 A;  2CV1 A;  3DXJ F;  2RQQ A;  1KON A;  4XMY A;  4C3H J;  3ZQL A;  3FDY A;  5IOY A;  5JVG F;  5GTH C;  1FY7 A;  2RRE A;  1QGP A;  1FP2 A;  1UHS A;  2OAZ A;  2R5Y B;  5J47 A;  5ICF A;  1FIA A;  2AXT C;  2XC7 A;  2X1D A;  4AWX B;  3G73 A;  5FD5 A;  5HLG A;  2M7B A;  2CSO A;  2X48 A;  1OFC X;  2IP2 A;  1ON1 A;  2LD5 A;  1VQ9 I;  3G1L A;  3E5U A;  3FF5 A;  4C3I J;  4XRF A;  3S14 J;  2B9S A;  5LEK A;  3AG3 H;  3JRA A;  2M5W A;  2P4W A;  5L3E A;  3MWM A;  2JUC A;  3S32 A;  4NC7 A;  1GLN A;  2JT1 A;  1LFP A;  4XN0 A;  1V5E A;  1SD7 A;  1MGT A;  2MGQ A;  2K9N A;  4M3D A;  1RPW A;  2XKP A;  2YPR A;  4JBA A;  1K78 A;  1QPI A;  2Y9Y A;  3HBL A;  2ZSH B;  4CXF A;  3K70 D;  3CCY A;  2E34 A;  1DGR M;  1E3O C;  4PFP A;  3CF2 A;  4YII A;  4XKV A;  2Q0O A;  4II3 A;  2M9H A;  2OF7 A;  4P1W A;  1XSX A;  1G3Y A;  4XM3 A;  1XMK A;  2VBX A;  2DTZ A;  2HGC A;  3A02 A;  1DDN A;  1QO0 D;  4KIB A;  3F8N A;  2NS7 A;  2QUF A;  4OIP F;  2P5V A;  4WXD A;  2K9L A;  2A07 F;  2LKX A;  3GTM J;  3WTW C;  1XX5 A;  5D6F A;  3WTU C;  4U0W A;  2ISZ A;  5D5V B;  2DT6 A;  2LG4 A;  2BXZ A;  3QOE A;  3TGN A;  3CC2 I;  5A2Q Z;  1N75 A;  3M1E A;  4JQF A;  2R7W A;  2HVS A;  1KQ0 A;  3EUA A;  3N05 A;  4PJN A;  3L2U A;  4Q5S F;  1I6H J;  3P9C A;  4N9H A;  2O9L A;  3AAF A;  4IRI A;  2CRG A;  4FCY A;  5LEJ A;  4XID A;  3CZ6 A;  2FSW A;  1P9Q C;  2L5Q A;  4QIW N;  3BJ6 A;  1OCP A;  2FEZ A;  3BQY A;  4A69 C;  1X19 A;  2DA5 A;  4IHX A;  4IQ4 A;  3TL4 X;  3I58 A;  4I09 A;  1MMA A;  1QPM A;  3FXL A;  2JA2 A;  2LKP A;  2R5Y A;  2B63 J;  5M5W J;  1IRG A;  4XRS G;  3KP4 A;  2BXY A;  4RGX A;  4WF2 A;  3CO6 C;  2H94 A;  2XDV A;  2QZ8 A;  4X6A J;  2BE5 F;  1O3Q A;  3AL0 C;  3GXO A;  1ZAO A;  3WG7 H;  4CZZ A;  1ETK A;  1ON2 A;  4U88 A;  3ZMZ A;  4MFD A;  4PSX A;  5J1R A;  4A3L J;  5J8C A;  3TDU C;  4WWC A;  1T08 B;  1AHD P;  4IXA A;  2ZKZ A;  4J19 A;  4HV6 A;  2JQ7 A;  2F2E A;  3TBI A;  1ZYR F;  2XGE A;  2QSF X;  3L2W A;  2OBP A;  1UZC A;  3CD6 I;  2NVX J;  3BJA A;  2HTJ A;  2A6H F;  4PSW A;  3EUH A;  3CP2 A;  5AIQ A;  5CKT A;  3G4S I;  1S9H A;  4LG0 B;  1XGN A;  4B8X A;  1ERD A;  3KLO A;  2A05 A;  2V9K A;  1D5V A;  4V2F A;  5FLM J;  4O5V A;  2ZCW A;  5JLW A;  4ON0 A;  3TKY A;  9ANT A;  3CCV I;  4W1U A;  5HVQ C;  5H6R A;  1R4N B;  1K61 A;  3H0G J;  4KUM A;  2MC4 A;  5K5Q A;  5HS7 A;  1WJF A;  3QPL A;  2X6W A;  1PUF B;  4BHB A;  5E8I A;  2IGN A;  1W4M A;  3FKJ A;  1A35 A;  1R9T J;  2QVO A;  1RET A;  1FSH A;  1U5T C;  1D8J A;  1T0F C;  1X1A A;  2DA6 A;  3RQ4 A;  3CCR I;  1YW8 A;  3K1N A;  3HRM A;  4WK8 F;  1Y6I A;  2E1M B;  4LK1 F;  1UST A;  3I64 A;  1IUF A;  3S3M A;  3KEQ A;  2A5W A;  1Z91 A;  2Y48 A;  1J75 A;  1TLH B;  1W7P D;  2K02 A;  2H27 A;  3OYI A;  2OJE D;  1FT9 A;  2BEO A;  2COB A;  2KL4 A;  1OQY A;  3KPH A;  4HST A;  2W7N A;  2MW8 A;  2AXL A;  1B4A A;  2CUE A;  4Z2Y A;  5E3O A;  2CQQ A;  3IL2 A;  4HF0 A;  1Y1V J;  3ZPL A;  1U3E M;  2D2W A;  5E1W A;  3H5A A;  3ZP5 A;  2LRD A;  1BC7 C;  4LD5 A;  3KP2 A;  1UFM A;  3HDD A;  2KRC A;  1WJD A;  2FOK A;  5B1A H;  1K83 J;  1LEA A;  3S3N A;  3SFI A;  2WV1 A;  4XLA A;  5ILU A;  4XQF A;  1BI3 A;  1T8I A;  1TT5 B;  2WAQ A;  3I59 B;  3L09 A;  4JX4 A;  3K6G A;  1D8K A;  2FML A;  3K4C A;  5CQE A;  2H09 A;  5CQG A;  1D5Y A;  3J7A Y;  3O8G A;  2MH2 A;  3L1P A;  2Z1D A;  2UXX A;  4MFE A;  3PSF A;  4R1H A;  1LPQ A;  1VQO I;  2OZU A;  2VPR A;  3G6E I;  3F8M A;  3HRS A;  4HV5 A;  4B4C A;  1K4T A;  1JJ8 C;  2LYC A;  4II2 A;  4HEA 2;  1S8N A;  1FZP B;  3GVA A;  1LVA A;  1Z7L A;  2LP0 A;  2Z16 A;  1OIS A;  4LG0 A;  1B9M A;  4M9X A;  1MMN A;  3WGH A;  5H2F C;  3C18 A;  4EJW A;  3DLL F;  2WAD A;  2PN6 A;  2ZFU A;  4E70 A;  3LFU A;  4GGG A;  3CJT B;  2L9S A;  4KA4 A;  3HKZ N;  2PFB A;  3GFM A;  4O3M A;  4MNU A;  2DMU A;  3PNY A;  1PUF A;  3BLY A;  4E7I A;  3GX4 X;  1DPU A;  4PJJ A;  3Q3S A;  2IGO A;  1A04 A;  2Y0S N;  1XGM A;  1EJ9 A;  2FNA A;  3O6B B;  1B6A A;  2V6E A;  2ZBK A;  4U87 A;  2DPU A;  3W6J B;  2EQR A;  1Z3Y A;  3OYA A;  3L2C A;  1DP3 A;  3RIR A;  2OC6 A;  1LVK A;  1EV7 A;  5CPR B;  2MD0 A;  2QWW A;  3J7A O;  3S2H J;  5GAH J;  2VKV A;  2JTV A;  3PFY A;  1YW7 A;  1U2W A;  1P7J A;  2V9V A;  3CTA A;  2D45 A;  4A5M A;  1X2M A;  2FQ3 A;  3V4G A;  4ESB A;  2KT0 A;  3DF8 A;  2LH9 A;  1AKH B;  1X1C A;  3HOZ J;  1R1T A;  3BR3 A;  3ZMU A;  2P5L C;  1ZR4 A;  5C4X J;  3BR6 A;  4IZZ A;  2VJ4 A;  1BA5 A;  4XOP A;  3P9K A;  4LB5 A;  3I59 A;  3I71 A;  4L9T A;  4PJL A;  4RLQ A;  1FP1 D;  1BW6 A;  3EPZ A;  1F5T A;  1S5L C;  2A5Y B;  1N77 A;  4LMY A;  1W5C C;  4BL0 B;  1GHC A;  2BY0 A;  2JRM A;  3NRV A;  4M71 A;  4LB6 B;  3WG9 A;  1G8X A;  2BYV E;  4G7O F;  5C3E J;  4ITV A;  4EGZ A;  5FKN A;  4ZTF A;  4V19 K;  3S2D J;  1IUY A;  4UUV A;  2VBY A;  2HZT A;  3JTH A;  3L00 A;  1YJW I;  2ELH A;  3LSP A;  3CMA I;  5B5E C;  1ZG3 A;  2WB1 A;  2V1X A;  5DV5 A;  3B6A A;  3QAH A;  2CG4 A;  4LGW A;  4D1Q A;  4AUX A;  3F21 A;  4G6T B;  1YHQ I;  3EYY A;  4UVB A;  2XAH A;  4LJZ F;  4LIU A;  2MH9 A;  1WGX A;  1MH4 A;  5ICG A;  4HLX A;  4XSX F;  2DBB A;  3LSM A;  1UJ8 A;  2HS5 A;  2KLO A;  3E7L A;  3BG5 A;  1FBS A;  3G71 I;  1PYV A;  1VQ7 I;  2K3P A;  3HEF A;  4HDU A;  3ZGK A;  5FD6 A;  4BJ5 C;  3FHN A;  4F91 B;  2VAS A;  2O8K A;  3FK7 A;  4L0Y B;  5DUK A;  5LLQ A;  3WE3 A;  3CCU I;  1P6R A;  2OD5 A;  3GO5 A;  3WTY C;  1YLF A;  4KNY A;  3LA3 A;  3ZQG A;  1MBJ A;  1HC8 A;  5L3C A;  1E17 A;  4QWQ A;  1O4X A;  2RC4 A;  3RKQ A;  3FBN B;  3O8H A;  3V7S A;  2O0Y A;  3GFJ A;  3GTJ J;  1Z7U A;  3M8E A;  1IW7 F;  3IRQ A;  3HIF A;  3ABU A;  5E79 C;  3IUO A;  4PGH A;  5M3M J;  2DA3 A;  2D5V A;  4KIS A;  2Y2Z A;  2TRT A;  2HZD A;  2NXN B;  5LGN A;  2VUM J;  5LHG A;  1IC8 A;  2N8G A;  3BPV A;  4FAS D;  3R0A A;  3DTI A;  1X1D A;  5GAE J;  4RBO A;  4G12 A;  4RDU A;  3OYN A;  3TQN A;  1OCR H;  4AID A;  1VZ0 A;  1ZLJ A;  3RPQ A;  2EB7 A;  3IC7 A;  4U0V A;  3TW6 A;  4CCJ A;  3JRG A;  3K7A J;  3FX3 A;  2KDO A;  3BR2 A;  1TQM A;  3MKY B;  2EWN A;  1J7K A;  3F22 A;  1SFE A;  2CV2 A;  4HPQ A;  4CCL A;  2MBF A;  3PQJ A;  2IPQ X;  2HQN A;  2XPV A;  4Q48 A;  4L9N A;  2E7X A;  3WTT C;  1G4D A;  5FKO A;  2GLO A;  2P0W A;  2PMZ A;  1Z1D A;  1XGO A;  4RAY A;  3WTS C;  1LKX A;  3IHU A;  1IAW A;  2ESH A;  3F9K A;  3ZN0 A;  2NNY A;  1ZAR A;  4S0H B;  4ENN A;  4UNO A;  4Q4Z F;  3REO A;  2DDA A;  1YTY A;  2PEX A;  1YE9 A;  3BQZ A;  5CVI A;  1HKQ A;  3NWS A;  4PDK A;  3P9I A;  2KMU A;  3RSN A;  1IG7 A;  4IHT A;  3E6D A;  1TW2 A;  3BY6 A;  5DDG A;  2VIX A;  4KDP A;  1ZRF A;  2CUJ A;  4HA8 A;  3KCC A;  5KNL A;  5K7H A;  1U8B A;  1M1E B;  3IH3 A;  1G3T A;  2GA1 A;  4MTD A;  1SFO J;  2GBY A;  2V1D A;  4G6Q A;  4C30 A;  1Z6T A;  2ZFW A;  4HRI A;  1XSD A;  1XCV A;  3MKZ A;  1ETQ A;  4BAC A;  3LWF A;  4B09 A;  3BCA A;  2EBI A;  5FLX Z;  2YX7 A;  4EV0 A;  3CP8 A;  3D0S A;  4EM2 A;  3GTO J;  3HPG A;  2LKS A;  1E3P A;  1V4R A;  3FXJ A;  2F6C A;  5E20 A;  2VE9 A;  2VOP A;  1I50 J;  2K5C A;  5J8F A;  4NBQ A;  3RZD J;  2EZH A;  2YUS A;  5ICC A;  1FYL A;  4PFO A;  2CO5 A;  2BZT A;  2KPM A;  2L9N A;  1XCB A;  2PMU A;  2XF5 A;  3PM1 A;  4GO1 A;  4ZYG A;  1VQ6 I;  2OCC H;  2BBY A;  2L0K A;  2LOO A;  3B6C A;  2FX0 A;  2HDC A;  2OUM A;  3SZP A;  3JRB A;  1HCR A;  2NAZ A;  5LRR A;  2JPB A;  1Z9C A;  4MO7 A;  5E8G A;  5L3D A;  3OS2 A;  2R4G A;  1LE8 B;  2RNG A;  3MN2 A;  3CCM I;  2JK3 A;  4M3B A;  4RS8 A;  1MND A;  3ULQ B;  2VOD A;  2XIG A;  2QQB A;  5KAI C;  1ETW A;  4KIT B;  2G7H A;  1T95 A;  1OJL A;  3GLL A;  1JKR C;  2JWT A;  1B72 B;  2EFW A;  1MMG A;  2HXI A;  3TMO A;  3DPL C;  1TWC J;  3V42 A;  1FMV A;  2VQG A;  5DEQ A;  1MNM C;  3OR1 C;  2KIQ A;  4U0Y A;  3DLA A;  4KT5 C;  3M9A A;  3I4N J;  1P92 A;  3OSF A;  2VBW A;  3GFI A;  2GZW A;  4Y13 A;  2EK5 A;  2EIK H;  3PQK A;  2DXI A;  2NYX A;  2EFP A;  4HSR A;  2PBI A;  2ME6 A;  4XBF A;  1D3Y A;  4Y3O A;  1WSU A;  4UVC A;  5KAF C;  3K70 C;  3AKZ A;  3D5R C;  2WA0 A;  2R7Q A;  3SYT A;  3V7C A;  2W25 A;  3K4N A;  3KZZ A;  1L3L A;  4ZJZ A;  2Y31 A;  4HQM A;  4FE7 A;  3LA7 A;  5HOO A;  2PMH A;  2FQ4 A;  3H9G A;  2FRH A;  3QPH A;  4N9I A;  2B7E A;  1XDU A;  2EV0 A;  3KIO A;  4BY7 J;  2CH0 A;  1KGS A;  1IRZ A;  2NOG A;  3LSJ A;  2KFD A;  3JRI A;  3HOW J;  1YIT I;  3IV5 A;  3TDZ C;  4BU2 A;  3BZC A;  2P81 A;  2CJJ A;  3BG9 A;  2VPL A;  3HOS A;  2FUG 2;  1SVM A;  3LAJ A;  1FPQ A;  2QKM B;  5F6F A;  3U9G A;  2YU9 J;  2JA8 J;  5JLX A;  3KYL A;  1T56 A;  2VQL A;  1QZY A;  2E2H J;  2DDB A;  2UZK A;  1LDJ A;  2VT3 A;  3IH4 A;  5GP9 A;  1PDN C;  4HDV A;  2YS9 A;  3AG4 H;  1IGN A;  4OU0 A;  5CVU A;  1LE8 A;  4BUP A;  4RAG A;  3H9J A;  2X9D A;  1MBH A;  1VF9 A;  4A0Z A;  4E7L A;  1E0E A;  3BJO A;  3C1D A;  1WFX A;  3CMM A;  3T8R A;  3MZY A;  1O3R A;  3KZI C;  1QHH D;  3ESW B;  4FX4 A;  2ZXI A;  4BBR J;  1B72 A;  1RUN A;  1MSF C;  3WGI A;  2JVH A;  2L7M P;  2DW4 A;  2R7R A;  5IYD J;  2WV0 A;  3JAM Z;  1QRY A;  3C7J A;  3KEO A;  4FX0 A;  2VOO A;  3PNT A;  1RUO A;  2EH3 A;  1APL C;  2F5C A;  4IO9 F;  1I6X A;  5HS9 A;  1YJN I;  2XAF A;  3VYR B;  5EEG A;  1X4P A;  2HPI A;  3GEZ A;  2EIL H;  2HXO A;  4ENJ A;  3U2R A;  4N4O B;  4NC8 A;  5JI6 A;  1J0R A;  3A2K A;  1IN6 A;  1SVO A;  5D5U B;  2XRL A;  3WTX C;  3BG3 A;  1JUS A;  1J9I A;  2A6T A;  2A3S A;  2FF4 A;  2K27 A;  2IJL A;  4DBQ A;  1EF4 A;  2ELK A;  4HYE A;  1Z0X A;  2RAE A;  2XB5 A;  4DYR A;  1UMQ A;  4EJO A;  5K5R A;  2LVS A;  5F1R A;  2VL8 A;  4DZJ A;  2XGX A;  4WCG A;  1FBU A;  1OKR A;  4JP0 A;  4I2O A;  1O7F A;  1R5I D;  2BY3 A;  3HC7 A;  3GWZ A;  1HKT A;  2H8W A;  2MYS A;  3WU1 B;  4IHS A;  1QHG A;  1L0O C;  3BCB A;  1GV2 A;  2A69 F;  3VPR A;  3MD2 A;  2MC3 A;  4JYK A;  3K4M A;  2FBH A;  2CGP A;  2IAI A;  2DMQ A;  4HNU A;  1USS A;  4I98 B;  3H3V K;  1T38 A;  3Q5F A;  2I8D A;  3F0C A;  3S2W A;  4G7H F;  4RAZ A;  4CIC A;  2W84 A;  3NWT A;  1R58 A;  2C6Y A;  4ZYD A;  3AL0 B;  3OY9 A;  3JAM K;  1U9O A;  1FLI A;  1AWC A;  5ED4 A;  1R00 A;  2DU9 A;  4HOB A;  4RM3 A;  4BS9 A;  4ENM A;  1S3J A;  4U7B A;  2XV4 S;  1YX3 A;  4AC0 A;  2EPF A;  4L0Z B;  3F6O A;  1B9N A;  4GCV A;  5IP9 J;  4IHY A;  1BR2 A;  3LL7 A;  4P96 A;  4BQO A;  4C2U A;  3TP0 A;  3LSH A;  3GW2 A;  1P4W A;  1V5G A;  4G7Z F;  2LTP A;  4ZZD A;  2ZNZ A;  4DW6 A;  1R1U A;  2L7F P;  3SZT A;  4A3B J;  1J09 A;  4YG2 F;  2HKO A;  1ONV A;  3VOE A;  1F9N A;  2I10 A;  1UCR A;  5B66 C;  1SMT A;  3RKY A;  1TL8 A;  1D0X A;  2XUB A;  1KU3 A;  1ZRC A;  4YFK F;  4IPA A;  3BG6 A;  4XNF A;  1ETX A;  1GVD A;  5ILS A;  1W0T A;  2HI3 A;  2DMP A;  3A03 A;  1NG7 A;  4XOR A;  3SDG A;  1U5T B;  2CFO A;  4HNT A;  3BT9 A;  2TCT A;  3VYU B;  4MIM A;  2DLL A;  3HJE A;  1IJW C;  1OR7 C;  3H35 A;  3LQQ A;  4XIC A;  1TTY A;  3WU0 A;  1YX5 A;  1W0U A;  2KJC A;  2EA4 A;  2M8E A;  2RVC A;  4B3A A;  3KP7 A;  1XDS A;  3RYR A;  3ECH A;  2IA1 A;  2VKE A;  3FMR A;  2OCE A;  2VBZ A;  2W48 A;  1BL0 A;  3HUG B;  4KMF A;  2GQQ A;  2AS5 F;  3M8J A;  3R4K A;  5TRD A;  1S7A A;  2F48 A;  2FBK A;  2CW0 F;  4PCQ A;  1R49 A;  2WTE A;  3W3C A;  2ZXW H;  3QYE A;  1AA7 A;  2W00 A;  2RN7 A;  5DCF A;  3T5X A;  1CF7 B;  4A3F J;  3OIO A;  1KYZ A;  2BOL A;  2XVC A;  1YQA A;  3LSK A;  3WGG A;  1O3S A;  2UWM A;  1EH8 A;  1ZR2 A;  1MKM A;  4XKC A;  5DTD A;  3MZH A;  2ISY A;  4KIF A;  2VC1 A;  4MGR A;  4WX9 A;  5FFZ A;  1SD6 A;  2XSD C;  5DD4 A;  1BN5 A;  4BNC A;  6PAX A;  3LA2 A;  3KP3 A;  3JRH A;  4A3C J;  2DYS H;  5F04 A;  2PJP A;  3E97 A;  1VQ8 I;  5A2Q K;  4BBS J;  4BQN A;  2F5F A;  2E7W A;  4AM3 A;  3CQZ J;  3BR5 A;  1V5F A;  4Y15 A;  2WAE A;  1MW7 A;  4AYB A;  1XTA A;  4E7J A;  1GUU A;  3V8L A;  3U1D A;  1U5T A;  1HST A;  1T0F A;  1WJE A;  3A4C A;  2V79 A;  4ZDL A;  4F52 A;  3RZO J;  1UB9 A;  1ZEL A;  1W1W E;  3BTJ A;  2HOE A;  4UV8 A;  2Y75 A;  1B1B A;  1JXS A;  1U78 A;  1A5J A;  3CES A;  1EA3 A;  4GYI A;  4F7Z A;  2HU9 A;  1Y0N A;  4OAZ A;  4LIV A;  4A0X A;  4BE2 A;  2P7V B;  3BZK A;  2CW7 A;  3WTZ A;  1C0W A;  1R4M B;  2W4S A;  4XR6 A;  2L9V A;  3PSI A;  5K5O A;  2JA6 J;  2K86 A;  2IRF G;  2CUF A;  1B8I B;  3HUG A;  1XD7 A;  2Z99 A;  2R7S A;  1RIO H;  3B02 A;  3FKI J;  3DWL E;  4K2E A;  3GZ6 A;  1SD4 A;  1I3A A;  2WB1 N;  3P7N A;  1G59 A;  2NNN A;  4KIC A;  2E36 A;  4BXX J;  2WY8 Q;  2EJR A;  1X3W B;  2WBM A;  3OIQ A;  1P7I A;  3L2Q A;  3ZXS A;  2X1E A;  1WJA A;  2XB0 X;  3K2Z A;  4X0G A;  3GUD A;  3K69 A;  2R7D A;  1CF7 A;  2Z5U A;  1TT0 A;  2VQC A;  2XF7 A;  1JTX A;  2BW3 B;  4UXN A;  2GOM A;  5DUI A;  4OMY A;  2X6O A;  1OYI A;  1LJ9 A;  3FZV A;  3FHZ A;  2COM A;  2HOA A;  2VI6 A;  5LFA A;  5KK1 A;  1VQN I;  1ZH5 A;  4CCK A;  2FE3 A;  3BG7 A;  4XON A;  2Y9Z A;  1ETY A;  3L7W A;  1RZ4 A;  3ZQQ A;  3VDX A;  2HEO A;  1LFU P;  1FNN A;  2O7O A;  4LLL A;  2LY2 A;  3ZRG A;  1SAX A;  3S15 J;  4RB2 C;  2B0L A;  4XN3 A;  1ZRD A;  2CW8 A;  1SFX A;  1IXR C;  2JSP A;  2BVM A;  2VXZ A;  1Z05 A;  1T98 A;  1WRJ A;  2K9S A;  4M73 A;  1PVE A;  2KP6 A;  4PJ0 C;  5BMZ A;  4KYW A;  3LFK A;  2NS8 A;  5TGT A;  1G3S A;  4G8X A;  1HLV A;  3ZQC A;  4A3I J;  5EGO B;  2VXD A;  3AG1 H;  2M0C A;  3H0D A;  2XGD A;  3F23 A;  3BWG A;  2D1H A;  4HBL A;  2LRE A;  1IV8 A;  2DYR H;  4EM1 A;  1ZKG A;  4UUS B;  3VEP A;  2GXB A;  2DA4 A;  2EIM H;  1XS9 A;  4AIJ A;  1FOY A;  4B43 A;  4OMZ A;  1YFH A;  3MFK A;  2R7O A;  3OR2 C;  2R93 J;  1B8I A;  1WJB A;  1LQ1 A;  5EF6 A;  3ZCO A;  2KZG A;  1I1G A;  1ODD A;  1TQI A;  1QVT A;  1RKW A;  2KRH A;  1PJR A;  1XC5 A;  5HLH A;  3S16 J;  2M34 A;  1HW1 A;  3OYG A;  1ZGW A;  2NVQ J;  3HSR A;  4RB1 A;  2J5P A;  3PL8 A;  5EEH A;  4FQG A;  3W2A A;  2QGU A;  5AIP A;  4XLP F;  3BRO A;  3L2R A;  4M6V A;  2BW3 A; 
#chains in the Genus database with same CATH homology
 1U0J A;  3QYF A;  4RMN A;  3I9V 2;  4KT6 A;  4Y33 A;  4F92 B;  4HRI A;  3MKZ A;  4LG3 A;  4BAC A;  3DTE A;  5KHD A;  3BCA A;  4BE1 A;  1SAU A;  3EUK L;  4QPQ A;  3CP8 A;  4CUG A;  2VJ5 A;  4ANJ A;  3HPG A;  2X51 A;  1NG6 A;  4E6K G;  3K4J A;  2F6C A;  3DKX A;  1UG0 A;  2R7X A;  3IP4 B;  2K5C A;  3S93 A;  4B47 A;  2M0M A;  3VWB A;  2AQF A;  3QOD A;  4AU7 A;  3EUH C;  4KJZ A;  4PFO A;  3OYB A;  4J00 A;  3OOU A;  4BDZ A;  2KPM A;  3SZG A;  2IS4 A;  3OMY A;  2L9N A;  4ZC3 A;  4CH7 A;  4BXF A;  4JOM A;  5LD2 C;  3DU6 A;  1DGW Y;  4RM2 A;  3H9Q A;  2DT7 B;  2XF5 A;  4YEL A;  2LBF B;  2HVR A;  2DOA A;  2IXS A;  5KCM A;  4CA0 A;  3OYE A;  3OYK A;  3OL4 A;  2LOO A;  3OS1 A;  1QU3 A;  5FRN A;  2OUM A;  2CV1 A;  2RQQ A;  1KON A;  4XMY A;  3FDY A;  3OS2 A;  2R4G A;  2RNG A;  2QKL B;  4MLO A;  1IRX A;  2RRE A;  1MND A;  3C2H A;  4NUB A;  2X6Y A;  2XC7 A;  2L7K A;  2X1D A;  2M7B A;  4NNJ A;  4KIT B;  4BGD A;  1T95 A;  4XL9 A;  2LY1 A;  4XLC A;  1Z3X A;  1MMG A;  2XF6 A;  3TMO A;  3DPL C;  3S32 A;  3V42 A;  4NC7 A;  2VQG A;  1FMV A;  1GLN A;  2M7A A;  1LFP A;  4PJM A;  3KEY A;  4XN0 A;  4CSW A;  1V5E A;  3OR1 C;  5JHF A;  4LIT A;  3DLA A;  3K4K A;  2ZXH A;  4IKF A;  2V7F A;  3RCO A;  3HKZ A;  2DXI A;  3UR3 C;  2ZSH B;  4HSR A;  3K70 D;  4Y3O A;  3VYS B;  1DGR M;  3K70 C;  4PFP A;  3AKZ A;  3CF2 A;  3D5R C;  2R7U A;  2WA0 A;  2UV1 A;  2R7Q A;  4XKV A;  3SYT A;  3K4N A;  1JI8 A;  4II3 A;  4F55 A;  2HDW A;  4ZJZ A;  4P1W A;  2CS3 A;  4XM3 A;  3VSK A;  5HOO A;  2VKH A;  2Y0S A;  4N4N B;  3H9G A;  2W1O A;  4DBR A;  3H5N A;  2W82 A;  2CH0 A;  2K9L A;  4H4K C;  3E0J B;  4BU2 A;  2V1N A;  2E5Z A;  3E1S A;  2VPL A;  3DPU A;  2DT6 A;  1DQU A;  2LBF A;  3HOS A;  2FUG 2;  2LG4 A;  3QOE A;  2QKM B;  1N75 A;  3KYL A;  4JQF A;  4XLH A;  2R7W A;  2HVS A;  2VQL A;  3EUA A;  3N05 A;  4PJN A;  3L2U A;  2PJR B;  2E60 A;  1R6R A;  3HOT A;  1WJ5 A;  3CZ6 A;  1P9Q C;  2L5Q A;  2R7V A;  4BUP A;  1X19 A;  2E1M C;  3H9J A;  4IQ4 A;  1D1C A;  3TL4 X;  5FRM A;  3VYT B;  1MMA A;  2JA2 A;  3KX2 A;  4EAT A;  4E7L A;  2IS1 A;  1E0E A;  2XDV A;  4C2T A;  1WFX A;  3CMM A;  3AL0 C;  2E5N A;  2HNH A;  3HPH A;  1QHH D;  2X85 A;  4PSX A;  2ZXI A;  3W2V A;  4E7H A;  3OYD A;  1TZL A;  2JVH A;  2V4J C;  2R7R A;  3TBI A;  3CJQ B;  3PNT A;  4XKB A;  4NQW B;  2K9M A;  3L2W A;  4DJA A;  4HG2 A;  1BR1 A;  2IGM A;  3VYR B;  1D1A A;  4PSW A;  3CP2 A;  3S3O A;  1X4P A;  1W36 D;  2HPI A;  2IGK A;  5CKT A;  1S9H A;  1W36 C;  4N4O B;  2OV7 A;  4NC8 A;  4DIQ A;  1X4O A;  3A1Y A;  3OYL A;  1D0Y A;  3A2K A;  1ERD A;  2VB6 A;  2V9K A;  3DQV C;  3DEE A;  2A6T A;  4PK4 A;  4BJT A;  4DBQ A;  4P5O A;  2VQH A;  5HVQ C;  3DKY A;  3K4B A;  2MAB A;  2MC4 A;  3HG9 A;  2VL8 A;  1WJF A;  2X6W A;  2AQE A;  2IGN A;  3FKJ A;  3HC7 A;  1T0F C;  1X1A A;  2MYS A;  3RQ4 A;  1QHG A;  3DU5 A;  3U21 A;  3BCB A;  4YEJ A;  1Y6I A;  2E1M B;  3MD2 A;  3SDB A;  3S3M A;  1Z21 A;  3K4M A;  2VJI A;  2A5W A;  4HNU A;  3HXL A;  3DTK A;  4BQQ A;  4CCO A;  5HNF A;  3FBI B;  2I8D A;  2KZV A;  3OYI A;  2PJR A;  2V26 A;  3K4L A;  3IAS 2;  2KL4 A;  3NWT A;  3ZR8 X;  4HST A;  3AL0 B;  2W7N A;  4XOT A;  3OY9 A;  2XSJ C;  4CZC A;  1K6Y A;  2L2O A;  4RM3 A;  4BS9 A;  4XLE A;  3OS0 A;  2F5V A;  4U7B A;  3SEZ A;  3H5A A;  2LRD A;  1YX3 A;  2KRC A;  1WJD A;  3VSL A;  3S3N A;  3HL2 A;  4XLA A;  4XQF A;  2WAF A;  2WAQ A;  1BR2 A;  3LL7 A;  4BQO A;  4C2U A;  3K6G A;  3K4C A;  5CQE A;  3LSH A;  2HVQ A;  4BE0 A;  5CQG A;  1V5G A;  3MKW B;  3J7A Y;  2Z1D A;  3PSF A;  1J09 A;  1UAA A;  4B44 A;  4PUS A;  3PUB A;  4R79 A;  2MFZ A;  5HNH A;  2LYC A;  4QPO A;  4II2 A;  4HEA 2;  1D0X A;  1MNE A;  2JUG A;  1Z7L A;  2Z16 A;  2F4I A;  4ZDP A;  3BG6 A;  4XNF A;  4FET A;  1MMN A;  2WAD A;  5HLT A;  2ZFU A;  1NG7 A;  4XOR A;  4HNT A;  3OYM A;  2CFO A;  3LFU A;  4BEH B;  2L9S A;  3VYU B;  2O5R A;  3BC8 A;  3RPU D;  4XKW A;  2M3A A;  3PNY A;  1OR7 C;  3H35 A;  3BLY A;  4E7I A;  3MMY B;  4PJJ A;  1YX5 A;  4XLF A;  2IGO A;  3RTR A;  4E7K A;  4GRI A;  2KQR A;  2V6E A;  4U87 A;  4DGW B;  2R7T A;  3HUG B;  1OLT A;  3W2W A;  3OYA A;  1DP3 A;  1Z3Y A;  3K10 A;  4BDY A;  3M8J A;  2OC6 A;  1LVK A;  5CPR B;  2MD0 A;  3CJR B;  3W3C A;  3IAM 2;  3OYC A;  2DCE A;  2GOX B;  1AA7 A;  2W00 A;  3QYE A;  2DJI A;  3PFY A;  4CCM A;  2BOL A;  3LSK A;  2UWM A;  4OWR B;  4XKC A;  2LH9 A;  1WJC A;  1X1C A;  2CV0 A;  4IZZ A;  2VJ4 A;  1D1B A;  4XOP A;  4CCN A;  3PNV A;  4E7S A;  4OAY A;  4PJL A;  2IS6 A;  2KHM A;  2M4K A;  4RLQ A;  3EPZ A;  3H5R A;  1FMW A;  3SEQ A;  1N77 A;  4BL0 B;  4BQN A;  3OL3 A;  1SFK A;  1LDK B;  2VLA A;  1V5F A;  1G8X A;  3C2G A;  4BJ6 C;  2WAE A;  3PJR A;  4ITV A;  1MW7 A;  4AYB A;  4ZTF A;  3OWT A;  4E7J A;  4RLF A;  2Z2S B;  2BVL A;  4ZDO A;  1HA8 A;  3DPT A;  3UNG C;  3M1C A;  4BEH A;  1WJE A;  3A4C A;  4ZDL A;  4F52 A;  2WB1 A;  1ZEL A;  2XAU A;  3G2B A;  4C9Y A;  2HPM A;  4D1Q A;  2IS2 A;  4YRV A;  4G6T B;  2LC2 A;  3CES A;  1EA3 A;  3OYH A;  2HU9 A;  2ZSI B;  1D0Z A;  4LIU A;  4LIV A;  4OAZ A;  4BE2 A;  4F93 B;  2CW7 A;  2W4S A;  4XR6 A;  3PSI A;  3LSM A;  2KLO A;  1PYV A;  2X1C A;  2K3P A;  2R7S A;  3ZGK A;  3DWL E;  4BJ5 C;  1G59 A;  3FHN A;  2WY8 Q;  2VAS A;  4F91 B;  2WBM A;  3AFH A;  3OIQ A;  4ZTJ A;  1N78 A;  3L2Q A;  3ZXS A;  2X1E A;  1WJA A;  4X0G A;  2WY7 Q;  4B3X A;  1X1B A;  1TT0 A;  2VQC A;  3FBN B;  2XF7 A;  2BW3 B;  2GOM A;  1BR4 A;  4E4H A;  2CUZ A;  4D9J A;  3IUO A;  3D5S C;  4Y4R A;  5LFA A;  4KIS A;  2VKD A;  4CCK A;  2HZD A;  2X6X A;  3BG7 A;  4XON A;  2Q2E B;  3LSI A;  4FAS D;  3ZQQ A;  2HQA A;  3DTI A;  3VDX A;  1X1D A;  3OYN A;  1MMD A;  3L2R A;  2M4G A;  1VZ0 A;  2LY2 A;  3ZRG A;  1BOB A;  4CCJ A;  4XN3 A;  2CW8 A;  2KDO A;  3MKY B;  3ONQ A;  2JSP A;  2BVM A;  2VXZ A;  5FRO A;  4J01 A;  4AVZ A;  3OYJ A;  2CV2 A;  2KP6 A;  4HPQ A;  4CCL A;  2NOJ B;  3OYF A;  4B48 A;  5TGT A;  2JVG A;  2CMP A;  3I3L A;  3D5L A;  2VXD A;  3LSG A;  2P0W A;  2PMZ A;  3H0D A;  2UUZ A;  2LRE A;  1LKX A;  3F9K A;  2VJJ A;  4F3Q A;  4E7Z A;  2Q1Z B;  4B43 A;  4ZYA A;  3L2V A;  1YE9 A;  2R7O A;  3OR2 C;  3LMM A;  4IX7 A;  3NWS A;  1WJB A;  3ZCO A;  2KMU A;  3RSN A;  2KRH A;  1PJR A;  3GBG A;  3OYG A;  4IQJ A;  3QYB A;  2VIX A;  3S8P A;  2ELJ A;  2CUJ A;  3PL8 A;  5KNL A;  3W2A A;  1UEL B;  1Y56 A;  3OIP A;  4DOZ A;  4C30 A;  2BW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...