4BEHB

Solution structure of human ribosomal protein p1.p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 60S ACIDIC RIBOSOMAL PROTEIN P1
publication title Solution Structure of Human P1P2 Heterodimer Provides Insights Into the Role of Eukaryotic Stalk in Recruiting the Ribosome-Inactivating Protein Trichosanthin to the Ribosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00428 Ribosomal_60s 60s Acidic ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4behB01
2LBFA 4BEHB 2LBFB 2W1OA 3A1YA 4BEHA
chains in the Genus database with same CATH superfamily
2QGUA 5C4XJ 5FLVA 3F9KA 5GAEJ 2NRAC 2J5PA 3K4NA 1OLTA 1V5EA 2MFZA 5FO5A 3CCUI 1FOKA 4A3JJ 2VQHA 3HG9A 4W1UA 4BEHA 3OSGA 2XHKA 3E97A 4IJAA 5CLSA 1U5TC 3GBGA 3KEQA 1F1ZA 1FIAA 4AYBA 3JCUC 3I3LA 3K4CA 2LH9A 5EF6A 4G9YA 4XR6A 2X6XA 3VSLA 2KIFA 1T08B 1ETOA 1X1AA 3HPHA 3K70D 4KT5C 3WTZA 4XLPF 4L5JA 4LJZF 3HIFA 2Z3YA 3LA2A 3U9GA 3ZQ7A 4E4HA 2D1HA 1USTA 2E1MB 1EV7A 3HRTA 5K7FA 1VQ4I 2A5WA 3I53A 3HOYJ 2QBYA 3DEWA 4EGYA 2E34A 3DFGA 2CWEA 4DIQA 4RAYA 3TDZC 2L9VA 4XONA 3VFZA 4KMFA 1OCTC 2CW7A 4RGSA 1FX7A 3E6BA 3FMQA 1IN5A 2RKHA 2EK5A 1HXDA 2TCTA 1JKPC 1XMXA 1D3YA 2JA6J 2OZUA 1SC7A 2QF7A 3D1NI 4U0VA 2D2WA 1T0FA 1LUJB 3GF2A 4XLAA 3L2WA 2Q2EA 2LY2A 3H9JA 3RZOJ 3VYSB 3JRFA 4M71A 1DU6A 4KA4A 1WJDA 1S9HA 2FMYA 4XLNF 1IRGA 5ICFA 3X2QH 4OIOF 1V5GA 4JK1X 2W25A 2X48A 4OAYA 2MABA 3C18A 1T33A 1A31A 3VB2A 3ASNH 3RPQA 1ZKGA 1XPXA 2VONA 2IS4A 3HKZA 2ZFWA 3BLYA 3K4BA 1FNNA 3L09A 3QP6A 1YHQI 4OIPF 1ZELA 1XSVA 3ULQB 1FMWA 5M3FJ 1WPKA 3FXOA 3JSPA 4HQEA 4CXFA 5K5OA 3QPTA 1UHWA 4LD5A 2XF5A 2HZTA 5CQGA 1ETVA 3DU6A 5HLGA 3OL3A 4I0BA 1UZCA 2VLAA 2MC3A 1E3OC 2R4GA 2IP2A 2EFPA 1FIPA 1D0ZA 2R5ZB 3HL2A 3H0GJ 3W2WA 3Q0WA 3QP5A 2LF8A 1TZLA 2EBIA 1MJ9A 2W82A 1P6RA 2DA1A 5IP6A 4HX4A 4E7HA 3M3YJ 2Z1DA 4KFCA 2EV5A 4A5MA 2CG4A 4HNTA 2DT7B 4E6KG 5J47A 4BUPA 1HBXG 2KRCA 1SD6A 2DDBA 4IF4A 4BH9A 5AONA 4Y4RA 3B02A 3H3UA 1OPCA 1UHMA 4XRSG 2L5QA 1R1VA 2BE5F 4HF0A 2IS1A 3HSRA 3LOCA 1YS6A 3TQNA 2L4AA 1O3RA 3DTKA 2UZKA 5L3EA 1HA8A 3ZXSA 2DFFA 3IC7A 4LMYA 4MNUA 4XNFA 5ILVA 2DMQA 1LEBA 4HDVA 3W3CA 5EDNA 2FF4A 2K9MA 1X4OA 2FD5A 4CO8A 3WGIA 1R9TJ 4M73A 3TDUC 3GEZA 1FP2A 2WWYA 3K9TA 2EZHA 2DYSH 2DQLA 1YI2I 2M1BA 3IAS2 5CJ9A 3CUQC 1OR7A 1U8RA 2QZ8A 2DOFA 4BY7J 4Q4ZF 2JUGA 3JRGA 3IH2A 4LITA 3O8HA 4OAZA 4BDYA 2IA2A 1W36D 1O7LA 5E1WA 1QHGA 4PJNA 2ZSIB 4PFPA 2QSHX 2LP0A 1QU3A 2JA5J 4EEFG 1WCMJ 4QPOA 4CCNA 1TW2A 5JVTA 1ZG5A 4G8XA 1R1TA 1WSUA 2HDDA 2K40A 1KU7A 2KJCA 2R5ZA 4PJMA 3TW7A 3DU5A 2M87A 3ASOH 1PJRA 3QOEA 4LK0F 2VT2A 5J8FA 2W57A 3CCQI 2PJRA 5D5XB 2Z99A 2W1OA 4IHVA 1X3ZB 3REOA 4UNOA 2DPUA 3LSHA 5E3NA 5JFRA 3V42A 4YIRX 4ENKA 2BHZA 3RDIA 3I58A 5M5XJ 2O7OA 3FZVA 1BL0A 2XF6A 4A3CJ 1IXCA 2DOAA 2G0EA 3B6AA 5HS8A 5L3BA 4UB6C 1R22A 4E7JA 2CSOA 3WTWC 3JAMZ 4A3KJ 2BBYA 4J01A 2MYSA 1YITI 4MFEA 1N78A 1V4RA 4YEJA 2FX0A 1ZR2A 1VQLI 2DA4A 4BJ6C 2M2EA 2FOWA 3PIOF 1G3SA 2MW8A 2OJED 5LBQA 1X1BA 1J5YA 3OL4A 2O5RA 3LQRA 4RBOA 3ERED 3U1DA 4BBRJ 2LBFB 4HAMA 5C44J 2STWA 2QKMB 4MTEA 2DXIA 5A2QK 1K78B 1HKTA 1X3WB 2V4JC 2JSPA 2RV8A 3EDPA 1Z3YA 3DBLB 3LSRA 3CC4I 2KPMA 2ZJRF 3BT9A 4IOAF 4M6VA 2LG4A 5D4SA 1MBFA 1IGNA 2K7LA 4E70A 1OYWA 2HTJA 3F8FA 4HBLA 3SEQA 1KQ0A 3A2KA 1W5TA 2EILH 2XGDA 3IKVA 3QU6A 1RPWA 5DS9A 1F43A 1GVDA 5BPIA 3BCAA 3FWEA 2O6GE 3D5LA 3AG2H 4AU7A 2HWVA 1I1SA 2VQCA 3DBRB 4UVBA 2HGCA 3CC2I 1XSXA 4D5FA 2QVOA 5FLXZ 2VT3A 5TJJA 4AVPA 2VBZA 5IT9K 4HNVA 3TBIA 2ZJQF 3OYNA 4D0PA 1MGTA 4MQ9F 2KHMA 4HNUA 2FMLA 3CMMA 5JR3A 5LHIA 1ENHA 1HLVA 3KZYA 3A1YA 2DMUA 1Z6TA 2CUEA 4Y52J 3WTUC 3HTSB 3ONQA 3HTUA 3LNQA 2EWNA 5HNHA 1T2KA 2WTEA 1HKSA 5EZHA 3QPHA 5LHHA 2R5YB 4F92B 2IPQX 1S8NA 3HC7A 3CTAA 2EV6A 3TMOA 5FLMJ 1T38A 2H1LA 2VC0A 4S0HB 2OTLI 5F0CA 1YJNI 2VUMJ 2LBFA 1Y0NA 5DV5A 3TO9A 3P9IA 1R4MB 1WWXA 1K78A 1UJ8A 4M72A 4B8XA 1ZLKA 1QPMA 1YJWI 1YX3A 4I09A 4A0ZA 2KRFA 1MNDA 3OYFA 1B72B 5FRMA 5KVRA 4AD9A 5LGNA 2KZVA 2IJLA 2GIZA 1I6HJ 5K5RA 3DCFA 1T98A 2XUBA 5HODA 3ZP5A 3ZQLA 4C2UA 2L3DA 5LLQA 2IRFG 1UB9A 1MBHA 4XK4A 3BJ6A 3H35A 2BZTA 3Q5FA 3MMYB 2E19A 4N4OB 5GP9A 1JKRC 1ORKA 5EEAA 4IL6C 5LRRA 3S1NJ 2R7VA 5EYRA 1YS7A 1VF9A 4XOPA 2NOJB 3A4CA 3J7YJ 2GZWA 2Y9ZA 2KISA 2ZJ2A 1N77A 4H4KC 1RKTA 1K79A 4OIQF 3WHBA 1D0YA 4PJJA 4ZJZA 3LSGA 5IOYA 1H9GA 3OWTA 5K1YA 2F5FA 2NS7A 3OYBA 1ZQ3P 1EJ9A 2KLOA 3VOEA 3QODA 3BZCA 2OV7A 2O8KA 4RAGA 1K6OA 1MNMC 2R5YA 1SVOA 1XGSA 1AOYA 2VKDA 3ZOBA 1IUYA 1Y8QB 2Y9YA 3VSKA 2W4SA 2O0YA 1IJWC 4BGDA 2IAIA 1TQMA 1BN5A 3E6CC 1ON1A 1UCRA 3IL2A 1ZARA 3SFIA 2XV4S 1S7OA 2R7DA 2VQGA 4CCKA 1J2XA 5B5EC 5IY5H 1B72A 1FTZA 2Z33A 4BNCA 2H8RA 2ZB9A 1TW3A 1A5JA 1Y1WJ 4EJVA 1SFXA 2EA4A 2CQ7A 2Y69H 5D6FA 5CVVA 3ZQQA 2XDVA 1PYVA 1OYYA 5C3EJ 4U0YA 2OCEA 3KP4A 4Q5SF 1MSFC 2QA4I 2EIJH 1QPIA 3L2VA 3TP0A 3VWBA 5KHDA 1HW2A 2FNPA 2X9DA 4E7KA 5DUKA 1YIJI 3NQOA 3NWTA 1BI3A 1LQ1A 1GUUA 3QPSA 4ENNA 3PSIA 1V54H 2YX7A 1RIOH 1G4DA 1ETQA 2W48A 3AKZA 2ZKZA 3GYHX 1T39A 3VYRB 3NAUA 4XBFA 3FHZA 1E17A 2DYRH 3JRCA 2GBYA 1XC5A 2WAEA 1WZ2A 4KYWA 4RA2A 1MMDA 2Y0SA 2HYJA 3G1OA 1PP7U 3DEEA 3V4GA 2ELJA 3ZMVA 2XGXA 3MKWB 3RSNA 2ZSHB 2L01A 2WB1N 1Q1HA 2K4BA 1OCPA 1YJ9I 4RB3C 2D45A 1NHAA 2F4IA 3KFWX 5FD6A 2ECCA 2Y0MA 4KIBA 4EJWA 4I0AA 2HOAA 3QYBA 4M3FA 4CDGA 1K7AA 2GM4A 1G3WA 2H27A 4KDPA 2H6CA 2W24A 1IO2A 4WK8F 2Y75A 4II2A 1RR8C 2KZGA 3RQIA 2NS8A 3KP2A 3CC7I 1IDYA 2QQ8A 2OD5A 2Q1ZB 2NVQJ 2FBHA 4GYGA 2XSJC 3O8GA 3GTJJ 4RAFA 2PN6A 3VPRA 3PSFA 1VQ7I 2R7UA 3PM1A 4YFKF 4V19K 2G9WA 2WAQN 3WTTC 1N25A 4M74A 1Z7LA 3BR1A 3GZ6A 4M6XA 2FOKA 4CH7A 2FEZA 1CF7B 1O4XA 2HPIA 1XSDA 3LAPA 2O61A 2QQBA 1RI7A 3LSMA 1EKEA 2QLZA 4HSTA 2JMWA 2P5VA 4L9NA 1QBJA 3K2ZA 2P8TA 3H0DA 4G7OF 2A3SA 1MBEA 3FIWA 4FASD 5F1JA 4BQNA 5D5WB 1LVKA 2LTPA 2JPBA 2OA4A 4HV6A 3OYKA 4D5CA 4NC8A 3SZTA 5GTIC 4FX4A 3O2PE 3OIOA 2JUCA 2B0LA 2IGOA 4P96A 5BNGA 3T8TA 2EZKA 2JJ7A 1XGOA 2E7XA 3FKIJ 1XCBA 2OC6A 2QYOA 1APLC 5IP9J 3V8LA 3F72A 3K1PA 2VKHA 3ML6A 4AIHA 2AO9A 3CCRI 3BR3A 2EFOA 2NVUB 4QLCU 5JLWA 3WTYC 4XRFA 1U3EM 1D8KA 1I27A 2K85A 2KL4A 5AIPA 3GZ5A 3FXJA 4M9XA 2EFQA 1QQIA 3D0SA 3JRIA 3TOAA 3HB9A 3CO6C 4ZYGA 4YIIA 5FJ8J 4JYKA 2XRLA 1XG1A 2FXAA 3GO5A 3QU3A 1YFHA 3HSEA 3MD2A 2OZ6A 1VQMI 4KJZA 1G6NA 4FE4A 4QTRA 2L0KA 1EA3A 4KITB 1JKOC 4UHTA 5GTHC 5J1RA 4FT8A 1TQIA 4HSRA 3CUQA 1R49A 2IA0A 1FY7A 2QM3A 5H20A 2YX4A 2XAJA 5BQTA 3BWGA 4IHXA 1YE9A 3D5SC 1FBUA 2VBYA 2AQEA 2V9PA 5CPRB 1CF7A 3BC8A 4Q48A 2A6HF 3ZQIA 2L02A 5A2QZ 3J81Z 2F2EA 1LDDA 2V9VA 1ZGWA 1R71A 1D5YA 4WXHA 5ILSA 2PMZA 1FLIA 3ROUA 3DTIA 1MMSA 3LWFA 4D7NA 2NS0A 4CHUA 1MKMA 3PNTA 1NK2P 1UHSA 4L0YB 4XKWA 4UVCA 1P4AA 2F5DA 3ZMUA 4M9SA 3QOPA 4R1HA 2V6CA 2KFDA 2IBDA 2E36A 3PL8A 2Q2EB 2ZO4A 3GTGJ 3I0TA 4HLYA 5GADJ 1G59A 2CS3A 2PFBA 1POGA 5BS6A 3KZIC 4QSHA 2B9SA 1BIBA 2ME0A 1LVAA 1R23A 2X85A 4F7ZA 2ELKA 3F6OA 3M8JA 1NG7A 3FM3A 3ISPA 1YW8A 4BDZA 3ZR8X 2GQQA 4P55A 5LD2C 4XRMA 3SDGA 1K83J 2FJ1A 1MJBA 1OCZH 4HV5A 4CZCA 3HEFA 1OFCX 1KYWA 3HOZJ 4XL9A 4HG2A 4U88A 3BR2A 5E3OA 1W7PB 1IW7F 1ERDA 1BJAA 4EMSA 1KQ9A 2EJRA 3GTLJ 2UUZA 4JX5A 4A6DA 1ZREA 5F0FA 3I56I 1HF0A 4GFBA 5H2FC 1WH7A 2NOGA 2AS5F 3ZQFA 4QWQA 4S05A 3R60A 1OQYA 3FX3A 2IS6A 3I4MJ 3RYPA 2ECBA 1R36A 2F5VA 5D6EA 1WVRA 4ZC3A 4EVIA 1U2WA 5HLTA 3K69A 3P9KA 3GTKJ 3G3ZA 3RI4A 4RDUA 1FPQA 1CQTA 1X1DA 4ENJA 1JE8A 5FKKA 2E1OA 4FTHA 1S5LC 2EZIA 3L2QA 2RDPA 2BGCA 1JT0A 3KP7A 1DGWY 3DPUA 3AAFA 3P9CA 4ZH4F 3CCEI 2E2HJ 4LG3A 3ZN1A 3BR0A 1W0TA 3CCJI 2KRHA 1BW6A 1IN4A 3OV8A 2RNGA 1BM9A 2CW0F 2I5UA 2VBWA 3GVAA 2IA1A 4U7BA 1D1CA 4PGGA 1DP3A 3S93A 2V9KA 2F5EA 4IRGA 1KYZA 4HDUA 1Z67A 4IZZA 3BG6A 3A03A 3B6CA 3FMRA 2M45A 3PFIA 1D5VA 2CV2A 2P5LC 4Y13A 3JR9A 3E5UA 3MQ0A 1I5ZA 4R79A 1W7PA 4WXCA 5FD5A 3W6JB 3ABKH 1JUSA 3V8KA 4KN7X 5FKLA 2ADUA 5HS9A 3WG9A 3RPUA 3TW6A 2CFOA 1JGGA 2HYFA 2P5KA 1F36A 2W84A 1YIOA 4F3QA 1SAXA 2B63J 2PQ8A 4UV9A 2VE8A 1Z6RA 4ESFA 4MLOA 1VI0A 2DTZA 3BG3A 5CVIA 2KDZA 3CDHA 3U2RA 3ABUA 5LEKA 3GX4X 3VYTB 1FYMA 1ETKA 3KYCB 4M3GA 2PJRB 2ACJA 2GLOA 1SANA 2NNYA 3C3WA 2GOMA 3S1QJ 1I6XA 1MH4A 3TO7A 2A6EF 4PJ0C 3D5RC 4OMZA 5FKNA 4Z6YA 2L54A 2ESNA 2RNJA 1OYIA 3KPHA 2L4MA 4XOTA 5C4JJ 3S2DJ 1XD7A 1X3UA 4A5NA 1LB2A 1ZHFA 1QZZA 5LFAA 3S32A 4HF2A 2KQRA 4PSWA 2FA5A 2FE3A 4HQMA 1K6YA 1SAUA 5FGMA 4IQJA 3KEOA 4NQWB 3OIQA 3OIPA 2WAFA 2NNNA 2LC2A 4PSXA 4AYBN 2FQ3A 1JJ6C 3F6VA 2GXGA 2P6SA 3Q0UA 3E5QA 2DA6A 3GFJA 4N0BA 3VEPA 3NARA 4NB5A 1A6QA 1FP1D 2D5VA 3A01B 4A93J 4ETSA 4K2EA 1TT5B 3CCSI 4BACA 1O3SA 1SD7A 1V55H 3K70C 3OYGA 2R93J 4UUSB 4N4NB 4OMYA 4KICA 3W6KB 1GVJA 2JA7J 4L9JA 4IX7A 2DA5A 3BROA 3RKWA 4BHCA 1A6IA 2W00A 2QCOA 3HZJA 3K4KA 2K3FA 5AIQA 3C2GA 2V6EA 2QENA 2K9SA 3R6SA 2XGCA 5J1YA 3ZMTA 1RUOA 5LEJA 5J6XA 1HW5A 1VQKI 5LRSA 2HOSA 5E1XA 3LSIA 3BZKA 4ZTJA 1TP4A 1S3JA 1JT6A 4E7LA 5DD8A 4FCYA 2K27A 4ZZLA 2EQRA 3F21A 1JHFA 4KIFA 3HOTA 2YPRA 1F4KA 4WWCA 3MVPA 1BR2A 4FQGA 4RMNA 3FXMA 5CVJA 3IKTA 1X2NA 1W7PD 3HPGA 3E3VA 4DQ2A 1E2XA 4YFNF 3I5UA 2HR3A 1GHCA 1MNEA 5KK1A 1WJ5A 4M3DA 2R7WA 1QRYA 3MAJA 2LSOA 3ERMA 3LA7A 4XKBA 2O03A 1P2FA 1IAWA 1SFEA 2BOLA 3BP8A 4NQWA 4IHTA 3GFLA 2EFNA 1KGSA 4WX9A 3LMMA 4MTDA 3MEXA 2DFIA 1EH8A 2EB7A 4C3IJ 4CCOA 3A01A 1VQPI 1FYKA 3M9AA 4Z2YA 1J0RA 4GDFA 3S8PA 3H92A 4UUSA 2HI3A 4UXNA 3L2UA 2V26A 1F5TA 1IRXA 3OR1C 2OAZA 2MSYA 3OYCA 1HDPA 3GFIA 2L9RA 2MLGA 5F6FA 4I6ZA 3HDDA 1X2MA 4BQAA 1SFKA 2A68F 3I55I 2M0CA 4ZYEA 2DTRA 1BJZA 2M4GA 2OBPA 1OISA 3H5AA 4EM0B 2WY8Q 3I59B 2PMHA 2KIQA 1IV8A 2K02A 3S15J 3EQLF 1IF1A 2X1CA 3K6GA 1FYLA 2NYXA 2OQRA 2W85A 2C6YA 1BW5A 4A3EJ 1USSA 2LKSA 2P81A 1QO0D 4U87A 1MMAA 3C1DA 3S16J 5J3LA 1GLNA 4CSWA 5FKMA 5IYCJ 3CLOA 1OCRH 2DQRA 1NH3A 5H6QA 1U78A 3PUFA 2EINH 3SZPA 3LFUA 4FX0A 4L0ZB 3F22A 2XPUA 3EPZA 2DOEA 5CKTA 3P7NA 2ISYA 2M4KA 1G3TA 2DODA 4CA0A 1LNWA 4BYYA 1MBKA 3ZQCA 3I54A 1WJCA 1N75A 3LL7A 3ZRGA 2IVMA 1DU0A 4HEA2 4CZZA 4RGRA 3ECHA 3M7GA 2F48A 4P9UA 1W36C 2VXDA 4XICA 4F93B 2RVCA 4CGZA 2RAEA 3R4KA 2CMPA 3HHGA 1G2HA 5ICGA 3SHFA 2XB0X 2UWMA 2LYCA 2VJIA 1FBSA 5FRNA 2BVLA 1Y39A 1TQPA 4HLXA 5E8IA 3QAHA 2ELHA 3Q3SA 2DFHA 2DPDA 2ZCWA 4EGZA 2FUG2 2GOXB 1IRFA 1BR1A 3ZMZA 4EV0A 3JRDA 2M7BA 1IV6A 2AXLA 1P9QC 1QVTA 3M1EA 4BE2A 2E35A 1R6RA 2VI6A 1E3PA 2HDWA 1DPRA 3DWLE 1U5TB 1VZ0A 2PBIA 3BG7A 1MMNA 3ECOA 2FBIA 4AC0A 4KIGA 3I59A 1ZG3A 2Z9OA 2CU7A 2RC4A 3G1LA 4B3XA 3ZQHA 3L2RA 1YYVA 2JVHA 4RM2A 2X6OA 3MKZA 4XMYA 4YG2F 3GMEA 3K0LA 3IH3A 3QQAA 5HDGA 3ZCOA 3CQZJ 1R00A 3HOUJ 1SFOJ 4XKCA 3K7AJ 1X1PA 1IUFA 4KISA 2DA3A 1DPUA 2WV0A 3KP5A 3EUKL 4L9TA 3CDIA 1HQCA 1GV5A 3DQVC 5EGOA 2HQAA 3M4OJ 1I39A 2LREA 4UV8A 2Q8KA 1MSEC 4ESJA 3DV8A 3HRUA 3QYFA 1HSJA 4EATA 2VJ4A 2IW5A 1SMYF 5HDKA 1WKMA 1XGMA 2A05A 2PI0A 4DYQA 2ISZA 3W2AA 2JA8J 4P9FA 1Y56A 3QWLA 2ZC2A 4AVZA 4BBSJ 3FBIB 4CCLA 5J8CA 4JX4A 2X0LA 2DO7A 2ZXHA 1WJBA 4MEXF 1RRJA 3MZHA 4RB1A 4AM3A 4Y7NJ 2YSRA 3FF5A 4A0XA 5M3MJ 3V8JA 3CMAI 2CV1A 2G7HA 4R8HA 5IOZA 3UR3C 2DW4A 3PO2J 3LSKA 4F52A 3C2HA 2DT5A 2KT0A 2DMTA 3M07A 5E17F 1H9TA 1UELB 1J59A 2L2OA 4P5OA 3HOSA 3N4MA 2GAUA 4PGHA 4EQQA 3S14J 3OS0A 1U5TA 2GA2A 3HRSA 4GYIA 2W7NA 4M3BA 2DA7A 2E1CA 3PQJA 5L3FA 4KN4X 4XORA 4HPQA 4MFDA 1UMQA 2MD0A 2E1NA 3E0JB 1R58A 2H94A 3OR2C 3OYAA 1GV2A 3AG1H 2AHQA 3WGHA 1SEUA 2HQ5A 5J4YA 2O3FA 2JVGA 3OS1A 2ZNZA 1HDDC 3HYIA 3CP2A 2L7MP 3GLLA 3L7WA 3BDDA 5FFZA 1JUPA 2Y31A 3E1SA 1TWAJ 1RKWA 4CYCB 2LDUA 4NHJA 4E7IA 2P0WA 3OS2A 3BPVA 3F8MA 3WTVC 4XLFA 5HNFA 3FBNB 1FZPB 1ETYA 4I99C 4KMUX 5DTDA 1MDMA 1ON2A 4EJOA 2DFEA 2KP6A 4KUMA 3GTMJ 3BJAA 3OMYA 1HCRA 2BYVE 5ICEA 4LB5A 3NEUA 1HSTA 2KIMA 4AIJA 1MH3A 3KX2A 1U8BA 1LJ9A 5F04A 4RLFA 1XGNA 4LIVA 5GAGJ 1DQUA 4N9IA 1Z1DA 2A5YB 2XC7A 1LFPA 1S72I 3IWFA 3JW4A 3H9GA 3CCLI 1UAAA 2XRNA 1Z77A 2BY0A 1IG7A 1OJLA 2LLKA 4NC7A 1XMKA 3R0JA 5DCMA 1VFCA 1QHHD 1VNDA 2VC1A 3K4MA 2Z5UA 5ILUA 4IRIA 2BW3A 1R1UA 2L7KA 1U6GA 1KA8A 4XQFA 3CUQB 1LE8B 5EJCA 4LLGF 1R4NB 4Q47A 1I1GA 4MIMA 3BQYA 1D0XA 1M1EB 2FU4A 3FM5A 4B3AA 3H1CA 1YRNA 5IT3A 1Z9CA 2F6CA 2MA3A 2Z2SB 3EETA 3MZ8A 5HOOA 1QA6A 4HF1A 2JA2A 2NVTJ 2VE9A 4DBQA 1VQ8I 5TRDA 1XDUA 4IHSA 1X1CA 1L3LA 3K4JA 3BJOA 2CYYA 3V7SA 3M8EA 3OY9A 1BA5A 1Y8RB 1TWCJ 1Z3XA 4CYCA 5B66C 4I98B 2ZXIA 1JHHA 4X6AJ 2BXYA 2XF7A 4CUGA 1B6AA 1H8AC 2K3PA 2PMUA 5HLIA 4JOMA 2ZNYA 2GA1A 2DA2A 1ZG1A 3G73A 4XLHA 2A6TA 3AG4H 2O8XA 4HX8A 1JKQC 1FWZA 2J5OA 4M6YA 1S6LA 2IEKA 2JRMA 1B1BA 3IV5A 3KYDB 5IYBJ 4OIRF 2VB6A 3FXRA 2LKPA 3CCYA 2R7FA 2CQKA 3OYEA 1LDJA 2MBFA 3LA3A 4XN3A 1K4TA 4S04A 2R7ZJ 4HX7A 4AUXA 2ZMEC 5KNLA 3W2VA 1YLFA 3PNYA 5L3CA 4MO7A 1LPQA 3CJNA 2XROA 1LFBA 4LB6B 2LRDA 4ANJA 1LE8A 1P7JA 3SFZA 4DW6A 1BI0A 1OCOH 3ZGKA 2UXXA 1WGXA 3OYHA 3DTEA 2IGMA 1JUMA 4WXDA 4RS8A 4XRSA 4HRIA 3H36A 4I2OA 3Q0VA 3J7AY 2XAQA 2Y2ZA 3E6MA 5EG0B 3CF5F 2E71A 2HQNA 4E7SA 3M1CA 4WCGA 4C2TA 5K7ZA 1OCCH 2ZFUA 1AHDP 2LY1A 3GWZA 4ZYDA 1WJAA 3L2CA 1AWCA 3GFMA 1GDTA 4IHYA 3S2HJ 1TNSA 1PUFA 1FJLA 3G4SI 1W0UA 4C9YA 2F4OB 1WI9A 3AFHA 3PUBA 3RTRA 3OYLA 2GWRA 3CMEI 2LOOA 1XTAA 2D1VA 2P6TA 2X1EA 4DBRA 1IDZA 4BL0B 2BEOA 3OSFA 2CH0A 2VPRA 3MWMA 1MIJA 4O3MA 1W5CC 3KE2A 4BE0A 2JSCA 2X6YA 1KZHA 2XPVA 1H0MA 3MKYB 3DF8A 4IKFA 2R7OA 5IT9Z 2XAUA 2HYGD 2XGEA 3PNVA 3HHHA 3J80K 3AL0C 4NNJA 2XSDC 2KIUA 4XSXF 1QVUA 1MZBA 2RREA 3LSPA 1UG0A 2IGNA 3FK6A 3HXLA 2MLKA 1BR4A 4LIUA 4LOCA 5JHUA 1EF4A 2I8DA 2IT0A 4A3GJ 4ENMA 2UV1A 4OWRB 4ZDOA 1KQ8A 3QYEA 4TV7A 4PCQA 3T1BA 3UNGC 2GXBA 1BOAA 1JTXA 3U1KA 4J19A 5IP7J 2K9NA 3CMYA 4HOBA 1AU7A 4A3MJ 2ME6A 2LFBA 4DGWB 4BKXA 2WADA 2YU9J 2E5NA 1Z05A 2CFXA 5KCMA 4EM1A 1YO5C 4UUVA 4Y17A 3VODA 3OYJA 2CQNA 2L7ZA 2V7FA 5GPCA 1R7JA 3PIPF 4CICA 5EG0A 1Z91A 2VL8A 1FC3A 4GGGA 3S3OA 5D5UB 2H8WA 2CQQA 1IN6A 3BOQA 3SDBA 3L1PA 1TLHB 4V2GA 3ABLH 2V1UA 1OMIA 4XIDA 3TO6A 5D8KB 1AA7A 1P7IA 2Y48A 1U9NA 1E0EA 2HKXA 1B9NA 2RN7A 4IOCF 4NC6A 1ZGAA 9ANTA 4V2FA 2XAFA 1VQOI 3TEDA 4XLCA 4YFXF 5FKOA 2VKEA 1GXQA 3L00A 2OU2A 4BU2A 4I76A 3VDXA 1E3HA 2MG4A 2QQ9A 3T8RA 3HGGA 2XKPA 2X6WA 5E3MA 4GRIA 4E7ZA 1Y1VJ 1R5ID 2Y30A 3PQKA 1GT0C 4L5IA 2BXZA 2DMNA 2HVSA 1WH5A 1J7KA 1SD4A 1HKQA 1Z21A 2N8GA 5DUIA 5E3LA 1WRJA 5H6RA 3KZZA 2PEXA 4X0GA 1ETWA 3SXYA 3CJRB 1B59A 4JP0A 4MGRA 1HOMA 4GCVA 3CF2A 5ERIA 2PMZN 4BXXJ 4BS9A 3WU2C 3O6BB 3QPLA 5IPAA 1IXSB 1PVEA 1ZRCA 3EUHC 1Q1VA 4BQQA 3JSOA 3HM5A 4AIKA 3V7CA 3RKYA 3BQZA 2OUMA 3E5XA 3A0BC 2VODA 1ZAOA 2DN0A 1HC8A 1YG2A 3WU0A 4DZPA 3JRAA 4DNCA 2QKLB 1ZN2A 2DJIA 3EYYA 3K1NA 4LG0B 3A0HC 3IRRA 4IPAA 3CP8A 3QRFF 4EJTA 1AKHB 2YS9A 3S3NA 4CCMA 2R7TA 5EEGA 2ZBKA 2L7FP 2MGQA 3F8CA 4HA8A 2KDOA 4UVAA 4HZFA 2A61A 3F23A 4IO9F 2XB5A 3OOUA 1T56A 4A2UA 3HGYA 1W5SA 3DLLF 2P7CB 4DYCA 4BHBA 4DYRA 4U7DA 1XX5A 4P1WA 4G94A 3RKXA 4A3BJ 1O7FA 1ZYRF 1A36A 5GPAA 2KKOA 2RQQA 5EEHA 5L3GA 1TWHJ 1IRZA 2JWTA 2OF7A 1IZ1A 1RC9A 4D7MA 5DCFA 3GZNB 1J09A 1KU2A 3MFKA 1MBGA 3CJQB 2CUFA 3Q9SA 2BVMA 3I4PA 3FDYA 3CDLA 3DPLC 3FISA 1RZ4A 2COMA 3H3VK 1MBJA 1O3TA 3S2WA 5FFXA 3KETA 5FROA 1RR7A 4A69C 4LFUA 3BR6A 3WG7H 2R7QA 1PP8F 4MEYF 1ONVA 1BOBA 2L9NA 4A6EA 2LVSA 2ETHA 3CCVI 4YRVA 3UKGA 3FXKA 1ZLJA 4BQOA 3HBLA 3KEYA 3I4NJ 5J40A 3LFKA 4PFOA 4DJAA 4PJLA 2M34A 2X4HA 4H0EA 2MH2A 5GAHJ 3DKXA 2TDXA 1FTTA 2LD5A 3GLXA 2XAHA 3SZGA 3BTCA 1REPC 3WODF 1KONA 4A0YA 2Z16A 5E1ZB 3BZ6A 4OINF 2R3SA 5B1AH 2HXIA 5L3DA 4LG0A 2LNBA 3IP4B 4G12A 1RESA 5CVRA 5FB2A 1AKHA 4G6QA 5K5QA 2R92J 5HDNA 2YU3A 4BHPA 2RQPA 3HKZN 3WU1B 5DEQA 2CO5A 2CUZA 1ITYA 2M7AA 4ITVA 3RPUD 3G71I 2JN6A 1FMVA 3CUOA 4LLLA 3FMSA 2K9LA 2NAZA 2DU9A 3BPXA 2VXZA 3G6EI 2DT6A 4C30A 5M5YJ 4X1EA 2DCEA 2HEOA 2V1XA 2HVRA 4J00A 4C3HJ 2HDCA 5DD4A 1TC3C 2QSGX 3F0CA 5LGUA 1FEXA 1XB4A 3GW2A 4PK4A 3OYDA 2HTSA 4JBAA 1O57A 2CQXA 3P5JA 3ZN0A 1L0OC 3J7AO 5DYMA 2M9HA 3O3KA 2CV0A 3K1MA 3A02A 5KAFC 4XLEA 1WFXA 4ZYHA 5JVGF 1XS9A 3ZPLA 4CCJA 3L9FA 3CLQA 5E79C 2Q0OA 3BTLA 1EH7A 1FOYA 5JHFA 3PJRA 2XAGA 4BJ5C 3CZ6A 1HW1A 4UY8I 2M5WA 1F9NA 2AQFA 1W1WE 2ZMEB 2K86A 2DBBA 3J81K 1UFMA 2VASA 5LGTA 1LFUP 2IGKA 2HOEA 3C7JA 3PFYA 1W4MA 3DPTA 3NRVA 3CESA 3DEUA 3KCCA 4QIWN 2NVYJ 2OTJI 4B47A 3FXQA 3WTXC 4BXUA 3HJEA 2P4WA 2YUSA 2EH3A 2X1DA 5CVUA 3S1MJ 2COBA 4ZYAA 3OYMA 4M9ZA 1X58A 5EGOB 3B73A 4FHTA 4AWXB 4LGWA 2CUJA 3ELKA 2EIKH 5F0HA 2HQRA 1WJEA 3FK7A 1ZRDA 3WE3A 2OCCH 2XVCA 2M30A 4KT6A 3F3XA 2I10A 2WC2A 4PZJA 5CQEA 1Z7UA 4U0WA 2A07F 5HS7A 2HOTA 1V3FA 1YOVB 1T0FC 1P4WA 3IAM2 5D8LB 5F1RA 2HU9A 2JTVA 2JRTA 2UXNA 2VOPA 1I3AA 2H09A 5D5VB 4KNYA 3N05A 3BG5A 3CD6I 1S7EA 3RQ4A 2OQGA 4G6TB 3SJMA 4G7HF 3AG3H 1RUNA 3ESWB 3ZMDA 4XN0A 2E5ZA 2E2IJ 4IEJA 3RJPA 4C2MJ 2V79A 2FNAA 2JPCA 4A3DJ 3PO3J 5F27A 1DGRM 1XDSA 2LK2A 5E18F 1U0JA 4G6DA 2LY9A 1LEAA 3W6VA 3VYUB 4D9JA 1TTYA 3AL0B 2HVQA 4GXOA 3EUAA 4Y3OA 2CGPA 2R7SA 2BY3A 2ICWG 3OYIA 5BMZA 1R5GA 3MN2A 3ZQGA 3HOWJ 2ZMEA 1U9OA 2XPWA 5BPDA 2VJJA 5DM6F 1OKRA 2STTA 3BY6A 2HXOA 2XASA 2R7XA 4Y15A 3SYTA 1VQNI 3G2BA 1YX5A 2MH9A 3J80Z 2JQ7A 2GXAA 4XKVA 2M0MA 2B7EA 3H5NA 1FBQA 3JRBA 3BCBA 2E1MC 5KAIC 2WB1A 5JI6A 3KLOA 2V1DA 1ETXA 3DBHB 2CRGA 3DLAA 4FE7A 2E2JJ 2QEXI 1A04A 3F8NA 2F4MB 2VOOA 3ABMH 1MDMB 4L18B 1VQ6I 4NDLA 1PUEE 3FXUA 3BTIA 3IH4A 2HFHA 5E20A 2YR2A 5F08A 2ZJPF 4ZDPA 2WY7Q 1VQ9I 1FT9A 4F55A 4LK1F 3TKYA 1BBYA 5B3SH 4ASNA 1IXRC 4FISA 1NTCA 1TT0A 2M8GX 1FOWA 4RB0A 2JT1A 2LR8A 2AXTC 1VQ5I 3GTPJ 4L5EA 2WAQA 4QPQA 3CCMI 5LHGA 4FETA 5E8GA 3RYRA 4PDKA 1KU9A 1WJFA 2VN2A 5CYVA 1QGPA 4IVNA 5DCMB 5J1UA 3JRHA 4PUSA 2IXSA 4EM2A 2BW3B 3T5XA 1OR7C 3FHNA 1FSEA 3KP6A 4BJTA 4ABZA 4L9VA 3H9QA 3RKQA 2WA0A 3BTJA 2K9QA 3ZMSA 1A35A 1BI1A 2G7UA 2L9SA 1D8JA 3T0YA 2PJPA 1R5HA 2ID6A 2NVXJ 1JJ8C 2LF7A 1YRNB 1H89C 1K61A 3WGGA 1MJAA 1FOXA 4XSZF 4I01A 3BR5A 4IQ4A 4IRHA 5K7HA 1BC8C 1SVLA 3GUDA 2OPTA 4D1QA 5J4VA 2KMUA 5JLXA 1D1AA 3DKYA 1VTNC 3I71A 2BHYA 3DXJF 2GIVA 3RCOA 1UG2A 4RGUA 1Y0UA 2RGVA 1ZRFA 4O5VA 1B8IB 2E60A 3WTSC 4RAZA 1J75A 2IS2A 2MC4A 2XIGA 3KP3A 4W97A 3LSTA 1TWFJ 4ESBA 1P92A 3S3MA 3C2BA 2QWWA 2V1NA 2QQAA 1CGPA 3R61A 1ULYA 3MZYA 1JXSA 1SVMA 3KIOA 2ESHA 5HVQC 4MQVA 4OOIA 4F91B 3GTOJ 1Y6IA 4A3IJ 1H88C 2DI3A 3BG9A 2BY2A 2F5CA 4GO1A 3FKJA 1SFUA 4Y33A 4B48A 5HLHA 5BOXA 1BIAA 1P4XA 3HOXJ 4LLNA 2VIXA 2HKOA 3DP7A 1BC7C 3RIRA 1SD5A 2O9LA 2H1KA 2XKOA 2VQLA 5B1BH 1KU3A 2VBXA 1QZYA 4O6JA 1GXPA 1DP7P 3MKLA 3H5RA 3TGNA 3M8FA 4C3JJ 4A12A 3CJTB 1WI3A 3EUHA 1O3QA 2EIMH 3WHCA 4NBQA 4RGXA 2JK3A 4CYDA 2EA2A 1FSHA 3HUGB 2WV1A 2EFWA 1B9MA 3JREA 2E7WA 4HW0A 4NUBA 3U21A 1XN7A 2FBKA 1MW7A 5ED4A 2HZDA 2LMDA 4ZZDA 4BE1A 3J7ZI 4DOZA 3JAMK 4A3FJ 1PUFB 2BV6A 3V7RA 2DDAA 4YELA 4B1RA 1MD0A 1JGSA 1B8IA 2R7RA 3K10A 1PDNC 1X19A 1K4SA 1ACIA 1G8XA 4IXAA 4BAYA 2X51A 1C0WA 4XM3A 5ICCA 2LKXA 4ON0A 4RLQA 1ZTRA 1XMAA 4M3EA 3E6DA 3E7LA 3KLNA 2K4JA 1I3QJ 1B4AA 2P7VB 4G7ZF 1S7AA 4B09A 2NXNB 3Q9VA 2CJJA 1LDKB 4DZJA 1ZH5A 1YW9A 3FXLA 2DAOA 1J9IA 2HPMA 3IUOA 2CW8A 4OU0A 1ZR4A 1T95A 1TWGJ 1RNLA 2DJNA 4B4CA 2DK8A 4I7HA 4MHGA 3I64A 6PAXA 3WE2A 2MD5A 3JTHA 3SEZA 2JZYA 1WHUA 2PX9A 4II3A 2VJ5A 1TL8A 1TNTA 2QSFX 1NG6A 1D1BA 3HRMA 4B44A 2FSWA 3F8BA 2QUFA 2Y0SN 1G3YA 1JI8A 3GCMA 4BEHB 2FQ4A 3N97A 3IHUA 4IHWA 3TP3A 2FRHA 3SQNA 4N9HA 2WBMA 2ID3A 2K5CA 3LSJA 3JTGA 1T8IA 3NWSA 5FLXK 1V5FA 4ZDLA 1I50J 3IRQA 3CO7C 2VKVA 3G1MA 4RM3A 3HUGA 2BY1A 4RB2C 3HSFA 1QNTA 3I9V2 5TISC 5DDGA 1YW7A 2ZXJA 1MMGA 1ODDA 5F64A 3LQQA 1TBXA 2M8EA 2H6BA 2M3AA 1SMTA 2HNHA 1WQ2A 1ZK8A 2EZLA 3H3ZA 1DDNA 1YQAA 2DLLA 4EJUA 1DUXC 2HS5A 2QBYB 1IN7A 1IN8A 4I02A 2TRTA 3OOPA 5D4RA 4WF2A 2PLYA 3S17J 2VPLA 3COAC 5IYDJ 4BY1J 4UUTA 3R0AA 2EPFA 5DM7F 3KYLA 5TGTA 2PG4A 3RZDJ 3ABTA 4JQFA 1STZA 3DKWA 3HOVJ 4A3LJ 2KJBA 4YIFA 1IC8A 4ZTFA 3TOBA 4BXFA 4JX6A 1X4PA 3S1RJ 1XCVA 5EZGA 1JTYA 3IWZA 1Z0XA 1EH6A 3K2AA 1RETA 2ZXWH 3GXOA 4AIDA 1T6SA 2EV0A 3K4LA 3EYIA 3GTQJ 3TL4X 2R0QC 1BI2A 4HYEA 4B43A 1NK3P 2DK5A 3LAJA 1YTYA 1QZEA 3MCZA 1LKXA 1S29A 4UB8C 2A69F 5M5WJ 2DMPA 1ZGJA
chains in the Genus database with same CATH topology
3KEYA 3F9KA 4DJAA 4PFOA 2FUG2 2GOXB 3K4NA 1OLTA 1BR1A 4PJLA 4II2A 1V5EA 2M7BA 2MFZA 1P9QC 3DKXA 2VQHA 3HG9A 4BE2A 3SZGA 1R6RA 2Q1ZB 4BEHA 1KONA 2HDWA 2XSJC 3DWLE 2Z16A 1VZ0A 3BG7A 3GBGA 1MMNA 3PSFA 4AYBA 2R7UA 3I3LA 3K4CA 4B3XA 2LH9A 3IP4B 3L2RA 2JVHA 1Z7LA 4XR6A 2X6XA 4RM2A 3VSLA 3MKZA 4XMYA 1X1AA 4CH7A 3HPHA 3K70D 3ZCOA 2HPIA 4XKCA 4E4HA 2CUZA 2E1MB 3LSMA 4KISA 2M7AA 4HSTA 4ITVA 2A5WA 3RPUD 3H0DA 1FMVA 4FASD 2K9LA 4DIQA 2VXZA 3EUKL 4BQNA 2DT6A 1LVKA 3DQVC 4C30A 2HQAA 2DCEA 4XONA 2HVRA 3OYKA 2LREA 4J00A 2CW7A 4NC8A 3QYFA 4EATA 2IGOA 2VJ4A 4PK4A 3W2AA 2OC6A 1Y56A 3OYDA 4AVZA 4XLAA 3L2WA 2VKHA 2LY2A 3FBIB 3H9JA 3VYSB 4CCLA 1WJDA 1S9HA 2ZXHA 2CV0A 1WJBA 4XLEA 1V5GA 1WFXA 2KL4A 2CV1A 4OAYA 2MABA 4CCJA 3UR3C 2IS4A 3LSKA 3HKZA 4F52A 3BLYA 3C2HA 3K4BA 5JHFA 3PJRA 1UELB 4BJ5C 3CZ6A 3MD2A 2L2OA 4P5OA 4KJZA 3HOSA 2AQFA 1EA3A 4KITB 1ZELA 1FMWA 3OS0A 4HSRA 2VASA 2W7NA 2IGKA 4XORA 4HPQA 3PFYA 2XF5A 2MD0A 3DPTA 5CQGA 3E0JB 3CESA 3OR2C 3DU6A 3OYAA 3OL3A 1YE9A 3D5SC 4B47A 2VLAA 2AQEA 2R4GA 5CPRB 3BC8A 2JVGA 3OS1A 1D0ZA 2X1DA 3CP2A 3HL2A 4ZYAA 3OYMA 3E1SA 3W2WA 2PMZA 1TZLA 2P0WA 3OS2A 2CUJA 4E7IA 3DTIA 1WJEA 4XLFA 2W82A 5HNFA 3FBNB 4E7HA 2Z1DA 3PNTA 4KT6A 4HNTA 5CQEA 2KP6A 2DT7B 4E6KG 4XKWA 4BUPA 3OMYA 2KRCA 1T0FC 4Y4RA 3PL8A 2Q2EB 3IAM2 2HU9A 2L5QA 1G59A 2IS1A 3KX2A 2CS3A 3DTKA 3N05A 4RLFA 4LIVA 3ZXSA 1HA8A 2X85A 4XNFA 1DQUA 3M8JA 3W3CA 1NG7A 4G6TB 2K9MA 3RQ4A 4BDZA 2XC7A 1LFPA 3ZR8X 4XN0A 2E5ZA 1X4OA 3H9GA 5LD2C 1UAAA 4CZCA 4NC7A 1DGRM 1QHHD 4XL9A 4HG2A 1U0JA 3K4MA 2BW3A 2L7KA 1ERDA 3VYUB 4D9JA 3AL0B 3IAS2 2HVQA 4XQFA 4Y3OA 3EUAA 2UUZA 2R7SA 3OYIA 2JUGA 4LITA 4OAZA 4BDYA 1W36D 1QHGA 4PJNA 2ZSIB 2VJJA 4PFPA 1D0XA 1QU3A 2R7XA 2IS6A 3SYTA 2F6CA 3G2BA 1YX5A 2Z2SB 4QPOA 2F5VA 4CCNA 5HOOA 4XKVA 2M0MA 3H5NA 4ZC3A 3BCBA 2E1MC 5HLTA 2JA2A 2WB1A 4DBQA 3DLAA 1X1CA 3K4JA 4PJMA 1X1DA 3DU5A 1PJRA 3QOEA 3OY9A 1Z3XA 2PJRA 2ZXIA 2W1OA 3L2QA 2XF7A 4ZDPA 4CUGA 3LSHA 1DGWY 3DPUA 3V42A 2K3PA 2WY7Q 4F55A 4LG3A 4JOMA 2XF6A 2KRHA 1TT0A 2DOAA 4XLHA 2A6TA 2RNGA 4U7BA 1D1CA 4E7JA 1DP3A 3S93A 2V9KA 2WAQA 4QPQA 4J01A 2MYSA 4FETA 1N78A 1WJFA 4YEJA 4IZZA 2VB6A 3BG6A 4BJ6C 4PUSA 2IXSA 2BW3B 3OYEA 1X1BA 2CV2A 1OR7C 3OL4A 4XN3A 2O5RA 3FHNA 4BJTA 2LBFB 2QKMB 3H9QA 5KNLA 3W2VA 2WA0A 3PNYA 4R79A 2DXIA 2L9SA 2LRDA 2JSPA 2V4JC 4ANJA 1Z3YA 2KPMA 2CFOA 2LG4A 4IQ4A 3ZGKA 4F3QA 3OYHA 3DTEA 2IGMA 4HRIA 3J7AY 4MLOA 4D1QA 4E7SA 2KMUA 3M1CA 1D1AA 3DKYA 4C2TA 3VYTB 2ZFUA 3SEQA 2LY1A 3A2KA 2PJRB 1WJAA 3RCOA 2GOMA 3BCAA 3D5LA 2E60A 3D5RC 4AU7A 2VQCA 4XOTA 2IS2A 2MC4A 4C9YA 5LFAA 3AFHA 3PUBA 3S32A 2KQRA 4PSWA 3RTRA 3OYLA 3S3MA 2LOOA 2V1NA 1K6YA 1SAUA 4IQJA 3TBIA 2X1EA 4DBRA 4NQWB 3OYNA 5HVQC 3OIQA 3OIPA 4HNUA 4F91B 2KHMA 2WAFA 4BL0B 4PSXA 2LC2A 3CMMA 2CH0A 1Y6IA 4BE0A 3A1YA 2X6YA 3ONQA 3MKYB 4IKFA 5HNHA 4BACA 3FKJA 4Y33A 2R7OA 4B48A 2XAUA 3OYGA 3K70C 4N4NB 4F92B 3PNVA 3AL0C 4NNJA 3HC7A 3TMOA 2RREA 2VIXA 4IX7A 1UG0A 2IGNA 2LBFA 3HXLA 2W00A 1BR4A 4LIUA 2VQLA 3K4KA 2I8DA 3C2GA 2V6EA 2UV1A 4OWRB 4ZDOA 3QYEA 3UNGC 1YX3A 3H5RA 1MNDA 3OYFA 4DGWB 2WADA 5FRMA 2E5NA 5KCMA 2KZVA 3LSIA 3OYJA 2V7FA 4ZTJA 3HUGB 4E7LA 2VL8A 3S3OA 4C2UA 3SDBA 3HOTA 4NUBA 3U21A 1MW7A 1AA7A 2HZDA 3H35A 4BE1A 1E0EA 1BR2A 4DOZA 4RMNA 3MMYB 4N4OB 3HPGA 4YELA 4XLCA 2R7RA 2R7VA 3K10A 1MNEA 1X19A 1WJ5A 1G8XA 2R7WA 2X51A 4XOPA 2NOJB 4BU2A 4XKBA 3VDXA 3A4CA 4XM3A 2BOLA 2X6WA 4RLQA 4GRIA 1N77A 4E7ZA 4H4KC 3LMMA 2HVSA 4ZJZA 1D0YA 4PJJA 1Z21A 3LSGA 1LDKB 3OWTA 4CCOA 3OYBA 4X0GA 2HPMA 2KLOA 3IUOA 2CW8A 3QODA 3S8PA 2OV7A 1T95A 3CJRB 2VKDA 3L2UA 2V26A 3CF2A 1IRXA 3OR1C 3VSKA 2W4SA 4BS9A 3OYCA 3SEZA 4BGDA 4II3A 3EUHC 1SFKA 2VJ5A 4BQQA 4B44A 1NG6A 1D1BA 1JI8A 2VQGA 4BEHB 4CCKA 2M4GA 3H5AA 2OUMA 2WY8Q 2WBMA 2QKLB 2K5CA 2DJIA 3NWSA 1V5FA 4ZDLA 3ZQQA 2XDVA 1PYVA 3CP8A 2X1CA 3K6GA 4RM3A 3I9V2 4U87A 3S3NA 1MMAA 4CCMA 2R7TA 1MMGA 1GLNA 4CSWA 3L2VA 3VWBA 5KHDA 2M3AA 2HNHA 2KDOA 4E7KA 3OOUA 3NWTA 3LFUA 4P1WA 3EPZA 2VPLA 5CKTA 3PSIA 2M4KA 4CA0A 3AKZA 2RQQA 1WJCA 3KYLA 1N75A 3LL7A 5TGTA 3ZRGA 3VYRB 4HEA2 4JQFA 1J09A 3CJQB 4ZTFA 2VXDA 1W36C 4F93B 2WAEA 2BVMA 2CMPA 4BXFA 1X4PA 1MMDA 2Y0SA 3FDYA 3DPLC 3DEEA 2ELJA 3MKWB 3RSNA 2ZSHB 5FROA 2UWMA 3K4LA 2LYCA 2VJIA 3TL4X 2R7QA 5FRNA 2BVLA 4B43A 1BOBA 2L9NA 2F4IA 1LKXA 4YRVA 4BQOA 3QYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBF A;  4BEH B;  2LBF B;  2W1O A;  3A1Y A;  4BEH A; 
#chains in the Genus database with same CATH topology
 2QGU A;  5C4X J;  5FLV A;  3F9K A;  5GAE J;  2NRA C;  2J5P A;  3K4N A;  1OLT A;  1V5E A;  2MFZ A;  5FO5 A;  3CCU I;  1FOK A;  4A3J J;  2VQH A;  3HG9 A;  4W1U A;  4BEH A;  3OSG A;  2XHK A;  3E97 A;  4IJA A;  5CLS A;  1U5T C;  3GBG A;  3KEQ A;  1F1Z A;  1FIA A;  4AYB A;  3JCU C;  3I3L A;  3K4C A;  2LH9 A;  5EF6 A;  4G9Y A;  4XR6 A;  2X6X A;  3VSL A;  2KIF A;  1T08 B;  1ETO A;  1X1A A;  3HPH A;  3K70 D;  4KT5 C;  3WTZ A;  4XLP F;  4L5J A;  4LJZ F;  3HIF A;  2Z3Y A;  3LA2 A;  3U9G A;  3ZQ7 A;  4E4H A;  2D1H A;  1UST A;  2E1M B;  1EV7 A;  3HRT A;  5K7F A;  1VQ4 I;  2A5W A;  3I53 A;  3HOY J;  2QBY A;  3DEW A;  4EGY A;  2E34 A;  3DFG A;  2CWE A;  4DIQ A;  4RAY A;  3TDZ C;  2L9V A;  4XON A;  3VFZ A;  4KMF A;  1OCT C;  2CW7 A;  4RGS A;  1FX7 A;  3E6B A;  3FMQ A;  1IN5 A;  2RKH A;  2EK5 A;  1HXD A;  2TCT A;  1JKP C;  1XMX A;  1D3Y A;  2JA6 J;  2OZU A;  1SC7 A;  2QF7 A;  3D1N I;  4U0V A;  2D2W A;  1T0F A;  1LUJ B;  3GF2 A;  4XLA A;  3L2W A;  2Q2E A;  2LY2 A;  3H9J A;  3RZO J;  3VYS B;  3JRF A;  4M71 A;  1DU6 A;  4KA4 A;  1WJD A;  1S9H A;  2FMY A;  4XLN F;  1IRG A;  5ICF A;  3X2Q H;  4OIO F;  1V5G A;  4JK1 X;  2W25 A;  2X48 A;  4OAY A;  2MAB A;  3C18 A;  1T33 A;  1A31 A;  3VB2 A;  3ASN H;  3RPQ A;  1ZKG A;  1XPX A;  2VON A;  2IS4 A;  3HKZ A;  2ZFW A;  3BLY A;  3K4B A;  1FNN A;  3L09 A;  3QP6 A;  1YHQ I;  4OIP F;  1ZEL A;  1XSV A;  3ULQ B;  1FMW A;  5M3F J;  1WPK A;  3FXO A;  3JSP A;  4HQE A;  4CXF A;  5K5O A;  3QPT A;  1UHW A;  4LD5 A;  2XF5 A;  2HZT A;  5CQG A;  1ETV A;  3DU6 A;  5HLG A;  3OL3 A;  4I0B A;  1UZC A;  2VLA A;  2MC3 A;  1E3O C;  2R4G A;  2IP2 A;  2EFP A;  1FIP A;  1D0Z A;  2R5Z B;  3HL2 A;  3H0G J;  3W2W A;  3Q0W A;  3QP5 A;  2LF8 A;  1TZL A;  2EBI A;  1MJ9 A;  2W82 A;  1P6R A;  2DA1 A;  5IP6 A;  4HX4 A;  4E7H A;  3M3Y J;  2Z1D A;  4KFC A;  2EV5 A;  4A5M A;  2CG4 A;  4HNT A;  2DT7 B;  4E6K G;  5J47 A;  4BUP A;  1HBX G;  2KRC A;  1SD6 A;  2DDB A;  4IF4 A;  4BH9 A;  5AON A;  4Y4R A;  3B02 A;  3H3U A;  1OPC A;  1UHM A;  4XRS G;  2L5Q A;  1R1V A;  2BE5 F;  4HF0 A;  2IS1 A;  3HSR A;  3LOC A;  1YS6 A;  3TQN A;  2L4A A;  1O3R A;  3DTK A;  2UZK A;  5L3E A;  1HA8 A;  3ZXS A;  2DFF A;  3IC7 A;  4LMY A;  4MNU A;  4XNF A;  5ILV A;  2DMQ A;  1LEB A;  4HDV A;  3W3C A;  5EDN A;  2FF4 A;  2K9M A;  1X4O A;  2FD5 A;  4CO8 A;  3WGI A;  1R9T J;  4M73 A;  3TDU C;  3GEZ A;  1FP2 A;  2WWY A;  3K9T A;  2EZH A;  2DYS H;  2DQL A;  1YI2 I;  2M1B A;  3IAS 2;  5CJ9 A;  3CUQ C;  1OR7 A;  1U8R A;  2QZ8 A;  2DOF A;  4BY7 J;  4Q4Z F;  2JUG A;  3JRG A;  3IH2 A;  4LIT A;  3O8H A;  4OAZ A;  4BDY A;  2IA2 A;  1W36 D;  1O7L A;  5E1W A;  1QHG A;  4PJN A;  2ZSI B;  4PFP A;  2QSH X;  2LP0 A;  1QU3 A;  2JA5 J;  4EEF G;  1WCM J;  4QPO A;  4CCN A;  1TW2 A;  5JVT A;  1ZG5 A;  4G8X A;  1R1T A;  1WSU A;  2HDD A;  2K40 A;  1KU7 A;  2KJC A;  2R5Z A;  4PJM A;  3TW7 A;  3DU5 A;  2M87 A;  3ASO H;  1PJR A;  3QOE A;  4LK0 F;  2VT2 A;  5J8F A;  2W57 A;  3CCQ I;  2PJR A;  5D5X B;  2Z99 A;  2W1O A;  4IHV A;  1X3Z B;  3REO A;  4UNO A;  2DPU A;  3LSH A;  5E3N A;  5JFR A;  3V42 A;  4YIR X;  4ENK A;  2BHZ A;  3RDI A;  3I58 A;  5M5X J;  2O7O A;  3FZV A;  1BL0 A;  2XF6 A;  4A3C J;  1IXC A;  2DOA A;  2G0E A;  3B6A A;  5HS8 A;  5L3B A;  4UB6 C;  1R22 A;  4E7J A;  2CSO A;  3WTW C;  3JAM Z;  4A3K J;  2BBY A;  4J01 A;  2MYS A;  1YIT I;  4MFE A;  1N78 A;  1V4R A;  4YEJ A;  2FX0 A;  1ZR2 A;  1VQL I;  2DA4 A;  4BJ6 C;  2M2E A;  2FOW A;  3PIO F;  1G3S A;  2MW8 A;  2OJE D;  5LBQ A;  1X1B A;  1J5Y A;  3OL4 A;  2O5R A;  3LQR A;  4RBO A;  3ERE D;  3U1D A;  4BBR J;  2LBF B;  4HAM A;  5C44 J;  2STW A;  2QKM B;  4MTE A;  2DXI A;  5A2Q K;  1K78 B;  1HKT A;  1X3W B;  2V4J C;  2JSP A;  2RV8 A;  3EDP A;  1Z3Y A;  3DBL B;  3LSR A;  3CC4 I;  2KPM A;  2ZJR F;  3BT9 A;  4IOA F;  4M6V A;  2LG4 A;  5D4S A;  1MBF A;  1IGN A;  2K7L A;  4E70 A;  1OYW A;  2HTJ A;  3F8F A;  4HBL A;  3SEQ A;  1KQ0 A;  3A2K A;  1W5T A;  2EIL H;  2XGD A;  3IKV A;  3QU6 A;  1RPW A;  5DS9 A;  1F43 A;  1GVD A;  5BPI A;  3BCA A;  3FWE A;  2O6G E;  3D5L A;  3AG2 H;  4AU7 A;  2HWV A;  1I1S A;  2VQC A;  3DBR B;  4UVB A;  2HGC A;  3CC2 I;  1XSX A;  4D5F A;  2QVO A;  5FLX Z;  2VT3 A;  5TJJ A;  4AVP A;  2VBZ A;  5IT9 K;  4HNV A;  3TBI A;  2ZJQ F;  3OYN A;  4D0P A;  1MGT A;  4MQ9 F;  2KHM A;  4HNU A;  2FML A;  3CMM A;  5JR3 A;  5LHI A;  1ENH A;  1HLV A;  3KZY A;  3A1Y A;  2DMU A;  1Z6T A;  2CUE A;  4Y52 J;  3WTU C;  3HTS B;  3ONQ A;  3HTU A;  3LNQ A;  2EWN A;  5HNH A;  1T2K A;  2WTE A;  1HKS A;  5EZH A;  3QPH A;  5LHH A;  2R5Y B;  4F92 B;  2IPQ X;  1S8N A;  3HC7 A;  3CTA A;  2EV6 A;  3TMO A;  5FLM J;  1T38 A;  2H1L A;  2VC0 A;  4S0H B;  2OTL I;  5F0C A;  1YJN I;  2VUM J;  2LBF A;  1Y0N A;  5DV5 A;  3TO9 A;  3P9I A;  1R4M B;  1WWX A;  1K78 A;  1UJ8 A;  4M72 A;  4B8X A;  1ZLK A;  1QPM A;  1YJW I;  1YX3 A;  4I09 A;  4A0Z A;  2KRF A;  1MND A;  3OYF A;  1B72 B;  5FRM A;  5KVR A;  4AD9 A;  5LGN A;  2KZV A;  2IJL A;  2GIZ A;  1I6H J;  5K5R A;  3DCF A;  1T98 A;  2XUB A;  5HOD A;  3ZP5 A;  3ZQL A;  4C2U A;  2L3D A;  5LLQ A;  2IRF G;  1UB9 A;  1MBH A;  4XK4 A;  3BJ6 A;  3H35 A;  2BZT A;  3Q5F A;  3MMY B;  2E19 A;  4N4O B;  5GP9 A;  1JKR C;  1ORK A;  5EEA A;  4IL6 C;  5LRR A;  3S1N J;  2R7V A;  5EYR A;  1YS7 A;  1VF9 A;  4XOP A;  2NOJ B;  3A4C A;  3J7Y J;  2GZW A;  2Y9Z A;  2KIS A;  2ZJ2 A;  1N77 A;  4H4K C;  1RKT A;  1K79 A;  4OIQ F;  3WHB A;  1D0Y A;  4PJJ A;  4ZJZ A;  3LSG A;  5IOY A;  1H9G A;  3OWT A;  5K1Y A;  2F5F A;  2NS7 A;  3OYB A;  1ZQ3 P;  1EJ9 A;  2KLO A;  3VOE A;  3QOD A;  3BZC A;  2OV7 A;  2O8K A;  4RAG A;  1K6O A;  1MNM C;  2R5Y A;  1SVO A;  1XGS A;  1AOY A;  2VKD A;  3ZOB A;  1IUY A;  1Y8Q B;  2Y9Y A;  3VSK A;  2W4S A;  2O0Y A;  1IJW C;  4BGD A;  2IAI A;  1TQM A;  1BN5 A;  3E6C C;  1ON1 A;  1UCR A;  3IL2 A;  1ZAR A;  3SFI A;  2XV4 S;  1S7O A;  2R7D A;  2VQG A;  4CCK A;  1J2X A;  5B5E C;  5IY5 H;  1B72 A;  1FTZ A;  2Z33 A;  4BNC A;  2H8R A;  2ZB9 A;  1TW3 A;  1A5J A;  1Y1W J;  4EJV A;  1SFX A;  2EA4 A;  2CQ7 A;  2Y69 H;  5D6F A;  5CVV A;  3ZQQ A;  2XDV A;  1PYV A;  1OYY A;  5C3E J;  4U0Y A;  2OCE A;  3KP4 A;  4Q5S F;  1MSF C;  2QA4 I;  2EIJ H;  1QPI A;  3L2V A;  3TP0 A;  3VWB A;  5KHD A;  1HW2 A;  2FNP A;  2X9D A;  4E7K A;  5DUK A;  1YIJ I;  3NQO A;  3NWT A;  1BI3 A;  1LQ1 A;  1GUU A;  3QPS A;  4ENN A;  3PSI A;  1V54 H;  2YX7 A;  1RIO H;  1G4D A;  1ETQ A;  2W48 A;  3AKZ A;  2ZKZ A;  3GYH X;  1T39 A;  3VYR B;  3NAU A;  4XBF A;  3FHZ A;  1E17 A;  2DYR H;  3JRC A;  2GBY A;  1XC5 A;  2WAE A;  1WZ2 A;  4KYW A;  4RA2 A;  1MMD A;  2Y0S A;  2HYJ A;  3G1O A;  1PP7 U;  3DEE A;  3V4G A;  2ELJ A;  3ZMV A;  2XGX A;  3MKW B;  3RSN A;  2ZSH B;  2L01 A;  2WB1 N;  1Q1H A;  2K4B A;  1OCP A;  1YJ9 I;  4RB3 C;  2D45 A;  1NHA A;  2F4I A;  3KFW X;  5FD6 A;  2ECC A;  2Y0M A;  4KIB A;  4EJW A;  4I0A A;  2HOA A;  3QYB A;  4M3F A;  4CDG A;  1K7A A;  2GM4 A;  1G3W A;  2H27 A;  4KDP A;  2H6C A;  2W24 A;  1IO2 A;  4WK8 F;  2Y75 A;  4II2 A;  1RR8 C;  2KZG A;  3RQI A;  2NS8 A;  3KP2 A;  3CC7 I;  1IDY A;  2QQ8 A;  2OD5 A;  2Q1Z B;  2NVQ J;  2FBH A;  4GYG A;  2XSJ C;  3O8G A;  3GTJ J;  4RAF A;  2PN6 A;  3VPR A;  3PSF A;  1VQ7 I;  2R7U A;  3PM1 A;  4YFK F;  4V19 K;  2G9W A;  2WAQ N;  3WTT C;  1N25 A;  4M74 A;  1Z7L A;  3BR1 A;  3GZ6 A;  4M6X A;  2FOK A;  4CH7 A;  2FEZ A;  1CF7 B;  1O4X A;  2HPI A;  1XSD A;  3LAP A;  2O61 A;  2QQB A;  1RI7 A;  3LSM A;  1EKE A;  2QLZ A;  4HST A;  2JMW A;  2P5V A;  4L9N A;  1QBJ A;  3K2Z A;  2P8T A;  3H0D A;  4G7O F;  2A3S A;  1MBE A;  3FIW A;  4FAS D;  5F1J A;  4BQN A;  5D5W B;  1LVK A;  2LTP A;  2JPB A;  2OA4 A;  4HV6 A;  3OYK A;  4D5C A;  4NC8 A;  3SZT A;  5GTI C;  4FX4 A;  3O2P E;  3OIO A;  2JUC A;  2B0L A;  2IGO A;  4P96 A;  5BNG A;  3T8T A;  2EZK A;  2JJ7 A;  1XGO A;  2E7X A;  3FKI J;  1XCB A;  2OC6 A;  2QYO A;  1APL C;  5IP9 J;  3V8L A;  3F72 A;  3K1P A;  2VKH A;  3ML6 A;  4AIH A;  2AO9 A;  3CCR I;  3BR3 A;  2EFO A;  2NVU B;  4QLC U;  5JLW A;  3WTY C;  4XRF A;  1U3E M;  1D8K A;  1I27 A;  2K85 A;  2KL4 A;  5AIP A;  3GZ5 A;  3FXJ A;  4M9X A;  2EFQ A;  1QQI A;  3D0S A;  3JRI A;  3TOA A;  3HB9 A;  3CO6 C;  4ZYG A;  4YII A;  5FJ8 J;  4JYK A;  2XRL A;  1XG1 A;  2FXA A;  3GO5 A;  3QU3 A;  1YFH A;  3HSE A;  3MD2 A;  2OZ6 A;  1VQM I;  4KJZ A;  1G6N A;  4FE4 A;  4QTR A;  2L0K A;  1EA3 A;  4KIT B;  1JKO C;  4UHT A;  5GTH C;  5J1R A;  4FT8 A;  1TQI A;  4HSR A;  3CUQ A;  1R49 A;  2IA0 A;  1FY7 A;  2QM3 A;  5H20 A;  2YX4 A;  2XAJ A;  5BQT A;  3BWG A;  4IHX A;  1YE9 A;  3D5S C;  1FBU A;  2VBY A;  2AQE A;  2V9P A;  5CPR B;  1CF7 A;  3BC8 A;  4Q48 A;  2A6H F;  3ZQI A;  2L02 A;  5A2Q Z;  3J81 Z;  2F2E A;  1LDD A;  2V9V A;  1ZGW A;  1R71 A;  1D5Y A;  4WXH A;  5ILS A;  2PMZ A;  1FLI A;  3ROU A;  3DTI A;  1MMS A;  3LWF A;  4D7N A;  2NS0 A;  4CHU A;  1MKM A;  3PNT A;  1NK2 P;  1UHS A;  4L0Y B;  4XKW A;  4UVC A;  1P4A A;  2F5D A;  3ZMU A;  4M9S A;  3QOP A;  4R1H A;  2V6C A;  2KFD A;  2IBD A;  2E36 A;  3PL8 A;  2Q2E B;  2ZO4 A;  3GTG J;  3I0T A;  4HLY A;  5GAD J;  1G59 A;  2CS3 A;  2PFB A;  1POG A;  5BS6 A;  3KZI C;  4QSH A;  2B9S A;  1BIB A;  2ME0 A;  1LVA A;  1R23 A;  2X85 A;  4F7Z A;  2ELK A;  3F6O A;  3M8J A;  1NG7 A;  3FM3 A;  3ISP A;  1YW8 A;  4BDZ A;  3ZR8 X;  2GQQ A;  4P55 A;  5LD2 C;  4XRM A;  3SDG A;  1K83 J;  2FJ1 A;  1MJB A;  1OCZ H;  4HV5 A;  4CZC A;  3HEF A;  1OFC X;  1KYW A;  3HOZ J;  4XL9 A;  4HG2 A;  4U88 A;  3BR2 A;  5E3O A;  1W7P B;  1IW7 F;  1ERD A;  1BJA A;  4EMS A;  1KQ9 A;  2EJR A;  3GTL J;  2UUZ A;  4JX5 A;  4A6D A;  1ZRE A;  5F0F A;  3I56 I;  1HF0 A;  4GFB A;  5H2F C;  1WH7 A;  2NOG A;  2AS5 F;  3ZQF A;  4QWQ A;  4S05 A;  3R60 A;  1OQY A;  3FX3 A;  2IS6 A;  3I4M J;  3RYP A;  2ECB A;  1R36 A;  2F5V A;  5D6E A;  1WVR A;  4ZC3 A;  4EVI A;  1U2W A;  5HLT A;  3K69 A;  3P9K A;  3GTK J;  3G3Z A;  3RI4 A;  4RDU A;  1FPQ A;  1CQT A;  1X1D A;  4ENJ A;  1JE8 A;  5FKK A;  2E1O A;  4FTH A;  1S5L C;  2EZI A;  3L2Q A;  2RDP A;  2BGC A;  1JT0 A;  3KP7 A;  1DGW Y;  3DPU A;  3AAF A;  3P9C A;  4ZH4 F;  3CCE I;  2E2H J;  4LG3 A;  3ZN1 A;  3BR0 A;  1W0T A;  3CCJ I;  2KRH A;  1BW6 A;  1IN4 A;  3OV8 A;  2RNG A;  1BM9 A;  2CW0 F;  2I5U A;  2VBW A;  3GVA A;  2IA1 A;  4U7B A;  1D1C A;  4PGG A;  1DP3 A;  3S93 A;  2V9K A;  2F5E A;  4IRG A;  1KYZ A;  4HDU A;  1Z67 A;  4IZZ A;  3BG6 A;  3A03 A;  3B6C A;  3FMR A;  2M45 A;  3PFI A;  1D5V A;  2CV2 A;  2P5L C;  4Y13 A;  3JR9 A;  3E5U A;  3MQ0 A;  1I5Z A;  4R79 A;  1W7P A;  4WXC A;  5FD5 A;  3W6J B;  3ABK H;  1JUS A;  3V8K A;  4KN7 X;  5FKL A;  2ADU A;  5HS9 A;  3WG9 A;  3RPU A;  3TW6 A;  2CFO A;  1JGG A;  2HYF A;  2P5K A;  1F36 A;  2W84 A;  1YIO A;  4F3Q A;  1SAX A;  2B63 J;  2PQ8 A;  4UV9 A;  2VE8 A;  1Z6R A;  4ESF A;  4MLO A;  1VI0 A;  2DTZ A;  3BG3 A;  5CVI A;  2KDZ A;  3CDH A;  3U2R A;  3ABU A;  5LEK A;  3GX4 X;  3VYT B;  1FYM A;  1ETK A;  3KYC B;  4M3G A;  2PJR B;  2ACJ A;  2GLO A;  1SAN A;  2NNY A;  3C3W A;  2GOM A;  3S1Q J;  1I6X A;  1MH4 A;  3TO7 A;  2A6E F;  4PJ0 C;  3D5R C;  4OMZ A;  5FKN A;  4Z6Y A;  2L54 A;  2ESN A;  2RNJ A;  1OYI A;  3KPH A;  2L4M A;  4XOT A;  5C4J J;  3S2D J;  1XD7 A;  1X3U A;  4A5N A;  1LB2 A;  1ZHF A;  1QZZ A;  5LFA A;  3S32 A;  4HF2 A;  2KQR A;  4PSW A;  2FA5 A;  2FE3 A;  4HQM A;  1K6Y A;  1SAU A;  5FGM A;  4IQJ A;  3KEO A;  4NQW B;  3OIQ A;  3OIP A;  2WAF A;  2NNN A;  2LC2 A;  4PSX A;  4AYB N;  2FQ3 A;  1JJ6 C;  3F6V A;  2GXG A;  2P6S A;  3Q0U A;  3E5Q A;  2DA6 A;  3GFJ A;  4N0B A;  3VEP A;  3NAR A;  4NB5 A;  1A6Q A;  1FP1 D;  2D5V A;  3A01 B;  4A93 J;  4ETS A;  4K2E A;  1TT5 B;  3CCS I;  4BAC A;  1O3S A;  1SD7 A;  1V55 H;  3K70 C;  3OYG A;  2R93 J;  4UUS B;  4N4N B;  4OMY A;  4KIC A;  3W6K B;  1GVJ A;  2JA7 J;  4L9J A;  4IX7 A;  2DA5 A;  3BRO A;  3RKW A;  4BHC A;  1A6I A;  2W00 A;  2QCO A;  3HZJ A;  3K4K A;  2K3F A;  5AIQ A;  3C2G A;  2V6E A;  2QEN A;  2K9S A;  3R6S A;  2XGC A;  5J1Y A;  3ZMT A;  1RUO A;  5LEJ A;  5J6X A;  1HW5 A;  1VQK I;  5LRS A;  2HOS A;  5E1X A;  3LSI A;  3BZK A;  4ZTJ A;  1TP4 A;  1S3J A;  1JT6 A;  4E7L A;  5DD8 A;  4FCY A;  2K27 A;  4ZZL A;  2EQR A;  3F21 A;  1JHF A;  4KIF A;  3HOT A;  2YPR A;  1F4K A;  4WWC A;  3MVP A;  1BR2 A;  4FQG A;  4RMN A;  3FXM A;  5CVJ A;  3IKT A;  1X2N A;  1W7P D;  3HPG A;  3E3V A;  4DQ2 A;  1E2X A;  4YFN F;  3I5U A;  2HR3 A;  1GHC A;  1MNE A;  5KK1 A;  1WJ5 A;  4M3D A;  2R7W A;  1QRY A;  3MAJ A;  2LSO A;  3ERM A;  3LA7 A;  4XKB A;  2O03 A;  1P2F A;  1IAW A;  1SFE A;  2BOL A;  3BP8 A;  4NQW A;  4IHT A;  3GFL A;  2EFN A;  1KGS A;  4WX9 A;  3LMM A;  4MTD A;  3MEX A;  2DFI A;  1EH8 A;  2EB7 A;  4C3I J;  4CCO A;  3A01 A;  1VQP I;  1FYK A;  3M9A A;  4Z2Y A;  1J0R A;  4GDF A;  3S8P A;  3H92 A;  4UUS A;  2HI3 A;  4UXN A;  3L2U A;  2V26 A;  1F5T A;  1IRX A;  3OR1 C;  2OAZ A;  2MSY A;  3OYC A;  1HDP A;  3GFI A;  2L9R A;  2MLG A;  5F6F A;  4I6Z A;  3HDD A;  1X2M A;  4BQA A;  1SFK A;  2A68 F;  3I55 I;  2M0C A;  4ZYE A;  2DTR A;  1BJZ A;  2M4G A;  2OBP A;  1OIS A;  3H5A A;  4EM0 B;  2WY8 Q;  3I59 B;  2PMH A;  2KIQ A;  1IV8 A;  2K02 A;  3S15 J;  3EQL F;  1IF1 A;  2X1C A;  3K6G A;  1FYL A;  2NYX A;  2OQR A;  2W85 A;  2C6Y A;  1BW5 A;  4A3E J;  1USS A;  2LKS A;  2P81 A;  1QO0 D;  4U87 A;  1MMA A;  3C1D A;  3S16 J;  5J3L A;  1GLN A;  4CSW A;  5FKM A;  5IYC J;  3CLO A;  1OCR H;  2DQR A;  1NH3 A;  5H6Q A;  1U78 A;  3PUF A;  2EIN H;  3SZP A;  3LFU A;  4FX0 A;  4L0Z B;  3F22 A;  2XPU A;  3EPZ A;  2DOE A;  5CKT A;  3P7N A;  2ISY A;  2M4K A;  1G3T A;  2DOD A;  4CA0 A;  1LNW A;  4BYY A;  1MBK A;  3ZQC A;  3I54 A;  1WJC A;  1N75 A;  3LL7 A;  3ZRG A;  2IVM A;  1DU0 A;  4HEA 2;  4CZZ A;  4RGR A;  3ECH A;  3M7G A;  2F48 A;  4P9U A;  1W36 C;  2VXD A;  4XIC A;  4F93 B;  2RVC A;  4CGZ A;  2RAE A;  3R4K A;  2CMP A;  3HHG A;  1G2H A;  5ICG A;  3SHF A;  2XB0 X;  2UWM A;  2LYC A;  2VJI A;  1FBS A;  5FRN A;  2BVL A;  1Y39 A;  1TQP A;  4HLX A;  5E8I A;  3QAH A;  2ELH A;  3Q3S A;  2DFH A;  2DPD A;  2ZCW A;  4EGZ A;  2FUG 2;  2GOX B;  1IRF A;  1BR1 A;  3ZMZ A;  4EV0 A;  3JRD A;  2M7B A;  1IV6 A;  2AXL A;  1P9Q C;  1QVT A;  3M1E A;  4BE2 A;  2E35 A;  1R6R A;  2VI6 A;  1E3P A;  2HDW A;  1DPR A;  3DWL E;  1U5T B;  1VZ0 A;  2PBI A;  3BG7 A;  1MMN A;  3ECO A;  2FBI A;  4AC0 A;  4KIG A;  3I59 A;  1ZG3 A;  2Z9O A;  2CU7 A;  2RC4 A;  3G1L A;  4B3X A;  3ZQH A;  3L2R A;  1YYV A;  2JVH A;  4RM2 A;  2X6O A;  3MKZ A;  4XMY A;  4YG2 F;  3GME A;  3K0L A;  3IH3 A;  3QQA A;  5HDG A;  3ZCO A;  3CQZ J;  1R00 A;  3HOU J;  1SFO J;  4XKC A;  3K7A J;  1X1P A;  1IUF A;  4KIS A;  2DA3 A;  1DPU A;  2WV0 A;  3KP5 A;  3EUK L;  4L9T A;  3CDI A;  1HQC A;  1GV5 A;  3DQV C;  5EGO A;  2HQA A;  3M4O J;  1I39 A;  2LRE A;  4UV8 A;  2Q8K A;  1MSE C;  4ESJ A;  3DV8 A;  3HRU A;  3QYF A;  1HSJ A;  4EAT A;  2VJ4 A;  2IW5 A;  1SMY F;  5HDK A;  1WKM A;  1XGM A;  2A05 A;  2PI0 A;  4DYQ A;  2ISZ A;  3W2A A;  2JA8 J;  4P9F A;  1Y56 A;  3QWL A;  2ZC2 A;  4AVZ A;  4BBS J;  3FBI B;  4CCL A;  5J8C A;  4JX4 A;  2X0L A;  2DO7 A;  2ZXH A;  1WJB A;  4MEX F;  1RRJ A;  3MZH A;  4RB1 A;  4AM3 A;  4Y7N J;  2YSR A;  3FF5 A;  4A0X A;  5M3M J;  3V8J A;  3CMA I;  2CV1 A;  2G7H A;  4R8H A;  5IOZ A;  3UR3 C;  2DW4 A;  3PO2 J;  3LSK A;  4F52 A;  3C2H A;  2DT5 A;  2KT0 A;  2DMT A;  3M07 A;  5E17 F;  1H9T A;  1UEL B;  1J59 A;  2L2O A;  4P5O A;  3HOS A;  3N4M A;  2GAU A;  4PGH A;  4EQQ A;  3S14 J;  3OS0 A;  1U5T A;  2GA2 A;  3HRS A;  4GYI A;  2W7N A;  4M3B A;  2DA7 A;  2E1C A;  3PQJ A;  5L3F A;  4KN4 X;  4XOR A;  4HPQ A;  4MFD A;  1UMQ A;  2MD0 A;  2E1N A;  3E0J B;  1R58 A;  2H94 A;  3OR2 C;  3OYA A;  1GV2 A;  3AG1 H;  2AHQ A;  3WGH A;  1SEU A;  2HQ5 A;  5J4Y A;  2O3F A;  2JVG A;  3OS1 A;  2ZNZ A;  1HDD C;  3HYI A;  3CP2 A;  2L7M P;  3GLL A;  3L7W A;  3BDD A;  5FFZ A;  1JUP A;  2Y31 A;  3E1S A;  1TWA J;  1RKW A;  4CYC B;  2LDU A;  4NHJ A;  4E7I A;  2P0W A;  3OS2 A;  3BPV A;  3F8M A;  3WTV C;  4XLF A;  5HNF A;  3FBN B;  1FZP B;  1ETY A;  4I99 C;  4KMU X;  5DTD A;  1MDM A;  1ON2 A;  4EJO A;  2DFE A;  2KP6 A;  4KUM A;  3GTM J;  3BJA A;  3OMY A;  1HCR A;  2BYV E;  5ICE A;  4LB5 A;  3NEU A;  1HST A;  2KIM A;  4AIJ A;  1MH3 A;  3KX2 A;  1U8B A;  1LJ9 A;  5F04 A;  4RLF A;  1XGN A;  4LIV A;  5GAG J;  1DQU A;  4N9I A;  1Z1D A;  2A5Y B;  2XC7 A;  1LFP A;  1S72 I;  3IWF A;  3JW4 A;  3H9G A;  3CCL I;  1UAA A;  2XRN A;  1Z77 A;  2BY0 A;  1IG7 A;  1OJL A;  2LLK A;  4NC7 A;  1XMK A;  3R0J A;  5DCM A;  1VFC A;  1QHH D;  1VND A;  2VC1 A;  3K4M A;  2Z5U A;  5ILU A;  4IRI A;  2BW3 A;  1R1U A;  2L7K A;  1U6G A;  1KA8 A;  4XQF A;  3CUQ B;  1LE8 B;  5EJC A;  4LLG F;  1R4N B;  4Q47 A;  1I1G A;  4MIM A;  3BQY A;  1D0X A;  1M1E B;  2FU4 A;  3FM5 A;  4B3A A;  3H1C A;  1YRN A;  5IT3 A;  1Z9C A;  2F6C A;  2MA3 A;  2Z2S B;  3EET A;  3MZ8 A;  5HOO A;  1QA6 A;  4HF1 A;  2JA2 A;  2NVT J;  2VE9 A;  4DBQ A;  1VQ8 I;  5TRD A;  1XDU A;  4IHS A;  1X1C A;  1L3L A;  3K4J A;  3BJO A;  2CYY A;  3V7S A;  3M8E A;  3OY9 A;  1BA5 A;  1Y8R B;  1TWC J;  1Z3X A;  4CYC A;  5B66 C;  4I98 B;  2ZXI A;  1JHH A;  4X6A J;  2BXY A;  2XF7 A;  4CUG A;  1B6A A;  1H8A C;  2K3P A;  2PMU A;  5HLI A;  4JOM A;  2ZNY A;  2GA1 A;  2DA2 A;  1ZG1 A;  3G73 A;  4XLH A;  2A6T A;  3AG4 H;  2O8X A;  4HX8 A;  1JKQ C;  1FWZ A;  2J5O A;  4M6Y A;  1S6L A;  2IEK A;  2JRM A;  1B1B A;  3IV5 A;  3KYD B;  5IYB J;  4OIR F;  2VB6 A;  3FXR A;  2LKP A;  3CCY A;  2R7F A;  2CQK A;  3OYE A;  1LDJ A;  2MBF A;  3LA3 A;  4XN3 A;  1K4T A;  4S04 A;  2R7Z J;  4HX7 A;  4AUX A;  2ZME C;  5KNL A;  3W2V A;  1YLF A;  3PNY A;  5L3C A;  4MO7 A;  1LPQ A;  3CJN A;  2XRO A;  1LFB A;  4LB6 B;  2LRD A;  4ANJ A;  1LE8 A;  1P7J A;  3SFZ A;  4DW6 A;  1BI0 A;  1OCO H;  3ZGK A;  2UXX A;  1WGX A;  3OYH A;  3DTE A;  2IGM A;  1JUM A;  4WXD A;  4RS8 A;  4XRS A;  4HRI A;  3H36 A;  4I2O A;  3Q0V A;  3J7A Y;  2XAQ A;  2Y2Z A;  3E6M A;  5EG0 B;  3CF5 F;  2E71 A;  2HQN A;  4E7S A;  3M1C A;  4WCG A;  4C2T A;  5K7Z A;  1OCC H;  2ZFU A;  1AHD P;  2LY1 A;  3GWZ A;  4ZYD A;  1WJA A;  3L2C A;  1AWC A;  3GFM A;  1GDT A;  4IHY A;  3S2H J;  1TNS A;  1PUF A;  1FJL A;  3G4S I;  1W0U A;  4C9Y A;  2F4O B;  1WI9 A;  3AFH A;  3PUB A;  3RTR A;  3OYL A;  2GWR A;  3CME I;  2LOO A;  1XTA A;  2D1V A;  2P6T A;  2X1E A;  4DBR A;  1IDZ A;  4BL0 B;  2BEO A;  3OSF A;  2CH0 A;  2VPR A;  3MWM A;  1MIJ A;  4O3M A;  1W5C C;  3KE2 A;  4BE0 A;  2JSC A;  2X6Y A;  1KZH A;  2XPV A;  1H0M A;  3MKY B;  3DF8 A;  4IKF A;  2R7O A;  5IT9 Z;  2XAU A;  2HYG D;  2XGE A;  3PNV A;  3HHH A;  3J80 K;  3AL0 C;  4NNJ A;  2XSD C;  2KIU A;  4XSX F;  1QVU A;  1MZB A;  2RRE A;  3LSP A;  1UG0 A;  2IGN A;  3FK6 A;  3HXL A;  2MLK A;  1BR4 A;  4LIU A;  4LOC A;  5JHU A;  1EF4 A;  2I8D A;  2IT0 A;  4A3G J;  4ENM A;  2UV1 A;  4OWR B;  4ZDO A;  1KQ8 A;  3QYE A;  4TV7 A;  4PCQ A;  3T1B A;  3UNG C;  2GXB A;  1BOA A;  1JTX A;  3U1K A;  4J19 A;  5IP7 J;  2K9N A;  3CMY A;  4HOB A;  1AU7 A;  4A3M J;  2ME6 A;  2LFB A;  4DGW B;  4BKX A;  2WAD A;  2YU9 J;  2E5N A;  1Z05 A;  2CFX A;  5KCM A;  4EM1 A;  1YO5 C;  4UUV A;  4Y17 A;  3VOD A;  3OYJ A;  2CQN A;  2L7Z A;  2V7F A;  5GPC A;  1R7J A;  3PIP F;  4CIC A;  5EG0 A;  1Z91 A;  2VL8 A;  1FC3 A;  4GGG A;  3S3O A;  5D5U B;  2H8W A;  2CQQ A;  1IN6 A;  3BOQ A;  3SDB A;  3L1P A;  1TLH B;  4V2G A;  3ABL H;  2V1U A;  1OMI A;  4XID A;  3TO6 A;  5D8K B;  1AA7 A;  1P7I A;  2Y48 A;  1U9N A;  1E0E A;  2HKX A;  1B9N A;  2RN7 A;  4IOC F;  4NC6 A;  1ZGA A;  9ANT A;  4V2F A;  2XAF A;  1VQO I;  3TED A;  4XLC A;  4YFX F;  5FKO A;  2VKE A;  1GXQ A;  3L00 A;  2OU2 A;  4BU2 A;  4I76 A;  3VDX A;  1E3H A;  2MG4 A;  2QQ9 A;  3T8R A;  3HGG A;  2XKP A;  2X6W A;  5E3M A;  4GRI A;  4E7Z A;  1Y1V J;  1R5I D;  2Y30 A;  3PQK A;  1GT0 C;  4L5I A;  2BXZ A;  2DMN A;  2HVS A;  1WH5 A;  1J7K A;  1SD4 A;  1HKQ A;  1Z21 A;  2N8G A;  5DUI A;  5E3L A;  1WRJ A;  5H6R A;  3KZZ A;  2PEX A;  4X0G A;  1ETW A;  3SXY A;  3CJR B;  1B59 A;  4JP0 A;  4MGR A;  1HOM A;  4GCV A;  3CF2 A;  5ERI A;  2PMZ N;  4BXX J;  4BS9 A;  3WU2 C;  3O6B B;  3QPL A;  5IPA A;  1IXS B;  1PVE A;  1ZRC A;  3EUH C;  1Q1V A;  4BQQ A;  3JSO A;  3HM5 A;  4AIK A;  3V7C A;  3RKY A;  3BQZ A;  2OUM A;  3E5X A;  3A0B C;  2VOD A;  1ZAO A;  2DN0 A;  1HC8 A;  1YG2 A;  3WU0 A;  4DZP A;  3JRA A;  4DNC A;  2QKL B;  1ZN2 A;  2DJI A;  3EYY A;  3K1N A;  4LG0 B;  3A0H C;  3IRR A;  4IPA A;  3CP8 A;  3QRF F;  4EJT A;  1AKH B;  2YS9 A;  3S3N A;  4CCM A;  2R7T A;  5EEG A;  2ZBK A;  2L7F P;  2MGQ A;  3F8C A;  4HA8 A;  2KDO A;  4UVA A;  4HZF A;  2A61 A;  3F23 A;  4IO9 F;  2XB5 A;  3OOU A;  1T56 A;  4A2U A;  3HGY A;  1W5S A;  3DLL F;  2P7C B;  4DYC A;  4BHB A;  4DYR A;  4U7D A;  1XX5 A;  4P1W A;  4G94 A;  3RKX A;  4A3B J;  1O7F A;  1ZYR F;  1A36 A;  5GPA A;  2KKO A;  2RQQ A;  5EEH A;  5L3G A;  1TWH J;  1IRZ A;  2JWT A;  2OF7 A;  1IZ1 A;  1RC9 A;  4D7M A;  5DCF A;  3GZN B;  1J09 A;  1KU2 A;  3MFK A;  1MBG A;  3CJQ B;  2CUF A;  3Q9S A;  2BVM A;  3I4P A;  3FDY A;  3CDL A;  3DPL C;  3FIS A;  1RZ4 A;  2COM A;  3H3V K;  1MBJ A;  1O3T A;  3S2W A;  5FFX A;  3KET A;  5FRO A;  1RR7 A;  4A69 C;  4LFU A;  3BR6 A;  3WG7 H;  2R7Q A;  1PP8 F;  4MEY F;  1ONV A;  1BOB A;  2L9N A;  4A6E A;  2LVS A;  2ETH A;  3CCV I;  4YRV A;  3UKG A;  3FXK A;  1ZLJ A;  4BQO A;  3HBL A;  3KEY A;  3I4N J;  5J40 A;  3LFK A;  4PFO A;  4DJA A;  4PJL A;  2M34 A;  2X4H A;  4H0E A;  2MH2 A;  5GAH J;  3DKX A;  2TDX A;  1FTT A;  2LD5 A;  3GLX A;  2XAH A;  3SZG A;  3BTC A;  1REP C;  3WOD F;  1KON A;  4A0Y A;  2Z16 A;  5E1Z B;  3BZ6 A;  4OIN F;  2R3S A;  5B1A H;  2HXI A;  5L3D A;  4LG0 A;  2LNB A;  3IP4 B;  4G12 A;  1RES A;  5CVR A;  5FB2 A;  1AKH A;  4G6Q A;  5K5Q A;  2R92 J;  5HDN A;  2YU3 A;  4BHP A;  2RQP A;  3HKZ N;  3WU1 B;  5DEQ A;  2CO5 A;  2CUZ A;  1ITY A;  2M7A A;  4ITV A;  3RPU D;  3G71 I;  2JN6 A;  1FMV A;  3CUO A;  4LLL A;  3FMS A;  2K9L A;  2NAZ A;  2DU9 A;  3BPX A;  2VXZ A;  3G6E I;  2DT6 A;  4C30 A;  5M5Y J;  4X1E A;  2DCE A;  2HEO A;  2V1X A;  2HVR A;  4J00 A;  4C3H J;  2HDC A;  5DD4 A;  1TC3 C;  2QSG X;  3F0C A;  5LGU A;  1FEX A;  1XB4 A;  3GW2 A;  4PK4 A;  3OYD A;  2HTS A;  4JBA A;  1O57 A;  2CQX A;  3P5J A;  3ZN0 A;  1L0O C;  3J7A O;  5DYM A;  2M9H A;  3O3K A;  2CV0 A;  3K1M A;  3A02 A;  5KAF C;  4XLE A;  1WFX A;  4ZYH A;  5JVG F;  1XS9 A;  3ZPL A;  4CCJ A;  3L9F A;  3CLQ A;  5E79 C;  2Q0O A;  3BTL A;  1EH7 A;  1FOY A;  5JHF A;  3PJR A;  2XAG A;  4BJ5 C;  3CZ6 A;  1HW1 A;  4UY8 I;  2M5W A;  1F9N A;  2AQF A;  1W1W E;  2ZME B;  2K86 A;  2DBB A;  3J81 K;  1UFM A;  2VAS A;  5LGT A;  1LFU P;  2IGK A;  2HOE A;  3C7J A;  3PFY A;  1W4M A;  3DPT A;  3NRV A;  3CES A;  3DEU A;  3KCC A;  4QIW N;  2NVY J;  2OTJ I;  4B47 A;  3FXQ A;  3WTX C;  4BXU A;  3HJE A;  2P4W A;  2YUS A;  2EH3 A;  2X1D A;  5CVU A;  3S1M J;  2COB A;  4ZYA A;  3OYM A;  4M9Z A;  1X58 A;  5EGO B;  3B73 A;  4FHT A;  4AWX B;  4LGW A;  2CUJ A;  3ELK A;  2EIK H;  5F0H A;  2HQR A;  1WJE A;  3FK7 A;  1ZRD A;  3WE3 A;  2OCC H;  2XVC A;  2M30 A;  4KT6 A;  3F3X A;  2I10 A;  2WC2 A;  4PZJ A;  5CQE A;  1Z7U A;  4U0W A;  2A07 F;  5HS7 A;  2HOT A;  1V3F A;  1YOV B;  1T0F C;  1P4W A;  3IAM 2;  5D8L B;  5F1R A;  2HU9 A;  2JTV A;  2JRT A;  2UXN A;  2VOP A;  1I3A A;  2H09 A;  5D5V B;  4KNY A;  3N05 A;  3BG5 A;  3CD6 I;  1S7E A;  3RQ4 A;  2OQG A;  4G6T B;  3SJM A;  4G7H F;  3AG3 H;  1RUN A;  3ESW B;  3ZMD A;  4XN0 A;  2E5Z A;  2E2I J;  4IEJ A;  3RJP A;  4C2M J;  2V79 A;  2FNA A;  2JPC A;  4A3D J;  3PO3 J;  5F27 A;  1DGR M;  1XDS A;  2LK2 A;  5E18 F;  1U0J A;  4G6D A;  2LY9 A;  1LEA A;  3W6V A;  3VYU B;  4D9J A;  1TTY A;  3AL0 B;  2HVQ A;  4GXO A;  3EUA A;  4Y3O A;  2CGP A;  2R7S A;  2BY3 A;  2ICW G;  3OYI A;  5BMZ A;  1R5G A;  3MN2 A;  3ZQG A;  3HOW J;  2ZME A;  1U9O A;  2XPW A;  5BPD A;  2VJJ A;  5DM6 F;  1OKR A;  2STT A;  3BY6 A;  2HXO A;  2XAS A;  2R7X A;  4Y15 A;  3SYT A;  1VQN I;  3G2B A;  1YX5 A;  2MH9 A;  3J80 Z;  2JQ7 A;  2GXA A;  4XKV A;  2M0M A;  2B7E A;  3H5N A;  1FBQ A;  3JRB A;  3BCB A;  2E1M C;  5KAI C;  2WB1 A;  5JI6 A;  3KLO A;  2V1D A;  1ETX A;  3DBH B;  2CRG A;  3DLA A;  4FE7 A;  2E2J J;  2QEX I;  1A04 A;  3F8N A;  2F4M B;  2VOO A;  3ABM H;  1MDM B;  4L18 B;  1VQ6 I;  4NDL A;  1PUE E;  3FXU A;  3BTI A;  3IH4 A;  2HFH A;  5E20 A;  2YR2 A;  5F08 A;  2ZJP F;  4ZDP A;  2WY7 Q;  1VQ9 I;  1FT9 A;  4F55 A;  4LK1 F;  3TKY A;  1BBY A;  5B3S H;  4ASN A;  1IXR C;  4FIS A;  1NTC A;  1TT0 A;  2M8G X;  1FOW A;  4RB0 A;  2JT1 A;  2LR8 A;  2AXT C;  1VQ5 I;  3GTP J;  4L5E A;  2WAQ A;  4QPQ A;  3CCM I;  5LHG A;  4FET A;  5E8G A;  3RYR A;  4PDK A;  1KU9 A;  1WJF A;  2VN2 A;  5CYV A;  1QGP A;  4IVN A;  5DCM B;  5J1U A;  3JRH A;  4PUS A;  2IXS A;  4EM2 A;  2BW3 B;  3T5X A;  1OR7 C;  3FHN A;  1FSE A;  3KP6 A;  4BJT A;  4ABZ A;  4L9V A;  3H9Q A;  3RKQ A;  2WA0 A;  3BTJ A;  2K9Q A;  3ZMS A;  1A35 A;  1BI1 A;  2G7U A;  2L9S A;  1D8J A;  3T0Y A;  2PJP A;  1R5H A;  2ID6 A;  2NVX J;  1JJ8 C;  2LF7 A;  1YRN B;  1H89 C;  1K61 A;  3WGG A;  1MJA A;  1FOX A;  4XSZ F;  4I01 A;  3BR5 A;  4IQ4 A;  4IRH A;  5K7H A;  1BC8 C;  1SVL A;  3GUD A;  2OPT A;  4D1Q A;  5J4V A;  2KMU A;  5JLX A;  1D1A A;  3DKY A;  1VTN C;  3I71 A;  2BHY A;  3DXJ F;  2GIV A;  3RCO A;  1UG2 A;  4RGU A;  1Y0U A;  2RGV A;  1ZRF A;  4O5V A;  1B8I B;  2E60 A;  3WTS C;  4RAZ A;  1J75 A;  2IS2 A;  2MC4 A;  2XIG A;  3KP3 A;  4W97 A;  3LST A;  1TWF J;  4ESB A;  1P92 A;  3S3M A;  3C2B A;  2QWW A;  2V1N A;  2QQA A;  1CGP A;  3R61 A;  1ULY A;  3MZY A;  1JXS A;  1SVM A;  3KIO A;  2ESH A;  5HVQ C;  4MQV A;  4OOI A;  4F91 B;  3GTO J;  1Y6I A;  4A3I J;  1H88 C;  2DI3 A;  3BG9 A;  2BY2 A;  2F5C A;  4GO1 A;  3FKJ A;  1SFU A;  4Y33 A;  4B48 A;  5HLH A;  5BOX A;  1BIA A;  1P4X A;  3HOX J;  4LLN A;  2VIX A;  2HKO A;  3DP7 A;  1BC7 C;  3RIR A;  1SD5 A;  2O9L A;  2H1K A;  2XKO A;  2VQL A;  5B1B H;  1KU3 A;  2VBX A;  1QZY A;  4O6J A;  1GXP A;  1DP7 P;  3MKL A;  3H5R A;  3TGN A;  3M8F A;  4C3J J;  4A12 A;  3CJT B;  1WI3 A;  3EUH A;  1O3Q A;  2EIM H;  3WHC A;  4NBQ A;  4RGX A;  2JK3 A;  4CYD A;  2EA2 A;  1FSH A;  3HUG B;  2WV1 A;  2EFW A;  1B9M A;  3JRE A;  2E7W A;  4HW0 A;  4NUB A;  3U21 A;  1XN7 A;  2FBK A;  1MW7 A;  5ED4 A;  2HZD A;  2LMD A;  4ZZD A;  4BE1 A;  3J7Z I;  4DOZ A;  3JAM K;  4A3F J;  1PUF B;  2BV6 A;  3V7R A;  2DDA A;  4YEL A;  4B1R A;  1MD0 A;  1JGS A;  1B8I A;  2R7R A;  3K10 A;  1PDN C;  1X19 A;  1K4S A;  1ACI A;  1G8X A;  4IXA A;  4BAY A;  2X51 A;  1C0W A;  4XM3 A;  5ICC A;  2LKX A;  4ON0 A;  4RLQ A;  1ZTR A;  1XMA A;  4M3E A;  3E6D A;  3E7L A;  3KLN A;  2K4J A;  1I3Q J;  1B4A A;  2P7V B;  4G7Z F;  1S7A A;  4B09 A;  2NXN B;  3Q9V A;  2CJJ A;  1LDK B;  4DZJ A;  1ZH5 A;  1YW9 A;  3FXL A;  2DAO A;  1J9I A;  2HPM A;  3IUO A;  2CW8 A;  4OU0 A;  1ZR4 A;  1T95 A;  1TWG J;  1RNL A;  2DJN A;  4B4C A;  2DK8 A;  4I7H A;  4MHG A;  3I64 A;  6PAX A;  3WE2 A;  2MD5 A;  3JTH A;  3SEZ A;  2JZY A;  1WHU A;  2PX9 A;  4II3 A;  2VJ5 A;  1TL8 A;  1TNT A;  2QSF X;  1NG6 A;  1D1B A;  3HRM A;  4B44 A;  2FSW A;  3F8B A;  2QUF A;  2Y0S N;  1G3Y A;  1JI8 A;  3GCM A;  4BEH B;  2FQ4 A;  3N97 A;  3IHU A;  4IHW A;  3TP3 A;  2FRH A;  3SQN A;  4N9H A;  2WBM A;  2ID3 A;  2K5C A;  3LSJ A;  3JTG A;  1T8I A;  3NWS A;  5FLX K;  1V5F A;  4ZDL A;  1I50 J;  3IRQ A;  3CO7 C;  2VKV A;  3G1M A;  4RM3 A;  3HUG A;  2BY1 A;  4RB2 C;  3HSF A;  1QNT A;  3I9V 2;  5TIS C;  5DDG A;  1YW7 A;  2ZXJ A;  1MMG A;  1ODD A;  5F64 A;  3LQQ A;  1TBX A;  2M8E A;  2H6B A;  2M3A A;  1SMT A;  2HNH A;  1WQ2 A;  1ZK8 A;  2EZL A;  3H3Z A;  1DDN A;  1YQA A;  2DLL A;  4EJU A;  1DUX C;  2HS5 A;  2QBY B;  1IN7 A;  1IN8 A;  4I02 A;  2TRT A;  3OOP A;  5D4R A;  4WF2 A;  2PLY A;  3S17 J;  2VPL A;  3COA C;  5IYD J;  4BY1 J;  4UUT A;  3R0A A;  2EPF A;  5DM7 F;  3KYL A;  5TGT A;  2PG4 A;  3RZD J;  3ABT A;  4JQF A;  1STZ A;  3DKW A;  3HOV J;  4A3L J;  2KJB A;  4YIF A;  1IC8 A;  4ZTF A;  3TOB A;  4BXF A;  4JX6 A;  1X4P A;  3S1R J;  1XCV A;  5EZG A;  1JTY A;  3IWZ A;  1Z0X A;  1EH6 A;  3K2A A;  1RET A;  2ZXW H;  3GXO A;  4AID A;  1T6S A;  2EV0 A;  3K4L A;  3EYI A;  3GTQ J;  3TL4 X;  2R0Q C;  1BI2 A;  4HYE A;  4B43 A;  1NK3 P;  2DK5 A;  3LAJ A;  1YTY A;  1QZE A;  3MCZ A;  1LKX A;  1S29 A;  4UB8 C;  2A69 F;  5M5W J;  2DMP A;  1ZGJ A; 
#chains in the Genus database with same CATH homology
 3KEY A;  3F9K A;  4DJA A;  4PFO A;  2FUG 2;  2GOX B;  3K4N A;  1OLT A;  1BR1 A;  4PJL A;  4II2 A;  1V5E A;  2M7B A;  2MFZ A;  1P9Q C;  3DKX A;  2VQH A;  3HG9 A;  4BE2 A;  3SZG A;  1R6R A;  2Q1Z B;  4BEH A;  1KON A;  2HDW A;  2XSJ C;  3DWL E;  2Z16 A;  1VZ0 A;  3BG7 A;  3GBG A;  1MMN A;  3PSF A;  4AYB A;  2R7U A;  3I3L A;  3K4C A;  4B3X A;  2LH9 A;  3IP4 B;  3L2R A;  2JVH A;  1Z7L A;  4XR6 A;  2X6X A;  4RM2 A;  3VSL A;  3MKZ A;  4XMY A;  1X1A A;  4CH7 A;  3HPH A;  3K70 D;  3ZCO A;  2HPI A;  4XKC A;  4E4H A;  2CUZ A;  2E1M B;  3LSM A;  4KIS A;  2M7A A;  4HST A;  4ITV A;  2A5W A;  3RPU D;  3H0D A;  1FMV A;  4FAS D;  2K9L A;  4DIQ A;  2VXZ A;  3EUK L;  4BQN A;  2DT6 A;  1LVK A;  3DQV C;  4C30 A;  2HQA A;  2DCE A;  4XON A;  2HVR A;  3OYK A;  2LRE A;  4J00 A;  2CW7 A;  4NC8 A;  3QYF A;  4EAT A;  2IGO A;  2VJ4 A;  4PK4 A;  3W2A A;  2OC6 A;  1Y56 A;  3OYD A;  4AVZ A;  4XLA A;  3L2W A;  2VKH A;  2LY2 A;  3FBI B;  3H9J A;  3VYS B;  4CCL A;  1WJD A;  1S9H A;  2ZXH A;  2CV0 A;  1WJB A;  4XLE A;  1V5G A;  1WFX A;  2KL4 A;  2CV1 A;  4OAY A;  2MAB A;  4CCJ A;  3UR3 C;  2IS4 A;  3LSK A;  3HKZ A;  4F52 A;  3BLY A;  3C2H A;  3K4B A;  5JHF A;  3PJR A;  1UEL B;  4BJ5 C;  3CZ6 A;  3MD2 A;  2L2O A;  4P5O A;  4KJZ A;  3HOS A;  2AQF A;  1EA3 A;  4KIT B;  1ZEL A;  1FMW A;  3OS0 A;  4HSR A;  2VAS A;  2W7N A;  2IGK A;  4XOR A;  4HPQ A;  3PFY A;  2XF5 A;  2MD0 A;  3DPT A;  5CQG A;  3E0J B;  3CES A;  3OR2 C;  3DU6 A;  3OYA A;  3OL3 A;  1YE9 A;  3D5S C;  4B47 A;  2VLA A;  2AQE A;  2R4G A;  5CPR B;  3BC8 A;  2JVG A;  3OS1 A;  1D0Z A;  2X1D A;  3CP2 A;  3HL2 A;  4ZYA A;  3OYM A;  3E1S A;  3W2W A;  2PMZ A;  1TZL A;  2P0W A;  3OS2 A;  2CUJ A;  4E7I A;  3DTI A;  1WJE A;  4XLF A;  2W82 A;  5HNF A;  3FBN B;  4E7H A;  2Z1D A;  3PNT A;  4KT6 A;  4HNT A;  5CQE A;  2KP6 A;  2DT7 B;  4E6K G;  4XKW A;  4BUP A;  3OMY A;  2KRC A;  1T0F C;  4Y4R A;  3PL8 A;  2Q2E B;  3IAM 2;  2HU9 A;  2L5Q A;  1G59 A;  2IS1 A;  3KX2 A;  2CS3 A;  3DTK A;  3N05 A;  4RLF A;  4LIV A;  3ZXS A;  1HA8 A;  2X85 A;  4XNF A;  1DQU A;  3M8J A;  3W3C A;  1NG7 A;  4G6T B;  2K9M A;  3RQ4 A;  4BDZ A;  2XC7 A;  1LFP A;  3ZR8 X;  4XN0 A;  2E5Z A;  1X4O A;  3H9G A;  5LD2 C;  1UAA A;  4CZC A;  4NC7 A;  1DGR M;  1QHH D;  4XL9 A;  4HG2 A;  1U0J A;  3K4M A;  2BW3 A;  2L7K A;  1ERD A;  3VYU B;  4D9J A;  3AL0 B;  3IAS 2;  2HVQ A;  4XQF A;  4Y3O A;  3EUA A;  2UUZ A;  2R7S A;  3OYI A;  2JUG A;  4LIT A;  4OAZ A;  4BDY A;  1W36 D;  1QHG A;  4PJN A;  2ZSI B;  2VJJ A;  4PFP A;  1D0X A;  1QU3 A;  2R7X A;  2IS6 A;  3SYT A;  2F6C A;  3G2B A;  1YX5 A;  2Z2S B;  4QPO A;  2F5V A;  4CCN A;  5HOO A;  4XKV A;  2M0M A;  3H5N A;  4ZC3 A;  3BCB A;  2E1M C;  5HLT A;  2JA2 A;  2WB1 A;  4DBQ A;  3DLA A;  1X1C A;  3K4J A;  4PJM A;  1X1D A;  3DU5 A;  1PJR A;  3QOE A;  3OY9 A;  1Z3X A;  2PJR A;  2ZXI A;  2W1O A;  3L2Q A;  2XF7 A;  4ZDP A;  4CUG A;  3LSH A;  1DGW Y;  3DPU A;  3V42 A;  2K3P A;  2WY7 Q;  4F55 A;  4LG3 A;  4JOM A;  2XF6 A;  2KRH A;  1TT0 A;  2DOA A;  4XLH A;  2A6T A;  2RNG A;  4U7B A;  1D1C A;  4E7J A;  1DP3 A;  3S93 A;  2V9K A;  2WAQ A;  4QPQ A;  4J01 A;  2MYS A;  4FET A;  1N78 A;  1WJF A;  4YEJ A;  4IZZ A;  2VB6 A;  3BG6 A;  4BJ6 C;  4PUS A;  2IXS A;  2BW3 B;  3OYE A;  1X1B A;  2CV2 A;  1OR7 C;  3OL4 A;  4XN3 A;  2O5R A;  3FHN A;  4BJT A;  2LBF B;  2QKM B;  3H9Q A;  5KNL A;  3W2V A;  2WA0 A;  3PNY A;  4R79 A;  2DXI A;  2L9S A;  2LRD A;  2JSP A;  2V4J C;  4ANJ A;  1Z3Y A;  2KPM A;  2CFO A;  2LG4 A;  4IQ4 A;  3ZGK A;  4F3Q A;  3OYH A;  3DTE A;  2IGM A;  4HRI A;  3J7A Y;  4MLO A;  4D1Q A;  4E7S A;  2KMU A;  3M1C A;  1D1A A;  3DKY A;  4C2T A;  3VYT B;  2ZFU A;  3SEQ A;  2LY1 A;  3A2K A;  2PJR B;  1WJA A;  3RCO A;  2GOM A;  3BCA A;  3D5L A;  2E60 A;  3D5R C;  4AU7 A;  2VQC A;  4XOT A;  2IS2 A;  2MC4 A;  4C9Y A;  5LFA A;  3AFH A;  3PUB A;  3S32 A;  2KQR A;  4PSW A;  3RTR A;  3OYL A;  3S3M A;  2LOO A;  2V1N A;  1K6Y A;  1SAU A;  4IQJ A;  3TBI A;  2X1E A;  4DBR A;  4NQW B;  3OYN A;  5HVQ C;  3OIQ A;  3OIP A;  4HNU A;  4F91 B;  2KHM A;  2WAF A;  4BL0 B;  4PSX A;  2LC2 A;  3CMM A;  2CH0 A;  1Y6I A;  4BE0 A;  3A1Y A;  2X6Y A;  3ONQ A;  3MKY B;  4IKF A;  5HNH A;  4BAC A;  3FKJ A;  4Y33 A;  2R7O A;  4B48 A;  2XAU A;  3OYG A;  3K70 C;  4N4N B;  4F92 B;  3PNV A;  3AL0 C;  4NNJ A;  3HC7 A;  3TMO A;  2RRE A;  2VIX A;  4IX7 A;  1UG0 A;  2IGN A;  2LBF A;  3HXL A;  2W00 A;  1BR4 A;  4LIU A;  2VQL A;  3K4K A;  2I8D A;  3C2G A;  2V6E A;  2UV1 A;  4OWR B;  4ZDO A;  3QYE A;  3UNG C;  1YX3 A;  3H5R A;  1MND A;  3OYF A;  4DGW B;  2WAD A;  5FRM A;  2E5N A;  5KCM A;  2KZV A;  3LSI A;  3OYJ A;  2V7F A;  4ZTJ A;  3HUG B;  4E7L A;  2VL8 A;  3S3O A;  4C2U A;  3SDB A;  3HOT A;  4NUB A;  3U21 A;  1MW7 A;  1AA7 A;  2HZD A;  3H35 A;  4BE1 A;  1E0E A;  1BR2 A;  4DOZ A;  4RMN A;  3MMY B;  4N4O B;  3HPG A;  4YEL A;  4XLC A;  2R7R A;  2R7V A;  3K10 A;  1MNE A;  1X19 A;  1WJ5 A;  1G8X A;  2R7W A;  2X51 A;  4XOP A;  2NOJ B;  4BU2 A;  4XKB A;  3VDX A;  3A4C A;  4XM3 A;  2BOL A;  2X6W A;  4RLQ A;  4GRI A;  1N77 A;  4E7Z A;  4H4K C;  3LMM A;  2HVS A;  4ZJZ A;  1D0Y A;  4PJJ A;  1Z21 A;  3LSG A;  1LDK B;  3OWT A;  4CCO A;  3OYB A;  4X0G A;  2HPM A;  2KLO A;  3IUO A;  2CW8 A;  3QOD A;  3S8P A;  2OV7 A;  1T95 A;  3CJR B;  2VKD A;  3L2U A;  2V26 A;  3CF2 A;  1IRX A;  3OR1 C;  3VSK A;  2W4S A;  4BS9 A;  3OYC A;  3SEZ A;  4BGD A;  4II3 A;  3EUH C;  1SFK A;  2VJ5 A;  4BQQ A;  4B44 A;  1NG6 A;  1D1B A;  1JI8 A;  2VQG A;  4BEH B;  4CCK A;  2M4G A;  3H5A A;  2OUM A;  2WY8 Q;  2WBM A;  2QKL B;  2K5C A;  2DJI A;  3NWS A;  1V5F A;  4ZDL A;  3ZQQ A;  2XDV A;  1PYV A;  3CP8 A;  2X1C A;  3K6G A;  4RM3 A;  3I9V 2;  4U87 A;  3S3N A;  1MMA A;  4CCM A;  2R7T A;  1MMG A;  1GLN A;  4CSW A;  3L2V A;  3VWB A;  5KHD A;  2M3A A;  2HNH A;  2KDO A;  4E7K A;  3OOU A;  3NWT A;  3LFU A;  4P1W A;  3EPZ A;  2VPL A;  5CKT A;  3PSI A;  2M4K A;  4CA0 A;  3AKZ A;  2RQQ A;  1WJC A;  3KYL A;  1N75 A;  3LL7 A;  5TGT A;  3ZRG A;  3VYR B;  4HEA 2;  4JQF A;  1J09 A;  3CJQ B;  4ZTF A;  2VXD A;  1W36 C;  4F93 B;  2WAE A;  2BVM A;  2CMP A;  4BXF A;  1X4P A;  1MMD A;  2Y0S A;  3FDY A;  3DPL C;  3DEE A;  2ELJ A;  3MKW B;  3RSN A;  2ZSH B;  5FRO A;  2UWM A;  3K4L A;  2LYC A;  2VJI A;  3TL4 X;  2R7Q A;  5FRN A;  2BVL A;  4B43 A;  1BOB A;  2L9N A;  2F4I A;  1LKX A;  4YRV A;  4BQO A;  3QYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...