5IYCJ

Human core-pic in the initial transcribing state
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iycJ00
3IH3A 2DMPA 3VPRA 1ENHA 3ZQIA 4XK4A 2R0QC 2XPWA 1BL0A 4A3DJ 2E1OA 1OJLA 2LKXA 2DA3A 2CU7A 1RESA 2HXOA 3B6CA 3ZQCA 3HOZJ 1ZR4A 1ZK8A 2E19A 1RKTA 2M2EA 5JLXA 2DN0A 1YRNA 1JKRC 4CYCB 4UUSB 2G0EA 3H0GJ 1JKQC 4BY7J 1Y1WJ 1SANA 3L1PA 5M3MJ 2CQXA 3BTJA 4V2GA 1JTXA 3GTGJ 3CMYA 1VF9A 3A03A 2VPRA 3S1NJ 1MNMC 2O8KA 4DZPA 4XIDA 2K9NA 1MBGA 4M3GA 5IYBJ 3UKGA 1LE8A 4IEJA 3MVPA 4DYRA 3DEWA 5IOYA 1BA5A 2NVXJ 3Q0WA 4DZJA 3FK7A 4A3EJ 5FKKA 2DMNA 1A5JA 1MH4A 4JX6A 2HXIA 1IGNA 2K40A 3BTLA 2O7OA 3Q0UA 2IAIA 1RETA 1XG1A 4A3IJ 2JA7J 2JWTA 4A3JJ 4M3DA 1I6HJ 3HKZN 2HOSA 2VKEA 1QVUA 2LP0A 1FIPA 1IDYA 3NAUA 1B72B 2ZB9A 5EDNA 4FCYA 4JP0A 3QPLA 2XPUA 1PUFB 1MSEC 2DA1A 2DTZA 1YRNB 1DU6A 3RQIA 2LD5A 3JRIA 2AHQA 2ME6A 5IOZA 3OSFA 2CJJA 5K7HA 3G1MA 2IEKA 2X6OA 3M4OJ 5GP9A 2ID3A 2N8GA 2DA5A 3HGGA 2DA4A 3ZQGA 5IP9J 1RKWA 1H8AC 4QIWN 4XICA 1IV6A 1Y1VJ 4QSHA 2IBDA 5C4JJ 2DA2A 2JA5J 4A3KJ 1QRYA 2NOGA 1K83J 1TWAJ 3Q0VA 1JTYA 1T33A 2DMTA 4AC0A 1FIAA 2ECCA 1LE8B 1UG2A 1BW6A 1NTCA 2LLKA 2JJ7A 2CRGA 3G1LA 1HDDC 2KT0A 1JUMA 2JMWA 5K7ZA 1NK3P 2FJ1A 2E2HJ 3BQZA 2XSDC 3H3VK 1JT0A 5F1JA 2K9SA 4IHWA 2YUSA 2XGCA 1TWGJ 1ZQ3P 4D5CA 5EYRA 3BR6A 2DA7A 5EF6A 4A3LJ 2RAEA 4JYKA 4DYQA 3HEFA 3JRCA 2X48A 3BR5A 2XGDA 5M3FJ 3JRHA 5E3LA 1Z0XA 2WAQN 3IH2A 2R5ZA 2GM4A 1OFCX 5GPAA 1XS9A 3CQZJ 5FKLA 4IHXA 2P81A 2K9QA 5EGOA 1K61A 1JJ8C 2NS7A 5C4XJ 3RZDJ 2ECBA 5IP6A 2MSYA 2LR8A 3O8GA 2LVSA 1XC5A 5FKOA 2B63J 2TRTA 4B4CA 3M3YJ 3IH4A 2HI3A 1MSFC 3HOUJ 1I50J 1JGGA 3HBLA 3QPSA 4S0HB 1APLC 3S17J 4D7MA 3A01A 2Y31A 1B8IB 1IG7A 4A69C 1RPWA 3JREA 1GV5A 2WB1N 4JX4A 2LFBA 5M5XJ 3CDLA 2DMUA 5EG0A 1ZGWA 1ZTRA 5K7FA 4MO7A 4X1EA 4I6ZA 4A3MJ 4BY1J 3HOVJ 1U9NA 1IUFA 4AYBN 3K2AA 4D7NA 3B6AA 5F08A 2E2JJ 1WPKA 4XRSA 4IHYA 2YU9J 2MGQA 2LK2A 3QQAA 2M34A 3O8HA 3HOYJ 4L5EA 2X9DA 4C2MJ 4LOCA 2YS9A 4MLOA 4IHVA 2HYJA 4V2FA 1TWCJ 1D5YA 3BTCA 4XRSG 2H8RA 5FKMA 3MN2A 2NVYJ 3SFIA 2CQQA 4DYCA 2H1KA 1W0TA 3FIWA 2JN6A 1JUPA 1WH5A 2GBYA 2R5YA 5EZGA 5IPAA 2EZLA 2M9HA 1OCTC 3OIOA 1W0UA 5E3MA 1IDZA 1Q1VA 1IRZA 1P7JA 5F0HA 1ETVA 2DMQA 5F0CA 1DU0A 2Y9YA 4B1RA 1GT0C 3GTOJ 3OOUA 1GUUA 3JRDA 1ETWA 3SJMA 4M3FA 3HB9A 3TEDA 3TW6A 2HQ5A 5M5YJ 4M3EA 1ETKA 3S1RJ 1WH7A 4AUXA 1JKOC 5IYCJ 3RKQA 4EEFG 1GV2A 1HF0A 2R92J 3PO2J 3JR9A 3GTKJ 1G2HA 1ETXA 4C3JJ 3PM1A 4Y52J 5BNGA 1Z77A 4CYCA 4UUSA 3FISA 1AHDP 4B3AA 2NVTJ 3HOXJ 9ANTA 1F36A 2EZKA 2FD5A 3LSGA 1BJZA 4UUTA 1X2NA 4RBOA 3GBGA 1JJ6C 1HLVA 3C2BA 5J3LA 1OCPA 5FLMJ 1LFBA 1BW5A 2ELKA 1IJWC 4RDUA 3BG9A 1FJLA 1F43A 3HOWJ 4G12A 2O9LA 2OF7A 1ETYA 1GVDA 3K7AJ 2L7ZA 2LY9A 2XB0X 2HOAA 1JUSA 5GPCA 3GTMJ 1FEXA 4X6AJ 1WI3A 2GLOA 2NVQJ 1VI0A 1POGA 2EH3A 3BQYA 1GDTA 1TWFJ 4MFEA 2CUEA 2LTPA 3NARA 3JRFA 3S15J 2WV1A 3I4NJ 1U8BA 1UHSA 2VUMJ 1U9OA 4FE4A 4GFBA 4BBRJ 1ORKA 4D5FA 5EEAA 4XRMA 2XRLA 2XB5A 1WGXA 3GTLJ 2L0KA 5JLWA 2EQRA 1B72A 3W6VA 3ZQLA 3IV5A 2CUFA 3SDGA 1MBKA 3LSRA 1RR7A 1PUFA 2DA6A 5IYDJ 3MKLA 2W48A 3ZQFA 2EBIA 1IC8A 2HDDA 4J19A 3JRAA 4BKXA 1MBFA 1MBHA 3BTIA 1S7EA 2EZHA 3F0CA 1P7IA 2OPTA 3TW7A 5DS9A 3CCYA 3A02A 4M3BA 1O4XA 2E2IJ 1UMQA 4Y7NJ 1U78A 1EF4A 1VNDA 3TP3A 1AKHA 1R9TJ 3BR3A 3Q3SA 4HNVA 1QVTA 3BT9A 2MW8A 3BR2A 2R5ZB 1H89C 3WHCA 3WHBA 5C3EJ 3LSPA 4A3CJ 4FTHA 1MBJA 1H88C 3LOCA 4W1UA 2R93J 5EGOB 4I76A 2DJNA 5FJ8J 1X2MA 5F04A 2VI6A 3I4MJ 1JT6A 3BG5A 4A93J 2JK3A 2L7FP 1ZKGA 2AO9A 2FX0A 2Y9ZA 2Y2ZA 2ME0A 2JA8J 2VKVA 1A6IA 2L9RA 3D1NI 5J1UA 4MFDA 2QCOA 2MG4A 5F0FA 4BXXJ 3A01B 1MH3A 3DCFA 3ZQHA 3JRGA 5E3OA 4FE7A 4C3HJ 1AU7A 1HCRA 1FTTA 5J1RA 5E3NA 5EG0B 2XGEA 3GTPJ 3BR1A 3HM5A 2D5VA 3HGYA 4NDLA 5M5WJ 1JKPC 1NK2P 1HOMA 4M6VA 5J1YA 1ZR2A 3BG3A 1FTZA 3S2HJ 1E3OC 2I10A 3LNQA 4W97A 3FKIJ 2KDZA 1T56A 5HODA 4MIMA 4DW6A 1CQTA 2TCTA 2M8GX 5F27A 3S14J 3GTJJ 2Y0SN 3RZOJ 4A3BJ 2XPVA 5EZHA 2ID6A 2L7MP 4QTRA 1AKHB 3GTQJ 4C3IJ 5DTDA 2COBA 1SFOJ 1LFUP 2R7ZJ 1ETOA 1B8IA 3LSJA 2QF7A 4A3GJ 3TP0A 3ZOBA 1ETQA 3JRBA 1TC3C 2Y30A 4FISA 4A3FJ 3S2DJ 1ITYA 3BR0A 1X58A 2R5YB 4JX5A 1TWHJ 2PMZN 3FK6A 3S1MJ 2FQ4A 1QPIA 5FKNA 2EZIA 2NS8A 5IP7J 1I3QJ 1VFCA 2M0CA 5FLVA 4BBSJ 4ABZA 2JA6J 5C44J 3PO3J 3G1OA 3S16J 1MBEA 1HDPA 2HOTA 3HDDA 1WCMJ 3S1QJ 3OSGA 3E7LA
chains in the Genus database with same CATH superfamily
3ZQIA 4E4HA 2MD0A 3DKWA 2R0QC 1CF7A 4A3DJ 4E7KA 3W2AA 3FBIB 2L7KA 2LKXA 4EJTA 4CZZA 4L5IA 3FX3A 4CA0A 3OS0A 2JTVA 3IAM2 2E19A 2JUGA 4XONA 2XAJA 2G0EA 3WE3A 2KJBA 4UUSB 3GLLA 1JKQC 1YG2A 1VQ5I 1FMVA 2CQXA 4I02A 3D5LA 4NC8A 2EA2A 1QU3A 3CMYA 4M6XA 3JSPA 1X3WB 4RMNA 3QYFA 3K9TA 1I3AA 3KCCA 3BLYA 4M6YA 1L3LA 3TBIA 2O8KA 4PSXA 5DD8A 2WBMA 4MQ9F 1QZZA 1HQCA 3ZQ7A 4R8HA 2L4MA 4PCQA 3K4CA 5J4YA 1VQ8I 4IEJA 3MVPA 1R4NB 1W7PA 5IOYA 2FOKA 3AG4H 3BJOA 4DZJA 2CQKA 1QBJA 5FFXA 3BOQA 3CJNA 1TQIA 3GXOA 2E34A 2ZSHB 4XOPA 4U87A 2DMNA 1G3SA 2LMDA 1RC9A 2EFWA 1U5TB 4ESFA 2F4IA 2DXIA 2H8WA 1XG1A 2K4JA 2XV4S 4A3JJ 3HKZN 2M8EA 4DQ2A 3T5XA 2VBXA 3WGHA 1FIPA 3QWLA 1IDYA 3QYBA 4NNJA 4IRIA 4OIQF 4FCYA 1PUFB 5L3FA 2DA1A 1DUXC 1DU6A 3SZTA 4Q48A 3RQIA 5ICEA 4PFPA 2ME6A 4MGRA 5D5UB 1YW8A 4YFKF 3G1MA 2X6OA 3AG1H 3M4OJ 3CDHA 3ZQGA 2DA4A 2W57A 4LITA 2ISZA 4XICA 3L7WA 1IV6A 1Y1VJ 2KHMA 4QSHA 2DA2A 2OCEA 1IRFA 1QRYA 3DEEA 1YIOA 2K85A 5LGUA 3ONQA 2PFBA 1LE8B 2DMTA 2FE3A 4P96A 1S6LA 1BW6A 4F93B 1NTCA 1HKSA 3N05A 2R3SA 3CCVI 5GAGJ 2JJ7A 3G1LA 4AIDA 3IRQA 2EFQA 3E6MA 3K6GA 3BZKA 3M07A 3QYEA 2HS5A 3C7JA 1HDDC 1E17A 3CUOA 2XF7A 1JUMA 2GOMA 4L0YB 2JMWA 4HLYA 4L5JA 2P8TA 1PUEE 2E1MC 3BQZA 3ZN0A 2K9SA 4IHWA 1TNSA 2XGCA 3F6OA 1KYWA 4RM3A 3L2WA 2Z3YA 2LREA 3U1KA 1IXCA 1ZLJA 2VJJA 1VQKI 2COMA 2X48A 3BR5A 5GTIC 1K7AA 4E7ZA 3JSOA 4ZH4F 5M3FJ 5E3LA 4RAFA 1OFCX 3H0DA 5KNLA 4KIGA 1FYLA 3CQZJ 5FKLA 4IHXA 2P81A 1K61A 3FZVA 3V8KA 1ZG5A 3BG6A 2A68F 1LVKA 3LA7A 5IP6A 2MSYA 2LR8A 3O8GA 3W6JB 1XC5A 3GZ5A 1T39A 4PJ0C 5FKOA 4FETA 1BI3A 4XLEA 2ZMEA 2H6CA 3IH4A 2M3AA 4XLHA 1BR2A 1MNEA 4ENMA 3HBLA 3QPSA 3NEUA 3F8BA 5DCFA 3M8EA 4RGSA 2RNJA 1X3ZB 2J5PA 3ASOH 2PQ8A 2LKPA 1HW2A 4CDGA 2RQQA 4OU0A 2QSGX 3OYLA 2KZVA 2B0LA 3F3XA 2DPUA 2R7VA 5DCMB 3FMRA 2LY2A 4Y4RA 4MO7A 1TW2A 4UHTA 2EINH 2X6WA 4G7HF 2QQAA 2GWRA 4BY1J 3F8CA 3K2AA 3I4PA 2LKSA 1LPQA 1WPKA 1LNWA 3HSFA 3QQAA 1G6NA 2FEZA 4L5EA 4XL9A 1O7FA 3N97A 2IXSA 4LIVA 1CF7B 3CUQC 1FSEA 1OMIA 1WKMA 3P5JA 4V2FA 1TWCJ 1T98A 2DW4A 4XKCA 1D5YA 5FKMA 2FRHA 2HDCA 3PNTA 3CC2I 3MN2A 2NVYJ 3CO6C 2DLLA 1MDMA 5E79C 2KRFA 4LIUA 4XLCA 4L0ZB 4IJAA 4LG3A 3FHZA 2R5YA 2XRNA 3B02A 3DP7A 3IP4B 2EV6A 2QBYA 1V55H 3CP8A 5J4VA 3ZMTA 2FMLA 1Q1VA 2MC3A 5F0CA 1DU0A 2Y9YA 5LD2C 5DDGA 1XDUA 4WX9A 5D8LB 1XB4A 2ZJQF 3SJMA 3CO7C 3LQRA 3WTVC 5M5YJ 4MEXF 3KP5A 3MWMA 5H6QA 1S8NA 4P55A 1R4MB 4KUMA 1F9NA 1W7PB 1E2XA 1ETXA 2OZ6A 2X1EA 4D9JA 5CLSA 5BNGA 1UAAA 2VLAA 3FISA 5AIPA 2NVTJ 3E3VA 4F91B 5KCMA 3LSGA 2VXZA 4UUTA 3KZZA 3CP2A 3CF2A 3DTKA 1R5GA 3GBGA 2ZNZA 3C2BA 1WSUA 5J3LA 1OCPA 3OIQA 1IJWC 2HNHA 2CUJA 3BG9A 4PGHA 1OYWA 3OR1C 1XN7A 3W2VA 1ETYA 5GTHC 2OAZA 4RB0A 1RUNA 4UVAA 1R7JA 2LY9A 2OD5A 2XB0X 2H09A 2M4GA 2HQAA 5IT9K 1JUSA 2EILH 2FBIA 3QAHA 4KIBA 2CW0F 1D0YA 1K6YA 1D8JA 2BY0A 5B66C 2L3DA 3MCZA 3ABUA 5FB2A 1R58A 3FXKA 2F48A 4HV5A 1AWCA 4HBLA 3F8MA 2M0MA 1SAUA 4Y17A 4JBAA 2X85A 1VQMI 4ITVA 2CQ7A 1U9OA 4ANJA 2EK5A 2Y0SA 2QZ8A 2MLKA 4BBRJ 2VBYA 5EEAA 3EUHC 1J59A 2H1LA 1R49A 1GXPA 5FRNA 3WU2C 1IN8A 2ESNA 2KP6A 2FNPA 3LSRA 4C30A 2QLZA 2A6TA 2RVCA 3J7YJ 2DBBA 2DOFA 1I6XA 1VTNC 2K9LA 2JUCA 3ZQFA 2ZJRF 2QKLB 2CW7A 1U8RA 2HVSA 2X4HA 4BKXA 1MBFA 1MBHA 3BTIA 1X1BA 1S7EA 2EZHA 1P7IA 1KU7A 1IN6A 3TW7A 1R6RA 3KP4A 4M3BA 5GADJ 4ZYAA 3LQQA 5HLGA 4II2A 3IAS2 1D8KA 2E2IJ 1EF4A 2F5DA 3J81K 4GYGA 3HL2A 1AKHA 1QPMA 1FBUA 4HNVA 3K2ZA 3FMQA 4FHTA 4B48A 3GZNB 4ZDOA 1DP7P 2RC4A 5ICFA 3P7NA 2X6XA 4A3CJ 3CCSI 1XTAA 3CF5F 1LDDA 4BQNA 4HSTA 3VB2A 3ZN1A 2IGOA 4ENNA 4CCKA 1DP3A 2FMYA 2IS1A 2VI6A 4FX4A 3AG2H 1JT6A 3L00A 4UB8C 2L7FP 5JVTA 3K1MA 3GFMA 2PG4A 2FX0A 1YFHA 3BG7A 2ZMEB 3WODF 1A6IA 2EV5A 3S32A 1YITI 1MJBA 3D1NI 3CCLI 4EJUA 1TL8A 5F0FA 5E8IA 4IPAA 4BXXJ 4EATA 4G6DA 1W36C 4KFCA 1FC3A 3DCFA 4KNYA 4C3HJ 2FSWA 2MBFA 5D4RA 2HDWA 3HXLA 1VQ7I 3KLOA 5TGTA 1QA6A 4XLPF 2ZNYA 1JKPC 1ON1A 3DXJF 2Z5UA 1ZR2A 5BQTA 1D5VA 1FTZA 3S2HJ 2ACJA 2ELJA 4BS9A 1E3OC 3PQKA 4DBQA 3SXYA 4MIMA 2TCTA 3RZOJ 2LH9A 3H3ZA 3K70D 2H94A 4B47A 3GTQJ 2Y48A 1HW1A 2VQGA 2HVRA 1I1GA 5HDNA 2ISYA 2YPRA 1O7LA 2NYXA 3OR2C 5J8FA 1S7OA 2DCEA 2EB7A 3OYGA 4I01A 2BY2A 1ZELA 1ETQA 2Z16A 3K4JA 1O3QA 1BR4A 2WC2A 3K4BA 3LAPA 1MDMB 1ITYA 3S2DJ 4IQ4A 2D1VA 2R5YB 2DTRA 2XAGA 2MH9A 2QBYB 3ZMUA 3E1SA 3S1MJ 1QPIA 4OMZA 1SD4A 2EZIA 3UNGC 2EWNA 1VFCA 1SMTA 1WZ2A 2DFEA 3A0HC 4BBSJ 4HDVA 5C44J 1HC8A 3PL8A 2XF5A 2FNAA 2B9SA 3RPQA 3V8LA 4BDYA 4FQGA 5CJ9A 5B1BH 1LEAA 3J7ZI 4B8XA 5HDGA 4XN3A 2FBHA 4Q5SF 3DBRB 1XPXA 2CU7A 1RESA 2RN7A 3EYYA 1HA8A 1XSXA 3HOZJ 2W25A 4UUVA 2DN0A 2AQFA 4BY7J 3S8PA 1MJ9A 2P6SA 2Y75A 1U2WA 3MKYB 3BTJA 4V2GA 1JTXA 2ZSIB 5CQGA 3PQJA 3C2HA 2YX7A 3CC7I 3OYFA 3I64A 1VF9A 4RAZA 1P92A 2VKHA 3HOTA 3BCBA 2BV6A 4PZJA 1MNMC 3HRUA 3QRFF 3TGNA 2AXLA 2JPBA 3IKVA 4HRIA 1OQYA 2K9NA 2WV0A 4M3GA 1Z3YA 2O03A 2ZO4A 3M8FA 4NC7A 4HDUA 1MMNA 5IYBJ 1UCRA 2DU9A 3MZ8A 1ZRFA 5F1RA 1LE8A 1PP7U 1IN7A 2L01A 2P5KA 4DYRA 4IKFA 2IGMA 1YW7A 2CYYA 2NVXJ 1IXSB 2CH0A 3LSTA 2RDPA 2EPFA 1KZHA 3OYMA 5K5OA 4O5VA 2MYSA 5FKKA 3CMEI 4GRIA 5H6RA 3UR3C 4DOZA 2LOOA 4KMFA 3HPHA 1VQNI 2DFFA 3GFJA 4PGGA 2IAIA 1RETA 3TO7A 4A3IJ 2JWTA 2CW8A 2HOSA 4HF1A 2E36A 4RGXA 1S72I 3F8FA 2YU3A 5FLXK 3NAUA 2VQCA 3G4SI 2LBFB 4JP0A 1A35A 2XPUA 2G9WA 5L3GA 2ZJPF 4ON0A 1QHGA 2DT5A 2ZXJA 2XUBA 1MZBA 4IOAF 1MJAA 1TT5B 4BQQA 4I98B 5L3BA 2CV1A 5B5EC 3KEOA 1XCBA 1FNNA 3FXQA 2ID3A 2DA5A 4ZTJA 5IP9J 3GCMA 2P4WA 4QIWN 3SDBA 2IBDA 1MMSA 4KMUX 3OYNA 3MFKA 3VSLA 1K83J 1QHHD 3Q0VA 2HTSA 2IVMA 2KL4A 2R4GA 4XN0A 4UY8I 3CUQA 1R1UA 4PJNA 1FIAA 1FWZA 3TOBA 2KRCA 3E6BA 4AC0A 2QQBA 4P9UA 3H5AA 5DD4A 5FRMA 2E5NA 1WJCA 1R23A 3RJPA 3HRSA 1YIJI 2IT0A 3LA2A 1LVAA 3P9IA 1SFKA 1BIAA 2Q2EB 2FJ1A 2E2HJ 2D2WA 4XMYA 4BAYA 5BMZA 2HPMA 1IV8A 3ELKA 1NHAA 4D5CA 2XIGA 3CJQB 3BR6A 1V3FA 4HQMA 4JYKA 5FD6A 4EV0A 4BHCA 2QSFX 4CSWA 3KYLA 1Z0XA 2WAQN 3KP2A 3VSKA 2Z9OA 5EEGA 2F5EA 5ILSA 3BZ6A 3OYJA 2G7UA 3FWEA 2Q0OA 2K9QA 5EGOA 5J8CA 1HXDA 1KYZA 4ENJA 3AAFA 5EEHA 2NS7A 2R7TA 5C4XJ 2OA4A 1YE9A 3CC4I 2A6EF 4UVBA 1LJ9A 1BOAA 1VQPI 4I09A 3KX2A 2EFPA 1K4SA 1MSFC 1I50J 1JGGA 4OIOF 1APLC 2V9KA 4HNTA 3VFZA 1FY7A 2IS2A 4D7MA 3CMMA 2NRAC 1RUOA 3FXRA 4F7ZA 2CFOA 3JREA 1GV5A 3GX4X 4JX4A 4MQVA 3RYRA 4BH9A 2UZKA 3F6VA 1D0ZA 2XSJC 1XGOA 1B59A 3H9QA 4I6ZA 4HX4A 2WAQA 1G4DA 3H36A 3KZYA 2OZUA 2KFDA 2DAOA 2CO5A 1FP2A 5HLHA 1IUFA 4L9VA 5CVRA 3GZ6A 3B6AA 3T8RA 2K9MA 4IHYA 1IO2A 2M4KA 1M1EB 1JHFA 5TJJA 2MLGA 1J09A 3CCEI 2V26A 4CXFA 3PNVA 4L9TA 2YX4A 1FYKA 2MH2A 2GIVA 4U0YA 3EUHA 1W7PD 4C2TA 1YLFA 3BTCA 2BW3B 1WWXA 4J00A 4ENKA 3SFIA 2CQQA 4BQOA 1X1DA 3CJTB 1W0TA 3OYAA 3FIWA 1WH5A 4XLFA 3CCUI 4ZJZA 3SZPA 5IPAA 1YW9A 1AOYA 2PI0A 4DNCA 1OCTC 2BEOA 2VQLA 3TO6A 5E3MA 1P7JA 2E1MB 2I5UA 3CJRB 2OC6A 1B6AA 1A04A 1R71A 3VYSB 3AKZA 2F5FA 3PFIA 4BGDA 2LC2A 2RGVA 1VQOI 1HKTA 1ETKA 3TMOA 5E18F 4AD9A 3A0BC 1MKMA 1OCZH 1SEUA 2V6CA 1GV2A 2X0LA 3OWTA 3G6EI 2GA2A 3JR9A 3E5XA 3LA3A 3N4MA 1G2HA 4IQJA 1KU2A 3BP8A 1LB2A 3PM1A 2QEXI 4NBQA 1XMXA 2JRTA 2KISA 3T1BA 4CYCA 1AHDP 3MZYA 4XQFA 1KQ8A 4WXCA 3PIOF 1Y0UA 2QUFA 4HOBA 5ILUA 2R7XA 1JJ6C 1UB9A 1R36A 5J6XA 5FLMJ 2JSCA 3HRMA 4F3QA 4RDUA 4RB3C 2IGKA 3WGGA 4U7DA 2K7LA 2K5CA 2DQLA 2HKOA 1HKQA 4G12A 1FBSA 1GVDA 1QQIA 4GYIA 1W5SA 1XGMA 1J75A 4XOTA 2UV1A 5GPCA 3GTMJ 2W24A 2R7QA 2NOJB 1FEXA 1V54H 4X6AJ 4U88A 2GLOA 2NVQJ 1VI0A 4AIJA 1H0MA 3H35A 1BR1A 2EH3A 4CUGA 3D5SC 4B43A 2GXAA 1WJDA 3A2KA 4MFEA 2FU4A 3NARA 4OAYA 1Z7UA 3E5QA 3S15J 1KONA 2VBZA 2VB6A 4IOCF 4HX8A 2PN6A 2GZWA 2Y69H 3Q5FA 3NQOA 1U8BA 2XGXA 1USSA 3EETA 5HS8A 2DK8A 1JE8A 4FE4A 3TQNA 1LDJA 3PIPF 2BOLA 2P7VB 2DYSH 4PDKA 3LSHA 4D5FA 5HDKA 3JW4A 4CYDA 2VL8A 2LF8A 2JPCA 3CUQB 2XB5A 3U1DA 1Z05A 2V9PA 5DUKA 3QP6A 1B72A 2UXXA 3W6VA 3IV5A 2KZGA 3MD2A 2E5ZA 3BZCA 3SDGA 4KN7X 1AA7A 1OCRH 3KEYA 3MKLA 4HF2A 5AIQA 1RRJA 2EBIA 1IC8A 2BBYA 4HSRA 2G7HA 4B44A 3SFZA 1MNDA 2IPQX 3F0CA 2BGCA 2L2OA 1T6SA 3HSEA 1KQ9A 2XASA 4XSXF 4YELA 2JVGA 3G73A 1O4XA 2KIQA 4GXOA 1YS7A 3H9JA 2XVCA 1VNDA 3I58A 1TNTA 1R9TJ 3BR3A 2QKMB 3K4NA 1QVTA 1WJFA 2DO7A 3S3OA 3MAJA 5LLQA 5E17F 5LGTA 3OYIA 2JT1A 4BYYA 5IT9Z 4OOIA 4IF4A 4FTHA 1MBJA 1TBXA 1BIBA 2M5WA 1H88C 3GVAA 3SEQA 4F92B 4N9HA 4PUSA 5EGOB 4G6TB 3VYTB 1Z3XA 1YJ9I 1XMKA 3I4MJ 3ULQB 4Y13A 3S2WA 2JZYA 2AO9A 3DLLF 2HOEA 2Y2ZA 2X51A 1BN5A 1TW3A 3TDZC 3VYUB 1O3RA 2Z2SB 4MFDA 4LLLA 3LSKA 3KP3A 3QPHA 2NNYA 1RR8C 3QU3A 1REPC 4Y15A 3GMEA 2A5WA 5E3OA 4FE7A 5D6EA 3W2WA 1RI7A 3RIRA 4IHTA 3OYCA 1FTTA 2ZXIA 2F5CA 4E7JA 4H0EA 1PYVA 3HM5A 4KJZA 2CGPA 2D5VA 2IA1A 3V7RA 3CDIA 3WE2A 1NK2P 3GLXA 5J1YA 2DI3A 1NG6A 3A4CA 3OV8A 4W97A 3FKIJ 3F72A 2KDZA 1T56A 2W4SA 1STZA 1Y8RB 4YG2F 2L9NA 4DW6A 3J7AO 3S14J 3ZMZA 2Y0SN 1PP8F 3L2RA 1VQLI 4A3BJ 5EZHA 2ID6A 1E3PA 2L7MP 3BWGA 1WJAA 4ZYDA 1FYMA 2L02A 3HZJA 3J81Z 5DTDA 3O6BB 3H9GA 5ILVA 2FA5A 1B8IA 2K3PA 1WQ2A 3TP0A 5K5RA 3J80K 3ZMVA 1VQ6I 3JRBA 3L09A 4U0VA 2V1UA 1HSTA 1TC3C 4FISA 4A3FJ 3BR0A 1LKXA 2D1HA 2PMZN 1E0EA 2ZCWA 2XAFA 3KIOA 2MD5A 2NS8A 5IP7J 3M1EA 1OPCA 2O6GE 5LEKA 5FLVA 4UXNA 1DPRA 3OY9A 3PO3J 3G1OA 3IRRA 5DM6F 1WCMJ 4AIKA 1J0RA 4ETSA 5LBQA 1YJWI 2MABA 3E7LA 3IH3A 4XK4A 2XPWA 1BC8C 2PLYA 3EDPA 3BDDA 1XMAA 2LF7A 3RQ4A 2DA3A 1ZG1A 2PJRA 4CHUA 1EKEA 2LBFA 4RA2A 3AL0C 3OMYA 1IW7F 2HYFA 1ZR4A 4KYWA 1ZK8A 2M2EA 1IN5A 4CYCB 3BJAA 2OUMA 2QVOA 3BPXA 1Y1WJ 1MMDA 2Z33A 4PSWA 3FXOA 4N4NB 2V79A 3GEZA 4ZDPA 2PMZA 2BHZA 2QGUA 5A2QK 1D0XA 3A03A 4HG2A 2VASA 1R22A 2V1XA 2VPRA 3S1NJ 4MNUA 3I5UA 2LG4A 4V19K 1MBGA 1YTYA 1J9IA 1NG7A 5L3DA 1LEBA 3UKGA 3ZMSA 3CTAA 1X1AA 2K3FA 4IHSA 3HJEA 3ERED 3DEWA 3HIFA 1BA5A 4HF0A 2PEXA 4BJ6C 4R1HA 5KAFC 2JVHA 3W3CA 4AU7A 1B1BA 4E7HA 5LRRA 4LB6B 2R7SA 2DFIA 4JX6A 2HXIA 1DGWY 5B3SH 2RV8A 2QA4I 1IGNA 4RGRA 2KPMA 2Q2EA 4TV7A 2O7OA 1I1SA 4GCVA 5DM7F 2JA7J 2FF4A 1SFXA 4XNFA 1QVUA 2W00A 3LWFA 1WRJA 2KIMA 3PUFA 3GW2A 1QGPA 5CYVA 1B72B 2BXYA 4ZZLA 2EIKH 4BL0B 4UNOA 3C18A 3QPLA 5HVQC 1MSEC 3I53A 2DTZA 1YRNB 1ODDA 1F4KA 2BY3A 1GXQA 1JGSA 1G59A 3I71A 4L9NA 2VONA 4MHGA 5IOZA 2WAEA 4DBRA 3HHHA 2CJJA 2F2EA 2IEKA 3HTUA 4PJJA 4XKVA 3WG7H 4AWXB 2L54A 2N8GA 4NUBA 3HGGA 5KVRA 1RKWA 2ICWG 3LSIA 2MC4A 5LHIA 4P1WA 3L2UA 4FX0A 4BACA 3SYTA 1VZ0A 3VWBA 4WF2A 3HG9A 1T33A 2BZTA 5JR3A 3WTUC 4MTEA 1OYYA 4OIPF 1SFUA 2LLKA 5TRDA 3CLOA 1MMGA 3DEUA 5HS7A 3CCMI 2Q1ZB 2GXGA 4IZZA 1OLTA 3E6CC 3K10A 1D1BA 2L5QA 2VQHA 4X0GA 3DPUA 3H3VK 5F1JA 4E7LA 1T0FC 2YUSA 1TWGJ 2VOOA 1RZ4A 1ZQ3P 2LY1A 3M7GA 1I39A 1HBXG 2OTJI 2BHYA 4HA8A 5EF6A 3WTZA 2RAEA 4G7ZF 3I9V2 3HEFA 3GFLA 4RB1A 4DGWB 1QZEA 4EVIA 4A0ZA 3L2VA 1ZGJA 3IH2A 3WTWC 5L3EA 1XSVA 2CMPA 2OTLI 2BW3A 1DQUA 4I0BA 3RZDJ 2ECBA 4CO8A 3QPTA 1XX5A 4GO1A 2LVSA 1W5CC 3IL2A 1W1WE 2EV0A 2B63J 4B4CA 3M3YJ 1P9QC 2KJCA 2MA3A 2HPIA 2DT7B 3HOUJ 3O3KA 2HZTA 5LHGA 3PUBA 1UJ8A 3K4LA 3Q9VA 4S0HB 4BJTA 5FO5A 3MKWB 2FXAA 4KT5C 1RIOH 1TT0A 4LLNA 1B8IB 2DFHA 1B4AA 2FBKA 1EH6A 3WGIA 1IG7A 4A69C 1RPWA 2HQRA 2WB1N 4BU2A 4RB2C 4EGYA 2LFBA 5M5XJ 4EGZA 4HNUA 1IRXA 4JOMA 4WCGA 2DMUA 1W5TA 5EG0A 5CVIA 5D8KB 1OISA 3IC7A 1ZTRA 2A07F 3QODA 4X1EA 5JFRA 4DJAA 3HOVJ 3EYIA 3ERMA 4F55A 1UFMA 1U9NA 2HR3A 3IWZA 2E2JJ 4QWQA 1DGRM 1Q1HA 1HSJA 2LK2A 2BVMA 3K69A 2M34A 3FF5A 2OCCH 2P5LC 1KU3A 1R5ID 1NH3A 1C0WA 3KLNA 4IRGA 4E7SA 5EJCA 5D4SA 2ELHA 2YS9A 4MLOA 3S93A 2HYJA 3VODA 4IHVA 2TDXA 5JHUA 2IGNA 3L9FA 4ZYEA 2PJRB 3CCRI 5GAEJ 4DYCA 2KMUA 4YIFA 1BI0A 2EA4A 1JUPA 2M7BA 2ZFUA 4I7HA 4M72A 4M74A 2WB1A 4RAYA 5EZGA 1S3JA 2E7XA 1D3YA 4CCMA 3MMYB 3OIOA 1Z6RA 2VE8A 1YX3A 3DKYA 1W0UA 3GF2A 3DBHB 1GLNA 3HUGA 1ZLKA 1ETVA 1EH7A 3GTOJ 3DPLC 1GT0C 2HFHA 3OOUA 3I0TA 4A12A 3KP6A 4B3XA 3VYRB 2A5YB 3V8JA 3FM3A 1OCOH 4G8XA 2BY1A 3RPUA 3SZGA 4M3FA 4RM2A 2K86A 3TW6A 3H1CA 1O3SA 2STWA 2ZFWA 1P4XA 1BBYA 2W84A 1G3TA 3S1RJ 1WH7A 4CCNA 1JKOC 4YIIA 1N77A 2F4MB 5IYCJ 2R92J 3PO2J 5F6FA 1UHWA 3GTKJ 4EM2A 3OYEA 3JTGA 3T0YA 1XGSA 3WTXC 1Z77A 3PSIA 2F6CA 3HOXJ 2GXBA 1IRGA 1F36A 3ABMH 2EZKA 2NNNA 2OJED 3TL4X 1T8IA 1X2NA 3H3UA 1BI1A 1K4TA 5AONA 1F1ZA 1ULYA 1YO5C 2CV2A 4O6JA 2CWEA 4RAGA 4WWCA 5K1YA 3I59B 1L0OC 2DOEA 2VBWA 3OL3A 3LL7A 1FJLA 3QP5A 5ERIA 1I5ZA 5HOOA 3F21A 2O9LA 2OF7A 2EIJH 5BS6A 3K7AJ 1YHQI 5FROA 4N0BA 5K5QA 3DTEA 5J40A 2XHKA 2BYVE 2EFOA 5LHHA 2VODA 5JI6A 1YS6A 1WI3A 4LD5A 2QWWA 1POGA 1JXSA 1V5EA 4AVZA 4EJWA 3ASNH 4PFOA 2CUEA 1ZN2A 4A6DA 3JRFA 1J2XA 1FPQA 1V5FA 1FT9A 3WTYC 1P4AA 4RS8A 3X2QH 1UHSA 2IP2A 2VUMJ 5LEJA 3ABKH 2L9SA 4GFBA 2R7FA 3CCJI 1ORKA 1DPUA 4ZYGA 1GVJA 4ESBA 4XRMA 4LJZF 3T8TA 2IA0A 5JLWA 4G94A 3ZQLA 2VIXA 2M87A 2DT6A 1MBKA 5IYDJ 1RR7A 4OAZA 4XKBA 1TZLA 1Y56A 1UG0A 4U0WA 4A2UA 5JVGF 4OWRB 2OU2A 1OR7C 1WI9A 2KKOA 3JAMK 1PJRA 4J19A 5DUIA 3Q9SA 3JRAA 5CVJA 3NRVA 4D0PA 2R7DA 6PAXA 3A02A 4DIQA 1U0JA 4QPOA 3I55I 1FSHA 3G71I 2ETHA 1FBQA 1XGNA 4L9JA 4Y7NJ 3K70C 1U78A 4OIRF 2AXTC 2K4BA 2O0YA 5JHFA 1Z1DA 2H6BA 2MW8A 4GGGA 4LFUA 1X4PA 2VT3A 3A1YA 2BXZA 3BR2A 2V4JC 1H89C 3ESWB 3WHCA 4IO9F 3D5RC 2E1NA 3ZGKA 5C3EJ 3LSPA 4XSZF 2KLOA 3FXMA 2M30A 2R93J 1MD0A 4I76A 2A3SA 3GUDA 2DJNA 2HEOA 3LAJA 2ESHA 1X2MA 3QOEA 5CVUA 2L9VA 2J5OA 1B9MA 1ZKGA 4XRFA 1SD6A 2DODA 3NWSA 3BROA 2O3FA 3HOSA 2ME0A 1E3HA 2HU9A 4E7IA 2JA8J 2VKVA 2L9RA 3TO9A 1PDNC 2X6YA 5J1UA 5BPDA 1X4OA 2OQGA 4YFXF 2R7RA 4C2UA 3ISPA 3ZQQA 3ML6A 4S05A 1S9HA 2CG4A 1AU7A 1R1VA 3FXUA 3WTTC 2IS4A 2M7AA 2XAHA 1P4WA 3R61A 2CQNA 4C9YA 5J1RA 5E3NA 1R5HA 2QYOA 3ROUA 4G6QA 3REOA 4Z6YA 2XGEA 3MQ0A 5EG0B 4BDZA 3OYBA 1FOXA 2C6YA 3EQLF 2HKXA 4NDLA 3L2QA 5M5WJ 3JCUC 4LG0A 1HOMA 2BVLA 1YYVA 1DDNA 5FGMA 1ZH5A 2DJIA 3M1CA 2FQ3A 3VOEA 4PJMA 2P5VA 3K4MA 3LNQA 1FOKA 1U5TC 1TP4A 3CLQA 3MEXA 1CQTA 2DPDA 3GTJJ 2E1CA 4U7BA 1K78A 2XPVA 1S7AA 3RI4A 4CCJA 1JHHA 1X1PA 2COBA 1FMWA 1X1CA 4EJVA 1LFUP 4HX7A 4HPQA 3HKZA 2DDAA 1KA8A 3IWFA 2PX9A 4M9XA 2PMHA 3SQNA 4EQQA 1IF1A 4B09A 4ZYHA 4ESJA 4CCLA 3V7CA 3WTSC 2HTJA 1UHMA 2KDOA 1D1CA 2V1NA 2E71A 4HAMA 1O57A 4JX5A 3W6KB 2IJLA 4XM3A 5FD5A 3G2BA 3FK6A 2BE5F 2FQ4A 3RCOA 5FKNA 1USTA 3HUGB 4E6KG 4E70A 1G3WA 1I3QJ 4FASD 1ZG3A 3DPTA 3I54A 4P5OA 2M0CA 3TKYA 4ABZA 3IKTA 1J5YA 4D1QA 1CGPA 2AQEA 3CZ6A 4UV8A 3VDXA 2CS3A 1MBEA 3S16J 3O2PE 1W36D 1HDPA 2HOTA 3S1QJ 1SMYF 1YQAA 3VPRA 2DMPA 2VJIA 1ENHA 3J7AY 3QU6A 1BL0A 2E1OA 4JQFA 1LDKB 2VT2A 1OJLA 2XAUA 5E8GA 3RSNA 5L3CA 3ZPLA 1GHCA 2HXOA 3B6CA 5E1WA 3ZQCA 1FLIA 1U3EM 3MZHA 1RKTA 5JLXA 4EM1A 1YRNA 1A6QA 1JKRC 5HLIA 3H0GJ 2A05A 4NQWA 1ZAOA 1SANA 3L1PA 1T95A 5M3MJ 1P6RA 1XD7A 3C3WA 3GTGJ 3K4KA 4FT8A 1Z91A 2ZJ2A 3PSFA 2RNGA 3U21A 1EJ9A 1WVRA 4BJ5C 4Q4ZF 3M9AA 3IHUA 1T0FA 2UXNA 3V4GA 4QPQA 4BUPA 3KP7A 5ICCA 2LRDA 2PBIA 2XKPA 4DZPA 5J47A 4XIDA 4O3MA 1TQMA 4RLFA 3BPVA 3RKXA 3J80Z 3EUAA 2E35A 1FZPB 2MFZA 5H20A 2Y0MA 3JTHA 3LFKA 4XR6A 2DQRA 3KE2A 2XF6A 3Q0WA 1R00A 4II3A 2OQRA 3FKJA 3FK7A 3R0AA 4A3EJ 4GDFA 1BI2A 5DV5A 1A5JA 1MH4A 4NC6A 2K40A 3BTLA 2QQ9A 1SVLA 3SHFA 3Q0UA 1D1AA 2STTA 5HS9A 4M3DA 1W4MA 1I6HJ 1S5LC 2LDUA 4M73A 4PJLA 1WHUA 2VKEA 2LP0A 4N9IA 1BOBA 4XLNF 1ONVA 3WG9A 2ZB9A 5EDNA 1IUYA 4KIFA 2CFXA 1F5TA 4H4KC 4M71A 1EH8A 2LD5A 3KZIC 5CQEA 3JRIA 3F23A 2IW5A 1VQ9I 2AHQA 4EMSA 3OSFA 2PJPA 1Z21A 2YR2A 1ACIA 5K7HA 1UELB 2LNBA 5GP9A 3OS1A 3P9CA 2XROA 4IXAA 1H8AC 3AFHA 4HW0A 5A2QZ 1A36A 4ZC3A 4HYEA 5C4JJ 2QSHX 4UB6C 2JA5J 4A3KJ 2NOGA 1TTYA 3AG3H 1SVOA 1TWAJ 3ZP5A 3CESA 1JTYA 2QENA 2ECCA 5IT3A 4J01A 1UG2A 1SVMA 5ICGA 2VE9A 3FBNB 5D5VB 4ZDLA 2WADA 3AL0B 2CRGA 2R7WA 3HTSB 3MKZA 2DOAA 2CUZA 2KT0A 3ZMDA 4Y33A 2DYRH 1SD7A 4K2EA 1A31A 4LB5A 4OMYA 2WA0A 5K7ZA 1NK3P 4KA4A 4KN4X 1MW7A 1WFXA 4XORA 3VEPA 3FXJA 5LFAA 2XSDC 1MIJA 1JT0A 5HNHA 1Z6TA 1S29A 2WY7Q 2XDVA 4M9SA 5EYRA 2JA2A 2EIMH 4R79A 2DA7A 1MGTA 4A3LJ 4MEYF 4DYQA 3JRCA 2EJRA 1ERDA 3E5UA 1IAWA 1Y0NA 3DKXA 4Y3OA 2XGDA 3JRHA 2GM4A 2R5ZA 2O8XA 4KISA 1ZRCA 2HWVA 1P2FA 2K27A 1XS9A 5GPAA 5GAHJ 3DF8A 1WJBA 1XSDA 5F64A 2F4OB 4LG0B 4AIHA 1JJ8C 2VJ5A 4I2OA 2M45A 3K1PA 3OYDA 4BE0A 3FHNA 2XKOA 3FDYA 3HYIA 3K1NA 3DTIA 2V7FA 5HLTA 1KQ0A 2CSOA 3PJRA 3ZRGA 1BM9A 2UUZA 1TQPA 1SFEA 1OYIA 2TRTA 4Q47A 3F22A 1SAXA 2NS0A 1K78B 4M9ZA 3FM5A 2HI3A 3OS2A 1K6OA 4BE1A 2JRMA 3I3LA 1LUJB 2A61A 5LGNA 1IZ1A 2VJ4A 4AM3A 3WU1B 4IVNA 4NHJA 3S17J 3BY6A 3FXLA 4HZFA 1EA3A 2Y31A 3DWLE 3EUKL 3A01A 4ZZDA 2QQ8A 5DYMA 4A0XA 3DQVC 1WJEA 3B73A 3CDLA 3RTRA 1B9NA 1ZGWA 3DBLB 5K7FA 4XKWA 2Q8KA 3LMMA 3IUOA 3R0JA 2ZXHA 3PFYA 5E1XA 4A3MJ 3HSRA 1YI2I 2PMUA 4RGUA 3COAC 2RKHA 4LLGF 4AYBN 3GO5A 4D7NA 3EPZA 5H2FC 2QM3A 5F08A 4XRSA 4EJOA 2YU9J 2MGQA 3F9KA 2VPLA 3O8HA 3DFGA 3HOYJ 4G7OF 1HW5A 4KT6A 2X9DA 3LFUA 4C2MJ 1G3YA 4LOCA 1FOYA 1Y39A 4A5MA 3I59A 3BCAA 1JI8A 1U6GA 4XRSG 2M1BA 5KHDA 2H8RA 4LMYA 2H1KA 2JN6A 2OV7A 2GBYA 2VXDA 4AVPA 3OYHA 4ASNA 1N75A 3NWTA 2GQQA 4NQWB 1SC7A 2HQNA 3ZR8X 2EZLA 2DDBA 1ZHFA 3RKWA 2M9HA 1OR7A 2ZXWH 2NAZA 1Y6IA 1IDZA 1IRZA 5F0HA 3S3MA 2NXNB 2DMQA 4B1RA 4WXHA 5D5XB 1GUUA 1ZGAA 4BEHA 1J7KA 2R7UA 2EFNA 3JRDA 4L18B 1ETWA 4N4OB 4AYBA 3TEDA 3HB9A 3CMAI 2HQ5A 2HVQA 2KRHA 2Z1DA 3E6DA 4M3EA 4HEA2 4BXUA 4CCOA 4HQEA 3S3NA 4AUXA 3QOPA 2O61A 1LFPA 5KAIC 1QNTA 1HF0A 1PVEA 4EEFG 2IA2A 3RKQA 4HLXA 5E1ZB 3OOPA 1FX7A 3HPGA 5CVVA 1ZYRF 4C3JJ 4IL6C 1N25A 4Y52J 2W82A 3KEQA 2DK5A 4UUSA 2W1OA 4IX7A 9ANTA 4B3AA 4HV6A 3R60A 2RREA 2FD5A 1BJZA 4WXDA 1O3TA 2ZMEC 1Y8QB 3F8NA 2ADUA 4RBOA 3KFWX 2JSPA 4ZTFA 1HLVA 1LFBA 1BW5A 2ZKZA 2W85A 2ELKA 1ZARA 1YJNI 2LSOA 3R4KA 1F43A 1V4RA 3RYPA 4EM0B 3HOWJ 5FLXZ 1T2KA 3RKYA 2L7ZA 4F52A 4WK8F 4RLQA 1KGSA 2HOAA 1H9TA 5B1AH 1QZYA 2K02A 3H5RA 5HNFA 3GFIA 1RNLA 2E7WA 2GOXB 3HRTA 2AS5F 2A6HF 3I56I 3BQYA 1GDTA 2X1DA 1TWFJ 5KK1A 2LTPA 2O5RA 2FOWA 3RDIA 3WU0A 1U5TA 3G3ZA 3E97A 5LRSA 3H5NA 2WV1A 3I4NJ 1V5GA 2VOPA 1VQ4I 3L2CA 4CZCA 1KU9A 1X19A 4BXFA 3KYCB 2GIZA 4XBFA 2XRLA 4KICA 2H27A 1WGXA 3HHGA 3GTLJ 2L0KA 2EQRA 2JQ7A 2CUFA 3U9GA 1SD5A 2V9VA 2E60A 1PUFA 2DA6A 2KIFA 3CD6I 3DU6A 1T38A 2W48A 5TISC 4YIRX 2HDDA 5CPRB 4NB5A 4CGZA 2HZDA 3M8JA 2Z99A 2NVUB 1EV7A 1TLHB 5IY5H 2GAUA 4XLAA 2OPTA 5DS9A 3CCYA 2W7NA 3KPHA 2WTEA 1FOWA 3DU5A 3SEZA 1YX5A 1UMQA 4KITB 2XAQA 3BJ6A 3TP3A 1IXRC 4A0YA 4BHBA 3Q3SA 3BT9A 3PNYA 4CICA 5E20A 1I27A 1R1TA 4CH7A 2L4AA 2OBPA 1XCVA 2R5ZB 4QLCU 2V6EA 3WHBA 1K79A 1XDSA 4G9YA 1OKRA 4BHPA 3LOCA 4W1UA 4YRVA 5FJ8J 4LK1F 5F04A 3OYKA 3BG5A 4A93J 2JK3A 3K0LA 5CKTA 3ABLH 3GYHX 4BNCA 2HGCA 3KYDB 5D6FA 4OINF 4BE2A 2Y9ZA 3ABTA 3V7SA 1UZCA 2F5VA 3P9KA 3OL4A 2FUG2 2IS6A 2QCOA 2MG4A 3R6SA 1Z67A 3ECHA 2WWYA 2VKDA 4JK1X 5BOXA 3U2RA 1ZRDA 3OIPA 2X1CA 3A01B 1MH3A 1G8XA 2P0WA 1QO0D 2V1DA 2ZBKA 1Z7LA 5DEQA 3ZQHA 3JRGA 2CV0A 1X3UA 1WJ5A 1HCRA 4A6EA 4LK0F 2XC7A 5D5WB 1ON2A 4I99C 3BR1A 3GTPJ 3TDUC 3HGYA 3V42A 5ED4A 4S04A 2WAFA 4M6VA 1Z9CA 3JAMZ 1YOVB 3ZXSA 3BG3A 3H92A 2I10A 3FMSA 1OCCH 2IRFG 3HC7A 2D45A 4KDPA 3CCQI 2P7CB 3E0JB 1BJAA 2ZC2A 5HODA 3RPUD 2VN2A 2M8GX 5F27A 2VC0A 4Z2YA 4MTDA 3BC8A 2VC1A 4QTRA 1AKHB 4C3IJ 2YSRA 1SFOJ 1ZREA 3DLAA 2R7ZJ 1ETOA 4P9FA 2I8DA 3LSJA 1H9GA 2QF7A 4A3GJ 5FFZA 3ZOBA 2UWMA 3GWZA 1FP1D 2R7OA 1BC7C 2RQPA 2Y30A 4IRHA 3KETA 5DCMA 1X58A 2HYGD 3C1DA 2GA1A 4UV9A 4LGWA 1TWHJ 2WY8Q 3ECOA 1MMAA 2B7EA 3C2GA 2KQRA 2P6TA 4BQAA 3ZCOA 4A5NA 4YFNF 4PK4A 2LYCA 3DV8A 3LSMA 3TOAA 4I0AA 3D0SA 1IN4A 2JA6J 4UVCA 4BEHB 5BPIA 1LQ1A 2KIUA 4YEJA 1N78A 3HDDA 2A69F 1T08B 3OSGA
chains in the Genus database with same CATH topology
3IH3A 2DMPA 3VPRA 1ENHA 3ZQIA 4XK4A 2R0QC 2XPWA 1BL0A 4A3DJ 2E1OA 1OJLA 2LKXA 2DA3A 2CU7A 1RESA 2HXOA 3B6CA 3ZQCA 3HOZJ 1ZR4A 1ZK8A 2E19A 1RKTA 2M2EA 5JLXA 2DN0A 1YRNA 1JKRC 4CYCB 4UUSB 2G0EA 3H0GJ 1JKQC 4BY7J 1Y1WJ 1SANA 3L1PA 5M3MJ 2CQXA 3BTJA 4V2GA 1JTXA 3GTGJ 3CMYA 1VF9A 3A03A 2VPRA 3S1NJ 1MNMC 2O8KA 4DZPA 4XIDA 2K9NA 1MBGA 4M3GA 5IYBJ 3UKGA 1LE8A 4IEJA 3MVPA 4DYRA 3DEWA 5IOYA 1BA5A 2NVXJ 3Q0WA 4DZJA 3FK7A 4A3EJ 5FKKA 2DMNA 1A5JA 1MH4A 4JX6A 2HXIA 1IGNA 2K40A 3BTLA 2O7OA 3Q0UA 2IAIA 1RETA 1XG1A 4A3IJ 2JA7J 2JWTA 4A3JJ 4M3DA 1I6HJ 3HKZN 2HOSA 2VKEA 1QVUA 2LP0A 1FIPA 1IDYA 3NAUA 1B72B 2ZB9A 5EDNA 4FCYA 4JP0A 3QPLA 2XPUA 1PUFB 1MSEC 2DA1A 2DTZA 1YRNB 1DU6A 3RQIA 2LD5A 3JRIA 2AHQA 2ME6A 5IOZA 3OSFA 2CJJA 5K7HA 3G1MA 2IEKA 2X6OA 3M4OJ 5GP9A 2ID3A 2N8GA 2DA5A 3HGGA 2DA4A 3ZQGA 5IP9J 1RKWA 1H8AC 4QIWN 4XICA 1IV6A 1Y1VJ 4QSHA 2IBDA 5C4JJ 2DA2A 2JA5J 4A3KJ 1QRYA 2NOGA 1K83J 1TWAJ 3Q0VA 1JTYA 1T33A 2DMTA 4AC0A 1FIAA 2ECCA 1LE8B 1UG2A 1BW6A 1NTCA 2LLKA 2JJ7A 2CRGA 3G1LA 1HDDC 2KT0A 1JUMA 2JMWA 5K7ZA 1NK3P 2FJ1A 2E2HJ 3BQZA 2XSDC 3H3VK 1JT0A 5F1JA 2K9SA 4IHWA 2YUSA 2XGCA 1TWGJ 1ZQ3P 4D5CA 5EYRA 3BR6A 2DA7A 5EF6A 4A3LJ 2RAEA 4JYKA 4DYQA 3HEFA 3JRCA 2X48A 3BR5A 2XGDA 5M3FJ 3JRHA 5E3LA 1Z0XA 2WAQN 3IH2A 2R5ZA 2GM4A 1OFCX 5GPAA 1XS9A 3CQZJ 5FKLA 4IHXA 2P81A 2K9QA 5EGOA 1K61A 1JJ8C 2NS7A 5C4XJ 3RZDJ 2ECBA 5IP6A 2MSYA 2LR8A 3O8GA 2LVSA 1XC5A 5FKOA 2B63J 2TRTA 4B4CA 3M3YJ 3IH4A 2HI3A 1MSFC 3HOUJ 1I50J 1JGGA 3HBLA 3QPSA 4S0HB 1APLC 3S17J 4D7MA 3A01A 2Y31A 1B8IB 1IG7A 4A69C 1RPWA 3JREA 1GV5A 2WB1N 4JX4A 2LFBA 5M5XJ 3CDLA 2DMUA 5EG0A 1ZGWA 1ZTRA 5K7FA 4MO7A 4X1EA 4I6ZA 4A3MJ 4BY1J 3HOVJ 1U9NA 1IUFA 4AYBN 3K2AA 4D7NA 3B6AA 5F08A 2E2JJ 1WPKA 4XRSA 4IHYA 2YU9J 2MGQA 2LK2A 3QQAA 2M34A 3O8HA 3HOYJ 4L5EA 2X9DA 4C2MJ 4LOCA 2YS9A 4MLOA 4IHVA 2HYJA 4V2FA 1TWCJ 1D5YA 3BTCA 4XRSG 2H8RA 5FKMA 3MN2A 2NVYJ 3SFIA 2CQQA 4DYCA 2H1KA 1W0TA 3FIWA 2JN6A 1JUPA 1WH5A 2GBYA 2R5YA 5EZGA 5IPAA 2EZLA 2M9HA 1OCTC 3OIOA 1W0UA 5E3MA 1IDZA 1Q1VA 1IRZA 1P7JA 5F0HA 1ETVA 2DMQA 5F0CA 1DU0A 2Y9YA 4B1RA 1GT0C 3GTOJ 3OOUA 1GUUA 3JRDA 1ETWA 3SJMA 4M3FA 3HB9A 3TEDA 3TW6A 2HQ5A 5M5YJ 4M3EA 1ETKA 3S1RJ 1WH7A 4AUXA 1JKOC 5IYCJ 3RKQA 4EEFG 1GV2A 1HF0A 2R92J 3PO2J 3JR9A 3GTKJ 1G2HA 1ETXA 4C3JJ 3PM1A 4Y52J 5BNGA 1Z77A 4CYCA 4UUSA 3FISA 1AHDP 4B3AA 2NVTJ 3HOXJ 9ANTA 1F36A 2EZKA 2FD5A 3LSGA 1BJZA 4UUTA 1X2NA 4RBOA 3GBGA 1JJ6C 1HLVA 3C2BA 5J3LA 1OCPA 5FLMJ 1LFBA 1BW5A 2ELKA 1IJWC 4RDUA 3BG9A 1FJLA 1F43A 3HOWJ 4G12A 2O9LA 2OF7A 1ETYA 1GVDA 3K7AJ 2L7ZA 2LY9A 2XB0X 2HOAA 1JUSA 5GPCA 3GTMJ 1FEXA 4X6AJ 1WI3A 2GLOA 2NVQJ 1VI0A 1POGA 2EH3A 3BQYA 1GDTA 1TWFJ 4MFEA 2CUEA 2LTPA 3NARA 3JRFA 3S15J 2WV1A 3I4NJ 1U8BA 1UHSA 2VUMJ 1U9OA 4FE4A 4GFBA 4BBRJ 1ORKA 4D5FA 5EEAA 4XRMA 2XRLA 2XB5A 1WGXA 3GTLJ 2L0KA 5JLWA 2EQRA 1B72A 3W6VA 3ZQLA 3IV5A 2CUFA 3SDGA 1MBKA 3LSRA 1RR7A 1PUFA 2DA6A 5IYDJ 3MKLA 2W48A 3ZQFA 2EBIA 1IC8A 2HDDA 4J19A 3JRAA 4BKXA 1MBFA 1MBHA 3BTIA 1S7EA 2EZHA 3F0CA 1P7IA 2OPTA 3TW7A 5DS9A 3CCYA 3A02A 4M3BA 1O4XA 2E2IJ 1UMQA 4Y7NJ 1U78A 1EF4A 1VNDA 3TP3A 1AKHA 1R9TJ 3BR3A 3Q3SA 4HNVA 1QVTA 3BT9A 2MW8A 3BR2A 2R5ZB 1H89C 3WHCA 3WHBA 5C3EJ 3LSPA 4A3CJ 4FTHA 1MBJA 1H88C 3LOCA 4W1UA 2R93J 5EGOB 4I76A 2DJNA 5FJ8J 1X2MA 5F04A 2VI6A 3I4MJ 1JT6A 3BG5A 4A93J 2JK3A 2L7FP 1ZKGA 2AO9A 2FX0A 2Y9ZA 2Y2ZA 2ME0A 2JA8J 2VKVA 1A6IA 2L9RA 3D1NI 5J1UA 4MFDA 2QCOA 2MG4A 5F0FA 4BXXJ 3A01B 1MH3A 3DCFA 3ZQHA 3JRGA 5E3OA 4FE7A 4C3HJ 1AU7A 1HCRA 1FTTA 5J1RA 5E3NA 5EG0B 2XGEA 3GTPJ 3BR1A 3HM5A 2D5VA 3HGYA 4NDLA 5M5WJ 1JKPC 1NK2P 1HOMA 4M6VA 5J1YA 1ZR2A 3BG3A 1FTZA 3S2HJ 1E3OC 2I10A 3LNQA 4W97A 3FKIJ 2KDZA 1T56A 5HODA 4MIMA 4DW6A 1CQTA 2TCTA 2M8GX 5F27A 3S14J 3GTJJ 2Y0SN 3RZOJ 4A3BJ 2XPVA 5EZHA 2ID6A 2L7MP 4QTRA 1AKHB 3GTQJ 4C3IJ 5DTDA 2COBA 1SFOJ 1LFUP 2R7ZJ 1ETOA 1B8IA 3LSJA 2QF7A 4A3GJ 3TP0A 3ZOBA 1ETQA 3JRBA 1TC3C 2Y30A 4FISA 4A3FJ 3S2DJ 1ITYA 3BR0A 1X58A 2R5YB 4JX5A 1TWHJ 2PMZN 3FK6A 3S1MJ 2FQ4A 1QPIA 5FKNA 2EZIA 2NS8A 5IP7J 1I3QJ 1VFCA 2M0CA 5FLVA 4BBSJ 4ABZA 2JA6J 5C44J 3PO3J 3G1OA 3S16J 1MBEA 1HDPA 2HOTA 3HDDA 1WCMJ 3S1QJ 3OSGA 3E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH3 A;  2DMP A;  3VPR A;  1ENH A;  3ZQI A;  4XK4 A;  2R0Q C;  2XPW A;  1BL0 A;  4A3D J;  2E1O A;  1OJL A;  2LKX A;  2DA3 A;  2CU7 A;  1RES A;  2HXO A;  3B6C A;  3ZQC A;  3HOZ J;  1ZR4 A;  1ZK8 A;  2E19 A;  1RKT A;  2M2E A;  5JLX A;  2DN0 A;  1YRN A;  1JKR C;  4CYC B;  4UUS B;  2G0E A;  3H0G J;  1JKQ C;  4BY7 J;  1Y1W J;  1SAN A;  3L1P A;  5M3M J;  2CQX A;  3BTJ A;  4V2G A;  1JTX A;  3GTG J;  3CMY A;  1VF9 A;  3A03 A;  2VPR A;  3S1N J;  1MNM C;  2O8K A;  4DZP A;  4XID A;  2K9N A;  1MBG A;  4M3G A;  5IYB J;  3UKG A;  1LE8 A;  4IEJ A;  3MVP A;  4DYR A;  3DEW A;  5IOY A;  1BA5 A;  2NVX J;  3Q0W A;  4DZJ A;  3FK7 A;  4A3E J;  5FKK A;  2DMN A;  1A5J A;  1MH4 A;  4JX6 A;  2HXI A;  1IGN A;  2K40 A;  3BTL A;  2O7O A;  3Q0U A;  2IAI A;  1RET A;  1XG1 A;  4A3I J;  2JA7 J;  2JWT A;  4A3J J;  4M3D A;  1I6H J;  3HKZ N;  2HOS A;  2VKE A;  1QVU A;  2LP0 A;  1FIP A;  1IDY A;  3NAU A;  1B72 B;  2ZB9 A;  5EDN A;  4FCY A;  4JP0 A;  3QPL A;  2XPU A;  1PUF B;  1MSE C;  2DA1 A;  2DTZ A;  1YRN B;  1DU6 A;  3RQI A;  2LD5 A;  3JRI A;  2AHQ A;  2ME6 A;  5IOZ A;  3OSF A;  2CJJ A;  5K7H A;  3G1M A;  2IEK A;  2X6O A;  3M4O J;  5GP9 A;  2ID3 A;  2N8G A;  2DA5 A;  3HGG A;  2DA4 A;  3ZQG A;  5IP9 J;  1RKW A;  1H8A C;  4QIW N;  4XIC A;  1IV6 A;  1Y1V J;  4QSH A;  2IBD A;  5C4J J;  2DA2 A;  2JA5 J;  4A3K J;  1QRY A;  2NOG A;  1K83 J;  1TWA J;  3Q0V A;  1JTY A;  1T33 A;  2DMT A;  4AC0 A;  1FIA A;  2ECC A;  1LE8 B;  1UG2 A;  1BW6 A;  1NTC A;  2LLK A;  2JJ7 A;  2CRG A;  3G1L A;  1HDD C;  2KT0 A;  1JUM A;  2JMW A;  5K7Z A;  1NK3 P;  2FJ1 A;  2E2H J;  3BQZ A;  2XSD C;  3H3V K;  1JT0 A;  5F1J A;  2K9S A;  4IHW A;  2YUS A;  2XGC A;  1TWG J;  1ZQ3 P;  4D5C A;  5EYR A;  3BR6 A;  2DA7 A;  5EF6 A;  4A3L J;  2RAE A;  4JYK A;  4DYQ A;  3HEF A;  3JRC A;  2X48 A;  3BR5 A;  2XGD A;  5M3F J;  3JRH A;  5E3L A;  1Z0X A;  2WAQ N;  3IH2 A;  2R5Z A;  2GM4 A;  1OFC X;  5GPA A;  1XS9 A;  3CQZ J;  5FKL A;  4IHX A;  2P81 A;  2K9Q A;  5EGO A;  1K61 A;  1JJ8 C;  2NS7 A;  5C4X J;  3RZD J;  2ECB A;  5IP6 A;  2MSY A;  2LR8 A;  3O8G A;  2LVS A;  1XC5 A;  5FKO A;  2B63 J;  2TRT A;  4B4C A;  3M3Y J;  3IH4 A;  2HI3 A;  1MSF C;  3HOU J;  1I50 J;  1JGG A;  3HBL A;  3QPS A;  4S0H B;  1APL C;  3S17 J;  4D7M A;  3A01 A;  2Y31 A;  1B8I B;  1IG7 A;  4A69 C;  1RPW A;  3JRE A;  1GV5 A;  2WB1 N;  4JX4 A;  2LFB A;  5M5X J;  3CDL A;  2DMU A;  5EG0 A;  1ZGW A;  1ZTR A;  5K7F A;  4MO7 A;  4X1E A;  4I6Z A;  4A3M J;  4BY1 J;  3HOV J;  1U9N A;  1IUF A;  4AYB N;  3K2A A;  4D7N A;  3B6A A;  5F08 A;  2E2J J;  1WPK A;  4XRS A;  4IHY A;  2YU9 J;  2MGQ A;  2LK2 A;  3QQA A;  2M34 A;  3O8H A;  3HOY J;  4L5E A;  2X9D A;  4C2M J;  4LOC A;  2YS9 A;  4MLO A;  4IHV A;  2HYJ A;  4V2F A;  1TWC J;  1D5Y A;  3BTC A;  4XRS G;  2H8R A;  5FKM A;  3MN2 A;  2NVY J;  3SFI A;  2CQQ A;  4DYC A;  2H1K A;  1W0T A;  3FIW A;  2JN6 A;  1JUP A;  1WH5 A;  2GBY A;  2R5Y A;  5EZG A;  5IPA A;  2EZL A;  2M9H A;  1OCT C;  3OIO A;  1W0U A;  5E3M A;  1IDZ A;  1Q1V A;  1IRZ A;  1P7J A;  5F0H A;  1ETV A;  2DMQ A;  5F0C A;  1DU0 A;  2Y9Y A;  4B1R A;  1GT0 C;  3GTO J;  3OOU A;  1GUU A;  3JRD A;  1ETW A;  3SJM A;  4M3F A;  3HB9 A;  3TED A;  3TW6 A;  2HQ5 A;  5M5Y J;  4M3E A;  1ETK A;  3S1R J;  1WH7 A;  4AUX A;  1JKO C;  5IYC J;  3RKQ A;  4EEF G;  1GV2 A;  1HF0 A;  2R92 J;  3PO2 J;  3JR9 A;  3GTK J;  1G2H A;  1ETX A;  4C3J J;  3PM1 A;  4Y52 J;  5BNG A;  1Z77 A;  4CYC A;  4UUS A;  3FIS A;  1AHD P;  4B3A A;  2NVT J;  3HOX J;  9ANT A;  1F36 A;  2EZK A;  2FD5 A;  3LSG A;  1BJZ A;  4UUT A;  1X2N A;  4RBO A;  3GBG A;  1JJ6 C;  1HLV A;  3C2B A;  5J3L A;  1OCP A;  5FLM J;  1LFB A;  1BW5 A;  2ELK A;  1IJW C;  4RDU A;  3BG9 A;  1FJL A;  1F43 A;  3HOW J;  4G12 A;  2O9L A;  2OF7 A;  1ETY A;  1GVD A;  3K7A J;  2L7Z A;  2LY9 A;  2XB0 X;  2HOA A;  1JUS A;  5GPC A;  3GTM J;  1FEX A;  4X6A J;  1WI3 A;  2GLO A;  2NVQ J;  1VI0 A;  1POG A;  2EH3 A;  3BQY A;  1GDT A;  1TWF J;  4MFE A;  2CUE A;  2LTP A;  3NAR A;  3JRF A;  3S15 J;  2WV1 A;  3I4N J;  1U8B A;  1UHS A;  2VUM J;  1U9O A;  4FE4 A;  4GFB A;  4BBR J;  1ORK A;  4D5F A;  5EEA A;  4XRM A;  2XRL A;  2XB5 A;  1WGX A;  3GTL J;  2L0K A;  5JLW A;  2EQR A;  1B72 A;  3W6V A;  3ZQL A;  3IV5 A;  2CUF A;  3SDG A;  1MBK A;  3LSR A;  1RR7 A;  1PUF A;  2DA6 A;  5IYD J;  3MKL A;  2W48 A;  3ZQF A;  2EBI A;  1IC8 A;  2HDD A;  4J19 A;  3JRA A;  4BKX A;  1MBF A;  1MBH A;  3BTI A;  1S7E A;  2EZH A;  3F0C A;  1P7I A;  2OPT A;  3TW7 A;  5DS9 A;  3CCY A;  3A02 A;  4M3B A;  1O4X A;  2E2I J;  1UMQ A;  4Y7N J;  1U78 A;  1EF4 A;  1VND A;  3TP3 A;  1AKH A;  1R9T J;  3BR3 A;  3Q3S A;  4HNV A;  1QVT A;  3BT9 A;  2MW8 A;  3BR2 A;  2R5Z B;  1H89 C;  3WHC A;  3WHB A;  5C3E J;  3LSP A;  4A3C J;  4FTH A;  1MBJ A;  1H88 C;  3LOC A;  4W1U A;  2R93 J;  5EGO B;  4I76 A;  2DJN A;  5FJ8 J;  1X2M A;  5F04 A;  2VI6 A;  3I4M J;  1JT6 A;  3BG5 A;  4A93 J;  2JK3 A;  2L7F P;  1ZKG A;  2AO9 A;  2FX0 A;  2Y9Z A;  2Y2Z A;  2ME0 A;  2JA8 J;  2VKV A;  1A6I A;  2L9R A;  3D1N I;  5J1U A;  4MFD A;  2QCO A;  2MG4 A;  5F0F A;  4BXX J;  3A01 B;  1MH3 A;  3DCF A;  3ZQH A;  3JRG A;  5E3O A;  4FE7 A;  4C3H J;  1AU7 A;  1HCR A;  1FTT A;  5J1R A;  5E3N A;  5EG0 B;  2XGE A;  3GTP J;  3BR1 A;  3HM5 A;  2D5V A;  3HGY A;  4NDL A;  5M5W J;  1JKP C;  1NK2 P;  1HOM A;  4M6V A;  5J1Y A;  1ZR2 A;  3BG3 A;  1FTZ A;  3S2H J;  1E3O C;  2I10 A;  3LNQ A;  4W97 A;  3FKI J;  2KDZ A;  1T56 A;  5HOD A;  4MIM A;  4DW6 A;  1CQT A;  2TCT A;  2M8G X;  5F27 A;  3S14 J;  3GTJ J;  2Y0S N;  3RZO J;  4A3B J;  2XPV A;  5EZH A;  2ID6 A;  2L7M P;  4QTR A;  1AKH B;  3GTQ J;  4C3I J;  5DTD A;  2COB A;  1SFO J;  1LFU P;  2R7Z J;  1ETO A;  1B8I A;  3LSJ A;  2QF7 A;  4A3G J;  3TP0 A;  3ZOB A;  1ETQ A;  3JRB A;  1TC3 C;  2Y30 A;  4FIS A;  4A3F J;  3S2D J;  1ITY A;  3BR0 A;  1X58 A;  2R5Y B;  4JX5 A;  1TWH J;  2PMZ N;  3FK6 A;  3S1M J;  2FQ4 A;  1QPI A;  5FKN A;  2EZI A;  2NS8 A;  5IP7 J;  1I3Q J;  1VFC A;  2M0C A;  5FLV A;  4BBS J;  4ABZ A;  2JA6 J;  5C44 J;  3PO3 J;  3G1O A;  3S16 J;  1MBE A;  1HDP A;  2HOT A;  3HDD A;  1WCM J;  3S1Q J;  3OSG A;  3E7L A; 
#chains in the Genus database with same CATH topology
 3ZQI A;  4E4H A;  2MD0 A;  3DKW A;  2R0Q C;  1CF7 A;  4A3D J;  4E7K A;  3W2A A;  3FBI B;  2L7K A;  2LKX A;  4EJT A;  4CZZ A;  4L5I A;  3FX3 A;  4CA0 A;  3OS0 A;  2JTV A;  3IAM 2;  2E19 A;  2JUG A;  4XON A;  2XAJ A;  2G0E A;  3WE3 A;  2KJB A;  4UUS B;  3GLL A;  1JKQ C;  1YG2 A;  1VQ5 I;  1FMV A;  2CQX A;  4I02 A;  3D5L A;  4NC8 A;  2EA2 A;  1QU3 A;  3CMY A;  4M6X A;  3JSP A;  1X3W B;  4RMN A;  3QYF A;  3K9T A;  1I3A A;  3KCC A;  3BLY A;  4M6Y A;  1L3L A;  3TBI A;  2O8K A;  4PSX A;  5DD8 A;  2WBM A;  4MQ9 F;  1QZZ A;  1HQC A;  3ZQ7 A;  4R8H A;  2L4M A;  4PCQ A;  3K4C A;  5J4Y A;  1VQ8 I;  4IEJ A;  3MVP A;  1R4N B;  1W7P A;  5IOY A;  2FOK A;  3AG4 H;  3BJO A;  4DZJ A;  2CQK A;  1QBJ A;  5FFX A;  3BOQ A;  3CJN A;  1TQI A;  3GXO A;  2E34 A;  2ZSH B;  4XOP A;  4U87 A;  2DMN A;  1G3S A;  2LMD A;  1RC9 A;  2EFW A;  1U5T B;  4ESF A;  2F4I A;  2DXI A;  2H8W A;  1XG1 A;  2K4J A;  2XV4 S;  4A3J J;  3HKZ N;  2M8E A;  4DQ2 A;  3T5X A;  2VBX A;  3WGH A;  1FIP A;  3QWL A;  1IDY A;  3QYB A;  4NNJ A;  4IRI A;  4OIQ F;  4FCY A;  1PUF B;  5L3F A;  2DA1 A;  1DUX C;  1DU6 A;  3SZT A;  4Q48 A;  3RQI A;  5ICE A;  4PFP A;  2ME6 A;  4MGR A;  5D5U B;  1YW8 A;  4YFK F;  3G1M A;  2X6O A;  3AG1 H;  3M4O J;  3CDH A;  3ZQG A;  2DA4 A;  2W57 A;  4LIT A;  2ISZ A;  4XIC A;  3L7W A;  1IV6 A;  1Y1V J;  2KHM A;  4QSH A;  2DA2 A;  2OCE A;  1IRF A;  1QRY A;  3DEE A;  1YIO A;  2K85 A;  5LGU A;  3ONQ A;  2PFB A;  1LE8 B;  2DMT A;  2FE3 A;  4P96 A;  1S6L A;  1BW6 A;  4F93 B;  1NTC A;  1HKS A;  3N05 A;  2R3S A;  3CCV I;  5GAG J;  2JJ7 A;  3G1L A;  4AID A;  3IRQ A;  2EFQ A;  3E6M A;  3K6G A;  3BZK A;  3M07 A;  3QYE A;  2HS5 A;  3C7J A;  1HDD C;  1E17 A;  3CUO A;  2XF7 A;  1JUM A;  2GOM A;  4L0Y B;  2JMW A;  4HLY A;  4L5J A;  2P8T A;  1PUE E;  2E1M C;  3BQZ A;  3ZN0 A;  2K9S A;  4IHW A;  1TNS A;  2XGC A;  3F6O A;  1KYW A;  4RM3 A;  3L2W A;  2Z3Y A;  2LRE A;  3U1K A;  1IXC A;  1ZLJ A;  2VJJ A;  1VQK I;  2COM A;  2X48 A;  3BR5 A;  5GTI C;  1K7A A;  4E7Z A;  3JSO A;  4ZH4 F;  5M3F J;  5E3L A;  4RAF A;  1OFC X;  3H0D A;  5KNL A;  4KIG A;  1FYL A;  3CQZ J;  5FKL A;  4IHX A;  2P81 A;  1K61 A;  3FZV A;  3V8K A;  1ZG5 A;  3BG6 A;  2A68 F;  1LVK A;  3LA7 A;  5IP6 A;  2MSY A;  2LR8 A;  3O8G A;  3W6J B;  1XC5 A;  3GZ5 A;  1T39 A;  4PJ0 C;  5FKO A;  4FET A;  1BI3 A;  4XLE A;  2ZME A;  2H6C A;  3IH4 A;  2M3A A;  4XLH A;  1BR2 A;  1MNE A;  4ENM A;  3HBL A;  3QPS A;  3NEU A;  3F8B A;  5DCF A;  3M8E A;  4RGS A;  2RNJ A;  1X3Z B;  2J5P A;  3ASO H;  2PQ8 A;  2LKP A;  1HW2 A;  4CDG A;  2RQQ A;  4OU0 A;  2QSG X;  3OYL A;  2KZV A;  2B0L A;  3F3X A;  2DPU A;  2R7V A;  5DCM B;  3FMR A;  2LY2 A;  4Y4R A;  4MO7 A;  1TW2 A;  4UHT A;  2EIN H;  2X6W A;  4G7H F;  2QQA A;  2GWR A;  4BY1 J;  3F8C A;  3K2A A;  3I4P A;  2LKS A;  1LPQ A;  1WPK A;  1LNW A;  3HSF A;  3QQA A;  1G6N A;  2FEZ A;  4L5E A;  4XL9 A;  1O7F A;  3N97 A;  2IXS A;  4LIV A;  1CF7 B;  3CUQ C;  1FSE A;  1OMI A;  1WKM A;  3P5J A;  4V2F A;  1TWC J;  1T98 A;  2DW4 A;  4XKC A;  1D5Y A;  5FKM A;  2FRH A;  2HDC A;  3PNT A;  3CC2 I;  3MN2 A;  2NVY J;  3CO6 C;  2DLL A;  1MDM A;  5E79 C;  2KRF A;  4LIU A;  4XLC A;  4L0Z B;  4IJA A;  4LG3 A;  3FHZ A;  2R5Y A;  2XRN A;  3B02 A;  3DP7 A;  3IP4 B;  2EV6 A;  2QBY A;  1V55 H;  3CP8 A;  5J4V A;  3ZMT A;  2FML A;  1Q1V A;  2MC3 A;  5F0C A;  1DU0 A;  2Y9Y A;  5LD2 C;  5DDG A;  1XDU A;  4WX9 A;  5D8L B;  1XB4 A;  2ZJQ F;  3SJM A;  3CO7 C;  3LQR A;  3WTV C;  5M5Y J;  4MEX F;  3KP5 A;  3MWM A;  5H6Q A;  1S8N A;  4P55 A;  1R4M B;  4KUM A;  1F9N A;  1W7P B;  1E2X A;  1ETX A;  2OZ6 A;  2X1E A;  4D9J A;  5CLS A;  5BNG A;  1UAA A;  2VLA A;  3FIS A;  5AIP A;  2NVT J;  3E3V A;  4F91 B;  5KCM A;  3LSG A;  2VXZ A;  4UUT A;  3KZZ A;  3CP2 A;  3CF2 A;  3DTK A;  1R5G A;  3GBG A;  2ZNZ A;  3C2B A;  1WSU A;  5J3L A;  1OCP A;  3OIQ A;  1IJW C;  2HNH A;  2CUJ A;  3BG9 A;  4PGH A;  1OYW A;  3OR1 C;  1XN7 A;  3W2V A;  1ETY A;  5GTH C;  2OAZ A;  4RB0 A;  1RUN A;  4UVA A;  1R7J A;  2LY9 A;  2OD5 A;  2XB0 X;  2H09 A;  2M4G A;  2HQA A;  5IT9 K;  1JUS A;  2EIL H;  2FBI A;  3QAH A;  4KIB A;  2CW0 F;  1D0Y A;  1K6Y A;  1D8J A;  2BY0 A;  5B66 C;  2L3D A;  3MCZ A;  3ABU A;  5FB2 A;  1R58 A;  3FXK A;  2F48 A;  4HV5 A;  1AWC A;  4HBL A;  3F8M A;  2M0M A;  1SAU A;  4Y17 A;  4JBA A;  2X85 A;  1VQM I;  4ITV A;  2CQ7 A;  1U9O A;  4ANJ A;  2EK5 A;  2Y0S A;  2QZ8 A;  2MLK A;  4BBR J;  2VBY A;  5EEA A;  3EUH C;  1J59 A;  2H1L A;  1R49 A;  1GXP A;  5FRN A;  3WU2 C;  1IN8 A;  2ESN A;  2KP6 A;  2FNP A;  3LSR A;  4C30 A;  2QLZ A;  2A6T A;  2RVC A;  3J7Y J;  2DBB A;  2DOF A;  1I6X A;  1VTN C;  2K9L A;  2JUC A;  3ZQF A;  2ZJR F;  2QKL B;  2CW7 A;  1U8R A;  2HVS A;  2X4H A;  4BKX A;  1MBF A;  1MBH A;  3BTI A;  1X1B A;  1S7E A;  2EZH A;  1P7I A;  1KU7 A;  1IN6 A;  3TW7 A;  1R6R A;  3KP4 A;  4M3B A;  5GAD J;  4ZYA A;  3LQQ A;  5HLG A;  4II2 A;  3IAS 2;  1D8K A;  2E2I J;  1EF4 A;  2F5D A;  3J81 K;  4GYG A;  3HL2 A;  1AKH A;  1QPM A;  1FBU A;  4HNV A;  3K2Z A;  3FMQ A;  4FHT A;  4B48 A;  3GZN B;  4ZDO A;  1DP7 P;  2RC4 A;  5ICF A;  3P7N A;  2X6X A;  4A3C J;  3CCS I;  1XTA A;  3CF5 F;  1LDD A;  4BQN A;  4HST A;  3VB2 A;  3ZN1 A;  2IGO A;  4ENN A;  4CCK A;  1DP3 A;  2FMY A;  2IS1 A;  2VI6 A;  4FX4 A;  3AG2 H;  1JT6 A;  3L00 A;  4UB8 C;  2L7F P;  5JVT A;  3K1M A;  3GFM A;  2PG4 A;  2FX0 A;  1YFH A;  3BG7 A;  2ZME B;  3WOD F;  1A6I A;  2EV5 A;  3S32 A;  1YIT I;  1MJB A;  3D1N I;  3CCL I;  4EJU A;  1TL8 A;  5F0F A;  5E8I A;  4IPA A;  4BXX J;  4EAT A;  4G6D A;  1W36 C;  4KFC A;  1FC3 A;  3DCF A;  4KNY A;  4C3H J;  2FSW A;  2MBF A;  5D4R A;  2HDW A;  3HXL A;  1VQ7 I;  3KLO A;  5TGT A;  1QA6 A;  4XLP F;  2ZNY A;  1JKP C;  1ON1 A;  3DXJ F;  2Z5U A;  1ZR2 A;  5BQT A;  1D5V A;  1FTZ A;  3S2H J;  2ACJ A;  2ELJ A;  4BS9 A;  1E3O C;  3PQK A;  4DBQ A;  3SXY A;  4MIM A;  2TCT A;  3RZO J;  2LH9 A;  3H3Z A;  3K70 D;  2H94 A;  4B47 A;  3GTQ J;  2Y48 A;  1HW1 A;  2VQG A;  2HVR A;  1I1G A;  5HDN A;  2ISY A;  2YPR A;  1O7L A;  2NYX A;  3OR2 C;  5J8F A;  1S7O A;  2DCE A;  2EB7 A;  3OYG A;  4I01 A;  2BY2 A;  1ZEL A;  1ETQ A;  2Z16 A;  3K4J A;  1O3Q A;  1BR4 A;  2WC2 A;  3K4B A;  3LAP A;  1MDM B;  1ITY A;  3S2D J;  4IQ4 A;  2D1V A;  2R5Y B;  2DTR A;  2XAG A;  2MH9 A;  2QBY B;  3ZMU A;  3E1S A;  3S1M J;  1QPI A;  4OMZ A;  1SD4 A;  2EZI A;  3UNG C;  2EWN A;  1VFC A;  1SMT A;  1WZ2 A;  2DFE A;  3A0H C;  4BBS J;  4HDV A;  5C44 J;  1HC8 A;  3PL8 A;  2XF5 A;  2FNA A;  2B9S A;  3RPQ A;  3V8L A;  4BDY A;  4FQG A;  5CJ9 A;  5B1B H;  1LEA A;  3J7Z I;  4B8X A;  5HDG A;  4XN3 A;  2FBH A;  4Q5S F;  3DBR B;  1XPX A;  2CU7 A;  1RES A;  2RN7 A;  3EYY A;  1HA8 A;  1XSX A;  3HOZ J;  2W25 A;  4UUV A;  2DN0 A;  2AQF A;  4BY7 J;  3S8P A;  1MJ9 A;  2P6S A;  2Y75 A;  1U2W A;  3MKY B;  3BTJ A;  4V2G A;  1JTX A;  2ZSI B;  5CQG A;  3PQJ A;  3C2H A;  2YX7 A;  3CC7 I;  3OYF A;  3I64 A;  1VF9 A;  4RAZ A;  1P92 A;  2VKH A;  3HOT A;  3BCB A;  2BV6 A;  4PZJ A;  1MNM C;  3HRU A;  3QRF F;  3TGN A;  2AXL A;  2JPB A;  3IKV A;  4HRI A;  1OQY A;  2K9N A;  2WV0 A;  4M3G A;  1Z3Y A;  2O03 A;  2ZO4 A;  3M8F A;  4NC7 A;  4HDU A;  1MMN A;  5IYB J;  1UCR A;  2DU9 A;  3MZ8 A;  1ZRF A;  5F1R A;  1LE8 A;  1PP7 U;  1IN7 A;  2L01 A;  2P5K A;  4DYR A;  4IKF A;  2IGM A;  1YW7 A;  2CYY A;  2NVX J;  1IXS B;  2CH0 A;  3LST A;  2RDP A;  2EPF A;  1KZH A;  3OYM A;  5K5O A;  4O5V A;  2MYS A;  5FKK A;  3CME I;  4GRI A;  5H6R A;  3UR3 C;  4DOZ A;  2LOO A;  4KMF A;  3HPH A;  1VQN I;  2DFF A;  3GFJ A;  4PGG A;  2IAI A;  1RET A;  3TO7 A;  4A3I J;  2JWT A;  2CW8 A;  2HOS A;  4HF1 A;  2E36 A;  4RGX A;  1S72 I;  3F8F A;  2YU3 A;  5FLX K;  3NAU A;  2VQC A;  3G4S I;  2LBF B;  4JP0 A;  1A35 A;  2XPU A;  2G9W A;  5L3G A;  2ZJP F;  4ON0 A;  1QHG A;  2DT5 A;  2ZXJ A;  2XUB A;  1MZB A;  4IOA F;  1MJA A;  1TT5 B;  4BQQ A;  4I98 B;  5L3B A;  2CV1 A;  5B5E C;  3KEO A;  1XCB A;  1FNN A;  3FXQ A;  2ID3 A;  2DA5 A;  4ZTJ A;  5IP9 J;  3GCM A;  2P4W A;  4QIW N;  3SDB A;  2IBD A;  1MMS A;  4KMU X;  3OYN A;  3MFK A;  3VSL A;  1K83 J;  1QHH D;  3Q0V A;  2HTS A;  2IVM A;  2KL4 A;  2R4G A;  4XN0 A;  4UY8 I;  3CUQ A;  1R1U A;  4PJN A;  1FIA A;  1FWZ A;  3TOB A;  2KRC A;  3E6B A;  4AC0 A;  2QQB A;  4P9U A;  3H5A A;  5DD4 A;  5FRM A;  2E5N A;  1WJC A;  1R23 A;  3RJP A;  3HRS A;  1YIJ I;  2IT0 A;  3LA2 A;  1LVA A;  3P9I A;  1SFK A;  1BIA A;  2Q2E B;  2FJ1 A;  2E2H J;  2D2W A;  4XMY A;  4BAY A;  5BMZ A;  2HPM A;  1IV8 A;  3ELK A;  1NHA A;  4D5C A;  2XIG A;  3CJQ B;  3BR6 A;  1V3F A;  4HQM A;  4JYK A;  5FD6 A;  4EV0 A;  4BHC A;  2QSF X;  4CSW A;  3KYL A;  1Z0X A;  2WAQ N;  3KP2 A;  3VSK A;  2Z9O A;  5EEG A;  2F5E A;  5ILS A;  3BZ6 A;  3OYJ A;  2G7U A;  3FWE A;  2Q0O A;  2K9Q A;  5EGO A;  5J8C A;  1HXD A;  1KYZ A;  4ENJ A;  3AAF A;  5EEH A;  2NS7 A;  2R7T A;  5C4X J;  2OA4 A;  1YE9 A;  3CC4 I;  2A6E F;  4UVB A;  1LJ9 A;  1BOA A;  1VQP I;  4I09 A;  3KX2 A;  2EFP A;  1K4S A;  1MSF C;  1I50 J;  1JGG A;  4OIO F;  1APL C;  2V9K A;  4HNT A;  3VFZ A;  1FY7 A;  2IS2 A;  4D7M A;  3CMM A;  2NRA C;  1RUO A;  3FXR A;  4F7Z A;  2CFO A;  3JRE A;  1GV5 A;  3GX4 X;  4JX4 A;  4MQV A;  3RYR A;  4BH9 A;  2UZK A;  3F6V A;  1D0Z A;  2XSJ C;  1XGO A;  1B59 A;  3H9Q A;  4I6Z A;  4HX4 A;  2WAQ A;  1G4D A;  3H36 A;  3KZY A;  2OZU A;  2KFD A;  2DAO A;  2CO5 A;  1FP2 A;  5HLH A;  1IUF A;  4L9V A;  5CVR A;  3GZ6 A;  3B6A A;  3T8R A;  2K9M A;  4IHY A;  1IO2 A;  2M4K A;  1M1E B;  1JHF A;  5TJJ A;  2MLG A;  1J09 A;  3CCE I;  2V26 A;  4CXF A;  3PNV A;  4L9T A;  2YX4 A;  1FYK A;  2MH2 A;  2GIV A;  4U0Y A;  3EUH A;  1W7P D;  4C2T A;  1YLF A;  3BTC A;  2BW3 B;  1WWX A;  4J00 A;  4ENK A;  3SFI A;  2CQQ A;  4BQO A;  1X1D A;  3CJT B;  1W0T A;  3OYA A;  3FIW A;  1WH5 A;  4XLF A;  3CCU I;  4ZJZ A;  3SZP A;  5IPA A;  1YW9 A;  1AOY A;  2PI0 A;  4DNC A;  1OCT C;  2BEO A;  2VQL A;  3TO6 A;  5E3M A;  1P7J A;  2E1M B;  2I5U A;  3CJR B;  2OC6 A;  1B6A A;  1A04 A;  1R71 A;  3VYS B;  3AKZ A;  2F5F A;  3PFI A;  4BGD A;  2LC2 A;  2RGV A;  1VQO I;  1HKT A;  1ETK A;  3TMO A;  5E18 F;  4AD9 A;  3A0B C;  1MKM A;  1OCZ H;  1SEU A;  2V6C A;  1GV2 A;  2X0L A;  3OWT A;  3G6E I;  2GA2 A;  3JR9 A;  3E5X A;  3LA3 A;  3N4M A;  1G2H A;  4IQJ A;  1KU2 A;  3BP8 A;  1LB2 A;  3PM1 A;  2QEX I;  4NBQ A;  1XMX A;  2JRT A;  2KIS A;  3T1B A;  4CYC A;  1AHD P;  3MZY A;  4XQF A;  1KQ8 A;  4WXC A;  3PIO F;  1Y0U A;  2QUF A;  4HOB A;  5ILU A;  2R7X A;  1JJ6 C;  1UB9 A;  1R36 A;  5J6X A;  5FLM J;  2JSC A;  3HRM A;  4F3Q A;  4RDU A;  4RB3 C;  2IGK A;  3WGG A;  4U7D A;  2K7L A;  2K5C A;  2DQL A;  2HKO A;  1HKQ A;  4G12 A;  1FBS A;  1GVD A;  1QQI A;  4GYI A;  1W5S A;  1XGM A;  1J75 A;  4XOT A;  2UV1 A;  5GPC A;  3GTM J;  2W24 A;  2R7Q A;  2NOJ B;  1FEX A;  1V54 H;  4X6A J;  4U88 A;  2GLO A;  2NVQ J;  1VI0 A;  4AIJ A;  1H0M A;  3H35 A;  1BR1 A;  2EH3 A;  4CUG A;  3D5S C;  4B43 A;  2GXA A;  1WJD A;  3A2K A;  4MFE A;  2FU4 A;  3NAR A;  4OAY A;  1Z7U A;  3E5Q A;  3S15 J;  1KON A;  2VBZ A;  2VB6 A;  4IOC F;  4HX8 A;  2PN6 A;  2GZW A;  2Y69 H;  3Q5F A;  3NQO A;  1U8B A;  2XGX A;  1USS A;  3EET A;  5HS8 A;  2DK8 A;  1JE8 A;  4FE4 A;  3TQN A;  1LDJ A;  3PIP F;  2BOL A;  2P7V B;  2DYS H;  4PDK A;  3LSH A;  4D5F A;  5HDK A;  3JW4 A;  4CYD A;  2VL8 A;  2LF8 A;  2JPC A;  3CUQ B;  2XB5 A;  3U1D A;  1Z05 A;  2V9P A;  5DUK A;  3QP6 A;  1B72 A;  2UXX A;  3W6V A;  3IV5 A;  2KZG A;  3MD2 A;  2E5Z A;  3BZC A;  3SDG A;  4KN7 X;  1AA7 A;  1OCR H;  3KEY A;  3MKL A;  4HF2 A;  5AIQ A;  1RRJ A;  2EBI A;  1IC8 A;  2BBY A;  4HSR A;  2G7H A;  4B44 A;  3SFZ A;  1MND A;  2IPQ X;  3F0C A;  2BGC A;  2L2O A;  1T6S A;  3HSE A;  1KQ9 A;  2XAS A;  4XSX F;  4YEL A;  2JVG A;  3G73 A;  1O4X A;  2KIQ A;  4GXO A;  1YS7 A;  3H9J A;  2XVC A;  1VND A;  3I58 A;  1TNT A;  1R9T J;  3BR3 A;  2QKM B;  3K4N A;  1QVT A;  1WJF A;  2DO7 A;  3S3O A;  3MAJ A;  5LLQ A;  5E17 F;  5LGT A;  3OYI A;  2JT1 A;  4BYY A;  5IT9 Z;  4OOI A;  4IF4 A;  4FTH A;  1MBJ A;  1TBX A;  1BIB A;  2M5W A;  1H88 C;  3GVA A;  3SEQ A;  4F92 B;  4N9H A;  4PUS A;  5EGO B;  4G6T B;  3VYT B;  1Z3X A;  1YJ9 I;  1XMK A;  3I4M J;  3ULQ B;  4Y13 A;  3S2W A;  2JZY A;  2AO9 A;  3DLL F;  2HOE A;  2Y2Z A;  2X51 A;  1BN5 A;  1TW3 A;  3TDZ C;  3VYU B;  1O3R A;  2Z2S B;  4MFD A;  4LLL A;  3LSK A;  3KP3 A;  3QPH A;  2NNY A;  1RR8 C;  3QU3 A;  1REP C;  4Y15 A;  3GME A;  2A5W A;  5E3O A;  4FE7 A;  5D6E A;  3W2W A;  1RI7 A;  3RIR A;  4IHT A;  3OYC A;  1FTT A;  2ZXI A;  2F5C A;  4E7J A;  4H0E A;  1PYV A;  3HM5 A;  4KJZ A;  2CGP A;  2D5V A;  2IA1 A;  3V7R A;  3CDI A;  3WE2 A;  1NK2 P;  3GLX A;  5J1Y A;  2DI3 A;  1NG6 A;  3A4C A;  3OV8 A;  4W97 A;  3FKI J;  3F72 A;  2KDZ A;  1T56 A;  2W4S A;  1STZ A;  1Y8R B;  4YG2 F;  2L9N A;  4DW6 A;  3J7A O;  3S14 J;  3ZMZ A;  2Y0S N;  1PP8 F;  3L2R A;  1VQL I;  4A3B J;  5EZH A;  2ID6 A;  1E3P A;  2L7M P;  3BWG A;  1WJA A;  4ZYD A;  1FYM A;  2L02 A;  3HZJ A;  3J81 Z;  5DTD A;  3O6B B;  3H9G A;  5ILV A;  2FA5 A;  1B8I A;  2K3P A;  1WQ2 A;  3TP0 A;  5K5R A;  3J80 K;  3ZMV A;  1VQ6 I;  3JRB A;  3L09 A;  4U0V A;  2V1U A;  1HST A;  1TC3 C;  4FIS A;  4A3F J;  3BR0 A;  1LKX A;  2D1H A;  2PMZ N;  1E0E A;  2ZCW A;  2XAF A;  3KIO A;  2MD5 A;  2NS8 A;  5IP7 J;  3M1E A;  1OPC A;  2O6G E;  5LEK A;  5FLV A;  4UXN A;  1DPR A;  3OY9 A;  3PO3 J;  3G1O A;  3IRR A;  5DM6 F;  1WCM J;  4AIK A;  1J0R A;  4ETS A;  5LBQ A;  1YJW I;  2MAB A;  3E7L A;  3IH3 A;  4XK4 A;  2XPW A;  1BC8 C;  2PLY A;  3EDP A;  3BDD A;  1XMA A;  2LF7 A;  3RQ4 A;  2DA3 A;  1ZG1 A;  2PJR A;  4CHU A;  1EKE A;  2LBF A;  4RA2 A;  3AL0 C;  3OMY A;  1IW7 F;  2HYF A;  1ZR4 A;  4KYW A;  1ZK8 A;  2M2E A;  1IN5 A;  4CYC B;  3BJA A;  2OUM A;  2QVO A;  3BPX A;  1Y1W J;  1MMD A;  2Z33 A;  4PSW A;  3FXO A;  4N4N B;  2V79 A;  3GEZ A;  4ZDP A;  2PMZ A;  2BHZ A;  2QGU A;  5A2Q K;  1D0X A;  3A03 A;  4HG2 A;  2VAS A;  1R22 A;  2V1X A;  2VPR A;  3S1N J;  4MNU A;  3I5U A;  2LG4 A;  4V19 K;  1MBG A;  1YTY A;  1J9I A;  1NG7 A;  5L3D A;  1LEB A;  3UKG A;  3ZMS A;  3CTA A;  1X1A A;  2K3F A;  4IHS A;  3HJE A;  3ERE D;  3DEW A;  3HIF A;  1BA5 A;  4HF0 A;  2PEX A;  4BJ6 C;  4R1H A;  5KAF C;  2JVH A;  3W3C A;  4AU7 A;  1B1B A;  4E7H A;  5LRR A;  4LB6 B;  2R7S A;  2DFI A;  4JX6 A;  2HXI A;  1DGW Y;  5B3S H;  2RV8 A;  2QA4 I;  1IGN A;  4RGR A;  2KPM A;  2Q2E A;  4TV7 A;  2O7O A;  1I1S A;  4GCV A;  5DM7 F;  2JA7 J;  2FF4 A;  1SFX A;  4XNF A;  1QVU A;  2W00 A;  3LWF A;  1WRJ A;  2KIM A;  3PUF A;  3GW2 A;  1QGP A;  5CYV A;  1B72 B;  2BXY A;  4ZZL A;  2EIK H;  4BL0 B;  4UNO A;  3C18 A;  3QPL A;  5HVQ C;  1MSE C;  3I53 A;  2DTZ A;  1YRN B;  1ODD A;  1F4K A;  2BY3 A;  1GXQ A;  1JGS A;  1G59 A;  3I71 A;  4L9N A;  2VON A;  4MHG A;  5IOZ A;  2WAE A;  4DBR A;  3HHH A;  2CJJ A;  2F2E A;  2IEK A;  3HTU A;  4PJJ A;  4XKV A;  3WG7 H;  4AWX B;  2L54 A;  2N8G A;  4NUB A;  3HGG A;  5KVR A;  1RKW A;  2ICW G;  3LSI A;  2MC4 A;  5LHI A;  4P1W A;  3L2U A;  4FX0 A;  4BAC A;  3SYT A;  1VZ0 A;  3VWB A;  4WF2 A;  3HG9 A;  1T33 A;  2BZT A;  5JR3 A;  3WTU C;  4MTE A;  1OYY A;  4OIP F;  1SFU A;  2LLK A;  5TRD A;  3CLO A;  1MMG A;  3DEU A;  5HS7 A;  3CCM I;  2Q1Z B;  2GXG A;  4IZZ A;  1OLT A;  3E6C C;  3K10 A;  1D1B A;  2L5Q A;  2VQH A;  4X0G A;  3DPU A;  3H3V K;  5F1J A;  4E7L A;  1T0F C;  2YUS A;  1TWG J;  2VOO A;  1RZ4 A;  1ZQ3 P;  2LY1 A;  3M7G A;  1I39 A;  1HBX G;  2OTJ I;  2BHY A;  4HA8 A;  5EF6 A;  3WTZ A;  2RAE A;  4G7Z F;  3I9V 2;  3HEF A;  3GFL A;  4RB1 A;  4DGW B;  1QZE A;  4EVI A;  4A0Z A;  3L2V A;  1ZGJ A;  3IH2 A;  3WTW C;  5L3E A;  1XSV A;  2CMP A;  2OTL I;  2BW3 A;  1DQU A;  4I0B A;  3RZD J;  2ECB A;  4CO8 A;  3QPT A;  1XX5 A;  4GO1 A;  2LVS A;  1W5C C;  3IL2 A;  1W1W E;  2EV0 A;  2B63 J;  4B4C A;  3M3Y J;  1P9Q C;  2KJC A;  2MA3 A;  2HPI A;  2DT7 B;  3HOU J;  3O3K A;  2HZT A;  5LHG A;  3PUB A;  1UJ8 A;  3K4L A;  3Q9V A;  4S0H B;  4BJT A;  5FO5 A;  3MKW B;  2FXA A;  4KT5 C;  1RIO H;  1TT0 A;  4LLN A;  1B8I B;  2DFH A;  1B4A A;  2FBK A;  1EH6 A;  3WGI A;  1IG7 A;  4A69 C;  1RPW A;  2HQR A;  2WB1 N;  4BU2 A;  4RB2 C;  4EGY A;  2LFB A;  5M5X J;  4EGZ A;  4HNU A;  1IRX A;  4JOM A;  4WCG A;  2DMU A;  1W5T A;  5EG0 A;  5CVI A;  5D8K B;  1OIS A;  3IC7 A;  1ZTR A;  2A07 F;  3QOD A;  4X1E A;  5JFR A;  4DJA A;  3HOV J;  3EYI A;  3ERM A;  4F55 A;  1UFM A;  1U9N A;  2HR3 A;  3IWZ A;  2E2J J;  4QWQ A;  1DGR M;  1Q1H A;  1HSJ A;  2LK2 A;  2BVM A;  3K69 A;  2M34 A;  3FF5 A;  2OCC H;  2P5L C;  1KU3 A;  1R5I D;  1NH3 A;  1C0W A;  3KLN A;  4IRG A;  4E7S A;  5EJC A;  5D4S A;  2ELH A;  2YS9 A;  4MLO A;  3S93 A;  2HYJ A;  3VOD A;  4IHV A;  2TDX A;  5JHU A;  2IGN A;  3L9F A;  4ZYE A;  2PJR B;  3CCR I;  5GAE J;  4DYC A;  2KMU A;  4YIF A;  1BI0 A;  2EA4 A;  1JUP A;  2M7B A;  2ZFU A;  4I7H A;  4M72 A;  4M74 A;  2WB1 A;  4RAY A;  5EZG A;  1S3J A;  2E7X A;  1D3Y A;  4CCM A;  3MMY B;  3OIO A;  1Z6R A;  2VE8 A;  1YX3 A;  3DKY A;  1W0U A;  3GF2 A;  3DBH B;  1GLN A;  3HUG A;  1ZLK A;  1ETV A;  1EH7 A;  3GTO J;  3DPL C;  1GT0 C;  2HFH A;  3OOU A;  3I0T A;  4A12 A;  3KP6 A;  4B3X A;  3VYR B;  2A5Y B;  3V8J A;  3FM3 A;  1OCO H;  4G8X A;  2BY1 A;  3RPU A;  3SZG A;  4M3F A;  4RM2 A;  2K86 A;  3TW6 A;  3H1C A;  1O3S A;  2STW A;  2ZFW A;  1P4X A;  1BBY A;  2W84 A;  1G3T A;  3S1R J;  1WH7 A;  4CCN A;  1JKO C;  4YII A;  1N77 A;  2F4M B;  5IYC J;  2R92 J;  3PO2 J;  5F6F A;  1UHW A;  3GTK J;  4EM2 A;  3OYE A;  3JTG A;  3T0Y A;  1XGS A;  3WTX C;  1Z77 A;  3PSI A;  2F6C A;  3HOX J;  2GXB A;  1IRG A;  1F36 A;  3ABM H;  2EZK A;  2NNN A;  2OJE D;  3TL4 X;  1T8I A;  1X2N A;  3H3U A;  1BI1 A;  1K4T A;  5AON A;  1F1Z A;  1ULY A;  1YO5 C;  2CV2 A;  4O6J A;  2CWE A;  4RAG A;  4WWC A;  5K1Y A;  3I59 B;  1L0O C;  2DOE A;  2VBW A;  3OL3 A;  3LL7 A;  1FJL A;  3QP5 A;  5ERI A;  1I5Z A;  5HOO A;  3F21 A;  2O9L A;  2OF7 A;  2EIJ H;  5BS6 A;  3K7A J;  1YHQ I;  5FRO A;  4N0B A;  5K5Q A;  3DTE A;  5J40 A;  2XHK A;  2BYV E;  2EFO A;  5LHH A;  2VOD A;  5JI6 A;  1YS6 A;  1WI3 A;  4LD5 A;  2QWW A;  1POG A;  1JXS A;  1V5E A;  4AVZ A;  4EJW A;  3ASN H;  4PFO A;  2CUE A;  1ZN2 A;  4A6D A;  3JRF A;  1J2X A;  1FPQ A;  1V5F A;  1FT9 A;  3WTY C;  1P4A A;  4RS8 A;  3X2Q H;  1UHS A;  2IP2 A;  2VUM J;  5LEJ A;  3ABK H;  2L9S A;  4GFB A;  2R7F A;  3CCJ I;  1ORK A;  1DPU A;  4ZYG A;  1GVJ A;  4ESB A;  4XRM A;  4LJZ F;  3T8T A;  2IA0 A;  5JLW A;  4G94 A;  3ZQL A;  2VIX A;  2M87 A;  2DT6 A;  1MBK A;  5IYD J;  1RR7 A;  4OAZ A;  4XKB A;  1TZL A;  1Y56 A;  1UG0 A;  4U0W A;  4A2U A;  5JVG F;  4OWR B;  2OU2 A;  1OR7 C;  1WI9 A;  2KKO A;  3JAM K;  1PJR A;  4J19 A;  5DUI A;  3Q9S A;  3JRA A;  5CVJ A;  3NRV A;  4D0P A;  2R7D A;  6PAX A;  3A02 A;  4DIQ A;  1U0J A;  4QPO A;  3I55 I;  1FSH A;  3G71 I;  2ETH A;  1FBQ A;  1XGN A;  4L9J A;  4Y7N J;  3K70 C;  1U78 A;  4OIR F;  2AXT C;  2K4B A;  2O0Y A;  5JHF A;  1Z1D A;  2H6B A;  2MW8 A;  4GGG A;  4LFU A;  1X4P A;  2VT3 A;  3A1Y A;  2BXZ A;  3BR2 A;  2V4J C;  1H89 C;  3ESW B;  3WHC A;  4IO9 F;  3D5R C;  2E1N A;  3ZGK A;  5C3E J;  3LSP A;  4XSZ F;  2KLO A;  3FXM A;  2M30 A;  2R93 J;  1MD0 A;  4I76 A;  2A3S A;  3GUD A;  2DJN A;  2HEO A;  3LAJ A;  2ESH A;  1X2M A;  3QOE A;  5CVU A;  2L9V A;  2J5O A;  1B9M A;  1ZKG A;  4XRF A;  1SD6 A;  2DOD A;  3NWS A;  3BRO A;  2O3F A;  3HOS A;  2ME0 A;  1E3H A;  2HU9 A;  4E7I A;  2JA8 J;  2VKV A;  2L9R A;  3TO9 A;  1PDN C;  2X6Y A;  5J1U A;  5BPD A;  1X4O A;  2OQG A;  4YFX F;  2R7R A;  4C2U A;  3ISP A;  3ZQQ A;  3ML6 A;  4S05 A;  1S9H A;  2CG4 A;  1AU7 A;  1R1V A;  3FXU A;  3WTT C;  2IS4 A;  2M7A A;  2XAH A;  1P4W A;  3R61 A;  2CQN A;  4C9Y A;  5J1R A;  5E3N A;  1R5H A;  2QYO A;  3ROU A;  4G6Q A;  3REO A;  4Z6Y A;  2XGE A;  3MQ0 A;  5EG0 B;  4BDZ A;  3OYB A;  1FOX A;  2C6Y A;  3EQL F;  2HKX A;  4NDL A;  3L2Q A;  5M5W J;  3JCU C;  4LG0 A;  1HOM A;  2BVL A;  1YYV A;  1DDN A;  5FGM A;  1ZH5 A;  2DJI A;  3M1C A;  2FQ3 A;  3VOE A;  4PJM A;  2P5V A;  3K4M A;  3LNQ A;  1FOK A;  1U5T C;  1TP4 A;  3CLQ A;  3MEX A;  1CQT A;  2DPD A;  3GTJ J;  2E1C A;  4U7B A;  1K78 A;  2XPV A;  1S7A A;  3RI4 A;  4CCJ A;  1JHH A;  1X1P A;  2COB A;  1FMW A;  1X1C A;  4EJV A;  1LFU P;  4HX7 A;  4HPQ A;  3HKZ A;  2DDA A;  1KA8 A;  3IWF A;  2PX9 A;  4M9X A;  2PMH A;  3SQN A;  4EQQ A;  1IF1 A;  4B09 A;  4ZYH A;  4ESJ A;  4CCL A;  3V7C A;  3WTS C;  2HTJ A;  1UHM A;  2KDO A;  1D1C A;  2V1N A;  2E71 A;  4HAM A;  1O57 A;  4JX5 A;  3W6K B;  2IJL A;  4XM3 A;  5FD5 A;  3G2B A;  3FK6 A;  2BE5 F;  2FQ4 A;  3RCO A;  5FKN A;  1UST A;  3HUG B;  4E6K G;  4E70 A;  1G3W A;  1I3Q J;  4FAS D;  1ZG3 A;  3DPT A;  3I54 A;  4P5O A;  2M0C A;  3TKY A;  4ABZ A;  3IKT A;  1J5Y A;  4D1Q A;  1CGP A;  2AQE A;  3CZ6 A;  4UV8 A;  3VDX A;  2CS3 A;  1MBE A;  3S16 J;  3O2P E;  1W36 D;  1HDP A;  2HOT A;  3S1Q J;  1SMY F;  1YQA A;  3VPR A;  2DMP A;  2VJI A;  1ENH A;  3J7A Y;  3QU6 A;  1BL0 A;  2E1O A;  4JQF A;  1LDK B;  2VT2 A;  1OJL A;  2XAU A;  5E8G A;  3RSN A;  5L3C A;  3ZPL A;  1GHC A;  2HXO A;  3B6C A;  5E1W A;  3ZQC A;  1FLI A;  1U3E M;  3MZH A;  1RKT A;  5JLX A;  4EM1 A;  1YRN A;  1A6Q A;  1JKR C;  5HLI A;  3H0G J;  2A05 A;  4NQW A;  1ZAO A;  1SAN A;  3L1P A;  1T95 A;  5M3M J;  1P6R A;  1XD7 A;  3C3W A;  3GTG J;  3K4K A;  4FT8 A;  1Z91 A;  2ZJ2 A;  3PSF A;  2RNG A;  3U21 A;  1EJ9 A;  1WVR A;  4BJ5 C;  4Q4Z F;  3M9A A;  3IHU A;  1T0F A;  2UXN A;  3V4G A;  4QPQ A;  4BUP A;  3KP7 A;  5ICC A;  2LRD A;  2PBI A;  2XKP A;  4DZP A;  5J47 A;  4XID A;  4O3M A;  1TQM A;  4RLF A;  3BPV A;  3RKX A;  3J80 Z;  3EUA A;  2E35 A;  1FZP B;  2MFZ A;  5H20 A;  2Y0M A;  3JTH A;  3LFK A;  4XR6 A;  2DQR A;  3KE2 A;  2XF6 A;  3Q0W A;  1R00 A;  4II3 A;  2OQR A;  3FKJ A;  3FK7 A;  3R0A A;  4A3E J;  4GDF A;  1BI2 A;  5DV5 A;  1A5J A;  1MH4 A;  4NC6 A;  2K40 A;  3BTL A;  2QQ9 A;  1SVL A;  3SHF A;  3Q0U A;  1D1A A;  2STT A;  5HS9 A;  4M3D A;  1W4M A;  1I6H J;  1S5L C;  2LDU A;  4M73 A;  4PJL A;  1WHU A;  2VKE A;  2LP0 A;  4N9I A;  1BOB A;  4XLN F;  1ONV A;  3WG9 A;  2ZB9 A;  5EDN A;  1IUY A;  4KIF A;  2CFX A;  1F5T A;  4H4K C;  4M71 A;  1EH8 A;  2LD5 A;  3KZI C;  5CQE A;  3JRI A;  3F23 A;  2IW5 A;  1VQ9 I;  2AHQ A;  4EMS A;  3OSF A;  2PJP A;  1Z21 A;  2YR2 A;  1ACI A;  5K7H A;  1UEL B;  2LNB A;  5GP9 A;  3OS1 A;  3P9C A;  2XRO A;  4IXA A;  1H8A C;  3AFH A;  4HW0 A;  5A2Q Z;  1A36 A;  4ZC3 A;  4HYE A;  5C4J J;  2QSH X;  4UB6 C;  2JA5 J;  4A3K J;  2NOG A;  1TTY A;  3AG3 H;  1SVO A;  1TWA J;  3ZP5 A;  3CES A;  1JTY A;  2QEN A;  2ECC A;  5IT3 A;  4J01 A;  1UG2 A;  1SVM A;  5ICG A;  2VE9 A;  3FBN B;  5D5V B;  4ZDL A;  2WAD A;  3AL0 B;  2CRG A;  2R7W A;  3HTS B;  3MKZ A;  2DOA A;  2CUZ A;  2KT0 A;  3ZMD A;  4Y33 A;  2DYR H;  1SD7 A;  4K2E A;  1A31 A;  4LB5 A;  4OMY A;  2WA0 A;  5K7Z A;  1NK3 P;  4KA4 A;  4KN4 X;  1MW7 A;  1WFX A;  4XOR A;  3VEP A;  3FXJ A;  5LFA A;  2XSD C;  1MIJ A;  1JT0 A;  5HNH A;  1Z6T A;  1S29 A;  2WY7 Q;  2XDV A;  4M9S A;  5EYR A;  2JA2 A;  2EIM H;  4R79 A;  2DA7 A;  1MGT A;  4A3L J;  4MEY F;  4DYQ A;  3JRC A;  2EJR A;  1ERD A;  3E5U A;  1IAW A;  1Y0N A;  3DKX A;  4Y3O A;  2XGD A;  3JRH A;  2GM4 A;  2R5Z A;  2O8X A;  4KIS A;  1ZRC A;  2HWV A;  1P2F A;  2K27 A;  1XS9 A;  5GPA A;  5GAH J;  3DF8 A;  1WJB A;  1XSD A;  5F64 A;  2F4O B;  4LG0 B;  4AIH A;  1JJ8 C;  2VJ5 A;  4I2O A;  2M45 A;  3K1P A;  3OYD A;  4BE0 A;  3FHN A;  2XKO A;  3FDY A;  3HYI A;  3K1N A;  3DTI A;  2V7F A;  5HLT A;  1KQ0 A;  2CSO A;  3PJR A;  3ZRG A;  1BM9 A;  2UUZ A;  1TQP A;  1SFE A;  1OYI A;  2TRT A;  4Q47 A;  3F22 A;  1SAX A;  2NS0 A;  1K78 B;  4M9Z A;  3FM5 A;  2HI3 A;  3OS2 A;  1K6O A;  4BE1 A;  2JRM A;  3I3L A;  1LUJ B;  2A61 A;  5LGN A;  1IZ1 A;  2VJ4 A;  4AM3 A;  3WU1 B;  4IVN A;  4NHJ A;  3S17 J;  3BY6 A;  3FXL A;  4HZF A;  1EA3 A;  2Y31 A;  3DWL E;  3EUK L;  3A01 A;  4ZZD A;  2QQ8 A;  5DYM A;  4A0X A;  3DQV C;  1WJE A;  3B73 A;  3CDL A;  3RTR A;  1B9N A;  1ZGW A;  3DBL B;  5K7F A;  4XKW A;  2Q8K A;  3LMM A;  3IUO A;  3R0J A;  2ZXH A;  3PFY A;  5E1X A;  4A3M J;  3HSR A;  1YI2 I;  2PMU A;  4RGU A;  3COA C;  2RKH A;  4LLG F;  4AYB N;  3GO5 A;  4D7N A;  3EPZ A;  5H2F C;  2QM3 A;  5F08 A;  4XRS A;  4EJO A;  2YU9 J;  2MGQ A;  3F9K A;  2VPL A;  3O8H A;  3DFG A;  3HOY J;  4G7O F;  1HW5 A;  4KT6 A;  2X9D A;  3LFU A;  4C2M J;  1G3Y A;  4LOC A;  1FOY A;  1Y39 A;  4A5M A;  3I59 A;  3BCA A;  1JI8 A;  1U6G A;  4XRS G;  2M1B A;  5KHD A;  2H8R A;  4LMY A;  2H1K A;  2JN6 A;  2OV7 A;  2GBY A;  2VXD A;  4AVP A;  3OYH A;  4ASN A;  1N75 A;  3NWT A;  2GQQ A;  4NQW B;  1SC7 A;  2HQN A;  3ZR8 X;  2EZL A;  2DDB A;  1ZHF A;  3RKW A;  2M9H A;  1OR7 A;  2ZXW H;  2NAZ A;  1Y6I A;  1IDZ A;  1IRZ A;  5F0H A;  3S3M A;  2NXN B;  2DMQ A;  4B1R A;  4WXH A;  5D5X B;  1GUU A;  1ZGA A;  4BEH A;  1J7K A;  2R7U A;  2EFN A;  3JRD A;  4L18 B;  1ETW A;  4N4O B;  4AYB A;  3TED A;  3HB9 A;  3CMA I;  2HQ5 A;  2HVQ A;  2KRH A;  2Z1D A;  3E6D A;  4M3E A;  4HEA 2;  4BXU A;  4CCO A;  4HQE A;  3S3N A;  4AUX A;  3QOP A;  2O61 A;  1LFP A;  5KAI C;  1QNT A;  1HF0 A;  1PVE A;  4EEF G;  2IA2 A;  3RKQ A;  4HLX A;  5E1Z B;  3OOP A;  1FX7 A;  3HPG A;  5CVV A;  1ZYR F;  4C3J J;  4IL6 C;  1N25 A;  4Y52 J;  2W82 A;  3KEQ A;  2DK5 A;  4UUS A;  2W1O A;  4IX7 A;  9ANT A;  4B3A A;  4HV6 A;  3R60 A;  2RRE A;  2FD5 A;  1BJZ A;  4WXD A;  1O3T A;  2ZME C;  1Y8Q B;  3F8N A;  2ADU A;  4RBO A;  3KFW X;  2JSP A;  4ZTF A;  1HLV A;  1LFB A;  1BW5 A;  2ZKZ A;  2W85 A;  2ELK A;  1ZAR A;  1YJN I;  2LSO A;  3R4K A;  1F43 A;  1V4R A;  3RYP A;  4EM0 B;  3HOW J;  5FLX Z;  1T2K A;  3RKY A;  2L7Z A;  4F52 A;  4WK8 F;  4RLQ A;  1KGS A;  2HOA A;  1H9T A;  5B1A H;  1QZY A;  2K02 A;  3H5R A;  5HNF A;  3GFI A;  1RNL A;  2E7W A;  2GOX B;  3HRT A;  2AS5 F;  2A6H F;  3I56 I;  3BQY A;  1GDT A;  2X1D A;  1TWF J;  5KK1 A;  2LTP A;  2O5R A;  2FOW A;  3RDI A;  3WU0 A;  1U5T A;  3G3Z A;  3E97 A;  5LRS A;  3H5N A;  2WV1 A;  3I4N J;  1V5G A;  2VOP A;  1VQ4 I;  3L2C A;  4CZC A;  1KU9 A;  1X19 A;  4BXF A;  3KYC B;  2GIZ A;  4XBF A;  2XRL A;  4KIC A;  2H27 A;  1WGX A;  3HHG A;  3GTL J;  2L0K A;  2EQR A;  2JQ7 A;  2CUF A;  3U9G A;  1SD5 A;  2V9V A;  2E60 A;  1PUF A;  2DA6 A;  2KIF A;  3CD6 I;  3DU6 A;  1T38 A;  2W48 A;  5TIS C;  4YIR X;  2HDD A;  5CPR B;  4NB5 A;  4CGZ A;  2HZD A;  3M8J A;  2Z99 A;  2NVU B;  1EV7 A;  1TLH B;  5IY5 H;  2GAU A;  4XLA A;  2OPT A;  5DS9 A;  3CCY A;  2W7N A;  3KPH A;  2WTE A;  1FOW A;  3DU5 A;  3SEZ A;  1YX5 A;  1UMQ A;  4KIT B;  2XAQ A;  3BJ6 A;  3TP3 A;  1IXR C;  4A0Y A;  4BHB A;  3Q3S A;  3BT9 A;  3PNY A;  4CIC A;  5E20 A;  1I27 A;  1R1T A;  4CH7 A;  2L4A A;  2OBP A;  1XCV A;  2R5Z B;  4QLC U;  2V6E A;  3WHB A;  1K79 A;  1XDS A;  4G9Y A;  1OKR A;  4BHP A;  3LOC A;  4W1U A;  4YRV A;  5FJ8 J;  4LK1 F;  5F04 A;  3OYK A;  3BG5 A;  4A93 J;  2JK3 A;  3K0L A;  5CKT A;  3ABL H;  3GYH X;  4BNC A;  2HGC A;  3KYD B;  5D6F A;  4OIN F;  4BE2 A;  2Y9Z A;  3ABT A;  3V7S A;  1UZC A;  2F5V A;  3P9K A;  3OL4 A;  2FUG 2;  2IS6 A;  2QCO A;  2MG4 A;  3R6S A;  1Z67 A;  3ECH A;  2WWY A;  2VKD A;  4JK1 X;  5BOX A;  3U2R A;  1ZRD A;  3OIP A;  2X1C A;  3A01 B;  1MH3 A;  1G8X A;  2P0W A;  1QO0 D;  2V1D A;  2ZBK A;  1Z7L A;  5DEQ A;  3ZQH A;  3JRG A;  2CV0 A;  1X3U A;  1WJ5 A;  1HCR A;  4A6E A;  4LK0 F;  2XC7 A;  5D5W B;  1ON2 A;  4I99 C;  3BR1 A;  3GTP J;  3TDU C;  3HGY A;  3V42 A;  5ED4 A;  4S04 A;  2WAF A;  4M6V A;  1Z9C A;  3JAM Z;  1YOV B;  3ZXS A;  3BG3 A;  3H92 A;  2I10 A;  3FMS A;  1OCC H;  2IRF G;  3HC7 A;  2D45 A;  4KDP A;  3CCQ I;  2P7C B;  3E0J B;  1BJA A;  2ZC2 A;  5HOD A;  3RPU D;  2VN2 A;  2M8G X;  5F27 A;  2VC0 A;  4Z2Y A;  4MTD A;  3BC8 A;  2VC1 A;  4QTR A;  1AKH B;  4C3I J;  2YSR A;  1SFO J;  1ZRE A;  3DLA A;  2R7Z J;  1ETO A;  4P9F A;  2I8D A;  3LSJ A;  1H9G A;  2QF7 A;  4A3G J;  5FFZ A;  3ZOB A;  2UWM A;  3GWZ A;  1FP1 D;  2R7O A;  1BC7 C;  2RQP A;  2Y30 A;  4IRH A;  3KET A;  5DCM A;  1X58 A;  2HYG D;  3C1D A;  2GA1 A;  4UV9 A;  4LGW A;  1TWH J;  2WY8 Q;  3ECO A;  1MMA A;  2B7E A;  3C2G A;  2KQR A;  2P6T A;  4BQA A;  3ZCO A;  4A5N A;  4YFN F;  4PK4 A;  2LYC A;  3DV8 A;  3LSM A;  3TOA A;  4I0A A;  3D0S A;  1IN4 A;  2JA6 J;  4UVC A;  4BEH B;  5BPI A;  1LQ1 A;  2KIU A;  4YEJ A;  1N78 A;  3HDD A;  2A69 F;  1T08 B;  3OSG A; 
#chains in the Genus database with same CATH homology
 3IH3 A;  2DMP A;  3VPR A;  1ENH A;  3ZQI A;  4XK4 A;  2R0Q C;  2XPW A;  1BL0 A;  4A3D J;  2E1O A;  1OJL A;  2LKX A;  2DA3 A;  2CU7 A;  1RES A;  2HXO A;  3B6C A;  3ZQC A;  3HOZ J;  1ZR4 A;  1ZK8 A;  2E19 A;  1RKT A;  2M2E A;  5JLX A;  2DN0 A;  1YRN A;  1JKR C;  4CYC B;  4UUS B;  2G0E A;  3H0G J;  1JKQ C;  4BY7 J;  1Y1W J;  1SAN A;  3L1P A;  5M3M J;  2CQX A;  3BTJ A;  4V2G A;  1JTX A;  3GTG J;  3CMY A;  1VF9 A;  3A03 A;  2VPR A;  3S1N J;  1MNM C;  2O8K A;  4DZP A;  4XID A;  2K9N A;  1MBG A;  4M3G A;  5IYB J;  3UKG A;  1LE8 A;  4IEJ A;  3MVP A;  4DYR A;  3DEW A;  5IOY A;  1BA5 A;  2NVX J;  3Q0W A;  4DZJ A;  3FK7 A;  4A3E J;  5FKK A;  2DMN A;  1A5J A;  1MH4 A;  4JX6 A;  2HXI A;  1IGN A;  2K40 A;  3BTL A;  2O7O A;  3Q0U A;  2IAI A;  1RET A;  1XG1 A;  4A3I J;  2JA7 J;  2JWT A;  4A3J J;  4M3D A;  1I6H J;  3HKZ N;  2HOS A;  2VKE A;  1QVU A;  2LP0 A;  1FIP A;  1IDY A;  3NAU A;  1B72 B;  2ZB9 A;  5EDN A;  4FCY A;  4JP0 A;  3QPL A;  2XPU A;  1PUF B;  1MSE C;  2DA1 A;  2DTZ A;  1YRN B;  1DU6 A;  3RQI A;  2LD5 A;  3JRI A;  2AHQ A;  2ME6 A;  5IOZ A;  3OSF A;  2CJJ A;  5K7H A;  3G1M A;  2IEK A;  2X6O A;  3M4O J;  5GP9 A;  2ID3 A;  2N8G A;  2DA5 A;  3HGG A;  2DA4 A;  3ZQG A;  5IP9 J;  1RKW A;  1H8A C;  4QIW N;  4XIC A;  1IV6 A;  1Y1V J;  4QSH A;  2IBD A;  5C4J J;  2DA2 A;  2JA5 J;  4A3K J;  1QRY A;  2NOG A;  1K83 J;  1TWA J;  3Q0V A;  1JTY A;  1T33 A;  2DMT A;  4AC0 A;  1FIA A;  2ECC A;  1LE8 B;  1UG2 A;  1BW6 A;  1NTC A;  2LLK A;  2JJ7 A;  2CRG A;  3G1L A;  1HDD C;  2KT0 A;  1JUM A;  2JMW A;  5K7Z A;  1NK3 P;  2FJ1 A;  2E2H J;  3BQZ A;  2XSD C;  3H3V K;  1JT0 A;  5F1J A;  2K9S A;  4IHW A;  2YUS A;  2XGC A;  1TWG J;  1ZQ3 P;  4D5C A;  5EYR A;  3BR6 A;  2DA7 A;  5EF6 A;  4A3L J;  2RAE A;  4JYK A;  4DYQ A;  3HEF A;  3JRC A;  2X48 A;  3BR5 A;  2XGD A;  5M3F J;  3JRH A;  5E3L A;  1Z0X A;  2WAQ N;  3IH2 A;  2R5Z A;  2GM4 A;  1OFC X;  5GPA A;  1XS9 A;  3CQZ J;  5FKL A;  4IHX A;  2P81 A;  2K9Q A;  5EGO A;  1K61 A;  1JJ8 C;  2NS7 A;  5C4X J;  3RZD J;  2ECB A;  5IP6 A;  2MSY A;  2LR8 A;  3O8G A;  2LVS A;  1XC5 A;  5FKO A;  2B63 J;  2TRT A;  4B4C A;  3M3Y J;  3IH4 A;  2HI3 A;  1MSF C;  3HOU J;  1I50 J;  1JGG A;  3HBL A;  3QPS A;  4S0H B;  1APL C;  3S17 J;  4D7M A;  3A01 A;  2Y31 A;  1B8I B;  1IG7 A;  4A69 C;  1RPW A;  3JRE A;  1GV5 A;  2WB1 N;  4JX4 A;  2LFB A;  5M5X J;  3CDL A;  2DMU A;  5EG0 A;  1ZGW A;  1ZTR A;  5K7F A;  4MO7 A;  4X1E A;  4I6Z A;  4A3M J;  4BY1 J;  3HOV J;  1U9N A;  1IUF A;  4AYB N;  3K2A A;  4D7N A;  3B6A A;  5F08 A;  2E2J J;  1WPK A;  4XRS A;  4IHY A;  2YU9 J;  2MGQ A;  2LK2 A;  3QQA A;  2M34 A;  3O8H A;  3HOY J;  4L5E A;  2X9D A;  4C2M J;  4LOC A;  2YS9 A;  4MLO A;  4IHV A;  2HYJ A;  4V2F A;  1TWC J;  1D5Y A;  3BTC A;  4XRS G;  2H8R A;  5FKM A;  3MN2 A;  2NVY J;  3SFI A;  2CQQ A;  4DYC A;  2H1K A;  1W0T A;  3FIW A;  2JN6 A;  1JUP A;  1WH5 A;  2GBY A;  2R5Y A;  5EZG A;  5IPA A;  2EZL A;  2M9H A;  1OCT C;  3OIO A;  1W0U A;  5E3M A;  1IDZ A;  1Q1V A;  1IRZ A;  1P7J A;  5F0H A;  1ETV A;  2DMQ A;  5F0C A;  1DU0 A;  2Y9Y A;  4B1R A;  1GT0 C;  3GTO J;  3OOU A;  1GUU A;  3JRD A;  1ETW A;  3SJM A;  4M3F A;  3HB9 A;  3TED A;  3TW6 A;  2HQ5 A;  5M5Y J;  4M3E A;  1ETK A;  3S1R J;  1WH7 A;  4AUX A;  1JKO C;  5IYC J;  3RKQ A;  4EEF G;  1GV2 A;  1HF0 A;  2R92 J;  3PO2 J;  3JR9 A;  3GTK J;  1G2H A;  1ETX A;  4C3J J;  3PM1 A;  4Y52 J;  5BNG A;  1Z77 A;  4CYC A;  4UUS A;  3FIS A;  1AHD P;  4B3A A;  2NVT J;  3HOX J;  9ANT A;  1F36 A;  2EZK A;  2FD5 A;  3LSG A;  1BJZ A;  4UUT A;  1X2N A;  4RBO A;  3GBG A;  1JJ6 C;  1HLV A;  3C2B A;  5J3L A;  1OCP A;  5FLM J;  1LFB A;  1BW5 A;  2ELK A;  1IJW C;  4RDU A;  3BG9 A;  1FJL A;  1F43 A;  3HOW J;  4G12 A;  2O9L A;  2OF7 A;  1ETY A;  1GVD A;  3K7A J;  2L7Z A;  2LY9 A;  2XB0 X;  2HOA A;  1JUS A;  5GPC A;  3GTM J;  1FEX A;  4X6A J;  1WI3 A;  2GLO A;  2NVQ J;  1VI0 A;  1POG A;  2EH3 A;  3BQY A;  1GDT A;  1TWF J;  4MFE A;  2CUE A;  2LTP A;  3NAR A;  3JRF A;  3S15 J;  2WV1 A;  3I4N J;  1U8B A;  1UHS A;  2VUM J;  1U9O A;  4FE4 A;  4GFB A;  4BBR J;  1ORK A;  4D5F A;  5EEA A;  4XRM A;  2XRL A;  2XB5 A;  1WGX A;  3GTL J;  2L0K A;  5JLW A;  2EQR A;  1B72 A;  3W6V A;  3ZQL A;  3IV5 A;  2CUF A;  3SDG A;  1MBK A;  3LSR A;  1RR7 A;  1PUF A;  2DA6 A;  5IYD J;  3MKL A;  2W48 A;  3ZQF A;  2EBI A;  1IC8 A;  2HDD A;  4J19 A;  3JRA A;  4BKX A;  1MBF A;  1MBH A;  3BTI A;  1S7E A;  2EZH A;  3F0C A;  1P7I A;  2OPT A;  3TW7 A;  5DS9 A;  3CCY A;  3A02 A;  4M3B A;  1O4X A;  2E2I J;  1UMQ A;  4Y7N J;  1U78 A;  1EF4 A;  1VND A;  3TP3 A;  1AKH A;  1R9T J;  3BR3 A;  3Q3S A;  4HNV A;  1QVT A;  3BT9 A;  2MW8 A;  3BR2 A;  2R5Z B;  1H89 C;  3WHC A;  3WHB A;  5C3E J;  3LSP A;  4A3C J;  4FTH A;  1MBJ A;  1H88 C;  3LOC A;  4W1U A;  2R93 J;  5EGO B;  4I76 A;  2DJN A;  5FJ8 J;  1X2M A;  5F04 A;  2VI6 A;  3I4M J;  1JT6 A;  3BG5 A;  4A93 J;  2JK3 A;  2L7F P;  1ZKG A;  2AO9 A;  2FX0 A;  2Y9Z A;  2Y2Z A;  2ME0 A;  2JA8 J;  2VKV A;  1A6I A;  2L9R A;  3D1N I;  5J1U A;  4MFD A;  2QCO A;  2MG4 A;  5F0F A;  4BXX J;  3A01 B;  1MH3 A;  3DCF A;  3ZQH A;  3JRG A;  5E3O A;  4FE7 A;  4C3H J;  1AU7 A;  1HCR A;  1FTT A;  5J1R A;  5E3N A;  5EG0 B;  2XGE A;  3GTP J;  3BR1 A;  3HM5 A;  2D5V A;  3HGY A;  4NDL A;  5M5W J;  1JKP C;  1NK2 P;  1HOM A;  4M6V A;  5J1Y A;  1ZR2 A;  3BG3 A;  1FTZ A;  3S2H J;  1E3O C;  2I10 A;  3LNQ A;  4W97 A;  3FKI J;  2KDZ A;  1T56 A;  5HOD A;  4MIM A;  4DW6 A;  1CQT A;  2TCT A;  2M8G X;  5F27 A;  3S14 J;  3GTJ J;  2Y0S N;  3RZO J;  4A3B J;  2XPV A;  5EZH A;  2ID6 A;  2L7M P;  4QTR A;  1AKH B;  3GTQ J;  4C3I J;  5DTD A;  2COB A;  1SFO J;  1LFU P;  2R7Z J;  1ETO A;  1B8I A;  3LSJ A;  2QF7 A;  4A3G J;  3TP0 A;  3ZOB A;  1ETQ A;  3JRB A;  1TC3 C;  2Y30 A;  4FIS A;  4A3F J;  3S2D J;  1ITY A;  3BR0 A;  1X58 A;  2R5Y B;  4JX5 A;  1TWH J;  2PMZ N;  3FK6 A;  3S1M J;  2FQ4 A;  1QPI A;  5FKN A;  2EZI A;  2NS8 A;  5IP7 J;  1I3Q J;  1VFC A;  2M0C A;  5FLV A;  4BBS J;  4ABZ A;  2JA6 J;  5C44 J;  3PO3 J;  3G1O A;  3S16 J;  1MBE A;  1HDP A;  2HOT A;  3HDD A;  1WCM J;  3S1Q J;  3OSG A;  3E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...