3M8FA

Protein structure of type iii plasmid segregation tubr mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
HFYTLNIAEIAERIGNDDCAYQVLMAFINENGEAQMLNKTAVAEMIQLSKPTVFATVNWFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative DNA-binding protein
publication title From the Cover: Plasmid protein TubR uses a distinct mode of HTH-DNA binding and recruits the prokaryotic tubulin homolog TubZ to effect DNA partition.
pubmed doi rcsb
source organism Bacillus thuringiensis
total genus 30
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3m8fA00
3G73A 5E1WA 2BGCA 2IVMA 4ZZDA 2ISZA 4U7DA 2A6HF 2OZ6A 3R0AA 2HZTA 2O6GE 3EQLF 4L0YB 4D0PA 3R4KA 1DUXC 2HWVA 2RQPA 2GAUA 2W25A 2HTSA 4U0VA 4R8HA 3KETA 4AIKA 3BDDA 4U88A 4ZYDA 1S29A 5D6EA 5L3CA 1LJ9A 4IVNA 1MD0A 1XSDA 2DPDA 3DPTA 2ZFWA 3LQRA 4LLLA 3KLNA 3TQNA 1BI2A 2J5PA 2KRFA 2GIVA 2PBIA 4IJAA 1R7JA 5KVRA 5D8KB 1XGOA 1BIAA 4WXHA 5HDGA 3IKTA 5EEHA 5ILVA 3DXJF 3E6DA 4IRHA 1T39A 3WGGA 1V3FA 2ZNZA 2KIUA 1MDMB 4I02A 4IF4A 2O3FA 2KJBA 4EJVA 4BQAA 3I54A 2MH9A 5ILUA 1K79A 3CLOA 2Q0OA 1TLHB 4L9VA 2DLLA 3ZMSA 3WTYC 3F8MA 4A0ZA 4U0YA 3E97A 4UNOA 5HS9A 2XVCA 2K27A 4XRFA 3HTSB 5E1ZB 2JSCA 2AXLA 4BXUA 3LFKA 4K2EA 2FU4A 3FXUA 3J80Z 2DK8A 1USSA 2JPCA 2FBKA 1ZLJA 4A5MA 3TOAA 4Q5SF 2YR2A 4HQEA 1H9TA 5LBQA 1BIBA 3L7WA 3IHUA 3WTSC 3IWZA 2F5CA 2EFNA 3ROUA 3E3VA 3BROA 3KCCA 3ML6A 4B8XA 2VE8A 4BNCA 1U8RA 2H27A 4BAYA 2QUFA 4JQFA 1R5GA 5DD4A 4EVIA 3ABUA 5LGTA 5KK1A 3Q9SA 2EV0A 3WTXC 3D0SA 1D8JA 1SAXA 1MZBA 2X0LA 2WV0A 1P4WA 3KP3A 5DCFA 1D5VA 1V4RA 2OU2A 4M71A 1DP7P 3ISPA 4P96A 1ZGJA 3DV8A 2XKPA 2Q8KA 2K7LA 1BI0A 3M9AA 1F5TA 1CF7A 2RC4A 4HLXA 4S05A 4M9SA 3CJNA 1U3EM 2RN7A 2XV4S 2VOOA 5E18F 2EV5A 1Z6RA 1YW8A 4PGHA 1KU3A 2QQAA 2FEZA 4U0WA 5LRSA 3BJAA 1IN8A 3LQQA 1LNWA 1XCBA 3I58A 1KQ8A 3TO6A 3IL2A 5H20A 3CO7C 2E1NA 4N9IA 2RKHA 5LEJA 3K9TA 3GYHX 1A04A 5AIPA 5DUKA 3F8NA 4YFKF 2VXZA 4WK8F 3K2ZA 4ENKA 2P6SA 2A68F 2D1VA 2KKOA 3LWFA 1BC8C 4ENJA 4OMYA 5FFXA 1O7LA 1DPUA 3EETA 2HS5A 2FMYA 4ZYHA 2OZUA 1G3WA 2VBXA 2HQRA 3I4PA 5D6FA 1FP2A 2ELHA 3WTVC 2GA2A 4EM2A 3CUQA 5L3GA 3KEOA 2FSWA 1ZRDA 2R7DA 1KQ9A 3F8BA 1J5YA 4PGGA 1YS6A 1PUEE 5J8FA 1IN7A 3F6VA 4ZYGA 3FMRA 2M45A 4ASNA 5IT3A 1TQIA 2LKPA 1XDSA 2D1HA 3PQKA 1I5ZA 2PMHA 3ZP5A 1F1ZA 4HX8A 4HAMA 1R5HA 2FBHA 2CSOA 4G8XA 5DCMA 4KIFA 1J75A 1SD4A 3ERED 1SD6A 1MKMA 3QOPA 4OU0A 1FWZA 3KZZA 4IPAA 2RNJA 1Z05A 1XD7A 4F7ZA 3V7SA 2VT3A 4MEYF 2ACJA 1CF7B 3Q5FA 2DBBA 3FF5A 4HX7A 2Q2EA 3IRRA 1FY7A 3P9CA 1S3JA 4LB5A 1B9MA 3FMSA 3QPHA 2V1XA 1YFHA 4Z2YA 3FM5A 5LGUA 1QZYA 4L5IA 3PQJA 1F4KA 3E5UA 4UHTA 5D5WB 3J81Z 3F3XA 2ETHA 5D5VB 1IAWA 4ZZLA 3F72A 3E6MA 4LMYA 1XGNA 5HOOA 2VOPA 2NYXA 2QM3A 2K4BA 1KU7A 1ZAOA 2EFPA 2CO5A 5AIQA 2IW5A 2UWMA 2V6CA 3GW2A 1ZG5A 2Z99A 2XAGA 4KNYA 2LF7A 2VBYA 5A2QK 1R1TA 1O7FA 2ADUA 2FNPA 3NRVA 1U5TA 3L09A 3RTRA 1FOKA 3HRMA 3WTWC 4ETSA 2STTA 3JAMZ 1T2KA 1ZLKA 2UZKA 4ESBA 1K78A 2YX7A 5FO5A 2Z9OA 1T0FA 2QBYB 3WGIA 3O2PE 2ZMEA 4HQMA 3MFKA 1XN7A 2PN6A 1IW7F 3NQOA 1W4MA 1WQ2A 4Y15A 2FQ3A 3JSOA 4I09A 4IHTA 2JT1A 1RZ4A 4O3MA 2H94A 4ZYEA 1W5SA 4JBAA 2MBFA 5LGNA 3LAPA 1BN5A 4I01A 1YS7A 1PP7U 4OIOF 1KA8A 4HV5A 2KIMA 3B73A 3Q9VA 2EA2A 4EGZA 5FD6A 1IF1A 3GVAA 4LD5A 2QWWA 1IXRC 1IRFA 4Q47A 4UVAA 4ENNA 4KIGA 3SHFA 4I2OA 1XGSA 4RGSA 1R36A 2FBIA 4R1HA 2V9VA 3L2CA 2HOEA 2GZWA 3KP6A 1FYLA 1ZN2A 4KYWA 5ICGA 5D5XB 3R60A 2FE3A 2YSRA 2EFOA 3HRTA 4KA4A 1PP8F 4L9TA 2ZCWA 2BEOA 1TTYA 3CTAA 4YFXF 3VEPA 2KIFA 1H9GA 1XDUA 3I64A 1IN6A 4UXNA 3P9KA 5CVRA 4ESJA 4ON0A 3HOTA 4A5NA 3GX4X 4AWXB 2RGVA 2O61A 1K6OA 2M87A 5HS8A 1YIOA 1U5TB 2GXGA 1R22A 3FX3A 1I27A 3LA2A 1BI3A 4GYIA 3J80K 5JR3A 3BZ6A 3I5UA 4LG0A 4HDVA 3FZVA 4YIFA 3W6KB 2QQ9A 1P92A 3ZN0A 3I59B 5ILSA 2ZMEB 3L00A 1FYKA 4RGUA 3HOSA 2G7HA 4HOBA 4AVPA 2XRNA 1TNSA 3CUOA 4R79A 4I98B 1J0RA 2XAHA 4ZH4F 2XKOA 3QP5A 1B4AA 2F2EA 3WTZA 4IRIA 1Q1HA 1Z9CA 4B09A 4JK1X 1FZPB 3IC7A 3JTHA 4CXFA 2OQGA 1UHWA 2ISYA 4BHBA 2ZKZA 2P5KA 4LB6B 2R7FA 2FOKA 5JI6A 4MTDA 4M6XA 2LDUA 2TDXA 4NB5A 3F22A 2EB7A 4CHUA 2GQQA 2IJLA 2IA1A 1EH8A 4G7ZF 4GGGA 5TJJA 5K5RA 2IP2A 3ZMDA 4KICA 2A07F 3SXYA 1C0WA 2NRAC 1QGPA 1XSXA 4M73A 4HX4A 2P8TA 3TOBA 2EWNA 2VT2A 1G4DA 2HKXA 1RUNA 1SMTA 2F5FA 1WSUA 2L01A 1NHAA 4EV0A 1MJ9A 1R1VA 3M1EA 3T8TA 1LVAA 4M74A 2BE5F 2CG4A 3M8FA 4I0AA 3ECHA 2NNNA 2D2WA 2MH2A 2PMUA 1YLFA 1H0MA 5LEKA 4M72A 1E17A 3FXQA 4A2UA 3LAJA 3EYYA 2KJCA 5CLSA 4A0XA 2HQNA 3WTUC 2P7VB 4BHPA 1ZG1A 3BJ6A 2FF4A 3E5XA 1J7KA 4L0ZB 4LG0B 2P4WA 4XLNF 3I53A 4XSZF 1ZRFA 5DDGA 4LK1F 1R00A 2XIGA 4N0BA 5E8GA 5F64A 4KN4X 3HHGA 2G7UA 3HYIA 2XHKA 3WTTC 1QZZA 4EJOA 4CICA 6PAXA 1OPCA 1R1UA 3GFLA 3KE2A 1S7AA 3MQ0A 1HKSA 3K1NA 1HSJA 4P9UA 2CYYA 3GZ6A 3ZQ7A 3K0LA 2CWEA 1B6AA 3BP8A 2L3DA 1SD5A 3WGHA 1BC7C 4BH9A 3ECOA 3U1DA 4RGXA 3BWGA 5HDNA 3CDHA 2Y75A 3F6OA 1P4AA 3TO7A 3AAFA 1J2XA 1YTYA 5BQTA 2EK5A 2DW4A 3S2WA 3U2RA 2P5LC 5CVVA 3T8RA 2QZ8A 1Y0UA 4HZFA 1XGMA 3REOA 4MHGA 3V7CA 3WE2A 2K86A 2A5YB 2QQBA 2FXAA 5JHUA 5DUIA 4G6DA 3BPVA 2W84A 3BJOA 3C18A 1W7PA 1P4XA 5CJ9A 3VB2A 2P5VA 5H6QA 5K5OA 4A0YA 4KDPA 2LNBA 2MA3A 2HKOA 2QYOA 4EJWA 5LHGA 1YO5C 3QP6A 5BMZA 1ZG3A 3F8CA 5L3FA 3OOPA 1JHFA 1IXCA 3VODA 1ZREA 2PI0A 4XSXF 1HW1A 4FX4A 1XSVA 4CYDA 4G6QA 2F5EA 2WWYA 4FX0A 1ZARA 4EM0B 4RB2C 1BBYA 5ICFA 2D45A 4CZZA 1OYYA 4HF0A 3J81K 3H3ZA 1HKQA 1S6LA 4NQWA 2A3SA 2F5DA 3JSPA 1KGSA 4UUVA 5E8IA 2Z33A 1JGSA 3DF8A 2XGXA 2IPQX 4A6EA 2V1DA 4I7HA 2DQRA 5H6RA 3GFMA 1P6RA 3HSRA 3KP2A 1U78A 5E17F 1OYWA 1S7OA 5L3BA 3JAMK 5IT9Z 4DQ2A 1LDDA 2Y0MA 2HEOA 3RKYA 2EV6A 1U6GA 5BPDA 5E20A 1HXDA 1T98A 1XMKA 4RAZA 1SMYF 4KMFA 1IN4A 2M5WA 1QNTA 2G9WA 5JFRA 1D8KA 1Z6TA 1ULYA 3SZPA 3FMQA 1LEBA 3LA7A 5HLIA 1GHCA 2RV8A 3ZPLA 1RNLA 3QAHA 3MZHA 4WX9A 1W7PB 1HKTA 3RKXA 1QO0D 1SFXA 3ZMVA 2OBPA 1IN5A 2E7WA 1KYWA 3RJPA 3VFZA 5K5QA 1EH6A 4LK0F 5FB2A 2EJRA 5CYVA 2W24A 2NS0A 1G6NA 3V4GA 2XROA 5BS6A 5BPIA 2FMLA 3WU1B 3DEUA 3KFWX 3HIFA 3CUQB 1D3YA 3K69A 1K7AA 5F6FA 5F1RA 3I71A 3ZMZA 5FLXZ 2CFXA 3N97A 4Q4ZF 2EFWA 1TBXA 1GXPA 1JE8A 3U9GA 4WF2A 3CUQC 3LA3A 4EQQA 2PFBA 2X4HA 2FNAA 2OA4A 5FFZA 3O6BB 4HW0A 1ONVA 4G7HF 3RI4A 4RB3C 1L0OC 5CVUA 2UXXA 4ESFA 4XLPF 2XASA 1AWCA 1ZYRF 5DCMB 1B1BA 1ON2A 2NAZA 3R6SA 4EJUA 5TRDA 3JTGA 2DPUA 3WE3A 3EDPA 3PFIA 1FBQA 2VE9A 3KZYA 3GZ5A 1ZGAA 1EV7A 2K4JA 3BY6A 3T0YA 3E5QA 2DT5A 3V7RA 2OD5A 4IXAA 3GO5A 3HSFA 2XAFA 1XMAA 1LEAA 3F8FA 1USTA 3DQVC 1LB2A 3V8LA 1MJBA 2RDPA 2L4MA 1TNTA 3ZMUA 2MC3A 1TQPA 3ZMTA 1Z1DA 4KFCA 4RGRA 4DNCA 2A6EF 3KLOA 1IZ1A 2L54A 3HHHA 4GO1A 5D5UB 4P55A 1WKMA 3T1BA 3HUGA 3QRFF 3OV8A 1WRJA 1YQAA 2DK5A 1YW7A 2O8XA 1J59A 2GA1A 3GFIA 1OYIA 2PLYA 4LLNA 3LSTA 3J7AO 4KN7X 1TW3A 1K78B 4OOIA 3D5LA 1U5TC 4LJZF 3KP7A 4GCVA 4KT5C 1P2FA 4M9ZA 1LQ1A 3BPXA 4O6JA 3HRUA 3TGNA 3T5XA 5AONA 3G3ZA 2K02A 1MGTA 1BOAA 2Z3YA 2OQRA 2VBZA 4OINF 1ODDA 1FSEA 2QVOA 4OIRF 1FBSA 2VN2A 3FHZA 4BHCA 1IXSB 1AOYA 1LDJA 4EGYA 1KYZA 1UFMA 1ZRCA 1FBUA 1R23A 4UVCA 4IRGA 3M8EA 1G3TA 2JZYA 2CGPA 1QPMA 1R58A 5FGMA 3K1MA 4MQVA 1IRGA 1HQCA 3EUHA 2IA2A 2L4AA 1KU9A 1FC3A 2VC0A 2DTRA 3O3KA 3F21A 2DAOA 2H6CA 1IUYA 1FLIA 1ON1A 2EA4A 2GWRA 2IRFG 4YG2F 2EFQA 4TV7A 1RIOH 3KEQA 1B9NA 4WXCA 4LFUA 3W6JB 3KP5A 3TO9A 2H6BA 2JRTA 2E1CA 1SFUA 1O3TA 2VC1A 4S04A 1UCRA 3HRSA 4CDGA 1FT9A 2J5OA 1YW9A 5L3DA 1XCVA 2FA5A 3MEXA 1JXSA 2HYGD 5D4SA 2DU9A 3DP7A 1S8NA 5E1XA 2H09A 2W57A 3DFGA 2HFHA 2V1UA 4QWQA 2HDCA 3GWZA 4H0EA 4FT8A 4Q48A 3SZTA 3V8JA 2ZNYA 4UV8A 3E6CC 1WI9A 4I0BA 2MD5A 3COAC 1G3YA 3E6BA 5FD5A 3RYRA 5ED4A 2GXBA 3WG9A 5BOXA 3I0TA 1RUOA 3IWFA 4KMUX 2O0YA 2IT0A 4NHJA 3R0JA 1FPQA 5D4RA 1G3SA 2LSOA 4MEXF 5HS7A 5HLGA 4EM1A 3DPLC 4WWCA 3NEUA 1I1SA 1I6XA 2VODA 3FXRA 2CW0F 4HA8A 3ZN1A 2O03A 5CVJA 3DKWA 1T6SA 1L3LA 1VTNC 1STZA 3GF2A 1OR7A 4L18B 2XAJA 5HVQC 3R61A 1U2WA 3EYIA 2ZJ2A 1O3QA 4A12A 4GXOA 4XBFA 2DFIA 2ZBKA 1DDNA 3B02A 4EMSA 4E70A 2L02A 3V8KA 2STWA 1TW2A 2PJPA 3BOQA 2YX4A 3C1DA 5LRRA 2CQKA 3SQNA 3P9IA 4RS8A 3CO6C 1Z7UA 2MLGA 1FSHA 1BI1A 2FRHA 4HF1A 1O57A 2ESHA 4N9HA 2ESNA 3GUDA 5DEQA 3RDIA 5J8CA 3MWMA 2ZXJA 4HYEA 5ICCA 2ZO4A 4HF2A 1MJAA 3K1PA 3ABTA 4GYGA 1PDNC 4HDUA 3M7GA 5IT9K 3KP4A 1OMIA 1W7PD 1HSTA 1HBXG 1QQIA 2OAZA 2VONA 3VOEA 2UXNA 1UHMA 4KIBA 4HBLA 2M30A 2YU3A 5D8LB 4P9FA 1T38A 2PEXA 5ERIA 3WODF 4U7BA 3RKWA 4PDKA 1QBJA 1Z91A 1KU2A 1HW5A 3H92A 2QBYA 2WC2A 2XAQA 1FYMA 4PCQA 4CGZA 1LDKB 3IRQA 5DV5A 3FWEA 1GVJA 3QU6A 3TDUC 2W85A 1KQ0A 4MTEA 2M8EA 3H3UA 2HTJA 2BYVE 4QLCU 1DPRA 4YFNF 2HYFA 2R3SA 5J6XA 3IKVA 5LLQA 3HTUA 2M1BA 3SFZA 3F23A 5DYMA 1O3SA 1CGPA 2B0LA 2P7CB 3TDZC 2Z5UA 1TQMA 1YYVA 1X3UA 2QENA 2XUBA 5FLXK 4HLYA 3TKYA 1EH7A 1OKRA 1O3RA 3RPUA 4L9NA 4HV6A 2QLZA 2LF8A 3C7JA 3RPQA 4AIHA 4G94A 2JTVA 1FX7A 4EJTA 3WU0A 3L9FA 2C6YA 4FHTA 3RIRA 4WXDA 5CVIA 4ENMA 5HDKA 2RVCA 1YG2A 2HR3A 2AS5F 1FNNA 1XB4A 2IA0A 1UB9A 4G9YA 4IHSA 2PQ8A 5HLHA 1B59A 2BBYA 5JVTA 2V79A 1GXQA 3RYPA 2HGCA 2COMA 2P6TA 3ELKA 3P7NA 1SD7A 4UV9A 1ZHFA 5LHIA 4MQ9F 5EEGA 2E7XA 4Y17A 4WCGA 2JPBA 4MGRA 3FM3A 3GFJA 1J9IA 4KUMA 4LGWA 3I59A 4RAYA 3MAJA 4L9JA 3GEZA 3QU3A 1RI7A 4RB0A 4L5JA 2WTEA 2DI3A 1MDMA 4RB1A 5LHHA 4OIPF 3MCZA 1HW2A 4P5OA 2BV6A 4YIIA 1ZH5A 2A69F 3C3WA 2DO7A 2NNYA 4Y13A 2PG4A 1BM9A 3HSEA 3MZYA 1FP1D 1I1GA 5DD8A 1REPC 1WWXA 1JHHA 4A6DA 2Y48A 4G7OF 5A2QZ 3JW4A 4O5VA 4OMZA 4UVBA 3GLXA 5ICEA 1BJAA 4M6YA 1F9NA 1E2XA 4LLGF 5L3EA 4PZJA 3ULQB 2VBWA 1SFEA 3GXOA 5K1YA 4OIQF 3QPTA 4AD9A 2A61A 1W5TA 2YPRA 4AIJA 2MLKA 4CO8A 2DQLA 4M9XA 4BYYA 3N4MA 4MNUA
chains in the Genus database with same CATH superfamily
4A3MJ 2R7ZJ 3G73A 5E1WA 2BGCA 2IVMA 2WA0A 5CKTA 4ZZDA 1XPXA 2ISZA 3E0JB 4U7DA 2A6HF 2OZ6A 3R0AA 2HZTA 1FJLA 4YEJA 1YJ9I 2O6GE 3EQLF 4L0YB 4D0PA 3R4KA 1DUXC 4E7SA 4CCLA 2HWVA 2RQPA 5EF6A 1RESA 2GAUA 3DLAA 2W25A 2HTSA 4HSRA 3BTIA 2R5ZB 3I56I 2F4MB 4U0VA 4DYQA 1NH3A 4R8HA 3M4OJ 1S5LC 4XN0A 4DBRA 2NOGA 3KETA 2DFEA 3CQZJ 4MFEA 3BQYA 4AIKA 3BDDA 1ZR2A 3PIOF 1SAUA 3NWSA 4U88A 4ZYDA 1S29A 3MZ8A 1Z3YA 5D6EA 5L3CA 1WI3A 1LJ9A 4CH7A 4IVNA 1UJ8A 1QU3A 1JGGA 1MD0A 4XKWA 5J4VA 1XSDA 2VASA 4HNVA 2DPDA 4AUXA 3DPTA 5TGTA 5FKKA 4I99C 4XRSG 3G2BA 3PUFA 4QPQA 5EGOB 2ZFWA 2Y30A 3LQRA 3GTKJ 4LLLA 3KLNA 3TQNA 1BI2A 2J5PA 2KRFA 3SJMA 3I4NJ 2GIVA 2PBIA 2DYRH 1R7JA 4IJAA 4DOZA 3BC8A 5KVRA 3BG7A 5D8KB 1XGOA 1BIAA 4WXHA 5HDGA 3QYBA 3IKTA 4F55A 1BOBA 5EEHA 3JRIA 5ILVA 4BGDA 4PUSA 3DXJF 4ZTFA 3E6DA 3DLLF 2I5UA 4FE7A 4IRHA 1T39A 1A36A 1ZKGA 1U9NA 3MMYB 3WGGA 1V3FA 3JRHA 2ZNZA 4IEJA 5FRNA 2KIUA 1MDMB 4I02A 4IF4A 1V55H 2O3FA 2KJBA 4MFDA 4EJVA 1UAAA 4BQAA 2HVQA 3I54A 3S3MA 4GDFA 3ZQFA 2BY1A 2E5ZA 4BQQA 1BR4A 4M3GA 1Z3XA 1SVLA 3H0DA 2MH9A 5ILUA 1K79A 3CLOA 3LSHA 4BXFA 1BA5A 2Q0OA 1EF4A 1Z77A 1TLHB 4L9VA 3PNTA 4CCMA 2DLLA 3ZMSA 3WTYC 4XLEA 1SEUA 2DMNA 3F8MA 4A0ZA 4U0YA 3OYEA 3E97A 4UNOA 2DFFA 2XVCA 5HS9A 4XRSA 2K27A 2B7EA 1JKPC 2LD5A 4XRFA 2D5VA 2DODA 3HTSB 1PVEA 5E1ZB 2V9KA 2JSCA 1D0XA 2KRHA 4C2UA 2DOEA 2OC6A 4XK4A 2AXLA 4BXUA 3LFKA 4DW6A 4K2EA 2L5QA 2FU4A 3FXUA 3J80Z 1V5GA 2DK8A 4RAFA 3AKZA 1USSA 2R0QC 2ZXIA 2JPCA 2FBKA 1ZLJA 2FOWA 2Y9YA 3TOAA 4A5MA 4Q5SF 2YR2A 5B1AH 4XORA 2GOXB 4HQEA 3KYDB 2BXZA 1RKWA 1H9TA 1PUFA 2K9LA 2Z2SB 3AG2H 5LBQA 1AKHB 1BIBA 3L7WA 3IHUA 3DBHB 5EDNA 1QRYA 1P9QC 3WTSC 1FTZA 1WJEA 3IWZA 3ZQGA 2F5CA 2EFNA 4C2MJ 3ROUA 3E3VA 3BROA 3KCCA 5K7ZA 3AG4H 3GBGA 3ML6A 4B8XA 5GTHC 3K6GA 2XC7A 4JOMA 2CV2A 1LUJB 2L9RA 2LK2A 2VE8A 4BNCA 1UG0A 1U8RA 2H27A 4BAYA 2QUFA 1YJNI 2L9SA 2K40A 2UUZA 4JQFA 5E3MA 1R5GA 5DD4A 4EVIA 4F93B 4IOAF 1IO2A 2K85A 1D1AA 3BR0A 3ABUA 3NAUA 1W1WE 1QHHD 5LGTA 3IP4B 2ZC2A 5KK1A 3Q9SA 3IH2A 4ZTJA 3TEDA 1W5CC 1G8XA 2EV0A 1WJCA 1MSFC 3S2HJ 3WHBA 9ANTA 2OV7A 3WTXC 4EATA 3D0SA 3IV5A 2E5NA 1D8JA 1SAXA 5FLVA 4CCOA 1MZBA 5FLMJ 3RSNA 3JRDA 2X0LA 2WV0A 1P4WA 2IGKA 4UB8C 3KP3A 1TP4A 4IQ4A 3PO2J 5DCFA 2LH9A 1D5VA 2VB6A 1N78A 1V4RA 2V9PA 2WAFA 2GM4A 2QSHX 5J1UA 3HXLA 2OU2A 3OYGA 2L9NA 4RAGA 4M71A 3HZJA 1DP7P 2EPFA 4XKVA 3ISPA 2HZDA 4P96A 1EJ9A 1ZGJA 5GPCA 2DA4A 3DV8A 2XKPA 1LFUP 2Q8KA 4QTRA 2ZSIB 2K7LA 4DIQA 1BI0A 3CESA 3M9AA 1F5TA 2VLAA 5IYCJ 5IPAA 3CP2A 1CF7A 2RC4A 4HLXA 4S05A 3BG5A 1ETVA 4M9SA 3CJNA 1U3EM 2RN7A 2XV4S 2VOOA 2IXSA 1IGNA 5E18F 2EV5A 3DU5A 3CCSI 3PM1A 2R7QA 3KX2A 1Z6RA 1YW8A 2E60A 1T95A 2NXNB 3CF5F 4PGHA 1ETOA 3EUHC 1KU3A 4M3BA 4JP0A 3IH4A 4QIWN 3OYBA 2QQAA 3MD2A 3VSLA 2FEZA 4U0WA 2M2EA 4B43A 5J1YA 2OCCH 2DOAA 1OCCH 2XF5A 3BJAA 5LRSA 1R6RA 1IN8A 3I9V2 3LQQA 1LNWA 4FQGA 1XCBA 5E3OA 1YOVB 3I58A 1KQ8A 3TO6A 3IL2A 5H20A 3VYUB 3CO7C 4X1EA 2LC2A 2E1NA 4N9IA 2RKHA 1NG7A 3PSIA 3HEFA 2BVLA 2X6XA 2WY7Q 3FXOA 3K9TA 5LEJA 1OCZH 3GYHX 1A04A 2BXYA 5AIPA 5DUKA 2MD0A 3F8NA 2H8WA 2XRLA 5K7FA 4YFKF 5C4JJ 2O8KA 2VXZA 4WK8F 3OOUA 5IOZA 3K2ZA 1K83J 4ENKA 2P6SA 2A68F 1YRNA 2D1VA 3ONQA 5GP9A 2KKOA 3RQIA 2PMZA 3LWFA 4PFPA 3PNYA 1OCTC 4V19K 4J19A 1POGA 3J7ZI 1BC8C 1V54H 4ENJA 1BW5A 4IHVA 2CUFA 4DZPA 1G59A 4OMYA 2CQQA 2KLOA 3GLLA 1O7LA 5FFXA 4KITB 4A3BJ 3EETA 1DPUA 2X1DA 1ENHA 2HS5A 2FMYA 4ZYHA 3RCOA 2OZUA 1Y39A 1G3WA 3OMYA 2VBXA 4ANJA 2HQRA 3I4PA 2MFZA 3UR3C 5D6FA 1FP2A 2ELHA 2QQ8A 2WB1N 3WTVC 2YUSA 2GA2A 4EM2A 3CUQA 5L3GA 3KEOA 2CUZA 2FSWA 1ZRDA 2VUMJ 1ITYA 2R7DA 3ERMA 1SC7A 1KQ9A 3F8BA 1J5YA 3CLQA 4PGGA 2MSYA 1YS6A 1PUEE 3Q0WA 1JUSA 1XG1A 5JLWA 1W0TA 1X1DA 5J8FA 1IN7A 3F6VA 4ZYGA 2OUMA 3FMRA 2M45A 4ASNA 5IT3A 2XPUA 4ZDOA 3OYFA 2DFHA 1TQIA 2LKPA 1XDSA 2X48A 4N4NB 2D1HA 4B3AA 3PQKA 1I5ZA 2PMHA 3CD6I 3DBLB 3ZP5A 1F1ZA 4HX8A 4HAMA 2JA6J 2V4JC 1LE8A 1R5HA 2FBHA 2JA2A 2CSOA 4G8XA 1MMAA 2VJIA 5DCMA 4KIFA 1J75A 1SD4A 3ERED 4LOCA 2WAEA 3ZQIA 1HCRA 2LY9A 5F04A 4CCKA 3E7LA 3OYCA 3A03A 1SD6A 1MKMA 3QOPA 4OU0A 3D5SC 2CU7A 1FWZA 3KZZA 4IPAA 4E6KG 2RNJA 3KZIC 1Z05A 1XD7A 4F7ZA 2KRCA 4A3LJ 2N8GA 4X0GA 2HOSA 2HVSA 3V7SA 1IRXA 3KYLA 2VT3A 4MEYF 2ACJA 1CF7B 3Q5FA 2DBBA 3FF5A 4HX7A 3SDBA 2Q2EA 3IRRA 1FY7A 2JRMA 3P9CA 1S3JA 4LB5A 4KISA 1YE9A 4AVZA 1B9MA 3FMSA 3QPHA 2V1XA 4NUBA 3BCAA 5F0HA 1YFHA 3K2AA 4Z2YA 3FM5A 5LGUA 3X2QH 2HQAA 1QZYA 2CW8A 2OTLI 2Z16A 4L5IA 3MKZA 4A69C 2DMPA 2DA5A 2MYSA 3PQJA 5J4YA 1WPKA 3G6EI 1F4KA 3E5UA 4UHTA 4FCYA 1ORKA 1IDZA 5D5WB 1MNEA 3J81Z 3F3XA 4RM3A 2ZJRF 4BS9A 3K10A 2ETHA 5D5VB 2RNGA 1IAWA 4ZZLA 3EUAA 3BZCA 2OCEA 2VJ4A 3F72A 4II2A 2KHMA 3E6MA 3QYEA 4ZDPA 4BEHA 4LMYA 1XGNA 5HOOA 1VQ6I 4BDYA 2VOPA 2NYXA 2QM3A 2K4BA 1KU7A 1DGRM 1ZAOA 2W7NA 3BZKA 2EFPA 4XR6A 3IAM2 1YI2I 2CO5A 3AFHA 5AIQA 2NS8A 2IW5A 4JX4A 3GZNB 2UWMA 1V5EA 3Q3SA 2V6CA 4A3CJ 1S9HA 3GW2A 1ZG5A 2WB1A 2Z99A 3FKJA 2XAGA 2Y31A 4KNYA 2LF7A 2VBYA 2VJJA 5A2QK 3CJTB 1R4NB 3FKIJ 2VPLA 1R1TA 1O7FA 3WG7H 1ZQ3P 2VI6A 2ADUA 2ELJA 4I6ZA 1MH4A 2K9MA 2FNPA 3NRVA 1U5TA 3L09A 5TISC 3RTRA 2HI3A 3SEQA 1FOKA 3HRMA 3WTWC 1MIJA 2BW3B 4ETSA 2STTA 3JAMZ 1IDYA 1TC3C 1T2KA 1ZLKA 2UZKA 1TWAJ 3LNQA 2B63J 3DU6A 1HDDC 2M4KA 4ESBA 4E7LA 1K78A 1B8IA 2NOJB 2YX7A 5C44J 5FO5A 1IV8A 1QZEA 2Z9OA 1T0FA 3CCRI 2QBYB 3WGIA 3O2PE 4Y4RA 2QSGX 1KZHA 4CYCB 3DEWA 2FJ1A 2ZMEA 4HQMA 3OYHA 3MFKA 1XN7A 2PN6A 5FKNA 1IW7F 3NQOA 3OYDA 1W4MA 1WQ2A 3H9GA 2CV0A 2ZXHA 4Y15A 2FQ3A 3TP3A 3JSOA 4I09A 4IHTA 2JT1A 1RZ4A 4M3FA 4O3MA 4PFOA 3A2KA 2H94A 2NVTJ 2K9SA 4ZYEA 3FK7A 1W5SA 2V26A 2MBFA 4JBAA 1QVUA 3TMOA 5LGNA 3FXMA 3LAPA 1BJZA 1BN5A 2LREA 4I01A 1YS7A 2MW8A 1PP7U 2KT0A 4OIOF 1KA8A 4HV5A 1Y8RB 3RZDJ 1Z7LA 2KIMA 3B73A 1VQOI 2KMUA 3Q9VA 5J40A 2EA2A 2EZKA 4EGZA 5FD6A 1IF1A 3GVAA 4LD5A 4E7KA 2QWWA 2TRTA 1IXRC 2JJ7A 1IRFA 4Q47A 1I39A 4UVAA 5HLTA 4ENNA 4KIGA 3SHFA 1V5FA 4I2OA 1XGSA 4RGSA 4E7HA 1VQ4I 1R36A 4YRVA 1ACIA 2FBIA 1MMGA 1TWFJ 4R1HA 3L2VA 3LOCA 2V9VA 2Q2EB 3L2CA 3HGYA 5FRMA 2HOEA 4PSWA 2DA3A 2GZWA 3S1NJ 2PJRA 3KP6A 4XIDA 1FYLA 2R7UA 1ZN2A 2TCTA 4KYWA 5ICGA 5D5XB 3QPSA 4LIVA 4B48A 3R60A 1UELB 4YELA 2FE3A 5CQGA 2YSRA 1VF9A 2EFOA 4A3EJ 3HRTA 4KA4A 3CF2A 1PP8F 4L9TA 2IS1A 2ZCWA 2BEOA 1TTYA 3CTAA 4YFXF 1QA6A 4RBOA 4M6VA 3VEPA 2KIFA 3DWLE 3JRFA 1H9GA 1XDUA 1S7EA 3CCMI 4JX6A 4BEHB 3CJRB 1YX3A 2XPVA 3I64A 1IN6A 4UXNA 1ERDA 3P9KA 1FMVA 5CVRA 4ESJA 1B72B 1RR7A 2MABA 3K70C 4ON0A 4MIMA 2AHQA 3HOTA 1FOWA 2F6CA 4A5NA 3GX4X 1VQ8I 1VI0A 4E7IA 2WY8Q 1K4SA 1ETXA 4AWXB 4E7JA 2RGVA 2O61A 2E71A 2WADA 3P5JA 1X3WB 3CZ6A 1RR8C 3K4LA 1K6OA 4D9JA 2M87A 5HS8A 1I3QJ 1YIOA 1U5TB 2GXGA 1WFXA 2M0CA 1R22A 3FX3A 2VXDA 3OS1A 4NC6A 1I27A 4ZC3A 1WJBA 3WU2C 3LA2A 1BI3A 1U9OA 4GYIA 5E3LA 3J80K 5JR3A 3BZ6A 1B8IB 3I5UA 1P7JA 2LY1A 4LG0A 4HDVA 2R7OA 1NTCA 3ASOH 3FZVA 4F3QA 2DDAA 5JHFA 1FTTA 4YIFA 3W6KB 4P1WA 2QQ9A 2IS2A 2ZXWH 1P92A 3ZN0A 3I59B 5ILSA 2ZMEB 1MSEC 3L00A 1FYKA 4RGUA 4DYRA 3HOSA 2G7HA 1E3PA 2LOOA 4HOBA 3VSKA 4AVPA 2XRNA 1LFBA 1TNSA 4BJ5C 1MBHA 4CSWA 2LKSA 3CUOA 3CMAI 4R79A 4I98B 1J0RA 2XAHA 4ZH4F 4C3IJ 3JRAA 4JX5A 2XKOA 3QP5A 1B4AA 2F2EA 3OIPA 3WTZA 1Q1HA 3OS0A 1Z9CA 4IRIA 4AU7A 4B09A 4JK1X 2DXIA 1FZPB 3IC7A 3JTHA 2AXTC 4CXFA 2OQGA 3GMEA 1UHWA 2ISYA 1LKXA 2HQ5A 2X9DA 4BHBA 2ZKZA 2P5KA 1FOXA 1MW7A 2L7ZA 2OF7A 1TWCJ 2F48A 2R7FA 2X6OA 4LB6B 2LG4A 3ABLH 2IGMA 2FOKA 5JI6A 4MTDA 4M6XA 2LDUA 2TDXA 4NB5A 4G6TB 1WJAA 2EB7A 3F22A 2XAUA 1HF0A 4C3HJ 4CHUA 2GQQA 3GTMJ 2IJLA 2JUCA 3W6VA 2IA1A 1EH8A 4G7ZF 4GGGA 5TJJA 3OSGA 3GTJJ 2PJRB 5K5RA 2IP2A 2A6TA 2XPWA 1I6HJ 1WZ2A 2XSJC 3ZMDA 1RRJA 4KICA 1AHDP 2A07F 2K5CA 3SXYA 1C0WA 2NRAC 1QGPA 3OYKA 1AU7A 4L5EA 1XSXA 4M73A 4HX4A 2P8TA 3TOBA 2DJIA 2VKVA 3LMMA 3J7AY 1X1AA 2EWNA 2P81A 2W48A 2VT2A 1YHQI 2HKXA 1G4DA 1MBKA 1RUNA 2R7WA 1R4MB 1SMTA 1I50J 5M5YJ 3ZQQA 2F5FA 3BG3A 1WSUA 4D7MA 5GAEJ 2L01A 2KZGA 1GLNA 3G1MA 5M3FJ 1NHAA 3HPHA 2KIQA 4EV0A 2LLKA 2IAIA 1MJ9A 1R1VA 3OYJA 3M1EA 3T8TA 3ZR8X 4HNTA 1LVAA 2JUGA 1N77A 4M74A 4IKFA 3GCMA 3GTOJ 1R71A 2BE5F 3Q0UA 2E2JJ 2CG4A 3DEEA 1VQMI 3GTPJ 3M8FA 4I0AA 4FASD 4A93J 3ECHA 2NNNA 2D2WA 3OYNA 2MH2A 2PMUA 5EJCA 2HVRA 1YLFA 4PK4A 1H0MA 5LEKA 4RDUA 2VKEA 4M72A 1E17A 5IY5H 2HYJA 1F43A 3FXQA 4A2UA 1Q1VA 1ETYA 1VQNI 2CMPA 3EYYA 3LAJA 2KJCA 2JSPA 1OFCX 5CLSA 2DT6A 1NK2P 4A0XA 2HQNA 3WTUC 2P7VB 4J01A 4BHPA 2WBMA 1ZG1A 3SZGA 3BG6A 3BJ6A 2FF4A 3E5XA 3H5NA 1J7KA 4L0ZB 3KYCB 4LG0B 2P4WA 3JR9A 4XLNF 3I53A 3SDGA 4XSZF 1ZRFA 4ZYAA 2A5WA 2CS3A 5DDGA 3DCFA 5F0CA 1SANA 2EBIA 4LK1F 4A3KJ 1R00A 3CMYA 2XIGA 4PJ0C 4N0BA 5E8GA 3H9QA 5F64A 4KN4X 3HHGA 5FROA 1IJWC 2G7UA 5HODA 2JA5J 1MBFA 4AC0A 2L7KA 3HYIA 2XHKA 3WTTC 1QZZA 3TP0A 4MO7A 4EJOA 1E0EA 4CICA 6PAXA 1OPCA 1R1UA 1U0JA 3DTIA 3K4JA 4C30A 1WGXA 3GFLA 3OYAA 3KE2A 3LSJA 1S7AA 4B3XA 1D1CA 2QCOA 4HNUA 2RREA 1WCMJ 3MQ0A 2CQXA 1HKSA 3K1NA 3NWTA 2Y69H 1HSJA 3BR2A 3OS2A 4P9UA 3MVPA 2CYYA 5EYRA 4IL6C 4C3JJ 3ZQ7A 3GZ6A 3K0LA 2CWEA 1OCOH 1B6AA 1XTAA 3BP8A 2L3DA 1SD5A 3WGHA 1BC7C 3S1RJ 4BH9A 3ECOA 4Y52J 3U1DA 4RGXA 3BWGA 3H3VK 3AG3H 3B6AA 4B44A 3H9JA 5HDNA 1BL0A 3CDHA 2Y75A 4KT6A 3F6OA 2IS4A 1P4AA 3TO7A 4E4HA 4NBQA 3AAFA 1J2XA 4M3EA 4BJ6C 1YTYA 1HDPA 2EK5A 5BQTA 2DW4A 5B1BH 3S2WA 3U2RA 3UNGC 4FISA 2P5LC 5CVVA 3T8RA 2QZ8A 1Y0UA 4BDZA 3K4KA 4HZFA 3ZQCA 1XGMA 3REOA 4MHGA 4IQJA 3V7CA 3WE2A 2K86A 5C4XJ 1X2NA 2A5YB 1VNDA 1FOYA 2QQBA 2B9SA 1YITI 2FXAA 5JHUA 5DUIA 1VQPI 1FMWA 4G6DA 1SFOJ 3BPVA 2W84A 3BJOA 3C18A 1W7PA 1PUFB 2O7OA 1P4XA 5CJ9A 3VB2A 2P5VA 2LKXA 5H6QA 4XMYA 1F36A 5K5OA 1D0YA 1Y1VJ 3AG1H 1X1PA 4A0YA 4KDPA 4I76A 4BQOA 2LNBA 2DT7B 2MA3A 1MNDA 2HKOA 4A3JJ 2ID6A 2NS7A 3OWTA 4PJJA 3HOXJ 2QYOA 4EJWA 5LHGA 1YO5C 4W97A 3QP6A 5IP9J 5BMZA 1ZG3A 2RAEA 3F8CA 5L3FA 2F4IA 1Y8QB 2YS9A 1JHFA 3OOPA 3G1LA 1IXCA 3VODA 4FTHA 1ZREA 2PI0A 4XSXF 1HW1A 4FX4A 4XN3A 1XSVA 4CYDA 5FKLA 2Y0SN 3A1YA 4G6QA 4XONA 2X6YA 3H35A 2F5EA 2WWYA 1SVOA 3PUBA 1K61A 4FX0A 5EZHA 2CQ7A 3HC7A 1ZARA 4EM0B 3KIOA 4AIDA 5B5EC 4RB2C 1VZ0A 1BBYA 2DTZA 4NC7A 1BR1A 5ICFA 5HNFA 2D45A 2JQ7A 4CZZA 1OYYA 3KPHA 3BT9A 1MBEA 5E3NA 2E2HJ 4HF0A 2LMDA 3J81K 1XS9A 2BVMA 2BY3A 3H3ZA 1HKQA 2L2OA 1IC8A 1S6LA 2MC4A 4NQWA 2EZHA 2A3SA 2F5DA 3JSPA 1KGSA 1DU0A 4UUVA 3JRBA 1Y1WJ 3S16J 2JWTA 2L7FP 2MGQA 5E8IA 1QVTA 3I4MJ 2O9LA 2Z33A 1JGSA 3S2DJ 1WHUA 3DF8A 3H36A 2XGXA 5JLXA 2IPQX 3HG9A 3PSFA 2VQCA 4XM3A 5CPRB 4XLCA 1FIPA 3ESWB 4A6EA 2V1DA 2VJ5A 4I7HA 2LFBA 3CCLI 3JRCA 2ECBA 5F1JA 2DQRA 2M8GX 2X1CA 1Z0XA 5H6RA 1GV2A 2QKLB 3MN2A 3GFMA 3ZQLA 2JVHA 3I3LA 4RM2A 5F08A 1ZR4A 1P6RA 3HSRA 2LVSA 3KP2A 1U78A 5E17F 1OYWA 4XKCA 2M0MA 2OJED 1S7OA 3SEZA 1BR2A 5L3BA 3JAMK 5IT9Z 4U87A 3BR5A 4DQ2A 4LITA 1T56A 5GAHJ 1LDDA 2Y0MA 1ETWA 2HEOA 3RKYA 2EV6A 5IP6A 3L2QA 3S14J 1U6GA 1TT5B 2BHZA 5BPDA 5E20A 1HXDA 1T98A 2V6EA 1XMKA 4RAZA 1SMYF 4BY7J 2ZB9A 4KMFA 1IN4A 2M5WA 4BJTA 3DKXA 4BY1J 3OR2C 1QNTA 2G9WA 5JFRA 2H8RA 3DTKA 4NDLA 1D8KA 3M07A 1Z6TA 1ULYA 5GTIC 3L2UA 3PO3J 3SZPA 3FMQA 1LEBA 3LA7A 4QPOA 3OY9A 1QHGA 5HLIA 2ELKA 1GHCA 1ETQA 4PJMA 2RV8A 3BR6A 4M3DA 1TL8A 3ZPLA 1TT0A 2E34A 1RNLA 3QAHA 3MZHA 1SFKA 4WX9A 1RPWA 1T8IA 3RPUD 1W7PB 2DA6A 3LSKA 2MG4A 2IBDA 5CQEA 1HKTA 3RKXA 1QO0D 1SFXA 3ZMVA 1MMNA 2OBPA 1IN5A 1EKEA 2E7WA 1KYWA 3OR1C 1YRNB 4AYBN 3RJPA 1EA3A 3VFZA 5K5QA 2JMWA 3W2WA 1EH6A 2BY2A 4LK0F 3K70D 5FB2A 2EJRA 3HM5A 5CYVA 3HL2A 2CFOA 1GDTA 2W24A 3CC4I 2NS0A 1G6NA 3F9KA 3HKZN 3V4GA 2XROA 1XMXA 5BS6A 4B4CA 5BPIA 3DTEA 2FMLA 3WU1B 2HXIA 4A3DJ 4BQNA 2DJNA 4XOTA 1MBGA 3LSGA 2E2IJ 3DEUA 3KFWX 1RETA 3HIFA 1TZLA 2XDVA 3CUQB 2LP0A 1D3YA 3K69A 4IZZA 1K7AA 2JA8J 5F6FA 1R9TJ 5F1RA 3I71A 3DPUA 3ZMZA 3H5RA 2CFXA 4XQFA 5FLXZ 3GTQJ 3N97A 1KONA 4Q4ZF 2EFWA 1TBXA 1GXPA 4D5CA 1R49A 2X1EA 4NQWB 4WF2A 3U9GA 1JE8A 2XGEA 3G1OA 3OL4A 3CUQC 3LA3A 4F92B 4EQQA 2PFBA 2EIKH 2X4HA 2FNAA 2OA4A 5FFZA 2RQQA 3O6BB 3N05A 2P0WA 4HW0A 5J47A 2R7XA 1ONVA 3OYLA 4G7HF 4RB3C 3RI4A 1L0OC 5CVUA 2UXXA 4ESFA 4C2TA 4XLPF 1LE8B 2BY0A 2XASA 1AWCA 4UB6C 1ZYRF 4EEFG 1A6IA 5DCMB 4XRMA 4S0HB 5EG0A 4OWRB 3L1PA 1B1BA 1ON2A 2NAZA 3R6SA 4EJUA 5TRDA 3JTGA 2DPUA 3LSRA 1G2HA 2G0EA 2EZLA 1JI8A 2R7TA 3WE3A 4D7NA 1VFCA 1JJ6C 3E1SA 3EDPA 2E35A 3PFIA 1FBQA 2VE9A 3PJRA 3CMMA 3M3YJ 3KZYA 2XF6A 2BZTA 3GZ5A 3ASNH 1ZGAA 3BTCA 3VYRB 2VKHA 3TL4X 2DMQA 3PFYA 1EV7A 1UG2A 2XGDA 3IAS2 2K4JA 3BY6A 3T0YA 2WV1A 3E5QA 4BE1A 5LD2C 4D1QA 2M7BA 2DT5A 3M1CA 3BTLA 2GXAA 3H1CA 4LIUA 2ZJPF 3V7RA 2OD5A 4BBRJ 4IXAA 3GO5A 3PL8A 3HSFA 2XAFA 3V42A 1XMAA 1LEAA 2UV1A 1WJFA 2DA2A 3CC7I 3S3OA 3F8FA 5KCMA 2XB5A 1ETKA 1USTA 3DQVC 1H88C 3FISA 1LB2A 3V8LA 1MJBA 3HKZA 4GRIA 2RDPA 2LYCA 1U8BA 1K4TA 2VQHA 2EZIA 2L4MA 1TNTA 3ZMUA 4HRIA 2H1KA 4BBSJ 4XLAA 2V1NA 2MC3A 4ITVA 1TQPA 3GTGJ 3U1KA 3ZMTA 3D1NI 1ZELA 1ZK8A 1YJWI 1Z1DA 4KFCA 1DGWY 4RGRA 1GT0C 4DNCA 2LBFA 2K9NA 2A6EF 3A0BC 3KLOA 1IZ1A 1Y56A 2L54A 3C2GA 2ME6A 5JVGF 1GV5A 2IEKA 3HHHA 4GO1A 5D5UB 5KAIC 3GTLJ 4P55A 1WKMA 1TWHJ 3T1BA 3HUGA 3QRFF 5IYBJ 2LRDA 3CDLA 3OV8A 1WRJA 1YQAA 2DK5A 1YW7A 2DYSH 2O8XA 1J59A 2GA1A 5EEAA 3GFIA 2EIMH 1OYIA 2PLYA 4LLNA 3L2RA 3LSTA 3LSPA 5B66C 1IG7A 3J7AO 3KEYA 4BE2A 4KN7X 2HPIA 4OAZA 3O8GA 1TW3A 3OYMA 1K78B 1D0ZA 4OOIA 3D5LA 1BW6A 1U5TC 3A0HC 1UZCA 4LJZF 3KP7A 5IP7J 3UKGA 1N75A 4GCVA 4A3IJ 2DMUA 1P2FA 4KT5C 4M9ZA 1LQ1A 5F27A 3BPXA 4GFBA 3I55I 1N25A 4O6JA 1R5ID 3HRUA 1Z21A 3TGNA 3T5XA 5AONA 3G3ZA 2K02A 2DOFA 1MGTA 1BOAA 2AO9A 2Z3YA 2OQRA 2VBZA 5FJ8J 4FETA 1T0FC 3U21A 4OINF 2CUEA 1ODDA 3M8JA 5GADJ 1FSEA 4II3A 2QVOA 4OIRF 1FBSA 4HG2A 2VN2A 2ZMEC 3ZOBA 3FHZA 1JUMA 4BUPA 4BHCA 1IXSB 1AOYA 3QOEA 3W2VA 1T08B 1LDJA 4EGYA 1KYZA 1UFMA 1JTXA 1ZRCA 3CJQB 1FBUA 1R23A 1QPIA 5F0FA 5EG0B 4UVCA 2XSDC 1X19A 4IRGA 3M8EA 1G3TA 3VYSB 4CCJA 4UUSA 1JJ8C 2JZYA 1Y6IA 2CGPA 2K3PA 3QODA 1QPMA 2QEXI 2COBA 1R58A 1GVDA 2F4OB 2I10A 2AQFA 5FGMA 3K1MA 2OTJI 4F52A 2DA1A 4NC8A 4MQVA 1HC8A 4V2GA 1HQCA 1IRGA 1OCPA 3HPGA 4Y7NJ 2CH0A 3MKYB 1DP3A 3EUHA 5J1RA 3TW6A 2IA2A 2L4AA 1J09A 1KU9A 1FC3A 4ABZA 2VC0A 1D5YA 3FXKA 2DTRA 3O3KA 4XKBA 2Q1ZB 5GPAA 1JKOC 3F21A 2DAOA 4XLFA 2H6CA 4Y33A 1IUYA 3H0GJ 1FLIA 1ON1A 2GLOA 1OQYA 3DBRB 4A3GJ 3S15J 2EA4A 2GWRA 2E19A 2IRFG 4YG2F 1XC5A 2EFQA 4TV7A 1RIOH 1JUPA 3KEQA 1B9NA 1A5JA 5K7HA 4WXCA 1W36C 4LFUA 3W6JB 2EH3A 3C2BA 3KP5A 1CQTA 3TO9A 5GAGJ 2H6BA 2LR8A 3SYTA 3HOYJ 2JRTA 2E1CA 1SFUA 2DCEA 1A6QA 3K4CA 1O3TA 2VC1A 3WHCA 4S04A 3HOZJ 2HOAA 3L2WA 5M5WJ 1UCRA 3G4SI 3C2HA 3HRSA 4CDGA 2VQGA 1FT9A 2KISA 2J5OA 1YW9A 2KDZA 3EUKL 2W00A 3PIPF 5L3DA 1XCVA 2FA5A 2OPTA 3H5AA 3MEXA 1JXSA 1OISA 2HYGD 2LBFB 3LL7A 5D4SA 2DU9A 3BR3A 3DP7A 3D5RC 3EPZA 1S8NA 3FBIB 5E1XA 2NVQJ 2H09A 3OYIA 2W57A 2JA7J 4PJLA 3DFGA 2HFHA 3S1QJ 3HUGB 2V1UA 4QWQA 4C9YA 3K4BA 2ME0A 2LY2A 3DKYA 2HPMA 2HDCA 1YX5A 3GWZA 3NARA 4BL0B 2NVYJ 3CCYA 1MMSA 4H0EA 4FT8A 2IGOA 4Q48A 3SZTA 3V8JA 1X3ZB 3ZXSA 2ZNYA 4UV8A 3E6CC 1WI9A 3S93A 2R5YA 4I0BA 3HGGA 2MD5A 2KQRA 1G3YA 3COAC 3E6BA 3HOWJ 4BU2A 3OIOA 2BHYA 5FD5A 3RYRA 5IOYA 5ED4A 1IUFA 2GXBA 3WG9A 5BOXA 3ZQHA 3ZCOA 1WJ5A 3I0TA 1RUOA 3IWFA 4KMUX 2EIJH 2O0YA 2PMZN 2IT0A 3R0JA 4NHJA 1JT0A 1FPQA 1DU6A 3FXLA 5D4RA 1G3SA 2LSOA 1NK3P 4MEXF 5DM7F 5HS7A 3K7AJ 5HLGA 1RC9A 2BOLA 3HBLA 1OCRH 4EM1A 3DPLC 1XX5A 3VDXA 1X2MA 4DBQA 4WWCA 3CCEI 3VWBA 3NEUA 1I1SA 1I6XA 2VODA 2HXOA 3FXRA 2CW0F 4HA8A 3ZN1A 2CQNA 1HLVA 3CCVI 2O03A 2KFDA 5CVJA 3DKWA 4UUSB 1WJDA 1MMDA 1T6SA 2WAQN 3TW7A 1VTNC 1L3LA 1STZA 3GF2A 3IUOA 2HDDA 1OR7A 1H8AC 2XAJA 4L18B 1LVKA 5HVQC 3LFUA 3R61A 1U2WA 3EYIA 2DN0A 2ZJ2A 1O3QA 4A12A 4GXOA 4XBFA 2DFIA 2ZBKA 2CUJA 1DDNA 5IYDJ 3B02A 3MKLA 2X6WA 4EMSA 4E70A 3Q0VA 2L02A 3V8KA 2STWA 2V7FA 3SFIA 1TW2A 4ZJZA 2PJPA 1S72I 4IO9F 3BOQA 2YX4A 4CA0A 3C1DA 4AM3A 5LRRA 2CQKA 1UMQA 3SQNA 3CDIA 2M9HA 3P9IA 4RS8A 5M5XJ 3CO6C 1VQ7I 1D1BA 2CRGA 1Z7UA 2MLGA 1FSHA 2A05A 1BI1A 2FRHA 4HF1A 1O57A 2ESHA 2R7SA 3A4CA 1Y0NA 3S17J 2YU9J 4PJNA 4N9HA 2ESNA 1YIJI 3HB9A 1DQUA 4Z6YA 3GUDA 5DEQA 3RDIA 5J8CA 3MWMA 2ZXJA 2HDWA 3BCBA 4HYEA 2XB0X 2I8DA 4W1UA 1MBJA 4V2FA 5ICCA 1VQKI 2ZO4A 2HOTA 3TBIA 4HF2A 1MJAA 3K1PA 3ABTA 1LFPA 4GYGA 4B1RA 4JYKA 3JREA 1PDNC 1X58A 4HDUA 3M7GA 2KP6A 1E3HA 3BLYA 5IT9K 3KP4A 1OMIA 5J3LA 1W7PD 2R7RA 1HSTA 3A01A 2CJJA 2QKMB 2QSFX 4MLOA 1QQIA 2OAZA 1HBXG 2VONA 2NVUB 3VOEA 2UXNA 1UHMA 2E36A 4KIBA 4XL9A 4HBLA 2M30A 2YU3A 4G12A 2F5VA 4PSXA 2L9VA 2O5RA 4BKXA 2QA4I 4F91B 1IRZA 3FK6A 2KPMA 2W82A 5D8LB 2GBYA 2BW3A 4P9FA 1T38A 1GUUA 2QGUA 4N4OB 1TWGJ 2PEXA 2XGCA 5ERIA 3WODF 2R5YB 3CMEI 2IS6A 4U7BA 2ID3A 3RKWA 1MH3A 4OAYA 1IV6A 4FE4A 4PDKA 1QBJA 2Y2ZA 1Z91A 1KU2A 1HW5A 2DA7A 4H4KC 3VPRA 3H92A 3S3NA 2WC2A 2QBYA 2PX9A 2WAQA 1X1CA 2XAQA 2JVGA 5LFAA 4CYCA 1FYMA 2LTPA 4PCQA 4CGZA 1LDKB 4RLFA 3IRQA 5DV5A 3FWEA 1NG6A 2R93J 1GVJA 3QU6A 1LPQA 3TDUC 2W85A 1APLC 3ZGKA 2M34A 2JN6A 3PNVA 1KQ0A 2FQ4A 4XNFA 4MTEA 1HOMA 3VYTB 2M8EA 3H3UA 2HTJA 2BYVE 4QLCU 2VQLA 1DPRA 3OIQA 4YFNF 2HYFA 2R3SA 5J6XA 2NVXJ 5DTDA 1K6YA 3IH3A 3IKVA 1X4PA 5LLQA 3HTUA 2M1BA 3SFZA 2ZFUA 3F23A 1FEXA 5DYMA 2H1LA 1O3SA 1UHSA 5H2FC 1CGPA 2B0LA 2P7CB 3TDZC 2W4SA 5EZGA 2VKDA 2R7VA 5E79C 3RZOJ 3LSIA 2ZSHB 1X4OA 2IGNA 1M1EB 2Z5UA 1TQMA 1SVMA 1YYVA 3FBNB 4RLQA 1X3UA 2QENA 1OJLA 2XUBA 5FLXK 1OR7C 3OSFA 1H89C 4HLYA 2W1OA 5FKMA 4BACA 3TKYA 2M3AA 1EH7A 1OKRA 3QWLA 1O3RA 3CC2I 2R4GA 1E3OC 3RPUA 4L9NA 5BNGA 5KAFC 4HV6A 3G71I 4XLHA 2KDOA 2LF8A 2QLZA 3C7JA 3RPQA 4AIHA 4G94A 3S32A 3ABKH 2JTVA 1FX7A 4EJTA 3WU0A 2Y0SA 3L9FA 2R92J 2C6YA 4FHTA 4RMNA 3RIRA 1HA8A 2E1OA 4WXDA 1JTYA 5CVIA 1JT6A 3K4NA 4Y3OA 3ZRGA 2X51A 1PJRA 4ENMA 1FIAA 5HDKA 1ZGWA 2RVCA 2JK3A 4DJAA 1YG2A 1ZTRA 2HR3A 2GOMA 2AS5F 4BE0A 4X6AJ 4IOCF 1FNNA 1XB4A 2AQEA 1UB9A 2IA0A 1PYVA 4G9YA 1AA7A 1B72A 4IHSA 4BXXJ 2PQ8A 2GIZA 4HSTA 4XOPA 5KHDA 5HLHA 2R5ZA 1P7IA 1B59A 3BTJA 5HNHA 2BBYA 5JVTA 2V79A 3HDDA 1GXQA 3A01B 2VPRA 3BR1A 4LG3A 2L0KA 4CZCA 3JRGA 2M7AA 4RA2A 3RYPA 2KL4A 2HGCA 2COMA 4NNJA 4ZDLA 2P6TA 3MKWB 2HNHA 2KZVA 3ELKA 2CV1A 1A35A 3P7NA 1OLTA 2Y9ZA 1SD7A 2K9QA 4UV9A 1ZHFA 5LHIA 3F0CA 3RKQA 2FD5A 4MQ9F 5DS9A 1A31A 2EINH 3W3CA 2ICWG 2E7XA 3FDYA 5EEGA 4E7ZA 4Y17A 5EGOA 1WH5A 4DYCA 4UUTA 4WCGA 1JKRC 2EQRA 3HOVJ 2JPBA 4CUGA 4D5FA 4MGRA 4DGWB 2VIXA 3FM3A 3FHNA 3QYFA 3QPLA 3GFJA 4B47A 1J9IA 4KUMA 3CCUI 5KNLA 4LGWA 3I59A 4RAYA 4A3FJ 3O8HA 3CP8A 4YIRX 3MAJA 3K4MA 1O4XA 4L9JA 2CW7A 1T33A 3GEZA 3QU3A 3S1MJ 4XICA 1I3AA 2HU9A 2VL8A 1RI7A 4HPQA 3S8PA 3RQ4A 4RB0A 5FKOA 2X85A 4L5JA 2ECCA 1W0UA 2WTEA 4QSHA 2DI3A 3CCQI 2M4GA 1MDMA 4RB1A 4HEA2 4J00A 2XF7A 5LHHA 5C3EJ 4OIPF 3MCZA 3A02A 3OL3A 1HW2A 2L7MP 4P5OA 2K3FA 2BV6A 3FIWA 4YIIA 1ZH5A 4KJZA 2A69F 3C3WA 3LSMA 3BG9A 2DO7A 4Y13A 2PG4A 3CCJI 2NNYA 3JCUC 1BM9A 3B6CA 5B3SH 3J7YJ 3HSEA 3HJEA 3MZYA 1FP1D 1I1GA 2EILH 5DD8A 1WWXA 1REPC 1JHHA 3QQAA 4A6DA 2Y48A 4G7OF 2DDBA 1VQ5I 1WH7A 1WVRA 2E1MB 2Z1DA 3JW4A 2FX0A 5A2QZ 4O5VA 4OMZA 4UVBA 4IHYA 3GLXA 5ICEA 1BJAA 1JKQC 2FUG2 1RKTA 4M6YA 4IHXA 1F9NA 1E2XA 2ZJQF 4UY8I 4LLGF 3W2AA 5L3EA 4PZJA 4AYBA 3ULQB 4CCNA 2E1MC 2VBWA 3AL0B 1VQ9I 1SFEA 4IHWA 3GXOA 5K1YA 3ABMH 4IX7A 4OIQF 3QPTA 3BQZA 1Z67A 5M3MJ 4AD9A 3HOUJ 2A61A 1MNMC 1W5TA 2YPRA 4AIJA 1W36D 3AL0C 2MLKA 4CO8A 2QF7A 2DQLA 1VQLI 4M9XA 4DZJA 1AKHA 1X1BA 4BYYA 3FXJA 5DM6F 3N4MA 4MNUA 2DMTA
chains in the Genus database with same CATH topology
3G73A 5E1WA 2BGCA 2IVMA 4ZZDA 2ISZA 4U7DA 2A6HF 2OZ6A 3R0AA 2HZTA 2O6GE 3EQLF 4L0YB 4D0PA 3R4KA 1DUXC 2HWVA 2RQPA 2GAUA 2W25A 2HTSA 4U0VA 4R8HA 3KETA 4AIKA 3BDDA 4U88A 4ZYDA 1S29A 5D6EA 5L3CA 1LJ9A 4IVNA 1MD0A 1XSDA 2DPDA 3DPTA 2ZFWA 3LQRA 4LLLA 3KLNA 3TQNA 1BI2A 2J5PA 2KRFA 2GIVA 2PBIA 4IJAA 1R7JA 5KVRA 5D8KB 1XGOA 1BIAA 4WXHA 5HDGA 3IKTA 5EEHA 5ILVA 3DXJF 3E6DA 4IRHA 1T39A 3WGGA 1V3FA 2ZNZA 2KIUA 1MDMB 4I02A 4IF4A 2O3FA 2KJBA 4EJVA 4BQAA 3I54A 2MH9A 5ILUA 1K79A 3CLOA 2Q0OA 1TLHB 4L9VA 2DLLA 3ZMSA 3WTYC 3F8MA 4A0ZA 4U0YA 3E97A 4UNOA 5HS9A 2XVCA 2K27A 4XRFA 3HTSB 5E1ZB 2JSCA 2AXLA 4BXUA 3LFKA 4K2EA 2FU4A 3FXUA 3J80Z 2DK8A 1USSA 2JPCA 2FBKA 1ZLJA 4A5MA 3TOAA 4Q5SF 2YR2A 4HQEA 1H9TA 5LBQA 1BIBA 3L7WA 3IHUA 3WTSC 3IWZA 2F5CA 2EFNA 3ROUA 3E3VA 3BROA 3KCCA 3ML6A 4B8XA 2VE8A 4BNCA 1U8RA 2H27A 4BAYA 2QUFA 4JQFA 1R5GA 5DD4A 4EVIA 3ABUA 5LGTA 5KK1A 3Q9SA 2EV0A 3WTXC 3D0SA 1D8JA 1SAXA 1MZBA 2X0LA 2WV0A 1P4WA 3KP3A 5DCFA 1D5VA 1V4RA 2OU2A 4M71A 1DP7P 3ISPA 4P96A 1ZGJA 3DV8A 2XKPA 2Q8KA 2K7LA 1BI0A 3M9AA 1F5TA 1CF7A 2RC4A 4HLXA 4S05A 4M9SA 3CJNA 1U3EM 2RN7A 2XV4S 2VOOA 5E18F 2EV5A 1Z6RA 1YW8A 4PGHA 1KU3A 2QQAA 2FEZA 4U0WA 5LRSA 3BJAA 1IN8A 3LQQA 1LNWA 1XCBA 3I58A 1KQ8A 3TO6A 3IL2A 5H20A 3CO7C 2E1NA 4N9IA 2RKHA 5LEJA 3K9TA 3GYHX 1A04A 5AIPA 5DUKA 3F8NA 4YFKF 2VXZA 4WK8F 3K2ZA 4ENKA 2P6SA 2A68F 2D1VA 2KKOA 3LWFA 1BC8C 4ENJA 4OMYA 5FFXA 1O7LA 1DPUA 3EETA 2HS5A 2FMYA 4ZYHA 2OZUA 1G3WA 2VBXA 2HQRA 3I4PA 5D6FA 1FP2A 2ELHA 3WTVC 2GA2A 4EM2A 3CUQA 5L3GA 3KEOA 2FSWA 1ZRDA 2R7DA 1KQ9A 3F8BA 1J5YA 4PGGA 1YS6A 1PUEE 5J8FA 1IN7A 3F6VA 4ZYGA 3FMRA 2M45A 4ASNA 5IT3A 1TQIA 2LKPA 1XDSA 2D1HA 3PQKA 1I5ZA 2PMHA 3ZP5A 1F1ZA 4HX8A 4HAMA 1R5HA 2FBHA 2CSOA 4G8XA 5DCMA 4KIFA 1J75A 1SD4A 3ERED 1SD6A 1MKMA 3QOPA 4OU0A 1FWZA 3KZZA 4IPAA 2RNJA 1Z05A 1XD7A 4F7ZA 3V7SA 2VT3A 4MEYF 2ACJA 1CF7B 3Q5FA 2DBBA 3FF5A 4HX7A 2Q2EA 3IRRA 1FY7A 3P9CA 1S3JA 4LB5A 1B9MA 3FMSA 3QPHA 2V1XA 1YFHA 4Z2YA 3FM5A 5LGUA 1QZYA 4L5IA 3PQJA 1F4KA 3E5UA 4UHTA 5D5WB 3J81Z 3F3XA 2ETHA 5D5VB 1IAWA 4ZZLA 3F72A 3E6MA 4LMYA 1XGNA 5HOOA 2VOPA 2NYXA 2QM3A 2K4BA 1KU7A 1ZAOA 2EFPA 2CO5A 5AIQA 2IW5A 2UWMA 2V6CA 3GW2A 1ZG5A 2Z99A 2XAGA 4KNYA 2LF7A 2VBYA 5A2QK 1R1TA 1O7FA 2ADUA 2FNPA 3NRVA 1U5TA 3L09A 3RTRA 1FOKA 3HRMA 3WTWC 4ETSA 2STTA 3JAMZ 1T2KA 1ZLKA 2UZKA 4ESBA 1K78A 2YX7A 5FO5A 2Z9OA 1T0FA 2QBYB 3WGIA 3O2PE 2ZMEA 4HQMA 3MFKA 1XN7A 2PN6A 1IW7F 3NQOA 1W4MA 1WQ2A 4Y15A 2FQ3A 3JSOA 4I09A 4IHTA 2JT1A 1RZ4A 4O3MA 2H94A 4ZYEA 1W5SA 4JBAA 2MBFA 5LGNA 3LAPA 1BN5A 4I01A 1YS7A 1PP7U 4OIOF 1KA8A 4HV5A 2KIMA 3B73A 3Q9VA 2EA2A 4EGZA 5FD6A 1IF1A 3GVAA 4LD5A 2QWWA 1IXRC 1IRFA 4Q47A 4UVAA 4ENNA 4KIGA 3SHFA 4I2OA 1XGSA 4RGSA 1R36A 2FBIA 4R1HA 2V9VA 3L2CA 2HOEA 2GZWA 3KP6A 1FYLA 1ZN2A 4KYWA 5ICGA 5D5XB 3R60A 2FE3A 2YSRA 2EFOA 3HRTA 4KA4A 1PP8F 4L9TA 2ZCWA 2BEOA 1TTYA 3CTAA 4YFXF 3VEPA 2KIFA 1H9GA 1XDUA 3I64A 1IN6A 4UXNA 3P9KA 5CVRA 4ESJA 4ON0A 3HOTA 4A5NA 3GX4X 4AWXB 2RGVA 2O61A 1K6OA 2M87A 5HS8A 1YIOA 1U5TB 2GXGA 1R22A 3FX3A 1I27A 3LA2A 1BI3A 4GYIA 3J80K 5JR3A 3BZ6A 3I5UA 4LG0A 4HDVA 3FZVA 4YIFA 3W6KB 2QQ9A 1P92A 3ZN0A 3I59B 5ILSA 2ZMEB 3L00A 1FYKA 4RGUA 3HOSA 2G7HA 4HOBA 4AVPA 2XRNA 1TNSA 3CUOA 4R79A 4I98B 1J0RA 2XAHA 4ZH4F 2XKOA 3QP5A 1B4AA 2F2EA 3WTZA 4IRIA 1Q1HA 1Z9CA 4B09A 4JK1X 1FZPB 3IC7A 3JTHA 4CXFA 2OQGA 1UHWA 2ISYA 4BHBA 2ZKZA 2P5KA 4LB6B 2R7FA 2FOKA 5JI6A 4MTDA 4M6XA 2LDUA 2TDXA 4NB5A 3F22A 2EB7A 4CHUA 2GQQA 2IJLA 2IA1A 1EH8A 4G7ZF 4GGGA 5TJJA 5K5RA 2IP2A 3ZMDA 4KICA 2A07F 3SXYA 1C0WA 2NRAC 1QGPA 1XSXA 4M73A 4HX4A 2P8TA 3TOBA 2EWNA 2VT2A 1G4DA 2HKXA 1RUNA 1SMTA 2F5FA 1WSUA 2L01A 1NHAA 4EV0A 1MJ9A 1R1VA 3M1EA 3T8TA 1LVAA 4M74A 2BE5F 2CG4A 3M8FA 4I0AA 3ECHA 2NNNA 2D2WA 2MH2A 2PMUA 1YLFA 1H0MA 5LEKA 4M72A 1E17A 3FXQA 4A2UA 3LAJA 3EYYA 2KJCA 5CLSA 4A0XA 2HQNA 3WTUC 2P7VB 4BHPA 1ZG1A 3BJ6A 2FF4A 3E5XA 1J7KA 4L0ZB 4LG0B 2P4WA 4XLNF 3I53A 4XSZF 1ZRFA 5DDGA 4LK1F 1R00A 2XIGA 4N0BA 5E8GA 5F64A 4KN4X 3HHGA 2G7UA 3HYIA 2XHKA 3WTTC 1QZZA 4EJOA 4CICA 6PAXA 1OPCA 1R1UA 3GFLA 3KE2A 1S7AA 3MQ0A 1HKSA 3K1NA 1HSJA 4P9UA 2CYYA 3GZ6A 3ZQ7A 3K0LA 2CWEA 1B6AA 3BP8A 2L3DA 1SD5A 3WGHA 1BC7C 4BH9A 3ECOA 3U1DA 4RGXA 3BWGA 5HDNA 3CDHA 2Y75A 3F6OA 1P4AA 3TO7A 3AAFA 1J2XA 1YTYA 5BQTA 2EK5A 2DW4A 3S2WA 3U2RA 2P5LC 5CVVA 3T8RA 2QZ8A 1Y0UA 4HZFA 1XGMA 3REOA 4MHGA 3V7CA 3WE2A 2K86A 2A5YB 2QQBA 2FXAA 5JHUA 5DUIA 4G6DA 3BPVA 2W84A 3BJOA 3C18A 1W7PA 1P4XA 5CJ9A 3VB2A 2P5VA 5H6QA 5K5OA 4A0YA 4KDPA 2LNBA 2MA3A 2HKOA 2QYOA 4EJWA 5LHGA 1YO5C 3QP6A 5BMZA 1ZG3A 3F8CA 5L3FA 3OOPA 1JHFA 1IXCA 3VODA 1ZREA 2PI0A 4XSXF 1HW1A 4FX4A 1XSVA 4CYDA 4G6QA 2F5EA 2WWYA 4FX0A 1ZARA 4EM0B 4RB2C 1BBYA 5ICFA 2D45A 4CZZA 1OYYA 4HF0A 3J81K 3H3ZA 1HKQA 1S6LA 4NQWA 2A3SA 2F5DA 3JSPA 1KGSA 4UUVA 5E8IA 2Z33A 1JGSA 3DF8A 2XGXA 2IPQX 4A6EA 2V1DA 4I7HA 2DQRA 5H6RA 3GFMA 1P6RA 3HSRA 3KP2A 1U78A 5E17F 1OYWA 1S7OA 5L3BA 3JAMK 5IT9Z 4DQ2A 1LDDA 2Y0MA 2HEOA 3RKYA 2EV6A 1U6GA 5BPDA 5E20A 1HXDA 1T98A 1XMKA 4RAZA 1SMYF 4KMFA 1IN4A 2M5WA 1QNTA 2G9WA 5JFRA 1D8KA 1Z6TA 1ULYA 3SZPA 3FMQA 1LEBA 3LA7A 5HLIA 1GHCA 2RV8A 3ZPLA 1RNLA 3QAHA 3MZHA 4WX9A 1W7PB 1HKTA 3RKXA 1QO0D 1SFXA 3ZMVA 2OBPA 1IN5A 2E7WA 1KYWA 3RJPA 3VFZA 5K5QA 1EH6A 4LK0F 5FB2A 2EJRA 5CYVA 2W24A 2NS0A 1G6NA 3V4GA 2XROA 5BS6A 5BPIA 2FMLA 3WU1B 3DEUA 3KFWX 3HIFA 3CUQB 1D3YA 3K69A 1K7AA 5F6FA 5F1RA 3I71A 3ZMZA 5FLXZ 2CFXA 3N97A 4Q4ZF 2EFWA 1TBXA 1GXPA 1JE8A 3U9GA 4WF2A 3CUQC 3LA3A 4EQQA 2PFBA 2X4HA 2FNAA 2OA4A 5FFZA 3O6BB 4HW0A 1ONVA 4G7HF 3RI4A 4RB3C 1L0OC 5CVUA 2UXXA 4ESFA 4XLPF 2XASA 1AWCA 1ZYRF 5DCMB 1B1BA 1ON2A 2NAZA 3R6SA 4EJUA 5TRDA 3JTGA 2DPUA 3WE3A 3EDPA 3PFIA 1FBQA 2VE9A 3KZYA 3GZ5A 1ZGAA 1EV7A 2K4JA 3BY6A 3T0YA 3E5QA 2DT5A 3V7RA 2OD5A 4IXAA 3GO5A 3HSFA 2XAFA 1XMAA 1LEAA 3F8FA 1USTA 3DQVC 1LB2A 3V8LA 1MJBA 2RDPA 2L4MA 1TNTA 3ZMUA 2MC3A 1TQPA 3ZMTA 1Z1DA 4KFCA 4RGRA 4DNCA 2A6EF 3KLOA 1IZ1A 2L54A 3HHHA 4GO1A 5D5UB 4P55A 1WKMA 3T1BA 3HUGA 3QRFF 3OV8A 1WRJA 1YQAA 2DK5A 1YW7A 2O8XA 1J59A 2GA1A 3GFIA 1OYIA 2PLYA 4LLNA 3LSTA 3J7AO 4KN7X 1TW3A 1K78B 4OOIA 3D5LA 1U5TC 4LJZF 3KP7A 4GCVA 4KT5C 1P2FA 4M9ZA 1LQ1A 3BPXA 4O6JA 3HRUA 3TGNA 3T5XA 5AONA 3G3ZA 2K02A 1MGTA 1BOAA 2Z3YA 2OQRA 2VBZA 4OINF 1ODDA 1FSEA 2QVOA 4OIRF 1FBSA 2VN2A 3FHZA 4BHCA 1IXSB 1AOYA 1LDJA 4EGYA 1KYZA 1UFMA 1ZRCA 1FBUA 1R23A 4UVCA 4IRGA 3M8EA 1G3TA 2JZYA 2CGPA 1QPMA 1R58A 5FGMA 3K1MA 4MQVA 1IRGA 1HQCA 3EUHA 2IA2A 2L4AA 1KU9A 1FC3A 2VC0A 2DTRA 3O3KA 3F21A 2DAOA 2H6CA 1IUYA 1FLIA 1ON1A 2EA4A 2GWRA 2IRFG 4YG2F 2EFQA 4TV7A 1RIOH 3KEQA 1B9NA 4WXCA 4LFUA 3W6JB 3KP5A 3TO9A 2H6BA 2JRTA 2E1CA 1SFUA 1O3TA 2VC1A 4S04A 1UCRA 3HRSA 4CDGA 1FT9A 2J5OA 1YW9A 5L3DA 1XCVA 2FA5A 3MEXA 1JXSA 2HYGD 5D4SA 2DU9A 3DP7A 1S8NA 5E1XA 2H09A 2W57A 3DFGA 2HFHA 2V1UA 4QWQA 2HDCA 3GWZA 4H0EA 4FT8A 4Q48A 3SZTA 3V8JA 2ZNYA 4UV8A 3E6CC 1WI9A 4I0BA 2MD5A 3COAC 1G3YA 3E6BA 5FD5A 3RYRA 5ED4A 2GXBA 3WG9A 5BOXA 3I0TA 1RUOA 3IWFA 4KMUX 2O0YA 2IT0A 4NHJA 3R0JA 1FPQA 5D4RA 1G3SA 2LSOA 4MEXF 5HS7A 5HLGA 4EM1A 3DPLC 4WWCA 3NEUA 1I1SA 1I6XA 2VODA 3FXRA 2CW0F 4HA8A 3ZN1A 2O03A 5CVJA 3DKWA 1T6SA 1L3LA 1VTNC 1STZA 3GF2A 1OR7A 4L18B 2XAJA 5HVQC 3R61A 1U2WA 3EYIA 2ZJ2A 1O3QA 4A12A 4GXOA 4XBFA 2DFIA 2ZBKA 1DDNA 3B02A 4EMSA 4E70A 2L02A 3V8KA 2STWA 1TW2A 2PJPA 3BOQA 2YX4A 3C1DA 5LRRA 2CQKA 3SQNA 3P9IA 4RS8A 3CO6C 1Z7UA 2MLGA 1FSHA 1BI1A 2FRHA 4HF1A 1O57A 2ESHA 4N9HA 2ESNA 3GUDA 5DEQA 3RDIA 5J8CA 3MWMA 2ZXJA 4HYEA 5ICCA 2ZO4A 4HF2A 1MJAA 3K1PA 3ABTA 4GYGA 1PDNC 4HDUA 3M7GA 5IT9K 3KP4A 1OMIA 1W7PD 1HSTA 1HBXG 1QQIA 2OAZA 2VONA 3VOEA 2UXNA 1UHMA 4KIBA 4HBLA 2M30A 2YU3A 5D8LB 4P9FA 1T38A 2PEXA 5ERIA 3WODF 4U7BA 3RKWA 4PDKA 1QBJA 1Z91A 1KU2A 1HW5A 3H92A 2QBYA 2WC2A 2XAQA 1FYMA 4PCQA 4CGZA 1LDKB 3IRQA 5DV5A 3FWEA 1GVJA 3QU6A 3TDUC 2W85A 1KQ0A 4MTEA 2M8EA 3H3UA 2HTJA 2BYVE 4QLCU 1DPRA 4YFNF 2HYFA 2R3SA 5J6XA 3IKVA 5LLQA 3HTUA 2M1BA 3SFZA 3F23A 5DYMA 1O3SA 1CGPA 2B0LA 2P7CB 3TDZC 2Z5UA 1TQMA 1YYVA 1X3UA 2QENA 2XUBA 5FLXK 4HLYA 3TKYA 1EH7A 1OKRA 1O3RA 3RPUA 4L9NA 4HV6A 2QLZA 2LF8A 3C7JA 3RPQA 4AIHA 4G94A 2JTVA 1FX7A 4EJTA 3WU0A 3L9FA 2C6YA 4FHTA 3RIRA 4WXDA 5CVIA 4ENMA 5HDKA 2RVCA 1YG2A 2HR3A 2AS5F 1FNNA 1XB4A 2IA0A 1UB9A 4G9YA 4IHSA 2PQ8A 5HLHA 1B59A 2BBYA 5JVTA 2V79A 1GXQA 3RYPA 2HGCA 2COMA 2P6TA 3ELKA 3P7NA 1SD7A 4UV9A 1ZHFA 5LHIA 4MQ9F 5EEGA 2E7XA 4Y17A 4WCGA 2JPBA 4MGRA 3FM3A 3GFJA 1J9IA 4KUMA 4LGWA 3I59A 4RAYA 3MAJA 4L9JA 3GEZA 3QU3A 1RI7A 4RB0A 4L5JA 2WTEA 2DI3A 1MDMA 4RB1A 5LHHA 4OIPF 3MCZA 1HW2A 4P5OA 2BV6A 4YIIA 1ZH5A 2A69F 3C3WA 2DO7A 2NNYA 4Y13A 2PG4A 1BM9A 3HSEA 3MZYA 1FP1D 1I1GA 5DD8A 1REPC 1WWXA 1JHHA 4A6DA 2Y48A 4G7OF 5A2QZ 3JW4A 4O5VA 4OMZA 4UVBA 3GLXA 5ICEA 1BJAA 4M6YA 1F9NA 1E2XA 4LLGF 5L3EA 4PZJA 3ULQB 2VBWA 1SFEA 3GXOA 5K1YA 4OIQF 3QPTA 4AD9A 2A61A 1W5TA 2YPRA 4AIJA 2MLKA 4CO8A 2DQLA 4M9XA 4BYYA 3N4MA 4MNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G73 A;  5E1W A;  2BGC A;  2IVM A;  4ZZD A;  2ISZ A;  4U7D A;  2A6H F;  2OZ6 A;  3R0A A;  2HZT A;  2O6G E;  3EQL F;  4L0Y B;  4D0P A;  3R4K A;  1DUX C;  2HWV A;  2RQP A;  2GAU A;  2W25 A;  2HTS A;  4U0V A;  4R8H A;  3KET A;  4AIK A;  3BDD A;  4U88 A;  4ZYD A;  1S29 A;  5D6E A;  5L3C A;  1LJ9 A;  4IVN A;  1MD0 A;  1XSD A;  2DPD A;  3DPT A;  2ZFW A;  3LQR A;  4LLL A;  3KLN A;  3TQN A;  1BI2 A;  2J5P A;  2KRF A;  2GIV A;  2PBI A;  4IJA A;  1R7J A;  5KVR A;  5D8K B;  1XGO A;  1BIA A;  4WXH A;  5HDG A;  3IKT A;  5EEH A;  5ILV A;  3DXJ F;  3E6D A;  4IRH A;  1T39 A;  3WGG A;  1V3F A;  2ZNZ A;  2KIU A;  1MDM B;  4I02 A;  4IF4 A;  2O3F A;  2KJB A;  4EJV A;  4BQA A;  3I54 A;  2MH9 A;  5ILU A;  1K79 A;  3CLO A;  2Q0O A;  1TLH B;  4L9V A;  2DLL A;  3ZMS A;  3WTY C;  3F8M A;  4A0Z A;  4U0Y A;  3E97 A;  4UNO A;  5HS9 A;  2XVC A;  2K27 A;  4XRF A;  3HTS B;  5E1Z B;  2JSC A;  2AXL A;  4BXU A;  3LFK A;  4K2E A;  2FU4 A;  3FXU A;  3J80 Z;  2DK8 A;  1USS A;  2JPC A;  2FBK A;  1ZLJ A;  4A5M A;  3TOA A;  4Q5S F;  2YR2 A;  4HQE A;  1H9T A;  5LBQ A;  1BIB A;  3L7W A;  3IHU A;  3WTS C;  3IWZ A;  2F5C A;  2EFN A;  3ROU A;  3E3V A;  3BRO A;  3KCC A;  3ML6 A;  4B8X A;  2VE8 A;  4BNC A;  1U8R A;  2H27 A;  4BAY A;  2QUF A;  4JQF A;  1R5G A;  5DD4 A;  4EVI A;  3ABU A;  5LGT A;  5KK1 A;  3Q9S A;  2EV0 A;  3WTX C;  3D0S A;  1D8J A;  1SAX A;  1MZB A;  2X0L A;  2WV0 A;  1P4W A;  3KP3 A;  5DCF A;  1D5V A;  1V4R A;  2OU2 A;  4M71 A;  1DP7 P;  3ISP A;  4P96 A;  1ZGJ A;  3DV8 A;  2XKP A;  2Q8K A;  2K7L A;  1BI0 A;  3M9A A;  1F5T A;  1CF7 A;  2RC4 A;  4HLX A;  4S05 A;  4M9S A;  3CJN A;  1U3E M;  2RN7 A;  2XV4 S;  2VOO A;  5E18 F;  2EV5 A;  1Z6R A;  1YW8 A;  4PGH A;  1KU3 A;  2QQA A;  2FEZ A;  4U0W A;  5LRS A;  3BJA A;  1IN8 A;  3LQQ A;  1LNW A;  1XCB A;  3I58 A;  1KQ8 A;  3TO6 A;  3IL2 A;  5H20 A;  3CO7 C;  2E1N A;  4N9I A;  2RKH A;  5LEJ A;  3K9T A;  3GYH X;  1A04 A;  5AIP A;  5DUK A;  3F8N A;  4YFK F;  2VXZ A;  4WK8 F;  3K2Z A;  4ENK A;  2P6S A;  2A68 F;  2D1V A;  2KKO A;  3LWF A;  1BC8 C;  4ENJ A;  4OMY A;  5FFX A;  1O7L A;  1DPU A;  3EET A;  2HS5 A;  2FMY A;  4ZYH A;  2OZU A;  1G3W A;  2VBX A;  2HQR A;  3I4P A;  5D6F A;  1FP2 A;  2ELH A;  3WTV C;  2GA2 A;  4EM2 A;  3CUQ A;  5L3G A;  3KEO A;  2FSW A;  1ZRD A;  2R7D A;  1KQ9 A;  3F8B A;  1J5Y A;  4PGG A;  1YS6 A;  1PUE E;  5J8F A;  1IN7 A;  3F6V A;  4ZYG A;  3FMR A;  2M45 A;  4ASN A;  5IT3 A;  1TQI A;  2LKP A;  1XDS A;  2D1H A;  3PQK A;  1I5Z A;  2PMH A;  3ZP5 A;  1F1Z A;  4HX8 A;  4HAM A;  1R5H A;  2FBH A;  2CSO A;  4G8X A;  5DCM A;  4KIF A;  1J75 A;  1SD4 A;  3ERE D;  1SD6 A;  1MKM A;  3QOP A;  4OU0 A;  1FWZ A;  3KZZ A;  4IPA A;  2RNJ A;  1Z05 A;  1XD7 A;  4F7Z A;  3V7S A;  2VT3 A;  4MEY F;  2ACJ A;  1CF7 B;  3Q5F A;  2DBB A;  3FF5 A;  4HX7 A;  2Q2E A;  3IRR A;  1FY7 A;  3P9C A;  1S3J A;  4LB5 A;  1B9M A;  3FMS A;  3QPH A;  2V1X A;  1YFH A;  4Z2Y A;  3FM5 A;  5LGU A;  1QZY A;  4L5I A;  3PQJ A;  1F4K A;  3E5U A;  4UHT A;  5D5W B;  3J81 Z;  3F3X A;  2ETH A;  5D5V B;  1IAW A;  4ZZL A;  3F72 A;  3E6M A;  4LMY A;  1XGN A;  5HOO A;  2VOP A;  2NYX A;  2QM3 A;  2K4B A;  1KU7 A;  1ZAO A;  2EFP A;  2CO5 A;  5AIQ A;  2IW5 A;  2UWM A;  2V6C A;  3GW2 A;  1ZG5 A;  2Z99 A;  2XAG A;  4KNY A;  2LF7 A;  2VBY A;  5A2Q K;  1R1T A;  1O7F A;  2ADU A;  2FNP A;  3NRV A;  1U5T A;  3L09 A;  3RTR A;  1FOK A;  3HRM A;  3WTW C;  4ETS A;  2STT A;  3JAM Z;  1T2K A;  1ZLK A;  2UZK A;  4ESB A;  1K78 A;  2YX7 A;  5FO5 A;  2Z9O A;  1T0F A;  2QBY B;  3WGI A;  3O2P E;  2ZME A;  4HQM A;  3MFK A;  1XN7 A;  2PN6 A;  1IW7 F;  3NQO A;  1W4M A;  1WQ2 A;  4Y15 A;  2FQ3 A;  3JSO A;  4I09 A;  4IHT A;  2JT1 A;  1RZ4 A;  4O3M A;  2H94 A;  4ZYE A;  1W5S A;  4JBA A;  2MBF A;  5LGN A;  3LAP A;  1BN5 A;  4I01 A;  1YS7 A;  1PP7 U;  4OIO F;  1KA8 A;  4HV5 A;  2KIM A;  3B73 A;  3Q9V A;  2EA2 A;  4EGZ A;  5FD6 A;  1IF1 A;  3GVA A;  4LD5 A;  2QWW A;  1IXR C;  1IRF A;  4Q47 A;  4UVA A;  4ENN A;  4KIG A;  3SHF A;  4I2O A;  1XGS A;  4RGS A;  1R36 A;  2FBI A;  4R1H A;  2V9V A;  3L2C A;  2HOE A;  2GZW A;  3KP6 A;  1FYL A;  1ZN2 A;  4KYW A;  5ICG A;  5D5X B;  3R60 A;  2FE3 A;  2YSR A;  2EFO A;  3HRT A;  4KA4 A;  1PP8 F;  4L9T A;  2ZCW A;  2BEO A;  1TTY A;  3CTA A;  4YFX F;  3VEP A;  2KIF A;  1H9G A;  1XDU A;  3I64 A;  1IN6 A;  4UXN A;  3P9K A;  5CVR A;  4ESJ A;  4ON0 A;  3HOT A;  4A5N A;  3GX4 X;  4AWX B;  2RGV A;  2O61 A;  1K6O A;  2M87 A;  5HS8 A;  1YIO A;  1U5T B;  2GXG A;  1R22 A;  3FX3 A;  1I27 A;  3LA2 A;  1BI3 A;  4GYI A;  3J80 K;  5JR3 A;  3BZ6 A;  3I5U A;  4LG0 A;  4HDV A;  3FZV A;  4YIF A;  3W6K B;  2QQ9 A;  1P92 A;  3ZN0 A;  3I59 B;  5ILS A;  2ZME B;  3L00 A;  1FYK A;  4RGU A;  3HOS A;  2G7H A;  4HOB A;  4AVP A;  2XRN A;  1TNS A;  3CUO A;  4R79 A;  4I98 B;  1J0R A;  2XAH A;  4ZH4 F;  2XKO A;  3QP5 A;  1B4A A;  2F2E A;  3WTZ A;  4IRI A;  1Q1H A;  1Z9C A;  4B09 A;  4JK1 X;  1FZP B;  3IC7 A;  3JTH A;  4CXF A;  2OQG A;  1UHW A;  2ISY A;  4BHB A;  2ZKZ A;  2P5K A;  4LB6 B;  2R7F A;  2FOK A;  5JI6 A;  4MTD A;  4M6X A;  2LDU A;  2TDX A;  4NB5 A;  3F22 A;  2EB7 A;  4CHU A;  2GQQ A;  2IJL A;  2IA1 A;  1EH8 A;  4G7Z F;  4GGG A;  5TJJ A;  5K5R A;  2IP2 A;  3ZMD A;  4KIC A;  2A07 F;  3SXY A;  1C0W A;  2NRA C;  1QGP A;  1XSX A;  4M73 A;  4HX4 A;  2P8T A;  3TOB A;  2EWN A;  2VT2 A;  1G4D A;  2HKX A;  1RUN A;  1SMT A;  2F5F A;  1WSU A;  2L01 A;  1NHA A;  4EV0 A;  1MJ9 A;  1R1V A;  3M1E A;  3T8T A;  1LVA A;  4M74 A;  2BE5 F;  2CG4 A;  3M8F A;  4I0A A;  3ECH A;  2NNN A;  2D2W A;  2MH2 A;  2PMU A;  1YLF A;  1H0M A;  5LEK A;  4M72 A;  1E17 A;  3FXQ A;  4A2U A;  3LAJ A;  3EYY A;  2KJC A;  5CLS A;  4A0X A;  2HQN A;  3WTU C;  2P7V B;  4BHP A;  1ZG1 A;  3BJ6 A;  2FF4 A;  3E5X A;  1J7K A;  4L0Z B;  4LG0 B;  2P4W A;  4XLN F;  3I53 A;  4XSZ F;  1ZRF A;  5DDG A;  4LK1 F;  1R00 A;  2XIG A;  4N0B A;  5E8G A;  5F64 A;  4KN4 X;  3HHG A;  2G7U A;  3HYI A;  2XHK A;  3WTT C;  1QZZ A;  4EJO A;  4CIC A;  6PAX A;  1OPC A;  1R1U A;  3GFL A;  3KE2 A;  1S7A A;  3MQ0 A;  1HKS A;  3K1N A;  1HSJ A;  4P9U A;  2CYY A;  3GZ6 A;  3ZQ7 A;  3K0L A;  2CWE A;  1B6A A;  3BP8 A;  2L3D A;  1SD5 A;  3WGH A;  1BC7 C;  4BH9 A;  3ECO A;  3U1D A;  4RGX A;  3BWG A;  5HDN A;  3CDH A;  2Y75 A;  3F6O A;  1P4A A;  3TO7 A;  3AAF A;  1J2X A;  1YTY A;  5BQT A;  2EK5 A;  2DW4 A;  3S2W A;  3U2R A;  2P5L C;  5CVV A;  3T8R A;  2QZ8 A;  1Y0U A;  4HZF A;  1XGM A;  3REO A;  4MHG A;  3V7C A;  3WE2 A;  2K86 A;  2A5Y B;  2QQB A;  2FXA A;  5JHU A;  5DUI A;  4G6D A;  3BPV A;  2W84 A;  3BJO A;  3C18 A;  1W7P A;  1P4X A;  5CJ9 A;  3VB2 A;  2P5V A;  5H6Q A;  5K5O A;  4A0Y A;  4KDP A;  2LNB A;  2MA3 A;  2HKO A;  2QYO A;  4EJW A;  5LHG A;  1YO5 C;  3QP6 A;  5BMZ A;  1ZG3 A;  3F8C A;  5L3F A;  3OOP A;  1JHF A;  1IXC A;  3VOD A;  1ZRE A;  2PI0 A;  4XSX F;  1HW1 A;  4FX4 A;  1XSV A;  4CYD A;  4G6Q A;  2F5E A;  2WWY A;  4FX0 A;  1ZAR A;  4EM0 B;  4RB2 C;  1BBY A;  5ICF A;  2D45 A;  4CZZ A;  1OYY A;  4HF0 A;  3J81 K;  3H3Z A;  1HKQ A;  1S6L A;  4NQW A;  2A3S A;  2F5D A;  3JSP A;  1KGS A;  4UUV A;  5E8I A;  2Z33 A;  1JGS A;  3DF8 A;  2XGX A;  2IPQ X;  4A6E A;  2V1D A;  4I7H A;  2DQR A;  5H6R A;  3GFM A;  1P6R A;  3HSR A;  3KP2 A;  1U78 A;  5E17 F;  1OYW A;  1S7O A;  5L3B A;  3JAM K;  5IT9 Z;  4DQ2 A;  1LDD A;  2Y0M A;  2HEO A;  3RKY A;  2EV6 A;  1U6G A;  5BPD A;  5E20 A;  1HXD A;  1T98 A;  1XMK A;  4RAZ A;  1SMY F;  4KMF A;  1IN4 A;  2M5W A;  1QNT A;  2G9W A;  5JFR A;  1D8K A;  1Z6T A;  1ULY A;  3SZP A;  3FMQ A;  1LEB A;  3LA7 A;  5HLI A;  1GHC A;  2RV8 A;  3ZPL A;  1RNL A;  3QAH A;  3MZH A;  4WX9 A;  1W7P B;  1HKT A;  3RKX A;  1QO0 D;  1SFX A;  3ZMV A;  2OBP A;  1IN5 A;  2E7W A;  1KYW A;  3RJP A;  3VFZ A;  5K5Q A;  1EH6 A;  4LK0 F;  5FB2 A;  2EJR A;  5CYV A;  2W24 A;  2NS0 A;  1G6N A;  3V4G A;  2XRO A;  5BS6 A;  5BPI A;  2FML A;  3WU1 B;  3DEU A;  3KFW X;  3HIF A;  3CUQ B;  1D3Y A;  3K69 A;  1K7A A;  5F6F A;  5F1R A;  3I71 A;  3ZMZ A;  5FLX Z;  2CFX A;  3N97 A;  4Q4Z F;  2EFW A;  1TBX A;  1GXP A;  1JE8 A;  3U9G A;  4WF2 A;  3CUQ C;  3LA3 A;  4EQQ A;  2PFB A;  2X4H A;  2FNA A;  2OA4 A;  5FFZ A;  3O6B B;  4HW0 A;  1ONV A;  4G7H F;  3RI4 A;  4RB3 C;  1L0O C;  5CVU A;  2UXX A;  4ESF A;  4XLP F;  2XAS A;  1AWC A;  1ZYR F;  5DCM B;  1B1B A;  1ON2 A;  2NAZ A;  3R6S A;  4EJU A;  5TRD A;  3JTG A;  2DPU A;  3WE3 A;  3EDP A;  3PFI A;  1FBQ A;  2VE9 A;  3KZY A;  3GZ5 A;  1ZGA A;  1EV7 A;  2K4J A;  3BY6 A;  3T0Y A;  3E5Q A;  2DT5 A;  3V7R A;  2OD5 A;  4IXA A;  3GO5 A;  3HSF A;  2XAF A;  1XMA A;  1LEA A;  3F8F A;  1UST A;  3DQV C;  1LB2 A;  3V8L A;  1MJB A;  2RDP A;  2L4M A;  1TNT A;  3ZMU A;  2MC3 A;  1TQP A;  3ZMT A;  1Z1D A;  4KFC A;  4RGR A;  4DNC A;  2A6E F;  3KLO A;  1IZ1 A;  2L54 A;  3HHH A;  4GO1 A;  5D5U B;  4P55 A;  1WKM A;  3T1B A;  3HUG A;  3QRF F;  3OV8 A;  1WRJ A;  1YQA A;  2DK5 A;  1YW7 A;  2O8X A;  1J59 A;  2GA1 A;  3GFI A;  1OYI A;  2PLY A;  4LLN A;  3LST A;  3J7A O;  4KN7 X;  1TW3 A;  1K78 B;  4OOI A;  3D5L A;  1U5T C;  4LJZ F;  3KP7 A;  4GCV A;  4KT5 C;  1P2F A;  4M9Z A;  1LQ1 A;  3BPX A;  4O6J A;  3HRU A;  3TGN A;  3T5X A;  5AON A;  3G3Z A;  2K02 A;  1MGT A;  1BOA A;  2Z3Y A;  2OQR A;  2VBZ A;  4OIN F;  1ODD A;  1FSE A;  2QVO A;  4OIR F;  1FBS A;  2VN2 A;  3FHZ A;  4BHC A;  1IXS B;  1AOY A;  1LDJ A;  4EGY A;  1KYZ A;  1UFM A;  1ZRC A;  1FBU A;  1R23 A;  4UVC A;  4IRG A;  3M8E A;  1G3T A;  2JZY A;  2CGP A;  1QPM A;  1R58 A;  5FGM A;  3K1M A;  4MQV A;  1IRG A;  1HQC A;  3EUH A;  2IA2 A;  2L4A A;  1KU9 A;  1FC3 A;  2VC0 A;  2DTR A;  3O3K A;  3F21 A;  2DAO A;  2H6C A;  1IUY A;  1FLI A;  1ON1 A;  2EA4 A;  2GWR A;  2IRF G;  4YG2 F;  2EFQ A;  4TV7 A;  1RIO H;  3KEQ A;  1B9N A;  4WXC A;  4LFU A;  3W6J B;  3KP5 A;  3TO9 A;  2H6B A;  2JRT A;  2E1C A;  1SFU A;  1O3T A;  2VC1 A;  4S04 A;  1UCR A;  3HRS A;  4CDG A;  1FT9 A;  2J5O A;  1YW9 A;  5L3D A;  1XCV A;  2FA5 A;  3MEX A;  1JXS A;  2HYG D;  5D4S A;  2DU9 A;  3DP7 A;  1S8N A;  5E1X A;  2H09 A;  2W57 A;  3DFG A;  2HFH A;  2V1U A;  4QWQ A;  2HDC A;  3GWZ A;  4H0E A;  4FT8 A;  4Q48 A;  3SZT A;  3V8J A;  2ZNY A;  4UV8 A;  3E6C C;  1WI9 A;  4I0B A;  2MD5 A;  3COA C;  1G3Y A;  3E6B A;  5FD5 A;  3RYR A;  5ED4 A;  2GXB A;  3WG9 A;  5BOX A;  3I0T A;  1RUO A;  3IWF A;  4KMU X;  2O0Y A;  2IT0 A;  4NHJ A;  3R0J A;  1FPQ A;  5D4R A;  1G3S A;  2LSO A;  4MEX F;  5HS7 A;  5HLG A;  4EM1 A;  3DPL C;  4WWC A;  3NEU A;  1I1S A;  1I6X A;  2VOD A;  3FXR A;  2CW0 F;  4HA8 A;  3ZN1 A;  2O03 A;  5CVJ A;  3DKW A;  1T6S A;  1L3L A;  1VTN C;  1STZ A;  3GF2 A;  1OR7 A;  4L18 B;  2XAJ A;  5HVQ C;  3R61 A;  1U2W A;  3EYI A;  2ZJ2 A;  1O3Q A;  4A12 A;  4GXO A;  4XBF A;  2DFI A;  2ZBK A;  1DDN A;  3B02 A;  4EMS A;  4E70 A;  2L02 A;  3V8K A;  2STW A;  1TW2 A;  2PJP A;  3BOQ A;  2YX4 A;  3C1D A;  5LRR A;  2CQK A;  3SQN A;  3P9I A;  4RS8 A;  3CO6 C;  1Z7U A;  2MLG A;  1FSH A;  1BI1 A;  2FRH A;  4HF1 A;  1O57 A;  2ESH A;  4N9H A;  2ESN A;  3GUD A;  5DEQ A;  3RDI A;  5J8C A;  3MWM A;  2ZXJ A;  4HYE A;  5ICC A;  2ZO4 A;  4HF2 A;  1MJA A;  3K1P A;  3ABT A;  4GYG A;  1PDN C;  4HDU A;  3M7G A;  5IT9 K;  3KP4 A;  1OMI A;  1W7P D;  1HST A;  1HBX G;  1QQI A;  2OAZ A;  2VON A;  3VOE A;  2UXN A;  1UHM A;  4KIB A;  4HBL A;  2M30 A;  2YU3 A;  5D8L B;  4P9F A;  1T38 A;  2PEX A;  5ERI A;  3WOD F;  4U7B A;  3RKW A;  4PDK A;  1QBJ A;  1Z91 A;  1KU2 A;  1HW5 A;  3H92 A;  2QBY A;  2WC2 A;  2XAQ A;  1FYM A;  4PCQ A;  4CGZ A;  1LDK B;  3IRQ A;  5DV5 A;  3FWE A;  1GVJ A;  3QU6 A;  3TDU C;  2W85 A;  1KQ0 A;  4MTE A;  2M8E A;  3H3U A;  2HTJ A;  2BYV E;  4QLC U;  1DPR A;  4YFN F;  2HYF A;  2R3S A;  5J6X A;  3IKV A;  5LLQ A;  3HTU A;  2M1B A;  3SFZ A;  3F23 A;  5DYM A;  1O3S A;  1CGP A;  2B0L A;  2P7C B;  3TDZ C;  2Z5U A;  1TQM A;  1YYV A;  1X3U A;  2QEN A;  2XUB A;  5FLX K;  4HLY A;  3TKY A;  1EH7 A;  1OKR A;  1O3R A;  3RPU A;  4L9N A;  4HV6 A;  2QLZ A;  2LF8 A;  3C7J A;  3RPQ A;  4AIH A;  4G94 A;  2JTV A;  1FX7 A;  4EJT A;  3WU0 A;  3L9F A;  2C6Y A;  4FHT A;  3RIR A;  4WXD A;  5CVI A;  4ENM A;  5HDK A;  2RVC A;  1YG2 A;  2HR3 A;  2AS5 F;  1FNN A;  1XB4 A;  2IA0 A;  1UB9 A;  4G9Y A;  4IHS A;  2PQ8 A;  5HLH A;  1B59 A;  2BBY A;  5JVT A;  2V79 A;  1GXQ A;  3RYP A;  2HGC A;  2COM A;  2P6T A;  3ELK A;  3P7N A;  1SD7 A;  4UV9 A;  1ZHF A;  5LHI A;  4MQ9 F;  5EEG A;  2E7X A;  4Y17 A;  4WCG A;  2JPB A;  4MGR A;  3FM3 A;  3GFJ A;  1J9I A;  4KUM A;  4LGW A;  3I59 A;  4RAY A;  3MAJ A;  4L9J A;  3GEZ A;  3QU3 A;  1RI7 A;  4RB0 A;  4L5J A;  2WTE A;  2DI3 A;  1MDM A;  4RB1 A;  5LHH A;  4OIP F;  3MCZ A;  1HW2 A;  4P5O A;  2BV6 A;  4YII A;  1ZH5 A;  2A69 F;  3C3W A;  2DO7 A;  2NNY A;  4Y13 A;  2PG4 A;  1BM9 A;  3HSE A;  3MZY A;  1FP1 D;  1I1G A;  5DD8 A;  1REP C;  1WWX A;  1JHH A;  4A6D A;  2Y48 A;  4G7O F;  5A2Q Z;  3JW4 A;  4O5V A;  4OMZ A;  4UVB A;  3GLX A;  5ICE A;  1BJA A;  4M6Y A;  1F9N A;  1E2X A;  4LLG F;  5L3E A;  4PZJ A;  3ULQ B;  2VBW A;  1SFE A;  3GXO A;  5K1Y A;  4OIQ F;  3QPT A;  4AD9 A;  2A61 A;  1W5T A;  2YPR A;  4AIJ A;  2MLK A;  4CO8 A;  2DQL A;  4M9X A;  4BYY A;  3N4M A;  4MNU A; 
#chains in the Genus database with same CATH topology
 4A3M J;  2R7Z J;  3G73 A;  5E1W A;  2BGC A;  2IVM A;  2WA0 A;  5CKT A;  4ZZD A;  1XPX A;  2ISZ A;  3E0J B;  4U7D A;  2A6H F;  2OZ6 A;  3R0A A;  2HZT A;  1FJL A;  4YEJ A;  1YJ9 I;  2O6G E;  3EQL F;  4L0Y B;  4D0P A;  3R4K A;  1DUX C;  4E7S A;  4CCL A;  2HWV A;  2RQP A;  5EF6 A;  1RES A;  2GAU A;  3DLA A;  2W25 A;  2HTS A;  4HSR A;  3BTI A;  2R5Z B;  3I56 I;  2F4M B;  4U0V A;  4DYQ A;  1NH3 A;  4R8H A;  3M4O J;  1S5L C;  4XN0 A;  4DBR A;  2NOG A;  3KET A;  2DFE A;  3CQZ J;  4MFE A;  3BQY A;  4AIK A;  3BDD A;  1ZR2 A;  3PIO F;  1SAU A;  3NWS A;  4U88 A;  4ZYD A;  1S29 A;  3MZ8 A;  1Z3Y A;  5D6E A;  5L3C A;  1WI3 A;  1LJ9 A;  4CH7 A;  4IVN A;  1UJ8 A;  1QU3 A;  1JGG A;  1MD0 A;  4XKW A;  5J4V A;  1XSD A;  2VAS A;  4HNV A;  2DPD A;  4AUX A;  3DPT A;  5TGT A;  5FKK A;  4I99 C;  4XRS G;  3G2B A;  3PUF A;  4QPQ A;  5EGO B;  2ZFW A;  2Y30 A;  3LQR A;  3GTK J;  4LLL A;  3KLN A;  3TQN A;  1BI2 A;  2J5P A;  2KRF A;  3SJM A;  3I4N J;  2GIV A;  2PBI A;  2DYR H;  1R7J A;  4IJA A;  4DOZ A;  3BC8 A;  5KVR A;  3BG7 A;  5D8K B;  1XGO A;  1BIA A;  4WXH A;  5HDG A;  3QYB A;  3IKT A;  4F55 A;  1BOB A;  5EEH A;  3JRI A;  5ILV A;  4BGD A;  4PUS A;  3DXJ F;  4ZTF A;  3E6D A;  3DLL F;  2I5U A;  4FE7 A;  4IRH A;  1T39 A;  1A36 A;  1ZKG A;  1U9N A;  3MMY B;  3WGG A;  1V3F A;  3JRH A;  2ZNZ A;  4IEJ A;  5FRN A;  2KIU A;  1MDM B;  4I02 A;  4IF4 A;  1V55 H;  2O3F A;  2KJB A;  4MFD A;  4EJV A;  1UAA A;  4BQA A;  2HVQ A;  3I54 A;  3S3M A;  4GDF A;  3ZQF A;  2BY1 A;  2E5Z A;  4BQQ A;  1BR4 A;  4M3G A;  1Z3X A;  1SVL A;  3H0D A;  2MH9 A;  5ILU A;  1K79 A;  3CLO A;  3LSH A;  4BXF A;  1BA5 A;  2Q0O A;  1EF4 A;  1Z77 A;  1TLH B;  4L9V A;  3PNT A;  4CCM A;  2DLL A;  3ZMS A;  3WTY C;  4XLE A;  1SEU A;  2DMN A;  3F8M A;  4A0Z A;  4U0Y A;  3OYE A;  3E97 A;  4UNO A;  2DFF A;  2XVC A;  5HS9 A;  4XRS A;  2K27 A;  2B7E A;  1JKP C;  2LD5 A;  4XRF A;  2D5V A;  2DOD A;  3HTS B;  1PVE A;  5E1Z B;  2V9K A;  2JSC A;  1D0X A;  2KRH A;  4C2U A;  2DOE A;  2OC6 A;  4XK4 A;  2AXL A;  4BXU A;  3LFK A;  4DW6 A;  4K2E A;  2L5Q A;  2FU4 A;  3FXU A;  3J80 Z;  1V5G A;  2DK8 A;  4RAF A;  3AKZ A;  1USS A;  2R0Q C;  2ZXI A;  2JPC A;  2FBK A;  1ZLJ A;  2FOW A;  2Y9Y A;  3TOA A;  4A5M A;  4Q5S F;  2YR2 A;  5B1A H;  4XOR A;  2GOX B;  4HQE A;  3KYD B;  2BXZ A;  1RKW A;  1H9T A;  1PUF A;  2K9L A;  2Z2S B;  3AG2 H;  5LBQ A;  1AKH B;  1BIB A;  3L7W A;  3IHU A;  3DBH B;  5EDN A;  1QRY A;  1P9Q C;  3WTS C;  1FTZ A;  1WJE A;  3IWZ A;  3ZQG A;  2F5C A;  2EFN A;  4C2M J;  3ROU A;  3E3V A;  3BRO A;  3KCC A;  5K7Z A;  3AG4 H;  3GBG A;  3ML6 A;  4B8X A;  5GTH C;  3K6G A;  2XC7 A;  4JOM A;  2CV2 A;  1LUJ B;  2L9R A;  2LK2 A;  2VE8 A;  4BNC A;  1UG0 A;  1U8R A;  2H27 A;  4BAY A;  2QUF A;  1YJN I;  2L9S A;  2K40 A;  2UUZ A;  4JQF A;  5E3M A;  1R5G A;  5DD4 A;  4EVI A;  4F93 B;  4IOA F;  1IO2 A;  2K85 A;  1D1A A;  3BR0 A;  3ABU A;  3NAU A;  1W1W E;  1QHH D;  5LGT A;  3IP4 B;  2ZC2 A;  5KK1 A;  3Q9S A;  3IH2 A;  4ZTJ A;  3TED A;  1W5C C;  1G8X A;  2EV0 A;  1WJC A;  1MSF C;  3S2H J;  3WHB A;  9ANT A;  2OV7 A;  3WTX C;  4EAT A;  3D0S A;  3IV5 A;  2E5N A;  1D8J A;  1SAX A;  5FLV A;  4CCO A;  1MZB A;  5FLM J;  3RSN A;  3JRD A;  2X0L A;  2WV0 A;  1P4W A;  2IGK A;  4UB8 C;  3KP3 A;  1TP4 A;  4IQ4 A;  3PO2 J;  5DCF A;  2LH9 A;  1D5V A;  2VB6 A;  1N78 A;  1V4R A;  2V9P A;  2WAF A;  2GM4 A;  2QSH X;  5J1U A;  3HXL A;  2OU2 A;  3OYG A;  2L9N A;  4RAG A;  4M71 A;  3HZJ A;  1DP7 P;  2EPF A;  4XKV A;  3ISP A;  2HZD A;  4P96 A;  1EJ9 A;  1ZGJ A;  5GPC A;  2DA4 A;  3DV8 A;  2XKP A;  1LFU P;  2Q8K A;  4QTR A;  2ZSI B;  2K7L A;  4DIQ A;  1BI0 A;  3CES A;  3M9A A;  1F5T A;  2VLA A;  5IYC J;  5IPA A;  3CP2 A;  1CF7 A;  2RC4 A;  4HLX A;  4S05 A;  3BG5 A;  1ETV A;  4M9S A;  3CJN A;  1U3E M;  2RN7 A;  2XV4 S;  2VOO A;  2IXS A;  1IGN A;  5E18 F;  2EV5 A;  3DU5 A;  3CCS I;  3PM1 A;  2R7Q A;  3KX2 A;  1Z6R A;  1YW8 A;  2E60 A;  1T95 A;  2NXN B;  3CF5 F;  4PGH A;  1ETO A;  3EUH C;  1KU3 A;  4M3B A;  4JP0 A;  3IH4 A;  4QIW N;  3OYB A;  2QQA A;  3MD2 A;  3VSL A;  2FEZ A;  4U0W A;  2M2E A;  4B43 A;  5J1Y A;  2OCC H;  2DOA A;  1OCC H;  2XF5 A;  3BJA A;  5LRS A;  1R6R A;  1IN8 A;  3I9V 2;  3LQQ A;  1LNW A;  4FQG A;  1XCB A;  5E3O A;  1YOV B;  3I58 A;  1KQ8 A;  3TO6 A;  3IL2 A;  5H20 A;  3VYU B;  3CO7 C;  4X1E A;  2LC2 A;  2E1N A;  4N9I A;  2RKH A;  1NG7 A;  3PSI A;  3HEF A;  2BVL A;  2X6X A;  2WY7 Q;  3FXO A;  3K9T A;  5LEJ A;  1OCZ H;  3GYH X;  1A04 A;  2BXY A;  5AIP A;  5DUK A;  2MD0 A;  3F8N A;  2H8W A;  2XRL A;  5K7F A;  4YFK F;  5C4J J;  2O8K A;  2VXZ A;  4WK8 F;  3OOU A;  5IOZ A;  3K2Z A;  1K83 J;  4ENK A;  2P6S A;  2A68 F;  1YRN A;  2D1V A;  3ONQ A;  5GP9 A;  2KKO A;  3RQI A;  2PMZ A;  3LWF A;  4PFP A;  3PNY A;  1OCT C;  4V19 K;  4J19 A;  1POG A;  3J7Z I;  1BC8 C;  1V54 H;  4ENJ A;  1BW5 A;  4IHV A;  2CUF A;  4DZP A;  1G59 A;  4OMY A;  2CQQ A;  2KLO A;  3GLL A;  1O7L A;  5FFX A;  4KIT B;  4A3B J;  3EET A;  1DPU A;  2X1D A;  1ENH A;  2HS5 A;  2FMY A;  4ZYH A;  3RCO A;  2OZU A;  1Y39 A;  1G3W A;  3OMY A;  2VBX A;  4ANJ A;  2HQR A;  3I4P A;  2MFZ A;  3UR3 C;  5D6F A;  1FP2 A;  2ELH A;  2QQ8 A;  2WB1 N;  3WTV C;  2YUS A;  2GA2 A;  4EM2 A;  3CUQ A;  5L3G A;  3KEO A;  2CUZ A;  2FSW A;  1ZRD A;  2VUM J;  1ITY A;  2R7D A;  3ERM A;  1SC7 A;  1KQ9 A;  3F8B A;  1J5Y A;  3CLQ A;  4PGG A;  2MSY A;  1YS6 A;  1PUE E;  3Q0W A;  1JUS A;  1XG1 A;  5JLW A;  1W0T A;  1X1D A;  5J8F A;  1IN7 A;  3F6V A;  4ZYG A;  2OUM A;  3FMR A;  2M45 A;  4ASN A;  5IT3 A;  2XPU A;  4ZDO A;  3OYF A;  2DFH A;  1TQI A;  2LKP A;  1XDS A;  2X48 A;  4N4N B;  2D1H A;  4B3A A;  3PQK A;  1I5Z A;  2PMH A;  3CD6 I;  3DBL B;  3ZP5 A;  1F1Z A;  4HX8 A;  4HAM A;  2JA6 J;  2V4J C;  1LE8 A;  1R5H A;  2FBH A;  2JA2 A;  2CSO A;  4G8X A;  1MMA A;  2VJI A;  5DCM A;  4KIF A;  1J75 A;  1SD4 A;  3ERE D;  4LOC A;  2WAE A;  3ZQI A;  1HCR A;  2LY9 A;  5F04 A;  4CCK A;  3E7L A;  3OYC A;  3A03 A;  1SD6 A;  1MKM A;  3QOP A;  4OU0 A;  3D5S C;  2CU7 A;  1FWZ A;  3KZZ A;  4IPA A;  4E6K G;  2RNJ A;  3KZI C;  1Z05 A;  1XD7 A;  4F7Z A;  2KRC A;  4A3L J;  2N8G A;  4X0G A;  2HOS A;  2HVS A;  3V7S A;  1IRX A;  3KYL A;  2VT3 A;  4MEY F;  2ACJ A;  1CF7 B;  3Q5F A;  2DBB A;  3FF5 A;  4HX7 A;  3SDB A;  2Q2E A;  3IRR A;  1FY7 A;  2JRM A;  3P9C A;  1S3J A;  4LB5 A;  4KIS A;  1YE9 A;  4AVZ A;  1B9M A;  3FMS A;  3QPH A;  2V1X A;  4NUB A;  3BCA A;  5F0H A;  1YFH A;  3K2A A;  4Z2Y A;  3FM5 A;  5LGU A;  3X2Q H;  2HQA A;  1QZY A;  2CW8 A;  2OTL I;  2Z16 A;  4L5I A;  3MKZ A;  4A69 C;  2DMP A;  2DA5 A;  2MYS A;  3PQJ A;  5J4Y A;  1WPK A;  3G6E I;  1F4K A;  3E5U A;  4UHT A;  4FCY A;  1ORK A;  1IDZ A;  5D5W B;  1MNE A;  3J81 Z;  3F3X A;  4RM3 A;  2ZJR F;  4BS9 A;  3K10 A;  2ETH A;  5D5V B;  2RNG A;  1IAW A;  4ZZL A;  3EUA A;  3BZC A;  2OCE A;  2VJ4 A;  3F72 A;  4II2 A;  2KHM A;  3E6M A;  3QYE A;  4ZDP A;  4BEH A;  4LMY A;  1XGN A;  5HOO A;  1VQ6 I;  4BDY A;  2VOP A;  2NYX A;  2QM3 A;  2K4B A;  1KU7 A;  1DGR M;  1ZAO A;  2W7N A;  3BZK A;  2EFP A;  4XR6 A;  3IAM 2;  1YI2 I;  2CO5 A;  3AFH A;  5AIQ A;  2NS8 A;  2IW5 A;  4JX4 A;  3GZN B;  2UWM A;  1V5E A;  3Q3S A;  2V6C A;  4A3C J;  1S9H A;  3GW2 A;  1ZG5 A;  2WB1 A;  2Z99 A;  3FKJ A;  2XAG A;  2Y31 A;  4KNY A;  2LF7 A;  2VBY A;  2VJJ A;  5A2Q K;  3CJT B;  1R4N B;  3FKI J;  2VPL A;  1R1T A;  1O7F A;  3WG7 H;  1ZQ3 P;  2VI6 A;  2ADU A;  2ELJ A;  4I6Z A;  1MH4 A;  2K9M A;  2FNP A;  3NRV A;  1U5T A;  3L09 A;  5TIS C;  3RTR A;  2HI3 A;  3SEQ A;  1FOK A;  3HRM A;  3WTW C;  1MIJ A;  2BW3 B;  4ETS A;  2STT A;  3JAM Z;  1IDY A;  1TC3 C;  1T2K A;  1ZLK A;  2UZK A;  1TWA J;  3LNQ A;  2B63 J;  3DU6 A;  1HDD C;  2M4K A;  4ESB A;  4E7L A;  1K78 A;  1B8I A;  2NOJ B;  2YX7 A;  5C44 J;  5FO5 A;  1IV8 A;  1QZE A;  2Z9O A;  1T0F A;  3CCR I;  2QBY B;  3WGI A;  3O2P E;  4Y4R A;  2QSG X;  1KZH A;  4CYC B;  3DEW A;  2FJ1 A;  2ZME A;  4HQM A;  3OYH A;  3MFK A;  1XN7 A;  2PN6 A;  5FKN A;  1IW7 F;  3NQO A;  3OYD A;  1W4M A;  1WQ2 A;  3H9G A;  2CV0 A;  2ZXH A;  4Y15 A;  2FQ3 A;  3TP3 A;  3JSO A;  4I09 A;  4IHT A;  2JT1 A;  1RZ4 A;  4M3F A;  4O3M A;  4PFO A;  3A2K A;  2H94 A;  2NVT J;  2K9S A;  4ZYE A;  3FK7 A;  1W5S A;  2V26 A;  2MBF A;  4JBA A;  1QVU A;  3TMO A;  5LGN A;  3FXM A;  3LAP A;  1BJZ A;  1BN5 A;  2LRE A;  4I01 A;  1YS7 A;  2MW8 A;  1PP7 U;  2KT0 A;  4OIO F;  1KA8 A;  4HV5 A;  1Y8R B;  3RZD J;  1Z7L A;  2KIM A;  3B73 A;  1VQO I;  2KMU A;  3Q9V A;  5J40 A;  2EA2 A;  2EZK A;  4EGZ A;  5FD6 A;  1IF1 A;  3GVA A;  4LD5 A;  4E7K A;  2QWW A;  2TRT A;  1IXR C;  2JJ7 A;  1IRF A;  4Q47 A;  1I39 A;  4UVA A;  5HLT A;  4ENN A;  4KIG A;  3SHF A;  1V5F A;  4I2O A;  1XGS A;  4RGS A;  4E7H A;  1VQ4 I;  1R36 A;  4YRV A;  1ACI A;  2FBI A;  1MMG A;  1TWF J;  4R1H A;  3L2V A;  3LOC A;  2V9V A;  2Q2E B;  3L2C A;  3HGY A;  5FRM A;  2HOE A;  4PSW A;  2DA3 A;  2GZW A;  3S1N J;  2PJR A;  3KP6 A;  4XID A;  1FYL A;  2R7U A;  1ZN2 A;  2TCT A;  4KYW A;  5ICG A;  5D5X B;  3QPS A;  4LIV A;  4B48 A;  3R60 A;  1UEL B;  4YEL A;  2FE3 A;  5CQG A;  2YSR A;  1VF9 A;  2EFO A;  4A3E J;  3HRT A;  4KA4 A;  3CF2 A;  1PP8 F;  4L9T A;  2IS1 A;  2ZCW A;  2BEO A;  1TTY A;  3CTA A;  4YFX F;  1QA6 A;  4RBO A;  4M6V A;  3VEP A;  2KIF A;  3DWL E;  3JRF A;  1H9G A;  1XDU A;  1S7E A;  3CCM I;  4JX6 A;  4BEH B;  3CJR B;  1YX3 A;  2XPV A;  3I64 A;  1IN6 A;  4UXN A;  1ERD A;  3P9K A;  1FMV A;  5CVR A;  4ESJ A;  1B72 B;  1RR7 A;  2MAB A;  3K70 C;  4ON0 A;  4MIM A;  2AHQ A;  3HOT A;  1FOW A;  2F6C A;  4A5N A;  3GX4 X;  1VQ8 I;  1VI0 A;  4E7I A;  2WY8 Q;  1K4S A;  1ETX A;  4AWX B;  4E7J A;  2RGV A;  2O61 A;  2E71 A;  2WAD A;  3P5J A;  1X3W B;  3CZ6 A;  1RR8 C;  3K4L A;  1K6O A;  4D9J A;  2M87 A;  5HS8 A;  1I3Q J;  1YIO A;  1U5T B;  2GXG A;  1WFX A;  2M0C A;  1R22 A;  3FX3 A;  2VXD A;  3OS1 A;  4NC6 A;  1I27 A;  4ZC3 A;  1WJB A;  3WU2 C;  3LA2 A;  1BI3 A;  1U9O A;  4GYI A;  5E3L A;  3J80 K;  5JR3 A;  3BZ6 A;  1B8I B;  3I5U A;  1P7J A;  2LY1 A;  4LG0 A;  4HDV A;  2R7O A;  1NTC A;  3ASO H;  3FZV A;  4F3Q A;  2DDA A;  5JHF A;  1FTT A;  4YIF A;  3W6K B;  4P1W A;  2QQ9 A;  2IS2 A;  2ZXW H;  1P92 A;  3ZN0 A;  3I59 B;  5ILS A;  2ZME B;  1MSE C;  3L00 A;  1FYK A;  4RGU A;  4DYR A;  3HOS A;  2G7H A;  1E3P A;  2LOO A;  4HOB A;  3VSK A;  4AVP A;  2XRN A;  1LFB A;  1TNS A;  4BJ5 C;  1MBH A;  4CSW A;  2LKS A;  3CUO A;  3CMA I;  4R79 A;  4I98 B;  1J0R A;  2XAH A;  4ZH4 F;  4C3I J;  3JRA A;  4JX5 A;  2XKO A;  3QP5 A;  1B4A A;  2F2E A;  3OIP A;  3WTZ A;  1Q1H A;  3OS0 A;  1Z9C A;  4IRI A;  4AU7 A;  4B09 A;  4JK1 X;  2DXI A;  1FZP B;  3IC7 A;  3JTH A;  2AXT C;  4CXF A;  2OQG A;  3GME A;  1UHW A;  2ISY A;  1LKX A;  2HQ5 A;  2X9D A;  4BHB A;  2ZKZ A;  2P5K A;  1FOX A;  1MW7 A;  2L7Z A;  2OF7 A;  1TWC J;  2F48 A;  2R7F A;  2X6O A;  4LB6 B;  2LG4 A;  3ABL H;  2IGM A;  2FOK A;  5JI6 A;  4MTD A;  4M6X A;  2LDU A;  2TDX A;  4NB5 A;  4G6T B;  1WJA A;  2EB7 A;  3F22 A;  2XAU A;  1HF0 A;  4C3H J;  4CHU A;  2GQQ A;  3GTM J;  2IJL A;  2JUC A;  3W6V A;  2IA1 A;  1EH8 A;  4G7Z F;  4GGG A;  5TJJ A;  3OSG A;  3GTJ J;  2PJR B;  5K5R A;  2IP2 A;  2A6T A;  2XPW A;  1I6H J;  1WZ2 A;  2XSJ C;  3ZMD A;  1RRJ A;  4KIC A;  1AHD P;  2A07 F;  2K5C A;  3SXY A;  1C0W A;  2NRA C;  1QGP A;  3OYK A;  1AU7 A;  4L5E A;  1XSX A;  4M73 A;  4HX4 A;  2P8T A;  3TOB A;  2DJI A;  2VKV A;  3LMM A;  3J7A Y;  1X1A A;  2EWN A;  2P81 A;  2W48 A;  2VT2 A;  1YHQ I;  2HKX A;  1G4D A;  1MBK A;  1RUN A;  2R7W A;  1R4M B;  1SMT A;  1I50 J;  5M5Y J;  3ZQQ A;  2F5F A;  3BG3 A;  1WSU A;  4D7M A;  5GAE J;  2L01 A;  2KZG A;  1GLN A;  3G1M A;  5M3F J;  1NHA A;  3HPH A;  2KIQ A;  4EV0 A;  2LLK A;  2IAI A;  1MJ9 A;  1R1V A;  3OYJ A;  3M1E A;  3T8T A;  3ZR8 X;  4HNT A;  1LVA A;  2JUG A;  1N77 A;  4M74 A;  4IKF A;  3GCM A;  3GTO J;  1R71 A;  2BE5 F;  3Q0U A;  2E2J J;  2CG4 A;  3DEE A;  1VQM I;  3GTP J;  3M8F A;  4I0A A;  4FAS D;  4A93 J;  3ECH A;  2NNN A;  2D2W A;  3OYN A;  2MH2 A;  2PMU A;  5EJC A;  2HVR A;  1YLF A;  4PK4 A;  1H0M A;  5LEK A;  4RDU A;  2VKE A;  4M72 A;  1E17 A;  5IY5 H;  2HYJ A;  1F43 A;  3FXQ A;  4A2U A;  1Q1V A;  1ETY A;  1VQN I;  2CMP A;  3EYY A;  3LAJ A;  2KJC A;  2JSP A;  1OFC X;  5CLS A;  2DT6 A;  1NK2 P;  4A0X A;  2HQN A;  3WTU C;  2P7V B;  4J01 A;  4BHP A;  2WBM A;  1ZG1 A;  3SZG A;  3BG6 A;  3BJ6 A;  2FF4 A;  3E5X A;  3H5N A;  1J7K A;  4L0Z B;  3KYC B;  4LG0 B;  2P4W A;  3JR9 A;  4XLN F;  3I53 A;  3SDG A;  4XSZ F;  1ZRF A;  4ZYA A;  2A5W A;  2CS3 A;  5DDG A;  3DCF A;  5F0C A;  1SAN A;  2EBI A;  4LK1 F;  4A3K J;  1R00 A;  3CMY A;  2XIG A;  4PJ0 C;  4N0B A;  5E8G A;  3H9Q A;  5F64 A;  4KN4 X;  3HHG A;  5FRO A;  1IJW C;  2G7U A;  5HOD A;  2JA5 J;  1MBF A;  4AC0 A;  2L7K A;  3HYI A;  2XHK A;  3WTT C;  1QZZ A;  3TP0 A;  4MO7 A;  4EJO A;  1E0E A;  4CIC A;  6PAX A;  1OPC A;  1R1U A;  1U0J A;  3DTI A;  3K4J A;  4C30 A;  1WGX A;  3GFL A;  3OYA A;  3KE2 A;  3LSJ A;  1S7A A;  4B3X A;  1D1C A;  2QCO A;  4HNU A;  2RRE A;  1WCM J;  3MQ0 A;  2CQX A;  1HKS A;  3K1N A;  3NWT A;  2Y69 H;  1HSJ A;  3BR2 A;  3OS2 A;  4P9U A;  3MVP A;  2CYY A;  5EYR A;  4IL6 C;  4C3J J;  3ZQ7 A;  3GZ6 A;  3K0L A;  2CWE A;  1OCO H;  1B6A A;  1XTA A;  3BP8 A;  2L3D A;  1SD5 A;  3WGH A;  1BC7 C;  3S1R J;  4BH9 A;  3ECO A;  4Y52 J;  3U1D A;  4RGX A;  3BWG A;  3H3V K;  3AG3 H;  3B6A A;  4B44 A;  3H9J A;  5HDN A;  1BL0 A;  3CDH A;  2Y75 A;  4KT6 A;  3F6O A;  2IS4 A;  1P4A A;  3TO7 A;  4E4H A;  4NBQ A;  3AAF A;  1J2X A;  4M3E A;  4BJ6 C;  1YTY A;  1HDP A;  2EK5 A;  5BQT A;  2DW4 A;  5B1B H;  3S2W A;  3U2R A;  3UNG C;  4FIS A;  2P5L C;  5CVV A;  3T8R A;  2QZ8 A;  1Y0U A;  4BDZ A;  3K4K A;  4HZF A;  3ZQC A;  1XGM A;  3REO A;  4MHG A;  4IQJ A;  3V7C A;  3WE2 A;  2K86 A;  5C4X J;  1X2N A;  2A5Y B;  1VND A;  1FOY A;  2QQB A;  2B9S A;  1YIT I;  2FXA A;  5JHU A;  5DUI A;  1VQP I;  1FMW A;  4G6D A;  1SFO J;  3BPV A;  2W84 A;  3BJO A;  3C18 A;  1W7P A;  1PUF B;  2O7O A;  1P4X A;  5CJ9 A;  3VB2 A;  2P5V A;  2LKX A;  5H6Q A;  4XMY A;  1F36 A;  5K5O A;  1D0Y A;  1Y1V J;  3AG1 H;  1X1P A;  4A0Y A;  4KDP A;  4I76 A;  4BQO A;  2LNB A;  2DT7 B;  2MA3 A;  1MND A;  2HKO A;  4A3J J;  2ID6 A;  2NS7 A;  3OWT A;  4PJJ A;  3HOX J;  2QYO A;  4EJW A;  5LHG A;  1YO5 C;  4W97 A;  3QP6 A;  5IP9 J;  5BMZ A;  1ZG3 A;  2RAE A;  3F8C A;  5L3F A;  2F4I A;  1Y8Q B;  2YS9 A;  1JHF A;  3OOP A;  3G1L A;  1IXC A;  3VOD A;  4FTH A;  1ZRE A;  2PI0 A;  4XSX F;  1HW1 A;  4FX4 A;  4XN3 A;  1XSV A;  4CYD A;  5FKL A;  2Y0S N;  3A1Y A;  4G6Q A;  4XON A;  2X6Y A;  3H35 A;  2F5E A;  2WWY A;  1SVO A;  3PUB A;  1K61 A;  4FX0 A;  5EZH A;  2CQ7 A;  3HC7 A;  1ZAR A;  4EM0 B;  3KIO A;  4AID A;  5B5E C;  4RB2 C;  1VZ0 A;  1BBY A;  2DTZ A;  4NC7 A;  1BR1 A;  5ICF A;  5HNF A;  2D45 A;  2JQ7 A;  4CZZ A;  1OYY A;  3KPH A;  3BT9 A;  1MBE A;  5E3N A;  2E2H J;  4HF0 A;  2LMD A;  3J81 K;  1XS9 A;  2BVM A;  2BY3 A;  3H3Z A;  1HKQ A;  2L2O A;  1IC8 A;  1S6L A;  2MC4 A;  4NQW A;  2EZH A;  2A3S A;  2F5D A;  3JSP A;  1KGS A;  1DU0 A;  4UUV A;  3JRB A;  1Y1W J;  3S16 J;  2JWT A;  2L7F P;  2MGQ A;  5E8I A;  1QVT A;  3I4M J;  2O9L A;  2Z33 A;  1JGS A;  3S2D J;  1WHU A;  3DF8 A;  3H36 A;  2XGX A;  5JLX A;  2IPQ X;  3HG9 A;  3PSF A;  2VQC A;  4XM3 A;  5CPR B;  4XLC A;  1FIP A;  3ESW B;  4A6E A;  2V1D A;  2VJ5 A;  4I7H A;  2LFB A;  3CCL I;  3JRC A;  2ECB A;  5F1J A;  2DQR A;  2M8G X;  2X1C A;  1Z0X A;  5H6R A;  1GV2 A;  2QKL B;  3MN2 A;  3GFM A;  3ZQL A;  2JVH A;  3I3L A;  4RM2 A;  5F08 A;  1ZR4 A;  1P6R A;  3HSR A;  2LVS A;  3KP2 A;  1U78 A;  5E17 F;  1OYW A;  4XKC A;  2M0M A;  2OJE D;  1S7O A;  3SEZ A;  1BR2 A;  5L3B A;  3JAM K;  5IT9 Z;  4U87 A;  3BR5 A;  4DQ2 A;  4LIT A;  1T56 A;  5GAH J;  1LDD A;  2Y0M A;  1ETW A;  2HEO A;  3RKY A;  2EV6 A;  5IP6 A;  3L2Q A;  3S14 J;  1U6G A;  1TT5 B;  2BHZ A;  5BPD A;  5E20 A;  1HXD A;  1T98 A;  2V6E A;  1XMK A;  4RAZ A;  1SMY F;  4BY7 J;  2ZB9 A;  4KMF A;  1IN4 A;  2M5W A;  4BJT A;  3DKX A;  4BY1 J;  3OR2 C;  1QNT A;  2G9W A;  5JFR A;  2H8R A;  3DTK A;  4NDL A;  1D8K A;  3M07 A;  1Z6T A;  1ULY A;  5GTI C;  3L2U A;  3PO3 J;  3SZP A;  3FMQ A;  1LEB A;  3LA7 A;  4QPO A;  3OY9 A;  1QHG A;  5HLI A;  2ELK A;  1GHC A;  1ETQ A;  4PJM A;  2RV8 A;  3BR6 A;  4M3D A;  1TL8 A;  3ZPL A;  1TT0 A;  2E34 A;  1RNL A;  3QAH A;  3MZH A;  1SFK A;  4WX9 A;  1RPW A;  1T8I A;  3RPU D;  1W7P B;  2DA6 A;  3LSK A;  2MG4 A;  2IBD A;  5CQE A;  1HKT A;  3RKX A;  1QO0 D;  1SFX A;  3ZMV A;  1MMN A;  2OBP A;  1IN5 A;  1EKE A;  2E7W A;  1KYW A;  3OR1 C;  1YRN B;  4AYB N;  3RJP A;  1EA3 A;  3VFZ A;  5K5Q A;  2JMW A;  3W2W A;  1EH6 A;  2BY2 A;  4LK0 F;  3K70 D;  5FB2 A;  2EJR A;  3HM5 A;  5CYV A;  3HL2 A;  2CFO A;  1GDT A;  2W24 A;  3CC4 I;  2NS0 A;  1G6N A;  3F9K A;  3HKZ N;  3V4G A;  2XRO A;  1XMX A;  5BS6 A;  4B4C A;  5BPI A;  3DTE A;  2FML A;  3WU1 B;  2HXI A;  4A3D J;  4BQN A;  2DJN A;  4XOT A;  1MBG A;  3LSG A;  2E2I J;  3DEU A;  3KFW X;  1RET A;  3HIF A;  1TZL A;  2XDV A;  3CUQ B;  2LP0 A;  1D3Y A;  3K69 A;  4IZZ A;  1K7A A;  2JA8 J;  5F6F A;  1R9T J;  5F1R A;  3I71 A;  3DPU A;  3ZMZ A;  3H5R A;  2CFX A;  4XQF A;  5FLX Z;  3GTQ J;  3N97 A;  1KON A;  4Q4Z F;  2EFW A;  1TBX A;  1GXP A;  4D5C A;  1R49 A;  2X1E A;  4NQW B;  4WF2 A;  3U9G A;  1JE8 A;  2XGE A;  3G1O A;  3OL4 A;  3CUQ C;  3LA3 A;  4F92 B;  4EQQ A;  2PFB A;  2EIK H;  2X4H A;  2FNA A;  2OA4 A;  5FFZ A;  2RQQ A;  3O6B B;  3N05 A;  2P0W A;  4HW0 A;  5J47 A;  2R7X A;  1ONV A;  3OYL A;  4G7H F;  4RB3 C;  3RI4 A;  1L0O C;  5CVU A;  2UXX A;  4ESF A;  4C2T A;  4XLP F;  1LE8 B;  2BY0 A;  2XAS A;  1AWC A;  4UB6 C;  1ZYR F;  4EEF G;  1A6I A;  5DCM B;  4XRM A;  4S0H B;  5EG0 A;  4OWR B;  3L1P A;  1B1B A;  1ON2 A;  2NAZ A;  3R6S A;  4EJU A;  5TRD A;  3JTG A;  2DPU A;  3LSR A;  1G2H A;  2G0E A;  2EZL A;  1JI8 A;  2R7T A;  3WE3 A;  4D7N A;  1VFC A;  1JJ6 C;  3E1S A;  3EDP A;  2E35 A;  3PFI A;  1FBQ A;  2VE9 A;  3PJR A;  3CMM A;  3M3Y J;  3KZY A;  2XF6 A;  2BZT A;  3GZ5 A;  3ASN H;  1ZGA A;  3BTC A;  3VYR B;  2VKH A;  3TL4 X;  2DMQ A;  3PFY A;  1EV7 A;  1UG2 A;  2XGD A;  3IAS 2;  2K4J A;  3BY6 A;  3T0Y A;  2WV1 A;  3E5Q A;  4BE1 A;  5LD2 C;  4D1Q A;  2M7B A;  2DT5 A;  3M1C A;  3BTL A;  2GXA A;  3H1C A;  4LIU A;  2ZJP F;  3V7R A;  2OD5 A;  4BBR J;  4IXA A;  3GO5 A;  3PL8 A;  3HSF A;  2XAF A;  3V42 A;  1XMA A;  1LEA A;  2UV1 A;  1WJF A;  2DA2 A;  3CC7 I;  3S3O A;  3F8F A;  5KCM A;  2XB5 A;  1ETK A;  1UST A;  3DQV C;  1H88 C;  3FIS A;  1LB2 A;  3V8L A;  1MJB A;  3HKZ A;  4GRI A;  2RDP A;  2LYC A;  1U8B A;  1K4T A;  2VQH A;  2EZI A;  2L4M A;  1TNT A;  3ZMU A;  4HRI A;  2H1K A;  4BBS J;  4XLA A;  2V1N A;  2MC3 A;  4ITV A;  1TQP A;  3GTG J;  3U1K A;  3ZMT A;  3D1N I;  1ZEL A;  1ZK8 A;  1YJW I;  1Z1D A;  4KFC A;  1DGW Y;  4RGR A;  1GT0 C;  4DNC A;  2LBF A;  2K9N A;  2A6E F;  3A0B C;  3KLO A;  1IZ1 A;  1Y56 A;  2L54 A;  3C2G A;  2ME6 A;  5JVG F;  1GV5 A;  2IEK A;  3HHH A;  4GO1 A;  5D5U B;  5KAI C;  3GTL J;  4P55 A;  1WKM A;  1TWH J;  3T1B A;  3HUG A;  3QRF F;  5IYB J;  2LRD A;  3CDL A;  3OV8 A;  1WRJ A;  1YQA A;  2DK5 A;  1YW7 A;  2DYS H;  2O8X A;  1J59 A;  2GA1 A;  5EEA A;  3GFI A;  2EIM H;  1OYI A;  2PLY A;  4LLN A;  3L2R A;  3LST A;  3LSP A;  5B66 C;  1IG7 A;  3J7A O;  3KEY A;  4BE2 A;  4KN7 X;  2HPI A;  4OAZ A;  3O8G A;  1TW3 A;  3OYM A;  1K78 B;  1D0Z A;  4OOI A;  3D5L A;  1BW6 A;  1U5T C;  3A0H C;  1UZC A;  4LJZ F;  3KP7 A;  5IP7 J;  3UKG A;  1N75 A;  4GCV A;  4A3I J;  2DMU A;  1P2F A;  4KT5 C;  4M9Z A;  1LQ1 A;  5F27 A;  3BPX A;  4GFB A;  3I55 I;  1N25 A;  4O6J A;  1R5I D;  3HRU A;  1Z21 A;  3TGN A;  3T5X A;  5AON A;  3G3Z A;  2K02 A;  2DOF A;  1MGT A;  1BOA A;  2AO9 A;  2Z3Y A;  2OQR A;  2VBZ A;  5FJ8 J;  4FET A;  1T0F C;  3U21 A;  4OIN F;  2CUE A;  1ODD A;  3M8J A;  5GAD J;  1FSE A;  4II3 A;  2QVO A;  4OIR F;  1FBS A;  4HG2 A;  2VN2 A;  2ZME C;  3ZOB A;  3FHZ A;  1JUM A;  4BUP A;  4BHC A;  1IXS B;  1AOY A;  3QOE A;  3W2V A;  1T08 B;  1LDJ A;  4EGY A;  1KYZ A;  1UFM A;  1JTX A;  1ZRC A;  3CJQ B;  1FBU A;  1R23 A;  1QPI A;  5F0F A;  5EG0 B;  4UVC A;  2XSD C;  1X19 A;  4IRG A;  3M8E A;  1G3T A;  3VYS B;  4CCJ A;  4UUS A;  1JJ8 C;  2JZY A;  1Y6I A;  2CGP A;  2K3P A;  3QOD A;  1QPM A;  2QEX I;  2COB A;  1R58 A;  1GVD A;  2F4O B;  2I10 A;  2AQF A;  5FGM A;  3K1M A;  2OTJ I;  4F52 A;  2DA1 A;  4NC8 A;  4MQV A;  1HC8 A;  4V2G A;  1HQC A;  1IRG A;  1OCP A;  3HPG A;  4Y7N J;  2CH0 A;  3MKY B;  1DP3 A;  3EUH A;  5J1R A;  3TW6 A;  2IA2 A;  2L4A A;  1J09 A;  1KU9 A;  1FC3 A;  4ABZ A;  2VC0 A;  1D5Y A;  3FXK A;  2DTR A;  3O3K A;  4XKB A;  2Q1Z B;  5GPA A;  1JKO C;  3F21 A;  2DAO A;  4XLF A;  2H6C A;  4Y33 A;  1IUY A;  3H0G J;  1FLI A;  1ON1 A;  2GLO A;  1OQY A;  3DBR B;  4A3G J;  3S15 J;  2EA4 A;  2GWR A;  2E19 A;  2IRF G;  4YG2 F;  1XC5 A;  2EFQ A;  4TV7 A;  1RIO H;  1JUP A;  3KEQ A;  1B9N A;  1A5J A;  5K7H A;  4WXC A;  1W36 C;  4LFU A;  3W6J B;  2EH3 A;  3C2B A;  3KP5 A;  1CQT A;  3TO9 A;  5GAG J;  2H6B A;  2LR8 A;  3SYT A;  3HOY J;  2JRT A;  2E1C A;  1SFU A;  2DCE A;  1A6Q A;  3K4C A;  1O3T A;  2VC1 A;  3WHC A;  4S04 A;  3HOZ J;  2HOA A;  3L2W A;  5M5W J;  1UCR A;  3G4S I;  3C2H A;  3HRS A;  4CDG A;  2VQG A;  1FT9 A;  2KIS A;  2J5O A;  1YW9 A;  2KDZ A;  3EUK L;  2W00 A;  3PIP F;  5L3D A;  1XCV A;  2FA5 A;  2OPT A;  3H5A A;  3MEX A;  1JXS A;  1OIS A;  2HYG D;  2LBF B;  3LL7 A;  5D4S A;  2DU9 A;  3BR3 A;  3DP7 A;  3D5R C;  3EPZ A;  1S8N A;  3FBI B;  5E1X A;  2NVQ J;  2H09 A;  3OYI A;  2W57 A;  2JA7 J;  4PJL A;  3DFG A;  2HFH A;  3S1Q J;  3HUG B;  2V1U A;  4QWQ A;  4C9Y A;  3K4B A;  2ME0 A;  2LY2 A;  3DKY A;  2HPM A;  2HDC A;  1YX5 A;  3GWZ A;  3NAR A;  4BL0 B;  2NVY J;  3CCY A;  1MMS A;  4H0E A;  4FT8 A;  2IGO A;  4Q48 A;  3SZT A;  3V8J A;  1X3Z B;  3ZXS A;  2ZNY A;  4UV8 A;  3E6C C;  1WI9 A;  3S93 A;  2R5Y A;  4I0B A;  3HGG A;  2MD5 A;  2KQR A;  1G3Y A;  3COA C;  3E6B A;  3HOW J;  4BU2 A;  3OIO A;  2BHY A;  5FD5 A;  3RYR A;  5IOY A;  5ED4 A;  1IUF A;  2GXB A;  3WG9 A;  5BOX A;  3ZQH A;  3ZCO A;  1WJ5 A;  3I0T A;  1RUO A;  3IWF A;  4KMU X;  2EIJ H;  2O0Y A;  2PMZ N;  2IT0 A;  3R0J A;  4NHJ A;  1JT0 A;  1FPQ A;  1DU6 A;  3FXL A;  5D4R A;  1G3S A;  2LSO A;  1NK3 P;  4MEX F;  5DM7 F;  5HS7 A;  3K7A J;  5HLG A;  1RC9 A;  2BOL A;  3HBL A;  1OCR H;  4EM1 A;  3DPL C;  1XX5 A;  3VDX A;  1X2M A;  4DBQ A;  4WWC A;  3CCE I;  3VWB A;  3NEU A;  1I1S A;  1I6X A;  2VOD A;  2HXO A;  3FXR A;  2CW0 F;  4HA8 A;  3ZN1 A;  2CQN A;  1HLV A;  3CCV I;  2O03 A;  2KFD A;  5CVJ A;  3DKW A;  4UUS B;  1WJD A;  1MMD A;  1T6S A;  2WAQ N;  3TW7 A;  1VTN C;  1L3L A;  1STZ A;  3GF2 A;  3IUO A;  2HDD A;  1OR7 A;  1H8A C;  2XAJ A;  4L18 B;  1LVK A;  5HVQ C;  3LFU A;  3R61 A;  1U2W A;  3EYI A;  2DN0 A;  2ZJ2 A;  1O3Q A;  4A12 A;  4GXO A;  4XBF A;  2DFI A;  2ZBK A;  2CUJ A;  1DDN A;  5IYD J;  3B02 A;  3MKL A;  2X6W A;  4EMS A;  4E70 A;  3Q0V A;  2L02 A;  3V8K A;  2STW A;  2V7F A;  3SFI A;  1TW2 A;  4ZJZ A;  2PJP A;  1S72 I;  4IO9 F;  3BOQ A;  2YX4 A;  4CA0 A;  3C1D A;  4AM3 A;  5LRR A;  2CQK A;  1UMQ A;  3SQN A;  3CDI A;  2M9H A;  3P9I A;  4RS8 A;  5M5X J;  3CO6 C;  1VQ7 I;  1D1B A;  2CRG A;  1Z7U A;  2MLG A;  1FSH A;  2A05 A;  1BI1 A;  2FRH A;  4HF1 A;  1O57 A;  2ESH A;  2R7S A;  3A4C A;  1Y0N A;  3S17 J;  2YU9 J;  4PJN A;  4N9H A;  2ESN A;  1YIJ I;  3HB9 A;  1DQU A;  4Z6Y A;  3GUD A;  5DEQ A;  3RDI A;  5J8C A;  3MWM A;  2ZXJ A;  2HDW A;  3BCB A;  4HYE A;  2XB0 X;  2I8D A;  4W1U A;  1MBJ A;  4V2F A;  5ICC A;  1VQK I;  2ZO4 A;  2HOT A;  3TBI A;  4HF2 A;  1MJA A;  3K1P A;  3ABT A;  1LFP A;  4GYG A;  4B1R A;  4JYK A;  3JRE A;  1PDN C;  1X58 A;  4HDU A;  3M7G A;  2KP6 A;  1E3H A;  3BLY A;  5IT9 K;  3KP4 A;  1OMI A;  5J3L A;  1W7P D;  2R7R A;  1HST A;  3A01 A;  2CJJ A;  2QKM B;  2QSF X;  4MLO A;  1QQI A;  2OAZ A;  1HBX G;  2VON A;  2NVU B;  3VOE A;  2UXN A;  1UHM A;  2E36 A;  4KIB A;  4XL9 A;  4HBL A;  2M30 A;  2YU3 A;  4G12 A;  2F5V A;  4PSX A;  2L9V A;  2O5R A;  4BKX A;  2QA4 I;  4F91 B;  1IRZ A;  3FK6 A;  2KPM A;  2W82 A;  5D8L B;  2GBY A;  2BW3 A;  4P9F A;  1T38 A;  1GUU A;  2QGU A;  4N4O B;  1TWG J;  2PEX A;  2XGC A;  5ERI A;  3WOD F;  2R5Y B;  3CME I;  2IS6 A;  4U7B A;  2ID3 A;  3RKW A;  1MH3 A;  4OAY A;  1IV6 A;  4FE4 A;  4PDK A;  1QBJ A;  2Y2Z A;  1Z91 A;  1KU2 A;  1HW5 A;  2DA7 A;  4H4K C;  3VPR A;  3H92 A;  3S3N A;  2WC2 A;  2QBY A;  2PX9 A;  2WAQ A;  1X1C A;  2XAQ A;  2JVG A;  5LFA A;  4CYC A;  1FYM A;  2LTP A;  4PCQ A;  4CGZ A;  1LDK B;  4RLF A;  3IRQ A;  5DV5 A;  3FWE A;  1NG6 A;  2R93 J;  1GVJ A;  3QU6 A;  1LPQ A;  3TDU C;  2W85 A;  1APL C;  3ZGK A;  2M34 A;  2JN6 A;  3PNV A;  1KQ0 A;  2FQ4 A;  4XNF A;  4MTE A;  1HOM A;  3VYT B;  2M8E A;  3H3U A;  2HTJ A;  2BYV E;  4QLC U;  2VQL A;  1DPR A;  3OIQ A;  4YFN F;  2HYF A;  2R3S A;  5J6X A;  2NVX J;  5DTD A;  1K6Y A;  3IH3 A;  3IKV A;  1X4P A;  5LLQ A;  3HTU A;  2M1B A;  3SFZ A;  2ZFU A;  3F23 A;  1FEX A;  5DYM A;  2H1L A;  1O3S A;  1UHS A;  5H2F C;  1CGP A;  2B0L A;  2P7C B;  3TDZ C;  2W4S A;  5EZG A;  2VKD A;  2R7V A;  5E79 C;  3RZO J;  3LSI A;  2ZSH B;  1X4O A;  2IGN A;  1M1E B;  2Z5U A;  1TQM A;  1SVM A;  1YYV A;  3FBN B;  4RLQ A;  1X3U A;  2QEN A;  1OJL A;  2XUB A;  5FLX K;  1OR7 C;  3OSF A;  1H89 C;  4HLY A;  2W1O A;  5FKM A;  4BAC A;  3TKY A;  2M3A A;  1EH7 A;  1OKR A;  3QWL A;  1O3R A;  3CC2 I;  2R4G A;  1E3O C;  3RPU A;  4L9N A;  5BNG A;  5KAF C;  4HV6 A;  3G71 I;  4XLH A;  2KDO A;  2LF8 A;  2QLZ A;  3C7J A;  3RPQ A;  4AIH A;  4G94 A;  3S32 A;  3ABK H;  2JTV A;  1FX7 A;  4EJT A;  3WU0 A;  2Y0S A;  3L9F A;  2R92 J;  2C6Y A;  4FHT A;  4RMN A;  3RIR A;  1HA8 A;  2E1O A;  4WXD A;  1JTY A;  5CVI A;  1JT6 A;  3K4N A;  4Y3O A;  3ZRG A;  2X51 A;  1PJR A;  4ENM A;  1FIA A;  5HDK A;  1ZGW A;  2RVC A;  2JK3 A;  4DJA A;  1YG2 A;  1ZTR A;  2HR3 A;  2GOM A;  2AS5 F;  4BE0 A;  4X6A J;  4IOC F;  1FNN A;  1XB4 A;  2AQE A;  1UB9 A;  2IA0 A;  1PYV A;  4G9Y A;  1AA7 A;  1B72 A;  4IHS A;  4BXX J;  2PQ8 A;  2GIZ A;  4HST A;  4XOP A;  5KHD A;  5HLH A;  2R5Z A;  1P7I A;  1B59 A;  3BTJ A;  5HNH A;  2BBY A;  5JVT A;  2V79 A;  3HDD A;  1GXQ A;  3A01 B;  2VPR A;  3BR1 A;  4LG3 A;  2L0K A;  4CZC A;  3JRG A;  2M7A A;  4RA2 A;  3RYP A;  2KL4 A;  2HGC A;  2COM A;  4NNJ A;  4ZDL A;  2P6T A;  3MKW B;  2HNH A;  2KZV A;  3ELK A;  2CV1 A;  1A35 A;  3P7N A;  1OLT A;  2Y9Z A;  1SD7 A;  2K9Q A;  4UV9 A;  1ZHF A;  5LHI A;  3F0C A;  3RKQ A;  2FD5 A;  4MQ9 F;  5DS9 A;  1A31 A;  2EIN H;  3W3C A;  2ICW G;  2E7X A;  3FDY A;  5EEG A;  4E7Z A;  4Y17 A;  5EGO A;  1WH5 A;  4DYC A;  4UUT A;  4WCG A;  1JKR C;  2EQR A;  3HOV J;  2JPB A;  4CUG A;  4D5F A;  4MGR A;  4DGW B;  2VIX A;  3FM3 A;  3FHN A;  3QYF A;  3QPL A;  3GFJ A;  4B47 A;  1J9I A;  4KUM A;  3CCU I;  5KNL A;  4LGW A;  3I59 A;  4RAY A;  4A3F J;  3O8H A;  3CP8 A;  4YIR X;  3MAJ A;  3K4M A;  1O4X A;  4L9J A;  2CW7 A;  1T33 A;  3GEZ A;  3QU3 A;  3S1M J;  4XIC A;  1I3A A;  2HU9 A;  2VL8 A;  1RI7 A;  4HPQ A;  3S8P A;  3RQ4 A;  4RB0 A;  5FKO A;  2X85 A;  4L5J A;  2ECC A;  1W0U A;  2WTE A;  4QSH A;  2DI3 A;  3CCQ I;  2M4G A;  1MDM A;  4RB1 A;  4HEA 2;  4J00 A;  2XF7 A;  5LHH A;  5C3E J;  4OIP F;  3MCZ A;  3A02 A;  3OL3 A;  1HW2 A;  2L7M P;  4P5O A;  2K3F A;  2BV6 A;  3FIW A;  4YII A;  1ZH5 A;  4KJZ A;  2A69 F;  3C3W A;  3LSM A;  3BG9 A;  2DO7 A;  4Y13 A;  2PG4 A;  3CCJ I;  2NNY A;  3JCU C;  1BM9 A;  3B6C A;  5B3S H;  3J7Y J;  3HSE A;  3HJE A;  3MZY A;  1FP1 D;  1I1G A;  2EIL H;  5DD8 A;  1WWX A;  1REP C;  1JHH A;  3QQA A;  4A6D A;  2Y48 A;  4G7O F;  2DDB A;  1VQ5 I;  1WH7 A;  1WVR A;  2E1M B;  2Z1D A;  3JW4 A;  2FX0 A;  5A2Q Z;  4O5V A;  4OMZ A;  4UVB A;  4IHY A;  3GLX A;  5ICE A;  1BJA A;  1JKQ C;  2FUG 2;  1RKT A;  4M6Y A;  4IHX A;  1F9N A;  1E2X A;  2ZJQ F;  4UY8 I;  4LLG F;  3W2A A;  5L3E A;  4PZJ A;  4AYB A;  3ULQ B;  4CCN A;  2E1M C;  2VBW A;  3AL0 B;  1VQ9 I;  1SFE A;  4IHW A;  3GXO A;  5K1Y A;  3ABM H;  4IX7 A;  4OIQ F;  3QPT A;  3BQZ A;  1Z67 A;  5M3M J;  4AD9 A;  3HOU J;  2A61 A;  1MNM C;  1W5T A;  2YPR A;  4AIJ A;  1W36 D;  3AL0 C;  2MLK A;  4CO8 A;  2QF7 A;  2DQL A;  1VQL I;  4M9X A;  4DZJ A;  1AKH A;  1X1B A;  4BYY A;  3FXJ A;  5DM6 F;  3N4M A;  4MNU A;  2DMT A; 
#chains in the Genus database with same CATH homology
 3G73 A;  5E1W A;  2BGC A;  2IVM A;  4ZZD A;  2ISZ A;  4U7D A;  2A6H F;  2OZ6 A;  3R0A A;  2HZT A;  2O6G E;  3EQL F;  4L0Y B;  4D0P A;  3R4K A;  1DUX C;  2HWV A;  2RQP A;  2GAU A;  2W25 A;  2HTS A;  4U0V A;  4R8H A;  3KET A;  4AIK A;  3BDD A;  4U88 A;  4ZYD A;  1S29 A;  5D6E A;  5L3C A;  1LJ9 A;  4IVN A;  1MD0 A;  1XSD A;  2DPD A;  3DPT A;  2ZFW A;  3LQR A;  4LLL A;  3KLN A;  3TQN A;  1BI2 A;  2J5P A;  2KRF A;  2GIV A;  2PBI A;  4IJA A;  1R7J A;  5KVR A;  5D8K B;  1XGO A;  1BIA A;  4WXH A;  5HDG A;  3IKT A;  5EEH A;  5ILV A;  3DXJ F;  3E6D A;  4IRH A;  1T39 A;  3WGG A;  1V3F A;  2ZNZ A;  2KIU A;  1MDM B;  4I02 A;  4IF4 A;  2O3F A;  2KJB A;  4EJV A;  4BQA A;  3I54 A;  2MH9 A;  5ILU A;  1K79 A;  3CLO A;  2Q0O A;  1TLH B;  4L9V A;  2DLL A;  3ZMS A;  3WTY C;  3F8M A;  4A0Z A;  4U0Y A;  3E97 A;  4UNO A;  5HS9 A;  2XVC A;  2K27 A;  4XRF A;  3HTS B;  5E1Z B;  2JSC A;  2AXL A;  4BXU A;  3LFK A;  4K2E A;  2FU4 A;  3FXU A;  3J80 Z;  2DK8 A;  1USS A;  2JPC A;  2FBK A;  1ZLJ A;  4A5M A;  3TOA A;  4Q5S F;  2YR2 A;  4HQE A;  1H9T A;  5LBQ A;  1BIB A;  3L7W A;  3IHU A;  3WTS C;  3IWZ A;  2F5C A;  2EFN A;  3ROU A;  3E3V A;  3BRO A;  3KCC A;  3ML6 A;  4B8X A;  2VE8 A;  4BNC A;  1U8R A;  2H27 A;  4BAY A;  2QUF A;  4JQF A;  1R5G A;  5DD4 A;  4EVI A;  3ABU A;  5LGT A;  5KK1 A;  3Q9S A;  2EV0 A;  3WTX C;  3D0S A;  1D8J A;  1SAX A;  1MZB A;  2X0L A;  2WV0 A;  1P4W A;  3KP3 A;  5DCF A;  1D5V A;  1V4R A;  2OU2 A;  4M71 A;  1DP7 P;  3ISP A;  4P96 A;  1ZGJ A;  3DV8 A;  2XKP A;  2Q8K A;  2K7L A;  1BI0 A;  3M9A A;  1F5T A;  1CF7 A;  2RC4 A;  4HLX A;  4S05 A;  4M9S A;  3CJN A;  1U3E M;  2RN7 A;  2XV4 S;  2VOO A;  5E18 F;  2EV5 A;  1Z6R A;  1YW8 A;  4PGH A;  1KU3 A;  2QQA A;  2FEZ A;  4U0W A;  5LRS A;  3BJA A;  1IN8 A;  3LQQ A;  1LNW A;  1XCB A;  3I58 A;  1KQ8 A;  3TO6 A;  3IL2 A;  5H20 A;  3CO7 C;  2E1N A;  4N9I A;  2RKH A;  5LEJ A;  3K9T A;  3GYH X;  1A04 A;  5AIP A;  5DUK A;  3F8N A;  4YFK F;  2VXZ A;  4WK8 F;  3K2Z A;  4ENK A;  2P6S A;  2A68 F;  2D1V A;  2KKO A;  3LWF A;  1BC8 C;  4ENJ A;  4OMY A;  5FFX A;  1O7L A;  1DPU A;  3EET A;  2HS5 A;  2FMY A;  4ZYH A;  2OZU A;  1G3W A;  2VBX A;  2HQR A;  3I4P A;  5D6F A;  1FP2 A;  2ELH A;  3WTV C;  2GA2 A;  4EM2 A;  3CUQ A;  5L3G A;  3KEO A;  2FSW A;  1ZRD A;  2R7D A;  1KQ9 A;  3F8B A;  1J5Y A;  4PGG A;  1YS6 A;  1PUE E;  5J8F A;  1IN7 A;  3F6V A;  4ZYG A;  3FMR A;  2M45 A;  4ASN A;  5IT3 A;  1TQI A;  2LKP A;  1XDS A;  2D1H A;  3PQK A;  1I5Z A;  2PMH A;  3ZP5 A;  1F1Z A;  4HX8 A;  4HAM A;  1R5H A;  2FBH A;  2CSO A;  4G8X A;  5DCM A;  4KIF A;  1J75 A;  1SD4 A;  3ERE D;  1SD6 A;  1MKM A;  3QOP A;  4OU0 A;  1FWZ A;  3KZZ A;  4IPA A;  2RNJ A;  1Z05 A;  1XD7 A;  4F7Z A;  3V7S A;  2VT3 A;  4MEY F;  2ACJ A;  1CF7 B;  3Q5F A;  2DBB A;  3FF5 A;  4HX7 A;  2Q2E A;  3IRR A;  1FY7 A;  3P9C A;  1S3J A;  4LB5 A;  1B9M A;  3FMS A;  3QPH A;  2V1X A;  1YFH A;  4Z2Y A;  3FM5 A;  5LGU A;  1QZY A;  4L5I A;  3PQJ A;  1F4K A;  3E5U A;  4UHT A;  5D5W B;  3J81 Z;  3F3X A;  2ETH A;  5D5V B;  1IAW A;  4ZZL A;  3F72 A;  3E6M A;  4LMY A;  1XGN A;  5HOO A;  2VOP A;  2NYX A;  2QM3 A;  2K4B A;  1KU7 A;  1ZAO A;  2EFP A;  2CO5 A;  5AIQ A;  2IW5 A;  2UWM A;  2V6C A;  3GW2 A;  1ZG5 A;  2Z99 A;  2XAG A;  4KNY A;  2LF7 A;  2VBY A;  5A2Q K;  1R1T A;  1O7F A;  2ADU A;  2FNP A;  3NRV A;  1U5T A;  3L09 A;  3RTR A;  1FOK A;  3HRM A;  3WTW C;  4ETS A;  2STT A;  3JAM Z;  1T2K A;  1ZLK A;  2UZK A;  4ESB A;  1K78 A;  2YX7 A;  5FO5 A;  2Z9O A;  1T0F A;  2QBY B;  3WGI A;  3O2P E;  2ZME A;  4HQM A;  3MFK A;  1XN7 A;  2PN6 A;  1IW7 F;  3NQO A;  1W4M A;  1WQ2 A;  4Y15 A;  2FQ3 A;  3JSO A;  4I09 A;  4IHT A;  2JT1 A;  1RZ4 A;  4O3M A;  2H94 A;  4ZYE A;  1W5S A;  4JBA A;  2MBF A;  5LGN A;  3LAP A;  1BN5 A;  4I01 A;  1YS7 A;  1PP7 U;  4OIO F;  1KA8 A;  4HV5 A;  2KIM A;  3B73 A;  3Q9V A;  2EA2 A;  4EGZ A;  5FD6 A;  1IF1 A;  3GVA A;  4LD5 A;  2QWW A;  1IXR C;  1IRF A;  4Q47 A;  4UVA A;  4ENN A;  4KIG A;  3SHF A;  4I2O A;  1XGS A;  4RGS A;  1R36 A;  2FBI A;  4R1H A;  2V9V A;  3L2C A;  2HOE A;  2GZW A;  3KP6 A;  1FYL A;  1ZN2 A;  4KYW A;  5ICG A;  5D5X B;  3R60 A;  2FE3 A;  2YSR A;  2EFO A;  3HRT A;  4KA4 A;  1PP8 F;  4L9T A;  2ZCW A;  2BEO A;  1TTY A;  3CTA A;  4YFX F;  3VEP A;  2KIF A;  1H9G A;  1XDU A;  3I64 A;  1IN6 A;  4UXN A;  3P9K A;  5CVR A;  4ESJ A;  4ON0 A;  3HOT A;  4A5N A;  3GX4 X;  4AWX B;  2RGV A;  2O61 A;  1K6O A;  2M87 A;  5HS8 A;  1YIO A;  1U5T B;  2GXG A;  1R22 A;  3FX3 A;  1I27 A;  3LA2 A;  1BI3 A;  4GYI A;  3J80 K;  5JR3 A;  3BZ6 A;  3I5U A;  4LG0 A;  4HDV A;  3FZV A;  4YIF A;  3W6K B;  2QQ9 A;  1P92 A;  3ZN0 A;  3I59 B;  5ILS A;  2ZME B;  3L00 A;  1FYK A;  4RGU A;  3HOS A;  2G7H A;  4HOB A;  4AVP A;  2XRN A;  1TNS A;  3CUO A;  4R79 A;  4I98 B;  1J0R A;  2XAH A;  4ZH4 F;  2XKO A;  3QP5 A;  1B4A A;  2F2E A;  3WTZ A;  4IRI A;  1Q1H A;  1Z9C A;  4B09 A;  4JK1 X;  1FZP B;  3IC7 A;  3JTH A;  4CXF A;  2OQG A;  1UHW A;  2ISY A;  4BHB A;  2ZKZ A;  2P5K A;  4LB6 B;  2R7F A;  2FOK A;  5JI6 A;  4MTD A;  4M6X A;  2LDU A;  2TDX A;  4NB5 A;  3F22 A;  2EB7 A;  4CHU A;  2GQQ A;  2IJL A;  2IA1 A;  1EH8 A;  4G7Z F;  4GGG A;  5TJJ A;  5K5R A;  2IP2 A;  3ZMD A;  4KIC A;  2A07 F;  3SXY A;  1C0W A;  2NRA C;  1QGP A;  1XSX A;  4M73 A;  4HX4 A;  2P8T A;  3TOB A;  2EWN A;  2VT2 A;  1G4D A;  2HKX A;  1RUN A;  1SMT A;  2F5F A;  1WSU A;  2L01 A;  1NHA A;  4EV0 A;  1MJ9 A;  1R1V A;  3M1E A;  3T8T A;  1LVA A;  4M74 A;  2BE5 F;  2CG4 A;  3M8F A;  4I0A A;  3ECH A;  2NNN A;  2D2W A;  2MH2 A;  2PMU A;  1YLF A;  1H0M A;  5LEK A;  4M72 A;  1E17 A;  3FXQ A;  4A2U A;  3LAJ A;  3EYY A;  2KJC A;  5CLS A;  4A0X A;  2HQN A;  3WTU C;  2P7V B;  4BHP A;  1ZG1 A;  3BJ6 A;  2FF4 A;  3E5X A;  1J7K A;  4L0Z B;  4LG0 B;  2P4W A;  4XLN F;  3I53 A;  4XSZ F;  1ZRF A;  5DDG A;  4LK1 F;  1R00 A;  2XIG A;  4N0B A;  5E8G A;  5F64 A;  4KN4 X;  3HHG A;  2G7U A;  3HYI A;  2XHK A;  3WTT C;  1QZZ A;  4EJO A;  4CIC A;  6PAX A;  1OPC A;  1R1U A;  3GFL A;  3KE2 A;  1S7A A;  3MQ0 A;  1HKS A;  3K1N A;  1HSJ A;  4P9U A;  2CYY A;  3GZ6 A;  3ZQ7 A;  3K0L A;  2CWE A;  1B6A A;  3BP8 A;  2L3D A;  1SD5 A;  3WGH A;  1BC7 C;  4BH9 A;  3ECO A;  3U1D A;  4RGX A;  3BWG A;  5HDN A;  3CDH A;  2Y75 A;  3F6O A;  1P4A A;  3TO7 A;  3AAF A;  1J2X A;  1YTY A;  5BQT A;  2EK5 A;  2DW4 A;  3S2W A;  3U2R A;  2P5L C;  5CVV A;  3T8R A;  2QZ8 A;  1Y0U A;  4HZF A;  1XGM A;  3REO A;  4MHG A;  3V7C A;  3WE2 A;  2K86 A;  2A5Y B;  2QQB A;  2FXA A;  5JHU A;  5DUI A;  4G6D A;  3BPV A;  2W84 A;  3BJO A;  3C18 A;  1W7P A;  1P4X A;  5CJ9 A;  3VB2 A;  2P5V A;  5H6Q A;  5K5O A;  4A0Y A;  4KDP A;  2LNB A;  2MA3 A;  2HKO A;  2QYO A;  4EJW A;  5LHG A;  1YO5 C;  3QP6 A;  5BMZ A;  1ZG3 A;  3F8C A;  5L3F A;  3OOP A;  1JHF A;  1IXC A;  3VOD A;  1ZRE A;  2PI0 A;  4XSX F;  1HW1 A;  4FX4 A;  1XSV A;  4CYD A;  4G6Q A;  2F5E A;  2WWY A;  4FX0 A;  1ZAR A;  4EM0 B;  4RB2 C;  1BBY A;  5ICF A;  2D45 A;  4CZZ A;  1OYY A;  4HF0 A;  3J81 K;  3H3Z A;  1HKQ A;  1S6L A;  4NQW A;  2A3S A;  2F5D A;  3JSP A;  1KGS A;  4UUV A;  5E8I A;  2Z33 A;  1JGS A;  3DF8 A;  2XGX A;  2IPQ X;  4A6E A;  2V1D A;  4I7H A;  2DQR A;  5H6R A;  3GFM A;  1P6R A;  3HSR A;  3KP2 A;  1U78 A;  5E17 F;  1OYW A;  1S7O A;  5L3B A;  3JAM K;  5IT9 Z;  4DQ2 A;  1LDD A;  2Y0M A;  2HEO A;  3RKY A;  2EV6 A;  1U6G A;  5BPD A;  5E20 A;  1HXD A;  1T98 A;  1XMK A;  4RAZ A;  1SMY F;  4KMF A;  1IN4 A;  2M5W A;  1QNT A;  2G9W A;  5JFR A;  1D8K A;  1Z6T A;  1ULY A;  3SZP A;  3FMQ A;  1LEB A;  3LA7 A;  5HLI A;  1GHC A;  2RV8 A;  3ZPL A;  1RNL A;  3QAH A;  3MZH A;  4WX9 A;  1W7P B;  1HKT A;  3RKX A;  1QO0 D;  1SFX A;  3ZMV A;  2OBP A;  1IN5 A;  2E7W A;  1KYW A;  3RJP A;  3VFZ A;  5K5Q A;  1EH6 A;  4LK0 F;  5FB2 A;  2EJR A;  5CYV A;  2W24 A;  2NS0 A;  1G6N A;  3V4G A;  2XRO A;  5BS6 A;  5BPI A;  2FML A;  3WU1 B;  3DEU A;  3KFW X;  3HIF A;  3CUQ B;  1D3Y A;  3K69 A;  1K7A A;  5F6F A;  5F1R A;  3I71 A;  3ZMZ A;  5FLX Z;  2CFX A;  3N97 A;  4Q4Z F;  2EFW A;  1TBX A;  1GXP A;  1JE8 A;  3U9G A;  4WF2 A;  3CUQ C;  3LA3 A;  4EQQ A;  2PFB A;  2X4H A;  2FNA A;  2OA4 A;  5FFZ A;  3O6B B;  4HW0 A;  1ONV A;  4G7H F;  3RI4 A;  4RB3 C;  1L0O C;  5CVU A;  2UXX A;  4ESF A;  4XLP F;  2XAS A;  1AWC A;  1ZYR F;  5DCM B;  1B1B A;  1ON2 A;  2NAZ A;  3R6S A;  4EJU A;  5TRD A;  3JTG A;  2DPU A;  3WE3 A;  3EDP A;  3PFI A;  1FBQ A;  2VE9 A;  3KZY A;  3GZ5 A;  1ZGA A;  1EV7 A;  2K4J A;  3BY6 A;  3T0Y A;  3E5Q A;  2DT5 A;  3V7R A;  2OD5 A;  4IXA A;  3GO5 A;  3HSF A;  2XAF A;  1XMA A;  1LEA A;  3F8F A;  1UST A;  3DQV C;  1LB2 A;  3V8L A;  1MJB A;  2RDP A;  2L4M A;  1TNT A;  3ZMU A;  2MC3 A;  1TQP A;  3ZMT A;  1Z1D A;  4KFC A;  4RGR A;  4DNC A;  2A6E F;  3KLO A;  1IZ1 A;  2L54 A;  3HHH A;  4GO1 A;  5D5U B;  4P55 A;  1WKM A;  3T1B A;  3HUG A;  3QRF F;  3OV8 A;  1WRJ A;  1YQA A;  2DK5 A;  1YW7 A;  2O8X A;  1J59 A;  2GA1 A;  3GFI A;  1OYI A;  2PLY A;  4LLN A;  3LST A;  3J7A O;  4KN7 X;  1TW3 A;  1K78 B;  4OOI A;  3D5L A;  1U5T C;  4LJZ F;  3KP7 A;  4GCV A;  4KT5 C;  1P2F A;  4M9Z A;  1LQ1 A;  3BPX A;  4O6J A;  3HRU A;  3TGN A;  3T5X A;  5AON A;  3G3Z A;  2K02 A;  1MGT A;  1BOA A;  2Z3Y A;  2OQR A;  2VBZ A;  4OIN F;  1ODD A;  1FSE A;  2QVO A;  4OIR F;  1FBS A;  2VN2 A;  3FHZ A;  4BHC A;  1IXS B;  1AOY A;  1LDJ A;  4EGY A;  1KYZ A;  1UFM A;  1ZRC A;  1FBU A;  1R23 A;  4UVC A;  4IRG A;  3M8E A;  1G3T A;  2JZY A;  2CGP A;  1QPM A;  1R58 A;  5FGM A;  3K1M A;  4MQV A;  1IRG A;  1HQC A;  3EUH A;  2IA2 A;  2L4A A;  1KU9 A;  1FC3 A;  2VC0 A;  2DTR A;  3O3K A;  3F21 A;  2DAO A;  2H6C A;  1IUY A;  1FLI A;  1ON1 A;  2EA4 A;  2GWR A;  2IRF G;  4YG2 F;  2EFQ A;  4TV7 A;  1RIO H;  3KEQ A;  1B9N A;  4WXC A;  4LFU A;  3W6J B;  3KP5 A;  3TO9 A;  2H6B A;  2JRT A;  2E1C A;  1SFU A;  1O3T A;  2VC1 A;  4S04 A;  1UCR A;  3HRS A;  4CDG A;  1FT9 A;  2J5O A;  1YW9 A;  5L3D A;  1XCV A;  2FA5 A;  3MEX A;  1JXS A;  2HYG D;  5D4S A;  2DU9 A;  3DP7 A;  1S8N A;  5E1X A;  2H09 A;  2W57 A;  3DFG A;  2HFH A;  2V1U A;  4QWQ A;  2HDC A;  3GWZ A;  4H0E A;  4FT8 A;  4Q48 A;  3SZT A;  3V8J A;  2ZNY A;  4UV8 A;  3E6C C;  1WI9 A;  4I0B A;  2MD5 A;  3COA C;  1G3Y A;  3E6B A;  5FD5 A;  3RYR A;  5ED4 A;  2GXB A;  3WG9 A;  5BOX A;  3I0T A;  1RUO A;  3IWF A;  4KMU X;  2O0Y A;  2IT0 A;  4NHJ A;  3R0J A;  1FPQ A;  5D4R A;  1G3S A;  2LSO A;  4MEX F;  5HS7 A;  5HLG A;  4EM1 A;  3DPL C;  4WWC A;  3NEU A;  1I1S A;  1I6X A;  2VOD A;  3FXR A;  2CW0 F;  4HA8 A;  3ZN1 A;  2O03 A;  5CVJ A;  3DKW A;  1T6S A;  1L3L A;  1VTN C;  1STZ A;  3GF2 A;  1OR7 A;  4L18 B;  2XAJ A;  5HVQ C;  3R61 A;  1U2W A;  3EYI A;  2ZJ2 A;  1O3Q A;  4A12 A;  4GXO A;  4XBF A;  2DFI A;  2ZBK A;  1DDN A;  3B02 A;  4EMS A;  4E70 A;  2L02 A;  3V8K A;  2STW A;  1TW2 A;  2PJP A;  3BOQ A;  2YX4 A;  3C1D A;  5LRR A;  2CQK A;  3SQN A;  3P9I A;  4RS8 A;  3CO6 C;  1Z7U A;  2MLG A;  1FSH A;  1BI1 A;  2FRH A;  4HF1 A;  1O57 A;  2ESH A;  4N9H A;  2ESN A;  3GUD A;  5DEQ A;  3RDI A;  5J8C A;  3MWM A;  2ZXJ A;  4HYE A;  5ICC A;  2ZO4 A;  4HF2 A;  1MJA A;  3K1P A;  3ABT A;  4GYG A;  1PDN C;  4HDU A;  3M7G A;  5IT9 K;  3KP4 A;  1OMI A;  1W7P D;  1HST A;  1HBX G;  1QQI A;  2OAZ A;  2VON A;  3VOE A;  2UXN A;  1UHM A;  4KIB A;  4HBL A;  2M30 A;  2YU3 A;  5D8L B;  4P9F A;  1T38 A;  2PEX A;  5ERI A;  3WOD F;  4U7B A;  3RKW A;  4PDK A;  1QBJ A;  1Z91 A;  1KU2 A;  1HW5 A;  3H92 A;  2QBY A;  2WC2 A;  2XAQ A;  1FYM A;  4PCQ A;  4CGZ A;  1LDK B;  3IRQ A;  5DV5 A;  3FWE A;  1GVJ A;  3QU6 A;  3TDU C;  2W85 A;  1KQ0 A;  4MTE A;  2M8E A;  3H3U A;  2HTJ A;  2BYV E;  4QLC U;  1DPR A;  4YFN F;  2HYF A;  2R3S A;  5J6X A;  3IKV A;  5LLQ A;  3HTU A;  2M1B A;  3SFZ A;  3F23 A;  5DYM A;  1O3S A;  1CGP A;  2B0L A;  2P7C B;  3TDZ C;  2Z5U A;  1TQM A;  1YYV A;  1X3U A;  2QEN A;  2XUB A;  5FLX K;  4HLY A;  3TKY A;  1EH7 A;  1OKR A;  1O3R A;  3RPU A;  4L9N A;  4HV6 A;  2QLZ A;  2LF8 A;  3C7J A;  3RPQ A;  4AIH A;  4G94 A;  2JTV A;  1FX7 A;  4EJT A;  3WU0 A;  3L9F A;  2C6Y A;  4FHT A;  3RIR A;  4WXD A;  5CVI A;  4ENM A;  5HDK A;  2RVC A;  1YG2 A;  2HR3 A;  2AS5 F;  1FNN A;  1XB4 A;  2IA0 A;  1UB9 A;  4G9Y A;  4IHS A;  2PQ8 A;  5HLH A;  1B59 A;  2BBY A;  5JVT A;  2V79 A;  1GXQ A;  3RYP A;  2HGC A;  2COM A;  2P6T A;  3ELK A;  3P7N A;  1SD7 A;  4UV9 A;  1ZHF A;  5LHI A;  4MQ9 F;  5EEG A;  2E7X A;  4Y17 A;  4WCG A;  2JPB A;  4MGR A;  3FM3 A;  3GFJ A;  1J9I A;  4KUM A;  4LGW A;  3I59 A;  4RAY A;  3MAJ A;  4L9J A;  3GEZ A;  3QU3 A;  1RI7 A;  4RB0 A;  4L5J A;  2WTE A;  2DI3 A;  1MDM A;  4RB1 A;  5LHH A;  4OIP F;  3MCZ A;  1HW2 A;  4P5O A;  2BV6 A;  4YII A;  1ZH5 A;  2A69 F;  3C3W A;  2DO7 A;  2NNY A;  4Y13 A;  2PG4 A;  1BM9 A;  3HSE A;  3MZY A;  1FP1 D;  1I1G A;  5DD8 A;  1REP C;  1WWX A;  1JHH A;  4A6D A;  2Y48 A;  4G7O F;  5A2Q Z;  3JW4 A;  4O5V A;  4OMZ A;  4UVB A;  3GLX A;  5ICE A;  1BJA A;  4M6Y A;  1F9N A;  1E2X A;  4LLG F;  5L3E A;  4PZJ A;  3ULQ B;  2VBW A;  1SFE A;  3GXO A;  5K1Y A;  4OIQ F;  3QPT A;  4AD9 A;  2A61 A;  1W5T A;  2YPR A;  4AIJ A;  2MLK A;  4CO8 A;  2DQL A;  4M9X A;  4BYY A;  3N4M A;  4MNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...