5IYCJ

Human core-pic in the initial transcribing state
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iycJ00
1U9NA 1BJZA 3S17J 3HOUJ 5M5YJ 2IBDA 3PO3J 4C2MJ 1U78A 1QVUA 4I76A 3BT9A 5GPCA 1HDDC 3S1RJ 1CQTA 3Q0VA 1OCPA 1VNDA 1DU6A 1A6IA 3S1QJ 2XB5A 1ENHA 2NVTJ 2ID3A 1I50J 3BG3A 2R5YB 1IRZA 2COBA 1ZK8A 1B8IA 2MSYA 4UUSB 2GM4A 1IG7A 5FKOA 3RZOJ 4Y7NJ 2FQ4A 3RQIA 3HOYJ 4M3EA 1NTCA 1BA5A 2VPRA 2XGCA 3JRHA 1IV6A 3SDGA 4AC0A 2YUSA 2WB1N 4FE7A 1ZR2A 2D5VA 5EZGA 3HOVJ 3O8HA 4D7NA 1ETKA 4DYCA 2E1OA 2O9LA 1RR7A 2R93J 5GP9A 1X2MA 1XC5A 1LFBA 2ECBA 5IYCJ 2ME0A 1JJ6C 1WGXA 4XK4A 2LY9A 5M5XJ 1SFOJ 3BR0A 1ORKA 5EG0B 1O4XA 1ZGWA 2O8KA 2HOSA 4BY7J 2JN6A 2XGEA 2R0QC 1MSFC 1FJLA 2FD5A 4A69C 5EZHA 4MFEA 2NVQJ 2R92J 2EH3A 2NVYJ 3CCYA 4IHYA 1ETQA 5DTDA 3MKLA 2WAQN 3G1OA 2OF7A 4A3JJ 1PUFB 4D5FA 1JT0A 2LR8A 3HDDA 2DA4A 3O8GA 5EGOA 4CYCB 3A01B 4BY1J 5E3MA 1RKTA 1MH4A 5F0CA 2DMQA 2IAIA 3H0GJ 3GTOJ 1U9OA 4D5CA 4FISA 1HCRA 1ZR4A 1MSEC 4M3FA 1IJWC 1Q1VA 3JRCA 3JR9A 3JRBA 4X1EA 3RZDJ 1T56A 3H3VK 5IPAA 1FEXA 3QQAA 2Y2ZA 4JYKA 4A3DJ 1F43A 5FLMJ 1W0UA 4IHXA 3FK7A 2MG4A 2R5YA 4A3CJ 2ELKA 1OCTC 1RKWA 1ETVA 1JT6A 2O7OA 1B72B 2M0CA 2LP0A 2AHQA 1FIPA 2NVXJ 2XPVA 3PM1A 4I6ZA 2X6OA 4MIMA 4AYBN 3WHBA 2LKXA 3MVPA 1QRYA 1APLC 2LTPA 2OPTA 4XRMA 4A3FJ 5F1JA 1IDYA 2X48A 4A3MJ 2R7ZJ 3BTIA 4X6AJ 3GTKJ 1FTTA 2HI3A 4V2FA 3FIWA 1POGA 1GUUA 4NDLA 3S2HJ 3HB9A 4UUSA 4C3IJ 4A3IJ 1VFCA 1ZQ3P 1TWCJ 5E3NA 1IDZA 1ETOA 3HEFA 5EEAA 2N8GA 2HYJA 3TP0A 2HOTA 5EF6A 1WH7A 3BR3A 3Q3SA 1TWAJ 5F0HA 3JRAA 3JRDA 4XRSA 3HGGA 3BR2A 4JX5A 3B6AA 3JRIA 4M3BA 3JRGA 3BQZA 1EF4A 2EBIA 1BW5A 4J19A 2IEKA 3ZQHA 1IC8A 5IYDJ 4A93J 2M9HA 3BG9A 5DS9A 3A01A 2Y0SN 2XB0X 3S1MJ 2L9RA 3OOUA 5GPAA 3I4MJ 5K7FA 1OJLA 1X2NA 2E2IJ 2PMZN 3CMYA 1AU7A 2EZLA 1BL0A 2B63J 3Q0UA 2HOAA 5HODA 1TWFJ 1WCMJ 2YU9J 3I4NJ 1ETXA 2P81A 2Y9ZA 3TW6A 4MLOA 2Y9YA 3D1NI 3SFIA 1ETWA 4EEFG 3HBLA 3F0CA 2YS9A 5F0FA 2GLOA 1UG2A 3HOZJ 4MFDA 2CJJA 3CQZJ 1HDPA 1NK3P 4CYCA 2ECCA 1HLVA 5C4JJ 5E3LA 1HF0A 5J1YA 2Y30A 3A02A 2DA1A 3S15J 2DJNA 4BBRJ 1GDTA 3BQYA 2WV1A 3LSPA 5C4XJ 1RPWA 2TRTA 3LOCA 4BXXJ 2K40A 4RBOA 2DN0A 2DA5A 3LSGA 4L5EA 1JTYA 5J1UA 4MO7A 1JKRC 2CQQA 2JA6J 2M2EA 4A3LJ 1RETA 4M3GA 1YRNB 3SJMA 5J1RA 5IP7J 4XICA 1AHDP 2Y31A 2R5ZB 1LE8A 3GTQJ 3IH2A 1Z0XA 3DCFA 3PO2J 4DZJA 2DMTA 2VKVA 1LFUP 1OFCX 5IOZA 3M3YJ 3BR5A 2ZB9A 3FISA 2JA8J 2RAEA 3LSJA 3HOWJ 5C3EJ 1ZTRA 5IOYA 2CU7A 3ZQFA 3IH3A 1GV2A 1GV5A 3OIOA 4HNVA 5FJ8J 1IGNA 1JUMA 1ZKGA 5FKLA 4JP0A 3WHCA 2X9DA 1SANA 1JKQC 1G2HA 4B1RA 5FKNA 3HOXJ 1JGGA 1K83J 3FK6A 2W48A 1JUPA 3G1MA 2DMNA 2HDDA 1E3OC 1UMQA 1GT0C 1JKPC 3BG5A 3C2BA 1RESA 4IEJA 2QCOA 2LD5A 3S1NJ 2H8RA 1H8AC 4A3EJ 1R9TJ 1TC3C 5K7HA 4DYQA 3GBGA 2M8GX 1MNMC 5FKKA 4DZPA 4FTHA 1WPKA 3ZQGA 4AUXA 4FE4A 1Y1VJ 2XPWA 4S0HB 4UUTA 3CDLA 2R5ZA 1AKHB 3A03A 3LSRA 2G0EA 2DA2A 3BR1A 2L7FP 5M3MJ 4V2GA 3NAUA 3BTCA 3GTLJ 1WI3A 2H1KA 4DYRA 4B4CA 2HXOA 5F27A 2ME6A 4XRSG 2NOGA 2E19A 2QF7A 1MBGA 3LNQA 4BBSJ 1JUSA 2CUFA 3HM5A 3DEWA 1I6HJ 2JMWA 3B6CA 9ANTA 1JKOC 1H88C 1IUFA 2DA3A 1P7JA 4A3KJ 5E3OA 3Q0WA 3K2AA 5EYRA 3UKGA 1MBKA 5F04A 1XS9A 2VUMJ 4B3AA 2EZHA 1VI0A 4QIWN 1T33A 2JWTA 4W1UA 2KDZA 2L0KA 1U8BA 1JJ8C 5IP6A 2DMPA 4D7MA 3BTLA 2TCTA 1H89C 3OSFA 4W97A 2HXIA 3QPSA 1NK2P 1AKHA 4A3GJ 1PUFA 4LOCA 2XRLA 1UHSA 3TW7A 5M3FJ 1JTXA 2LFBA 1MBJA 3S2DJ 4XIDA 4M6VA 5JLXA 3W6VA 2JJ7A 4A3BJ 2AO9A 4IHVA 5IP9J 2JK3A 1TWHJ 2HQ5A 2JA5J 3NARA 3GTGJ 3GTMJ 5C44J 2LLKA 1WH5A 1B8IB 1QVTA 2CRGA 2DMUA 3ZQLA 1VF9A 4ABZA 4IHWA 3RKQA 5FLVA 1W0TA 5EDNA 2FX0A 2K9NA 2E2JJ 2JA7J 1B72A 3S16J 3IV5A 2ID6A 1F36A 2LVSA 1S7EA 1QPIA 2L7MP 2XGDA 1BW6A 3IH4A 4C3JJ 2DTZA 1MBHA 4QTRA 1TWGJ 2MW8A 3E7LA 2XSDC 4JX4A 3BR6A 3ZQCA 2K9SA 5J3LA 5IYBJ 1I3QJ 5M5WJ 3K7AJ 5JLWA 3JRFA 2DA7A 4BKXA 1FTZA 1Y1WJ 2GBYA 4FCYA 1X58A 4RDUA 1MBFA 2M34A 2LK2A 3FKIJ 3JREA 3VPRA 4DW6A 4Y52J 3GTJJ 5FKMA 4C3HJ 5BNGA 1ITYA 1K61A 3HGYA 2EZKA 2MGQA 1MBEA 3HKZN 3G1LA 1P7IA 3TP3A 5K7ZA 2XPUA 2EZIA 3M4OJ 1HOMA 2DA6A 1ETYA 3TEDA 1Z77A 5EGOB 5EG0A 2E2HJ 2NS8A 1FIAA 1MH3A 1YRNA 1GVDA 2K9QA 3GTPJ 1LE8B 1DU0A 5F08A 2CQXA 2FJ1A 3BTJA 4G12A 3L1PA 4JX6A 3QPLA 3MN2A 2L7ZA 2CUEA 2EQRA 3S14J 1D5YA 3ZOBA 2KT0A 4QSHA 2VI6A 2I10A 4GFBA 2NS7A 4M3DA 3OSGA 1XG1A 3ZQIA 2VKEA 1A5JA
chains in the Genus database with same CATH superfamily
3TGNA 1BJZA 1Z6TA 2PG4A 3WU0A 2Y0SA 4F55A 5M5YJ 4P5OA 4EJWA 3FXQA 5GAHJ 2M0MA 2W24A 1TZLA 1IO2A 3NWTA 1QZYA 2FU4A 2DYSH 2MYSA 3S1RJ 1LEAA 1XGNA 1B6AA 4NQWB 2QYOA 5HS8A 5FROA 3S1QJ 3CLOA 2PLYA 3FXRA 1SD5A 2ID3A 1I50J 2QA4I 2R5YB 4UY8I 1W7PD 3BLYA 2LYCA 2NRAC 1IRZA 1IN4A 3OYDA 2COBA 4C30A 3V8JA 1UG0A 1UFMA 1V5GA 1YS6A 2ESNA 2L01A 4Y7NJ 3RQIA 1QO0D 1U0JA 3I59B 2HDWA 4M3EA 2ZMEA 1BA5A 4RM3A 1I5ZA 1IV6A 2D5VA 4FE7A 2FNAA 2FOWA 3HXLA 1Q1HA 4D7NA 2M7BA 1SAXA 4RLFA 4XSZF 4CCLA 4BJTA 1SC7A 5GP9A 3ASNH 3MAJA 2K5CA 3WGGA 2CYYA 5IYCJ 5D5VB 1JJ6C 4A6EA 2VE9A 3CMEI 2XF5A 3TBIA 3J7YJ 2M30A 1LB2A 1SFOJ 3BR0A 2E5NA 1ZGWA 3MEXA 4B48A 2ETHA 3L09A 4JBAA 2E1CA 3DEEA 2PJPA 3L2RA 2XGEA 2VKHA 3ZMUA 1FJLA 4A69C 3V8LA 4IXAA 1XSDA 3WTXC 2LRDA 2HPIA 2R92J 3W2VA 1MNEA 5DUKA 3CCYA 1K78B 3GVAA 2VXDA 1NH3A 4KISA 3ZGKA 4IHYA 5JI6A 3RKXA 3MKLA 4WX9A 1ZARA 3HDDA 2W1OA 2UWMA 1QZZA 5LGTA 3F9KA 4BJ5C 2DPDA 1I3AA 1X1BA 2H1LA 4UB6C 4XOPA 1DDNA 4LIVA 3V8KA 5E3MA 2BXYA 1TNTA 3H0GJ 3K1NA 2C6YA 3WU1B 2M87A 2PJRB 5ICEA 4X0GA 4LGWA 2PQ8A 4PSWA 4RB1A 1HCRA 4IKFA 1ZR4A 3DQVC 2BXZA 4PUSA 2MLGA 1IJWC 3LSKA 1PDNC 3TQNA 3OIPA 3RZDJ 4HG2A 3A1YA 3H3VK 2KJBA 1EH6A 2A68F 2O5RA 2EB7A 2VJ5A 2Y2ZA 4I99C 4JYKA 4YIRX 4UUVA 4A3DJ 5KNLA 5A2QK 4V19K 3I54A 2X51A 3LA3A 3CF2A 4CZCA 1D8KA 2ELKA 2VBWA 2W25A 2FA5A 1OCZH 2OZ6A 1V4RA 3IUOA 2ISYA 4CCOA 2M0CA 3EUKL 4KYWA 2LNBA 2XPVA 3ERED 4XLAA 4IO9F 4ENKA 1XCBA 2L5QA 1G3YA 4AYBN 1IXCA 2V9KA 1YFHA 2L02A 2DBBA 4MNUA 2LTPA 1W36D 2HR3A 3OYIA 2L7KA 2R7ZJ 4X6AJ 2FE3A 3RKWA 1BR2A 3GLXA 4CGZA 2P6TA 3PSIA 3GTKJ 4I02A 2HI3A 1FTTA 5BQTA 4N0BA 4MGRA 2G9WA 1CF7B 5HDGA 1XGSA 5CVIA 3QOEA 2CW8A 4NDLA 5L3FA 3ZMTA 4M6YA 2IRFG 1G4DA 1BIBA 1YW7A 3DBRB 2F4MB 5E3NA 1IDZA 2W57A 4AU7A 2ZXWH 1D5VA 3RCOA 3TOBA 2HOTA 2LOOA 3Q3SA 4XRSA 3K70D 3HGGA 4O3MA 4M3BA 3BQZA 1ZGAA 1EF4A 1W1WE 4CCKA 2QQAA 2XASA 2BHYA 1IC8A 2DFFA 5E8IA 2VQCA 2M9HA 4WXHA 3DLAA 4NB5A 2X85A 2R7QA 3I4MJ 2EIKH 1YQAA 3W2WA 2DAOA 3A0HC 1R5ID 2L9NA 5D6FA 1AU7A 4A0XA 2EZLA 3FBNB 5CPRB 2B63J 3IL2A 3OYFA 5HODA 3LSIA 4A5NA 3UNGC 3Q9SA 1IAWA 2OJED 2Y9YA 4MLOA 4OINF 3VB2A 3D1NI 3F21A 5HLHA 1ETWA 2V7FA 4RGSA 4HBLA 3F0CA 1KQ0A 3HOZJ 3AG2H 3FWEA 3QU3A 3IP4B 5BPIA 2EV5A 1KONA 2JA2A 1GXPA 2EPFA 5J1YA 2DA1A 3CJQB 4HPQA 2BYVE 1UCRA 3AL0C 2PBIA 3QP5A 3TL4X 2JZYA 1WZ2A 3DKYA 3GFMA 1KZHA 3LSGA 3OY9A 3CCLI 2CV1A 4HSTA 2WADA 3DTKA 1YI2I 5J1UA 2CQQA 2I8DA 2M2EA 2JA6J 1RETA 2RNJA 1YITI 1GXQA 1YRNB 4Q48A 5J8CA 3S3NA 5CQGA 3JAMZ 2IS6A 3OR2C 4BEHB 3D5RC 3GEZA 1Z0XA 2CQNA 3L7WA 1LFUP 1VQKI 2PMHA 3ZN1A 2X6WA 3BR5A 3ROUA 2JA8J 4BE2A 2R7WA 2FEZA 2RAEA 3DF8A 1VQ7I 4PJJA 4E70A 2X1CA 4AIJA 1BC7C 3WTYC 2F5VA 4ESJA 2EIMH 3OIOA 4HNVA 5FJ8J 1IGNA 3FXUA 5FKLA 4N4NB 4HF1A 1S8NA 4JP0A 4B1RA 3JCUC 5B1AH 2VJJA 5JVGF 2WTEA 5J47A 1O7FA 2W48A 3FDYA 1MNDA 1XGOA 2ZC2A 4O5VA 4OIPF 3OL4A 3VYUB 2ZKZA 4PK4A 1GT0C 2FUG2 3S1NJ 1T2KA 4A3EJ 4P9UA 1XGMA 4AIDA 1TC3C 1N78A 3OWTA 4NC7A 3A2KA 2IVMA 1UZCA 1OCOH 5FKKA 1MNMC 3LSHA 2O03A 3F22A 3I53A 2DODA 3ZQGA 2ZJQF 2IS1A 1IN8A 3GYHX 2EILH 2J5PA 2RGVA 2XPWA 4XBFA 1REPC 2L4AA 3A03A 2QVOA 1LVAA 2GAUA 2K27A 2L7FP 4ETSA 2PJRA 2KQRA 5M3MJ 3FM5A 2OQGA 4V2GA 2XSJC 3S3OA 1TL8A 1Y39A 3MZYA 4OIQF 1SVLA 1WI3A 3DPUA 3KIOA 4DYRA 4B4CA 1RI7A 1SD4A 1K4SA 2H1KA 4ZYHA 2OUMA 4ZJZA 2ME6A 2KP6A 4PGGA 4XRSG 1BJAA 2OA4A 2QF7A 4MEYF 3V42A 4KT5C 3LNQA 1HBXG 1WVRA 3WTTC 4GGGA 5BOXA 1WQ2A 4BBSJ 2RREA 1IXSB 1I6HJ 4XR6A 4A2UA 2ZXJA 4UHTA 1H88C 1RRJA 1WWXA 3K0LA 3RTRA 3Q5FA 3I56I 3HOTA 3FF5A 1FOWA 5EYRA 1A04A 4PJLA 2IP2A 4F91B 1W5SA 4B3AA 4Y33A 2EZHA 2JWTA 3TDZC 5IP6A 2DMPA 2XAQA 1J09A 2TCTA 2UUZA 1H89C 2HXIA 4ZZDA 4L0ZB 5CVJA 2LF7A 4A12A 1LDDA 2VJIA 2X1EA 1AKHA 1PUFA 3CCQI 4P1WA 4QWQA 1JTXA 2LFBA 2D1VA 4HSRA 4U88A 3F8FA 2XDVA 5IT3A 5GTHC 5JLXA 2AO9A 1GLNA 1O3RA 4RAFA 3BROA 4U87A 5IP9J 3VODA 1B9NA 2KKOA 4E7KA 3GWZA 3HJEA 2I5UA 1FNNA 2JA5J 3NARA 5JHUA 2JVGA 4LG0B 2LLKA 2CRGA 2EFWA 2A3SA 1RZ4A 1FOYA 2IGMA 4HDUA 3HC7A 3UR3C 1W0TA 3S16J 4ZYGA 3H9GA 1B72A 2XAJA 3OS2A 1QPIA 3NEUA 3VEPA 3OIQA 3I3LA 2DTZA 3S32A 2OQRA 4HZFA 3HUGB 5ICCA 1SEUA 1BR4A 1DGWY 1QQIA 3K9TA 4BH9A 5A2QZ 2VQGA 4Y4RA 4G6QA 3BOQA 1I3QJ 3BPVA 5HNHA 3ABMH 1N25A 5ED4A 3H36A 3ZQQA 3K4LA 2E1MB 3QYBA 2KJCA 2Q2EA 2DT7B 2GBYA 3R6SA 1X58A 5J4YA 4S05A 3FZVA 1FOXA 1P4XA 4LK0F 3VPRA 3S3MA 3EYIA 1SAUA 5J4VA 1YHQI 4BDZA 2X4HA 2W84A 1K61A 3QU6A 3BY6A 1MD0A 4OOIA 2CQKA 4QLCU 2HU9A 4NQWA 2BE5F 2K3FA 2EINH 2EFQA 4CUGA 3G71I 2XPUA 3BDDA 1HOMA 1FYKA 5LEKA 2E2HJ 2NS8A 3EDPA 3J7AO 1TP4A 2HKOA 1J0RA 2UZKA 1GVDA 3V7CA 3E5UA 3GTPJ 3ERMA 1DU0A 2XIGA 3BTJA 3L1PA 3BC8A 3QPLA 1USTA 3KP3A 1HSTA 4M71A 3ZOBA 3CTAA 3CCEI 2ZJRF 2D45A 2CH0A 3I55I 3R61A 5DYMA 3K70C 1H9TA 1A31A 3DLLF 1FT9A 2ZFWA 5DCMA 1E3PA 2E1NA 2R7VA 2VC1A 3ZQIA 2EFPA 2LC2A 3W3CA 3HPGA 2WA0A 3ECHA 5K5OA 5HS7A 2DFHA 2X6YA 3HOUJ 2NVUB 3TKYA 2E1MC 3T5XA 1Z3YA 2PMUA 3BG7A 4H4KC 2MABA 1X3ZB 1IV8A 4OMZA 2BY3A 2P5VA 5JHFA 1HDDC 2KIFA 1OPCA 1X3UA 3Q0VA 1OCPA 1VNDA 2H27A 4B43A 1XN7A 2RV8A 3B02A 3HSRA 1QU3A 3CCVI 2E35A 1CF7A 2GOXB 4XQFA 1AWCA 3ZR8X 4DIQA 3FHNA 4ESFA 2M8EA 2STWA 1J5YA 4I2OA 2PEXA 3SXYA 3DU5A 3ABKH 1IG7A 5FKOA 4HX8A 3QP6A 2A61A 3CJNA 2JRTA 1NTCA 5ILVA 1BM9A 2XGCA 2RVCA 2E60A 4EJTA 1V3FA 2MLKA 2YUSA 1ZR2A 1GVJA 4EGZA 3O8HA 2EWNA 2J5OA 4EM0B 1ETKA 4DYCA 3OYCA 1TNSA 3CCJI 2GXBA 1RR7A 2CG4A 3PQKA 1FMWA 2GOMA 4LMYA 2K4BA 5LGUA 1WGXA 3DPTA 2UXNA 2F6CA 4HQMA 2IW5A 3P9IA 2ZJPF 5EG0B 1DGRM 4BHPA 3SEQA 4LFUA 2MA3A 2QM3A 4G8XA 4G9YA 3ZRGA 2ZFUA 1P92A 2PFBA 3DV8A 3E6CC 2HVSA 5HLGA 4B44A 2JN6A 3LL7A 2IGKA 3O6BB 4XN3A 3KEYA 3CCRI 4NNJA 5EZHA 3CDHA 3E5XA 2EH3A 1O57A 5LBQA 3LAJA 2CV2A 1D0ZA 3K4KA 1W5CC 5CVVA 5BPDA 1YS7A 3LA7A 1XMXA 4A3JJ 3OV8A 3IKVA 3RIRA 2DA4A 2AQFA 3C3WA 1NG7A 4CYCB 1YW9A 5B3SH 3LFKA 1EH7A 5DD4A 4OU0A 4B09A 2HVRA 4HRIA 3L2UA 1F4KA 4D5CA 4CCMA 4M3FA 2BGCA 1WJCA 4BYYA 3JRCA 4KIGA 3JRBA 3M8FA 2MC3A 1HA8A 1T56A 2BVLA 2VQHA 5IPAA 4D1QA 5LLQA 1G3WA 2HTSA 2DT5A 3QQAA 4M9SA 1TT0A 2GA2A 1F43A 1W0UA 2FXAA 4EV0A 5IT9Z 3M1EA 4AM3A 2VLAA 1R22A 1ZG5A 3FKJA 3K69A 1P9QC 5AIPA 1F5TA 1G3TA 1RKWA 1ETVA 1JT6A 2O7OA 3ELKA 4R79A 2F5FA 1B72B 3HIFA 1K4TA 4HNUA 1VQOI 3GFIA 3PM1A 2XHKA 3D0SA 4XLHA 1F9NA 2X6OA 2DDBA 3ZPLA 1HC8A 5EEHA 3KCCA 2LKXA 3PUBA 1SFUA 3U1KA 4NC8A 4HV6A 4XRMA 4A3FJ 2WC2A 5F1JA 1IDYA 2TDXA 2X48A 3BTIA 4WCGA 1HQCA 2H8WA 3I9V2 5FO5A 1FBQA 4ZDOA 4BGDA 2LF8A 3LAPA 4V2FA 3FIWA 5KK1A 3IRRA 1GUUA 2HZDA 5CQEA 2XF7A 1RNLA 1VZ0A 2BW3A 4C3IJ 3LSMA 1VFCA 2LG4A 1TWCJ 1OMIA 4IRHA 1JGSA 2XKPA 3L00A 4D0PA 2EJRA 3SYTA 5D5WB 3PSFA 2DU9A 3JRAA 2A05A 3PNTA 1HSJA 4ZDLA 4CZZA 3BJ6A 3P5JA 3JRDA 3B6AA 1J7KA 4RGXA 3JRGA 2EFOA 3C7JA 2KIMA 1KQ8A 1Z91A 3F72A 1BBYA 1BW5A 2YR2A 2IEKA 3KEQA 3L2WA 4J19A 5IYDJ 1ZRFA 4HF0A 4EGYA 1SVMA 1XSXA 3N05A 5GAEJ 1T0FA 3A01A 1K6YA 2RQPA 2Y0SN 2QLZA 4U7DA 4BQAA 1XB4A 1BOAA 5DCFA 1HXDA 4XKCA 5KAFC 1OJLA 2E2IJ 3VYRB 2DCEA 2PMZN 2KZGA 3ML6A 4KA4A 1BL0A 2DOFA 4ZYDA 2ZCWA 1TWFJ 4EJVA 4L9NA 1B9MA 1SMTA 3CUOA 4PFPA 3I4NJ 1VQ9I 1ETXA 2P81A 4XLNF 4IOCF 4HOBA 3SFIA 3CUQA 2NYXA 2QBYB 3CLQA 3HBLA 4PJ0C 2QKLB 4BHCA 1UG2A 3H3ZA 1YJNI 4U0WA 1NK3P 3ESWB 1XMAA 1X1CA 5E3LA 1HF0A 2RNGA 2Y30A 3TO7A 1ERDA 4FHTA 2NXNB 4PJNA 5DUIA 3LSPA 1LDJA 3QWLA 2TRTA 3IRQA 3L2CA 1Y8RB 3VDXA 1JTYA 2FNPA 3L2VA 4J00A 4MO7A 3H9QA 3HZJA 1ZLKA 5ILSA 4HLXA 1SFXA 3HL2A 4M3GA 3F6OA 5FRNA 4XICA 3E6DA 1AHDP 1ZYRF 3PFIA 2F4IA 3DBHB 3IH2A 2FSWA 3I64A 3F8BA 2LMDA 1N77A 4LK1F 4FASD 3GZ6A 1D3YA 5E18F 1OFCX 5IOZA 2ZB9A 3GXOA 2F5CA 3PJRA 1XSVA 5C3EJ 4DNCA 2CU7A 3ZQFA 1GV2A 1MMDA 2NAZA 2CS3A 2VL8A 5F6FA 1Z1DA 3E6BA 1SANA 2MH9A 1JGGA 3KZZA 2ACJA 4RA2A 2M45A 1E3OC 1UMQA 3DPLC 4C2UA 1OCRH 1RESA 4IEJA 2QCOA 2LD5A 3MKYB 2H8RA 4XKVA 1R9TJ 1ON1A 2BBYA 4I09A 1JHHA 3VFZA 4UXNA 2QENA 3HHHA 3WGHA 1DP7P 4E6KG 3ZMSA 1WPKA 3ONQA 2EV6A 4FE4A 2A6HF 4M74A 4U0YA 1S7AA 2EK5A 4UUTA 3CDLA 2R5ZA 2OD5A 2EFNA 2BZTA 4YELA 2VC0A 3BR1A 5H6RA 1S3JA 5HDKA 1R5GA 1E17A 1R71A 4EJOA 4AIHA 2Z99A 1ZGJA 2HXOA 2Q1ZB 2QQ8A 5F27A 2NOGA 2E19A 5KHDA 2A5YB 5D4RA 1IF1A 4XRFA 4RMNA 2CUFA 4BXFA 3ECOA 4LG0A 1IUFA 2DA3A 5E1XA 1P7JA 3AG4H 1FC3A 1S29A 3K2AA 2P7VB 3HSFA 1NG6A 2L9VA 4A6DA 4MQVA 3H0DA 2GIVA 5F04A 4IHSA 1T39A 1OKRA 3QOPA 1VI0A 4QIWN 2KDZA 4W1UA 2DDAA 2Z3YA 4HNTA 2D2WA 2IS4A 2VN2A 4YIFA 1KU2A 5L3DA 2NNNA 2A07F 4K2EA 1WJFA 4DBRA 4BXUA 2V1UA 3CD6I 2JT1A 4EM1A 3GFLA 2FBHA 2QGUA 1Z21A 5TISC 4A3GJ 2V9VA 3I71A 3U9GA 3JAMK 3TW7A 5M3FJ 3M8EA 1ZAOA 5B1BH 3GF2A 2OC6A 3FXKA 2MC4A 4XIDA 3W6VA 2LREA 4A3BJ 5FLXK 1EA3A 4XORA 1VQ6I 4HX7A 1IW7F 1YX3A 4KN7X 1XX5A 1W5TA 1OYYA 1WKMA 3TOAA 3DFGA 3HKZA 3ABLH 3GTMJ 1XMKA 3NWSA 2CGPA 1WH5A 2OU2A 4IPAA 3ZMZA 2L3DA 3CO6C 3ZQLA 3JW4A 4IHWA 4YEJA 1MIJA 3CP2A 4CH7A 5FLVA 5E1WA 1S5LC 4EMSA 2K9NA 1MDMA 1YIJI 4RAYA 3BPXA 3IV5A 2LKPA 5DM7F 2L7MP 2XGDA 4CA0A 2JTVA 2YU3A 3IH4A 4C3JJ 1MBHA 4EM2A 4IX7A 5D8KB 2XSDC 2CUZA 2BY0A 3K10A 2QQBA 5M5WJ 2VBYA 5JLWA 5HLTA 2M5WA 3BJOA 4ZZLA 4E7JA 2XAUA 4BKXA 2YX7A 1T8IA 3IAM2 3ZCOA 2XV4S 4G6DA 4FCYA 1S9HA 2IA2A 1RIOH 4RDUA 1K6OA 1PVEA 2L9SA 4RB0A 2JRMA 3FKIJ 3JREA 1SFKA 2BOLA 2IGNA 2ZSIB 4UNOA 4Y52J 3GTJJ 1A35A 5LEJA 1MMGA 2QSGX 1SMYF 4P9FA 3F8MA 4NUBA 3PNVA 2QQ9A 3HGYA 5D6EA 4YFXF 1IN7A 3RPUA 3FXMA 4XLFA 3W6KB 2RC4A 4PZJA 5FLXZ 3T1BA 2IPQX 2DQLA 3SHFA 2EZIA 2Z5UA 1XD7A 1ETYA 3TEDA 5EGOB 1MGTA 2M7AA 1MJAA 1FSEA 4RGUA 5L3CA 1YLFA 2OCEA 1MH3A 3F8CA 1U5TA 1JHFA 4N4OB 3HTUA 1UHWA 1LE8B 3K4MA 4IRIA 3TMOA 4ENMA 1VQNI 3MN2A 2L7ZA 2P5KA 2CUEA 2CSOA 4RAZA 3RSNA 3S14J 2WY8Q 2KT0A 4H0EA 3KP4A 3X2QH 4U7BA 3NQOA 4M3DA 3EPZA 2GZWA 2DYRH 1X1AA 1Y0UA 2Q2EB 5HS9A 3L2QA 1LUJB 2XAHA 3BZ6A 3AG1H 2Q8KA 4CSWA 1IN6A 3VSLA 1LEBA 1A5JA 3R4KA 3S17J 1XCVA 4HA8A 1H0MA 3ZMDA 1ACIA 2V1NA 5F64A 4IL6C 2F4OB 2IBDA 2GXAA 3GLLA 2HOEA 3RI4A 3HRUA 4C2MJ 4ZYEA 4I76A 3FXJA 4HW0A 2V6EA 5GPCA 4RB2C 3JTGA 5FFXA 1FPQA 1CQTA 2Y69H 1O7LA 4IRGA 1DU6A 4KIBA 4YFKF 3K4JA 1Z9CA 4L9TA 1ENHA 1R23A 1WHUA 2AXLA 1KYZA 4NHJA 2WV0A 3WE3A 5LFAA 5B5EC 2JPCA 2WAQA 3PUFA 2MH2A 2VASA 4G94A 2MSYA 4UUSB 2GM4A 1AOYA 4WF2A 3F6VA 2EA2A 3M9AA 4RGRA 1R1UA 2FQ4A 2OTJI 1WSUA 3LSTA 2VPRA 4UV9A 1FBSA 3JRHA 3QPTA 4AC0A 3N4MA 2HPMA 3HOVJ 5ICFA 5EZGA 2JSCA 2BY1A 3KLOA 3A4CA 2Y75A 2NNYA 1V55H 2RKHA 1YO5C 2E1OA 2O9LA 1T98A 3RPQA 2R93J 1TQIA 3WTSC 1XC5A 2VT2A 3EQLF 4DGWB 1G3SA 2ECBA 2ME0A 4WXCA 2W85A 1Y0NA 4XK4A 1A6QA 2LY9A 5M5XJ 1ORKA 1O4XA 2Z9OA 2A5WA 2AQEA 3COAC 5B66C 1WFXA 2EV0A 4XLPF 1K79A 1TT5B 2K9LA 4MTDA 1FWZA 1W36C 2O8KA 4BQOA 3KPHA 2HKXA 2GWRA 1Y8QB 1HW2A 2FD5A 1VQMI 5TGTA 4MFEA 3AAFA 2NVQJ 1KU9A 3R0JA 4TV7A 1IZ1A 2XVCA 1EKEA 4GRIA 1ULYA 1ETQA 1MMNA 3G1OA 4C2TA 2A6TA 3MKWB 2LR8A 4OAYA 3E1SA 4OMYA 4ON0A 3O8GA 4ZYAA 3A01B 4BY1J 3SZGA 1RKTA 3CC7I 2CWEA 3HRSA 2KHMA 3J80K 2DMQA 3QRFF 1U9OA 3C1DA 4FISA 1A36A 1MSEC 1I1GA 3H5NA 2RQQA 3JR9A 1B4AA 2KL4A 4X1EA 2ESHA 2DXIA 2RDPA 2LKSA 2DOEA 3ABUA 1WRJA 2O61A 1EJ9A 3LWFA 1BOBA 1V54H 1SFEA 2JPBA 5FLMJ 3FK7A 1F1ZA 1W7PB 2V6CA 5KCMA 3R0AA 1OR7A 1YIOA 3FXLA 4A3CJ 1VQ5I 3MWMA 1UHMA 1K7AA 1OCTC 3SEZA 4L5JA 3E5QA 2VOPA 3I58A 5E8GA 4LB6B 3KZYA 2K86A 3BZCA 2NVXJ 2DOAA 5HVQC 2HYFA 1U8RA 4I6ZA 3K1MA 4MIMA 1Z7UA 2K02A 3WHBA 4HLYA 3MVPA 1QRYA 4PJMA 2OPTA 3SQNA 3VWBA 1S7OA 2E5ZA 2HQAA 3U21A 2Z16A 4ESBA 2R3SA 6PAXA 2VPLA 1J9IA 1POGA 1BN5A 3CUQB 3REOA 3ABTA 4LG3A 2B7EA 1NHAA 5HDNA 3S2HJ 1LQ1A 3HB9A 5FD5A 4A3IJ 4AVPA 2E36A 1ETOA 3HEFA 5LRRA 5EEAA 2N8GA 3PFYA 2O8XA 1G6NA 3TP0A 2NOJB 5EF6A 1WH7A 1TQMA 1RUOA 1ZG3A 3H5AA 2HQRA 3H9JA 5J40A 3LQRA 2XUBA 4BS9A 1B1BA 1Y6IA 3M1CA 2BV6A 1N75A 2EBIA 4RLQA 3CCUI 3ZQHA 3U1DA 3BG9A 5JFRA 2Z33A 4KICA 2NS0A 2QSFX 1DPRA 2XB0X 4BDYA 3OOUA 1ZHFA 5GPAA 3ZMVA 3NRVA 2KLOA 3EUAA 3P9KA 1TTYA 3VSKA 2M3AA 3E3VA 2PX9A 3KLNA 4PCQA 3CMYA 3DTIA 4E7LA 4CXFA 4RB3C 2OTLI 1WCMJ 2YU9J 3FHZA 1U5TC 2UXXA 2BW3B 2O6GE 5F0FA 4N9IA 1D1AA 4I01A 1UB9A 2ADUA 4MFDA 2CJJA 3CQZJ 4CYCA 1HLVA 5LRSA 5C4JJ 2QWWA 4G7HF 4OIOF 3A02A 2KZVA 2DJNA 1X19A 2ELHA 2FRHA 2Z1DA 1Y56A 2ZNYA 3PIOF 1R58A 2WV1A 2VIXA 5C4XJ 4RS8A 4MTEA 1RPWA 3LA2A 3OYLA 4KDPA 1ZELA 3TDUC 4XSXF 1U6GA 3PNYA 3CJRB 2VODA 2DN0A 3JTHA 4HEA2 3SJMA 5E79C 5IP7J 3SZTA 2Y31A 2R5ZB 5H20A 4QPOA 4LITA 2Y48A 5D5XB 5BMZA 2PMZA 4A5MA 3DCFA 2R7DA 1OYWA 5DD8A 4OIRF 3KZIC 5H6QA 4DZJA 3LQQA 2VKVA 1D0XA 2CW0F 1LVKA 1YW8A 3WTWC 3LSJA 4JOMA 3HOWJ 2O3FA 4ZC3A 2BY2A 5AIQA 1VQLI 4F93B 4LLNA 5ICGA 3K2ZA 3KYCB 1ZKGA 5AONA 3J7ZI 4KITB 2IJLA 2X9DA 3QYEA 4ENJA 1Z67A 2V1XA 3FK6A 3G1MA 1JUPA 4R8HA 1D0YA 1CGPA 1J75A 5LHHA 1JKPC 4I98B 1WJAA 3RYRA 4LJZF 4S04A 1SD6A 1K78A 2R4GA 4IHTA 2OV7A 2M8GX 2MBFA 3HHGA 3TO9A 4CCNA 4G7ZF 4AUXA 3HTSB 4E7IA 3MD2A 3IKTA 4A0ZA 2W00A 1Y1VJ 2XGXA 4UV8A 3P9CA 4S0HB 2STTA 4LD5A 3LSRA 1I27A 4HQEA 3FMRA 4RM2A 1YTYA 2KRHA 4XOTA 4BU2A 2E34A 3K1PA 3NAUA 3ASOH 4GXOA 3GUDA 1WI9A 5BS6A 3RDIA 1FYMA 1AA7A 2ZJ2A 5L3EA 5IY5H 1ZG1A 1Z05A 2WB1A 5EEGA 3S8PA 1QBJA 4G6TB 4IF4A 2VBXA 2F5DA 4U0VA 1JUSA 3MZ8A 1VQ8I 1MKMA 9ANTA 1EV7A 1JKOC 3J80Z 1MZBA 2BVMA 2ICWG 2JUCA 3I0TA 4A3KJ 1Z6RA 5HLIA 5E3OA 1QHHD 3Q0WA 3OYKA 3MFKA 1ZH5A 2GXGA 2R7UA 4QPQA 1XS9A 2HQNA 3H1CA 4IJAA 1O3SA 1T33A 1STZA 1U8BA 4D7MA 4BQQA 1ODDA 3BTLA 1WJEA 5TJJA 3OSFA 2R7OA 3H3UA 3KETA 1HKTA 2BHZA 4F7ZA 1O3TA 4Z2YA 1V5EA 1NK2P 1P2FA 1ZLJA 2X1DA 2VBZA 3CESA 1Z7LA 3LMMA 1FOKA 3S2DJ 2O0YA 3KEOA 3N97A 4E4HA 4IHVA 1OCCH 1USSA 2JK3A 3MMYB 1ON2A 5DEQA 3VYTB 3KYLA 1S72I 2GIZA 3AKZA 1TWHJ 3F8NA 1WJDA 2HQ5A 2DFEA 2IA0A 2RN7A 3OYHA 3V4GA 2V9PA 3CP8A 3CZ6A 5FB2A 4DOZA 1QVTA 2CUJA 3GZ5A 3ISPA 5LHIA 1VF9A 4ABZA 2DI3A 3RKQA 4ZDPA 3WTUC 1T6SA 1HW1A 1LNWA 5EDNA 2E2JJ 3KX2A 4KMUX 2LVSA 3IHUA 2K9MA 1BW6A 3DWLE 2Y0MA 3RYPA 5GADJ 1TWGJ 1BI0A 2MW8A 3E7LA 3ULQB 3B73A 2XROA 1D8JA 2JQ7A 4XN0A 3BR6A 3ZQCA 5GTIC 2K9SA 5IYBJ 3C18A 1L0OC 5F1RA 3K7AJ 1D1CA 3IWFA 2OZUA 3O2PE 1TW2A 1X1PA 1KU3A 1E2XA 1DQUA 3DP7A 3FX3A 2LK2A 2MFZA 3MQ0A 4XKWA 4BQNA 3J81Z 4DW6A 4MEXF 5LGNA 3HSEA 5BNGA 4AYBA 1ITYA 2MD5A 2DQRA 1W4MA 3QODA 4YFNF 3HKZN 3G1LA 4Q47A 1RR8C 2DTRA 3CO7C 4M73A 1P7IA 3TP3A 3M4OJ 1T95A 2DA6A 1Z77A 2DT6A 1YG2A 3E6MA 2Z2SB 1R5HA 2IA1A 2IT0A 1QZEA 3M07A 1FIAA 1YRNA 3CUQC 5K1YA 1DP3A 1J59A 1BI1A 1R1TA 1YX5A 4ITVA 1IRGA 1D5YA 2VONA 2HYGD 4QSHA 1HW5A 2I10A 2F5EA 1XDUA 2NS7A 2B0LA 2L4MA 3OSGA 5CJ9A 5CKTA 4Q5SF 3SDBA 1IUYA 4KMFA 4J01A 4AVZA 3DXJF 1YJ9I 1BC8C 4L0YB 4GYIA 2VJ4A 3FXOA 2MD0A 1U9NA 4ZH4F 2CW7A 3QAHA 2WAEA 3WTZA 4XMYA 1ONVA 4WK8F 2QBYA 3PO3J 2DK8A 4O6JA 3OYNA 1HKSA 3CC2I 2W4SA 1U78A 1QVUA 1JI8A 4Y3OA 3BCBA 3BT9A 1U3EM 1RUNA 2KIQA 1OYIA 4R1HA 4XKBA 3C2HA 4FQGA 3WTVC 1A6IA 1LPQA 2XB5A 4LB5A 3GZNB 4WXDA 4L9VA 2NVTJ 2V26A 2VT3A 2R7FA 2LBFB 3BG3A 1SVOA 1IN5A 1YJWI 2ZSHB 1ZK8A 1B8IA 4PDKA 4PGHA 2XRNA 3RZOJ 5CYVA 5GAGJ 1R00A 4UVAA 3CC4I 2QUFA 3JSPA 3HOYJ 2L54A 3SDGA 3G3ZA 2WB1N 1HKQA 1OISA 3DBLB 3R60A 3OYGA 5DDGA 4HV5A 4EVIA 2B9SA 2YX4A 1LDKB 3S2WA 2H09A 1PP8F 1X2MA 2HVQA 3BZKA 3FMSA 3CCMI 1LFBA 2L2OA 3DEUA 2EA4A 3DKWA 1LJ9A 3KFWX 5EJCA 3WG9A 3J81K 4CHUA 4F92B 4P55A 4BE1A 1UELB 2H94A 2WWYA 3H35A 1YE9A 1LFPA 3K4BA 4HF2A 2FBIA 4HX4A 5JR3A 1FY7A 4IZZA 5HNFA 2HOSA 1G8XA 4BY7J 2R0QC 1X3WB 5J8FA 1MSFC 3GFJA 3EYYA 2IXSA 2IS2A 1DPUA 2KISA 2ZBKA 4ANJA 5D4SA 1FLIA 3GMEA 4KJZA 4KT6A 2NVYJ 5CVRA 2E71A 1R4NB 1X4OA 3BCAA 5DTDA 2WAQN 1PUFB 2OF7A 4B3XA 4NC6A 4D5FA 1JT0A 4PSXA 4F52A 2V4JC 2XF6A 4XM3A 2A6EF 5EGOA 3CF5F 3OS1A 2KRFA 1V5FA 1MH4A 4IQ4A 5KVRA 1U5TB 2V79A 5F0CA 2CFOA 2IAIA 3LFUA 4G7OF 3GTOJ 3RKYA 1X4PA 1QA6A 4XNFA 1Q1VA 5TRDA 1XDSA 1R1VA 3K4NA 2G7UA 2OAZA 2PI0A 1FEXA 3CDIA 3EETA 2YSRA 3KP2A 4IHXA 3F3XA 1P4WA 3EUHC 1PUEE 2K7LA 1JXSA 4BE0A 2MG4A 4PFOA 3V7RA 2R5YA 4BEHA 2LP0A 2AHQA 2VE8A 3CCSI 1FIPA 1VQPI 2FMYA 3OYAA 3K6GA 5FRMA 3I59A 3CMAI 3T8TA 2DJIA 4BNCA 2PN6A 1APLC 3GW2A 2HZTA 1FBUA 2DO7A 3G6EI 2CMPA 4A3MJ 4M9ZA 4AWXB 2V1DA 4HDVA 4ZTJA 2DPUA 3OYJA 3HYIA 3HOSA 4LLGF 1QHGA 1BIAA 3D5LA 1R36A 1GHCA 4UUSA 3GCMA 3VYSB 4DQ2A 2OBPA 1ZQ3P 5LD2C 2QKMB 2CFXA 3JSOA 3I5UA 1PYVA 4LIUA 2ZMEB 2HYJA 1MJBA 2DFIA 3BR3A 1TWAJ 2WY7Q 5F0HA 3OR1C 2JVHA 2KPMA 3PIPF 3PQJA 1SD7A 3G2BA 3EUHA 2W82A 3BR2A 4JX5A 1ZREA 3JRIA 2VQLA 3J7AY 3CMMA 3H5RA 4M72A 4A93J 3FM3A 1T38A 2ZNZA 5DS9A 2CV0A 3S1MJ 2DLLA 2K4JA 2L9RA 3FBIB 1MDMB 2H6CA 2OCCH 1VQ4I 5K7FA 4I0BA 1X2NA 1Z3XA 1KGSA 4EJUA 5FFZA 3Q0UA 5DCMB 1OLTA 1FP1D 1FSHA 2HWVA 2HOAA 3T8RA 1ZN2A 2K3PA 3RJPA 2Y9ZA 3TW6A 2P5LC 4XLCA 1W7PA 3A0BC 4EEFG 4FX4A 2YS9A 2G7HA 1YYVA 2GLOA 2F2EA 4UVBA 4F3QA 2ISZA 1MW7A 3ZN0A 2ZO4A 2M4KA 1HDPA 2KRCA 2D1HA 2H6BA 2ECCA 4E7SA 2JSPA 4II3A 3W2AA 1KU7A 2GA1A 3S15J 4Q4ZF 2FOKA 4BBRJ 2LY1A 4HAMA 1GDTA 3BQYA 1WJ5A 3WE2A 2HDCA 4MQ9F 4IQJA 1X1DA 3E0JB 5D8LB 3KP5A 2ZMEC 3IWZA 3LOCA 4BXXJ 2K40A 4RBOA 2R7XA 2DA5A 3P7NA 3O3KA 1KYWA 4WWCA 2AS5F 4L5EA 4FETA 5J6XA 5D5UB 4A3LJ 1JKRC 2XAGA 1OR7C 3BJAA 3L9FA 2P7CB 2GQQA 2KDOA 3GX4X 4C9YA 5J1RA 3WGIA 1B59A 4DBQA 2FF4A 1LE8A 3GTQJ 3E97A 3DTEA 3PO2J 1FP2A 2VXZA 2DMTA 3BWGA 3OL3A 5JVTA 3M3YJ 5H2FC 2FBKA 1UJ8A 3FISA 2QZ8A 1MMAA 4FT8A 3HRTA 4XL9A 4Y13A 2KFDA 2CO5A 3I4PA 4RAGA 1QPMA 4KFCA 1ZTRA 5IOYA 4XLEA 5KAIC 4UVCA 3IAS2 3IH3A 3W6JB 1GV5A 1JUMA 3T0YA 4IOAF 2KMUA 3WHCA 4YG2F 1JKQC 1G2HA 5FKNA 2UV1A 2HFHA 3HOXJ 1P6RA 1K83J 2LY2A 3QYFA 5K5QA 2DMNA 5L3GA 4CDGA 2HTJA 4JK1X 2HDDA 1MMSA 3WG7H 3AL0B 4N9HA 2R7SA 2XKOA 3BG5A 3C2BA 3V7SA 4Z6YA 1E3HA 4GO1A 1G59A 3KP6A 1E0EA 1H8AC 1O3QA 3HG9A 5K7HA 3DU6A 4DYQA 3GBGA 4DZPA 4L5IA 4FTHA 1IRFA 3WU2C 4P96A 5LHGA 2XAFA 2COMA 1AKHB 2WBMA 2M1BA 2M4GA 3OYEA 4E7ZA 2G0EA 2DA2A 4YIIA 4UB8C 3K4CA 4D9JA 4FX0A 1I6XA 3SZPA 3BTCA 3RPUD 3GTLJ 2DK5A 2KIUA 3PL8A 4Y15A 4BAYA 4XONA 2EIJH 3RQ4A 3MZHA 1FYLA 4IVNA 2R7TA 2HGCA 1MBGA 1T0FC 2VB6A 1OQYA 2WAFA 4I7HA 1VTNC 3HM5A 3DEWA 3CJTB 1XPXA 5K5RA 2JMWA 3B6CA 4L18B 2P0WA 1EH8A 4GCVA 2YPRA 3OMYA 2CQ7A 2LH9A 3UKGA 1H9GA 1MBKA 4Y17A 3TO6A 2VUMJ 2Q0OA 4ENNA 4B47A 2L0KA 1JJ8C 5CVUA 3OYBA 1BI3A 3HUGA 2X0LA 2QSHX 5IT9K 2VKDA 2XC7A 1C0WA 2FQ3A 3MCZA 4BACA 4NBQA 4W97A 2F48A 3M7GA 3QPSA 4HYEA 5FGMA 2DW4A 5E17F 1PJRA 4LOCA 2XRLA 1UHSA 4E7HA 4DJAA 1IRXA 3SFZA 4KUMA 3Q9VA 3VOEA 4KN4X 3QPHA 3HPHA 4CICA 1MBJA 4I0AA 3D5SC 1T08B 3DKXA 2P4WA 1FMVA 4M6VA 2JJ7A 4BL0B 3GO5A 4JQFA 2P6SA 3G73A 5DM6F 1TW3A 1WJBA 1LKXA 4GYGA 2BEOA 3GTGJ 5CLSA 4KIFA 5C44J 1B8IB 4M9XA 3KP7A 3ZP5A 2DMUA 2E7XA 1FZPB 2LSOA 4II2A 2VOOA 3ZQ7A 2HNHA 1TLHB 3IC7A 5E20A 3AFHA 2FX0A 4OAZA 2JA7J 2ID6A 1F36A 4A0YA 1S7EA 1BI2A 4BJ6C 1PP7U 1FX7A 1YOVB 5FD6A 5ILUA 4EATA 4QTRA 1I1SA 2LDUA 4JX4A 2R7RA 5J3LA 5HOOA 4AD9A 3AG3H 4L9JA 4B8XA 1ZRDA 3JRFA 2AXTC 2DA7A 2LBFA 1IXRC 4EQQA 4BUPA 1FTZA 1Y1WJ 3ZXSA 2HEOA 4CCJA 2W7NA 1MBFA 2M34A 3BG6A 2ZXHA 4GDFA 3WODF 4YRVA 1R7JA 4OWRB 4KNYA 5FKMA 1KQ9A 3HRMA 1S6LA 3S93A 3U2RA 4C3HJ 1JE8A 1ZRCA 1TBXA 1R6RA 4CYDA 4M6XA 2IGOA 2P8TA 1UAAA 2EZKA 1I39A 2MGQA 1MBEA 4ASNA 2HS5A 1D1BA 1QNTA 5E1ZB 1P4AA 1J2XA 5K7ZA 2ZXIA 3KYDB 4AIKA 2JUGA 3FMQA 1R4MB 5EG0A 2E7WA 1QGPA 1BR1A 3C2GA 1R49A 2K9QA 3M8JA 3OOPA 5DV5A 5ERIA 2CQXA 2FJ1A 4G12A 5F08A 4JX6A 1DUXC 3KE2A 3BP8A 1RC9A 2ELJA 2EQRA 1MJ9A 3OS0A 3MKZA 1U2WA 1XTAA 4CO8A 1L3LA 2A69F 1M1EB 2VI6A 4GFBA 3F23A 2QEXI 2X6XA 2FMLA 1TQPA 4LLLA 1XG1A 5L3BA 4ZTFA 1KA8A 2K85A 4BHBA 4MHGA 3G4SI 2VKEA 3OYMA 3H92A
chains in the Genus database with same CATH topology
1U9NA 1BJZA 3S17J 3HOUJ 5M5YJ 2IBDA 3PO3J 4C2MJ 1U78A 1QVUA 4I76A 3BT9A 5GPCA 1HDDC 3S1RJ 1CQTA 3Q0VA 1OCPA 1VNDA 1DU6A 1A6IA 3S1QJ 2XB5A 1ENHA 2NVTJ 2ID3A 1I50J 3BG3A 2R5YB 1IRZA 2COBA 1ZK8A 1B8IA 2MSYA 4UUSB 2GM4A 1IG7A 5FKOA 3RZOJ 4Y7NJ 2FQ4A 3RQIA 3HOYJ 4M3EA 1NTCA 1BA5A 2VPRA 2XGCA 3JRHA 1IV6A 3SDGA 4AC0A 2YUSA 2WB1N 4FE7A 1ZR2A 2D5VA 5EZGA 3HOVJ 3O8HA 4D7NA 1ETKA 4DYCA 2E1OA 2O9LA 1RR7A 2R93J 5GP9A 1X2MA 1XC5A 1LFBA 2ECBA 5IYCJ 2ME0A 1JJ6C 1WGXA 4XK4A 2LY9A 5M5XJ 1SFOJ 3BR0A 1ORKA 5EG0B 1O4XA 1ZGWA 2O8KA 2HOSA 4BY7J 2JN6A 2XGEA 2R0QC 1MSFC 1FJLA 2FD5A 4A69C 5EZHA 4MFEA 2NVQJ 2R92J 2EH3A 2NVYJ 3CCYA 4IHYA 1ETQA 5DTDA 3MKLA 2WAQN 3G1OA 2OF7A 4A3JJ 1PUFB 4D5FA 1JT0A 2LR8A 3HDDA 2DA4A 3O8GA 5EGOA 4CYCB 3A01B 4BY1J 5E3MA 1RKTA 1MH4A 5F0CA 2DMQA 2IAIA 3H0GJ 3GTOJ 1U9OA 4D5CA 4FISA 1HCRA 1ZR4A 1MSEC 4M3FA 1IJWC 1Q1VA 3JRCA 3JR9A 3JRBA 4X1EA 3RZDJ 1T56A 3H3VK 5IPAA 1FEXA 3QQAA 2Y2ZA 4JYKA 4A3DJ 1F43A 5FLMJ 1W0UA 4IHXA 3FK7A 2MG4A 2R5YA 4A3CJ 2ELKA 1OCTC 1RKWA 1ETVA 1JT6A 2O7OA 1B72B 2M0CA 2LP0A 2AHQA 1FIPA 2NVXJ 2XPVA 3PM1A 4I6ZA 2X6OA 4MIMA 4AYBN 3WHBA 2LKXA 3MVPA 1QRYA 1APLC 2LTPA 2OPTA 4XRMA 4A3FJ 5F1JA 1IDYA 2X48A 4A3MJ 2R7ZJ 3BTIA 4X6AJ 3GTKJ 1FTTA 2HI3A 4V2FA 3FIWA 1POGA 1GUUA 4NDLA 3S2HJ 3HB9A 4UUSA 4C3IJ 4A3IJ 1VFCA 1ZQ3P 1TWCJ 5E3NA 1IDZA 1ETOA 3HEFA 5EEAA 2N8GA 2HYJA 3TP0A 2HOTA 5EF6A 1WH7A 3BR3A 3Q3SA 1TWAJ 5F0HA 3JRAA 3JRDA 4XRSA 3HGGA 3BR2A 4JX5A 3B6AA 3JRIA 4M3BA 3JRGA 3BQZA 1EF4A 2EBIA 1BW5A 4J19A 2IEKA 3ZQHA 1IC8A 5IYDJ 4A93J 2M9HA 3BG9A 5DS9A 3A01A 2Y0SN 2XB0X 3S1MJ 2L9RA 3OOUA 5GPAA 3I4MJ 5K7FA 1OJLA 1X2NA 2E2IJ 2PMZN 3CMYA 1AU7A 2EZLA 1BL0A 2B63J 3Q0UA 2HOAA 5HODA 1TWFJ 1WCMJ 2YU9J 3I4NJ 1ETXA 2P81A 2Y9ZA 3TW6A 4MLOA 2Y9YA 3D1NI 3SFIA 1ETWA 4EEFG 3HBLA 3F0CA 2YS9A 5F0FA 2GLOA 1UG2A 3HOZJ 4MFDA 2CJJA 3CQZJ 1HDPA 1NK3P 4CYCA 2ECCA 1HLVA 5C4JJ 5E3LA 1HF0A 5J1YA 2Y30A 3A02A 2DA1A 3S15J 2DJNA 4BBRJ 1GDTA 3BQYA 2WV1A 3LSPA 5C4XJ 1RPWA 2TRTA 3LOCA 4BXXJ 2K40A 4RBOA 2DN0A 2DA5A 3LSGA 4L5EA 1JTYA 5J1UA 4MO7A 1JKRC 2CQQA 2JA6J 2M2EA 4A3LJ 1RETA 4M3GA 1YRNB 3SJMA 5J1RA 5IP7J 4XICA 1AHDP 2Y31A 2R5ZB 1LE8A 3GTQJ 3IH2A 1Z0XA 3DCFA 3PO2J 4DZJA 2DMTA 2VKVA 1LFUP 1OFCX 5IOZA 3M3YJ 3BR5A 2ZB9A 3FISA 2JA8J 2RAEA 3LSJA 3HOWJ 5C3EJ 1ZTRA 5IOYA 2CU7A 3ZQFA 3IH3A 1GV2A 1GV5A 3OIOA 4HNVA 5FJ8J 1IGNA 1JUMA 1ZKGA 5FKLA 4JP0A 3WHCA 2X9DA 1SANA 1JKQC 1G2HA 4B1RA 5FKNA 3HOXJ 1JGGA 1K83J 3FK6A 2W48A 1JUPA 3G1MA 2DMNA 2HDDA 1E3OC 1UMQA 1GT0C 1JKPC 3BG5A 3C2BA 1RESA 4IEJA 2QCOA 2LD5A 3S1NJ 2H8RA 1H8AC 4A3EJ 1R9TJ 1TC3C 5K7HA 4DYQA 3GBGA 2M8GX 1MNMC 5FKKA 4DZPA 4FTHA 1WPKA 3ZQGA 4AUXA 4FE4A 1Y1VJ 2XPWA 4S0HB 4UUTA 3CDLA 2R5ZA 1AKHB 3A03A 3LSRA 2G0EA 2DA2A 3BR1A 2L7FP 5M3MJ 4V2GA 3NAUA 3BTCA 3GTLJ 1WI3A 2H1KA 4DYRA 4B4CA 2HXOA 5F27A 2ME6A 4XRSG 2NOGA 2E19A 2QF7A 1MBGA 3LNQA 4BBSJ 1JUSA 2CUFA 3HM5A 3DEWA 1I6HJ 2JMWA 3B6CA 9ANTA 1JKOC 1H88C 1IUFA 2DA3A 1P7JA 4A3KJ 5E3OA 3Q0WA 3K2AA 5EYRA 3UKGA 1MBKA 5F04A 1XS9A 2VUMJ 4B3AA 2EZHA 1VI0A 4QIWN 1T33A 2JWTA 4W1UA 2KDZA 2L0KA 1U8BA 1JJ8C 5IP6A 2DMPA 4D7MA 3BTLA 2TCTA 1H89C 3OSFA 4W97A 2HXIA 3QPSA 1NK2P 1AKHA 4A3GJ 1PUFA 4LOCA 2XRLA 1UHSA 3TW7A 5M3FJ 1JTXA 2LFBA 1MBJA 3S2DJ 4XIDA 4M6VA 5JLXA 3W6VA 2JJ7A 4A3BJ 2AO9A 4IHVA 5IP9J 2JK3A 1TWHJ 2HQ5A 2JA5J 3NARA 3GTGJ 3GTMJ 5C44J 2LLKA 1WH5A 1B8IB 1QVTA 2CRGA 2DMUA 3ZQLA 1VF9A 4ABZA 4IHWA 3RKQA 5FLVA 1W0TA 5EDNA 2FX0A 2K9NA 2E2JJ 2JA7J 1B72A 3S16J 3IV5A 2ID6A 1F36A 2LVSA 1S7EA 1QPIA 2L7MP 2XGDA 1BW6A 3IH4A 4C3JJ 2DTZA 1MBHA 4QTRA 1TWGJ 2MW8A 3E7LA 2XSDC 4JX4A 3BR6A 3ZQCA 2K9SA 5J3LA 5IYBJ 1I3QJ 5M5WJ 3K7AJ 5JLWA 3JRFA 2DA7A 4BKXA 1FTZA 1Y1WJ 2GBYA 4FCYA 1X58A 4RDUA 1MBFA 2M34A 2LK2A 3FKIJ 3JREA 3VPRA 4DW6A 4Y52J 3GTJJ 5FKMA 4C3HJ 5BNGA 1ITYA 1K61A 3HGYA 2EZKA 2MGQA 1MBEA 3HKZN 3G1LA 1P7IA 3TP3A 5K7ZA 2XPUA 2EZIA 3M4OJ 1HOMA 2DA6A 1ETYA 3TEDA 1Z77A 5EGOB 5EG0A 2E2HJ 2NS8A 1FIAA 1MH3A 1YRNA 1GVDA 2K9QA 3GTPJ 1LE8B 1DU0A 5F08A 2CQXA 2FJ1A 3BTJA 4G12A 3L1PA 4JX6A 3QPLA 3MN2A 2L7ZA 2CUEA 2EQRA 3S14J 1D5YA 3ZOBA 2KT0A 4QSHA 2VI6A 2I10A 4GFBA 2NS7A 4M3DA 3OSGA 1XG1A 3ZQIA 2VKEA 1A5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9N A;  1BJZ A;  3S17 J;  3HOU J;  5M5Y J;  2IBD A;  3PO3 J;  4C2M J;  1U78 A;  1QVU A;  4I76 A;  3BT9 A;  5GPC A;  1HDD C;  3S1R J;  1CQT A;  3Q0V A;  1OCP A;  1VND A;  1DU6 A;  1A6I A;  3S1Q J;  2XB5 A;  1ENH A;  2NVT J;  2ID3 A;  1I50 J;  3BG3 A;  2R5Y B;  1IRZ A;  2COB A;  1ZK8 A;  1B8I A;  2MSY A;  4UUS B;  2GM4 A;  1IG7 A;  5FKO A;  3RZO J;  4Y7N J;  2FQ4 A;  3RQI A;  3HOY J;  4M3E A;  1NTC A;  1BA5 A;  2VPR A;  2XGC A;  3JRH A;  1IV6 A;  3SDG A;  4AC0 A;  2YUS A;  2WB1 N;  4FE7 A;  1ZR2 A;  2D5V A;  5EZG A;  3HOV J;  3O8H A;  4D7N A;  1ETK A;  4DYC A;  2E1O A;  2O9L A;  1RR7 A;  2R93 J;  5GP9 A;  1X2M A;  1XC5 A;  1LFB A;  2ECB A;  5IYC J;  2ME0 A;  1JJ6 C;  1WGX A;  4XK4 A;  2LY9 A;  5M5X J;  1SFO J;  3BR0 A;  1ORK A;  5EG0 B;  1O4X A;  1ZGW A;  2O8K A;  2HOS A;  4BY7 J;  2JN6 A;  2XGE A;  2R0Q C;  1MSF C;  1FJL A;  2FD5 A;  4A69 C;  5EZH A;  4MFE A;  2NVQ J;  2R92 J;  2EH3 A;  2NVY J;  3CCY A;  4IHY A;  1ETQ A;  5DTD A;  3MKL A;  2WAQ N;  3G1O A;  2OF7 A;  4A3J J;  1PUF B;  4D5F A;  1JT0 A;  2LR8 A;  3HDD A;  2DA4 A;  3O8G A;  5EGO A;  4CYC B;  3A01 B;  4BY1 J;  5E3M A;  1RKT A;  1MH4 A;  5F0C A;  2DMQ A;  2IAI A;  3H0G J;  3GTO J;  1U9O A;  4D5C A;  4FIS A;  1HCR A;  1ZR4 A;  1MSE C;  4M3F A;  1IJW C;  1Q1V A;  3JRC A;  3JR9 A;  3JRB A;  4X1E A;  3RZD J;  1T56 A;  3H3V K;  5IPA A;  1FEX A;  3QQA A;  2Y2Z A;  4JYK A;  4A3D J;  1F43 A;  5FLM J;  1W0U A;  4IHX A;  3FK7 A;  2MG4 A;  2R5Y A;  4A3C J;  2ELK A;  1OCT C;  1RKW A;  1ETV A;  1JT6 A;  2O7O A;  1B72 B;  2M0C A;  2LP0 A;  2AHQ A;  1FIP A;  2NVX J;  2XPV A;  3PM1 A;  4I6Z A;  2X6O A;  4MIM A;  4AYB N;  3WHB A;  2LKX A;  3MVP A;  1QRY A;  1APL C;  2LTP A;  2OPT A;  4XRM A;  4A3F J;  5F1J A;  1IDY A;  2X48 A;  4A3M J;  2R7Z J;  3BTI A;  4X6A J;  3GTK J;  1FTT A;  2HI3 A;  4V2F A;  3FIW A;  1POG A;  1GUU A;  4NDL A;  3S2H J;  3HB9 A;  4UUS A;  4C3I J;  4A3I J;  1VFC A;  1ZQ3 P;  1TWC J;  5E3N A;  1IDZ A;  1ETO A;  3HEF A;  5EEA A;  2N8G A;  2HYJ A;  3TP0 A;  2HOT A;  5EF6 A;  1WH7 A;  3BR3 A;  3Q3S A;  1TWA J;  5F0H A;  3JRA A;  3JRD A;  4XRS A;  3HGG A;  3BR2 A;  4JX5 A;  3B6A A;  3JRI A;  4M3B A;  3JRG A;  3BQZ A;  1EF4 A;  2EBI A;  1BW5 A;  4J19 A;  2IEK A;  3ZQH A;  1IC8 A;  5IYD J;  4A93 J;  2M9H A;  3BG9 A;  5DS9 A;  3A01 A;  2Y0S N;  2XB0 X;  3S1M J;  2L9R A;  3OOU A;  5GPA A;  3I4M J;  5K7F A;  1OJL A;  1X2N A;  2E2I J;  2PMZ N;  3CMY A;  1AU7 A;  2EZL A;  1BL0 A;  2B63 J;  3Q0U A;  2HOA A;  5HOD A;  1TWF J;  1WCM J;  2YU9 J;  3I4N J;  1ETX A;  2P81 A;  2Y9Z A;  3TW6 A;  4MLO A;  2Y9Y A;  3D1N I;  3SFI A;  1ETW A;  4EEF G;  3HBL A;  3F0C A;  2YS9 A;  5F0F A;  2GLO A;  1UG2 A;  3HOZ J;  4MFD A;  2CJJ A;  3CQZ J;  1HDP A;  1NK3 P;  4CYC A;  2ECC A;  1HLV A;  5C4J J;  5E3L A;  1HF0 A;  5J1Y A;  2Y30 A;  3A02 A;  2DA1 A;  3S15 J;  2DJN A;  4BBR J;  1GDT A;  3BQY A;  2WV1 A;  3LSP A;  5C4X J;  1RPW A;  2TRT A;  3LOC A;  4BXX J;  2K40 A;  4RBO A;  2DN0 A;  2DA5 A;  3LSG A;  4L5E A;  1JTY A;  5J1U A;  4MO7 A;  1JKR C;  2CQQ A;  2JA6 J;  2M2E A;  4A3L J;  1RET A;  4M3G A;  1YRN B;  3SJM A;  5J1R A;  5IP7 J;  4XIC A;  1AHD P;  2Y31 A;  2R5Z B;  1LE8 A;  3GTQ J;  3IH2 A;  1Z0X A;  3DCF A;  3PO2 J;  4DZJ A;  2DMT A;  2VKV A;  1LFU P;  1OFC X;  5IOZ A;  3M3Y J;  3BR5 A;  2ZB9 A;  3FIS A;  2JA8 J;  2RAE A;  3LSJ A;  3HOW J;  5C3E J;  1ZTR A;  5IOY A;  2CU7 A;  3ZQF A;  3IH3 A;  1GV2 A;  1GV5 A;  3OIO A;  4HNV A;  5FJ8 J;  1IGN A;  1JUM A;  1ZKG A;  5FKL A;  4JP0 A;  3WHC A;  2X9D A;  1SAN A;  1JKQ C;  1G2H A;  4B1R A;  5FKN A;  3HOX J;  1JGG A;  1K83 J;  3FK6 A;  2W48 A;  1JUP A;  3G1M A;  2DMN A;  2HDD A;  1E3O C;  1UMQ A;  1GT0 C;  1JKP C;  3BG5 A;  3C2B A;  1RES A;  4IEJ A;  2QCO A;  2LD5 A;  3S1N J;  2H8R A;  1H8A C;  4A3E J;  1R9T J;  1TC3 C;  5K7H A;  4DYQ A;  3GBG A;  2M8G X;  1MNM C;  5FKK A;  4DZP A;  4FTH A;  1WPK A;  3ZQG A;  4AUX A;  4FE4 A;  1Y1V J;  2XPW A;  4S0H B;  4UUT A;  3CDL A;  2R5Z A;  1AKH B;  3A03 A;  3LSR A;  2G0E A;  2DA2 A;  3BR1 A;  2L7F P;  5M3M J;  4V2G A;  3NAU A;  3BTC A;  3GTL J;  1WI3 A;  2H1K A;  4DYR A;  4B4C A;  2HXO A;  5F27 A;  2ME6 A;  4XRS G;  2NOG A;  2E19 A;  2QF7 A;  1MBG A;  3LNQ A;  4BBS J;  1JUS A;  2CUF A;  3HM5 A;  3DEW A;  1I6H J;  2JMW A;  3B6C A;  9ANT A;  1JKO C;  1H88 C;  1IUF A;  2DA3 A;  1P7J A;  4A3K J;  5E3O A;  3Q0W A;  3K2A A;  5EYR A;  3UKG A;  1MBK A;  5F04 A;  1XS9 A;  2VUM J;  4B3A A;  2EZH A;  1VI0 A;  4QIW N;  1T33 A;  2JWT A;  4W1U A;  2KDZ A;  2L0K A;  1U8B A;  1JJ8 C;  5IP6 A;  2DMP A;  4D7M A;  3BTL A;  2TCT A;  1H89 C;  3OSF A;  4W97 A;  2HXI A;  3QPS A;  1NK2 P;  1AKH A;  4A3G J;  1PUF A;  4LOC A;  2XRL A;  1UHS A;  3TW7 A;  5M3F J;  1JTX A;  2LFB A;  1MBJ A;  3S2D J;  4XID A;  4M6V A;  5JLX A;  3W6V A;  2JJ7 A;  4A3B J;  2AO9 A;  4IHV A;  5IP9 J;  2JK3 A;  1TWH J;  2HQ5 A;  2JA5 J;  3NAR A;  3GTG J;  3GTM J;  5C44 J;  2LLK A;  1WH5 A;  1B8I B;  1QVT A;  2CRG A;  2DMU A;  3ZQL A;  1VF9 A;  4ABZ A;  4IHW A;  3RKQ A;  5FLV A;  1W0T A;  5EDN A;  2FX0 A;  2K9N A;  2E2J J;  2JA7 J;  1B72 A;  3S16 J;  3IV5 A;  2ID6 A;  1F36 A;  2LVS A;  1S7E A;  1QPI A;  2L7M P;  2XGD A;  1BW6 A;  3IH4 A;  4C3J J;  2DTZ A;  1MBH A;  4QTR A;  1TWG J;  2MW8 A;  3E7L A;  2XSD C;  4JX4 A;  3BR6 A;  3ZQC A;  2K9S A;  5J3L A;  5IYB J;  1I3Q J;  5M5W J;  3K7A J;  5JLW A;  3JRF A;  2DA7 A;  4BKX A;  1FTZ A;  1Y1W J;  2GBY A;  4FCY A;  1X58 A;  4RDU A;  1MBF A;  2M34 A;  2LK2 A;  3FKI J;  3JRE A;  3VPR A;  4DW6 A;  4Y52 J;  3GTJ J;  5FKM A;  4C3H J;  5BNG A;  1ITY A;  1K61 A;  3HGY A;  2EZK A;  2MGQ A;  1MBE A;  3HKZ N;  3G1L A;  1P7I A;  3TP3 A;  5K7Z A;  2XPU A;  2EZI A;  3M4O J;  1HOM A;  2DA6 A;  1ETY A;  3TED A;  1Z77 A;  5EGO B;  5EG0 A;  2E2H J;  2NS8 A;  1FIA A;  1MH3 A;  1YRN A;  1GVD A;  2K9Q A;  3GTP J;  1LE8 B;  1DU0 A;  5F08 A;  2CQX A;  2FJ1 A;  3BTJ A;  4G12 A;  3L1P A;  4JX6 A;  3QPL A;  3MN2 A;  2L7Z A;  2CUE A;  2EQR A;  3S14 J;  1D5Y A;  3ZOB A;  2KT0 A;  4QSH A;  2VI6 A;  2I10 A;  4GFB A;  2NS7 A;  4M3D A;  3OSG A;  1XG1 A;  3ZQI A;  2VKE A;  1A5J A; 
#chains in the Genus database with same CATH topology
 3TGN A;  1BJZ A;  1Z6T A;  2PG4 A;  3WU0 A;  2Y0S A;  4F55 A;  5M5Y J;  4P5O A;  4EJW A;  3FXQ A;  5GAH J;  2M0M A;  2W24 A;  1TZL A;  1IO2 A;  3NWT A;  1QZY A;  2FU4 A;  2DYS H;  2MYS A;  3S1R J;  1LEA A;  1XGN A;  1B6A A;  4NQW B;  2QYO A;  5HS8 A;  5FRO A;  3S1Q J;  3CLO A;  2PLY A;  3FXR A;  1SD5 A;  2ID3 A;  1I50 J;  2QA4 I;  2R5Y B;  4UY8 I;  1W7P D;  3BLY A;  2LYC A;  2NRA C;  1IRZ A;  1IN4 A;  3OYD A;  2COB A;  4C30 A;  3V8J A;  1UG0 A;  1UFM A;  1V5G A;  1YS6 A;  2ESN A;  2L01 A;  4Y7N J;  3RQI A;  1QO0 D;  1U0J A;  3I59 B;  2HDW A;  4M3E A;  2ZME A;  1BA5 A;  4RM3 A;  1I5Z A;  1IV6 A;  2D5V A;  4FE7 A;  2FNA A;  2FOW A;  3HXL A;  1Q1H A;  4D7N A;  2M7B A;  1SAX A;  4RLF A;  4XSZ F;  4CCL A;  4BJT A;  1SC7 A;  5GP9 A;  3ASN H;  3MAJ A;  2K5C A;  3WGG A;  2CYY A;  5IYC J;  5D5V B;  1JJ6 C;  4A6E A;  2VE9 A;  3CME I;  2XF5 A;  3TBI A;  3J7Y J;  2M30 A;  1LB2 A;  1SFO J;  3BR0 A;  2E5N A;  1ZGW A;  3MEX A;  4B48 A;  2ETH A;  3L09 A;  4JBA A;  2E1C A;  3DEE A;  2PJP A;  3L2R A;  2XGE A;  2VKH A;  3ZMU A;  1FJL A;  4A69 C;  3V8L A;  4IXA A;  1XSD A;  3WTX C;  2LRD A;  2HPI A;  2R92 J;  3W2V A;  1MNE A;  5DUK A;  3CCY A;  1K78 B;  3GVA A;  2VXD A;  1NH3 A;  4KIS A;  3ZGK A;  4IHY A;  5JI6 A;  3RKX A;  3MKL A;  4WX9 A;  1ZAR A;  3HDD A;  2W1O A;  2UWM A;  1QZZ A;  5LGT A;  3F9K A;  4BJ5 C;  2DPD A;  1I3A A;  1X1B A;  2H1L A;  4UB6 C;  4XOP A;  1DDN A;  4LIV A;  3V8K A;  5E3M A;  2BXY A;  1TNT A;  3H0G J;  3K1N A;  2C6Y A;  3WU1 B;  2M87 A;  2PJR B;  5ICE A;  4X0G A;  4LGW A;  2PQ8 A;  4PSW A;  4RB1 A;  1HCR A;  4IKF A;  1ZR4 A;  3DQV C;  2BXZ A;  4PUS A;  2MLG A;  1IJW C;  3LSK A;  1PDN C;  3TQN A;  3OIP A;  3RZD J;  4HG2 A;  3A1Y A;  3H3V K;  2KJB A;  1EH6 A;  2A68 F;  2O5R A;  2EB7 A;  2VJ5 A;  2Y2Z A;  4I99 C;  4JYK A;  4YIR X;  4UUV A;  4A3D J;  5KNL A;  5A2Q K;  4V19 K;  3I54 A;  2X51 A;  3LA3 A;  3CF2 A;  4CZC A;  1D8K A;  2ELK A;  2VBW A;  2W25 A;  2FA5 A;  1OCZ H;  2OZ6 A;  1V4R A;  3IUO A;  2ISY A;  4CCO A;  2M0C A;  3EUK L;  4KYW A;  2LNB A;  2XPV A;  3ERE D;  4XLA A;  4IO9 F;  4ENK A;  1XCB A;  2L5Q A;  1G3Y A;  4AYB N;  1IXC A;  2V9K A;  1YFH A;  2L02 A;  2DBB A;  4MNU A;  2LTP A;  1W36 D;  2HR3 A;  3OYI A;  2L7K A;  2R7Z J;  4X6A J;  2FE3 A;  3RKW A;  1BR2 A;  3GLX A;  4CGZ A;  2P6T A;  3PSI A;  3GTK J;  4I02 A;  2HI3 A;  1FTT A;  5BQT A;  4N0B A;  4MGR A;  2G9W A;  1CF7 B;  5HDG A;  1XGS A;  5CVI A;  3QOE A;  2CW8 A;  4NDL A;  5L3F A;  3ZMT A;  4M6Y A;  2IRF G;  1G4D A;  1BIB A;  1YW7 A;  3DBR B;  2F4M B;  5E3N A;  1IDZ A;  2W57 A;  4AU7 A;  2ZXW H;  1D5V A;  3RCO A;  3TOB A;  2HOT A;  2LOO A;  3Q3S A;  4XRS A;  3K70 D;  3HGG A;  4O3M A;  4M3B A;  3BQZ A;  1ZGA A;  1EF4 A;  1W1W E;  4CCK A;  2QQA A;  2XAS A;  2BHY A;  1IC8 A;  2DFF A;  5E8I A;  2VQC A;  2M9H A;  4WXH A;  3DLA A;  4NB5 A;  2X85 A;  2R7Q A;  3I4M J;  2EIK H;  1YQA A;  3W2W A;  2DAO A;  3A0H C;  1R5I D;  2L9N A;  5D6F A;  1AU7 A;  4A0X A;  2EZL A;  3FBN B;  5CPR B;  2B63 J;  3IL2 A;  3OYF A;  5HOD A;  3LSI A;  4A5N A;  3UNG C;  3Q9S A;  1IAW A;  2OJE D;  2Y9Y A;  4MLO A;  4OIN F;  3VB2 A;  3D1N I;  3F21 A;  5HLH A;  1ETW A;  2V7F A;  4RGS A;  4HBL A;  3F0C A;  1KQ0 A;  3HOZ J;  3AG2 H;  3FWE A;  3QU3 A;  3IP4 B;  5BPI A;  2EV5 A;  1KON A;  2JA2 A;  1GXP A;  2EPF A;  5J1Y A;  2DA1 A;  3CJQ B;  4HPQ A;  2BYV E;  1UCR A;  3AL0 C;  2PBI A;  3QP5 A;  3TL4 X;  2JZY A;  1WZ2 A;  3DKY A;  3GFM A;  1KZH A;  3LSG A;  3OY9 A;  3CCL I;  2CV1 A;  4HST A;  2WAD A;  3DTK A;  1YI2 I;  5J1U A;  2CQQ A;  2I8D A;  2M2E A;  2JA6 J;  1RET A;  2RNJ A;  1YIT I;  1GXQ A;  1YRN B;  4Q48 A;  5J8C A;  3S3N A;  5CQG A;  3JAM Z;  2IS6 A;  3OR2 C;  4BEH B;  3D5R C;  3GEZ A;  1Z0X A;  2CQN A;  3L7W A;  1LFU P;  1VQK I;  2PMH A;  3ZN1 A;  2X6W A;  3BR5 A;  3ROU A;  2JA8 J;  4BE2 A;  2R7W A;  2FEZ A;  2RAE A;  3DF8 A;  1VQ7 I;  4PJJ A;  4E70 A;  2X1C A;  4AIJ A;  1BC7 C;  3WTY C;  2F5V A;  4ESJ A;  2EIM H;  3OIO A;  4HNV A;  5FJ8 J;  1IGN A;  3FXU A;  5FKL A;  4N4N B;  4HF1 A;  1S8N A;  4JP0 A;  4B1R A;  3JCU C;  5B1A H;  2VJJ A;  5JVG F;  2WTE A;  5J47 A;  1O7F A;  2W48 A;  3FDY A;  1MND A;  1XGO A;  2ZC2 A;  4O5V A;  4OIP F;  3OL4 A;  3VYU B;  2ZKZ A;  4PK4 A;  1GT0 C;  2FUG 2;  3S1N J;  1T2K A;  4A3E J;  4P9U A;  1XGM A;  4AID A;  1TC3 C;  1N78 A;  3OWT A;  4NC7 A;  3A2K A;  2IVM A;  1UZC A;  1OCO H;  5FKK A;  1MNM C;  3LSH A;  2O03 A;  3F22 A;  3I53 A;  2DOD A;  3ZQG A;  2ZJQ F;  2IS1 A;  1IN8 A;  3GYH X;  2EIL H;  2J5P A;  2RGV A;  2XPW A;  4XBF A;  1REP C;  2L4A A;  3A03 A;  2QVO A;  1LVA A;  2GAU A;  2K27 A;  2L7F P;  4ETS A;  2PJR A;  2KQR A;  5M3M J;  3FM5 A;  2OQG A;  4V2G A;  2XSJ C;  3S3O A;  1TL8 A;  1Y39 A;  3MZY A;  4OIQ F;  1SVL A;  1WI3 A;  3DPU A;  3KIO A;  4DYR A;  4B4C A;  1RI7 A;  1SD4 A;  1K4S A;  2H1K A;  4ZYH A;  2OUM A;  4ZJZ A;  2ME6 A;  2KP6 A;  4PGG A;  4XRS G;  1BJA A;  2OA4 A;  2QF7 A;  4MEY F;  3V42 A;  4KT5 C;  3LNQ A;  1HBX G;  1WVR A;  3WTT C;  4GGG A;  5BOX A;  1WQ2 A;  4BBS J;  2RRE A;  1IXS B;  1I6H J;  4XR6 A;  4A2U A;  2ZXJ A;  4UHT A;  1H88 C;  1RRJ A;  1WWX A;  3K0L A;  3RTR A;  3Q5F A;  3I56 I;  3HOT A;  3FF5 A;  1FOW A;  5EYR A;  1A04 A;  4PJL A;  2IP2 A;  4F91 B;  1W5S A;  4B3A A;  4Y33 A;  2EZH A;  2JWT A;  3TDZ C;  5IP6 A;  2DMP A;  2XAQ A;  1J09 A;  2TCT A;  2UUZ A;  1H89 C;  2HXI A;  4ZZD A;  4L0Z B;  5CVJ A;  2LF7 A;  4A12 A;  1LDD A;  2VJI A;  2X1E A;  1AKH A;  1PUF A;  3CCQ I;  4P1W A;  4QWQ A;  1JTX A;  2LFB A;  2D1V A;  4HSR A;  4U88 A;  3F8F A;  2XDV A;  5IT3 A;  5GTH C;  5JLX A;  2AO9 A;  1GLN A;  1O3R A;  4RAF A;  3BRO A;  4U87 A;  5IP9 J;  3VOD A;  1B9N A;  2KKO A;  4E7K A;  3GWZ A;  3HJE A;  2I5U A;  1FNN A;  2JA5 J;  3NAR A;  5JHU A;  2JVG A;  4LG0 B;  2LLK A;  2CRG A;  2EFW A;  2A3S A;  1RZ4 A;  1FOY A;  2IGM A;  4HDU A;  3HC7 A;  3UR3 C;  1W0T A;  3S16 J;  4ZYG A;  3H9G A;  1B72 A;  2XAJ A;  3OS2 A;  1QPI A;  3NEU A;  3VEP A;  3OIQ A;  3I3L A;  2DTZ A;  3S32 A;  2OQR A;  4HZF A;  3HUG B;  5ICC A;  1SEU A;  1BR4 A;  1DGW Y;  1QQI A;  3K9T A;  4BH9 A;  5A2Q Z;  2VQG A;  4Y4R A;  4G6Q A;  3BOQ A;  1I3Q J;  3BPV A;  5HNH A;  3ABM H;  1N25 A;  5ED4 A;  3H36 A;  3ZQQ A;  3K4L A;  2E1M B;  3QYB A;  2KJC A;  2Q2E A;  2DT7 B;  2GBY A;  3R6S A;  1X58 A;  5J4Y A;  4S05 A;  3FZV A;  1FOX A;  1P4X A;  4LK0 F;  3VPR A;  3S3M A;  3EYI A;  1SAU A;  5J4V A;  1YHQ I;  4BDZ A;  2X4H A;  2W84 A;  1K61 A;  3QU6 A;  3BY6 A;  1MD0 A;  4OOI A;  2CQK A;  4QLC U;  2HU9 A;  4NQW A;  2BE5 F;  2K3F A;  2EIN H;  2EFQ A;  4CUG A;  3G71 I;  2XPU A;  3BDD A;  1HOM A;  1FYK A;  5LEK A;  2E2H J;  2NS8 A;  3EDP A;  3J7A O;  1TP4 A;  2HKO A;  1J0R A;  2UZK A;  1GVD A;  3V7C A;  3E5U A;  3GTP J;  3ERM A;  1DU0 A;  2XIG A;  3BTJ A;  3L1P A;  3BC8 A;  3QPL A;  1UST A;  3KP3 A;  1HST A;  4M71 A;  3ZOB A;  3CTA A;  3CCE I;  2ZJR F;  2D45 A;  2CH0 A;  3I55 I;  3R61 A;  5DYM A;  3K70 C;  1H9T A;  1A31 A;  3DLL F;  1FT9 A;  2ZFW A;  5DCM A;  1E3P A;  2E1N A;  2R7V A;  2VC1 A;  3ZQI A;  2EFP A;  2LC2 A;  3W3C A;  3HPG A;  2WA0 A;  3ECH A;  5K5O A;  5HS7 A;  2DFH A;  2X6Y A;  3HOU J;  2NVU B;  3TKY A;  2E1M C;  3T5X A;  1Z3Y A;  2PMU A;  3BG7 A;  4H4K C;  2MAB A;  1X3Z B;  1IV8 A;  4OMZ A;  2BY3 A;  2P5V A;  5JHF A;  1HDD C;  2KIF A;  1OPC A;  1X3U A;  3Q0V A;  1OCP A;  1VND A;  2H27 A;  4B43 A;  1XN7 A;  2RV8 A;  3B02 A;  3HSR A;  1QU3 A;  3CCV I;  2E35 A;  1CF7 A;  2GOX B;  4XQF A;  1AWC A;  3ZR8 X;  4DIQ A;  3FHN A;  4ESF A;  2M8E A;  2STW A;  1J5Y A;  4I2O A;  2PEX A;  3SXY A;  3DU5 A;  3ABK H;  1IG7 A;  5FKO A;  4HX8 A;  3QP6 A;  2A61 A;  3CJN A;  2JRT A;  1NTC A;  5ILV A;  1BM9 A;  2XGC A;  2RVC A;  2E60 A;  4EJT A;  1V3F A;  2MLK A;  2YUS A;  1ZR2 A;  1GVJ A;  4EGZ A;  3O8H A;  2EWN A;  2J5O A;  4EM0 B;  1ETK A;  4DYC A;  3OYC A;  1TNS A;  3CCJ I;  2GXB A;  1RR7 A;  2CG4 A;  3PQK A;  1FMW A;  2GOM A;  4LMY A;  2K4B A;  5LGU A;  1WGX A;  3DPT A;  2UXN A;  2F6C A;  4HQM A;  2IW5 A;  3P9I A;  2ZJP F;  5EG0 B;  1DGR M;  4BHP A;  3SEQ A;  4LFU A;  2MA3 A;  2QM3 A;  4G8X A;  4G9Y A;  3ZRG A;  2ZFU A;  1P92 A;  2PFB A;  3DV8 A;  3E6C C;  2HVS A;  5HLG A;  4B44 A;  2JN6 A;  3LL7 A;  2IGK A;  3O6B B;  4XN3 A;  3KEY A;  3CCR I;  4NNJ A;  5EZH A;  3CDH A;  3E5X A;  2EH3 A;  1O57 A;  5LBQ A;  3LAJ A;  2CV2 A;  1D0Z A;  3K4K A;  1W5C C;  5CVV A;  5BPD A;  1YS7 A;  3LA7 A;  1XMX A;  4A3J J;  3OV8 A;  3IKV A;  3RIR A;  2DA4 A;  2AQF A;  3C3W A;  1NG7 A;  4CYC B;  1YW9 A;  5B3S H;  3LFK A;  1EH7 A;  5DD4 A;  4OU0 A;  4B09 A;  2HVR A;  4HRI A;  3L2U A;  1F4K A;  4D5C A;  4CCM A;  4M3F A;  2BGC A;  1WJC A;  4BYY A;  3JRC A;  4KIG A;  3JRB A;  3M8F A;  2MC3 A;  1HA8 A;  1T56 A;  2BVL A;  2VQH A;  5IPA A;  4D1Q A;  5LLQ A;  1G3W A;  2HTS A;  2DT5 A;  3QQA A;  4M9S A;  1TT0 A;  2GA2 A;  1F43 A;  1W0U A;  2FXA A;  4EV0 A;  5IT9 Z;  3M1E A;  4AM3 A;  2VLA A;  1R22 A;  1ZG5 A;  3FKJ A;  3K69 A;  1P9Q C;  5AIP A;  1F5T A;  1G3T A;  1RKW A;  1ETV A;  1JT6 A;  2O7O A;  3ELK A;  4R79 A;  2F5F A;  1B72 B;  3HIF A;  1K4T A;  4HNU A;  1VQO I;  3GFI A;  3PM1 A;  2XHK A;  3D0S A;  4XLH A;  1F9N A;  2X6O A;  2DDB A;  3ZPL A;  1HC8 A;  5EEH A;  3KCC A;  2LKX A;  3PUB A;  1SFU A;  3U1K A;  4NC8 A;  4HV6 A;  4XRM A;  4A3F J;  2WC2 A;  5F1J A;  1IDY A;  2TDX A;  2X48 A;  3BTI A;  4WCG A;  1HQC A;  2H8W A;  3I9V 2;  5FO5 A;  1FBQ A;  4ZDO A;  4BGD A;  2LF8 A;  3LAP A;  4V2F A;  3FIW A;  5KK1 A;  3IRR A;  1GUU A;  2HZD A;  5CQE A;  2XF7 A;  1RNL A;  1VZ0 A;  2BW3 A;  4C3I J;  3LSM A;  1VFC A;  2LG4 A;  1TWC J;  1OMI A;  4IRH A;  1JGS A;  2XKP A;  3L00 A;  4D0P A;  2EJR A;  3SYT A;  5D5W B;  3PSF A;  2DU9 A;  3JRA A;  2A05 A;  3PNT A;  1HSJ A;  4ZDL A;  4CZZ A;  3BJ6 A;  3P5J A;  3JRD A;  3B6A A;  1J7K A;  4RGX A;  3JRG A;  2EFO A;  3C7J A;  2KIM A;  1KQ8 A;  1Z91 A;  3F72 A;  1BBY A;  1BW5 A;  2YR2 A;  2IEK A;  3KEQ A;  3L2W A;  4J19 A;  5IYD J;  1ZRF A;  4HF0 A;  4EGY A;  1SVM A;  1XSX A;  3N05 A;  5GAE J;  1T0F A;  3A01 A;  1K6Y A;  2RQP A;  2Y0S N;  2QLZ A;  4U7D A;  4BQA A;  1XB4 A;  1BOA A;  5DCF A;  1HXD A;  4XKC A;  5KAF C;  1OJL A;  2E2I J;  3VYR B;  2DCE A;  2PMZ N;  2KZG A;  3ML6 A;  4KA4 A;  1BL0 A;  2DOF A;  4ZYD A;  2ZCW A;  1TWF J;  4EJV A;  4L9N A;  1B9M A;  1SMT A;  3CUO A;  4PFP A;  3I4N J;  1VQ9 I;  1ETX A;  2P81 A;  4XLN F;  4IOC F;  4HOB A;  3SFI A;  3CUQ A;  2NYX A;  2QBY B;  3CLQ A;  3HBL A;  4PJ0 C;  2QKL B;  4BHC A;  1UG2 A;  3H3Z A;  1YJN I;  4U0W A;  1NK3 P;  3ESW B;  1XMA A;  1X1C A;  5E3L A;  1HF0 A;  2RNG A;  2Y30 A;  3TO7 A;  1ERD A;  4FHT A;  2NXN B;  4PJN A;  5DUI A;  3LSP A;  1LDJ A;  3QWL A;  2TRT A;  3IRQ A;  3L2C A;  1Y8R B;  3VDX A;  1JTY A;  2FNP A;  3L2V A;  4J00 A;  4MO7 A;  3H9Q A;  3HZJ A;  1ZLK A;  5ILS A;  4HLX A;  1SFX A;  3HL2 A;  4M3G A;  3F6O A;  5FRN A;  4XIC A;  3E6D A;  1AHD P;  1ZYR F;  3PFI A;  2F4I A;  3DBH B;  3IH2 A;  2FSW A;  3I64 A;  3F8B A;  2LMD A;  1N77 A;  4LK1 F;  4FAS D;  3GZ6 A;  1D3Y A;  5E18 F;  1OFC X;  5IOZ A;  2ZB9 A;  3GXO A;  2F5C A;  3PJR A;  1XSV A;  5C3E J;  4DNC A;  2CU7 A;  3ZQF A;  1GV2 A;  1MMD A;  2NAZ A;  2CS3 A;  2VL8 A;  5F6F A;  1Z1D A;  3E6B A;  1SAN A;  2MH9 A;  1JGG A;  3KZZ A;  2ACJ A;  4RA2 A;  2M45 A;  1E3O C;  1UMQ A;  3DPL C;  4C2U A;  1OCR H;  1RES A;  4IEJ A;  2QCO A;  2LD5 A;  3MKY B;  2H8R A;  4XKV A;  1R9T J;  1ON1 A;  2BBY A;  4I09 A;  1JHH A;  3VFZ A;  4UXN A;  2QEN A;  3HHH A;  3WGH A;  1DP7 P;  4E6K G;  3ZMS A;  1WPK A;  3ONQ A;  2EV6 A;  4FE4 A;  2A6H F;  4M74 A;  4U0Y A;  1S7A A;  2EK5 A;  4UUT A;  3CDL A;  2R5Z A;  2OD5 A;  2EFN A;  2BZT A;  4YEL A;  2VC0 A;  3BR1 A;  5H6R A;  1S3J A;  5HDK A;  1R5G A;  1E17 A;  1R71 A;  4EJO A;  4AIH A;  2Z99 A;  1ZGJ A;  2HXO A;  2Q1Z B;  2QQ8 A;  5F27 A;  2NOG A;  2E19 A;  5KHD A;  2A5Y B;  5D4R A;  1IF1 A;  4XRF A;  4RMN A;  2CUF A;  4BXF A;  3ECO A;  4LG0 A;  1IUF A;  2DA3 A;  5E1X A;  1P7J A;  3AG4 H;  1FC3 A;  1S29 A;  3K2A A;  2P7V B;  3HSF A;  1NG6 A;  2L9V A;  4A6D A;  4MQV A;  3H0D A;  2GIV A;  5F04 A;  4IHS A;  1T39 A;  1OKR A;  3QOP A;  1VI0 A;  4QIW N;  2KDZ A;  4W1U A;  2DDA A;  2Z3Y A;  4HNT A;  2D2W A;  2IS4 A;  2VN2 A;  4YIF A;  1KU2 A;  5L3D A;  2NNN A;  2A07 F;  4K2E A;  1WJF A;  4DBR A;  4BXU A;  2V1U A;  3CD6 I;  2JT1 A;  4EM1 A;  3GFL A;  2FBH A;  2QGU A;  1Z21 A;  5TIS C;  4A3G J;  2V9V A;  3I71 A;  3U9G A;  3JAM K;  3TW7 A;  5M3F J;  3M8E A;  1ZAO A;  5B1B H;  3GF2 A;  2OC6 A;  3FXK A;  2MC4 A;  4XID A;  3W6V A;  2LRE A;  4A3B J;  5FLX K;  1EA3 A;  4XOR A;  1VQ6 I;  4HX7 A;  1IW7 F;  1YX3 A;  4KN7 X;  1XX5 A;  1W5T A;  1OYY A;  1WKM A;  3TOA A;  3DFG A;  3HKZ A;  3ABL H;  3GTM J;  1XMK A;  3NWS A;  2CGP A;  1WH5 A;  2OU2 A;  4IPA A;  3ZMZ A;  2L3D A;  3CO6 C;  3ZQL A;  3JW4 A;  4IHW A;  4YEJ A;  1MIJ A;  3CP2 A;  4CH7 A;  5FLV A;  5E1W A;  1S5L C;  4EMS A;  2K9N A;  1MDM A;  1YIJ I;  4RAY A;  3BPX A;  3IV5 A;  2LKP A;  5DM7 F;  2L7M P;  2XGD A;  4CA0 A;  2JTV A;  2YU3 A;  3IH4 A;  4C3J J;  1MBH A;  4EM2 A;  4IX7 A;  5D8K B;  2XSD C;  2CUZ A;  2BY0 A;  3K10 A;  2QQB A;  5M5W J;  2VBY A;  5JLW A;  5HLT A;  2M5W A;  3BJO A;  4ZZL A;  4E7J A;  2XAU A;  4BKX A;  2YX7 A;  1T8I A;  3IAM 2;  3ZCO A;  2XV4 S;  4G6D A;  4FCY A;  1S9H A;  2IA2 A;  1RIO H;  4RDU A;  1K6O A;  1PVE A;  2L9S A;  4RB0 A;  2JRM A;  3FKI J;  3JRE A;  1SFK A;  2BOL A;  2IGN A;  2ZSI B;  4UNO A;  4Y52 J;  3GTJ J;  1A35 A;  5LEJ A;  1MMG A;  2QSG X;  1SMY F;  4P9F A;  3F8M A;  4NUB A;  3PNV A;  2QQ9 A;  3HGY A;  5D6E A;  4YFX F;  1IN7 A;  3RPU A;  3FXM A;  4XLF A;  3W6K B;  2RC4 A;  4PZJ A;  5FLX Z;  3T1B A;  2IPQ X;  2DQL A;  3SHF A;  2EZI A;  2Z5U A;  1XD7 A;  1ETY A;  3TED A;  5EGO B;  1MGT A;  2M7A A;  1MJA A;  1FSE A;  4RGU A;  5L3C A;  1YLF A;  2OCE A;  1MH3 A;  3F8C A;  1U5T A;  1JHF A;  4N4O B;  3HTU A;  1UHW A;  1LE8 B;  3K4M A;  4IRI A;  3TMO A;  4ENM A;  1VQN I;  3MN2 A;  2L7Z A;  2P5K A;  2CUE A;  2CSO A;  4RAZ A;  3RSN A;  3S14 J;  2WY8 Q;  2KT0 A;  4H0E A;  3KP4 A;  3X2Q H;  4U7B A;  3NQO A;  4M3D A;  3EPZ A;  2GZW A;  2DYR H;  1X1A A;  1Y0U A;  2Q2E B;  5HS9 A;  3L2Q A;  1LUJ B;  2XAH A;  3BZ6 A;  3AG1 H;  2Q8K A;  4CSW A;  1IN6 A;  3VSL A;  1LEB A;  1A5J A;  3R4K A;  3S17 J;  1XCV A;  4HA8 A;  1H0M A;  3ZMD A;  1ACI A;  2V1N A;  5F64 A;  4IL6 C;  2F4O B;  2IBD A;  2GXA A;  3GLL A;  2HOE A;  3RI4 A;  3HRU A;  4C2M J;  4ZYE A;  4I76 A;  3FXJ A;  4HW0 A;  2V6E A;  5GPC A;  4RB2 C;  3JTG A;  5FFX A;  1FPQ A;  1CQT A;  2Y69 H;  1O7L A;  4IRG A;  1DU6 A;  4KIB A;  4YFK F;  3K4J A;  1Z9C A;  4L9T A;  1ENH A;  1R23 A;  1WHU A;  2AXL A;  1KYZ A;  4NHJ A;  2WV0 A;  3WE3 A;  5LFA A;  5B5E C;  2JPC A;  2WAQ A;  3PUF A;  2MH2 A;  2VAS A;  4G94 A;  2MSY A;  4UUS B;  2GM4 A;  1AOY A;  4WF2 A;  3F6V A;  2EA2 A;  3M9A A;  4RGR A;  1R1U A;  2FQ4 A;  2OTJ I;  1WSU A;  3LST A;  2VPR A;  4UV9 A;  1FBS A;  3JRH A;  3QPT A;  4AC0 A;  3N4M A;  2HPM A;  3HOV J;  5ICF A;  5EZG A;  2JSC A;  2BY1 A;  3KLO A;  3A4C A;  2Y75 A;  2NNY A;  1V55 H;  2RKH A;  1YO5 C;  2E1O A;  2O9L A;  1T98 A;  3RPQ A;  2R93 J;  1TQI A;  3WTS C;  1XC5 A;  2VT2 A;  3EQL F;  4DGW B;  1G3S A;  2ECB A;  2ME0 A;  4WXC A;  2W85 A;  1Y0N A;  4XK4 A;  1A6Q A;  2LY9 A;  5M5X J;  1ORK A;  1O4X A;  2Z9O A;  2A5W A;  2AQE A;  3COA C;  5B66 C;  1WFX A;  2EV0 A;  4XLP F;  1K79 A;  1TT5 B;  2K9L A;  4MTD A;  1FWZ A;  1W36 C;  2O8K A;  4BQO A;  3KPH A;  2HKX A;  2GWR A;  1Y8Q B;  1HW2 A;  2FD5 A;  1VQM I;  5TGT A;  4MFE A;  3AAF A;  2NVQ J;  1KU9 A;  3R0J A;  4TV7 A;  1IZ1 A;  2XVC A;  1EKE A;  4GRI A;  1ULY A;  1ETQ A;  1MMN A;  3G1O A;  4C2T A;  2A6T A;  3MKW B;  2LR8 A;  4OAY A;  3E1S A;  4OMY A;  4ON0 A;  3O8G A;  4ZYA A;  3A01 B;  4BY1 J;  3SZG A;  1RKT A;  3CC7 I;  2CWE A;  3HRS A;  2KHM A;  3J80 K;  2DMQ A;  3QRF F;  1U9O A;  3C1D A;  4FIS A;  1A36 A;  1MSE C;  1I1G A;  3H5N A;  2RQQ A;  3JR9 A;  1B4A A;  2KL4 A;  4X1E A;  2ESH A;  2DXI A;  2RDP A;  2LKS A;  2DOE A;  3ABU A;  1WRJ A;  2O61 A;  1EJ9 A;  3LWF A;  1BOB A;  1V54 H;  1SFE A;  2JPB A;  5FLM J;  3FK7 A;  1F1Z A;  1W7P B;  2V6C A;  5KCM A;  3R0A A;  1OR7 A;  1YIO A;  3FXL A;  4A3C J;  1VQ5 I;  3MWM A;  1UHM A;  1K7A A;  1OCT C;  3SEZ A;  4L5J A;  3E5Q A;  2VOP A;  3I58 A;  5E8G A;  4LB6 B;  3KZY A;  2K86 A;  3BZC A;  2NVX J;  2DOA A;  5HVQ C;  2HYF A;  1U8R A;  4I6Z A;  3K1M A;  4MIM A;  1Z7U A;  2K02 A;  3WHB A;  4HLY A;  3MVP A;  1QRY A;  4PJM A;  2OPT A;  3SQN A;  3VWB A;  1S7O A;  2E5Z A;  2HQA A;  3U21 A;  2Z16 A;  4ESB A;  2R3S A;  6PAX A;  2VPL A;  1J9I A;  1POG A;  1BN5 A;  3CUQ B;  3REO A;  3ABT A;  4LG3 A;  2B7E A;  1NHA A;  5HDN A;  3S2H J;  1LQ1 A;  3HB9 A;  5FD5 A;  4A3I J;  4AVP A;  2E36 A;  1ETO A;  3HEF A;  5LRR A;  5EEA A;  2N8G A;  3PFY A;  2O8X A;  1G6N A;  3TP0 A;  2NOJ B;  5EF6 A;  1WH7 A;  1TQM A;  1RUO A;  1ZG3 A;  3H5A A;  2HQR A;  3H9J A;  5J40 A;  3LQR A;  2XUB A;  4BS9 A;  1B1B A;  1Y6I A;  3M1C A;  2BV6 A;  1N75 A;  2EBI A;  4RLQ A;  3CCU I;  3ZQH A;  3U1D A;  3BG9 A;  5JFR A;  2Z33 A;  4KIC A;  2NS0 A;  2QSF X;  1DPR A;  2XB0 X;  4BDY A;  3OOU A;  1ZHF A;  5GPA A;  3ZMV A;  3NRV A;  2KLO A;  3EUA A;  3P9K A;  1TTY A;  3VSK A;  2M3A A;  3E3V A;  2PX9 A;  3KLN A;  4PCQ A;  3CMY A;  3DTI A;  4E7L A;  4CXF A;  4RB3 C;  2OTL I;  1WCM J;  2YU9 J;  3FHZ A;  1U5T C;  2UXX A;  2BW3 B;  2O6G E;  5F0F A;  4N9I A;  1D1A A;  4I01 A;  1UB9 A;  2ADU A;  4MFD A;  2CJJ A;  3CQZ J;  4CYC A;  1HLV A;  5LRS A;  5C4J J;  2QWW A;  4G7H F;  4OIO F;  3A02 A;  2KZV A;  2DJN A;  1X19 A;  2ELH A;  2FRH A;  2Z1D A;  1Y56 A;  2ZNY A;  3PIO F;  1R58 A;  2WV1 A;  2VIX A;  5C4X J;  4RS8 A;  4MTE A;  1RPW A;  3LA2 A;  3OYL A;  4KDP A;  1ZEL A;  3TDU C;  4XSX F;  1U6G A;  3PNY A;  3CJR B;  2VOD A;  2DN0 A;  3JTH A;  4HEA 2;  3SJM A;  5E79 C;  5IP7 J;  3SZT A;  2Y31 A;  2R5Z B;  5H20 A;  4QPO A;  4LIT A;  2Y48 A;  5D5X B;  5BMZ A;  2PMZ A;  4A5M A;  3DCF A;  2R7D A;  1OYW A;  5DD8 A;  4OIR F;  3KZI C;  5H6Q A;  4DZJ A;  3LQQ A;  2VKV A;  1D0X A;  2CW0 F;  1LVK A;  1YW8 A;  3WTW C;  3LSJ A;  4JOM A;  3HOW J;  2O3F A;  4ZC3 A;  2BY2 A;  5AIQ A;  1VQL I;  4F93 B;  4LLN A;  5ICG A;  3K2Z A;  3KYC B;  1ZKG A;  5AON A;  3J7Z I;  4KIT B;  2IJL A;  2X9D A;  3QYE A;  4ENJ A;  1Z67 A;  2V1X A;  3FK6 A;  3G1M A;  1JUP A;  4R8H A;  1D0Y A;  1CGP A;  1J75 A;  5LHH A;  1JKP C;  4I98 B;  1WJA A;  3RYR A;  4LJZ F;  4S04 A;  1SD6 A;  1K78 A;  2R4G A;  4IHT A;  2OV7 A;  2M8G X;  2MBF A;  3HHG A;  3TO9 A;  4CCN A;  4G7Z F;  4AUX A;  3HTS B;  4E7I A;  3MD2 A;  3IKT A;  4A0Z A;  2W00 A;  1Y1V J;  2XGX A;  4UV8 A;  3P9C A;  4S0H B;  2STT A;  4LD5 A;  3LSR A;  1I27 A;  4HQE A;  3FMR A;  4RM2 A;  1YTY A;  2KRH A;  4XOT A;  4BU2 A;  2E34 A;  3K1P A;  3NAU A;  3ASO H;  4GXO A;  3GUD A;  1WI9 A;  5BS6 A;  3RDI A;  1FYM A;  1AA7 A;  2ZJ2 A;  5L3E A;  5IY5 H;  1ZG1 A;  1Z05 A;  2WB1 A;  5EEG A;  3S8P A;  1QBJ A;  4G6T B;  4IF4 A;  2VBX A;  2F5D A;  4U0V A;  1JUS A;  3MZ8 A;  1VQ8 I;  1MKM A;  9ANT A;  1EV7 A;  1JKO C;  3J80 Z;  1MZB A;  2BVM A;  2ICW G;  2JUC A;  3I0T A;  4A3K J;  1Z6R A;  5HLI A;  5E3O A;  1QHH D;  3Q0W A;  3OYK A;  3MFK A;  1ZH5 A;  2GXG A;  2R7U A;  4QPQ A;  1XS9 A;  2HQN A;  3H1C A;  4IJA A;  1O3S A;  1T33 A;  1STZ A;  1U8B A;  4D7M A;  4BQQ A;  1ODD A;  3BTL A;  1WJE A;  5TJJ A;  3OSF A;  2R7O A;  3H3U A;  3KET A;  1HKT A;  2BHZ A;  4F7Z A;  1O3T A;  4Z2Y A;  1V5E A;  1NK2 P;  1P2F A;  1ZLJ A;  2X1D A;  2VBZ A;  3CES A;  1Z7L A;  3LMM A;  1FOK A;  3S2D J;  2O0Y A;  3KEO A;  3N97 A;  4E4H A;  4IHV A;  1OCC H;  1USS A;  2JK3 A;  3MMY B;  1ON2 A;  5DEQ A;  3VYT B;  3KYL A;  1S72 I;  2GIZ A;  3AKZ A;  1TWH J;  3F8N A;  1WJD A;  2HQ5 A;  2DFE A;  2IA0 A;  2RN7 A;  3OYH A;  3V4G A;  2V9P A;  3CP8 A;  3CZ6 A;  5FB2 A;  4DOZ A;  1QVT A;  2CUJ A;  3GZ5 A;  3ISP A;  5LHI A;  1VF9 A;  4ABZ A;  2DI3 A;  3RKQ A;  4ZDP A;  3WTU C;  1T6S A;  1HW1 A;  1LNW A;  5EDN A;  2E2J J;  3KX2 A;  4KMU X;  2LVS A;  3IHU A;  2K9M A;  1BW6 A;  3DWL E;  2Y0M A;  3RYP A;  5GAD J;  1TWG J;  1BI0 A;  2MW8 A;  3E7L A;  3ULQ B;  3B73 A;  2XRO A;  1D8J A;  2JQ7 A;  4XN0 A;  3BR6 A;  3ZQC A;  5GTI C;  2K9S A;  5IYB J;  3C18 A;  1L0O C;  5F1R A;  3K7A J;  1D1C A;  3IWF A;  2OZU A;  3O2P E;  1TW2 A;  1X1P A;  1KU3 A;  1E2X A;  1DQU A;  3DP7 A;  3FX3 A;  2LK2 A;  2MFZ A;  3MQ0 A;  4XKW A;  4BQN A;  3J81 Z;  4DW6 A;  4MEX F;  5LGN A;  3HSE A;  5BNG A;  4AYB A;  1ITY A;  2MD5 A;  2DQR A;  1W4M A;  3QOD A;  4YFN F;  3HKZ N;  3G1L A;  4Q47 A;  1RR8 C;  2DTR A;  3CO7 C;  4M73 A;  1P7I A;  3TP3 A;  3M4O J;  1T95 A;  2DA6 A;  1Z77 A;  2DT6 A;  1YG2 A;  3E6M A;  2Z2S B;  1R5H A;  2IA1 A;  2IT0 A;  1QZE A;  3M07 A;  1FIA A;  1YRN A;  3CUQ C;  5K1Y A;  1DP3 A;  1J59 A;  1BI1 A;  1R1T A;  1YX5 A;  4ITV A;  1IRG A;  1D5Y A;  2VON A;  2HYG D;  4QSH A;  1HW5 A;  2I10 A;  2F5E A;  1XDU A;  2NS7 A;  2B0L A;  2L4M A;  3OSG A;  5CJ9 A;  5CKT A;  4Q5S F;  3SDB A;  1IUY A;  4KMF A;  4J01 A;  4AVZ A;  3DXJ F;  1YJ9 I;  1BC8 C;  4L0Y B;  4GYI A;  2VJ4 A;  3FXO A;  2MD0 A;  1U9N A;  4ZH4 F;  2CW7 A;  3QAH A;  2WAE A;  3WTZ A;  4XMY A;  1ONV A;  4WK8 F;  2QBY A;  3PO3 J;  2DK8 A;  4O6J A;  3OYN A;  1HKS A;  3CC2 I;  2W4S A;  1U78 A;  1QVU A;  1JI8 A;  4Y3O A;  3BCB A;  3BT9 A;  1U3E M;  1RUN A;  2KIQ A;  1OYI A;  4R1H A;  4XKB A;  3C2H A;  4FQG A;  3WTV C;  1A6I A;  1LPQ A;  2XB5 A;  4LB5 A;  3GZN B;  4WXD A;  4L9V A;  2NVT J;  2V26 A;  2VT3 A;  2R7F A;  2LBF B;  3BG3 A;  1SVO A;  1IN5 A;  1YJW I;  2ZSH B;  1ZK8 A;  1B8I A;  4PDK A;  4PGH A;  2XRN A;  3RZO J;  5CYV A;  5GAG J;  1R00 A;  4UVA A;  3CC4 I;  2QUF A;  3JSP A;  3HOY J;  2L54 A;  3SDG A;  3G3Z A;  2WB1 N;  1HKQ A;  1OIS A;  3DBL B;  3R60 A;  3OYG A;  5DDG A;  4HV5 A;  4EVI A;  2B9S A;  2YX4 A;  1LDK B;  3S2W A;  2H09 A;  1PP8 F;  1X2M A;  2HVQ A;  3BZK A;  3FMS A;  3CCM I;  1LFB A;  2L2O A;  3DEU A;  2EA4 A;  3DKW A;  1LJ9 A;  3KFW X;  5EJC A;  3WG9 A;  3J81 K;  4CHU A;  4F92 B;  4P55 A;  4BE1 A;  1UEL B;  2H94 A;  2WWY A;  3H35 A;  1YE9 A;  1LFP A;  3K4B A;  4HF2 A;  2FBI A;  4HX4 A;  5JR3 A;  1FY7 A;  4IZZ A;  5HNF A;  2HOS A;  1G8X A;  4BY7 J;  2R0Q C;  1X3W B;  5J8F A;  1MSF C;  3GFJ A;  3EYY A;  2IXS A;  2IS2 A;  1DPU A;  2KIS A;  2ZBK A;  4ANJ A;  5D4S A;  1FLI A;  3GME A;  4KJZ A;  4KT6 A;  2NVY J;  5CVR A;  2E71 A;  1R4N B;  1X4O A;  3BCA A;  5DTD A;  2WAQ N;  1PUF B;  2OF7 A;  4B3X A;  4NC6 A;  4D5F A;  1JT0 A;  4PSX A;  4F52 A;  2V4J C;  2XF6 A;  4XM3 A;  2A6E F;  5EGO A;  3CF5 F;  3OS1 A;  2KRF A;  1V5F A;  1MH4 A;  4IQ4 A;  5KVR A;  1U5T B;  2V79 A;  5F0C A;  2CFO A;  2IAI A;  3LFU A;  4G7O F;  3GTO J;  3RKY A;  1X4P A;  1QA6 A;  4XNF A;  1Q1V A;  5TRD A;  1XDS A;  1R1V A;  3K4N A;  2G7U A;  2OAZ A;  2PI0 A;  1FEX A;  3CDI A;  3EET A;  2YSR A;  3KP2 A;  4IHX A;  3F3X A;  1P4W A;  3EUH C;  1PUE E;  2K7L A;  1JXS A;  4BE0 A;  2MG4 A;  4PFO A;  3V7R A;  2R5Y A;  4BEH A;  2LP0 A;  2AHQ A;  2VE8 A;  3CCS I;  1FIP A;  1VQP I;  2FMY A;  3OYA A;  3K6G A;  5FRM A;  3I59 A;  3CMA I;  3T8T A;  2DJI A;  4BNC A;  2PN6 A;  1APL C;  3GW2 A;  2HZT A;  1FBU A;  2DO7 A;  3G6E I;  2CMP A;  4A3M J;  4M9Z A;  4AWX B;  2V1D A;  4HDV A;  4ZTJ A;  2DPU A;  3OYJ A;  3HYI A;  3HOS A;  4LLG F;  1QHG A;  1BIA A;  3D5L A;  1R36 A;  1GHC A;  4UUS A;  3GCM A;  3VYS B;  4DQ2 A;  2OBP A;  1ZQ3 P;  5LD2 C;  2QKM B;  2CFX A;  3JSO A;  3I5U A;  1PYV A;  4LIU A;  2ZME B;  2HYJ A;  1MJB A;  2DFI A;  3BR3 A;  1TWA J;  2WY7 Q;  5F0H A;  3OR1 C;  2JVH A;  2KPM A;  3PIP F;  3PQJ A;  1SD7 A;  3G2B A;  3EUH A;  2W82 A;  3BR2 A;  4JX5 A;  1ZRE A;  3JRI A;  2VQL A;  3J7A Y;  3CMM A;  3H5R A;  4M72 A;  4A93 J;  3FM3 A;  1T38 A;  2ZNZ A;  5DS9 A;  2CV0 A;  3S1M J;  2DLL A;  2K4J A;  2L9R A;  3FBI B;  1MDM B;  2H6C A;  2OCC H;  1VQ4 I;  5K7F A;  4I0B A;  1X2N A;  1Z3X A;  1KGS A;  4EJU A;  5FFZ A;  3Q0U A;  5DCM B;  1OLT A;  1FP1 D;  1FSH A;  2HWV A;  2HOA A;  3T8R A;  1ZN2 A;  2K3P A;  3RJP A;  2Y9Z A;  3TW6 A;  2P5L C;  4XLC A;  1W7P A;  3A0B C;  4EEF G;  4FX4 A;  2YS9 A;  2G7H A;  1YYV A;  2GLO A;  2F2E A;  4UVB A;  4F3Q A;  2ISZ A;  1MW7 A;  3ZN0 A;  2ZO4 A;  2M4K A;  1HDP A;  2KRC A;  2D1H A;  2H6B A;  2ECC A;  4E7S A;  2JSP A;  4II3 A;  3W2A A;  1KU7 A;  2GA1 A;  3S15 J;  4Q4Z F;  2FOK A;  4BBR J;  2LY1 A;  4HAM A;  1GDT A;  3BQY A;  1WJ5 A;  3WE2 A;  2HDC A;  4MQ9 F;  4IQJ A;  1X1D A;  3E0J B;  5D8L B;  3KP5 A;  2ZME C;  3IWZ A;  3LOC A;  4BXX J;  2K40 A;  4RBO A;  2R7X A;  2DA5 A;  3P7N A;  3O3K A;  1KYW A;  4WWC A;  2AS5 F;  4L5E A;  4FET A;  5J6X A;  5D5U B;  4A3L J;  1JKR C;  2XAG A;  1OR7 C;  3BJA A;  3L9F A;  2P7C B;  2GQQ A;  2KDO A;  3GX4 X;  4C9Y A;  5J1R A;  3WGI A;  1B59 A;  4DBQ A;  2FF4 A;  1LE8 A;  3GTQ J;  3E97 A;  3DTE A;  3PO2 J;  1FP2 A;  2VXZ A;  2DMT A;  3BWG A;  3OL3 A;  5JVT A;  3M3Y J;  5H2F C;  2FBK A;  1UJ8 A;  3FIS A;  2QZ8 A;  1MMA A;  4FT8 A;  3HRT A;  4XL9 A;  4Y13 A;  2KFD A;  2CO5 A;  3I4P A;  4RAG A;  1QPM A;  4KFC A;  1ZTR A;  5IOY A;  4XLE A;  5KAI C;  4UVC A;  3IAS 2;  3IH3 A;  3W6J B;  1GV5 A;  1JUM A;  3T0Y A;  4IOA F;  2KMU A;  3WHC A;  4YG2 F;  1JKQ C;  1G2H A;  5FKN A;  2UV1 A;  2HFH A;  3HOX J;  1P6R A;  1K83 J;  2LY2 A;  3QYF A;  5K5Q A;  2DMN A;  5L3G A;  4CDG A;  2HTJ A;  4JK1 X;  2HDD A;  1MMS A;  3WG7 H;  3AL0 B;  4N9H A;  2R7S A;  2XKO A;  3BG5 A;  3C2B A;  3V7S A;  4Z6Y A;  1E3H A;  4GO1 A;  1G59 A;  3KP6 A;  1E0E A;  1H8A C;  1O3Q A;  3HG9 A;  5K7H A;  3DU6 A;  4DYQ A;  3GBG A;  4DZP A;  4L5I A;  4FTH A;  1IRF A;  3WU2 C;  4P96 A;  5LHG A;  2XAF A;  2COM A;  1AKH B;  2WBM A;  2M1B A;  2M4G A;  3OYE A;  4E7Z A;  2G0E A;  2DA2 A;  4YII A;  4UB8 C;  3K4C A;  4D9J A;  4FX0 A;  1I6X A;  3SZP A;  3BTC A;  3RPU D;  3GTL J;  2DK5 A;  2KIU A;  3PL8 A;  4Y15 A;  4BAY A;  4XON A;  2EIJ H;  3RQ4 A;  3MZH A;  1FYL A;  4IVN A;  2R7T A;  2HGC A;  1MBG A;  1T0F C;  2VB6 A;  1OQY A;  2WAF A;  4I7H A;  1VTN C;  3HM5 A;  3DEW A;  3CJT B;  1XPX A;  5K5R A;  2JMW A;  3B6C A;  4L18 B;  2P0W A;  1EH8 A;  4GCV A;  2YPR A;  3OMY A;  2CQ7 A;  2LH9 A;  3UKG A;  1H9G A;  1MBK A;  4Y17 A;  3TO6 A;  2VUM J;  2Q0O A;  4ENN A;  4B47 A;  2L0K A;  1JJ8 C;  5CVU A;  3OYB A;  1BI3 A;  3HUG A;  2X0L A;  2QSH X;  5IT9 K;  2VKD A;  2XC7 A;  1C0W A;  2FQ3 A;  3MCZ A;  4BAC A;  4NBQ A;  4W97 A;  2F48 A;  3M7G A;  3QPS A;  4HYE A;  5FGM A;  2DW4 A;  5E17 F;  1PJR A;  4LOC A;  2XRL A;  1UHS A;  4E7H A;  4DJA A;  1IRX A;  3SFZ A;  4KUM A;  3Q9V A;  3VOE A;  4KN4 X;  3QPH A;  3HPH A;  4CIC A;  1MBJ A;  4I0A A;  3D5S C;  1T08 B;  3DKX A;  2P4W A;  1FMV A;  4M6V A;  2JJ7 A;  4BL0 B;  3GO5 A;  4JQF A;  2P6S A;  3G73 A;  5DM6 F;  1TW3 A;  1WJB A;  1LKX A;  4GYG A;  2BEO A;  3GTG J;  5CLS A;  4KIF A;  5C44 J;  1B8I B;  4M9X A;  3KP7 A;  3ZP5 A;  2DMU A;  2E7X A;  1FZP B;  2LSO A;  4II2 A;  2VOO A;  3ZQ7 A;  2HNH A;  1TLH B;  3IC7 A;  5E20 A;  3AFH A;  2FX0 A;  4OAZ A;  2JA7 J;  2ID6 A;  1F36 A;  4A0Y A;  1S7E A;  1BI2 A;  4BJ6 C;  1PP7 U;  1FX7 A;  1YOV B;  5FD6 A;  5ILU A;  4EAT A;  4QTR A;  1I1S A;  2LDU A;  4JX4 A;  2R7R A;  5J3L A;  5HOO A;  4AD9 A;  3AG3 H;  4L9J A;  4B8X A;  1ZRD A;  3JRF A;  2AXT C;  2DA7 A;  2LBF A;  1IXR C;  4EQQ A;  4BUP A;  1FTZ A;  1Y1W J;  3ZXS A;  2HEO A;  4CCJ A;  2W7N A;  1MBF A;  2M34 A;  3BG6 A;  2ZXH A;  4GDF A;  3WOD F;  4YRV A;  1R7J A;  4OWR B;  4KNY A;  5FKM A;  1KQ9 A;  3HRM A;  1S6L A;  3S93 A;  3U2R A;  4C3H J;  1JE8 A;  1ZRC A;  1TBX A;  1R6R A;  4CYD A;  4M6X A;  2IGO A;  2P8T A;  1UAA A;  2EZK A;  1I39 A;  2MGQ A;  1MBE A;  4ASN A;  2HS5 A;  1D1B A;  1QNT A;  5E1Z B;  1P4A A;  1J2X A;  5K7Z A;  2ZXI A;  3KYD B;  4AIK A;  2JUG A;  3FMQ A;  1R4M B;  5EG0 A;  2E7W A;  1QGP A;  1BR1 A;  3C2G A;  1R49 A;  2K9Q A;  3M8J A;  3OOP A;  5DV5 A;  5ERI A;  2CQX A;  2FJ1 A;  4G12 A;  5F08 A;  4JX6 A;  1DUX C;  3KE2 A;  3BP8 A;  1RC9 A;  2ELJ A;  2EQR A;  1MJ9 A;  3OS0 A;  3MKZ A;  1U2W A;  1XTA A;  4CO8 A;  1L3L A;  2A69 F;  1M1E B;  2VI6 A;  4GFB A;  3F23 A;  2QEX I;  2X6X A;  2FML A;  1TQP A;  4LLL A;  1XG1 A;  5L3B A;  4ZTF A;  1KA8 A;  2K85 A;  4BHB A;  4MHG A;  3G4S I;  2VKE A;  3OYM A;  3H92 A; 
#chains in the Genus database with same CATH homology
 1U9N A;  1BJZ A;  3S17 J;  3HOU J;  5M5Y J;  2IBD A;  3PO3 J;  4C2M J;  1U78 A;  1QVU A;  4I76 A;  3BT9 A;  5GPC A;  1HDD C;  3S1R J;  1CQT A;  3Q0V A;  1OCP A;  1VND A;  1DU6 A;  1A6I A;  3S1Q J;  2XB5 A;  1ENH A;  2NVT J;  2ID3 A;  1I50 J;  3BG3 A;  2R5Y B;  1IRZ A;  2COB A;  1ZK8 A;  1B8I A;  2MSY A;  4UUS B;  2GM4 A;  1IG7 A;  5FKO A;  3RZO J;  4Y7N J;  2FQ4 A;  3RQI A;  3HOY J;  4M3E A;  1NTC A;  1BA5 A;  2VPR A;  2XGC A;  3JRH A;  1IV6 A;  3SDG A;  4AC0 A;  2YUS A;  2WB1 N;  4FE7 A;  1ZR2 A;  2D5V A;  5EZG A;  3HOV J;  3O8H A;  4D7N A;  1ETK A;  4DYC A;  2E1O A;  2O9L A;  1RR7 A;  2R93 J;  5GP9 A;  1X2M A;  1XC5 A;  1LFB A;  2ECB A;  5IYC J;  2ME0 A;  1JJ6 C;  1WGX A;  4XK4 A;  2LY9 A;  5M5X J;  1SFO J;  3BR0 A;  1ORK A;  5EG0 B;  1O4X A;  1ZGW A;  2O8K A;  2HOS A;  4BY7 J;  2JN6 A;  2XGE A;  2R0Q C;  1MSF C;  1FJL A;  2FD5 A;  4A69 C;  5EZH A;  4MFE A;  2NVQ J;  2R92 J;  2EH3 A;  2NVY J;  3CCY A;  4IHY A;  1ETQ A;  5DTD A;  3MKL A;  2WAQ N;  3G1O A;  2OF7 A;  4A3J J;  1PUF B;  4D5F A;  1JT0 A;  2LR8 A;  3HDD A;  2DA4 A;  3O8G A;  5EGO A;  4CYC B;  3A01 B;  4BY1 J;  5E3M A;  1RKT A;  1MH4 A;  5F0C A;  2DMQ A;  2IAI A;  3H0G J;  3GTO J;  1U9O A;  4D5C A;  4FIS A;  1HCR A;  1ZR4 A;  1MSE C;  4M3F A;  1IJW C;  1Q1V A;  3JRC A;  3JR9 A;  3JRB A;  4X1E A;  3RZD J;  1T56 A;  3H3V K;  5IPA A;  1FEX A;  3QQA A;  2Y2Z A;  4JYK A;  4A3D J;  1F43 A;  5FLM J;  1W0U A;  4IHX A;  3FK7 A;  2MG4 A;  2R5Y A;  4A3C J;  2ELK A;  1OCT C;  1RKW A;  1ETV A;  1JT6 A;  2O7O A;  1B72 B;  2M0C A;  2LP0 A;  2AHQ A;  1FIP A;  2NVX J;  2XPV A;  3PM1 A;  4I6Z A;  2X6O A;  4MIM A;  4AYB N;  3WHB A;  2LKX A;  3MVP A;  1QRY A;  1APL C;  2LTP A;  2OPT A;  4XRM A;  4A3F J;  5F1J A;  1IDY A;  2X48 A;  4A3M J;  2R7Z J;  3BTI A;  4X6A J;  3GTK J;  1FTT A;  2HI3 A;  4V2F A;  3FIW A;  1POG A;  1GUU A;  4NDL A;  3S2H J;  3HB9 A;  4UUS A;  4C3I J;  4A3I J;  1VFC A;  1ZQ3 P;  1TWC J;  5E3N A;  1IDZ A;  1ETO A;  3HEF A;  5EEA A;  2N8G A;  2HYJ A;  3TP0 A;  2HOT A;  5EF6 A;  1WH7 A;  3BR3 A;  3Q3S A;  1TWA J;  5F0H A;  3JRA A;  3JRD A;  4XRS A;  3HGG A;  3BR2 A;  4JX5 A;  3B6A A;  3JRI A;  4M3B A;  3JRG A;  3BQZ A;  1EF4 A;  2EBI A;  1BW5 A;  4J19 A;  2IEK A;  3ZQH A;  1IC8 A;  5IYD J;  4A93 J;  2M9H A;  3BG9 A;  5DS9 A;  3A01 A;  2Y0S N;  2XB0 X;  3S1M J;  2L9R A;  3OOU A;  5GPA A;  3I4M J;  5K7F A;  1OJL A;  1X2N A;  2E2I J;  2PMZ N;  3CMY A;  1AU7 A;  2EZL A;  1BL0 A;  2B63 J;  3Q0U A;  2HOA A;  5HOD A;  1TWF J;  1WCM J;  2YU9 J;  3I4N J;  1ETX A;  2P81 A;  2Y9Z A;  3TW6 A;  4MLO A;  2Y9Y A;  3D1N I;  3SFI A;  1ETW A;  4EEF G;  3HBL A;  3F0C A;  2YS9 A;  5F0F A;  2GLO A;  1UG2 A;  3HOZ J;  4MFD A;  2CJJ A;  3CQZ J;  1HDP A;  1NK3 P;  4CYC A;  2ECC A;  1HLV A;  5C4J J;  5E3L A;  1HF0 A;  5J1Y A;  2Y30 A;  3A02 A;  2DA1 A;  3S15 J;  2DJN A;  4BBR J;  1GDT A;  3BQY A;  2WV1 A;  3LSP A;  5C4X J;  1RPW A;  2TRT A;  3LOC A;  4BXX J;  2K40 A;  4RBO A;  2DN0 A;  2DA5 A;  3LSG A;  4L5E A;  1JTY A;  5J1U A;  4MO7 A;  1JKR C;  2CQQ A;  2JA6 J;  2M2E A;  4A3L J;  1RET A;  4M3G A;  1YRN B;  3SJM A;  5J1R A;  5IP7 J;  4XIC A;  1AHD P;  2Y31 A;  2R5Z B;  1LE8 A;  3GTQ J;  3IH2 A;  1Z0X A;  3DCF A;  3PO2 J;  4DZJ A;  2DMT A;  2VKV A;  1LFU P;  1OFC X;  5IOZ A;  3M3Y J;  3BR5 A;  2ZB9 A;  3FIS A;  2JA8 J;  2RAE A;  3LSJ A;  3HOW J;  5C3E J;  1ZTR A;  5IOY A;  2CU7 A;  3ZQF A;  3IH3 A;  1GV2 A;  1GV5 A;  3OIO A;  4HNV A;  5FJ8 J;  1IGN A;  1JUM A;  1ZKG A;  5FKL A;  4JP0 A;  3WHC A;  2X9D A;  1SAN A;  1JKQ C;  1G2H A;  4B1R A;  5FKN A;  3HOX J;  1JGG A;  1K83 J;  3FK6 A;  2W48 A;  1JUP A;  3G1M A;  2DMN A;  2HDD A;  1E3O C;  1UMQ A;  1GT0 C;  1JKP C;  3BG5 A;  3C2B A;  1RES A;  4IEJ A;  2QCO A;  2LD5 A;  3S1N J;  2H8R A;  1H8A C;  4A3E J;  1R9T J;  1TC3 C;  5K7H A;  4DYQ A;  3GBG A;  2M8G X;  1MNM C;  5FKK A;  4DZP A;  4FTH A;  1WPK A;  3ZQG A;  4AUX A;  4FE4 A;  1Y1V J;  2XPW A;  4S0H B;  4UUT A;  3CDL A;  2R5Z A;  1AKH B;  3A03 A;  3LSR A;  2G0E A;  2DA2 A;  3BR1 A;  2L7F P;  5M3M J;  4V2G A;  3NAU A;  3BTC A;  3GTL J;  1WI3 A;  2H1K A;  4DYR A;  4B4C A;  2HXO A;  5F27 A;  2ME6 A;  4XRS G;  2NOG A;  2E19 A;  2QF7 A;  1MBG A;  3LNQ A;  4BBS J;  1JUS A;  2CUF A;  3HM5 A;  3DEW A;  1I6H J;  2JMW A;  3B6C A;  9ANT A;  1JKO C;  1H88 C;  1IUF A;  2DA3 A;  1P7J A;  4A3K J;  5E3O A;  3Q0W A;  3K2A A;  5EYR A;  3UKG A;  1MBK A;  5F04 A;  1XS9 A;  2VUM J;  4B3A A;  2EZH A;  1VI0 A;  4QIW N;  1T33 A;  2JWT A;  4W1U A;  2KDZ A;  2L0K A;  1U8B A;  1JJ8 C;  5IP6 A;  2DMP A;  4D7M A;  3BTL A;  2TCT A;  1H89 C;  3OSF A;  4W97 A;  2HXI A;  3QPS A;  1NK2 P;  1AKH A;  4A3G J;  1PUF A;  4LOC A;  2XRL A;  1UHS A;  3TW7 A;  5M3F J;  1JTX A;  2LFB A;  1MBJ A;  3S2D J;  4XID A;  4M6V A;  5JLX A;  3W6V A;  2JJ7 A;  4A3B J;  2AO9 A;  4IHV A;  5IP9 J;  2JK3 A;  1TWH J;  2HQ5 A;  2JA5 J;  3NAR A;  3GTG J;  3GTM J;  5C44 J;  2LLK A;  1WH5 A;  1B8I B;  1QVT A;  2CRG A;  2DMU A;  3ZQL A;  1VF9 A;  4ABZ A;  4IHW A;  3RKQ A;  5FLV A;  1W0T A;  5EDN A;  2FX0 A;  2K9N A;  2E2J J;  2JA7 J;  1B72 A;  3S16 J;  3IV5 A;  2ID6 A;  1F36 A;  2LVS A;  1S7E A;  1QPI A;  2L7M P;  2XGD A;  1BW6 A;  3IH4 A;  4C3J J;  2DTZ A;  1MBH A;  4QTR A;  1TWG J;  2MW8 A;  3E7L A;  2XSD C;  4JX4 A;  3BR6 A;  3ZQC A;  2K9S A;  5J3L A;  5IYB J;  1I3Q J;  5M5W J;  3K7A J;  5JLW A;  3JRF A;  2DA7 A;  4BKX A;  1FTZ A;  1Y1W J;  2GBY A;  4FCY A;  1X58 A;  4RDU A;  1MBF A;  2M34 A;  2LK2 A;  3FKI J;  3JRE A;  3VPR A;  4DW6 A;  4Y52 J;  3GTJ J;  5FKM A;  4C3H J;  5BNG A;  1ITY A;  1K61 A;  3HGY A;  2EZK A;  2MGQ A;  1MBE A;  3HKZ N;  3G1L A;  1P7I A;  3TP3 A;  5K7Z A;  2XPU A;  2EZI A;  3M4O J;  1HOM A;  2DA6 A;  1ETY A;  3TED A;  1Z77 A;  5EGO B;  5EG0 A;  2E2H J;  2NS8 A;  1FIA A;  1MH3 A;  1YRN A;  1GVD A;  2K9Q A;  3GTP J;  1LE8 B;  1DU0 A;  5F08 A;  2CQX A;  2FJ1 A;  3BTJ A;  4G12 A;  3L1P A;  4JX6 A;  3QPL A;  3MN2 A;  2L7Z A;  2CUE A;  2EQR A;  3S14 J;  1D5Y A;  3ZOB A;  2KT0 A;  4QSH A;  2VI6 A;  2I10 A;  4GFB A;  2NS7 A;  4M3D A;  3OSG A;  1XG1 A;  3ZQI A;  2VKE A;  1A5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...