3CJTB

Ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
139
structure length
126
Chain Sequence
KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGREIAKQKMPLEAAARMIAGSARSMGVEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/ribosomal protein
molecule keywords Ribosomal protein L11 methyltransferase
publication title Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 23
structure length 126
sequence length 139
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
B PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3cjtB02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3cjtB01
5GAEJ 1YJWI 1YJ9I 2H8WA 1VQMI 3CD6I 1VQ6I 3CCMI 3CJRB 3CCJI 3PIPF 1VQLI 4IO9F 1VQOI 3J7YJ 1HC8A 1Y39A 3CCUI 3CCRI 3CCLI 3G71I 1WIBA 5DM6F 1VQ8I 3CF5F 3CC7I 2NXNB 1YI2I 2JQ7A 3CC4I 3DLLF 3I56I 2ZJRF 3G4SI 3CC2I 1ACIA 3PIOF 1YJNI 1VQNI 4V19K 3CJQB 2QA4I 5JVGF 1VQ9I 1VQKI 3EGVB 4UY8I 2OTLI 3I55I 1VQ4I 5GADJ 1QA6A 5DM7F 2QEXI 5GAHJ 2FOWA 1YITI 3CCSI 3CCEI 2OTJI 5GAGJ 1MMSA 2ZJPF 4IOAF 1VQ5I 2ZJQF 3J7ZI 2E36A 1VQ7I 1YIJI 2K3FA 1FOWA 2E35A 2E34A 3CMAI 4IOCF 3CMEI 1VQPI 3CCVI 1YHQI 3CJSB 1FOXA 3CJTB 1S72I 3G6EI 3CCQI 1FOYA
chains in the Genus database with same CATH superfamily
2UXNA 1YJWI 3TO7A 4P9UA 3BJAA 1R6RA 3GCMA 2HKXA 3GXOA 3JRHA 3WTYC 2XPVA 3BTIA 3PSFA 4BEHA 3GMEA 4H4KC 2Y31A 3S15J 3N05A 3J81K 5EF6A 2ZMEC 3TW7A 4IO9F 4A3LJ 1TZLA 1GVJA 5IOZA 5J4VA 4BBSJ 3IV5A 1XSXA 1U9OA 4BAYA 3HOTA 1EA3A 1OCCH 3H0GJ 4XKCA 1BOAA 1RUOA 3DV8A 2ZBKA 3BZKA 3RJPA 4BQQA 3VWBA 4E7JA 2G7UA 4B47A 1ULYA 1EH7A 1WJEA 5KAIC 5H6QA 3QYFA 3WE2A 2D2WA 3C2GA 3E5QA 2HOSA 3CC7I 1MJAA 2CG4A 2KZGA 3DBHB 4E7HA 2CJJA 1E17A 1JHHA 5F27A 1OLTA 3O8GA 3ZQGA 2MFZA 3Q0WA 1OCZH 2O7OA 4NB5A 2ZKZA 2V9KA 3I4NJ 5KHDA 2ZXHA 3EPZA 3KLOA 4OAZA 1H8AC 3EDPA 4CICA 1SD4A 1OPCA 2CMPA 5CVJA 3DKXA 2AHQA 4BQOA 4DOZA 1ZRDA 3CZ6A 4L5EA 3SEZA 5TRDA 1ETOA 3K4MA 1BR1A 4RM3A 1MGTA 4GCVA 1UHSA 2VKEA 1QU3A 3HTUA 4HPQA 4KUMA 4XRFA 4BJTA 1OCPA 2E1MB 2LY9A 1LFUP 1XDUA 3VYRB 2VQHA 1HA8A 3A03A 4M9SA 2QSHX 2XAHA 1ODDA 2JTVA 3ELKA 3I54A 5ERIA 1O3QA 3E5UA 3R4KA 4XSXF 1JTXA 4AVZA 3FISA 2UZKA 4GYIA 2H09A 5FFZA 2RNJA 5C44J 3IL2A 4HZFA 3CUOA 5B66C 2E34A 1J2XA 4MEXF 2XF7A 4IOCF 3CMEI 3DEUA 2WB1N 2EFNA 2IPQX 3F8BA 3K69A 5K5QA 1P7IA 4XLEA 2EIKH 4EQQA 2OQRA 2KJCA 3OYEA 2HQRA 1Z77A 2NNYA 1GHCA 3FXRA 3AL0B 2DQRA 1BM9A 4RLFA 1HSJA 2PMHA 4I76A 3TO9A 3OYKA 1NH3A 2NAZA 3HB9A 2LSOA 2NOGA 1VQ6I 4ZYEA 4KISA 3AAFA 4LIUA 3GTLJ 5EEHA 3DTEA 3U9GA 5IT9K 4MEYF 2IA2A 1R5HA 1TT5B 5EJCA 3D5RC 5CVIA 4RA2A 1KU9A 4YRVA 4Q4ZF 3K4NA 1DGRM 2K4BA 1D0YA 3QOPA 3Q0VA 1BIBA 2HS5A 5BPIA 2PLYA 1FBSA 1G59A 3IH3A 2IT0A 1X4PA 4OOIA 4G12A 4G6DA 3LQQA 1DU0A 2R7XA 2KJBA 4IQ4A 2IS1A 4A0ZA 2BY3A 3V8LA 4EM1A 1X1CA 3DLLF 3Q3SA 1IN6A 3L2UA 2L9NA 3MKZA 3R0AA 2F4MB 5IP9J 2L01A 3CC2I 1J09A 1ZG3A 4ZZLA 3S32A 5H6RA 2CQNA 3CUQB 2V7FA 1TWGJ 1B6AA 3G73A 2O61A 3CJQB 3OV8A 3RQIA 1REPC 2EZLA 1VQ9I 4FE7A 1T0FC 2E5NA 1H9TA 5EG0B 2CO5A 5JLWA 1UMQA 2HTSA 4C3IJ 4XIDA 1QZZA 3UKGA 4IHTA 3JRBA 1FX7A 4B48A 4FISA 3OL4A 1Z91A 2FU4A 1B72B 2O9LA 1ON2A 3OL3A 5EEAA 4II2A 1X4OA 3RTRA 4U7BA 4CHUA 4IOAF 4R79A 1ETYA 4UUVA 1R36A 3OWTA 2KIFA 2LBFB 4XRMA 2XASA 4D7MA 3FWEA 1YLFA 1MJ9A 2IAIA 3LSRA 1FLIA 2F4IA 2H1LA 2BVLA 2JN6A 4HEA2 3FMQA 3TKYA 3QPSA 1POGA 3S1NJ 1A35A 1JI8A 1MNDA 1QHGA 5IYDJ 3RSNA 3CJTB 4PFOA 4LGWA 1S72I 4A93J 3WE3A 4DIQA 3OYJA 2CUFA 2F4OB 1VZ0A 3WU0A 3VEPA 2W82A 3KEOA 5E17F 1FEXA 3MN2A 1W0TA 3WTUC 3K70D 4F55A 3NWSA 1UAAA 3ULQB 5KVRA 3LSMA 2ZSHB 1Y1VJ 4B43A 1GV2A 4WXDA 4CH7A 4CZZA 2CU7A 2HZTA 3GTQJ 2F2EA 2V26A 4CCOA 5EZHA 2XROA 1SAXA 1UCRA 2DDAA 3BQYA 2X6XA 5ILVA 3IH2A 4HQMA 4J19A 1U0JA 1V5FA 4IXAA 4ESBA 3GTOJ 1Z3XA 2VOOA 4XLHA 4N9HA 4A3BJ 4LLGF 2XGDA 5E1XA 5HLHA 2XAFA 1RETA 4YELA 2XKOA 3PM1A 4II3A 4MFEA 2R5YB 4A3CJ 2CSOA 4C30A 2EFWA 1D1AA 6PAXA 4JX4A 1I3QJ 3OSFA 3K2ZA 3L9FA 5IP7J 2XVCA 2FMLA 2QWWA 2W4SA 2DJNA 1W36C 1G3WA 2NVYJ 5BNGA 1IUYA 2DA7A 4DZPA 1LB2A 1T39A 4HW0A 2AXTC 2F5CA 2JMWA 3HRUA 3GW2A 2VB6A 3FM5A 1QNTA 2K5CA 3PSIA 3DXJF 3CUQA 4BE0A 1KZHA 2E1CA 1LVKA 4GFBA 1ZRFA 1PJRA 1ZGWA 3HSRA 1TLHB 2X4HA 4P5OA 4C3HJ 3CJNA 4ZYGA 4FX4A 3ZQLA 1V54H 3MVPA 5CKTA 1FTZA 1MH3A 2X48A 1I1GA 2O03A 4ZC3A 3JCUC 3UNGC 1G6NA 1JKQC 4I02A 2IGOA 3JREA 4HNVA 3DBLB 4UVCA 1O4XA 3M8FA 3GZ6A 3RQ4A 1FZPB 2DI3A 5KNLA 3GTKJ 2WAQN 2VJJA 1Z0XA 5TJJA 4BHCA 2W85A 2DDBA 2ZJQF 4BYYA 4UUTA 3E97A 3H5RA 2WB1A 1XMAA 4X1EA 2VT3A 4OMZA 2MG4A 1ETVA 3FF5A 4I99C 3EETA 2MABA 4EM2A 3ERED 1H89C 2O8XA 5DEQA 1YHQI 4D9JA 1QZYA 2X1EA 5JHUA 2XF6A 1PUFB 3AKZA 1JUSA 3COAC 3J80K 1X2NA 1IGNA 2K85A 5FKOA 2CH0A 2JWTA 2VKDA 2LOOA 1SVMA 4L0YB 3BOQA 2VBZA 1TP4A 3R60A 1ZELA 3A01A 2BY2A 3LA2A 3BZ6A 5DD4A 3HRSA 4NQWB 3TOAA 2E1NA 4BXUA 2FF4A 3LOCA 4I7HA 4XONA 1ETXA 1R5ID 4WXCA 2XGXA 5FKLA 3V7RA 3GLXA 3A2KA 3B6CA 3M3YJ 3FMSA 5FRNA 1QO0D 2YX7A 2FE3A 1VQLI 3V8KA 1ETWA 1VQOI 3GFIA 3EUHC 3HOXJ 5KAFC 2BHZA 5E3NA 3ZP5A 3PNTA 4KNYA 1S6LA 1J9IA 4PZJA 1MNEA 1STZA 2VJIA 4KT5C 1V55H 4RAYA 1WJDA 2P6TA 3G1OA 2ZO4A 3L2QA 2IVMA 3KYDB 5LRSA 1JE8A 1IW7F 4D5CA 1DP3A 1FMWA 3UR3C 4GDFA 2W57A 3CMMA 2ISZA 2GA1A 3I56I 3I4PA 1RNLA 4FETA 3V4GA 2GBYA 1SFUA 1FJLA 1WZ2A 2X85A 2ZFUA 2JRTA 2ZXJA 1T6SA 1WVRA 2ICWG 2OZUA 2WTEA 1BJAA 4YIIA 4DBQA 5HS8A 5JVGF 4I2OA 4QSHA 1SD6A 2Y0SN 3FXKA 4XOPA 1P4AA 2QGUA 1Z67A 3FXQA 3F22A 4E7SA 2H6CA 2IA1A 2WC2A 1IRFA 1KU3A 1R5GA 3KX2A 3HG9A 5DM7F 2YU3A 3AG4H 1JHFA 2PN6A 2FMYA 1DGWY 4QWQA 4ZYAA 4ASNA 2V6EA 1LQ1A 4HNTA 3JTHA 2Q1ZB 2IP2A 3T8TA 4N9IA 1K6OA 1CQTA 1IRZA 3MD2A 4U88A 4ZJZA 1ZARA 4Y15A 3BR3A 2XAQA 2V6CA 2LKPA 4PJLA 4RAZA 4Y4RA 1FBUA 2CW8A 1UZCA 2CV2A 1XG1A 1APLC 1A5JA 3SFZA 5H20A 2R7ZJ 2N8GA 1X1AA 2ZC2A 2BXYA 3HEFA 3TMOA 1T2KA 4MTEA 3V8JA 1EH8A 3SDBA 4AWXB 3CJSB 4P55A 2VBXA 5F0HA 1PUFA 2E1OA 2JUGA 4NHJA 2XGCA 5CJ9A 2LC2A 2BY0A 2DFHA 3H5NA 4KIBA 2IXSA 1E2XA 4OIOF 1FOYA 4A0YA 2GIZA 4BXXJ 3GTJJ 4I0BA 4BE1A 4NQWA 3IKVA 2IW5A 1S8NA 5J1RA 3I59B 4MQVA 3O8HA 4F91B 2EA2A 3HOYJ 1XGNA 2DA3A 2BZTA 3F6VA 3OS2A 2DTRA 3O3KA 4NC7A 2XUBA 1IN5A 2KISA 3O6BB 4E7KA 3TEDA 2FOKA 1P92A 2CQXA 2DMTA 4S05A 5FKKA 4YFKF 3ZMTA 2BYVE 4UB8C 1MIJA 2UV1A 4LOCA 3M1CA 2K02A 4B4CA 4H0EA 2VOPA 1V4RA 1U5TC 2BVMA 4G6QA 3KZZA 4WF2A 2ME6A 2YR2A 2A5YB 2DT6A 2EV0A 3G1LA 1WH7A 1XSVA 3SZGA 1X58A 1BI2A 2CRGA 2FA5A 3E6MA 3F9KA 4B1RA 3S16J 3L1PA 5EYRA 2VONA 1YJNI 2EH3A 3HBLA 2BY1A 2AXLA 1FNNA 1P6RA 1W7PD 4XK4A 4A3IJ 4A3MJ 2HOTA 1FYKA 1R1VA 3U1DA 1JJ6C 1W7PB 4KMUX 3ZR8X 5B3SH 2ELHA 1AHDP 1YW8A 3HHHA 1BC7C 1RKTA 1OJLA 1U3EM 1Y0UA 3BT9A 2BE5F 3KP7A 3S2WA 4RDUA 3LQRA 2WAQA 3F8FA 3RKXA 1XGSA 2UUZA 3AG2H 1R71A 4IHSA 1QPIA 4CYDA 2VN2A 3IKTA 5E8GA 2NNNA 5DCMA 4A3DJ 3KLNA 2VC0A 4L5JA 4N4NB 2HVRA 2LLKA 3SJMA 2MSYA 1Y6IA 3OOUA 4CA0A 4ZDOA 4M6XA 1ZG5A 3A0HC 1JXSA 1RI7A 2LF7A 5E3MA 3ASOH 1A04A 2QLZA 3QRFF 3S1QJ 4HA8A 3HM5A 3ISPA 5D5WB 1O3RA 2OF7A 1FOWA 2V1DA 3IWZA 2E35A 4W97A 3KEYA 1WHUA 5LLQA 2XGEA 2XAUA 4OIRF 4BNCA 3BG9A 2K86A 1F1ZA 5DCFA 4Y52J 1MZBA 2IJLA 2RV8A 4BQNA 2YU9J 3WODF 2ACJA 5FLVA 3OIPA 5K7FA 1IN4A 4Q5SF 1KGSA 3QAHA 3S8PA 1K7AA 4E4HA 5F64A 2EFQA 2EBIA 5F1JA 1YYVA 1XCBA 3I59A 4BXFA 4CZCA 2QCOA 1WKMA 1NG6A 3TOBA 4PK4A 5D4SA 3KZIC 5E8IA 5K7HA 3PUFA 1DUXC 5HOOA 3GO5A 4JX5A 5GTIC 3LA3A 2HEOA 3KP4A 3P9CA 3LMMA 2QSFX 1LFBA 2NS0A 3ECHA 4RGXA 4XORA 4D1QA 3ABLH 3CCUI 1YIOA 2FRHA 1AA7A 1XCVA 1WCMJ 2OV7A 2RREA 4ZTJA 2WY7Q 2LKSA 1D5VA 5DUIA 2X1CA 4OIQF 4HNUA 1K4SA 4L9NA 5LFAA 1B8IA 3F72A 1WJCA 4U0YA 4IKFA 5FD5A 2M34A 1X2MA 2KRCA 2WADA 4Y33A 1E3PA 1WQ2A 3DEEA 2F48A 2LG4A 2K9QA 3CLOA 3QOEA 3DKYA 2CV0A 3T1BA 2A5WA 3NRVA 4RGRA 3OYNA 1HBXG 3KPHA 2Y0SA 2XB5A 2KDZA 3WGIA 1P7JA 1D8JA 2HQAA 3QU3A 1NG7A 3GZNB 4P1WA 1IZ1A 2QUFA 4MQ9F 4HX4A 3AFHA 4XLCA 1OISA 3PFYA 4EGYA 2ISYA 5AIPA 5M5YJ 4XLNF 3M4OJ 3KYLA 1TC3C 4ENMA 1QPMA 5CQEA 2P5LC 3S2HJ 4BL0B 2X6WA 2ZMEB 2EK5A 5A2QZ 3L00A 2E7WA 2FOWA 2VUMJ 3E1SA 2P4WA 2OTJI 3PFIA 1ZR2A 2ZSIB 3FZVA 2Q2EB 1LVAA 4U0WA 1X1BA 5F1RA 3W3CA 4WXHA 3O2PE 3CO6C 1ZN2A 3ZN0A 2QQBA 3VFZA 3J7ZI 1I50J 5L3GA 5B1AH 3HGGA 4G7HF 4Q47A 2QBYB 1RRJA 1OR7A 3CCYA 3M9AA 2Y48A 2Z1DA 3E3VA 4AVPA 3M1EA 2CV1A 5M3MJ 3C3WA 4ENKA 3H35A 5FRMA 2OZ6A 5E1ZB 2R7OA 4QLCU 2A6HF 3NAUA 3KZYA 1SMYF 1B4AA 3H1CA 5FGMA 1VFCA 1Z9CA 2G7HA 3ZQHA 3JAMK 3RKYA 1IO2A 2R5ZA 2E19A 3OS0A 3OYBA 3IRRA 4L18B 2EQRA 1YX5A 5LGTA 3CCMI 1OMIA 1U9NA 2GZWA 2R0QC 4RB3C 3HL2A 4OU0A 2V79A 4FE4A 3VOEA 2HPMA 3DU5A 5D8KB 2XB0X 1FP1D 3CP8A 3GFJA 4C3JJ 4EATA 3PIPF 3EYIA 3OIQA 5J40A 1PDNC 2B63J 1LE8B 1TNTA 2FBIA 2O5RA 1RZ4A 1Q1VA 5K5RA 1ONVA 3HHGA 1Y39A 3OYIA 4FTHA 3OMYA 3ABTA 5FLXK 2CUJA 3RKWA 3G71I 3OY9A 1QZEA 1QBJA 2ETHA 5LHIA 1EJ9A 2HVSA 2HYFA 2LYCA 1SFOJ 2MC3A 1ITYA 2COMA 4E70A 5DM6F 3LAJA 3L2WA 1VQ8I 1DQUA 2CUZA 4M9XA 1SVLA 2HNHA 2ZB9A 5BOXA 1ZREA 2XC7A 2KMUA 1Y8QB 1YQAA 2E71A 3DWLE 3HIFA 3B02A 2DYRH 4FCYA 1V5EA 3TP3A 3BDDA 2ZNYA 5K7ZA 4HV6A 1Z21A 1ZYRF 2VKVA 1FPQA 4A69C 3LSJA 4L9VA 2VC1A 1FT9A 4Z2YA 2O0YA 3L7WA 3EGVB 4UY8I 5AONA 1BBYA 4IPAA 4M3EA 3BLYA 1ZKGA 2OUMA 4Y17A 1DPUA 3MZHA 3RYRA 4WK8F 2LFBA 2ZMEA 4E7LA 5ED4A 1RIOH 1TTYA 3MQ0A 3LSIA 3TDZC 4PSXA 3NEUA 2HZDA 1JKRC 2A3SA 3VYUB 2D1HA 1KQ0A 4AC0A 4JQFA 4D0PA 5HNFA 4LG3A 4RLQA 4M9ZA 1MNMC 1LFPA 4G7ZF 3CMYA 2EZKA 4XBFA 1T33A 1R4MB 4UV9A 4GYGA 3J81Z 5ICGA 1I1SA 2QBYA 4K2EA 4ZTFA 1FWZA 2IS6A 1KA8A 1R23A 2CFOA 3ZMDA 2E60A 4HV5A 1E3HA 2P5VA 3RIRA 2JJ7A 4G7OF 3W6KB 1IN8A 4PDKA 3VYSB 3LFKA 5LEKA 3W6VA 2L2OA 1YO5C 4P9FA 2F5EA 3DQVC 2F5VA 3BR0A 1USSA 3E6DA 4BUPA 4XQFA 2DA5A 1K4TA 2STWA 3HJEA 4KYWA 4G9YA 3PQJA 4IHXA 3F8MA 3KEQA 1UELB 4IRGA 5DDGA 1YJ9I 2EIJH 1X19A 2WA0A 3CF2A 3Q0UA 3DPLC 1L0OC 2K3PA 2KL4A 2MLGA 4FX0A 1KYZA 1U2WA 4PJMA 3C7JA 3FK6A 4EVIA 2VQCA 2XHKA 4I0AA 1Y0NA 1IXCA 4HQEA 1LE8A 4ZZDA 5L3EA 1HC8A 3TDUC 1NK3P 1HQCA 4BQAA 4PJJA 4QIWN 1OYYA 3HUGB 3I9V2 5HDKA 1FIPA 2ELKA 1MBHA 5L3BA 3F21A 1HDPA 2QZ8A 4EJTA 4UVBA 4F52A 2JVGA 3WU1B 3GF2A 2ME0A 3K1MA 3CF5F 4UUSB 2I8DA 5HNHA 2AO9A 3JAMZ 1HCRA 2DLLA 3K4JA 4ETSA 2PFBA 3HDDA 1R49A 3D1NI 3IC7A 3WTTC 4HSRA 2VE9A 2MH9A 2HVQA 4S0HB 1N77A 5D8LB 2WWYA 3S3OA 3JRGA 2DPUA 4HLXA 2B7EA 4GRIA 2CS3A 4A3EJ 2LK2A 3DPTA 2MBFA 2RVCA 4JBAA 2GOMA 2M87A 3HOSA 2Y75A 3IAS2 1MJBA 4F3QA 4DYCA 4BDZA 2LF8A 1YITI 1XTAA 3S17J 4KITB 2NOJB 1FY7A 2PX9A 1IAWA 1MMDA 4JK1X 2VQLA 3GWZA 3FHZA 5FKMA 1W36D 1MSEC 2Y9YA 5DTDA 1G3SA 2FQ3A 3SZTA 4V2GA 2LR8A 4LITA 5IT9Z 5ICCA 2I10A 3MFKA 1T95A 1ZR4A 1HKQA 2BGCA 2H1KA 1W5TA 2ECBA 4MIMA 2VI6A 2QVOA 3BG7A 4F7ZA 2DMPA 1Y8RB 1BC8C 2C6YA 5TGTA 4OINF 4CCNA 1ZRCA 4RAGA 1TWAJ 2Z16A 2PBIA 4HSTA 3V7SA 3REOA 5EG0A 2LNBA 5D5UB 4M3BA 2M1BA 2GWRA 4C2TA 5E3OA 2P5KA 4ZYDA 1HOMA 2K7LA 1UHMA 3K4CA 4MFDA 5IYBJ 1FP2A 1AWCA 3FKIJ 3MZYA 5JHFA 1G8XA 1WH5A 2UXXA 4Q48A 5C4XJ 1B72A 3KIOA 2F5FA 1EKEA 4EV0A 3CCQI 3DFGA 3VSKA 3OIOA 2PMZA 1PUEE 4XKVA 1PYVA 3SZPA 2NVTJ 3IAM2 4AIHA 1K78B 2GIVA 2LBFA 1K83J 2M4KA 2XPUA 3FXLA 4D5FA 1HDDC 2HPIA 1BN5A 3MZ8A 3P9KA 4EMSA 1S29A 1ENHA 4ESFA 3CCJI 5B5EC 4BKXA 5J8FA 3NWTA 2J5OA 3OYAA 1R22A 1EH6A 2JRMA 3MKWB 2KIQA 3K4BA 4HG2A 2IRFG 3W6JB 1A6IA 4KIFA 3R61A 4L9TA 4LIVA 3ASNH 2NVXJ 3ZRGA 2X6OA 3HUGA 3ZMUA 3L2CA 3TGNA 2QENA 3K0LA 1IRXA 1X3WB 2K40A 2YS9A 4MO7A 2DT7B 1NHAA 2CW7A 2PMUA 2KIUA 4NC8A 3A02A 2RC4A 1CF7B 1OCOH 4WCGA 2AQEA 2VE8A 2D5VA 3BWGA 3K6GA 1Q1HA 2DMNA 1Z3YA 3K1PA 2PJRB 3JSPA 4PUSA 3T8RA 4UB6C 2DA6A 1B1BA 2X6YA 3TL4X 1YRNB 4V19K 2V1XA 2QA4I 4N4OB 2QM3A 2A61A 3SYTA 2L02A 4B44A 2R5YA 4YIRX 2PI0A 2TRTA 3OYCA 4I01A 5J6XA 4RAFA 4CSWA 5LHGA 1D0ZA 4UXNA 3CO7C 1F4KA 3OYDA 2DO7A 3HTSB 4IEJA 2L9VA 3LWFA 5LGUA 5CVUA 4XN0A 1HXDA 4TV7A 4XOTA 4AUXA 4JX6A 1J7KA 2QF7A 3M7GA 3HPGA 1USTA 1S7EA 5BPDA 3W2VA 2IS2A 2F5DA 1OKRA 5FLMJ 2M0MA 5JVTA 4FHTA 4E7IA 2EZHA 3IRQA 4YFXF 3JRDA 2VIXA 2D1VA 1H88C 2ZXIA 4XL9A 3T5XA 1OCRH 1SANA 2DQLA 1B9NA 2CFXA 3SXYA 1J75A 2NVUB 5JFRA 5DV5A 2MD5A 1BR4A 3G3ZA 1F43A 4LK0F 3I5UA 4MGRA 2MW8A 2JSPA 1IG7A 3HOZJ 4CCJA 3Q9VA 1FOXA 4KN7X 4N0BA 4EJUA 3OYFA 1H0MA 1V5GA 2FD5A 2RGVA 2TDXA 3ZQQA 1P9QC 3QP6A 4CCKA 4EJVA 3BC8A 5D5VB 3G6EI 3GTMJ 1KQ9A 3T0YA 4F92B 2EV5A 3BG3A 4G94A 1VQMI 3OS1A 4M73A 5HDNA 1JT6A 3HZJA 1JTYA 3H92A 2VODA 1I39A 3GFLA 2IA0A 2IS4A 3CDLA 3BROA 5DS9A 3CJRB 3VPRA 1TW2A 5CVRA 3PO2J 2E2IJ 3EUAA 4X0GA 4B8XA 5IYCJ 3CDIA 1Z1DA 4AM3A 5BQTA 3FMRA 4NBQA 1OYIA 1BA5A 2G9WA 3P7NA 1BW5A 1IDZA 2KQRA 1C0WA 4XKWA 4IRIA 3N4MA 3IHUA 4HLYA 1IJWC 4GO1A 1TWFJ 3GBGA 3HYIA 3VDXA 4DQ2A 3QPTA 1HKTA 2JQ7A 1IV6A 1CF7A 1ZTRA 1R9TJ 2ID6A 2J5PA 2M7BA 1VTNC 2JA7J 4HX7A 3RZDJ 1Z7LA 4DGWB 1T08B 3WGGA 1Y1WJ 3GTGJ 3BQZA 4XM3A 1RC9A 2HI3A 3S1MJ 4M74A 2CYYA 1YRNA 1X3UA 1TW3A 4XNFA 4LFUA 1RKWA 3KP3A 5EEGA 2R7TA 1NTCA 4QTRA 3H0DA 2P6SA 1ZH5A 2EILH 3L2RA 1QA6A 3J80Z 2HOAA 5D6FA 4RGSA 3A0BC 1BW6A 3PJRA 1WWXA 1LEBA 1K6YA 2M3AA 4M3DA 1TWCJ 4WX9A 3E5XA 4RBOA 5J4YA 1WI9A 4PJNA 4O5VA 4PGGA 2R7RA 4XRSG 1ZG1A 2EJRA 1OQYA 2KKOA 2WAFA 1U5TB 1R58A 1SMTA 1VQ7I 3FIWA 5M5XJ 4UHTA 4BEHB 2CW0F 2K27A 2P0WA 2OBPA 5LRRA 3PNYA 3CCVI 4A3FJ 2ELJA 1UHWA 2BEOA 2L0KA 3R6SA 1QGPA 2MLKA 3D5SC 4LD5A 3H3ZA 2RDPA 3C2HA 2X51A 2Y9ZA 1ZLKA 3A4CA 2FBKA 4IX7A 3LNQA 2NRAC 2R93J 1BI3A 2HWVA 2DMUA 2XIGA 4BS9A 2B0LA 2EFPA 5D5XB 1BJZA 3Q5FA 1VNDA 2Z3YA 5CPRB 2RQPA 2V1NA 4A12A 2CQQA 1T38A 2L54A 2L4MA 4I98B 4LG0B 1TQPA 1O3TA 5HVQC 4HDUA 1FSEA 5EZGA 1A36A 2K4JA 3OOPA 3P9IA 3KE2A 1FYMA 1SFXA 4BU2A 1WGXA 1I6HJ 1KU2A 4KFCA 2JA2A 1LDJA 4Y13A 4W1UA 3I4MJ 1MBEA 2HGCA 2M0CA 3CCRI 5F04A 1KYWA 2KLOA 3ESWB 3GTPJ 4AYBN 1XS9A 2L9RA 2IGNA 4U0VA 2NS8A 5HDGA 1JGGA 1H9GA 1F5TA 1YI2I 3AG1H 4XKBA 4A3GJ 2OJED 1IN7A 2OAZA 2RQQA 5CQGA 2GXGA 2R7FA 3QPLA 3ZMVA 3ROUA 3HSFA 1ETQA 1K79A 1J5YA 2M45A 4LLNA 2RKHA 1R00A 2KRFA 4P96A 1S5LC 2E2HJ 2KRHA 3MKYB 1SAUA 3E7LA 3CQZJ 2FX0A 2HQ5A 2W1OA 1SD5A 4S04A 4CO8A 2R7UA 2V9VA 2XKPA 3BJOA 3DPUA 1A6QA 1HF0A 2ZFWA 3TQNA 1HW5A 2RN7A 1VQ4I 1M1EB 3DEWA 4HYEA 1T56A 2A6TA 1BL0A 3HRTA 1JGSA 1OCTC 3QODA 3FXOA 4ANJA 4RM2A 4EJWA 2HXOA 3HPHA 3W2AA 3HRMA 2HU9A 1OFCX 2ZXWH 1SEUA 4X6AJ 1FSHA 2DOAA 3SEQA 1U78A 1JKPC 2Y30A 3K4LA 1MKMA 4BH9A 2IGMA 1MMSA 1FC3A 1IV8A 3OR2C 5K1YA 3ECOA 1QQIA 4M6YA 3K4KA 5FB2A 1U5TA 5LEJA 3LSTA 2XAGA 1GT0C 3U21A 3GYHX 1GDTA 4BJ5C 2HOEA 1W7PA 1FOKA 2CWEA 2OCEA 2COBA 3WTZA 3FBNB 3ZMSA 1ERDA 4L9JA 1YW7A 1DPRA 4U87A 1YS6A 4LB6B 2EA4A 1MMNA 1BIAA 5HLTA 2VASA 1MDMB 3GEZA 1GVDA 2WV0A 2XDVA 2CGPA 3QYEA 2HDDA 3CDHA 3KP6A 2JSCA 5GAEJ 1IDYA 5E3LA 2M8EA 3ZQ7A 2H8WA 5AIQA 4A5NA 2VPRA 5F6FA 2FUG2 2WY8Q 4HDVA 4PCQA 3JSOA 4GGGA 1ON1A 3BG6A 3QWLA 5ILUA 3WGHA 4E6KG 5C3EJ 3CTAA 3M07A 1FYLA 2Y0MA 3K7AJ 4LG0A 5KK1A 1B59A 1ZGJA 3GX4X 1YOVB 2JA5J 2JT1A 4LB5A 3ZXSA 1XX5A 4M6VA 1S9HA 2E1MC 2DA1A 5L3DA 4OWRB 2IBDA 1Y56A 2R7SA 2DXIA 4IHVA 4AIKA 2DFFA 3ZQIA 4BDYA 1S7OA 4QPOA 4RB1A 1RUNA 5J1UA 2Z5UA 2G0EA 2OC6A 4NDLA 2R92J 1DDNA 3PUBA 4ZYHA 3FXMA 3KCCA 2Y69H 4PFPA 2DK8A 3HKZN 1P4WA 2PMZN 3KETA 2ESHA 4G8XA 1R4NB 3BR6A 2HKOA 4I6ZA 3FXJA 4UV8A 3G4SI 1LDKB 2R7WA 1WPKA 1WJBA 1O7LA 2GQQA 2VBYA 3PIOF 4EEFG 1XD7A 2VXDA 2XSDC 2DPDA 5HS9A 5H2FC 4RMNA 2W84A 3WTSC 5J8CA 4ZH4F 3AL0C 2W48A 1G2HA 1GLNA 1XB4A 1I5ZA 1I3AA 2O8KA 1WJAA 4MTDA 2VPLA 2DYSH 5GADJ 1MMGA 1IUFA 1KU7A 3DCFA 2K9NA 2RAEA 2DBBA 2B9SA 1MMAA 4PSWA 4U7DA 4IHYA 1F9NA 3IP4B 2XRLA 4HF1A 3B73A 2HR3A 4OIPF 2KT0A 3WU2C 5IP6A 2W00A 5IOYA 2VJ5A 1QVUA 4UVAA 1B9MA 2P7VB 2E5ZA 2IGKA 3NARA 4HX8A 9ANTA 3VYTB 4HF2A 1YIJI 4A5MA 1O7FA 4V2FA 3JRIA 2DODA 3HXLA 4XRSA 1LJ9A 1XGOA 2W24A 5GPCA 3HOVJ 4A2UA 4HAMA 4FT8A 3WG9A 4KIGA 3BR2A 4AU7A 3I0TA 2DAOA 2DOEA 2H27A 4AIDA 4BGDA 1JUMA 3I3LA 4L5IA 5B1BH 2LTPA 3BR1A 1SC7A 4I09A 2QQAA 2MH2A 3HC7A 4IL6C 2L7ZA 1MDMA 3CUQC 2Q2EA 5DUKA 2EB7A 1UG2A 2L3DA 2X9DA 3CESA 1AKHB 1D5YA 1Z6TA 1Z7UA 2KP6A 1MW7A 2HYJA 3U1KA 2JA6J 2PEXA 3ZQFA 4ESJA 1WSUA 2XAJA 2CUEA 1FIAA 2DT5A 2AQFA 3L09A 5LBQA 5HODA 3OYMA 1XDSA 1OYWA 4AYBA 4LJZF 3IUOA 4HBLA 4NUBA 3H9JA 3HSEA 1ZLJA 4IVNA 5ILSA 4KMFA 3RYPA 2BXZA 1KQ8A 4BHPA 3QU6A 3SQNA 4KICA 4JOMA 5LGNA 2WV1A 3VODA 3RCOA 3FM3A 1GXPA 2JVHA 1V3FA 4MNUA 4C9YA 2QQ8A 1PP7U 1D0XA 4A0XA 2XV4S 3H9GA 2JUCA 4FASD 1JKOC 2GA2A 5JLXA 2JK3A 3TO6A 2PQ8A 4WWCA 1AOYA 1RPWA 3ZMZA 1MBJA 1X1PA 2F6CA 4M72A 5DYMA 1T8IA 1RR8C 4L0ZB 5GPAA 1HSTA 2BHYA 2YPRA 2AS5F 2OU2A 2M8GX 2A68F 2YX4A 2VKHA 3GVAA 3AG3H 2OTLI 4PGHA 5J3LA 1DU6A 5FKNA 1ZK8A 1RESA 2KHMA 1O57A 1QRYA 1U8BA 2LY1A 5KCMA 1WI3A 3K70C 1ZAOA 4JYKA 3EUKL 1WFXA 3HGYA 3PNVA 5L3FA 2DJIA 2OPTA 2HTJA 2MYSA 1VI0A 3V7CA 3A01B 2QKLB 1YS7A 3DBRB 4DJAA 5IY5H 2CQKA 3F0CA 3S2DJ 4G6TB 4DYRA 3DP7A 2K9MA 3KP2A 2E36A 1YW9A 2E7XA 3E6CC 2I5UA 3BCAA 4OMYA 3ZOBA 3BP8A 1LUJB 2ESNA 2XF5A 3MKLA 5HLGA 2QYOA 4XLPF 1G3TA 3ZGKA 2KIMA 1K61A 5FLXZ 5F0FA 4RB0A 3VSLA 1PP8F 2V4JC 3FXUA 4J01A 3JW4A 3L2VA 1TQIA 4QPQA 1BOBA 1XGMA 4IF4A 1FBQA 3U2RA 4HRIA 2BW3B 5E18F 1HKSA 4KA4A 5BMZA 1SFEA 3RDIA 3F6OA 1IXSB 3EYYA 3CD6I 4HF0A 2R7VA 3S3NA 3X2QH 4M71A 1AKHA 3GFMA 4BBRJ 1TBXA 1IF1A 1O3SA 2DFIA 1EF4A 1D1CA 1I27A 3I53A 3ONQA 2OA4A 1LDDA 3BTJA 2ZCWA 5HLIA 5FFXA 2UWMA 2L9SA 3BJ6A 1W5SA 4CCMA 3CCLI 1N75A 3HKZA 1T0FA 2EIMH 3SFIA 3OSGA 2M5WA 2VL8A 4M3FA 1E0EA 3W2WA 3DTIA 2ECCA 1N25A 2H6BA 2Z99A 5GTHC 2VJ4A 3ERMA 3BPVA 4NC6A 5FJ8J 4BY1J 1GV5A 3RPQA 3B6AA 3E0JB 2NVQJ 1P2FA 3KYCB 2MD0A 3M8EA 4XLFA 3ZCOA 4O3MA 3J7AO 3WTXC 2A6EF 3MEXA 1E3OC 5ICEA 4M3GA 2FQ4A 4BJ6C 4KDPA 3F23A 4KT6A 1VQNI 4D7NA 3JRFA 3DLAA 4IQJA 4BY7J 5K5OA 1EV7A 4J00A 2QQ9A 1VQKI 1MBFA 3HOUJ 2GLOA 5M3FJ 1PVEA 2VXZA 4YEJA 3I55I 1S3JA 1P4XA 3BTCA 3WTWC 3BCBA 3K1NA 3BTLA 4EGZA 4YIFA 5IT3A 3ABMH 3IH4A 4UUSA 4IZZA 2Q0OA 3D0SA 5E20A 5GAHJ 3GZ5A 4CCLA 1YTYA 2R7DA 2D45A 2FNAA 3S1RJ 2R7QA 2DU9A 5IPAA 3IWFA 2ZJPF 1YE9A 1VQ5I 2DK5A 1TT0A 2OQGA 1WJ5A 2QKMB 2HXIA 2WBMA 5GP9A 2K3FA 2GXBA 1S7AA 5D6EA 2X1DA 3QPHA 2M9HA 1VQPI 1DP7P 3BG5A 3V42A 1WJFA 3OR1C 1ETKA 1A31A 2MC4A 5BS6A 2DOFA 2DCEA 1W1WE 2M2EA 2EWNA 5LHHA 3BPXA 2EFOA 3ZN1A 2NS7A 2JPCA 5F0CA 1ZHFA 3DU6A 4BACA 2Z33A 2BW3A 2OCCH 4RGUA 3R0JA 4BE2A 3QQAA 4UNOA 1D1BA 1SFKA 4ON0A 2X0LA 4B3XA 4JP0A 4A6EA 2PJPA 4CYCB 1SVOA 2GOXB 1MSFC 4RB2C 1UG0A 4NNJA 5JI6A 1MD0A 1HW1A 1VF9A 4ITVA 2XRNA 3FX3A 3K2AA 3GLLA 3MMYB 1MBKA 1YG2A 3C2BA 3TP0A 3J7YJ 2LMDA 5E1WA 1JJ8C 1IC8A 1JT0A 2FNPA 1U6GA 2W7NA 3H9QA 1WIBA 3WG7H 3CP2A 3PO3J 2A07F 4AIJA 4LMYA 4HOBA 3RPUD 4Y7NJ 3N97A 1K78A 2EZIA 2HDWA 2NXNB 3A1YA 3EQLF 3CC4I 1XC5A 4E7ZA 3F8NA 2LY2A 5DD8A 3QP5A 2DW4A 2Z2SB 1W5CC 2XSJC 3WTVC 5EDNA 2PG4A 2A69F 2FEZA 2ZJRF 1Z6RA 4YFNF 3ZPLA 4DW6A 1X1DA 4DYQA 3RZOJ 2FXAA 2QSGX 2L7MP 5J47A 3G2BA 5DCMB 3M8JA 1W0UA 1ZGAA 1XMKA 1R7JA 1W4MA 1QHHD 3ABUA 1FTTA 1GUUA 5EGOB 4Z6YA 1JUPA 3HOWJ 4R8HA 1I6XA 4ABZA 2YSRA 2L4AA 3GUDA 4KN4X 4ZDLA 3QYBA 3P5JA 2QEXI 4ENNA 4IRHA 3FK7A 2O6GE 3J7AY 4FQGA 3CCSI 3FKJA 1ORKA 2JZYA 3KP5A 2PJRA 3WHCA 3CCEI 1X3ZB 1HLVA 4DZJA 3FHNA 3LAPA 4F93B 3JRAA 4PJ0C 1J59A 2Z9OA 4C2UA 4IHWA 3MWMA 4CGZA 3LSHA 2MGQA 5CLSA 4LLLA 2FSWA 2FJ1A 3H36A 4XSZF 1UJ8A 2R3SA 1U8RA 1HW2A 3NQOA 1D8KA 4Y3OA 4A3JJ 2M7AA 3BZCA 3OYLA 3ZQCA 4IJAA 1AU7A 5TISC 1LKXA 4EM0B 3FDYA 2BOLA 5FROA 5C4JJ 2H8RA 3EUHA 2TCTA 2Y2ZA 2L7KA 3LL7A 3KFWX 1CGPA 4AD9A 2KDOA 2P7CB 3DKWA 5A2QK 1XPXA 2KPMA 3MCZA 1T98A 2XPWA 1N78A 2LD5A 2VT2A 5CYVA 3LA7A 3RI4A 2A05A 2OD5A 5FO5A 2DTZA 3S14J 1GXQA 2IEKA 4XICA 2R4GA 1B8IB 2HDCA 2P8TA 2CQ7A 3H5AA 3OYHA 4YG2F 2ZJ2A 3JTGA 2L5QA 3LFUA 2EINH 4CYCA 2W25A 3C18A 2MA3A 1MH4A 3LSPA 1TL8A 2KZVA 3PL8A 3LSKA 3TW6A 4B3AA 3I64A 2Q8KA 5D4RA 2ADUA 4DNCA 3D5LA 3FBIB 5CVVA 2LDUA 4O6JA 5M5WJ 4KJZA 1XMXA 1G3YA 2GAUA 1G4DA 4XN3A 3H3VK 1XSDA 2JA8J 2LVSA 1OR7C 1NK2P 3JRCA 2BV6A 1TWHJ 1UFMA 2BBYA 2HFHA 3LSGA 3SDGA 2H94A 3S3MA 3I58A 2EPFA 4XLAA 5E79C 2O3FA 1Z05A 1BI1A 3I71A 2ID3A 2M30A 3RPUA 5JR3A 1QVTA 3OYGA 1ACIA 2DFEA 3SHFA 3ABKH 5L3CA 2LH9A 1FMVA 1YX3A 1BR2A 3MAJA 3Q9SA 3RKQA 2FBHA 2M4GA 3BR5A 2LP0A 3BY6A 1D3YA 2K9LA 2EV6A 1LPQA 1L3LA 3WHBA 1F36A 5EGOA 4MHGA 4ENJA 2HQNA 1R1UA 1UB9A 4DBRA 2GXAA 3H3UA 3K10A 2JPBA 2KFDA 4A3KJ 4RS8A 2VQGA 2HYGD 1SD7A 1IRGA 2GM4A 1XN7A 3E6BA 2LKXA 1LEAA 4BHBA 1TNSA 2RNGA 4GXOA 1LNWA 4A6DA 4CDGA 2LREA 3PQKA 5GAGJ 5ICFA 4B09A 2DA4A 1RR7A 2R5ZB 1WRJA 3F3XA 4XMYA 3JR9A 4CXFA 4C2MJ 2VLAA 3ML6A 1TQMA 2ZNZA 4LK1F 5F08A 3DF8A 2DMQA 3DTKA 5HS7A 3TBIA 2DN0A 2P81A 2DA2A 4MLOA 4ZDPA 5LD2C 1ZQ3P 3K9TA 2VBWA 1BI0A 4XR6A 4EJOA 2LRDA 3CMAI 1IXRC 2NYXA 3G1MA 2V1UA 2V9PA 5J1YA 1KONA 1R1TA 2K9SA 2YUSA 4CUGA 1J0RA 4R1HA 4OAYA 3VB2A 2E2JJ 2STTA 3S93A 3CLQA 3C1DA 2L7FP 5FD6A 3F8CA 2WAEA 1YFHA 1MBGA
chains in the Genus database with same CATH topology
5GAEJ 1YJWI 1YJ9I 2H8WA 1VQMI 3CD6I 1VQ6I 3CCMI 3CJRB 3CCJI 3PIPF 1VQLI 4IO9F 1VQOI 3J7YJ 1HC8A 1Y39A 3CCUI 3CCRI 3CCLI 3G71I 1WIBA 5DM6F 1VQ8I 3CF5F 3CC7I 2NXNB 1YI2I 2JQ7A 3CC4I 3DLLF 3I56I 2ZJRF 3G4SI 3CC2I 1ACIA 3PIOF 1YJNI 1VQNI 4V19K 3CJQB 2QA4I 5JVGF 1VQ9I 1VQKI 3EGVB 4UY8I 2OTLI 3I55I 1VQ4I 5GADJ 1QA6A 5DM7F 2QEXI 5GAHJ 2FOWA 1YITI 3CCSI 3CCEI 2OTJI 5GAGJ 1MMSA 2ZJPF 4IOAF 1VQ5I 2ZJQF 3J7ZI 2E36A 1VQ7I 1YIJI 2K3FA 1FOWA 2E35A 2E34A 3CMAI 4IOCF 3CMEI 1VQPI 3CCVI 1YHQI 3CJSB 1FOXA 3CJTB 1S72I 3G6EI 3CCQI 1FOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE J;  1YJW I;  1YJ9 I;  2H8W A;  1VQM I;  3CD6 I;  1VQ6 I;  3CCM I;  3CJR B;  3CCJ I;  3PIP F;  1VQL I;  4IO9 F;  1VQO I;  3J7Y J;  1HC8 A;  1Y39 A;  3CCU I;  3CCR I;  3CCL I;  3G71 I;  1WIB A;  5DM6 F;  1VQ8 I;  3CF5 F;  3CC7 I;  2NXN B;  1YI2 I;  2JQ7 A;  3CC4 I;  3DLL F;  3I56 I;  2ZJR F;  3G4S I;  3CC2 I;  1ACI A;  3PIO F;  1YJN I;  1VQN I;  4V19 K;  3CJQ B;  2QA4 I;  5JVG F;  1VQ9 I;  1VQK I;  3EGV B;  4UY8 I;  2OTL I;  3I55 I;  1VQ4 I;  5GAD J;  1QA6 A;  5DM7 F;  2QEX I;  5GAH J;  2FOW A;  1YIT I;  3CCS I;  3CCE I;  2OTJ I;  5GAG J;  1MMS A;  2ZJP F;  4IOA F;  1VQ5 I;  2ZJQ F;  3J7Z I;  2E36 A;  1VQ7 I;  1YIJ I;  2K3F A;  1FOW A;  2E35 A;  2E34 A;  3CMA I;  4IOC F;  3CME I;  1VQP I;  3CCV I;  1YHQ I;  3CJS B;  1FOX A;  3CJT B;  1S72 I;  3G6E I;  3CCQ I;  1FOY A; 
#chains in the Genus database with same CATH topology
 2UXN A;  1YJW I;  3TO7 A;  4P9U A;  3BJA A;  1R6R A;  3GCM A;  2HKX A;  3GXO A;  3JRH A;  3WTY C;  2XPV A;  3BTI A;  3PSF A;  4BEH A;  3GME A;  4H4K C;  2Y31 A;  3S15 J;  3N05 A;  3J81 K;  5EF6 A;  2ZME C;  3TW7 A;  4IO9 F;  4A3L J;  1TZL A;  1GVJ A;  5IOZ A;  5J4V A;  4BBS J;  3IV5 A;  1XSX A;  1U9O A;  4BAY A;  3HOT A;  1EA3 A;  1OCC H;  3H0G J;  4XKC A;  1BOA A;  1RUO A;  3DV8 A;  2ZBK A;  3BZK A;  3RJP A;  4BQQ A;  3VWB A;  4E7J A;  2G7U A;  4B47 A;  1ULY A;  1EH7 A;  1WJE A;  5KAI C;  5H6Q A;  3QYF A;  3WE2 A;  2D2W A;  3C2G A;  3E5Q A;  2HOS A;  3CC7 I;  1MJA A;  2CG4 A;  2KZG A;  3DBH B;  4E7H A;  2CJJ A;  1E17 A;  1JHH A;  5F27 A;  1OLT A;  3O8G A;  3ZQG A;  2MFZ A;  3Q0W A;  1OCZ H;  2O7O A;  4NB5 A;  2ZKZ A;  2V9K A;  3I4N J;  5KHD A;  2ZXH A;  3EPZ A;  3KLO A;  4OAZ A;  1H8A C;  3EDP A;  4CIC A;  1SD4 A;  1OPC A;  2CMP A;  5CVJ A;  3DKX A;  2AHQ A;  4BQO A;  4DOZ A;  1ZRD A;  3CZ6 A;  4L5E A;  3SEZ A;  5TRD A;  1ETO A;  3K4M A;  1BR1 A;  4RM3 A;  1MGT A;  4GCV A;  1UHS A;  2VKE A;  1QU3 A;  3HTU A;  4HPQ A;  4KUM A;  4XRF A;  4BJT A;  1OCP A;  2E1M B;  2LY9 A;  1LFU P;  1XDU A;  3VYR B;  2VQH A;  1HA8 A;  3A03 A;  4M9S A;  2QSH X;  2XAH A;  1ODD A;  2JTV A;  3ELK A;  3I54 A;  5ERI A;  1O3Q A;  3E5U A;  3R4K A;  4XSX F;  1JTX A;  4AVZ A;  3FIS A;  2UZK A;  4GYI A;  2H09 A;  5FFZ A;  2RNJ A;  5C44 J;  3IL2 A;  4HZF A;  3CUO A;  5B66 C;  2E34 A;  1J2X A;  4MEX F;  2XF7 A;  4IOC F;  3CME I;  3DEU A;  2WB1 N;  2EFN A;  2IPQ X;  3F8B A;  3K69 A;  5K5Q A;  1P7I A;  4XLE A;  2EIK H;  4EQQ A;  2OQR A;  2KJC A;  3OYE A;  2HQR A;  1Z77 A;  2NNY A;  1GHC A;  3FXR A;  3AL0 B;  2DQR A;  1BM9 A;  4RLF A;  1HSJ A;  2PMH A;  4I76 A;  3TO9 A;  3OYK A;  1NH3 A;  2NAZ A;  3HB9 A;  2LSO A;  2NOG A;  1VQ6 I;  4ZYE A;  4KIS A;  3AAF A;  4LIU A;  3GTL J;  5EEH A;  3DTE A;  3U9G A;  5IT9 K;  4MEY F;  2IA2 A;  1R5H A;  1TT5 B;  5EJC A;  3D5R C;  5CVI A;  4RA2 A;  1KU9 A;  4YRV A;  4Q4Z F;  3K4N A;  1DGR M;  2K4B A;  1D0Y A;  3QOP A;  3Q0V A;  1BIB A;  2HS5 A;  5BPI A;  2PLY A;  1FBS A;  1G59 A;  3IH3 A;  2IT0 A;  1X4P A;  4OOI A;  4G12 A;  4G6D A;  3LQQ A;  1DU0 A;  2R7X A;  2KJB A;  4IQ4 A;  2IS1 A;  4A0Z A;  2BY3 A;  3V8L A;  4EM1 A;  1X1C A;  3DLL F;  3Q3S A;  1IN6 A;  3L2U A;  2L9N A;  3MKZ A;  3R0A A;  2F4M B;  5IP9 J;  2L01 A;  3CC2 I;  1J09 A;  1ZG3 A;  4ZZL A;  3S32 A;  5H6R A;  2CQN A;  3CUQ B;  2V7F A;  1TWG J;  1B6A A;  3G73 A;  2O61 A;  3CJQ B;  3OV8 A;  3RQI A;  1REP C;  2EZL A;  1VQ9 I;  4FE7 A;  1T0F C;  2E5N A;  1H9T A;  5EG0 B;  2CO5 A;  5JLW A;  1UMQ A;  2HTS A;  4C3I J;  4XID A;  1QZZ A;  3UKG A;  4IHT A;  3JRB A;  1FX7 A;  4B48 A;  4FIS A;  3OL4 A;  1Z91 A;  2FU4 A;  1B72 B;  2O9L A;  1ON2 A;  3OL3 A;  5EEA A;  4II2 A;  1X4O A;  3RTR A;  4U7B A;  4CHU A;  4IOA F;  4R79 A;  1ETY A;  4UUV A;  1R36 A;  3OWT A;  2KIF A;  2LBF B;  4XRM A;  2XAS A;  4D7M A;  3FWE A;  1YLF A;  1MJ9 A;  2IAI A;  3LSR A;  1FLI A;  2F4I A;  2H1L A;  2BVL A;  2JN6 A;  4HEA 2;  3FMQ A;  3TKY A;  3QPS A;  1POG A;  3S1N J;  1A35 A;  1JI8 A;  1MND A;  1QHG A;  5IYD J;  3RSN A;  3CJT B;  4PFO A;  4LGW A;  1S72 I;  4A93 J;  3WE3 A;  4DIQ A;  3OYJ A;  2CUF A;  2F4O B;  1VZ0 A;  3WU0 A;  3VEP A;  2W82 A;  3KEO A;  5E17 F;  1FEX A;  3MN2 A;  1W0T A;  3WTU C;  3K70 D;  4F55 A;  3NWS A;  1UAA A;  3ULQ B;  5KVR A;  3LSM A;  2ZSH B;  1Y1V J;  4B43 A;  1GV2 A;  4WXD A;  4CH7 A;  4CZZ A;  2CU7 A;  2HZT A;  3GTQ J;  2F2E A;  2V26 A;  4CCO A;  5EZH A;  2XRO A;  1SAX A;  1UCR A;  2DDA A;  3BQY A;  2X6X A;  5ILV A;  3IH2 A;  4HQM A;  4J19 A;  1U0J A;  1V5F A;  4IXA A;  4ESB A;  3GTO J;  1Z3X A;  2VOO A;  4XLH A;  4N9H A;  4A3B J;  4LLG F;  2XGD A;  5E1X A;  5HLH A;  2XAF A;  1RET A;  4YEL A;  2XKO A;  3PM1 A;  4II3 A;  4MFE A;  2R5Y B;  4A3C J;  2CSO A;  4C30 A;  2EFW A;  1D1A A;  6PAX A;  4JX4 A;  1I3Q J;  3OSF A;  3K2Z A;  3L9F A;  5IP7 J;  2XVC A;  2FML A;  2QWW A;  2W4S A;  2DJN A;  1W36 C;  1G3W A;  2NVY J;  5BNG A;  1IUY A;  2DA7 A;  4DZP A;  1LB2 A;  1T39 A;  4HW0 A;  2AXT C;  2F5C A;  2JMW A;  3HRU A;  3GW2 A;  2VB6 A;  3FM5 A;  1QNT A;  2K5C A;  3PSI A;  3DXJ F;  3CUQ A;  4BE0 A;  1KZH A;  2E1C A;  1LVK A;  4GFB A;  1ZRF A;  1PJR A;  1ZGW A;  3HSR A;  1TLH B;  2X4H A;  4P5O A;  4C3H J;  3CJN A;  4ZYG A;  4FX4 A;  3ZQL A;  1V54 H;  3MVP A;  5CKT A;  1FTZ A;  1MH3 A;  2X48 A;  1I1G A;  2O03 A;  4ZC3 A;  3JCU C;  3UNG C;  1G6N A;  1JKQ C;  4I02 A;  2IGO A;  3JRE A;  4HNV A;  3DBL B;  4UVC A;  1O4X A;  3M8F A;  3GZ6 A;  3RQ4 A;  1FZP B;  2DI3 A;  5KNL A;  3GTK J;  2WAQ N;  2VJJ A;  1Z0X A;  5TJJ A;  4BHC A;  2W85 A;  2DDB A;  2ZJQ F;  4BYY A;  4UUT A;  3E97 A;  3H5R A;  2WB1 A;  1XMA A;  4X1E A;  2VT3 A;  4OMZ A;  2MG4 A;  1ETV A;  3FF5 A;  4I99 C;  3EET A;  2MAB A;  4EM2 A;  3ERE D;  1H89 C;  2O8X A;  5DEQ A;  1YHQ I;  4D9J A;  1QZY A;  2X1E A;  5JHU A;  2XF6 A;  1PUF B;  3AKZ A;  1JUS A;  3COA C;  3J80 K;  1X2N A;  1IGN A;  2K85 A;  5FKO A;  2CH0 A;  2JWT A;  2VKD A;  2LOO A;  1SVM A;  4L0Y B;  3BOQ A;  2VBZ A;  1TP4 A;  3R60 A;  1ZEL A;  3A01 A;  2BY2 A;  3LA2 A;  3BZ6 A;  5DD4 A;  3HRS A;  4NQW B;  3TOA A;  2E1N A;  4BXU A;  2FF4 A;  3LOC A;  4I7H A;  4XON A;  1ETX A;  1R5I D;  4WXC A;  2XGX A;  5FKL A;  3V7R A;  3GLX A;  3A2K A;  3B6C A;  3M3Y J;  3FMS A;  5FRN A;  1QO0 D;  2YX7 A;  2FE3 A;  1VQL I;  3V8K A;  1ETW A;  1VQO I;  3GFI A;  3EUH C;  3HOX J;  5KAF C;  2BHZ A;  5E3N A;  3ZP5 A;  3PNT A;  4KNY A;  1S6L A;  1J9I A;  4PZJ A;  1MNE A;  1STZ A;  2VJI A;  4KT5 C;  1V55 H;  4RAY A;  1WJD A;  2P6T A;  3G1O A;  2ZO4 A;  3L2Q A;  2IVM A;  3KYD B;  5LRS A;  1JE8 A;  1IW7 F;  4D5C A;  1DP3 A;  1FMW A;  3UR3 C;  4GDF A;  2W57 A;  3CMM A;  2ISZ A;  2GA1 A;  3I56 I;  3I4P A;  1RNL A;  4FET A;  3V4G A;  2GBY A;  1SFU A;  1FJL A;  1WZ2 A;  2X85 A;  2ZFU A;  2JRT A;  2ZXJ A;  1T6S A;  1WVR A;  2ICW G;  2OZU A;  2WTE A;  1BJA A;  4YII A;  4DBQ A;  5HS8 A;  5JVG F;  4I2O A;  4QSH A;  1SD6 A;  2Y0S N;  3FXK A;  4XOP A;  1P4A A;  2QGU A;  1Z67 A;  3FXQ A;  3F22 A;  4E7S A;  2H6C A;  2IA1 A;  2WC2 A;  1IRF A;  1KU3 A;  1R5G A;  3KX2 A;  3HG9 A;  5DM7 F;  2YU3 A;  3AG4 H;  1JHF A;  2PN6 A;  2FMY A;  1DGW Y;  4QWQ A;  4ZYA A;  4ASN A;  2V6E A;  1LQ1 A;  4HNT A;  3JTH A;  2Q1Z B;  2IP2 A;  3T8T A;  4N9I A;  1K6O A;  1CQT A;  1IRZ A;  3MD2 A;  4U88 A;  4ZJZ A;  1ZAR A;  4Y15 A;  3BR3 A;  2XAQ A;  2V6C A;  2LKP A;  4PJL A;  4RAZ A;  4Y4R A;  1FBU A;  2CW8 A;  1UZC A;  2CV2 A;  1XG1 A;  1APL C;  1A5J A;  3SFZ A;  5H20 A;  2R7Z J;  2N8G A;  1X1A A;  2ZC2 A;  2BXY A;  3HEF A;  3TMO A;  1T2K A;  4MTE A;  3V8J A;  1EH8 A;  3SDB A;  4AWX B;  3CJS B;  4P55 A;  2VBX A;  5F0H A;  1PUF A;  2E1O A;  2JUG A;  4NHJ A;  2XGC A;  5CJ9 A;  2LC2 A;  2BY0 A;  2DFH A;  3H5N A;  4KIB A;  2IXS A;  1E2X A;  4OIO F;  1FOY A;  4A0Y A;  2GIZ A;  4BXX J;  3GTJ J;  4I0B A;  4BE1 A;  4NQW A;  3IKV A;  2IW5 A;  1S8N A;  5J1R A;  3I59 B;  4MQV A;  3O8H A;  4F91 B;  2EA2 A;  3HOY J;  1XGN A;  2DA3 A;  2BZT A;  3F6V A;  3OS2 A;  2DTR A;  3O3K A;  4NC7 A;  2XUB A;  1IN5 A;  2KIS A;  3O6B B;  4E7K A;  3TED A;  2FOK A;  1P92 A;  2CQX A;  2DMT A;  4S05 A;  5FKK A;  4YFK F;  3ZMT A;  2BYV E;  4UB8 C;  1MIJ A;  2UV1 A;  4LOC A;  3M1C A;  2K02 A;  4B4C A;  4H0E A;  2VOP A;  1V4R A;  1U5T C;  2BVM A;  4G6Q A;  3KZZ A;  4WF2 A;  2ME6 A;  2YR2 A;  2A5Y B;  2DT6 A;  2EV0 A;  3G1L A;  1WH7 A;  1XSV A;  3SZG A;  1X58 A;  1BI2 A;  2CRG A;  2FA5 A;  3E6M A;  3F9K A;  4B1R A;  3S16 J;  3L1P A;  5EYR A;  2VON A;  1YJN I;  2EH3 A;  3HBL A;  2BY1 A;  2AXL A;  1FNN A;  1P6R A;  1W7P D;  4XK4 A;  4A3I J;  4A3M J;  2HOT A;  1FYK A;  1R1V A;  3U1D A;  1JJ6 C;  1W7P B;  4KMU X;  3ZR8 X;  5B3S H;  2ELH A;  1AHD P;  1YW8 A;  3HHH A;  1BC7 C;  1RKT A;  1OJL A;  1U3E M;  1Y0U A;  3BT9 A;  2BE5 F;  3KP7 A;  3S2W A;  4RDU A;  3LQR A;  2WAQ A;  3F8F A;  3RKX A;  1XGS A;  2UUZ A;  3AG2 H;  1R71 A;  4IHS A;  1QPI A;  4CYD A;  2VN2 A;  3IKT A;  5E8G A;  2NNN A;  5DCM A;  4A3D J;  3KLN A;  2VC0 A;  4L5J A;  4N4N B;  2HVR A;  2LLK A;  3SJM A;  2MSY A;  1Y6I A;  3OOU A;  4CA0 A;  4ZDO A;  4M6X A;  1ZG5 A;  3A0H C;  1JXS A;  1RI7 A;  2LF7 A;  5E3M A;  3ASO H;  1A04 A;  2QLZ A;  3QRF F;  3S1Q J;  4HA8 A;  3HM5 A;  3ISP A;  5D5W B;  1O3R A;  2OF7 A;  1FOW A;  2V1D A;  3IWZ A;  2E35 A;  4W97 A;  3KEY A;  1WHU A;  5LLQ A;  2XGE A;  2XAU A;  4OIR F;  4BNC A;  3BG9 A;  2K86 A;  1F1Z A;  5DCF A;  4Y52 J;  1MZB A;  2IJL A;  2RV8 A;  4BQN A;  2YU9 J;  3WOD F;  2ACJ A;  5FLV A;  3OIP A;  5K7F A;  1IN4 A;  4Q5S F;  1KGS A;  3QAH A;  3S8P A;  1K7A A;  4E4H A;  5F64 A;  2EFQ A;  2EBI A;  5F1J A;  1YYV A;  1XCB A;  3I59 A;  4BXF A;  4CZC A;  2QCO A;  1WKM A;  1NG6 A;  3TOB A;  4PK4 A;  5D4S A;  3KZI C;  5E8I A;  5K7H A;  3PUF A;  1DUX C;  5HOO A;  3GO5 A;  4JX5 A;  5GTI C;  3LA3 A;  2HEO A;  3KP4 A;  3P9C A;  3LMM A;  2QSF X;  1LFB A;  2NS0 A;  3ECH A;  4RGX A;  4XOR A;  4D1Q A;  3ABL H;  3CCU I;  1YIO A;  2FRH A;  1AA7 A;  1XCV A;  1WCM J;  2OV7 A;  2RRE A;  4ZTJ A;  2WY7 Q;  2LKS A;  1D5V A;  5DUI A;  2X1C A;  4OIQ F;  4HNU A;  1K4S A;  4L9N A;  5LFA A;  1B8I A;  3F72 A;  1WJC A;  4U0Y A;  4IKF A;  5FD5 A;  2M34 A;  1X2M A;  2KRC A;  2WAD A;  4Y33 A;  1E3P A;  1WQ2 A;  3DEE A;  2F48 A;  2LG4 A;  2K9Q A;  3CLO A;  3QOE A;  3DKY A;  2CV0 A;  3T1B A;  2A5W A;  3NRV A;  4RGR A;  3OYN A;  1HBX G;  3KPH A;  2Y0S A;  2XB5 A;  2KDZ A;  3WGI A;  1P7J A;  1D8J A;  2HQA A;  3QU3 A;  1NG7 A;  3GZN B;  4P1W A;  1IZ1 A;  2QUF A;  4MQ9 F;  4HX4 A;  3AFH A;  4XLC A;  1OIS A;  3PFY A;  4EGY A;  2ISY A;  5AIP A;  5M5Y J;  4XLN F;  3M4O J;  3KYL A;  1TC3 C;  4ENM A;  1QPM A;  5CQE A;  2P5L C;  3S2H J;  4BL0 B;  2X6W A;  2ZME B;  2EK5 A;  5A2Q Z;  3L00 A;  2E7W A;  2FOW A;  2VUM J;  3E1S A;  2P4W A;  2OTJ I;  3PFI A;  1ZR2 A;  2ZSI B;  3FZV A;  2Q2E B;  1LVA A;  4U0W A;  1X1B A;  5F1R A;  3W3C A;  4WXH A;  3O2P E;  3CO6 C;  1ZN2 A;  3ZN0 A;  2QQB A;  3VFZ A;  3J7Z I;  1I50 J;  5L3G A;  5B1A H;  3HGG A;  4G7H F;  4Q47 A;  2QBY B;  1RRJ A;  1OR7 A;  3CCY A;  3M9A A;  2Y48 A;  2Z1D A;  3E3V A;  4AVP A;  3M1E A;  2CV1 A;  5M3M J;  3C3W A;  4ENK A;  3H35 A;  5FRM A;  2OZ6 A;  5E1Z B;  2R7O A;  4QLC U;  2A6H F;  3NAU A;  3KZY A;  1SMY F;  1B4A A;  3H1C A;  5FGM A;  1VFC A;  1Z9C A;  2G7H A;  3ZQH A;  3JAM K;  3RKY A;  1IO2 A;  2R5Z A;  2E19 A;  3OS0 A;  3OYB A;  3IRR A;  4L18 B;  2EQR A;  1YX5 A;  5LGT A;  3CCM I;  1OMI A;  1U9N A;  2GZW A;  2R0Q C;  4RB3 C;  3HL2 A;  4OU0 A;  2V79 A;  4FE4 A;  3VOE A;  2HPM A;  3DU5 A;  5D8K B;  2XB0 X;  1FP1 D;  3CP8 A;  3GFJ A;  4C3J J;  4EAT A;  3PIP F;  3EYI A;  3OIQ A;  5J40 A;  1PDN C;  2B63 J;  1LE8 B;  1TNT A;  2FBI A;  2O5R A;  1RZ4 A;  1Q1V A;  5K5R A;  1ONV A;  3HHG A;  1Y39 A;  3OYI A;  4FTH A;  3OMY A;  3ABT A;  5FLX K;  2CUJ A;  3RKW A;  3G71 I;  3OY9 A;  1QZE A;  1QBJ A;  2ETH A;  5LHI A;  1EJ9 A;  2HVS A;  2HYF A;  2LYC A;  1SFO J;  2MC3 A;  1ITY A;  2COM A;  4E70 A;  5DM6 F;  3LAJ A;  3L2W A;  1VQ8 I;  1DQU A;  2CUZ A;  4M9X A;  1SVL A;  2HNH A;  2ZB9 A;  5BOX A;  1ZRE A;  2XC7 A;  2KMU A;  1Y8Q B;  1YQA A;  2E71 A;  3DWL E;  3HIF A;  3B02 A;  2DYR H;  4FCY A;  1V5E A;  3TP3 A;  3BDD A;  2ZNY A;  5K7Z A;  4HV6 A;  1Z21 A;  1ZYR F;  2VKV A;  1FPQ A;  4A69 C;  3LSJ A;  4L9V A;  2VC1 A;  1FT9 A;  4Z2Y A;  2O0Y A;  3L7W A;  3EGV B;  4UY8 I;  5AON A;  1BBY A;  4IPA A;  4M3E A;  3BLY A;  1ZKG A;  2OUM A;  4Y17 A;  1DPU A;  3MZH A;  3RYR A;  4WK8 F;  2LFB A;  2ZME A;  4E7L A;  5ED4 A;  1RIO H;  1TTY A;  3MQ0 A;  3LSI A;  3TDZ C;  4PSX A;  3NEU A;  2HZD A;  1JKR C;  2A3S A;  3VYU B;  2D1H A;  1KQ0 A;  4AC0 A;  4JQF A;  4D0P A;  5HNF A;  4LG3 A;  4RLQ A;  4M9Z A;  1MNM C;  1LFP A;  4G7Z F;  3CMY A;  2EZK A;  4XBF A;  1T33 A;  1R4M B;  4UV9 A;  4GYG A;  3J81 Z;  5ICG A;  1I1S A;  2QBY A;  4K2E A;  4ZTF A;  1FWZ A;  2IS6 A;  1KA8 A;  1R23 A;  2CFO A;  3ZMD A;  2E60 A;  4HV5 A;  1E3H A;  2P5V A;  3RIR A;  2JJ7 A;  4G7O F;  3W6K B;  1IN8 A;  4PDK A;  3VYS B;  3LFK A;  5LEK A;  3W6V A;  2L2O A;  1YO5 C;  4P9F A;  2F5E A;  3DQV C;  2F5V A;  3BR0 A;  1USS A;  3E6D A;  4BUP A;  4XQF A;  2DA5 A;  1K4T A;  2STW A;  3HJE A;  4KYW A;  4G9Y A;  3PQJ A;  4IHX A;  3F8M A;  3KEQ A;  1UEL B;  4IRG A;  5DDG A;  1YJ9 I;  2EIJ H;  1X19 A;  2WA0 A;  3CF2 A;  3Q0U A;  3DPL C;  1L0O C;  2K3P A;  2KL4 A;  2MLG A;  4FX0 A;  1KYZ A;  1U2W A;  4PJM A;  3C7J A;  3FK6 A;  4EVI A;  2VQC A;  2XHK A;  4I0A A;  1Y0N A;  1IXC A;  4HQE A;  1LE8 A;  4ZZD A;  5L3E A;  1HC8 A;  3TDU C;  1NK3 P;  1HQC A;  4BQA A;  4PJJ A;  4QIW N;  1OYY A;  3HUG B;  3I9V 2;  5HDK A;  1FIP A;  2ELK A;  1MBH A;  5L3B A;  3F21 A;  1HDP A;  2QZ8 A;  4EJT A;  4UVB A;  4F52 A;  2JVG A;  3WU1 B;  3GF2 A;  2ME0 A;  3K1M A;  3CF5 F;  4UUS B;  2I8D A;  5HNH A;  2AO9 A;  3JAM Z;  1HCR A;  2DLL A;  3K4J A;  4ETS A;  2PFB A;  3HDD A;  1R49 A;  3D1N I;  3IC7 A;  3WTT C;  4HSR A;  2VE9 A;  2MH9 A;  2HVQ A;  4S0H B;  1N77 A;  5D8L B;  2WWY A;  3S3O A;  3JRG A;  2DPU A;  4HLX A;  2B7E A;  4GRI A;  2CS3 A;  4A3E J;  2LK2 A;  3DPT A;  2MBF A;  2RVC A;  4JBA A;  2GOM A;  2M87 A;  3HOS A;  2Y75 A;  3IAS 2;  1MJB A;  4F3Q A;  4DYC A;  4BDZ A;  2LF8 A;  1YIT I;  1XTA A;  3S17 J;  4KIT B;  2NOJ B;  1FY7 A;  2PX9 A;  1IAW A;  1MMD A;  4JK1 X;  2VQL A;  3GWZ A;  3FHZ A;  5FKM A;  1W36 D;  1MSE C;  2Y9Y A;  5DTD A;  1G3S A;  2FQ3 A;  3SZT A;  4V2G A;  2LR8 A;  4LIT A;  5IT9 Z;  5ICC A;  2I10 A;  3MFK A;  1T95 A;  1ZR4 A;  1HKQ A;  2BGC A;  2H1K A;  1W5T A;  2ECB A;  4MIM A;  2VI6 A;  2QVO A;  3BG7 A;  4F7Z A;  2DMP A;  1Y8R B;  1BC8 C;  2C6Y A;  5TGT A;  4OIN F;  4CCN A;  1ZRC A;  4RAG A;  1TWA J;  2Z16 A;  2PBI A;  4HST A;  3V7S A;  3REO A;  5EG0 A;  2LNB A;  5D5U B;  4M3B A;  2M1B A;  2GWR A;  4C2T A;  5E3O A;  2P5K A;  4ZYD A;  1HOM A;  2K7L A;  1UHM A;  3K4C A;  4MFD A;  5IYB J;  1FP2 A;  1AWC A;  3FKI J;  3MZY A;  5JHF A;  1G8X A;  1WH5 A;  2UXX A;  4Q48 A;  5C4X J;  1B72 A;  3KIO A;  2F5F A;  1EKE A;  4EV0 A;  3CCQ I;  3DFG A;  3VSK A;  3OIO A;  2PMZ A;  1PUE E;  4XKV A;  1PYV A;  3SZP A;  2NVT J;  3IAM 2;  4AIH A;  1K78 B;  2GIV A;  2LBF A;  1K83 J;  2M4K A;  2XPU A;  3FXL A;  4D5F A;  1HDD C;  2HPI A;  1BN5 A;  3MZ8 A;  3P9K A;  4EMS A;  1S29 A;  1ENH A;  4ESF A;  3CCJ I;  5B5E C;  4BKX A;  5J8F A;  3NWT A;  2J5O A;  3OYA A;  1R22 A;  1EH6 A;  2JRM A;  3MKW B;  2KIQ A;  3K4B A;  4HG2 A;  2IRF G;  3W6J B;  1A6I A;  4KIF A;  3R61 A;  4L9T A;  4LIV A;  3ASN H;  2NVX J;  3ZRG A;  2X6O A;  3HUG A;  3ZMU A;  3L2C A;  3TGN A;  2QEN A;  3K0L A;  1IRX A;  1X3W B;  2K40 A;  2YS9 A;  4MO7 A;  2DT7 B;  1NHA A;  2CW7 A;  2PMU A;  2KIU A;  4NC8 A;  3A02 A;  2RC4 A;  1CF7 B;  1OCO H;  4WCG A;  2AQE A;  2VE8 A;  2D5V A;  3BWG A;  3K6G A;  1Q1H A;  2DMN A;  1Z3Y A;  3K1P A;  2PJR B;  3JSP A;  4PUS A;  3T8R A;  4UB6 C;  2DA6 A;  1B1B A;  2X6Y A;  3TL4 X;  1YRN B;  4V19 K;  2V1X A;  2QA4 I;  4N4O B;  2QM3 A;  2A61 A;  3SYT A;  2L02 A;  4B44 A;  2R5Y A;  4YIR X;  2PI0 A;  2TRT A;  3OYC A;  4I01 A;  5J6X A;  4RAF A;  4CSW A;  5LHG A;  1D0Z A;  4UXN A;  3CO7 C;  1F4K A;  3OYD A;  2DO7 A;  3HTS B;  4IEJ A;  2L9V A;  3LWF A;  5LGU A;  5CVU A;  4XN0 A;  1HXD A;  4TV7 A;  4XOT A;  4AUX A;  4JX6 A;  1J7K A;  2QF7 A;  3M7G A;  3HPG A;  1UST A;  1S7E A;  5BPD A;  3W2V A;  2IS2 A;  2F5D A;  1OKR A;  5FLM J;  2M0M A;  5JVT A;  4FHT A;  4E7I A;  2EZH A;  3IRQ A;  4YFX F;  3JRD A;  2VIX A;  2D1V A;  1H88 C;  2ZXI A;  4XL9 A;  3T5X A;  1OCR H;  1SAN A;  2DQL A;  1B9N A;  2CFX A;  3SXY A;  1J75 A;  2NVU B;  5JFR A;  5DV5 A;  2MD5 A;  1BR4 A;  3G3Z A;  1F43 A;  4LK0 F;  3I5U A;  4MGR A;  2MW8 A;  2JSP A;  1IG7 A;  3HOZ J;  4CCJ A;  3Q9V A;  1FOX A;  4KN7 X;  4N0B A;  4EJU A;  3OYF A;  1H0M A;  1V5G A;  2FD5 A;  2RGV A;  2TDX A;  3ZQQ A;  1P9Q C;  3QP6 A;  4CCK A;  4EJV A;  3BC8 A;  5D5V B;  3G6E I;  3GTM J;  1KQ9 A;  3T0Y A;  4F92 B;  2EV5 A;  3BG3 A;  4G94 A;  1VQM I;  3OS1 A;  4M73 A;  5HDN A;  1JT6 A;  3HZJ A;  1JTY A;  3H92 A;  2VOD A;  1I39 A;  3GFL A;  2IA0 A;  2IS4 A;  3CDL A;  3BRO A;  5DS9 A;  3CJR B;  3VPR A;  1TW2 A;  5CVR A;  3PO2 J;  2E2I J;  3EUA A;  4X0G A;  4B8X A;  5IYC J;  3CDI A;  1Z1D A;  4AM3 A;  5BQT A;  3FMR A;  4NBQ A;  1OYI A;  1BA5 A;  2G9W A;  3P7N A;  1BW5 A;  1IDZ A;  2KQR A;  1C0W A;  4XKW A;  4IRI A;  3N4M A;  3IHU A;  4HLY A;  1IJW C;  4GO1 A;  1TWF J;  3GBG A;  3HYI A;  3VDX A;  4DQ2 A;  3QPT A;  1HKT A;  2JQ7 A;  1IV6 A;  1CF7 A;  1ZTR A;  1R9T J;  2ID6 A;  2J5P A;  2M7B A;  1VTN C;  2JA7 J;  4HX7 A;  3RZD J;  1Z7L A;  4DGW B;  1T08 B;  3WGG A;  1Y1W J;  3GTG J;  3BQZ A;  4XM3 A;  1RC9 A;  2HI3 A;  3S1M J;  4M74 A;  2CYY A;  1YRN A;  1X3U A;  1TW3 A;  4XNF A;  4LFU A;  1RKW A;  3KP3 A;  5EEG A;  2R7T A;  1NTC A;  4QTR A;  3H0D A;  2P6S A;  1ZH5 A;  2EIL H;  3L2R A;  1QA6 A;  3J80 Z;  2HOA A;  5D6F A;  4RGS A;  3A0B C;  1BW6 A;  3PJR A;  1WWX A;  1LEB A;  1K6Y A;  2M3A A;  4M3D A;  1TWC J;  4WX9 A;  3E5X A;  4RBO A;  5J4Y A;  1WI9 A;  4PJN A;  4O5V A;  4PGG A;  2R7R A;  4XRS G;  1ZG1 A;  2EJR A;  1OQY A;  2KKO A;  2WAF A;  1U5T B;  1R58 A;  1SMT A;  1VQ7 I;  3FIW A;  5M5X J;  4UHT A;  4BEH B;  2CW0 F;  2K27 A;  2P0W A;  2OBP A;  5LRR A;  3PNY A;  3CCV I;  4A3F J;  2ELJ A;  1UHW A;  2BEO A;  2L0K A;  3R6S A;  1QGP A;  2MLK A;  3D5S C;  4LD5 A;  3H3Z A;  2RDP A;  3C2H A;  2X51 A;  2Y9Z A;  1ZLK A;  3A4C A;  2FBK A;  4IX7 A;  3LNQ A;  2NRA C;  2R93 J;  1BI3 A;  2HWV A;  2DMU A;  2XIG A;  4BS9 A;  2B0L A;  2EFP A;  5D5X B;  1BJZ A;  3Q5F A;  1VND A;  2Z3Y A;  5CPR B;  2RQP A;  2V1N A;  4A12 A;  2CQQ A;  1T38 A;  2L54 A;  2L4M A;  4I98 B;  4LG0 B;  1TQP A;  1O3T A;  5HVQ C;  4HDU A;  1FSE A;  5EZG A;  1A36 A;  2K4J A;  3OOP A;  3P9I A;  3KE2 A;  1FYM A;  1SFX A;  4BU2 A;  1WGX A;  1I6H J;  1KU2 A;  4KFC A;  2JA2 A;  1LDJ A;  4Y13 A;  4W1U A;  3I4M J;  1MBE A;  2HGC A;  2M0C A;  3CCR I;  5F04 A;  1KYW A;  2KLO A;  3ESW B;  3GTP J;  4AYB N;  1XS9 A;  2L9R A;  2IGN A;  4U0V A;  2NS8 A;  5HDG A;  1JGG A;  1H9G A;  1F5T A;  1YI2 I;  3AG1 H;  4XKB A;  4A3G J;  2OJE D;  1IN7 A;  2OAZ A;  2RQQ A;  5CQG A;  2GXG A;  2R7F A;  3QPL A;  3ZMV A;  3ROU A;  3HSF A;  1ETQ A;  1K79 A;  1J5Y A;  2M45 A;  4LLN A;  2RKH A;  1R00 A;  2KRF A;  4P96 A;  1S5L C;  2E2H J;  2KRH A;  3MKY B;  1SAU A;  3E7L A;  3CQZ J;  2FX0 A;  2HQ5 A;  2W1O A;  1SD5 A;  4S04 A;  4CO8 A;  2R7U A;  2V9V A;  2XKP A;  3BJO A;  3DPU A;  1A6Q A;  1HF0 A;  2ZFW A;  3TQN A;  1HW5 A;  2RN7 A;  1VQ4 I;  1M1E B;  3DEW A;  4HYE A;  1T56 A;  2A6T A;  1BL0 A;  3HRT A;  1JGS A;  1OCT C;  3QOD A;  3FXO A;  4ANJ A;  4RM2 A;  4EJW A;  2HXO A;  3HPH A;  3W2A A;  3HRM A;  2HU9 A;  1OFC X;  2ZXW H;  1SEU A;  4X6A J;  1FSH A;  2DOA A;  3SEQ A;  1U78 A;  1JKP C;  2Y30 A;  3K4L A;  1MKM A;  4BH9 A;  2IGM A;  1MMS A;  1FC3 A;  1IV8 A;  3OR2 C;  5K1Y A;  3ECO A;  1QQI A;  4M6Y A;  3K4K A;  5FB2 A;  1U5T A;  5LEJ A;  3LST A;  2XAG A;  1GT0 C;  3U21 A;  3GYH X;  1GDT A;  4BJ5 C;  2HOE A;  1W7P A;  1FOK A;  2CWE A;  2OCE A;  2COB A;  3WTZ A;  3FBN B;  3ZMS A;  1ERD A;  4L9J A;  1YW7 A;  1DPR A;  4U87 A;  1YS6 A;  4LB6 B;  2EA4 A;  1MMN A;  1BIA A;  5HLT A;  2VAS A;  1MDM B;  3GEZ A;  1GVD A;  2WV0 A;  2XDV A;  2CGP A;  3QYE A;  2HDD A;  3CDH A;  3KP6 A;  2JSC A;  5GAE J;  1IDY A;  5E3L A;  2M8E A;  3ZQ7 A;  2H8W A;  5AIQ A;  4A5N A;  2VPR A;  5F6F A;  2FUG 2;  2WY8 Q;  4HDV A;  4PCQ A;  3JSO A;  4GGG A;  1ON1 A;  3BG6 A;  3QWL A;  5ILU A;  3WGH A;  4E6K G;  5C3E J;  3CTA A;  3M07 A;  1FYL A;  2Y0M A;  3K7A J;  4LG0 A;  5KK1 A;  1B59 A;  1ZGJ A;  3GX4 X;  1YOV B;  2JA5 J;  2JT1 A;  4LB5 A;  3ZXS A;  1XX5 A;  4M6V A;  1S9H A;  2E1M C;  2DA1 A;  5L3D A;  4OWR B;  2IBD A;  1Y56 A;  2R7S A;  2DXI A;  4IHV A;  4AIK A;  2DFF A;  3ZQI A;  4BDY A;  1S7O A;  4QPO A;  4RB1 A;  1RUN A;  5J1U A;  2Z5U A;  2G0E A;  2OC6 A;  4NDL A;  2R92 J;  1DDN A;  3PUB A;  4ZYH A;  3FXM A;  3KCC A;  2Y69 H;  4PFP A;  2DK8 A;  3HKZ N;  1P4W A;  2PMZ N;  3KET A;  2ESH A;  4G8X A;  1R4N B;  3BR6 A;  2HKO A;  4I6Z A;  3FXJ A;  4UV8 A;  3G4S I;  1LDK B;  2R7W A;  1WPK A;  1WJB A;  1O7L A;  2GQQ A;  2VBY A;  3PIO F;  4EEF G;  1XD7 A;  2VXD A;  2XSD C;  2DPD A;  5HS9 A;  5H2F C;  4RMN A;  2W84 A;  3WTS C;  5J8C A;  4ZH4 F;  3AL0 C;  2W48 A;  1G2H A;  1GLN A;  1XB4 A;  1I5Z A;  1I3A A;  2O8K A;  1WJA A;  4MTD A;  2VPL A;  2DYS H;  5GAD J;  1MMG A;  1IUF A;  1KU7 A;  3DCF A;  2K9N A;  2RAE A;  2DBB A;  2B9S A;  1MMA A;  4PSW A;  4U7D A;  4IHY A;  1F9N A;  3IP4 B;  2XRL A;  4HF1 A;  3B73 A;  2HR3 A;  4OIP F;  2KT0 A;  3WU2 C;  5IP6 A;  2W00 A;  5IOY A;  2VJ5 A;  1QVU A;  4UVA A;  1B9M A;  2P7V B;  2E5Z A;  2IGK A;  3NAR A;  4HX8 A;  9ANT A;  3VYT B;  4HF2 A;  1YIJ I;  4A5M A;  1O7F A;  4V2F A;  3JRI A;  2DOD A;  3HXL A;  4XRS A;  1LJ9 A;  1XGO A;  2W24 A;  5GPC A;  3HOV J;  4A2U A;  4HAM A;  4FT8 A;  3WG9 A;  4KIG A;  3BR2 A;  4AU7 A;  3I0T A;  2DAO A;  2DOE A;  2H27 A;  4AID A;  4BGD A;  1JUM A;  3I3L A;  4L5I A;  5B1B H;  2LTP A;  3BR1 A;  1SC7 A;  4I09 A;  2QQA A;  2MH2 A;  3HC7 A;  4IL6 C;  2L7Z A;  1MDM A;  3CUQ C;  2Q2E A;  5DUK A;  2EB7 A;  1UG2 A;  2L3D A;  2X9D A;  3CES A;  1AKH B;  1D5Y A;  1Z6T A;  1Z7U A;  2KP6 A;  1MW7 A;  2HYJ A;  3U1K A;  2JA6 J;  2PEX A;  3ZQF A;  4ESJ A;  1WSU A;  2XAJ A;  2CUE A;  1FIA A;  2DT5 A;  2AQF A;  3L09 A;  5LBQ A;  5HOD A;  3OYM A;  1XDS A;  1OYW A;  4AYB A;  4LJZ F;  3IUO A;  4HBL A;  4NUB A;  3H9J A;  3HSE A;  1ZLJ A;  4IVN A;  5ILS A;  4KMF A;  3RYP A;  2BXZ A;  1KQ8 A;  4BHP A;  3QU6 A;  3SQN A;  4KIC A;  4JOM A;  5LGN A;  2WV1 A;  3VOD A;  3RCO A;  3FM3 A;  1GXP A;  2JVH A;  1V3F A;  4MNU A;  4C9Y A;  2QQ8 A;  1PP7 U;  1D0X A;  4A0X A;  2XV4 S;  3H9G A;  2JUC A;  4FAS D;  1JKO C;  2GA2 A;  5JLX A;  2JK3 A;  3TO6 A;  2PQ8 A;  4WWC A;  1AOY A;  1RPW A;  3ZMZ A;  1MBJ A;  1X1P A;  2F6C A;  4M72 A;  5DYM A;  1T8I A;  1RR8 C;  4L0Z B;  5GPA A;  1HST A;  2BHY A;  2YPR A;  2AS5 F;  2OU2 A;  2M8G X;  2A68 F;  2YX4 A;  2VKH A;  3GVA A;  3AG3 H;  2OTL I;  4PGH A;  5J3L A;  1DU6 A;  5FKN A;  1ZK8 A;  1RES A;  2KHM A;  1O57 A;  1QRY A;  1U8B A;  2LY1 A;  5KCM A;  1WI3 A;  3K70 C;  1ZAO A;  4JYK A;  3EUK L;  1WFX A;  3HGY A;  3PNV A;  5L3F A;  2DJI A;  2OPT A;  2HTJ A;  2MYS A;  1VI0 A;  3V7C A;  3A01 B;  2QKL B;  1YS7 A;  3DBR B;  4DJA A;  5IY5 H;  2CQK A;  3F0C A;  3S2D J;  4G6T B;  4DYR A;  3DP7 A;  2K9M A;  3KP2 A;  2E36 A;  1YW9 A;  2E7X A;  3E6C C;  2I5U A;  3BCA A;  4OMY A;  3ZOB A;  3BP8 A;  1LUJ B;  2ESN A;  2XF5 A;  3MKL A;  5HLG A;  2QYO A;  4XLP F;  1G3T A;  3ZGK A;  2KIM A;  1K61 A;  5FLX Z;  5F0F A;  4RB0 A;  3VSL A;  1PP8 F;  2V4J C;  3FXU A;  4J01 A;  3JW4 A;  3L2V A;  1TQI A;  4QPQ A;  1BOB A;  1XGM A;  4IF4 A;  1FBQ A;  3U2R A;  4HRI A;  2BW3 B;  5E18 F;  1HKS A;  4KA4 A;  5BMZ A;  1SFE A;  3RDI A;  3F6O A;  1IXS B;  3EYY A;  3CD6 I;  4HF0 A;  2R7V A;  3S3N A;  3X2Q H;  4M71 A;  1AKH A;  3GFM A;  4BBR J;  1TBX A;  1IF1 A;  1O3S A;  2DFI A;  1EF4 A;  1D1C A;  1I27 A;  3I53 A;  3ONQ A;  2OA4 A;  1LDD A;  3BTJ A;  2ZCW A;  5HLI A;  5FFX A;  2UWM A;  2L9S A;  3BJ6 A;  1W5S A;  4CCM A;  3CCL I;  1N75 A;  3HKZ A;  1T0F A;  2EIM H;  3SFI A;  3OSG A;  2M5W A;  2VL8 A;  4M3F A;  1E0E A;  3W2W A;  3DTI A;  2ECC A;  1N25 A;  2H6B A;  2Z99 A;  5GTH C;  2VJ4 A;  3ERM A;  3BPV A;  4NC6 A;  5FJ8 J;  4BY1 J;  1GV5 A;  3RPQ A;  3B6A A;  3E0J B;  2NVQ J;  1P2F A;  3KYC B;  2MD0 A;  3M8E A;  4XLF A;  3ZCO A;  4O3M A;  3J7A O;  3WTX C;  2A6E F;  3MEX A;  1E3O C;  5ICE A;  4M3G A;  2FQ4 A;  4BJ6 C;  4KDP A;  3F23 A;  4KT6 A;  1VQN I;  4D7N A;  3JRF A;  3DLA A;  4IQJ A;  4BY7 J;  5K5O A;  1EV7 A;  4J00 A;  2QQ9 A;  1VQK I;  1MBF A;  3HOU J;  2GLO A;  5M3F J;  1PVE A;  2VXZ A;  4YEJ A;  3I55 I;  1S3J A;  1P4X A;  3BTC A;  3WTW C;  3BCB A;  3K1N A;  3BTL A;  4EGZ A;  4YIF A;  5IT3 A;  3ABM H;  3IH4 A;  4UUS A;  4IZZ A;  2Q0O A;  3D0S A;  5E20 A;  5GAH J;  3GZ5 A;  4CCL A;  1YTY A;  2R7D A;  2D45 A;  2FNA A;  3S1R J;  2R7Q A;  2DU9 A;  5IPA A;  3IWF A;  2ZJP F;  1YE9 A;  1VQ5 I;  2DK5 A;  1TT0 A;  2OQG A;  1WJ5 A;  2QKM B;  2HXI A;  2WBM A;  5GP9 A;  2K3F A;  2GXB A;  1S7A A;  5D6E A;  2X1D A;  3QPH A;  2M9H A;  1VQP I;  1DP7 P;  3BG5 A;  3V42 A;  1WJF A;  3OR1 C;  1ETK A;  1A31 A;  2MC4 A;  5BS6 A;  2DOF A;  2DCE A;  1W1W E;  2M2E A;  2EWN A;  5LHH A;  3BPX A;  2EFO A;  3ZN1 A;  2NS7 A;  2JPC A;  5F0C A;  1ZHF A;  3DU6 A;  4BAC A;  2Z33 A;  2BW3 A;  2OCC H;  4RGU A;  3R0J A;  4BE2 A;  3QQA A;  4UNO A;  1D1B A;  1SFK A;  4ON0 A;  2X0L A;  4B3X A;  4JP0 A;  4A6E A;  2PJP A;  4CYC B;  1SVO A;  2GOX B;  1MSF C;  4RB2 C;  1UG0 A;  4NNJ A;  5JI6 A;  1MD0 A;  1HW1 A;  1VF9 A;  4ITV A;  2XRN A;  3FX3 A;  3K2A A;  3GLL A;  3MMY B;  1MBK A;  1YG2 A;  3C2B A;  3TP0 A;  3J7Y J;  2LMD A;  5E1W A;  1JJ8 C;  1IC8 A;  1JT0 A;  2FNP A;  1U6G A;  2W7N A;  3H9Q A;  1WIB A;  3WG7 H;  3CP2 A;  3PO3 J;  2A07 F;  4AIJ A;  4LMY A;  4HOB A;  3RPU D;  4Y7N J;  3N97 A;  1K78 A;  2EZI A;  2HDW A;  2NXN B;  3A1Y A;  3EQL F;  3CC4 I;  1XC5 A;  4E7Z A;  3F8N A;  2LY2 A;  5DD8 A;  3QP5 A;  2DW4 A;  2Z2S B;  1W5C C;  2XSJ C;  3WTV C;  5EDN A;  2PG4 A;  2A69 F;  2FEZ A;  2ZJR F;  1Z6R A;  4YFN F;  3ZPL A;  4DW6 A;  1X1D A;  4DYQ A;  3RZO J;  2FXA A;  2QSG X;  2L7M P;  5J47 A;  3G2B A;  5DCM B;  3M8J A;  1W0U A;  1ZGA A;  1XMK A;  1R7J A;  1W4M A;  1QHH D;  3ABU A;  1FTT A;  1GUU A;  5EGO B;  4Z6Y A;  1JUP A;  3HOW J;  4R8H A;  1I6X A;  4ABZ A;  2YSR A;  2L4A A;  3GUD A;  4KN4 X;  4ZDL A;  3QYB A;  3P5J A;  2QEX I;  4ENN A;  4IRH A;  3FK7 A;  2O6G E;  3J7A Y;  4FQG A;  3CCS I;  3FKJ A;  1ORK A;  2JZY A;  3KP5 A;  2PJR A;  3WHC A;  3CCE I;  1X3Z B;  1HLV A;  4DZJ A;  3FHN A;  3LAP A;  4F93 B;  3JRA A;  4PJ0 C;  1J59 A;  2Z9O A;  4C2U A;  4IHW A;  3MWM A;  4CGZ A;  3LSH A;  2MGQ A;  5CLS A;  4LLL A;  2FSW A;  2FJ1 A;  3H36 A;  4XSZ F;  1UJ8 A;  2R3S A;  1U8R A;  1HW2 A;  3NQO A;  1D8K A;  4Y3O A;  4A3J J;  2M7A A;  3BZC A;  3OYL A;  3ZQC A;  4IJA A;  1AU7 A;  5TIS C;  1LKX A;  4EM0 B;  3FDY A;  2BOL A;  5FRO A;  5C4J J;  2H8R A;  3EUH A;  2TCT A;  2Y2Z A;  2L7K A;  3LL7 A;  3KFW X;  1CGP A;  4AD9 A;  2KDO A;  2P7C B;  3DKW A;  5A2Q K;  1XPX A;  2KPM A;  3MCZ A;  1T98 A;  2XPW A;  1N78 A;  2LD5 A;  2VT2 A;  5CYV A;  3LA7 A;  3RI4 A;  2A05 A;  2OD5 A;  5FO5 A;  2DTZ A;  3S14 J;  1GXQ A;  2IEK A;  4XIC A;  2R4G A;  1B8I B;  2HDC A;  2P8T A;  2CQ7 A;  3H5A A;  3OYH A;  4YG2 F;  2ZJ2 A;  3JTG A;  2L5Q A;  3LFU A;  2EIN H;  4CYC A;  2W25 A;  3C18 A;  2MA3 A;  1MH4 A;  3LSP A;  1TL8 A;  2KZV A;  3PL8 A;  3LSK A;  3TW6 A;  4B3A A;  3I64 A;  2Q8K A;  5D4R A;  2ADU A;  4DNC A;  3D5L A;  3FBI B;  5CVV A;  2LDU A;  4O6J A;  5M5W J;  4KJZ A;  1XMX A;  1G3Y A;  2GAU A;  1G4D A;  4XN3 A;  3H3V K;  1XSD A;  2JA8 J;  2LVS A;  1OR7 C;  1NK2 P;  3JRC A;  2BV6 A;  1TWH J;  1UFM A;  2BBY A;  2HFH A;  3LSG A;  3SDG A;  2H94 A;  3S3M A;  3I58 A;  2EPF A;  4XLA A;  5E79 C;  2O3F A;  1Z05 A;  1BI1 A;  3I71 A;  2ID3 A;  2M30 A;  3RPU A;  5JR3 A;  1QVT A;  3OYG A;  1ACI A;  2DFE A;  3SHF A;  3ABK H;  5L3C A;  2LH9 A;  1FMV A;  1YX3 A;  1BR2 A;  3MAJ A;  3Q9S A;  3RKQ A;  2FBH A;  2M4G A;  3BR5 A;  2LP0 A;  3BY6 A;  1D3Y A;  2K9L A;  2EV6 A;  1LPQ A;  1L3L A;  3WHB A;  1F36 A;  5EGO A;  4MHG A;  4ENJ A;  2HQN A;  1R1U A;  1UB9 A;  4DBR A;  2GXA A;  3H3U A;  3K10 A;  2JPB A;  2KFD A;  4A3K J;  4RS8 A;  2VQG A;  2HYG D;  1SD7 A;  1IRG A;  2GM4 A;  1XN7 A;  3E6B A;  2LKX A;  1LEA A;  4BHB A;  1TNS A;  2RNG A;  4GXO A;  1LNW A;  4A6D A;  4CDG A;  2LRE A;  3PQK A;  5GAG J;  5ICF A;  4B09 A;  2DA4 A;  1RR7 A;  2R5Z B;  1WRJ A;  3F3X A;  4XMY A;  3JR9 A;  4CXF A;  4C2M J;  2VLA A;  3ML6 A;  1TQM A;  2ZNZ A;  4LK1 F;  5F08 A;  3DF8 A;  2DMQ A;  3DTK A;  5HS7 A;  3TBI A;  2DN0 A;  2P81 A;  2DA2 A;  4MLO A;  4ZDP A;  5LD2 C;  1ZQ3 P;  3K9T A;  2VBW A;  1BI0 A;  4XR6 A;  4EJO A;  2LRD A;  3CMA I;  1IXR C;  2NYX A;  3G1M A;  2V1U A;  2V9P A;  5J1Y A;  1KON A;  1R1T A;  2K9S A;  2YUS A;  4CUG A;  1J0R A;  4R1H A;  4OAY A;  3VB2 A;  2E2J J;  2STT A;  3S93 A;  3CLQ A;  3C1D A;  2L7F P;  5FD6 A;  3F8C A;  2WAE A;  1YFH A;  1MBG A; 
#chains in the Genus database with same CATH homology
 5GAE J;  1YJW I;  1YJ9 I;  2H8W A;  1VQM I;  3CD6 I;  1VQ6 I;  3CCM I;  3CJR B;  3CCJ I;  3PIP F;  1VQL I;  4IO9 F;  1VQO I;  3J7Y J;  1HC8 A;  1Y39 A;  3CCU I;  3CCR I;  3CCL I;  3G71 I;  1WIB A;  5DM6 F;  1VQ8 I;  3CF5 F;  3CC7 I;  2NXN B;  1YI2 I;  2JQ7 A;  3CC4 I;  3DLL F;  3I56 I;  2ZJR F;  3G4S I;  3CC2 I;  1ACI A;  3PIO F;  1YJN I;  1VQN I;  4V19 K;  3CJQ B;  2QA4 I;  5JVG F;  1VQ9 I;  1VQK I;  3EGV B;  4UY8 I;  2OTL I;  3I55 I;  1VQ4 I;  5GAD J;  1QA6 A;  5DM7 F;  2QEX I;  5GAH J;  2FOW A;  1YIT I;  3CCS I;  3CCE I;  2OTJ I;  5GAG J;  1MMS A;  2ZJP F;  4IOA F;  1VQ5 I;  2ZJQ F;  3J7Z I;  2E36 A;  1VQ7 I;  1YIJ I;  2K3F A;  1FOW A;  2E35 A;  2E34 A;  3CMA I;  4IOC F;  3CME I;  1VQP I;  3CCV I;  1YHQ I;  3CJS B;  1FOX A;  3CJT B;  1S72 I;  3G6E I;  3CCQ I;  1FOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...