3CJTB

Ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
139
structure length
126
Chain Sequence
KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGREIAKQKMPLEAAARMIAGSARSMGVEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein L11 methyltransferase
publication title Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase/ribosomal protein
total genus 23
structure length 126
sequence length 139
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
B PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cjtB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3cjtB01
1YIJI 3I55I 3CMEI 1VQPI 2QEXI 3CCQI 5JVGF 1YITI 2H8WA 3PIPF 5GADJ 1YJWI 3J7ZI 1WIBA 3CC2I 1YHQI 3CMAI 3CCJI 3I56I 3CCMI 5GAEJ 1VQKI 3CC7I 2OTLI 3CC4I 5DM6F 3CJQB 1FOXA 1VQ6I 2NXNB 3CJTB 3G4SI 3CCLI 2E34A 1VQOI 2E36A 3CCUI 1ACIA 1S72I 5GAGJ 3PIOF 1VQ4I 4IOAF 2K3FA 4IO9F 1VQLI 4V19K 3CD6I 3G6EI 1VQMI 1Y39A 3CCVI 3J7YJ 2ZJPF 3G71I 1MMSA 3DLLF 1VQ5I 1FOYA 1VQ7I 2ZJQF 1VQ8I 4UY8I 4IOCF 3CJSB 1YJNI 1FOWA 3CCEI 3CF5F 1YI2I 3EGVB 1YJ9I 2OTJI 2FOWA 1VQNI 2ZJRF 5GAHJ 1QA6A 1VQ9I 3CCSI 2E35A 1HC8A 5DM7F 2QA4I 2JQ7A 3CCRI 3CJRB
chains in the Genus database with same CATH superfamily
1JT6A 3I55I 2OCCH 3CMEI 1P9QC 2PJRA 4M72A 2K40A 1ONVA 3EUKL 2D45A 5F0CA 3J81Z 3OS0A 2A61A 3S93A 3BZKA 2Z99A 5KNLA 1FMWA 4C2TA 4KJZA 5DDGA 3LSJA 3L1PA 4F91B 1O4XA 1JT0A 1U5TA 1M1EB 4L5EA 4X6AJ 1S9HA 2M30A 1Z9CA 3Q0WA 3CMYA 1N78A 5IT9Z 2H8RA 3BOQA 2MGQA 1SFOJ 4D5CA 3HIFA 2VI6A 4HYEA 3OYAA 2BHZA 1VQOI 2ELKA 4HSRA 1ZK8A 2E36A 3TDZC 4XKVA 4A2UA 1RZ4A 4HNVA 4NC6A 3ERED 3DEEA 2W24A 3R4KA 2KDZA 3E7LA 2CFOA 4AIKA 5BOXA 1GLNA 4BDZA 2WAFA 4DNCA 2GIVA 1YX5A 4WXHA 1VQLI 4V19K 1ODDA 2EV6A 5C4JJ 3ESWB 4MGRA 2M7AA 2BGCA 3CUQC 1Z6RA 1PUEE 4MIMA 2STWA 4UB8C 2G9WA 4DW6A 4A3DJ 1D8JA 3S1MJ 4ESFA 3BDDA 4EGYA 1D1AA 4A3JJ 2VT2A 1WPKA 3CZ6A 2RC4A 1W4MA 1VQ5I 1ENHA 2CSOA 4M3EA 2KJBA 2RREA 5JHFA 1D0YA 2IGKA 4Y52J 3VFZA 2DT5A 3IH2A 3FMSA 3FK6A 5EEAA 4S04A 3H1CA 1MNEA 4A3MJ 3KPHA 4I02A 4DZPA 3BG9A 3RKXA 4BL0B 2CRGA 2QQ8A 3L2WA 2VODA 3CUOA 4PFPA 2ID3A 4X1EA 4B3XA 1ZHFA 2WAEA 2XPWA 2M7BA 1B59A 5EYRA 1NK2P 2JA2A 3PQJA 1IN4A 2BEOA 5FFXA 1IDZA 3V8KA 1Z6TA 1S7AA 2LNBA 4OINF 2K9SA 2VE8A 3RZOJ 4IF4A 1IO2A 2DOFA 1KZHA 3HOXJ 1OCTC 2R5ZA 3OYBA 3IKTA 3FXQA 3H0GJ 4NDLA 2OQGA 2EIKH 1R1UA 4XLFA 2DA6A 2VJ5A 2MLGA 3H5AA 4GYGA 3G3ZA 1YIJI 2R3SA 2H6BA 1NK3P 5JVGF 4RAFA 4I01A 5FFZA 4M3BA 4EMSA 4CXFA 5LRSA 1KQ8A 1BI1A 1IV8A 3ISPA 1YRNB 3PIPF 2ID6A 3U2RA 1ZG1A 1YJWI 1GXPA 3ABLH 3B6AA 4KISA 2DMTA 2EFQA 1U0JA 1WJ5A 3HRSA 2ZNYA 4A12A 2X6OA 3LOCA 2FMLA 1Z7LA 1XMAA 2VKEA 4UVBA 1FBUA 1LVAA 4KUMA 5E17F 3T1BA 1FJLA 3WGIA 1EV7A 2L5QA 2KP6A 2DT6A 2Y31A 5HDGA 3S2DJ 2LD5A 1DU6A 3WTXC 2KRFA 4PDKA 2JPCA 2D1VA 5D8KB 2ZC2A 1WKMA 1USTA 2CU7A 4LLNA 5H6RA 3ZMUA 2IXSA 2FF4A 3LSTA 4IX7A 4G6DA 4IZZA 3W2VA 2EZKA 3CD6I 1E3HA 1IUFA 2E2JJ 3I58A 4ZC3A 1IW7F 5EEHA 5J1YA 4JP0A 4XQFA 4XSZF 1I39A 1J7KA 3J7AO 3K4LA 3MFKA 5M3MJ 2F5FA 3OYCA 4RAZA 3JRBA 2XROA 1T6SA 2KT0A 4LK1F 2VJJA 2PMHA 3K2AA 4BGDA 3QU3A 5JLXA 1ITYA 2LKPA 2QZ8A 1AOYA 2PN6A 5ED4A 4J19A 1USSA 3FZVA 5L3CA 1NG6A 2BY1A 1KU9A 1MGTA 4N4OB 5ERIA 3ZP5A 2KKOA 2ME0A 5FGMA 2CUZA 1FYMA 2BE5F 2QKLB 3R61A 4GXOA 4BJTA 3D5SC 4A5MA 5F6FA 2BW3A 1B4AA 5DV5A 3JR9A 2EFNA 4LITA 3MWMA 4BBSJ 1X1CA 5LGTA 2JMWA 5EGOA 4BBRJ 2LF7A 3OYMA 4LB6B 2CG4A 5DD4A 5D5UB 2EINH 4FE4A 3Q3SA 1TLHB 2ELHA 3ZN0A 1QZEA 2B9SA 3PNVA 3QYEA 2QA4I 3PSIA 3SJMA 2NVXJ 1MW7A 2PJRB 2UXNA 3JREA 4ZYAA 1O57A 3VYTB 4B4CA 2WB1A 3Q0UA 4K2EA 2JA5J 1HF0A 4F7ZA 1P7JA 2FQ3A 3BR6A 4XKCA 3EUAA 3MN2A 3ECHA 1R1VA 4CHUA 3V7CA 4U7BA 3OR1C 1OKRA 2K7LA 5E3NA 1TWGJ 1RUNA 3OL3A 1WIBA 3IAS2 1FBSA 2PMZA 2AXLA 3HZJA 3K0LA 3CCMI 2VXDA 4H0EA 2XIGA 1N25A 3QYBA 4L9JA 3CMMA 2DA1A 3CC4I 2D2WA 1K83J 3WODF 5LGUA 4A6EA 4CCOA 3CJQB 5JHUA 2BYVE 4ZDOA 1J09A 1ZLJA 2GQQA 1K78B 2ZXWH 4EM1A 2E34A 1LVKA 2MABA 3K9TA 4RB2C 1JKQC 3TGNA 2LSOA 4PGGA 5BS6A 1QVUA 2CMPA 4BS9A 3AFHA 5FROA 4MNUA 5IT3A 3KEOA 1R1TA 1OPCA 3BR1A 3CLQA 2NRAC 3MZYA 2X1DA 1NHAA 1Z77A 3DCFA 2QCOA 4KIBA 4PZJA 1NTCA 2LTPA 4RBOA 3F8FA 3K6GA 1R5ID 2BBYA 2FU4A 2FOKA 3KP3A 1AHDP 2E71A 1MH4A 3DPLC 3S3NA 4I99C 1ZAOA 2JRTA 3FXRA 4O5VA 4I09A 4IHSA 1S7OA 1ULYA 1MMDA 2BXZA 3GTLJ 5LGNA 2HFHA 4EJWA 5J4VA 3UNGC 2ETHA 1DU0A 4DBQA 3QQAA 3N4MA 3I3LA 3GLLA 2G7HA 4IOCF 3HTUA 2ECCA 3R0AA 2IP2A 3KP2A 2Y48A 2WA0A 4HDVA 3HXLA 1B72B 1FC3A 3JW4A 4M6VA 1T2KA 1T95A 1U5TC 5E8GA 1YE9A 2N8GA 6PAXA 2OD5A 1YJ9I 4BACA 2OV7A 1DPRA 2R5ZB 4XLPF 2P81A 3MAJA 5C44J 1Q1HA 4ZTJA 3GTKJ 2K27A 3PFIA 2RVCA 2ZMEA 2GA1A 2K5CA 5CVRA 4C30A 2VN2A 1H9GA 3VSKA 2IS4A 9ANTA 3TOAA 2NVQJ 3W6JB 5LEKA 4G7HF 3WTWC 1IN5A 4QLCU 2E1CA 2VOOA 3K4NA 5C4XJ 2JSCA 3D0SA 4KMFA 1UG2A 4MTDA 3F0CA 3VYUB 1I50J 2OZ6A 4CCLA 4AC0A 3RI4A 1LDDA 2K86A 3NRVA 3ML6A 3CO7C 4XSXF 1W7PD 2TCTA 4PJLA 1FP1D 1HKTA 2Y75A 3IUOA 4UB6C 4LG0B 1YHQI 3BZCA 3VB2A 4BQQA 2GLOA 2Q2EA 2F5CA 4HOBA 2MD0A 2IGOA 1JHHA 4V2FA 3W6KB 1WFXA 1K4TA 1FSHA 2R4GA 2DXIA 3JRHA 1WJBA 1U9NA 3HBLA 1UB9A 1Q1VA 2EBIA 2F5VA 2LR8A 2Z3YA 1BR2A 3HKZN 4XL9A 3RCOA 5HS8A 3MKWB 1KYWA 3F6OA 2L02A 3CDIA 1P4AA 3KEQA 4FCYA 1WSUA 1Z3YA 1T08B 2HDCA 3IWZA 2L7MP 4HF2A 4PCQA 3BG6A 1R4NB 2XHKA 5K7FA 3KX2A 3D1NI 2M87A 4YELA 5K5OA 2GXAA 5F0FA 4IO9F 4NHJA 2O5RA 3K4CA 3G2BA 1JXSA 4IRHA 4FASD 5EZGA 2XUBA 4RB1A 4AYBN 1WJAA 3Q9VA 2FBIA 2MYSA 3JTGA 1W5TA 3DXJF 5J8FA 3OMYA 1XMXA 1TNTA 1D5VA 5F1JA 3HC7A 3VODA 3E5QA 1MMNA 2GOMA 3CP2A 2R7FA 2NS8A 4A69C 1YG2A 3GTJJ 4ENMA 2GXBA 2CO5A 4DOZA 4B8XA 2R7WA 4F3QA 2RKHA 1QU3A 2HTSA 3GFIA 2BW3B 1R00A 4XLEA 2K9LA 4RMNA 1GVDA 1HCRA 1ERDA 2LDUA 5FD6A 3S3OA 4QTRA 1D1CA 3IH4A 4XRSA 5KK1A 3CCEI 2V7FA 1ZG5A 2OPTA 1FT9A 3ZN1A 3O3KA 5JVTA 2E1MB 4Y4RA 1EH7A 1OR7A 4ZDPA 4HQMA 5FLXZ 3S15J 2R7RA 3CCSI 3KZZA 4UV8A 2V6EA 2V1DA 5FO5A 1XSVA 5C3EJ 4M9SA 3BCBA 3RIRA 2FNAA 2K4BA 3E6BA 3IL2A 5EZHA 1Y0UA 2W00A 3O2PE 1IRGA 2JJ7A 1ORKA 2CQKA 3AG2H 3OYGA 1SD7A 2L9SA 1NH3A 4Y17A 1JTXA 1XN7A 1BA5A 1JI8A 4ENJA 1K4SA 2COBA 2RN7A 5FJ8J 1IZ1A 3CCQI 4IHTA 2NVTJ 1F9NA 2L01A 3F23A 1L3LA 1DGRM 2CYYA 3MKZA 3K1MA 2PBIA 3ERMA 4R79A 2HKXA 1WZ2A 4HQEA 1Z1DA 3GO5A 5CPRB 3JRGA 1FNNA 4L18B 3M4OJ 3VEPA 2KDOA 4DZJA 1HDDC 3OYDA 1MIJA 1TWHJ 2A5YB 3F8NA 3H35A 5DYMA 2IW5A 4E7HA 3SFIA 3GXOA 3HOSA 5E20A 2LBFA 1UZCA 2M1BA 4RLQA 3CF2A 2JUCA 4RB3C 3CCLI 2A6TA 3LNQA 4A3GJ 1SD6A 4ITVA 2WC2A 2VBWA 3HHGA 2VC0A 3KZIC 1A6IA 1HA8A 3TP3A 4P9FA 4BY7J 2QSFX 3OIQA 4IOAF 3FIWA 2LKXA 2R92J 3K4BA 4N0BA 3GEZA 5A2QZ 1YRNA 1W0UA 2H09A 2NVYJ 3K69A 4A93J 1ZG3A 3RQIA 2VBZA 1BI3A 1RNLA 2VJIA 2RV8A 1Z67A 1RI7A 2VT3A 1LUJB 4ZDLA 2LY9A 4G9YA 3H3ZA 4HDUA 4F52A 1KGSA 3P9IA 2RAEA 3TW7A 1W5CC 2XF5A 5FD5A 5L3BA 2A69F 3GBGA 3GTQJ 3LA3A 4GO1A 1LE8A 2B7EA 1HKSA 2IS6A 4PFOA 3DPUA 1WGXA 2MW8A 4JK1X 2HVSA 1BW6A 1XGMA 2XGXA 5D8LB 4I2OA 1VI0A 4JBAA 3DU6A 3TO6A 1MSEC 1JE8A 1IN8A 2YX4A 1G59A 2X6WA 5JI6A 1Z0XA 1B9MA 3K70C 1OCOH 1V5EA 2ZO4A 1IXCA 2Z16A 3KETA 1FY7A 3F6VA 2HI3A 4KIGA 3ZMZA 2LYCA 2CFXA 1V55H 3SZTA 5IP6A 3EYIA 2OA4A 3BR3A 1BBYA 3L2CA 1TW3A 4GCVA 1MNMC 2VKHA 1QPIA 2FJ1A 1G8XA 1WHUA 2CWEA 2Q1ZB 2B63J 5LEJA 2J5OA 4UUSA 2QEXI 1HSTA 3J80Z 2I5UA 4XONA 2PJPA 1I6HJ 3QYFA 1W7PB 1YIOA 3BR2A 2HQAA 3RPUA 3IRQA 3F22A 1FPQA 4AIJA 3A03A 5TRDA 1D8KA 2P6TA 5HOOA 1OYIA 4LLLA 3IRRA 1R4MB 3GFJA 4B09A 3OYEA 1V5FA 3R6SA 4O3MA 2G7UA 3TP0A 1PVEA 1ZQ3P 2NS7A 2F4IA 4WXCA 4AVPA 1VQ6I 5E1WA 3KLOA 3VPRA 3G4SI 4EQQA 3V42A 4G8XA 3L2VA 2DAOA 4MQVA 3SDBA 1B9NA 3HYIA 1ZLKA 2EIJH 5F1RA 1VQ4I 2XB5A 5IY5H 3QPTA 3OSGA 2E5ZA 1TT5B 2LFBA 1PYVA 4BXFA 1IV6A 3W6VA 2DMUA 3GTGJ 2VXZA 3LAPA 2Y9YA 3CDLA 1Y8RB 4OU0A 3AG4H 1ZH5A 4C9YA 1KA8A 1G3YA 1S8NA 2ZMEC 3WTVC 2W1OA 1APLC 4IQJA 2ZXJA 3BT9A 3G71I 3BTLA 1IXRC 1ZKGA 2JK3A 5F04A 3BTCA 3HTSB 3AG1H 3KP5A 1FSEA 2BY3A 3W3CA 2IVMA 1K78A 4M9XA 3WTTC 1R71A 4E7JA 5CQGA 1MZBA 3WGHA 1U3EM 2KQRA 4UY8I 2L4MA 3ZMTA 4ZZDA 4MTEA 1POGA 4I0BA 5L3DA 2WAQA 3H36A 3MZ8A 3M8JA 4YFKF 3ONQA 4F92B 2ESNA 1IRZA 1I3AA 2DA2A 3R0JA 4EATA 2X0LA 3P5JA 3E5UA 3I9V2 1LJ9A 2H27A 1FLIA 1HW2A 2P7VB 3WTZA 2XDVA 2PG4A 2W82A 1BJAA 2I10A 3D5RC 3ABTA 2MC3A 2FXAA 4UUTA 2QF7A 2DN0A 2EK5A 3WTYC 1OLTA 4M71A 2E35A 1MBHA 4HEA2 2KIMA 1P2FA 1MJAA 2DMNA 1YQAA 2XRLA 1J0RA 3JAMK 1ZREA 4A3CJ 2HOSA 3IC7A 2AO9A 1YOVB 2CUFA 2NVUB 4HZFA 5DCMB 4D1QA 2WB1N 2GXGA 3ZMVA 4WXDA 1MBFA 3DEUA 2EQRA 4BEHA 1B72A 2E5NA 5HS9A 3FHZA 2GIZA 1IUYA 1A04A 5H6QA 3ZRGA 4OAYA 2HQNA 3CP8A 4MFDA 3NWTA 4XKWA 3H9JA 2QUFA 4P55A 2PMZN 2LBFB 2DA3A 1X4OA 4XR6A 4WCGA 5HLGA 2XRNA 2HOTA 3T0YA 1OCZH 1BN5A 4XN0A 1T0FC 1RRJA 2L4AA 1FOXA 3SZGA 4FE7A 1UG0A 1RKWA 2JPBA 4L9NA 3M1EA 1XSDA 5BPIA 3CCYA 4DYCA 3A4CA 2IS2A 5ILUA 3QP5A 3PIOF 5GPCA 3LSGA 3E6MA 2K3FA 1J2XA 1QBJA 3TDUC 2IGNA 4FX4A 3AAFA 2RNGA 1HDPA 3FF5A 4N4NB 3U9GA 1DQUA 3MMYB 3IKVA 3WE2A 5KAIC 1OR7C 2FE3A 1UHWA 4M3FA 4LG0A 2V79A 5EJCA 2W7NA 5DUKA 1PP7U 4AUXA 5DCFA 5JFRA 3ABKH 1K61A 1ZN2A 1LE8B 2HYFA 3SEZA 1MMSA 2BY0A 2UZKA 2W85A 2IS1A 1OQYA 3M3YJ 1GUUA 2G0EA 3JRAA 3SXYA 1O3RA 2Y9ZA 4B3AA 1LDKB 1H89C 4EEFG 4DGWB 4P1WA 4Y13A 1XCBA 1XDUA 1R49A 5HLIA 2M0MA 3OYHA 1MBJA 4HLYA 3C2BA 1G4DA 4QPQA 5DUIA 4B48A 2EILH 1D0XA 4L0ZB 2KIUA 1KU7A 4J01A 5TGTA 5DS9A 2DA7A 2VBXA 4RGUA 2M8EA 2D1HA 3BROA 2JA8J 5D4RA 5GTIC 2XF7A 3BJOA 1YX3A 2ZFWA 4B43A 1IN6A 2E1NA 2OF7A 1FOKA 4C2UA 4UUSB 2DQRA 2DMQA 3TO9A 2LY1A 3HSEA 3DLAA 3EUHA 2VUMJ 1GXQA 5M3FJ 1X3ZB 1ETKA 1UHSA 4LD5A 1YS6A 2QBYB 1HLVA 3MKLA 3PNTA 5CJ9A 3J7ZI 1TL8A 3PJRA 3M8FA 5IYDJ 1OCRH 1SFUA 2D5VA 4LB5A 1XSXA 3EDPA 1JKOC 3BC8A 1L0OC 2DFEA 3LSIA 4YIRX 2PQ8A 1WJCA 2EZHA 3DBRB 2LP0A 2WV0A 3B6CA 3BY6A 4M3GA 3M9AA 3ELKA 3ZGKA 4DQ2A 2PFBA 3ZQGA 2YUSA 2OCEA 3NARA 4R1HA 2JN6A 3KFWX 2K02A 1SVLA 3HJEA 5D5VB 4OIPF 5BMZA 1MMGA 4IHWA 1BR1A 1SAUA 1UHMA 3FBIB 2WV1A 2V6CA 3RYRA 1R6RA 5B5EC 3HPGA 1OMIA 2VKVA 4RM2A 1DP3A 2HYJA 1XDSA 5E1ZB 3LQRA 2EA4A 1YTYA 5EF6A 1U78A 1GVJA 2DQLA 3JCUC 3HOVJ 4ZYHA 3C3WA 2HEOA 1T56A 1MD0A 3N05A 5HVQC 1IDYA 3OYLA 1DDNA 2PMUA 2EPFA 2J5PA 3K70D 1I1GA 2AS5F 3HPHA 1FOYA 2DK8A 1G3WA 4UVCA 3VSLA 4BH9A 2EWNA 4E7IA 1QHGA 4XORA 3SFZA 3GTMJ 3GMEA 3BLYA 3ZQCA 3REOA 3I4NJ 2YU3A 2DO7A 3OL4A 2L7FP 3VWBA 2R7ZJ 2Y69H 1QHHD 2V1UA 2QWWA 1WWXA 2R7UA 4F93B 3S17J 4D7NA 4G6TB 1OCCH 1SEUA 2R7VA 3EGVB 3LFUA 2OTJI 2FOWA 1XGOA 2ACJA 2OUMA 4YEJA 1O7LA 1I1SA 2OBPA 3RKWA 4CSWA 2ZSIB 2BZTA 4DYQA 1TQMA 4MO7A 3KYLA 3AKZA 4M6XA 1SAXA 4XLHA 4L0YB 4BEHB 3IV5A 1MMAA 4U88A 2QQ9A 5HDNA 1LFUP 4BXUA 1VQPI 1TC3C 2Y2ZA 2A05A 2HR3A 1E0EA 3O6BB 3I4MJ 2JRMA 2KZGA 5IP7J 1WCMJ 2ECBA 2YR2A 2A68F 2L54A 4HPQA 1ON1A 4YRVA 4P9UA 5JLWA 2F6CA 4OAZA 4BY1J 3HGYA 1P4WA 2X9DA 1ON2A 1QPMA 2HVRA 3ZQIA 2QQAA 1TBXA 2LOOA 4S0HB 5HNFA 3QU6A 3A1YA 3CESA 2IEKA 4D5FA 4OIRF 2CQXA 2KHMA 3ZPLA 2LC2A 1XCVA 3C2HA 5CVVA 1ZGAA 4KFCA 3S14J 4WX9A 1H88C 4BU2A 2M8GX 1JGSA 5IOYA 3U21A 4A3EJ 2R7TA 2COMA 2R7OA 3PSFA 5GAGJ 3ZQQA 1QGPA 4KT6A 4KN7X 4OOIA 1W7PA 4KMUX 3C18A 3OYFA 3WG9A 2KPMA 2AQEA 4XRMA 5FKLA 3G6EI 2EZIA 3IH3A 1X4PA 3K4JA 2XKOA 5FKMA 4Y33A 2DTZA 4RGXA 2LY2A 4NC7A 2P7CB 4YFNF 4L9VA 1RETA 3GFMA 1Y39A 4CCNA 3J7YJ 2DDAA 2X51A 1HW1A 1ZYRF 1G2HA 3I5UA 4Z2YA 2RQQA 5BQTA 3GTOJ 2EZLA 2ZB9A 3KE2A 3HM5A 5HLHA 2VQGA 2M5WA 2P0WA 1PDNC 1UCRA 1PUFA 2DOEA 2VBYA 2O9LA 5FB2A 2MD5A 5K7HA 3ASOH 4W1UA 2Z9OA 2DTRA 2VL8A 4BQAA 2DU9A 4KA4A 2P6SA 3TQNA 3DQVC 3LSRA 3BPVA 1YO5C 1XMKA 2KZVA 1REPC 3H5NA 3JSPA 2X1EA 1SFEA 1WH5A 1U8RA 3HSFA 1G6NA 2IBDA 1BC7C 2Y0MA 4PK4A 2VLAA 1U6GA 1D3YA 2CQ7A 3KCCA 4ZJZA 2DT7B 5DTDA 4ABZA 3OOPA 4BDYA 2VASA 5FLVA 2EIMH 4RLFA 4GFBA 1OYYA 4B1RA 3HDDA 3BCAA 2XAHA 4FETA 4E70A 1WVRA 3JRDA 4PSXA 5CVJA 2CQNA 4U87A 3P9KA 4PGHA 2XPVA 4EJVA 5L3GA 5K5QA 5DM7F 2DW4A 4I76A 1TZLA 2F4OB 2JTVA 4GYIA 3CTAA 3BTJA 3OS2A 3CCRI 3KEYA 5FLXK 4EGZA 3B02A 2FRHA 3SZPA 3WTSC 2HDWA 2XV4S 2HQRA 4ZH4F 4I98B 2QGUA 4XNFA 1R7JA 4CICA 2Q8KA 1P4XA 1K6OA 1SD5A 2R7XA 1JUSA 3E6DA 5K5RA 3E1SA 3CO6C 4KITB 5J3LA 1AU7A 2DPUA 3LSKA 4WK8F 1ZARA 3P7NA 1FYKA 2KFDA 3A02A 1V54H 5LRRA 1WJFA 2HPMA 4N9HA 2OTLI 1R5GA 2HOAA 2X6YA 3LMMA 4X0GA 2R7SA 2CW7A 2BV6A 2BXYA 2M45A 3E97A 3CJTB 2UUZA 4RDUA 5CVUA 3AL0B 2JZYA 4IQ4A 1FEXA 5B66C 4JOMA 5DCMA 3GUDA 2LREA 2M4KA 2FX0A 4M74A 4E7ZA 4IHYA 3EQLF 3DBHB 1JJ8C 2GM4A 3BR5A 3HGGA 3A2KA 2A5WA 1LEAA 3ZMSA 3ZCOA 1FBQA 3C2GA 4EM0B 4PSWA 3ROUA 3HSRA 4BE2A 3ZMDA 2JVHA 2CUJA 3MQ0A 3FM3A 2R7QA 2ZJPF 5F64A 3S1NJ 4HX8A 1O3QA 1FYLA 2UXXA 2XF6A 3L09A 4EJTA 2WY8Q 5J4YA 1VFCA 3F21A 4AU7A 2ZJQF 2QLZA 3TEDA 2HNHA 1E3OC 3EUHC 1RUOA 1O3SA 1VQ8I 1IRXA 2TRTA 2X1CA 1TQIA 2FBHA 3LQQA 1GT0C 2FEZA 2BVLA 1TWCJ 4XM3A 2KMUA 1CQTA 2M3AA 2WAQN 1GV2A 4ESBA 5ICFA 2ISYA 4XMYA 1TW2A 1WQ2A 4GGGA 5AIPA 2O61A 2V26A 3KP6A 3V4GA 3CJSB 4C3IJ 3KZYA 2BVMA 1FWZA 2HXOA 2E1MC 4G6QA 1YI2I 1Y8QB 2XAQA 4QIWN 5B1BH 2L7KA 4IHVA 1X2NA 3A01A 3H5RA 1LB2A 1I27A 1KU2A 2JSPA 2DJIA 2Z2SB 2IA0A 2KIQA 3OOUA 4CCKA 2XGDA 4LLGF 3VYRB 4OWRB 3HOYJ 1UELB 4BAYA 1R9TJ 1KQ9A 3F3XA 1YW8A 2CQQA 1CGPA 2K3PA 1XD7A 3FK7A 2JQ7A 2YS9A 5HS7A 3LAJA 2O8KA 1MBKA 3F8CA 2Y30A 3FX3A 1Z05A 2MC4A 2V1NA 1U8BA 3CJNA 1KYZA 5EG0A 4M6YA 5K7ZA 3U1DA 1G3TA 4E7KA 4RB0A 3SQNA 2JA6J 1MDMA 3FXLA 2MA3A 1LFPA 1BM9A 3CC2I 3FKIJ 1MH3A 2EB7A 5LLQA 3CMAI 3BTIA 1K6YA 3Q5FA 5LHGA 2B0LA 3DBLB 4IRGA 3NEUA 1YFHA 1JKPC 1Z91A 2RGVA 3CC7I 5HDKA 2DA5A 3HOWJ 5BNGA 2XSJC 1BOAA 3COAC 5FRNA 1A6QA 3BG3A 5CYVA 2X48A 3DFGA 3N97A 3CCUI 2HXIA 3I54A 4RA2A 1QQIA 4LOCA 1BL0A 2GZWA 1XB4A 3PUFA 4MLOA 3KIOA 3J81K 2QBYA 3P9CA 2FBKA 2L3DA 1IGNA 1OJLA 4JX4A 1GHCA 3PUBA 1JGGA 2PX9A 3GZ6A 2UWMA 4UVAA 5LD2C 1EH6A 5FRMA 4ZYEA 1LPQA 4QWQA 2QENA 3T5XA 1PUFB 4M9ZA 3BZ6A 4KN4X 5IT9K 2DYRH 3R60A 2R5YA 3DLLF 1X2MA 2EH3A 3GW2A 4XN3A 1ETWA 2L9RA 2CH0A 2R0QC 4KNYA 5ILSA 2CUEA 2GA2A 4YFXF 4JYKA 5J40A 3LA7A 3F8BA 2X6XA 5D6EA 3U1KA 4A0ZA 4ZYDA 2VONA 4P96A 5D5WB 4BQNA 2STTA 1J9IA 4MFEA 4A3BJ 1FTTA 2ZKZA 2X85A 3E0JB 3BG7A 3IHUA 1TP4A 1TTYA 2MBFA 3HG9A 2ZNZA 3TOBA 4JX5A 1V5GA 3V8JA 1K7AA 1CF7A 1BI0A 2VPRA 3ZQLA 4IEJA 5B3SH 1VQNI 1QRYA 2VPLA 4L5IA 3LFKA 3H3VK 1TQPA 4YIFA 4BJ5C 3F72A 4QPOA 2M34A 4XLNF 1VTNC 2HZTA 2DFIA 3I59A 3BG5A 3K2ZA 2JA7J 1S6LA 3IWFA 2ZXIA 5E8IA 4WF2A 1ZGWA 3FXKA 2OAZA 3BQYA 5AIQA 2DK5A 2YX7A 1HQCA 1AKHA 1OFCX 1H8AC 5GPAA 5L3FA 4AIDA 4AM3A 3A0HC 1MJBA 3M8EA 2WADA 1BIAA 2HPIA 4P5OA 4FQGA 2XAFA 2HZDA 3LSMA 3ABMH 3WGGA 2DMPA 2IA1A 4YIIA 5KCMA 5D6FA 3V8LA 4MHGA 3K10A 1LNWA 4CDGA 2DYSH 3S8PA 2F2EA 5GAEJ 1VQKI 1Y1VJ 3FM5A 2ISZA 3HOTA 3C7JA 1BOBA 2W4SA 1PJRA 2DODA 5IYCJ 5FKKA 3BP8A 5CLSA 2EFPA 2W84A 2DPDA 2NOJB 1Y56A 3BJ6A 3NQOA 3DWLE 4CYDA 2JVGA 2BOLA 4ZZLA 3S1RJ 3RQ4A 1XC5A 3FWEA 1S72I 1IC8A 5FKOA 5ICEA 3JRIA 3LWFA 1XGNA 3RYPA 3CQZJ 1ZRDA 3G1MA 4FX0A 1R22A 2AXTC 4UNOA 4IPAA 1F5TA 2Q0OA 3EETA 3ZQFA 1DP7P 4ON0A 4GDFA 3L2QA 1VQMI 5LHHA 2Y0SA 4CYCB 4XOTA 4EV0A 3DKWA 4G94A 4E7LA 2DLLA 3MEXA 5J1UA 1BR4A 4G7ZF 2DJNA 3DU5A 3ZQHA 4BHCA 5TISC 1EF4A 4CCMA 3HUGA 1MBEA 4N9IA 4BNCA 4LMYA 2GOXB 3L7WA 4BJ6C 3JAMZ 1A36A 2KISA 1P7IA 3I64A 1EH8A 2ADUA 3FMQA 3OYIA 2K9MA 1SC7A 1B8IA 2PLYA 1YLFA 5IP9J 2VE9A 3QPHA 1Y0NA 3K1NA 5TJJA 2V4JC 2FA5A 2H6CA 5F27A 2CV0A 2LK2A 3A01B 3HL2A 1RC9A 1FX7A 1UJ8A 4CUGA 2KRHA 4B47A 3L2RA 3O8GA 2NYXA 1WJDA 1X58A 4NC8A 3I4PA 4XIDA 5GTHC 5GAHJ 4F55A 4HG2A 1RR8C 2E7XA 4D9JA 1HC8A 2VOPA 3G73A 3IP4B 3RTRA 1BJZA 3OIPA 2OC6A 4E6KG 4LIUA 1F4KA 4D0PA 1LFBA 5EG0B 1S7EA 3TO7A 3WU2C 4CZCA 1WJEA 1SMTA 1TWFJ 2F4MB 4G7OF 1A5JA 1MDMB 2DFHA 4FTHA 2VKDA 2FMYA 4PJ0C 3MVPA 2IT0A 4IHXA 4XOPA 2XAJA 2EV5A 2JT1A 1YITI 2GWRA 4RAYA 2EV0A 5CVIA 2K4JA 2O03A 4HNUA 1BW5A 1N75A 1XS9A 4L5JA 5J6XA 4HA8A 2DOAA 4OMYA 3GLXA 3T8TA 3T8RA 2M0CA 1QZYA 1FP2A 3JRFA 4LG3A 4YG2F 2LKSA 1FIPA 2HOEA 2QKMB 3CDHA 3S2WA 2EFWA 1LEBA 1Z7UA 2OZUA 2KL4A 1ZR4A 1N77A 1QZZA 1BI2A 2L0KA 4RGSA 4BXXJ 2ME6A 3GWZA 4L9TA 2CV2A 1O3TA 1I3QJ 4EM2A 5HNHA 5M5YJ 1F36A 5E3MA 4IKFA 2O3FA 4BE0A 2GAUA 3ECOA 2CS3A 2E1OA 3FDYA 2E19A 5FKNA 1F43A 4ENNA 3X2QH 2JUGA 1X3UA 2CV1A 2HU9A 4JQFA 4ENKA 4OMZA 3JRCA 4LK0F 3W2AA 3CCVI 1T38A 2R5YB 1QO0D 1ZELA 1H9TA 3Q0VA 5DEQA 3RPQA 2AQFA 4ETSA 3O8HA 3A0BC 1O7FA 2E2IJ 1C0WA 3Q9SA 3DTIA 4O6JA 3FHNA 3S2HJ 1R5HA 2DBBA 3KLNA 2F5DA 2ZCWA 1ZR2A 1MNDA 2QQBA 4FHTA 3PNYA 4HF0A 1Y1WJ 4IL6C 4CA0A 4G12A 2Z5UA 4UUVA 5ICCA 3PFYA 3WU0A 2ZXHA 1CF7B 2XVCA 3DKYA 1AA7A 1T33A 5B1AH 2IJLA 3MCZA 3QPLA 3IAM2 2M4GA 2L7ZA 5D4SA 2CGPA 2HS5A 3OS1A 1V4RA 1IF1A 1RKTA 2K9QA 1U5TB 2OQRA 4RGRA 1RESA 1FTZA 1WI9A 3I59B 3GX4X 1QA6A 1VQ9I 3QODA 1DGWY 2NAZA 5LBQA 3WHCA 1AKHB 1BIBA 1JUPA 2NNNA 3BQZA 1GV5A 3DTKA 3MD2A 1WH7A 5KAFC 4ZTFA 5BPDA 1XX5A 2KJCA 4CCJA 1UFMA 1VZ0A 1S5LC 2X4HA 4C2MJ 3H3UA 1HW5A 3RKQA 4EJOA 4FISA 1W36C 2XB0X 3ULQB 1YS7A 2VB6A 2ZSHB 3JTHA 1RR7A 1V3FA 1H0MA 1ETVA 2H8WA 2QYOA 5ILVA 3GFLA 2P5LC 1KONA 3GZ5A 1PP8F 1KU3A 1TWAJ 4J00A 4JX6A 2BHYA 3HEFA 5DD8A 3OYKA 4IVNA 2TDXA 1J75A 1XGSA 4LIVA 3I56I 3S32A 1I5ZA 4CO8A 2XAGA 3DF8A 4ANJA 2MFZA 3FXMA 1VNDA 3QAHA 3HOUJ 2Z33A 4HV6A 3PM1A 3TW6A 1IRFA 4Q4ZF 3RDIA 4IJAA 2HVQA 5J1RA 1JTYA 4KICA 3MZHA 1FZPB 4Q5SF 3HHHA 3LSPA 1ACIA 1ZGJA 1EA3A 5E3OA 2YSRA 3WHBA 2HGCA 1IJWC 1SFKA 2UV1A 2R93J 2ELJA 3M1CA 1B1BA 5LHIA 3B73A 1OCPA 4NQWA 2NS0A 5K1YA 1JHFA 4U0VA 4E7SA 3LL7A 4HV5A 3WE3A 3HUGB 4LGWA 3D5LA 4PJNA 4S05A 3TBIA 1FIAA 3RSNA 4XK4A 4NB5A 1ETOA 3FXOA 1W0TA 3OV8A 4Y7NJ 1AWCA 1LDJA 5KVRA 1HBXG 1B8IB 3E6CC 1EJ9A 5E1XA 3ZR8X 3PO2J 5E79C 3GYHX 4CH7A 1OISA 4EJUA 2ZJ2A 1E2XA 2XGEA 4MQ9F 3BWGA 2CW8A 2L2OA 4II3A 4XBFA 1X1BA 5L3EA 1S3JA 5M5WJ 2QSGX 3F9KA 2L9VA 4HNTA 1R36A 2GBYA 3DP7A 3VDXA 3OSFA 2IGMA 2V9PA 1Y6IA 2PEXA 2L9NA 3V7RA 2W57A 3FKJA 1X1DA 1YJNI 1FOWA 5IYBJ 4HRIA 5ICGA 4FT8A 1BC8C 4RS8A 4U0WA 2H94A 2VJ4A 3CUQA 3I0TA 3C1DA 3SEQA 2E7WA 3RKYA 4XICA 2XSDC 1IXSB 3E5XA 1QNTA 2O8XA 5F08A 2IAIA 3SYTA 1QVTA 2KRCA 4RM3A 3LSHA 1YW7A 4AWXB 4BHBA 2FNPA 1IAWA 2QM3A 4HSTA 4KYWA 2EFOA 5H20A 4UXNA 2P8TA 3H9QA 2VQHA 2HWVA 5CQEA 4C3HJ 4OIQF 4KIFA 4UV9A 4XKBA 5D5XB 2HYGD 4AD9A 2ZBKA 3WU1B 1MBGA 4A3FJ 2LLKA 1A35A 3ZXSA 3KP7A 5GADJ 3GF2A 4XRFA 2MSYA 1SD4A 2LF8A 1JKRC 3CCJI 4Z6YA 1MSFC 4C3JJ 4DYRA 2E60A 2WY7Q 1KQ0A 2DCEA 2ICWG 2WTEA 3FXUA 5DM6F 1XG1A 4Q47A 5IOZA 4A3KJ 2NXNB 3OYJA 2P5VA 1E3PA 2HDDA 3BPXA 1U9OA 1SVOA 3V7SA 3J7AY 4NBQA 4OIOF 1X1AA 3DEWA 2YPRA 1TT0A 1T0FA 3FXJA 1K79A 1XPXA 5FLMJ 3I71A 2JWTA 2RQPA 3DKXA 3DTEA 2A07F 4CZZA 2C6YA 4HLXA 2HTJA 3SDGA 4D7MA 4GRIA 5LFAA 3QOPA 4BHPA 1XTAA 4NUBA 2NNYA 1X19A 1SFXA 2DDBA 3TL4X 2XKPA 4A0YA 4XRSG 2FD5A 1T39A 2O6GE 3K4MA 1LQ1A 4E4HA 5EGOB 2HQ5A 1STZA 4II2A 3ASNH 4UHTA 3HRUA 4H4KC 2A6HF 2E2HJ 4WWCA 3VYSB 1WI3A 3I53A 2ZFUA 2YU9J 5M5XJ 3BJAA 5F0HA 3VOEA 1HKQA 1J5YA 2MLKA 1SMYF 4Q48A 3OWTA 1D0ZA 1DPUA 1D5YA 1JUMA 3HB9A 4I7HA 4QSHA 5AONA 4XLCA 3OY9A 4Y3OA 1W5SA 3GCMA 3WG7H 4BE1A 4U0YA 3QWLA 2M9HA 4BKXA 5A2QK 3CF5F 4CYCA 1GDTA 3G1OA 4I0AA 3KP4A 1LKXA 3BR0A 2ZJRF 2OU2A 3F8MA 5IPAA 1MKMA 1HOMA 3DV8A 1TNSA 3CLOA 3H0DA 4CGZA 5CKTA 3QPSA 3ZQ7A 3HOZJ 2F5EA 2QSHX 2PI0A 2XC7A 4BQOA 1X3WB 4KDPA 2LH9A 5JR3A 2NOGA 3CJRB 3KYCB 1WRJA 2M2EA 5E3LA 2DA4A 5EDNA 1I6XA 2FUG2 2CW0F 4A3IJ 2WWYA 1Z3XA 4HW0A 2P4WA 4PJJA 4B44A 4HX7A 1ZTRA 2IPQX 3H9GA 4DBRA 1OYWA 3OYNA 2Z1DA 1P6RA 4ESJA 3S1QJ 2IA2A 4HF1A 3TKYA 2W25A 3UKGA 3RJPA 3S3MA 1YYVA 1Z21A 2R7DA 2VQCA 2BY2A 1JJ6C 3S16J 3PO3J 3E3VA 3G1LA 3M7GA 4HAMA 4HBLA 3ABUA 3PQKA 3GVAA 4R8HA 1ZRFA 4MEYF 1FMVA 4ASNA 3QOEA 1DUXC 1ETQA 2MG4A 4DJAA 1U2WA 2FQ4A 2MH9A 2VIXA 2O7OA 3AL0C 2W48A 3LA2A 2I8DA 4NNJA 3AG3H 4LJZF 3HKZA 4A5NA 4EVIA 5EEGA 2A6EF 2LG4A 3OR2C 4DIQA 3HRTA 4A3LJ 4LFUA 4A0XA 1HSJA 1ZRCA 3FISA 1T8IA 2RDPA 4NQWB 2MH2A 1EKEA 5HLTA 4A6DA 3J80K 4BUPA 4M73A 1F1ZA 3JSOA 4HX4A 3GZNB 2Y0SN 3W2WA 2EJRA 1NG7A 1P92A 3TMOA 1IG7A 2XGCA 2XAUA 3K1PA 4AYBA 1X1PA 1RIOH 4RAGA 2A3SA 2DI3A 3OIOA 4BYYA 2V1XA 2CJJA 5E18F 4XLAA 2ZMEB 3L00A 2XASA 2ESHA 3HRMA 3L9FA 4V2GA 2WBMA 2VQLA 4ZYGA 3PL8A 5J47A 2FSWA 2QVOA 5J8CA 2H1LA 5KHDA 1VQ7I 3SHFA 1IN7A 2O0YA 2H1KA 2V9KA 4KT5C 1SVMA 2RNJA 4I6ZA 4M3DA 1RPWA 1ETXA 1D1BA 1HXDA 3NAUA 3DPTA 4U7DA 3MKYB 3KYDB 4AVZA 1ETYA 4PUSA 3WTUC 2LVSA 3EPZA 1MJ9A 1UAAA 5GP9A 1UMQA 3QRFF 2IRFG 4W97A 3CUQB 3RPUD 2K85A 2K9NA 3NWSA 2XPUA 3K4KA 3QP6A 2HKOA 4PJMA 4MEXF 3UR3C 4IXAA 2P5KA 2Q2EB 1W36D 1A31A 1E17A 1R23A 5H2FC 2EA2A 1YW9A 2LRDA 3EYYA 3K7AJ 5HODA 1W1WE 3RZDJ 2KIFA 2VC1A 4TV7A 4IRIA 2V9VA 2AHQA 3FBNB 1G3SA 2F48A 1SANA 3FMRA 1B6AA 2OJED 3H92A 3L2UA 3ZOBA 1R58A 3M07A 1S29A 2LMDA 1J59A 1VF9A 4AIHA 1T98A 2KLOA 4Y15A 2DFFA 3GTPJ
chains in the Genus database with same CATH topology
1YIJI 3I55I 3CMEI 1VQPI 2QEXI 3CCQI 5JVGF 1YITI 2H8WA 3PIPF 5GADJ 1YJWI 3J7ZI 1WIBA 3CC2I 1YHQI 3CMAI 3CCJI 3I56I 3CCMI 5GAEJ 1VQKI 3CC7I 2OTLI 3CC4I 5DM6F 3CJQB 1FOXA 1VQ6I 2NXNB 3CJTB 3G4SI 3CCLI 2E34A 1VQOI 2E36A 3CCUI 1ACIA 1S72I 5GAGJ 3PIOF 1VQ4I 4IOAF 2K3FA 4IO9F 1VQLI 4V19K 3CD6I 3G6EI 1VQMI 1Y39A 3CCVI 3J7YJ 2ZJPF 3G71I 1MMSA 3DLLF 1VQ5I 1FOYA 1VQ7I 2ZJQF 1VQ8I 4UY8I 4IOCF 3CJSB 1YJNI 1FOWA 3CCEI 3CF5F 1YI2I 3EGVB 1YJ9I 2OTJI 2FOWA 1VQNI 2ZJRF 5GAHJ 1QA6A 1VQ9I 3CCSI 2E35A 1HC8A 5DM7F 2QA4I 2JQ7A 3CCRI 3CJRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ I;  3I55 I;  3CME I;  1VQP I;  2QEX I;  3CCQ I;  5JVG F;  1YIT I;  2H8W A;  3PIP F;  5GAD J;  1YJW I;  3J7Z I;  1WIB A;  3CC2 I;  1YHQ I;  3CMA I;  3CCJ I;  3I56 I;  3CCM I;  5GAE J;  1VQK I;  3CC7 I;  2OTL I;  3CC4 I;  5DM6 F;  3CJQ B;  1FOX A;  1VQ6 I;  2NXN B;  3CJT B;  3G4S I;  3CCL I;  2E34 A;  1VQO I;  2E36 A;  3CCU I;  1ACI A;  1S72 I;  5GAG J;  3PIO F;  1VQ4 I;  4IOA F;  2K3F A;  4IO9 F;  1VQL I;  4V19 K;  3CD6 I;  3G6E I;  1VQM I;  1Y39 A;  3CCV I;  3J7Y J;  2ZJP F;  3G71 I;  1MMS A;  3DLL F;  1VQ5 I;  1FOY A;  1VQ7 I;  2ZJQ F;  1VQ8 I;  4UY8 I;  4IOC F;  3CJS B;  1YJN I;  1FOW A;  3CCE I;  3CF5 F;  1YI2 I;  3EGV B;  1YJ9 I;  2OTJ I;  2FOW A;  1VQN I;  2ZJR F;  5GAH J;  1QA6 A;  1VQ9 I;  3CCS I;  2E35 A;  1HC8 A;  5DM7 F;  2QA4 I;  2JQ7 A;  3CCR I;  3CJR B; 
#chains in the Genus database with same CATH topology
 1JT6 A;  3I55 I;  2OCC H;  3CME I;  1P9Q C;  2PJR A;  4M72 A;  2K40 A;  1ONV A;  3EUK L;  2D45 A;  5F0C A;  3J81 Z;  3OS0 A;  2A61 A;  3S93 A;  3BZK A;  2Z99 A;  5KNL A;  1FMW A;  4C2T A;  4KJZ A;  5DDG A;  3LSJ A;  3L1P A;  4F91 B;  1O4X A;  1JT0 A;  1U5T A;  1M1E B;  4L5E A;  4X6A J;  1S9H A;  2M30 A;  1Z9C A;  3Q0W A;  3CMY A;  1N78 A;  5IT9 Z;  2H8R A;  3BOQ A;  2MGQ A;  1SFO J;  4D5C A;  3HIF A;  2VI6 A;  4HYE A;  3OYA A;  2BHZ A;  1VQO I;  2ELK A;  4HSR A;  1ZK8 A;  2E36 A;  3TDZ C;  4XKV A;  4A2U A;  1RZ4 A;  4HNV A;  4NC6 A;  3ERE D;  3DEE A;  2W24 A;  3R4K A;  2KDZ A;  3E7L A;  2CFO A;  4AIK A;  5BOX A;  1GLN A;  4BDZ A;  2WAF A;  4DNC A;  2GIV A;  1YX5 A;  4WXH A;  1VQL I;  4V19 K;  1ODD A;  2EV6 A;  5C4J J;  3ESW B;  4MGR A;  2M7A A;  2BGC A;  3CUQ C;  1Z6R A;  1PUE E;  4MIM A;  2STW A;  4UB8 C;  2G9W A;  4DW6 A;  4A3D J;  1D8J A;  3S1M J;  4ESF A;  3BDD A;  4EGY A;  1D1A A;  4A3J J;  2VT2 A;  1WPK A;  3CZ6 A;  2RC4 A;  1W4M A;  1VQ5 I;  1ENH A;  2CSO A;  4M3E A;  2KJB A;  2RRE A;  5JHF A;  1D0Y A;  2IGK A;  4Y52 J;  3VFZ A;  2DT5 A;  3IH2 A;  3FMS A;  3FK6 A;  5EEA A;  4S04 A;  3H1C A;  1MNE A;  4A3M J;  3KPH A;  4I02 A;  4DZP A;  3BG9 A;  3RKX A;  4BL0 B;  2CRG A;  2QQ8 A;  3L2W A;  2VOD A;  3CUO A;  4PFP A;  2ID3 A;  4X1E A;  4B3X A;  1ZHF A;  2WAE A;  2XPW A;  2M7B A;  1B59 A;  5EYR A;  1NK2 P;  2JA2 A;  3PQJ A;  1IN4 A;  2BEO A;  5FFX A;  1IDZ A;  3V8K A;  1Z6T A;  1S7A A;  2LNB A;  4OIN F;  2K9S A;  2VE8 A;  3RZO J;  4IF4 A;  1IO2 A;  2DOF A;  1KZH A;  3HOX J;  1OCT C;  2R5Z A;  3OYB A;  3IKT A;  3FXQ A;  3H0G J;  4NDL A;  2OQG A;  2EIK H;  1R1U A;  4XLF A;  2DA6 A;  2VJ5 A;  2MLG A;  3H5A A;  4GYG A;  3G3Z A;  1YIJ I;  2R3S A;  2H6B A;  1NK3 P;  5JVG F;  4RAF A;  4I01 A;  5FFZ A;  4M3B A;  4EMS A;  4CXF A;  5LRS A;  1KQ8 A;  1BI1 A;  1IV8 A;  3ISP A;  1YRN B;  3PIP F;  2ID6 A;  3U2R A;  1ZG1 A;  1YJW I;  1GXP A;  3ABL H;  3B6A A;  4KIS A;  2DMT A;  2EFQ A;  1U0J A;  1WJ5 A;  3HRS A;  2ZNY A;  4A12 A;  2X6O A;  3LOC A;  2FML A;  1Z7L A;  1XMA A;  2VKE A;  4UVB A;  1FBU A;  1LVA A;  4KUM A;  5E17 F;  3T1B A;  1FJL A;  3WGI A;  1EV7 A;  2L5Q A;  2KP6 A;  2DT6 A;  2Y31 A;  5HDG A;  3S2D J;  2LD5 A;  1DU6 A;  3WTX C;  2KRF A;  4PDK A;  2JPC A;  2D1V A;  5D8K B;  2ZC2 A;  1WKM A;  1UST A;  2CU7 A;  4LLN A;  5H6R A;  3ZMU A;  2IXS A;  2FF4 A;  3LST A;  4IX7 A;  4G6D A;  4IZZ A;  3W2V A;  2EZK A;  3CD6 I;  1E3H A;  1IUF A;  2E2J J;  3I58 A;  4ZC3 A;  1IW7 F;  5EEH A;  5J1Y A;  4JP0 A;  4XQF A;  4XSZ F;  1I39 A;  1J7K A;  3J7A O;  3K4L A;  3MFK A;  5M3M J;  2F5F A;  3OYC A;  4RAZ A;  3JRB A;  2XRO A;  1T6S A;  2KT0 A;  4LK1 F;  2VJJ A;  2PMH A;  3K2A A;  4BGD A;  3QU3 A;  5JLX A;  1ITY A;  2LKP A;  2QZ8 A;  1AOY A;  2PN6 A;  5ED4 A;  4J19 A;  1USS A;  3FZV A;  5L3C A;  1NG6 A;  2BY1 A;  1KU9 A;  1MGT A;  4N4O B;  5ERI A;  3ZP5 A;  2KKO A;  2ME0 A;  5FGM A;  2CUZ A;  1FYM A;  2BE5 F;  2QKL B;  3R61 A;  4GXO A;  4BJT A;  3D5S C;  4A5M A;  5F6F A;  2BW3 A;  1B4A A;  5DV5 A;  3JR9 A;  2EFN A;  4LIT A;  3MWM A;  4BBS J;  1X1C A;  5LGT A;  2JMW A;  5EGO A;  4BBR J;  2LF7 A;  3OYM A;  4LB6 B;  2CG4 A;  5DD4 A;  5D5U B;  2EIN H;  4FE4 A;  3Q3S A;  1TLH B;  2ELH A;  3ZN0 A;  1QZE A;  2B9S A;  3PNV A;  3QYE A;  2QA4 I;  3PSI A;  3SJM A;  2NVX J;  1MW7 A;  2PJR B;  2UXN A;  3JRE A;  4ZYA A;  1O57 A;  3VYT B;  4B4C A;  2WB1 A;  3Q0U A;  4K2E A;  2JA5 J;  1HF0 A;  4F7Z A;  1P7J A;  2FQ3 A;  3BR6 A;  4XKC A;  3EUA A;  3MN2 A;  3ECH A;  1R1V A;  4CHU A;  3V7C A;  4U7B A;  3OR1 C;  1OKR A;  2K7L A;  5E3N A;  1TWG J;  1RUN A;  3OL3 A;  1WIB A;  3IAS 2;  1FBS A;  2PMZ A;  2AXL A;  3HZJ A;  3K0L A;  3CCM I;  2VXD A;  4H0E A;  2XIG A;  1N25 A;  3QYB A;  4L9J A;  3CMM A;  2DA1 A;  3CC4 I;  2D2W A;  1K83 J;  3WOD F;  5LGU A;  4A6E A;  4CCO A;  3CJQ B;  5JHU A;  2BYV E;  4ZDO A;  1J09 A;  1ZLJ A;  2GQQ A;  1K78 B;  2ZXW H;  4EM1 A;  2E34 A;  1LVK A;  2MAB A;  3K9T A;  4RB2 C;  1JKQ C;  3TGN A;  2LSO A;  4PGG A;  5BS6 A;  1QVU A;  2CMP A;  4BS9 A;  3AFH A;  5FRO A;  4MNU A;  5IT3 A;  3KEO A;  1R1T A;  1OPC A;  3BR1 A;  3CLQ A;  2NRA C;  3MZY A;  2X1D A;  1NHA A;  1Z77 A;  3DCF A;  2QCO A;  4KIB A;  4PZJ A;  1NTC A;  2LTP A;  4RBO A;  3F8F A;  3K6G A;  1R5I D;  2BBY A;  2FU4 A;  2FOK A;  3KP3 A;  1AHD P;  2E71 A;  1MH4 A;  3DPL C;  3S3N A;  4I99 C;  1ZAO A;  2JRT A;  3FXR A;  4O5V A;  4I09 A;  4IHS A;  1S7O A;  1ULY A;  1MMD A;  2BXZ A;  3GTL J;  5LGN A;  2HFH A;  4EJW A;  5J4V A;  3UNG C;  2ETH A;  1DU0 A;  4DBQ A;  3QQA A;  3N4M A;  3I3L A;  3GLL A;  2G7H A;  4IOC F;  3HTU A;  2ECC A;  3R0A A;  2IP2 A;  3KP2 A;  2Y48 A;  2WA0 A;  4HDV A;  3HXL A;  1B72 B;  1FC3 A;  3JW4 A;  4M6V A;  1T2K A;  1T95 A;  1U5T C;  5E8G A;  1YE9 A;  2N8G A;  6PAX A;  2OD5 A;  1YJ9 I;  4BAC A;  2OV7 A;  1DPR A;  2R5Z B;  4XLP F;  2P81 A;  3MAJ A;  5C44 J;  1Q1H A;  4ZTJ A;  3GTK J;  2K27 A;  3PFI A;  2RVC A;  2ZME A;  2GA1 A;  2K5C A;  5CVR A;  4C30 A;  2VN2 A;  1H9G A;  3VSK A;  2IS4 A;  9ANT A;  3TOA A;  2NVQ J;  3W6J B;  5LEK A;  4G7H F;  3WTW C;  1IN5 A;  4QLC U;  2E1C A;  2VOO A;  3K4N A;  5C4X J;  2JSC A;  3D0S A;  4KMF A;  1UG2 A;  4MTD A;  3F0C A;  3VYU B;  1I50 J;  2OZ6 A;  4CCL A;  4AC0 A;  3RI4 A;  1LDD A;  2K86 A;  3NRV A;  3ML6 A;  3CO7 C;  4XSX F;  1W7P D;  2TCT A;  4PJL A;  1FP1 D;  1HKT A;  2Y75 A;  3IUO A;  4UB6 C;  4LG0 B;  1YHQ I;  3BZC A;  3VB2 A;  4BQQ A;  2GLO A;  2Q2E A;  2F5C A;  4HOB A;  2MD0 A;  2IGO A;  1JHH A;  4V2F A;  3W6K B;  1WFX A;  1K4T A;  1FSH A;  2R4G A;  2DXI A;  3JRH A;  1WJB A;  1U9N A;  3HBL A;  1UB9 A;  1Q1V A;  2EBI A;  2F5V A;  2LR8 A;  2Z3Y A;  1BR2 A;  3HKZ N;  4XL9 A;  3RCO A;  5HS8 A;  3MKW B;  1KYW A;  3F6O A;  2L02 A;  3CDI A;  1P4A A;  3KEQ A;  4FCY A;  1WSU A;  1Z3Y A;  1T08 B;  2HDC A;  3IWZ A;  2L7M P;  4HF2 A;  4PCQ A;  3BG6 A;  1R4N B;  2XHK A;  5K7F A;  3KX2 A;  3D1N I;  2M87 A;  4YEL A;  5K5O A;  2GXA A;  5F0F A;  4IO9 F;  4NHJ A;  2O5R A;  3K4C A;  3G2B A;  1JXS A;  4IRH A;  4FAS D;  5EZG A;  2XUB A;  4RB1 A;  4AYB N;  1WJA A;  3Q9V A;  2FBI A;  2MYS A;  3JTG A;  1W5T A;  3DXJ F;  5J8F A;  3OMY A;  1XMX A;  1TNT A;  1D5V A;  5F1J A;  3HC7 A;  3VOD A;  3E5Q A;  1MMN A;  2GOM A;  3CP2 A;  2R7F A;  2NS8 A;  4A69 C;  1YG2 A;  3GTJ J;  4ENM A;  2GXB A;  2CO5 A;  4DOZ A;  4B8X A;  2R7W A;  4F3Q A;  2RKH A;  1QU3 A;  2HTS A;  3GFI A;  2BW3 B;  1R00 A;  4XLE A;  2K9L A;  4RMN A;  1GVD A;  1HCR A;  1ERD A;  2LDU A;  5FD6 A;  3S3O A;  4QTR A;  1D1C A;  3IH4 A;  4XRS A;  5KK1 A;  3CCE I;  2V7F A;  1ZG5 A;  2OPT A;  1FT9 A;  3ZN1 A;  3O3K A;  5JVT A;  2E1M B;  4Y4R A;  1EH7 A;  1OR7 A;  4ZDP A;  4HQM A;  5FLX Z;  3S15 J;  2R7R A;  3CCS I;  3KZZ A;  4UV8 A;  2V6E A;  2V1D A;  5FO5 A;  1XSV A;  5C3E J;  4M9S A;  3BCB A;  3RIR A;  2FNA A;  2K4B A;  3E6B A;  3IL2 A;  5EZH A;  1Y0U A;  2W00 A;  3O2P E;  1IRG A;  2JJ7 A;  1ORK A;  2CQK A;  3AG2 H;  3OYG A;  1SD7 A;  2L9S A;  1NH3 A;  4Y17 A;  1JTX A;  1XN7 A;  1BA5 A;  1JI8 A;  4ENJ A;  1K4S A;  2COB A;  2RN7 A;  5FJ8 J;  1IZ1 A;  3CCQ I;  4IHT A;  2NVT J;  1F9N A;  2L01 A;  3F23 A;  1L3L A;  1DGR M;  2CYY A;  3MKZ A;  3K1M A;  2PBI A;  3ERM A;  4R79 A;  2HKX A;  1WZ2 A;  4HQE A;  1Z1D A;  3GO5 A;  5CPR B;  3JRG A;  1FNN A;  4L18 B;  3M4O J;  3VEP A;  2KDO A;  4DZJ A;  1HDD C;  3OYD A;  1MIJ A;  1TWH J;  2A5Y B;  3F8N A;  3H35 A;  5DYM A;  2IW5 A;  4E7H A;  3SFI A;  3GXO A;  3HOS A;  5E20 A;  2LBF A;  1UZC A;  2M1B A;  4RLQ A;  3CF2 A;  2JUC A;  4RB3 C;  3CCL I;  2A6T A;  3LNQ A;  4A3G J;  1SD6 A;  4ITV A;  2WC2 A;  2VBW A;  3HHG A;  2VC0 A;  3KZI C;  1A6I A;  1HA8 A;  3TP3 A;  4P9F A;  4BY7 J;  2QSF X;  3OIQ A;  4IOA F;  3FIW A;  2LKX A;  2R92 J;  3K4B A;  4N0B A;  3GEZ A;  5A2Q Z;  1YRN A;  1W0U A;  2H09 A;  2NVY J;  3K69 A;  4A93 J;  1ZG3 A;  3RQI A;  2VBZ A;  1BI3 A;  1RNL A;  2VJI A;  2RV8 A;  1Z67 A;  1RI7 A;  2VT3 A;  1LUJ B;  4ZDL A;  2LY9 A;  4G9Y A;  3H3Z A;  4HDU A;  4F52 A;  1KGS A;  3P9I A;  2RAE A;  3TW7 A;  1W5C C;  2XF5 A;  5FD5 A;  5L3B A;  2A69 F;  3GBG A;  3GTQ J;  3LA3 A;  4GO1 A;  1LE8 A;  2B7E A;  1HKS A;  2IS6 A;  4PFO A;  3DPU A;  1WGX A;  2MW8 A;  4JK1 X;  2HVS A;  1BW6 A;  1XGM A;  2XGX A;  5D8L B;  4I2O A;  1VI0 A;  4JBA A;  3DU6 A;  3TO6 A;  1MSE C;  1JE8 A;  1IN8 A;  2YX4 A;  1G59 A;  2X6W A;  5JI6 A;  1Z0X A;  1B9M A;  3K70 C;  1OCO H;  1V5E A;  2ZO4 A;  1IXC A;  2Z16 A;  3KET A;  1FY7 A;  3F6V A;  2HI3 A;  4KIG A;  3ZMZ A;  2LYC A;  2CFX A;  1V55 H;  3SZT A;  5IP6 A;  3EYI A;  2OA4 A;  3BR3 A;  1BBY A;  3L2C A;  1TW3 A;  4GCV A;  1MNM C;  2VKH A;  1QPI A;  2FJ1 A;  1G8X A;  1WHU A;  2CWE A;  2Q1Z B;  2B63 J;  5LEJ A;  2J5O A;  4UUS A;  2QEX I;  1HST A;  3J80 Z;  2I5U A;  4XON A;  2PJP A;  1I6H J;  3QYF A;  1W7P B;  1YIO A;  3BR2 A;  2HQA A;  3RPU A;  3IRQ A;  3F22 A;  1FPQ A;  4AIJ A;  3A03 A;  5TRD A;  1D8K A;  2P6T A;  5HOO A;  1OYI A;  4LLL A;  3IRR A;  1R4M B;  3GFJ A;  4B09 A;  3OYE A;  1V5F A;  3R6S A;  4O3M A;  2G7U A;  3TP0 A;  1PVE A;  1ZQ3 P;  2NS7 A;  2F4I A;  4WXC A;  4AVP A;  1VQ6 I;  5E1W A;  3KLO A;  3VPR A;  3G4S I;  4EQQ A;  3V42 A;  4G8X A;  3L2V A;  2DAO A;  4MQV A;  3SDB A;  1B9N A;  3HYI A;  1ZLK A;  2EIJ H;  5F1R A;  1VQ4 I;  2XB5 A;  5IY5 H;  3QPT A;  3OSG A;  2E5Z A;  1TT5 B;  2LFB A;  1PYV A;  4BXF A;  1IV6 A;  3W6V A;  2DMU A;  3GTG J;  2VXZ A;  3LAP A;  2Y9Y A;  3CDL A;  1Y8R B;  4OU0 A;  3AG4 H;  1ZH5 A;  4C9Y A;  1KA8 A;  1G3Y A;  1S8N A;  2ZME C;  3WTV C;  2W1O A;  1APL C;  4IQJ A;  2ZXJ A;  3BT9 A;  3G71 I;  3BTL A;  1IXR C;  1ZKG A;  2JK3 A;  5F04 A;  3BTC A;  3HTS B;  3AG1 H;  3KP5 A;  1FSE A;  2BY3 A;  3W3C A;  2IVM A;  1K78 A;  4M9X A;  3WTT C;  1R71 A;  4E7J A;  5CQG A;  1MZB A;  3WGH A;  1U3E M;  2KQR A;  4UY8 I;  2L4M A;  3ZMT A;  4ZZD A;  4MTE A;  1POG A;  4I0B A;  5L3D A;  2WAQ A;  3H36 A;  3MZ8 A;  3M8J A;  4YFK F;  3ONQ A;  4F92 B;  2ESN A;  1IRZ A;  1I3A A;  2DA2 A;  3R0J A;  4EAT A;  2X0L A;  3P5J A;  3E5U A;  3I9V 2;  1LJ9 A;  2H27 A;  1FLI A;  1HW2 A;  2P7V B;  3WTZ A;  2XDV A;  2PG4 A;  2W82 A;  1BJA A;  2I10 A;  3D5R C;  3ABT A;  2MC3 A;  2FXA A;  4UUT A;  2QF7 A;  2DN0 A;  2EK5 A;  3WTY C;  1OLT A;  4M71 A;  2E35 A;  1MBH A;  4HEA 2;  2KIM A;  1P2F A;  1MJA A;  2DMN A;  1YQA A;  2XRL A;  1J0R A;  3JAM K;  1ZRE A;  4A3C J;  2HOS A;  3IC7 A;  2AO9 A;  1YOV B;  2CUF A;  2NVU B;  4HZF A;  5DCM B;  4D1Q A;  2WB1 N;  2GXG A;  3ZMV A;  4WXD A;  1MBF A;  3DEU A;  2EQR A;  4BEH A;  1B72 A;  2E5N A;  5HS9 A;  3FHZ A;  2GIZ A;  1IUY A;  1A04 A;  5H6Q A;  3ZRG A;  4OAY A;  2HQN A;  3CP8 A;  4MFD A;  3NWT A;  4XKW A;  3H9J A;  2QUF A;  4P55 A;  2PMZ N;  2LBF B;  2DA3 A;  1X4O A;  4XR6 A;  4WCG A;  5HLG A;  2XRN A;  2HOT A;  3T0Y A;  1OCZ H;  1BN5 A;  4XN0 A;  1T0F C;  1RRJ A;  2L4A A;  1FOX A;  3SZG A;  4FE7 A;  1UG0 A;  1RKW A;  2JPB A;  4L9N A;  3M1E A;  1XSD A;  5BPI A;  3CCY A;  4DYC A;  3A4C A;  2IS2 A;  5ILU A;  3QP5 A;  3PIO F;  5GPC A;  3LSG A;  3E6M A;  2K3F A;  1J2X A;  1QBJ A;  3TDU C;  2IGN A;  4FX4 A;  3AAF A;  2RNG A;  1HDP A;  3FF5 A;  4N4N B;  3U9G A;  1DQU A;  3MMY B;  3IKV A;  3WE2 A;  5KAI C;  1OR7 C;  2FE3 A;  1UHW A;  4M3F A;  4LG0 A;  2V79 A;  5EJC A;  2W7N A;  5DUK A;  1PP7 U;  4AUX A;  5DCF A;  5JFR A;  3ABK H;  1K61 A;  1ZN2 A;  1LE8 B;  2HYF A;  3SEZ A;  1MMS A;  2BY0 A;  2UZK A;  2W85 A;  2IS1 A;  1OQY A;  3M3Y J;  1GUU A;  2G0E A;  3JRA A;  3SXY A;  1O3R A;  2Y9Z A;  4B3A A;  1LDK B;  1H89 C;  4EEF G;  4DGW B;  4P1W A;  4Y13 A;  1XCB A;  1XDU A;  1R49 A;  5HLI A;  2M0M A;  3OYH A;  1MBJ A;  4HLY A;  3C2B A;  1G4D A;  4QPQ A;  5DUI A;  4B48 A;  2EIL H;  1D0X A;  4L0Z B;  2KIU A;  1KU7 A;  4J01 A;  5TGT A;  5DS9 A;  2DA7 A;  2VBX A;  4RGU A;  2M8E A;  2D1H A;  3BRO A;  2JA8 J;  5D4R A;  5GTI C;  2XF7 A;  3BJO A;  1YX3 A;  2ZFW A;  4B43 A;  1IN6 A;  2E1N A;  2OF7 A;  1FOK A;  4C2U A;  4UUS B;  2DQR A;  2DMQ A;  3TO9 A;  2LY1 A;  3HSE A;  3DLA A;  3EUH A;  2VUM J;  1GXQ A;  5M3F J;  1X3Z B;  1ETK A;  1UHS A;  4LD5 A;  1YS6 A;  2QBY B;  1HLV A;  3MKL A;  3PNT A;  5CJ9 A;  3J7Z I;  1TL8 A;  3PJR A;  3M8F A;  5IYD J;  1OCR H;  1SFU A;  2D5V A;  4LB5 A;  1XSX A;  3EDP A;  1JKO C;  3BC8 A;  1L0O C;  2DFE A;  3LSI A;  4YIR X;  2PQ8 A;  1WJC A;  2EZH A;  3DBR B;  2LP0 A;  2WV0 A;  3B6C A;  3BY6 A;  4M3G A;  3M9A A;  3ELK A;  3ZGK A;  4DQ2 A;  2PFB A;  3ZQG A;  2YUS A;  2OCE A;  3NAR A;  4R1H A;  2JN6 A;  3KFW X;  2K02 A;  1SVL A;  3HJE A;  5D5V B;  4OIP F;  5BMZ A;  1MMG A;  4IHW A;  1BR1 A;  1SAU A;  1UHM A;  3FBI B;  2WV1 A;  2V6C A;  3RYR A;  1R6R A;  5B5E C;  3HPG A;  1OMI A;  2VKV A;  4RM2 A;  1DP3 A;  2HYJ A;  1XDS A;  5E1Z B;  3LQR A;  2EA4 A;  1YTY A;  5EF6 A;  1U78 A;  1GVJ A;  2DQL A;  3JCU C;  3HOV J;  4ZYH A;  3C3W A;  2HEO A;  1T56 A;  1MD0 A;  3N05 A;  5HVQ C;  1IDY A;  3OYL A;  1DDN A;  2PMU A;  2EPF A;  2J5P A;  3K70 D;  1I1G A;  2AS5 F;  3HPH A;  1FOY A;  2DK8 A;  1G3W A;  4UVC A;  3VSL A;  4BH9 A;  2EWN A;  4E7I A;  1QHG A;  4XOR A;  3SFZ A;  3GTM J;  3GME A;  3BLY A;  3ZQC A;  3REO A;  3I4N J;  2YU3 A;  2DO7 A;  3OL4 A;  2L7F P;  3VWB A;  2R7Z J;  2Y69 H;  1QHH D;  2V1U A;  2QWW A;  1WWX A;  2R7U A;  4F93 B;  3S17 J;  4D7N A;  4G6T B;  1OCC H;  1SEU A;  2R7V A;  3EGV B;  3LFU A;  2OTJ I;  2FOW A;  1XGO A;  2ACJ A;  2OUM A;  4YEJ A;  1O7L A;  1I1S A;  2OBP A;  3RKW A;  4CSW A;  2ZSI B;  2BZT A;  4DYQ A;  1TQM A;  4MO7 A;  3KYL A;  3AKZ A;  4M6X A;  1SAX A;  4XLH A;  4L0Y B;  4BEH B;  3IV5 A;  1MMA A;  4U88 A;  2QQ9 A;  5HDN A;  1LFU P;  4BXU A;  1VQP I;  1TC3 C;  2Y2Z A;  2A05 A;  2HR3 A;  1E0E A;  3O6B B;  3I4M J;  2JRM A;  2KZG A;  5IP7 J;  1WCM J;  2ECB A;  2YR2 A;  2A68 F;  2L54 A;  4HPQ A;  1ON1 A;  4YRV A;  4P9U A;  5JLW A;  2F6C A;  4OAZ A;  4BY1 J;  3HGY A;  1P4W A;  2X9D A;  1ON2 A;  1QPM A;  2HVR A;  3ZQI A;  2QQA A;  1TBX A;  2LOO A;  4S0H B;  5HNF A;  3QU6 A;  3A1Y A;  3CES A;  2IEK A;  4D5F A;  4OIR F;  2CQX A;  2KHM A;  3ZPL A;  2LC2 A;  1XCV A;  3C2H A;  5CVV A;  1ZGA A;  4KFC A;  3S14 J;  4WX9 A;  1H88 C;  4BU2 A;  2M8G X;  1JGS A;  5IOY A;  3U21 A;  4A3E J;  2R7T A;  2COM A;  2R7O A;  3PSF A;  5GAG J;  3ZQQ A;  1QGP A;  4KT6 A;  4KN7 X;  4OOI A;  1W7P A;  4KMU X;  3C18 A;  3OYF A;  3WG9 A;  2KPM A;  2AQE A;  4XRM A;  5FKL A;  3G6E I;  2EZI A;  3IH3 A;  1X4P A;  3K4J A;  2XKO A;  5FKM A;  4Y33 A;  2DTZ A;  4RGX A;  2LY2 A;  4NC7 A;  2P7C B;  4YFN F;  4L9V A;  1RET A;  3GFM A;  1Y39 A;  4CCN A;  3J7Y J;  2DDA A;  2X51 A;  1HW1 A;  1ZYR F;  1G2H A;  3I5U A;  4Z2Y A;  2RQQ A;  5BQT A;  3GTO J;  2EZL A;  2ZB9 A;  3KE2 A;  3HM5 A;  5HLH A;  2VQG A;  2M5W A;  2P0W A;  1PDN C;  1UCR A;  1PUF A;  2DOE A;  2VBY A;  2O9L A;  5FB2 A;  2MD5 A;  5K7H A;  3ASO H;  4W1U A;  2Z9O A;  2DTR A;  2VL8 A;  4BQA A;  2DU9 A;  4KA4 A;  2P6S A;  3TQN A;  3DQV C;  3LSR A;  3BPV A;  1YO5 C;  1XMK A;  2KZV A;  1REP C;  3H5N A;  3JSP A;  2X1E A;  1SFE A;  1WH5 A;  1U8R A;  3HSF A;  1G6N A;  2IBD A;  1BC7 C;  2Y0M A;  4PK4 A;  2VLA A;  1U6G A;  1D3Y A;  2CQ7 A;  3KCC A;  4ZJZ A;  2DT7 B;  5DTD A;  4ABZ A;  3OOP A;  4BDY A;  2VAS A;  5FLV A;  2EIM H;  4RLF A;  4GFB A;  1OYY A;  4B1R A;  3HDD A;  3BCA A;  2XAH A;  4FET A;  4E70 A;  1WVR A;  3JRD A;  4PSX A;  5CVJ A;  2CQN A;  4U87 A;  3P9K A;  4PGH A;  2XPV A;  4EJV A;  5L3G A;  5K5Q A;  5DM7 F;  2DW4 A;  4I76 A;  1TZL A;  2F4O B;  2JTV A;  4GYI A;  3CTA A;  3BTJ A;  3OS2 A;  3CCR I;  3KEY A;  5FLX K;  4EGZ A;  3B02 A;  2FRH A;  3SZP A;  3WTS C;  2HDW A;  2XV4 S;  2HQR A;  4ZH4 F;  4I98 B;  2QGU A;  4XNF A;  1R7J A;  4CIC A;  2Q8K A;  1P4X A;  1K6O A;  1SD5 A;  2R7X A;  1JUS A;  3E6D A;  5K5R A;  3E1S A;  3CO6 C;  4KIT B;  5J3L A;  1AU7 A;  2DPU A;  3LSK A;  4WK8 F;  1ZAR A;  3P7N A;  1FYK A;  2KFD A;  3A02 A;  1V54 H;  5LRR A;  1WJF A;  2HPM A;  4N9H A;  2OTL I;  1R5G A;  2HOA A;  2X6Y A;  3LMM A;  4X0G A;  2R7S A;  2CW7 A;  2BV6 A;  2BXY A;  2M45 A;  3E97 A;  3CJT B;  2UUZ A;  4RDU A;  5CVU A;  3AL0 B;  2JZY A;  4IQ4 A;  1FEX A;  5B66 C;  4JOM A;  5DCM A;  3GUD A;  2LRE A;  2M4K A;  2FX0 A;  4M74 A;  4E7Z A;  4IHY A;  3EQL F;  3DBH B;  1JJ8 C;  2GM4 A;  3BR5 A;  3HGG A;  3A2K A;  2A5W A;  1LEA A;  3ZMS A;  3ZCO A;  1FBQ A;  3C2G A;  4EM0 B;  4PSW A;  3ROU A;  3HSR A;  4BE2 A;  3ZMD A;  2JVH A;  2CUJ A;  3MQ0 A;  3FM3 A;  2R7Q A;  2ZJP F;  5F64 A;  3S1N J;  4HX8 A;  1O3Q A;  1FYL A;  2UXX A;  2XF6 A;  3L09 A;  4EJT A;  2WY8 Q;  5J4Y A;  1VFC A;  3F21 A;  4AU7 A;  2ZJQ F;  2QLZ A;  3TED A;  2HNH A;  1E3O C;  3EUH C;  1RUO A;  1O3S A;  1VQ8 I;  1IRX A;  2TRT A;  2X1C A;  1TQI A;  2FBH A;  3LQQ A;  1GT0 C;  2FEZ A;  2BVL A;  1TWC J;  4XM3 A;  2KMU A;  1CQT A;  2M3A A;  2WAQ N;  1GV2 A;  4ESB A;  5ICF A;  2ISY A;  4XMY A;  1TW2 A;  1WQ2 A;  4GGG A;  5AIP A;  2O61 A;  2V26 A;  3KP6 A;  3V4G A;  3CJS B;  4C3I J;  3KZY A;  2BVM A;  1FWZ A;  2HXO A;  2E1M C;  4G6Q A;  1YI2 I;  1Y8Q B;  2XAQ A;  4QIW N;  5B1B H;  2L7K A;  4IHV A;  1X2N A;  3A01 A;  3H5R A;  1LB2 A;  1I27 A;  1KU2 A;  2JSP A;  2DJI A;  2Z2S B;  2IA0 A;  2KIQ A;  3OOU A;  4CCK A;  2XGD A;  4LLG F;  3VYR B;  4OWR B;  3HOY J;  1UEL B;  4BAY A;  1R9T J;  1KQ9 A;  3F3X A;  1YW8 A;  2CQQ A;  1CGP A;  2K3P A;  1XD7 A;  3FK7 A;  2JQ7 A;  2YS9 A;  5HS7 A;  3LAJ A;  2O8K A;  1MBK A;  3F8C A;  2Y30 A;  3FX3 A;  1Z05 A;  2MC4 A;  2V1N A;  1U8B A;  3CJN A;  1KYZ A;  5EG0 A;  4M6Y A;  5K7Z A;  3U1D A;  1G3T A;  4E7K A;  4RB0 A;  3SQN A;  2JA6 J;  1MDM A;  3FXL A;  2MA3 A;  1LFP A;  1BM9 A;  3CC2 I;  3FKI J;  1MH3 A;  2EB7 A;  5LLQ A;  3CMA I;  3BTI A;  1K6Y A;  3Q5F A;  5LHG A;  2B0L A;  3DBL B;  4IRG A;  3NEU A;  1YFH A;  1JKP C;  1Z91 A;  2RGV A;  3CC7 I;  5HDK A;  2DA5 A;  3HOW J;  5BNG A;  2XSJ C;  1BOA A;  3COA C;  5FRN A;  1A6Q A;  3BG3 A;  5CYV A;  2X48 A;  3DFG A;  3N97 A;  3CCU I;  2HXI A;  3I54 A;  4RA2 A;  1QQI A;  4LOC A;  1BL0 A;  2GZW A;  1XB4 A;  3PUF A;  4MLO A;  3KIO A;  3J81 K;  2QBY A;  3P9C A;  2FBK A;  2L3D A;  1IGN A;  1OJL A;  4JX4 A;  1GHC A;  3PUB A;  1JGG A;  2PX9 A;  3GZ6 A;  2UWM A;  4UVA A;  5LD2 C;  1EH6 A;  5FRM A;  4ZYE A;  1LPQ A;  4QWQ A;  2QEN A;  3T5X A;  1PUF B;  4M9Z A;  3BZ6 A;  4KN4 X;  5IT9 K;  2DYR H;  3R60 A;  2R5Y A;  3DLL F;  1X2M A;  2EH3 A;  3GW2 A;  4XN3 A;  1ETW A;  2L9R A;  2CH0 A;  2R0Q C;  4KNY A;  5ILS A;  2CUE A;  2GA2 A;  4YFX F;  4JYK A;  5J40 A;  3LA7 A;  3F8B A;  2X6X A;  5D6E A;  3U1K A;  4A0Z A;  4ZYD A;  2VON A;  4P96 A;  5D5W B;  4BQN A;  2STT A;  1J9I A;  4MFE A;  4A3B J;  1FTT A;  2ZKZ A;  2X85 A;  3E0J B;  3BG7 A;  3IHU A;  1TP4 A;  1TTY A;  2MBF A;  3HG9 A;  2ZNZ A;  3TOB A;  4JX5 A;  1V5G A;  3V8J A;  1K7A A;  1CF7 A;  1BI0 A;  2VPR A;  3ZQL A;  4IEJ A;  5B3S H;  1VQN I;  1QRY A;  2VPL A;  4L5I A;  3LFK A;  3H3V K;  1TQP A;  4YIF A;  4BJ5 C;  3F72 A;  4QPO A;  2M34 A;  4XLN F;  1VTN C;  2HZT A;  2DFI A;  3I59 A;  3BG5 A;  3K2Z A;  2JA7 J;  1S6L A;  3IWF A;  2ZXI A;  5E8I A;  4WF2 A;  1ZGW A;  3FXK A;  2OAZ A;  3BQY A;  5AIQ A;  2DK5 A;  2YX7 A;  1HQC A;  1AKH A;  1OFC X;  1H8A C;  5GPA A;  5L3F A;  4AID A;  4AM3 A;  3A0H C;  1MJB A;  3M8E A;  2WAD A;  1BIA A;  2HPI A;  4P5O A;  4FQG A;  2XAF A;  2HZD A;  3LSM A;  3ABM H;  3WGG A;  2DMP A;  2IA1 A;  4YII A;  5KCM A;  5D6F A;  3V8L A;  4MHG A;  3K10 A;  1LNW A;  4CDG A;  2DYS H;  3S8P A;  2F2E A;  5GAE J;  1VQK I;  1Y1V J;  3FM5 A;  2ISZ A;  3HOT A;  3C7J A;  1BOB A;  2W4S A;  1PJR A;  2DOD A;  5IYC J;  5FKK A;  3BP8 A;  5CLS A;  2EFP A;  2W84 A;  2DPD A;  2NOJ B;  1Y56 A;  3BJ6 A;  3NQO A;  3DWL E;  4CYD A;  2JVG A;  2BOL A;  4ZZL A;  3S1R J;  3RQ4 A;  1XC5 A;  3FWE A;  1S72 I;  1IC8 A;  5FKO A;  5ICE A;  3JRI A;  3LWF A;  1XGN A;  3RYP A;  3CQZ J;  1ZRD A;  3G1M A;  4FX0 A;  1R22 A;  2AXT C;  4UNO A;  4IPA A;  1F5T A;  2Q0O A;  3EET A;  3ZQF A;  1DP7 P;  4ON0 A;  4GDF A;  3L2Q A;  1VQM I;  5LHH A;  2Y0S A;  4CYC B;  4XOT A;  4EV0 A;  3DKW A;  4G94 A;  4E7L A;  2DLL A;  3MEX A;  5J1U A;  1BR4 A;  4G7Z F;  2DJN A;  3DU5 A;  3ZQH A;  4BHC A;  5TIS C;  1EF4 A;  4CCM A;  3HUG A;  1MBE A;  4N9I A;  4BNC A;  4LMY A;  2GOX B;  3L7W A;  4BJ6 C;  3JAM Z;  1A36 A;  2KIS A;  1P7I A;  3I64 A;  1EH8 A;  2ADU A;  3FMQ A;  3OYI A;  2K9M A;  1SC7 A;  1B8I A;  2PLY A;  1YLF A;  5IP9 J;  2VE9 A;  3QPH A;  1Y0N A;  3K1N A;  5TJJ A;  2V4J C;  2FA5 A;  2H6C A;  5F27 A;  2CV0 A;  2LK2 A;  3A01 B;  3HL2 A;  1RC9 A;  1FX7 A;  1UJ8 A;  4CUG A;  2KRH A;  4B47 A;  3L2R A;  3O8G A;  2NYX A;  1WJD A;  1X58 A;  4NC8 A;  3I4P A;  4XID A;  5GTH C;  5GAH J;  4F55 A;  4HG2 A;  1RR8 C;  2E7X A;  4D9J A;  1HC8 A;  2VOP A;  3G73 A;  3IP4 B;  3RTR A;  1BJZ A;  3OIP A;  2OC6 A;  4E6K G;  4LIU A;  1F4K A;  4D0P A;  1LFB A;  5EG0 B;  1S7E A;  3TO7 A;  3WU2 C;  4CZC A;  1WJE A;  1SMT A;  1TWF J;  2F4M B;  4G7O F;  1A5J A;  1MDM B;  2DFH A;  4FTH A;  2VKD A;  2FMY A;  4PJ0 C;  3MVP A;  2IT0 A;  4IHX A;  4XOP A;  2XAJ A;  2EV5 A;  2JT1 A;  1YIT I;  2GWR A;  4RAY A;  2EV0 A;  5CVI A;  2K4J A;  2O03 A;  4HNU A;  1BW5 A;  1N75 A;  1XS9 A;  4L5J A;  5J6X A;  4HA8 A;  2DOA A;  4OMY A;  3GLX A;  3T8T A;  3T8R A;  2M0C A;  1QZY A;  1FP2 A;  3JRF A;  4LG3 A;  4YG2 F;  2LKS A;  1FIP A;  2HOE A;  2QKM B;  3CDH A;  3S2W A;  2EFW A;  1LEB A;  1Z7U A;  2OZU A;  2KL4 A;  1ZR4 A;  1N77 A;  1QZZ A;  1BI2 A;  2L0K A;  4RGS A;  4BXX J;  2ME6 A;  3GWZ A;  4L9T A;  2CV2 A;  1O3T A;  1I3Q J;  4EM2 A;  5HNH A;  5M5Y J;  1F36 A;  5E3M A;  4IKF A;  2O3F A;  4BE0 A;  2GAU A;  3ECO A;  2CS3 A;  2E1O A;  3FDY A;  2E19 A;  5FKN A;  1F43 A;  4ENN A;  3X2Q H;  2JUG A;  1X3U A;  2CV1 A;  2HU9 A;  4JQF A;  4ENK A;  4OMZ A;  3JRC A;  4LK0 F;  3W2A A;  3CCV I;  1T38 A;  2R5Y B;  1QO0 D;  1ZEL A;  1H9T A;  3Q0V A;  5DEQ A;  3RPQ A;  2AQF A;  4ETS A;  3O8H A;  3A0B C;  1O7F A;  2E2I J;  1C0W A;  3Q9S A;  3DTI A;  4O6J A;  3FHN A;  3S2H J;  1R5H A;  2DBB A;  3KLN A;  2F5D A;  2ZCW A;  1ZR2 A;  1MND A;  2QQB A;  4FHT A;  3PNY A;  4HF0 A;  1Y1W J;  4IL6 C;  4CA0 A;  4G12 A;  2Z5U A;  4UUV A;  5ICC A;  3PFY A;  3WU0 A;  2ZXH A;  1CF7 B;  2XVC A;  3DKY A;  1AA7 A;  1T33 A;  5B1A H;  2IJL A;  3MCZ A;  3QPL A;  3IAM 2;  2M4G A;  2L7Z A;  5D4S A;  2CGP A;  2HS5 A;  3OS1 A;  1V4R A;  1IF1 A;  1RKT A;  2K9Q A;  1U5T B;  2OQR A;  4RGR A;  1RES A;  1FTZ A;  1WI9 A;  3I59 B;  3GX4 X;  1QA6 A;  1VQ9 I;  3QOD A;  1DGW Y;  2NAZ A;  5LBQ A;  3WHC A;  1AKH B;  1BIB A;  1JUP A;  2NNN A;  3BQZ A;  1GV5 A;  3DTK A;  3MD2 A;  1WH7 A;  5KAF C;  4ZTF A;  5BPD A;  1XX5 A;  2KJC A;  4CCJ A;  1UFM A;  1VZ0 A;  1S5L C;  2X4H A;  4C2M J;  3H3U A;  1HW5 A;  3RKQ A;  4EJO A;  4FIS A;  1W36 C;  2XB0 X;  3ULQ B;  1YS7 A;  2VB6 A;  2ZSH B;  3JTH A;  1RR7 A;  1V3F A;  1H0M A;  1ETV A;  2H8W A;  2QYO A;  5ILV A;  3GFL A;  2P5L C;  1KON A;  3GZ5 A;  1PP8 F;  1KU3 A;  1TWA J;  4J00 A;  4JX6 A;  2BHY A;  3HEF A;  5DD8 A;  3OYK A;  4IVN A;  2TDX A;  1J75 A;  1XGS A;  4LIV A;  3I56 I;  3S32 A;  1I5Z A;  4CO8 A;  2XAG A;  3DF8 A;  4ANJ A;  2MFZ A;  3FXM A;  1VND A;  3QAH A;  3HOU J;  2Z33 A;  4HV6 A;  3PM1 A;  3TW6 A;  1IRF A;  4Q4Z F;  3RDI A;  4IJA A;  2HVQ A;  5J1R A;  1JTY A;  4KIC A;  3MZH A;  1FZP B;  4Q5S F;  3HHH A;  3LSP A;  1ACI A;  1ZGJ A;  1EA3 A;  5E3O A;  2YSR A;  3WHB A;  2HGC A;  1IJW C;  1SFK A;  2UV1 A;  2R93 J;  2ELJ A;  3M1C A;  1B1B A;  5LHI A;  3B73 A;  1OCP A;  4NQW A;  2NS0 A;  5K1Y A;  1JHF A;  4U0V A;  4E7S A;  3LL7 A;  4HV5 A;  3WE3 A;  3HUG B;  4LGW A;  3D5L A;  4PJN A;  4S05 A;  3TBI A;  1FIA A;  3RSN A;  4XK4 A;  4NB5 A;  1ETO A;  3FXO A;  1W0T A;  3OV8 A;  4Y7N J;  1AWC A;  1LDJ A;  5KVR A;  1HBX G;  1B8I B;  3E6C C;  1EJ9 A;  5E1X A;  3ZR8 X;  3PO2 J;  5E79 C;  3GYH X;  4CH7 A;  1OIS A;  4EJU A;  2ZJ2 A;  1E2X A;  2XGE A;  4MQ9 F;  3BWG A;  2CW8 A;  2L2O A;  4II3 A;  4XBF A;  1X1B A;  5L3E A;  1S3J A;  5M5W J;  2QSG X;  3F9K A;  2L9V A;  4HNT A;  1R36 A;  2GBY A;  3DP7 A;  3VDX A;  3OSF A;  2IGM A;  2V9P A;  1Y6I A;  2PEX A;  2L9N A;  3V7R A;  2W57 A;  3FKJ A;  1X1D A;  1YJN I;  1FOW A;  5IYB J;  4HRI A;  5ICG A;  4FT8 A;  1BC8 C;  4RS8 A;  4U0W A;  2H94 A;  2VJ4 A;  3CUQ A;  3I0T A;  3C1D A;  3SEQ A;  2E7W A;  3RKY A;  4XIC A;  2XSD C;  1IXS B;  3E5X A;  1QNT A;  2O8X A;  5F08 A;  2IAI A;  3SYT A;  1QVT A;  2KRC A;  4RM3 A;  3LSH A;  1YW7 A;  4AWX B;  4BHB A;  2FNP A;  1IAW A;  2QM3 A;  4HST A;  4KYW A;  2EFO A;  5H20 A;  4UXN A;  2P8T A;  3H9Q A;  2VQH A;  2HWV A;  5CQE A;  4C3H J;  4OIQ F;  4KIF A;  4UV9 A;  4XKB A;  5D5X B;  2HYG D;  4AD9 A;  2ZBK A;  3WU1 B;  1MBG A;  4A3F J;  2LLK A;  1A35 A;  3ZXS A;  3KP7 A;  5GAD J;  3GF2 A;  4XRF A;  2MSY A;  1SD4 A;  2LF8 A;  1JKR C;  3CCJ I;  4Z6Y A;  1MSF C;  4C3J J;  4DYR A;  2E60 A;  2WY7 Q;  1KQ0 A;  2DCE A;  2ICW G;  2WTE A;  3FXU A;  5DM6 F;  1XG1 A;  4Q47 A;  5IOZ A;  4A3K J;  2NXN B;  3OYJ A;  2P5V A;  1E3P A;  2HDD A;  3BPX A;  1U9O A;  1SVO A;  3V7S A;  3J7A Y;  4NBQ A;  4OIO F;  1X1A A;  3DEW A;  2YPR A;  1TT0 A;  1T0F A;  3FXJ A;  1K79 A;  1XPX A;  5FLM J;  3I71 A;  2JWT A;  2RQP A;  3DKX A;  3DTE A;  2A07 F;  4CZZ A;  2C6Y A;  4HLX A;  2HTJ A;  3SDG A;  4D7M A;  4GRI A;  5LFA A;  3QOP A;  4BHP A;  1XTA A;  4NUB A;  2NNY A;  1X19 A;  1SFX A;  2DDB A;  3TL4 X;  2XKP A;  4A0Y A;  4XRS G;  2FD5 A;  1T39 A;  2O6G E;  3K4M A;  1LQ1 A;  4E4H A;  5EGO B;  2HQ5 A;  1STZ A;  4II2 A;  3ASN H;  4UHT A;  3HRU A;  4H4K C;  2A6H F;  2E2H J;  4WWC A;  3VYS B;  1WI3 A;  3I53 A;  2ZFU A;  2YU9 J;  5M5X J;  3BJA A;  5F0H A;  3VOE A;  1HKQ A;  1J5Y A;  2MLK A;  1SMY F;  4Q48 A;  3OWT A;  1D0Z A;  1DPU A;  1D5Y A;  1JUM A;  3HB9 A;  4I7H A;  4QSH A;  5AON A;  4XLC A;  3OY9 A;  4Y3O A;  1W5S A;  3GCM A;  3WG7 H;  4BE1 A;  4U0Y A;  3QWL A;  2M9H A;  4BKX A;  5A2Q K;  3CF5 F;  4CYC A;  1GDT A;  3G1O A;  4I0A A;  3KP4 A;  1LKX A;  3BR0 A;  2ZJR F;  2OU2 A;  3F8M A;  5IPA A;  1MKM A;  1HOM A;  3DV8 A;  1TNS A;  3CLO A;  3H0D A;  4CGZ A;  5CKT A;  3QPS A;  3ZQ7 A;  3HOZ J;  2F5E A;  2QSH X;  2PI0 A;  2XC7 A;  4BQO A;  1X3W B;  4KDP A;  2LH9 A;  5JR3 A;  2NOG A;  3CJR B;  3KYC B;  1WRJ A;  2M2E A;  5E3L A;  2DA4 A;  5EDN A;  1I6X A;  2FUG 2;  2CW0 F;  4A3I J;  2WWY A;  1Z3X A;  4HW0 A;  2P4W A;  4PJJ A;  4B44 A;  4HX7 A;  1ZTR A;  2IPQ X;  3H9G A;  4DBR A;  1OYW A;  3OYN A;  2Z1D A;  1P6R A;  4ESJ A;  3S1Q J;  2IA2 A;  4HF1 A;  3TKY A;  2W25 A;  3UKG A;  3RJP A;  3S3M A;  1YYV A;  1Z21 A;  2R7D A;  2VQC A;  2BY2 A;  1JJ6 C;  3S16 J;  3PO3 J;  3E3V A;  3G1L A;  3M7G A;  4HAM A;  4HBL A;  3ABU A;  3PQK A;  3GVA A;  4R8H A;  1ZRF A;  4MEY F;  1FMV A;  4ASN A;  3QOE A;  1DUX C;  1ETQ A;  2MG4 A;  4DJA A;  1U2W A;  2FQ4 A;  2MH9 A;  2VIX A;  2O7O A;  3AL0 C;  2W48 A;  3LA2 A;  2I8D A;  4NNJ A;  3AG3 H;  4LJZ F;  3HKZ A;  4A5N A;  4EVI A;  5EEG A;  2A6E F;  2LG4 A;  3OR2 C;  4DIQ A;  3HRT A;  4A3L J;  4LFU A;  4A0X A;  1HSJ A;  1ZRC A;  3FIS A;  1T8I A;  2RDP A;  4NQW B;  2MH2 A;  1EKE A;  5HLT A;  4A6D A;  3J80 K;  4BUP A;  4M73 A;  1F1Z A;  3JSO A;  4HX4 A;  3GZN B;  2Y0S N;  3W2W A;  2EJR A;  1NG7 A;  1P92 A;  3TMO A;  1IG7 A;  2XGC A;  2XAU A;  3K1P A;  4AYB A;  1X1P A;  1RIO H;  4RAG A;  2A3S A;  2DI3 A;  3OIO A;  4BYY A;  2V1X A;  2CJJ A;  5E18 F;  4XLA A;  2ZME B;  3L00 A;  2XAS A;  2ESH A;  3HRM A;  3L9F A;  4V2G A;  2WBM A;  2VQL A;  4ZYG A;  3PL8 A;  5J47 A;  2FSW A;  2QVO A;  5J8C A;  2H1L A;  5KHD A;  1VQ7 I;  3SHF A;  1IN7 A;  2O0Y A;  2H1K A;  2V9K A;  4KT5 C;  1SVM A;  2RNJ A;  4I6Z A;  4M3D A;  1RPW A;  1ETX A;  1D1B A;  1HXD A;  3NAU A;  3DPT A;  4U7D A;  3MKY B;  3KYD B;  4AVZ A;  1ETY A;  4PUS A;  3WTU C;  2LVS A;  3EPZ A;  1MJ9 A;  1UAA A;  5GP9 A;  1UMQ A;  3QRF F;  2IRF G;  4W97 A;  3CUQ B;  3RPU D;  2K85 A;  2K9N A;  3NWS A;  2XPU A;  3K4K A;  3QP6 A;  2HKO A;  4PJM A;  4MEX F;  3UR3 C;  4IXA A;  2P5K A;  2Q2E B;  1W36 D;  1A31 A;  1E17 A;  1R23 A;  5H2F C;  2EA2 A;  1YW9 A;  2LRD A;  3EYY A;  3K7A J;  5HOD A;  1W1W E;  3RZD J;  2KIF A;  2VC1 A;  4TV7 A;  4IRI A;  2V9V A;  2AHQ A;  3FBN B;  1G3S A;  2F48 A;  1SAN A;  3FMR A;  1B6A A;  2OJE D;  3H92 A;  3L2U A;  3ZOB A;  1R58 A;  3M07 A;  1S29 A;  2LMD A;  1J59 A;  1VF9 A;  4AIH A;  1T98 A;  2KLO A;  4Y15 A;  2DFF A;  3GTP J; 
#chains in the Genus database with same CATH homology
 1YIJ I;  3I55 I;  3CME I;  1VQP I;  2QEX I;  3CCQ I;  5JVG F;  1YIT I;  2H8W A;  3PIP F;  5GAD J;  1YJW I;  3J7Z I;  1WIB A;  3CC2 I;  1YHQ I;  3CMA I;  3CCJ I;  3I56 I;  3CCM I;  5GAE J;  1VQK I;  3CC7 I;  2OTL I;  3CC4 I;  5DM6 F;  3CJQ B;  1FOX A;  1VQ6 I;  2NXN B;  3CJT B;  3G4S I;  3CCL I;  2E34 A;  1VQO I;  2E36 A;  3CCU I;  1ACI A;  1S72 I;  5GAG J;  3PIO F;  1VQ4 I;  4IOA F;  2K3F A;  4IO9 F;  1VQL I;  4V19 K;  3CD6 I;  3G6E I;  1VQM I;  1Y39 A;  3CCV I;  3J7Y J;  2ZJP F;  3G71 I;  1MMS A;  3DLL F;  1VQ5 I;  1FOY A;  1VQ7 I;  2ZJQ F;  1VQ8 I;  4UY8 I;  4IOC F;  3CJS B;  1YJN I;  1FOW A;  3CCE I;  3CF5 F;  1YI2 I;  3EGV B;  1YJ9 I;  2OTJ I;  2FOW A;  1VQN I;  2ZJR F;  5GAH J;  1QA6 A;  1VQ9 I;  3CCS I;  2E35 A;  1HC8 A;  5DM7 F;  2QA4 I;  2JQ7 A;  3CCR I;  3CJR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...