5JVTA

Crystal structure of the dna binding domain of transcription factor fli1 in complex with an 11-mer dna gaccggaagtg
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Friend leukemia integration 1 transcription factor
publication title Structures of mithramycin analogues bound to DNA and implications for targeting transcription factor FLI1.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 96
sequence length 96
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5jvtA00
1XN7A 3C7JA 2ESHA 2H09A 2RV8A 4DNCA 1R00A 3R4KA 1RUNA 4IHTA 3ZMTA 4PGHA 1RZ4A 1Z7UA 2EK5A 1CF7A 1TQPA 3WTSC 4RB1A 2VODA 2RNJA 2WC2A 2UXXA 2QQ9A 3SFZA 2MLKA 4L9NA 3ZMVA 1CF7B 2XAQA 2GZWA 4LLGF 3BJAA 2GAUA 2ETHA 4MGRA 3WTUC 2P7CB 2OA4A 4Z2YA 2Q2EA 4HF2A 3HRMA 5E1WA 1ON2A 1K79A 1OMIA 5DV5A 1QGPA 3ISPA 2X4HA 4KDPA 1K78A 4G7HF 1I6XA 4BQAA 3QP6A 3H3UA 1J75A 3C18A 3LAPA 1J9IA 4HQMA 3ML6A 3GYHX 4XRFA 1KU3A 2F5FA 3MZYA 1BC7C 2FSWA 1F4KA 5E1ZB 3FZVA 1K78B 3J81K 2KKOA 1R1TA 1LB2A 2Z3YA 3CTAA 4BHCA 1IXSB 5LRSA 3V8JA 3DP7A 2LKPA 3IC7A 2YPRA 3T0YA 1P2FA 1UHMA 4ESFA 2JPBA 1P4AA 4NHJA 4MTDA 5JI6A 1PP7U 3E6CC 3L9FA 3ZMZA 3EQLF 1F5TA 1G3SA 5HLIA 2M45A 3LAJA 3KP7A 1ZRFA 1I5ZA 4Q4ZF 1SD4A 4MNUA 3OOPA 1FC3A 4G9YA 2RC4A 4KFCA 1E17A 1OYWA 4RAZA 3KZYA 3WODF 3L7WA 3V8KA 1OKRA 4M73A 4H0EA 3RI4A 1R5HA 2F5CA 2ZNYA 3T5XA 2HYGD 3JAMZ 3ECOA 3KP3A 2EWNA 2EA4A 4IVNA 5JFRA 4CGZA 5L3BA 4AIHA 3OV8A 3KFWX 4L18B 2P4WA 2F5DA 2KJCA 4O6JA 4CDGA 1BI1A 2HGCA 4HF1A 1KYZA 2XGXA 4ZZDA 2DI3A 1REPC 5LGNA 4OMYA 4N9IA 5D6FA 3I5UA 2NS0A 3REOA 2WV0A 2VE8A 2OZ6A 3E5XA 3KE2A 4A2UA 2HDCA 2CO5A 3PQKA 5J6XA 3GUDA 1OYYA 5D5VB 4M71A 2RKHA 4I02A 2L4AA 4AWXB 3JTHA 3GX4X 3HSEA 5L3CA 4ZYGA 1YQAA 3GLXA 1JHFA 1WSUA 4G8XA 2DFIA 2GA1A 4P96A 2DK8A 4EM2A 2OAZA 4P55A 3MWMA 5E8IA 1OPCA 5E17F 1T2KA 3FWEA 2NNNA 3EDPA 3NEUA 1SFXA 3R0AA 1TLHB 5E20A 3EETA 2MC3A 1XSDA 3TKYA 3E97A 1SD7A 4PCQA 1BC8C 4HZFA 4A12A 1YFHA 4M74A 3W6KB 5L3FA 1EH7A 2GIVA 4LD5A 4LLLA 3S2WA 2EFOA 2NRAC 4OOIA 4EQQA 2HOEA 2CGPA 1T6SA 5FGMA 4G94A 2HKOA 5K5RA 1B1BA 4ZYHA 2FMYA 3V7CA 2V1DA 4LJZF 2L01A 5D5UB 4GYIA 2L02A 1RI7A 2XKOA 3BOQA 2EB7A 2CYYA 3I71A 2GWRA 1LQ1A 4I09A 2BEOA 1GHCA 1ZRDA 4KT5C 1SD5A 2G9WA 1J59A 1V3FA 1TTYA 3I64A 1C0WA 1LEBA 4MTEA 2MLGA 2EFWA 1IXRC 4YFKF 4RB0A 3SZPA 3RKXA 3WTWC 1KQ8A 1FOKA 4MQ9F 2RGVA 3J80K 5DCMA 2IJLA 3VOEA 3P7NA 3CDHA 1BOAA 3HOSA 1UHWA 1IF1A 5BQTA 2GXGA 1ZG3A 2DO7A 4M6XA 2A69F 1IXCA 5DCMB 2BBYA 2VT2A 4AIKA 3E5QA 1WI9A 2ZXJA 3SZTA 2R7DA 4JBAA 3V7SA 3I58A 4RB2C 5H6QA 1R5GA 2OBPA 2M30A 3M1EA 3WGHA 2VT3A 3ABTA 3GWZA 3GZ5A 2EFNA 3N97A 3MAJA 2VE9A 2ZMEA 2P5KA 3BPVA 1ZN2A 3LA7A 2VXZA 3HIFA 1YS7A 4HX8A 3F72A 2E1CA 3H92A 1R1UA 1U2WA 1ZG5A 1YW8A 4FX0A 3ZMUA 3WE2A 1HSJA 1ODDA 2IPQX 2WWYA 4WWCA 3ELKA 4YIFA 1RUOA 2HKXA 2XAFA 2VBYA 5CLSA 4ESBA 4LGWA 2K02A 2GA2A 3WGGA 4UVBA 3JW4A 2LF7A 1WQ2A 1LEAA 1A04A 3GW2A 2O03A 2ISZA 1LVAA 4KIGA 3KCCA 4HDUA 1ZLKA 5LRRA 1B4AA 2OZUA 4L5IA 1UCRA 1U8RA 1JE8A 3DPTA 2RDPA 1W5TA 3HSRA 4L9JA 3T8RA 4RGSA 4I7HA 4FT8A 5D5WB 2A61A 2Z5UA 2CFXA 2F5EA 1PDNC 4EGZA 4HOBA 3ZP5A 4U7DA 4U7BA 1QPMA 3WTVC 1X3UA 1O3TA 2Z99A 1STZA 4G7OF 4MEXF 3C3WA 3IRRA 2UWMA 2P6TA 2QM3A 3VB2A 2FOKA 1O7LA 4KICA 3BP8A 3QAHA 4F7ZA 4OINF 4Y15A 3SHFA 1ZH5A 2J5OA 4XBFA 4UVCA 5ICEA 2GXBA 1B9NA 5AIPA 4LMYA 1UFMA 4BHPA 4BH9A 3VEPA 3E5UA 2G7HA 1KQ9A 1FLIA 2W85A 3TGNA 4WF2A 3D5LA 2O8XA 4HAMA 4L9TA 3QU3A 3FMQA 2FNAA 1H9GA 2FXAA 3RTRA 4WX9A 5E18F 3T8TA 4NQWA 4IXAA 3TOBA 2K7LA 2IW5A 2XAJA 4AVPA 5D4RA 1FP1D 1S7OA 4S04A 4KA4A 1G3TA 3ZN0A 4TV7A 3GO5A 5D6EA 4GXOA 1W4MA 5EEHA 4WCGA 1I1SA 1XGOA 1J0RA 3TDUC 2QBYA 5KK1A 4A0XA 4GGGA 2XKPA 2J5PA 5ILUA 3JSOA 4OMZA 4BXUA 2XROA 3CUQC 4CZZA 1K7AA 1Q1HA 3R0JA 2QYOA 3RPUA 4JQFA 1IRFA 1ONVA 4LFUA 1W7PD 3ULQB 3GF2A 3BZ6A 1QZYA 4I2OA 4EGYA 2Y48A 3JAMK 2NNYA 2XV4S 1DUXC 2NYXA 1XD7A 2IP2A 4G7ZF 3KEQA 1SMYF 1MJAA 3U1DA 4OU0A 3M8EA 1JGSA 2V79A 1YW7A 1ULYA 4ZYEA 1VTNC 4PZJA 1RNLA 3WG9A 4N0BA 1BI3A 4EV0A 2MH9A 1TQIA 2MBFA 4QLCU 1HKTA 4A6EA 5H6RA 2M5WA 2FBIA 1KA8A 4OIOF 1YS6A 3V8LA 3JSPA 5ICGA 4CXFA 1AWCA 2W25A 5DD4A 1TNTA 4GYGA 2W24A 4RGUA 3RYPA 2QVOA 1P6RA 4HW0A 4A0YA 3KP4A 1T39A 2EV5A 3I59A 2LF8A 3ECHA 5TRDA 3FHZA 2A6HF 1R22A 2VN2A 4UHTA 1ZGAA 1HW5A 5FLXK 3KP5A 2YSRA 3NRVA 3I59B 5ED4A 5DDGA 1YO5C 5IT9K 1DPRA 4RAYA 2OQRA 4L5JA 2A6EF 2MA3A 4ZH4F 4ZYDA 1QZZA 3GEZA 2YR2A 4OIRF 1IN8A 1T98A 1KGSA 3G73A 2PN6A 2JRTA 5K5QA 3FM3A 5JVTA 1LJ9A 3BPXA 3FMSA 2HFHA 3IKVA 1H9TA 5FD5A 2EJRA 5CVUA 3WU1B 1B59A 3IKTA 2XRNA 3LFKA 5D8KB 4Y17A 1K6OA 4OIQF 1U5TC 1BJAA 3I4PA 2D1VA 5DCFA 1HW2A 2FF4A 2FEZA 2WTEA 3QOPA 5BS6A 2P5VA 5F6FA 1S3JA 1S6LA 1HQCA 2A68F 1TBXA 1ZAOA 2E1NA 2X0LA 1JHHA 4WK8F 3MCZA 1T38A 5F1RA 2A3SA 3H3ZA 1TW2A 1AOYA 4KIFA 2PI0A 2E7WA 1G4DA 4KUMA 1HW1A 4EJOA 3HHGA 1FT9A 1WKMA 4O5VA 3BJOA 4FHTA 4U0VA 1J7KA 1O57A 3QU6A 1IW7F 4CO8A 1F9NA 2ESNA 1LDJA 3QP5A 4ENMA 3ERED 3HYIA 1D8JA 1HXDA 5E8GA 2M87A 4UNOA 1FWZA 3ZN1A 2QZ8A 2LNBA 2FBHA 3K1NA 2KIMA 2VBWA 3ZPLA 3F8FA 3LA3A 1LNWA 3GXOA 1J2XA 4R1HA 3Q9VA 3FX3A 2DAOA 3O6BB 2PEXA 5FD6A 1IUYA 2STTA 1S8NA 4ON0A 3I0TA 3B02A 1XDUA 2VBZA 3EUHA 1JXSA 1MDMA 5FB2A 2DTRA 2O0YA 5DYMA 3DFGA 1MJBA 1SD6A 3GFLA 2K4BA 3GZ6A 4HX4A 1IAWA 1MDMB 2FBKA 2QLZA 4R8HA 4P5OA 1I1GA 5K1YA 3L2CA 1ZRCA 2DU9A 1U78A 1ZYRF 3F21A 5ERIA 2ELHA 1KU2A 4CHUA 1XGSA 2DK5A 1R1VA 3C1DA 1RIOH 1IZ1A 2H6BA 2E7XA 4R79A 4EJVA 3WTZA 2M1BA 1R58A 1MZBA 1DDNA 2KIUA 4BAYA 2W57A 4I0AA 3EYYA 3QPHA 3CUOA 2Y0MA 1W7PA 5HS9A 1ZG1A 5BPIA 5IT3A 2F2EA 2PLYA 1W7PB 2HQRA 3P9CA 4Q5SF 2V9VA 2VBXA 2CW0F 4G6QA 3L09A 3RKYA 2HS5A 3V4GA 4HDVA 1O3RA 4IHSA 1W5SA 1J5YA 3GFJA 4M9ZA 4HQEA 1XGNA 1CGPA 2ZMEB 5KVRA 2A5YB 1FBUA 4YIIA 3IHUA 3F3XA 3TO7A 3F8NA 4PDKA 2XAGA 3RYRA 1U6GA 3DPLC 3ABUA 2K86A 1WRJA 1XMAA 1B6AA 5BPDA 3P9IA 3KLNA 2Q8KA 1SFUA 1IN7A 3CJNA 5DUIA 2UXNA 3U2RA 2G7UA 3BROA 1IN6A 5LLQA 3F8BA 4I98B 2FNPA 3L00A 4EJTA 2KIFA 5LHGA 1D8KA 4A5NA 2DQLA 5A2QZ 2ZKZA 4DQ2A 5DD8A 4LK1F 4UUVA 4OIPF 2D1HA 1QBJA 2AXLA 2QQAA 1USSA 2CSOA 1D5VA 2QWWA 3RJPA 1FSHA 3GFIA 2YU3A 3VODA 3LSTA 3LWFA 1Z9CA 1P92A 2P7VB 5AONA 3K0LA 1YYVA 2HR3A 5ICCA 1T0FA 2L3DA 4KN4X 4U0YA 2R3SA 3F8CA 3IWZA 3HSFA 1UB9A 1QNTA 2Z9OA 1D3YA 4B8XA 3RKWA 4EVIA 1FZPB 4HA8A 4LLNA 2D2WA 2IA2A 2EFPA 1FYMA 2O61A 4UXNA 2FMLA 1R7JA 2L54A 2VOPA 1ZARA 2MD5A 3O3KA 3FMRA 3BY6A 2UZKA 1GXQA 4JK1X 2A07F 3DV8A 4Y13A 5HOOA 3HUGA 2KJBA 4MHGA 1F1ZA 3W6JB 5LGTA 2L4MA 1G3WA 3FF5A 1SMTA 2IRFG 3MEXA 5ILSA 1G6NA 3DXJF 2HTJA 2IA1A 1BI2A 2CG4A 4M72A 3KP2A 2FA5A 4ENKA 4KIBA 3O2PE 3HRSA 3K2ZA 3CUQA 3HRTA 1GXPA 2EA2A 2JT1A 1TQMA 5LBQA 2YX7A 1BI0A 3CUQB 2PMHA 4L9VA 1MGTA 1QQIA 1KQ0A 5BMZA 3E6DA 4A5MA 4IJAA 2QBYB 4EM1A 3TO6A 4Q47A 2KRFA 4AIJA 4NB5A 5LHHA 2VC0A 4LK0F 2HWVA 3HTUA 4HX7A 4YFNF 1O3SA 4EM0B 3B73A 2DBBA 2JTVA 2PJPA 3K9TA 1DPUA 1O3QA 3FXRA 4M6YA 1FBQA 3ZMDA 4D0PA 5LGUA 2O6GE 4EJUA 4WXDA 3R6SA 4EJWA 3DKWA 4UVAA 2K4JA 2RN7A 2Z33A 2CQKA 2D45A 3MZHA 1Z91A 2V1UA 4ENNA 1ON1A 3TOAA 3SXYA 1YTYA 1ZHFA 1KYWA 3IWFA 3V7RA 2MH2A 5F64A 3K1PA 4P9UA 1Z6RA 3MQ0A 1Y0UA 3FXUA 1R23A 1Z6TA 4KNYA 4S05A 3BJ6A 3Q5FA 1NHAA 5LEJA 2RVCA 2B0LA 3CLOA 1BIBA 3COAC 3TDZC 4RB3C 3KEOA 4HYEA 3G3ZA 5JR3A 2ACJA 4XLNF 2GQQA 3WTXC 1S29A 1XDSA 1R36A 5TJJA 2DLLA 4CYDA 3DEUA 5FO5A 3EYIA 3LQRA 3GFMA 2ZFWA 4UV8A 1QO0D 4LG0A 3LA2A 4E70A 1IN5A 2PQ8A 5CYVA 3JTGA 5L3DA 2QQBA 1L3LA 3F22A 4BYYA 2DPUA 2HZTA 1U5TA 4ETSA 4LG0B 5DUKA 2HYFA 1KU9A 3LQQA 2DPDA 2JPCA 2PFBA 3PFIA 5L3GA 1MD0A 5CVJA 1U5TB 3M9AA 2Q0OA 2RQPA 5HLHA 1USTA 3J81Z 1XCBA 2FE3A 4BNCA 2O3FA 3CO7C 3RPQA 2QUFA 5HS7A 4G6DA 1B9MA 4LB6B 5CVRA 2VC1A 5FFXA 3T1BA 3F23A 3P9KA 2ISYA 4ENJA 2H94A 4YG2F 3F6VA 2QENA 5CVVA 1XSXA 1YIOA 1XB4A 1ZGJA 1LDKB 2OD5A 4K2EA 4KN7X 2CWEA 5FLXZ 3IL2A 1BM9A 5AIQA 2FRHA 4P9FA 5IT9Z 2VONA 2H6CA 4HV5A 1Z1DA 1HSTA 3U9GA 4YFXF 1O7FA 1L0OC 1PUEE 2OU2A 3AAFA 4HF0A 1OYIA 2ZCWA 5BOXA 2ZNZA 1ZLJA 3QRFF 3KZZA 1FYLA 2PMUA 5HDGA 3ROUA 4N9HA 3WU0A 4IRHA 5K5OA 2ADUA 3D0SA 1G3YA 2P5LC 4KMFA 5D4SA 3E6MA 3QPTA 1XMKA 2IVMA 4EMSA 2YX4A 3I53A 1DP7P 1HKSA 1YW9A 5J8CA 1MKMA 4BHBA 1KU7A 2EFQA 4U0WA 2EV6A 1MJ9A 4RGRA 4IPAA 2NAZA 4IRIA 2V6CA 3Q9SA 1S7AA 1FBSA 5DEQA 1IN4A 2XASA 1U3EM 3WGIA 4GCVA 3K69A 1FNNA 1XCVA 4IRGA 2P8TA 3KP6A 5A2QK 3F8MA 2ZO4A 3RDIA 5HDNA 1YG2A 5CVIA 3KLOA 2JZYA 3CO6C 1ZREA 3WTYC 3NQOA 4I0BA 4RGXA 1WWXA 1BN5A 5J8FA 1EV7A 4UV9A 3KETA 4HBLA 2PG4A 2XIGA 2DT5A 4XLPF 3FM5A 1E2XA 2JSCA 4ZZLA 4PGGA 5LHIA 5JHUA 3DQVC 3HTSB 1TW3A 1XSVA 3VFZA 4ASNA 1PP8F 4XSXF 1I27A 2HTSA 4I01A 1FX7A 1SAXA 2IA0A 4L0ZB 5L3EA 2H27A 3DF8A 4XSZF 2XHKA 2P6SA 5D8LB 3HOTA 5H20A 2BV6A 2XVCA 2BGCA 2W84A 4KMUX 2VOOA 4U88A 1EH6A 5E1XA 4L0YB 5HLGA 2K27A 5HS8A 4A0ZA 4M9XA 3E3VA 4Q48A 4MEYF 4QWQA 4WXCA 1FY7A 2BYVE 1OR7A 5ILVA 3TO9A 3J80Z 4O3MA 2V1XA 1EH8A 3R60A 1TNSA 3E6BA 2COMA 2LDUA 1LDDA 4ESJA 3RIRA 5LEKA 1V4RA 2BE5F 3WE3A 2OQGA 4WXHA 2IT0A 2ZBKA 4FX4A 3M7GA 1FYKA 1H0MA 1GVJA 3R61A 3MFKA 4GO1A 4AD9A 5CJ9A 1IRGA 4HV6A 2FU4A 2C6YA 3I54A 2FQ3A 2ZJ2A 4LB5A 1P4WA 4CICA 3GVAA 4MQVA 3N4MA 3HRUA 1BBYA 5HDKA 4IF4A 3TQNA 4B09A 1YLFA 1SFEA 1FSEA 3HHHA 1Z05A 2HQNA 3PQJA 2EV0A 3BWGA 2XAHA 1FP2A 4HLXA 1HBXG 3M8FA 4HLYA 4M9SA 5ICFA 4RS8A 4KYWA 2HEOA 2STWA 3K1MA 5FFZA 2DQRA 2LSOA 5HVQC 3J7AO 5D5XB 3SQNA 4A6DA 1P4XA 3ZQ7A 6PAXA 1BIAA 2PBIA 2XUBA 1XGMA 2M8EA 3WTTC 5EEGA 2AS5F 2DW4A 2TDXA 2Y75A 3IRQA 3ZMSA 3F6OA 2R7FA 1HKQA 1FPQA 3FXQA 3BDDA
chains in the Genus database with same CATH superfamily
1XN7A 1WJAA 2PJRA 3C7JA 2ESHA 3OYIA 1ZK8A 2H09A 1VQ6I 2R92J 2RV8A 3O8HA 3S2DJ 4DNCA 2EZLA 3JRAA 3MKYB 1R00A 3R4KA 1RUNA 3TEDA 1Z77A 4DZJA 4IHTA 3PL8A 2O5RA 2PJRB 2JA7J 3ZMTA 3L2RA 4PGHA 1ZTRA 1RZ4A 1Z7UA 4A3FJ 2EK5A 1VQLI 3GTPJ 4XOPA 1CF7A 1TQPA 4JX4A 4BXXJ 3WTSC 1U9OA 4RB1A 2MD0A 2VODA 1APLC 2PMZN 2RNJA 3LSMA 2E60A 2WC2A 4XKCA 4ITVA 2TCTA 2UXXA 2LC2A 2QQ9A 3SFZA 2MLKA 3IH3A 4L9NA 1ZELA 3LSGA 1V55H 3ZMVA 1CF7B 2XAQA 2GZWA 4LLGF 4II2A 4DW6A 3AKZA 3BJAA 3IV5A 5CQGA 3UKGA 2GAUA 4A3LJ 5B66C 2ETHA 1I50J 4MGRA 2WA0A 3WTUC 1Z21A 2JA5J 2RQQA 3BT9A 4XLHA 2BHYA 2OA4A 2P7CB 1BA5A 4Z2YA 4DBRA 2Q2EA 4QTRA 1RETA 4HF2A 3HRMA 5E1WA 4LIUA 5CQEA 3J7ZI 2V9PA 3BG7A 4BU2A 2P0WA 3IUOA 1ON2A 2K3PA 1K79A 1OMIA 3SEZA 5DV5A 1QGPA 1XG1A 3ISPA 3MVPA 1QPIA 2X4HA 3RCOA 4KDPA 2AHQA 1ETXA 1JUPA 5E3OA 2Q2EB 1K78A 4G7HF 1I6XA 4BQAA 3QP6A 3H3UA 1X19A 1J75A 2K3FA 3C18A 3LAPA 1J9IA 4HQMA 3ML6A 3GYHX 3GLLA 4XRFA 4QSHA 1KU3A 2F5FA 4BUPA 3MZYA 1BC7C 2FSWA 2QSGX 4D5CA 5E1ZB 2DCEA 1F4KA 3FZVA 2CW7A 1K78B 3J81K 3PUFA 2KKOA 2DFHA 2KP6A 1WJ5A 1R1TA 3U1KA 1LB2A 1LPQA 2Z3YA 4XLAA 3CTAA 4BHCA 1IXSB 5LRSA 2H8WA 1MNDA 3V8JA 1D1AA 2IGNA 3DP7A 2LKPA 2MFZA 5BNGA 4Z6YA 1N25A 3IC7A 2YPRA 3OMYA 3T0YA 1P2FA 1UHMA 4ESFA 2JPBA 1P4AA 4NHJA 4XKVA 1X3ZB 4JX5A 4D7MA 3K4BA 2OUMA 3TP0A 5JI6A 4MTDA 3GTJJ 1PP7U 5FRMA 4BQOA 3E6CC 3L9FA 1FMWA 3ZMZA 1FIAA 3EQLF 2DJIA 2QEXI 1F5TA 1G3SA 5HLIA 2ZXHA 4YELA 2M45A 3LAJA 4XRSG 3KP7A 5C44J 1ZRFA 1YX3A 2X1DA 1I5ZA 1P7JA 4XN0A 2HVRA 4Q4ZF 1SD4A 4MNUA 2PMZA 1UELB 2VB6A 3BR3A 2OPTA 1FC3A 3OOPA 3K4MA 4G9YA 2RC4A 4KFCA 3X2QH 1E17A 1OYWA 2DT7B 4RAZA 2ZJPF 5FJ8J 3KZYA 2ZJQF 3WODF 3M1CA 3L7WA 2BXZA 1OKRA 4M73A 3V8KA 4H0EA 3RI4A 1R5HA 2F5CA 2ZNYA 3T5XA 5M5XJ 2V9KA 3QYBA 2HYGD 4BS9A 3JAMZ 3A01A 3ECOA 3KP3A 2EWNA 1UJ8A 1H88C 3MD2A 1FTTA 2EA4A 4JOMA 5EZHA 1PYVA 2M4KA 3AG2H 2UV1A 4IVNA 5JFRA 4CGZA 4BACA 5L3BA 1BR2A 1YOVB 4AIHA 3OV8A 3KFWX 5H2FC 3A01B 4L18B 2P4WA 2F5DA 2KJCA 3S8PA 4O6JA 4CDGA 1BI1A 1EF4A 2HGCA 1WJEA 1QRYA 4HF1A 1KYZA 4RLQA 4S0HB 3VYRB 2XGXA 4F3QA 5J1UA 2BXYA 2IGMA 4ZZDA 3CCSI 4CCKA 2DI3A 1D5YA 3S3MA 3KYDB 1REPC 1R9TJ 4Y3OA 5LGNA 4OMYA 4RM2A 3RKQA 4N9IA 5D6FA 2CUZA 2QQ8A 3I5UA 1R5ID 3H5RA 3ZR8X 2NS0A 3REOA 1RKWA 1P7IA 2R4GA 2WV0A 3ZQGA 3SDBA 3CJQB 2VE8A 1WPKA 3CCJI 3CMYA 2OZ6A 3E5XA 3KE2A 4A2UA 1S5LC 2CO5A 2XB5A 4NNJA 2HDCA 3QYEA 3PQKA 1QVUA 3G1OA 3GUDA 1OYYA 5J6XA 2W48A 4M71A 2RKHA 5D5VB 3BR5A 1A31A 4I02A 2L4AA 4AWXB 1Z67A 5EZGA 3H9GA 2KFDA 3JTHA 3GX4X 1NH3A 3DBRB 3ZQFA 3HSEA 5L3CA 1RPWA 4ZYGA 1YQAA 1R49A 2O9LA 3GLXA 1JHFA 4BE0A 1WSUA 3VWBA 4G8XA 2DFIA 2Y2ZA 1ZR2A 3ZQIA 2XB0X 2GA1A 4P96A 4XOTA 3G4SI 2DK8A 4EM2A 3BTJA 4ABZA 4AM3A 2OAZA 4P55A 3MWMA 5E8IA 1OPCA 4IZZA 5KHDA 3A02A 3PO3J 5E17F 2JMWA 1T2KA 1X1AA 3FWEA 2NNNA 3EDPA 2EQRA 3NEUA 1G59A 1MH3A 1SFXA 2E2JJ 1OISA 1TLHB 3CZ6A 3R0AA 5E20A 2HNHA 2JJ7A 3EETA 5M5YJ 2MC3A 2X9DA 2DFEA 1XC5A 1XMXA 3TKYA 3FXOA 1XSDA 4MLOA 3E97A 4V19K 1SD7A 4PCQA 1BC8C 3QPLA 1YE9A 1BR1A 3OYJA 4HZFA 1F36A 4A12A 3IAS2 4D5FA 1W5CC 5DM7F 1YFHA 1ETQA 4M74A 3ZXSA 3W6KB 5L3FA 3FXMA 2ZXIA 4IX7A 1VFCA 1EH7A 2GIVA 4LD5A 4LLLA 3GCMA 4E7IA 3S2WA 4E6KG 4UUTA 2EFOA 4PFPA 2NRAC 1SVLA 4OOIA 4EQQA 1HDDC 2HOEA 2CGPA 1T6SA 1UG2A 3PSFA 1H89C 4KT6A 5FGMA 1SVOA 3C2BA 4YRVA 4G94A 3RPUD 2HKOA 4NDLA 2WAQN 5K5RA 2R7TA 1B1BA 3FBNB 2FMYA 3V7CA 4ZYHA 4DGWB 2CV1A 3DBLB 2V1DA 4LJZF 3MKZA 2L01A 5D5UB 4GYIA 2L02A 2E5NA 3LSKA 1R6RA 1KONA 3DLAA 1RI7A 2XKOA 3BOQA 2EB7A 4B3XA 1AU7A 1GLNA 2CYYA 5HLTA 1LFUP 3HZJA 3I71A 2GWRA 3EUHC 1LQ1A 3JR9A 4I09A 2BEOA 1GHCA 1JT6A 3OS2A 1ZRDA 4KT5C 5FKMA 1SD5A 3SEQA 1OCOH 2Y30A 3KPHA 2G9WA 1J59A 1V3FA 1TTYA 3I64A 1C0WA 4C3JJ 2JA8J 1LEBA 1A5JA 4MTEA 1NG6A 2R7VA 3KEYA 3LSHA 2MLGA 5LFAA 4FTHA 1SFKA 2EFWA 4IHWA 1IXRC 4YFKF 4RB0A 3DPUA 3S17J 3SZPA 2CUJA 1FOYA 3RKXA 3WTWC 1FMVA 1KQ8A 1FOKA 3QOEA 4V2GA 4MQ9F 2FUG2 1HLVA 2KRCA 2RGVA 3J80K 5DCMA 2IJLA 2ZJRF 3VOEA 3P7NA 5KAIC 2KZVA 3CDHA 3M8JA 3OL3A 1BOAA 5J4YA 3HOSA 2MYSA 4RAFA 3BG5A 3H0DA 4W97A 1UHWA 4XORA 5GADJ 1IF1A 1RR7A 3JRHA 5BQTA 2GXGA 1ZG3A 2DO7A 4M6XA 2A69F 1FIPA 1IXCA 5DCMB 2BBYA 2VT2A 4AIKA 2M0CA 1WI9A 2ZXJA 3E5QA 3SZTA 2R7DA 4JBAA 3FKJA 3V7SA 2GBYA 3I58A 2I8DA 1V5EA 2KZGA 4PJJA 4RB2C 5H6QA 1R5GA 2CU7A 3GMEA 2OBPA 2M30A 1SAUA 3H1CA 3M1EA 5DTDA 3WGHA 2Y9YA 2VT3A 1YJNI 3ABTA 4XKBA 3GWZA 2ID3A 3GZ5A 2EFNA 3N97A 2K5CA 3K4KA 2XDVA 2DT6A 2LREA 3MAJA 2VE9A 3HOVJ 2ZMEA 2M7AA 1A36A 2AQFA 2P5KA 3H36A 2WADA 3BPVA 2CQ7A 1ZN2A 3LA7A 1D0YA 1MMDA 2K9LA 3D1NI 3H35A 2HPIA 2MGQA 2VXZA 1OCPA 3HIFA 2R5YA 1YS7A 4U87A 2WAQA 4HX8A 5M5WJ 2LY1A 3F72A 2E1CA 3H92A 1R1UA 1U2WA 1ZG5A 9ANTA 1YW8A 4FX0A 3ZMUA 4Y4RA 3WE2A 1HSJA 1ODDA 4E7ZA 2R5YB 1Y39A 2IPQX 3BQZA 2WWYA 4WWCA 3ELKA 3GTQJ 1OCTC 4YIFA 1RUOA 2W1OA 4BE1A 2HKXA 4HNUA 3LSJA 2XAFA 2DOFA 2VBYA 2IS4A 2LFBA 5CLSA 4ESBA 2LK2A 4LGWA 2K02A 4B3AA 2GA2A 3BG9A 3WGGA 4UVBA 3IP4B 3RZDJ 1IG7A 3CCYA 3JW4A 3OYKA 1VQMI 1D0XA 2LF7A 1HOMA 1UG0A 1WQ2A 1LEAA 1TWHJ 1A04A 1JKOC 4RDUA 3FIWA 3W2VA 3PFYA 1K4TA 3GW2A 3S15J 2O03A 2ISZA 1LVAA 4BEHA 4KIGA 2DOAA 4HSTA 4XK4A 2OF7A 3PUBA 3KCCA 3OSFA 2GM4A 4HDUA 1ZLKA 5LRRA 1B4AA 2OZUA 1X58A 4L5IA 5HNFA 4MO7A 1UCRA 1U8RA 1JE8A 2X6OA 4BEHB 4XMYA 2JUCA 4XICA 3DPTA 2RDPA 3OR2C 3AG4H 1W5TA 3HSRA 2H1LA 4L9JA 1W1WE 3PNYA 3T8RA 3VDXA 4RGSA 3H3VK 4I7HA 4FT8A 5CKTA 1H8AC 2LKSA 5D5WB 3I55I 1D0ZA 2VKVA 2A61A 1I39A 2Z5UA 2CFXA 1X1BA 2F5EA 1PDNC 2HDDA 1TP4A 1OJLA 3QQAA 3SJMA 2HOSA 4EGZA 4A3BJ 4HOBA 3ZP5A 4EATA 4U7DA 4U7BA 1QPMA 3WTVC 1X3UA 1O3TA 1HF0A 3UNGC 2Z99A 1T56A 1Y8QB 4JX6A 1MNMC 1STZA 4G7OF 4MEXF 3C3WA 3IRRA 2UWMA 2FQ4A 2P6TA 2QM3A 3HPHA 2K9SA 3QPSA 3VB2A 3V42A 4ANJA 2FOKA 2LD5A 1O7LA 3G1LA 4KICA 4A3CJ 3BP8A 2E36A 3QAHA 2E1OA 2NVQJ 4F7ZA 4OINF 1T0FC 4Y15A 3MN2A 3SHFA 4RA2A 1ZH5A 2J5OA 3CC7I 4J19A 4XBFA 2FX0A 2A6TA 4F92B 1ENHA 5FROA 2OTLI 2XGEA 4UVCA 3HM5A 5ICEA 4QPQA 2GXBA 1B9NA 2ID6A 3CMEI 1TT5B 5AIPA 4LMYA 1UFMA 4BHPA 3DEEA 3FHNA 2F48A 4BH9A 2YS9A 4EEFG 3VEPA 3E5UA 2G7HA 1KQ9A 4NC6A 2W85A 1FLIA 3TGNA 2EPFA 3D5LA 4WF2A 2O8XA 4HAMA 2AQEA 4L9TA 2HDWA 3QU3A 3S1NJ 3FMQA 2FNAA 3DBHB 3CCRI 1T33A 1H9GA 2FXAA 2LVSA 4X6AJ 3RTRA 3RQIA 5E18F 4WX9A 2LY9A 2R7OA 4RAGA 2F6CA 3T8TA 1RR8C 4NQWA 3DU5A 1JJ8C 2EINH 4IXAA 5TGTA 2DMPA 3TOBA 2F4IA 2K7LA 4HEA2 2VKDA 1QVTA 5HNHA 2IW5A 2DA1A 2XAJA 3CCMI 4JYKA 4HG2A 4XKWA 4XL9A 4AVPA 5D4RA 4C2TA 3J7AY 3A0HC 5DM6F 1FP1D 1S7OA 4A3DJ 3K10A 4S04A 5EJCA 1G3TA 4NQWB 3K4CA 4KA4A 3ZN0A 4TV7A 3GO5A 1DGRM 1PVEA 2OC6A 5D6EA 3OIPA 4GXOA 1W4MA 5F04A 5EEHA 3SDGA 3K4LA 4IEJA 4WCGA 1I1SA 1XGOA 1J0RA 3TDUC 2L9RA 3H5AA 1IRZA 2RAEA 4HPQA 2RNGA 2QBYA 5KK1A 4A0XA 4GGGA 2I10A 2XKPA 2J5PA 5ILUA 3JSOA 4OMZA 4X1EA 4BXUA 1K83J 2XC7A 2VL8A 2XROA 3CUQC 4CZZA 2L9VA 2H1KA 1K7AA 1Q1HA 3R0JA 2QYOA 3RPUA 4KISA 4JQFA 1IRFA 1IRXA 3K4NA 1ONVA 4N4OB 4BY1J 3S3NA 2IAIA 2IXSA 2R7WA 2XAUA 4LFUA 4I6ZA 1W7PD 3ULQB 3GF2A 3BZ6A 1VQOI 1WH7A 3HOXJ 3FISA 3BTIA 1MBKA 1QZYA 4MFDA 2HOTA 4AC0A 2ELJA 2EZIA 1XTAA 1ACIA 3HC7A 4I2OA 2L5QA 2Y48A 3JRFA 4EGYA 1JGGA 3JAMK 3H9QA 2VJJA 3PIPF 2NNYA 4IHXA 2XV4S 5IP6A 2FJ1A 1DUXC 2NYXA 3LSPA 1RC9A 3S32A 1VQ9I 1YITI 3CDIA 1XD7A 2IP2A 2O7OA 2VIXA 3ASOH 4G7ZF 3OSGA 3KEQA 1Z0XA 1SMYF 2LR8A 1MJAA 3U1DA 4OU0A 1WJCA 3M8EA 4A3GJ 3HEFA 1JGSA 1S72I 2V79A 1YW7A 1ULYA 4ZYEA 2W7NA 1VTNC 2WV1A 1RKTA 4PZJA 1RNLA 4FQGA 3WG9A 4N0BA 1BI3A 4EV0A 2MH9A 1TQIA 2MBFA 4AVZA 4QLCU 1HKTA 4A6EA 5H6RA 4AUXA 2LBFA 2M5WA 2FBIA 1KA8A 4E7KA 2CQQA 3AG1H 3CJTB 4I76A 4OIOF 2DDAA 1YS6A 3V8LA 3JSPA 1P9QC 2ME0A 5ICGA 3A2KA 1RRJA 4CXFA 1AWCA 2W25A 5DD4A 4MIMA 1TNTA 4GYGA 2W24A 4RGUA 1OFCX 1MIJA 2OTJI 3RYPA 1TWCJ 2QVOA 2JK3A 3A4CA 1P6RA 2LBFB 4HW0A 4A0YA 3OYMA 3KP4A 1T39A 5JVGF 4ZTFA 1MMSA 3E7LA 2NOGA 3TMOA 2W00A 1FOWA 2EV5A 3HOUJ 3I59A 2LF8A 2LH9A 3OS1A 2KIQA 1I3AA 4M3GA 3ECHA 5TRDA 3FHZA 4KITB 4AIDA 1WZ2A 3IH2A 3O8GA 2A6HF 1R22A 2VN2A 2VLAA 1N77A 1B72A 5C4XJ 3HKZN 4UHTA 1ZGAA 3VSKA 1HW5A 5FLXK 2M3AA 4XLFA 2E1MB 1MSEC 3KP5A 2YSRA 1DQUA 1OQYA 3CD6I 3NRVA 2L0KA 3I59B 5ED4A 5DDGA 1YO5C 1LE8A 3OYBA 2XF5A 1DPRA 5IT9K 4RAYA 4IQ4A 2OQRA 3NWTA 4L5JA 4IL6C 3OL4A 2A6EF 2MA3A 3G71I 1B72B 1CQTA 4ZH4F 4ZYDA 4W1UA 1QZZA 3GEZA 5IYCJ 2YUSA 4KJZA 2YR2A 3QYFA 2ELKA 1ERDA 4OIRF 2K9NA 1IN8A 3IH4A 1T98A 2LRDA 1KGSA 2KDZA 1LE8B 3NWSA 3G73A 2PN6A 2JRTA 2WY8Q 3OIQA 2V4JC 5K5QA 2R7SA 1VQKI 3FM3A 4CCNA 1WVRA 2CH0A 2E71A 5JVTA 1LJ9A 3BPXA 3S2HJ 2R7XA 3FMSA 2HFHA 2DA6A 2X1EA 1ETOA 3IKVA 2CJJA 1H9TA 5LD2C 5FD5A 2EJRA 2LG4A 2CUFA 5CVUA 2E35A 3LSRA 3CMAI 3WU1B 1B59A 3IKTA 2QKMB 2MABA 2XRNA 3LFKA 5D8KB 3P5JA 4Y17A 1K6OA 4OIQF 1U5TC 3AG3H 1BJAA 3I4PA 2D1VA 2WB1N 3K2AA 3L1PA 5DCFA 2VJIA 2WTEA 2FF4A 2DA7A 2FEZA 3QOPA 1LUJB 4CCOA 1HW2A 4UY8I 5BS6A 2M4GA 2P5VA 5F6FA 4ZDLA 3KYCB 1S3JA 2COBA 3JRBA 2VJ5A 1S6LA 3HXLA 1HQCA 3S3OA 3CC2I 2A68F 1TBXA 1ZAOA 2E1NA 2X0LA 1JHHA 4WK8F 1BW6A 5M3MJ 3S1QJ 2JRMA 1IGNA 4A3KJ 3MCZA 1T38A 5F1RA 2A3SA 3H3ZA 1TW2A 1AOYA 1U0JA 4KIFA 5B3SH 2PI0A 4B48A 3CF2A 4NUBA 3KIOA 2V1NA 2E7WA 1G4DA 5FKLA 4KUMA 1HW1A 4EJOA 3HHGA 1X4PA 1FT9A 1WKMA 3CESA 3KX2A 3OYLA 1K61A 1WCMJ 3DTEA 4O5VA 4UB6C 3BJOA 4FHTA 3OYFA 5B1AH 4U0VA 1J7KA 5FLVA 4IOAF 2X6YA 1O57A 1ZQ3P 2HQAA 2GOMA 3QU6A 1IW7F 4CO8A 1F9NA 2ESNA 4ZTJA 1LDJA 1W0UA 3QP5A 1E0EA 4ENMA 1LFPA 3HYIA 5DS9A 4CYCA 3ERED 1D8JA 1HXDA 5E8GA 3CCLI 2M87A 4UNOA 1I3QJ 1FWZA 3ZN1A 5IYDJ 1ETYA 4BDZA 3BG6A 5FRNA 5J40A 4BXFA 2QZ8A 2LNBA 2FBHA 3W2WA 2BW3A 2BY1A 2X6WA 3K1NA 3SZGA 2CRGA 2KIMA 2VBWA 4M3EA 4C2MJ 1VQ7I 3ZPLA 1Y56A 3F8FA 1TT0A 3LA3A 4CYCB 3JCUC 1LNWA 2V7FA 3DKYA 3GXOA 1J2XA 4CSWA 1YX5A 3FXJA 2DODA 4X0GA 1GV5A 2DYSH 4R1HA 3JRDA 3Q9VA 2BW3B 3FX3A 2F4MB 3OYAA 1DGWY 2DAOA 4F91B 4PJLA 3TBIA 3O6BB 2PEXA 5FD6A 3L2QA 1IUYA 3ERMA 4JP0A 2STTA 2HU9A 1S8NA 4ON0A 2DMNA 3I0TA 4F55A 4DYQA 3B02A 1XDUA 4A3JJ 2VBZA 3EUHA 1JXSA 1MDMA 2WB1A 5FB2A 2GXAA 3H9JA 3AL0B 4C3HJ 2DA3A 2K85A 2DTRA 3E1SA 1KZHA 4Y7NJ 3HJEA 5IP9J 2O0YA 5DYMA 4GRIA 3DFGA 1MJBA 2DA5A 4Y33A 1OLTA 1MBEA 1SD6A 3GFLA 2K4BA 3GZ6A 4HX4A 4B1RA 3HOWJ 1Y0NA 1IAWA 1MDMB 4CZCA 2FBKA 5HODA 1NK3P 2QLZA 4R8HA 5IP7J 4A93J 3GTKJ 3PNVA 1HC8A 1Y1VJ 1JUMA 4P5OA 5GAEJ 1I1GA 5K1YA 3L2CA 4ZC3A 1ZRCA 2DU9A 5KCMA 1U78A 1ZYRF 1YIJI 3F21A 3BLYA 2ELHA 5ERIA 1KU2A 2DTZA 4CHUA 1XGSA 2DK5A 3DU6A 1R1VA 4D1QA 1QA6A 3C1DA 1RIOH 1IZ1A 2H6BA 1XX5A 2IS1A 2E7XA 4R79A 4EJVA 2K40A 3WTZA 2M1BA 1R58A 3ABMH 1MZBA 4DZPA 1DDNA 2KIUA 4BAYA 2W57A 4I0AA 3EYYA 5IOZA 5M3FJ 5IPAA 3QPHA 3CUOA 1WGXA 2Y0MA 1W7PA 5HS9A 3L2VA 1Y8RB 3ZRGA 1ZG1A 5BPIA 3ABLH 1Y1WJ 5IT3A 3CQZJ 4F93B 2CUEA 2F2EA 3JRCA 1K4SA 2PLYA 3CDLA 1W7PB 2CFOA 2X1CA 2HQRA 3P9CA 4N4NB 4BDYA 1YRNA 4Q5SF 2V9VA 4E7HA 2VBXA 2CW0F 4G6QA 3BC8A 4PK4A 3L09A 2KMUA 3RKYA 3VSLA 3BCBA 2IS2A 1QU3A 2HXOA 3J7YJ 2JA6J 4E7JA 4G12A 4Y52J 1MBJA 2HS5A 3V4GA 4HDVA 1YRNB 2KQRA 1PUFA 4ZDPA 2R7RA 2Y31A 1O3RA 4A69C 2QA4I 4IHSA 4YEJA 4CH7A 1SC7A 1W5SA 1J5YA 3GFJA 4M9ZA 4BL0B 4CCMA 4HQEA 3W3CA 1XGNA 1CGPA 2ZMEB 5KVRA 2A05A 2A5YB 1FBUA 4LOCA 4YIIA 3IHUA 3HOYJ 3F3XA 3JRGA 3TO7A 3F8NA 2CS3A 1PUFB 4PDKA 2XAGA 3RYRA 1U6GA 3DPLC 4DJAA 3ABUA 3Q0UA 2K86A 2ZSIB 1WRJA 1XMAA 2PX9A 4AYBN 1B6AA 1IC8A 2VUMJ 4OAYA 5BPDA 3P9IA 1MMGA 2G0EA 3KLNA 2Q8KA 3FK7A 3FK6A 1SFUA 3I4MJ 1IN7A 3CJNA 3LMMA 1X4OA 5DUIA 2UXNA 1WJDA 3U2RA 1JTYA 2G7UA 4NC7A 4I99C 5EGOA 3BROA 1N75A 1IN6A 5LLQA 4M3DA 3HPGA 3F8BA 4I98B 2FNPA 1JKQC 5J3LA 1IUFA 2DYRH 3L00A 3A03A 4EJTA 2KIFA 5LHGA 1D8KA 3FBIB 4A5NA 2DQLA 4CUGA 5A2QZ 4J01A 2ZKZA 3G1MA 4DQ2A 2N8GA 3FXLA 5DD8A 2Y0SN 3MKWB 4LK1F 2JA2A 4UUVA 4OIPF 1MW7A 3AFHA 4HRIA 3S93A 2D1HA 1VNDA 2Q1ZB 1MSFC 2AXLA 2QQAA 1QBJA 1USSA 2CSOA 1D5VA 1ZR4A 4II3A 1ETKA 2VKEA 4D7NA 2QWWA 3RJPA 2W4SA 3ASNH 1G8XA 1FSHA 3GFIA 2YU3A 5F27A 1OR7C 3MKLA 4PFOA 4C3IJ 3VODA 3LSTA 2LYCA 2LY2A 3LWFA 3TL4X 2XSDC 2NVXJ 2NVTJ 2L7KA 3IAM2 4IO9F 2B63J 2EIKH 1Z9CA 1P92A 2P7VB 2BHZA 5AONA 4BJ6C 2VQHA 1ETVA 3K0LA 5E3MA 1YYVA 5F1JA 2WY7Q 2HR3A 5ICCA 1T0FA 2L3DA 4BJ5C 4KN4X 2KLOA 4U0YA 2DMQA 2R3SA 3I3LA 3G6EI 3F8CA 1QHGA 3IWZA 2VQCA 3HSFA 1UB9A 1JKRC 1QNTA 2Z9OA 2B9SA 2QKLB 2GIZA 2VJ4A 1D3YA 4XNFA 4B8XA 3RKWA 4EVIA 1FZPB 2ZSHB 4HA8A 5KNLA 2BVLA 4LLNA 2D2WA 2IA2A 2EFPA 2R5ZA 2MW8A 5EDNA 1FYMA 4AYBA 2O61A 4UXNA 2FMLA 1R7JA 2L54A 2VOPA 3I4NJ 1ZARA 2MD5A 3O3KA 2BVMA 3FMRA 3BY6A 2Z16A 2UZKA 1GXQA 2OJED 4GFBA 2LMDA 4JK1X 2A07F 2R5ZB 3DV8A 4Y13A 5HOOA 1Z3XA 3BTCA 1V5GA 2IBDA 3LFUA 3HUGA 2KJBA 4QPOA 4MHGA 1F1ZA 3HOZJ 3W6JB 5LGTA 1VI0A 4FISA 2L4MA 1G3WA 4BQNA 3FF5A 2ICWG 4PJNA 1SMTA 3HGGA 3KYLA 2IRFG 4FE7A 2QSFX 3MEXA 5ILSA 1FOXA 3HUGB 1G6NA 4G6TB 3OS0A 3GTGJ 4PJMA 3DXJF 2HTJA 2IA1A 1FTZA 2BZTA 3OR1C 1BI2A 2CG4A 4RMNA 2GLOA 2OCEA 4M72A 3CJRB 1IJWC 3K7AJ 4UB8C 4BBSJ 3KP2A 2XGDA 1U8BA 2FA5A 3BCAA 4ENKA 3EUKL 5F08A 4KIBA 3O2PE 1FEXA 1IDZA 4XN3A 2Y9ZA 5GAGJ 3HRSA 1V54H 2LOOA 3K2ZA 2BOLA 3HBLA 3CUQA 4XIDA 4IQJA 3RQ4A 3HRTA 5B1BH 1HA8A 1GXPA 2EA2A 2JT1A 2L7ZA 3RZOJ 5F0FA 1SFOJ 1TQMA 2DOEA 3VPRA 2KL4A 1TC3C 1DP3A 5LBQA 2YX7A 3GZNB 1BI0A 5E3LA 2VXDA 3ZQHA 3CUQB 2PMHA 3K70D 4BE2A 3BR6A 4L9VA 4ZDOA 2WAFA 3OYHA 2EH3A 1MGTA 1A6IA 1QQIA 1KQ0A 1Y6IA 2V6EA 5BMZA 3I9V2 3E6DA 4A5MA 5EF6A 5F0HA 1JJ6C 2L7MP 4IJAA 2AO9A 4LG3A 3OOUA 4EM1A 2QBYB 2HQ5A 3TO6A 4BQQA 4Q47A 2KRFA 4AIJA 4OWRB 4DYRA 4NB5A 4IOCF 1FJLA 5LHHA 2VC0A 4LK0F 2HWVA 3B6AA 3HTUA 3CCUI 4HX7A 4YFNF 1O3SA 2L7FP 1IO2A 4BY7J 3VYUB 1A6QA 4EM0B 1X1PA 2R7ZJ 4PSWA 3B73A 2DBBA 3OYCA 5K7FA 4PUSA 2JTVA 4ZJZA 1AA7A 4IKFA 2PJPA 3K9TA 1DPUA 1O3QA 2KPMA 3FXRA 3C2HA 1AHDP 3W6VA 3M4OJ 4M6YA 4XLEA 2M2EA 4HNVA 3K6GA 1WI3A 3LSIA 1W36C 1FBQA 3ZMDA 4D0PA 4LITA 5LGUA 2ZFUA 2O6GE 3A1YA 4EJUA 1X2NA 4WXDA 3R6SA 4EJWA 3DKWA 4E4HA 4UVAA 2R93J 2K4JA 1D1CA 2RN7A 2D5VA 4BJTA 2IEKA 2JSPA 2JVGA 2DDBA 2Z33A 2X51A 2CQKA 2QCOA 3CP2A 3ZGKA 4NC8A 3OYGA 1O4XA 3S1RJ 2O8KA 2NS7A 2D45A 3MZHA 2ZB9A 1Z91A 3FKIJ 4FCYA 3JREA 2V1UA 1YJ9I 4ENNA 1ON1A 3TOAA 2HZDA 3WU2C 3SXYA 1YTYA 2E19A 5EG0A 4B47A 2H8RA 3BG3A 1ZHFA 1GVDA 1QZEA 1KYWA 3IWFA 3V7RA 2MH2A 4XR6A 2JUGA 5F64A 3K1PA 4A3IJ 2R7UA 2E34A 2X6XA 4P9UA 1Z6RA 3MQ0A 3WG7H 2M9HA 1Y0UA 2IS6A 3FXUA 1R23A 1IV8A 1Z6TA 5EG0B 3HGYA 4KNYA 4S05A 3BJ6A 3Q5FA 1NHAA 5JLXA 2RVCA 3CLOA 2B0LA 5LEJA 1BIBA 3COAC 4IHYA 2HI3A 3TDZC 4RB3C 2DA4A 3KEOA 4HYEA 4DBQA 3FDYA 3G3ZA 4XRSA 2NXNB 3MMYB 2L9NA 4BGDA 1WFXA 5JR3A 2ACJA 4DYCA 1V5FA 3ONQA 4XLNF 4L5EA 4FE4A 2EZKA 3OYNA 2GQQA 4IHVA 3WTXC 5GPCA 1GT0C 1I6HJ 1S29A 1XDSA 1R36A 5TJJA 5GPAA 2M7BA 2XPVA 2DLLA 4DIQA 4CYDA 3DEUA 3QWLA 5FO5A 5IOYA 3EYIA 3LQRA 2E2IJ 1NK2P 3GFMA 3U21A 3ZQQA 5IYBJ 2HVQA 2ZFWA 4XQFA 4UV8A 1QO0D 4LG0A 3Q3SA 2E1MC 1R4MB 3LA2A 4M6VA 1MBHA 1IN5A 4E70A 1POGA 1T95A 2PQ8A 5J1YA 5CYVA 3JTGA 3F0CA 5L3DA 3WHBA 2QQBA 1W0TA 1L3LA 3F22A 4BYYA 2DPUA 2HZTA 1U5TA 4ETSA 2CMPA 4LG0B 4MFEA 3BZCA 3Q0VA 5DUKA 2HYFA 1KU9A 3LQQA 2DPDA 2JPCA 1BL0A 3LOCA 2PFBA 2KRHA 1NTCA 2QF7A 3G2BA 3PFIA 5L3GA 1MD0A 5CVJA 4A3EJ 2XRLA 1U5TB 3M9AA 3CF5F 1S9HA 2UUZA 1G2HA 1QHHD 2Q0OA 2RQPA 5HLHA 1USTA 1MMAA 3J81Z 1XCBA 2FE3A 3ZQLA 4BNCA 1SEUA 2O3FA 2ECBA 2ZXWH 4J00A 3M3YJ 3BTLA 3E0JB 3CO7C 3N05A 1MBGA 3OYEA 3CCVI 1JT0A 1IDYA 1OCCH 3LL7A 4DOZA 2OV7A 3RPQA 2QUFA 5HS7A 4G6DA 1B9MA 4LB6B 5CVRA 3ZCOA 2DMTA 1VQ5I 2VC1A 5FFXA 3T1BA 3K4JA 5F0CA 3F23A 1WH5A 1ITYA 3P9KA 2ISYA 5TISC 2A5WA 4LIVA 5K7HA 1WJBA 4ENJA 1J09A 2H94A 2RREA 2X85A 4YG2F 3S14J 3F6VA 5C4JJ 2QENA 5CVVA 1XSXA 3HKZA 1YIOA 3PO2J 3NARA 5CPRB 1TWAJ 1XB4A 1T8IA 1JI8A 1ZGJA 1LDKB 4B44A 2OD5A 4K2EA 2JN6A 4KN7X 4RLFA 2CWEA 5JLWA 5J4VA 2IGKA 5FLXZ 4C2UA 1X1CA 3IL2A 1BM9A 5AIQA 2FRHA 1F43A 1T08B 1X2MA 2DFFA 4P9FA 3WHCA 2HYJA 3D5RC 1Z7LA 5IT9Z 1TWGJ 2VONA 2WAEA 2H6CA 4HV5A 2W82A 3DCFA 1Z1DA 1ZGWA 2XGCA 1HSTA 3U9GA 4YFXF 1O7FA 1L0OC 2VASA 1YI2I 1PUEE 2OU2A 3AAFA 4HF0A 1D1BA 1OYIA 4E7LA 2VPLA 1DU6A 2ZCWA 3GBGA 3NAUA 5BOXA 5C3EJ 1Q1VA 5FKOA 2ZNZA 1ZLJA 3PIOF 2GOXB 3QRFF 3KZZA 4RM3A 1VQNI 1NG7A 2F4OB 3TP3A 1TWFJ 3CP8A 3H0GJ 2DJNA 3DLLF 4V2FA 1IV6A 1GDTA 2VKHA 2HVSA 4XM3A 1FYLA 2PMUA 1E3PA 5HDGA 3ROUA 4N9HA 3L2WA 3EUAA 3WU0A 2B7EA 1U9NA 5FLMJ 3L2UA 4IRHA 2I5UA 2NS8A 3PJRA 3HL2A 2ME6A 2EIMH 2ADUA 3D0SA 1BR4A 5K5OA 1XPXA 3VYTB 1G3YA 2P5LC 4KMFA 5D4SA 3E6MA 2HXIA 3CC4I 3OY9A 1EA3A 3QPTA 1XMKA 1SANA 2IVMA 4EMSA 3DEWA 2YX4A 3I53A 1DP7P 1HKSA 3TW6A 1JKPC 3PSIA 1YW9A 2BY3A 5J8CA 1MKMA 4BHBA 1KU7A 2MG4A 3D5SC 4XLCA 2EFQA 1LKXA 1W36D 4BBRJ 4PSXA 4U0WA 3EPZA 2VQLA 4HNTA 2EV6A 1MJ9A 1MNEA 3AL0C 4M3FA 4RGRA 5J1RA 1B8IA 3FXKA 4IPAA 2NAZA 4BKXA 2XF6A 4CCLA 2XPWA 2V6CA 4IRIA 3Q9SA 3LNQA 1S7AA 1FBSA 2CW8A 5DEQA 1IN4A 4UUSA 2XASA 2LKXA 1VQPI 1U3EM 5E3NA 1B8IB 3WGIA 4GCVA 2Z1DA 3K69A 4B43A 1FNNA 4C30A 1XCVA 2ECCA 4IRGA 2LTPA 1GV2A 2P8TA 3DWLE 4UUSB 3KP6A 5A2QK 3F8MA 2ZO4A 3K70C 1ETWA 3RDIA 5HDNA 4CCJA 1XS9A 1YG2A 5CVIA 3KLOA 1JTXA 2JZYA 5IY5H 3CO6C 4NBQA 1ZREA 2EILH 3WTYC 3GTOJ 3NQOA 2K9MA 2M34A 4I0BA 4RGXA 5GTHC 2P81A 1WWXA 3OWTA 1BN5A 5J8FA 1EV7A 4UV9A 3KETA 4HBLA 1R71A 2PG4A 4AU7A 4QIWN 5J47A 2XIGA 3Q0WA 2DT5A 2MSYA 4XLPF 2WBMA 2DA2A 2VI6A 3FM5A 4F52A 1E2XA 4C9YA 1GUUA 2K9QA 3ZOBA 3MZ8A 2JSCA 1K6YA 1WJFA 1EKEA 3M07A 2HOAA 2FOWA 1MBFA 4ZZLA 2TRTA 4FETA 3B6CA 2M8GX 4PGGA 3OIOA 5LHIA 1ZKGA 4A3MJ 5JHUA 3DQVC 4E7SA 1TW3A 1UAAA 3HTSB 1XSVA 3VFZA 3I56I 1HCRA 2HPMA 1RESA 4HSRA 4ASNA 1PP8F 3HDDA 4XSXF 1I27A 2HTSA 2JWTA 4I01A 1FX7A 1SAXA 2IA0A 4L0ZB 5L3EA 2E2HJ 2H27A 5GAHJ 2XSJC 3DF8A 4XSZF 2XHKA 1WHUA 2P6SA 5D8LB 3CCQI 3HOTA 2ZMEC 2XF7A 5H20A 3BZKA 3QODA 1YHQI 2QSHX 1VZ0A 1BOBA 1DU0A 2JVHA 2BV6A 2XVCA 4PJ0C 2BGCA 5FKNA 2W84A 5KAFC 1UZCA 4KMUX 2VOOA 4U88A 2L2OA 1EH6A 3ABKH 5E1XA 2F5VA 4L0YB 4CA0A 2EZHA 1MH4A 2BY2A 2K27A 5HLGA 1TL8A 5B5EC 5HS8A 3ZQCA 4A0ZA 4M9XA 5GTIC 3E3VA 4Q48A 2BY0A 5EGOB 4MEYF 3ESWB 4QWQA 4WXCA 1FY7A 2BYVE 1OR7A 5ILVA 3TO9A 1UHSA 3J80Z 4O3MA 2V1XA 2FD5A 1LVKA 1EH8A 3BR0A 3BQYA 1EJ9A 3R60A 1TNSA 3E6BA 2EBIA 2COMA 4RBOA 2YU9J 2LDUA 1LDDA 3A0BC 4ESJA 2Y69H 3SYTA 3RIRA 5LEKA 2X48A 1V4RA 2BE5F 3WE3A 4ZYAA 2OQGA 2NOJB 2XPUA 4WXHA 2NVYJ 3CLQA 2MC4A 1S7EA 2IT0A 2ZBKA 2AXTC 4GDFA 1VF9A 2DN0A 3HG9A 4B4CA 3HB9A 4FX4A 2DXIA 3SFIA 3M7GA 1FYKA 1E3HA 1H0MA 1A35A 2LLKA 1GVJA 2KHMA 3R61A 3MFKA 3H5NA 3OYDA 3F9KA 4GO1A 4AD9A 1UMQA 2VQGA 5EEAA 2QGUA 1JUSA 1X1DA 2IGOA 1TZLA 2EIJH 5CJ9A 1IRGA 4HV6A 2FU4A 2OCCH 3PM1A 3VYSB 2C6YA 3I54A 5FKKA 1BW5A 2FQ3A 2M0MA 4XRMA 2ZJ2A 4LB5A 2R7QA 1P4WA 4CICA 1LFBA 3GVAA 4MQVA 3N4MA 3HRUA 2CV0A 1BBYA 3DTKA 4H4KC 5HDKA 2JQ7A 5GP9A 2NVUB 4IF4A 2DMUA 2KT0A 3TQNA 4B09A 2CQNA 1YLFA 4OAZA 3TW7A 4D9JA 2L9SA 1HDPA 1FSEA 1SFEA 3BR1A 3HHHA 4P1WA 1AKHA 1BJZA 1Z05A 2HQNA 3PQJA 2EV0A 2E5ZA 1PJRA 3BWGA 2KDOA 2XAHA 5JHFA 1FP2A 1SVMA 2CQXA 4HLXA 2LP0A 3JRIA 1HBXG 2V26A 3M8FA 3CMMA 4HLYA 4M9SA 1OCRH 2VPRA 1VQ8I 3DKXA 5ICFA 5EYRA 3C2GA 4RS8A 1AKHB 3UR3C 4KYWA 1YJWI 1M1EB 1X3WB 1ORKA 2HEOA 1N78A 3KZIC 3RSNA 2STWA 3CCEI 3K1MA 5FFZA 5K7ZA 2KISA 2DQRA 2Z2SB 3DTIA 3GTLJ 2LSOA 5HVQC 3J7AO 2Y0SA 5D5XB 4XONA 1VQ4I 3SQNA 4A6DA 3W2AA 1P4XA 3ZQ7A 1MMNA 6PAXA 1BIAA 2PBIA 2XUBA 1R4NB 1XGMA 4FASD 2M8EA 2R0QC 1OCZH 3S16J 4M3BA 3WTTC 3BR2A 5EEGA 2AS5F 2DW4A 2ZC2A 3GTMJ 2TDXA 2Y75A 4YIRX 3ZMSA 3IRQA 3F6OA 1Z3YA 1E3OC 2R7FA 1HKQA 2CV2A 1FPQA 3PNTA 3S1MJ 3FXQA 3BDDA 5E79C
chains in the Genus database with same CATH topology
1XN7A 3C7JA 2ESHA 2H09A 2RV8A 4DNCA 1R00A 3R4KA 1RUNA 4IHTA 3ZMTA 4PGHA 1RZ4A 1Z7UA 2EK5A 1CF7A 1TQPA 3WTSC 4RB1A 2VODA 2RNJA 2WC2A 2UXXA 2QQ9A 3SFZA 2MLKA 4L9NA 3ZMVA 1CF7B 2XAQA 2GZWA 4LLGF 3BJAA 2GAUA 2ETHA 4MGRA 3WTUC 2P7CB 2OA4A 4Z2YA 2Q2EA 4HF2A 3HRMA 5E1WA 1ON2A 1K79A 1OMIA 5DV5A 1QGPA 3ISPA 2X4HA 4KDPA 1K78A 4G7HF 1I6XA 4BQAA 3QP6A 3H3UA 1J75A 3C18A 3LAPA 1J9IA 4HQMA 3ML6A 3GYHX 4XRFA 1KU3A 2F5FA 3MZYA 1BC7C 2FSWA 1F4KA 5E1ZB 3FZVA 1K78B 3J81K 2KKOA 1R1TA 1LB2A 2Z3YA 3CTAA 4BHCA 1IXSB 5LRSA 3V8JA 3DP7A 2LKPA 3IC7A 2YPRA 3T0YA 1P2FA 1UHMA 4ESFA 2JPBA 1P4AA 4NHJA 4MTDA 5JI6A 1PP7U 3E6CC 3L9FA 3ZMZA 3EQLF 1F5TA 1G3SA 5HLIA 2M45A 3LAJA 3KP7A 1ZRFA 1I5ZA 4Q4ZF 1SD4A 4MNUA 3OOPA 1FC3A 4G9YA 2RC4A 4KFCA 1E17A 1OYWA 4RAZA 3KZYA 3WODF 3L7WA 3V8KA 1OKRA 4M73A 4H0EA 3RI4A 1R5HA 2F5CA 2ZNYA 3T5XA 2HYGD 3JAMZ 3ECOA 3KP3A 2EWNA 2EA4A 4IVNA 5JFRA 4CGZA 5L3BA 4AIHA 3OV8A 3KFWX 4L18B 2P4WA 2F5DA 2KJCA 4O6JA 4CDGA 1BI1A 2HGCA 4HF1A 1KYZA 2XGXA 4ZZDA 2DI3A 1REPC 5LGNA 4OMYA 4N9IA 5D6FA 3I5UA 2NS0A 3REOA 2WV0A 2VE8A 2OZ6A 3E5XA 3KE2A 4A2UA 2HDCA 2CO5A 3PQKA 5J6XA 3GUDA 1OYYA 5D5VB 4M71A 2RKHA 4I02A 2L4AA 4AWXB 3JTHA 3GX4X 3HSEA 5L3CA 4ZYGA 1YQAA 3GLXA 1JHFA 1WSUA 4G8XA 2DFIA 2GA1A 4P96A 2DK8A 4EM2A 2OAZA 4P55A 3MWMA 5E8IA 1OPCA 5E17F 1T2KA 3FWEA 2NNNA 3EDPA 3NEUA 1SFXA 3R0AA 1TLHB 5E20A 3EETA 2MC3A 1XSDA 3TKYA 3E97A 1SD7A 4PCQA 1BC8C 4HZFA 4A12A 1YFHA 4M74A 3W6KB 5L3FA 1EH7A 2GIVA 4LD5A 4LLLA 3S2WA 2EFOA 2NRAC 4OOIA 4EQQA 2HOEA 2CGPA 1T6SA 5FGMA 4G94A 2HKOA 5K5RA 1B1BA 4ZYHA 2FMYA 3V7CA 2V1DA 4LJZF 2L01A 5D5UB 4GYIA 2L02A 1RI7A 2XKOA 3BOQA 2EB7A 2CYYA 3I71A 2GWRA 1LQ1A 4I09A 2BEOA 1GHCA 1ZRDA 4KT5C 1SD5A 2G9WA 1J59A 1V3FA 1TTYA 3I64A 1C0WA 1LEBA 4MTEA 2MLGA 2EFWA 1IXRC 4YFKF 4RB0A 3SZPA 3RKXA 3WTWC 1KQ8A 1FOKA 4MQ9F 2RGVA 3J80K 5DCMA 2IJLA 3VOEA 3P7NA 3CDHA 1BOAA 3HOSA 1UHWA 1IF1A 5BQTA 2GXGA 1ZG3A 2DO7A 4M6XA 2A69F 1IXCA 5DCMB 2BBYA 2VT2A 4AIKA 3E5QA 1WI9A 2ZXJA 3SZTA 2R7DA 4JBAA 3V7SA 3I58A 4RB2C 5H6QA 1R5GA 2OBPA 2M30A 3M1EA 3WGHA 2VT3A 3ABTA 3GWZA 3GZ5A 2EFNA 3N97A 3MAJA 2VE9A 2ZMEA 2P5KA 3BPVA 1ZN2A 3LA7A 2VXZA 3HIFA 1YS7A 4HX8A 3F72A 2E1CA 3H92A 1R1UA 1U2WA 1ZG5A 1YW8A 4FX0A 3ZMUA 3WE2A 1HSJA 1ODDA 2IPQX 2WWYA 4WWCA 3ELKA 4YIFA 1RUOA 2HKXA 2XAFA 2VBYA 5CLSA 4ESBA 4LGWA 2K02A 2GA2A 3WGGA 4UVBA 3JW4A 2LF7A 1WQ2A 1LEAA 1A04A 3GW2A 2O03A 2ISZA 1LVAA 4KIGA 3KCCA 4HDUA 1ZLKA 5LRRA 1B4AA 2OZUA 4L5IA 1UCRA 1U8RA 1JE8A 3DPTA 2RDPA 1W5TA 3HSRA 4L9JA 3T8RA 4RGSA 4I7HA 4FT8A 5D5WB 2A61A 2Z5UA 2CFXA 2F5EA 1PDNC 4EGZA 4HOBA 3ZP5A 4U7DA 4U7BA 1QPMA 3WTVC 1X3UA 1O3TA 2Z99A 1STZA 4G7OF 4MEXF 3C3WA 3IRRA 2UWMA 2P6TA 2QM3A 3VB2A 2FOKA 1O7LA 4KICA 3BP8A 3QAHA 4F7ZA 4OINF 4Y15A 3SHFA 1ZH5A 2J5OA 4XBFA 4UVCA 5ICEA 2GXBA 1B9NA 5AIPA 4LMYA 1UFMA 4BHPA 4BH9A 3VEPA 3E5UA 2G7HA 1KQ9A 1FLIA 2W85A 3TGNA 4WF2A 3D5LA 2O8XA 4HAMA 4L9TA 3QU3A 3FMQA 2FNAA 1H9GA 2FXAA 3RTRA 4WX9A 5E18F 3T8TA 4NQWA 4IXAA 3TOBA 2K7LA 2IW5A 2XAJA 4AVPA 5D4RA 1FP1D 1S7OA 4S04A 4KA4A 1G3TA 3ZN0A 4TV7A 3GO5A 5D6EA 4GXOA 1W4MA 5EEHA 4WCGA 1I1SA 1XGOA 1J0RA 3TDUC 2QBYA 5KK1A 4A0XA 4GGGA 2XKPA 2J5PA 5ILUA 3JSOA 4OMZA 4BXUA 2XROA 3CUQC 4CZZA 1K7AA 1Q1HA 3R0JA 2QYOA 3RPUA 4JQFA 1IRFA 1ONVA 4LFUA 1W7PD 3ULQB 3GF2A 3BZ6A 1QZYA 4I2OA 4EGYA 2Y48A 3JAMK 2NNYA 2XV4S 1DUXC 2NYXA 1XD7A 2IP2A 4G7ZF 3KEQA 1SMYF 1MJAA 3U1DA 4OU0A 3M8EA 1JGSA 2V79A 1YW7A 1ULYA 4ZYEA 1VTNC 4PZJA 1RNLA 3WG9A 4N0BA 1BI3A 4EV0A 2MH9A 1TQIA 2MBFA 4QLCU 1HKTA 4A6EA 5H6RA 2M5WA 2FBIA 1KA8A 4OIOF 1YS6A 3V8LA 3JSPA 5ICGA 4CXFA 1AWCA 2W25A 5DD4A 1TNTA 4GYGA 2W24A 4RGUA 3RYPA 2QVOA 1P6RA 4HW0A 4A0YA 3KP4A 1T39A 2EV5A 3I59A 2LF8A 3ECHA 5TRDA 3FHZA 2A6HF 1R22A 2VN2A 4UHTA 1ZGAA 1HW5A 5FLXK 3KP5A 2YSRA 3NRVA 3I59B 5ED4A 5DDGA 1YO5C 5IT9K 1DPRA 4RAYA 2OQRA 4L5JA 2A6EF 2MA3A 4ZH4F 4ZYDA 1QZZA 3GEZA 2YR2A 4OIRF 1IN8A 1T98A 1KGSA 3G73A 2PN6A 2JRTA 5K5QA 3FM3A 5JVTA 1LJ9A 3BPXA 3FMSA 2HFHA 3IKVA 1H9TA 5FD5A 2EJRA 5CVUA 3WU1B 1B59A 3IKTA 2XRNA 3LFKA 5D8KB 4Y17A 1K6OA 4OIQF 1U5TC 1BJAA 3I4PA 2D1VA 5DCFA 1HW2A 2FF4A 2FEZA 2WTEA 3QOPA 5BS6A 2P5VA 5F6FA 1S3JA 1S6LA 1HQCA 2A68F 1TBXA 1ZAOA 2E1NA 2X0LA 1JHHA 4WK8F 3MCZA 1T38A 5F1RA 2A3SA 3H3ZA 1TW2A 1AOYA 4KIFA 2PI0A 2E7WA 1G4DA 4KUMA 1HW1A 4EJOA 3HHGA 1FT9A 1WKMA 4O5VA 3BJOA 4FHTA 4U0VA 1J7KA 1O57A 3QU6A 1IW7F 4CO8A 1F9NA 2ESNA 1LDJA 3QP5A 4ENMA 3ERED 3HYIA 1D8JA 1HXDA 5E8GA 2M87A 4UNOA 1FWZA 3ZN1A 2QZ8A 2LNBA 2FBHA 3K1NA 2KIMA 2VBWA 3ZPLA 3F8FA 3LA3A 1LNWA 3GXOA 1J2XA 4R1HA 3Q9VA 3FX3A 2DAOA 3O6BB 2PEXA 5FD6A 1IUYA 2STTA 1S8NA 4ON0A 3I0TA 3B02A 1XDUA 2VBZA 3EUHA 1JXSA 1MDMA 5FB2A 2DTRA 2O0YA 5DYMA 3DFGA 1MJBA 1SD6A 3GFLA 2K4BA 3GZ6A 4HX4A 1IAWA 1MDMB 2FBKA 2QLZA 4R8HA 4P5OA 1I1GA 5K1YA 3L2CA 1ZRCA 2DU9A 1U78A 1ZYRF 3F21A 5ERIA 2ELHA 1KU2A 4CHUA 1XGSA 2DK5A 1R1VA 3C1DA 1RIOH 1IZ1A 2H6BA 2E7XA 4R79A 4EJVA 3WTZA 2M1BA 1R58A 1MZBA 1DDNA 2KIUA 4BAYA 2W57A 4I0AA 3EYYA 3QPHA 3CUOA 2Y0MA 1W7PA 5HS9A 1ZG1A 5BPIA 5IT3A 2F2EA 2PLYA 1W7PB 2HQRA 3P9CA 4Q5SF 2V9VA 2VBXA 2CW0F 4G6QA 3L09A 3RKYA 2HS5A 3V4GA 4HDVA 1O3RA 4IHSA 1W5SA 1J5YA 3GFJA 4M9ZA 4HQEA 1XGNA 1CGPA 2ZMEB 5KVRA 2A5YB 1FBUA 4YIIA 3IHUA 3F3XA 3TO7A 3F8NA 4PDKA 2XAGA 3RYRA 1U6GA 3DPLC 3ABUA 2K86A 1WRJA 1XMAA 1B6AA 5BPDA 3P9IA 3KLNA 2Q8KA 1SFUA 1IN7A 3CJNA 5DUIA 2UXNA 3U2RA 2G7UA 3BROA 1IN6A 5LLQA 3F8BA 4I98B 2FNPA 3L00A 4EJTA 2KIFA 5LHGA 1D8KA 4A5NA 2DQLA 5A2QZ 2ZKZA 4DQ2A 5DD8A 4LK1F 4UUVA 4OIPF 2D1HA 1QBJA 2AXLA 2QQAA 1USSA 2CSOA 1D5VA 2QWWA 3RJPA 1FSHA 3GFIA 2YU3A 3VODA 3LSTA 3LWFA 1Z9CA 1P92A 2P7VB 5AONA 3K0LA 1YYVA 2HR3A 5ICCA 1T0FA 2L3DA 4KN4X 4U0YA 2R3SA 3F8CA 3IWZA 3HSFA 1UB9A 1QNTA 2Z9OA 1D3YA 4B8XA 3RKWA 4EVIA 1FZPB 4HA8A 4LLNA 2D2WA 2IA2A 2EFPA 1FYMA 2O61A 4UXNA 2FMLA 1R7JA 2L54A 2VOPA 1ZARA 2MD5A 3O3KA 3FMRA 3BY6A 2UZKA 1GXQA 4JK1X 2A07F 3DV8A 4Y13A 5HOOA 3HUGA 2KJBA 4MHGA 1F1ZA 3W6JB 5LGTA 2L4MA 1G3WA 3FF5A 1SMTA 2IRFG 3MEXA 5ILSA 1G6NA 3DXJF 2HTJA 2IA1A 1BI2A 2CG4A 4M72A 3KP2A 2FA5A 4ENKA 4KIBA 3O2PE 3HRSA 3K2ZA 3CUQA 3HRTA 1GXPA 2EA2A 2JT1A 1TQMA 5LBQA 2YX7A 1BI0A 3CUQB 2PMHA 4L9VA 1MGTA 1QQIA 1KQ0A 5BMZA 3E6DA 4A5MA 4IJAA 2QBYB 4EM1A 3TO6A 4Q47A 2KRFA 4AIJA 4NB5A 5LHHA 2VC0A 4LK0F 2HWVA 3HTUA 4HX7A 4YFNF 1O3SA 4EM0B 3B73A 2DBBA 2JTVA 2PJPA 3K9TA 1DPUA 1O3QA 3FXRA 4M6YA 1FBQA 3ZMDA 4D0PA 5LGUA 2O6GE 4EJUA 4WXDA 3R6SA 4EJWA 3DKWA 4UVAA 2K4JA 2RN7A 2Z33A 2CQKA 2D45A 3MZHA 1Z91A 2V1UA 4ENNA 1ON1A 3TOAA 3SXYA 1YTYA 1ZHFA 1KYWA 3IWFA 3V7RA 2MH2A 5F64A 3K1PA 4P9UA 1Z6RA 3MQ0A 1Y0UA 3FXUA 1R23A 1Z6TA 4KNYA 4S05A 3BJ6A 3Q5FA 1NHAA 5LEJA 2RVCA 2B0LA 3CLOA 1BIBA 3COAC 3TDZC 4RB3C 3KEOA 4HYEA 3G3ZA 5JR3A 2ACJA 4XLNF 2GQQA 3WTXC 1S29A 1XDSA 1R36A 5TJJA 2DLLA 4CYDA 3DEUA 5FO5A 3EYIA 3LQRA 3GFMA 2ZFWA 4UV8A 1QO0D 4LG0A 3LA2A 4E70A 1IN5A 2PQ8A 5CYVA 3JTGA 5L3DA 2QQBA 1L3LA 3F22A 4BYYA 2DPUA 2HZTA 1U5TA 4ETSA 4LG0B 5DUKA 2HYFA 1KU9A 3LQQA 2DPDA 2JPCA 2PFBA 3PFIA 5L3GA 1MD0A 5CVJA 1U5TB 3M9AA 2Q0OA 2RQPA 5HLHA 1USTA 3J81Z 1XCBA 2FE3A 4BNCA 2O3FA 3CO7C 3RPQA 2QUFA 5HS7A 4G6DA 1B9MA 4LB6B 5CVRA 2VC1A 5FFXA 3T1BA 3F23A 3P9KA 2ISYA 4ENJA 2H94A 4YG2F 3F6VA 2QENA 5CVVA 1XSXA 1YIOA 1XB4A 1ZGJA 1LDKB 2OD5A 4K2EA 4KN7X 2CWEA 5FLXZ 3IL2A 1BM9A 5AIQA 2FRHA 4P9FA 5IT9Z 2VONA 2H6CA 4HV5A 1Z1DA 1HSTA 3U9GA 4YFXF 1O7FA 1L0OC 1PUEE 2OU2A 3AAFA 4HF0A 1OYIA 2ZCWA 5BOXA 2ZNZA 1ZLJA 3QRFF 3KZZA 1FYLA 2PMUA 5HDGA 3ROUA 4N9HA 3WU0A 4IRHA 5K5OA 2ADUA 3D0SA 1G3YA 2P5LC 4KMFA 5D4SA 3E6MA 3QPTA 1XMKA 2IVMA 4EMSA 2YX4A 3I53A 1DP7P 1HKSA 1YW9A 5J8CA 1MKMA 4BHBA 1KU7A 2EFQA 4U0WA 2EV6A 1MJ9A 4RGRA 4IPAA 2NAZA 4IRIA 2V6CA 3Q9SA 1S7AA 1FBSA 5DEQA 1IN4A 2XASA 1U3EM 3WGIA 4GCVA 3K69A 1FNNA 1XCVA 4IRGA 2P8TA 3KP6A 5A2QK 3F8MA 2ZO4A 3RDIA 5HDNA 1YG2A 5CVIA 3KLOA 2JZYA 3CO6C 1ZREA 3WTYC 3NQOA 4I0BA 4RGXA 1WWXA 1BN5A 5J8FA 1EV7A 4UV9A 3KETA 4HBLA 2PG4A 2XIGA 2DT5A 4XLPF 3FM5A 1E2XA 2JSCA 4ZZLA 4PGGA 5LHIA 5JHUA 3DQVC 3HTSB 1TW3A 1XSVA 3VFZA 4ASNA 1PP8F 4XSXF 1I27A 2HTSA 4I01A 1FX7A 1SAXA 2IA0A 4L0ZB 5L3EA 2H27A 3DF8A 4XSZF 2XHKA 2P6SA 5D8LB 3HOTA 5H20A 2BV6A 2XVCA 2BGCA 2W84A 4KMUX 2VOOA 4U88A 1EH6A 5E1XA 4L0YB 5HLGA 2K27A 5HS8A 4A0ZA 4M9XA 3E3VA 4Q48A 4MEYF 4QWQA 4WXCA 1FY7A 2BYVE 1OR7A 5ILVA 3TO9A 3J80Z 4O3MA 2V1XA 1EH8A 3R60A 1TNSA 3E6BA 2COMA 2LDUA 1LDDA 4ESJA 3RIRA 5LEKA 1V4RA 2BE5F 3WE3A 2OQGA 4WXHA 2IT0A 2ZBKA 4FX4A 3M7GA 1FYKA 1H0MA 1GVJA 3R61A 3MFKA 4GO1A 4AD9A 5CJ9A 1IRGA 4HV6A 2FU4A 2C6YA 3I54A 2FQ3A 2ZJ2A 4LB5A 1P4WA 4CICA 3GVAA 4MQVA 3N4MA 3HRUA 1BBYA 5HDKA 4IF4A 3TQNA 4B09A 1YLFA 1SFEA 1FSEA 3HHHA 1Z05A 2HQNA 3PQJA 2EV0A 3BWGA 2XAHA 1FP2A 4HLXA 1HBXG 3M8FA 4HLYA 4M9SA 5ICFA 4RS8A 4KYWA 2HEOA 2STWA 3K1MA 5FFZA 2DQRA 2LSOA 5HVQC 3J7AO 5D5XB 3SQNA 4A6DA 1P4XA 3ZQ7A 6PAXA 1BIAA 2PBIA 2XUBA 1XGMA 2M8EA 3WTTC 5EEGA 2AS5F 2DW4A 2TDXA 2Y75A 3IRQA 3ZMSA 3F6OA 2R7FA 1HKQA 1FPQA 3FXQA 3BDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XN7 A;  3C7J A;  2ESH A;  2H09 A;  2RV8 A;  4DNC A;  1R00 A;  3R4K A;  1RUN A;  4IHT A;  3ZMT A;  4PGH A;  1RZ4 A;  1Z7U A;  2EK5 A;  1CF7 A;  1TQP A;  3WTS C;  4RB1 A;  2VOD A;  2RNJ A;  2WC2 A;  2UXX A;  2QQ9 A;  3SFZ A;  2MLK A;  4L9N A;  3ZMV A;  1CF7 B;  2XAQ A;  2GZW A;  4LLG F;  3BJA A;  2GAU A;  2ETH A;  4MGR A;  3WTU C;  2P7C B;  2OA4 A;  4Z2Y A;  2Q2E A;  4HF2 A;  3HRM A;  5E1W A;  1ON2 A;  1K79 A;  1OMI A;  5DV5 A;  1QGP A;  3ISP A;  2X4H A;  4KDP A;  1K78 A;  4G7H F;  1I6X A;  4BQA A;  3QP6 A;  3H3U A;  1J75 A;  3C18 A;  3LAP A;  1J9I A;  4HQM A;  3ML6 A;  3GYH X;  4XRF A;  1KU3 A;  2F5F A;  3MZY A;  1BC7 C;  2FSW A;  1F4K A;  5E1Z B;  3FZV A;  1K78 B;  3J81 K;  2KKO A;  1R1T A;  1LB2 A;  2Z3Y A;  3CTA A;  4BHC A;  1IXS B;  5LRS A;  3V8J A;  3DP7 A;  2LKP A;  3IC7 A;  2YPR A;  3T0Y A;  1P2F A;  1UHM A;  4ESF A;  2JPB A;  1P4A A;  4NHJ A;  4MTD A;  5JI6 A;  1PP7 U;  3E6C C;  3L9F A;  3ZMZ A;  3EQL F;  1F5T A;  1G3S A;  5HLI A;  2M45 A;  3LAJ A;  3KP7 A;  1ZRF A;  1I5Z A;  4Q4Z F;  1SD4 A;  4MNU A;  3OOP A;  1FC3 A;  4G9Y A;  2RC4 A;  4KFC A;  1E17 A;  1OYW A;  4RAZ A;  3KZY A;  3WOD F;  3L7W A;  3V8K A;  1OKR A;  4M73 A;  4H0E A;  3RI4 A;  1R5H A;  2F5C A;  2ZNY A;  3T5X A;  2HYG D;  3JAM Z;  3ECO A;  3KP3 A;  2EWN A;  2EA4 A;  4IVN A;  5JFR A;  4CGZ A;  5L3B A;  4AIH A;  3OV8 A;  3KFW X;  4L18 B;  2P4W A;  2F5D A;  2KJC A;  4O6J A;  4CDG A;  1BI1 A;  2HGC A;  4HF1 A;  1KYZ A;  2XGX A;  4ZZD A;  2DI3 A;  1REP C;  5LGN A;  4OMY A;  4N9I A;  5D6F A;  3I5U A;  2NS0 A;  3REO A;  2WV0 A;  2VE8 A;  2OZ6 A;  3E5X A;  3KE2 A;  4A2U A;  2HDC A;  2CO5 A;  3PQK A;  5J6X A;  3GUD A;  1OYY A;  5D5V B;  4M71 A;  2RKH A;  4I02 A;  2L4A A;  4AWX B;  3JTH A;  3GX4 X;  3HSE A;  5L3C A;  4ZYG A;  1YQA A;  3GLX A;  1JHF A;  1WSU A;  4G8X A;  2DFI A;  2GA1 A;  4P96 A;  2DK8 A;  4EM2 A;  2OAZ A;  4P55 A;  3MWM A;  5E8I A;  1OPC A;  5E17 F;  1T2K A;  3FWE A;  2NNN A;  3EDP A;  3NEU A;  1SFX A;  3R0A A;  1TLH B;  5E20 A;  3EET A;  2MC3 A;  1XSD A;  3TKY A;  3E97 A;  1SD7 A;  4PCQ A;  1BC8 C;  4HZF A;  4A12 A;  1YFH A;  4M74 A;  3W6K B;  5L3F A;  1EH7 A;  2GIV A;  4LD5 A;  4LLL A;  3S2W A;  2EFO A;  2NRA C;  4OOI A;  4EQQ A;  2HOE A;  2CGP A;  1T6S A;  5FGM A;  4G94 A;  2HKO A;  5K5R A;  1B1B A;  4ZYH A;  2FMY A;  3V7C A;  2V1D A;  4LJZ F;  2L01 A;  5D5U B;  4GYI A;  2L02 A;  1RI7 A;  2XKO A;  3BOQ A;  2EB7 A;  2CYY A;  3I71 A;  2GWR A;  1LQ1 A;  4I09 A;  2BEO A;  1GHC A;  1ZRD A;  4KT5 C;  1SD5 A;  2G9W A;  1J59 A;  1V3F A;  1TTY A;  3I64 A;  1C0W A;  1LEB A;  4MTE A;  2MLG A;  2EFW A;  1IXR C;  4YFK F;  4RB0 A;  3SZP A;  3RKX A;  3WTW C;  1KQ8 A;  1FOK A;  4MQ9 F;  2RGV A;  3J80 K;  5DCM A;  2IJL A;  3VOE A;  3P7N A;  3CDH A;  1BOA A;  3HOS A;  1UHW A;  1IF1 A;  5BQT A;  2GXG A;  1ZG3 A;  2DO7 A;  4M6X A;  2A69 F;  1IXC A;  5DCM B;  2BBY A;  2VT2 A;  4AIK A;  3E5Q A;  1WI9 A;  2ZXJ A;  3SZT A;  2R7D A;  4JBA A;  3V7S A;  3I58 A;  4RB2 C;  5H6Q A;  1R5G A;  2OBP A;  2M30 A;  3M1E A;  3WGH A;  2VT3 A;  3ABT A;  3GWZ A;  3GZ5 A;  2EFN A;  3N97 A;  3MAJ A;  2VE9 A;  2ZME A;  2P5K A;  3BPV A;  1ZN2 A;  3LA7 A;  2VXZ A;  3HIF A;  1YS7 A;  4HX8 A;  3F72 A;  2E1C A;  3H92 A;  1R1U A;  1U2W A;  1ZG5 A;  1YW8 A;  4FX0 A;  3ZMU A;  3WE2 A;  1HSJ A;  1ODD A;  2IPQ X;  2WWY A;  4WWC A;  3ELK A;  4YIF A;  1RUO A;  2HKX A;  2XAF A;  2VBY A;  5CLS A;  4ESB A;  4LGW A;  2K02 A;  2GA2 A;  3WGG A;  4UVB A;  3JW4 A;  2LF7 A;  1WQ2 A;  1LEA A;  1A04 A;  3GW2 A;  2O03 A;  2ISZ A;  1LVA A;  4KIG A;  3KCC A;  4HDU A;  1ZLK A;  5LRR A;  1B4A A;  2OZU A;  4L5I A;  1UCR A;  1U8R A;  1JE8 A;  3DPT A;  2RDP A;  1W5T A;  3HSR A;  4L9J A;  3T8R A;  4RGS A;  4I7H A;  4FT8 A;  5D5W B;  2A61 A;  2Z5U A;  2CFX A;  2F5E A;  1PDN C;  4EGZ A;  4HOB A;  3ZP5 A;  4U7D A;  4U7B A;  1QPM A;  3WTV C;  1X3U A;  1O3T A;  2Z99 A;  1STZ A;  4G7O F;  4MEX F;  3C3W A;  3IRR A;  2UWM A;  2P6T A;  2QM3 A;  3VB2 A;  2FOK A;  1O7L A;  4KIC A;  3BP8 A;  3QAH A;  4F7Z A;  4OIN F;  4Y15 A;  3SHF A;  1ZH5 A;  2J5O A;  4XBF A;  4UVC A;  5ICE A;  2GXB A;  1B9N A;  5AIP A;  4LMY A;  1UFM A;  4BHP A;  4BH9 A;  3VEP A;  3E5U A;  2G7H A;  1KQ9 A;  1FLI A;  2W85 A;  3TGN A;  4WF2 A;  3D5L A;  2O8X A;  4HAM A;  4L9T A;  3QU3 A;  3FMQ A;  2FNA A;  1H9G A;  2FXA A;  3RTR A;  4WX9 A;  5E18 F;  3T8T A;  4NQW A;  4IXA A;  3TOB A;  2K7L A;  2IW5 A;  2XAJ A;  4AVP A;  5D4R A;  1FP1 D;  1S7O A;  4S04 A;  4KA4 A;  1G3T A;  3ZN0 A;  4TV7 A;  3GO5 A;  5D6E A;  4GXO A;  1W4M A;  5EEH A;  4WCG A;  1I1S A;  1XGO A;  1J0R A;  3TDU C;  2QBY A;  5KK1 A;  4A0X A;  4GGG A;  2XKP A;  2J5P A;  5ILU A;  3JSO A;  4OMZ A;  4BXU A;  2XRO A;  3CUQ C;  4CZZ A;  1K7A A;  1Q1H A;  3R0J A;  2QYO A;  3RPU A;  4JQF A;  1IRF A;  1ONV A;  4LFU A;  1W7P D;  3ULQ B;  3GF2 A;  3BZ6 A;  1QZY A;  4I2O A;  4EGY A;  2Y48 A;  3JAM K;  2NNY A;  2XV4 S;  1DUX C;  2NYX A;  1XD7 A;  2IP2 A;  4G7Z F;  3KEQ A;  1SMY F;  1MJA A;  3U1D A;  4OU0 A;  3M8E A;  1JGS A;  2V79 A;  1YW7 A;  1ULY A;  4ZYE A;  1VTN C;  4PZJ A;  1RNL A;  3WG9 A;  4N0B A;  1BI3 A;  4EV0 A;  2MH9 A;  1TQI A;  2MBF A;  4QLC U;  1HKT A;  4A6E A;  5H6R A;  2M5W A;  2FBI A;  1KA8 A;  4OIO F;  1YS6 A;  3V8L A;  3JSP A;  5ICG A;  4CXF A;  1AWC A;  2W25 A;  5DD4 A;  1TNT A;  4GYG A;  2W24 A;  4RGU A;  3RYP A;  2QVO A;  1P6R A;  4HW0 A;  4A0Y A;  3KP4 A;  1T39 A;  2EV5 A;  3I59 A;  2LF8 A;  3ECH A;  5TRD A;  3FHZ A;  2A6H F;  1R22 A;  2VN2 A;  4UHT A;  1ZGA A;  1HW5 A;  5FLX K;  3KP5 A;  2YSR A;  3NRV A;  3I59 B;  5ED4 A;  5DDG A;  1YO5 C;  5IT9 K;  1DPR A;  4RAY A;  2OQR A;  4L5J A;  2A6E F;  2MA3 A;  4ZH4 F;  4ZYD A;  1QZZ A;  3GEZ A;  2YR2 A;  4OIR F;  1IN8 A;  1T98 A;  1KGS A;  3G73 A;  2PN6 A;  2JRT A;  5K5Q A;  3FM3 A;  5JVT A;  1LJ9 A;  3BPX A;  3FMS A;  2HFH A;  3IKV A;  1H9T A;  5FD5 A;  2EJR A;  5CVU A;  3WU1 B;  1B59 A;  3IKT A;  2XRN A;  3LFK A;  5D8K B;  4Y17 A;  1K6O A;  4OIQ F;  1U5T C;  1BJA A;  3I4P A;  2D1V A;  5DCF A;  1HW2 A;  2FF4 A;  2FEZ A;  2WTE A;  3QOP A;  5BS6 A;  2P5V A;  5F6F A;  1S3J A;  1S6L A;  1HQC A;  2A68 F;  1TBX A;  1ZAO A;  2E1N A;  2X0L A;  1JHH A;  4WK8 F;  3MCZ A;  1T38 A;  5F1R A;  2A3S A;  3H3Z A;  1TW2 A;  1AOY A;  4KIF A;  2PI0 A;  2E7W A;  1G4D A;  4KUM A;  1HW1 A;  4EJO A;  3HHG A;  1FT9 A;  1WKM A;  4O5V A;  3BJO A;  4FHT A;  4U0V A;  1J7K A;  1O57 A;  3QU6 A;  1IW7 F;  4CO8 A;  1F9N A;  2ESN A;  1LDJ A;  3QP5 A;  4ENM A;  3ERE D;  3HYI A;  1D8J A;  1HXD A;  5E8G A;  2M87 A;  4UNO A;  1FWZ A;  3ZN1 A;  2QZ8 A;  2LNB A;  2FBH A;  3K1N A;  2KIM A;  2VBW A;  3ZPL A;  3F8F A;  3LA3 A;  1LNW A;  3GXO A;  1J2X A;  4R1H A;  3Q9V A;  3FX3 A;  2DAO A;  3O6B B;  2PEX A;  5FD6 A;  1IUY A;  2STT A;  1S8N A;  4ON0 A;  3I0T A;  3B02 A;  1XDU A;  2VBZ A;  3EUH A;  1JXS A;  1MDM A;  5FB2 A;  2DTR A;  2O0Y A;  5DYM A;  3DFG A;  1MJB A;  1SD6 A;  3GFL A;  2K4B A;  3GZ6 A;  4HX4 A;  1IAW A;  1MDM B;  2FBK A;  2QLZ A;  4R8H A;  4P5O A;  1I1G A;  5K1Y A;  3L2C A;  1ZRC A;  2DU9 A;  1U78 A;  1ZYR F;  3F21 A;  5ERI A;  2ELH A;  1KU2 A;  4CHU A;  1XGS A;  2DK5 A;  1R1V A;  3C1D A;  1RIO H;  1IZ1 A;  2H6B A;  2E7X A;  4R79 A;  4EJV A;  3WTZ A;  2M1B A;  1R58 A;  1MZB A;  1DDN A;  2KIU A;  4BAY A;  2W57 A;  4I0A A;  3EYY A;  3QPH A;  3CUO A;  2Y0M A;  1W7P A;  5HS9 A;  1ZG1 A;  5BPI A;  5IT3 A;  2F2E A;  2PLY A;  1W7P B;  2HQR A;  3P9C A;  4Q5S F;  2V9V A;  2VBX A;  2CW0 F;  4G6Q A;  3L09 A;  3RKY A;  2HS5 A;  3V4G A;  4HDV A;  1O3R A;  4IHS A;  1W5S A;  1J5Y A;  3GFJ A;  4M9Z A;  4HQE A;  1XGN A;  1CGP A;  2ZME B;  5KVR A;  2A5Y B;  1FBU A;  4YII A;  3IHU A;  3F3X A;  3TO7 A;  3F8N A;  4PDK A;  2XAG A;  3RYR A;  1U6G A;  3DPL C;  3ABU A;  2K86 A;  1WRJ A;  1XMA A;  1B6A A;  5BPD A;  3P9I A;  3KLN A;  2Q8K A;  1SFU A;  1IN7 A;  3CJN A;  5DUI A;  2UXN A;  3U2R A;  2G7U A;  3BRO A;  1IN6 A;  5LLQ A;  3F8B A;  4I98 B;  2FNP A;  3L00 A;  4EJT A;  2KIF A;  5LHG A;  1D8K A;  4A5N A;  2DQL A;  5A2Q Z;  2ZKZ A;  4DQ2 A;  5DD8 A;  4LK1 F;  4UUV A;  4OIP F;  2D1H A;  1QBJ A;  2AXL A;  2QQA A;  1USS A;  2CSO A;  1D5V A;  2QWW A;  3RJP A;  1FSH A;  3GFI A;  2YU3 A;  3VOD A;  3LST A;  3LWF A;  1Z9C A;  1P92 A;  2P7V B;  5AON A;  3K0L A;  1YYV A;  2HR3 A;  5ICC A;  1T0F A;  2L3D A;  4KN4 X;  4U0Y A;  2R3S A;  3F8C A;  3IWZ A;  3HSF A;  1UB9 A;  1QNT A;  2Z9O A;  1D3Y A;  4B8X A;  3RKW A;  4EVI A;  1FZP B;  4HA8 A;  4LLN A;  2D2W A;  2IA2 A;  2EFP A;  1FYM A;  2O61 A;  4UXN A;  2FML A;  1R7J A;  2L54 A;  2VOP A;  1ZAR A;  2MD5 A;  3O3K A;  3FMR A;  3BY6 A;  2UZK A;  1GXQ A;  4JK1 X;  2A07 F;  3DV8 A;  4Y13 A;  5HOO A;  3HUG A;  2KJB A;  4MHG A;  1F1Z A;  3W6J B;  5LGT A;  2L4M A;  1G3W A;  3FF5 A;  1SMT A;  2IRF G;  3MEX A;  5ILS A;  1G6N A;  3DXJ F;  2HTJ A;  2IA1 A;  1BI2 A;  2CG4 A;  4M72 A;  3KP2 A;  2FA5 A;  4ENK A;  4KIB A;  3O2P E;  3HRS A;  3K2Z A;  3CUQ A;  3HRT A;  1GXP A;  2EA2 A;  2JT1 A;  1TQM A;  5LBQ A;  2YX7 A;  1BI0 A;  3CUQ B;  2PMH A;  4L9V A;  1MGT A;  1QQI A;  1KQ0 A;  5BMZ A;  3E6D A;  4A5M A;  4IJA A;  2QBY B;  4EM1 A;  3TO6 A;  4Q47 A;  2KRF A;  4AIJ A;  4NB5 A;  5LHH A;  2VC0 A;  4LK0 F;  2HWV A;  3HTU A;  4HX7 A;  4YFN F;  1O3S A;  4EM0 B;  3B73 A;  2DBB A;  2JTV A;  2PJP A;  3K9T A;  1DPU A;  1O3Q A;  3FXR A;  4M6Y A;  1FBQ A;  3ZMD A;  4D0P A;  5LGU A;  2O6G E;  4EJU A;  4WXD A;  3R6S A;  4EJW A;  3DKW A;  4UVA A;  2K4J A;  2RN7 A;  2Z33 A;  2CQK A;  2D45 A;  3MZH A;  1Z91 A;  2V1U A;  4ENN A;  1ON1 A;  3TOA A;  3SXY A;  1YTY A;  1ZHF A;  1KYW A;  3IWF A;  3V7R A;  2MH2 A;  5F64 A;  3K1P A;  4P9U A;  1Z6R A;  3MQ0 A;  1Y0U A;  3FXU A;  1R23 A;  1Z6T A;  4KNY A;  4S05 A;  3BJ6 A;  3Q5F A;  1NHA A;  5LEJ A;  2RVC A;  2B0L A;  3CLO A;  1BIB A;  3COA C;  3TDZ C;  4RB3 C;  3KEO A;  4HYE A;  3G3Z A;  5JR3 A;  2ACJ A;  4XLN F;  2GQQ A;  3WTX C;  1S29 A;  1XDS A;  1R36 A;  5TJJ A;  2DLL A;  4CYD A;  3DEU A;  5FO5 A;  3EYI A;  3LQR A;  3GFM A;  2ZFW A;  4UV8 A;  1QO0 D;  4LG0 A;  3LA2 A;  4E70 A;  1IN5 A;  2PQ8 A;  5CYV A;  3JTG A;  5L3D A;  2QQB A;  1L3L A;  3F22 A;  4BYY A;  2DPU A;  2HZT A;  1U5T A;  4ETS A;  4LG0 B;  5DUK A;  2HYF A;  1KU9 A;  3LQQ A;  2DPD A;  2JPC A;  2PFB A;  3PFI A;  5L3G A;  1MD0 A;  5CVJ A;  1U5T B;  3M9A A;  2Q0O A;  2RQP A;  5HLH A;  1UST A;  3J81 Z;  1XCB A;  2FE3 A;  4BNC A;  2O3F A;  3CO7 C;  3RPQ A;  2QUF A;  5HS7 A;  4G6D A;  1B9M A;  4LB6 B;  5CVR A;  2VC1 A;  5FFX A;  3T1B A;  3F23 A;  3P9K A;  2ISY A;  4ENJ A;  2H94 A;  4YG2 F;  3F6V A;  2QEN A;  5CVV A;  1XSX A;  1YIO A;  1XB4 A;  1ZGJ A;  1LDK B;  2OD5 A;  4K2E A;  4KN7 X;  2CWE A;  5FLX Z;  3IL2 A;  1BM9 A;  5AIQ A;  2FRH A;  4P9F A;  5IT9 Z;  2VON A;  2H6C A;  4HV5 A;  1Z1D A;  1HST A;  3U9G A;  4YFX F;  1O7F A;  1L0O C;  1PUE E;  2OU2 A;  3AAF A;  4HF0 A;  1OYI A;  2ZCW A;  5BOX A;  2ZNZ A;  1ZLJ A;  3QRF F;  3KZZ A;  1FYL A;  2PMU A;  5HDG A;  3ROU A;  4N9H A;  3WU0 A;  4IRH A;  5K5O A;  2ADU A;  3D0S A;  1G3Y A;  2P5L C;  4KMF A;  5D4S A;  3E6M A;  3QPT A;  1XMK A;  2IVM A;  4EMS A;  2YX4 A;  3I53 A;  1DP7 P;  1HKS A;  1YW9 A;  5J8C A;  1MKM A;  4BHB A;  1KU7 A;  2EFQ A;  4U0W A;  2EV6 A;  1MJ9 A;  4RGR A;  4IPA A;  2NAZ A;  4IRI A;  2V6C A;  3Q9S A;  1S7A A;  1FBS A;  5DEQ A;  1IN4 A;  2XAS A;  1U3E M;  3WGI A;  4GCV A;  3K69 A;  1FNN A;  1XCV A;  4IRG A;  2P8T A;  3KP6 A;  5A2Q K;  3F8M A;  2ZO4 A;  3RDI A;  5HDN A;  1YG2 A;  5CVI A;  3KLO A;  2JZY A;  3CO6 C;  1ZRE A;  3WTY C;  3NQO A;  4I0B A;  4RGX A;  1WWX A;  1BN5 A;  5J8F A;  1EV7 A;  4UV9 A;  3KET A;  4HBL A;  2PG4 A;  2XIG A;  2DT5 A;  4XLP F;  3FM5 A;  1E2X A;  2JSC A;  4ZZL A;  4PGG A;  5LHI A;  5JHU A;  3DQV C;  3HTS B;  1TW3 A;  1XSV A;  3VFZ A;  4ASN A;  1PP8 F;  4XSX F;  1I27 A;  2HTS A;  4I01 A;  1FX7 A;  1SAX A;  2IA0 A;  4L0Z B;  5L3E A;  2H27 A;  3DF8 A;  4XSZ F;  2XHK A;  2P6S A;  5D8L B;  3HOT A;  5H20 A;  2BV6 A;  2XVC A;  2BGC A;  2W84 A;  4KMU X;  2VOO A;  4U88 A;  1EH6 A;  5E1X A;  4L0Y B;  5HLG A;  2K27 A;  5HS8 A;  4A0Z A;  4M9X A;  3E3V A;  4Q48 A;  4MEY F;  4QWQ A;  4WXC A;  1FY7 A;  2BYV E;  1OR7 A;  5ILV A;  3TO9 A;  3J80 Z;  4O3M A;  2V1X A;  1EH8 A;  3R60 A;  1TNS A;  3E6B A;  2COM A;  2LDU A;  1LDD A;  4ESJ A;  3RIR A;  5LEK A;  1V4R A;  2BE5 F;  3WE3 A;  2OQG A;  4WXH A;  2IT0 A;  2ZBK A;  4FX4 A;  3M7G A;  1FYK A;  1H0M A;  1GVJ A;  3R61 A;  3MFK A;  4GO1 A;  4AD9 A;  5CJ9 A;  1IRG A;  4HV6 A;  2FU4 A;  2C6Y A;  3I54 A;  2FQ3 A;  2ZJ2 A;  4LB5 A;  1P4W A;  4CIC A;  3GVA A;  4MQV A;  3N4M A;  3HRU A;  1BBY A;  5HDK A;  4IF4 A;  3TQN A;  4B09 A;  1YLF A;  1SFE A;  1FSE A;  3HHH A;  1Z05 A;  2HQN A;  3PQJ A;  2EV0 A;  3BWG A;  2XAH A;  1FP2 A;  4HLX A;  1HBX G;  3M8F A;  4HLY A;  4M9S A;  5ICF A;  4RS8 A;  4KYW A;  2HEO A;  2STW A;  3K1M A;  5FFZ A;  2DQR A;  2LSO A;  5HVQ C;  3J7A O;  5D5X B;  3SQN A;  4A6D A;  1P4X A;  3ZQ7 A;  6PAX A;  1BIA A;  2PBI A;  2XUB A;  1XGM A;  2M8E A;  3WTT C;  5EEG A;  2AS5 F;  2DW4 A;  2TDX A;  2Y75 A;  3IRQ A;  3ZMS A;  3F6O A;  2R7F A;  1HKQ A;  1FPQ A;  3FXQ A;  3BDD A; 
#chains in the Genus database with same CATH topology
 1XN7 A;  1WJA A;  2PJR A;  3C7J A;  2ESH A;  3OYI A;  1ZK8 A;  2H09 A;  1VQ6 I;  2R92 J;  2RV8 A;  3O8H A;  3S2D J;  4DNC A;  2EZL A;  3JRA A;  3MKY B;  1R00 A;  3R4K A;  1RUN A;  3TED A;  1Z77 A;  4DZJ A;  4IHT A;  3PL8 A;  2O5R A;  2PJR B;  2JA7 J;  3ZMT A;  3L2R A;  4PGH A;  1ZTR A;  1RZ4 A;  1Z7U A;  4A3F J;  2EK5 A;  1VQL I;  3GTP J;  4XOP A;  1CF7 A;  1TQP A;  4JX4 A;  4BXX J;  3WTS C;  1U9O A;  4RB1 A;  2MD0 A;  2VOD A;  1APL C;  2PMZ N;  2RNJ A;  3LSM A;  2E60 A;  2WC2 A;  4XKC A;  4ITV A;  2TCT A;  2UXX A;  2LC2 A;  2QQ9 A;  3SFZ A;  2MLK A;  3IH3 A;  4L9N A;  1ZEL A;  3LSG A;  1V55 H;  3ZMV A;  1CF7 B;  2XAQ A;  2GZW A;  4LLG F;  4II2 A;  4DW6 A;  3AKZ A;  3BJA A;  3IV5 A;  5CQG A;  3UKG A;  2GAU A;  4A3L J;  5B66 C;  2ETH A;  1I50 J;  4MGR A;  2WA0 A;  3WTU C;  1Z21 A;  2JA5 J;  2RQQ A;  3BT9 A;  4XLH A;  2BHY A;  2OA4 A;  2P7C B;  1BA5 A;  4Z2Y A;  4DBR A;  2Q2E A;  4QTR A;  1RET A;  4HF2 A;  3HRM A;  5E1W A;  4LIU A;  5CQE A;  3J7Z I;  2V9P A;  3BG7 A;  4BU2 A;  2P0W A;  3IUO A;  1ON2 A;  2K3P A;  1K79 A;  1OMI A;  3SEZ A;  5DV5 A;  1QGP A;  1XG1 A;  3ISP A;  3MVP A;  1QPI A;  2X4H A;  3RCO A;  4KDP A;  2AHQ A;  1ETX A;  1JUP A;  5E3O A;  2Q2E B;  1K78 A;  4G7H F;  1I6X A;  4BQA A;  3QP6 A;  3H3U A;  1X19 A;  1J75 A;  2K3F A;  3C18 A;  3LAP A;  1J9I A;  4HQM A;  3ML6 A;  3GYH X;  3GLL A;  4XRF A;  4QSH A;  1KU3 A;  2F5F A;  4BUP A;  3MZY A;  1BC7 C;  2FSW A;  2QSG X;  4D5C A;  5E1Z B;  2DCE A;  1F4K A;  3FZV A;  2CW7 A;  1K78 B;  3J81 K;  3PUF A;  2KKO A;  2DFH A;  2KP6 A;  1WJ5 A;  1R1T A;  3U1K A;  1LB2 A;  1LPQ A;  2Z3Y A;  4XLA A;  3CTA A;  4BHC A;  1IXS B;  5LRS A;  2H8W A;  1MND A;  3V8J A;  1D1A A;  2IGN A;  3DP7 A;  2LKP A;  2MFZ A;  5BNG A;  4Z6Y A;  1N25 A;  3IC7 A;  2YPR A;  3OMY A;  3T0Y A;  1P2F A;  1UHM A;  4ESF A;  2JPB A;  1P4A A;  4NHJ A;  4XKV A;  1X3Z B;  4JX5 A;  4D7M A;  3K4B A;  2OUM A;  3TP0 A;  5JI6 A;  4MTD A;  3GTJ J;  1PP7 U;  5FRM A;  4BQO A;  3E6C C;  3L9F A;  1FMW A;  3ZMZ A;  1FIA A;  3EQL F;  2DJI A;  2QEX I;  1F5T A;  1G3S A;  5HLI A;  2ZXH A;  4YEL A;  2M45 A;  3LAJ A;  4XRS G;  3KP7 A;  5C44 J;  1ZRF A;  1YX3 A;  2X1D A;  1I5Z A;  1P7J A;  4XN0 A;  2HVR A;  4Q4Z F;  1SD4 A;  4MNU A;  2PMZ A;  1UEL B;  2VB6 A;  3BR3 A;  2OPT A;  1FC3 A;  3OOP A;  3K4M A;  4G9Y A;  2RC4 A;  4KFC A;  3X2Q H;  1E17 A;  1OYW A;  2DT7 B;  4RAZ A;  2ZJP F;  5FJ8 J;  3KZY A;  2ZJQ F;  3WOD F;  3M1C A;  3L7W A;  2BXZ A;  1OKR A;  4M73 A;  3V8K A;  4H0E A;  3RI4 A;  1R5H A;  2F5C A;  2ZNY A;  3T5X A;  5M5X J;  2V9K A;  3QYB A;  2HYG D;  4BS9 A;  3JAM Z;  3A01 A;  3ECO A;  3KP3 A;  2EWN A;  1UJ8 A;  1H88 C;  3MD2 A;  1FTT A;  2EA4 A;  4JOM A;  5EZH A;  1PYV A;  2M4K A;  3AG2 H;  2UV1 A;  4IVN A;  5JFR A;  4CGZ A;  4BAC A;  5L3B A;  1BR2 A;  1YOV B;  4AIH A;  3OV8 A;  3KFW X;  5H2F C;  3A01 B;  4L18 B;  2P4W A;  2F5D A;  2KJC A;  3S8P A;  4O6J A;  4CDG A;  1BI1 A;  1EF4 A;  2HGC A;  1WJE A;  1QRY A;  4HF1 A;  1KYZ A;  4RLQ A;  4S0H B;  3VYR B;  2XGX A;  4F3Q A;  5J1U A;  2BXY A;  2IGM A;  4ZZD A;  3CCS I;  4CCK A;  2DI3 A;  1D5Y A;  3S3M A;  3KYD B;  1REP C;  1R9T J;  4Y3O A;  5LGN A;  4OMY A;  4RM2 A;  3RKQ A;  4N9I A;  5D6F A;  2CUZ A;  2QQ8 A;  3I5U A;  1R5I D;  3H5R A;  3ZR8 X;  2NS0 A;  3REO A;  1RKW A;  1P7I A;  2R4G A;  2WV0 A;  3ZQG A;  3SDB A;  3CJQ B;  2VE8 A;  1WPK A;  3CCJ I;  3CMY A;  2OZ6 A;  3E5X A;  3KE2 A;  4A2U A;  1S5L C;  2CO5 A;  2XB5 A;  4NNJ A;  2HDC A;  3QYE A;  3PQK A;  1QVU A;  3G1O A;  3GUD A;  1OYY A;  5J6X A;  2W48 A;  4M71 A;  2RKH A;  5D5V B;  3BR5 A;  1A31 A;  4I02 A;  2L4A A;  4AWX B;  1Z67 A;  5EZG A;  3H9G A;  2KFD A;  3JTH A;  3GX4 X;  1NH3 A;  3DBR B;  3ZQF A;  3HSE A;  5L3C A;  1RPW A;  4ZYG A;  1YQA A;  1R49 A;  2O9L A;  3GLX A;  1JHF A;  4BE0 A;  1WSU A;  3VWB A;  4G8X A;  2DFI A;  2Y2Z A;  1ZR2 A;  3ZQI A;  2XB0 X;  2GA1 A;  4P96 A;  4XOT A;  3G4S I;  2DK8 A;  4EM2 A;  3BTJ A;  4ABZ A;  4AM3 A;  2OAZ A;  4P55 A;  3MWM A;  5E8I A;  1OPC A;  4IZZ A;  5KHD A;  3A02 A;  3PO3 J;  5E17 F;  2JMW A;  1T2K A;  1X1A A;  3FWE A;  2NNN A;  3EDP A;  2EQR A;  3NEU A;  1G59 A;  1MH3 A;  1SFX A;  2E2J J;  1OIS A;  1TLH B;  3CZ6 A;  3R0A A;  5E20 A;  2HNH A;  2JJ7 A;  3EET A;  5M5Y J;  2MC3 A;  2X9D A;  2DFE A;  1XC5 A;  1XMX A;  3TKY A;  3FXO A;  1XSD A;  4MLO A;  3E97 A;  4V19 K;  1SD7 A;  4PCQ A;  1BC8 C;  3QPL A;  1YE9 A;  1BR1 A;  3OYJ A;  4HZF A;  1F36 A;  4A12 A;  3IAS 2;  4D5F A;  1W5C C;  5DM7 F;  1YFH A;  1ETQ A;  4M74 A;  3ZXS A;  3W6K B;  5L3F A;  3FXM A;  2ZXI A;  4IX7 A;  1VFC A;  1EH7 A;  2GIV A;  4LD5 A;  4LLL A;  3GCM A;  4E7I A;  3S2W A;  4E6K G;  4UUT A;  2EFO A;  4PFP A;  2NRA C;  1SVL A;  4OOI A;  4EQQ A;  1HDD C;  2HOE A;  2CGP A;  1T6S A;  1UG2 A;  3PSF A;  1H89 C;  4KT6 A;  5FGM A;  1SVO A;  3C2B A;  4YRV A;  4G94 A;  3RPU D;  2HKO A;  4NDL A;  2WAQ N;  5K5R A;  2R7T A;  1B1B A;  3FBN B;  2FMY A;  3V7C A;  4ZYH A;  4DGW B;  2CV1 A;  3DBL B;  2V1D A;  4LJZ F;  3MKZ A;  2L01 A;  5D5U B;  4GYI A;  2L02 A;  2E5N A;  3LSK A;  1R6R A;  1KON A;  3DLA A;  1RI7 A;  2XKO A;  3BOQ A;  2EB7 A;  4B3X A;  1AU7 A;  1GLN A;  2CYY A;  5HLT A;  1LFU P;  3HZJ A;  3I71 A;  2GWR A;  3EUH C;  1LQ1 A;  3JR9 A;  4I09 A;  2BEO A;  1GHC A;  1JT6 A;  3OS2 A;  1ZRD A;  4KT5 C;  5FKM A;  1SD5 A;  3SEQ A;  1OCO H;  2Y30 A;  3KPH A;  2G9W A;  1J59 A;  1V3F A;  1TTY A;  3I64 A;  1C0W A;  4C3J J;  2JA8 J;  1LEB A;  1A5J A;  4MTE A;  1NG6 A;  2R7V A;  3KEY A;  3LSH A;  2MLG A;  5LFA A;  4FTH A;  1SFK A;  2EFW A;  4IHW A;  1IXR C;  4YFK F;  4RB0 A;  3DPU A;  3S17 J;  3SZP A;  2CUJ A;  1FOY A;  3RKX A;  3WTW C;  1FMV A;  1KQ8 A;  1FOK A;  3QOE A;  4V2G A;  4MQ9 F;  2FUG 2;  1HLV A;  2KRC A;  2RGV A;  3J80 K;  5DCM A;  2IJL A;  2ZJR F;  3VOE A;  3P7N A;  5KAI C;  2KZV A;  3CDH A;  3M8J A;  3OL3 A;  1BOA A;  5J4Y A;  3HOS A;  2MYS A;  4RAF A;  3BG5 A;  3H0D A;  4W97 A;  1UHW A;  4XOR A;  5GAD J;  1IF1 A;  1RR7 A;  3JRH A;  5BQT A;  2GXG A;  1ZG3 A;  2DO7 A;  4M6X A;  2A69 F;  1FIP A;  1IXC A;  5DCM B;  2BBY A;  2VT2 A;  4AIK A;  2M0C A;  1WI9 A;  2ZXJ A;  3E5Q A;  3SZT A;  2R7D A;  4JBA A;  3FKJ A;  3V7S A;  2GBY A;  3I58 A;  2I8D A;  1V5E A;  2KZG A;  4PJJ A;  4RB2 C;  5H6Q A;  1R5G A;  2CU7 A;  3GME A;  2OBP A;  2M30 A;  1SAU A;  3H1C A;  3M1E A;  5DTD A;  3WGH A;  2Y9Y A;  2VT3 A;  1YJN I;  3ABT A;  4XKB A;  3GWZ A;  2ID3 A;  3GZ5 A;  2EFN A;  3N97 A;  2K5C A;  3K4K A;  2XDV A;  2DT6 A;  2LRE A;  3MAJ A;  2VE9 A;  3HOV J;  2ZME A;  2M7A A;  1A36 A;  2AQF A;  2P5K A;  3H36 A;  2WAD A;  3BPV A;  2CQ7 A;  1ZN2 A;  3LA7 A;  1D0Y A;  1MMD A;  2K9L A;  3D1N I;  3H35 A;  2HPI A;  2MGQ A;  2VXZ A;  1OCP A;  3HIF A;  2R5Y A;  1YS7 A;  4U87 A;  2WAQ A;  4HX8 A;  5M5W J;  2LY1 A;  3F72 A;  2E1C A;  3H92 A;  1R1U A;  1U2W A;  1ZG5 A;  9ANT A;  1YW8 A;  4FX0 A;  3ZMU A;  4Y4R A;  3WE2 A;  1HSJ A;  1ODD A;  4E7Z A;  2R5Y B;  1Y39 A;  2IPQ X;  3BQZ A;  2WWY A;  4WWC A;  3ELK A;  3GTQ J;  1OCT C;  4YIF A;  1RUO A;  2W1O A;  4BE1 A;  2HKX A;  4HNU A;  3LSJ A;  2XAF A;  2DOF A;  2VBY A;  2IS4 A;  2LFB A;  5CLS A;  4ESB A;  2LK2 A;  4LGW A;  2K02 A;  4B3A A;  2GA2 A;  3BG9 A;  3WGG A;  4UVB A;  3IP4 B;  3RZD J;  1IG7 A;  3CCY A;  3JW4 A;  3OYK A;  1VQM I;  1D0X A;  2LF7 A;  1HOM A;  1UG0 A;  1WQ2 A;  1LEA A;  1TWH J;  1A04 A;  1JKO C;  4RDU A;  3FIW A;  3W2V A;  3PFY A;  1K4T A;  3GW2 A;  3S15 J;  2O03 A;  2ISZ A;  1LVA A;  4BEH A;  4KIG A;  2DOA A;  4HST A;  4XK4 A;  2OF7 A;  3PUB A;  3KCC A;  3OSF A;  2GM4 A;  4HDU A;  1ZLK A;  5LRR A;  1B4A A;  2OZU A;  1X58 A;  4L5I A;  5HNF A;  4MO7 A;  1UCR A;  1U8R A;  1JE8 A;  2X6O A;  4BEH B;  4XMY A;  2JUC A;  4XIC A;  3DPT A;  2RDP A;  3OR2 C;  3AG4 H;  1W5T A;  3HSR A;  2H1L A;  4L9J A;  1W1W E;  3PNY A;  3T8R A;  3VDX A;  4RGS A;  3H3V K;  4I7H A;  4FT8 A;  5CKT A;  1H8A C;  2LKS A;  5D5W B;  3I55 I;  1D0Z A;  2VKV A;  2A61 A;  1I39 A;  2Z5U A;  2CFX A;  1X1B A;  2F5E A;  1PDN C;  2HDD A;  1TP4 A;  1OJL A;  3QQA A;  3SJM A;  2HOS A;  4EGZ A;  4A3B J;  4HOB A;  3ZP5 A;  4EAT A;  4U7D A;  4U7B A;  1QPM A;  3WTV C;  1X3U A;  1O3T A;  1HF0 A;  3UNG C;  2Z99 A;  1T56 A;  1Y8Q B;  4JX6 A;  1MNM C;  1STZ A;  4G7O F;  4MEX F;  3C3W A;  3IRR A;  2UWM A;  2FQ4 A;  2P6T A;  2QM3 A;  3HPH A;  2K9S A;  3QPS A;  3VB2 A;  3V42 A;  4ANJ A;  2FOK A;  2LD5 A;  1O7L A;  3G1L A;  4KIC A;  4A3C J;  3BP8 A;  2E36 A;  3QAH A;  2E1O A;  2NVQ J;  4F7Z A;  4OIN F;  1T0F C;  4Y15 A;  3MN2 A;  3SHF A;  4RA2 A;  1ZH5 A;  2J5O A;  3CC7 I;  4J19 A;  4XBF A;  2FX0 A;  2A6T A;  4F92 B;  1ENH A;  5FRO A;  2OTL I;  2XGE A;  4UVC A;  3HM5 A;  5ICE A;  4QPQ A;  2GXB A;  1B9N A;  2ID6 A;  3CME I;  1TT5 B;  5AIP A;  4LMY A;  1UFM A;  4BHP A;  3DEE A;  3FHN A;  2F48 A;  4BH9 A;  2YS9 A;  4EEF G;  3VEP A;  3E5U A;  2G7H A;  1KQ9 A;  4NC6 A;  2W85 A;  1FLI A;  3TGN A;  2EPF A;  3D5L A;  4WF2 A;  2O8X A;  4HAM A;  2AQE A;  4L9T A;  2HDW A;  3QU3 A;  3S1N J;  3FMQ A;  2FNA A;  3DBH B;  3CCR I;  1T33 A;  1H9G A;  2FXA A;  2LVS A;  4X6A J;  3RTR A;  3RQI A;  5E18 F;  4WX9 A;  2LY9 A;  2R7O A;  4RAG A;  2F6C A;  3T8T A;  1RR8 C;  4NQW A;  3DU5 A;  1JJ8 C;  2EIN H;  4IXA A;  5TGT A;  2DMP A;  3TOB A;  2F4I A;  2K7L A;  4HEA 2;  2VKD A;  1QVT A;  5HNH A;  2IW5 A;  2DA1 A;  2XAJ A;  3CCM I;  4JYK A;  4HG2 A;  4XKW A;  4XL9 A;  4AVP A;  5D4R A;  4C2T A;  3J7A Y;  3A0H C;  5DM6 F;  1FP1 D;  1S7O A;  4A3D J;  3K10 A;  4S04 A;  5EJC A;  1G3T A;  4NQW B;  3K4C A;  4KA4 A;  3ZN0 A;  4TV7 A;  3GO5 A;  1DGR M;  1PVE A;  2OC6 A;  5D6E A;  3OIP A;  4GXO A;  1W4M A;  5F04 A;  5EEH A;  3SDG A;  3K4L A;  4IEJ A;  4WCG A;  1I1S A;  1XGO A;  1J0R A;  3TDU C;  2L9R A;  3H5A A;  1IRZ A;  2RAE A;  4HPQ A;  2RNG A;  2QBY A;  5KK1 A;  4A0X A;  4GGG A;  2I10 A;  2XKP A;  2J5P A;  5ILU A;  3JSO A;  4OMZ A;  4X1E A;  4BXU A;  1K83 J;  2XC7 A;  2VL8 A;  2XRO A;  3CUQ C;  4CZZ A;  2L9V A;  2H1K A;  1K7A A;  1Q1H A;  3R0J A;  2QYO A;  3RPU A;  4KIS A;  4JQF A;  1IRF A;  1IRX A;  3K4N A;  1ONV A;  4N4O B;  4BY1 J;  3S3N A;  2IAI A;  2IXS A;  2R7W A;  2XAU A;  4LFU A;  4I6Z A;  1W7P D;  3ULQ B;  3GF2 A;  3BZ6 A;  1VQO I;  1WH7 A;  3HOX J;  3FIS A;  3BTI A;  1MBK A;  1QZY A;  4MFD A;  2HOT A;  4AC0 A;  2ELJ A;  2EZI A;  1XTA A;  1ACI A;  3HC7 A;  4I2O A;  2L5Q A;  2Y48 A;  3JRF A;  4EGY A;  1JGG A;  3JAM K;  3H9Q A;  2VJJ A;  3PIP F;  2NNY A;  4IHX A;  2XV4 S;  5IP6 A;  2FJ1 A;  1DUX C;  2NYX A;  3LSP A;  1RC9 A;  3S32 A;  1VQ9 I;  1YIT I;  3CDI A;  1XD7 A;  2IP2 A;  2O7O A;  2VIX A;  3ASO H;  4G7Z F;  3OSG A;  3KEQ A;  1Z0X A;  1SMY F;  2LR8 A;  1MJA A;  3U1D A;  4OU0 A;  1WJC A;  3M8E A;  4A3G J;  3HEF A;  1JGS A;  1S72 I;  2V79 A;  1YW7 A;  1ULY A;  4ZYE A;  2W7N A;  1VTN C;  2WV1 A;  1RKT A;  4PZJ A;  1RNL A;  4FQG A;  3WG9 A;  4N0B A;  1BI3 A;  4EV0 A;  2MH9 A;  1TQI A;  2MBF A;  4AVZ A;  4QLC U;  1HKT A;  4A6E A;  5H6R A;  4AUX A;  2LBF A;  2M5W A;  2FBI A;  1KA8 A;  4E7K A;  2CQQ A;  3AG1 H;  3CJT B;  4I76 A;  4OIO F;  2DDA A;  1YS6 A;  3V8L A;  3JSP A;  1P9Q C;  2ME0 A;  5ICG A;  3A2K A;  1RRJ A;  4CXF A;  1AWC A;  2W25 A;  5DD4 A;  4MIM A;  1TNT A;  4GYG A;  2W24 A;  4RGU A;  1OFC X;  1MIJ A;  2OTJ I;  3RYP A;  1TWC J;  2QVO A;  2JK3 A;  3A4C A;  1P6R A;  2LBF B;  4HW0 A;  4A0Y A;  3OYM A;  3KP4 A;  1T39 A;  5JVG F;  4ZTF A;  1MMS A;  3E7L A;  2NOG A;  3TMO A;  2W00 A;  1FOW A;  2EV5 A;  3HOU J;  3I59 A;  2LF8 A;  2LH9 A;  3OS1 A;  2KIQ A;  1I3A A;  4M3G A;  3ECH A;  5TRD A;  3FHZ A;  4KIT B;  4AID A;  1WZ2 A;  3IH2 A;  3O8G A;  2A6H F;  1R22 A;  2VN2 A;  2VLA A;  1N77 A;  1B72 A;  5C4X J;  3HKZ N;  4UHT A;  1ZGA A;  3VSK A;  1HW5 A;  5FLX K;  2M3A A;  4XLF A;  2E1M B;  1MSE C;  3KP5 A;  2YSR A;  1DQU A;  1OQY A;  3CD6 I;  3NRV A;  2L0K A;  3I59 B;  5ED4 A;  5DDG A;  1YO5 C;  1LE8 A;  3OYB A;  2XF5 A;  1DPR A;  5IT9 K;  4RAY A;  4IQ4 A;  2OQR A;  3NWT A;  4L5J A;  4IL6 C;  3OL4 A;  2A6E F;  2MA3 A;  3G71 I;  1B72 B;  1CQT A;  4ZH4 F;  4ZYD A;  4W1U A;  1QZZ A;  3GEZ A;  5IYC J;  2YUS A;  4KJZ A;  2YR2 A;  3QYF A;  2ELK A;  1ERD A;  4OIR F;  2K9N A;  1IN8 A;  3IH4 A;  1T98 A;  2LRD A;  1KGS A;  2KDZ A;  1LE8 B;  3NWS A;  3G73 A;  2PN6 A;  2JRT A;  2WY8 Q;  3OIQ A;  2V4J C;  5K5Q A;  2R7S A;  1VQK I;  3FM3 A;  4CCN A;  1WVR A;  2CH0 A;  2E71 A;  5JVT A;  1LJ9 A;  3BPX A;  3S2H J;  2R7X A;  3FMS A;  2HFH A;  2DA6 A;  2X1E A;  1ETO A;  3IKV A;  2CJJ A;  1H9T A;  5LD2 C;  5FD5 A;  2EJR A;  2LG4 A;  2CUF A;  5CVU A;  2E35 A;  3LSR A;  3CMA I;  3WU1 B;  1B59 A;  3IKT A;  2QKM B;  2MAB A;  2XRN A;  3LFK A;  5D8K B;  3P5J A;  4Y17 A;  1K6O A;  4OIQ F;  1U5T C;  3AG3 H;  1BJA A;  3I4P A;  2D1V A;  2WB1 N;  3K2A A;  3L1P A;  5DCF A;  2VJI A;  2WTE A;  2FF4 A;  2DA7 A;  2FEZ A;  3QOP A;  1LUJ B;  4CCO A;  1HW2 A;  4UY8 I;  5BS6 A;  2M4G A;  2P5V A;  5F6F A;  4ZDL A;  3KYC B;  1S3J A;  2COB A;  3JRB A;  2VJ5 A;  1S6L A;  3HXL A;  1HQC A;  3S3O A;  3CC2 I;  2A68 F;  1TBX A;  1ZAO A;  2E1N A;  2X0L A;  1JHH A;  4WK8 F;  1BW6 A;  5M3M J;  3S1Q J;  2JRM A;  1IGN A;  4A3K J;  3MCZ A;  1T38 A;  5F1R A;  2A3S A;  3H3Z A;  1TW2 A;  1AOY A;  1U0J A;  4KIF A;  5B3S H;  2PI0 A;  4B48 A;  3CF2 A;  4NUB A;  3KIO A;  2V1N A;  2E7W A;  1G4D A;  5FKL A;  4KUM A;  1HW1 A;  4EJO A;  3HHG A;  1X4P A;  1FT9 A;  1WKM A;  3CES A;  3KX2 A;  3OYL A;  1K61 A;  1WCM J;  3DTE A;  4O5V A;  4UB6 C;  3BJO A;  4FHT A;  3OYF A;  5B1A H;  4U0V A;  1J7K A;  5FLV A;  4IOA F;  2X6Y A;  1O57 A;  1ZQ3 P;  2HQA A;  2GOM A;  3QU6 A;  1IW7 F;  4CO8 A;  1F9N A;  2ESN A;  4ZTJ A;  1LDJ A;  1W0U A;  3QP5 A;  1E0E A;  4ENM A;  1LFP A;  3HYI A;  5DS9 A;  4CYC A;  3ERE D;  1D8J A;  1HXD A;  5E8G A;  3CCL I;  2M87 A;  4UNO A;  1I3Q J;  1FWZ A;  3ZN1 A;  5IYD J;  1ETY A;  4BDZ A;  3BG6 A;  5FRN A;  5J40 A;  4BXF A;  2QZ8 A;  2LNB A;  2FBH A;  3W2W A;  2BW3 A;  2BY1 A;  2X6W A;  3K1N A;  3SZG A;  2CRG A;  2KIM A;  2VBW A;  4M3E A;  4C2M J;  1VQ7 I;  3ZPL A;  1Y56 A;  3F8F A;  1TT0 A;  3LA3 A;  4CYC B;  3JCU C;  1LNW A;  2V7F A;  3DKY A;  3GXO A;  1J2X A;  4CSW A;  1YX5 A;  3FXJ A;  2DOD A;  4X0G A;  1GV5 A;  2DYS H;  4R1H A;  3JRD A;  3Q9V A;  2BW3 B;  3FX3 A;  2F4M B;  3OYA A;  1DGW Y;  2DAO A;  4F91 B;  4PJL A;  3TBI A;  3O6B B;  2PEX A;  5FD6 A;  3L2Q A;  1IUY A;  3ERM A;  4JP0 A;  2STT A;  2HU9 A;  1S8N A;  4ON0 A;  2DMN A;  3I0T A;  4F55 A;  4DYQ A;  3B02 A;  1XDU A;  4A3J J;  2VBZ A;  3EUH A;  1JXS A;  1MDM A;  2WB1 A;  5FB2 A;  2GXA A;  3H9J A;  3AL0 B;  4C3H J;  2DA3 A;  2K85 A;  2DTR A;  3E1S A;  1KZH A;  4Y7N J;  3HJE A;  5IP9 J;  2O0Y A;  5DYM A;  4GRI A;  3DFG A;  1MJB A;  2DA5 A;  4Y33 A;  1OLT A;  1MBE A;  1SD6 A;  3GFL A;  2K4B A;  3GZ6 A;  4HX4 A;  4B1R A;  3HOW J;  1Y0N A;  1IAW A;  1MDM B;  4CZC A;  2FBK A;  5HOD A;  1NK3 P;  2QLZ A;  4R8H A;  5IP7 J;  4A93 J;  3GTK J;  3PNV A;  1HC8 A;  1Y1V J;  1JUM A;  4P5O A;  5GAE J;  1I1G A;  5K1Y A;  3L2C A;  4ZC3 A;  1ZRC A;  2DU9 A;  5KCM A;  1U78 A;  1ZYR F;  1YIJ I;  3F21 A;  3BLY A;  2ELH A;  5ERI A;  1KU2 A;  2DTZ A;  4CHU A;  1XGS A;  2DK5 A;  3DU6 A;  1R1V A;  4D1Q A;  1QA6 A;  3C1D A;  1RIO H;  1IZ1 A;  2H6B A;  1XX5 A;  2IS1 A;  2E7X A;  4R79 A;  4EJV A;  2K40 A;  3WTZ A;  2M1B A;  1R58 A;  3ABM H;  1MZB A;  4DZP A;  1DDN A;  2KIU A;  4BAY A;  2W57 A;  4I0A A;  3EYY A;  5IOZ A;  5M3F J;  5IPA A;  3QPH A;  3CUO A;  1WGX A;  2Y0M A;  1W7P A;  5HS9 A;  3L2V A;  1Y8R B;  3ZRG A;  1ZG1 A;  5BPI A;  3ABL H;  1Y1W J;  5IT3 A;  3CQZ J;  4F93 B;  2CUE A;  2F2E A;  3JRC A;  1K4S A;  2PLY A;  3CDL A;  1W7P B;  2CFO A;  2X1C A;  2HQR A;  3P9C A;  4N4N B;  4BDY A;  1YRN A;  4Q5S F;  2V9V A;  4E7H A;  2VBX A;  2CW0 F;  4G6Q A;  3BC8 A;  4PK4 A;  3L09 A;  2KMU A;  3RKY A;  3VSL A;  3BCB A;  2IS2 A;  1QU3 A;  2HXO A;  3J7Y J;  2JA6 J;  4E7J A;  4G12 A;  4Y52 J;  1MBJ A;  2HS5 A;  3V4G A;  4HDV A;  1YRN B;  2KQR A;  1PUF A;  4ZDP A;  2R7R A;  2Y31 A;  1O3R A;  4A69 C;  2QA4 I;  4IHS A;  4YEJ A;  4CH7 A;  1SC7 A;  1W5S A;  1J5Y A;  3GFJ A;  4M9Z A;  4BL0 B;  4CCM A;  4HQE A;  3W3C A;  1XGN A;  1CGP A;  2ZME B;  5KVR A;  2A05 A;  2A5Y B;  1FBU A;  4LOC A;  4YII A;  3IHU A;  3HOY J;  3F3X A;  3JRG A;  3TO7 A;  3F8N A;  2CS3 A;  1PUF B;  4PDK A;  2XAG A;  3RYR A;  1U6G A;  3DPL C;  4DJA A;  3ABU A;  3Q0U A;  2K86 A;  2ZSI B;  1WRJ A;  1XMA A;  2PX9 A;  4AYB N;  1B6A A;  1IC8 A;  2VUM J;  4OAY A;  5BPD A;  3P9I A;  1MMG A;  2G0E A;  3KLN A;  2Q8K A;  3FK7 A;  3FK6 A;  1SFU A;  3I4M J;  1IN7 A;  3CJN A;  3LMM A;  1X4O A;  5DUI A;  2UXN A;  1WJD A;  3U2R A;  1JTY A;  2G7U A;  4NC7 A;  4I99 C;  5EGO A;  3BRO A;  1N75 A;  1IN6 A;  5LLQ A;  4M3D A;  3HPG A;  3F8B A;  4I98 B;  2FNP A;  1JKQ C;  5J3L A;  1IUF A;  2DYR H;  3L00 A;  3A03 A;  4EJT A;  2KIF A;  5LHG A;  1D8K A;  3FBI B;  4A5N A;  2DQL A;  4CUG A;  5A2Q Z;  4J01 A;  2ZKZ A;  3G1M A;  4DQ2 A;  2N8G A;  3FXL A;  5DD8 A;  2Y0S N;  3MKW B;  4LK1 F;  2JA2 A;  4UUV A;  4OIP F;  1MW7 A;  3AFH A;  4HRI A;  3S93 A;  2D1H A;  1VND A;  2Q1Z B;  1MSF C;  2AXL A;  2QQA A;  1QBJ A;  1USS A;  2CSO A;  1D5V A;  1ZR4 A;  4II3 A;  1ETK A;  2VKE A;  4D7N A;  2QWW A;  3RJP A;  2W4S A;  3ASN H;  1G8X A;  1FSH A;  3GFI A;  2YU3 A;  5F27 A;  1OR7 C;  3MKL A;  4PFO A;  4C3I J;  3VOD A;  3LST A;  2LYC A;  2LY2 A;  3LWF A;  3TL4 X;  2XSD C;  2NVX J;  2NVT J;  2L7K A;  3IAM 2;  4IO9 F;  2B63 J;  2EIK H;  1Z9C A;  1P92 A;  2P7V B;  2BHZ A;  5AON A;  4BJ6 C;  2VQH A;  1ETV A;  3K0L A;  5E3M A;  1YYV A;  5F1J A;  2WY7 Q;  2HR3 A;  5ICC A;  1T0F A;  2L3D A;  4BJ5 C;  4KN4 X;  2KLO A;  4U0Y A;  2DMQ A;  2R3S A;  3I3L A;  3G6E I;  3F8C A;  1QHG A;  3IWZ A;  2VQC A;  3HSF A;  1UB9 A;  1JKR C;  1QNT A;  2Z9O A;  2B9S A;  2QKL B;  2GIZ A;  2VJ4 A;  1D3Y A;  4XNF A;  4B8X A;  3RKW A;  4EVI A;  1FZP B;  2ZSH B;  4HA8 A;  5KNL A;  2BVL A;  4LLN A;  2D2W A;  2IA2 A;  2EFP A;  2R5Z A;  2MW8 A;  5EDN A;  1FYM A;  4AYB A;  2O61 A;  4UXN A;  2FML A;  1R7J A;  2L54 A;  2VOP A;  3I4N J;  1ZAR A;  2MD5 A;  3O3K A;  2BVM A;  3FMR A;  3BY6 A;  2Z16 A;  2UZK A;  1GXQ A;  2OJE D;  4GFB A;  2LMD A;  4JK1 X;  2A07 F;  2R5Z B;  3DV8 A;  4Y13 A;  5HOO A;  1Z3X A;  3BTC A;  1V5G A;  2IBD A;  3LFU A;  3HUG A;  2KJB A;  4QPO A;  4MHG A;  1F1Z A;  3HOZ J;  3W6J B;  5LGT A;  1VI0 A;  4FIS A;  2L4M A;  1G3W A;  4BQN A;  3FF5 A;  2ICW G;  4PJN A;  1SMT A;  3HGG A;  3KYL A;  2IRF G;  4FE7 A;  2QSF X;  3MEX A;  5ILS A;  1FOX A;  3HUG B;  1G6N A;  4G6T B;  3OS0 A;  3GTG J;  4PJM A;  3DXJ F;  2HTJ A;  2IA1 A;  1FTZ A;  2BZT A;  3OR1 C;  1BI2 A;  2CG4 A;  4RMN A;  2GLO A;  2OCE A;  4M72 A;  3CJR B;  1IJW C;  3K7A J;  4UB8 C;  4BBS J;  3KP2 A;  2XGD A;  1U8B A;  2FA5 A;  3BCA A;  4ENK A;  3EUK L;  5F08 A;  4KIB A;  3O2P E;  1FEX A;  1IDZ A;  4XN3 A;  2Y9Z A;  5GAG J;  3HRS A;  1V54 H;  2LOO A;  3K2Z A;  2BOL A;  3HBL A;  3CUQ A;  4XID A;  4IQJ A;  3RQ4 A;  3HRT A;  5B1B H;  1HA8 A;  1GXP A;  2EA2 A;  2JT1 A;  2L7Z A;  3RZO J;  5F0F A;  1SFO J;  1TQM A;  2DOE A;  3VPR A;  2KL4 A;  1TC3 C;  1DP3 A;  5LBQ A;  2YX7 A;  3GZN B;  1BI0 A;  5E3L A;  2VXD A;  3ZQH A;  3CUQ B;  2PMH A;  3K70 D;  4BE2 A;  3BR6 A;  4L9V A;  4ZDO A;  2WAF A;  3OYH A;  2EH3 A;  1MGT A;  1A6I A;  1QQI A;  1KQ0 A;  1Y6I A;  2V6E A;  5BMZ A;  3I9V 2;  3E6D A;  4A5M A;  5EF6 A;  5F0H A;  1JJ6 C;  2L7M P;  4IJA A;  2AO9 A;  4LG3 A;  3OOU A;  4EM1 A;  2QBY B;  2HQ5 A;  3TO6 A;  4BQQ A;  4Q47 A;  2KRF A;  4AIJ A;  4OWR B;  4DYR A;  4NB5 A;  4IOC F;  1FJL A;  5LHH A;  2VC0 A;  4LK0 F;  2HWV A;  3B6A A;  3HTU A;  3CCU I;  4HX7 A;  4YFN F;  1O3S A;  2L7F P;  1IO2 A;  4BY7 J;  3VYU B;  1A6Q A;  4EM0 B;  1X1P A;  2R7Z J;  4PSW A;  3B73 A;  2DBB A;  3OYC A;  5K7F A;  4PUS A;  2JTV A;  4ZJZ A;  1AA7 A;  4IKF A;  2PJP A;  3K9T A;  1DPU A;  1O3Q A;  2KPM A;  3FXR A;  3C2H A;  1AHD P;  3W6V A;  3M4O J;  4M6Y A;  4XLE A;  2M2E A;  4HNV A;  3K6G A;  1WI3 A;  3LSI A;  1W36 C;  1FBQ A;  3ZMD A;  4D0P A;  4LIT A;  5LGU A;  2ZFU A;  2O6G E;  3A1Y A;  4EJU A;  1X2N A;  4WXD A;  3R6S A;  4EJW A;  3DKW A;  4E4H A;  4UVA A;  2R93 J;  2K4J A;  1D1C A;  2RN7 A;  2D5V A;  4BJT A;  2IEK A;  2JSP A;  2JVG A;  2DDB A;  2Z33 A;  2X51 A;  2CQK A;  2QCO A;  3CP2 A;  3ZGK A;  4NC8 A;  3OYG A;  1O4X A;  3S1R J;  2O8K A;  2NS7 A;  2D45 A;  3MZH A;  2ZB9 A;  1Z91 A;  3FKI J;  4FCY A;  3JRE A;  2V1U A;  1YJ9 I;  4ENN A;  1ON1 A;  3TOA A;  2HZD A;  3WU2 C;  3SXY A;  1YTY A;  2E19 A;  5EG0 A;  4B47 A;  2H8R A;  3BG3 A;  1ZHF A;  1GVD A;  1QZE A;  1KYW A;  3IWF A;  3V7R A;  2MH2 A;  4XR6 A;  2JUG A;  5F64 A;  3K1P A;  4A3I J;  2R7U A;  2E34 A;  2X6X A;  4P9U A;  1Z6R A;  3MQ0 A;  3WG7 H;  2M9H A;  1Y0U A;  2IS6 A;  3FXU A;  1R23 A;  1IV8 A;  1Z6T A;  5EG0 B;  3HGY A;  4KNY A;  4S05 A;  3BJ6 A;  3Q5F A;  1NHA A;  5JLX A;  2RVC A;  3CLO A;  2B0L A;  5LEJ A;  1BIB A;  3COA C;  4IHY A;  2HI3 A;  3TDZ C;  4RB3 C;  2DA4 A;  3KEO A;  4HYE A;  4DBQ A;  3FDY A;  3G3Z A;  4XRS A;  2NXN B;  3MMY B;  2L9N A;  4BGD A;  1WFX A;  5JR3 A;  2ACJ A;  4DYC A;  1V5F A;  3ONQ A;  4XLN F;  4L5E A;  4FE4 A;  2EZK A;  3OYN A;  2GQQ A;  4IHV A;  3WTX C;  5GPC A;  1GT0 C;  1I6H J;  1S29 A;  1XDS A;  1R36 A;  5TJJ A;  5GPA A;  2M7B A;  2XPV A;  2DLL A;  4DIQ A;  4CYD A;  3DEU A;  3QWL A;  5FO5 A;  5IOY A;  3EYI A;  3LQR A;  2E2I J;  1NK2 P;  3GFM A;  3U21 A;  3ZQQ A;  5IYB J;  2HVQ A;  2ZFW A;  4XQF A;  4UV8 A;  1QO0 D;  4LG0 A;  3Q3S A;  2E1M C;  1R4M B;  3LA2 A;  4M6V A;  1MBH A;  1IN5 A;  4E70 A;  1POG A;  1T95 A;  2PQ8 A;  5J1Y A;  5CYV A;  3JTG A;  3F0C A;  5L3D A;  3WHB A;  2QQB A;  1W0T A;  1L3L A;  3F22 A;  4BYY A;  2DPU A;  2HZT A;  1U5T A;  4ETS A;  2CMP A;  4LG0 B;  4MFE A;  3BZC A;  3Q0V A;  5DUK A;  2HYF A;  1KU9 A;  3LQQ A;  2DPD A;  2JPC A;  1BL0 A;  3LOC A;  2PFB A;  2KRH A;  1NTC A;  2QF7 A;  3G2B A;  3PFI A;  5L3G A;  1MD0 A;  5CVJ A;  4A3E J;  2XRL A;  1U5T B;  3M9A A;  3CF5 F;  1S9H A;  2UUZ A;  1G2H A;  1QHH D;  2Q0O A;  2RQP A;  5HLH A;  1UST A;  1MMA A;  3J81 Z;  1XCB A;  2FE3 A;  3ZQL A;  4BNC A;  1SEU A;  2O3F A;  2ECB A;  2ZXW H;  4J00 A;  3M3Y J;  3BTL A;  3E0J B;  3CO7 C;  3N05 A;  1MBG A;  3OYE A;  3CCV I;  1JT0 A;  1IDY A;  1OCC H;  3LL7 A;  4DOZ A;  2OV7 A;  3RPQ A;  2QUF A;  5HS7 A;  4G6D A;  1B9M A;  4LB6 B;  5CVR A;  3ZCO A;  2DMT A;  1VQ5 I;  2VC1 A;  5FFX A;  3T1B A;  3K4J A;  5F0C A;  3F23 A;  1WH5 A;  1ITY A;  3P9K A;  2ISY A;  5TIS C;  2A5W A;  4LIV A;  5K7H A;  1WJB A;  4ENJ A;  1J09 A;  2H94 A;  2RRE A;  2X85 A;  4YG2 F;  3S14 J;  3F6V A;  5C4J J;  2QEN A;  5CVV A;  1XSX A;  3HKZ A;  1YIO A;  3PO2 J;  3NAR A;  5CPR B;  1TWA J;  1XB4 A;  1T8I A;  1JI8 A;  1ZGJ A;  1LDK B;  4B44 A;  2OD5 A;  4K2E A;  2JN6 A;  4KN7 X;  4RLF A;  2CWE A;  5JLW A;  5J4V A;  2IGK A;  5FLX Z;  4C2U A;  1X1C A;  3IL2 A;  1BM9 A;  5AIQ A;  2FRH A;  1F43 A;  1T08 B;  1X2M A;  2DFF A;  4P9F A;  3WHC A;  2HYJ A;  3D5R C;  1Z7L A;  5IT9 Z;  1TWG J;  2VON A;  2WAE A;  2H6C A;  4HV5 A;  2W82 A;  3DCF A;  1Z1D A;  1ZGW A;  2XGC A;  1HST A;  3U9G A;  4YFX F;  1O7F A;  1L0O C;  2VAS A;  1YI2 I;  1PUE E;  2OU2 A;  3AAF A;  4HF0 A;  1D1B A;  1OYI A;  4E7L A;  2VPL A;  1DU6 A;  2ZCW A;  3GBG A;  3NAU A;  5BOX A;  5C3E J;  1Q1V A;  5FKO A;  2ZNZ A;  1ZLJ A;  3PIO F;  2GOX B;  3QRF F;  3KZZ A;  4RM3 A;  1VQN I;  1NG7 A;  2F4O B;  3TP3 A;  1TWF J;  3CP8 A;  3H0G J;  2DJN A;  3DLL F;  4V2F A;  1IV6 A;  1GDT A;  2VKH A;  2HVS A;  4XM3 A;  1FYL A;  2PMU A;  1E3P A;  5HDG A;  3ROU A;  4N9H A;  3L2W A;  3EUA A;  3WU0 A;  2B7E A;  1U9N A;  5FLM J;  3L2U A;  4IRH A;  2I5U A;  2NS8 A;  3PJR A;  3HL2 A;  2ME6 A;  2EIM H;  2ADU A;  3D0S A;  1BR4 A;  5K5O A;  1XPX A;  3VYT B;  1G3Y A;  2P5L C;  4KMF A;  5D4S A;  3E6M A;  2HXI A;  3CC4 I;  3OY9 A;  1EA3 A;  3QPT A;  1XMK A;  1SAN A;  2IVM A;  4EMS A;  3DEW A;  2YX4 A;  3I53 A;  1DP7 P;  1HKS A;  3TW6 A;  1JKP C;  3PSI A;  1YW9 A;  2BY3 A;  5J8C A;  1MKM A;  4BHB A;  1KU7 A;  2MG4 A;  3D5S C;  4XLC A;  2EFQ A;  1LKX A;  1W36 D;  4BBR J;  4PSX A;  4U0W A;  3EPZ A;  2VQL A;  4HNT A;  2EV6 A;  1MJ9 A;  1MNE A;  3AL0 C;  4M3F A;  4RGR A;  5J1R A;  1B8I A;  3FXK A;  4IPA A;  2NAZ A;  4BKX A;  2XF6 A;  4CCL A;  2XPW A;  2V6C A;  4IRI A;  3Q9S A;  3LNQ A;  1S7A A;  1FBS A;  2CW8 A;  5DEQ A;  1IN4 A;  4UUS A;  2XAS A;  2LKX A;  1VQP I;  1U3E M;  5E3N A;  1B8I B;  3WGI A;  4GCV A;  2Z1D A;  3K69 A;  4B43 A;  1FNN A;  4C30 A;  1XCV A;  2ECC A;  4IRG A;  2LTP A;  1GV2 A;  2P8T A;  3DWL E;  4UUS B;  3KP6 A;  5A2Q K;  3F8M A;  2ZO4 A;  3K70 C;  1ETW A;  3RDI A;  5HDN A;  4CCJ A;  1XS9 A;  1YG2 A;  5CVI A;  3KLO A;  1JTX A;  2JZY A;  5IY5 H;  3CO6 C;  4NBQ A;  1ZRE A;  2EIL H;  3WTY C;  3GTO J;  3NQO A;  2K9M A;  2M34 A;  4I0B A;  4RGX A;  5GTH C;  2P81 A;  1WWX A;  3OWT A;  1BN5 A;  5J8F A;  1EV7 A;  4UV9 A;  3KET A;  4HBL A;  1R71 A;  2PG4 A;  4AU7 A;  4QIW N;  5J47 A;  2XIG A;  3Q0W A;  2DT5 A;  2MSY A;  4XLP F;  2WBM A;  2DA2 A;  2VI6 A;  3FM5 A;  4F52 A;  1E2X A;  4C9Y A;  1GUU A;  2K9Q A;  3ZOB A;  3MZ8 A;  2JSC A;  1K6Y A;  1WJF A;  1EKE A;  3M07 A;  2HOA A;  2FOW A;  1MBF A;  4ZZL A;  2TRT A;  4FET A;  3B6C A;  2M8G X;  4PGG A;  3OIO A;  5LHI A;  1ZKG A;  4A3M J;  5JHU A;  3DQV C;  4E7S A;  1TW3 A;  1UAA A;  3HTS B;  1XSV A;  3VFZ A;  3I56 I;  1HCR A;  2HPM A;  1RES A;  4HSR A;  4ASN A;  1PP8 F;  3HDD A;  4XSX F;  1I27 A;  2HTS A;  2JWT A;  4I01 A;  1FX7 A;  1SAX A;  2IA0 A;  4L0Z B;  5L3E A;  2E2H J;  2H27 A;  5GAH J;  2XSJ C;  3DF8 A;  4XSZ F;  2XHK A;  1WHU A;  2P6S A;  5D8L B;  3CCQ I;  3HOT A;  2ZME C;  2XF7 A;  5H20 A;  3BZK A;  3QOD A;  1YHQ I;  2QSH X;  1VZ0 A;  1BOB A;  1DU0 A;  2JVH A;  2BV6 A;  2XVC A;  4PJ0 C;  2BGC A;  5FKN A;  2W84 A;  5KAF C;  1UZC A;  4KMU X;  2VOO A;  4U88 A;  2L2O A;  1EH6 A;  3ABK H;  5E1X A;  2F5V A;  4L0Y B;  4CA0 A;  2EZH A;  1MH4 A;  2BY2 A;  2K27 A;  5HLG A;  1TL8 A;  5B5E C;  5HS8 A;  3ZQC A;  4A0Z A;  4M9X A;  5GTI C;  3E3V A;  4Q48 A;  2BY0 A;  5EGO B;  4MEY F;  3ESW B;  4QWQ A;  4WXC A;  1FY7 A;  2BYV E;  1OR7 A;  5ILV A;  3TO9 A;  1UHS A;  3J80 Z;  4O3M A;  2V1X A;  2FD5 A;  1LVK A;  1EH8 A;  3BR0 A;  3BQY A;  1EJ9 A;  3R60 A;  1TNS A;  3E6B A;  2EBI A;  2COM A;  4RBO A;  2YU9 J;  2LDU A;  1LDD A;  3A0B C;  4ESJ A;  2Y69 H;  3SYT A;  3RIR A;  5LEK A;  2X48 A;  1V4R A;  2BE5 F;  3WE3 A;  4ZYA A;  2OQG A;  2NOJ B;  2XPU A;  4WXH A;  2NVY J;  3CLQ A;  2MC4 A;  1S7E A;  2IT0 A;  2ZBK A;  2AXT C;  4GDF A;  1VF9 A;  2DN0 A;  3HG9 A;  4B4C A;  3HB9 A;  4FX4 A;  2DXI A;  3SFI A;  3M7G A;  1FYK A;  1E3H A;  1H0M A;  1A35 A;  2LLK A;  1GVJ A;  2KHM A;  3R61 A;  3MFK A;  3H5N A;  3OYD A;  3F9K A;  4GO1 A;  4AD9 A;  1UMQ A;  2VQG A;  5EEA A;  2QGU A;  1JUS A;  1X1D A;  2IGO A;  1TZL A;  2EIJ H;  5CJ9 A;  1IRG A;  4HV6 A;  2FU4 A;  2OCC H;  3PM1 A;  3VYS B;  2C6Y A;  3I54 A;  5FKK A;  1BW5 A;  2FQ3 A;  2M0M A;  4XRM A;  2ZJ2 A;  4LB5 A;  2R7Q A;  1P4W A;  4CIC A;  1LFB A;  3GVA A;  4MQV A;  3N4M A;  3HRU A;  2CV0 A;  1BBY A;  3DTK A;  4H4K C;  5HDK A;  2JQ7 A;  5GP9 A;  2NVU B;  4IF4 A;  2DMU A;  2KT0 A;  3TQN A;  4B09 A;  2CQN A;  1YLF A;  4OAZ A;  3TW7 A;  4D9J A;  2L9S A;  1HDP A;  1FSE A;  1SFE A;  3BR1 A;  3HHH A;  4P1W A;  1AKH A;  1BJZ A;  1Z05 A;  2HQN A;  3PQJ A;  2EV0 A;  2E5Z A;  1PJR A;  3BWG A;  2KDO A;  2XAH A;  5JHF A;  1FP2 A;  1SVM A;  2CQX A;  4HLX A;  2LP0 A;  3JRI A;  1HBX G;  2V26 A;  3M8F A;  3CMM A;  4HLY A;  4M9S A;  1OCR H;  2VPR A;  1VQ8 I;  3DKX A;  5ICF A;  5EYR A;  3C2G A;  4RS8 A;  1AKH B;  3UR3 C;  4KYW A;  1YJW I;  1M1E B;  1X3W B;  1ORK A;  2HEO A;  1N78 A;  3KZI C;  3RSN A;  2STW A;  3CCE I;  3K1M A;  5FFZ A;  5K7Z A;  2KIS A;  2DQR A;  2Z2S B;  3DTI A;  3GTL J;  2LSO A;  5HVQ C;  3J7A O;  2Y0S A;  5D5X B;  4XON A;  1VQ4 I;  3SQN A;  4A6D A;  3W2A A;  1P4X A;  3ZQ7 A;  1MMN A;  6PAX A;  1BIA A;  2PBI A;  2XUB A;  1R4N B;  1XGM A;  4FAS D;  2M8E A;  2R0Q C;  1OCZ H;  3S16 J;  4M3B A;  3WTT C;  3BR2 A;  5EEG A;  2AS5 F;  2DW4 A;  2ZC2 A;  3GTM J;  2TDX A;  2Y75 A;  4YIR X;  3ZMS A;  3IRQ A;  3F6O A;  1Z3Y A;  1E3O C;  2R7F A;  1HKQ A;  2CV2 A;  1FPQ A;  3PNT A;  3S1M J;  3FXQ A;  3BDD A;  5E79 C; 
#chains in the Genus database with same CATH homology
 1XN7 A;  3C7J A;  2ESH A;  2H09 A;  2RV8 A;  4DNC A;  1R00 A;  3R4K A;  1RUN A;  4IHT A;  3ZMT A;  4PGH A;  1RZ4 A;  1Z7U A;  2EK5 A;  1CF7 A;  1TQP A;  3WTS C;  4RB1 A;  2VOD A;  2RNJ A;  2WC2 A;  2UXX A;  2QQ9 A;  3SFZ A;  2MLK A;  4L9N A;  3ZMV A;  1CF7 B;  2XAQ A;  2GZW A;  4LLG F;  3BJA A;  2GAU A;  2ETH A;  4MGR A;  3WTU C;  2P7C B;  2OA4 A;  4Z2Y A;  2Q2E A;  4HF2 A;  3HRM A;  5E1W A;  1ON2 A;  1K79 A;  1OMI A;  5DV5 A;  1QGP A;  3ISP A;  2X4H A;  4KDP A;  1K78 A;  4G7H F;  1I6X A;  4BQA A;  3QP6 A;  3H3U A;  1J75 A;  3C18 A;  3LAP A;  1J9I A;  4HQM A;  3ML6 A;  3GYH X;  4XRF A;  1KU3 A;  2F5F A;  3MZY A;  1BC7 C;  2FSW A;  1F4K A;  5E1Z B;  3FZV A;  1K78 B;  3J81 K;  2KKO A;  1R1T A;  1LB2 A;  2Z3Y A;  3CTA A;  4BHC A;  1IXS B;  5LRS A;  3V8J A;  3DP7 A;  2LKP A;  3IC7 A;  2YPR A;  3T0Y A;  1P2F A;  1UHM A;  4ESF A;  2JPB A;  1P4A A;  4NHJ A;  4MTD A;  5JI6 A;  1PP7 U;  3E6C C;  3L9F A;  3ZMZ A;  3EQL F;  1F5T A;  1G3S A;  5HLI A;  2M45 A;  3LAJ A;  3KP7 A;  1ZRF A;  1I5Z A;  4Q4Z F;  1SD4 A;  4MNU A;  3OOP A;  1FC3 A;  4G9Y A;  2RC4 A;  4KFC A;  1E17 A;  1OYW A;  4RAZ A;  3KZY A;  3WOD F;  3L7W A;  3V8K A;  1OKR A;  4M73 A;  4H0E A;  3RI4 A;  1R5H A;  2F5C A;  2ZNY A;  3T5X A;  2HYG D;  3JAM Z;  3ECO A;  3KP3 A;  2EWN A;  2EA4 A;  4IVN A;  5JFR A;  4CGZ A;  5L3B A;  4AIH A;  3OV8 A;  3KFW X;  4L18 B;  2P4W A;  2F5D A;  2KJC A;  4O6J A;  4CDG A;  1BI1 A;  2HGC A;  4HF1 A;  1KYZ A;  2XGX A;  4ZZD A;  2DI3 A;  1REP C;  5LGN A;  4OMY A;  4N9I A;  5D6F A;  3I5U A;  2NS0 A;  3REO A;  2WV0 A;  2VE8 A;  2OZ6 A;  3E5X A;  3KE2 A;  4A2U A;  2HDC A;  2CO5 A;  3PQK A;  5J6X A;  3GUD A;  1OYY A;  5D5V B;  4M71 A;  2RKH A;  4I02 A;  2L4A A;  4AWX B;  3JTH A;  3GX4 X;  3HSE A;  5L3C A;  4ZYG A;  1YQA A;  3GLX A;  1JHF A;  1WSU A;  4G8X A;  2DFI A;  2GA1 A;  4P96 A;  2DK8 A;  4EM2 A;  2OAZ A;  4P55 A;  3MWM A;  5E8I A;  1OPC A;  5E17 F;  1T2K A;  3FWE A;  2NNN A;  3EDP A;  3NEU A;  1SFX A;  3R0A A;  1TLH B;  5E20 A;  3EET A;  2MC3 A;  1XSD A;  3TKY A;  3E97 A;  1SD7 A;  4PCQ A;  1BC8 C;  4HZF A;  4A12 A;  1YFH A;  4M74 A;  3W6K B;  5L3F A;  1EH7 A;  2GIV A;  4LD5 A;  4LLL A;  3S2W A;  2EFO A;  2NRA C;  4OOI A;  4EQQ A;  2HOE A;  2CGP A;  1T6S A;  5FGM A;  4G94 A;  2HKO A;  5K5R A;  1B1B A;  4ZYH A;  2FMY A;  3V7C A;  2V1D A;  4LJZ F;  2L01 A;  5D5U B;  4GYI A;  2L02 A;  1RI7 A;  2XKO A;  3BOQ A;  2EB7 A;  2CYY A;  3I71 A;  2GWR A;  1LQ1 A;  4I09 A;  2BEO A;  1GHC A;  1ZRD A;  4KT5 C;  1SD5 A;  2G9W A;  1J59 A;  1V3F A;  1TTY A;  3I64 A;  1C0W A;  1LEB A;  4MTE A;  2MLG A;  2EFW A;  1IXR C;  4YFK F;  4RB0 A;  3SZP A;  3RKX A;  3WTW C;  1KQ8 A;  1FOK A;  4MQ9 F;  2RGV A;  3J80 K;  5DCM A;  2IJL A;  3VOE A;  3P7N A;  3CDH A;  1BOA A;  3HOS A;  1UHW A;  1IF1 A;  5BQT A;  2GXG A;  1ZG3 A;  2DO7 A;  4M6X A;  2A69 F;  1IXC A;  5DCM B;  2BBY A;  2VT2 A;  4AIK A;  3E5Q A;  1WI9 A;  2ZXJ A;  3SZT A;  2R7D A;  4JBA A;  3V7S A;  3I58 A;  4RB2 C;  5H6Q A;  1R5G A;  2OBP A;  2M30 A;  3M1E A;  3WGH A;  2VT3 A;  3ABT A;  3GWZ A;  3GZ5 A;  2EFN A;  3N97 A;  3MAJ A;  2VE9 A;  2ZME A;  2P5K A;  3BPV A;  1ZN2 A;  3LA7 A;  2VXZ A;  3HIF A;  1YS7 A;  4HX8 A;  3F72 A;  2E1C A;  3H92 A;  1R1U A;  1U2W A;  1ZG5 A;  1YW8 A;  4FX0 A;  3ZMU A;  3WE2 A;  1HSJ A;  1ODD A;  2IPQ X;  2WWY A;  4WWC A;  3ELK A;  4YIF A;  1RUO A;  2HKX A;  2XAF A;  2VBY A;  5CLS A;  4ESB A;  4LGW A;  2K02 A;  2GA2 A;  3WGG A;  4UVB A;  3JW4 A;  2LF7 A;  1WQ2 A;  1LEA A;  1A04 A;  3GW2 A;  2O03 A;  2ISZ A;  1LVA A;  4KIG A;  3KCC A;  4HDU A;  1ZLK A;  5LRR A;  1B4A A;  2OZU A;  4L5I A;  1UCR A;  1U8R A;  1JE8 A;  3DPT A;  2RDP A;  1W5T A;  3HSR A;  4L9J A;  3T8R A;  4RGS A;  4I7H A;  4FT8 A;  5D5W B;  2A61 A;  2Z5U A;  2CFX A;  2F5E A;  1PDN C;  4EGZ A;  4HOB A;  3ZP5 A;  4U7D A;  4U7B A;  1QPM A;  3WTV C;  1X3U A;  1O3T A;  2Z99 A;  1STZ A;  4G7O F;  4MEX F;  3C3W A;  3IRR A;  2UWM A;  2P6T A;  2QM3 A;  3VB2 A;  2FOK A;  1O7L A;  4KIC A;  3BP8 A;  3QAH A;  4F7Z A;  4OIN F;  4Y15 A;  3SHF A;  1ZH5 A;  2J5O A;  4XBF A;  4UVC A;  5ICE A;  2GXB A;  1B9N A;  5AIP A;  4LMY A;  1UFM A;  4BHP A;  4BH9 A;  3VEP A;  3E5U A;  2G7H A;  1KQ9 A;  1FLI A;  2W85 A;  3TGN A;  4WF2 A;  3D5L A;  2O8X A;  4HAM A;  4L9T A;  3QU3 A;  3FMQ A;  2FNA A;  1H9G A;  2FXA A;  3RTR A;  4WX9 A;  5E18 F;  3T8T A;  4NQW A;  4IXA A;  3TOB A;  2K7L A;  2IW5 A;  2XAJ A;  4AVP A;  5D4R A;  1FP1 D;  1S7O A;  4S04 A;  4KA4 A;  1G3T A;  3ZN0 A;  4TV7 A;  3GO5 A;  5D6E A;  4GXO A;  1W4M A;  5EEH A;  4WCG A;  1I1S A;  1XGO A;  1J0R A;  3TDU C;  2QBY A;  5KK1 A;  4A0X A;  4GGG A;  2XKP A;  2J5P A;  5ILU A;  3JSO A;  4OMZ A;  4BXU A;  2XRO A;  3CUQ C;  4CZZ A;  1K7A A;  1Q1H A;  3R0J A;  2QYO A;  3RPU A;  4JQF A;  1IRF A;  1ONV A;  4LFU A;  1W7P D;  3ULQ B;  3GF2 A;  3BZ6 A;  1QZY A;  4I2O A;  4EGY A;  2Y48 A;  3JAM K;  2NNY A;  2XV4 S;  1DUX C;  2NYX A;  1XD7 A;  2IP2 A;  4G7Z F;  3KEQ A;  1SMY F;  1MJA A;  3U1D A;  4OU0 A;  3M8E A;  1JGS A;  2V79 A;  1YW7 A;  1ULY A;  4ZYE A;  1VTN C;  4PZJ A;  1RNL A;  3WG9 A;  4N0B A;  1BI3 A;  4EV0 A;  2MH9 A;  1TQI A;  2MBF A;  4QLC U;  1HKT A;  4A6E A;  5H6R A;  2M5W A;  2FBI A;  1KA8 A;  4OIO F;  1YS6 A;  3V8L A;  3JSP A;  5ICG A;  4CXF A;  1AWC A;  2W25 A;  5DD4 A;  1TNT A;  4GYG A;  2W24 A;  4RGU A;  3RYP A;  2QVO A;  1P6R A;  4HW0 A;  4A0Y A;  3KP4 A;  1T39 A;  2EV5 A;  3I59 A;  2LF8 A;  3ECH A;  5TRD A;  3FHZ A;  2A6H F;  1R22 A;  2VN2 A;  4UHT A;  1ZGA A;  1HW5 A;  5FLX K;  3KP5 A;  2YSR A;  3NRV A;  3I59 B;  5ED4 A;  5DDG A;  1YO5 C;  5IT9 K;  1DPR A;  4RAY A;  2OQR A;  4L5J A;  2A6E F;  2MA3 A;  4ZH4 F;  4ZYD A;  1QZZ A;  3GEZ A;  2YR2 A;  4OIR F;  1IN8 A;  1T98 A;  1KGS A;  3G73 A;  2PN6 A;  2JRT A;  5K5Q A;  3FM3 A;  5JVT A;  1LJ9 A;  3BPX A;  3FMS A;  2HFH A;  3IKV A;  1H9T A;  5FD5 A;  2EJR A;  5CVU A;  3WU1 B;  1B59 A;  3IKT A;  2XRN A;  3LFK A;  5D8K B;  4Y17 A;  1K6O A;  4OIQ F;  1U5T C;  1BJA A;  3I4P A;  2D1V A;  5DCF A;  1HW2 A;  2FF4 A;  2FEZ A;  2WTE A;  3QOP A;  5BS6 A;  2P5V A;  5F6F A;  1S3J A;  1S6L A;  1HQC A;  2A68 F;  1TBX A;  1ZAO A;  2E1N A;  2X0L A;  1JHH A;  4WK8 F;  3MCZ A;  1T38 A;  5F1R A;  2A3S A;  3H3Z A;  1TW2 A;  1AOY A;  4KIF A;  2PI0 A;  2E7W A;  1G4D A;  4KUM A;  1HW1 A;  4EJO A;  3HHG A;  1FT9 A;  1WKM A;  4O5V A;  3BJO A;  4FHT A;  4U0V A;  1J7K A;  1O57 A;  3QU6 A;  1IW7 F;  4CO8 A;  1F9N A;  2ESN A;  1LDJ A;  3QP5 A;  4ENM A;  3ERE D;  3HYI A;  1D8J A;  1HXD A;  5E8G A;  2M87 A;  4UNO A;  1FWZ A;  3ZN1 A;  2QZ8 A;  2LNB A;  2FBH A;  3K1N A;  2KIM A;  2VBW A;  3ZPL A;  3F8F A;  3LA3 A;  1LNW A;  3GXO A;  1J2X A;  4R1H A;  3Q9V A;  3FX3 A;  2DAO A;  3O6B B;  2PEX A;  5FD6 A;  1IUY A;  2STT A;  1S8N A;  4ON0 A;  3I0T A;  3B02 A;  1XDU A;  2VBZ A;  3EUH A;  1JXS A;  1MDM A;  5FB2 A;  2DTR A;  2O0Y A;  5DYM A;  3DFG A;  1MJB A;  1SD6 A;  3GFL A;  2K4B A;  3GZ6 A;  4HX4 A;  1IAW A;  1MDM B;  2FBK A;  2QLZ A;  4R8H A;  4P5O A;  1I1G A;  5K1Y A;  3L2C A;  1ZRC A;  2DU9 A;  1U78 A;  1ZYR F;  3F21 A;  5ERI A;  2ELH A;  1KU2 A;  4CHU A;  1XGS A;  2DK5 A;  1R1V A;  3C1D A;  1RIO H;  1IZ1 A;  2H6B A;  2E7X A;  4R79 A;  4EJV A;  3WTZ A;  2M1B A;  1R58 A;  1MZB A;  1DDN A;  2KIU A;  4BAY A;  2W57 A;  4I0A A;  3EYY A;  3QPH A;  3CUO A;  2Y0M A;  1W7P A;  5HS9 A;  1ZG1 A;  5BPI A;  5IT3 A;  2F2E A;  2PLY A;  1W7P B;  2HQR A;  3P9C A;  4Q5S F;  2V9V A;  2VBX A;  2CW0 F;  4G6Q A;  3L09 A;  3RKY A;  2HS5 A;  3V4G A;  4HDV A;  1O3R A;  4IHS A;  1W5S A;  1J5Y A;  3GFJ A;  4M9Z A;  4HQE A;  1XGN A;  1CGP A;  2ZME B;  5KVR A;  2A5Y B;  1FBU A;  4YII A;  3IHU A;  3F3X A;  3TO7 A;  3F8N A;  4PDK A;  2XAG A;  3RYR A;  1U6G A;  3DPL C;  3ABU A;  2K86 A;  1WRJ A;  1XMA A;  1B6A A;  5BPD A;  3P9I A;  3KLN A;  2Q8K A;  1SFU A;  1IN7 A;  3CJN A;  5DUI A;  2UXN A;  3U2R A;  2G7U A;  3BRO A;  1IN6 A;  5LLQ A;  3F8B A;  4I98 B;  2FNP A;  3L00 A;  4EJT A;  2KIF A;  5LHG A;  1D8K A;  4A5N A;  2DQL A;  5A2Q Z;  2ZKZ A;  4DQ2 A;  5DD8 A;  4LK1 F;  4UUV A;  4OIP F;  2D1H A;  1QBJ A;  2AXL A;  2QQA A;  1USS A;  2CSO A;  1D5V A;  2QWW A;  3RJP A;  1FSH A;  3GFI A;  2YU3 A;  3VOD A;  3LST A;  3LWF A;  1Z9C A;  1P92 A;  2P7V B;  5AON A;  3K0L A;  1YYV A;  2HR3 A;  5ICC A;  1T0F A;  2L3D A;  4KN4 X;  4U0Y A;  2R3S A;  3F8C A;  3IWZ A;  3HSF A;  1UB9 A;  1QNT A;  2Z9O A;  1D3Y A;  4B8X A;  3RKW A;  4EVI A;  1FZP B;  4HA8 A;  4LLN A;  2D2W A;  2IA2 A;  2EFP A;  1FYM A;  2O61 A;  4UXN A;  2FML A;  1R7J A;  2L54 A;  2VOP A;  1ZAR A;  2MD5 A;  3O3K A;  3FMR A;  3BY6 A;  2UZK A;  1GXQ A;  4JK1 X;  2A07 F;  3DV8 A;  4Y13 A;  5HOO A;  3HUG A;  2KJB A;  4MHG A;  1F1Z A;  3W6J B;  5LGT A;  2L4M A;  1G3W A;  3FF5 A;  1SMT A;  2IRF G;  3MEX A;  5ILS A;  1G6N A;  3DXJ F;  2HTJ A;  2IA1 A;  1BI2 A;  2CG4 A;  4M72 A;  3KP2 A;  2FA5 A;  4ENK A;  4KIB A;  3O2P E;  3HRS A;  3K2Z A;  3CUQ A;  3HRT A;  1GXP A;  2EA2 A;  2JT1 A;  1TQM A;  5LBQ A;  2YX7 A;  1BI0 A;  3CUQ B;  2PMH A;  4L9V A;  1MGT A;  1QQI A;  1KQ0 A;  5BMZ A;  3E6D A;  4A5M A;  4IJA A;  2QBY B;  4EM1 A;  3TO6 A;  4Q47 A;  2KRF A;  4AIJ A;  4NB5 A;  5LHH A;  2VC0 A;  4LK0 F;  2HWV A;  3HTU A;  4HX7 A;  4YFN F;  1O3S A;  4EM0 B;  3B73 A;  2DBB A;  2JTV A;  2PJP A;  3K9T A;  1DPU A;  1O3Q A;  3FXR A;  4M6Y A;  1FBQ A;  3ZMD A;  4D0P A;  5LGU A;  2O6G E;  4EJU A;  4WXD A;  3R6S A;  4EJW A;  3DKW A;  4UVA A;  2K4J A;  2RN7 A;  2Z33 A;  2CQK A;  2D45 A;  3MZH A;  1Z91 A;  2V1U A;  4ENN A;  1ON1 A;  3TOA A;  3SXY A;  1YTY A;  1ZHF A;  1KYW A;  3IWF A;  3V7R A;  2MH2 A;  5F64 A;  3K1P A;  4P9U A;  1Z6R A;  3MQ0 A;  1Y0U A;  3FXU A;  1R23 A;  1Z6T A;  4KNY A;  4S05 A;  3BJ6 A;  3Q5F A;  1NHA A;  5LEJ A;  2RVC A;  2B0L A;  3CLO A;  1BIB A;  3COA C;  3TDZ C;  4RB3 C;  3KEO A;  4HYE A;  3G3Z A;  5JR3 A;  2ACJ A;  4XLN F;  2GQQ A;  3WTX C;  1S29 A;  1XDS A;  1R36 A;  5TJJ A;  2DLL A;  4CYD A;  3DEU A;  5FO5 A;  3EYI A;  3LQR A;  3GFM A;  2ZFW A;  4UV8 A;  1QO0 D;  4LG0 A;  3LA2 A;  4E70 A;  1IN5 A;  2PQ8 A;  5CYV A;  3JTG A;  5L3D A;  2QQB A;  1L3L A;  3F22 A;  4BYY A;  2DPU A;  2HZT A;  1U5T A;  4ETS A;  4LG0 B;  5DUK A;  2HYF A;  1KU9 A;  3LQQ A;  2DPD A;  2JPC A;  2PFB A;  3PFI A;  5L3G A;  1MD0 A;  5CVJ A;  1U5T B;  3M9A A;  2Q0O A;  2RQP A;  5HLH A;  1UST A;  3J81 Z;  1XCB A;  2FE3 A;  4BNC A;  2O3F A;  3CO7 C;  3RPQ A;  2QUF A;  5HS7 A;  4G6D A;  1B9M A;  4LB6 B;  5CVR A;  2VC1 A;  5FFX A;  3T1B A;  3F23 A;  3P9K A;  2ISY A;  4ENJ A;  2H94 A;  4YG2 F;  3F6V A;  2QEN A;  5CVV A;  1XSX A;  1YIO A;  1XB4 A;  1ZGJ A;  1LDK B;  2OD5 A;  4K2E A;  4KN7 X;  2CWE A;  5FLX Z;  3IL2 A;  1BM9 A;  5AIQ A;  2FRH A;  4P9F A;  5IT9 Z;  2VON A;  2H6C A;  4HV5 A;  1Z1D A;  1HST A;  3U9G A;  4YFX F;  1O7F A;  1L0O C;  1PUE E;  2OU2 A;  3AAF A;  4HF0 A;  1OYI A;  2ZCW A;  5BOX A;  2ZNZ A;  1ZLJ A;  3QRF F;  3KZZ A;  1FYL A;  2PMU A;  5HDG A;  3ROU A;  4N9H A;  3WU0 A;  4IRH A;  5K5O A;  2ADU A;  3D0S A;  1G3Y A;  2P5L C;  4KMF A;  5D4S A;  3E6M A;  3QPT A;  1XMK A;  2IVM A;  4EMS A;  2YX4 A;  3I53 A;  1DP7 P;  1HKS A;  1YW9 A;  5J8C A;  1MKM A;  4BHB A;  1KU7 A;  2EFQ A;  4U0W A;  2EV6 A;  1MJ9 A;  4RGR A;  4IPA A;  2NAZ A;  4IRI A;  2V6C A;  3Q9S A;  1S7A A;  1FBS A;  5DEQ A;  1IN4 A;  2XAS A;  1U3E M;  3WGI A;  4GCV A;  3K69 A;  1FNN A;  1XCV A;  4IRG A;  2P8T A;  3KP6 A;  5A2Q K;  3F8M A;  2ZO4 A;  3RDI A;  5HDN A;  1YG2 A;  5CVI A;  3KLO A;  2JZY A;  3CO6 C;  1ZRE A;  3WTY C;  3NQO A;  4I0B A;  4RGX A;  1WWX A;  1BN5 A;  5J8F A;  1EV7 A;  4UV9 A;  3KET A;  4HBL A;  2PG4 A;  2XIG A;  2DT5 A;  4XLP F;  3FM5 A;  1E2X A;  2JSC A;  4ZZL A;  4PGG A;  5LHI A;  5JHU A;  3DQV C;  3HTS B;  1TW3 A;  1XSV A;  3VFZ A;  4ASN A;  1PP8 F;  4XSX F;  1I27 A;  2HTS A;  4I01 A;  1FX7 A;  1SAX A;  2IA0 A;  4L0Z B;  5L3E A;  2H27 A;  3DF8 A;  4XSZ F;  2XHK A;  2P6S A;  5D8L B;  3HOT A;  5H20 A;  2BV6 A;  2XVC A;  2BGC A;  2W84 A;  4KMU X;  2VOO A;  4U88 A;  1EH6 A;  5E1X A;  4L0Y B;  5HLG A;  2K27 A;  5HS8 A;  4A0Z A;  4M9X A;  3E3V A;  4Q48 A;  4MEY F;  4QWQ A;  4WXC A;  1FY7 A;  2BYV E;  1OR7 A;  5ILV A;  3TO9 A;  3J80 Z;  4O3M A;  2V1X A;  1EH8 A;  3R60 A;  1TNS A;  3E6B A;  2COM A;  2LDU A;  1LDD A;  4ESJ A;  3RIR A;  5LEK A;  1V4R A;  2BE5 F;  3WE3 A;  2OQG A;  4WXH A;  2IT0 A;  2ZBK A;  4FX4 A;  3M7G A;  1FYK A;  1H0M A;  1GVJ A;  3R61 A;  3MFK A;  4GO1 A;  4AD9 A;  5CJ9 A;  1IRG A;  4HV6 A;  2FU4 A;  2C6Y A;  3I54 A;  2FQ3 A;  2ZJ2 A;  4LB5 A;  1P4W A;  4CIC A;  3GVA A;  4MQV A;  3N4M A;  3HRU A;  1BBY A;  5HDK A;  4IF4 A;  3TQN A;  4B09 A;  1YLF A;  1SFE A;  1FSE A;  3HHH A;  1Z05 A;  2HQN A;  3PQJ A;  2EV0 A;  3BWG A;  2XAH A;  1FP2 A;  4HLX A;  1HBX G;  3M8F A;  4HLY A;  4M9S A;  5ICF A;  4RS8 A;  4KYW A;  2HEO A;  2STW A;  3K1M A;  5FFZ A;  2DQR A;  2LSO A;  5HVQ C;  3J7A O;  5D5X B;  3SQN A;  4A6D A;  1P4X A;  3ZQ7 A;  6PAX A;  1BIA A;  2PBI A;  2XUB A;  1XGM A;  2M8E A;  3WTT C;  5EEG A;  2AS5 F;  2DW4 A;  2TDX A;  2Y75 A;  3IRQ A;  3ZMS A;  3F6O A;  2R7F A;  1HKQ A;  1FPQ A;  3FXQ A;  3BDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...