5IYCJ

Human core-pic in the initial transcribing state
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iycJ00
1HOMA 3OIOA 3IH3A 3LSJA 5M3FJ 5EYRA 4C3JJ 4J19A 1A5JA 1IV6A 1AHDP 3M3YJ 3M4OJ 4MFDA 2JMWA 3RZOJ 5C44J 1IDZA 1E3OC 2K40A 1YRNA 4A3MJ 4MFEA 5M5YJ 2O9LA 3BQYA 3QPLA 2M9HA 3ZQIA 2WV1A 5HODA 3O8GA 3BTLA 4C2MJ 1QRYA 4AC0A 5K7HA 1JT0A 1ZKGA 3ZQHA 3C2BA 5IOYA 2XPVA 4FE7A 4C3IJ 3B6CA 3LSPA 2QCOA 3JRCA 1JUSA 1MBFA 4IHYA 1CQTA 3GTLJ 2HOAA 5C4JJ 4A3CJ 3HOZJ 1S7EA 3BR2A 2DA3A 1RESA 5JLWA 2K9NA 4D7NA 4BY1J 1D5YA 3RKQA 4QTRA 4I76A 3FIWA 3OSFA 2JA8J 3HGGA 3LOCA 4X6AJ 5DTDA 3HDDA 3LSRA 5GPCA 1ETVA 4QSHA 2XPWA 1H8AC 5IP6A 2JN6A 2DTZA 1IJWC 4MO7A 1GDTA 3BR6A 2JA6J 1WH7A 1QVTA 4AUXA 3IH4A 3SDGA 1TWCJ 5EF6A 2B63J 5DS9A 5EG0A 3JRFA 2RAEA 2FD5A 3OOUA 5FKLA 2HI3A 1B8IB 2AHQA 2AO9A 3G1LA 5FKNA 4XRSG 4A3EJ 2E2IJ 1F36A 2N8GA 2O8KA 1SANA 5GPAA 4M3GA 1IC8A 1QVUA 1UG2A 4X1EA 3B6AA 1JUPA 3FISA 3NAUA 2XB5A 5E3OA 4BBRJ 1QPIA 5FLMJ 3DCFA 3JRHA 3Q0UA 4DYQA 1EF4A 1RETA 3JRDA 2COBA 2LY9A 5EZGA 2JA7J 3MN2A 2NVYJ 2ME0A 1MBJA 2LR8A 2TCTA 4B4CA 4Y52J 1LE8A 3TP0A 3A02A 2DJNA 1BL0A 2L7FP 1IG7A 4JP0A 1JKQC 1BA5A 4M3BA 3JRAA 1Z0XA 2LLKA 1DU0A 3HOYJ 2PMZN 5C4XJ 1X2MA 2R7ZJ 2MW8A 3TW7A 2XGEA 4D5FA 3TP3A 2R5ZB 1PUFB 2VKVA 2K9SA 2R0QC 3A01B 3GTGJ 2X6OA 1Y1VJ 2ZB9A 2NVTJ 5JLXA 4XIDA 2NS8A 4UUTA 1TWAJ 2G0EA 5BNGA 1MBHA 1FIAA 2VPRA 2IEKA 4IHVA 4EEFG 4IHXA 3HKZN 5FKMA 2HYJA 1JT6A 1MSEC 1NK2P 5FKKA 2LFBA 2DA5A 2XGDA 5M3MJ 3ZQFA 1JJ6C 4A3FJ 2L9RA 1NTCA 4DZJA 1OCPA 1P7IA 2ECBA 5EGOA 5FLVA 2H8RA 4JX5A 4FTHA 2VUMJ 5EZHA 1W0UA 4XICA 2KT0A 2YS9A 3IV5A 1JGGA 1TWHJ 4ABZA 1DU6A 2MGQA 4M6VA 2LK2A 1WCMJ 4Y7NJ 3WHBA 3PO3J 2CQXA 1MBKA 1K61A 2JWTA 5J1UA 4QIWN 2LTPA 1MNMC 3W6VA 2IAIA 3F0CA 5F0FA 2E2JJ 2DMNA 3HGYA 2TRTA 3SFIA 1IUFA 2R5YA 2EH3A 4I6ZA 4XRMA 2DMUA 2XGCA 1O4XA 1X58A 3QQAA 1AU7A 3BR5A 1ETQA 4JX6A 2GBYA 4B3AA 1NK3P 3HOXJ 2HOTA 1U78A 9ANTA 4S0HB 1ETXA 1MH4A 4JYKA 3Q0WA 2L7ZA 1MBEA 1WI3A 5M5XJ 3ZQCA 2HOSA 5EEAA 2JJ7A 2XB0X 3ZQLA 3GTOJ 2O7OA 1W0TA 3BG5A 4FISA 5C3EJ 1R9TJ 1BW6A 3PO2J 1TC3C 2HDDA 1FTZA 2Y31A 1MBGA 2DA4A 2Y2ZA 3QPSA 3BG3A 4BXXJ 1X2NA 5EG0B 2R92J 3RZDJ 2OPTA 5FJ8J 1ETYA 5EDNA 4A3IJ 4XK4A 5IYCJ 1GT0C 1IRZA 3JRGA 3FK7A 2CUFA 2NOGA 2ME6A 1MSFC 4B1RA 1RKTA 4BY7J 2E19A 1ENHA 4GFBA 1TWFJ 2LD5A 4RDUA 4NDLA 4LOCA 2EQRA 5F27A 3HOWJ 3HOUJ 1RKWA 1ZR2A 2DA2A 1VF9A 5K7FA 1LE8B 5FKOA 3GTJJ 2X9DA 1ZGWA 3I4MJ 2DMPA 3HEFA 1RR7A 2E1OA 4D7MA 1IGNA 4FCYA 1BW5A 5F08A 1LFUP 5F1JA 3CMYA 3H0GJ 1AKHA 2DA1A 1G2HA 2DA7A 1HLVA 5E3MA 3CDLA 1OJLA 1ZQ3P 1B72A 3FK6A 3BTCA 2NVQJ 1GVDA 1WH5A 1VNDA 1U8BA 2JK3A 1JKOC 4CYCA 2LVSA 4A69C 3S1MJ 4W97A 5IYBJ 5GP9A 1JKRC 4A93J 3S14J 2R5ZA 2MSYA 4UUSA 2FX0A 5IPAA 2LP0A 3S2DJ 2CU7A 4MIMA 1ZTRA 2HQ5A 1UHSA 1RPWA 5M5WJ 3JR9A 3GTPJ 4DW6A 4HNVA 2K9QA 4RBOA 3A03A 2YUSA 5E3LA 1YRNB 2CRGA 5EGOB 2LKXA 1HCRA 2VKEA 2WAQN 3HB9A 4A3DJ 2XSDC 3MVPA 1GV5A 5J1YA 3S1RJ 1SFOJ 3S16J 1I3QJ 3G1OA 1LFBA 3BR1A 3DEWA 3LNQA 2FQ4A 2CJJA 1XG1A 3G1MA 1A6IA 3O8HA 2EBIA 1JUMA 3GTQJ 2Y30A 3MKLA 5IOZA 4JX4A 1BJZA 2ID6A 3UKGA 2P81A 1UMQA 1HDDC 1U9OA 2L0KA 5F0CA 5E3NA 2R5YB 1TWGJ 4BKXA 3JRBA 3BG9A 4A3LJ 1FTTA 3GTMJ 3CQZJ 4V2GA 2M8GX 3HBLA 4V2FA 3HOVJ 1VFCA 5IP7J 2KDZA 5J3LA 3I4NJ 3GBGA 2M0CA 2QF7A 1APLC 3H3VK 1WGXA 4M3DA 1XC5A 1ETKA 2Y9ZA 2EZLA 1OFCX 2ID3A 2X48A 2FJ1A 4IEJA 3GTKJ 5F0HA 1JTXA 5K7ZA 4L5EA 2ECCA 4BBSJ 4MLOA 3D1NI 3S17J 3K2AA 3PM1A 2OF7A 1P7JA 3K7AJ 3LSGA 4G12A 3VPRA 2ELKA 2Y0SN 1I6HJ 1FEXA 3BTIA 1FIPA 2NVXJ 4A3GJ 1ITYA 1ETOA 1ZR4A 1H89C 2GLOA 2CQQA 2DA6A 1JTYA 2YU9J 3BQZA 4A3JJ 1HF0A 1VI0A 5IYDJ 2W48A 5IP9J 3NARA 2M2EA 3FKIJ 2GM4A 1B8IA 1T56A 1JKPC 2D5VA 2EZKA 3SJMA 2WB1N 2EZHA 2DMQA 1FJLA 2NS7A 4A3KJ 3Q0VA 1F43A 3ZOBA 2E2HJ 1I50J 3S1QJ 3BR0A 1Z77A 4DYCA 3RQIA 3Q3SA 2H1KA 3L1PA 3ZQGA 1JJ8C 4IHWA 2CUEA 3TEDA 1ZK8A 5J1RA 3BTJA 4DYRA 3BT9A 4M3FA 1AKHB 2L7MP 3BR3A 4M3EA 4C3HJ 4D5CA 1Y1WJ 3JRIA 2MG4A 3S2HJ 3S15J 3IH2A 4XRSA 1ETWA 1XS9A 1B72B 4FE4A 2VI6A 2R93J 4CYCB 4A3BJ 2M34A 2EZIA 1POGA 1PUFA 3A01A 4AYBN 1GV2A 2XPUA 2HXIA 1HDPA 1T33A 1IDYA 3WHCA 3JREA 1ORKA 2I10A 4UUSB 1WPKA 2DN0A 1H88C 3TW6A 3E7LA 2Y9YA 2HXOA 4DZPA 1MH3A 5F04A 1OCTC 2JA5J 2XRLA 3CCYA 3S1NJ 2IBDA 1Q1VA 3HM5A 1GUUA 1K83J 4W1UA 2DMTA 3OSGA 1U9NA
chains in the Genus database with same CATH superfamily
1HOMA 1CGPA 4ZZLA 5CYVA 3OIOA 3H5RA 4C3JJ 4J19A 4Z6YA 1MW7A 1AHDP 3M4OJ 2VQGA 4ZYHA 1A5JA 1GXQA 3OYIA 3I53A 3RZOJ 2X6WA 2E5ZA 3BJAA 3HKZA 1YW7A 5DV5A 5FGMA 2K7LA 4C9YA 4I99C 2K9MA 2G9WA 5DDGA 5HNHA 2AXTC 4H4KC 5M5YJ 3ROUA 2VJJA 2TDXA 2O9LA 2K86A 3F8MA 3HRSA 2IGNA 2GQQA 3JTHA 4II2A 3WTXC 1ZH5A 3TQNA 1OYWA 3BTLA 2DPDA 3ZQHA 1WJBA 3LSPA 3GFMA 2Z16A 4IHYA 5E8IA 1O7LA 1MMAA 3L2WA 4A12A 3LSTA 4CO8A 2ISYA 1RR8C 2LG4A 2DFHA 3GUDA 5E20A 2DA3A 2K9NA 4L9VA 4XKBA 1FYLA 2L9SA 4LMYA 3OS0A 5FFZA 3CMEI 3ABLH 4UVAA 3L2QA 3FIWA 3ZQ7A 2EA4A 2WAEA 2JA8J 4PJLA 2HGCA 3WG7H 3HDDA 2W57A 2VXZA 3F9KA 2UUZA 4O6JA 1I1GA 1XN7A 3BPVA 1XSVA 3W3CA 5D5WB 4E6KG 3I3LA 3MEXA 2JN6A 3FMRA 4XORA 1GDTA 3CLOA 3RKYA 1VZ0A 3BR6A 4LIUA 5F6FA 5LEKA 4E7HA 3IH4A 4GO1A 2CMPA 1E17A 2PJRA 1BM9A 5EF6A 3P7NA 5EG0A 2FD5A 4YG2F 5FKLA 2GZWA 3N4MA 1U5TB 4XRSG 3E0JB 2VE9A 1DP3A 5ILSA 1OCRH 5GPAA 3PJRA 1BIAA 4AIDA 2DJIA 1QVUA 4BYYA 4AU7A 1JUPA 2H6BA 1D8KA 4G9YA 4BBRJ 1H9TA 4M72A 3W2AA 4XN0A 2ZJRF 1EH7A 1RZ4A 3AFHA 3BDDA 5LFAA 4UUVA 1T08B 2COBA 4OIOF 2JA7J 1R36A 4Q48A 3L2UA 1MBJA 2FA5A 5LGTA 1Z3YA 2LKPA 3FXKA 4BHBA 1R4MB 4HQEA 2DJNA 4XN3A 3LSKA 3M1CA 4IL6C 1Z9CA 2IGKA 2L7FP 1IG7A 2JPBA 4BE0A 1JKQC 3DTKA 3Q5FA 1FP2A 2XASA 3CLQA 3HC7A 4GXOA 4M3BA 1Z0XA 4N9IA 4PJ0C 2CO5A 2Y48A 1SVOA 3VYRB 3ERMA 3TW7A 4D5FA 1BI3A 1Z1DA 2JSCA 1PUFB 5BQTA 1MZBA 2KISA 2L54A 1IF1A 2X6OA 1Y1VJ 4ZC3A 2NVTJ 3OIPA 3F8FA 4UHTA 2FU4A 3KETA 2NS8A 3RYPA 5HLHA 1MJBA 3H9GA 2HZTA 1X1AA 1USSA 4CDGA 4RB2C 1QZZA 3LMMA 2G0EA 5BNGA 2XROA 2QLZA 3SZGA 2ZMEC 4MEYF 5LBQA 1FZPB 1IN8A 4NC6A 5ERIA 1TQIA 2HNHA 3HKZN 2VQHA 1EH6A 1SAXA 3J7AO 5J4YA 3OY9A 5ED4A 3IHUA 4IO9F 1YQAA 4AM3A 2V7FA 5DCMB 3ZQFA 2K02A 2L9RA 1NTCA 2R7SA 1TP4A 5EGOA 3LQRA 1R7JA 2W84A 2LSOA 4HAMA 3O2PE 4LK0F 1S3JA 1YX3A 4UVBA 3SXYA 3NEUA 4XICA 3PNYA 1R49A 2O3FA 2FEZA 3FBIB 1LJ9A 1OMIA 2MGQA 3KPHA 1WCMJ 5ICFA 4WXDA 1U2WA 2CQXA 2VT2A 2JWTA 4M6XA 5J1UA 2LTPA 4BAYA 1MNMC 4KISA 3FXUA 1VQ7I 4ENKA 3HGYA 3A2KA 5AIQA 1ZREA 3SFIA 1ZN2A 5DEQA 5E1WA 4B09A 2L3DA 2DMUA 4GCVA 4PJNA 1O4XA 4GYGA 1RIOH 2O61A 2XAFA 3I59B 2VOPA 5ILVA 4JX6A 1YYVA 4AIHA 1EKEA 4HQMA 5HLGA 4EJWA 1BJAA 2CQKA 4RA2A 3CCQI 4EJVA 4DBQA 2BHZA 4M6YA 4HG2A 3VOEA 4L5JA 3ZQCA 2FNAA 5IY5H 5EEAA 4TV7A 4G7OF 4IJAA 1R1TA 1XMXA 4PJMA 5LGNA 4F7ZA 4BQAA 5CVIA 3FXMA 4CYDA 2ACJA 3MZ8A 4KJZA 4HF0A 4HRIA 2F4IA 5EJCA 2Y2ZA 2IVMA 3A1YA 2VQCA 2QSHX 2ZSHB 1ETYA 4A3IJ 4V19K 3DBHB 1EH8A 3K1MA 4BXFA 5IYCJ 1GT0C 4MGRA 4F52A 1PYVA 4WWCA 1USTA 3IRQA 4ZTJA 2KZVA 1MJAA 3GMEA 5BMZA 1MSFC 2IP2A 5GADJ 2DCEA 1S7AA 4AD9A 4BY7J 2E19A 1ENHA 4GFBA 2VL8A 1G3WA 3HIFA 2LD5A 3H9QA 4NDLA 1LDKB 2A61A 1FPQA 1W36C 2Z33A 4HA8A 3S32A 3HOUJ 3AKZA 1ZR2A 4NUBA 3O3KA 2R7VA 1JI8A 1LE8B 4H0EA 3CF2A 3FHNA 2M3AA 4CA0A 2WBMA 2HWVA 1FNNA 2EV5A 2JTVA 2M30A 1RR7A 2E1OA 1IGNA 3P9CA 4CHUA 5F08A 1PP7U 2HYFA 4LGWA 4N4OB 5F1JA 3H0GJ 1Y39A 2H27A 1R5ID 2M0MA 4Q47A 4Z2YA 4X0GA 4DQ2A 5E3MA 1ZQ3P 1B72A 1K79A 3BTCA 1YJNI 1TT5B 2M1BA 4U87A 1U8BA 5HOOA 1FBUA 1VQ9I 1FBQA 1YS6A 2FMYA 4YFXF 3S1MJ 2W24A 4RGRA 2DFEA 5GP9A 5IYBJ 4HZFA 4A93J 3PUFA 3S14J 1IXCA 2FQ3A 2VQLA 2G7HA 1FOYA 1ZG5A 2X0LA 3VODA 2HYGD 5IPAA 3WU2C 3K4CA 3S2DJ 1IUYA 2CU7A 2O03A 1SD4A 1UHSA 4RS8A 2F5DA 3JR9A 2MH9A 1OYIA 2K9QA 3A03A 2QBYB 3E97A 4IVNA 2RVCA 2CRGA 5B1BH 4U7BA 3M8JA 3A0BC 4BEHB 4BL0B 2A6TA 2EIMH 2XSDC 1LEBA 4KMUX 2EB7A 2Y75A 1LFBA 4G6QA 1REPC 2R7XA 1YTYA 1X19A 1ACIA 2DI3A 2XRNA 4I01A 5FRMA 3D5LA 4PZJA 2ZFWA 3HUGB 4HPQA 4RGSA 1A6IA 3GCMA 1IV8A 2EBIA 4XRFA 1JUMA 2NNYA 3MKLA 4M9ZA 5IOZA 5CQEA 1BJZA 1G59A 1HDDC 4ITVA 2L0KA 3EUAA 4B48A 5E3NA 1TWGJ 2LRDA 3H5NA 3BG9A 1QQIA 3OYGA 2BHYA 4V2GA 2BVLA 2UXXA 1ZRCA 3VDXA 2QUFA 2WY7Q 3S3MA 2D1VA 3G71I 5E8GA 4BQNA 3I4NJ 2ZXJA 2M0CA 3GFLA 2STWA 1YX5A 2L9VA 1K78B 3QYBA 2UZKA 2DAOA 4M3DA 3H3ZA 1ETKA 4D1QA 3KEOA 2EZLA 3GLXA 2KLOA 2X48A 4IEJA 5F0HA 2EFOA 1JTXA 5K7ZA 2Z99A 4L5EA 2B7EA 2ECCA 2HEOA 5TJJA 2OF7A 3KIOA 3WTSC 3LSGA 4G12A 2J5PA 5KNLA 2DBBA 4HNTA 2VKHA 1IO2A 5GTHC 5L3FA 2Y0SA 2E1CA 4HSTA 5HDGA 5F64A 2RQQA 2R7WA 4UV8A 3KCCA 2RDPA 2YU9J 1SEUA 2EK5A 2PMUA 1I1SA 1SFKA 3CP8A 3TO9A 1Z91A 2XVCA 2DOFA 2LY2A 3VYSB 3FKIJ 1A6QA 1JKPC 2D5VA 1LFPA 3VYTB 2DMQA 2LH9A 3ESWB 3KLNA 5TISC 4A3KJ 4HV5A 3Q0VA 2EJRA 3AG4H 1F43A 4F92B 2XKPA 3CCVI 4FX0A 3S1QJ 4DYCA 3PQKA 2ZFUA 2BZTA 3MMYB 3PSFA 5IT9K 4CICA 3R4KA 2H1KA 3W2WA 1JJ8C 2ETHA 1BC8C 2Y69H 4XM3A 3RKWA 2M4GA 3BTJA 3J7ZI 1AOYA 4XKVA 1VTNC 1AKHB 2ZXIA 3F6OA 1MMNA 4D5CA 1Y1WJ 3ASNH 3JRIA 1PVEA 3S2HJ 1OISA 1WSUA 2K9LA 1HC8A 1ETWA 1XS9A 3IL2A 3HG9A 4ETSA 3JTGA 4E7KA 4EATA 2JVGA 2Z1DA 2VJ5A 3LA7A 2H1LA 3TO6A 4RAZA 1MDMA 3E5QA 2QZ8A 1VQ4I 3WHCA 1ORKA 4DNCA 2I10A 1WPKA 2KIFA 4OMYA 5BOXA 2PMZA 2Y9YA 2V9VA 1EA3A 3GLLA 1WI9A 2JA5J 2XRLA 3WGGA 1DPRA 2QQBA 1Q1VA 2MLGA 3OYNA 2Z3YA 3ECHA 1GUUA 1DDNA 4IQJA 2Z2SB 2DMTA 4W1UA 4MTDA 3OSGA 1U9NA 2LBFA 2W85A 2CV0A 1HKQA 3HYIA 4J01A 3H0DA 2JQ7A 2JMWA 3PSIA 3ULQB 5C44J 1RNLA 2VOOA 2I5UA 3S3NA 1E3OC 1YRNA 1VQ6I 3J81K 5JR3A 4A3MJ 1MIJA 3LAJA 1SD5A 4RLFA 1MMSA 1SD7A 2LMDA 4ANJA 3BQYA 3LAPA 1Z6RA 5LHIA 4MEXF 2GA2A 3O8GA 3H9JA 1F4KA 5K7HA 1XGMA 3BWGA 3C2BA 2MBFA 1VQPI 4FE7A 1O7FA 2QCOA 4M9XA 3JRCA 2KZGA 4K2EA 5TRDA 2CFOA 1R58A 4KNYA 5GAGJ 3OYBA 1CQTA 2GWRA 4BJ5C 3GTLJ 4ZYEA 4A3CJ 1S7OA 1J75A 1RESA 3NWSA 1WWXA 2L5QA 5JI6A 1B9MA 4BNCA 1BI0A 2HQRA 2V1DA 3DKXA 1D5YA 3RKQA 1UJ8A 4ZYDA 3VWBA 5DTDA 2OTJI 4XLAA 3WODF 3IKTA 2JVHA 4FQGA 1VQLI 2NRAC 4MQVA 5A2QK 2DODA 2XAUA 1K6OA 4LG0A 1IN5A 4QSHA 1TW2A 5IP6A 1IJWC 3F8NA 3M1EA 4MO7A 4CCLA 4IOAF 2JA6J 4XNFA 3BG7A 3F23A 1N77A 3KEYA 4KIGA 3QRFF 1G3SA 1QNTA 4N4NB 1TWCJ 4BGDA 2KPMA 3TKYA 2NOJB 5DS9A 4UXNA 2HVRA 4CCMA 3FXOA 2HI3A 3J81Z 2AHQA 3G1LA 2VC0A 3OR1C 5FKNA 4A3EJ 2E2IJ 1F36A 1D1BA 2N8GA 2EIKH 3EYIA 1SANA 3K0LA 3K9TA 3Q9SA 3BJ6A 2KL4A 3KLOA 3MQ0A 3B6AA 1YITI 1F9NA 2XB5A 2RQPA 4EJOA 2XAHA 4ZJZA 3JRHA 4YFNF 3R0JA 2HVQA 1EF4A 2IRFG 3SZTA 1RETA 1G4DA 2ZC2A 3JRDA 2NVYJ 3E1SA 3OL4A 1YOVB 2TCTA 4B4CA 2LY1A 3TP0A 2ESNA 5LHHA 1BL0A 2NXNB 3CF5F 4HEA2 4E7LA 5L3DA 2E5NA 5ILUA 1TBXA 2K4JA 3CCLI 3JRAA 4HW0A 1FSEA 3F21A 1Y8RB 5CVVA 2PMZN 2KQRA 4QLCU 2XGEA 1PUEE 2V9PA 2VODA 2DQLA 2VKVA 2BE5F 3DBRB 5A2QZ 3GTGJ 3MFKA 5CJ9A 5JLXA 2VBYA 4UUTA 3R61A 1TWAJ 3OS1A 4OIPF 3AL0C 2L01A 1XCVA 1XDUA 4IF4A 3G2BA 2HTSA 1MBHA 1KONA 2VPRA 3K4KA 3H36A 2O0YA 3DF8A 3WTTC 2IEKA 4EEFG 2RREA 3PIOF 5FKMA 5K5RA 4XLHA 1MSEC 4OWRB 3RDIA 3FF5A 2M5WA 3ELKA 2JRMA 2OBPA 4CXFA 5M3MJ 2O6GE 1DGWY 4RB1A 4HLXA 1JJ6C 2H8WA 4DZJA 1OCPA 1P7IA 2A68F 2RKHA 2WADA 3E6BA 3X2QH 4HDVA 3GFJA 1YW9A 5L3BA 5J8CA 1VQ8I 4NC8A 5HS9A 1Z3XA 1NG7A 2UXNA 1W0UA 3FX3A 1MMDA 4XKCA 2KT0A 4A0ZA 3IV5A 1QZEA 1JGGA 1TWHJ 3G4SI 1DU6A 4PGHA 4IRHA 2WAQA 2HS5A 4KA4A 2QQ9A 2GXAA 2VBXA 1MBKA 4QIWN 2BBYA 5K5OA 5LEJA 1I39A 1WZ2A 2IAIA 4BU2A 3F0CA 5F0FA 1T2KA 1I27A 1SFXA 2DMNA 2V6CA 3CD6I 4NHJA 5LRRA 2XF7A 3K4MA 1X1BA 2EH3A 1R6RA 3R60A 4XRMA 3U1DA 2E36A 3ZQQA 3ABKH 3GEZA 4BJ6C 1D1AA 4AIJA 3D5RC 1P9QC 1ETQA 3OYKA 3BROA 3HHHA 3T8RA 2GBYA 2GXGA 3EYYA 3JCUC 3K4BA 3BLYA 5KAFC 1NK3P 4YIRX 5JHFA 5CKTA 2HOTA 4OU0A 9ANTA 2VB6A 1ETXA 1MH4A 4S0HB 2L7ZA 3RJPA 5M5XJ 1MBEA 3HSFA 2E1NA 1IN7A 2LREA 4EQQA 4BUPA 2XB0X 3ZQLA 5HLIA 3L09A 2O7OA 1X1DA 2VIXA 3BG5A 5C3EJ 4B44A 1W7PB 3U1KA 1TC3C 2CS3A 2DA4A 5DM6F 2PJRB 2QVOA 2PG4A 3V7CA 5EG0B 1AWCA 2R92J 5FJ8J 5EDNA 3WTZA 1RC9A 2F5FA 3PUBA 2GIVA 4YELA 2WC2A 2F5VA 3VEPA 1S9HA 3CO6C 2K27A 4XR6A 4PSWA 4OIRF 1R22A 5ICEA 3KP6A 2EQRA 4PCQA 2BGCA 4PFOA 1K4SA 3QU6A 3C18A 4P5OA 2VONA 1BI1A 2PFBA 4I7HA 1FOWA 3HRMA 1OCOH 4XLCA 1VF9A 2M7BA 3HSRA 3AG2H 1J5YA 3SDBA 3CC7I 1BR2A 1S6LA 3S3OA 1FP1D 2X85A 2X9DA 5L3CA 2CW0F 4NBQA 3HEFA 1YE9A 1T39A 3CMYA 1G2HA 4PK4A 1HLVA 2DYRH 2PQ8A 3EUHC 3WGIA 2W1OA 3R6SA 3FXRA 5CLSA 5L3GA 3FK6A 1MGTA 3KYCB 4LLNA 5F1RA 3JAMK 2VPLA 3C7JA 1WH5A 5HVQC 2DDAA 1VNDA 3AAFA 2VJIA 5E18F 1JKOC 2OQGA 1RUOA 4A69C 3REOA 4L0ZB 1UAAA 5LGUA 1W36D 1JKRC 3PNTA 4C2TA 4IX7A 4UUSA 3CC4I 2K3FA 2RNJA 1P4AA 1XTAA 2VBWA 2ZJ2A 2VBZA 2HQ5A 1FMVA 3L2CA 1FWZA 1RPWA 1OR7A 4FX4A 4PFPA 4RBOA 4HNVA 3FMSA 3CDHA 1FBSA 2A6EF 5EGOB 3BG6A 2QA4I 5GAEJ 2WAQN 1TNSA 1GV5A 1OLTA 3S16J 1I3QJ 3G1OA 1WJFA 4YIFA 2FOWA 4U7DA 3BR1A 2DO7A 2CV1A 3I58A 3DPLC 2FQ4A 3G1MA 2BY1A 2K5CA 1V55H 2CWEA 3O8HA 3ZMSA 3CZ6A 3GTQJ 4ENJA 2IXSA 3F6VA 4FETA 5AIPA 4JX4A 3SEZA 1UHMA 2CUZA 4DGWB 2ID6A 2P81A 2YSRA 1Y56A 3SZPA 1KYWA 3EDPA 3MKYB 2E71A 2JSPA 3I4PA 3GYHX 4V2FA 1Z67A 2NS0A 2GXBA 1KYZA 3ASOH 1VFCA 2R7TA 3TGNA 4BE1A 5J3LA 1WJAA 1KGSA 2R7FA 3PFYA 3JAMZ 3CJRB 1YFHA 1WVRA 1WGXA 3I71A 2PI0A 3DU6A 1XC5A 4HLYA 5DUKA 4KUMA 1HA8A 3W6JB 4OOIA 1H9GA 1OFCX 2ID3A 3GTKJ 4RM3A 1TNTA 3QU3A 3S17J 3ECOA 1D0ZA 2KIUA 1T6SA 5JVGF 1ON2A 3PNVA 1P7JA 3RIRA 1HKTA 1I6HJ 1WFXA 1ZG3A 3BTIA 2OU2A 4XOPA 2L2OA 4A3GJ 3CUQC 3V42A 2EFNA 3G3ZA 2DFFA 5E17F 1LUJB 1ZR4A 2GOMA 2R7UA 1JTYA 5E1ZB 1OCCH 4A3JJ 1TL8A 2DOEA 5FROA 3SYTA 4G6DA 3CDIA 4MHGA 5IP9J 3DV8A 3K2ZA 1NH3A 1W5CC 1XD7A 3KZZA 2A69F 3RSNA 1B8IA 1MKMA 2GM4A 3SJMA 4D9JA 4PGGA 2X1DA 1L0OC 2NS7A 4QPOA 2DQRA 1QHGA 3ZOBA 2V26A 2P6SA 1I50J 2CSOA 3BZ6A 1FT9A 4BS9A 3GO5A 3RQIA 4LLLA 4S04A 3HOTA 3IWZA 2VE8A 3L1PA 3RPQA 1OYYA 1SD6A 2FE3A 3I54A 1O3TA 2P7CB 2CUEA 5CPRB 1ZK8A 5J1RA 4ESJA 1ZG1A 4DYRA 2PX9A 2PN6A 5HLTA 1SFEA 2LC2A 2L7MP 3BR3A 3E5UA 2OV7A 4C3HJ 4RGXA 4ON0A 3S2WA 3IH2A 1CF7A 1B72B 4MNUA 2NAZA 4XLNF 2Q8KA 3V8LA 4WX9A 4I09A 2JZYA 2VI6A 1LB2A 2QSGX 4A3BJ 3QP6A 1OQYA 2P6TA 1POGA 2KIQA 3K4NA 5B5EC 3A01A 2KMUA 4P55A 2XPUA 2HXIA 1S5LC 1T33A 1IDYA 3H92A 3MWMA 1KU2A 2IS6A 1J7KA 2DU9A 3TW6A 2DLLA 5D5VB 2A5WA 4RLQA 4BHPA 1XB4A 3DFGA 4KIBA 2PLYA 1OCTC 2IGMA 3FXLA 2BXZA 1U0JA 3HOWJ 2EV6A 4A5MA 3IH3A 3R0AA 1ZGAA 1B59A 5EYRA 3HZJA 1IV6A 4MFDA 4CCKA 4I02A 4KITB 3CCJI 2EWNA 1EJ9A 1JXSA 3C2GA 2KRHA 4FHTA 4BQOA 1IDZA 4I0AA 5D8LB 2K40A 4HX7A 2QQ8A 4ZDOA 3H35A 4MFEA 3E6MA 2HKOA 1XGNA 1DPUA 2M9HA 3ZQIA 4G6TB 1T95A 2BOLA 2WV1A 5HODA 1STZA 4C2MJ 1V4RA 3OYLA 4HX4A 4DBRA 5DM7F 3HUGA 1JT0A 2XPVA 3V8JA 1GVJA 3B6CA 2DPUA 1MBFA 3OIQA 4RM2A 2K85A 4O5VA 4Y3OA 2CW8A 3IKVA 2HOAA 5CQGA 4C2UA 4HX8A 1SVLA 4R1HA 3ZRGA 5HS7A 3HOZJ 1S7EA 2X51A 1R00A 4ZDPA 3IC7A 5D6FA 1IRXA 2AS5F 1HBXG 5JLWA 1U5TC 1TW3A 4KDPA 1YIOA 2R7DA 2Q2EA 4D7NA 1F5TA 2FUG2 3EETA 2QGUA 1X3ZB 3HGGA 3MZYA 3E3VA 4MTEA 2KIMA 3HL2A 2F5CA 3ISPA 1Y0UA 4N9HA 5GPCA 3FMQA 4HDUA 3F3XA 1WJCA 2XPWA 1X3WB 1YJWI 3DU5A 2IGOA 1G6NA 1OCZH 4XL9A 1S8NA 2F5EA 1VQNI 3G73A 1QVTA 3DLLF 4WCGA 4AUXA 1JE8A 3VFZA 2XUBA 2BV6A 3I0TA 1HSTA 3LFKA 2B63J 3C3WA 3TO7A 3CCUI 1KU9A 3OOUA 4ZYAA 3S8PA 2L4MA 2B9SA 1QHHD 5D8KB 3OMYA 2FNPA 3W6KB 1MD0A 2LF7A 1JGSA 2QKMB 1ZLJA 3K70C 2ISZA 3EQLF 4F55A 4BDZA 1UG2A 4X1EA 3U9GA 1E2XA 3NAUA 3KZYA 2IS4A 2Q1ZB 5H6RA 4HYEA 2HOEA 4KT5C 4A2UA 5FLMJ 3DCFA 5J40A 3E6DA 1HKSA 3DPTA 3ABUA 3Q0UA 1FY7A 1ZRDA 4MQ9F 3P9IA 5EEGA 2KRCA 2KP6A 2BY3A 4Y15A 3MN2A 2XC7A 4QPQA 2ME0A 2LR8A 2XAGA 3Q9VA 4Y52J 3A4CA 2L4AA 4EM2A 2VC1A 2ZBKA 2LKSA 4HV6A 4NQWB 4I2OA 4EJUA 4P9UA 2MD0A 4CCJA 4AVZA 3WU1B 4UB6C 4G94A 2HQAA 1BA5A 2BY0A 3K1NA 1H0MA 1DU0A 3HOYJ 1J0RA 3RCOA 4PJJA 4M73A 2L7KA 1B9NA 2MW8A 2HPMA 1O57A 1R1VA 3TP3A 2R5ZB 2K9SA 2R0QC 4J00A 3PQJA 1SMYF 1MDMB 1VQ5I 1D1CA 3HXLA 5KVRA 3KP4A 5KAIC 3OYCA 1N75A 2PBIA 3TL4X 2AQFA 3K69A 1XMKA 1K6YA 2JA2A 4QWQA 1BI2A 3MD2A 4OMZA 1D8JA 5FD5A 2HYJA 2LBFB 1R5HA 2ZNZA 5HS8A 5FKKA 2IA2A 3L00A 2HDCA 4E7JA 2JT1A 4B8XA 4F93B 4DJAA 2F4OB 2KRFA 2ECBA 2F2EA 5FLVA 3AG3H 2OUMA 2H8RA 1SMTA 4FTHA 3EUHA 2OCCH 4CZZA 2VUMJ 2YPRA 2KDOA 2ELJA 2LNBA 4JQFA 1Z7UA 2V1NA 1XDSA 2LK2A 3T8TA 1Z05A 2ZMEA 3WHBA 3PO3J 1K61A 5J47A 3CJQB 3LSHA 2VN2A 2FBHA 4HBLA 1WHUA 2MLKA 3CC2I 2OJED 3OYJA 4AVPA 3K1PA 4P9FA 1IUFA 2R5YA 2OA4A 1X4PA 1W4MA 1X58A 2BW3A 1X3UA 1BC7C 3KP7A 1T98A 2MD5A 3QQAA 2H09A 3OR2C 4E7ZA 2DXIA 1E3PA 3RQ4A 1WJDA 3QOPA 1HSJA 1QGPA 4U88A 1LEAA 4FASD 1JHHA 2WV0A 3V7RA 2P5KA 3WE2A 2YU3A 1C0WA 1U78A 1YS7A 2JUCA 2ZKZA 3CCMI 3Q0WA 1WI3A 3DEUA 1Y6IA 2HOSA 1XSXA 2MFZA 2PJPA 2E35A 1FYKA 2JJ7A 4LG0B 5TGTA 3WTWC 3GTOJ 1W0TA 3WG9A 1R9TJ 3J80K 3H5AA 3H1CA 3PO2J 4PUSA 4PDKA 2HDDA 2P8TA 2Y31A 4HSRA 2F6CA 2MABA 3BG3A 1KQ0A 3MZHA 3TDZC 1U6GA 3RZDJ 2OPTA 3FHZA 3IP4B 2ADUA 2P7VB 4XK4A 3RPUA 3GX4X 4OAYA 5GTIC 2VT3A 1RI7A 2I8DA 3J7YJ 3JRGA 3FK7A 1IRZA 3K10A 1RKTA 1P2FA 4LJZF 3A0HC 3DPUA 1FMWA 2JRTA 2ZO4A 1TWFJ 3TMOA 4RDUA 5JFRA 4GYIA 5FO5A 2BYVE 1SAUA 3HRTA 3ML6A 3BJOA 2KJCA 4IXAA 5E79C 2IA1A 2DA2A 5K7FA 4KN7X 3M07A 2MYSA 1WRJA 3GTJJ 4WXCA 3LA3A 3CUQA 4M71A 3FKJA 2AXLA 3EPZA 3I4MJ 2DMPA 3GZ5A 1BW5A 3I5UA 3RTRA 3I56I 1DUXC 2H94A 4DIQA 2DA1A 1DGRM 2PMHA 2DA7A 3GWZA 4UB8C 2XSJC 3CDLA 1OJLA 2L9NA 1GVDA 5LLQA 3ZMTA 1J9IA 3L2RA 2XKOA 3HOSA 3J80Z 2JK3A 2DW4A 4CYCA 2LVSA 1ZARA 3HPGA 4XLFA 1PDNC 4W97A 1NG6A 4RAFA 4L0YB 4A0YA 1S29A 2GAUA 2CUJA 4EMSA 2MSYA 3QP5A 4KMFA 3ZP5A 3JSOA 4AIKA 1N25A 4P96A 2RN7A 1R71A 1LVAA 2XAJA 4MIMA 4XQFA 3ZMDA 1Y8QB 3HTSB 4AYBA 4M74A 2IS2A 1XGOA 1VQMI 4XMYA 1ULYA 3QAHA 1X4OA 1AA7A 3D5SC 5E3LA 1HCRA 2VKEA 4BJTA 2P5LC 5J1YA 3S1RJ 1FOXA 2OZ6A 4EV0A 2LYCA 5DYMA 3CTAA 2ZNYA 3DEWA 3LNQA 2QENA 3P5JA 1SC7A 2ZJQF 1V5FA 3F8BA 3NRVA 4A0XA 2Y30A 4IKFA 3I64A 3IAM2 2EFPA 1LDDA 4IHTA 2CV2A 3UKGA 1UMQA 1D0XA 3BC8A 4G7HF 4CSWA 1A36A 3JRBA 1FTTA 3HPHA 4A3LJ 1IXRC 2M45A 2HFHA 4XLPF 3KE2A 3H3UA 5H20A 2M8GX 1HW2A 3CCSI 4IRGA 3F72A 5IP7J 2UWMA 2DT5A 3ZMVA 3GBGA 2HR3A 5L3EA 4XBFA 2QF7A 2EFQA 3CJTB 1B1BA 3H3VK 1TLHB 4LITA 1V5EA 2IA0A 5HDNA 1X1PA 2Y9ZA 1KU3A 3CJNA 4UNOA 4HOBA 2XIGA 2A3SA 3DWLE 2GOXB 3E5XA 4M9SA 3D1NI 2OC6A 3PM1A 3C1DA 3KP2A 4ZTFA 3K7AJ 2ELKA 3OYHA 1IN4A 3J7AY 2K3PA 4WXHA 5D4RA 2NVXJ 2STTA 3M9AA 4UVCA 1ITYA 1TQPA 2HU9A 5AONA 1ETOA 3KEQA 4RAYA 1H89C 2GLOA 2DA6A 2D1HA 3OYMA 1W7PA 1XMAA 2OCEA 3BQZA 1OPCA 1VI0A 1YW8A 3RPUD 1WQ2A 2M87A 2W48A 2Z9OA 3NARA 2D2WA 5D4SA 1YJ9I 1T56A 1ODDA 1U5TA 2F4MB 2EZKA 3BY6A 3IAS2 2WB1N 2EZHA 2FBKA 3CESA 2RV8A 3CUOA 4ZH4F 4F91B 2G7UA 4JBAA 4RB0A 2E2HJ 1W5SA 3HJEA 1Z77A 1V5GA 1TQMA 1ZRFA 5KCMA 2E1MB 1P4WA 5D6EA 1K4TA 1N78A 1XPXA 3CCRI 2IPQX 2RC4A 4IHWA 3FM5A 3HSEA 2ZCWA 1YLFA 3BT9A 4PSXA 1IW7F 3T1BA 4M3EA 2ESHA 2DYSH 1LNWA 3JW4A 2MG4A 3QPTA 4RMNA 2W7NA 3BOQA 1D3YA 3S15J 1RRJA 4ZDLA 4FE4A 1SFUA 1R4NB 2XF6A 4NB5A 2Z5UA 3FXJA 3QYEA 4BE2A 3KP5A 1VQOI 1BOBA 1O3RA 2CFXA 2W25A 4YEJA 1PUFA 2EPFA 1M1EB 4AYBN 1GV2A 3QWLA 1HDPA 3JREA 3ABTA 4UUSB 2DN0A 3OS2A 4ENMA 2XV4S 2HDWA 2HXOA 1MH3A 2P4WA 1P6RA 3PL8A 2VXDA 1LVKA 3CCYA 2DDBA 4WK8F 2IBDA 4L18B 1GHCA 3FZVA 1IXSB 3HM5A 2DOAA 1FLIA 4E70A 2M7AA 3C2HA 4L9NA 2NVUB 2QM3A 2MA3A 3LSJA 5M3FJ 3M3YJ 3DXJF 1B4AA 4ESFA 3E6CC 4BDYA 5DCMA 5LHGA 2XF5A 3M8FA 4B43A 4R79A 4ZZDA 4E4HA 1PJRA 1BIBA 3GXOA 4II3A 3CO7C 3ZGKA 3QPLA 4CZCA 1T0FC 2J5OA 3P9KA 1G8XA 2JPCA 1HQCA 1QRYA 3F22A 4AC0A 4JOMA 1ZKGA 3B02A 5IOYA 3MAJA 4IPAA 4OAZA 4C3IJ 3DTEA 5CVJA 1JUSA 3LA2A 1ZGJA 2IT0A 2ICWG 2V1UA 5ICCA 3COAC 5BS6A 2A05A 1R5GA 5C4JJ 1QU3A 3FBNB 3L7WA 5FRNA 4F3QA 1XCBA 2EILH 2WAFA 3BR2A 3I59A 3IWFA 3QOEA 3QYFA 1LPQA 1D5VA 1IZ1A 2VASA 1XGSA 3KYLA 2MH2A 4BY1J 3T0YA 3ZPLA 5CVRA 4QTRA 2BVMA 4I76A 1YI2I 2XDVA 3OSFA 3WTVC 1QO0D 3LOCA 3OL3A 4X6AJ 3LSRA 4YIIA 3ERED 3ABMH 2R7QA 1ETVA 4GGGA 1H8AC 2DTZA 1P4XA 2ELHA 3M7GA 4U0WA 4O3MA 1FC3A 1BBYA 1WH7A 3GF2A 2XGXA 1V3FA 3V7SA 3SDGA 2YX4A 1K7AA 1FYMA 1W7PD 1BN5A 3JRFA 2RAEA 4XSZF 2EV0A 5K5QA 1B8IB 2AO9A 1S72I 1QPMA 5LRSA 1IRFA 2O8KA 4M3GA 3ZR8X 1IC8A 3LSMA 2GIZA 1KZHA 3NWTA 2RNGA 3FISA 4IHSA 4KT6A 5E3OA 4E7IA 1QPIA 2CG4A 3QPHA 2OZUA 1LKXA 3M8EA 1HXDA 5E1XA 4B3XA 4DYQA 3DKYA 1WJEA 2KKOA 2X6YA 3HTUA 3S93A 2LY9A 5EZGA 4EGZA 1YIJI 2OQRA 5BPIA 1LE8A 2QKLB 4B47A 1NHAA 3A02A 5HDKA 2YR2A 4JP0A 1G3TA 2O8XA 1CF7B 4XSXF 1BR4A 1WKMA 5FFXA 2LLKA 4KFCA 3I9V2 3WE3A 3UNGC 2LF8A 2EINH 4P1WA 1JHFA 1X2MA 3G6EI 2R7ZJ 1QBJA 5C4XJ 2A5YB 1GXPA 3A01B 2D45A 3DKWA 4Y17A 3DQVC 2ZB9A 3DLAA 3RKXA 2FF4A 3K70D 2KHMA 4XIDA 3MCZA 2A6HF 2BY2A 5D5UB 3PFIA 2CYYA 1I6XA 2AQEA 1ZELA 2IW5A 2ZXWH 4IZZA 4FT8A 4LD5A 2QQAA 5J6XA 1FIAA 3N97A 1F1ZA 5ICGA 2DK8A 4ASNA 4IHVA 4IHXA 4LFUA 3VB2A 5HNFA 1JT6A 2XAQA 2HQNA 1NK2P 2HKXA 4KYWA 1R23A 1MMGA 1XX5A 2DA5A 2LFBA 3F8CA 3FWEA 2IS1A 2XGDA 1DQUA 4KICA 3BZCA 2V9KA 4A3FJ 3QODA 2QBYA 3LSIA 1IRGA 1O3SA 2VJ4A 2DT6A 4JX5A 4BEHA 1ZYRF 5EZHA 1Q1HA 1ZLKA 4Y4RA 3ONQA 1D0YA 1YG2A 3FM3A 2YS9A 5DUIA 2GA1A 3TDUC 3AG1H 4ABZA 4ENNA 4A6DA 1G3YA 4L5IA 5FLXK 1UG0A 3B73A 2VLAA 3TOAA 3GFIA 3AL0B 4M6VA 4Y7NJ 1T38A 3BCBA 4NC7A 3W6VA 4C30A 2E2JJ 4N0BA 2TRTA 4RB3C 2V1XA 4GDFA 2NYXA 3L9FA 4EVIA 4BQQA 3BPXA 3PIPF 4I6ZA 3SEQA 2XGCA 5KK1A 3UR3C 3ZCOA 2WWYA 3NQOA 2EFWA 1FSHA 5B1AH 4EGYA 1AU7A 3KZIC 3BR5A 3JSPA 2CGPA 1ZAOA 2Q2EB 4IQ4A 1P92A 3K6GA 4Q5SF 1E3HA 2WTEA 1BOAA 3VSKA 4B3AA 1K78A 5H6QA 3N05A 3HOXJ 1J59A 3GW2A 3K4JA 5FD6A 4JYKA 1Y0NA 2MC4A 2M8EA 3HRUA 1SVMA 4RAGA 4Y13A 3SFZA 6PAXA 4FISA 1W1WE 3MKWB 2A07F 1BW6A 1FTZA 3K4LA 1MBGA 4HF2A 1W5TA 3QPSA 4G8XA 1FOKA 4XOTA 2E1MC 4BXXJ 2FXAA 4L9JA 1X2NA 2JUGA 3CMMA 3KFWX 3ZXSA 2O5RA 1UB9A 1UZCA 3LWFA 4A5NA 1UFMA 3D0SA 3SHFA 4UV9A 5J4VA 3KX2A 2PEXA 2CUFA 2NOGA 2ME6A 1KA8A 1LQ1A 4B1RA 2UV1A 2XHKA 5FLXZ 1OKRA 2EIJH 3ZMZA 4BHCA 4LOCA 2ZXHA 4XONA 4Q4ZF 3LFUA 4YRVA 5F27A 4I0BA 3OYDA 3OYEA 1RKWA 2R3SA 4EJTA 2BXYA 1X1CA 1L3LA 1IN6A 2DTRA 2V79A 3V4GA 3MKZA 5FKOA 3TBIA 1A04A 3ZN1A 4CCNA 1EV7A 1ZGWA 2LOOA 2C6YA 1IAWA 2R7OA 5FB2A 4D7MA 3OV8A 4FCYA 4U0YA 2H6CA 1OR7C 2L02A 4D0PA 1LFUP 2P0WA 4AWXB 1AKHA 4DOZA 5DD8A 3CCEI 1VQKI 4GRIA 2ZSIB 3BZKA 2YX7A 2RGVA 4A6EA 4NQWA 5DD4A 2QSFX 4G7ZF 1YHQI 4LB6B 2NVQJ 5D5XB 2EA2A 1YO5C 1PP8F 3LQQA 2WA0A 3U2RA 1HW5A 2LDUA 3IRRA 2R5ZA 2FX0A 3SQNA 2LP0A 1HW1A 5B66C 2W82A 2DT7B 1ZTRA 2IJLA 4JK1X 5M5WJ 2E60A 3GTPJ 1FX7A 3V8KA 4DW6A 1BR1A 2CQ7A 2YUSA 1YRNB 2FMLA 2LKXA 2QWWA 2X4HA 3HB9A 4A3DJ 1QA6A 3W2VA 1MNEA 2NNNA 3MVPA 3ZN0A 4BXUA 1XSDA 1SFOJ 1MJ9A 4LB5A 5H2FC 1MNDA 2X1EA 2OD5A 3OYAA 3HHGA 2BEOA 1GLNA 1Z21A 2CJJA 1XG1A 1A35A 2ZMEB 4LIVA 1T8IA 5IT9Z 2ZJPF 2HVSA 1U9OA 5F0CA 5DCFA 2R5YB 2Y0MA 2CQNA 4BKXA 4I98B 2BW3B 4Y33A 3GTMJ 1UHWA 2MC3A 3CQZJ 4IOCF 3HOVJ 3HBLA 4LG3A 4XKWA 4OINF 1TT0A 2KFDA 2KDZA 3WTYC 4LK1F 1KU7A 1RUNA 2DFIA 3DTIA 1UCRA 2R4GA 1APLC 3EUKL 3KYDB 4IRIA 4KIFA 3VYUB 2OTLI 2W4SA 3DEEA 3VSLA 3WU0A 3RI4A 2FJ1A 2E7XA 4EM0B 1I3AA 3O6BB 1R1UA 4BBSJ 4MLOA 3K2AA 3KP3A 3BP8A 4EM1A 4CGZA 4WF2A 3VPRA 2Y0SN 5B3SH 1FEXA 1ZHFA 2FRHA 1FIPA 1T0FA 2E34A 4KN4X 5J8FA 1O3QA 5GAHJ 5JVTA 4YFKF 4S05A 5BPDA 4L9TA 1ONVA 2X6XA 2CQQA 2Q0OA 4ZYGA 2OAZA 5JHUA 1HF0A 1E0EA 2HZDA 2FBIA 2HTJA 1Z7LA 4NNJA 3WGHA 3FXQA 5IYDJ 3RYRA 4OIQF 2M2EA 2M4KA 1Z6TA 3L2VA 2QYOA 5CVUA 2V4JC 2VKDA 4CCOA 4BACA 4UY8I 3GVAA 3ZMUA 3TOBA 3GZNB 3IUOA 1B6AA 1FJLA 2R7RA 2F48A 2X1CA 1U3EM 1QZYA 5EEHA 1ERDA 2B0LA 1LDJA 2KJBA 3LL7A 2WB1A 3BR0A 4E7SA 2DK5A 3Q3SA 2FOKA 1I5ZA 3CUQB 3ZQGA 1U8RA 3FDYA 2W00A 4U0VA 2V6EA 3GZ6A 1J09A 3TEDA 1ON1A 4M3FA 3U21A 5K1YA 2CH0A 3CP2A 3DP7A 2E7WA 1DP7P 5LD2C 3BCAA 1KQ8A 4BH9A 4XRSA 1TTYA 2CW7A 3WTUC 3T5XA 4XLEA 2WY8Q 1KQ9A 2K4BA 2R93J 5KHDA 4CYCB 3DBLB 2M34A 2EZIA 4CH7A 5IT3A 3I55I 3CMAI 4CUGA 4RGUA 4ESBA 1H88C 1A31A 1WJ5A 4LLGF 1TZLA 3OOPA 1J2XA 3E7LA 3OWTA 1V54H 4DZPA 2HPIA 5F04A 2COMA 4HNUA 4R8HA 4HF1A 3S1NJ 1UELB 2QEXI 2FSWA 1K83J 2P5VA 3OYFA
chains in the Genus database with same CATH topology
1HOMA 3OIOA 3IH3A 3LSJA 5M3FJ 5EYRA 4C3JJ 4J19A 1A5JA 1IV6A 1AHDP 3M3YJ 3M4OJ 4MFDA 2JMWA 3RZOJ 5C44J 1IDZA 1E3OC 2K40A 1YRNA 4A3MJ 4MFEA 5M5YJ 2O9LA 3BQYA 3QPLA 2M9HA 3ZQIA 2WV1A 5HODA 3O8GA 3BTLA 4C2MJ 1QRYA 4AC0A 5K7HA 1JT0A 1ZKGA 3ZQHA 3C2BA 5IOYA 2XPVA 4FE7A 4C3IJ 3B6CA 3LSPA 2QCOA 3JRCA 1JUSA 1MBFA 4IHYA 1CQTA 3GTLJ 2HOAA 5C4JJ 4A3CJ 3HOZJ 1S7EA 3BR2A 2DA3A 1RESA 5JLWA 2K9NA 4D7NA 4BY1J 1D5YA 3RKQA 4QTRA 4I76A 3FIWA 3OSFA 2JA8J 3HGGA 3LOCA 4X6AJ 5DTDA 3HDDA 3LSRA 5GPCA 1ETVA 4QSHA 2XPWA 1H8AC 5IP6A 2JN6A 2DTZA 1IJWC 4MO7A 1GDTA 3BR6A 2JA6J 1WH7A 1QVTA 4AUXA 3IH4A 3SDGA 1TWCJ 5EF6A 2B63J 5DS9A 5EG0A 3JRFA 2RAEA 2FD5A 3OOUA 5FKLA 2HI3A 1B8IB 2AHQA 2AO9A 3G1LA 5FKNA 4XRSG 4A3EJ 2E2IJ 1F36A 2N8GA 2O8KA 1SANA 5GPAA 4M3GA 1IC8A 1QVUA 1UG2A 4X1EA 3B6AA 1JUPA 3FISA 3NAUA 2XB5A 5E3OA 4BBRJ 1QPIA 5FLMJ 3DCFA 3JRHA 3Q0UA 4DYQA 1EF4A 1RETA 3JRDA 2COBA 2LY9A 5EZGA 2JA7J 3MN2A 2NVYJ 2ME0A 1MBJA 2LR8A 2TCTA 4B4CA 4Y52J 1LE8A 3TP0A 3A02A 2DJNA 1BL0A 2L7FP 1IG7A 4JP0A 1JKQC 1BA5A 4M3BA 3JRAA 1Z0XA 2LLKA 1DU0A 3HOYJ 2PMZN 5C4XJ 1X2MA 2R7ZJ 2MW8A 3TW7A 2XGEA 4D5FA 3TP3A 2R5ZB 1PUFB 2VKVA 2K9SA 2R0QC 3A01B 3GTGJ 2X6OA 1Y1VJ 2ZB9A 2NVTJ 5JLXA 4XIDA 2NS8A 4UUTA 1TWAJ 2G0EA 5BNGA 1MBHA 1FIAA 2VPRA 2IEKA 4IHVA 4EEFG 4IHXA 3HKZN 5FKMA 2HYJA 1JT6A 1MSEC 1NK2P 5FKKA 2LFBA 2DA5A 2XGDA 5M3MJ 3ZQFA 1JJ6C 4A3FJ 2L9RA 1NTCA 4DZJA 1OCPA 1P7IA 2ECBA 5EGOA 5FLVA 2H8RA 4JX5A 4FTHA 2VUMJ 5EZHA 1W0UA 4XICA 2KT0A 2YS9A 3IV5A 1JGGA 1TWHJ 4ABZA 1DU6A 2MGQA 4M6VA 2LK2A 1WCMJ 4Y7NJ 3WHBA 3PO3J 2CQXA 1MBKA 1K61A 2JWTA 5J1UA 4QIWN 2LTPA 1MNMC 3W6VA 2IAIA 3F0CA 5F0FA 2E2JJ 2DMNA 3HGYA 2TRTA 3SFIA 1IUFA 2R5YA 2EH3A 4I6ZA 4XRMA 2DMUA 2XGCA 1O4XA 1X58A 3QQAA 1AU7A 3BR5A 1ETQA 4JX6A 2GBYA 4B3AA 1NK3P 3HOXJ 2HOTA 1U78A 9ANTA 4S0HB 1ETXA 1MH4A 4JYKA 3Q0WA 2L7ZA 1MBEA 1WI3A 5M5XJ 3ZQCA 2HOSA 5EEAA 2JJ7A 2XB0X 3ZQLA 3GTOJ 2O7OA 1W0TA 3BG5A 4FISA 5C3EJ 1R9TJ 1BW6A 3PO2J 1TC3C 2HDDA 1FTZA 2Y31A 1MBGA 2DA4A 2Y2ZA 3QPSA 3BG3A 4BXXJ 1X2NA 5EG0B 2R92J 3RZDJ 2OPTA 5FJ8J 1ETYA 5EDNA 4A3IJ 4XK4A 5IYCJ 1GT0C 1IRZA 3JRGA 3FK7A 2CUFA 2NOGA 2ME6A 1MSFC 4B1RA 1RKTA 4BY7J 2E19A 1ENHA 4GFBA 1TWFJ 2LD5A 4RDUA 4NDLA 4LOCA 2EQRA 5F27A 3HOWJ 3HOUJ 1RKWA 1ZR2A 2DA2A 1VF9A 5K7FA 1LE8B 5FKOA 3GTJJ 2X9DA 1ZGWA 3I4MJ 2DMPA 3HEFA 1RR7A 2E1OA 4D7MA 1IGNA 4FCYA 1BW5A 5F08A 1LFUP 5F1JA 3CMYA 3H0GJ 1AKHA 2DA1A 1G2HA 2DA7A 1HLVA 5E3MA 3CDLA 1OJLA 1ZQ3P 1B72A 3FK6A 3BTCA 2NVQJ 1GVDA 1WH5A 1VNDA 1U8BA 2JK3A 1JKOC 4CYCA 2LVSA 4A69C 3S1MJ 4W97A 5IYBJ 5GP9A 1JKRC 4A93J 3S14J 2R5ZA 2MSYA 4UUSA 2FX0A 5IPAA 2LP0A 3S2DJ 2CU7A 4MIMA 1ZTRA 2HQ5A 1UHSA 1RPWA 5M5WJ 3JR9A 3GTPJ 4DW6A 4HNVA 2K9QA 4RBOA 3A03A 2YUSA 5E3LA 1YRNB 2CRGA 5EGOB 2LKXA 1HCRA 2VKEA 2WAQN 3HB9A 4A3DJ 2XSDC 3MVPA 1GV5A 5J1YA 3S1RJ 1SFOJ 3S16J 1I3QJ 3G1OA 1LFBA 3BR1A 3DEWA 3LNQA 2FQ4A 2CJJA 1XG1A 3G1MA 1A6IA 3O8HA 2EBIA 1JUMA 3GTQJ 2Y30A 3MKLA 5IOZA 4JX4A 1BJZA 2ID6A 3UKGA 2P81A 1UMQA 1HDDC 1U9OA 2L0KA 5F0CA 5E3NA 2R5YB 1TWGJ 4BKXA 3JRBA 3BG9A 4A3LJ 1FTTA 3GTMJ 3CQZJ 4V2GA 2M8GX 3HBLA 4V2FA 3HOVJ 1VFCA 5IP7J 2KDZA 5J3LA 3I4NJ 3GBGA 2M0CA 2QF7A 1APLC 3H3VK 1WGXA 4M3DA 1XC5A 1ETKA 2Y9ZA 2EZLA 1OFCX 2ID3A 2X48A 2FJ1A 4IEJA 3GTKJ 5F0HA 1JTXA 5K7ZA 4L5EA 2ECCA 4BBSJ 4MLOA 3D1NI 3S17J 3K2AA 3PM1A 2OF7A 1P7JA 3K7AJ 3LSGA 4G12A 3VPRA 2ELKA 2Y0SN 1I6HJ 1FEXA 3BTIA 1FIPA 2NVXJ 4A3GJ 1ITYA 1ETOA 1ZR4A 1H89C 2GLOA 2CQQA 2DA6A 1JTYA 2YU9J 3BQZA 4A3JJ 1HF0A 1VI0A 5IYDJ 2W48A 5IP9J 3NARA 2M2EA 3FKIJ 2GM4A 1B8IA 1T56A 1JKPC 2D5VA 2EZKA 3SJMA 2WB1N 2EZHA 2DMQA 1FJLA 2NS7A 4A3KJ 3Q0VA 1F43A 3ZOBA 2E2HJ 1I50J 3S1QJ 3BR0A 1Z77A 4DYCA 3RQIA 3Q3SA 2H1KA 3L1PA 3ZQGA 1JJ8C 4IHWA 2CUEA 3TEDA 1ZK8A 5J1RA 3BTJA 4DYRA 3BT9A 4M3FA 1AKHB 2L7MP 3BR3A 4M3EA 4C3HJ 4D5CA 1Y1WJ 3JRIA 2MG4A 3S2HJ 3S15J 3IH2A 4XRSA 1ETWA 1XS9A 1B72B 4FE4A 2VI6A 2R93J 4CYCB 4A3BJ 2M34A 2EZIA 1POGA 1PUFA 3A01A 4AYBN 1GV2A 2XPUA 2HXIA 1HDPA 1T33A 1IDYA 3WHCA 3JREA 1ORKA 2I10A 4UUSB 1WPKA 2DN0A 1H88C 3TW6A 3E7LA 2Y9YA 2HXOA 4DZPA 1MH3A 5F04A 1OCTC 2JA5J 2XRLA 3CCYA 3S1NJ 2IBDA 1Q1VA 3HM5A 1GUUA 1K83J 4W1UA 2DMTA 3OSGA 1U9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HOM A;  3OIO A;  3IH3 A;  3LSJ A;  5M3F J;  5EYR A;  4C3J J;  4J19 A;  1A5J A;  1IV6 A;  1AHD P;  3M3Y J;  3M4O J;  4MFD A;  2JMW A;  3RZO J;  5C44 J;  1IDZ A;  1E3O C;  2K40 A;  1YRN A;  4A3M J;  4MFE A;  5M5Y J;  2O9L A;  3BQY A;  3QPL A;  2M9H A;  3ZQI A;  2WV1 A;  5HOD A;  3O8G A;  3BTL A;  4C2M J;  1QRY A;  4AC0 A;  5K7H A;  1JT0 A;  1ZKG A;  3ZQH A;  3C2B A;  5IOY A;  2XPV A;  4FE7 A;  4C3I J;  3B6C A;  3LSP A;  2QCO A;  3JRC A;  1JUS A;  1MBF A;  4IHY A;  1CQT A;  3GTL J;  2HOA A;  5C4J J;  4A3C J;  3HOZ J;  1S7E A;  3BR2 A;  2DA3 A;  1RES A;  5JLW A;  2K9N A;  4D7N A;  4BY1 J;  1D5Y A;  3RKQ A;  4QTR A;  4I76 A;  3FIW A;  3OSF A;  2JA8 J;  3HGG A;  3LOC A;  4X6A J;  5DTD A;  3HDD A;  3LSR A;  5GPC A;  1ETV A;  4QSH A;  2XPW A;  1H8A C;  5IP6 A;  2JN6 A;  2DTZ A;  1IJW C;  4MO7 A;  1GDT A;  3BR6 A;  2JA6 J;  1WH7 A;  1QVT A;  4AUX A;  3IH4 A;  3SDG A;  1TWC J;  5EF6 A;  2B63 J;  5DS9 A;  5EG0 A;  3JRF A;  2RAE A;  2FD5 A;  3OOU A;  5FKL A;  2HI3 A;  1B8I B;  2AHQ A;  2AO9 A;  3G1L A;  5FKN A;  4XRS G;  4A3E J;  2E2I J;  1F36 A;  2N8G A;  2O8K A;  1SAN A;  5GPA A;  4M3G A;  1IC8 A;  1QVU A;  1UG2 A;  4X1E A;  3B6A A;  1JUP A;  3FIS A;  3NAU A;  2XB5 A;  5E3O A;  4BBR J;  1QPI A;  5FLM J;  3DCF A;  3JRH A;  3Q0U A;  4DYQ A;  1EF4 A;  1RET A;  3JRD A;  2COB A;  2LY9 A;  5EZG A;  2JA7 J;  3MN2 A;  2NVY J;  2ME0 A;  1MBJ A;  2LR8 A;  2TCT A;  4B4C A;  4Y52 J;  1LE8 A;  3TP0 A;  3A02 A;  2DJN A;  1BL0 A;  2L7F P;  1IG7 A;  4JP0 A;  1JKQ C;  1BA5 A;  4M3B A;  3JRA A;  1Z0X A;  2LLK A;  1DU0 A;  3HOY J;  2PMZ N;  5C4X J;  1X2M A;  2R7Z J;  2MW8 A;  3TW7 A;  2XGE A;  4D5F A;  3TP3 A;  2R5Z B;  1PUF B;  2VKV A;  2K9S A;  2R0Q C;  3A01 B;  3GTG J;  2X6O A;  1Y1V J;  2ZB9 A;  2NVT J;  5JLX A;  4XID A;  2NS8 A;  4UUT A;  1TWA J;  2G0E A;  5BNG A;  1MBH A;  1FIA A;  2VPR A;  2IEK A;  4IHV A;  4EEF G;  4IHX A;  3HKZ N;  5FKM A;  2HYJ A;  1JT6 A;  1MSE C;  1NK2 P;  5FKK A;  2LFB A;  2DA5 A;  2XGD A;  5M3M J;  3ZQF A;  1JJ6 C;  4A3F J;  2L9R A;  1NTC A;  4DZJ A;  1OCP A;  1P7I A;  2ECB A;  5EGO A;  5FLV A;  2H8R A;  4JX5 A;  4FTH A;  2VUM J;  5EZH A;  1W0U A;  4XIC A;  2KT0 A;  2YS9 A;  3IV5 A;  1JGG A;  1TWH J;  4ABZ A;  1DU6 A;  2MGQ A;  4M6V A;  2LK2 A;  1WCM J;  4Y7N J;  3WHB A;  3PO3 J;  2CQX A;  1MBK A;  1K61 A;  2JWT A;  5J1U A;  4QIW N;  2LTP A;  1MNM C;  3W6V A;  2IAI A;  3F0C A;  5F0F A;  2E2J J;  2DMN A;  3HGY A;  2TRT A;  3SFI A;  1IUF A;  2R5Y A;  2EH3 A;  4I6Z A;  4XRM A;  2DMU A;  2XGC A;  1O4X A;  1X58 A;  3QQA A;  1AU7 A;  3BR5 A;  1ETQ A;  4JX6 A;  2GBY A;  4B3A A;  1NK3 P;  3HOX J;  2HOT A;  1U78 A;  9ANT A;  4S0H B;  1ETX A;  1MH4 A;  4JYK A;  3Q0W A;  2L7Z A;  1MBE A;  1WI3 A;  5M5X J;  3ZQC A;  2HOS A;  5EEA A;  2JJ7 A;  2XB0 X;  3ZQL A;  3GTO J;  2O7O A;  1W0T A;  3BG5 A;  4FIS A;  5C3E J;  1R9T J;  1BW6 A;  3PO2 J;  1TC3 C;  2HDD A;  1FTZ A;  2Y31 A;  1MBG A;  2DA4 A;  2Y2Z A;  3QPS A;  3BG3 A;  4BXX J;  1X2N A;  5EG0 B;  2R92 J;  3RZD J;  2OPT A;  5FJ8 J;  1ETY A;  5EDN A;  4A3I J;  4XK4 A;  5IYC J;  1GT0 C;  1IRZ A;  3JRG A;  3FK7 A;  2CUF A;  2NOG A;  2ME6 A;  1MSF C;  4B1R A;  1RKT A;  4BY7 J;  2E19 A;  1ENH A;  4GFB A;  1TWF J;  2LD5 A;  4RDU A;  4NDL A;  4LOC A;  2EQR A;  5F27 A;  3HOW J;  3HOU J;  1RKW A;  1ZR2 A;  2DA2 A;  1VF9 A;  5K7F A;  1LE8 B;  5FKO A;  3GTJ J;  2X9D A;  1ZGW A;  3I4M J;  2DMP A;  3HEF A;  1RR7 A;  2E1O A;  4D7M A;  1IGN A;  4FCY A;  1BW5 A;  5F08 A;  1LFU P;  5F1J A;  3CMY A;  3H0G J;  1AKH A;  2DA1 A;  1G2H A;  2DA7 A;  1HLV A;  5E3M A;  3CDL A;  1OJL A;  1ZQ3 P;  1B72 A;  3FK6 A;  3BTC A;  2NVQ J;  1GVD A;  1WH5 A;  1VND A;  1U8B A;  2JK3 A;  1JKO C;  4CYC A;  2LVS A;  4A69 C;  3S1M J;  4W97 A;  5IYB J;  5GP9 A;  1JKR C;  4A93 J;  3S14 J;  2R5Z A;  2MSY A;  4UUS A;  2FX0 A;  5IPA A;  2LP0 A;  3S2D J;  2CU7 A;  4MIM A;  1ZTR A;  2HQ5 A;  1UHS A;  1RPW A;  5M5W J;  3JR9 A;  3GTP J;  4DW6 A;  4HNV A;  2K9Q A;  4RBO A;  3A03 A;  2YUS A;  5E3L A;  1YRN B;  2CRG A;  5EGO B;  2LKX A;  1HCR A;  2VKE A;  2WAQ N;  3HB9 A;  4A3D J;  2XSD C;  3MVP A;  1GV5 A;  5J1Y A;  3S1R J;  1SFO J;  3S16 J;  1I3Q J;  3G1O A;  1LFB A;  3BR1 A;  3DEW A;  3LNQ A;  2FQ4 A;  2CJJ A;  1XG1 A;  3G1M A;  1A6I A;  3O8H A;  2EBI A;  1JUM A;  3GTQ J;  2Y30 A;  3MKL A;  5IOZ A;  4JX4 A;  1BJZ A;  2ID6 A;  3UKG A;  2P81 A;  1UMQ A;  1HDD C;  1U9O A;  2L0K A;  5F0C A;  5E3N A;  2R5Y B;  1TWG J;  4BKX A;  3JRB A;  3BG9 A;  4A3L J;  1FTT A;  3GTM J;  3CQZ J;  4V2G A;  2M8G X;  3HBL A;  4V2F A;  3HOV J;  1VFC A;  5IP7 J;  2KDZ A;  5J3L A;  3I4N J;  3GBG A;  2M0C A;  2QF7 A;  1APL C;  3H3V K;  1WGX A;  4M3D A;  1XC5 A;  1ETK A;  2Y9Z A;  2EZL A;  1OFC X;  2ID3 A;  2X48 A;  2FJ1 A;  4IEJ A;  3GTK J;  5F0H A;  1JTX A;  5K7Z A;  4L5E A;  2ECC A;  4BBS J;  4MLO A;  3D1N I;  3S17 J;  3K2A A;  3PM1 A;  2OF7 A;  1P7J A;  3K7A J;  3LSG A;  4G12 A;  3VPR A;  2ELK A;  2Y0S N;  1I6H J;  1FEX A;  3BTI A;  1FIP A;  2NVX J;  4A3G J;  1ITY A;  1ETO A;  1ZR4 A;  1H89 C;  2GLO A;  2CQQ A;  2DA6 A;  1JTY A;  2YU9 J;  3BQZ A;  4A3J J;  1HF0 A;  1VI0 A;  5IYD J;  2W48 A;  5IP9 J;  3NAR A;  2M2E A;  3FKI J;  2GM4 A;  1B8I A;  1T56 A;  1JKP C;  2D5V A;  2EZK A;  3SJM A;  2WB1 N;  2EZH A;  2DMQ A;  1FJL A;  2NS7 A;  4A3K J;  3Q0V A;  1F43 A;  3ZOB A;  2E2H J;  1I50 J;  3S1Q J;  3BR0 A;  1Z77 A;  4DYC A;  3RQI A;  3Q3S A;  2H1K A;  3L1P A;  3ZQG A;  1JJ8 C;  4IHW A;  2CUE A;  3TED A;  1ZK8 A;  5J1R A;  3BTJ A;  4DYR A;  3BT9 A;  4M3F A;  1AKH B;  2L7M P;  3BR3 A;  4M3E A;  4C3H J;  4D5C A;  1Y1W J;  3JRI A;  2MG4 A;  3S2H J;  3S15 J;  3IH2 A;  4XRS A;  1ETW A;  1XS9 A;  1B72 B;  4FE4 A;  2VI6 A;  2R93 J;  4CYC B;  4A3B J;  2M34 A;  2EZI A;  1POG A;  1PUF A;  3A01 A;  4AYB N;  1GV2 A;  2XPU A;  2HXI A;  1HDP A;  1T33 A;  1IDY A;  3WHC A;  3JRE A;  1ORK A;  2I10 A;  4UUS B;  1WPK A;  2DN0 A;  1H88 C;  3TW6 A;  3E7L A;  2Y9Y A;  2HXO A;  4DZP A;  1MH3 A;  5F04 A;  1OCT C;  2JA5 J;  2XRL A;  3CCY A;  3S1N J;  2IBD A;  1Q1V A;  3HM5 A;  1GUU A;  1K83 J;  4W1U A;  2DMT A;  3OSG A;  1U9N A; 
#chains in the Genus database with same CATH topology
 1HOM A;  1CGP A;  4ZZL A;  5CYV A;  3OIO A;  3H5R A;  4C3J J;  4J19 A;  4Z6Y A;  1MW7 A;  1AHD P;  3M4O J;  2VQG A;  4ZYH A;  1A5J A;  1GXQ A;  3OYI A;  3I53 A;  3RZO J;  2X6W A;  2E5Z A;  3BJA A;  3HKZ A;  1YW7 A;  5DV5 A;  5FGM A;  2K7L A;  4C9Y A;  4I99 C;  2K9M A;  2G9W A;  5DDG A;  5HNH A;  2AXT C;  4H4K C;  5M5Y J;  3ROU A;  2VJJ A;  2TDX A;  2O9L A;  2K86 A;  3F8M A;  3HRS A;  2IGN A;  2GQQ A;  3JTH A;  4II2 A;  3WTX C;  1ZH5 A;  3TQN A;  1OYW A;  3BTL A;  2DPD A;  3ZQH A;  1WJB A;  3LSP A;  3GFM A;  2Z16 A;  4IHY A;  5E8I A;  1O7L A;  1MMA A;  3L2W A;  4A12 A;  3LST A;  4CO8 A;  2ISY A;  1RR8 C;  2LG4 A;  2DFH A;  3GUD A;  5E20 A;  2DA3 A;  2K9N A;  4L9V A;  4XKB A;  1FYL A;  2L9S A;  4LMY A;  3OS0 A;  5FFZ A;  3CME I;  3ABL H;  4UVA A;  3L2Q A;  3FIW A;  3ZQ7 A;  2EA4 A;  2WAE A;  2JA8 J;  4PJL A;  2HGC A;  3WG7 H;  3HDD A;  2W57 A;  2VXZ A;  3F9K A;  2UUZ A;  4O6J A;  1I1G A;  1XN7 A;  3BPV A;  1XSV A;  3W3C A;  5D5W B;  4E6K G;  3I3L A;  3MEX A;  2JN6 A;  3FMR A;  4XOR A;  1GDT A;  3CLO A;  3RKY A;  1VZ0 A;  3BR6 A;  4LIU A;  5F6F A;  5LEK A;  4E7H A;  3IH4 A;  4GO1 A;  2CMP A;  1E17 A;  2PJR A;  1BM9 A;  5EF6 A;  3P7N A;  5EG0 A;  2FD5 A;  4YG2 F;  5FKL A;  2GZW A;  3N4M A;  1U5T B;  4XRS G;  3E0J B;  2VE9 A;  1DP3 A;  5ILS A;  1OCR H;  5GPA A;  3PJR A;  1BIA A;  4AID A;  2DJI A;  1QVU A;  4BYY A;  4AU7 A;  1JUP A;  2H6B A;  1D8K A;  4G9Y A;  4BBR J;  1H9T A;  4M72 A;  3W2A A;  4XN0 A;  2ZJR F;  1EH7 A;  1RZ4 A;  3AFH A;  3BDD A;  5LFA A;  4UUV A;  1T08 B;  2COB A;  4OIO F;  2JA7 J;  1R36 A;  4Q48 A;  3L2U A;  1MBJ A;  2FA5 A;  5LGT A;  1Z3Y A;  2LKP A;  3FXK A;  4BHB A;  1R4M B;  4HQE A;  2DJN A;  4XN3 A;  3LSK A;  3M1C A;  4IL6 C;  1Z9C A;  2IGK A;  2L7F P;  1IG7 A;  2JPB A;  4BE0 A;  1JKQ C;  3DTK A;  3Q5F A;  1FP2 A;  2XAS A;  3CLQ A;  3HC7 A;  4GXO A;  4M3B A;  1Z0X A;  4N9I A;  4PJ0 C;  2CO5 A;  2Y48 A;  1SVO A;  3VYR B;  3ERM A;  3TW7 A;  4D5F A;  1BI3 A;  1Z1D A;  2JSC A;  1PUF B;  5BQT A;  1MZB A;  2KIS A;  2L54 A;  1IF1 A;  2X6O A;  1Y1V J;  4ZC3 A;  2NVT J;  3OIP A;  3F8F A;  4UHT A;  2FU4 A;  3KET A;  2NS8 A;  3RYP A;  5HLH A;  1MJB A;  3H9G A;  2HZT A;  1X1A A;  1USS A;  4CDG A;  4RB2 C;  1QZZ A;  3LMM A;  2G0E A;  5BNG A;  2XRO A;  2QLZ A;  3SZG A;  2ZME C;  4MEY F;  5LBQ A;  1FZP B;  1IN8 A;  4NC6 A;  5ERI A;  1TQI A;  2HNH A;  3HKZ N;  2VQH A;  1EH6 A;  1SAX A;  3J7A O;  5J4Y A;  3OY9 A;  5ED4 A;  3IHU A;  4IO9 F;  1YQA A;  4AM3 A;  2V7F A;  5DCM B;  3ZQF A;  2K02 A;  2L9R A;  1NTC A;  2R7S A;  1TP4 A;  5EGO A;  3LQR A;  1R7J A;  2W84 A;  2LSO A;  4HAM A;  3O2P E;  4LK0 F;  1S3J A;  1YX3 A;  4UVB A;  3SXY A;  3NEU A;  4XIC A;  3PNY A;  1R49 A;  2O3F A;  2FEZ A;  3FBI B;  1LJ9 A;  1OMI A;  2MGQ A;  3KPH A;  1WCM J;  5ICF A;  4WXD A;  1U2W A;  2CQX A;  2VT2 A;  2JWT A;  4M6X A;  5J1U A;  2LTP A;  4BAY A;  1MNM C;  4KIS A;  3FXU A;  1VQ7 I;  4ENK A;  3HGY A;  3A2K A;  5AIQ A;  1ZRE A;  3SFI A;  1ZN2 A;  5DEQ A;  5E1W A;  4B09 A;  2L3D A;  2DMU A;  4GCV A;  4PJN A;  1O4X A;  4GYG A;  1RIO H;  2O61 A;  2XAF A;  3I59 B;  2VOP A;  5ILV A;  4JX6 A;  1YYV A;  4AIH A;  1EKE A;  4HQM A;  5HLG A;  4EJW A;  1BJA A;  2CQK A;  4RA2 A;  3CCQ I;  4EJV A;  4DBQ A;  2BHZ A;  4M6Y A;  4HG2 A;  3VOE A;  4L5J A;  3ZQC A;  2FNA A;  5IY5 H;  5EEA A;  4TV7 A;  4G7O F;  4IJA A;  1R1T A;  1XMX A;  4PJM A;  5LGN A;  4F7Z A;  4BQA A;  5CVI A;  3FXM A;  4CYD A;  2ACJ A;  3MZ8 A;  4KJZ A;  4HF0 A;  4HRI A;  2F4I A;  5EJC A;  2Y2Z A;  2IVM A;  3A1Y A;  2VQC A;  2QSH X;  2ZSH B;  1ETY A;  4A3I J;  4V19 K;  3DBH B;  1EH8 A;  3K1M A;  4BXF A;  5IYC J;  1GT0 C;  4MGR A;  4F52 A;  1PYV A;  4WWC A;  1UST A;  3IRQ A;  4ZTJ A;  2KZV A;  1MJA A;  3GME A;  5BMZ A;  1MSF C;  2IP2 A;  5GAD J;  2DCE A;  1S7A A;  4AD9 A;  4BY7 J;  2E19 A;  1ENH A;  4GFB A;  2VL8 A;  1G3W A;  3HIF A;  2LD5 A;  3H9Q A;  4NDL A;  1LDK B;  2A61 A;  1FPQ A;  1W36 C;  2Z33 A;  4HA8 A;  3S32 A;  3HOU J;  3AKZ A;  1ZR2 A;  4NUB A;  3O3K A;  2R7V A;  1JI8 A;  1LE8 B;  4H0E A;  3CF2 A;  3FHN A;  2M3A A;  4CA0 A;  2WBM A;  2HWV A;  1FNN A;  2EV5 A;  2JTV A;  2M30 A;  1RR7 A;  2E1O A;  1IGN A;  3P9C A;  4CHU A;  5F08 A;  1PP7 U;  2HYF A;  4LGW A;  4N4O B;  5F1J A;  3H0G J;  1Y39 A;  2H27 A;  1R5I D;  2M0M A;  4Q47 A;  4Z2Y A;  4X0G A;  4DQ2 A;  5E3M A;  1ZQ3 P;  1B72 A;  1K79 A;  3BTC A;  1YJN I;  1TT5 B;  2M1B A;  4U87 A;  1U8B A;  5HOO A;  1FBU A;  1VQ9 I;  1FBQ A;  1YS6 A;  2FMY A;  4YFX F;  3S1M J;  2W24 A;  4RGR A;  2DFE A;  5GP9 A;  5IYB J;  4HZF A;  4A93 J;  3PUF A;  3S14 J;  1IXC A;  2FQ3 A;  2VQL A;  2G7H A;  1FOY A;  1ZG5 A;  2X0L A;  3VOD A;  2HYG D;  5IPA A;  3WU2 C;  3K4C A;  3S2D J;  1IUY A;  2CU7 A;  2O03 A;  1SD4 A;  1UHS A;  4RS8 A;  2F5D A;  3JR9 A;  2MH9 A;  1OYI A;  2K9Q A;  3A03 A;  2QBY B;  3E97 A;  4IVN A;  2RVC A;  2CRG A;  5B1B H;  4U7B A;  3M8J A;  3A0B C;  4BEH B;  4BL0 B;  2A6T A;  2EIM H;  2XSD C;  1LEB A;  4KMU X;  2EB7 A;  2Y75 A;  1LFB A;  4G6Q A;  1REP C;  2R7X A;  1YTY A;  1X19 A;  1ACI A;  2DI3 A;  2XRN A;  4I01 A;  5FRM A;  3D5L A;  4PZJ A;  2ZFW A;  3HUG B;  4HPQ A;  4RGS A;  1A6I A;  3GCM A;  1IV8 A;  2EBI A;  4XRF A;  1JUM A;  2NNY A;  3MKL A;  4M9Z A;  5IOZ A;  5CQE A;  1BJZ A;  1G59 A;  1HDD C;  4ITV A;  2L0K A;  3EUA A;  4B48 A;  5E3N A;  1TWG J;  2LRD A;  3H5N A;  3BG9 A;  1QQI A;  3OYG A;  2BHY A;  4V2G A;  2BVL A;  2UXX A;  1ZRC A;  3VDX A;  2QUF A;  2WY7 Q;  3S3M A;  2D1V A;  3G71 I;  5E8G A;  4BQN A;  3I4N J;  2ZXJ A;  2M0C A;  3GFL A;  2STW A;  1YX5 A;  2L9V A;  1K78 B;  3QYB A;  2UZK A;  2DAO A;  4M3D A;  3H3Z A;  1ETK A;  4D1Q A;  3KEO A;  2EZL A;  3GLX A;  2KLO A;  2X48 A;  4IEJ A;  5F0H A;  2EFO A;  1JTX A;  5K7Z A;  2Z99 A;  4L5E A;  2B7E A;  2ECC A;  2HEO A;  5TJJ A;  2OF7 A;  3KIO A;  3WTS C;  3LSG A;  4G12 A;  2J5P A;  5KNL A;  2DBB A;  4HNT A;  2VKH A;  1IO2 A;  5GTH C;  5L3F A;  2Y0S A;  2E1C A;  4HST A;  5HDG A;  5F64 A;  2RQQ A;  2R7W A;  4UV8 A;  3KCC A;  2RDP A;  2YU9 J;  1SEU A;  2EK5 A;  2PMU A;  1I1S A;  1SFK A;  3CP8 A;  3TO9 A;  1Z91 A;  2XVC A;  2DOF A;  2LY2 A;  3VYS B;  3FKI J;  1A6Q A;  1JKP C;  2D5V A;  1LFP A;  3VYT B;  2DMQ A;  2LH9 A;  3ESW B;  3KLN A;  5TIS C;  4A3K J;  4HV5 A;  3Q0V A;  2EJR A;  3AG4 H;  1F43 A;  4F92 B;  2XKP A;  3CCV I;  4FX0 A;  3S1Q J;  4DYC A;  3PQK A;  2ZFU A;  2BZT A;  3MMY B;  3PSF A;  5IT9 K;  4CIC A;  3R4K A;  2H1K A;  3W2W A;  1JJ8 C;  2ETH A;  1BC8 C;  2Y69 H;  4XM3 A;  3RKW A;  2M4G A;  3BTJ A;  3J7Z I;  1AOY A;  4XKV A;  1VTN C;  1AKH B;  2ZXI A;  3F6O A;  1MMN A;  4D5C A;  1Y1W J;  3ASN H;  3JRI A;  1PVE A;  3S2H J;  1OIS A;  1WSU A;  2K9L A;  1HC8 A;  1ETW A;  1XS9 A;  3IL2 A;  3HG9 A;  4ETS A;  3JTG A;  4E7K A;  4EAT A;  2JVG A;  2Z1D A;  2VJ5 A;  3LA7 A;  2H1L A;  3TO6 A;  4RAZ A;  1MDM A;  3E5Q A;  2QZ8 A;  1VQ4 I;  3WHC A;  1ORK A;  4DNC A;  2I10 A;  1WPK A;  2KIF A;  4OMY A;  5BOX A;  2PMZ A;  2Y9Y A;  2V9V A;  1EA3 A;  3GLL A;  1WI9 A;  2JA5 J;  2XRL A;  3WGG A;  1DPR A;  2QQB A;  1Q1V A;  2MLG A;  3OYN A;  2Z3Y A;  3ECH A;  1GUU A;  1DDN A;  4IQJ A;  2Z2S B;  2DMT A;  4W1U A;  4MTD A;  3OSG A;  1U9N A;  2LBF A;  2W85 A;  2CV0 A;  1HKQ A;  3HYI A;  4J01 A;  3H0D A;  2JQ7 A;  2JMW A;  3PSI A;  3ULQ B;  5C44 J;  1RNL A;  2VOO A;  2I5U A;  3S3N A;  1E3O C;  1YRN A;  1VQ6 I;  3J81 K;  5JR3 A;  4A3M J;  1MIJ A;  3LAJ A;  1SD5 A;  4RLF A;  1MMS A;  1SD7 A;  2LMD A;  4ANJ A;  3BQY A;  3LAP A;  1Z6R A;  5LHI A;  4MEX F;  2GA2 A;  3O8G A;  3H9J A;  1F4K A;  5K7H A;  1XGM A;  3BWG A;  3C2B A;  2MBF A;  1VQP I;  4FE7 A;  1O7F A;  2QCO A;  4M9X A;  3JRC A;  2KZG A;  4K2E A;  5TRD A;  2CFO A;  1R58 A;  4KNY A;  5GAG J;  3OYB A;  1CQT A;  2GWR A;  4BJ5 C;  3GTL J;  4ZYE A;  4A3C J;  1S7O A;  1J75 A;  1RES A;  3NWS A;  1WWX A;  2L5Q A;  5JI6 A;  1B9M A;  4BNC A;  1BI0 A;  2HQR A;  2V1D A;  3DKX A;  1D5Y A;  3RKQ A;  1UJ8 A;  4ZYD A;  3VWB A;  5DTD A;  2OTJ I;  4XLA A;  3WOD F;  3IKT A;  2JVH A;  4FQG A;  1VQL I;  2NRA C;  4MQV A;  5A2Q K;  2DOD A;  2XAU A;  1K6O A;  4LG0 A;  1IN5 A;  4QSH A;  1TW2 A;  5IP6 A;  1IJW C;  3F8N A;  3M1E A;  4MO7 A;  4CCL A;  4IOA F;  2JA6 J;  4XNF A;  3BG7 A;  3F23 A;  1N77 A;  3KEY A;  4KIG A;  3QRF F;  1G3S A;  1QNT A;  4N4N B;  1TWC J;  4BGD A;  2KPM A;  3TKY A;  2NOJ B;  5DS9 A;  4UXN A;  2HVR A;  4CCM A;  3FXO A;  2HI3 A;  3J81 Z;  2AHQ A;  3G1L A;  2VC0 A;  3OR1 C;  5FKN A;  4A3E J;  2E2I J;  1F36 A;  1D1B A;  2N8G A;  2EIK H;  3EYI A;  1SAN A;  3K0L A;  3K9T A;  3Q9S A;  3BJ6 A;  2KL4 A;  3KLO A;  3MQ0 A;  3B6A A;  1YIT I;  1F9N A;  2XB5 A;  2RQP A;  4EJO A;  2XAH A;  4ZJZ A;  3JRH A;  4YFN F;  3R0J A;  2HVQ A;  1EF4 A;  2IRF G;  3SZT A;  1RET A;  1G4D A;  2ZC2 A;  3JRD A;  2NVY J;  3E1S A;  3OL4 A;  1YOV B;  2TCT A;  4B4C A;  2LY1 A;  3TP0 A;  2ESN A;  5LHH A;  1BL0 A;  2NXN B;  3CF5 F;  4HEA 2;  4E7L A;  5L3D A;  2E5N A;  5ILU A;  1TBX A;  2K4J A;  3CCL I;  3JRA A;  4HW0 A;  1FSE A;  3F21 A;  1Y8R B;  5CVV A;  2PMZ N;  2KQR A;  4QLC U;  2XGE A;  1PUE E;  2V9P A;  2VOD A;  2DQL A;  2VKV A;  2BE5 F;  3DBR B;  5A2Q Z;  3GTG J;  3MFK A;  5CJ9 A;  5JLX A;  2VBY A;  4UUT A;  3R61 A;  1TWA J;  3OS1 A;  4OIP F;  3AL0 C;  2L01 A;  1XCV A;  1XDU A;  4IF4 A;  3G2B A;  2HTS A;  1MBH A;  1KON A;  2VPR A;  3K4K A;  3H36 A;  2O0Y A;  3DF8 A;  3WTT C;  2IEK A;  4EEF G;  2RRE A;  3PIO F;  5FKM A;  5K5R A;  4XLH A;  1MSE C;  4OWR B;  3RDI A;  3FF5 A;  2M5W A;  3ELK A;  2JRM A;  2OBP A;  4CXF A;  5M3M J;  2O6G E;  1DGW Y;  4RB1 A;  4HLX A;  1JJ6 C;  2H8W A;  4DZJ A;  1OCP A;  1P7I A;  2A68 F;  2RKH A;  2WAD A;  3E6B A;  3X2Q H;  4HDV A;  3GFJ A;  1YW9 A;  5L3B A;  5J8C A;  1VQ8 I;  4NC8 A;  5HS9 A;  1Z3X A;  1NG7 A;  2UXN A;  1W0U A;  3FX3 A;  1MMD A;  4XKC A;  2KT0 A;  4A0Z A;  3IV5 A;  1QZE A;  1JGG A;  1TWH J;  3G4S I;  1DU6 A;  4PGH A;  4IRH A;  2WAQ A;  2HS5 A;  4KA4 A;  2QQ9 A;  2GXA A;  2VBX A;  1MBK A;  4QIW N;  2BBY A;  5K5O A;  5LEJ A;  1I39 A;  1WZ2 A;  2IAI A;  4BU2 A;  3F0C A;  5F0F A;  1T2K A;  1I27 A;  1SFX A;  2DMN A;  2V6C A;  3CD6 I;  4NHJ A;  5LRR A;  2XF7 A;  3K4M A;  1X1B A;  2EH3 A;  1R6R A;  3R60 A;  4XRM A;  3U1D A;  2E36 A;  3ZQQ A;  3ABK H;  3GEZ A;  4BJ6 C;  1D1A A;  4AIJ A;  3D5R C;  1P9Q C;  1ETQ A;  3OYK A;  3BRO A;  3HHH A;  3T8R A;  2GBY A;  2GXG A;  3EYY A;  3JCU C;  3K4B A;  3BLY A;  5KAF C;  1NK3 P;  4YIR X;  5JHF A;  5CKT A;  2HOT A;  4OU0 A;  9ANT A;  2VB6 A;  1ETX A;  1MH4 A;  4S0H B;  2L7Z A;  3RJP A;  5M5X J;  1MBE A;  3HSF A;  2E1N A;  1IN7 A;  2LRE A;  4EQQ A;  4BUP A;  2XB0 X;  3ZQL A;  5HLI A;  3L09 A;  2O7O A;  1X1D A;  2VIX A;  3BG5 A;  5C3E J;  4B44 A;  1W7P B;  3U1K A;  1TC3 C;  2CS3 A;  2DA4 A;  5DM6 F;  2PJR B;  2QVO A;  2PG4 A;  3V7C A;  5EG0 B;  1AWC A;  2R92 J;  5FJ8 J;  5EDN A;  3WTZ A;  1RC9 A;  2F5F A;  3PUB A;  2GIV A;  4YEL A;  2WC2 A;  2F5V A;  3VEP A;  1S9H A;  3CO6 C;  2K27 A;  4XR6 A;  4PSW A;  4OIR F;  1R22 A;  5ICE A;  3KP6 A;  2EQR A;  4PCQ A;  2BGC A;  4PFO A;  1K4S A;  3QU6 A;  3C18 A;  4P5O A;  2VON A;  1BI1 A;  2PFB A;  4I7H A;  1FOW A;  3HRM A;  1OCO H;  4XLC A;  1VF9 A;  2M7B A;  3HSR A;  3AG2 H;  1J5Y A;  3SDB A;  3CC7 I;  1BR2 A;  1S6L A;  3S3O A;  1FP1 D;  2X85 A;  2X9D A;  5L3C A;  2CW0 F;  4NBQ A;  3HEF A;  1YE9 A;  1T39 A;  3CMY A;  1G2H A;  4PK4 A;  1HLV A;  2DYR H;  2PQ8 A;  3EUH C;  3WGI A;  2W1O A;  3R6S A;  3FXR A;  5CLS A;  5L3G A;  3FK6 A;  1MGT A;  3KYC B;  4LLN A;  5F1R A;  3JAM K;  2VPL A;  3C7J A;  1WH5 A;  5HVQ C;  2DDA A;  1VND A;  3AAF A;  2VJI A;  5E18 F;  1JKO C;  2OQG A;  1RUO A;  4A69 C;  3REO A;  4L0Z B;  1UAA A;  5LGU A;  1W36 D;  1JKR C;  3PNT A;  4C2T A;  4IX7 A;  4UUS A;  3CC4 I;  2K3F A;  2RNJ A;  1P4A A;  1XTA A;  2VBW A;  2ZJ2 A;  2VBZ A;  2HQ5 A;  1FMV A;  3L2C A;  1FWZ A;  1RPW A;  1OR7 A;  4FX4 A;  4PFP A;  4RBO A;  4HNV A;  3FMS A;  3CDH A;  1FBS A;  2A6E F;  5EGO B;  3BG6 A;  2QA4 I;  5GAE J;  2WAQ N;  1TNS A;  1GV5 A;  1OLT A;  3S16 J;  1I3Q J;  3G1O A;  1WJF A;  4YIF A;  2FOW A;  4U7D A;  3BR1 A;  2DO7 A;  2CV1 A;  3I58 A;  3DPL C;  2FQ4 A;  3G1M A;  2BY1 A;  2K5C A;  1V55 H;  2CWE A;  3O8H A;  3ZMS A;  3CZ6 A;  3GTQ J;  4ENJ A;  2IXS A;  3F6V A;  4FET A;  5AIP A;  4JX4 A;  3SEZ A;  1UHM A;  2CUZ A;  4DGW B;  2ID6 A;  2P81 A;  2YSR A;  1Y56 A;  3SZP A;  1KYW A;  3EDP A;  3MKY B;  2E71 A;  2JSP A;  3I4P A;  3GYH X;  4V2F A;  1Z67 A;  2NS0 A;  2GXB A;  1KYZ A;  3ASO H;  1VFC A;  2R7T A;  3TGN A;  4BE1 A;  5J3L A;  1WJA A;  1KGS A;  2R7F A;  3PFY A;  3JAM Z;  3CJR B;  1YFH A;  1WVR A;  1WGX A;  3I71 A;  2PI0 A;  3DU6 A;  1XC5 A;  4HLY A;  5DUK A;  4KUM A;  1HA8 A;  3W6J B;  4OOI A;  1H9G A;  1OFC X;  2ID3 A;  3GTK J;  4RM3 A;  1TNT A;  3QU3 A;  3S17 J;  3ECO A;  1D0Z A;  2KIU A;  1T6S A;  5JVG F;  1ON2 A;  3PNV A;  1P7J A;  3RIR A;  1HKT A;  1I6H J;  1WFX A;  1ZG3 A;  3BTI A;  2OU2 A;  4XOP A;  2L2O A;  4A3G J;  3CUQ C;  3V42 A;  2EFN A;  3G3Z A;  2DFF A;  5E17 F;  1LUJ B;  1ZR4 A;  2GOM A;  2R7U A;  1JTY A;  5E1Z B;  1OCC H;  4A3J J;  1TL8 A;  2DOE A;  5FRO A;  3SYT A;  4G6D A;  3CDI A;  4MHG A;  5IP9 J;  3DV8 A;  3K2Z A;  1NH3 A;  1W5C C;  1XD7 A;  3KZZ A;  2A69 F;  3RSN A;  1B8I A;  1MKM A;  2GM4 A;  3SJM A;  4D9J A;  4PGG A;  2X1D A;  1L0O C;  2NS7 A;  4QPO A;  2DQR A;  1QHG A;  3ZOB A;  2V26 A;  2P6S A;  1I50 J;  2CSO A;  3BZ6 A;  1FT9 A;  4BS9 A;  3GO5 A;  3RQI A;  4LLL A;  4S04 A;  3HOT A;  3IWZ A;  2VE8 A;  3L1P A;  3RPQ A;  1OYY A;  1SD6 A;  2FE3 A;  3I54 A;  1O3T A;  2P7C B;  2CUE A;  5CPR B;  1ZK8 A;  5J1R A;  4ESJ A;  1ZG1 A;  4DYR A;  2PX9 A;  2PN6 A;  5HLT A;  1SFE A;  2LC2 A;  2L7M P;  3BR3 A;  3E5U A;  2OV7 A;  4C3H J;  4RGX A;  4ON0 A;  3S2W A;  3IH2 A;  1CF7 A;  1B72 B;  4MNU A;  2NAZ A;  4XLN F;  2Q8K A;  3V8L A;  4WX9 A;  4I09 A;  2JZY A;  2VI6 A;  1LB2 A;  2QSG X;  4A3B J;  3QP6 A;  1OQY A;  2P6T A;  1POG A;  2KIQ A;  3K4N A;  5B5E C;  3A01 A;  2KMU A;  4P55 A;  2XPU A;  2HXI A;  1S5L C;  1T33 A;  1IDY A;  3H92 A;  3MWM A;  1KU2 A;  2IS6 A;  1J7K A;  2DU9 A;  3TW6 A;  2DLL A;  5D5V B;  2A5W A;  4RLQ A;  4BHP A;  1XB4 A;  3DFG A;  4KIB A;  2PLY A;  1OCT C;  2IGM A;  3FXL A;  2BXZ A;  1U0J A;  3HOW J;  2EV6 A;  4A5M A;  3IH3 A;  3R0A A;  1ZGA A;  1B59 A;  5EYR A;  3HZJ A;  1IV6 A;  4MFD A;  4CCK A;  4I02 A;  4KIT B;  3CCJ I;  2EWN A;  1EJ9 A;  1JXS A;  3C2G A;  2KRH A;  4FHT A;  4BQO A;  1IDZ A;  4I0A A;  5D8L B;  2K40 A;  4HX7 A;  2QQ8 A;  4ZDO A;  3H35 A;  4MFE A;  3E6M A;  2HKO A;  1XGN A;  1DPU A;  2M9H A;  3ZQI A;  4G6T B;  1T95 A;  2BOL A;  2WV1 A;  5HOD A;  1STZ A;  4C2M J;  1V4R A;  3OYL A;  4HX4 A;  4DBR A;  5DM7 F;  3HUG A;  1JT0 A;  2XPV A;  3V8J A;  1GVJ A;  3B6C A;  2DPU A;  1MBF A;  3OIQ A;  4RM2 A;  2K85 A;  4O5V A;  4Y3O A;  2CW8 A;  3IKV A;  2HOA A;  5CQG A;  4C2U A;  4HX8 A;  1SVL A;  4R1H A;  3ZRG A;  5HS7 A;  3HOZ J;  1S7E A;  2X51 A;  1R00 A;  4ZDP A;  3IC7 A;  5D6F A;  1IRX A;  2AS5 F;  1HBX G;  5JLW A;  1U5T C;  1TW3 A;  4KDP A;  1YIO A;  2R7D A;  2Q2E A;  4D7N A;  1F5T A;  2FUG 2;  3EET A;  2QGU A;  1X3Z B;  3HGG A;  3MZY A;  3E3V A;  4MTE A;  2KIM A;  3HL2 A;  2F5C A;  3ISP A;  1Y0U A;  4N9H A;  5GPC A;  3FMQ A;  4HDU A;  3F3X A;  1WJC A;  2XPW A;  1X3W B;  1YJW I;  3DU5 A;  2IGO A;  1G6N A;  1OCZ H;  4XL9 A;  1S8N A;  2F5E A;  1VQN I;  3G73 A;  1QVT A;  3DLL F;  4WCG A;  4AUX A;  1JE8 A;  3VFZ A;  2XUB A;  2BV6 A;  3I0T A;  1HST A;  3LFK A;  2B63 J;  3C3W A;  3TO7 A;  3CCU I;  1KU9 A;  3OOU A;  4ZYA A;  3S8P A;  2L4M A;  2B9S A;  1QHH D;  5D8K B;  3OMY A;  2FNP A;  3W6K B;  1MD0 A;  2LF7 A;  1JGS A;  2QKM B;  1ZLJ A;  3K70 C;  2ISZ A;  3EQL F;  4F55 A;  4BDZ A;  1UG2 A;  4X1E A;  3U9G A;  1E2X A;  3NAU A;  3KZY A;  2IS4 A;  2Q1Z B;  5H6R A;  4HYE A;  2HOE A;  4KT5 C;  4A2U A;  5FLM J;  3DCF A;  5J40 A;  3E6D A;  1HKS A;  3DPT A;  3ABU A;  3Q0U A;  1FY7 A;  1ZRD A;  4MQ9 F;  3P9I A;  5EEG A;  2KRC A;  2KP6 A;  2BY3 A;  4Y15 A;  3MN2 A;  2XC7 A;  4QPQ A;  2ME0 A;  2LR8 A;  2XAG A;  3Q9V A;  4Y52 J;  3A4C A;  2L4A A;  4EM2 A;  2VC1 A;  2ZBK A;  2LKS A;  4HV6 A;  4NQW B;  4I2O A;  4EJU A;  4P9U A;  2MD0 A;  4CCJ A;  4AVZ A;  3WU1 B;  4UB6 C;  4G94 A;  2HQA A;  1BA5 A;  2BY0 A;  3K1N A;  1H0M A;  1DU0 A;  3HOY J;  1J0R A;  3RCO A;  4PJJ A;  4M73 A;  2L7K A;  1B9N A;  2MW8 A;  2HPM A;  1O57 A;  1R1V A;  3TP3 A;  2R5Z B;  2K9S A;  2R0Q C;  4J00 A;  3PQJ A;  1SMY F;  1MDM B;  1VQ5 I;  1D1C A;  3HXL A;  5KVR A;  3KP4 A;  5KAI C;  3OYC A;  1N75 A;  2PBI A;  3TL4 X;  2AQF A;  3K69 A;  1XMK A;  1K6Y A;  2JA2 A;  4QWQ A;  1BI2 A;  3MD2 A;  4OMZ A;  1D8J A;  5FD5 A;  2HYJ A;  2LBF B;  1R5H A;  2ZNZ A;  5HS8 A;  5FKK A;  2IA2 A;  3L00 A;  2HDC A;  4E7J A;  2JT1 A;  4B8X A;  4F93 B;  4DJA A;  2F4O B;  2KRF A;  2ECB A;  2F2E A;  5FLV A;  3AG3 H;  2OUM A;  2H8R A;  1SMT A;  4FTH A;  3EUH A;  2OCC H;  4CZZ A;  2VUM J;  2YPR A;  2KDO A;  2ELJ A;  2LNB A;  4JQF A;  1Z7U A;  2V1N A;  1XDS A;  2LK2 A;  3T8T A;  1Z05 A;  2ZME A;  3WHB A;  3PO3 J;  1K61 A;  5J47 A;  3CJQ B;  3LSH A;  2VN2 A;  2FBH A;  4HBL A;  1WHU A;  2MLK A;  3CC2 I;  2OJE D;  3OYJ A;  4AVP A;  3K1P A;  4P9F A;  1IUF A;  2R5Y A;  2OA4 A;  1X4P A;  1W4M A;  1X58 A;  2BW3 A;  1X3U A;  1BC7 C;  3KP7 A;  1T98 A;  2MD5 A;  3QQA A;  2H09 A;  3OR2 C;  4E7Z A;  2DXI A;  1E3P A;  3RQ4 A;  1WJD A;  3QOP A;  1HSJ A;  1QGP A;  4U88 A;  1LEA A;  4FAS D;  1JHH A;  2WV0 A;  3V7R A;  2P5K A;  3WE2 A;  2YU3 A;  1C0W A;  1U78 A;  1YS7 A;  2JUC A;  2ZKZ A;  3CCM I;  3Q0W A;  1WI3 A;  3DEU A;  1Y6I A;  2HOS A;  1XSX A;  2MFZ A;  2PJP A;  2E35 A;  1FYK A;  2JJ7 A;  4LG0 B;  5TGT A;  3WTW C;  3GTO J;  1W0T A;  3WG9 A;  1R9T J;  3J80 K;  3H5A A;  3H1C A;  3PO2 J;  4PUS A;  4PDK A;  2HDD A;  2P8T A;  2Y31 A;  4HSR A;  2F6C A;  2MAB A;  3BG3 A;  1KQ0 A;  3MZH A;  3TDZ C;  1U6G A;  3RZD J;  2OPT A;  3FHZ A;  3IP4 B;  2ADU A;  2P7V B;  4XK4 A;  3RPU A;  3GX4 X;  4OAY A;  5GTI C;  2VT3 A;  1RI7 A;  2I8D A;  3J7Y J;  3JRG A;  3FK7 A;  1IRZ A;  3K10 A;  1RKT A;  1P2F A;  4LJZ F;  3A0H C;  3DPU A;  1FMW A;  2JRT A;  2ZO4 A;  1TWF J;  3TMO A;  4RDU A;  5JFR A;  4GYI A;  5FO5 A;  2BYV E;  1SAU A;  3HRT A;  3ML6 A;  3BJO A;  2KJC A;  4IXA A;  5E79 C;  2IA1 A;  2DA2 A;  5K7F A;  4KN7 X;  3M07 A;  2MYS A;  1WRJ A;  3GTJ J;  4WXC A;  3LA3 A;  3CUQ A;  4M71 A;  3FKJ A;  2AXL A;  3EPZ A;  3I4M J;  2DMP A;  3GZ5 A;  1BW5 A;  3I5U A;  3RTR A;  3I56 I;  1DUX C;  2H94 A;  4DIQ A;  2DA1 A;  1DGR M;  2PMH A;  2DA7 A;  3GWZ A;  4UB8 C;  2XSJ C;  3CDL A;  1OJL A;  2L9N A;  1GVD A;  5LLQ A;  3ZMT A;  1J9I A;  3L2R A;  2XKO A;  3HOS A;  3J80 Z;  2JK3 A;  2DW4 A;  4CYC A;  2LVS A;  1ZAR A;  3HPG A;  4XLF A;  1PDN C;  4W97 A;  1NG6 A;  4RAF A;  4L0Y B;  4A0Y A;  1S29 A;  2GAU A;  2CUJ A;  4EMS A;  2MSY A;  3QP5 A;  4KMF A;  3ZP5 A;  3JSO A;  4AIK A;  1N25 A;  4P96 A;  2RN7 A;  1R71 A;  1LVA A;  2XAJ A;  4MIM A;  4XQF A;  3ZMD A;  1Y8Q B;  3HTS B;  4AYB A;  4M74 A;  2IS2 A;  1XGO A;  1VQM I;  4XMY A;  1ULY A;  3QAH A;  1X4O A;  1AA7 A;  3D5S C;  5E3L A;  1HCR A;  2VKE A;  4BJT A;  2P5L C;  5J1Y A;  3S1R J;  1FOX A;  2OZ6 A;  4EV0 A;  2LYC A;  5DYM A;  3CTA A;  2ZNY A;  3DEW A;  3LNQ A;  2QEN A;  3P5J A;  1SC7 A;  2ZJQ F;  1V5F A;  3F8B A;  3NRV A;  4A0X A;  2Y30 A;  4IKF A;  3I64 A;  3IAM 2;  2EFP A;  1LDD A;  4IHT A;  2CV2 A;  3UKG A;  1UMQ A;  1D0X A;  3BC8 A;  4G7H F;  4CSW A;  1A36 A;  3JRB A;  1FTT A;  3HPH A;  4A3L J;  1IXR C;  2M45 A;  2HFH A;  4XLP F;  3KE2 A;  3H3U A;  5H20 A;  2M8G X;  1HW2 A;  3CCS I;  4IRG A;  3F72 A;  5IP7 J;  2UWM A;  2DT5 A;  3ZMV A;  3GBG A;  2HR3 A;  5L3E A;  4XBF A;  2QF7 A;  2EFQ A;  3CJT B;  1B1B A;  3H3V K;  1TLH B;  4LIT A;  1V5E A;  2IA0 A;  5HDN A;  1X1P A;  2Y9Z A;  1KU3 A;  3CJN A;  4UNO A;  4HOB A;  2XIG A;  2A3S A;  3DWL E;  2GOX B;  3E5X A;  4M9S A;  3D1N I;  2OC6 A;  3PM1 A;  3C1D A;  3KP2 A;  4ZTF A;  3K7A J;  2ELK A;  3OYH A;  1IN4 A;  3J7A Y;  2K3P A;  4WXH A;  5D4R A;  2NVX J;  2STT A;  3M9A A;  4UVC A;  1ITY A;  1TQP A;  2HU9 A;  5AON A;  1ETO A;  3KEQ A;  4RAY A;  1H89 C;  2GLO A;  2DA6 A;  2D1H A;  3OYM A;  1W7P A;  1XMA A;  2OCE A;  3BQZ A;  1OPC A;  1VI0 A;  1YW8 A;  3RPU D;  1WQ2 A;  2M87 A;  2W48 A;  2Z9O A;  3NAR A;  2D2W A;  5D4S A;  1YJ9 I;  1T56 A;  1ODD A;  1U5T A;  2F4M B;  2EZK A;  3BY6 A;  3IAS 2;  2WB1 N;  2EZH A;  2FBK A;  3CES A;  2RV8 A;  3CUO A;  4ZH4 F;  4F91 B;  2G7U A;  4JBA A;  4RB0 A;  2E2H J;  1W5S A;  3HJE A;  1Z77 A;  1V5G A;  1TQM A;  1ZRF A;  5KCM A;  2E1M B;  1P4W A;  5D6E A;  1K4T A;  1N78 A;  1XPX A;  3CCR I;  2IPQ X;  2RC4 A;  4IHW A;  3FM5 A;  3HSE A;  2ZCW A;  1YLF A;  3BT9 A;  4PSX A;  1IW7 F;  3T1B A;  4M3E A;  2ESH A;  2DYS H;  1LNW A;  3JW4 A;  2MG4 A;  3QPT A;  4RMN A;  2W7N A;  3BOQ A;  1D3Y A;  3S15 J;  1RRJ A;  4ZDL A;  4FE4 A;  1SFU A;  1R4N B;  2XF6 A;  4NB5 A;  2Z5U A;  3FXJ A;  3QYE A;  4BE2 A;  3KP5 A;  1VQO I;  1BOB A;  1O3R A;  2CFX A;  2W25 A;  4YEJ A;  1PUF A;  2EPF A;  1M1E B;  4AYB N;  1GV2 A;  3QWL A;  1HDP A;  3JRE A;  3ABT A;  4UUS B;  2DN0 A;  3OS2 A;  4ENM A;  2XV4 S;  2HDW A;  2HXO A;  1MH3 A;  2P4W A;  1P6R A;  3PL8 A;  2VXD A;  1LVK A;  3CCY A;  2DDB A;  4WK8 F;  2IBD A;  4L18 B;  1GHC A;  3FZV A;  1IXS B;  3HM5 A;  2DOA A;  1FLI A;  4E70 A;  2M7A A;  3C2H A;  4L9N A;  2NVU B;  2QM3 A;  2MA3 A;  3LSJ A;  5M3F J;  3M3Y J;  3DXJ F;  1B4A A;  4ESF A;  3E6C C;  4BDY A;  5DCM A;  5LHG A;  2XF5 A;  3M8F A;  4B43 A;  4R79 A;  4ZZD A;  4E4H A;  1PJR A;  1BIB A;  3GXO A;  4II3 A;  3CO7 C;  3ZGK A;  3QPL A;  4CZC A;  1T0F C;  2J5O A;  3P9K A;  1G8X A;  2JPC A;  1HQC A;  1QRY A;  3F22 A;  4AC0 A;  4JOM A;  1ZKG A;  3B02 A;  5IOY A;  3MAJ A;  4IPA A;  4OAZ A;  4C3I J;  3DTE A;  5CVJ A;  1JUS A;  3LA2 A;  1ZGJ A;  2IT0 A;  2ICW G;  2V1U A;  5ICC A;  3COA C;  5BS6 A;  2A05 A;  1R5G A;  5C4J J;  1QU3 A;  3FBN B;  3L7W A;  5FRN A;  4F3Q A;  1XCB A;  2EIL H;  2WAF A;  3BR2 A;  3I59 A;  3IWF A;  3QOE A;  3QYF A;  1LPQ A;  1D5V A;  1IZ1 A;  2VAS A;  1XGS A;  3KYL A;  2MH2 A;  4BY1 J;  3T0Y A;  3ZPL A;  5CVR A;  4QTR A;  2BVM A;  4I76 A;  1YI2 I;  2XDV A;  3OSF A;  3WTV C;  1QO0 D;  3LOC A;  3OL3 A;  4X6A J;  3LSR A;  4YII A;  3ERE D;  3ABM H;  2R7Q A;  1ETV A;  4GGG A;  1H8A C;  2DTZ A;  1P4X A;  2ELH A;  3M7G A;  4U0W A;  4O3M A;  1FC3 A;  1BBY A;  1WH7 A;  3GF2 A;  2XGX A;  1V3F A;  3V7S A;  3SDG A;  2YX4 A;  1K7A A;  1FYM A;  1W7P D;  1BN5 A;  3JRF A;  2RAE A;  4XSZ F;  2EV0 A;  5K5Q A;  1B8I B;  2AO9 A;  1S72 I;  1QPM A;  5LRS A;  1IRF A;  2O8K A;  4M3G A;  3ZR8 X;  1IC8 A;  3LSM A;  2GIZ A;  1KZH A;  3NWT A;  2RNG A;  3FIS A;  4IHS A;  4KT6 A;  5E3O A;  4E7I A;  1QPI A;  2CG4 A;  3QPH A;  2OZU A;  1LKX A;  3M8E A;  1HXD A;  5E1X A;  4B3X A;  4DYQ A;  3DKY A;  1WJE A;  2KKO A;  2X6Y A;  3HTU A;  3S93 A;  2LY9 A;  5EZG A;  4EGZ A;  1YIJ I;  2OQR A;  5BPI A;  1LE8 A;  2QKL B;  4B47 A;  1NHA A;  3A02 A;  5HDK A;  2YR2 A;  4JP0 A;  1G3T A;  2O8X A;  1CF7 B;  4XSX F;  1BR4 A;  1WKM A;  5FFX A;  2LLK A;  4KFC A;  3I9V 2;  3WE3 A;  3UNG C;  2LF8 A;  2EIN H;  4P1W A;  1JHF A;  1X2M A;  3G6E I;  2R7Z J;  1QBJ A;  5C4X J;  2A5Y B;  1GXP A;  3A01 B;  2D45 A;  3DKW A;  4Y17 A;  3DQV C;  2ZB9 A;  3DLA A;  3RKX A;  2FF4 A;  3K70 D;  2KHM A;  4XID A;  3MCZ A;  2A6H F;  2BY2 A;  5D5U B;  3PFI A;  2CYY A;  1I6X A;  2AQE A;  1ZEL A;  2IW5 A;  2ZXW H;  4IZZ A;  4FT8 A;  4LD5 A;  2QQA A;  5J6X A;  1FIA A;  3N97 A;  1F1Z A;  5ICG A;  2DK8 A;  4ASN A;  4IHV A;  4IHX A;  4LFU A;  3VB2 A;  5HNF A;  1JT6 A;  2XAQ A;  2HQN A;  1NK2 P;  2HKX A;  4KYW A;  1R23 A;  1MMG A;  1XX5 A;  2DA5 A;  2LFB A;  3F8C A;  3FWE A;  2IS1 A;  2XGD A;  1DQU A;  4KIC A;  3BZC A;  2V9K A;  4A3F J;  3QOD A;  2QBY A;  3LSI A;  1IRG A;  1O3S A;  2VJ4 A;  2DT6 A;  4JX5 A;  4BEH A;  1ZYR F;  5EZH A;  1Q1H A;  1ZLK A;  4Y4R A;  3ONQ A;  1D0Y A;  1YG2 A;  3FM3 A;  2YS9 A;  5DUI A;  2GA1 A;  3TDU C;  3AG1 H;  4ABZ A;  4ENN A;  4A6D A;  1G3Y A;  4L5I A;  5FLX K;  1UG0 A;  3B73 A;  2VLA A;  3TOA A;  3GFI A;  3AL0 B;  4M6V A;  4Y7N J;  1T38 A;  3BCB A;  4NC7 A;  3W6V A;  4C30 A;  2E2J J;  4N0B A;  2TRT A;  4RB3 C;  2V1X A;  4GDF A;  2NYX A;  3L9F A;  4EVI A;  4BQQ A;  3BPX A;  3PIP F;  4I6Z A;  3SEQ A;  2XGC A;  5KK1 A;  3UR3 C;  3ZCO A;  2WWY A;  3NQO A;  2EFW A;  1FSH A;  5B1A H;  4EGY A;  1AU7 A;  3KZI C;  3BR5 A;  3JSP A;  2CGP A;  1ZAO A;  2Q2E B;  4IQ4 A;  1P92 A;  3K6G A;  4Q5S F;  1E3H A;  2WTE A;  1BOA A;  3VSK A;  4B3A A;  1K78 A;  5H6Q A;  3N05 A;  3HOX J;  1J59 A;  3GW2 A;  3K4J A;  5FD6 A;  4JYK A;  1Y0N A;  2MC4 A;  2M8E A;  3HRU A;  1SVM A;  4RAG A;  4Y13 A;  3SFZ A;  6PAX A;  4FIS A;  1W1W E;  3MKW B;  2A07 F;  1BW6 A;  1FTZ A;  3K4L A;  1MBG A;  4HF2 A;  1W5T A;  3QPS A;  4G8X A;  1FOK A;  4XOT A;  2E1M C;  4BXX J;  2FXA A;  4L9J A;  1X2N A;  2JUG A;  3CMM A;  3KFW X;  3ZXS A;  2O5R A;  1UB9 A;  1UZC A;  3LWF A;  4A5N A;  1UFM A;  3D0S A;  3SHF A;  4UV9 A;  5J4V A;  3KX2 A;  2PEX A;  2CUF A;  2NOG A;  2ME6 A;  1KA8 A;  1LQ1 A;  4B1R A;  2UV1 A;  2XHK A;  5FLX Z;  1OKR A;  2EIJ H;  3ZMZ A;  4BHC A;  4LOC A;  2ZXH A;  4XON A;  4Q4Z F;  3LFU A;  4YRV A;  5F27 A;  4I0B A;  3OYD A;  3OYE A;  1RKW A;  2R3S A;  4EJT A;  2BXY A;  1X1C A;  1L3L A;  1IN6 A;  2DTR A;  2V79 A;  3V4G A;  3MKZ A;  5FKO A;  3TBI A;  1A04 A;  3ZN1 A;  4CCN A;  1EV7 A;  1ZGW A;  2LOO A;  2C6Y A;  1IAW A;  2R7O A;  5FB2 A;  4D7M A;  3OV8 A;  4FCY A;  4U0Y A;  2H6C A;  1OR7 C;  2L02 A;  4D0P A;  1LFU P;  2P0W A;  4AWX B;  1AKH A;  4DOZ A;  5DD8 A;  3CCE I;  1VQK I;  4GRI A;  2ZSI B;  3BZK A;  2YX7 A;  2RGV A;  4A6E A;  4NQW A;  5DD4 A;  2QSF X;  4G7Z F;  1YHQ I;  4LB6 B;  2NVQ J;  5D5X B;  2EA2 A;  1YO5 C;  1PP8 F;  3LQQ A;  2WA0 A;  3U2R A;  1HW5 A;  2LDU A;  3IRR A;  2R5Z A;  2FX0 A;  3SQN A;  2LP0 A;  1HW1 A;  5B66 C;  2W82 A;  2DT7 B;  1ZTR A;  2IJL A;  4JK1 X;  5M5W J;  2E60 A;  3GTP J;  1FX7 A;  3V8K A;  4DW6 A;  1BR1 A;  2CQ7 A;  2YUS A;  1YRN B;  2FML A;  2LKX A;  2QWW A;  2X4H A;  3HB9 A;  4A3D J;  1QA6 A;  3W2V A;  1MNE A;  2NNN A;  3MVP A;  3ZN0 A;  4BXU A;  1XSD A;  1SFO J;  1MJ9 A;  4LB5 A;  5H2F C;  1MND A;  2X1E A;  2OD5 A;  3OYA A;  3HHG A;  2BEO A;  1GLN A;  1Z21 A;  2CJJ A;  1XG1 A;  1A35 A;  2ZME B;  4LIV A;  1T8I A;  5IT9 Z;  2ZJP F;  2HVS A;  1U9O A;  5F0C A;  5DCF A;  2R5Y B;  2Y0M A;  2CQN A;  4BKX A;  4I98 B;  2BW3 B;  4Y33 A;  3GTM J;  1UHW A;  2MC3 A;  3CQZ J;  4IOC F;  3HOV J;  3HBL A;  4LG3 A;  4XKW A;  4OIN F;  1TT0 A;  2KFD A;  2KDZ A;  3WTY C;  4LK1 F;  1KU7 A;  1RUN A;  2DFI A;  3DTI A;  1UCR A;  2R4G A;  1APL C;  3EUK L;  3KYD B;  4IRI A;  4KIF A;  3VYU B;  2OTL I;  2W4S A;  3DEE A;  3VSL A;  3WU0 A;  3RI4 A;  2FJ1 A;  2E7X A;  4EM0 B;  1I3A A;  3O6B B;  1R1U A;  4BBS J;  4MLO A;  3K2A A;  3KP3 A;  3BP8 A;  4EM1 A;  4CGZ A;  4WF2 A;  3VPR A;  2Y0S N;  5B3S H;  1FEX A;  1ZHF A;  2FRH A;  1FIP A;  1T0F A;  2E34 A;  4KN4 X;  5J8F A;  1O3Q A;  5GAH J;  5JVT A;  4YFK F;  4S05 A;  5BPD A;  4L9T A;  1ONV A;  2X6X A;  2CQQ A;  2Q0O A;  4ZYG A;  2OAZ A;  5JHU A;  1HF0 A;  1E0E A;  2HZD A;  2FBI A;  2HTJ A;  1Z7L A;  4NNJ A;  3WGH A;  3FXQ A;  5IYD J;  3RYR A;  4OIQ F;  2M2E A;  2M4K A;  1Z6T A;  3L2V A;  2QYO A;  5CVU A;  2V4J C;  2VKD A;  4CCO A;  4BAC A;  4UY8 I;  3GVA A;  3ZMU A;  3TOB A;  3GZN B;  3IUO A;  1B6A A;  1FJL A;  2R7R A;  2F48 A;  2X1C A;  1U3E M;  1QZY A;  5EEH A;  1ERD A;  2B0L A;  1LDJ A;  2KJB A;  3LL7 A;  2WB1 A;  3BR0 A;  4E7S A;  2DK5 A;  3Q3S A;  2FOK A;  1I5Z A;  3CUQ B;  3ZQG A;  1U8R A;  3FDY A;  2W00 A;  4U0V A;  2V6E A;  3GZ6 A;  1J09 A;  3TED A;  1ON1 A;  4M3F A;  3U21 A;  5K1Y A;  2CH0 A;  3CP2 A;  3DP7 A;  2E7W A;  1DP7 P;  5LD2 C;  3BCA A;  1KQ8 A;  4BH9 A;  4XRS A;  1TTY A;  2CW7 A;  3WTU C;  3T5X A;  4XLE A;  2WY8 Q;  1KQ9 A;  2K4B A;  2R93 J;  5KHD A;  4CYC B;  3DBL B;  2M34 A;  2EZI A;  4CH7 A;  5IT3 A;  3I55 I;  3CMA I;  4CUG A;  4RGU A;  4ESB A;  1H88 C;  1A31 A;  1WJ5 A;  4LLG F;  1TZL A;  3OOP A;  1J2X A;  3E7L A;  3OWT A;  1V54 H;  4DZP A;  2HPI A;  5F04 A;  2COM A;  4HNU A;  4R8H A;  4HF1 A;  3S1N J;  1UEL B;  2QEX I;  2FSW A;  1K83 J;  2P5V A;  3OYF A; 
#chains in the Genus database with same CATH homology
 1HOM A;  3OIO A;  3IH3 A;  3LSJ A;  5M3F J;  5EYR A;  4C3J J;  4J19 A;  1A5J A;  1IV6 A;  1AHD P;  3M3Y J;  3M4O J;  4MFD A;  2JMW A;  3RZO J;  5C44 J;  1IDZ A;  1E3O C;  2K40 A;  1YRN A;  4A3M J;  4MFE A;  5M5Y J;  2O9L A;  3BQY A;  3QPL A;  2M9H A;  3ZQI A;  2WV1 A;  5HOD A;  3O8G A;  3BTL A;  4C2M J;  1QRY A;  4AC0 A;  5K7H A;  1JT0 A;  1ZKG A;  3ZQH A;  3C2B A;  5IOY A;  2XPV A;  4FE7 A;  4C3I J;  3B6C A;  3LSP A;  2QCO A;  3JRC A;  1JUS A;  1MBF A;  4IHY A;  1CQT A;  3GTL J;  2HOA A;  5C4J J;  4A3C J;  3HOZ J;  1S7E A;  3BR2 A;  2DA3 A;  1RES A;  5JLW A;  2K9N A;  4D7N A;  4BY1 J;  1D5Y A;  3RKQ A;  4QTR A;  4I76 A;  3FIW A;  3OSF A;  2JA8 J;  3HGG A;  3LOC A;  4X6A J;  5DTD A;  3HDD A;  3LSR A;  5GPC A;  1ETV A;  4QSH A;  2XPW A;  1H8A C;  5IP6 A;  2JN6 A;  2DTZ A;  1IJW C;  4MO7 A;  1GDT A;  3BR6 A;  2JA6 J;  1WH7 A;  1QVT A;  4AUX A;  3IH4 A;  3SDG A;  1TWC J;  5EF6 A;  2B63 J;  5DS9 A;  5EG0 A;  3JRF A;  2RAE A;  2FD5 A;  3OOU A;  5FKL A;  2HI3 A;  1B8I B;  2AHQ A;  2AO9 A;  3G1L A;  5FKN A;  4XRS G;  4A3E J;  2E2I J;  1F36 A;  2N8G A;  2O8K A;  1SAN A;  5GPA A;  4M3G A;  1IC8 A;  1QVU A;  1UG2 A;  4X1E A;  3B6A A;  1JUP A;  3FIS A;  3NAU A;  2XB5 A;  5E3O A;  4BBR J;  1QPI A;  5FLM J;  3DCF A;  3JRH A;  3Q0U A;  4DYQ A;  1EF4 A;  1RET A;  3JRD A;  2COB A;  2LY9 A;  5EZG A;  2JA7 J;  3MN2 A;  2NVY J;  2ME0 A;  1MBJ A;  2LR8 A;  2TCT A;  4B4C A;  4Y52 J;  1LE8 A;  3TP0 A;  3A02 A;  2DJN A;  1BL0 A;  2L7F P;  1IG7 A;  4JP0 A;  1JKQ C;  1BA5 A;  4M3B A;  3JRA A;  1Z0X A;  2LLK A;  1DU0 A;  3HOY J;  2PMZ N;  5C4X J;  1X2M A;  2R7Z J;  2MW8 A;  3TW7 A;  2XGE A;  4D5F A;  3TP3 A;  2R5Z B;  1PUF B;  2VKV A;  2K9S A;  2R0Q C;  3A01 B;  3GTG J;  2X6O A;  1Y1V J;  2ZB9 A;  2NVT J;  5JLX A;  4XID A;  2NS8 A;  4UUT A;  1TWA J;  2G0E A;  5BNG A;  1MBH A;  1FIA A;  2VPR A;  2IEK A;  4IHV A;  4EEF G;  4IHX A;  3HKZ N;  5FKM A;  2HYJ A;  1JT6 A;  1MSE C;  1NK2 P;  5FKK A;  2LFB A;  2DA5 A;  2XGD A;  5M3M J;  3ZQF A;  1JJ6 C;  4A3F J;  2L9R A;  1NTC A;  4DZJ A;  1OCP A;  1P7I A;  2ECB A;  5EGO A;  5FLV A;  2H8R A;  4JX5 A;  4FTH A;  2VUM J;  5EZH A;  1W0U A;  4XIC A;  2KT0 A;  2YS9 A;  3IV5 A;  1JGG A;  1TWH J;  4ABZ A;  1DU6 A;  2MGQ A;  4M6V A;  2LK2 A;  1WCM J;  4Y7N J;  3WHB A;  3PO3 J;  2CQX A;  1MBK A;  1K61 A;  2JWT A;  5J1U A;  4QIW N;  2LTP A;  1MNM C;  3W6V A;  2IAI A;  3F0C A;  5F0F A;  2E2J J;  2DMN A;  3HGY A;  2TRT A;  3SFI A;  1IUF A;  2R5Y A;  2EH3 A;  4I6Z A;  4XRM A;  2DMU A;  2XGC A;  1O4X A;  1X58 A;  3QQA A;  1AU7 A;  3BR5 A;  1ETQ A;  4JX6 A;  2GBY A;  4B3A A;  1NK3 P;  3HOX J;  2HOT A;  1U78 A;  9ANT A;  4S0H B;  1ETX A;  1MH4 A;  4JYK A;  3Q0W A;  2L7Z A;  1MBE A;  1WI3 A;  5M5X J;  3ZQC A;  2HOS A;  5EEA A;  2JJ7 A;  2XB0 X;  3ZQL A;  3GTO J;  2O7O A;  1W0T A;  3BG5 A;  4FIS A;  5C3E J;  1R9T J;  1BW6 A;  3PO2 J;  1TC3 C;  2HDD A;  1FTZ A;  2Y31 A;  1MBG A;  2DA4 A;  2Y2Z A;  3QPS A;  3BG3 A;  4BXX J;  1X2N A;  5EG0 B;  2R92 J;  3RZD J;  2OPT A;  5FJ8 J;  1ETY A;  5EDN A;  4A3I J;  4XK4 A;  5IYC J;  1GT0 C;  1IRZ A;  3JRG A;  3FK7 A;  2CUF A;  2NOG A;  2ME6 A;  1MSF C;  4B1R A;  1RKT A;  4BY7 J;  2E19 A;  1ENH A;  4GFB A;  1TWF J;  2LD5 A;  4RDU A;  4NDL A;  4LOC A;  2EQR A;  5F27 A;  3HOW J;  3HOU J;  1RKW A;  1ZR2 A;  2DA2 A;  1VF9 A;  5K7F A;  1LE8 B;  5FKO A;  3GTJ J;  2X9D A;  1ZGW A;  3I4M J;  2DMP A;  3HEF A;  1RR7 A;  2E1O A;  4D7M A;  1IGN A;  4FCY A;  1BW5 A;  5F08 A;  1LFU P;  5F1J A;  3CMY A;  3H0G J;  1AKH A;  2DA1 A;  1G2H A;  2DA7 A;  1HLV A;  5E3M A;  3CDL A;  1OJL A;  1ZQ3 P;  1B72 A;  3FK6 A;  3BTC A;  2NVQ J;  1GVD A;  1WH5 A;  1VND A;  1U8B A;  2JK3 A;  1JKO C;  4CYC A;  2LVS A;  4A69 C;  3S1M J;  4W97 A;  5IYB J;  5GP9 A;  1JKR C;  4A93 J;  3S14 J;  2R5Z A;  2MSY A;  4UUS A;  2FX0 A;  5IPA A;  2LP0 A;  3S2D J;  2CU7 A;  4MIM A;  1ZTR A;  2HQ5 A;  1UHS A;  1RPW A;  5M5W J;  3JR9 A;  3GTP J;  4DW6 A;  4HNV A;  2K9Q A;  4RBO A;  3A03 A;  2YUS A;  5E3L A;  1YRN B;  2CRG A;  5EGO B;  2LKX A;  1HCR A;  2VKE A;  2WAQ N;  3HB9 A;  4A3D J;  2XSD C;  3MVP A;  1GV5 A;  5J1Y A;  3S1R J;  1SFO J;  3S16 J;  1I3Q J;  3G1O A;  1LFB A;  3BR1 A;  3DEW A;  3LNQ A;  2FQ4 A;  2CJJ A;  1XG1 A;  3G1M A;  1A6I A;  3O8H A;  2EBI A;  1JUM A;  3GTQ J;  2Y30 A;  3MKL A;  5IOZ A;  4JX4 A;  1BJZ A;  2ID6 A;  3UKG A;  2P81 A;  1UMQ A;  1HDD C;  1U9O A;  2L0K A;  5F0C A;  5E3N A;  2R5Y B;  1TWG J;  4BKX A;  3JRB A;  3BG9 A;  4A3L J;  1FTT A;  3GTM J;  3CQZ J;  4V2G A;  2M8G X;  3HBL A;  4V2F A;  3HOV J;  1VFC A;  5IP7 J;  2KDZ A;  5J3L A;  3I4N J;  3GBG A;  2M0C A;  2QF7 A;  1APL C;  3H3V K;  1WGX A;  4M3D A;  1XC5 A;  1ETK A;  2Y9Z A;  2EZL A;  1OFC X;  2ID3 A;  2X48 A;  2FJ1 A;  4IEJ A;  3GTK J;  5F0H A;  1JTX A;  5K7Z A;  4L5E A;  2ECC A;  4BBS J;  4MLO A;  3D1N I;  3S17 J;  3K2A A;  3PM1 A;  2OF7 A;  1P7J A;  3K7A J;  3LSG A;  4G12 A;  3VPR A;  2ELK A;  2Y0S N;  1I6H J;  1FEX A;  3BTI A;  1FIP A;  2NVX J;  4A3G J;  1ITY A;  1ETO A;  1ZR4 A;  1H89 C;  2GLO A;  2CQQ A;  2DA6 A;  1JTY A;  2YU9 J;  3BQZ A;  4A3J J;  1HF0 A;  1VI0 A;  5IYD J;  2W48 A;  5IP9 J;  3NAR A;  2M2E A;  3FKI J;  2GM4 A;  1B8I A;  1T56 A;  1JKP C;  2D5V A;  2EZK A;  3SJM A;  2WB1 N;  2EZH A;  2DMQ A;  1FJL A;  2NS7 A;  4A3K J;  3Q0V A;  1F43 A;  3ZOB A;  2E2H J;  1I50 J;  3S1Q J;  3BR0 A;  1Z77 A;  4DYC A;  3RQI A;  3Q3S A;  2H1K A;  3L1P A;  3ZQG A;  1JJ8 C;  4IHW A;  2CUE A;  3TED A;  1ZK8 A;  5J1R A;  3BTJ A;  4DYR A;  3BT9 A;  4M3F A;  1AKH B;  2L7M P;  3BR3 A;  4M3E A;  4C3H J;  4D5C A;  1Y1W J;  3JRI A;  2MG4 A;  3S2H J;  3S15 J;  3IH2 A;  4XRS A;  1ETW A;  1XS9 A;  1B72 B;  4FE4 A;  2VI6 A;  2R93 J;  4CYC B;  4A3B J;  2M34 A;  2EZI A;  1POG A;  1PUF A;  3A01 A;  4AYB N;  1GV2 A;  2XPU A;  2HXI A;  1HDP A;  1T33 A;  1IDY A;  3WHC A;  3JRE A;  1ORK A;  2I10 A;  4UUS B;  1WPK A;  2DN0 A;  1H88 C;  3TW6 A;  3E7L A;  2Y9Y A;  2HXO A;  4DZP A;  1MH3 A;  5F04 A;  1OCT C;  2JA5 J;  2XRL A;  3CCY A;  3S1N J;  2IBD A;  1Q1V A;  3HM5 A;  1GUU A;  1K83 J;  4W1U A;  2DMT A;  3OSG A;  1U9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...