1TWFJ

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twfJ00
4XK4A 4X6AJ 5EG0A 3SJMA 5F1JA 1UMQA 4QTRA 2XPWA 5GPCA 1JKRC 3QPLA 3S1QJ 4MFEA 2DMTA 1GV5A 4EEFG 1P7IA 2LK2A 3K2AA 5IYBJ 5C3EJ 5IYDJ 3JR9A 3RZDJ 4A3IJ 5E3LA 2VI6A 3GTPJ 3E7LA 4CYCB 3FKIJ 1JT0A 4I6ZA 3S16J 2DA7A 2LP0A 3B6AA 2O9LA 4ABZA 1JTYA 4V2FA 1FEXA 2JWTA 1VF9A 1R9TJ 4XIDA 3TW7A 2FX0A 1IJWC 2TRTA 2XB5A 2R5ZA 1ETVA 5IYCJ 2B63J 4M3DA 2IEKA 4XICA 3S17J 4IHXA 1I6HJ 1H88C 1RPWA 3ZQGA 5F0FA 2X9DA 2M8GX 2DJNA 5F27A 1X2MA 1TWGJ 4D7MA 1I3QJ 4DYQA 2VUMJ 1HCRA 2LTPA 2R7ZJ 2WB1N 4A3FJ 2R93J 2AHQA 3BTIA 3S2HJ 2Y30A 1IDZA 1RESA 3GTJJ 4LOCA 4A3GJ 1ETYA 1Z77A 3C2BA 2G0EA 2HXIA 3HOXJ 2ECBA 5J1UA 1FTTA 2CU7A 4A3MJ 1TWFJ 5M3FJ 1XS9A 4Y52J 1T33A 1X2NA 3A01A 2Y31A 3CQZJ 4L5EA 1MH3A 3CDLA 4IHYA 4JX5A 1DU0A 3BQYA 4M3BA 5EGOA 3M3YJ 2LLKA 1O4XA 1ETWA 3FIWA 1W0UA 2FD5A 2DA1A 2Y9YA 1ETXA 3PO3J 2ECCA 1BL0A 1Q1VA 2XPUA 3HB9A 2EZKA 4XRSG 1HLVA 1EF4A 2L0KA 3F0CA 4XRSA 3OSFA 4M3GA 3VPRA 2R5YA 1SANA 1IDYA 3GTKJ 2OPTA 4I76A 2DA5A 1TC3C 1K61A 5IPAA 1G2HA 3L1PA 2KT0A 2MW8A 5IOYA 2DTZA 5K7FA 2EH3A 3NARA 2LVSA 3ZQCA 2Y2ZA 2RAEA 3IH3A 4C3HJ 3IV5A 3G1OA 1AKHA 3TW6A 4C2MJ 1D5YA 3PM1A 2HDDA 1FJLA 4BBSJ 1JKOC 2W48A 3RZOJ 2ID3A 1FIPA 2EZLA 1TWAJ 5M3MJ 1JJ6C 4JYKA 1NK2P 4A93J 1LFUP 1QVUA 4UUSA 5DTDA 1H89C 2NVTJ 3G1LA 3BTLA 4MO7A 5FJ8J 1MSFC 1MBFA 1VNDA 1ITYA 4FISA 5F04A 1FTZA 2LFBA 2FJ1A 2LY9A 4BKXA 2KDZA 3TEDA 3GTGJ 3JRAA 1E3OC 1JGGA 5C4XJ 2NVQJ 1A5JA 3S1MJ 2OF7A 5IP6A 3ZQIA 1B8IA 3TP3A 3JRBA 1BA5A 2CUEA 4S0HB 4MLOA 1P7JA 1S7EA 2XPVA 1HOMA 1BW6A 3BR1A 3BR0A 3A01B 2DMQA 5IOZA 3JRHA 1F43A 5EDNA 1ZR4A 3S2DJ 2NVXJ 5JLXA 5EGOB 5F0CA 3BR6A 4C3JJ 3ZQLA 5GP9A 5EYRA 4W1UA 1HF0A 3CMYA 1AU7A 5E3NA 3A03A 1A6IA 2Y0SN 4B3AA 1ZTRA 5JLWA 1NK3P 4M3FA 4DW6A 2L7ZA 5K7ZA 4Y7NJ 1RKTA 5FKOA 1OCTC 1HDDC 4A3BJ 1JJ8C 2GM4A 2D5VA 3UKGA 1MH4A 1XG1A 5FKLA 2GLOA 1B72B 1TWHJ 3BTCA 1POGA 1MBGA 4XRMA 3JRDA 1JUSA 2HQ5A 3GTMJ 2IAIA 1PUFA 3JRIA 3DEWA 1RR7A 3JRCA 3MVPA 1IRZA 2EQRA 1XC5A 2HOSA 5M5YJ 1AKHB 3BT9A 3GTLJ 1H8AC 9ANTA 2HYJA 2DA4A 1JKQC 2E2JJ 2JA6J 2CRGA 4QIWN 1RKWA 3HBLA 4FE7A 2JA5J 3S1RJ 3BTJA 2E1OA 3HOYJ 4A3KJ 3M4OJ 3I4NJ 1ZQ3P 2X48A 2LR8A 5F0HA 3CCYA 2LD5A 2XB0X 1IUFA 2O8KA 1U8BA 3BG5A 3HKZN 3BG9A 4D5FA 5EZGA 4BBRJ 3PO2J 1BW5A 1SFOJ 1I50J 3G1MA 2K9SA 5EG0B 2DA6A 2XRLA 5FKKA 2I10A 1WI3A 3BQZA 3Q3SA 4IHVA 2EZIA 1APLC 1YRNA 1LE8A 3FK6A 2O7OA 1VFCA 3GTQJ 2VPRA 2DMPA 3HGYA 3MN2A 1QVTA 4DZPA 2E19A 3QQAA 3O8HA 4DYRA 5M5XJ 4D5CA 3WHCA 4AC0A 1ZKGA 1QRYA 1T56A 2HI3A 3LOCA 2R5ZB 4X1EA 4RDUA 1ENHA 3IH2A 4J19A 4FCYA 2P81A 2E2IJ 2YUSA 4AUXA 5FLMJ 4A69C 3W6VA 5J1YA 1U78A 2HXOA 2M2EA 3MKLA 3HGGA 3S14J 2E2HJ 3BR2A 1WH5A 3Q0VA 4M3EA 2WAQN 1TWCJ 5J3LA 2DMUA 4FTHA 1IV6A 3GTOJ 2MG4A 2ELKA 2VKEA 1UG2A 1VI0A 2HOAA 4RBOA 1MNMC 3LSGA 1W0TA 2VKVA 2XGCA 4JX4A 3LSRA 4NDLA 1HDPA 1MBJA 3BR5A 1RETA 1CQTA 1IGNA 3H0GJ 3NAUA 2M0CA 3OSGA 1MBKA 1OFCX 1WH7A 5E3MA 3GBGA 5E3OA 2QF7A 3LNQA 1F36A 2H1KA 2H8RA 3HOZJ 1GUUA 1ORKA 4AYBN 5EEAA 1GV2A 4A3DJ 1JT6A 2JJ7A 3BR3A 1GDTA 5BNGA 3FK7A 3I4MJ 3IH4A 4V2GA 1QPIA 4A3CJ 3JRFA 5K7HA 2R5YB 3HDDA 2ZB9A 2L9RA 5EZHA 1GT0C 5EF6A 2Y9ZA 2IBDA 2JK3A 2L7MP 1AHDP 2YS9A 2M9HA 3JRGA 5M5WJ 1YRNB 2YU9J 3K7AJ 1LE8B 1ETQA 1U9OA 2CJJA 1GVDA 2ID6A 3O8GA 4D7NA 3S1NJ 1BJZA 2EBIA 3DCFA 2DA2A 1ZGWA 3JREA 5F08A 1Y1WJ 4BY1J 2K9QA 3TP0A 3Q0WA 3HEFA 1Y1VJ 3WHBA 2DA3A 1DU6A 1IC8A 2MSYA 4FE4A 4BXXJ 2R0QC 2X6OA 5J1RA 1FIAA 3OIOA 5FKNA 4UUSB 2CUFA 4CYCA 4GFBA 2XGEA 4G12A 2JN6A 2DMNA 2GBYA 5C44J 2WV1A 2EZHA 5FKMA 1UHSA 3RKQA 2CQQA 2FQ4A 3SFIA 1WPKA 1JTXA 3OOUA 2DN0A 1OCPA 4UUTA 2M34A 4C3IJ 1B8IB 1MBEA 5IP9J 2MGQA 2HOTA 3FISA 2JMWA 2COBA 3S15J 1WCMJ 1U9NA 1K83J 4JX6A 2CQXA 3HM5A 4HNVA 4DYCA 5GPAA 5IP7J 5HODA 3HOWJ 4JP0A 2JA7J 4QSHA 2JA8J 5DS9A 4MFDA 4MIMA 2NVYJ 2L7FP 4B1RA 1JUPA 1WGXA 3A02A 2ME6A 2N8GA 3RQIA 5FLVA 3ZQFA 1ETOA 1B72A 1ETKA 2K9NA 4BY7J 1OJLA 2PMZN 2XGDA 3SDGA 3H3VK 3QPSA 3LSJA 1IG7A 3B6CA 3BG3A 1MBHA 3HOVJ 1LFBA 4B4CA 1ZR2A 1JKPC 4A3JJ 2QCOA 1ZK8A 3ZOBA 5C4JJ 2NS7A 4A3LJ 4IHWA 4IEJA 4DZJA 3Q0UA 2NOGA 2AO9A 1X58A 4W97A 3ZQHA 4A3EJ 1PUFB 3HOUJ 2ME0A 3D1NI 2K40A 1NTCA 1JUMA 4M6VA 2NS8A 3LSPA 2XSDC 2LKXA 2TCTA 2R92J 1Z0XA 1MSEC
chains in the Genus database with same CATH superfamily
3P7NA 1OYYA 3SJMA 5F1JA 3CP8A 4QTRA 1LQ1A 4P5OA 4IHTA 1RNLA 4EEFG 4HV5A 1P7IA 5IYBJ 3WTVC 1U5TA 3FXUA 2VI6A 2OCCH 3E7LA 3FKIJ 2K7LA 4KUMA 4I6ZA 4BS9A 1X4PA 1LDJA 3OY9A 3GYHX 1D0XA 2OC6A 3VYTB 1IJWC 3GX4X 3FMQA 3TOAA 2O03A 3WTSC 2B63J 2A3SA 3OMYA 3OS2A 3CCVI 4IHXA 4QWQA 2R7XA 4IO9F 2IS1A 1I6HJ 4CA0A 3PSIA 5ERIA 2DYRH 1YHQI 3ZQGA 2JSCA 5F27A 1TWGJ 3F8FA 4P1WA 5DD8A 3CZ6A 5LGNA 1O7LA 3OL3A 4LIUA 2LTPA 4E7JA 4YIIA 3EDPA 4RAZA 4A3FJ 4WF2A 1XMAA 3HUGB 2AHQA 3LQQA 1U5TC 3FZVA 1IDZA 3BCBA 1S5LC 2VQLA 3K4CA 2F4MB 3QP6A 1ETYA 1S72I 2G0EA 2HXIA 3FXOA 3HOXJ 2XAQA 2CU7A 4F3QA 1XDSA 2LNBA 4KN4X 4A3MJ 3TGNA 1XS9A 4Q48A 2IW5A 2H1LA 4HA8A 4LG3A 4JX5A 1MJAA 3I59B 1DU0A 3SDBA 2GXAA 4PSWA 1O4XA 3RPQA 1ETWA 4B43A 3CC4I 1UB9A 4ESJA 2ZMEC 1TL8A 2B9SA 4HDVA 1ETXA 3ROUA 3WU1B 1BL0A 1FOYA 2P5LC 2OD5A 1Q1VA 5FO5A 2XPUA 3KFWX 4CO8A 2MH2A 4BQQA 4JOMA 5E8GA 2WAEA 4XRSG 4XSXF 4XLPF 3AL0B 2YR2A 3LSKA 3ABLH 2L0KA 4AVZA 1K78A 3F0CA 4XRSA 5TISC 3G2BA 3DTEA 1IF1A 3CO7C 2L02A 4GCVA 1UZCA 3S2WA 3PIOF 2X6WA 2OA4A 4ENJA 2LG4A 4UNOA 2PMHA 2XAJA 4Q4ZF 3BJOA 2HVQA 1IN8A 5K5OA 2MYSA 2VJ5A 1K61A 3L1PA 1N77A 2KT0A 5HS8A 1OCCH 1Z7LA 2X6XA 3C2GA 2NYXA 3F8CA 3KX2A 4C3HJ 3ZQCA 3N97A 1VQNI 3TO7A 2LH9A 2W25A 3EUHA 3K70D 3G1OA 3TW6A 3H5NA 1D5YA 3HIFA 5TRDA 3CC7I 3PM1A 4CCLA 2JPCA 1TBXA 3MZYA 3L9FA 1S6LA 1KU7A 1VZ0A 1WJAA 2BY3A 4ZZLA 1QNTA 2DXIA 1JKOC 3CCEI 2ID3A 1TWAJ 3PQKA 1JJ6C 3E6DA 3Q9VA 3W6JB 4G7ZF 1NK2P 1LFUP 1NG6A 1Z67A 2NVTJ 2ZO4A 1XN7A 3J81K 3L00A 4NNJA 1R5HA 2DO7A 5F04A 1XSVA 2H94A 2LFBA 1W1WE 3LA2A 4BKXA 2KDZA 4R79A 3TEDA 2C6YA 4XL9A 2GQQA 4V19K 3S8PA 5LHGA 1LPQA 4UB8C 1JGGA 2NVQJ 1R7JA 1GHCA 2AQFA 5KVRA 1B8IA 2IS4A 1T0FA 3EUHC 1P7JA 5ICEA 1FOWA 2HEOA 1HOMA 3AKZA 2EJRA 1W5TA 3OWTA 3A01B 2DMQA 1USTA 5CQEA 5IOZA 1ZR4A 1LFPA 2E1MB 3ZPLA 5F0CA 1BR4A 5B66C 3OYIA 3M8EA 2EK5A 2CG4A 1A6IA 4A5MA 2Y0SN 4B3AA 1GXQA 4M3FA 2GZWA 5K7ZA 2K9MA 3HHHA 4WX9A 5FKOA 5E20A 3LSIA 2FF4A 2RNJA 1A35A 4U7DA 4RS8A 4A3BJ 3NRVA 2HVSA 1T0FC 2CSOA 2DDBA 3RKYA 1JJ8C 2D5VA 3UKGA 3K1PA 4JQFA 4AU7A 1CF7B 1U0JA 3NEUA 1XG1A 3FWEA 3NQOA 3TO9A 4ZDPA 3OYGA 2PEXA 2GWRA 3JRDA 1MBGA 1X1DA 2CV0A 1JUSA 1X3ZB 3VSKA 3RQ4A 4WCGA 2VT2A 4IZZA 4LMYA 1ZAOA 2Z3YA 1FBSA 2PN6A 2FMLA 1XC5A 3I3LA 2NAZA 5DCMA 1AKHB 1E17A 2QM3A 3SEQA 3BY6A 5J8CA 2VJ4A 1LVKA 1OMIA 2IA1A 4XORA 3L2RA 1VQ7I 4QIWN 2JA6J 2AXTC 3S1RJ 3HOYJ 3GZ5A 3JAMK 4ENMA 1W36C 3HRSA 5F0HA 1N75A 3CF5F 3K9TA 3DKXA 2XB0X 2VQHA 2KP6A 4XKCA 3JTGA 1R58A 3BG6A 3K2ZA 3HKZN 2CUZA 4D5FA 3DPLC 2HQRA 3WGGA 2V7FA 3PO2J 3NWSA 4HSRA 2KJCA 1SFOJ 2XSJC 2K9SA 5CVJA 3UR3C 4BHBA 3OIPA 3EUKL 1SD5A 2E7WA 3BQZA 4UV9A 4OINF 4IPAA 3ZGKA 2FBIA 2RNGA 3ABTA 3KP5A 3H35A 3HOTA 1YRNA 3F22A 1EJ9A 1YJNI 1U5TB 1FOXA 2I8DA 5GTIC 1W7PA 1VFCA 4G7HF 2FRHA 2R7VA 3GTQJ 1YI2I 4HQMA 1QVTA 4U7BA 1K79A 2VT3A 4YEJA 3O8HA 3MEXA 3CO6C 2RKHA 4IRIA 4UB6C 2GA1A 4ETSA 1Y8QB 3LOCA 2NNNA 1FLIA 4BACA 2L4MA 1TQMA 1WJBA 2R7FA 4CCMA 2PBIA 1G6NA 2YUSA 4S04A 1LDDA 2V1NA 5D5WB 1R49A 4N0BA 2G7UA 2JPBA 2ZMEB 4NQWA 2E60A 3F6OA 1USSA 1X4OA 3VODA 3PNYA 3AAFA 5FD5A 3HGGA 2K27A 2DT7B 5L3GA 1WH5A 3ZMZA 3Q0VA 4M3EA 4QPOA 3V8LA 2KHMA 5E1XA 5J3LA 3BG7A 1D5VA 2UXXA 3R6SA 1B9MA 2ZJ2A 3LWFA 1HKTA 2KL4A 5HDGA 2ZXIA 1SAXA 2VN2A 5FD6A 1NH3A 2K5CA 3CESA 2K4BA 3OYNA 1LKXA 4KMFA 3LSGA 4Y17A 1R1VA 3LSRA 5AONA 5CVVA 4KFCA 4HAMA 1WHUA 1BIBA 1MIJA 4HF0A 4I99C 2BGCA 4A6DA 3VFZA 2M0CA 3OSGA 1RRJA 4EJOA 2XAFA 2H1KA 1Y0NA 2QF7A 4XRFA 5AIQA 4S05A 3GLXA 4HNUA 2QWWA 3ABMH 5EEAA 3REOA 3ECHA 1QZEA 1GVJA 1GDTA 4XQFA 4BGDA 2YX4A 1K78B 2K9LA 3BWGA 3U1DA 3W2VA 3LQRA 3H9JA 5FROA 1X1BA 3ZN0A 2NS0A 4IL6C 5HLIA 3ZMDA 1Z1DA 3JRFA 2CV1A 5K7HA 4XNFA 2L9RA 3R61A 3FHNA 1XGSA 5EF6A 1GLNA 1MD0A 2Y9ZA 2YS9A 3GW2A 3JRGA 3MKWB 5HDNA 4NC8A 5D5XB 2ID6A 1T2KA 3S1NJ 3F6VA 4HX4A 1G3YA 1ZGWA 3IWZA 3KETA 3JREA 2K9QA 3OR2C 3TP0A 4II2A 2BE5F 5HLHA 1SC7A 1R5ID 3RI4A 2KIFA 5FLXZ 2D1HA 2DQRA 3CLOA 1FYMA 4CCKA 2DJIA 2IXSA 2WAQA 1WVRA 3BCAA 1T39A 4BXXJ 2EA4A 3KP7A 2ZJQF 2R0QC 4OIQF 2YSRA 3KYDB 4IQJA 1FIAA 2EWNA 4GFBA 2XGEA 2WY7Q 5F6FA 2MBFA 1ACIA 4RGRA 5E1WA 1STZA 4PUSA 2WV1A 2CFXA 3ML6A 4G8XA 2QBYB 2E35A 4CXFA 1PYVA 1ON2A 4Y15A 3MZHA 2IRFG 4A0ZA 4G7OF 2BXYA 1QO0D 1VQMI 1ULYA 3OOUA 2DN0A 2Z9OA 1TNSA 3HXLA 1MBEA 3L2WA 4U0WA 4E7KA 1B8IB 3A1YA 4AYBA 2HOTA 2FOWA 2COBA 4E7IA 4IQ4A 3N05A 4E7LA 5HODA 1K83J 2R7RA 4DYCA 1P2FA 3HPGA 3CCSI 2JA8J 1KYWA 2VE9A 1DGWY 4G6DA 4MIMA 3ISPA 4KITB 1OCRH 3BC8A 4J00A 1JUPA 2X1DA 3BJ6A 4IRHA 2STWA 2OV7A 3M7GA 3ZQFA 1IZ1A 1ETOA 2M7BA 1S7OA 1SAUA 4BY7J 4GDFA 1OISA 3RCOA 3DBRB 3LSJA 2JSPA 3B73A 1Y6IA 1MBHA 1LFBA 1V55H 2HFHA 3GO5A 3FBIB 3K0LA 3I59A 2IA2A 4PJ0C 2COMA 2LSOA 1XD7A 1UHMA 2AXLA 3Q0UA 1BR1A 5ED4A 2FNPA 5LD2C 1OCZH 3H92A 3RJPA 3HOUJ 1F9NA 2ME0A 5GAEJ 2GOXB 4XLCA 3LSPA 2QLZA 4F93B 1K6OA 1FMWA 5B1AH 5FRMA 4U88A 5DCMB 4EJUA 2DQLA 2ISYA 1Z91A 3LSTA 2OU2A 3OS1A 1UMQA 3S93A 4R1HA 3HPHA 1D8KA 1OPCA 1JKRC 3ERED 4MFEA 2DMTA 3S1QJ 3K2AA 5C3EJ 3SZPA 4KYWA 2L01A 3TMOA 3JR9A 5E3LA 3GTPJ 3TO6A 2H6BA 1J2XA 2M7AA 3AG4H 2OTLI 2CGPA 1I3AA 2KJBA 4C30A 3QPTA 2LP0A 3B6AA 5JI6A 4NC6A 4V2FA 3OL4A 2JWTA 1VF9A 1OQYA 4XIDA 3HL2A 2AS5F 2FX0A 2FEZA 2LF7A 2XHKA 3I58A 5KCMA 3RYRA 1YTYA 2R5ZA 2J5OA 4M3DA 3S17J 5JVGF 4A12A 1N78A 1RPWA 5ICCA 3ASOH 3AG2H 2ACJA 2VJJA 1HSJA 3JCUC 4DYQA 5DV5A 1IRGA 3IRRA 3U1KA 1ZRCA 4MEYF 3CMAI 1P6RA 2X4HA 2Y30A 4KICA 3GTJJ 3W6KB 1FYKA 1ZLJA 4A3GJ 2UWMA 1Z77A 1FYLA 2IT0A 2ECBA 4YIRX 4IF4A 1H9TA 4WXHA 5M3FJ 2ZC2A 4Y52J 1X2NA 3A01A 2Y31A 4L5EA 1MH3A 3CMEI 4D0PA 2GIZA 2XUBA 1A04A 3L2VA 2CW7A 3DWLE 1BI0A 1UHWA 2R7SA 5HLTA 4MGRA 3JSPA 4HPQA 4B8XA 1DPRA 4OIOF 2VLAA 2BZTA 5A2QK 3PO3J 4ITVA 1OKRA 3LFKA 3EYIA 5E1ZB 4U0VA 1KZHA 3F23A 4NB5A 2MD0A 1QQIA 3OSFA 2HZDA 1P92A 2Z2SB 3VDXA 1DQUA 5DUIA 2VE8A 1CF7A 2OPTA 2M4GA 4ASNA 1ZREA 2DA5A 5IPAA 2A05A 5BMZA 3CUQA 1AWCA 5K7FA 3CJTB 2EH3A 2QKLB 3DV8A 1H9GA 1VQ8I 5E79C 1VQ6I 2Y2ZA 4XM3A 1ONVA 4B44A 3IKTA 1AKHA 2RVCA 2JQ7A 5EJCA 3EPZA 1KU2A 3ZMUA 4X0GA 3RZOJ 1YO5C 1QGPA 1T8IA 3WODF 2F2EA 3M8JA 4A93J 3QPHA 4EMSA 1QVUA 4UUSA 1R00A 1H89C 3BTLA 4HX7A 3AG1H 1MBFA 3RSNA 1ITYA 1AA7A 4FISA 4EM0B 1OCOH 3QODA 2GOMA 1KYZA 3FF5A 3CUQC 1KGSA 2PFBA 2XAGA 1E3OC 1RUNA 5H6RA 5C4XJ 1A5JA 2HZTA 2L9VA 1Z05A 2OF7A 3H36A 5IP6A 3S1MJ 1HA8A 2KRCA 4H4KC 4WXDA 2E5ZA 4GO1A 3TP3A 3JRBA 3S3OA 2ISZA 1ZN2A 2NRAC 4IRGA 4BU2A 4MLOA 5J6XA 2IVMA 2DK8A 2ZXHA 3WE3A 3CCLI 2UXNA 4RMNA 3BR0A 1ZGAA 2BY0A 3F9KA 4M6XA 3H5RA 1Y39A 3I56I 1X1CA 1F43A 5EDNA 5J8FA 4I09A 5EGOB 4C3JJ 2JT1A 3D5LA 2W85A 3R4KA 4N4NB 5GP9A 2E36A 3CMYA 3QRFF 4IJAA 2XGXA 2WTEA 1NK3P 4DW6A 3I0TA 4Y7NJ 4YFXF 2ZMEA 3CLQA 2L2OA 4BQAA 4EJTA 3EYYA 2K85A 1IXRC 4ZZDA 2XC7A 2IGMA 2VOOA 4PJLA 4EATA 1F5TA 2MFZA 2NVUB 1Z3YA 3H9GA 3WGIA 4G94A 1OYWA 2LYCA 2M87A 5FKLA 1TWHJ 1LDKB 4GYGA 3I71A 3GTMJ 3O2PE 2ZJRF 1PUFA 3GZNB 3C1DA 2L9SA 2KLOA 2Q8KA 3KCCA 5BQTA 1ZH5A 4KN7X 1IUYA 3MVPA 4OAZA 4ON0A 1D1AA 4AIKA 2KZGA 2LREA 4PFPA 2P5KA 1PVEA 3GTLJ 9ANTA 2VBYA 1H8AC 2V9PA 2HYJA 5BPIA 1DUXC 2JTVA 3KEOA 3K4JA 1JKQC 3OYHA 3ZQ7A 2XAHA 2HGCA 4HX8A 1TZLA 4A3KJ 1XTAA 3I4NJ 2L4AA 3PJRA 1ZHFA 3WTYC 1B4AA 2Z99A 2LY1A 2DPDA 1AOYA 2NXNB 1U8BA 3BG5A 4CYDA 3BG9A 5ILUA 5EZGA 4BBRJ 2XV4S 2W7NA 4A6EA 2RV8A 4RM3A 1YITI 2DA6A 4I02A 2FSWA 5GTHC 2I10A 1WI3A 1HW2A 1YIOA 2KQRA 1KU9A 2W1OA 1U8RA 3SHFA 1SMTA 2QQ8A 2Y0SA 5L3FA 2DFHA 2XF7A 1MMGA 4OIRF 1EA3A 3LSMA 3FXKA 4M9SA 5JVTA 1O3SA 2O7OA 3FXLA 3VEPA 1HW1A 4FHTA 2ZKZA 2XAUA 1D1BA 2VPRA 4L5IA 4OOIA 1TLHB 3HGYA 2PJRB 4DZPA 2NNYA 4Z2YA 3F21A 1H0MA 3DF8A 1YYVA 4CCOA 4D5CA 1O3QA 3IUOA 4XN3A 1ZKGA 1QRYA 1T56A 2HI3A 4AC0A 2R5ZB 1QHGA 4LG0A 2L54A 3FX3A 3IH2A 3VYSB 2IGNA 2W82A 3O3KA 2FMYA 3WTZA 4J19A 2P81A 3FM3A 4LITA 2E2IJ 2PQ8A 4AUXA 1IO2A 1IXSB 4E7ZA 3LSHA 1YOVB 2M2EA 2R7TA 1TTYA 2QBYA 4OMYA 2JRMA 3SZTA 4A2UA 3KYCB 3L2CA 3J7YJ 3CCUI 2CMPA 3GXOA 1HBXG 1TWCJ 3RTRA 3HOSA 3GTOJ 2VB6A 4XN0A 1R71A 4EM2A 2CV2A 2B7EA 1WKMA 1Z3XA 2LBFB 2BVMA 1WI9A 2A6HF 2B0LA 4KA4A 1WJDA 3GFMA 2ELKA 2VKEA 3RIRA 1UG2A 1VI0A 4RB0A 2RQPA 2HOAA 3HKZA 2L3DA 4L9VA 4HNTA 3C18A 4MHGA 3CD6I 1MBJA 3BR5A 1CQTA 4UUVA 2ZJPF 3H0GJ 3S3MA 1MBKA 5E3MA 1PUEE 3GBGA 3LNQA 1F36A 2H8RA 4J01A 5HLGA 4Y33A 1JT6A 1XGNA 2LDUA 3QWLA 5BNGA 4MTEA 4I7HA 3F8MA 2MLKA 3IH4A 4V2GA 4YG2F 2QKMB 1HC8A 1VQ4I 2CS3A 4GXOA 1Z0XA 1SD6A 5D5VB 2QA4I 2WADA 2V79A 3HDDA 2BOLA 5KHDA 2ZB9A 2QQ9A 2QSHX 1KQ0A 2IBDA 1ZRDA 2M9HA 3CUQB 4BJ5C 1M1EB 3K7AJ 1ETQA 1U9OA 2CJJA 3PIPF 2DT6A 5FGMA 1YLFA 1YG2A 3DCFA 1MW7A 2VL8A 2FU4A 3L2UA 3EUAA 4OWRB 4BY1J 4KIBA 2A68F 4PGHA 3Q0WA 1Q1HA 4UVBA 2P7CB 3HEFA 5H20A 4AWXB 2E5NA 4MQVA 3HRUA 4PFOA 3NWTA 1DU6A 1IW7F 1ZYRF 1IC8A 3PFIA 4CCJA 2BW3A 2MSYA 4FE4A 1P4WA 3OYKA 4F55A 1ZG1A 1OLTA 2DYSH 3K4BA 3OIOA 5EEHA 2VKDA 1VQKI 2P6TA 4UUSB 2VC1A 3PL8A 2DU9A 1WJ5A 4G12A 2KDOA 2BVLA 2DMNA 2GBYA 3BPVA 1X1PA 4LLNA 2EZHA 3CJQB 4Q47A 5FRNA 3I5UA 4E7HA 2MABA 3K1MA 4LK0F 2DCEA 1G8XA 3OYAA 4HZFA 3LAPA 3WGHA 1QA6A 2K4JA 4AD9A 1WCMJ 4L9TA 3D5SC 2CQXA 3HM5A 3JTHA 4P9UA 4JP0A 4YELA 2JA7J 4XOTA 1UG0A 2OQGA 2P5VA 4PJJA 2JRTA 4XKVA 3COAC 2GA2A 1SVMA 2NVYJ 1F4KA 1U2WA 4B1RA 3KYLA 4DNCA 1WGXA 3A02A 4KDPA 2WWYA 1FNNA 1B72A 1X1AA 4R8HA 2XGDA 3HSFA 4OMZA 3H3VK 4LB6B 1TQIA 3QPSA 1IG7A 3BG3A 2MD5A 2F48A 3HOVJ 4B4CA 1HXDA 1LJ9A 1G59A 2HR3A 4A3JJ 2QCOA 1ZK8A 2OUMA 1BJAA 3ZOBA 2PMUA 3KIOA 5CQGA 4A3LJ 3OYLA 4IEJA 2BV6A 5DD4A 3PQJA 2W24A 1SFKA 2DLLA 1V4RA 4L18B 1DP3A 3PFYA 4A3EJ 3R0AA 1FWZA 4HYEA 2VBXA 1PUFB 3WTUC 2O3FA 3ZP5A 4M6VA 3OR1C 4ZTJA 2WV0A 4Q5SF 3VYRB 1B59A 1WFXA 2TCTA 3GCMA 3WU2C 4BQNA 5IT9K 2IJLA 4JBAA 3P9KA 1YW8A 3DTIA 4JK1X 3W3CA 2YPRA 4X6AJ 5EG0A 3G3ZA 2F5EA 2X85A 4E4HA 3VB2A 4BH9A 2ZSIB 5GPCA 3GFLA 1MJ9A 2HKOA 3QPLA 1R4NB 1SVLA 1YX3A 2JUCA 3ZMVA 1MMSA 5IYDJ 3RZDJ 3BJAA 3QAHA 2XF6A 5FFXA 1JT0A 4Y4RA 2VQCA 4A0XA 2OAZA 2W4SA 2X6YA 3S16J 3FM5A 4ABZA 1JTYA 2VONA 3U9GA 1FY7A 5H2FC 1FEXA 4BE2A 3A4CA 1G4DA 2TRTA 5J47A 3VOEA 5IYCJ 2ZBKA 3GFJA 5DEQA 2IEKA 2EFNA 3WTXC 5FB2A 2O61A 3CP2A 2LMDA 5F0FA 2BHZA 2M8GX 1V5FA 2X9DA 1X2MA 4XLAA 1VQOI 4D7MA 2VUMJ 2OCEA 1S3JA 4I01A 3FXRA 2WB1N 1R1TA 2LF8A 3FMRA 2R93J 3S2HJ 4K2EA 4EGZA 1RESA 2EV6A 3EETA 3FXMA 4DBQA 3E5XA 2A07F 1K4TA 3O6BB 4C2TA 4FETA 3C2BA 1YQAA 3HTSB 3BPXA 4LG0B 1RC9A 5J1UA 1FTTA 2D2WA 2DOAA 4UVCA 5D5UB 4L0ZB 4GGGA 1TWFJ 1T33A 2VQGA 3BROA 1DGRM 2CH0A 4M9XA 3CDLA 5JHUA 2F4OB 3I64A 4KIFA 3R60A 2A6TA 3BQYA 4M3BA 5EGOA 2EA2A 3J7ZI 2DI3A 3M3YJ 2LLKA 2EFQA 1X3WB 3FIWA 4AVPA 3J81Z 4ZYGA 1YW7A 1XGOA 2EFPA 1YFHA 2BYVE 2ECCA 3L2QA 3MKZA 3DXJF 5DYMA 3HB9A 1JHHA 2HS5A 5EEGA 1HLVA 1FP2A 4BXFA 1EF4A 2I5UA 3E6CC 4RGUA 2JVHA 1U3EM 2X1CA 3G71I 5J4YA 3H5AA 2PI0A 4EVIA 4G6QA 4M9ZA 5D6FA 3VPRA 1IDYA 4ZJZA 3CMMA 1TC3C 5LEKA 1G2HA 2XIGA 3V7CA 1R22A 2FBKA 2MW8A 1LVAA 2ZXWH 3BZ6A 3WG9A 2VOPA 2XF5A 2Y0MA 3M07A 4NC7A 5KAIC 1XX5A 4P96A 2R7WA 2RAEA 3IV5A 3DLLF 4BXUA 2O6GE 1HW5A 1ODDA 4UV8A 3G73A 1X3UA 4C2MJ 4Y3OA 1MMDA 2JUGA 4BBSJ 1I5ZA 1WJFA 3ESWB 3A0HC 3K6GA 2EZLA 4RLQA 5M3MJ 5DDGA 3DKWA 4XLHA 5GAHJ 5DTDA 2KZVA 3KEQA 5FJ8J 1MSFC 1VNDA 4YIFA 2ADUA 1FTZA 3TDZC 4KMUX 5HNFA 5K5QA 3OS0A 3T8TA 3GTGJ 4HF1A 1HKQA 4ZYDA 2M4KA 4E6KG 2BW3B 2HNHA 1T38A 1I27A 3ZQIA 2F5CA 1D3YA 3C7JA 4YRVA 2CUEA 1BA5A 1O57A 2P8TA 2PX9A 5LGTA 2DFFA 2ZNZA 1S7EA 1A6QA 3BR1A 1MZBA 2CUJA 2K3FA 4CSWA 2HPMA 4DOZA 2FQ3A 3JAMZ 3S2DJ 2NVXJ 2IP2A 3T1BA 2PJRA 1LEBA 3ASNH 2Z33A 3ZQLA 2LRDA 2VBZA 1R5GA 3B02A 5EYRA 4W1UA 1AU7A 5CVIA 3H3UA 5E3NA 3A03A 3F72A 3KEYA 1W5SA 4YFNF 3IAM2 1ZTRA 3IC7A 4HSTA 2CWEA 2L7ZA 1ERDA 5HVQC 3D0SA 1HDDC 4F7ZA 3FKJA 2GM4A 3BLYA 3DBHB 1O7FA 4ZYHA 1MH4A 4PK4A 5ICGA 2FUG2 2DBBA 3LA7A 4IVNA 4BUPA 2KRHA 1B72B 3BTCA 1PP7U 1KONA 4XKBA 1JHFA 2HQ5A 3FDYA 2LBFA 4XR6A 2IAIA 2QQAA 1TT0A 3DEWA 2QVOA 4XSZF 1RR7A 2HKXA 3IAS2 2EQRA 4TV7A 2HOSA 1EH8A 4KT5C 3RDIA 3SQNA 3MKYB 4BYYA 2DA4A 3KZZA 4EJWA 5L3DA 2HVRA 2CQNA 5B3SH 4N9IA 1FC3A 3HBLA 4FE7A 4RB1A 1BBYA 2JA5J 2E1OA 3M4OJ 3RKWA 4D9JA 1ZQ3P 1PJRA 1LNWA 2LR8A 2QZ8A 2P6SA 1P4AA 3CCYA 3V42A 4BHCA 4AIJA 4DQ2A 2LD5A 1JGSA 3DPUA 1IXCA 3TDUC 3J7AO 2O8KA 2QSFX 3SFZA 1V5GA 3J80K 2BBYA 1WZ2A 1A31A 4WK8F 1BW5A 2CQ7A 4RM2A 1I50J 5EG0B 4ENKA 1J5YA 2XRLA 3MCZA 1V5EA 5B1BH 4KISA 1MMNA 2F5FA 4RA2A 5HS7A 1BM9A 1OYIA 1RI7A 3MZ8A 1APLC 5CKTA 4D1QA 3HHGA 3N4MA 1WRJA 2V6EA 3TQNA 2CYYA 1T98A 4ZC3A 3H3ZA 1TNTA 1YW9A 3VWBA 3QQAA 2Y69H 2Y75A 3F8NA 3C3WA 3WHCA 1HKSA 2HQNA 3I4PA 2TDXA 4X1EA 2NOJB 1ENHA 2BHYA 4FCYA 2BY1A 4ZH4F 3RYPA 1RIOH 2KKOA 5K1YA 2EFWA 4A69C 3W6VA 1S29A 3CCRI 4HRIA 2XASA 2OBPA 1VTNC 3E97A 1FSHA 1OR7A 3E3VA 3IRQA 2G9WA 4HW0A 2ZNYA 3BR2A 4G6TB 2H09A 5HNHA 1G3TA 4Y13A 2EV5A 2FE3A 1IV6A 2WC2A 3HYIA 1Y0UA 1JI8A 3HSRA 1S8NA 3PSFA 4F52A 5LLQA 5HDKA 1FSEA 4B09A 1SFUA 2O8XA 4RBOA 4NBQA 1MNMC 3ZCOA 2XGCA 2F5DA 1HDPA 3DBLB 1BOAA 4C2UA 2V9KA 1R23A 2FXAA 5LHHA 1WH7A 1OFCX 5E3OA 5D4SA 1MJBA 2R7QA 3HG9A 5D8KB 4KT6A 1OR7C 1XMKA 2GXBA 4QLCU 5LHIA 2RDPA 3QU6A 4AIDA 4RB2C 2DFEA 3DLAA 1EH6A 2IPQX 4O6JA 1QBJA 2R3SA 2Z5UA 3BDDA 1J59A 3V8JA 1E0EA 1R4MB 1J7KA 2H8WA 2K86A 4FT8A 3CCJI 2JK3A 2L7MP 3FXJA 1YE9A 1BC8C 5M5WJ 3FMSA 1P9QC 1LE8B 1GVDA 1XSDA 2EBIA 4HV6A 1D8JA 3DEUA 1QZYA 2DA2A 1Y1WJ 1LB2A 2EPFA 1YX5A 1JXSA 4BQOA 1ON1A 4RB3C 2QGUA 3LMMA 1BR2A 1Y1VJ 3WHBA 4LGWA 4EQQA 2BEOA 1K6YA 4IXAA 1EH7A 1E2XA 3DPTA 2W57A 5FFZA 2OQRA 3X2QH 5D6EA 2RC4A 5J1RA 3T5XA 3IKVA 3IP4B 3DU5A 2DAOA 2QQBA 2CO5A 3CF2A 3DFGA 2VXDA 3E0JB 4BL0B 2BXZA 2JN6A 3CCMI 2VASA 4B48A 5KNLA 4BEHB 5C44J 1O3TA 3MAJA 5FKMA 2CQQA 4XOPA 2FQ4A 1ZG3A 3K4KA 1JTXA 4P55A 1V54H 1OCPA 4B3XA 1SD7A 4UUTA 3SZGA 4CICA 4BAYA 4C3IJ 2E1CA 4L9NA 1QU3A 1IV8A 1WQ2A 3A2KA 5IP9J 2KISA 3FISA 2JMWA 2UZKA 1MKMA 1E3HA 1U9NA 5IP7J 4KIGA 5GPAA 3HOWJ 1FT9A 4AM3A 5DS9A 2WY8Q 1ZELA 5B5EC 1FPQA 4MFDA 1YJ9I 3HRTA 3V8KA 2EB7A 4XKWA 2L7FP 1KQ9A 1EV7A 1G3SA 2LOOA 3MWMA 2E34A 3KE2A 2N8GA 3RQIA 1ETKA 1R1UA 1OJLA 4C9YA 3SDGA 2JA2A 4RAFA 5LRSA 5FLXK 4M71A 3LA3A 1ZR2A 1JKPC 5C4JJ 4KJZA 4OAYA 2HTSA 3MMYB 4OU0A 2Q2EB 4II3A 4P9FA 3KP6A 2NOGA 2AO9A 2D45A 1R6RA 1U6GA 1YJWI 3RPUD 1X58A 3ZQHA 2DOFA 1FBUA 2QENA 3V7SA 2YX7A 2Q1ZB 3D1NI 4BDZA 2K40A 1NTCA 4IKFA 3KZYA 4CH7A 2XSDC 2LKXA 4HEA2 4HBLA 4LIVA 2VJIA 3CUOA 3SXYA 1MSEC 2R92J 3LAJA 2M0MA 4XK4A 2HU9A 1BI3A 4M6YA 2VODA 1QHHD 2XPWA 1W4MA 1Y8RB 3BZCA 3EQLF 1Z6RA 5K5RA 1GV5A 3GVAA 4UVAA 3Q5FA 2LK2A 3KLNA 1L3LA 1D0ZA 3AG3H 2QYOA 3OYJA 4A3IJ 2JVGA 4HG2A 2KIQA 4CYCB 3E5UA 5LEJA 4ENNA 4L5JA 4H0EA 5A2QZ 1YS6A 3ZN1A 4IOAF 2ESHA 2Z1DA 2DA7A 4FX4A 4EGYA 2O9LA 3QYEA 4CHUA 4FX0A 1XMXA 1KA8A 1R9TJ 2E1NA 3TW7A 3QU3A 1SEUA 2H27A 2XB5A 3J80Z 2P4WA 1ETVA 4XICA 1J09A 3HRMA 5LRRA 1SFXA 4CDGA 4M72A 4G9YA 3K69A 1H88C 4MNUA 2F6CA 1MNDA 1PP8F 1TP4A 1TW3A 1SFEA 2DJNA 2OJED 3M1EA 2HWVA 1I3QJ 1HCRA 2QUFA 2ICWG 2R7ZJ 1IN7A 1S9HA 3ZQQA 2XKOA 2EILH 3CTAA 3BTIA 4XLEA 1LEAA 3OIQA 5JR3A 5TJJA 3K1NA 3GMEA 4LOCA 2DPUA 4BDYA 1NG7A 2HTJA 2CW8A 2M3AA 4EV0A 1XPXA 1B9NA 3HC7A 1SVOA 4UY8I 5LFAA 1FP1D 2LKPA 3E1SA 1E3PA 4A0YA 5D4RA 2K3PA 1V3FA 3ZRGA 3CQZJ 4IHYA 4U0YA 1X19A 1KU3A 3OYFA 2RGVA 2HPIA 4DJAA 1MGTA 3LFUA 4I0BA 4B47A 3GF2A 1W0UA 4LB5A 2XDVA 2FD5A 1ZGJA 1BIAA 3CDIA 5DUKA 5TGTA 2DA1A 2Y9YA 3H9QA 1BOBA 3GWZA 2CFOA 3LL7A 2Z16A 2L9NA 1EKEA 1XSXA 1Y56A 2L7KA 5LGUA 4HLYA 2EZKA 3A0BC 5F1RA 3OYEA 2STTA 4MTDA 3KP2A 3FXQA 3KP4A 1VQ9I 4ESBA 2DT5A 1WSUA 4M3GA 5ICFA 2R5YA 1SANA 2M30A 4LFUA 3GTKJ 2ZFWA 4I76A 2MLGA 3ECOA 2HDCA 5IOYA 2DTZA 2VBWA 3ZMTA 1MMAA 1S7AA 1JE8A 3NARA 3ZXSA 1HQCA 2LVSA 4CZCA 3G6EI 1G3WA 1D1CA 1YS7A 2MC3A 3IH3A 3FHZA 4FASD 5GAGJ 2WB1A 4IOCF 2ESNA 1XCVA 2HDDA 2EIMH 2OTJI 4DIQA 1FJLA 3TKYA 1IRFA 2K02A 3QP5A 2W48A 4N9HA 1FIPA 1HSTA 1DP7P 3CJNA 4JYKA 2XVCA 4CCNA 3ZMSA 2HYFA 2G7HA 2R7DA 2R7OA 2O0YA 1CGPA 5E18F 1GXPA 3G1LA 1WJCA 4MO7A 2KMUA 1I1SA 1ZARA 3OYMA 3BP8A 3K4LA 1IN5A 2FJ1A 2LY9A 3JRAA 2DOEA 1Z6TA 2KIUA 3KP3A 5CJ9A 3JW4A 1MDMA 3J7AY 2E71A 3WTTC 1UELB 4LJZF 3HJEA 3FBNB 4ESFA 2W84A 4S0HB 2QSGX 2F5VA 3HTUA 5BPDA 2XPVA 1BW6A 1REPC 2FBHA 4E70A 3JRHA 3ZR8X 2MH9A 2PLYA 4RAYA 3PUBA 4OIPF 4CUGA 2FA5A 5JLXA 3WTWC 2IGKA 3BR6A 3KPHA 2EIKH 3JSOA 1Z9CA 4ZTFA 2MA3A 3CCQI 1HF0A 5DM7F 1QPMA 1BI2A 1MNEA 2UUZA 3DKYA 3IHUA 1PDNC 2DW4A 5JLWA 4GYIA 2IS2A 1RKTA 2W00A 3RKXA 4WXCA 1OCTC 1UJ8A 4F91B 2P7VB 5ILVA 3PUFA 3WG7H 1VQ5I 1FBQA 1J0RA 3M9AA 2A5WA 2FNAA 4Z6YA 1ZLKA 1KQ8A 1XGMA 3UNGC 3WE2A 2IGOA 1A36A 5L3BA 2IA0A 3MD2A 1W36D 2GLOA 4RLFA 3ULQB 5IT3A 1POGA 4XRMA 1BN5A 4I0AA 5F64A 3L09A 2F4IA 3K4NA 3JRIA 3GZ6A 1Z7UA 3M1CA 2J5PA 1DDNA 3OYCA 3TBIA 3JRCA 4XLNF 3CJRB 2YU3A 2X0LA 1IRZA 1N25A 3GFIA 5M5YJ 3BT9A 3QYBA 1VQPI 2E2JJ 3T0YA 2CRGA 2VXZA 1RKWA 4RGSA 2HYGD 3BTJA 5H6QA 1C0WA 2X48A 2Y48A 3GLLA 4PJNA 3SYTA 5J40A 3V4GA 3BOQA 4PSXA 1IUFA 2KRFA 2LC2A 1BC7C 4ZDOA 3R0JA 2V1UA 1L0OC 3HZJA 4RGXA 5CLSA 5CVRA 4CGZA 5HS9A 1RUOA 5LBQA 3P9CA 1K4SA 2M5WA 4A5NA 3MQ0A 3G1MA 3I53A 4CZZA 5JFRA 1R36A 3ABKH 1T6SA 3ABUA 1I6XA 3CDHA 5FKKA 5ILSA 3I55I 2VPLA 4IX7A 3Q3SA 4ZDLA 4IHVA 2EZIA 3PNTA 4XMYA 5KK1A 4WWCA 2GAUA 1LE8A 3GEZA 3FK6A 4YFKF 1XDUA 3DTKA 4GRIA 2DMPA 5HOOA 3MN2A 1I1GA 3QOPA 3IL2A 1VQLI 2AQEA 3HUGA 2E19A 2V6CA 4UXNA 4ZYEA 4DYRA 3CC2I 5M5XJ 4LK1F 1W7PD 3OYDA 4UHTA 5BS6A 4PGGA 2ZXJA 1IN4A 3DEEA 4XONA 3TOBA 4RDUA 3Q9SA 5J4VA 5FLMJ 5CYVA 2KPMA 3AFHA 2RQQA 4U87A 5J1YA 1U78A 4N4OB 1Z21A 2HXOA 4BEHA 2BY2A 2VIXA 4BNCA 2MC4A 3H1CA 3MKLA 3ERMA 4I2OA 3S14J 2E2HJ 3D5RC 2WAQN 1T95A 2EV0A 2KFDA 2M45A 4O3MA 4ZYAA 2DMUA 4FTHA 2ELHA 5E8IA 2LKSA 2DODA 5CPRB 2XROA 2ETHA 2EFOA 2MG4A 3BZKA 2V9VA 1FX7A 1FMVA 3W2WA 4MQ9F 2A6EF 2R4GA 1W0TA 2VKVA 4JX4A 3H0DA 4EM1A 3OV8A 4NDLA 3E5QA 1RETA 4HOBA 1IGNA 1SD4A 5DM6F 3NAUA 3KZIC 3C2HA 3I54A 2DFIA 1I39A 5DCFA 3U2RA 3SEZA 1B1BA 2PG4A 2EIJH 1IAWA 5GADJ 1ZG5A 5JHFA 1UFMA 3HOZJ 1GUUA 2M8EA 1ORKA 3I9V2 4AYBN 1GV2A 4A3DJ 4QPQA 5L3EA 1YIJI 2RREA 2JJ7A 1T08B 3BR3A 3K10A 2V4JC 3WU0A 3FK7A 4L9JA 3I4MJ 1UCRA 4LLGF 2UV1A 3HSEA 3K4MA 2EINH 2HQAA 4PJMA 1QPIA 3W2AA 5CVUA 2CQKA 4A3CJ 3S3NA 2H6CA 1K7AA 1LUJB 4PDKA 2WA0A 3V7RA 4BE0A 2Q2EA 4L0YB 4HDUA 2R5YB 3AL0C 4LD5A 4AIHA 5EZHA 4NHJA 1IN6A 1GT0C 1AHDP 4HF2A 2PMZA 1YRNB 2YU9J 5AIPA 2IS6A 1SMYF 4ANJA 3O8GA 4D7NA 1BJZA 3DQVC 1W7PB 1D0YA 2E7XA 2VKHA 5E17F 3E6BA 1WWXA 5F08A 4DGWB 1FOKA 2JZYA 3ONQA 3L7WA 2DA3A 4MEXF 1IRXA 2XRNA 3G4SI 2QEXI 1RZ4A 2LY2A 2DK5A 4BJTA 4M74A 1TW2A 4NUBA 2FOKA 2X6OA 3M8FA 1ZRFA 2V26A 1P4XA 3MFKA 3QYFA 5FKNA 2CUFA 4CYCA 4NQWB 2A69F 1QZZA 4RAGA 4XLFA 3IWFA 2WBMA 4IHSA 2RN7A 1UHSA 3RKQA 1J75A 1DPUA 2CW0F 2HDWA 3SFIA 1MDMB 1WPKA 1BI1A 3P5JA 1TT5B 2ZFUA 2M34A 4PCQA 3F3XA 5IT9Z 2XKPA 4O5VA 2DTRA 2X1EA 3ELKA 3KLOA 2MGQA 2VC0A 3VYUB 5L3CA 3S32A 2PJPA 4HLXA 3S15J 4M73A 1FZPB 4HNVA 4JX6A 4HQEA 4KNYA 4QSHA 3E6MA 2GIVA 2Q0OA 5D8LB 5KAFC 3F8BA 2KIMA 1TQPA 4LLLA 2ZCWA 2OZUA 5IY5H 4PZJA 3DU6A 2ME6A 4BJ6C 5FLVA 4BE1A 3GUDA 3OOPA 2K9NA 2PMZN 2E1MC 4I98B 2A61A 3B6CA 2DDAA 4FQGA 1RR8C 6PAXA 3VSLA 1UAAA 2X51A 2L5QA 2ELJA 2O5RA 2GXGA 1XB4A 2NS7A 3RPUA 1NHAA 4XBFA 1W5CC 4F92B 1F1ZA 3P9IA 2WAFA 3DP7A 3OYBA 4IHWA 1WJEA 2R7UA 3T8RA 4DZJA 2A5YB 2V1DA 2OZ6A 1XCBA 2HOEA 1O3RA 3QOEA 4W97A 5BOXA 1B6AA 2M1BA 1JUMA 2NS8A 2D1VA 1J9IA 2P0WA 3PNVA 3TL4X 3U21A 4E7SA 4DBRA 3K70C 4BHPA 2V1XA 4EJVA 2ZSHB
chains in the Genus database with same CATH topology
4XK4A 4X6AJ 5EG0A 3SJMA 5F1JA 1UMQA 4QTRA 2XPWA 5GPCA 1JKRC 3QPLA 3S1QJ 4MFEA 2DMTA 1GV5A 4EEFG 1P7IA 2LK2A 3K2AA 5IYBJ 5C3EJ 5IYDJ 3JR9A 3RZDJ 4A3IJ 5E3LA 2VI6A 3GTPJ 3E7LA 4CYCB 3FKIJ 1JT0A 4I6ZA 3S16J 2DA7A 2LP0A 3B6AA 2O9LA 4ABZA 1JTYA 4V2FA 1FEXA 2JWTA 1VF9A 1R9TJ 4XIDA 3TW7A 2FX0A 1IJWC 2TRTA 2XB5A 2R5ZA 1ETVA 5IYCJ 2B63J 4M3DA 2IEKA 4XICA 3S17J 4IHXA 1I6HJ 1H88C 1RPWA 3ZQGA 5F0FA 2X9DA 2M8GX 2DJNA 5F27A 1X2MA 1TWGJ 4D7MA 1I3QJ 4DYQA 2VUMJ 1HCRA 2LTPA 2R7ZJ 2WB1N 4A3FJ 2R93J 2AHQA 3BTIA 3S2HJ 2Y30A 1IDZA 1RESA 3GTJJ 4LOCA 4A3GJ 1ETYA 1Z77A 3C2BA 2G0EA 2HXIA 3HOXJ 2ECBA 5J1UA 1FTTA 2CU7A 4A3MJ 1TWFJ 5M3FJ 1XS9A 4Y52J 1T33A 1X2NA 3A01A 2Y31A 3CQZJ 4L5EA 1MH3A 3CDLA 4IHYA 4JX5A 1DU0A 3BQYA 4M3BA 5EGOA 3M3YJ 2LLKA 1O4XA 1ETWA 3FIWA 1W0UA 2FD5A 2DA1A 2Y9YA 1ETXA 3PO3J 2ECCA 1BL0A 1Q1VA 2XPUA 3HB9A 2EZKA 4XRSG 1HLVA 1EF4A 2L0KA 3F0CA 4XRSA 3OSFA 4M3GA 3VPRA 2R5YA 1SANA 1IDYA 3GTKJ 2OPTA 4I76A 2DA5A 1TC3C 1K61A 5IPAA 1G2HA 3L1PA 2KT0A 2MW8A 5IOYA 2DTZA 5K7FA 2EH3A 3NARA 2LVSA 3ZQCA 2Y2ZA 2RAEA 3IH3A 4C3HJ 3IV5A 3G1OA 1AKHA 3TW6A 4C2MJ 1D5YA 3PM1A 2HDDA 1FJLA 4BBSJ 1JKOC 2W48A 3RZOJ 2ID3A 1FIPA 2EZLA 1TWAJ 5M3MJ 1JJ6C 4JYKA 1NK2P 4A93J 1LFUP 1QVUA 4UUSA 5DTDA 1H89C 2NVTJ 3G1LA 3BTLA 4MO7A 5FJ8J 1MSFC 1MBFA 1VNDA 1ITYA 4FISA 5F04A 1FTZA 2LFBA 2FJ1A 2LY9A 4BKXA 2KDZA 3TEDA 3GTGJ 3JRAA 1E3OC 1JGGA 5C4XJ 2NVQJ 1A5JA 3S1MJ 2OF7A 5IP6A 3ZQIA 1B8IA 3TP3A 3JRBA 1BA5A 2CUEA 4S0HB 4MLOA 1P7JA 1S7EA 2XPVA 1HOMA 1BW6A 3BR1A 3BR0A 3A01B 2DMQA 5IOZA 3JRHA 1F43A 5EDNA 1ZR4A 3S2DJ 2NVXJ 5JLXA 5EGOB 5F0CA 3BR6A 4C3JJ 3ZQLA 5GP9A 5EYRA 4W1UA 1HF0A 3CMYA 1AU7A 5E3NA 3A03A 1A6IA 2Y0SN 4B3AA 1ZTRA 5JLWA 1NK3P 4M3FA 4DW6A 2L7ZA 5K7ZA 4Y7NJ 1RKTA 5FKOA 1OCTC 1HDDC 4A3BJ 1JJ8C 2GM4A 2D5VA 3UKGA 1MH4A 1XG1A 5FKLA 2GLOA 1B72B 1TWHJ 3BTCA 1POGA 1MBGA 4XRMA 3JRDA 1JUSA 2HQ5A 3GTMJ 2IAIA 1PUFA 3JRIA 3DEWA 1RR7A 3JRCA 3MVPA 1IRZA 2EQRA 1XC5A 2HOSA 5M5YJ 1AKHB 3BT9A 3GTLJ 1H8AC 9ANTA 2HYJA 2DA4A 1JKQC 2E2JJ 2JA6J 2CRGA 4QIWN 1RKWA 3HBLA 4FE7A 2JA5J 3S1RJ 3BTJA 2E1OA 3HOYJ 4A3KJ 3M4OJ 3I4NJ 1ZQ3P 2X48A 2LR8A 5F0HA 3CCYA 2LD5A 2XB0X 1IUFA 2O8KA 1U8BA 3BG5A 3HKZN 3BG9A 4D5FA 5EZGA 4BBRJ 3PO2J 1BW5A 1SFOJ 1I50J 3G1MA 2K9SA 5EG0B 2DA6A 2XRLA 5FKKA 2I10A 1WI3A 3BQZA 3Q3SA 4IHVA 2EZIA 1APLC 1YRNA 1LE8A 3FK6A 2O7OA 1VFCA 3GTQJ 2VPRA 2DMPA 3HGYA 3MN2A 1QVTA 4DZPA 2E19A 3QQAA 3O8HA 4DYRA 5M5XJ 4D5CA 3WHCA 4AC0A 1ZKGA 1QRYA 1T56A 2HI3A 3LOCA 2R5ZB 4X1EA 4RDUA 1ENHA 3IH2A 4J19A 4FCYA 2P81A 2E2IJ 2YUSA 4AUXA 5FLMJ 4A69C 3W6VA 5J1YA 1U78A 2HXOA 2M2EA 3MKLA 3HGGA 3S14J 2E2HJ 3BR2A 1WH5A 3Q0VA 4M3EA 2WAQN 1TWCJ 5J3LA 2DMUA 4FTHA 1IV6A 3GTOJ 2MG4A 2ELKA 2VKEA 1UG2A 1VI0A 2HOAA 4RBOA 1MNMC 3LSGA 1W0TA 2VKVA 2XGCA 4JX4A 3LSRA 4NDLA 1HDPA 1MBJA 3BR5A 1RETA 1CQTA 1IGNA 3H0GJ 3NAUA 2M0CA 3OSGA 1MBKA 1OFCX 1WH7A 5E3MA 3GBGA 5E3OA 2QF7A 3LNQA 1F36A 2H1KA 2H8RA 3HOZJ 1GUUA 1ORKA 4AYBN 5EEAA 1GV2A 4A3DJ 1JT6A 2JJ7A 3BR3A 1GDTA 5BNGA 3FK7A 3I4MJ 3IH4A 4V2GA 1QPIA 4A3CJ 3JRFA 5K7HA 2R5YB 3HDDA 2ZB9A 2L9RA 5EZHA 1GT0C 5EF6A 2Y9ZA 2IBDA 2JK3A 2L7MP 1AHDP 2YS9A 2M9HA 3JRGA 5M5WJ 1YRNB 2YU9J 3K7AJ 1LE8B 1ETQA 1U9OA 2CJJA 1GVDA 2ID6A 3O8GA 4D7NA 3S1NJ 1BJZA 2EBIA 3DCFA 2DA2A 1ZGWA 3JREA 5F08A 1Y1WJ 4BY1J 2K9QA 3TP0A 3Q0WA 3HEFA 1Y1VJ 3WHBA 2DA3A 1DU6A 1IC8A 2MSYA 4FE4A 4BXXJ 2R0QC 2X6OA 5J1RA 1FIAA 3OIOA 5FKNA 4UUSB 2CUFA 4CYCA 4GFBA 2XGEA 4G12A 2JN6A 2DMNA 2GBYA 5C44J 2WV1A 2EZHA 5FKMA 1UHSA 3RKQA 2CQQA 2FQ4A 3SFIA 1WPKA 1JTXA 3OOUA 2DN0A 1OCPA 4UUTA 2M34A 4C3IJ 1B8IB 1MBEA 5IP9J 2MGQA 2HOTA 3FISA 2JMWA 2COBA 3S15J 1WCMJ 1U9NA 1K83J 4JX6A 2CQXA 3HM5A 4HNVA 4DYCA 5GPAA 5IP7J 5HODA 3HOWJ 4JP0A 2JA7J 4QSHA 2JA8J 5DS9A 4MFDA 4MIMA 2NVYJ 2L7FP 4B1RA 1JUPA 1WGXA 3A02A 2ME6A 2N8GA 3RQIA 5FLVA 3ZQFA 1ETOA 1B72A 1ETKA 2K9NA 4BY7J 1OJLA 2PMZN 2XGDA 3SDGA 3H3VK 3QPSA 3LSJA 1IG7A 3B6CA 3BG3A 1MBHA 3HOVJ 1LFBA 4B4CA 1ZR2A 1JKPC 4A3JJ 2QCOA 1ZK8A 3ZOBA 5C4JJ 2NS7A 4A3LJ 4IHWA 4IEJA 4DZJA 3Q0UA 2NOGA 2AO9A 1X58A 4W97A 3ZQHA 4A3EJ 1PUFB 3HOUJ 2ME0A 3D1NI 2K40A 1NTCA 1JUMA 4M6VA 2NS8A 3LSPA 2XSDC 2LKXA 2TCTA 2R92J 1Z0XA 1MSEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK4 A;  4X6A J;  5EG0 A;  3SJM A;  5F1J A;  1UMQ A;  4QTR A;  2XPW A;  5GPC A;  1JKR C;  3QPL A;  3S1Q J;  4MFE A;  2DMT A;  1GV5 A;  4EEF G;  1P7I A;  2LK2 A;  3K2A A;  5IYB J;  5C3E J;  5IYD J;  3JR9 A;  3RZD J;  4A3I J;  5E3L A;  2VI6 A;  3GTP J;  3E7L A;  4CYC B;  3FKI J;  1JT0 A;  4I6Z A;  3S16 J;  2DA7 A;  2LP0 A;  3B6A A;  2O9L A;  4ABZ A;  1JTY A;  4V2F A;  1FEX A;  2JWT A;  1VF9 A;  1R9T J;  4XID A;  3TW7 A;  2FX0 A;  1IJW C;  2TRT A;  2XB5 A;  2R5Z A;  1ETV A;  5IYC J;  2B63 J;  4M3D A;  2IEK A;  4XIC A;  3S17 J;  4IHX A;  1I6H J;  1H88 C;  1RPW A;  3ZQG A;  5F0F A;  2X9D A;  2M8G X;  2DJN A;  5F27 A;  1X2M A;  1TWG J;  4D7M A;  1I3Q J;  4DYQ A;  2VUM J;  1HCR A;  2LTP A;  2R7Z J;  2WB1 N;  4A3F J;  2R93 J;  2AHQ A;  3BTI A;  3S2H J;  2Y30 A;  1IDZ A;  1RES A;  3GTJ J;  4LOC A;  4A3G J;  1ETY A;  1Z77 A;  3C2B A;  2G0E A;  2HXI A;  3HOX J;  2ECB A;  5J1U A;  1FTT A;  2CU7 A;  4A3M J;  1TWF J;  5M3F J;  1XS9 A;  4Y52 J;  1T33 A;  1X2N A;  3A01 A;  2Y31 A;  3CQZ J;  4L5E A;  1MH3 A;  3CDL A;  4IHY A;  4JX5 A;  1DU0 A;  3BQY A;  4M3B A;  5EGO A;  3M3Y J;  2LLK A;  1O4X A;  1ETW A;  3FIW A;  1W0U A;  2FD5 A;  2DA1 A;  2Y9Y A;  1ETX A;  3PO3 J;  2ECC A;  1BL0 A;  1Q1V A;  2XPU A;  3HB9 A;  2EZK A;  4XRS G;  1HLV A;  1EF4 A;  2L0K A;  3F0C A;  4XRS A;  3OSF A;  4M3G A;  3VPR A;  2R5Y A;  1SAN A;  1IDY A;  3GTK J;  2OPT A;  4I76 A;  2DA5 A;  1TC3 C;  1K61 A;  5IPA A;  1G2H A;  3L1P A;  2KT0 A;  2MW8 A;  5IOY A;  2DTZ A;  5K7F A;  2EH3 A;  3NAR A;  2LVS A;  3ZQC A;  2Y2Z A;  2RAE A;  3IH3 A;  4C3H J;  3IV5 A;  3G1O A;  1AKH A;  3TW6 A;  4C2M J;  1D5Y A;  3PM1 A;  2HDD A;  1FJL A;  4BBS J;  1JKO C;  2W48 A;  3RZO J;  2ID3 A;  1FIP A;  2EZL A;  1TWA J;  5M3M J;  1JJ6 C;  4JYK A;  1NK2 P;  4A93 J;  1LFU P;  1QVU A;  4UUS A;  5DTD A;  1H89 C;  2NVT J;  3G1L A;  3BTL A;  4MO7 A;  5FJ8 J;  1MSF C;  1MBF A;  1VND A;  1ITY A;  4FIS A;  5F04 A;  1FTZ A;  2LFB A;  2FJ1 A;  2LY9 A;  4BKX A;  2KDZ A;  3TED A;  3GTG J;  3JRA A;  1E3O C;  1JGG A;  5C4X J;  2NVQ J;  1A5J A;  3S1M J;  2OF7 A;  5IP6 A;  3ZQI A;  1B8I A;  3TP3 A;  3JRB A;  1BA5 A;  2CUE A;  4S0H B;  4MLO A;  1P7J A;  1S7E A;  2XPV A;  1HOM A;  1BW6 A;  3BR1 A;  3BR0 A;  3A01 B;  2DMQ A;  5IOZ A;  3JRH A;  1F43 A;  5EDN A;  1ZR4 A;  3S2D J;  2NVX J;  5JLX A;  5EGO B;  5F0C A;  3BR6 A;  4C3J J;  3ZQL A;  5GP9 A;  5EYR A;  4W1U A;  1HF0 A;  3CMY A;  1AU7 A;  5E3N A;  3A03 A;  1A6I A;  2Y0S N;  4B3A A;  1ZTR A;  5JLW A;  1NK3 P;  4M3F A;  4DW6 A;  2L7Z A;  5K7Z A;  4Y7N J;  1RKT A;  5FKO A;  1OCT C;  1HDD C;  4A3B J;  1JJ8 C;  2GM4 A;  2D5V A;  3UKG A;  1MH4 A;  1XG1 A;  5FKL A;  2GLO A;  1B72 B;  1TWH J;  3BTC A;  1POG A;  1MBG A;  4XRM A;  3JRD A;  1JUS A;  2HQ5 A;  3GTM J;  2IAI A;  1PUF A;  3JRI A;  3DEW A;  1RR7 A;  3JRC A;  3MVP A;  1IRZ A;  2EQR A;  1XC5 A;  2HOS A;  5M5Y J;  1AKH B;  3BT9 A;  3GTL J;  1H8A C;  9ANT A;  2HYJ A;  2DA4 A;  1JKQ C;  2E2J J;  2JA6 J;  2CRG A;  4QIW N;  1RKW A;  3HBL A;  4FE7 A;  2JA5 J;  3S1R J;  3BTJ A;  2E1O A;  3HOY J;  4A3K J;  3M4O J;  3I4N J;  1ZQ3 P;  2X48 A;  2LR8 A;  5F0H A;  3CCY A;  2LD5 A;  2XB0 X;  1IUF A;  2O8K A;  1U8B A;  3BG5 A;  3HKZ N;  3BG9 A;  4D5F A;  5EZG A;  4BBR J;  3PO2 J;  1BW5 A;  1SFO J;  1I50 J;  3G1M A;  2K9S A;  5EG0 B;  2DA6 A;  2XRL A;  5FKK A;  2I10 A;  1WI3 A;  3BQZ A;  3Q3S A;  4IHV A;  2EZI A;  1APL C;  1YRN A;  1LE8 A;  3FK6 A;  2O7O A;  1VFC A;  3GTQ J;  2VPR A;  2DMP A;  3HGY A;  3MN2 A;  1QVT A;  4DZP A;  2E19 A;  3QQA A;  3O8H A;  4DYR A;  5M5X J;  4D5C A;  3WHC A;  4AC0 A;  1ZKG A;  1QRY A;  1T56 A;  2HI3 A;  3LOC A;  2R5Z B;  4X1E A;  4RDU A;  1ENH A;  3IH2 A;  4J19 A;  4FCY A;  2P81 A;  2E2I J;  2YUS A;  4AUX A;  5FLM J;  4A69 C;  3W6V A;  5J1Y A;  1U78 A;  2HXO A;  2M2E A;  3MKL A;  3HGG A;  3S14 J;  2E2H J;  3BR2 A;  1WH5 A;  3Q0V A;  4M3E A;  2WAQ N;  1TWC J;  5J3L A;  2DMU A;  4FTH A;  1IV6 A;  3GTO J;  2MG4 A;  2ELK A;  2VKE A;  1UG2 A;  1VI0 A;  2HOA A;  4RBO A;  1MNM C;  3LSG A;  1W0T A;  2VKV A;  2XGC A;  4JX4 A;  3LSR A;  4NDL A;  1HDP A;  1MBJ A;  3BR5 A;  1RET A;  1CQT A;  1IGN A;  3H0G J;  3NAU A;  2M0C A;  3OSG A;  1MBK A;  1OFC X;  1WH7 A;  5E3M A;  3GBG A;  5E3O A;  2QF7 A;  3LNQ A;  1F36 A;  2H1K A;  2H8R A;  3HOZ J;  1GUU A;  1ORK A;  4AYB N;  5EEA A;  1GV2 A;  4A3D J;  1JT6 A;  2JJ7 A;  3BR3 A;  1GDT A;  5BNG A;  3FK7 A;  3I4M J;  3IH4 A;  4V2G A;  1QPI A;  4A3C J;  3JRF A;  5K7H A;  2R5Y B;  3HDD A;  2ZB9 A;  2L9R A;  5EZH A;  1GT0 C;  5EF6 A;  2Y9Z A;  2IBD A;  2JK3 A;  2L7M P;  1AHD P;  2YS9 A;  2M9H A;  3JRG A;  5M5W J;  1YRN B;  2YU9 J;  3K7A J;  1LE8 B;  1ETQ A;  1U9O A;  2CJJ A;  1GVD A;  2ID6 A;  3O8G A;  4D7N A;  3S1N J;  1BJZ A;  2EBI A;  3DCF A;  2DA2 A;  1ZGW A;  3JRE A;  5F08 A;  1Y1W J;  4BY1 J;  2K9Q A;  3TP0 A;  3Q0W A;  3HEF A;  1Y1V J;  3WHB A;  2DA3 A;  1DU6 A;  1IC8 A;  2MSY A;  4FE4 A;  4BXX J;  2R0Q C;  2X6O A;  5J1R A;  1FIA A;  3OIO A;  5FKN A;  4UUS B;  2CUF A;  4CYC A;  4GFB A;  2XGE A;  4G12 A;  2JN6 A;  2DMN A;  2GBY A;  5C44 J;  2WV1 A;  2EZH A;  5FKM A;  1UHS A;  3RKQ A;  2CQQ A;  2FQ4 A;  3SFI A;  1WPK A;  1JTX A;  3OOU A;  2DN0 A;  1OCP A;  4UUT A;  2M34 A;  4C3I J;  1B8I B;  1MBE A;  5IP9 J;  2MGQ A;  2HOT A;  3FIS A;  2JMW A;  2COB A;  3S15 J;  1WCM J;  1U9N A;  1K83 J;  4JX6 A;  2CQX A;  3HM5 A;  4HNV A;  4DYC A;  5GPA A;  5IP7 J;  5HOD A;  3HOW J;  4JP0 A;  2JA7 J;  4QSH A;  2JA8 J;  5DS9 A;  4MFD A;  4MIM A;  2NVY J;  2L7F P;  4B1R A;  1JUP A;  1WGX A;  3A02 A;  2ME6 A;  2N8G A;  3RQI A;  5FLV A;  3ZQF A;  1ETO A;  1B72 A;  1ETK A;  2K9N A;  4BY7 J;  1OJL A;  2PMZ N;  2XGD A;  3SDG A;  3H3V K;  3QPS A;  3LSJ A;  1IG7 A;  3B6C A;  3BG3 A;  1MBH A;  3HOV J;  1LFB A;  4B4C A;  1ZR2 A;  1JKP C;  4A3J J;  2QCO A;  1ZK8 A;  3ZOB A;  5C4J J;  2NS7 A;  4A3L J;  4IHW A;  4IEJ A;  4DZJ A;  3Q0U A;  2NOG A;  2AO9 A;  1X58 A;  4W97 A;  3ZQH A;  4A3E J;  1PUF B;  3HOU J;  2ME0 A;  3D1N I;  2K40 A;  1NTC A;  1JUM A;  4M6V A;  2NS8 A;  3LSP A;  2XSD C;  2LKX A;  2TCT A;  2R92 J;  1Z0X A;  1MSE C; 
#chains in the Genus database with same CATH topology
 3P7N A;  1OYY A;  3SJM A;  5F1J A;  3CP8 A;  4QTR A;  1LQ1 A;  4P5O A;  4IHT A;  1RNL A;  4EEF G;  4HV5 A;  1P7I A;  5IYB J;  3WTV C;  1U5T A;  3FXU A;  2VI6 A;  2OCC H;  3E7L A;  3FKI J;  2K7L A;  4KUM A;  4I6Z A;  4BS9 A;  1X4P A;  1LDJ A;  3OY9 A;  3GYH X;  1D0X A;  2OC6 A;  3VYT B;  1IJW C;  3GX4 X;  3FMQ A;  3TOA A;  2O03 A;  3WTS C;  2B63 J;  2A3S A;  3OMY A;  3OS2 A;  3CCV I;  4IHX A;  4QWQ A;  2R7X A;  4IO9 F;  2IS1 A;  1I6H J;  4CA0 A;  3PSI A;  5ERI A;  2DYR H;  1YHQ I;  3ZQG A;  2JSC A;  5F27 A;  1TWG J;  3F8F A;  4P1W A;  5DD8 A;  3CZ6 A;  5LGN A;  1O7L A;  3OL3 A;  4LIU A;  2LTP A;  4E7J A;  4YII A;  3EDP A;  4RAZ A;  4A3F J;  4WF2 A;  1XMA A;  3HUG B;  2AHQ A;  3LQQ A;  1U5T C;  3FZV A;  1IDZ A;  3BCB A;  1S5L C;  2VQL A;  3K4C A;  2F4M B;  3QP6 A;  1ETY A;  1S72 I;  2G0E A;  2HXI A;  3FXO A;  3HOX J;  2XAQ A;  2CU7 A;  4F3Q A;  1XDS A;  2LNB A;  4KN4 X;  4A3M J;  3TGN A;  1XS9 A;  4Q48 A;  2IW5 A;  2H1L A;  4HA8 A;  4LG3 A;  4JX5 A;  1MJA A;  3I59 B;  1DU0 A;  3SDB A;  2GXA A;  4PSW A;  1O4X A;  3RPQ A;  1ETW A;  4B43 A;  3CC4 I;  1UB9 A;  4ESJ A;  2ZME C;  1TL8 A;  2B9S A;  4HDV A;  1ETX A;  3ROU A;  3WU1 B;  1BL0 A;  1FOY A;  2P5L C;  2OD5 A;  1Q1V A;  5FO5 A;  2XPU A;  3KFW X;  4CO8 A;  2MH2 A;  4BQQ A;  4JOM A;  5E8G A;  2WAE A;  4XRS G;  4XSX F;  4XLP F;  3AL0 B;  2YR2 A;  3LSK A;  3ABL H;  2L0K A;  4AVZ A;  1K78 A;  3F0C A;  4XRS A;  5TIS C;  3G2B A;  3DTE A;  1IF1 A;  3CO7 C;  2L02 A;  4GCV A;  1UZC A;  3S2W A;  3PIO F;  2X6W A;  2OA4 A;  4ENJ A;  2LG4 A;  4UNO A;  2PMH A;  2XAJ A;  4Q4Z F;  3BJO A;  2HVQ A;  1IN8 A;  5K5O A;  2MYS A;  2VJ5 A;  1K61 A;  3L1P A;  1N77 A;  2KT0 A;  5HS8 A;  1OCC H;  1Z7L A;  2X6X A;  3C2G A;  2NYX A;  3F8C A;  3KX2 A;  4C3H J;  3ZQC A;  3N97 A;  1VQN I;  3TO7 A;  2LH9 A;  2W25 A;  3EUH A;  3K70 D;  3G1O A;  3TW6 A;  3H5N A;  1D5Y A;  3HIF A;  5TRD A;  3CC7 I;  3PM1 A;  4CCL A;  2JPC A;  1TBX A;  3MZY A;  3L9F A;  1S6L A;  1KU7 A;  1VZ0 A;  1WJA A;  2BY3 A;  4ZZL A;  1QNT A;  2DXI A;  1JKO C;  3CCE I;  2ID3 A;  1TWA J;  3PQK A;  1JJ6 C;  3E6D A;  3Q9V A;  3W6J B;  4G7Z F;  1NK2 P;  1LFU P;  1NG6 A;  1Z67 A;  2NVT J;  2ZO4 A;  1XN7 A;  3J81 K;  3L00 A;  4NNJ A;  1R5H A;  2DO7 A;  5F04 A;  1XSV A;  2H94 A;  2LFB A;  1W1W E;  3LA2 A;  4BKX A;  2KDZ A;  4R79 A;  3TED A;  2C6Y A;  4XL9 A;  2GQQ A;  4V19 K;  3S8P A;  5LHG A;  1LPQ A;  4UB8 C;  1JGG A;  2NVQ J;  1R7J A;  1GHC A;  2AQF A;  5KVR A;  1B8I A;  2IS4 A;  1T0F A;  3EUH C;  1P7J A;  5ICE A;  1FOW A;  2HEO A;  1HOM A;  3AKZ A;  2EJR A;  1W5T A;  3OWT A;  3A01 B;  2DMQ A;  1UST A;  5CQE A;  5IOZ A;  1ZR4 A;  1LFP A;  2E1M B;  3ZPL A;  5F0C A;  1BR4 A;  5B66 C;  3OYI A;  3M8E A;  2EK5 A;  2CG4 A;  1A6I A;  4A5M A;  2Y0S N;  4B3A A;  1GXQ A;  4M3F A;  2GZW A;  5K7Z A;  2K9M A;  3HHH A;  4WX9 A;  5FKO A;  5E20 A;  3LSI A;  2FF4 A;  2RNJ A;  1A35 A;  4U7D A;  4RS8 A;  4A3B J;  3NRV A;  2HVS A;  1T0F C;  2CSO A;  2DDB A;  3RKY A;  1JJ8 C;  2D5V A;  3UKG A;  3K1P A;  4JQF A;  4AU7 A;  1CF7 B;  1U0J A;  3NEU A;  1XG1 A;  3FWE A;  3NQO A;  3TO9 A;  4ZDP A;  3OYG A;  2PEX A;  2GWR A;  3JRD A;  1MBG A;  1X1D A;  2CV0 A;  1JUS A;  1X3Z B;  3VSK A;  3RQ4 A;  4WCG A;  2VT2 A;  4IZZ A;  4LMY A;  1ZAO A;  2Z3Y A;  1FBS A;  2PN6 A;  2FML A;  1XC5 A;  3I3L A;  2NAZ A;  5DCM A;  1AKH B;  1E17 A;  2QM3 A;  3SEQ A;  3BY6 A;  5J8C A;  2VJ4 A;  1LVK A;  1OMI A;  2IA1 A;  4XOR A;  3L2R A;  1VQ7 I;  4QIW N;  2JA6 J;  2AXT C;  3S1R J;  3HOY J;  3GZ5 A;  3JAM K;  4ENM A;  1W36 C;  3HRS A;  5F0H A;  1N75 A;  3CF5 F;  3K9T A;  3DKX A;  2XB0 X;  2VQH A;  2KP6 A;  4XKC A;  3JTG A;  1R58 A;  3BG6 A;  3K2Z A;  3HKZ N;  2CUZ A;  4D5F A;  3DPL C;  2HQR A;  3WGG A;  2V7F A;  3PO2 J;  3NWS A;  4HSR A;  2KJC A;  1SFO J;  2XSJ C;  2K9S A;  5CVJ A;  3UR3 C;  4BHB A;  3OIP A;  3EUK L;  1SD5 A;  2E7W A;  3BQZ A;  4UV9 A;  4OIN F;  4IPA A;  3ZGK A;  2FBI A;  2RNG A;  3ABT A;  3KP5 A;  3H35 A;  3HOT A;  1YRN A;  3F22 A;  1EJ9 A;  1YJN I;  1U5T B;  1FOX A;  2I8D A;  5GTI C;  1W7P A;  1VFC A;  4G7H F;  2FRH A;  2R7V A;  3GTQ J;  1YI2 I;  4HQM A;  1QVT A;  4U7B A;  1K79 A;  2VT3 A;  4YEJ A;  3O8H A;  3MEX A;  3CO6 C;  2RKH A;  4IRI A;  4UB6 C;  2GA1 A;  4ETS A;  1Y8Q B;  3LOC A;  2NNN A;  1FLI A;  4BAC A;  2L4M A;  1TQM A;  1WJB A;  2R7F A;  4CCM A;  2PBI A;  1G6N A;  2YUS A;  4S04 A;  1LDD A;  2V1N A;  5D5W B;  1R49 A;  4N0B A;  2G7U A;  2JPB A;  2ZME B;  4NQW A;  2E60 A;  3F6O A;  1USS A;  1X4O A;  3VOD A;  3PNY A;  3AAF A;  5FD5 A;  3HGG A;  2K27 A;  2DT7 B;  5L3G A;  1WH5 A;  3ZMZ A;  3Q0V A;  4M3E A;  4QPO A;  3V8L A;  2KHM A;  5E1X A;  5J3L A;  3BG7 A;  1D5V A;  2UXX A;  3R6S A;  1B9M A;  2ZJ2 A;  3LWF A;  1HKT A;  2KL4 A;  5HDG A;  2ZXI A;  1SAX A;  2VN2 A;  5FD6 A;  1NH3 A;  2K5C A;  3CES A;  2K4B A;  3OYN A;  1LKX A;  4KMF A;  3LSG A;  4Y17 A;  1R1V A;  3LSR A;  5AON A;  5CVV A;  4KFC A;  4HAM A;  1WHU A;  1BIB A;  1MIJ A;  4HF0 A;  4I99 C;  2BGC A;  4A6D A;  3VFZ A;  2M0C A;  3OSG A;  1RRJ A;  4EJO A;  2XAF A;  2H1K A;  1Y0N A;  2QF7 A;  4XRF A;  5AIQ A;  4S05 A;  3GLX A;  4HNU A;  2QWW A;  3ABM H;  5EEA A;  3REO A;  3ECH A;  1QZE A;  1GVJ A;  1GDT A;  4XQF A;  4BGD A;  2YX4 A;  1K78 B;  2K9L A;  3BWG A;  3U1D A;  3W2V A;  3LQR A;  3H9J A;  5FRO A;  1X1B A;  3ZN0 A;  2NS0 A;  4IL6 C;  5HLI A;  3ZMD A;  1Z1D A;  3JRF A;  2CV1 A;  5K7H A;  4XNF A;  2L9R A;  3R61 A;  3FHN A;  1XGS A;  5EF6 A;  1GLN A;  1MD0 A;  2Y9Z A;  2YS9 A;  3GW2 A;  3JRG A;  3MKW B;  5HDN A;  4NC8 A;  5D5X B;  2ID6 A;  1T2K A;  3S1N J;  3F6V A;  4HX4 A;  1G3Y A;  1ZGW A;  3IWZ A;  3KET A;  3JRE A;  2K9Q A;  3OR2 C;  3TP0 A;  4II2 A;  2BE5 F;  5HLH A;  1SC7 A;  1R5I D;  3RI4 A;  2KIF A;  5FLX Z;  2D1H A;  2DQR A;  3CLO A;  1FYM A;  4CCK A;  2DJI A;  2IXS A;  2WAQ A;  1WVR A;  3BCA A;  1T39 A;  4BXX J;  2EA4 A;  3KP7 A;  2ZJQ F;  2R0Q C;  4OIQ F;  2YSR A;  3KYD B;  4IQJ A;  1FIA A;  2EWN A;  4GFB A;  2XGE A;  2WY7 Q;  5F6F A;  2MBF A;  1ACI A;  4RGR A;  5E1W A;  1STZ A;  4PUS A;  2WV1 A;  2CFX A;  3ML6 A;  4G8X A;  2QBY B;  2E35 A;  4CXF A;  1PYV A;  1ON2 A;  4Y15 A;  3MZH A;  2IRF G;  4A0Z A;  4G7O F;  2BXY A;  1QO0 D;  1VQM I;  1ULY A;  3OOU A;  2DN0 A;  2Z9O A;  1TNS A;  3HXL A;  1MBE A;  3L2W A;  4U0W A;  4E7K A;  1B8I B;  3A1Y A;  4AYB A;  2HOT A;  2FOW A;  2COB A;  4E7I A;  4IQ4 A;  3N05 A;  4E7L A;  5HOD A;  1K83 J;  2R7R A;  4DYC A;  1P2F A;  3HPG A;  3CCS I;  2JA8 J;  1KYW A;  2VE9 A;  1DGW Y;  4G6D A;  4MIM A;  3ISP A;  4KIT B;  1OCR H;  3BC8 A;  4J00 A;  1JUP A;  2X1D A;  3BJ6 A;  4IRH A;  2STW A;  2OV7 A;  3M7G A;  3ZQF A;  1IZ1 A;  1ETO A;  2M7B A;  1S7O A;  1SAU A;  4BY7 J;  4GDF A;  1OIS A;  3RCO A;  3DBR B;  3LSJ A;  2JSP A;  3B73 A;  1Y6I A;  1MBH A;  1LFB A;  1V55 H;  2HFH A;  3GO5 A;  3FBI B;  3K0L A;  3I59 A;  2IA2 A;  4PJ0 C;  2COM A;  2LSO A;  1XD7 A;  1UHM A;  2AXL A;  3Q0U A;  1BR1 A;  5ED4 A;  2FNP A;  5LD2 C;  1OCZ H;  3H92 A;  3RJP A;  3HOU J;  1F9N A;  2ME0 A;  5GAE J;  2GOX B;  4XLC A;  3LSP A;  2QLZ A;  4F93 B;  1K6O A;  1FMW A;  5B1A H;  5FRM A;  4U88 A;  5DCM B;  4EJU A;  2DQL A;  2ISY A;  1Z91 A;  3LST A;  2OU2 A;  3OS1 A;  1UMQ A;  3S93 A;  4R1H A;  3HPH A;  1D8K A;  1OPC A;  1JKR C;  3ERE D;  4MFE A;  2DMT A;  3S1Q J;  3K2A A;  5C3E J;  3SZP A;  4KYW A;  2L01 A;  3TMO A;  3JR9 A;  5E3L A;  3GTP J;  3TO6 A;  2H6B A;  1J2X A;  2M7A A;  3AG4 H;  2OTL I;  2CGP A;  1I3A A;  2KJB A;  4C30 A;  3QPT A;  2LP0 A;  3B6A A;  5JI6 A;  4NC6 A;  4V2F A;  3OL4 A;  2JWT A;  1VF9 A;  1OQY A;  4XID A;  3HL2 A;  2AS5 F;  2FX0 A;  2FEZ A;  2LF7 A;  2XHK A;  3I58 A;  5KCM A;  3RYR A;  1YTY A;  2R5Z A;  2J5O A;  4M3D A;  3S17 J;  5JVG F;  4A12 A;  1N78 A;  1RPW A;  5ICC A;  3ASO H;  3AG2 H;  2ACJ A;  2VJJ A;  1HSJ A;  3JCU C;  4DYQ A;  5DV5 A;  1IRG A;  3IRR A;  3U1K A;  1ZRC A;  4MEY F;  3CMA I;  1P6R A;  2X4H A;  2Y30 A;  4KIC A;  3GTJ J;  3W6K B;  1FYK A;  1ZLJ A;  4A3G J;  2UWM A;  1Z77 A;  1FYL A;  2IT0 A;  2ECB A;  4YIR X;  4IF4 A;  1H9T A;  4WXH A;  5M3F J;  2ZC2 A;  4Y52 J;  1X2N A;  3A01 A;  2Y31 A;  4L5E A;  1MH3 A;  3CME I;  4D0P A;  2GIZ A;  2XUB A;  1A04 A;  3L2V A;  2CW7 A;  3DWL E;  1BI0 A;  1UHW A;  2R7S A;  5HLT A;  4MGR A;  3JSP A;  4HPQ A;  4B8X A;  1DPR A;  4OIO F;  2VLA A;  2BZT A;  5A2Q K;  3PO3 J;  4ITV A;  1OKR A;  3LFK A;  3EYI A;  5E1Z B;  4U0V A;  1KZH A;  3F23 A;  4NB5 A;  2MD0 A;  1QQI A;  3OSF A;  2HZD A;  1P92 A;  2Z2S B;  3VDX A;  1DQU A;  5DUI A;  2VE8 A;  1CF7 A;  2OPT A;  2M4G A;  4ASN A;  1ZRE A;  2DA5 A;  5IPA A;  2A05 A;  5BMZ A;  3CUQ A;  1AWC A;  5K7F A;  3CJT B;  2EH3 A;  2QKL B;  3DV8 A;  1H9G A;  1VQ8 I;  5E79 C;  1VQ6 I;  2Y2Z A;  4XM3 A;  1ONV A;  4B44 A;  3IKT A;  1AKH A;  2RVC A;  2JQ7 A;  5EJC A;  3EPZ A;  1KU2 A;  3ZMU A;  4X0G A;  3RZO J;  1YO5 C;  1QGP A;  1T8I A;  3WOD F;  2F2E A;  3M8J A;  4A93 J;  3QPH A;  4EMS A;  1QVU A;  4UUS A;  1R00 A;  1H89 C;  3BTL A;  4HX7 A;  3AG1 H;  1MBF A;  3RSN A;  1ITY A;  1AA7 A;  4FIS A;  4EM0 B;  1OCO H;  3QOD A;  2GOM A;  1KYZ A;  3FF5 A;  3CUQ C;  1KGS A;  2PFB A;  2XAG A;  1E3O C;  1RUN A;  5H6R A;  5C4X J;  1A5J A;  2HZT A;  2L9V A;  1Z05 A;  2OF7 A;  3H36 A;  5IP6 A;  3S1M J;  1HA8 A;  2KRC A;  4H4K C;  4WXD A;  2E5Z A;  4GO1 A;  3TP3 A;  3JRB A;  3S3O A;  2ISZ A;  1ZN2 A;  2NRA C;  4IRG A;  4BU2 A;  4MLO A;  5J6X A;  2IVM A;  2DK8 A;  2ZXH A;  3WE3 A;  3CCL I;  2UXN A;  4RMN A;  3BR0 A;  1ZGA A;  2BY0 A;  3F9K A;  4M6X A;  3H5R A;  1Y39 A;  3I56 I;  1X1C A;  1F43 A;  5EDN A;  5J8F A;  4I09 A;  5EGO B;  4C3J J;  2JT1 A;  3D5L A;  2W85 A;  3R4K A;  4N4N B;  5GP9 A;  2E36 A;  3CMY A;  3QRF F;  4IJA A;  2XGX A;  2WTE A;  1NK3 P;  4DW6 A;  3I0T A;  4Y7N J;  4YFX F;  2ZME A;  3CLQ A;  2L2O A;  4BQA A;  4EJT A;  3EYY A;  2K85 A;  1IXR C;  4ZZD A;  2XC7 A;  2IGM A;  2VOO A;  4PJL A;  4EAT A;  1F5T A;  2MFZ A;  2NVU B;  1Z3Y A;  3H9G A;  3WGI A;  4G94 A;  1OYW A;  2LYC A;  2M87 A;  5FKL A;  1TWH J;  1LDK B;  4GYG A;  3I71 A;  3GTM J;  3O2P E;  2ZJR F;  1PUF A;  3GZN B;  3C1D A;  2L9S A;  2KLO A;  2Q8K A;  3KCC A;  5BQT A;  1ZH5 A;  4KN7 X;  1IUY A;  3MVP A;  4OAZ A;  4ON0 A;  1D1A A;  4AIK A;  2KZG A;  2LRE A;  4PFP A;  2P5K A;  1PVE A;  3GTL J;  9ANT A;  2VBY A;  1H8A C;  2V9P A;  2HYJ A;  5BPI A;  1DUX C;  2JTV A;  3KEO A;  3K4J A;  1JKQ C;  3OYH A;  3ZQ7 A;  2XAH A;  2HGC A;  4HX8 A;  1TZL A;  4A3K J;  1XTA A;  3I4N J;  2L4A A;  3PJR A;  1ZHF A;  3WTY C;  1B4A A;  2Z99 A;  2LY1 A;  2DPD A;  1AOY A;  2NXN B;  1U8B A;  3BG5 A;  4CYD A;  3BG9 A;  5ILU A;  5EZG A;  4BBR J;  2XV4 S;  2W7N A;  4A6E A;  2RV8 A;  4RM3 A;  1YIT I;  2DA6 A;  4I02 A;  2FSW A;  5GTH C;  2I10 A;  1WI3 A;  1HW2 A;  1YIO A;  2KQR A;  1KU9 A;  2W1O A;  1U8R A;  3SHF A;  1SMT A;  2QQ8 A;  2Y0S A;  5L3F A;  2DFH A;  2XF7 A;  1MMG A;  4OIR F;  1EA3 A;  3LSM A;  3FXK A;  4M9S A;  5JVT A;  1O3S A;  2O7O A;  3FXL A;  3VEP A;  1HW1 A;  4FHT A;  2ZKZ A;  2XAU A;  1D1B A;  2VPR A;  4L5I A;  4OOI A;  1TLH B;  3HGY A;  2PJR B;  4DZP A;  2NNY A;  4Z2Y A;  3F21 A;  1H0M A;  3DF8 A;  1YYV A;  4CCO A;  4D5C A;  1O3Q A;  3IUO A;  4XN3 A;  1ZKG A;  1QRY A;  1T56 A;  2HI3 A;  4AC0 A;  2R5Z B;  1QHG A;  4LG0 A;  2L54 A;  3FX3 A;  3IH2 A;  3VYS B;  2IGN A;  2W82 A;  3O3K A;  2FMY A;  3WTZ A;  4J19 A;  2P81 A;  3FM3 A;  4LIT A;  2E2I J;  2PQ8 A;  4AUX A;  1IO2 A;  1IXS B;  4E7Z A;  3LSH A;  1YOV B;  2M2E A;  2R7T A;  1TTY A;  2QBY A;  4OMY A;  2JRM A;  3SZT A;  4A2U A;  3KYC B;  3L2C A;  3J7Y J;  3CCU I;  2CMP A;  3GXO A;  1HBX G;  1TWC J;  3RTR A;  3HOS A;  3GTO J;  2VB6 A;  4XN0 A;  1R71 A;  4EM2 A;  2CV2 A;  2B7E A;  1WKM A;  1Z3X A;  2LBF B;  2BVM A;  1WI9 A;  2A6H F;  2B0L A;  4KA4 A;  1WJD A;  3GFM A;  2ELK A;  2VKE A;  3RIR A;  1UG2 A;  1VI0 A;  4RB0 A;  2RQP A;  2HOA A;  3HKZ A;  2L3D A;  4L9V A;  4HNT A;  3C18 A;  4MHG A;  3CD6 I;  1MBJ A;  3BR5 A;  1CQT A;  4UUV A;  2ZJP F;  3H0G J;  3S3M A;  1MBK A;  5E3M A;  1PUE E;  3GBG A;  3LNQ A;  1F36 A;  2H8R A;  4J01 A;  5HLG A;  4Y33 A;  1JT6 A;  1XGN A;  2LDU A;  3QWL A;  5BNG A;  4MTE A;  4I7H A;  3F8M A;  2MLK A;  3IH4 A;  4V2G A;  4YG2 F;  2QKM B;  1HC8 A;  1VQ4 I;  2CS3 A;  4GXO A;  1Z0X A;  1SD6 A;  5D5V B;  2QA4 I;  2WAD A;  2V79 A;  3HDD A;  2BOL A;  5KHD A;  2ZB9 A;  2QQ9 A;  2QSH X;  1KQ0 A;  2IBD A;  1ZRD A;  2M9H A;  3CUQ B;  4BJ5 C;  1M1E B;  3K7A J;  1ETQ A;  1U9O A;  2CJJ A;  3PIP F;  2DT6 A;  5FGM A;  1YLF A;  1YG2 A;  3DCF A;  1MW7 A;  2VL8 A;  2FU4 A;  3L2U A;  3EUA A;  4OWR B;  4BY1 J;  4KIB A;  2A68 F;  4PGH A;  3Q0W A;  1Q1H A;  4UVB A;  2P7C B;  3HEF A;  5H20 A;  4AWX B;  2E5N A;  4MQV A;  3HRU A;  4PFO A;  3NWT A;  1DU6 A;  1IW7 F;  1ZYR F;  1IC8 A;  3PFI A;  4CCJ A;  2BW3 A;  2MSY A;  4FE4 A;  1P4W A;  3OYK A;  4F55 A;  1ZG1 A;  1OLT A;  2DYS H;  3K4B A;  3OIO A;  5EEH A;  2VKD A;  1VQK I;  2P6T A;  4UUS B;  2VC1 A;  3PL8 A;  2DU9 A;  1WJ5 A;  4G12 A;  2KDO A;  2BVL A;  2DMN A;  2GBY A;  3BPV A;  1X1P A;  4LLN A;  2EZH A;  3CJQ B;  4Q47 A;  5FRN A;  3I5U A;  4E7H A;  2MAB A;  3K1M A;  4LK0 F;  2DCE A;  1G8X A;  3OYA A;  4HZF A;  3LAP A;  3WGH A;  1QA6 A;  2K4J A;  4AD9 A;  1WCM J;  4L9T A;  3D5S C;  2CQX A;  3HM5 A;  3JTH A;  4P9U A;  4JP0 A;  4YEL A;  2JA7 J;  4XOT A;  1UG0 A;  2OQG A;  2P5V A;  4PJJ A;  2JRT A;  4XKV A;  3COA C;  2GA2 A;  1SVM A;  2NVY J;  1F4K A;  1U2W A;  4B1R A;  3KYL A;  4DNC A;  1WGX A;  3A02 A;  4KDP A;  2WWY A;  1FNN A;  1B72 A;  1X1A A;  4R8H A;  2XGD A;  3HSF A;  4OMZ A;  3H3V K;  4LB6 B;  1TQI A;  3QPS A;  1IG7 A;  3BG3 A;  2MD5 A;  2F48 A;  3HOV J;  4B4C A;  1HXD A;  1LJ9 A;  1G59 A;  2HR3 A;  4A3J J;  2QCO A;  1ZK8 A;  2OUM A;  1BJA A;  3ZOB A;  2PMU A;  3KIO A;  5CQG A;  4A3L J;  3OYL A;  4IEJ A;  2BV6 A;  5DD4 A;  3PQJ A;  2W24 A;  1SFK A;  2DLL A;  1V4R A;  4L18 B;  1DP3 A;  3PFY A;  4A3E J;  3R0A A;  1FWZ A;  4HYE A;  2VBX A;  1PUF B;  3WTU C;  2O3F A;  3ZP5 A;  4M6V A;  3OR1 C;  4ZTJ A;  2WV0 A;  4Q5S F;  3VYR B;  1B59 A;  1WFX A;  2TCT A;  3GCM A;  3WU2 C;  4BQN A;  5IT9 K;  2IJL A;  4JBA A;  3P9K A;  1YW8 A;  3DTI A;  4JK1 X;  3W3C A;  2YPR A;  4X6A J;  5EG0 A;  3G3Z A;  2F5E A;  2X85 A;  4E4H A;  3VB2 A;  4BH9 A;  2ZSI B;  5GPC A;  3GFL A;  1MJ9 A;  2HKO A;  3QPL A;  1R4N B;  1SVL A;  1YX3 A;  2JUC A;  3ZMV A;  1MMS A;  5IYD J;  3RZD J;  3BJA A;  3QAH A;  2XF6 A;  5FFX A;  1JT0 A;  4Y4R A;  2VQC A;  4A0X A;  2OAZ A;  2W4S A;  2X6Y A;  3S16 J;  3FM5 A;  4ABZ A;  1JTY A;  2VON A;  3U9G A;  1FY7 A;  5H2F C;  1FEX A;  4BE2 A;  3A4C A;  1G4D A;  2TRT A;  5J47 A;  3VOE A;  5IYC J;  2ZBK A;  3GFJ A;  5DEQ A;  2IEK A;  2EFN A;  3WTX C;  5FB2 A;  2O61 A;  3CP2 A;  2LMD A;  5F0F A;  2BHZ A;  2M8G X;  1V5F A;  2X9D A;  1X2M A;  4XLA A;  1VQO I;  4D7M A;  2VUM J;  2OCE A;  1S3J A;  4I01 A;  3FXR A;  2WB1 N;  1R1T A;  2LF8 A;  3FMR A;  2R93 J;  3S2H J;  4K2E A;  4EGZ A;  1RES A;  2EV6 A;  3EET A;  3FXM A;  4DBQ A;  3E5X A;  2A07 F;  1K4T A;  3O6B B;  4C2T A;  4FET A;  3C2B A;  1YQA A;  3HTS B;  3BPX A;  4LG0 B;  1RC9 A;  5J1U A;  1FTT A;  2D2W A;  2DOA A;  4UVC A;  5D5U B;  4L0Z B;  4GGG A;  1TWF J;  1T33 A;  2VQG A;  3BRO A;  1DGR M;  2CH0 A;  4M9X A;  3CDL A;  5JHU A;  2F4O B;  3I64 A;  4KIF A;  3R60 A;  2A6T A;  3BQY A;  4M3B A;  5EGO A;  2EA2 A;  3J7Z I;  2DI3 A;  3M3Y J;  2LLK A;  2EFQ A;  1X3W B;  3FIW A;  4AVP A;  3J81 Z;  4ZYG A;  1YW7 A;  1XGO A;  2EFP A;  1YFH A;  2BYV E;  2ECC A;  3L2Q A;  3MKZ A;  3DXJ F;  5DYM A;  3HB9 A;  1JHH A;  2HS5 A;  5EEG A;  1HLV A;  1FP2 A;  4BXF A;  1EF4 A;  2I5U A;  3E6C C;  4RGU A;  2JVH A;  1U3E M;  2X1C A;  3G71 I;  5J4Y A;  3H5A A;  2PI0 A;  4EVI A;  4G6Q A;  4M9Z A;  5D6F A;  3VPR A;  1IDY A;  4ZJZ A;  3CMM A;  1TC3 C;  5LEK A;  1G2H A;  2XIG A;  3V7C A;  1R22 A;  2FBK A;  2MW8 A;  1LVA A;  2ZXW H;  3BZ6 A;  3WG9 A;  2VOP A;  2XF5 A;  2Y0M A;  3M07 A;  4NC7 A;  5KAI C;  1XX5 A;  4P96 A;  2R7W A;  2RAE A;  3IV5 A;  3DLL F;  4BXU A;  2O6G E;  1HW5 A;  1ODD A;  4UV8 A;  3G73 A;  1X3U A;  4C2M J;  4Y3O A;  1MMD A;  2JUG A;  4BBS J;  1I5Z A;  1WJF A;  3ESW B;  3A0H C;  3K6G A;  2EZL A;  4RLQ A;  5M3M J;  5DDG A;  3DKW A;  4XLH A;  5GAH J;  5DTD A;  2KZV A;  3KEQ A;  5FJ8 J;  1MSF C;  1VND A;  4YIF A;  2ADU A;  1FTZ A;  3TDZ C;  4KMU X;  5HNF A;  5K5Q A;  3OS0 A;  3T8T A;  3GTG J;  4HF1 A;  1HKQ A;  4ZYD A;  2M4K A;  4E6K G;  2BW3 B;  2HNH A;  1T38 A;  1I27 A;  3ZQI A;  2F5C A;  1D3Y A;  3C7J A;  4YRV A;  2CUE A;  1BA5 A;  1O57 A;  2P8T A;  2PX9 A;  5LGT A;  2DFF A;  2ZNZ A;  1S7E A;  1A6Q A;  3BR1 A;  1MZB A;  2CUJ A;  2K3F A;  4CSW A;  2HPM A;  4DOZ A;  2FQ3 A;  3JAM Z;  3S2D J;  2NVX J;  2IP2 A;  3T1B A;  2PJR A;  1LEB A;  3ASN H;  2Z33 A;  3ZQL A;  2LRD A;  2VBZ A;  1R5G A;  3B02 A;  5EYR A;  4W1U A;  1AU7 A;  5CVI A;  3H3U A;  5E3N A;  3A03 A;  3F72 A;  3KEY A;  1W5S A;  4YFN F;  3IAM 2;  1ZTR A;  3IC7 A;  4HST A;  2CWE A;  2L7Z A;  1ERD A;  5HVQ C;  3D0S A;  1HDD C;  4F7Z A;  3FKJ A;  2GM4 A;  3BLY A;  3DBH B;  1O7F A;  4ZYH A;  1MH4 A;  4PK4 A;  5ICG A;  2FUG 2;  2DBB A;  3LA7 A;  4IVN A;  4BUP A;  2KRH A;  1B72 B;  3BTC A;  1PP7 U;  1KON A;  4XKB A;  1JHF A;  2HQ5 A;  3FDY A;  2LBF A;  4XR6 A;  2IAI A;  2QQA A;  1TT0 A;  3DEW A;  2QVO A;  4XSZ F;  1RR7 A;  2HKX A;  3IAS 2;  2EQR A;  4TV7 A;  2HOS A;  1EH8 A;  4KT5 C;  3RDI A;  3SQN A;  3MKY B;  4BYY A;  2DA4 A;  3KZZ A;  4EJW A;  5L3D A;  2HVR A;  2CQN A;  5B3S H;  4N9I A;  1FC3 A;  3HBL A;  4FE7 A;  4RB1 A;  1BBY A;  2JA5 J;  2E1O A;  3M4O J;  3RKW A;  4D9J A;  1ZQ3 P;  1PJR A;  1LNW A;  2LR8 A;  2QZ8 A;  2P6S A;  1P4A A;  3CCY A;  3V42 A;  4BHC A;  4AIJ A;  4DQ2 A;  2LD5 A;  1JGS A;  3DPU A;  1IXC A;  3TDU C;  3J7A O;  2O8K A;  2QSF X;  3SFZ A;  1V5G A;  3J80 K;  2BBY A;  1WZ2 A;  1A31 A;  4WK8 F;  1BW5 A;  2CQ7 A;  4RM2 A;  1I50 J;  5EG0 B;  4ENK A;  1J5Y A;  2XRL A;  3MCZ A;  1V5E A;  5B1B H;  4KIS A;  1MMN A;  2F5F A;  4RA2 A;  5HS7 A;  1BM9 A;  1OYI A;  1RI7 A;  3MZ8 A;  1APL C;  5CKT A;  4D1Q A;  3HHG A;  3N4M A;  1WRJ A;  2V6E A;  3TQN A;  2CYY A;  1T98 A;  4ZC3 A;  3H3Z A;  1TNT A;  1YW9 A;  3VWB A;  3QQA A;  2Y69 H;  2Y75 A;  3F8N A;  3C3W A;  3WHC A;  1HKS A;  2HQN A;  3I4P A;  2TDX A;  4X1E A;  2NOJ B;  1ENH A;  2BHY A;  4FCY A;  2BY1 A;  4ZH4 F;  3RYP A;  1RIO H;  2KKO A;  5K1Y A;  2EFW A;  4A69 C;  3W6V A;  1S29 A;  3CCR I;  4HRI A;  2XAS A;  2OBP A;  1VTN C;  3E97 A;  1FSH A;  1OR7 A;  3E3V A;  3IRQ A;  2G9W A;  4HW0 A;  2ZNY A;  3BR2 A;  4G6T B;  2H09 A;  5HNH A;  1G3T A;  4Y13 A;  2EV5 A;  2FE3 A;  1IV6 A;  2WC2 A;  3HYI A;  1Y0U A;  1JI8 A;  3HSR A;  1S8N A;  3PSF A;  4F52 A;  5LLQ A;  5HDK A;  1FSE A;  4B09 A;  1SFU A;  2O8X A;  4RBO A;  4NBQ A;  1MNM C;  3ZCO A;  2XGC A;  2F5D A;  1HDP A;  3DBL B;  1BOA A;  4C2U A;  2V9K A;  1R23 A;  2FXA A;  5LHH A;  1WH7 A;  1OFC X;  5E3O A;  5D4S A;  1MJB A;  2R7Q A;  3HG9 A;  5D8K B;  4KT6 A;  1OR7 C;  1XMK A;  2GXB A;  4QLC U;  5LHI A;  2RDP A;  3QU6 A;  4AID A;  4RB2 C;  2DFE A;  3DLA A;  1EH6 A;  2IPQ X;  4O6J A;  1QBJ A;  2R3S A;  2Z5U A;  3BDD A;  1J59 A;  3V8J A;  1E0E A;  1R4M B;  1J7K A;  2H8W A;  2K86 A;  4FT8 A;  3CCJ I;  2JK3 A;  2L7M P;  3FXJ A;  1YE9 A;  1BC8 C;  5M5W J;  3FMS A;  1P9Q C;  1LE8 B;  1GVD A;  1XSD A;  2EBI A;  4HV6 A;  1D8J A;  3DEU A;  1QZY A;  2DA2 A;  1Y1W J;  1LB2 A;  2EPF A;  1YX5 A;  1JXS A;  4BQO A;  1ON1 A;  4RB3 C;  2QGU A;  3LMM A;  1BR2 A;  1Y1V J;  3WHB A;  4LGW A;  4EQQ A;  2BEO A;  1K6Y A;  4IXA A;  1EH7 A;  1E2X A;  3DPT A;  2W57 A;  5FFZ A;  2OQR A;  3X2Q H;  5D6E A;  2RC4 A;  5J1R A;  3T5X A;  3IKV A;  3IP4 B;  3DU5 A;  2DAO A;  2QQB A;  2CO5 A;  3CF2 A;  3DFG A;  2VXD A;  3E0J B;  4BL0 B;  2BXZ A;  2JN6 A;  3CCM I;  2VAS A;  4B48 A;  5KNL A;  4BEH B;  5C44 J;  1O3T A;  3MAJ A;  5FKM A;  2CQQ A;  4XOP A;  2FQ4 A;  1ZG3 A;  3K4K A;  1JTX A;  4P55 A;  1V54 H;  1OCP A;  4B3X A;  1SD7 A;  4UUT A;  3SZG A;  4CIC A;  4BAY A;  4C3I J;  2E1C A;  4L9N A;  1QU3 A;  1IV8 A;  1WQ2 A;  3A2K A;  5IP9 J;  2KIS A;  3FIS A;  2JMW A;  2UZK A;  1MKM A;  1E3H A;  1U9N A;  5IP7 J;  4KIG A;  5GPA A;  3HOW J;  1FT9 A;  4AM3 A;  5DS9 A;  2WY8 Q;  1ZEL A;  5B5E C;  1FPQ A;  4MFD A;  1YJ9 I;  3HRT A;  3V8K A;  2EB7 A;  4XKW A;  2L7F P;  1KQ9 A;  1EV7 A;  1G3S A;  2LOO A;  3MWM A;  2E34 A;  3KE2 A;  2N8G A;  3RQI A;  1ETK A;  1R1U A;  1OJL A;  4C9Y A;  3SDG A;  2JA2 A;  4RAF A;  5LRS A;  5FLX K;  4M71 A;  3LA3 A;  1ZR2 A;  1JKP C;  5C4J J;  4KJZ A;  4OAY A;  2HTS A;  3MMY B;  4OU0 A;  2Q2E B;  4II3 A;  4P9F A;  3KP6 A;  2NOG A;  2AO9 A;  2D45 A;  1R6R A;  1U6G A;  1YJW I;  3RPU D;  1X58 A;  3ZQH A;  2DOF A;  1FBU A;  2QEN A;  3V7S A;  2YX7 A;  2Q1Z B;  3D1N I;  4BDZ A;  2K40 A;  1NTC A;  4IKF A;  3KZY A;  4CH7 A;  2XSD C;  2LKX A;  4HEA 2;  4HBL A;  4LIV A;  2VJI A;  3CUO A;  3SXY A;  1MSE C;  2R92 J;  3LAJ A;  2M0M A;  4XK4 A;  2HU9 A;  1BI3 A;  4M6Y A;  2VOD A;  1QHH D;  2XPW A;  1W4M A;  1Y8R B;  3BZC A;  3EQL F;  1Z6R A;  5K5R A;  1GV5 A;  3GVA A;  4UVA A;  3Q5F A;  2LK2 A;  3KLN A;  1L3L A;  1D0Z A;  3AG3 H;  2QYO A;  3OYJ A;  4A3I J;  2JVG A;  4HG2 A;  2KIQ A;  4CYC B;  3E5U A;  5LEJ A;  4ENN A;  4L5J A;  4H0E A;  5A2Q Z;  1YS6 A;  3ZN1 A;  4IOA F;  2ESH A;  2Z1D A;  2DA7 A;  4FX4 A;  4EGY A;  2O9L A;  3QYE A;  4CHU A;  4FX0 A;  1XMX A;  1KA8 A;  1R9T J;  2E1N A;  3TW7 A;  3QU3 A;  1SEU A;  2H27 A;  2XB5 A;  3J80 Z;  2P4W A;  1ETV A;  4XIC A;  1J09 A;  3HRM A;  5LRR A;  1SFX A;  4CDG A;  4M72 A;  4G9Y A;  3K69 A;  1H88 C;  4MNU A;  2F6C A;  1MND A;  1PP8 F;  1TP4 A;  1TW3 A;  1SFE A;  2DJN A;  2OJE D;  3M1E A;  2HWV A;  1I3Q J;  1HCR A;  2QUF A;  2ICW G;  2R7Z J;  1IN7 A;  1S9H A;  3ZQQ A;  2XKO A;  2EIL H;  3CTA A;  3BTI A;  4XLE A;  1LEA A;  3OIQ A;  5JR3 A;  5TJJ A;  3K1N A;  3GME A;  4LOC A;  2DPU A;  4BDY A;  1NG7 A;  2HTJ A;  2CW8 A;  2M3A A;  4EV0 A;  1XPX A;  1B9N A;  3HC7 A;  1SVO A;  4UY8 I;  5LFA A;  1FP1 D;  2LKP A;  3E1S A;  1E3P A;  4A0Y A;  5D4R A;  2K3P A;  1V3F A;  3ZRG A;  3CQZ J;  4IHY A;  4U0Y A;  1X19 A;  1KU3 A;  3OYF A;  2RGV A;  2HPI A;  4DJA A;  1MGT A;  3LFU A;  4I0B A;  4B47 A;  3GF2 A;  1W0U A;  4LB5 A;  2XDV A;  2FD5 A;  1ZGJ A;  1BIA A;  3CDI A;  5DUK A;  5TGT A;  2DA1 A;  2Y9Y A;  3H9Q A;  1BOB A;  3GWZ A;  2CFO A;  3LL7 A;  2Z16 A;  2L9N A;  1EKE A;  1XSX A;  1Y56 A;  2L7K A;  5LGU A;  4HLY A;  2EZK A;  3A0B C;  5F1R A;  3OYE A;  2STT A;  4MTD A;  3KP2 A;  3FXQ A;  3KP4 A;  1VQ9 I;  4ESB A;  2DT5 A;  1WSU A;  4M3G A;  5ICF A;  2R5Y A;  1SAN A;  2M30 A;  4LFU A;  3GTK J;  2ZFW A;  4I76 A;  2MLG A;  3ECO A;  2HDC A;  5IOY A;  2DTZ A;  2VBW A;  3ZMT A;  1MMA A;  1S7A A;  1JE8 A;  3NAR A;  3ZXS A;  1HQC A;  2LVS A;  4CZC A;  3G6E I;  1G3W A;  1D1C A;  1YS7 A;  2MC3 A;  3IH3 A;  3FHZ A;  4FAS D;  5GAG J;  2WB1 A;  4IOC F;  2ESN A;  1XCV A;  2HDD A;  2EIM H;  2OTJ I;  4DIQ A;  1FJL A;  3TKY A;  1IRF A;  2K02 A;  3QP5 A;  2W48 A;  4N9H A;  1FIP A;  1HST A;  1DP7 P;  3CJN A;  4JYK A;  2XVC A;  4CCN A;  3ZMS A;  2HYF A;  2G7H A;  2R7D A;  2R7O A;  2O0Y A;  1CGP A;  5E18 F;  1GXP A;  3G1L A;  1WJC A;  4MO7 A;  2KMU A;  1I1S A;  1ZAR A;  3OYM A;  3BP8 A;  3K4L A;  1IN5 A;  2FJ1 A;  2LY9 A;  3JRA A;  2DOE A;  1Z6T A;  2KIU A;  3KP3 A;  5CJ9 A;  3JW4 A;  1MDM A;  3J7A Y;  2E71 A;  3WTT C;  1UEL B;  4LJZ F;  3HJE A;  3FBN B;  4ESF A;  2W84 A;  4S0H B;  2QSG X;  2F5V A;  3HTU A;  5BPD A;  2XPV A;  1BW6 A;  1REP C;  2FBH A;  4E70 A;  3JRH A;  3ZR8 X;  2MH9 A;  2PLY A;  4RAY A;  3PUB A;  4OIP F;  4CUG A;  2FA5 A;  5JLX A;  3WTW C;  2IGK A;  3BR6 A;  3KPH A;  2EIK H;  3JSO A;  1Z9C A;  4ZTF A;  2MA3 A;  3CCQ I;  1HF0 A;  5DM7 F;  1QPM A;  1BI2 A;  1MNE A;  2UUZ A;  3DKY A;  3IHU A;  1PDN C;  2DW4 A;  5JLW A;  4GYI A;  2IS2 A;  1RKT A;  2W00 A;  3RKX A;  4WXC A;  1OCT C;  1UJ8 A;  4F91 B;  2P7V B;  5ILV A;  3PUF A;  3WG7 H;  1VQ5 I;  1FBQ A;  1J0R A;  3M9A A;  2A5W A;  2FNA A;  4Z6Y A;  1ZLK A;  1KQ8 A;  1XGM A;  3UNG C;  3WE2 A;  2IGO A;  1A36 A;  5L3B A;  2IA0 A;  3MD2 A;  1W36 D;  2GLO A;  4RLF A;  3ULQ B;  5IT3 A;  1POG A;  4XRM A;  1BN5 A;  4I0A A;  5F64 A;  3L09 A;  2F4I A;  3K4N A;  3JRI A;  3GZ6 A;  1Z7U A;  3M1C A;  2J5P A;  1DDN A;  3OYC A;  3TBI A;  3JRC A;  4XLN F;  3CJR B;  2YU3 A;  2X0L A;  1IRZ A;  1N25 A;  3GFI A;  5M5Y J;  3BT9 A;  3QYB A;  1VQP I;  2E2J J;  3T0Y A;  2CRG A;  2VXZ A;  1RKW A;  4RGS A;  2HYG D;  3BTJ A;  5H6Q A;  1C0W A;  2X48 A;  2Y48 A;  3GLL A;  4PJN A;  3SYT A;  5J40 A;  3V4G A;  3BOQ A;  4PSX A;  1IUF A;  2KRF A;  2LC2 A;  1BC7 C;  4ZDO A;  3R0J A;  2V1U A;  1L0O C;  3HZJ A;  4RGX A;  5CLS A;  5CVR A;  4CGZ A;  5HS9 A;  1RUO A;  5LBQ A;  3P9C A;  1K4S A;  2M5W A;  4A5N A;  3MQ0 A;  3G1M A;  3I53 A;  4CZZ A;  5JFR A;  1R36 A;  3ABK H;  1T6S A;  3ABU A;  1I6X A;  3CDH A;  5FKK A;  5ILS A;  3I55 I;  2VPL A;  4IX7 A;  3Q3S A;  4ZDL A;  4IHV A;  2EZI A;  3PNT A;  4XMY A;  5KK1 A;  4WWC A;  2GAU A;  1LE8 A;  3GEZ A;  3FK6 A;  4YFK F;  1XDU A;  3DTK A;  4GRI A;  2DMP A;  5HOO A;  3MN2 A;  1I1G A;  3QOP A;  3IL2 A;  1VQL I;  2AQE A;  3HUG A;  2E19 A;  2V6C A;  4UXN A;  4ZYE A;  4DYR A;  3CC2 I;  5M5X J;  4LK1 F;  1W7P D;  3OYD A;  4UHT A;  5BS6 A;  4PGG A;  2ZXJ A;  1IN4 A;  3DEE A;  4XON A;  3TOB A;  4RDU A;  3Q9S A;  5J4V A;  5FLM J;  5CYV A;  2KPM A;  3AFH A;  2RQQ A;  4U87 A;  5J1Y A;  1U78 A;  4N4O B;  1Z21 A;  2HXO A;  4BEH A;  2BY2 A;  2VIX A;  4BNC A;  2MC4 A;  3H1C A;  3MKL A;  3ERM A;  4I2O A;  3S14 J;  2E2H J;  3D5R C;  2WAQ N;  1T95 A;  2EV0 A;  2KFD A;  2M45 A;  4O3M A;  4ZYA A;  2DMU A;  4FTH A;  2ELH A;  5E8I A;  2LKS A;  2DOD A;  5CPR B;  2XRO A;  2ETH A;  2EFO A;  2MG4 A;  3BZK A;  2V9V A;  1FX7 A;  1FMV A;  3W2W A;  4MQ9 F;  2A6E F;  2R4G A;  1W0T A;  2VKV A;  4JX4 A;  3H0D A;  4EM1 A;  3OV8 A;  4NDL A;  3E5Q A;  1RET A;  4HOB A;  1IGN A;  1SD4 A;  5DM6 F;  3NAU A;  3KZI C;  3C2H A;  3I54 A;  2DFI A;  1I39 A;  5DCF A;  3U2R A;  3SEZ A;  1B1B A;  2PG4 A;  2EIJ H;  1IAW A;  5GAD J;  1ZG5 A;  5JHF A;  1UFM A;  3HOZ J;  1GUU A;  2M8E A;  1ORK A;  3I9V 2;  4AYB N;  1GV2 A;  4A3D J;  4QPQ A;  5L3E A;  1YIJ I;  2RRE A;  2JJ7 A;  1T08 B;  3BR3 A;  3K10 A;  2V4J C;  3WU0 A;  3FK7 A;  4L9J A;  3I4M J;  1UCR A;  4LLG F;  2UV1 A;  3HSE A;  3K4M A;  2EIN H;  2HQA A;  4PJM A;  1QPI A;  3W2A A;  5CVU A;  2CQK A;  4A3C J;  3S3N A;  2H6C A;  1K7A A;  1LUJ B;  4PDK A;  2WA0 A;  3V7R A;  4BE0 A;  2Q2E A;  4L0Y B;  4HDU A;  2R5Y B;  3AL0 C;  4LD5 A;  4AIH A;  5EZH A;  4NHJ A;  1IN6 A;  1GT0 C;  1AHD P;  4HF2 A;  2PMZ A;  1YRN B;  2YU9 J;  5AIP A;  2IS6 A;  1SMY F;  4ANJ A;  3O8G A;  4D7N A;  1BJZ A;  3DQV C;  1W7P B;  1D0Y A;  2E7X A;  2VKH A;  5E17 F;  3E6B A;  1WWX A;  5F08 A;  4DGW B;  1FOK A;  2JZY A;  3ONQ A;  3L7W A;  2DA3 A;  4MEX F;  1IRX A;  2XRN A;  3G4S I;  2QEX I;  1RZ4 A;  2LY2 A;  2DK5 A;  4BJT A;  4M74 A;  1TW2 A;  4NUB A;  2FOK A;  2X6O A;  3M8F A;  1ZRF A;  2V26 A;  1P4X A;  3MFK A;  3QYF A;  5FKN A;  2CUF A;  4CYC A;  4NQW B;  2A69 F;  1QZZ A;  4RAG A;  4XLF A;  3IWF A;  2WBM A;  4IHS A;  2RN7 A;  1UHS A;  3RKQ A;  1J75 A;  1DPU A;  2CW0 F;  2HDW A;  3SFI A;  1MDM B;  1WPK A;  1BI1 A;  3P5J A;  1TT5 B;  2ZFU A;  2M34 A;  4PCQ A;  3F3X A;  5IT9 Z;  2XKP A;  4O5V A;  2DTR A;  2X1E A;  3ELK A;  3KLO A;  2MGQ A;  2VC0 A;  3VYU B;  5L3C A;  3S32 A;  2PJP A;  4HLX A;  3S15 J;  4M73 A;  1FZP B;  4HNV A;  4JX6 A;  4HQE A;  4KNY A;  4QSH A;  3E6M A;  2GIV A;  2Q0O A;  5D8L B;  5KAF C;  3F8B A;  2KIM A;  1TQP A;  4LLL A;  2ZCW A;  2OZU A;  5IY5 H;  4PZJ A;  3DU6 A;  2ME6 A;  4BJ6 C;  5FLV A;  4BE1 A;  3GUD A;  3OOP A;  2K9N A;  2PMZ N;  2E1M C;  4I98 B;  2A61 A;  3B6C A;  2DDA A;  4FQG A;  1RR8 C;  6PAX A;  3VSL A;  1UAA A;  2X51 A;  2L5Q A;  2ELJ A;  2O5R A;  2GXG A;  1XB4 A;  2NS7 A;  3RPU A;  1NHA A;  4XBF A;  1W5C C;  4F92 B;  1F1Z A;  3P9I A;  2WAF A;  3DP7 A;  3OYB A;  4IHW A;  1WJE A;  2R7U A;  3T8R A;  4DZJ A;  2A5Y B;  2V1D A;  2OZ6 A;  1XCB A;  2HOE A;  1O3R A;  3QOE A;  4W97 A;  5BOX A;  1B6A A;  2M1B A;  1JUM A;  2NS8 A;  2D1V A;  1J9I A;  2P0W A;  3PNV A;  3TL4 X;  3U21 A;  4E7S A;  4DBR A;  3K70 C;  4BHP A;  2V1X A;  4EJV A;  2ZSH B; 
#chains in the Genus database with same CATH homology
 4XK4 A;  4X6A J;  5EG0 A;  3SJM A;  5F1J A;  1UMQ A;  4QTR A;  2XPW A;  5GPC A;  1JKR C;  3QPL A;  3S1Q J;  4MFE A;  2DMT A;  1GV5 A;  4EEF G;  1P7I A;  2LK2 A;  3K2A A;  5IYB J;  5C3E J;  5IYD J;  3JR9 A;  3RZD J;  4A3I J;  5E3L A;  2VI6 A;  3GTP J;  3E7L A;  4CYC B;  3FKI J;  1JT0 A;  4I6Z A;  3S16 J;  2DA7 A;  2LP0 A;  3B6A A;  2O9L A;  4ABZ A;  1JTY A;  4V2F A;  1FEX A;  2JWT A;  1VF9 A;  1R9T J;  4XID A;  3TW7 A;  2FX0 A;  1IJW C;  2TRT A;  2XB5 A;  2R5Z A;  1ETV A;  5IYC J;  2B63 J;  4M3D A;  2IEK A;  4XIC A;  3S17 J;  4IHX A;  1I6H J;  1H88 C;  1RPW A;  3ZQG A;  5F0F A;  2X9D A;  2M8G X;  2DJN A;  5F27 A;  1X2M A;  1TWG J;  4D7M A;  1I3Q J;  4DYQ A;  2VUM J;  1HCR A;  2LTP A;  2R7Z J;  2WB1 N;  4A3F J;  2R93 J;  2AHQ A;  3BTI A;  3S2H J;  2Y30 A;  1IDZ A;  1RES A;  3GTJ J;  4LOC A;  4A3G J;  1ETY A;  1Z77 A;  3C2B A;  2G0E A;  2HXI A;  3HOX J;  2ECB A;  5J1U A;  1FTT A;  2CU7 A;  4A3M J;  1TWF J;  5M3F J;  1XS9 A;  4Y52 J;  1T33 A;  1X2N A;  3A01 A;  2Y31 A;  3CQZ J;  4L5E A;  1MH3 A;  3CDL A;  4IHY A;  4JX5 A;  1DU0 A;  3BQY A;  4M3B A;  5EGO A;  3M3Y J;  2LLK A;  1O4X A;  1ETW A;  3FIW A;  1W0U A;  2FD5 A;  2DA1 A;  2Y9Y A;  1ETX A;  3PO3 J;  2ECC A;  1BL0 A;  1Q1V A;  2XPU A;  3HB9 A;  2EZK A;  4XRS G;  1HLV A;  1EF4 A;  2L0K A;  3F0C A;  4XRS A;  3OSF A;  4M3G A;  3VPR A;  2R5Y A;  1SAN A;  1IDY A;  3GTK J;  2OPT A;  4I76 A;  2DA5 A;  1TC3 C;  1K61 A;  5IPA A;  1G2H A;  3L1P A;  2KT0 A;  2MW8 A;  5IOY A;  2DTZ A;  5K7F A;  2EH3 A;  3NAR A;  2LVS A;  3ZQC A;  2Y2Z A;  2RAE A;  3IH3 A;  4C3H J;  3IV5 A;  3G1O A;  1AKH A;  3TW6 A;  4C2M J;  1D5Y A;  3PM1 A;  2HDD A;  1FJL A;  4BBS J;  1JKO C;  2W48 A;  3RZO J;  2ID3 A;  1FIP A;  2EZL A;  1TWA J;  5M3M J;  1JJ6 C;  4JYK A;  1NK2 P;  4A93 J;  1LFU P;  1QVU A;  4UUS A;  5DTD A;  1H89 C;  2NVT J;  3G1L A;  3BTL A;  4MO7 A;  5FJ8 J;  1MSF C;  1MBF A;  1VND A;  1ITY A;  4FIS A;  5F04 A;  1FTZ A;  2LFB A;  2FJ1 A;  2LY9 A;  4BKX A;  2KDZ A;  3TED A;  3GTG J;  3JRA A;  1E3O C;  1JGG A;  5C4X J;  2NVQ J;  1A5J A;  3S1M J;  2OF7 A;  5IP6 A;  3ZQI A;  1B8I A;  3TP3 A;  3JRB A;  1BA5 A;  2CUE A;  4S0H B;  4MLO A;  1P7J A;  1S7E A;  2XPV A;  1HOM A;  1BW6 A;  3BR1 A;  3BR0 A;  3A01 B;  2DMQ A;  5IOZ A;  3JRH A;  1F43 A;  5EDN A;  1ZR4 A;  3S2D J;  2NVX J;  5JLX A;  5EGO B;  5F0C A;  3BR6 A;  4C3J J;  3ZQL A;  5GP9 A;  5EYR A;  4W1U A;  1HF0 A;  3CMY A;  1AU7 A;  5E3N A;  3A03 A;  1A6I A;  2Y0S N;  4B3A A;  1ZTR A;  5JLW A;  1NK3 P;  4M3F A;  4DW6 A;  2L7Z A;  5K7Z A;  4Y7N J;  1RKT A;  5FKO A;  1OCT C;  1HDD C;  4A3B J;  1JJ8 C;  2GM4 A;  2D5V A;  3UKG A;  1MH4 A;  1XG1 A;  5FKL A;  2GLO A;  1B72 B;  1TWH J;  3BTC A;  1POG A;  1MBG A;  4XRM A;  3JRD A;  1JUS A;  2HQ5 A;  3GTM J;  2IAI A;  1PUF A;  3JRI A;  3DEW A;  1RR7 A;  3JRC A;  3MVP A;  1IRZ A;  2EQR A;  1XC5 A;  2HOS A;  5M5Y J;  1AKH B;  3BT9 A;  3GTL J;  1H8A C;  9ANT A;  2HYJ A;  2DA4 A;  1JKQ C;  2E2J J;  2JA6 J;  2CRG A;  4QIW N;  1RKW A;  3HBL A;  4FE7 A;  2JA5 J;  3S1R J;  3BTJ A;  2E1O A;  3HOY J;  4A3K J;  3M4O J;  3I4N J;  1ZQ3 P;  2X48 A;  2LR8 A;  5F0H A;  3CCY A;  2LD5 A;  2XB0 X;  1IUF A;  2O8K A;  1U8B A;  3BG5 A;  3HKZ N;  3BG9 A;  4D5F A;  5EZG A;  4BBR J;  3PO2 J;  1BW5 A;  1SFO J;  1I50 J;  3G1M A;  2K9S A;  5EG0 B;  2DA6 A;  2XRL A;  5FKK A;  2I10 A;  1WI3 A;  3BQZ A;  3Q3S A;  4IHV A;  2EZI A;  1APL C;  1YRN A;  1LE8 A;  3FK6 A;  2O7O A;  1VFC A;  3GTQ J;  2VPR A;  2DMP A;  3HGY A;  3MN2 A;  1QVT A;  4DZP A;  2E19 A;  3QQA A;  3O8H A;  4DYR A;  5M5X J;  4D5C A;  3WHC A;  4AC0 A;  1ZKG A;  1QRY A;  1T56 A;  2HI3 A;  3LOC A;  2R5Z B;  4X1E A;  4RDU A;  1ENH A;  3IH2 A;  4J19 A;  4FCY A;  2P81 A;  2E2I J;  2YUS A;  4AUX A;  5FLM J;  4A69 C;  3W6V A;  5J1Y A;  1U78 A;  2HXO A;  2M2E A;  3MKL A;  3HGG A;  3S14 J;  2E2H J;  3BR2 A;  1WH5 A;  3Q0V A;  4M3E A;  2WAQ N;  1TWC J;  5J3L A;  2DMU A;  4FTH A;  1IV6 A;  3GTO J;  2MG4 A;  2ELK A;  2VKE A;  1UG2 A;  1VI0 A;  2HOA A;  4RBO A;  1MNM C;  3LSG A;  1W0T A;  2VKV A;  2XGC A;  4JX4 A;  3LSR A;  4NDL A;  1HDP A;  1MBJ A;  3BR5 A;  1RET A;  1CQT A;  1IGN A;  3H0G J;  3NAU A;  2M0C A;  3OSG A;  1MBK A;  1OFC X;  1WH7 A;  5E3M A;  3GBG A;  5E3O A;  2QF7 A;  3LNQ A;  1F36 A;  2H1K A;  2H8R A;  3HOZ J;  1GUU A;  1ORK A;  4AYB N;  5EEA A;  1GV2 A;  4A3D J;  1JT6 A;  2JJ7 A;  3BR3 A;  1GDT A;  5BNG A;  3FK7 A;  3I4M J;  3IH4 A;  4V2G A;  1QPI A;  4A3C J;  3JRF A;  5K7H A;  2R5Y B;  3HDD A;  2ZB9 A;  2L9R A;  5EZH A;  1GT0 C;  5EF6 A;  2Y9Z A;  2IBD A;  2JK3 A;  2L7M P;  1AHD P;  2YS9 A;  2M9H A;  3JRG A;  5M5W J;  1YRN B;  2YU9 J;  3K7A J;  1LE8 B;  1ETQ A;  1U9O A;  2CJJ A;  1GVD A;  2ID6 A;  3O8G A;  4D7N A;  3S1N J;  1BJZ A;  2EBI A;  3DCF A;  2DA2 A;  1ZGW A;  3JRE A;  5F08 A;  1Y1W J;  4BY1 J;  2K9Q A;  3TP0 A;  3Q0W A;  3HEF A;  1Y1V J;  3WHB A;  2DA3 A;  1DU6 A;  1IC8 A;  2MSY A;  4FE4 A;  4BXX J;  2R0Q C;  2X6O A;  5J1R A;  1FIA A;  3OIO A;  5FKN A;  4UUS B;  2CUF A;  4CYC A;  4GFB A;  2XGE A;  4G12 A;  2JN6 A;  2DMN A;  2GBY A;  5C44 J;  2WV1 A;  2EZH A;  5FKM A;  1UHS A;  3RKQ A;  2CQQ A;  2FQ4 A;  3SFI A;  1WPK A;  1JTX A;  3OOU A;  2DN0 A;  1OCP A;  4UUT A;  2M34 A;  4C3I J;  1B8I B;  1MBE A;  5IP9 J;  2MGQ A;  2HOT A;  3FIS A;  2JMW A;  2COB A;  3S15 J;  1WCM J;  1U9N A;  1K83 J;  4JX6 A;  2CQX A;  3HM5 A;  4HNV A;  4DYC A;  5GPA A;  5IP7 J;  5HOD A;  3HOW J;  4JP0 A;  2JA7 J;  4QSH A;  2JA8 J;  5DS9 A;  4MFD A;  4MIM A;  2NVY J;  2L7F P;  4B1R A;  1JUP A;  1WGX A;  3A02 A;  2ME6 A;  2N8G A;  3RQI A;  5FLV A;  3ZQF A;  1ETO A;  1B72 A;  1ETK A;  2K9N A;  4BY7 J;  1OJL A;  2PMZ N;  2XGD A;  3SDG A;  3H3V K;  3QPS A;  3LSJ A;  1IG7 A;  3B6C A;  3BG3 A;  1MBH A;  3HOV J;  1LFB A;  4B4C A;  1ZR2 A;  1JKP C;  4A3J J;  2QCO A;  1ZK8 A;  3ZOB A;  5C4J J;  2NS7 A;  4A3L J;  4IHW A;  4IEJ A;  4DZJ A;  3Q0U A;  2NOG A;  2AO9 A;  1X58 A;  4W97 A;  3ZQH A;  4A3E J;  1PUF B;  3HOU J;  2ME0 A;  3D1N I;  2K40 A;  1NTC A;  1JUM A;  4M6V A;  2NS8 A;  3LSP A;  2XSD C;  2LKX A;  2TCT A;  2R92 J;  1Z0X A;  1MSE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...