4ZYAA

The n-terminal extension domain of human asparaginyl-trna synthetase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
69
Chain Sequence
MAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSRWNVISKSQLKNIKKMWHREQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Asparagine--tRNA ligase, cytoplasmic
publication title Unique N-terminal extension domain of human asparaginyl-tRNA synthetase elicits CCR3-mediated chemokine activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 69
sequence length 74
chains with identical sequence B
ec nomenclature ec 6.1.1.22: Asparagine--tRNA ligase.
pdb deposition date 2015-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4zyaA00
2KQRA 4ZYAA
chains in the Genus database with same CATH superfamily
5GTIC 3FM3A 5BQTA 3WGHA 1MBKA 3KFWX 2KQRA 1U5TA 2VQHA 4MIMA 4A5NA 3OYFA 2BE5F 1X19A 2DTZA 2EA2A 2ADUA 2O8XA 5EZHA 1Z6TA 1O3RA 1ACIA 4RLFA 1Z3XA 2DBBA 2EBIA 2LY1A 1IJWC 2FD5A 4KIFA 4FASD 5LRRA 1RC9A 2ZJRF 4XMYA 1YI2I 4V2GA 2X0LA 3F3XA 4R8HA 3OYEA 3M9AA 1TWHJ 4NDLA 3PIOF 2R5YB 1UHMA 1XSXA 3Q3SA 1EKEA 5A2QK 3GF2A 3DV8A 2OTLI 4ANJA 3HUGA 3FBIB 2CU7A 2KDOA 2XROA 4RAYA 1MBJA 1I3QJ 1QZEA 4EJUA 4LB6B 5TISC 4ZYHA 4LB5A 1WKMA 1ONVA 2L9RA 4ZYAA 3MFKA 3LAJA 4XNFA 3QOEA 1Y1WJ 1UCRA 1K6OA 1ITYA 3TGNA 3DLLF 2VC1A 4EEFG 2HEOA 1E17A 3WTTC 4GRIA 2W85A 3E6MA 3C2HA 1YRNA 1B72A 1MNEA 3O8GA 1ETOA 3OS1A 4BDZA 2K9SA 2XAGA 3W3CA 5GPAA 4JBAA 4U7BA 1MH3A 1XCVA 2WA0A 2E7XA 3G4SI 3LMMA 3PNVA 4BHBA 2AQEA 1HDPA 4EGZA 1ZH5A 3RI4A 3VYTB 1AOYA 1HDDC 1MBEA 5H2FC 1B1BA 4ENKA 5JR3A 3S1MJ 1H9TA 2EV5A 2ZXJA 1SFEA 2R7WA 1YW7A 1IUFA 4Q5SF 4IOAF 3HOSA 3ZGKA 5B3SH 3CQZJ 2X6XA 1HW1A 3BTCA 1ETKA 3JAMZ 2A3SA 2JK3A 3BR0A 3Q5FA 2ID3A 2R7UA 3W2WA 2G9WA 4M71A 1VFCA 2NOGA 3HTSB 3GXOA 2K9LA 5KAFC 1Y39A 2DT7B 2LKSA 4L0ZB 4UVAA 2LTPA 3FISA 1D0ZA 1YQAA 3BCBA 3BC8A 4QIWN 4MEXF 1RNLA 3I4PA 3L2QA 4HF2A 2G7HA 1BR1A 2ZB9A 4A3CJ 1D5YA 4KICA 3M7GA 1ETVA 2W24A 3UR3C 4DW6A 2P6SA 4C2TA 2E5ZA 2L7KA 3L1PA 1JJ6C 2E71A 3GO5A 3JR9A 2VJ4A 2L54A 3F8MA 3GZNB 3GTJJ 3K69A 2UWMA 2HFHA 2L7ZA 2ZMEB 3OY9A 2R7RA 3PFYA 2IS2A 3BOQA 5CQGA 1UZCA 1E3PA 2OF7A 4P9UA 4ZH4F 2NOJB 4WXDA 2JSPA 2VONA 2JA2A 5LGUA 1K83J 2WAEA 1K78B 5FKMA 1LQ1A 1VI0A 2O0YA 1FIPA 5CVIA 3LAPA 5C4JJ 1DPUA 1XGMA 4FHTA 4M3GA 2I10A 2IXSA 3PNTA 2FMLA 4QTRA 4ON0A 4AYBA 1Y6IA 3CO7C 1QGPA 1BOAA 2DT6A 3K7AJ 4J01A 3MCZA 3WTXC 3FX3A 2VN2A 3PSIA 3WU1B 3I4NJ 4HV5A 3MKWB 1BJZA 5F04A 1O4XA 2CH0A 2P7CB 2PFBA 3DU6A 3TO6A 2HI3A 1Y0UA 2VUMJ 3M1CA 3RZDJ 4D7MA 1FTTA 1D8KA 3OS2A 3BTLA 3M1EA 3J81K 1ETYA 2V79A 3FWEA 4AYBN 4ZYDA 4XRSA 2EB7A 3RKQA 3HZJA 1KA8A 2QCOA 1HC8A 1D3YA 4P1WA 3EQLF 1MD0A 2G0EA 2MC4A 3HSEA 4WF2A 1X3ZB 2P8TA 1MJBA 3F8CA 2JA6J 1UJ8A 1VNDA 5FROA 1BOBA 4S04A 3MKYB 2OV7A 1VF9A 1PUFB 5F1RA 2ZJPF 2QVOA 3UNGC 2M45A 5K7HA 1YFHA 4HX8A 4DQ2A 5JFRA 2AO9A 4A12A 2NAZA 4Y7NJ 2CG4A 1F9NA 1Y56A 2GXAA 1R5HA 4KIGA 1FIAA 5DEQA 3GFIA 4BXFA 1T98A 3H3ZA 2K9QA 5C4XJ 2ETHA 4AVPA 4B43A 2LG4A 1U5TB 1R1TA 2DMUA 3WE2A 2XC7A 1KONA 2MBFA 3RPQA 5DCMB 1ZRCA 1O3SA 1VQ7I 1OLTA 5HOOA 4HG2A 5K7FA 2IPQX 5IP7J 3JSOA 1HW2A 2W4SA 2WV1A 4RDUA 2PLYA 2Y48A 4EQQA 2GLOA 2XF7A 4MNUA 4NC7A 1Z9CA 2CW0F 3DBLB 1YJWI 3FXJA 2K5CA 3T8TA 4XKBA 1TQIA 4LIUA 5TGTA 4Y33A 3HUGB 3WGIA 3OYIA 5JLWA 2BHYA 1QHGA 3KZIC 2JQ7A 4AD9A 4A5MA 5AIPA 2D2WA 5DD8A 2DAOA 2EILH 1OYWA 3OSGA 2PEXA 3LOCA 5BMZA 4YIFA 3RDIA 3LNQA 1RKTA 2DA5A 4CO8A 3JRIA 4HF1A 5IP6A 4PJLA 1DPRA 3IL2A 3CP8A 3RKWA 1A31A 5GTHC 3Q0WA 2LRDA 5LHHA 1XGNA 2CQ7A 3WODF 2DODA 3GFJA 2M4GA 3ZCOA 1YRNB 1B72B 3OIOA 2JJ7A 1YS7A 2RNGA 4OMZA 1S7AA 3SYTA 4AWXB 4XLNF 3F22A 3ABMH 3KLNA 4E7SA 2MLGA 2Q0OA 1U78A 5JVGF 2F5EA 3GX4X 4XM3A 5J4VA 4OIPF 1T6SA 5K5QA 1ZN2A 2VIXA 3LSGA 4ZDLA 2IAIA 3G6EI 3A03A 4RB1A 1FLIA 5KK1A 3HJEA 3LA3A 3LA2A 3FXMA 4ZDOA 4DBQA 3CCJI 4FX0A 1LUJB 3V8JA 2EA4A 4H4KC 3DCFA 3ZR8X 1W36C 2L4AA 4BY7J 3IAM2 2MH9A 3X2QH 4YFNF 3BWGA 3HM5A 1MDMA 2NVYJ 4A2UA 2QEXI 3N97A 2MW8A 4DGWB 5GPCA 1T8IA 5LEJA 1YLFA 1IRFA 4WCGA 1KU9A 4MQ9F 3R0JA 1V54H 4XLAA 4X0GA 4HSTA 2FXAA 5CLSA 3HOVJ 1YIJI 3ML6A 4AM3A 3I56I 1F5TA 3JAMK 2K9NA 5HS9A 1QO0D 5D6FA 4QPQA 3SDGA 5J1UA 3WTUC 1ETQA 4JX5A 4C30A 3QYFA 3JSPA 2L0KA 1RI7A 1ZGAA 1OKRA 2V1DA 3CC7I 4E7IA 2JWTA 2L7FP 2DCEA 2GOXB 3D1NI 3DFGA 2HVRA 2O9LA 1FEXA 3L2UA 3IV5A 2Y2ZA 4ETSA 4PK4A 1SFUA 4G8XA 2K3PA 1BR4A 3DTKA 3LSPA 2YX7A 3DPUA 5CKTA 2FEZA 4PJNA 1SFOJ 1JKRC 3VYSB 2LVSA 4YFKF 1OCCH 1G2HA 3BY6A 3TKYA 2D45A 4UUTA 1GV2A 1B9MA 4RB2C 2Y0SA 3TO9A 4PGGA 4ITVA 2VODA 3HDDA 4XN0A 3OOPA 4I09A 5E8GA 3PJRA 4U0YA 3MD2A 3QODA 1TW3A 2HDWA 4KN4X 5BNGA 4P5OA 4JQFA 5IYCJ 4XRSG 2PMUA 4M72A 4CDGA 2NRAC 1LKXA 4E6KG 4F52A 3H1CA 4XLFA 3CCMI 3D5RC 4CXFA 3D5SC 3LQQA 4KA4A 5E1XA 3CDIA 4GFBA 1EH8A 4OMYA 3T8RA 2W48A 2GIZA 2Y0SN 1XS9A 5IPAA 4Y4RA 3RTRA 5FKOA 4BS9A 2X51A 2YUSA 2R7DA 3QOPA 3WU0A 4EM2A 1JHHA 1U0JA 2QQAA 3FBNB 2CUZA 1KZHA 2J5PA 3ZMSA 5A2QZ 4IHYA 1OMIA 5E1WA 4CCMA 1K61A 2VQGA 4IHVA 1E3OC 2P4WA 2W00A 2RQPA 5F0CA 3COAC 1USTA 4M6VA 4ABZA 1SMYF 1ETXA 1XTAA 5L3DA 4Y15A 3JRCA 2QM3A 4N9HA 1MSEC 2EZIA 3HBLA 4HLYA 1P4AA 2FBKA 1E0EA 3HOTA 1O3TA 2CSOA 1VQLI 3KP5A 3H3UA 3SJMA 4JX4A 1JJ8C 3BG3A 2LR8A 4EATA 3LWFA 2DO7A 3FXLA 4UV9A 2IBDA 4HDUA 3OOUA 5F6FA 5ED4A 3A02A 2OA4A 3ASOH 3H36A 3AAFA 5LD2C 1LB2A 3Q9VA 3H9QA 5KNLA 1ON1A 4I0BA 2IGNA 2X4HA 2R7VA 1WJ5A 1U8RA 4B09A 2VI6A 3QU6A 4XLCA 3LQRA 1S29A 2YX4A 2XPUA 2YS9A 4D7NA 1KYZA 1WH5A 3D5LA 1ZG1A 5IY5H 4K2EA 3HTUA 2R93J 1J7KA 4C3JJ 3DLAA 3DTEA 3HHHA 1T56A 3TW7A 3S3MA 3ELKA 2COBA 3K0LA 4A0YA 2CQXA 4G7OF 3T0YA 2JTVA 1OR7A 3K4NA 3QP6A 3FHNA 1DU6A 2KIFA 3TP3A 2ZXHA 3TP0A 4LIVA 5F0FA 4A6EA 2JVHA 2H27A 1PP8F 2EINH 3CF2A 3S3NA 5E3LA 2WB1A 5ILVA 4HNVA 3OL3A 2XKPA 1WVRA 2ZFWA 3MZ8A 2OQRA 1XC5A 3GUDA 4N0BA 4PCQA 3L2WA 4F7ZA 3CCQI 4BBRJ 1B8IA 4HW0A 3SHFA 1Z91A 2E7WA 4BL0B 2FRHA 2ZFUA 3MKLA 3L7WA 1LDKB 4AIJA 4BJ6C 1WJBA 4DOZA 2KLOA 4G6DA 2XVCA 3E7LA 1W36D 4KIBA 5EJCA 1B9NA 2Q1ZB 1YO5C 1JT6A 1W7PD 3ZQCA 4A3KJ 3AG4H 2BVLA 3E6BA 3SFIA 3RKXA 4WK8F 2R7SA 4AIDA 4B48A 3GLXA 2F5FA 3BZ6A 5GAEJ 1MDMB 3T1BA 3BJOA 1FYLA 3T5XA 4EJOA 3KX2A 1I6XA 5D5VB 2V6EA 2GOMA 1Z05A 4IQJA 3C2BA 4BU2A 2KKOA 2XDVA 4MTDA 2YR2A 1FPQA 2QBYA 3HRSA 1VQPI 4ENNA 4E7ZA 1MJAA 3TOAA 1DP3A 2DMQA 1QVUA 2EIJH 1QBJA 1W5CC 3HGGA 1XB4A 3WTVC 1HKTA 4IO9F 2L4MA 4HYEA 4OOIA 1OCPA 4I98B 2B7EA 2EFPA 3F6OA 2UUZA 2RAEA 1S6LA 5FD5A 3TDUC 5LFAA 4P96A 4L18B 2DT5A 3J81Z 2VQLA 2E34A 2E19A 3PL8A 2WAQA 4A0ZA 3CUQC 4M3DA 2M87A 1JHFA 2M5WA 4HLXA 1S5LC 3M07A 2GBYA 4KMFA 1Y0NA 3ZMTA 1H8AC 1STZA 3I0TA 2XF5A 1JKPC 1ZHFA 3ZMZA 2O03A 3OYAA 1T08B 2E35A 1SFXA 2E1MC 4G9YA 3KZZA 4F55A 1R4MB 1WSUA 3I58A 1J75A 5E3MA 3CF5F 3Q0VA 2ZSHB 1SD6A 1J2XA 3HOXJ 2Z16A 2R0QC 2HYJA 1BI0A 3CUOA 2OTJI 2IGKA 1R4NB 3I64A 2Z2SB 1B59A 4BUPA 4D0PA 1X3UA 3K4LA 1GXPA 1AWCA 3GMEA 4N4NB 3CCLI 2FOKA 2KRCA 5D5XB 2H8RA 4A3DJ 1R1VA 4KT5C 1WCMJ 3HKZA 1LPQA 4BACA 1MMNA 3I4MJ 2DU9A 4OIRF 2HTJA 5J8CA 3BR3A 3K4MA 1IUYA 3KEQA 4DJAA 3S16J 1HF0A 4HBLA 1G59A 1JGGA 3V8LA 3PM1A 4HX4A 4EMSA 2VT2A 4NBQA 2HVQA 3GZ5A 4I01A 1VQMI 3I53A 4YG2F 2A68F 2MABA 2QQ8A 5J40A 2MA3A 1XG1A 4ZZDA 5BPDA 3E5UA 3HKZN 2EFQA 3EUKL 2AHQA 2OBPA 3H5AA 2KDZA 2FQ3A 3FXRA 3C3WA 1MMGA 5F08A 2GQQA 4RAFA 3ROUA 3OYMA 4I99C 3HIFA 5LHGA 3J80K 2VBXA 2CQNA 1V5GA 4U88A 1RIOH 2DN0A 3RCOA 4AIHA 3DU5A 1JUPA 3CCEI 2Y30A 2W25A 5CQEA 4ZC3A 4F93B 2A6EF 2GZWA 1UHWA 2LBFA 4ENJA 1EJ9A 5H6QA 2K02A 2O8KA 1GV5A 2R7QA 3ZRGA 4L5EA 1QPMA 2KIUA 4ZTFA 4QPOA 3ERED 1FOKA 2R7XA 1R1UA 2X1DA 1BN5A 2R5ZA 3RYRA 1TTYA 2FUG2 3ZQFA 5DV5A 1W1WE 3DEWA 2CFXA 5ICGA 3QP5A 4I76A 3HSRA 1XMAA 3G1MA 5D8KB 1U8BA 4YIIA 2W84A 3VSLA 1A6QA 2NXNB 2LYCA 2CQKA 3LFUA 4ENMA 2W7NA 3GTKJ 1FT9A 2DA2A 2EZLA 3K2AA 1RUOA 3HSFA 4EGYA 1K4SA 3KYDB 4XL9A 4BXXJ 1Z7UA 2P7VB 4A3FJ 2EV6A 3WE3A 3OYDA 5D5WB 1OCOH 3IH3A 2L02A 4CCNA 3BR2A 1S8NA 4RAGA 3ZOBA 1ZRFA 3FXUA 3D0SA 4H0EA 1XSVA 2OUMA 4RB3C 5BOXA 2BY3A 2E2IJ 2KRHA 5ERIA 4LG0B 4RGXA 3TMOA 1U9OA 4Q47A 5DS9A 4Y17A 5AIQA 3WTSC 3H3VK 2HDDA 2M7AA 4RAZA 3MZYA 1RR7A 3HG9A 2RN7A 1REPC 1HOMA 3K6GA 5H20A 2F5VA 2TRTA 1UELB 3RKYA 2PI0A 4GYGA 3RYPA 1SAXA 1PJRA 4XKCA 2M7BA 3ZQGA 1FX7A 2XV4S 2Z33A 2IA1A 4DYQA 4OAYA 1SMTA 3BTJA 1DGRM 3B73A 3BPVA 1G6NA 2NVUB 3S1NJ 2E2JJ 2KIQA 2YU9J 3KEOA 2LF8A 4NUBA 2HVSA 3WGGA 1IAWA 3B02A 2QBYB 1MMDA 3E1SA 4BQOA 1YJ9I 1DU0A 2JA8J 3PUBA 1TLHB 4M9XA 4IRHA 2DOAA 2M1BA 1SAUA 1TT5B 3DF8A 5CVJA 2HOTA 1BI3A 2NNNA 4M3FA 4V19K 1FMVA 2XAQA 1KGSA 1AKHA 5HNHA 3F8FA 1BIAA 1A6IA 3HYIA 1XPXA 2WAFA 3B6CA 2D1VA 1I39A 3KP6A 4HSRA 3VB2A 4CICA 3B6AA 4DYRA 4GXOA 5LGTA 2ELKA 2DYSH 2RC4A 3KETA 1OISA 3KCCA 3V7CA 1I1GA 4U7DA 1YYVA 4A69C 3TO7A 2JA5J 1QPIA 5FKNA 4ESFA 2VJ5A 5JLXA 1YX3A 2MSYA 2QQBA 2ECBA 1MIJA 3SDBA 5K1YA 2L7MP 2F4OB 2B9SA 1FWZA 4C2UA 1NK3P 5GAHJ 1WHUA 4F92B 3L9FA 2LY9A 1I27A 1LDDA 2JT1A 2V6CA 3KPHA 4L9NA 3ABTA 1BBYA 4W1UA 1O7LA 3RPUD 4KDPA 4F3QA 2VJJA 3GFLA 3JTGA 5ICCA 1Z67A 1IG7A 2VXZA 5E3NA 3DEUA 2DK8A 3DXJF 1I3AA 1ENHA 3CJNA 2OC6A 4M6YA 1HSTA 1IRXA 2ICWG 1KQ8A 1EH6A 5EG0A 4C9YA 3IAS2 2PQ8A 2LF7A 2RQQA 3AL0B 3OSFA 2H8WA 2LP0A 1SD5A 5E3OA 3A01A 1N77A 1FOXA 3KP4A 5LEKA 3R6SA 1XX5A 2HOAA 2F6CA 3A0HC 4HX7A 2DK5A 3AFHA 1J9IA 3S15J 4P9FA 2ELJA 4B3AA 2Y9ZA 4MO7A 3QRFF 3IWFA 2PBIA 5FO5A 2XPVA 4CCOA 2Y75A 4FCYA 2XUBA 1S7EA 3KIOA 4DBRA 1ZGWA 2PJPA 4E7HA 4UXNA 2M34A 3HRTA 1QA6A 1ZQ3P 1DDNA 1O7FA 1UHSA 3U21A 2HOEA 1IRGA 3HRUA 4A3BJ 3FHZA 1IC8A 1P7IA 2LBFB 2VE8A 3RIRA 3R60A 4DNCA 4WX9A 4PFPA 4JOMA 4OIOF 4KNYA 2VOOA 2R7TA 5B66C 1PUEE 4CA0A 3E97A 2GAUA 3H5NA 4EJTA 1ZTRA 1T38A 3U1DA 1OFCX 2HPMA 1MSFC 1GXQA 2EH3A 1XDSA 4RGRA 1LDJA 1WI9A 2WC2A 3MZHA 2O6GE 2ZKZA 5EZGA 3E6DA 1RKWA 5ICFA 1GUUA 3EYIA 5FGMA 2VT3A 1HKSA 1EA3A 2K3FA 2V26A 1AHDP 5EGOA 4D1QA 3R4KA 2LKPA 3WHCA 2QF7A 3SEZA 3DBHB 1TQPA 3BCAA 3H92A 4BKXA 3L2CA 1G4DA 4BH9A 4E7KA 3CTAA 1ORKA 4M3EA 3U9GA 4KYWA 3ESWB 2BY0A 9ANTA 5HDNA 3IRQA 4XKVA 1WQ2A 1HXDA 2LK2A 4A93J 2DXIA 4O5VA 2MD5A 4XONA 4A3JJ 2FE3A 1V55H 1Z77A 4BAYA 3M3YJ 1GVDA 2HQ5A 3FK7A 3S8PA 4BE0A 1E3HA 4J19A 3CZ6A 5K5OA 1LEBA 2DDBA 2DA3A 3FDYA 3DPTA 4QLCU 2R7FA 4IX7A 1I1SA 3A4CA 3MN2A 5BS6A 2KZVA 2X1CA 4NC6A 2LC2A 3C7JA 1ULYA 3REOA 2M30A 3NEUA 4PSXA 2EJRA 4XORA 3AKZA 2I5UA 2JMWA 2X6YA 4XICA 2VASA 1A04A 1ON2A 2E1CA 2Z5UA 5CVRA 3ABUA 1QU3A 4G7HF 1BC7C 3GWZA 4AU7A 3I9V2 4MFDA 4WXCA 5KAIC 1XCBA 2EFOA 1JKOC 2ZO4A 3P9KA 3BPXA 4Z2YA 4CYCA 1APLC 4MGRA 4PDKA 1ZR2A 4A3GJ 1YOVB 4G6QA 1WPKA 2RDPA 1R36A 1J09A 3CDLA 3OIQA 5K7ZA 2HOSA 3BROA 4U0WA 1JI8A 2NNYA 3I71A 1SANA 4CCKA 1Z3YA 4MFEA 1Z0XA 3G1OA 3CCUI 2HPIA 1H9GA 1CGPA 3CCSI 5D6EA 2F2EA 1BIBA 2DI3A 5FLMJ 5FD6A 1AKHB 3MKZA 4I02A 2OU2A 1IXSB 2QSFX 3Q9SA 1R5ID 1QZZA 3CMAI 1KYWA 5FKKA 1JXSA 4PZJA 2XSJC 2TCTA 2O7OA 1W7PA 1FTZA 3CCYA 3LSTA 3ERMA 2CFOA 3SFZA 3M8EA 2M8GX 5HNFA 1LEAA 1J5YA 2FU4A 2NS0A 2W57A 1YW9A 5FKLA 1W5SA 2Y0MA 4DYCA 3IH2A 2EZHA 3OYNA 3G71I 4M9SA 2M2EA 4M3BA 2V1UA 1VQ5I 3P9CA 4D5FA 5HVQC 2FBIA 2ZXWH 1OYIA 4XQFA 2EV0A 4W97A 3TDZC 4JP0A 4L9JA 4LD5A 5IYBJ 1XMXA 5CYVA 4TV7A 3H35A 2YSRA 4II3A 2EQRA 4AVZA 1IO2A 1RRJA 1HBXG 1DQUA 3J80Z 1TWFJ 4BGDA 2O5RA 1T33A 3F9KA 1M1EB 5IT9K 1TL8A 3HXLA 1XGOA 2ESNA 5EG0B 4UNOA 3HC7A 1ZELA 1R00A 1P2FA 4JK1X 3GVAA 2PMHA 3A01B 3K4BA 5ILSA 2JVGA 1L0OC 1NG6A 1Y8RB 3CJTB 1X2NA 3NARA 4R79A 3CJRB 2XGCA 5HLGA 1D8JA 2KP6A 2K7LA 3E5QA 4PJMA 1PP7U 4XOPA 2P5KA 1ETWA 1FY7A 2EIMH 2WBMA 4B1RA 1BC8C 3S1RJ 2BHZA 3S2HJ 2H09A 3ECHA 1LJ9A 5E1ZB 2CW7A 3OS0A 4NQWA 2JN6A 2ZXIA 4U0VA 2Q8KA 2VE9A 4EJWA 3BJ6A 3ABLH 1QZYA 1XD7A 4HAMA 2DMTA 2OCEA 3IC7A 4HNUA 2ZNZA 2EZKA 1IRZA 2BGCA 2XAHA 4B4CA 3KEYA 1YW8A 2NVQJ 1R6RA 2VB6A 4M73A 4QSHA 3I59A 2F48A 3BR1A 3M8JA 3OV8A 3W6JB 1NHAA 2K4JA 1WI3A 1BM9A 2X1EA 5H6RA 4XIDA 3CESA 2XAUA 1IN7A 3DEEA 3H5RA 4Q48A 2RREA 3FK6A 1FYKA 3S2WA 1U3EM 2QENA 4WWCA 4IHWA 3G1LA 4OAZA 3ULQB 3TW6A 3V7SA 1C0WA 3G3ZA 3W6KB 2KL4A 1OCRH 1ODDA 4JYKA 5EGOB 2E2HJ 5HLTA 1T0FA 1MBHA 4CCJA 4P55A 1E2XA 3P5JA 2V7FA 4HZFA 1X1PA 1HW5A 5HODA 1ZAOA 2DDAA 3KZYA 2XHKA 1RR8C 4EVIA 2DA6A 2CS3A 2KT0A 4RA2A 5JHUA 2E36A 1H88C 1HSJA 2VKEA 3QYEA 1L3LA 4RGUA 2BVMA 2WV0A 1VZ0A 1G3SA 2FX0A 3HL2A 1WJFA 2GXGA 2HWVA 2IA0A 2A5WA 3RQ4A 3UKGA 1ZLJA 5D4RA 1EV7A 1GT0C 3GFMA 4II2A 2O3FA 2XB5A 4Y13A 1Y8QB 2DOEA 2JRMA 1N25A 2OAZA 3ZXSA 1R58A 1Z7LA 2X6WA 2XRNA 5E20A 2H1LA 2JPCA 1HCRA 3EUHC 1TWGJ 4M6XA 2Q2EA 2JUCA 3PFIA 3QPLA 2D5VA 2ZMEC 2DJIA 5C3EJ 5LBQA 1RESA 4IKFA 3IKVA 3HRMA 2CV0A 2EK5A 3NWSA 2M0CA 2VPRA 3JRBA 1J0RA 2J5OA 2H1KA 2FJ1A 3OYGA 3GTLJ 1LVKA 2CUJA 2XF6A 2B0LA 2HS5A 3A1YA 1D1AA 5HLHA 1UB9A 2A6HF 2NS7A 5B5EC 4NNJA 5IYDJ 1NK2P 4KUMA 5B1AH 4CYCB 2DFFA 4C3IJ 1MBGA 1WRJA 5M5XJ 3KLOA 2NYXA 3H0DA 3S32A 2WADA 4N9IA 1VQ8I 2P6TA 3HHGA 4XR6A 4BXUA 1F36A 1G3TA 1XDUA 4AC0A 3N4MA 1JE8A 2DFIA 4UUSA 1NH3A 3I5UA 3EYYA 4MTEA 2R7ZJ 3DKWA 2DFHA 2KRFA 2V1NA 3SXYA 2IS4A 2V9KA 3VFZA 2DYRH 1WFXA 1SVOA 1XGSA 1CQTA 2D1HA 4IL6C 4MQVA 1K79A 2YU3A 4PUSA 1W7PB 2KJBA 3GTPJ 2FNAA 3GW2A 2QKLB 3CCVI 5L3CA 3W6VA 1KU7A 1DUXC 1JTXA 1R22A 3CLQA 4OWRB 4RBOA 2AXLA 3SEQA 5M5YJ 4EM0B 1SD4A 4CCLA 1MMAA 1IV8A 2L2OA 3CO6C 3CP2A 3AL0C 1XN7A 4A3LJ 1USSA 4M74A 2E1OA 3KP3A 5D8LB 4UV8A 1MGTA 2DA7A 1YS6A 4MHGA 2STTA 5EF6A 3P7NA 1S9HA 3DWLE 1O57A 3ASNH 1WJDA 3Q0UA 4ZTJA 2COMA 1UG2A 4NC8A 2C6YA 4FQGA 1U5TC 1QVTA 4IHXA 5ILUA 3E3VA 3RZOJ 4QWQA 3CUQA 2F4MB 3TBIA 4KITB 2HKOA 3MMYB 4IHSA 1ZRDA 2A6TA 4LG3A 4XKWA 2Z1DA 1K6YA 3CLOA 1VQ4I 1P9QC 3VYRB 2IS1A 3VWBA 1V5FA 1LFBA 1S3JA 2XASA 2JA7J 4EM1A 2HDCA 1D1BA 5KCMA 5L3GA 4CSWA 3BG9A 3VDXA 2ISZA 2LOOA 4XBFA 4C3HJ 3F23A 3MQ0A 2M4KA 1UG0A 2ID6A 2XSDC 1WWXA 2BW3A 2CYYA 2K40A 1ZGJA 1YJNI 2HYFA 2I8DA 2MGQA 1U9NA 2V4JC 4UVCA 2ZBKA 3JW4A 3RPUA 3OWTA 4XOTA 4HDVA 3JRHA 3MEXA 2QYOA 3N05A 2IVMA 4XRMA 3K1NA 1NTCA 4BE1A 5HLIA 5DYMA 5FFXA 1GLNA 1PYVA 1P6RA 2FMYA 3F8NA 4ZZLA 2L5QA 1IN5A 4NQWB 1JUSA 2K85A 4AUXA 3HPHA 4N4OB 2Y69H 2KIMA 4KT6A 3DTIA 5DCMA 5ICEA 3LSRA 4E7JA 3WHBA 1X1BA 3C18A 4UB8C 4PFOA 3QQAA 3JRFA 1IDZA 1F1ZA 2RGVA 3GTOJ 3FMSA 5LGNA 1B6AA 3TQNA 2FOWA 3I59B 1R5GA 3PSFA 2PMZN 3F21A 2QZ8A 4Y3OA 3J7AO 1HA8A 1AU7A 3KYCB 1BR2A 1QQIA 3V7RA 3W2VA 1DP7P 2LH9A 1TBXA 4IQ4A 1MMSA 1IXRC 2RNJA 2BYVE 3BTIA 3JRGA 4A6DA 1KU3A 1ZKGA 1X1AA 3K1MA 2M8EA 2BY1A 1FZPB 1IN8A 1UMQA 4MEYF 1P7JA 4XRFA 4IRGA 3KP7A 1LE8A 4BBSJ 3FXKA 1TP4A 1IF1A 4RGSA 2QWWA 4AIKA 2DMNA 2JSCA 2CWEA 2VOPA 4V2FA 4WXHA 2CO5A 3JRAA 3KP2A 2W1OA 2OPTA 3VPRA 1B8IB 4IVNA 4CZZA 3PIPF 2FQ4A 3CMEI 3ZMVA 3K70C 2E1NA 4YFXF 5L3BA 4HQMA 3P9IA 3SZGA 3WU2C 4CHUA 2XGXA 1R7JA 2VPLA 1WJEA 5LHIA 1YHQI 2XAFA 1IGNA 2Q2EB 2A69F 1V5EA 3BJAA 3BZKA 3HOZJ 1Y1VJ 2R3SA 1R49A 5KHDA 3NRVA 1KU2A 1JUMA 2Y31A 2H6BA 3HB9A 2DPDA 4PJJA 3JREA 3G2BA 5M3FJ 4ZYGA 2ME0A 2M3AA 1FP2A 3OIPA 2OZ6A 1D5VA 3OMYA 5FLXK 4L9VA 5DCFA 4UVBA 1R71A 2LMDA 4CGZA 2MD0A 3IH4A 4A3EJ 1ZK8A 1D1CA 1QHHD 3BQZA 3PQKA 5DM6F 1IN4A 3FKIJ 2CV1A 2PX9A 5DUIA 4Z6YA 4UUSB 1N75A 1T2KA 2IRFG 4RM3A 1TW2A 5FRMA 1RUNA 2NVXJ 2VKHA 1QRYA 3K4KA 5IOZA 2G7UA 2P81A 3QPTA 3OYBA 4IOCF 2WY8Q 3K9TA 3KYLA 2MH2A 2K9MA 1LNWA 4KMUX 3BP8A 5IT9Z 3FXOA 2K27A 2OCCH 4D9JA 3MWMA 3HEFA 4XLHA 3GTMJ 4UUVA 4XLPF 4HPQA 4MLOA 3ZMDA 4FE4A 3HOYJ 1U2WA 2CQQA 4S05A 2FBHA 2JRTA 2K4BA 1I50J 2VBYA 1P92A 1FSEA 1MJ9A 2HZTA 2RV8A 4HF0A 5EEHA 3F0CA 5B1BH 3GYHX 1SC7A 3IUOA 1FYMA 1OCTC 1BW5A 4I2OA 5JI6A 4CUGA 5DM7F 1BI1A 5E17F 2ME6A 1BW6A 1HKQA 1RZ4A 1H0MA 1G8XA 3E6CC 2QSHX 4LK1F 2LD5A 2GIVA 4EV0A 5HS7A 2AXTC 4RLQA 4FX4A 1IXCA 2IEKA 1S7OA 2ZC2A 3CUQB 2AQFA 3OL4A 2GA1A 5DDGA 4GDFA 3LSHA 1MNMC 1H89C 4LK0F 4F91B 5J47A 4BQAA 4R1HA 3CMMA 4PGHA 3KE2A 3RJPA 4L5IA 4J00A 3L2RA 4BEHA 2E1MB 4XLEA 5TJJA 4C2MJ 3ZQ7A 1BL0A 4LLNA 2XB0X 4B44A 1GVJA 2HQAA 2VBWA 3LSMA 5J6XA 4HNTA 2CGPA 1FBSA 4IRIA 2BW3B 3K10A 2CW8A 4GO1A 1ZARA 4LJZF 3ECOA 4CH7A 2LSOA 3ZN0A 3OYKA 1SD7A 4IXAA 3L2VA 3ISPA 3EUAA 3J7ZI 2P0WA 3ZQLA 1HLVA 4LLGF 4IF4A 4DZJA 2W82A 1OQYA 1G3WA 3U1KA 1HQCA 3E5XA 3FXQA 2OQGA 4FETA 1R23A 1TWCJ 2KJCA 3TEDA 1X1DA 2VL8A 2R5ZB 2OJED 5FFZA 4BNCA 2UXXA 3SQNA 4GCVA 4OIQF 5CVVA 2VKDA 3LA7A 4B8XA 3G73A 3HPGA 1UFMA 2ELHA 4BHPA 1YIOA 2LFBA 4A0XA 4XSZF 4D5CA 1TC3C 2EFNA 2MFZA 3CDHA 3FMRA 5L3FA 2L9VA 1FP1D 2HGCA 1SFKA 1X4OA 2BBYA 1CF7A 1Z6RA 1T95A 3BQYA 4LFUA 5D5UB 3FM5A 2H94A 3WTZA 1WJAA 5M5WJ 1ZG5A 2EPFA 3K4CA 5IT3A 5FRNA 3CC4I 3ZMUA 1LE8B 2VBZA 3EDPA 1FOWA 1X58A 2DTRA 3AG2H 4Y52J 1YG2A 3QWLA 2DA4A 2IP2A 2JZYA 3RQIA 3AG3H 2V9VA 3K2ZA 4KFCA 4IPAA 1NG7A 1SVMA 3V4GA 3K70D 3GTGJ 3SZPA 4DZPA 1X2MA 1Z21A 3F72A 3PQJA 2GWRA 5EEGA 1ZYRF 2B63J 4BQNA 4S0HB 2BY2A 1JGSA 4XSXF 2DPUA 2ISYA 3FMQA 5DTDA 3DBRB 4RS8A 3ZQHA 2DLLA 1YX5A 3EETA 1ZR4A 5C44J 3FZVA 3J7YJ 3DQVC 1FSHA 2QLZA 3S93A 1PDNC 3O8HA 4BQQA 5E18F 1FBUA 5HS8A 2L9SA 3S2DJ 4G7ZF 4RB0A 3GEZA 1YITI 1Q1VA 3FKJA 1LFUP 4LMYA 4L9TA 1TQMA 2IS6A 3OR2C 2E5NA 1A36A 1POGA 4ESJA 3S14J 1A35A 3ZQIA 2VKVA 2QA4I 2Z3YA 2QQ9A 5CVUA 1SEUA 5HDGA 2F5CA 1W0TA 4OU0A 2ZCWA 5EEAA 3R0AA 2VQCA 3K4JA 4BHCA 1J59A 4BYYA 1EF4A 2IA2A 2E60A 3WG9A 2KHMA 3PO3J 1LFPA 2HXIA 2ZNYA 3LFKA 1W0UA 3RSNA 4CZCA 2DW4A 1RETA 2EIKH 3A0BC 1W4MA 3LSJA 1FNNA 4HV6A 2AS5F 2HKXA 5AONA 3MAJA 1ZREA 2K86A 3M8FA 5J8FA 5M3MJ 1IW7F 1WH7A 3CCRI 2QGUA 1OPCA 4XN3A 2X9DA 3IP4B 1X3WB 4HEA2 4FISA 5TRDA 2DQLA 4ZJZA 2LDUA 4A3MJ 2CRGA 4LITA 5LRSA 2A07F 4GYIA 2LY2A 2WTEA 3TL4X 2KISA 1K4TA 2A61A 3ZQQA 4YIRX 2VC0A 3M4OJ 2R7OA 4KISA 1Z1DA 2X6OA 4E4HA 1IV6A 2HR3A 2QKMB 3QYBA 4BY1J 3GTQJ 1IZ1A 2QSGX 2VJIA 4HQEA 3IWZA 2CMPA 1TT0A 5J3LA 1AA7A 1MBFA 1IDYA 3BR6A 1GHCA 2WWYA 2UZKA 1ZG3A 3EPZA 4PJ0C 5KVRA 2M0MA 3CJQB 3H0GJ 4DIQA 5J4YA 1VTNC 1F43A 3L09A 3CC2I 2PJRA 1MW7A 3L00A 4ZDPA 3K1PA 3O3KA 1GDTA 4IJAA 1FMWA 4G6TB 3O2PE 2ZSIB 2H6CA 2CUFA 4L5JA 1KQ9A 5EDNA 2MC3A 4BEHB 1D0XA 1S72I 1R9TJ 2BOLA 5LLQA 4GGGA 2X85A 2ECCA 4B3XA 1BJAA 1TZLA 1X4PA 2BZTA 4RM2A 3VODA 3LSKA 3SZTA 2IT0A 1WZ2A 1BI2A 6PAXA 3BT9A 3FIWA 2TDXA 2XPWA 3DKYA 2YPRA 1X1CA 4NB5A 5GP9A 3HOUJ 2IW5A 2A5YB 3QPHA 2WY7Q 1N78A 4I7HA 5BPIA 2V9PA 5CJ9A 3OYCA 4BJ5C 1V3FA 3R61A 4FT8A 4G12A 3TOBA 2LLKA 3GLLA 3PUFA 5IOYA 2IGOA 3I55I 5K5RA 1OR7C 2L9NA 3HGYA 1T0FC 3BDDA 4IZZA 2EFWA 2JUGA 5D4SA 3OYLA 1TWAJ 2P5LC 2XGEA 2HQNA 2R5YA 1MZBA 4LOCA 4BE2A 4IHTA 3S17J 1VQ9I 2Z9OA 2R92J 3CD6I 3GZ6A 3FF5A 3NQOA 3VOEA 4M9ZA 1OJLA 1T39A 5E8IA 3IRRA 2DMPA 5GAGJ 1FJLA 1CF7B 2RVCA 3NAUA 1YE9A 1MNDA 2F4IA 3QAHA 5JVTA 2CUEA 3WTWC 1P4XA 4KN7X 3ZP5A 2DJNA 2LREA 2IJLA 2NS8A 2HU9A 5EYRA 3A2KA 3BG7A 2P5VA 2DOFA 3BR5A 2F5DA 4A3IJ 2KPMA 4EJVA 2L3DA 2LNBA 3GCMA 5FLXZ 1JKQC 3V8KA 4YRVA 2IGMA 4RMNA 2O61A 4HOBA 3F8BA 2LKXA 3CMYA 1BA5A 2EWNA 4E70A 2KMUA 1QNTA 2QUFA 2PG4A 1F4KA 3OYHA 1DGWY 1VQNI 4Q4ZF 2HNHA 2M9HA 2STWA 1VQOI 4LG0A 1WGXA 4I6ZA 4B47A 1RPWA 3BG6A 1SVLA 1KQ0A 1I6HJ 1OCZH 4ZYEA 5JHFA 4BDYA 5F1JA 2NVTJ 3BZCA 5E79C 4L0YB 2R4GA 3S1QJ 2MG4A 4KJZA 3DP7A 1ERDA 3JRDA 1YTYA 1FOYA 3AG1H 4FE7A 2HQRA 1A5JA 3NWTA 3ONQA 4HRIA 1VQKI 2WB1N 4PSWA 3ZN1A 3I54A 2DFEA 3S3OA 3OR1C 3ABKH 4X1EA 1PVEA 1JTYA 1V4RA 2FSWA 4E7LA 2GXBA 3JCUC 4O6JA 2GM4A 3I3LA 3PO2J 4FTHA 1MKMA 4G94A 1UAAA 3W2AA 2V1XA 4UB6C 2XKOA 3C2GA 1TNTA 1EH7A 3O6BB 2OD5A 3BLYA 1I5ZA 3VSKA 1WJCA 3EUHA 5F0HA 1JT0A 5HDKA 2ZMEA 4LGWA 3V42A 1TNSA 1ZLKA 3U2RA 4ESBA 4NHJA 1K7AA 2XRLA 4LLLA 3IHUA 2RKHA 4I0AA 1IN6A 3GBGA 2DA1A 5J1YA 2HYGD 2KZGA 1K78A 1G3YA 3JTHA 2ZJQF 5DD4A 2UV1A 3HOWJ 2A05A 3VYUB 2BV6A 2JPBA 2HZDA 4UY8I 3WG7H 5FB2A 3QPSA 3E0JB 3DKXA 2XIGA 3MVPA 2ZJ2A 4XK4A 1O3QA 1B4AA 1D0YA 3QU3A 5CPRB 4CYDA 2CV2A 1Q1HA 4ASNA 1P4WA 2X48A 1XMKA 1FC3A 2UXNA 3IKTA 1LVAA 5F64A 1MH4A 2WAQN 2XAJA 5FJ8J 3C1DA 3H9GA 2BXYA 4YELA 2BEOA 3F6VA 4O3MA 2HXOA 2KFDA 2XGDA 3J7AY 2ACJA 2GA2A 4UHTA 1OYYA 3OYJA 2PJRB 3ZPLA 4BJTA 4IEJA 5GADJ 2L01A 2MLKA 2MYSA 2FF4A 2Z99A 3LSIA 2BXZA 3VEPA 4OINF 1W5TA 2FNPA 2FA5A 2VXDA 5DUKA 5L3EA 1PUFA 5F27A 1FBQA 2N8GA 4YEJA 2OZUA 2HTSA 3BG5A 4JX6A 2ESHA 2VLAA 4X6AJ 3DPLC 3PNYA 3WTYC 1VQ6I 3H9JA 5FLVA 3LL7A 1XSDA 4HA8A 2CJJA 2PN6A 2Y9YA 1U6GA 4U87A 5IP9J 5J1RA 2DQRA 2PMZA
chains in the Genus database with same CATH topology
3S3MA 3IUOA 2KQRA 2VQHA 1J09A 3OIQA 3K4NA 3FHNA 4CUGA 3OYFA 2ZXHA 1JI8A 4CCKA 1Z3YA 4LIVA 1X19A 2JVHA 1G8XA 3CF2A 3S3NA 4RLFA 2WB1A 1Z3XA 3OL3A 2HPIA 2LY1A 4RLQA 4FASD 3L2WA 4XMYA 2AQFA 3OL4A 3OYEA 3MKZA 3LSHA 4BL0B 2ZFUA 4F91B 1LDKB 3CMMA 2XSJC 4BJ6C 3FBIB 4ANJA 1WJBA 2KDOA 3L2RA 4DOZA 4J00A 2KLOA 4BEHA 2E1MB 4XLEA 1W36D 2CFOA 2Q1ZB 4B44A 5HNFA 2HQAA 3LSMA 4HNTA 2BVLA 4ZYAA 4XNFA 2BW3B 3K10A 3QOEA 2CW8A 3OYNA 2R7SA 4CH7A 4B48A 3OYKA 3L2VA 5HVQC 3EUAA 4GRIA 2P0WA 3KX2A 2V6EA 2GOMA 4IQJA 3C2HA 4XQFA 4BU2A 1MNEA 2XDVA 2W82A 3OS1A 4BDZA 3W3CA 4U7BA 3H35A 4II3A 4AVZA 4E7ZA 1DP3A 1DQUA 2WA0A 4FETA 3LMMA 3PNVA 4BGDA 2AQEA 2O5RA 1X1DA 3F9KA 3VYTB 2VL8A 2UUZA 3HXLA 5LFAA 2VQLA 3HC7A 1ZELA 2R7WA 2VKDA 3PL8A 3HOSA 2WAQA 3HPGA 3ZGKA 2X6XA 3K4BA 2R7UA 2MFZA 2JVGA 1NG6A 3W2WA 4R79A 1SFKA 1X4OA 3CJRB 2XF5A 2KP6A 1T95A 3OYAA 2E1MC 4PJMA 4XOPA 4F55A 1WJAA 3K4CA 5FRNA 2K9LA 2DT7B 2WBMA 2ZSHB 1D0ZA 2Z16A 3BCBA 3BC8A 3L2QA 1BR1A 2CW7A 3OS0A 2IGKA 2ZXIA 3UR3C 2Z2SB 4BUPA 1NG7A 4C2TA 3K4LA 3K70D 2E5ZA 2L7KA 1Z21A 4N4NB 2KRCA 4HNUA 4BQNA 2VJ4A 2UWMA 3OY9A 3HKZA 3KEYA 4BACA 1MMNA 1R6RA 2VB6A 2R7RA 3PFYA 2IS2A 1YX5A 3K4MA 5CQGA 3M8JA 4DJAA 2NOJB 2JSPA 3DQVC 2JA2A 2X1EA 2WAEA 3S93A 1G59A 4BQQA 3CESA 2XAUA 3H5RA 3DEEA 2HVQA 2RREA 2L9SA 2MABA 4OAZA 2IXSA 3FKJA 3PNTA 2IS6A 4AYBA 1Y6IA 2E5NA 3OR2C 3EUKL 2KL4A 3H5AA 2DT6A 5HLTA 4J01A 1MMGA 4CCJA 3PSIA 2V7FA 3OYMA 2VQCA 3K4JA 3MKWB 1V5GA 2CS3A 3RCOA 3DU5A 2CH0A 3DU6A 2E60A 2KHMA 3M1CA 3QYEA 1LFPA 2BVMA 1VZ0A 5CQEA 4ZC3A 3RSNA 4CZCA 4F93B 3OS2A 3HL2A 1WJFA 3RQ4A 2A5WA 2LBFA 4II2A 2R7QA 3ZRGA 4ZTFA 4QPOA 4P1WA 2R7XA 2MC4A 2X1DA 3ZXSA 4XN3A 2X6WA 1Z7LA 3IP4B 2FUG2 3EUHC 4HEA2 4ZJZA 5FROA 1BOBA 2DJIA 3MKYB 2OV7A 4IKFA 4LITA 2CV0A 3VSLA 3NWSA 2LYCA 3LFUA 3UNGC 2W7NA 2LY2A 3TL4X 3OYGA 1LVKA 2CUJA 2XF6A 3ZQQA 3A1YA 1D1AA 1Y56A 2R7OA 4KISA 4BXFA 4NNJA 4XL9A 4E4HA 2QKMB 3QYBA 4B43A 2LG4A 2VJIA 2WADA 3S32A 3H0DA 2XC7A 1KONA 1TT0A 2CMPA 4XR6A 1AA7A 3OYDA 1OLTA 3EPZA 5HOOA 4CCNA 2M0MA 4HG2A 2OUMA 3CJQB 2W4SA 2V1NA 2KRHA 4DIQA 2IS4A 3TMOA 2XF7A 2PJRA 1MW7A 4NC7A 2V9KA 4ZDPA 1WFXA 2K5CA 4XKBA 1FMWA 2M7AA 4G6TB 4LIUA 5TGTA 4Y33A 3HUGB 2ZSIB 4PUSA 3OYIA 3HG9A 4BEHB 1QHGA 3K6GA 1D0XA 2BOLA 2F5VA 2QKLB 1UELB 2X85A 4B3XA 1TZLA 1PJRA 1X4PA 4RM2A 2M7BA 4XKCA 3LSKA 4OAYA 4OWRB 1DGRM 3DKYA 3SEQA 1X1CA 4PJLA 1MMAA 2L2OA 2WY7Q 3CP8A 3CP2A 4CCLA 3AL0C 1N78A 2LRDA 3ZCOA 4NUBA 2M4GA 2HVSA 2RNGA 3SYTA 3OYCA 4BJ5C 4E7SA 1MMDA 3E1SA 4BQOA 1S9HA 3PUBA 3DWLE 1WJDA 2DOAA 4XM3A 4ZTJA 1SAUA 4NC8A 2IGOA 1OR7C 2L9NA 1T0FC 3TBIA 4KITB 1FMVA 3MMYB 2VIXA 2JUGA 3OYLA 4IZZA 2A6TA 4LG3A 4XKWA 2Z1DA 3LSGA 1K6YA 5HNHA 4ZDLA 4BE2A 1P9QC 3VYRB 2IS1A 3VWBA 1V5FA 2WAFA 4HSRA 4ZDOA 4DBQA 1D1BA 5KCMA 4CSWA 3VDXA 4H4KC 3ZR8X 2LOOA 1W36C 2M4KA 1UG0A 2BW3A 3IAM2 2VJ5A 1YE9A 1MNDA 1YX3A 2F4IA 2I8DA 3SDBA 4C2UA 2V4JC 4F92B 4DGWB 3OWTA 2LREA 4XOTA 2HU9A 3A2KA 3BG7A 3N05A 2KPMA 4BE1A 3RPUD 4F3QA 2VJJA 4XLAA 4YRVA 1GLNA 1PYVA 4HSTA 4X0GA 2IGMA 2L5QA 4NQWB 4RMNA 2VXZA 3HPHA 4N4OB 4KT6A 3DTIA 2KMUA 4E7JA 4QPQA 2OC6A 1IRXA 3OYHA 1X1BA 4C30A 1DGWY 3QYFA 4PFOA 2HNHA 4E7IA 2DCEA 4C9YA 3IAS2 2GOXB 2RQQA 3PSFA 2HVRA 3AL0B 4B47A 3L2UA 4Y3OA 1HA8A 3BG6A 1N77A 1BR2A 4PK4A 5JHFA 4BDYA 3W2VA 2K3PA 2LH9A 2R4GA 4IQ4A 4KJZA 1ERDA 1BR4A 2F6CA 3DTKA 3NWTA 3DPUA 5CKTA 3AFHA 3ONQA 4PJNA 1X1AA 3VYSB 4HRIA 2ELJA 4PSWA 3S3OA 2Y0SA 4CCOA 4ITVA 3OR1C 4XN0A 4E7LA 4DBRA 3PJRA 3MD2A 4E7HA 3I3LA 3QODA 2HDWA 4P5OA 4JQFA 1UAAA 3W2AA 2W1OA 3U21A 1LKXA 4E6KG 4F52A 4XLFA 3C2GA 3D5RC 3D5SC 3BLYA 2LBFB 3VSKA 1WJCA 3K70C 4PFPA 4JOMA 2R7TA 3V42A 4Y4RA 4CA0A 3RTRA 3SZGA 4BS9A 2X51A 3H5NA 2VPLA 1WJEA 2HPMA 1U0JA 3FBNB 2Q2EB 3GBGA 2CUZA 1V5EA 5KHDA 2UV1A 4CCMA 3VYUB 2VQGA 4PJJA 3G2BA 2HZDA 2M3AA 3OIPA 2W00A 1EA3A 2V26A 3OMYA 3E0JB 3DKXA 4D1QA 2MD0A 1D0YA 5CPRB 3SEZA 2CV2A 3BCAA 1D1CA 1QHHD 4E7KA 2CV1A 4YELA 3H9GA 3HOTA 1E0EA 4XKVA 1N75A 2DXIA 4XONA 4RM3A 3J7AY 5FRMA 3S8PA 4EATA 4BE0A 2VKHA 3CZ6A 3K4KA 3OYJA 2PJRB 3OOUA 4BJTA 3FDYA 3OYBA 3DPTA 4IX7A 2WY8Q 3KYLA 2MYSA 5LD2C 2K9MA 3A4CA 3H9QA 5KNLA 2KZVA 3LSIA 2IGNA 2R7VA 1WJ5A 2X1CA 2LC2A 4D9JA 2VXDA 4XLHA 4XLCA 4PSXA 3AKZA 4HPQA 4XORA 4MLOA 4YEJA 2X6YA 2VASA 2VLAA 3DPLC 3PNYA 1QU3A 3H9JA 3D5LA 3LL7A 4AU7A 3I9V2 3DLAA 3DTEA 4U87A 2PMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQR A;  4ZYA A; 
#chains in the Genus database with same CATH topology
 5GTI C;  3FM3 A;  5BQT A;  3WGH A;  1MBK A;  3KFW X;  2KQR A;  1U5T A;  2VQH A;  4MIM A;  4A5N A;  3OYF A;  2BE5 F;  1X19 A;  2DTZ A;  2EA2 A;  2ADU A;  2O8X A;  5EZH A;  1Z6T A;  1O3R A;  1ACI A;  4RLF A;  1Z3X A;  2DBB A;  2EBI A;  2LY1 A;  1IJW C;  2FD5 A;  4KIF A;  4FAS D;  5LRR A;  1RC9 A;  2ZJR F;  4XMY A;  1YI2 I;  4V2G A;  2X0L A;  3F3X A;  4R8H A;  3OYE A;  3M9A A;  1TWH J;  4NDL A;  3PIO F;  2R5Y B;  1UHM A;  1XSX A;  3Q3S A;  1EKE A;  5A2Q K;  3GF2 A;  3DV8 A;  2OTL I;  4ANJ A;  3HUG A;  3FBI B;  2CU7 A;  2KDO A;  2XRO A;  4RAY A;  1MBJ A;  1I3Q J;  1QZE A;  4EJU A;  4LB6 B;  5TIS C;  4ZYH A;  4LB5 A;  1WKM A;  1ONV A;  2L9R A;  4ZYA A;  3MFK A;  3LAJ A;  4XNF A;  3QOE A;  1Y1W J;  1UCR A;  1K6O A;  1ITY A;  3TGN A;  3DLL F;  2VC1 A;  4EEF G;  2HEO A;  1E17 A;  3WTT C;  4GRI A;  2W85 A;  3E6M A;  3C2H A;  1YRN A;  1B72 A;  1MNE A;  3O8G A;  1ETO A;  3OS1 A;  4BDZ A;  2K9S A;  2XAG A;  3W3C A;  5GPA A;  4JBA A;  4U7B A;  1MH3 A;  1XCV A;  2WA0 A;  2E7X A;  3G4S I;  3LMM A;  3PNV A;  4BHB A;  2AQE A;  1HDP A;  4EGZ A;  1ZH5 A;  3RI4 A;  3VYT B;  1AOY A;  1HDD C;  1MBE A;  5H2F C;  1B1B A;  4ENK A;  5JR3 A;  3S1M J;  1H9T A;  2EV5 A;  2ZXJ A;  1SFE A;  2R7W A;  1YW7 A;  1IUF A;  4Q5S F;  4IOA F;  3HOS A;  3ZGK A;  5B3S H;  3CQZ J;  2X6X A;  1HW1 A;  3BTC A;  1ETK A;  3JAM Z;  2A3S A;  2JK3 A;  3BR0 A;  3Q5F A;  2ID3 A;  2R7U A;  3W2W A;  2G9W A;  4M71 A;  1VFC A;  2NOG A;  3HTS B;  3GXO A;  2K9L A;  5KAF C;  1Y39 A;  2DT7 B;  2LKS A;  4L0Z B;  4UVA A;  2LTP A;  3FIS A;  1D0Z A;  1YQA A;  3BCB A;  3BC8 A;  4QIW N;  4MEX F;  1RNL A;  3I4P A;  3L2Q A;  4HF2 A;  2G7H A;  1BR1 A;  2ZB9 A;  4A3C J;  1D5Y A;  4KIC A;  3M7G A;  1ETV A;  2W24 A;  3UR3 C;  4DW6 A;  2P6S A;  4C2T A;  2E5Z A;  2L7K A;  3L1P A;  1JJ6 C;  2E71 A;  3GO5 A;  3JR9 A;  2VJ4 A;  2L54 A;  3F8M A;  3GZN B;  3GTJ J;  3K69 A;  2UWM A;  2HFH A;  2L7Z A;  2ZME B;  3OY9 A;  2R7R A;  3PFY A;  2IS2 A;  3BOQ A;  5CQG A;  1UZC A;  1E3P A;  2OF7 A;  4P9U A;  4ZH4 F;  2NOJ B;  4WXD A;  2JSP A;  2VON A;  2JA2 A;  5LGU A;  1K83 J;  2WAE A;  1K78 B;  5FKM A;  1LQ1 A;  1VI0 A;  2O0Y A;  1FIP A;  5CVI A;  3LAP A;  5C4J J;  1DPU A;  1XGM A;  4FHT A;  4M3G A;  2I10 A;  2IXS A;  3PNT A;  2FML A;  4QTR A;  4ON0 A;  4AYB A;  1Y6I A;  3CO7 C;  1QGP A;  1BOA A;  2DT6 A;  3K7A J;  4J01 A;  3MCZ A;  3WTX C;  3FX3 A;  2VN2 A;  3PSI A;  3WU1 B;  3I4N J;  4HV5 A;  3MKW B;  1BJZ A;  5F04 A;  1O4X A;  2CH0 A;  2P7C B;  2PFB A;  3DU6 A;  3TO6 A;  2HI3 A;  1Y0U A;  2VUM J;  3M1C A;  3RZD J;  4D7M A;  1FTT A;  1D8K A;  3OS2 A;  3BTL A;  3M1E A;  3J81 K;  1ETY A;  2V79 A;  3FWE A;  4AYB N;  4ZYD A;  4XRS A;  2EB7 A;  3RKQ A;  3HZJ A;  1KA8 A;  2QCO A;  1HC8 A;  1D3Y A;  4P1W A;  3EQL F;  1MD0 A;  2G0E A;  2MC4 A;  3HSE A;  4WF2 A;  1X3Z B;  2P8T A;  1MJB A;  3F8C A;  2JA6 J;  1UJ8 A;  1VND A;  5FRO A;  1BOB A;  4S04 A;  3MKY B;  2OV7 A;  1VF9 A;  1PUF B;  5F1R A;  2ZJP F;  2QVO A;  3UNG C;  2M45 A;  5K7H A;  1YFH A;  4HX8 A;  4DQ2 A;  5JFR A;  2AO9 A;  4A12 A;  2NAZ A;  4Y7N J;  2CG4 A;  1F9N A;  1Y56 A;  2GXA A;  1R5H A;  4KIG A;  1FIA A;  5DEQ A;  3GFI A;  4BXF A;  1T98 A;  3H3Z A;  2K9Q A;  5C4X J;  2ETH A;  4AVP A;  4B43 A;  2LG4 A;  1U5T B;  1R1T A;  2DMU A;  3WE2 A;  2XC7 A;  1KON A;  2MBF A;  3RPQ A;  5DCM B;  1ZRC A;  1O3S A;  1VQ7 I;  1OLT A;  5HOO A;  4HG2 A;  5K7F A;  2IPQ X;  5IP7 J;  3JSO A;  1HW2 A;  2W4S A;  2WV1 A;  4RDU A;  2PLY A;  2Y48 A;  4EQQ A;  2GLO A;  2XF7 A;  4MNU A;  4NC7 A;  1Z9C A;  2CW0 F;  3DBL B;  1YJW I;  3FXJ A;  2K5C A;  3T8T A;  4XKB A;  1TQI A;  4LIU A;  5TGT A;  4Y33 A;  3HUG B;  3WGI A;  3OYI A;  5JLW A;  2BHY A;  1QHG A;  3KZI C;  2JQ7 A;  4AD9 A;  4A5M A;  5AIP A;  2D2W A;  5DD8 A;  2DAO A;  2EIL H;  1OYW A;  3OSG A;  2PEX A;  3LOC A;  5BMZ A;  4YIF A;  3RDI A;  3LNQ A;  1RKT A;  2DA5 A;  4CO8 A;  3JRI A;  4HF1 A;  5IP6 A;  4PJL A;  1DPR A;  3IL2 A;  3CP8 A;  3RKW A;  1A31 A;  5GTH C;  3Q0W A;  2LRD A;  5LHH A;  1XGN A;  2CQ7 A;  3WOD F;  2DOD A;  3GFJ A;  2M4G A;  3ZCO A;  1YRN B;  1B72 B;  3OIO A;  2JJ7 A;  1YS7 A;  2RNG A;  4OMZ A;  1S7A A;  3SYT A;  4AWX B;  4XLN F;  3F22 A;  3ABM H;  3KLN A;  4E7S A;  2MLG A;  2Q0O A;  1U78 A;  5JVG F;  2F5E A;  3GX4 X;  4XM3 A;  5J4V A;  4OIP F;  1T6S A;  5K5Q A;  1ZN2 A;  2VIX A;  3LSG A;  4ZDL A;  2IAI A;  3G6E I;  3A03 A;  4RB1 A;  1FLI A;  5KK1 A;  3HJE A;  3LA3 A;  3LA2 A;  3FXM A;  4ZDO A;  4DBQ A;  3CCJ I;  4FX0 A;  1LUJ B;  3V8J A;  2EA4 A;  4H4K C;  3DCF A;  3ZR8 X;  1W36 C;  2L4A A;  4BY7 J;  3IAM 2;  2MH9 A;  3X2Q H;  4YFN F;  3BWG A;  3HM5 A;  1MDM A;  2NVY J;  4A2U A;  2QEX I;  3N97 A;  2MW8 A;  4DGW B;  5GPC A;  1T8I A;  5LEJ A;  1YLF A;  1IRF A;  4WCG A;  1KU9 A;  4MQ9 F;  3R0J A;  1V54 H;  4XLA A;  4X0G A;  4HST A;  2FXA A;  5CLS A;  3HOV J;  1YIJ I;  3ML6 A;  4AM3 A;  3I56 I;  1F5T A;  3JAM K;  2K9N A;  5HS9 A;  1QO0 D;  5D6F A;  4QPQ A;  3SDG A;  5J1U A;  3WTU C;  1ETQ A;  4JX5 A;  4C30 A;  3QYF A;  3JSP A;  2L0K A;  1RI7 A;  1ZGA A;  1OKR A;  2V1D A;  3CC7 I;  4E7I A;  2JWT A;  2L7F P;  2DCE A;  2GOX B;  3D1N I;  3DFG A;  2HVR A;  2O9L A;  1FEX A;  3L2U A;  3IV5 A;  2Y2Z A;  4ETS A;  4PK4 A;  1SFU A;  4G8X A;  2K3P A;  1BR4 A;  3DTK A;  3LSP A;  2YX7 A;  3DPU A;  5CKT A;  2FEZ A;  4PJN A;  1SFO J;  1JKR C;  3VYS B;  2LVS A;  4YFK F;  1OCC H;  1G2H A;  3BY6 A;  3TKY A;  2D45 A;  4UUT A;  1GV2 A;  1B9M A;  4RB2 C;  2Y0S A;  3TO9 A;  4PGG A;  4ITV A;  2VOD A;  3HDD A;  4XN0 A;  3OOP A;  4I09 A;  5E8G A;  3PJR A;  4U0Y A;  3MD2 A;  3QOD A;  1TW3 A;  2HDW A;  4KN4 X;  5BNG A;  4P5O A;  4JQF A;  5IYC J;  4XRS G;  2PMU A;  4M72 A;  4CDG A;  2NRA C;  1LKX A;  4E6K G;  4F52 A;  3H1C A;  4XLF A;  3CCM I;  3D5R C;  4CXF A;  3D5S C;  3LQQ A;  4KA4 A;  5E1X A;  3CDI A;  4GFB A;  1EH8 A;  4OMY A;  3T8R A;  2W48 A;  2GIZ A;  2Y0S N;  1XS9 A;  5IPA A;  4Y4R A;  3RTR A;  5FKO A;  4BS9 A;  2X51 A;  2YUS A;  2R7D A;  3QOP A;  3WU0 A;  4EM2 A;  1JHH A;  1U0J A;  2QQA A;  3FBN B;  2CUZ A;  1KZH A;  2J5P A;  3ZMS A;  5A2Q Z;  4IHY A;  1OMI A;  5E1W A;  4CCM A;  1K61 A;  2VQG A;  4IHV A;  1E3O C;  2P4W A;  2W00 A;  2RQP A;  5F0C A;  3COA C;  1UST A;  4M6V A;  4ABZ A;  1SMY F;  1ETX A;  1XTA A;  5L3D A;  4Y15 A;  3JRC A;  2QM3 A;  4N9H A;  1MSE C;  2EZI A;  3HBL A;  4HLY A;  1P4A A;  2FBK A;  1E0E A;  3HOT A;  1O3T A;  2CSO A;  1VQL I;  3KP5 A;  3H3U A;  3SJM A;  4JX4 A;  1JJ8 C;  3BG3 A;  2LR8 A;  4EAT A;  3LWF A;  2DO7 A;  3FXL A;  4UV9 A;  2IBD A;  4HDU A;  3OOU A;  5F6F A;  5ED4 A;  3A02 A;  2OA4 A;  3ASO H;  3H36 A;  3AAF A;  5LD2 C;  1LB2 A;  3Q9V A;  3H9Q A;  5KNL A;  1ON1 A;  4I0B A;  2IGN A;  2X4H A;  2R7V A;  1WJ5 A;  1U8R A;  4B09 A;  2VI6 A;  3QU6 A;  4XLC A;  3LQR A;  1S29 A;  2YX4 A;  2XPU A;  2YS9 A;  4D7N A;  1KYZ A;  1WH5 A;  3D5L A;  1ZG1 A;  5IY5 H;  4K2E A;  3HTU A;  2R93 J;  1J7K A;  4C3J J;  3DLA A;  3DTE A;  3HHH A;  1T56 A;  3TW7 A;  3S3M A;  3ELK A;  2COB A;  3K0L A;  4A0Y A;  2CQX A;  4G7O F;  3T0Y A;  2JTV A;  1OR7 A;  3K4N A;  3QP6 A;  3FHN A;  1DU6 A;  2KIF A;  3TP3 A;  2ZXH A;  3TP0 A;  4LIV A;  5F0F A;  4A6E A;  2JVH A;  2H27 A;  1PP8 F;  2EIN H;  3CF2 A;  3S3N A;  5E3L A;  2WB1 A;  5ILV A;  4HNV A;  3OL3 A;  2XKP A;  1WVR A;  2ZFW A;  3MZ8 A;  2OQR A;  1XC5 A;  3GUD A;  4N0B A;  4PCQ A;  3L2W A;  4F7Z A;  3CCQ I;  4BBR J;  1B8I A;  4HW0 A;  3SHF A;  1Z91 A;  2E7W A;  4BL0 B;  2FRH A;  2ZFU A;  3MKL A;  3L7W A;  1LDK B;  4AIJ A;  4BJ6 C;  1WJB A;  4DOZ A;  2KLO A;  4G6D A;  2XVC A;  3E7L A;  1W36 D;  4KIB A;  5EJC A;  1B9N A;  2Q1Z B;  1YO5 C;  1JT6 A;  1W7P D;  3ZQC A;  4A3K J;  3AG4 H;  2BVL A;  3E6B A;  3SFI A;  3RKX A;  4WK8 F;  2R7S A;  4AID A;  4B48 A;  3GLX A;  2F5F A;  3BZ6 A;  5GAE J;  1MDM B;  3T1B A;  3BJO A;  1FYL A;  3T5X A;  4EJO A;  3KX2 A;  1I6X A;  5D5V B;  2V6E A;  2GOM A;  1Z05 A;  4IQJ A;  3C2B A;  4BU2 A;  2KKO A;  2XDV A;  4MTD A;  2YR2 A;  1FPQ A;  2QBY A;  3HRS A;  1VQP I;  4ENN A;  4E7Z A;  1MJA A;  3TOA A;  1DP3 A;  2DMQ A;  1QVU A;  2EIJ H;  1QBJ A;  1W5C C;  3HGG A;  1XB4 A;  3WTV C;  1HKT A;  4IO9 F;  2L4M A;  4HYE A;  4OOI A;  1OCP A;  4I98 B;  2B7E A;  2EFP A;  3F6O A;  2UUZ A;  2RAE A;  1S6L A;  5FD5 A;  3TDU C;  5LFA A;  4P96 A;  4L18 B;  2DT5 A;  3J81 Z;  2VQL A;  2E34 A;  2E19 A;  3PL8 A;  2WAQ A;  4A0Z A;  3CUQ C;  4M3D A;  2M87 A;  1JHF A;  2M5W A;  4HLX A;  1S5L C;  3M07 A;  2GBY A;  4KMF A;  1Y0N A;  3ZMT A;  1H8A C;  1STZ A;  3I0T A;  2XF5 A;  1JKP C;  1ZHF A;  3ZMZ A;  2O03 A;  3OYA A;  1T08 B;  2E35 A;  1SFX A;  2E1M C;  4G9Y A;  3KZZ A;  4F55 A;  1R4M B;  1WSU A;  3I58 A;  1J75 A;  5E3M A;  3CF5 F;  3Q0V A;  2ZSH B;  1SD6 A;  1J2X A;  3HOX J;  2Z16 A;  2R0Q C;  2HYJ A;  1BI0 A;  3CUO A;  2OTJ I;  2IGK A;  1R4N B;  3I64 A;  2Z2S B;  1B59 A;  4BUP A;  4D0P A;  1X3U A;  3K4L A;  1GXP A;  1AWC A;  3GME A;  4N4N B;  3CCL I;  2FOK A;  2KRC A;  5D5X B;  2H8R A;  4A3D J;  1R1V A;  4KT5 C;  1WCM J;  3HKZ A;  1LPQ A;  4BAC A;  1MMN A;  3I4M J;  2DU9 A;  4OIR F;  2HTJ A;  5J8C A;  3BR3 A;  3K4M A;  1IUY A;  3KEQ A;  4DJA A;  3S16 J;  1HF0 A;  4HBL A;  1G59 A;  1JGG A;  3V8L A;  3PM1 A;  4HX4 A;  4EMS A;  2VT2 A;  4NBQ A;  2HVQ A;  3GZ5 A;  4I01 A;  1VQM I;  3I53 A;  4YG2 F;  2A68 F;  2MAB A;  2QQ8 A;  5J40 A;  2MA3 A;  1XG1 A;  4ZZD A;  5BPD A;  3E5U A;  3HKZ N;  2EFQ A;  3EUK L;  2AHQ A;  2OBP A;  3H5A A;  2KDZ A;  2FQ3 A;  3FXR A;  3C3W A;  1MMG A;  5F08 A;  2GQQ A;  4RAF A;  3ROU A;  3OYM A;  4I99 C;  3HIF A;  5LHG A;  3J80 K;  2VBX A;  2CQN A;  1V5G A;  4U88 A;  1RIO H;  2DN0 A;  3RCO A;  4AIH A;  3DU5 A;  1JUP A;  3CCE I;  2Y30 A;  2W25 A;  5CQE A;  4ZC3 A;  4F93 B;  2A6E F;  2GZW A;  1UHW A;  2LBF A;  4ENJ A;  1EJ9 A;  5H6Q A;  2K02 A;  2O8K A;  1GV5 A;  2R7Q A;  3ZRG A;  4L5E A;  1QPM A;  2KIU A;  4ZTF A;  4QPO A;  3ERE D;  1FOK A;  2R7X A;  1R1U A;  2X1D A;  1BN5 A;  2R5Z A;  3RYR A;  1TTY A;  2FUG 2;  3ZQF A;  5DV5 A;  1W1W E;  3DEW A;  2CFX A;  5ICG A;  3QP5 A;  4I76 A;  3HSR A;  1XMA A;  3G1M A;  5D8K B;  1U8B A;  4YII A;  2W84 A;  3VSL A;  1A6Q A;  2NXN B;  2LYC A;  2CQK A;  3LFU A;  4ENM A;  2W7N A;  3GTK J;  1FT9 A;  2DA2 A;  2EZL A;  3K2A A;  1RUO A;  3HSF A;  4EGY A;  1K4S A;  3KYD B;  4XL9 A;  4BXX J;  1Z7U A;  2P7V B;  4A3F J;  2EV6 A;  3WE3 A;  3OYD A;  5D5W B;  1OCO H;  3IH3 A;  2L02 A;  4CCN A;  3BR2 A;  1S8N A;  4RAG A;  3ZOB A;  1ZRF A;  3FXU A;  3D0S A;  4H0E A;  1XSV A;  2OUM A;  4RB3 C;  5BOX A;  2BY3 A;  2E2I J;  2KRH A;  5ERI A;  4LG0 B;  4RGX A;  3TMO A;  1U9O A;  4Q47 A;  5DS9 A;  4Y17 A;  5AIQ A;  3WTS C;  3H3V K;  2HDD A;  2M7A A;  4RAZ A;  3MZY A;  1RR7 A;  3HG9 A;  2RN7 A;  1REP C;  1HOM A;  3K6G A;  5H20 A;  2F5V A;  2TRT A;  1UEL B;  3RKY A;  2PI0 A;  4GYG A;  3RYP A;  1SAX A;  1PJR A;  4XKC A;  2M7B A;  3ZQG A;  1FX7 A;  2XV4 S;  2Z33 A;  2IA1 A;  4DYQ A;  4OAY A;  1SMT A;  3BTJ A;  1DGR M;  3B73 A;  3BPV A;  1G6N A;  2NVU B;  3S1N J;  2E2J J;  2KIQ A;  2YU9 J;  3KEO A;  2LF8 A;  4NUB A;  2HVS A;  3WGG A;  1IAW A;  3B02 A;  2QBY B;  1MMD A;  3E1S A;  4BQO A;  1YJ9 I;  1DU0 A;  2JA8 J;  3PUB A;  1TLH B;  4M9X A;  4IRH A;  2DOA A;  2M1B A;  1SAU A;  1TT5 B;  3DF8 A;  5CVJ A;  2HOT A;  1BI3 A;  2NNN A;  4M3F A;  4V19 K;  1FMV A;  2XAQ A;  1KGS A;  1AKH A;  5HNH A;  3F8F A;  1BIA A;  1A6I A;  3HYI A;  1XPX A;  2WAF A;  3B6C A;  2D1V A;  1I39 A;  3KP6 A;  4HSR A;  3VB2 A;  4CIC A;  3B6A A;  4DYR A;  4GXO A;  5LGT A;  2ELK A;  2DYS H;  2RC4 A;  3KET A;  1OIS A;  3KCC A;  3V7C A;  1I1G A;  4U7D A;  1YYV A;  4A69 C;  3TO7 A;  2JA5 J;  1QPI A;  5FKN A;  4ESF A;  2VJ5 A;  5JLX A;  1YX3 A;  2MSY A;  2QQB A;  2ECB A;  1MIJ A;  3SDB A;  5K1Y A;  2L7M P;  2F4O B;  2B9S A;  1FWZ A;  4C2U A;  1NK3 P;  5GAH J;  1WHU A;  4F92 B;  3L9F A;  2LY9 A;  1I27 A;  1LDD A;  2JT1 A;  2V6C A;  3KPH A;  4L9N A;  3ABT A;  1BBY A;  4W1U A;  1O7L A;  3RPU D;  4KDP A;  4F3Q A;  2VJJ A;  3GFL A;  3JTG A;  5ICC A;  1Z67 A;  1IG7 A;  2VXZ A;  5E3N A;  3DEU A;  2DK8 A;  3DXJ F;  1I3A A;  1ENH A;  3CJN A;  2OC6 A;  4M6Y A;  1HST A;  1IRX A;  2ICW G;  1KQ8 A;  1EH6 A;  5EG0 A;  4C9Y A;  3IAS 2;  2PQ8 A;  2LF7 A;  2RQQ A;  3AL0 B;  3OSF A;  2H8W A;  2LP0 A;  1SD5 A;  5E3O A;  3A01 A;  1N77 A;  1FOX A;  3KP4 A;  5LEK A;  3R6S A;  1XX5 A;  2HOA A;  2F6C A;  3A0H C;  4HX7 A;  2DK5 A;  3AFH A;  1J9I A;  3S15 J;  4P9F A;  2ELJ A;  4B3A A;  2Y9Z A;  4MO7 A;  3QRF F;  3IWF A;  2PBI A;  5FO5 A;  2XPV A;  4CCO A;  2Y75 A;  4FCY A;  2XUB A;  1S7E A;  3KIO A;  4DBR A;  1ZGW A;  2PJP A;  4E7H A;  4UXN A;  2M34 A;  3HRT A;  1QA6 A;  1ZQ3 P;  1DDN A;  1O7F A;  1UHS A;  3U21 A;  2HOE A;  1IRG A;  3HRU A;  4A3B J;  3FHZ A;  1IC8 A;  1P7I A;  2LBF B;  2VE8 A;  3RIR A;  3R60 A;  4DNC A;  4WX9 A;  4PFP A;  4JOM A;  4OIO F;  4KNY A;  2VOO A;  2R7T A;  5B66 C;  1PUE E;  4CA0 A;  3E97 A;  2GAU A;  3H5N A;  4EJT A;  1ZTR A;  1T38 A;  3U1D A;  1OFC X;  2HPM A;  1MSF C;  1GXQ A;  2EH3 A;  1XDS A;  4RGR A;  1LDJ A;  1WI9 A;  2WC2 A;  3MZH A;  2O6G E;  2ZKZ A;  5EZG A;  3E6D A;  1RKW A;  5ICF A;  1GUU A;  3EYI A;  5FGM A;  2VT3 A;  1HKS A;  1EA3 A;  2K3F A;  2V26 A;  1AHD P;  5EGO A;  4D1Q A;  3R4K A;  2LKP A;  3WHC A;  2QF7 A;  3SEZ A;  3DBH B;  1TQP A;  3BCA A;  3H92 A;  4BKX A;  3L2C A;  1G4D A;  4BH9 A;  4E7K A;  3CTA A;  1ORK A;  4M3E A;  3U9G A;  4KYW A;  3ESW B;  2BY0 A;  9ANT A;  5HDN A;  3IRQ A;  4XKV A;  1WQ2 A;  1HXD A;  2LK2 A;  4A93 J;  2DXI A;  4O5V A;  2MD5 A;  4XON A;  4A3J J;  2FE3 A;  1V55 H;  1Z77 A;  4BAY A;  3M3Y J;  1GVD A;  2HQ5 A;  3FK7 A;  3S8P A;  4BE0 A;  1E3H A;  4J19 A;  3CZ6 A;  5K5O A;  1LEB A;  2DDB A;  2DA3 A;  3FDY A;  3DPT A;  4QLC U;  2R7F A;  4IX7 A;  1I1S A;  3A4C A;  3MN2 A;  5BS6 A;  2KZV A;  2X1C A;  4NC6 A;  2LC2 A;  3C7J A;  1ULY A;  3REO A;  2M30 A;  3NEU A;  4PSX A;  2EJR A;  4XOR A;  3AKZ A;  2I5U A;  2JMW A;  2X6Y A;  4XIC A;  2VAS A;  1A04 A;  1ON2 A;  2E1C A;  2Z5U A;  5CVR A;  3ABU A;  1QU3 A;  4G7H F;  1BC7 C;  3GWZ A;  4AU7 A;  3I9V 2;  4MFD A;  4WXC A;  5KAI C;  1XCB A;  2EFO A;  1JKO C;  2ZO4 A;  3P9K A;  3BPX A;  4Z2Y A;  4CYC A;  1APL C;  4MGR A;  4PDK A;  1ZR2 A;  4A3G J;  1YOV B;  4G6Q A;  1WPK A;  2RDP A;  1R36 A;  1J09 A;  3CDL A;  3OIQ A;  5K7Z A;  2HOS A;  3BRO A;  4U0W A;  1JI8 A;  2NNY A;  3I71 A;  1SAN A;  4CCK A;  1Z3Y A;  4MFE A;  1Z0X A;  3G1O A;  3CCU I;  2HPI A;  1H9G A;  1CGP A;  3CCS I;  5D6E A;  2F2E A;  1BIB A;  2DI3 A;  5FLM J;  5FD6 A;  1AKH B;  3MKZ A;  4I02 A;  2OU2 A;  1IXS B;  2QSF X;  3Q9S A;  1R5I D;  1QZZ A;  3CMA I;  1KYW A;  5FKK A;  1JXS A;  4PZJ A;  2XSJ C;  2TCT A;  2O7O A;  1W7P A;  1FTZ A;  3CCY A;  3LST A;  3ERM A;  2CFO A;  3SFZ A;  3M8E A;  2M8G X;  5HNF A;  1LEA A;  1J5Y A;  2FU4 A;  2NS0 A;  2W57 A;  1YW9 A;  5FKL A;  1W5S A;  2Y0M A;  4DYC A;  3IH2 A;  2EZH A;  3OYN A;  3G71 I;  4M9S A;  2M2E A;  4M3B A;  2V1U A;  1VQ5 I;  3P9C A;  4D5F A;  5HVQ C;  2FBI A;  2ZXW H;  1OYI A;  4XQF A;  2EV0 A;  4W97 A;  3TDZ C;  4JP0 A;  4L9J A;  4LD5 A;  5IYB J;  1XMX A;  5CYV A;  4TV7 A;  3H35 A;  2YSR A;  4II3 A;  2EQR A;  4AVZ A;  1IO2 A;  1RRJ A;  1HBX G;  1DQU A;  3J80 Z;  1TWF J;  4BGD A;  2O5R A;  1T33 A;  3F9K A;  1M1E B;  5IT9 K;  1TL8 A;  3HXL A;  1XGO A;  2ESN A;  5EG0 B;  4UNO A;  3HC7 A;  1ZEL A;  1R00 A;  1P2F A;  4JK1 X;  3GVA A;  2PMH A;  3A01 B;  3K4B A;  5ILS A;  2JVG A;  1L0O C;  1NG6 A;  1Y8R B;  3CJT B;  1X2N A;  3NAR A;  4R79 A;  3CJR B;  2XGC A;  5HLG A;  1D8J A;  2KP6 A;  2K7L A;  3E5Q A;  4PJM A;  1PP7 U;  4XOP A;  2P5K A;  1ETW A;  1FY7 A;  2EIM H;  2WBM A;  4B1R A;  1BC8 C;  3S1R J;  2BHZ A;  3S2H J;  2H09 A;  3ECH A;  1LJ9 A;  5E1Z B;  2CW7 A;  3OS0 A;  4NQW A;  2JN6 A;  2ZXI A;  4U0V A;  2Q8K A;  2VE9 A;  4EJW A;  3BJ6 A;  3ABL H;  1QZY A;  1XD7 A;  4HAM A;  2DMT A;  2OCE A;  3IC7 A;  4HNU A;  2ZNZ A;  2EZK A;  1IRZ A;  2BGC A;  2XAH A;  4B4C A;  3KEY A;  1YW8 A;  2NVQ J;  1R6R A;  2VB6 A;  4M73 A;  4QSH A;  3I59 A;  2F48 A;  3BR1 A;  3M8J A;  3OV8 A;  3W6J B;  1NHA A;  2K4J A;  1WI3 A;  1BM9 A;  2X1E A;  5H6R A;  4XID A;  3CES A;  2XAU A;  1IN7 A;  3DEE A;  3H5R A;  4Q48 A;  2RRE A;  3FK6 A;  1FYK A;  3S2W A;  1U3E M;  2QEN A;  4WWC A;  4IHW A;  3G1L A;  4OAZ A;  3ULQ B;  3TW6 A;  3V7S A;  1C0W A;  3G3Z A;  3W6K B;  2KL4 A;  1OCR H;  1ODD A;  4JYK A;  5EGO B;  2E2H J;  5HLT A;  1T0F A;  1MBH A;  4CCJ A;  4P55 A;  1E2X A;  3P5J A;  2V7F A;  4HZF A;  1X1P A;  1HW5 A;  5HOD A;  1ZAO A;  2DDA A;  3KZY A;  2XHK A;  1RR8 C;  4EVI A;  2DA6 A;  2CS3 A;  2KT0 A;  4RA2 A;  5JHU A;  2E36 A;  1H88 C;  1HSJ A;  2VKE A;  3QYE A;  1L3L A;  4RGU A;  2BVM A;  2WV0 A;  1VZ0 A;  1G3S A;  2FX0 A;  3HL2 A;  1WJF A;  2GXG A;  2HWV A;  2IA0 A;  2A5W A;  3RQ4 A;  3UKG A;  1ZLJ A;  5D4R A;  1EV7 A;  1GT0 C;  3GFM A;  4II2 A;  2O3F A;  2XB5 A;  4Y13 A;  1Y8Q B;  2DOE A;  2JRM A;  1N25 A;  2OAZ A;  3ZXS A;  1R58 A;  1Z7L A;  2X6W A;  2XRN A;  5E20 A;  2H1L A;  2JPC A;  1HCR A;  3EUH C;  1TWG J;  4M6X A;  2Q2E A;  2JUC A;  3PFI A;  3QPL A;  2D5V A;  2ZME C;  2DJI A;  5C3E J;  5LBQ A;  1RES A;  4IKF A;  3IKV A;  3HRM A;  2CV0 A;  2EK5 A;  3NWS A;  2M0C A;  2VPR A;  3JRB A;  1J0R A;  2J5O A;  2H1K A;  2FJ1 A;  3OYG A;  3GTL J;  1LVK A;  2CUJ A;  2XF6 A;  2B0L A;  2HS5 A;  3A1Y A;  1D1A A;  5HLH A;  1UB9 A;  2A6H F;  2NS7 A;  5B5E C;  4NNJ A;  5IYD J;  1NK2 P;  4KUM A;  5B1A H;  4CYC B;  2DFF A;  4C3I J;  1MBG A;  1WRJ A;  5M5X J;  3KLO A;  2NYX A;  3H0D A;  3S32 A;  2WAD A;  4N9I A;  1VQ8 I;  2P6T A;  3HHG A;  4XR6 A;  4BXU A;  1F36 A;  1G3T A;  1XDU A;  4AC0 A;  3N4M A;  1JE8 A;  2DFI A;  4UUS A;  1NH3 A;  3I5U A;  3EYY A;  4MTE A;  2R7Z J;  3DKW A;  2DFH A;  2KRF A;  2V1N A;  3SXY A;  2IS4 A;  2V9K A;  3VFZ A;  2DYR H;  1WFX A;  1SVO A;  1XGS A;  1CQT A;  2D1H A;  4IL6 C;  4MQV A;  1K79 A;  2YU3 A;  4PUS A;  1W7P B;  2KJB A;  3GTP J;  2FNA A;  3GW2 A;  2QKL B;  3CCV I;  5L3C A;  3W6V A;  1KU7 A;  1DUX C;  1JTX A;  1R22 A;  3CLQ A;  4OWR B;  4RBO A;  2AXL A;  3SEQ A;  5M5Y J;  4EM0 B;  1SD4 A;  4CCL A;  1MMA A;  1IV8 A;  2L2O A;  3CO6 C;  3CP2 A;  3AL0 C;  1XN7 A;  4A3L J;  1USS A;  4M74 A;  2E1O A;  3KP3 A;  5D8L B;  4UV8 A;  1MGT A;  2DA7 A;  1YS6 A;  4MHG A;  2STT A;  5EF6 A;  3P7N A;  1S9H A;  3DWL E;  1O57 A;  3ASN H;  1WJD A;  3Q0U A;  4ZTJ A;  2COM A;  1UG2 A;  4NC8 A;  2C6Y A;  4FQG A;  1U5T C;  1QVT A;  4IHX A;  5ILU A;  3E3V A;  3RZO J;  4QWQ A;  3CUQ A;  2F4M B;  3TBI A;  4KIT B;  2HKO A;  3MMY B;  4IHS A;  1ZRD A;  2A6T A;  4LG3 A;  4XKW A;  2Z1D A;  1K6Y A;  3CLO A;  1VQ4 I;  1P9Q C;  3VYR B;  2IS1 A;  3VWB A;  1V5F A;  1LFB A;  1S3J A;  2XAS A;  2JA7 J;  4EM1 A;  2HDC A;  1D1B A;  5KCM A;  5L3G A;  4CSW A;  3BG9 A;  3VDX A;  2ISZ A;  2LOO A;  4XBF A;  4C3H J;  3F23 A;  3MQ0 A;  2M4K A;  1UG0 A;  2ID6 A;  2XSD C;  1WWX A;  2BW3 A;  2CYY A;  2K40 A;  1ZGJ A;  1YJN I;  2HYF A;  2I8D A;  2MGQ A;  1U9N A;  2V4J C;  4UVC A;  2ZBK A;  3JW4 A;  3RPU A;  3OWT A;  4XOT A;  4HDV A;  3JRH A;  3MEX A;  2QYO A;  3N05 A;  2IVM A;  4XRM A;  3K1N A;  1NTC A;  4BE1 A;  5HLI A;  5DYM A;  5FFX A;  1GLN A;  1PYV A;  1P6R A;  2FMY A;  3F8N A;  4ZZL A;  2L5Q A;  1IN5 A;  4NQW B;  1JUS A;  2K85 A;  4AUX A;  3HPH A;  4N4O B;  2Y69 H;  2KIM A;  4KT6 A;  3DTI A;  5DCM A;  5ICE A;  3LSR A;  4E7J A;  3WHB A;  1X1B A;  3C18 A;  4UB8 C;  4PFO A;  3QQA A;  3JRF A;  1IDZ A;  1F1Z A;  2RGV A;  3GTO J;  3FMS A;  5LGN A;  1B6A A;  3TQN A;  2FOW A;  3I59 B;  1R5G A;  3PSF A;  2PMZ N;  3F21 A;  2QZ8 A;  4Y3O A;  3J7A O;  1HA8 A;  1AU7 A;  3KYC B;  1BR2 A;  1QQI A;  3V7R A;  3W2V A;  1DP7 P;  2LH9 A;  1TBX A;  4IQ4 A;  1MMS A;  1IXR C;  2RNJ A;  2BYV E;  3BTI A;  3JRG A;  4A6D A;  1KU3 A;  1ZKG A;  1X1A A;  3K1M A;  2M8E A;  2BY1 A;  1FZP B;  1IN8 A;  1UMQ A;  4MEY F;  1P7J A;  4XRF A;  4IRG A;  3KP7 A;  1LE8 A;  4BBS J;  3FXK A;  1TP4 A;  1IF1 A;  4RGS A;  2QWW A;  4AIK A;  2DMN A;  2JSC A;  2CWE A;  2VOP A;  4V2F A;  4WXH A;  2CO5 A;  3JRA A;  3KP2 A;  2W1O A;  2OPT A;  3VPR A;  1B8I B;  4IVN A;  4CZZ A;  3PIP F;  2FQ4 A;  3CME I;  3ZMV A;  3K70 C;  2E1N A;  4YFX F;  5L3B A;  4HQM A;  3P9I A;  3SZG A;  3WU2 C;  4CHU A;  2XGX A;  1R7J A;  2VPL A;  1WJE A;  5LHI A;  1YHQ I;  2XAF A;  1IGN A;  2Q2E B;  2A69 F;  1V5E A;  3BJA A;  3BZK A;  3HOZ J;  1Y1V J;  2R3S A;  1R49 A;  5KHD A;  3NRV A;  1KU2 A;  1JUM A;  2Y31 A;  2H6B A;  3HB9 A;  2DPD A;  4PJJ A;  3JRE A;  3G2B A;  5M3F J;  4ZYG A;  2ME0 A;  2M3A A;  1FP2 A;  3OIP A;  2OZ6 A;  1D5V A;  3OMY A;  5FLX K;  4L9V A;  5DCF A;  4UVB A;  1R71 A;  2LMD A;  4CGZ A;  2MD0 A;  3IH4 A;  4A3E J;  1ZK8 A;  1D1C A;  1QHH D;  3BQZ A;  3PQK A;  5DM6 F;  1IN4 A;  3FKI J;  2CV1 A;  2PX9 A;  5DUI A;  4Z6Y A;  4UUS B;  1N75 A;  1T2K A;  2IRF G;  4RM3 A;  1TW2 A;  5FRM A;  1RUN A;  2NVX J;  2VKH A;  1QRY A;  3K4K A;  5IOZ A;  2G7U A;  2P81 A;  3QPT A;  3OYB A;  4IOC F;  2WY8 Q;  3K9T A;  3KYL A;  2MH2 A;  2K9M A;  1LNW A;  4KMU X;  3BP8 A;  5IT9 Z;  3FXO A;  2K27 A;  2OCC H;  4D9J A;  3MWM A;  3HEF A;  4XLH A;  3GTM J;  4UUV A;  4XLP F;  4HPQ A;  4MLO A;  3ZMD A;  4FE4 A;  3HOY J;  1U2W A;  2CQQ A;  4S05 A;  2FBH A;  2JRT A;  2K4B A;  1I50 J;  2VBY A;  1P92 A;  1FSE A;  1MJ9 A;  2HZT A;  2RV8 A;  4HF0 A;  5EEH A;  3F0C A;  5B1B H;  3GYH X;  1SC7 A;  3IUO A;  1FYM A;  1OCT C;  1BW5 A;  4I2O A;  5JI6 A;  4CUG A;  5DM7 F;  1BI1 A;  5E17 F;  2ME6 A;  1BW6 A;  1HKQ A;  1RZ4 A;  1H0M A;  1G8X A;  3E6C C;  2QSH X;  4LK1 F;  2LD5 A;  2GIV A;  4EV0 A;  5HS7 A;  2AXT C;  4RLQ A;  4FX4 A;  1IXC A;  2IEK A;  1S7O A;  2ZC2 A;  3CUQ B;  2AQF A;  3OL4 A;  2GA1 A;  5DDG A;  4GDF A;  3LSH A;  1MNM C;  1H89 C;  4LK0 F;  4F91 B;  5J47 A;  4BQA A;  4R1H A;  3CMM A;  4PGH A;  3KE2 A;  3RJP A;  4L5I A;  4J00 A;  3L2R A;  4BEH A;  2E1M B;  4XLE A;  5TJJ A;  4C2M J;  3ZQ7 A;  1BL0 A;  4LLN A;  2XB0 X;  4B44 A;  1GVJ A;  2HQA A;  2VBW A;  3LSM A;  5J6X A;  4HNT A;  2CGP A;  1FBS A;  4IRI A;  2BW3 B;  3K10 A;  2CW8 A;  4GO1 A;  1ZAR A;  4LJZ F;  3ECO A;  4CH7 A;  2LSO A;  3ZN0 A;  3OYK A;  1SD7 A;  4IXA A;  3L2V A;  3ISP A;  3EUA A;  3J7Z I;  2P0W A;  3ZQL A;  1HLV A;  4LLG F;  4IF4 A;  4DZJ A;  2W82 A;  1OQY A;  1G3W A;  3U1K A;  1HQC A;  3E5X A;  3FXQ A;  2OQG A;  4FET A;  1R23 A;  1TWC J;  2KJC A;  3TED A;  1X1D A;  2VL8 A;  2R5Z B;  2OJE D;  5FFZ A;  4BNC A;  2UXX A;  3SQN A;  4GCV A;  4OIQ F;  5CVV A;  2VKD A;  3LA7 A;  4B8X A;  3G73 A;  3HPG A;  1UFM A;  2ELH A;  4BHP A;  1YIO A;  2LFB A;  4A0X A;  4XSZ F;  4D5C A;  1TC3 C;  2EFN A;  2MFZ A;  3CDH A;  3FMR A;  5L3F A;  2L9V A;  1FP1 D;  2HGC A;  1SFK A;  1X4O A;  2BBY A;  1CF7 A;  1Z6R A;  1T95 A;  3BQY A;  4LFU A;  5D5U B;  3FM5 A;  2H94 A;  3WTZ A;  1WJA A;  5M5W J;  1ZG5 A;  2EPF A;  3K4C A;  5IT3 A;  5FRN A;  3CC4 I;  3ZMU A;  1LE8 B;  2VBZ A;  3EDP A;  1FOW A;  1X58 A;  2DTR A;  3AG2 H;  4Y52 J;  1YG2 A;  3QWL A;  2DA4 A;  2IP2 A;  2JZY A;  3RQI A;  3AG3 H;  2V9V A;  3K2Z A;  4KFC A;  4IPA A;  1NG7 A;  1SVM A;  3V4G A;  3K70 D;  3GTG J;  3SZP A;  4DZP A;  1X2M A;  1Z21 A;  3F72 A;  3PQJ A;  2GWR A;  5EEG A;  1ZYR F;  2B63 J;  4BQN A;  4S0H B;  2BY2 A;  1JGS A;  4XSX F;  2DPU A;  2ISY A;  3FMQ A;  5DTD A;  3DBR B;  4RS8 A;  3ZQH A;  2DLL A;  1YX5 A;  3EET A;  1ZR4 A;  5C44 J;  3FZV A;  3J7Y J;  3DQV C;  1FSH A;  2QLZ A;  3S93 A;  1PDN C;  3O8H A;  4BQQ A;  5E18 F;  1FBU A;  5HS8 A;  2L9S A;  3S2D J;  4G7Z F;  4RB0 A;  3GEZ A;  1YIT I;  1Q1V A;  3FKJ A;  1LFU P;  4LMY A;  4L9T A;  1TQM A;  2IS6 A;  3OR2 C;  2E5N A;  1A36 A;  1POG A;  4ESJ A;  3S14 J;  1A35 A;  3ZQI A;  2VKV A;  2QA4 I;  2Z3Y A;  2QQ9 A;  5CVU A;  1SEU A;  5HDG A;  2F5C A;  1W0T A;  4OU0 A;  2ZCW A;  5EEA A;  3R0A A;  2VQC A;  3K4J A;  4BHC A;  1J59 A;  4BYY A;  1EF4 A;  2IA2 A;  2E60 A;  3WG9 A;  2KHM A;  3PO3 J;  1LFP A;  2HXI A;  2ZNY A;  3LFK A;  1W0U A;  3RSN A;  4CZC A;  2DW4 A;  1RET A;  2EIK H;  3A0B C;  1W4M A;  3LSJ A;  1FNN A;  4HV6 A;  2AS5 F;  2HKX A;  5AON A;  3MAJ A;  1ZRE A;  2K86 A;  3M8F A;  5J8F A;  5M3M J;  1IW7 F;  1WH7 A;  3CCR I;  2QGU A;  1OPC A;  4XN3 A;  2X9D A;  3IP4 B;  1X3W B;  4HEA 2;  4FIS A;  5TRD A;  2DQL A;  4ZJZ A;  2LDU A;  4A3M J;  2CRG A;  4LIT A;  5LRS A;  2A07 F;  4GYI A;  2LY2 A;  2WTE A;  3TL4 X;  2KIS A;  1K4T A;  2A61 A;  3ZQQ A;  4YIR X;  2VC0 A;  3M4O J;  2R7O A;  4KIS A;  1Z1D A;  2X6O A;  4E4H A;  1IV6 A;  2HR3 A;  2QKM B;  3QYB A;  4BY1 J;  3GTQ J;  1IZ1 A;  2QSG X;  2VJI A;  4HQE A;  3IWZ A;  2CMP A;  1TT0 A;  5J3L A;  1AA7 A;  1MBF A;  1IDY A;  3BR6 A;  1GHC A;  2WWY A;  2UZK A;  1ZG3 A;  3EPZ A;  4PJ0 C;  5KVR A;  2M0M A;  3CJQ B;  3H0G J;  4DIQ A;  5J4Y A;  1VTN C;  1F43 A;  3L09 A;  3CC2 I;  2PJR A;  1MW7 A;  3L00 A;  4ZDP A;  3K1P A;  3O3K A;  1GDT A;  4IJA A;  1FMW A;  4G6T B;  3O2P E;  2ZSI B;  2H6C A;  2CUF A;  4L5J A;  1KQ9 A;  5EDN A;  2MC3 A;  4BEH B;  1D0X A;  1S72 I;  1R9T J;  2BOL A;  5LLQ A;  4GGG A;  2X85 A;  2ECC A;  4B3X A;  1BJA A;  1TZL A;  1X4P A;  2BZT A;  4RM2 A;  3VOD A;  3LSK A;  3SZT A;  2IT0 A;  1WZ2 A;  1BI2 A;  6PAX A;  3BT9 A;  3FIW A;  2TDX A;  2XPW A;  3DKY A;  2YPR A;  1X1C A;  4NB5 A;  5GP9 A;  3HOU J;  2IW5 A;  2A5Y B;  3QPH A;  2WY7 Q;  1N78 A;  4I7H A;  5BPI A;  2V9P A;  5CJ9 A;  3OYC A;  4BJ5 C;  1V3F A;  3R61 A;  4FT8 A;  4G12 A;  3TOB A;  2LLK A;  3GLL A;  3PUF A;  5IOY A;  2IGO A;  3I55 I;  5K5R A;  1OR7 C;  2L9N A;  3HGY A;  1T0F C;  3BDD A;  4IZZ A;  2EFW A;  2JUG A;  5D4S A;  3OYL A;  1TWA J;  2P5L C;  2XGE A;  2HQN A;  2R5Y A;  1MZB A;  4LOC A;  4BE2 A;  4IHT A;  3S17 J;  1VQ9 I;  2Z9O A;  2R92 J;  3CD6 I;  3GZ6 A;  3FF5 A;  3NQO A;  3VOE A;  4M9Z A;  1OJL A;  1T39 A;  5E8I A;  3IRR A;  2DMP A;  5GAG J;  1FJL A;  1CF7 B;  2RVC A;  3NAU A;  1YE9 A;  1MND A;  2F4I A;  3QAH A;  5JVT A;  2CUE A;  3WTW C;  1P4X A;  4KN7 X;  3ZP5 A;  2DJN A;  2LRE A;  2IJL A;  2NS8 A;  2HU9 A;  5EYR A;  3A2K A;  3BG7 A;  2P5V A;  2DOF A;  3BR5 A;  2F5D A;  4A3I J;  2KPM A;  4EJV A;  2L3D A;  2LNB A;  3GCM A;  5FLX Z;  1JKQ C;  3V8K A;  4YRV A;  2IGM A;  4RMN A;  2O61 A;  4HOB A;  3F8B A;  2LKX A;  3CMY A;  1BA5 A;  2EWN A;  4E70 A;  2KMU A;  1QNT A;  2QUF A;  2PG4 A;  1F4K A;  3OYH A;  1DGW Y;  1VQN I;  4Q4Z F;  2HNH A;  2M9H A;  2STW A;  1VQO I;  4LG0 A;  1WGX A;  4I6Z A;  4B47 A;  1RPW A;  3BG6 A;  1SVL A;  1KQ0 A;  1I6H J;  1OCZ H;  4ZYE A;  5JHF A;  4BDY A;  5F1J A;  2NVT J;  3BZC A;  5E79 C;  4L0Y B;  2R4G A;  3S1Q J;  2MG4 A;  4KJZ A;  3DP7 A;  1ERD A;  3JRD A;  1YTY A;  1FOY A;  3AG1 H;  4FE7 A;  2HQR A;  1A5J A;  3NWT A;  3ONQ A;  4HRI A;  1VQK I;  2WB1 N;  4PSW A;  3ZN1 A;  3I54 A;  2DFE A;  3S3O A;  3OR1 C;  3ABK H;  4X1E A;  1PVE A;  1JTY A;  1V4R A;  2FSW A;  4E7L A;  2GXB A;  3JCU C;  4O6J A;  2GM4 A;  3I3L A;  3PO2 J;  4FTH A;  1MKM A;  4G94 A;  1UAA A;  3W2A A;  2V1X A;  4UB6 C;  2XKO A;  3C2G A;  1TNT A;  1EH7 A;  3O6B B;  2OD5 A;  3BLY A;  1I5Z A;  3VSK A;  1WJC A;  3EUH A;  5F0H A;  1JT0 A;  5HDK A;  2ZME A;  4LGW A;  3V42 A;  1TNS A;  1ZLK A;  3U2R A;  4ESB A;  4NHJ A;  1K7A A;  2XRL A;  4LLL A;  3IHU A;  2RKH A;  4I0A A;  1IN6 A;  3GBG A;  2DA1 A;  5J1Y A;  2HYG D;  2KZG A;  1K78 A;  1G3Y A;  3JTH A;  2ZJQ F;  5DD4 A;  2UV1 A;  3HOW J;  2A05 A;  3VYU B;  2BV6 A;  2JPB A;  2HZD A;  4UY8 I;  3WG7 H;  5FB2 A;  3QPS A;  3E0J B;  3DKX A;  2XIG A;  3MVP A;  2ZJ2 A;  4XK4 A;  1O3Q A;  1B4A A;  1D0Y A;  3QU3 A;  5CPR B;  4CYD A;  2CV2 A;  1Q1H A;  4ASN A;  1P4W A;  2X48 A;  1XMK A;  1FC3 A;  2UXN A;  3IKT A;  1LVA A;  5F64 A;  1MH4 A;  2WAQ N;  2XAJ A;  5FJ8 J;  3C1D A;  3H9G A;  2BXY A;  4YEL A;  2BEO A;  3F6V A;  4O3M A;  2HXO A;  2KFD A;  2XGD A;  3J7A Y;  2ACJ A;  2GA2 A;  4UHT A;  1OYY A;  3OYJ A;  2PJR B;  3ZPL A;  4BJT A;  4IEJ A;  5GAD J;  2L01 A;  2MLK A;  2MYS A;  2FF4 A;  2Z99 A;  3LSI A;  2BXZ A;  3VEP A;  4OIN F;  1W5T A;  2FNP A;  2FA5 A;  2VXD A;  5DUK A;  5L3E A;  1PUF A;  5F27 A;  1FBQ A;  2N8G A;  4YEJ A;  2OZU A;  2HTS A;  3BG5 A;  4JX6 A;  2ESH A;  2VLA A;  4X6A J;  3DPL C;  3PNY A;  3WTY C;  1VQ6 I;  3H9J A;  5FLV A;  3LL7 A;  1XSD A;  4HA8 A;  2CJJ A;  2PN6 A;  2Y9Y A;  1U6G A;  4U87 A;  5IP9 J;  5J1R A;  2DQR A;  2PMZ A; 
#chains in the Genus database with same CATH homology
 3S3M A;  3IUO A;  2KQR A;  2VQH A;  1J09 A;  3OIQ A;  3K4N A;  3FHN A;  4CUG A;  3OYF A;  2ZXH A;  1JI8 A;  4CCK A;  1Z3Y A;  4LIV A;  1X19 A;  2JVH A;  1G8X A;  3CF2 A;  3S3N A;  4RLF A;  2WB1 A;  1Z3X A;  3OL3 A;  2HPI A;  2LY1 A;  4RLQ A;  4FAS D;  3L2W A;  4XMY A;  2AQF A;  3OL4 A;  3OYE A;  3MKZ A;  3LSH A;  4BL0 B;  2ZFU A;  4F91 B;  1LDK B;  3CMM A;  2XSJ C;  4BJ6 C;  3FBI B;  4ANJ A;  1WJB A;  2KDO A;  3L2R A;  4DOZ A;  4J00 A;  2KLO A;  4BEH A;  2E1M B;  4XLE A;  1W36 D;  2CFO A;  2Q1Z B;  4B44 A;  5HNF A;  2HQA A;  3LSM A;  4HNT A;  2BVL A;  4ZYA A;  4XNF A;  2BW3 B;  3K10 A;  3QOE A;  2CW8 A;  3OYN A;  2R7S A;  4CH7 A;  4B48 A;  3OYK A;  3L2V A;  5HVQ C;  3EUA A;  4GRI A;  2P0W A;  3KX2 A;  2V6E A;  2GOM A;  4IQJ A;  3C2H A;  4XQF A;  4BU2 A;  1MNE A;  2XDV A;  2W82 A;  3OS1 A;  4BDZ A;  3W3C A;  4U7B A;  3H35 A;  4II3 A;  4AVZ A;  4E7Z A;  1DP3 A;  1DQU A;  2WA0 A;  4FET A;  3LMM A;  3PNV A;  4BGD A;  2AQE A;  2O5R A;  1X1D A;  3F9K A;  3VYT B;  2VL8 A;  2UUZ A;  3HXL A;  5LFA A;  2VQL A;  3HC7 A;  1ZEL A;  2R7W A;  2VKD A;  3PL8 A;  3HOS A;  2WAQ A;  3HPG A;  3ZGK A;  2X6X A;  3K4B A;  2R7U A;  2MFZ A;  2JVG A;  1NG6 A;  3W2W A;  4R79 A;  1SFK A;  1X4O A;  3CJR B;  2XF5 A;  2KP6 A;  1T95 A;  3OYA A;  2E1M C;  4PJM A;  4XOP A;  4F55 A;  1WJA A;  3K4C A;  5FRN A;  2K9L A;  2DT7 B;  2WBM A;  2ZSH B;  1D0Z A;  2Z16 A;  3BCB A;  3BC8 A;  3L2Q A;  1BR1 A;  2CW7 A;  3OS0 A;  2IGK A;  2ZXI A;  3UR3 C;  2Z2S B;  4BUP A;  1NG7 A;  4C2T A;  3K4L A;  3K70 D;  2E5Z A;  2L7K A;  1Z21 A;  4N4N B;  2KRC A;  4HNU A;  4BQN A;  2VJ4 A;  2UWM A;  3OY9 A;  3HKZ A;  3KEY A;  4BAC A;  1MMN A;  1R6R A;  2VB6 A;  2R7R A;  3PFY A;  2IS2 A;  1YX5 A;  3K4M A;  5CQG A;  3M8J A;  4DJA A;  2NOJ B;  2JSP A;  3DQV C;  2JA2 A;  2X1E A;  2WAE A;  3S93 A;  1G59 A;  4BQQ A;  3CES A;  2XAU A;  3H5R A;  3DEE A;  2HVQ A;  2RRE A;  2L9S A;  2MAB A;  4OAZ A;  2IXS A;  3FKJ A;  3PNT A;  2IS6 A;  4AYB A;  1Y6I A;  2E5N A;  3OR2 C;  3EUK L;  2KL4 A;  3H5A A;  2DT6 A;  5HLT A;  4J01 A;  1MMG A;  4CCJ A;  3PSI A;  2V7F A;  3OYM A;  2VQC A;  3K4J A;  3MKW B;  1V5G A;  2CS3 A;  3RCO A;  3DU5 A;  2CH0 A;  3DU6 A;  2E60 A;  2KHM A;  3M1C A;  3QYE A;  1LFP A;  2BVM A;  1VZ0 A;  5CQE A;  4ZC3 A;  3RSN A;  4CZC A;  4F93 B;  3OS2 A;  3HL2 A;  1WJF A;  3RQ4 A;  2A5W A;  2LBF A;  4II2 A;  2R7Q A;  3ZRG A;  4ZTF A;  4QPO A;  4P1W A;  2R7X A;  2MC4 A;  2X1D A;  3ZXS A;  4XN3 A;  2X6W A;  1Z7L A;  3IP4 B;  2FUG 2;  3EUH C;  4HEA 2;  4ZJZ A;  5FRO A;  1BOB A;  2DJI A;  3MKY B;  2OV7 A;  4IKF A;  4LIT A;  2CV0 A;  3VSL A;  3NWS A;  2LYC A;  3LFU A;  3UNG C;  2W7N A;  2LY2 A;  3TL4 X;  3OYG A;  1LVK A;  2CUJ A;  2XF6 A;  3ZQQ A;  3A1Y A;  1D1A A;  1Y56 A;  2R7O A;  4KIS A;  4BXF A;  4NNJ A;  4XL9 A;  4E4H A;  2QKM B;  3QYB A;  4B43 A;  2LG4 A;  2VJI A;  2WAD A;  3S32 A;  3H0D A;  2XC7 A;  1KON A;  1TT0 A;  2CMP A;  4XR6 A;  1AA7 A;  3OYD A;  1OLT A;  3EPZ A;  5HOO A;  4CCN A;  2M0M A;  4HG2 A;  2OUM A;  3CJQ B;  2W4S A;  2V1N A;  2KRH A;  4DIQ A;  2IS4 A;  3TMO A;  2XF7 A;  2PJR A;  1MW7 A;  4NC7 A;  2V9K A;  4ZDP A;  1WFX A;  2K5C A;  4XKB A;  1FMW A;  2M7A A;  4G6T B;  4LIU A;  5TGT A;  4Y33 A;  3HUG B;  2ZSI B;  4PUS A;  3OYI A;  3HG9 A;  4BEH B;  1QHG A;  3K6G A;  1D0X A;  2BOL A;  2F5V A;  2QKL B;  1UEL B;  2X85 A;  4B3X A;  1TZL A;  1PJR A;  1X4P A;  4RM2 A;  2M7B A;  4XKC A;  3LSK A;  4OAY A;  4OWR B;  1DGR M;  3DKY A;  3SEQ A;  1X1C A;  4PJL A;  1MMA A;  2L2O A;  2WY7 Q;  3CP8 A;  3CP2 A;  4CCL A;  3AL0 C;  1N78 A;  2LRD A;  3ZCO A;  4NUB A;  2M4G A;  2HVS A;  2RNG A;  3SYT A;  3OYC A;  4BJ5 C;  4E7S A;  1MMD A;  3E1S A;  4BQO A;  1S9H A;  3PUB A;  3DWL E;  1WJD A;  2DOA A;  4XM3 A;  4ZTJ A;  1SAU A;  4NC8 A;  2IGO A;  1OR7 C;  2L9N A;  1T0F C;  3TBI A;  4KIT B;  1FMV A;  3MMY B;  2VIX A;  2JUG A;  3OYL A;  4IZZ A;  2A6T A;  4LG3 A;  4XKW A;  2Z1D A;  3LSG A;  1K6Y A;  5HNH A;  4ZDL A;  4BE2 A;  1P9Q C;  3VYR B;  2IS1 A;  3VWB A;  1V5F A;  2WAF A;  4HSR A;  4ZDO A;  4DBQ A;  1D1B A;  5KCM A;  4CSW A;  3VDX A;  4H4K C;  3ZR8 X;  2LOO A;  1W36 C;  2M4K A;  1UG0 A;  2BW3 A;  3IAM 2;  2VJ5 A;  1YE9 A;  1MND A;  1YX3 A;  2F4I A;  2I8D A;  3SDB A;  4C2U A;  2V4J C;  4F92 B;  4DGW B;  3OWT A;  2LRE A;  4XOT A;  2HU9 A;  3A2K A;  3BG7 A;  3N05 A;  2KPM A;  4BE1 A;  3RPU D;  4F3Q A;  2VJJ A;  4XLA A;  4YRV A;  1GLN A;  1PYV A;  4HST A;  4X0G A;  2IGM A;  2L5Q A;  4NQW B;  4RMN A;  2VXZ A;  3HPH A;  4N4O B;  4KT6 A;  3DTI A;  2KMU A;  4E7J A;  4QPQ A;  2OC6 A;  1IRX A;  3OYH A;  1X1B A;  4C30 A;  1DGW Y;  3QYF A;  4PFO A;  2HNH A;  4E7I A;  2DCE A;  4C9Y A;  3IAS 2;  2GOX B;  2RQQ A;  3PSF A;  2HVR A;  3AL0 B;  4B47 A;  3L2U A;  4Y3O A;  1HA8 A;  3BG6 A;  1N77 A;  1BR2 A;  4PK4 A;  5JHF A;  4BDY A;  3W2V A;  2K3P A;  2LH9 A;  2R4G A;  4IQ4 A;  4KJZ A;  1ERD A;  1BR4 A;  2F6C A;  3DTK A;  3NWT A;  3DPU A;  5CKT A;  3AFH A;  3ONQ A;  4PJN A;  1X1A A;  3VYS B;  4HRI A;  2ELJ A;  4PSW A;  3S3O A;  2Y0S A;  4CCO A;  4ITV A;  3OR1 C;  4XN0 A;  4E7L A;  4DBR A;  3PJR A;  3MD2 A;  4E7H A;  3I3L A;  3QOD A;  2HDW A;  4P5O A;  4JQF A;  1UAA A;  3W2A A;  2W1O A;  3U21 A;  1LKX A;  4E6K G;  4F52 A;  4XLF A;  3C2G A;  3D5R C;  3D5S C;  3BLY A;  2LBF B;  3VSK A;  1WJC A;  3K70 C;  4PFP A;  4JOM A;  2R7T A;  3V42 A;  4Y4R A;  4CA0 A;  3RTR A;  3SZG A;  4BS9 A;  2X51 A;  3H5N A;  2VPL A;  1WJE A;  2HPM A;  1U0J A;  3FBN B;  2Q2E B;  3GBG A;  2CUZ A;  1V5E A;  5KHD A;  2UV1 A;  4CCM A;  3VYU B;  2VQG A;  4PJJ A;  3G2B A;  2HZD A;  2M3A A;  3OIP A;  2W00 A;  1EA3 A;  2V26 A;  3OMY A;  3E0J B;  3DKX A;  4D1Q A;  2MD0 A;  1D0Y A;  5CPR B;  3SEZ A;  2CV2 A;  3BCA A;  1D1C A;  1QHH D;  4E7K A;  2CV1 A;  4YEL A;  3H9G A;  3HOT A;  1E0E A;  4XKV A;  1N75 A;  2DXI A;  4XON A;  4RM3 A;  3J7A Y;  5FRM A;  3S8P A;  4EAT A;  4BE0 A;  2VKH A;  3CZ6 A;  3K4K A;  3OYJ A;  2PJR B;  3OOU A;  4BJT A;  3FDY A;  3OYB A;  3DPT A;  4IX7 A;  2WY8 Q;  3KYL A;  2MYS A;  5LD2 C;  2K9M A;  3A4C A;  3H9Q A;  5KNL A;  2KZV A;  3LSI A;  2IGN A;  2R7V A;  1WJ5 A;  2X1C A;  2LC2 A;  4D9J A;  2VXD A;  4XLH A;  4XLC A;  4PSX A;  3AKZ A;  4HPQ A;  4XOR A;  4MLO A;  4YEJ A;  2X6Y A;  2VAS A;  2VLA A;  3DPL C;  3PNY A;  1QU3 A;  3H9J A;  3D5L A;  3LL7 A;  4AU7 A;  3I9V 2;  3DLA A;  3DTE A;  4U87 A;  2PMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...