4BEHB

Solution structure of human ribosomal protein p1.p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of Human P1P2 Heterodimer Provides Insights Into the Role of Eukaryotic Stalk in Recruiting the Ribosome-Inactivating Protein Trichosanthin to the Ribosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords 60S ACIDIC RIBOSOMAL PROTEIN P1
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00428 Ribosomal_60s 60s Acidic ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4behB01
2W1OA 4BEHB 2LBFB 3A1YA 4BEHA 2LBFA
chains in the Genus database with same CATH superfamily
1CGPA 3GZNB 4LB6B 2M0MA 5ILSA 3VOEA 2WTEA 4M6XA 2VBXA 3HBLA 1FYLA 4RAGA 5GTHC 1P6RA 3F72A 2HEOA 5L3EA 4UUVA 3BG9A 2ZXWH 2CGPA 4JOMA 2UXNA 2EB7A 2ZO4A 4XR6A 1IRZA 2JUCA 1VNDA 2XRLA 3KYLA 3LMMA 3IAS2 2M7AA 4UUSB 2F4IA 4V2GA 2DBBA 4Z6YA 5JR3A 1ETOA 1WFXA 3KFWX 4XSZF 3F23A 5JI6A 1ZGWA 1PP7U 1I27A 1T6SA 2HQAA 2VOOA 3V42A 3OIOA 4RA2A 2K27A 2V9KA 3ELKA 1WRJA 1FMVA 4ESFA 5K7FA 2HXIA 5IOZA 2XF7A 3O3KA 2X85A 2CV1A 1Y8QB 5HS7A 5IY5H 2O7OA 5DDGA 4E7KA 2QQ9A 2WAEA 3OSGA 3J7AO 1GLNA 1X3UA 2XAFA 3K2ZA 4I6ZA 1TC3C 2M8GX 2BEOA 2RNJA 2IS2A 3R60A 2FD5A 5M3FJ 1TWFJ 2KIFA 3SDGA 1MSFC 4QPOA 1LFPA 3O8HA 4OIQF 2ZJRF 1NK3P 4KNYA 2H6BA 2ZB9A 3FXLA 5HLTA 2W24A 2FMLA 2E35A 2ZSHB 2OBPA 5D5UB 2TCTA 3PIOF 2ACJA 4LG0A 3U1DA 2KDZA 3WGHA 1IZ1A 1B4AA 1RZ4A 3DTKA 2QGUA 1Z91A 3LA7A 1JUSA 4P55A 2NS7A 1VZ0A 4A0YA 3M9AA 2XPVA 1KU3A 3BG3A 1WWXA 1IF1A 4LOCA 4ENNA 2DMQA 2HZTA 4XKWA 3OYKA 2WWYA 2K7LA 1D1AA 2TRTA 3IH2A 2FQ3A 5J47A 3GLLA 4NDLA 3U21A 4G6QA 2EINH 3ISPA 2HVQA 2RKHA 1I39A 4BL0B 1YG2A 3GCMA 5J1YA 1P4WA 4C3HJ 5EDNA 4CXFA 2GZWA 4UUSA 1RNLA 1O7LA 2IJLA 3EUHC 3JRBA 4X1EA 4A3FJ 2CUZA 4J19A 2VQLA 2E7XA 2Z16A 1A36A 1NTCA 3A0BC 4AWXB 2VPRA 5M5YJ 3OYFA 2FOKA 1QBJA 1SVMA 3WU0A 4D7MA 1OJLA 2IGKA 3D1NI 1K79A 1WVRA 2KRFA 2VB6A 3NAUA 1I1GA 2DT7B 2XGCA 2OCCH 2V7FA 4XLHA 2QA4I 1JT0A 1R58A 3PNVA 4XLNF 3LFUA 1KU9A 3K4MA 2CW7A 1S72I 2D45A 2DAOA 2PN6A 3FKJA 3KP5A 4NC8A 1S5LC 2EA2A 4C3JJ 3OR2C 4FE4A 2XB5A 3ABTA 5ICGA 5CLSA 1ZR2A 1ZRFA 4L18B 1SAUA 4F92B 1OLTA 1LJ9A 4IHXA 2CQKA 3H3ZA 4UB8C 2XAHA 4RAYA 3JREA 3DU6A 3LOCA 1ZG3A 4O5VA 4F93B 2STWA 2GA1A 5IP9J 4I09A 4LK1F 4LG0B 2VQHA 3HB9A 3GTPJ 2K3FA 2KIMA 4A93J 3E3VA 1ON2A 5GPAA 1WZ2A 1QU3A 3TGNA 4A5MA 4QLCU 3KZZA 1NK2P 3KZIC 1JKQC 2CV0A 1J2XA 3LAJA 3HRSA 4ZJZA 1ACIA 4EVIA 4F3QA 1K7AA 2VBYA 1K4SA 3CCUI 5E79C 1KU7A 5J40A 4CYDA 3M7GA 1ZH5A 1U3EM 2L3DA 4ANJA 2F5FA 5E17F 2AO9A 1D0ZA 2L7KA 2LKPA 5LGUA 1CF7B 1W0TA 5LEJA 1RIOH 4GDFA 4D5FA 2NAZA 2XGDA 3TL4X 3KYCB 5AIPA 4CYCB 2K4BA 3MKLA 2WY8Q 3BQZA 2XPWA 1D5VA 3DFGA 2OJED 2KL4A 2FNAA 2ECBA 2HDWA 2JPCA 4BKXA 5ED4A 4HQMA 4XLEA 1FP1D 1AU7A 1OFCX 4U87A 2NS8A 3FIWA 3L7WA 1UHMA 2ZSIB 1LNWA 3K10A 2Y31A 2ADUA 3RSNA 2PMHA 1Y8RB 1ZYRF 1IJWC 2DMPA 4AYBN 2ZJPF 3DTEA 2M5WA 2H1KA 1OISA 1TBXA 2CUEA 3PSFA 2ETHA 3CF2A 4Y4RA 2G7UA 2ELKA 4XLPF 1EH7A 3R0AA 2EJRA 1FP2A 2JA5J 3GTGJ 1UAAA 5F04A 2EZLA 2BE5F 2DFIA 2B0LA 2EIKH 1VQNI 1ETVA 1R6RA 1X3WB 1LE8A 2OQGA 2BVMA 2QQ8A 2KDOA 4A3EJ 3CC4I 1D8JA 3DLLF 4A3MJ 2CQXA 3V7RA 1P2FA 1IUFA 2EH3A 5JLXA 2E1NA 3GW2A 1IUYA 3G6EI 2M3AA 3NWTA 4I0AA 4AM3A 4Z2YA 3OL3A 1DU0A 2J5PA 2P5LC 1RR8C 1XGOA 2L9VA 1T95A 1VF9A 3L2WA 1B6AA 1LQ1A 5B66C 1OR7A 1K83J 2A3SA 1SFXA 2OUMA 1EH6A 2HPIA 2M45A 5DD8A 4F52A 1AWCA 2FE3A 4HF2A 2W25A 3CCVI 4A3JJ 1FBUA 3DPUA 4XRSG 3CUQB 3CF5F 1J7KA 2BHZA 5LD2C 3GTKJ 1MBEA 1H0MA 4BGDA 3R4KA 3VSKA 3M4OJ 2PQ8A 4Q5SF 1E17A 2BYVE 3WG9A 4B09A 5E3NA 3OYMA 2R3SA 3TDZC 2X6OA 3BR0A 4ENKA 1VFCA 3E6BA 3ZQHA 2VJ5A 3BWGA 1GT0C 1GDTA 4KA4A 4XLFA 3N97A 3A2KA 3M07A 1JT6A 1FY7A 2D2WA 3QOEA 2VL8A 3KX2A 2DOFA 3IH3A 2FUG2 4DW6A 1BW6A 3ABLH 4GO1A 3VEPA 5HOOA 3EUKL 1Z7UA 3I53A 5F64A 4XORA 2XSDC 1WJDA 1J75A 2JA2A 3EUAA 3W6JB 4QSHA 3E6MA 2RQQA 1MMSA 1XSVA 1KONA 3LSTA 4HV5A 3ZMDA 1IN5A 2KZVA 3RKWA 4RB1A 5FRNA 2ZJQF 4L5IA 2P81A 3DV8A 4FCYA 4WXDA 2NS0A 2X1DA 4HW0A 1QZYA 4XMYA 1HLVA 4QIWN 2OZUA 1W7PD 4MHGA 2DMUA 4EJUA 4DOZA 4M9SA 4RS8A 2VE9A 4KIBA 1FOYA 1E3HA 2F4MB 2R7TA 3SFZA 5IOYA 4N9HA 1UFMA 2VKVA 3ZMZA 4KN7X 5IYCJ 4KYWA 3S1NJ 3PQJA 3BR5A 1CF7A 1OCTC 1Z05A 4YFXF 2A6EF 4OIPF 3F8FA 1V54H 4M9ZA 4LLNA 4Y33A 5EEAA 3FK6A 1PVEA 2HKXA 2BOLA 2GIZA 5LHIA 1L0OC 3TQNA 1LDKB 2DU9A 3MZYA 3HPHA 3GFIA 4YFKF 1WPKA 3KEOA 3RKYA 4A3BJ 1TQPA 1O57A 3FDYA 1QA6A 2E2HJ 3DBHB 1APLC 3U1KA 4FX4A 1CQTA 2LY9A 3H92A 2DOEA 1VQOI 2LF8A 3GTOJ 4ZZDA 2HS5A 2NNNA 3FXUA 5BMZA 3CLOA 3P9KA 3DEUA 5FKMA 2VODA 1SFEA 1ZREA 4IHSA 3CJTB 3C7JA 2QSHX 3M8EA 2VE8A 1ORKA 4G7ZF 4XIDA 4OIOF 2Y30A 2A05A 3RIRA 5EGOA 3K1MA 1U9NA 3GFLA 2GLOA 2K9SA 1ZGJA 4PGGA 3SZGA 1R1TA 4HX8A 3V7CA 2CV2A 3RKXA 3ZQLA 1H9TA 2EV0A 4BS9A 1N25A 3PIPF 3VB2A 4E4HA 4RGUA 3AFHA 2QLZA 1YW9A 2YX4A 3CDIA 1LE8B 3X2QH 2W00A 6PAXA 1GHCA 1PYVA 3HM5A 4XLAA 5LHHA 2COMA 3BTIA 1S7EA 3VDXA 4HG2A 5GAHJ 1SD7A 2BXZA 4Y17A 2RNGA 2DA1A 2OPTA 2QENA 2FEZA 1HKTA 1DQUA 3LA2A 1K78B 1YJNI 4CCMA 1T0FA 1FOKA 1EKEA 4NC7A 1JTXA 2L5QA 3ZMUA 4ABZA 3L00A 2HR3A 1JKPC 4CICA 4LJZF 1MBJA 2IA1A 1SD5A 2Z2SB 1U0JA 4MLOA 4QPQA 1AKHB 2LR8A 1LUJB 1EJ9A 4BHPA 2EIJH 4Q47A 2HQRA 1OCOH 1KQ9A 1TW3A 2DMNA 2JMWA 4HPQA 1XX5A 2G0EA 4GXOA 5J1UA 5HLGA 2A6HF 2OU2A 2EIMH 3F8CA 1J9IA 4ENMA 3KZYA 4JBAA 2DA2A 3I64A 1UCRA 1MBKA 3M8JA 4KN4X 1IN6A 4II2A 5IP7J 1OKRA 4TV7A 2HYFA 3BZCA 3G1OA 4DYQA 1NG6A 1VQ4I 1W5CC 1MNEA 4EJWA 5FB2A 2R7SA 3FXKA 3HOZJ 1XSDA 2ID6A 1V3FA 1IN7A 2BZTA 3G4SI 2MGQA 1OYYA 2IS4A 3IHUA 3FK7A 4UNOA 1X1PA 2DPDA 3WTYC 1D3YA 3GBGA 3TP3A 1EF4A 2PBIA 5K7ZA 2W4SA 4G7HF 3F6OA 2FXAA 5D6EA 2HTSA 1GVDA 2XAJA 3CESA 4FHTA 3FM3A 2DA3A 3SEZA 4HV6A 2XUBA 3F22A 1HXDA 4OAYA 3LSKA 5GTIC 1ZG5A 3BR2A 3A0HC 4HLYA 2WAQA 4CCNA 2ZXIA 1JKRC 3OYBA 3HOYJ 5D5WB 5D5XB 2F2EA 4ON0A 3BPVA 3T5XA 2R7UA 2A5WA 3MMYB 2KISA 2CO5A 1AHDP 2D1VA 1R5ID 2DPUA 3S1MJ 2X4HA 3G1MA 2FBKA 3QODA 4UB6C 4DZPA 4C2UA 2CMPA 2V26A 1MBGA 3TW6A 2QSFX 3OS2A 3H9JA 1A35A 4B4CA 2E60A 3E5XA 2V1DA 2VI6A 5HLHA 3T1BA 4UV8A 3ULQB 5B5EC 4LGWA 4IO9F 1E0EA 1PDNC 1BL0A 1X3ZB 1TQIA 1LFBA 1T56A 2UZKA 1VQ9I 3L2CA 1E3OC 4OMYA 1V5EA 3WG7H 3HXLA 2LD5A 2FMYA 2RREA 1K6YA 1F1ZA 2PLYA 1YO5C 3CD6I 1E2XA 3DPTA 4UVBA 1MNMC 4XRSA 2HI3A 2K9NA 3A1YA 3MVPA 1Z3YA 1TL8A 1HQCA 1FC3A 3DP7A 3S2HJ 5HVQC 2ZNYA 2ZBKA 3LQRA 3K7AJ 1K4TA 1A6IA 2E71A 2UXXA 3IWFA 2M34A 1XPXA 2E7WA 3OYAA 1FOXA 4LD5A 1UG2A 3ABUA 3OSFA 3JCUC 3BPXA 2Y0SN 2EK5A 4HZFA 4UVAA 2HWVA 3JRHA 2R7QA 5CQEA 2L54A 1FSEA 1YQAA 3WU2C 3RZOJ 1X1DA 2N8GA 1JJ6C 2W84A 3QAHA 4LB5A 3G2BA 4BH9A 1FTTA 5J4YA 3KPHA 1IXCA 3C2GA 5K7HA 1W36C 2NNYA 1X2NA 5DCFA 4U0WA 3B73A 1S29A 4NC6A 5HDNA 2DA7A 2EBIA 4S04A 2JVGA 5DD4A 4CH7A 3C3WA 4PJ0C 3NQOA 1G3SA 2LNBA 2VIXA 3F6VA 4M74A 4YEJA 4RB3C 4IL6C 4NQWB 1YS6A 1XC5A 4A2UA 3FHZA 2R5YA 3ZQCA 3ML6A 1FNNA 2D1HA 2IA2A 5F1RA 2VC0A 4YG2F 5E18F 3HZJA 3REOA 5DTDA 2HPMA 2R7XA 2DT6A 4B8XA 1OMIA 3TOBA 3ZN1A 3F8MA 1Y0UA 2L7ZA 5J8FA 3FXMA 4A3IJ 2HGCA 1HDDC 4DNCA 1V5FA 2CS3A 5EZGA 1ZR4A 1BC8C 4IRIA 3KEYA 2V1XA 3BJOA 1SFUA 3JTGA 5L3FA 2IXSA 4PJJA 2QUFA 2R0QC 2LKSA 1KYWA 1RPWA 1K78A 2Y2ZA 1G8XA 4NBQA 4Q4ZF 2LY1A 1X1BA 2BY3A 5J3LA 2LBFA 2K3PA 5ILUA 1RESA 2COBA 4B48A 1D1BA 2CUFA 1BR4A 2WAQN 1T98A 3I0TA 2YS9A 3M8FA 2JZYA 4RM3A 3L2RA 4ASNA 4BE1A 1ZTRA 3EYIA 5ILVA 1X2MA 4DYRA 4HYEA 3OOPA 4PGHA 4C30A 2RQPA 2EZHA 1LDJA 2CG4A 2KZGA 2MLGA 4MTDA 4L0ZB 4KFCA 1MBFA 2NRAC 3FZVA 4JX5A 4R1HA 2ZJ2A 3E5UA 4PFOA 1ZARA 1FSHA 4MQ9F 5IPAA 1GVJA 4WF2A 5HNFA 3F0CA 2V79A 4S05A 5LRRA 1W4MA 3FBNB 2P8TA 3RDIA 2P7CB 3SZPA 5FRMA 2Y48A 3LSMA 5DS9A 5M5WJ 3HL2A 1G3WA 1D0YA 5FD6A 2WV1A 2WA0A 4BE2A 2H1LA 4KMUX 1AOYA 2ME0A 2J5OA 2ZMEB 3GLXA 4JP0A 3SDBA 3QOPA 5LHGA 4BY7J 1IRFA 2JVHA 5DCMB 3ZGKA 4A6EA 3DU5A 3LFKA 1ZG1A 1TQMA 2CQNA 1P4XA 3IRRA 3FX3A 4J00A 4HNVA 1WJAA 4U0VA 3AG3H 2KP6A 3KP6A 3LSPA 1G6NA 1R9TJ 3D5SC 2BY1A 1R00A 3BZ6A 5E8GA 2X6XA 3WE3A 1XSXA 1AKHA 1XDUA 4BXXJ 1S7AA 4L9TA 2L01A 1B9MA 5BS6A 3L9FA 4XICA 2FNPA 1O3QA 2XF5A 4CHUA 3H3VK 4BDYA 2PMUA 5BOXA 4AIDA 2AS5F 4HF1A 4X0GA 2L02A 1ON1A 3Q0VA 5CVJA 4LITA 4HX4A 2P5KA 2DT5A 3JRIA 1V55H 2Z5UA 1I1SA 2LLKA 1WHUA 2PG4A 1S6LA 1WSUA 3Q5FA 2V9PA 4I7HA 1SVLA 2YU3A 4K2EA 1MMAA 3GFMA 3L09A 1REPC 4EGZA 1UZCA 2VPLA 2CW8A 2MA3A 3JAMK 2QWWA 4RAFA 3RYRA 4IJAA 1IO2A 4RLFA 1ZLJA 2CJJA 3PQKA 3L2VA 1USTA 2HOSA 5CQGA 3MZ8A 4P5OA 2E1CA 4II3A 1T33A 3RPUA 1JXSA 5B3SH 3OS1A 3JRFA 5KK1A 3CCRI 2GWRA 5JLWA 2R5ZB 2H8RA 4RB2C 1I6XA 1Q1HA 3BP8A 2QYOA 4H4KC 3S3MA 5C4JJ 3U9GA 2I5UA 3KCCA 2ZC2A 3ERED 3SJMA 1P7JA 1R22A 3K2AA 1SD6A 4PK4A 2UWMA 4EJTA 2KPMA 5EEGA 3MN2A 2B7EA 5EZHA 2XPUA 1W7PB 2IA0A 1S3JA 2KLOA 2OQRA 2R7FA 2DYRH 1W0UA 3VYTB 4KT6A 1V5GA 3ZMVA 1R1UA 4UV9A 4BEHB 5IYBJ 3LA3A 2X0LA 3CCQI 1RKWA 3I3LA 5BPDA 5DEQA 5D6FA 3IH4A 3G73A 3HHHA 2LY2A 3D0SA 3GXOA 2QBYA 3S15J 3CUQC 5LGNA 1YOVB 1HW5A 1ZK8A 1KGSA 3S8PA 1R49A 2HU9A 1VQ8I 3IWZA 2KHMA 1Y56A 1HC8A 4PJNA 4A3GJ 1QHHD 3AG1H 4JQFA 5J4VA 1Z1DA 4YIFA 3LSRA 1FTZA 3OYLA 2PJPA 2BY2A 4E7HA 4XSXF 3VWBA 4DQ2A 2IGOA 3HDDA 1YI2I 1BR2A 4ESBA 1IV6A 3CCMI 3C1DA 3ESWB 3ZR8X 1FIPA 3JRDA 3CMYA 2E2IJ 2Z33A 1IDZA 3PNYA 2EZKA 2Y75A 2OA4A 2PJRA 1OR7C 1PJRA 3EQLF 2R7ZJ 2FJ1A 1ETQA 3DKWA 4P9FA 1JGGA 2EFOA 1WJBA 2ECCA 2JT1A 2WY7Q 2DW4A 4OAZA 2AXLA 4LLGF 3I59A 1WQ2A 3FMRA 5BNGA 4P9UA 2QKMB 2PX9A 3VFZA 2DJIA 3PSIA 3K4LA 4A3LJ 2PFBA 2GBYA 4E7IA 2HNHA 2LK2A 1X58A 3QYFA 1ZRDA 5B1BH 1Y39A 2MC3A 1HOMA 1XMAA 3NARA 4JX6A 4XM3A 3KP3A 3LSJA 4XK4A 4YFNF 3MD2A 1P9QC 3BQYA 2Q1ZB 4LIVA 1FWZA 2K02A 2K9LA 4B47A 4FT8A 4GYIA 3QPLA 1WH7A 2DFFA 2ESHA 3RPUD 5KCMA 2DK8A 2LMDA 5ICFA 4B1RA 4ITVA 2VBZA 3BR6A 3WTSC 4BYYA 2VASA 4FQGA 3QP6A 4CCJA 1H89C 4CCOA 2HDDA 4O3MA 2DJNA 1LVAA 3CDHA 2F5CA 2XASA 2BXYA 5FKNA 3HKZN 2R5YB 1C0WA 1F43A 1ENHA 3SHFA 4PDKA 1WH5A 2KMUA 3DEEA 2VUMJ 1UJ8A 1DGRM 3LSGA 3PUFA 2BVLA 5LBQA 3KLNA 2LH9A 2RGVA 1TP4A 2MD5A 3C2BA 3SZTA 1EA3A 1A31A 3V7SA 3DXJF 1JJ8C 1G2HA 3VPRA 1IN8A 2DOAA 2P6TA 1H9GA 3GUDA 4HNTA 4OOIA 2ZMEA 3U2RA 4UY8I 3OIQA 1WJEA 1DU6A 4IQ4A 4ZYAA 1UMQA 1YHQI 1QZEA 1N78A 4GGGA 2K4JA 4P1WA 2CH0A 1TWGJ 1JI8A 3CC2I 2X9DA 5IT3A 1BA5A 1O4XA 3P9IA 1D0XA 3LQQA 5JVTA 3S16J 2VJ4A 3AL0B 3A02A 3QRFF 3BG6A 3FXQA 2DFHA 3BCBA 2JPBA 4V2FA 1V4RA 1JTYA 1BOBA 3B6AA 2IBDA 2NVUB 3MZHA 4HOBA 5L3BA 4EGYA 3C18A 4CCKA 1OYWA 3WTZA 2LREA 3V4GA 3CLQA 2ICWG 2M4GA 2O9LA 1RRJA 1QVTA 4XL9A 1BJAA 1R5HA 2WB1A 2JSPA 4PJMA 2DCEA 2KJBA 3WTTC 1RUOA 5HODA 3OYCA 3GWZA 4G8XA 4LLLA 1USSA 3CUQA 3HRMA 3CO7C 4DIQA 5IT9Z 2V6CA 1LVKA 2K40A 2JA8J 3RQIA 1FX7A 2JRTA 3RTRA 1GUUA 1IGNA 4AVZA 1JGSA 2BW3B 3CCYA 2M8EA 3CJRB 2OZ6A 5DCMA 3GX4X 2HFHA 4RMNA 4Y52J 4YIIA 4KMFA 3D5LA 2HOTA 4MNUA 2DLLA 4NB5A 1FJLA 3S17J 2QVOA 4ETSA 1RKTA 5FLXK 2A68F 3HUGB 4N4NB 1B72A 3MKYB 1OPCA 1Z7LA 2YPRA 1YFHA 2GA2A 2FOWA 4ZH4F 3WGIA 5K5OA 4GFBA 4ZYHA 2VKHA 1VQMI 5F0CA 1BW5A 1FLIA 3DBLB 2ELJA 2R5ZA 2M4KA 4C2TA 3FISA 1XS9A 2OTLI 1AA7A 3O6BB 4C9YA 1TTYA 5F0HA 2DI3A 2DXIA 3QWLA 3I4MJ 1HSJA 4U0YA 2FU4A 1TWAJ 4HSTA 1JUPA 2HDCA 4ZYGA 2OD5A 3SYTA 2EZIA 2L9RA 4M72A 1A6QA 4AC0A 5AIQA 3QPHA 5E3OA 1PUFA 1YW7A 3G1LA 1HDPA 3I58A 1KYZA 3HEFA 1F5TA 1M1EB 5DM7F 2V4JC 1WI9A 2HTJA 3NWSA 3RQ4A 3ZMSA 2JA6J 5TISC 2CFXA 2VT2A 1SFOJ 1ETXA 1XN7A 5EG0A 4MEYF 3EUHA 2L2OA 3DKYA 1K61A 1G3YA 4HLXA 1R4MB 1U9OA 2V6EA 3FXOA 2RAEA 4L5JA 2MH2A 4LK0F 2YUSA 4U7BA 4AU7A 4PZJA 3K4BA 4RGXA 4CO8A 2LC2A 3B6CA 2HZDA 1BC7C 4RAZA 3CCEI 1HA8A 3OIPA 2XVCA 2ZNZA 1B1BA 3H5AA 3O8GA 2LDUA 4W97A 4R79A 2IEKA 2CQQA 5K5QA 2FSWA 3SQNA 2XAGA 4CGZA 1FEXA 2MLKA 5GPCA 4M6VA 1BJZA 1R36A 3DPLC 4MQVA 3H0DA 3NEUA 3J7AY 3GVAA 3SFIA 4EQQA 5EGOB 2F5VA 1IAWA 2V1UA 3HSFA 5GAEJ 3L2UA 2BY0A 1BBYA 2GXGA 4MIMA 3C2HA 3RPQA 2L9NA 4BJTA 1LFUP 5C4XJ 2QQBA 2CYYA 3W2WA 3PFIA 2M0CA 1ZN2A 5CVRA 2Y0MA 3H0GJ 5IT9K 3RKQA 1B72B 1BI0A 1JUMA 4EJVA 4H0EA 1MIJA 3OYIA 4XRMA 1R23A 3BCAA 1P4AA 1MKMA 1YE9A 5EYRA 2XROA 1OYIA 4GCVA 2X6WA 3BT9A 3H9GA 3PUBA 1FBSA 1XMKA 3ROUA 2DK5A 4Y7NJ 2PEXA 4CCLA 2IRFG 3ABKH 1XCVA 3K70C 1MJAA 1MBHA 3FF5A 1QQIA 2CRGA 3W6VA 1ODDA 2HQNA 3LL7A 4QWQA 3ZMTA 3KETA 2E36A 2L9SA 3V8LA 1ZAOA 2HKOA 4HAMA 1MMGA 1IN4A 1JHHA 3WTWC 1YIJI 2VC1A 3EYYA 3TEDA 3HOVJ 4M6YA 4CYCA 2LKXA 2HVSA 2E1MB 4I98B 1TT0A 5IP6A 1XGMA 3CMAI 4JYKA 3E6DA 3K4CA 3KE2A 1WJCA 4RBOA 2K9QA 3SXYA 3L2QA 5FFZA 4BDZA 3JTHA 1QPIA 4B44A 1Z21A 2XDVA 4B3XA 2H8WA 2GM4A 1GV2A 3F9KA 1UELB 2FA5A 1QZZA 2NVYJ 3BTLA 4M3GA 4A69C 2NVXJ 1GXQA 1XD7A 3RJPA 2M7BA 4HX7A 4A0ZA 3OYDA 1SAXA 3L1PA 1R1VA 5FLXZ 3DF8A 4M3FA 4NQWA 2JRMA 3MWMA 1U5TC 4FETA 5E3LA 1JKOC 1U78A 3S93A 4CA0A 2E2JJ 3ASOH 1QVUA 2FBIA 4IOCF 2X1EA 1TZLA 1BIAA 3VODA 4V19K 1U8RA 2QM3A 1MMDA 1VQ6I 2LVSA 2XV4S 1G59A 4Y15A 1R7JA 1QHGA 5L3CA 1XMXA 2A69F 3I4PA 5D8KB 2NXNB 3I5UA 1TWCJ 1T8IA 2R4GA 4OU0A 2R7RA 2OC6A 4OMZA 4XOPA 3CJNA 3QU3A 3FMQA 2ZKZA 2UV1A 2BW3A 2VXZA 3ZRGA 5H2FC 1KU2A 3BR1A 1XDSA 1MW7A 1GV5A 1Z67A 3F3XA 1B8IB 4D0PA 2C6YA 2AXTC 4D5CA 2LOOA 1Y6IA 2WB1N 2RVCA 5LRSA 1BI1A 2O5RA 2IGNA 3SEQA 4RGSA 3TOAA 3E5QA 5JHUA 2F4OB 4F7ZA 1HW2A 3ZCOA 4E7LA 3JRCA 1Y1WJ 2OV7A 1YTYA 4WXCA 4ESJA 2ID3A 3ZPLA 1HCRA 2JWTA 1KA8A 4KUMA 4P96A 4G6DA 1S9HA 4Q48A 2MH9A 3BROA 1IDYA 4I02A 5C44J 4IOAF 3CCLI 2CWEA 4IHYA 4FX0A 3HOSA 4BUPA 5B1AH 4GYGA 3RCOA 3DCFA 3K4NA 3P9CA 2LYCA 3HJEA 2KIUA 4EM1A 2DO7A 3IAM2 1X1CA 1VQ5I 3W2AA 2RN7A 3TMOA 3S1RJ 2KT0A 1VQ7I 3EDPA 2FX0A 1Y0NA 3I55I 2GQQA 4N0BA 3WTUC 1ITYA 2O6GE 3J7YJ 4FASD 2PMZN 4A3KJ 4BXFA 3E97A 1O3TA 3Q3SA 3HUGA 2R7DA 1SMYF 1FIAA 3BTCA 4LG3A 2EPFA 1ETWA 3PL8A 4XKCA 4DBQA 1DPUA 2XGEA 3PM1A 3TDUC 1SEUA 1QRYA 2L4MA 5DM6F 3AAFA 5M5XJ 1MDMA 2STTA 1UB9A 3J7ZI 3P7NA 3T8RA 4L5EA 4BHBA 4CZCA 1RUNA 5EF6A 2YSRA 4S0HB 1TNTA 4BY1J 2GOMA 2HOAA 2DFEA 1ZQ3P 2X51A 2F48A 3PNTA 3HGGA 1DP3A 5ICEA 5GAGJ 2L4AA 3CCSI 5FO5A 4L0YB 1DPRA 3LSIA 4M3BA 1YX5A 2G9WA 2FRHA 3UNGC 1T39A 1R5GA 4I01A 3OYEA 1VI0A 4E6KG 3HSRA 3CJQB 4HDUA 1YW8A 5FGMA 4G6TB 4ZYEA 5J8CA 5LLQA 2AQFA 3FXJA 3GTJJ 4G7OF 3OL4A 5DYMA 4E7JA 1B59A 1B9NA 3UR3C 5FKLA 4BJ6C 3Q0WA 3BC8A 2G7HA 1R4NB 2QCOA 1HSTA 1IG7A 5FFXA 2V1NA 3QYBA 3AG4H 2QSGX 4I99C 3RI4A 1YITI 3IRQA 1IRGA 5CVUA 2IT0A 2P5VA 2LBFB 2ISZA 3H5NA 4A5NA 4KITB 5L3GA 2DTRA 3HPGA 3F8BA 3W3CA 1YJWI 4B3AA 1Z6RA 3BG7A 5JFRA 1FZPB 3TO9A 1SD4A 1LEAA 3DEWA 3AG2H 1W7PA 1QNTA 4UXNA 1A5JA 4O6JA 2H09A 4M3DA 1LB2A 5H20A 1N75A 5TRDA 3CUOA 2DA6A 2DN0A 2EQRA 2VT3A 1YRNB 2YR2A 2VJJA 2W57A 3VYSB 2R92J 4NHJA 4G94A 4XN0A 1QO0D 2W82A 3A01B 5F08A 2CU7A 4HEA2 2IS6A 4BEHA 1OCRH 2M2EA 4PFPA 2M30A 2H6CA 2VJIA 2XRNA 2B63J 4BJ5C 3JSPA 1N77A 2QBYB 1WJ5A 4EMSA 1L3LA 5F6FA 3BY6A 4MEXF 3OR1C 3MCZA 1U8BA 2XF6A 4IHVA 2LTPA 1HBXG 1FMWA 3S3NA 4HA8A 3CDLA 4HBLA 1GXPA 2OCEA 1BI2A 3DBRB 3GMEA 2EV5A 2JUGA 4KISA 1IW7F 3CMEI 1IV8A 1KZHA 3CTAA 4R8HA 1F4KA 1X4PA 4G12A 3A4CA 3JRAA 4RM2A 3T8TA 2DQRA 1MD0A 3RZDJ 3M1EA 1PP8F 2BHYA 4FE7A 2JK3A 4BQOA 3R6SA 4E7SA 2PMZA 5DUIA 2DMTA 3AKZA 4I2OA 2ISYA 3KP7A 4DJAA 2F6CA 3N05A 2M1BA 4XBFA 4WK8F 2LSOA 3HKZA 3W6KB 4A3CJ 4BQQA 3G3ZA 1LEBA 3JSOA 4ENJA 1T38A 2VN2A 2RC4A 2O3FA 4FISA 4AUXA 1LPQA 1ONVA 5D8LB 1U2WA 5TJJA 2A07F 2ME6A 3COAC 1FYMA 4WCGA 5M3MJ 3GTQJ 2Z3YA 1X4OA 2MABA 3K0LA 3M1CA 3HTSB 1I5ZA 1RC9A 1QGPA 4A6DA 4EJOA 4NUBA 3F8NA 2EA4A 1E3PA 4IZZA 1G3TA 2B9SA 4AIKA 4AIJA 1YRNA 1ZHFA 3WE2A 2DODA 2IVMA 3H1CA 5CYVA 4C3IJ 2XAUA 1ZRCA 1SANA 3GEZA 1MDMB 2M9HA 3T0YA 3I9V2 1RI7A 2FF4A 2O8KA 4DGWB 3J81K 2EFPA 2I10A 1D8KA 5HLIA 1D5YA 2JJ7A 1Y1VJ 3MEXA 5CKTA 3ZQFA 1BM9A 2E1MC 3OY9A 2CUJA 2VBWA 2Z1DA 3IL2A 1I6HJ 2JSCA 4IKFA 2NOGA 3DTIA 3PJRA 4U7DA 4CZZA 1MNDA 1FPQA 4MFEA 1B8IA 2MW8A 2V9VA 3HRTA 2VKDA 4MFDA 2EV6A 2EWNA 2NYXA 1POGA 4IQJA 3IV5A 4L9JA 2IP2A 3S1QJ 2K5CA 1KQ0A 4WX9A 1ULYA 3GFJA 3IC7A 3BR3A 5DUKA 3IP4B 3IKVA 3VYRB 3HRUA 5FKOA 3CQZJ 4CUGA 3OYGA 3LAPA 4MO7A 1ERDA 2Y9ZA 5E1XA 1LDDA 3BZKA 4XRFA 3K1PA 2DQLA 4Y13A 2QZ8A 3MKZA 2Y69H 3ECHA 3BJ6A 1XGSA 2NVTJ 2VONA 3PO2J 3O2PE 1FOWA 1ZKGA 4OWRB 2WC2A 3N4MA 1EV7A 3OOUA 3I59B 2VLAA 2ZCWA 3V8JA 2P7VB 3BDDA 5AONA 2VXDA 3OYJA 5GADJ 1TT5B 2Y9YA 2HQ5A 3OYHA 1XTAA 1X1AA 3KP2A 3HOUJ 4A0XA 3GF2A 4XNFA 3G71I 1ZLKA 4XQFA 3CP2A 2R7WA 2AHQA 3KIOA 4BACA 1WGXA 5KHDA 1Z77A 1DGWY 1MSEC 2EFQA 4HF0A 2KIQA 5BQTA 2X48A 2MYSA 1MH3A 2A5YB 2R93J 1S8NA 3JRGA 3IUOA 2Z99A 2Q0OA 3ZQGA 2JA7J 1F9NA 2O0YA 2ESNA 4JX4A 4YIRX 3BTJA 4ZTFA 3J80K 4MTEA 3CO6C 4E7ZA 3K69A 1MZBA 3I71A 2Y0SA 4WWCA 4PUSA 1A04A 2WBMA 4HNUA 4EV0A 4ZDOA 4M71A 1VTNC 3JAMZ 5EEHA 3FXRA 4PSWA 4KJZA 2XB0X 4PJLA 1XCBA 5K1YA 3PO3J 2QKLB 1YLFA 4D1QA 4D7NA 3FKIJ 2XC7A 5E1ZB 3HHGA 3FBIB 1I3AA 2KQRA 3HTUA 2VKEA 3ABMH 2LFBA 1OQYA 2IAIA 5J6XA 4KIFA 5CVIA 4JK1X 2E5ZA 3FMSA 3VYUB 3BLYA 2GAUA 5H6QA 5A2QZ 2HOEA 5E3MA 1P92A 3CC7I 2JQ7A 3RYPA 1PUEE 1KQ8A 2MBFA 5TGTA 2IPQX 4EEFG 5KNLA 3HOTA 4MGRA 4YELA 1O3RA 1BIBA 1MMNA 2HYGD 1UG0A 5C3EJ 5IYDJ 4HSRA 4ZYDA 2A61A 1FBQA 4ZDLA 2CW0F 2Q8KA 3ZOBA 1O3SA 3WODF 1OCPA 4A12A 3ZQ7A 3EETA 3A01A 2WAFA 2DTZA 1MJBA 3Q9SA 2D5VA 4AD9A 4DBRA 3TP0A 3B02A 4XOTA 1XB4A 5KAIC 5L3DA 1YIOA 3MAJA 2F5DA 1NH3A 3GTMJ 1WJFA 4QTRA 4OIRF 3HC7A 2L7FP 2BV6A 4C2MJ 1YYVA 1IC8A 3ASNH 2DDAA 4NNJA 3QP5A 2OAZA 4DYCA 2H27A 2AQEA 1J09A 4A3DJ 1Z3XA 3LSHA 3QYEA 2FQ4A 4X6AJ 1RETA 4RB0A 5LEKA 2ZFWA 4F55A 3HSEA 4UVCA 2XKPA 1TNSA 2DA5A 4AYBA 2K85A 3QU6A 1I3QJ 4BAYA 3KYDB 2EILH 3VSLA 1U5TB 4DZJA 3K6GA 4IX7A 5EJCA 1PUFB 3MFKA 3P5JA 2I8DA 1F36A 1BN5A 4KICA 5A2QK 2M87A 4GRIA 5FJ8J 4XLCA 3EPZA 2IW5A 5D4RA 1IXRC 2QF7A 5EG0B 1ZGAA 3DWLE 4D9JA 2H94A 2ELHA 3GZ6A 3I4NJ 3W2VA 3Q0UA 2X6YA 2L0KA 3K4JA 1BOAA 1UHWA 2Q2EA 2VOPA 2W7NA 1Z9CA 4RGRA 1WKMA 3D5RC 2XHKA 4IF4A 4I0BA 4J01A 4N9IA 1DDNA 1HKQA 2PI0A 2MSYA 4EATA 3FWEA 4LMYA 5E8IA 1QPMA 1YJ9I 2RV8A 2VQGA 3J80Z 1T2KA 3K4KA 3OWTA 4LFUA 1Z6TA 3TO6A 5F27A 5CJ9A 4FTHA 2Z9OA 2CFOA 1O7FA 1NG7A 4XKBA 1Q1VA 1MGTA 1HW1A 1JE8A 2IGMA 2IS1A 1FT9A 4BU2A 4B43A 5FLVA 3I56I 1SC7A 2RDPA 2LRDA 5HS8A 3NRVA 3E6CC 1SVOA 3ZP5A 3A03A 3DQVC 3E0JB 2QEXI 2WV0A 1I50J 1J0RA 2E19A 2P0WA 3BOQA 3H5RA 4IXAA 2HYJA 4BBSJ 1UHSA 4KIGA 2E34A 1VQPI 3KLOA 2O61A 4BQAA 3AL0C 1T08B 4EM0B 2MD0A 5CVVA 4YRVA 1YX3A 2JTVA 4CSWA 3HGYA 5JHFA 1LKXA 2NOJB 2K9MA 3V8KA 3GTLJ 3H36A 1ETYA 2TDXA 1SMTA 2QQAA 1H88C 2MFZA 4XKVA 2HVRA 3CMMA 2LF7A 3MQ0A 4HRIA 3HG9A 1XG1A 3K1NA 4BE0A 2XSJC 1NHAA 1U5TA 5F0FA 4AIHA 3S2DJ 2EFNA 2KRCA 3WTXC 2O8XA 2BBYA 2ZMEC 3GO5A 1S7OA 3ONQA 3F21A 3ZN0A 5LGTA 4CDGA 3JW4A 1H8AC 3QPSA 4HQEA 2WADA 5D4SA 4BXUA 3I54A 3WHBA 1WI3A 3WHCA 4BHCA 1TWHJ 2OTJI 1TW2A 2DA4A 4KT5C 5GP9A 5HDGA 1W5SA 3PFYA 4ZDPA 5KVRA 5HDKA 2KRHA 3DKXA 1X19A 1VQLI 2LP0A 4RLQA 2W1OA 2YX7A 4RDUA 1YS7A 2GXBA 4BQNA 2CSOA 3R0JA 2X1CA 2E5NA 2JN6A 1W5TA 2GIVA 2YU9J 3R61A 4PSXA 3FM5A 2EFWA 5ERIA 3HIFA 1VQKI 5FD5A 2R7VA 3MKWB 4WXHA 2W85A 4I76A 1SFKA 4M9XA 2KFDA 3TW7A 4U88A 1U6GA 3JR9A 3J81Z 2FBHA 3CP8A 4XN3A 4IHTA 3KP4A 4E70A 3OV8A 5K5RA 4KDPA 2KKOA 1MJ9A 5BPIA 5FKKA 3BG5A 2O03A 2NVQJ 4PCQA 3GYHX 3E1SA 3ZXSA 2ZFUA 3QPTA 4IHWA 1T0FC 1BR1A 1Z0XA 3H35A 3S32A 2BGCA 2GXAA 3WTVC 2OF7A 1ZELA 4UUTA 1P7IA 1K6OA 4BBRJ 5ICCA 3OMYA 1OCZH 3H9QA 3WGGA 4ZC3A 3S14J 3DLAA 1JHFA 2HXOA 3FHNA 3ECOA 3ZQQA 5E1WA 3OYNA 3CCJI 4F91B 4N4OB 3IKTA 5HS9A 2P6SA 4AVPA 4ZTJA 2DDBA 4W1UA 3Q9VA 4Y3OA 4BNCA 4G9YA 1R71A 3GZ5A 4UHTA 4XONA 4IVNA 2PJRB 2MC4A 1OCCH 4EM2A 3S2WA 3LNQA 2Q2EB 2W48A 2VQCA 2XAQA 2ZXJA 5E20A 1EH8A 2CQ7A 4L9VA 1STZA 3S3OA 1FYKA 3BJAA 3QQAA 4L9NA 4OINF 3WU1B 3UKGA 2LG4A 4IRGA 2XGXA 1XGNA 4IEJA 2ZXHA 5LFAA 2XKOA 1IRXA 4LIUA 5H6RA 1HF0A 4ZZLA 2F5EA 2L7MP 3CZ6A 5CPRB 5HNHA 2DYSH 4IRHA 2UUZA 5F1JA 1D1CA 1WCMJ 2K86A 4M3EA 2MG4A 3H3UA 3OS0A 1RR7A 2A6TA 1J59A 3K70D 2R7OA 3TKYA 1IXSB 3KEQA 5DV5A 1DP7P 1DUXC 2P4WA 1ETKA 3LWFA 1TLHB 5D5VB 4HDVA 4IPAA 1W1WE 5FLMJ 5JVGF 1W36D 2KJCA 3E7LA 3K9TA 4M73A 5FROA 5KAFC 5J1RA 3HOXJ 3M3YJ 3HYIA 1J5YA 2XIGA 3TBIA 1G4DA 1BI3A 1HKSA 2E1OA 3ZQIA 3ERMA 3HOWJ 2GOXB 9ANTA 3TO7A 1MH4A
chains in the Genus database with same CATH topology
5CKTA 1LVKA 3M8JA 4II2A 2M0MA 2E1MC 3OY9A 2CUJA 3RTRA 1NG6A 2Z1DA 4AVZA 2BW3B 1MNEA 3CJRB 2R7SA 4IKFA 3DTIA 4RMNA 3PJRA 1MNDA 3D5LA 4JOMA 4XR6A 3HUGB 3KYLA 3LMMA 4N4NB 3IAS2 2IS4A 2VKDA 3MKYB 2M7AA 1Z7LA 2F4IA 3GBGA 4IQJA 2VKHA 1WFXA 2W4SA 2K5CA 2ELJA 2HQAA 2M4KA 4C2TA 3CESA 1AA7A 4C9YA 3V42A 3IP4B 3SEZA 2DXIA 2V9KA 3VYRB 4OAYA 3LSKA 1FMVA 4CUGA 3OYGA 2XF7A 2WAQA 2X85A 2CV1A 1ERDA 4HSTA 4CCNA 2ZXIA 3OYBA 3SYTA 3MKZA 4E7KA 2R7UA 2A5WA 3MMYB 2WAEA 1GLNA 2V4JC 3NWSA 2IS2A 3RQ4A 4OWRB 3QODA 4C2UA 2CMPA 2V26A 3OOUA 2VLAA 3OS2A 3H9JA 2L2OA 2E60A 3DKYA 2VXDA 4QPOA 3OYJA 1LFPA 2V6EA 3OYHA 1X1AA 1E0EA 4XNFA 5HLTA 4U7BA 4AU7A 4XQFA 3CP2A 2R7WA 2ZSHB 3K4BA 1V5EA 2LC2A 3HXLA 2RREA 1K6YA 2HZDA 4BACA 5KHDA 1DGWY 1HA8A 3DTKA 3OIPA 3H5AA 3DPTA 4R79A 1VZ0A 3A1YA 2MYSA 1Z3YA 3IUOA 5HVQC 3DPLC 3H0DA 4ZTFA 3J7AY 4XKWA 4E7ZA 3OYKA 2F5VA 3OYAA 1D1AA 2Y0SA 4PUSA 3L2UA 2WBMA 3U21A 4HNUA 3C2HA 2L9NA 4BJTA 4ZDOA 2HVQA 2R7QA 5CQEA 3W2WA 1X1DA 4BL0B 4PSWA 4KJZA 4PJLA 2QKLB 3G2BA 4D1QA 3C2GA 3OYIA 2XC7A 1W36C 3FBIB 2KQRA 3EUHC 2CUZA 3BCAA 2VQLA 1YE9A 2Z16A 2X6WA 3OYFA 3H9GA 2E5ZA 3PUBA 3VYUB 3BLYA 4CCLA 2IGKA 2JVGA 4CH7A 2VB6A 5TGTA 3K70C 3HOTA 2VIXA 5KNLA 4YEJA 2DT7B 4NQWB 2V7FA 4XLHA 4YELA 3PNVA 3LFUA 3K4MA 2CW7A 1MMNA 3LL7A 1UG0A 2L9SA 3FKJA 4HSRA 4NC8A 1MMGA 2HPMA 3OR2C 2R7XA 2DT6A 4ZDLA 2WAFA 1SAUA 2HVSA 2E1MB 4F92B 1OLTA 1TT0A 3K4CA 1WJCA 1V5FA 2CS3A 4DBRA 3L2QA 3DU6A 3KEYA 4XOTA 4F93B 4BDZA 4B44A 2IXSA 4PJJA 2VQHA 1Z21A 1WJFA 2XDVA 4B3XA 3HC7A 1G8XA 3F9KA 1UELB 2LY1A 1X1BA 1QU3A 2LBFA 2K3PA 4B48A 1D1BA 2CV0A 2M7BA 1BR4A 3OYDA 4ZJZA 4RM3A 4F3QA 3L2RA 4BE1A 4FETA 4NNJA 4C30A 3S93A 4CA0A 2AQEA 4ANJA 1J09A 1D0ZA 2L7KA 2X1EA 1TZLA 1Z3XA 4PFOA 3LSHA 3QYEA 5HNFA 1MMDA 1G59A 3TL4X 3FBNB 4F55A 1QHGA 2WY8Q 5FRMA 4AYBA 3LSMA 2KL4A 3VSLA 3HL2A 2HDWA 1D0YA 2R4GA 3K6GA 2WA0A 4BE2A 4IX7A 4XLEA 2R7RA 2OC6A 2I8DA 4XOPA 4U87A 2UV1A 3SDBA 2BW3A 2VXZA 3ZRGA 2JVHA 3ZGKA 4GRIA 3DU5A 1MW7A 4XLCA 2ZSIB 3EPZA 3K10A 4J00A 3RSNA 1WJAA 3DWLE 4D9JA 2KP6A 2LOOA 3DTEA 1Y6IA 3D5SC 2O5RA 2IGNA 3SEQA 3W2VA 2X6XA 2X6YA 3ZCOA 3K4JA 4E7LA 3PSFA 2OV7A 3CF2A 4Y4RA 2W7NA 3D5RC 4J01A 1S9HA 1UAAA 4EATA 2XF5A 4BDYA 2VQGA 3K4KA 3OWTA 4X0GA 4BUPA 3HOSA 3RCOA 1R6RA 4LITA 3K4NA 2CFOA 2LYCA 2BVMA 4XKBA 1NG7A 3IAM2 1X1CA 2KDOA 3W2AA 2IGMA 2IS1A 3TMOA 4B43A 1MMAA 2LRDA 2VPLA 2CW8A 3DQVC 3E0JB 4FASD 4RLFA 3L2VA 5CQGA 4P5OA 4BXFA 2P0WA 3H5RA 4II3A 2M3AA 3NWTA 3OL3A 3OS1A 4LG3A 3AL0C 3PL8A 1T95A 4XKCA 4DBQA 3L2WA 2MD0A 4YRVA 1YX3A 4CSWA 5JHFA 1LKXA 2NOJB 2K9MA 2OUMA 2HPIA 4H4KC 3S3MA 2MFZA 4XKVA 2HVRA 3CMMA 4CZCA 4F52A 4HRIA 2GOMA 3HG9A 3DPUA 4BE0A 2XSJC 2X51A 4PK4A 2UWMA 2KPMA 3PNTA 2KRCA 1DP3A 5LD2C 2KLOA 4BGDA 3VSKA 3ONQA 3VYTB 3OYMA 3LSIA 1YX5A 4KT6A 1V5GA 2VJ5A 3UNGC 3OYEA 4XLFA 4E6KG 2WADA 4BEHB 3A2KA 3CJQB 3QOEA 2VL8A 3I3LA 4G6TB 2AQFA 3KX2A 2FUG2 3OL4A 5HOOA 4E7JA 3EUKL 2LY2A 3PFYA 3UR3C 4ZDPA 4BJ6C 3BC8A 2KRHA 3DKXA 1X19A 4XORA 1WJDA 4RLQA 2V1NA 2W1OA 3QYBA 3S8PA 2HU9A 2JA2A 2KHMA 3EUAA 4BQNA 1Y56A 4PJNA 2RQQA 1QHHD 2X1CA 2E5NA 4JQFA 1KONA 3OYLA 4PSXA 2KZVA 2LBFB 4E7HA 3VWBA 5FRNA 3H5NA 4KITB 2IGOA 3HPGA 1BR2A 2R7VA 2X1DA 3W3CA 3MKWB 4XMYA 1SFKA 3ZR8X 3BG7A 4DOZA 3PNYA 3CP8A 2PJRA 1OR7C 1PJRA 4XN3A 2R7TA 1N75A 2VJJA 1WJBA 3VYSB 2WY7Q 4OAZA 4XN0A 2W82A 4Y33A 3E1SA 3ZXSA 4HEA2 2IS6A 2ZFUA 4BEHA 2QKMB 2BOLA 2DJIA 3PSIA 4PFPA 1LDKB 3K4LA 1T0FC 3HPHA 1BR1A 3H35A 3S32A 2HNHA 4E7IA 2VJIA 4BJ5C 3QYFA 1N77A 1ZELA 1WJ5A 3FDYA 3OMYA 4XM3A 3H9QA 3OR1C 4ZC3A 3DLAA 3MD2A 3FHNA 1P9QC 2XF6A 3ZQQA 3OYNA 2Q1ZB 1FMWA 3S3NA 4LIVA 2K9LA 4B47A 4F91B 4N4OB 4BU2A 2JUGA 4KISA 3RPUD 5KCMA 4ITVA 4ZTJA 2VASA 4Y3OA 4CCJA 4CCOA 1X4PA 4XONA 3A4CA 4RM2A 2PJRB 2MC4A 2Q2EB 2KMUA 3DEEA 2VQCA 3LSGA 1DGRM 2BVLA 3SZGA 3S3OA 2LH9A 4BQOA 4E7SA 2CV2A 2PMZA 3AKZA 1EA3A 4BS9A 4E4HA 3AFHA 4DJAA 2DOAA 2F6CA 2LG4A 3N05A 2W00A 3HKZA 1PYVA 4XLAA 4HNTA 2ZXHA 4BQQA 5LFAA 3VDXA 4HG2A 1IRXA 2RNGA 4LIUA 3OIQA 1WJEA 4IQ4A 4ZYAA 3CZ6A 5CPRB 1N78A 5HNHA 1DQUA 4CCMA 4P1WA 1JI8A 2CH0A 2UUZA 1D1CA 4NC7A 2L5QA 1X4OA 1D0XA 2MABA 3M1CA 3OS0A 2VJ4A 2A6TA 3AL0B 3BG6A 3K70D 2R7OA 2Z2SB 1U0JA 4MLOA 4NUBA 3BCBA 4QPQA 4IZZA 1BOBA 1W36D 2XAUA 4CCKA 2LREA 4HPQA 2M4GA 4XL9A 5FROA 3I9V2 2WB1A 2JSPA 4PJMA 3TBIA 2DCEA 4DGWB 3OYCA 2GOXB 4DIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1O A;  4BEH B;  2LBF B;  3A1Y A;  4BEH A;  2LBF A; 
#chains in the Genus database with same CATH topology
 1CGP A;  3GZN B;  4LB6 B;  2M0M A;  5ILS A;  3VOE A;  2WTE A;  4M6X A;  2VBX A;  3HBL A;  1FYL A;  4RAG A;  5GTH C;  1P6R A;  3F72 A;  2HEO A;  5L3E A;  4UUV A;  3BG9 A;  2ZXW H;  2CGP A;  4JOM A;  2UXN A;  2EB7 A;  2ZO4 A;  4XR6 A;  1IRZ A;  2JUC A;  1VND A;  2XRL A;  3KYL A;  3LMM A;  3IAS 2;  2M7A A;  4UUS B;  2F4I A;  4V2G A;  2DBB A;  4Z6Y A;  5JR3 A;  1ETO A;  1WFX A;  3KFW X;  4XSZ F;  3F23 A;  5JI6 A;  1ZGW A;  1PP7 U;  1I27 A;  1T6S A;  2HQA A;  2VOO A;  3V42 A;  3OIO A;  4RA2 A;  2K27 A;  2V9K A;  3ELK A;  1WRJ A;  1FMV A;  4ESF A;  5K7F A;  2HXI A;  5IOZ A;  2XF7 A;  3O3K A;  2X85 A;  2CV1 A;  1Y8Q B;  5HS7 A;  5IY5 H;  2O7O A;  5DDG A;  4E7K A;  2QQ9 A;  2WAE A;  3OSG A;  3J7A O;  1GLN A;  1X3U A;  2XAF A;  3K2Z A;  4I6Z A;  1TC3 C;  2M8G X;  2BEO A;  2RNJ A;  2IS2 A;  3R60 A;  2FD5 A;  5M3F J;  1TWF J;  2KIF A;  3SDG A;  1MSF C;  4QPO A;  1LFP A;  3O8H A;  4OIQ F;  2ZJR F;  1NK3 P;  4KNY A;  2H6B A;  2ZB9 A;  3FXL A;  5HLT A;  2W24 A;  2FML A;  2E35 A;  2ZSH B;  2OBP A;  5D5U B;  2TCT A;  3PIO F;  2ACJ A;  4LG0 A;  3U1D A;  2KDZ A;  3WGH A;  1IZ1 A;  1B4A A;  1RZ4 A;  3DTK A;  2QGU A;  1Z91 A;  3LA7 A;  1JUS A;  4P55 A;  2NS7 A;  1VZ0 A;  4A0Y A;  3M9A A;  2XPV A;  1KU3 A;  3BG3 A;  1WWX A;  1IF1 A;  4LOC A;  4ENN A;  2DMQ A;  2HZT A;  4XKW A;  3OYK A;  2WWY A;  2K7L A;  1D1A A;  2TRT A;  3IH2 A;  2FQ3 A;  5J47 A;  3GLL A;  4NDL A;  3U21 A;  4G6Q A;  2EIN H;  3ISP A;  2HVQ A;  2RKH A;  1I39 A;  4BL0 B;  1YG2 A;  3GCM A;  5J1Y A;  1P4W A;  4C3H J;  5EDN A;  4CXF A;  2GZW A;  4UUS A;  1RNL A;  1O7L A;  2IJL A;  3EUH C;  3JRB A;  4X1E A;  4A3F J;  2CUZ A;  4J19 A;  2VQL A;  2E7X A;  2Z16 A;  1A36 A;  1NTC A;  3A0B C;  4AWX B;  2VPR A;  5M5Y J;  3OYF A;  2FOK A;  1QBJ A;  1SVM A;  3WU0 A;  4D7M A;  1OJL A;  2IGK A;  3D1N I;  1K79 A;  1WVR A;  2KRF A;  2VB6 A;  3NAU A;  1I1G A;  2DT7 B;  2XGC A;  2OCC H;  2V7F A;  4XLH A;  2QA4 I;  1JT0 A;  1R58 A;  3PNV A;  4XLN F;  3LFU A;  1KU9 A;  3K4M A;  2CW7 A;  1S72 I;  2D45 A;  2DAO A;  2PN6 A;  3FKJ A;  3KP5 A;  4NC8 A;  1S5L C;  2EA2 A;  4C3J J;  3OR2 C;  4FE4 A;  2XB5 A;  3ABT A;  5ICG A;  5CLS A;  1ZR2 A;  1ZRF A;  4L18 B;  1SAU A;  4F92 B;  1OLT A;  1LJ9 A;  4IHX A;  2CQK A;  3H3Z A;  4UB8 C;  2XAH A;  4RAY A;  3JRE A;  3DU6 A;  3LOC A;  1ZG3 A;  4O5V A;  4F93 B;  2STW A;  2GA1 A;  5IP9 J;  4I09 A;  4LK1 F;  4LG0 B;  2VQH A;  3HB9 A;  3GTP J;  2K3F A;  2KIM A;  4A93 J;  3E3V A;  1ON2 A;  5GPA A;  1WZ2 A;  1QU3 A;  3TGN A;  4A5M A;  4QLC U;  3KZZ A;  1NK2 P;  3KZI C;  1JKQ C;  2CV0 A;  1J2X A;  3LAJ A;  3HRS A;  4ZJZ A;  1ACI A;  4EVI A;  4F3Q A;  1K7A A;  2VBY A;  1K4S A;  3CCU I;  5E79 C;  1KU7 A;  5J40 A;  4CYD A;  3M7G A;  1ZH5 A;  1U3E M;  2L3D A;  4ANJ A;  2F5F A;  5E17 F;  2AO9 A;  1D0Z A;  2L7K A;  2LKP A;  5LGU A;  1CF7 B;  1W0T A;  5LEJ A;  1RIO H;  4GDF A;  4D5F A;  2NAZ A;  2XGD A;  3TL4 X;  3KYC B;  5AIP A;  4CYC B;  2K4B A;  3MKL A;  2WY8 Q;  3BQZ A;  2XPW A;  1D5V A;  3DFG A;  2OJE D;  2KL4 A;  2FNA A;  2ECB A;  2HDW A;  2JPC A;  4BKX A;  5ED4 A;  4HQM A;  4XLE A;  1FP1 D;  1AU7 A;  1OFC X;  4U87 A;  2NS8 A;  3FIW A;  3L7W A;  1UHM A;  2ZSI B;  1LNW A;  3K10 A;  2Y31 A;  2ADU A;  3RSN A;  2PMH A;  1Y8R B;  1ZYR F;  1IJW C;  2DMP A;  4AYB N;  2ZJP F;  3DTE A;  2M5W A;  2H1K A;  1OIS A;  1TBX A;  2CUE A;  3PSF A;  2ETH A;  3CF2 A;  4Y4R A;  2G7U A;  2ELK A;  4XLP F;  1EH7 A;  3R0A A;  2EJR A;  1FP2 A;  2JA5 J;  3GTG J;  1UAA A;  5F04 A;  2EZL A;  2BE5 F;  2DFI A;  2B0L A;  2EIK H;  1VQN I;  1ETV A;  1R6R A;  1X3W B;  1LE8 A;  2OQG A;  2BVM A;  2QQ8 A;  2KDO A;  4A3E J;  3CC4 I;  1D8J A;  3DLL F;  4A3M J;  2CQX A;  3V7R A;  1P2F A;  1IUF A;  2EH3 A;  5JLX A;  2E1N A;  3GW2 A;  1IUY A;  3G6E I;  2M3A A;  3NWT A;  4I0A A;  4AM3 A;  4Z2Y A;  3OL3 A;  1DU0 A;  2J5P A;  2P5L C;  1RR8 C;  1XGO A;  2L9V A;  1T95 A;  1VF9 A;  3L2W A;  1B6A A;  1LQ1 A;  5B66 C;  1OR7 A;  1K83 J;  2A3S A;  1SFX A;  2OUM A;  1EH6 A;  2HPI A;  2M45 A;  5DD8 A;  4F52 A;  1AWC A;  2FE3 A;  4HF2 A;  2W25 A;  3CCV I;  4A3J J;  1FBU A;  3DPU A;  4XRS G;  3CUQ B;  3CF5 F;  1J7K A;  2BHZ A;  5LD2 C;  3GTK J;  1MBE A;  1H0M A;  4BGD A;  3R4K A;  3VSK A;  3M4O J;  2PQ8 A;  4Q5S F;  1E17 A;  2BYV E;  3WG9 A;  4B09 A;  5E3N A;  3OYM A;  2R3S A;  3TDZ C;  2X6O A;  3BR0 A;  4ENK A;  1VFC A;  3E6B A;  3ZQH A;  2VJ5 A;  3BWG A;  1GT0 C;  1GDT A;  4KA4 A;  4XLF A;  3N97 A;  3A2K A;  3M07 A;  1JT6 A;  1FY7 A;  2D2W A;  3QOE A;  2VL8 A;  3KX2 A;  2DOF A;  3IH3 A;  2FUG 2;  4DW6 A;  1BW6 A;  3ABL H;  4GO1 A;  3VEP A;  5HOO A;  3EUK L;  1Z7U A;  3I53 A;  5F64 A;  4XOR A;  2XSD C;  1WJD A;  1J75 A;  2JA2 A;  3EUA A;  3W6J B;  4QSH A;  3E6M A;  2RQQ A;  1MMS A;  1XSV A;  1KON A;  3LST A;  4HV5 A;  3ZMD A;  1IN5 A;  2KZV A;  3RKW A;  4RB1 A;  5FRN A;  2ZJQ F;  4L5I A;  2P81 A;  3DV8 A;  4FCY A;  4WXD A;  2NS0 A;  2X1D A;  4HW0 A;  1QZY A;  4XMY A;  1HLV A;  4QIW N;  2OZU A;  1W7P D;  4MHG A;  2DMU A;  4EJU A;  4DOZ A;  4M9S A;  4RS8 A;  2VE9 A;  4KIB A;  1FOY A;  1E3H A;  2F4M B;  2R7T A;  3SFZ A;  5IOY A;  4N9H A;  1UFM A;  2VKV A;  3ZMZ A;  4KN7 X;  5IYC J;  4KYW A;  3S1N J;  3PQJ A;  3BR5 A;  1CF7 A;  1OCT C;  1Z05 A;  4YFX F;  2A6E F;  4OIP F;  3F8F A;  1V54 H;  4M9Z A;  4LLN A;  4Y33 A;  5EEA A;  3FK6 A;  1PVE A;  2HKX A;  2BOL A;  2GIZ A;  5LHI A;  1L0O C;  3TQN A;  1LDK B;  2DU9 A;  3MZY A;  3HPH A;  3GFI A;  4YFK F;  1WPK A;  3KEO A;  3RKY A;  4A3B J;  1TQP A;  1O57 A;  3FDY A;  1QA6 A;  2E2H J;  3DBH B;  1APL C;  3U1K A;  4FX4 A;  1CQT A;  2LY9 A;  3H92 A;  2DOE A;  1VQO I;  2LF8 A;  3GTO J;  4ZZD A;  2HS5 A;  2NNN A;  3FXU A;  5BMZ A;  3CLO A;  3P9K A;  3DEU A;  5FKM A;  2VOD A;  1SFE A;  1ZRE A;  4IHS A;  3CJT B;  3C7J A;  2QSH X;  3M8E A;  2VE8 A;  1ORK A;  4G7Z F;  4XID A;  4OIO F;  2Y30 A;  2A05 A;  3RIR A;  5EGO A;  3K1M A;  1U9N A;  3GFL A;  2GLO A;  2K9S A;  1ZGJ A;  4PGG A;  3SZG A;  1R1T A;  4HX8 A;  3V7C A;  2CV2 A;  3RKX A;  3ZQL A;  1H9T A;  2EV0 A;  4BS9 A;  1N25 A;  3PIP F;  3VB2 A;  4E4H A;  4RGU A;  3AFH A;  2QLZ A;  1YW9 A;  2YX4 A;  3CDI A;  1LE8 B;  3X2Q H;  2W00 A;  6PAX A;  1GHC A;  1PYV A;  3HM5 A;  4XLA A;  5LHH A;  2COM A;  3BTI A;  1S7E A;  3VDX A;  4HG2 A;  5GAH J;  1SD7 A;  2BXZ A;  4Y17 A;  2RNG A;  2DA1 A;  2OPT A;  2QEN A;  2FEZ A;  1HKT A;  1DQU A;  3LA2 A;  1K78 B;  1YJN I;  4CCM A;  1T0F A;  1FOK A;  1EKE A;  4NC7 A;  1JTX A;  2L5Q A;  3ZMU A;  4ABZ A;  3L00 A;  2HR3 A;  1JKP C;  4CIC A;  4LJZ F;  1MBJ A;  2IA1 A;  1SD5 A;  2Z2S B;  1U0J A;  4MLO A;  4QPQ A;  1AKH B;  2LR8 A;  1LUJ B;  1EJ9 A;  4BHP A;  2EIJ H;  4Q47 A;  2HQR A;  1OCO H;  1KQ9 A;  1TW3 A;  2DMN A;  2JMW A;  4HPQ A;  1XX5 A;  2G0E A;  4GXO A;  5J1U A;  5HLG A;  2A6H F;  2OU2 A;  2EIM H;  3F8C A;  1J9I A;  4ENM A;  3KZY A;  4JBA A;  2DA2 A;  3I64 A;  1UCR A;  1MBK A;  3M8J A;  4KN4 X;  1IN6 A;  4II2 A;  5IP7 J;  1OKR A;  4TV7 A;  2HYF A;  3BZC A;  3G1O A;  4DYQ A;  1NG6 A;  1VQ4 I;  1W5C C;  1MNE A;  4EJW A;  5FB2 A;  2R7S A;  3FXK A;  3HOZ J;  1XSD A;  2ID6 A;  1V3F A;  1IN7 A;  2BZT A;  3G4S I;  2MGQ A;  1OYY A;  2IS4 A;  3IHU A;  3FK7 A;  4UNO A;  1X1P A;  2DPD A;  3WTY C;  1D3Y A;  3GBG A;  3TP3 A;  1EF4 A;  2PBI A;  5K7Z A;  2W4S A;  4G7H F;  3F6O A;  2FXA A;  5D6E A;  2HTS A;  1GVD A;  2XAJ A;  3CES A;  4FHT A;  3FM3 A;  2DA3 A;  3SEZ A;  4HV6 A;  2XUB A;  3F22 A;  1HXD A;  4OAY A;  3LSK A;  5GTI C;  1ZG5 A;  3BR2 A;  3A0H C;  4HLY A;  2WAQ A;  4CCN A;  2ZXI A;  1JKR C;  3OYB A;  3HOY J;  5D5W B;  5D5X B;  2F2E A;  4ON0 A;  3BPV A;  3T5X A;  2R7U A;  2A5W A;  3MMY B;  2KIS A;  2CO5 A;  1AHD P;  2D1V A;  1R5I D;  2DPU A;  3S1M J;  2X4H A;  3G1M A;  2FBK A;  3QOD A;  4UB6 C;  4DZP A;  4C2U A;  2CMP A;  2V26 A;  1MBG A;  3TW6 A;  2QSF X;  3OS2 A;  3H9J A;  1A35 A;  4B4C A;  2E60 A;  3E5X A;  2V1D A;  2VI6 A;  5HLH A;  3T1B A;  4UV8 A;  3ULQ B;  5B5E C;  4LGW A;  4IO9 F;  1E0E A;  1PDN C;  1BL0 A;  1X3Z B;  1TQI A;  1LFB A;  1T56 A;  2UZK A;  1VQ9 I;  3L2C A;  1E3O C;  4OMY A;  1V5E A;  3WG7 H;  3HXL A;  2LD5 A;  2FMY A;  2RRE A;  1K6Y A;  1F1Z A;  2PLY A;  1YO5 C;  3CD6 I;  1E2X A;  3DPT A;  4UVB A;  1MNM C;  4XRS A;  2HI3 A;  2K9N A;  3A1Y A;  3MVP A;  1Z3Y A;  1TL8 A;  1HQC A;  1FC3 A;  3DP7 A;  3S2H J;  5HVQ C;  2ZNY A;  2ZBK A;  3LQR A;  3K7A J;  1K4T A;  1A6I A;  2E71 A;  2UXX A;  3IWF A;  2M34 A;  1XPX A;  2E7W A;  3OYA A;  1FOX A;  4LD5 A;  1UG2 A;  3ABU A;  3OSF A;  3JCU C;  3BPX A;  2Y0S N;  2EK5 A;  4HZF A;  4UVA A;  2HWV A;  3JRH A;  2R7Q A;  5CQE A;  2L54 A;  1FSE A;  1YQA A;  3WU2 C;  3RZO J;  1X1D A;  2N8G A;  1JJ6 C;  2W84 A;  3QAH A;  4LB5 A;  3G2B A;  4BH9 A;  1FTT A;  5J4Y A;  3KPH A;  1IXC A;  3C2G A;  5K7H A;  1W36 C;  2NNY A;  1X2N A;  5DCF A;  4U0W A;  3B73 A;  1S29 A;  4NC6 A;  5HDN A;  2DA7 A;  2EBI A;  4S04 A;  2JVG A;  5DD4 A;  4CH7 A;  3C3W A;  4PJ0 C;  3NQO A;  1G3S A;  2LNB A;  2VIX A;  3F6V A;  4M74 A;  4YEJ A;  4RB3 C;  4IL6 C;  4NQW B;  1YS6 A;  1XC5 A;  4A2U A;  3FHZ A;  2R5Y A;  3ZQC A;  3ML6 A;  1FNN A;  2D1H A;  2IA2 A;  5F1R A;  2VC0 A;  4YG2 F;  5E18 F;  3HZJ A;  3REO A;  5DTD A;  2HPM A;  2R7X A;  2DT6 A;  4B8X A;  1OMI A;  3TOB A;  3ZN1 A;  3F8M A;  1Y0U A;  2L7Z A;  5J8F A;  3FXM A;  4A3I J;  2HGC A;  1HDD C;  4DNC A;  1V5F A;  2CS3 A;  5EZG A;  1ZR4 A;  1BC8 C;  4IRI A;  3KEY A;  2V1X A;  3BJO A;  1SFU A;  3JTG A;  5L3F A;  2IXS A;  4PJJ A;  2QUF A;  2R0Q C;  2LKS A;  1KYW A;  1RPW A;  1K78 A;  2Y2Z A;  1G8X A;  4NBQ A;  4Q4Z F;  2LY1 A;  1X1B A;  2BY3 A;  5J3L A;  2LBF A;  2K3P A;  5ILU A;  1RES A;  2COB A;  4B48 A;  1D1B A;  2CUF A;  1BR4 A;  2WAQ N;  1T98 A;  3I0T A;  2YS9 A;  3M8F A;  2JZY A;  4RM3 A;  3L2R A;  4ASN A;  4BE1 A;  1ZTR A;  3EYI A;  5ILV A;  1X2M A;  4DYR A;  4HYE A;  3OOP A;  4PGH A;  4C30 A;  2RQP A;  2EZH A;  1LDJ A;  2CG4 A;  2KZG A;  2MLG A;  4MTD A;  4L0Z B;  4KFC A;  1MBF A;  2NRA C;  3FZV A;  4JX5 A;  4R1H A;  2ZJ2 A;  3E5U A;  4PFO A;  1ZAR A;  1FSH A;  4MQ9 F;  5IPA A;  1GVJ A;  4WF2 A;  5HNF A;  3F0C A;  2V79 A;  4S05 A;  5LRR A;  1W4M A;  3FBN B;  2P8T A;  3RDI A;  2P7C B;  3SZP A;  5FRM A;  2Y48 A;  3LSM A;  5DS9 A;  5M5W J;  3HL2 A;  1G3W A;  1D0Y A;  5FD6 A;  2WV1 A;  2WA0 A;  4BE2 A;  2H1L A;  4KMU X;  1AOY A;  2ME0 A;  2J5O A;  2ZME B;  3GLX A;  4JP0 A;  3SDB A;  3QOP A;  5LHG A;  4BY7 J;  1IRF A;  2JVH A;  5DCM B;  3ZGK A;  4A6E A;  3DU5 A;  3LFK A;  1ZG1 A;  1TQM A;  2CQN A;  1P4X A;  3IRR A;  3FX3 A;  4J00 A;  4HNV A;  1WJA A;  4U0V A;  3AG3 H;  2KP6 A;  3KP6 A;  3LSP A;  1G6N A;  1R9T J;  3D5S C;  2BY1 A;  1R00 A;  3BZ6 A;  5E8G A;  2X6X A;  3WE3 A;  1XSX A;  1AKH A;  1XDU A;  4BXX J;  1S7A A;  4L9T A;  2L01 A;  1B9M A;  5BS6 A;  3L9F A;  4XIC A;  2FNP A;  1O3Q A;  2XF5 A;  4CHU A;  3H3V K;  4BDY A;  2PMU A;  5BOX A;  4AID A;  2AS5 F;  4HF1 A;  4X0G A;  2L02 A;  1ON1 A;  3Q0V A;  5CVJ A;  4LIT A;  4HX4 A;  2P5K A;  2DT5 A;  3JRI A;  1V55 H;  2Z5U A;  1I1S A;  2LLK A;  1WHU A;  2PG4 A;  1S6L A;  1WSU A;  3Q5F A;  2V9P A;  4I7H A;  1SVL A;  2YU3 A;  4K2E A;  1MMA A;  3GFM A;  3L09 A;  1REP C;  4EGZ A;  1UZC A;  2VPL A;  2CW8 A;  2MA3 A;  3JAM K;  2QWW A;  4RAF A;  3RYR A;  4IJA A;  1IO2 A;  4RLF A;  1ZLJ A;  2CJJ A;  3PQK A;  3L2V A;  1UST A;  2HOS A;  5CQG A;  3MZ8 A;  4P5O A;  2E1C A;  4II3 A;  1T33 A;  3RPU A;  1JXS A;  5B3S H;  3OS1 A;  3JRF A;  5KK1 A;  3CCR I;  2GWR A;  5JLW A;  2R5Z B;  2H8R A;  4RB2 C;  1I6X A;  1Q1H A;  3BP8 A;  2QYO A;  4H4K C;  3S3M A;  5C4J J;  3U9G A;  2I5U A;  3KCC A;  2ZC2 A;  3ERE D;  3SJM A;  1P7J A;  1R22 A;  3K2A A;  1SD6 A;  4PK4 A;  2UWM A;  4EJT A;  2KPM A;  5EEG A;  3MN2 A;  2B7E A;  5EZH A;  2XPU A;  1W7P B;  2IA0 A;  1S3J A;  2KLO A;  2OQR A;  2R7F A;  2DYR H;  1W0U A;  3VYT B;  4KT6 A;  1V5G A;  3ZMV A;  1R1U A;  4UV9 A;  4BEH B;  5IYB J;  3LA3 A;  2X0L A;  3CCQ I;  1RKW A;  3I3L A;  5BPD A;  5DEQ A;  5D6F A;  3IH4 A;  3G73 A;  3HHH A;  2LY2 A;  3D0S A;  3GXO A;  2QBY A;  3S15 J;  3CUQ C;  5LGN A;  1YOV B;  1HW5 A;  1ZK8 A;  1KGS A;  3S8P A;  1R49 A;  2HU9 A;  1VQ8 I;  3IWZ A;  2KHM A;  1Y56 A;  1HC8 A;  4PJN A;  4A3G J;  1QHH D;  3AG1 H;  4JQF A;  5J4V A;  1Z1D A;  4YIF A;  3LSR A;  1FTZ A;  3OYL A;  2PJP A;  2BY2 A;  4E7H A;  4XSX F;  3VWB A;  4DQ2 A;  2IGO A;  3HDD A;  1YI2 I;  1BR2 A;  4ESB A;  1IV6 A;  3CCM I;  3C1D A;  3ESW B;  3ZR8 X;  1FIP A;  3JRD A;  3CMY A;  2E2I J;  2Z33 A;  1IDZ A;  3PNY A;  2EZK A;  2Y75 A;  2OA4 A;  2PJR A;  1OR7 C;  1PJR A;  3EQL F;  2R7Z J;  2FJ1 A;  1ETQ A;  3DKW A;  4P9F A;  1JGG A;  2EFO A;  1WJB A;  2ECC A;  2JT1 A;  2WY7 Q;  2DW4 A;  4OAZ A;  2AXL A;  4LLG F;  3I59 A;  1WQ2 A;  3FMR A;  5BNG A;  4P9U A;  2QKM B;  2PX9 A;  3VFZ A;  2DJI A;  3PSI A;  3K4L A;  4A3L J;  2PFB A;  2GBY A;  4E7I A;  2HNH A;  2LK2 A;  1X58 A;  3QYF A;  1ZRD A;  5B1B H;  1Y39 A;  2MC3 A;  1HOM A;  1XMA A;  3NAR A;  4JX6 A;  4XM3 A;  3KP3 A;  3LSJ A;  4XK4 A;  4YFN F;  3MD2 A;  1P9Q C;  3BQY A;  2Q1Z B;  4LIV A;  1FWZ A;  2K02 A;  2K9L A;  4B47 A;  4FT8 A;  4GYI A;  3QPL A;  1WH7 A;  2DFF A;  2ESH A;  3RPU D;  5KCM A;  2DK8 A;  2LMD A;  5ICF A;  4B1R A;  4ITV A;  2VBZ A;  3BR6 A;  3WTS C;  4BYY A;  2VAS A;  4FQG A;  3QP6 A;  4CCJ A;  1H89 C;  4CCO A;  2HDD A;  4O3M A;  2DJN A;  1LVA A;  3CDH A;  2F5C A;  2XAS A;  2BXY A;  5FKN A;  3HKZ N;  2R5Y B;  1C0W A;  1F43 A;  1ENH A;  3SHF A;  4PDK A;  1WH5 A;  2KMU A;  3DEE A;  2VUM J;  1UJ8 A;  1DGR M;  3LSG A;  3PUF A;  2BVL A;  5LBQ A;  3KLN A;  2LH9 A;  2RGV A;  1TP4 A;  2MD5 A;  3C2B A;  3SZT A;  1EA3 A;  1A31 A;  3V7S A;  3DXJ F;  1JJ8 C;  1G2H A;  3VPR A;  1IN8 A;  2DOA A;  2P6T A;  1H9G A;  3GUD A;  4HNT A;  4OOI A;  2ZME A;  3U2R A;  4UY8 I;  3OIQ A;  1WJE A;  1DU6 A;  4IQ4 A;  4ZYA A;  1UMQ A;  1YHQ I;  1QZE A;  1N78 A;  4GGG A;  2K4J A;  4P1W A;  2CH0 A;  1TWG J;  1JI8 A;  3CC2 I;  2X9D A;  5IT3 A;  1BA5 A;  1O4X A;  3P9I A;  1D0X A;  3LQQ A;  5JVT A;  3S16 J;  2VJ4 A;  3AL0 B;  3A02 A;  3QRF F;  3BG6 A;  3FXQ A;  2DFH A;  3BCB A;  2JPB A;  4V2F A;  1V4R A;  1JTY A;  1BOB A;  3B6A A;  2IBD A;  2NVU B;  3MZH A;  4HOB A;  5L3B A;  4EGY A;  3C18 A;  4CCK A;  1OYW A;  3WTZ A;  2LRE A;  3V4G A;  3CLQ A;  2ICW G;  2M4G A;  2O9L A;  1RRJ A;  1QVT A;  4XL9 A;  1BJA A;  1R5H A;  2WB1 A;  2JSP A;  4PJM A;  2DCE A;  2KJB A;  3WTT C;  1RUO A;  5HOD A;  3OYC A;  3GWZ A;  4G8X A;  4LLL A;  1USS A;  3CUQ A;  3HRM A;  3CO7 C;  4DIQ A;  5IT9 Z;  2V6C A;  1LVK A;  2K40 A;  2JA8 J;  3RQI A;  1FX7 A;  2JRT A;  3RTR A;  1GUU A;  1IGN A;  4AVZ A;  1JGS A;  2BW3 B;  3CCY A;  2M8E A;  3CJR B;  2OZ6 A;  5DCM A;  3GX4 X;  2HFH A;  4RMN A;  4Y52 J;  4YII A;  4KMF A;  3D5L A;  2HOT A;  4MNU A;  2DLL A;  4NB5 A;  1FJL A;  3S17 J;  2QVO A;  4ETS A;  1RKT A;  5FLX K;  2A68 F;  3HUG B;  4N4N B;  1B72 A;  3MKY B;  1OPC A;  1Z7L A;  2YPR A;  1YFH A;  2GA2 A;  2FOW A;  4ZH4 F;  3WGI A;  5K5O A;  4GFB A;  4ZYH A;  2VKH A;  1VQM I;  5F0C A;  1BW5 A;  1FLI A;  3DBL B;  2ELJ A;  2R5Z A;  2M4K A;  4C2T A;  3FIS A;  1XS9 A;  2OTL I;  1AA7 A;  3O6B B;  4C9Y A;  1TTY A;  5F0H A;  2DI3 A;  2DXI A;  3QWL A;  3I4M J;  1HSJ A;  4U0Y A;  2FU4 A;  1TWA J;  4HST A;  1JUP A;  2HDC A;  4ZYG A;  2OD5 A;  3SYT A;  2EZI A;  2L9R A;  4M72 A;  1A6Q A;  4AC0 A;  5AIQ A;  3QPH A;  5E3O A;  1PUF A;  1YW7 A;  3G1L A;  1HDP A;  3I58 A;  1KYZ A;  3HEF A;  1F5T A;  1M1E B;  5DM7 F;  2V4J C;  1WI9 A;  2HTJ A;  3NWS A;  3RQ4 A;  3ZMS A;  2JA6 J;  5TIS C;  2CFX A;  2VT2 A;  1SFO J;  1ETX A;  1XN7 A;  5EG0 A;  4MEY F;  3EUH A;  2L2O A;  3DKY A;  1K61 A;  1G3Y A;  4HLX A;  1R4M B;  1U9O A;  2V6E A;  3FXO A;  2RAE A;  4L5J A;  2MH2 A;  4LK0 F;  2YUS A;  4U7B A;  4AU7 A;  4PZJ A;  3K4B A;  4RGX A;  4CO8 A;  2LC2 A;  3B6C A;  2HZD A;  1BC7 C;  4RAZ A;  3CCE I;  1HA8 A;  3OIP A;  2XVC A;  2ZNZ A;  1B1B A;  3H5A A;  3O8G A;  2LDU A;  4W97 A;  4R79 A;  2IEK A;  2CQQ A;  5K5Q A;  2FSW A;  3SQN A;  2XAG A;  4CGZ A;  1FEX A;  2MLK A;  5GPC A;  4M6V A;  1BJZ A;  1R36 A;  3DPL C;  4MQV A;  3H0D A;  3NEU A;  3J7A Y;  3GVA A;  3SFI A;  4EQQ A;  5EGO B;  2F5V A;  1IAW A;  2V1U A;  3HSF A;  5GAE J;  3L2U A;  2BY0 A;  1BBY A;  2GXG A;  4MIM A;  3C2H A;  3RPQ A;  2L9N A;  4BJT A;  1LFU P;  5C4X J;  2QQB A;  2CYY A;  3W2W A;  3PFI A;  2M0C A;  1ZN2 A;  5CVR A;  2Y0M A;  3H0G J;  5IT9 K;  3RKQ A;  1B72 B;  1BI0 A;  1JUM A;  4EJV A;  4H0E A;  1MIJ A;  3OYI A;  4XRM A;  1R23 A;  3BCA A;  1P4A A;  1MKM A;  1YE9 A;  5EYR A;  2XRO A;  1OYI A;  4GCV A;  2X6W A;  3BT9 A;  3H9G A;  3PUB A;  1FBS A;  1XMK A;  3ROU A;  2DK5 A;  4Y7N J;  2PEX A;  4CCL A;  2IRF G;  3ABK H;  1XCV A;  3K70 C;  1MJA A;  1MBH A;  3FF5 A;  1QQI A;  2CRG A;  3W6V A;  1ODD A;  2HQN A;  3LL7 A;  4QWQ A;  3ZMT A;  3KET A;  2E36 A;  2L9S A;  3V8L A;  1ZAO A;  2HKO A;  4HAM A;  1MMG A;  1IN4 A;  1JHH A;  3WTW C;  1YIJ I;  2VC1 A;  3EYY A;  3TED A;  3HOV J;  4M6Y A;  4CYC A;  2LKX A;  2HVS A;  2E1M B;  4I98 B;  1TT0 A;  5IP6 A;  1XGM A;  3CMA I;  4JYK A;  3E6D A;  3K4C A;  3KE2 A;  1WJC A;  4RBO A;  2K9Q A;  3SXY A;  3L2Q A;  5FFZ A;  4BDZ A;  3JTH A;  1QPI A;  4B44 A;  1Z21 A;  2XDV A;  4B3X A;  2H8W A;  2GM4 A;  1GV2 A;  3F9K A;  1UEL B;  2FA5 A;  1QZZ A;  2NVY J;  3BTL A;  4M3G A;  4A69 C;  2NVX J;  1GXQ A;  1XD7 A;  3RJP A;  2M7B A;  4HX7 A;  4A0Z A;  3OYD A;  1SAX A;  3L1P A;  1R1V A;  5FLX Z;  3DF8 A;  4M3F A;  4NQW A;  2JRM A;  3MWM A;  1U5T C;  4FET A;  5E3L A;  1JKO C;  1U78 A;  3S93 A;  4CA0 A;  2E2J J;  3ASO H;  1QVU A;  2FBI A;  4IOC F;  2X1E A;  1TZL A;  1BIA A;  3VOD A;  4V19 K;  1U8R A;  2QM3 A;  1MMD A;  1VQ6 I;  2LVS A;  2XV4 S;  1G59 A;  4Y15 A;  1R7J A;  1QHG A;  5L3C A;  1XMX A;  2A69 F;  3I4P A;  5D8K B;  2NXN B;  3I5U A;  1TWC J;  1T8I A;  2R4G A;  4OU0 A;  2R7R A;  2OC6 A;  4OMZ A;  4XOP A;  3CJN A;  3QU3 A;  3FMQ A;  2ZKZ A;  2UV1 A;  2BW3 A;  2VXZ A;  3ZRG A;  5H2F C;  1KU2 A;  3BR1 A;  1XDS A;  1MW7 A;  1GV5 A;  1Z67 A;  3F3X A;  1B8I B;  4D0P A;  2C6Y A;  2AXT C;  4D5C A;  2LOO A;  1Y6I A;  2WB1 N;  2RVC A;  5LRS A;  1BI1 A;  2O5R A;  2IGN A;  3SEQ A;  4RGS A;  3TOA A;  3E5Q A;  5JHU A;  2F4O B;  4F7Z A;  1HW2 A;  3ZCO A;  4E7L A;  3JRC A;  1Y1W J;  2OV7 A;  1YTY A;  4WXC A;  4ESJ A;  2ID3 A;  3ZPL A;  1HCR A;  2JWT A;  1KA8 A;  4KUM A;  4P96 A;  4G6D A;  1S9H A;  4Q48 A;  2MH9 A;  3BRO A;  1IDY A;  4I02 A;  5C44 J;  4IOA F;  3CCL I;  2CWE A;  4IHY A;  4FX0 A;  3HOS A;  4BUP A;  5B1A H;  4GYG A;  3RCO A;  3DCF A;  3K4N A;  3P9C A;  2LYC A;  3HJE A;  2KIU A;  4EM1 A;  2DO7 A;  3IAM 2;  1X1C A;  1VQ5 I;  3W2A A;  2RN7 A;  3TMO A;  3S1R J;  2KT0 A;  1VQ7 I;  3EDP A;  2FX0 A;  1Y0N A;  3I55 I;  2GQQ A;  4N0B A;  3WTU C;  1ITY A;  2O6G E;  3J7Y J;  4FAS D;  2PMZ N;  4A3K J;  4BXF A;  3E97 A;  1O3T A;  3Q3S A;  3HUG A;  2R7D A;  1SMY F;  1FIA A;  3BTC A;  4LG3 A;  2EPF A;  1ETW A;  3PL8 A;  4XKC A;  4DBQ A;  1DPU A;  2XGE A;  3PM1 A;  3TDU C;  1SEU A;  1QRY A;  2L4M A;  5DM6 F;  3AAF A;  5M5X J;  1MDM A;  2STT A;  1UB9 A;  3J7Z I;  3P7N A;  3T8R A;  4L5E A;  4BHB A;  4CZC A;  1RUN A;  5EF6 A;  2YSR A;  4S0H B;  1TNT A;  4BY1 J;  2GOM A;  2HOA A;  2DFE A;  1ZQ3 P;  2X51 A;  2F48 A;  3PNT A;  3HGG A;  1DP3 A;  5ICE A;  5GAG J;  2L4A A;  3CCS I;  5FO5 A;  4L0Y B;  1DPR A;  3LSI A;  4M3B A;  1YX5 A;  2G9W A;  2FRH A;  3UNG C;  1T39 A;  1R5G A;  4I01 A;  3OYE A;  1VI0 A;  4E6K G;  3HSR A;  3CJQ B;  4HDU A;  1YW8 A;  5FGM A;  4G6T B;  4ZYE A;  5J8C A;  5LLQ A;  2AQF A;  3FXJ A;  3GTJ J;  4G7O F;  3OL4 A;  5DYM A;  4E7J A;  1B59 A;  1B9N A;  3UR3 C;  5FKL A;  4BJ6 C;  3Q0W A;  3BC8 A;  2G7H A;  1R4N B;  2QCO A;  1HST A;  1IG7 A;  5FFX A;  2V1N A;  3QYB A;  3AG4 H;  2QSG X;  4I99 C;  3RI4 A;  1YIT I;  3IRQ A;  1IRG A;  5CVU A;  2IT0 A;  2P5V A;  2LBF B;  2ISZ A;  3H5N A;  4A5N A;  4KIT B;  5L3G A;  2DTR A;  3HPG A;  3F8B A;  3W3C A;  1YJW I;  4B3A A;  1Z6R A;  3BG7 A;  5JFR A;  1FZP B;  3TO9 A;  1SD4 A;  1LEA A;  3DEW A;  3AG2 H;  1W7P A;  1QNT A;  4UXN A;  1A5J A;  4O6J A;  2H09 A;  4M3D A;  1LB2 A;  5H20 A;  1N75 A;  5TRD A;  3CUO A;  2DA6 A;  2DN0 A;  2EQR A;  2VT3 A;  1YRN B;  2YR2 A;  2VJJ A;  2W57 A;  3VYS B;  2R92 J;  4NHJ A;  4G94 A;  4XN0 A;  1QO0 D;  2W82 A;  3A01 B;  5F08 A;  2CU7 A;  4HEA 2;  2IS6 A;  4BEH A;  1OCR H;  2M2E A;  4PFP A;  2M30 A;  2H6C A;  2VJI A;  2XRN A;  2B63 J;  4BJ5 C;  3JSP A;  1N77 A;  2QBY B;  1WJ5 A;  4EMS A;  1L3L A;  5F6F A;  3BY6 A;  4MEX F;  3OR1 C;  3MCZ A;  1U8B A;  2XF6 A;  4IHV A;  2LTP A;  1HBX G;  1FMW A;  3S3N A;  4HA8 A;  3CDL A;  4HBL A;  1GXP A;  2OCE A;  1BI2 A;  3DBR B;  3GME A;  2EV5 A;  2JUG A;  4KIS A;  1IW7 F;  3CME I;  1IV8 A;  1KZH A;  3CTA A;  4R8H A;  1F4K A;  1X4P A;  4G12 A;  3A4C A;  3JRA A;  4RM2 A;  3T8T A;  2DQR A;  1MD0 A;  3RZD J;  3M1E A;  1PP8 F;  2BHY A;  4FE7 A;  2JK3 A;  4BQO A;  3R6S A;  4E7S A;  2PMZ A;  5DUI A;  2DMT A;  3AKZ A;  4I2O A;  2ISY A;  3KP7 A;  4DJA A;  2F6C A;  3N05 A;  2M1B A;  4XBF A;  4WK8 F;  2LSO A;  3HKZ A;  3W6K B;  4A3C J;  4BQQ A;  3G3Z A;  1LEB A;  3JSO A;  4ENJ A;  1T38 A;  2VN2 A;  2RC4 A;  2O3F A;  4FIS A;  4AUX A;  1LPQ A;  1ONV A;  5D8L B;  1U2W A;  5TJJ A;  2A07 F;  2ME6 A;  3COA C;  1FYM A;  4WCG A;  5M3M J;  3GTQ J;  2Z3Y A;  1X4O A;  2MAB A;  3K0L A;  3M1C A;  3HTS B;  1I5Z A;  1RC9 A;  1QGP A;  4A6D A;  4EJO A;  4NUB A;  3F8N A;  2EA4 A;  1E3P A;  4IZZ A;  1G3T A;  2B9S A;  4AIK A;  4AIJ A;  1YRN A;  1ZHF A;  3WE2 A;  2DOD A;  2IVM A;  3H1C A;  5CYV A;  4C3I J;  2XAU A;  1ZRC A;  1SAN A;  3GEZ A;  1MDM B;  2M9H A;  3T0Y A;  3I9V 2;  1RI7 A;  2FF4 A;  2O8K A;  4DGW B;  3J81 K;  2EFP A;  2I10 A;  1D8K A;  5HLI A;  1D5Y A;  2JJ7 A;  1Y1V J;  3MEX A;  5CKT A;  3ZQF A;  1BM9 A;  2E1M C;  3OY9 A;  2CUJ A;  2VBW A;  2Z1D A;  3IL2 A;  1I6H J;  2JSC A;  4IKF A;  2NOG A;  3DTI A;  3PJR A;  4U7D A;  4CZZ A;  1MND A;  1FPQ A;  4MFE A;  1B8I A;  2MW8 A;  2V9V A;  3HRT A;  2VKD A;  4MFD A;  2EV6 A;  2EWN A;  2NYX A;  1POG A;  4IQJ A;  3IV5 A;  4L9J A;  2IP2 A;  3S1Q J;  2K5C A;  1KQ0 A;  4WX9 A;  1ULY A;  3GFJ A;  3IC7 A;  3BR3 A;  5DUK A;  3IP4 B;  3IKV A;  3VYR B;  3HRU A;  5FKO A;  3CQZ J;  4CUG A;  3OYG A;  3LAP A;  4MO7 A;  1ERD A;  2Y9Z A;  5E1X A;  1LDD A;  3BZK A;  4XRF A;  3K1P A;  2DQL A;  4Y13 A;  2QZ8 A;  3MKZ A;  2Y69 H;  3ECH A;  3BJ6 A;  1XGS A;  2NVT J;  2VON A;  3PO2 J;  3O2P E;  1FOW A;  1ZKG A;  4OWR B;  2WC2 A;  3N4M A;  1EV7 A;  3OOU A;  3I59 B;  2VLA A;  2ZCW A;  3V8J A;  2P7V B;  3BDD A;  5AON A;  2VXD A;  3OYJ A;  5GAD J;  1TT5 B;  2Y9Y A;  2HQ5 A;  3OYH A;  1XTA A;  1X1A A;  3KP2 A;  3HOU J;  4A0X A;  3GF2 A;  4XNF A;  3G71 I;  1ZLK A;  4XQF A;  3CP2 A;  2R7W A;  2AHQ A;  3KIO A;  4BAC A;  1WGX A;  5KHD A;  1Z77 A;  1DGW Y;  1MSE C;  2EFQ A;  4HF0 A;  2KIQ A;  5BQT A;  2X48 A;  2MYS A;  1MH3 A;  2A5Y B;  2R93 J;  1S8N A;  3JRG A;  3IUO A;  2Z99 A;  2Q0O A;  3ZQG A;  2JA7 J;  1F9N A;  2O0Y A;  2ESN A;  4JX4 A;  4YIR X;  3BTJ A;  4ZTF A;  3J80 K;  4MTE A;  3CO6 C;  4E7Z A;  3K69 A;  1MZB A;  3I71 A;  2Y0S A;  4WWC A;  4PUS A;  1A04 A;  2WBM A;  4HNU A;  4EV0 A;  4ZDO A;  4M71 A;  1VTN C;  3JAM Z;  5EEH A;  3FXR A;  4PSW A;  4KJZ A;  2XB0 X;  4PJL A;  1XCB A;  5K1Y A;  3PO3 J;  2QKL B;  1YLF A;  4D1Q A;  4D7N A;  3FKI J;  2XC7 A;  5E1Z B;  3HHG A;  3FBI B;  1I3A A;  2KQR A;  3HTU A;  2VKE A;  3ABM H;  2LFB A;  1OQY A;  2IAI A;  5J6X A;  4KIF A;  5CVI A;  4JK1 X;  2E5Z A;  3FMS A;  3VYU B;  3BLY A;  2GAU A;  5H6Q A;  5A2Q Z;  2HOE A;  5E3M A;  1P92 A;  3CC7 I;  2JQ7 A;  3RYP A;  1PUE E;  1KQ8 A;  2MBF A;  5TGT A;  2IPQ X;  4EEF G;  5KNL A;  3HOT A;  4MGR A;  4YEL A;  1O3R A;  1BIB A;  1MMN A;  2HYG D;  1UG0 A;  5C3E J;  5IYD J;  4HSR A;  4ZYD A;  2A61 A;  1FBQ A;  4ZDL A;  2CW0 F;  2Q8K A;  3ZOB A;  1O3S A;  3WOD F;  1OCP A;  4A12 A;  3ZQ7 A;  3EET A;  3A01 A;  2WAF A;  2DTZ A;  1MJB A;  3Q9S A;  2D5V A;  4AD9 A;  4DBR A;  3TP0 A;  3B02 A;  4XOT A;  1XB4 A;  5KAI C;  5L3D A;  1YIO A;  3MAJ A;  2F5D A;  1NH3 A;  3GTM J;  1WJF A;  4QTR A;  4OIR F;  3HC7 A;  2L7F P;  2BV6 A;  4C2M J;  1YYV A;  1IC8 A;  3ASN H;  2DDA A;  4NNJ A;  3QP5 A;  2OAZ A;  4DYC A;  2H27 A;  2AQE A;  1J09 A;  4A3D J;  1Z3X A;  3LSH A;  3QYE A;  2FQ4 A;  4X6A J;  1RET A;  4RB0 A;  5LEK A;  2ZFW A;  4F55 A;  3HSE A;  4UVC A;  2XKP A;  1TNS A;  2DA5 A;  4AYB A;  2K85 A;  3QU6 A;  1I3Q J;  4BAY A;  3KYD B;  2EIL H;  3VSL A;  1U5T B;  4DZJ A;  3K6G A;  4IX7 A;  5EJC A;  1PUF B;  3MFK A;  3P5J A;  2I8D A;  1F36 A;  1BN5 A;  4KIC A;  5A2Q K;  2M87 A;  4GRI A;  5FJ8 J;  4XLC A;  3EPZ A;  2IW5 A;  5D4R A;  1IXR C;  2QF7 A;  5EG0 B;  1ZGA A;  3DWL E;  4D9J A;  2H94 A;  2ELH A;  3GZ6 A;  3I4N J;  3W2V A;  3Q0U A;  2X6Y A;  2L0K A;  3K4J A;  1BOA A;  1UHW A;  2Q2E A;  2VOP A;  2W7N A;  1Z9C A;  4RGR A;  1WKM A;  3D5R C;  2XHK A;  4IF4 A;  4I0B A;  4J01 A;  4N9I A;  1DDN A;  1HKQ A;  2PI0 A;  2MSY A;  4EAT A;  3FWE A;  4LMY A;  5E8I A;  1QPM A;  1YJ9 I;  2RV8 A;  2VQG A;  3J80 Z;  1T2K A;  3K4K A;  3OWT A;  4LFU A;  1Z6T A;  3TO6 A;  5F27 A;  5CJ9 A;  4FTH A;  2Z9O A;  2CFO A;  1O7F A;  1NG7 A;  4XKB A;  1Q1V A;  1MGT A;  1HW1 A;  1JE8 A;  2IGM A;  2IS1 A;  1FT9 A;  4BU2 A;  4B43 A;  5FLV A;  3I56 I;  1SC7 A;  2RDP A;  2LRD A;  5HS8 A;  3NRV A;  3E6C C;  1SVO A;  3ZP5 A;  3A03 A;  3DQV C;  3E0J B;  2QEX I;  2WV0 A;  1I50 J;  1J0R A;  2E19 A;  2P0W A;  3BOQ A;  3H5R A;  4IXA A;  2HYJ A;  4BBS J;  1UHS A;  4KIG A;  2E34 A;  1VQP I;  3KLO A;  2O61 A;  4BQA A;  3AL0 C;  1T08 B;  4EM0 B;  2MD0 A;  5CVV A;  4YRV A;  1YX3 A;  2JTV A;  4CSW A;  3HGY A;  5JHF A;  1LKX A;  2NOJ B;  2K9M A;  3V8K A;  3GTL J;  3H36 A;  1ETY A;  2TDX A;  1SMT A;  2QQA A;  1H88 C;  2MFZ A;  4XKV A;  2HVR A;  3CMM A;  2LF7 A;  3MQ0 A;  4HRI A;  3HG9 A;  1XG1 A;  3K1N A;  4BE0 A;  2XSJ C;  1NHA A;  1U5T A;  5F0F A;  4AIH A;  3S2D J;  2EFN A;  2KRC A;  3WTX C;  2O8X A;  2BBY A;  2ZME C;  3GO5 A;  1S7O A;  3ONQ A;  3F21 A;  3ZN0 A;  5LGT A;  4CDG A;  3JW4 A;  1H8A C;  3QPS A;  4HQE A;  2WAD A;  5D4S A;  4BXU A;  3I54 A;  3WHB A;  1WI3 A;  3WHC A;  4BHC A;  1TWH J;  2OTJ I;  1TW2 A;  2DA4 A;  4KT5 C;  5GP9 A;  5HDG A;  1W5S A;  3PFY A;  4ZDP A;  5KVR A;  5HDK A;  2KRH A;  3DKX A;  1X19 A;  1VQL I;  2LP0 A;  4RLQ A;  2W1O A;  2YX7 A;  4RDU A;  1YS7 A;  2GXB A;  4BQN A;  2CSO A;  3R0J A;  2X1C A;  2E5N A;  2JN6 A;  1W5T A;  2GIV A;  2YU9 J;  3R61 A;  4PSX A;  3FM5 A;  2EFW A;  5ERI A;  3HIF A;  1VQK I;  5FD5 A;  2R7V A;  3MKW B;  4WXH A;  2W85 A;  4I76 A;  1SFK A;  4M9X A;  2KFD A;  3TW7 A;  4U88 A;  1U6G A;  3JR9 A;  3J81 Z;  2FBH A;  3CP8 A;  4XN3 A;  4IHT A;  3KP4 A;  4E70 A;  3OV8 A;  5K5R A;  4KDP A;  2KKO A;  1MJ9 A;  5BPI A;  5FKK A;  3BG5 A;  2O03 A;  2NVQ J;  4PCQ A;  3GYH X;  3E1S A;  3ZXS A;  2ZFU A;  3QPT A;  4IHW A;  1T0F C;  1BR1 A;  1Z0X A;  3H35 A;  3S32 A;  2BGC A;  2GXA A;  3WTV C;  2OF7 A;  1ZEL A;  4UUT A;  1P7I A;  1K6O A;  4BBR J;  5ICC A;  3OMY A;  1OCZ H;  3H9Q A;  3WGG A;  4ZC3 A;  3S14 J;  3DLA A;  1JHF A;  2HXO A;  3FHN A;  3ECO A;  3ZQQ A;  5E1W A;  3OYN A;  3CCJ I;  4F91 B;  4N4O B;  3IKT A;  5HS9 A;  2P6S A;  4AVP A;  4ZTJ A;  2DDB A;  4W1U A;  3Q9V A;  4Y3O A;  4BNC A;  4G9Y A;  1R71 A;  3GZ5 A;  4UHT A;  4XON A;  4IVN A;  2PJR B;  2MC4 A;  1OCC H;  4EM2 A;  3S2W A;  3LNQ A;  2Q2E B;  2W48 A;  2VQC A;  2XAQ A;  2ZXJ A;  5E20 A;  1EH8 A;  2CQ7 A;  4L9V A;  1STZ A;  3S3O A;  1FYK A;  3BJA A;  3QQA A;  4L9N A;  4OIN F;  3WU1 B;  3UKG A;  2LG4 A;  4IRG A;  2XGX A;  1XGN A;  4IEJ A;  2ZXH A;  5LFA A;  2XKO A;  1IRX A;  4LIU A;  5H6R A;  1HF0 A;  4ZZL A;  2F5E A;  2L7M P;  3CZ6 A;  5CPR B;  5HNH A;  2DYS H;  4IRH A;  2UUZ A;  5F1J A;  1D1C A;  1WCM J;  2K86 A;  4M3E A;  2MG4 A;  3H3U A;  3OS0 A;  1RR7 A;  2A6T A;  1J59 A;  3K70 D;  2R7O A;  3TKY A;  1IXS B;  3KEQ A;  5DV5 A;  1DP7 P;  1DUX C;  2P4W A;  1ETK A;  3LWF A;  1TLH B;  5D5V B;  4HDV A;  4IPA A;  1W1W E;  5FLM J;  5JVG F;  1W36 D;  2KJC A;  3E7L A;  3K9T A;  4M73 A;  5FRO A;  5KAF C;  5J1R A;  3HOX J;  3M3Y J;  3HYI A;  1J5Y A;  2XIG A;  3TBI A;  1G4D A;  1BI3 A;  1HKS A;  2E1O A;  3ZQI A;  3ERM A;  3HOW J;  2GOX B;  9ANT A;  3TO7 A;  1MH4 A; 
#chains in the Genus database with same CATH homology
 5CKT A;  1LVK A;  3M8J A;  4II2 A;  2M0M A;  2E1M C;  3OY9 A;  2CUJ A;  3RTR A;  1NG6 A;  2Z1D A;  4AVZ A;  2BW3 B;  1MNE A;  3CJR B;  2R7S A;  4IKF A;  3DTI A;  4RMN A;  3PJR A;  1MND A;  3D5L A;  4JOM A;  4XR6 A;  3HUG B;  3KYL A;  3LMM A;  4N4N B;  3IAS 2;  2IS4 A;  2VKD A;  3MKY B;  2M7A A;  1Z7L A;  2F4I A;  3GBG A;  4IQJ A;  2VKH A;  1WFX A;  2W4S A;  2K5C A;  2ELJ A;  2HQA A;  2M4K A;  4C2T A;  3CES A;  1AA7 A;  4C9Y A;  3V42 A;  3IP4 B;  3SEZ A;  2DXI A;  2V9K A;  3VYR B;  4OAY A;  3LSK A;  1FMV A;  4CUG A;  3OYG A;  2XF7 A;  2WAQ A;  2X85 A;  2CV1 A;  1ERD A;  4HST A;  4CCN A;  2ZXI A;  3OYB A;  3SYT A;  3MKZ A;  4E7K A;  2R7U A;  2A5W A;  3MMY B;  2WAE A;  1GLN A;  2V4J C;  3NWS A;  2IS2 A;  3RQ4 A;  4OWR B;  3QOD A;  4C2U A;  2CMP A;  2V26 A;  3OOU A;  2VLA A;  3OS2 A;  3H9J A;  2L2O A;  2E60 A;  3DKY A;  2VXD A;  4QPO A;  3OYJ A;  1LFP A;  2V6E A;  3OYH A;  1X1A A;  1E0E A;  4XNF A;  5HLT A;  4U7B A;  4AU7 A;  4XQF A;  3CP2 A;  2R7W A;  2ZSH B;  3K4B A;  1V5E A;  2LC2 A;  3HXL A;  2RRE A;  1K6Y A;  2HZD A;  4BAC A;  5KHD A;  1DGW Y;  1HA8 A;  3DTK A;  3OIP A;  3H5A A;  3DPT A;  4R79 A;  1VZ0 A;  3A1Y A;  2MYS A;  1Z3Y A;  3IUO A;  5HVQ C;  3DPL C;  3H0D A;  4ZTF A;  3J7A Y;  4XKW A;  4E7Z A;  3OYK A;  2F5V A;  3OYA A;  1D1A A;  2Y0S A;  4PUS A;  3L2U A;  2WBM A;  3U21 A;  4HNU A;  3C2H A;  2L9N A;  4BJT A;  4ZDO A;  2HVQ A;  2R7Q A;  5CQE A;  3W2W A;  1X1D A;  4BL0 B;  4PSW A;  4KJZ A;  4PJL A;  2QKL B;  3G2B A;  4D1Q A;  3C2G A;  3OYI A;  2XC7 A;  1W36 C;  3FBI B;  2KQR A;  3EUH C;  2CUZ A;  3BCA A;  2VQL A;  1YE9 A;  2Z16 A;  2X6W A;  3OYF A;  3H9G A;  2E5Z A;  3PUB A;  3VYU B;  3BLY A;  4CCL A;  2IGK A;  2JVG A;  4CH7 A;  2VB6 A;  5TGT A;  3K70 C;  3HOT A;  2VIX A;  5KNL A;  4YEJ A;  2DT7 B;  4NQW B;  2V7F A;  4XLH A;  4YEL A;  3PNV A;  3LFU A;  3K4M A;  2CW7 A;  1MMN A;  3LL7 A;  1UG0 A;  2L9S A;  3FKJ A;  4HSR A;  4NC8 A;  1MMG A;  2HPM A;  3OR2 C;  2R7X A;  2DT6 A;  4ZDL A;  2WAF A;  1SAU A;  2HVS A;  2E1M B;  4F92 B;  1OLT A;  1TT0 A;  3K4C A;  1WJC A;  1V5F A;  2CS3 A;  4DBR A;  3L2Q A;  3DU6 A;  3KEY A;  4XOT A;  4F93 B;  4BDZ A;  4B44 A;  2IXS A;  4PJJ A;  2VQH A;  1Z21 A;  1WJF A;  2XDV A;  4B3X A;  3HC7 A;  1G8X A;  3F9K A;  1UEL B;  2LY1 A;  1X1B A;  1QU3 A;  2LBF A;  2K3P A;  4B48 A;  1D1B A;  2CV0 A;  2M7B A;  1BR4 A;  3OYD A;  4ZJZ A;  4RM3 A;  4F3Q A;  3L2R A;  4BE1 A;  4FET A;  4NNJ A;  4C30 A;  3S93 A;  4CA0 A;  2AQE A;  4ANJ A;  1J09 A;  1D0Z A;  2L7K A;  2X1E A;  1TZL A;  1Z3X A;  4PFO A;  3LSH A;  3QYE A;  5HNF A;  1MMD A;  1G59 A;  3TL4 X;  3FBN B;  4F55 A;  1QHG A;  2WY8 Q;  5FRM A;  4AYB A;  3LSM A;  2KL4 A;  3VSL A;  3HL2 A;  2HDW A;  1D0Y A;  2R4G A;  3K6G A;  2WA0 A;  4BE2 A;  4IX7 A;  4XLE A;  2R7R A;  2OC6 A;  2I8D A;  4XOP A;  4U87 A;  2UV1 A;  3SDB A;  2BW3 A;  2VXZ A;  3ZRG A;  2JVH A;  3ZGK A;  4GRI A;  3DU5 A;  1MW7 A;  4XLC A;  2ZSI B;  3EPZ A;  3K10 A;  4J00 A;  3RSN A;  1WJA A;  3DWL E;  4D9J A;  2KP6 A;  2LOO A;  3DTE A;  1Y6I A;  3D5S C;  2O5R A;  2IGN A;  3SEQ A;  3W2V A;  2X6X A;  2X6Y A;  3ZCO A;  3K4J A;  4E7L A;  3PSF A;  2OV7 A;  3CF2 A;  4Y4R A;  2W7N A;  3D5R C;  4J01 A;  1S9H A;  1UAA A;  4EAT A;  2XF5 A;  4BDY A;  2VQG A;  3K4K A;  3OWT A;  4X0G A;  4BUP A;  3HOS A;  3RCO A;  1R6R A;  4LIT A;  3K4N A;  2CFO A;  2LYC A;  2BVM A;  4XKB A;  1NG7 A;  3IAM 2;  1X1C A;  2KDO A;  3W2A A;  2IGM A;  2IS1 A;  3TMO A;  4B43 A;  1MMA A;  2LRD A;  2VPL A;  2CW8 A;  3DQV C;  3E0J B;  4FAS D;  4RLF A;  3L2V A;  5CQG A;  4P5O A;  4BXF A;  2P0W A;  3H5R A;  4II3 A;  2M3A A;  3NWT A;  3OL3 A;  3OS1 A;  4LG3 A;  3AL0 C;  3PL8 A;  1T95 A;  4XKC A;  4DBQ A;  3L2W A;  2MD0 A;  4YRV A;  1YX3 A;  4CSW A;  5JHF A;  1LKX A;  2NOJ B;  2K9M A;  2OUM A;  2HPI A;  4H4K C;  3S3M A;  2MFZ A;  4XKV A;  2HVR A;  3CMM A;  4CZC A;  4F52 A;  4HRI A;  2GOM A;  3HG9 A;  3DPU A;  4BE0 A;  2XSJ C;  2X51 A;  4PK4 A;  2UWM A;  2KPM A;  3PNT A;  2KRC A;  1DP3 A;  5LD2 C;  2KLO A;  4BGD A;  3VSK A;  3ONQ A;  3VYT B;  3OYM A;  3LSI A;  1YX5 A;  4KT6 A;  1V5G A;  2VJ5 A;  3UNG C;  3OYE A;  4XLF A;  4E6K G;  2WAD A;  4BEH B;  3A2K A;  3CJQ B;  3QOE A;  2VL8 A;  3I3L A;  4G6T B;  2AQF A;  3KX2 A;  2FUG 2;  3OL4 A;  5HOO A;  4E7J A;  3EUK L;  2LY2 A;  3PFY A;  3UR3 C;  4ZDP A;  4BJ6 C;  3BC8 A;  2KRH A;  3DKX A;  1X19 A;  4XOR A;  1WJD A;  4RLQ A;  2V1N A;  2W1O A;  3QYB A;  3S8P A;  2HU9 A;  2JA2 A;  2KHM A;  3EUA A;  4BQN A;  1Y56 A;  4PJN A;  2RQQ A;  1QHH D;  2X1C A;  2E5N A;  4JQF A;  1KON A;  3OYL A;  4PSX A;  2KZV A;  2LBF B;  4E7H A;  3VWB A;  5FRN A;  3H5N A;  4KIT B;  2IGO A;  3HPG A;  1BR2 A;  2R7V A;  2X1D A;  3W3C A;  3MKW B;  4XMY A;  1SFK A;  3ZR8 X;  3BG7 A;  4DOZ A;  3PNY A;  3CP8 A;  2PJR A;  1OR7 C;  1PJR A;  4XN3 A;  2R7T A;  1N75 A;  2VJJ A;  1WJB A;  3VYS B;  2WY7 Q;  4OAZ A;  4XN0 A;  2W82 A;  4Y33 A;  3E1S A;  3ZXS A;  4HEA 2;  2IS6 A;  2ZFU A;  4BEH A;  2QKM B;  2BOL A;  2DJI A;  3PSI A;  4PFP A;  1LDK B;  3K4L A;  1T0F C;  3HPH A;  1BR1 A;  3H35 A;  3S32 A;  2HNH A;  4E7I A;  2VJI A;  4BJ5 C;  3QYF A;  1N77 A;  1ZEL A;  1WJ5 A;  3FDY A;  3OMY A;  4XM3 A;  3H9Q A;  3OR1 C;  4ZC3 A;  3DLA A;  3MD2 A;  3FHN A;  1P9Q C;  2XF6 A;  3ZQQ A;  3OYN A;  2Q1Z B;  1FMW A;  3S3N A;  4LIV A;  2K9L A;  4B47 A;  4F91 B;  4N4O B;  4BU2 A;  2JUG A;  4KIS A;  3RPU D;  5KCM A;  4ITV A;  4ZTJ A;  2VAS A;  4Y3O A;  4CCJ A;  4CCO A;  1X4P A;  4XON A;  3A4C A;  4RM2 A;  2PJR B;  2MC4 A;  2Q2E B;  2KMU A;  3DEE A;  2VQC A;  3LSG A;  1DGR M;  2BVL A;  3SZG A;  3S3O A;  2LH9 A;  4BQO A;  4E7S A;  2CV2 A;  2PMZ A;  3AKZ A;  1EA3 A;  4BS9 A;  4E4H A;  3AFH A;  4DJA A;  2DOA A;  2F6C A;  2LG4 A;  3N05 A;  2W00 A;  3HKZ A;  1PYV A;  4XLA A;  4HNT A;  2ZXH A;  4BQQ A;  5LFA A;  3VDX A;  4HG2 A;  1IRX A;  2RNG A;  4LIU A;  3OIQ A;  1WJE A;  4IQ4 A;  4ZYA A;  3CZ6 A;  5CPR B;  1N78 A;  5HNH A;  1DQU A;  4CCM A;  4P1W A;  1JI8 A;  2CH0 A;  2UUZ A;  1D1C A;  4NC7 A;  2L5Q A;  1X4O A;  1D0X A;  2MAB A;  3M1C A;  3OS0 A;  2VJ4 A;  2A6T A;  3AL0 B;  3BG6 A;  3K70 D;  2R7O A;  2Z2S B;  1U0J A;  4MLO A;  4NUB A;  3BCB A;  4QPQ A;  4IZZ A;  1BOB A;  1W36 D;  2XAU A;  4CCK A;  2LRE A;  4HPQ A;  2M4G A;  4XL9 A;  5FRO A;  3I9V 2;  2WB1 A;  2JSP A;  4PJM A;  3TBI A;  2DCE A;  4DGW B;  3OYC A;  2GOX B;  4DIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...