4ZYAA

The n-terminal extension domain of human asparaginyl-trna synthetase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
69
Chain Sequence
MAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSRWNVISKSQLKNIKKMWHREQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Asparagine--tRNA ligase, cytoplasmic
publication title Unique N-terminal extension domain of human asparaginyl-tRNA synthetase elicits CCR3-mediated chemokine activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 69
sequence length 74
chains with identical sequence B
ec nomenclature ec 6.1.1.22: Asparagine--tRNA ligase.
pdb deposition date 2015-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1430 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4zyaA00
2KQRA 4ZYAA
chains in the Genus database with same CATH superfamily
4RB2C 2ZJQF 3OYBA 1KGSA 1VQ7I 3RZDJ 2MLKA 2OBPA 5FROA 4CA0A 4G8XA 4CDGA 5K5OA 3TP3A 3U1KA 3IKTA 1IRGA 5ILVA 3BWGA 5CLSA 1XPXA 4D9JA 2E5NA 2WB1N 5H6QA 2LY9A 3BZ6A 2L7KA 1WJ5A 1P4WA 1W7PA 3FWEA 4BXUA 3KEYA 1ZR4A 3RYPA 2JPCA 1ULYA 3AG2H 2RQPA 1BW5A 1IDYA 2LLKA 5BQTA 2HKXA 1ZN2A 1IV6A 4CYCA 4M3GA 1SD6A 1ZLKA 1RIOH 2GA1A 3F22A 3A01A 1MSEC 4RLQA 2BYVE 2L4MA 2RQQA 1T56A 4MEYF 2KDZA 5HLHA 3K2ZA 1RUNA 3JAMK 3NWTA 1QBJA 1MBKA 3PIOF 4A3MJ 1GHCA 2JJ7A 1IGNA 3MEXA 4XKBA 3CJQB 1GLNA 5L3GA 1FOXA 4M9ZA 1KZHA 4UNOA 3F8MA 2WAEA 4XN0A 3S2WA 4R1HA 1O4XA 2HOSA 3S17J 2EV0A 4IZZA 1J0RA 1W5CC 4DOZA 3QPSA 1XDUA 1HA8A 3V8LA 3E5QA 3BZCA 2NRAC 1J75A 4FASD 5M3FJ 2DMPA 1QZYA 1EJ9A 1A5JA 1LFPA 1B72A 1D8KA 1X4OA 2VJ5A 2XSJC 1MBHA 3OYHA 3MQ0A 2OCCH 2B63J 4JX5A 1GV2A 2DW4A 3FIWA 1CGPA 3Q0VA 2OV7A 3NARA 3O6BB 2MYSA 1TQMA 1MMSA 1ETQA 3CESA 1PDNC 1ITYA 4I76A 1MBEA 5CVVA 2JMWA 2X9DA 3WU2C 3IKVA 5F08A 2QZ8A 3EYIA 5EG0B 1KQ8A 3VOEA 3BG7A 5GP9A 4LLNA 9ANTA 2H09A 3G3ZA 5DM7F 2ZSIB 2XC7A 2STWA 1SVOA 4JYKA 3M8JA 5DEQA 2E1OA 2IEKA 3N05A 2O8KA 3CUQA 1KQ9A 1V3FA 2R3SA 2V1NA 4OINF 4IF4A 2BVMA 4KN7X 4MHGA 1X1BA 4G12A 2IGOA 3KCCA 3AL0C 5DYMA 1MNDA 2JA7J 3CMMA 2LBFA 4HF1A 3ERMA 2XB0X 1U9OA 3OL3A 4FX4A 2BXZA 5ILUA 4XBFA 5HNFA 2ACJA 1ZR2A 1XX5A 1S7EA 1OISA 2VB6A 1RC9A 2QQBA 1FTZA 2KJBA 1FT9A 1IN5A 3QAHA 5HLTA 1TTYA 2V6EA 4L9TA 3MCZA 3BOQA 2Z16A 5J47A 3HZJA 1OKRA 1SC7A 3PNVA 1WWXA 5K5RA 5CVIA 1XGOA 2NVXJ 2FOKA 2FXAA 3LAJA 1VQLI 4CSWA 3WE2A 1ETVA 4HV5A 3WTXC 4IO9F 4PJMA 1DP7P 4PJLA 5E1ZB 2H6BA 3OOPA 2M30A 3LSHA 2OJED 2EZLA 1D1BA 1I27A 2ZMEA 1YFHA 3P5JA 1ONVA 4PFPA 3VYRB 1WJDA 4HOBA 2OPTA 2ECBA 1ZHFA 2A61A 3DFGA 4N9HA 4OU0A 2KKOA 2COMA 3DV8A 4XRFA 3IH2A 3IHUA 2D2WA 2XPVA 3M4OJ 1WJAA 1SVLA 5J6XA 2F2EA 4J00A 3JRIA 3RPUD 4BNCA 2L02A 2L3DA 4JOMA 2E19A 2V9KA 2FEZA 1VFCA 2J5OA 5H2FC 3ZQGA 4QPQA 5E17F 4DGWB 5AIQA 3LSJA 4MGRA 5TRDA 1YG2A 4XLPF 1QPIA 2DYSH 2E1MB 2IGNA 4XQFA 3S3OA 1TZLA 1ODDA 2Z5UA 2EA4A 1DGRM 4FHTA 1XTAA 1Z7UA 2VXDA 4R79A 4P9UA 4IRGA 2HQ5A 3OWTA 3PSFA 2H8WA 1A36A 4KISA 2CW7A 3E5XA 4C3HJ 1V5GA 3DPLC 4XKWA 4A93J 3CF2A 1GXPA 3BT9A 4QTRA 1G6NA 4RGXA 4RAGA 5ICCA 1T33A 1S9HA 3NRVA 2ECCA 3CMYA 3R61A 2P5LC 1OR7A 2MGQA 1JT6A 4Q48A 2GBYA 3DWLE 4LK0F 2M5WA 3WU1B 1BW6A 4KN4X 1S29A 2RNGA 4XIDA 1LVKA 2VJJA 5E3NA 4U0YA 3ZMDA 1R1UA 1WHUA 3CCEI 2NOJB 3R60A 1HW1A 5E1XA 4RM3A 1Y39A 1R22A 1EH8A 1XB4A 3S8PA 3LQRA 1YQAA 1BI2A 1G4DA 5HS7A 1YO5C 3R0JA 4XONA 3UKGA 3DEEA 1J09A 2F5EA 3HTUA 2AQFA 5EEHA 2LTPA 5DDGA 3JAMZ 1JI8A 4MTEA 2DTZA 2F5DA 1EH6A 5TGTA 4BDZA 2VIXA 2XPUA 5K5QA 2JVGA 2R5YA 2LR8A 1VQPI 5DUKA 1O3RA 2GOMA 3ZRGA 4UV8A 4EJVA 1KU2A 3H9JA 4AC0A 3PIPF 3WHCA 3MKLA 3ZMTA 2CH0A 3DQVC 1BC8C 5J3LA 3H0GJ 4ZZLA 2HI3A 4BQAA 3OSFA 1GXQA 2WAFA 3ULQB 5LBQA 3ZMSA 2RN7A 2LREA 3RKYA 2CW8A 3RPQA 4CCLA 4HW0A 5J4VA 2PMZN 2TCTA 4AIHA 2BHYA 2EJRA 2W57A 3KYCB 3ROUA 5FRMA 1XDSA 2QBYB 3ZQ7A 4RA2A 4HNTA 2HDDA 4OIQF 1IF1A 2HZDA 1ZTRA 2MLGA 4HF2A 2FBHA 1M1EB 3CUOA 3QP5A 5HLGA 3D5RC 4NC8A 3MFKA 5HDNA 1I3AA 1BI1A 4PJ0C 5GADJ 5L3EA 4BE1A 2XV4S 2NAZA 2QUFA 2Y2ZA 1LQ1A 2V9PA 1BC7C 2D5VA 2MC3A 4UB8C 4AVPA 4KNYA 2ELHA 4HRIA 1G3TA 2DMNA 3TL4X 1Z9CA 1I6HJ 2VJ4A 2IS6A 4V2GA 2LF7A 1T98A 5L3DA 2KMUA 4Y33A 5FB2A 2RC4A 5IP9J 2H8RA 2QF7A 3KFWX 5EGOA 2BV6A 3BG3A 5K1YA 2DFFA 4A6EA 1FEXA 2FQ4A 2BY2A 5DCMB 1IXRC 4DW6A 4M9XA 2PG4A 4RDUA 2C6YA 4M9SA 2WAQA 2IW5A 2BY1A 3HSRA 1RKTA 1IXCA 5D5WB 3CC7I 1UG2A 3PUFA 3HTSB 3BR3A 3ELKA 2ZO4A 3A03A 2CV1A 3QU3A 4PUSA 1S5LC 4GGGA 2R7QA 4RGRA 5E1WA 5CQGA 2FJ1A 1REPC 4S04A 3HKZA 3B73A 3GEZA 2EFWA 1VQOI 4EJTA 1B9MA 3MWMA 2IPQX 5D6EA 2DQRA 3GZNB 2M2EA 4HAMA 2LRDA 2PJRB 5BMZA 2JT1A 1ON2A 2KLOA 3E5UA 2NXNB 1FLIA 2EWNA 3SXYA 1A04A 3C2HA 1ETKA 3DTIA 4ENKA 4Q5SF 1YITI 2LH9A 2XPWA 2P7CB 3CZ6A 3O2PE 3GLLA 2M45A 3J80K 3PJRA 5FLMJ 4F92B 1R00A 1KU7A 3I59A 3TMOA 4ENNA 3BC8A 3ZQLA 3A4CA 1VI0A 2A05A 3HSEA 4MTDA 1ZG3A 5E3MA 2JZYA 1R5HA 4G7ZF 4CCMA 2FX0A 1NK3P 2VBWA 2DT7B 2DOEA 2EFQA 2DT6A 3KE2A 4JX4A 2Q0OA 2CFXA 1NTCA 2OA4A 3E1SA 4EJWA 1OFCX 1OYIA 3J7AO 5JLWA 1G3WA 2K9SA 3LSKA 4F3QA 3BR6A 5KK1A 2FSWA 2L7FP 2JA8J 1MBFA 3OYKA 3M1CA 1J5YA 4N4OB 1WI9A 2OZUA 3W3CA 3U9GA 3DF8A 1Z1DA 4G6TB 4NQWA 4J19A 3JTGA 4GYIA 4S05A 3QQAA 4X6AJ 2HQRA 4A3CJ 5FO5A 5IYCJ 3RSNA 2VODA 3K4LA 4EVIA 3H92A 3M07A 3OYLA 3FHZA 2XF6A 2K4JA 4DYCA 3OSGA 5M5XJ 2L4AA 5JVTA 1BBYA 3EUKL 2M0MA 3CC2I 1HOMA 2BY3A 2ISZA 1MJAA 2HVQA 1MNEA 1Y56A 3TDZC 5J4YA 1RZ4A 3I3LA 2V7FA 1JKPC 2VT3A 2VKEA 2VOOA 1R4NB 4EGZA 4M74A 2R7UA 1JT0A 5F0CA 4BUPA 1WJFA 4WCGA 4LG0B 4HZFA 2DODA 3FK7A 4XSZF 1QU3A 2H1LA 4UUSB 4KA4A 5IYDJ 3DP7A 3JR9A 3S1QJ 1OPCA 3G1LA 1AKHA 4HQEA 2KZVA 3ZMZA 1TWHJ 1IN4A 4D7NA 3DTEA 2JA2A 2VJIA 5B1AH 5IOZA 1A35A 2VUMJ 1BOAA 2EIJH 1FOWA 5AONA 3V8KA 2Y9YA 1MBJA 2W24A 2ZKZA 3BQZA 1IRXA 2A07F 2H94A 4KUMA 4ZTFA 3SDGA 3C18A 4HX4A 4MQVA 3IUOA 3DCFA 3GO5A 4C2UA 3ZOBA 2VQLA 2ESNA 4O3MA 1BI0A 1TNTA 3L2UA 4G7HF 2KIMA 1WVRA 2JSPA 1HBXG 2IS4A 3GUDA 2J5PA 1J2XA 2L9NA 2X6YA 2MFZA 3LA7A 3RCOA 4HDVA 1KU9A 3E7LA 2VI6A 4KT6A 3TP0A 1ZGAA 3FXMA 4U87A 2MD0A 4NUBA 1SFEA 1PVEA 2Q8KA 5BNGA 2F4OB 4IXAA 2OD5A 3W6KB 2EFOA 4W1UA 2NVQJ 5LHGA 1Z3YA 4FT8A 5D8KB 4UVBA 4A3KJ 2E35A 3ABLH 1GT0C 1P92A 1YLFA 2P0WA 3U21A 2Y69H 3OYGA 2VBYA 2K9NA 2HGCA 3G1MA 2DA4A 1XD7A 2OU2A 1IUFA 3WTZA 3ZR8X 5L3CA 2V1DA 2Z2SB 3BTIA 1V5EA 1AWCA 2GQQA 2M4KA 3HL2A 1IN7A 4KMUX 3NEUA 4XNFA 3TO6A 2X85A 4ANJA 2UZKA 2LSOA 3HRMA 4UY8I 2GZWA 4JBAA 1FTTA 4DBRA 3D5SC 3BG6A 2CJJA 4C3IJ 2R5ZB 5LD2C 3J7YJ 3H3VK 3K0LA 1ETWA 1WQ2A 3LSPA 2VONA 1ZGJA 3ZGKA 4IQ4A 5TISC 3FBIB 2RVCA 2E2HJ 1FSEA 1FX7A 1V4RA 3QYBA 1HW2A 4A3LJ 3J7ZI 1HSTA 3QYEA 1R23A 3GWZA 2ICWG 2EQRA 2K7LA 3QPHA 2G7UA 2B9SA 1ETYA 1R5GA 4PDKA 5H20A 2HYJA 5GTIC 2ADUA 1MJ9A 1XN7A 1Z3XA 3DLLF 5J8FA 5ILSA 1ZQ3P 2XGXA 2RDPA 3NWSA 5IOYA 2RKHA 4FETA 1SFKA 3GX4X 3TOBA 4M6XA 2M3AA 3IL2A 4BHBA 1A31A 2DMTA 3OY9A 2Y9ZA 1XS9A 1VF9A 3MVPA 3HG9A 4N9IA 3H3UA 3PNYA 1J7KA 1MBGA 4XRSA 5FKLA 4DQ2A 3CJTB 4CCJA 2CQQA 3DPTA 3J80Z 3WTTC 3OYCA 4Y4RA 4A3GJ 2A5WA 3KP3A 5HS9A 5EJCA 3OMYA 4A3BJ 4ZYHA 2R92J 4EJOA 1IRFA 1EA3A 4IHWA 3FXLA 4LB5A 2Z1DA 3GFLA 4MFEA 2XKOA 3ASOH 3DXJF 5D5VB 4XRSG 3SFZA 1MMDA 4CCKA 3CC4I 2M4GA 3LSRA 4DIQA 3OYEA 1B8IB 5FD5A 1QVTA 3HJEA 4BBSJ 3IH3A 2E7WA 4YRVA 1O3TA 3DPUA 3GTQJ 4JQFA 2DA2A 2ME6A 1OCTC 1K6YA 1HQCA 1F36A 3R0AA 3K2AA 3KEQA 1W7PD 2E5ZA 4CZCA 3F8FA 3GYHX 1GDTA 1AA7A 1IC8A 2I10A 2V1XA 4LFUA 3E6DA 3KZIC 4II2A 1G2HA 1ZLJA 2W00A 1FBQA 2BGCA 4KT5C 1R58A 2YX7A 2ZJPF 2TRTA 1DPUA 4RMNA 2WV1A 4L9VA 3TDUC 4KITB 3I4NJ 1TT5B 2VKDA 5FFXA 3DEWA 4YEJA 2GAUA 5KHDA 2EFPA 3LFKA 1QRYA 1K4TA 4QWQA 3HYIA 5AIPA 3LA2A 2O9LA 4B09A 4P96A 2VN2A 2DQLA 1YYVA 3K4KA 3QPLA 4M3BA 5D8LB 3F23A 1NG7A 3HOYJ 1BL0A 4BE0A 2HEOA 1SMYF 3GVAA 3JTHA 3FXKA 4IHVA 3CO7C 3ZN1A 2UXNA 4OIRF 2LMDA 4GXOA 1RI7A 2GIVA 2V9VA 4QSHA 1IW7F 3W2VA 3CCMI 2R0QC 2V4JC 2QKMB 5BPDA 3OYAA 2DFIA 2FOWA 2R7DA 2MABA 1X4PA 5LLQA 2XGCA 4LK1F 1R71A 1VQKI 4IL6C 4M6VA 1HF0A 1ACIA 1SD7A 1IJWC 4HLXA 2Y0MA 3A01B 2V1UA 1MMNA 2BW3A 4X0GA 1OCRH 4CCNA 3ZQHA 3KP6A 2JUCA 3TGNA 2LFBA 4IJAA 2R4GA 5IP7J 4A12A 1ETOA 3FXOA 3OYMA 3CO6C 2HTSA 2QSGX 1SD4A 3K70D 2WADA 4NC7A 2K86A 1N77A 1RR7A 3I55I 2DYRH 1K4SA 3M9AA 4A3FJ 4ASNA 2FA5A 1ON1A 2EK5A 2KISA 4E7SA 3IWZA 1BN5A 1T0FC 5D5UB 4BY7J 3KPHA 1YIOA 5E8IA 2BBYA 2ZSHB 2JRTA 3ABTA 2DN0A 3JREA 3DLAA 3EUHA 4GDFA 1QZZA 2HPIA 3BLYA 2NYXA 3BCAA 1ERDA 4CICA 5K7ZA 1FYLA 2XAGA 3R4KA 3RQ4A 1R1TA 1U5TC 3AKZA 1YTYA 5LRSA 1O3QA 2R7VA 2WAQN 3BPXA 3IRRA 3FMRA 1X1CA 2V79A 5GAHJ 2CWEA 1JJ6C 2HZTA 4N0BA 2HDWA 4OMYA 2W85A 3BQYA 1ZG1A 1EKEA 2XB5A 2E1NA 3DKWA 1R6RA 3ZCOA 1W5SA 2LKSA 3F72A 4B3AA 4HDUA 1GVDA 3HKZN 2A6HF 2A69F 3I4MJ 2Y48A 3WGGA 3GFJA 3ZPLA 2K9QA 3FXUA 2FMYA 3CUQB 2EIMH 3EQLF 5TJJA 4PCQA 2XHKA 4HSTA 1QA6A 3S32A 4UVCA 2Z3YA 3ZQCA 3WGHA 1IAWA 5IYBJ 2PJPA 5CPRB 3DBLB 2LBFB 1I5ZA 1PP8F 3I53A 1S72I 3BCBA 4WF2A 1X3UA 1BIBA 1SAUA 1X2MA 1FOYA 1XSVA 2H6CA 1Y0NA 3H9GA 4XLAA 3JRCA 2CUZA 3N4MA 1OCOH 2FF4A 2BVLA 2FE3A 3RKWA 4L0YB 1CQTA 3T1BA 3H3ZA 3OIOA 3MD2A 2EINH 2Y31A 1ZYRF 2G9WA 2ZFUA 4E6KG 1UZCA 5GTHC 2ZBKA 2DFEA 1XSDA 4MLOA 1VQ9I 1HKSA 2P81A 2DJNA 4CXFA 2LF8A 3BP8A 4OOIA 1LE8B 1S3JA 1D5YA 3BPVA 5FD6A 3S2DJ 2K4BA 4LITA 1UELB 3CCLI 1H8AC 2R7XA 2NS0A 2QA4I 5FLXK 2ZMEB 2X6OA 4B44A 3HOVJ 3CDIA 3A0BC 2ZXHA 4PSXA 4CO8A 4DZJA 4WX9A 4OAZA 4NB5A 3MMYB 4BE2A 2R7ZJ 4IX7A 2R7WA 3PSIA 2YU9J 2CU7A 3HHHA 1MD0A 3ONQA 1LFUP 4L18B 3JSPA 3L2RA 5CVUA 2KQRA 4AU7A 2W7NA 1K79A 1DDNA 4M3DA 2P6SA 3TW6A 4UVAA 4LIVA 1SFOJ 3KZYA 3J7AY 2X1DA 1O7LA 4I2OA 4M71A 2IT0A 2O7OA 1OYYA 3KYDB 4OAYA 4PJNA 1A6IA 3G1OA 1FBSA 3ZN0A 3ABMH 1U3EM 4EJUA 2BY0A 1O57A 5C44J 1JTXA 2D1HA 2EZIA 2L01A 1SMTA 3WTUC 4LLGF 2CQKA 3BTCA 2Y0SN 3CTAA 1D0XA 1W4MA 3F8CA 4LB6B 1MH3A 3H5AA 1KONA 3HOSA 3FX3A 4E7HA 3TOAA 2CV0A 3U2RA 1BR1A 5IT9K 2MBFA 1IN8A 4KDPA 3VDXA 4QPOA 3U1DA 3PNTA 3QU6A 4A0XA 5IT3A 3HC7A 1IDZA 2EV5A 2LP0A 2XRLA 1YW8A 2DT5A 3PQJA 5GPAA 5D4SA 1MIJA 5F1JA 1TWFJ 3RI4A 2KJCA 3HB9A 3RTRA 4J01A 3F8BA 1WRJA 2Q2EA 5EF6A 2W1OA 3K4NA 2AXLA 4BU2A 4RAZA 1NK2P 3IP4B 3R6SA 1MMAA 1BR2A 3FBNB 3E97A 3VPRA 1O7FA 1B9NA 5JVGF 1GUUA 1TWAJ 1WZ2A 1B59A 3S1NJ 2XAQA 3VODA 1BI3A 5KCMA 2QBYA 4ZZDA 4ZDPA 5CKTA 3GBGA 3G71I 2ZJ2A 3WG7H 4AWXB 3D1NI 3WTSC 1GV5A 5F64A 2LNBA 3JRDA 2DK8A 3K1MA 3T8RA 3F6OA 5J1YA 2Z99A 5J1RA 4BEHA 3RKQA 3L09A 1YIJI 1U78A 1ZARA 2DFHA 3S1MJ 2XF5A 1AOYA 3H35A 2DU9A 3PFYA 5LFAA 3HGGA 2DAOA 2R7RA 4E7KA 1XCVA 3ZQQA 2L5QA 4D7MA 1OCPA 3A0HC 3VSLA 2G0EA 4YFXF 1ZH5A 3AG3H 5L3BA 3VEPA 4F52A 2DI3A 2CQ7A 2CS3A 2DCEA 1FIPA 4G94A 2OTJI 2VPRA 5E79C 2ZXJA 2DLLA 3A2KA 1XMXA 5DCMA 3ISPA 2K9LA 1TC3C 5J8CA 1FC3A 4RAYA 2A5YB 2HR3A 1W0UA 2W82A 5DD4A 2DO7A 3OL4A 1FIAA 4YFKF 2WBMA 3K70C 3DKYA 2WY7Q 3CUQC 2RV8A 4BAYA 4ESJA 2K85A 1YW9A 1RR8C 1LUJB 2OF7A 3OYNA 3EYYA 2M0CA 3TKYA 2K3FA 4OIPF 4BHPA 4LOCA 1YW7A 2FMLA 4Q47A 2CUFA 1FZPB 2OZ6A 2D1VA 2ELJA 1HKQA 2NOGA 3AFHA 3ZQFA 4EQQA 3KYLA 3BR2A 1U9NA 3Q5FA 1MDMA 2PBIA 4AYBA 3E6MA 4B1RA 2FNPA 1BJZA 3K4MA 1G3YA 2VPLA 1YX3A 1ZKGA 3AG1H 3BROA 4XK4A 2CV2A 1LJ9A 4II3A 2OQGA 3KP5A 1T38A 4ABZA 1JXSA 3FKIJ 3H5RA 1P2FA 2STTA 2HU9A 1W5TA 2OC6A 3SZGA 1R7JA 1EH7A 2MW8A 4A2UA 1HDDC 4Z2YA 3KZZA 1K78A 4GCVA 4XLEA 2QSFX 4IQJA 1XGMA 3B6AA 2P5KA 1ZG5A 2HXOA 6PAXA 4FTHA 4Y13A 1P9QC 5JHUA 4Y52J 3JRGA 4EMSA 2DOAA 3FISA 1UCRA 2L2OA 3NAUA 2HTJA 2ZMEC 4BQOA 2EPFA 5FLXZ 1N75A 4A5MA 2B0LA 5C4XJ 3EPZA 1E2XA 1WJEA 2RNJA 1G8XA 1Y8RB 4NNJA 1VQMI 4HF0A 1NH3A 5DS9A 2K27A 4HNVA 1LPQA 2K9MA 2P7VB 4BYYA 4XLNF 1P6RA 2DA5A 1OMIA 1IUYA 2TDXA 4WXCA 2ID6A 3LSIA 3FK6A 3LAPA 2X1CA 4EATA 1WGXA 1CF7A 3LOCA 3S14J 2NS8A 1V5FA 1HSJA 2LOOA 4FQGA 5B1BH 3W2WA 3HDDA 4G7OF 3FMSA 2LK2A 2V6CA 4WK8F 2WY8Q 2CUEA 3PL8A 4ZYGA 4Y15A 2VLAA 3BTJA 4DZPA 3A1YA 2UV1A 2JPBA 4IHYA 1ZK8A 2E71A 4RGSA 3GTJJ 3I5UA 4NQWB 1E3OC 5JHFA 4G9YA 2CFOA 3QWLA 2ZXWH 1O3SA 1USTA 4C2MJ 3K4BA 1HXDA 2IAIA 5IT9Z 1OR7C 3CP2A 1SD5A 3DTKA 5FLVA 1WI3A 1E3HA 4AVZA 4XOTA 2Y0SA 1YE9A 5E18F 2QEXI 5KAFC 3K1NA 2GIZA 3L00A 4I0BA 1SVMA 3G6EI 2KIUA 4LGWA 1YI2I 3RJPA 1APLC 2GXAA 5DCFA 1NHAA 3KP4A 1OLTA 5ICEA 4IHXA 3P9CA 4I02A 1TQPA 3SYTA 4KYWA 3CCRI 2XGDA 3C2BA 4E7JA 3IRQA 1HLVA 2BXYA 1OCCH 4IOAF 3LWFA 1PJRA 2O5RA 5CVJA 2L7ZA 4U88A 3I0TA 5EEAA 1V55H 2P4WA 3HBLA 2JK3A 4I99C 2E2JJ 2DDBA 4D5FA 2WV0A 5C3EJ 2DA6A 3V4GA 2ME0A 3S3MA 2NVUB 1PUEE 1Y6IA 2DA1A 1IZ1A 1X2NA 3BR0A 1JTYA 4AUXA 1A6QA 4KIBA 2LKXA 3S93A 5LHHA 1U5TB 5FKOA 5ED4A 1KYWA 4R8HA 3CMAI 3HRUA 2X1EA 3EDPA 1Z67A 4ESBA 4EGYA 2E1CA 1RETA 2IJLA 2VE9A 1BM9A 1MW7A 4OMZA 2JWTA 2QM3A 1HCRA 2ZC2A 3ECHA 4E70A 1YRNB 1I50J 2AO9A 5D4RA 4F91B 4X1EA 1QPMA 4LLLA 2YX4A 4D5CA 1ZELA 2R5ZA 2KT0A 5B3SH 1USSA 2KZGA 2Z33A 3DU5A 3GXOA 1F9NA 5A2QK 3MZYA 4B43A 2KIFA 2K02A 3HUGB 3OYDA 1POGA 1TQIA 3FMQA 2GXBA 2DJIA 2DXIA 2HS5A 4AD9A 3LNQA 5BOXA 4A6DA 3P7NA 4EM1A 3T5XA 3OIPA 3BG9A 2VXZA 3K4CA 3GTGJ 1TT0A 2XUBA 3AG4H 5KAIC 4NC6A 3MKZA 5BS6A 3SEZA 3HHGA 2VT2A 3C1DA 2FU4A 3FXQA 1IV8A 5JR3A 2KRCA 3TBIA 1T6SA 2XASA 3KEOA 2W4SA 2RREA 2PMUA 3GTOJ 5LGTA 5EYRA 4RB3C 5JFRA 2QSHX 2QVOA 1R36A 4YIIA 2B7EA 2IXSA 4FISA 2HDCA 1WJBA 2L0KA 3TO7A 3C7JA 4GRIA 3RKXA 3F0CA 3LSMA 2H27A 4ZYDA 5DM6F 4F7ZA 1JKRC 1WFXA 3A02A 2NVYJ 4L0ZB 4BL0B 3GCMA 3OS1A 4IRHA 2R7FA 2WC2A 2DA3A 1PUFA 1S8NA 2XROA 3Q0UA 3VFZA 2EB7A 3SJMA 2DDAA 4CCOA 2JTVA 5FGMA 4XLHA 3MZ8A 1B8IA 1TNSA 1R5ID 3AAFA 5FKMA 3HOTA 2JA5J 4ZDOA 4HV6A 3PFIA 2BZTA 2OAZA 2QKLB 3I71A 1X1AA 2D45A 3BR5A 4P1WA 1FY7A 2PX9A 4XKVA 3FM5A 2LC2A 1TBXA 4M72A 3PQKA 5E20A 2HXIA 1R9TJ 1BOBA 2FBKA 3MKWB 4ZC3A 2VQGA 4H4KC 1JUPA 3GTPJ 4XICA 2E34A 3CQZJ 3LL7A 2IBDA 4U0VA 1X1PA 3RIRA 3CF5F 1FMWA 1X1DA 2OUMA 5K7FA 2IGKA 3O8GA 3QOEA 1K61A 1S7AA 2BOLA 1KYZA 1XSXA 5LGUA 5EDNA 1LEBA 1R4MB 3HM5A 4U7DA 1U2WA 3QP6A 1FJLA 4ESFA 1SANA 4YELA 2IA2A 1TWGJ 5F0HA 2XVCA 2GLOA 5HVQC 4EV0A 2VL8A 4EEFG 1UMQA 3K1PA 3BDDA 1Z21A 5HS8A 2Y75A 3LSGA 3BY6A 1K7AA 2CMPA 2WWYA 4PGGA 4JK1X 3DBHB 3O8HA 1W7PB 3QODA 4JX6A 4V19K 3K10A 3HRTA 4XSXF 2PN6A 4N4NB 3C2GA 5E3OA 1TW2A 1WH5A 2CSOA 4O5VA 4GYGA 1JKOC 4CYCB 2LYCA 4I6ZA 2QWWA 2X6XA 2MH9A 5B66C 1YJ9I 1T8IA 3GTKJ 4IHTA 2R7OA 1WKMA 4HBLA 2QYOA 4FCYA 3DBRB 1RPWA 1XC5A 1I6XA 3KLOA 5LGNA 1LFBA 3IAS2 1HKTA 3J81K 1VNDA 1UHWA 1Z77A 3M8FA 3S16J 3F8NA 3HSFA 3HGYA 1Q1HA 5EG0A 4I01A 2DK5A 4HG2A 1TL8A 1N78A 2KP6A 3T8TA 3GTLJ 4L5EA 4XRMA 1VTNC 3PM1A 3E0JB 2P5VA 3CCYA 4LMYA 3GW2A 1RNLA 2BW3B 2M9HA 5LHIA 2OQRA 1B72B 5K7HA 4KIGA 1F1ZA 2QLZA 2CO5A 3OOUA 1UAAA 3LMMA 4HSRA 1Z6RA 2GA2A 3BTLA 4B4CA 3W2AA 2O03A 1VQ4I 1JHHA 4BGDA 3O3KA 3GZ5A 3CJNA 2COBA 2VKVA 2XIGA 3V42A 5E3LA 2HWVA 4K2EA 3JSOA 3IWFA 4A3EJ 2LY2A 4FX0A 4CHUA 2HYGD 1FSHA 1JUMA 1WJCA 2AHQA 2X0LA 4D1QA 1Z91A 3MN2A 3JRFA 1OYWA 2H1KA 1D3YA 2GXGA 2QGUA 2DOFA 2CUJA 5GAGJ 3HPHA 1EF4A 2HYFA 4C30A 1HDPA 1LDDA 1VQ8I 1FNNA 1UB9A 4AYBN 5HODA 5A2QZ 1PYVA 1TP4A 1P7IA 4H0EA 3S3NA 3Q9SA 1T39A 2O6GE 3PO3J 2A6TA 3PO2J 2KL4A 4B48A 1W1WE 2VBXA 4RBOA 5DTDA 4QIWN 2W48A 3FHNA 4YIFA 4PGHA 2DA7A 4NBQA 1SFXA 3ZXSA 3ABKH 2V26A 3L2VA 1RKWA 4HNUA 1IO2A 2MSYA 5HOOA 3LFUA 3Q3SA 5CJ9A 3SZPA 5B5EC 3FF5A 4BACA 1FYKA 3CP8A 2ZB9A 4KFCA 3LA3A 2FD5A 5H6RA 4CH7A 2XRNA 5F1RA 4BXFA 1I1SA 1WPKA 4JP0A 2ELKA 1DGWY 4A69C 1EV7A 3WG9A 1JGGA 3WTVC 3SHFA 1LE8A 3CCSI 4HX7A 5GAEJ 2IA0A 4I0AA 3EUAA 1SAXA 4MEXF 2AQEA 3C3WA 3OS0A 1NG6A 1B6AA 3WTYC 2NS7A 4ZTJA 4B8XA 1LKXA 1STZA 1TLHB 4FE4A 4IOCF 2JN6A 5M5YJ 5ICFA 3SQNA 2DPUA 2DPDA 2JUGA 4M6YA 2EIKH 5FKKA 4HX8A 3HPGA 3COAC 1I1GA 4P55A 1IG7A 4KIFA 5JLXA 1T08B 3FZVA 3DU6A 4Y7NJ 3ABUA 3IH4A 1WSUA 3PUBA 3TO9A 1D1AA 3FM3A 1L3LA 3I56I 1SFUA 1PP7U 2MC4A 2FBIA 1UHMA 2KIQA 2F4MB 1YOVB 2KFDA 4DNCA 4LG3A 1D0ZA 3DEUA 1DUXC 4B3XA 2EZHA 2KDOA 1H9TA 1D5VA 4OIOF 3RPUA 3TW7A 2EFNA 2XSDC 3CMEI 1XMAA 3GFMA 3W6JB 1U0JA 1AHDP 5LRRA 1DU0A 2ZJRF 1VQNI 1W36C 3HOWJ 4E7ZA 1BJAA 2I5UA 3CD6I 1QNTA 2HOAA 1DU6A 3H5NA 4UXNA 4E7LA 2R93J 3ESWB 1MH4A 4HYEA 4IEJA 1E17A 2FQ3A 2HOEA 2YUSA 2NVTJ 1FWZA 3FDYA 1HC8A 3QYFA 1K83J 4BJTA 4AIJA 2MH2A 3H0DA 4L9NA 1KQ0A 3SFIA 4BKXA 5L3FA 3RZOJ 2FRHA 3HIFA 1BR4A 1GVJA 2X4HA 2CW0F 3MKYB 3VYUB 2JSCA 5DD8A 1R1VA 3CCUI 2X48A 1LEAA 3CDLA 1FBUA 3E6CC 3KETA 3CCJI 4BY1J 2VQCA 4BBRJ 2AS5F 4UUVA 2CRGA 3OIQA 4U7BA 2ETHA 1YS6A 1V54H 2WB1A 4MO7A 2GWRA 4KJZA 4ZH4F 3JCUC 4F55A 1DQUA 4MFDA 1D1CA 5FFZA 1C0WA 2LKPA 2L9SA 3G2BA 2O61A 5KVRA 3LQQA 3CCVI 2GOXB 1JUSA 4PZJA 5F04A 3X2QH 1QVUA 3E3VA 3OR2C 3SZTA 2XAFA 4ZJZA 4YIRX 4KMFA 4TV7A 2KPMA 4RAFA 2HFHA 1OJLA 3WU0A 3J81Z 1RESA 2IGMA 2R5YB 3S1RJ 3K4JA 5EEGA 4A0ZA 4YFNF 2EH3A 3OYIA 4ZYEA 4IRIA 2L7MP 5HDKA 3BJAA 1MJBA 2Q2EB 4M3EA 4G6QA 3V8JA 2QQ8A 3DKXA 5IP6A 4A5NA 5HNHA 1G3SA 1YS7A 1Z0XA 3F21A 1Z6TA 4WWCA 1QQIA 1P4XA 1F43A 4A3IJ 5KNLA 1QGPA 5IY5H 2BHZA 4LIUA 4DYRA 3GFIA 3GZ6A 3Q0WA 3MAJA 1UHSA 3M7GA 1T2KA 2UXXA 1H88C 2QQAA 3E6BA 3V7CA 1E0EA 1X3WB 4BEHB 5JI6A 2NNYA 2LY1A 4C3JJ 3BJ6A 4BH9A 3S15J 1P4AA 2M34A 2ID3A 5E8GA 5F6FA 3GF2A 3EUHC 4I7HA 2MG4A 4I98B 2IP2A 3P9IA 3HOUJ 2HQNA 2FNAA 2XAUA 1X19A 1SEUA 1I39A 2M8GX 1ZAOA 3N97A 2XKPA 5EGOB 3BG5A 1VQ5I 1B4AA 2LDUA 2VOPA 2PJRA 3RYRA 1FMVA 3GMEA 3B02A 1FP2A 3GTMJ 4MIMA 2N8GA 5HDGA 2VBZA 2CQXA 2IS2A 1R49A 1XCBA 2VE8A 3ASNH 2O8XA 1XGSA 1Y8QB 2XGEA 2WTEA 2YR2A 2KRFA 4WXDA 1WH7A 3ML6A 4ITVA 2ISYA 2PEXA 3WGIA 1UJ8A 2F4IA 3KP7A 1LNWA 4XM3A 3VB2A 2L54A 2P8TA 1L0OC 2A6EF 2ZNZA 4IPAA 5LEKA 3L2WA 1AU7A 4ON0A 2YPRA 2CG4A 3CCQI 2O0YA 4AIDA 3HOXJ 3V7SA 1IRZA 1Y0UA 1H9GA 2RGVA 1BA5A 1VZ0A 3V7RA 2HPMA 1MDMB 2LD5A 2XAJA 2MA3A 5D6FA 3I58A 3VSKA 1J59A 4IHSA 2F5VA 2X51A 4D0PA 1FP1D 4IVNA 3K69A 2IRFG 2XAHA 4W97A 1IXSB 4RLFA 1P7JA 4L9JA 1XGNA 3I64A 2QCOA 2R7SA 1F5TA 3IV5A 3IC7A 4C9YA 2OTLI 1KA8A 2IA1A 3I54A 3BJOA 3FXRA 3I59B 3FXJA 4M3FA 3RDIA 5F0FA 2JQ7A 2JA6J 3F3XA 1RRJA 3FKJA 1YJNI 1I3QJ 2R7TA 1T95A 5IPAA 1FOKA 3CLOA 1S7OA 2BE5F 4XLFA 1QHGA 1OCZH 1K78B 3OYFA 4Q4ZF 5F27A 5CYVA 4A3JJ 2BEOA 3ZP5A 3NQOA 4E7IA 1MGTA 3SDBA 3L7WA 3WE3A 4PSWA 3EETA 3K6GA 2K3PA 1D0YA 3F6VA 1W0TA 2E1MC 2HNHA 3KIOA 3L2CA 2NNNA 5DV5A 4F93B 2JRMA 2PI0A 1ETXA 2WA0A 3QPTA 4RS8A 3UNGC 1IN6A 3OYJA 1QHHD 3JRAA 1Z7LA 2K5CA 1ZRDA 4LG0A 1UG0A 4BXXJ 1XMKA 1BIAA 2KRHA 5HLIA 3D0SA 5FKNA 1G59A 4UUSA 4HLYA 2MD5A 4GO1A 1MZBA 1Z05A 2OCEA 2GM4A 2CYYA 5ICGA 3TEDA 2PMHA 4AM3A 4WXHA 4DBQA 4LD5A 2EA2A 1Y1VJ 1CF7B 1ORKA 3BR1A 1E3PA 2KHMA 1JHFA 4M73A 1X3ZB 4XN3A 4HA8A 4DJAA 5FJ8J 4RM2A 1MNMC 2PLYA 2XF7A 4PK4A 3WODF 4P5OA 3H1CA 4LJZF 2E60A 3KX2A 4HEA2 4UB6C 4Z6YA 3QRFF 1JJ8C 2F6CA 4XORA 2XDVA 3P9KA 3L9FA 1FPQA 3JRHA 2O3FA 4XLCA 3UR3C 3REOA 2VC1A 3L1PA 3MZHA 3HRSA 5J1UA 4Y17A 1ENHA 4ENMA 2VKHA 4UHTA 1AKHB 5EZGA 2YU3A 2VASA 4HQMA 3SEQA 2VQHA 2X6WA 4A0YA 2M87A 2QQ9A 2M7BA 1XG1A 5DUIA 2UUZA 4U0WA 3QOPA 3L2QA 2LVSA 4AIKA 1FYMA 1Q1VA 4BQQA 3RQIA 2W84A 4EM0B 3CLQA 1TW3A 5M3MJ 4L5JA 4HPQA 3ZQIA 2ZXIA 1T0FA 3CJRB 2ZCWA 1LVAA 4G6DA 4RGUA 1H89C 4ENJA 2HQAA 2I8DA 4XL9A 3W6VA 4PFOA 3TQNA 4BJ6C 2YSRA 2ZNYA 1U5TA 1QZEA 2EV6A 4P9FA 5FRNA 1MSFC 1U6GA 2IVMA 4BJ5C 2E2IJ 3ZMUA 2EBIA 2M1BA 1J9IA 5LEJA 1LDKB 5D5XB 4GFBA 3T0YA 3VWBA 1LB2A 3K7AJ 1YRNA 3GLXA 1LDJA 1OQYA 4BQNA 1TWCJ 2E36A 4UV9A 3KLNA 4CGZA 1HW5A 1Y1WJ 1JKQC 5GPCA 4MNUA 2YS9A 1ZRFA 4I09A 3I4PA 2PMZA 4RB1A 2FUG2 3M8EA 4L5IA 4YG2F 4IKFA 1MMGA 1ZGWA 4C2TA 4O6JA 2ESHA 4PJJA 1UFMA 1U8BA 3HUGA 3AL0B 4A3DJ 1D8JA 4MQ9F 5CVRA 2F5CA 4ZYAA 2EZKA 1RUOA 2VC0A 3Q9VA 3WHBA 2P6TA 3ECOA 4ETSA 2M8EA 2CQNA 4V2FA 1WCMJ 1QO0D 3H36A 2CGPA 2F48A 3VYSB 2QENA 4Y3OA 4BS9A 2HVRA 3ERED 1JE8A 1S6LA 3VYTB 4RB0A 3OR1C 4B47A 1YX5A 4CYDA 2EILH 5BPIA 3HXLA 2UWMA 3H9QA 2Y30A 3CDHA 4UUTA 3BZKA 1DPRA 4NDLA 4XMYA 5CQEA 2E7XA 1K6OA 2Q1ZB 1JGSA 4EM2A 2HVSA 3D5LA 2PFBA 2LG4A 1YHQI 3OV8A 4BDYA 1ZREA 2HOTA 1VQ6I 1MKMA 5ERIA 3WTWC 1W36D 3K9TA 4CZZA 5J40A 2DTRA 3ZMVA 3LSTA 1KU3A 4XR6A 3IAM2 2G7HA 2L9RA 4XKCA 3G4SI 4ZDLA 3G73A 4QLCU 1U8RA 2F5FA 3JW4A 1X58A 2A68F 2HKOA 2RAEA 3S2HJ 2DMUA 2IS1A 2ZFWA 4OWRB 4S0HB 2PQ8A 3B6CA 2JVHA 4BHCA 3F9KA 3M3YJ 5M5WJ 1F4KA 4FE7A 1ZRCA 2K40A 2W25A 2L9VA 2DMQA 4DYQA 3JRBA 4NHJA 2DBBA 1H0MA 2AXTC 3KP2A 1PUFB 3I9V2 1B1BA 4XOPA 1N25A 3HEFA 3HOZJ 4CUGA 3OS2A 4E4HA 1DP3A 3M1EA 4KICA 2M7AA 5C4JJ 2A3SA 2Z9OA 5EZHA 1YJWI
chains in the Genus database with same CATH topology
4C2UA 3OYBA 2VQLA 3EUAA 3L2UA 2AQEA 2JSPA 3OS0A 2W82A 5FROA 2IS4A 1NG6A 3OL4A 4CA0A 2X6YA 2L9NA 2MFZA 4ZTJA 3K70C 2WBMA 1LKXA 3DKYA 2WY7Q 3RCOA 4D9JA 2E5NA 2JUGA 4KT6A 2L7KA 1WJ5A 3OYNA 3HPGA 4U87A 2MD0A 3KEYA 4NUBA 3DU6A 2ELJA 3AFHA 3PUBA 1D1AA 3KYLA 2MC4A 1Z3YA 4RLQA 2RQQA 4LG3A 4AYBA 1D0ZA 2P0WA 3U21A 4B3XA 2KDOA 3NWTA 3K4MA 2VPLA 1YX3A 3OYGA 4XKBA 3CJQB 1GLNA 2CV2A 4II3A 2WAEA 4XN0A 1U0JA 3ZR8X 3H5RA 4IZZA 4DOZA 2Z2SB 1W36C 2HU9A 4E7ZA 2OC6A 1V5EA 3SZGA 2M4KA 3HL2A 1HA8A 4XNFA 2X85A 4ANJA 3H5NA 4E7LA 4XLEA 4FASD 4IQJA 4DBRA 3D5SC 3BG6A 1LFPA 5LD2C 1X4OA 2VJ5A 3FDYA 2XSJC 3OYHA 1P9QC 3QYFA 2DOAA 3ZGKA 4IQ4A 4BJTA 2L2OA 2OV7A 3H0DA 2MYSA 3FBIB 4BQOA 3CESA 1N75A 3QYBA 3EPZA 1BR4A 1WJEA 1G8XA 3MKYB 3QYEA 4NNJA 3VYUB 3BG7A 2K9MA 2VQCA 2ZSIB 2XC7A 1Z3XA 3OIQA 3LSIA 3M8JA 4U7BA 3NWSA 2WB1A 2X1CA 1SFKA 4FETA 3N05A 4KJZA 4EATA 4F55A 1DQUA 2M3AA 1D1CA 1V5FA 2L9SA 2LOOA 2V1NA 3G2BA 2BVMA 3W2WA 3OY9A 1X1BA 2IGOA 2GOXB 3OR2C 3AL0C 4ZJZA 1MNDA 3HG9A 3CMMA 3PNYA 2LBFA 2KPMA 2WY8Q 3PL8A 2VLAA 3OL3A 3A1YA 4CCJA 3DPTA 3OYCA 2UV1A 4Y4RA 2IGMA 2A5WA 3K4JA 4NQWB 5HNFA 3OYIA 3OMYA 5JHFA 2VB6A 2Q2EB 2CFOA 3DKXA 1EA3A 5HLTA 5HNHA 2V6EA 3K4BA 2Z16A 1OR7C 2Z1DA 3CP2A 3DTKA 4AVZA 5KNLA 3PNVA 1MMDA 4XOTA 4CCKA 2M4GA 2Y0SA 1YE9A 4LIUA 4DIQA 3OYEA 4CSWA 4YRVA 1E0EA 3DPUA 4BEHB 4JQFA 4PJMA 1OLTA 1K6YA 4PJLA 2LY1A 3LSHA 2E5ZA 3SYTA 4CZCA 1D1BA 4E7JA 1AA7A 4PFPA 3VYRB 1WJDA 3EUHC 1PJRA 2O5RA 4II2A 2XAUA 1X19A 2W00A 1WJAA 4RMNA 4KITB 4J00A 2VKDA 3S3MA 3RPUD 1Y6IA 4JOMA 4YEJA 5KHDA 2V9KA 2PJRA 1FMVA 4QPQA 4DGWB 3K4KA 3S93A 2IS2A 1NG7A 4BE0A 2E1MB 2IGNA 4XQFA 2X1EA 3S3OA 1TZLA 4ITVA 1DGRM 1MW7A 3W2VA 2F4IA 2VXDA 2V4JC 4R79A 4XM3A 2QKMB 3OWTA 3OYAA 3L2WA 3PSFA 4KISA 2MABA 2CW7A 1X4PA 4F91B 1V5GA 3DPLC 4XKWA 3CF2A 1ZELA 1VZ0A 2HPMA 1S9HA 3DU5A 3VSKA 1MMNA 2BW3A 4X0GA 2F5VA 2X51A 4CCNA 3DWLE 4B43A 3HUGB 3OYDA 2R4GA 4RLFA 2RNGA 2R7SA 2DJIA 2DXIA 1LVKA 4C9YA 3OYMA 2VJJA 3OIPA 2VXZA 3K70D 2WADA 4NC7A 1N77A 3K4CA 1TT0A 2NOJB 3FKJA 2R7TA 1T95A 3MKZA 4RM3A 4XLFA 3SEZA 4E7SA 1QHGA 3S8PA 1T0FC 3OYFA 2ZSHB 3DLAA 2KRCA 3TBIA 4E7IA 2HPIA 3BLYA 3SDBA 3BCAA 1ERDA 2W4SA 4PSWA 2RREA 3DEEA 4XONA 1J09A 3K6GA 2K3PA 3RQ4A 3AKZA 1D0YA 2R7VA 2E1MC 2HNHA 1X1CA 2AQFA 4F93B 1JI8A 2WA0A 2HDWA 3UNGC 5TGTA 4BDZA 2IXSA 2VIXA 3OYJA 1QHHD 1Z7LA 1WJBA 2K5CA 2JVGA 1UG0A 4GRIA 3LSMA 2GOMA 3ZRGA 2KRHA 3H9JA 1R6RA 3ZCOA 1G59A 1WFXA 2CH0A 3DQVC 4BL0B 2WAFA 3OS1A 2LREA 4CCLA 2CW8A 4DBQA 4HSTA 5FRMA 3S32A 4CCOA 2KHMA 4XN3A 4DJAA 4XLHA 4RM2A 4HNTA 2XF7A 5CPRB 4PK4A 4P5OA 3HOTA 2LBFB 4ZDOA 2HZDA 2E60A 3KX2A 4HEA2 2QKLB 1X1AA 4P1WA 3D5RC 3BCBA 2F6CA 4NC8A 4XORA 2XDVA 4XKVA 1SAUA 2LC2A 4BE1A 4XLAA 3H9GA 4XLCA 2CUZA 3UR3C 2VKHA 4HRIA 2BVLA 1BOBA 3TL4X 3MKWB 2VJ4A 2VASA 2VQGA 4ZC3A 4H4KC 2IS6A 3SEQA 2VQHA 2X6WA 2KMUA 2M7BA 3LL7A 4Y33A 2UUZA 3MD2A 3L2QA 2ZFUA 4E6KG 1FMWA 1X1DA 4MLOA 2OUMA 4BQQA 2IGKA 3QOEA 4HPQA 2ZXIA 3CJRB 2BOLA 2HQAA 2I8DA 4XL9A 2WAQA 4LITA 4PFOA 1UELB 4YELA 4BJ6C 5FRNA 5HVQC 2R7XA 2VL8A 2CV1A 4PUSA 4BJ5C 1Z21A 4B44A 2R7QA 2ZXHA 3LSGA 4PSXA 1LDKB 2CMPA 5CQGA 4OAZA 4BE2A 3MMYB 3VWBA 4IX7A 2R7WA 3HKZA 3PSIA 3QODA 4BQNA 3K10A 3ONQA 4N4NB 3C2GA 3L2RA 4AU7A 2KQRA 2W7NA 2PJRB 2LRDA 2PMZA 2FUG2 2LYCA 2KLOA 2X6XA 4IKFA 4LIVA 1MMGA 4C2TA 3J7AY 2R7OA 4PJJA 2X1DA 3C2HA 3DTIA 3AL0B 2LH9A 4OAYA 3CZ6A 3IAS2 4PJNA 4ZYAA 3PJRA 4F92B 3TMOA 3BC8A 3A4CA 4HG2A 1N78A 2KP6A 1D0XA 4CCMA 3H5AA 1KONA 3VYSB 3HOSA 4E7HA 4Y3OA 2DT7B 4BS9A 2CV0A 3E0JB 1BR1A 2HVRA 2DT6A 3VYTB 2BW3B 3VDXA 3OR1C 4QPOA 3E1SA 4B47A 3OOUA 3PNTA 1UAAA 3HC7A 1YX5A 3LMMA 3LSKA 4F3QA 4HSRA 3HXLA 2UWMA 3H9QA 3W2AA 4XMYA 5CQEA 4BGDA 3OYKA 3M1CA 4N4OB 2Q1ZB 3W3CA 3V42A 2HVSA 3D5LA 3RTRA 2LY2A 4G6TB 2LG4A 4J01A 1WJCA 4BDYA 4D1QA 2W1OA 3K4NA 1W36D 4BU2A 3RSNA 3K4LA 3IP4B 1MMAA 3OYLA 1BR2A 2XF6A 3FBNB 2CUJA 4XR6A 3IAM2 3HPHA 3EUKL 4XKCA 2M0MA 4C30A 4ZDLA 5KCMA 2HVQA 1MNEA 1Y56A 4ZDPA 5CKTA 3GBGA 1PYVA 3I3LA 3S3NA 2V7FA 2IS1A 2A6TA 2R7UA 2KL4A 4B48A 4BUPA 1WJFA 4OWRB 3FHNA 2JVHA 3F9KA 4BEHA 1QU3A 2XF5A 3ZXSA 2V26A 3H35A 3L2VA 3PFYA 4HNUA 5LFAA 2R7RA 5HOOA 4E7KA 2KZVA 3LFUA 4BACA 3ZQQA 2L5QA 3DTEA 2JA2A 2VJIA 3CP8A 3I9V2 4XOPA 3VSLA 4CH7A 4BXFA 4CUGA 3OS2A 4E4HA 1DP3A 1IRXA 4F52A 4ZTFA 1DGWY 2M7AA 2CS3A 2DCEA 3IUOA 3A2KA 2K9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQR A;  4ZYA A; 
#chains in the Genus database with same CATH topology
 4RB2 C;  2ZJQ F;  3OYB A;  1KGS A;  1VQ7 I;  3RZD J;  2MLK A;  2OBP A;  5FRO A;  4CA0 A;  4G8X A;  4CDG A;  5K5O A;  3TP3 A;  3U1K A;  3IKT A;  1IRG A;  5ILV A;  3BWG A;  5CLS A;  1XPX A;  4D9J A;  2E5N A;  2WB1 N;  5H6Q A;  2LY9 A;  3BZ6 A;  2L7K A;  1WJ5 A;  1P4W A;  1W7P A;  3FWE A;  4BXU A;  3KEY A;  1ZR4 A;  3RYP A;  2JPC A;  1ULY A;  3AG2 H;  2RQP A;  1BW5 A;  1IDY A;  2LLK A;  5BQT A;  2HKX A;  1ZN2 A;  1IV6 A;  4CYC A;  4M3G A;  1SD6 A;  1ZLK A;  1RIO H;  2GA1 A;  3F22 A;  3A01 A;  1MSE C;  4RLQ A;  2BYV E;  2L4M A;  2RQQ A;  1T56 A;  4MEY F;  2KDZ A;  5HLH A;  3K2Z A;  1RUN A;  3JAM K;  3NWT A;  1QBJ A;  1MBK A;  3PIO F;  4A3M J;  1GHC A;  2JJ7 A;  1IGN A;  3MEX A;  4XKB A;  3CJQ B;  1GLN A;  5L3G A;  1FOX A;  4M9Z A;  1KZH A;  4UNO A;  3F8M A;  2WAE A;  4XN0 A;  3S2W A;  4R1H A;  1O4X A;  2HOS A;  3S17 J;  2EV0 A;  4IZZ A;  1J0R A;  1W5C C;  4DOZ A;  3QPS A;  1XDU A;  1HA8 A;  3V8L A;  3E5Q A;  3BZC A;  2NRA C;  1J75 A;  4FAS D;  5M3F J;  2DMP A;  1QZY A;  1EJ9 A;  1A5J A;  1LFP A;  1B72 A;  1D8K A;  1X4O A;  2VJ5 A;  2XSJ C;  1MBH A;  3OYH A;  3MQ0 A;  2OCC H;  2B63 J;  4JX5 A;  1GV2 A;  2DW4 A;  3FIW A;  1CGP A;  3Q0V A;  2OV7 A;  3NAR A;  3O6B B;  2MYS A;  1TQM A;  1MMS A;  1ETQ A;  3CES A;  1PDN C;  1ITY A;  4I76 A;  1MBE A;  5CVV A;  2JMW A;  2X9D A;  3WU2 C;  3IKV A;  5F08 A;  2QZ8 A;  3EYI A;  5EG0 B;  1KQ8 A;  3VOE A;  3BG7 A;  5GP9 A;  4LLN A;  9ANT A;  2H09 A;  3G3Z A;  5DM7 F;  2ZSI B;  2XC7 A;  2STW A;  1SVO A;  4JYK A;  3M8J A;  5DEQ A;  2E1O A;  2IEK A;  3N05 A;  2O8K A;  3CUQ A;  1KQ9 A;  1V3F A;  2R3S A;  2V1N A;  4OIN F;  4IF4 A;  2BVM A;  4KN7 X;  4MHG A;  1X1B A;  4G12 A;  2IGO A;  3KCC A;  3AL0 C;  5DYM A;  1MND A;  2JA7 J;  3CMM A;  2LBF A;  4HF1 A;  3ERM A;  2XB0 X;  1U9O A;  3OL3 A;  4FX4 A;  2BXZ A;  5ILU A;  4XBF A;  5HNF A;  2ACJ A;  1ZR2 A;  1XX5 A;  1S7E A;  1OIS A;  2VB6 A;  1RC9 A;  2QQB A;  1FTZ A;  2KJB A;  1FT9 A;  1IN5 A;  3QAH A;  5HLT A;  1TTY A;  2V6E A;  4L9T A;  3MCZ A;  3BOQ A;  2Z16 A;  5J47 A;  3HZJ A;  1OKR A;  1SC7 A;  3PNV A;  1WWX A;  5K5R A;  5CVI A;  1XGO A;  2NVX J;  2FOK A;  2FXA A;  3LAJ A;  1VQL I;  4CSW A;  3WE2 A;  1ETV A;  4HV5 A;  3WTX C;  4IO9 F;  4PJM A;  1DP7 P;  4PJL A;  5E1Z B;  2H6B A;  3OOP A;  2M30 A;  3LSH A;  2OJE D;  2EZL A;  1D1B A;  1I27 A;  2ZME A;  1YFH A;  3P5J A;  1ONV A;  4PFP A;  3VYR B;  1WJD A;  4HOB A;  2OPT A;  2ECB A;  1ZHF A;  2A61 A;  3DFG A;  4N9H A;  4OU0 A;  2KKO A;  2COM A;  3DV8 A;  4XRF A;  3IH2 A;  3IHU A;  2D2W A;  2XPV A;  3M4O J;  1WJA A;  1SVL A;  5J6X A;  2F2E A;  4J00 A;  3JRI A;  3RPU D;  4BNC A;  2L02 A;  2L3D A;  4JOM A;  2E19 A;  2V9K A;  2FEZ A;  1VFC A;  2J5O A;  5H2F C;  3ZQG A;  4QPQ A;  5E17 F;  4DGW B;  5AIQ A;  3LSJ A;  4MGR A;  5TRD A;  1YG2 A;  4XLP F;  1QPI A;  2DYS H;  2E1M B;  2IGN A;  4XQF A;  3S3O A;  1TZL A;  1ODD A;  2Z5U A;  2EA4 A;  1DGR M;  4FHT A;  1XTA A;  1Z7U A;  2VXD A;  4R79 A;  4P9U A;  4IRG A;  2HQ5 A;  3OWT A;  3PSF A;  2H8W A;  1A36 A;  4KIS A;  2CW7 A;  3E5X A;  4C3H J;  1V5G A;  3DPL C;  4XKW A;  4A93 J;  3CF2 A;  1GXP A;  3BT9 A;  4QTR A;  1G6N A;  4RGX A;  4RAG A;  5ICC A;  1T33 A;  1S9H A;  3NRV A;  2ECC A;  3CMY A;  3R61 A;  2P5L C;  1OR7 A;  2MGQ A;  1JT6 A;  4Q48 A;  2GBY A;  3DWL E;  4LK0 F;  2M5W A;  3WU1 B;  1BW6 A;  4KN4 X;  1S29 A;  2RNG A;  4XID A;  1LVK A;  2VJJ A;  5E3N A;  4U0Y A;  3ZMD A;  1R1U A;  1WHU A;  3CCE I;  2NOJ B;  3R60 A;  1HW1 A;  5E1X A;  4RM3 A;  1Y39 A;  1R22 A;  1EH8 A;  1XB4 A;  3S8P A;  3LQR A;  1YQA A;  1BI2 A;  1G4D A;  5HS7 A;  1YO5 C;  3R0J A;  4XON A;  3UKG A;  3DEE A;  1J09 A;  2F5E A;  3HTU A;  2AQF A;  5EEH A;  2LTP A;  5DDG A;  3JAM Z;  1JI8 A;  4MTE A;  2DTZ A;  2F5D A;  1EH6 A;  5TGT A;  4BDZ A;  2VIX A;  2XPU A;  5K5Q A;  2JVG A;  2R5Y A;  2LR8 A;  1VQP I;  5DUK A;  1O3R A;  2GOM A;  3ZRG A;  4UV8 A;  4EJV A;  1KU2 A;  3H9J A;  4AC0 A;  3PIP F;  3WHC A;  3MKL A;  3ZMT A;  2CH0 A;  3DQV C;  1BC8 C;  5J3L A;  3H0G J;  4ZZL A;  2HI3 A;  4BQA A;  3OSF A;  1GXQ A;  2WAF A;  3ULQ B;  5LBQ A;  3ZMS A;  2RN7 A;  2LRE A;  3RKY A;  2CW8 A;  3RPQ A;  4CCL A;  4HW0 A;  5J4V A;  2PMZ N;  2TCT A;  4AIH A;  2BHY A;  2EJR A;  2W57 A;  3KYC B;  3ROU A;  5FRM A;  1XDS A;  2QBY B;  3ZQ7 A;  4RA2 A;  4HNT A;  2HDD A;  4OIQ F;  1IF1 A;  2HZD A;  1ZTR A;  2MLG A;  4HF2 A;  2FBH A;  1M1E B;  3CUO A;  3QP5 A;  5HLG A;  3D5R C;  4NC8 A;  3MFK A;  5HDN A;  1I3A A;  1BI1 A;  4PJ0 C;  5GAD J;  5L3E A;  4BE1 A;  2XV4 S;  2NAZ A;  2QUF A;  2Y2Z A;  1LQ1 A;  2V9P A;  1BC7 C;  2D5V A;  2MC3 A;  4UB8 C;  4AVP A;  4KNY A;  2ELH A;  4HRI A;  1G3T A;  2DMN A;  3TL4 X;  1Z9C A;  1I6H J;  2VJ4 A;  2IS6 A;  4V2G A;  2LF7 A;  1T98 A;  5L3D A;  2KMU A;  4Y33 A;  5FB2 A;  2RC4 A;  5IP9 J;  2H8R A;  2QF7 A;  3KFW X;  5EGO A;  2BV6 A;  3BG3 A;  5K1Y A;  2DFF A;  4A6E A;  1FEX A;  2FQ4 A;  2BY2 A;  5DCM B;  1IXR C;  4DW6 A;  4M9X A;  2PG4 A;  4RDU A;  2C6Y A;  4M9S A;  2WAQ A;  2IW5 A;  2BY1 A;  3HSR A;  1RKT A;  1IXC A;  5D5W B;  3CC7 I;  1UG2 A;  3PUF A;  3HTS B;  3BR3 A;  3ELK A;  2ZO4 A;  3A03 A;  2CV1 A;  3QU3 A;  4PUS A;  1S5L C;  4GGG A;  2R7Q A;  4RGR A;  5E1W A;  5CQG A;  2FJ1 A;  1REP C;  4S04 A;  3HKZ A;  3B73 A;  3GEZ A;  2EFW A;  1VQO I;  4EJT A;  1B9M A;  3MWM A;  2IPQ X;  5D6E A;  2DQR A;  3GZN B;  2M2E A;  4HAM A;  2LRD A;  2PJR B;  5BMZ A;  2JT1 A;  1ON2 A;  2KLO A;  3E5U A;  2NXN B;  1FLI A;  2EWN A;  3SXY A;  1A04 A;  3C2H A;  1ETK A;  3DTI A;  4ENK A;  4Q5S F;  1YIT I;  2LH9 A;  2XPW A;  2P7C B;  3CZ6 A;  3O2P E;  3GLL A;  2M45 A;  3J80 K;  3PJR A;  5FLM J;  4F92 B;  1R00 A;  1KU7 A;  3I59 A;  3TMO A;  4ENN A;  3BC8 A;  3ZQL A;  3A4C A;  1VI0 A;  2A05 A;  3HSE A;  4MTD A;  1ZG3 A;  5E3M A;  2JZY A;  1R5H A;  4G7Z F;  4CCM A;  2FX0 A;  1NK3 P;  2VBW A;  2DT7 B;  2DOE A;  2EFQ A;  2DT6 A;  3KE2 A;  4JX4 A;  2Q0O A;  2CFX A;  1NTC A;  2OA4 A;  3E1S A;  4EJW A;  1OFC X;  1OYI A;  3J7A O;  5JLW A;  1G3W A;  2K9S A;  3LSK A;  4F3Q A;  3BR6 A;  5KK1 A;  2FSW A;  2L7F P;  2JA8 J;  1MBF A;  3OYK A;  3M1C A;  1J5Y A;  4N4O B;  1WI9 A;  2OZU A;  3W3C A;  3U9G A;  3DF8 A;  1Z1D A;  4G6T B;  4NQW A;  4J19 A;  3JTG A;  4GYI A;  4S05 A;  3QQA A;  4X6A J;  2HQR A;  4A3C J;  5FO5 A;  5IYC J;  3RSN A;  2VOD A;  3K4L A;  4EVI A;  3H92 A;  3M07 A;  3OYL A;  3FHZ A;  2XF6 A;  2K4J A;  4DYC A;  3OSG A;  5M5X J;  2L4A A;  5JVT A;  1BBY A;  3EUK L;  2M0M A;  3CC2 I;  1HOM A;  2BY3 A;  2ISZ A;  1MJA A;  2HVQ A;  1MNE A;  1Y56 A;  3TDZ C;  5J4Y A;  1RZ4 A;  3I3L A;  2V7F A;  1JKP C;  2VT3 A;  2VKE A;  2VOO A;  1R4N B;  4EGZ A;  4M74 A;  2R7U A;  1JT0 A;  5F0C A;  4BUP A;  1WJF A;  4WCG A;  4LG0 B;  4HZF A;  2DOD A;  3FK7 A;  4XSZ F;  1QU3 A;  2H1L A;  4UUS B;  4KA4 A;  5IYD J;  3DP7 A;  3JR9 A;  3S1Q J;  1OPC A;  3G1L A;  1AKH A;  4HQE A;  2KZV A;  3ZMZ A;  1TWH J;  1IN4 A;  4D7N A;  3DTE A;  2JA2 A;  2VJI A;  5B1A H;  5IOZ A;  1A35 A;  2VUM J;  1BOA A;  2EIJ H;  1FOW A;  5AON A;  3V8K A;  2Y9Y A;  1MBJ A;  2W24 A;  2ZKZ A;  3BQZ A;  1IRX A;  2A07 F;  2H94 A;  4KUM A;  4ZTF A;  3SDG A;  3C18 A;  4HX4 A;  4MQV A;  3IUO A;  3DCF A;  3GO5 A;  4C2U A;  3ZOB A;  2VQL A;  2ESN A;  4O3M A;  1BI0 A;  1TNT A;  3L2U A;  4G7H F;  2KIM A;  1WVR A;  2JSP A;  1HBX G;  2IS4 A;  3GUD A;  2J5P A;  1J2X A;  2L9N A;  2X6Y A;  2MFZ A;  3LA7 A;  3RCO A;  4HDV A;  1KU9 A;  3E7L A;  2VI6 A;  4KT6 A;  3TP0 A;  1ZGA A;  3FXM A;  4U87 A;  2MD0 A;  4NUB A;  1SFE A;  1PVE A;  2Q8K A;  5BNG A;  2F4O B;  4IXA A;  2OD5 A;  3W6K B;  2EFO A;  4W1U A;  2NVQ J;  5LHG A;  1Z3Y A;  4FT8 A;  5D8K B;  4UVB A;  4A3K J;  2E35 A;  3ABL H;  1GT0 C;  1P92 A;  1YLF A;  2P0W A;  3U21 A;  2Y69 H;  3OYG A;  2VBY A;  2K9N A;  2HGC A;  3G1M A;  2DA4 A;  1XD7 A;  2OU2 A;  1IUF A;  3WTZ A;  3ZR8 X;  5L3C A;  2V1D A;  2Z2S B;  3BTI A;  1V5E A;  1AWC A;  2GQQ A;  2M4K A;  3HL2 A;  1IN7 A;  4KMU X;  3NEU A;  4XNF A;  3TO6 A;  2X85 A;  4ANJ A;  2UZK A;  2LSO A;  3HRM A;  4UY8 I;  2GZW A;  4JBA A;  1FTT A;  4DBR A;  3D5S C;  3BG6 A;  2CJJ A;  4C3I J;  2R5Z B;  5LD2 C;  3J7Y J;  3H3V K;  3K0L A;  1ETW A;  1WQ2 A;  3LSP A;  2VON A;  1ZGJ A;  3ZGK A;  4IQ4 A;  5TIS C;  3FBI B;  2RVC A;  2E2H J;  1FSE A;  1FX7 A;  1V4R A;  3QYB A;  1HW2 A;  4A3L J;  3J7Z I;  1HST A;  3QYE A;  1R23 A;  3GWZ A;  2ICW G;  2EQR A;  2K7L A;  3QPH A;  2G7U A;  2B9S A;  1ETY A;  1R5G A;  4PDK A;  5H20 A;  2HYJ A;  5GTI C;  2ADU A;  1MJ9 A;  1XN7 A;  1Z3X A;  3DLL F;  5J8F A;  5ILS A;  1ZQ3 P;  2XGX A;  2RDP A;  3NWS A;  5IOY A;  2RKH A;  4FET A;  1SFK A;  3GX4 X;  3TOB A;  4M6X A;  2M3A A;  3IL2 A;  4BHB A;  1A31 A;  2DMT A;  3OY9 A;  2Y9Z A;  1XS9 A;  1VF9 A;  3MVP A;  3HG9 A;  4N9I A;  3H3U A;  3PNY A;  1J7K A;  1MBG A;  4XRS A;  5FKL A;  4DQ2 A;  3CJT B;  4CCJ A;  2CQQ A;  3DPT A;  3J80 Z;  3WTT C;  3OYC A;  4Y4R A;  4A3G J;  2A5W A;  3KP3 A;  5HS9 A;  5EJC A;  3OMY A;  4A3B J;  4ZYH A;  2R92 J;  4EJO A;  1IRF A;  1EA3 A;  4IHW A;  3FXL A;  4LB5 A;  2Z1D A;  3GFL A;  4MFE A;  2XKO A;  3ASO H;  3DXJ F;  5D5V B;  4XRS G;  3SFZ A;  1MMD A;  4CCK A;  3CC4 I;  2M4G A;  3LSR A;  4DIQ A;  3OYE A;  1B8I B;  5FD5 A;  1QVT A;  3HJE A;  4BBS J;  3IH3 A;  2E7W A;  4YRV A;  1O3T A;  3DPU A;  3GTQ J;  4JQF A;  2DA2 A;  2ME6 A;  1OCT C;  1K6Y A;  1HQC A;  1F36 A;  3R0A A;  3K2A A;  3KEQ A;  1W7P D;  2E5Z A;  4CZC A;  3F8F A;  3GYH X;  1GDT A;  1AA7 A;  1IC8 A;  2I10 A;  2V1X A;  4LFU A;  3E6D A;  3KZI C;  4II2 A;  1G2H A;  1ZLJ A;  2W00 A;  1FBQ A;  2BGC A;  4KT5 C;  1R58 A;  2YX7 A;  2ZJP F;  2TRT A;  1DPU A;  4RMN A;  2WV1 A;  4L9V A;  3TDU C;  4KIT B;  3I4N J;  1TT5 B;  2VKD A;  5FFX A;  3DEW A;  4YEJ A;  2GAU A;  5KHD A;  2EFP A;  3LFK A;  1QRY A;  1K4T A;  4QWQ A;  3HYI A;  5AIP A;  3LA2 A;  2O9L A;  4B09 A;  4P96 A;  2VN2 A;  2DQL A;  1YYV A;  3K4K A;  3QPL A;  4M3B A;  5D8L B;  3F23 A;  1NG7 A;  3HOY J;  1BL0 A;  4BE0 A;  2HEO A;  1SMY F;  3GVA A;  3JTH A;  3FXK A;  4IHV A;  3CO7 C;  3ZN1 A;  2UXN A;  4OIR F;  2LMD A;  4GXO A;  1RI7 A;  2GIV A;  2V9V A;  4QSH A;  1IW7 F;  3W2V A;  3CCM I;  2R0Q C;  2V4J C;  2QKM B;  5BPD A;  3OYA A;  2DFI A;  2FOW A;  2R7D A;  2MAB A;  1X4P A;  5LLQ A;  2XGC A;  4LK1 F;  1R71 A;  1VQK I;  4IL6 C;  4M6V A;  1HF0 A;  1ACI A;  1SD7 A;  1IJW C;  4HLX A;  2Y0M A;  3A01 B;  2V1U A;  1MMN A;  2BW3 A;  4X0G A;  1OCR H;  4CCN A;  3ZQH A;  3KP6 A;  2JUC A;  3TGN A;  2LFB A;  4IJA A;  2R4G A;  5IP7 J;  4A12 A;  1ETO A;  3FXO A;  3OYM A;  3CO6 C;  2HTS A;  2QSG X;  1SD4 A;  3K70 D;  2WAD A;  4NC7 A;  2K86 A;  1N77 A;  1RR7 A;  3I55 I;  2DYR H;  1K4S A;  3M9A A;  4A3F J;  4ASN A;  2FA5 A;  1ON1 A;  2EK5 A;  2KIS A;  4E7S A;  3IWZ A;  1BN5 A;  1T0F C;  5D5U B;  4BY7 J;  3KPH A;  1YIO A;  5E8I A;  2BBY A;  2ZSH B;  2JRT A;  3ABT A;  2DN0 A;  3JRE A;  3DLA A;  3EUH A;  4GDF A;  1QZZ A;  2HPI A;  3BLY A;  2NYX A;  3BCA A;  1ERD A;  4CIC A;  5K7Z A;  1FYL A;  2XAG A;  3R4K A;  3RQ4 A;  1R1T A;  1U5T C;  3AKZ A;  1YTY A;  5LRS A;  1O3Q A;  2R7V A;  2WAQ N;  3BPX A;  3IRR A;  3FMR A;  1X1C A;  2V79 A;  5GAH J;  2CWE A;  1JJ6 C;  2HZT A;  4N0B A;  2HDW A;  4OMY A;  2W85 A;  3BQY A;  1ZG1 A;  1EKE A;  2XB5 A;  2E1N A;  3DKW A;  1R6R A;  3ZCO A;  1W5S A;  2LKS A;  3F72 A;  4B3A A;  4HDU A;  1GVD A;  3HKZ N;  2A6H F;  2A69 F;  3I4M J;  2Y48 A;  3WGG A;  3GFJ A;  3ZPL A;  2K9Q A;  3FXU A;  2FMY A;  3CUQ B;  2EIM H;  3EQL F;  5TJJ A;  4PCQ A;  2XHK A;  4HST A;  1QA6 A;  3S32 A;  4UVC A;  2Z3Y A;  3ZQC A;  3WGH A;  1IAW A;  5IYB J;  2PJP A;  5CPR B;  3DBL B;  2LBF B;  1I5Z A;  1PP8 F;  3I53 A;  1S72 I;  3BCB A;  4WF2 A;  1X3U A;  1BIB A;  1SAU A;  1X2M A;  1FOY A;  1XSV A;  2H6C A;  1Y0N A;  3H9G A;  4XLA A;  3JRC A;  2CUZ A;  3N4M A;  1OCO H;  2FF4 A;  2BVL A;  2FE3 A;  3RKW A;  4L0Y B;  1CQT A;  3T1B A;  3H3Z A;  3OIO A;  3MD2 A;  2EIN H;  2Y31 A;  1ZYR F;  2G9W A;  2ZFU A;  4E6K G;  1UZC A;  5GTH C;  2ZBK A;  2DFE A;  1XSD A;  4MLO A;  1VQ9 I;  1HKS A;  2P81 A;  2DJN A;  4CXF A;  2LF8 A;  3BP8 A;  4OOI A;  1LE8 B;  1S3J A;  1D5Y A;  3BPV A;  5FD6 A;  3S2D J;  2K4B A;  4LIT A;  1UEL B;  3CCL I;  1H8A C;  2R7X A;  2NS0 A;  2QA4 I;  5FLX K;  2ZME B;  2X6O A;  4B44 A;  3HOV J;  3CDI A;  3A0B C;  2ZXH A;  4PSX A;  4CO8 A;  4DZJ A;  4WX9 A;  4OAZ A;  4NB5 A;  3MMY B;  4BE2 A;  2R7Z J;  4IX7 A;  2R7W A;  3PSI A;  2YU9 J;  2CU7 A;  3HHH A;  1MD0 A;  3ONQ A;  1LFU P;  4L18 B;  3JSP A;  3L2R A;  5CVU A;  2KQR A;  4AU7 A;  2W7N A;  1K79 A;  1DDN A;  4M3D A;  2P6S A;  3TW6 A;  4UVA A;  4LIV A;  1SFO J;  3KZY A;  3J7A Y;  2X1D A;  1O7L A;  4I2O A;  4M71 A;  2IT0 A;  2O7O A;  1OYY A;  3KYD B;  4OAY A;  4PJN A;  1A6I A;  3G1O A;  1FBS A;  3ZN0 A;  3ABM H;  1U3E M;  4EJU A;  2BY0 A;  1O57 A;  5C44 J;  1JTX A;  2D1H A;  2EZI A;  2L01 A;  1SMT A;  3WTU C;  4LLG F;  2CQK A;  3BTC A;  2Y0S N;  3CTA A;  1D0X A;  1W4M A;  3F8C A;  4LB6 B;  1MH3 A;  3H5A A;  1KON A;  3HOS A;  3FX3 A;  4E7H A;  3TOA A;  2CV0 A;  3U2R A;  1BR1 A;  5IT9 K;  2MBF A;  1IN8 A;  4KDP A;  3VDX A;  4QPO A;  3U1D A;  3PNT A;  3QU6 A;  4A0X A;  5IT3 A;  3HC7 A;  1IDZ A;  2EV5 A;  2LP0 A;  2XRL A;  1YW8 A;  2DT5 A;  3PQJ A;  5GPA A;  5D4S A;  1MIJ A;  5F1J A;  1TWF J;  3RI4 A;  2KJC A;  3HB9 A;  3RTR A;  4J01 A;  3F8B A;  1WRJ A;  2Q2E A;  5EF6 A;  2W1O A;  3K4N A;  2AXL A;  4BU2 A;  4RAZ A;  1NK2 P;  3IP4 B;  3R6S A;  1MMA A;  1BR2 A;  3FBN B;  3E97 A;  3VPR A;  1O7F A;  1B9N A;  5JVG F;  1GUU A;  1TWA J;  1WZ2 A;  1B59 A;  3S1N J;  2XAQ A;  3VOD A;  1BI3 A;  5KCM A;  2QBY A;  4ZZD A;  4ZDP A;  5CKT A;  3GBG A;  3G71 I;  2ZJ2 A;  3WG7 H;  4AWX B;  3D1N I;  3WTS C;  1GV5 A;  5F64 A;  2LNB A;  3JRD A;  2DK8 A;  3K1M A;  3T8R A;  3F6O A;  5J1Y A;  2Z99 A;  5J1R A;  4BEH A;  3RKQ A;  3L09 A;  1YIJ I;  1U78 A;  1ZAR A;  2DFH A;  3S1M J;  2XF5 A;  1AOY A;  3H35 A;  2DU9 A;  3PFY A;  5LFA A;  3HGG A;  2DAO A;  2R7R A;  4E7K A;  1XCV A;  3ZQQ A;  2L5Q A;  4D7M A;  1OCP A;  3A0H C;  3VSL A;  2G0E A;  4YFX F;  1ZH5 A;  3AG3 H;  5L3B A;  3VEP A;  4F52 A;  2DI3 A;  2CQ7 A;  2CS3 A;  2DCE A;  1FIP A;  4G94 A;  2OTJ I;  2VPR A;  5E79 C;  2ZXJ A;  2DLL A;  3A2K A;  1XMX A;  5DCM A;  3ISP A;  2K9L A;  1TC3 C;  5J8C A;  1FC3 A;  4RAY A;  2A5Y B;  2HR3 A;  1W0U A;  2W82 A;  5DD4 A;  2DO7 A;  3OL4 A;  1FIA A;  4YFK F;  2WBM A;  3K70 C;  3DKY A;  2WY7 Q;  3CUQ C;  2RV8 A;  4BAY A;  4ESJ A;  2K85 A;  1YW9 A;  1RR8 C;  1LUJ B;  2OF7 A;  3OYN A;  3EYY A;  2M0C A;  3TKY A;  2K3F A;  4OIP F;  4BHP A;  4LOC A;  1YW7 A;  2FML A;  4Q47 A;  2CUF A;  1FZP B;  2OZ6 A;  2D1V A;  2ELJ A;  1HKQ A;  2NOG A;  3AFH A;  3ZQF A;  4EQQ A;  3KYL A;  3BR2 A;  1U9N A;  3Q5F A;  1MDM A;  2PBI A;  4AYB A;  3E6M A;  4B1R A;  2FNP A;  1BJZ A;  3K4M A;  1G3Y A;  2VPL A;  1YX3 A;  1ZKG A;  3AG1 H;  3BRO A;  4XK4 A;  2CV2 A;  1LJ9 A;  4II3 A;  2OQG A;  3KP5 A;  1T38 A;  4ABZ A;  1JXS A;  3FKI J;  3H5R A;  1P2F A;  2STT A;  2HU9 A;  1W5T A;  2OC6 A;  3SZG A;  1R7J A;  1EH7 A;  2MW8 A;  4A2U A;  1HDD C;  4Z2Y A;  3KZZ A;  1K78 A;  4GCV A;  4XLE A;  2QSF X;  4IQJ A;  1XGM A;  3B6A A;  2P5K A;  1ZG5 A;  2HXO A;  6PAX A;  4FTH A;  4Y13 A;  1P9Q C;  5JHU A;  4Y52 J;  3JRG A;  4EMS A;  2DOA A;  3FIS A;  1UCR A;  2L2O A;  3NAU A;  2HTJ A;  2ZME C;  4BQO A;  2EPF A;  5FLX Z;  1N75 A;  4A5M A;  2B0L A;  5C4X J;  3EPZ A;  1E2X A;  1WJE A;  2RNJ A;  1G8X A;  1Y8R B;  4NNJ A;  1VQM I;  4HF0 A;  1NH3 A;  5DS9 A;  2K27 A;  4HNV A;  1LPQ A;  2K9M A;  2P7V B;  4BYY A;  4XLN F;  1P6R A;  2DA5 A;  1OMI A;  1IUY A;  2TDX A;  4WXC A;  2ID6 A;  3LSI A;  3FK6 A;  3LAP A;  2X1C A;  4EAT A;  1WGX A;  1CF7 A;  3LOC A;  3S14 J;  2NS8 A;  1V5F A;  1HSJ A;  2LOO A;  4FQG A;  5B1B H;  3W2W A;  3HDD A;  4G7O F;  3FMS A;  2LK2 A;  2V6C A;  4WK8 F;  2WY8 Q;  2CUE A;  3PL8 A;  4ZYG A;  4Y15 A;  2VLA A;  3BTJ A;  4DZP A;  3A1Y A;  2UV1 A;  2JPB A;  4IHY A;  1ZK8 A;  2E71 A;  4RGS A;  3GTJ J;  3I5U A;  4NQW B;  1E3O C;  5JHF A;  4G9Y A;  2CFO A;  3QWL A;  2ZXW H;  1O3S A;  1UST A;  4C2M J;  3K4B A;  1HXD A;  2IAI A;  5IT9 Z;  1OR7 C;  3CP2 A;  1SD5 A;  3DTK A;  5FLV A;  1WI3 A;  1E3H A;  4AVZ A;  4XOT A;  2Y0S A;  1YE9 A;  5E18 F;  2QEX I;  5KAF C;  3K1N A;  2GIZ A;  3L00 A;  4I0B A;  1SVM A;  3G6E I;  2KIU A;  4LGW A;  1YI2 I;  3RJP A;  1APL C;  2GXA A;  5DCF A;  1NHA A;  3KP4 A;  1OLT A;  5ICE A;  4IHX A;  3P9C A;  4I02 A;  1TQP A;  3SYT A;  4KYW A;  3CCR I;  2XGD A;  3C2B A;  4E7J A;  3IRQ A;  1HLV A;  2BXY A;  1OCC H;  4IOA F;  3LWF A;  1PJR A;  2O5R A;  5CVJ A;  2L7Z A;  4U88 A;  3I0T A;  5EEA A;  1V55 H;  2P4W A;  3HBL A;  2JK3 A;  4I99 C;  2E2J J;  2DDB A;  4D5F A;  2WV0 A;  5C3E J;  2DA6 A;  3V4G A;  2ME0 A;  3S3M A;  2NVU B;  1PUE E;  1Y6I A;  2DA1 A;  1IZ1 A;  1X2N A;  3BR0 A;  1JTY A;  4AUX A;  1A6Q A;  4KIB A;  2LKX A;  3S93 A;  5LHH A;  1U5T B;  5FKO A;  5ED4 A;  1KYW A;  4R8H A;  3CMA I;  3HRU A;  2X1E A;  3EDP A;  1Z67 A;  4ESB A;  4EGY A;  2E1C A;  1RET A;  2IJL A;  2VE9 A;  1BM9 A;  1MW7 A;  4OMZ A;  2JWT A;  2QM3 A;  1HCR A;  2ZC2 A;  3ECH A;  4E70 A;  1YRN B;  1I50 J;  2AO9 A;  5D4R A;  4F91 B;  4X1E A;  1QPM A;  4LLL A;  2YX4 A;  4D5C A;  1ZEL A;  2R5Z A;  2KT0 A;  5B3S H;  1USS A;  2KZG A;  2Z33 A;  3DU5 A;  3GXO A;  1F9N A;  5A2Q K;  3MZY A;  4B43 A;  2KIF A;  2K02 A;  3HUG B;  3OYD A;  1POG A;  1TQI A;  3FMQ A;  2GXB A;  2DJI A;  2DXI A;  2HS5 A;  4AD9 A;  3LNQ A;  5BOX A;  4A6D A;  3P7N A;  4EM1 A;  3T5X A;  3OIP A;  3BG9 A;  2VXZ A;  3K4C A;  3GTG J;  1TT0 A;  2XUB A;  3AG4 H;  5KAI C;  4NC6 A;  3MKZ A;  5BS6 A;  3SEZ A;  3HHG A;  2VT2 A;  3C1D A;  2FU4 A;  3FXQ A;  1IV8 A;  5JR3 A;  2KRC A;  3TBI A;  1T6S A;  2XAS A;  3KEO A;  2W4S A;  2RRE A;  2PMU A;  3GTO J;  5LGT A;  5EYR A;  4RB3 C;  5JFR A;  2QSH X;  2QVO A;  1R36 A;  4YII A;  2B7E A;  2IXS A;  4FIS A;  2HDC A;  1WJB A;  2L0K A;  3TO7 A;  3C7J A;  4GRI A;  3RKX A;  3F0C A;  3LSM A;  2H27 A;  4ZYD A;  5DM6 F;  4F7Z A;  1JKR C;  1WFX A;  3A02 A;  2NVY J;  4L0Z B;  4BL0 B;  3GCM A;  3OS1 A;  4IRH A;  2R7F A;  2WC2 A;  2DA3 A;  1PUF A;  1S8N A;  2XRO A;  3Q0U A;  3VFZ A;  2EB7 A;  3SJM A;  2DDA A;  4CCO A;  2JTV A;  5FGM A;  4XLH A;  3MZ8 A;  1B8I A;  1TNS A;  1R5I D;  3AAF A;  5FKM A;  3HOT A;  2JA5 J;  4ZDO A;  4HV6 A;  3PFI A;  2BZT A;  2OAZ A;  2QKL B;  3I71 A;  1X1A A;  2D45 A;  3BR5 A;  4P1W A;  1FY7 A;  2PX9 A;  4XKV A;  3FM5 A;  2LC2 A;  1TBX A;  4M72 A;  3PQK A;  5E20 A;  2HXI A;  1R9T J;  1BOB A;  2FBK A;  3MKW B;  4ZC3 A;  2VQG A;  4H4K C;  1JUP A;  3GTP J;  4XIC A;  2E34 A;  3CQZ J;  3LL7 A;  2IBD A;  4U0V A;  1X1P A;  3RIR A;  3CF5 F;  1FMW A;  1X1D A;  2OUM A;  5K7F A;  2IGK A;  3O8G A;  3QOE A;  1K61 A;  1S7A A;  2BOL A;  1KYZ A;  1XSX A;  5LGU A;  5EDN A;  1LEB A;  1R4M B;  3HM5 A;  4U7D A;  1U2W A;  3QP6 A;  1FJL A;  4ESF A;  1SAN A;  4YEL A;  2IA2 A;  1TWG J;  5F0H A;  2XVC A;  2GLO A;  5HVQ C;  4EV0 A;  2VL8 A;  4EEF G;  1UMQ A;  3K1P A;  3BDD A;  1Z21 A;  5HS8 A;  2Y75 A;  3LSG A;  3BY6 A;  1K7A A;  2CMP A;  2WWY A;  4PGG A;  4JK1 X;  3DBH B;  3O8H A;  1W7P B;  3QOD A;  4JX6 A;  4V19 K;  3K10 A;  3HRT A;  4XSX F;  2PN6 A;  4N4N B;  3C2G A;  5E3O A;  1TW2 A;  1WH5 A;  2CSO A;  4O5V A;  4GYG A;  1JKO C;  4CYC B;  2LYC A;  4I6Z A;  2QWW A;  2X6X A;  2MH9 A;  5B66 C;  1YJ9 I;  1T8I A;  3GTK J;  4IHT A;  2R7O A;  1WKM A;  4HBL A;  2QYO A;  4FCY A;  3DBR B;  1RPW A;  1XC5 A;  1I6X A;  3KLO A;  5LGN A;  1LFB A;  3IAS 2;  1HKT A;  3J81 K;  1VND A;  1UHW A;  1Z77 A;  3M8F A;  3S16 J;  3F8N A;  3HSF A;  3HGY A;  1Q1H A;  5EG0 A;  4I01 A;  2DK5 A;  4HG2 A;  1TL8 A;  1N78 A;  2KP6 A;  3T8T A;  3GTL J;  4L5E A;  4XRM A;  1VTN C;  3PM1 A;  3E0J B;  2P5V A;  3CCY A;  4LMY A;  3GW2 A;  1RNL A;  2BW3 B;  2M9H A;  5LHI A;  2OQR A;  1B72 B;  5K7H A;  4KIG A;  1F1Z A;  2QLZ A;  2CO5 A;  3OOU A;  1UAA A;  3LMM A;  4HSR A;  1Z6R A;  2GA2 A;  3BTL A;  4B4C A;  3W2A A;  2O03 A;  1VQ4 I;  1JHH A;  4BGD A;  3O3K A;  3GZ5 A;  3CJN A;  2COB A;  2VKV A;  2XIG A;  3V42 A;  5E3L A;  2HWV A;  4K2E A;  3JSO A;  3IWF A;  4A3E J;  2LY2 A;  4FX0 A;  4CHU A;  2HYG D;  1FSH A;  1JUM A;  1WJC A;  2AHQ A;  2X0L A;  4D1Q A;  1Z91 A;  3MN2 A;  3JRF A;  1OYW A;  2H1K A;  1D3Y A;  2GXG A;  2QGU A;  2DOF A;  2CUJ A;  5GAG J;  3HPH A;  1EF4 A;  2HYF A;  4C30 A;  1HDP A;  1LDD A;  1VQ8 I;  1FNN A;  1UB9 A;  4AYB N;  5HOD A;  5A2Q Z;  1PYV A;  1TP4 A;  1P7I A;  4H0E A;  3S3N A;  3Q9S A;  1T39 A;  2O6G E;  3PO3 J;  2A6T A;  3PO2 J;  2KL4 A;  4B48 A;  1W1W E;  2VBX A;  4RBO A;  5DTD A;  4QIW N;  2W48 A;  3FHN A;  4YIF A;  4PGH A;  2DA7 A;  4NBQ A;  1SFX A;  3ZXS A;  3ABK H;  2V26 A;  3L2V A;  1RKW A;  4HNU A;  1IO2 A;  2MSY A;  5HOO A;  3LFU A;  3Q3S A;  5CJ9 A;  3SZP A;  5B5E C;  3FF5 A;  4BAC A;  1FYK A;  3CP8 A;  2ZB9 A;  4KFC A;  3LA3 A;  2FD5 A;  5H6R A;  4CH7 A;  2XRN A;  5F1R A;  4BXF A;  1I1S A;  1WPK A;  4JP0 A;  2ELK A;  1DGW Y;  4A69 C;  1EV7 A;  3WG9 A;  1JGG A;  3WTV C;  3SHF A;  1LE8 A;  3CCS I;  4HX7 A;  5GAE J;  2IA0 A;  4I0A A;  3EUA A;  1SAX A;  4MEX F;  2AQE A;  3C3W A;  3OS0 A;  1NG6 A;  1B6A A;  3WTY C;  2NS7 A;  4ZTJ A;  4B8X A;  1LKX A;  1STZ A;  1TLH B;  4FE4 A;  4IOC F;  2JN6 A;  5M5Y J;  5ICF A;  3SQN A;  2DPU A;  2DPD A;  2JUG A;  4M6Y A;  2EIK H;  5FKK A;  4HX8 A;  3HPG A;  3COA C;  1I1G A;  4P55 A;  1IG7 A;  4KIF A;  5JLX A;  1T08 B;  3FZV A;  3DU6 A;  4Y7N J;  3ABU A;  3IH4 A;  1WSU A;  3PUB A;  3TO9 A;  1D1A A;  3FM3 A;  1L3L A;  3I56 I;  1SFU A;  1PP7 U;  2MC4 A;  2FBI A;  1UHM A;  2KIQ A;  2F4M B;  1YOV B;  2KFD A;  4DNC A;  4LG3 A;  1D0Z A;  3DEU A;  1DUX C;  4B3X A;  2EZH A;  2KDO A;  1H9T A;  1D5V A;  4OIO F;  3RPU A;  3TW7 A;  2EFN A;  2XSD C;  3CME I;  1XMA A;  3GFM A;  3W6J B;  1U0J A;  1AHD P;  5LRR A;  1DU0 A;  2ZJR F;  1VQN I;  1W36 C;  3HOW J;  4E7Z A;  1BJA A;  2I5U A;  3CD6 I;  1QNT A;  2HOA A;  1DU6 A;  3H5N A;  4UXN A;  4E7L A;  2R93 J;  3ESW B;  1MH4 A;  4HYE A;  4IEJ A;  1E17 A;  2FQ3 A;  2HOE A;  2YUS A;  2NVT J;  1FWZ A;  3FDY A;  1HC8 A;  3QYF A;  1K83 J;  4BJT A;  4AIJ A;  2MH2 A;  3H0D A;  4L9N A;  1KQ0 A;  3SFI A;  4BKX A;  5L3F A;  3RZO J;  2FRH A;  3HIF A;  1BR4 A;  1GVJ A;  2X4H A;  2CW0 F;  3MKY B;  3VYU B;  2JSC A;  5DD8 A;  1R1V A;  3CCU I;  2X48 A;  1LEA A;  3CDL A;  1FBU A;  3E6C C;  3KET A;  3CCJ I;  4BY1 J;  2VQC A;  4BBR J;  2AS5 F;  4UUV A;  2CRG A;  3OIQ A;  4U7B A;  2ETH A;  1YS6 A;  1V54 H;  2WB1 A;  4MO7 A;  2GWR A;  4KJZ A;  4ZH4 F;  3JCU C;  4F55 A;  1DQU A;  4MFD A;  1D1C A;  5FFZ A;  1C0W A;  2LKP A;  2L9S A;  3G2B A;  2O61 A;  5KVR A;  3LQQ A;  3CCV I;  2GOX B;  1JUS A;  4PZJ A;  5F04 A;  3X2Q H;  1QVU A;  3E3V A;  3OR2 C;  3SZT A;  2XAF A;  4ZJZ A;  4YIR X;  4KMF A;  4TV7 A;  2KPM A;  4RAF A;  2HFH A;  1OJL A;  3WU0 A;  3J81 Z;  1RES A;  2IGM A;  2R5Y B;  3S1R J;  3K4J A;  5EEG A;  4A0Z A;  4YFN F;  2EH3 A;  3OYI A;  4ZYE A;  4IRI A;  2L7M P;  5HDK A;  3BJA A;  1MJB A;  2Q2E B;  4M3E A;  4G6Q A;  3V8J A;  2QQ8 A;  3DKX A;  5IP6 A;  4A5N A;  5HNH A;  1G3S A;  1YS7 A;  1Z0X A;  3F21 A;  1Z6T A;  4WWC A;  1QQI A;  1P4X A;  1F43 A;  4A3I J;  5KNL A;  1QGP A;  5IY5 H;  2BHZ A;  4LIU A;  4DYR A;  3GFI A;  3GZ6 A;  3Q0W A;  3MAJ A;  1UHS A;  3M7G A;  1T2K A;  2UXX A;  1H88 C;  2QQA A;  3E6B A;  3V7C A;  1E0E A;  1X3W B;  4BEH B;  5JI6 A;  2NNY A;  2LY1 A;  4C3J J;  3BJ6 A;  4BH9 A;  3S15 J;  1P4A A;  2M34 A;  2ID3 A;  5E8G A;  5F6F A;  3GF2 A;  3EUH C;  4I7H A;  2MG4 A;  4I98 B;  2IP2 A;  3P9I A;  3HOU J;  2HQN A;  2FNA A;  2XAU A;  1X19 A;  1SEU A;  1I39 A;  2M8G X;  1ZAO A;  3N97 A;  2XKP A;  5EGO B;  3BG5 A;  1VQ5 I;  1B4A A;  2LDU A;  2VOP A;  2PJR A;  3RYR A;  1FMV A;  3GME A;  3B02 A;  1FP2 A;  3GTM J;  4MIM A;  2N8G A;  5HDG A;  2VBZ A;  2CQX A;  2IS2 A;  1R49 A;  1XCB A;  2VE8 A;  3ASN H;  2O8X A;  1XGS A;  1Y8Q B;  2XGE A;  2WTE A;  2YR2 A;  2KRF A;  4WXD A;  1WH7 A;  3ML6 A;  4ITV A;  2ISY A;  2PEX A;  3WGI A;  1UJ8 A;  2F4I A;  3KP7 A;  1LNW A;  4XM3 A;  3VB2 A;  2L54 A;  2P8T A;  1L0O C;  2A6E F;  2ZNZ A;  4IPA A;  5LEK A;  3L2W A;  1AU7 A;  4ON0 A;  2YPR A;  2CG4 A;  3CCQ I;  2O0Y A;  4AID A;  3HOX J;  3V7S A;  1IRZ A;  1Y0U A;  1H9G A;  2RGV A;  1BA5 A;  1VZ0 A;  3V7R A;  2HPM A;  1MDM B;  2LD5 A;  2XAJ A;  2MA3 A;  5D6F A;  3I58 A;  3VSK A;  1J59 A;  4IHS A;  2F5V A;  2X51 A;  4D0P A;  1FP1 D;  4IVN A;  3K69 A;  2IRF G;  2XAH A;  4W97 A;  1IXS B;  4RLF A;  1P7J A;  4L9J A;  1XGN A;  3I64 A;  2QCO A;  2R7S A;  1F5T A;  3IV5 A;  3IC7 A;  4C9Y A;  2OTL I;  1KA8 A;  2IA1 A;  3I54 A;  3BJO A;  3FXR A;  3I59 B;  3FXJ A;  4M3F A;  3RDI A;  5F0F A;  2JQ7 A;  2JA6 J;  3F3X A;  1RRJ A;  3FKJ A;  1YJN I;  1I3Q J;  2R7T A;  1T95 A;  5IPA A;  1FOK A;  3CLO A;  1S7O A;  2BE5 F;  4XLF A;  1QHG A;  1OCZ H;  1K78 B;  3OYF A;  4Q4Z F;  5F27 A;  5CYV A;  4A3J J;  2BEO A;  3ZP5 A;  3NQO A;  4E7I A;  1MGT A;  3SDB A;  3L7W A;  3WE3 A;  4PSW A;  3EET A;  3K6G A;  2K3P A;  1D0Y A;  3F6V A;  1W0T A;  2E1M C;  2HNH A;  3KIO A;  3L2C A;  2NNN A;  5DV5 A;  4F93 B;  2JRM A;  2PI0 A;  1ETX A;  2WA0 A;  3QPT A;  4RS8 A;  3UNG C;  1IN6 A;  3OYJ A;  1QHH D;  3JRA A;  1Z7L A;  2K5C A;  1ZRD A;  4LG0 A;  1UG0 A;  4BXX J;  1XMK A;  1BIA A;  2KRH A;  5HLI A;  3D0S A;  5FKN A;  1G59 A;  4UUS A;  4HLY A;  2MD5 A;  4GO1 A;  1MZB A;  1Z05 A;  2OCE A;  2GM4 A;  2CYY A;  5ICG A;  3TED A;  2PMH A;  4AM3 A;  4WXH A;  4DBQ A;  4LD5 A;  2EA2 A;  1Y1V J;  1CF7 B;  1ORK A;  3BR1 A;  1E3P A;  2KHM A;  1JHF A;  4M73 A;  1X3Z B;  4XN3 A;  4HA8 A;  4DJA A;  5FJ8 J;  4RM2 A;  1MNM C;  2PLY A;  2XF7 A;  4PK4 A;  3WOD F;  4P5O A;  3H1C A;  4LJZ F;  2E60 A;  3KX2 A;  4HEA 2;  4UB6 C;  4Z6Y A;  3QRF F;  1JJ8 C;  2F6C A;  4XOR A;  2XDV A;  3P9K A;  3L9F A;  1FPQ A;  3JRH A;  2O3F A;  4XLC A;  3UR3 C;  3REO A;  2VC1 A;  3L1P A;  3MZH A;  3HRS A;  5J1U A;  4Y17 A;  1ENH A;  4ENM A;  2VKH A;  4UHT A;  1AKH B;  5EZG A;  2YU3 A;  2VAS A;  4HQM A;  3SEQ A;  2VQH A;  2X6W A;  4A0Y A;  2M87 A;  2QQ9 A;  2M7B A;  1XG1 A;  5DUI A;  2UUZ A;  4U0W A;  3QOP A;  3L2Q A;  2LVS A;  4AIK A;  1FYM A;  1Q1V A;  4BQQ A;  3RQI A;  2W84 A;  4EM0 B;  3CLQ A;  1TW3 A;  5M3M J;  4L5J A;  4HPQ A;  3ZQI A;  2ZXI A;  1T0F A;  3CJR B;  2ZCW A;  1LVA A;  4G6D A;  4RGU A;  1H89 C;  4ENJ A;  2HQA A;  2I8D A;  4XL9 A;  3W6V A;  4PFO A;  3TQN A;  4BJ6 C;  2YSR A;  2ZNY A;  1U5T A;  1QZE A;  2EV6 A;  4P9F A;  5FRN A;  1MSF C;  1U6G A;  2IVM A;  4BJ5 C;  2E2I J;  3ZMU A;  2EBI A;  2M1B A;  1J9I A;  5LEJ A;  1LDK B;  5D5X B;  4GFB A;  3T0Y A;  3VWB A;  1LB2 A;  3K7A J;  1YRN A;  3GLX A;  1LDJ A;  1OQY A;  4BQN A;  1TWC J;  2E36 A;  4UV9 A;  3KLN A;  4CGZ A;  1HW5 A;  1Y1W J;  1JKQ C;  5GPC A;  4MNU A;  2YS9 A;  1ZRF A;  4I09 A;  3I4P A;  2PMZ A;  4RB1 A;  2FUG 2;  3M8E A;  4L5I A;  4YG2 F;  4IKF A;  1MMG A;  1ZGW A;  4C2T A;  4O6J A;  2ESH A;  4PJJ A;  1UFM A;  1U8B A;  3HUG A;  3AL0 B;  4A3D J;  1D8J A;  4MQ9 F;  5CVR A;  2F5C A;  4ZYA A;  2EZK A;  1RUO A;  2VC0 A;  3Q9V A;  3WHB A;  2P6T A;  3ECO A;  4ETS A;  2M8E A;  2CQN A;  4V2F A;  1WCM J;  1QO0 D;  3H36 A;  2CGP A;  2F48 A;  3VYS B;  2QEN A;  4Y3O A;  4BS9 A;  2HVR A;  3ERE D;  1JE8 A;  1S6L A;  3VYT B;  4RB0 A;  3OR1 C;  4B47 A;  1YX5 A;  4CYD A;  2EIL H;  5BPI A;  3HXL A;  2UWM A;  3H9Q A;  2Y30 A;  3CDH A;  4UUT A;  3BZK A;  1DPR A;  4NDL A;  4XMY A;  5CQE A;  2E7X A;  1K6O A;  2Q1Z B;  1JGS A;  4EM2 A;  2HVS A;  3D5L A;  2PFB A;  2LG4 A;  1YHQ I;  3OV8 A;  4BDY A;  1ZRE A;  2HOT A;  1VQ6 I;  1MKM A;  5ERI A;  3WTW C;  1W36 D;  3K9T A;  4CZZ A;  5J40 A;  2DTR A;  3ZMV A;  3LST A;  1KU3 A;  4XR6 A;  3IAM 2;  2G7H A;  2L9R A;  4XKC A;  3G4S I;  4ZDL A;  3G73 A;  4QLC U;  1U8R A;  2F5F A;  3JW4 A;  1X58 A;  2A68 F;  2HKO A;  2RAE A;  3S2H J;  2DMU A;  2IS1 A;  2ZFW A;  4OWR B;  4S0H B;  2PQ8 A;  3B6C A;  2JVH A;  4BHC A;  3F9K A;  3M3Y J;  5M5W J;  1F4K A;  4FE7 A;  1ZRC A;  2K40 A;  2W25 A;  2L9V A;  2DMQ A;  4DYQ A;  3JRB A;  4NHJ A;  2DBB A;  1H0M A;  2AXT C;  3KP2 A;  1PUF B;  3I9V 2;  1B1B A;  4XOP A;  1N25 A;  3HEF A;  3HOZ J;  4CUG A;  3OS2 A;  4E4H A;  1DP3 A;  3M1E A;  4KIC A;  2M7A A;  5C4J J;  2A3S A;  2Z9O A;  5EZH A;  1YJW I; 
#chains in the Genus database with same CATH homology
 4C2U A;  3OYB A;  2VQL A;  3EUA A;  3L2U A;  2AQE A;  2JSP A;  3OS0 A;  2W82 A;  5FRO A;  2IS4 A;  1NG6 A;  3OL4 A;  4CA0 A;  2X6Y A;  2L9N A;  2MFZ A;  4ZTJ A;  3K70 C;  2WBM A;  1LKX A;  3DKY A;  2WY7 Q;  3RCO A;  4D9J A;  2E5N A;  2JUG A;  4KT6 A;  2L7K A;  1WJ5 A;  3OYN A;  3HPG A;  4U87 A;  2MD0 A;  3KEY A;  4NUB A;  3DU6 A;  2ELJ A;  3AFH A;  3PUB A;  1D1A A;  3KYL A;  2MC4 A;  1Z3Y A;  4RLQ A;  2RQQ A;  4LG3 A;  4AYB A;  1D0Z A;  2P0W A;  3U21 A;  4B3X A;  2KDO A;  3NWT A;  3K4M A;  2VPL A;  1YX3 A;  3OYG A;  4XKB A;  3CJQ B;  1GLN A;  2CV2 A;  4II3 A;  2WAE A;  4XN0 A;  1U0J A;  3ZR8 X;  3H5R A;  4IZZ A;  4DOZ A;  2Z2S B;  1W36 C;  2HU9 A;  4E7Z A;  2OC6 A;  1V5E A;  3SZG A;  2M4K A;  3HL2 A;  1HA8 A;  4XNF A;  2X85 A;  4ANJ A;  3H5N A;  4E7L A;  4XLE A;  4FAS D;  4IQJ A;  4DBR A;  3D5S C;  3BG6 A;  1LFP A;  5LD2 C;  1X4O A;  2VJ5 A;  3FDY A;  2XSJ C;  3OYH A;  1P9Q C;  3QYF A;  2DOA A;  3ZGK A;  4IQ4 A;  4BJT A;  2L2O A;  2OV7 A;  3H0D A;  2MYS A;  3FBI B;  4BQO A;  3CES A;  1N75 A;  3QYB A;  3EPZ A;  1BR4 A;  1WJE A;  1G8X A;  3MKY B;  3QYE A;  4NNJ A;  3VYU B;  3BG7 A;  2K9M A;  2VQC A;  2ZSI B;  2XC7 A;  1Z3X A;  3OIQ A;  3LSI A;  3M8J A;  4U7B A;  3NWS A;  2WB1 A;  2X1C A;  1SFK A;  4FET A;  3N05 A;  4KJZ A;  4EAT A;  4F55 A;  1DQU A;  2M3A A;  1D1C A;  1V5F A;  2L9S A;  2LOO A;  2V1N A;  3G2B A;  2BVM A;  3W2W A;  3OY9 A;  1X1B A;  2IGO A;  2GOX B;  3OR2 C;  3AL0 C;  4ZJZ A;  1MND A;  3HG9 A;  3CMM A;  3PNY A;  2LBF A;  2KPM A;  2WY8 Q;  3PL8 A;  2VLA A;  3OL3 A;  3A1Y A;  4CCJ A;  3DPT A;  3OYC A;  2UV1 A;  4Y4R A;  2IGM A;  2A5W A;  3K4J A;  4NQW B;  5HNF A;  3OYI A;  3OMY A;  5JHF A;  2VB6 A;  2Q2E B;  2CFO A;  3DKX A;  1EA3 A;  5HLT A;  5HNH A;  2V6E A;  3K4B A;  2Z16 A;  1OR7 C;  2Z1D A;  3CP2 A;  3DTK A;  4AVZ A;  5KNL A;  3PNV A;  1MMD A;  4XOT A;  4CCK A;  2M4G A;  2Y0S A;  1YE9 A;  4LIU A;  4DIQ A;  3OYE A;  4CSW A;  4YRV A;  1E0E A;  3DPU A;  4BEH B;  4JQF A;  4PJM A;  1OLT A;  1K6Y A;  4PJL A;  2LY1 A;  3LSH A;  2E5Z A;  3SYT A;  4CZC A;  1D1B A;  4E7J A;  1AA7 A;  4PFP A;  3VYR B;  1WJD A;  3EUH C;  1PJR A;  2O5R A;  4II2 A;  2XAU A;  1X19 A;  2W00 A;  1WJA A;  4RMN A;  4KIT B;  4J00 A;  2VKD A;  3S3M A;  3RPU D;  1Y6I A;  4JOM A;  4YEJ A;  5KHD A;  2V9K A;  2PJR A;  1FMV A;  4QPQ A;  4DGW B;  3K4K A;  3S93 A;  2IS2 A;  1NG7 A;  4BE0 A;  2E1M B;  2IGN A;  4XQF A;  2X1E A;  3S3O A;  1TZL A;  4ITV A;  1DGR M;  1MW7 A;  3W2V A;  2F4I A;  2VXD A;  2V4J C;  4R79 A;  4XM3 A;  2QKM B;  3OWT A;  3OYA A;  3L2W A;  3PSF A;  4KIS A;  2MAB A;  2CW7 A;  1X4P A;  4F91 B;  1V5G A;  3DPL C;  4XKW A;  3CF2 A;  1ZEL A;  1VZ0 A;  2HPM A;  1S9H A;  3DU5 A;  3VSK A;  1MMN A;  2BW3 A;  4X0G A;  2F5V A;  2X51 A;  4CCN A;  3DWL E;  4B43 A;  3HUG B;  3OYD A;  2R4G A;  4RLF A;  2RNG A;  2R7S A;  2DJI A;  2DXI A;  1LVK A;  4C9Y A;  3OYM A;  2VJJ A;  3OIP A;  2VXZ A;  3K70 D;  2WAD A;  4NC7 A;  1N77 A;  3K4C A;  1TT0 A;  2NOJ B;  3FKJ A;  2R7T A;  1T95 A;  3MKZ A;  4RM3 A;  4XLF A;  3SEZ A;  4E7S A;  1QHG A;  3S8P A;  1T0F C;  3OYF A;  2ZSH B;  3DLA A;  2KRC A;  3TBI A;  4E7I A;  2HPI A;  3BLY A;  3SDB A;  3BCA A;  1ERD A;  2W4S A;  4PSW A;  2RRE A;  3DEE A;  4XON A;  1J09 A;  3K6G A;  2K3P A;  3RQ4 A;  3AKZ A;  1D0Y A;  2R7V A;  2E1M C;  2HNH A;  1X1C A;  2AQF A;  4F93 B;  1JI8 A;  2WA0 A;  2HDW A;  3UNG C;  5TGT A;  4BDZ A;  2IXS A;  2VIX A;  3OYJ A;  1QHH D;  1Z7L A;  1WJB A;  2K5C A;  2JVG A;  1UG0 A;  4GRI A;  3LSM A;  2GOM A;  3ZRG A;  2KRH A;  3H9J A;  1R6R A;  3ZCO A;  1G59 A;  1WFX A;  2CH0 A;  3DQV C;  4BL0 B;  2WAF A;  3OS1 A;  2LRE A;  4CCL A;  2CW8 A;  4DBQ A;  4HST A;  5FRM A;  3S32 A;  4CCO A;  2KHM A;  4XN3 A;  4DJA A;  4XLH A;  4RM2 A;  4HNT A;  2XF7 A;  5CPR B;  4PK4 A;  4P5O A;  3HOT A;  2LBF B;  4ZDO A;  2HZD A;  2E60 A;  3KX2 A;  4HEA 2;  2QKL B;  1X1A A;  4P1W A;  3D5R C;  3BCB A;  2F6C A;  4NC8 A;  4XOR A;  2XDV A;  4XKV A;  1SAU A;  2LC2 A;  4BE1 A;  4XLA A;  3H9G A;  4XLC A;  2CUZ A;  3UR3 C;  2VKH A;  4HRI A;  2BVL A;  1BOB A;  3TL4 X;  3MKW B;  2VJ4 A;  2VAS A;  2VQG A;  4ZC3 A;  4H4K C;  2IS6 A;  3SEQ A;  2VQH A;  2X6W A;  2KMU A;  2M7B A;  3LL7 A;  4Y33 A;  2UUZ A;  3MD2 A;  3L2Q A;  2ZFU A;  4E6K G;  1FMW A;  1X1D A;  4MLO A;  2OUM A;  4BQQ A;  2IGK A;  3QOE A;  4HPQ A;  2ZXI A;  3CJR B;  2BOL A;  2HQA A;  2I8D A;  4XL9 A;  2WAQ A;  4LIT A;  4PFO A;  1UEL B;  4YEL A;  4BJ6 C;  5FRN A;  5HVQ C;  2R7X A;  2VL8 A;  2CV1 A;  4PUS A;  4BJ5 C;  1Z21 A;  4B44 A;  2R7Q A;  2ZXH A;  3LSG A;  4PSX A;  1LDK B;  2CMP A;  5CQG A;  4OAZ A;  4BE2 A;  3MMY B;  3VWB A;  4IX7 A;  2R7W A;  3HKZ A;  3PSI A;  3QOD A;  4BQN A;  3K10 A;  3ONQ A;  4N4N B;  3C2G A;  3L2R A;  4AU7 A;  2KQR A;  2W7N A;  2PJR B;  2LRD A;  2PMZ A;  2FUG 2;  2LYC A;  2KLO A;  2X6X A;  4IKF A;  4LIV A;  1MMG A;  4C2T A;  3J7A Y;  2R7O A;  4PJJ A;  2X1D A;  3C2H A;  3DTI A;  3AL0 B;  2LH9 A;  4OAY A;  3CZ6 A;  3IAS 2;  4PJN A;  4ZYA A;  3PJR A;  4F92 B;  3TMO A;  3BC8 A;  3A4C A;  4HG2 A;  1N78 A;  2KP6 A;  1D0X A;  4CCM A;  3H5A A;  1KON A;  3VYS B;  3HOS A;  4E7H A;  4Y3O A;  2DT7 B;  4BS9 A;  2CV0 A;  3E0J B;  1BR1 A;  2HVR A;  2DT6 A;  3VYT B;  2BW3 B;  3VDX A;  3OR1 C;  4QPO A;  3E1S A;  4B47 A;  3OOU A;  3PNT A;  1UAA A;  3HC7 A;  1YX5 A;  3LMM A;  3LSK A;  4F3Q A;  4HSR A;  3HXL A;  2UWM A;  3H9Q A;  3W2A A;  4XMY A;  5CQE A;  4BGD A;  3OYK A;  3M1C A;  4N4O B;  2Q1Z B;  3W3C A;  3V42 A;  2HVS A;  3D5L A;  3RTR A;  2LY2 A;  4G6T B;  2LG4 A;  4J01 A;  1WJC A;  4BDY A;  4D1Q A;  2W1O A;  3K4N A;  1W36 D;  4BU2 A;  3RSN A;  3K4L A;  3IP4 B;  1MMA A;  3OYL A;  1BR2 A;  2XF6 A;  3FBN B;  2CUJ A;  4XR6 A;  3IAM 2;  3HPH A;  3EUK L;  4XKC A;  2M0M A;  4C30 A;  4ZDL A;  5KCM A;  2HVQ A;  1MNE A;  1Y56 A;  4ZDP A;  5CKT A;  3GBG A;  1PYV A;  3I3L A;  3S3N A;  2V7F A;  2IS1 A;  2A6T A;  2R7U A;  2KL4 A;  4B48 A;  4BUP A;  1WJF A;  4OWR B;  3FHN A;  2JVH A;  3F9K A;  4BEH A;  1QU3 A;  2XF5 A;  3ZXS A;  2V26 A;  3H35 A;  3L2V A;  3PFY A;  4HNU A;  5LFA A;  2R7R A;  5HOO A;  4E7K A;  2KZV A;  3LFU A;  4BAC A;  3ZQQ A;  2L5Q A;  3DTE A;  2JA2 A;  2VJI A;  3CP8 A;  3I9V 2;  4XOP A;  3VSL A;  4CH7 A;  4BXF A;  4CUG A;  3OS2 A;  4E4H A;  1DP3 A;  1IRX A;  4F52 A;  4ZTF A;  1DGW Y;  2M7A A;  2CS3 A;  2DCE A;  3IUO A;  3A2K A;  2K9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...