3M8FA

Protein structure of type iii plasmid segregation tubr mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
HFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNWFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative DNA-binding protein
publication title From the Cover: Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Dna binding protein
total genus 30
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m8fA00
3GO5A 1LJ9A 1S3JA 5FD6A 4HF1A 4LD5A 3GZ5A 5DYMA 2QYOA 3J80K 3SFZA 1SFUA 1QQIA 3CDHA 1OKRA 1OR7A 1J59A 3IL2A 3TO9A 2ETHA 1BI1A 4KNYA 1IXCA 2VBWA 1REPC 1T0FA 2QENA 3VODA 1OPCA 4EVIA 2A07F 1EH6A 3FMQA 1KU7A 3U9GA 2DQLA 1Z7UA 4UHTA 4EQQA 4L9TA 5DDGA 3GEZA 5ILVA 1FPQA 3KZYA 2D2WA 3HTSB 4KN4X 1TLHB 3Q9VA 4ESFA 2GA1A 1S7AA 4MHGA 4EM2A 4G9YA 5HLGA 3ZMVA 4I2OA 1ZRDA 3EYIA 1ULYA 5HS9A 5D8LB 4IVNA 5HOOA 5L3BA 3FWEA 3TOBA 2RN7A 3KEQA 1UFMA 4O5VA 1TQPA 2B0LA 2Z33A 4ON0A 2L02A 5D5XB 4Y13A 4ZZLA 3RKYA 2DU9A 2VBYA 3WGHA 3RKXA 4P96A 1HQCA 2L4AA 2FSWA 5HDKA 4U7BA 5FLXK 1K78A 2VXZA 1R23A 1HSTA 2O0YA 3IKVA 1XSDA 3I0TA 1ZRFA 3KZZA 4HX4A 2O61A 4Y17A 1YIOA 2UXXA 1RI7A 4BH9A 2W57A 2EFOA 2FNAA 2CSOA 4KMUX 5D8KB 1CF7A 1GVJA 3CUQC 2F5CA 5CVRA 2STTA 2RV8A 4AVPA 1ZREA 2ZMEA 4A6EA 1JXSA 1TTYA 2EV5A 4LB6B 1FSHA 2L01A 3WE3A 3KFWX 1V3FA 2OA4A 3QRFF 2BE5F 3KP6A 1KYWA 1TNTA 1KU9A 2Y75A 3H3ZA 2STWA 2M5WA 4WXCA 5D4RA 2PI0A 4CGZA 4B8XA 5J8CA 3FMRA 2KIFA 1W7PA 4AIKA 1B4AA 1K78B 1SMYF 3V7SA 3DQVC 4A2UA 1YLFA 2UWMA 2Y48A 3R4KA 1LB2A 3JW4A 4MEXF 1HW5A 1J75A 4G6DA 2LDUA 2XHKA 5JFRA 2EWNA 3JTGA 3CO7C 3GX4X 2PN6A 2M30A 1CF7B 3E6DA 5CVUA 1RIOH 1XGSA 3HHHA 1IN4A 1ZRCA 2ZMEB 2A5YB 2JZYA 3T8TA 1SAXA 1UHWA 4KYWA 2X4HA 1QO0D 4KIGA 2K4BA 1ON1A 2GA2A 1FZPB 3WU0A 4KICA 3LQRA 4I02A 4BNCA 1UB9A 2VC1A 3HIFA 2X0LA 3MZHA 3CUQA 4UVCA 5D6FA 1ZG5A 1TW3A 3HOSA 4DQ2A 1GHCA 5ICCA 1Z91A 1W7PB 4FX4A 3E6CC 1BC8C 2NNNA 2V1XA 3EQLF 4GO1A 4EJVA 3H92A 5ICFA 2PEXA 2Z5UA 1D5VA 3MCZA 1SD5A 3I58A 2NS0A 4M9ZA 2DI3A 3MEXA 1ZH5A 2HOEA 4L18B 3F72A 1BIAA 1O7LA 1DDNA 4F7ZA 3DPLC 1IN8A 4WXHA 4YFXF 4PZJA 1ZGJA 3R61A 3LWFA 1LDDA 2NNYA 2QLZA 2PJPA 2RKHA 2H09A 5D5WB 2V6CA 2L4MA 3ZMSA 5BPDA 3FM5A 5DUKA 2W24A 4L9NA 4LLLA 3HRUA 5LGNA 1ZGAA 4S05A 4WX9A 3HRSA 2Q2EA 1BN5A 1BI0A 3LA7A 3RJPA 3N4MA 1W7PD 3VFZA 4OOIA 2IRFG 2FRHA 2OU2A 3ZPLA 1FT9A 2BBYA 2W84A 1J0RA 1USSA 2YPRA 2VE8A 3F22A 5AONA 1JGSA 1S29A 2EJRA 1XGMA 4WXDA 4GGGA 4OMYA 5E18F 1LEAA 4N9HA 1RUOA 1K6OA 1L3LA 3ROUA 3FXQA 1TW2A 3R60A 1ZG1A 3FXRA 4ENKA 2A68F 5FFZA 1PUEE 1A04A 1DP7P 4G6QA 2ZFWA 4UV9A 2FQ3A 4YFNF 1IF1A 2HDCA 1GXQA 3JAMK 1MJBA 4M9SA 4ZZDA 1KGSA 1LDJA 3LAJA 2P6TA 2XAJA 3E6MA 1F9NA 3I53A 1PP8F 2IVMA 4Q4ZF 1HBXG 3C7JA 1B1BA 2MA3A 1U78A 2KIMA 4M73A 2O6GE 4KUMA 1JE8A 3F8CA 3IWFA 4P55A 4BHPA 3REOA 3GF2A 1YO5C 2K86A 3WE2A 3RYPA 3KEOA 4QWQA 2D1VA 3E97A 1BBYA 1B59A 3MQ0A 2DK8A 1P4WA 1FBQA 1YS7A 4RGXA 2ACJA 3IKTA 5DCFA 4AWXB 4HYEA 1XD7A 1FYMA 3ELKA 3CJNA 1G6NA 1S7OA 1D3YA 1QPMA 2HZTA 1SD6A 3BP8A 5A2QZ 3DEUA 4JQFA 4M74A 2A6HF 2VC0A 1I1GA 4Q47A 5JR3A 3V8KA 2P5VA 5CLSA 2EV0A 4XRFA 2QZ8A 2HKXA 5ICGA 4RB0A 3R6SA 5K5RA 4XLPF 1YW8A 3KETA 2IP2A 1J7KA 1YW7A 3ZMDA 4L0ZB 3BOQA 1J9IA 3DF8A 2G7UA 3K9TA 2ZNZA 5HVQC 3F21A 3G73A 4RAYA 1O7FA 4U0YA 4PDKA 4I01A 2XGXA 1ZLJA 2CO5A 4FX0A 1O3TA 2EFQA 1WRJA 4R1HA 3ECHA 5LRRA 2XKPA 4RGSA 1O3SA 3QP6A 4BYYA 1T39A 2LNBA 3KLNA 4ZYEA 3HTUA 2E7XA 1W4MA 4LLNA 1Z6RA 3SHFA 4ZYDA 5FD5A 3WTXC 3L9FA 2OQRA 3F8NA 2KJBA 1IN6A 4IPAA 1MDMA 4L0YB 4U7DA 1IN7A 3KP5A 3FHZA 2KKOA 3K1MA 2CYYA 3DPTA 4NHJA 3NQOA 2A3SA 4ZYGA 1VTNC 3E5UA 1R36A 4MGRA 5ED4A 2TDXA 3J80Z 4HLXA 4HQEA 1MKMA 3K2ZA 1BC7C 2VE9A 3S2WA 2MD5A 1XMAA 1KA8A 3BJ6A 5DV5A 4RB1A 5E20A 2VONA 4M71A 1ZAOA 1YS6A 3VB2A 5JHUA 1U8RA 2ZBKA 1U3EM 2MLKA 4IRHA 1XB4A 3HUGA 1I27A 3TGNA 3TQNA 1STZA 3M8EA 2LF8A 3WGGA 1ZLKA 4HZFA 2O8XA 2RNJA 2AS5F 5E8IA 2UXNA 3SZTA 1XCBA 1CGPA 2P5LC 2R7DA 1LDKB 4BAYA 4ZYHA 2Z99A 5L3GA 2C6YA 5L3CA 2H27A 2XIGA 1WQ2A 5CJ9A 4EM1A 1FP2A 2FA5A 2R7FA 3MFKA 3TDUC 4ZH4F 1HW2A 1MDMB 1Z6TA 1XMKA 3F23A 3L09A 4Q48A 3QAHA 5J8FA 5FLXZ 2DPDA 3TOAA 5LHHA 4UV8A 2CGPA 5KVRA 1R5GA 1JHFA 1I1SA 4A5MA 2OBPA 5IT9K 2L54A 3GWZA 3K0LA 2MLGA 3K69A 4I0BA 5D5VB 3GLXA 5LLQA 5DD8A 2VT3A 3GVAA 3K1PA 2ESHA 3ZN1A 2E7WA 5H6QA 2RGVA 3FZVA 1YFHA 3WGIA 2HEOA 5ILUA 4KIFA 5IT9Z 1U5TC 4AIHA 4HOBA 4YG2F 1P92A 5CVVA 1U2WA 3ECOA 2FE3A 4ENJA 5BOXA 3HSEA 3W6JB 4BQAA 2AXLA 2P7CB 2GXGA 2ZNYA 3V7RA 5BMZA 4HLYA 1HW1A 5KK1A 2MBFA 3QU6A 1IXRC 3GUDA 3SXYA 4XLNF 1E17A 1IRGA 4OMZA 4O3MA 2F5DA 2FBKA 1YW9A 1IUYA 2GQQA 3RYRA 4A12A 1XGNA 3QP5A 2YSRA 4GYGA 1FWZA 5D4SA 1ONVA 3NEUA 4HDUA 1FYLA 1XN7A 4CYDA 1H0MA 1X3UA 1R5HA 4EM0B 5F1RA 3RTRA 2HYGD 2JTVA 1K79A 5L3EA 2BEOA 3TDZC 4KMFA 1KU3A 2PQ8A 4MTEA 4U0WA 1O57A 1P6RA 3ZN0A 3NRVA 1IRFA 1OMIA 4HA8A 4L9VA 4A6DA 2DTRA 3GFMA 5D6EA 3RI4A 4UUVA 3HRMA 3I71A 2CG4A 2HWVA 1R22A 1MJAA 4AIJA 2Q0OA 1R00A 4HBLA 3TO6A 4LK0F 3LQQA 4NB5A 2LSOA 2K7LA 1EV7A 2R3SA 4KT5C 3BZ6A 4D0PA 3E5QA 4ESJA 4I0AA 2P4WA 4G8XA 5DEQA 2COMA 4ETSA 3RPUA 1BIBA 1QNTA 4YIFA 3CLOA 1W5TA 3M9AA 3WTUC 2XKOA 1BI2A 4GYIA 1WWXA 1SMTA 2IA2A 2M87A 3N97A 1TBXA 3ZMUA 2F2EA 3M8FA 3LAPA 3C1DA 2XAHA 4HQMA 2FF4A 4IJAA 4ENMA 3BPXA 4HF0A 2DPUA 2DFIA 2XVCA 4FT8A 1XDSA 2GWRA 1KU2A 2CWEA 2M1BA 4TV7A 5ILSA 1RUNA 1HXDA 2H6CA 3CUQB 5JI6A 4M9XA 1XSVA 4HW0A 3IHUA 3LA3A 1PDNC 2P7VB 2YR2A 3FF5A 4ASNA 2XAQA 2XRNA 3QPHA 1K7AA 3EUHA 2GAUA 2WC2A 1TQIA 2HYFA 3J81K 2P8TA 3HHGA 3PQKA 1R1TA 2OD5A 2VBZA 3GFJA 2Z9OA 4I7HA 4BHCA 1O3QA 5LEJA 1OYYA 3GFLA 1P2FA 3L2CA 4AD9A 2RC4A 4KIBA 4R79A 3QOPA 3J81Z 5DCMA 4IF4A 1V4RA 1MD0A 2D45A 1RZ4A 1FSEA 1BI3A 5CVIA 1U6GA 3V7CA 1P4XA 3GYHX 3E3VA 3ML6A 2DK5A 3JAMZ 3ABTA 3WTZA 2XROA 3RDIA 2H6BA 2XASA 2EV6A 2E1NA 2ESNA 2FMYA 2QVOA 1RNLA 3F6OA 2XAFA 1G3TA 2OZUA 4Y15A 4XBFA 4RGUA 3HYIA 1KYZA 2P5KA 5CYVA 1YG2A 2O03A 2IJLA 2HR3A 1ODDA 4P5OA 3F8MA 3G3ZA 2H94A 1B6AA 4G94A 5CVJA 1SFXA 4M6XA 2DQRA 4OU0A 4NQWA 4FHTA 4RB2C 4HV6A 1FOKA 1LEBA 4GCVA 4P9UA 1GXPA 1YTYA 2ZXJA 3E6BA 3RKWA 2RQPA 2V1DA 3ZMZA 3KP4A 4EJOA 5DCMB 1DUXC 1S8NA 4IRIA 1J2XA 2UZKA 1IXSB 3GZ6A 1HSJA 4O6JA 4M6YA 4MQVA 4BHBA 3GW2A 1Z9CA 1QZZA 5LGUA 1Q1HA 5IT3A 1UHMA 1W5SA 3EETA 3TO7A 5AIPA 3I54A 3LSTA 3RPQA 3PQJA 1B9NA 4CDGA 4EMSA 4UNOA 3O6BB 4S04A 1S6LA 5FFXA 1WSUA 2BGCA 3JSOA 3F6VA 1BJAA 1F1ZA 2RDPA 3EDPA 2O3FA 3O3KA 4I98B 3IC7A 5BPIA 5FO5A 4BXUA 4L9JA 4PGGA 3WTYC 1L0OC 2L3DA 2VN2A 2JPCA 1R1VA 4RGRA 3CO6C 4A5NA 3IRQA 2D1HA 5DUIA 1XDUA 2A6EF 2QQAA 1H9GA 3P7NA 4MTDA 4RB3C 4UVBA 2KIUA 4R8HA 2DLLA 1MJ9A 4K2EA 3WODF 1PP7U 4IXAA 2XV4S 2QQ9A 4N9IA 4YIIA 2MH2A 2BYVE 3R0AA 2ZKZA 4WK8F 4MQ9F 3Q5FA 4ENNA 3LA2A 1G3WA 1R1UA 1J5YA 1ZG3A 4CXFA 3VEPA 2W25A 1SD7A 2NYXA 4A0XA 1ON2A 4WCGA 3KP7A 4EGYA 2ISYA 1P4AA 1C0WA 3L7WA 4B09A 3M1EA 2GZWA 4L5JA 4HAMA 1TNSA 3V8JA 2DAOA 2K27A 1FX7A 1ZYRF 3FM3A 1H9TA 3I5UA 3BROA 2M45A 2K02A 2PG4A 2QQBA 1FNNA 2PFBA 2ZJ2A 2DW4A 3MZYA 5K5OA 4IHSA 4RAZA 4PGHA 3EYYA 5L3DA 2FU4A 2EA4A 4OIOF 4CICA 4LMYA 2YU3A 4OIPF 1I5ZA 1O3RA 3F3XA 4HV5A 5AIQA 1ZHFA 3U2RA 5D5UB 3F8BA 2GXBA 4LGWA 4OIQF 2EA2A 2EB7A 3IWZA 2CW0F 3BY6A 4OIRF 1IZ1A 2V1UA 4UVAA 4CO8A 2VODA 2FOKA 3BDDA 3K1NA 3M7GA 2QBYA 4HX7A 3OOPA 3MWMA 1UCRA 3LFKA 2EFNA 4KDPA 2JSCA 2QM3A 5HLHA 4EV0A 3IRRA 1XGOA 3QU3A 2ISZA 3OV8A 3JSPA 3ZQ7A 3SQNA 2HTJA 4KA4A 3PFIA 1NHAA 5E8GA 4LB5A 4IHTA 2J5OA 1B9MA 2VBXA 4G7ZF 3P9KA 5FGMA 3HRTA 4WF2A 2IW5A 1AOYA 1FC3A 1YYVA 2K4JA 3FX3A 1OYWA 3MAJA 5K5QA 1KQ9A 6PAXA 1OYIA 4EJWA 5HLIA 3J7AO 1R7JA 4H0EA 2A61A 2EK5A 2FBHA 2CFXA 4JBAA 1XSXA 2HTSA 3WU1B 5E1ZB 3Q9SA 3C3WA 3E5XA 2QUFA 1QZYA 2Q8KA 3O2PE 1SFEA 2Z3YA 3DFGA 3WTTC 1LNWA 1DPUA 2XAGA 2OQGA 2HGCA 3DXJF 4HX8A 2EFWA 1ZN2A 2QBYB 5E17F 2ELHA 3C18A 1Y0UA 3WTVC 2FNPA 1LVAA 5H20A 2EFPA 3W6KB 2J5PA 2GIVA 1XCVA 1F5TA 2HQNA 5L3FA 3H3UA 5LBQA 5J6XA 4XSXF 3I59A 2KJCA 4XSZF 1U5TA 1BOAA 5LHGA 2DT5A 4A0ZA 1T6SA 4KN7X 3VOEA 4YFKF 3I64A 3SZPA 2OAZA 2YX7A 2PBIA 1R58A 5E1WA 2HQRA 4MEYF 5JVTA 4PCQA 1FP1D 2WV0A 4U88A 2HFHA 3I4PA 2JPBA 4JK1X 2RVCA 3KLOA 1HKSA 2A69F 2V9VA 4P9FA 3BJOA 5F64A 1G4DA 3KE2A 5HS7A 3KP2A 2F5FA 5H6RA 3HOTA 1SD4A 1T98A 2HKOA 3D5LA 4LK1F 1F4KA 2ZO4A 2BV6A 4L5IA 1FYKA 2PLYA 1E2XA 3CUOA 2W85A 1Z1DA 4MNUA 5LRSA 1JHHA 2FMLA 4EJTA 2HS5A 3DKWA 3DP7A 5TRDA 1ZARA 3B73A 5ICEA 1EH7A 3WG9A 1DPRA 2G7HA 1FBUA 1TQMA 3DV8A 2WWYA 2JT1A 1I6XA 5HDNA 3I59B 4G7OF 1WI9A 2VOOA 3CTAA 1U5TB 2VOPA 2KRFA 2V79A 3ZP5A 2LKPA 4RS8A 1FBSA 1FY7A 5EEGA 5EEHA 2FXAA 2Y0MA 1KQ0A 5LHIA 1D8JA 1IW7F 3V8LA 4Q5SF 4UXNA 2MH9A 2G9WA 5BQTA 1QBJA 3T1BA 3ERED 4EGZA 3BWGA 2JRTA 5E1XA 3B02A 2ADUA 1USTA 2OZ6A 4HDVA 4IRGA 5HDGA 1IAWA 4LJZF 5DD4A 3WTWC 2PMHA 2WTEA 2FBIA 3HSRA 2IA1A 1AWCA 3RIRA 5FB2A 5K1YA 2NRAC 4CZZA 1HKQA 4E70A 3L00A 1EH8A 2NAZA 1MZBA 4ESBA 2FEZA 3F8FA 4Z2YA 2MC3A 3FMSA 1Z05A 4GXOA 1IN5A 1YQAA 3T0YA 4A0YA 3U1DA 5ERIA 4M72A 3KCCA 2PMUA 4U0VA 1FLIA 1BM9A 3ABUA 3ULQB 4OINF 3TKYA 4LG0A 3WTSC 4G7HF 4DNCA 4KFCA 3T5XA 3KP3A 3BJAA 4N0BA 5BS6A 4QLCU 4I09A 1LQ1A 5A2QK 2VT2A 2IPQX 3GFIA 3JTHA 1G3YA 3QPTA 5LGTA 2CQKA 2XUBA 2IT0A 3R0JA 4EJUA 5LEKA 3P9IA 5TJJA 3AAFA 2E1CA 2ZCWA 2M8EA 1QGPA 2YX4A 4HF2A 3ISPA 1KQ8A 3COAC 2DO7A 4LFUA 5HS8A 2IA0A 2P6SA 4LLGF 3D0SA 4CHUA 1D8KA 2F5EA 3FXUA 1G3SA 1T2KA 3ZMTA 2DBBA 1WKMA 3GXOA 3T8RA 3V4GA 3P9CA 3HSFA 4WWCA 1MGTA 2QWWA 3BPVA 1HKTA 5F6FA 1T38A 4LG0B 2LF7A
chains in the Genus database with same CATH superfamily
2ZC2A 2F4OB 5KCMA 1YHQI 1YI2I 3S15J 2WADA 1GUUA 4BQNA 3GO5A 5FRNA 1LJ9A 5FKOA 1S3JA 4BACA 5FD6A 4HF1A 3DU6A 1MMGA 4LD5A 4RM3A 2L0KA 3PO3J 3GZ5A 5DYMA 4BU2A 2QYOA 3N05A 3J80K 3SFZA 1SFUA 4IHVA 1X1PA 4CCNA 1QQIA 2JA7J 3CDHA 1OKRA 1OR7A 4JX5A 4I6ZA 1J59A 3IL2A 3TO9A 2ETHA 5IYCJ 1BI1A 2HVSA 4KNYA 1IXCA 1HLVA 2VBWA 5J3LA 1T0FA 1REPC 2QENA 3VODA 2ZXIA 1OPCA 4EVIA 2A07F 1EH6A 2P0WA 3FMQA 4RMNA 3CLQA 1KU7A 3H9GA 3U9GA 1TWGJ 5JLXA 2DQLA 3S14J 1S7EA 4M3GA 2LBFA 3L2WA 4JOMA 1Z7UA 3OYMA 4UHTA 4EQQA 4L9TA 5DDGA 4G12A 1U9NA 3LOCA 3GEZA 1VZ0A 3HOXJ 1GDTA 5ILVA 3OS0A 1FPQA 5EGOA 2ECCA 3KZYA 2R5ZB 1WJAA 2WAFA 3LSJA 3DEWA 2D2WA 2KL4A 3HTSB 4KN4X 3PL8A 4DYCA 1TLHB 2R7WA 3Q9VA 4ESFA 2GA1A 2DODA 1SVOA 2KPMA 3DKYA 3OR1C 1S7AA 3JRCA 2V26A 3DBRB 3OMYA 4MHGA 4EM2A 3QPLA 1LE8B 4G9YA 5HLGA 3ZMVA 4I2OA 1ZRDA 1HDDC 4X1EA 3EYIA 3LNQA 4ZTFA 4XN3A 1ULYA 5HS9A 4IQJA 4A3BJ 3A02A 4QSHA 5D8LB 4IVNA 1MBGA 3L2QA 5HOOA 5L3BA 1U0JA 3FWEA 3TOBA 2DFEA 2RN7A 1UFMA 3KEQA 5FKMA 4O5VA 1OCOH 4BBSJ 1DGWY 1TQPA 1ETWA 3W2AA 2B0LA 2Z33A 2F4MB 4ON0A 4E7LA 2L02A 5D5XB 2O7OA 4Y13A 5GPCA 4CYCB 4ZZLA 3RKYA 5F04A 1AU7A 2GLOA 1B72B 2DU9A 4BBRJ 1WJ5A 2VBYA 3WGHA 4OAYA 5BNGA 3H3VK 3VYTB 3RKXA 4P96A 2IS6A 1HQCA 2L4AA 2FSWA 5HDKA 1RESA 4U7BA 5FLXK 2RREA 1K78A 2L9RA 2VXZA 3OOUA 1W1WE 1WJDA 3BQZA 1MW7A 1R23A 4DOZA 1HSTA 2IGKA 4I76A 2O0YA 3IKVA 4II2A 1XSDA 2F48A 3I0TA 1ZRFA 2K3FA 3KZZA 4HX4A 2O61A 4IHYA 4Y17A 1YIOA 1FIAA 2UXXA 1RI7A 2LREA 4BH9A 5IYDJ 3HOUJ 3TW7A 2W57A 2EFOA 2FNAA 3AL0B 2CSOA 4KMUX 4JX6A 5D8KB 2OCEA 3JRAA 2LBFB 1CF7A 1GVJA 2E60A 4J19A 3CUQC 2F5CA 2EH3A 1U8BA 1YJWI 5CVRA 2STTA 2RV8A 4AVPA 1NK2P 2ZMEA 3WU2C 4A6EA 3CCEI 1ZREA 5EGOB 1JXSA 3S3NA 1TTYA 2EV5A 2Y9YA 4LB6B 1FSHA 3HOYJ 2L01A 3WE3A 3KFWX 3U21A 4XKWA 4C2MJ 1V3FA 5EDNA 2M4GA 2OA4A 1HCRA 3QRFF 2BE5F 4MFEA 4D1QA 2OF7A 3S17J 3OYAA 3KP6A 1KYWA 1TNTA 3MKYB 1LFPA 1KU9A 3FK6A 1PVEA 1S72I 2Y75A 3H3ZA 2STWA 2M5WA 4WXCA 5D4RA 2DN0A 1QHGA 2E34A 1HF0A 2PI0A 4HNVA 3FXJA 1IO2A 2VB6A 3HXLA 4UB6C 4CGZA 3UNGC 1RPWA 4ZC3A 4B8XA 5J8CA 1Y8RB 3FMRA 1X4OA 2EINH 2KIFA 1W7PA 2HDWA 4AIKA 1B4AA 2X6OA 1K78B 2QA4I 1Q1VA 1SMYF 3V7SA 4YRVA 3CMYA 3DQVC 4C2UA 3OYFA 4A2UA 4XM3A 1Z3XA 4NNJA 1YLFA 3JRIA 3G6EI 2UWMA 2JUCA 1IV8A 5EJCA 2FOWA 2Y48A 3R4KA 1LB2A 1OQYA 3JW4A 4MEXF 1HW5A 1IRZA 1J75A 2W7NA 1A6IA 3O8HA 4G6DA 4ABZA 4MIMA 4IX7A 2LDUA 2XHKA 3PSIA 5JFRA 2EWNA 5IOZA 3JTGA 3CO7C 1MNMC 4PJMA 3GX4X 1ZQ3P 5IOYA 1VF9A 2HI3A 3GCMA 2PN6A 2VJJA 2M30A 3TW6A 1CF7B 3E6DA 5CVUA 5IP6A 1X19A 5F1JA 1APLC 1RIOH 1XGSA 3HHHA 1IN4A 2DT6A 1ZRCA 2ZMEB 1H88C 2A5YB 1OCPA 2JZYA 4HSTA 4BS9A 1VQLI 3T8TA 1SAXA 1UHWA 2CMPA 5CQEA 2DFFA 4KYWA 1YRNA 3AG3H 4PSXA 2HXIA 2X4HA 1GV2A 1QO0D 4KIGA 2K4BA 3GTMJ 3EUHC 1ON1A 2GA2A 1UMQA 1FZPB 1VQ9I 1VQ6I 3WU0A 2OJED 2VJ4A 4KICA 4ZDPA 3LQRA 4BY7J 2Y9ZA 3MD2A 4I02A 3I4MJ 4BNCA 1UB9A 4A3LJ 3DWLE 2VC1A 2KDOA 3HIFA 2X0LA 3MZHA 3CUQA 4UVCA 3DEEA 5D6FA 5HNHA 5F0CA 3DTIA 1ZG5A 5E3LA 4KITB 3CCLI 1D1CA 2IEKA 1TW3A 2V9KA 3HOSA 4DQ2A 2F6CA 1GHCA 5ICCA 4E7ZA 2Y0SN 2LP0A 2X9DA 1QPIA 2GOXB 4KJZA 1Z91A 4XLEA 1W7PB 4FX4A 3E6CC 2BY0A 2IS4A 4V19K 2JVHA 1BC8C 1FOWA 2GM4A 2NNNA 5FLVA 2V1XA 3EQLF 1MMDA 2R0QC 4GO1A 5EEAA 4EJVA 2H8RA 3H92A 2R93J 3QPSA 5ICFA 2R5YA 2PEXA 2Z5UA 1D5VA 4BE0A 2PJRA 1XTAA 1SD5A 3MCZA 5J40A 3CJRB 4Y33A 3I58A 2LY2A 4XKBA 2NS0A 4M9ZA 2DI3A 3MEXA 1ZH5A 2HOEA 2L9NA 4L18B 1POGA 3K4LA 3F72A 1BIAA 1O7LA 3DPUA 1DDNA 4F7ZA 3DPLC 1IN8A 1AA7A 4WXHA 4YFXF 4PZJA 1ZGJA 3R61A 2CQQA 1LDDA 3LWFA 2NNYA 1DU0A 2QLZA 4BY1J 2R7SA 3K4KA 2WBMA 2IS2A 2PJPA 2LMDA 2RKHA 4E7HA 3TBIA 2H09A 5D5WB 2I10A 3K6GA 1XMXA 2V6CA 3CDLA 4BKXA 2L4MA 3ZMSA 5BPDA 2JWTA 2XF6A 3FM5A 5DUKA 1HC8A 2W24A 3BQYA 4LIUA 4A3FJ 4L9NA 4FCYA 4LLLA 3NARA 3HRUA 4XORA 1R9TJ 2VKDA 5LGNA 1ZGAA 1G2HA 1YRNB 4S05A 4WX9A 3NWTA 2CFOA 2IGNA 3HRSA 5DTDA 4EATA 2Q2EA 1BN5A 2Y69H 1BI0A 3LA7A 3RJPA 2O9LA 2NVXJ 3OYDA 3N4MA 1W7PD 2QKLB 3I9V2 3VFZA 1F43A 1RRJA 4OOIA 2WAQN 2IRFG 1BR2A 2FRHA 2MFZA 2OU2A 3ZPLA 3UKGA 1FT9A 2BBYA 1WH5A 2KFDA 2W84A 3BLYA 3GTLJ 5IYBJ 1K4SA 1I6HJ 2DA5A 1J0RA 1USSA 2YPRA 2VE8A 3E1SA 3FBNB 2I5UA 4BXFA 3SEQA 3NAUA 4XLFA 3M1CA 3F22A 5AONA 3A0HC 1JGSA 3OY9A 5JLWA 5FKLA 1S29A 2EJRA 3OYHA 1WGXA 1XGMA 2DA7A 4PSWA 2ZJPF 4YIRX 4WXDA 3CMMA 5GPAA 4GGGA 2ME0A 2BW3A 3BR6A 4OMYA 5E18F 4ANJA 1LEAA 4N9HA 1RUOA 1K6OA 1L3LA 1MMNA 2MG4A 3ROUA 3FXQA 3PNVA 2VJ5A 1TW2A 1GVDA 3R60A 1ZG1A 3OS2A 2VI6A 4LIVA 4XKVA 2R5YB 3FXRA 1N78A 1U9OA 4ENKA 2CU7A 1Y0NA 3H0GJ 3TMOA 2PJRB 4ZTJA 4IQ4A 2A68F 5FFZA 1PUEE 1A04A 2BOLA 3ZR8X 4BGDA 1K61A 1DP7P 3PNYA 4E6KG 4G6QA 3MKWB 2ZFWA 4UV9A 4GDFA 2LKXA 2FQ3A 4YFNF 1IF1A 2CRGA 4IOCF 2HDCA 1GXQA 2AHQA 3JAMK 1MJBA 4M9SA 4ZZDA 1KGSA 1LDJA 2M4KA 2WA0A 1MH4A 2P6TA 3DLAA 3IH4A 3Q0VA 4CA0A 2XAJA 3E6MA 2EBIA 1G59A 1ZKGA 1F9NA 3I53A 3UR3C 1PP8F 2IVMA 2E5ZA 4Q4ZF 1MSEC 4B3AA 4HPQA 1HBXG 2EILH 2IXSA 4DBRA 2X1DA 3C7JA 4OWRB 1JGGA 1B1BA 1P9QC 2GIZA 2MA3A 3HB9A 4FISA 2Q2EB 1Z0XA 1U78A 2Q1ZB 5KNLA 3OYLA 1Y8QB 2KIMA 4M73A 2O6GE 4KUMA 1JE8A 1QHHD 3F8CA 1FTTA 4E7KA 2F4IA 3RQIA 1V55H 3IWFA 2EIJH 1DQUA 5GTHC 3JREA 4P55A 4BHPA 4UUSA 1V54H 1GV5A 3REOA 3A01A 5HLTA 3GF2A 1YO5C 2BHZA 4RM2A 2CJJA 1X4PA 2K86A 3WE2A 3RYPA 3KEOA 3CC2I 4QWQA 2D1VA 2WB1N 3GMEA 4CCOA 2R7TA 3A03A 3E97A 2KISA 3CESA 1JI8A 1BBYA 1OCTC 4XOTA 2OV7A 1B59A 3M07A 4RLQA 3MQ0A 4M6VA 2DK8A 1P4WA 2BW3B 1FBQA 1EA3A 1YS7A 4RGXA 2ACJA 3IKTA 3S8PA 1VQNI 5DCFA 4AWXB 2JRMA 3L2RA 4HYEA 1XD7A 1ENHA 1TT5B 3CP8A 3FXMA 3ELKA 1FYMA 5C4XJ 1BW5A 4MLOA 3EUAA 3LSMA 3CJNA 4IZZA 3MVPA 1G6NA 1S7OA 3GTQJ 1QPMA 1D3YA 2HZTA 4HEA2 4AIDA 2VKHA 1SD6A 3H0DA 5B1AH 2X85A 3BP8A 5A2QZ 3J7AY 3G4SI 1ZK8A 1X3WB 3DEUA 5E3NA 4JQFA 4M3BA 4M74A 1MMSA 2IBDA 3BC8A 2A6HF 2VC0A 1I1GA 4XOPA 4Q47A 5JR3A 3V8KA 2P5VA 2ZJRF 1KZHA 2R7RA 5CLSA 2EV0A 3HL2A 5J1RA 1MMAA 4XRFA 3VYSB 3GTJJ 4XIDA 2RQQA 2QZ8A 2HKXA 5ICGA 4RB0A 4QPQA 3R6SA 2DOEA 3W6VA 3HGGA 5K5RA 4XLPF 4X6AJ 1YW8A 2WAQA 3KETA 2IP2A 3ZOBA 3H35A 2OTJI 3QYEA 5EF6A 1J7KA 1MIJA 1YW7A 4L5EA 3ZMDA 4L0ZB 3J7ZI 3BOQA 1J9IA 3LAJA 3DF8A 3SDGA 1JJ6C 1E3OC 2G7UA 5EG0A 3K9TA 3ONQA 2ZNZA 5HVQC 5E3OA 4ZJZA 3F21A 1XS9A 4UUSB 3G73A 3B6AA 4RAYA 4H4KC 4E7JA 1O7FA 4U0YA 1AKHA 3OSGA 4PDKA 3A01B 1JKOC 4I01A 2OPTA 1ZLJA 2CO5A 2XGXA 4FX0A 1O3TA 2EFQA 1WRJA 1DP3A 4R1HA 3ECHA 1FIPA 3FIWA 3BR3A 2OUMA 5F27A 5LRRA 2XKPA 2LTPA 4RGSA 2DTZA 3QP6A 4BYYA 1O3SA 3ZQLA 2LNBA 1T39A 5GP9A 3KLNA 3RZOJ 2B7EA 4ZYEA 1W0TA 3HTUA 2JA5J 1ETQA 4E4HA 1QU3A 2E7XA 1W4MA 4LLNA 2HU9A 1Z6RA 3HKZA 3SHFA 5FD5A 4ZYDA 3WTXC 3L9FA 2OQRA 3F8NA 4XLAA 3BG7A 2KJBA 4YEJA 2CS3A 2NVYJ 1IN6A 4IPAA 1MDMA 4L0YB 2K9LA 2O8KA 4U7DA 1IN7A 1LVKA 3KP5A 3FHZA 4IEJA 3EPZA 2L2OA 2E2HJ 2KKOA 3K1MA 1UG0A 1IGNA 3HGYA 1NK3P 2CYYA 3DPTA 2NVQJ 4NHJA 2HQ5A 3NQOA 2A3SA 4ZYGA 3CZ6A 4J00A 1VTNC 2QGUA 3E5UA 1R36A 4MGRA 3H1CA 3BG5A 3DTEA 5ED4A 2TDXA 3J80Z 3ESWB 4HLXA 4HQEA 1MKMA 5J4VA 3K2ZA 1X58A 3MKZA 1BC7C 2VE9A 3S2WA 2MD5A 1XMAA 1KA8A 3BJ6A 5DV5A 4RB1A 1SC7A 5E20A 2VONA 4M71A 1ZAOA 2JA8J 4Y52J 2G0EA 2PX9A 3JRFA 1EF4A 1YS6A 1QVTA 1X1DA 2CV0A 3VB2A 5JHUA 1E0EA 1U8RA 4A3DJ 2ZBKA 4M3DA 1U3EM 2QSGX 3C2BA 1ETYA 2HOAA 2MLKA 1RKWA 3K4NA 4IRHA 4UUTA 1XB4A 3HUGA 1I27A 4KT6A 3TGNA 3ZQQA 3Q3SA 2DXIA 1UG2A 5EG0B 3TQNA 1STZA 2AO9A 3M8EA 2QSFX 2LF8A 3WGGA 2DA6A 1YX5A 1YE9A 1O4XA 1ZLKA 4HZFA 5J4YA 1AKHB 3K2AA 2O8XA 2RNJA 2AS5F 1MBJA 3LL7A 4F92B 5E8IA 4HNUA 1TZLA 3CCMI 2UXNA 4IL6C 1RC9A 3OL3A 3QODA 3SZTA 1XCBA 3PSFA 2I8DA 3F9KA 4PJLA 1CGPA 2P5LC 4XRSA 4Y4RA 2R7DA 1LDKB 1MBFA 4BAYA 4ZYHA 2NOJB 3D1NI 2Z99A 5L3GA 2C6YA 5L3CA 1CQTA 5FRMA 2H27A 3HJEA 1SFOJ 2XIGA 1WQ2A 2DFHA 2JUGA 5CJ9A 2ZXHA 2W00A 4EM1A 1FP2A 2FA5A 2R7FA 3MFKA 3TDUC 4ZH4F 3CMEI 1HW2A 3BG6A 3LSRA 3K7AJ 4DZPA 4F3QA 1MDMB 3PIPF 1Z6TA 3WHBA 2M0MA 1XMKA 3OYIA 3F23A 4PFOA 3L09A 4Q48A 3QAHA 5J8FA 5FLXZ 5J1YA 2M7AA 4RBOA 2DPDA 2IGOA 3TOAA 3AL0C 1RR7A 5LHHA 1MBEA 4UV8A 1MSFC 4M3EA 4M3FA 4A3MJ 5JVGF 2Y31A 4CCKA 2CGPA 5KVRA 3FK7A 1Y1VJ 2JJ7A 1R5GA 1JHFA 1JUMA 1QVUA 2B9SA 3IH3A 1I1SA 1MNEA 2K5CA 2OBPA 4A5MA 5IT9K 2L54A 3GWZA 2W1OA 3HBLA 4BE2A 3K0LA 2MLGA 1WH7A 3K69A 4I0BA 4MFDA 2PMZN 5D5VB 2CQXA 3QYBA 3GLXA 5LLQA 3OYBA 5DD8A 3OWTA 2VT3A 2R4GA 4YELA 3NWSA 1P7IA 1OFCX 3SEZA 3GVAA 2XAUA 4Y3OA 1X1BA 3X2QH 1S9HA 4J01A 2R7ZJ 3K1PA 2ESHA 1F36A 3ZN1A 2E7WA 2JSPA 2RGVA 5H6QA 3HUGB 4HRIA 3FZVA 1YFHA 3WGIA 2HEOA 5ILUA 5GAEJ 4KIFA 4S0HB 3OYCA 4RAFA 5IT9Z 1U5TC 1IJWC 4AIHA 4HOBA 1Y1WJ 1UELB 2M8GX 4YG2F 1LKXA 1P92A 4DYQA 5CVVA 1U2WA 3ECOA 2FE3A 2HZDA 4ENJA 2IGMA 3W2WA 3HSEA 5BOXA 1VQ5I 3HC7A 2Y30A 3W6JB 4BQAA 2AXLA 4DZJA 5DS9A 4NC6A 2P7CB 1JUPA 4A93J 2GXGA 2WAEA 3SZGA 1B8IA 2E36A 2ZNYA 3V7RA 5BMZA 1I3AA 4HLYA 1D5YA 1HW1A 5KK1A 2MBFA 3QU6A 2HVQA 1IXRC 3GUDA 1DU6A 3SXYA 4XLNF 3L1PA 1E17A 4XL9A 1IRGA 4OMZA 3ABKH 3DKXA 2DA2A 4O3MA 2F5DA 2FBKA 1YW9A 1IUYA 4HG2A 2GQQA 3RYRA 4A12A 1BL0A 1XGNA 1YJNI 4F93B 2CV2A 3QP5A 2YSRA 2HOSA 4GYGA 1FWZA 5D4SA 1ONVA 2L7ZA 2ZXWH 3NEUA 4HDUA 1E3PA 2XRLA 2HNHA 1FYLA 2VJIA 1XG1A 4PUSA 1XN7A 4CYDA 2HDDA 2AQFA 3K70D 3OS1A 1H0MA 1X3UA 2ZB9A 3CF2A 5CPRB 1R5HA 4EM0B 5HNFA 5EYRA 5F1RA 2VPLA 4QPOA 3RTRA 2HYGD 2JTVA 1K79A 5L3EA 2BEOA 3TDZC 4KMFA 1KU3A 4B4CA 2PQ8A 3SJMA 4MTEA 2K85A 3D5SC 1XPXA 4U0WA 1O57A 1P6RA 3ZN0A 1V5GA 3NRVA 1WFXA 1IRFA 1OMIA 2KHMA 4HA8A 4L9VA 3BZKA 4A6DA 4IOAF 2DTRA 3GFMA 3L2VA 4GRIA 2VL8A 1SANA 2E5NA 2WV1A 5D6EA 2FD5A 3RI4A 4BXXJ 1ETXA 2HVRA 4D7MA 4UUVA 3HRMA 2R7OA 1T8IA 3I71A 3OYNA 1WVRA 2CG4A 3D5RC 4F55A 2HWVA 2O5RA 1R22A 3G1LA 3E7LA 1MJAA 1Y56A 3BTCA 1ETKA 4XQFA 4X0GA 4AIJA 2Q0OA 2DMQA 1R00A 3FKJA 4AYBN 3OR2C 3ZRGA 4HBLA 3O8GA 2COBA 3QQAA 1VNDA 1B8IB 3TO6A 1JTYA 1A6QA 4LK0F 2DYRH 3LQQA 1ZGWA 4NB5A 5JHFA 1SVLA 5GAHJ 2HXOA 3PJRA 4I99C 2X48A 1BR1A 4F91B 2LSOA 4ZDLA 4CSWA 2K7LA 5KAIC 2ICWG 1EV7A 1HDPA 2R3SA 4KT5C 1J09A 3BZ6A 1JKPC 4U87A 4D0PA 3E5QA 1X1CA 1LFBA 1QZEA 4ESJA 3M3YJ 2VXDA 1WJCA 1ORKA 3TL4X 5HODA 4I0AA 2P4WA 4B48A 4G8XA 2ZJQF 1ZTRA 4GFBA 5DEQA 2COMA 4ETSA 2B63J 3RPUA 2KP6A 3CP2A 1BIBA 1QNTA 4YIFA 1T95A 2CQNA 3CLOA 1W5TA 3M9AA 3WTUC 2XKOA 3K10A 2R7XA 1VI0A 2HOTA 2KRHA 4W1UA 1BI2A 2M3AA 4IKFA 4GYIA 1FMWA 5CKTA 3LSHA 3FXKA 2NXNB 4ZYAA 1WWXA 1SMTA 3TEDA 2IA2A 2M87A 3N97A 1TBXA 3ZMUA 5M3FJ 4IHWA 2CW7A 3W2VA 3ASNH 4A3IJ 3F0CA 2F2EA 2ECBA 3M8FA 3LAPA 5E3MA 1TT0A 3C1DA 2XAHA 1XC5A 4HQMA 2FF4A 4IJAA 3KX2A 4ENMA 1MH3A 3BPXA 4HF0A 1IV6A 2DPUA 4CCJA 4A3CJ 2DFIA 2XVCA 4FT8A 3ASOH 3JRGA 3ABLH 1XDSA 2GWRA 3DLLF 1KU2A 2CWEA 2M1BA 3ZXSA 2NS8A 2KZGA 2BVMA 4TV7A 5ILSA 1RUNA 5EZHA 4ZDOA 1HXDA 2H6CA 2VUMJ 4PJ0C 3CUQB 4XMYA 5JI6A 1G8XA 2XGCA 2R7UA 3GLLA 4M9XA 1XSVA 1IDYA 4HW0A 3DTKA 3IHUA 3LA3A 3RZDJ 1PDNC 2P7VB 2YR2A 3FF5A 4ASNA 2V7FA 4BL0B 2DOAA 2XAQA 2FUG2 3HPGA 1YJ9I 2XRNA 3PUBA 3QPHA 1K7AA 3EUHA 2LR8A 2UUZA 2GAUA 3VPRA 1W0UA 2WC2A 1TQIA 2HYFA 3J81K 5J47A 1GT0C 4Z6YA 2P8TA 2BY3A 3HHGA 3PQKA 1R1TA 2OD5A 2VBZA 3GFJA 2Z9OA 4I7HA 3IP4B 3S1NJ 1D0XA 4W97A 1R5ID 4BHCA 1O3QA 3M8JA 2DA4A 5LEJA 3CMAI 1OYYA 3GFLA 5GAGJ 1P2FA 3L2CA 5CQGA 3CCQI 4AD9A 3CJQB 2RC4A 1PUFA 4KIBA 3S1MJ 4R79A 3QOPA 2DOFA 3J81Z 3E0JB 5DCMA 2K9MA 4IF4A 1V4RA 1MD0A 1IRXA 1VQOI 2P81A 2D45A 2DA1A 2MABA 1RZ4A 1FSEA 2BY2A 2H8WA 1BI3A 5CVIA 1U6GA 2JA6J 4D5CA 5EZGA 3V7CA 2DMTA 1W36D 1FOXA 1P4XA 5B3SH 3GYHX 3E3VA 3ML6A 2OTLI 5B66C 2DK5A 3JAMZ 2IAIA 3ABTA 3GTKJ 3WTZA 2XROA 3HOZJ 1TWAJ 2V6EA 2XGDA 2BY1A 3BR0A 3RDIA 2H6BA 4JYKA 1R4MB 2LRDA 3FXLA 2XASA 1WCMJ 3ZCOA 2EV6A 4RA2A 1RKTA 1WJEA 2E1NA 2JN6A 2ESNA 2FMYA 2QVOA 1RNLA 3BTLA 3F6OA 5DM7F 1X2NA 2XAFA 1G3TA 2OZUA 4Y15A 4XBFA 4RGUA 1BA5A 4N4NB 3HYIA 5FKKA 2Y0SA 1ETVA 3PM1A 5FJ8J 4G6TB 1KYZA 2VQCA 2MW8A 1A31A 2P5KA 3H5AA 1LFUP 5CYVA 1YG2A 2O03A 2IJLA 4UB8C 1MBKA 4EEFG 1DGRM 3SDBA 2HR3A 1ODDA 4RDUA 4P5OA 1OR7C 4CUGA 1JUSA 4PK4A 5M5YJ 4XR6A 1Y39A 5J1UA 3F8MA 1SAUA 2EPFA 1VQMI 3G3ZA 2H94A 1B6AA 4G94A 3HEFA 1R6RA 5CVJA 1RR8C 2E2JJ 1SFXA 5M3MJ 4M6XA 2DQRA 3CQZJ 3FXOA 2HPIA 4FHTA 4NQWA 1WHUA 4OU0A 4XKCA 4RB2C 4HV6A 1FOKA 1LEBA 2X1CA 3OIOA 4GCVA 3VYRB 4P9UA 1GXPA 2A05A 2LG4A 2QCOA 1YTYA 2ZXJA 3E6BA 3AFHA 2KT0A 4PJNA 3U1KA 1HA8A 1V5EA 3RKWA 3IUOA 2RQPA 4BDYA 2JVGA 3LSKA 1PUFB 3S3MA 2V1DA 3ZMZA 5M5XJ 2UV1A 3JRDA 3KP4A 4EJOA 3L2UA 4DBQA 3S2DJ 4OAZA 5DCMB 2VLAA 2L7MP 1DUXC 3K70C 1E3HA 1IDZA 3BG3A 1UAAA 1XX5A 5B5EC 1S8NA 2L5QA 4IRIA 3BG9A 1J2XA 2UZKA 1IXSB 4ITVA 3GZ6A 2DDAA 1HSJA 4O6JA 4RAGA 2CUJA 1Z77A 4M6YA 4MQVA 4BHBA 2M0CA 4PJJA 3ZQCA 4D5FA 4XLHA 3GW2A 2YS9A 1Z9CA 2D5VA 1X3ZB 4XLCA 1QZZA 2HQAA 1Z7LA 5LGUA 5IY5H 3KZIC 1Q1HA 1OISA 2AXTC 5IT3A 2EZHA 3ZQGA 1UHMA 1FOYA 1OCRH 1W5SA 3EETA 1ZR2A 3DCFA 3TO7A 5AIPA 1VQKI 3OYEA 3I54A 2KRCA 3LSTA 2FJ1A 3RPQA 4AU7A 3PQJA 2LKSA 1B9NA 4CDGA 4EMSA 2JK3A 4UNOA 5LD2C 3O6BB 4S04A 1S6LA 3DBHB 5FFXA 3V42A 2CQ7A 1WSUA 2BGCA 3JSOA 3F6VA 2W48A 1IC8A 1BJAA 2R92J 1F1ZA 2RDPA 2ZFUA 3EDPA 3ZQHA 4QIWN 5KHDA 3K4JA 2O3FA 3CF5F 3QOEA 3O3KA 4I98B 3IC7A 3DBLB 5BPIA 5FO5A 4BXUA 4L9JA 4PGGA 3WTYC 2KLOA 5B1BH 4NQWB 2BHYA 1L0OC 2L3DA 2VN2A 2JPCA 1R1VA 2QEXI 3PO2J 2VKVA 4RGRA 3CO6C 4A5NA 2ZMEC 4XNFA 3IRQA 2D1HA 1NG7A 5DUIA 1JKQC 1XDUA 3KPHA 2A6EF 2QQAA 3ERMA 1RETA 1H9GA 3P7NA 3RKQA 3C2GA 4MTDA 4RB3C 4UVBA 2KIUA 4R8HA 2DLLA 1MJ9A 4K2EA 3WODF 5FLMJ 1PP7U 2CUEA 1WJFA 1BOBA 2XV4S 4IXAA 2MC4A 2ZSHB 2QQ9A 2BXYA 4N9IA 4YIIA 2MH2A 2XB5A 2BYVE 3R0AA 5C44J 2LOOA 4C9YA 3CCUI 2ZKZA 4WK8F 5F08A 4MQ9F 3Q5FA 1X2MA 2M9HA 4ENNA 4DYRA 1OLTA 2W4SA 2GXAA 3LA2A 1G3WA 2ID3A 2KZVA 3IV5A 4P1WA 1R1UA 1J5YA 1ZG3A 2TRTA 4CXFA 3VEPA 2W25A 1SD7A 2NYXA 4XN0A 2BXZA 2MD0A 4A0XA 1ON2A 4WCGA 3KP7A 4EGYA 2ISYA 1P4AA 1C0WA 2NS7A 3G1MA 1H8AC 3M4OJ 1JTXA 3G71I 3L7WA 2WB1A 3DU5A 4II3A 1P7JA 4B09A 3M1EA 2GZWA 3VSLA 2E19A 4UY8I 4L5JA 4HAMA 1TNSA 3V8JA 3WG7H 3PNTA 4IO9F 1NH3A 4A3GJ 3H9JA 3BR1A 2DAOA 1UZCA 2K27A 1FX7A 4BDZA 2MYSA 3G2BA 3A2KA 3H5NA 1ZYRF 3G1OA 5LFAA 3FM3A 1H9TA 3I5UA 3BROA 4A69C 4FE7A 2M45A 2K02A 2PG4A 4DJAA 2AQEA 2QQBA 2WY8Q 1FNNA 2PFBA 2ZJ2A 2DW4A 2LH9A 1D1AA 4FQGA 1SVMA 3MZYA 2QF7A 3QYFA 2KDZA 1A36A 5K5OA 4IHSA 5E79C 4RAZA 3CCJI 4PGHA 2OCCH 3EYYA 1A35A 2E2IJ 3H5RA 4IHXA 3S1QJ 5L3DA 2FU4A 2XB0X 4A3JJ 2HYJA 2FQ4A 2EA4A 4OIOF 4CICA 4LMYA 2JMWA 2YU3A 4OIPF 3K4MA 1I5ZA 2NVUB 3AG2H 1O3RA 2DCEA 3F3XA 4HV5A 5AIQA 3BTIA 1D1BA 1ZHFA 3U2RA 5D5UB 1WZ2A 1YIJI 1VQ7I 4KISA 3F8BA 2GXBA 4LGWA 4OIQF 2EA2A 2EB7A 1TWHJ 4LITA 3AG1H 2LK2A 3IWZA 2CW0F 3BY6A 1K83J 4OIRF 4XK4A 3OSFA 4CCLA 1IZ1A 1H89C 2V1UA 3MN2A 4UVAA 1BR4A 1R71A 4CO8A 1W36C 1UHSA 2K9QA 4NC7A 2VODA 1AHDP 3FHNA 2FOKA 3BDDA 3K1NA 2DMPA 3M7GA 1QRYA 3H36A 4A3EJ 2EZKA 2QBYA 4HX7A 4RLFA 1ETOA 3OOPA 3MWMA 1UCRA 4B47A 2Z1DA 3LFKA 1YX3A 2EFNA 2GBYA 1NG6A 4BJTA 4KDPA 3HPHA 1YOVB 3BTJA 2JSCA 2QM3A 3BCAA 5HLHA 4EV0A 3IRRA 1XGOA 3QU3A 3MZ8A 3I3LA 2ISZA 2BZTA 3OYJA 3LSGA 3OV8A 3JR9A 3JSPA 2L9SA 3ZQ7A 3SQNA 2HTJA 1VQPI 1LUJB 2CV1A 4KA4A 1WPKA 1PYVA 2DDBA 3PFIA 1NHAA 2EIMH 3OL4A 3BT9A 3A0BC 5E8GA 4LB5A 3CJTB 3JRHA 3RCOA 4IHTA 1X1AA 2J5OA 1B9MA 2XC7A 2VBXA 3OIQA 4G7ZF 3P9KA 2XPVA 5FGMA 3HRTA 4WF2A 2IW5A 1AOYA 1FC3A 2DA3A 1YYVA 2K4JA 2E1OA 3FX3A 4JP0A 1OYWA 3MAJA 5K5QA 1KQ9A 2R7QA 3S32A 1MNDA 2XDVA 3KIOA 1T08B 3FDYA 3RSNA 6PAXA 2NOGA 1OYIA 4EJWA 5K7FA 1JT6A 5HLIA 3J7AO 1R7JA 3QWLA 4H0EA 2A61A 5DM6F 2EK5A 2FBHA 2CFXA 5H2FC 4JBAA 1XSXA 2HTSA 1TC3C 2DT7B 3WU1B 4E7IA 5FROA 1EJ9A 5E1ZB 3Q9SA 1IG7A 5TGTA 3C3WA 3E5XA 2QUFA 4DW6A 2XSDC 4B44A 3CCRI 1QZYA 1Z21A 4LOCA 2Q8KA 3O2PE 2LLKA 2M2EA 2CH0A 3HDDA 1SFEA 2Z3YA 1TWCJ 3DFGA 1VQ4I 3WTTC 1LNWA 1DPUA 2FX0A 3LFUA 2XAGA 3FBIB 1N75A 1JKRC 2OQGA 2Y2ZA 2HGCA 3DXJF 3A4CA 4HX8A 3HOWJ 2EFWA 1ZN2A 2QBYB 5E17F 2ELHA 1K6YA 3C18A 1Y0UA 1PJRA 3Q0UA 3JRBA 3HM5A 3WTVC 4HNTA 2FNPA 3PUFA 3S3OA 1LVAA 5GADJ 5H20A 4B1RA 2EFPA 3W6KB 1R4NB 2J5PA 2GIVA 2DYSH 1XCVA 3EUKL 1WJBA 3SYTA 1F5TA 2K40A 2XPUA 2HQNA 3BCBA 5L3FA 3H3UA 2VQGA 2ME6A 5LBQA 5J6XA 3H9QA 4XSXF 3I59A 3PFYA 2CUZA 4AUXA 3GZNB 2KJCA 1ZR4A 4XSZF 1U5TA 5TISC 1BOAA 2VASA 5LHGA 2DT5A 3IAS2 4A0ZA 2VQLA 1T6SA 1WI3A 4KN7X 2QKMB 1N77A 1Z67A 3VOEA 2EQRA 4YFKF 3I64A 2L7KA 3SZPA 3CCSI 3LMMA 2OAZA 2YX7A 2PBIA 1R58A 5E1WA 2HQRA 4MEYF 3VSKA 2E35A 5JVTA 4PCQA 4FETA 1FP1D 2WV0A 4U88A 1K4TA 4F52A 2ELJA 2HFHA 5C4JJ 1A5JA 3I4PA 2JPBA 4JK1X 2Z2SB 3HZJA 2L7FP 3W3CA 3HOVJ 2PMZA 1T33A 2RVCA 3CCYA 1HOMA 2CW8A 3KLOA 1NTCA 1HKSA 1Y6IA 4BQQA 1FMVA 1LPQA 3VWBA 2EIKH 2A69F 4NDLA 2V9VA 3KYDB 4P9FA 4AM3A 3BJOA 4DGWB 5F64A 1G4DA 2XPWA 3KE2A 4D7NA 5HS7A 3KP2A 2F5FA 1ERDA 2HPMA 2M34A 5H6RA 2E1MC 4B3XA 3HOTA 2ZSIB 4BE1A 1SD4A 1T98A 3A1YA 2HKOA 3D5LA 4LK1F 3MKLA 4C30A 1F4KA 2ZO4A 2BV6A 4V2FA 4L5IA 1FYKA 2PLYA 1E2XA 2A5WA 3CUOA 4BEHA 4FASD 3AG4H 2W85A 4BUPA 1FTZA 1BW6A 1ACIA 2WY7Q 3HG9A 4BJ6C 1Z1DA 2KMUA 2LY1A 4MNUA 5LRSA 1JHHA 2FMLA 4Y7NJ 4EJTA 1I3QJ 2HS5A 3ZGKA 3S16J 3ZQIA 3DKWA 2X6YA 3DP7A 5TRDA 1ZARA 2A6TA 4PFPA 4AC0A 3B73A 5ICEA 3J7YJ 3KYLA 1EH7A 3I56I 5M5WJ 3WG9A 1DPRA 2G7HA 1FBUA 1OJLA 3KYCB 3OIPA 1TQMA 2XF7A 3I4NJ 3DV8A 4C3JJ 4AVZA 2KQRA 1TP4A 1VFCA 2WWYA 2JT1A 1I6XA 3KEYA 5HDNA 2LYCA 3I59B 2K9NA 4G7OF 1WI9A 1SEUA 3CTAA 2VOOA 2VKEA 3OYGA 1Z3YA 4XONA 1U5TB 1M1EB 2KRFA 2VOPA 2V79A 3ZP5A 2LKPA 2NVTJ 2YU9J 4RS8A 1FBSA 1FY7A 1GLNA 3FKIJ 3GBGA 1QA6A 4B43A 3HKZN 5EEGA 5EEHA 2FXAA 2XGEA 2MSYA 2Y0MA 1KQ0A 5LHIA 3S93A 1D8JA 2RNGA 1IW7F 4DIQA 3OYKA 4C2TA 3I55I 2LY9A 5FKNA 3V8LA 4Q5SF 4UXNA 2MH9A 5K7HA 1MBHA 2G9WA 2V1NA 2IS1A 5BQTA 1V5FA 1QBJA 2EZLA 3T1BA 3ERED 3IAM2 4MO7A 4NUBA 5KAFC 4EGZA 3BWGA 2JRTA 2N8GA 3B02A 5E1XA 2ADUA 1USTA 3IH2A 2OZ6A 4HSRA 4HDVA 4IRGA 3BZCA 3TP3A 5HDGA 1IAWA 4LJZF 5DD4A 2EZIA 2LVSA 3WTWC 2PMHA 3CC7I 1TWFJ 2XF5A 3WHCA 2WTEA 2DMUA 2FBIA 2R7VA 4BEHB 1N25A 2IA1A 3HSRA 4BQOA 3RIRA 5FB2A 1AWCA 2KIQA 1I50J 4LG3A 4AYBA 5K1YA 2DMNA 2NRAC 4C3HJ 4CZZA 1ITYA 1HKQA 4E7SA 4E70A 3L00A 2K9SA 1EH8A 2NAZA 2VQHA 1MZBA 3Q0WA 4ESBA 2FEZA 3AKZA 3CD6I 2RAEA 3F8FA 4Z2YA 2MC3A 2XSJC 1Z05A 3FMSA 4V2GA 2GOMA 4GXOA 1IN5A 1YQAA 3RPUD 3T0YA 4A0YA 3U1DA 2Z16A 3FISA 5IP9J 5F0HA 5ERIA 9ANTA 4M72A 1T0FC 3KCCA 1VQ8I 2DJNA 2ELKA 1T56A 2PMUA 4U0VA 1FLIA 1BM9A 3ABUA 3ULQB 3ZQFA 4OINF 2H1LA 3TKYA 3PIOF 2CUFA 3RQ4A 3LSIA 4LG0A 4NBQA 5C3EJ 3WTSC 4G7HF 2ID6A 4DNCA 3CC4I 3T5XA 3KP3A 4N4OB 4KFCA 1R49A 3BJAA 3GTOJ 3S2HJ 4N0BA 5BS6A 4QLCU 4I09A 2OC6A 1LQ1A 1SFKA 5A2QK 4JX4A 2VIXA 2BVLA 2LFBA 2VT2A 1YITI 2IPQX 3GFIA 3TP0A 2L9VA 3VDXA 3JTHA 1G3YA 3GTGJ 3QPTA 5LGTA 2CQKA 4A3KJ 2DJIA 2XUBA 5IPAA 4BJ5C 2VPRA 2QQ8A 2IT0A 2X51A 3R0JA 2LD5A 1FEXA 2F5VA 4FE4A 3S1RJ 4C3IJ 3SFIA 2YUSA 4EJUA 5IP7J 5LEKA 3K4BA 1FJLA 2X6WA 1JT0A 1IUFA 1D0YA 2MGQA 3P9IA 1ZELA 4XICA 3K4CA 4CZCA 5TJJA 1EKEA 3AAFA 2E1CA 2ZCWA 2R5ZA 2M8EA 3BR2A 1QGPA 1JJ8C 2YX4A 4HF2A 3CDIA 1BJZA 3ISPA 3VYUB 1KQ8A 3COAC 5GTIC 2M7BA 1D0ZA 2DO7A 2JA2A 2K3PA 3JCUC 1LE8A 4CH7A 4LFUA 5HS8A 3CCVI 2IA0A 2P6SA 4LLGF 3D0SA 2TCTA 4FTHA 4CHUA 1S5LC 1D8KA 2F5EA 1OCCH 3FXUA 3P5JA 1G3SA 1T2KA 2LC2A 4CCMA 1KONA 2H1KA 2W82A 3ZMTA 4XRSG 2DBBA 5F0FA 1W5CC 4QTRA 3LSPA 1WKMA 4D9JA 3GXOA 3T8RA 3V4GA 2V9PA 1UJ8A 3B6CA 3P9CA 5K7ZA 1I39A 1TL8A 2QSHX 1OCZH 3HSFA 4CYCA 4WWCA 2JQ7A 3MMYB 1B72A 2E71A 1MGTA 2V4JC 3ABMH 4XRMA 3GTPJ 2QWWA 3BPVA 2X6XA 1HKTA 5F6FA 2E1MB 3C2HA 1T38A 3BR5A 2X1EA 4NC8A 4LG0B 2LF7A
chains in the Genus database with same CATH topology
3GO5A 1LJ9A 1S3JA 5FD6A 4HF1A 4LD5A 3GZ5A 5DYMA 2QYOA 3J80K 3SFZA 1SFUA 1QQIA 3CDHA 1OKRA 1OR7A 1J59A 3IL2A 3TO9A 2ETHA 1BI1A 4KNYA 1IXCA 2VBWA 1REPC 1T0FA 2QENA 3VODA 1OPCA 4EVIA 2A07F 1EH6A 3FMQA 1KU7A 3U9GA 2DQLA 1Z7UA 4UHTA 4EQQA 4L9TA 5DDGA 3GEZA 5ILVA 1FPQA 3KZYA 2D2WA 3HTSB 4KN4X 1TLHB 3Q9VA 4ESFA 2GA1A 1S7AA 4MHGA 4EM2A 4G9YA 5HLGA 3ZMVA 4I2OA 1ZRDA 3EYIA 1ULYA 5HS9A 5D8LB 4IVNA 5HOOA 5L3BA 3FWEA 3TOBA 2RN7A 3KEQA 1UFMA 4O5VA 1TQPA 2B0LA 2Z33A 4ON0A 2L02A 5D5XB 4Y13A 4ZZLA 3RKYA 2DU9A 2VBYA 3WGHA 3RKXA 4P96A 1HQCA 2L4AA 2FSWA 5HDKA 4U7BA 5FLXK 1K78A 2VXZA 1R23A 1HSTA 2O0YA 3IKVA 1XSDA 3I0TA 1ZRFA 3KZZA 4HX4A 2O61A 4Y17A 1YIOA 2UXXA 1RI7A 4BH9A 2W57A 2EFOA 2FNAA 2CSOA 4KMUX 5D8KB 1CF7A 1GVJA 3CUQC 2F5CA 5CVRA 2STTA 2RV8A 4AVPA 1ZREA 2ZMEA 4A6EA 1JXSA 1TTYA 2EV5A 4LB6B 1FSHA 2L01A 3WE3A 3KFWX 1V3FA 2OA4A 3QRFF 2BE5F 3KP6A 1KYWA 1TNTA 1KU9A 2Y75A 3H3ZA 2STWA 2M5WA 4WXCA 5D4RA 2PI0A 4CGZA 4B8XA 5J8CA 3FMRA 2KIFA 1W7PA 4AIKA 1B4AA 1K78B 1SMYF 3V7SA 3DQVC 4A2UA 1YLFA 2UWMA 2Y48A 3R4KA 1LB2A 3JW4A 4MEXF 1HW5A 1J75A 4G6DA 2LDUA 2XHKA 5JFRA 2EWNA 3JTGA 3CO7C 3GX4X 2PN6A 2M30A 1CF7B 3E6DA 5CVUA 1RIOH 1XGSA 3HHHA 1IN4A 1ZRCA 2ZMEB 2A5YB 2JZYA 3T8TA 1SAXA 1UHWA 4KYWA 2X4HA 1QO0D 4KIGA 2K4BA 1ON1A 2GA2A 1FZPB 3WU0A 4KICA 3LQRA 4I02A 4BNCA 1UB9A 2VC1A 3HIFA 2X0LA 3MZHA 3CUQA 4UVCA 5D6FA 1ZG5A 1TW3A 3HOSA 4DQ2A 1GHCA 5ICCA 1Z91A 1W7PB 4FX4A 3E6CC 1BC8C 2NNNA 2V1XA 3EQLF 4GO1A 4EJVA 3H92A 5ICFA 2PEXA 2Z5UA 1D5VA 3MCZA 1SD5A 3I58A 2NS0A 4M9ZA 2DI3A 3MEXA 1ZH5A 2HOEA 4L18B 3F72A 1BIAA 1O7LA 1DDNA 4F7ZA 3DPLC 1IN8A 4WXHA 4YFXF 4PZJA 1ZGJA 3R61A 3LWFA 1LDDA 2NNYA 2QLZA 2PJPA 2RKHA 2H09A 5D5WB 2V6CA 2L4MA 3ZMSA 5BPDA 3FM5A 5DUKA 2W24A 4L9NA 4LLLA 3HRUA 5LGNA 1ZGAA 4S05A 4WX9A 3HRSA 2Q2EA 1BN5A 1BI0A 3LA7A 3RJPA 3N4MA 1W7PD 3VFZA 4OOIA 2IRFG 2FRHA 2OU2A 3ZPLA 1FT9A 2BBYA 2W84A 1J0RA 1USSA 2YPRA 2VE8A 3F22A 5AONA 1JGSA 1S29A 2EJRA 1XGMA 4WXDA 4GGGA 4OMYA 5E18F 1LEAA 4N9HA 1RUOA 1K6OA 1L3LA 3ROUA 3FXQA 1TW2A 3R60A 1ZG1A 3FXRA 4ENKA 2A68F 5FFZA 1PUEE 1A04A 1DP7P 4G6QA 2ZFWA 4UV9A 2FQ3A 4YFNF 1IF1A 2HDCA 1GXQA 3JAMK 1MJBA 4M9SA 4ZZDA 1KGSA 1LDJA 3LAJA 2P6TA 2XAJA 3E6MA 1F9NA 3I53A 1PP8F 2IVMA 4Q4ZF 1HBXG 3C7JA 1B1BA 2MA3A 1U78A 2KIMA 4M73A 2O6GE 4KUMA 1JE8A 3F8CA 3IWFA 4P55A 4BHPA 3REOA 3GF2A 1YO5C 2K86A 3WE2A 3RYPA 3KEOA 4QWQA 2D1VA 3E97A 1BBYA 1B59A 3MQ0A 2DK8A 1P4WA 1FBQA 1YS7A 4RGXA 2ACJA 3IKTA 5DCFA 4AWXB 4HYEA 1XD7A 1FYMA 3ELKA 3CJNA 1G6NA 1S7OA 1D3YA 1QPMA 2HZTA 1SD6A 3BP8A 5A2QZ 3DEUA 4JQFA 4M74A 2A6HF 2VC0A 1I1GA 4Q47A 5JR3A 3V8KA 2P5VA 5CLSA 2EV0A 4XRFA 2QZ8A 2HKXA 5ICGA 4RB0A 3R6SA 5K5RA 4XLPF 1YW8A 3KETA 2IP2A 1J7KA 1YW7A 3ZMDA 4L0ZB 3BOQA 1J9IA 3DF8A 2G7UA 3K9TA 2ZNZA 5HVQC 3F21A 3G73A 4RAYA 1O7FA 4U0YA 4PDKA 4I01A 2XGXA 1ZLJA 2CO5A 4FX0A 1O3TA 2EFQA 1WRJA 4R1HA 3ECHA 5LRRA 2XKPA 4RGSA 1O3SA 3QP6A 4BYYA 1T39A 2LNBA 3KLNA 4ZYEA 3HTUA 2E7XA 1W4MA 4LLNA 1Z6RA 3SHFA 4ZYDA 5FD5A 3WTXC 3L9FA 2OQRA 3F8NA 2KJBA 1IN6A 4IPAA 1MDMA 4L0YB 4U7DA 1IN7A 3KP5A 3FHZA 2KKOA 3K1MA 2CYYA 3DPTA 4NHJA 3NQOA 2A3SA 4ZYGA 1VTNC 3E5UA 1R36A 4MGRA 5ED4A 2TDXA 3J80Z 4HLXA 4HQEA 1MKMA 3K2ZA 1BC7C 2VE9A 3S2WA 2MD5A 1XMAA 1KA8A 3BJ6A 5DV5A 4RB1A 5E20A 2VONA 4M71A 1ZAOA 1YS6A 3VB2A 5JHUA 1U8RA 2ZBKA 1U3EM 2MLKA 4IRHA 1XB4A 3HUGA 1I27A 3TGNA 3TQNA 1STZA 3M8EA 2LF8A 3WGGA 1ZLKA 4HZFA 2O8XA 2RNJA 2AS5F 5E8IA 2UXNA 3SZTA 1XCBA 1CGPA 2P5LC 2R7DA 1LDKB 4BAYA 4ZYHA 2Z99A 5L3GA 2C6YA 5L3CA 2H27A 2XIGA 1WQ2A 5CJ9A 4EM1A 1FP2A 2FA5A 2R7FA 3MFKA 3TDUC 4ZH4F 1HW2A 1MDMB 1Z6TA 1XMKA 3F23A 3L09A 4Q48A 3QAHA 5J8FA 5FLXZ 2DPDA 3TOAA 5LHHA 4UV8A 2CGPA 5KVRA 1R5GA 1JHFA 1I1SA 4A5MA 2OBPA 5IT9K 2L54A 3GWZA 3K0LA 2MLGA 3K69A 4I0BA 5D5VB 3GLXA 5LLQA 5DD8A 2VT3A 3GVAA 3K1PA 2ESHA 3ZN1A 2E7WA 5H6QA 2RGVA 3FZVA 1YFHA 3WGIA 2HEOA 5ILUA 4KIFA 5IT9Z 1U5TC 4AIHA 4HOBA 4YG2F 1P92A 5CVVA 1U2WA 3ECOA 2FE3A 4ENJA 5BOXA 3HSEA 3W6JB 4BQAA 2AXLA 2P7CB 2GXGA 2ZNYA 3V7RA 5BMZA 4HLYA 1HW1A 5KK1A 2MBFA 3QU6A 1IXRC 3GUDA 3SXYA 4XLNF 1E17A 1IRGA 4OMZA 4O3MA 2F5DA 2FBKA 1YW9A 1IUYA 2GQQA 3RYRA 4A12A 1XGNA 3QP5A 2YSRA 4GYGA 1FWZA 5D4SA 1ONVA 3NEUA 4HDUA 1FYLA 1XN7A 4CYDA 1H0MA 1X3UA 1R5HA 4EM0B 5F1RA 3RTRA 2HYGD 2JTVA 1K79A 5L3EA 2BEOA 3TDZC 4KMFA 1KU3A 2PQ8A 4MTEA 4U0WA 1O57A 1P6RA 3ZN0A 3NRVA 1IRFA 1OMIA 4HA8A 4L9VA 4A6DA 2DTRA 3GFMA 5D6EA 3RI4A 4UUVA 3HRMA 3I71A 2CG4A 2HWVA 1R22A 1MJAA 4AIJA 2Q0OA 1R00A 4HBLA 3TO6A 4LK0F 3LQQA 4NB5A 2LSOA 2K7LA 1EV7A 2R3SA 4KT5C 3BZ6A 4D0PA 3E5QA 4ESJA 4I0AA 2P4WA 4G8XA 5DEQA 2COMA 4ETSA 3RPUA 1BIBA 1QNTA 4YIFA 3CLOA 1W5TA 3M9AA 3WTUC 2XKOA 1BI2A 4GYIA 1WWXA 1SMTA 2IA2A 2M87A 3N97A 1TBXA 3ZMUA 2F2EA 3M8FA 3LAPA 3C1DA 2XAHA 4HQMA 2FF4A 4IJAA 4ENMA 3BPXA 4HF0A 2DPUA 2DFIA 2XVCA 4FT8A 1XDSA 2GWRA 1KU2A 2CWEA 2M1BA 4TV7A 5ILSA 1RUNA 1HXDA 2H6CA 3CUQB 5JI6A 4M9XA 1XSVA 4HW0A 3IHUA 3LA3A 1PDNC 2P7VB 2YR2A 3FF5A 4ASNA 2XAQA 2XRNA 3QPHA 1K7AA 3EUHA 2GAUA 2WC2A 1TQIA 2HYFA 3J81K 2P8TA 3HHGA 3PQKA 1R1TA 2OD5A 2VBZA 3GFJA 2Z9OA 4I7HA 4BHCA 1O3QA 5LEJA 1OYYA 3GFLA 1P2FA 3L2CA 4AD9A 2RC4A 4KIBA 4R79A 3QOPA 3J81Z 5DCMA 4IF4A 1V4RA 1MD0A 2D45A 1RZ4A 1FSEA 1BI3A 5CVIA 1U6GA 3V7CA 1P4XA 3GYHX 3E3VA 3ML6A 2DK5A 3JAMZ 3ABTA 3WTZA 2XROA 3RDIA 2H6BA 2XASA 2EV6A 2E1NA 2ESNA 2FMYA 2QVOA 1RNLA 3F6OA 2XAFA 1G3TA 2OZUA 4Y15A 4XBFA 4RGUA 3HYIA 1KYZA 2P5KA 5CYVA 1YG2A 2O03A 2IJLA 2HR3A 1ODDA 4P5OA 3F8MA 3G3ZA 2H94A 1B6AA 4G94A 5CVJA 1SFXA 4M6XA 2DQRA 4OU0A 4NQWA 4FHTA 4RB2C 4HV6A 1FOKA 1LEBA 4GCVA 4P9UA 1GXPA 1YTYA 2ZXJA 3E6BA 3RKWA 2RQPA 2V1DA 3ZMZA 3KP4A 4EJOA 5DCMB 1DUXC 1S8NA 4IRIA 1J2XA 2UZKA 1IXSB 3GZ6A 1HSJA 4O6JA 4M6YA 4MQVA 4BHBA 3GW2A 1Z9CA 1QZZA 5LGUA 1Q1HA 5IT3A 1UHMA 1W5SA 3EETA 3TO7A 5AIPA 3I54A 3LSTA 3RPQA 3PQJA 1B9NA 4CDGA 4EMSA 4UNOA 3O6BB 4S04A 1S6LA 5FFXA 1WSUA 2BGCA 3JSOA 3F6VA 1BJAA 1F1ZA 2RDPA 3EDPA 2O3FA 3O3KA 4I98B 3IC7A 5BPIA 5FO5A 4BXUA 4L9JA 4PGGA 3WTYC 1L0OC 2L3DA 2VN2A 2JPCA 1R1VA 4RGRA 3CO6C 4A5NA 3IRQA 2D1HA 5DUIA 1XDUA 2A6EF 2QQAA 1H9GA 3P7NA 4MTDA 4RB3C 4UVBA 2KIUA 4R8HA 2DLLA 1MJ9A 4K2EA 3WODF 1PP7U 4IXAA 2XV4S 2QQ9A 4N9IA 4YIIA 2MH2A 2BYVE 3R0AA 2ZKZA 4WK8F 4MQ9F 3Q5FA 4ENNA 3LA2A 1G3WA 1R1UA 1J5YA 1ZG3A 4CXFA 3VEPA 2W25A 1SD7A 2NYXA 4A0XA 1ON2A 4WCGA 3KP7A 4EGYA 2ISYA 1P4AA 1C0WA 3L7WA 4B09A 3M1EA 2GZWA 4L5JA 4HAMA 1TNSA 3V8JA 2DAOA 2K27A 1FX7A 1ZYRF 3FM3A 1H9TA 3I5UA 3BROA 2M45A 2K02A 2PG4A 2QQBA 1FNNA 2PFBA 2ZJ2A 2DW4A 3MZYA 5K5OA 4IHSA 4RAZA 4PGHA 3EYYA 5L3DA 2FU4A 2EA4A 4OIOF 4CICA 4LMYA 2YU3A 4OIPF 1I5ZA 1O3RA 3F3XA 4HV5A 5AIQA 1ZHFA 3U2RA 5D5UB 3F8BA 2GXBA 4LGWA 4OIQF 2EA2A 2EB7A 3IWZA 2CW0F 3BY6A 4OIRF 1IZ1A 2V1UA 4UVAA 4CO8A 2VODA 2FOKA 3BDDA 3K1NA 3M7GA 2QBYA 4HX7A 3OOPA 3MWMA 1UCRA 3LFKA 2EFNA 4KDPA 2JSCA 2QM3A 5HLHA 4EV0A 3IRRA 1XGOA 3QU3A 2ISZA 3OV8A 3JSPA 3ZQ7A 3SQNA 2HTJA 4KA4A 3PFIA 1NHAA 5E8GA 4LB5A 4IHTA 2J5OA 1B9MA 2VBXA 4G7ZF 3P9KA 5FGMA 3HRTA 4WF2A 2IW5A 1AOYA 1FC3A 1YYVA 2K4JA 3FX3A 1OYWA 3MAJA 5K5QA 1KQ9A 6PAXA 1OYIA 4EJWA 5HLIA 3J7AO 1R7JA 4H0EA 2A61A 2EK5A 2FBHA 2CFXA 4JBAA 1XSXA 2HTSA 3WU1B 5E1ZB 3Q9SA 3C3WA 3E5XA 2QUFA 1QZYA 2Q8KA 3O2PE 1SFEA 2Z3YA 3DFGA 3WTTC 1LNWA 1DPUA 2XAGA 2OQGA 2HGCA 3DXJF 4HX8A 2EFWA 1ZN2A 2QBYB 5E17F 2ELHA 3C18A 1Y0UA 3WTVC 2FNPA 1LVAA 5H20A 2EFPA 3W6KB 2J5PA 2GIVA 1XCVA 1F5TA 2HQNA 5L3FA 3H3UA 5LBQA 5J6XA 4XSXF 3I59A 2KJCA 4XSZF 1U5TA 1BOAA 5LHGA 2DT5A 4A0ZA 1T6SA 4KN7X 3VOEA 4YFKF 3I64A 3SZPA 2OAZA 2YX7A 2PBIA 1R58A 5E1WA 2HQRA 4MEYF 5JVTA 4PCQA 1FP1D 2WV0A 4U88A 2HFHA 3I4PA 2JPBA 4JK1X 2RVCA 3KLOA 1HKSA 2A69F 2V9VA 4P9FA 3BJOA 5F64A 1G4DA 3KE2A 5HS7A 3KP2A 2F5FA 5H6RA 3HOTA 1SD4A 1T98A 2HKOA 3D5LA 4LK1F 1F4KA 2ZO4A 2BV6A 4L5IA 1FYKA 2PLYA 1E2XA 3CUOA 2W85A 1Z1DA 4MNUA 5LRSA 1JHHA 2FMLA 4EJTA 2HS5A 3DKWA 3DP7A 5TRDA 1ZARA 3B73A 5ICEA 1EH7A 3WG9A 1DPRA 2G7HA 1FBUA 1TQMA 3DV8A 2WWYA 2JT1A 1I6XA 5HDNA 3I59B 4G7OF 1WI9A 2VOOA 3CTAA 1U5TB 2VOPA 2KRFA 2V79A 3ZP5A 2LKPA 4RS8A 1FBSA 1FY7A 5EEGA 5EEHA 2FXAA 2Y0MA 1KQ0A 5LHIA 1D8JA 1IW7F 3V8LA 4Q5SF 4UXNA 2MH9A 2G9WA 5BQTA 1QBJA 3T1BA 3ERED 4EGZA 3BWGA 2JRTA 5E1XA 3B02A 2ADUA 1USTA 2OZ6A 4HDVA 4IRGA 5HDGA 1IAWA 4LJZF 5DD4A 3WTWC 2PMHA 2WTEA 2FBIA 3HSRA 2IA1A 1AWCA 3RIRA 5FB2A 5K1YA 2NRAC 4CZZA 1HKQA 4E70A 3L00A 1EH8A 2NAZA 1MZBA 4ESBA 2FEZA 3F8FA 4Z2YA 2MC3A 3FMSA 1Z05A 4GXOA 1IN5A 1YQAA 3T0YA 4A0YA 3U1DA 5ERIA 4M72A 3KCCA 2PMUA 4U0VA 1FLIA 1BM9A 3ABUA 3ULQB 4OINF 3TKYA 4LG0A 3WTSC 4G7HF 4DNCA 4KFCA 3T5XA 3KP3A 3BJAA 4N0BA 5BS6A 4QLCU 4I09A 1LQ1A 5A2QK 2VT2A 2IPQX 3GFIA 3JTHA 1G3YA 3QPTA 5LGTA 2CQKA 2XUBA 2IT0A 3R0JA 4EJUA 5LEKA 3P9IA 5TJJA 3AAFA 2E1CA 2ZCWA 2M8EA 1QGPA 2YX4A 4HF2A 3ISPA 1KQ8A 3COAC 2DO7A 4LFUA 5HS8A 2IA0A 2P6SA 4LLGF 3D0SA 4CHUA 1D8KA 2F5EA 3FXUA 1G3SA 1T2KA 3ZMTA 2DBBA 1WKMA 3GXOA 3T8RA 3V4GA 3P9CA 3HSFA 4WWCA 1MGTA 2QWWA 3BPVA 1HKTA 5F6FA 1T38A 4LG0B 2LF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO5 A;  1LJ9 A;  1S3J A;  5FD6 A;  4HF1 A;  4LD5 A;  3GZ5 A;  5DYM A;  2QYO A;  3J80 K;  3SFZ A;  1SFU A;  1QQI A;  3CDH A;  1OKR A;  1OR7 A;  1J59 A;  3IL2 A;  3TO9 A;  2ETH A;  1BI1 A;  4KNY A;  1IXC A;  2VBW A;  1REP C;  1T0F A;  2QEN A;  3VOD A;  1OPC A;  4EVI A;  2A07 F;  1EH6 A;  3FMQ A;  1KU7 A;  3U9G A;  2DQL A;  1Z7U A;  4UHT A;  4EQQ A;  4L9T A;  5DDG A;  3GEZ A;  5ILV A;  1FPQ A;  3KZY A;  2D2W A;  3HTS B;  4KN4 X;  1TLH B;  3Q9V A;  4ESF A;  2GA1 A;  1S7A A;  4MHG A;  4EM2 A;  4G9Y A;  5HLG A;  3ZMV A;  4I2O A;  1ZRD A;  3EYI A;  1ULY A;  5HS9 A;  5D8L B;  4IVN A;  5HOO A;  5L3B A;  3FWE A;  3TOB A;  2RN7 A;  3KEQ A;  1UFM A;  4O5V A;  1TQP A;  2B0L A;  2Z33 A;  4ON0 A;  2L02 A;  5D5X B;  4Y13 A;  4ZZL A;  3RKY A;  2DU9 A;  2VBY A;  3WGH A;  3RKX A;  4P96 A;  1HQC A;  2L4A A;  2FSW A;  5HDK A;  4U7B A;  5FLX K;  1K78 A;  2VXZ A;  1R23 A;  1HST A;  2O0Y A;  3IKV A;  1XSD A;  3I0T A;  1ZRF A;  3KZZ A;  4HX4 A;  2O61 A;  4Y17 A;  1YIO A;  2UXX A;  1RI7 A;  4BH9 A;  2W57 A;  2EFO A;  2FNA A;  2CSO A;  4KMU X;  5D8K B;  1CF7 A;  1GVJ A;  3CUQ C;  2F5C A;  5CVR A;  2STT A;  2RV8 A;  4AVP A;  1ZRE A;  2ZME A;  4A6E A;  1JXS A;  1TTY A;  2EV5 A;  4LB6 B;  1FSH A;  2L01 A;  3WE3 A;  3KFW X;  1V3F A;  2OA4 A;  3QRF F;  2BE5 F;  3KP6 A;  1KYW A;  1TNT A;  1KU9 A;  2Y75 A;  3H3Z A;  2STW A;  2M5W A;  4WXC A;  5D4R A;  2PI0 A;  4CGZ A;  4B8X A;  5J8C A;  3FMR A;  2KIF A;  1W7P A;  4AIK A;  1B4A A;  1K78 B;  1SMY F;  3V7S A;  3DQV C;  4A2U A;  1YLF A;  2UWM A;  2Y48 A;  3R4K A;  1LB2 A;  3JW4 A;  4MEX F;  1HW5 A;  1J75 A;  4G6D A;  2LDU A;  2XHK A;  5JFR A;  2EWN A;  3JTG A;  3CO7 C;  3GX4 X;  2PN6 A;  2M30 A;  1CF7 B;  3E6D A;  5CVU A;  1RIO H;  1XGS A;  3HHH A;  1IN4 A;  1ZRC A;  2ZME B;  2A5Y B;  2JZY A;  3T8T A;  1SAX A;  1UHW A;  4KYW A;  2X4H A;  1QO0 D;  4KIG A;  2K4B A;  1ON1 A;  2GA2 A;  1FZP B;  3WU0 A;  4KIC A;  3LQR A;  4I02 A;  4BNC A;  1UB9 A;  2VC1 A;  3HIF A;  2X0L A;  3MZH A;  3CUQ A;  4UVC A;  5D6F A;  1ZG5 A;  1TW3 A;  3HOS A;  4DQ2 A;  1GHC A;  5ICC A;  1Z91 A;  1W7P B;  4FX4 A;  3E6C C;  1BC8 C;  2NNN A;  2V1X A;  3EQL F;  4GO1 A;  4EJV A;  3H92 A;  5ICF A;  2PEX A;  2Z5U A;  1D5V A;  3MCZ A;  1SD5 A;  3I58 A;  2NS0 A;  4M9Z A;  2DI3 A;  3MEX A;  1ZH5 A;  2HOE A;  4L18 B;  3F72 A;  1BIA A;  1O7L A;  1DDN A;  4F7Z A;  3DPL C;  1IN8 A;  4WXH A;  4YFX F;  4PZJ A;  1ZGJ A;  3R61 A;  3LWF A;  1LDD A;  2NNY A;  2QLZ A;  2PJP A;  2RKH A;  2H09 A;  5D5W B;  2V6C A;  2L4M A;  3ZMS A;  5BPD A;  3FM5 A;  5DUK A;  2W24 A;  4L9N A;  4LLL A;  3HRU A;  5LGN A;  1ZGA A;  4S05 A;  4WX9 A;  3HRS A;  2Q2E A;  1BN5 A;  1BI0 A;  3LA7 A;  3RJP A;  3N4M A;  1W7P D;  3VFZ A;  4OOI A;  2IRF G;  2FRH A;  2OU2 A;  3ZPL A;  1FT9 A;  2BBY A;  2W84 A;  1J0R A;  1USS A;  2YPR A;  2VE8 A;  3F22 A;  5AON A;  1JGS A;  1S29 A;  2EJR A;  1XGM A;  4WXD A;  4GGG A;  4OMY A;  5E18 F;  1LEA A;  4N9H A;  1RUO A;  1K6O A;  1L3L A;  3ROU A;  3FXQ A;  1TW2 A;  3R60 A;  1ZG1 A;  3FXR A;  4ENK A;  2A68 F;  5FFZ A;  1PUE E;  1A04 A;  1DP7 P;  4G6Q A;  2ZFW A;  4UV9 A;  2FQ3 A;  4YFN F;  1IF1 A;  2HDC A;  1GXQ A;  3JAM K;  1MJB A;  4M9S A;  4ZZD A;  1KGS A;  1LDJ A;  3LAJ A;  2P6T A;  2XAJ A;  3E6M A;  1F9N A;  3I53 A;  1PP8 F;  2IVM A;  4Q4Z F;  1HBX G;  3C7J A;  1B1B A;  2MA3 A;  1U78 A;  2KIM A;  4M73 A;  2O6G E;  4KUM A;  1JE8 A;  3F8C A;  3IWF A;  4P55 A;  4BHP A;  3REO A;  3GF2 A;  1YO5 C;  2K86 A;  3WE2 A;  3RYP A;  3KEO A;  4QWQ A;  2D1V A;  3E97 A;  1BBY A;  1B59 A;  3MQ0 A;  2DK8 A;  1P4W A;  1FBQ A;  1YS7 A;  4RGX A;  2ACJ A;  3IKT A;  5DCF A;  4AWX B;  4HYE A;  1XD7 A;  1FYM A;  3ELK A;  3CJN A;  1G6N A;  1S7O A;  1D3Y A;  1QPM A;  2HZT A;  1SD6 A;  3BP8 A;  5A2Q Z;  3DEU A;  4JQF A;  4M74 A;  2A6H F;  2VC0 A;  1I1G A;  4Q47 A;  5JR3 A;  3V8K A;  2P5V A;  5CLS A;  2EV0 A;  4XRF A;  2QZ8 A;  2HKX A;  5ICG A;  4RB0 A;  3R6S A;  5K5R A;  4XLP F;  1YW8 A;  3KET A;  2IP2 A;  1J7K A;  1YW7 A;  3ZMD A;  4L0Z B;  3BOQ A;  1J9I A;  3DF8 A;  2G7U A;  3K9T A;  2ZNZ A;  5HVQ C;  3F21 A;  3G73 A;  4RAY A;  1O7F A;  4U0Y A;  4PDK A;  4I01 A;  2XGX A;  1ZLJ A;  2CO5 A;  4FX0 A;  1O3T A;  2EFQ A;  1WRJ A;  4R1H A;  3ECH A;  5LRR A;  2XKP A;  4RGS A;  1O3S A;  3QP6 A;  4BYY A;  1T39 A;  2LNB A;  3KLN A;  4ZYE A;  3HTU A;  2E7X A;  1W4M A;  4LLN A;  1Z6R A;  3SHF A;  4ZYD A;  5FD5 A;  3WTX C;  3L9F A;  2OQR A;  3F8N A;  2KJB A;  1IN6 A;  4IPA A;  1MDM A;  4L0Y B;  4U7D A;  1IN7 A;  3KP5 A;  3FHZ A;  2KKO A;  3K1M A;  2CYY A;  3DPT A;  4NHJ A;  3NQO A;  2A3S A;  4ZYG A;  1VTN C;  3E5U A;  1R36 A;  4MGR A;  5ED4 A;  2TDX A;  3J80 Z;  4HLX A;  4HQE A;  1MKM A;  3K2Z A;  1BC7 C;  2VE9 A;  3S2W A;  2MD5 A;  1XMA A;  1KA8 A;  3BJ6 A;  5DV5 A;  4RB1 A;  5E20 A;  2VON A;  4M71 A;  1ZAO A;  1YS6 A;  3VB2 A;  5JHU A;  1U8R A;  2ZBK A;  1U3E M;  2MLK A;  4IRH A;  1XB4 A;  3HUG A;  1I27 A;  3TGN A;  3TQN A;  1STZ A;  3M8E A;  2LF8 A;  3WGG A;  1ZLK A;  4HZF A;  2O8X A;  2RNJ A;  2AS5 F;  5E8I A;  2UXN A;  3SZT A;  1XCB A;  1CGP A;  2P5L C;  2R7D A;  1LDK B;  4BAY A;  4ZYH A;  2Z99 A;  5L3G A;  2C6Y A;  5L3C A;  2H27 A;  2XIG A;  1WQ2 A;  5CJ9 A;  4EM1 A;  1FP2 A;  2FA5 A;  2R7F A;  3MFK A;  3TDU C;  4ZH4 F;  1HW2 A;  1MDM B;  1Z6T A;  1XMK A;  3F23 A;  3L09 A;  4Q48 A;  3QAH A;  5J8F A;  5FLX Z;  2DPD A;  3TOA A;  5LHH A;  4UV8 A;  2CGP A;  5KVR A;  1R5G A;  1JHF A;  1I1S A;  4A5M A;  2OBP A;  5IT9 K;  2L54 A;  3GWZ A;  3K0L A;  2MLG A;  3K69 A;  4I0B A;  5D5V B;  3GLX A;  5LLQ A;  5DD8 A;  2VT3 A;  3GVA A;  3K1P A;  2ESH A;  3ZN1 A;  2E7W A;  5H6Q A;  2RGV A;  3FZV A;  1YFH A;  3WGI A;  2HEO A;  5ILU A;  4KIF A;  5IT9 Z;  1U5T C;  4AIH A;  4HOB A;  4YG2 F;  1P92 A;  5CVV A;  1U2W A;  3ECO A;  2FE3 A;  4ENJ A;  5BOX A;  3HSE A;  3W6J B;  4BQA A;  2AXL A;  2P7C B;  2GXG A;  2ZNY A;  3V7R A;  5BMZ A;  4HLY A;  1HW1 A;  5KK1 A;  2MBF A;  3QU6 A;  1IXR C;  3GUD A;  3SXY A;  4XLN F;  1E17 A;  1IRG A;  4OMZ A;  4O3M A;  2F5D A;  2FBK A;  1YW9 A;  1IUY A;  2GQQ A;  3RYR A;  4A12 A;  1XGN A;  3QP5 A;  2YSR A;  4GYG A;  1FWZ A;  5D4S A;  1ONV A;  3NEU A;  4HDU A;  1FYL A;  1XN7 A;  4CYD A;  1H0M A;  1X3U A;  1R5H A;  4EM0 B;  5F1R A;  3RTR A;  2HYG D;  2JTV A;  1K79 A;  5L3E A;  2BEO A;  3TDZ C;  4KMF A;  1KU3 A;  2PQ8 A;  4MTE A;  4U0W A;  1O57 A;  1P6R A;  3ZN0 A;  3NRV A;  1IRF A;  1OMI A;  4HA8 A;  4L9V A;  4A6D A;  2DTR A;  3GFM A;  5D6E A;  3RI4 A;  4UUV A;  3HRM A;  3I71 A;  2CG4 A;  2HWV A;  1R22 A;  1MJA A;  4AIJ A;  2Q0O A;  1R00 A;  4HBL A;  3TO6 A;  4LK0 F;  3LQQ A;  4NB5 A;  2LSO A;  2K7L A;  1EV7 A;  2R3S A;  4KT5 C;  3BZ6 A;  4D0P A;  3E5Q A;  4ESJ A;  4I0A A;  2P4W A;  4G8X A;  5DEQ A;  2COM A;  4ETS A;  3RPU A;  1BIB A;  1QNT A;  4YIF A;  3CLO A;  1W5T A;  3M9A A;  3WTU C;  2XKO A;  1BI2 A;  4GYI A;  1WWX A;  1SMT A;  2IA2 A;  2M87 A;  3N97 A;  1TBX A;  3ZMU A;  2F2E A;  3M8F A;  3LAP A;  3C1D A;  2XAH A;  4HQM A;  2FF4 A;  4IJA A;  4ENM A;  3BPX A;  4HF0 A;  2DPU A;  2DFI A;  2XVC A;  4FT8 A;  1XDS A;  2GWR A;  1KU2 A;  2CWE A;  2M1B A;  4TV7 A;  5ILS A;  1RUN A;  1HXD A;  2H6C A;  3CUQ B;  5JI6 A;  4M9X A;  1XSV A;  4HW0 A;  3IHU A;  3LA3 A;  1PDN C;  2P7V B;  2YR2 A;  3FF5 A;  4ASN A;  2XAQ A;  2XRN A;  3QPH A;  1K7A A;  3EUH A;  2GAU A;  2WC2 A;  1TQI A;  2HYF A;  3J81 K;  2P8T A;  3HHG A;  3PQK A;  1R1T A;  2OD5 A;  2VBZ A;  3GFJ A;  2Z9O A;  4I7H A;  4BHC A;  1O3Q A;  5LEJ A;  1OYY A;  3GFL A;  1P2F A;  3L2C A;  4AD9 A;  2RC4 A;  4KIB A;  4R79 A;  3QOP A;  3J81 Z;  5DCM A;  4IF4 A;  1V4R A;  1MD0 A;  2D45 A;  1RZ4 A;  1FSE A;  1BI3 A;  5CVI A;  1U6G A;  3V7C A;  1P4X A;  3GYH X;  3E3V A;  3ML6 A;  2DK5 A;  3JAM Z;  3ABT A;  3WTZ A;  2XRO A;  3RDI A;  2H6B A;  2XAS A;  2EV6 A;  2E1N A;  2ESN A;  2FMY A;  2QVO A;  1RNL A;  3F6O A;  2XAF A;  1G3T A;  2OZU A;  4Y15 A;  4XBF A;  4RGU A;  3HYI A;  1KYZ A;  2P5K A;  5CYV A;  1YG2 A;  2O03 A;  2IJL A;  2HR3 A;  1ODD A;  4P5O A;  3F8M A;  3G3Z A;  2H94 A;  1B6A A;  4G94 A;  5CVJ A;  1SFX A;  4M6X A;  2DQR A;  4OU0 A;  4NQW A;  4FHT A;  4RB2 C;  4HV6 A;  1FOK A;  1LEB A;  4GCV A;  4P9U A;  1GXP A;  1YTY A;  2ZXJ A;  3E6B A;  3RKW A;  2RQP A;  2V1D A;  3ZMZ A;  3KP4 A;  4EJO A;  5DCM B;  1DUX C;  1S8N A;  4IRI A;  1J2X A;  2UZK A;  1IXS B;  3GZ6 A;  1HSJ A;  4O6J A;  4M6Y A;  4MQV A;  4BHB A;  3GW2 A;  1Z9C A;  1QZZ A;  5LGU A;  1Q1H A;  5IT3 A;  1UHM A;  1W5S A;  3EET A;  3TO7 A;  5AIP A;  3I54 A;  3LST A;  3RPQ A;  3PQJ A;  1B9N A;  4CDG A;  4EMS A;  4UNO A;  3O6B B;  4S04 A;  1S6L A;  5FFX A;  1WSU A;  2BGC A;  3JSO A;  3F6V A;  1BJA A;  1F1Z A;  2RDP A;  3EDP A;  2O3F A;  3O3K A;  4I98 B;  3IC7 A;  5BPI A;  5FO5 A;  4BXU A;  4L9J A;  4PGG A;  3WTY C;  1L0O C;  2L3D A;  2VN2 A;  2JPC A;  1R1V A;  4RGR A;  3CO6 C;  4A5N A;  3IRQ A;  2D1H A;  5DUI A;  1XDU A;  2A6E F;  2QQA A;  1H9G A;  3P7N A;  4MTD A;  4RB3 C;  4UVB A;  2KIU A;  4R8H A;  2DLL A;  1MJ9 A;  4K2E A;  3WOD F;  1PP7 U;  4IXA A;  2XV4 S;  2QQ9 A;  4N9I A;  4YII A;  2MH2 A;  2BYV E;  3R0A A;  2ZKZ A;  4WK8 F;  4MQ9 F;  3Q5F A;  4ENN A;  3LA2 A;  1G3W A;  1R1U A;  1J5Y A;  1ZG3 A;  4CXF A;  3VEP A;  2W25 A;  1SD7 A;  2NYX A;  4A0X A;  1ON2 A;  4WCG A;  3KP7 A;  4EGY A;  2ISY A;  1P4A A;  1C0W A;  3L7W A;  4B09 A;  3M1E A;  2GZW A;  4L5J A;  4HAM A;  1TNS A;  3V8J A;  2DAO A;  2K27 A;  1FX7 A;  1ZYR F;  3FM3 A;  1H9T A;  3I5U A;  3BRO A;  2M45 A;  2K02 A;  2PG4 A;  2QQB A;  1FNN A;  2PFB A;  2ZJ2 A;  2DW4 A;  3MZY A;  5K5O A;  4IHS A;  4RAZ A;  4PGH A;  3EYY A;  5L3D A;  2FU4 A;  2EA4 A;  4OIO F;  4CIC A;  4LMY A;  2YU3 A;  4OIP F;  1I5Z A;  1O3R A;  3F3X A;  4HV5 A;  5AIQ A;  1ZHF A;  3U2R A;  5D5U B;  3F8B A;  2GXB A;  4LGW A;  4OIQ F;  2EA2 A;  2EB7 A;  3IWZ A;  2CW0 F;  3BY6 A;  4OIR F;  1IZ1 A;  2V1U A;  4UVA A;  4CO8 A;  2VOD A;  2FOK A;  3BDD A;  3K1N A;  3M7G A;  2QBY A;  4HX7 A;  3OOP A;  3MWM A;  1UCR A;  3LFK A;  2EFN A;  4KDP A;  2JSC A;  2QM3 A;  5HLH A;  4EV0 A;  3IRR A;  1XGO A;  3QU3 A;  2ISZ A;  3OV8 A;  3JSP A;  3ZQ7 A;  3SQN A;  2HTJ A;  4KA4 A;  3PFI A;  1NHA A;  5E8G A;  4LB5 A;  4IHT A;  2J5O A;  1B9M A;  2VBX A;  4G7Z F;  3P9K A;  5FGM A;  3HRT A;  4WF2 A;  2IW5 A;  1AOY A;  1FC3 A;  1YYV A;  2K4J A;  3FX3 A;  1OYW A;  3MAJ A;  5K5Q A;  1KQ9 A;  6PAX A;  1OYI A;  4EJW A;  5HLI A;  3J7A O;  1R7J A;  4H0E A;  2A61 A;  2EK5 A;  2FBH A;  2CFX A;  4JBA A;  1XSX A;  2HTS A;  3WU1 B;  5E1Z B;  3Q9S A;  3C3W A;  3E5X A;  2QUF A;  1QZY A;  2Q8K A;  3O2P E;  1SFE A;  2Z3Y A;  3DFG A;  3WTT C;  1LNW A;  1DPU A;  2XAG A;  2OQG A;  2HGC A;  3DXJ F;  4HX8 A;  2EFW A;  1ZN2 A;  2QBY B;  5E17 F;  2ELH A;  3C18 A;  1Y0U A;  3WTV C;  2FNP A;  1LVA A;  5H20 A;  2EFP A;  3W6K B;  2J5P A;  2GIV A;  1XCV A;  1F5T A;  2HQN A;  5L3F A;  3H3U A;  5LBQ A;  5J6X A;  4XSX F;  3I59 A;  2KJC A;  4XSZ F;  1U5T A;  1BOA A;  5LHG A;  2DT5 A;  4A0Z A;  1T6S A;  4KN7 X;  3VOE A;  4YFK F;  3I64 A;  3SZP A;  2OAZ A;  2YX7 A;  2PBI A;  1R58 A;  5E1W A;  2HQR A;  4MEY F;  5JVT A;  4PCQ A;  1FP1 D;  2WV0 A;  4U88 A;  2HFH A;  3I4P A;  2JPB A;  4JK1 X;  2RVC A;  3KLO A;  1HKS A;  2A69 F;  2V9V A;  4P9F A;  3BJO A;  5F64 A;  1G4D A;  3KE2 A;  5HS7 A;  3KP2 A;  2F5F A;  5H6R A;  3HOT A;  1SD4 A;  1T98 A;  2HKO A;  3D5L A;  4LK1 F;  1F4K A;  2ZO4 A;  2BV6 A;  4L5I A;  1FYK A;  2PLY A;  1E2X A;  3CUO A;  2W85 A;  1Z1D A;  4MNU A;  5LRS A;  1JHH A;  2FML A;  4EJT A;  2HS5 A;  3DKW A;  3DP7 A;  5TRD A;  1ZAR A;  3B73 A;  5ICE A;  1EH7 A;  3WG9 A;  1DPR A;  2G7H A;  1FBU A;  1TQM A;  3DV8 A;  2WWY A;  2JT1 A;  1I6X A;  5HDN A;  3I59 B;  4G7O F;  1WI9 A;  2VOO A;  3CTA A;  1U5T B;  2VOP A;  2KRF A;  2V79 A;  3ZP5 A;  2LKP A;  4RS8 A;  1FBS A;  1FY7 A;  5EEG A;  5EEH A;  2FXA A;  2Y0M A;  1KQ0 A;  5LHI A;  1D8J A;  1IW7 F;  3V8L A;  4Q5S F;  4UXN A;  2MH9 A;  2G9W A;  5BQT A;  1QBJ A;  3T1B A;  3ERE D;  4EGZ A;  3BWG A;  2JRT A;  5E1X A;  3B02 A;  2ADU A;  1UST A;  2OZ6 A;  4HDV A;  4IRG A;  5HDG A;  1IAW A;  4LJZ F;  5DD4 A;  3WTW C;  2PMH A;  2WTE A;  2FBI A;  3HSR A;  2IA1 A;  1AWC A;  3RIR A;  5FB2 A;  5K1Y A;  2NRA C;  4CZZ A;  1HKQ A;  4E70 A;  3L00 A;  1EH8 A;  2NAZ A;  1MZB A;  4ESB A;  2FEZ A;  3F8F A;  4Z2Y A;  2MC3 A;  3FMS A;  1Z05 A;  4GXO A;  1IN5 A;  1YQA A;  3T0Y A;  4A0Y A;  3U1D A;  5ERI A;  4M72 A;  3KCC A;  2PMU A;  4U0V A;  1FLI A;  1BM9 A;  3ABU A;  3ULQ B;  4OIN F;  3TKY A;  4LG0 A;  3WTS C;  4G7H F;  4DNC A;  4KFC A;  3T5X A;  3KP3 A;  3BJA A;  4N0B A;  5BS6 A;  4QLC U;  4I09 A;  1LQ1 A;  5A2Q K;  2VT2 A;  2IPQ X;  3GFI A;  3JTH A;  1G3Y A;  3QPT A;  5LGT A;  2CQK A;  2XUB A;  2IT0 A;  3R0J A;  4EJU A;  5LEK A;  3P9I A;  5TJJ A;  3AAF A;  2E1C A;  2ZCW A;  2M8E A;  1QGP A;  2YX4 A;  4HF2 A;  3ISP A;  1KQ8 A;  3COA C;  2DO7 A;  4LFU A;  5HS8 A;  2IA0 A;  2P6S A;  4LLG F;  3D0S A;  4CHU A;  1D8K A;  2F5E A;  3FXU A;  1G3S A;  1T2K A;  3ZMT A;  2DBB A;  1WKM A;  3GXO A;  3T8R A;  3V4G A;  3P9C A;  3HSF A;  4WWC A;  1MGT A;  2QWW A;  3BPV A;  1HKT A;  5F6F A;  1T38 A;  4LG0 B;  2LF7 A; 
#chains in the Genus database with same CATH topology
 2ZC2 A;  2F4O B;  5KCM A;  1YHQ I;  1YI2 I;  3S15 J;  2WAD A;  1GUU A;  4BQN A;  3GO5 A;  5FRN A;  1LJ9 A;  5FKO A;  1S3J A;  4BAC A;  5FD6 A;  4HF1 A;  3DU6 A;  1MMG A;  4LD5 A;  4RM3 A;  2L0K A;  3PO3 J;  3GZ5 A;  5DYM A;  4BU2 A;  2QYO A;  3N05 A;  3J80 K;  3SFZ A;  1SFU A;  4IHV A;  1X1P A;  4CCN A;  1QQI A;  2JA7 J;  3CDH A;  1OKR A;  1OR7 A;  4JX5 A;  4I6Z A;  1J59 A;  3IL2 A;  3TO9 A;  2ETH A;  5IYC J;  1BI1 A;  2HVS A;  4KNY A;  1IXC A;  1HLV A;  2VBW A;  5J3L A;  1T0F A;  1REP C;  2QEN A;  3VOD A;  2ZXI A;  1OPC A;  4EVI A;  2A07 F;  1EH6 A;  2P0W A;  3FMQ A;  4RMN A;  3CLQ A;  1KU7 A;  3H9G A;  3U9G A;  1TWG J;  5JLX A;  2DQL A;  3S14 J;  1S7E A;  4M3G A;  2LBF A;  3L2W A;  4JOM A;  1Z7U A;  3OYM A;  4UHT A;  4EQQ A;  4L9T A;  5DDG A;  4G12 A;  1U9N A;  3LOC A;  3GEZ A;  1VZ0 A;  3HOX J;  1GDT A;  5ILV A;  3OS0 A;  1FPQ A;  5EGO A;  2ECC A;  3KZY A;  2R5Z B;  1WJA A;  2WAF A;  3LSJ A;  3DEW A;  2D2W A;  2KL4 A;  3HTS B;  4KN4 X;  3PL8 A;  4DYC A;  1TLH B;  2R7W A;  3Q9V A;  4ESF A;  2GA1 A;  2DOD A;  1SVO A;  2KPM A;  3DKY A;  3OR1 C;  1S7A A;  3JRC A;  2V26 A;  3DBR B;  3OMY A;  4MHG A;  4EM2 A;  3QPL A;  1LE8 B;  4G9Y A;  5HLG A;  3ZMV A;  4I2O A;  1ZRD A;  1HDD C;  4X1E A;  3EYI A;  3LNQ A;  4ZTF A;  4XN3 A;  1ULY A;  5HS9 A;  4IQJ A;  4A3B J;  3A02 A;  4QSH A;  5D8L B;  4IVN A;  1MBG A;  3L2Q A;  5HOO A;  5L3B A;  1U0J A;  3FWE A;  3TOB A;  2DFE A;  2RN7 A;  1UFM A;  3KEQ A;  5FKM A;  4O5V A;  1OCO H;  4BBS J;  1DGW Y;  1TQP A;  1ETW A;  3W2A A;  2B0L A;  2Z33 A;  2F4M B;  4ON0 A;  4E7L A;  2L02 A;  5D5X B;  2O7O A;  4Y13 A;  5GPC A;  4CYC B;  4ZZL A;  3RKY A;  5F04 A;  1AU7 A;  2GLO A;  1B72 B;  2DU9 A;  4BBR J;  1WJ5 A;  2VBY A;  3WGH A;  4OAY A;  5BNG A;  3H3V K;  3VYT B;  3RKX A;  4P96 A;  2IS6 A;  1HQC A;  2L4A A;  2FSW A;  5HDK A;  1RES A;  4U7B A;  5FLX K;  2RRE A;  1K78 A;  2L9R A;  2VXZ A;  3OOU A;  1W1W E;  1WJD A;  3BQZ A;  1MW7 A;  1R23 A;  4DOZ A;  1HST A;  2IGK A;  4I76 A;  2O0Y A;  3IKV A;  4II2 A;  1XSD A;  2F48 A;  3I0T A;  1ZRF A;  2K3F A;  3KZZ A;  4HX4 A;  2O61 A;  4IHY A;  4Y17 A;  1YIO A;  1FIA A;  2UXX A;  1RI7 A;  2LRE A;  4BH9 A;  5IYD J;  3HOU J;  3TW7 A;  2W57 A;  2EFO A;  2FNA A;  3AL0 B;  2CSO A;  4KMU X;  4JX6 A;  5D8K B;  2OCE A;  3JRA A;  2LBF B;  1CF7 A;  1GVJ A;  2E60 A;  4J19 A;  3CUQ C;  2F5C A;  2EH3 A;  1U8B A;  1YJW I;  5CVR A;  2STT A;  2RV8 A;  4AVP A;  1NK2 P;  2ZME A;  3WU2 C;  4A6E A;  3CCE I;  1ZRE A;  5EGO B;  1JXS A;  3S3N A;  1TTY A;  2EV5 A;  2Y9Y A;  4LB6 B;  1FSH A;  3HOY J;  2L01 A;  3WE3 A;  3KFW X;  3U21 A;  4XKW A;  4C2M J;  1V3F A;  5EDN A;  2M4G A;  2OA4 A;  1HCR A;  3QRF F;  2BE5 F;  4MFE A;  4D1Q A;  2OF7 A;  3S17 J;  3OYA A;  3KP6 A;  1KYW A;  1TNT A;  3MKY B;  1LFP A;  1KU9 A;  3FK6 A;  1PVE A;  1S72 I;  2Y75 A;  3H3Z A;  2STW A;  2M5W A;  4WXC A;  5D4R A;  2DN0 A;  1QHG A;  2E34 A;  1HF0 A;  2PI0 A;  4HNV A;  3FXJ A;  1IO2 A;  2VB6 A;  3HXL A;  4UB6 C;  4CGZ A;  3UNG C;  1RPW A;  4ZC3 A;  4B8X A;  5J8C A;  1Y8R B;  3FMR A;  1X4O A;  2EIN H;  2KIF A;  1W7P A;  2HDW A;  4AIK A;  1B4A A;  2X6O A;  1K78 B;  2QA4 I;  1Q1V A;  1SMY F;  3V7S A;  4YRV A;  3CMY A;  3DQV C;  4C2U A;  3OYF A;  4A2U A;  4XM3 A;  1Z3X A;  4NNJ A;  1YLF A;  3JRI A;  3G6E I;  2UWM A;  2JUC A;  1IV8 A;  5EJC A;  2FOW A;  2Y48 A;  3R4K A;  1LB2 A;  1OQY A;  3JW4 A;  4MEX F;  1HW5 A;  1IRZ A;  1J75 A;  2W7N A;  1A6I A;  3O8H A;  4G6D A;  4ABZ A;  4MIM A;  4IX7 A;  2LDU A;  2XHK A;  3PSI A;  5JFR A;  2EWN A;  5IOZ A;  3JTG A;  3CO7 C;  1MNM C;  4PJM A;  3GX4 X;  1ZQ3 P;  5IOY A;  1VF9 A;  2HI3 A;  3GCM A;  2PN6 A;  2VJJ A;  2M30 A;  3TW6 A;  1CF7 B;  3E6D A;  5CVU A;  5IP6 A;  1X19 A;  5F1J A;  1APL C;  1RIO H;  1XGS A;  3HHH A;  1IN4 A;  2DT6 A;  1ZRC A;  2ZME B;  1H88 C;  2A5Y B;  1OCP A;  2JZY A;  4HST A;  4BS9 A;  1VQL I;  3T8T A;  1SAX A;  1UHW A;  2CMP A;  5CQE A;  2DFF A;  4KYW A;  1YRN A;  3AG3 H;  4PSX A;  2HXI A;  2X4H A;  1GV2 A;  1QO0 D;  4KIG A;  2K4B A;  3GTM J;  3EUH C;  1ON1 A;  2GA2 A;  1UMQ A;  1FZP B;  1VQ9 I;  1VQ6 I;  3WU0 A;  2OJE D;  2VJ4 A;  4KIC A;  4ZDP A;  3LQR A;  4BY7 J;  2Y9Z A;  3MD2 A;  4I02 A;  3I4M J;  4BNC A;  1UB9 A;  4A3L J;  3DWL E;  2VC1 A;  2KDO A;  3HIF A;  2X0L A;  3MZH A;  3CUQ A;  4UVC A;  3DEE A;  5D6F A;  5HNH A;  5F0C A;  3DTI A;  1ZG5 A;  5E3L A;  4KIT B;  3CCL I;  1D1C A;  2IEK A;  1TW3 A;  2V9K A;  3HOS A;  4DQ2 A;  2F6C A;  1GHC A;  5ICC A;  4E7Z A;  2Y0S N;  2LP0 A;  2X9D A;  1QPI A;  2GOX B;  4KJZ A;  1Z91 A;  4XLE A;  1W7P B;  4FX4 A;  3E6C C;  2BY0 A;  2IS4 A;  4V19 K;  2JVH A;  1BC8 C;  1FOW A;  2GM4 A;  2NNN A;  5FLV A;  2V1X A;  3EQL F;  1MMD A;  2R0Q C;  4GO1 A;  5EEA A;  4EJV A;  2H8R A;  3H92 A;  2R93 J;  3QPS A;  5ICF A;  2R5Y A;  2PEX A;  2Z5U A;  1D5V A;  4BE0 A;  2PJR A;  1XTA A;  1SD5 A;  3MCZ A;  5J40 A;  3CJR B;  4Y33 A;  3I58 A;  2LY2 A;  4XKB A;  2NS0 A;  4M9Z A;  2DI3 A;  3MEX A;  1ZH5 A;  2HOE A;  2L9N A;  4L18 B;  1POG A;  3K4L A;  3F72 A;  1BIA A;  1O7L A;  3DPU A;  1DDN A;  4F7Z A;  3DPL C;  1IN8 A;  1AA7 A;  4WXH A;  4YFX F;  4PZJ A;  1ZGJ A;  3R61 A;  2CQQ A;  1LDD A;  3LWF A;  2NNY A;  1DU0 A;  2QLZ A;  4BY1 J;  2R7S A;  3K4K A;  2WBM A;  2IS2 A;  2PJP A;  2LMD A;  2RKH A;  4E7H A;  3TBI A;  2H09 A;  5D5W B;  2I10 A;  3K6G A;  1XMX A;  2V6C A;  3CDL A;  4BKX A;  2L4M A;  3ZMS A;  5BPD A;  2JWT A;  2XF6 A;  3FM5 A;  5DUK A;  1HC8 A;  2W24 A;  3BQY A;  4LIU A;  4A3F J;  4L9N A;  4FCY A;  4LLL A;  3NAR A;  3HRU A;  4XOR A;  1R9T J;  2VKD A;  5LGN A;  1ZGA A;  1G2H A;  1YRN B;  4S05 A;  4WX9 A;  3NWT A;  2CFO A;  2IGN A;  3HRS A;  5DTD A;  4EAT A;  2Q2E A;  1BN5 A;  2Y69 H;  1BI0 A;  3LA7 A;  3RJP A;  2O9L A;  2NVX J;  3OYD A;  3N4M A;  1W7P D;  2QKL B;  3I9V 2;  3VFZ A;  1F43 A;  1RRJ A;  4OOI A;  2WAQ N;  2IRF G;  1BR2 A;  2FRH A;  2MFZ A;  2OU2 A;  3ZPL A;  3UKG A;  1FT9 A;  2BBY A;  1WH5 A;  2KFD A;  2W84 A;  3BLY A;  3GTL J;  5IYB J;  1K4S A;  1I6H J;  2DA5 A;  1J0R A;  1USS A;  2YPR A;  2VE8 A;  3E1S A;  3FBN B;  2I5U A;  4BXF A;  3SEQ A;  3NAU A;  4XLF A;  3M1C A;  3F22 A;  5AON A;  3A0H C;  1JGS A;  3OY9 A;  5JLW A;  5FKL A;  1S29 A;  2EJR A;  3OYH A;  1WGX A;  1XGM A;  2DA7 A;  4PSW A;  2ZJP F;  4YIR X;  4WXD A;  3CMM A;  5GPA A;  4GGG A;  2ME0 A;  2BW3 A;  3BR6 A;  4OMY A;  5E18 F;  4ANJ A;  1LEA A;  4N9H A;  1RUO A;  1K6O A;  1L3L A;  1MMN A;  2MG4 A;  3ROU A;  3FXQ A;  3PNV A;  2VJ5 A;  1TW2 A;  1GVD A;  3R60 A;  1ZG1 A;  3OS2 A;  2VI6 A;  4LIV A;  4XKV A;  2R5Y B;  3FXR A;  1N78 A;  1U9O A;  4ENK A;  2CU7 A;  1Y0N A;  3H0G J;  3TMO A;  2PJR B;  4ZTJ A;  4IQ4 A;  2A68 F;  5FFZ A;  1PUE E;  1A04 A;  2BOL A;  3ZR8 X;  4BGD A;  1K61 A;  1DP7 P;  3PNY A;  4E6K G;  4G6Q A;  3MKW B;  2ZFW A;  4UV9 A;  4GDF A;  2LKX A;  2FQ3 A;  4YFN F;  1IF1 A;  2CRG A;  4IOC F;  2HDC A;  1GXQ A;  2AHQ A;  3JAM K;  1MJB A;  4M9S A;  4ZZD A;  1KGS A;  1LDJ A;  2M4K A;  2WA0 A;  1MH4 A;  2P6T A;  3DLA A;  3IH4 A;  3Q0V A;  4CA0 A;  2XAJ A;  3E6M A;  2EBI A;  1G59 A;  1ZKG A;  1F9N A;  3I53 A;  3UR3 C;  1PP8 F;  2IVM A;  2E5Z A;  4Q4Z F;  1MSE C;  4B3A A;  4HPQ A;  1HBX G;  2EIL H;  2IXS A;  4DBR A;  2X1D A;  3C7J A;  4OWR B;  1JGG A;  1B1B A;  1P9Q C;  2GIZ A;  2MA3 A;  3HB9 A;  4FIS A;  2Q2E B;  1Z0X A;  1U78 A;  2Q1Z B;  5KNL A;  3OYL A;  1Y8Q B;  2KIM A;  4M73 A;  2O6G E;  4KUM A;  1JE8 A;  1QHH D;  3F8C A;  1FTT A;  4E7K A;  2F4I A;  3RQI A;  1V55 H;  3IWF A;  2EIJ H;  1DQU A;  5GTH C;  3JRE A;  4P55 A;  4BHP A;  4UUS A;  1V54 H;  1GV5 A;  3REO A;  3A01 A;  5HLT A;  3GF2 A;  1YO5 C;  2BHZ A;  4RM2 A;  2CJJ A;  1X4P A;  2K86 A;  3WE2 A;  3RYP A;  3KEO A;  3CC2 I;  4QWQ A;  2D1V A;  2WB1 N;  3GME A;  4CCO A;  2R7T A;  3A03 A;  3E97 A;  2KIS A;  3CES A;  1JI8 A;  1BBY A;  1OCT C;  4XOT A;  2OV7 A;  1B59 A;  3M07 A;  4RLQ A;  3MQ0 A;  4M6V A;  2DK8 A;  1P4W A;  2BW3 B;  1FBQ A;  1EA3 A;  1YS7 A;  4RGX A;  2ACJ A;  3IKT A;  3S8P A;  1VQN I;  5DCF A;  4AWX B;  2JRM A;  3L2R A;  4HYE A;  1XD7 A;  1ENH A;  1TT5 B;  3CP8 A;  3FXM A;  3ELK A;  1FYM A;  5C4X J;  1BW5 A;  4MLO A;  3EUA A;  3LSM A;  3CJN A;  4IZZ A;  3MVP A;  1G6N A;  1S7O A;  3GTQ J;  1QPM A;  1D3Y A;  2HZT A;  4HEA 2;  4AID A;  2VKH A;  1SD6 A;  3H0D A;  5B1A H;  2X85 A;  3BP8 A;  5A2Q Z;  3J7A Y;  3G4S I;  1ZK8 A;  1X3W B;  3DEU A;  5E3N A;  4JQF A;  4M3B A;  4M74 A;  1MMS A;  2IBD A;  3BC8 A;  2A6H F;  2VC0 A;  1I1G A;  4XOP A;  4Q47 A;  5JR3 A;  3V8K A;  2P5V A;  2ZJR F;  1KZH A;  2R7R A;  5CLS A;  2EV0 A;  3HL2 A;  5J1R A;  1MMA A;  4XRF A;  3VYS B;  3GTJ J;  4XID A;  2RQQ A;  2QZ8 A;  2HKX A;  5ICG A;  4RB0 A;  4QPQ A;  3R6S A;  2DOE A;  3W6V A;  3HGG A;  5K5R A;  4XLP F;  4X6A J;  1YW8 A;  2WAQ A;  3KET A;  2IP2 A;  3ZOB A;  3H35 A;  2OTJ I;  3QYE A;  5EF6 A;  1J7K A;  1MIJ A;  1YW7 A;  4L5E A;  3ZMD A;  4L0Z B;  3J7Z I;  3BOQ A;  1J9I A;  3LAJ A;  3DF8 A;  3SDG A;  1JJ6 C;  1E3O C;  2G7U A;  5EG0 A;  3K9T A;  3ONQ A;  2ZNZ A;  5HVQ C;  5E3O A;  4ZJZ A;  3F21 A;  1XS9 A;  4UUS B;  3G73 A;  3B6A A;  4RAY A;  4H4K C;  4E7J A;  1O7F A;  4U0Y A;  1AKH A;  3OSG A;  4PDK A;  3A01 B;  1JKO C;  4I01 A;  2OPT A;  1ZLJ A;  2CO5 A;  2XGX A;  4FX0 A;  1O3T A;  2EFQ A;  1WRJ A;  1DP3 A;  4R1H A;  3ECH A;  1FIP A;  3FIW A;  3BR3 A;  2OUM A;  5F27 A;  5LRR A;  2XKP A;  2LTP A;  4RGS A;  2DTZ A;  3QP6 A;  4BYY A;  1O3S A;  3ZQL A;  2LNB A;  1T39 A;  5GP9 A;  3KLN A;  3RZO J;  2B7E A;  4ZYE A;  1W0T A;  3HTU A;  2JA5 J;  1ETQ A;  4E4H A;  1QU3 A;  2E7X A;  1W4M A;  4LLN A;  2HU9 A;  1Z6R A;  3HKZ A;  3SHF A;  5FD5 A;  4ZYD A;  3WTX C;  3L9F A;  2OQR A;  3F8N A;  4XLA A;  3BG7 A;  2KJB A;  4YEJ A;  2CS3 A;  2NVY J;  1IN6 A;  4IPA A;  1MDM A;  4L0Y B;  2K9L A;  2O8K A;  4U7D A;  1IN7 A;  1LVK A;  3KP5 A;  3FHZ A;  4IEJ A;  3EPZ A;  2L2O A;  2E2H J;  2KKO A;  3K1M A;  1UG0 A;  1IGN A;  3HGY A;  1NK3 P;  2CYY A;  3DPT A;  2NVQ J;  4NHJ A;  2HQ5 A;  3NQO A;  2A3S A;  4ZYG A;  3CZ6 A;  4J00 A;  1VTN C;  2QGU A;  3E5U A;  1R36 A;  4MGR A;  3H1C A;  3BG5 A;  3DTE A;  5ED4 A;  2TDX A;  3J80 Z;  3ESW B;  4HLX A;  4HQE A;  1MKM A;  5J4V A;  3K2Z A;  1X58 A;  3MKZ A;  1BC7 C;  2VE9 A;  3S2W A;  2MD5 A;  1XMA A;  1KA8 A;  3BJ6 A;  5DV5 A;  4RB1 A;  1SC7 A;  5E20 A;  2VON A;  4M71 A;  1ZAO A;  2JA8 J;  4Y52 J;  2G0E A;  2PX9 A;  3JRF A;  1EF4 A;  1YS6 A;  1QVT A;  1X1D A;  2CV0 A;  3VB2 A;  5JHU A;  1E0E A;  1U8R A;  4A3D J;  2ZBK A;  4M3D A;  1U3E M;  2QSG X;  3C2B A;  1ETY A;  2HOA A;  2MLK A;  1RKW A;  3K4N A;  4IRH A;  4UUT A;  1XB4 A;  3HUG A;  1I27 A;  4KT6 A;  3TGN A;  3ZQQ A;  3Q3S A;  2DXI A;  1UG2 A;  5EG0 B;  3TQN A;  1STZ A;  2AO9 A;  3M8E A;  2QSF X;  2LF8 A;  3WGG A;  2DA6 A;  1YX5 A;  1YE9 A;  1O4X A;  1ZLK A;  4HZF A;  5J4Y A;  1AKH B;  3K2A A;  2O8X A;  2RNJ A;  2AS5 F;  1MBJ A;  3LL7 A;  4F92 B;  5E8I A;  4HNU A;  1TZL A;  3CCM I;  2UXN A;  4IL6 C;  1RC9 A;  3OL3 A;  3QOD A;  3SZT A;  1XCB A;  3PSF A;  2I8D A;  3F9K A;  4PJL A;  1CGP A;  2P5L C;  4XRS A;  4Y4R A;  2R7D A;  1LDK B;  1MBF A;  4BAY A;  4ZYH A;  2NOJ B;  3D1N I;  2Z99 A;  5L3G A;  2C6Y A;  5L3C A;  1CQT A;  5FRM A;  2H27 A;  3HJE A;  1SFO J;  2XIG A;  1WQ2 A;  2DFH A;  2JUG A;  5CJ9 A;  2ZXH A;  2W00 A;  4EM1 A;  1FP2 A;  2FA5 A;  2R7F A;  3MFK A;  3TDU C;  4ZH4 F;  3CME I;  1HW2 A;  3BG6 A;  3LSR A;  3K7A J;  4DZP A;  4F3Q A;  1MDM B;  3PIP F;  1Z6T A;  3WHB A;  2M0M A;  1XMK A;  3OYI A;  3F23 A;  4PFO A;  3L09 A;  4Q48 A;  3QAH A;  5J8F A;  5FLX Z;  5J1Y A;  2M7A A;  4RBO A;  2DPD A;  2IGO A;  3TOA A;  3AL0 C;  1RR7 A;  5LHH A;  1MBE A;  4UV8 A;  1MSF C;  4M3E A;  4M3F A;  4A3M J;  5JVG F;  2Y31 A;  4CCK A;  2CGP A;  5KVR A;  3FK7 A;  1Y1V J;  2JJ7 A;  1R5G A;  1JHF A;  1JUM A;  1QVU A;  2B9S A;  3IH3 A;  1I1S A;  1MNE A;  2K5C A;  2OBP A;  4A5M A;  5IT9 K;  2L54 A;  3GWZ A;  2W1O A;  3HBL A;  4BE2 A;  3K0L A;  2MLG A;  1WH7 A;  3K69 A;  4I0B A;  4MFD A;  2PMZ N;  5D5V B;  2CQX A;  3QYB A;  3GLX A;  5LLQ A;  3OYB A;  5DD8 A;  3OWT A;  2VT3 A;  2R4G A;  4YEL A;  3NWS A;  1P7I A;  1OFC X;  3SEZ A;  3GVA A;  2XAU A;  4Y3O A;  1X1B A;  3X2Q H;  1S9H A;  4J01 A;  2R7Z J;  3K1P A;  2ESH A;  1F36 A;  3ZN1 A;  2E7W A;  2JSP A;  2RGV A;  5H6Q A;  3HUG B;  4HRI A;  3FZV A;  1YFH A;  3WGI A;  2HEO A;  5ILU A;  5GAE J;  4KIF A;  4S0H B;  3OYC A;  4RAF A;  5IT9 Z;  1U5T C;  1IJW C;  4AIH A;  4HOB A;  1Y1W J;  1UEL B;  2M8G X;  4YG2 F;  1LKX A;  1P92 A;  4DYQ A;  5CVV A;  1U2W A;  3ECO A;  2FE3 A;  2HZD A;  4ENJ A;  2IGM A;  3W2W A;  3HSE A;  5BOX A;  1VQ5 I;  3HC7 A;  2Y30 A;  3W6J B;  4BQA A;  2AXL A;  4DZJ A;  5DS9 A;  4NC6 A;  2P7C B;  1JUP A;  4A93 J;  2GXG A;  2WAE A;  3SZG A;  1B8I A;  2E36 A;  2ZNY A;  3V7R A;  5BMZ A;  1I3A A;  4HLY A;  1D5Y A;  1HW1 A;  5KK1 A;  2MBF A;  3QU6 A;  2HVQ A;  1IXR C;  3GUD A;  1DU6 A;  3SXY A;  4XLN F;  3L1P A;  1E17 A;  4XL9 A;  1IRG A;  4OMZ A;  3ABK H;  3DKX A;  2DA2 A;  4O3M A;  2F5D A;  2FBK A;  1YW9 A;  1IUY A;  4HG2 A;  2GQQ A;  3RYR A;  4A12 A;  1BL0 A;  1XGN A;  1YJN I;  4F93 B;  2CV2 A;  3QP5 A;  2YSR A;  2HOS A;  4GYG A;  1FWZ A;  5D4S A;  1ONV A;  2L7Z A;  2ZXW H;  3NEU A;  4HDU A;  1E3P A;  2XRL A;  2HNH A;  1FYL A;  2VJI A;  1XG1 A;  4PUS A;  1XN7 A;  4CYD A;  2HDD A;  2AQF A;  3K70 D;  3OS1 A;  1H0M A;  1X3U A;  2ZB9 A;  3CF2 A;  5CPR B;  1R5H A;  4EM0 B;  5HNF A;  5EYR A;  5F1R A;  2VPL A;  4QPO A;  3RTR A;  2HYG D;  2JTV A;  1K79 A;  5L3E A;  2BEO A;  3TDZ C;  4KMF A;  1KU3 A;  4B4C A;  2PQ8 A;  3SJM A;  4MTE A;  2K85 A;  3D5S C;  1XPX A;  4U0W A;  1O57 A;  1P6R A;  3ZN0 A;  1V5G A;  3NRV A;  1WFX A;  1IRF A;  1OMI A;  2KHM A;  4HA8 A;  4L9V A;  3BZK A;  4A6D A;  4IOA F;  2DTR A;  3GFM A;  3L2V A;  4GRI A;  2VL8 A;  1SAN A;  2E5N A;  2WV1 A;  5D6E A;  2FD5 A;  3RI4 A;  4BXX J;  1ETX A;  2HVR A;  4D7M A;  4UUV A;  3HRM A;  2R7O A;  1T8I A;  3I71 A;  3OYN A;  1WVR A;  2CG4 A;  3D5R C;  4F55 A;  2HWV A;  2O5R A;  1R22 A;  3G1L A;  3E7L A;  1MJA A;  1Y56 A;  3BTC A;  1ETK A;  4XQF A;  4X0G A;  4AIJ A;  2Q0O A;  2DMQ A;  1R00 A;  3FKJ A;  4AYB N;  3OR2 C;  3ZRG A;  4HBL A;  3O8G A;  2COB A;  3QQA A;  1VND A;  1B8I B;  3TO6 A;  1JTY A;  1A6Q A;  4LK0 F;  2DYR H;  3LQQ A;  1ZGW A;  4NB5 A;  5JHF A;  1SVL A;  5GAH J;  2HXO A;  3PJR A;  4I99 C;  2X48 A;  1BR1 A;  4F91 B;  2LSO A;  4ZDL A;  4CSW A;  2K7L A;  5KAI C;  2ICW G;  1EV7 A;  1HDP A;  2R3S A;  4KT5 C;  1J09 A;  3BZ6 A;  1JKP C;  4U87 A;  4D0P A;  3E5Q A;  1X1C A;  1LFB A;  1QZE A;  4ESJ A;  3M3Y J;  2VXD A;  1WJC A;  1ORK A;  3TL4 X;  5HOD A;  4I0A A;  2P4W A;  4B48 A;  4G8X A;  2ZJQ F;  1ZTR A;  4GFB A;  5DEQ A;  2COM A;  4ETS A;  2B63 J;  3RPU A;  2KP6 A;  3CP2 A;  1BIB A;  1QNT A;  4YIF A;  1T95 A;  2CQN A;  3CLO A;  1W5T A;  3M9A A;  3WTU C;  2XKO A;  3K10 A;  2R7X A;  1VI0 A;  2HOT A;  2KRH A;  4W1U A;  1BI2 A;  2M3A A;  4IKF A;  4GYI A;  1FMW A;  5CKT A;  3LSH A;  3FXK A;  2NXN B;  4ZYA A;  1WWX A;  1SMT A;  3TED A;  2IA2 A;  2M87 A;  3N97 A;  1TBX A;  3ZMU A;  5M3F J;  4IHW A;  2CW7 A;  3W2V A;  3ASN H;  4A3I J;  3F0C A;  2F2E A;  2ECB A;  3M8F A;  3LAP A;  5E3M A;  1TT0 A;  3C1D A;  2XAH A;  1XC5 A;  4HQM A;  2FF4 A;  4IJA A;  3KX2 A;  4ENM A;  1MH3 A;  3BPX A;  4HF0 A;  1IV6 A;  2DPU A;  4CCJ A;  4A3C J;  2DFI A;  2XVC A;  4FT8 A;  3ASO H;  3JRG A;  3ABL H;  1XDS A;  2GWR A;  3DLL F;  1KU2 A;  2CWE A;  2M1B A;  3ZXS A;  2NS8 A;  2KZG A;  2BVM A;  4TV7 A;  5ILS A;  1RUN A;  5EZH A;  4ZDO A;  1HXD A;  2H6C A;  2VUM J;  4PJ0 C;  3CUQ B;  4XMY A;  5JI6 A;  1G8X A;  2XGC A;  2R7U A;  3GLL A;  4M9X A;  1XSV A;  1IDY A;  4HW0 A;  3DTK A;  3IHU A;  3LA3 A;  3RZD J;  1PDN C;  2P7V B;  2YR2 A;  3FF5 A;  4ASN A;  2V7F A;  4BL0 B;  2DOA A;  2XAQ A;  2FUG 2;  3HPG A;  1YJ9 I;  2XRN A;  3PUB A;  3QPH A;  1K7A A;  3EUH A;  2LR8 A;  2UUZ A;  2GAU A;  3VPR A;  1W0U A;  2WC2 A;  1TQI A;  2HYF A;  3J81 K;  5J47 A;  1GT0 C;  4Z6Y A;  2P8T A;  2BY3 A;  3HHG A;  3PQK A;  1R1T A;  2OD5 A;  2VBZ A;  3GFJ A;  2Z9O A;  4I7H A;  3IP4 B;  3S1N J;  1D0X A;  4W97 A;  1R5I D;  4BHC A;  1O3Q A;  3M8J A;  2DA4 A;  5LEJ A;  3CMA I;  1OYY A;  3GFL A;  5GAG J;  1P2F A;  3L2C A;  5CQG A;  3CCQ I;  4AD9 A;  3CJQ B;  2RC4 A;  1PUF A;  4KIB A;  3S1M J;  4R79 A;  3QOP A;  2DOF A;  3J81 Z;  3E0J B;  5DCM A;  2K9M A;  4IF4 A;  1V4R A;  1MD0 A;  1IRX A;  1VQO I;  2P81 A;  2D45 A;  2DA1 A;  2MAB A;  1RZ4 A;  1FSE A;  2BY2 A;  2H8W A;  1BI3 A;  5CVI A;  1U6G A;  2JA6 J;  4D5C A;  5EZG A;  3V7C A;  2DMT A;  1W36 D;  1FOX A;  1P4X A;  5B3S H;  3GYH X;  3E3V A;  3ML6 A;  2OTL I;  5B66 C;  2DK5 A;  3JAM Z;  2IAI A;  3ABT A;  3GTK J;  3WTZ A;  2XRO A;  3HOZ J;  1TWA J;  2V6E A;  2XGD A;  2BY1 A;  3BR0 A;  3RDI A;  2H6B A;  4JYK A;  1R4M B;  2LRD A;  3FXL A;  2XAS A;  1WCM J;  3ZCO A;  2EV6 A;  4RA2 A;  1RKT A;  1WJE A;  2E1N A;  2JN6 A;  2ESN A;  2FMY A;  2QVO A;  1RNL A;  3BTL A;  3F6O A;  5DM7 F;  1X2N A;  2XAF A;  1G3T A;  2OZU A;  4Y15 A;  4XBF A;  4RGU A;  1BA5 A;  4N4N B;  3HYI A;  5FKK A;  2Y0S A;  1ETV A;  3PM1 A;  5FJ8 J;  4G6T B;  1KYZ A;  2VQC A;  2MW8 A;  1A31 A;  2P5K A;  3H5A A;  1LFU P;  5CYV A;  1YG2 A;  2O03 A;  2IJL A;  4UB8 C;  1MBK A;  4EEF G;  1DGR M;  3SDB A;  2HR3 A;  1ODD A;  4RDU A;  4P5O A;  1OR7 C;  4CUG A;  1JUS A;  4PK4 A;  5M5Y J;  4XR6 A;  1Y39 A;  5J1U A;  3F8M A;  1SAU A;  2EPF A;  1VQM I;  3G3Z A;  2H94 A;  1B6A A;  4G94 A;  3HEF A;  1R6R A;  5CVJ A;  1RR8 C;  2E2J J;  1SFX A;  5M3M J;  4M6X A;  2DQR A;  3CQZ J;  3FXO A;  2HPI A;  4FHT A;  4NQW A;  1WHU A;  4OU0 A;  4XKC A;  4RB2 C;  4HV6 A;  1FOK A;  1LEB A;  2X1C A;  3OIO A;  4GCV A;  3VYR B;  4P9U A;  1GXP A;  2A05 A;  2LG4 A;  2QCO A;  1YTY A;  2ZXJ A;  3E6B A;  3AFH A;  2KT0 A;  4PJN A;  3U1K A;  1HA8 A;  1V5E A;  3RKW A;  3IUO A;  2RQP A;  4BDY A;  2JVG A;  3LSK A;  1PUF B;  3S3M A;  2V1D A;  3ZMZ A;  5M5X J;  2UV1 A;  3JRD A;  3KP4 A;  4EJO A;  3L2U A;  4DBQ A;  3S2D J;  4OAZ A;  5DCM B;  2VLA A;  2L7M P;  1DUX C;  3K70 C;  1E3H A;  1IDZ A;  3BG3 A;  1UAA A;  1XX5 A;  5B5E C;  1S8N A;  2L5Q A;  4IRI A;  3BG9 A;  1J2X A;  2UZK A;  1IXS B;  4ITV A;  3GZ6 A;  2DDA A;  1HSJ A;  4O6J A;  4RAG A;  2CUJ A;  1Z77 A;  4M6Y A;  4MQV A;  4BHB A;  2M0C A;  4PJJ A;  3ZQC A;  4D5F A;  4XLH A;  3GW2 A;  2YS9 A;  1Z9C A;  2D5V A;  1X3Z B;  4XLC A;  1QZZ A;  2HQA A;  1Z7L A;  5LGU A;  5IY5 H;  3KZI C;  1Q1H A;  1OIS A;  2AXT C;  5IT3 A;  2EZH A;  3ZQG A;  1UHM A;  1FOY A;  1OCR H;  1W5S A;  3EET A;  1ZR2 A;  3DCF A;  3TO7 A;  5AIP A;  1VQK I;  3OYE A;  3I54 A;  2KRC A;  3LST A;  2FJ1 A;  3RPQ A;  4AU7 A;  3PQJ A;  2LKS A;  1B9N A;  4CDG A;  4EMS A;  2JK3 A;  4UNO A;  5LD2 C;  3O6B B;  4S04 A;  1S6L A;  3DBH B;  5FFX A;  3V42 A;  2CQ7 A;  1WSU A;  2BGC A;  3JSO A;  3F6V A;  2W48 A;  1IC8 A;  1BJA A;  2R92 J;  1F1Z A;  2RDP A;  2ZFU A;  3EDP A;  3ZQH A;  4QIW N;  5KHD A;  3K4J A;  2O3F A;  3CF5 F;  3QOE A;  3O3K A;  4I98 B;  3IC7 A;  3DBL B;  5BPI A;  5FO5 A;  4BXU A;  4L9J A;  4PGG A;  3WTY C;  2KLO A;  5B1B H;  4NQW B;  2BHY A;  1L0O C;  2L3D A;  2VN2 A;  2JPC A;  1R1V A;  2QEX I;  3PO2 J;  2VKV A;  4RGR A;  3CO6 C;  4A5N A;  2ZME C;  4XNF A;  3IRQ A;  2D1H A;  1NG7 A;  5DUI A;  1JKQ C;  1XDU A;  3KPH A;  2A6E F;  2QQA A;  3ERM A;  1RET A;  1H9G A;  3P7N A;  3RKQ A;  3C2G A;  4MTD A;  4RB3 C;  4UVB A;  2KIU A;  4R8H A;  2DLL A;  1MJ9 A;  4K2E A;  3WOD F;  5FLM J;  1PP7 U;  2CUE A;  1WJF A;  1BOB A;  2XV4 S;  4IXA A;  2MC4 A;  2ZSH B;  2QQ9 A;  2BXY A;  4N9I A;  4YII A;  2MH2 A;  2XB5 A;  2BYV E;  3R0A A;  5C44 J;  2LOO A;  4C9Y A;  3CCU I;  2ZKZ A;  4WK8 F;  5F08 A;  4MQ9 F;  3Q5F A;  1X2M A;  2M9H A;  4ENN A;  4DYR A;  1OLT A;  2W4S A;  2GXA A;  3LA2 A;  1G3W A;  2ID3 A;  2KZV A;  3IV5 A;  4P1W A;  1R1U A;  1J5Y A;  1ZG3 A;  2TRT A;  4CXF A;  3VEP A;  2W25 A;  1SD7 A;  2NYX A;  4XN0 A;  2BXZ A;  2MD0 A;  4A0X A;  1ON2 A;  4WCG A;  3KP7 A;  4EGY A;  2ISY A;  1P4A A;  1C0W A;  2NS7 A;  3G1M A;  1H8A C;  3M4O J;  1JTX A;  3G71 I;  3L7W A;  2WB1 A;  3DU5 A;  4II3 A;  1P7J A;  4B09 A;  3M1E A;  2GZW A;  3VSL A;  2E19 A;  4UY8 I;  4L5J A;  4HAM A;  1TNS A;  3V8J A;  3WG7 H;  3PNT A;  4IO9 F;  1NH3 A;  4A3G J;  3H9J A;  3BR1 A;  2DAO A;  1UZC A;  2K27 A;  1FX7 A;  4BDZ A;  2MYS A;  3G2B A;  3A2K A;  3H5N A;  1ZYR F;  3G1O A;  5LFA A;  3FM3 A;  1H9T A;  3I5U A;  3BRO A;  4A69 C;  4FE7 A;  2M45 A;  2K02 A;  2PG4 A;  4DJA A;  2AQE A;  2QQB A;  2WY8 Q;  1FNN A;  2PFB A;  2ZJ2 A;  2DW4 A;  2LH9 A;  1D1A A;  4FQG A;  1SVM A;  3MZY A;  2QF7 A;  3QYF A;  2KDZ A;  1A36 A;  5K5O A;  4IHS A;  5E79 C;  4RAZ A;  3CCJ I;  4PGH A;  2OCC H;  3EYY A;  1A35 A;  2E2I J;  3H5R A;  4IHX A;  3S1Q J;  5L3D A;  2FU4 A;  2XB0 X;  4A3J J;  2HYJ A;  2FQ4 A;  2EA4 A;  4OIO F;  4CIC A;  4LMY A;  2JMW A;  2YU3 A;  4OIP F;  3K4M A;  1I5Z A;  2NVU B;  3AG2 H;  1O3R A;  2DCE A;  3F3X A;  4HV5 A;  5AIQ A;  3BTI A;  1D1B A;  1ZHF A;  3U2R A;  5D5U B;  1WZ2 A;  1YIJ I;  1VQ7 I;  4KIS A;  3F8B A;  2GXB A;  4LGW A;  4OIQ F;  2EA2 A;  2EB7 A;  1TWH J;  4LIT A;  3AG1 H;  2LK2 A;  3IWZ A;  2CW0 F;  3BY6 A;  1K83 J;  4OIR F;  4XK4 A;  3OSF A;  4CCL A;  1IZ1 A;  1H89 C;  2V1U A;  3MN2 A;  4UVA A;  1BR4 A;  1R71 A;  4CO8 A;  1W36 C;  1UHS A;  2K9Q A;  4NC7 A;  2VOD A;  1AHD P;  3FHN A;  2FOK A;  3BDD A;  3K1N A;  2DMP A;  3M7G A;  1QRY A;  3H36 A;  4A3E J;  2EZK A;  2QBY A;  4HX7 A;  4RLF A;  1ETO A;  3OOP A;  3MWM A;  1UCR A;  4B47 A;  2Z1D A;  3LFK A;  1YX3 A;  2EFN A;  2GBY A;  1NG6 A;  4BJT A;  4KDP A;  3HPH A;  1YOV B;  3BTJ A;  2JSC A;  2QM3 A;  3BCA A;  5HLH A;  4EV0 A;  3IRR A;  1XGO A;  3QU3 A;  3MZ8 A;  3I3L A;  2ISZ A;  2BZT A;  3OYJ A;  3LSG A;  3OV8 A;  3JR9 A;  3JSP A;  2L9S A;  3ZQ7 A;  3SQN A;  2HTJ A;  1VQP I;  1LUJ B;  2CV1 A;  4KA4 A;  1WPK A;  1PYV A;  2DDB A;  3PFI A;  1NHA A;  2EIM H;  3OL4 A;  3BT9 A;  3A0B C;  5E8G A;  4LB5 A;  3CJT B;  3JRH A;  3RCO A;  4IHT A;  1X1A A;  2J5O A;  1B9M A;  2XC7 A;  2VBX A;  3OIQ A;  4G7Z F;  3P9K A;  2XPV A;  5FGM A;  3HRT A;  4WF2 A;  2IW5 A;  1AOY A;  1FC3 A;  2DA3 A;  1YYV A;  2K4J A;  2E1O A;  3FX3 A;  4JP0 A;  1OYW A;  3MAJ A;  5K5Q A;  1KQ9 A;  2R7Q A;  3S32 A;  1MND A;  2XDV A;  3KIO A;  1T08 B;  3FDY A;  3RSN A;  6PAX A;  2NOG A;  1OYI A;  4EJW A;  5K7F A;  1JT6 A;  5HLI A;  3J7A O;  1R7J A;  3QWL A;  4H0E A;  2A61 A;  5DM6 F;  2EK5 A;  2FBH A;  2CFX A;  5H2F C;  4JBA A;  1XSX A;  2HTS A;  1TC3 C;  2DT7 B;  3WU1 B;  4E7I A;  5FRO A;  1EJ9 A;  5E1Z B;  3Q9S A;  1IG7 A;  5TGT A;  3C3W A;  3E5X A;  2QUF A;  4DW6 A;  2XSD C;  4B44 A;  3CCR I;  1QZY A;  1Z21 A;  4LOC A;  2Q8K A;  3O2P E;  2LLK A;  2M2E A;  2CH0 A;  3HDD A;  1SFE A;  2Z3Y A;  1TWC J;  3DFG A;  1VQ4 I;  3WTT C;  1LNW A;  1DPU A;  2FX0 A;  3LFU A;  2XAG A;  3FBI B;  1N75 A;  1JKR C;  2OQG A;  2Y2Z A;  2HGC A;  3DXJ F;  3A4C A;  4HX8 A;  3HOW J;  2EFW A;  1ZN2 A;  2QBY B;  5E17 F;  2ELH A;  1K6Y A;  3C18 A;  1Y0U A;  1PJR A;  3Q0U A;  3JRB A;  3HM5 A;  3WTV C;  4HNT A;  2FNP A;  3PUF A;  3S3O A;  1LVA A;  5GAD J;  5H20 A;  4B1R A;  2EFP A;  3W6K B;  1R4N B;  2J5P A;  2GIV A;  2DYS H;  1XCV A;  3EUK L;  1WJB A;  3SYT A;  1F5T A;  2K40 A;  2XPU A;  2HQN A;  3BCB A;  5L3F A;  3H3U A;  2VQG A;  2ME6 A;  5LBQ A;  5J6X A;  3H9Q A;  4XSX F;  3I59 A;  3PFY A;  2CUZ A;  4AUX A;  3GZN B;  2KJC A;  1ZR4 A;  4XSZ F;  1U5T A;  5TIS C;  1BOA A;  2VAS A;  5LHG A;  2DT5 A;  3IAS 2;  4A0Z A;  2VQL A;  1T6S A;  1WI3 A;  4KN7 X;  2QKM B;  1N77 A;  1Z67 A;  3VOE A;  2EQR A;  4YFK F;  3I64 A;  2L7K A;  3SZP A;  3CCS I;  3LMM A;  2OAZ A;  2YX7 A;  2PBI A;  1R58 A;  5E1W A;  2HQR A;  4MEY F;  3VSK A;  2E35 A;  5JVT A;  4PCQ A;  4FET A;  1FP1 D;  2WV0 A;  4U88 A;  1K4T A;  4F52 A;  2ELJ A;  2HFH A;  5C4J J;  1A5J A;  3I4P A;  2JPB A;  4JK1 X;  2Z2S B;  3HZJ A;  2L7F P;  3W3C A;  3HOV J;  2PMZ A;  1T33 A;  2RVC A;  3CCY A;  1HOM A;  2CW8 A;  3KLO A;  1NTC A;  1HKS A;  1Y6I A;  4BQQ A;  1FMV A;  1LPQ A;  3VWB A;  2EIK H;  2A69 F;  4NDL A;  2V9V A;  3KYD B;  4P9F A;  4AM3 A;  3BJO A;  4DGW B;  5F64 A;  1G4D A;  2XPW A;  3KE2 A;  4D7N A;  5HS7 A;  3KP2 A;  2F5F A;  1ERD A;  2HPM A;  2M34 A;  5H6R A;  2E1M C;  4B3X A;  3HOT A;  2ZSI B;  4BE1 A;  1SD4 A;  1T98 A;  3A1Y A;  2HKO A;  3D5L A;  4LK1 F;  3MKL A;  4C30 A;  1F4K A;  2ZO4 A;  2BV6 A;  4V2F A;  4L5I A;  1FYK A;  2PLY A;  1E2X A;  2A5W A;  3CUO A;  4BEH A;  4FAS D;  3AG4 H;  2W85 A;  4BUP A;  1FTZ A;  1BW6 A;  1ACI A;  2WY7 Q;  3HG9 A;  4BJ6 C;  1Z1D A;  2KMU A;  2LY1 A;  4MNU A;  5LRS A;  1JHH A;  2FML A;  4Y7N J;  4EJT A;  1I3Q J;  2HS5 A;  3ZGK A;  3S16 J;  3ZQI A;  3DKW A;  2X6Y A;  3DP7 A;  5TRD A;  1ZAR A;  2A6T A;  4PFP A;  4AC0 A;  3B73 A;  5ICE A;  3J7Y J;  3KYL A;  1EH7 A;  3I56 I;  5M5W J;  3WG9 A;  1DPR A;  2G7H A;  1FBU A;  1OJL A;  3KYC B;  3OIP A;  1TQM A;  2XF7 A;  3I4N J;  3DV8 A;  4C3J J;  4AVZ A;  2KQR A;  1TP4 A;  1VFC A;  2WWY A;  2JT1 A;  1I6X A;  3KEY A;  5HDN A;  2LYC A;  3I59 B;  2K9N A;  4G7O F;  1WI9 A;  1SEU A;  3CTA A;  2VOO A;  2VKE A;  3OYG A;  1Z3Y A;  4XON A;  1U5T B;  1M1E B;  2KRF A;  2VOP A;  2V79 A;  3ZP5 A;  2LKP A;  2NVT J;  2YU9 J;  4RS8 A;  1FBS A;  1FY7 A;  1GLN A;  3FKI J;  3GBG A;  1QA6 A;  4B43 A;  3HKZ N;  5EEG A;  5EEH A;  2FXA A;  2XGE A;  2MSY A;  2Y0M A;  1KQ0 A;  5LHI A;  3S93 A;  1D8J A;  2RNG A;  1IW7 F;  4DIQ A;  3OYK A;  4C2T A;  3I55 I;  2LY9 A;  5FKN A;  3V8L A;  4Q5S F;  4UXN A;  2MH9 A;  5K7H A;  1MBH A;  2G9W A;  2V1N A;  2IS1 A;  5BQT A;  1V5F A;  1QBJ A;  2EZL A;  3T1B A;  3ERE D;  3IAM 2;  4MO7 A;  4NUB A;  5KAF C;  4EGZ A;  3BWG A;  2JRT A;  2N8G A;  3B02 A;  5E1X A;  2ADU A;  1UST A;  3IH2 A;  2OZ6 A;  4HSR A;  4HDV A;  4IRG A;  3BZC A;  3TP3 A;  5HDG A;  1IAW A;  4LJZ F;  5DD4 A;  2EZI A;  2LVS A;  3WTW C;  2PMH A;  3CC7 I;  1TWF J;  2XF5 A;  3WHC A;  2WTE A;  2DMU A;  2FBI A;  2R7V A;  4BEH B;  1N25 A;  2IA1 A;  3HSR A;  4BQO A;  3RIR A;  5FB2 A;  1AWC A;  2KIQ A;  1I50 J;  4LG3 A;  4AYB A;  5K1Y A;  2DMN A;  2NRA C;  4C3H J;  4CZZ A;  1ITY A;  1HKQ A;  4E7S A;  4E70 A;  3L00 A;  2K9S A;  1EH8 A;  2NAZ A;  2VQH A;  1MZB A;  3Q0W A;  4ESB A;  2FEZ A;  3AKZ A;  3CD6 I;  2RAE A;  3F8F A;  4Z2Y A;  2MC3 A;  2XSJ C;  1Z05 A;  3FMS A;  4V2G A;  2GOM A;  4GXO A;  1IN5 A;  1YQA A;  3RPU D;  3T0Y A;  4A0Y A;  3U1D A;  2Z16 A;  3FIS A;  5IP9 J;  5F0H A;  5ERI A;  9ANT A;  4M72 A;  1T0F C;  3KCC A;  1VQ8 I;  2DJN A;  2ELK A;  1T56 A;  2PMU A;  4U0V A;  1FLI A;  1BM9 A;  3ABU A;  3ULQ B;  3ZQF A;  4OIN F;  2H1L A;  3TKY A;  3PIO F;  2CUF A;  3RQ4 A;  3LSI A;  4LG0 A;  4NBQ A;  5C3E J;  3WTS C;  4G7H F;  2ID6 A;  4DNC A;  3CC4 I;  3T5X A;  3KP3 A;  4N4O B;  4KFC A;  1R49 A;  3BJA A;  3GTO J;  3S2H J;  4N0B A;  5BS6 A;  4QLC U;  4I09 A;  2OC6 A;  1LQ1 A;  1SFK A;  5A2Q K;  4JX4 A;  2VIX A;  2BVL A;  2LFB A;  2VT2 A;  1YIT I;  2IPQ X;  3GFI A;  3TP0 A;  2L9V A;  3VDX A;  3JTH A;  1G3Y A;  3GTG J;  3QPT A;  5LGT A;  2CQK A;  4A3K J;  2DJI A;  2XUB A;  5IPA A;  4BJ5 C;  2VPR A;  2QQ8 A;  2IT0 A;  2X51 A;  3R0J A;  2LD5 A;  1FEX A;  2F5V A;  4FE4 A;  3S1R J;  4C3I J;  3SFI A;  2YUS A;  4EJU A;  5IP7 J;  5LEK A;  3K4B A;  1FJL A;  2X6W A;  1JT0 A;  1IUF A;  1D0Y A;  2MGQ A;  3P9I A;  1ZEL A;  4XIC A;  3K4C A;  4CZC A;  5TJJ A;  1EKE A;  3AAF A;  2E1C A;  2ZCW A;  2R5Z A;  2M8E A;  3BR2 A;  1QGP A;  1JJ8 C;  2YX4 A;  4HF2 A;  3CDI A;  1BJZ A;  3ISP A;  3VYU B;  1KQ8 A;  3COA C;  5GTI C;  2M7B A;  1D0Z A;  2DO7 A;  2JA2 A;  2K3P A;  3JCU C;  1LE8 A;  4CH7 A;  4LFU A;  5HS8 A;  3CCV I;  2IA0 A;  2P6S A;  4LLG F;  3D0S A;  2TCT A;  4FTH A;  4CHU A;  1S5L C;  1D8K A;  2F5E A;  1OCC H;  3FXU A;  3P5J A;  1G3S A;  1T2K A;  2LC2 A;  4CCM A;  1KON A;  2H1K A;  2W82 A;  3ZMT A;  4XRS G;  2DBB A;  5F0F A;  1W5C C;  4QTR A;  3LSP A;  1WKM A;  4D9J A;  3GXO A;  3T8R A;  3V4G A;  2V9P A;  1UJ8 A;  3B6C A;  3P9C A;  5K7Z A;  1I39 A;  1TL8 A;  2QSH X;  1OCZ H;  3HSF A;  4CYC A;  4WWC A;  2JQ7 A;  3MMY B;  1B72 A;  2E71 A;  1MGT A;  2V4J C;  3ABM H;  4XRM A;  3GTP J;  2QWW A;  3BPV A;  2X6X A;  1HKT A;  5F6F A;  2E1M B;  3C2H A;  1T38 A;  3BR5 A;  2X1E A;  4NC8 A;  4LG0 B;  2LF7 A; 
#chains in the Genus database with same CATH homology
 3GO5 A;  1LJ9 A;  1S3J A;  5FD6 A;  4HF1 A;  4LD5 A;  3GZ5 A;  5DYM A;  2QYO A;  3J80 K;  3SFZ A;  1SFU A;  1QQI A;  3CDH A;  1OKR A;  1OR7 A;  1J59 A;  3IL2 A;  3TO9 A;  2ETH A;  1BI1 A;  4KNY A;  1IXC A;  2VBW A;  1REP C;  1T0F A;  2QEN A;  3VOD A;  1OPC A;  4EVI A;  2A07 F;  1EH6 A;  3FMQ A;  1KU7 A;  3U9G A;  2DQL A;  1Z7U A;  4UHT A;  4EQQ A;  4L9T A;  5DDG A;  3GEZ A;  5ILV A;  1FPQ A;  3KZY A;  2D2W A;  3HTS B;  4KN4 X;  1TLH B;  3Q9V A;  4ESF A;  2GA1 A;  1S7A A;  4MHG A;  4EM2 A;  4G9Y A;  5HLG A;  3ZMV A;  4I2O A;  1ZRD A;  3EYI A;  1ULY A;  5HS9 A;  5D8L B;  4IVN A;  5HOO A;  5L3B A;  3FWE A;  3TOB A;  2RN7 A;  3KEQ A;  1UFM A;  4O5V A;  1TQP A;  2B0L A;  2Z33 A;  4ON0 A;  2L02 A;  5D5X B;  4Y13 A;  4ZZL A;  3RKY A;  2DU9 A;  2VBY A;  3WGH A;  3RKX A;  4P96 A;  1HQC A;  2L4A A;  2FSW A;  5HDK A;  4U7B A;  5FLX K;  1K78 A;  2VXZ A;  1R23 A;  1HST A;  2O0Y A;  3IKV A;  1XSD A;  3I0T A;  1ZRF A;  3KZZ A;  4HX4 A;  2O61 A;  4Y17 A;  1YIO A;  2UXX A;  1RI7 A;  4BH9 A;  2W57 A;  2EFO A;  2FNA A;  2CSO A;  4KMU X;  5D8K B;  1CF7 A;  1GVJ A;  3CUQ C;  2F5C A;  5CVR A;  2STT A;  2RV8 A;  4AVP A;  1ZRE A;  2ZME A;  4A6E A;  1JXS A;  1TTY A;  2EV5 A;  4LB6 B;  1FSH A;  2L01 A;  3WE3 A;  3KFW X;  1V3F A;  2OA4 A;  3QRF F;  2BE5 F;  3KP6 A;  1KYW A;  1TNT A;  1KU9 A;  2Y75 A;  3H3Z A;  2STW A;  2M5W A;  4WXC A;  5D4R A;  2PI0 A;  4CGZ A;  4B8X A;  5J8C A;  3FMR A;  2KIF A;  1W7P A;  4AIK A;  1B4A A;  1K78 B;  1SMY F;  3V7S A;  3DQV C;  4A2U A;  1YLF A;  2UWM A;  2Y48 A;  3R4K A;  1LB2 A;  3JW4 A;  4MEX F;  1HW5 A;  1J75 A;  4G6D A;  2LDU A;  2XHK A;  5JFR A;  2EWN A;  3JTG A;  3CO7 C;  3GX4 X;  2PN6 A;  2M30 A;  1CF7 B;  3E6D A;  5CVU A;  1RIO H;  1XGS A;  3HHH A;  1IN4 A;  1ZRC A;  2ZME B;  2A5Y B;  2JZY A;  3T8T A;  1SAX A;  1UHW A;  4KYW A;  2X4H A;  1QO0 D;  4KIG A;  2K4B A;  1ON1 A;  2GA2 A;  1FZP B;  3WU0 A;  4KIC A;  3LQR A;  4I02 A;  4BNC A;  1UB9 A;  2VC1 A;  3HIF A;  2X0L A;  3MZH A;  3CUQ A;  4UVC A;  5D6F A;  1ZG5 A;  1TW3 A;  3HOS A;  4DQ2 A;  1GHC A;  5ICC A;  1Z91 A;  1W7P B;  4FX4 A;  3E6C C;  1BC8 C;  2NNN A;  2V1X A;  3EQL F;  4GO1 A;  4EJV A;  3H92 A;  5ICF A;  2PEX A;  2Z5U A;  1D5V A;  3MCZ A;  1SD5 A;  3I58 A;  2NS0 A;  4M9Z A;  2DI3 A;  3MEX A;  1ZH5 A;  2HOE A;  4L18 B;  3F72 A;  1BIA A;  1O7L A;  1DDN A;  4F7Z A;  3DPL C;  1IN8 A;  4WXH A;  4YFX F;  4PZJ A;  1ZGJ A;  3R61 A;  3LWF A;  1LDD A;  2NNY A;  2QLZ A;  2PJP A;  2RKH A;  2H09 A;  5D5W B;  2V6C A;  2L4M A;  3ZMS A;  5BPD A;  3FM5 A;  5DUK A;  2W24 A;  4L9N A;  4LLL A;  3HRU A;  5LGN A;  1ZGA A;  4S05 A;  4WX9 A;  3HRS A;  2Q2E A;  1BN5 A;  1BI0 A;  3LA7 A;  3RJP A;  3N4M A;  1W7P D;  3VFZ A;  4OOI A;  2IRF G;  2FRH A;  2OU2 A;  3ZPL A;  1FT9 A;  2BBY A;  2W84 A;  1J0R A;  1USS A;  2YPR A;  2VE8 A;  3F22 A;  5AON A;  1JGS A;  1S29 A;  2EJR A;  1XGM A;  4WXD A;  4GGG A;  4OMY A;  5E18 F;  1LEA A;  4N9H A;  1RUO A;  1K6O A;  1L3L A;  3ROU A;  3FXQ A;  1TW2 A;  3R60 A;  1ZG1 A;  3FXR A;  4ENK A;  2A68 F;  5FFZ A;  1PUE E;  1A04 A;  1DP7 P;  4G6Q A;  2ZFW A;  4UV9 A;  2FQ3 A;  4YFN F;  1IF1 A;  2HDC A;  1GXQ A;  3JAM K;  1MJB A;  4M9S A;  4ZZD A;  1KGS A;  1LDJ A;  3LAJ A;  2P6T A;  2XAJ A;  3E6M A;  1F9N A;  3I53 A;  1PP8 F;  2IVM A;  4Q4Z F;  1HBX G;  3C7J A;  1B1B A;  2MA3 A;  1U78 A;  2KIM A;  4M73 A;  2O6G E;  4KUM A;  1JE8 A;  3F8C A;  3IWF A;  4P55 A;  4BHP A;  3REO A;  3GF2 A;  1YO5 C;  2K86 A;  3WE2 A;  3RYP A;  3KEO A;  4QWQ A;  2D1V A;  3E97 A;  1BBY A;  1B59 A;  3MQ0 A;  2DK8 A;  1P4W A;  1FBQ A;  1YS7 A;  4RGX A;  2ACJ A;  3IKT A;  5DCF A;  4AWX B;  4HYE A;  1XD7 A;  1FYM A;  3ELK A;  3CJN A;  1G6N A;  1S7O A;  1D3Y A;  1QPM A;  2HZT A;  1SD6 A;  3BP8 A;  5A2Q Z;  3DEU A;  4JQF A;  4M74 A;  2A6H F;  2VC0 A;  1I1G A;  4Q47 A;  5JR3 A;  3V8K A;  2P5V A;  5CLS A;  2EV0 A;  4XRF A;  2QZ8 A;  2HKX A;  5ICG A;  4RB0 A;  3R6S A;  5K5R A;  4XLP F;  1YW8 A;  3KET A;  2IP2 A;  1J7K A;  1YW7 A;  3ZMD A;  4L0Z B;  3BOQ A;  1J9I A;  3DF8 A;  2G7U A;  3K9T A;  2ZNZ A;  5HVQ C;  3F21 A;  3G73 A;  4RAY A;  1O7F A;  4U0Y A;  4PDK A;  4I01 A;  2XGX A;  1ZLJ A;  2CO5 A;  4FX0 A;  1O3T A;  2EFQ A;  1WRJ A;  4R1H A;  3ECH A;  5LRR A;  2XKP A;  4RGS A;  1O3S A;  3QP6 A;  4BYY A;  1T39 A;  2LNB A;  3KLN A;  4ZYE A;  3HTU A;  2E7X A;  1W4M A;  4LLN A;  1Z6R A;  3SHF A;  4ZYD A;  5FD5 A;  3WTX C;  3L9F A;  2OQR A;  3F8N A;  2KJB A;  1IN6 A;  4IPA A;  1MDM A;  4L0Y B;  4U7D A;  1IN7 A;  3KP5 A;  3FHZ A;  2KKO A;  3K1M A;  2CYY A;  3DPT A;  4NHJ A;  3NQO A;  2A3S A;  4ZYG A;  1VTN C;  3E5U A;  1R36 A;  4MGR A;  5ED4 A;  2TDX A;  3J80 Z;  4HLX A;  4HQE A;  1MKM A;  3K2Z A;  1BC7 C;  2VE9 A;  3S2W A;  2MD5 A;  1XMA A;  1KA8 A;  3BJ6 A;  5DV5 A;  4RB1 A;  5E20 A;  2VON A;  4M71 A;  1ZAO A;  1YS6 A;  3VB2 A;  5JHU A;  1U8R A;  2ZBK A;  1U3E M;  2MLK A;  4IRH A;  1XB4 A;  3HUG A;  1I27 A;  3TGN A;  3TQN A;  1STZ A;  3M8E A;  2LF8 A;  3WGG A;  1ZLK A;  4HZF A;  2O8X A;  2RNJ A;  2AS5 F;  5E8I A;  2UXN A;  3SZT A;  1XCB A;  1CGP A;  2P5L C;  2R7D A;  1LDK B;  4BAY A;  4ZYH A;  2Z99 A;  5L3G A;  2C6Y A;  5L3C A;  2H27 A;  2XIG A;  1WQ2 A;  5CJ9 A;  4EM1 A;  1FP2 A;  2FA5 A;  2R7F A;  3MFK A;  3TDU C;  4ZH4 F;  1HW2 A;  1MDM B;  1Z6T A;  1XMK A;  3F23 A;  3L09 A;  4Q48 A;  3QAH A;  5J8F A;  5FLX Z;  2DPD A;  3TOA A;  5LHH A;  4UV8 A;  2CGP A;  5KVR A;  1R5G A;  1JHF A;  1I1S A;  4A5M A;  2OBP A;  5IT9 K;  2L54 A;  3GWZ A;  3K0L A;  2MLG A;  3K69 A;  4I0B A;  5D5V B;  3GLX A;  5LLQ A;  5DD8 A;  2VT3 A;  3GVA A;  3K1P A;  2ESH A;  3ZN1 A;  2E7W A;  5H6Q A;  2RGV A;  3FZV A;  1YFH A;  3WGI A;  2HEO A;  5ILU A;  4KIF A;  5IT9 Z;  1U5T C;  4AIH A;  4HOB A;  4YG2 F;  1P92 A;  5CVV A;  1U2W A;  3ECO A;  2FE3 A;  4ENJ A;  5BOX A;  3HSE A;  3W6J B;  4BQA A;  2AXL A;  2P7C B;  2GXG A;  2ZNY A;  3V7R A;  5BMZ A;  4HLY A;  1HW1 A;  5KK1 A;  2MBF A;  3QU6 A;  1IXR C;  3GUD A;  3SXY A;  4XLN F;  1E17 A;  1IRG A;  4OMZ A;  4O3M A;  2F5D A;  2FBK A;  1YW9 A;  1IUY A;  2GQQ A;  3RYR A;  4A12 A;  1XGN A;  3QP5 A;  2YSR A;  4GYG A;  1FWZ A;  5D4S A;  1ONV A;  3NEU A;  4HDU A;  1FYL A;  1XN7 A;  4CYD A;  1H0M A;  1X3U A;  1R5H A;  4EM0 B;  5F1R A;  3RTR A;  2HYG D;  2JTV A;  1K79 A;  5L3E A;  2BEO A;  3TDZ C;  4KMF A;  1KU3 A;  2PQ8 A;  4MTE A;  4U0W A;  1O57 A;  1P6R A;  3ZN0 A;  3NRV A;  1IRF A;  1OMI A;  4HA8 A;  4L9V A;  4A6D A;  2DTR A;  3GFM A;  5D6E A;  3RI4 A;  4UUV A;  3HRM A;  3I71 A;  2CG4 A;  2HWV A;  1R22 A;  1MJA A;  4AIJ A;  2Q0O A;  1R00 A;  4HBL A;  3TO6 A;  4LK0 F;  3LQQ A;  4NB5 A;  2LSO A;  2K7L A;  1EV7 A;  2R3S A;  4KT5 C;  3BZ6 A;  4D0P A;  3E5Q A;  4ESJ A;  4I0A A;  2P4W A;  4G8X A;  5DEQ A;  2COM A;  4ETS A;  3RPU A;  1BIB A;  1QNT A;  4YIF A;  3CLO A;  1W5T A;  3M9A A;  3WTU C;  2XKO A;  1BI2 A;  4GYI A;  1WWX A;  1SMT A;  2IA2 A;  2M87 A;  3N97 A;  1TBX A;  3ZMU A;  2F2E A;  3M8F A;  3LAP A;  3C1D A;  2XAH A;  4HQM A;  2FF4 A;  4IJA A;  4ENM A;  3BPX A;  4HF0 A;  2DPU A;  2DFI A;  2XVC A;  4FT8 A;  1XDS A;  2GWR A;  1KU2 A;  2CWE A;  2M1B A;  4TV7 A;  5ILS A;  1RUN A;  1HXD A;  2H6C A;  3CUQ B;  5JI6 A;  4M9X A;  1XSV A;  4HW0 A;  3IHU A;  3LA3 A;  1PDN C;  2P7V B;  2YR2 A;  3FF5 A;  4ASN A;  2XAQ A;  2XRN A;  3QPH A;  1K7A A;  3EUH A;  2GAU A;  2WC2 A;  1TQI A;  2HYF A;  3J81 K;  2P8T A;  3HHG A;  3PQK A;  1R1T A;  2OD5 A;  2VBZ A;  3GFJ A;  2Z9O A;  4I7H A;  4BHC A;  1O3Q A;  5LEJ A;  1OYY A;  3GFL A;  1P2F A;  3L2C A;  4AD9 A;  2RC4 A;  4KIB A;  4R79 A;  3QOP A;  3J81 Z;  5DCM A;  4IF4 A;  1V4R A;  1MD0 A;  2D45 A;  1RZ4 A;  1FSE A;  1BI3 A;  5CVI A;  1U6G A;  3V7C A;  1P4X A;  3GYH X;  3E3V A;  3ML6 A;  2DK5 A;  3JAM Z;  3ABT A;  3WTZ A;  2XRO A;  3RDI A;  2H6B A;  2XAS A;  2EV6 A;  2E1N A;  2ESN A;  2FMY A;  2QVO A;  1RNL A;  3F6O A;  2XAF A;  1G3T A;  2OZU A;  4Y15 A;  4XBF A;  4RGU A;  3HYI A;  1KYZ A;  2P5K A;  5CYV A;  1YG2 A;  2O03 A;  2IJL A;  2HR3 A;  1ODD A;  4P5O A;  3F8M A;  3G3Z A;  2H94 A;  1B6A A;  4G94 A;  5CVJ A;  1SFX A;  4M6X A;  2DQR A;  4OU0 A;  4NQW A;  4FHT A;  4RB2 C;  4HV6 A;  1FOK A;  1LEB A;  4GCV A;  4P9U A;  1GXP A;  1YTY A;  2ZXJ A;  3E6B A;  3RKW A;  2RQP A;  2V1D A;  3ZMZ A;  3KP4 A;  4EJO A;  5DCM B;  1DUX C;  1S8N A;  4IRI A;  1J2X A;  2UZK A;  1IXS B;  3GZ6 A;  1HSJ A;  4O6J A;  4M6Y A;  4MQV A;  4BHB A;  3GW2 A;  1Z9C A;  1QZZ A;  5LGU A;  1Q1H A;  5IT3 A;  1UHM A;  1W5S A;  3EET A;  3TO7 A;  5AIP A;  3I54 A;  3LST A;  3RPQ A;  3PQJ A;  1B9N A;  4CDG A;  4EMS A;  4UNO A;  3O6B B;  4S04 A;  1S6L A;  5FFX A;  1WSU A;  2BGC A;  3JSO A;  3F6V A;  1BJA A;  1F1Z A;  2RDP A;  3EDP A;  2O3F A;  3O3K A;  4I98 B;  3IC7 A;  5BPI A;  5FO5 A;  4BXU A;  4L9J A;  4PGG A;  3WTY C;  1L0O C;  2L3D A;  2VN2 A;  2JPC A;  1R1V A;  4RGR A;  3CO6 C;  4A5N A;  3IRQ A;  2D1H A;  5DUI A;  1XDU A;  2A6E F;  2QQA A;  1H9G A;  3P7N A;  4MTD A;  4RB3 C;  4UVB A;  2KIU A;  4R8H A;  2DLL A;  1MJ9 A;  4K2E A;  3WOD F;  1PP7 U;  4IXA A;  2XV4 S;  2QQ9 A;  4N9I A;  4YII A;  2MH2 A;  2BYV E;  3R0A A;  2ZKZ A;  4WK8 F;  4MQ9 F;  3Q5F A;  4ENN A;  3LA2 A;  1G3W A;  1R1U A;  1J5Y A;  1ZG3 A;  4CXF A;  3VEP A;  2W25 A;  1SD7 A;  2NYX A;  4A0X A;  1ON2 A;  4WCG A;  3KP7 A;  4EGY A;  2ISY A;  1P4A A;  1C0W A;  3L7W A;  4B09 A;  3M1E A;  2GZW A;  4L5J A;  4HAM A;  1TNS A;  3V8J A;  2DAO A;  2K27 A;  1FX7 A;  1ZYR F;  3FM3 A;  1H9T A;  3I5U A;  3BRO A;  2M45 A;  2K02 A;  2PG4 A;  2QQB A;  1FNN A;  2PFB A;  2ZJ2 A;  2DW4 A;  3MZY A;  5K5O A;  4IHS A;  4RAZ A;  4PGH A;  3EYY A;  5L3D A;  2FU4 A;  2EA4 A;  4OIO F;  4CIC A;  4LMY A;  2YU3 A;  4OIP F;  1I5Z A;  1O3R A;  3F3X A;  4HV5 A;  5AIQ A;  1ZHF A;  3U2R A;  5D5U B;  3F8B A;  2GXB A;  4LGW A;  4OIQ F;  2EA2 A;  2EB7 A;  3IWZ A;  2CW0 F;  3BY6 A;  4OIR F;  1IZ1 A;  2V1U A;  4UVA A;  4CO8 A;  2VOD A;  2FOK A;  3BDD A;  3K1N A;  3M7G A;  2QBY A;  4HX7 A;  3OOP A;  3MWM A;  1UCR A;  3LFK A;  2EFN A;  4KDP A;  2JSC A;  2QM3 A;  5HLH A;  4EV0 A;  3IRR A;  1XGO A;  3QU3 A;  2ISZ A;  3OV8 A;  3JSP A;  3ZQ7 A;  3SQN A;  2HTJ A;  4KA4 A;  3PFI A;  1NHA A;  5E8G A;  4LB5 A;  4IHT A;  2J5O A;  1B9M A;  2VBX A;  4G7Z F;  3P9K A;  5FGM A;  3HRT A;  4WF2 A;  2IW5 A;  1AOY A;  1FC3 A;  1YYV A;  2K4J A;  3FX3 A;  1OYW A;  3MAJ A;  5K5Q A;  1KQ9 A;  6PAX A;  1OYI A;  4EJW A;  5HLI A;  3J7A O;  1R7J A;  4H0E A;  2A61 A;  2EK5 A;  2FBH A;  2CFX A;  4JBA A;  1XSX A;  2HTS A;  3WU1 B;  5E1Z B;  3Q9S A;  3C3W A;  3E5X A;  2QUF A;  1QZY A;  2Q8K A;  3O2P E;  1SFE A;  2Z3Y A;  3DFG A;  3WTT C;  1LNW A;  1DPU A;  2XAG A;  2OQG A;  2HGC A;  3DXJ F;  4HX8 A;  2EFW A;  1ZN2 A;  2QBY B;  5E17 F;  2ELH A;  3C18 A;  1Y0U A;  3WTV C;  2FNP A;  1LVA A;  5H20 A;  2EFP A;  3W6K B;  2J5P A;  2GIV A;  1XCV A;  1F5T A;  2HQN A;  5L3F A;  3H3U A;  5LBQ A;  5J6X A;  4XSX F;  3I59 A;  2KJC A;  4XSZ F;  1U5T A;  1BOA A;  5LHG A;  2DT5 A;  4A0Z A;  1T6S A;  4KN7 X;  3VOE A;  4YFK F;  3I64 A;  3SZP A;  2OAZ A;  2YX7 A;  2PBI A;  1R58 A;  5E1W A;  2HQR A;  4MEY F;  5JVT A;  4PCQ A;  1FP1 D;  2WV0 A;  4U88 A;  2HFH A;  3I4P A;  2JPB A;  4JK1 X;  2RVC A;  3KLO A;  1HKS A;  2A69 F;  2V9V A;  4P9F A;  3BJO A;  5F64 A;  1G4D A;  3KE2 A;  5HS7 A;  3KP2 A;  2F5F A;  5H6R A;  3HOT A;  1SD4 A;  1T98 A;  2HKO A;  3D5L A;  4LK1 F;  1F4K A;  2ZO4 A;  2BV6 A;  4L5I A;  1FYK A;  2PLY A;  1E2X A;  3CUO A;  2W85 A;  1Z1D A;  4MNU A;  5LRS A;  1JHH A;  2FML A;  4EJT A;  2HS5 A;  3DKW A;  3DP7 A;  5TRD A;  1ZAR A;  3B73 A;  5ICE A;  1EH7 A;  3WG9 A;  1DPR A;  2G7H A;  1FBU A;  1TQM A;  3DV8 A;  2WWY A;  2JT1 A;  1I6X A;  5HDN A;  3I59 B;  4G7O F;  1WI9 A;  2VOO A;  3CTA A;  1U5T B;  2VOP A;  2KRF A;  2V79 A;  3ZP5 A;  2LKP A;  4RS8 A;  1FBS A;  1FY7 A;  5EEG A;  5EEH A;  2FXA A;  2Y0M A;  1KQ0 A;  5LHI A;  1D8J A;  1IW7 F;  3V8L A;  4Q5S F;  4UXN A;  2MH9 A;  2G9W A;  5BQT A;  1QBJ A;  3T1B A;  3ERE D;  4EGZ A;  3BWG A;  2JRT A;  5E1X A;  3B02 A;  2ADU A;  1UST A;  2OZ6 A;  4HDV A;  4IRG A;  5HDG A;  1IAW A;  4LJZ F;  5DD4 A;  3WTW C;  2PMH A;  2WTE A;  2FBI A;  3HSR A;  2IA1 A;  1AWC A;  3RIR A;  5FB2 A;  5K1Y A;  2NRA C;  4CZZ A;  1HKQ A;  4E70 A;  3L00 A;  1EH8 A;  2NAZ A;  1MZB A;  4ESB A;  2FEZ A;  3F8F A;  4Z2Y A;  2MC3 A;  3FMS A;  1Z05 A;  4GXO A;  1IN5 A;  1YQA A;  3T0Y A;  4A0Y A;  3U1D A;  5ERI A;  4M72 A;  3KCC A;  2PMU A;  4U0V A;  1FLI A;  1BM9 A;  3ABU A;  3ULQ B;  4OIN F;  3TKY A;  4LG0 A;  3WTS C;  4G7H F;  4DNC A;  4KFC A;  3T5X A;  3KP3 A;  3BJA A;  4N0B A;  5BS6 A;  4QLC U;  4I09 A;  1LQ1 A;  5A2Q K;  2VT2 A;  2IPQ X;  3GFI A;  3JTH A;  1G3Y A;  3QPT A;  5LGT A;  2CQK A;  2XUB A;  2IT0 A;  3R0J A;  4EJU A;  5LEK A;  3P9I A;  5TJJ A;  3AAF A;  2E1C A;  2ZCW A;  2M8E A;  1QGP A;  2YX4 A;  4HF2 A;  3ISP A;  1KQ8 A;  3COA C;  2DO7 A;  4LFU A;  5HS8 A;  2IA0 A;  2P6S A;  4LLG F;  3D0S A;  4CHU A;  1D8K A;  2F5E A;  3FXU A;  1G3S A;  1T2K A;  3ZMT A;  2DBB A;  1WKM A;  3GXO A;  3T8R A;  3V4G A;  3P9C A;  3HSF A;  4WWC A;  1MGT A;  2QWW A;  3BPV A;  1HKT A;  5F6F A;  1T38 A;  4LG0 B;  2LF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...