1MIJA

Crystal structure of the homeo-prospero domain of d. melanogaster prospero
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
139
Chain Sequence
SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein prospero
publication title Structure of the DNA Binding Region of Prospero Reveals a Novel Homeo-Prospero Domain
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 45
structure length 139
sequence length 152
ec nomenclature
pdb deposition date 2002-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1mijA00
1XPXA 2LMDA 1MIJA
chains in the Genus database with same CATH superfamily
3CD6I 4Z2YA 4GFBA 3B6AA 5GAEJ 4D9JA 3BR3A 2X9DA 1NH3A 2FBIA 3H5NA 5GPCA 2R4GA 5CVRA 3ZN0A 3FKIJ 5IPAA 4BQOA 4ZZLA 4JQFA 3JREA 1T56A 4BACA 1JHFA 3FK6A 4P5OA 4MNUA 1T39A 2CUJA 2KT0A 2KIUA 1J75A 3HYIA 1R1UA 4KN7X 2CQXA 5K1YA 3HXLA 3ABTA 1T33A 2DFEA 3ML6A 2I10A 2QBYA 4HDVA 1QGPA 2LSOA 5CJ9A 3ZQIA 3IH3A 4G12A 4NBQA 5LGTA 3RKYA 1MMNA 3HOWJ 3SFZA 1R22A 3F8FA 2ICWG 2FRHA 3NWTA 1C0WA 2VT3A 1E17A 3CMYA 4S05A 2EK5A 1VQ8I 1MBGA 3OY9A 3SYTA 2A69F 2Q8KA 2FBHA 3ELKA 2WB1A 4EJOA 1RI7A 2QWWA 4ITVA 3GTPJ 1BM9A 1G2HA 2F5FA 3B6CA 1WCMJ 3I53A 5CKTA 2OTJI 1VTNC 2A07F 1QVUA 2O6GE 3EUAA 3LFUA 3HHGA 3MN2A 3DTKA 4UNOA 4RM2A 1SFOJ 3BROA 1RUOA 3H92A 4BXXJ 3NAUA 1IXCA 2DQRA 4A3CJ 1F43A 2DT6A 4YELA 1MNDA 1QPMA 1ODDA 2BYVE 4G7OF 1UHSA 1W7PA 4HZFA 2F5VA 3RSNA 2WAQN 4PJMA 3R6SA 1EH6A 2PMZN 3HJEA 4WK8F 3R0AA 3W6JB 3L00A 5BS6A 2ZKZA 3L2CA 2BEOA 4A3MJ 2K27A 5LD2C 2JT1A 1FNNA 5K5OA 3LSRA 1YJWI 2JWTA 1ZH5A 4CZZA 3GEZA 4RLQA 2EPFA 3HOYJ 4IVNA 2EJRA 4IL6C 3WTXC 5LFAA 1HCRA 4Y4RA 2FA5A 2FJ1A 1X1BA 4JP0A 4LMYA 4L0YB 2HKOA 5D6FA 2JRMA 4BHPA 5M3MJ 5J1RA 5DM7F 1OPCA 5IT9Z 4A6DA 5E3LA 2M7AA 3PJRA 2GIVA 2JSPA 3LSKA 3T1BA 1OISA 4J00A 2A68F 3WU0A 1K78B 5J1UA 2VPLA 3Q9SA 2BY2A 4HDUA 3SZGA 4RAFA 1WH5A 3H3ZA 2K9SA 2ZMEB 4CZCA 1MBFA 5JLXA 1YG2A 4E70A 3AKZA 2Z1DA 1X2MA 2E34A 2OD5A 2QEXI 4IQJA 1A35A 1STZA 2JA7J 1IGNA 3N05A 5BQTA 1XTAA 4HSRA 1UB9A 2F5EA 1I50J 4U88A 1OMIA 4NUBA 4M3DA 1G3TA 3GYHX 3ZQCA 2GM4A 1ZG3A 5E8IA 5E20A 4ZJZA 2DT7B 2VBWA 1B9MA 1SD7A 3OWTA 3WGIA 1FTZA 2IA0A 1E3OC 3HUGA 5TRDA 2VC0A 4LFUA 2D1VA 4WWCA 3QPLA 4IRGA 1MD0A 1L3LA 2XPWA 1Y1WJ 5J4VA 4AYBA 1CGPA 3HPHA 2CFOA 1R5HA 5DTDA 2A3SA 1IUYA 4XRFA 2M1BA 2XAUA 3BT9A 2QSGX 1B72A 2ZJ2A 2WTEA 4M71A 2NVUB 1HW5A 2HXOA 4AIHA 2KISA 2I5UA 2V9VA 3LSPA 1OCZH 3HSEA 4XL9A 2AXLA 1DGWY 2K9LA 2KRCA 3E6DA 1JHHA 2VT2A 2CJJA 3OYBA 4M9XA 3PQKA 1O3TA 1QU3A 3CF2A 4BUPA 1SD4A 3E1SA 4WXCA 1MKMA 2XGDA 5FD6A 2FNAA 1VQ6I 1OCCH 1I6XA 4G9YA 2VE9A 3Q0WA 4P9UA 1MH3A 3KX2A 2LOOA 1POGA 4A5NA 3S1RJ 3M07A 2XPUA 1MZBA 4EATA 3SZPA 3U2RA 2NNNA 3LSMA 4X1EA 2DXIA 1RR7A 3DBLB 1OCRH 2R7UA 2M4KA 2RGVA 1WQ2A 5DD8A 1I1GA 1HLVA 3LSHA 2X51A 5FFZA 3JW4A 4KITB 3ABMH 3Q5FA 3F8CA 2V1XA 5DDGA 3GF2A 5J40A 2KMUA 2DA3A 4A3BJ 5L3CA 3HRUA 3OV8A 1LVKA 2NS7A 2VKDA 2MC3A 1S8NA 3BPXA 5F0FA 2ZXHA 2YU3A 4MLOA 2HQNA 1DUXC 3GZ5A 4DZJA 1ZRFA 2CV1A 2CQKA 3DU5A 4ETSA 1HSTA 3I9V2 4HF1A 3F22A 2P7CB 5ICFA 4M6VA 4FE4A 3HKZN 4IPAA 2NOJB 4HQMA 1S29A 2OAZA 2R3SA 3DWLE 3J80K 3JRHA 1SC7A 4P96A 3T8TA 1ZGWA 5DS9A 4IRHA 3ZQFA 1HA8A 3G1OA 3ABLH 3V8JA 3CCLI 3RIRA 5AONA 3IAM2 1MDMA 3TQNA 1B59A 2MBFA 1T38A 4B3XA 5IT9K 1H0MA 1EH8A 2GOXB 1YW9A 3KP4A 2ME0A 2BHZA 1SANA 3ABUA 3O6BB 3RYPA 3PIOF 3L2QA 2XF6A 2HZTA 2LC2A 2Y0SA 1OYWA 4WF2A 4PDKA 4V19K 1YIOA 1SFXA 3LL7A 4XKVA 5J4YA 3MKYB 3JAMK 2Q1ZB 4X6AJ 3ZQ7A 2V6EA 5FGMA 2L4MA 4JX6A 1FOXA 2X1EA 2CWEA 2L01A 2DOFA 4KA4A 1I27A 3PFYA 5H20A 5IP6A 4EM0B 2XKPA 1B8IA 2Z33A 1A31A 2CG4A 2RAEA 4V2FA 3V7RA 3S1QJ 1KQ8A 4GRIA 1ZK8A 1WI9A 4UUVA 2P0WA 3OIQA 1FY7A 3U1KA 2LBFA 2Y9YA 2NXNB 4CA0A 1P7IA 3O8HA 1OCTC 2QQBA 3I59A 1SFEA 1WJFA 3FIWA 4WXDA 4NC7A 3T5XA 1XGOA 2QBYB 2EIJH 3V8KA 3G3ZA 2ZCWA 4A3GJ 3S3MA 5F1JA 2VASA 1OFCX 2LDUA 2D45A 3ZPLA 3K1PA 3TGNA 3CCVI 2DI3A 2DMQA 3WTWC 3BR2A 4P9FA 1FEXA 1U0JA 1G3SA 1XGNA 2EFOA 3MEXA 4HEA2 2E1MB 1MMSA 5LLQA 3BG3A 2BXZA 1LEAA 2HQRA 1HF0A 3W2AA 1T8IA 3E6MA 1TT5B 4YFXF 3OYCA 3GTOJ 2I8DA 2YR2A 3WU2C 5F0CA 1X2NA 5CVJA 1YS6A 2R7DA 1DDNA 4PUSA 1U5TA 2A05A 4AIJA 4EJWA 4KFCA 3OL4A 3WODF 3V8LA 2WAQA 3D5RC 4JX5A 2PMZA 3OYKA 2RQQA 3AFHA 5FLMJ 3Q0UA 3DPLC 2VBZA 4E7ZA 3WGHA 4E7HA 1G3WA 5LHIA 5C44J 2M0MA 1KZHA 3H3VK 4G7ZF 3FHZA 3OSFA 1DPUA 1W7PB 5CVUA 4L5JA 3VWBA 4B44A 1APLC 3IL2A 1VQ9I 4XLCA 1P4AA 2BGCA 1U9NA 4U87A 1F1ZA 3SEQA 4CCMA 2LY1A 4IHTA 5FD5A 5HS8A 2HQ5A 1JKPC 2YU9J 1MBHA 3QP6A 4HRIA 1RUNA 2STWA 1J09A 1JXSA 3GTGJ 2R5YB 2Z9OA 4RMNA 4HLYA 4XLNF 1HDDC 1OR7A 1TWHJ 3DPTA 5DYMA 4F93B 2H1LA 4IXAA 1XGSA 3FXRA 1GDTA 1BR2A 4ZYGA 1IN6A 2G7HA 3H9QA 5J3LA 4FHTA 2M8GX 3WU1B 2UZKA 2X6YA 3WTZA 4LG3A 4J19A 1VQPI 4Y3OA 5IP9J 1EA3A 5HVQC 2R7OA 2HOAA 4IJAA 2IT0A 2A6EF 4I2OA 2VXDA 4AVZA 3OYGA 1W0TA 2WV0A 2IS2A 2X1CA 2DOEA 2FMYA 2FD5A 2PFBA 4DW6A 2HVSA 1ORKA 1ON1A 1ONVA 3PNYA 5L3DA 4MHGA 3I54A 3QODA 4KDPA 1ZG5A 1FLIA 3I5UA 3LSIA 4XRMA 3LQQA 1WZ2A 1Z21A 3LA2A 2VKEA 3UNGC 4G7HF 1B1BA 5HDGA 1BC8C 1HW1A 3EUHA 2KHMA 3A0BC 3HUGB 4EMSA 4BDYA 3AAFA 1Y1VJ 5E18F 1IN7A 2YX7A 5KAFC 1YX3A 3Q9VA 5IYBJ 2W85A 1P2FA 2WADA 1S7AA 4XN3A 3RCOA 5IY5H 6PAXA 1FSEA 3BJAA 1UZCA 4IHVA 2LNBA 3RKXA 4DYQA 1FYKA 3U21A 1Z7UA 2DAOA 2H8RA 4EEFG 1RNLA 1TW2A 5KK1A 2VOPA 1B72B 3V7CA 3GVAA 1QZZA 3EPZA 2E7XA 1ENHA 2OTLI 3ZMDA 3O8GA 3REOA 5JVGF 3WTSC 4XSZF 3OYFA 1XPXA 1D0ZA 2IGMA 2PG4A 1XDSA 3ZRGA 3HHHA 3WTVC 2JPCA 2KJCA 4B1RA 4N0BA 1GV5A 5ERIA 4S0HB 4DYCA 4QTRA 1SAXA 3H3UA 1VQ7I 1U9OA 3MMYB 2R93J 3FXKA 4Q5SF 2D2WA 3E5UA 3E6BA 3K4KA 3GTQJ 2NYXA 4BDZA 2VOOA 3DFGA 5FRNA 2X6WA 3GTKJ 3CMAI 4GO1A 2QZ8A 5K7FA 2AXTC 2COMA 1VZ0A 4KIGA 5D8KB 3CF5F 5F04A 5EEAA 3CP8A 1Y8RB 1J59A 1FP1D 1YJ9I 1BR4A 2OQRA 4HSTA 3BZCA 2KFDA 1LE8A 1MBJA 3D0SA 5GAHJ 2K9QA 4H4KC 1G6NA 3GXOA 2E7WA 4A6EA 4O5VA 2QSFX 3LWFA 2Z3YA 2ID3A 2DA6A 2HEOA 1ETOA 4BJ5C 3JRGA 3EYIA 4BBSJ 1Z3YA 4XOPA 3SHFA 4GYIA 2CW8A 4ESBA 3G4SI 3K4JA 5IOYA 1HC8A 2OJED 4MTEA 4YIFA 4RGSA 2P5KA 2R92J 1EV7A 2D5VA 5EEGA 1SFUA 3M7GA 1LFBA 2NVTJ 1BI2A 3ISPA 4ZYHA 1HKQA 1IRXA 2P6TA 2LRDA 1MDMB 3CDIA 3O2PE 1LB2A 1VQ5I 3TEDA 2LF7A 2FBKA 1ETWA 2ZMEC 2GXAA 1FZPB 3ZOBA 4Y13A 5M5YJ 4KMFA 2QVOA 2FXAA 3FF5A 1H8AC 1WWXA 2A5YB 2HI3A 5JHFA 4I6ZA 1DP7P 3F3XA 2JUGA 2O3FA 3AG2H 2XB5A 2IJLA 2W00A 5BPDA 1Y56A 3KP7A 1T0FA 2M9HA 2RV8A 2W24A 1BOAA 3SEZA 5IOZA 2DO7A 3ZMVA 2JRTA 3ZMZA 1FOKA 1V5FA 2OC6A 1B8IB 1V5EA 3BG5A 2M30A 4G6DA 4G8XA 2QLZA 3G1LA 4XLHA 2MLGA 4BYYA 4ABZA 1IAWA 4O3MA 3I4NJ 3WHCA 2QM3A 1MMGA 2D1HA 3V42A 3ZN1A 2MD0A 4DGWB 2DA5A 4X0GA 5E17F 2LBFB 1EKEA 2EIKH 3S3NA 2IVMA 4UVAA 5H6QA 3CQZJ 5BPIA 2F2EA 2LLKA 2NVQJ 2KKOA 2ETHA 5F1RA 3I59B 3S1NJ 3FXLA 3PSIA 2CUZA 2VB6A 3CP2A 1QNTA 1IO2A 3ZXSA 1BN5A 4XKWA 1ETXA 4QIWN 3BDDA 2V9PA 3IV5A 4G94A 3BR1A 3WTTC 2JJ7A 3LSTA 2L3DA 2O5RA 3CJTB 3HDDA 4ZDPA 1ETYA 2W1OA 1KONA 2O03A 1YHQI 3MZHA 3HGYA 2OZ6A 3KPHA 2W82A 2R7ZJ 2E71A 3R4KA 1U5TB 4QPQA 3FBIB 4BE0A 1JUMA 4Y15A 1VFCA 3QU6A 4Q48A 4HF0A 1FWZA 3JR9A 3C2HA 3HTSB 2R7WA 2KRHA 4M6XA 1FTTA 4V2GA 5E79C 5EZGA 4LK1F 2COBA 2BXYA 5EZHA 5CQGA 4I0BA 5C4JJ 2GQQA 4FTHA 1ZGAA 2F5DA 5EF6A 4KISA 3K70D 3CJRB 3WG9A 1LKXA 2P6SA 4OIPF 4WCGA 2Q2EA 3K70C 3GFJA 4DOZA 2CUEA 4QLCU 3RJPA 4IRIA 4C30A 1N75A 1K6OA 5HLHA 1XMXA 3EQLF 2QQAA 4BJTA 1SVMA 3F0CA 2V1DA 1Y39A 4A5MA 4EGYA 4IOCF 1K61A 1D3YA 2IGNA 3HRTA 5B1AH 1FOYA 1IRZA 1R49A 3BG9A 1ERDA 1X3ZB 4U0WA 3RZDJ 2VN2A 4KIFA 5B66C 2HU9A 2K85A 2WA0A 4EM1A 1SAUA 2V1NA 3OYNA 2O9LA 5D6EA 3RPUD 2WBMA 1EF4A 5ILUA 2PI0A 5JHUA 4GYGA 3BY6A 1FYMA 4C3JJ 2MSYA 4XLEA 1OYIA 2DBBA 5F0HA 3FK7A 2JN6A 5IT3A 2HOTA 1T98A 1NHAA 2DPUA 2TDXA 1FBSA 2E36A 5DUKA 4CH7A 2OCEA 3DV8A 4OINF 4YFKF 3CCQI 3P9KA 5TGTA 2ZXWH 3OOUA 4UUTA 4UY8I 2STTA 3BC8A 1TLHB 1U2WA 1IXSB 3TW6A 1WJ5A 3WTYC 2PLYA 5B1BH 3O3KA 4XK4A 5HOOA 1F4KA 2EA4A 1K79A 2XUBA 3WHBA 2CYYA 2MC4A 1YIJI 1OCPA 3T0YA 1ETVA 1VF9A 3BJOA 2L9NA 3HM5A 3VPRA 3ROUA 2RNGA 2JSCA 2JA2A 2OCCH 1QPIA 4I02A 2UV1A 2RDPA 1QBJA 2RKHA 1BOBA 4Y7NJ 5H2FC 4MTDA 3C2BA 2FSWA 4M74A 3M8FA 3K7AJ 3PL8A 2Q0OA 3C1DA 4D7MA 4BNCA 2IS4A 2L7MP 4NHJA 3CCYA 4AIDA 2DTZA 4P55A 2E1MC 3UKGA 3ECHA 2EIMH 3OIOA 2ZJQF 1S7EA 4CCLA 1XSVA 2M5WA 2VIXA 2NS8A 4IF4A 2QKMB 1LNWA 2LTPA 3J80Z 2KZGA 3FXUA 2X6OA 4BQNA 2R5YA 4PK4A 4HAMA 4HQEA 4HA8A 4D7NA 4L5EA 1Z67A 1ZG1A 4B8XA 2MH2A 2RVCA 2EILH 1DQUA 2MW8A 5B5EC 1BL0A 3KFWX 1GVJA 4OMYA 3HOXJ 1LDDA 1XS9A 3MKZA 4EJTA 1TP4A 1WSUA 2L4AA 1YRNA 4XQFA 2VKHA 1GV2A 4FX4A 3TO9A 1NK3P 1W7PD 3FDYA 1Z05A 3JAMZ 2KPMA 1MW7A 3R60A 5FFXA 1S72I 4BQQA 3GLXA 3K4LA 2HYJA 1LE8B 2K40A 2UXNA 3LQRA 4CDGA 4FASD 1I1SA 1MBEA 1NG7A 5DV5A 2JVHA 2HPIA 2NS0A 4ENMA 4KICA 2ID6A 3F21A 1FT9A 2YPRA 2PEXA 3J81Z 1G4DA 1GUUA 2JTVA 5JVTA 4M3BA 3S16J 4HX4A 4RB2C 5D8LB 3GLLA 4HYEA 4CCOA 3K2ZA 1TQPA 2DFHA 3HRSA 3QYFA 4MO7A 2BY3A 2OPTA 3K1NA 4M73A 1XGMA 4PZJA 2XAHA 2VQHA 1BBYA 1P4WA 1JGSA 1D1AA 2KQRA 4D5CA 1KGSA 4ESFA 1TBXA 3FKJA 3DF8A 3VEPA 5KNLA 1MNMC 3R0JA 2E2IJ 1VNDA 4MIMA 2WY7Q 3QU3A 4A3EJ 2L54A 3DTEA 5ICGA 5LBQA 1BJAA 2IW5A 3LFKA 1Y0NA 3QWLA 3QP5A 1A04A 5DD4A 2DA1A 4R8HA 4Q4ZF 4BKXA 4ZZDA 3L2RA 4BL0B 4I99C 1PJRA 1R5ID 1Y8QB 2AQEA 3QYEA 2HXIA 2P8TA 4B48A 1E0EA 1HKTA 1O57A 1W1WE 3KLOA 3BZKA 3GFIA 2XAJA 4XICA 3BJ6A 1CF7A 3IAS2 3ZQLA 2FF4A 2QQ9A 3CUQA 3GFMA 2F5CA 1HXDA 4ENNA 1WKMA 3BTIA 2HYGD 3RQ4A 2Y9ZA 2E1NA 5LRRA 1CQTA 2IS6A 1QHHD 3GTJJ 1IV8A 3BR0A 2RN7A 5D4SA 1UCRA 2DODA 3EDPA 1YFHA 4GDFA 4CXFA 3IUOA 3C18A 2W7NA 4LIVA 2NVYJ 4IKFA 1D5VA 1RPWA 3FMSA 4DQ2A 3CCEI 1WJBA 3I4MJ 3BZ6A 1LJ9A 4A2UA 4BAYA 3F6OA 4A69C 1PP7U 3RTRA 1OLTA 5J1YA 1IN8A 2N8GA 2EV0A 1S3JA 4Z6YA 2K3FA 1X19A 5FJ8J 3H9JA 1LDKB 5LGNA 1JJ8C 1BW5A 3BLYA 2B63J 2QCOA 3HRMA 4M3FA 5LRSA 1LQ1A 1HDPA 2XDVA 3OSGA 2W4SA 4OIOF 3LA3A 5LHGA 3DQVC 2Q2EB 1X58A 2R7VA 2RQPA 1XB4A 5KCMA 3OL3A 1FP2A 3LOCA 3HOUJ 3MKLA 4RM3A 2RC4A 2FU4A 5DEQA 2F48A 2HVQA 2DQLA 2Z5UA 3W6KB 4CGZA 2H8WA 1X3WB 1OJLA 1R58A 1U8RA 3HEFA 3WG7H 2G9WA 4PGHA 9ANTA 3GTMJ 1FJLA 5C4XJ 3BG6A 4OWRB 2IS1A 1BJZA 4NNJA 3CC2I 2HWVA 3HIFA 3RZOJ 4QSHA 3J7ZI 4PFOA 3KEOA 4HNVA 3J81K 2E1OA 3V7SA 4I7HA 1LPQA 5HDKA 3CCMI 4L9NA 4RGUA 3ASOH 1WHUA 3R61A 1FMVA 4BGDA 5EG0A 3MFKA 3IKVA 4OAYA 4A3LJ 4XLFA 2K02A 2KL4A 3H0GJ 2X85A 2XAFA 2JZYA 4UB8C 2WV1A 1BC7C 4W1UA 4A0ZA 2ECCA 2VC1A 3K2AA 3VYUB 2KDZA 2HTSA 2BHYA 4IHWA 3TDZC 1WVRA 4F3QA 1UHWA 1KYZA 4RS8A 1LVAA 2ZFWA 3Q3SA 2R7RA 1HBXG 4DBQA 3J7AY 5IYDJ 1NTCA 4I0AA 5E3NA 2J5OA 3HOZJ 1IDYA 2R5ZA 1R1VA 3NQOA 2VQGA 4M3GA 3WE2A 1YITI 2EZHA 4ASNA 1TWCJ 3RYRA 3KEYA 1DP3A 1I6HJ 2VI6A 2OBPA 3K6GA 1XG1A 2PN6A 2L7FP 3QPSA 1H89C 3G73A 4M72A 1YX5A 3I58A 2M7BA 1BI3A 3IKTA 3KP6A 4YEJA 1BIBA 4XSXF 1GLNA 1FC3A 2K5CA 3PNTA 4KT6A 1K6YA 3CTAA 3G1MA 3K4NA 4NC6A 4CCJA 3PUFA 2G0EA 5FRMA 1V55H 1YW8A 4Y33A 5FLVA 2DTRA 3AG4H 1N25A 5ILVA 4K2EA 1UELB 2NAZA 1WJCA 3K9TA 3L1PA 1YQAA 4PJNA 3N97A 2H94A 2DCEA 1L0OC 2KLOA 3K1MA 3IC7A 3ZQGA 5M5WJ 2E60A 2IP2A 2IAIA 1VQ4I 1D0XA 3L7WA 1MJ9A 2IGOA 2ZSIB 1FIPA 1U5TC 3RKQA 5HS7A 2FOKA 1VQLI 1BIAA 4HX7A 4E6KG 3A01A 3MD2A 1QQIA 2G7UA 1R7JA 2F4OB 3TO7A 3S2WA 3QOPA 3I71A 1S6LA 3IH2A 3IWZA 3ONQA 3PIPF 3ECOA 4CYDA 1YRNB 5CPRB 2LFBA 4L18B 1DPRA 3GMEA 4UV9A 4ZH4F 2XPVA 4BJ6C 5FLXK 1TT0A 2ISZA 3H9GA 3CZ6A 4UUSA 1OYYA 3ZQHA 3DKXA 4LK0F 4BE2A 3DKWA 1MJAA 1BR1A 1BA5A 4BY7J 5JFRA 3SDGA 2E2JJ 3GO5A 1EJ9A 4OOIA 4M6YA 1TC3C 4XRSG 1F36A 5K5RA 2CV0A 4HPQA 4RDUA 3VYRB 1MSFC 4IHSA 5J8FA 2OA4A 1JKQC 5DCMA 1YW7A 1XCBA 2V1UA 1PP8F 2O61A 2PJPA 2B9SA 3OYDA 2GIZA 2BOLA 5HDNA 1H9TA 2R7TA 1QO0D 2PMHA 4A93J 1EH7A 1LUJB 1JT6A 4CUGA 4ZYDA 1TL8A 1XSDA 1LEBA 1O4XA 1R1TA 1XC5A 2W57A 2E5ZA 4UVCA 2K86A 4BEHA 2CFXA 1XSXA 2V6CA 3FBNB 3UR3C 2VJIA 1GVDA 2A5WA 4BXFA 1TQIA 1JUPA 2WB1N 4RLFA 3DBRB 5FKNA 3JTHA 2H27A 3E3VA 3QRFF 4XMYA 1W36D 4FQGA 1ZTRA 2EFNA 2OUMA 4XNFA 3Q0VA 1WGXA 4DNCA 4YFNF 3L09A 2FNPA 2H09A 1ZQ3P 1RETA 2P5LC 2O8XA 1W4MA 2EQRA 3AL0B 2DJNA 3COAC 1CF7B 3PUBA 3BOQA 2DMNA 1J5YA 4LG0A 2JMWA 5FKOA 3CUQB 4NB5A 2GXGA 3VDXA 4U7DA 3HGGA 1SD6A 3OYHA 2E35A 1TWGJ 3I3LA 1B6AA 4N4NB 2ME6A 2ADUA 2O0YA 3KP2A 3WGGA 4BBRJ 3S2DJ 2P81A 3HKZA 2WAFA 1JTYA 2XVCA 2WY8Q 3I55I 1KU3A 4XM3A 3PO2J 1SEUA 1QRYA 3GCMA 2DLLA 1JT0A 1Z1DA 2IBDA 2ESNA 2DYRH 2XGEA 3GUDA 2CGPA 5B3SH 3ERMA 3PQJA 2HDWA 4A3FJ 1U78A 3BQYA 1H9GA 2V4JC 3LSJA 1R4MB 4P1WA 4XONA 3M8EA 2XIGA 1N77A 5ILSA 1TTYA 1UFMA 2OF7A 3FMQA 3VFZA 2EV6A 3F23A 3LNQA 1O3SA 3C3WA 3DTIA 3FXOA 2IA2A 2V79A 2JA5J 2CH0A 2Z16A 4IX7A 5F27A 2GLOA 3ASNH 3MKWB 3GW2A 1MJBA 3B02A 3TL4X 3N4MA 1FSHA 1V3FA 2BBYA 1JTXA 1D8KA 1D5YA 3MQ0A 2FEZA 1IG7A 2C6YA 3A0HC 1H88C 1N78A 5FB2A 5HLGA 2DT5A 2DFIA 2L02A 3KYCB 5L3FA 4C2UA 3QQAA 1A36A 2F6CA 4XORA 3W6VA 2DOAA 5HLTA 4DIQA 4RGXA 3W2WA 1ZREA 1LFUP 1ULYA 4AYBN 1ZLKA 1R6RA 1WFXA 2EFPA 4N9IA 3J7AO 5LHHA 2VKVA 3EETA 1IN5A 2HDCA 2M8EA 4RBOA 3KCCA 5EG0B 3FHNA 4PFPA 1IF1A 3ESWB 4HW0A 4BU2A 1RKWA 5FKMA 4MEXF 2EFQA 1B9NA 2EZKA 3H0DA 3CDHA 1IW7F 2PX9A 2VL8A 4CYCA 1AU7A 1Z6RA 2LK2A 1AHDP 4C3HJ 1RESA 1FMWA 3OMYA 4HX8A 3HOSA 1M1EB 5L3GA 3I64A 1FOWA 2LKPA 5E1WA 3BTJA 1T0FC 3SXYA 5GTHC 5DCFA 2R5ZB 2K4JA 2L7ZA 2LY9A 3HZJA 5FROA 5DM6F 2AHQA 2ACJA 4JYKA 4YIRX 2ZNZA 3JTGA 1MGTA 3DU6A 4EGZA 2BVLA 1YLFA 2VLAA 4BH9A 2P5VA 1X1PA 4IZZA 3DKYA 3LAJA 3A2KA 3OYLA 4Y17A 2YSRA 2DW4A 3E5XA 3HC7A 4A0XA 3F9KA 1MIJA 4XRSA 1R71A 3S2HJ 2L7KA 3P7NA 4RA2A 1REPC 4A3JJ 2BW3A 4MQ9F 2DA2A 2GAUA 4DZPA 4RAZA 2VXZA 2JA8J 2EB7A 3I0TA 2K4BA 1WJEA 2OU2A 2L9VA 3I4PA 1Y6IA 4LIUA 4NQWA 4JOMA 3CJNA 2Y0MA 2LY2A 4I76A 4ON0A 3L2UA 4OIRF 2QA4I 2IPQX 3F8BA 3ZMSA 3KP3A 1PUEE 2ZSHB 4XBFA 1G3YA 4GGGA 4C9YA 3A01B 1Z7LA 4AC0A 3K4BA 1V4RA 1P4XA 3KIOA 4ZYAA 1XDUA 2X48A 3MCZA 2L9SA 3RQIA 4MEYF 2ISYA 2ZNYA 5GAGJ 3QPHA 3JRFA 1GXQA 2Y0SN 1IUFA 3X2QH 5BOXA 1RZ4A 4YRVA 4UUSB 1PUFA 2WAEA 3W2VA 3SJMA 2WC2A 4CSWA 4E7JA 3GZNB 3CC7I 2XSJC 4PSWA 1GXPA 5IP7J 2ZC2A 1FBUA 1FX7A 3S17J 1UHMA 3JRCA 1S5LC 2ESHA 4IHYA 1F5TA 5FO5A 3CLQA 1U6GA 1MBKA 2Y30A 3ABKH 3BCBA 3U9GA 3JRBA 1FPQA 2Y31A 4BE1A 3WE3A 1ZR4A 1LDJA 4BQAA 2M0CA 1WI3A 3S32A 1SMYF 5DCMB 1IC8A 1JKRC 2A6TA 2JK3A 1B4AA 3CJQB 4FX0A 4KJZA 2ELKA 2AS5F 2MABA 5HNFA 3OS2A 2K7LA 3BR5A 1FIAA 2EWNA 2YS9A 3CMEI 2JA6J 3TW7A 3ZCOA 3GZ6A 3FXJA 2UUZA 1W0UA 2MD5A 1ITYA 4BEHB 4LB5A 3DCFA 3T8RA 2CQNA 3IWFA 3NRVA 1KQ9A 3OS0A 1X1AA 1IDZA 1UJ8A 1AKHA 1K83J 1XD7A 4EJUA 2VE8A 3DP7A 2RREA 2X6XA 3ULQB 2PMUA 1MSEC 2NOGA 3JRDA 1I3QJ 4AIKA 1ZARA 3J7YJ 3S8PA 3VYTB 5CQEA 2OZUA 2NNYA 4L9JA 1D8JA 5K7ZA 3SQNA 2XSDC 5EEHA 5L3EA 3AG3H 4OMZA 2VJJA 1W5CC 1T08B 1Z3XA 3H36A 4U0VA 4BXUA 3D5SC 1WH7A 5L3BA 2HQAA 4U7BA 1V54H 4DJAA 3GWZA 2F4IA 1O7FA 1MH4A 2CRGA 4A3IJ 1HSJA 3H5AA 4XKCA 4BHCA 4HNUA 2NVXJ 2YX4A 2ZBKA 4LG0B 4BY1J 3HPGA 2AQFA 2M3AA 3VSKA 1A6IA 4ZYEA 4JBAA 4MQVA 4H0EA 2MG4A 3ZMUA 2DMUA 1KQ0A 1A5JA 2DJIA 3S15J 2QF7A 3A1YA 1PVEA 4LJZF 1ZRDA 4HOBA 4EV0A 3RDIA 3OYEA 4NC8A 2FQ3A 3KEQA 2LF8A 3P9CA 3OS1A 2QYOA 2UWMA 2XAGA 3FWEA 4FT8A 2HKXA 4PJLA 4RB3C 2Z99A 5E3MA 1R5GA 5GTIC 2KIQA 4II2A 1ZELA 2VONA 4IOAF 2R7XA 3KZIC 2IA1A 1VI0A 4I09A 2VPRA 1GT0C 2P7VB 2V26A 1TW3A 3OR2C 4L5IA 4L9VA 1E3PA 4WXHA 4XKBA 1QA6A 3S14J 2O8KA 1ZR2A 1ACIA 4ZTFA 3F6VA 4OAZA 4PJJA 1QHGA 1HOMA 2FQ4A 2VJ5A 4B3AA 3BTLA 4PCQA 1XCVA 1WPKA 4RB0A 3IRQA 3I56I 2HR3A 2R7SA 3OYMA 4FCYA 4A0YA 1UG2A 4D1QA 3QAHA 3PO3J 2B0LA 3L2WA 2CS3A 1RIOH 5J8CA 1X1CA 2X4HA 2KRFA 3KZYA 2XV4S 1BI1A 2EINH 2LMDA 3VYSB 1YYVA 3OYAA 1WJDA 2MYSA 4Y52J 2IRFG 5J47A 3GFLA 5TJJA 4XIDA 2CV2A 4LLGF 3PM1A 2VBYA 2VUMJ 1XN7A 4GCVA 2XF5A 1BW6A 2JVGA 2EA2A 2MGQA 5GPAA 1P92A 2LH9A 1P9QC 2Y2ZA 3DPUA 4XN0A 1HKSA 3OYJA 2CO5A 1D1CA 3P5JA 1JKOC 2CQQA 1TNSA 4ZTJA 1Z9CA 4BHBA 5LEJA 2ZXJA 2DU9A 1J7KA 2X0LA 3LMMA 2EFWA 1R36A 5E1ZB 3TKYA 3BWGA 4U0YA 2Z2SB 3LSGA 2B7EA 2ZJRF 4CYCB 3S1MJ 3TBIA 5KAIC 2KIFA 5CVVA 3KZZA 2PJRA 3TMOA 2E2HJ 5ED4A 4F91B 1J0RA 2DA4A 1F9NA 1BI0A 2BY0A 3TOAA 5C3EJ 4M9SA 1OCOH 3BR6A 3WTUC 1D1BA 5FLXZ 5E1XA 1AA7A 2HFHA 4LITA 5CYVA 3NEUA 5ICCA 2FMLA 1ZGJA 3AL0C 3GTLJ 4E4HA 2HOEA 1IN4A 3CUQC 3JRIA 3M4OJ 3BG7A 2QSHX 4EM2A 1VQNI 3AG1H 3D5LA 4OU0A 4KYWA 1X4PA 2KP6A 4HNTA 2L2OA 1FBQA 3SZTA 2UXXA 1V5GA 2BW3B 5HODA 2XC7A 2HPMA 1Q1HA 4M3EA 4RGRA 3JCUC 2E19A 4FISA 5CVIA 2DDBA 2ZFUA 1T95A 2V9KA 3IRRA 1UAAA 2PQ8A 2IGKA 4NQWB 3SDBA 2O7OA 5K5QA 4S04A 2EZLA 2P4WA 2TRTA 4E7LA 4KN4X 2VQCA 3P9IA 4I98B 4D5FA 3CCUI 2K3PA 4EVIA 1IRFA 2EBIA 4LLLA 1SMTA 3ZGKA 2ELHA 2QQ8A 2LKXA 4LLNA 1XMAA 1AOYA 4UV8A 4QWQA 4HF2A 1I39A 2FUG2 3G6EI 2BZTA 4CCNA 1QZYA 5J6XA 3M9AA 1VQKI 4E7IA 2GOMA 3IHUA 1Z6TA 2CQ7A 2Y69H 1YE9A 3B73A 4UB6C 5JI6A 3KYLA 2ZJPF 4C3IJ 1T6SA 1YS7A 2R7QA 1MMAA 1RRJA 3HTUA 1JUSA 3K4MA 1PUFB 3CC4I 5D5XB 3K10A 4ENJA 4GXOA 1JGGA 2HNHA 4RB1A 3M1EA 3D1NI 4JX4A 2QKLB 2XKOA 5F08A 4AVPA 4XR6A 4R1HA 5D5UB 3DEUA 1T2KA 1DU0A 4N4OB 1I3AA 2HYFA 4E7KA 3DEWA 3FM3A 3LA7A 2HGCA 5D4RA 5ICEA 3KETA 4AUXA 1SFKA 2HTJA 4HV6A 5KVRA 5JR3A 2X1DA 1KU9A 1O3RA 3F72A 4UXNA 1R00A 4MFDA 4MGRA 4KIBA 4F55A 3DBHB 5FKKA 2OQGA 1SVLA 1PDNC 3CUOA 1U3EM 1X1DA 2DMPA 4IO9F 4O6JA 1PYVA 1DU6A 1TWAJ 4R79A 5FKLA 1YTYA 2XGXA 1I5ZA 5E3OA 5EGOA 1AKHB 1NG6A 4B4CA 2GBYA 3CESA 1OQYA 3OR1C 4IQ4A 3RI4A 3HSFA 2F4MB 1RR8C 2VJ4A 4KUMA 3ZQQA 5E8GA 1X3UA 3FXQA 5BMZA 2VQLA 3EYYA 2ZB9A 1P6RA 2W48A 3KP5A 1RC9A 1Z77A 4CCKA 3JSOA 2MH9A 2XROA 2XB0X 2XGCA 4LOCA 1J2XA 1WRJA 1D0YA 4PJ0C 5LEKA 4F92B 1J9IA 1IJWC 1S7OA 3OYIA 3NWSA 4ZC3A 2WWYA 3CCSI 3ERED 1JI8A 1E2XA 1UMQA 3CCRI 1SVOA 1TWFJ 3FXMA 3VB2A 4HBLA 3RKWA 1HQCA 3BP8A 3E97A 3F8MA 3VODA 2FX0A 3PFIA 2KIMA 1ETKA 1ETQA 1P7JA 3BCAA 5AIPA 2PBIA 1X4OA 4HLXA 2TCTA 3G71I 1E3HA 5EYRA 4ENKA 3CLOA 2IXSA 1TNTA 4DYRA 4C2MJ 1ZAOA 2K9NA 4XLPF 2CSOA 1OR7C 4M9ZA 5HLIA 3VOEA 3TP3A 1VQOI 2BV6A 4F52A 5HNHA 1YOVB 2MA3A 1Q1VA 2JQ7A 3VSLA 2MFZA 3C7JA 2H1KA 4NDLA 5AIQA 4L0ZB 4ZDOA 3S93A 1O3QA 4XLAA 5BNGA 2FE3A 2CW0F 3HBLA 3MWMA 3L9FA 2A61A 5M5XJ 4OIQF 4ESJA 3IP4B 2XF7A 4YG2F 5A2QZ 1ZHFA 3H1CA 2LVSA 2RNJA 3HOVJ 3HB9A 5JLWA 1NK2P 1Y0UA 3SFIA 2J5PA 4IEJA 3CO6C 4HV5A 3EUKL 2GA2A 2HVRA 4C2TA 3FZVA 4JK1X 2LR8A 5TISC 2EV5A 2KJBA 2Y75A 4FETA 5CLSA 2LKSA 1W36C 1KU7A 4RAGA 3ZR8X 2M4GA 3EUHC 5GADJ 1TQMA 4EJVA 3HSRA 4I01A 2W25A 1U8BA 3PSFA 3G2BA 2M87A 2NRAC 1LFPA 1USTA 4F7ZA 3HG9A 1ZKGA 3E6CC 4KMUX 2GZWA 5K7HA 1TZLA 1AWCA 1KA8A 2KZVA 4UHTA 3TO6A 2ELJA 3E0JB 1MMDA 2CMPA 2EH3A 4UVBA 1YI2I 4IHXA 3QYBA 1XX5A 4PSXA 4RAYA 3MAJA 4ZDLA 2OV7A 4D0PA 1SD5A 2DYSH 1K78A 3OIPA 1ZRCA 3H5RA 1KU2A 2ECBA 2YUSA 2DK5A 4G6QA 4MFEA 3KE2A 1W5SA 3E7LA 1IZ1A 3NARA 2PJRB 1RKTA 4II3A 1K7AA 2LREA 3H35A 2R0QC 4A12A 2ZMEA 2Y48A 3F8NA 3V4GA 3U1DA 5KHDA 4AU7A 2L0KA 3FISA 3FMRA 3KYDB 5H6RA 3TP0A 4E7SA 1JE8A 3A4CA 3GX4X 4KT5C 3CMMA 1Z0XA 2L9RA 1VQMI 2QUFA 2BE5F 1A6QA 2DA7A 1ON2A 1OKRA 1IRGA 2LG4A 2CU7A 3E5QA 5F6FA 3CO7C 3MZYA 2DK8A 1QZEA 1WJAA 5EDNA 1FYLA 2VBXA 1W5TA 2ZXIA 1UG0A 3IH4A 4AWXB 2M2EA 3RPQA 2LYCA 1ZN2A 1IXRC 2E5NA 2XAQA 2HZDA 3A02A 4PGGA 4L9TA 2HOSA 2XRLA 2DFFA 3W3CA 3TDUC 4ANJA 4FE7A 4BS9A 2H6CA 3BTCA 3DXJF 1MNEA 2HS5A 5D5WB 3KLNA 2K9MA 3HOTA 4XOTA 1KYWA 1R9TJ 2GWRA 2R7FA 1ZYRF 5DUIA 4HG2A 2DDAA 3M8JA 2V7FA 3K4CA 4LGWA 3C2GA 1JJ6C 1G8XA 2LD5A 3K0LA 2LP0A 3PNVA 5IYCJ 5HS9A 3JRAA 2H6BA 3DEEA 4LB6B 4B09A 1ZLJA 1R4NB 4B43A 1DGRM 5M3FJ 2IEKA 2DMTA 1Z91A 2XHKA 2VODA 2M34A 2XRNA 3ZMTA 2DN0A 3OOPA 5EJCA 3FM5A 1K4TA 5A2QK 3A03A 4WX9A 4YIIA 2GA1A 1K4SA 1YO5C 2M45A 1IV6A 4QPOA 4CO8A 3HL2A 2HDDA 4A3KJ 3DLLF 2JPBA 4LD5A 3CCJI 4TV7A 2AO9A 1YJNI 2MLKA 2DPDA 1GHCA 4G6TB 3QPTA 2BY1A 2JUCA 4N9HA 2EZIA 3GBGA 3BPVA 3MVPA 5LGUA 3S3OA 1O7LA 2BVMA 5D5VB 5GP9A 1HW2A 3CDLA 4AM3A 5F64A 2ZO4A 2CUFA 1QVTA 4W97A 4CHUA 2XASA 3LAPA 4A3DJ 4B47A 3FX3A 3L2VA 3JSPA 4J01A 3DLAA 1S9HA 3M3YJ 3MZ8A 2KDOA 3RPUA 3ZP5A 4KNYA 2GXBA 2QGUA 1R23A 2L5QA 5EGOB 2A6HF 2QENA 3M1CA 3BQZA 2FOWA 3TOBA 4Q47A 2CW7A 3K69A 4AD9A 2E1CA 1XMKA 4DBRA 3QOEA 1G59A 1USSA 4CICA 2W84A 4EQQA
chains in the Genus database with same CATH topology
1XPXA 2LMDA 1MIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPX A;  2LMD A;  1MIJ A; 
#chains in the Genus database with same CATH topology
 3CD6 I;  4Z2Y A;  4GFB A;  3B6A A;  5GAE J;  4D9J A;  3BR3 A;  2X9D A;  1NH3 A;  2FBI A;  3H5N A;  5GPC A;  2R4G A;  5CVR A;  3ZN0 A;  3FKI J;  5IPA A;  4BQO A;  4ZZL A;  4JQF A;  3JRE A;  1T56 A;  4BAC A;  1JHF A;  3FK6 A;  4P5O A;  4MNU A;  1T39 A;  2CUJ A;  2KT0 A;  2KIU A;  1J75 A;  3HYI A;  1R1U A;  4KN7 X;  2CQX A;  5K1Y A;  3HXL A;  3ABT A;  1T33 A;  2DFE A;  3ML6 A;  2I10 A;  2QBY A;  4HDV A;  1QGP A;  2LSO A;  5CJ9 A;  3ZQI A;  3IH3 A;  4G12 A;  4NBQ A;  5LGT A;  3RKY A;  1MMN A;  3HOW J;  3SFZ A;  1R22 A;  3F8F A;  2ICW G;  2FRH A;  3NWT A;  1C0W A;  2VT3 A;  1E17 A;  3CMY A;  4S05 A;  2EK5 A;  1VQ8 I;  1MBG A;  3OY9 A;  3SYT A;  2A69 F;  2Q8K A;  2FBH A;  3ELK A;  2WB1 A;  4EJO A;  1RI7 A;  2QWW A;  4ITV A;  3GTP J;  1BM9 A;  1G2H A;  2F5F A;  3B6C A;  1WCM J;  3I53 A;  5CKT A;  2OTJ I;  1VTN C;  2A07 F;  1QVU A;  2O6G E;  3EUA A;  3LFU A;  3HHG A;  3MN2 A;  3DTK A;  4UNO A;  4RM2 A;  1SFO J;  3BRO A;  1RUO A;  3H92 A;  4BXX J;  3NAU A;  1IXC A;  2DQR A;  4A3C J;  1F43 A;  2DT6 A;  4YEL A;  1MND A;  1QPM A;  1ODD A;  2BYV E;  4G7O F;  1UHS A;  1W7P A;  4HZF A;  2F5V A;  3RSN A;  2WAQ N;  4PJM A;  3R6S A;  1EH6 A;  2PMZ N;  3HJE A;  4WK8 F;  3R0A A;  3W6J B;  3L00 A;  5BS6 A;  2ZKZ A;  3L2C A;  2BEO A;  4A3M J;  2K27 A;  5LD2 C;  2JT1 A;  1FNN A;  5K5O A;  3LSR A;  1YJW I;  2JWT A;  1ZH5 A;  4CZZ A;  3GEZ A;  4RLQ A;  2EPF A;  3HOY J;  4IVN A;  2EJR A;  4IL6 C;  3WTX C;  5LFA A;  1HCR A;  4Y4R A;  2FA5 A;  2FJ1 A;  1X1B A;  4JP0 A;  4LMY A;  4L0Y B;  2HKO A;  5D6F A;  2JRM A;  4BHP A;  5M3M J;  5J1R A;  5DM7 F;  1OPC A;  5IT9 Z;  4A6D A;  5E3L A;  2M7A A;  3PJR A;  2GIV A;  2JSP A;  3LSK A;  3T1B A;  1OIS A;  4J00 A;  2A68 F;  3WU0 A;  1K78 B;  5J1U A;  2VPL A;  3Q9S A;  2BY2 A;  4HDU A;  3SZG A;  4RAF A;  1WH5 A;  3H3Z A;  2K9S A;  2ZME B;  4CZC A;  1MBF A;  5JLX A;  1YG2 A;  4E70 A;  3AKZ A;  2Z1D A;  1X2M A;  2E34 A;  2OD5 A;  2QEX I;  4IQJ A;  1A35 A;  1STZ A;  2JA7 J;  1IGN A;  3N05 A;  5BQT A;  1XTA A;  4HSR A;  1UB9 A;  2F5E A;  1I50 J;  4U88 A;  1OMI A;  4NUB A;  4M3D A;  1G3T A;  3GYH X;  3ZQC A;  2GM4 A;  1ZG3 A;  5E8I A;  5E20 A;  4ZJZ A;  2DT7 B;  2VBW A;  1B9M A;  1SD7 A;  3OWT A;  3WGI A;  1FTZ A;  2IA0 A;  1E3O C;  3HUG A;  5TRD A;  2VC0 A;  4LFU A;  2D1V A;  4WWC A;  3QPL A;  4IRG A;  1MD0 A;  1L3L A;  2XPW A;  1Y1W J;  5J4V A;  4AYB A;  1CGP A;  3HPH A;  2CFO A;  1R5H A;  5DTD A;  2A3S A;  1IUY A;  4XRF A;  2M1B A;  2XAU A;  3BT9 A;  2QSG X;  1B72 A;  2ZJ2 A;  2WTE A;  4M71 A;  2NVU B;  1HW5 A;  2HXO A;  4AIH A;  2KIS A;  2I5U A;  2V9V A;  3LSP A;  1OCZ H;  3HSE A;  4XL9 A;  2AXL A;  1DGW Y;  2K9L A;  2KRC A;  3E6D A;  1JHH A;  2VT2 A;  2CJJ A;  3OYB A;  4M9X A;  3PQK A;  1O3T A;  1QU3 A;  3CF2 A;  4BUP A;  1SD4 A;  3E1S A;  4WXC A;  1MKM A;  2XGD A;  5FD6 A;  2FNA A;  1VQ6 I;  1OCC H;  1I6X A;  4G9Y A;  2VE9 A;  3Q0W A;  4P9U A;  1MH3 A;  3KX2 A;  2LOO A;  1POG A;  4A5N A;  3S1R J;  3M07 A;  2XPU A;  1MZB A;  4EAT A;  3SZP A;  3U2R A;  2NNN A;  3LSM A;  4X1E A;  2DXI A;  1RR7 A;  3DBL B;  1OCR H;  2R7U A;  2M4K A;  2RGV A;  1WQ2 A;  5DD8 A;  1I1G A;  1HLV A;  3LSH A;  2X51 A;  5FFZ A;  3JW4 A;  4KIT B;  3ABM H;  3Q5F A;  3F8C A;  2V1X A;  5DDG A;  3GF2 A;  5J40 A;  2KMU A;  2DA3 A;  4A3B J;  5L3C A;  3HRU A;  3OV8 A;  1LVK A;  2NS7 A;  2VKD A;  2MC3 A;  1S8N A;  3BPX A;  5F0F A;  2ZXH A;  2YU3 A;  4MLO A;  2HQN A;  1DUX C;  3GZ5 A;  4DZJ A;  1ZRF A;  2CV1 A;  2CQK A;  3DU5 A;  4ETS A;  1HST A;  3I9V 2;  4HF1 A;  3F22 A;  2P7C B;  5ICF A;  4M6V A;  4FE4 A;  3HKZ N;  4IPA A;  2NOJ B;  4HQM A;  1S29 A;  2OAZ A;  2R3S A;  3DWL E;  3J80 K;  3JRH A;  1SC7 A;  4P96 A;  3T8T A;  1ZGW A;  5DS9 A;  4IRH A;  3ZQF A;  1HA8 A;  3G1O A;  3ABL H;  3V8J A;  3CCL I;  3RIR A;  5AON A;  3IAM 2;  1MDM A;  3TQN A;  1B59 A;  2MBF A;  1T38 A;  4B3X A;  5IT9 K;  1H0M A;  1EH8 A;  2GOX B;  1YW9 A;  3KP4 A;  2ME0 A;  2BHZ A;  1SAN A;  3ABU A;  3O6B B;  3RYP A;  3PIO F;  3L2Q A;  2XF6 A;  2HZT A;  2LC2 A;  2Y0S A;  1OYW A;  4WF2 A;  4PDK A;  4V19 K;  1YIO A;  1SFX A;  3LL7 A;  4XKV A;  5J4Y A;  3MKY B;  3JAM K;  2Q1Z B;  4X6A J;  3ZQ7 A;  2V6E A;  5FGM A;  2L4M A;  4JX6 A;  1FOX A;  2X1E A;  2CWE A;  2L01 A;  2DOF A;  4KA4 A;  1I27 A;  3PFY A;  5H20 A;  5IP6 A;  4EM0 B;  2XKP A;  1B8I A;  2Z33 A;  1A31 A;  2CG4 A;  2RAE A;  4V2F A;  3V7R A;  3S1Q J;  1KQ8 A;  4GRI A;  1ZK8 A;  1WI9 A;  4UUV A;  2P0W A;  3OIQ A;  1FY7 A;  3U1K A;  2LBF A;  2Y9Y A;  2NXN B;  4CA0 A;  1P7I A;  3O8H A;  1OCT C;  2QQB A;  3I59 A;  1SFE A;  1WJF A;  3FIW A;  4WXD A;  4NC7 A;  3T5X A;  1XGO A;  2QBY B;  2EIJ H;  3V8K A;  3G3Z A;  2ZCW A;  4A3G J;  3S3M A;  5F1J A;  2VAS A;  1OFC X;  2LDU A;  2D45 A;  3ZPL A;  3K1P A;  3TGN A;  3CCV I;  2DI3 A;  2DMQ A;  3WTW C;  3BR2 A;  4P9F A;  1FEX A;  1U0J A;  1G3S A;  1XGN A;  2EFO A;  3MEX A;  4HEA 2;  2E1M B;  1MMS A;  5LLQ A;  3BG3 A;  2BXZ A;  1LEA A;  2HQR A;  1HF0 A;  3W2A A;  1T8I A;  3E6M A;  1TT5 B;  4YFX F;  3OYC A;  3GTO J;  2I8D A;  2YR2 A;  3WU2 C;  5F0C A;  1X2N A;  5CVJ A;  1YS6 A;  2R7D A;  1DDN A;  4PUS A;  1U5T A;  2A05 A;  4AIJ A;  4EJW A;  4KFC A;  3OL4 A;  3WOD F;  3V8L A;  2WAQ A;  3D5R C;  4JX5 A;  2PMZ A;  3OYK A;  2RQQ A;  3AFH A;  5FLM J;  3Q0U A;  3DPL C;  2VBZ A;  4E7Z A;  3WGH A;  4E7H A;  1G3W A;  5LHI A;  5C44 J;  2M0M A;  1KZH A;  3H3V K;  4G7Z F;  3FHZ A;  3OSF A;  1DPU A;  1W7P B;  5CVU A;  4L5J A;  3VWB A;  4B44 A;  1APL C;  3IL2 A;  1VQ9 I;  4XLC A;  1P4A A;  2BGC A;  1U9N A;  4U87 A;  1F1Z A;  3SEQ A;  4CCM A;  2LY1 A;  4IHT A;  5FD5 A;  5HS8 A;  2HQ5 A;  1JKP C;  2YU9 J;  1MBH A;  3QP6 A;  4HRI A;  1RUN A;  2STW A;  1J09 A;  1JXS A;  3GTG J;  2R5Y B;  2Z9O A;  4RMN A;  4HLY A;  4XLN F;  1HDD C;  1OR7 A;  1TWH J;  3DPT A;  5DYM A;  4F93 B;  2H1L A;  4IXA A;  1XGS A;  3FXR A;  1GDT A;  1BR2 A;  4ZYG A;  1IN6 A;  2G7H A;  3H9Q A;  5J3L A;  4FHT A;  2M8G X;  3WU1 B;  2UZK A;  2X6Y A;  3WTZ A;  4LG3 A;  4J19 A;  1VQP I;  4Y3O A;  5IP9 J;  1EA3 A;  5HVQ C;  2R7O A;  2HOA A;  4IJA A;  2IT0 A;  2A6E F;  4I2O A;  2VXD A;  4AVZ A;  3OYG A;  1W0T A;  2WV0 A;  2IS2 A;  2X1C A;  2DOE A;  2FMY A;  2FD5 A;  2PFB A;  4DW6 A;  2HVS A;  1ORK A;  1ON1 A;  1ONV A;  3PNY A;  5L3D A;  4MHG A;  3I54 A;  3QOD A;  4KDP A;  1ZG5 A;  1FLI A;  3I5U A;  3LSI A;  4XRM A;  3LQQ A;  1WZ2 A;  1Z21 A;  3LA2 A;  2VKE A;  3UNG C;  4G7H F;  1B1B A;  5HDG A;  1BC8 C;  1HW1 A;  3EUH A;  2KHM A;  3A0B C;  3HUG B;  4EMS A;  4BDY A;  3AAF A;  1Y1V J;  5E18 F;  1IN7 A;  2YX7 A;  5KAF C;  1YX3 A;  3Q9V A;  5IYB J;  2W85 A;  1P2F A;  2WAD A;  1S7A A;  4XN3 A;  3RCO A;  5IY5 H;  6PAX A;  1FSE A;  3BJA A;  1UZC A;  4IHV A;  2LNB A;  3RKX A;  4DYQ A;  1FYK A;  3U21 A;  1Z7U A;  2DAO A;  2H8R A;  4EEF G;  1RNL A;  1TW2 A;  5KK1 A;  2VOP A;  1B72 B;  3V7C A;  3GVA A;  1QZZ A;  3EPZ A;  2E7X A;  1ENH A;  2OTL I;  3ZMD A;  3O8G A;  3REO A;  5JVG F;  3WTS C;  4XSZ F;  3OYF A;  1XPX A;  1D0Z A;  2IGM A;  2PG4 A;  1XDS A;  3ZRG A;  3HHH A;  3WTV C;  2JPC A;  2KJC A;  4B1R A;  4N0B A;  1GV5 A;  5ERI A;  4S0H B;  4DYC A;  4QTR A;  1SAX A;  3H3U A;  1VQ7 I;  1U9O A;  3MMY B;  2R93 J;  3FXK A;  4Q5S F;  2D2W A;  3E5U A;  3E6B A;  3K4K A;  3GTQ J;  2NYX A;  4BDZ A;  2VOO A;  3DFG A;  5FRN A;  2X6W A;  3GTK J;  3CMA I;  4GO1 A;  2QZ8 A;  5K7F A;  2AXT C;  2COM A;  1VZ0 A;  4KIG A;  5D8K B;  3CF5 F;  5F04 A;  5EEA A;  3CP8 A;  1Y8R B;  1J59 A;  1FP1 D;  1YJ9 I;  1BR4 A;  2OQR A;  4HST A;  3BZC A;  2KFD A;  1LE8 A;  1MBJ A;  3D0S A;  5GAH J;  2K9Q A;  4H4K C;  1G6N A;  3GXO A;  2E7W A;  4A6E A;  4O5V A;  2QSF X;  3LWF A;  2Z3Y A;  2ID3 A;  2DA6 A;  2HEO A;  1ETO A;  4BJ5 C;  3JRG A;  3EYI A;  4BBS J;  1Z3Y A;  4XOP A;  3SHF A;  4GYI A;  2CW8 A;  4ESB A;  3G4S I;  3K4J A;  5IOY A;  1HC8 A;  2OJE D;  4MTE A;  4YIF A;  4RGS A;  2P5K A;  2R92 J;  1EV7 A;  2D5V A;  5EEG A;  1SFU A;  3M7G A;  1LFB A;  2NVT J;  1BI2 A;  3ISP A;  4ZYH A;  1HKQ A;  1IRX A;  2P6T A;  2LRD A;  1MDM B;  3CDI A;  3O2P E;  1LB2 A;  1VQ5 I;  3TED A;  2LF7 A;  2FBK A;  1ETW A;  2ZME C;  2GXA A;  1FZP B;  3ZOB A;  4Y13 A;  5M5Y J;  4KMF A;  2QVO A;  2FXA A;  3FF5 A;  1H8A C;  1WWX A;  2A5Y B;  2HI3 A;  5JHF A;  4I6Z A;  1DP7 P;  3F3X A;  2JUG A;  2O3F A;  3AG2 H;  2XB5 A;  2IJL A;  2W00 A;  5BPD A;  1Y56 A;  3KP7 A;  1T0F A;  2M9H A;  2RV8 A;  2W24 A;  1BOA A;  3SEZ A;  5IOZ A;  2DO7 A;  3ZMV A;  2JRT A;  3ZMZ A;  1FOK A;  1V5F A;  2OC6 A;  1B8I B;  1V5E A;  3BG5 A;  2M30 A;  4G6D A;  4G8X A;  2QLZ A;  3G1L A;  4XLH A;  2MLG A;  4BYY A;  4ABZ A;  1IAW A;  4O3M A;  3I4N J;  3WHC A;  2QM3 A;  1MMG A;  2D1H A;  3V42 A;  3ZN1 A;  2MD0 A;  4DGW B;  2DA5 A;  4X0G A;  5E17 F;  2LBF B;  1EKE A;  2EIK H;  3S3N A;  2IVM A;  4UVA A;  5H6Q A;  3CQZ J;  5BPI A;  2F2E A;  2LLK A;  2NVQ J;  2KKO A;  2ETH A;  5F1R A;  3I59 B;  3S1N J;  3FXL A;  3PSI A;  2CUZ A;  2VB6 A;  3CP2 A;  1QNT A;  1IO2 A;  3ZXS A;  1BN5 A;  4XKW A;  1ETX A;  4QIW N;  3BDD A;  2V9P A;  3IV5 A;  4G94 A;  3BR1 A;  3WTT C;  2JJ7 A;  3LST A;  2L3D A;  2O5R A;  3CJT B;  3HDD A;  4ZDP A;  1ETY A;  2W1O A;  1KON A;  2O03 A;  1YHQ I;  3MZH A;  3HGY A;  2OZ6 A;  3KPH A;  2W82 A;  2R7Z J;  2E71 A;  3R4K A;  1U5T B;  4QPQ A;  3FBI B;  4BE0 A;  1JUM A;  4Y15 A;  1VFC A;  3QU6 A;  4Q48 A;  4HF0 A;  1FWZ A;  3JR9 A;  3C2H A;  3HTS B;  2R7W A;  2KRH A;  4M6X A;  1FTT A;  4V2G A;  5E79 C;  5EZG A;  4LK1 F;  2COB A;  2BXY A;  5EZH A;  5CQG A;  4I0B A;  5C4J J;  2GQQ A;  4FTH A;  1ZGA A;  2F5D A;  5EF6 A;  4KIS A;  3K70 D;  3CJR B;  3WG9 A;  1LKX A;  2P6S A;  4OIP F;  4WCG A;  2Q2E A;  3K70 C;  3GFJ A;  4DOZ A;  2CUE A;  4QLC U;  3RJP A;  4IRI A;  4C30 A;  1N75 A;  1K6O A;  5HLH A;  1XMX A;  3EQL F;  2QQA A;  4BJT A;  1SVM A;  3F0C A;  2V1D A;  1Y39 A;  4A5M A;  4EGY A;  4IOC F;  1K61 A;  1D3Y A;  2IGN A;  3HRT A;  5B1A H;  1FOY A;  1IRZ A;  1R49 A;  3BG9 A;  1ERD A;  1X3Z B;  4U0W A;  3RZD J;  2VN2 A;  4KIF A;  5B66 C;  2HU9 A;  2K85 A;  2WA0 A;  4EM1 A;  1SAU A;  2V1N A;  3OYN A;  2O9L A;  5D6E A;  3RPU D;  2WBM A;  1EF4 A;  5ILU A;  2PI0 A;  5JHU A;  4GYG A;  3BY6 A;  1FYM A;  4C3J J;  2MSY A;  4XLE A;  1OYI A;  2DBB A;  5F0H A;  3FK7 A;  2JN6 A;  5IT3 A;  2HOT A;  1T98 A;  1NHA A;  2DPU A;  2TDX A;  1FBS A;  2E36 A;  5DUK A;  4CH7 A;  2OCE A;  3DV8 A;  4OIN F;  4YFK F;  3CCQ I;  3P9K A;  5TGT A;  2ZXW H;  3OOU A;  4UUT A;  4UY8 I;  2STT A;  3BC8 A;  1TLH B;  1U2W A;  1IXS B;  3TW6 A;  1WJ5 A;  3WTY C;  2PLY A;  5B1B H;  3O3K A;  4XK4 A;  5HOO A;  1F4K A;  2EA4 A;  1K79 A;  2XUB A;  3WHB A;  2CYY A;  2MC4 A;  1YIJ I;  1OCP A;  3T0Y A;  1ETV A;  1VF9 A;  3BJO A;  2L9N A;  3HM5 A;  3VPR A;  3ROU A;  2RNG A;  2JSC A;  2JA2 A;  2OCC H;  1QPI A;  4I02 A;  2UV1 A;  2RDP A;  1QBJ A;  2RKH A;  1BOB A;  4Y7N J;  5H2F C;  4MTD A;  3C2B A;  2FSW A;  4M74 A;  3M8F A;  3K7A J;  3PL8 A;  2Q0O A;  3C1D A;  4D7M A;  4BNC A;  2IS4 A;  2L7M P;  4NHJ A;  3CCY A;  4AID A;  2DTZ A;  4P55 A;  2E1M C;  3UKG A;  3ECH A;  2EIM H;  3OIO A;  2ZJQ F;  1S7E A;  4CCL A;  1XSV A;  2M5W A;  2VIX A;  2NS8 A;  4IF4 A;  2QKM B;  1LNW A;  2LTP A;  3J80 Z;  2KZG A;  3FXU A;  2X6O A;  4BQN A;  2R5Y A;  4PK4 A;  4HAM A;  4HQE A;  4HA8 A;  4D7N A;  4L5E A;  1Z67 A;  1ZG1 A;  4B8X A;  2MH2 A;  2RVC A;  2EIL H;  1DQU A;  2MW8 A;  5B5E C;  1BL0 A;  3KFW X;  1GVJ A;  4OMY A;  3HOX J;  1LDD A;  1XS9 A;  3MKZ A;  4EJT A;  1TP4 A;  1WSU A;  2L4A A;  1YRN A;  4XQF A;  2VKH A;  1GV2 A;  4FX4 A;  3TO9 A;  1NK3 P;  1W7P D;  3FDY A;  1Z05 A;  3JAM Z;  2KPM A;  1MW7 A;  3R60 A;  5FFX A;  1S72 I;  4BQQ A;  3GLX A;  3K4L A;  2HYJ A;  1LE8 B;  2K40 A;  2UXN A;  3LQR A;  4CDG A;  4FAS D;  1I1S A;  1MBE A;  1NG7 A;  5DV5 A;  2JVH A;  2HPI A;  2NS0 A;  4ENM A;  4KIC A;  2ID6 A;  3F21 A;  1FT9 A;  2YPR A;  2PEX A;  3J81 Z;  1G4D A;  1GUU A;  2JTV A;  5JVT A;  4M3B A;  3S16 J;  4HX4 A;  4RB2 C;  5D8L B;  3GLL A;  4HYE A;  4CCO A;  3K2Z A;  1TQP A;  2DFH A;  3HRS A;  3QYF A;  4MO7 A;  2BY3 A;  2OPT A;  3K1N A;  4M73 A;  1XGM A;  4PZJ A;  2XAH A;  2VQH A;  1BBY A;  1P4W A;  1JGS A;  1D1A A;  2KQR A;  4D5C A;  1KGS A;  4ESF A;  1TBX A;  3FKJ A;  3DF8 A;  3VEP A;  5KNL A;  1MNM C;  3R0J A;  2E2I J;  1VND A;  4MIM A;  2WY7 Q;  3QU3 A;  4A3E J;  2L54 A;  3DTE A;  5ICG A;  5LBQ A;  1BJA A;  2IW5 A;  3LFK A;  1Y0N A;  3QWL A;  3QP5 A;  1A04 A;  5DD4 A;  2DA1 A;  4R8H A;  4Q4Z F;  4BKX A;  4ZZD A;  3L2R A;  4BL0 B;  4I99 C;  1PJR A;  1R5I D;  1Y8Q B;  2AQE A;  3QYE A;  2HXI A;  2P8T A;  4B48 A;  1E0E A;  1HKT A;  1O57 A;  1W1W E;  3KLO A;  3BZK A;  3GFI A;  2XAJ A;  4XIC A;  3BJ6 A;  1CF7 A;  3IAS 2;  3ZQL A;  2FF4 A;  2QQ9 A;  3CUQ A;  3GFM A;  2F5C A;  1HXD A;  4ENN A;  1WKM A;  3BTI A;  2HYG D;  3RQ4 A;  2Y9Z A;  2E1N A;  5LRR A;  1CQT A;  2IS6 A;  1QHH D;  3GTJ J;  1IV8 A;  3BR0 A;  2RN7 A;  5D4S A;  1UCR A;  2DOD A;  3EDP A;  1YFH A;  4GDF A;  4CXF A;  3IUO A;  3C18 A;  2W7N A;  4LIV A;  2NVY J;  4IKF A;  1D5V A;  1RPW A;  3FMS A;  4DQ2 A;  3CCE I;  1WJB A;  3I4M J;  3BZ6 A;  1LJ9 A;  4A2U A;  4BAY A;  3F6O A;  4A69 C;  1PP7 U;  3RTR A;  1OLT A;  5J1Y A;  1IN8 A;  2N8G A;  2EV0 A;  1S3J A;  4Z6Y A;  2K3F A;  1X19 A;  5FJ8 J;  3H9J A;  1LDK B;  5LGN A;  1JJ8 C;  1BW5 A;  3BLY A;  2B63 J;  2QCO A;  3HRM A;  4M3F A;  5LRS A;  1LQ1 A;  1HDP A;  2XDV A;  3OSG A;  2W4S A;  4OIO F;  3LA3 A;  5LHG A;  3DQV C;  2Q2E B;  1X58 A;  2R7V A;  2RQP A;  1XB4 A;  5KCM A;  3OL3 A;  1FP2 A;  3LOC A;  3HOU J;  3MKL A;  4RM3 A;  2RC4 A;  2FU4 A;  5DEQ A;  2F48 A;  2HVQ A;  2DQL A;  2Z5U A;  3W6K B;  4CGZ A;  2H8W A;  1X3W B;  1OJL A;  1R58 A;  1U8R A;  3HEF A;  3WG7 H;  2G9W A;  4PGH A;  9ANT A;  3GTM J;  1FJL A;  5C4X J;  3BG6 A;  4OWR B;  2IS1 A;  1BJZ A;  4NNJ A;  3CC2 I;  2HWV A;  3HIF A;  3RZO J;  4QSH A;  3J7Z I;  4PFO A;  3KEO A;  4HNV A;  3J81 K;  2E1O A;  3V7S A;  4I7H A;  1LPQ A;  5HDK A;  3CCM I;  4L9N A;  4RGU A;  3ASO H;  1WHU A;  3R61 A;  1FMV A;  4BGD A;  5EG0 A;  3MFK A;  3IKV A;  4OAY A;  4A3L J;  4XLF A;  2K02 A;  2KL4 A;  3H0G J;  2X85 A;  2XAF A;  2JZY A;  4UB8 C;  2WV1 A;  1BC7 C;  4W1U A;  4A0Z A;  2ECC A;  2VC1 A;  3K2A A;  3VYU B;  2KDZ A;  2HTS A;  2BHY A;  4IHW A;  3TDZ C;  1WVR A;  4F3Q A;  1UHW A;  1KYZ A;  4RS8 A;  1LVA A;  2ZFW A;  3Q3S A;  2R7R A;  1HBX G;  4DBQ A;  3J7A Y;  5IYD J;  1NTC A;  4I0A A;  5E3N A;  2J5O A;  3HOZ J;  1IDY A;  2R5Z A;  1R1V A;  3NQO A;  2VQG A;  4M3G A;  3WE2 A;  1YIT I;  2EZH A;  4ASN A;  1TWC J;  3RYR A;  3KEY A;  1DP3 A;  1I6H J;  2VI6 A;  2OBP A;  3K6G A;  1XG1 A;  2PN6 A;  2L7F P;  3QPS A;  1H89 C;  3G73 A;  4M72 A;  1YX5 A;  3I58 A;  2M7B A;  1BI3 A;  3IKT A;  3KP6 A;  4YEJ A;  1BIB A;  4XSX F;  1GLN A;  1FC3 A;  2K5C A;  3PNT A;  4KT6 A;  1K6Y A;  3CTA A;  3G1M A;  3K4N A;  4NC6 A;  4CCJ A;  3PUF A;  2G0E A;  5FRM A;  1V55 H;  1YW8 A;  4Y33 A;  5FLV A;  2DTR A;  3AG4 H;  1N25 A;  5ILV A;  4K2E A;  1UEL B;  2NAZ A;  1WJC A;  3K9T A;  3L1P A;  1YQA A;  4PJN A;  3N97 A;  2H94 A;  2DCE A;  1L0O C;  2KLO A;  3K1M A;  3IC7 A;  3ZQG A;  5M5W J;  2E60 A;  2IP2 A;  2IAI A;  1VQ4 I;  1D0X A;  3L7W A;  1MJ9 A;  2IGO A;  2ZSI B;  1FIP A;  1U5T C;  3RKQ A;  5HS7 A;  2FOK A;  1VQL I;  1BIA A;  4HX7 A;  4E6K G;  3A01 A;  3MD2 A;  1QQI A;  2G7U A;  1R7J A;  2F4O B;  3TO7 A;  3S2W A;  3QOP A;  3I71 A;  1S6L A;  3IH2 A;  3IWZ A;  3ONQ A;  3PIP F;  3ECO A;  4CYD A;  1YRN B;  5CPR B;  2LFB A;  4L18 B;  1DPR A;  3GME A;  4UV9 A;  4ZH4 F;  2XPV A;  4BJ6 C;  5FLX K;  1TT0 A;  2ISZ A;  3H9G A;  3CZ6 A;  4UUS A;  1OYY A;  3ZQH A;  3DKX A;  4LK0 F;  4BE2 A;  3DKW A;  1MJA A;  1BR1 A;  1BA5 A;  4BY7 J;  5JFR A;  3SDG A;  2E2J J;  3GO5 A;  1EJ9 A;  4OOI A;  4M6Y A;  1TC3 C;  4XRS G;  1F36 A;  5K5R A;  2CV0 A;  4HPQ A;  4RDU A;  3VYR B;  1MSF C;  4IHS A;  5J8F A;  2OA4 A;  1JKQ C;  5DCM A;  1YW7 A;  1XCB A;  2V1U A;  1PP8 F;  2O61 A;  2PJP A;  2B9S A;  3OYD A;  2GIZ A;  2BOL A;  5HDN A;  1H9T A;  2R7T A;  1QO0 D;  2PMH A;  4A93 J;  1EH7 A;  1LUJ B;  1JT6 A;  4CUG A;  4ZYD A;  1TL8 A;  1XSD A;  1LEB A;  1O4X A;  1R1T A;  1XC5 A;  2W57 A;  2E5Z A;  4UVC A;  2K86 A;  4BEH A;  2CFX A;  1XSX A;  2V6C A;  3FBN B;  3UR3 C;  2VJI A;  1GVD A;  2A5W A;  4BXF A;  1TQI A;  1JUP A;  2WB1 N;  4RLF A;  3DBR B;  5FKN A;  3JTH A;  2H27 A;  3E3V A;  3QRF F;  4XMY A;  1W36 D;  4FQG A;  1ZTR A;  2EFN A;  2OUM A;  4XNF A;  3Q0V A;  1WGX A;  4DNC A;  4YFN F;  3L09 A;  2FNP A;  2H09 A;  1ZQ3 P;  1RET A;  2P5L C;  2O8X A;  1W4M A;  2EQR A;  3AL0 B;  2DJN A;  3COA C;  1CF7 B;  3PUB A;  3BOQ A;  2DMN A;  1J5Y A;  4LG0 A;  2JMW A;  5FKO A;  3CUQ B;  4NB5 A;  2GXG A;  3VDX A;  4U7D A;  3HGG A;  1SD6 A;  3OYH A;  2E35 A;  1TWG J;  3I3L A;  1B6A A;  4N4N B;  2ME6 A;  2ADU A;  2O0Y A;  3KP2 A;  3WGG A;  4BBR J;  3S2D J;  2P81 A;  3HKZ A;  2WAF A;  1JTY A;  2XVC A;  2WY8 Q;  3I55 I;  1KU3 A;  4XM3 A;  3PO2 J;  1SEU A;  1QRY A;  3GCM A;  2DLL A;  1JT0 A;  1Z1D A;  2IBD A;  2ESN A;  2DYR H;  2XGE A;  3GUD A;  2CGP A;  5B3S H;  3ERM A;  3PQJ A;  2HDW A;  4A3F J;  1U78 A;  3BQY A;  1H9G A;  2V4J C;  3LSJ A;  1R4M B;  4P1W A;  4XON A;  3M8E A;  2XIG A;  1N77 A;  5ILS A;  1TTY A;  1UFM A;  2OF7 A;  3FMQ A;  3VFZ A;  2EV6 A;  3F23 A;  3LNQ A;  1O3S A;  3C3W A;  3DTI A;  3FXO A;  2IA2 A;  2V79 A;  2JA5 J;  2CH0 A;  2Z16 A;  4IX7 A;  5F27 A;  2GLO A;  3ASN H;  3MKW B;  3GW2 A;  1MJB A;  3B02 A;  3TL4 X;  3N4M A;  1FSH A;  1V3F A;  2BBY A;  1JTX A;  1D8K A;  1D5Y A;  3MQ0 A;  2FEZ A;  1IG7 A;  2C6Y A;  3A0H C;  1H88 C;  1N78 A;  5FB2 A;  5HLG A;  2DT5 A;  2DFI A;  2L02 A;  3KYC B;  5L3F A;  4C2U A;  3QQA A;  1A36 A;  2F6C A;  4XOR A;  3W6V A;  2DOA A;  5HLT A;  4DIQ A;  4RGX A;  3W2W A;  1ZRE A;  1LFU P;  1ULY A;  4AYB N;  1ZLK A;  1R6R A;  1WFX A;  2EFP A;  4N9I A;  3J7A O;  5LHH A;  2VKV A;  3EET A;  1IN5 A;  2HDC A;  2M8E A;  4RBO A;  3KCC A;  5EG0 B;  3FHN A;  4PFP A;  1IF1 A;  3ESW B;  4HW0 A;  4BU2 A;  1RKW A;  5FKM A;  4MEX F;  2EFQ A;  1B9N A;  2EZK A;  3H0D A;  3CDH A;  1IW7 F;  2PX9 A;  2VL8 A;  4CYC A;  1AU7 A;  1Z6R A;  2LK2 A;  1AHD P;  4C3H J;  1RES A;  1FMW A;  3OMY A;  4HX8 A;  3HOS A;  1M1E B;  5L3G A;  3I64 A;  1FOW A;  2LKP A;  5E1W A;  3BTJ A;  1T0F C;  3SXY A;  5GTH C;  5DCF A;  2R5Z B;  2K4J A;  2L7Z A;  2LY9 A;  3HZJ A;  5FRO A;  5DM6 F;  2AHQ A;  2ACJ A;  4JYK A;  4YIR X;  2ZNZ A;  3JTG A;  1MGT A;  3DU6 A;  4EGZ A;  2BVL A;  1YLF A;  2VLA A;  4BH9 A;  2P5V A;  1X1P A;  4IZZ A;  3DKY A;  3LAJ A;  3A2K A;  3OYL A;  4Y17 A;  2YSR A;  2DW4 A;  3E5X A;  3HC7 A;  4A0X A;  3F9K A;  1MIJ A;  4XRS A;  1R71 A;  3S2H J;  2L7K A;  3P7N A;  4RA2 A;  1REP C;  4A3J J;  2BW3 A;  4MQ9 F;  2DA2 A;  2GAU A;  4DZP A;  4RAZ A;  2VXZ A;  2JA8 J;  2EB7 A;  3I0T A;  2K4B A;  1WJE A;  2OU2 A;  2L9V A;  3I4P A;  1Y6I A;  4LIU A;  4NQW A;  4JOM A;  3CJN A;  2Y0M A;  2LY2 A;  4I76 A;  4ON0 A;  3L2U A;  4OIR F;  2QA4 I;  2IPQ X;  3F8B A;  3ZMS A;  3KP3 A;  1PUE E;  2ZSH B;  4XBF A;  1G3Y A;  4GGG A;  4C9Y A;  3A01 B;  1Z7L A;  4AC0 A;  3K4B A;  1V4R A;  1P4X A;  3KIO A;  4ZYA A;  1XDU A;  2X48 A;  3MCZ A;  2L9S A;  3RQI A;  4MEY F;  2ISY A;  2ZNY A;  5GAG J;  3QPH A;  3JRF A;  1GXQ A;  2Y0S N;  1IUF A;  3X2Q H;  5BOX A;  1RZ4 A;  4YRV A;  4UUS B;  1PUF A;  2WAE A;  3W2V A;  3SJM A;  2WC2 A;  4CSW A;  4E7J A;  3GZN B;  3CC7 I;  2XSJ C;  4PSW A;  1GXP A;  5IP7 J;  2ZC2 A;  1FBU A;  1FX7 A;  3S17 J;  1UHM A;  3JRC A;  1S5L C;  2ESH A;  4IHY A;  1F5T A;  5FO5 A;  3CLQ A;  1U6G A;  1MBK A;  2Y30 A;  3ABK H;  3BCB A;  3U9G A;  3JRB A;  1FPQ A;  2Y31 A;  4BE1 A;  3WE3 A;  1ZR4 A;  1LDJ A;  4BQA A;  2M0C A;  1WI3 A;  3S32 A;  1SMY F;  5DCM B;  1IC8 A;  1JKR C;  2A6T A;  2JK3 A;  1B4A A;  3CJQ B;  4FX0 A;  4KJZ A;  2ELK A;  2AS5 F;  2MAB A;  5HNF A;  3OS2 A;  2K7L A;  3BR5 A;  1FIA A;  2EWN A;  2YS9 A;  3CME I;  2JA6 J;  3TW7 A;  3ZCO A;  3GZ6 A;  3FXJ A;  2UUZ A;  1W0U A;  2MD5 A;  1ITY A;  4BEH B;  4LB5 A;  3DCF A;  3T8R A;  2CQN A;  3IWF A;  3NRV A;  1KQ9 A;  3OS0 A;  1X1A A;  1IDZ A;  1UJ8 A;  1AKH A;  1K83 J;  1XD7 A;  4EJU A;  2VE8 A;  3DP7 A;  2RRE A;  2X6X A;  3ULQ B;  2PMU A;  1MSE C;  2NOG A;  3JRD A;  1I3Q J;  4AIK A;  1ZAR A;  3J7Y J;  3S8P A;  3VYT B;  5CQE A;  2OZU A;  2NNY A;  4L9J A;  1D8J A;  5K7Z A;  3SQN A;  2XSD C;  5EEH A;  5L3E A;  3AG3 H;  4OMZ A;  2VJJ A;  1W5C C;  1T08 B;  1Z3X A;  3H36 A;  4U0V A;  4BXU A;  3D5S C;  1WH7 A;  5L3B A;  2HQA A;  4U7B A;  1V54 H;  4DJA A;  3GWZ A;  2F4I A;  1O7F A;  1MH4 A;  2CRG A;  4A3I J;  1HSJ A;  3H5A A;  4XKC A;  4BHC A;  4HNU A;  2NVX J;  2YX4 A;  2ZBK A;  4LG0 B;  4BY1 J;  3HPG A;  2AQF A;  2M3A A;  3VSK A;  1A6I A;  4ZYE A;  4JBA A;  4MQV A;  4H0E A;  2MG4 A;  3ZMU A;  2DMU A;  1KQ0 A;  1A5J A;  2DJI A;  3S15 J;  2QF7 A;  3A1Y A;  1PVE A;  4LJZ F;  1ZRD A;  4HOB A;  4EV0 A;  3RDI A;  3OYE A;  4NC8 A;  2FQ3 A;  3KEQ A;  2LF8 A;  3P9C A;  3OS1 A;  2QYO A;  2UWM A;  2XAG A;  3FWE A;  4FT8 A;  2HKX A;  4PJL A;  4RB3 C;  2Z99 A;  5E3M A;  1R5G A;  5GTI C;  2KIQ A;  4II2 A;  1ZEL A;  2VON A;  4IOA F;  2R7X A;  3KZI C;  2IA1 A;  1VI0 A;  4I09 A;  2VPR A;  1GT0 C;  2P7V B;  2V26 A;  1TW3 A;  3OR2 C;  4L5I A;  4L9V A;  1E3P A;  4WXH A;  4XKB A;  1QA6 A;  3S14 J;  2O8K A;  1ZR2 A;  1ACI A;  4ZTF A;  3F6V A;  4OAZ A;  4PJJ A;  1QHG A;  1HOM A;  2FQ4 A;  2VJ5 A;  4B3A A;  3BTL A;  4PCQ A;  1XCV A;  1WPK A;  4RB0 A;  3IRQ A;  3I56 I;  2HR3 A;  2R7S A;  3OYM A;  4FCY A;  4A0Y A;  1UG2 A;  4D1Q A;  3QAH A;  3PO3 J;  2B0L A;  3L2W A;  2CS3 A;  1RIO H;  5J8C A;  1X1C A;  2X4H A;  2KRF A;  3KZY A;  2XV4 S;  1BI1 A;  2EIN H;  2LMD A;  3VYS B;  1YYV A;  3OYA A;  1WJD A;  2MYS A;  4Y52 J;  2IRF G;  5J47 A;  3GFL A;  5TJJ A;  4XID A;  2CV2 A;  4LLG F;  3PM1 A;  2VBY A;  2VUM J;  1XN7 A;  4GCV A;  2XF5 A;  1BW6 A;  2JVG A;  2EA2 A;  2MGQ A;  5GPA A;  1P92 A;  2LH9 A;  1P9Q C;  2Y2Z A;  3DPU A;  4XN0 A;  1HKS A;  3OYJ A;  2CO5 A;  1D1C A;  3P5J A;  1JKO C;  2CQQ A;  1TNS A;  4ZTJ A;  1Z9C A;  4BHB A;  5LEJ A;  2ZXJ A;  2DU9 A;  1J7K A;  2X0L A;  3LMM A;  2EFW A;  1R36 A;  5E1Z B;  3TKY A;  3BWG A;  4U0Y A;  2Z2S B;  3LSG A;  2B7E A;  2ZJR F;  4CYC B;  3S1M J;  3TBI A;  5KAI C;  2KIF A;  5CVV A;  3KZZ A;  2PJR A;  3TMO A;  2E2H J;  5ED4 A;  4F91 B;  1J0R A;  2DA4 A;  1F9N A;  1BI0 A;  2BY0 A;  3TOA A;  5C3E J;  4M9S A;  1OCO H;  3BR6 A;  3WTU C;  1D1B A;  5FLX Z;  5E1X A;  1AA7 A;  2HFH A;  4LIT A;  5CYV A;  3NEU A;  5ICC A;  2FML A;  1ZGJ A;  3AL0 C;  3GTL J;  4E4H A;  2HOE A;  1IN4 A;  3CUQ C;  3JRI A;  3M4O J;  3BG7 A;  2QSH X;  4EM2 A;  1VQN I;  3AG1 H;  3D5L A;  4OU0 A;  4KYW A;  1X4P A;  2KP6 A;  4HNT A;  2L2O A;  1FBQ A;  3SZT A;  2UXX A;  1V5G A;  2BW3 B;  5HOD A;  2XC7 A;  2HPM A;  1Q1H A;  4M3E A;  4RGR A;  3JCU C;  2E19 A;  4FIS A;  5CVI A;  2DDB A;  2ZFU A;  1T95 A;  2V9K A;  3IRR A;  1UAA A;  2PQ8 A;  2IGK A;  4NQW B;  3SDB A;  2O7O A;  5K5Q A;  4S04 A;  2EZL A;  2P4W A;  2TRT A;  4E7L A;  4KN4 X;  2VQC A;  3P9I A;  4I98 B;  4D5F A;  3CCU I;  2K3P A;  4EVI A;  1IRF A;  2EBI A;  4LLL A;  1SMT A;  3ZGK A;  2ELH A;  2QQ8 A;  2LKX A;  4LLN A;  1XMA A;  1AOY A;  4UV8 A;  4QWQ A;  4HF2 A;  1I39 A;  2FUG 2;  3G6E I;  2BZT A;  4CCN A;  1QZY A;  5J6X A;  3M9A A;  1VQK I;  4E7I A;  2GOM A;  3IHU A;  1Z6T A;  2CQ7 A;  2Y69 H;  1YE9 A;  3B73 A;  4UB6 C;  5JI6 A;  3KYL A;  2ZJP F;  4C3I J;  1T6S A;  1YS7 A;  2R7Q A;  1MMA A;  1RRJ A;  3HTU A;  1JUS A;  3K4M A;  1PUF B;  3CC4 I;  5D5X B;  3K10 A;  4ENJ A;  4GXO A;  1JGG A;  2HNH A;  4RB1 A;  3M1E A;  3D1N I;  4JX4 A;  2QKL B;  2XKO A;  5F08 A;  4AVP A;  4XR6 A;  4R1H A;  5D5U B;  3DEU A;  1T2K A;  1DU0 A;  4N4O B;  1I3A A;  2HYF A;  4E7K A;  3DEW A;  3FM3 A;  3LA7 A;  2HGC A;  5D4R A;  5ICE A;  3KET A;  4AUX A;  1SFK A;  2HTJ A;  4HV6 A;  5KVR A;  5JR3 A;  2X1D A;  1KU9 A;  1O3R A;  3F72 A;  4UXN A;  1R00 A;  4MFD A;  4MGR A;  4KIB A;  4F55 A;  3DBH B;  5FKK A;  2OQG A;  1SVL A;  1PDN C;  3CUO A;  1U3E M;  1X1D A;  2DMP A;  4IO9 F;  4O6J A;  1PYV A;  1DU6 A;  1TWA J;  4R79 A;  5FKL A;  1YTY A;  2XGX A;  1I5Z A;  5E3O A;  5EGO A;  1AKH B;  1NG6 A;  4B4C A;  2GBY A;  3CES A;  1OQY A;  3OR1 C;  4IQ4 A;  3RI4 A;  3HSF A;  2F4M B;  1RR8 C;  2VJ4 A;  4KUM A;  3ZQQ A;  5E8G A;  1X3U A;  3FXQ A;  5BMZ A;  2VQL A;  3EYY A;  2ZB9 A;  1P6R A;  2W48 A;  3KP5 A;  1RC9 A;  1Z77 A;  4CCK A;  3JSO A;  2MH9 A;  2XRO A;  2XB0 X;  2XGC A;  4LOC A;  1J2X A;  1WRJ A;  1D0Y A;  4PJ0 C;  5LEK A;  4F92 B;  1J9I A;  1IJW C;  1S7O A;  3OYI A;  3NWS A;  4ZC3 A;  2WWY A;  3CCS I;  3ERE D;  1JI8 A;  1E2X A;  1UMQ A;  3CCR I;  1SVO A;  1TWF J;  3FXM A;  3VB2 A;  4HBL A;  3RKW A;  1HQC A;  3BP8 A;  3E97 A;  3F8M A;  3VOD A;  2FX0 A;  3PFI A;  2KIM A;  1ETK A;  1ETQ A;  1P7J A;  3BCA A;  5AIP A;  2PBI A;  1X4O A;  4HLX A;  2TCT A;  3G71 I;  1E3H A;  5EYR A;  4ENK A;  3CLO A;  2IXS A;  1TNT A;  4DYR A;  4C2M J;  1ZAO A;  2K9N A;  4XLP F;  2CSO A;  1OR7 C;  4M9Z A;  5HLI A;  3VOE A;  3TP3 A;  1VQO I;  2BV6 A;  4F52 A;  5HNH A;  1YOV B;  2MA3 A;  1Q1V A;  2JQ7 A;  3VSL A;  2MFZ A;  3C7J A;  2H1K A;  4NDL A;  5AIQ A;  4L0Z B;  4ZDO A;  3S93 A;  1O3Q A;  4XLA A;  5BNG A;  2FE3 A;  2CW0 F;  3HBL A;  3MWM A;  3L9F A;  2A61 A;  5M5X J;  4OIQ F;  4ESJ A;  3IP4 B;  2XF7 A;  4YG2 F;  5A2Q Z;  1ZHF A;  3H1C A;  2LVS A;  2RNJ A;  3HOV J;  3HB9 A;  5JLW A;  1NK2 P;  1Y0U A;  3SFI A;  2J5P A;  4IEJ A;  3CO6 C;  4HV5 A;  3EUK L;  2GA2 A;  2HVR A;  4C2T A;  3FZV A;  4JK1 X;  2LR8 A;  5TIS C;  2EV5 A;  2KJB A;  2Y75 A;  4FET A;  5CLS A;  2LKS A;  1W36 C;  1KU7 A;  4RAG A;  3ZR8 X;  2M4G A;  3EUH C;  5GAD J;  1TQM A;  4EJV A;  3HSR A;  4I01 A;  2W25 A;  1U8B A;  3PSF A;  3G2B A;  2M87 A;  2NRA C;  1LFP A;  1UST A;  4F7Z A;  3HG9 A;  1ZKG A;  3E6C C;  4KMU X;  2GZW A;  5K7H A;  1TZL A;  1AWC A;  1KA8 A;  2KZV A;  4UHT A;  3TO6 A;  2ELJ A;  3E0J B;  1MMD A;  2CMP A;  2EH3 A;  4UVB A;  1YI2 I;  4IHX A;  3QYB A;  1XX5 A;  4PSX A;  4RAY A;  3MAJ A;  4ZDL A;  2OV7 A;  4D0P A;  1SD5 A;  2DYS H;  1K78 A;  3OIP A;  1ZRC A;  3H5R A;  1KU2 A;  2ECB A;  2YUS A;  2DK5 A;  4G6Q A;  4MFE A;  3KE2 A;  1W5S A;  3E7L A;  1IZ1 A;  3NAR A;  2PJR B;  1RKT A;  4II3 A;  1K7A A;  2LRE A;  3H35 A;  2R0Q C;  4A12 A;  2ZME A;  2Y48 A;  3F8N A;  3V4G A;  3U1D A;  5KHD A;  4AU7 A;  2L0K A;  3FIS A;  3FMR A;  3KYD B;  5H6R A;  3TP0 A;  4E7S A;  1JE8 A;  3A4C A;  3GX4 X;  4KT5 C;  3CMM A;  1Z0X A;  2L9R A;  1VQM I;  2QUF A;  2BE5 F;  1A6Q A;  2DA7 A;  1ON2 A;  1OKR A;  1IRG A;  2LG4 A;  2CU7 A;  3E5Q A;  5F6F A;  3CO7 C;  3MZY A;  2DK8 A;  1QZE A;  1WJA A;  5EDN A;  1FYL A;  2VBX A;  1W5T A;  2ZXI A;  1UG0 A;  3IH4 A;  4AWX B;  2M2E A;  3RPQ A;  2LYC A;  1ZN2 A;  1IXR C;  2E5N A;  2XAQ A;  2HZD A;  3A02 A;  4PGG A;  4L9T A;  2HOS A;  2XRL A;  2DFF A;  3W3C A;  3TDU C;  4ANJ A;  4FE7 A;  4BS9 A;  2H6C A;  3BTC A;  3DXJ F;  1MNE A;  2HS5 A;  5D5W B;  3KLN A;  2K9M A;  3HOT A;  4XOT A;  1KYW A;  1R9T J;  2GWR A;  2R7F A;  1ZYR F;  5DUI A;  4HG2 A;  2DDA A;  3M8J A;  2V7F A;  3K4C A;  4LGW A;  3C2G A;  1JJ6 C;  1G8X A;  2LD5 A;  3K0L A;  2LP0 A;  3PNV A;  5IYC J;  5HS9 A;  3JRA A;  2H6B A;  3DEE A;  4LB6 B;  4B09 A;  1ZLJ A;  1R4N B;  4B43 A;  1DGR M;  5M3F J;  2IEK A;  2DMT A;  1Z91 A;  2XHK A;  2VOD A;  2M34 A;  2XRN A;  3ZMT A;  2DN0 A;  3OOP A;  5EJC A;  3FM5 A;  1K4T A;  5A2Q K;  3A03 A;  4WX9 A;  4YII A;  2GA1 A;  1K4S A;  1YO5 C;  2M45 A;  1IV6 A;  4QPO A;  4CO8 A;  3HL2 A;  2HDD A;  4A3K J;  3DLL F;  2JPB A;  4LD5 A;  3CCJ I;  4TV7 A;  2AO9 A;  1YJN I;  2MLK A;  2DPD A;  1GHC A;  4G6T B;  3QPT A;  2BY1 A;  2JUC A;  4N9H A;  2EZI A;  3GBG A;  3BPV A;  3MVP A;  5LGU A;  3S3O A;  1O7L A;  2BVM A;  5D5V B;  5GP9 A;  1HW2 A;  3CDL A;  4AM3 A;  5F64 A;  2ZO4 A;  2CUF A;  1QVT A;  4W97 A;  4CHU A;  2XAS A;  3LAP A;  4A3D J;  4B47 A;  3FX3 A;  3L2V A;  3JSP A;  4J01 A;  3DLA A;  1S9H A;  3M3Y J;  3MZ8 A;  2KDO A;  3RPU A;  3ZP5 A;  4KNY A;  2GXB A;  2QGU A;  1R23 A;  2L5Q A;  5EGO B;  2A6H F;  2QEN A;  3M1C A;  3BQZ A;  2FOW A;  3TOB A;  4Q47 A;  2CW7 A;  3K69 A;  4AD9 A;  2E1C A;  1XMK A;  4DBR A;  3QOE A;  1G59 A;  1USS A;  4CIC A;  2W84 A;  4EQQ A; 
#chains in the Genus database with same CATH homology
 1XPX A;  2LMD A;  1MIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...