4BEHB

Solution structure of human ribosomal protein p1.p2 heterodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
116
structure length
116
Chain Sequence
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 60S ACIDIC RIBOSOMAL PROTEIN P1
publication title Solution Structure of Human P1P2 Heterodimer Provides Insights Into the Role of Eukaryotic Stalk in Recruiting the Ribosome-Inactivating Protein Trichosanthin to the Ribosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 17
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00428 Ribosomal_60s 60s Acidic ribosomal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4behB01
4BEHB 2W1OA 4BEHA 2LBFB 2LBFA 3A1YA
chains in the Genus database with same CATH superfamily
1K79A 1FMVA 2M1BA 1TWHJ 2CWEA 1K7AA 3H1CA 1GHCA 4I2OA 1OCZH 3ZGKA 2Y0SN 3BG7A 2DA6A 3DKXA 3DXJF 1FP2A 3K4MA 3GTKJ 2BGCA 3NWSA 3T8RA 5LRSA 3H92A 2KDZA 3HOTA 2N8GA 2RNGA 3DU5A 4ABZA 4K2EA 4ESFA 1H8AC 4HAMA 1XB4A 3BR6A 3VYTB 3EUAA 1IGNA 2L01A 3D5SC 1RUNA 4BXUA 3VYSB 3VPRA 4DYRA 5HLTA 2ELHA 3COAC 4UVAA 1GT0C 2I8DA 1OJLA 3F8CA 3FMRA 1BOBA 1P2FA 4IL6C 2EIMH 2FSWA 1FWZA 2KISA 5J4VA 4S04A 3ABLH 3HBLA 4BBRJ 3OYGA 4Y17A 2PJRB 3KP4A 4DBQA 2Y30A 3NAUA 1I39A 3RPUD 4MEXF 2KIQA 1PVEA 4MQVA 1X2MA 3V8KA 3NEUA 3R60A 2F4IA 1DP7P 1ORKA 3KZIC 2JMWA 4BGDA 1JJ8C 1OYWA 5K7HA 4XLEA 3CMEI 4EJWA 2O5RA 2IGKA 2LK2A 2ETHA 3CJRB 5IP7J 2W82A 3BQYA 4EJTA 1I6HJ 1HW5A 2QBYA 5JI6A 2Y75A 2CMPA 3FMQA 4DGWB 1FOXA 1SD5A 3RIRA 2MLGA 3R4KA 3K70D 4MHGA 4L18B 3K4BA 1MBGA 1K78A 1GVDA 2VKHA 4D7NA 1C0WA 4PDKA 1IV8A 1WFXA 2QQ8A 1ODDA 3FXQA 3FXOA 2D2WA 2FOWA 1XDSA 3T0YA 1IG7A 1GXPA 1K6OA 1IAWA 3QYBA 4KIFA 5ICGA 2DLLA 3HXLA 5ILUA 3WGHA 2NOGA 3LOCA 1Y39A 2IW5A 4NUBA 2CO5A 1JGGA 2Z2SB 1IXSB 2PQ8A 3CCYA 3TDUC 2DBBA 1JUSA 3ML6A 1NG6A 5EEHA 3IKTA 3PIPF 4E7LA 4E7IA 2DTRA 2K86A 4A3CJ 4FE4A 2MG4A 2OA4A 2L5QA 2QUFA 3RKYA 3OYLA 2PMZN 1YX5A 2QSFX 3IP4B 5DTDA 5DUIA 5F08A 3DTKA 9ANTA 2LOOA 2QZ8A 4B3XA 4PFOA 3CCUI 4HV6A 3HOYJ 1T39A 3DBLB 4HF0A 2PJPA 3KLOA 3K4JA 1E17A 4YELA 1JKOC 1KU3A 3GFLA 1WJDA 4Y13A 1HDPA 4XLCA 1EH7A 2VQHA 2HVQA 5KNLA 1QU3A 2KRHA 4PSXA 3GVAA 4RGSA 2VONA 5F64A 4LITA 2FRHA 5D6EA 2NS7A 4U7DA 2R7WA 1U8BA 2H1KA 1ZARA 3MD2A 1R1TA 2LG4A 4I99C 4RDUA 4HPQA 5IT3A 3GO5A 1Z3YA 3DP7A 3RYRA 3L1PA 3OIQA 4RMNA 3TBIA 4OWRB 5D8LB 2F5CA 3LFKA 3LQRA 3MMYB 4HSRA 4NQWA 2A5YB 2RREA 4JK1X 4A0YA 1MMDA 3JCUC 1TL8A 4X1EA 4JBAA 3KPHA 4AC0A 4BY1J 1R1VA 2CUZA 2QWWA 4LIUA 4WX9A 3ZPLA 1GVJA 2BHZA 2L7KA 2NS0A 2E34A 3D5LA 4XKBA 4BYYA 4EV0A 4PJJA 1UELB 1BA5A 3KP5A 2JA7J 2UZKA 2R7XA 2KP6A 2OQGA 3SDBA 2P5KA 1QZZA 4GXOA 4F92B 2WB1N 3D1NI 3CQZJ 4UUTA 3EYIA 4XL9A 2VE9A 2MD5A 2L7MP 1VQLI 3ZMZA 5FFXA 4CCLA 5FLMJ 3CCSI 1P7JA 2QSHX 1UB9A 3BWGA 5C4JJ 2NVYJ 2W25A 4EQQA 2FEZA 1QZEA 4RLQA 3SFZA 3SJMA 3M8JA 3RKQA 2O6GE 3JW4A 2JK3A 3L2VA 4M3BA 2X9DA 3VEPA 1VQMI 2YPRA 5BQTA 2H94A 1BC7C 2EZIA 1BR4A 3HSRA 1U9OA 2R5YB 2OPTA 3AG2H 1F9NA 3TW6A 2KQRA 5JFRA 2JSCA 2DI3A 3WTTC 2A69F 5LLQA 1S8NA 2V26A 5LEJA 4G6QA 2DMNA 3ABUA 3K6GA 5IYBJ 2GXGA 1P4AA 4I0AA 4XORA 1IW7F 1KU9A 2ECBA 3M7GA 2W85A 4BS9A 5IP6A 3JRCA 3G6EI 1MBHA 4LMYA 3HRUA 2VQGA 4F3QA 3K1MA 1MJ9A 5DD8A 4FHTA 2EWNA 4ZZLA 3BTJA 3FXJA 1W7PB 3H3VK 1H9GA 4U0WA 5GADJ 1POGA 3OL3A 2ZCWA 1JT0A 2IS1A 2DFEA 2PN6A 2QLZA 5EG0B 4M9ZA 2W48A 5HLHA 1MH4A 1AKHA 3REOA 3C7JA 2AQFA 1IV6A 4GFBA 4AM3A 4U88A 3JRAA 3OYCA 2CQXA 1V54H 3GZ5A 5LGNA 2O9LA 2VL8A 1TBXA 3CCLI 4RM2A 1R6RA 3I55I 1OYIA 2PBIA 2VQCA 4OOIA 3ZCOA 3ZOBA 2BXYA 5JR3A 2A3SA 3ECOA 2EQRA 2GWRA 2R4GA 4JP0A 2EJRA 3ZMVA 4E7SA 1UZCA 4AU7A 5FD6A 1MBJA 5KAIC 1WZ2A 4ZTJA 3K2ZA 1G2HA 3B6AA 4BE0A 5IPAA 4IX7A 2F6CA 2LF8A 5BMZA 2VPLA 4AYBN 4J19A 1H9TA 2GXBA 4A5NA 1K6YA 3OV8A 5H20A 4ESJA 1X3UA 1V4RA 4LD5A 3C2HA 3Q9SA 3PNVA 4HOBA 2XAGA 1R49A 5DM7F 3IWZA 1JT6A 5EG0A 4JX5A 3I56I 4XLPF 1T2KA 2KIMA 3M4OJ 2RGVA 4RM3A 1ZKGA 2FXAA 1VQPI 1PJRA 1O7LA 3H0GJ 2HFHA 2JWTA 3HM5A 2QKMB 3GTGJ 1YE9A 2JPCA 4LG0A 2OCCH 3MKWB 2KLOA 2NYXA 1A31A 2OF7A 3K10A 2MSYA 3WTYC 4II2A 4BJ5C 2HEOA 4BNCA 1QRYA 3OYIA 2DCEA 3C2GA 2DU9A 4U0VA 2BYVE 1EJ9A 2HPMA 3DV8A 3CO7C 4A3GJ 3CDIA 4XNFA 2ZMEA 4YRVA 1Y1VJ 2EFNA 4A6DA 2EFPA 5CVJA 4LIVA 3ZQIA 2WAQN 1ERDA 5M3FJ 2UXXA 1QZYA 1KA8A 1VQ6I 3CMAI 1B72B 2L9VA 4UNOA 4C2TA 3BCBA 3IKVA 5GPAA 4DYQA 1F5TA 2FBHA 1ZELA 4HX4A 2VT3A 3HKZN 3M3YJ 2XUBA 4LK0F 3QODA 1F36A 3LA2A 3WTZA 3W2AA 3JTHA 3HOSA 2VXDA 5CVUA 1LVKA 1D8KA 2IEKA 4PJMA 4B8XA 2H1LA 4BXXJ 3KP7A 4EVIA 3U9GA 3H9JA 1BBYA 2RAEA 3VB2A 4IO9F 4CO8A 1DP3A 3BR0A 4G7ZF 1IN4A 2VBYA 4NBQA 1FC3A 3GMEA 4ZYAA 1FZPB 2E5ZA 5EEAA 3O8HA 1QHGA 1G3SA 1U0JA 1QPIA 4RA2A 2B0LA 4IEJA 2HTJA 5FKOA 2X6WA 5EGOB 2CGPA 3GX4X 1R58A 4HLXA 4II3A 4ZYGA 4IF4A 1WHUA 3QYEA 1VFCA 1FSEA 4DYCA 2HDWA 3ZR8X 2HQNA 3QU3A 3QYFA 4ESBA 1R71A 1YOVB 1T98A 1S7EA 4OIOF 3IHUA 3L2RA 3E0JB 2AHQA 4LGWA 2OTLI 1MH3A 3LSKA 4DZJA 1MKMA 2ISYA 3PNYA 4ZZDA 3BR1A 2DFFA 1R36A 4BJTA 3KP6A 2K4BA 1AHDP 2HOTA 3DPLC 4HA8A 2ACJA 1REPC 1KONA 4CCMA 3OS0A 4A3BJ 1IO2A 2LF7A 2BY1A 1B59A 1ZR4A 2M87A 3P9CA 5E1WA 4DZPA 1HLVA 5J3LA 4EATA 5CKTA 4IZZA 4PSWA 2UWMA 3FHZA 1RRJA 4RGUA 3PIOF 2JT1A 3HOVJ 1WI3A 2K9QA 1F1ZA 5ERIA 3KEOA 4GGGA 3TMOA 3G1OA 2M4KA 1VQ7I 4KYWA 2JZYA 2F4MB 2OAZA 1P6RA 1OKRA 1JXSA 4XONA 2Y9ZA 5D8KB 3CZ6A 1D1BA 2L7ZA 5D5UB 2BW3A 2PFBA 3HG9A 3FIWA 4HF1A 2E36A 3PSFA 3CP8A 2MABA 3E97A 3RZOJ 1N77A 4ZDLA 2P6SA 2P7CB 4S0HB 1LQ1A 3I53A 1YQAA 5KVRA 3BR5A 5TISC 2VXZA 3QP5A 3SZTA 1L0OC 3S15J 1KZHA 3QPLA 1MSEC 2DMPA 1FIPA 2R7UA 1AWCA 1HQCA 4UB8C 5FKNA 3FK7A 3ONQA 3CCVI 2R7SA 1RESA 3PFYA 3UNGC 4L0YB 3HEFA 2K85A 3E1SA 3HTSB 1D0YA 4UV8A 4G6TB 4L0ZB 4PCQA 3VYUB 4E7KA 3BY6A 3L2CA 1J2XA 2H09A 3T8TA 3BQZA 4H4KC 4RGXA 2K5CA 4XSXF 1S3JA 2BY2A 2E1OA 1R1UA 3QU6A 5GTIC 3QQAA 1UHMA 1MDMA 3DKWA 3HUGB 4L9NA 1FP1D 5F0FA 3GCMA 5FRMA 3BZ6A 1ZQ3P 3DU6A 2EZLA 5GAEJ 3G71I 2OC6A 5JVGF 3JRHA 2L7FP 2E1CA 2K9NA 2V9KA 4B1RA 3E7LA 3DLAA 3DPUA 5JLWA 1O3RA 2IPQX 2D1VA 2RKHA 4BDZA 2HTSA 3ZN0A 3RYPA 2A07F 4IHYA 2EIJH 2MFZA 5GP9A 2QGUA 2P5LC 3O3KA 3AL0B 3DTIA 2X0LA 4XKCA 5J1RA 5K7ZA 2M45A 4NDLA 5EF6A 1N75A 1JTXA 1JKPC 4Y52J 2XV4S 4Y4RA 3U1KA 3FHNA 1X3ZB 1JI8A 2K4JA 5F0HA 1ZRFA 3GUDA 3BG9A 2WV1A 3HUGA 3N05A 4XRMA 4LK1F 2IGMA 5IY5H 3E6DA 3HRTA 5HDNA 4Y15A 1VQ4I 5HNFA 2L02A 3J7ZI 2Z5UA 5J4YA 5B1AH 1QGPA 4A3LJ 3RQ4A 4Z2YA 3WU0A 2K40A 1IRFA 5AIPA 1SD7A 4EMSA 3ZQFA 3FM5A 5IT9Z 1W0TA 2EA2A 1BC8C 3BPXA 4CCNA 2DDAA 1A6IA 2A5WA 3QWLA 3V42A 5HOOA 1ZN2A 1X19A 4A3KJ 5HDGA 4DNCA 4JX6A 3ZQ7A 2XAJA 2ESHA 4J01A 4XKVA 1ITYA 3H0DA 3F72A 5M5XJ 1PUFA 3S16J 2XGXA 4KN7X 3D0SA 1WWXA 3PFIA 1R5ID 6PAXA 3JRGA 4GDFA 1YIOA 4BHBA 3LSPA 3GYHX 3BG6A 1Z21A 2R5ZA 3ZQCA 3CC4I 2JA2A 2XGEA 1O57A 5L3GA 2CFXA 2LYCA 4A3DJ 1A5JA 2JUGA 1ZG1A 1R00A 3K7AJ 2X85A 1SEUA 1F43A 2XF6A 2Y2ZA 5GAHJ 2EILH 1FOWA 2MC3A 5E3OA 5FRNA 3F8MA 2AS5F 1Q1VA 3H9QA 2HWVA 4NC6A 4UB6C 3P5JA 5EZHA 2YU9J 1SFOJ 2GM4A 3DPTA 4EJUA 5FFZA 1FOYA 3OY9A 2ZKZA 2A6EF 4AIDA 5L3CA 1V5GA 4O3MA 2DXIA 3K69A 2VQLA 2DK5A 3ABKH 1Z05A 5IP9J 4FCYA 2LDUA 2O7OA 4KJZA 3BP8A 3L9FA 2DYRH 3M1CA 1X3WB 2E35A 2ZXWH 1Y6IA 3ERMA 2YSRA 1G4DA 4MEYF 3C1DA 3OMYA 4E70A 3MZ8A 3OS1A 1SFEA 3G1MA 3KYDB 2QBYB 3BJOA 3DLLF 5EZGA 2EZKA 2HYGD 3LFUA 2IS6A 3FKJA 5B3SH 1WKMA 5D5WB 3OOPA 5EDNA 1MNEA 1K78B 3WHCA 1X1CA 2MW8A 1VQ8I 3CP2A 1A36A 1Y0UA 3ABTA 3U2RA 1GDTA 3CUQA 4BJ6C 4C3HJ 4E4HA 3RPUA 3HDDA 5FD5A 2R7OA 3E6BA 5C44J 2HKOA 5IT9K 4CHUA 2VUMJ 2LH9A 4MLOA 2JSPA 4IPAA 2DK8A 4OAZA 5B66C 3ZMTA 3IRRA 1LFUP 4A93J 2M7AA 3NQOA 3WE3A 3SZGA 4GCVA 5EEGA 2QQ9A 1HOMA 1B6AA 2G9WA 2YR2A 5ICCA 1ACIA 4WXCA 1XX5A 4UUSA 3EUHA 2GXAA 4KN4X 2ZSIB 4UVBA 4FE7A 4MGRA 3CESA 2QSGX 1I1SA 1UHSA 1D1CA 2TDXA 3OL4A 2R7DA 5GPCA 1V5EA 1DU0A 2EV6A 2ZJRF 1BL0A 1ZK8A 4HYEA 4XICA 2COBA 3AFHA 5DD4A 1FPQA 4KISA 5FO5A 3H35A 5JHUA 5M5YJ 2Y69H 1QHHD 1QVUA 4V2FA 2AXTC 5K1YA 1XS9A 3G3ZA 3NARA 4LJZF 1KYZA 3VFZA 1YX3A 2EPFA 2OBPA 1JKRC 1WJFA 1TWGJ 4ZJZA 3MZYA 3S2DJ 2A61A 3H36A 3VDXA 2VJIA 2KMUA 2VIXA 2DTZA 1O4XA 2L9SA 2FA5A 2Z16A 1I3AA 4MFEA 3E5UA 4CYDA 1O3QA 4NQWB 1MSFC 1TT0A 5J40A 1LPQA 1J75A 3C2BA 3HB9A 3M8FA 1MJBA 2BOLA 3MQ0A 3M07A 3VSLA 2KDOA 3HGGA 3I71A 2CUJA 2H6BA 3KP2A 2NXNB 3KYLA 3K0LA 1CQTA 2UUZA 1X1PA 4BY7J 4HX7A 3CC7I 2VOPA 1HCRA 2E71A 2B9SA 1ZR2A 1ETXA 2JRMA 1QNTA 2CV2A 2P5VA 1UG0A 4M3DA 1PYVA 1FNNA 4LG3A 1DU6A 1IF1A 3GF2A 3P7NA 2E7WA 1YJWI 3I5UA 2M30A 4XSZF 5DV5A 2EB7A 4EGYA 2WAEA 1XSVA 3I0TA 4MFDA 3RKXA 4EM1A 5ILVA 4F52A 3SEQA 3BOQA 2O61A 4OINF 2CRGA 1L3LA 2V6CA 5F6FA 2L9NA 1R7JA 4LLNA 5HVQC 4V2GA 4XIDA 2KPMA 1YO5C 2UXNA 3A0BC 1NK2P 1OYYA 1M1EB 1E0EA 2PG4A 3G1LA 1TWCJ 3ZQGA 4IRGA 4DQ2A 1LVAA 5CVVA 1FT9A 2P4WA 4XN0A 4C3IJ 3KFWX 4XBFA 3C3WA 4RS8A 4B47A 3GTPJ 3AG3H 1J59A 3JREA 4BE1A 4FT8A 3HHHA 4CH7A 4HDUA 2KJCA 4D9JA 2BVLA 2D45A 4G8XA 3SZPA 4Z6YA 4I09A 3SYTA 3TO7A 2EA4A 1AKHB 3GTLJ 4QSHA 3LMMA 5E8IA 3BLYA 1QPMA 3FKIJ 1ZLJA 2LLKA 1E2XA 2IVMA 3MZHA 3VODA 1BOAA 4KIBA 5DCMB 2G0EA 1AOYA 2L54A 2CV1A 3HIFA 3PL8A 3F23A 3KLNA 1SMYF 1UMQA 4WK8F 1OR7A 2LY2A 2YX4A 2DOAA 1JUMA 3S3NA 4XKWA 3TO9A 3S1NJ 1UHWA 2EBIA 1FMWA 1IXRC 3GXOA 1VQNI 2X6XA 2F5VA 2BEOA 4EGZA 1T95A 3M9AA 5FROA 2VC1A 2BV6A 5A2QZ 2HZDA 3HPGA 3QAHA 3DBHB 2BXZA 1XDUA 2CQQA 2K9SA 4HW0A 2CJJA 5B1BH 3OYEA 2DPUA 4IJAA 4FTHA 1Z6TA 1DUXC 3S3OA 2DA1A 2LVSA 3GFJA 2Z1DA 4A6EA 4ENJA 4RGRA 3PO2J 3HOXJ 4IHWA 3BCAA 1D1AA 3CO6C 1S72I 3CLQA 4LG0B 4M3EA 5KAFC 4LB5A 5DCMA 1JJ6C 2ZNZA 5BOXA 3OIOA 3GW2A 5D5VB 3DTEA 1LDDA 3HYIA 3EUKL 1S7AA 3M1EA 4KA4A 1FOKA 2LC2A 4P96A 5J8FA 1ZRCA 2K7LA 2LP0A 4IOAF 3BJ6A 2ZMEB 4BBSJ 2M0CA 2V9PA 3GTQJ 2RNJA 4W97A 2IAIA 2XPVA 3QP6A 3GTMJ 2XKOA 2OJED 3LSMA 2E19A 2GOMA 1XC5A 4Y33A 3BG3A 2IRFG 2QQBA 1TTYA 3PM1A 2NVUB 4GYIA 4HV5A 1WGXA 2Y0MA 4Q47A 1RETA 3J7AY 4KITB 3K1NA 3A2KA 2CUFA 4MNUA 3KZZA 3V7RA 4MTEA 4YIIA 3RJPA 2LY1A 4OIRF 4D1QA 5DUKA 3F8FA 4AWXB 1N78A 3E3VA 3ELKA 5J6XA 2ZBKA 5H6QA 5K5QA 4ZYHA 3CDLA 1WRJA 2EK5A 3F8BA 3HGYA 3BR2A 1W5TA 1W7PD 2LBFA 2LR8A 2XHKA 4HNUA 2W57A 3S32A 1HA8A 3O6BB 2QCOA 1P9QC 2F48A 4L9TA 2CH0A 2EFWA 3WTVC 4Y7NJ 3W2WA 4PJ0C 5D4SA 1VQOI 2X51A 1WJEA 2XC7A 2FMYA 3DEWA 3I64A 3RPQA 4B3AA 1Y1WJ 1U2WA 3H3ZA 4F55A 5IYDJ 3TP0A 5CQEA 2FUG2 2P81A 1ZAOA 2DT7B 4XLFA 4I0BA 3S8PA 2HQAA 5A2QK 1A6QA 3CCQI 1MMNA 2JJ7A 3OYDA 2YS9A 2HQRA 2HYFA 1DPUA 2BBYA 3HC7A 3LA3A 1TNTA 1GUUA 2MD0A 3BJAA 3I4PA 4U7BA 4E7ZA 5E1ZB 5FGMA 4I98B 1FSHA 5F1RA 2ZNYA 3MVPA 2GIZA 3H3UA 2KIUA 4JX4A 4Y3OA 3S1MJ 4B48A 4BQQA 1IDZA 3TKYA 1OCCH 2KHMA 3OYNA 2NRAC 4A3MJ 3QPSA 1VQKI 3CCMI 1FIAA 2A6HF 4YFNF 3LAJA 3LNQA 1O3SA 2EFOA 3KYCB 1KU7A 2DO7A 1MMAA 1BI0A 1V55H 3SHFA 1RR8C 2HOSA 4IHSA 1U8RA 2QVOA 1OCTC 4XK4A 2FBKA 2VI6A 5L3EA 1Z6RA 3VWBA 4MTDA 1PDNC 2XASA 4L9JA 4OMYA 1S9HA 4I02A 4NB5A 1Y8RB 1YG2A 2I10A 4KDPA 2HU9A 1SAXA 1JUPA 5H2FC 5HNHA 5C3EJ 1ZYRF 3N97A 4CCKA 3AL0C 4ENKA 4M6VA 2BW3B 2GAUA 1TP4A 2ELKA 3BZKA 2Z9OA 1BR1A 2LSOA 3UKGA 4L9VA 1EF4A 4IHXA 1XCBA 3OYFA 1EV7A 2ME0A 3K4LA 1LFPA 1YW8A 3L2WA 4F91B 4P5OA 4AIJA 2O3FA 1ZG3A 3FISA 2QA4I 5K5OA 3KEQA 2IBDA 4BEHA 4I7HA 3F8NA 1D3YA 1STZA 3KE2A 2AO9A 1K61A 2HR3A 3P9IA 4XLAA 2GIVA 2Q2EA 1SMTA 4M71A 5J8CA 1YW7A 3W2VA 3BDDA 3S3MA 2STWA 3CMMA 2JA5J 1TZLA 3L2UA 1WJCA 2CYYA 1ZHFA 3FXKA 3EETA 1W0UA 1RNLA 2R7VA 5K5RA 4MQ9F 2VKVA 3G2BA 3TP3A 2NS8A 3PQKA 5LHHA 3OS2A 1FLIA 3BT9A 2VJ5A 4IQJA 1MDMB 2VKEA 1QVTA 1IRZA 3GTOJ 5J47A 3GBGA 1YITI 1MMGA 1SVOA 4D5CA 1F4KA 2JQ7A 2LKSA 5JLXA 1XGMA 4AYBA 4AIKA 3KIOA 1E3PA 2X4HA 2R0QC 5E17F 2KKOA 3FXUA 5E18F 4C2UA 3ZQLA 2G7UA 4XR6A 2WC2A 5KK1A 2ECCA 5IYCJ 2QKLB 2LD5A 2CW7A 1BIAA 2OU2A 3A0HC 3L00A 3WHBA 4DW6A 3VYRB 1BI2A 2W24A 1B8IA 2XGDA 3WTXC 5BNGA 2V6EA 2ZJPF 1BJZA 3H5RA 2IA2A 3FXMA 4I76A 1U78A 5E3MA 5DDGA 2DYSH 3WODF 1MNMC 2XIGA 3Q0WA 2L9RA 1BI1A 2IGNA 2E7XA 3V7CA 2EH3A 2NAZA 4C2MJ 2NVQJ 2WADA 3HRMA 5EYRA 1QO0D 4YFKF 3BTIA 2W84A 4UV9A 3LSIA 2VBXA 4BU2A 4HQEA 1XMAA 4UXNA 2DPDA 1MW7A 2WAQA 3OYHA 4EJVA 4HZFA 3LQQA 1WPKA 2Y48A 3BC8A 4XN3A 1YTYA 1OMIA 3K4KA 2GBYA 3EPZA 2KIFA 2W7NA 3BR3A 3BPVA 3EUHC 3E5QA 4HX8A 2DA2A 3FK6A 2FU4A 5D5XB 1BI3A 3T5XA 3QOPA 5KHDA 2FQ3A 1EKEA 4O6JA 2FE3A 1W36C 4CYCA 2XKPA 2ZXJA 5FKLA 3ABMH 1ZG5A 4V19K 1PUFB 1IZ1A 1GXQA 2D1HA 2GQQA 3OIPA 2IP2A 1QBJA 2XVCA 3WGGA 2XF5A 3V4GA 3JAMK 2Q8KA 1T33A 1TLHB 3S2HJ 4Q48A 2HKXA 1U5TA 2VB6A 2Y31A 1RUOA 3E6MA 2R5ZB 2E1MB 2Y9YA 4IHTA 3DCFA 1MGTA 4ENNA 2W4SA 1BM9A 2V1NA 4WF2A 1G3YA 3F9KA 3ZMUA 2X6OA 2K3FA 3TOAA 3HSFA 1RI7A 4M9XA 4DOZA 1NTCA 4C3JJ 5GTHC 3F6OA 2O03A 1WJBA 2KL4A 2KFDA 2PEXA 2XSJC 2EIKH 3RQIA 3PUFA 3HSEA 2RQPA 5LEKA 2DOEA 1FEXA 1OCOH 5F04A 1U6GA 3A03A 3QPHA 3CJQB 3JRDA 4YIRX 3S93A 1Y0NA 1ZTRA 2TCTA 3Q0VA 3WE2A 3J81Z 2LKPA 4IXAA 2ELJA 3R6SA 4YG2F 3SDGA 5M5WJ 2DOFA 2Z99A 4G94A 3RSNA 5CVIA 2OZ6A 1USSA 2WAFA 1YRNA 3HOWJ 3F3XA 1XPXA 2X48A 4LLLA 3JR9A 1Z7LA 2EFQA 2EV0A 4G7HF 4BQAA 1SFKA 2P0WA 3OR1C 3I54A 3TGNA 1KU2A 3GZNB 3R0AA 2XPWA 1CF7A 5GAGJ 3PQJA 4HG2A 3D5RC 3A4CA 1WQ2A 2LKXA 1X4PA 4XRSA 3IAS2 2HVSA 3LA7A 3TQNA 4ZC3A 3CUQB 3FXLA 1OISA 2ID6A 4CCJA 2D5VA 5LFAA 2MLKA 3CC2I 2L0KA 4CXFA 2L3DA 2HQ5A 2BVMA 1Z67A 2DT5A 2XROA 4HNVA 4BQNA 3J80K 3IH3A 4IHVA 1FYLA 1X1DA 3BG5A 2JRTA 4X6AJ 2ESNA 1I1GA 1SD6A 1XSDA 3V7SA 3I3LA 3CF2A 4RB3C 4PUSA 1FX7A 1W4MA 3HTUA 4UUSB 1KGSA 3IRQA 1I50J 5L3DA 1ON1A 2FJ1A 5BPDA 1XGSA 5J1UA 1YIJI 2M2EA 1IUYA 3GFMA 3HZJA 3HJEA 3LSJA 3L7WA 4MIMA 5FJ8J 4IKFA 1H0MA 4RAZA 4WCGA 3WGIA 1FYMA 4EM2A 2VE8A 3SEZA 5JHFA 3DQVC 4JYKA 2V7FA 2EV5A 4S05A 3MKLA 1SAUA 1APLC 5B5EC 1IN6A 5E3NA 3JSPA 3JRBA 3R0JA 1AA7A 2E60A 5LRRA 2RQQA 4JOMA 4HLYA 1XMXA 1OR7C 3GWZA 4OU0A 1GV5A 5D6FA 1I3QJ 2DA5A 2IXSA 4RBOA 4M6XA 2HZTA 2HOAA 1V3FA 2WA0A 4TV7A 2VBWA 4HF2A 2IGOA 2YUSA 3OYMA 4M9SA 5FLVA 1T0FA 2AXLA 5EJCA 3K9TA 2PMUA 1HKQA 4XM3A 3GFIA 2HGCA 3ZQHA 4XRFA 1W1WE 5E20A 3MKYB 1MBFA 2MH9A 3KZYA 1MBEA 2ZXIA 2BZTA 3MKZA 2V1UA 2XSDC 4HQMA 4AVZA 2CG4A 3J81K 2A68F 1FTZA 4JQFA 3IAM2 5LD2C 3RZDJ 4I01A 5FLXZ 1FBUA 1LDJA 2E1NA 4N9IA 4FX0A 5LGUA 3K2AA 3S1RJ 2DFHA 4CDGA 3HHGA 1TC3C 2FD5A 1VF9A 4IOCF 2KZVA 2LTPA 2ICWG 1ETKA 4RAFA 1D0XA 3GLLA 1RKTA 3ROUA 5DS9A 1JKQC 2V79A 2M7BA 4OIPF 3ASNH 1H88C 3A02A 2ZSHB 4A3EJ 4C9YA 3PJRA 1ON2A 2LMDA 4ZDPA 2XB5A 2ISZA 3CTAA 1NH3A 1UAAA 1YFHA 5L3BA 4L5EA 1IRXA 1LEBA 1RZ4A 2X6YA 1KYWA 2HXOA 1W36D 2DT6A 3LL7A 3E6CC 1VQ5I 3QRFF 1LNWA 3HOUJ 2DA7A 1NHAA 2IA0A 2W1OA 1X58A 1U9NA 4AUXA 4ZTFA 2PJRA 4HBLA 5IOYA 1TQPA 2HI3A 1WI9A 2XGCA 1PP7U 3W6VA 3TL4X 2E2HJ 5FB2A 2KZGA 4H0EA 3G73A 3RKWA 1HW2A 1MBKA 3QPTA 4EM0B 1T38A 2DJIA 2VBZA 2V9VA 4CGZA 3FBIB 1IXCA 3TO6A 3EDPA 1S5LC 2YX7A 3PO3J 2QM3A 1YYVA 2Q0OA 1N25A 2NNNA 1D0ZA 2ZMEC 1RPWA 3HOZJ 2WBMA 4KT5C 4P55A 1LDKB 2GA2A 4ON0A 3W3CA 1HXDA 2ZJ2A 4E7HA 1XD7A 1YW9A 5DM6F 3WG7H 4M74A 1XSXA 1G8XA 5TGTA 2JA8J 3QOEA 3EQLF 3RTRA 4ZYDA 2KRFA 2JTVA 4A2UA 1VTNC 4B44A 1K4TA 5LHGA 3B6CA 4CUGA 2CQKA 4Q5SF 1TW3A 3JRFA 3DWLE 1WH7A 4G6DA 4R8HA 1VNDA 4UVCA 4F7ZA 3MCZA 4RLFA 4BL0B 4A3IJ 1HC8A 5BS6A 3F0CA 3LWFA 3PNTA 1Z91A 2BE5F 1IN8A 4P1WA 4P9UA 2XAQA 3IH2A 1RKWA 2DMUA 1VZ0A 2XAFA 5DCFA 5FLXK 1B4AA 4G9YA 5M3MJ 2Y0SA 5L3FA 5HDKA 1YS6A 2HNHA 3SQNA 3TOBA 4PJLA 1X1BA 3JRIA 4NC7A 1WJAA 2XPUA 1FYKA 3OYKA 2BY3A 1OLTA 3I4MJ 4BUPA 5HLGA 1WVRA 1ETQA 1YLFA 3VOEA 2C6YA 1JE8A 2X1DA 5LBQA 2VC0A 5LGTA 2OD5A 2H6CA 3OYAA 1KQ0A 2P7VB 1P92A 2VKDA 3S2WA 2MC4A 1I27A 1IRGA 2ZXHA 3U1DA 2WV0A 1HF0A 3MWMA 4LLGF 3Q3SA 2KJBA 2LREA 1PUEE 4ZYEA 4PJNA 3W6JB 2K9LA 3T1BA 3HL2A 1HKSA 2RN7A 3OOUA 1FTTA 3RCOA 2UV1A 2GLOA 2JPBA 2VODA 4A69C 5ICEA 1O7FA 5DEQA 2NNYA 5AIQA 1CGPA 3L2QA 1LFBA 4J00A 2A05A 2XF7A 5CQGA 4UUVA 1MZBA 5CYVA 3ERED 1ETYA 2W00A 4IVNA 2H8RA 3KEYA 5E79C 3ZP5A 1XTAA 4KMFA 4WXHA 2TRTA 2CV0A 2R93J 3LSHA 4GRIA 3CJTB 3L09A 2J5PA 2OZUA 1K4SA 1R4MB 1ETVA 2FBIA 2MGQA 1E3OC 2IJLA 2OQRA 4L5JA 4HDVA 4XMYA 1SVMA 5HS9A 4N4NB 1FBSA 3V8LA 2DODA 2FF4A 2DMQA 1E3HA 3B73A 1J5YA 2LBFB 3J7YJ 1G59A 1BN5A 4FX4A 3CUOA 3AAFA 4A3FJ 2VASA 3I4NJ 1BJAA 1DGRM 1XCVA 1LE8B 4C30A 5CLSA 5J1YA 4UHTA 4BACA 2HOEA 2F5DA 1HKTA 1G3WA 2E5NA 2JUCA 2R5YA 5HS7A 5AONA 5C4XJ 1OPCA 1MJAA 1YS7A 2PI0A 3AKZA 2IT0A 3CJNA 2DAOA 2MYSA 2PMZA 4KICA 2RVCA 2OUMA 2M3AA 1SC7A 2QEXI 4BHCA 3P9KA 1IC8A 4R1HA 4A0XA 1Z77A 4CA0A 1J09A 5E3LA 2R7QA 2M0MA 4RB2C 2L4AA 4XLNF 4FQGA 3GLXA 1BW5A 2ZO4A 1LJ9A 1W7PA 4I6ZA 1FY7A 2VLAA 4M3GA 2VOOA 3N4MA 2GOXB 3ZMSA 1OQYA 2Z3YA 2HYJA 3ZRGA 1RIOH 1UJ8A 1ZH5A 3FXRA 4A0ZA 2CW8A 2FNAA 4XQFA 4FASD 1P4XA 1SFXA 1XG1A 1LE8A 3C18A 2P8TA 1DQUA 4PGGA 3OWTA 4AIHA 2Z33A 5KCMA 2R92J 4AD9A 2XAUA 1MMSA 3F22A 1OCPA 4CCOA 4B4CA 1LUJB 2DJNA 4MO7A 4QPOA 2MBFA 1Q1HA 4M73A 1SFUA 1DPRA 3LSRA 2OCEA 1JHFA 4A5MA 4D5FA 3TEDA 1U3EM 2CQ7A 3I58A 2R7ZJ 1EH8A 2KRCA 1B1BA 4R79A 4U0YA 3WU2C 2CFOA 3BZCA 3WU1B 5TRDA 1T8IA 4QWQA 1RR7A 2DMTA 1BR2A 1X4OA 1UCRA 1S7OA 2EINH 4Q4ZF 2WY8Q 4QPQA 3FZVA 2CSOA 2QQAA 1R5GA 4OAYA 2B7EA 4PZJA 4BKXA 1HBXG 4KMUX 2WB1A 2STTA 3BTCA 3RI4A 1Y56A 3G4SI 2G7HA 2M8GX 3IWFA 4BEHB 4E6KG 2IS2A 2VJJA 2ZB9A 2GA1A 3DBRB 4KFCA 1FBQA 2HPIA 1TW2A 3AG4H 2VPRA 1VQ9I 2RV8A 2VT2A 1U5TC 4G7OF 3LSTA 2CQNA 4DIQA 4ENMA 4QTRA 2Q2EB 1XMKA 1AU7A 2FNPA 1G3TA 3NWTA 1IUFA 4LFUA 4HNTA 5CVRA 3EYYA 4IQ4A 3J7AO 5HS8A 3ECHA 3OR2C 2OV7A 4YIFA 4OIQF 2L4MA 4ITVA 2B63J 1ONVA 3M8EA 3ASOH 2ME6A 2K02A 2E2IJ 2XAHA 3ESWB 4P9FA 1R9TJ 2HDDA 2LY9A 3BTLA 3WG9A 1KQ8A 2M9HA 3FM3A 3DEUA 1B72A 4HRIA 3LSGA 2PX9A 1VI0A 2V1XA 3PUBA 2O8XA 4D0PA 2JVHA 5FKKA 3K4NA 3CCEI 2CS3A 4DJAA 5CJ9A 3F21A 3MAJA 4KUMA 1JTYA 1YJ9I 4X0GA 2ZJQF 3JSOA 1A04A 4WWCA 3H5AA 1B8IB 2FMLA 2E1MC 1HSTA 5F0CA 4PK4A 1BIBA 3O8GA 1J0RA 3JAMZ 4DBRA 1JGSA 4EEFG 3GTJJ 3U21A 3SXYA 5JVTA 1TQIA 2RDPA 1ZGWA 1J9IA 1I6XA 3LAPA 2IS4A 5EGOA 1UG2A 1X2NA 4QLCU 2E2JJ 2V4JC 1ULYA 3X2QH 1Z9CA 1HW1A 3E5XA 4CZZA 4YFXF 1NK3P 2YU3A 2HVRA 2R3SA 2H27A 2R7TA 1O3TA 4W1UA 1W5SA 3S17J 3ZN1A 2XDVA 4PFPA 3CF5F 2DW4A 3A1YA 5IOZA 1QA6A 3A01B 1X1AA 1JHHA 2I5UA 4CICA 3UR3C 4RB1A 1ZREA 1EH6A 1SVLA 2ADUA 2BY0A 3FWEA 3WTSC 3GEZA 2VN2A 2AQEA 2L2OA 3Q0UA 3CLOA 1TWAJ 2COMA 2P6TA 2V1DA 4GO1A 3FDYA 1D5YA 1W5CC 1R22A 1XN7A 1V5FA 4N0BA 1P4WA 3ISPA 1TNSA 2EZHA 4GYGA 3CMYA 2CW0F 3WTUC 4CYCB 4FETA 3S1QJ 1TQMA 3GZ6A 5CPRB 1IN7A 4LB6B 2F4OB 3IV5A 3IC7A 2K9MA 1EA3A 1ETOA 1WH5A 3DF8A 3AG1H 1T56A 4RAGA 1OFCX 1SD4A 2PLYA 1PP8F 4A3JJ 5HLIA 4N4OB 1D5VA 3CUQC 1DDNA 2JVGA 2DDBA 1U5TB 3CCRI 4L5IA 3FBNB 2F5FA 4HSTA 5TJJA 2M8EA 1QQIA 2DFIA 1R4NB 3MFKA 1K83J 2QENA 1XGOA 4IRHA 1B9MA 2RC4A 3A01A 3CDHA 1S6LA 4ZDOA 3KX2A 1T0FC 3Q5FA 1Y8QB 3ZXSA 4ANJA 2NVTJ 1ZGAA 2X1EA 4BAYA 4PGHA 3I59B 3HKZA 1KQ9A 4QIWN 3J80Z 2HXIA 1B9NA 4M72A 1TT5B 2F2EA 2DA3A 1GV2A 2XB0X 2O0YA 2NVXJ 2PMHA 2LNBA 3K70C 3OYJA 1ZGJA 2FOKA 4BDYA 3R61A 3RDIA 1YJNI 2ID3A 3K1PA 3ULQB 2BHYA 2LRDA 3I9V2 4LOCA 5F1JA 3F6VA 3SFIA 4BE2A 3DFGA 1J7KA 2CUEA 2JA6J 1TWFJ 2Q1ZB 3JTGA 4XOTA 3CCJI 1P7IA 5ILSA 2FQ4A 5E8GA 1I5ZA 4AVPA 1GLNA 1IJWC 2DN0A 2ZC2A 2R7RA 1R23A 2DQLA 2LFBA 1MIJA 1YRNB 3O2PE 3H5NA 4RAYA 3TDZC 2QF7A 4BXFA 1MD0A 4XLHA 5FKMA 1RC9A 1G6NA 1IDYA 1D8JA 2K3PA 4F93B 1R5HA 1CF7B 1ZLKA 2VJ4A 3I59A 3IH4A 5D4RA 1S29A 2F5EA 4OMZA 1Z1DA 2GZWA 4WXDA 1LB2A 3HPHA 3KP3A 1ETWA 5HODA 1NG7A 3DKYA 3OSFA 4ZH4F 4BHPA 4KIGA 4N9HA 4IRIA 3OSGA 2HDCA 4YEJA 1FJLA 3Q9VA 5ED4A 3ZQQA 3KETA 2FX0A 3MEXA 3VSKA 4NHJA 5E1XA 3V8JA 1MNDA 2J5OA 1A35A 1Z7UA 3CD6I 1SANA 1OCRH 2X1CA 1UFMA 1WJ5A 2O8KA 4KT6A 2M34A 3FMSA 4EJOA 3IL2A 4B43A 3S14J 1LEAA 1ENHA 4U87A 3ZMDA 3DEEA 1WCMJ 2K27A 4XOPA 4BQOA 2JN6A 2XRNA 3KCCA 2M4GA 2QYOA 1T6SA 4CZCA 4HEA2 5F27A 2NOJB 1HSJA 2OTJI 2DA4A 3WTWC 2H8WA 4E7JA 1BW6A 3W6KB 1H89C 1Z0XA 2MA3A 4B09A 5BPIA 1YHQI 3TW7A 3FF5A 1T08B 4M6YA 4NC8A 4G12A 2ZFUA 3NRVA 1HDDC 4ASNA 4M3FA 4CSWA 4KNYA 3HRSA 4NNJA 3MN2A 3H9GA 2WY7Q 3BROA 3K4CA 1XGNA 2R7FA 3B02A 4FISA 4A12A 2M5WA 4RB0A 1YI2I 2A6TA 2ZFWA 4O5VA 2MH2A 2IA1A 1Z3XA 2WTEA 2DQRA 2WWYA 2XRLA 4ETSA 2HS5A 1USTA 5H6RA 5ICFA 3FX3A 3IUOA 2KT0A 4XRSG 5LHIA 3OYBA 1ZRDA 5K7FA 5DYMA 1LKXA 4BH9A 1IN5A 4D7MA 1WSUA 4UY8I 3PSIA 2CU7A 1DGWY
chains in the Genus database with same CATH topology
3E1SA 1FMVA 1D0YA 4RLFA 4BL0B 4G6TB 3VYUB 4E7KA 3PNTA 4F55A 5CQEA 4P1WA 2FUG2 4H4KC 3ZGKA 2K5CA 2DT7B 1VZ0A 3BG7A 3DKXA 4XLFA 3S8PA 2HQAA 1MMNA 3OYDA 2Y0SA 3HUGB 2HNHA 3K4MA 5FRMA 4PJLA 1X1BA 3NWSA 3DU6A 1WJAA 4NC7A 3HOTA 2RNGA 3DU5A 2OC6A 3HC7A 3OYKA 3VYTB 1OLTA 3EUAA 4BUPA 2MD0A 2V9KA 4U7BA 3D5SC 4E7ZA 3DLAA 3DPUA 3VYSB 2X1DA 5HLTA 4BDZA 4Y3OA 2I8DA 1BOBA 3OYAA 4B48A 4BQQA 2VKDA 2MC4A 2MFZA 2KHMA 2ZXHA 3OYNA 3AL0B 3DTIA 2LREA 4XKCA 4PJNA 3OYGA 2PJRB 2K9LA 3HL2A 4DBQA 1N75A 3RPUD 1MMAA 3OOUA 4Y4RA 3RCOA 2UV1A 3FHNA 2F4IA 1JI8A 3VWBA 3L2QA 4J00A 1S9HA 4BGDA 2XF7A 5CQGA 4XLEA 2HU9A 2W00A 2O5RA 3N05A 2IGKA 2IGMA 3CJRB 2W82A 3KEYA 5HNHA 5HNFA 4CCKA 3AL0C 2CV0A 2BW3B 3LSHA 4GRIA 1BR1A 2CMPA 4DGWB 3K70D 3K4BA 3RQ4A 3OYFA 3K4LA 2VKHA 1LFPA 1WFXA 4F91B 4XMYA 4P5OA 3QYBA 4N4NB 3HXLA 4BEHA 1G59A 2LBFB 4CCNA 2A5WA 3V42A 4NUBA 2VASA 5HOOA 1X19A 2Z2SB 1DGRM 4C30A 1NG6A 4XLAA 4J01A 4BACA 4XKVA 4E7LA 3H0DA 4E7IA 3W2VA 3S3MA 2E5NA 3CMMA 2L5QA 3OYLA 1TZLA 1YX5A 3L2UA 3IP4B 1WJCA 3AKZA 3DTKA 2LOOA 2R7VA 2MYSA 2PMZA 2OUMA 2M3AA 3BG6A 4B3XA 4PFOA 1Z21A 3G2BA 3OS2A 4CA0A 2VJ5A 1J09A 4IQJA 2R7QA 3K4JA 2JA2A 3GBGA 1MMGA 4YELA 2LYCA 2M0MA 2JUGA 4AYBA 2X85A 1WJDA 4XLCA 1QU3A 2VQHA 2XF6A 2HVQA 5KNLA 2KRHA 4C2UA 5FRNA 2VLAA 4PSXA 2GOXB 3H9QA 3ZRGA 4XR6A 4LITA 2R7WA 2QKLB 2CW8A 2CW7A 3DPTA 3MD2A 4FASD 4XQFA 3VYRB 3OY9A 2LG4A 1V5GA 2V6EA 3H5RA 2DXIA 2VQLA 4HPQA 1DQUA 1Z3YA 3OWTA 4KJZA 5KCMA 3OIQA 4RMNA 3TBIA 4OWRB 2XAUA 4HSRA 3MMYB 4CCOA 3M1CA 2RREA 4QPOA 1MMDA 1Y6IA 2IGNA 2CUZA 4LIUA 3OMYA 2WADA 2L7KA 3D5LA 2KRCA 4XKBA 4PJJA 1UELB 4R79A 3OS1A 2CFOA 2R7XA 3LSIA 2KP6A 4BU2A 3LFUA 3SDBA 2IS6A 1BR2A 1X4OA 3FKJA 2WY8Q 1MW7A 4QPQA 4F92B 2WAQA 4OAYA 3OYHA 1MNEA 1X1CA 3CP2A 4XL9A 2WB1A 3BC8A 1Y56A 4XN3A 3K4KA 4BJ6C 3EPZA 4E4HA 2W7NA 4CCLA 4BEHB 4E6KG 2IS2A 2VJJA 2R7OA 3EUHC 2LH9A 2HPIA 2JSPA 4MLOA 4RLQA 3M8JA 4OAZA 3L2VA 5KHDA 4DIQA 2M7AA 1W36C 2Q2EB 3SZGA 3NWTA 1BR4A 3OIPA 2KQRA 2XF5A 4HNTA 4IQ4A 3OR2C 2OV7A 4ITVA 2ZSIB 2V26A 3K6GA 2VB6A 3CESA 3L2WA 4XORA 4BS9A 2E1MB 1D1CA 3OL4A 1V5EA 2W4SA 2V1NA 2VQGA 4F3QA 4HRIA 3LSGA 3F9KA 3PUBA 2JVHA 3K4NA 3AFHA 4KISA 3OL3A 3H35A 2IS1A 4DOZA 2CS3A 1QHHD 4DJAA 1WJBA 2KL4A 2XSJC 1YX3A 2AQFA 4X0GA 1WJFA 3OYCA 3H5AA 4ZJZA 2E1MC 4PK4A 2VL8A 3VDXA 2VJIA 4RM2A 1R6RA 2KMUA 2VIXA 2VQCA 3ZCOA 4DBRA 2L9SA 2Z16A 3CJQB 2R4GA 3S93A 4NQWB 3U21A 1TT0A 4E7SA 4AU7A 2BOLA 4ZTJA 2ELJA 4BE0A 4IX7A 2IS4A 3VSLA 2F6CA 2KDOA 2VPLA 2CUJA 2V4JC 3RSNA 2WAFA 3KYLA 2HVRA 1K6YA 2UUZA 1Z7LA 2R7TA 1SFKA 2P0WA 3OR1C 3C2HA 3PNVA 2XDVA 4PFPA 3A1YA 2CV2A 1UG0A 1X1AA 4RM3A 1PYVA 4HG2A 3D5RC 3A4CA 4LG3A 3UR3C 1PJRA 1X4PA 3IAS2 2HVSA 4ZC3A 4CCJA 5LFAA 2QKMB 2WAEA 2AQEA 1YE9A 2L2OA 3MKWB 2KLOA 3FDYA 2BVMA 4F52A 3K10A 3SEQA 1V5FA 4BQNA 4II2A 4BJ5C 3OYIA 2DCEA 2L9NA 4FETA 1X1DA 3C2GA 5CPRB 5HVQC 2KPMA 2HPMA 2K9MA 1EA3A 3I3LA 3CF2A 4PUSA 4XNFA 1E0EA 4YRVA 4N4OB 2JVGA 4LIVA 1ERDA 4IKFA 4XN0A 3FBNB 4HSTA 4C2TA 3BCBA 4B47A 3SEZA 5JHFA 3DQVC 2V7FA 1ZELA 4BE1A 4ZDOA 3KX2A 1SAUA 1T0FC 4CH7A 3QODA 3ZXSA 2BVLA 4D9JA 4ANJA 3W2AA 1AA7A 2X1EA 2E60A 2RQQA 3HKZA 3SYTA 4JOMA 3HOSA 1OR7C 2VXDA 1LVKA 3LMMA 4PJMA 2IXSA 3K70C 3OYJA 2WA0A 4BDYA 3BLYA 2IGOA 3H9JA 3OYMA 1DP3A 2LRDA 3I9V2 4XM3A 4BE2A 2CV1A 3PL8A 4ZYAA 2Q1ZB 4XOTA 2E5ZA 2LY2A 2DOAA 3S3NA 1QHGA 3MKYB 4XKWA 1U0JA 1FMWA 2X6WA 2X6XA 2ZXIA 2F5VA 3MKZA 1GLNA 4AVZA 1T95A 4II3A 5FROA 4JQFA 2R7RA 3IAM2 5LD2C 3H5NA 2HZDA 3HPGA 3QYEA 4BXFA 4XLHA 2HDWA 3ZR8X 3OYEA 2K3PA 4F93B 3QYFA 2KZVA 3S3OA 2VJ4A 3E0JB 3L2RA 2Z1DA 1D0XA 3LSKA 3PNYA 2M7BA 3BCAA 1D1AA 3HPHA 2ZSHB 4BJTA 4C9YA 3PJRA 1NG7A 3DKYA 4ZDPA 1UAAA 3DPLC 1IRXA 1KONA 4CCMA 3OS0A 2X6YA 1W36D 4YEJA 3ZQQA 2DT6A 3LL7A 3VSKA 3DTEA 4EATA 5CKTA 1MNDA 4IZZA 4PSWA 2UWMA 3EUKL 2X1CA 1WJ5A 2LC2A 2W1OA 4KT6A 4B43A 4ZTFA 2PJRA 4U87A 3DEEA 4BQOA 4XOPA 2M4GA 3TL4X 3TMOA 2M4KA 4CZCA 4HEA2 2NOJB 3LSMA 2GOMA 2DJIA 4Y33A 4E7JA 3FBIB 4XONA 4NC8A 3CZ6A 1D1BA 3J7AY 2BW3A 2ZFUA 3HG9A 4KITB 3A2KA 1D0ZA 3CP8A 3PSFA 2MABA 1N77A 4CSWA 4ZDLA 2WBMA 2LY1A 4D1QA 4NNJA 1LDKB 3H9GA 1N78A 2WY7Q 3K4CA 3W3CA 4E7HA 2VXZA 1G8XA 5TGTA 2A6TA 2LBFA 3QOEA 3RTRA 4HNUA 1Z3XA 3S32A 4B44A 1HA8A 2R7UA 1P9QC 2CH0A 4CUGA 3W2WA 3IUOA 3OYBA 3ONQA 2R7SA 3PFYA 2X51A 3UNGC 1WJEA 2XC7A 1LKXA 3PSIA 3DWLE 1DGWY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEH B;  2W1O A;  4BEH A;  2LBF B;  2LBF A;  3A1Y A; 
#chains in the Genus database with same CATH topology
 1K79 A;  1FMV A;  2M1B A;  1TWH J;  2CWE A;  1K7A A;  3H1C A;  1GHC A;  4I2O A;  1OCZ H;  3ZGK A;  2Y0S N;  3BG7 A;  2DA6 A;  3DKX A;  3DXJ F;  1FP2 A;  3K4M A;  3GTK J;  2BGC A;  3NWS A;  3T8R A;  5LRS A;  3H92 A;  2KDZ A;  3HOT A;  2N8G A;  2RNG A;  3DU5 A;  4ABZ A;  4K2E A;  4ESF A;  1H8A C;  4HAM A;  1XB4 A;  3BR6 A;  3VYT B;  3EUA A;  1IGN A;  2L01 A;  3D5S C;  1RUN A;  4BXU A;  3VYS B;  3VPR A;  4DYR A;  5HLT A;  2ELH A;  3COA C;  4UVA A;  1GT0 C;  2I8D A;  1OJL A;  3F8C A;  3FMR A;  1BOB A;  1P2F A;  4IL6 C;  2EIM H;  2FSW A;  1FWZ A;  2KIS A;  5J4V A;  4S04 A;  3ABL H;  3HBL A;  4BBR J;  3OYG A;  4Y17 A;  2PJR B;  3KP4 A;  4DBQ A;  2Y30 A;  3NAU A;  1I39 A;  3RPU D;  4MEX F;  2KIQ A;  1PVE A;  4MQV A;  1X2M A;  3V8K A;  3NEU A;  3R60 A;  2F4I A;  1DP7 P;  1ORK A;  3KZI C;  2JMW A;  4BGD A;  1JJ8 C;  1OYW A;  5K7H A;  4XLE A;  3CME I;  4EJW A;  2O5R A;  2IGK A;  2LK2 A;  2ETH A;  3CJR B;  5IP7 J;  2W82 A;  3BQY A;  4EJT A;  1I6H J;  1HW5 A;  2QBY A;  5JI6 A;  2Y75 A;  2CMP A;  3FMQ A;  4DGW B;  1FOX A;  1SD5 A;  3RIR A;  2MLG A;  3R4K A;  3K70 D;  4MHG A;  4L18 B;  3K4B A;  1MBG A;  1K78 A;  1GVD A;  2VKH A;  4D7N A;  1C0W A;  4PDK A;  1IV8 A;  1WFX A;  2QQ8 A;  1ODD A;  3FXQ A;  3FXO A;  2D2W A;  2FOW A;  1XDS A;  3T0Y A;  1IG7 A;  1GXP A;  1K6O A;  1IAW A;  3QYB A;  4KIF A;  5ICG A;  2DLL A;  3HXL A;  5ILU A;  3WGH A;  2NOG A;  3LOC A;  1Y39 A;  2IW5 A;  4NUB A;  2CO5 A;  1JGG A;  2Z2S B;  1IXS B;  2PQ8 A;  3CCY A;  3TDU C;  2DBB A;  1JUS A;  3ML6 A;  1NG6 A;  5EEH A;  3IKT A;  3PIP F;  4E7L A;  4E7I A;  2DTR A;  2K86 A;  4A3C J;  4FE4 A;  2MG4 A;  2OA4 A;  2L5Q A;  2QUF A;  3RKY A;  3OYL A;  2PMZ N;  1YX5 A;  2QSF X;  3IP4 B;  5DTD A;  5DUI A;  5F08 A;  3DTK A;  9ANT A;  2LOO A;  2QZ8 A;  4B3X A;  4PFO A;  3CCU I;  4HV6 A;  3HOY J;  1T39 A;  3DBL B;  4HF0 A;  2PJP A;  3KLO A;  3K4J A;  1E17 A;  4YEL A;  1JKO C;  1KU3 A;  3GFL A;  1WJD A;  4Y13 A;  1HDP A;  4XLC A;  1EH7 A;  2VQH A;  2HVQ A;  5KNL A;  1QU3 A;  2KRH A;  4PSX A;  3GVA A;  4RGS A;  2VON A;  5F64 A;  4LIT A;  2FRH A;  5D6E A;  2NS7 A;  4U7D A;  2R7W A;  1U8B A;  2H1K A;  1ZAR A;  3MD2 A;  1R1T A;  2LG4 A;  4I99 C;  4RDU A;  4HPQ A;  5IT3 A;  3GO5 A;  1Z3Y A;  3DP7 A;  3RYR A;  3L1P A;  3OIQ A;  4RMN A;  3TBI A;  4OWR B;  5D8L B;  2F5C A;  3LFK A;  3LQR A;  3MMY B;  4HSR A;  4NQW A;  2A5Y B;  2RRE A;  4JK1 X;  4A0Y A;  1MMD A;  3JCU C;  1TL8 A;  4X1E A;  4JBA A;  3KPH A;  4AC0 A;  4BY1 J;  1R1V A;  2CUZ A;  2QWW A;  4LIU A;  4WX9 A;  3ZPL A;  1GVJ A;  2BHZ A;  2L7K A;  2NS0 A;  2E34 A;  3D5L A;  4XKB A;  4BYY A;  4EV0 A;  4PJJ A;  1UEL B;  1BA5 A;  3KP5 A;  2JA7 J;  2UZK A;  2R7X A;  2KP6 A;  2OQG A;  3SDB A;  2P5K A;  1QZZ A;  4GXO A;  4F92 B;  2WB1 N;  3D1N I;  3CQZ J;  4UUT A;  3EYI A;  4XL9 A;  2VE9 A;  2MD5 A;  2L7M P;  1VQL I;  3ZMZ A;  5FFX A;  4CCL A;  5FLM J;  3CCS I;  1P7J A;  2QSH X;  1UB9 A;  3BWG A;  5C4J J;  2NVY J;  2W25 A;  4EQQ A;  2FEZ A;  1QZE A;  4RLQ A;  3SFZ A;  3SJM A;  3M8J A;  3RKQ A;  2O6G E;  3JW4 A;  2JK3 A;  3L2V A;  4M3B A;  2X9D A;  3VEP A;  1VQM I;  2YPR A;  5BQT A;  2H94 A;  1BC7 C;  2EZI A;  1BR4 A;  3HSR A;  1U9O A;  2R5Y B;  2OPT A;  3AG2 H;  1F9N A;  3TW6 A;  2KQR A;  5JFR A;  2JSC A;  2DI3 A;  3WTT C;  2A69 F;  5LLQ A;  1S8N A;  2V26 A;  5LEJ A;  4G6Q A;  2DMN A;  3ABU A;  3K6G A;  5IYB J;  2GXG A;  1P4A A;  4I0A A;  4XOR A;  1IW7 F;  1KU9 A;  2ECB A;  3M7G A;  2W85 A;  4BS9 A;  5IP6 A;  3JRC A;  3G6E I;  1MBH A;  4LMY A;  3HRU A;  2VQG A;  4F3Q A;  3K1M A;  1MJ9 A;  5DD8 A;  4FHT A;  2EWN A;  4ZZL A;  3BTJ A;  3FXJ A;  1W7P B;  3H3V K;  1H9G A;  4U0W A;  5GAD J;  1POG A;  3OL3 A;  2ZCW A;  1JT0 A;  2IS1 A;  2DFE A;  2PN6 A;  2QLZ A;  5EG0 B;  4M9Z A;  2W48 A;  5HLH A;  1MH4 A;  1AKH A;  3REO A;  3C7J A;  2AQF A;  1IV6 A;  4GFB A;  4AM3 A;  4U88 A;  3JRA A;  3OYC A;  2CQX A;  1V54 H;  3GZ5 A;  5LGN A;  2O9L A;  2VL8 A;  1TBX A;  3CCL I;  4RM2 A;  1R6R A;  3I55 I;  1OYI A;  2PBI A;  2VQC A;  4OOI A;  3ZCO A;  3ZOB A;  2BXY A;  5JR3 A;  2A3S A;  3ECO A;  2EQR A;  2GWR A;  2R4G A;  4JP0 A;  2EJR A;  3ZMV A;  4E7S A;  1UZC A;  4AU7 A;  5FD6 A;  1MBJ A;  5KAI C;  1WZ2 A;  4ZTJ A;  3K2Z A;  1G2H A;  3B6A A;  4BE0 A;  5IPA A;  4IX7 A;  2F6C A;  2LF8 A;  5BMZ A;  2VPL A;  4AYB N;  4J19 A;  1H9T A;  2GXB A;  4A5N A;  1K6Y A;  3OV8 A;  5H20 A;  4ESJ A;  1X3U A;  1V4R A;  4LD5 A;  3C2H A;  3Q9S A;  3PNV A;  4HOB A;  2XAG A;  1R49 A;  5DM7 F;  3IWZ A;  1JT6 A;  5EG0 A;  4JX5 A;  3I56 I;  4XLP F;  1T2K A;  2KIM A;  3M4O J;  2RGV A;  4RM3 A;  1ZKG A;  2FXA A;  1VQP I;  1PJR A;  1O7L A;  3H0G J;  2HFH A;  2JWT A;  3HM5 A;  2QKM B;  3GTG J;  1YE9 A;  2JPC A;  4LG0 A;  2OCC H;  3MKW B;  2KLO A;  2NYX A;  1A31 A;  2OF7 A;  3K10 A;  2MSY A;  3WTY C;  4II2 A;  4BJ5 C;  2HEO A;  4BNC A;  1QRY A;  3OYI A;  2DCE A;  3C2G A;  2DU9 A;  4U0V A;  2BYV E;  1EJ9 A;  2HPM A;  3DV8 A;  3CO7 C;  4A3G J;  3CDI A;  4XNF A;  2ZME A;  4YRV A;  1Y1V J;  2EFN A;  4A6D A;  2EFP A;  5CVJ A;  4LIV A;  3ZQI A;  2WAQ N;  1ERD A;  5M3F J;  2UXX A;  1QZY A;  1KA8 A;  1VQ6 I;  3CMA I;  1B72 B;  2L9V A;  4UNO A;  4C2T A;  3BCB A;  3IKV A;  5GPA A;  4DYQ A;  1F5T A;  2FBH A;  1ZEL A;  4HX4 A;  2VT3 A;  3HKZ N;  3M3Y J;  2XUB A;  4LK0 F;  3QOD A;  1F36 A;  3LA2 A;  3WTZ A;  3W2A A;  3JTH A;  3HOS A;  2VXD A;  5CVU A;  1LVK A;  1D8K A;  2IEK A;  4PJM A;  4B8X A;  2H1L A;  4BXX J;  3KP7 A;  4EVI A;  3U9G A;  3H9J A;  1BBY A;  2RAE A;  3VB2 A;  4IO9 F;  4CO8 A;  1DP3 A;  3BR0 A;  4G7Z F;  1IN4 A;  2VBY A;  4NBQ A;  1FC3 A;  3GME A;  4ZYA A;  1FZP B;  2E5Z A;  5EEA A;  3O8H A;  1QHG A;  1G3S A;  1U0J A;  1QPI A;  4RA2 A;  2B0L A;  4IEJ A;  2HTJ A;  5FKO A;  2X6W A;  5EGO B;  2CGP A;  3GX4 X;  1R58 A;  4HLX A;  4II3 A;  4ZYG A;  4IF4 A;  1WHU A;  3QYE A;  1VFC A;  1FSE A;  4DYC A;  2HDW A;  3ZR8 X;  2HQN A;  3QU3 A;  3QYF A;  4ESB A;  1R71 A;  1YOV B;  1T98 A;  1S7E A;  4OIO F;  3IHU A;  3L2R A;  3E0J B;  2AHQ A;  4LGW A;  2OTL I;  1MH3 A;  3LSK A;  4DZJ A;  1MKM A;  2ISY A;  3PNY A;  4ZZD A;  3BR1 A;  2DFF A;  1R36 A;  4BJT A;  3KP6 A;  2K4B A;  1AHD P;  2HOT A;  3DPL C;  4HA8 A;  2ACJ A;  1REP C;  1KON A;  4CCM A;  3OS0 A;  4A3B J;  1IO2 A;  2LF7 A;  2BY1 A;  1B59 A;  1ZR4 A;  2M87 A;  3P9C A;  5E1W A;  4DZP A;  1HLV A;  5J3L A;  4EAT A;  5CKT A;  4IZZ A;  4PSW A;  2UWM A;  3FHZ A;  1RRJ A;  4RGU A;  3PIO F;  2JT1 A;  3HOV J;  1WI3 A;  2K9Q A;  1F1Z A;  5ERI A;  3KEO A;  4GGG A;  3TMO A;  3G1O A;  2M4K A;  1VQ7 I;  4KYW A;  2JZY A;  2F4M B;  2OAZ A;  1P6R A;  1OKR A;  1JXS A;  4XON A;  2Y9Z A;  5D8K B;  3CZ6 A;  1D1B A;  2L7Z A;  5D5U B;  2BW3 A;  2PFB A;  3HG9 A;  3FIW A;  4HF1 A;  2E36 A;  3PSF A;  3CP8 A;  2MAB A;  3E97 A;  3RZO J;  1N77 A;  4ZDL A;  2P6S A;  2P7C B;  4S0H B;  1LQ1 A;  3I53 A;  1YQA A;  5KVR A;  3BR5 A;  5TIS C;  2VXZ A;  3QP5 A;  3SZT A;  1L0O C;  3S15 J;  1KZH A;  3QPL A;  1MSE C;  2DMP A;  1FIP A;  2R7U A;  1AWC A;  1HQC A;  4UB8 C;  5FKN A;  3FK7 A;  3ONQ A;  3CCV I;  2R7S A;  1RES A;  3PFY A;  3UNG C;  4L0Y B;  3HEF A;  2K85 A;  3E1S A;  3HTS B;  1D0Y A;  4UV8 A;  4G6T B;  4L0Z B;  4PCQ A;  3VYU B;  4E7K A;  3BY6 A;  3L2C A;  1J2X A;  2H09 A;  3T8T A;  3BQZ A;  4H4K C;  4RGX A;  2K5C A;  4XSX F;  1S3J A;  2BY2 A;  2E1O A;  1R1U A;  3QU6 A;  5GTI C;  3QQA A;  1UHM A;  1MDM A;  3DKW A;  3HUG B;  4L9N A;  1FP1 D;  5F0F A;  3GCM A;  5FRM A;  3BZ6 A;  1ZQ3 P;  3DU6 A;  2EZL A;  5GAE J;  3G71 I;  2OC6 A;  5JVG F;  3JRH A;  2L7F P;  2E1C A;  2K9N A;  2V9K A;  4B1R A;  3E7L A;  3DLA A;  3DPU A;  5JLW A;  1O3R A;  2IPQ X;  2D1V A;  2RKH A;  4BDZ A;  2HTS A;  3ZN0 A;  3RYP A;  2A07 F;  4IHY A;  2EIJ H;  2MFZ A;  5GP9 A;  2QGU A;  2P5L C;  3O3K A;  3AL0 B;  3DTI A;  2X0L A;  4XKC A;  5J1R A;  5K7Z A;  2M45 A;  4NDL A;  5EF6 A;  1N75 A;  1JTX A;  1JKP C;  4Y52 J;  2XV4 S;  4Y4R A;  3U1K A;  3FHN A;  1X3Z B;  1JI8 A;  2K4J A;  5F0H A;  1ZRF A;  3GUD A;  3BG9 A;  2WV1 A;  3HUG A;  3N05 A;  4XRM A;  4LK1 F;  2IGM A;  5IY5 H;  3E6D A;  3HRT A;  5HDN A;  4Y15 A;  1VQ4 I;  5HNF A;  2L02 A;  3J7Z I;  2Z5U A;  5J4Y A;  5B1A H;  1QGP A;  4A3L J;  3RQ4 A;  4Z2Y A;  3WU0 A;  2K40 A;  1IRF A;  5AIP A;  1SD7 A;  4EMS A;  3ZQF A;  3FM5 A;  5IT9 Z;  1W0T A;  2EA2 A;  1BC8 C;  3BPX A;  4CCN A;  2DDA A;  1A6I A;  2A5W A;  3QWL A;  3V42 A;  5HOO A;  1ZN2 A;  1X19 A;  4A3K J;  5HDG A;  4DNC A;  4JX6 A;  3ZQ7 A;  2XAJ A;  2ESH A;  4J01 A;  4XKV A;  1ITY A;  3H0D A;  3F72 A;  5M5X J;  1PUF A;  3S16 J;  2XGX A;  4KN7 X;  3D0S A;  1WWX A;  3PFI A;  1R5I D;  6PAX A;  3JRG A;  4GDF A;  1YIO A;  4BHB A;  3LSP A;  3GYH X;  3BG6 A;  1Z21 A;  2R5Z A;  3ZQC A;  3CC4 I;  2JA2 A;  2XGE A;  1O57 A;  5L3G A;  2CFX A;  2LYC A;  4A3D J;  1A5J A;  2JUG A;  1ZG1 A;  1R00 A;  3K7A J;  2X85 A;  1SEU A;  1F43 A;  2XF6 A;  2Y2Z A;  5GAH J;  2EIL H;  1FOW A;  2MC3 A;  5E3O A;  5FRN A;  3F8M A;  2AS5 F;  1Q1V A;  3H9Q A;  2HWV A;  4NC6 A;  4UB6 C;  3P5J A;  5EZH A;  2YU9 J;  1SFO J;  2GM4 A;  3DPT A;  4EJU A;  5FFZ A;  1FOY A;  3OY9 A;  2ZKZ A;  2A6E F;  4AID A;  5L3C A;  1V5G A;  4O3M A;  2DXI A;  3K69 A;  2VQL A;  2DK5 A;  3ABK H;  1Z05 A;  5IP9 J;  4FCY A;  2LDU A;  2O7O A;  4KJZ A;  3BP8 A;  3L9F A;  2DYR H;  3M1C A;  1X3W B;  2E35 A;  2ZXW H;  1Y6I A;  3ERM A;  2YSR A;  1G4D A;  4MEY F;  3C1D A;  3OMY A;  4E70 A;  3MZ8 A;  3OS1 A;  1SFE A;  3G1M A;  3KYD B;  2QBY B;  3BJO A;  3DLL F;  5EZG A;  2EZK A;  2HYG D;  3LFU A;  2IS6 A;  3FKJ A;  5B3S H;  1WKM A;  5D5W B;  3OOP A;  5EDN A;  1MNE A;  1K78 B;  3WHC A;  1X1C A;  2MW8 A;  1VQ8 I;  3CP2 A;  1A36 A;  1Y0U A;  3ABT A;  3U2R A;  1GDT A;  3CUQ A;  4BJ6 C;  4C3H J;  4E4H A;  3RPU A;  3HDD A;  5FD5 A;  2R7O A;  3E6B A;  5C44 J;  2HKO A;  5IT9 K;  4CHU A;  2VUM J;  2LH9 A;  4MLO A;  2JSP A;  4IPA A;  2DK8 A;  4OAZ A;  5B66 C;  3ZMT A;  3IRR A;  1LFU P;  4A93 J;  2M7A A;  3NQO A;  3WE3 A;  3SZG A;  4GCV A;  5EEG A;  2QQ9 A;  1HOM A;  1B6A A;  2G9W A;  2YR2 A;  5ICC A;  1ACI A;  4WXC A;  1XX5 A;  4UUS A;  3EUH A;  2GXA A;  4KN4 X;  2ZSI B;  4UVB A;  4FE7 A;  4MGR A;  3CES A;  2QSG X;  1I1S A;  1UHS A;  1D1C A;  2TDX A;  3OL4 A;  2R7D A;  5GPC A;  1V5E A;  1DU0 A;  2EV6 A;  2ZJR F;  1BL0 A;  1ZK8 A;  4HYE A;  4XIC A;  2COB A;  3AFH A;  5DD4 A;  1FPQ A;  4KIS A;  5FO5 A;  3H35 A;  5JHU A;  5M5Y J;  2Y69 H;  1QHH D;  1QVU A;  4V2F A;  2AXT C;  5K1Y A;  1XS9 A;  3G3Z A;  3NAR A;  4LJZ F;  1KYZ A;  3VFZ A;  1YX3 A;  2EPF A;  2OBP A;  1JKR C;  1WJF A;  1TWG J;  4ZJZ A;  3MZY A;  3S2D J;  2A61 A;  3H36 A;  3VDX A;  2VJI A;  2KMU A;  2VIX A;  2DTZ A;  1O4X A;  2L9S A;  2FA5 A;  2Z16 A;  1I3A A;  4MFE A;  3E5U A;  4CYD A;  1O3Q A;  4NQW B;  1MSF C;  1TT0 A;  5J40 A;  1LPQ A;  1J75 A;  3C2B A;  3HB9 A;  3M8F A;  1MJB A;  2BOL A;  3MQ0 A;  3M07 A;  3VSL A;  2KDO A;  3HGG A;  3I71 A;  2CUJ A;  2H6B A;  3KP2 A;  2NXN B;  3KYL A;  3K0L A;  1CQT A;  2UUZ A;  1X1P A;  4BY7 J;  4HX7 A;  3CC7 I;  2VOP A;  1HCR A;  2E71 A;  2B9S A;  1ZR2 A;  1ETX A;  2JRM A;  1QNT A;  2CV2 A;  2P5V A;  1UG0 A;  4M3D A;  1PYV A;  1FNN A;  4LG3 A;  1DU6 A;  1IF1 A;  3GF2 A;  3P7N A;  2E7W A;  1YJW I;  3I5U A;  2M30 A;  4XSZ F;  5DV5 A;  2EB7 A;  4EGY A;  2WAE A;  1XSV A;  3I0T A;  4MFD A;  3RKX A;  4EM1 A;  5ILV A;  4F52 A;  3SEQ A;  3BOQ A;  2O61 A;  4OIN F;  2CRG A;  1L3L A;  2V6C A;  5F6F A;  2L9N A;  1R7J A;  4LLN A;  5HVQ C;  4V2G A;  4XID A;  2KPM A;  1YO5 C;  2UXN A;  3A0B C;  1NK2 P;  1OYY A;  1M1E B;  1E0E A;  2PG4 A;  3G1L A;  1TWC J;  3ZQG A;  4IRG A;  4DQ2 A;  1LVA A;  5CVV A;  1FT9 A;  2P4W A;  4XN0 A;  4C3I J;  3KFW X;  4XBF A;  3C3W A;  4RS8 A;  4B47 A;  3GTP J;  3AG3 H;  1J59 A;  3JRE A;  4BE1 A;  4FT8 A;  3HHH A;  4CH7 A;  4HDU A;  2KJC A;  4D9J A;  2BVL A;  2D45 A;  4G8X A;  3SZP A;  4Z6Y A;  4I09 A;  3SYT A;  3TO7 A;  2EA4 A;  1AKH B;  3GTL J;  4QSH A;  3LMM A;  5E8I A;  3BLY A;  1QPM A;  3FKI J;  1ZLJ A;  2LLK A;  1E2X A;  2IVM A;  3MZH A;  3VOD A;  1BOA A;  4KIB A;  5DCM B;  2G0E A;  1AOY A;  2L54 A;  2CV1 A;  3HIF A;  3PL8 A;  3F23 A;  3KLN A;  1SMY F;  1UMQ A;  4WK8 F;  1OR7 A;  2LY2 A;  2YX4 A;  2DOA A;  1JUM A;  3S3N A;  4XKW A;  3TO9 A;  3S1N J;  1UHW A;  2EBI A;  1FMW A;  1IXR C;  3GXO A;  1VQN I;  2X6X A;  2F5V A;  2BEO A;  4EGZ A;  1T95 A;  3M9A A;  5FRO A;  2VC1 A;  2BV6 A;  5A2Q Z;  2HZD A;  3HPG A;  3QAH A;  3DBH B;  2BXZ A;  1XDU A;  2CQQ A;  2K9S A;  4HW0 A;  2CJJ A;  5B1B H;  3OYE A;  2DPU A;  4IJA A;  4FTH A;  1Z6T A;  1DUX C;  3S3O A;  2DA1 A;  2LVS A;  3GFJ A;  2Z1D A;  4A6E A;  4ENJ A;  4RGR A;  3PO2 J;  3HOX J;  4IHW A;  3BCA A;  1D1A A;  3CO6 C;  1S72 I;  3CLQ A;  4LG0 B;  4M3E A;  5KAF C;  4LB5 A;  5DCM A;  1JJ6 C;  2ZNZ A;  5BOX A;  3OIO A;  3GW2 A;  5D5V B;  3DTE A;  1LDD A;  3HYI A;  3EUK L;  1S7A A;  3M1E A;  4KA4 A;  1FOK A;  2LC2 A;  4P96 A;  5J8F A;  1ZRC A;  2K7L A;  2LP0 A;  4IOA F;  3BJ6 A;  2ZME B;  4BBS J;  2M0C A;  2V9P A;  3GTQ J;  2RNJ A;  4W97 A;  2IAI A;  2XPV A;  3QP6 A;  3GTM J;  2XKO A;  2OJE D;  3LSM A;  2E19 A;  2GOM A;  1XC5 A;  4Y33 A;  3BG3 A;  2IRF G;  2QQB A;  1TTY A;  3PM1 A;  2NVU B;  4GYI A;  4HV5 A;  1WGX A;  2Y0M A;  4Q47 A;  1RET A;  3J7A Y;  4KIT B;  3K1N A;  3A2K A;  2CUF A;  4MNU A;  3KZZ A;  3V7R A;  4MTE A;  4YII A;  3RJP A;  2LY1 A;  4OIR F;  4D1Q A;  5DUK A;  3F8F A;  4AWX B;  1N78 A;  3E3V A;  3ELK A;  5J6X A;  2ZBK A;  5H6Q A;  5K5Q A;  4ZYH A;  3CDL A;  1WRJ A;  2EK5 A;  3F8B A;  3HGY A;  3BR2 A;  1W5T A;  1W7P D;  2LBF A;  2LR8 A;  2XHK A;  4HNU A;  2W57 A;  3S32 A;  1HA8 A;  3O6B B;  2QCO A;  1P9Q C;  2F48 A;  4L9T A;  2CH0 A;  2EFW A;  3WTV C;  4Y7N J;  3W2W A;  4PJ0 C;  5D4S A;  1VQO I;  2X51 A;  1WJE A;  2XC7 A;  2FMY A;  3DEW A;  3I64 A;  3RPQ A;  4B3A A;  1Y1W J;  1U2W A;  3H3Z A;  4F55 A;  5IYD J;  3TP0 A;  5CQE A;  2FUG 2;  2P81 A;  1ZAO A;  2DT7 B;  4XLF A;  4I0B A;  3S8P A;  2HQA A;  5A2Q K;  1A6Q A;  3CCQ I;  1MMN A;  2JJ7 A;  3OYD A;  2YS9 A;  2HQR A;  2HYF A;  1DPU A;  2BBY A;  3HC7 A;  3LA3 A;  1TNT A;  1GUU A;  2MD0 A;  3BJA A;  3I4P A;  4U7B A;  4E7Z A;  5E1Z B;  5FGM A;  4I98 B;  1FSH A;  5F1R A;  2ZNY A;  3MVP A;  2GIZ A;  3H3U A;  2KIU A;  4JX4 A;  4Y3O A;  3S1M J;  4B48 A;  4BQQ A;  1IDZ A;  3TKY A;  1OCC H;  2KHM A;  3OYN A;  2NRA C;  4A3M J;  3QPS A;  1VQK I;  3CCM I;  1FIA A;  2A6H F;  4YFN F;  3LAJ A;  3LNQ A;  1O3S A;  2EFO A;  3KYC B;  1KU7 A;  2DO7 A;  1MMA A;  1BI0 A;  1V55 H;  3SHF A;  1RR8 C;  2HOS A;  4IHS A;  1U8R A;  2QVO A;  1OCT C;  4XK4 A;  2FBK A;  2VI6 A;  5L3E A;  1Z6R A;  3VWB A;  4MTD A;  1PDN C;  2XAS A;  4L9J A;  4OMY A;  1S9H A;  4I02 A;  4NB5 A;  1Y8R B;  1YG2 A;  2I10 A;  4KDP A;  2HU9 A;  1SAX A;  1JUP A;  5H2F C;  5HNH A;  5C3E J;  1ZYR F;  3N97 A;  4CCK A;  3AL0 C;  4ENK A;  4M6V A;  2BW3 B;  2GAU A;  1TP4 A;  2ELK A;  3BZK A;  2Z9O A;  1BR1 A;  2LSO A;  3UKG A;  4L9V A;  1EF4 A;  4IHX A;  1XCB A;  3OYF A;  1EV7 A;  2ME0 A;  3K4L A;  1LFP A;  1YW8 A;  3L2W A;  4F91 B;  4P5O A;  4AIJ A;  2O3F A;  1ZG3 A;  3FIS A;  2QA4 I;  5K5O A;  3KEQ A;  2IBD A;  4BEH A;  4I7H A;  3F8N A;  1D3Y A;  1STZ A;  3KE2 A;  2AO9 A;  1K61 A;  2HR3 A;  3P9I A;  4XLA A;  2GIV A;  2Q2E A;  1SMT A;  4M71 A;  5J8C A;  1YW7 A;  3W2V A;  3BDD A;  3S3M A;  2STW A;  3CMM A;  2JA5 J;  1TZL A;  3L2U A;  1WJC A;  2CYY A;  1ZHF A;  3FXK A;  3EET A;  1W0U A;  1RNL A;  2R7V A;  5K5R A;  4MQ9 F;  2VKV A;  3G2B A;  3TP3 A;  2NS8 A;  3PQK A;  5LHH A;  3OS2 A;  1FLI A;  3BT9 A;  2VJ5 A;  4IQJ A;  1MDM B;  2VKE A;  1QVT A;  1IRZ A;  3GTO J;  5J47 A;  3GBG A;  1YIT I;  1MMG A;  1SVO A;  4D5C A;  1F4K A;  2JQ7 A;  2LKS A;  5JLX A;  1XGM A;  4AYB A;  4AIK A;  3KIO A;  1E3P A;  2X4H A;  2R0Q C;  5E17 F;  2KKO A;  3FXU A;  5E18 F;  4C2U A;  3ZQL A;  2G7U A;  4XR6 A;  2WC2 A;  5KK1 A;  2ECC A;  5IYC J;  2QKL B;  2LD5 A;  2CW7 A;  1BIA A;  2OU2 A;  3A0H C;  3L00 A;  3WHB A;  4DW6 A;  3VYR B;  1BI2 A;  2W24 A;  1B8I A;  2XGD A;  3WTX C;  5BNG A;  2V6E A;  2ZJP F;  1BJZ A;  3H5R A;  2IA2 A;  3FXM A;  4I76 A;  1U78 A;  5E3M A;  5DDG A;  2DYS H;  3WOD F;  1MNM C;  2XIG A;  3Q0W A;  2L9R A;  1BI1 A;  2IGN A;  2E7X A;  3V7C A;  2EH3 A;  2NAZ A;  4C2M J;  2NVQ J;  2WAD A;  3HRM A;  5EYR A;  1QO0 D;  4YFK F;  3BTI A;  2W84 A;  4UV9 A;  3LSI A;  2VBX A;  4BU2 A;  4HQE A;  1XMA A;  4UXN A;  2DPD A;  1MW7 A;  2WAQ A;  3OYH A;  4EJV A;  4HZF A;  3LQQ A;  1WPK A;  2Y48 A;  3BC8 A;  4XN3 A;  1YTY A;  1OMI A;  3K4K A;  2GBY A;  3EPZ A;  2KIF A;  2W7N A;  3BR3 A;  3BPV A;  3EUH C;  3E5Q A;  4HX8 A;  2DA2 A;  3FK6 A;  2FU4 A;  5D5X B;  1BI3 A;  3T5X A;  3QOP A;  5KHD A;  2FQ3 A;  1EKE A;  4O6J A;  2FE3 A;  1W36 C;  4CYC A;  2XKP A;  2ZXJ A;  5FKL A;  3ABM H;  1ZG5 A;  4V19 K;  1PUF B;  1IZ1 A;  1GXQ A;  2D1H A;  2GQQ A;  3OIP A;  2IP2 A;  1QBJ A;  2XVC A;  3WGG A;  2XF5 A;  3V4G A;  3JAM K;  2Q8K A;  1T33 A;  1TLH B;  3S2H J;  4Q48 A;  2HKX A;  1U5T A;  2VB6 A;  2Y31 A;  1RUO A;  3E6M A;  2R5Z B;  2E1M B;  2Y9Y A;  4IHT A;  3DCF A;  1MGT A;  4ENN A;  2W4S A;  1BM9 A;  2V1N A;  4WF2 A;  1G3Y A;  3F9K A;  3ZMU A;  2X6O A;  2K3F A;  3TOA A;  3HSF A;  1RI7 A;  4M9X A;  4DOZ A;  1NTC A;  4C3J J;  5GTH C;  3F6O A;  2O03 A;  1WJB A;  2KL4 A;  2KFD A;  2PEX A;  2XSJ C;  2EIK H;  3RQI A;  3PUF A;  3HSE A;  2RQP A;  5LEK A;  2DOE A;  1FEX A;  1OCO H;  5F04 A;  1U6G A;  3A03 A;  3QPH A;  3CJQ B;  3JRD A;  4YIR X;  3S93 A;  1Y0N A;  1ZTR A;  2TCT A;  3Q0V A;  3WE2 A;  3J81 Z;  2LKP A;  4IXA A;  2ELJ A;  3R6S A;  4YG2 F;  3SDG A;  5M5W J;  2DOF A;  2Z99 A;  4G94 A;  3RSN A;  5CVI A;  2OZ6 A;  1USS A;  2WAF A;  1YRN A;  3HOW J;  3F3X A;  1XPX A;  2X48 A;  4LLL A;  3JR9 A;  1Z7L A;  2EFQ A;  2EV0 A;  4G7H F;  4BQA A;  1SFK A;  2P0W A;  3OR1 C;  3I54 A;  3TGN A;  1KU2 A;  3GZN B;  3R0A A;  2XPW A;  1CF7 A;  5GAG J;  3PQJ A;  4HG2 A;  3D5R C;  3A4C A;  1WQ2 A;  2LKX A;  1X4P A;  4XRS A;  3IAS 2;  2HVS A;  3LA7 A;  3TQN A;  4ZC3 A;  3CUQ B;  3FXL A;  1OIS A;  2ID6 A;  4CCJ A;  2D5V A;  5LFA A;  2MLK A;  3CC2 I;  2L0K A;  4CXF A;  2L3D A;  2HQ5 A;  2BVM A;  1Z67 A;  2DT5 A;  2XRO A;  4HNV A;  4BQN A;  3J80 K;  3IH3 A;  4IHV A;  1FYL A;  1X1D A;  3BG5 A;  2JRT A;  4X6A J;  2ESN A;  1I1G A;  1SD6 A;  1XSD A;  3V7S A;  3I3L A;  3CF2 A;  4RB3 C;  4PUS A;  1FX7 A;  1W4M A;  3HTU A;  4UUS B;  1KGS A;  3IRQ A;  1I50 J;  5L3D A;  1ON1 A;  2FJ1 A;  5BPD A;  1XGS A;  5J1U A;  1YIJ I;  2M2E A;  1IUY A;  3GFM A;  3HZJ A;  3HJE A;  3LSJ A;  3L7W A;  4MIM A;  5FJ8 J;  4IKF A;  1H0M A;  4RAZ A;  4WCG A;  3WGI A;  1FYM A;  4EM2 A;  2VE8 A;  3SEZ A;  5JHF A;  3DQV C;  4JYK A;  2V7F A;  2EV5 A;  4S05 A;  3MKL A;  1SAU A;  1APL C;  5B5E C;  1IN6 A;  5E3N A;  3JSP A;  3JRB A;  3R0J A;  1AA7 A;  2E60 A;  5LRR A;  2RQQ A;  4JOM A;  4HLY A;  1XMX A;  1OR7 C;  3GWZ A;  4OU0 A;  1GV5 A;  5D6F A;  1I3Q J;  2DA5 A;  2IXS A;  4RBO A;  4M6X A;  2HZT A;  2HOA A;  1V3F A;  2WA0 A;  4TV7 A;  2VBW A;  4HF2 A;  2IGO A;  2YUS A;  3OYM A;  4M9S A;  5FLV A;  1T0F A;  2AXL A;  5EJC A;  3K9T A;  2PMU A;  1HKQ A;  4XM3 A;  3GFI A;  2HGC A;  3ZQH A;  4XRF A;  1W1W E;  5E20 A;  3MKY B;  1MBF A;  2MH9 A;  3KZY A;  1MBE A;  2ZXI A;  2BZT A;  3MKZ A;  2V1U A;  2XSD C;  4HQM A;  4AVZ A;  2CG4 A;  3J81 K;  2A68 F;  1FTZ A;  4JQF A;  3IAM 2;  5LD2 C;  3RZD J;  4I01 A;  5FLX Z;  1FBU A;  1LDJ A;  2E1N A;  4N9I A;  4FX0 A;  5LGU A;  3K2A A;  3S1R J;  2DFH A;  4CDG A;  3HHG A;  1TC3 C;  2FD5 A;  1VF9 A;  4IOC F;  2KZV A;  2LTP A;  2ICW G;  1ETK A;  4RAF A;  1D0X A;  3GLL A;  1RKT A;  3ROU A;  5DS9 A;  1JKQ C;  2V79 A;  2M7B A;  4OIP F;  3ASN H;  1H88 C;  3A02 A;  2ZSH B;  4A3E J;  4C9Y A;  3PJR A;  1ON2 A;  2LMD A;  4ZDP A;  2XB5 A;  2ISZ A;  3CTA A;  1NH3 A;  1UAA A;  1YFH A;  5L3B A;  4L5E A;  1IRX A;  1LEB A;  1RZ4 A;  2X6Y A;  1KYW A;  2HXO A;  1W36 D;  2DT6 A;  3LL7 A;  3E6C C;  1VQ5 I;  3QRF F;  1LNW A;  3HOU J;  2DA7 A;  1NHA A;  2IA0 A;  2W1O A;  1X58 A;  1U9N A;  4AUX A;  4ZTF A;  2PJR A;  4HBL A;  5IOY A;  1TQP A;  2HI3 A;  1WI9 A;  2XGC A;  1PP7 U;  3W6V A;  3TL4 X;  2E2H J;  5FB2 A;  2KZG A;  4H0E A;  3G73 A;  3RKW A;  1HW2 A;  1MBK A;  3QPT A;  4EM0 B;  1T38 A;  2DJI A;  2VBZ A;  2V9V A;  4CGZ A;  3FBI B;  1IXC A;  3TO6 A;  3EDP A;  1S5L C;  2YX7 A;  3PO3 J;  2QM3 A;  1YYV A;  2Q0O A;  1N25 A;  2NNN A;  1D0Z A;  2ZME C;  1RPW A;  3HOZ J;  2WBM A;  4KT5 C;  4P55 A;  1LDK B;  2GA2 A;  4ON0 A;  3W3C A;  1HXD A;  2ZJ2 A;  4E7H A;  1XD7 A;  1YW9 A;  5DM6 F;  3WG7 H;  4M74 A;  1XSX A;  1G8X A;  5TGT A;  2JA8 J;  3QOE A;  3EQL F;  3RTR A;  4ZYD A;  2KRF A;  2JTV A;  4A2U A;  1VTN C;  4B44 A;  1K4T A;  5LHG A;  3B6C A;  4CUG A;  2CQK A;  4Q5S F;  1TW3 A;  3JRF A;  3DWL E;  1WH7 A;  4G6D A;  4R8H A;  1VND A;  4UVC A;  4F7Z A;  3MCZ A;  4RLF A;  4BL0 B;  4A3I J;  1HC8 A;  5BS6 A;  3F0C A;  3LWF A;  3PNT A;  1Z91 A;  2BE5 F;  1IN8 A;  4P1W A;  4P9U A;  2XAQ A;  3IH2 A;  1RKW A;  2DMU A;  1VZ0 A;  2XAF A;  5DCF A;  5FLX K;  1B4A A;  4G9Y A;  5M3M J;  2Y0S A;  5L3F A;  5HDK A;  1YS6 A;  2HNH A;  3SQN A;  3TOB A;  4PJL A;  1X1B A;  3JRI A;  4NC7 A;  1WJA A;  2XPU A;  1FYK A;  3OYK A;  2BY3 A;  1OLT A;  3I4M J;  4BUP A;  5HLG A;  1WVR A;  1ETQ A;  1YLF A;  3VOE A;  2C6Y A;  1JE8 A;  2X1D A;  5LBQ A;  2VC0 A;  5LGT A;  2OD5 A;  2H6C A;  3OYA A;  1KQ0 A;  2P7V B;  1P92 A;  2VKD A;  3S2W A;  2MC4 A;  1I27 A;  1IRG A;  2ZXH A;  3U1D A;  2WV0 A;  1HF0 A;  3MWM A;  4LLG F;  3Q3S A;  2KJB A;  2LRE A;  1PUE E;  4ZYE A;  4PJN A;  3W6J B;  2K9L A;  3T1B A;  3HL2 A;  1HKS A;  2RN7 A;  3OOU A;  1FTT A;  3RCO A;  2UV1 A;  2GLO A;  2JPB A;  2VOD A;  4A69 C;  5ICE A;  1O7F A;  5DEQ A;  2NNY A;  5AIQ A;  1CGP A;  3L2Q A;  1LFB A;  4J00 A;  2A05 A;  2XF7 A;  5CQG A;  4UUV A;  1MZB A;  5CYV A;  3ERE D;  1ETY A;  2W00 A;  4IVN A;  2H8R A;  3KEY A;  5E79 C;  3ZP5 A;  1XTA A;  4KMF A;  4WXH A;  2TRT A;  2CV0 A;  2R93 J;  3LSH A;  4GRI A;  3CJT B;  3L09 A;  2J5P A;  2OZU A;  1K4S A;  1R4M B;  1ETV A;  2FBI A;  2MGQ A;  1E3O C;  2IJL A;  2OQR A;  4L5J A;  4HDV A;  4XMY A;  1SVM A;  5HS9 A;  4N4N B;  1FBS A;  3V8L A;  2DOD A;  2FF4 A;  2DMQ A;  1E3H A;  3B73 A;  1J5Y A;  2LBF B;  3J7Y J;  1G59 A;  1BN5 A;  4FX4 A;  3CUO A;  3AAF A;  4A3F J;  2VAS A;  3I4N J;  1BJA A;  1DGR M;  1XCV A;  1LE8 B;  4C30 A;  5CLS A;  5J1Y A;  4UHT A;  4BAC A;  2HOE A;  2F5D A;  1HKT A;  1G3W A;  2E5N A;  2JUC A;  2R5Y A;  5HS7 A;  5AON A;  5C4X J;  1OPC A;  1MJA A;  1YS7 A;  2PI0 A;  3AKZ A;  2IT0 A;  3CJN A;  2DAO A;  2MYS A;  2PMZ A;  4KIC A;  2RVC A;  2OUM A;  2M3A A;  1SC7 A;  2QEX I;  4BHC A;  3P9K A;  1IC8 A;  4R1H A;  4A0X A;  1Z77 A;  4CA0 A;  1J09 A;  5E3L A;  2R7Q A;  2M0M A;  4RB2 C;  2L4A A;  4XLN F;  4FQG A;  3GLX A;  1BW5 A;  2ZO4 A;  1LJ9 A;  1W7P A;  4I6Z A;  1FY7 A;  2VLA A;  4M3G A;  2VOO A;  3N4M A;  2GOX B;  3ZMS A;  1OQY A;  2Z3Y A;  2HYJ A;  3ZRG A;  1RIO H;  1UJ8 A;  1ZH5 A;  3FXR A;  4A0Z A;  2CW8 A;  2FNA A;  4XQF A;  4FAS D;  1P4X A;  1SFX A;  1XG1 A;  1LE8 A;  3C18 A;  2P8T A;  1DQU A;  4PGG A;  3OWT A;  4AIH A;  2Z33 A;  5KCM A;  2R92 J;  4AD9 A;  2XAU A;  1MMS A;  3F22 A;  1OCP A;  4CCO A;  4B4C A;  1LUJ B;  2DJN A;  4MO7 A;  4QPO A;  2MBF A;  1Q1H A;  4M73 A;  1SFU A;  1DPR A;  3LSR A;  2OCE A;  1JHF A;  4A5M A;  4D5F A;  3TED A;  1U3E M;  2CQ7 A;  3I58 A;  2R7Z J;  1EH8 A;  2KRC A;  1B1B A;  4R79 A;  4U0Y A;  3WU2 C;  2CFO A;  3BZC A;  3WU1 B;  5TRD A;  1T8I A;  4QWQ A;  1RR7 A;  2DMT A;  1BR2 A;  1X4O A;  1UCR A;  1S7O A;  2EIN H;  4Q4Z F;  2WY8 Q;  4QPQ A;  3FZV A;  2CSO A;  2QQA A;  1R5G A;  4OAY A;  2B7E A;  4PZJ A;  4BKX A;  1HBX G;  4KMU X;  2WB1 A;  2STT A;  3BTC A;  3RI4 A;  1Y56 A;  3G4S I;  2G7H A;  2M8G X;  3IWF A;  4BEH B;  4E6K G;  2IS2 A;  2VJJ A;  2ZB9 A;  2GA1 A;  3DBR B;  4KFC A;  1FBQ A;  2HPI A;  1TW2 A;  3AG4 H;  2VPR A;  1VQ9 I;  2RV8 A;  2VT2 A;  1U5T C;  4G7O F;  3LST A;  2CQN A;  4DIQ A;  4ENM A;  4QTR A;  2Q2E B;  1XMK A;  1AU7 A;  2FNP A;  1G3T A;  3NWT A;  1IUF A;  4LFU A;  4HNT A;  5CVR A;  3EYY A;  4IQ4 A;  3J7A O;  5HS8 A;  3ECH A;  3OR2 C;  2OV7 A;  4YIF A;  4OIQ F;  2L4M A;  4ITV A;  2B63 J;  1ONV A;  3M8E A;  3ASO H;  2ME6 A;  2K02 A;  2E2I J;  2XAH A;  3ESW B;  4P9F A;  1R9T J;  2HDD A;  2LY9 A;  3BTL A;  3WG9 A;  1KQ8 A;  2M9H A;  3FM3 A;  3DEU A;  1B72 A;  4HRI A;  3LSG A;  2PX9 A;  1VI0 A;  2V1X A;  3PUB A;  2O8X A;  4D0P A;  2JVH A;  5FKK A;  3K4N A;  3CCE I;  2CS3 A;  4DJA A;  5CJ9 A;  3F21 A;  3MAJ A;  4KUM A;  1JTY A;  1YJ9 I;  4X0G A;  2ZJQ F;  3JSO A;  1A04 A;  4WWC A;  3H5A A;  1B8I B;  2FML A;  2E1M C;  1HST A;  5F0C A;  4PK4 A;  1BIB A;  3O8G A;  1J0R A;  3JAM Z;  4DBR A;  1JGS A;  4EEF G;  3GTJ J;  3U21 A;  3SXY A;  5JVT A;  1TQI A;  2RDP A;  1ZGW A;  1J9I A;  1I6X A;  3LAP A;  2IS4 A;  5EGO A;  1UG2 A;  1X2N A;  4QLC U;  2E2J J;  2V4J C;  1ULY A;  3X2Q H;  1Z9C A;  1HW1 A;  3E5X A;  4CZZ A;  4YFX F;  1NK3 P;  2YU3 A;  2HVR A;  2R3S A;  2H27 A;  2R7T A;  1O3T A;  4W1U A;  1W5S A;  3S17 J;  3ZN1 A;  2XDV A;  4PFP A;  3CF5 F;  2DW4 A;  3A1Y A;  5IOZ A;  1QA6 A;  3A01 B;  1X1A A;  1JHH A;  2I5U A;  4CIC A;  3UR3 C;  4RB1 A;  1ZRE A;  1EH6 A;  1SVL A;  2ADU A;  2BY0 A;  3FWE A;  3WTS C;  3GEZ A;  2VN2 A;  2AQE A;  2L2O A;  3Q0U A;  3CLO A;  1TWA J;  2COM A;  2P6T A;  2V1D A;  4GO1 A;  3FDY A;  1D5Y A;  1W5C C;  1R22 A;  1XN7 A;  1V5F A;  4N0B A;  1P4W A;  3ISP A;  1TNS A;  2EZH A;  4GYG A;  3CMY A;  2CW0 F;  3WTU C;  4CYC B;  4FET A;  3S1Q J;  1TQM A;  3GZ6 A;  5CPR B;  1IN7 A;  4LB6 B;  2F4O B;  3IV5 A;  3IC7 A;  2K9M A;  1EA3 A;  1ETO A;  1WH5 A;  3DF8 A;  3AG1 H;  1T56 A;  4RAG A;  1OFC X;  1SD4 A;  2PLY A;  1PP8 F;  4A3J J;  5HLI A;  4N4O B;  1D5V A;  3CUQ C;  1DDN A;  2JVG A;  2DDB A;  1U5T B;  3CCR I;  4L5I A;  3FBN B;  2F5F A;  4HST A;  5TJJ A;  2M8E A;  1QQI A;  2DFI A;  1R4N B;  3MFK A;  1K83 J;  2QEN A;  1XGO A;  4IRH A;  1B9M A;  2RC4 A;  3A01 A;  3CDH A;  1S6L A;  4ZDO A;  3KX2 A;  1T0F C;  3Q5F A;  1Y8Q B;  3ZXS A;  4ANJ A;  2NVT J;  1ZGA A;  2X1E A;  4BAY A;  4PGH A;  3I59 B;  3HKZ A;  1KQ9 A;  4QIW N;  3J80 Z;  2HXI A;  1B9N A;  4M72 A;  1TT5 B;  2F2E A;  2DA3 A;  1GV2 A;  2XB0 X;  2O0Y A;  2NVX J;  2PMH A;  2LNB A;  3K70 C;  3OYJ A;  1ZGJ A;  2FOK A;  4BDY A;  3R61 A;  3RDI A;  1YJN I;  2ID3 A;  3K1P A;  3ULQ B;  2BHY A;  2LRD A;  3I9V 2;  4LOC A;  5F1J A;  3F6V A;  3SFI A;  4BE2 A;  3DFG A;  1J7K A;  2CUE A;  2JA6 J;  1TWF J;  2Q1Z B;  3JTG A;  4XOT A;  3CCJ I;  1P7I A;  5ILS A;  2FQ4 A;  5E8G A;  1I5Z A;  4AVP A;  1GLN A;  1IJW C;  2DN0 A;  2ZC2 A;  2R7R A;  1R23 A;  2DQL A;  2LFB A;  1MIJ A;  1YRN B;  3O2P E;  3H5N A;  4RAY A;  3TDZ C;  2QF7 A;  4BXF A;  1MD0 A;  4XLH A;  5FKM A;  1RC9 A;  1G6N A;  1IDY A;  1D8J A;  2K3P A;  4F93 B;  1R5H A;  1CF7 B;  1ZLK A;  2VJ4 A;  3I59 A;  3IH4 A;  5D4R A;  1S29 A;  2F5E A;  4OMZ A;  1Z1D A;  2GZW A;  4WXD A;  1LB2 A;  3HPH A;  3KP3 A;  1ETW A;  5HOD A;  1NG7 A;  3DKY A;  3OSF A;  4ZH4 F;  4BHP A;  4KIG A;  4N9H A;  4IRI A;  3OSG A;  2HDC A;  4YEJ A;  1FJL A;  3Q9V A;  5ED4 A;  3ZQQ A;  3KET A;  2FX0 A;  3MEX A;  3VSK A;  4NHJ A;  5E1X A;  3V8J A;  1MND A;  2J5O A;  1A35 A;  1Z7U A;  3CD6 I;  1SAN A;  1OCR H;  2X1C A;  1UFM A;  1WJ5 A;  2O8K A;  4KT6 A;  2M34 A;  3FMS A;  4EJO A;  3IL2 A;  4B43 A;  3S14 J;  1LEA A;  1ENH A;  4U87 A;  3ZMD A;  3DEE A;  1WCM J;  2K27 A;  4XOP A;  4BQO A;  2JN6 A;  2XRN A;  3KCC A;  2M4G A;  2QYO A;  1T6S A;  4CZC A;  4HEA 2;  5F27 A;  2NOJ B;  1HSJ A;  2OTJ I;  2DA4 A;  3WTW C;  2H8W A;  4E7J A;  1BW6 A;  3W6K B;  1H89 C;  1Z0X A;  2MA3 A;  4B09 A;  5BPI A;  1YHQ I;  3TW7 A;  3FF5 A;  1T08 B;  4M6Y A;  4NC8 A;  4G12 A;  2ZFU A;  3NRV A;  1HDD C;  4ASN A;  4M3F A;  4CSW A;  4KNY A;  3HRS A;  4NNJ A;  3MN2 A;  3H9G A;  2WY7 Q;  3BRO A;  3K4C A;  1XGN A;  2R7F A;  3B02 A;  4FIS A;  4A12 A;  2M5W A;  4RB0 A;  1YI2 I;  2A6T A;  2ZFW A;  4O5V A;  2MH2 A;  2IA1 A;  1Z3X A;  2WTE A;  2DQR A;  2WWY A;  2XRL A;  4ETS A;  2HS5 A;  1UST A;  5H6R A;  5ICF A;  3FX3 A;  3IUO A;  2KT0 A;  4XRS G;  5LHI A;  3OYB A;  1ZRD A;  5K7F A;  5DYM A;  1LKX A;  4BH9 A;  1IN5 A;  4D7M A;  1WSU A;  4UY8 I;  3PSI A;  2CU7 A;  1DGW Y; 
#chains in the Genus database with same CATH homology
 3E1S A;  1FMV A;  1D0Y A;  4RLF A;  4BL0 B;  4G6T B;  3VYU B;  4E7K A;  3PNT A;  4F55 A;  5CQE A;  4P1W A;  2FUG 2;  4H4K C;  3ZGK A;  2K5C A;  2DT7 B;  1VZ0 A;  3BG7 A;  3DKX A;  4XLF A;  3S8P A;  2HQA A;  1MMN A;  3OYD A;  2Y0S A;  3HUG B;  2HNH A;  3K4M A;  5FRM A;  4PJL A;  1X1B A;  3NWS A;  3DU6 A;  1WJA A;  4NC7 A;  3HOT A;  2RNG A;  3DU5 A;  2OC6 A;  3HC7 A;  3OYK A;  3VYT B;  1OLT A;  3EUA A;  4BUP A;  2MD0 A;  2V9K A;  4U7B A;  3D5S C;  4E7Z A;  3DLA A;  3DPU A;  3VYS B;  2X1D A;  5HLT A;  4BDZ A;  4Y3O A;  2I8D A;  1BOB A;  3OYA A;  4B48 A;  4BQQ A;  2VKD A;  2MC4 A;  2MFZ A;  2KHM A;  2ZXH A;  3OYN A;  3AL0 B;  3DTI A;  2LRE A;  4XKC A;  4PJN A;  3OYG A;  2PJR B;  2K9L A;  3HL2 A;  4DBQ A;  1N75 A;  3RPU D;  1MMA A;  3OOU A;  4Y4R A;  3RCO A;  2UV1 A;  3FHN A;  2F4I A;  1JI8 A;  3VWB A;  3L2Q A;  4J00 A;  1S9H A;  4BGD A;  2XF7 A;  5CQG A;  4XLE A;  2HU9 A;  2W00 A;  2O5R A;  3N05 A;  2IGK A;  2IGM A;  3CJR B;  2W82 A;  3KEY A;  5HNH A;  5HNF A;  4CCK A;  3AL0 C;  2CV0 A;  2BW3 B;  3LSH A;  4GRI A;  1BR1 A;  2CMP A;  4DGW B;  3K70 D;  3K4B A;  3RQ4 A;  3OYF A;  3K4L A;  2VKH A;  1LFP A;  1WFX A;  4F91 B;  4XMY A;  4P5O A;  3QYB A;  4N4N B;  3HXL A;  4BEH A;  1G59 A;  2LBF B;  4CCN A;  2A5W A;  3V42 A;  4NUB A;  2VAS A;  5HOO A;  1X19 A;  2Z2S B;  1DGR M;  4C30 A;  1NG6 A;  4XLA A;  4J01 A;  4BAC A;  4XKV A;  4E7L A;  3H0D A;  4E7I A;  3W2V A;  3S3M A;  2E5N A;  3CMM A;  2L5Q A;  3OYL A;  1TZL A;  1YX5 A;  3L2U A;  3IP4 B;  1WJC A;  3AKZ A;  3DTK A;  2LOO A;  2R7V A;  2MYS A;  2PMZ A;  2OUM A;  2M3A A;  3BG6 A;  4B3X A;  4PFO A;  1Z21 A;  3G2B A;  3OS2 A;  4CA0 A;  2VJ5 A;  1J09 A;  4IQJ A;  2R7Q A;  3K4J A;  2JA2 A;  3GBG A;  1MMG A;  4YEL A;  2LYC A;  2M0M A;  2JUG A;  4AYB A;  2X85 A;  1WJD A;  4XLC A;  1QU3 A;  2VQH A;  2XF6 A;  2HVQ A;  5KNL A;  2KRH A;  4C2U A;  5FRN A;  2VLA A;  4PSX A;  2GOX B;  3H9Q A;  3ZRG A;  4XR6 A;  4LIT A;  2R7W A;  2QKL B;  2CW8 A;  2CW7 A;  3DPT A;  3MD2 A;  4FAS D;  4XQF A;  3VYR B;  3OY9 A;  2LG4 A;  1V5G A;  2V6E A;  3H5R A;  2DXI A;  2VQL A;  4HPQ A;  1DQU A;  1Z3Y A;  3OWT A;  4KJZ A;  5KCM A;  3OIQ A;  4RMN A;  3TBI A;  4OWR B;  2XAU A;  4HSR A;  3MMY B;  4CCO A;  3M1C A;  2RRE A;  4QPO A;  1MMD A;  1Y6I A;  2IGN A;  2CUZ A;  4LIU A;  3OMY A;  2WAD A;  2L7K A;  3D5L A;  2KRC A;  4XKB A;  4PJJ A;  1UEL B;  4R79 A;  3OS1 A;  2CFO A;  2R7X A;  3LSI A;  2KP6 A;  4BU2 A;  3LFU A;  3SDB A;  2IS6 A;  1BR2 A;  1X4O A;  3FKJ A;  2WY8 Q;  1MW7 A;  4QPQ A;  4F92 B;  2WAQ A;  4OAY A;  3OYH A;  1MNE A;  1X1C A;  3CP2 A;  4XL9 A;  2WB1 A;  3BC8 A;  1Y56 A;  4XN3 A;  3K4K A;  4BJ6 C;  3EPZ A;  4E4H A;  2W7N A;  4CCL A;  4BEH B;  4E6K G;  2IS2 A;  2VJJ A;  2R7O A;  3EUH C;  2LH9 A;  2HPI A;  2JSP A;  4MLO A;  4RLQ A;  3M8J A;  4OAZ A;  3L2V A;  5KHD A;  4DIQ A;  2M7A A;  1W36 C;  2Q2E B;  3SZG A;  3NWT A;  1BR4 A;  3OIP A;  2KQR A;  2XF5 A;  4HNT A;  4IQ4 A;  3OR2 C;  2OV7 A;  4ITV A;  2ZSI B;  2V26 A;  3K6G A;  2VB6 A;  3CES A;  3L2W A;  4XOR A;  4BS9 A;  2E1M B;  1D1C A;  3OL4 A;  1V5E A;  2W4S A;  2V1N A;  2VQG A;  4F3Q A;  4HRI A;  3LSG A;  3F9K A;  3PUB A;  2JVH A;  3K4N A;  3AFH A;  4KIS A;  3OL3 A;  3H35 A;  2IS1 A;  4DOZ A;  2CS3 A;  1QHH D;  4DJA A;  1WJB A;  2KL4 A;  2XSJ C;  1YX3 A;  2AQF A;  4X0G A;  1WJF A;  3OYC A;  3H5A A;  4ZJZ A;  2E1M C;  4PK4 A;  2VL8 A;  3VDX A;  2VJI A;  4RM2 A;  1R6R A;  2KMU A;  2VIX A;  2VQC A;  3ZCO A;  4DBR A;  2L9S A;  2Z16 A;  3CJQ B;  2R4G A;  3S93 A;  4NQW B;  3U21 A;  1TT0 A;  4E7S A;  4AU7 A;  2BOL A;  4ZTJ A;  2ELJ A;  4BE0 A;  4IX7 A;  2IS4 A;  3VSL A;  2F6C A;  2KDO A;  2VPL A;  2CUJ A;  2V4J C;  3RSN A;  2WAF A;  3KYL A;  2HVR A;  1K6Y A;  2UUZ A;  1Z7L A;  2R7T A;  1SFK A;  2P0W A;  3OR1 C;  3C2H A;  3PNV A;  2XDV A;  4PFP A;  3A1Y A;  2CV2 A;  1UG0 A;  1X1A A;  4RM3 A;  1PYV A;  4HG2 A;  3D5R C;  3A4C A;  4LG3 A;  3UR3 C;  1PJR A;  1X4P A;  3IAS 2;  2HVS A;  4ZC3 A;  4CCJ A;  5LFA A;  2QKM B;  2WAE A;  2AQE A;  1YE9 A;  2L2O A;  3MKW B;  2KLO A;  3FDY A;  2BVM A;  4F52 A;  3K10 A;  3SEQ A;  1V5F A;  4BQN A;  4II2 A;  4BJ5 C;  3OYI A;  2DCE A;  2L9N A;  4FET A;  1X1D A;  3C2G A;  5CPR B;  5HVQ C;  2KPM A;  2HPM A;  2K9M A;  1EA3 A;  3I3L A;  3CF2 A;  4PUS A;  4XNF A;  1E0E A;  4YRV A;  4N4O B;  2JVG A;  4LIV A;  1ERD A;  4IKF A;  4XN0 A;  3FBN B;  4HST A;  4C2T A;  3BCB A;  4B47 A;  3SEZ A;  5JHF A;  3DQV C;  2V7F A;  1ZEL A;  4BE1 A;  4ZDO A;  3KX2 A;  1SAU A;  1T0F C;  4CH7 A;  3QOD A;  3ZXS A;  2BVL A;  4D9J A;  4ANJ A;  3W2A A;  1AA7 A;  2X1E A;  2E60 A;  2RQQ A;  3HKZ A;  3SYT A;  4JOM A;  3HOS A;  1OR7 C;  2VXD A;  1LVK A;  3LMM A;  4PJM A;  2IXS A;  3K70 C;  3OYJ A;  2WA0 A;  4BDY A;  3BLY A;  2IGO A;  3H9J A;  3OYM A;  1DP3 A;  2LRD A;  3I9V 2;  4XM3 A;  4BE2 A;  2CV1 A;  3PL8 A;  4ZYA A;  2Q1Z B;  4XOT A;  2E5Z A;  2LY2 A;  2DOA A;  3S3N A;  1QHG A;  3MKY B;  4XKW A;  1U0J A;  1FMW A;  2X6W A;  2X6X A;  2ZXI A;  2F5V A;  3MKZ A;  1GLN A;  4AVZ A;  1T95 A;  4II3 A;  5FRO A;  4JQF A;  2R7R A;  3IAM 2;  5LD2 C;  3H5N A;  2HZD A;  3HPG A;  3QYE A;  4BXF A;  4XLH A;  2HDW A;  3ZR8 X;  3OYE A;  2K3P A;  4F93 B;  3QYF A;  2KZV A;  3S3O A;  2VJ4 A;  3E0J B;  3L2R A;  2Z1D A;  1D0X A;  3LSK A;  3PNY A;  2M7B A;  3BCA A;  1D1A A;  3HPH A;  2ZSH B;  4BJT A;  4C9Y A;  3PJR A;  1NG7 A;  3DKY A;  4ZDP A;  1UAA A;  3DPL C;  1IRX A;  1KON A;  4CCM A;  3OS0 A;  2X6Y A;  1W36 D;  4YEJ A;  3ZQQ A;  2DT6 A;  3LL7 A;  3VSK A;  3DTE A;  4EAT A;  5CKT A;  1MND A;  4IZZ A;  4PSW A;  2UWM A;  3EUK L;  2X1C A;  1WJ5 A;  2LC2 A;  2W1O A;  4KT6 A;  4B43 A;  4ZTF A;  2PJR A;  4U87 A;  3DEE A;  4BQO A;  4XOP A;  2M4G A;  3TL4 X;  3TMO A;  2M4K A;  4CZC A;  4HEA 2;  2NOJ B;  3LSM A;  2GOM A;  2DJI A;  4Y33 A;  4E7J A;  3FBI B;  4XON A;  4NC8 A;  3CZ6 A;  1D1B A;  3J7A Y;  2BW3 A;  2ZFU A;  3HG9 A;  4KIT B;  3A2K A;  1D0Z A;  3CP8 A;  3PSF A;  2MAB A;  1N77 A;  4CSW A;  4ZDL A;  2WBM A;  2LY1 A;  4D1Q A;  4NNJ A;  1LDK B;  3H9G A;  1N78 A;  2WY7 Q;  3K4C A;  3W3C A;  4E7H A;  2VXZ A;  1G8X A;  5TGT A;  2A6T A;  2LBF A;  3QOE A;  3RTR A;  4HNU A;  1Z3X A;  3S32 A;  4B44 A;  1HA8 A;  2R7U A;  1P9Q C;  2CH0 A;  4CUG A;  3W2W A;  3IUO A;  3OYB A;  3ONQ A;  2R7S A;  3PFY A;  2X51 A;  3UNG C;  1WJE A;  2XC7 A;  1LKX A;  3PSI A;  3DWL E;  1DGW Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...