5JVTA

Crystal structure of the dna binding domain of transcription factor fli1 in complex with an 11-mer dna gaccggaagtg
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of mithramycin analogues bound to DNA and implications for targeting transcription factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Friend leukemia integration 1 transcription factor
total genus 31
structure length 96
sequence length 96
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5jvtA00
4KICA 3ZMZA 4L0ZB 2K4JA 4O5VA 3TO7A 2FQ3A 1YLFA 3QU6A 2CW0F 5E8GA 4MQ9F 4ENKA 1W7PD 5D4SA 4HAMA 4RB1A 4MGRA 2DQLA 2DT5A 5EEHA 1ZLJA 2PMHA 4RAYA 2EK5A 2A3SA 3E6CC 4NQWA 1Z6TA 2R7DA 4HX7A 1F9NA 5HVQC 2OU2A 2ZKZA 4BHPA 1I27A 3KCCA 3MEXA 2HGCA 5BPDA 5K5QA 1B4AA 5LRSA 1YYVA 2QVOA 4EJTA 3IRRA 3HTUA 2RVCA 2J5PA 4R79A 3GZ5A 1Z91A 3JAMK 1TBXA 4U7DA 1U8RA 1TNTA 2IW5A 1AWCA 4U0VA 4BHBA 2FU4A 5ICCA 1KA8A 4HZFA 3WTUC 4OIOF 2A6EF 1FY7A 2BYVE 5FFXA 5CYVA 3DQVC 3E6DA 3RKXA 1OPCA 1L0OC 5DCMB 1IF1A 1HW5A 3K69A 5F6FA 1KYZA 3BROA 1Z05A 3KZZA 3GX4X 4EM1A 2ZBKA 3GW2A 2PMUA 4HBLA 2HDCA 3SQNA 2XHKA 3ZMTA 3I71A 4LG0B 2A6HF 1IRFA 3NRVA 2HYFA 3W6JB 2HQNA 2XKPA 1KQ9A 2FNAA 1QZYA 3KEOA 2CQKA 4XSXF 4KA4A 3DXJF 2IA1A 4Q4ZF 2M8EA 4ENJA 1QGPA 1S7AA 2XAHA 2LSOA 2HFHA 2OQRA 2EFWA 3F8CA 1RZ4A 2EV6A 2D2WA 2D1VA 4Y17A 5FD6A 3WTYC 1BI1A 4DNCA 3KZYA 4EGZA 5AONA 3J7AO 5K5RA 3R6SA 2ZJ2A 4AIJA 1ZRCA 2O03A 2VE9A 3KP2A 2X0LA 3GXOA 3K0LA 5LGUA 3F8NA 5E1XA 3TDZC 1G6NA 1R22A 4YG2F 4CDGA 1W5TA 1LDJA 1V4RA 2A61A 1SD6A 2E1NA 4IHTA 3LWFA 4CO8A 4EM2A 2F2EA 2GWRA 1WKMA 1FOKA 3JTGA 1XSDA 1U78A 1G3SA 1OMIA 2P5LC 4I09A 3WTZA 3CUQB 1YS6A 2MBFA 3KP3A 2O8XA 3GFMA 5HLGA 4Y13A 5HDKA 1HKQA 1SD4A 4P5OA 2GZWA 1IW7F 1AOYA 3FXRA 4FT8A 2YX7A 3WTWC 5BMZA 2QBYA 3F8FA 4GO1A 3I59A 2QUFA 2EB7A 2FA5A 3R0AA 1KU9A 1T6SA 1HBXG 2YU3A 3I5UA 5FLXK 5JHUA 3QP6A 1D8KA 3ERED 2PFBA 1O3SA 2XIGA 3C1DA 1R23A 1F5TA 2PEXA 1YO5C 3GWZA 4BYYA 2MLGA 3DPLC 3E6MA 1ZLKA 3RKWA 2K02A 4HV6A 3EQLF 3IHUA 4I7HA 1V3FA 2RN7A 3K1PA 3V7SA 5ED4A 1FT9A 2MA3A 3V8KA 3ZMVA 3TOBA 2VE8A 1F1ZA 2HKXA 1IN8A 5LLQA 3WODF 2KRFA 2Y75A 2O61A 2M45A 1DPRA 4IVNA 5D6EA 1XMAA 5CVRA 5DV5A 1REPC 3N97A 2AS5F 2ESNA 4MNUA 2KIFA 4JK1X 2QYOA 4BNCA 4LJZF 3M1EA 1YS7A 4UV8A 1FYMA 1U5TB 1ZH5A 2JZYA 2NS0A 3P9KA 1MD0A 1XGMA 3HRMA 1K6OA 1J75A 5FFZA 2EV0A 5J8CA 1B9MA 2DI3A 5H20A 2W25A 4I2OA 2D45A 3M9AA 5D5WB 3DFGA 3F72A 3HHHA 1MDMB 4G7ZF 2L01A 4BHCA 3IWZA 3IL2A 2XKOA 2DAOA 1X3UA 3CLOA 3QU3A 2FF4A 1BI2A 4S05A 1PP7U 2P6TA 3AAFA 4KFCA 2P7VB 3DV8A 2Z9OA 3S2WA 1A04A 1W5SA 2HOEA 3HHGA 3U2RA 5HS8A 3QRFF 4KDPA 1NHAA 5EEGA 4HV5A 3EYYA 3QPHA 1UHMA 4OOIA 2H09A 1UHWA 3KP6A 3WGIA 2P4WA 3GYHX 1S6LA 1LNWA 1SD5A 2NAZA 3GFIA 2HQRA 4N9HA 4WX9A 5F1RA 1QBJA 2L54A 4L9NA 1FBUA 2NNYA 2IA2A 3WTXC 1T38A 1BI3A 2HR3A 2V9VA 1RNLA 1KU2A 2LDUA 1T2KA 1U5TC 3V8LA 2HTJA 5ICGA 1J0RA 2G7HA 2ZO4A 4PCQA 3T8RA 4OMZA 2O0YA 1IUYA 5HLHA 1WSUA 1CGPA 1FSEA 5F64A 4LMYA 1G3YA 2VBWA 4WWCA 1YG2A 4EQQA 2KIMA 5L3CA 1L3LA 1ZG3A 3GEZA 2STWA 3HRUA 2B0LA 2GXBA 5JR3A 3C3WA 3E5UA 1FYLA 3EYIA 2Y48A 2EFNA 1IXSB 4BQAA 4FHTA 5D4RA 4A5MA 4QLCU 3LSTA 4KN7X 3ZMUA 1D8JA 4M73A 1ZREA 1YW9A 5JFRA 5HS9A 4EJOA 3GFJA 4MTEA 1DUXC 4ZYHA 4G7HF 1Z6RA 2V6CA 2UXNA 1I6XA 4YIFA 4AD9A 2CGPA 2AXLA 2GAUA 3O2PE 3ML6A 1UCRA 3HTSB 2O3FA 3T5XA 2JT1A 1HKSA 2XGXA 2E1CA 2MLKA 4M72A 2ISZA 2FBKA 4N9IA 2M87A 3EUHA 3FMSA 4RB2C 4XLNF 3FZVA 5L3BA 3TOAA 1ZG5A 2VC0A 1HW2A 1U5TA 3KP5A 1BJAA 1I5ZA 2IRFG 4OMYA 3FMQA 2V1UA 4IF4A 3FXQA 3WGHA 4HW0A 1O3TA 5L3GA 4EV0A 5E1WA 4JBAA 5K1YA 3B73A 2ZMEB 4CYDA 1IN5A 3T0YA 4I98B 3JAMZ 3QP5A 1EH7A 5DUKA 1LEBA 4LB5A 2EJRA 4Q5SF 4DQ2A 4IRHA 4CZZA 2Z99A 2QQAA 2Q8KA 5BPIA 1HW1A 1EV7A 3L00A 3B02A 5JVTA 2FXAA 1KGSA 2X4HA 2DU9A 3R61A 2CYYA 4G94A 5J6XA 1XGOA 2ZCWA 4IRGA 1SAXA 4RGRA 2VT2A 2QWWA 5H6QA 1MJBA 1EH8A 1FSHA 4R8HA 1J2XA 5D6FA 1O7LA 4UUVA 3L2CA 3QPTA 3HOSA 2QBYB 4LK0F 3L9FA 5D5XB 5FD5A 3DF8A 1YTYA 5CVJA 2DK8A 3ZN1A 4RGSA 2VOOA 4M9ZA 3RPQA 2XASA 3VFZA 2OZ6A 2KJBA 2RDPA 2Q0OA 5LHGA 2YX4A 3ABUA 5DDGA 3G3ZA 3L7WA 2Z5UA 3GO5A 2PN6A 4TV7A 2M1BA 2ETHA 2OA4A 3RJPA 3ELKA 3BY6A 3GLXA 4PDKA 1ON1A 3F21A 1JGSA 2VBXA 4FX0A 1LQ1A 4P96A 1DDNA 2RV8A 3HOTA 3ZN0A 2H27A 3I0TA 2MH2A 3P9CA 4M6XA 4RGXA 1H0MA 2M30A 1TW3A 2CG4A 4I0AA 1J9IA 3D0SA 3EETA 3IWFA 4LB6B 2ISYA 5BS6A 1YIOA 3HYIA 2GQQA 3ZP5A 2DBBA 2PQ8A 5DD4A 2HS5A 1BC7C 1FZPB 5L3DA 4AWXB 2P5KA 2WTEA 2DW4A 3K1MA 2WV0A 1SFXA 3RTRA 1KYWA 4BAYA 1B9NA 4ESJA 4WCGA 4MEXF 4IXAA 4LFUA 3KETA 4A6EA 3BJ6A 2TDXA 4HF0A 1BIBA 3I4PA 3LA3A 2IVMA 4OIRF 3SXYA 3WE3A 5D8LB 4KMUX 1ZYRF 3WG9A 3Q9VA 4L18B 1R1UA 2KKOA 4ON0A 1STZA 1W4MA 3RKYA 3RI4A 2EV5A 2E7WA 1KU3A 1GXQA 2ZMEA 2UZKA 1TQMA 4KMFA 2KJCA 3V7CA 3FMRA 1USTA 3CTAA 2LF8A 3SZTA 2W24A 4KUMA 5LGNA 2F5EA 4GGGA 4CICA 1YQAA 3CO6C 1B59A 1S3JA 2PBIA 5LEKA 2K27A 1SMYF 2R3SA 4Q48A 2COMA 3LA2A 4PZJA 1KQ8A 3VB2A 1OKRA 2YPRA 4N0BA 1JHFA 4KIGA 3LQRA 5LBQA 5CJ9A 4QWQA 3O3KA 1P4WA 3KE2A 3F3XA 3TO6A 3I59B 1FBQA 2F5DA 1JE8A 4IJAA 1R5GA 3WTTC 2DFIA 2GA2A 2OAZA 2K4BA 1UB9A 3H3UA 4LLGF 4CHUA 2FNPA 3OOPA 4B8XA 2XVCA 4RB3C 3TGNA 1YFHA 2RC4A 1ZAOA 1FWZA 2ZXJA 1GVJA 3TO9A 2VONA 1XMKA 2PG4A 5BQTA 2LF7A 3R4KA 5H6RA 1H9GA 1FNNA 1LJ9A 3L09A 3IC7A 2DTRA 1E17A 2IPQX 3Q9SA 3FF5A 3ECOA 1TQIA 2MC3A 3IKTA 1IN6A 1ON2A 2QQBA 3H92A 2HWVA 3TDUC 5LEJA 2IA0A 1MZBA 3V7RA 3VODA 4XLPF 2GIVA 3FX3A 1BN5A 2YR2A 4A5NA 3E5QA 3RYPA 4M9XA 4L5IA 1PUEE 5LHIA 3TKYA 1LEAA 4CGZA 4G7OF 2Z33A 2EWNA 1OYIA 4M9SA 3CJNA 3E97A 3ISPA 5CVUA 4UHTA 1D5VA 4IHSA 3GUDA 1I1SA 3K1NA 4H0EA 1R1VA 2DQRA 1BBYA 4ZZDA 3BJOA 5ILVA 3I64A 3V8JA 3QAHA 3NQOA 2CSOA 2O6GE 3GZ6A 1TNSA 4BXUA 4HX8A 4YFNF 3J80Z 1E2XA 1P6RA 4HDVA 2BGCA 5HOOA 1IRGA 3BJAA 4P55A 1RIOH 2GA1A 5D8KB 1TW2A 4MEYF 5A2QK 1MKMA 4XRFA 5HLIA 5J8FA 3REOA 3U9GA 2A69F 5D5UB 2EA2A 3ZPLA 2UXXA 4EVIA 4U7BA 1O3RA 2BEOA 2NYXA 4HX4A 5KVRA 2OQGA 1RUNA 3M8FA 4UVAA 2EFPA 5E1ZB 1G4DA 2HKOA 4RGUA 4LLLA 2G9WA 1W7PA 4Y15A 5ICFA 1QO0D 2J5OA 1RUOA 4KIFA 5HDGA 2V1DA 5TRDA 4MQVA 4RB0A 2WC2A 5LGTA 4WXCA 2QLZA 4BH9A 5AIQA 4A0YA 1WI9A 2NNNA 2MD5A 2GXGA 3LQQA 2FEZA 3R60A 2H6BA 3R0JA 4ESFA 1FPQA 4WXHA 1UFMA 4LGWA 1XGNA 1U3EM 2FMLA 3C7JA 3M7GA 1FP1D 2DLLA 1SD7A 1F4KA 3P7NA 2HTSA 1U2WA 3TQNA 3BZ6A 2XAGA 2V79A 4K2EA 2LKPA 6PAXA 2A68F 4AIKA 2EFQA 2F5CA 1B6AA 1IAWA 4U88A 1JXSA 5DEQA 3COAC 3MWMA 1P4AA 3E6BA 3BWGA 5ILUA 2EFOA 3EDPA 2FBIA 3HRSA 1R58A 3CO7C 1XSXA 1ZRDA 5DCFA 3WU0A 4M6YA 2FBHA 1XDUA 3LAJA 4KIBA 3MQ0A 1O7FA 4ZYEA 4UNOA 4EGYA 3ROUA 3F23A 3FHZA 3LFKA 4XBFA 1QQIA 5A2QZ 1C0WA 1FLIA 1OYYA 4FX4A 4CXFA 3E5XA 3BOQA 3NEUA 4HF2A 2H94A 4L9JA 1T0FA 3G73A 4OIQF 2G7UA 3FWEA 2PI0A 2VODA 2XAQA 3W6KB 3QOPA 5LRRA 4HLYA 4ZYDA 4PGGA 2FMYA 2VT3A 4KNYA 1IXRC 1MJ9A 2BV6A 3WU1B 4UXNA 4UVCA 1MGTA 1SFUA 4LLNA 3MZHA 5E18F 4ESBA 5E17F 4EJVA 4HQEA 3SFZA 3O6BB 2A5YB 1EH6A 3GVAA 5IT9K 4I0BA 1CF7A 3FM3A 1ZHFA 1KU7A 2IJLA 2ESHA 2FE3A 1BI0A 1ONVA 3I54A 4M74A 2UWMA 5JI6A 3N4MA 5ERIA 1QZZA 4LG0A 2ELHA 1MJAA 2HEOA 2JSCA 2CWEA 3JSOA 1P92A 1FYKA 3PQKA 4U0WA 2KIUA 4L9VA 4HF1A 3DEUA 1T98A 1WRJA 2HZTA 4ENMA 2W84A 3PFIA 1IZ1A 4OINF 1PP8F 2Z3YA 2QZ8A 2BBYA 2F5FA 4A6DA 3MFKA 3DP7A 2EA4A 1XCBA 2QQ9A 1Z9CA 3F6OA 2P5VA 4WK8F 4EMSA 1HKTA 1JHHA 1K78A 5K5OA 4XSZF 4GCVA 1Z7UA 2L3DA 3F22A 2VC1A 1P2FA 1J59A 5BOXA 1IN4A 2ACJA 3VEPA 5HDNA 1R00A 2QM3A 3PQJA 4KYWA 2DO7A 2NRAC 5ILSA 4NB5A 2XAFA 1ZGAA 4I02A 1XGSA 4G9YA 5CVIA 1VTNC 1HSTA 3LA7A 1ODDA 2CO5A 5FO5A 5DYMA 1CF7B 1ZRFA 3RIRA 3FXUA 2CFXA 1T39A 1W7PB 3WGGA 1FBSA 1YW8A 1R1TA 3D5LA 3HSFA 1GHCA 2L4MA 5LHHA 4KN4X 3BPVA 1LVAA 3E3VA 3BP8A 3T8TA 3V4GA 1RI7A 4YIIA 2Q2EA 2XROA 2V1XA 1BM9A 1SFEA 3ZQ7A 5CLSA 4GYGA 1FP2A 2DK5A 3RDIA 1TQPA 1DPUA 3RYRA 3ZMSA 4L0YB 1J5YA 3K9TA 2LNBA 1S8NA 3MAJA 3SZPA 1KQ0A 1FX7A 4HOBA 3J80K 3IRQA 1R7JA 3DPTA 2FSWA 5FB2A 5DCMA 5L3FA 1BIAA 2RNJA 4O6JA 1WQ2A 3CUOA 1O57A 4ZH4F 4ASNA 1R36A 2VXZA 3F6VA 5AIPA 4RAZA 4GXOA 5IT9Z 3KLNA 4F7ZA 5FLXZ 2VOPA 2OD5A 2L02A 1OR7A 3GF2A 3HSEA 3RPUA 1DP7P 3F8BA 1P4XA 1I1GA 1K7AA 5ICEA 4WXDA 5E20A 4Q47A 2ZFWA 3CDHA 1G3TA 4B09A 4MHGA 4ETSA 1YW7A 4GYIA 2IT0A 2OBPA 1K78B 4EJUA 2L4AA 3J81Z 1HSJA 3HRTA 4ZYGA 2C6YA 1G3WA 4EJWA 1R5HA 2H6CA 2FRHA 3FM5A 3Q5FA 3MCZA 4AVPA 4NHJA 4PGHA 1ZG1A 3DKWA 3ECHA 4U0YA 5TJJA 3P9IA 2WWYA 4YFXF 4HLXA 2W85A 3JW4A 3LAPA 2W57A 1IN7A 4IRIA 2E7XA 4A0ZA 4Z2YA 5HS7A 3OV8A 2XUBA 3M8EA 4HDUA 4AIHA 2PLYA 1MDMA 3VOEA 3MZYA 2JTVA 2QENA 4EM0B 4YFKF 3H3ZA 3CUQA 3HSRA 5CVVA 1S7OA 2YSRA 4LK1F 2A07F 2RGVA 2ADUA 2JRTA 4LD5A 5DD8A 2FOKA 4R1HA 1BOAA 1U6GA 3BPXA 1LDKB 1HXDA 5E8IA 1XSVA 3JSPA 2HYGD 2K86A 4ENNA 3F8MA 1K79A 3WTVC 3KLOA 2XAJA 3WE2A 4A12A 2M5WA 3JTHA 1LDDA 2PJPA 2P8TA 2XRNA 1Y0UA 2RKHA 1IXCA 2K7LA 4UVBA 1OYWA 1HQCA 1O3QA 2VBYA 1USSA 4JQFA 1WWXA 3CUQC 3ABTA 1S29A 1PDNC 2XV4S 2ZNYA 2Y0MA 4A2UA 3J81K 1TLHB 5L3EA 4S04A 1XB4A 1B1BA 2BE5F 4G6DA 2P7CB 3KEQA 2R7FA 1XD7A 1XDSA 3ZMDA 4UV9A 4M71A 1TTYA 4OIPF 4A0XA 1J7KA 4O3MA 1ZN2A 1SMTA 4L9TA 2JPBA 1H9TA 1XCVA 1Q1HA 2STTA 2P6SA 4G6QA 2D1HA 4IPAA 1BC8C 2IP2A 4HYEA 2OZUA 5DUIA 4WF2A 3I53A 3U1DA 3KP4A 4I01A 4MTDA 1QPMA 2DPUA 2DPDA 1LB2A 4E70A 1FC3A 1GXPA 4D0PA 4G8XA 3BDDA 3GFLA 2JPCA 1XN7A 3KFWX 2MH9A 4P9UA 3ULQB 5KK1A 3IKVA 2RQPA 4L5JA 4KT5C 4ZZLA 4HA8A 2VBZA 4HQMA 3WTSC 3K2ZA 3T1BA 1ZGJA 3KP7A 4RS8A 3C18A 5FGMA 3HIFA 3SHFA 2VN2A 1ULYA 3I58A 1D3YA 4OU0A 3HUGA 4P9FA 5IT3A 2ZNZA 1ZARA 1Z1DA 5D5VB 1QNTA
chains in the Genus database with same CATH superfamily
3C2BA 4KICA 3ZMZA 3HGGA 2IS6A 4L0ZB 1D0XA 2K4JA 5KAFC 4O5VA 3TO7A 2FQ3A 4BXFA 2EH3A 1YLFA 4HSRA 5M3FJ 3QU6A 2CW0F 3QODA 4LIUA 5E8GA 4MQ9F 3CCLI 4ENKA 3DLAA 3Q0VA 2BY3A 3GTQJ 1W7PD 4BQQA 5D4SA 1V55H 4HAMA 2RREA 4RB1A 4MGRA 2X6WA 2DQLA 2DT5A 4C2TA 4AYBN 3HOXJ 5EEHA 4FE7A 1ZLJA 2BVMA 3FXOA 2V4JC 2PMHA 4FETA 1U8BA 2DMUA 2HDWA 4RAYA 2EK5A 2WAQN 5IYBJ 2A3SA 3E6CC 5J47A 4NQWA 3RZOJ 3VYRB 1Z6TA 3TP0A 2R7DA 4HX7A 4EEFG 2GM4A 1F9NA 4IKFA 5IYDJ 5HVQC 2OU2A 2ZKZA 4BHPA 3MD2A 2BHZA 2WAQA 1I27A 3KCCA 5JLWA 3VSLA 2V6EA 5EZHA 4XN3A 3MEXA 5FKOA 2HGCA 4C3HJ 5BPDA 3HOWJ 5K5QA 3QYBA 1B4AA 5LRSA 1YYVA 2QVOA 2KZVA 4BE2A 4EJTA 3IRRA 4A3CJ 3HTUA 2RVCA 3OYBA 2J5PA 5GPCA 3CJTB 4PSWA 4R79A 4JX6A 1MMNA 3GZ5A 1Z91A 3JAMK 1TBXA 5J4VA 4U7DA 1U8RA 1TNTA 2IW5A 1AWCA 4U0VA 4BHBA 2FU4A 1YE9A 1HOMA 5ICCA 1MBJA 1KA8A 2AQEA 4HZFA 3WTUC 5FRNA 4OIOF 2A6EF 1FY7A 2BYVE 5FFXA 2H8WA 5CYVA 1NK2P 3DQVC 2CQ7A 3JCUC 3MVPA 1TL8A 2DA7A 3E6DA 3CCUI 1MBKA 3HKZA 1DU0A 4ZDLA 3ZGKA 4C3JJ 1FOWA 1NG7A 3RKXA 1OPCA 3PNVA 3CDLA 1L0OC 5FLMJ 2XB0X 5DCMB 2K9NA 3EUKL 1IF1A 1HW5A 3BR5A 3K69A 2WBMA 2M8GX 5F6FA 1N78A 1KYZA 3BROA 1Z05A 3KZZA 3PIPF 4EM1A 3GX4X 2UUZA 4ZC3A 4ANJA 1D1CA 2ZBKA 3LL7A 2QSGX 3GW2A 2CV0A 2PMUA 4HBLA 2HDCA 4X1EA 2JMWA 3SQNA 2XHKA 4CCKA 1BR1A 4MFDA 3ZMTA 1QU3A 2MFZA 3SEQA 4QTRA 3I71A 4LG0B 2OF7A 2A6HF 1IRFA 3NRVA 2HYFA 2OUMA 3W6JB 2HQNA 2XKPA 4XRMA 2L7ZA 2JVGA 1KQ9A 4RMNA 2FNAA 4DZPA 3ZQQA 2LKSA 1QZYA 4BACA 3JRDA 3KEOA 2CQKA 2E1MB 3A02A 4XSXF 4F93B 4KA4A 1I39A 3DXJF 2IA1A 2R7TA 4Q4ZF 2DODA 2NS7A 3AG3H 2M8EA 4ENJA 1QGPA 2LTPA 1S7AA 2XAHA 2VASA 2JA7J 2LSOA 2HFHA 2OQRA 2FJ1A 2EFWA 3AG1H 3F8CA 4XLFA 1RZ4A 1OCZH 1ETOA 1OCPA 2H1KA 2EV6A 2D2WA 2JA2A 1X2MA 1RRJA 2D1VA 3FXJA 2WAEA 1DGRM 3AKZA 4Y17A 5FD6A 3WTYC 1BI1A 4DNCA 2E2IJ 1UG0A 3KZYA 1F36A 4EGZA 2CV1A 5AONA 3J7AO 1ZGWA 5K5RA 4BGDA 3PSFA 3R6SA 2ZJ2A 1TT5B 4AIJA 4W97A 1ZRCA 4Z6YA 2O03A 3U1KA 2VE9A 3KP2A 2X0LA 3GXOA 2K9LA 4CUGA 3K0LA 1XS9A 1MSEC 4DYRA 5LGUA 3F8NA 1X3ZB 5E1XA 1ZELA 3TDZC 1G6NA 1R22A 2DCEA 4YG2F 1Z0XA 3IAM2 5J40A 1W5TA 4CDGA 5F04A 3LSRA 3HB9A 3HZJA 4M3DA 3K2AA 1KONA 1LDJA 1ETXA 2MW8A 1B72B 3G71I 1V4RA 2A61A 1SD6A 2E1NA 4IHTA 3LWFA 4CO8A 4EM2A 3DLLF 2F2EA 3G6EI 1MBFA 2GWRA 1WKMA 1FOKA 4MIMA 1TP4A 4PSXA 1YI2I 1K83J 3JTGA 1XSDA 3BR0A 1U78A 1G3SA 1OMIA 3W2VA 4I09A 3WTZA 2P5LC 3CUQB 3I4MJ 1YS6A 1ITYA 2MBFA 3KP3A 2ID6A 2O8XA 4XOPA 3LSGA 3GFMA 1H88C 5J1RA 3L2UA 3FKJA 5HLGA 4Y13A 3DU5A 5HDKA 5LD2C 2M34A 1VQ8I 3CD6I 1HKQA 1WJ5A 2AQFA 1SD4A 3FHNA 2GZWA 4P5OA 4BKXA 1IW7F 1IJWC 2HVQA 1HA8A 1K6YA 4NC7A 2V26A 1AOYA 3FXRA 3GZNB 4FT8A 1JJ6C 2YX7A 2PJRB 3WTWC 5BMZA 2QBYA 3F8FA 4GO1A 3I59A 3ZQGA 2FX0A 2ZXIA 2QUFA 2EB7A 1ETVA 3HOZJ 2FA5A 3R0AA 3PO3J 3DKXA 1KU9A 1T6SA 1HBXG 4LITA 2YU3A 3K4KA 3I5UA 4A3MJ 2FUG2 5FLXK 5JHUA 2L7KA 3QP6A 2JA8J 2A6TA 3A2KA 2VLAA 1D8KA 2JRMA 5K7FA 5J1YA 1X1PA 3ERED 2PFBA 1FOXA 1LFPA 1O3SA 3PUBA 2IXSA 2XIGA 1RKWA 3C1DA 3OR1C 4AYBA 3S2HJ 1R23A 1F5TA 2PEXA 1YO5C 1N77A 3GWZA 4BYYA 2MLGA 1JUSA 3DPLC 4PUSA 4DZJA 3E6MA 3IUOA 5TGTA 1ZLKA 3W3CA 3RKWA 2K02A 4HV6A 3OL3A 1Y8QB 3EQLF 3IHUA 4I7HA 1V3FA 1W0TA 2RN7A 3K1PA 3V7SA 4UY8I 5ED4A 3I4NJ 1X2NA 1FT9A 2MA3A 1VQ5I 1VI0A 3V8KA 3ZMVA 2R4GA 4A3DJ 5JLXA 3TOBA 1WJDA 1Z21A 2VE8A 1F1ZA 2HKXA 2LY1A 3OYDA 1IN8A 5LLQA 3WODF 2XSDC 2KRFA 1SFKA 2MD0A 2Y75A 2O61A 3LMMA 1S72I 5FROA 2CJJA 2M45A 1DPRA 1GT0C 1PUFB 1UMQA 4IVNA 5D6EA 1XMAA 2L0KA 5CVRA 5DV5A 1IV8A 2E35A 4FASD 3OY9A 3N97A 1REPC 1F43A 4XRSG 1BJZA 2ESNA 2AS5F 4MNUA 2X6XA 3BR6A 4IO9F 1PVEA 2KIFA 4JK1X 2QYOA 2Y30A 2VKVA 4BNCA 3LSHA 4LJZF 1OCTC 3M1EA 2LK2A 1OQYA 1YS7A 4UV8A 1FYMA 4ABZA 1U5TB 4DIQA 1ZH5A 3KYDB 3HOYJ 2JZYA 2NS0A 3H5RA 4XLCA 1OFCX 5KCMA 4D1QA 3P9KA 2K9MA 1MD0A 3KEYA 1XGMA 3HRMA 1K6OA 4JYKA 2Y9ZA 1J75A 1Y8RB 2ZXWH 5FFZA 2EV0A 5J8CA 2E1MC 1B9MA 1NK3P 4EATA 1WFXA 2DI3A 4OWRB 1AHDP 5H20A 2W25A 3EUAA 2D45A 4I2OA 3M9AA 2L9NA 3S2DJ 2HVRA 2KISA 5KHDA 3OS0A 1JJ8C 3HPGA 3FXLA 1BR4A 1VQMI 1A31A 3D5RC 3LOCA 3S3NA 3CMMA 2E5ZA 5D5WB 3DFGA 3DEEA 3L2VA 3F72A 3OYKA 3HHHA 2KT0A 1MDMB 4RM2A 4G7ZF 2L01A 4BHCA 3IWZA 3ONQA 4ZTJA 3IL2A 3ZQFA 3BG6A 2L7FP 2WB1A 3S14J 1QVTA 2XKOA 2DAOA 1X3UA 3CLOA 3QU3A 4DYQA 1MNEA 2FF4A 1BI2A 2EQRA 1I50J 2IT0A 1FTTA 4XICA 4S05A 1PP7U 2P6TA 3AAFA 4KFCA 2EBIA 2P7VB 3DV8A 2W1OA 3IP4B 2Z9OA 3S2WA 4F3QA 4LOCA 2JA6J 1A04A 4A3KJ 1W5SA 2CW7A 2HOEA 3HHGA 4XONA 3U2RA 5HS8A 2K85A 2XPVA 5GTIC 2IEKA 5EDNA 3QRFF 1TWAJ 2CQXA 1ACIA 5F1JA 4KDPA 4NDLA 1NHAA 5EEGA 2EIMH 1SVMA 4HV5A 3EYYA 1A5JA 3QPHA 4BJ5C 3NAUA 1UHMA 2VL8A 4OOIA 2H09A 1UHWA 4QPQA 3KP6A 1V5GA 3WGIA 2P4WA 3GYHX 3OL4A 3IH3A 4C2MJ 1S6LA 1LNWA 1SD5A 2NAZA 2ID3A 3GFIA 4M3BA 3J7YJ 1HF0A 2HQRA 2NVUB 3VDXA 4F92B 4N9HA 2X85A 1Z67A 4WX9A 4P1WA 4JX5A 5F1RA 5HLTA 3L2RA 3Q3SA 1H89C 1QBJA 1P7IA 1BW6A 2F4OB 2L54A 5DM7F 2E71A 4L9NA 5M5WJ 1FBUA 4Y3OA 2NNYA 1D0ZA 2IA2A 3H35A 4JX4A 3WTXC 4XR6A 3A0BC 1T38A 1BI3A 2HR3A 4CCOA 2V9VA 4XORA 2VQHA 1RNLA 1KU2A 2LDUA 1I6HJ 1T2KA 1U5TC 3V8LA 2HTJA 3F9KA 5ICGA 1J0RA 2G7HA 2ZO4A 4PCQA 3PFYA 2N8GA 3H9QA 3T8RA 1AKHA 4OMZA 4FISA 4S0HB 1V54H 2O0YA 2MSYA 2KDZA 4N4OB 1IUYA 5HLHA 4AUXA 4B1RA 1DGWY 5GTHC 4BDYA 5FRMA 4L5EA 1WSUA 1CGPA 4E6KG 1FSEA 5F64A 4LMYA 1G3YA 1WJAA 4HNTA 5BNGA 2VBWA 3SDBA 4WWCA 1YG2A 3CESA 4EQQA 2QEXI 2KIMA 5L3CA 1AA7A 1PJRA 4X0GA 5E3NA 1L3LA 1JTYA 4IL6C 3KPHA 4AIDA 2VJJA 1ZG3A 3S93A 2JN6A 3GEZA 4QPOA 2STWA 1E3PA 2DJIA 2YUSA 2B0LA 3HRUA 2GXBA 5JR3A 2NVYJ 3C3WA 2CMPA 3E5UA 2RAEA 1FYLA 5EG0B 3L2WA 3EYIA 5KNLA 1W36C 3HM5A 2Y48A 3S1NJ 2X1EA 2EFNA 1IXSB 1MBEA 2M2EA 4BQAA 4FHTA 5D4RA 4A5MA 4QLCU 3LSTA 4KN7X 3J7AY 1WH7A 3ZMUA 4C2UA 3UNGC 4BS9A 4A93J 1D8JA 2I10A 1B8IB 4M73A 1T8IA 4UB6C 3D5SC 3H3VK 4YRVA 4Y33A 1RETA 1ZREA 1YW9A 5JFRA 4W1UA 3WG7H 5HS9A 4A69C 4EJOA 3PNYA 3GFJA 4MTEA 3ABMH 1DUXC 4E7IA 2EIKH 4ZYHA 1XG1A 2W82A 4G7HF 2Q1ZB 1Z6RA 2V6CA 2PMZN 2UXNA 1I6XA 3EUHC 4AD9A 4YIFA 2R5YA 2AXLA 2GAUA 2CGPA 3O2PE 2LD5A 3ML6A 1X1AA 1UCRA 3HTSB 1GVDA 3QPSA 4F52A 1IV6A 1RR7A 2O3FA 1SC7A 1X1CA 3T5XA 2LOOA 3BLYA 3H5NA 3BTLA 2WY8Q 2R0QC 2JT1A 1HKSA 3QWLA 2XGXA 2E1CA 2MLKA 3PM1A 4I99C 4M72A 3W2WA 2ISZA 2FBKA 4N9IA 1JT6A 3K10A 2M87A 3EUHA 3FMSA 3QYFA 3RPUD 4RB2C 4XLNF 3HL2A 3FZVA 3DKYA 5L3BA 3TOAA 1ZG5A 3A4CA 2DFFA 2VC0A 1HW2A 1U5TA 3KP5A 2VJIA 2BVLA 2YU9J 1JUPA 2P81A 1BJAA 3CCSI 3O8GA 3M8JA 1I5ZA 2IRFG 4PK4A 4OMYA 2HNHA 3FMQA 4D7NA 2V1UA 4IF4A 2QKLB 3OYFA 2CQNA 3FXQA 3FDYA 3WGHA 3ZQHA 5GAEJ 2DXIA 2RNGA 4HW0A 1R4NB 1O3TA 1BL0A 5L3GA 2HPIA 4EV0A 5E1WA 4JBAA 5EG0A 5K1YA 3B73A 2ZMEB 4CYDA 1IN5A 3D1NI 1LPQA 3T0YA 4I98B 3JAMZ 3QP5A 2E5NA 2QA4I 4B44A 2R7RA 2HU9A 1EH7A 3E7LA 1K4SA 5DUKA 1LEBA 4LB5A 2EJRA 3LFUA 4Q5SF 4DQ2A 3CC7I 4IRHA 3TL4X 2XGDA 3SZGA 4CZZA 2Z99A 2QQAA 3TW7A 3KIOA 4BEHA 5IPAA 4F91B 2LKXA 3S1RJ 4V2GA 2Q8KA 5BPIA 2K3FA 4BE0A 1HW1A 2EZKA 5EZGA 3K4BA 4RLQA 3ABKH 3PJRA 3DBLB 1EV7A 3L00A 2W00A 2E1OA 1OLTA 2ELKA 3B02A 3GTGJ 2BXZA 5JVTA 1MW7A 2KRHA 2FXAA 1KGSA 3G1MA 2X4HA 2B7EA 2DU9A 1UAAA 3R61A 2LY2A 3CMEI 2CYYA 4G94A 4BU2A 4E4HA 1XGOA 5J6XA 2BZTA 1TT0A 2ZCWA 2ZSHB 4IRGA 1SAXA 1HC8A 4RGRA 2VT2A 5K7HA 2QWWA 5H6QA 1MJBA 4OAYA 1EH8A 4B43A 3OYEA 1FSHA 4R8HA 3M07A 5HNFA 1J2XA 2ME0A 4J00A 5D6FA 4CCNA 1O7LA 4UUVA 3L2CA 3QPTA 4YELA 3HOSA 4MO7A 5E3OA 2X9DA 4LK0F 1FIAA 2QBYB 3L9FA 5D5XB 1VZ0A 5FD5A 3DF8A 1YTYA 5C4JJ 3AG4H 5CVJA 1I3QJ 5IY5H 2DK8A 2ZXHA 3H36A 3EPZA 2ZB9A 1ETWA 3SYTA 2JJ7A 3ZN1A 5IYCJ 4A3GJ 4BQOA 2VB6A 4RGSA 3U21A 2VOOA 4YEJA 3A0HC 2NS8A 2VUMJ 4M9ZA 2V7FA 1ZKGA 3RPQA 2XASA 2DOAA 1TWFJ 3VFZA 3ZRGA 4X6AJ 4IQ4A 2OZ6A 2KJBA 1BR2A 5C44J 1K61A 2RDPA 2XF7A 2Q0OA 5H2FC 3SFIA 5LHGA 1ORKA 2YX4A 5M5XJ 3ABUA 5DDGA 3G3ZA 1BW5A 3L7WA 5CQGA 3BG5A 2CU7A 2Z5UA 2DA3A 1VQ6I 3GO5A 2PN6A 4TV7A 2M1BA 2OJED 2ETHA 2OA4A 3JRFA 3RJPA 3DCFA 3ELKA 3BY6A 3GLXA 5GPAA 4PDKA 1ON1A 2VXDA 3F21A 1JGSA 2VBXA 4FX0A 4NUBA 3BT9A 1ETKA 4XKCA 4C3IJ 4P96A 1LQ1A 1DDNA 2RV8A 3HOTA 3CP2A 2IGNA 2W7NA 4CSWA 4UUSB 1JT0A 3ZN0A 2H27A 4IOAF 3I0TA 2MH2A 3P9CA 4M6XA 4RGXA 5F08A 1H0MA 2M30A 1TW3A 2CG4A 4I0AA 1J9IA 3D0SA 3EETA 4BBRJ 3IWFA 4LB6B 2ISYA 3QOEA 3TBIA 5BS6A 4Y52J 3RCOA 1YIOA 3HYIA 4G12A 2GQQA 3ZP5A 2DBBA 3HDDA 2PQ8A 2D5VA 5DD4A 3LSMA 1YHQI 2HS5A 3LSKA 1BC7C 1ETYA 4DGWB 4J01A 1FZPB 3ABLH 1GV5A 5L3DA 4BQNA 4AWXB 1DP3A 2P5KA 2PMZA 2WTEA 2DW4A 3K1MA 2WV0A 2Y31A 1SFXA 3GBGA 3RTRA 1KYWA 4BAYA 5J3LA 1B9NA 4ESJA 1SFOJ 4UB8C 3A01B 2HOAA 4WCGA 4MEXF 4HRIA 4IXAA 4LFUA 4CCJA 3KETA 4A6EA 3ZQLA 1VQ7I 1GV2A 4ZYAA 5GADJ 3BJ6A 2TDXA 4HF0A 5GAGJ 2R7VA 2HPMA 4NC6A 4Y7NJ 3VPRA 3M3YJ 1BIBA 4I6ZA 3I4PA 3LA3A 2IVMA 4OIRF 3SXYA 3WE3A 2ELJA 5D8LB 4KMUX 1ZYRF 3WG9A 3Q9VA 4IQJA 4L18B 1R1UA 2KKOA 4ON0A 1STZA 1W4MA 1ZQ3P 1WZ2A 3RKYA 4AVZA 1RR8C 1PUFA 3RI4A 1ETQA 1QRYA 2EV5A 2E7WA 4II3A 2BOLA 1KU3A 3HGYA 1GXQA 4N4NB 3G4SI 2VQCA 3IH4A 2ZMEA 1T0FC 2GOXB 2UZKA 2GXAA 1TQMA 3RZDJ 4KMFA 1E0EA 2BHYA 5LFAA 4FTHA 4IHVA 4XL9A 1T56A 2KJCA 3V7CA 3FMRA 1USTA 3CTAA 2JVHA 4IZZA 3BCBA 3H0GJ 2LF8A 3K4JA 3PNTA 3SZTA 2W24A 4PFPA 4H4KC 4KUMA 5LGNA 1ZR4A 2JK3A 2F5EA 5FKNA 4GGGA 4PJNA 4CICA 1YQAA 2DT7B 3CO6C 3AFHA 1B59A 1S3JA 2PBIA 3SDGA 4D7MA 1UELB 1WGXA 3LSJA 3BCAA 3OSGA 5TISC 2XRLA 5LEKA 2I8DA 2K27A 1SMYF 3H1CA 2R3SA 2R93J 3IAS2 4Q48A 2K5CA 2COMA 3LA2A 4IEJA 4BBSJ 4PZJA 5J1UA 3DTIA 1KQ8A 3W6VA 2VPLA 1YJNI 5E3MA 3HBLA 1X1BA 3VB2A 1OKRA 2YPRA 2KHMA 4DOZA 4V19K 2VKEA 3PUFA 1VQ4I 4N0BA 1JHFA 4KIGA 2CS3A 3CLQA 3ESWB 4XLAA 3CZ6A 3LQRA 5LBQA 5CJ9A 2DDAA 4QWQA 2XF5A 5EEAA 3O3KA 1P4WA 5C4XJ 2EIJH 3KE2A 3F3XA 3TO6A 3I59B 1GUUA 1FBQA 2DA6A 2F5DA 1ZK8A 1JE8A 4IJAA 2DTZA 1R5GA 3GTKJ 3WTTC 3GTMJ 1X19A 1DU6A 2DFIA 3BR3A 2LBFB 1ENHA 2GA2A 5K7ZA 2XC7A 3A03A 2OAZA 2K4BA 3DEWA 1HCRA 1UB9A 2GLOA 3H3UA 2R5ZA 1TC3C 4LLGF 1WPKA 4CHUA 2EZHA 2FNPA 3OOPA 4B8XA 4DYCA 3GTLJ 5JVGF 2XVCA 2CFOA 3BTJA 3TGNA 4RB3C 2UV1A 1YFHA 2RC4A 1ZAOA 1FWZA 4A3LJ 2ZXJA 1GVJA 1MMAA 3TO9A 2F5VA 3E0JB 3FXMA 2VONA 4PJJA 1LUJB 1XMKA 2PG4A 5BQTA 1SVLA 2LF7A 3R4KA 5GP9A 5H6RA 5F0CA 5C3EJ 1LE8A 1H9GA 4BEHB 2CUZA 1FNNA 1LJ9A 3L09A 4XKBA 3HC7A 3FBIB 3IC7A 3PSIA 4E7HA 3K70D 4MFEA 1ZR2A 2X6OA 3S3MA 2MGQA 2DTRA 4BE1A 1E17A 2IPQX 1OR7C 3PL8A 2Z16A 2COBA 3Q9SA 3FF5A 1YJ9I 1SVOA 3BTIA 3ECOA 3BTCA 1TQIA 4D5CA 2HXIA 3OIQA 2MC3A 3IKTA 1IN6A 4UUSA 1SEUA 2VKDA 3E1SA 1ON2A 2NOGA 1BOBA 3OIPA 4KISA 2QQBA 3H92A 2HWVA 3TDUC 5LEJA 2OC6A 2IA0A 1MZBA 3V7RA 3VODA 1JKRC 4XLPF 2GIVA 3FX3A 3PO2J 3AG2H 1BN5A 2YR2A 4A5NA 1YJWI 1VQ9I 1UG2A 3E5QA 3RYPA 4M9XA 4L5IA 1PUEE 4IHWA 5LHIA 2E36A 4DBQA 1VQNI 3TKYA 1LEAA 1FJLA 4E7SA 3S8PA 3MMYB 2Z33A 4E7KA 4IHYA 4CGZA 3HOUJ 4G7OF 2ZMEC 3JRHA 2CUFA 2DMTA 2EWNA 1OYIA 4M9SA 3CJNA 3E97A 3ISPA 4NC8A 2OV7A 2VJ5A 5CVUA 4B3AA 3CMYA 4LG3A 4UHTA 3FK7A 4XMYA 1P7JA 3TW6A 3OMYA 1D5VA 4IHSA 5CKTA 3GUDA 1I1SA 3K1NA 3HUGB 4H0EA 1R1VA 2DQRA 1BBYA 4NBQA 4AC0A 3AL0B 4ZZDA 3BJOA 2P0WA 2NXNB 1S7EA 4HSTA 5ILVA 3I64A 3V8JA 3JRIA 2W4SA 3K70C 3OYIA 3QAHA 3NQOA 4XKVA 3BG3A 3CDIA 2CSOA 2O6GE 4DJAA 3GZ6A 1TNSA 4HNVA 4BXUA 3W2AA 1MNDA 4B4CA 4HX8A 3OIOA 4YFNF 2ICWG 2V9PA 3J80Z 2O9LA 4D9JA 1E2XA 1P6RA 4HDVA 2M7AA 2NVQJ 2BGCA 1WJCA 5HOOA 3BJAA 2G0EA 4P55A 2RQQA 3LSIA 1IRGA 1IGNA 4B47A 1RIOH 2NVXJ 2GA1A 2K3PA 1G59A 2X51A 3DTEA 5D8KB 2ECCA 4UUTA 1YX5A 1TW2A 4MEYF 5A2QK 3OYAA 1IRZA 1MKMA 4XRFA 5HLIA 5J8FA 1SANA 1JUMA 3REOA 3U9GA 2A69F 3X2QH 5D5UB 2EA2A 3FISA 3ZPLA 3CC4I 2M4KA 3S3OA 1IO2A 4NQWB 2UXXA 4J19A 3S32A 4EVIA 4U7BA 2L5QA 1O3RA 4AU7A 2BEOA 2NYXA 4KT6A 4HX4A 5KVRA 3GCMA 1LKXA 2OQGA 3OYCA 1RUNA 5F0HA 3M8FA 2XSJC 4V2FA 4UVAA 4RAGA 2EFPA 5E1ZB 3MKYB 4HEA2 1G4DA 4BY1J 2LFBA 2HKOA 4RGUA 2K9SA 4ZDPA 2KRCA 2G9WA 1W7PA 4Y15A 5ICFA 4LLLA 1QO0D 1WJBA 2ZSIB 2J5OA 2M0MA 1LVKA 1T08B 4KITB 4RAFA 3N05A 1FTZA 1Y6IA 3MZ8A 3V42A 1RUOA 1X4OA 2CQQA 4KIFA 4BY7J 5HDGA 2LRDA 2XGEA 2V1DA 5TRDA 4PJ0C 4MQVA 4RB0A 4RM3A 2YS9A 2DN0A 2WC2A 1U9OA 1D5YA 5LGTA 4WXCA 1VQOI 3OYJA 1R4MB 2WADA 2QLZA 1Z3YA 4BH9A 5AIQA 2LC2A 2QCOA 4A0YA 3H0DA 1WI9A 4LIVA 5EF6A 2NNNA 3OS2A 2MD5A 1W36D 4CZCA 2GXGA 5M5YJ 2ZC2A 3LQQA 2FEZA 2KFDA 3HPHA 2H6BA 3R60A 3RQIA 4HNUA 3R0JA 3NWTA 4ESFA 2MABA 1V5FA 4CYCA 1FPQA 4ZJZA 4WXHA 1UFMA 4LGWA 1XGNA 5FKKA 2DA5A 4D5FA 2ZJPF 3VYSB 3RSNA 1XPXA 2B9SA 1U3EM 3AL0C 3OWTA 2FMLA 3C7JA 1XMXA 3M7GA 4I76A 4XLHA 3GTOJ 1FP1D 2DLLA 2JWTA 1SD7A 3H5AA 1F4KA 1IUFA 3P7NA 2IBDA 1Z7LA 2HTSA 1U2WA 3TQNA 2Z2SB 3BZ6A 2XAGA 2V79A 4K2EA 4JOMA 3S1MJ 2LKPA 5EGOA 3I9V2 2MG4A 6PAXA 3K7AJ 1V5EA 2A68F 2WV1A 4AIKA 2EFQA 2F5CA 2LG4A 4XLEA 3JRBA 1B6AA 3DBHB 4U88A 1IAWA 1JXSA 5DEQA 3COAC 1WJFA 3MWMA 1P4AA 3E6BA 2HXOA 3BWGA 5ILUA 2EFOA 3EDPA 2XGCA 3VSKA 2FBIA 2WB1N 4A3FJ 3HRSA 3K4LA 3M1CA 3WU2C 3ASOH 1R58A 1MH4A 3CO7C 1XSXA 1ZRDA 5DCFA 3A01A 1NG6A 3WU0A 4M6YA 1U0JA 4C9YA 1MBGA 2FBHA 1XDUA 1MSFC 1MH3A 4XK4A 3LAJA 2A5WA 4B48A 2X48A 1J09A 4KIBA 3MQ0A 2HDDA 1O7FA 4ZYEA 4UNOA 2HZDA 4EGYA 3J7ZI 3HEFA 2XAUA 1WJEA 3ROUA 3F23A 3FHZA 3RQ4A 5IP9J 3LFKA 5DS9A 4XBFA 1QQIA 3ZOBA 5A2QZ 2LREA 2IS1A 3JRAA 1C0WA 1FLIA 2A05A 2H1LA 5IOZA 5B1BH 1OYYA 4CXFA 4FX4A 3G1OA 3E5XA 3BOQA 3NEUA 2LR8A 4HF2A 1X3WB 2H94A 2IGMA 2OCEA 4L9JA 3SJMA 1T0FA 3G73A 4OIQF 4U87A 4RDUA 2G7UA 1R9TJ 3FWEA 1E3OC 2PI0A 2VODA 2XAQA 3W6KB 3S1QJ 1QA6A 2WAFA 2IS4A 3QOPA 3OYHA 5LRRA 4HLYA 1VQLI 4ZYDA 1CQTA 5FLVA 1Z3XA 2CW8A 2FMYA 2Y2ZA 4PGGA 2VT3A 2E19A 4KNYA 3GTJJ 1IXRC 4GFBA 1MJ9A 2BV6A 3WU1B 4RA2A 4UXNA 2E2HJ 2EINH 4UVCA 1MGTA 1SFUA 4LLNA 5EJCA 3MZHA 4PJLA 3WHBA 4BUPA 5E18F 4ESBA 1JKPC 5E17F 2L9RA 1RPWA 4EJVA 4HQEA 3SFZA 2KPMA 5E79C 4CCMA 3O6BB 2WA0A 2A5YB 1Y1VJ 1EH6A 1HDPA 2EZIA 3GVAA 5B1AH 5IT9K 1N25A 4I0BA 2JA5J 1UZCA 1CF7A 3CCJI 3FM3A 2OPTA 1ZHFA 2R7ZJ 1KU7A 2IJLA 2VI6A 2R7SA 2ESHA 2FE3A 1BI0A 1ONVA 2NVTJ 2BY0A 2IGOA 2M4GA 2M7BA 3I54A 4M74A 1WVRA 2HQAA 3GMEA 4G6TB 2L7MP 2ME6A 5JI6A 3N4MA 5ERIA 2UWMA 1Y1WJ 1QZZA 1MMGA 4LG0A 2R7XA 2DJNA 2ELHA 1MJAA 1YIJI 2DFHA 3I56I 1X1DA 3HG9A 2HEOA 1A6IA 2JSCA 2CWEA 3JSOA 3CP8A 3MN2A 4HG2A 2MC4A 3ZCOA 2CV2A 5IP6A 1HLVA 1EKEA 1P92A 2M9HA 1FYKA 3DBRB 9ANTA 3PQKA 4U0WA 3K4CA 2KIUA 1IDYA 4L9VA 2L2OA 4HF1A 2LVSA 4M3GA 1N75A 2H8RA 1YX3A 2DFEA 3GTPJ 3DEUA 1T98A 1WRJA 2HZTA 4ENMA 1MMDA 2W84A 3PFIA 1IZ1A 4OINF 5B5EC 3JRCA 1PP8F 1A6QA 1FOYA 4RLFA 2Z3YA 2QZ8A 2BBYA 3ZR8X 2F5FA 4A6DA 1ZTRA 3MFKA 3CF2A 3ERMA 3VYUB 1P9QC 3DP7A 2EA4A 3Q0UA 2CH0A 1XCBA 3TEDA 2EZLA 2I5UA 1M1EB 2QQ9A 2JSPA 1Z9CA 3F6OA 2B63J 5M3MJ 2GIZA 1R5ID 1VFCA 2P5VA 2X1DA 4WK8F 4EMSA 1HKTA 1JHHA 1XC5A 3JRGA 1AU7A 3ASNH 1K78A 5K5OA 5FKMA 1FIPA 4BJ6C 2R92J 2GOMA 3K4NA 4XSZF 2QKMB 4GCVA 1PYVA 1Z7UA 2ZJRF 2L3DA 3F22A 2VC1A 1IC8A 3OYMA 1P2FA 2QSFX 1J59A 2Y69H 5BOXA 2OTLI 2AXTC 1IN4A 3CJQB 4AM3A 2CUJA 2ACJA 2DYSH 3OYLA 3CCEI 3F0CA 3VEPA 5HDNA 3S15J 1R00A 2LMDA 2QM3A 1QPIA 1FEXA 1LE8B 4HPQA 4PJMA 5J4YA 2BW3A 4M6VA 3CCVI 4BDZA 2R7UA 1MBHA 3PQJA 4KYWA 2DO7A 5F27A 2NRAC 5ILSA 1T33A 4NB5A 2XAFA 1QVUA 1ZGAA 4I02A 1RKTA 1D1AA 1XGSA 5CPRB 1SAUA 4G9YA 1OJLA 5CVIA 2ZJQF 1VTNC 2JUCA 1HSTA 2Y0SA 3LA7A 1ODDA 2CO5A 5FO5A 2TCTA 5DYMA 4MLOA 1CF7B 2DA2A 1ZRFA 3RIRA 2XB5A 3UR3C 3CCYA 3FXUA 1XX5A 2CFXA 1T39A 1XTAA 1W7PB 1Y0NA 3KYLA 3WGGA 2LYCA 2QGUA 3OSFA 2VKHA 1FBSA 2DDBA 1ERDA 1YW8A 1R1TA 3D5LA 3HSFA 5EGOB 2DA4A 3CQZJ 1GHCA 2L4MA 1R71A 1WI3A 1OCOH 1JKQC 3CMAI 4M3FA 5LHHA 3FK6A 4KN4X 3BPVA 4II2A 1LVAA 3E3VA 3WHCA 3BP8A 3T8TA 2L9VA 3V4GA 1RI7A 2KP6A 4YIIA 3HXLA 1UJ8A 3BQZA 2KQRA 4FQGA 5CQEA 3QYEA 4A3IJ 2Q2EA 2XROA 2V1XA 1BM9A 1SFEA 5B66C 3ZQ7A 4IOCF 1JKOC 5CLSA 4GYGA 1Y39A 1FP2A 2DK5A 3RDIA 1TQPA 3VWBA 1DPUA 5EYRA 3RYRA 3BG9A 3DWLE 3ZMSA 4F55A 4IX7A 3H9JA 3TP3A 2R7OA 4GRIA 1Z77A 4XOTA 1FMVA 4ZDOA 4KJZA 2VPRA 4L0YB 4DBRA 1J5YA 1H8AC 3K9TA 3HKZN 2QQ8A 2LNBA 1S8NA 3MAJA 3SZPA 1KQ0A 1FX7A 2BW3B 2JUGA 4HOBA 1EF4A 3J80K 3IRQA 2LLKA 2O5RA 1R7JA 2DMPA 3DPTA 2DOEA 3KYCB 3MKZA 3CCMI 2FSWA 3DPUA 3P5JA 4CH7A 5FB2A 2OTJI 2LH9A 5DTDA 2QSHX 1LFBA 2FD5A 5DCMA 4BXXJ 1TWCJ 1WCMJ 3B6AA 3BZKA 3ZXSA 5L3FA 1BIAA 2RNJA 2R5ZB 4O6JA 3BZCA 1WQ2A 3CUOA 1O57A 1A35A 4YIRX 2Z1DA 3BC8A 3L1PA 2KMUA 4ZH4F 3B6CA 2R5YB 4ASNA 1R36A 2F4IA 1YRNB 2R7QA 2VXZA 2DMQA 2X1CA 3F6VA 5AIPA 4RAZA 2EPFA 4GXOA 3OR2C 5IT9Z 3KLNA 4F7ZA 2KZGA 5FLXZ 1VQKI 2VOPA 1G8XA 2OD5A 4BJTA 4A3EJ 2L02A 1OR7A 4PFOA 2W48A 2V1NA 1MIJA 3GF2A 3HSEA 1MMSA 1W1WE 3RPUA 4E7ZA 1T95A 1DP7P 1HDDC 3I55I 3F8BA 1P4XA 4CA0A 2DYRH 1I1GA 1K7AA 4XNFA 2IAIA 1JGGA 2XDVA 2DA1A 5HODA 5ICEA 1OCRH 4WXDA 5E20A 2KL4A 1DQUA 4Q47A 5KAIC 2JQ7A 2ZFWA 3CDHA 1WHUA 2O8KA 1G3TA 4B09A 2AHQA 4MHGA 4ETSA 1APLC 1YW7A 3HOVJ 4XRSA 3MKLA 2E2JJ 2M0CA 2HVSA 4GYIA 1OCCH 3TMOA 1W0UA 2XF6A 3IV5A 2PX9A 3OYNA 3CCRI 2OBPA 2TRTA 1WH5A 1K78B 1B72A 3MKWB 4EJUA 3L2QA 2L4AA 1D0YA 3FIWA 3J81Z 1HSJA 4BL0B 3HRTA 4OAZA 4ZYGA 2C6YA 4RBOA 3M4OJ 2AO9A 5FJ8J 1G3WA 4EJWA 1KZHA 1R5HA 2H6CA 4QSHA 1S5LC 2FRHA 3VYTB 5D5VB 3FM5A 3Q5FA 3MCZA 4AVPA 4NHJA 3OS1A 1R6RA 4PGHA 1LFUP 1IDZA 1ZG1A 1W5CC 2KLOA 3DKWA 3K4MA 3FXKA 3ECHA 3HJEA 4U0YA 1RESA 5TJJA 3RKQA 1TWGJ 2E34A 2X6YA 3P9IA 3IH2A 2WWYA 1R49A 4YFXF 4HLXA 2W85A 3JW4A 3LAPA 3LNQA 2IS2A 2W57A 1NTCA 1IN7A 3Q0WA 4ZTFA 4IRIA 2E7XA 4A0ZA 4Z2YA 5HS7A 3OV8A 2XUBA 3M8EA 4HDUA 4AIHA 2PLYA 4GDFA 5B3SH 1X58A 1MDMA 1OISA 2K40A 1POGA 2Y9YA 3VOEA 3MZYA 3QQAA 2JTVA 2K9QA 3KX2A 2QENA 1MNMC 1TZLA 4EM0B 4YFKF 3A1YA 1Y56A 3CUQA 3H3ZA 3HSRA 1AKHB 1I3AA 1IG7A 5CVVA 1O4XA 1S7OA 2WY7Q 2YSRA 3FKIJ 1GDTA 4XKWA 3G2BA 4LK1F 2A07F 2RGVA 4CCLA 2HOTA 3K6GA 1UHSA 4JP0A 5DM6F 2VJ4A 2ADUA 2FQ4A 2JRTA 4LD5A 4XIDA 5DD8A 2FOKA 1VF9A 4R1HA 1BOAA 2O7OA 1U6GA 3S17J 4A3BJ 3BPXA 1LDKB 1HXDA 2PJRA 1EJ9A 5E8IA 2Q2EB 1XSVA 3JSPA 2HYGD 2K86A 2F4MB 4NNJA 3F8MA 4ENNA 3WTVC 1K79A 3KLOA 2Y0SN 2XAJA 1K4TA 2CRGA 2QF7A 3WE2A 4A12A 2M5WA 3JTHA 3UKGA 1LDDA 2IGKA 2PJPA 4XQFA 2P8TA 2KIQA 1Y0UA 2RKHA 1IXCA 2XRNA 3H9GA 2K7LA 1RC9A 1TWHJ 4ITVA 4UVBA 1OYWA 1BA5A 5IOYA 1HQCA 3NARA 3SEZA 1YITI 1O3QA 3CCQI 3S16J 2VBYA 1USSA 4JQFA 1WWXA 3BR1A 4E7JA 3JR9A 1NH3A 1EA3A 3CUQC 3ABTA 1S29A 2GBYA 1A36A 4FE4A 1PDNC 5F0FA 5E3LA 2XV4S 1S9HA 2HQ5A 2ZNYA 4IHXA 2F48A 2FOWA 2R7WA 1GLNA 1D1BA 2Y0MA 1IRXA 4A2UA 3J81K 1TLHB 5L3EA 2VQLA 4S04A 1XB4A 2M3AA 1B1BA 3C2GA 2V9KA 2BE5F 2HYJA 4G6DA 2P7CB 2VIXA 3C2HA 3KEQA 2VQGA 2R7FA 1XD7A 1XDSA 3ZMDA 2OCCH 4UV9A 3DU6A 4E7LA 3CC2I 3ZQCA 5IP7J 1X4PA 4M71A 2XPUA 2XPWA 4XM3A 1TTYA 2ZFUA 4A0XA 4OIPF 2E60A 5FKLA 3ZQIA 1J7KA 4O3MA 3LSPA 4Y4RA 3OOUA 1ZN2A 4CYCB 1QZEA 2EILH 3OYGA 1SMTA 5HNHA 2DMNA 2MYSA 4L9TA 2JPBA 1H9TA 2BXYA 2KDOA 1XCVA 4C30A 1Q1HA 2STTA 2P6SA 4G6QA 2D1HA 3DTKA 4IPAA 5GAHJ 1BC8C 2IP2A 3JREA 4HYEA 2OZUA 5DUIA 3FBNB 4WF2A 4B3XA 3I53A 3U1DA 3KP4A 4I01A 4MTDA 3NWSA 1QPMA 2DPUA 3PIOF 2DPDA 1LB2A 2LY9A 3KZIC 3G1LA 3I3LA 4E70A 2DOFA 1FC3A 2HOSA 1Q1VA 1U9NA 1JTXA 1GXPA 4D0PA 2BY2A 1YOVB 4DW6A 2CUEA 1B8IA 1E3HA 4G8XA 3BDDA 3GFLA 1YRNA 2JPCA 1XN7A 3KFWX 2MH9A 4P9UA 4FCYA 3O8HA 3ULQB 5KK1A 3IKVA 1QHGA 3QPLA 3GLLA 2LBFA 2BY1A 2RQPA 4L5JA 4KT5C 2F6CA 4ZZLA 2DT6A 1JI8A 3CF5F 4XN0A 3BG7A 1QHHD 4HA8A 2VBZA 1VNDA 3BR2A 4HQMA 3WTSC 2L9SA 3K2ZA 2LP0A 2NOJB 1ZGJA 3T1BA 3KP7A 4RS8A 3C18A 5FGMA 3HIFA 2ECBA 3SHFA 2VN2A 1ULYA 3I58A 4M3EA 1D3YA 4OU0A 3HUGA 4P9FA 4QIWN 5IT3A 1FMWA 1VQPI 3CJRB 2ZNZA 1ZARA 1Z1DA 4A3JJ 1G2HA 3BQYA 5JHFA 2HI3A 1QNTA
chains in the Genus database with same CATH topology
4KICA 3ZMZA 4L0ZB 2K4JA 4O5VA 3TO7A 2FQ3A 1YLFA 3QU6A 2CW0F 5E8GA 4MQ9F 4ENKA 1W7PD 5D4SA 4HAMA 4RB1A 4MGRA 2DQLA 2DT5A 5EEHA 1ZLJA 2PMHA 4RAYA 2EK5A 2A3SA 3E6CC 4NQWA 1Z6TA 2R7DA 4HX7A 1F9NA 5HVQC 2OU2A 2ZKZA 4BHPA 1I27A 3KCCA 3MEXA 2HGCA 5BPDA 5K5QA 1B4AA 5LRSA 1YYVA 2QVOA 4EJTA 3IRRA 3HTUA 2RVCA 2J5PA 4R79A 3GZ5A 1Z91A 3JAMK 1TBXA 4U7DA 1U8RA 1TNTA 2IW5A 1AWCA 4U0VA 4BHBA 2FU4A 5ICCA 1KA8A 4HZFA 3WTUC 4OIOF 2A6EF 1FY7A 2BYVE 5FFXA 5CYVA 3DQVC 3E6DA 3RKXA 1OPCA 1L0OC 5DCMB 1IF1A 1HW5A 3K69A 5F6FA 1KYZA 3BROA 1Z05A 3KZZA 3GX4X 4EM1A 2ZBKA 3GW2A 2PMUA 4HBLA 2HDCA 3SQNA 2XHKA 3ZMTA 3I71A 4LG0B 2A6HF 1IRFA 3NRVA 2HYFA 3W6JB 2HQNA 2XKPA 1KQ9A 2FNAA 1QZYA 3KEOA 2CQKA 4XSXF 4KA4A 3DXJF 2IA1A 4Q4ZF 2M8EA 4ENJA 1QGPA 1S7AA 2XAHA 2LSOA 2HFHA 2OQRA 2EFWA 3F8CA 1RZ4A 2EV6A 2D2WA 2D1VA 4Y17A 5FD6A 3WTYC 1BI1A 4DNCA 3KZYA 4EGZA 5AONA 3J7AO 5K5RA 3R6SA 2ZJ2A 4AIJA 1ZRCA 2O03A 2VE9A 3KP2A 2X0LA 3GXOA 3K0LA 5LGUA 3F8NA 5E1XA 3TDZC 1G6NA 1R22A 4YG2F 4CDGA 1W5TA 1LDJA 1V4RA 2A61A 1SD6A 2E1NA 4IHTA 3LWFA 4CO8A 4EM2A 2F2EA 2GWRA 1WKMA 1FOKA 3JTGA 1XSDA 1U78A 1G3SA 1OMIA 2P5LC 4I09A 3WTZA 3CUQB 1YS6A 2MBFA 3KP3A 2O8XA 3GFMA 5HLGA 4Y13A 5HDKA 1HKQA 1SD4A 4P5OA 2GZWA 1IW7F 1AOYA 3FXRA 4FT8A 2YX7A 3WTWC 5BMZA 2QBYA 3F8FA 4GO1A 3I59A 2QUFA 2EB7A 2FA5A 3R0AA 1KU9A 1T6SA 1HBXG 2YU3A 3I5UA 5FLXK 5JHUA 3QP6A 1D8KA 3ERED 2PFBA 1O3SA 2XIGA 3C1DA 1R23A 1F5TA 2PEXA 1YO5C 3GWZA 4BYYA 2MLGA 3DPLC 3E6MA 1ZLKA 3RKWA 2K02A 4HV6A 3EQLF 3IHUA 4I7HA 1V3FA 2RN7A 3K1PA 3V7SA 5ED4A 1FT9A 2MA3A 3V8KA 3ZMVA 3TOBA 2VE8A 1F1ZA 2HKXA 1IN8A 5LLQA 3WODF 2KRFA 2Y75A 2O61A 2M45A 1DPRA 4IVNA 5D6EA 1XMAA 5CVRA 5DV5A 1REPC 3N97A 2AS5F 2ESNA 4MNUA 2KIFA 4JK1X 2QYOA 4BNCA 4LJZF 3M1EA 1YS7A 4UV8A 1FYMA 1U5TB 1ZH5A 2JZYA 2NS0A 3P9KA 1MD0A 1XGMA 3HRMA 1K6OA 1J75A 5FFZA 2EV0A 5J8CA 1B9MA 2DI3A 5H20A 2W25A 4I2OA 2D45A 3M9AA 5D5WB 3DFGA 3F72A 3HHHA 1MDMB 4G7ZF 2L01A 4BHCA 3IWZA 3IL2A 2XKOA 2DAOA 1X3UA 3CLOA 3QU3A 2FF4A 1BI2A 4S05A 1PP7U 2P6TA 3AAFA 4KFCA 2P7VB 3DV8A 2Z9OA 3S2WA 1A04A 1W5SA 2HOEA 3HHGA 3U2RA 5HS8A 3QRFF 4KDPA 1NHAA 5EEGA 4HV5A 3EYYA 3QPHA 1UHMA 4OOIA 2H09A 1UHWA 3KP6A 3WGIA 2P4WA 3GYHX 1S6LA 1LNWA 1SD5A 2NAZA 3GFIA 2HQRA 4N9HA 4WX9A 5F1RA 1QBJA 2L54A 4L9NA 1FBUA 2NNYA 2IA2A 3WTXC 1T38A 1BI3A 2HR3A 2V9VA 1RNLA 1KU2A 2LDUA 1T2KA 1U5TC 3V8LA 2HTJA 5ICGA 1J0RA 2G7HA 2ZO4A 4PCQA 3T8RA 4OMZA 2O0YA 1IUYA 5HLHA 1WSUA 1CGPA 1FSEA 5F64A 4LMYA 1G3YA 2VBWA 4WWCA 1YG2A 4EQQA 2KIMA 5L3CA 1L3LA 1ZG3A 3GEZA 2STWA 3HRUA 2B0LA 2GXBA 5JR3A 3C3WA 3E5UA 1FYLA 3EYIA 2Y48A 2EFNA 1IXSB 4BQAA 4FHTA 5D4RA 4A5MA 4QLCU 3LSTA 4KN7X 3ZMUA 1D8JA 4M73A 1ZREA 1YW9A 5JFRA 5HS9A 4EJOA 3GFJA 4MTEA 1DUXC 4ZYHA 4G7HF 1Z6RA 2V6CA 2UXNA 1I6XA 4YIFA 4AD9A 2CGPA 2AXLA 2GAUA 3O2PE 3ML6A 1UCRA 3HTSB 2O3FA 3T5XA 2JT1A 1HKSA 2XGXA 2E1CA 2MLKA 4M72A 2ISZA 2FBKA 4N9IA 2M87A 3EUHA 3FMSA 4RB2C 4XLNF 3FZVA 5L3BA 3TOAA 1ZG5A 2VC0A 1HW2A 1U5TA 3KP5A 1BJAA 1I5ZA 2IRFG 4OMYA 3FMQA 2V1UA 4IF4A 3FXQA 3WGHA 4HW0A 1O3TA 5L3GA 4EV0A 5E1WA 4JBAA 5K1YA 3B73A 2ZMEB 4CYDA 1IN5A 3T0YA 4I98B 3JAMZ 3QP5A 1EH7A 5DUKA 1LEBA 4LB5A 2EJRA 4Q5SF 4DQ2A 4IRHA 4CZZA 2Z99A 2QQAA 2Q8KA 5BPIA 1HW1A 1EV7A 3L00A 3B02A 5JVTA 2FXAA 1KGSA 2X4HA 2DU9A 3R61A 2CYYA 4G94A 5J6XA 1XGOA 2ZCWA 4IRGA 1SAXA 4RGRA 2VT2A 2QWWA 5H6QA 1MJBA 1EH8A 1FSHA 4R8HA 1J2XA 5D6FA 1O7LA 4UUVA 3L2CA 3QPTA 3HOSA 2QBYB 4LK0F 3L9FA 5D5XB 5FD5A 3DF8A 1YTYA 5CVJA 2DK8A 3ZN1A 4RGSA 2VOOA 4M9ZA 3RPQA 2XASA 3VFZA 2OZ6A 2KJBA 2RDPA 2Q0OA 5LHGA 2YX4A 3ABUA 5DDGA 3G3ZA 3L7WA 2Z5UA 3GO5A 2PN6A 4TV7A 2M1BA 2ETHA 2OA4A 3RJPA 3ELKA 3BY6A 3GLXA 4PDKA 1ON1A 3F21A 1JGSA 2VBXA 4FX0A 1LQ1A 4P96A 1DDNA 2RV8A 3HOTA 3ZN0A 2H27A 3I0TA 2MH2A 3P9CA 4M6XA 4RGXA 1H0MA 2M30A 1TW3A 2CG4A 4I0AA 1J9IA 3D0SA 3EETA 3IWFA 4LB6B 2ISYA 5BS6A 1YIOA 3HYIA 2GQQA 3ZP5A 2DBBA 2PQ8A 5DD4A 2HS5A 1BC7C 1FZPB 5L3DA 4AWXB 2P5KA 2WTEA 2DW4A 3K1MA 2WV0A 1SFXA 3RTRA 1KYWA 4BAYA 1B9NA 4ESJA 4WCGA 4MEXF 4IXAA 4LFUA 3KETA 4A6EA 3BJ6A 2TDXA 4HF0A 1BIBA 3I4PA 3LA3A 2IVMA 4OIRF 3SXYA 3WE3A 5D8LB 4KMUX 1ZYRF 3WG9A 3Q9VA 4L18B 1R1UA 2KKOA 4ON0A 1STZA 1W4MA 3RKYA 3RI4A 2EV5A 2E7WA 1KU3A 1GXQA 2ZMEA 2UZKA 1TQMA 4KMFA 2KJCA 3V7CA 3FMRA 1USTA 3CTAA 2LF8A 3SZTA 2W24A 4KUMA 5LGNA 2F5EA 4GGGA 4CICA 1YQAA 3CO6C 1B59A 1S3JA 2PBIA 5LEKA 2K27A 1SMYF 2R3SA 4Q48A 2COMA 3LA2A 4PZJA 1KQ8A 3VB2A 1OKRA 2YPRA 4N0BA 1JHFA 4KIGA 3LQRA 5LBQA 5CJ9A 4QWQA 3O3KA 1P4WA 3KE2A 3F3XA 3TO6A 3I59B 1FBQA 2F5DA 1JE8A 4IJAA 1R5GA 3WTTC 2DFIA 2GA2A 2OAZA 2K4BA 1UB9A 3H3UA 4LLGF 4CHUA 2FNPA 3OOPA 4B8XA 2XVCA 4RB3C 3TGNA 1YFHA 2RC4A 1ZAOA 1FWZA 2ZXJA 1GVJA 3TO9A 2VONA 1XMKA 2PG4A 5BQTA 2LF7A 3R4KA 5H6RA 1H9GA 1FNNA 1LJ9A 3L09A 3IC7A 2DTRA 1E17A 2IPQX 3Q9SA 3FF5A 3ECOA 1TQIA 2MC3A 3IKTA 1IN6A 1ON2A 2QQBA 3H92A 2HWVA 3TDUC 5LEJA 2IA0A 1MZBA 3V7RA 3VODA 4XLPF 2GIVA 3FX3A 1BN5A 2YR2A 4A5NA 3E5QA 3RYPA 4M9XA 4L5IA 1PUEE 5LHIA 3TKYA 1LEAA 4CGZA 4G7OF 2Z33A 2EWNA 1OYIA 4M9SA 3CJNA 3E97A 3ISPA 5CVUA 4UHTA 1D5VA 4IHSA 3GUDA 1I1SA 3K1NA 4H0EA 1R1VA 2DQRA 1BBYA 4ZZDA 3BJOA 5ILVA 3I64A 3V8JA 3QAHA 3NQOA 2CSOA 2O6GE 3GZ6A 1TNSA 4BXUA 4HX8A 4YFNF 3J80Z 1E2XA 1P6RA 4HDVA 2BGCA 5HOOA 1IRGA 3BJAA 4P55A 1RIOH 2GA1A 5D8KB 1TW2A 4MEYF 5A2QK 1MKMA 4XRFA 5HLIA 5J8FA 3REOA 3U9GA 2A69F 5D5UB 2EA2A 3ZPLA 2UXXA 4EVIA 4U7BA 1O3RA 2BEOA 2NYXA 4HX4A 5KVRA 2OQGA 1RUNA 3M8FA 4UVAA 2EFPA 5E1ZB 1G4DA 2HKOA 4RGUA 4LLLA 2G9WA 1W7PA 4Y15A 5ICFA 1QO0D 2J5OA 1RUOA 4KIFA 5HDGA 2V1DA 5TRDA 4MQVA 4RB0A 2WC2A 5LGTA 4WXCA 2QLZA 4BH9A 5AIQA 4A0YA 1WI9A 2NNNA 2MD5A 2GXGA 3LQQA 2FEZA 3R60A 2H6BA 3R0JA 4ESFA 1FPQA 4WXHA 1UFMA 4LGWA 1XGNA 1U3EM 2FMLA 3C7JA 3M7GA 1FP1D 2DLLA 1SD7A 1F4KA 3P7NA 2HTSA 1U2WA 3TQNA 3BZ6A 2XAGA 2V79A 4K2EA 2LKPA 6PAXA 2A68F 4AIKA 2EFQA 2F5CA 1B6AA 1IAWA 4U88A 1JXSA 5DEQA 3COAC 3MWMA 1P4AA 3E6BA 3BWGA 5ILUA 2EFOA 3EDPA 2FBIA 3HRSA 1R58A 3CO7C 1XSXA 1ZRDA 5DCFA 3WU0A 4M6YA 2FBHA 1XDUA 3LAJA 4KIBA 3MQ0A 1O7FA 4ZYEA 4UNOA 4EGYA 3ROUA 3F23A 3FHZA 3LFKA 4XBFA 1QQIA 5A2QZ 1C0WA 1FLIA 1OYYA 4FX4A 4CXFA 3E5XA 3BOQA 3NEUA 4HF2A 2H94A 4L9JA 1T0FA 3G73A 4OIQF 2G7UA 3FWEA 2PI0A 2VODA 2XAQA 3W6KB 3QOPA 5LRRA 4HLYA 4ZYDA 4PGGA 2FMYA 2VT3A 4KNYA 1IXRC 1MJ9A 2BV6A 3WU1B 4UXNA 4UVCA 1MGTA 1SFUA 4LLNA 3MZHA 5E18F 4ESBA 5E17F 4EJVA 4HQEA 3SFZA 3O6BB 2A5YB 1EH6A 3GVAA 5IT9K 4I0BA 1CF7A 3FM3A 1ZHFA 1KU7A 2IJLA 2ESHA 2FE3A 1BI0A 1ONVA 3I54A 4M74A 2UWMA 5JI6A 3N4MA 5ERIA 1QZZA 4LG0A 2ELHA 1MJAA 2HEOA 2JSCA 2CWEA 3JSOA 1P92A 1FYKA 3PQKA 4U0WA 2KIUA 4L9VA 4HF1A 3DEUA 1T98A 1WRJA 2HZTA 4ENMA 2W84A 3PFIA 1IZ1A 4OINF 1PP8F 2Z3YA 2QZ8A 2BBYA 2F5FA 4A6DA 3MFKA 3DP7A 2EA4A 1XCBA 2QQ9A 1Z9CA 3F6OA 2P5VA 4WK8F 4EMSA 1HKTA 1JHHA 1K78A 5K5OA 4XSZF 4GCVA 1Z7UA 2L3DA 3F22A 2VC1A 1P2FA 1J59A 5BOXA 1IN4A 2ACJA 3VEPA 5HDNA 1R00A 2QM3A 3PQJA 4KYWA 2DO7A 2NRAC 5ILSA 4NB5A 2XAFA 1ZGAA 4I02A 1XGSA 4G9YA 5CVIA 1VTNC 1HSTA 3LA7A 1ODDA 2CO5A 5FO5A 5DYMA 1CF7B 1ZRFA 3RIRA 3FXUA 2CFXA 1T39A 1W7PB 3WGGA 1FBSA 1YW8A 1R1TA 3D5LA 3HSFA 1GHCA 2L4MA 5LHHA 4KN4X 3BPVA 1LVAA 3E3VA 3BP8A 3T8TA 3V4GA 1RI7A 4YIIA 2Q2EA 2XROA 2V1XA 1BM9A 1SFEA 3ZQ7A 5CLSA 4GYGA 1FP2A 2DK5A 3RDIA 1TQPA 1DPUA 3RYRA 3ZMSA 4L0YB 1J5YA 3K9TA 2LNBA 1S8NA 3MAJA 3SZPA 1KQ0A 1FX7A 4HOBA 3J80K 3IRQA 1R7JA 3DPTA 2FSWA 5FB2A 5DCMA 5L3FA 1BIAA 2RNJA 4O6JA 1WQ2A 3CUOA 1O57A 4ZH4F 4ASNA 1R36A 2VXZA 3F6VA 5AIPA 4RAZA 4GXOA 5IT9Z 3KLNA 4F7ZA 5FLXZ 2VOPA 2OD5A 2L02A 1OR7A 3GF2A 3HSEA 3RPUA 1DP7P 3F8BA 1P4XA 1I1GA 1K7AA 5ICEA 4WXDA 5E20A 4Q47A 2ZFWA 3CDHA 1G3TA 4B09A 4MHGA 4ETSA 1YW7A 4GYIA 2IT0A 2OBPA 1K78B 4EJUA 2L4AA 3J81Z 1HSJA 3HRTA 4ZYGA 2C6YA 1G3WA 4EJWA 1R5HA 2H6CA 2FRHA 3FM5A 3Q5FA 3MCZA 4AVPA 4NHJA 4PGHA 1ZG1A 3DKWA 3ECHA 4U0YA 5TJJA 3P9IA 2WWYA 4YFXF 4HLXA 2W85A 3JW4A 3LAPA 2W57A 1IN7A 4IRIA 2E7XA 4A0ZA 4Z2YA 5HS7A 3OV8A 2XUBA 3M8EA 4HDUA 4AIHA 2PLYA 1MDMA 3VOEA 3MZYA 2JTVA 2QENA 4EM0B 4YFKF 3H3ZA 3CUQA 3HSRA 5CVVA 1S7OA 2YSRA 4LK1F 2A07F 2RGVA 2ADUA 2JRTA 4LD5A 5DD8A 2FOKA 4R1HA 1BOAA 1U6GA 3BPXA 1LDKB 1HXDA 5E8IA 1XSVA 3JSPA 2HYGD 2K86A 4ENNA 3F8MA 1K79A 3WTVC 3KLOA 2XAJA 3WE2A 4A12A 2M5WA 3JTHA 1LDDA 2PJPA 2P8TA 2XRNA 1Y0UA 2RKHA 1IXCA 2K7LA 4UVBA 1OYWA 1HQCA 1O3QA 2VBYA 1USSA 4JQFA 1WWXA 3CUQC 3ABTA 1S29A 1PDNC 2XV4S 2ZNYA 2Y0MA 4A2UA 3J81K 1TLHB 5L3EA 4S04A 1XB4A 1B1BA 2BE5F 4G6DA 2P7CB 3KEQA 2R7FA 1XD7A 1XDSA 3ZMDA 4UV9A 4M71A 1TTYA 4OIPF 4A0XA 1J7KA 4O3MA 1ZN2A 1SMTA 4L9TA 2JPBA 1H9TA 1XCVA 1Q1HA 2STTA 2P6SA 4G6QA 2D1HA 4IPAA 1BC8C 2IP2A 4HYEA 2OZUA 5DUIA 4WF2A 3I53A 3U1DA 3KP4A 4I01A 4MTDA 1QPMA 2DPUA 2DPDA 1LB2A 4E70A 1FC3A 1GXPA 4D0PA 4G8XA 3BDDA 3GFLA 2JPCA 1XN7A 3KFWX 2MH9A 4P9UA 3ULQB 5KK1A 3IKVA 2RQPA 4L5JA 4KT5C 4ZZLA 4HA8A 2VBZA 4HQMA 3WTSC 3K2ZA 3T1BA 1ZGJA 3KP7A 4RS8A 3C18A 5FGMA 3HIFA 3SHFA 2VN2A 1ULYA 3I58A 1D3YA 4OU0A 3HUGA 4P9FA 5IT3A 2ZNZA 1ZARA 1Z1DA 5D5VB 1QNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIC A;  3ZMZ A;  4L0Z B;  2K4J A;  4O5V A;  3TO7 A;  2FQ3 A;  1YLF A;  3QU6 A;  2CW0 F;  5E8G A;  4MQ9 F;  4ENK A;  1W7P D;  5D4S A;  4HAM A;  4RB1 A;  4MGR A;  2DQL A;  2DT5 A;  5EEH A;  1ZLJ A;  2PMH A;  4RAY A;  2EK5 A;  2A3S A;  3E6C C;  4NQW A;  1Z6T A;  2R7D A;  4HX7 A;  1F9N A;  5HVQ C;  2OU2 A;  2ZKZ A;  4BHP A;  1I27 A;  3KCC A;  3MEX A;  2HGC A;  5BPD A;  5K5Q A;  1B4A A;  5LRS A;  1YYV A;  2QVO A;  4EJT A;  3IRR A;  3HTU A;  2RVC A;  2J5P A;  4R79 A;  3GZ5 A;  1Z91 A;  3JAM K;  1TBX A;  4U7D A;  1U8R A;  1TNT A;  2IW5 A;  1AWC A;  4U0V A;  4BHB A;  2FU4 A;  5ICC A;  1KA8 A;  4HZF A;  3WTU C;  4OIO F;  2A6E F;  1FY7 A;  2BYV E;  5FFX A;  5CYV A;  3DQV C;  3E6D A;  3RKX A;  1OPC A;  1L0O C;  5DCM B;  1IF1 A;  1HW5 A;  3K69 A;  5F6F A;  1KYZ A;  3BRO A;  1Z05 A;  3KZZ A;  3GX4 X;  4EM1 A;  2ZBK A;  3GW2 A;  2PMU A;  4HBL A;  2HDC A;  3SQN A;  2XHK A;  3ZMT A;  3I71 A;  4LG0 B;  2A6H F;  1IRF A;  3NRV A;  2HYF A;  3W6J B;  2HQN A;  2XKP A;  1KQ9 A;  2FNA A;  1QZY A;  3KEO A;  2CQK A;  4XSX F;  4KA4 A;  3DXJ F;  2IA1 A;  4Q4Z F;  2M8E A;  4ENJ A;  1QGP A;  1S7A A;  2XAH A;  2LSO A;  2HFH A;  2OQR A;  2EFW A;  3F8C A;  1RZ4 A;  2EV6 A;  2D2W A;  2D1V A;  4Y17 A;  5FD6 A;  3WTY C;  1BI1 A;  4DNC A;  3KZY A;  4EGZ A;  5AON A;  3J7A O;  5K5R A;  3R6S A;  2ZJ2 A;  4AIJ A;  1ZRC A;  2O03 A;  2VE9 A;  3KP2 A;  2X0L A;  3GXO A;  3K0L A;  5LGU A;  3F8N A;  5E1X A;  3TDZ C;  1G6N A;  1R22 A;  4YG2 F;  4CDG A;  1W5T A;  1LDJ A;  1V4R A;  2A61 A;  1SD6 A;  2E1N A;  4IHT A;  3LWF A;  4CO8 A;  4EM2 A;  2F2E A;  2GWR A;  1WKM A;  1FOK A;  3JTG A;  1XSD A;  1U78 A;  1G3S A;  1OMI A;  2P5L C;  4I09 A;  3WTZ A;  3CUQ B;  1YS6 A;  2MBF A;  3KP3 A;  2O8X A;  3GFM A;  5HLG A;  4Y13 A;  5HDK A;  1HKQ A;  1SD4 A;  4P5O A;  2GZW A;  1IW7 F;  1AOY A;  3FXR A;  4FT8 A;  2YX7 A;  3WTW C;  5BMZ A;  2QBY A;  3F8F A;  4GO1 A;  3I59 A;  2QUF A;  2EB7 A;  2FA5 A;  3R0A A;  1KU9 A;  1T6S A;  1HBX G;  2YU3 A;  3I5U A;  5FLX K;  5JHU A;  3QP6 A;  1D8K A;  3ERE D;  2PFB A;  1O3S A;  2XIG A;  3C1D A;  1R23 A;  1F5T A;  2PEX A;  1YO5 C;  3GWZ A;  4BYY A;  2MLG A;  3DPL C;  3E6M A;  1ZLK A;  3RKW A;  2K02 A;  4HV6 A;  3EQL F;  3IHU A;  4I7H A;  1V3F A;  2RN7 A;  3K1P A;  3V7S A;  5ED4 A;  1FT9 A;  2MA3 A;  3V8K A;  3ZMV A;  3TOB A;  2VE8 A;  1F1Z A;  2HKX A;  1IN8 A;  5LLQ A;  3WOD F;  2KRF A;  2Y75 A;  2O61 A;  2M45 A;  1DPR A;  4IVN A;  5D6E A;  1XMA A;  5CVR A;  5DV5 A;  1REP C;  3N97 A;  2AS5 F;  2ESN A;  4MNU A;  2KIF A;  4JK1 X;  2QYO A;  4BNC A;  4LJZ F;  3M1E A;  1YS7 A;  4UV8 A;  1FYM A;  1U5T B;  1ZH5 A;  2JZY A;  2NS0 A;  3P9K A;  1MD0 A;  1XGM A;  3HRM A;  1K6O A;  1J75 A;  5FFZ A;  2EV0 A;  5J8C A;  1B9M A;  2DI3 A;  5H20 A;  2W25 A;  4I2O A;  2D45 A;  3M9A A;  5D5W B;  3DFG A;  3F72 A;  3HHH A;  1MDM B;  4G7Z F;  2L01 A;  4BHC A;  3IWZ A;  3IL2 A;  2XKO A;  2DAO A;  1X3U A;  3CLO A;  3QU3 A;  2FF4 A;  1BI2 A;  4S05 A;  1PP7 U;  2P6T A;  3AAF A;  4KFC A;  2P7V B;  3DV8 A;  2Z9O A;  3S2W A;  1A04 A;  1W5S A;  2HOE A;  3HHG A;  3U2R A;  5HS8 A;  3QRF F;  4KDP A;  1NHA A;  5EEG A;  4HV5 A;  3EYY A;  3QPH A;  1UHM A;  4OOI A;  2H09 A;  1UHW A;  3KP6 A;  3WGI A;  2P4W A;  3GYH X;  1S6L A;  1LNW A;  1SD5 A;  2NAZ A;  3GFI A;  2HQR A;  4N9H A;  4WX9 A;  5F1R A;  1QBJ A;  2L54 A;  4L9N A;  1FBU A;  2NNY A;  2IA2 A;  3WTX C;  1T38 A;  1BI3 A;  2HR3 A;  2V9V A;  1RNL A;  1KU2 A;  2LDU A;  1T2K A;  1U5T C;  3V8L A;  2HTJ A;  5ICG A;  1J0R A;  2G7H A;  2ZO4 A;  4PCQ A;  3T8R A;  4OMZ A;  2O0Y A;  1IUY A;  5HLH A;  1WSU A;  1CGP A;  1FSE A;  5F64 A;  4LMY A;  1G3Y A;  2VBW A;  4WWC A;  1YG2 A;  4EQQ A;  2KIM A;  5L3C A;  1L3L A;  1ZG3 A;  3GEZ A;  2STW A;  3HRU A;  2B0L A;  2GXB A;  5JR3 A;  3C3W A;  3E5U A;  1FYL A;  3EYI A;  2Y48 A;  2EFN A;  1IXS B;  4BQA A;  4FHT A;  5D4R A;  4A5M A;  4QLC U;  3LST A;  4KN7 X;  3ZMU A;  1D8J A;  4M73 A;  1ZRE A;  1YW9 A;  5JFR A;  5HS9 A;  4EJO A;  3GFJ A;  4MTE A;  1DUX C;  4ZYH A;  4G7H F;  1Z6R A;  2V6C A;  2UXN A;  1I6X A;  4YIF A;  4AD9 A;  2CGP A;  2AXL A;  2GAU A;  3O2P E;  3ML6 A;  1UCR A;  3HTS B;  2O3F A;  3T5X A;  2JT1 A;  1HKS A;  2XGX A;  2E1C A;  2MLK A;  4M72 A;  2ISZ A;  2FBK A;  4N9I A;  2M87 A;  3EUH A;  3FMS A;  4RB2 C;  4XLN F;  3FZV A;  5L3B A;  3TOA A;  1ZG5 A;  2VC0 A;  1HW2 A;  1U5T A;  3KP5 A;  1BJA A;  1I5Z A;  2IRF G;  4OMY A;  3FMQ A;  2V1U A;  4IF4 A;  3FXQ A;  3WGH A;  4HW0 A;  1O3T A;  5L3G A;  4EV0 A;  5E1W A;  4JBA A;  5K1Y A;  3B73 A;  2ZME B;  4CYD A;  1IN5 A;  3T0Y A;  4I98 B;  3JAM Z;  3QP5 A;  1EH7 A;  5DUK A;  1LEB A;  4LB5 A;  2EJR A;  4Q5S F;  4DQ2 A;  4IRH A;  4CZZ A;  2Z99 A;  2QQA A;  2Q8K A;  5BPI A;  1HW1 A;  1EV7 A;  3L00 A;  3B02 A;  5JVT A;  2FXA A;  1KGS A;  2X4H A;  2DU9 A;  3R61 A;  2CYY A;  4G94 A;  5J6X A;  1XGO A;  2ZCW A;  4IRG A;  1SAX A;  4RGR A;  2VT2 A;  2QWW A;  5H6Q A;  1MJB A;  1EH8 A;  1FSH A;  4R8H A;  1J2X A;  5D6F A;  1O7L A;  4UUV A;  3L2C A;  3QPT A;  3HOS A;  2QBY B;  4LK0 F;  3L9F A;  5D5X B;  5FD5 A;  3DF8 A;  1YTY A;  5CVJ A;  2DK8 A;  3ZN1 A;  4RGS A;  2VOO A;  4M9Z A;  3RPQ A;  2XAS A;  3VFZ A;  2OZ6 A;  2KJB A;  2RDP A;  2Q0O A;  5LHG A;  2YX4 A;  3ABU A;  5DDG A;  3G3Z A;  3L7W A;  2Z5U A;  3GO5 A;  2PN6 A;  4TV7 A;  2M1B A;  2ETH A;  2OA4 A;  3RJP A;  3ELK A;  3BY6 A;  3GLX A;  4PDK A;  1ON1 A;  3F21 A;  1JGS A;  2VBX A;  4FX0 A;  1LQ1 A;  4P96 A;  1DDN A;  2RV8 A;  3HOT A;  3ZN0 A;  2H27 A;  3I0T A;  2MH2 A;  3P9C A;  4M6X A;  4RGX A;  1H0M A;  2M30 A;  1TW3 A;  2CG4 A;  4I0A A;  1J9I A;  3D0S A;  3EET A;  3IWF A;  4LB6 B;  2ISY A;  5BS6 A;  1YIO A;  3HYI A;  2GQQ A;  3ZP5 A;  2DBB A;  2PQ8 A;  5DD4 A;  2HS5 A;  1BC7 C;  1FZP B;  5L3D A;  4AWX B;  2P5K A;  2WTE A;  2DW4 A;  3K1M A;  2WV0 A;  1SFX A;  3RTR A;  1KYW A;  4BAY A;  1B9N A;  4ESJ A;  4WCG A;  4MEX F;  4IXA A;  4LFU A;  3KET A;  4A6E A;  3BJ6 A;  2TDX A;  4HF0 A;  1BIB A;  3I4P A;  3LA3 A;  2IVM A;  4OIR F;  3SXY A;  3WE3 A;  5D8L B;  4KMU X;  1ZYR F;  3WG9 A;  3Q9V A;  4L18 B;  1R1U A;  2KKO A;  4ON0 A;  1STZ A;  1W4M A;  3RKY A;  3RI4 A;  2EV5 A;  2E7W A;  1KU3 A;  1GXQ A;  2ZME A;  2UZK A;  1TQM A;  4KMF A;  2KJC A;  3V7C A;  3FMR A;  1UST A;  3CTA A;  2LF8 A;  3SZT A;  2W24 A;  4KUM A;  5LGN A;  2F5E A;  4GGG A;  4CIC A;  1YQA A;  3CO6 C;  1B59 A;  1S3J A;  2PBI A;  5LEK A;  2K27 A;  1SMY F;  2R3S A;  4Q48 A;  2COM A;  3LA2 A;  4PZJ A;  1KQ8 A;  3VB2 A;  1OKR A;  2YPR A;  4N0B A;  1JHF A;  4KIG A;  3LQR A;  5LBQ A;  5CJ9 A;  4QWQ A;  3O3K A;  1P4W A;  3KE2 A;  3F3X A;  3TO6 A;  3I59 B;  1FBQ A;  2F5D A;  1JE8 A;  4IJA A;  1R5G A;  3WTT C;  2DFI A;  2GA2 A;  2OAZ A;  2K4B A;  1UB9 A;  3H3U A;  4LLG F;  4CHU A;  2FNP A;  3OOP A;  4B8X A;  2XVC A;  4RB3 C;  3TGN A;  1YFH A;  2RC4 A;  1ZAO A;  1FWZ A;  2ZXJ A;  1GVJ A;  3TO9 A;  2VON A;  1XMK A;  2PG4 A;  5BQT A;  2LF7 A;  3R4K A;  5H6R A;  1H9G A;  1FNN A;  1LJ9 A;  3L09 A;  3IC7 A;  2DTR A;  1E17 A;  2IPQ X;  3Q9S A;  3FF5 A;  3ECO A;  1TQI A;  2MC3 A;  3IKT A;  1IN6 A;  1ON2 A;  2QQB A;  3H92 A;  2HWV A;  3TDU C;  5LEJ A;  2IA0 A;  1MZB A;  3V7R A;  3VOD A;  4XLP F;  2GIV A;  3FX3 A;  1BN5 A;  2YR2 A;  4A5N A;  3E5Q A;  3RYP A;  4M9X A;  4L5I A;  1PUE E;  5LHI A;  3TKY A;  1LEA A;  4CGZ A;  4G7O F;  2Z33 A;  2EWN A;  1OYI A;  4M9S A;  3CJN A;  3E97 A;  3ISP A;  5CVU A;  4UHT A;  1D5V A;  4IHS A;  3GUD A;  1I1S A;  3K1N A;  4H0E A;  1R1V A;  2DQR A;  1BBY A;  4ZZD A;  3BJO A;  5ILV A;  3I64 A;  3V8J A;  3QAH A;  3NQO A;  2CSO A;  2O6G E;  3GZ6 A;  1TNS A;  4BXU A;  4HX8 A;  4YFN F;  3J80 Z;  1E2X A;  1P6R A;  4HDV A;  2BGC A;  5HOO A;  1IRG A;  3BJA A;  4P55 A;  1RIO H;  2GA1 A;  5D8K B;  1TW2 A;  4MEY F;  5A2Q K;  1MKM A;  4XRF A;  5HLI A;  5J8F A;  3REO A;  3U9G A;  2A69 F;  5D5U B;  2EA2 A;  3ZPL A;  2UXX A;  4EVI A;  4U7B A;  1O3R A;  2BEO A;  2NYX A;  4HX4 A;  5KVR A;  2OQG A;  1RUN A;  3M8F A;  4UVA A;  2EFP A;  5E1Z B;  1G4D A;  2HKO A;  4RGU A;  4LLL A;  2G9W A;  1W7P A;  4Y15 A;  5ICF A;  1QO0 D;  2J5O A;  1RUO A;  4KIF A;  5HDG A;  2V1D A;  5TRD A;  4MQV A;  4RB0 A;  2WC2 A;  5LGT A;  4WXC A;  2QLZ A;  4BH9 A;  5AIQ A;  4A0Y A;  1WI9 A;  2NNN A;  2MD5 A;  2GXG A;  3LQQ A;  2FEZ A;  3R60 A;  2H6B A;  3R0J A;  4ESF A;  1FPQ A;  4WXH A;  1UFM A;  4LGW A;  1XGN A;  1U3E M;  2FML A;  3C7J A;  3M7G A;  1FP1 D;  2DLL A;  1SD7 A;  1F4K A;  3P7N A;  2HTS A;  1U2W A;  3TQN A;  3BZ6 A;  2XAG A;  2V79 A;  4K2E A;  2LKP A;  6PAX A;  2A68 F;  4AIK A;  2EFQ A;  2F5C A;  1B6A A;  1IAW A;  4U88 A;  1JXS A;  5DEQ A;  3COA C;  3MWM A;  1P4A A;  3E6B A;  3BWG A;  5ILU A;  2EFO A;  3EDP A;  2FBI A;  3HRS A;  1R58 A;  3CO7 C;  1XSX A;  1ZRD A;  5DCF A;  3WU0 A;  4M6Y A;  2FBH A;  1XDU A;  3LAJ A;  4KIB A;  3MQ0 A;  1O7F A;  4ZYE A;  4UNO A;  4EGY A;  3ROU A;  3F23 A;  3FHZ A;  3LFK A;  4XBF A;  1QQI A;  5A2Q Z;  1C0W A;  1FLI A;  1OYY A;  4FX4 A;  4CXF A;  3E5X A;  3BOQ A;  3NEU A;  4HF2 A;  2H94 A;  4L9J A;  1T0F A;  3G73 A;  4OIQ F;  2G7U A;  3FWE A;  2PI0 A;  2VOD A;  2XAQ A;  3W6K B;  3QOP A;  5LRR A;  4HLY A;  4ZYD A;  4PGG A;  2FMY A;  2VT3 A;  4KNY A;  1IXR C;  1MJ9 A;  2BV6 A;  3WU1 B;  4UXN A;  4UVC A;  1MGT A;  1SFU A;  4LLN A;  3MZH A;  5E18 F;  4ESB A;  5E17 F;  4EJV A;  4HQE A;  3SFZ A;  3O6B B;  2A5Y B;  1EH6 A;  3GVA A;  5IT9 K;  4I0B A;  1CF7 A;  3FM3 A;  1ZHF A;  1KU7 A;  2IJL A;  2ESH A;  2FE3 A;  1BI0 A;  1ONV A;  3I54 A;  4M74 A;  2UWM A;  5JI6 A;  3N4M A;  5ERI A;  1QZZ A;  4LG0 A;  2ELH A;  1MJA A;  2HEO A;  2JSC A;  2CWE A;  3JSO A;  1P92 A;  1FYK A;  3PQK A;  4U0W A;  2KIU A;  4L9V A;  4HF1 A;  3DEU A;  1T98 A;  1WRJ A;  2HZT A;  4ENM A;  2W84 A;  3PFI A;  1IZ1 A;  4OIN F;  1PP8 F;  2Z3Y A;  2QZ8 A;  2BBY A;  2F5F A;  4A6D A;  3MFK A;  3DP7 A;  2EA4 A;  1XCB A;  2QQ9 A;  1Z9C A;  3F6O A;  2P5V A;  4WK8 F;  4EMS A;  1HKT A;  1JHH A;  1K78 A;  5K5O A;  4XSZ F;  4GCV A;  1Z7U A;  2L3D A;  3F22 A;  2VC1 A;  1P2F A;  1J59 A;  5BOX A;  1IN4 A;  2ACJ A;  3VEP A;  5HDN A;  1R00 A;  2QM3 A;  3PQJ A;  4KYW A;  2DO7 A;  2NRA C;  5ILS A;  4NB5 A;  2XAF A;  1ZGA A;  4I02 A;  1XGS A;  4G9Y A;  5CVI A;  1VTN C;  1HST A;  3LA7 A;  1ODD A;  2CO5 A;  5FO5 A;  5DYM A;  1CF7 B;  1ZRF A;  3RIR A;  3FXU A;  2CFX A;  1T39 A;  1W7P B;  3WGG A;  1FBS A;  1YW8 A;  1R1T A;  3D5L A;  3HSF A;  1GHC A;  2L4M A;  5LHH A;  4KN4 X;  3BPV A;  1LVA A;  3E3V A;  3BP8 A;  3T8T A;  3V4G A;  1RI7 A;  4YII A;  2Q2E A;  2XRO A;  2V1X A;  1BM9 A;  1SFE A;  3ZQ7 A;  5CLS A;  4GYG A;  1FP2 A;  2DK5 A;  3RDI A;  1TQP A;  1DPU A;  3RYR A;  3ZMS A;  4L0Y B;  1J5Y A;  3K9T A;  2LNB A;  1S8N A;  3MAJ A;  3SZP A;  1KQ0 A;  1FX7 A;  4HOB A;  3J80 K;  3IRQ A;  1R7J A;  3DPT A;  2FSW A;  5FB2 A;  5DCM A;  5L3F A;  1BIA A;  2RNJ A;  4O6J A;  1WQ2 A;  3CUO A;  1O57 A;  4ZH4 F;  4ASN A;  1R36 A;  2VXZ A;  3F6V A;  5AIP A;  4RAZ A;  4GXO A;  5IT9 Z;  3KLN A;  4F7Z A;  5FLX Z;  2VOP A;  2OD5 A;  2L02 A;  1OR7 A;  3GF2 A;  3HSE A;  3RPU A;  1DP7 P;  3F8B A;  1P4X A;  1I1G A;  1K7A A;  5ICE A;  4WXD A;  5E20 A;  4Q47 A;  2ZFW A;  3CDH A;  1G3T A;  4B09 A;  4MHG A;  4ETS A;  1YW7 A;  4GYI A;  2IT0 A;  2OBP A;  1K78 B;  4EJU A;  2L4A A;  3J81 Z;  1HSJ A;  3HRT A;  4ZYG A;  2C6Y A;  1G3W A;  4EJW A;  1R5H A;  2H6C A;  2FRH A;  3FM5 A;  3Q5F A;  3MCZ A;  4AVP A;  4NHJ A;  4PGH A;  1ZG1 A;  3DKW A;  3ECH A;  4U0Y A;  5TJJ A;  3P9I A;  2WWY A;  4YFX F;  4HLX A;  2W85 A;  3JW4 A;  3LAP A;  2W57 A;  1IN7 A;  4IRI A;  2E7X A;  4A0Z A;  4Z2Y A;  5HS7 A;  3OV8 A;  2XUB A;  3M8E A;  4HDU A;  4AIH A;  2PLY A;  1MDM A;  3VOE A;  3MZY A;  2JTV A;  2QEN A;  4EM0 B;  4YFK F;  3H3Z A;  3CUQ A;  3HSR A;  5CVV A;  1S7O A;  2YSR A;  4LK1 F;  2A07 F;  2RGV A;  2ADU A;  2JRT A;  4LD5 A;  5DD8 A;  2FOK A;  4R1H A;  1BOA A;  1U6G A;  3BPX A;  1LDK B;  1HXD A;  5E8I A;  1XSV A;  3JSP A;  2HYG D;  2K86 A;  4ENN A;  3F8M A;  1K79 A;  3WTV C;  3KLO A;  2XAJ A;  3WE2 A;  4A12 A;  2M5W A;  3JTH A;  1LDD A;  2PJP A;  2P8T A;  2XRN A;  1Y0U A;  2RKH A;  1IXC A;  2K7L A;  4UVB A;  1OYW A;  1HQC A;  1O3Q A;  2VBY A;  1USS A;  4JQF A;  1WWX A;  3CUQ C;  3ABT A;  1S29 A;  1PDN C;  2XV4 S;  2ZNY A;  2Y0M A;  4A2U A;  3J81 K;  1TLH B;  5L3E A;  4S04 A;  1XB4 A;  1B1B A;  2BE5 F;  4G6D A;  2P7C B;  3KEQ A;  2R7F A;  1XD7 A;  1XDS A;  3ZMD A;  4UV9 A;  4M71 A;  1TTY A;  4OIP F;  4A0X A;  1J7K A;  4O3M A;  1ZN2 A;  1SMT A;  4L9T A;  2JPB A;  1H9T A;  1XCV A;  1Q1H A;  2STT A;  2P6S A;  4G6Q A;  2D1H A;  4IPA A;  1BC8 C;  2IP2 A;  4HYE A;  2OZU A;  5DUI A;  4WF2 A;  3I53 A;  3U1D A;  3KP4 A;  4I01 A;  4MTD A;  1QPM A;  2DPU A;  2DPD A;  1LB2 A;  4E70 A;  1FC3 A;  1GXP A;  4D0P A;  4G8X A;  3BDD A;  3GFL A;  2JPC A;  1XN7 A;  3KFW X;  2MH9 A;  4P9U A;  3ULQ B;  5KK1 A;  3IKV A;  2RQP A;  4L5J A;  4KT5 C;  4ZZL A;  4HA8 A;  2VBZ A;  4HQM A;  3WTS C;  3K2Z A;  3T1B A;  1ZGJ A;  3KP7 A;  4RS8 A;  3C18 A;  5FGM A;  3HIF A;  3SHF A;  2VN2 A;  1ULY A;  3I58 A;  1D3Y A;  4OU0 A;  3HUG A;  4P9F A;  5IT3 A;  2ZNZ A;  1ZAR A;  1Z1D A;  5D5V B;  1QNT A; 
#chains in the Genus database with same CATH topology
 3C2B A;  4KIC A;  3ZMZ A;  3HGG A;  2IS6 A;  4L0Z B;  1D0X A;  2K4J A;  5KAF C;  4O5V A;  3TO7 A;  2FQ3 A;  4BXF A;  2EH3 A;  1YLF A;  4HSR A;  5M3F J;  3QU6 A;  2CW0 F;  3QOD A;  4LIU A;  5E8G A;  4MQ9 F;  3CCL I;  4ENK A;  3DLA A;  3Q0V A;  2BY3 A;  3GTQ J;  1W7P D;  4BQQ A;  5D4S A;  1V55 H;  4HAM A;  2RRE A;  4RB1 A;  4MGR A;  2X6W A;  2DQL A;  2DT5 A;  4C2T A;  4AYB N;  3HOX J;  5EEH A;  4FE7 A;  1ZLJ A;  2BVM A;  3FXO A;  2V4J C;  2PMH A;  4FET A;  1U8B A;  2DMU A;  2HDW A;  4RAY A;  2EK5 A;  2WAQ N;  5IYB J;  2A3S A;  3E6C C;  5J47 A;  4NQW A;  3RZO J;  3VYR B;  1Z6T A;  3TP0 A;  2R7D A;  4HX7 A;  4EEF G;  2GM4 A;  1F9N A;  4IKF A;  5IYD J;  5HVQ C;  2OU2 A;  2ZKZ A;  4BHP A;  3MD2 A;  2BHZ A;  2WAQ A;  1I27 A;  3KCC A;  5JLW A;  3VSL A;  2V6E A;  5EZH A;  4XN3 A;  3MEX A;  5FKO A;  2HGC A;  4C3H J;  5BPD A;  3HOW J;  5K5Q A;  3QYB A;  1B4A A;  5LRS A;  1YYV A;  2QVO A;  2KZV A;  4BE2 A;  4EJT A;  3IRR A;  4A3C J;  3HTU A;  2RVC A;  3OYB A;  2J5P A;  5GPC A;  3CJT B;  4PSW A;  4R79 A;  4JX6 A;  1MMN A;  3GZ5 A;  1Z91 A;  3JAM K;  1TBX A;  5J4V A;  4U7D A;  1U8R A;  1TNT A;  2IW5 A;  1AWC A;  4U0V A;  4BHB A;  2FU4 A;  1YE9 A;  1HOM A;  5ICC A;  1MBJ A;  1KA8 A;  2AQE A;  4HZF A;  3WTU C;  5FRN A;  4OIO F;  2A6E F;  1FY7 A;  2BYV E;  5FFX A;  2H8W A;  5CYV A;  1NK2 P;  3DQV C;  2CQ7 A;  3JCU C;  3MVP A;  1TL8 A;  2DA7 A;  3E6D A;  3CCU I;  1MBK A;  3HKZ A;  1DU0 A;  4ZDL A;  3ZGK A;  4C3J J;  1FOW A;  1NG7 A;  3RKX A;  1OPC A;  3PNV A;  3CDL A;  1L0O C;  5FLM J;  2XB0 X;  5DCM B;  2K9N A;  3EUK L;  1IF1 A;  1HW5 A;  3BR5 A;  3K69 A;  2WBM A;  2M8G X;  5F6F A;  1N78 A;  1KYZ A;  3BRO A;  1Z05 A;  3KZZ A;  3PIP F;  4EM1 A;  3GX4 X;  2UUZ A;  4ZC3 A;  4ANJ A;  1D1C A;  2ZBK A;  3LL7 A;  2QSG X;  3GW2 A;  2CV0 A;  2PMU A;  4HBL A;  2HDC A;  4X1E A;  2JMW A;  3SQN A;  2XHK A;  4CCK A;  1BR1 A;  4MFD A;  3ZMT A;  1QU3 A;  2MFZ A;  3SEQ A;  4QTR A;  3I71 A;  4LG0 B;  2OF7 A;  2A6H F;  1IRF A;  3NRV A;  2HYF A;  2OUM A;  3W6J B;  2HQN A;  2XKP A;  4XRM A;  2L7Z A;  2JVG A;  1KQ9 A;  4RMN A;  2FNA A;  4DZP A;  3ZQQ A;  2LKS A;  1QZY A;  4BAC A;  3JRD A;  3KEO A;  2CQK A;  2E1M B;  3A02 A;  4XSX F;  4F93 B;  4KA4 A;  1I39 A;  3DXJ F;  2IA1 A;  2R7T A;  4Q4Z F;  2DOD A;  2NS7 A;  3AG3 H;  2M8E A;  4ENJ A;  1QGP A;  2LTP A;  1S7A A;  2XAH A;  2VAS A;  2JA7 J;  2LSO A;  2HFH A;  2OQR A;  2FJ1 A;  2EFW A;  3AG1 H;  3F8C A;  4XLF A;  1RZ4 A;  1OCZ H;  1ETO A;  1OCP A;  2H1K A;  2EV6 A;  2D2W A;  2JA2 A;  1X2M A;  1RRJ A;  2D1V A;  3FXJ A;  2WAE A;  1DGR M;  3AKZ A;  4Y17 A;  5FD6 A;  3WTY C;  1BI1 A;  4DNC A;  2E2I J;  1UG0 A;  3KZY A;  1F36 A;  4EGZ A;  2CV1 A;  5AON A;  3J7A O;  1ZGW A;  5K5R A;  4BGD A;  3PSF A;  3R6S A;  2ZJ2 A;  1TT5 B;  4AIJ A;  4W97 A;  1ZRC A;  4Z6Y A;  2O03 A;  3U1K A;  2VE9 A;  3KP2 A;  2X0L A;  3GXO A;  2K9L A;  4CUG A;  3K0L A;  1XS9 A;  1MSE C;  4DYR A;  5LGU A;  3F8N A;  1X3Z B;  5E1X A;  1ZEL A;  3TDZ C;  1G6N A;  1R22 A;  2DCE A;  4YG2 F;  1Z0X A;  3IAM 2;  5J40 A;  1W5T A;  4CDG A;  5F04 A;  3LSR A;  3HB9 A;  3HZJ A;  4M3D A;  3K2A A;  1KON A;  1LDJ A;  1ETX A;  2MW8 A;  1B72 B;  3G71 I;  1V4R A;  2A61 A;  1SD6 A;  2E1N A;  4IHT A;  3LWF A;  4CO8 A;  4EM2 A;  3DLL F;  2F2E A;  3G6E I;  1MBF A;  2GWR A;  1WKM A;  1FOK A;  4MIM A;  1TP4 A;  4PSX A;  1YI2 I;  1K83 J;  3JTG A;  1XSD A;  3BR0 A;  1U78 A;  1G3S A;  1OMI A;  3W2V A;  4I09 A;  3WTZ A;  2P5L C;  3CUQ B;  3I4M J;  1YS6 A;  1ITY A;  2MBF A;  3KP3 A;  2ID6 A;  2O8X A;  4XOP A;  3LSG A;  3GFM A;  1H88 C;  5J1R A;  3L2U A;  3FKJ A;  5HLG A;  4Y13 A;  3DU5 A;  5HDK A;  5LD2 C;  2M34 A;  1VQ8 I;  3CD6 I;  1HKQ A;  1WJ5 A;  2AQF A;  1SD4 A;  3FHN A;  2GZW A;  4P5O A;  4BKX A;  1IW7 F;  1IJW C;  2HVQ A;  1HA8 A;  1K6Y A;  4NC7 A;  2V26 A;  1AOY A;  3FXR A;  3GZN B;  4FT8 A;  1JJ6 C;  2YX7 A;  2PJR B;  3WTW C;  5BMZ A;  2QBY A;  3F8F A;  4GO1 A;  3I59 A;  3ZQG A;  2FX0 A;  2ZXI A;  2QUF A;  2EB7 A;  1ETV A;  3HOZ J;  2FA5 A;  3R0A A;  3PO3 J;  3DKX A;  1KU9 A;  1T6S A;  1HBX G;  4LIT A;  2YU3 A;  3K4K A;  3I5U A;  4A3M J;  2FUG 2;  5FLX K;  5JHU A;  2L7K A;  3QP6 A;  2JA8 J;  2A6T A;  3A2K A;  2VLA A;  1D8K A;  2JRM A;  5K7F A;  5J1Y A;  1X1P A;  3ERE D;  2PFB A;  1FOX A;  1LFP A;  1O3S A;  3PUB A;  2IXS A;  2XIG A;  1RKW A;  3C1D A;  3OR1 C;  4AYB A;  3S2H J;  1R23 A;  1F5T A;  2PEX A;  1YO5 C;  1N77 A;  3GWZ A;  4BYY A;  2MLG A;  1JUS A;  3DPL C;  4PUS A;  4DZJ A;  3E6M A;  3IUO A;  5TGT A;  1ZLK A;  3W3C A;  3RKW A;  2K02 A;  4HV6 A;  3OL3 A;  1Y8Q B;  3EQL F;  3IHU A;  4I7H A;  1V3F A;  1W0T A;  2RN7 A;  3K1P A;  3V7S A;  4UY8 I;  5ED4 A;  3I4N J;  1X2N A;  1FT9 A;  2MA3 A;  1VQ5 I;  1VI0 A;  3V8K A;  3ZMV A;  2R4G A;  4A3D J;  5JLX A;  3TOB A;  1WJD A;  1Z21 A;  2VE8 A;  1F1Z A;  2HKX A;  2LY1 A;  3OYD A;  1IN8 A;  5LLQ A;  3WOD F;  2XSD C;  2KRF A;  1SFK A;  2MD0 A;  2Y75 A;  2O61 A;  3LMM A;  1S72 I;  5FRO A;  2CJJ A;  2M45 A;  1DPR A;  1GT0 C;  1PUF B;  1UMQ A;  4IVN A;  5D6E A;  1XMA A;  2L0K A;  5CVR A;  5DV5 A;  1IV8 A;  2E35 A;  4FAS D;  3OY9 A;  3N97 A;  1REP C;  1F43 A;  4XRS G;  1BJZ A;  2ESN A;  2AS5 F;  4MNU A;  2X6X A;  3BR6 A;  4IO9 F;  1PVE A;  2KIF A;  4JK1 X;  2QYO A;  2Y30 A;  2VKV A;  4BNC A;  3LSH A;  4LJZ F;  1OCT C;  3M1E A;  2LK2 A;  1OQY A;  1YS7 A;  4UV8 A;  1FYM A;  4ABZ A;  1U5T B;  4DIQ A;  1ZH5 A;  3KYD B;  3HOY J;  2JZY A;  2NS0 A;  3H5R A;  4XLC A;  1OFC X;  5KCM A;  4D1Q A;  3P9K A;  2K9M A;  1MD0 A;  3KEY A;  1XGM A;  3HRM A;  1K6O A;  4JYK A;  2Y9Z A;  1J75 A;  1Y8R B;  2ZXW H;  5FFZ A;  2EV0 A;  5J8C A;  2E1M C;  1B9M A;  1NK3 P;  4EAT A;  1WFX A;  2DI3 A;  4OWR B;  1AHD P;  5H20 A;  2W25 A;  3EUA A;  2D45 A;  4I2O A;  3M9A A;  2L9N A;  3S2D J;  2HVR A;  2KIS A;  5KHD A;  3OS0 A;  1JJ8 C;  3HPG A;  3FXL A;  1BR4 A;  1VQM I;  1A31 A;  3D5R C;  3LOC A;  3S3N A;  3CMM A;  2E5Z A;  5D5W B;  3DFG A;  3DEE A;  3L2V A;  3F72 A;  3OYK A;  3HHH A;  2KT0 A;  1MDM B;  4RM2 A;  4G7Z F;  2L01 A;  4BHC A;  3IWZ A;  3ONQ A;  4ZTJ A;  3IL2 A;  3ZQF A;  3BG6 A;  2L7F P;  2WB1 A;  3S14 J;  1QVT A;  2XKO A;  2DAO A;  1X3U A;  3CLO A;  3QU3 A;  4DYQ A;  1MNE A;  2FF4 A;  1BI2 A;  2EQR A;  1I50 J;  2IT0 A;  1FTT A;  4XIC A;  4S05 A;  1PP7 U;  2P6T A;  3AAF A;  4KFC A;  2EBI A;  2P7V B;  3DV8 A;  2W1O A;  3IP4 B;  2Z9O A;  3S2W A;  4F3Q A;  4LOC A;  2JA6 J;  1A04 A;  4A3K J;  1W5S A;  2CW7 A;  2HOE A;  3HHG A;  4XON A;  3U2R A;  5HS8 A;  2K85 A;  2XPV A;  5GTI C;  2IEK A;  5EDN A;  3QRF F;  1TWA J;  2CQX A;  1ACI A;  5F1J A;  4KDP A;  4NDL A;  1NHA A;  5EEG A;  2EIM H;  1SVM A;  4HV5 A;  3EYY A;  1A5J A;  3QPH A;  4BJ5 C;  3NAU A;  1UHM A;  2VL8 A;  4OOI A;  2H09 A;  1UHW A;  4QPQ A;  3KP6 A;  1V5G A;  3WGI A;  2P4W A;  3GYH X;  3OL4 A;  3IH3 A;  4C2M J;  1S6L A;  1LNW A;  1SD5 A;  2NAZ A;  2ID3 A;  3GFI A;  4M3B A;  3J7Y J;  1HF0 A;  2HQR A;  2NVU B;  3VDX A;  4F92 B;  4N9H A;  2X85 A;  1Z67 A;  4WX9 A;  4P1W A;  4JX5 A;  5F1R A;  5HLT A;  3L2R A;  3Q3S A;  1H89 C;  1QBJ A;  1P7I A;  1BW6 A;  2F4O B;  2L54 A;  5DM7 F;  2E71 A;  4L9N A;  5M5W J;  1FBU A;  4Y3O A;  2NNY A;  1D0Z A;  2IA2 A;  3H35 A;  4JX4 A;  3WTX C;  4XR6 A;  3A0B C;  1T38 A;  1BI3 A;  2HR3 A;  4CCO A;  2V9V A;  4XOR A;  2VQH A;  1RNL A;  1KU2 A;  2LDU A;  1I6H J;  1T2K A;  1U5T C;  3V8L A;  2HTJ A;  3F9K A;  5ICG A;  1J0R A;  2G7H A;  2ZO4 A;  4PCQ A;  3PFY A;  2N8G A;  3H9Q A;  3T8R A;  1AKH A;  4OMZ A;  4FIS A;  4S0H B;  1V54 H;  2O0Y A;  2MSY A;  2KDZ A;  4N4O B;  1IUY A;  5HLH A;  4AUX A;  4B1R A;  1DGW Y;  5GTH C;  4BDY A;  5FRM A;  4L5E A;  1WSU A;  1CGP A;  4E6K G;  1FSE A;  5F64 A;  4LMY A;  1G3Y A;  1WJA A;  4HNT A;  5BNG A;  2VBW A;  3SDB A;  4WWC A;  1YG2 A;  3CES A;  4EQQ A;  2QEX I;  2KIM A;  5L3C A;  1AA7 A;  1PJR A;  4X0G A;  5E3N A;  1L3L A;  1JTY A;  4IL6 C;  3KPH A;  4AID A;  2VJJ A;  1ZG3 A;  3S93 A;  2JN6 A;  3GEZ A;  4QPO A;  2STW A;  1E3P A;  2DJI A;  2YUS A;  2B0L A;  3HRU A;  2GXB A;  5JR3 A;  2NVY J;  3C3W A;  2CMP A;  3E5U A;  2RAE A;  1FYL A;  5EG0 B;  3L2W A;  3EYI A;  5KNL A;  1W36 C;  3HM5 A;  2Y48 A;  3S1N J;  2X1E A;  2EFN A;  1IXS B;  1MBE A;  2M2E A;  4BQA A;  4FHT A;  5D4R A;  4A5M A;  4QLC U;  3LST A;  4KN7 X;  3J7A Y;  1WH7 A;  3ZMU A;  4C2U A;  3UNG C;  4BS9 A;  4A93 J;  1D8J A;  2I10 A;  1B8I B;  4M73 A;  1T8I A;  4UB6 C;  3D5S C;  3H3V K;  4YRV A;  4Y33 A;  1RET A;  1ZRE A;  1YW9 A;  5JFR A;  4W1U A;  3WG7 H;  5HS9 A;  4A69 C;  4EJO A;  3PNY A;  3GFJ A;  4MTE A;  3ABM H;  1DUX C;  4E7I A;  2EIK H;  4ZYH A;  1XG1 A;  2W82 A;  4G7H F;  2Q1Z B;  1Z6R A;  2V6C A;  2PMZ N;  2UXN A;  1I6X A;  3EUH C;  4AD9 A;  4YIF A;  2R5Y A;  2AXL A;  2GAU A;  2CGP A;  3O2P E;  2LD5 A;  3ML6 A;  1X1A A;  1UCR A;  3HTS B;  1GVD A;  3QPS A;  4F52 A;  1IV6 A;  1RR7 A;  2O3F A;  1SC7 A;  1X1C A;  3T5X A;  2LOO A;  3BLY A;  3H5N A;  3BTL A;  2WY8 Q;  2R0Q C;  2JT1 A;  1HKS A;  3QWL A;  2XGX A;  2E1C A;  2MLK A;  3PM1 A;  4I99 C;  4M72 A;  3W2W A;  2ISZ A;  2FBK A;  4N9I A;  1JT6 A;  3K10 A;  2M87 A;  3EUH A;  3FMS A;  3QYF A;  3RPU D;  4RB2 C;  4XLN F;  3HL2 A;  3FZV A;  3DKY A;  5L3B A;  3TOA A;  1ZG5 A;  3A4C A;  2DFF A;  2VC0 A;  1HW2 A;  1U5T A;  3KP5 A;  2VJI A;  2BVL A;  2YU9 J;  1JUP A;  2P81 A;  1BJA A;  3CCS I;  3O8G A;  3M8J A;  1I5Z A;  2IRF G;  4PK4 A;  4OMY A;  2HNH A;  3FMQ A;  4D7N A;  2V1U A;  4IF4 A;  2QKL B;  3OYF A;  2CQN A;  3FXQ A;  3FDY A;  3WGH A;  3ZQH A;  5GAE J;  2DXI A;  2RNG A;  4HW0 A;  1R4N B;  1O3T A;  1BL0 A;  5L3G A;  2HPI A;  4EV0 A;  5E1W A;  4JBA A;  5EG0 A;  5K1Y A;  3B73 A;  2ZME B;  4CYD A;  1IN5 A;  3D1N I;  1LPQ A;  3T0Y A;  4I98 B;  3JAM Z;  3QP5 A;  2E5N A;  2QA4 I;  4B44 A;  2R7R A;  2HU9 A;  1EH7 A;  3E7L A;  1K4S A;  5DUK A;  1LEB A;  4LB5 A;  2EJR A;  3LFU A;  4Q5S F;  4DQ2 A;  3CC7 I;  4IRH A;  3TL4 X;  2XGD A;  3SZG A;  4CZZ A;  2Z99 A;  2QQA A;  3TW7 A;  3KIO A;  4BEH A;  5IPA A;  4F91 B;  2LKX A;  3S1R J;  4V2G A;  2Q8K A;  5BPI A;  2K3F A;  4BE0 A;  1HW1 A;  2EZK A;  5EZG A;  3K4B A;  4RLQ A;  3ABK H;  3PJR A;  3DBL B;  1EV7 A;  3L00 A;  2W00 A;  2E1O A;  1OLT A;  2ELK A;  3B02 A;  3GTG J;  2BXZ A;  5JVT A;  1MW7 A;  2KRH A;  2FXA A;  1KGS A;  3G1M A;  2X4H A;  2B7E A;  2DU9 A;  1UAA A;  3R61 A;  2LY2 A;  3CME I;  2CYY A;  4G94 A;  4BU2 A;  4E4H A;  1XGO A;  5J6X A;  2BZT A;  1TT0 A;  2ZCW A;  2ZSH B;  4IRG A;  1SAX A;  1HC8 A;  4RGR A;  2VT2 A;  5K7H A;  2QWW A;  5H6Q A;  1MJB A;  4OAY A;  1EH8 A;  4B43 A;  3OYE A;  1FSH A;  4R8H A;  3M07 A;  5HNF A;  1J2X A;  2ME0 A;  4J00 A;  5D6F A;  4CCN A;  1O7L A;  4UUV A;  3L2C A;  3QPT A;  4YEL A;  3HOS A;  4MO7 A;  5E3O A;  2X9D A;  4LK0 F;  1FIA A;  2QBY B;  3L9F A;  5D5X B;  1VZ0 A;  5FD5 A;  3DF8 A;  1YTY A;  5C4J J;  3AG4 H;  5CVJ A;  1I3Q J;  5IY5 H;  2DK8 A;  2ZXH A;  3H36 A;  3EPZ A;  2ZB9 A;  1ETW A;  3SYT A;  2JJ7 A;  3ZN1 A;  5IYC J;  4A3G J;  4BQO A;  2VB6 A;  4RGS A;  3U21 A;  2VOO A;  4YEJ A;  3A0H C;  2NS8 A;  2VUM J;  4M9Z A;  2V7F A;  1ZKG A;  3RPQ A;  2XAS A;  2DOA A;  1TWF J;  3VFZ A;  3ZRG A;  4X6A J;  4IQ4 A;  2OZ6 A;  2KJB A;  1BR2 A;  5C44 J;  1K61 A;  2RDP A;  2XF7 A;  2Q0O A;  5H2F C;  3SFI A;  5LHG A;  1ORK A;  2YX4 A;  5M5X J;  3ABU A;  5DDG A;  3G3Z A;  1BW5 A;  3L7W A;  5CQG A;  3BG5 A;  2CU7 A;  2Z5U A;  2DA3 A;  1VQ6 I;  3GO5 A;  2PN6 A;  4TV7 A;  2M1B A;  2OJE D;  2ETH A;  2OA4 A;  3JRF A;  3RJP A;  3DCF A;  3ELK A;  3BY6 A;  3GLX A;  5GPA A;  4PDK A;  1ON1 A;  2VXD A;  3F21 A;  1JGS A;  2VBX A;  4FX0 A;  4NUB A;  3BT9 A;  1ETK A;  4XKC A;  4C3I J;  4P96 A;  1LQ1 A;  1DDN A;  2RV8 A;  3HOT A;  3CP2 A;  2IGN A;  2W7N A;  4CSW A;  4UUS B;  1JT0 A;  3ZN0 A;  2H27 A;  4IOA F;  3I0T A;  2MH2 A;  3P9C A;  4M6X A;  4RGX A;  5F08 A;  1H0M A;  2M30 A;  1TW3 A;  2CG4 A;  4I0A A;  1J9I A;  3D0S A;  3EET A;  4BBR J;  3IWF A;  4LB6 B;  2ISY A;  3QOE A;  3TBI A;  5BS6 A;  4Y52 J;  3RCO A;  1YIO A;  3HYI A;  4G12 A;  2GQQ A;  3ZP5 A;  2DBB A;  3HDD A;  2PQ8 A;  2D5V A;  5DD4 A;  3LSM A;  1YHQ I;  2HS5 A;  3LSK A;  1BC7 C;  1ETY A;  4DGW B;  4J01 A;  1FZP B;  3ABL H;  1GV5 A;  5L3D A;  4BQN A;  4AWX B;  1DP3 A;  2P5K A;  2PMZ A;  2WTE A;  2DW4 A;  3K1M A;  2WV0 A;  2Y31 A;  1SFX A;  3GBG A;  3RTR A;  1KYW A;  4BAY A;  5J3L A;  1B9N A;  4ESJ A;  1SFO J;  4UB8 C;  3A01 B;  2HOA A;  4WCG A;  4MEX F;  4HRI A;  4IXA A;  4LFU A;  4CCJ A;  3KET A;  4A6E A;  3ZQL A;  1VQ7 I;  1GV2 A;  4ZYA A;  5GAD J;  3BJ6 A;  2TDX A;  4HF0 A;  5GAG J;  2R7V A;  2HPM A;  4NC6 A;  4Y7N J;  3VPR A;  3M3Y J;  1BIB A;  4I6Z A;  3I4P A;  3LA3 A;  2IVM A;  4OIR F;  3SXY A;  3WE3 A;  2ELJ A;  5D8L B;  4KMU X;  1ZYR F;  3WG9 A;  3Q9V A;  4IQJ A;  4L18 B;  1R1U A;  2KKO A;  4ON0 A;  1STZ A;  1W4M A;  1ZQ3 P;  1WZ2 A;  3RKY A;  4AVZ A;  1RR8 C;  1PUF A;  3RI4 A;  1ETQ A;  1QRY A;  2EV5 A;  2E7W A;  4II3 A;  2BOL A;  1KU3 A;  3HGY A;  1GXQ A;  4N4N B;  3G4S I;  2VQC A;  3IH4 A;  2ZME A;  1T0F C;  2GOX B;  2UZK A;  2GXA A;  1TQM A;  3RZD J;  4KMF A;  1E0E A;  2BHY A;  5LFA A;  4FTH A;  4IHV A;  4XL9 A;  1T56 A;  2KJC A;  3V7C A;  3FMR A;  1UST A;  3CTA A;  2JVH A;  4IZZ A;  3BCB A;  3H0G J;  2LF8 A;  3K4J A;  3PNT A;  3SZT A;  2W24 A;  4PFP A;  4H4K C;  4KUM A;  5LGN A;  1ZR4 A;  2JK3 A;  2F5E A;  5FKN A;  4GGG A;  4PJN A;  4CIC A;  1YQA A;  2DT7 B;  3CO6 C;  3AFH A;  1B59 A;  1S3J A;  2PBI A;  3SDG A;  4D7M A;  1UEL B;  1WGX A;  3LSJ A;  3BCA A;  3OSG A;  5TIS C;  2XRL A;  5LEK A;  2I8D A;  2K27 A;  1SMY F;  3H1C A;  2R3S A;  2R93 J;  3IAS 2;  4Q48 A;  2K5C A;  2COM A;  3LA2 A;  4IEJ A;  4BBS J;  4PZJ A;  5J1U A;  3DTI A;  1KQ8 A;  3W6V A;  2VPL A;  1YJN I;  5E3M A;  3HBL A;  1X1B A;  3VB2 A;  1OKR A;  2YPR A;  2KHM A;  4DOZ A;  4V19 K;  2VKE A;  3PUF A;  1VQ4 I;  4N0B A;  1JHF A;  4KIG A;  2CS3 A;  3CLQ A;  3ESW B;  4XLA A;  3CZ6 A;  3LQR A;  5LBQ A;  5CJ9 A;  2DDA A;  4QWQ A;  2XF5 A;  5EEA A;  3O3K A;  1P4W A;  5C4X J;  2EIJ H;  3KE2 A;  3F3X A;  3TO6 A;  3I59 B;  1GUU A;  1FBQ A;  2DA6 A;  2F5D A;  1ZK8 A;  1JE8 A;  4IJA A;  2DTZ A;  1R5G A;  3GTK J;  3WTT C;  3GTM J;  1X19 A;  1DU6 A;  2DFI A;  3BR3 A;  2LBF B;  1ENH A;  2GA2 A;  5K7Z A;  2XC7 A;  3A03 A;  2OAZ A;  2K4B A;  3DEW A;  1HCR A;  1UB9 A;  2GLO A;  3H3U A;  2R5Z A;  1TC3 C;  4LLG F;  1WPK A;  4CHU A;  2EZH A;  2FNP A;  3OOP A;  4B8X A;  4DYC A;  3GTL J;  5JVG F;  2XVC A;  2CFO A;  3BTJ A;  3TGN A;  4RB3 C;  2UV1 A;  1YFH A;  2RC4 A;  1ZAO A;  1FWZ A;  4A3L J;  2ZXJ A;  1GVJ A;  1MMA A;  3TO9 A;  2F5V A;  3E0J B;  3FXM A;  2VON A;  4PJJ A;  1LUJ B;  1XMK A;  2PG4 A;  5BQT A;  1SVL A;  2LF7 A;  3R4K A;  5GP9 A;  5H6R A;  5F0C A;  5C3E J;  1LE8 A;  1H9G A;  4BEH B;  2CUZ A;  1FNN A;  1LJ9 A;  3L09 A;  4XKB A;  3HC7 A;  3FBI B;  3IC7 A;  3PSI A;  4E7H A;  3K70 D;  4MFE A;  1ZR2 A;  2X6O A;  3S3M A;  2MGQ A;  2DTR A;  4BE1 A;  1E17 A;  2IPQ X;  1OR7 C;  3PL8 A;  2Z16 A;  2COB A;  3Q9S A;  3FF5 A;  1YJ9 I;  1SVO A;  3BTI A;  3ECO A;  3BTC A;  1TQI A;  4D5C A;  2HXI A;  3OIQ A;  2MC3 A;  3IKT A;  1IN6 A;  4UUS A;  1SEU A;  2VKD A;  3E1S A;  1ON2 A;  2NOG A;  1BOB A;  3OIP A;  4KIS A;  2QQB A;  3H92 A;  2HWV A;  3TDU C;  5LEJ A;  2OC6 A;  2IA0 A;  1MZB A;  3V7R A;  3VOD A;  1JKR C;  4XLP F;  2GIV A;  3FX3 A;  3PO2 J;  3AG2 H;  1BN5 A;  2YR2 A;  4A5N A;  1YJW I;  1VQ9 I;  1UG2 A;  3E5Q A;  3RYP A;  4M9X A;  4L5I A;  1PUE E;  4IHW A;  5LHI A;  2E36 A;  4DBQ A;  1VQN I;  3TKY A;  1LEA A;  1FJL A;  4E7S A;  3S8P A;  3MMY B;  2Z33 A;  4E7K A;  4IHY A;  4CGZ A;  3HOU J;  4G7O F;  2ZME C;  3JRH A;  2CUF A;  2DMT A;  2EWN A;  1OYI A;  4M9S A;  3CJN A;  3E97 A;  3ISP A;  4NC8 A;  2OV7 A;  2VJ5 A;  5CVU A;  4B3A A;  3CMY A;  4LG3 A;  4UHT A;  3FK7 A;  4XMY A;  1P7J A;  3TW6 A;  3OMY A;  1D5V A;  4IHS A;  5CKT A;  3GUD A;  1I1S A;  3K1N A;  3HUG B;  4H0E A;  1R1V A;  2DQR A;  1BBY A;  4NBQ A;  4AC0 A;  3AL0 B;  4ZZD A;  3BJO A;  2P0W A;  2NXN B;  1S7E A;  4HST A;  5ILV A;  3I64 A;  3V8J A;  3JRI A;  2W4S A;  3K70 C;  3OYI A;  3QAH A;  3NQO A;  4XKV A;  3BG3 A;  3CDI A;  2CSO A;  2O6G E;  4DJA A;  3GZ6 A;  1TNS A;  4HNV A;  4BXU A;  3W2A A;  1MND A;  4B4C A;  4HX8 A;  3OIO A;  4YFN F;  2ICW G;  2V9P A;  3J80 Z;  2O9L A;  4D9J A;  1E2X A;  1P6R A;  4HDV A;  2M7A A;  2NVQ J;  2BGC A;  1WJC A;  5HOO A;  3BJA A;  2G0E A;  4P55 A;  2RQQ A;  3LSI A;  1IRG A;  1IGN A;  4B47 A;  1RIO H;  2NVX J;  2GA1 A;  2K3P A;  1G59 A;  2X51 A;  3DTE A;  5D8K B;  2ECC A;  4UUT A;  1YX5 A;  1TW2 A;  4MEY F;  5A2Q K;  3OYA A;  1IRZ A;  1MKM A;  4XRF A;  5HLI A;  5J8F A;  1SAN A;  1JUM A;  3REO A;  3U9G A;  2A69 F;  3X2Q H;  5D5U B;  2EA2 A;  3FIS A;  3ZPL A;  3CC4 I;  2M4K A;  3S3O A;  1IO2 A;  4NQW B;  2UXX A;  4J19 A;  3S32 A;  4EVI A;  4U7B A;  2L5Q A;  1O3R A;  4AU7 A;  2BEO A;  2NYX A;  4KT6 A;  4HX4 A;  5KVR A;  3GCM A;  1LKX A;  2OQG A;  3OYC A;  1RUN A;  5F0H A;  3M8F A;  2XSJ C;  4V2F A;  4UVA A;  4RAG A;  2EFP A;  5E1Z B;  3MKY B;  4HEA 2;  1G4D A;  4BY1 J;  2LFB A;  2HKO A;  4RGU A;  2K9S A;  4ZDP A;  2KRC A;  2G9W A;  1W7P A;  4Y15 A;  5ICF A;  4LLL A;  1QO0 D;  1WJB A;  2ZSI B;  2J5O A;  2M0M A;  1LVK A;  1T08 B;  4KIT B;  4RAF A;  3N05 A;  1FTZ A;  1Y6I A;  3MZ8 A;  3V42 A;  1RUO A;  1X4O A;  2CQQ A;  4KIF A;  4BY7 J;  5HDG A;  2LRD A;  2XGE A;  2V1D A;  5TRD A;  4PJ0 C;  4MQV A;  4RB0 A;  4RM3 A;  2YS9 A;  2DN0 A;  2WC2 A;  1U9O A;  1D5Y A;  5LGT A;  4WXC A;  1VQO I;  3OYJ A;  1R4M B;  2WAD A;  2QLZ A;  1Z3Y A;  4BH9 A;  5AIQ A;  2LC2 A;  2QCO A;  4A0Y A;  3H0D A;  1WI9 A;  4LIV A;  5EF6 A;  2NNN A;  3OS2 A;  2MD5 A;  1W36 D;  4CZC A;  2GXG A;  5M5Y J;  2ZC2 A;  3LQQ A;  2FEZ A;  2KFD A;  3HPH A;  2H6B A;  3R60 A;  3RQI A;  4HNU A;  3R0J A;  3NWT A;  4ESF A;  2MAB A;  1V5F A;  4CYC A;  1FPQ A;  4ZJZ A;  4WXH A;  1UFM A;  4LGW A;  1XGN A;  5FKK A;  2DA5 A;  4D5F A;  2ZJP F;  3VYS B;  3RSN A;  1XPX A;  2B9S A;  1U3E M;  3AL0 C;  3OWT A;  2FML A;  3C7J A;  1XMX A;  3M7G A;  4I76 A;  4XLH A;  3GTO J;  1FP1 D;  2DLL A;  2JWT A;  1SD7 A;  3H5A A;  1F4K A;  1IUF A;  3P7N A;  2IBD A;  1Z7L A;  2HTS A;  1U2W A;  3TQN A;  2Z2S B;  3BZ6 A;  2XAG A;  2V79 A;  4K2E A;  4JOM A;  3S1M J;  2LKP A;  5EGO A;  3I9V 2;  2MG4 A;  6PAX A;  3K7A J;  1V5E A;  2A68 F;  2WV1 A;  4AIK A;  2EFQ A;  2F5C A;  2LG4 A;  4XLE A;  3JRB A;  1B6A A;  3DBH B;  4U88 A;  1IAW A;  1JXS A;  5DEQ A;  3COA C;  1WJF A;  3MWM A;  1P4A A;  3E6B A;  2HXO A;  3BWG A;  5ILU A;  2EFO A;  3EDP A;  2XGC A;  3VSK A;  2FBI A;  2WB1 N;  4A3F J;  3HRS A;  3K4L A;  3M1C A;  3WU2 C;  3ASO H;  1R58 A;  1MH4 A;  3CO7 C;  1XSX A;  1ZRD A;  5DCF A;  3A01 A;  1NG6 A;  3WU0 A;  4M6Y A;  1U0J A;  4C9Y A;  1MBG A;  2FBH A;  1XDU A;  1MSF C;  1MH3 A;  4XK4 A;  3LAJ A;  2A5W A;  4B48 A;  2X48 A;  1J09 A;  4KIB A;  3MQ0 A;  2HDD A;  1O7F A;  4ZYE A;  4UNO A;  2HZD A;  4EGY A;  3J7Z I;  3HEF A;  2XAU A;  1WJE A;  3ROU A;  3F23 A;  3FHZ A;  3RQ4 A;  5IP9 J;  3LFK A;  5DS9 A;  4XBF A;  1QQI A;  3ZOB A;  5A2Q Z;  2LRE A;  2IS1 A;  3JRA A;  1C0W A;  1FLI A;  2A05 A;  2H1L A;  5IOZ A;  5B1B H;  1OYY A;  4CXF A;  4FX4 A;  3G1O A;  3E5X A;  3BOQ A;  3NEU A;  2LR8 A;  4HF2 A;  1X3W B;  2H94 A;  2IGM A;  2OCE A;  4L9J A;  3SJM A;  1T0F A;  3G73 A;  4OIQ F;  4U87 A;  4RDU A;  2G7U A;  1R9T J;  3FWE A;  1E3O C;  2PI0 A;  2VOD A;  2XAQ A;  3W6K B;  3S1Q J;  1QA6 A;  2WAF A;  2IS4 A;  3QOP A;  3OYH A;  5LRR A;  4HLY A;  1VQL I;  4ZYD A;  1CQT A;  5FLV A;  1Z3X A;  2CW8 A;  2FMY A;  2Y2Z A;  4PGG A;  2VT3 A;  2E19 A;  4KNY A;  3GTJ J;  1IXR C;  4GFB A;  1MJ9 A;  2BV6 A;  3WU1 B;  4RA2 A;  4UXN A;  2E2H J;  2EIN H;  4UVC A;  1MGT A;  1SFU A;  4LLN A;  5EJC A;  3MZH A;  4PJL A;  3WHB A;  4BUP A;  5E18 F;  4ESB A;  1JKP C;  5E17 F;  2L9R A;  1RPW A;  4EJV A;  4HQE A;  3SFZ A;  2KPM A;  5E79 C;  4CCM A;  3O6B B;  2WA0 A;  2A5Y B;  1Y1V J;  1EH6 A;  1HDP A;  2EZI A;  3GVA A;  5B1A H;  5IT9 K;  1N25 A;  4I0B A;  2JA5 J;  1UZC A;  1CF7 A;  3CCJ I;  3FM3 A;  2OPT A;  1ZHF A;  2R7Z J;  1KU7 A;  2IJL A;  2VI6 A;  2R7S A;  2ESH A;  2FE3 A;  1BI0 A;  1ONV A;  2NVT J;  2BY0 A;  2IGO A;  2M4G A;  2M7B A;  3I54 A;  4M74 A;  1WVR A;  2HQA A;  3GME A;  4G6T B;  2L7M P;  2ME6 A;  5JI6 A;  3N4M A;  5ERI A;  2UWM A;  1Y1W J;  1QZZ A;  1MMG A;  4LG0 A;  2R7X A;  2DJN A;  2ELH A;  1MJA A;  1YIJ I;  2DFH A;  3I56 I;  1X1D A;  3HG9 A;  2HEO A;  1A6I A;  2JSC A;  2CWE A;  3JSO A;  3CP8 A;  3MN2 A;  4HG2 A;  2MC4 A;  3ZCO A;  2CV2 A;  5IP6 A;  1HLV A;  1EKE A;  1P92 A;  2M9H A;  1FYK A;  3DBR B;  9ANT A;  3PQK A;  4U0W A;  3K4C A;  2KIU A;  1IDY A;  4L9V A;  2L2O A;  4HF1 A;  2LVS A;  4M3G A;  1N75 A;  2H8R A;  1YX3 A;  2DFE A;  3GTP J;  3DEU A;  1T98 A;  1WRJ A;  2HZT A;  4ENM A;  1MMD A;  2W84 A;  3PFI A;  1IZ1 A;  4OIN F;  5B5E C;  3JRC A;  1PP8 F;  1A6Q A;  1FOY A;  4RLF A;  2Z3Y A;  2QZ8 A;  2BBY A;  3ZR8 X;  2F5F A;  4A6D A;  1ZTR A;  3MFK A;  3CF2 A;  3ERM A;  3VYU B;  1P9Q C;  3DP7 A;  2EA4 A;  3Q0U A;  2CH0 A;  1XCB A;  3TED A;  2EZL A;  2I5U A;  1M1E B;  2QQ9 A;  2JSP A;  1Z9C A;  3F6O A;  2B63 J;  5M3M J;  2GIZ A;  1R5I D;  1VFC A;  2P5V A;  2X1D A;  4WK8 F;  4EMS A;  1HKT A;  1JHH A;  1XC5 A;  3JRG A;  1AU7 A;  3ASN H;  1K78 A;  5K5O A;  5FKM A;  1FIP A;  4BJ6 C;  2R92 J;  2GOM A;  3K4N A;  4XSZ F;  2QKM B;  4GCV A;  1PYV A;  1Z7U A;  2ZJR F;  2L3D A;  3F22 A;  2VC1 A;  1IC8 A;  3OYM A;  1P2F A;  2QSF X;  1J59 A;  2Y69 H;  5BOX A;  2OTL I;  2AXT C;  1IN4 A;  3CJQ B;  4AM3 A;  2CUJ A;  2ACJ A;  2DYS H;  3OYL A;  3CCE I;  3F0C A;  3VEP A;  5HDN A;  3S15 J;  1R00 A;  2LMD A;  2QM3 A;  1QPI A;  1FEX A;  1LE8 B;  4HPQ A;  4PJM A;  5J4Y A;  2BW3 A;  4M6V A;  3CCV I;  4BDZ A;  2R7U A;  1MBH A;  3PQJ A;  4KYW A;  2DO7 A;  5F27 A;  2NRA C;  5ILS A;  1T33 A;  4NB5 A;  2XAF A;  1QVU A;  1ZGA A;  4I02 A;  1RKT A;  1D1A A;  1XGS A;  5CPR B;  1SAU A;  4G9Y A;  1OJL A;  5CVI A;  2ZJQ F;  1VTN C;  2JUC A;  1HST A;  2Y0S A;  3LA7 A;  1ODD A;  2CO5 A;  5FO5 A;  2TCT A;  5DYM A;  4MLO A;  1CF7 B;  2DA2 A;  1ZRF A;  3RIR A;  2XB5 A;  3UR3 C;  3CCY A;  3FXU A;  1XX5 A;  2CFX A;  1T39 A;  1XTA A;  1W7P B;  1Y0N A;  3KYL A;  3WGG A;  2LYC A;  2QGU A;  3OSF A;  2VKH A;  1FBS A;  2DDB A;  1ERD A;  1YW8 A;  1R1T A;  3D5L A;  3HSF A;  5EGO B;  2DA4 A;  3CQZ J;  1GHC A;  2L4M A;  1R71 A;  1WI3 A;  1OCO H;  1JKQ C;  3CMA I;  4M3F A;  5LHH A;  3FK6 A;  4KN4 X;  3BPV A;  4II2 A;  1LVA A;  3E3V A;  3WHC A;  3BP8 A;  3T8T A;  2L9V A;  3V4G A;  1RI7 A;  2KP6 A;  4YII A;  3HXL A;  1UJ8 A;  3BQZ A;  2KQR A;  4FQG A;  5CQE A;  3QYE A;  4A3I J;  2Q2E A;  2XRO A;  2V1X A;  1BM9 A;  1SFE A;  5B66 C;  3ZQ7 A;  4IOC F;  1JKO C;  5CLS A;  4GYG A;  1Y39 A;  1FP2 A;  2DK5 A;  3RDI A;  1TQP A;  3VWB A;  1DPU A;  5EYR A;  3RYR A;  3BG9 A;  3DWL E;  3ZMS A;  4F55 A;  4IX7 A;  3H9J A;  3TP3 A;  2R7O A;  4GRI A;  1Z77 A;  4XOT A;  1FMV A;  4ZDO A;  4KJZ A;  2VPR A;  4L0Y B;  4DBR A;  1J5Y A;  1H8A C;  3K9T A;  3HKZ N;  2QQ8 A;  2LNB A;  1S8N A;  3MAJ A;  3SZP A;  1KQ0 A;  1FX7 A;  2BW3 B;  2JUG A;  4HOB A;  1EF4 A;  3J80 K;  3IRQ A;  2LLK A;  2O5R A;  1R7J A;  2DMP A;  3DPT A;  2DOE A;  3KYC B;  3MKZ A;  3CCM I;  2FSW A;  3DPU A;  3P5J A;  4CH7 A;  5FB2 A;  2OTJ I;  2LH9 A;  5DTD A;  2QSH X;  1LFB A;  2FD5 A;  5DCM A;  4BXX J;  1TWC J;  1WCM J;  3B6A A;  3BZK A;  3ZXS A;  5L3F A;  1BIA A;  2RNJ A;  2R5Z B;  4O6J A;  3BZC A;  1WQ2 A;  3CUO A;  1O57 A;  1A35 A;  4YIR X;  2Z1D A;  3BC8 A;  3L1P A;  2KMU A;  4ZH4 F;  3B6C A;  2R5Y B;  4ASN A;  1R36 A;  2F4I A;  1YRN B;  2R7Q A;  2VXZ A;  2DMQ A;  2X1C A;  3F6V A;  5AIP A;  4RAZ A;  2EPF A;  4GXO A;  3OR2 C;  5IT9 Z;  3KLN A;  4F7Z A;  2KZG A;  5FLX Z;  1VQK I;  2VOP A;  1G8X A;  2OD5 A;  4BJT A;  4A3E J;  2L02 A;  1OR7 A;  4PFO A;  2W48 A;  2V1N A;  1MIJ A;  3GF2 A;  3HSE A;  1MMS A;  1W1W E;  3RPU A;  4E7Z A;  1T95 A;  1DP7 P;  1HDD C;  3I55 I;  3F8B A;  1P4X A;  4CA0 A;  2DYR H;  1I1G A;  1K7A A;  4XNF A;  2IAI A;  1JGG A;  2XDV A;  2DA1 A;  5HOD A;  5ICE A;  1OCR H;  4WXD A;  5E20 A;  2KL4 A;  1DQU A;  4Q47 A;  5KAI C;  2JQ7 A;  2ZFW A;  3CDH A;  1WHU A;  2O8K A;  1G3T A;  4B09 A;  2AHQ A;  4MHG A;  4ETS A;  1APL C;  1YW7 A;  3HOV J;  4XRS A;  3MKL A;  2E2J J;  2M0C A;  2HVS A;  4GYI A;  1OCC H;  3TMO A;  1W0U A;  2XF6 A;  3IV5 A;  2PX9 A;  3OYN A;  3CCR I;  2OBP A;  2TRT A;  1WH5 A;  1K78 B;  1B72 A;  3MKW B;  4EJU A;  3L2Q A;  2L4A A;  1D0Y A;  3FIW A;  3J81 Z;  1HSJ A;  4BL0 B;  3HRT A;  4OAZ A;  4ZYG A;  2C6Y A;  4RBO A;  3M4O J;  2AO9 A;  5FJ8 J;  1G3W A;  4EJW A;  1KZH A;  1R5H A;  2H6C A;  4QSH A;  1S5L C;  2FRH A;  3VYT B;  5D5V B;  3FM5 A;  3Q5F A;  3MCZ A;  4AVP A;  4NHJ A;  3OS1 A;  1R6R A;  4PGH A;  1LFU P;  1IDZ A;  1ZG1 A;  1W5C C;  2KLO A;  3DKW A;  3K4M A;  3FXK A;  3ECH A;  3HJE A;  4U0Y A;  1RES A;  5TJJ A;  3RKQ A;  1TWG J;  2E34 A;  2X6Y A;  3P9I A;  3IH2 A;  2WWY A;  1R49 A;  4YFX F;  4HLX A;  2W85 A;  3JW4 A;  3LAP A;  3LNQ A;  2IS2 A;  2W57 A;  1NTC A;  1IN7 A;  3Q0W A;  4ZTF A;  4IRI A;  2E7X A;  4A0Z A;  4Z2Y A;  5HS7 A;  3OV8 A;  2XUB A;  3M8E A;  4HDU A;  4AIH A;  2PLY A;  4GDF A;  5B3S H;  1X58 A;  1MDM A;  1OIS A;  2K40 A;  1POG A;  2Y9Y A;  3VOE A;  3MZY A;  3QQA A;  2JTV A;  2K9Q A;  3KX2 A;  2QEN A;  1MNM C;  1TZL A;  4EM0 B;  4YFK F;  3A1Y A;  1Y56 A;  3CUQ A;  3H3Z A;  3HSR A;  1AKH B;  1I3A A;  1IG7 A;  5CVV A;  1O4X A;  1S7O A;  2WY7 Q;  2YSR A;  3FKI J;  1GDT A;  4XKW A;  3G2B A;  4LK1 F;  2A07 F;  2RGV A;  4CCL A;  2HOT A;  3K6G A;  1UHS A;  4JP0 A;  5DM6 F;  2VJ4 A;  2ADU A;  2FQ4 A;  2JRT A;  4LD5 A;  4XID A;  5DD8 A;  2FOK A;  1VF9 A;  4R1H A;  1BOA A;  2O7O A;  1U6G A;  3S17 J;  4A3B J;  3BPX A;  1LDK B;  1HXD A;  2PJR A;  1EJ9 A;  5E8I A;  2Q2E B;  1XSV A;  3JSP A;  2HYG D;  2K86 A;  2F4M B;  4NNJ A;  3F8M A;  4ENN A;  3WTV C;  1K79 A;  3KLO A;  2Y0S N;  2XAJ A;  1K4T A;  2CRG A;  2QF7 A;  3WE2 A;  4A12 A;  2M5W A;  3JTH A;  3UKG A;  1LDD A;  2IGK A;  2PJP A;  4XQF A;  2P8T A;  2KIQ A;  1Y0U A;  2RKH A;  1IXC A;  2XRN A;  3H9G A;  2K7L A;  1RC9 A;  1TWH J;  4ITV A;  4UVB A;  1OYW A;  1BA5 A;  5IOY A;  1HQC A;  3NAR A;  3SEZ A;  1YIT I;  1O3Q A;  3CCQ I;  3S16 J;  2VBY A;  1USS A;  4JQF A;  1WWX A;  3BR1 A;  4E7J A;  3JR9 A;  1NH3 A;  1EA3 A;  3CUQ C;  3ABT A;  1S29 A;  2GBY A;  1A36 A;  4FE4 A;  1PDN C;  5F0F A;  5E3L A;  2XV4 S;  1S9H A;  2HQ5 A;  2ZNY A;  4IHX A;  2F48 A;  2FOW A;  2R7W A;  1GLN A;  1D1B A;  2Y0M A;  1IRX A;  4A2U A;  3J81 K;  1TLH B;  5L3E A;  2VQL A;  4S04 A;  1XB4 A;  2M3A A;  1B1B A;  3C2G A;  2V9K A;  2BE5 F;  2HYJ A;  4G6D A;  2P7C B;  2VIX A;  3C2H A;  3KEQ A;  2VQG A;  2R7F A;  1XD7 A;  1XDS A;  3ZMD A;  2OCC H;  4UV9 A;  3DU6 A;  4E7L A;  3CC2 I;  3ZQC A;  5IP7 J;  1X4P A;  4M71 A;  2XPU A;  2XPW A;  4XM3 A;  1TTY A;  2ZFU A;  4A0X A;  4OIP F;  2E60 A;  5FKL A;  3ZQI A;  1J7K A;  4O3M A;  3LSP A;  4Y4R A;  3OOU A;  1ZN2 A;  4CYC B;  1QZE A;  2EIL H;  3OYG A;  1SMT A;  5HNH A;  2DMN A;  2MYS A;  4L9T A;  2JPB A;  1H9T A;  2BXY A;  2KDO A;  1XCV A;  4C30 A;  1Q1H A;  2STT A;  2P6S A;  4G6Q A;  2D1H A;  3DTK A;  4IPA A;  5GAH J;  1BC8 C;  2IP2 A;  3JRE A;  4HYE A;  2OZU A;  5DUI A;  3FBN B;  4WF2 A;  4B3X A;  3I53 A;  3U1D A;  3KP4 A;  4I01 A;  4MTD A;  3NWS A;  1QPM A;  2DPU A;  3PIO F;  2DPD A;  1LB2 A;  2LY9 A;  3KZI C;  3G1L A;  3I3L A;  4E70 A;  2DOF A;  1FC3 A;  2HOS A;  1Q1V A;  1U9N A;  1JTX A;  1GXP A;  4D0P A;  2BY2 A;  1YOV B;  4DW6 A;  2CUE A;  1B8I A;  1E3H A;  4G8X A;  3BDD A;  3GFL A;  1YRN A;  2JPC A;  1XN7 A;  3KFW X;  2MH9 A;  4P9U A;  4FCY A;  3O8H A;  3ULQ B;  5KK1 A;  3IKV A;  1QHG A;  3QPL A;  3GLL A;  2LBF A;  2BY1 A;  2RQP A;  4L5J A;  4KT5 C;  2F6C A;  4ZZL A;  2DT6 A;  1JI8 A;  3CF5 F;  4XN0 A;  3BG7 A;  1QHH D;  4HA8 A;  2VBZ A;  1VND A;  3BR2 A;  4HQM A;  3WTS C;  2L9S A;  3K2Z A;  2LP0 A;  2NOJ B;  1ZGJ A;  3T1B A;  3KP7 A;  4RS8 A;  3C18 A;  5FGM A;  3HIF A;  2ECB A;  3SHF A;  2VN2 A;  1ULY A;  3I58 A;  4M3E A;  1D3Y A;  4OU0 A;  3HUG A;  4P9F A;  4QIW N;  5IT3 A;  1FMW A;  1VQP I;  3CJR B;  2ZNZ A;  1ZAR A;  1Z1D A;  4A3J J;  1G2H A;  3BQY A;  5JHF A;  2HI3 A;  1QNT A; 
#chains in the Genus database with same CATH homology
 4KIC A;  3ZMZ A;  4L0Z B;  2K4J A;  4O5V A;  3TO7 A;  2FQ3 A;  1YLF A;  3QU6 A;  2CW0 F;  5E8G A;  4MQ9 F;  4ENK A;  1W7P D;  5D4S A;  4HAM A;  4RB1 A;  4MGR A;  2DQL A;  2DT5 A;  5EEH A;  1ZLJ A;  2PMH A;  4RAY A;  2EK5 A;  2A3S A;  3E6C C;  4NQW A;  1Z6T A;  2R7D A;  4HX7 A;  1F9N A;  5HVQ C;  2OU2 A;  2ZKZ A;  4BHP A;  1I27 A;  3KCC A;  3MEX A;  2HGC A;  5BPD A;  5K5Q A;  1B4A A;  5LRS A;  1YYV A;  2QVO A;  4EJT A;  3IRR A;  3HTU A;  2RVC A;  2J5P A;  4R79 A;  3GZ5 A;  1Z91 A;  3JAM K;  1TBX A;  4U7D A;  1U8R A;  1TNT A;  2IW5 A;  1AWC A;  4U0V A;  4BHB A;  2FU4 A;  5ICC A;  1KA8 A;  4HZF A;  3WTU C;  4OIO F;  2A6E F;  1FY7 A;  2BYV E;  5FFX A;  5CYV A;  3DQV C;  3E6D A;  3RKX A;  1OPC A;  1L0O C;  5DCM B;  1IF1 A;  1HW5 A;  3K69 A;  5F6F A;  1KYZ A;  3BRO A;  1Z05 A;  3KZZ A;  3GX4 X;  4EM1 A;  2ZBK A;  3GW2 A;  2PMU A;  4HBL A;  2HDC A;  3SQN A;  2XHK A;  3ZMT A;  3I71 A;  4LG0 B;  2A6H F;  1IRF A;  3NRV A;  2HYF A;  3W6J B;  2HQN A;  2XKP A;  1KQ9 A;  2FNA A;  1QZY A;  3KEO A;  2CQK A;  4XSX F;  4KA4 A;  3DXJ F;  2IA1 A;  4Q4Z F;  2M8E A;  4ENJ A;  1QGP A;  1S7A A;  2XAH A;  2LSO A;  2HFH A;  2OQR A;  2EFW A;  3F8C A;  1RZ4 A;  2EV6 A;  2D2W A;  2D1V A;  4Y17 A;  5FD6 A;  3WTY C;  1BI1 A;  4DNC A;  3KZY A;  4EGZ A;  5AON A;  3J7A O;  5K5R A;  3R6S A;  2ZJ2 A;  4AIJ A;  1ZRC A;  2O03 A;  2VE9 A;  3KP2 A;  2X0L A;  3GXO A;  3K0L A;  5LGU A;  3F8N A;  5E1X A;  3TDZ C;  1G6N A;  1R22 A;  4YG2 F;  4CDG A;  1W5T A;  1LDJ A;  1V4R A;  2A61 A;  1SD6 A;  2E1N A;  4IHT A;  3LWF A;  4CO8 A;  4EM2 A;  2F2E A;  2GWR A;  1WKM A;  1FOK A;  3JTG A;  1XSD A;  1U78 A;  1G3S A;  1OMI A;  2P5L C;  4I09 A;  3WTZ A;  3CUQ B;  1YS6 A;  2MBF A;  3KP3 A;  2O8X A;  3GFM A;  5HLG A;  4Y13 A;  5HDK A;  1HKQ A;  1SD4 A;  4P5O A;  2GZW A;  1IW7 F;  1AOY A;  3FXR A;  4FT8 A;  2YX7 A;  3WTW C;  5BMZ A;  2QBY A;  3F8F A;  4GO1 A;  3I59 A;  2QUF A;  2EB7 A;  2FA5 A;  3R0A A;  1KU9 A;  1T6S A;  1HBX G;  2YU3 A;  3I5U A;  5FLX K;  5JHU A;  3QP6 A;  1D8K A;  3ERE D;  2PFB A;  1O3S A;  2XIG A;  3C1D A;  1R23 A;  1F5T A;  2PEX A;  1YO5 C;  3GWZ A;  4BYY A;  2MLG A;  3DPL C;  3E6M A;  1ZLK A;  3RKW A;  2K02 A;  4HV6 A;  3EQL F;  3IHU A;  4I7H A;  1V3F A;  2RN7 A;  3K1P A;  3V7S A;  5ED4 A;  1FT9 A;  2MA3 A;  3V8K A;  3ZMV A;  3TOB A;  2VE8 A;  1F1Z A;  2HKX A;  1IN8 A;  5LLQ A;  3WOD F;  2KRF A;  2Y75 A;  2O61 A;  2M45 A;  1DPR A;  4IVN A;  5D6E A;  1XMA A;  5CVR A;  5DV5 A;  1REP C;  3N97 A;  2AS5 F;  2ESN A;  4MNU A;  2KIF A;  4JK1 X;  2QYO A;  4BNC A;  4LJZ F;  3M1E A;  1YS7 A;  4UV8 A;  1FYM A;  1U5T B;  1ZH5 A;  2JZY A;  2NS0 A;  3P9K A;  1MD0 A;  1XGM A;  3HRM A;  1K6O A;  1J75 A;  5FFZ A;  2EV0 A;  5J8C A;  1B9M A;  2DI3 A;  5H20 A;  2W25 A;  4I2O A;  2D45 A;  3M9A A;  5D5W B;  3DFG A;  3F72 A;  3HHH A;  1MDM B;  4G7Z F;  2L01 A;  4BHC A;  3IWZ A;  3IL2 A;  2XKO A;  2DAO A;  1X3U A;  3CLO A;  3QU3 A;  2FF4 A;  1BI2 A;  4S05 A;  1PP7 U;  2P6T A;  3AAF A;  4KFC A;  2P7V B;  3DV8 A;  2Z9O A;  3S2W A;  1A04 A;  1W5S A;  2HOE A;  3HHG A;  3U2R A;  5HS8 A;  3QRF F;  4KDP A;  1NHA A;  5EEG A;  4HV5 A;  3EYY A;  3QPH A;  1UHM A;  4OOI A;  2H09 A;  1UHW A;  3KP6 A;  3WGI A;  2P4W A;  3GYH X;  1S6L A;  1LNW A;  1SD5 A;  2NAZ A;  3GFI A;  2HQR A;  4N9H A;  4WX9 A;  5F1R A;  1QBJ A;  2L54 A;  4L9N A;  1FBU A;  2NNY A;  2IA2 A;  3WTX C;  1T38 A;  1BI3 A;  2HR3 A;  2V9V A;  1RNL A;  1KU2 A;  2LDU A;  1T2K A;  1U5T C;  3V8L A;  2HTJ A;  5ICG A;  1J0R A;  2G7H A;  2ZO4 A;  4PCQ A;  3T8R A;  4OMZ A;  2O0Y A;  1IUY A;  5HLH A;  1WSU A;  1CGP A;  1FSE A;  5F64 A;  4LMY A;  1G3Y A;  2VBW A;  4WWC A;  1YG2 A;  4EQQ A;  2KIM A;  5L3C A;  1L3L A;  1ZG3 A;  3GEZ A;  2STW A;  3HRU A;  2B0L A;  2GXB A;  5JR3 A;  3C3W A;  3E5U A;  1FYL A;  3EYI A;  2Y48 A;  2EFN A;  1IXS B;  4BQA A;  4FHT A;  5D4R A;  4A5M A;  4QLC U;  3LST A;  4KN7 X;  3ZMU A;  1D8J A;  4M73 A;  1ZRE A;  1YW9 A;  5JFR A;  5HS9 A;  4EJO A;  3GFJ A;  4MTE A;  1DUX C;  4ZYH A;  4G7H F;  1Z6R A;  2V6C A;  2UXN A;  1I6X A;  4YIF A;  4AD9 A;  2CGP A;  2AXL A;  2GAU A;  3O2P E;  3ML6 A;  1UCR A;  3HTS B;  2O3F A;  3T5X A;  2JT1 A;  1HKS A;  2XGX A;  2E1C A;  2MLK A;  4M72 A;  2ISZ A;  2FBK A;  4N9I A;  2M87 A;  3EUH A;  3FMS A;  4RB2 C;  4XLN F;  3FZV A;  5L3B A;  3TOA A;  1ZG5 A;  2VC0 A;  1HW2 A;  1U5T A;  3KP5 A;  1BJA A;  1I5Z A;  2IRF G;  4OMY A;  3FMQ A;  2V1U A;  4IF4 A;  3FXQ A;  3WGH A;  4HW0 A;  1O3T A;  5L3G A;  4EV0 A;  5E1W A;  4JBA A;  5K1Y A;  3B73 A;  2ZME B;  4CYD A;  1IN5 A;  3T0Y A;  4I98 B;  3JAM Z;  3QP5 A;  1EH7 A;  5DUK A;  1LEB A;  4LB5 A;  2EJR A;  4Q5S F;  4DQ2 A;  4IRH A;  4CZZ A;  2Z99 A;  2QQA A;  2Q8K A;  5BPI A;  1HW1 A;  1EV7 A;  3L00 A;  3B02 A;  5JVT A;  2FXA A;  1KGS A;  2X4H A;  2DU9 A;  3R61 A;  2CYY A;  4G94 A;  5J6X A;  1XGO A;  2ZCW A;  4IRG A;  1SAX A;  4RGR A;  2VT2 A;  2QWW A;  5H6Q A;  1MJB A;  1EH8 A;  1FSH A;  4R8H A;  1J2X A;  5D6F A;  1O7L A;  4UUV A;  3L2C A;  3QPT A;  3HOS A;  2QBY B;  4LK0 F;  3L9F A;  5D5X B;  5FD5 A;  3DF8 A;  1YTY A;  5CVJ A;  2DK8 A;  3ZN1 A;  4RGS A;  2VOO A;  4M9Z A;  3RPQ A;  2XAS A;  3VFZ A;  2OZ6 A;  2KJB A;  2RDP A;  2Q0O A;  5LHG A;  2YX4 A;  3ABU A;  5DDG A;  3G3Z A;  3L7W A;  2Z5U A;  3GO5 A;  2PN6 A;  4TV7 A;  2M1B A;  2ETH A;  2OA4 A;  3RJP A;  3ELK A;  3BY6 A;  3GLX A;  4PDK A;  1ON1 A;  3F21 A;  1JGS A;  2VBX A;  4FX0 A;  1LQ1 A;  4P96 A;  1DDN A;  2RV8 A;  3HOT A;  3ZN0 A;  2H27 A;  3I0T A;  2MH2 A;  3P9C A;  4M6X A;  4RGX A;  1H0M A;  2M30 A;  1TW3 A;  2CG4 A;  4I0A A;  1J9I A;  3D0S A;  3EET A;  3IWF A;  4LB6 B;  2ISY A;  5BS6 A;  1YIO A;  3HYI A;  2GQQ A;  3ZP5 A;  2DBB A;  2PQ8 A;  5DD4 A;  2HS5 A;  1BC7 C;  1FZP B;  5L3D A;  4AWX B;  2P5K A;  2WTE A;  2DW4 A;  3K1M A;  2WV0 A;  1SFX A;  3RTR A;  1KYW A;  4BAY A;  1B9N A;  4ESJ A;  4WCG A;  4MEX F;  4IXA A;  4LFU A;  3KET A;  4A6E A;  3BJ6 A;  2TDX A;  4HF0 A;  1BIB A;  3I4P A;  3LA3 A;  2IVM A;  4OIR F;  3SXY A;  3WE3 A;  5D8L B;  4KMU X;  1ZYR F;  3WG9 A;  3Q9V A;  4L18 B;  1R1U A;  2KKO A;  4ON0 A;  1STZ A;  1W4M A;  3RKY A;  3RI4 A;  2EV5 A;  2E7W A;  1KU3 A;  1GXQ A;  2ZME A;  2UZK A;  1TQM A;  4KMF A;  2KJC A;  3V7C A;  3FMR A;  1UST A;  3CTA A;  2LF8 A;  3SZT A;  2W24 A;  4KUM A;  5LGN A;  2F5E A;  4GGG A;  4CIC A;  1YQA A;  3CO6 C;  1B59 A;  1S3J A;  2PBI A;  5LEK A;  2K27 A;  1SMY F;  2R3S A;  4Q48 A;  2COM A;  3LA2 A;  4PZJ A;  1KQ8 A;  3VB2 A;  1OKR A;  2YPR A;  4N0B A;  1JHF A;  4KIG A;  3LQR A;  5LBQ A;  5CJ9 A;  4QWQ A;  3O3K A;  1P4W A;  3KE2 A;  3F3X A;  3TO6 A;  3I59 B;  1FBQ A;  2F5D A;  1JE8 A;  4IJA A;  1R5G A;  3WTT C;  2DFI A;  2GA2 A;  2OAZ A;  2K4B A;  1UB9 A;  3H3U A;  4LLG F;  4CHU A;  2FNP A;  3OOP A;  4B8X A;  2XVC A;  4RB3 C;  3TGN A;  1YFH A;  2RC4 A;  1ZAO A;  1FWZ A;  2ZXJ A;  1GVJ A;  3TO9 A;  2VON A;  1XMK A;  2PG4 A;  5BQT A;  2LF7 A;  3R4K A;  5H6R A;  1H9G A;  1FNN A;  1LJ9 A;  3L09 A;  3IC7 A;  2DTR A;  1E17 A;  2IPQ X;  3Q9S A;  3FF5 A;  3ECO A;  1TQI A;  2MC3 A;  3IKT A;  1IN6 A;  1ON2 A;  2QQB A;  3H92 A;  2HWV A;  3TDU C;  5LEJ A;  2IA0 A;  1MZB A;  3V7R A;  3VOD A;  4XLP F;  2GIV A;  3FX3 A;  1BN5 A;  2YR2 A;  4A5N A;  3E5Q A;  3RYP A;  4M9X A;  4L5I A;  1PUE E;  5LHI A;  3TKY A;  1LEA A;  4CGZ A;  4G7O F;  2Z33 A;  2EWN A;  1OYI A;  4M9S A;  3CJN A;  3E97 A;  3ISP A;  5CVU A;  4UHT A;  1D5V A;  4IHS A;  3GUD A;  1I1S A;  3K1N A;  4H0E A;  1R1V A;  2DQR A;  1BBY A;  4ZZD A;  3BJO A;  5ILV A;  3I64 A;  3V8J A;  3QAH A;  3NQO A;  2CSO A;  2O6G E;  3GZ6 A;  1TNS A;  4BXU A;  4HX8 A;  4YFN F;  3J80 Z;  1E2X A;  1P6R A;  4HDV A;  2BGC A;  5HOO A;  1IRG A;  3BJA A;  4P55 A;  1RIO H;  2GA1 A;  5D8K B;  1TW2 A;  4MEY F;  5A2Q K;  1MKM A;  4XRF A;  5HLI A;  5J8F A;  3REO A;  3U9G A;  2A69 F;  5D5U B;  2EA2 A;  3ZPL A;  2UXX A;  4EVI A;  4U7B A;  1O3R A;  2BEO A;  2NYX A;  4HX4 A;  5KVR A;  2OQG A;  1RUN A;  3M8F A;  4UVA A;  2EFP A;  5E1Z B;  1G4D A;  2HKO A;  4RGU A;  4LLL A;  2G9W A;  1W7P A;  4Y15 A;  5ICF A;  1QO0 D;  2J5O A;  1RUO A;  4KIF A;  5HDG A;  2V1D A;  5TRD A;  4MQV A;  4RB0 A;  2WC2 A;  5LGT A;  4WXC A;  2QLZ A;  4BH9 A;  5AIQ A;  4A0Y A;  1WI9 A;  2NNN A;  2MD5 A;  2GXG A;  3LQQ A;  2FEZ A;  3R60 A;  2H6B A;  3R0J A;  4ESF A;  1FPQ A;  4WXH A;  1UFM A;  4LGW A;  1XGN A;  1U3E M;  2FML A;  3C7J A;  3M7G A;  1FP1 D;  2DLL A;  1SD7 A;  1F4K A;  3P7N A;  2HTS A;  1U2W A;  3TQN A;  3BZ6 A;  2XAG A;  2V79 A;  4K2E A;  2LKP A;  6PAX A;  2A68 F;  4AIK A;  2EFQ A;  2F5C A;  1B6A A;  1IAW A;  4U88 A;  1JXS A;  5DEQ A;  3COA C;  3MWM A;  1P4A A;  3E6B A;  3BWG A;  5ILU A;  2EFO A;  3EDP A;  2FBI A;  3HRS A;  1R58 A;  3CO7 C;  1XSX A;  1ZRD A;  5DCF A;  3WU0 A;  4M6Y A;  2FBH A;  1XDU A;  3LAJ A;  4KIB A;  3MQ0 A;  1O7F A;  4ZYE A;  4UNO A;  4EGY A;  3ROU A;  3F23 A;  3FHZ A;  3LFK A;  4XBF A;  1QQI A;  5A2Q Z;  1C0W A;  1FLI A;  1OYY A;  4FX4 A;  4CXF A;  3E5X A;  3BOQ A;  3NEU A;  4HF2 A;  2H94 A;  4L9J A;  1T0F A;  3G73 A;  4OIQ F;  2G7U A;  3FWE A;  2PI0 A;  2VOD A;  2XAQ A;  3W6K B;  3QOP A;  5LRR A;  4HLY A;  4ZYD A;  4PGG A;  2FMY A;  2VT3 A;  4KNY A;  1IXR C;  1MJ9 A;  2BV6 A;  3WU1 B;  4UXN A;  4UVC A;  1MGT A;  1SFU A;  4LLN A;  3MZH A;  5E18 F;  4ESB A;  5E17 F;  4EJV A;  4HQE A;  3SFZ A;  3O6B B;  2A5Y B;  1EH6 A;  3GVA A;  5IT9 K;  4I0B A;  1CF7 A;  3FM3 A;  1ZHF A;  1KU7 A;  2IJL A;  2ESH A;  2FE3 A;  1BI0 A;  1ONV A;  3I54 A;  4M74 A;  2UWM A;  5JI6 A;  3N4M A;  5ERI A;  1QZZ A;  4LG0 A;  2ELH A;  1MJA A;  2HEO A;  2JSC A;  2CWE A;  3JSO A;  1P92 A;  1FYK A;  3PQK A;  4U0W A;  2KIU A;  4L9V A;  4HF1 A;  3DEU A;  1T98 A;  1WRJ A;  2HZT A;  4ENM A;  2W84 A;  3PFI A;  1IZ1 A;  4OIN F;  1PP8 F;  2Z3Y A;  2QZ8 A;  2BBY A;  2F5F A;  4A6D A;  3MFK A;  3DP7 A;  2EA4 A;  1XCB A;  2QQ9 A;  1Z9C A;  3F6O A;  2P5V A;  4WK8 F;  4EMS A;  1HKT A;  1JHH A;  1K78 A;  5K5O A;  4XSZ F;  4GCV A;  1Z7U A;  2L3D A;  3F22 A;  2VC1 A;  1P2F A;  1J59 A;  5BOX A;  1IN4 A;  2ACJ A;  3VEP A;  5HDN A;  1R00 A;  2QM3 A;  3PQJ A;  4KYW A;  2DO7 A;  2NRA C;  5ILS A;  4NB5 A;  2XAF A;  1ZGA A;  4I02 A;  1XGS A;  4G9Y A;  5CVI A;  1VTN C;  1HST A;  3LA7 A;  1ODD A;  2CO5 A;  5FO5 A;  5DYM A;  1CF7 B;  1ZRF A;  3RIR A;  3FXU A;  2CFX A;  1T39 A;  1W7P B;  3WGG A;  1FBS A;  1YW8 A;  1R1T A;  3D5L A;  3HSF A;  1GHC A;  2L4M A;  5LHH A;  4KN4 X;  3BPV A;  1LVA A;  3E3V A;  3BP8 A;  3T8T A;  3V4G A;  1RI7 A;  4YII A;  2Q2E A;  2XRO A;  2V1X A;  1BM9 A;  1SFE A;  3ZQ7 A;  5CLS A;  4GYG A;  1FP2 A;  2DK5 A;  3RDI A;  1TQP A;  1DPU A;  3RYR A;  3ZMS A;  4L0Y B;  1J5Y A;  3K9T A;  2LNB A;  1S8N A;  3MAJ A;  3SZP A;  1KQ0 A;  1FX7 A;  4HOB A;  3J80 K;  3IRQ A;  1R7J A;  3DPT A;  2FSW A;  5FB2 A;  5DCM A;  5L3F A;  1BIA A;  2RNJ A;  4O6J A;  1WQ2 A;  3CUO A;  1O57 A;  4ZH4 F;  4ASN A;  1R36 A;  2VXZ A;  3F6V A;  5AIP A;  4RAZ A;  4GXO A;  5IT9 Z;  3KLN A;  4F7Z A;  5FLX Z;  2VOP A;  2OD5 A;  2L02 A;  1OR7 A;  3GF2 A;  3HSE A;  3RPU A;  1DP7 P;  3F8B A;  1P4X A;  1I1G A;  1K7A A;  5ICE A;  4WXD A;  5E20 A;  4Q47 A;  2ZFW A;  3CDH A;  1G3T A;  4B09 A;  4MHG A;  4ETS A;  1YW7 A;  4GYI A;  2IT0 A;  2OBP A;  1K78 B;  4EJU A;  2L4A A;  3J81 Z;  1HSJ A;  3HRT A;  4ZYG A;  2C6Y A;  1G3W A;  4EJW A;  1R5H A;  2H6C A;  2FRH A;  3FM5 A;  3Q5F A;  3MCZ A;  4AVP A;  4NHJ A;  4PGH A;  1ZG1 A;  3DKW A;  3ECH A;  4U0Y A;  5TJJ A;  3P9I A;  2WWY A;  4YFX F;  4HLX A;  2W85 A;  3JW4 A;  3LAP A;  2W57 A;  1IN7 A;  4IRI A;  2E7X A;  4A0Z A;  4Z2Y A;  5HS7 A;  3OV8 A;  2XUB A;  3M8E A;  4HDU A;  4AIH A;  2PLY A;  1MDM A;  3VOE A;  3MZY A;  2JTV A;  2QEN A;  4EM0 B;  4YFK F;  3H3Z A;  3CUQ A;  3HSR A;  5CVV A;  1S7O A;  2YSR A;  4LK1 F;  2A07 F;  2RGV A;  2ADU A;  2JRT A;  4LD5 A;  5DD8 A;  2FOK A;  4R1H A;  1BOA A;  1U6G A;  3BPX A;  1LDK B;  1HXD A;  5E8I A;  1XSV A;  3JSP A;  2HYG D;  2K86 A;  4ENN A;  3F8M A;  1K79 A;  3WTV C;  3KLO A;  2XAJ A;  3WE2 A;  4A12 A;  2M5W A;  3JTH A;  1LDD A;  2PJP A;  2P8T A;  2XRN A;  1Y0U A;  2RKH A;  1IXC A;  2K7L A;  4UVB A;  1OYW A;  1HQC A;  1O3Q A;  2VBY A;  1USS A;  4JQF A;  1WWX A;  3CUQ C;  3ABT A;  1S29 A;  1PDN C;  2XV4 S;  2ZNY A;  2Y0M A;  4A2U A;  3J81 K;  1TLH B;  5L3E A;  4S04 A;  1XB4 A;  1B1B A;  2BE5 F;  4G6D A;  2P7C B;  3KEQ A;  2R7F A;  1XD7 A;  1XDS A;  3ZMD A;  4UV9 A;  4M71 A;  1TTY A;  4OIP F;  4A0X A;  1J7K A;  4O3M A;  1ZN2 A;  1SMT A;  4L9T A;  2JPB A;  1H9T A;  1XCV A;  1Q1H A;  2STT A;  2P6S A;  4G6Q A;  2D1H A;  4IPA A;  1BC8 C;  2IP2 A;  4HYE A;  2OZU A;  5DUI A;  4WF2 A;  3I53 A;  3U1D A;  3KP4 A;  4I01 A;  4MTD A;  1QPM A;  2DPU A;  2DPD A;  1LB2 A;  4E70 A;  1FC3 A;  1GXP A;  4D0P A;  4G8X A;  3BDD A;  3GFL A;  2JPC A;  1XN7 A;  3KFW X;  2MH9 A;  4P9U A;  3ULQ B;  5KK1 A;  3IKV A;  2RQP A;  4L5J A;  4KT5 C;  4ZZL A;  4HA8 A;  2VBZ A;  4HQM A;  3WTS C;  3K2Z A;  3T1B A;  1ZGJ A;  3KP7 A;  4RS8 A;  3C18 A;  5FGM A;  3HIF A;  3SHF A;  2VN2 A;  1ULY A;  3I58 A;  1D3Y A;  4OU0 A;  3HUG A;  4P9F A;  5IT3 A;  2ZNZ A;  1ZAR A;  1Z1D A;  5D5V B;  1QNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...