1MIJA

Crystal structure of the homeo-prospero domain of d. melanogaster prospero
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
139
Chain Sequence
b'SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein prospero
publication title Structure of the DNA Binding Region of Prospero Reveals a Novel Homeo-Prospero Domain
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 45
structure length 139
sequence length 152
ec nomenclature
pdb deposition date 2002-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1mijA00
1XPXA 1MIJA 2LMDA
chains in the Genus database with same CATH superfamily
1EH8A 2O5RA 2QENA 1P7IA 2KKOA 1T6SA 4E7IA 5EG0B 5EF6A 3B6AA 3BZKA 4BHCA 4DJAA 1G3WA 1WI9A 4ON0A 2BY3A 4AC0A 1W5TA 4IQ4A 4IRGA 2KHMA 3BOQA 4Y3OA 2L4AA 3D5SC 4L5JA 5E3OA 5FKLA 1JGGA 1TWAJ 1W7PD 3WODF 1E2XA 4F92B 3KX2A 1MMNA 4HQMA 4N9HA 3LL7A 2XAJA 3H35A 2LTPA 1PUFB 3VEPA 3MD2A 1FYKA 4A3CJ 4JBAA 5D5UB 1TP4A 1X3ZB 4U0VA 4KIGA 3C3WA 3F21A 2QLZA 2BGCA 2DQLA 3I58A 4HNTA 4FETA 4CZCA 2X1DA 4BACA 3JRHA 3ZPLA 1D3YA 2VI6A 5DV5A 2ZSHB 5EEHA 2CQKA 2JA7J 1S7OA 4KJZA 2BE5F 1IV8A 3WE3A 2FD5A 4D0PA 2P5LC 2IVMA 1NK2P 2P5KA 1PYVA 2QKLB 1K61A 1Z0XA 2XF7A 5LEKA 2LG4A 4UY8I 2Z1DA 3OS2A 5DD4A 3PM1A 2ELJA 2VONA 1OYWA 5LFAA 4XL9A 5ED4A 3RSNA 4C3JJ 5IYBJ 4B8XA 5J1RA 2M1BA 2CW7A 3ULQB 3H3VK 2DA5A 1ONVA 1KQ9A 1YFHA 2LBFB 3CCUI 2PG4A 3ERMA 4RGSA 2CQXA 2ZFUA 1POGA 3A03A 3OYKA 3ASNH 2RQPA 2KDZA 4FX4A 2R93J 3C7JA 1DPUA 1TT5B 4PZJA 4WCGA 3ML6A 1LE8B 4IPAA 3OY9A 2CUZA 2EZLA 2ZJQF 3FXOA 2RQQA 3FXQA 4IL6C 1T98A 3HUGA 3BG5A 4XSZF 4GFBA 1I27A 3V8KA 3KP7A 4ZYHA 2OCCH 3GTGJ 5F04A 1FOXA 3RCOA 4RAGA 2R7RA 4I76A 2VKHA 4AIDA 2FEZA 3RJPA 1WJEA 2E71A 2ZXJA 3H0DA 1WGXA 3FWEA 1H0MA 1E3PA 1LPQA 3DLAA 3VODA 1IJWC 2H27A 4QPOA 1GVDA 1XTAA 2CRGA 2JUCA 1QZZA 4IHSA 5K5QA 2Y0MA 4P55A 3DPLC 4V2GA 4B09A 3PIPF 5C3EJ 4NC6A 2BVLA 4A3LJ 1HKTA 1QVTA 2NOGA 1HA8A 2XGDA 2XGXA 3SQNA 4D7NA 3PQJA 2HWVA 1FOYA 4BKXA 2HOSA 1YITI 1J59A 4M71A 4ESFA 2VE9A 5TRDA 2M8EA 5EDNA 3SEQA 4FASD 2D5VA 2VQCA 3K4LA 1XGNA 1WKMA 4WXHA 3TP3A 1ZELA 3BR0A 1R6RA 2XDVA 4I09A 3AAFA 1P6RA 5JHUA 2VB6A 5F1JA 1BR4A 3IKVA 3HGYA 2L2OA 4I98B 2VBZA 2NVYJ 4B3AA 4BXFA 3AG4H 2M2EA 4Y13A 3I3LA 5KAIC 3M4OJ 2CV2A 1YTYA 1B59A 1QHHD 5HNHA 1FWZA 4XICA 1IN5A 2O9LA 3CCRI 5CVIA 2X1EA 3ABUA 2E5ZA 5JI6A 3N4MA 2BV6A 4U0YA 3HOYJ 2UZKA 5TISC 4L9TA 3JRIA 2NVTJ 2Z2SB 4CZZA 2R7UA 4JX6A 2GIVA 3ZN1A 2JT1A 4HBLA 4BU2A 1T08B 2IGKA 2DMQA 2M4GA 5ILSA 3CP8A 3H5NA 5JFRA 2KLOA 4E4HA 3S17J 3ONQA 1W36D 4G94A 1MKMA 4KMUX 4KUMA 3WU1B 1IXCA 1XPXA 2XKPA 1U3EM 5H2FC 2VE8A 3CUQA 3RKXA 1DPRA 3H5RA 2DMNA 2B0LA 2EILH 3OR1C 3HOVJ 2EH3A 2PLYA 3F3XA 3HHGA 3JTGA 1QZYA 2A5WA 1AKHA 4X6AJ 1X1DA 5AIPA 1JHHA 2E1NA 4U88A 3BZCA 2HOAA 3OV8A 1M1EB 4W1UA 4BDYA 5FKMA 4BHBA 4DQ2A 4PJLA 5D5WB 1LNWA 5J4VA 4J19A 1LQ1A 5E1WA 3S93A 2K02A 2HTSA 1Z6RA 2ZXIA 4YIFA 3OSGA 1MBHA 5B1BH 1OLTA 2G7UA 9ANTA 2ETHA 2VODA 3LSMA 2QSFX 3RKQA 1XX5A 1ODDA 3B73A 3LWFA 3MKZA 2LR8A 2UV1A 2CQNA 1VQ6I 1GXPA 2LKSA 2OUMA 2HZDA 1DP3A 2ZXWH 2STWA 4ZZLA 4LJZF 5HOOA 5A2QK 1RI7A 2E34A 2DA6A 2Z5UA 2OQGA 3DU6A 4EGZA 2O61A 2PX9A 3BT9A 1OCRH 3UKGA 4G7HF 3HSRA 1ACIA 4XLFA 3A02A 1UZCA 2CG4A 3DEWA 2WC2A 3Q9VA 1BI1A 5B3SH 4UNOA 1HSTA 1H9GA 1R1UA 4B44A 1I1SA 1O3QA 4YIIA 1MNDA 4YRVA 3C18A 3CDIA 1JE8A 3QPSA 4AIKA 2P6SA 2MC4A 2RNJA 2R7TA 3I59B 2L7ZA 4YFKF 5E3NA 3U1KA 3DEUA 1AU7A 1BOAA 3DBRB 4A0XA 3LA3A 1TW2A 1YX3A 4I0AA 2DFFA 1MNMC 3JRBA 2HNHA 1GLNA 3BR2A 4BEHB 2R92J 2DK5A 4M3FA 2PI0A 2DO7A 4XQFA 1OCOH 2O6GE 2IA2A 2X9DA 3HRTA 5E8GA 3IRRA 4HG2A 3K4CA 4RMNA 2F4OB 3EQLF 2GOXB 3GXOA 3J80K 3ZN0A 3DEEA 5J3LA 3HL2A 2VXZA 3PNVA 4BL0B 3ZRGA 5DD8A 4ENKA 4KA4A 3BDDA 4HX7A 3HHHA 2FQ4A 6PAXA 3KIOA 1NTCA 4IRHA 2X48A 1ZQ3P 4CCJA 3I56I 4LLLA 1T0FC 1WJ5A 4A2UA 4A3IJ 1BI3A 4L9VA 3MMYB 5LHGA 3K4MA 2R7XA 1D8KA 2VQLA 2DAOA 3A2KA 3U1DA 1R1TA 3LAPA 4PGHA 3TQNA 4RB2C 4HNVA 4GO1A 4RGRA 4P9UA 2MH9A 2EBIA 3FXJA 2ELHA 3RKYA 3J81K 2M0CA 3F8BA 2IJLA 4TV7A 2OQRA 4EV0A 3E6MA 4EJWA 1S9HA 3GYHX 2Z99A 2WAFA 4H0EA 3DKWA 2GXGA 3GCMA 3WU0A 4NNJA 3HOSA 2BOLA 2IEKA 3LSIA 1SFXA 3V42A 2V7FA 1USSA 2M7BA 2RDPA 4F55A 3OYIA 2PMZN 1ZLKA 1K4TA 1NHAA 1PVEA 4IKFA 3E97A 3CO6C 3RPUD 3ZQGA 4KNYA 3SJMA 3BCAA 4PFPA 4B4CA 4G6QA 2O8KA 4KN7X 3REOA 1XD7A 4M72A 5LHIA 1REPC 1MDMB 1RESA 1V55H 4XOTA 1XB4A 4KITB 4E6KG 3HOTA 5CVUA 4XLHA 2VKVA 2HGCA 2HKXA 5EGOA 1QNTA 2E19A 3ESWB 4AIJA 4HV6A 2KIUA 3OYJA 5K5OA 1R5GA 5K1YA 3ERED 1SD6A 2MD5A 5LBQA 1X1BA 3LFKA 4MEYF 3GLXA 3G3ZA 4LG0A 4KDPA 5B1AH 3KPHA 1CGPA 2L3DA 3S32A 4ZTFA 1FYLA 1KQ0A 2E1CA 1VQ4I 2ID6A 2W24A 3L2WA 5DUKA 4XLCA 2WAQA 1YIOA 1LDJA 2JRTA 2DK8A 4D5CA 2GBYA 3EYIA 3QODA 2Z9OA 4N0BA 1MW7A 2L5QA 2XSDC 2KL4A 2V79A 2QVOA 3GX4X 1WJDA 4U0WA 1TZLA 2BW3B 3F6OA 4BGDA 3DU5A 3CTAA 3CLQA 3BTIA 2LRDA 2IXSA 3WGGA 1TW3A 2DMTA 3CCSI 3GFLA 4PJ0C 4BBSJ 3CDHA 4LMYA 4PGGA 2KPMA 1YI2I 2KZVA 1SEUA 3I4PA 2NNNA 2JPBA 4AYBA 2DA2A 4M6YA 3J7AO 4BHPA 5CVRA 2DDBA 4MTDA 5ILUA 1KU3A 3FM5A 3Q0VA 1AA7A 3HPGA 1O7FA 3LFUA 5KK1A 1DU0A 2K27A 3K2AA 3RYPA 3H9GA 1ZN2A 5DYMA 3GTMJ 2NRAC 2VBWA 5BOXA 5IY5H 5FLXZ 2Z33A 3HDDA 2BBYA 1PP8F 3FDYA 2IPQX 3HIFA 2XRNA 4DZJA 4AU7A 4LB6B 4QPQA 3HRSA 3T5XA 4RAYA 1YRNB 5D8KB 1RKWA 2BXZA 2QGUA 2E60A 4NQWA 4XK4A 3VSKA 3QYEA 4JK1X 3GVAA 3QPHA 2R7VA 4D1QA 3OS0A 4A3FJ 2EZKA 4IHYA 5E20A 2GXBA 2ZO4A 2V26A 3PFIA 5FB2A 1QPIA 3A01B 1XGOA 5FLMJ 3CCVI 2ACJA 3S14J 2KJBA 2Y31A 4E70A 1IUYA 3KEQA 5JVTA 3M8JA 3CCYA 1Z1DA 5H20A 2K40A 1R4NB 2ZNZA 3GTOJ 3S2HJ 3K0LA 4HSTA 2F5FA 3BQZA 4IRIA 3QRFF 1I1GA 1P9QC 2FNPA 2PFBA 2XV4S 3HC7A 3KE2A 2E2IJ 2GM4A 2DN0A 4I7HA 1QBJA 4EJTA 1YHQI 1U9NA 1HKQA 4UVBA 4ESBA 2VASA 5E3MA 1RZ4A 4FQGA 1JT0A 2WTEA 3CUOA 3FKIJ 3BTLA 2X6OA 2RV8A 3FK6A 1YJNI 1HXDA 2DBBA 3S8PA 3CMEI 4HDUA 4E7JA 3LSRA 2EA2A 5L3GA 2H8RA 3VYSB 2BZTA 4Y52J 3A0BC 5L3BA 1QU3A 4HNUA 3EUAA 1EV7A 1X1CA 2Q0OA 2XPVA 1G8XA 4LK1F 4CHUA 3M1CA 5DDGA 3LA7A 3BR1A 4GDFA 2ZNYA 4JP0A 4ETSA 3HBLA 3N05A 3HTUA 1Z7UA 1D0XA 4KISA 1K79A 2V4JC 1FP2A 1ORKA 3ZQIA 2EV5A 1R71A 2VJIA 4A0ZA 3HOXJ 4LB5A 3Q9SA 2PEXA 2VQGA 4GXOA 2OTLI 1R5ID 5GAEJ 3GW2A 3QYFA 1QHGA 2BYVE 1DQUA 2X1CA 2KP6A 5L3DA 2LKXA 2WV1A 1TC3C 3BG6A 1UELB 2FXAA 2XAHA 4HA8A 2JZYA 1IXSB 4KIBA 4XORA 3OOUA 3I64A 4AVZA 4V2FA 4BS9A 4CA0A 3PFYA 1HW5A 2KRCA 1BBYA 2W00A 5IP7J 1K78B 2PJRB 3IWZA 4HLXA 1TL8A 2LOOA 3DWLE 4EJOA 1O4XA 3ASOH 2HR3A 4ZDLA 1S6LA 4QIWN 1UB9A 3OIPA 2VBYA 4IOAF 2HYJA 3K10A 5FLVA 3CP2A 1H9TA 5FKKA 3RPUA 1MBEA 2R5YB 2UXXA 1AWCA 1QGPA 3W2WA 2DPDA 3NWSA 2P0WA 5JVGF 3AKZA 2PMZA 3LSJA 5IYCJ 5ICFA 1N77A 2GA2A 2CW8A 1R58A 3H5AA 2Y48A 4F91B 1YJ9I 5J40A 1IG7A 4Y4RA 2NS0A 4BUPA 4UUSA 5ICGA 1I6HJ 2F5DA 2V1UA 2D1HA 2DLLA 1ZG3A 3ABTA 2Z16A 1SFKA 1MJBA 2COMA 2KRFA 4XLNF 3FISA 3RQIA 3FKJA 2XGEA 4M3EA 2A6EF 2VKDA 2R5ZA 5F0HA 3WG7H 2QBYB 4XONA 3MN2A 5LRRA 1ETWA 1T56A 3KYLA 3LA2A 2R3SA 1UG2A 1MZBA 5LGUA 2L9RA 4BY7J 2EZHA 4RBOA 3F72A 2O0YA 3ABKH 3M9AA 2G9WA 4LG3A 2ZXHA 1FOKA 2FF4A 3TDZC 2VL8A 2W4SA 4EM1A 4C3IJ 1EKEA 5DCMA 1AOYA 1W0TA 3OYEA 2GA1A 4BQQA 5EG0A 4YEJA 1MNEA 2HS5A 1H8AC 1FMVA 3TW7A 2B9SA 1MGTA 3CC4I 3I0TA 2HQRA 5E18F 2HKOA 3IWFA 4EQQA 4FE7A 4XM3A 5E1XA 4HDVA 1EH6A 5DM7F 1FIPA 1GXQA 2CV1A 3DFGA 2WAEA 3OYNA 5ERIA 4I6ZA 4Y7NJ 1V5GA 1BN5A 3GZ6A 2HQNA 3ZQCA 2LC2A 4QTRA 2F4MB 1X4OA 2ICWG 2MLGA 4OIRF 2ISZA 3GTJJ 2L7KA 4IHXA 3FXUA 1PUFA 5L3EA 1X3WB 4QWQA 4HQEA 1VQ5I 3SXYA 2QQBA 4F7ZA 3S15J 2EFOA 2GOMA 2OTJI 1R4MB 3KZIC 4ANJA 1LVAA 3F6VA 2JA6J 1LFUP 3R61A 2EPFA 3L9FA 3IH2A 3ZOBA 3TO7A 3Q5FA 4RDUA 1TTYA 2WB1A 2X0LA 4B3XA 3BPXA 5JHFA 1U5TC 4IVNA 2VJJA 2A68F 2ESHA 4LIVA 1I3QJ 1XGMA 4XNFA 1EF4A 4XSXF 5H6QA 2MW8A 2HFHA 3LSGA 1XGSA 2NYXA 2N8GA 5FKNA 2MC3A 3GZ5A 1U6GA 1LDDA 2XF6A 2FOWA 4OMZA 5IT3A 3QPTA 4HRIA 4IHVA 4IHTA 1Z6TA 3WGIA 2VC1A 4DZPA 2DI3A 1K6YA 3QQAA 3ZMZA 4F93B 2D45A 2EIJH 1D5VA 2JJ7A 3CUQC 3H0GJ 1VTNC 1WSUA 1A35A 4RLQA 3EDPA 3G1OA 4RAFA 1QPMA 2C6YA 4A3MJ 3DKXA 2AO9A 3H1CA 2ZMEA 4XRSA 1KYWA 1ETKA 4A0YA 4YFXF 3M3YJ 3E5QA 1WHUA 5HDNA 2MH2A 4L0ZB 3CCJI 1QO0D 4I2OA 3IL2A 3CLOA 2O3FA 2ELKA 1TQPA 1OCCH 3KYDB 3Q0UA 3OYAA 2BVMA 3K2ZA 3T8RA 1YOVB 3HTSB 2QYOA 4NUBA 2MLKA 4DNCA 1F9NA 3K1MA 3MAJA 3DTEA 1IXRC 2KZGA 4RGXA 4A3KJ 1FEXA 1CF7A 3WTVC 3MEXA 4P9FA 5K7ZA 2DQRA 1R7JA 5KVRA 4CYCA 2WADA 2IS2A 4M9ZA 4EJVA 3BG3A 1S29A 3D0SA 4A3JJ 2CJJA 4CYDA 3CJQB 3PNYA 1MIJA 2RN7A 3G1MA 5GAHJ 3D5RC 3H9JA 1XG1A 2OPTA 1OCZH 2HOEA 2V9VA 3OMYA 2HU9A 2H1KA 1GT0C 2QF7A 3VWBA 2VPLA 1HQCA 2OAZA 1JKOC 4XOPA 1JJ8C 1ETQA 1PDNC 5F08A 1XDSA 2DCEA 2G7HA 2E2HJ 4I0BA 3K9TA 4G9YA 3F8MA 5LRSA 2WAQN 1ZRCA 3DTKA 5K7HA 4FE4A 5LLQA 5GPCA 2R0QC 1VQKI 1YS6A 1ON1A 3BR6A 2EIMH 1A31A 4M6XA 1EH7A 3M1EA 2F4IA 3L2CA 3AG1H 3Q3SA 3OYBA 1LVKA 2L9SA 1WCMJ 1UJ8A 1WWXA 1SFOJ 4M3DA 1UAAA 1Y56A 3RYRA 3LSTA 3GMEA 5F0CA 3L2UA 2ZKZA 3V8LA 1B9NA 1JTXA 2DA1A 1A6IA 3E5XA 5EEGA 5LEJA 3CJTB 2R7ZJ 4L9NA 4KIFA 3EYYA 1ITYA 4AYBN 3CCQI 1UG0A 4ZJZA 2OD5A 4PJJA 3L2VA 1U5TB 2DTZA 3BPVA 3GFJA 4U7DA 3HRMA 1K6OA 2DODA 2VXDA 2LSOA 3E3VA 2VT3A 4JYKA 3ZMDA 2QZ8A 3L00A 2ESNA 2P81A 2YU3A 2QWWA 3DQVC 3RZDJ 3JRCA 2QM3A 3COAC 1W5CC 2GQQA 5F27A 3ZCOA 3B6CA 3M8FA 1IRGA 2IS4A 4GRIA 2IGMA 5FRMA 1T33A 4A3EJ 3RQ4A 2LY9A 1HF0A 2FX0A 3IUOA 3F0CA 2COBA 1ZYRF 4JX4A 1FTZA 4DBQA 1G3YA 3FXMA 4PSWA 5HS9A 4FHTA 3L1PA 4FISA 4PJNA 4Q5SF 4BJ5C 4E7HA 1Z7LA 2HEOA 1Z05A 1TWFJ 2QQ9A 3BTCA 4J00A 2P7VB 1IW7F 1AKHB 3FHZA 4HF0A 1HBXG 2W48A 3BJAA 3W6JB 2HYGD 3ABMH 3QU6A 1RR7A 2HPIA 5TJJA 1E3OC 5M3MJ 3BJ6A 4M3GA 1I5ZA 3KP4A 2WY8Q 3CMAI 1T39A 1ZAOA 1SVOA 5KHDA 1MBKA 1Y0UA 3JSOA 2VQHA 1E0EA 5ICEA 1YO5C 3GTQJ 3WTZA 2KT0A 4BQNA 5LGNA 1MD0A 5HLIA 3SDBA 1FX7A 3IAS2 2LYCA 5J4YA 1MH4A 5EZHA 2L9NA 3T8TA 4OU0A 4UV9A 1JTYA 1UHWA 2NVUB 2DTRA 4P5OA 2CUEA 1Y0NA 2D1VA 2FJ1A 3ZR8X 4C2TA 3KZZA 1W7PB 1X19A 4EMSA 4II2A 4OAYA 3OYGA 2HDDA 2PN6A 3IKTA 1X1AA 3CO7C 2K3FA 3H92A 3CJRB 2K9MA 3G2BA 1Y8RB 3OIOA 2BY1A 4KT6A 1T8IA 2EFPA 3WU2C 4GYGA 4C9YA 3C1DA 4WXCA 5K7FA 1VQ7I 1WJAA 3HYIA 2EZIA 4XKWA 3AG2H 1YLFA 5KAFC 3ZQLA 2A69F 4PSXA 2DA4A 1LKXA 3UR3C 1FJLA 1JI8A 1WFXA 5A2QZ 3CZ6A 1WJBA 4L18B 4OOIA 2K4JA 1ENHA 1W36C 1J9IA 5FKOA 4XIDA 3S1MJ 2V6CA 4MQVA 2IBDA 4RAZA 2HQAA 3LSKA 4C3HJ 2EIKH 2JUGA 2HVSA 3IRQA 3HEFA 5FFZA 2D2WA 2WV0A 2XB0X 1CQTA 3DV8A 4HW0A 3LSPA 1OYIA 4A3BJ 2DU9A 4LD5A 4J01A 1HW1A 3ZQQA 4A5NA 2JTVA 1WJCA 3R60A 4ZH4F 3G6EI 1SD7A 4O5VA 1FYMA 3SEZA 3HOZJ 5DS9A 2FOKA 1HSJA 2BY0A 3OYHA 4HZFA 5F0FA 3K7AJ 4MHGA 1IRXA 2UXNA 5HODA 4XN0A 1LUJB 3FZVA 1DUXC 4KT5C 3TO9A 1BR2A 2E2JJ 1KONA 4M73A 5AONA 3A4CA 1XSXA 2GLOA 5BPDA 2W82A 2ECBA 4A6DA 1G59A 1TLHB 1U0JA 2RNGA 4L9JA 5IOZA 3J80Z 1FSEA 1VQMI 1Y39A 2J5OA 4XBFA 2E7XA 4UB6C 4L5EA 3ROUA 1XS9A 1JHFA 2KQRA 2ZJPF 3E5UA 2DT5A 2CUJA 4F3QA 4K2EA 2NOJB 1XC5A 1F36A 4XN3A 4BY1J 1Y1WJ 1G2HA 2VJ5A 4WF2A 4ZYEA 4ENNA 1MDMA 2XAGA 3PO3J 4F52A 1LEBA 1LB2A 4QLCU 2CFOA 5D5VB 1XMXA 4DYRA 2Y2ZA 4RS8A 3RPQA 3LSHA 4QSHA 5KNLA 3U21A 1E3HA 1DGWY 1MBJA 4PCQA 3J81Z 1Z3XA 3A0HC 2HVQA 4MQ9F 2A07F 1VNDA 2LKPA 3K70D 2OZ6A 5FD6A 2QEXI 3F8NA 2AXTC 5L3CA 1K7AA 2ME0A 1D0ZA 3M8EA 3R0JA 3W6VA 3GWZA 1P4AA 1RC9A 2K9SA 2OZUA 2VN2A 2X6YA 3ELKA 3GUDA 2Y75A 3MFKA 3JTHA 3JRGA 1IC8A 3WTWC 2EFQA 3J7ZI 1SD5A 2VPRA 1Y8QB 2BXYA 2CFXA 3PNTA 4UHTA 2V1DA 4BXXJ 3QU3A 1P4XA 1LEAA 2BW3A 3WGHA 3QP5A 2LK2A 2CS3A 1B9MA 3FXRA 2V1NA 3FMQA 3P7NA 3S3MA 2H6BA 3OIQA 1Z3YA 3C2GA 2M87A 4ZYAA 4DOZA 3LNQA 1OCPA 1Q1HA 5HDKA 3CCLI 1OYYA 3OYDA 3ZP5A 3L7WA 4LLNA 2HXIA 3DCFA 4IO9F 1BC7C 2MSYA 4Q47A 4ABZA 1Y1VJ 3TEDA 3TBIA 2R7FA 5HLGA 1ERDA 2ZCWA 1UHSA 1D8JA 2WB1N 2K3PA 2DOAA 2Y9YA 1NH3A 3U2RA 2STTA 4MLOA 3HRUA 5J1YA 2E36A 3ZMUA 1A04A 3R0AA 3JRAA 3LQQA 2HDCA 1WZ2A 2CWEA 4P96A 5KCMA 5IOYA 1VQOI 2MBFA 5L3FA 1OISA 4E7LA 2I10A 3MZYA 1YRNA 1R22A 5E1ZB 1UMQA 2BHYA 1XCBA 3BROA 1DU6A 3F9KA 3AG3H 4XRSG 1HW2A 2BEOA 4ZDOA 2K7LA 3WE2A 2OBPA 3K1NA 1BW5A 3O8GA 3A01A 1Z91A 2Y0SA 1V4RA 3VB2A 3PUBA 3TOAA 2QQ8A 1D0YA 2P8TA 3DP7A 3JW4A 1JGSA 1O3RA 1LFBA 1IDYA 1BIBA 4LGWA 4FX0A 5AIQA 3K70C 2FSWA 5LGTA 2CU7A 4Y33A 2VLAA 4A12A 2DFIA 5D8LB 1SD4A 5GP9A 1EA3A 2DOEA 3K4JA 2VUMJ 3D5LA 3F23A 5TGTA 1NK3P 1U8BA 4RA2A 2KJCA 2P5VA 4IEJA 1YW7A 3KLNA 3JRDA 1NG7A 3M7GA 3DPTA 2Q1ZB 1L0OC 1USTA 5LD2C 4HX8A 5GTHC 2CYYA 3IP4B 1A5JA 2DT6A 1FBSA 3E6CC 2HPMA 1WI3A 4W97A 1HC8A 1O57A 2JSCA 2TRTA 2W1OA 2HZTA 1ZR2A 3RDIA 2R7SA 1PJRA 4OINF 3SYTA 1XSDA 2DFHA 2A5YB 4MEXF 1FY7A 2X51A 4HEA2 1I6XA 2OF7A 1TNTA 2IT0A 1MMAA 1MMSA 4AUXA 2JQ7A 2JA5J 3DTIA 4UVAA 1X3UA 1DGRM 2XAFA 3S1RJ 2DYRH 5M3FJ 1S7EA 2F6CA 4HSRA 1KA8A 2QKMB 3LOCA 3WHCA 4C2MJ 3QOEA 4ZC3A 2MD0A 4NC7A 3U9GA 3GLLA 4AD9A 2FMLA 2RVCA 2ZSIB 4CCMA 2ZBKA 4CCOA 2NVQJ 1ZG1A 4M6VA 3IC7A 1K78A 2PJRA 5IP6A 3LMMA 2EFWA 3TDUC 4PJMA 1B72B 2FE3A 2L9VA 2OCEA 4ZYDA 1R1VA 3FF5A 4MNUA 1IN7A 2XPUA 3P9CA 1SANA 1XN7A 3I53A 2VBXA 3OR2C 4IQJA 4A93J 3OYCA 2RAEA 5E3LA 4OIOF 1TT0A 1IV6A 2R5YA 1GDTA 2W25A 3FXLA 2JPCA 1IUFA 4CCKA 1JXSA 3KP5A 2GZWA 3FK7A 5ILVA 1G3SA 2CUFA 3S1NJ 2OV7A 3G1LA 5K5RA 3O6BB 2IP2A 1ETXA 2NXNB 2DJIA 4XRFA 5M5XJ 1DP7P 2O7OA 5IT9K 2JA2A 4B48A 2M0MA 2CV0A 1BJAA 4BQAA 3F22A 2X6WA 2ZMEC 1B8IB 2YU9J 4E7KA 2EQRA 2K85A 2E1MC 4UVCA 3MKWB 1J75A 2TDXA 3I4MJ 2A3SA 4HPQA 2V9KA 3IH4A 4NDLA 1KQ8A 4OAZA 2OU2A 1OR7A 2CW0F 4LLGF 4O6JA 5BNGA 1P4WA 1KU7A 1SAUA 2RREA 2TCTA 4DBRA 2Q2EA 3HSFA 3V7SA 4DGWB 2ZFWA 2GAUA 2BHZA 2LREA 2IA0A 4FTHA 1P7JA 2KDOA 2M4KA 2FQ3A 2W84A 2M30A 2R5ZB 1SAXA 1MMGA 3NWTA 5D6EA 4DYCA 3OOPA 4Q4ZF 3W2VA 4XKBA 4AM3A 1QQIA 5JR3A 1JJ6C 2RKHA 4GCVA 3KP6A 2XF5A 4AWXB 5DTDA 1IN8A 4HYEA 2ECCA 3EUHA 1LFPA 4WWCA 1ETOA 2L7FP 3CMMA 2G0EA 5EEAA 3SZTA 2XUBA 3PQKA 5DCMB 4E7ZA 1LJ9A 1ZARA 2LF8A 5D6FA 2R7WA 1SMTA 4S05A 1JUMA 2DYSH 4UV8A 4EGYA 1RR8C 2F2EA 5FFXA 1IRFA 2HDWA 3VDXA 2Y9ZA 4A5MA 1D1BA 3UNGC 4G12A 3L2RA 4IJAA 2XAUA 1KZHA 2ME6A 4M74A 5M5WJ 2LFBA 3V7CA 1DDNA 5LHHA 1WRJA 3L2QA 3KFWX 2E7WA 1XCVA 2K5CA 3KEOA 4HLYA 1Z67A 4A69C 4BE2A 5EYRA 2WA0A 1ZRFA 1MSFC 3OSFA 1VZ0A 4R1HA 4H4KC 1GHCA 3HGGA 2JN6A 1Q1VA 2RGVA 1RIOH 3CJNA 3WTTC 3BJOA 1SMYF 1YIJI 1S8NA 1YE9A 3VOEA 3RKWA 3NAUA 3JRFA 4UB8C 3CMYA 3R6SA 2LBFA 4BBRJ 4WX9A 1T38A 2EINH 1XDUA 3O8HA 1LE8A 5HLHA 1TWHJ 3N97A 1LDKB 5CYVA 2XAQA 4KYWA 5EZGA 3CCEI 4ESJA 2WBMA 1ZTRA 1R00A 2JK3A 3O3KA 3G73A 2CGPA 1T95A 4HF1A 3CCMI 3WG9A 1B6AA 3GO5A 1VQPI 3I54A 3G4SI 2MGQA 2CQQA 4CCLA 4LK0F 2XC7A 1FSHA 1C0WA 2VJ4A 2HOTA 1MBGA 1G6NA 3HUGB 5CVVA 1BA5A 1FC3A 1Y6IA 1OKRA 1ZLJA 3B02A 3HM5A 4D7MA 2ZMEB 2XRLA 2KIFA 2R4GA 1NG6A 5FO5A 2DXIA 2E1MB 3RI4A 1YX5A 4D5FA 5HS8A 1YYVA 4ZZDA 3BQYA 2GXAA 1KU9A 4II3A 4FT8A 1FTTA 4XR6A 4JOMA 3VFZA 2DPUA 1V5EA 1AHDP 1FMWA 1ZK8A 3I55I 5E17F 3RIRA 4G7ZF 1Z77A 2K9QA 2L02A 3HPHA 2ID3A 5J8FA 2KISA 2M34A 2XHKA 1CF7B 1D1CA 1MJAA 5H6RA 2HYFA 1N75A 4R79A 2LP0A 1IDZA 4CYCB 1Z21A 3R4KA 2H09A 1GVJA 4RB1A 4C30A 1O7LA 2PMHA 4MFEA 4EM0B 4XRMA 4I01A 2L7MP 2JWTA 1ZREA 3HG9A 2F5EA 3KEYA 2DA3A 4MO7A 3I9V2 3IH3A 3PSIA 1X1PA 3V4GA 2XSJC 3BTJA 2YX4A 3PUFA 3TL4X 2Y30A 2KIQA 1FIAA 3QPLA 1KU2A 4BE0A 3C2HA 5ICCA 3OYFA 1R5HA 3TW6A 1FNNA 2MA3A 3VYRB 1FOWA 2XB5A 1U8RA 3OYMA 2BY2A 4X1EA 3S3NA 2NS8A 1UHMA 3LQRA 3FBNB 5FROA 4NC8A 2EK5A 2I8DA 3BZ6A 2QCOA 2AQFA 3W6KB 5CJ9A 1X2NA 3DLLF 2JVGA 3HB9A 2LY1A 3PJRA 1F4KA 3QWLA 1TWGJ 1U5TA 4UUTA 4BJTA 1IZ1A 2DDAA 1ZGWA 3GTKJ 1WJFA 1EJ9A 2K4BA 3CC7I 1J5YA 1HDPA 1P92A 1BI0A 1JKQC 2F5VA 3TKYA 5IP9J 3BWGA 3P9IA 1FBUA 5BS6A 3CF5F 1X2MA 3V7RA 4FCYA 3CUQB 3DF8A 3LAJA 3PSFA 2F5CA 1VQLI 1W1WE 4Z6YA 1OJLA 3BR3A 4OWRB 1R49A 2X85A 4PUSA 1GV5A 3HKZA 3VYUB 1JUSA 3HOWJ 2YPRA 1E17A 3HJEA 4XKCA 3K69A 1W5SA 4XKVA 1SVMA 1UCRA 2AXLA 4A6EA 3OL3A 2IS1A 4Q48A 2Y0SN 3NRVA 3K6GA 1H88C 2M45A 4M9SA 4KMFA 2ISYA 1JUPA 2FU4A 1BW6A 4BAYA 5C4JJ 3SZPA 1TNSA 2K9NA 3I71A 4LITA 1VFCA 5JLXA 4M3BA 3KP3A 2IGOA 4JX5A 1W4MA 3MZ8A 2EA4A 2R7QA 2QSHX 1TBXA 4NBQA 3OL4A 2DA7A 2E35A 3SFZA 5J47A 3SHFA 4YFNF 1V5FA 3FM3A 1W7PA 4RLFA 2NVXJ 3ABLH 3DKYA 1JT6A 4S04A 5F1RA 3VPRA 5GTIC 3I59A 2XROA 3H9QA 1ZR4A 1WPKA 2JMWA 1WQ2A 2NAZA 2KIMA 4ENJA 2OC6A 2H6CA 3JAMK 2R7DA 5B66C 5DCFA 4MGRA 2DMPA 3S2WA 1G3TA 4BEHA 2P4WA 5HNFA 2H8WA 2EFNA 2FNAA 3OYLA 1S72I 3JREA 4XLPF 2UUZA 1VQNI 3FBIB 4RB0A 1FPQA 5HLTA 3ECOA 4E7SA 4LOCA 3QAHA 4IF4A 1VI0A 1FT9A 1A6QA 3CQZJ 4R8HA 1MMDA 1WVRA 5D5XB 3PIOF 3WTUC 1ON2A 1U78A 3I4NJ 3FMRA 3X2QH 4XLAA 4Y15A 2HI3A 4N4OB 4PFOA 4JQFA 3SFIA 4MIMA 4IOCF 2YR2A 1HOMA 4HAMA 4LIUA 1IO2A 3T0YA 3JR9A 3WTXC 2XPWA 4EATA 2ZB9A 4CXFA 2LVSA 1ZG5A 2B7EA 3E7LA 3P9KA 2EV0A 4MFDA 3NEUA 2KRHA 1B1BA 2I5UA 3S1QJ 3ISPA 1APLC 2A61A 5FD5A 1I50J 1P2FA 3FIWA 4GGGA 3E6BA 4BH9A 1IGNA 4PK4A 4GYIA 2WWYA 3JAMZ 1V54H 1FLIA 1STZA 2M9HA 3ZMSA 3ZMVA 5C4XJ 3E1SA 2JVHA 2RC4A 2VIXA 3RZOJ 3HSEA 4BJ6C 1QA6A 1BR1A 3I5UA 1SC7A 3JSPA 1S5LC 1ETYA 2QA4I 2EV6A 1FP1D 2CH0A 2ADUA 3H36A 2HVRA 5J1UA 2K86A 1FZPB 4CO8A 1K4SA 3W2AA 5D4SA 1D1AA 1J0RA 3GFIA 5JLWA 3GFMA 1SFUA 2XKOA 1F43A 1VQ9I 3CDLA 4Y17A 3S16J 3C2BA 3PL8A 1OQYA 1K83J 3TP0A 1GV2A 1J2XA 5CLSA 2O03A 1RRJA 3HZJA 1MJ9A 4L5IA 1HDDC 2JRMA 3IHUA 1HCRA 4AVPA 4D9JA 2P7CB 1KGSA 2ZC2A 5HDGA 2Z3YA 4U7BA 3BG9A 4X0GA 3VSLA 4EJUA 1ZH5A 1BJZA 3G71I 2OJED 4EEFG 4IXAA 1O3TA 3CF2A 3SZGA 5B5EC 1R23A 1HLVA 2QSGX 5FJ8J 4IZZA 2M7AA 5FGMA 1I3AA 1ZGAA 4CH7A 3CD6I 1IRZA 5EGOB 3MVPA 3NARA 3BG7A 4ASNA 2V6EA 1WH5A 1YQAA 3ZQ7A 3HXLA 2J5PA 5D4RA 1ZHFA 4N9IA 4BXUA 4LG0B 2FUG2 3H3UA 4ENMA 1L3LA 3AL0C 2K9LA 4BQOA 2DFEA 2VOOA 2HTJA 3ZQFA 1QZEA 2L0KA 4KN4X 4DW6A 2IA1A 3BP8A 3K1PA 1N78A 2AQEA 3EUKL 2EWNA 2XASA 4AIHA 1D5YA 1QRYA 4RB3C 1UFMA 3K4NA 1GUUA 1OFCX 4BDZA 4V19K 3E6DA 5DUIA 1OMIA 5J6XA 2FA5A 2X4HA 3KYCB 3P5JA 5FLXK 2PQ8A 1JKPC 2JSPA 4YG2F 4KFCA 4Z2YA 1RUOA 4HOBA 4KICA 3FHNA 3HOUJ 4IX7A 3CC2I 1OPCA 2CMPA 4ITVA 4ZDPA 1PP7U 2YS9A 3GZNB 1YJWI 3DXJF 4NHJA 5M5YJ 1N25A 4U87A 2EJRA 5DEQA 1HKSA 4C2UA 5HS7A 2YUSA 3CESA 1G4DA 2KMUA 2R7OA 2W7NA 3O2PE 2LLKA 1MSEC 3F8CA 2LDUA 4I02A 3V8JA 1T0FA 1XMAA 2IS6A 4L0YB 2CO5A 4BE1A 1WH7A 2ZJRF 1F1ZA 3BC8A 3F8FA 4NB5A 3RTRA 3MKYB 4UXNA 1J7KA 2MYSA 1IN6A 5E79C 1ULYA 2LMDA 2FMYA 1VQ8I 4G8XA 5C44J 3H3ZA 5CQEA 4HV5A 1RPWA 1BL0A 4XMYA 2VT2A 1XMKA 1PUEE 1SFEA 3A1YA 4YELA 5HVQC 2DMUA 3ZXSA 1BIAA 2IAIA 4WXDA 3BLYA 3BY6A 1S7AA 3L09A 4ZYGA 2PBIA 2PMUA 4NQWB 4XLEA 3TOBA 3FXKA 2AHQA 2DW4A 2VKEA 4CGZA 5BQTA 1OR7C 4MTEA 1R9TJ 4CICA 2KFDA 4YIRX 2V1XA 3NQOA 3WTYC 2VOPA 1TWCJ 5IYDJ 4BYYA 3KP2A 5GAGJ 4EM2A 3QOPA 3QP6A 3TO6A 2Y69H 3EPZA 5CVJA 4G6DA 1X58A 2FRHA 4HF2A 4G6TB 1XSVA 1OCTC 2XIGA 2LY2A 2M5WA 2YX7A 4LFUA 3T1BA 4ZTJA 5GADJ 1U2WA 5IPAA 2NNYA 3PO2J 4BNCA 2L54A 1BOBA 3EUHC 4G7OF 1R36A 1YW9A 4S0HB 3OWTA 4OIQF 4EVIA 2B63J 2PJPA 3WHBA 2A6HF 3K4KA 2W57A 2E1OA 2FBIA 3EETA 2GIZA 2HXOA 2M3AA 4I99C 4UUVA 3ZGKA 3BR5A 3GBGA 1J09A 3ECHA 3D1NI 4B47A 1VF9A 1F5TA 2A05A 4CUGA 2IGNA 1SVLA 2DJNA 1RKTA 3MWMA 2NS7A 3MKLA 3AL0B 1YW8A 4A3DJ 3MQ0A 2A6TA 3GEZA 3KLOA 2L01A 1IN4A 2HQ5A 1RNLA 3DBLB 2EB7A 2MG4A 1FBQA 1S3JA 5FRNA 3QYBA 4A3GJ 1BI2A 1ETVA 2LH9A 2IW5A 4CCNA 2AS5F 3KZYA 2H1LA 2CSOA 2V9PA 1T2KA 2CQ7A 5CKTA 3K4BA 2FBKA 1QVUA 2X6XA 1B72A 4OMYA 3JCUC 5EJCA 2Q8KA 1ZKGA 1Z9CA 4O3MA 4DYQA 1TQMA 2FBHA 3KCCA 2L4MA 2F48A 2WY7Q 1KYZA 3GF2A 2DOFA 3M07A 5CPRB 2QUFA 1MH3A 2O8XA 2UWMA 3SDGA 3ZQHA 2MABA 5F64A 4RM2A 1W0UA 2XGCA 2GWRA 2XVCA 4RM3A 2LD5A 1JKRC 4HX4A 2DT7B 3MCZA 4IHWA 3E0JB 3AFHA 3VYTB 1RUNA 3J7YJ 1I39A 1MBFA 1TQIA 2OA4A 1B8IA 4RGUA 2W85A 2ZJ2A 4P1WA 4CDGA 3TMOA 3J7AY 4N4NB 3S2DJ 3BCBA 2IRFG 2LNBA 2M8GX 1IAWA 2YSRA 1V3FA 2MFZA 4UUSB 4B43A 1X4PA 2LF7A 3TGNA 4B1RA 1H89C 2QQAA 1A36A 2QBYA 1ZGJA 3MZHA 3HKZN 3W3CA 5J8CA 4PDKA 4DIQA 3GTPJ 5GPAA 2H94A 2P6TA 1O3SA 1BM9A 4CSWA 3OS1A 1RETA 1IF1A 3ZMTA 3IV5A 3FMSA 3DPUA 3S3OA 2JA8J 4OIPF 5BPIA 4M9XA 3GTLJ 1YG2A 2Q2EB 2E5NA 1ZRDA 5IT9Z 5DM6F 3IAM2 2VC0A 5BMZA 3KETA 3DBHB 4WK8F 1BC8C 1YS7A 5E8IA 1B4AA 3Q0WA 5CQGA 3WTSC 1U9OA 3FX3A 5F6FA
chains in the Genus database with same CATH topology
1XPXA 1MIJA 2LMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPX A;  1MIJ A;  2LMD A; 
#chains in the Genus database with same CATH topology
 1EH8 A;  2O5R A;  2QEN A;  1P7I A;  2KKO A;  1T6S A;  4E7I A;  5EG0 B;  5EF6 A;  3B6A A;  3BZK A;  4BHC A;  4DJA A;  1G3W A;  1WI9 A;  4ON0 A;  2BY3 A;  4AC0 A;  1W5T A;  4IQ4 A;  4IRG A;  2KHM A;  3BOQ A;  4Y3O A;  2L4A A;  3D5S C;  4L5J A;  5E3O A;  5FKL A;  1JGG A;  1TWA J;  1W7P D;  3WOD F;  1E2X A;  4F92 B;  3KX2 A;  1MMN A;  4HQM A;  4N9H A;  3LL7 A;  2XAJ A;  3H35 A;  2LTP A;  1PUF B;  3VEP A;  3MD2 A;  1FYK A;  4A3C J;  4JBA A;  5D5U B;  1TP4 A;  1X3Z B;  4U0V A;  4KIG A;  3C3W A;  3F21 A;  2QLZ A;  2BGC A;  2DQL A;  3I58 A;  4HNT A;  4FET A;  4CZC A;  2X1D A;  4BAC A;  3JRH A;  3ZPL A;  1D3Y A;  2VI6 A;  5DV5 A;  2ZSH B;  5EEH A;  2CQK A;  2JA7 J;  1S7O A;  4KJZ A;  2BE5 F;  1IV8 A;  3WE3 A;  2FD5 A;  4D0P A;  2P5L C;  2IVM A;  1NK2 P;  2P5K A;  1PYV A;  2QKL B;  1K61 A;  1Z0X A;  2XF7 A;  5LEK A;  2LG4 A;  4UY8 I;  2Z1D A;  3OS2 A;  5DD4 A;  3PM1 A;  2ELJ A;  2VON A;  1OYW A;  5LFA A;  4XL9 A;  5ED4 A;  3RSN A;  4C3J J;  5IYB J;  4B8X A;  5J1R A;  2M1B A;  2CW7 A;  3ULQ B;  3H3V K;  2DA5 A;  1ONV A;  1KQ9 A;  1YFH A;  2LBF B;  3CCU I;  2PG4 A;  3ERM A;  4RGS A;  2CQX A;  2ZFU A;  1POG A;  3A03 A;  3OYK A;  3ASN H;  2RQP A;  2KDZ A;  4FX4 A;  2R93 J;  3C7J A;  1DPU A;  1TT5 B;  4PZJ A;  4WCG A;  3ML6 A;  1LE8 B;  4IPA A;  3OY9 A;  2CUZ A;  2EZL A;  2ZJQ F;  3FXO A;  2RQQ A;  3FXQ A;  4IL6 C;  1T98 A;  3HUG A;  3BG5 A;  4XSZ F;  4GFB A;  1I27 A;  3V8K A;  3KP7 A;  4ZYH A;  2OCC H;  3GTG J;  5F04 A;  1FOX A;  3RCO A;  4RAG A;  2R7R A;  4I76 A;  2VKH A;  4AID A;  2FEZ A;  3RJP A;  1WJE A;  2E71 A;  2ZXJ A;  3H0D A;  1WGX A;  3FWE A;  1H0M A;  1E3P A;  1LPQ A;  3DLA A;  3VOD A;  1IJW C;  2H27 A;  4QPO A;  1GVD A;  1XTA A;  2CRG A;  2JUC A;  1QZZ A;  4IHS A;  5K5Q A;  2Y0M A;  4P55 A;  3DPL C;  4V2G A;  4B09 A;  3PIP F;  5C3E J;  4NC6 A;  2BVL A;  4A3L J;  1HKT A;  1QVT A;  2NOG A;  1HA8 A;  2XGD A;  2XGX A;  3SQN A;  4D7N A;  3PQJ A;  2HWV A;  1FOY A;  4BKX A;  2HOS A;  1YIT I;  1J59 A;  4M71 A;  4ESF A;  2VE9 A;  5TRD A;  2M8E A;  5EDN A;  3SEQ A;  4FAS D;  2D5V A;  2VQC A;  3K4L A;  1XGN A;  1WKM A;  4WXH A;  3TP3 A;  1ZEL A;  3BR0 A;  1R6R A;  2XDV A;  4I09 A;  3AAF A;  1P6R A;  5JHU A;  2VB6 A;  5F1J A;  1BR4 A;  3IKV A;  3HGY A;  2L2O A;  4I98 B;  2VBZ A;  2NVY J;  4B3A A;  4BXF A;  3AG4 H;  2M2E A;  4Y13 A;  3I3L A;  5KAI C;  3M4O J;  2CV2 A;  1YTY A;  1B59 A;  1QHH D;  5HNH A;  1FWZ A;  4XIC A;  1IN5 A;  2O9L A;  3CCR I;  5CVI A;  2X1E A;  3ABU A;  2E5Z A;  5JI6 A;  3N4M A;  2BV6 A;  4U0Y A;  3HOY J;  2UZK A;  5TIS C;  4L9T A;  3JRI A;  2NVT J;  2Z2S B;  4CZZ A;  2R7U A;  4JX6 A;  2GIV A;  3ZN1 A;  2JT1 A;  4HBL A;  4BU2 A;  1T08 B;  2IGK A;  2DMQ A;  2M4G A;  5ILS A;  3CP8 A;  3H5N A;  5JFR A;  2KLO A;  4E4H A;  3S17 J;  3ONQ A;  1W36 D;  4G94 A;  1MKM A;  4KMU X;  4KUM A;  3WU1 B;  1IXC A;  1XPX A;  2XKP A;  1U3E M;  5H2F C;  2VE8 A;  3CUQ A;  3RKX A;  1DPR A;  3H5R A;  2DMN A;  2B0L A;  2EIL H;  3OR1 C;  3HOV J;  2EH3 A;  2PLY A;  3F3X A;  3HHG A;  3JTG A;  1QZY A;  2A5W A;  1AKH A;  4X6A J;  1X1D A;  5AIP A;  1JHH A;  2E1N A;  4U88 A;  3BZC A;  2HOA A;  3OV8 A;  1M1E B;  4W1U A;  4BDY A;  5FKM A;  4BHB A;  4DQ2 A;  4PJL A;  5D5W B;  1LNW A;  5J4V A;  4J19 A;  1LQ1 A;  5E1W A;  3S93 A;  2K02 A;  2HTS A;  1Z6R A;  2ZXI A;  4YIF A;  3OSG A;  1MBH A;  5B1B H;  1OLT A;  2G7U A;  9ANT A;  2ETH A;  2VOD A;  3LSM A;  2QSF X;  3RKQ A;  1XX5 A;  1ODD A;  3B73 A;  3LWF A;  3MKZ A;  2LR8 A;  2UV1 A;  2CQN A;  1VQ6 I;  1GXP A;  2LKS A;  2OUM A;  2HZD A;  1DP3 A;  2ZXW H;  2STW A;  4ZZL A;  4LJZ F;  5HOO A;  5A2Q K;  1RI7 A;  2E34 A;  2DA6 A;  2Z5U A;  2OQG A;  3DU6 A;  4EGZ A;  2O61 A;  2PX9 A;  3BT9 A;  1OCR H;  3UKG A;  4G7H F;  3HSR A;  1ACI A;  4XLF A;  3A02 A;  1UZC A;  2CG4 A;  3DEW A;  2WC2 A;  3Q9V A;  1BI1 A;  5B3S H;  4UNO A;  1HST A;  1H9G A;  1R1U A;  4B44 A;  1I1S A;  1O3Q A;  4YII A;  1MND A;  4YRV A;  3C18 A;  3CDI A;  1JE8 A;  3QPS A;  4AIK A;  2P6S A;  2MC4 A;  2RNJ A;  2R7T A;  3I59 B;  2L7Z A;  4YFK F;  5E3N A;  3U1K A;  3DEU A;  1AU7 A;  1BOA A;  3DBR B;  4A0X A;  3LA3 A;  1TW2 A;  1YX3 A;  4I0A A;  2DFF A;  1MNM C;  3JRB A;  2HNH A;  1GLN A;  3BR2 A;  4BEH B;  2R92 J;  2DK5 A;  4M3F A;  2PI0 A;  2DO7 A;  4XQF A;  1OCO H;  2O6G E;  2IA2 A;  2X9D A;  3HRT A;  5E8G A;  3IRR A;  4HG2 A;  3K4C A;  4RMN A;  2F4O B;  3EQL F;  2GOX B;  3GXO A;  3J80 K;  3ZN0 A;  3DEE A;  5J3L A;  3HL2 A;  2VXZ A;  3PNV A;  4BL0 B;  3ZRG A;  5DD8 A;  4ENK A;  4KA4 A;  3BDD A;  4HX7 A;  3HHH A;  2FQ4 A;  6PAX A;  3KIO A;  1NTC A;  4IRH A;  2X48 A;  1ZQ3 P;  4CCJ A;  3I56 I;  4LLL A;  1T0F C;  1WJ5 A;  4A2U A;  4A3I J;  1BI3 A;  4L9V A;  3MMY B;  5LHG A;  3K4M A;  2R7X A;  1D8K A;  2VQL A;  2DAO A;  3A2K A;  3U1D A;  1R1T A;  3LAP A;  4PGH A;  3TQN A;  4RB2 C;  4HNV A;  4GO1 A;  4RGR A;  4P9U A;  2MH9 A;  2EBI A;  3FXJ A;  2ELH A;  3RKY A;  3J81 K;  2M0C A;  3F8B A;  2IJL A;  4TV7 A;  2OQR A;  4EV0 A;  3E6M A;  4EJW A;  1S9H A;  3GYH X;  2Z99 A;  2WAF A;  4H0E A;  3DKW A;  2GXG A;  3GCM A;  3WU0 A;  4NNJ A;  3HOS A;  2BOL A;  2IEK A;  3LSI A;  1SFX A;  3V42 A;  2V7F A;  1USS A;  2M7B A;  2RDP A;  4F55 A;  3OYI A;  2PMZ N;  1ZLK A;  1K4T A;  1NHA A;  1PVE A;  4IKF A;  3E97 A;  3CO6 C;  3RPU D;  3ZQG A;  4KNY A;  3SJM A;  3BCA A;  4PFP A;  4B4C A;  4G6Q A;  2O8K A;  4KN7 X;  3REO A;  1XD7 A;  4M72 A;  5LHI A;  1REP C;  1MDM B;  1RES A;  1V55 H;  4XOT A;  1XB4 A;  4KIT B;  4E6K G;  3HOT A;  5CVU A;  4XLH A;  2VKV A;  2HGC A;  2HKX A;  5EGO A;  1QNT A;  2E19 A;  3ESW B;  4AIJ A;  4HV6 A;  2KIU A;  3OYJ A;  5K5O A;  1R5G A;  5K1Y A;  3ERE D;  1SD6 A;  2MD5 A;  5LBQ A;  1X1B A;  3LFK A;  4MEY F;  3GLX A;  3G3Z A;  4LG0 A;  4KDP A;  5B1A H;  3KPH A;  1CGP A;  2L3D A;  3S32 A;  4ZTF A;  1FYL A;  1KQ0 A;  2E1C A;  1VQ4 I;  2ID6 A;  2W24 A;  3L2W A;  5DUK A;  4XLC A;  2WAQ A;  1YIO A;  1LDJ A;  2JRT A;  2DK8 A;  4D5C A;  2GBY A;  3EYI A;  3QOD A;  2Z9O A;  4N0B A;  1MW7 A;  2L5Q A;  2XSD C;  2KL4 A;  2V79 A;  2QVO A;  3GX4 X;  1WJD A;  4U0W A;  1TZL A;  2BW3 B;  3F6O A;  4BGD A;  3DU5 A;  3CTA A;  3CLQ A;  3BTI A;  2LRD A;  2IXS A;  3WGG A;  1TW3 A;  2DMT A;  3CCS I;  3GFL A;  4PJ0 C;  4BBS J;  3CDH A;  4LMY A;  4PGG A;  2KPM A;  1YI2 I;  2KZV A;  1SEU A;  3I4P A;  2NNN A;  2JPB A;  4AYB A;  2DA2 A;  4M6Y A;  3J7A O;  4BHP A;  5CVR A;  2DDB A;  4MTD A;  5ILU A;  1KU3 A;  3FM5 A;  3Q0V A;  1AA7 A;  3HPG A;  1O7F A;  3LFU A;  5KK1 A;  1DU0 A;  2K27 A;  3K2A A;  3RYP A;  3H9G A;  1ZN2 A;  5DYM A;  3GTM J;  2NRA C;  2VBW A;  5BOX A;  5IY5 H;  5FLX Z;  2Z33 A;  3HDD A;  2BBY A;  1PP8 F;  3FDY A;  2IPQ X;  3HIF A;  2XRN A;  4DZJ A;  4AU7 A;  4LB6 B;  4QPQ A;  3HRS A;  3T5X A;  4RAY A;  1YRN B;  5D8K B;  1RKW A;  2BXZ A;  2QGU A;  2E60 A;  4NQW A;  4XK4 A;  3VSK A;  3QYE A;  4JK1 X;  3GVA A;  3QPH A;  2R7V A;  4D1Q A;  3OS0 A;  4A3F J;  2EZK A;  4IHY A;  5E20 A;  2GXB A;  2ZO4 A;  2V26 A;  3PFI A;  5FB2 A;  1QPI A;  3A01 B;  1XGO A;  5FLM J;  3CCV I;  2ACJ A;  3S14 J;  2KJB A;  2Y31 A;  4E70 A;  1IUY A;  3KEQ A;  5JVT A;  3M8J A;  3CCY A;  1Z1D A;  5H20 A;  2K40 A;  1R4N B;  2ZNZ A;  3GTO J;  3S2H J;  3K0L A;  4HST A;  2F5F A;  3BQZ A;  4IRI A;  3QRF F;  1I1G A;  1P9Q C;  2FNP A;  2PFB A;  2XV4 S;  3HC7 A;  3KE2 A;  2E2I J;  2GM4 A;  2DN0 A;  4I7H A;  1QBJ A;  4EJT A;  1YHQ I;  1U9N A;  1HKQ A;  4UVB A;  4ESB A;  2VAS A;  5E3M A;  1RZ4 A;  4FQG A;  1JT0 A;  2WTE A;  3CUO A;  3FKI J;  3BTL A;  2X6O A;  2RV8 A;  3FK6 A;  1YJN I;  1HXD A;  2DBB A;  3S8P A;  3CME I;  4HDU A;  4E7J A;  3LSR A;  2EA2 A;  5L3G A;  2H8R A;  3VYS B;  2BZT A;  4Y52 J;  3A0B C;  5L3B A;  1QU3 A;  4HNU A;  3EUA A;  1EV7 A;  1X1C A;  2Q0O A;  2XPV A;  1G8X A;  4LK1 F;  4CHU A;  3M1C A;  5DDG A;  3LA7 A;  3BR1 A;  4GDF A;  2ZNY A;  4JP0 A;  4ETS A;  3HBL A;  3N05 A;  3HTU A;  1Z7U A;  1D0X A;  4KIS A;  1K79 A;  2V4J C;  1FP2 A;  1ORK A;  3ZQI A;  2EV5 A;  1R71 A;  2VJI A;  4A0Z A;  3HOX J;  4LB5 A;  3Q9S A;  2PEX A;  2VQG A;  4GXO A;  2OTL I;  1R5I D;  5GAE J;  3GW2 A;  3QYF A;  1QHG A;  2BYV E;  1DQU A;  2X1C A;  2KP6 A;  5L3D A;  2LKX A;  2WV1 A;  1TC3 C;  3BG6 A;  1UEL B;  2FXA A;  2XAH A;  4HA8 A;  2JZY A;  1IXS B;  4KIB A;  4XOR A;  3OOU A;  3I64 A;  4AVZ A;  4V2F A;  4BS9 A;  4CA0 A;  3PFY A;  1HW5 A;  2KRC A;  1BBY A;  2W00 A;  5IP7 J;  1K78 B;  2PJR B;  3IWZ A;  4HLX A;  1TL8 A;  2LOO A;  3DWL E;  4EJO A;  1O4X A;  3ASO H;  2HR3 A;  4ZDL A;  1S6L A;  4QIW N;  1UB9 A;  3OIP A;  2VBY A;  4IOA F;  2HYJ A;  3K10 A;  5FLV A;  3CP2 A;  1H9T A;  5FKK A;  3RPU A;  1MBE A;  2R5Y B;  2UXX A;  1AWC A;  1QGP A;  3W2W A;  2DPD A;  3NWS A;  2P0W A;  5JVG F;  3AKZ A;  2PMZ A;  3LSJ A;  5IYC J;  5ICF A;  1N77 A;  2GA2 A;  2CW8 A;  1R58 A;  3H5A A;  2Y48 A;  4F91 B;  1YJ9 I;  5J40 A;  1IG7 A;  4Y4R A;  2NS0 A;  4BUP A;  4UUS A;  5ICG A;  1I6H J;  2F5D A;  2V1U A;  2D1H A;  2DLL A;  1ZG3 A;  3ABT A;  2Z16 A;  1SFK A;  1MJB A;  2COM A;  2KRF A;  4XLN F;  3FIS A;  3RQI A;  3FKJ A;  2XGE A;  4M3E A;  2A6E F;  2VKD A;  2R5Z A;  5F0H A;  3WG7 H;  2QBY B;  4XON A;  3MN2 A;  5LRR A;  1ETW A;  1T56 A;  3KYL A;  3LA2 A;  2R3S A;  1UG2 A;  1MZB A;  5LGU A;  2L9R A;  4BY7 J;  2EZH A;  4RBO A;  3F72 A;  2O0Y A;  3ABK H;  3M9A A;  2G9W A;  4LG3 A;  2ZXH A;  1FOK A;  2FF4 A;  3TDZ C;  2VL8 A;  2W4S A;  4EM1 A;  4C3I J;  1EKE A;  5DCM A;  1AOY A;  1W0T A;  3OYE A;  2GA1 A;  4BQQ A;  5EG0 A;  4YEJ A;  1MNE A;  2HS5 A;  1H8A C;  1FMV A;  3TW7 A;  2B9S A;  1MGT A;  3CC4 I;  3I0T A;  2HQR A;  5E18 F;  2HKO A;  3IWF A;  4EQQ A;  4FE7 A;  4XM3 A;  5E1X A;  4HDV A;  1EH6 A;  5DM7 F;  1FIP A;  1GXQ A;  2CV1 A;  3DFG A;  2WAE A;  3OYN A;  5ERI A;  4I6Z A;  4Y7N J;  1V5G A;  1BN5 A;  3GZ6 A;  2HQN A;  3ZQC A;  2LC2 A;  4QTR A;  2F4M B;  1X4O A;  2ICW G;  2MLG A;  4OIR F;  2ISZ A;  3GTJ J;  2L7K A;  4IHX A;  3FXU A;  1PUF A;  5L3E A;  1X3W B;  4QWQ A;  4HQE A;  1VQ5 I;  3SXY A;  2QQB A;  4F7Z A;  3S15 J;  2EFO A;  2GOM A;  2OTJ I;  1R4M B;  3KZI C;  4ANJ A;  1LVA A;  3F6V A;  2JA6 J;  1LFU P;  3R61 A;  2EPF A;  3L9F A;  3IH2 A;  3ZOB A;  3TO7 A;  3Q5F A;  4RDU A;  1TTY A;  2WB1 A;  2X0L A;  4B3X A;  3BPX A;  5JHF A;  1U5T C;  4IVN A;  2VJJ A;  2A68 F;  2ESH A;  4LIV A;  1I3Q J;  1XGM A;  4XNF A;  1EF4 A;  4XSX F;  5H6Q A;  2MW8 A;  2HFH A;  3LSG A;  1XGS A;  2NYX A;  2N8G A;  5FKN A;  2MC3 A;  3GZ5 A;  1U6G A;  1LDD A;  2XF6 A;  2FOW A;  4OMZ A;  5IT3 A;  3QPT A;  4HRI A;  4IHV A;  4IHT A;  1Z6T A;  3WGI A;  2VC1 A;  4DZP A;  2DI3 A;  1K6Y A;  3QQA A;  3ZMZ A;  4F93 B;  2D45 A;  2EIJ H;  1D5V A;  2JJ7 A;  3CUQ C;  3H0G J;  1VTN C;  1WSU A;  1A35 A;  4RLQ A;  3EDP A;  3G1O A;  4RAF A;  1QPM A;  2C6Y A;  4A3M J;  3DKX A;  2AO9 A;  3H1C A;  2ZME A;  4XRS A;  1KYW A;  1ETK A;  4A0Y A;  4YFX F;  3M3Y J;  3E5Q A;  1WHU A;  5HDN A;  2MH2 A;  4L0Z B;  3CCJ I;  1QO0 D;  4I2O A;  3IL2 A;  3CLO A;  2O3F A;  2ELK A;  1TQP A;  1OCC H;  3KYD B;  3Q0U A;  3OYA A;  2BVM A;  3K2Z A;  3T8R A;  1YOV B;  3HTS B;  2QYO A;  4NUB A;  2MLK A;  4DNC A;  1F9N A;  3K1M A;  3MAJ A;  3DTE A;  1IXR C;  2KZG A;  4RGX A;  4A3K J;  1FEX A;  1CF7 A;  3WTV C;  3MEX A;  4P9F A;  5K7Z A;  2DQR A;  1R7J A;  5KVR A;  4CYC A;  2WAD A;  2IS2 A;  4M9Z A;  4EJV A;  3BG3 A;  1S29 A;  3D0S A;  4A3J J;  2CJJ A;  4CYD A;  3CJQ B;  3PNY A;  1MIJ A;  2RN7 A;  3G1M A;  5GAH J;  3D5R C;  3H9J A;  1XG1 A;  2OPT A;  1OCZ H;  2HOE A;  2V9V A;  3OMY A;  2HU9 A;  2H1K A;  1GT0 C;  2QF7 A;  3VWB A;  2VPL A;  1HQC A;  2OAZ A;  1JKO C;  4XOP A;  1JJ8 C;  1ETQ A;  1PDN C;  5F08 A;  1XDS A;  2DCE A;  2G7H A;  2E2H J;  4I0B A;  3K9T A;  4G9Y A;  3F8M A;  5LRS A;  2WAQ N;  1ZRC A;  3DTK A;  5K7H A;  4FE4 A;  5LLQ A;  5GPC A;  2R0Q C;  1VQK I;  1YS6 A;  1ON1 A;  3BR6 A;  2EIM H;  1A31 A;  4M6X A;  1EH7 A;  3M1E A;  2F4I A;  3L2C A;  3AG1 H;  3Q3S A;  3OYB A;  1LVK A;  2L9S A;  1WCM J;  1UJ8 A;  1WWX A;  1SFO J;  4M3D A;  1UAA A;  1Y56 A;  3RYR A;  3LST A;  3GME A;  5F0C A;  3L2U A;  2ZKZ A;  3V8L A;  1B9N A;  1JTX A;  2DA1 A;  1A6I A;  3E5X A;  5EEG A;  5LEJ A;  3CJT B;  2R7Z J;  4L9N A;  4KIF A;  3EYY A;  1ITY A;  4AYB N;  3CCQ I;  1UG0 A;  4ZJZ A;  2OD5 A;  4PJJ A;  3L2V A;  1U5T B;  2DTZ A;  3BPV A;  3GFJ A;  4U7D A;  3HRM A;  1K6O A;  2DOD A;  2VXD A;  2LSO A;  3E3V A;  2VT3 A;  4JYK A;  3ZMD A;  2QZ8 A;  3L00 A;  2ESN A;  2P81 A;  2YU3 A;  2QWW A;  3DQV C;  3RZD J;  3JRC A;  2QM3 A;  3COA C;  1W5C C;  2GQQ A;  5F27 A;  3ZCO A;  3B6C A;  3M8F A;  1IRG A;  2IS4 A;  4GRI A;  2IGM A;  5FRM A;  1T33 A;  4A3E J;  3RQ4 A;  2LY9 A;  1HF0 A;  2FX0 A;  3IUO A;  3F0C A;  2COB A;  1ZYR F;  4JX4 A;  1FTZ A;  4DBQ A;  1G3Y A;  3FXM A;  4PSW A;  5HS9 A;  4FHT A;  3L1P A;  4FIS A;  4PJN A;  4Q5S F;  4BJ5 C;  4E7H A;  1Z7L A;  2HEO A;  1Z05 A;  1TWF J;  2QQ9 A;  3BTC A;  4J00 A;  2P7V B;  1IW7 F;  1AKH B;  3FHZ A;  4HF0 A;  1HBX G;  2W48 A;  3BJA A;  3W6J B;  2HYG D;  3ABM H;  3QU6 A;  1RR7 A;  2HPI A;  5TJJ A;  1E3O C;  5M3M J;  3BJ6 A;  4M3G A;  1I5Z A;  3KP4 A;  2WY8 Q;  3CMA I;  1T39 A;  1ZAO A;  1SVO A;  5KHD A;  1MBK A;  1Y0U A;  3JSO A;  2VQH A;  1E0E A;  5ICE A;  1YO5 C;  3GTQ J;  3WTZ A;  2KT0 A;  4BQN A;  5LGN A;  1MD0 A;  5HLI A;  3SDB A;  1FX7 A;  3IAS 2;  2LYC A;  5J4Y A;  1MH4 A;  5EZH A;  2L9N A;  3T8T A;  4OU0 A;  4UV9 A;  1JTY A;  1UHW A;  2NVU B;  2DTR A;  4P5O A;  2CUE A;  1Y0N A;  2D1V A;  2FJ1 A;  3ZR8 X;  4C2T A;  3KZZ A;  1W7P B;  1X19 A;  4EMS A;  4II2 A;  4OAY A;  3OYG A;  2HDD A;  2PN6 A;  3IKT A;  1X1A A;  3CO7 C;  2K3F A;  3H92 A;  3CJR B;  2K9M A;  3G2B A;  1Y8R B;  3OIO A;  2BY1 A;  4KT6 A;  1T8I A;  2EFP A;  3WU2 C;  4GYG A;  4C9Y A;  3C1D A;  4WXC A;  5K7F A;  1VQ7 I;  1WJA A;  3HYI A;  2EZI A;  4XKW A;  3AG2 H;  1YLF A;  5KAF C;  3ZQL A;  2A69 F;  4PSX A;  2DA4 A;  1LKX A;  3UR3 C;  1FJL A;  1JI8 A;  1WFX A;  5A2Q Z;  3CZ6 A;  1WJB A;  4L18 B;  4OOI A;  2K4J A;  1ENH A;  1W36 C;  1J9I A;  5FKO A;  4XID A;  3S1M J;  2V6C A;  4MQV A;  2IBD A;  4RAZ A;  2HQA A;  3LSK A;  4C3H J;  2EIK H;  2JUG A;  2HVS A;  3IRQ A;  3HEF A;  5FFZ A;  2D2W A;  2WV0 A;  2XB0 X;  1CQT A;  3DV8 A;  4HW0 A;  3LSP A;  1OYI A;  4A3B J;  2DU9 A;  4LD5 A;  4J01 A;  1HW1 A;  3ZQQ A;  4A5N A;  2JTV A;  1WJC A;  3R60 A;  4ZH4 F;  3G6E I;  1SD7 A;  4O5V A;  1FYM A;  3SEZ A;  3HOZ J;  5DS9 A;  2FOK A;  1HSJ A;  2BY0 A;  3OYH A;  4HZF A;  5F0F A;  3K7A J;  4MHG A;  1IRX A;  2UXN A;  5HOD A;  4XN0 A;  1LUJ B;  3FZV A;  1DUX C;  4KT5 C;  3TO9 A;  1BR2 A;  2E2J J;  1KON A;  4M73 A;  5AON A;  3A4C A;  1XSX A;  2GLO A;  5BPD A;  2W82 A;  2ECB A;  4A6D A;  1G59 A;  1TLH B;  1U0J A;  2RNG A;  4L9J A;  5IOZ A;  3J80 Z;  1FSE A;  1VQM I;  1Y39 A;  2J5O A;  4XBF A;  2E7X A;  4UB6 C;  4L5E A;  3ROU A;  1XS9 A;  1JHF A;  2KQR A;  2ZJP F;  3E5U A;  2DT5 A;  2CUJ A;  4F3Q A;  4K2E A;  2NOJ B;  1XC5 A;  1F36 A;  4XN3 A;  4BY1 J;  1Y1W J;  1G2H A;  2VJ5 A;  4WF2 A;  4ZYE A;  4ENN A;  1MDM A;  2XAG A;  3PO3 J;  4F52 A;  1LEB A;  1LB2 A;  4QLC U;  2CFO A;  5D5V B;  1XMX A;  4DYR A;  2Y2Z A;  4RS8 A;  3RPQ A;  3LSH A;  4QSH A;  5KNL A;  3U21 A;  1E3H A;  1DGW Y;  1MBJ A;  4PCQ A;  3J81 Z;  1Z3X A;  3A0H C;  2HVQ A;  4MQ9 F;  2A07 F;  1VND A;  2LKP A;  3K70 D;  2OZ6 A;  5FD6 A;  2QEX I;  3F8N A;  2AXT C;  5L3C A;  1K7A A;  2ME0 A;  1D0Z A;  3M8E A;  3R0J A;  3W6V A;  3GWZ A;  1P4A A;  1RC9 A;  2K9S A;  2OZU A;  2VN2 A;  2X6Y A;  3ELK A;  3GUD A;  2Y75 A;  3MFK A;  3JTH A;  3JRG A;  1IC8 A;  3WTW C;  2EFQ A;  3J7Z I;  1SD5 A;  2VPR A;  1Y8Q B;  2BXY A;  2CFX A;  3PNT A;  4UHT A;  2V1D A;  4BXX J;  3QU3 A;  1P4X A;  1LEA A;  2BW3 A;  3WGH A;  3QP5 A;  2LK2 A;  2CS3 A;  1B9M A;  3FXR A;  2V1N A;  3FMQ A;  3P7N A;  3S3M A;  2H6B A;  3OIQ A;  1Z3Y A;  3C2G A;  2M87 A;  4ZYA A;  4DOZ A;  3LNQ A;  1OCP A;  1Q1H A;  5HDK A;  3CCL I;  1OYY A;  3OYD A;  3ZP5 A;  3L7W A;  4LLN A;  2HXI A;  3DCF A;  4IO9 F;  1BC7 C;  2MSY A;  4Q47 A;  4ABZ A;  1Y1V J;  3TED A;  3TBI A;  2R7F A;  5HLG A;  1ERD A;  2ZCW A;  1UHS A;  1D8J A;  2WB1 N;  2K3P A;  2DOA A;  2Y9Y A;  1NH3 A;  3U2R A;  2STT A;  4MLO A;  3HRU A;  5J1Y A;  2E36 A;  3ZMU A;  1A04 A;  3R0A A;  3JRA A;  3LQQ A;  2HDC A;  1WZ2 A;  2CWE A;  4P96 A;  5KCM A;  5IOY A;  1VQO I;  2MBF A;  5L3F A;  1OIS A;  4E7L A;  2I10 A;  3MZY A;  1YRN A;  1R22 A;  5E1Z B;  1UMQ A;  2BHY A;  1XCB A;  3BRO A;  1DU6 A;  3F9K A;  3AG3 H;  4XRS G;  1HW2 A;  2BEO A;  4ZDO A;  2K7L A;  3WE2 A;  2OBP A;  3K1N A;  1BW5 A;  3O8G A;  3A01 A;  1Z91 A;  2Y0S A;  1V4R A;  3VB2 A;  3PUB A;  3TOA A;  2QQ8 A;  1D0Y A;  2P8T A;  3DP7 A;  3JW4 A;  1JGS A;  1O3R A;  1LFB A;  1IDY A;  1BIB A;  4LGW A;  4FX0 A;  5AIQ A;  3K70 C;  2FSW A;  5LGT A;  2CU7 A;  4Y33 A;  2VLA A;  4A12 A;  2DFI A;  5D8L B;  1SD4 A;  5GP9 A;  1EA3 A;  2DOE A;  3K4J A;  2VUM J;  3D5L A;  3F23 A;  5TGT A;  1NK3 P;  1U8B A;  4RA2 A;  2KJC A;  2P5V A;  4IEJ A;  1YW7 A;  3KLN A;  3JRD A;  1NG7 A;  3M7G A;  3DPT A;  2Q1Z B;  1L0O C;  1UST A;  5LD2 C;  4HX8 A;  5GTH C;  2CYY A;  3IP4 B;  1A5J A;  2DT6 A;  1FBS A;  3E6C C;  2HPM A;  1WI3 A;  4W97 A;  1HC8 A;  1O57 A;  2JSC A;  2TRT A;  2W1O A;  2HZT A;  1ZR2 A;  3RDI A;  2R7S A;  1PJR A;  4OIN F;  3SYT A;  1XSD A;  2DFH A;  2A5Y B;  4MEX F;  1FY7 A;  2X51 A;  4HEA 2;  1I6X A;  2OF7 A;  1TNT A;  2IT0 A;  1MMA A;  1MMS A;  4AUX A;  2JQ7 A;  2JA5 J;  3DTI A;  4UVA A;  1X3U A;  1DGR M;  2XAF A;  3S1R J;  2DYR H;  5M3F J;  1S7E A;  2F6C A;  4HSR A;  1KA8 A;  2QKM B;  3LOC A;  3WHC A;  4C2M J;  3QOE A;  4ZC3 A;  2MD0 A;  4NC7 A;  3U9G A;  3GLL A;  4AD9 A;  2FML A;  2RVC A;  2ZSI B;  4CCM A;  2ZBK A;  4CCO A;  2NVQ J;  1ZG1 A;  4M6V A;  3IC7 A;  1K78 A;  2PJR A;  5IP6 A;  3LMM A;  2EFW A;  3TDU C;  4PJM A;  1B72 B;  2FE3 A;  2L9V A;  2OCE A;  4ZYD A;  1R1V A;  3FF5 A;  4MNU A;  1IN7 A;  2XPU A;  3P9C A;  1SAN A;  1XN7 A;  3I53 A;  2VBX A;  3OR2 C;  4IQJ A;  4A93 J;  3OYC A;  2RAE A;  5E3L A;  4OIO F;  1TT0 A;  1IV6 A;  2R5Y A;  1GDT A;  2W25 A;  3FXL A;  2JPC A;  1IUF A;  4CCK A;  1JXS A;  3KP5 A;  2GZW A;  3FK7 A;  5ILV A;  1G3S A;  2CUF A;  3S1N J;  2OV7 A;  3G1L A;  5K5R A;  3O6B B;  2IP2 A;  1ETX A;  2NXN B;  2DJI A;  4XRF A;  5M5X J;  1DP7 P;  2O7O A;  5IT9 K;  2JA2 A;  4B48 A;  2M0M A;  2CV0 A;  1BJA A;  4BQA A;  3F22 A;  2X6W A;  2ZME C;  1B8I B;  2YU9 J;  4E7K A;  2EQR A;  2K85 A;  2E1M C;  4UVC A;  3MKW B;  1J75 A;  2TDX A;  3I4M J;  2A3S A;  4HPQ A;  2V9K A;  3IH4 A;  4NDL A;  1KQ8 A;  4OAZ A;  2OU2 A;  1OR7 A;  2CW0 F;  4LLG F;  4O6J A;  5BNG A;  1P4W A;  1KU7 A;  1SAU A;  2RRE A;  2TCT A;  4DBR A;  2Q2E A;  3HSF A;  3V7S A;  4DGW B;  2ZFW A;  2GAU A;  2BHZ A;  2LRE A;  2IA0 A;  4FTH A;  1P7J A;  2KDO A;  2M4K A;  2FQ3 A;  2W84 A;  2M30 A;  2R5Z B;  1SAX A;  1MMG A;  3NWT A;  5D6E A;  4DYC A;  3OOP A;  4Q4Z F;  3W2V A;  4XKB A;  4AM3 A;  1QQI A;  5JR3 A;  1JJ6 C;  2RKH A;  4GCV A;  3KP6 A;  2XF5 A;  4AWX B;  5DTD A;  1IN8 A;  4HYE A;  2ECC A;  3EUH A;  1LFP A;  4WWC A;  1ETO A;  2L7F P;  3CMM A;  2G0E A;  5EEA A;  3SZT A;  2XUB A;  3PQK A;  5DCM B;  4E7Z A;  1LJ9 A;  1ZAR A;  2LF8 A;  5D6F A;  2R7W A;  1SMT A;  4S05 A;  1JUM A;  2DYS H;  4UV8 A;  4EGY A;  1RR8 C;  2F2E A;  5FFX A;  1IRF A;  2HDW A;  3VDX A;  2Y9Z A;  4A5M A;  1D1B A;  3UNG C;  4G12 A;  3L2R A;  4IJA A;  2XAU A;  1KZH A;  2ME6 A;  4M74 A;  5M5W J;  2LFB A;  3V7C A;  1DDN A;  5LHH A;  1WRJ A;  3L2Q A;  3KFW X;  2E7W A;  1XCV A;  2K5C A;  3KEO A;  4HLY A;  1Z67 A;  4A69 C;  4BE2 A;  5EYR A;  2WA0 A;  1ZRF A;  1MSF C;  3OSF A;  1VZ0 A;  4R1H A;  4H4K C;  1GHC A;  3HGG A;  2JN6 A;  1Q1V A;  2RGV A;  1RIO H;  3CJN A;  3WTT C;  3BJO A;  1SMY F;  1YIJ I;  1S8N A;  1YE9 A;  3VOE A;  3RKW A;  3NAU A;  3JRF A;  4UB8 C;  3CMY A;  3R6S A;  2LBF A;  4BBR J;  4WX9 A;  1T38 A;  2EIN H;  1XDU A;  3O8H A;  1LE8 A;  5HLH A;  1TWH J;  3N97 A;  1LDK B;  5CYV A;  2XAQ A;  4KYW A;  5EZG A;  3CCE I;  4ESJ A;  2WBM A;  1ZTR A;  1R00 A;  2JK3 A;  3O3K A;  3G73 A;  2CGP A;  1T95 A;  4HF1 A;  3CCM I;  3WG9 A;  1B6A A;  3GO5 A;  1VQP I;  3I54 A;  3G4S I;  2MGQ A;  2CQQ A;  4CCL A;  4LK0 F;  2XC7 A;  1FSH A;  1C0W A;  2VJ4 A;  2HOT A;  1MBG A;  1G6N A;  3HUG B;  5CVV A;  1BA5 A;  1FC3 A;  1Y6I A;  1OKR A;  1ZLJ A;  3B02 A;  3HM5 A;  4D7M A;  2ZME B;  2XRL A;  2KIF A;  2R4G A;  1NG6 A;  5FO5 A;  2DXI A;  2E1M B;  3RI4 A;  1YX5 A;  4D5F A;  5HS8 A;  1YYV A;  4ZZD A;  3BQY A;  2GXA A;  1KU9 A;  4II3 A;  4FT8 A;  1FTT A;  4XR6 A;  4JOM A;  3VFZ A;  2DPU A;  1V5E A;  1AHD P;  1FMW A;  1ZK8 A;  3I55 I;  5E17 F;  3RIR A;  4G7Z F;  1Z77 A;  2K9Q A;  2L02 A;  3HPH A;  2ID3 A;  5J8F A;  2KIS A;  2M34 A;  2XHK A;  1CF7 B;  1D1C A;  1MJA A;  5H6R A;  2HYF A;  1N75 A;  4R79 A;  2LP0 A;  1IDZ A;  4CYC B;  1Z21 A;  3R4K A;  2H09 A;  1GVJ A;  4RB1 A;  4C30 A;  1O7L A;  2PMH A;  4MFE A;  4EM0 B;  4XRM A;  4I01 A;  2L7M P;  2JWT A;  1ZRE A;  3HG9 A;  2F5E A;  3KEY A;  2DA3 A;  4MO7 A;  3I9V 2;  3IH3 A;  3PSI A;  1X1P A;  3V4G A;  2XSJ C;  3BTJ A;  2YX4 A;  3PUF A;  3TL4 X;  2Y30 A;  2KIQ A;  1FIA A;  3QPL A;  1KU2 A;  4BE0 A;  3C2H A;  5ICC A;  3OYF A;  1R5H A;  3TW6 A;  1FNN A;  2MA3 A;  3VYR B;  1FOW A;  2XB5 A;  1U8R A;  3OYM A;  2BY2 A;  4X1E A;  3S3N A;  2NS8 A;  1UHM A;  3LQR A;  3FBN B;  5FRO A;  4NC8 A;  2EK5 A;  2I8D A;  3BZ6 A;  2QCO A;  2AQF A;  3W6K B;  5CJ9 A;  1X2N A;  3DLL F;  2JVG A;  3HB9 A;  2LY1 A;  3PJR A;  1F4K A;  3QWL A;  1TWG J;  1U5T A;  4UUT A;  4BJT A;  1IZ1 A;  2DDA A;  1ZGW A;  3GTK J;  1WJF A;  1EJ9 A;  2K4B A;  3CC7 I;  1J5Y A;  1HDP A;  1P92 A;  1BI0 A;  1JKQ C;  2F5V A;  3TKY A;  5IP9 J;  3BWG A;  3P9I A;  1FBU A;  5BS6 A;  3CF5 F;  1X2M A;  3V7R A;  4FCY A;  3CUQ B;  3DF8 A;  3LAJ A;  3PSF A;  2F5C A;  1VQL I;  1W1W E;  4Z6Y A;  1OJL A;  3BR3 A;  4OWR B;  1R49 A;  2X85 A;  4PUS A;  1GV5 A;  3HKZ A;  3VYU B;  1JUS A;  3HOW J;  2YPR A;  1E17 A;  3HJE A;  4XKC A;  3K69 A;  1W5S A;  4XKV A;  1SVM A;  1UCR A;  2AXL A;  4A6E A;  3OL3 A;  2IS1 A;  4Q48 A;  2Y0S N;  3NRV A;  3K6G A;  1H88 C;  2M45 A;  4M9S A;  4KMF A;  2ISY A;  1JUP A;  2FU4 A;  1BW6 A;  4BAY A;  5C4J J;  3SZP A;  1TNS A;  2K9N A;  3I71 A;  4LIT A;  1VFC A;  5JLX A;  4M3B A;  3KP3 A;  2IGO A;  4JX5 A;  1W4M A;  3MZ8 A;  2EA4 A;  2R7Q A;  2QSH X;  1TBX A;  4NBQ A;  3OL4 A;  2DA7 A;  2E35 A;  3SFZ A;  5J47 A;  3SHF A;  4YFN F;  1V5F A;  3FM3 A;  1W7P A;  4RLF A;  2NVX J;  3ABL H;  3DKY A;  1JT6 A;  4S04 A;  5F1R A;  3VPR A;  5GTI C;  3I59 A;  2XRO A;  3H9Q A;  1ZR4 A;  1WPK A;  2JMW A;  1WQ2 A;  2NAZ A;  2KIM A;  4ENJ A;  2OC6 A;  2H6C A;  3JAM K;  2R7D A;  5B66 C;  5DCF A;  4MGR A;  2DMP A;  3S2W A;  1G3T A;  4BEH A;  2P4W A;  5HNF A;  2H8W A;  2EFN A;  2FNA A;  3OYL A;  1S72 I;  3JRE A;  4XLP F;  2UUZ A;  1VQN I;  3FBI B;  4RB0 A;  1FPQ A;  5HLT A;  3ECO A;  4E7S A;  4LOC A;  3QAH A;  4IF4 A;  1VI0 A;  1FT9 A;  1A6Q A;  3CQZ J;  4R8H A;  1MMD A;  1WVR A;  5D5X B;  3PIO F;  3WTU C;  1ON2 A;  1U78 A;  3I4N J;  3FMR A;  3X2Q H;  4XLA A;  4Y15 A;  2HI3 A;  4N4O B;  4PFO A;  4JQF A;  3SFI A;  4MIM A;  4IOC F;  2YR2 A;  1HOM A;  4HAM A;  4LIU A;  1IO2 A;  3T0Y A;  3JR9 A;  3WTX C;  2XPW A;  4EAT A;  2ZB9 A;  4CXF A;  2LVS A;  1ZG5 A;  2B7E A;  3E7L A;  3P9K A;  2EV0 A;  4MFD A;  3NEU A;  2KRH A;  1B1B A;  2I5U A;  3S1Q J;  3ISP A;  1APL C;  2A61 A;  5FD5 A;  1I50 J;  1P2F A;  3FIW A;  4GGG A;  3E6B A;  4BH9 A;  1IGN A;  4PK4 A;  4GYI A;  2WWY A;  3JAM Z;  1V54 H;  1FLI A;  1STZ A;  2M9H A;  3ZMS A;  3ZMV A;  5C4X J;  3E1S A;  2JVH A;  2RC4 A;  2VIX A;  3RZO J;  3HSE A;  4BJ6 C;  1QA6 A;  1BR1 A;  3I5U A;  1SC7 A;  3JSP A;  1S5L C;  1ETY A;  2QA4 I;  2EV6 A;  1FP1 D;  2CH0 A;  2ADU A;  3H36 A;  2HVR A;  5J1U A;  2K86 A;  1FZP B;  4CO8 A;  1K4S A;  3W2A A;  5D4S A;  1D1A A;  1J0R A;  3GFI A;  5JLW A;  3GFM A;  1SFU A;  2XKO A;  1F43 A;  1VQ9 I;  3CDL A;  4Y17 A;  3S16 J;  3C2B A;  3PL8 A;  1OQY A;  1K83 J;  3TP0 A;  1GV2 A;  1J2X A;  5CLS A;  2O03 A;  1RRJ A;  3HZJ A;  1MJ9 A;  4L5I A;  1HDD C;  2JRM A;  3IHU A;  1HCR A;  4AVP A;  4D9J A;  2P7C B;  1KGS A;  2ZC2 A;  5HDG A;  2Z3Y A;  4U7B A;  3BG9 A;  4X0G A;  3VSL A;  4EJU A;  1ZH5 A;  1BJZ A;  3G71 I;  2OJE D;  4EEF G;  4IXA A;  1O3T A;  3CF2 A;  3SZG A;  5B5E C;  1R23 A;  1HLV A;  2QSG X;  5FJ8 J;  4IZZ A;  2M7A A;  5FGM A;  1I3A A;  1ZGA A;  4CH7 A;  3CD6 I;  1IRZ A;  5EGO B;  3MVP A;  3NAR A;  3BG7 A;  4ASN A;  2V6E A;  1WH5 A;  1YQA A;  3ZQ7 A;  3HXL A;  2J5P A;  5D4R A;  1ZHF A;  4N9I A;  4BXU A;  4LG0 B;  2FUG 2;  3H3U A;  4ENM A;  1L3L A;  3AL0 C;  2K9L A;  4BQO A;  2DFE A;  2VOO A;  2HTJ A;  3ZQF A;  1QZE A;  2L0K A;  4KN4 X;  4DW6 A;  2IA1 A;  3BP8 A;  3K1P A;  1N78 A;  2AQE A;  3EUK L;  2EWN A;  2XAS A;  4AIH A;  1D5Y A;  1QRY A;  4RB3 C;  1UFM A;  3K4N A;  1GUU A;  1OFC X;  4BDZ A;  4V19 K;  3E6D A;  5DUI A;  1OMI A;  5J6X A;  2FA5 A;  2X4H A;  3KYC B;  3P5J A;  5FLX K;  2PQ8 A;  1JKP C;  2JSP A;  4YG2 F;  4KFC A;  4Z2Y A;  1RUO A;  4HOB A;  4KIC A;  3FHN A;  3HOU J;  4IX7 A;  3CC2 I;  1OPC A;  2CMP A;  4ITV A;  4ZDP A;  1PP7 U;  2YS9 A;  3GZN B;  1YJW I;  3DXJ F;  4NHJ A;  5M5Y J;  1N25 A;  4U87 A;  2EJR A;  5DEQ A;  1HKS A;  4C2U A;  5HS7 A;  2YUS A;  3CES A;  1G4D A;  2KMU A;  2R7O A;  2W7N A;  3O2P E;  2LLK A;  1MSE C;  3F8C A;  2LDU A;  4I02 A;  3V8J A;  1T0F A;  1XMA A;  2IS6 A;  4L0Y B;  2CO5 A;  4BE1 A;  1WH7 A;  2ZJR F;  1F1Z A;  3BC8 A;  3F8F A;  4NB5 A;  3RTR A;  3MKY B;  4UXN A;  1J7K A;  2MYS A;  1IN6 A;  5E79 C;  1ULY A;  2LMD A;  2FMY A;  1VQ8 I;  4G8X A;  5C44 J;  3H3Z A;  5CQE A;  4HV5 A;  1RPW A;  1BL0 A;  4XMY A;  2VT2 A;  1XMK A;  1PUE E;  1SFE A;  3A1Y A;  4YEL A;  5HVQ C;  2DMU A;  3ZXS A;  1BIA A;  2IAI A;  4WXD A;  3BLY A;  3BY6 A;  1S7A A;  3L09 A;  4ZYG A;  2PBI A;  2PMU A;  4NQW B;  4XLE A;  3TOB A;  3FXK A;  2AHQ A;  2DW4 A;  2VKE A;  4CGZ A;  5BQT A;  1OR7 C;  4MTE A;  1R9T J;  4CIC A;  2KFD A;  4YIR X;  2V1X A;  3NQO A;  3WTY C;  2VOP A;  1TWC J;  5IYD J;  4BYY A;  3KP2 A;  5GAG J;  4EM2 A;  3QOP A;  3QP6 A;  3TO6 A;  2Y69 H;  3EPZ A;  5CVJ A;  4G6D A;  1X58 A;  2FRH A;  4HF2 A;  4G6T B;  1XSV A;  1OCT C;  2XIG A;  2LY2 A;  2M5W A;  2YX7 A;  4LFU A;  3T1B A;  4ZTJ A;  5GAD J;  1U2W A;  5IPA A;  2NNY A;  3PO2 J;  4BNC A;  2L54 A;  1BOB A;  3EUH C;  4G7O F;  1R36 A;  1YW9 A;  4S0H B;  3OWT A;  4OIQ F;  4EVI A;  2B63 J;  2PJP A;  3WHB A;  2A6H F;  3K4K A;  2W57 A;  2E1O A;  2FBI A;  3EET A;  2GIZ A;  2HXO A;  2M3A A;  4I99 C;  4UUV A;  3ZGK A;  3BR5 A;  3GBG A;  1J09 A;  3ECH A;  3D1N I;  4B47 A;  1VF9 A;  1F5T A;  2A05 A;  4CUG A;  2IGN A;  1SVL A;  2DJN A;  1RKT A;  3MWM A;  2NS7 A;  3MKL A;  3AL0 B;  1YW8 A;  4A3D J;  3MQ0 A;  2A6T A;  3GEZ A;  3KLO A;  2L01 A;  1IN4 A;  2HQ5 A;  1RNL A;  3DBL B;  2EB7 A;  2MG4 A;  1FBQ A;  1S3J A;  5FRN A;  3QYB A;  4A3G J;  1BI2 A;  1ETV A;  2LH9 A;  2IW5 A;  4CCN A;  2AS5 F;  3KZY A;  2H1L A;  2CSO A;  2V9P A;  1T2K A;  2CQ7 A;  5CKT A;  3K4B A;  2FBK A;  1QVU A;  2X6X A;  1B72 A;  4OMY A;  3JCU C;  5EJC A;  2Q8K A;  1ZKG A;  1Z9C A;  4O3M A;  4DYQ A;  1TQM A;  2FBH A;  3KCC A;  2L4M A;  2F48 A;  2WY7 Q;  1KYZ A;  3GF2 A;  2DOF A;  3M07 A;  5CPR B;  2QUF A;  1MH3 A;  2O8X A;  2UWM A;  3SDG A;  3ZQH A;  2MAB A;  5F64 A;  4RM2 A;  1W0U A;  2XGC A;  2GWR A;  2XVC A;  4RM3 A;  2LD5 A;  1JKR C;  4HX4 A;  2DT7 B;  3MCZ A;  4IHW A;  3E0J B;  3AFH A;  3VYT B;  1RUN A;  3J7Y J;  1I39 A;  1MBF A;  1TQI A;  2OA4 A;  1B8I A;  4RGU A;  2W85 A;  2ZJ2 A;  4P1W A;  4CDG A;  3TMO A;  3J7A Y;  4N4N B;  3S2D J;  3BCB A;  2IRF G;  2LNB A;  2M8G X;  1IAW A;  2YSR A;  1V3F A;  2MFZ A;  4UUS B;  4B43 A;  1X4P A;  2LF7 A;  3TGN A;  4B1R A;  1H89 C;  2QQA A;  1A36 A;  2QBY A;  1ZGJ A;  3MZH A;  3HKZ N;  3W3C A;  5J8C A;  4PDK A;  4DIQ A;  3GTP J;  5GPA A;  2H94 A;  2P6T A;  1O3S A;  1BM9 A;  4CSW A;  3OS1 A;  1RET A;  1IF1 A;  3ZMT A;  3IV5 A;  3FMS A;  3DPU A;  3S3O A;  2JA8 J;  4OIP F;  5BPI A;  4M9X A;  3GTL J;  1YG2 A;  2Q2E B;  2E5N A;  1ZRD A;  5IT9 Z;  5DM6 F;  3IAM 2;  2VC0 A;  5BMZ A;  3KET A;  3DBH B;  4WK8 F;  1BC8 C;  1YS7 A;  5E8I A;  1B4A A;  3Q0W A;  5CQG A;  3WTS C;  1U9O A;  3FX3 A;  5F6F A; 
#chains in the Genus database with same CATH homology
 1XPX A;  1MIJ A;  2LMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...