1TWFJ

Rna polymerase ii complexed with utp at 2.3 a resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twfJ00
3A01B 1A5JA 1IJWC 1JJ6C 5BNGA 3SFIA 2DA2A 4A3IJ 1T56A 3BTIA 5FKNA 2JA6J 2JMWA 4A3EJ 1TWFJ 4BKXA 4C3JJ 4AYBN 1MSEC 4IHXA 5C4JJ 2XB5A 5EF6A 4A93J 1Z0XA 3K2AA 3LSJA 1JJ8C 2HQ5A 3Q0UA 3F0CA 2L0KA 3DEWA 3IV5A 3SDGA 3JR9A 2FQ4A 1LE8A 1HF0A 5EZGA 1NK3P 2YS9A 4XICA 3QPSA 5HODA 4NDLA 2IAIA 3I4MJ 2LTPA 1H8AC 1FTZA 1AKHA 4ABZA 3QQAA 2Y9ZA 1G2HA 3HKZN 4UUSB 1U8BA 3BG9A 4IHVA 1OCPA 2E19A 5IP9J 2EH3A 4BXXJ 3ZQLA 2HDDA 2EQRA 2MGQA 4FCYA 2M34A 1UMQA 2Y0SN 1XS9A 1IV6A 2ELKA 4A3BJ 2NS7A 4XRSA 4S0HB 4Y52J 2FD5A 2NVXJ 5GPCA 3LNQA 3MKLA 1B8IB 5EYRA 1FJLA 2JA7J 2VUMJ 1IC8A 3S14J 3A01A 3MN2A 4DYCA 2P81A 2IEKA 2XGEA 2NVTJ 2E2IJ 2NOGA 1FEXA 1ORKA 2M9HA 5FKOA 1S7EA 3TP0A 3JRGA 3IH4A 1HCRA 3G1OA 2FJ1A 1BL0A 1JUSA 4BBSJ 5DS9A 2R92J 5F0FA 5F0HA 3WHCA 1FIAA 4M3DA 4A3GJ 4MIMA 1HLVA 1SANA 1HDPA 1DU0A 3HM5A 1Z77A 3BR0A 1H88C 2ECBA 3GTJJ 1T33A 5EGOB 5EDNA 2L7FP 1OCTC 1WH7A 4QSHA 1UG2A 1LFUP 4Y7NJ 1I6HJ 3CCYA 2ID6A 1VFCA 3H0GJ 2JJ7A 2FX0A 3JRHA 2DA6A 2E1OA 1APLC 3G1MA 4A3CJ 4FE7A 2R5YB 1AU7A 1X2MA 5FLVA 4CYCA 4I6ZA 2LD5A 2R5ZB 5JLXA 1B8IA 4A3LJ 1LFBA 5IPAA 1TC3C 2LKXA 2DMQA 3JRDA 3HOWJ 1B72A 1JT0A 3S1RJ 3D1NI 3LOCA 2R0QC 3S1MJ 5IP6A 5J1RA 2K40A 3ZQIA 2CQXA 2YU9J 2HOAA 2LR8A 2CRGA 5IYBJ 5M3FJ 2GBYA 2DN0A 3JRAA 1O4XA 1NK2P 2AHQA 3OSFA 2VPRA 1PUFB 3K7AJ 5EGOA 1CQTA 3BTLA 3A03A 5FKLA 1ETQA 3OOUA 3BR2A 2L7ZA 1VNDA 4IEJA 2L9RA 5IOZA 2XGCA 4XK4A 5E3OA 3M4OJ 1WGXA 1NTCA 2LP0A 2KT0A 4JYKA 1WCMJ 1WH5A 2ID3A 1RKWA 1JUMA 2R5YA 2R93J 5M5XJ 2MG4A 1K61A 4M6VA 5FKKA 3B6AA 3Q3SA 2H8RA 1FIPA 1Y1VJ 2VKEA 5J1UA 4DYQA 4DZPA 3LSPA 1IG7A 1I3QJ 2JA8J 3ZOBA 5EG0B 1W0UA 1ZQ3P 1I50J 1RPWA 5DTDA 2WB1N 2MW8A 5E3MA 1BA5A 1ITYA 1ETVA 3FK6A 3NAUA 3NARA 5F0CA 4XRSG 4W97A 5C44J 3OIOA 3ZQHA 1MBEA 1QVTA 5FLMJ 4IHYA 4A69C 3Q0VA 2X48A 3O8GA 4C3HJ 3GTPJ 2EBIA 2DA4A 2D5VA 2ECCA 5J3LA 3S2HJ 4C2MJ 5IYCJ 2Y31A 1ZGWA 1IDZA 1WI3A 2HOSA 2NS8A 1X58A 2XPUA 2EZHA 2W48A 4EEFG 1OJLA 4BY1J 2PMZN 5K7ZA 4HNVA 1W0TA 2B63J 1GV2A 3S16J 2LY9A 4MO7A 2DMUA 1XG1A 1IGNA 3B6CA 3LSRA 1POGA 3O8HA 1MBGA 3M3YJ 4L5EA 4M3GA 1JKPC 1F36A 1YRNB 3S1NJ 1JUPA 1IRZA 1K83J 1E3OC 3TW6A 4DYRA 3HB9A 2GLOA 2E2HJ 5E3LA 3OSGA 4JX6A 4MFEA 3E7LA 3G1LA 4UUSA 4IHWA 3GTLJ 1VF9A 5EG0A 2JK3A 3S2DJ 2CQQA 4XIDA 1GT0C 4A3FJ 4J19A 2AO9A 1JTYA 2OF7A 2DMNA 2G0EA 4QIWN 5C4XJ 1GUUA 1R9TJ 3H3VK 3PM1A 4D5FA 3HOVJ 4B3AA 2X6OA 1GV5A 5GPAA 1ETXA 4W1UA 3DCFA 3JRCA 5M5WJ 1MH3A 3LSGA 3HGYA 2XRLA 1JTXA 5GP9A 3QPLA 5EZHA 3JRBA 1JKQC 3CQZJ 1P7JA 1AHDP 1HOMA 3VPRA 2ME6A 4AC0A 2DA5A 1ZR4A 4UUTA 2GM4A 3BTCA 1OFCX 1ZKGA 2LVSA 2R7ZJ 3BR3A 3HOUJ 1EF4A 2OPTA 2TRTA 5IP7J 1TWCJ 1ZR2A 1YRNA 2CJJA 5M3MJ 1X2NA 3L1PA 4JX4A 1Y1WJ 4GFBA 1MNMC 3HOYJ 5IOYA 2EZIA 4B1RA 3S17J 5F08A 1F43A 2VI6A 3RZDJ 3GTOJ 2XPWA 1ETWA 1RESA 1ENHA 2DJNA 3TW7A 3CDLA 4D5CA 4A3DJ 1JKRC 1IDYA 2HI3A 2TCTA 2JN6A 2K9SA 1WPKA 3TEDA 2O9LA 1HDDC 2EZKA 2LK2A 5IYDJ 2JWTA 1VI0A 2IBDA 2L7MP 3IH2A 3WHBA 3RKQA 4AUXA 1IUFA 2O7OA 3BQYA 3ZQFA 2R5ZA 2Y30A 2DA3A 2YUSA 3BG5A 5J1YA 1MBFA 2M2EA 4M3EA 1U9NA 5C3EJ 3UKGA 4JP0A 1ETKA 3BQZA 3I4NJ 2JA5J 2CUEA 5K7HA 3A02A 3BTJA 4V2GA 2VKVA 3BR1A 4X6AJ 4BBRJ 1MSFC 3Q0WA 4X1EA 3ZQCA 3GTQJ 4C3IJ 3PO2J 3S1QJ 2O8KA 2HXIA 2WAQN 3GBGA 1D5YA 1MBHA 1P7IA 4DZJA 4FE4A 3BT9A 2E2JJ 4LOCA 2NVYJ 3S15J 2CUFA 1MBKA 1PUFA 1ZK8A 5FJ8J 3JREA 2H1KA 4M3BA 2DMPA 2XGDA 2QCOA 3RQIA 3JRFA 3W6VA 4CYCB 1MBJA 9ANTA 2HXOA 2X9DA 3HOXJ 1BJZA 3TP3A 4A3KJ 4QTRA 1TWHJ 2KDZA 3SJMA 3FISA 2N8GA 1UHSA 3HBLA 3HGGA 1B72B 5F27A 1BW6A 2HOTA 3FKIJ 4MLOA 4V2FA 1JKOC 1ZTRA 4XRMA 1RKTA 4RBOA 1A6IA 4MFDA 3FK7A 1ETOA 1Q1VA 1TWAJ 4B4CA 2K9NA 3BR5A 1ETYA 1QVUA 2RAEA 4RDUA 3ZQGA 3HEFA 4I76A 2NVQJ 2LLKA 2Y9YA 3BG3A 5F1JA 1DU6A 2DA1A 3CMYA 2EZLA 1JGGA 1JT6A 2HYJA 2WV1A 1RR7A 5K7FA 5EEAA 4G12A 3FIWA 5E3NA 3JRIA 1U9OA 1QRYA 2DA7A 3HOZJ 1GVDA 2CU7A 5M5YJ 2I10A 3HDDA 2XSDC 3MVPA 1LE8B 3GTGJ 1SFOJ 1H89C 2K9QA 2XPVA 4JX5A 1MH4A 3C2BA 2M8GX 3RZOJ 2Y2ZA 5F04A 4A3JJ 1BW5A 1QPIA 1AKHB 3GTMJ 2ME0A 1FTTA 2XB0X 2QF7A 2DMTA 2COBA 4D7MA 4BY7J 3PO3J 4A3MJ 2M0CA 2ZB9A 1XC5A 2LFBA 4M3FA 4DW6A 1U78A 4D7NA 1RETA 3BR6A 1TWGJ 5JLWA 4FTHA 5FKMA 2DTZA 3GTKJ 4FISA 3IH3A 2MSYA 1GDTA
chains in the Genus database with same CATH superfamily
3A01B 5HDNA 2HQRA 1U5TB 3R60A 1IJWC 2CW0F 4M6YA 2ACJA 3GLLA 3S3OA 4K2EA 3DLLF 3QU3A 2MA3A 5LGTA 1KU7A 3S8PA 5E18F 5HS9A 4C3JJ 1MSEC 2OA4A 4IHXA 3CJNA 4LG0A 4A93J 4HSRA 4II3A 3LSJA 2HQ5A 2GIZA 4IOAF 2L0KA 3SZPA 1FP1D 3IV5A 4QPQA 2X4HA 3T5XA 1BR1A 3K4JA 3DKYA 2EIKH 3BJ6A 2NAZA 4A0XA 1OKRA 2V9KA 2IGKA 3U1KA 5DD8A 2X6YA 1TTYA 4KN4X 4UUSB 1U8BA 4IHVA 2L02A 1OCPA 4XKBA 3C3WA 1R1TA 2HDDA 2QSHX 4MEXF 2MGQA 4RAYA 2L9NA 1V5EA 1XDSA 2O8XA 1MDMA 1XS9A 1ODDA 3MMYB 3TO6A 3FXJA 3HYIA 4XRSA 1HW5A 4LIUA 2MD0A 1IXCA 3NEUA 2FD5A 1EH7A 2JUGA 4XLEA 3B73A 1I1GA 2XC7A 1FJLA 2VUMJ 1O3SA 2BY1A 4IXAA 2H8WA 3EYIA 2DPUA 3PFYA 2IEKA 4IRHA 4RLFA 3AAFA 2NVTJ 2M5WA 4FQGA 2WV0A 1UELB 2E2IJ 1FEXA 1ORKA 1YTYA 4IQJA 1ZAOA 2M9HA 5FKOA 3OYKA 3FHNA 3JRGA 1HCRA 3W2AA 1XMXA 2LC2A 4BDYA 5DS9A 3ML6A 5F0FA 3WHCA 3FXUA 3OS1A 4OIQF 1UAAA 2VODA 2NVUB 1YW9A 4PGHA 3JSPA 4ZYDA 3G2BA 1SVMA 4RGUA 3HM5A 2G7UA 4IRGA 1H88C 3LMMA 5DUKA 3VYSB 4ZYHA 1RRJA 5EGOB 3FXOA 1LQ1A 1X4PA 1LVKA 1OCTC 5K1YA 1LFUP 1G8XA 2HOEA 2MH2A 2JJ7A 4EM2A 3F8NA 3EQLF 4LD5A 2VBXA 3BROA 4U0YA 2M7BA 3KP6A 4A3CJ 4FE7A 3MKWB 3I59A 4CYCA 4I6ZA 4HX8A 1X3WB 1WHUA 1EV7A 5HLHA 1J09A 1QHHD 1PJRA 1PYVA 4A3LJ 3LA7A 2KLOA 3C1DA 2R7UA 2GA1A 1FSEA 1P2FA 3JRDA 3HOWJ 1B72A 1UHWA 5FROA 1JT0A 3SYTA 3V8JA 1KU3A 3LOCA 3PL8A 4P96A 4XOPA 5E8IA 3FKJA 2DXIA 1U2WA 1B6AA 4RB2C 3ZQIA 4I09A 2YU9J 1RZ4A 4I7HA 2NNYA 3MZ8A 4DOZA 1VQ5I 4B44A 2XKOA 1HSTA 2DN0A 2XDVA 1MW7A 1IRGA 2BW3B 1DP7P 1WWXA 3KPHA 1STZA 4WXCA 4BE0A 4F93B 1YS6A 3WU1B 4CA0A 3HKZA 3BTLA 3I55I 1ETQA 2LH9A 3OOUA 5BPDA 2L7ZA 2OCCH 5TISC 3JAMZ 2YR2A 4M9SA 3KX2A 3BDDA 3MWMA 2FUG2 2GWRA 2L9RA 2XGCA 1FLIA 5A2QZ 1NTCA 2P5VA 4GYGA 4KIGA 1YS7A 2VJ4A 1W5SA 2PBIA 2Y48A 2IT0A 2R93J 1VQKI 3I5UA 4HW0A 2KKOA 1JHFA 4WF2A 3ABMH 3AG1H 4DZPA 4EJOA 2VT2A 3BPVA 1I3QJ 1VQ6I 1M1EB 2JA8J 3CCRI 1FYMA 5JR3A 6PAXA 1BN5A 1KYWA 2MW8A 5K5RA 1BA5A 4M9XA 2PFBA 4M9ZA 2Z33A 2LBFA 2X1CA 5AIPA 3NAUA 2M30A 4XRSG 5C44J 4W97A 1PUEE 4EGZA 2XVCA 4IHYA 2VC0A 3O8GA 4XNFA 1TW3A 3QYBA 5CQGA 3MFKA 2E7WA 2MABA 4ITVA 4ZYGA 3SDBA 1TBXA 2Y31A 1IDZA 4HLXA 3BLYA 4U0VA 4EMSA 5CJ9A 2HOSA 1XGNA 2NS8A 2EZHA 4EEFG 2PX9A 3DTEA 3TDZC 3KEQA 4HNVA 5ILSA 3E6MA 1GV2A 4E7HA 3WG9A 5LEJA 2DOAA 2DMUA 2DQRA 3QWLA 4F55A 3CLQA 1IGNA 2PI0A 3Q5FA 4O6JA 4YIFA 1NG7A 1MJAA 4I99C 1V4RA 3CMAI 3ASOH 3C7JA 1WI9A 2O03A 1JKPC 2VC1A 3S1NJ 1B9NA 3HRUA 4LGWA 1K83J 2UXNA 2IVMA 2QQAA 2WY8Q 3FDYA 1JE8A 2EIMH 1MMDA 2GLOA 3RQ4A 2F6CA 3OSGA 2DODA 2RKHA 1WJ5A 4H0EA 2VQCA 5DCFA 4V19K 4IVNA 4UUSA 2L2OA 4IHWA 4HF2A 3GTLJ 1UZCA 4ESJA 4AIDA 4RAZA 2HVQA 1LDDA 2JVGA 4QIWN 2JVHA 5C4XJ 3GZ5A 1R9TJ 3ABKH 1ZH5A 1QPMA 1YW7A 2DDBA 2CGPA 4B3AA 2P6SA 4ENKA 2WAEA 1F9NA 1KGSA 5M5WJ 1MH3A 1N77A 2HEOA 4BHPA 1FT9A 1JTXA 3QPLA 3EETA 1IAWA 3EYYA 1HOMA 1VZ0A 2IS6A 2W25A 2ME6A 1LEBA 2LSOA 4EATA 5HOOA 2A3SA 4FETA 2DA5A 2CFXA 1YO5C 4UUTA 3GO5A 2GM4A 1X1BA 2E60A 1OFCX 1W4MA 2V26A 3WTTC 2QSGX 2R7ZJ 4LK1F 1EF4A 3UNGC 4Y4RA 1EKEA 3BCBA 1ZR2A 1X3UA 1DGWY 5M3MJ 1R22A 2WTEA 3L1PA 2EFNA 2KMUA 5D5XB 1KU9A 4ZDOA 4B1RA 3RCOA 3S17J 5L3CA 4P1WA 3OOPA 4PFOA 3TW7A 2WB1A 3VOEA 4D5CA 5LD2C 4A3DJ 1LDJA 3WGHA 1WJEA 2TCTA 3E0JB 3T8TA 2VOOA 3VDXA 3CP8A 3KYCB 1LNWA 2F5CA 1TNSA 5L3EA 1YFHA 3MAJA 1SMTA 2LK2A 2HNHA 3H35A 1VQ9I 4WK8F 4EJTA 3DV8A 3I4PA 2L7MP 3WHBA 4HQMA 3RKQA 3SEQA 1IUFA 3DTKA 4OAZA 4DQ2A 2DPDA 3E3VA 3CC4I 3ECOA 3AKZA 1XTAA 3OYGA 4PJNA 4CZCA 5J1YA 1MBFA 1S29A 4P5OA 3DKXA 1E3HA 1QZEA 4GO1A 1IO2A 3CCEI 2CUEA 4RAGA 2JSCA 3A02A 3BTJA 5D5UB 2DT5A 2FXAA 3MKYB 4M74A 2HZTA 1BI3A 1H9GA 2BHZA 4ENNA 1R58A 1YQAA 4HPQA 3GTQJ 2LMDA 1Z91A 3DFGA 1J2XA 2FE3A 4CSWA 3CDHA 3OR2C 4BEHB 2WC2A 2VLAA 2BW3A 4DZJA 4HOBA 2F4OB 4FE4A 4XORA 5F6FA 3BT9A 2CUFA 4LMYA 3O6BB 2VXDA 5KK1A 5FJ8J 3JREA 3E6BA 2FOWA 2DW4A 4DBRA 3FX3A 2DMPA 2YU3A 1OCOH 2QCOA 2FNAA 2RV8A 4CXFA 3DEEA 4Y13A 1MBJA 2KZGA 3BPXA 3IKTA 2HXOA 3HOXJ 1X4OA 1R4MB 2KRFA 3TP3A 2X51A 2BY2A 5HVQC 3IKVA 2PLYA 4S04A 2ZJQF 4CUGA 2A6HF 4LB5A 4NBQA 3RPUA 4UXNA 4RM2A 1BW6A 4Z2YA 3RYPA 3ZMSA 2HOTA 4BHCA 1BM9A 3ZMZA 4XBFA 2XAHA 2XUBA 3GX4X 2I8DA 1ZTRA 4BE1A 4CCLA 1I1SA 4XRMA 4MQ9F 2F5EA 2Q8KA 3GFLA 4LG3A 4MFDA 3I64A 1O3QA 2H6CA 3X2QH 4OAYA 3VFZA 4B4CA 1H9TA 3H3UA 4XLCA 1ETYA 4U7DA 4HNTA 3HZJA 4TV7A 1YOVB 2HVRA 3EUKL 1XMKA 4I76A 2OUMA 3O3KA 2Y9YA 2YPRA 3CDIA 3BG3A 5DM6F 3LFKA 2V6EA 2KISA 1P4WA 2WA0A 4XONA 4AIHA 2HYJA 5AONA 1QBJA 4LG0B 3CJRB 2IGNA 2VXZA 2VQLA 1E17A 5EEAA 5E3NA 3JRIA 3KEOA 3K4KA 5DM7F 1U9OA 3HSRA 2CU7A 3O2PE 5E20A 3BG6A 1I27A 3EDPA 3RPUD 3L00A 3HUGB 2CG4A 2IGOA 1D8JA 1H89C 2DI3A 2K7LA 2K9QA 2XPVA 1YJ9I 3E97A 3WTZA 3FBIB 1ON2A 4O5VA 3OMYA 3S93A 2ME0A 5CVVA 3G71I 2EINH 4N9HA 3DBHB 2QWWA 2CQNA 2DT7B 2XB0X 2DK8A 3DPLC 1W1WE 4AYBA 1R23A 1MNEA 2COBA 4B3XA 5F1RA 3OS0A 1GHCA 1Z3YA 3HOTA 1MDMB 1IXRC 1QNTA 1XC5A 4M3FA 4DW6A 2L5QA 3U21A 2OAZA 1I39A 3BR6A 1ZGJA 1TWGJ 2B0LA 2EV5A 2OC6A 1HQCA 5JLWA 3WODF 1OYWA 2DTZA 3TL4X 3IWZA 3JTHA 1FOYA 3OY9A 4YFXF 2HWVA 4I98B 1CF7A 2ZNZA 1JJ6C 2B9SA 5DYMA 3SFIA 2QZ8A 3KFWX 1R6RA 3HG9A 4HZFA 2JMWA 2QBYB 4NHJA 1YE9A 2BXZA 2LF7A 4BKXA 2JA6J 4AYBN 1B9MA 4GXOA 1NH3A 5C4JJ 1QO0D 3CC7I 4EGYA 2EIJH 5EEGA 1S5LC 2FBKA 1R5HA 3K2AA 4U87A 2M87A 2ELJA 3F0CA 1BIAA 2FU4A 2X1EA 5KAFC 2FQ3A 3SDGA 3FWEA 4I0AA 4XLAA 2D1HA 2FQ4A 1NK3P 3QPHA 5GADJ 2YS9A 3CLOA 3QPSA 4ETSA 1WJFA 3H1CA 4NDLA 2DBBA 4UUVA 2LTPA 3K1NA 1H8AC 1AKHA 4ABZA 1FTZA 3QQAA 3GEZA 2VKDA 3JCUC 2R7XA 2AXLA 3BZKA 3MCZA 1T0FA 3BCAA 5FLXZ 4M72A 4FCYA 2M34A 1IV6A 3CMMA 2L54A 3R4KA 4PSXA 4S0HB 5HDKA 3FXQA 1D0XA 2JA2A 5FFZA 3PUBA 2M3AA 1T08B 3LNQA 1ZRFA 5EYRA 1T2KA 1IC8A 2EFPA 2VIXA 1BR2A 1F1ZA 1E2XA 2ZMEC 4RM3A 1ZHFA 4XKVA 2DOEA 4XN0A 2NOGA 2BY0A 2XGXA 3TP0A 1J5YA 1S7EA 3W2VA 2ESHA 2KJCA 1BL0A 2QKLB 1JUSA 1Z9CA 1I3AA 3ROUA 1SC7A 3VB2A 4PJJA 4A3GJ 4UB6C 2LRDA 2OQGA 3GMEA 1HLVA 3QYFA 2VBYA 4KT6A 2QEXI 5D5VB 2F2EA 1DU0A 3BZCA 3BR0A 2Z99A 2CV0A 1QU3A 2GOMA 3GTJJ 3G73A 2ZKZA 1T33A 2OD5A 4BEHA 2W7NA 2CV2A 3LSIA 3TKYA 3CUQC 3HHGA 3KEYA 1YJNI 2PMUA 2ID6A 4PCQA 1VFCA 2PJRB 2D1VA 3FXRA 2FX0A 3JRHA 1HKTA 1FMVA 2R7QA 3H0DA 1DGRM 5FD6A 1APLC 2HDWA 2X6WA 3CUQA 1X1PA 4B09A 5ILUA 1AU7A 3N97A 2Q2EA 1LEAA 5FLVA 2ELHA 2EFWA 3KP7A 3LA3A 2R5ZB 2A07F 2UWMA 4KIFA 1TLHB 2V1NA 5IPAA 4XR6A 1J0RA 2LKXA 1SD4A 2NXNB 1C0WA 3SXYA 1D5VA 3ERMA 1U0JA 2CQKA 3CTAA 2R0QC 3TDUC 1N75A 3D5LA 2K40A 3PFIA 5L3GA 3K4NA 1H0MA 2V7FA 1PP8F 2GBYA 3OIQA 4HEA2 4PGGA 3JRAA 1S9HA 5BS6A 4P9UA 1J75A 4L9VA 2A5YB 4UVBA 2DYRH 3OYBA 4R1HA 1TP4A 3GFJA 3VSKA 2NOJB 3GZ6A 3G4SI 3NWTA 1PUFB 3JTGA 3S32A 3M8EA 2VE8A 4XLFA 1CQTA 1BR4A 1W7PA 3R0JA 4U0WA 1VQOI 1K4SA 4IEJA 3Q9VA 3B02A 5IOZA 2W1OA 3BJOA 4ASNA 4BH9A 3M4OJ 4I01A 4YIRX 1ZN2A 5CYVA 2ID3A 4PDKA 3MQ0A 3NRVA 2XAFA 2L3DA 2BZTA 2ZBKA 3ASNH 3HUGA 3DP7A 2M4GA 5BOXA 4U7BA 2Q0OA 1K61A 4M6VA 5FKKA 2NS0A 1Y1VJ 5J1UA 4DYQA 1AWCA 3LWFA 3GLXA 2WBMA 3D5RC 4HNUA 3ZOBA 2KPMA 4E7IA 5K5OA 2R7DA 3M9AA 1RPWA 2DDAA 4I0BA 2DLLA 2OBPA 1ITYA 4NNJA 1R49A 2PG4A 1D1CA 5D4RA 1X3ZB 4OINF 3FK6A 4C2TA 1YI2I 4CCNA 3HC7A 3WG7H 1XDUA 1LJ9A 2FF4A 1QVTA 1G4DA 5FLMJ 4G94A 2FOKA 3AFHA 3F8MA 2VQHA 3FZVA 5F64A 1W7PD 3I0TA 4XLPF 4KMUX 3PNTA 2PQ8A 1RIOH 1IF1A 1FBQA 1P4XA 3H3ZA 4C2MJ 4IZZA 3QU6A 4A0ZA 4LJZF 2XIGA 2A5WA 2ZXWH 1O3TA 1Y6IA 2W57A 5K7ZA 1W0TA 3BG7A 4RB0A 2QBYA 2JUCA 1ZLJA 1SFKA 4HDVA 2LKSA 4MO7A 5LEKA 4ZH4F 1IN7A 1XG1A 2ESNA 4E4HA 3B6CA 2BV6A 3LSRA 3PNVA 2ZO4A 3M3YJ 4M3GA 2MBFA 2E1CA 2O3FA 4P55A 1Z1DA 3J7AO 1E3OC 2MH9A 4DYRA 3WTYC 1HW2A 2E2HJ 5E3LA 1BOBA 4JX6A 4WWCA 1VQNI 4MFEA 2ZC2A 3E7LA 5AIQA 4XLNF 4LB6B 1VF9A 5EG0A 4H4KC 3IRRA 2XAUA 4AU7A 2L7KA 2STWA 3CUOA 2VKHA 1MD0A 3DBRB 4D5FA 2X6OA 5GPAA 1ONVA 2CUZA 4EJUA 4W1UA 2AS5F 4BJ6C 5H20A 4L9JA 4IHTA 3HGYA 2HQNA 4KDPA 2EWNA 3ZMVA 3CQZJ 1P7JA 3VPRA 1BI0A 4L9TA 4UB8C 4AC0A 2ZJPF 4NQWB 3N05A 1ZR4A 4KA4A 5LBQA 2JZYA 2LVSA 3V42A 5DD4A 1Y0UA 5K5QA 2QKMB 2XASA 2KFDA 2O61A 3E5UA 2OPTA 2TRTA 2CFOA 1XD7A 2CJJA 3L2VA 4BS9A 2VT3A 2CSOA 1Y1WJ 5FLXK 2OV7A 4PZJA 4G6QA 1AOYA 2A6TA 5F08A 2FBHA 4JK1X 1Z67A 1T39A 5B5EC 5HNFA 3J81Z 2W24A 1IDYA 2HDCA 2JN6A 2K9SA 2PJRA 4MQVA 3TEDA 4AM3A 1S6LA 3H9JA 2OZUA 2P4WA 3ZRGA 4YRVA 5CLSA 1MGTA 2YSRA 3BZ6A 1HBXG 2OCEA 5LGNA 4BQOA 3CZ6A 3DPTA 1LVAA 3QRFF 1FOXA 3BQYA 3F9KA 2VJJA 3ZQFA 4LLNA 2R5ZA 2Y30A 2YUSA 3BG5A 1IN8A 2VJIA 2IS4A 1U9NA 5C3EJ 3TOBA 4G7ZF 4KYWA 2R7WA 4IX7A 1IRFA 3BQZA 3SFZA 4E7ZA 5K7HA 4V2GA 1O7LA 1IW7F 1BI2A 2VKVA 3GFMA 1XSVA 4X6AJ 4IOCF 1MSFC 1LKXA 2B7EA 3Q0WA 4X1EA 4C3IJ 4EM0B 1OISA 2EK5A 2WAQN 1D5YA 2F5VA 3HJEA 2IW5A 1MMNA 4IL6C 4IRIA 5JI6A 3GFIA 4XM3A 2KIMA 3DU5A 2E2JJ 4LOCA 2NVYJ 3S15J 4HX4A 4Y17A 2X85A 2XKPA 1PUFA 5HS7A 3FXLA 3KP4A 5BMZA 2H1KA 4M3BA 2XAGA 1LPQA 3RQIA 3ZGKA 1BJAA 1Z3XA 3TGNA 3W6VA 5HNHA 5LFAA 2OTJI 2ZSIB 2ISYA 1S8NA 3TOAA 4L5JA 3SQNA 2WAFA 3T1BA 4HRIA 4MTEA 5GAGJ 3NQOA 2V1DA 1OCCH 3HGGA 4PJ0C 4PJLA 2D45A 3J7ZI 3SZGA 3R61A 4MLOA 1BC7C 2R7OA 2IA1A 2H27A 1FSHA 2K4JA 2VQGA 1JKOC 4BGDA 1RKTA 4B43A 3OYFA 1D0ZA 3H9QA 2BE5F 1ETOA 1SD7A 3P9KA 1CF7B 1QVUA 3E6CC 1FP2A 3ZQGA 4RGSA 2MLGA 2LLKA 4AVPA 1K7AA 4WCGA 4II2A 3L09A 5F1JA 4IPAA 4BUPA 5LRSA 4CCOA 3CMYA 2ZXHA 1JT6A 2A61A 1A6QA 2DJIA 3K2ZA 2P7VB 1QQIA 5J40A 1KQ9A 2R7TA 4KITB 4G12A 1ZYRF 3MZHA 2STTA 1IZ1A 2DA7A 2BBYA 4ZYAA 5BPIA 1GVDA 5FD5A 2XSDC 2JQ7A 2KZVA 3M7GA 1X1CA 2ISZA 1UFMA 3J80Z 3AL0C 2Y75A 3PNYA 4EJWA 3F8BA 4E7JA 4A3JJ 4ZTFA 1QPIA 1AKHB 3GTMJ 1JI8A 4OMYA 2VN2A 1RNLA 3V7RA 2MFZA 3A0HC 1AA7A 4XOTA 2A6EF 3PO3J 4A3MJ 1R36A 2XHKA 5E79C 3FBNB 2RC4A 4G6DA 2ZB9A 1FOWA 1GVJA 3GWZA 1O7FA 4ZDPA 1OCZH 5FKMA 1PVEA 2VPLA 4JQFA 1DP3A 2K3PA 3W2WA 2OZ6A 2AQFA 4GDFA 5HLGA 2EB7A 1A5JA 3K1PA 5BNGA 5J47A 4R79A 1T56A 1TL8A 3RIRA 3BTIA 2K02A 3AG4H 5FKNA 4ENJA 1HXDA 1ERDA 3ZP5A 4A3EJ 1PDNC 4KICA 3ZXSA 1TWFJ 2XROA 1DPUA 4KMFA 3VSLA 2K9LA 3A2KA 2G7HA 3WGGA 1Z0XA 3VEPA 1SD5A 1JJ8C 2JRTA 1IN4A 2V9PA 3Q0UA 4XKCA 1BC8C 4IKFA 2KIQA 2ZMEB 2GXAA 2VONA 3LFUA 4NQWA 4FX0A 1F5TA 4QWQA 1V54H 3JR9A 2Z3YA 3ECHA 2M4KA 4BACA 3M07A 1LE8A 5EZGA 3CJTB 5JHFA 4R8HA 4XICA 2RNJA 3F6VA 1RR8C 3N4MA 3KLOA 3I4MJ 1KQ0A 3TO7A 2Y9ZA 3L2RA 1MNDA 2XF6A 5E8GA 1G2HA 2IPQX 2RDPA 5IP9J 2EH3A 1HKQA 3ZQLA 1Q1HA 1K6YA 2EQRA 3U2RA 4CCKA 2ZJRF 2QM3A 3EPZA 2O5RA 1SFEA 2LNBA 1UMQA 2Y0SN 3F6OA 3CUQB 4A3BJ 2NS7A 3DPUA 4Y52J 2Q2EB 3KP5A 4CDGA 4PJMA 2NVXJ 2HS5A 5GPCA 3OYCA 4G7HF 2TDXA 2DFEA 3MKLA 3S14J 2ICWG 4RMNA 3DXJF 1FYLA 3A4CA 5D6FA 2P81A 1S72I 4CO8A 4BDZA 2R3SA 4HV6A 4L5IA 4XSXF 3ZQ7A 2OU2A 5D5WB 1Y39A 1OPCA 3ESWB 3K70C 3IH4A 5KNLA 3G1OA 2FJ1A 3ISPA 1G3WA 4YG2F 5FRNA 2BHYA 4G9YA 4NUBA 3LSHA 1FIAA 4M3DA 3IHUA 4MIMA 1EA3A 1HC8A 3RKWA 1HDPA 1T98A 2F5FA 3NWSA 2EPFA 1D1AA 2ECBA 1BIBA 3J81K 3F21A 4E70A 2LYCA 3JAMK 5EDNA 1T8IA 5ILVA 1W7PB 2L7FP 3WE3A 4B47A 2DFHA 3CCYA 3U9GA 5A2QK 4OIPF 1NG6A 3OYNA 3R0AA 2LKPA 1SFUA 3WGIA 1EJ9A 3OYAA 2E1OA 2HPIA 2Y0MA 4ANJA 2H6BA 3CCMI 1MJBA 2K3FA 2W82A 1XPXA 2GIVA 5JLXA 1B8IA 3E5QA 4LITA 4J00A 3M8JA 4L0ZB 1ACIA 2MYSA 4IQ4A 2DMQA 4PK4A 3P9CA 2CQ7A 2HYFA 4LK0F 5KCMA 1YYVA 1Z6RA 2UZKA 3S1RJ 2RREA 2XF5A 1D3YA 4ZZDA 3K70D 3D1NI 1TQMA 3S1MJ 1O3RA 3IP4B 4GCVA 2JRMA 5J1RA 2XF7A 2CQXA 1UB9A 1QA6A 3MEXA 2LR8A 2CRGA 5M3FJ 1MIJA 4KNYA 4GGGA 1XCBA 2M8EA 5LRRA 1XN7A 2AHQA 2KDOA 2MC3A 3ZR8X 3OSFA 2E7XA 2VPRA 2BYVE 4XMYA 3K7AJ 3A03A 3H92A 5FKLA 1MKMA 2KIFA 3CP2A 3S2WA 2W4SA 3QP5A 2MLKA 1VNDA 2GOXB 4A6DA 4EV0A 3KYLA 4LFUA 4ESFA 1WGXA 2LP0A 3L9FA 3VYUB 1WH5A 5E1XA 1V5FA 2R5YA 2XRNA 4U88A 1IUYA 2MG4A 5J4VA 3B6AA 3PQJA 3Q3SA 1FIPA 5LHIA 3OYHA 3TO9A 4BL0B 2OJED 3HXLA 4QPOA 3F72A 2E5ZA 4BJ5C 4RS8A 4AWXB 5EG0B 1WSUA 1I50J 5DEQA 2GQQA 4OWRB 5DTDA 1K6OA 4BXFA 4FT8A 2COMA 4JOMA 5D6EA 4CGZA 3SHFA 1ETVA 1V3FA 1XSXA 2FA5A 3FM3A 2VJ5A 4UV8A 5ED4A 3OIOA 1ZG3A 1MBEA 2K86A 1ZARA 4A69C 2DFIA 4F52A 1ULYA 2X48A 1YG2A 2L4AA 4C3HJ 2DTRA 3GTPJ 5CVJA 2D5VA 2ECCA 3TMOA 1YLFA 3VWBA 2H94A 1B1BA 2Z9OA 5DV5A 1XGOA 4C9YA 2L9SA 4ESBA 3U1DA 5JVGF 1QZZA 4OOIA 1L0OC 4J01A 2W48A 1OJLA 4BY1J 1Y8RB 2PMZN 2KP6A 5CVRA 2B63J 4C30A 1V55H 2FSWA 4N4NB 4XLHA 3J80K 3S16J 2LY9A 1B4AA 4D1QA 3JSOA 3HTSB 1REPC 1KZHA 1IRXA 2E71A 4Y15A 4DGWB 3PSFA 5TJJA 1SVLA 2ZMEA 1MBGA 1D0YA 4L5EA 4BYYA 1R7JA 5FB2A 2CS3A 3CJQB 1JUPA 1LFPA 3HPGA 1IRZA 4YIIA 4BE2A 3DQVC 4HYEA 3TW6A 1E3PA 2R7FA 3IL2A 2GXGA 3M1CA 3OYJA 2HQAA 2R4GA 2R7RA 1A31A 4HBLA 3MKZA 3G1LA 2K4BA 4CCJA 1U6GA 3RKYA 3S2DJ 2JK3A 4XIDA 2CV1A 4A3FJ 4J19A 2AO9A 4KN7X 1JTYA 2OF7A 2DMNA 2G0EA 3L2UA 1P6RA 1GUUA 1WQ2A 1R5GA 3FMRA 4XKWA 3QOPA 3GCMA 3OYDA 4DIQA 4BQNA 1T38A 2E34A 4LLLA 3DCFA 3FHZA 4PSWA 3JRCA 4UY8I 2FNPA 2AQEA 5FRMA 1TT5B 1Z21A 1FY7A 5LLQA 3QPTA 2ADUA 5EZHA 5GP9A 3JRBA 1HKSA 4HDUA 3ZCOA 3OIPA 2A68F 3KZIC 3K69A 2NYXA 1ZKGA 4RB1A 4I02A 1UG0A 1GXQA 2HKXA 2EFOA 3HSFA 3W6KB 5D8KB 3DLAA 5IP7J 3RDIA 1YRNA 2YX7A 3P7NA 4WXHA 5GTIC 1YHQI 2IP2A 4N0BA 4JX4A 3S3MA 3DBLB 1MNMC 3J7AY 5IOYA 2EZIA 2RGVA 2VI6A 3GTOJ 2XPWA 3KIOA 3OWTA 1ENHA 2DYSH 3CDLA 5H2FC 1JKRC 5EJCA 5L3BA 3K4BA 3D5SC 1WPKA 2DT6A 2O9LA 2EZKA 4RGXA 5IYDJ 2JWTA 2V1UA 3WTWC 2L4MA 1X1DA 4GYIA 3KP3A 4AUXA 1RUNA 5ICFA 1LUJB 2O7OA 3BY6A 2DA3A 1MJ9A 4UVAA 4XQFA 3OYEA 5GAHJ 4HV5A 3UKGA 3HRTA 1MMAA 1TT0A 1WJDA 4Z6YA 4JP0A 2JA5J 3T0YA 3H5AA 2GA2A 2CW8A 4BBRJ 1S7AA 2Z1DA 2P5LC 1OMIA 2R7SA 4XN3A 3PO2J 1R71A 3FF5A 3V4GA 3S1QJ 2O8KA 2HXIA 1I5ZA 1MBHA 3P5JA 3F3XA 1P7IA 4O3MA 1RC9A 1WKMA 4FHTA 3RYRA 2BGCA 1S7OA 1ZK8A 3SEZA 2Q1ZB 2VBWA 3C2GA 1Z05A 2K27A 3LSTA 4D9JA 5L3FA 1MMGA 2J5OA 3M8FA 4JBAA 2IS1A 3K10A 9ANTA 3COAC 4CICA 3W6JB 1VQMI 4ZTJA 4QTRA 2E1MC 2KDZA 2RN7A 5LHGA 3FISA 2OQRA 1J59A 3HBLA 3PJRA 3CESA 1T95A 1IN6A 1BOAA 5F27A 3AL0B 4YEJA 3CC2I 3LSMA 1NHAA 1G3TA 4KISA 1X19A 3JW4A 4V2FA 5TRDA 1Y8QB 1I6XA 2KHMA 3LAPA 3KZZA 1X1AA 2QENA 4HF0A 2K85A 5CVIA 2UV1A 2ZJ2A 1Q1VA 1TWAJ 4OIRF 5DCMB 2HU9A 2K9NA 3KETA 3CCQI 3G3ZA 5CQEA 1FX7A 4RDUA 1OR7C 3A0BC 1P92A 3HEFA 2NVQJ 1USTA 2PMHA 2HVSA 3T8RA 1DU6A 2DA1A 2KRCA 2MD5A 2EZLA 4ZYEA 4ZJZA 4NC6A 5E1WA 2YX4A 1RR7A 1OR7A 5HDGA 5K7FA 3I56I 1YITI 2ZSHB 3H9GA 4BQAA 3C18A 2A69F 1QRYA 2JT1A 3EUAA 5D8LB 3HPHA 3I54A 1SFXA 2QQ8A 1LE8B 2UUZA 3CO7C 1SFOJ 2CO5A 3IUOA 4JX5A 3QAHA 2M8GX 2FMLA 5J8FA 5FFXA 2J5PA 1WJAA 1USSA 4YFKF 3F23A 2Z2SB 3LAJA 2HPMA 1VQ8I 2GAUA 2QF7A 2DMTA 4HF1A 3I3LA 3RKXA 4UV9A 4D7MA 1S3JA 3K4CA 2M0CA 2EA2A 1YW8A 3OS2A 3F8CA 1EH6A 1G3YA 1RETA 4Y3OA 5E1ZB 1R1UA 5FO5A 2C6YA 3DEUA 1D8KA 2IGMA 3GTKJ 3WU0A 4PFPA 1FZPB 3ABUA 4FISA 3IH3A 2MSYA 4F91B 5HLTA 4ENMA 2H09A 1YIJI 2E35A 1TZLA 1GDTA 3FM5A 2WAQA 2CW7A 2WADA 3GVAA 1FBUA 2DA2A 4A3IJ 5DDGA 2V9VA 4L18B 4F92B 2KRHA 4DNCA 3L2CA 2XB5A 4F7ZA 5EF6A 3RJPA 4RGRA 2X6XA 3ZN0A 1KONA 3KYDB 3DEWA 2F5DA 3GF2A 2QGUA 4HX7A 3PSIA 4E7LA 2W84A 1HF0A 1WRJA 1FWZA 3DKWA 2LREA 4M71A 3ZPLA 5HODA 2IAIA 1FYKA 4BJTA 1Z7LA 4HQEA 2KQRA 1VQ7I 3HKZN 4B48A 3BG9A 2E19A 1VQPI 4BXXJ 2EILH 1LB2A 1UCRA 3BP8A 2XAQA 1JHHA 1FPQA 5B1AH 1FMWA 1U5TC 2ELKA 2FEZA 3LSKA 3WU2C 3CD6I 3I53A 1Z7UA 2LF8A 3ZMDA 1ZRDA 3ZN1A 2E5NA 2LY1A 1B8IB 1IV8A 3D0SA 4OMZA 4PUSA 2JA7J 3A01A 3MN2A 4NB5A 1U5TA 4DYCA 2VL8A 5JHUA 4MNUA 2XGEA 3HRSA 1B59A 3V7CA 4E7KA 3KP2A 4KUMA 3ZQQA 1TQIA 4FX4A 1R1VA 1OLTA 1XX5A 2EV6A 1R5ID 3CO6C 5CKTA 2VE9A 1A36A 3CF5F 1FOKA 2VB6A 4BBSJ 3AG2H 3OV8A 4ZC3A 5F0HA 2R92J 3BWGA 2JPCA 3KZYA 1YJWI 4NC8A 2IS2A 2M7AA 1VTNC 2CH0A 4XL9A 4CYDA 1SANA 1Z77A 1W5TA 4OU0A 3P9IA 3WTVC 1RI7A 3S3NA 2KIUA 4IJAA 2IA0A 1DQUA 1R00A 5IT9Z 1ZREA 4AIJA 1WH7A 3H36A 1UG2A 4QSHA 4CHUA 1MMSA 2CYYA 3OL4A 4Y7NJ 2P6TA 2QQ9A 3F8FA 1I6HJ 1UHMA 3H0GJ 3Q9SA 4Q47A 2DA6A 2LG4A 1ZELA 3G1MA 3H5RA 2F4MB 2BY3A 1TQPA 3CCJI 2R5YB 1X2MA 3ABTA 3H5NA 1N25A 4YFNF 2LD5A 2IXSA 5IT3A 2EA4A 3PIPF 1LFBA 5KHDA 4QLCU 1SEUA 2HZDA 3PIOF 2DOFA 4CH7A 1TC3C 4Y33A 5CPRB 4HG2A 2O0YA 1TNTA 4XRFA 2P0WA 3V8LA 2JPBA 1V5GA 4KT5C 1KA8A 4MEYF 5IP6A 2HOAA 1WVRA 1MZBA 2ZFUA 1SAUA 2BVMA 5IYBJ 1KQ8A 4L0YB 2NNNA 2F4IA 3PQKA 2QUFA 5DCMA 5B1BH 1O4XA 2DK5A 3C2HA 1NK2P 1DPRA 4BQQA 2O6GE 4BXUA 5ICGA 5EGOA 2P8TA 5GTHC 2V79A 4HSTA 4GRIA 3BR2A 3FMSA 3CCSI 1ZG5A 4FASD 2IA2A 3CCLI 3L2QA 3EUHC 2Y0SA 2Z16A 4XK4A 5E3OA 2JTVA 3OYIA 1SVOA 2KT0A 4JYKA 1WCMJ 4D0PA 4EJVA 1RKWA 1JUMA 3L7WA 4AVZA 3K4LA 3RPQA 5M5XJ 3V7SA 3MZYA 3EUHA 2UXXA 1Y0NA 2KL4A 2G9WA 2H8RA 1VQ4I 5E17F 2VKEA 1FBSA 1DUXC 3LSPA 4A5MA 3TQNA 1IG7A 1FC3A 4BU2A 3GW2A 1ZQ3P 1W0UA 3K0LA 2EV0A 3ULQB 5J6XA 3GYHX 2WB1N 1XSDA 5E3MA 1HSJA 2HYGD 3ABLH 5CVUA 1K78B 4S05A 4IF4A 5F0CA 3NARA 4RB3C 2V6CA 2XV4S 3ZQHA 1W36C 3I71A 4UVCA 3Q0VA 5BQTA 4LLGF 5GAEJ 2W85A 2EBIA 2DA4A 3I58A 2KJBA 1DDNA 2K5CA 3GXOA 5J3LA 2M1BA 3FMQA 3S2HJ 3CMEI 5IYCJ 5ICCA 1ZGWA 1WI3A 4I2OA 1X58A 1SAXA 1A04A 1KYZA 2F48A 2XPUA 4X0GA 1JXSA 3KE2A 1SMYF 2XSJC 1CGPA 3GZNB 1HA8A 2BXYA 2RQPA 3BOQA 3KCCA 4Q48A 1XB4A 4Q5SF 1J9IA 4A0YA 1POGA 3O8HA 2QA4I 1TW2A 1F36A 1YRNB 1VQLI 1T6SA 2ZFWA 2HR3A 4C2UA 2K9MA 5H6RA 3HB9A 3BC8A 3HOSA 3IRQA 2LY2A 1YX5A 5B3SH 4KIBA 1U3EM 3REOA 2Z5UA 1O57A 1RUOA 2V1XA 4AD9A 3I9V2 2XAJA 2CQQA 1EH8A 2QVOA 1GT0C 1QZYA 4G7OF 2BVLA 2FRHA 3OYLA 4XSZF 3KLNA 3M1EA 1FNNA 1W36D 4EM1A 4N9IA 3A1YA 1UJ8A 3K1MA 3H3VK 3PM1A 4NC7A 3QOEA 3HOVJ 1GV5A 4MTDA 1ETXA 2R7VA 3GUDA 3J7YJ 4Q4ZF 3IAS2 3LSGA 2XRLA 3WTUC 2WWYA 2GXBA 4CCMA 1ZLKA 2DQLA 4M6XA 4KFCA 5KAIC 1JKQC 2L01A 4MGRA 1AHDP 4AIKA 2A05A 2FBIA 3QP6A 4ZZLA 2RVCA 3WE2A 4WXDA 3BTCA 4RAFA 2NRAC 3MD2A 3BR3A 3W3CA 3HOUJ 2EFQA 1G6NA 1G3SA 1Y56A 2I5UA 4N4OB 2RNGA 2GZWA 3R6SA 3ERED 3HIFA 3HRMA 1TWCJ 2BEOA 3CCVI 1GLNA 3LA2A 4BHBA 1X2NA 1L3LA 4A2UA 4GFBA 1G59A 3OL3A 2M0MA 3HOYJ 3VYTB 2CWEA 1IXSB 2E1NA 3HHHA 1WJCA 1F43A 3PUFA 5IY5H 4M73A 3RZDJ 5J8CA 1ETWA 1RESA 2DJNA 1XMAA 4CZZA 3DTIA 5EEHA 1QHGA 2ZXJA 2HI3A 5TGTA 1HDDC 4OIOF 3HL2A 1VI0A 4DJAA 2IBDA 1BBYA 3IH2A 3L2WA 1E0EA 3OR1C 2H1LA 3DWLE 1YX3A 3ZMUA 5KVRA 1HW1A 3F22A 1PP7U 4HAMA 2MC4A 2M2EA 4M3EA 2HTSA 2DCEA 2E1MB 2LOOA 3BJAA 1P4AA 5B66C 2QSFX 1ETKA 3WTXC 1QGPA 4L9NA 2PEXA 3I4NJ 2PMZA 3DF8A 2V4JC 1ZRCA 3FXMA 3UR3C 3BR1A 3CCUI 2DU9A 3E5XA 5D4SA 5FGMA 4RLQA 3ZQCA 4MHGA 1WJBA 1T0FC 4KJZA 2RQQA 3GBGA 1XCVA 3WTSC 5IT9K 1ZG1A 4HA8A 3K4MA 3RSNA 4DBQA 5H6QA 4IHSA 1ZGAA 3VYRB 3G6EI 2IJLA 1YIOA 1MBKA 3SZTA 1GXPA 1KU2A 1SD6A 5HLIA 1U8RA 2XGDA 2HFHA 2HKOA 2CUJA 2HTJA 2QQBA 3JRFA 2IRFG 4A5NA 1OCRH 4ON0A 3I59B 3RI4A 4CYCB 2X9DA 2HGCA 1BJZA 5JFRA 3IAM2 4A3KJ 2P5KA 1TWHJ 4HLYA 3SJMA 2ZNYA 1WZ2A 2N8GA 5LGUA 1UHSA 3ZMTA 5LHHA 4BNCA 5JVTA 1B72B 2LDUA 2PJPA 3VODA 3HTUA 1LDKB 2ETHA 2W00A 1Z6TA 2ZXIA 5DUIA 4BAYA 3FKIJ 3E1SA 4E7SA 2JSPA 3E6DA 3QYEA 4RBOA 4G8XA 1K78A 1A6IA 2L9VA 3FK7A 3LQRA 1N78A 4IO9F 3IWFA 1J7KA 4EQQA 3BR5A 4UHTA 2M45A 3OYMA 1WFXA 5J4YA 4F3QA 1R4NB 2RAEA 4RA2A 3TBIA 2QYOA 1OYYA 2X0LA 1K4TA 3RTRA 1BI1A 4EVIA 2QLZA 1D1BA 3FXKA 4G6TB 4A12A 1JGGA 3LQQA 2VASA 1XGSA 2WV1A 3AG3H 3LL7A 1OQYA 2Y69H 2ZCWA 2E36A 3FIWA 3V8KA 3ELKA 1XGMA 5L3DA 5ICEA 2P7CB 5M5YJ 4UNOA 3HOZJ 2I10A 4B8XA 3HDDA 3MVPA 1A35A 1P9QC 3GTGJ 3QODA 1W5CC 1MH4A 3C2BA 1F4KA 4A6EA 3RZOJ 2Y2ZA 4YELA 1IN5A 5F04A 2PN6A 5ERIA 1BW5A 1JGSA 2FMYA 1FTTA 2VOPA 2D2WA 2EJRA 2X1DA 2CMPA 2WY7Q 1K79A 3DU6A 4ZDLA 2AXTC 1OYIA 5HS8A 4BY7J 2DFFA 4E6KG 2LBFB 2LFBA 3K9TA 4WX9A 2VBZA 1U78A 4P9FA 4D7NA 3CF2A 1ON1A 3K6GA 4FTHA 3HSEA 2BOLA 4LIVA 2OTLI 3IC7A 2DAOA 2DO7A 3ONQA
chains in the Genus database with same CATH topology
3A01B 1A5JA 1IJWC 1JJ6C 5BNGA 3SFIA 2DA2A 4A3IJ 1T56A 3BTIA 5FKNA 2JA6J 2JMWA 4A3EJ 1TWFJ 4BKXA 4C3JJ 4AYBN 1MSEC 4IHXA 5C4JJ 2XB5A 5EF6A 4A93J 1Z0XA 3K2AA 3LSJA 1JJ8C 2HQ5A 3Q0UA 3F0CA 2L0KA 3DEWA 3IV5A 3SDGA 3JR9A 2FQ4A 1LE8A 1HF0A 5EZGA 1NK3P 2YS9A 4XICA 3QPSA 5HODA 4NDLA 2IAIA 3I4MJ 2LTPA 1H8AC 1FTZA 1AKHA 4ABZA 3QQAA 2Y9ZA 1G2HA 3HKZN 4UUSB 1U8BA 3BG9A 4IHVA 1OCPA 2E19A 5IP9J 2EH3A 4BXXJ 3ZQLA 2HDDA 2EQRA 2MGQA 4FCYA 2M34A 1UMQA 2Y0SN 1XS9A 1IV6A 2ELKA 4A3BJ 2NS7A 4XRSA 4S0HB 4Y52J 2FD5A 2NVXJ 5GPCA 3LNQA 3MKLA 1B8IB 5EYRA 1FJLA 2JA7J 2VUMJ 1IC8A 3S14J 3A01A 3MN2A 4DYCA 2P81A 2IEKA 2XGEA 2NVTJ 2E2IJ 2NOGA 1FEXA 1ORKA 2M9HA 5FKOA 1S7EA 3TP0A 3JRGA 3IH4A 1HCRA 3G1OA 2FJ1A 1BL0A 1JUSA 4BBSJ 5DS9A 2R92J 5F0FA 5F0HA 3WHCA 1FIAA 4M3DA 4A3GJ 4MIMA 1HLVA 1SANA 1HDPA 1DU0A 3HM5A 1Z77A 3BR0A 1H88C 2ECBA 3GTJJ 1T33A 5EGOB 5EDNA 2L7FP 1OCTC 1WH7A 4QSHA 1UG2A 1LFUP 4Y7NJ 1I6HJ 3CCYA 2ID6A 1VFCA 3H0GJ 2JJ7A 2FX0A 3JRHA 2DA6A 2E1OA 1APLC 3G1MA 4A3CJ 4FE7A 2R5YB 1AU7A 1X2MA 5FLVA 4CYCA 4I6ZA 2LD5A 2R5ZB 5JLXA 1B8IA 4A3LJ 1LFBA 5IPAA 1TC3C 2LKXA 2DMQA 3JRDA 3HOWJ 1B72A 1JT0A 3S1RJ 3D1NI 3LOCA 2R0QC 3S1MJ 5IP6A 5J1RA 2K40A 3ZQIA 2CQXA 2YU9J 2HOAA 2LR8A 2CRGA 5IYBJ 5M3FJ 2GBYA 2DN0A 3JRAA 1O4XA 1NK2P 2AHQA 3OSFA 2VPRA 1PUFB 3K7AJ 5EGOA 1CQTA 3BTLA 3A03A 5FKLA 1ETQA 3OOUA 3BR2A 2L7ZA 1VNDA 4IEJA 2L9RA 5IOZA 2XGCA 4XK4A 5E3OA 3M4OJ 1WGXA 1NTCA 2LP0A 2KT0A 4JYKA 1WCMJ 1WH5A 2ID3A 1RKWA 1JUMA 2R5YA 2R93J 5M5XJ 2MG4A 1K61A 4M6VA 5FKKA 3B6AA 3Q3SA 2H8RA 1FIPA 1Y1VJ 2VKEA 5J1UA 4DYQA 4DZPA 3LSPA 1IG7A 1I3QJ 2JA8J 3ZOBA 5EG0B 1W0UA 1ZQ3P 1I50J 1RPWA 5DTDA 2WB1N 2MW8A 5E3MA 1BA5A 1ITYA 1ETVA 3FK6A 3NAUA 3NARA 5F0CA 4XRSG 4W97A 5C44J 3OIOA 3ZQHA 1MBEA 1QVTA 5FLMJ 4IHYA 4A69C 3Q0VA 2X48A 3O8GA 4C3HJ 3GTPJ 2EBIA 2DA4A 2D5VA 2ECCA 5J3LA 3S2HJ 4C2MJ 5IYCJ 2Y31A 1ZGWA 1IDZA 1WI3A 2HOSA 2NS8A 1X58A 2XPUA 2EZHA 2W48A 4EEFG 1OJLA 4BY1J 2PMZN 5K7ZA 4HNVA 1W0TA 2B63J 1GV2A 3S16J 2LY9A 4MO7A 2DMUA 1XG1A 1IGNA 3B6CA 3LSRA 1POGA 3O8HA 1MBGA 3M3YJ 4L5EA 4M3GA 1JKPC 1F36A 1YRNB 3S1NJ 1JUPA 1IRZA 1K83J 1E3OC 3TW6A 4DYRA 3HB9A 2GLOA 2E2HJ 5E3LA 3OSGA 4JX6A 4MFEA 3E7LA 3G1LA 4UUSA 4IHWA 3GTLJ 1VF9A 5EG0A 2JK3A 3S2DJ 2CQQA 4XIDA 1GT0C 4A3FJ 4J19A 2AO9A 1JTYA 2OF7A 2DMNA 2G0EA 4QIWN 5C4XJ 1GUUA 1R9TJ 3H3VK 3PM1A 4D5FA 3HOVJ 4B3AA 2X6OA 1GV5A 5GPAA 1ETXA 4W1UA 3DCFA 3JRCA 5M5WJ 1MH3A 3LSGA 3HGYA 2XRLA 1JTXA 5GP9A 3QPLA 5EZHA 3JRBA 1JKQC 3CQZJ 1P7JA 1AHDP 1HOMA 3VPRA 2ME6A 4AC0A 2DA5A 1ZR4A 4UUTA 2GM4A 3BTCA 1OFCX 1ZKGA 2LVSA 2R7ZJ 3BR3A 3HOUJ 1EF4A 2OPTA 2TRTA 5IP7J 1TWCJ 1ZR2A 1YRNA 2CJJA 5M3MJ 1X2NA 3L1PA 4JX4A 1Y1WJ 4GFBA 1MNMC 3HOYJ 5IOYA 2EZIA 4B1RA 3S17J 5F08A 1F43A 2VI6A 3RZDJ 3GTOJ 2XPWA 1ETWA 1RESA 1ENHA 2DJNA 3TW7A 3CDLA 4D5CA 4A3DJ 1JKRC 1IDYA 2HI3A 2TCTA 2JN6A 2K9SA 1WPKA 3TEDA 2O9LA 1HDDC 2EZKA 2LK2A 5IYDJ 2JWTA 1VI0A 2IBDA 2L7MP 3IH2A 3WHBA 3RKQA 4AUXA 1IUFA 2O7OA 3BQYA 3ZQFA 2R5ZA 2Y30A 2DA3A 2YUSA 3BG5A 5J1YA 1MBFA 2M2EA 4M3EA 1U9NA 5C3EJ 3UKGA 4JP0A 1ETKA 3BQZA 3I4NJ 2JA5J 2CUEA 5K7HA 3A02A 3BTJA 4V2GA 2VKVA 3BR1A 4X6AJ 4BBRJ 1MSFC 3Q0WA 4X1EA 3ZQCA 3GTQJ 4C3IJ 3PO2J 3S1QJ 2O8KA 2HXIA 2WAQN 3GBGA 1D5YA 1MBHA 1P7IA 4DZJA 4FE4A 3BT9A 2E2JJ 4LOCA 2NVYJ 3S15J 2CUFA 1MBKA 1PUFA 1ZK8A 5FJ8J 3JREA 2H1KA 4M3BA 2DMPA 2XGDA 2QCOA 3RQIA 3JRFA 3W6VA 4CYCB 1MBJA 9ANTA 2HXOA 2X9DA 3HOXJ 1BJZA 3TP3A 4A3KJ 4QTRA 1TWHJ 2KDZA 3SJMA 3FISA 2N8GA 1UHSA 3HBLA 3HGGA 1B72B 5F27A 1BW6A 2HOTA 3FKIJ 4MLOA 4V2FA 1JKOC 1ZTRA 4XRMA 1RKTA 4RBOA 1A6IA 4MFDA 3FK7A 1ETOA 1Q1VA 1TWAJ 4B4CA 2K9NA 3BR5A 1ETYA 1QVUA 2RAEA 4RDUA 3ZQGA 3HEFA 4I76A 2NVQJ 2LLKA 2Y9YA 3BG3A 5F1JA 1DU6A 2DA1A 3CMYA 2EZLA 1JGGA 1JT6A 2HYJA 2WV1A 1RR7A 5K7FA 5EEAA 4G12A 3FIWA 5E3NA 3JRIA 1U9OA 1QRYA 2DA7A 3HOZJ 1GVDA 2CU7A 5M5YJ 2I10A 3HDDA 2XSDC 3MVPA 1LE8B 3GTGJ 1SFOJ 1H89C 2K9QA 2XPVA 4JX5A 1MH4A 3C2BA 2M8GX 3RZOJ 2Y2ZA 5F04A 4A3JJ 1BW5A 1QPIA 1AKHB 3GTMJ 2ME0A 1FTTA 2XB0X 2QF7A 2DMTA 2COBA 4D7MA 4BY7J 3PO3J 4A3MJ 2M0CA 2ZB9A 1XC5A 2LFBA 4M3FA 4DW6A 1U78A 4D7NA 1RETA 3BR6A 1TWGJ 5JLWA 4FTHA 5FKMA 2DTZA 3GTKJ 4FISA 3IH3A 2MSYA 1GDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A01 B;  1A5J A;  1IJW C;  1JJ6 C;  5BNG A;  3SFI A;  2DA2 A;  4A3I J;  1T56 A;  3BTI A;  5FKN A;  2JA6 J;  2JMW A;  4A3E J;  1TWF J;  4BKX A;  4C3J J;  4AYB N;  1MSE C;  4IHX A;  5C4J J;  2XB5 A;  5EF6 A;  4A93 J;  1Z0X A;  3K2A A;  3LSJ A;  1JJ8 C;  2HQ5 A;  3Q0U A;  3F0C A;  2L0K A;  3DEW A;  3IV5 A;  3SDG A;  3JR9 A;  2FQ4 A;  1LE8 A;  1HF0 A;  5EZG A;  1NK3 P;  2YS9 A;  4XIC A;  3QPS A;  5HOD A;  4NDL A;  2IAI A;  3I4M J;  2LTP A;  1H8A C;  1FTZ A;  1AKH A;  4ABZ A;  3QQA A;  2Y9Z A;  1G2H A;  3HKZ N;  4UUS B;  1U8B A;  3BG9 A;  4IHV A;  1OCP A;  2E19 A;  5IP9 J;  2EH3 A;  4BXX J;  3ZQL A;  2HDD A;  2EQR A;  2MGQ A;  4FCY A;  2M34 A;  1UMQ A;  2Y0S N;  1XS9 A;  1IV6 A;  2ELK A;  4A3B J;  2NS7 A;  4XRS A;  4S0H B;  4Y52 J;  2FD5 A;  2NVX J;  5GPC A;  3LNQ A;  3MKL A;  1B8I B;  5EYR A;  1FJL A;  2JA7 J;  2VUM J;  1IC8 A;  3S14 J;  3A01 A;  3MN2 A;  4DYC A;  2P81 A;  2IEK A;  2XGE A;  2NVT J;  2E2I J;  2NOG A;  1FEX A;  1ORK A;  2M9H A;  5FKO A;  1S7E A;  3TP0 A;  3JRG A;  3IH4 A;  1HCR A;  3G1O A;  2FJ1 A;  1BL0 A;  1JUS A;  4BBS J;  5DS9 A;  2R92 J;  5F0F A;  5F0H A;  3WHC A;  1FIA A;  4M3D A;  4A3G J;  4MIM A;  1HLV A;  1SAN A;  1HDP A;  1DU0 A;  3HM5 A;  1Z77 A;  3BR0 A;  1H88 C;  2ECB A;  3GTJ J;  1T33 A;  5EGO B;  5EDN A;  2L7F P;  1OCT C;  1WH7 A;  4QSH A;  1UG2 A;  1LFU P;  4Y7N J;  1I6H J;  3CCY A;  2ID6 A;  1VFC A;  3H0G J;  2JJ7 A;  2FX0 A;  3JRH A;  2DA6 A;  2E1O A;  1APL C;  3G1M A;  4A3C J;  4FE7 A;  2R5Y B;  1AU7 A;  1X2M A;  5FLV A;  4CYC A;  4I6Z A;  2LD5 A;  2R5Z B;  5JLX A;  1B8I A;  4A3L J;  1LFB A;  5IPA A;  1TC3 C;  2LKX A;  2DMQ A;  3JRD A;  3HOW J;  1B72 A;  1JT0 A;  3S1R J;  3D1N I;  3LOC A;  2R0Q C;  3S1M J;  5IP6 A;  5J1R A;  2K40 A;  3ZQI A;  2CQX A;  2YU9 J;  2HOA A;  2LR8 A;  2CRG A;  5IYB J;  5M3F J;  2GBY A;  2DN0 A;  3JRA A;  1O4X A;  1NK2 P;  2AHQ A;  3OSF A;  2VPR A;  1PUF B;  3K7A J;  5EGO A;  1CQT A;  3BTL A;  3A03 A;  5FKL A;  1ETQ A;  3OOU A;  3BR2 A;  2L7Z A;  1VND A;  4IEJ A;  2L9R A;  5IOZ A;  2XGC A;  4XK4 A;  5E3O A;  3M4O J;  1WGX A;  1NTC A;  2LP0 A;  2KT0 A;  4JYK A;  1WCM J;  1WH5 A;  2ID3 A;  1RKW A;  1JUM A;  2R5Y A;  2R93 J;  5M5X J;  2MG4 A;  1K61 A;  4M6V A;  5FKK A;  3B6A A;  3Q3S A;  2H8R A;  1FIP A;  1Y1V J;  2VKE A;  5J1U A;  4DYQ A;  4DZP A;  3LSP A;  1IG7 A;  1I3Q J;  2JA8 J;  3ZOB A;  5EG0 B;  1W0U A;  1ZQ3 P;  1I50 J;  1RPW A;  5DTD A;  2WB1 N;  2MW8 A;  5E3M A;  1BA5 A;  1ITY A;  1ETV A;  3FK6 A;  3NAU A;  3NAR A;  5F0C A;  4XRS G;  4W97 A;  5C44 J;  3OIO A;  3ZQH A;  1MBE A;  1QVT A;  5FLM J;  4IHY A;  4A69 C;  3Q0V A;  2X48 A;  3O8G A;  4C3H J;  3GTP J;  2EBI A;  2DA4 A;  2D5V A;  2ECC A;  5J3L A;  3S2H J;  4C2M J;  5IYC J;  2Y31 A;  1ZGW A;  1IDZ A;  1WI3 A;  2HOS A;  2NS8 A;  1X58 A;  2XPU A;  2EZH A;  2W48 A;  4EEF G;  1OJL A;  4BY1 J;  2PMZ N;  5K7Z A;  4HNV A;  1W0T A;  2B63 J;  1GV2 A;  3S16 J;  2LY9 A;  4MO7 A;  2DMU A;  1XG1 A;  1IGN A;  3B6C A;  3LSR A;  1POG A;  3O8H A;  1MBG A;  3M3Y J;  4L5E A;  4M3G A;  1JKP C;  1F36 A;  1YRN B;  3S1N J;  1JUP A;  1IRZ A;  1K83 J;  1E3O C;  3TW6 A;  4DYR A;  3HB9 A;  2GLO A;  2E2H J;  5E3L A;  3OSG A;  4JX6 A;  4MFE A;  3E7L A;  3G1L A;  4UUS A;  4IHW A;  3GTL J;  1VF9 A;  5EG0 A;  2JK3 A;  3S2D J;  2CQQ A;  4XID A;  1GT0 C;  4A3F J;  4J19 A;  2AO9 A;  1JTY A;  2OF7 A;  2DMN A;  2G0E A;  4QIW N;  5C4X J;  1GUU A;  1R9T J;  3H3V K;  3PM1 A;  4D5F A;  3HOV J;  4B3A A;  2X6O A;  1GV5 A;  5GPA A;  1ETX A;  4W1U A;  3DCF A;  3JRC A;  5M5W J;  1MH3 A;  3LSG A;  3HGY A;  2XRL A;  1JTX A;  5GP9 A;  3QPL A;  5EZH A;  3JRB A;  1JKQ C;  3CQZ J;  1P7J A;  1AHD P;  1HOM A;  3VPR A;  2ME6 A;  4AC0 A;  2DA5 A;  1ZR4 A;  4UUT A;  2GM4 A;  3BTC A;  1OFC X;  1ZKG A;  2LVS A;  2R7Z J;  3BR3 A;  3HOU J;  1EF4 A;  2OPT A;  2TRT A;  5IP7 J;  1TWC J;  1ZR2 A;  1YRN A;  2CJJ A;  5M3M J;  1X2N A;  3L1P A;  4JX4 A;  1Y1W J;  4GFB A;  1MNM C;  3HOY J;  5IOY A;  2EZI A;  4B1R A;  3S17 J;  5F08 A;  1F43 A;  2VI6 A;  3RZD J;  3GTO J;  2XPW A;  1ETW A;  1RES A;  1ENH A;  2DJN A;  3TW7 A;  3CDL A;  4D5C A;  4A3D J;  1JKR C;  1IDY A;  2HI3 A;  2TCT A;  2JN6 A;  2K9S A;  1WPK A;  3TED A;  2O9L A;  1HDD C;  2EZK A;  2LK2 A;  5IYD J;  2JWT A;  1VI0 A;  2IBD A;  2L7M P;  3IH2 A;  3WHB A;  3RKQ A;  4AUX A;  1IUF A;  2O7O A;  3BQY A;  3ZQF A;  2R5Z A;  2Y30 A;  2DA3 A;  2YUS A;  3BG5 A;  5J1Y A;  1MBF A;  2M2E A;  4M3E A;  1U9N A;  5C3E J;  3UKG A;  4JP0 A;  1ETK A;  3BQZ A;  3I4N J;  2JA5 J;  2CUE A;  5K7H A;  3A02 A;  3BTJ A;  4V2G A;  2VKV A;  3BR1 A;  4X6A J;  4BBR J;  1MSF C;  3Q0W A;  4X1E A;  3ZQC A;  3GTQ J;  4C3I J;  3PO2 J;  3S1Q J;  2O8K A;  2HXI A;  2WAQ N;  3GBG A;  1D5Y A;  1MBH A;  1P7I A;  4DZJ A;  4FE4 A;  3BT9 A;  2E2J J;  4LOC A;  2NVY J;  3S15 J;  2CUF A;  1MBK A;  1PUF A;  1ZK8 A;  5FJ8 J;  3JRE A;  2H1K A;  4M3B A;  2DMP A;  2XGD A;  2QCO A;  3RQI A;  3JRF A;  3W6V A;  4CYC B;  1MBJ A;  9ANT A;  2HXO A;  2X9D A;  3HOX J;  1BJZ A;  3TP3 A;  4A3K J;  4QTR A;  1TWH J;  2KDZ A;  3SJM A;  3FIS A;  2N8G A;  1UHS A;  3HBL A;  3HGG A;  1B72 B;  5F27 A;  1BW6 A;  2HOT A;  3FKI J;  4MLO A;  4V2F A;  1JKO C;  1ZTR A;  4XRM A;  1RKT A;  4RBO A;  1A6I A;  4MFD A;  3FK7 A;  1ETO A;  1Q1V A;  1TWA J;  4B4C A;  2K9N A;  3BR5 A;  1ETY A;  1QVU A;  2RAE A;  4RDU A;  3ZQG A;  3HEF A;  4I76 A;  2NVQ J;  2LLK A;  2Y9Y A;  3BG3 A;  5F1J A;  1DU6 A;  2DA1 A;  3CMY A;  2EZL A;  1JGG A;  1JT6 A;  2HYJ A;  2WV1 A;  1RR7 A;  5K7F A;  5EEA A;  4G12 A;  3FIW A;  5E3N A;  3JRI A;  1U9O A;  1QRY A;  2DA7 A;  3HOZ J;  1GVD A;  2CU7 A;  5M5Y J;  2I10 A;  3HDD A;  2XSD C;  3MVP A;  1LE8 B;  3GTG J;  1SFO J;  1H89 C;  2K9Q A;  2XPV A;  4JX5 A;  1MH4 A;  3C2B A;  2M8G X;  3RZO J;  2Y2Z A;  5F04 A;  4A3J J;  1BW5 A;  1QPI A;  1AKH B;  3GTM J;  2ME0 A;  1FTT A;  2XB0 X;  2QF7 A;  2DMT A;  2COB A;  4D7M A;  4BY7 J;  3PO3 J;  4A3M J;  2M0C A;  2ZB9 A;  1XC5 A;  2LFB A;  4M3F A;  4DW6 A;  1U78 A;  4D7N A;  1RET A;  3BR6 A;  1TWG J;  5JLW A;  4FTH A;  5FKM A;  2DTZ A;  3GTK J;  4FIS A;  3IH3 A;  2MSY A;  1GDT A; 
#chains in the Genus database with same CATH topology
 3A01 B;  5HDN A;  2HQR A;  1U5T B;  3R60 A;  1IJW C;  2CW0 F;  4M6Y A;  2ACJ A;  3GLL A;  3S3O A;  4K2E A;  3DLL F;  3QU3 A;  2MA3 A;  5LGT A;  1KU7 A;  3S8P A;  5E18 F;  5HS9 A;  4C3J J;  1MSE C;  2OA4 A;  4IHX A;  3CJN A;  4LG0 A;  4A93 J;  4HSR A;  4II3 A;  3LSJ A;  2HQ5 A;  2GIZ A;  4IOA F;  2L0K A;  3SZP A;  1FP1 D;  3IV5 A;  4QPQ A;  2X4H A;  3T5X A;  1BR1 A;  3K4J A;  3DKY A;  2EIK H;  3BJ6 A;  2NAZ A;  4A0X A;  1OKR A;  2V9K A;  2IGK A;  3U1K A;  5DD8 A;  2X6Y A;  1TTY A;  4KN4 X;  4UUS B;  1U8B A;  4IHV A;  2L02 A;  1OCP A;  4XKB A;  3C3W A;  1R1T A;  2HDD A;  2QSH X;  4MEX F;  2MGQ A;  4RAY A;  2L9N A;  1V5E A;  1XDS A;  2O8X A;  1MDM A;  1XS9 A;  1ODD A;  3MMY B;  3TO6 A;  3FXJ A;  3HYI A;  4XRS A;  1HW5 A;  4LIU A;  2MD0 A;  1IXC A;  3NEU A;  2FD5 A;  1EH7 A;  2JUG A;  4XLE A;  3B73 A;  1I1G A;  2XC7 A;  1FJL A;  2VUM J;  1O3S A;  2BY1 A;  4IXA A;  2H8W A;  3EYI A;  2DPU A;  3PFY A;  2IEK A;  4IRH A;  4RLF A;  3AAF A;  2NVT J;  2M5W A;  4FQG A;  2WV0 A;  1UEL B;  2E2I J;  1FEX A;  1ORK A;  1YTY A;  4IQJ A;  1ZAO A;  2M9H A;  5FKO A;  3OYK A;  3FHN A;  3JRG A;  1HCR A;  3W2A A;  1XMX A;  2LC2 A;  4BDY A;  5DS9 A;  3ML6 A;  5F0F A;  3WHC A;  3FXU A;  3OS1 A;  4OIQ F;  1UAA A;  2VOD A;  2NVU B;  1YW9 A;  4PGH A;  3JSP A;  4ZYD A;  3G2B A;  1SVM A;  4RGU A;  3HM5 A;  2G7U A;  4IRG A;  1H88 C;  3LMM A;  5DUK A;  3VYS B;  4ZYH A;  1RRJ A;  5EGO B;  3FXO A;  1LQ1 A;  1X4P A;  1LVK A;  1OCT C;  5K1Y A;  1LFU P;  1G8X A;  2HOE A;  2MH2 A;  2JJ7 A;  4EM2 A;  3F8N A;  3EQL F;  4LD5 A;  2VBX A;  3BRO A;  4U0Y A;  2M7B A;  3KP6 A;  4A3C J;  4FE7 A;  3MKW B;  3I59 A;  4CYC A;  4I6Z A;  4HX8 A;  1X3W B;  1WHU A;  1EV7 A;  5HLH A;  1J09 A;  1QHH D;  1PJR A;  1PYV A;  4A3L J;  3LA7 A;  2KLO A;  3C1D A;  2R7U A;  2GA1 A;  1FSE A;  1P2F A;  3JRD A;  3HOW J;  1B72 A;  1UHW A;  5FRO A;  1JT0 A;  3SYT A;  3V8J A;  1KU3 A;  3LOC A;  3PL8 A;  4P96 A;  4XOP A;  5E8I A;  3FKJ A;  2DXI A;  1U2W A;  1B6A A;  4RB2 C;  3ZQI A;  4I09 A;  2YU9 J;  1RZ4 A;  4I7H A;  2NNY A;  3MZ8 A;  4DOZ A;  1VQ5 I;  4B44 A;  2XKO A;  1HST A;  2DN0 A;  2XDV A;  1MW7 A;  1IRG A;  2BW3 B;  1DP7 P;  1WWX A;  3KPH A;  1STZ A;  4WXC A;  4BE0 A;  4F93 B;  1YS6 A;  3WU1 B;  4CA0 A;  3HKZ A;  3BTL A;  3I55 I;  1ETQ A;  2LH9 A;  3OOU A;  5BPD A;  2L7Z A;  2OCC H;  5TIS C;  3JAM Z;  2YR2 A;  4M9S A;  3KX2 A;  3BDD A;  3MWM A;  2FUG 2;  2GWR A;  2L9R A;  2XGC A;  1FLI A;  5A2Q Z;  1NTC A;  2P5V A;  4GYG A;  4KIG A;  1YS7 A;  2VJ4 A;  1W5S A;  2PBI A;  2Y48 A;  2IT0 A;  2R93 J;  1VQK I;  3I5U A;  4HW0 A;  2KKO A;  1JHF A;  4WF2 A;  3ABM H;  3AG1 H;  4DZP A;  4EJO A;  2VT2 A;  3BPV A;  1I3Q J;  1VQ6 I;  1M1E B;  2JA8 J;  3CCR I;  1FYM A;  5JR3 A;  6PAX A;  1BN5 A;  1KYW A;  2MW8 A;  5K5R A;  1BA5 A;  4M9X A;  2PFB A;  4M9Z A;  2Z33 A;  2LBF A;  2X1C A;  5AIP A;  3NAU A;  2M30 A;  4XRS G;  5C44 J;  4W97 A;  1PUE E;  4EGZ A;  2XVC A;  4IHY A;  2VC0 A;  3O8G A;  4XNF A;  1TW3 A;  3QYB A;  5CQG A;  3MFK A;  2E7W A;  2MAB A;  4ITV A;  4ZYG A;  3SDB A;  1TBX A;  2Y31 A;  1IDZ A;  4HLX A;  3BLY A;  4U0V A;  4EMS A;  5CJ9 A;  2HOS A;  1XGN A;  2NS8 A;  2EZH A;  4EEF G;  2PX9 A;  3DTE A;  3TDZ C;  3KEQ A;  4HNV A;  5ILS A;  3E6M A;  1GV2 A;  4E7H A;  3WG9 A;  5LEJ A;  2DOA A;  2DMU A;  2DQR A;  3QWL A;  4F55 A;  3CLQ A;  1IGN A;  2PI0 A;  3Q5F A;  4O6J A;  4YIF A;  1NG7 A;  1MJA A;  4I99 C;  1V4R A;  3CMA I;  3ASO H;  3C7J A;  1WI9 A;  2O03 A;  1JKP C;  2VC1 A;  3S1N J;  1B9N A;  3HRU A;  4LGW A;  1K83 J;  2UXN A;  2IVM A;  2QQA A;  2WY8 Q;  3FDY A;  1JE8 A;  2EIM H;  1MMD A;  2GLO A;  3RQ4 A;  2F6C A;  3OSG A;  2DOD A;  2RKH A;  1WJ5 A;  4H0E A;  2VQC A;  5DCF A;  4V19 K;  4IVN A;  4UUS A;  2L2O A;  4IHW A;  4HF2 A;  3GTL J;  1UZC A;  4ESJ A;  4AID A;  4RAZ A;  2HVQ A;  1LDD A;  2JVG A;  4QIW N;  2JVH A;  5C4X J;  3GZ5 A;  1R9T J;  3ABK H;  1ZH5 A;  1QPM A;  1YW7 A;  2DDB A;  2CGP A;  4B3A A;  2P6S A;  4ENK A;  2WAE A;  1F9N A;  1KGS A;  5M5W J;  1MH3 A;  1N77 A;  2HEO A;  4BHP A;  1FT9 A;  1JTX A;  3QPL A;  3EET A;  1IAW A;  3EYY A;  1HOM A;  1VZ0 A;  2IS6 A;  2W25 A;  2ME6 A;  1LEB A;  2LSO A;  4EAT A;  5HOO A;  2A3S A;  4FET A;  2DA5 A;  2CFX A;  1YO5 C;  4UUT A;  3GO5 A;  2GM4 A;  1X1B A;  2E60 A;  1OFC X;  1W4M A;  2V26 A;  3WTT C;  2QSG X;  2R7Z J;  4LK1 F;  1EF4 A;  3UNG C;  4Y4R A;  1EKE A;  3BCB A;  1ZR2 A;  1X3U A;  1DGW Y;  5M3M J;  1R22 A;  2WTE A;  3L1P A;  2EFN A;  2KMU A;  5D5X B;  1KU9 A;  4ZDO A;  4B1R A;  3RCO A;  3S17 J;  5L3C A;  4P1W A;  3OOP A;  4PFO A;  3TW7 A;  2WB1 A;  3VOE A;  4D5C A;  5LD2 C;  4A3D J;  1LDJ A;  3WGH A;  1WJE A;  2TCT A;  3E0J B;  3T8T A;  2VOO A;  3VDX A;  3CP8 A;  3KYC B;  1LNW A;  2F5C A;  1TNS A;  5L3E A;  1YFH A;  3MAJ A;  1SMT A;  2LK2 A;  2HNH A;  3H35 A;  1VQ9 I;  4WK8 F;  4EJT A;  3DV8 A;  3I4P A;  2L7M P;  3WHB A;  4HQM A;  3RKQ A;  3SEQ A;  1IUF A;  3DTK A;  4OAZ A;  4DQ2 A;  2DPD A;  3E3V A;  3CC4 I;  3ECO A;  3AKZ A;  1XTA A;  3OYG A;  4PJN A;  4CZC A;  5J1Y A;  1MBF A;  1S29 A;  4P5O A;  3DKX A;  1E3H A;  1QZE A;  4GO1 A;  1IO2 A;  3CCE I;  2CUE A;  4RAG A;  2JSC A;  3A02 A;  3BTJ A;  5D5U B;  2DT5 A;  2FXA A;  3MKY B;  4M74 A;  2HZT A;  1BI3 A;  1H9G A;  2BHZ A;  4ENN A;  1R58 A;  1YQA A;  4HPQ A;  3GTQ J;  2LMD A;  1Z91 A;  3DFG A;  1J2X A;  2FE3 A;  4CSW A;  3CDH A;  3OR2 C;  4BEH B;  2WC2 A;  2VLA A;  2BW3 A;  4DZJ A;  4HOB A;  2F4O B;  4FE4 A;  4XOR A;  5F6F A;  3BT9 A;  2CUF A;  4LMY A;  3O6B B;  2VXD A;  5KK1 A;  5FJ8 J;  3JRE A;  3E6B A;  2FOW A;  2DW4 A;  4DBR A;  3FX3 A;  2DMP A;  2YU3 A;  1OCO H;  2QCO A;  2FNA A;  2RV8 A;  4CXF A;  3DEE A;  4Y13 A;  1MBJ A;  2KZG A;  3BPX A;  3IKT A;  2HXO A;  3HOX J;  1X4O A;  1R4M B;  2KRF A;  3TP3 A;  2X51 A;  2BY2 A;  5HVQ C;  3IKV A;  2PLY A;  4S04 A;  2ZJQ F;  4CUG A;  2A6H F;  4LB5 A;  4NBQ A;  3RPU A;  4UXN A;  4RM2 A;  1BW6 A;  4Z2Y A;  3RYP A;  3ZMS A;  2HOT A;  4BHC A;  1BM9 A;  3ZMZ A;  4XBF A;  2XAH A;  2XUB A;  3GX4 X;  2I8D A;  1ZTR A;  4BE1 A;  4CCL A;  1I1S A;  4XRM A;  4MQ9 F;  2F5E A;  2Q8K A;  3GFL A;  4LG3 A;  4MFD A;  3I64 A;  1O3Q A;  2H6C A;  3X2Q H;  4OAY A;  3VFZ A;  4B4C A;  1H9T A;  3H3U A;  4XLC A;  1ETY A;  4U7D A;  4HNT A;  3HZJ A;  4TV7 A;  1YOV B;  2HVR A;  3EUK L;  1XMK A;  4I76 A;  2OUM A;  3O3K A;  2Y9Y A;  2YPR A;  3CDI A;  3BG3 A;  5DM6 F;  3LFK A;  2V6E A;  2KIS A;  1P4W A;  2WA0 A;  4XON A;  4AIH A;  2HYJ A;  5AON A;  1QBJ A;  4LG0 B;  3CJR B;  2IGN A;  2VXZ A;  2VQL A;  1E17 A;  5EEA A;  5E3N A;  3JRI A;  3KEO A;  3K4K A;  5DM7 F;  1U9O A;  3HSR A;  2CU7 A;  3O2P E;  5E20 A;  3BG6 A;  1I27 A;  3EDP A;  3RPU D;  3L00 A;  3HUG B;  2CG4 A;  2IGO A;  1D8J A;  1H89 C;  2DI3 A;  2K7L A;  2K9Q A;  2XPV A;  1YJ9 I;  3E97 A;  3WTZ A;  3FBI B;  1ON2 A;  4O5V A;  3OMY A;  3S93 A;  2ME0 A;  5CVV A;  3G71 I;  2EIN H;  4N9H A;  3DBH B;  2QWW A;  2CQN A;  2DT7 B;  2XB0 X;  2DK8 A;  3DPL C;  1W1W E;  4AYB A;  1R23 A;  1MNE A;  2COB A;  4B3X A;  5F1R A;  3OS0 A;  1GHC A;  1Z3Y A;  3HOT A;  1MDM B;  1IXR C;  1QNT A;  1XC5 A;  4M3F A;  4DW6 A;  2L5Q A;  3U21 A;  2OAZ A;  1I39 A;  3BR6 A;  1ZGJ A;  1TWG J;  2B0L A;  2EV5 A;  2OC6 A;  1HQC A;  5JLW A;  3WOD F;  1OYW A;  2DTZ A;  3TL4 X;  3IWZ A;  3JTH A;  1FOY A;  3OY9 A;  4YFX F;  2HWV A;  4I98 B;  1CF7 A;  2ZNZ A;  1JJ6 C;  2B9S A;  5DYM A;  3SFI A;  2QZ8 A;  3KFW X;  1R6R A;  3HG9 A;  4HZF A;  2JMW A;  2QBY B;  4NHJ A;  1YE9 A;  2BXZ A;  2LF7 A;  4BKX A;  2JA6 J;  4AYB N;  1B9M A;  4GXO A;  1NH3 A;  5C4J J;  1QO0 D;  3CC7 I;  4EGY A;  2EIJ H;  5EEG A;  1S5L C;  2FBK A;  1R5H A;  3K2A A;  4U87 A;  2M87 A;  2ELJ A;  3F0C A;  1BIA A;  2FU4 A;  2X1E A;  5KAF C;  2FQ3 A;  3SDG A;  3FWE A;  4I0A A;  4XLA A;  2D1H A;  2FQ4 A;  1NK3 P;  3QPH A;  5GAD J;  2YS9 A;  3CLO A;  3QPS A;  4ETS A;  1WJF A;  3H1C A;  4NDL A;  2DBB A;  4UUV A;  2LTP A;  3K1N A;  1H8A C;  1AKH A;  4ABZ A;  1FTZ A;  3QQA A;  3GEZ A;  2VKD A;  3JCU C;  2R7X A;  2AXL A;  3BZK A;  3MCZ A;  1T0F A;  3BCA A;  5FLX Z;  4M72 A;  4FCY A;  2M34 A;  1IV6 A;  3CMM A;  2L54 A;  3R4K A;  4PSX A;  4S0H B;  5HDK A;  3FXQ A;  1D0X A;  2JA2 A;  5FFZ A;  3PUB A;  2M3A A;  1T08 B;  3LNQ A;  1ZRF A;  5EYR A;  1T2K A;  1IC8 A;  2EFP A;  2VIX A;  1BR2 A;  1F1Z A;  1E2X A;  2ZME C;  4RM3 A;  1ZHF A;  4XKV A;  2DOE A;  4XN0 A;  2NOG A;  2BY0 A;  2XGX A;  3TP0 A;  1J5Y A;  1S7E A;  3W2V A;  2ESH A;  2KJC A;  1BL0 A;  2QKL B;  1JUS A;  1Z9C A;  1I3A A;  3ROU A;  1SC7 A;  3VB2 A;  4PJJ A;  4A3G J;  4UB6 C;  2LRD A;  2OQG A;  3GME A;  1HLV A;  3QYF A;  2VBY A;  4KT6 A;  2QEX I;  5D5V B;  2F2E A;  1DU0 A;  3BZC A;  3BR0 A;  2Z99 A;  2CV0 A;  1QU3 A;  2GOM A;  3GTJ J;  3G73 A;  2ZKZ A;  1T33 A;  2OD5 A;  4BEH A;  2W7N A;  2CV2 A;  3LSI A;  3TKY A;  3CUQ C;  3HHG A;  3KEY A;  1YJN I;  2PMU A;  2ID6 A;  4PCQ A;  1VFC A;  2PJR B;  2D1V A;  3FXR A;  2FX0 A;  3JRH A;  1HKT A;  1FMV A;  2R7Q A;  3H0D A;  1DGR M;  5FD6 A;  1APL C;  2HDW A;  2X6W A;  3CUQ A;  1X1P A;  4B09 A;  5ILU A;  1AU7 A;  3N97 A;  2Q2E A;  1LEA A;  5FLV A;  2ELH A;  2EFW A;  3KP7 A;  3LA3 A;  2R5Z B;  2A07 F;  2UWM A;  4KIF A;  1TLH B;  2V1N A;  5IPA A;  4XR6 A;  1J0R A;  2LKX A;  1SD4 A;  2NXN B;  1C0W A;  3SXY A;  1D5V A;  3ERM A;  1U0J A;  2CQK A;  3CTA A;  2R0Q C;  3TDU C;  1N75 A;  3D5L A;  2K40 A;  3PFI A;  5L3G A;  3K4N A;  1H0M A;  2V7F A;  1PP8 F;  2GBY A;  3OIQ A;  4HEA 2;  4PGG A;  3JRA A;  1S9H A;  5BS6 A;  4P9U A;  1J75 A;  4L9V A;  2A5Y B;  4UVB A;  2DYR H;  3OYB A;  4R1H A;  1TP4 A;  3GFJ A;  3VSK A;  2NOJ B;  3GZ6 A;  3G4S I;  3NWT A;  1PUF B;  3JTG A;  3S32 A;  3M8E A;  2VE8 A;  4XLF A;  1CQT A;  1BR4 A;  1W7P A;  3R0J A;  4U0W A;  1VQO I;  1K4S A;  4IEJ A;  3Q9V A;  3B02 A;  5IOZ A;  2W1O A;  3BJO A;  4ASN A;  4BH9 A;  3M4O J;  4I01 A;  4YIR X;  1ZN2 A;  5CYV A;  2ID3 A;  4PDK A;  3MQ0 A;  3NRV A;  2XAF A;  2L3D A;  2BZT A;  2ZBK A;  3ASN H;  3HUG A;  3DP7 A;  2M4G A;  5BOX A;  4U7B A;  2Q0O A;  1K61 A;  4M6V A;  5FKK A;  2NS0 A;  1Y1V J;  5J1U A;  4DYQ A;  1AWC A;  3LWF A;  3GLX A;  2WBM A;  3D5R C;  4HNU A;  3ZOB A;  2KPM A;  4E7I A;  5K5O A;  2R7D A;  3M9A A;  1RPW A;  2DDA A;  4I0B A;  2DLL A;  2OBP A;  1ITY A;  4NNJ A;  1R49 A;  2PG4 A;  1D1C A;  5D4R A;  1X3Z B;  4OIN F;  3FK6 A;  4C2T A;  1YI2 I;  4CCN A;  3HC7 A;  3WG7 H;  1XDU A;  1LJ9 A;  2FF4 A;  1QVT A;  1G4D A;  5FLM J;  4G94 A;  2FOK A;  3AFH A;  3F8M A;  2VQH A;  3FZV A;  5F64 A;  1W7P D;  3I0T A;  4XLP F;  4KMU X;  3PNT A;  2PQ8 A;  1RIO H;  1IF1 A;  1FBQ A;  1P4X A;  3H3Z A;  4C2M J;  4IZZ A;  3QU6 A;  4A0Z A;  4LJZ F;  2XIG A;  2A5W A;  2ZXW H;  1O3T A;  1Y6I A;  2W57 A;  5K7Z A;  1W0T A;  3BG7 A;  4RB0 A;  2QBY A;  2JUC A;  1ZLJ A;  1SFK A;  4HDV A;  2LKS A;  4MO7 A;  5LEK A;  4ZH4 F;  1IN7 A;  1XG1 A;  2ESN A;  4E4H A;  3B6C A;  2BV6 A;  3LSR A;  3PNV A;  2ZO4 A;  3M3Y J;  4M3G A;  2MBF A;  2E1C A;  2O3F A;  4P55 A;  1Z1D A;  3J7A O;  1E3O C;  2MH9 A;  4DYR A;  3WTY C;  1HW2 A;  2E2H J;  5E3L A;  1BOB A;  4JX6 A;  4WWC A;  1VQN I;  4MFE A;  2ZC2 A;  3E7L A;  5AIQ A;  4XLN F;  4LB6 B;  1VF9 A;  5EG0 A;  4H4K C;  3IRR A;  2XAU A;  4AU7 A;  2L7K A;  2STW A;  3CUO A;  2VKH A;  1MD0 A;  3DBR B;  4D5F A;  2X6O A;  5GPA A;  1ONV A;  2CUZ A;  4EJU A;  4W1U A;  2AS5 F;  4BJ6 C;  5H20 A;  4L9J A;  4IHT A;  3HGY A;  2HQN A;  4KDP A;  2EWN A;  3ZMV A;  3CQZ J;  1P7J A;  3VPR A;  1BI0 A;  4L9T A;  4UB8 C;  4AC0 A;  2ZJP F;  4NQW B;  3N05 A;  1ZR4 A;  4KA4 A;  5LBQ A;  2JZY A;  2LVS A;  3V42 A;  5DD4 A;  1Y0U A;  5K5Q A;  2QKM B;  2XAS A;  2KFD A;  2O61 A;  3E5U A;  2OPT A;  2TRT A;  2CFO A;  1XD7 A;  2CJJ A;  3L2V A;  4BS9 A;  2VT3 A;  2CSO A;  1Y1W J;  5FLX K;  2OV7 A;  4PZJ A;  4G6Q A;  1AOY A;  2A6T A;  5F08 A;  2FBH A;  4JK1 X;  1Z67 A;  1T39 A;  5B5E C;  5HNF A;  3J81 Z;  2W24 A;  1IDY A;  2HDC A;  2JN6 A;  2K9S A;  2PJR A;  4MQV A;  3TED A;  4AM3 A;  1S6L A;  3H9J A;  2OZU A;  2P4W A;  3ZRG A;  4YRV A;  5CLS A;  1MGT A;  2YSR A;  3BZ6 A;  1HBX G;  2OCE A;  5LGN A;  4BQO A;  3CZ6 A;  3DPT A;  1LVA A;  3QRF F;  1FOX A;  3BQY A;  3F9K A;  2VJJ A;  3ZQF A;  4LLN A;  2R5Z A;  2Y30 A;  2YUS A;  3BG5 A;  1IN8 A;  2VJI A;  2IS4 A;  1U9N A;  5C3E J;  3TOB A;  4G7Z F;  4KYW A;  2R7W A;  4IX7 A;  1IRF A;  3BQZ A;  3SFZ A;  4E7Z A;  5K7H A;  4V2G A;  1O7L A;  1IW7 F;  1BI2 A;  2VKV A;  3GFM A;  1XSV A;  4X6A J;  4IOC F;  1MSF C;  1LKX A;  2B7E A;  3Q0W A;  4X1E A;  4C3I J;  4EM0 B;  1OIS A;  2EK5 A;  2WAQ N;  1D5Y A;  2F5V A;  3HJE A;  2IW5 A;  1MMN A;  4IL6 C;  4IRI A;  5JI6 A;  3GFI A;  4XM3 A;  2KIM A;  3DU5 A;  2E2J J;  4LOC A;  2NVY J;  3S15 J;  4HX4 A;  4Y17 A;  2X85 A;  2XKP A;  1PUF A;  5HS7 A;  3FXL A;  3KP4 A;  5BMZ A;  2H1K A;  4M3B A;  2XAG A;  1LPQ A;  3RQI A;  3ZGK A;  1BJA A;  1Z3X A;  3TGN A;  3W6V A;  5HNH A;  5LFA A;  2OTJ I;  2ZSI B;  2ISY A;  1S8N A;  3TOA A;  4L5J A;  3SQN A;  2WAF A;  3T1B A;  4HRI A;  4MTE A;  5GAG J;  3NQO A;  2V1D A;  1OCC H;  3HGG A;  4PJ0 C;  4PJL A;  2D45 A;  3J7Z I;  3SZG A;  3R61 A;  4MLO A;  1BC7 C;  2R7O A;  2IA1 A;  2H27 A;  1FSH A;  2K4J A;  2VQG A;  1JKO C;  4BGD A;  1RKT A;  4B43 A;  3OYF A;  1D0Z A;  3H9Q A;  2BE5 F;  1ETO A;  1SD7 A;  3P9K A;  1CF7 B;  1QVU A;  3E6C C;  1FP2 A;  3ZQG A;  4RGS A;  2MLG A;  2LLK A;  4AVP A;  1K7A A;  4WCG A;  4II2 A;  3L09 A;  5F1J A;  4IPA A;  4BUP A;  5LRS A;  4CCO A;  3CMY A;  2ZXH A;  1JT6 A;  2A61 A;  1A6Q A;  2DJI A;  3K2Z A;  2P7V B;  1QQI A;  5J40 A;  1KQ9 A;  2R7T A;  4KIT B;  4G12 A;  1ZYR F;  3MZH A;  2STT A;  1IZ1 A;  2DA7 A;  2BBY A;  4ZYA A;  5BPI A;  1GVD A;  5FD5 A;  2XSD C;  2JQ7 A;  2KZV A;  3M7G A;  1X1C A;  2ISZ A;  1UFM A;  3J80 Z;  3AL0 C;  2Y75 A;  3PNY A;  4EJW A;  3F8B A;  4E7J A;  4A3J J;  4ZTF A;  1QPI A;  1AKH B;  3GTM J;  1JI8 A;  4OMY A;  2VN2 A;  1RNL A;  3V7R A;  2MFZ A;  3A0H C;  1AA7 A;  4XOT A;  2A6E F;  3PO3 J;  4A3M J;  1R36 A;  2XHK A;  5E79 C;  3FBN B;  2RC4 A;  4G6D A;  2ZB9 A;  1FOW A;  1GVJ A;  3GWZ A;  1O7F A;  4ZDP A;  1OCZ H;  5FKM A;  1PVE A;  2VPL A;  4JQF A;  1DP3 A;  2K3P A;  3W2W A;  2OZ6 A;  2AQF A;  4GDF A;  5HLG A;  2EB7 A;  1A5J A;  3K1P A;  5BNG A;  5J47 A;  4R79 A;  1T56 A;  1TL8 A;  3RIR A;  3BTI A;  2K02 A;  3AG4 H;  5FKN A;  4ENJ A;  1HXD A;  1ERD A;  3ZP5 A;  4A3E J;  1PDN C;  4KIC A;  3ZXS A;  1TWF J;  2XRO A;  1DPU A;  4KMF A;  3VSL A;  2K9L A;  3A2K A;  2G7H A;  3WGG A;  1Z0X A;  3VEP A;  1SD5 A;  1JJ8 C;  2JRT A;  1IN4 A;  2V9P A;  3Q0U A;  4XKC A;  1BC8 C;  4IKF A;  2KIQ A;  2ZME B;  2GXA A;  2VON A;  3LFU A;  4NQW A;  4FX0 A;  1F5T A;  4QWQ A;  1V54 H;  3JR9 A;  2Z3Y A;  3ECH A;  2M4K A;  4BAC A;  3M07 A;  1LE8 A;  5EZG A;  3CJT B;  5JHF A;  4R8H A;  4XIC A;  2RNJ A;  3F6V A;  1RR8 C;  3N4M A;  3KLO A;  3I4M J;  1KQ0 A;  3TO7 A;  2Y9Z A;  3L2R A;  1MND A;  2XF6 A;  5E8G A;  1G2H A;  2IPQ X;  2RDP A;  5IP9 J;  2EH3 A;  1HKQ A;  3ZQL A;  1Q1H A;  1K6Y A;  2EQR A;  3U2R A;  4CCK A;  2ZJR F;  2QM3 A;  3EPZ A;  2O5R A;  1SFE A;  2LNB A;  1UMQ A;  2Y0S N;  3F6O A;  3CUQ B;  4A3B J;  2NS7 A;  3DPU A;  4Y52 J;  2Q2E B;  3KP5 A;  4CDG A;  4PJM A;  2NVX J;  2HS5 A;  5GPC A;  3OYC A;  4G7H F;  2TDX A;  2DFE A;  3MKL A;  3S14 J;  2ICW G;  4RMN A;  3DXJ F;  1FYL A;  3A4C A;  5D6F A;  2P81 A;  1S72 I;  4CO8 A;  4BDZ A;  2R3S A;  4HV6 A;  4L5I A;  4XSX F;  3ZQ7 A;  2OU2 A;  5D5W B;  1Y39 A;  1OPC A;  3ESW B;  3K70 C;  3IH4 A;  5KNL A;  3G1O A;  2FJ1 A;  3ISP A;  1G3W A;  4YG2 F;  5FRN A;  2BHY A;  4G9Y A;  4NUB A;  3LSH A;  1FIA A;  4M3D A;  3IHU A;  4MIM A;  1EA3 A;  1HC8 A;  3RKW A;  1HDP A;  1T98 A;  2F5F A;  3NWS A;  2EPF A;  1D1A A;  2ECB A;  1BIB A;  3J81 K;  3F21 A;  4E70 A;  2LYC A;  3JAM K;  5EDN A;  1T8I A;  5ILV A;  1W7P B;  2L7F P;  3WE3 A;  4B47 A;  2DFH A;  3CCY A;  3U9G A;  5A2Q K;  4OIP F;  1NG6 A;  3OYN A;  3R0A A;  2LKP A;  1SFU A;  3WGI A;  1EJ9 A;  3OYA A;  2E1O A;  2HPI A;  2Y0M A;  4ANJ A;  2H6B A;  3CCM I;  1MJB A;  2K3F A;  2W82 A;  1XPX A;  2GIV A;  5JLX A;  1B8I A;  3E5Q A;  4LIT A;  4J00 A;  3M8J A;  4L0Z B;  1ACI A;  2MYS A;  4IQ4 A;  2DMQ A;  4PK4 A;  3P9C A;  2CQ7 A;  2HYF A;  4LK0 F;  5KCM A;  1YYV A;  1Z6R A;  2UZK A;  3S1R J;  2RRE A;  2XF5 A;  1D3Y A;  4ZZD A;  3K70 D;  3D1N I;  1TQM A;  3S1M J;  1O3R A;  3IP4 B;  4GCV A;  2JRM A;  5J1R A;  2XF7 A;  2CQX A;  1UB9 A;  1QA6 A;  3MEX A;  2LR8 A;  2CRG A;  5M3F J;  1MIJ A;  4KNY A;  4GGG A;  1XCB A;  2M8E A;  5LRR A;  1XN7 A;  2AHQ A;  2KDO A;  2MC3 A;  3ZR8 X;  3OSF A;  2E7X A;  2VPR A;  2BYV E;  4XMY A;  3K7A J;  3A03 A;  3H92 A;  5FKL A;  1MKM A;  2KIF A;  3CP2 A;  3S2W A;  2W4S A;  3QP5 A;  2MLK A;  1VND A;  2GOX B;  4A6D A;  4EV0 A;  3KYL A;  4LFU A;  4ESF A;  1WGX A;  2LP0 A;  3L9F A;  3VYU B;  1WH5 A;  5E1X A;  1V5F A;  2R5Y A;  2XRN A;  4U88 A;  1IUY A;  2MG4 A;  5J4V A;  3B6A A;  3PQJ A;  3Q3S A;  1FIP A;  5LHI A;  3OYH A;  3TO9 A;  4BL0 B;  2OJE D;  3HXL A;  4QPO A;  3F72 A;  2E5Z A;  4BJ5 C;  4RS8 A;  4AWX B;  5EG0 B;  1WSU A;  1I50 J;  5DEQ A;  2GQQ A;  4OWR B;  5DTD A;  1K6O A;  4BXF A;  4FT8 A;  2COM A;  4JOM A;  5D6E A;  4CGZ A;  3SHF A;  1ETV A;  1V3F A;  1XSX A;  2FA5 A;  3FM3 A;  2VJ5 A;  4UV8 A;  5ED4 A;  3OIO A;  1ZG3 A;  1MBE A;  2K86 A;  1ZAR A;  4A69 C;  2DFI A;  4F52 A;  1ULY A;  2X48 A;  1YG2 A;  2L4A A;  4C3H J;  2DTR A;  3GTP J;  5CVJ A;  2D5V A;  2ECC A;  3TMO A;  1YLF A;  3VWB A;  2H94 A;  1B1B A;  2Z9O A;  5DV5 A;  1XGO A;  4C9Y A;  2L9S A;  4ESB A;  3U1D A;  5JVG F;  1QZZ A;  4OOI A;  1L0O C;  4J01 A;  2W48 A;  1OJL A;  4BY1 J;  1Y8R B;  2PMZ N;  2KP6 A;  5CVR A;  2B63 J;  4C30 A;  1V55 H;  2FSW A;  4N4N B;  4XLH A;  3J80 K;  3S16 J;  2LY9 A;  1B4A A;  4D1Q A;  3JSO A;  3HTS B;  1REP C;  1KZH A;  1IRX A;  2E71 A;  4Y15 A;  4DGW B;  3PSF A;  5TJJ A;  1SVL A;  2ZME A;  1MBG A;  1D0Y A;  4L5E A;  4BYY A;  1R7J A;  5FB2 A;  2CS3 A;  3CJQ B;  1JUP A;  1LFP A;  3HPG A;  1IRZ A;  4YII A;  4BE2 A;  3DQV C;  4HYE A;  3TW6 A;  1E3P A;  2R7F A;  3IL2 A;  2GXG A;  3M1C A;  3OYJ A;  2HQA A;  2R4G A;  2R7R A;  1A31 A;  4HBL A;  3MKZ A;  3G1L A;  2K4B A;  4CCJ A;  1U6G A;  3RKY A;  3S2D J;  2JK3 A;  4XID A;  2CV1 A;  4A3F J;  4J19 A;  2AO9 A;  4KN7 X;  1JTY A;  2OF7 A;  2DMN A;  2G0E A;  3L2U A;  1P6R A;  1GUU A;  1WQ2 A;  1R5G A;  3FMR A;  4XKW A;  3QOP A;  3GCM A;  3OYD A;  4DIQ A;  4BQN A;  1T38 A;  2E34 A;  4LLL A;  3DCF A;  3FHZ A;  4PSW A;  3JRC A;  4UY8 I;  2FNP A;  2AQE A;  5FRM A;  1TT5 B;  1Z21 A;  1FY7 A;  5LLQ A;  3QPT A;  2ADU A;  5EZH A;  5GP9 A;  3JRB A;  1HKS A;  4HDU A;  3ZCO A;  3OIP A;  2A68 F;  3KZI C;  3K69 A;  2NYX A;  1ZKG A;  4RB1 A;  4I02 A;  1UG0 A;  1GXQ A;  2HKX A;  2EFO A;  3HSF A;  3W6K B;  5D8K B;  3DLA A;  5IP7 J;  3RDI A;  1YRN A;  2YX7 A;  3P7N A;  4WXH A;  5GTI C;  1YHQ I;  2IP2 A;  4N0B A;  4JX4 A;  3S3M A;  3DBL B;  1MNM C;  3J7A Y;  5IOY A;  2EZI A;  2RGV A;  2VI6 A;  3GTO J;  2XPW A;  3KIO A;  3OWT A;  1ENH A;  2DYS H;  3CDL A;  5H2F C;  1JKR C;  5EJC A;  5L3B A;  3K4B A;  3D5S C;  1WPK A;  2DT6 A;  2O9L A;  2EZK A;  4RGX A;  5IYD J;  2JWT A;  2V1U A;  3WTW C;  2L4M A;  1X1D A;  4GYI A;  3KP3 A;  4AUX A;  1RUN A;  5ICF A;  1LUJ B;  2O7O A;  3BY6 A;  2DA3 A;  1MJ9 A;  4UVA A;  4XQF A;  3OYE A;  5GAH J;  4HV5 A;  3UKG A;  3HRT A;  1MMA A;  1TT0 A;  1WJD A;  4Z6Y A;  4JP0 A;  2JA5 J;  3T0Y A;  3H5A A;  2GA2 A;  2CW8 A;  4BBR J;  1S7A A;  2Z1D A;  2P5L C;  1OMI A;  2R7S A;  4XN3 A;  3PO2 J;  1R71 A;  3FF5 A;  3V4G A;  3S1Q J;  2O8K A;  2HXI A;  1I5Z A;  1MBH A;  3P5J A;  3F3X A;  1P7I A;  4O3M A;  1RC9 A;  1WKM A;  4FHT A;  3RYR A;  2BGC A;  1S7O A;  1ZK8 A;  3SEZ A;  2Q1Z B;  2VBW A;  3C2G A;  1Z05 A;  2K27 A;  3LST A;  4D9J A;  5L3F A;  1MMG A;  2J5O A;  3M8F A;  4JBA A;  2IS1 A;  3K10 A;  9ANT A;  3COA C;  4CIC A;  3W6J B;  1VQM I;  4ZTJ A;  4QTR A;  2E1M C;  2KDZ A;  2RN7 A;  5LHG A;  3FIS A;  2OQR A;  1J59 A;  3HBL A;  3PJR A;  3CES A;  1T95 A;  1IN6 A;  1BOA A;  5F27 A;  3AL0 B;  4YEJ A;  3CC2 I;  3LSM A;  1NHA A;  1G3T A;  4KIS A;  1X19 A;  3JW4 A;  4V2F A;  5TRD A;  1Y8Q B;  1I6X A;  2KHM A;  3LAP A;  3KZZ A;  1X1A A;  2QEN A;  4HF0 A;  2K85 A;  5CVI A;  2UV1 A;  2ZJ2 A;  1Q1V A;  1TWA J;  4OIR F;  5DCM B;  2HU9 A;  2K9N A;  3KET A;  3CCQ I;  3G3Z A;  5CQE A;  1FX7 A;  4RDU A;  1OR7 C;  3A0B C;  1P92 A;  3HEF A;  2NVQ J;  1UST A;  2PMH A;  2HVS A;  3T8R A;  1DU6 A;  2DA1 A;  2KRC A;  2MD5 A;  2EZL A;  4ZYE A;  4ZJZ A;  4NC6 A;  5E1W A;  2YX4 A;  1RR7 A;  1OR7 A;  5HDG A;  5K7F A;  3I56 I;  1YIT I;  2ZSH B;  3H9G A;  4BQA A;  3C18 A;  2A69 F;  1QRY A;  2JT1 A;  3EUA A;  5D8L B;  3HPH A;  3I54 A;  1SFX A;  2QQ8 A;  1LE8 B;  2UUZ A;  3CO7 C;  1SFO J;  2CO5 A;  3IUO A;  4JX5 A;  3QAH A;  2M8G X;  2FML A;  5J8F A;  5FFX A;  2J5P A;  1WJA A;  1USS A;  4YFK F;  3F23 A;  2Z2S B;  3LAJ A;  2HPM A;  1VQ8 I;  2GAU A;  2QF7 A;  2DMT A;  4HF1 A;  3I3L A;  3RKX A;  4UV9 A;  4D7M A;  1S3J A;  3K4C A;  2M0C A;  2EA2 A;  1YW8 A;  3OS2 A;  3F8C A;  1EH6 A;  1G3Y A;  1RET A;  4Y3O A;  5E1Z B;  1R1U A;  5FO5 A;  2C6Y A;  3DEU A;  1D8K A;  2IGM A;  3GTK J;  3WU0 A;  4PFP A;  1FZP B;  3ABU A;  4FIS A;  3IH3 A;  2MSY A;  4F91 B;  5HLT A;  4ENM A;  2H09 A;  1YIJ I;  2E35 A;  1TZL A;  1GDT A;  3FM5 A;  2WAQ A;  2CW7 A;  2WAD A;  3GVA A;  1FBU A;  2DA2 A;  4A3I J;  5DDG A;  2V9V A;  4L18 B;  4F92 B;  2KRH A;  4DNC A;  3L2C A;  2XB5 A;  4F7Z A;  5EF6 A;  3RJP A;  4RGR A;  2X6X A;  3ZN0 A;  1KON A;  3KYD B;  3DEW A;  2F5D A;  3GF2 A;  2QGU A;  4HX7 A;  3PSI A;  4E7L A;  2W84 A;  1HF0 A;  1WRJ A;  1FWZ A;  3DKW A;  2LRE A;  4M71 A;  3ZPL A;  5HOD A;  2IAI A;  1FYK A;  4BJT A;  1Z7L A;  4HQE A;  2KQR A;  1VQ7 I;  3HKZ N;  4B48 A;  3BG9 A;  2E19 A;  1VQP I;  4BXX J;  2EIL H;  1LB2 A;  1UCR A;  3BP8 A;  2XAQ A;  1JHH A;  1FPQ A;  5B1A H;  1FMW A;  1U5T C;  2ELK A;  2FEZ A;  3LSK A;  3WU2 C;  3CD6 I;  3I53 A;  1Z7U A;  2LF8 A;  3ZMD A;  1ZRD A;  3ZN1 A;  2E5N A;  2LY1 A;  1B8I B;  1IV8 A;  3D0S A;  4OMZ A;  4PUS A;  2JA7 J;  3A01 A;  3MN2 A;  4NB5 A;  1U5T A;  4DYC A;  2VL8 A;  5JHU A;  4MNU A;  2XGE A;  3HRS A;  1B59 A;  3V7C A;  4E7K A;  3KP2 A;  4KUM A;  3ZQQ A;  1TQI A;  4FX4 A;  1R1V A;  1OLT A;  1XX5 A;  2EV6 A;  1R5I D;  3CO6 C;  5CKT A;  2VE9 A;  1A36 A;  3CF5 F;  1FOK A;  2VB6 A;  4BBS J;  3AG2 H;  3OV8 A;  4ZC3 A;  5F0H A;  2R92 J;  3BWG A;  2JPC A;  3KZY A;  1YJW I;  4NC8 A;  2IS2 A;  2M7A A;  1VTN C;  2CH0 A;  4XL9 A;  4CYD A;  1SAN A;  1Z77 A;  1W5T A;  4OU0 A;  3P9I A;  3WTV C;  1RI7 A;  3S3N A;  2KIU A;  4IJA A;  2IA0 A;  1DQU A;  1R00 A;  5IT9 Z;  1ZRE A;  4AIJ A;  1WH7 A;  3H36 A;  1UG2 A;  4QSH A;  4CHU A;  1MMS A;  2CYY A;  3OL4 A;  4Y7N J;  2P6T A;  2QQ9 A;  3F8F A;  1I6H J;  1UHM A;  3H0G J;  3Q9S A;  4Q47 A;  2DA6 A;  2LG4 A;  1ZEL A;  3G1M A;  3H5R A;  2F4M B;  2BY3 A;  1TQP A;  3CCJ I;  2R5Y B;  1X2M A;  3ABT A;  3H5N A;  1N25 A;  4YFN F;  2LD5 A;  2IXS A;  5IT3 A;  2EA4 A;  3PIP F;  1LFB A;  5KHD A;  4QLC U;  1SEU A;  2HZD A;  3PIO F;  2DOF A;  4CH7 A;  1TC3 C;  4Y33 A;  5CPR B;  4HG2 A;  2O0Y A;  1TNT A;  4XRF A;  2P0W A;  3V8L A;  2JPB A;  1V5G A;  4KT5 C;  1KA8 A;  4MEY F;  5IP6 A;  2HOA A;  1WVR A;  1MZB A;  2ZFU A;  1SAU A;  2BVM A;  5IYB J;  1KQ8 A;  4L0Y B;  2NNN A;  2F4I A;  3PQK A;  2QUF A;  5DCM A;  5B1B H;  1O4X A;  2DK5 A;  3C2H A;  1NK2 P;  1DPR A;  4BQQ A;  2O6G E;  4BXU A;  5ICG A;  5EGO A;  2P8T A;  5GTH C;  2V79 A;  4HST A;  4GRI A;  3BR2 A;  3FMS A;  3CCS I;  1ZG5 A;  4FAS D;  2IA2 A;  3CCL I;  3L2Q A;  3EUH C;  2Y0S A;  2Z16 A;  4XK4 A;  5E3O A;  2JTV A;  3OYI A;  1SVO A;  2KT0 A;  4JYK A;  1WCM J;  4D0P A;  4EJV A;  1RKW A;  1JUM A;  3L7W A;  4AVZ A;  3K4L A;  3RPQ A;  5M5X J;  3V7S A;  3MZY A;  3EUH A;  2UXX A;  1Y0N A;  2KL4 A;  2G9W A;  2H8R A;  1VQ4 I;  5E17 F;  2VKE A;  1FBS A;  1DUX C;  3LSP A;  4A5M A;  3TQN A;  1IG7 A;  1FC3 A;  4BU2 A;  3GW2 A;  1ZQ3 P;  1W0U A;  3K0L A;  2EV0 A;  3ULQ B;  5J6X A;  3GYH X;  2WB1 N;  1XSD A;  5E3M A;  1HSJ A;  2HYG D;  3ABL H;  5CVU A;  1K78 B;  4S05 A;  4IF4 A;  5F0C A;  3NAR A;  4RB3 C;  2V6C A;  2XV4 S;  3ZQH A;  1W36 C;  3I71 A;  4UVC A;  3Q0V A;  5BQT A;  4LLG F;  5GAE J;  2W85 A;  2EBI A;  2DA4 A;  3I58 A;  2KJB A;  1DDN A;  2K5C A;  3GXO A;  5J3L A;  2M1B A;  3FMQ A;  3S2H J;  3CME I;  5IYC J;  5ICC A;  1ZGW A;  1WI3 A;  4I2O A;  1X58 A;  1SAX A;  1A04 A;  1KYZ A;  2F48 A;  2XPU A;  4X0G A;  1JXS A;  3KE2 A;  1SMY F;  2XSJ C;  1CGP A;  3GZN B;  1HA8 A;  2BXY A;  2RQP A;  3BOQ A;  3KCC A;  4Q48 A;  1XB4 A;  4Q5S F;  1J9I A;  4A0Y A;  1POG A;  3O8H A;  2QA4 I;  1TW2 A;  1F36 A;  1YRN B;  1VQL I;  1T6S A;  2ZFW A;  2HR3 A;  4C2U A;  2K9M A;  5H6R A;  3HB9 A;  3BC8 A;  3HOS A;  3IRQ A;  2LY2 A;  1YX5 A;  5B3S H;  4KIB A;  1U3E M;  3REO A;  2Z5U A;  1O57 A;  1RUO A;  2V1X A;  4AD9 A;  3I9V 2;  2XAJ A;  2CQQ A;  1EH8 A;  2QVO A;  1GT0 C;  1QZY A;  4G7O F;  2BVL A;  2FRH A;  3OYL A;  4XSZ F;  3KLN A;  3M1E A;  1FNN A;  1W36 D;  4EM1 A;  4N9I A;  3A1Y A;  1UJ8 A;  3K1M A;  3H3V K;  3PM1 A;  4NC7 A;  3QOE A;  3HOV J;  1GV5 A;  4MTD A;  1ETX A;  2R7V A;  3GUD A;  3J7Y J;  4Q4Z F;  3IAS 2;  3LSG A;  2XRL A;  3WTU C;  2WWY A;  2GXB A;  4CCM A;  1ZLK A;  2DQL A;  4M6X A;  4KFC A;  5KAI C;  1JKQ C;  2L01 A;  4MGR A;  1AHD P;  4AIK A;  2A05 A;  2FBI A;  3QP6 A;  4ZZL A;  2RVC A;  3WE2 A;  4WXD A;  3BTC A;  4RAF A;  2NRA C;  3MD2 A;  3BR3 A;  3W3C A;  3HOU J;  2EFQ A;  1G6N A;  1G3S A;  1Y56 A;  2I5U A;  4N4O B;  2RNG A;  2GZW A;  3R6S A;  3ERE D;  3HIF A;  3HRM A;  1TWC J;  2BEO A;  3CCV I;  1GLN A;  3LA2 A;  4BHB A;  1X2N A;  1L3L A;  4A2U A;  4GFB A;  1G59 A;  3OL3 A;  2M0M A;  3HOY J;  3VYT B;  2CWE A;  1IXS B;  2E1N A;  3HHH A;  1WJC A;  1F43 A;  3PUF A;  5IY5 H;  4M73 A;  3RZD J;  5J8C A;  1ETW A;  1RES A;  2DJN A;  1XMA A;  4CZZ A;  3DTI A;  5EEH A;  1QHG A;  2ZXJ A;  2HI3 A;  5TGT A;  1HDD C;  4OIO F;  3HL2 A;  1VI0 A;  4DJA A;  2IBD A;  1BBY A;  3IH2 A;  3L2W A;  1E0E A;  3OR1 C;  2H1L A;  3DWL E;  1YX3 A;  3ZMU A;  5KVR A;  1HW1 A;  3F22 A;  1PP7 U;  4HAM A;  2MC4 A;  2M2E A;  4M3E A;  2HTS A;  2DCE A;  2E1M B;  2LOO A;  3BJA A;  1P4A A;  5B66 C;  2QSF X;  1ETK A;  3WTX C;  1QGP A;  4L9N A;  2PEX A;  3I4N J;  2PMZ A;  3DF8 A;  2V4J C;  1ZRC A;  3FXM A;  3UR3 C;  3BR1 A;  3CCU I;  2DU9 A;  3E5X A;  5D4S A;  5FGM A;  4RLQ A;  3ZQC A;  4MHG A;  1WJB A;  1T0F C;  4KJZ A;  2RQQ A;  3GBG A;  1XCV A;  3WTS C;  5IT9 K;  1ZG1 A;  4HA8 A;  3K4M A;  3RSN A;  4DBQ A;  5H6Q A;  4IHS A;  1ZGA A;  3VYR B;  3G6E I;  2IJL A;  1YIO A;  1MBK A;  3SZT A;  1GXP A;  1KU2 A;  1SD6 A;  5HLI A;  1U8R A;  2XGD A;  2HFH A;  2HKO A;  2CUJ A;  2HTJ A;  2QQB A;  3JRF A;  2IRF G;  4A5N A;  1OCR H;  4ON0 A;  3I59 B;  3RI4 A;  4CYC B;  2X9D A;  2HGC A;  1BJZ A;  5JFR A;  3IAM 2;  4A3K J;  2P5K A;  1TWH J;  4HLY A;  3SJM A;  2ZNY A;  1WZ2 A;  2N8G A;  5LGU A;  1UHS A;  3ZMT A;  5LHH A;  4BNC A;  5JVT A;  1B72 B;  2LDU A;  2PJP A;  3VOD A;  3HTU A;  1LDK B;  2ETH A;  2W00 A;  1Z6T A;  2ZXI A;  5DUI A;  4BAY A;  3FKI J;  3E1S A;  4E7S A;  2JSP A;  3E6D A;  3QYE A;  4RBO A;  4G8X A;  1K78 A;  1A6I A;  2L9V A;  3FK7 A;  3LQR A;  1N78 A;  4IO9 F;  3IWF A;  1J7K A;  4EQQ A;  3BR5 A;  4UHT A;  2M45 A;  3OYM A;  1WFX A;  5J4Y A;  4F3Q A;  1R4N B;  2RAE A;  4RA2 A;  3TBI A;  2QYO A;  1OYY A;  2X0L A;  1K4T A;  3RTR A;  1BI1 A;  4EVI A;  2QLZ A;  1D1B A;  3FXK A;  4G6T B;  4A12 A;  1JGG A;  3LQQ A;  2VAS A;  1XGS A;  2WV1 A;  3AG3 H;  3LL7 A;  1OQY A;  2Y69 H;  2ZCW A;  2E36 A;  3FIW A;  3V8K A;  3ELK A;  1XGM A;  5L3D A;  5ICE A;  2P7C B;  5M5Y J;  4UNO A;  3HOZ J;  2I10 A;  4B8X A;  3HDD A;  3MVP A;  1A35 A;  1P9Q C;  3GTG J;  3QOD A;  1W5C C;  1MH4 A;  3C2B A;  1F4K A;  4A6E A;  3RZO J;  2Y2Z A;  4YEL A;  1IN5 A;  5F04 A;  2PN6 A;  5ERI A;  1BW5 A;  1JGS A;  2FMY A;  1FTT A;  2VOP A;  2D2W A;  2EJR A;  2X1D A;  2CMP A;  2WY7 Q;  1K79 A;  3DU6 A;  4ZDL A;  2AXT C;  1OYI A;  5HS8 A;  4BY7 J;  2DFF A;  4E6K G;  2LBF B;  2LFB A;  3K9T A;  4WX9 A;  2VBZ A;  1U78 A;  4P9F A;  4D7N A;  3CF2 A;  1ON1 A;  3K6G A;  4FTH A;  3HSE A;  2BOL A;  4LIV A;  2OTL I;  3IC7 A;  2DAO A;  2DO7 A;  3ONQ A; 
#chains in the Genus database with same CATH homology
 3A01 B;  1A5J A;  1IJW C;  1JJ6 C;  5BNG A;  3SFI A;  2DA2 A;  4A3I J;  1T56 A;  3BTI A;  5FKN A;  2JA6 J;  2JMW A;  4A3E J;  1TWF J;  4BKX A;  4C3J J;  4AYB N;  1MSE C;  4IHX A;  5C4J J;  2XB5 A;  5EF6 A;  4A93 J;  1Z0X A;  3K2A A;  3LSJ A;  1JJ8 C;  2HQ5 A;  3Q0U A;  3F0C A;  2L0K A;  3DEW A;  3IV5 A;  3SDG A;  3JR9 A;  2FQ4 A;  1LE8 A;  1HF0 A;  5EZG A;  1NK3 P;  2YS9 A;  4XIC A;  3QPS A;  5HOD A;  4NDL A;  2IAI A;  3I4M J;  2LTP A;  1H8A C;  1FTZ A;  1AKH A;  4ABZ A;  3QQA A;  2Y9Z A;  1G2H A;  3HKZ N;  4UUS B;  1U8B A;  3BG9 A;  4IHV A;  1OCP A;  2E19 A;  5IP9 J;  2EH3 A;  4BXX J;  3ZQL A;  2HDD A;  2EQR A;  2MGQ A;  4FCY A;  2M34 A;  1UMQ A;  2Y0S N;  1XS9 A;  1IV6 A;  2ELK A;  4A3B J;  2NS7 A;  4XRS A;  4S0H B;  4Y52 J;  2FD5 A;  2NVX J;  5GPC A;  3LNQ A;  3MKL A;  1B8I B;  5EYR A;  1FJL A;  2JA7 J;  2VUM J;  1IC8 A;  3S14 J;  3A01 A;  3MN2 A;  4DYC A;  2P81 A;  2IEK A;  2XGE A;  2NVT J;  2E2I J;  2NOG A;  1FEX A;  1ORK A;  2M9H A;  5FKO A;  1S7E A;  3TP0 A;  3JRG A;  3IH4 A;  1HCR A;  3G1O A;  2FJ1 A;  1BL0 A;  1JUS A;  4BBS J;  5DS9 A;  2R92 J;  5F0F A;  5F0H A;  3WHC A;  1FIA A;  4M3D A;  4A3G J;  4MIM A;  1HLV A;  1SAN A;  1HDP A;  1DU0 A;  3HM5 A;  1Z77 A;  3BR0 A;  1H88 C;  2ECB A;  3GTJ J;  1T33 A;  5EGO B;  5EDN A;  2L7F P;  1OCT C;  1WH7 A;  4QSH A;  1UG2 A;  1LFU P;  4Y7N J;  1I6H J;  3CCY A;  2ID6 A;  1VFC A;  3H0G J;  2JJ7 A;  2FX0 A;  3JRH A;  2DA6 A;  2E1O A;  1APL C;  3G1M A;  4A3C J;  4FE7 A;  2R5Y B;  1AU7 A;  1X2M A;  5FLV A;  4CYC A;  4I6Z A;  2LD5 A;  2R5Z B;  5JLX A;  1B8I A;  4A3L J;  1LFB A;  5IPA A;  1TC3 C;  2LKX A;  2DMQ A;  3JRD A;  3HOW J;  1B72 A;  1JT0 A;  3S1R J;  3D1N I;  3LOC A;  2R0Q C;  3S1M J;  5IP6 A;  5J1R A;  2K40 A;  3ZQI A;  2CQX A;  2YU9 J;  2HOA A;  2LR8 A;  2CRG A;  5IYB J;  5M3F J;  2GBY A;  2DN0 A;  3JRA A;  1O4X A;  1NK2 P;  2AHQ A;  3OSF A;  2VPR A;  1PUF B;  3K7A J;  5EGO A;  1CQT A;  3BTL A;  3A03 A;  5FKL A;  1ETQ A;  3OOU A;  3BR2 A;  2L7Z A;  1VND A;  4IEJ A;  2L9R A;  5IOZ A;  2XGC A;  4XK4 A;  5E3O A;  3M4O J;  1WGX A;  1NTC A;  2LP0 A;  2KT0 A;  4JYK A;  1WCM J;  1WH5 A;  2ID3 A;  1RKW A;  1JUM A;  2R5Y A;  2R93 J;  5M5X J;  2MG4 A;  1K61 A;  4M6V A;  5FKK A;  3B6A A;  3Q3S A;  2H8R A;  1FIP A;  1Y1V J;  2VKE A;  5J1U A;  4DYQ A;  4DZP A;  3LSP A;  1IG7 A;  1I3Q J;  2JA8 J;  3ZOB A;  5EG0 B;  1W0U A;  1ZQ3 P;  1I50 J;  1RPW A;  5DTD A;  2WB1 N;  2MW8 A;  5E3M A;  1BA5 A;  1ITY A;  1ETV A;  3FK6 A;  3NAU A;  3NAR A;  5F0C A;  4XRS G;  4W97 A;  5C44 J;  3OIO A;  3ZQH A;  1MBE A;  1QVT A;  5FLM J;  4IHY A;  4A69 C;  3Q0V A;  2X48 A;  3O8G A;  4C3H J;  3GTP J;  2EBI A;  2DA4 A;  2D5V A;  2ECC A;  5J3L A;  3S2H J;  4C2M J;  5IYC J;  2Y31 A;  1ZGW A;  1IDZ A;  1WI3 A;  2HOS A;  2NS8 A;  1X58 A;  2XPU A;  2EZH A;  2W48 A;  4EEF G;  1OJL A;  4BY1 J;  2PMZ N;  5K7Z A;  4HNV A;  1W0T A;  2B63 J;  1GV2 A;  3S16 J;  2LY9 A;  4MO7 A;  2DMU A;  1XG1 A;  1IGN A;  3B6C A;  3LSR A;  1POG A;  3O8H A;  1MBG A;  3M3Y J;  4L5E A;  4M3G A;  1JKP C;  1F36 A;  1YRN B;  3S1N J;  1JUP A;  1IRZ A;  1K83 J;  1E3O C;  3TW6 A;  4DYR A;  3HB9 A;  2GLO A;  2E2H J;  5E3L A;  3OSG A;  4JX6 A;  4MFE A;  3E7L A;  3G1L A;  4UUS A;  4IHW A;  3GTL J;  1VF9 A;  5EG0 A;  2JK3 A;  3S2D J;  2CQQ A;  4XID A;  1GT0 C;  4A3F J;  4J19 A;  2AO9 A;  1JTY A;  2OF7 A;  2DMN A;  2G0E A;  4QIW N;  5C4X J;  1GUU A;  1R9T J;  3H3V K;  3PM1 A;  4D5F A;  3HOV J;  4B3A A;  2X6O A;  1GV5 A;  5GPA A;  1ETX A;  4W1U A;  3DCF A;  3JRC A;  5M5W J;  1MH3 A;  3LSG A;  3HGY A;  2XRL A;  1JTX A;  5GP9 A;  3QPL A;  5EZH A;  3JRB A;  1JKQ C;  3CQZ J;  1P7J A;  1AHD P;  1HOM A;  3VPR A;  2ME6 A;  4AC0 A;  2DA5 A;  1ZR4 A;  4UUT A;  2GM4 A;  3BTC A;  1OFC X;  1ZKG A;  2LVS A;  2R7Z J;  3BR3 A;  3HOU J;  1EF4 A;  2OPT A;  2TRT A;  5IP7 J;  1TWC J;  1ZR2 A;  1YRN A;  2CJJ A;  5M3M J;  1X2N A;  3L1P A;  4JX4 A;  1Y1W J;  4GFB A;  1MNM C;  3HOY J;  5IOY A;  2EZI A;  4B1R A;  3S17 J;  5F08 A;  1F43 A;  2VI6 A;  3RZD J;  3GTO J;  2XPW A;  1ETW A;  1RES A;  1ENH A;  2DJN A;  3TW7 A;  3CDL A;  4D5C A;  4A3D J;  1JKR C;  1IDY A;  2HI3 A;  2TCT A;  2JN6 A;  2K9S A;  1WPK A;  3TED A;  2O9L A;  1HDD C;  2EZK A;  2LK2 A;  5IYD J;  2JWT A;  1VI0 A;  2IBD A;  2L7M P;  3IH2 A;  3WHB A;  3RKQ A;  4AUX A;  1IUF A;  2O7O A;  3BQY A;  3ZQF A;  2R5Z A;  2Y30 A;  2DA3 A;  2YUS A;  3BG5 A;  5J1Y A;  1MBF A;  2M2E A;  4M3E A;  1U9N A;  5C3E J;  3UKG A;  4JP0 A;  1ETK A;  3BQZ A;  3I4N J;  2JA5 J;  2CUE A;  5K7H A;  3A02 A;  3BTJ A;  4V2G A;  2VKV A;  3BR1 A;  4X6A J;  4BBR J;  1MSF C;  3Q0W A;  4X1E A;  3ZQC A;  3GTQ J;  4C3I J;  3PO2 J;  3S1Q J;  2O8K A;  2HXI A;  2WAQ N;  3GBG A;  1D5Y A;  1MBH A;  1P7I A;  4DZJ A;  4FE4 A;  3BT9 A;  2E2J J;  4LOC A;  2NVY J;  3S15 J;  2CUF A;  1MBK A;  1PUF A;  1ZK8 A;  5FJ8 J;  3JRE A;  2H1K A;  4M3B A;  2DMP A;  2XGD A;  2QCO A;  3RQI A;  3JRF A;  3W6V A;  4CYC B;  1MBJ A;  9ANT A;  2HXO A;  2X9D A;  3HOX J;  1BJZ A;  3TP3 A;  4A3K J;  4QTR A;  1TWH J;  2KDZ A;  3SJM A;  3FIS A;  2N8G A;  1UHS A;  3HBL A;  3HGG A;  1B72 B;  5F27 A;  1BW6 A;  2HOT A;  3FKI J;  4MLO A;  4V2F A;  1JKO C;  1ZTR A;  4XRM A;  1RKT A;  4RBO A;  1A6I A;  4MFD A;  3FK7 A;  1ETO A;  1Q1V A;  1TWA J;  4B4C A;  2K9N A;  3BR5 A;  1ETY A;  1QVU A;  2RAE A;  4RDU A;  3ZQG A;  3HEF A;  4I76 A;  2NVQ J;  2LLK A;  2Y9Y A;  3BG3 A;  5F1J A;  1DU6 A;  2DA1 A;  3CMY A;  2EZL A;  1JGG A;  1JT6 A;  2HYJ A;  2WV1 A;  1RR7 A;  5K7F A;  5EEA A;  4G12 A;  3FIW A;  5E3N A;  3JRI A;  1U9O A;  1QRY A;  2DA7 A;  3HOZ J;  1GVD A;  2CU7 A;  5M5Y J;  2I10 A;  3HDD A;  2XSD C;  3MVP A;  1LE8 B;  3GTG J;  1SFO J;  1H89 C;  2K9Q A;  2XPV A;  4JX5 A;  1MH4 A;  3C2B A;  2M8G X;  3RZO J;  2Y2Z A;  5F04 A;  4A3J J;  1BW5 A;  1QPI A;  1AKH B;  3GTM J;  2ME0 A;  1FTT A;  2XB0 X;  2QF7 A;  2DMT A;  2COB A;  4D7M A;  4BY7 J;  3PO3 J;  4A3M J;  2M0C A;  2ZB9 A;  1XC5 A;  2LFB A;  4M3F A;  4DW6 A;  1U78 A;  4D7N A;  1RET A;  3BR6 A;  1TWG J;  5JLW A;  4FTH A;  5FKM A;  2DTZ A;  3GTK J;  4FIS A;  3IH3 A;  2MSY A;  1GDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...