4BEHB

Solution structure of human ribosomal protein p1.p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords 60S ACIDIC RIBOSOMAL PROTEIN P1
publication title Solution Structure of Human P1P2 Heterodimer Provides Insights Into the Role of Eukaryotic Stalk in Recruiting the Ribosome-Inactivating Protein Trichosanthin to the Ribosome.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00428 Ribosomal_60s 60s Acidic ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4behB01
3A1YA 4BEHB 2W1OA 2LBFB 4BEHA 2LBFA
chains in the Genus database with same CATH superfamily
4FX0A 4FTHA 1QBJA 1YIOA 2GM4A 2JSCA 1VI0A 3ABKH 4LG3A 1N25A 1Z6TA 4DIQA 2CW8A 1PUFB 3RDIA 1QVTA 1XMXA 3FM5A 3IRRA 3AG4H 4XSXF 1I1SA 3LSIA 2K27A 1Z7UA 2P5VA 3DU6A 2AS5F 3FXKA 5JHFA 2X1DA 1J75A 2DA3A 3M8EA 4NQWA 2WTEA 1MMAA 3NRVA 1AKHA 3OIOA 4BS9A 3JR9A 4CCOA 5GAHJ 5BPDA 5BQTA 2LMDA 1IUFA 1HDDC 3AL0C 3QYFA 5CQEA 2BHYA 4OOIA 4O5VA 3MZHA 1TP4A 3JRHA 3OYHA 2PLYA 3K4JA 3PJRA 3L2WA 1WQ2A 4KFCA 2GLOA 1HC8A 1ZH5A 1R4NB 2WY7Q 4A3FJ 2JRMA 2K9LA 2MLKA 2GAUA 3M07A 3CZ6A 2CS3A 3RZDJ 2NS0A 4BEHB 4Y13A 2DA4A 2V4JC 4BQNA 5F0HA 2X48A 2FU4A 3L00A 3ZMVA 4F3QA 2VONA 4NB5A 3U21A 4UXNA 2IS1A 4DGWB 4J19A 2JWTA 4ZTFA 1LNWA 5FFXA 5JLWA 2X51A 5FKKA 4BE1A 1AOYA 2FEZA 1F43A 5FKLA 1VQKI 1X3WB 1ITYA 4A3CJ 5J4YA 4WK8F 1KGSA 2WAEA 1FIPA 5GTHC 2PG4A 2RN7A 2LKXA 2HVQA 5KNLA 1APLC 4UY8I 3HZJA 2V9KA 5HDKA 4RB1A 4J00A 1TTYA 3VYUB 3C3WA 3GWZA 3HXLA 3JSPA 5KVRA 2PFBA 4G6TB 3LOCA 1Z67A 2F4OB 3OL4A 1U9OA 4WF2A 3ECOA 4I98B 3KYDB 4NC7A 1W1WE 4A93J 1KYWA 2VIXA 4XKBA 5ED4A 5J1YA 1VQ5I 3CQZJ 3F8MA 4HOBA 3L2RA 3O8HA 3HOYJ 2DQLA 2VQLA 4ZYDA 1WJ5A 2VJJA 2V79A 3FK6A 5LRSA 4A6DA 1GHCA 2XGXA 3F6OA 3HHHA 2DMTA 4EJVA 3RPQA 4ZZDA 3RYRA 1ZR2A 3BZCA 1AWCA 1HXDA 1OKRA 2FMYA 5F1RA 4ANJA 4O3MA 2Y0MA 5DD4A 1T08B 3RQIA 3N4MA 1FMWA 4A69C 2EV5A 5BMZA 1R5HA 5AONA 4BQAA 3BPVA 5DM7F 1Z7LA 3HSFA 1Z05A 1I50J 2A5YB 3CF5F 4UUTA 3ZQGA 4N4OB 2LP0A 3CC7I 2M2EA 3S1NJ 2K4BA 1PUFA 4PSXA 2IEKA 1Y56A 2FNAA 2HI3A 3FWEA 2CSOA 3HOSA 1D3YA 3CCVI 2K9SA 5IPAA 3BJ6A 4XLNF 1BW5A 1OCCH 1MIJA 1MNEA 4U88A 4BXUA 3HGYA 4A0YA 3ABLH 2L02A 4BE2A 2GOMA 1NHAA 4JP0A 5HNFA 2DK5A 3ZMZA 2Z2SB 3ERMA 1LJ9A 2FD5A 1ETVA 2MH9A 2R7OA 4YRVA 3TMOA 3GCMA 1M1EB 3HC7A 3HRTA 4I0BA 3E5QA 4LGWA 3M8FA 5BS6A 4XLHA 3P9CA 2L01A 2YX4A 5EEHA 5ICCA 3IL2A 3MKWB 4HDVA 4L18B 4LFUA 3HDDA 1WWXA 4IHXA 3TP3A 2XF5A 4BEHA 4QWQA 1DGRM 2R7WA 2MD5A 3EPZA 4OIOF 3QU6A 4KA4A 1BW6A 1A36A 4YIFA 4RS8A 1G4DA 1G2HA 2X85A 2XKPA 2R7DA 1YG2A 2Z33A 3KP6A 2ISZA 4RA2A 4BNCA 2VQCA 2KDOA 1PJRA 4U87A 4IXAA 3G6EI 1OLTA 2DMUA 2R7RA 2HZDA 1FSHA 2JT1A 1A31A 1H8AC 3ZMUA 1T8IA 2XAUA 3TP0A 2RGVA 3NEUA 1YS7A 3BP8A 4A3DJ 4AUXA 3MN2A 3S3OA 2HOEA 4EJUA 1ZLKA 3C18A 1IV6A 2JTVA 5JR3A 5M5YJ 3PM1A 2GZWA 4A0ZA 1BN5A 3SQNA 1OCOH 1EKEA 2F5DA 4HSTA 1B9NA 4EEFG 3BG9A 2LD5A 1RKTA 2LYCA 4FHTA 2CUEA 2MD0A 1B1BA 2R3SA 2OCEA 9ANTA 1QGPA 2DDAA 1G59A 4RB0A 3JTHA 4PFPA 4BU2A 2F5FA 4IQ4A 5D4RA 3C1DA 1WI9A 4XLPF 1Q1VA 4X0GA 2FXAA 5DV5A 3KEYA 3V7RA 2RDPA 5K7ZA 2HVRA 1QQIA 4HA8A 5LFAA 4IVNA 3DCFA 1AHDP 4U7BA 1MBHA 1V5EA 2DAOA 4ZYAA 3JRCA 4UB6C 3G1LA 2WV0A 3I5UA 4GFBA 2K9MA 4AM3A 3BLYA 2ZO4A 1F4KA 2DDBA 2G7UA 2GWRA 5BNGA 4XN0A 3HKZA 3ZQLA 2O5RA 4EVIA 1IRXA 2FBKA 2FX0A 1I5ZA 3HOZJ 2NRAC 4FETA 5FKNA 1W5TA 2NNYA 3WU0A 5K5RA 4M6XA 5IT3A 4KT6A 4HQEA 1S7OA 1UJ8A 3TO6A 1ZRDA 2JZYA 2EFWA 2GQQA 3TW6A 1X2MA 3WODF 4UUVA 4BBSJ 2R7XA 3M3YJ 1B8IB 2JUGA 3CO7C 5E17F 3GUDA 2IT0A 3BR0A 1DUXC 1HDPA 3OIQA 4UVCA 5D8KB 3JREA 2Y0SN 2BEOA 2VC0A 5ICGA 2K3PA 2JQ7A 5D6FA 1ETQA 3OL3A 3RKYA 2M8GX 1O3SA 2AO9A 4N0BA 2M45A 3G73A 1XGSA 3F0CA 3TKYA 4YELA 2CQKA 2TCTA 2KIQA 3DV8A 4N4NB 4XICA 5EEGA 2NVQJ 4AIJA 1LE8B 2DJNA 2XV4S 4Q48A 1TC3C 3IUOA 4CXFA 1S9HA 1C0WA 1I6HJ 4M3BA 1GXPA 2K85A 2DPDA 2ZJQF 2VKVA 2GBYA 1IV8A 1SVLA 3RPUD 3L9FA 1OMIA 1ODDA 3FIWA 3Q9SA 1P4XA 4OMYA 1DU6A 4CH7A 4HPQA 1BI2A 1MZBA 3U9GA 3RKWA 1SC7A 3DTKA 2JA5J 4HX8A 3M1EA 4KUMA 2LTPA 3SFZA 4EV0A 1YW8A 1YITI 4E70A 3GFIA 3LSMA 5ILSA 1MJAA 5DCMB 5DUKA 3CP8A 2QA4I 2B63J 1RNLA 1WCMJ 1ERDA 1BJZA 2ZXWH 5ERIA 4OIPF 4EM2A 1RZ4A 2X1EA 4LIVA 1LUJB 3GZNB 3WGIA 4NBQA 5F1JA 2G9WA 1JGSA 3HRMA 1IN7A 1N77A 3P5JA 5L3EA 5LHHA 3PQKA 1X1DA 2OA4A 4IKFA 3G4SI 3W2AA 3HTSB 2EILH 1J9IA 3C2GA 3CJRB 3FMSA 3LSRA 2F5EA 4KNYA 4JQFA 2O8XA 2XF6A 2ZXJA 1V5FA 1BJAA 2L5QA 2Q2EB 4MEYF 1W36D 2L7MP 1X1PA 3FBNB 1ETKA 2Z16A 3HM5A 2HQAA 2ZCWA 4AVPA 1G3TA 2V6EA 3CCMI 3H3UA 2IGNA 2V9VA 4MNUA 3B6AA 1R6RA 1MH3A 4I09A 2H09A 3H5AA 2XC7A 3ECHA 2L0KA 4XBFA 2NS7A 3I0TA 2H1KA 1SAXA 4PJMA 2HDWA 2DYRH 3T1BA 3OY9A 4KIBA 3G1MA 1HQCA 3D5SC 2M34A 2QZ8A 1MW7A 4G12A 1LFBA 4CZZA 5J40A 1LDKB 4P9FA 3H92A 4L5IA 2K86A 1RRJA 2HYGD 3GLLA 3OS0A 4D0PA 1IZ1A 1TWGJ 4PCQA 3WGHA 3BT9A 3FXLA 2QEXI 1KU3A 5CVIA 2V6CA 2QCOA 3ZR8X 3DP7A 2ECBA 3QPSA 2HOAA 4NUBA 2EIKH 3K4NA 1B59A 2XPUA 2P81A 4EM1A 1TLHB 1B8IA 3CCJI 3DLLF 5JVTA 5D8LB 3OSGA 5FRMA 1KA8A 2BBYA 4B1RA 1TZLA 3BG6A 2EPFA 2XGEA 3FDYA 1IF1A 4X6AJ 2ESNA 2H6BA 5F27A 4HYEA 3HOUJ 1O57A 3PUBA 1VTNC 1GVJA 3H0DA 1LE8A 3MWMA 3F8NA 4RM2A 1VQ7I 1BI1A 2HQRA 2OF7A 3MZ8A 1PVEA 3HOTA 2V1NA 4JX5A 3IH2A 4DZJA 5LD2C 2KL4A 1KONA 2GA1A 1EV7A 2J5PA 4XIDA 5C3EJ 2IA1A 5IYDJ 4OWRB 3ULQB 2L54A 2ZC2A 2KISA 2STTA 3QP5A 1X1CA 1P7IA 2IXSA 3IKVA 3HEFA 4KYWA 4DYQA 3DPTA 4AU7A 1IDZA 2AQFA 3U1DA 4L9TA 5DCMA 1J59A 1FEXA 1BI0A 2VOOA 2R7SA 3VDXA 1ZREA 2WV1A 4KICA 3JSOA 2IRFG 5C4JJ 2STWA 4IHYA 3PSIA 2XROA 5FKMA 1T95A 5J47A 1FP2A 2OAZA 2IPQX 1E2XA 4ZYHA 2F48A 1VQ8I 4BXFA 3TEDA 3K0LA 4XN3A 3ABMH 2LK2A 2XIGA 3JRDA 2IS6A 3S93A 2CWEA 2XF7A 2IW5A 5TRDA 1O3RA 3BCBA 5JHUA 2Q2EA 1TW3A 1Y0NA 4ZDOA 5LHGA 2HNHA 2JVGA 3CF2A 5FKOA 4FISA 3N97A 2H1LA 2IGMA 2D45A 2HVSA 3MKLA 4U0WA 1XG1A 3PIOF 5F6FA 1SVMA 2DO7A 1BM9A 3BR2A 5E1WA 5E3OA 1ETOA 1W7PB 4NQWB 2MA3A 2PN6A 3R60A 4MEXF 2XB5A 4HBLA 5FD5A 1POGA 2FE3A 3BROA 4XRSG 5IOYA 4RGRA 2R4GA 2M7AA 1K7AA 3GW2A 4ZDPA 2O03A 1YJWI 5HODA 2JPCA 2GXBA 1LDJA 2E1MB 3WGGA 3KP3A 3E0JB 4IRIA 2JSPA 2KT0A 1VFCA 4LLGF 1SFOJ 1XCBA 2H8WA 1ON2A 2VL8A 2LH9A 3J7ZI 4PFOA 5DDGA 3BG5A 3CCQI 2OV7A 4HRIA 1JT6A 1QRYA 1D8JA 2E1CA 2CMPA 4GCVA 1Y0UA 2HPIA 4Z6YA 3QWLA 1UHSA 1XDUA 3HKZN 1SD5A 2NS8A 2DCEA 3U1KA 5GAGJ 2F5CA 1MJ9A 2E7WA 1IN5A 3PNTA 3QU3A 4XNFA 2Y31A 1ETYA 1LKXA 2P4WA 1V55H 3I3LA 1WRJA 4PGHA 4B09A 1Y1VJ 4WXCA 3I9V2 1N75A 4H4KC 5J8CA 2H8RA 3D1NI 1IAWA 1EH6A 4B44A 4UVAA 2YU9J 1WJCA 3N05A 3DU5A 2K02A 2KIFA 2OC6A 1HBXG 1BR4A 4IL6C 4CDGA 1YRNB 1CF7B 3SJMA 3NQOA 5LHIA 2CW0F 2RAEA 3E5XA 3WG9A 2LKSA 3L2CA 1P2FA 2Z5UA 2R7UA 2K9NA 5IOZA 2VASA 1FJLA 2A07F 1ZN2A 3E5UA 3EDPA 1K6OA 3CJNA 2CRGA 3HOWJ 1EA3A 2X6YA 2HQ5A 1UG0A 5LBQA 5EZGA 1FOYA 1ZR4A 1X3ZB 4EGZA 1T2KA 2P6SA 3CTAA 2CJJA 3ABTA 4WXHA 1YTYA 4FASD 2OQRA 4CSWA 2E2HJ 2JPBA 3I55I 4G7HF 3K70C 4P96A 5LEJA 2PJPA 5EEAA 1UHWA 5HLHA 4G94A 3A01B 1IGNA 2CQ7A 1XC5A 2LSOA 3ERED 5J8FA 1IN6A 3AAFA 1GV2A 3L7WA 5JI6A 3M7GA 3COAC 2DT6A 4ZC3A 4PJ0C 2RNGA 1BIAA 3LA7A 1XSDA 1OPCA 4LD5A 1VQOI 3V8LA 2DA7A 2ZNYA 2MSYA 3K1PA 4BY7J 1RUNA 4FX4A 3H5RA 3OYCA 3LAPA 4XK4A 5AIPA 1J09A 5F64A 4P9UA 2ELHA 3DEEA 3M8JA 1W7PA 1X2NA 4M3FA 1Z9CA 4RGXA 3TDUC 3A0HC 4IF4A 3PSFA 4A12A 4RBOA 1EH7A 5HNHA 5CKTA 1H88C 3W6VA 1J2XA 3DBLB 1S6LA 3HG9A 3H35A 2D1VA 2FUG2 1RI7A 2ZJRF 4CCKA 1ORKA 3DXJF 1S5LC 3QP6A 1IXSB 3R6SA 4U7DA 3VFZA 1ON1A 1U3EM 5IP9J 1IRGA 4DOZA 3F22A 3CUQB 3R0AA 1U9NA 2LY9A 2HGCA 5AIQA 3FISA 4DBQA 1OCPA 2OD5A 3PIPF 4B3XA 5TJJA 1XMKA 5DD8A 4E7LA 4AIKA 5EDNA 2ZB9A 3V7CA 3S1QJ 3MD2A 1LQ1A 4M72A 2HQNA 2EH3A 2FMLA 2VJ5A 4GRIA 2NVUB 3HRSA 1R23A 1WSUA 3EQLF 2ZBKA 3ZN1A 4NHJA 2LLKA 3F6VA 3KPHA 1MH4A 4M3DA 4C3HJ 3SZPA 1P6RA 3DBRB 4EM0B 2QQ8A 2WAQA 3IAS2 2R92J 1Z91A 1YRNA 4RLQA 2DTZA 1CF7A 1ZGJA 3HSEA 1O3TA 1KZHA 5J1UA 2LC2A 2CUZA 2CUFA 1B72B 1Y8QB 3BG3A 5M5XJ 2VBWA 2VXDA 2M5WA 2XKOA 1IDYA 1RR8C 2HFHA 4XOTA 4C30A 4LOCA 2DYSH 3P9IA 3TBIA 2A68F 4B8XA 4ZYGA 1FIAA 2BHZA 1VQMI 1FX7A 2ZXHA 3RZOJ 1JXSA 5E3MA 4QSHA 2RQQA 4AYBN 1IO2A 1D1BA 4I76A 2WB1A 1K6YA 3FHNA 1YHQI 2VQHA 3A01A 4IOAF 4U0YA 1HCRA 2Z9OA 3SZTA 2Z1DA 3KLOA 1R1VA 3Q9VA 1Q1HA 2A61A 2JA2A 4M9XA 5KAIC 4GGGA 5IY5H 4U0VA 2KQRA 1R1TA 1KQ8A 3GF2A 2DFIA 4ZZLA 3I59B 4BHPA 4A3LJ 1GXQA 3BZKA 1KQ0A 1DP7P 2KMUA 4XSZF 1TBXA 3IRQA 5B5EC 2W4SA 3W2VA 3UKGA 3FXOA 4CYCB 1QO0D 1ZKGA 1EJ9A 1W5SA 2ISYA 3LSKA 2E2JJ 3IWZA 4FE7A 5DTDA 5M3FJ 3WTTC 1R7JA 3CUQC 5HS8A 2BY0A 1I27A 2IGKA 3S1MJ 1DU0A 3OOUA 4IZZA 4LK1F 3LQQA 1TQPA 4F92B 3GTMJ 3Q5FA 5ICFA 4HX7A 2P5LC 2QYOA 1SMYF 2HR3A 2VC1A 3SXYA 3FF5A 3CUQA 5E1XA 1R1UA 4BJ5C 2R7TA 2XPVA 1OISA 3ZRGA 5HOOA 3L2VA 3F21A 3JRAA 4I01A 3WTWC 2DXIA 3OOPA 1F9NA 1T56A 1SD7A 5LGNA 2DA6A 3SDGA 2B0LA 4LMYA 1UFMA 3ZOBA 2KJCA 4CA0A 1IC8A 5IYCJ 1IW7F 4TV7A 4GO1A 2MLGA 1ZARA 2E1NA 3QAHA 1SFXA 4MTDA 1BR2A 2X9DA 1FSEA 4BHBA 4A3GJ 2VJ4A 1GDTA 4MQVA 3GVAA 2FOKA 2JUCA 2HWVA 5F0CA 1ZQ3P 4XRSA 2BGCA 1ACIA 1RESA 4Y3OA 1LPQA 4KJZA 2DT5A 4JX6A 3BTCA 2EZIA 3A0BC 1D0XA 1BR1A 2EB7A 1WGXA 5L3GA 5E79C 1ZRCA 3KE2A 4M6VA 3GTOJ 1HLVA 3MEXA 1B72A 3JRBA 1OCRH 1R4MB 3WTUC 4MIMA 4XONA 3MFKA 2ZNZA 2KRFA 5B1BH 5H6RA 3WHBA 5D4SA 4X1EA 4L5EA 2LVSA 2W25A 4BDYA 2XVCA 1J5YA 2A3SA 4OIQF 3FBIB 3LWFA 5FB2A 4IJAA 2JVHA 1G8XA 3FHZA 3HRUA 4PSWA 5FGMA 2EIMH 2HZTA 1XMAA 2DOEA 2VODA 2MW8A 3R4KA 3DFGA 4XKCA 1SD6A 4F93B 2UWMA 4B43A 3RKQA 2L7ZA 3F8BA 5GP9A 1Z3YA 2OUMA 3FXMA 2X6XA 3MKYB 3GYHX 1X19A 3FK7A 3S8PA 1K4SA 1ZRFA 3S2WA 3E97A 1MDMB 4D1QA 3IH4A 2O3FA 4XMYA 1MNDA 2HU9A 3I59A 2MC3A 2NXNB 3CCUI 3K10A 2XAJA 1WI3A 2HKXA 2FBHA 2IA2A 3ASNH 3ZQ7A 3KP5A 2GA2A 1R36A 2W1OA 4CYCA 1JKRC 3GTPJ 1QHGA 3OV8A 3IV5A 2XRNA 3RIRA 4BJTA 2FA5A 2W48A 3R0JA 4ENMA 2QSGX 2BY3A 5IP7J 1XCVA 3IKTA 3BWGA 2L3DA 5CQGA 4C2MJ 2D1HA 5E1ZB 3ISPA 2N8GA 4QLCU 3LSHA 3MCZA 1EH8A 3HL2A 5CVVA 2Q1ZB 1D5VA 3HTUA 4A3JJ 3MMYB 1V4RA 3OYIA 2IS2A 4XORA 5H6QA 4LJZF 2EFPA 3KYLA 1DQUA 3ELKA 4ZH4F 3FX3A 3EUHA 5ICEA 1GV5A 1LEAA 4RAGA 4KDPA 1VQLI 2YPRA 2YU3A 1VNDA 4S04A 3HOXJ 2EZLA 2IGOA 4DBRA 1P7JA 2FQ3A 2PMHA 4C3IJ 1JGGA 2E19A 3OSFA 1K79A 2JA6J 4L5JA 4I6ZA 4EMSA 1MSEC 1U8RA 1T39A 1KU2A 3C7JA 5J3LA 5ILVA 2BOLA 1B9MA 3E7LA 2EFNA 4KIGA 2F2EA 3BY6A 3BJAA 3F23A 3H36A 2R93J 1XSVA 2VBZA 1YFHA 5FD6A 2R7FA 4XRFA 2L4MA 1HKTA 4XKWA 2LFBA 3I4MJ 3PO3J 4UV8A 1JT0A 2WAQN 2PX9A 2V1XA 4HLYA 3WU1B 1T98A 3BOQA 4N9IA 4MTEA 4E7JA 3TL4X 1H0MA 2VKHA 2DA1A 1YQAA 4KMFA 3ROUA 1VQNI 5K5OA 2KKOA 2DLLA 5L3FA 2X0LA 4LB6B 3RTRA 2DMQA 4WX9A 1NK3P 3Q0VA 2H94A 4YFXF 1WH7A 3KZZA 3RJPA 3MZYA 3SZGA 2IBDA 5HS7A 3OYKA 5HS9A 2E60A 5J1RA 3J7AY 4IHWA 3PNVA 3HGGA 5FJ8J 2LKPA 1OYYA 2ZXIA 2ICWG 3D5LA 4HLXA 1REPC 1VF9A 1XB4A 2Y69H 3ZP5A 4EQQA 2CFXA 3P9KA 3BC8A 2IJLA 5BPIA 2KZVA 4KN7X 4MO7A 1WJAA 2JN6A 3SFIA 4YIIA 1FYKA 1JTYA 1MBFA 3CLQA 3FKIJ 4Y17A 1MDMA 1FTTA 2X6OA 2CU7A 3TO7A 3FXRA 3OYDA 2WY8Q 1FOXA 2BVMA 3FM3A 3OR1C 3LSGA 2NVXJ 2W7NA 2HPMA 3KCCA 2HDDA 2RREA 3OWTA 1BOAA 1E17A 3VOEA 2G0EA 2DU9A 3O3KA 3ZQCA 4ESFA 4ENNA 1P4WA 4KT5C 5J4VA 1YJNI 3F72A 4C2TA 3J7AO 2CQNA 4XM3A 3DEWA 3VSLA 2XGCA 1MGTA 2ESHA 4ENKA 1KU7A 4UNOA 2UXNA 2CO5A 2DN0A 2TDXA 4OU0A 2B9SA 1Z6RA 1V5GA 3HUGB 2AXTC 4MFEA 1XTAA 2EQRA 2P8TA 1U5TB 3I71A 3KZYA 2E35A 1L0OC 2W85A 1YOVB 3GTKJ 2ME6A 2QUFA 5F08A 4C2UA 2FNPA 3CD6I 5CVJA 2MABA 2EZKA 3FXQA 2XASA 4CHUA 2M9HA 2VPRA 1YIJI 4IO9F 2ACJA 2RKHA 1UMQA 4XR6A 4L0YB 3PFYA 4UUSB 4Y52J 2MYSA 2VJIA 3JTGA 1JUPA 3WE3A 4HNUA 4CCLA 2LOOA 2ZFWA 4DZPA 4F7ZA 1VQ6I 5JVGF 4OINF 2VKDA 4Z2YA 4ESJA 2KFDA 2LG4A 2E5ZA 3CC2I 1RR7A 2XB0X 3K7AJ 4HAMA 2P6TA 1FOWA 3Q3SA 2ID3A 4Q47A 3AFHA 1K4TA 3REOA 1TNSA 3ZGKA 3GFMA 5B66C 3TO9A 3H0GJ 3B73A 4EATA 1ZTRA 1USSA 1FYLA 2F4IA 3KP7A 1JKOC 2Z99A 1JUMA 1UZCA 5CVUA 3F8CA 1U0JA 3A02A 4OAZA 3RPUA 4HX4A 3ZCOA 4PK4A 2MFZA 4EJWA 4A3IJ 2DA5A 3SEQA 4BH9A 2R5ZB 5EYRA 5EZHA 5EGOB 2VBXA 3JAMZ 3DLAA 1ZHFA 1G3YA 4XLEA 1GVDA 2LREA 1G6NA 2HOTA 1JI8A 1OCZH 1FOKA 2BXYA 1GT0C 2YS9A 2G7HA 3CMMA 4A5MA 1A35A 2BY1A 1F1ZA 2W00A 1MBEA 3JCUC 5GADJ 2WBMA 4Q5SF 4N9HA 1E0EA 5GPAA 2O0YA 5D6EA 5J6XA 4M3EA 3ZMTA 4ON0A 1BC7C 1TT5B 1W36C 3E6MA 3G1OA 4HG2A 2E1OA 1PYVA 3JAMK 1QA6A 1WJBA 2AHQA 2NYXA 3V8KA 5GPCA 3K4MA 2QKLB 2NNNA 2E7XA 2RVCA 3DPLC 5E20A 4HV5A 1D1AA 3JRIA 2PBIA 4RB2C 3S2HJ 4P55A 4O6JA 2EBIA 5C44J 3VYRB 3PUFA 4JK1X 2J5OA 5HDNA 3M1CA 2V1DA 2VXZA 4JOMA 4ASNA 1LDDA 1R5GA 5ILUA 3FXUA 3HYIA 1WJDA 2F4MB 3JRFA 4IX7A 2H6CA 2ECCA 1Z77A 4CO8A 2CV2A 2FJ1A 5FO5A 4XL9A 4F52A 2CFOA 5IP6A 3HUGA 3TGNA 2BVLA 5K5QA 2M8EA 4WWCA 1U5TA 1T38A 3HJEA 1O3QA 1HKSA 2XDVA 4RLFA 3EYIA 5BOXA 3CC4I 1YO5C 2QSFX 1L3LA 4YFKF 3CJQB 5HLTA 2XHKA 2WC2A 2B7EA 3CJTB 4YEJA 3SDBA 3WTYC 1VQPI 1R22A 2F6CA 2LF7A 6PAXA 4CYDA 3C2BA 1STZA 2A5WA 3DF8A 1E3PA 1N78A 3SHFA 1RPWA 4UUSA 4I02A 4QPOA 3WTSC 2QVOA 3CCEI 1QPIA 1NH3A 1G3SA 3IP4B 3K69A 3G3ZA 5GAEJ 1I39A 3OYEA 2VUMJ 1SAUA 3E1SA 4LLLA 4PJJA 2OBPA 4ESBA 1MBKA 2M30A 4LG0B 3VYSB 3OYNA 4DYCA 1T33A 3HB9A 3H9JA 2QQ9A 3AG2H 3ML6A 3B6CA 1S72I 3F9KA 2L9NA 3BTLA 1A04A 3CDIA 3TW7A 2QQBA 1SFKA 1HA8A 4BAYA 1XS9A 1TNTA 2VLAA 4JX4A 3KP2A 3O8GA 3Q0WA 2CUJA 4B3AA 4OAYA 3K4LA 3H3VK 2R5ZA 4P1WA 5EGOA 1Y8RB 3DKXA 1P92A 4NNJA 3WTXC 2F5VA 1PUEE 3D5RC 3GFLA 4HF1A 5E18F 3QODA 1O7FA 4HW0A 2JJ7A 2NOGA 3CCSI 3S16J 3MVPA 3I58A 3A03A 3BTIA 3OYLA 2OTJI 3BTJA 3HPHA 2LNBA 3K6GA 2VT3A 2QKMB 3BPXA 3LSJA 4UHTA 1X4PA 3KEOA 5DYMA 4AIHA 2E1MC 4PUSA 2OCCH 1LFPA 1DGWY 4PZJA 2ELJA 3KX2A 3VODA 3VSKA 3OYGA 1F5TA 2H27A 2QWWA 1YJ9I 2XGDA 1ZK8A 3ZMSA 1KQ9A 2BXZA 4Y7NJ 4GYGA 5F04A 4L9NA 3W6JB 1GUUA 3LFKA 2R5YB 2HEOA 2QF7A 2HS5A 2AQEA 1YS6A 2Y48A 3QOEA 2VN2A 1HW5A 4BDZA 2MGQA 1D0ZA 4CCNA 4XLCA 1S29A 4I2OA 1YE9A 3IC7A 2V1UA 4EGYA 4IRHA 2HDCA 2V7FA 3CO6C 2EA2A 2L2OA 2P7VB 1QHHD 1DPRA 3DWLE 3S3MA 5CYVA 3ZPLA 2Y0SA 2ADUA 1Y6IA 3FMQA 1RIOH 5FROA 2PJRB 2FSWA 4AWXB 3OR2C 1BI3A 5LEKA 4A3BJ 1FTZA 2YUSA 3CP2A 4E7SA 2OTLI 3M4OJ 4V2FA 2K40A 2Q0OA 1ZYRF 4XOPA 3CMAI 1LEBA 3NWSA 1JE8A 3BZ6A 3HIFA 2BE5F 4J01A 4K2EA 4I0AA 2CV0A 4G9YA 4NDLA 2K3FA 2ZSHB 2KJBA 3CDLA 3G71I 2CG4A 2ZJPF 4LG0A 3BR6A 1QU3A 1FNNA 2DPUA 3E6DA 2O61A 4A3EJ 5FLVA 1USTA 3QOPA 3IH3A 2OQGA 2NAZA 4A2UA 3HPGA 4E7HA 3HHGA 1X1AA 2E34A 1QNTA 2R7ZJ 3I4PA 3NARA 5D5WB 2EINH 3RCOA 3CCRI 1SVOA 4HSRA 1B6AA 1XDSA 4GDFA 1OYIA 1S3JA 2DJIA 4GYIA 1Z0XA 2DMNA 2LDUA 2HYJA 4BJ6C 2CGPA 1KYZA 3G2BA 3JW4A 3GXOA 3VYTB 3R61A 1UG2A 4A0XA 3TDZC 2KRHA 5HLGA 2QBYB 2EK5A 5H2FC 3J80Z 4HF2A 1D0YA 1OCTC 4BY1J 5K1YA 3ESWB 2KZGA 4XQFA 1D8KA 1SD4A 3IWFA 1IN4A 4HNVA 3AG3H 3D0SA 2GIVA 3H3ZA 3MKZA 1I1GA 2GXAA 1Z1DA 1U2WA 4L9JA 3LMMA 1BOBA 2XPWA 1W0TA 2NOJB 3UNGC 1CGPA 3WTVC 1TQIA 4EJTA 3J80K 1NG6A 1YW9A 1XGNA 2Y75A 4NC6A 1FPQA 2R0QC 3DTEA 3F3XA 3S2DJ 4AD9A 1MD0A 2HTSA 5B3SH 3DPUA 2X1CA 3BG7A 3CMYA 2GXGA 4IPAA 1WHUA 1YYVA 1P9QC 4HEA2 4M74A 2HYFA 1IXRC 2LRDA 3KFWX 1FZPB 3CCYA 2RC4A 2R5YA 1XGMA 2OJED 3GEZA 4BXXJ 1ZLJA 1J0RA 1P4AA 1SFEA 3KLNA 2XSJC 3ABUA 3H9GA 1FC3A 2W57A 4L9VA 4LLNA 2QSHX 3DKWA 4FQGA 5FFZA 3HOVJ 1ZG1A 2NVTJ 3IHUA 3BQZA 3L1PA 3QQAA 4MHGA 5K7FA 2L9VA 4M9ZA 1DPUA 4S05A 3CDHA 2DOFA 2C6YA 2JK3A 1I3AA 2KHMA 1TWHJ 1GLNA 1TWCJ 2PJRA 3GMEA 4DW6A 2FQ4A 3H9QA 5E3NA 2PQ8A 2KIMA 3I64A 4BYYA 2E71A 1QVUA 2VI6A 3K1MA 5DS9A 2E5NA 1IXCA 3ZMDA 3ZN0A 1S7EA 4OIRF 5L3DA 4M6YA 1FT9A 2L4AA 4DNCA 1HSTA 5M5WJ 4RB3C 3BR1A 5CJ9A 3K2ZA 1S8NA 1A6QA 3W6KB 2COMA 4M3GA 2Y9YA 4LB5A 4PJNA 1OQYA 3RKXA 5TGTA 2RNJA 4MGRA 4BUPA 1A5JA 3BCAA 2HKOA 1D1CA 1T6SA 2PMZA 1ZGAA 2X4HA 4B4CA 3GTGJ 2PEXA 1Z3XA 2VE8A 2Q8KA 4UB8C 3QRFF 2YSRA 3K4KA 2EV0A 1I3QJ 1F36A 2BZTA 1RKWA 1QZZA 5DCFA 3V42A 2LBFB 2W82A 2MG4A 3DQVC 3HSRA 5LRRA 1FBSA 4A6EA 1QZEA 2VT2A 2W24A 4IOCF 3TOBA 3ZQHA 2IAIA 5H20A 2A6HF 2DA2A 1JTXA 4D7MA 3RQ4A 1HOMA 3LSTA 1WKMA 2QBYA 1OR7C 1WJFA 5LGUA 3RI4A 3S15J 1TWAJ 4YG2F 4FT8A 4G7OF 1W0UA 4RDUA 4M71A 1YX3A 2DQRA 4E7KA 2ELKA 5D5UB 2X6WA 3EUKL 3OYMA 3CLOA 2CH0A 1HF0A 1PP8F 1WJEA 1X1BA 1XN7A 4HDUA 1K61A 1OR7A 2M87A 3Q0UA 4CUGA 3I56I 1Z21A 2UZKA 4IHSA 2EFOA 1IRZA 1WPKA 2QQAA 2O6GE 1X58A 1R9TJ 3ONQA 4Y15A 2CV1A 2W84A 1QZYA 4FE4A 3AG1H 3T8TA 2IS4A 3K4BA 3LQRA 4KIFA 2P5KA 5E3LA 2EJRA 2UXXA 4BL0B 1MJBA 3J7YJ 1BL0A 5EG0B 4FCYA 2CQQA 2XUBA 5E8GA 1VQ9I 3LFUA 3OYFA 3J81Z 1G3WA 3RYPA 1ULYA 1XSXA 2IA0A 2M4GA 2E36A 2KIUA 1A6IA 3EUHC 1J7KA 5HVQC 2HTJA 1JJ6C 1JJ8C 4M73A 4A5NA 3CESA 2I10A 2GIZA 2I8DA 2KRCA 4ITVA 3KETA 1R71A 2XRLA 4BQOA 1ETWA 4C9YA 3OS1A 2FOWA 2DODA 2COBA 2OU2A 3FXJA 4XRMA 2A69F 1WVRA 1X4OA 2ID6A 1JKQC 2WWYA 1K78B 4B48A 2YX7A 3J81K 1TQMA 4XKVA 3AKZA 2EZHA 3I54A 3B02A 4II2A 1AU7A 4IHTA 3I53A 1YLFA 1RUOA 3LA2A 3V4GA 3A2KA 3X2QH 1X3UA 5LLQA 2ETHA 1ZG5A 2M1BA 3GZ5A 3OYBA 1SFUA 2V9PA 3OIPA 3E6BA 2UUZA 2M0MA 3KZIC 2ZKZA 4XLFA 2VB6A 1TT0A 2JRTA 2O8KA 1ZELA 1SANA 1T0FC 4JBAA 4D7NA 4IQJA 2XAGA 1V3FA 3HBLA 4DQ2A 2FBIA 4IHVA 3A1YA 5DEQA 3S1RJ 4HNTA 3H5NA 1B4AA 1MBGA 4Y33A 3GZ6A 3V8JA 2ZJ2A 3FZVA 1T0FA 1HSJA 5IYBJ 2TRTA 1PDNC 2ZFUA 2EV6A 3SYTA 1FBUA 1RC9A 3K2AA 5A2QZ 4KISA 3S32A 4BBRJ 2HOSA 2DMPA 2LBFA 4RMNA 2LF8A 4LK0F 1MMNA 3VEPA 3W2WA 4E7ZA 2CW7A 2D2WA 2CYYA 3QPHA 4DJAA 4E6KG 1U6GA 2M7BA 4BACA 1XD7A 2M4KA 4KN4X 2D5VA 4A3KJ 1MSFC 5JFRA 3WE2A 4HZFA 2BYVE 2K5CA 4CGZA 5C4XJ 4PJLA 2LR8A 2O7OA 5A2QK 2WB1N 4R79A 3EETA 3DTIA 3KYCB 1LB2A 4Y4RA 4E7IA 4PGGA 2GOXB 1ONVA 2FRHA 2PMUA 1VZ0A 4IRGA 3M9AA 1K83J 1SEUA 1W5CC 3WTZA 5F0FA 4CZCA 3LAJA 4D9JA 3OMYA 1NTCA 2KP6A 1FWZA 4V19K 4R8HA 2JA8J 3DKYA 2BY2A 3IAM2 3GBGA 1LFUP 5D5VB 1JHHA 3KEQA 5EG0A 3O2PE 4C3JJ 1IRFA 1HW1A 3QYBA 4D5CA 4QTRA 3OYJA 1IG7A 3BDDA 2E2IJ 2QM3A 4R1HA 2DFEA 3ZQQA 5K7HA 3VPRA 1O4XA 2DFHA 3I4NJ 2K4JA 1OJLA 3BJOA 1YX5A 4ZDLA 4GXOA 2OZUA 4OMZA 1UHMA 3W3CA 2BW3B 5M3MJ 1Y1WJ 1UB9A 1BC8C 5CLSA 4BE0A 4G6DA 3FKJA 4S0HB 5KAFC 1FYMA 2L7FP 3PNYA 1IUYA 4KITB 1K78A 1LVKA 1WFXA 3O6BB 4II3A 3LSPA 2R7VA 2MH2A 2ME0A 2BV6A 4HV6A 2DBBA 3GX4X 3WG7H 5DUIA 5DM6F 1H9GA 3GFJA 3PO2J 3BQYA 2R7QA 5EJCA 5EF6A 3L09A 2A6EF 1PP7U 3ASOH 2VKEA 4Q4ZF 2A05A 4YIRX 5D5XB 4I99C 2WAFA 2K9QA 1JUSA 1DP3A 4BQQA 2XAFA 3K9TA 4B47A 3LNQA 2L9RA 3CUOA 1MMSA 5JLXA 3ZQFA 2YR2A 1UAAA 2JA7J 1E3HA 2DT7B 3L2UA 4A3MJ 1NK2P 3T8RA 4MLOA 4ZTJA 3H1CA 3V7SA 3E6CC 4H0EA 2EIJH 1IN8A 1QPMA 3CMEI 3T0YA 3F8FA 5IT9Z 4AYBA 4HQMA 4G7ZF 2PMZN 3NWTA 4G8XA 3EYYA 5B1AH 1ZGWA 1MMDA 5E8IA 4ENJA 2VOPA 2EFQA 2DOAA 1BBYA 2DTRA 1FP1D 2XAHA 2WADA 3K70D 5FLMJ 2M3AA 2XAQA 4V2GA 4RAFA 4CICA 4QIWN 1ENHA 2OZ6A 2IP2A 4PDKA 1YW7A 4AVZA 3OYAA 2O9LA 1BIBA 2ZMEB 4W1UA 2VE9A 2UV1A 1XGOA 3KIOA 4CCJA 3PQJA 5IT9K 4YFNF 1W7PD 4KMUX 4EJOA 2QLZA 5KCMA 3U2RA 1WH5A 4CCMA 2HXOA 4RGSA 3MAJA 1OYWA 2V26A 3P7NA 4F91B 4ABZA 5KK1A 3S14J 4I7HA 5GTIC 1FY7A 2RV8A 3S17J 1ZAOA 1U5TC 4UV9A 4G6QA 2Z3YA 3K4CA 3S3NA 3WU2C 2MBFA 1LVAA 2DW4A 1TWFJ 2A6TA 2DFFA 4M9SA 1I6XA 4QPQA 1YI2I 1U78A 2LY1A 4XLAA 1Y39A 1VQ4I 1JHFA 3PFIA 4WXDA 2FF4A 1HW2A 1AKHB 2IVMA 3DEUA 4ZJZA 4ETSA 1ZG3A 3WHCA 4DYRA 3UR3C 1WZ2A 1MNMC 1AA7A 3MQ0A 1V54H 4MFDA 4D5FA 4JYKA 4LIUA 4RAZA 3VWBA 1FLIA 3LL7A 1CQTA 3BR3A 3GTQJ 2VPLA 1XPXA 2BW3A 3GO5A 1NG7A 3AL0B 3RSNA 4WCGA 1KU9A 4P5OA 2KDZA 2HXIA 2LY2A 3C2HA 4IEJA 1UCRA 1R58A 2L9SA 3BR5A 1D5YA 2KLOA 1MKMA 3NAUA 1R5ID 2VQGA 3TOAA 3TQNA 2XSDC 2CQXA 3JRGA 2KPMA 2EWNA 2Y9ZA 1MMGA 3CCLI 2P0WA 2NVYJ 1XX5A 4MQ9F 2DI3A 1FMVA 5FLXZ 4F55A 5LGTA 1U8BA 1TL8A 5CVRA 5HLIA 5CPRB 4LITA 5FRNA 2OPTA 2QGUA 4ZYEA 3QYEA 2ZSIB 2PI0A 3PL8A 2VBYA 1MBJA 3GLXA 4HF0A 5HDGA 3SEZA 1HKQA 5KHDA 2MC4A 4BHCA 1H9TA 4L0ZB 5TISC 4AIDA 3ZXSA 5L3CA 1IJWC 2Y2ZA 5FLXK 2M0CA 3DBHB 3K1NA 3ZQIA 4UVBA 1RETA 3VB2A 2WA0A 1H89C 1UELB 2I5UA 1EF4A 3LA3A 2K7LA 1R00A 2JMWA 3KP4A 3QPTA 5L3BA 1S7AA 1E3OC 1W4MA 3E3VA 3QPLA 4NC8A 3GTJJ 4W97A 1ETXA 1BA5A 2L7KA 1DDNA 4RAYA 2ZMEC 3FMRA 2QENA 2EA4A 1OFCX 1TW2A 4BKXA 3EUAA 4BGDA 4E4HA 4AC0A 1R49A 1SMTA 1FBQA 1O7LA 2DK8A 4RGUA 3L2QA 2AXLA 2RQPA 2Y30A 3T5XA 4RM3A 2P7CB 2ZMEA 3A4CA 3OS2A 1JKPC 3GTLJ
chains in the Genus database with same CATH topology
2R7SA 3VDXA 4LG3A 3PSIA 4DIQA 2CW8A 2KHMA 2BOLA 1T95A 1GLNA 3LSIA 3DU6A 2PJRA 3H9QA 5JHFA 2X1DA 4BXFA 4XN3A 4XKWA 2IS6A 3S93A 1MMAA 2XF7A 2E5NA 4BS9A 3BCBA 4CCOA 4ZDOA 4E7JA 2HNHA 3TL4X 3AL0C 2JVGA 2VKHA 3CF2A 3QYFA 5CQEA 2HVSA 2IGMA 3RTRA 4NQWB 3OYHA 3K4JA 3PJRA 3L2WA 4PJNA 3SZGA 2R4GA 5TGTA 2M7AA 4BUPA 3OYKA 3J7AY 2E60A 3BCAA 4ZDPA 1D1CA 3PNVA 2PMZA 2WY7Q 2K9LA 2E1MB 2ZXIA 3D5LA 3CZ6A 2CS3A 1Z3XA 3E0JB 4BEHB 2JSPA 2V4JC 4BQNA 3K4KA 4F3QA 2VL8A 3BC8A 2LH9A 2KZVA 3U21A 4PFOA 1WJAA 2LBFB 3V42A 2OV7A 4HRIA 4DGWB 2W82A 2IS1A 3DQVC 2CMPA 4ZTFA 2HPIA 3OYDA 2WY8Q 2BVMA 2X51A 2DCEA 4BE1A 3OR1C 3LSGA 3RQ4A 2W7NA 2HPMA 3PNTA 2RREA 2WAEA 3OWTA 4XNFA 1OR7C 1WJFA 1LKXA 3I3LA 2HVQA 5KNLA 2V9KA 4C2TA 4XM3A 1YX3A 3I9V2 1N75A 4H4KC 3VSLA 4J00A 4E7KA 3VYUB 4B44A 3HXLA 2X6WA 3EUKL 3OYMA 1V5GA 3HUGB 2CH0A 1WJCA 3N05A 1WJEA 1X1BA 3DU5A 2OC6A 4G6TB 1BR4A 3OL4A 4CUGA 1Z21A 4C2UA 4NC7A 2MABA 3ONQA 2VIXA 2CV1A 4XKBA 2IS4A 3K4BA 3L2RA 2VQLA 4BL0B 1WJ5A 2VJJA 4XR6A 3PFYA 2R7UA 3LFUA 3OYFA 2MYSA 2VJIA 2VASA 2M4GA 4HNUA 4CCLA 4ANJA 2LOOA 3EUHC 5HVQC 1EA3A 2X6YA 1FMWA 1UG0A 2VKDA 3CESA 2I8DA 2KRCA 2E5ZA 2LG4A 4ITVA 1Z7LA 4BQOA 4FASD 4C9YA 3OS1A 4CSWA 4N4OB 3K70C 4PSXA 1X4OA 3AFHA 4B48A 1Y56A 3ZGKA 4XKVA 3HOSA 3AKZA 4EATA 4II2A 2F4IA 1MNEA 3A2KA 2DT6A 1U0JA 4OAZA 4ZC3A 3ZCOA 3OYBA 2GOMA 4BE2A 2RNGA 2MFZA 4PK4A 3OIPA 3SEQA 5HNFA 2UUZA 2M0MA 4XLFA 2Z2SB 2VB6A 3DLAA 4XLEA 1TT0A 2LREA 3H5RA 1ZELA 2R7OA 3OYCA 4YRVA 1T0FC 1JI8A 1J09A 3TMOA 3HC7A 3DEEA 3M8JA 4IQJA 3CMMA 4XLHA 3A1YA 3PSFA 3MKWB 2W00A 5HNHA 5CKTA 4HNTA 3H5NA 2WBMA 1E0EA 4Y33A 3HG9A 3H35A 2FUG2 2ZFUA 3SYTA 2XF5A 4BEHA 4CCKA 1DGRM 2R7WA 4HG2A 1W36C 1PYVA 3EPZA 1WJBA 4KISA 3S32A 3K4MA 2QKLB 2X85A 4RMNA 2LBFA 4DOZA 1MMNA 3W2WA 4E7ZA 2CW7A 3DPLC 2VQCA 1D1AA 2KDOA 4DJAA 1PJRA 4U87A 4E6KG 2M7BA 4BACA 1OLTA 2M4KA 2R7RA 2HZDA 3VYRB 4DBQA 3M1CA 4B3XA 4E7LA 2XAUA 2VXZA 4JOMA 2K5CA 4PJLA 1WJDA 3MD2A 4R79A 4IX7A 3DTIA 4Y4RA 4E7IA 2VJ5A 4GRIA 2CV2A 3S3OA 2GOXB 4XL9A 4F52A 2CFOA 1VZ0A 2BVLA 2XDVA 4RLFA 2WAQA 4CZCA 3IAS2 4D9JA 3OMYA 3CJQB 4RLQA 5HLTA 4HSTA 4YEJA 3SDBA 2KP6A 2F6CA 2LC2A 2CUZA 2A5WA 3DKYA 2LYCA 3IAM2 2MD0A 3GBGA 1G59A 1N78A 2VXDA 3OYJA 3QYBA 4PFPA 4BU2A 4QPOA 4IQ4A 3ZQQA 4XOTA 3IP4B 4X0GA 4C30A 3OYEA 3KEYA 1YX5A 1SAUA 3E1SA 4ZDLA 2HVRA 4PJJA 5LFAA 3TBIA 4U7BA 1V5EA 4ZYAA 3VYSB 3W3CA 2BW3B 3OYNA 2ZXHA 3H9JA 4BE0A 2K9MA 2RQQA 3FKJA 1D1BA 2WB1A 3BLYA 3F9KA 1K6YA 3PNYA 3FHNA 2L9NA 4KITB 2VQHA 1LVKA 1WFXA 4II3A 4XN0A 2R7VA 3HKZA 2Z1DA 1SFKA 2O5RA 1HA8A 2JA2A 1IRXA 2VLAA 4FETA 2CUJA 2R7QA 2KQRA 4OAYA 3K4LA 4KT6A 4P1WA 3DKXA 2R7XA 4NNJA 2KMUA 2WAFA 1DP3A 2F5VA 3D5RC 4BQQA 2JUGA 2W4SA 3W2VA 3QODA 3OIQA 4B47A 2K3PA 1UAAA 3LSKA 3OL3A 2DT7B 3L2UA 3OYLA 3HPHA 4YELA 4MLOA 4ZTJA 4N4NB 3K6GA 2IGKA 2QKMB 3OOUA 4IZZA 1X4PA 2E1MC 3IUOA 4F92B 4PUSA 4AYBA 1S9HA 1LFPA 1DGWY 2ELJA 3KX2A 3NWTA 3VSKA 3OYGA 4BJ5C 1MMDA 2R7TA 2DOAA 2WADA 3ZRGA 5HOOA 3L2VA 3K70D 2M3AA 2DXIA 3RPUD 4CH7A 4HPQA 2AQEA 4CA0A 4AVZA 3DTKA 3OYAA 3QOEA 4BDZA 1D0ZA 2UV1A 4CCNA 4CCJA 4XLCA 3LSMA 1YE9A 1BR2A 3CP8A 1ERDA 5KCMA 2VJ4A 4CCMA 2V7FA 2L2OA 2V26A 1QHHD 3DWLE 2X1EA 4F91B 4LIVA 3S3MA 2Y0SA 1Y6IA 1N77A 4Y3OA 3S3NA 3K4CA 5FROA 2PJRB 4KJZA 1X1DA 1D0XA 4IKFA 1BR1A 3W2AA 2A6TA 4QPQA 3OR2C 3C2GA 2LY1A 3CJRB 4XLAA 3CP2A 4E7SA 4JQFA 2XF6A 4ZJZA 1V5FA 4XOPA 2Q2EB 2L5QA 4XONA 3UR3C 1AA7A 3NWSA 1W36D 3FBNB 2Z16A 2HQAA 4J01A 4LIUA 2CV0A 2V6EA 3VWBA 3LL7A 2IGNA 4BDYA 2ZSHB 1R6RA 2VPLA 3H5AA 3FBIB 2XC7A 1QU3A 2BW3A 2JVHA 1NG7A 1G8XA 2HDWA 4PJMA 3OY9A 4PSWA 3AL0B 3RSNA 4P5OA 3D5SC 3HPGA 2LY2A 4E7HA 3C2HA 1MW7A 1X1AA 1LDKB 2L9SA 2KLOA 4XKCA 2VQGA 4F93B 2UWMA 4B43A 3RCOA 2KPMA 3OS0A 1Z3YA 2OUMA 4HSRA 1MMGA 2X6XA 3MKYB 1X19A 2P0WA 2DJIA 3S8PA 1FMVA 4BJ6C 3G2BA 4D1QA 4F55A 3ZR8X 4XMYA 1MNDA 2HU9A 4NUBA 3K10A 3K4NA 3VYTB 5CPRB 4LITA 5FRNA 2KRHA 1D0YA 2W1OA 3QYEA 5FRMA 2ZSIB 3PL8A 1TZLA 1QHGA 3BG6A 3SEZA 4XQFA 4BJTA 5KHDA 2MC4A 3FDYA 3ZXSA 3PUBA 3MKZA 3H0DA 2WA0A 3LMMA 1UELB 1BOBA 5CQGA 2NOJB 3UNGC 4RM2A 4NC8A 3LSHA 3HOTA 2L7KA 1NG6A 3HL2A 2V1NA 2Q1ZB 3DTEA 5LD2C 2KL4A 1KONA 3DPUA 3MMYB 2X1CA 3BG7A 3OYIA 1P9QC 2IS2A 3EUAA 4HEA2 4BGDA 4E4HA 2LRDA 4OWRB 4XORA 3KYLA 1DQUA 3L2QA 1X1CA 4RM3A 2IXSA 3A4CA 3OS2A 2XSJC 3H9GA 3DPTA 4AU7A 2IGOA 4DBRA 2AQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A1Y A;  4BEH B;  2W1O A;  2LBF B;  4BEH A;  2LBF A; 
#chains in the Genus database with same CATH topology
 4FX0 A;  4FTH A;  1QBJ A;  1YIO A;  2GM4 A;  2JSC A;  1VI0 A;  3ABK H;  4LG3 A;  1N25 A;  1Z6T A;  4DIQ A;  2CW8 A;  1PUF B;  3RDI A;  1QVT A;  1XMX A;  3FM5 A;  3IRR A;  3AG4 H;  4XSX F;  1I1S A;  3LSI A;  2K27 A;  1Z7U A;  2P5V A;  3DU6 A;  2AS5 F;  3FXK A;  5JHF A;  2X1D A;  1J75 A;  2DA3 A;  3M8E A;  4NQW A;  2WTE A;  1MMA A;  3NRV A;  1AKH A;  3OIO A;  4BS9 A;  3JR9 A;  4CCO A;  5GAH J;  5BPD A;  5BQT A;  2LMD A;  1IUF A;  1HDD C;  3AL0 C;  3QYF A;  5CQE A;  2BHY A;  4OOI A;  4O5V A;  3MZH A;  1TP4 A;  3JRH A;  3OYH A;  2PLY A;  3K4J A;  3PJR A;  3L2W A;  1WQ2 A;  4KFC A;  2GLO A;  1HC8 A;  1ZH5 A;  1R4N B;  2WY7 Q;  4A3F J;  2JRM A;  2K9L A;  2MLK A;  2GAU A;  3M07 A;  3CZ6 A;  2CS3 A;  3RZD J;  2NS0 A;  4BEH B;  4Y13 A;  2DA4 A;  2V4J C;  4BQN A;  5F0H A;  2X48 A;  2FU4 A;  3L00 A;  3ZMV A;  4F3Q A;  2VON A;  4NB5 A;  3U21 A;  4UXN A;  2IS1 A;  4DGW B;  4J19 A;  2JWT A;  4ZTF A;  1LNW A;  5FFX A;  5JLW A;  2X51 A;  5FKK A;  4BE1 A;  1AOY A;  2FEZ A;  1F43 A;  5FKL A;  1VQK I;  1X3W B;  1ITY A;  4A3C J;  5J4Y A;  4WK8 F;  1KGS A;  2WAE A;  1FIP A;  5GTH C;  2PG4 A;  2RN7 A;  2LKX A;  2HVQ A;  5KNL A;  1APL C;  4UY8 I;  3HZJ A;  2V9K A;  5HDK A;  4RB1 A;  4J00 A;  1TTY A;  3VYU B;  3C3W A;  3GWZ A;  3HXL A;  3JSP A;  5KVR A;  2PFB A;  4G6T B;  3LOC A;  1Z67 A;  2F4O B;  3OL4 A;  1U9O A;  4WF2 A;  3ECO A;  4I98 B;  3KYD B;  4NC7 A;  1W1W E;  4A93 J;  1KYW A;  2VIX A;  4XKB A;  5ED4 A;  5J1Y A;  1VQ5 I;  3CQZ J;  3F8M A;  4HOB A;  3L2R A;  3O8H A;  3HOY J;  2DQL A;  2VQL A;  4ZYD A;  1WJ5 A;  2VJJ A;  2V79 A;  3FK6 A;  5LRS A;  4A6D A;  1GHC A;  2XGX A;  3F6O A;  3HHH A;  2DMT A;  4EJV A;  3RPQ A;  4ZZD A;  3RYR A;  1ZR2 A;  3BZC A;  1AWC A;  1HXD A;  1OKR A;  2FMY A;  5F1R A;  4ANJ A;  4O3M A;  2Y0M A;  5DD4 A;  1T08 B;  3RQI A;  3N4M A;  1FMW A;  4A69 C;  2EV5 A;  5BMZ A;  1R5H A;  5AON A;  4BQA A;  3BPV A;  5DM7 F;  1Z7L A;  3HSF A;  1Z05 A;  1I50 J;  2A5Y B;  3CF5 F;  4UUT A;  3ZQG A;  4N4O B;  2LP0 A;  3CC7 I;  2M2E A;  3S1N J;  2K4B A;  1PUF A;  4PSX A;  2IEK A;  1Y56 A;  2FNA A;  2HI3 A;  3FWE A;  2CSO A;  3HOS A;  1D3Y A;  3CCV I;  2K9S A;  5IPA A;  3BJ6 A;  4XLN F;  1BW5 A;  1OCC H;  1MIJ A;  1MNE A;  4U88 A;  4BXU A;  3HGY A;  4A0Y A;  3ABL H;  2L02 A;  4BE2 A;  2GOM A;  1NHA A;  4JP0 A;  5HNF A;  2DK5 A;  3ZMZ A;  2Z2S B;  3ERM A;  1LJ9 A;  2FD5 A;  1ETV A;  2MH9 A;  2R7O A;  4YRV A;  3TMO A;  3GCM A;  1M1E B;  3HC7 A;  3HRT A;  4I0B A;  3E5Q A;  4LGW A;  3M8F A;  5BS6 A;  4XLH A;  3P9C A;  2L01 A;  2YX4 A;  5EEH A;  5ICC A;  3IL2 A;  3MKW B;  4HDV A;  4L18 B;  4LFU A;  3HDD A;  1WWX A;  4IHX A;  3TP3 A;  2XF5 A;  4BEH A;  4QWQ A;  1DGR M;  2R7W A;  2MD5 A;  3EPZ A;  4OIO F;  3QU6 A;  4KA4 A;  1BW6 A;  1A36 A;  4YIF A;  4RS8 A;  1G4D A;  1G2H A;  2X85 A;  2XKP A;  2R7D A;  1YG2 A;  2Z33 A;  3KP6 A;  2ISZ A;  4RA2 A;  4BNC A;  2VQC A;  2KDO A;  1PJR A;  4U87 A;  4IXA A;  3G6E I;  1OLT A;  2DMU A;  2R7R A;  2HZD A;  1FSH A;  2JT1 A;  1A31 A;  1H8A C;  3ZMU A;  1T8I A;  2XAU A;  3TP0 A;  2RGV A;  3NEU A;  1YS7 A;  3BP8 A;  4A3D J;  4AUX A;  3MN2 A;  3S3O A;  2HOE A;  4EJU A;  1ZLK A;  3C18 A;  1IV6 A;  2JTV A;  5JR3 A;  5M5Y J;  3PM1 A;  2GZW A;  4A0Z A;  1BN5 A;  3SQN A;  1OCO H;  1EKE A;  2F5D A;  4HST A;  1B9N A;  4EEF G;  3BG9 A;  2LD5 A;  1RKT A;  2LYC A;  4FHT A;  2CUE A;  2MD0 A;  1B1B A;  2R3S A;  2OCE A;  9ANT A;  1QGP A;  2DDA A;  1G59 A;  4RB0 A;  3JTH A;  4PFP A;  4BU2 A;  2F5F A;  4IQ4 A;  5D4R A;  3C1D A;  1WI9 A;  4XLP F;  1Q1V A;  4X0G A;  2FXA A;  5DV5 A;  3KEY A;  3V7R A;  2RDP A;  5K7Z A;  2HVR A;  1QQI A;  4HA8 A;  5LFA A;  4IVN A;  3DCF A;  1AHD P;  4U7B A;  1MBH A;  1V5E A;  2DAO A;  4ZYA A;  3JRC A;  4UB6 C;  3G1L A;  2WV0 A;  3I5U A;  4GFB A;  2K9M A;  4AM3 A;  3BLY A;  2ZO4 A;  1F4K A;  2DDB A;  2G7U A;  2GWR A;  5BNG A;  4XN0 A;  3HKZ A;  3ZQL A;  2O5R A;  4EVI A;  1IRX A;  2FBK A;  2FX0 A;  1I5Z A;  3HOZ J;  2NRA C;  4FET A;  5FKN A;  1W5T A;  2NNY A;  3WU0 A;  5K5R A;  4M6X A;  5IT3 A;  4KT6 A;  4HQE A;  1S7O A;  1UJ8 A;  3TO6 A;  1ZRD A;  2JZY A;  2EFW A;  2GQQ A;  3TW6 A;  1X2M A;  3WOD F;  4UUV A;  4BBS J;  2R7X A;  3M3Y J;  1B8I B;  2JUG A;  3CO7 C;  5E17 F;  3GUD A;  2IT0 A;  3BR0 A;  1DUX C;  1HDP A;  3OIQ A;  4UVC A;  5D8K B;  3JRE A;  2Y0S N;  2BEO A;  2VC0 A;  5ICG A;  2K3P A;  2JQ7 A;  5D6F A;  1ETQ A;  3OL3 A;  3RKY A;  2M8G X;  1O3S A;  2AO9 A;  4N0B A;  2M45 A;  3G73 A;  1XGS A;  3F0C A;  3TKY A;  4YEL A;  2CQK A;  2TCT A;  2KIQ A;  3DV8 A;  4N4N B;  4XIC A;  5EEG A;  2NVQ J;  4AIJ A;  1LE8 B;  2DJN A;  2XV4 S;  4Q48 A;  1TC3 C;  3IUO A;  4CXF A;  1S9H A;  1C0W A;  1I6H J;  4M3B A;  1GXP A;  2K85 A;  2DPD A;  2ZJQ F;  2VKV A;  2GBY A;  1IV8 A;  1SVL A;  3RPU D;  3L9F A;  1OMI A;  1ODD A;  3FIW A;  3Q9S A;  1P4X A;  4OMY A;  1DU6 A;  4CH7 A;  4HPQ A;  1BI2 A;  1MZB A;  3U9G A;  3RKW A;  1SC7 A;  3DTK A;  2JA5 J;  4HX8 A;  3M1E A;  4KUM A;  2LTP A;  3SFZ A;  4EV0 A;  1YW8 A;  1YIT I;  4E70 A;  3GFI A;  3LSM A;  5ILS A;  1MJA A;  5DCM B;  5DUK A;  3CP8 A;  2QA4 I;  2B63 J;  1RNL A;  1WCM J;  1ERD A;  1BJZ A;  2ZXW H;  5ERI A;  4OIP F;  4EM2 A;  1RZ4 A;  2X1E A;  4LIV A;  1LUJ B;  3GZN B;  3WGI A;  4NBQ A;  5F1J A;  2G9W A;  1JGS A;  3HRM A;  1IN7 A;  1N77 A;  3P5J A;  5L3E A;  5LHH A;  3PQK A;  1X1D A;  2OA4 A;  4IKF A;  3G4S I;  3W2A A;  3HTS B;  2EIL H;  1J9I A;  3C2G A;  3CJR B;  3FMS A;  3LSR A;  2F5E A;  4KNY A;  4JQF A;  2O8X A;  2XF6 A;  2ZXJ A;  1V5F A;  1BJA A;  2L5Q A;  2Q2E B;  4MEY F;  1W36 D;  2L7M P;  1X1P A;  3FBN B;  1ETK A;  2Z16 A;  3HM5 A;  2HQA A;  2ZCW A;  4AVP A;  1G3T A;  2V6E A;  3CCM I;  3H3U A;  2IGN A;  2V9V A;  4MNU A;  3B6A A;  1R6R A;  1MH3 A;  4I09 A;  2H09 A;  3H5A A;  2XC7 A;  3ECH A;  2L0K A;  4XBF A;  2NS7 A;  3I0T A;  2H1K A;  1SAX A;  4PJM A;  2HDW A;  2DYR H;  3T1B A;  3OY9 A;  4KIB A;  3G1M A;  1HQC A;  3D5S C;  2M34 A;  2QZ8 A;  1MW7 A;  4G12 A;  1LFB A;  4CZZ A;  5J40 A;  1LDK B;  4P9F A;  3H92 A;  4L5I A;  2K86 A;  1RRJ A;  2HYG D;  3GLL A;  3OS0 A;  4D0P A;  1IZ1 A;  1TWG J;  4PCQ A;  3WGH A;  3BT9 A;  3FXL A;  2QEX I;  1KU3 A;  5CVI A;  2V6C A;  2QCO A;  3ZR8 X;  3DP7 A;  2ECB A;  3QPS A;  2HOA A;  4NUB A;  2EIK H;  3K4N A;  1B59 A;  2XPU A;  2P81 A;  4EM1 A;  1TLH B;  1B8I A;  3CCJ I;  3DLL F;  5JVT A;  5D8L B;  3OSG A;  5FRM A;  1KA8 A;  2BBY A;  4B1R A;  1TZL A;  3BG6 A;  2EPF A;  2XGE A;  3FDY A;  1IF1 A;  4X6A J;  2ESN A;  2H6B A;  5F27 A;  4HYE A;  3HOU J;  1O57 A;  3PUB A;  1VTN C;  1GVJ A;  3H0D A;  1LE8 A;  3MWM A;  3F8N A;  4RM2 A;  1VQ7 I;  1BI1 A;  2HQR A;  2OF7 A;  3MZ8 A;  1PVE A;  3HOT A;  2V1N A;  4JX5 A;  3IH2 A;  4DZJ A;  5LD2 C;  2KL4 A;  1KON A;  2GA1 A;  1EV7 A;  2J5P A;  4XID A;  5C3E J;  2IA1 A;  5IYD J;  4OWR B;  3ULQ B;  2L54 A;  2ZC2 A;  2KIS A;  2STT A;  3QP5 A;  1X1C A;  1P7I A;  2IXS A;  3IKV A;  3HEF A;  4KYW A;  4DYQ A;  3DPT A;  4AU7 A;  1IDZ A;  2AQF A;  3U1D A;  4L9T A;  5DCM A;  1J59 A;  1FEX A;  1BI0 A;  2VOO A;  2R7S A;  3VDX A;  1ZRE A;  2WV1 A;  4KIC A;  3JSO A;  2IRF G;  5C4J J;  2STW A;  4IHY A;  3PSI A;  2XRO A;  5FKM A;  1T95 A;  5J47 A;  1FP2 A;  2OAZ A;  2IPQ X;  1E2X A;  4ZYH A;  2F48 A;  1VQ8 I;  4BXF A;  3TED A;  3K0L A;  4XN3 A;  3ABM H;  2LK2 A;  2XIG A;  3JRD A;  2IS6 A;  3S93 A;  2CWE A;  2XF7 A;  2IW5 A;  5TRD A;  1O3R A;  3BCB A;  5JHU A;  2Q2E A;  1TW3 A;  1Y0N A;  4ZDO A;  5LHG A;  2HNH A;  2JVG A;  3CF2 A;  5FKO A;  4FIS A;  3N97 A;  2H1L A;  2IGM A;  2D45 A;  2HVS A;  3MKL A;  4U0W A;  1XG1 A;  3PIO F;  5F6F A;  1SVM A;  2DO7 A;  1BM9 A;  3BR2 A;  5E1W A;  5E3O A;  1ETO A;  1W7P B;  4NQW B;  2MA3 A;  2PN6 A;  3R60 A;  4MEX F;  2XB5 A;  4HBL A;  5FD5 A;  1POG A;  2FE3 A;  3BRO A;  4XRS G;  5IOY A;  4RGR A;  2R4G A;  2M7A A;  1K7A A;  3GW2 A;  4ZDP A;  2O03 A;  1YJW I;  5HOD A;  2JPC A;  2GXB A;  1LDJ A;  2E1M B;  3WGG A;  3KP3 A;  3E0J B;  4IRI A;  2JSP A;  2KT0 A;  1VFC A;  4LLG F;  1SFO J;  1XCB A;  2H8W A;  1ON2 A;  2VL8 A;  2LH9 A;  3J7Z I;  4PFO A;  5DDG A;  3BG5 A;  3CCQ I;  2OV7 A;  4HRI A;  1JT6 A;  1QRY A;  1D8J A;  2E1C A;  2CMP A;  4GCV A;  1Y0U A;  2HPI A;  4Z6Y A;  3QWL A;  1UHS A;  1XDU A;  3HKZ N;  1SD5 A;  2NS8 A;  2DCE A;  3U1K A;  5GAG J;  2F5C A;  1MJ9 A;  2E7W A;  1IN5 A;  3PNT A;  3QU3 A;  4XNF A;  2Y31 A;  1ETY A;  1LKX A;  2P4W A;  1V55 H;  3I3L A;  1WRJ A;  4PGH A;  4B09 A;  1Y1V J;  4WXC A;  3I9V 2;  1N75 A;  4H4K C;  5J8C A;  2H8R A;  3D1N I;  1IAW A;  1EH6 A;  4B44 A;  4UVA A;  2YU9 J;  1WJC A;  3N05 A;  3DU5 A;  2K02 A;  2KIF A;  2OC6 A;  1HBX G;  1BR4 A;  4IL6 C;  4CDG A;  1YRN B;  1CF7 B;  3SJM A;  3NQO A;  5LHI A;  2CW0 F;  2RAE A;  3E5X A;  3WG9 A;  2LKS A;  3L2C A;  1P2F A;  2Z5U A;  2R7U A;  2K9N A;  5IOZ A;  2VAS A;  1FJL A;  2A07 F;  1ZN2 A;  3E5U A;  3EDP A;  1K6O A;  3CJN A;  2CRG A;  3HOW J;  1EA3 A;  2X6Y A;  2HQ5 A;  1UG0 A;  5LBQ A;  5EZG A;  1FOY A;  1ZR4 A;  1X3Z B;  4EGZ A;  1T2K A;  2P6S A;  3CTA A;  2CJJ A;  3ABT A;  4WXH A;  1YTY A;  4FAS D;  2OQR A;  4CSW A;  2E2H J;  2JPB A;  3I55 I;  4G7H F;  3K70 C;  4P96 A;  5LEJ A;  2PJP A;  5EEA A;  1UHW A;  5HLH A;  4G94 A;  3A01 B;  1IGN A;  2CQ7 A;  1XC5 A;  2LSO A;  3ERE D;  5J8F A;  1IN6 A;  3AAF A;  1GV2 A;  3L7W A;  5JI6 A;  3M7G A;  3COA C;  2DT6 A;  4ZC3 A;  4PJ0 C;  2RNG A;  1BIA A;  3LA7 A;  1XSD A;  1OPC A;  4LD5 A;  1VQO I;  3V8L A;  2DA7 A;  2ZNY A;  2MSY A;  3K1P A;  4BY7 J;  1RUN A;  4FX4 A;  3H5R A;  3OYC A;  3LAP A;  4XK4 A;  5AIP A;  1J09 A;  5F64 A;  4P9U A;  2ELH A;  3DEE A;  3M8J A;  1W7P A;  1X2N A;  4M3F A;  1Z9C A;  4RGX A;  3TDU C;  3A0H C;  4IF4 A;  3PSF A;  4A12 A;  4RBO A;  1EH7 A;  5HNH A;  5CKT A;  1H88 C;  3W6V A;  1J2X A;  3DBL B;  1S6L A;  3HG9 A;  3H35 A;  2D1V A;  2FUG 2;  1RI7 A;  2ZJR F;  4CCK A;  1ORK A;  3DXJ F;  1S5L C;  3QP6 A;  1IXS B;  3R6S A;  4U7D A;  3VFZ A;  1ON1 A;  1U3E M;  5IP9 J;  1IRG A;  4DOZ A;  3F22 A;  3CUQ B;  3R0A A;  1U9N A;  2LY9 A;  2HGC A;  5AIQ A;  3FIS A;  4DBQ A;  1OCP A;  2OD5 A;  3PIP F;  4B3X A;  5TJJ A;  1XMK A;  5DD8 A;  4E7L A;  4AIK A;  5EDN A;  2ZB9 A;  3V7C A;  3S1Q J;  3MD2 A;  1LQ1 A;  4M72 A;  2HQN A;  2EH3 A;  2FML A;  2VJ5 A;  4GRI A;  2NVU B;  3HRS A;  1R23 A;  1WSU A;  3EQL F;  2ZBK A;  3ZN1 A;  4NHJ A;  2LLK A;  3F6V A;  3KPH A;  1MH4 A;  4M3D A;  4C3H J;  3SZP A;  1P6R A;  3DBR B;  4EM0 B;  2QQ8 A;  2WAQ A;  3IAS 2;  2R92 J;  1Z91 A;  1YRN A;  4RLQ A;  2DTZ A;  1CF7 A;  1ZGJ A;  3HSE A;  1O3T A;  1KZH A;  5J1U A;  2LC2 A;  2CUZ A;  2CUF A;  1B72 B;  1Y8Q B;  3BG3 A;  5M5X J;  2VBW A;  2VXD A;  2M5W A;  2XKO A;  1IDY A;  1RR8 C;  2HFH A;  4XOT A;  4C30 A;  4LOC A;  2DYS H;  3P9I A;  3TBI A;  2A68 F;  4B8X A;  4ZYG A;  1FIA A;  2BHZ A;  1VQM I;  1FX7 A;  2ZXH A;  3RZO J;  1JXS A;  5E3M A;  4QSH A;  2RQQ A;  4AYB N;  1IO2 A;  1D1B A;  4I76 A;  2WB1 A;  1K6Y A;  3FHN A;  1YHQ I;  2VQH A;  3A01 A;  4IOA F;  4U0Y A;  1HCR A;  2Z9O A;  3SZT A;  2Z1D A;  3KLO A;  1R1V A;  3Q9V A;  1Q1H A;  2A61 A;  2JA2 A;  4M9X A;  5KAI C;  4GGG A;  5IY5 H;  4U0V A;  2KQR A;  1R1T A;  1KQ8 A;  3GF2 A;  2DFI A;  4ZZL A;  3I59 B;  4BHP A;  4A3L J;  1GXQ A;  3BZK A;  1KQ0 A;  1DP7 P;  2KMU A;  4XSZ F;  1TBX A;  3IRQ A;  5B5E C;  2W4S A;  3W2V A;  3UKG A;  3FXO A;  4CYC B;  1QO0 D;  1ZKG A;  1EJ9 A;  1W5S A;  2ISY A;  3LSK A;  2E2J J;  3IWZ A;  4FE7 A;  5DTD A;  5M3F J;  3WTT C;  1R7J A;  3CUQ C;  5HS8 A;  2BY0 A;  1I27 A;  2IGK A;  3S1M J;  1DU0 A;  3OOU A;  4IZZ A;  4LK1 F;  3LQQ A;  1TQP A;  4F92 B;  3GTM J;  3Q5F A;  5ICF A;  4HX7 A;  2P5L C;  2QYO A;  1SMY F;  2HR3 A;  2VC1 A;  3SXY A;  3FF5 A;  3CUQ A;  5E1X A;  1R1U A;  4BJ5 C;  2R7T A;  2XPV A;  1OIS A;  3ZRG A;  5HOO A;  3L2V A;  3F21 A;  3JRA A;  4I01 A;  3WTW C;  2DXI A;  3OOP A;  1F9N A;  1T56 A;  1SD7 A;  5LGN A;  2DA6 A;  3SDG A;  2B0L A;  4LMY A;  1UFM A;  3ZOB A;  2KJC A;  4CA0 A;  1IC8 A;  5IYC J;  1IW7 F;  4TV7 A;  4GO1 A;  2MLG A;  1ZAR A;  2E1N A;  3QAH A;  1SFX A;  4MTD A;  1BR2 A;  2X9D A;  1FSE A;  4BHB A;  4A3G J;  2VJ4 A;  1GDT A;  4MQV A;  3GVA A;  2FOK A;  2JUC A;  2HWV A;  5F0C A;  1ZQ3 P;  4XRS A;  2BGC A;  1ACI A;  1RES A;  4Y3O A;  1LPQ A;  4KJZ A;  2DT5 A;  4JX6 A;  3BTC A;  2EZI A;  3A0B C;  1D0X A;  1BR1 A;  2EB7 A;  1WGX A;  5L3G A;  5E79 C;  1ZRC A;  3KE2 A;  4M6V A;  3GTO J;  1HLV A;  3MEX A;  1B72 A;  3JRB A;  1OCR H;  1R4M B;  3WTU C;  4MIM A;  4XON A;  3MFK A;  2ZNZ A;  2KRF A;  5B1B H;  5H6R A;  3WHB A;  5D4S A;  4X1E A;  4L5E A;  2LVS A;  2W25 A;  4BDY A;  2XVC A;  1J5Y A;  2A3S A;  4OIQ F;  3FBI B;  3LWF A;  5FB2 A;  4IJA A;  2JVH A;  1G8X A;  3FHZ A;  3HRU A;  4PSW A;  5FGM A;  2EIM H;  2HZT A;  1XMA A;  2DOE A;  2VOD A;  2MW8 A;  3R4K A;  3DFG A;  4XKC A;  1SD6 A;  4F93 B;  2UWM A;  4B43 A;  3RKQ A;  2L7Z A;  3F8B A;  5GP9 A;  1Z3Y A;  2OUM A;  3FXM A;  2X6X A;  3MKY B;  3GYH X;  1X19 A;  3FK7 A;  3S8P A;  1K4S A;  1ZRF A;  3S2W A;  3E97 A;  1MDM B;  4D1Q A;  3IH4 A;  2O3F A;  4XMY A;  1MND A;  2HU9 A;  3I59 A;  2MC3 A;  2NXN B;  3CCU I;  3K10 A;  2XAJ A;  1WI3 A;  2HKX A;  2FBH A;  2IA2 A;  3ASN H;  3ZQ7 A;  3KP5 A;  2GA2 A;  1R36 A;  2W1O A;  4CYC A;  1JKR C;  3GTP J;  1QHG A;  3OV8 A;  3IV5 A;  2XRN A;  3RIR A;  4BJT A;  2FA5 A;  2W48 A;  3R0J A;  4ENM A;  2QSG X;  2BY3 A;  5IP7 J;  1XCV A;  3IKT A;  3BWG A;  2L3D A;  5CQG A;  4C2M J;  2D1H A;  5E1Z B;  3ISP A;  2N8G A;  4QLC U;  3LSH A;  3MCZ A;  1EH8 A;  3HL2 A;  5CVV A;  2Q1Z B;  1D5V A;  3HTU A;  4A3J J;  3MMY B;  1V4R A;  3OYI A;  2IS2 A;  4XOR A;  5H6Q A;  4LJZ F;  2EFP A;  3KYL A;  1DQU A;  3ELK A;  4ZH4 F;  3FX3 A;  3EUH A;  5ICE A;  1GV5 A;  1LEA A;  4RAG A;  4KDP A;  1VQL I;  2YPR A;  2YU3 A;  1VND A;  4S04 A;  3HOX J;  2EZL A;  2IGO A;  4DBR A;  1P7J A;  2FQ3 A;  2PMH A;  4C3I J;  1JGG A;  2E19 A;  3OSF A;  1K79 A;  2JA6 J;  4L5J A;  4I6Z A;  4EMS A;  1MSE C;  1U8R A;  1T39 A;  1KU2 A;  3C7J A;  5J3L A;  5ILV A;  2BOL A;  1B9M A;  3E7L A;  2EFN A;  4KIG A;  2F2E A;  3BY6 A;  3BJA A;  3F23 A;  3H36 A;  2R93 J;  1XSV A;  2VBZ A;  1YFH A;  5FD6 A;  2R7F A;  4XRF A;  2L4M A;  1HKT A;  4XKW A;  2LFB A;  3I4M J;  3PO3 J;  4UV8 A;  1JT0 A;  2WAQ N;  2PX9 A;  2V1X A;  4HLY A;  3WU1 B;  1T98 A;  3BOQ A;  4N9I A;  4MTE A;  4E7J A;  3TL4 X;  1H0M A;  2VKH A;  2DA1 A;  1YQA A;  4KMF A;  3ROU A;  1VQN I;  5K5O A;  2KKO A;  2DLL A;  5L3F A;  2X0L A;  4LB6 B;  3RTR A;  2DMQ A;  4WX9 A;  1NK3 P;  3Q0V A;  2H94 A;  4YFX F;  1WH7 A;  3KZZ A;  3RJP A;  3MZY A;  3SZG A;  2IBD A;  5HS7 A;  3OYK A;  5HS9 A;  2E60 A;  5J1R A;  3J7A Y;  4IHW A;  3PNV A;  3HGG A;  5FJ8 J;  2LKP A;  1OYY A;  2ZXI A;  2ICW G;  3D5L A;  4HLX A;  1REP C;  1VF9 A;  1XB4 A;  2Y69 H;  3ZP5 A;  4EQQ A;  2CFX A;  3P9K A;  3BC8 A;  2IJL A;  5BPI A;  2KZV A;  4KN7 X;  4MO7 A;  1WJA A;  2JN6 A;  3SFI A;  4YII A;  1FYK A;  1JTY A;  1MBF A;  3CLQ A;  3FKI J;  4Y17 A;  1MDM A;  1FTT A;  2X6O A;  2CU7 A;  3TO7 A;  3FXR A;  3OYD A;  2WY8 Q;  1FOX A;  2BVM A;  3FM3 A;  3OR1 C;  3LSG A;  2NVX J;  2W7N A;  2HPM A;  3KCC A;  2HDD A;  2RRE A;  3OWT A;  1BOA A;  1E17 A;  3VOE A;  2G0E A;  2DU9 A;  3O3K A;  3ZQC A;  4ESF A;  4ENN A;  1P4W A;  4KT5 C;  5J4V A;  1YJN I;  3F72 A;  4C2T A;  3J7A O;  2CQN A;  4XM3 A;  3DEW A;  3VSL A;  2XGC A;  1MGT A;  2ESH A;  4ENK A;  1KU7 A;  4UNO A;  2UXN A;  2CO5 A;  2DN0 A;  2TDX A;  4OU0 A;  2B9S A;  1Z6R A;  1V5G A;  3HUG B;  2AXT C;  4MFE A;  1XTA A;  2EQR A;  2P8T A;  1U5T B;  3I71 A;  3KZY A;  2E35 A;  1L0O C;  2W85 A;  1YOV B;  3GTK J;  2ME6 A;  2QUF A;  5F08 A;  4C2U A;  2FNP A;  3CD6 I;  5CVJ A;  2MAB A;  2EZK A;  3FXQ A;  2XAS A;  4CHU A;  2M9H A;  2VPR A;  1YIJ I;  4IO9 F;  2ACJ A;  2RKH A;  1UMQ A;  4XR6 A;  4L0Y B;  3PFY A;  4UUS B;  4Y52 J;  2MYS A;  2VJI A;  3JTG A;  1JUP A;  3WE3 A;  4HNU A;  4CCL A;  2LOO A;  2ZFW A;  4DZP A;  4F7Z A;  1VQ6 I;  5JVG F;  4OIN F;  2VKD A;  4Z2Y A;  4ESJ A;  2KFD A;  2LG4 A;  2E5Z A;  3CC2 I;  1RR7 A;  2XB0 X;  3K7A J;  4HAM A;  2P6T A;  1FOW A;  3Q3S A;  2ID3 A;  4Q47 A;  3AFH A;  1K4T A;  3REO A;  1TNS A;  3ZGK A;  3GFM A;  5B66 C;  3TO9 A;  3H0G J;  3B73 A;  4EAT A;  1ZTR A;  1USS A;  1FYL A;  2F4I A;  3KP7 A;  1JKO C;  2Z99 A;  1JUM A;  1UZC A;  5CVU A;  3F8C A;  1U0J A;  3A02 A;  4OAZ A;  3RPU A;  4HX4 A;  3ZCO A;  4PK4 A;  2MFZ A;  4EJW A;  4A3I J;  2DA5 A;  3SEQ A;  4BH9 A;  2R5Z B;  5EYR A;  5EZH A;  5EGO B;  2VBX A;  3JAM Z;  3DLA A;  1ZHF A;  1G3Y A;  4XLE A;  1GVD A;  2LRE A;  1G6N A;  2HOT A;  1JI8 A;  1OCZ H;  1FOK A;  2BXY A;  1GT0 C;  2YS9 A;  2G7H A;  3CMM A;  4A5M A;  1A35 A;  2BY1 A;  1F1Z A;  2W00 A;  1MBE A;  3JCU C;  5GAD J;  2WBM A;  4Q5S F;  4N9H A;  1E0E A;  5GPA A;  2O0Y A;  5D6E A;  5J6X A;  4M3E A;  3ZMT A;  4ON0 A;  1BC7 C;  1TT5 B;  1W36 C;  3E6M A;  3G1O A;  4HG2 A;  2E1O A;  1PYV A;  3JAM K;  1QA6 A;  1WJB A;  2AHQ A;  2NYX A;  3V8K A;  5GPC A;  3K4M A;  2QKL B;  2NNN A;  2E7X A;  2RVC A;  3DPL C;  5E20 A;  4HV5 A;  1D1A A;  3JRI A;  2PBI A;  4RB2 C;  3S2H J;  4P55 A;  4O6J A;  2EBI A;  5C44 J;  3VYR B;  3PUF A;  4JK1 X;  2J5O A;  5HDN A;  3M1C A;  2V1D A;  2VXZ A;  4JOM A;  4ASN A;  1LDD A;  1R5G A;  5ILU A;  3FXU A;  3HYI A;  1WJD A;  2F4M B;  3JRF A;  4IX7 A;  2H6C A;  2ECC A;  1Z77 A;  4CO8 A;  2CV2 A;  2FJ1 A;  5FO5 A;  4XL9 A;  4F52 A;  2CFO A;  5IP6 A;  3HUG A;  3TGN A;  2BVL A;  5K5Q A;  2M8E A;  4WWC A;  1U5T A;  1T38 A;  3HJE A;  1O3Q A;  1HKS A;  2XDV A;  4RLF A;  3EYI A;  5BOX A;  3CC4 I;  1YO5 C;  2QSF X;  1L3L A;  4YFK F;  3CJQ B;  5HLT A;  2XHK A;  2WC2 A;  2B7E A;  3CJT B;  4YEJ A;  3SDB A;  3WTY C;  1VQP I;  1R22 A;  2F6C A;  2LF7 A;  6PAX A;  4CYD A;  3C2B A;  1STZ A;  2A5W A;  3DF8 A;  1E3P A;  1N78 A;  3SHF A;  1RPW A;  4UUS A;  4I02 A;  4QPO A;  3WTS C;  2QVO A;  3CCE I;  1QPI A;  1NH3 A;  1G3S A;  3IP4 B;  3K69 A;  3G3Z A;  5GAE J;  1I39 A;  3OYE A;  2VUM J;  1SAU A;  3E1S A;  4LLL A;  4PJJ A;  2OBP A;  4ESB A;  1MBK A;  2M30 A;  4LG0 B;  3VYS B;  3OYN A;  4DYC A;  1T33 A;  3HB9 A;  3H9J A;  2QQ9 A;  3AG2 H;  3ML6 A;  3B6C A;  1S72 I;  3F9K A;  2L9N A;  3BTL A;  1A04 A;  3CDI A;  3TW7 A;  2QQB A;  1SFK A;  1HA8 A;  4BAY A;  1XS9 A;  1TNT A;  2VLA A;  4JX4 A;  3KP2 A;  3O8G A;  3Q0W A;  2CUJ A;  4B3A A;  4OAY A;  3K4L A;  3H3V K;  2R5Z A;  4P1W A;  5EGO A;  1Y8R B;  3DKX A;  1P92 A;  4NNJ A;  3WTX C;  2F5V A;  1PUE E;  3D5R C;  3GFL A;  4HF1 A;  5E18 F;  3QOD A;  1O7F A;  4HW0 A;  2JJ7 A;  2NOG A;  3CCS I;  3S16 J;  3MVP A;  3I58 A;  3A03 A;  3BTI A;  3OYL A;  2OTJ I;  3BTJ A;  3HPH A;  2LNB A;  3K6G A;  2VT3 A;  2QKM B;  3BPX A;  3LSJ A;  4UHT A;  1X4P A;  3KEO A;  5DYM A;  4AIH A;  2E1M C;  4PUS A;  2OCC H;  1LFP A;  1DGW Y;  4PZJ A;  2ELJ A;  3KX2 A;  3VOD A;  3VSK A;  3OYG A;  1F5T A;  2H27 A;  2QWW A;  1YJ9 I;  2XGD A;  1ZK8 A;  3ZMS A;  1KQ9 A;  2BXZ A;  4Y7N J;  4GYG A;  5F04 A;  4L9N A;  3W6J B;  1GUU A;  3LFK A;  2R5Y B;  2HEO A;  2QF7 A;  2HS5 A;  2AQE A;  1YS6 A;  2Y48 A;  3QOE A;  2VN2 A;  1HW5 A;  4BDZ A;  2MGQ A;  1D0Z A;  4CCN A;  4XLC A;  1S29 A;  4I2O A;  1YE9 A;  3IC7 A;  2V1U A;  4EGY A;  4IRH A;  2HDC A;  2V7F A;  3CO6 C;  2EA2 A;  2L2O A;  2P7V B;  1QHH D;  1DPR A;  3DWL E;  3S3M A;  5CYV A;  3ZPL A;  2Y0S A;  2ADU A;  1Y6I A;  3FMQ A;  1RIO H;  5FRO A;  2PJR B;  2FSW A;  4AWX B;  3OR2 C;  1BI3 A;  5LEK A;  4A3B J;  1FTZ A;  2YUS A;  3CP2 A;  4E7S A;  2OTL I;  3M4O J;  4V2F A;  2K40 A;  2Q0O A;  1ZYR F;  4XOP A;  3CMA I;  1LEB A;  3NWS A;  1JE8 A;  3BZ6 A;  3HIF A;  2BE5 F;  4J01 A;  4K2E A;  4I0A A;  2CV0 A;  4G9Y A;  4NDL A;  2K3F A;  2ZSH B;  2KJB A;  3CDL A;  3G71 I;  2CG4 A;  2ZJP F;  4LG0 A;  3BR6 A;  1QU3 A;  1FNN A;  2DPU A;  3E6D A;  2O61 A;  4A3E J;  5FLV A;  1UST A;  3QOP A;  3IH3 A;  2OQG A;  2NAZ A;  4A2U A;  3HPG A;  4E7H A;  3HHG A;  1X1A A;  2E34 A;  1QNT A;  2R7Z J;  3I4P A;  3NAR A;  5D5W B;  2EIN H;  3RCO A;  3CCR I;  1SVO A;  4HSR A;  1B6A A;  1XDS A;  4GDF A;  1OYI A;  1S3J A;  2DJI A;  4GYI A;  1Z0X A;  2DMN A;  2LDU A;  2HYJ A;  4BJ6 C;  2CGP A;  1KYZ A;  3G2B A;  3JW4 A;  3GXO A;  3VYT B;  3R61 A;  1UG2 A;  4A0X A;  3TDZ C;  2KRH A;  5HLG A;  2QBY B;  2EK5 A;  5H2F C;  3J80 Z;  4HF2 A;  1D0Y A;  1OCT C;  4BY1 J;  5K1Y A;  3ESW B;  2KZG A;  4XQF A;  1D8K A;  1SD4 A;  3IWF A;  1IN4 A;  4HNV A;  3AG3 H;  3D0S A;  2GIV A;  3H3Z A;  3MKZ A;  1I1G A;  2GXA A;  1Z1D A;  1U2W A;  4L9J A;  3LMM A;  1BOB A;  2XPW A;  1W0T A;  2NOJ B;  3UNG C;  1CGP A;  3WTV C;  1TQI A;  4EJT A;  3J80 K;  1NG6 A;  1YW9 A;  1XGN A;  2Y75 A;  4NC6 A;  1FPQ A;  2R0Q C;  3DTE A;  3F3X A;  3S2D J;  4AD9 A;  1MD0 A;  2HTS A;  5B3S H;  3DPU A;  2X1C A;  3BG7 A;  3CMY A;  2GXG A;  4IPA A;  1WHU A;  1YYV A;  1P9Q C;  4HEA 2;  4M74 A;  2HYF A;  1IXR C;  2LRD A;  3KFW X;  1FZP B;  3CCY A;  2RC4 A;  2R5Y A;  1XGM A;  2OJE D;  3GEZ A;  4BXX J;  1ZLJ A;  1J0R A;  1P4A A;  1SFE A;  3KLN A;  2XSJ C;  3ABU A;  3H9G A;  1FC3 A;  2W57 A;  4L9V A;  4LLN A;  2QSH X;  3DKW A;  4FQG A;  5FFZ A;  3HOV J;  1ZG1 A;  2NVT J;  3IHU A;  3BQZ A;  3L1P A;  3QQA A;  4MHG A;  5K7F A;  2L9V A;  4M9Z A;  1DPU A;  4S05 A;  3CDH A;  2DOF A;  2C6Y A;  2JK3 A;  1I3A A;  2KHM A;  1TWH J;  1GLN A;  1TWC J;  2PJR A;  3GME A;  4DW6 A;  2FQ4 A;  3H9Q A;  5E3N A;  2PQ8 A;  2KIM A;  3I64 A;  4BYY A;  2E71 A;  1QVU A;  2VI6 A;  3K1M A;  5DS9 A;  2E5N A;  1IXC A;  3ZMD A;  3ZN0 A;  1S7E A;  4OIR F;  5L3D A;  4M6Y A;  1FT9 A;  2L4A A;  4DNC A;  1HST A;  5M5W J;  4RB3 C;  3BR1 A;  5CJ9 A;  3K2Z A;  1S8N A;  1A6Q A;  3W6K B;  2COM A;  4M3G A;  2Y9Y A;  4LB5 A;  4PJN A;  1OQY A;  3RKX A;  5TGT A;  2RNJ A;  4MGR A;  4BUP A;  1A5J A;  3BCA A;  2HKO A;  1D1C A;  1T6S A;  2PMZ A;  1ZGA A;  2X4H A;  4B4C A;  3GTG J;  2PEX A;  1Z3X A;  2VE8 A;  2Q8K A;  4UB8 C;  3QRF F;  2YSR A;  3K4K A;  2EV0 A;  1I3Q J;  1F36 A;  2BZT A;  1RKW A;  1QZZ A;  5DCF A;  3V42 A;  2LBF B;  2W82 A;  2MG4 A;  3DQV C;  3HSR A;  5LRR A;  1FBS A;  4A6E A;  1QZE A;  2VT2 A;  2W24 A;  4IOC F;  3TOB A;  3ZQH A;  2IAI A;  5H20 A;  2A6H F;  2DA2 A;  1JTX A;  4D7M A;  3RQ4 A;  1HOM A;  3LST A;  1WKM A;  2QBY A;  1OR7 C;  1WJF A;  5LGU A;  3RI4 A;  3S15 J;  1TWA J;  4YG2 F;  4FT8 A;  4G7O F;  1W0U A;  4RDU A;  4M71 A;  1YX3 A;  2DQR A;  4E7K A;  2ELK A;  5D5U B;  2X6W A;  3EUK L;  3OYM A;  3CLO A;  2CH0 A;  1HF0 A;  1PP8 F;  1WJE A;  1X1B A;  1XN7 A;  4HDU A;  1K61 A;  1OR7 A;  2M87 A;  3Q0U A;  4CUG A;  3I56 I;  1Z21 A;  2UZK A;  4IHS A;  2EFO A;  1IRZ A;  1WPK A;  2QQA A;  2O6G E;  1X58 A;  1R9T J;  3ONQ A;  4Y15 A;  2CV1 A;  2W84 A;  1QZY A;  4FE4 A;  3AG1 H;  3T8T A;  2IS4 A;  3K4B A;  3LQR A;  4KIF A;  2P5K A;  5E3L A;  2EJR A;  2UXX A;  4BL0 B;  1MJB A;  3J7Y J;  1BL0 A;  5EG0 B;  4FCY A;  2CQQ A;  2XUB A;  5E8G A;  1VQ9 I;  3LFU A;  3OYF A;  3J81 Z;  1G3W A;  3RYP A;  1ULY A;  1XSX A;  2IA0 A;  2M4G A;  2E36 A;  2KIU A;  1A6I A;  3EUH C;  1J7K A;  5HVQ C;  2HTJ A;  1JJ6 C;  1JJ8 C;  4M73 A;  4A5N A;  3CES A;  2I10 A;  2GIZ A;  2I8D A;  2KRC A;  4ITV A;  3KET A;  1R71 A;  2XRL A;  4BQO A;  1ETW A;  4C9Y A;  3OS1 A;  2FOW A;  2DOD A;  2COB A;  2OU2 A;  3FXJ A;  4XRM A;  2A69 F;  1WVR A;  1X4O A;  2ID6 A;  1JKQ C;  2WWY A;  1K78 B;  4B48 A;  2YX7 A;  3J81 K;  1TQM A;  4XKV A;  3AKZ A;  2EZH A;  3I54 A;  3B02 A;  4II2 A;  1AU7 A;  4IHT A;  3I53 A;  1YLF A;  1RUO A;  3LA2 A;  3V4G A;  3A2K A;  3X2Q H;  1X3U A;  5LLQ A;  2ETH A;  1ZG5 A;  2M1B A;  3GZ5 A;  3OYB A;  1SFU A;  2V9P A;  3OIP A;  3E6B A;  2UUZ A;  2M0M A;  3KZI C;  2ZKZ A;  4XLF A;  2VB6 A;  1TT0 A;  2JRT A;  2O8K A;  1ZEL A;  1SAN A;  1T0F C;  4JBA A;  4D7N A;  4IQJ A;  2XAG A;  1V3F A;  3HBL A;  4DQ2 A;  2FBI A;  4IHV A;  3A1Y A;  5DEQ A;  3S1R J;  4HNT A;  3H5N A;  1B4A A;  1MBG A;  4Y33 A;  3GZ6 A;  3V8J A;  2ZJ2 A;  3FZV A;  1T0F A;  1HSJ A;  5IYB J;  2TRT A;  1PDN C;  2ZFU A;  2EV6 A;  3SYT A;  1FBU A;  1RC9 A;  3K2A A;  5A2Q Z;  4KIS A;  3S32 A;  4BBR J;  2HOS A;  2DMP A;  2LBF A;  4RMN A;  2LF8 A;  4LK0 F;  1MMN A;  3VEP A;  3W2W A;  4E7Z A;  2CW7 A;  2D2W A;  2CYY A;  3QPH A;  4DJA A;  4E6K G;  1U6G A;  2M7B A;  4BAC A;  1XD7 A;  2M4K A;  4KN4 X;  2D5V A;  4A3K J;  1MSF C;  5JFR A;  3WE2 A;  4HZF A;  2BYV E;  2K5C A;  4CGZ A;  5C4X J;  4PJL A;  2LR8 A;  2O7O A;  5A2Q K;  2WB1 N;  4R79 A;  3EET A;  3DTI A;  3KYC B;  1LB2 A;  4Y4R A;  4E7I A;  4PGG A;  2GOX B;  1ONV A;  2FRH A;  2PMU A;  1VZ0 A;  4IRG A;  3M9A A;  1K83 J;  1SEU A;  1W5C C;  3WTZ A;  5F0F A;  4CZC A;  3LAJ A;  4D9J A;  3OMY A;  1NTC A;  2KP6 A;  1FWZ A;  4V19 K;  4R8H A;  2JA8 J;  3DKY A;  2BY2 A;  3IAM 2;  3GBG A;  1LFU P;  5D5V B;  1JHH A;  3KEQ A;  5EG0 A;  3O2P E;  4C3J J;  1IRF A;  1HW1 A;  3QYB A;  4D5C A;  4QTR A;  3OYJ A;  1IG7 A;  3BDD A;  2E2I J;  2QM3 A;  4R1H A;  2DFE A;  3ZQQ A;  5K7H A;  3VPR A;  1O4X A;  2DFH A;  3I4N J;  2K4J A;  1OJL A;  3BJO A;  1YX5 A;  4ZDL A;  4GXO A;  2OZU A;  4OMZ A;  1UHM A;  3W3C A;  2BW3 B;  5M3M J;  1Y1W J;  1UB9 A;  1BC8 C;  5CLS A;  4BE0 A;  4G6D A;  3FKJ A;  4S0H B;  5KAF C;  1FYM A;  2L7F P;  3PNY A;  1IUY A;  4KIT B;  1K78 A;  1LVK A;  1WFX A;  3O6B B;  4II3 A;  3LSP A;  2R7V A;  2MH2 A;  2ME0 A;  2BV6 A;  4HV6 A;  2DBB A;  3GX4 X;  3WG7 H;  5DUI A;  5DM6 F;  1H9G A;  3GFJ A;  3PO2 J;  3BQY A;  2R7Q A;  5EJC A;  5EF6 A;  3L09 A;  2A6E F;  1PP7 U;  3ASO H;  2VKE A;  4Q4Z F;  2A05 A;  4YIR X;  5D5X B;  4I99 C;  2WAF A;  2K9Q A;  1JUS A;  1DP3 A;  4BQQ A;  2XAF A;  3K9T A;  4B47 A;  3LNQ A;  2L9R A;  3CUO A;  1MMS A;  5JLX A;  3ZQF A;  2YR2 A;  1UAA A;  2JA7 J;  1E3H A;  2DT7 B;  3L2U A;  4A3M J;  1NK2 P;  3T8R A;  4MLO A;  4ZTJ A;  3H1C A;  3V7S A;  3E6C C;  4H0E A;  2EIJ H;  1IN8 A;  1QPM A;  3CME I;  3T0Y A;  3F8F A;  5IT9 Z;  4AYB A;  4HQM A;  4G7Z F;  2PMZ N;  3NWT A;  4G8X A;  3EYY A;  5B1A H;  1ZGW A;  1MMD A;  5E8I A;  4ENJ A;  2VOP A;  2EFQ A;  2DOA A;  1BBY A;  2DTR A;  1FP1 D;  2XAH A;  2WAD A;  3K70 D;  5FLM J;  2M3A A;  2XAQ A;  4V2G A;  4RAF A;  4CIC A;  4QIW N;  1ENH A;  2OZ6 A;  2IP2 A;  4PDK A;  1YW7 A;  4AVZ A;  3OYA A;  2O9L A;  1BIB A;  2ZME B;  4W1U A;  2VE9 A;  2UV1 A;  1XGO A;  3KIO A;  4CCJ A;  3PQJ A;  5IT9 K;  4YFN F;  1W7P D;  4KMU X;  4EJO A;  2QLZ A;  5KCM A;  3U2R A;  1WH5 A;  4CCM A;  2HXO A;  4RGS A;  3MAJ A;  1OYW A;  2V26 A;  3P7N A;  4F91 B;  4ABZ A;  5KK1 A;  3S14 J;  4I7H A;  5GTI C;  1FY7 A;  2RV8 A;  3S17 J;  1ZAO A;  1U5T C;  4UV9 A;  4G6Q A;  2Z3Y A;  3K4C A;  3S3N A;  3WU2 C;  2MBF A;  1LVA A;  2DW4 A;  1TWF J;  2A6T A;  2DFF A;  4M9S A;  1I6X A;  4QPQ A;  1YI2 I;  1U78 A;  2LY1 A;  4XLA A;  1Y39 A;  1VQ4 I;  1JHF A;  3PFI A;  4WXD A;  2FF4 A;  1HW2 A;  1AKH B;  2IVM A;  3DEU A;  4ZJZ A;  4ETS A;  1ZG3 A;  3WHC A;  4DYR A;  3UR3 C;  1WZ2 A;  1MNM C;  1AA7 A;  3MQ0 A;  1V54 H;  4MFD A;  4D5F A;  4JYK A;  4LIU A;  4RAZ A;  3VWB A;  1FLI A;  3LL7 A;  1CQT A;  3BR3 A;  3GTQ J;  2VPL A;  1XPX A;  2BW3 A;  3GO5 A;  1NG7 A;  3AL0 B;  3RSN A;  4WCG A;  1KU9 A;  4P5O A;  2KDZ A;  2HXI A;  2LY2 A;  3C2H A;  4IEJ A;  1UCR A;  1R58 A;  2L9S A;  3BR5 A;  1D5Y A;  2KLO A;  1MKM A;  3NAU A;  1R5I D;  2VQG A;  3TOA A;  3TQN A;  2XSD C;  2CQX A;  3JRG A;  2KPM A;  2EWN A;  2Y9Z A;  1MMG A;  3CCL I;  2P0W A;  2NVY J;  1XX5 A;  4MQ9 F;  2DI3 A;  1FMV A;  5FLX Z;  4F55 A;  5LGT A;  1U8B A;  1TL8 A;  5CVR A;  5HLI A;  5CPR B;  4LIT A;  5FRN A;  2OPT A;  2QGU A;  4ZYE A;  3QYE A;  2ZSI B;  2PI0 A;  3PL8 A;  2VBY A;  1MBJ A;  3GLX A;  4HF0 A;  5HDG A;  3SEZ A;  1HKQ A;  5KHD A;  2MC4 A;  4BHC A;  1H9T A;  4L0Z B;  5TIS C;  4AID A;  3ZXS A;  5L3C A;  1IJW C;  2Y2Z A;  5FLX K;  2M0C A;  3DBH B;  3K1N A;  3ZQI A;  4UVB A;  1RET A;  3VB2 A;  2WA0 A;  1H89 C;  1UEL B;  2I5U A;  1EF4 A;  3LA3 A;  2K7L A;  1R00 A;  2JMW A;  3KP4 A;  3QPT A;  5L3B A;  1S7A A;  1E3O C;  1W4M A;  3E3V A;  3QPL A;  4NC8 A;  3GTJ J;  4W97 A;  1ETX A;  1BA5 A;  2L7K A;  1DDN A;  4RAY A;  2ZME C;  3FMR A;  2QEN A;  2EA4 A;  1OFC X;  1TW2 A;  4BKX A;  3EUA A;  4BGD A;  4E4H A;  4AC0 A;  1R49 A;  1SMT A;  1FBQ A;  1O7L A;  2DK8 A;  4RGU A;  3L2Q A;  2AXL A;  2RQP A;  2Y30 A;  3T5X A;  4RM3 A;  2P7C B;  2ZME A;  3A4C A;  3OS2 A;  1JKP C;  3GTL J; 
#chains in the Genus database with same CATH homology
 2R7S A;  3VDX A;  4LG3 A;  3PSI A;  4DIQ A;  2CW8 A;  2KHM A;  2BOL A;  1T95 A;  1GLN A;  3LSI A;  3DU6 A;  2PJR A;  3H9Q A;  5JHF A;  2X1D A;  4BXF A;  4XN3 A;  4XKW A;  2IS6 A;  3S93 A;  1MMA A;  2XF7 A;  2E5N A;  4BS9 A;  3BCB A;  4CCO A;  4ZDO A;  4E7J A;  2HNH A;  3TL4 X;  3AL0 C;  2JVG A;  2VKH A;  3CF2 A;  3QYF A;  5CQE A;  2HVS A;  2IGM A;  3RTR A;  4NQW B;  3OYH A;  3K4J A;  3PJR A;  3L2W A;  4PJN A;  3SZG A;  2R4G A;  5TGT A;  2M7A A;  4BUP A;  3OYK A;  3J7A Y;  2E60 A;  3BCA A;  4ZDP A;  1D1C A;  3PNV A;  2PMZ A;  2WY7 Q;  2K9L A;  2E1M B;  2ZXI A;  3D5L A;  3CZ6 A;  2CS3 A;  1Z3X A;  3E0J B;  4BEH B;  2JSP A;  2V4J C;  4BQN A;  3K4K A;  4F3Q A;  2VL8 A;  3BC8 A;  2LH9 A;  2KZV A;  3U21 A;  4PFO A;  1WJA A;  2LBF B;  3V42 A;  2OV7 A;  4HRI A;  4DGW B;  2W82 A;  2IS1 A;  3DQV C;  2CMP A;  4ZTF A;  2HPI A;  3OYD A;  2WY8 Q;  2BVM A;  2X51 A;  2DCE A;  4BE1 A;  3OR1 C;  3LSG A;  3RQ4 A;  2W7N A;  2HPM A;  3PNT A;  2RRE A;  2WAE A;  3OWT A;  4XNF A;  1OR7 C;  1WJF A;  1LKX A;  3I3L A;  2HVQ A;  5KNL A;  2V9K A;  4C2T A;  4XM3 A;  1YX3 A;  3I9V 2;  1N75 A;  4H4K C;  3VSL A;  4J00 A;  4E7K A;  3VYU B;  4B44 A;  3HXL A;  2X6W A;  3EUK L;  3OYM A;  1V5G A;  3HUG B;  2CH0 A;  1WJC A;  3N05 A;  1WJE A;  1X1B A;  3DU5 A;  2OC6 A;  4G6T B;  1BR4 A;  3OL4 A;  4CUG A;  1Z21 A;  4C2U A;  4NC7 A;  2MAB A;  3ONQ A;  2VIX A;  2CV1 A;  4XKB A;  2IS4 A;  3K4B A;  3L2R A;  2VQL A;  4BL0 B;  1WJ5 A;  2VJJ A;  4XR6 A;  3PFY A;  2R7U A;  3LFU A;  3OYF A;  2MYS A;  2VJI A;  2VAS A;  2M4G A;  4HNU A;  4CCL A;  4ANJ A;  2LOO A;  3EUH C;  5HVQ C;  1EA3 A;  2X6Y A;  1FMW A;  1UG0 A;  2VKD A;  3CES A;  2I8D A;  2KRC A;  2E5Z A;  2LG4 A;  4ITV A;  1Z7L A;  4BQO A;  4FAS D;  4C9Y A;  3OS1 A;  4CSW A;  4N4O B;  3K70 C;  4PSX A;  1X4O A;  3AFH A;  4B48 A;  1Y56 A;  3ZGK A;  4XKV A;  3HOS A;  3AKZ A;  4EAT A;  4II2 A;  2F4I A;  1MNE A;  3A2K A;  2DT6 A;  1U0J A;  4OAZ A;  4ZC3 A;  3ZCO A;  3OYB A;  2GOM A;  4BE2 A;  2RNG A;  2MFZ A;  4PK4 A;  3OIP A;  3SEQ A;  5HNF A;  2UUZ A;  2M0M A;  4XLF A;  2Z2S B;  2VB6 A;  3DLA A;  4XLE A;  1TT0 A;  2LRE A;  3H5R A;  1ZEL A;  2R7O A;  3OYC A;  4YRV A;  1T0F C;  1JI8 A;  1J09 A;  3TMO A;  3HC7 A;  3DEE A;  3M8J A;  4IQJ A;  3CMM A;  4XLH A;  3A1Y A;  3PSF A;  3MKW B;  2W00 A;  5HNH A;  5CKT A;  4HNT A;  3H5N A;  2WBM A;  1E0E A;  4Y33 A;  3HG9 A;  3H35 A;  2FUG 2;  2ZFU A;  3SYT A;  2XF5 A;  4BEH A;  4CCK A;  1DGR M;  2R7W A;  4HG2 A;  1W36 C;  1PYV A;  3EPZ A;  1WJB A;  4KIS A;  3S32 A;  3K4M A;  2QKL B;  2X85 A;  4RMN A;  2LBF A;  4DOZ A;  1MMN A;  3W2W A;  4E7Z A;  2CW7 A;  3DPL C;  2VQC A;  1D1A A;  2KDO A;  4DJA A;  1PJR A;  4U87 A;  4E6K G;  2M7B A;  4BAC A;  1OLT A;  2M4K A;  2R7R A;  2HZD A;  3VYR B;  4DBQ A;  3M1C A;  4B3X A;  4E7L A;  2XAU A;  2VXZ A;  4JOM A;  2K5C A;  4PJL A;  1WJD A;  3MD2 A;  4R79 A;  4IX7 A;  3DTI A;  4Y4R A;  4E7I A;  2VJ5 A;  4GRI A;  2CV2 A;  3S3O A;  2GOX B;  4XL9 A;  4F52 A;  2CFO A;  1VZ0 A;  2BVL A;  2XDV A;  4RLF A;  2WAQ A;  4CZC A;  3IAS 2;  4D9J A;  3OMY A;  3CJQ B;  4RLQ A;  5HLT A;  4HST A;  4YEJ A;  3SDB A;  2KP6 A;  2F6C A;  2LC2 A;  2CUZ A;  2A5W A;  3DKY A;  2LYC A;  3IAM 2;  2MD0 A;  3GBG A;  1G59 A;  1N78 A;  2VXD A;  3OYJ A;  3QYB A;  4PFP A;  4BU2 A;  4QPO A;  4IQ4 A;  3ZQQ A;  4XOT A;  3IP4 B;  4X0G A;  4C30 A;  3OYE A;  3KEY A;  1YX5 A;  1SAU A;  3E1S A;  4ZDL A;  2HVR A;  4PJJ A;  5LFA A;  3TBI A;  4U7B A;  1V5E A;  4ZYA A;  3VYS B;  3W3C A;  2BW3 B;  3OYN A;  2ZXH A;  3H9J A;  4BE0 A;  2K9M A;  2RQQ A;  3FKJ A;  1D1B A;  2WB1 A;  3BLY A;  3F9K A;  1K6Y A;  3PNY A;  3FHN A;  2L9N A;  4KIT B;  2VQH A;  1LVK A;  1WFX A;  4II3 A;  4XN0 A;  2R7V A;  3HKZ A;  2Z1D A;  1SFK A;  2O5R A;  1HA8 A;  2JA2 A;  1IRX A;  2VLA A;  4FET A;  2CUJ A;  2R7Q A;  2KQR A;  4OAY A;  3K4L A;  4KT6 A;  4P1W A;  3DKX A;  2R7X A;  4NNJ A;  2KMU A;  2WAF A;  1DP3 A;  2F5V A;  3D5R C;  4BQQ A;  2JUG A;  2W4S A;  3W2V A;  3QOD A;  3OIQ A;  4B47 A;  2K3P A;  1UAA A;  3LSK A;  3OL3 A;  2DT7 B;  3L2U A;  3OYL A;  3HPH A;  4YEL A;  4MLO A;  4ZTJ A;  4N4N B;  3K6G A;  2IGK A;  2QKM B;  3OOU A;  4IZZ A;  1X4P A;  2E1M C;  3IUO A;  4F92 B;  4PUS A;  4AYB A;  1S9H A;  1LFP A;  1DGW Y;  2ELJ A;  3KX2 A;  3NWT A;  3VSK A;  3OYG A;  4BJ5 C;  1MMD A;  2R7T A;  2DOA A;  2WAD A;  3ZRG A;  5HOO A;  3L2V A;  3K70 D;  2M3A A;  2DXI A;  3RPU D;  4CH7 A;  4HPQ A;  2AQE A;  4CA0 A;  4AVZ A;  3DTK A;  3OYA A;  3QOE A;  4BDZ A;  1D0Z A;  2UV1 A;  4CCN A;  4CCJ A;  4XLC A;  3LSM A;  1YE9 A;  1BR2 A;  3CP8 A;  1ERD A;  5KCM A;  2VJ4 A;  4CCM A;  2V7F A;  2L2O A;  2V26 A;  1QHH D;  3DWL E;  2X1E A;  4F91 B;  4LIV A;  3S3M A;  2Y0S A;  1Y6I A;  1N77 A;  4Y3O A;  3S3N A;  3K4C A;  5FRO A;  2PJR B;  4KJZ A;  1X1D A;  1D0X A;  4IKF A;  1BR1 A;  3W2A A;  2A6T A;  4QPQ A;  3OR2 C;  3C2G A;  2LY1 A;  3CJR B;  4XLA A;  3CP2 A;  4E7S A;  4JQF A;  2XF6 A;  4ZJZ A;  1V5F A;  4XOP A;  2Q2E B;  2L5Q A;  4XON A;  3UR3 C;  1AA7 A;  3NWS A;  1W36 D;  3FBN B;  2Z16 A;  2HQA A;  4J01 A;  4LIU A;  2CV0 A;  2V6E A;  3VWB A;  3LL7 A;  2IGN A;  4BDY A;  2ZSH B;  1R6R A;  2VPL A;  3H5A A;  3FBI B;  2XC7 A;  1QU3 A;  2BW3 A;  2JVH A;  1NG7 A;  1G8X A;  2HDW A;  4PJM A;  3OY9 A;  4PSW A;  3AL0 B;  3RSN A;  4P5O A;  3D5S C;  3HPG A;  2LY2 A;  4E7H A;  3C2H A;  1MW7 A;  1X1A A;  1LDK B;  2L9S A;  2KLO A;  4XKC A;  2VQG A;  4F93 B;  2UWM A;  4B43 A;  3RCO A;  2KPM A;  3OS0 A;  1Z3Y A;  2OUM A;  4HSR A;  1MMG A;  2X6X A;  3MKY B;  1X19 A;  2P0W A;  2DJI A;  3S8P A;  1FMV A;  4BJ6 C;  3G2B A;  4D1Q A;  4F55 A;  3ZR8 X;  4XMY A;  1MND A;  2HU9 A;  4NUB A;  3K10 A;  3K4N A;  3VYT B;  5CPR B;  4LIT A;  5FRN A;  2KRH A;  1D0Y A;  2W1O A;  3QYE A;  5FRM A;  2ZSI B;  3PL8 A;  1TZL A;  1QHG A;  3BG6 A;  3SEZ A;  4XQF A;  4BJT A;  5KHD A;  2MC4 A;  3FDY A;  3ZXS A;  3PUB A;  3MKZ A;  3H0D A;  2WA0 A;  3LMM A;  1UEL B;  1BOB A;  5CQG A;  2NOJ B;  3UNG C;  4RM2 A;  4NC8 A;  3LSH A;  3HOT A;  2L7K A;  1NG6 A;  3HL2 A;  2V1N A;  2Q1Z B;  3DTE A;  5LD2 C;  2KL4 A;  1KON A;  3DPU A;  3MMY B;  2X1C A;  3BG7 A;  3OYI A;  1P9Q C;  2IS2 A;  3EUA A;  4HEA 2;  4BGD A;  4E4H A;  2LRD A;  4OWR B;  4XOR A;  3KYL A;  1DQU A;  3L2Q A;  1X1C A;  4RM3 A;  2IXS A;  3A4C A;  3OS2 A;  2XSJ C;  3H9G A;  3DPT A;  4AU7 A;  2IGO A;  4DBR A;  2AQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...