1TWFJ

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twfJ00
1WCMJ 3A01B 3HB9A 4A3KJ 1Z0XA 2K9NA 3HOZJ 1TWAJ 3HDDA 3JRFA 4RDUA 4W97A 1RETA 2XB5A 5EGOB 5K7FA 2R0QC 1RR7A 3FK7A 1RPWA 3QPLA 2DMTA 2LLKA 1DU0A 3SFIA 1U78A 4XRSG 2MG4A 2VKEA 3IH3A 5FKKA 1ORKA 2HOTA 1UG2A 3TEDA 2JMWA 2LY9A 1VNDA 1MBJA 2LTPA 5EG0A 1GT0C 2QF7A 3GTLJ 4DYQA 5FLVA 1TWCJ 1VF9A 2DA2A 3ZOBA 3A02A 3GTMJ 1XG1A 2KDZA 2WV1A 4MLOA 1F43A 4M3DA 2R92J 4JX5A 4JYKA 2XPUA 2HOAA 5GPAA 3UKGA 1ZK8A 3BG3A 4Y52J 1H89C 3OSFA 2FJ1A 1MSEC 1P7JA 2O9LA 5GP9A 4IHXA 5E3MA 4AYBN 3BTCA 3H3VK 5F04A 1HOMA 3L1PA 2NVXJ 4CYCA 4C3IJ 3BR6A 2HXIA 1BW6A 5IYCJ 3QPSA 4D5FA 4V2GA 4BBRJ 2K9QA 4DW6A 2Y2ZA 1K83J 2EZLA 3K2AA 4DYCA 3O8HA 2LVSA 1VFCA 1U9OA 1X2NA 1SANA 2VI6A 1IV6A 4M3GA 5EG0B 4XRSA 2QCOA 2XGEA 3A01A 2IAIA 3RZDJ 4XIDA 1QVTA 3HOYJ 1UHSA 5C4XJ 1JKPC 3JRDA 1QPIA 4A3LJ 2DJNA 1X58A 4IHVA 3BR5A 3I4MJ 1WI3A 1UMQA 3M3YJ 2FX0A 4MFDA 2MSYA 2ZB9A 1DU6A 4S0HB 5EGOA 3ZQGA 3C2BA 4AUXA 4FTHA 2EZHA 2GM4A 3BQYA 4A3CJ 4CYCB 2PMZN 1IC8A 2M8GX 3BG9A 2Y30A 2CUFA 1MH4A 4A93J 2EH3A 5JLWA 1ETOA 1TWGJ 3IH4A 5F27A 2P81A 4W1UA 1LE8A 2JWTA 4X6AJ 1MBHA 2JK3A 2YUSA 5J3LA 2JA8J 5IYBJ 3LSGA 1TWHJ 1GV2A 4A3FJ 1YRNA 1R9TJ 3Q0VA 5JLXA 1WH7A 4BBSJ 4DZJA 4C3JJ 2H8RA 5FKLA 3B6CA 4I76A 1JT0A 4A3MJ 3CMYA 1BJZA 1ETKA 3Q0UA 1JKOC 2R5YA 2ELKA 1B8IA 1FTTA 2DA1A 1FTZA 3NAUA 3RZOJ 4D7MA 4D5CA 3IH2A 2ECCA 3HOUJ 3BR0A 1A5JA 2R93J 3S14J 2EBIA 1W0UA 3GTKJ 1ZR4A 3MKLA 5F0CA 2AHQA 2D5VA 3RKQA 1T56A 1POGA 3MN2A 3JREA 4XRMA 3LNQA 3HOWJ 3HOXJ 1HLVA 2X6OA 5E3NA 1HCRA 5IYDJ 1Y1WJ 5EZGA 2XGDA 4V2FA 3RQIA 2FD5A 4ABZA 2W48A 2XPWA 2R5ZB 3LSPA 5E3LA 5M5WJ 1LE8B 2RAEA 2XPVA 3BTJA 4RBOA 1ITYA 4IHWA 3LOCA 1YRNB 3HKZN 2NVYJ 2LD5A 3MVPA 2XSDC 3DEWA 3WHBA 2COBA 4Y7NJ 4QSHA 1ETXA 2ME6A 4QTRA 2R5YB 3BR3A 1B8IB 5HODA 3CDLA 5EEAA 3S17J 2I10A 3Q0WA 2VUMJ 4B1RA 5M3FJ 1LFUP 2JA5J 2CU7A 1Z77A 2HQ5A 2XRLA 1XS9A 1JKQC 1OCTC 4M3FA 1G2HA 2HOSA 4A3BJ 1GUUA 1ZKGA 1JUSA 3A03A 1BL0A 4A3GJ 5F0HA 1I50J 2EZIA 3GTPJ 2CRGA 3TW6A 4BY7J 3ZQCA 2E1OA 1T33A 3GTJJ 4MO7A 3W6VA 1LFBA 2X48A 2CQXA 5FKMA 2CUEA 1IG7A 5BNGA 5C3EJ 5J1YA 3BG5A 1MBGA 1RESA 4UUTA 2TRTA 3CCYA 3GTGJ 3DCFA 1ZQ3P 1I3QJ 2Y31A 4B4CA 2NVQJ 3LSJA 4J19A 2K40A 1MBEA 2EQRA 3E7LA 2Y9ZA 3BR1A 2K9SA 4GFBA 1VI0A 4UUSB 5M5XJ 3HM5A 1NTCA 1BA5A 4M3EA 3TP3A 3JRAA 4I6ZA 2WAQN 5C44J 1FEXA 3FK6A 1JT6A 1H8AC 3BR2A 4A3IJ 2Y0SN 1XC5A 1JKRC 3GTQJ 2YU9J 2DA5A 4JX4A 4MIMA 4HNVA 2R5ZA 3GBGA 5FLMJ 1O4XA 1BW5A 4FISA 2VPRA 3PO2J 2M9HA 5IP6A 1QRYA 2GLOA 1TWFJ 3ZQLA 3O8GA 2DMPA 2WB1N 1QVUA 1HF0A 1WGXA 3S15J 2M0CA 2ME0A 1FJLA 3ZQIA 2L7MP 1ENHA 1FIAA 3VPRA 3S2DJ 3SDGA 4JP0A 2TCTA 3JRIA 4A3JJ 1W0TA 2L9RA 3K7AJ 4IEJA 1WPKA 4M6VA 1A6IA 3JRGA 1ETVA 4AC0A 1MSFC 1IJWC 4M3BA 3JRCA 3S1RJ 2MW8A 1IDYA 9ANTA 5EZHA 4A69C 5DTDA 1Q1VA 2M2EA 1JTXA 2LKXA 1ETWA 4IHYA 3BQZA 1FIPA 5J1UA 1MNMC 2O7OA 4A3DJ 2GBYA 2IEKA 2KT0A 1B72B 5M5YJ 1MBKA 1ZGWA 4FCYA 3S1NJ 5J1RA 4B3AA 4EEFG 4BKXA 5IP9J 4XICA 2LR8A 4BXXJ 2DA3A 2IBDA 1IUFA 3OOUA 4XK4A 3D1NI 1Y1VJ 2N8GA 1AKHB 2XB0X 3BTLA 5IPAA 3FIWA 3HEFA 2NS8A 2NVTJ 3S1QJ 1GV5A 3FISA 1OJLA 2O8KA 1H88C 2NS7A 4C3HJ 3FKIJ 2LP0A 3G1LA 5F08A 4C2MJ 2CQQA 2ID3A 4L5EA 1MH3A 2JN6A 5F1JA 1SFOJ 2LK2A 4UUSA 2DMUA 1PUFA 1RKWA 3G1OA 1CQTA 3Q3SA 3B6AA 2L7FP 1D5YA 3M4OJ 2DA6A 1E3OC 4X1EA 4FE4A 1K61A 3WHCA 2H1KA 1EF4A 3S16J 3ZQFA 4D7NA 4QIWN 5GPCA 2DA7A 1AHDP 2R7ZJ 2DMQA 3OIOA 3HBLA 2JA7J 2CJJA 1JUMA 2E19A 4NDLA 5EDNA 3IV5A 5EYRA 5FKNA 3JRHA 2OF7A 1ZR2A 2L7ZA 1HDPA 3HGYA 5K7ZA 2L0KA 2M34A 5IOYA 3OSGA 1GDTA 1RKTA 5E3OA 1X2MA 2E2IJ 2E2HJ 1GVDA 1ZTRA 2FQ4A 2HDDA 5FJ8J 4LOCA 4A3EJ 1JGGA 3S1MJ 3NARA 2LFBA 1NK2P 1HDDC 3JR9A 4DZPA 1TC3C 5FKOA 1AU7A 3I4NJ 2DTZA 1F36A 1PUFB 3LSRA 1NK3P 1ETQA 1U8BA 2HXOA 2X9DA 1B72A 4G12A 1WH5A 1U9NA 1OCPA 5IOZA 1IRZA 1AKHA 2HI3A 3SJMA 4BY1J 5DS9A 2DMNA 2YS9A 3TP0A 5EF6A 3G1MA 2DN0A 1ETYA 1JJ6C 2JA6J 2DA4A 2E2JJ 2ID6A 3S2HJ 1MBFA 2Y9YA 3PO3J 2G0EA 3GTOJ 2NOGA 1OFCX 5M3MJ 4DYRA 3BT9A 3TW7A 3HOVJ 2VKVA 3H0GJ 1APLC 1S7EA 3QQAA 2HYJA 1I6HJ 3F0CA 4FE7A 2ECBA 3BTIA 2B63J 2JJ7A 2OPTA 5IP7J 1P7IA 3CQZJ 4JX6A 3PM1A 4MFEA 1JJ8C 5F0FA 1IGNA 2MGQA 2AO9A 5K7HA 2XGCA 1IDZA 5C4JJ 3ZQHA 1JUPA 2EZKA 3JRBA 1JTYA 3HGGA
chains in the Genus database with same CATH superfamily
2FMYA 4M6XA 1WCMJ 4NHJA 3LSHA 3GFMA 2ZJPF 3ABKH 3LAPA 2Y0MA 2X1CA 2FNPA 2K9NA 4BDYA 4RGRA 3GMEA 3LFUA 3HOZJ 1W5TA 3QP6A 1U6GA 1J75A 2Y0SA 4KJZA 3JRFA 1X1BA 2WWYA 3OIQA 3EYIA 5ILSA 1U2WA 5EGOB 3BCBA 3FK7A 3QPLA 3E1SA 5JR3A 2LNBA 1YQAA 4XRSG 2CQKA 4M74A 4XBFA 3GFIA 1IRGA 1FWZA 3IH3A 3U9GA 2DT7B 2R7RA 2JPBA 1P9QC 3OV8A 4HSRA 2EA4A 2BV6A 4RAYA 1YW9A 3KEQA 1Z7LA 5EG0A 4LLLA 3L2CA 3SQNA 4F91B 3HRUA 2VIXA 3RJPA 1VQNI 1WJCA 5HNFA 4XL9A 3GTMJ 1BR4A 4Q47A 4MLOA 3A4CA 4RM3A 1SMTA 3ZN1A 2IGKA 4IPAA 4RAGA 2L9NA 3TOAA 1J5YA 1FYLA 1OR7A 4LMYA 3AG1H 1P7JA 3VEPA 4IHXA 2G7UA 2RQPA 4AYBN 2KP6A 2O8XA 3BROA 1BI0A 3BTCA 3H35A 4PJMA 4QPOA 1KZHA 1HOMA 2O0YA 2NVXJ 4C3IJ 2MD0A 2IT0A 3K9TA 2OA4A 4YRVA 3BR6A 2HTJA 4HDUA 4HQEA 2QA4I 4ZYGA 1HQCA 2ZMEB 4NC8A 5IYCJ 3S3OA 3AL0B 2HNHA 2CWEA 1WI9A 4V2GA 4ZZDA 4HQMA 2RNJA 2K9QA 2JUCA 4OMYA 4EV0A 4FX0A 1G59A 3K2AA 3KEYA 4KT6A 2V6EA 1W7PA 3CESA 2FU4A 4UNOA 4KMFA 2AXLA 1B4AA 1WJBA 1V5FA 3A01A 2IS1A 1VQOI 1TT5B 4YG2F 4MTEA 3MZHA 4XIDA 1KU2A 1W1WE 3FM3A 3HOYJ 3CJQB 3OY9A 4KITB 4ENNA 4RM2A 1K78A 1N78A 3JRDA 3PL8A 2DJNA 3K70D 3L7WA 1XSDA 2XF7A 1ZG5A 3I4MJ 2IJLA 1HKQA 1HC8A 1WVRA 2GXAA 3M3YJ 2FX0A 3Q9SA 3K4MA 3VYTB 2NYXA 4S0HB 3RTRA 3I54A 1XTAA 3VB2A 4BDZA 1JHHA 1G6NA 4BHCA 4CUGA 2IS4A 3D5SC 3GVAA 1OYYA 2PMZN 1XX5A 2CSOA 2K9LA 2VN2A 1U3EM 3FF5A 1HXDA 3BG9A 2V9KA 3K10A 2P7VB 4EQQA 2ZFUA 2IVMA 2B7EA 1GHCA 1ETOA 2DFEA 4ANJA 5BPIA 3MEXA 3S8PA 4CSWA 4HBLA 1V4RA 5HS7A 2JK3A 2YUSA 2JA8J 3F8CA 4A3FJ 3LSIA 3B6CA 3M8FA 4XKVA 4AU7A 2C6YA 4A3MJ 4JOMA 1BJZA 1MDMA 3Q0UA 3ZMTA 2VE8A 2XF6A 4HX8A 4XOTA 2R5YA 2JQ7A 5DEQA 2Q0OA 1EA3A 2CFXA 2FNAA 3DBRB 1USTA 3EETA 3IH2A 1NG6A 2VBYA 3IC7A 2CQ7A 3BR0A 1XB4A 5FFZA 2LREA 4ZC3A 4YFXF 3GTKJ 3J81K 2D5VA 1FSEA 3ML6A 3RKQA 1OYIA 3NWSA 2YSRA 5B3SH 3GLLA 3IWFA 1A35A 3FXRA 3JREA 4XRMA 2ESHA 1YIJI 1HCRA 5IYDJ 4OWRB 1Y1WJ 4BGDA 3R0AA 4WXCA 3ZMSA 2PMZA 2HKXA 2VC0A 1C0WA 2PEXA 2EV5A 4WXDA 3V8KA 3G73A 1UAAA 3FXMA 3GEZA 3IRQA 5CLSA 4HNUA 3F22A 1QBJA 3LOCA 3J80Z 2LD5A 2YU3A 2X6WA 3OYGA 2XSDC 4KICA 3ROUA 2H94A 3WHBA 5ILVA 1ON2A 1ON1A 3BR3A 3JAMZ 5HODA 3LSTA 5EEAA 3Q0WA 3OR2C 2DLLA 1SAXA 2XASA 3HC7A 4B1RA 3OL4A 1P4AA 5E1WA 1JKQC 1OCTC 1G3WA 4A3BJ 1YTYA 1JUSA 3IKTA 3LQRA 2M1BA 3CUQC 4RS8A 4UV9A 1X1PA 2L01A 1D8KA 2JTVA 1Z6TA 5KCMA 1E3PA 1BI2A 3QPHA 3TW6A 4BY7J 2E1OA 2X48A 2CQXA 4XNFA 2WY7Q 2CUEA 1QO0D 4HOBA 1MBGA 4D1QA 3AFHA 1PYVA 3HJEA 3WTVC 2KISA 1KU3A 4UVCA 4CCJA 3CCYA 1ZQ3P 3OYJA 4RB0A 4J19A 3DU5A 4HNTA 4M9XA 2Y9ZA 5K5RA 2K9SA 2E5ZA 4GFBA 4AVZA 4RGXA 2HS5A 2B0LA 2VONA 3I53A 4CHUA 4MNUA 4M3EA 3TP3A 3JRAA 2WAQN 4II3A 2FUG2 4G8XA 5BQTA 2M8EA 1I39A 1FEXA 4HX4A 4U88A 5L3GA 3H5NA 4PCQA 4BH9A 2E1MC 2OQRA 2ZNZA 1XC5A 2ZO4A 5E8GA 3A0BC 1UZCA 1WJFA 3K4JA 4L0ZB 4AM3A 2YU9J 1GVJA 2H09A 3K1NA 4A2UA 1O4XA 3GBGA 5FLMJ 3E5XA 1V5GA 2HWVA 3WTUC 3BZCA 2HZTA 2FE3A 2RDPA 1SVOA 3CCRI 5L3CA 5J47A 2DOAA 3W3CA 4O5VA 1FJLA 3ZQIA 1HKSA 3GW2A 4DBRA 1WJDA 2TCTA 3JRIA 4A3JJ 3K7AJ 3FWEA 4BJ5C 3JRGA 4ESBA 4AC0A 1MSFC 2IW5A 4LLGF 3RPQA 1R1UA 1WZ2A 2I8DA 4PFPA 3MD2A 2W82A 3SEZA 4ZYAA 3C2GA 2FXAA 2M4KA 3LWFA 2DXIA 1HW5A 3QODA 5GADJ 3BQZA 4E4HA 1X1AA 2WY8Q 3CJRB 3H0DA 1XGSA 5M5YJ 5JFRA 2W85A 5E79C 3VDXA 5J1RA 1WHUA 4IOAF 1BM9A 3KP7A 4XICA 2WAQA 2LR8A 5DM6F 2HEOA 1AKHB 1Z6RA 3E6MA 5FO5A 1F5TA 1QGPA 4UXNA 2KFDA 5LLQA 1IN6A 3FIWA 1QHGA 4IVNA 2E1NA 2NS8A 3S1QJ 2UXNA 4CCNA 3G71I 3G1LA 3DLAA 5F08A 1U0JA 2WADA 1MH3A 1TLHB 2FA5A 1TW2A 2L4AA 2AQEA 2H6BA 2MABA 4Z2YA 3OS0A 1BI3A 3I0TA 4KIFA 2EPFA 1S3JA 4G94A 4RB2C 2XV4S 4KYWA 3K4LA 3K1PA 3P5JA 1KU7A 2K85A 4BXFA 1K7AA 1TW3A 3SHFA 1N75A 3ZN0A 4BQQA 3P7NA 2ESNA 1OPCA 2IGOA 3ECOA 5GPCA 1SC7A 1AHDP 5E17F 2I5UA 3IHUA 2DMQA 3HBLA 3CC4I 3OIPA 2CJJA 1IAWA 2GAUA 2HKOA 1K6YA 5EYRA 4F3QA 1WKMA 2ZFWA 2CV1A 4AIJA 1F4KA 3WU1B 1TL8A 2L7ZA 2QYOA 2L0KA 4L9TA 4CCMA 2M0MA 4H4KC 5LRSA 3OSGA 1GDTA 2ZXIA 5IT3A 2HDDA 1XDSA 2VKDA 3DKWA 1JGGA 5J4YA 1R4MB 3S1MJ 4Z6YA 2FBHA 5FKOA 2CUJA 4FHTA 1JE8A 2FMLA 1WQ2A 4KFCA 3JTHA 3CP2A 1E0EA 4J01A 1F36A 1I1GA 3GZ6A 4B43A 3R4KA 3TKYA 1U5TA 4BJTA 3DKYA 1YI2I 1TT0A 2OUMA 3LFKA 2J5OA 2Z99A 1U8BA 2JZYA 2OCCH 5D5WB 2EB7A 2WTEA 1B72A 1KYZA 3OOPA 1U9NA 2W57A 4EJOA 1OCPA 2O5RA 2A6EF 4LK0F 3ASOH 4CCLA 3N97A 1WSUA 3SJMA 3CF2A 4HLYA 5LHHA 3G1MA 2GA1A 2R7WA 4U7DA 1Z21A 3IP4B 1JJ6C 2E2JJ 1FP1D 2HFHA 1MBFA 1MGTA 2QQBA 3JCUC 4MEYF 2DDAA 2OC6A 3KP3A 3E3VA 4DNCA 5DCFA 4U7BA 2NXNB 2NOGA 2Z1DA 4PSWA 2ZJRF 4DYRA 1S29A 3BT9A 3FXLA 3KE2A 1HSTA 1S7EA 2DT5A 1UB9A 2JT1A 2DK8A 3SFZA 3G6EI 1U5TC 3KYLA 2XSJC 3BTIA 4RA2A 2OJED 3K6GA 2X51A 4N0BA 4BE1A 2R7FA 5IP7J 1IN4A 1P7IA 2BY3A 3DEEA 3WTYC 1H9GA 4JX6A 2XIGA 4MFEA 4YFNF 2PJPA 4HX7A 2FRHA 2MGQA 2AO9A 1ZARA 4BS9A 2RN7A 2DK5A 1LDJA 5C4JJ 2HZDA 1ZGJA 1D3YA 2MH9A 4KT5C 3V8LA 4WXHA 3CCLI 1T38A 1T39A 4XLNF 2VBXA 4AIHA 4LJZF 4KIGA 4YFKF 2YX7A 4E6KG 3TGNA 3DP7A 2ZMEA 2QQ8A 2K9MA 4RDUA 4P55A 3VYUB 3VYRB 3DWLE 2IA0A 1VQ8I 2P0WA 3I59B 3IAS2 2DMTA 3DBLB 3VWBA 2KJBA 1KQ8A 2HOEA 2MG4A 1MMGA 4AWXB 2VKEA 2XAFA 1W5CC 5FKKA 4F93B 2LKPA 3U21A 3S3MA 2HOTA 2GWRA 3TEDA 5K1YA 1PP8F 2IPQX 2QQAA 1N25A 3TO9A 2LTPA 1GT0C 2M30A 3GTLJ 3K69A 1S7AA 2J5PA 1VF9A 2DODA 3SZGA 1R58A 2KLOA 4UHTA 3BCAA 1XDUA 2KDZA 3DPLC 4GRIA 4HG2A 3I58A 4HSTA 4DIQA 2R92J 4JYKA 2Z3YA 2HOAA 2GXGA 3BPXA 3BG3A 4ESFA 2R7DA 3OSFA 2FJ1A 1MSEC 2O9LA 2Z33A 1FYKA 2ZMEC 1BOAA 3BLYA 4EJVA 1N77A 2HQNA 2F4MB 3QP5A 2DJIA 2JRMA 3HTSB 2BYVE 1H0MA 3JSPA 2PMUA 2BY1A 2R7SA 3I64A 5FRMA 2A6TA 1V54H 3QPSA 4WCGA 1HKTA 2Y2ZA 2EZLA 1AOYA 1USSA 2Z9OA 3QOEA 1Q1HA 3CDHA 2DPUA 3O8HA 1MNDA 1BOBA 4RMNA 1U9OA 1SANA 3DV8A 3ZGKA 4M3GA 4HV5A 1CGPA 3LA2A 1YS7A 1QVTA 2R7OA 4I7HA 1RZ4A 3EQLF 1A36A 1ZREA 1SVMA 3KYDB 5LGNA 5HLHA 2ZJ2A 3P9CA 2LOOA 3ABTA 1Y6IA 1Z3YA 1QPIA 1W5SA 3HOSA 1X58A 3KP5A 3BR5A 4B09A 4IHVA 3M1EA 3V42A 1P92A 1UMQA 3U1DA 4XLEA 3FHZA 5FROA 3ZQGA 1YJWI 2F4IA 2KQRA 4CGZA 4MQ9F 4QPQA 4G7ZF 3C1DA 1IC8A 2Y69H 4HV6A 2DYRH 2X6YA 1QZYA 2R7UA 4N9IA 3OYBA 1TWGJ 3IH4A 3KYCB 1YFHA 5F27A 2P81A 1SFKA 4W1UA 4GO1A 4I98B 3F21A 4UUVA 4D0PA 5IYBJ 2QUFA 4B47A 1GV2A 2WAEA 3EYYA 1REPC 5JLXA 4XOPA 2X1DA 2DBBA 1MMSA 2DQRA 1IF1A 3MWMA 2P7CB 1KONA 1FTTA 1SD6A 2L9VA 3CDIA 3HIFA 3HSFA 2DA1A 1FTZA 3RZOJ 4D5CA 1I3AA 4L9JA 4OOIA 1OKRA 3J7AO 1RIOH 5E18F 1A5JA 2R93J 3S14J 2HQAA 1UHMA 3HG9A 3MKLA 4IO9F 2CW0F 3BC8A 1K79A 1T56A 5DUKA 4ZDLA 1Y8QB 3HHHA 2V1NA 4MEXF 3CC2I 2L4MA 3LNQA 2LKSA 4N9HA 2LRDA 4BE2A 2E7WA 2X6OA 2BXYA 4JQFA 4RGUA 5E3NA 1AA7A 1PVEA 4O6JA 3S32A 5EZGA 2DQLA 4ZTJA 1T08B 2P5KA 4Y15A 2W25A 2XGDA 1OCRH 3LA3A 2W48A 2XPWA 3F8FA 4BHBA 1W36C 2ZXHA 4Q5SF 1LE8B 3H3ZA 2CYYA 2PG4A 2XPVA 3MKWB 3R61A 2MH2A 4RBOA 4LD5A 3WGHA 2BEOA 2ZSHB 3I55I 1ITYA 1YRNB 1EV7A 3FBIB 3H9JA 3HKZN 4G9YA 2FEZA 4E70A 4XKBA 2F5CA 5HLIA 3MZ8A 5IT9K 4Y7NJ 1W7PD 1XPXA 4QSHA 3UR3C 4WX9A 3FMSA 1B8IB 1LDDA 2RC4A 1D1CA 1YYVA 3CDLA 4OIOF 2I10A 2VQGA 2VUMJ 3PFIA 2JA2A 1Y56A 3ZMVA 2HPMA 2XAQA 2XRLA 3WGGA 1SFXA 4XSZF 5FD6A 1G2HA 2BY0A 1ODDA 1AWCA 1GUUA 1VQKI 2Q8KA 4OU0A 1BL0A 4A3GJ 4KN7X 5BOXA 2A69F 3DF8A 4YIIA 2IGNA 1VQLI 1RRJA 2IS2A 5H6RA 1T33A 2A68F 3W6VA 2PBIA 1IG7A 4Y3OA 3BP8A 4IHSA 3BPVA 3CO6C 1TTYA 2BZTA 2R3SA 4ZTFA 3DPUA 5FRNA 3GZNB 1I3QJ 2Y31A 1D0YA 4B4CA 3LSJA 3WTZA 2GIVA 3E7LA 4EJTA 5D6EA 3F3XA 1VI0A 3CTAA 1LDKB 2NVUB 2KHMA 5M5XJ 1MW7A 1NTCA 2MFZA 1PUEE 4LLNA 4I6ZA 3ZP5A 4M9ZA 5ILUA 1ZYRF 2ISYA 1ZN2A 1JT6A 2NS0A 3CLOA 2Q1ZB 1XGNA 3TDZC 4II2A 2UUZA 1R5HA 4AYBA 3M8EA 3PSIA 3V7RA 1JKRC 2VXDA 5H2FC 2E71A 2E5NA 3HOWJ 1D8JA 3TL4X 1R6RA 2DA5A 1BJAA 4JX4A 2V1XA 4MIMA 2R5ZA 1YHQI 4U0VA 3RCOA 2IGMA 4I02A 2XKOA 3HUGB 2M9HA 1R7JA 4XLCA 4L9NA 1BBYA 4P5OA 1TWFJ 1O7LA 1LEAA 2HPIA 2WBMA 2DMPA 2WB1N 1QVUA 3ASNH 1HF0A 3HRMA 3RDIA 3S15J 3F23A 2ME0A 5CQEA 4A0XA 1R4NB 1FIAA 3S2DJ 3GWZA 3SDGA 3RYRA 4ZH4F 2STWA 1SD4A 2VB6A 3KETA 1W0TA 3WTXC 1YO5C 2A6HF 3CCSI 1ETVA 1SMYF 2FSWA 4P9FA 4M9SA 3JRCA 3CD6I 3CCJI 2MW8A 4C9YA 1FMWA 2BHZA 9ANTA 2QQ9A 2M5WA 5EZHA 4ESJA 5DTDA 2VOOA 2OAZA 4KUMA 3U1KA 2KRFA 5DM7F 4LG0B 2M2EA 2LKXA 1ETWA 4IHYA 1BN5A 2ZSIB 1YJ9I 5GTIC 1GXQA 2IEKA 2KT0A 2LMDA 5LEKA 1W4MA 2EIMH 3WTTC 1ZRCA 1LKXA 4FCYA 2VQCA 3KP6A 3HRSA 5L3EA 2VQHA 1PP7U 4BXXJ 3D1NI 4XK4A 3OOUA 4NUBA 2NNNA 4FETA 4GGGA 3IL2A 1LQ1A 3KZYA 5F1RA 2XB0X 1Z7UA 3OYEA 5IPAA 3CUQA 3WTSC 2NVTJ 1R71A 1GV5A 3FISA 1KQ9A 4JK1X 4C3HJ 1S7OA 3EUKL 4L18B 2BBYA 2M4GA 2LBFB 3RI4A 1OMIA 2CQQA 2ID3A 2OD5A 4L5EA 5D5XB 4E7KA 3K70C 1D5VA 2X0LA 2F5FA 3OYHA 2GQQA 4XORA 2FOKA 5F1JA 3ZCOA 4G7HF 2LK2A 1RUNA 2ISZA 4UUSA 3M7GA 5TISC 4BUPA 1RKWA 1DDNA 1DPRA 2WB1A 1RI7A 3M4OJ 5CJ9A 3F8NA 2DA6A 2GOMA 2HR3A 4S04A 4FE4A 4XN0A 4QLCU 1K61A 1E3OC 4N4OB 3OYDA 4LK1F 3ZQFA 4NNJA 4D7NA 3MKZA 1S72I 4R8HA 3KFWX 2KIQA 3OIOA 5KNLA 4ZDOA 4NDLA 5EDNA 2CQNA 3IV5A 2XROA 1LJ9A 3W2VA 1J09A 2K4BA 3ESWB 1UJ8A 1SD5A 5LHIA 1ZR2A 2X4HA 4GCVA 2GZWA 5D8KB 4BNCA 1OCOH 5IOYA 3ERED 1YITI 2JPCA 5E3OA 1OISA 1X2MA 2E2IJ 2AS5F 2A07F 3OS1A 1ZTRA 5FJ8J 2OTLI 5D6FA 1HW1A 4LOCA 4A3EJ 1BIBA 2G7HA 3AG3H 1NK2P 3JR9A 4KNYA 3I4NJ 1YW7A 2XAJA 4K2EA 3G2BA 3PQKA 3KP2A 5CVVA 5D5UB 2E1CA 3ZQQA 2DT6A 3D0SA 1OYWA 1FP2A 1NK3P 3FXJA 1SD7A 3V4GA 3FKJA 1WH5A 1ZELA 1IRZA 2Y75A 2HI3A 4O3MA 1FBSA 4YELA 4BY1J 3TP0A 2WAFA 4XN3A 5CQGA 3KZZA 5EF6A 2RV8A 1ETYA 2JA6J 2ID6A 3S2HJ 3I59A 2IRFG 2PJRA 2W1OA 2KRHA 2XAHA 2A5YB 2STTA 5E1ZB 4E7LA 1FYMA 4AVPA 1OFCX 1X4PA 5M3MJ 3QRFF 3L2RA 2RGVA 1A6QA 5F6FA 2VKVA 3HOVJ 3H0GJ 2O6GE 1APLC 2E35A 3HPGA 3QU6A 1Z05A 1I6HJ 3V8JA 2QSHX 4IRHA 3B02A 4XR6A 1T2KA 3GO5A 2QKLB 2JJ7A 5JHFA 4IRIA 2O3FA 1XGOA 2CG4A 1H9TA 2QVOA 3IAM2 5F0FA 1MJ9A 2XGCA 2EA2A 1W7PB 4KN4X 3H1CA 4XSXF 5K7HA 3AKZA 1FOXA 4MGRA 1DP3A 3QAHA 3A01B 2XHKA 2VLAA 2K02A 4CICA 4A3KJ 1Z0XA 2CGPA 1VQ6I 3DXJF 3RIRA 1K78B 3DTKA 2KJCA 1ZGAA 4HA8A 3ULQB 3S2WA 2M7BA 3KPHA 4DGWB 1VQMI 1TWAJ 1T0FC 4FASD 4I0AA 5D4RA 2BVMA 3BG6A 3LL7A 3LSMA 3HDDA 2DOFA 2L54A 1RETA 1S8NA 1EH8A 2D1VA 5K7FA 2R0QC 1RPWA 5DUIA 2QSGX 5CVJA 3SFIA 4BE0A 1U78A 3J7AY 1TQMA 4LB6B 3I71A 4LIUA 5E8IA 3CMEI 1P4XA 2A5WA 2JMWA 2BOLA 2LY9A 2MBFA 1B6AA 2ACJA 5JVTA 3ZOBA 3CMAI 1IW7F 3A02A 3CMMA 4XLAA 1SFUA 1BC7C 3F6VA 1XG1A 2WV1A 3I9V2 1F43A 1IN5A 3T8TA 4JX5A 3VFZA 3EUAA 1R23A 3HRTA 3KP4A 2GA2A 1DUXC 2LYCA 5HS9A 3LMMA 4XKWA 2D45A 1H89C 4Y52J 1D0ZA 2JVHA 2Q2EA 1JHFA 5B66C 3F8MA 4JBAA 1IRXA 2HTSA 5F04A 4X0GA 5JHUA 3FX3A 2XF5A 2KZVA 4I01A 3ZMUA 2K5CA 3FBNB 3Q9VA 2M3AA 1Z91A 3JTGA 5IY5H 5CVUA 4R79A 2QENA 3S3NA 2HQRA 2NNYA 3A2KA 2H1LA 4G6QA 4PJNA 1K83J 3SEQA 4RB3C 2VJIA 3FXOA 3E5QA 3K4KA 1WJEA 4DYCA 2LVSA 1CF7B 4EVIA 2B9SA 1X2NA 2VI6A 4CCOA 4HW0A 2ZC2A 3GZ5A 3OYIA 2FBIA 4XRSA 2PX9A 1I5ZA 4HF0A 4NBQA 2IAIA 2CS3A 3RZDJ 4IXAA 3QPTA 3PUBA 1UHSA 3QOPA 4B48A 3HOTA 1HSJA 1SAUA 1WWXA 5LRRA 1G8XA 3TO6A 2FBKA 1J0RA 2KMUA 3KLOA 1NHAA 1OQYA 1NH3A 4UVAA 2K7LA 2R7QA 1YW8A 4MFDA 5ICGA 2ZB9A 1DU6A 3KZIC 3QU3A 3VODA 5EGOA 2DO7A 2EZHA 3BQYA 2RREA 4CYCB 3J7YJ 1G3SA 1X3UA 2Y30A 1RNLA 2CUFA 1UG0A 3F8BA 2KL4A 1MH4A 2MA3A 2OV7A 2F48A 2P5VA 5CVIA 4A93J 2LY2A 2KKOA 4BYYA 1MKMA 1LE8A 3H3UA 5CVRA 2JWTA 2YPRA 4X6AJ 5DDGA 4E7IA 4IJAA 5J3LA 4PGHA 2GIZA 3DLLF 1TWHJ 4M71A 1YRNA 1R9TJ 3Q0VA 1Y0NA 4BBSJ 4DZJA 4C3JJ 2H8RA 3H5AA 1Y0UA 5FKLA 1X1CA 4I76A 4EJUA 1IUYA 1IXCA 4H0EA 3CMYA 4B8XA 3LSKA 2PMHA 2ELKA 4B44A 1B8IA 3KX2A 3O3KA 2AQFA 5IT9Z 2MC3A 1XSVA 4L9VA 5B1BH 5LGTA 2R4GA 2HU9A 1ZRFA 2HVSA 2K3PA 4Y4RA 2OBPA 5EEGA 1W0UA 1NG7A 5F0CA 1JI8A 4F52A 1LVKA 3EPZA 2BVLA 5H20A 4HF2A 3MN2A 2EFWA 1YG2A 3ERMA 5GTHC 4BHPA 3OYAA 3HOXJ 1HLVA 2R7VA 5FLXK 4R1HA 2FQ3A 4ZYEA 1IZ1A 1KQ0A 2FD5A 3T0YA 1V55H 4ABZA 1J7KA 2E34A 5E3LA 3PIOF 4PJJA 1PJRA 2RAEA 5HLTA 4IHWA 3GXOA 2K86A 2VXZA 3SZPA 2L5QA 1FSHA 4BACA 2COBA 3SYTA 3PUFA 2COMA 2DTRA 4HLXA 5HDNA 2KIUA 4M72A 3S17J 4U87A 1VQ5I 4PUSA 5J4VA 4F92B 1ZAOA 1MMAA 2L2OA 3FXKA 5M3FJ 2JA5J 1FOWA 1Z77A 2EV0A 1O7FA 1UFMA 3GF2A 3RSNA 4ZDPA 1X3ZB 3MMYB 4IZZA 1Z9CA 3WE2A 3RKXA 3T1BA 5L3BA 4DOZA 5CYVA 2HOSA 1ZKGA 2M87A 3CP8A 2ZXJA 3PIPF 3WU2C 3HUGA 1I50J 2IXSA 2EZIA 3GTPJ 3CCUI 3OL3A 3ZQCA 4MO7A 3BDDA 4I99C 2Z2SB 3DFGA 2RVCA 1VZ0A 3K4CA 5FKMA 4DQ2A 1XMAA 3C3WA 1TP4A 1QZEA 2ZCWA 5J1YA 1RC9A 3MFKA 1RESA 1E3HA 1FPQA 4UUTA 3TO7A 3H92A 2TRTA 2CUZA 1BC8C 3DCFA 1G3TA 3DPTA 3CCQI 2NVQJ 4PFOA 1MBEA 5LBQA 5BMZA 3HM5A 4Y17A 1DPUA 2P5LC 3RPUA 5KHDA 4ZJZA 5FD5A 3E6BA 3FK6A 1S9HA 2M45A 3CUOA 1H8AC 5HDKA 3H9QA 1KU9A 2Y0SN 1O3QA 2VPLA 1ONVA 3GFLA 2HVRA 2VOPA 1U8RA 6PAXA 3REOA 3RKWA 3GTQJ 3J7ZI 2QLZA 3B73A 4AIKA 4C2TA 3PSFA 4HNVA 3RYPA 2RQQA 1BW5A 4BXUA 3OR1C 2BW3B 4CXFA 1STZA 4FISA 2VPRA 3PO2J 1ZLKA 5F64A 5IP6A 1TNSA 3F6OA 5DCMB 3RKYA 3H36A 2OQGA 3HTUA 2M7AA 3ZQ7A 2ZXWH 4CYDA 3BJ6A 2L7MP 1ENHA 3BOQA 4JP0A 1WJAA 2VL8A 2P8TA 2L9RA 3FZVA 5D4SA 2F5VA 4D9JA 4RB1A 1DGRM 1ULYA 3OYLA 2VASA 3K0LA 4EGYA 3S1RJ 5A2QK 1JXSA 1IDYA 2KIFA 1F1ZA 3K1MA 4CZCA 2KZGA 3AG4H 1FZPB 5J1UA 1MNMC 2O7OA 5FB2A 4IHTA 1B72B 1MBKA 1FC3A 3COAC 1ZGWA 3S1NJ 2H8WA 4B3AA 4EEFG 4BKXA 1OCCH 5IP9J 2DA3A 2IBDA 1IUFA 3T8RA 4V19K 1Y1VJ 1DP7P 5K5OA 3HYIA 3BTLA 2DU9A 5KAFC 4OINF 4E7JA 3O2PE 2UZKA 3HEFA 3G3ZA 3DU6A 2OTJI 3RQ4A 4WF2A 2HGCA 3FKIJ 2LP0A 4XONA 5FFXA 3VSKA 3W6KB 5ICEA 1UCRA 2EINH 3KIOA 5HDGA 4E7ZA 4I09A 4QWQA 2PN6A 4OMZA 1SFOJ 1Z3XA 1FY7A 1EKEA 2DFFA 2DMUA 4XLHA 3G1OA 1CQTA 3Q3SA 2OCEA 2VBWA 3B6AA 4G7OF 2ZNYA 2A61A 2L7FP 1D5YA 4M73A 4PJLA 3WHCA 1D0XA 1EF4A 2HDWA 4UV8A 4J00A 3DBHB 3WTWC 3S16J 2BGCA 4QIWN 3NWTA 5GAEJ 4HAMA 2QKMB 2LG4A 5HNHA 5EJCA 3CCEI 4Y13A 5DYMA 2LF7A 3JRHA 3D5RC 2CFOA 2NAZA 4BEHB 2BE5F 1VQ9I 1IXSB 2V1UA 2OF7A 1HDPA 3HGYA 5K7ZA 5D8LB 2M34A 2V26A 1RKTA 2V7FA 3EDPA 3NRVA 4PSXA 2FOWA 1ZG1A 2E2HJ 3ZMZA 3ZMDA 3CLQA 2JRTA 2IS6A 3I4PA 4BL0B 2LFBA 1HDDC 1MD0A 4DZPA 2H6CA 2MC4A 1KA8A 3KLNA 3WG7H 2DTZA 4LFUA 4CDGA 4OIQF 3E97A 3OYNA 3F9KA 1Z67A 3L2UA 5J40A 3JSOA 1M1EB 3M8JA 1R49A 1PUFB 3LSRA 3HKZA 4HRIA 3NEUA 2V4JC 2HXOA 2W84A 5TJJA 2QBYB 2WV0A 5FGMA 4G12A 1OR7C 1RR8C 5ED4A 1LB2A 1E17A 5IOZA 1QPMA 1Y39A 1AKHA 4IKFA 2L9SA 3VSLA 2DMNA 2YS9A 5DS9A 1FLIA 3CJNA 4ZYDA 4XRFA 1YIOA 2XDVA 3DTEA 1G4DA 4B3XA 3X2QH 2QZ8A 4UVBA 3TW7A 4AD9A 4OAZA 4E7SA 3F0CA 1G3YA 3GFJA 2ECBA 2JVGA 4EM0B 2B63J 1WRJA 4MHGA 3GLXA 3CQZJ 4HF1A 2A05A 5BPDA 1JJ8C 3PM1A 1IN8A 2Y48A 3OWTA 1JUPA 2EZKA 1JTYA 3MQ0A 3DTIA 2DW4A 3HB9A 3E6CC 5DV5A 3OS2A 2O03A 3H5RA 5HVQC 4C30A 2PLYA 3ELKA 4CCKA 5BS6A 5AIPA 2VQLA 2CO5A 1O57A 1PDNC 1QA6A 2W00A 4W97A 4KA4A 1SEUA 5LD2C 2XUBA 2XB5A 1RR7A 2HDCA 2LLKA 2VT2A 1DU0A 1L0OC 4G6TB 3BZ6A 3OYMA 2X1EA 4I2OA 4FQGA 1ORKA 3HL2A 3MKYB 1VTNC 1CF7A 3I3LA 1L3LA 1UG2A 1VNDA 1MBJA 1IV8A 1YS6A 2LDUA 2QF7A 1KGSA 3K4NA 4DYQA 5FLVA 1TWCJ 2DA2A 2F4OB 1UHWA 2MLKA 4P9UA 3ZXSA 2F6CA 4ENMA 4NQWB 1X1DA 4U0WA 4NB5A 4M3DA 3O6BB 2XPUA 1BR2A 5GPAA 4A5NA 4CH7A 1XGMA 1MIJA 3HSEA 3UKGA 1ZK8A 2LY1A 4OAYA 5GP9A 2EILH 5E3MA 4HZFA 3H3VK 3V7CA 5GAGJ 1WJ5A 3GUDA 4EMSA 3L1PA 4CYCA 5ICFA 3C7JA 5B5EC 1HA8A 1FNNA 3L9FA 4WWCA 2HXIA 4YIRX 3OYKA 2LH9A 1BW6A 1K4SA 1SVLA 4ITVA 1ERDA 2XKPA 4D5FA 3HPHA 4BBRJ 4DW6A 2HYGD 3QYBA 5DD8A 3IRRA 2L7KA 4Y33A 5JI6A 2QSFX 1VFCA 1IV6A 2DYSH 2DI3A 3D5LA 2CMPA 5EG0B 3QYFA 5JVGF 2QCOA 2XGEA 1FOYA 4UY8I 2EFQA 3L00A 3I56I 2XGXA 1QHHD 5C4XJ 3OYFA 3L2WA 1R1VA 1JKPC 3K2ZA 3T5XA 4A3LJ 1GLNA 4IRGA 2EFNA 4GDFA 1IO2A 1EH6A 1R00A 3CC7I 2CV0A 2ZKZA 1WI3A 4XLPF 1ZLJA 2MSYA 3N4MA 1FBQA 2E7XA 3HZJA 4EM2A 2YX4A 1I27A 4CA0A 3C2BA 4AUXA 4FTHA 3KEOA 1R1TA 2GM4A 2Z5UA 2UXXA 4N4NB 1T0FA 4A3CJ 1WFXA 4A5MA 2VKHA 3U2RA 2M8GX 4OIPF 1BI1A 2RNGA 4XM3A 1TZLA 4A0ZA 3FMRA 4I0BA 3IKVA 2EH3A 4IF4A 3AG2H 5GAHJ 5JLWA 3GX4X 1QQIA 2KIMA 1EJ9A 2R7XA 5FLXZ 1T98A 3H9GA 1MJBA 2DOEA 2QGUA 3DEUA 1MBHA 3ABMH 4BQOA 1FT9A 3F72A 3LSGA 4FT8A 3WODF 1WH7A 2BHYA 2EFPA 4S05A 1JT0A 4P1WA 1ETKA 1JKOC 2OZUA 2JUGA 2DCEA 2PFBA 4XLFA 1KYWA 2VBZA 2A3SA 3NAUA 4RLQA 3AAFA 4D7MA 2BXZA 2ECCA 1I6XA 2EK5A 3HOUJ 2EBIA 5HOOA 2CW7A 2KRCA 5K5QA 1ZR4A 2AHQA 2EIKH 2YR2A 4MQVA 2E36A 3ONQA 1X4OA 1POGA 1FBUA 5ERIA 4ENJA 4RLFA 3VOEA 5TGTA 4BU2A 1K6OA 3W2AA 2PI0A 3LA7A 4NC7A 2W7NA 2VJ4A 3ZR8X 2X85A 4V2FA 5DD4A 3RQIA 2R5ZB 3ZRGA 2IA1A 3LSPA 3PNYA 4BJ6C 4L5JA 5M5WJ 4RGSA 1X19A 3TMOA 2LSOA 4F55A 1MZBA 4RAFA 3SXYA 1J2XA 3BTJA 2CH0A 3CZ6A 1XSXA 3EUHA 1FX7A 2NVYJ 2VC1A 1YLFA 4KISA 3MVPA 3DEWA 3IUOA 2DPDA 1MNEA 3L2VA 4A0YA 1MDMB 1ETXA 2ME6A 4QTRA 2R5YB 3CCVI 1SFEA 5LHGA 2ELHA 2IA2A 3HXLA 1LFUP 1J59A 2CU7A 2EIJH 1DGWY 1TQIA 3ABUA 5LEJA 1LEBA 1ACIA 2HQ5A 1XS9A 1IN7A 4DBQA 1T8IA 4FX4A 4M3FA 1TQPA 5J8CA 4ASNA 3CJTB 3A03A 4NC6A 2BW3A 5E20A 4UB8C 2EV6A 5F0HA 4LITA 5AONA 1YJNI 2MYSA 5DCMA 2HYFA 3A0HC 2CRGA 2V6CA 3GTJJ 3SZTA 5H6QA 1LFBA 2E60A 3EUHC 2EJRA 3MZYA 1R5ID 1B1BA 3CUQB 3DKXA 5BNGA 5C3EJ 1TBXA 4CZZA 3BG5A 3P9IA 3J80K 1VQPI 1O3RA 2L02A 1P6RA 3GTGJ 1B9MA 2CV2A 2MD5A 3M9AA 3R60A 2K40A 2V9PA 3JAMK 3E0JB 3KCCA 2EQRA 5KVRA 1F9NA 1YX5A 3BR1A 4UUSB 1BA5A 3I5UA 2OU2A 1YOVB 1YE9A 4P96A 4UB6C 4OIRF 5A2QZ 5C44J 3C18A 3BR2A 5HS8A 2IP2A 2G9WA 3N05A 3ECHA 1P2FA 2AXTC 4TV7A 3L2QA 4A3IJ 1OLTA 3WU0A 5KAIC 5CPRB 4LGWA 2MLGA 2HVQA 3BWGA 4A12A 4IL6C 1YX3A 2DFHA 1E2XA 3CO7C 2WC2A 2L3DA 3Q5FA 3TDUC 2E1MB 3PQJA 2GXBA 3UNGC 1S6LA 2RKHA 1QRYA 1D1BA 2GLOA 4Q4ZF 3ZQLA 3O8GA 5AIQA 1WGXA 3G4SI 2CW8A 2M0CA 3VPRA 4C2UA 2P6TA 3E6DA 4HDVA 4IQJA 2DAOA 3TOBA 2XC7A 4IEJA 4M6VA 1LFPA 1WPKA 3PNTA 1A6IA 1R5GA 4ZZLA 4HPQA 2ZJQF 4CO8A 4PJ0C 4EJWA 5L3DA 1IJWC 2VJJA 3MCZA 4GXOA 4M3BA 1QNTA 3M07A 2KDOA 1HBXG 1X3WB 2TDXA 2JSCA 3FXQA 5EEHA 2DDBA 4IQ4A 4A69C 4BQNA 3WGIA 1Q1VA 1R36A 1A04A 4LIVA 1JTXA 2ZBKA 4XMYA 1P4WA 5J8FA 1RUOA 1S5LC 1FIPA 3W2WA 4A3DJ 4ON0A 2GBYA 1ZG3A 2ADUA 1ZH5A 4BEHA 1MJAA 1UELB 2XRNA 5CKTA 3P9KA 2QM3A 1LPQA 2P4WA 1TNTA 4LG3A 3S93A 2BY2A 1MMDA 2N8GA 4F7ZA 3HSRA 3ABLH 2NOJB 1T6SA 2V9VA 1OJLA 4WK8F 3K4BA 2O8KA 1H88C 2NS7A 2P6SA 4EM1A 1V3FA 2VT3A 3LQQA 4M6YA 3SDBA 1LUJB 4C2MJ 4DJAA 1D1AA 2PJRB 2V79A 4KDPA 4PDKA 1LNWA 1LVAA 2JN6A 2EFOA 3PNVA 3DQVC 1PUFA 2R7TA 2XAGA 1ZHFA 4GYIA 5LGUA 5D5VB 3FDYA 1B9NA 2QBYA 2ETHA 4X1EA 3M1CA 5E1XA 3WG9A 1IRFA 2H1KA 2V1DA 1DQUA 1O3SA 3A1YA 4KMUX 4PK4A 3HHGA 2DA7A 2R7ZJ 5L3FA 2H27A 2JA7J 1BR1A 1JUMA 2E19A 4IOCF 1VQ4I 3TQNA 1XMXA 3JW4A 5FKNA 1GXPA 3AL0C 4GYGA 4XKCA 1QU3A 3RPUD 2KPMA 4Q48A 4A6DA 4PGGA 4AIDA 4U0YA 3FHNA 1EH7A 4PZJA 5KK1A 2K4JA 2Z16A 3BY6A 4BQAA 1J9IA 1IXRC 2ELJA 1GVDA 3C2HA 2WA0A 2PQ8A 2FQ4A 4HYEA 3PFYA 1XCBA 3OMYA 4LB5A 4IX7A 3CCMI 1K4TA 3NARA 3NQOA 4ZYHA 1TC3C 1AU7A 1B59A 4ETSA 2W24A 5LFAA 2F2EA 2K3FA 3TBIA 1R22A 2F5DA 4LG0A 3R6SA 2K27A 4L0YB 1ETQA 2X6XA 4YIFA 4EGZA 1W36D 2QWWA 1JGSA 2X9DA 3E5UA 5J6XA 1FOKA 1FMVA 3FM5A 3CF5F 1T95A 3BJOA 2VODA 5TRDA 2LC2A 3QWLA 2ICWG 4KIBA 2JSPA 3MAJA 2VE9A 3VYSB 4L5IA 3BZKA 3WE3A 3W6JB 1XMKA 1MMNA 3PJRA 5ICCA 2DN0A 1XD7A 3R0JA 2DA4A 4HEA2 3OYCA 2Q2EB 4E7HA 2GOXB 2DFIA 2EWNA 3FMQA 2LBFA 2Y9YA 3ISPA 5B1AH 1VQ7I 3PO3J 2G0EA 1OCZH 1V5EA 2F5EA 3BJAA 3GTOJ 1A31A 3L09A 4BAYA 3FXUA 3J81Z 3LAJA 1ZRDA 2NRAC 1HW2A 1Z1DA 3QQAA 2HYJA 1O3TA 5HLGA 2UV1A 3QYEA 4EATA 2UWMA 4FE7A 2D1HA 2XVCA 2QEXI 1XN7A 3V7SA 3ZPLA 1I1SA 2OPTA 4ENKA 4G6DA 2W4SA 3IWZA 2O61A 2VJ5A 3GCMA 1XCVA 2LF8A 1QZZA 4NQWA 2OZ6A 4XQFA 4MTDA 2FF4A 4A6EA 4RAZA 1IGNA 1IDZA 3BG7A 3ZQHA 1U5TB 3JRBA 1Y8RB 4YEJA 3GYHX 1BIAA 3HGGA 2D2WA 2XAUA
chains in the Genus database with same CATH topology
1WCMJ 3A01B 3HB9A 4A3KJ 1Z0XA 2K9NA 3HOZJ 1TWAJ 3HDDA 3JRFA 4RDUA 4W97A 1RETA 2XB5A 5EGOB 5K7FA 2R0QC 1RR7A 3FK7A 1RPWA 3QPLA 2DMTA 2LLKA 1DU0A 3SFIA 1U78A 4XRSG 2MG4A 2VKEA 3IH3A 5FKKA 1ORKA 2HOTA 1UG2A 3TEDA 2JMWA 2LY9A 1VNDA 1MBJA 2LTPA 5EG0A 1GT0C 2QF7A 3GTLJ 4DYQA 5FLVA 1TWCJ 1VF9A 2DA2A 3ZOBA 3A02A 3GTMJ 1XG1A 2KDZA 2WV1A 4MLOA 1F43A 4M3DA 2R92J 4JX5A 4JYKA 2XPUA 2HOAA 5GPAA 3UKGA 1ZK8A 3BG3A 4Y52J 1H89C 3OSFA 2FJ1A 1MSEC 1P7JA 2O9LA 5GP9A 4IHXA 5E3MA 4AYBN 3BTCA 3H3VK 5F04A 1HOMA 3L1PA 2NVXJ 4CYCA 4C3IJ 3BR6A 2HXIA 1BW6A 5IYCJ 3QPSA 4D5FA 4V2GA 4BBRJ 2K9QA 4DW6A 2Y2ZA 1K83J 2EZLA 3K2AA 4DYCA 3O8HA 2LVSA 1VFCA 1U9OA 1X2NA 1SANA 2VI6A 1IV6A 4M3GA 5EG0B 4XRSA 2QCOA 2XGEA 3A01A 2IAIA 3RZDJ 4XIDA 1QVTA 3HOYJ 1UHSA 5C4XJ 1JKPC 3JRDA 1QPIA 4A3LJ 2DJNA 1X58A 4IHVA 3BR5A 3I4MJ 1WI3A 1UMQA 3M3YJ 2FX0A 4MFDA 2MSYA 2ZB9A 1DU6A 4S0HB 5EGOA 3ZQGA 3C2BA 4AUXA 4FTHA 2EZHA 2GM4A 3BQYA 4A3CJ 4CYCB 2PMZN 1IC8A 2M8GX 3BG9A 2Y30A 2CUFA 1MH4A 4A93J 2EH3A 5JLWA 1ETOA 1TWGJ 3IH4A 5F27A 2P81A 4W1UA 1LE8A 2JWTA 4X6AJ 1MBHA 2JK3A 2YUSA 5J3LA 2JA8J 5IYBJ 3LSGA 1TWHJ 1GV2A 4A3FJ 1YRNA 1R9TJ 3Q0VA 5JLXA 1WH7A 4BBSJ 4DZJA 4C3JJ 2H8RA 5FKLA 3B6CA 4I76A 1JT0A 4A3MJ 3CMYA 1BJZA 1ETKA 3Q0UA 1JKOC 2R5YA 2ELKA 1B8IA 1FTTA 2DA1A 1FTZA 3NAUA 3RZOJ 4D7MA 4D5CA 3IH2A 2ECCA 3HOUJ 3BR0A 1A5JA 2R93J 3S14J 2EBIA 1W0UA 3GTKJ 1ZR4A 3MKLA 5F0CA 2AHQA 2D5VA 3RKQA 1T56A 1POGA 3MN2A 3JREA 4XRMA 3LNQA 3HOWJ 3HOXJ 1HLVA 2X6OA 5E3NA 1HCRA 5IYDJ 1Y1WJ 5EZGA 2XGDA 4V2FA 3RQIA 2FD5A 4ABZA 2W48A 2XPWA 2R5ZB 3LSPA 5E3LA 5M5WJ 1LE8B 2RAEA 2XPVA 3BTJA 4RBOA 1ITYA 4IHWA 3LOCA 1YRNB 3HKZN 2NVYJ 2LD5A 3MVPA 2XSDC 3DEWA 3WHBA 2COBA 4Y7NJ 4QSHA 1ETXA 2ME6A 4QTRA 2R5YB 3BR3A 1B8IB 5HODA 3CDLA 5EEAA 3S17J 2I10A 3Q0WA 2VUMJ 4B1RA 5M3FJ 1LFUP 2JA5J 2CU7A 1Z77A 2HQ5A 2XRLA 1XS9A 1JKQC 1OCTC 4M3FA 1G2HA 2HOSA 4A3BJ 1GUUA 1ZKGA 1JUSA 3A03A 1BL0A 4A3GJ 5F0HA 1I50J 2EZIA 3GTPJ 2CRGA 3TW6A 4BY7J 3ZQCA 2E1OA 1T33A 3GTJJ 4MO7A 3W6VA 1LFBA 2X48A 2CQXA 5FKMA 2CUEA 1IG7A 5BNGA 5C3EJ 5J1YA 3BG5A 1MBGA 1RESA 4UUTA 2TRTA 3CCYA 3GTGJ 3DCFA 1ZQ3P 1I3QJ 2Y31A 4B4CA 2NVQJ 3LSJA 4J19A 2K40A 1MBEA 2EQRA 3E7LA 2Y9ZA 3BR1A 2K9SA 4GFBA 1VI0A 4UUSB 5M5XJ 3HM5A 1NTCA 1BA5A 4M3EA 3TP3A 3JRAA 4I6ZA 2WAQN 5C44J 1FEXA 3FK6A 1JT6A 1H8AC 3BR2A 4A3IJ 2Y0SN 1XC5A 1JKRC 3GTQJ 2YU9J 2DA5A 4JX4A 4MIMA 4HNVA 2R5ZA 3GBGA 5FLMJ 1O4XA 1BW5A 4FISA 2VPRA 3PO2J 2M9HA 5IP6A 1QRYA 2GLOA 1TWFJ 3ZQLA 3O8GA 2DMPA 2WB1N 1QVUA 1HF0A 1WGXA 3S15J 2M0CA 2ME0A 1FJLA 3ZQIA 2L7MP 1ENHA 1FIAA 3VPRA 3S2DJ 3SDGA 4JP0A 2TCTA 3JRIA 4A3JJ 1W0TA 2L9RA 3K7AJ 4IEJA 1WPKA 4M6VA 1A6IA 3JRGA 1ETVA 4AC0A 1MSFC 1IJWC 4M3BA 3JRCA 3S1RJ 2MW8A 1IDYA 9ANTA 5EZHA 4A69C 5DTDA 1Q1VA 2M2EA 1JTXA 2LKXA 1ETWA 4IHYA 3BQZA 1FIPA 5J1UA 1MNMC 2O7OA 4A3DJ 2GBYA 2IEKA 2KT0A 1B72B 5M5YJ 1MBKA 1ZGWA 4FCYA 3S1NJ 5J1RA 4B3AA 4EEFG 4BKXA 5IP9J 4XICA 2LR8A 4BXXJ 2DA3A 2IBDA 1IUFA 3OOUA 4XK4A 3D1NI 1Y1VJ 2N8GA 1AKHB 2XB0X 3BTLA 5IPAA 3FIWA 3HEFA 2NS8A 2NVTJ 3S1QJ 1GV5A 3FISA 1OJLA 2O8KA 1H88C 2NS7A 4C3HJ 3FKIJ 2LP0A 3G1LA 5F08A 4C2MJ 2CQQA 2ID3A 4L5EA 1MH3A 2JN6A 5F1JA 1SFOJ 2LK2A 4UUSA 2DMUA 1PUFA 1RKWA 3G1OA 1CQTA 3Q3SA 3B6AA 2L7FP 1D5YA 3M4OJ 2DA6A 1E3OC 4X1EA 4FE4A 1K61A 3WHCA 2H1KA 1EF4A 3S16J 3ZQFA 4D7NA 4QIWN 5GPCA 2DA7A 1AHDP 2R7ZJ 2DMQA 3OIOA 3HBLA 2JA7J 2CJJA 1JUMA 2E19A 4NDLA 5EDNA 3IV5A 5EYRA 5FKNA 3JRHA 2OF7A 1ZR2A 2L7ZA 1HDPA 3HGYA 5K7ZA 2L0KA 2M34A 5IOYA 3OSGA 1GDTA 1RKTA 5E3OA 1X2MA 2E2IJ 2E2HJ 1GVDA 1ZTRA 2FQ4A 2HDDA 5FJ8J 4LOCA 4A3EJ 1JGGA 3S1MJ 3NARA 2LFBA 1NK2P 1HDDC 3JR9A 4DZPA 1TC3C 5FKOA 1AU7A 3I4NJ 2DTZA 1F36A 1PUFB 3LSRA 1NK3P 1ETQA 1U8BA 2HXOA 2X9DA 1B72A 4G12A 1WH5A 1U9NA 1OCPA 5IOZA 1IRZA 1AKHA 2HI3A 3SJMA 4BY1J 5DS9A 2DMNA 2YS9A 3TP0A 5EF6A 3G1MA 2DN0A 1ETYA 1JJ6C 2JA6J 2DA4A 2E2JJ 2ID6A 3S2HJ 1MBFA 2Y9YA 3PO3J 2G0EA 3GTOJ 2NOGA 1OFCX 5M3MJ 4DYRA 3BT9A 3TW7A 3HOVJ 2VKVA 3H0GJ 1APLC 1S7EA 3QQAA 2HYJA 1I6HJ 3F0CA 4FE7A 2ECBA 3BTIA 2B63J 2JJ7A 2OPTA 5IP7J 1P7IA 3CQZJ 4JX6A 3PM1A 4MFEA 1JJ8C 5F0FA 1IGNA 2MGQA 2AO9A 5K7HA 2XGCA 1IDZA 5C4JJ 3ZQHA 1JUPA 2EZKA 3JRBA 1JTYA 3HGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM J;  3A01 B;  3HB9 A;  4A3K J;  1Z0X A;  2K9N A;  3HOZ J;  1TWA J;  3HDD A;  3JRF A;  4RDU A;  4W97 A;  1RET A;  2XB5 A;  5EGO B;  5K7F A;  2R0Q C;  1RR7 A;  3FK7 A;  1RPW A;  3QPL A;  2DMT A;  2LLK A;  1DU0 A;  3SFI A;  1U78 A;  4XRS G;  2MG4 A;  2VKE A;  3IH3 A;  5FKK A;  1ORK A;  2HOT A;  1UG2 A;  3TED A;  2JMW A;  2LY9 A;  1VND A;  1MBJ A;  2LTP A;  5EG0 A;  1GT0 C;  2QF7 A;  3GTL J;  4DYQ A;  5FLV A;  1TWC J;  1VF9 A;  2DA2 A;  3ZOB A;  3A02 A;  3GTM J;  1XG1 A;  2KDZ A;  2WV1 A;  4MLO A;  1F43 A;  4M3D A;  2R92 J;  4JX5 A;  4JYK A;  2XPU A;  2HOA A;  5GPA A;  3UKG A;  1ZK8 A;  3BG3 A;  4Y52 J;  1H89 C;  3OSF A;  2FJ1 A;  1MSE C;  1P7J A;  2O9L A;  5GP9 A;  4IHX A;  5E3M A;  4AYB N;  3BTC A;  3H3V K;  5F04 A;  1HOM A;  3L1P A;  2NVX J;  4CYC A;  4C3I J;  3BR6 A;  2HXI A;  1BW6 A;  5IYC J;  3QPS A;  4D5F A;  4V2G A;  4BBR J;  2K9Q A;  4DW6 A;  2Y2Z A;  1K83 J;  2EZL A;  3K2A A;  4DYC A;  3O8H A;  2LVS A;  1VFC A;  1U9O A;  1X2N A;  1SAN A;  2VI6 A;  1IV6 A;  4M3G A;  5EG0 B;  4XRS A;  2QCO A;  2XGE A;  3A01 A;  2IAI A;  3RZD J;  4XID A;  1QVT A;  3HOY J;  1UHS A;  5C4X J;  1JKP C;  3JRD A;  1QPI A;  4A3L J;  2DJN A;  1X58 A;  4IHV A;  3BR5 A;  3I4M J;  1WI3 A;  1UMQ A;  3M3Y J;  2FX0 A;  4MFD A;  2MSY A;  2ZB9 A;  1DU6 A;  4S0H B;  5EGO A;  3ZQG A;  3C2B A;  4AUX A;  4FTH A;  2EZH A;  2GM4 A;  3BQY A;  4A3C J;  4CYC B;  2PMZ N;  1IC8 A;  2M8G X;  3BG9 A;  2Y30 A;  2CUF A;  1MH4 A;  4A93 J;  2EH3 A;  5JLW A;  1ETO A;  1TWG J;  3IH4 A;  5F27 A;  2P81 A;  4W1U A;  1LE8 A;  2JWT A;  4X6A J;  1MBH A;  2JK3 A;  2YUS A;  5J3L A;  2JA8 J;  5IYB J;  3LSG A;  1TWH J;  1GV2 A;  4A3F J;  1YRN A;  1R9T J;  3Q0V A;  5JLX A;  1WH7 A;  4BBS J;  4DZJ A;  4C3J J;  2H8R A;  5FKL A;  3B6C A;  4I76 A;  1JT0 A;  4A3M J;  3CMY A;  1BJZ A;  1ETK A;  3Q0U A;  1JKO C;  2R5Y A;  2ELK A;  1B8I A;  1FTT A;  2DA1 A;  1FTZ A;  3NAU A;  3RZO J;  4D7M A;  4D5C A;  3IH2 A;  2ECC A;  3HOU J;  3BR0 A;  1A5J A;  2R93 J;  3S14 J;  2EBI A;  1W0U A;  3GTK J;  1ZR4 A;  3MKL A;  5F0C A;  2AHQ A;  2D5V A;  3RKQ A;  1T56 A;  1POG A;  3MN2 A;  3JRE A;  4XRM A;  3LNQ A;  3HOW J;  3HOX J;  1HLV A;  2X6O A;  5E3N A;  1HCR A;  5IYD J;  1Y1W J;  5EZG A;  2XGD A;  4V2F A;  3RQI A;  2FD5 A;  4ABZ A;  2W48 A;  2XPW A;  2R5Z B;  3LSP A;  5E3L A;  5M5W J;  1LE8 B;  2RAE A;  2XPV A;  3BTJ A;  4RBO A;  1ITY A;  4IHW A;  3LOC A;  1YRN B;  3HKZ N;  2NVY J;  2LD5 A;  3MVP A;  2XSD C;  3DEW A;  3WHB A;  2COB A;  4Y7N J;  4QSH A;  1ETX A;  2ME6 A;  4QTR A;  2R5Y B;  3BR3 A;  1B8I B;  5HOD A;  3CDL A;  5EEA A;  3S17 J;  2I10 A;  3Q0W A;  2VUM J;  4B1R A;  5M3F J;  1LFU P;  2JA5 J;  2CU7 A;  1Z77 A;  2HQ5 A;  2XRL A;  1XS9 A;  1JKQ C;  1OCT C;  4M3F A;  1G2H A;  2HOS A;  4A3B J;  1GUU A;  1ZKG A;  1JUS A;  3A03 A;  1BL0 A;  4A3G J;  5F0H A;  1I50 J;  2EZI A;  3GTP J;  2CRG A;  3TW6 A;  4BY7 J;  3ZQC A;  2E1O A;  1T33 A;  3GTJ J;  4MO7 A;  3W6V A;  1LFB A;  2X48 A;  2CQX A;  5FKM A;  2CUE A;  1IG7 A;  5BNG A;  5C3E J;  5J1Y A;  3BG5 A;  1MBG A;  1RES A;  4UUT A;  2TRT A;  3CCY A;  3GTG J;  3DCF A;  1ZQ3 P;  1I3Q J;  2Y31 A;  4B4C A;  2NVQ J;  3LSJ A;  4J19 A;  2K40 A;  1MBE A;  2EQR A;  3E7L A;  2Y9Z A;  3BR1 A;  2K9S A;  4GFB A;  1VI0 A;  4UUS B;  5M5X J;  3HM5 A;  1NTC A;  1BA5 A;  4M3E A;  3TP3 A;  3JRA A;  4I6Z A;  2WAQ N;  5C44 J;  1FEX A;  3FK6 A;  1JT6 A;  1H8A C;  3BR2 A;  4A3I J;  2Y0S N;  1XC5 A;  1JKR C;  3GTQ J;  2YU9 J;  2DA5 A;  4JX4 A;  4MIM A;  4HNV A;  2R5Z A;  3GBG A;  5FLM J;  1O4X A;  1BW5 A;  4FIS A;  2VPR A;  3PO2 J;  2M9H A;  5IP6 A;  1QRY A;  2GLO A;  1TWF J;  3ZQL A;  3O8G A;  2DMP A;  2WB1 N;  1QVU A;  1HF0 A;  1WGX A;  3S15 J;  2M0C A;  2ME0 A;  1FJL A;  3ZQI A;  2L7M P;  1ENH A;  1FIA A;  3VPR A;  3S2D J;  3SDG A;  4JP0 A;  2TCT A;  3JRI A;  4A3J J;  1W0T A;  2L9R A;  3K7A J;  4IEJ A;  1WPK A;  4M6V A;  1A6I A;  3JRG A;  1ETV A;  4AC0 A;  1MSF C;  1IJW C;  4M3B A;  3JRC A;  3S1R J;  2MW8 A;  1IDY A;  9ANT A;  5EZH A;  4A69 C;  5DTD A;  1Q1V A;  2M2E A;  1JTX A;  2LKX A;  1ETW A;  4IHY A;  3BQZ A;  1FIP A;  5J1U A;  1MNM C;  2O7O A;  4A3D J;  2GBY A;  2IEK A;  2KT0 A;  1B72 B;  5M5Y J;  1MBK A;  1ZGW A;  4FCY A;  3S1N J;  5J1R A;  4B3A A;  4EEF G;  4BKX A;  5IP9 J;  4XIC A;  2LR8 A;  4BXX J;  2DA3 A;  2IBD A;  1IUF A;  3OOU A;  4XK4 A;  3D1N I;  1Y1V J;  2N8G A;  1AKH B;  2XB0 X;  3BTL A;  5IPA A;  3FIW A;  3HEF A;  2NS8 A;  2NVT J;  3S1Q J;  1GV5 A;  3FIS A;  1OJL A;  2O8K A;  1H88 C;  2NS7 A;  4C3H J;  3FKI J;  2LP0 A;  3G1L A;  5F08 A;  4C2M J;  2CQQ A;  2ID3 A;  4L5E A;  1MH3 A;  2JN6 A;  5F1J A;  1SFO J;  2LK2 A;  4UUS A;  2DMU A;  1PUF A;  1RKW A;  3G1O A;  1CQT A;  3Q3S A;  3B6A A;  2L7F P;  1D5Y A;  3M4O J;  2DA6 A;  1E3O C;  4X1E A;  4FE4 A;  1K61 A;  3WHC A;  2H1K A;  1EF4 A;  3S16 J;  3ZQF A;  4D7N A;  4QIW N;  5GPC A;  2DA7 A;  1AHD P;  2R7Z J;  2DMQ A;  3OIO A;  3HBL A;  2JA7 J;  2CJJ A;  1JUM A;  2E19 A;  4NDL A;  5EDN A;  3IV5 A;  5EYR A;  5FKN A;  3JRH A;  2OF7 A;  1ZR2 A;  2L7Z A;  1HDP A;  3HGY A;  5K7Z A;  2L0K A;  2M34 A;  5IOY A;  3OSG A;  1GDT A;  1RKT A;  5E3O A;  1X2M A;  2E2I J;  2E2H J;  1GVD A;  1ZTR A;  2FQ4 A;  2HDD A;  5FJ8 J;  4LOC A;  4A3E J;  1JGG A;  3S1M J;  3NAR A;  2LFB A;  1NK2 P;  1HDD C;  3JR9 A;  4DZP A;  1TC3 C;  5FKO A;  1AU7 A;  3I4N J;  2DTZ A;  1F36 A;  1PUF B;  3LSR A;  1NK3 P;  1ETQ A;  1U8B A;  2HXO A;  2X9D A;  1B72 A;  4G12 A;  1WH5 A;  1U9N A;  1OCP A;  5IOZ A;  1IRZ A;  1AKH A;  2HI3 A;  3SJM A;  4BY1 J;  5DS9 A;  2DMN A;  2YS9 A;  3TP0 A;  5EF6 A;  3G1M A;  2DN0 A;  1ETY A;  1JJ6 C;  2JA6 J;  2DA4 A;  2E2J J;  2ID6 A;  3S2H J;  1MBF A;  2Y9Y A;  3PO3 J;  2G0E A;  3GTO J;  2NOG A;  1OFC X;  5M3M J;  4DYR A;  3BT9 A;  3TW7 A;  3HOV J;  2VKV A;  3H0G J;  1APL C;  1S7E A;  3QQA A;  2HYJ A;  1I6H J;  3F0C A;  4FE7 A;  2ECB A;  3BTI A;  2B63 J;  2JJ7 A;  2OPT A;  5IP7 J;  1P7I A;  3CQZ J;  4JX6 A;  3PM1 A;  4MFE A;  1JJ8 C;  5F0F A;  1IGN A;  2MGQ A;  2AO9 A;  5K7H A;  2XGC A;  1IDZ A;  5C4J J;  3ZQH A;  1JUP A;  2EZK A;  3JRB A;  1JTY A;  3HGG A; 
#chains in the Genus database with same CATH topology
 2FMY A;  4M6X A;  1WCM J;  4NHJ A;  3LSH A;  3GFM A;  2ZJP F;  3ABK H;  3LAP A;  2Y0M A;  2X1C A;  2FNP A;  2K9N A;  4BDY A;  4RGR A;  3GME A;  3LFU A;  3HOZ J;  1W5T A;  3QP6 A;  1U6G A;  1J75 A;  2Y0S A;  4KJZ A;  3JRF A;  1X1B A;  2WWY A;  3OIQ A;  3EYI A;  5ILS A;  1U2W A;  5EGO B;  3BCB A;  3FK7 A;  3QPL A;  3E1S A;  5JR3 A;  2LNB A;  1YQA A;  4XRS G;  2CQK A;  4M74 A;  4XBF A;  3GFI A;  1IRG A;  1FWZ A;  3IH3 A;  3U9G A;  2DT7 B;  2R7R A;  2JPB A;  1P9Q C;  3OV8 A;  4HSR A;  2EA4 A;  2BV6 A;  4RAY A;  1YW9 A;  3KEQ A;  1Z7L A;  5EG0 A;  4LLL A;  3L2C A;  3SQN A;  4F91 B;  3HRU A;  2VIX A;  3RJP A;  1VQN I;  1WJC A;  5HNF A;  4XL9 A;  3GTM J;  1BR4 A;  4Q47 A;  4MLO A;  3A4C A;  4RM3 A;  1SMT A;  3ZN1 A;  2IGK A;  4IPA A;  4RAG A;  2L9N A;  3TOA A;  1J5Y A;  1FYL A;  1OR7 A;  4LMY A;  3AG1 H;  1P7J A;  3VEP A;  4IHX A;  2G7U A;  2RQP A;  4AYB N;  2KP6 A;  2O8X A;  3BRO A;  1BI0 A;  3BTC A;  3H35 A;  4PJM A;  4QPO A;  1KZH A;  1HOM A;  2O0Y A;  2NVX J;  4C3I J;  2MD0 A;  2IT0 A;  3K9T A;  2OA4 A;  4YRV A;  3BR6 A;  2HTJ A;  4HDU A;  4HQE A;  2QA4 I;  4ZYG A;  1HQC A;  2ZME B;  4NC8 A;  5IYC J;  3S3O A;  3AL0 B;  2HNH A;  2CWE A;  1WI9 A;  4V2G A;  4ZZD A;  4HQM A;  2RNJ A;  2K9Q A;  2JUC A;  4OMY A;  4EV0 A;  4FX0 A;  1G59 A;  3K2A A;  3KEY A;  4KT6 A;  2V6E A;  1W7P A;  3CES A;  2FU4 A;  4UNO A;  4KMF A;  2AXL A;  1B4A A;  1WJB A;  1V5F A;  3A01 A;  2IS1 A;  1VQO I;  1TT5 B;  4YG2 F;  4MTE A;  3MZH A;  4XID A;  1KU2 A;  1W1W E;  3FM3 A;  3HOY J;  3CJQ B;  3OY9 A;  4KIT B;  4ENN A;  4RM2 A;  1K78 A;  1N78 A;  3JRD A;  3PL8 A;  2DJN A;  3K70 D;  3L7W A;  1XSD A;  2XF7 A;  1ZG5 A;  3I4M J;  2IJL A;  1HKQ A;  1HC8 A;  1WVR A;  2GXA A;  3M3Y J;  2FX0 A;  3Q9S A;  3K4M A;  3VYT B;  2NYX A;  4S0H B;  3RTR A;  3I54 A;  1XTA A;  3VB2 A;  4BDZ A;  1JHH A;  1G6N A;  4BHC A;  4CUG A;  2IS4 A;  3D5S C;  3GVA A;  1OYY A;  2PMZ N;  1XX5 A;  2CSO A;  2K9L A;  2VN2 A;  1U3E M;  3FF5 A;  1HXD A;  3BG9 A;  2V9K A;  3K10 A;  2P7V B;  4EQQ A;  2ZFU A;  2IVM A;  2B7E A;  1GHC A;  1ETO A;  2DFE A;  4ANJ A;  5BPI A;  3MEX A;  3S8P A;  4CSW A;  4HBL A;  1V4R A;  5HS7 A;  2JK3 A;  2YUS A;  2JA8 J;  3F8C A;  4A3F J;  3LSI A;  3B6C A;  3M8F A;  4XKV A;  4AU7 A;  2C6Y A;  4A3M J;  4JOM A;  1BJZ A;  1MDM A;  3Q0U A;  3ZMT A;  2VE8 A;  2XF6 A;  4HX8 A;  4XOT A;  2R5Y A;  2JQ7 A;  5DEQ A;  2Q0O A;  1EA3 A;  2CFX A;  2FNA A;  3DBR B;  1UST A;  3EET A;  3IH2 A;  1NG6 A;  2VBY A;  3IC7 A;  2CQ7 A;  3BR0 A;  1XB4 A;  5FFZ A;  2LRE A;  4ZC3 A;  4YFX F;  3GTK J;  3J81 K;  2D5V A;  1FSE A;  3ML6 A;  3RKQ A;  1OYI A;  3NWS A;  2YSR A;  5B3S H;  3GLL A;  3IWF A;  1A35 A;  3FXR A;  3JRE A;  4XRM A;  2ESH A;  1YIJ I;  1HCR A;  5IYD J;  4OWR B;  1Y1W J;  4BGD A;  3R0A A;  4WXC A;  3ZMS A;  2PMZ A;  2HKX A;  2VC0 A;  1C0W A;  2PEX A;  2EV5 A;  4WXD A;  3V8K A;  3G73 A;  1UAA A;  3FXM A;  3GEZ A;  3IRQ A;  5CLS A;  4HNU A;  3F22 A;  1QBJ A;  3LOC A;  3J80 Z;  2LD5 A;  2YU3 A;  2X6W A;  3OYG A;  2XSD C;  4KIC A;  3ROU A;  2H94 A;  3WHB A;  5ILV A;  1ON2 A;  1ON1 A;  3BR3 A;  3JAM Z;  5HOD A;  3LST A;  5EEA A;  3Q0W A;  3OR2 C;  2DLL A;  1SAX A;  2XAS A;  3HC7 A;  4B1R A;  3OL4 A;  1P4A A;  5E1W A;  1JKQ C;  1OCT C;  1G3W A;  4A3B J;  1YTY A;  1JUS A;  3IKT A;  3LQR A;  2M1B A;  3CUQ C;  4RS8 A;  4UV9 A;  1X1P A;  2L01 A;  1D8K A;  2JTV A;  1Z6T A;  5KCM A;  1E3P A;  1BI2 A;  3QPH A;  3TW6 A;  4BY7 J;  2E1O A;  2X48 A;  2CQX A;  4XNF A;  2WY7 Q;  2CUE A;  1QO0 D;  4HOB A;  1MBG A;  4D1Q A;  3AFH A;  1PYV A;  3HJE A;  3WTV C;  2KIS A;  1KU3 A;  4UVC A;  4CCJ A;  3CCY A;  1ZQ3 P;  3OYJ A;  4RB0 A;  4J19 A;  3DU5 A;  4HNT A;  4M9X A;  2Y9Z A;  5K5R A;  2K9S A;  2E5Z A;  4GFB A;  4AVZ A;  4RGX A;  2HS5 A;  2B0L A;  2VON A;  3I53 A;  4CHU A;  4MNU A;  4M3E A;  3TP3 A;  3JRA A;  2WAQ N;  4II3 A;  2FUG 2;  4G8X A;  5BQT A;  2M8E A;  1I39 A;  1FEX A;  4HX4 A;  4U88 A;  5L3G A;  3H5N A;  4PCQ A;  4BH9 A;  2E1M C;  2OQR A;  2ZNZ A;  1XC5 A;  2ZO4 A;  5E8G A;  3A0B C;  1UZC A;  1WJF A;  3K4J A;  4L0Z B;  4AM3 A;  2YU9 J;  1GVJ A;  2H09 A;  3K1N A;  4A2U A;  1O4X A;  3GBG A;  5FLM J;  3E5X A;  1V5G A;  2HWV A;  3WTU C;  3BZC A;  2HZT A;  2FE3 A;  2RDP A;  1SVO A;  3CCR I;  5L3C A;  5J47 A;  2DOA A;  3W3C A;  4O5V A;  1FJL A;  3ZQI A;  1HKS A;  3GW2 A;  4DBR A;  1WJD A;  2TCT A;  3JRI A;  4A3J J;  3K7A J;  3FWE A;  4BJ5 C;  3JRG A;  4ESB A;  4AC0 A;  1MSF C;  2IW5 A;  4LLG F;  3RPQ A;  1R1U A;  1WZ2 A;  2I8D A;  4PFP A;  3MD2 A;  2W82 A;  3SEZ A;  4ZYA A;  3C2G A;  2FXA A;  2M4K A;  3LWF A;  2DXI A;  1HW5 A;  3QOD A;  5GAD J;  3BQZ A;  4E4H A;  1X1A A;  2WY8 Q;  3CJR B;  3H0D A;  1XGS A;  5M5Y J;  5JFR A;  2W85 A;  5E79 C;  3VDX A;  5J1R A;  1WHU A;  4IOA F;  1BM9 A;  3KP7 A;  4XIC A;  2WAQ A;  2LR8 A;  5DM6 F;  2HEO A;  1AKH B;  1Z6R A;  3E6M A;  5FO5 A;  1F5T A;  1QGP A;  4UXN A;  2KFD A;  5LLQ A;  1IN6 A;  3FIW A;  1QHG A;  4IVN A;  2E1N A;  2NS8 A;  3S1Q J;  2UXN A;  4CCN A;  3G71 I;  3G1L A;  3DLA A;  5F08 A;  1U0J A;  2WAD A;  1MH3 A;  1TLH B;  2FA5 A;  1TW2 A;  2L4A A;  2AQE A;  2H6B A;  2MAB A;  4Z2Y A;  3OS0 A;  1BI3 A;  3I0T A;  4KIF A;  2EPF A;  1S3J A;  4G94 A;  4RB2 C;  2XV4 S;  4KYW A;  3K4L A;  3K1P A;  3P5J A;  1KU7 A;  2K85 A;  4BXF A;  1K7A A;  1TW3 A;  3SHF A;  1N75 A;  3ZN0 A;  4BQQ A;  3P7N A;  2ESN A;  1OPC A;  2IGO A;  3ECO A;  5GPC A;  1SC7 A;  1AHD P;  5E17 F;  2I5U A;  3IHU A;  2DMQ A;  3HBL A;  3CC4 I;  3OIP A;  2CJJ A;  1IAW A;  2GAU A;  2HKO A;  1K6Y A;  5EYR A;  4F3Q A;  1WKM A;  2ZFW A;  2CV1 A;  4AIJ A;  1F4K A;  3WU1 B;  1TL8 A;  2L7Z A;  2QYO A;  2L0K A;  4L9T A;  4CCM A;  2M0M A;  4H4K C;  5LRS A;  3OSG A;  1GDT A;  2ZXI A;  5IT3 A;  2HDD A;  1XDS A;  2VKD A;  3DKW A;  1JGG A;  5J4Y A;  1R4M B;  3S1M J;  4Z6Y A;  2FBH A;  5FKO A;  2CUJ A;  4FHT A;  1JE8 A;  2FML A;  1WQ2 A;  4KFC A;  3JTH A;  3CP2 A;  1E0E A;  4J01 A;  1F36 A;  1I1G A;  3GZ6 A;  4B43 A;  3R4K A;  3TKY A;  1U5T A;  4BJT A;  3DKY A;  1YI2 I;  1TT0 A;  2OUM A;  3LFK A;  2J5O A;  2Z99 A;  1U8B A;  2JZY A;  2OCC H;  5D5W B;  2EB7 A;  2WTE A;  1B72 A;  1KYZ A;  3OOP A;  1U9N A;  2W57 A;  4EJO A;  1OCP A;  2O5R A;  2A6E F;  4LK0 F;  3ASO H;  4CCL A;  3N97 A;  1WSU A;  3SJM A;  3CF2 A;  4HLY A;  5LHH A;  3G1M A;  2GA1 A;  2R7W A;  4U7D A;  1Z21 A;  3IP4 B;  1JJ6 C;  2E2J J;  1FP1 D;  2HFH A;  1MBF A;  1MGT A;  2QQB A;  3JCU C;  4MEY F;  2DDA A;  2OC6 A;  3KP3 A;  3E3V A;  4DNC A;  5DCF A;  4U7B A;  2NXN B;  2NOG A;  2Z1D A;  4PSW A;  2ZJR F;  4DYR A;  1S29 A;  3BT9 A;  3FXL A;  3KE2 A;  1HST A;  1S7E A;  2DT5 A;  1UB9 A;  2JT1 A;  2DK8 A;  3SFZ A;  3G6E I;  1U5T C;  3KYL A;  2XSJ C;  3BTI A;  4RA2 A;  2OJE D;  3K6G A;  2X51 A;  4N0B A;  4BE1 A;  2R7F A;  5IP7 J;  1IN4 A;  1P7I A;  2BY3 A;  3DEE A;  3WTY C;  1H9G A;  4JX6 A;  2XIG A;  4MFE A;  4YFN F;  2PJP A;  4HX7 A;  2FRH A;  2MGQ A;  2AO9 A;  1ZAR A;  4BS9 A;  2RN7 A;  2DK5 A;  1LDJ A;  5C4J J;  2HZD A;  1ZGJ A;  1D3Y A;  2MH9 A;  4KT5 C;  3V8L A;  4WXH A;  3CCL I;  1T38 A;  1T39 A;  4XLN F;  2VBX A;  4AIH A;  4LJZ F;  4KIG A;  4YFK F;  2YX7 A;  4E6K G;  3TGN A;  3DP7 A;  2ZME A;  2QQ8 A;  2K9M A;  4RDU A;  4P55 A;  3VYU B;  3VYR B;  3DWL E;  2IA0 A;  1VQ8 I;  2P0W A;  3I59 B;  3IAS 2;  2DMT A;  3DBL B;  3VWB A;  2KJB A;  1KQ8 A;  2HOE A;  2MG4 A;  1MMG A;  4AWX B;  2VKE A;  2XAF A;  1W5C C;  5FKK A;  4F93 B;  2LKP A;  3U21 A;  3S3M A;  2HOT A;  2GWR A;  3TED A;  5K1Y A;  1PP8 F;  2IPQ X;  2QQA A;  1N25 A;  3TO9 A;  2LTP A;  1GT0 C;  2M30 A;  3GTL J;  3K69 A;  1S7A A;  2J5P A;  1VF9 A;  2DOD A;  3SZG A;  1R58 A;  2KLO A;  4UHT A;  3BCA A;  1XDU A;  2KDZ A;  3DPL C;  4GRI A;  4HG2 A;  3I58 A;  4HST A;  4DIQ A;  2R92 J;  4JYK A;  2Z3Y A;  2HOA A;  2GXG A;  3BPX A;  3BG3 A;  4ESF A;  2R7D A;  3OSF A;  2FJ1 A;  1MSE C;  2O9L A;  2Z33 A;  1FYK A;  2ZME C;  1BOA A;  3BLY A;  4EJV A;  1N77 A;  2HQN A;  2F4M B;  3QP5 A;  2DJI A;  2JRM A;  3HTS B;  2BYV E;  1H0M A;  3JSP A;  2PMU A;  2BY1 A;  2R7S A;  3I64 A;  5FRM A;  2A6T A;  1V54 H;  3QPS A;  4WCG A;  1HKT A;  2Y2Z A;  2EZL A;  1AOY A;  1USS A;  2Z9O A;  3QOE A;  1Q1H A;  3CDH A;  2DPU A;  3O8H A;  1MND A;  1BOB A;  4RMN A;  1U9O A;  1SAN A;  3DV8 A;  3ZGK A;  4M3G A;  4HV5 A;  1CGP A;  3LA2 A;  1YS7 A;  1QVT A;  2R7O A;  4I7H A;  1RZ4 A;  3EQL F;  1A36 A;  1ZRE A;  1SVM A;  3KYD B;  5LGN A;  5HLH A;  2ZJ2 A;  3P9C A;  2LOO A;  3ABT A;  1Y6I A;  1Z3Y A;  1QPI A;  1W5S A;  3HOS A;  1X58 A;  3KP5 A;  3BR5 A;  4B09 A;  4IHV A;  3M1E A;  3V42 A;  1P92 A;  1UMQ A;  3U1D A;  4XLE A;  3FHZ A;  5FRO A;  3ZQG A;  1YJW I;  2F4I A;  2KQR A;  4CGZ A;  4MQ9 F;  4QPQ A;  4G7Z F;  3C1D A;  1IC8 A;  2Y69 H;  4HV6 A;  2DYR H;  2X6Y A;  1QZY A;  2R7U A;  4N9I A;  3OYB A;  1TWG J;  3IH4 A;  3KYC B;  1YFH A;  5F27 A;  2P81 A;  1SFK A;  4W1U A;  4GO1 A;  4I98 B;  3F21 A;  4UUV A;  4D0P A;  5IYB J;  2QUF A;  4B47 A;  1GV2 A;  2WAE A;  3EYY A;  1REP C;  5JLX A;  4XOP A;  2X1D A;  2DBB A;  1MMS A;  2DQR A;  1IF1 A;  3MWM A;  2P7C B;  1KON A;  1FTT A;  1SD6 A;  2L9V A;  3CDI A;  3HIF A;  3HSF A;  2DA1 A;  1FTZ A;  3RZO J;  4D5C A;  1I3A A;  4L9J A;  4OOI A;  1OKR A;  3J7A O;  1RIO H;  5E18 F;  1A5J A;  2R93 J;  3S14 J;  2HQA A;  1UHM A;  3HG9 A;  3MKL A;  4IO9 F;  2CW0 F;  3BC8 A;  1K79 A;  1T56 A;  5DUK A;  4ZDL A;  1Y8Q B;  3HHH A;  2V1N A;  4MEX F;  3CC2 I;  2L4M A;  3LNQ A;  2LKS A;  4N9H A;  2LRD A;  4BE2 A;  2E7W A;  2X6O A;  2BXY A;  4JQF A;  4RGU A;  5E3N A;  1AA7 A;  1PVE A;  4O6J A;  3S32 A;  5EZG A;  2DQL A;  4ZTJ A;  1T08 B;  2P5K A;  4Y15 A;  2W25 A;  2XGD A;  1OCR H;  3LA3 A;  2W48 A;  2XPW A;  3F8F A;  4BHB A;  1W36 C;  2ZXH A;  4Q5S F;  1LE8 B;  3H3Z A;  2CYY A;  2PG4 A;  2XPV A;  3MKW B;  3R61 A;  2MH2 A;  4RBO A;  4LD5 A;  3WGH A;  2BEO A;  2ZSH B;  3I55 I;  1ITY A;  1YRN B;  1EV7 A;  3FBI B;  3H9J A;  3HKZ N;  4G9Y A;  2FEZ A;  4E70 A;  4XKB A;  2F5C A;  5HLI A;  3MZ8 A;  5IT9 K;  4Y7N J;  1W7P D;  1XPX A;  4QSH A;  3UR3 C;  4WX9 A;  3FMS A;  1B8I B;  1LDD A;  2RC4 A;  1D1C A;  1YYV A;  3CDL A;  4OIO F;  2I10 A;  2VQG A;  2VUM J;  3PFI A;  2JA2 A;  1Y56 A;  3ZMV A;  2HPM A;  2XAQ A;  2XRL A;  3WGG A;  1SFX A;  4XSZ F;  5FD6 A;  1G2H A;  2BY0 A;  1ODD A;  1AWC A;  1GUU A;  1VQK I;  2Q8K A;  4OU0 A;  1BL0 A;  4A3G J;  4KN7 X;  5BOX A;  2A69 F;  3DF8 A;  4YII A;  2IGN A;  1VQL I;  1RRJ A;  2IS2 A;  5H6R A;  1T33 A;  2A68 F;  3W6V A;  2PBI A;  1IG7 A;  4Y3O A;  3BP8 A;  4IHS A;  3BPV A;  3CO6 C;  1TTY A;  2BZT A;  2R3S A;  4ZTF A;  3DPU A;  5FRN A;  3GZN B;  1I3Q J;  2Y31 A;  1D0Y A;  4B4C A;  3LSJ A;  3WTZ A;  2GIV A;  3E7L A;  4EJT A;  5D6E A;  3F3X A;  1VI0 A;  3CTA A;  1LDK B;  2NVU B;  2KHM A;  5M5X J;  1MW7 A;  1NTC A;  2MFZ A;  1PUE E;  4LLN A;  4I6Z A;  3ZP5 A;  4M9Z A;  5ILU A;  1ZYR F;  2ISY A;  1ZN2 A;  1JT6 A;  2NS0 A;  3CLO A;  2Q1Z B;  1XGN A;  3TDZ C;  4II2 A;  2UUZ A;  1R5H A;  4AYB A;  3M8E A;  3PSI A;  3V7R A;  1JKR C;  2VXD A;  5H2F C;  2E71 A;  2E5N A;  3HOW J;  1D8J A;  3TL4 X;  1R6R A;  2DA5 A;  1BJA A;  4JX4 A;  2V1X A;  4MIM A;  2R5Z A;  1YHQ I;  4U0V A;  3RCO A;  2IGM A;  4I02 A;  2XKO A;  3HUG B;  2M9H A;  1R7J A;  4XLC A;  4L9N A;  1BBY A;  4P5O A;  1TWF J;  1O7L A;  1LEA A;  2HPI A;  2WBM A;  2DMP A;  2WB1 N;  1QVU A;  3ASN H;  1HF0 A;  3HRM A;  3RDI A;  3S15 J;  3F23 A;  2ME0 A;  5CQE A;  4A0X A;  1R4N B;  1FIA A;  3S2D J;  3GWZ A;  3SDG A;  3RYR A;  4ZH4 F;  2STW A;  1SD4 A;  2VB6 A;  3KET A;  1W0T A;  3WTX C;  1YO5 C;  2A6H F;  3CCS I;  1ETV A;  1SMY F;  2FSW A;  4P9F A;  4M9S A;  3JRC A;  3CD6 I;  3CCJ I;  2MW8 A;  4C9Y A;  1FMW A;  2BHZ A;  9ANT A;  2QQ9 A;  2M5W A;  5EZH A;  4ESJ A;  5DTD A;  2VOO A;  2OAZ A;  4KUM A;  3U1K A;  2KRF A;  5DM7 F;  4LG0 B;  2M2E A;  2LKX A;  1ETW A;  4IHY A;  1BN5 A;  2ZSI B;  1YJ9 I;  5GTI C;  1GXQ A;  2IEK A;  2KT0 A;  2LMD A;  5LEK A;  1W4M A;  2EIM H;  3WTT C;  1ZRC A;  1LKX A;  4FCY A;  2VQC A;  3KP6 A;  3HRS A;  5L3E A;  2VQH A;  1PP7 U;  4BXX J;  3D1N I;  4XK4 A;  3OOU A;  4NUB A;  2NNN A;  4FET A;  4GGG A;  3IL2 A;  1LQ1 A;  3KZY A;  5F1R A;  2XB0 X;  1Z7U A;  3OYE A;  5IPA A;  3CUQ A;  3WTS C;  2NVT J;  1R71 A;  1GV5 A;  3FIS A;  1KQ9 A;  4JK1 X;  4C3H J;  1S7O A;  3EUK L;  4L18 B;  2BBY A;  2M4G A;  2LBF B;  3RI4 A;  1OMI A;  2CQQ A;  2ID3 A;  2OD5 A;  4L5E A;  5D5X B;  4E7K A;  3K70 C;  1D5V A;  2X0L A;  2F5F A;  3OYH A;  2GQQ A;  4XOR A;  2FOK A;  5F1J A;  3ZCO A;  4G7H F;  2LK2 A;  1RUN A;  2ISZ A;  4UUS A;  3M7G A;  5TIS C;  4BUP A;  1RKW A;  1DDN A;  1DPR A;  2WB1 A;  1RI7 A;  3M4O J;  5CJ9 A;  3F8N A;  2DA6 A;  2GOM A;  2HR3 A;  4S04 A;  4FE4 A;  4XN0 A;  4QLC U;  1K61 A;  1E3O C;  4N4O B;  3OYD A;  4LK1 F;  3ZQF A;  4NNJ A;  4D7N A;  3MKZ A;  1S72 I;  4R8H A;  3KFW X;  2KIQ A;  3OIO A;  5KNL A;  4ZDO A;  4NDL A;  5EDN A;  2CQN A;  3IV5 A;  2XRO A;  1LJ9 A;  3W2V A;  1J09 A;  2K4B A;  3ESW B;  1UJ8 A;  1SD5 A;  5LHI A;  1ZR2 A;  2X4H A;  4GCV A;  2GZW A;  5D8K B;  4BNC A;  1OCO H;  5IOY A;  3ERE D;  1YIT I;  2JPC A;  5E3O A;  1OIS A;  1X2M A;  2E2I J;  2AS5 F;  2A07 F;  3OS1 A;  1ZTR A;  5FJ8 J;  2OTL I;  5D6F A;  1HW1 A;  4LOC A;  4A3E J;  1BIB A;  2G7H A;  3AG3 H;  1NK2 P;  3JR9 A;  4KNY A;  3I4N J;  1YW7 A;  2XAJ A;  4K2E A;  3G2B A;  3PQK A;  3KP2 A;  5CVV A;  5D5U B;  2E1C A;  3ZQQ A;  2DT6 A;  3D0S A;  1OYW A;  1FP2 A;  1NK3 P;  3FXJ A;  1SD7 A;  3V4G A;  3FKJ A;  1WH5 A;  1ZEL A;  1IRZ A;  2Y75 A;  2HI3 A;  4O3M A;  1FBS A;  4YEL A;  4BY1 J;  3TP0 A;  2WAF A;  4XN3 A;  5CQG A;  3KZZ A;  5EF6 A;  2RV8 A;  1ETY A;  2JA6 J;  2ID6 A;  3S2H J;  3I59 A;  2IRF G;  2PJR A;  2W1O A;  2KRH A;  2XAH A;  2A5Y B;  2STT A;  5E1Z B;  4E7L A;  1FYM A;  4AVP A;  1OFC X;  1X4P A;  5M3M J;  3QRF F;  3L2R A;  2RGV A;  1A6Q A;  5F6F A;  2VKV A;  3HOV J;  3H0G J;  2O6G E;  1APL C;  2E35 A;  3HPG A;  3QU6 A;  1Z05 A;  1I6H J;  3V8J A;  2QSH X;  4IRH A;  3B02 A;  4XR6 A;  1T2K A;  3GO5 A;  2QKL B;  2JJ7 A;  5JHF A;  4IRI A;  2O3F A;  1XGO A;  2CG4 A;  1H9T A;  2QVO A;  3IAM 2;  5F0F A;  1MJ9 A;  2XGC A;  2EA2 A;  1W7P B;  4KN4 X;  3H1C A;  4XSX F;  5K7H A;  3AKZ A;  1FOX A;  4MGR A;  1DP3 A;  3QAH A;  3A01 B;  2XHK A;  2VLA A;  2K02 A;  4CIC A;  4A3K J;  1Z0X A;  2CGP A;  1VQ6 I;  3DXJ F;  3RIR A;  1K78 B;  3DTK A;  2KJC A;  1ZGA A;  4HA8 A;  3ULQ B;  3S2W A;  2M7B A;  3KPH A;  4DGW B;  1VQM I;  1TWA J;  1T0F C;  4FAS D;  4I0A A;  5D4R A;  2BVM A;  3BG6 A;  3LL7 A;  3LSM A;  3HDD A;  2DOF A;  2L54 A;  1RET A;  1S8N A;  1EH8 A;  2D1V A;  5K7F A;  2R0Q C;  1RPW A;  5DUI A;  2QSG X;  5CVJ A;  3SFI A;  4BE0 A;  1U78 A;  3J7A Y;  1TQM A;  4LB6 B;  3I71 A;  4LIU A;  5E8I A;  3CME I;  1P4X A;  2A5W A;  2JMW A;  2BOL A;  2LY9 A;  2MBF A;  1B6A A;  2ACJ A;  5JVT A;  3ZOB A;  3CMA I;  1IW7 F;  3A02 A;  3CMM A;  4XLA A;  1SFU A;  1BC7 C;  3F6V A;  1XG1 A;  2WV1 A;  3I9V 2;  1F43 A;  1IN5 A;  3T8T A;  4JX5 A;  3VFZ A;  3EUA A;  1R23 A;  3HRT A;  3KP4 A;  2GA2 A;  1DUX C;  2LYC A;  5HS9 A;  3LMM A;  4XKW A;  2D45 A;  1H89 C;  4Y52 J;  1D0Z A;  2JVH A;  2Q2E A;  1JHF A;  5B66 C;  3F8M A;  4JBA A;  1IRX A;  2HTS A;  5F04 A;  4X0G A;  5JHU A;  3FX3 A;  2XF5 A;  2KZV A;  4I01 A;  3ZMU A;  2K5C A;  3FBN B;  3Q9V A;  2M3A A;  1Z91 A;  3JTG A;  5IY5 H;  5CVU A;  4R79 A;  2QEN A;  3S3N A;  2HQR A;  2NNY A;  3A2K A;  2H1L A;  4G6Q A;  4PJN A;  1K83 J;  3SEQ A;  4RB3 C;  2VJI A;  3FXO A;  3E5Q A;  3K4K A;  1WJE A;  4DYC A;  2LVS A;  1CF7 B;  4EVI A;  2B9S A;  1X2N A;  2VI6 A;  4CCO A;  4HW0 A;  2ZC2 A;  3GZ5 A;  3OYI A;  2FBI A;  4XRS A;  2PX9 A;  1I5Z A;  4HF0 A;  4NBQ A;  2IAI A;  2CS3 A;  3RZD J;  4IXA A;  3QPT A;  3PUB A;  1UHS A;  3QOP A;  4B48 A;  3HOT A;  1HSJ A;  1SAU A;  1WWX A;  5LRR A;  1G8X A;  3TO6 A;  2FBK A;  1J0R A;  2KMU A;  3KLO A;  1NHA A;  1OQY A;  1NH3 A;  4UVA A;  2K7L A;  2R7Q A;  1YW8 A;  4MFD A;  5ICG A;  2ZB9 A;  1DU6 A;  3KZI C;  3QU3 A;  3VOD A;  5EGO A;  2DO7 A;  2EZH A;  3BQY A;  2RRE A;  4CYC B;  3J7Y J;  1G3S A;  1X3U A;  2Y30 A;  1RNL A;  2CUF A;  1UG0 A;  3F8B A;  2KL4 A;  1MH4 A;  2MA3 A;  2OV7 A;  2F48 A;  2P5V A;  5CVI A;  4A93 J;  2LY2 A;  2KKO A;  4BYY A;  1MKM A;  1LE8 A;  3H3U A;  5CVR A;  2JWT A;  2YPR A;  4X6A J;  5DDG A;  4E7I A;  4IJA A;  5J3L A;  4PGH A;  2GIZ A;  3DLL F;  1TWH J;  4M71 A;  1YRN A;  1R9T J;  3Q0V A;  1Y0N A;  4BBS J;  4DZJ A;  4C3J J;  2H8R A;  3H5A A;  1Y0U A;  5FKL A;  1X1C A;  4I76 A;  4EJU A;  1IUY A;  1IXC A;  4H0E A;  3CMY A;  4B8X A;  3LSK A;  2PMH A;  2ELK A;  4B44 A;  1B8I A;  3KX2 A;  3O3K A;  2AQF A;  5IT9 Z;  2MC3 A;  1XSV A;  4L9V A;  5B1B H;  5LGT A;  2R4G A;  2HU9 A;  1ZRF A;  2HVS A;  2K3P A;  4Y4R A;  2OBP A;  5EEG A;  1W0U A;  1NG7 A;  5F0C A;  1JI8 A;  4F52 A;  1LVK A;  3EPZ A;  2BVL A;  5H20 A;  4HF2 A;  3MN2 A;  2EFW A;  1YG2 A;  3ERM A;  5GTH C;  4BHP A;  3OYA A;  3HOX J;  1HLV A;  2R7V A;  5FLX K;  4R1H A;  2FQ3 A;  4ZYE A;  1IZ1 A;  1KQ0 A;  2FD5 A;  3T0Y A;  1V55 H;  4ABZ A;  1J7K A;  2E34 A;  5E3L A;  3PIO F;  4PJJ A;  1PJR A;  2RAE A;  5HLT A;  4IHW A;  3GXO A;  2K86 A;  2VXZ A;  3SZP A;  2L5Q A;  1FSH A;  4BAC A;  2COB A;  3SYT A;  3PUF A;  2COM A;  2DTR A;  4HLX A;  5HDN A;  2KIU A;  4M72 A;  3S17 J;  4U87 A;  1VQ5 I;  4PUS A;  5J4V A;  4F92 B;  1ZAO A;  1MMA A;  2L2O A;  3FXK A;  5M3F J;  2JA5 J;  1FOW A;  1Z77 A;  2EV0 A;  1O7F A;  1UFM A;  3GF2 A;  3RSN A;  4ZDP A;  1X3Z B;  3MMY B;  4IZZ A;  1Z9C A;  3WE2 A;  3RKX A;  3T1B A;  5L3B A;  4DOZ A;  5CYV A;  2HOS A;  1ZKG A;  2M87 A;  3CP8 A;  2ZXJ A;  3PIP F;  3WU2 C;  3HUG A;  1I50 J;  2IXS A;  2EZI A;  3GTP J;  3CCU I;  3OL3 A;  3ZQC A;  4MO7 A;  3BDD A;  4I99 C;  2Z2S B;  3DFG A;  2RVC A;  1VZ0 A;  3K4C A;  5FKM A;  4DQ2 A;  1XMA A;  3C3W A;  1TP4 A;  1QZE A;  2ZCW A;  5J1Y A;  1RC9 A;  3MFK A;  1RES A;  1E3H A;  1FPQ A;  4UUT A;  3TO7 A;  3H92 A;  2TRT A;  2CUZ A;  1BC8 C;  3DCF A;  1G3T A;  3DPT A;  3CCQ I;  2NVQ J;  4PFO A;  1MBE A;  5LBQ A;  5BMZ A;  3HM5 A;  4Y17 A;  1DPU A;  2P5L C;  3RPU A;  5KHD A;  4ZJZ A;  5FD5 A;  3E6B A;  3FK6 A;  1S9H A;  2M45 A;  3CUO A;  1H8A C;  5HDK A;  3H9Q A;  1KU9 A;  2Y0S N;  1O3Q A;  2VPL A;  1ONV A;  3GFL A;  2HVR A;  2VOP A;  1U8R A;  6PAX A;  3REO A;  3RKW A;  3GTQ J;  3J7Z I;  2QLZ A;  3B73 A;  4AIK A;  4C2T A;  3PSF A;  4HNV A;  3RYP A;  2RQQ A;  1BW5 A;  4BXU A;  3OR1 C;  2BW3 B;  4CXF A;  1STZ A;  4FIS A;  2VPR A;  3PO2 J;  1ZLK A;  5F64 A;  5IP6 A;  1TNS A;  3F6O A;  5DCM B;  3RKY A;  3H36 A;  2OQG A;  3HTU A;  2M7A A;  3ZQ7 A;  2ZXW H;  4CYD A;  3BJ6 A;  2L7M P;  1ENH A;  3BOQ A;  4JP0 A;  1WJA A;  2VL8 A;  2P8T A;  2L9R A;  3FZV A;  5D4S A;  2F5V A;  4D9J A;  4RB1 A;  1DGR M;  1ULY A;  3OYL A;  2VAS A;  3K0L A;  4EGY A;  3S1R J;  5A2Q K;  1JXS A;  1IDY A;  2KIF A;  1F1Z A;  3K1M A;  4CZC A;  2KZG A;  3AG4 H;  1FZP B;  5J1U A;  1MNM C;  2O7O A;  5FB2 A;  4IHT A;  1B72 B;  1MBK A;  1FC3 A;  3COA C;  1ZGW A;  3S1N J;  2H8W A;  4B3A A;  4EEF G;  4BKX A;  1OCC H;  5IP9 J;  2DA3 A;  2IBD A;  1IUF A;  3T8R A;  4V19 K;  1Y1V J;  1DP7 P;  5K5O A;  3HYI A;  3BTL A;  2DU9 A;  5KAF C;  4OIN F;  4E7J A;  3O2P E;  2UZK A;  3HEF A;  3G3Z A;  3DU6 A;  2OTJ I;  3RQ4 A;  4WF2 A;  2HGC A;  3FKI J;  2LP0 A;  4XON A;  5FFX A;  3VSK A;  3W6K B;  5ICE A;  1UCR A;  2EIN H;  3KIO A;  5HDG A;  4E7Z A;  4I09 A;  4QWQ A;  2PN6 A;  4OMZ A;  1SFO J;  1Z3X A;  1FY7 A;  1EKE A;  2DFF A;  2DMU A;  4XLH A;  3G1O A;  1CQT A;  3Q3S A;  2OCE A;  2VBW A;  3B6A A;  4G7O F;  2ZNY A;  2A61 A;  2L7F P;  1D5Y A;  4M73 A;  4PJL A;  3WHC A;  1D0X A;  1EF4 A;  2HDW A;  4UV8 A;  4J00 A;  3DBH B;  3WTW C;  3S16 J;  2BGC A;  4QIW N;  3NWT A;  5GAE J;  4HAM A;  2QKM B;  2LG4 A;  5HNH A;  5EJC A;  3CCE I;  4Y13 A;  5DYM A;  2LF7 A;  3JRH A;  3D5R C;  2CFO A;  2NAZ A;  4BEH B;  2BE5 F;  1VQ9 I;  1IXS B;  2V1U A;  2OF7 A;  1HDP A;  3HGY A;  5K7Z A;  5D8L B;  2M34 A;  2V26 A;  1RKT A;  2V7F A;  3EDP A;  3NRV A;  4PSX A;  2FOW A;  1ZG1 A;  2E2H J;  3ZMZ A;  3ZMD A;  3CLQ A;  2JRT A;  2IS6 A;  3I4P A;  4BL0 B;  2LFB A;  1HDD C;  1MD0 A;  4DZP A;  2H6C A;  2MC4 A;  1KA8 A;  3KLN A;  3WG7 H;  2DTZ A;  4LFU A;  4CDG A;  4OIQ F;  3E97 A;  3OYN A;  3F9K A;  1Z67 A;  3L2U A;  5J40 A;  3JSO A;  1M1E B;  3M8J A;  1R49 A;  1PUF B;  3LSR A;  3HKZ A;  4HRI A;  3NEU A;  2V4J C;  2HXO A;  2W84 A;  5TJJ A;  2QBY B;  2WV0 A;  5FGM A;  4G12 A;  1OR7 C;  1RR8 C;  5ED4 A;  1LB2 A;  1E17 A;  5IOZ A;  1QPM A;  1Y39 A;  1AKH A;  4IKF A;  2L9S A;  3VSL A;  2DMN A;  2YS9 A;  5DS9 A;  1FLI A;  3CJN A;  4ZYD A;  4XRF A;  1YIO A;  2XDV A;  3DTE A;  1G4D A;  4B3X A;  3X2Q H;  2QZ8 A;  4UVB A;  3TW7 A;  4AD9 A;  4OAZ A;  4E7S A;  3F0C A;  1G3Y A;  3GFJ A;  2ECB A;  2JVG A;  4EM0 B;  2B63 J;  1WRJ A;  4MHG A;  3GLX A;  3CQZ J;  4HF1 A;  2A05 A;  5BPD A;  1JJ8 C;  3PM1 A;  1IN8 A;  2Y48 A;  3OWT A;  1JUP A;  2EZK A;  1JTY A;  3MQ0 A;  3DTI A;  2DW4 A;  3HB9 A;  3E6C C;  5DV5 A;  3OS2 A;  2O03 A;  3H5R A;  5HVQ C;  4C30 A;  2PLY A;  3ELK A;  4CCK A;  5BS6 A;  5AIP A;  2VQL A;  2CO5 A;  1O57 A;  1PDN C;  1QA6 A;  2W00 A;  4W97 A;  4KA4 A;  1SEU A;  5LD2 C;  2XUB A;  2XB5 A;  1RR7 A;  2HDC A;  2LLK A;  2VT2 A;  1DU0 A;  1L0O C;  4G6T B;  3BZ6 A;  3OYM A;  2X1E A;  4I2O A;  4FQG A;  1ORK A;  3HL2 A;  3MKY B;  1VTN C;  1CF7 A;  3I3L A;  1L3L A;  1UG2 A;  1VND A;  1MBJ A;  1IV8 A;  1YS6 A;  2LDU A;  2QF7 A;  1KGS A;  3K4N A;  4DYQ A;  5FLV A;  1TWC J;  2DA2 A;  2F4O B;  1UHW A;  2MLK A;  4P9U A;  3ZXS A;  2F6C A;  4ENM A;  4NQW B;  1X1D A;  4U0W A;  4NB5 A;  4M3D A;  3O6B B;  2XPU A;  1BR2 A;  5GPA A;  4A5N A;  4CH7 A;  1XGM A;  1MIJ A;  3HSE A;  3UKG A;  1ZK8 A;  2LY1 A;  4OAY A;  5GP9 A;  2EIL H;  5E3M A;  4HZF A;  3H3V K;  3V7C A;  5GAG J;  1WJ5 A;  3GUD A;  4EMS A;  3L1P A;  4CYC A;  5ICF A;  3C7J A;  5B5E C;  1HA8 A;  1FNN A;  3L9F A;  4WWC A;  2HXI A;  4YIR X;  3OYK A;  2LH9 A;  1BW6 A;  1K4S A;  1SVL A;  4ITV A;  1ERD A;  2XKP A;  4D5F A;  3HPH A;  4BBR J;  4DW6 A;  2HYG D;  3QYB A;  5DD8 A;  3IRR A;  2L7K A;  4Y33 A;  5JI6 A;  2QSF X;  1VFC A;  1IV6 A;  2DYS H;  2DI3 A;  3D5L A;  2CMP A;  5EG0 B;  3QYF A;  5JVG F;  2QCO A;  2XGE A;  1FOY A;  4UY8 I;  2EFQ A;  3L00 A;  3I56 I;  2XGX A;  1QHH D;  5C4X J;  3OYF A;  3L2W A;  1R1V A;  1JKP C;  3K2Z A;  3T5X A;  4A3L J;  1GLN A;  4IRG A;  2EFN A;  4GDF A;  1IO2 A;  1EH6 A;  1R00 A;  3CC7 I;  2CV0 A;  2ZKZ A;  1WI3 A;  4XLP F;  1ZLJ A;  2MSY A;  3N4M A;  1FBQ A;  2E7X A;  3HZJ A;  4EM2 A;  2YX4 A;  1I27 A;  4CA0 A;  3C2B A;  4AUX A;  4FTH A;  3KEO A;  1R1T A;  2GM4 A;  2Z5U A;  2UXX A;  4N4N B;  1T0F A;  4A3C J;  1WFX A;  4A5M A;  2VKH A;  3U2R A;  2M8G X;  4OIP F;  1BI1 A;  2RNG A;  4XM3 A;  1TZL A;  4A0Z A;  3FMR A;  4I0B A;  3IKV A;  2EH3 A;  4IF4 A;  3AG2 H;  5GAH J;  5JLW A;  3GX4 X;  1QQI A;  2KIM A;  1EJ9 A;  2R7X A;  5FLX Z;  1T98 A;  3H9G A;  1MJB A;  2DOE A;  2QGU A;  3DEU A;  1MBH A;  3ABM H;  4BQO A;  1FT9 A;  3F72 A;  3LSG A;  4FT8 A;  3WOD F;  1WH7 A;  2BHY A;  2EFP A;  4S05 A;  1JT0 A;  4P1W A;  1ETK A;  1JKO C;  2OZU A;  2JUG A;  2DCE A;  2PFB A;  4XLF A;  1KYW A;  2VBZ A;  2A3S A;  3NAU A;  4RLQ A;  3AAF A;  4D7M A;  2BXZ A;  2ECC A;  1I6X A;  2EK5 A;  3HOU J;  2EBI A;  5HOO A;  2CW7 A;  2KRC A;  5K5Q A;  1ZR4 A;  2AHQ A;  2EIK H;  2YR2 A;  4MQV A;  2E36 A;  3ONQ A;  1X4O A;  1POG A;  1FBU A;  5ERI A;  4ENJ A;  4RLF A;  3VOE A;  5TGT A;  4BU2 A;  1K6O A;  3W2A A;  2PI0 A;  3LA7 A;  4NC7 A;  2W7N A;  2VJ4 A;  3ZR8 X;  2X85 A;  4V2F A;  5DD4 A;  3RQI A;  2R5Z B;  3ZRG A;  2IA1 A;  3LSP A;  3PNY A;  4BJ6 C;  4L5J A;  5M5W J;  4RGS A;  1X19 A;  3TMO A;  2LSO A;  4F55 A;  1MZB A;  4RAF A;  3SXY A;  1J2X A;  3BTJ A;  2CH0 A;  3CZ6 A;  1XSX A;  3EUH A;  1FX7 A;  2NVY J;  2VC1 A;  1YLF A;  4KIS A;  3MVP A;  3DEW A;  3IUO A;  2DPD A;  1MNE A;  3L2V A;  4A0Y A;  1MDM B;  1ETX A;  2ME6 A;  4QTR A;  2R5Y B;  3CCV I;  1SFE A;  5LHG A;  2ELH A;  2IA2 A;  3HXL A;  1LFU P;  1J59 A;  2CU7 A;  2EIJ H;  1DGW Y;  1TQI A;  3ABU A;  5LEJ A;  1LEB A;  1ACI A;  2HQ5 A;  1XS9 A;  1IN7 A;  4DBQ A;  1T8I A;  4FX4 A;  4M3F A;  1TQP A;  5J8C A;  4ASN A;  3CJT B;  3A03 A;  4NC6 A;  2BW3 A;  5E20 A;  4UB8 C;  2EV6 A;  5F0H A;  4LIT A;  5AON A;  1YJN I;  2MYS A;  5DCM A;  2HYF A;  3A0H C;  2CRG A;  2V6C A;  3GTJ J;  3SZT A;  5H6Q A;  1LFB A;  2E60 A;  3EUH C;  2EJR A;  3MZY A;  1R5I D;  1B1B A;  3CUQ B;  3DKX A;  5BNG A;  5C3E J;  1TBX A;  4CZZ A;  3BG5 A;  3P9I A;  3J80 K;  1VQP I;  1O3R A;  2L02 A;  1P6R A;  3GTG J;  1B9M A;  2CV2 A;  2MD5 A;  3M9A A;  3R60 A;  2K40 A;  2V9P A;  3JAM K;  3E0J B;  3KCC A;  2EQR A;  5KVR A;  1F9N A;  1YX5 A;  3BR1 A;  4UUS B;  1BA5 A;  3I5U A;  2OU2 A;  1YOV B;  1YE9 A;  4P96 A;  4UB6 C;  4OIR F;  5A2Q Z;  5C44 J;  3C18 A;  3BR2 A;  5HS8 A;  2IP2 A;  2G9W A;  3N05 A;  3ECH A;  1P2F A;  2AXT C;  4TV7 A;  3L2Q A;  4A3I J;  1OLT A;  3WU0 A;  5KAI C;  5CPR B;  4LGW A;  2MLG A;  2HVQ A;  3BWG A;  4A12 A;  4IL6 C;  1YX3 A;  2DFH A;  1E2X A;  3CO7 C;  2WC2 A;  2L3D A;  3Q5F A;  3TDU C;  2E1M B;  3PQJ A;  2GXB A;  3UNG C;  1S6L A;  2RKH A;  1QRY A;  1D1B A;  2GLO A;  4Q4Z F;  3ZQL A;  3O8G A;  5AIQ A;  1WGX A;  3G4S I;  2CW8 A;  2M0C A;  3VPR A;  4C2U A;  2P6T A;  3E6D A;  4HDV A;  4IQJ A;  2DAO A;  3TOB A;  2XC7 A;  4IEJ A;  4M6V A;  1LFP A;  1WPK A;  3PNT A;  1A6I A;  1R5G A;  4ZZL A;  4HPQ A;  2ZJQ F;  4CO8 A;  4PJ0 C;  4EJW A;  5L3D A;  1IJW C;  2VJJ A;  3MCZ A;  4GXO A;  4M3B A;  1QNT A;  3M07 A;  2KDO A;  1HBX G;  1X3W B;  2TDX A;  2JSC A;  3FXQ A;  5EEH A;  2DDB A;  4IQ4 A;  4A69 C;  4BQN A;  3WGI A;  1Q1V A;  1R36 A;  1A04 A;  4LIV A;  1JTX A;  2ZBK A;  4XMY A;  1P4W A;  5J8F A;  1RUO A;  1S5L C;  1FIP A;  3W2W A;  4A3D J;  4ON0 A;  2GBY A;  1ZG3 A;  2ADU A;  1ZH5 A;  4BEH A;  1MJA A;  1UEL B;  2XRN A;  5CKT A;  3P9K A;  2QM3 A;  1LPQ A;  2P4W A;  1TNT A;  4LG3 A;  3S93 A;  2BY2 A;  1MMD A;  2N8G A;  4F7Z A;  3HSR A;  3ABL H;  2NOJ B;  1T6S A;  2V9V A;  1OJL A;  4WK8 F;  3K4B A;  2O8K A;  1H88 C;  2NS7 A;  2P6S A;  4EM1 A;  1V3F A;  2VT3 A;  3LQQ A;  4M6Y A;  3SDB A;  1LUJ B;  4C2M J;  4DJA A;  1D1A A;  2PJR B;  2V79 A;  4KDP A;  4PDK A;  1LNW A;  1LVA A;  2JN6 A;  2EFO A;  3PNV A;  3DQV C;  1PUF A;  2R7T A;  2XAG A;  1ZHF A;  4GYI A;  5LGU A;  5D5V B;  3FDY A;  1B9N A;  2QBY A;  2ETH A;  4X1E A;  3M1C A;  5E1X A;  3WG9 A;  1IRF A;  2H1K A;  2V1D A;  1DQU A;  1O3S A;  3A1Y A;  4KMU X;  4PK4 A;  3HHG A;  2DA7 A;  2R7Z J;  5L3F A;  2H27 A;  2JA7 J;  1BR1 A;  1JUM A;  2E19 A;  4IOC F;  1VQ4 I;  3TQN A;  1XMX A;  3JW4 A;  5FKN A;  1GXP A;  3AL0 C;  4GYG A;  4XKC A;  1QU3 A;  3RPU D;  2KPM A;  4Q48 A;  4A6D A;  4PGG A;  4AID A;  4U0Y A;  3FHN A;  1EH7 A;  4PZJ A;  5KK1 A;  2K4J A;  2Z16 A;  3BY6 A;  4BQA A;  1J9I A;  1IXR C;  2ELJ A;  1GVD A;  3C2H A;  2WA0 A;  2PQ8 A;  2FQ4 A;  4HYE A;  3PFY A;  1XCB A;  3OMY A;  4LB5 A;  4IX7 A;  3CCM I;  1K4T A;  3NAR A;  3NQO A;  4ZYH A;  1TC3 C;  1AU7 A;  1B59 A;  4ETS A;  2W24 A;  5LFA A;  2F2E A;  2K3F A;  3TBI A;  1R22 A;  2F5D A;  4LG0 A;  3R6S A;  2K27 A;  4L0Y B;  1ETQ A;  2X6X A;  4YIF A;  4EGZ A;  1W36 D;  2QWW A;  1JGS A;  2X9D A;  3E5U A;  5J6X A;  1FOK A;  1FMV A;  3FM5 A;  3CF5 F;  1T95 A;  3BJO A;  2VOD A;  5TRD A;  2LC2 A;  3QWL A;  2ICW G;  4KIB A;  2JSP A;  3MAJ A;  2VE9 A;  3VYS B;  4L5I A;  3BZK A;  3WE3 A;  3W6J B;  1XMK A;  1MMN A;  3PJR A;  5ICC A;  2DN0 A;  1XD7 A;  3R0J A;  2DA4 A;  4HEA 2;  3OYC A;  2Q2E B;  4E7H A;  2GOX B;  2DFI A;  2EWN A;  3FMQ A;  2LBF A;  2Y9Y A;  3ISP A;  5B1A H;  1VQ7 I;  3PO3 J;  2G0E A;  1OCZ H;  1V5E A;  2F5E A;  3BJA A;  3GTO J;  1A31 A;  3L09 A;  4BAY A;  3FXU A;  3J81 Z;  3LAJ A;  1ZRD A;  2NRA C;  1HW2 A;  1Z1D A;  3QQA A;  2HYJ A;  1O3T A;  5HLG A;  2UV1 A;  3QYE A;  4EAT A;  2UWM A;  4FE7 A;  2D1H A;  2XVC A;  2QEX I;  1XN7 A;  3V7S A;  3ZPL A;  1I1S A;  2OPT A;  4ENK A;  4G6D A;  2W4S A;  3IWZ A;  2O61 A;  2VJ5 A;  3GCM A;  1XCV A;  2LF8 A;  1QZZ A;  4NQW A;  2OZ6 A;  4XQF A;  4MTD A;  2FF4 A;  4A6E A;  4RAZ A;  1IGN A;  1IDZ A;  3BG7 A;  3ZQH A;  1U5T B;  3JRB A;  1Y8R B;  4YEJ A;  3GYH X;  1BIA A;  3HGG A;  2D2W A;  2XAU A; 
#chains in the Genus database with same CATH homology
 1WCM J;  3A01 B;  3HB9 A;  4A3K J;  1Z0X A;  2K9N A;  3HOZ J;  1TWA J;  3HDD A;  3JRF A;  4RDU A;  4W97 A;  1RET A;  2XB5 A;  5EGO B;  5K7F A;  2R0Q C;  1RR7 A;  3FK7 A;  1RPW A;  3QPL A;  2DMT A;  2LLK A;  1DU0 A;  3SFI A;  1U78 A;  4XRS G;  2MG4 A;  2VKE A;  3IH3 A;  5FKK A;  1ORK A;  2HOT A;  1UG2 A;  3TED A;  2JMW A;  2LY9 A;  1VND A;  1MBJ A;  2LTP A;  5EG0 A;  1GT0 C;  2QF7 A;  3GTL J;  4DYQ A;  5FLV A;  1TWC J;  1VF9 A;  2DA2 A;  3ZOB A;  3A02 A;  3GTM J;  1XG1 A;  2KDZ A;  2WV1 A;  4MLO A;  1F43 A;  4M3D A;  2R92 J;  4JX5 A;  4JYK A;  2XPU A;  2HOA A;  5GPA A;  3UKG A;  1ZK8 A;  3BG3 A;  4Y52 J;  1H89 C;  3OSF A;  2FJ1 A;  1MSE C;  1P7J A;  2O9L A;  5GP9 A;  4IHX A;  5E3M A;  4AYB N;  3BTC A;  3H3V K;  5F04 A;  1HOM A;  3L1P A;  2NVX J;  4CYC A;  4C3I J;  3BR6 A;  2HXI A;  1BW6 A;  5IYC J;  3QPS A;  4D5F A;  4V2G A;  4BBR J;  2K9Q A;  4DW6 A;  2Y2Z A;  1K83 J;  2EZL A;  3K2A A;  4DYC A;  3O8H A;  2LVS A;  1VFC A;  1U9O A;  1X2N A;  1SAN A;  2VI6 A;  1IV6 A;  4M3G A;  5EG0 B;  4XRS A;  2QCO A;  2XGE A;  3A01 A;  2IAI A;  3RZD J;  4XID A;  1QVT A;  3HOY J;  1UHS A;  5C4X J;  1JKP C;  3JRD A;  1QPI A;  4A3L J;  2DJN A;  1X58 A;  4IHV A;  3BR5 A;  3I4M J;  1WI3 A;  1UMQ A;  3M3Y J;  2FX0 A;  4MFD A;  2MSY A;  2ZB9 A;  1DU6 A;  4S0H B;  5EGO A;  3ZQG A;  3C2B A;  4AUX A;  4FTH A;  2EZH A;  2GM4 A;  3BQY A;  4A3C J;  4CYC B;  2PMZ N;  1IC8 A;  2M8G X;  3BG9 A;  2Y30 A;  2CUF A;  1MH4 A;  4A93 J;  2EH3 A;  5JLW A;  1ETO A;  1TWG J;  3IH4 A;  5F27 A;  2P81 A;  4W1U A;  1LE8 A;  2JWT A;  4X6A J;  1MBH A;  2JK3 A;  2YUS A;  5J3L A;  2JA8 J;  5IYB J;  3LSG A;  1TWH J;  1GV2 A;  4A3F J;  1YRN A;  1R9T J;  3Q0V A;  5JLX A;  1WH7 A;  4BBS J;  4DZJ A;  4C3J J;  2H8R A;  5FKL A;  3B6C A;  4I76 A;  1JT0 A;  4A3M J;  3CMY A;  1BJZ A;  1ETK A;  3Q0U A;  1JKO C;  2R5Y A;  2ELK A;  1B8I A;  1FTT A;  2DA1 A;  1FTZ A;  3NAU A;  3RZO J;  4D7M A;  4D5C A;  3IH2 A;  2ECC A;  3HOU J;  3BR0 A;  1A5J A;  2R93 J;  3S14 J;  2EBI A;  1W0U A;  3GTK J;  1ZR4 A;  3MKL A;  5F0C A;  2AHQ A;  2D5V A;  3RKQ A;  1T56 A;  1POG A;  3MN2 A;  3JRE A;  4XRM A;  3LNQ A;  3HOW J;  3HOX J;  1HLV A;  2X6O A;  5E3N A;  1HCR A;  5IYD J;  1Y1W J;  5EZG A;  2XGD A;  4V2F A;  3RQI A;  2FD5 A;  4ABZ A;  2W48 A;  2XPW A;  2R5Z B;  3LSP A;  5E3L A;  5M5W J;  1LE8 B;  2RAE A;  2XPV A;  3BTJ A;  4RBO A;  1ITY A;  4IHW A;  3LOC A;  1YRN B;  3HKZ N;  2NVY J;  2LD5 A;  3MVP A;  2XSD C;  3DEW A;  3WHB A;  2COB A;  4Y7N J;  4QSH A;  1ETX A;  2ME6 A;  4QTR A;  2R5Y B;  3BR3 A;  1B8I B;  5HOD A;  3CDL A;  5EEA A;  3S17 J;  2I10 A;  3Q0W A;  2VUM J;  4B1R A;  5M3F J;  1LFU P;  2JA5 J;  2CU7 A;  1Z77 A;  2HQ5 A;  2XRL A;  1XS9 A;  1JKQ C;  1OCT C;  4M3F A;  1G2H A;  2HOS A;  4A3B J;  1GUU A;  1ZKG A;  1JUS A;  3A03 A;  1BL0 A;  4A3G J;  5F0H A;  1I50 J;  2EZI A;  3GTP J;  2CRG A;  3TW6 A;  4BY7 J;  3ZQC A;  2E1O A;  1T33 A;  3GTJ J;  4MO7 A;  3W6V A;  1LFB A;  2X48 A;  2CQX A;  5FKM A;  2CUE A;  1IG7 A;  5BNG A;  5C3E J;  5J1Y A;  3BG5 A;  1MBG A;  1RES A;  4UUT A;  2TRT A;  3CCY A;  3GTG J;  3DCF A;  1ZQ3 P;  1I3Q J;  2Y31 A;  4B4C A;  2NVQ J;  3LSJ A;  4J19 A;  2K40 A;  1MBE A;  2EQR A;  3E7L A;  2Y9Z A;  3BR1 A;  2K9S A;  4GFB A;  1VI0 A;  4UUS B;  5M5X J;  3HM5 A;  1NTC A;  1BA5 A;  4M3E A;  3TP3 A;  3JRA A;  4I6Z A;  2WAQ N;  5C44 J;  1FEX A;  3FK6 A;  1JT6 A;  1H8A C;  3BR2 A;  4A3I J;  2Y0S N;  1XC5 A;  1JKR C;  3GTQ J;  2YU9 J;  2DA5 A;  4JX4 A;  4MIM A;  4HNV A;  2R5Z A;  3GBG A;  5FLM J;  1O4X A;  1BW5 A;  4FIS A;  2VPR A;  3PO2 J;  2M9H A;  5IP6 A;  1QRY A;  2GLO A;  1TWF J;  3ZQL A;  3O8G A;  2DMP A;  2WB1 N;  1QVU A;  1HF0 A;  1WGX A;  3S15 J;  2M0C A;  2ME0 A;  1FJL A;  3ZQI A;  2L7M P;  1ENH A;  1FIA A;  3VPR A;  3S2D J;  3SDG A;  4JP0 A;  2TCT A;  3JRI A;  4A3J J;  1W0T A;  2L9R A;  3K7A J;  4IEJ A;  1WPK A;  4M6V A;  1A6I A;  3JRG A;  1ETV A;  4AC0 A;  1MSF C;  1IJW C;  4M3B A;  3JRC A;  3S1R J;  2MW8 A;  1IDY A;  9ANT A;  5EZH A;  4A69 C;  5DTD A;  1Q1V A;  2M2E A;  1JTX A;  2LKX A;  1ETW A;  4IHY A;  3BQZ A;  1FIP A;  5J1U A;  1MNM C;  2O7O A;  4A3D J;  2GBY A;  2IEK A;  2KT0 A;  1B72 B;  5M5Y J;  1MBK A;  1ZGW A;  4FCY A;  3S1N J;  5J1R A;  4B3A A;  4EEF G;  4BKX A;  5IP9 J;  4XIC A;  2LR8 A;  4BXX J;  2DA3 A;  2IBD A;  1IUF A;  3OOU A;  4XK4 A;  3D1N I;  1Y1V J;  2N8G A;  1AKH B;  2XB0 X;  3BTL A;  5IPA A;  3FIW A;  3HEF A;  2NS8 A;  2NVT J;  3S1Q J;  1GV5 A;  3FIS A;  1OJL A;  2O8K A;  1H88 C;  2NS7 A;  4C3H J;  3FKI J;  2LP0 A;  3G1L A;  5F08 A;  4C2M J;  2CQQ A;  2ID3 A;  4L5E A;  1MH3 A;  2JN6 A;  5F1J A;  1SFO J;  2LK2 A;  4UUS A;  2DMU A;  1PUF A;  1RKW A;  3G1O A;  1CQT A;  3Q3S A;  3B6A A;  2L7F P;  1D5Y A;  3M4O J;  2DA6 A;  1E3O C;  4X1E A;  4FE4 A;  1K61 A;  3WHC A;  2H1K A;  1EF4 A;  3S16 J;  3ZQF A;  4D7N A;  4QIW N;  5GPC A;  2DA7 A;  1AHD P;  2R7Z J;  2DMQ A;  3OIO A;  3HBL A;  2JA7 J;  2CJJ A;  1JUM A;  2E19 A;  4NDL A;  5EDN A;  3IV5 A;  5EYR A;  5FKN A;  3JRH A;  2OF7 A;  1ZR2 A;  2L7Z A;  1HDP A;  3HGY A;  5K7Z A;  2L0K A;  2M34 A;  5IOY A;  3OSG A;  1GDT A;  1RKT A;  5E3O A;  1X2M A;  2E2I J;  2E2H J;  1GVD A;  1ZTR A;  2FQ4 A;  2HDD A;  5FJ8 J;  4LOC A;  4A3E J;  1JGG A;  3S1M J;  3NAR A;  2LFB A;  1NK2 P;  1HDD C;  3JR9 A;  4DZP A;  1TC3 C;  5FKO A;  1AU7 A;  3I4N J;  2DTZ A;  1F36 A;  1PUF B;  3LSR A;  1NK3 P;  1ETQ A;  1U8B A;  2HXO A;  2X9D A;  1B72 A;  4G12 A;  1WH5 A;  1U9N A;  1OCP A;  5IOZ A;  1IRZ A;  1AKH A;  2HI3 A;  3SJM A;  4BY1 J;  5DS9 A;  2DMN A;  2YS9 A;  3TP0 A;  5EF6 A;  3G1M A;  2DN0 A;  1ETY A;  1JJ6 C;  2JA6 J;  2DA4 A;  2E2J J;  2ID6 A;  3S2H J;  1MBF A;  2Y9Y A;  3PO3 J;  2G0E A;  3GTO J;  2NOG A;  1OFC X;  5M3M J;  4DYR A;  3BT9 A;  3TW7 A;  3HOV J;  2VKV A;  3H0G J;  1APL C;  1S7E A;  3QQA A;  2HYJ A;  1I6H J;  3F0C A;  4FE7 A;  2ECB A;  3BTI A;  2B63 J;  2JJ7 A;  2OPT A;  5IP7 J;  1P7I A;  3CQZ J;  4JX6 A;  3PM1 A;  4MFE A;  1JJ8 C;  5F0F A;  1IGN A;  2MGQ A;  2AO9 A;  5K7H A;  2XGC A;  1IDZ A;  5C4J J;  3ZQH A;  1JUP A;  2EZK A;  3JRB A;  1JTY A;  3HGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...