1YITI

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome/antibiotic
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yitI00
2E36A 2OTJI 1ACIA 1YJNI 5GAHJ 1VQKI 3CCVI 1YJWI 3CC7I 3CJTB 3CC2I 1VQMI 1VQOI 5GADJ 1YI2I 2ZJQF 3CCJI 1YITI 1S72I 1VQ9I 1YIJI 4UY8I 3CCSI 1VQ8I 5GAEJ 4V19K 2H8WA 4IOCF 3CCMI 2E34A 3CMAI 3CF5F 5JVGF 3CC4I 4IO9F 3I56I 1FOXA 3PIPF 3PIOF 2JQ7A 3CCEI 3G6EI 2OTLI 1VQ6I 5DM6F 1HC8A 3G4SI 1YHQI 1VQ5I 3CD6I 2E35A 1Y39A 1FOWA 2K3FA 1QA6A 2QEXI 3G71I 3CCUI 1VQPI 3I55I 2ZJRF 3CCLI 1VQ7I 5GAGJ 2ZJPF 3CCRI 3CCQI 2NXNB 1VQ4I 3J7YJ 2QA4I 3CMEI 3J7ZI 5DM7F 1VQLI 1MMSA 4IOAF 2FOWA 1VQNI 3DLLF 1FOYA 1YJ9I
chains in the Genus database with same CATH superfamily
3S1MJ 2DDAA 4HBLA 4OAYA 5D4RA 4B8XA 2CGPA 4NUBA 4HLYA 4RB3C 1X1DA 3R4KA 3GTGJ 1A31A 5TGTA 3HOZJ 1FC3A 3K2ZA 3K69A 4KN7X 4AM3A 1PJRA 1S9HA 4LIUA 2CFOA 3WE3A 1IRGA 5EEHA 5H20A 5GP9A 1YW9A 3F72A 3U1KA 4C3JJ 1LFBA 1WI3A 3ZQHA 3ZMUA 2EA2A 2IBDA 1MMSA 3LMMA 1LFPA 3OOPA 2RN7A 1M1EB 3Q0VA 3I3LA 2IS6A 5EG0B 4BUPA 4BHPA 1SFUA 1FIPA 4FT8A 1MDMB 2L4MA 5HLGA 3GFJA 2JA7J 2DYRH 3L7WA 3S2DJ 2JA5J 4KFCA 2R4GA 3EPZA 4MEXF 2NXNB 4HEA2 4OIOF 4AWXB 4KYWA 2JT1A 3CMEI 4XOPA 4R8HA 5IY5H 5IT9K 2CV2A 5GTIC 5J8CA 1GVJA 3J81K 4BJTA 2I5UA 2A6TA 2VIXA 2CQ7A 2L7MP 2L7FP 4HDVA 2PQ8A 1ZRFA 5FKLA 3V8JA 2LKSA 1Y1WJ 3F21A 1OCRH 3C18A 3LSPA 3ESWB 3ONQA 2M3AA 1GV5A 4CICA 2XSDC 1JKOC 3FZVA 3VFZA 2QQAA 3OMYA 2KHMA 3ZRGA 5JFRA 1ULYA 2WTEA 3OYFA 1VTNC 2EIKH 3H3ZA 2DA2A 4CCJA 4A3DJ 3HSRA 3SQNA 2L4AA 4DOZA 1IC8A 4CGZA 2P81A 2E5ZA 2CS3A 2EV5A 1KGSA 2DT7B 1FWZA 4F7ZA 2LTPA 2M7AA 3M7GA 3BR3A 4NC6A 3ZQIA 2KP6A 2EFQA 2H8WA 4RM3A 4XLCA 3OY9A 1ZRDA 2BBYA 4L18B 1XDSA 3IWFA 4QIWN 1VFCA 2H27A 4ASNA 3OYJA 2WB1A 1FBUA 3GWZA 3IKTA 4LG0B 1X3UA 3FXQA 4OIRF 2AS5F 4BEHA 3M8FA 5CVJA 1P2FA 1VF9A 1S29A 1J7KA 2Z2SB 2VXDA 4JQFA 5HS7A 3WG7H 2ECCA 1D3YA 5K7HA 2K4JA 2DTZA 2R7DA 2M30A 5KHDA 3ZMVA 3B73A 2NAZA 4EVIA 4G6DA 3JR9A 2X48A 5EYRA 5H6QA 1BOAA 2NYXA 1O7LA 2E2HJ 2L5QA 1TNSA 3QPHA 2HYFA 4RAFA 1UHMA 3PNTA 3QYEA 4RGXA 2XB5A 3DBLB 2PBIA 2LC2A 3Q3SA 2YSRA 5AONA 1ZARA 1IV6A 3PO3J 3OIQA 2L2OA 2EPFA 5L3FA 1VQNI 3O8HA 4G7HF 2O8KA 1F5TA 3B6CA 3KLNA 2JPCA 3LAJA 2XB0X 2I8DA 1X3WB 4KA4A 4HF1A 2LRDA 4I76A 1YW8A 4A12A 2XF5A 4U0VA 2CFXA 3HIFA 4DBRA 1BL0A 3FF5A 3NWTA 1R71A 2UV1A 4JYKA 1DGWY 4XORA 1UB9A 3I9V2 3REOA 3C2HA 3KYCB 3MQ0A 1WJBA 1X19A 4EM2A 4AVZA 4II2A 4XKCA 5LHGA 4IRIA 1E3OC 4Y4RA 3LSMA 3CESA 1Z1DA 1R6RA 3KPHA 4NC7A 2Q2EB 2JA2A 3A0HC 5J4YA 3GTOJ 3RZOJ 3JRHA 1GXPA 3K4CA 5E17F 4A5MA 1FT9A 4M71A 1ZELA 2XRNA 4AYBN 3AG3H 2EINH 3DEWA 3HYIA 3F8CA 2JWTA 3LFUA 5B1BH 4B4CA 3W3CA 4ESJA 3F6VA 4Y15A 2CU7A 4RA2A 1ON1A 2WV1A 2P5LC 4QLCU 5BMZA 2HXIA 1KU9A 1SFOJ 2LMDA 2R5YA 2QBYB 1Y0UA 1PUFA 2K40A 4DGWB 1IN7A 5FD6A 3L2CA 1T56A 2KDOA 4I09A 5FKOA 1PUFB 3H5NA 5F27A 5F1RA 2WA0A 2K27A 1XD7A 1F1ZA 4C2MJ 1V54H 2HYJA 2YPRA 2KIUA 4ZYAA 2VQHA 5F1JA 4UUSB 3BJOA 3ZN1A 1QU3A 1DU6A 3MAJA 2IGMA 2WB1N 2HYGD 1ON2A 5GPCA 4JBAA 4D5CA 3V4GA 3FK6A 4F3QA 3QQAA 2DT6A 5DM6F 5KNLA 3MMYB 4B43A 2JA6J 3S8PA 1R4NB 3VEPA 2ZNYA 4O5VA 4RM2A 2HU9A 4PDKA 1STZA 2DOAA 3J7ZI 4ANJA 1VQLI 1UZCA 1P9QC 1YOVB 3RPUA 1JJ6C 1SAUA 1BC8C 1IRXA 3S3MA 4RB0A 2DA4A 3RQ4A 1U6GA 1MKMA 4L0YB 4IEJA 2R7TA 5J1YA 2XAQA 3SDBA 4YEJA 3TP3A 3W6KB 3HUGB 3RZDJ 1FPQA 4BACA 5D8LB 2DPDA 3HOXJ 1J5YA 1EKEA 4FX0A 3N97A 4HF2A 2HZDA 2Q1ZB 3BPVA 2ZJRF 5CVIA 3IRRA 3CP8A 3E6CC 3KZIC 3OSGA 4FTHA 1X58A 1MBKA 4OOIA 4N9HA 2XASA 5K7FA 1R1TA 2OD5A 2OTJI 1T2KA 2XDVA 4OIPF 4C3IJ 5LGNA 2OAZA 4CCNA 3S15J 1UHWA 4EV0A 2GXBA 4X0GA 3E0JB 4XLHA 4JK1X 1L0OC 2TCTA 4IKFA 4XRMA 3D1NI 5F64A 1QRYA 5HDNA 1WPKA 4IHYA 2XGCA 1V5FA 5C44J 3DBHB 2JSCA 4LG3A 3WHCA 2PJPA 3H9GA 4BQOA 1RUNA 1B72A 3DEEA 5JR3A 2XAGA 2DN0A 1YI2I 3OYBA 1D1BA 4XK4A 5M5XJ 3G1LA 4B44A 1T39A 4I6ZA 3M1CA 4RGRA 2GLOA 4M6XA 1MJAA 1TT0A 4NNJA 3DP7A 5FRMA 2NS8A 1LEBA 1BR4A 4L0ZB 2V1XA 1JHFA 3BR5A 3JRBA 3FK7A 3DTKA 3CCLI 2Z99A 4XICA 1WRJA 1VQ4I 1DPRA 3LSHA 2E60A 2FOWA 2ELJA 2R7OA 2PMUA 2O61A 2E1OA 4HV6A 5GADJ 2DK8A 5TJJA 1ZLJA 4QTRA 3V7RA 4A3FJ 2JRTA 1OCTC 2KKOA 4GGGA 2DU9A 3OYLA 1T98A 1SFEA 3E1SA 4M3FA 3RKQA 3HKZA 1OKRA 2DTRA 2ID6A 2YUSA 2HKOA 4CYCA 2VBWA 5CVUA 4IHSA 1WZ2A 4PGHA 1WH7A 3ZQFA 5DM7F 2Z33A 1JHHA 5K5OA 3ZGKA 2BY1A 2DO7A 2X6OA 3OYGA 1D0ZA 3KETA 1ENHA 3ECOA 3K4KA 3JRCA 3COAC 1HKSA 4NQWB 4E7KA 2L0KA 4E7IA 1BC7C 2X85A 1REPC 3F8FA 3BCBA 2Q2EA 4LOCA 3JSPA 2G9WA 2G0EA 4WXCA 1MNMC 1UHSA 3FXLA 5LRSA 2JK3A 2E19A 1F43A 1F9NA 2F6CA 3BCAA 3FMSA 3EYIA 2LG4A 4XBFA 2V26A 2K9NA 5H6RA 2M7BA 2B0LA 3ASOH 4ESFA 2V9KA 3JRFA 1JXSA 4XIDA 4M9SA 4UVBA 2LVSA 5AIPA 4MQ9F 3NAUA 1MSFC 3TDUC 4B3AA 1ZYRF 1YRNB 1YITI 3QPTA 2L7ZA 2VQCA 3HEFA 2FU4A 4GFBA 2QSGX 2A6EF 4G8XA 2DA5A 1ZG3A 3OOUA 2E1CA 3R60A 1POGA 3O3KA 5FO5A 3RSNA 2LF7A 2WY7Q 3JREA 5L3CA 1K61A 4NB5A 4CZZA 2XF6A 1YX3A 2RNGA 1HF0A 4N0BA 2RAEA 1I3AA 3KLOA 4IRHA 1WQ2A 1SMTA 3NARA 5J6XA 3H5AA 3FX3A 1QO0D 1XN7A 3WTYC 1R5HA 2P4WA 3KP7A 4G9YA 5DCFA 1PP7U 2LP0A 3LA3A 4P96A 1E2XA 3LAPA 2JQ7A 1OYIA 2X1DA 2VJJA 4LJZF 2PJRA 1Q1HA 3DQVC 4AC0A 3LSTA 4IZZA 2YX4A 4HSRA 2R7ZJ 2FNAA 3PUBA 3R61A 4MFEA 1RETA 1FSEA 3ZMDA 2HPIA 1NK2P 2Y48A 3OR2C 5GAHJ 5HODA 3BQYA 3HRUA 2ADUA 2KL4A 1Z77A 4RAGA 3TKYA 4XQFA 3H35A 3Q0WA 1WJCA 2HQ5A 4IHXA 3S17J 2DBBA 1FIAA 2FF4A 1P4XA 2R7VA 2M1BA 2RVCA 2ZNZA 3E7LA 3QP6A 4XSXF 1KU2A 1XTAA 4XR6A 1NG7A 4EJOA 1QGPA 1ETVA 1RR8C 2ZFWA 1LJ9A 3BT9A 2IA1A 5HLHA 4AIJA 3LSIA 4YELA 3S2HJ 5F08A 1ZG1A 2HNHA 2MA3A 1TQMA 4RAYA 2W25A 5GPAA 5LFAA 5EEAA 2W57A 1R49A 1VI0A 2FBIA 4P55A 1YO5C 3ZP5A 1BW5A 3G3ZA 4W1UA 1JUPA 1IDYA 2CW7A 3P9IA 4N4OB 2OQGA 2IPQX 3UNGC 5GTHC 3SZPA 1P4WA 4ZYHA 4Y7NJ 2Y9ZA 3BP8A 4Y17A 3DEUA 1R36A 4KMUX 3JRDA 1FTTA 2O03A 4EJUA 2CH0A 4YFKF 3MZ8A 3BZCA 2ZFUA 4DJAA 2EILH 3I0TA 4H4KC 3RKYA 3GFIA 1AHDP 2DMNA 1X1BA 1H89C 1A6IA 3K4BA 3C2BA 3K4LA 4B47A 3DF8A 5EZGA 3H0DA 2EIMH 4ENKA 3H3UA 4HAMA 2DMQA 2VI6A 4Q5SF 1V5EA 1YG2A 4JX5A 1HSTA 2K4BA 1GLNA 1TZLA 2COBA 1DP3A 4BXUA 3H1CA 3MVPA 3M8JA 4Z2YA 3G71I 3Q0UA 2M9HA 2MH2A 1BBYA 3CCQI 1G3TA 1ZAOA 2L7KA 1ETWA 1MBEA 2H8RA 2CQXA 1S72I 3H36A 1FX7A 3TDZC 4EGZA 1SD6A 3J81Z 3FHZA 1GUUA 2EZKA 1W36C 5F0CA 3FHNA 2M87A 1T0FA 4P5OA 4CCMA 1KU7A 2UWMA 3CDLA 2Z1DA 2CMPA 1K78B 4Y33A 3IRQA 2IA0A 4FX4A 3K7AJ 3JAMK 2QEXI 1I27A 3W2AA 4M6VA 3HC7A 1FMVA 2ME0A 5A2QK 4A3MJ 2FXAA 3KZYA 1YIJI 4HQEA 4XLNF 1I3QJ 5EJCA 1ZN2A 2GOMA 2HQRA 1MH3A 2QSHX 2QM3A 3P5JA 4O6JA 5CPRB 3S1QJ 3ZQCA 1Z05A 3O8GA 3PSFA 1XDUA 1C0WA 5ILSA 2D1HA 2VONA 1LDDA 2YU3A 2QWWA 2R7FA 3E6MA 4M3DA 2UUZA 2LY9A 1FOWA 2L54A 2JTVA 1Y8RB 3IUOA 2W24A 3Q9VA 3KP6A 2FOKA 3W6VA 4V2GA 5IOZA 3CJRB 4A0ZA 3T1BA 4BE2A 2FRHA 1HW2A 5LD2C 3DXJF 1SD5A 4Y13A 2FSWA 1HKQA 1Q1VA 2K86A 2L9SA 3H9JA 1VQMI 5EDNA 5IT3A 2GXAA 2Y0MA 4JOMA 4AVPA 4M3GA 3I58A 3Q9SA 4I98B 1FNNA 3IWZA 3S3OA 5F04A 1QBJA 2NS7A 4PJ0C 1KZHA 2QF7A 4BXFA 1FSHA 2R7RA 2NVTJ 1TWHJ 1YHQI 4L5IA 5TRDA 3IH3A 3RPQA 3K70D 4DYQA 3JTGA 2JZYA 2RV8A 1W0TA 1XGNA 2A6HF 3QOPA 1XSVA 4II3A 1JKQC 1MBJA 4C3HJ 1IGNA 1X1CA 2M4GA 4EMSA 2NOJB 1BI2A 1ZKGA 5D5UB 5LEKA 2V4JC 3F3XA 4S04A 2V6CA 3EQLF 1SANA 3OS0A 2EQRA 2CG4A 2NVXJ 4XLAA 3PIPF 4X6AJ 3U2RA 4D0PA 5E8IA 3CP2A 4N4NB 4LLLA 1BIAA 2VC1A 2WC2A 1ZLKA 4L9VA 1FY7A 2UXXA 2XAJA 2QSFX 3JRAA 2JN6A 2DJNA 1J59A 4UVAA 3LFKA 2DCEA 3BTLA 1OYWA 1U0JA 1SC7A 1W0UA 2VE8A 2XAHA 1YJWI 4IVNA 5LEJA 3K10A 1DQUA 3ZR8X 5DS9A 2X1CA 5DCMA 4LB6B 1YYVA 1U5TB 3FDYA 4I01A 4ZDOA 2HDWA 2L01A 3KZZA 2K02A 2VBZA 2HDCA 2OBPA 1WJFA 2P8TA 1XMXA 1R22A 2FBKA 3DBRB 1TQPA 4MHGA 2EA4A 4BH9A 2BHZA 3FXUA 4A0XA 1NHAA 1O3QA 3MD2A 5B66C 3CC2I 2M0MA 2QYOA 4YFXF 1XG1A 1ZGAA 5ICFA 3DU6A 4FISA 3HPGA 3ELKA 2XV4S 4F93B 4KIFA 3KCCA 3FXKA 3VWBA 3ULQB 2VT3A 3KP4A 1J75A 5JHFA 3VSKA 3OYDA 3SXYA 2K3PA 4G12A 1D1CA 3WE2A 3K1MA 4JX6A 3ECHA 4YRVA 1O3RA 3PJRA 2IA2A 3J80Z 2KJBA 2GWRA 1IV8A 4RB2C 2PMZA 2LSOA 4ABZA 1HW1A 3BG9A 3TOBA 1G4DA 5K5RA 3OWTA 3FBNB 1W4MA 2RGVA 2H09A 4I0AA 4WXHA 3V8LA 1MJ9A 1D8JA 2M4KA 4OAZA 2DDBA 5LBQA 1D0YA 4MLOA 5J1UA 1XPXA 4M6YA 2R3SA 3OYNA 1FYKA 2XROA 4OIQF 1NK3P 5ILVA 1N77A 1QZZA 4GCVA 2NVYJ 2YR2A 3GTLJ 2R7WA 3JRIA 1F4KA 1CQTA 4EQQA 3ERMA 2HQAA 2MSYA 2M2EA 3B02A 2IW5A 2D5VA 3HZJA 3VODA 2XKPA 4BS9A 2KQRA 3BQZA 4LIVA 3R6SA 3I56I 1ZQ3P 2EH3A 1EH6A 1WJ5A 2VB6A 1RIOH 3ROUA 5EEGA 2CO5A 2XUBA 5FJ8J 3G4SI 4RLQA 2EK5A 1K7AA 4L5JA 5FFZA 3RPUD 1UELB 2ZMEC 3CQZJ 3I5UA 4A5NA 4L9TA 4BKXA 4RAZA 1EV7A 4G7OF 1QNTA 3V7CA 2WV0A 3ZMTA 3KIOA 4HX7A 1WI9A 3J7AY 2RQQA 3FXRA 4DIQA 2BXYA 4P1WA 4XN3A 1I39A 2IGKA 2VBYA 1Z7UA 2NNNA 1R58A 3CZ6A 3SDGA 3QPSA 4XRSG 4BY1J 2LLKA 1IUYA 1H9TA 1Y0NA 2E1MB 1QPMA 2G7UA 1ZG5A 2GBYA 1T38A 4UXNA 2QKLB 4PFPA 3K70C 1G3SA 3MZYA 4UB8C 5D6EA 3LSRA 3BJAA 4ZJZA 1TWAJ 2E36A 4XN0A 3LSKA 3V8KA 3FWEA 3K4NA 2X1EA 3CCVI 4CCLA 4DZJA 1HLVA 1JJ8C 1IG7A 1FBQA 2FBHA 2EBIA 3BG6A 3K1NA 2O9LA 2W85A 3VB2A 3CF5F 4JX4A 1AWCA 2XPWA 2VJ5A 1K4TA 4ENNA 2M8EA 4P9UA 2GAUA 2BY3A 2ZMEB 5LGUA 1LPQA 5DD4A 1YX5A 2GZWA 5B3SH 2CUZA 4YIFA 5E20A 3A01A 2EZHA 2AXTC 4IHVA 1J9IA 2LOOA 1HA8A 2KIQA 1USSA 4NHJA 1XC5A 2X0LA 2HOSA 2LYCA 3CUQB 5DUKA 2E2IJ 2ZKZA 1A5JA 5L3BA 4H0EA 4BEHB 3VDXA 5HLTA 1RPWA 4DYCA 1VQ8I 1B59A 1G6NA 5JVGF 2X9DA 1UCRA 2IS1A 4DBQA 1TWFJ 3HOWJ 1WGXA 2W00A 4GYIA 2E1MC 1D8KA 5KVRA 1VQ6I 4OINF 4QPQA 1E3HA 4A2UA 4BYYA 9ANTA 1J2XA 1XGOA 3DFGA 1N78A 1IZ1A 1X4PA 2HOEA 2X6WA 2R7XA 1IN6A 1LQ1A 2CJJA 4UNOA 2VJ4A 2F5DA 3HOUJ 1Z6RA 2XPVA 1ACIA 2XC7A 3ERED 3GTKJ 5EGOA 2K7LA 5L3GA 1DGRM 2A68F 2MABA 1RUOA 2OCCH 2V1DA 3N4MA 4PSWA 3G1OA 2H1LA 1OLTA 2MD0A 4ITVA 4M73A 5E3NA 1YQAA 3TW6A 4LK0F 3HUGA 1ZRCA 1AOYA 3ZMSA 4Z6YA 2OZ6A 3V7SA 2NRAC 3U1DA 4A6DA 3ML6A 1U5TA 3KYLA 4FCYA 2L9RA 2QQ9A 1WJEA 2MD5A 4AIDA 3VYRB 3FM5A 3CCJI 1UAAA 2E1NA 4RS8A 4ZDLA 2LREA 3CCSI 2Y0SN 4CDGA 3L1PA 1A36A 1DU0A 3SJMA 3A01B 1ZR4A 1H9GA 1J09A 1QZYA 4IRGA 4IHWA 3AKZA 2JJ7A 3OIPA 1S3JA 2CUFA 5JLXA 3CLQA 3L00A 3G2BA 4AUXA 3GZNB 4HNVA 5HDKA 3SEZA 2YX7A 5B5EC 5K1YA 5D5VB 1EJ9A 3H5RA 1FMWA 1K79A 4XKBA 2OV7A 4RGSA 3NQOA 1D0XA 2X51A 4GDFA 2EJRA 3ZQ7A 2W84A 2EFOA 4XRSA 1E17A 3WU1B 2VOOA 3GXOA 3GTMJ 2WBMA 3PIOF 3BDDA 4DQ2A 1MMGA 3EDPA 2DW4A 2X4HA 3BOQA 3ZPLA 1K6OA 2R93J 2HVQA 1BR1A 1K78A 4PJMA 2B9SA 1TBXA 3M1EA 2BY2A 2QLZA 4DNCA 5BOXA 3CJTB 2VL8A 1TLHB 1KYZA 1T95A 2RNJA 5CKTA 2DOFA 4IQJA 5H2FC 3PNYA 3EUHA 5FLVA 3E97A 2J5PA 5FFXA 3QYBA 4IF4A 3E5UA 4AD9A 1X1PA 1UG2A 4BHCA 2CYYA 2BHYA 1CGPA 4E7HA 3P9CA 1PDNC 4IQ4A 4MTDA 1HSJA 2JPBA 2FMYA 4UV9A 4J00A 5LHHA 1BJZA 4E70A 1JGSA 2E71A 1FYMA 4I02A 4A3JJ 3WHBA 1TWGJ 1YE9A 2HTJA 2FMLA 1YS7A 2D1VA 4A0YA 1SEUA 1EF4A 4CYDA 1JKRC 3JCUC 3BROA 1LNWA 4KITB 1IJWC 1XS9A 3L2WA 2RQPA 1G3WA 2E34A 3L2UA 2DT5A 3ZCOA 2LKXA 3H9QA 3CCEI 5E79C 4F52A 5LLQA 3KEOA 4B09A 1X1AA 2Q0OA 1XMKA 4Y52J 5ED4A 2P6SA 1OQYA 4EEFG 5M3FJ 5FLXK 4I0BA 5FD5A 1B9MA 1WHUA 2MC3A 4D1QA 5DD8A 1R1VA 1RR7A 3MN2A 3CC7I 4A3GJ 3PFYA 5E3OA 5HNHA 2AHQA 2HFHA 3GLXA 5J40A 3G73A 2VE9A 2ME6A 3K0LA 2HTSA 4KT5C 2EZIA 4N9IA 1H88C 4CZCA 2K5CA 2Z16A 4ZZLA 2JMWA 3L09A 2K9SA 3ABKH 2L9VA 2EZLA 2ZJ2A 2TDXA 3QODA 2BEOA 1LDKB 2XAFA 3PNVA 2KJCA 2A07F 1OISA 4BE0A 1BIBA 4GXOA 1KQ9A 3DKXA 2JUCA 3CCMI 1R4MB 2NOGA 1O4XA 2PFBA 2HDDA 1Z9CA 2NS0A 1SFXA 1ETOA 3A03A 4HOBA 3OYAA 2DQLA 4YFNF 2F5EA 2UXNA 1HDPA 1QA6A 4BDYA 2DMTA 3F9KA 3I55I 5F0FA 1Z91A 3DTIA 1XSXA 5CVVA 3EUAA 4B3XA 3HRMA 4E7SA 3R0AA 4U0WA 1V4RA 2B7EA 2R7UA 2ESHA 1JT0A 3P7NA 3TGNA 1W5TA 4B1RA 1HBXG 4XKWA 3A4CA 2E7WA 4BHBA 1Y6IA 4MIMA 2X6XA 5LGTA 2GQQA 1A04A 4UY8I 1LKXA 1MGTA 5HVQC 1S7AA 2MC4A 2HR3A 1RI7A 4PJJA 5E1WA 1O57A 3T5XA 3RDIA 2Y69H 2KPMA 2FNPA 2EFWA 3HB9A 3FISA 3TMOA 2F2EA 2JRMA 2H6CA 4IXAA 5IPAA 4RLFA 2BE5F 3PUFA 4G94A 5ICCA 3GTPJ 2QZ8A 2VC0A 3QRFF 1IAWA 2Y9YA 3S93A 1TL8A 2OPTA 1I5ZA 3TO7A 3TBIA 3LWFA 1TW2A 2ZJQF 1MIJA 2FQ4A 4CHUA 2QVOA 1R5ID 1S8NA 2STTA 4I2OA 4LG0A 3WTUC 2ZXHA 4A3EJ 2FQ3A 4IPAA 3KYDB 4PCQA 1K4SA 2IS2A 5CJ9A 4CXFA 5HS8A 4NBQA 4O3MA 2LNBA 2XGXA 3DPTA 5D5XB 2V79A 4KISA 3SEQA 4AIHA 4HG2A 2BZTA 4PK4A 2W7NA 2A5WA 1IXRC 2XKOA 1GVDA 1VQKI 4ZC3A 3ABLH 3W2WA 4OWRB 1FP1D 4EJTA 5E3MA 4LLNA 1ETQA 1W7PD 1WCMJ 3NWSA 4CUGA 3SZTA 3WTXC 2A5YB 4BQAA 2D2WA 3RTRA 2CQKA 3CO7C 1IN4A 1HDDC 4PJLA 1Z7LA 2MLGA 3B6AA 5KAIC 1B9NA 1QHGA 2KT0A 4UUSA 2QA4I 1FP2A 1LVKA 3WU0A 3OS1A 2FE3A 1RRJA 5IYBJ 2ZC2A 1X2MA 3FKIJ 3H92A 4ZDPA 4HZFA 1X4OA 3OS2A 1YJ9I 2F5VA 1T6SA 4BJ6C 4M3BA 3BTIA 4L9NA 4MFDA 1IXSB 2CSOA 1QZEA 3K1PA 3QYFA 3IC7A 1EA3A 3DKWA 4MO7A 1O3TA 3LSJA 2XHKA 2IRFG 2W1OA 4G6TB 3KE2A 2DA7A 4KT6A 1VQ7I 5ICGA 3IH4A 3BG5A 2BW3B 3NRVA 4A3BJ 2XF7A 4F92B 5HLIA 4QSHA 4XKVA 2LY2A 2MH9A 1TTYA 3D5SC 3BWGA 3LSGA 1ETYA 2LKPA 4BXXJ 1P6RA 1YRNA 3QAHA 4S0HB 2CUJA 1B72B 1YW7A 2LBFA 2ZBKA 4C2UA 3HJEA 2BVLA 3OYIA 2HPMA 2IJLA 4C9YA 2W48A 4UB6C 3HOTA 2M45A 3ZQGA 3L2RA 1OR7A 2NVQJ 5JI6A 4FQGA 3JTHA 1LUJB 3A2KA 3BR0A 5BPIA 2IGNA 3LL7A 5CQGA 1HXDA 2VKVA 3S14J 5FLXZ 1JTYA 4RB1A 1SD4A 2DA1A 1O7FA 4ZTJA 1APLC 1E3PA 1I50J 2IS4A 1ZGWA 2CV0A 1OR7C 1GT0C 2Y75A 1PYVA 1B6AA 4BU2A 2DOEA 2RKHA 2EV6A 2DFHA 4D9JA 2M8GX 4EATA 3RI4A 2KIFA 4EM0B 2KMUA 4A93J 1HQCA 1JE8A 1H8AC 3IKVA 4LITA 3QP5A 5LHIA 2DPUA 4DW6A 4BGDA 2Y30A 2Z9OA 5M3MJ 3CO6C 1Z0XA 2AXLA 1FEXA 1S7OA 4HPQA 2Z5UA 1SD7A 2ISYA 2BW3A 5J3LA 2LH9A 3TW7A 4IX7A 3RJPA 1ZHFA 5KAFC 1YTYA 4M3EA 4XSZF 2X6YA 2JVHA 3OV8A 4AIKA 4IJAA 1IRFA 2GM4A 4Q47A 4KDPA 2V1NA 1DPUA 2V9PA 3E5XA 4U7BA 2Y31A 1IF1A 5E1XA 3HTSB 3GZ6A 2AQEA 3FMRA 5IT9Z 2BVMA 3AFHA 5FROA 2MBFA 3CC4I 3W2VA 3CUQC 4FE7A 1G8XA 1H0MA 2XGDA 5ILUA 4WXDA 1YIOA 3IHUA 3FKJA 4BQNA 5GAGJ 1A35A 3T8RA 2R5YB 2M5WA 2QBYA 3VSLA 2DFEA 4WF2A 5EGOB 2W4SA 2O6GE 3DPLC 1BI0A 5JLWA 1XCBA 2DMPA 3H3VK 3RKWA 2RREA 3IAS2 3DCFA 3BC8A 4BBRJ 3BJ6A 2VUMJ 1GHCA 5BNGA 4FASD 4P9FA 2Y2ZA 3SYTA 3TL4X 5LRRA 5DYMA 3SHFA 1ZH5A 5J1RA 1AKHA 4RGUA 4K2EA 1LEAA 1T33A 1JI8A 1JTXA 1MDMA 2R7SA 1J0RA 1BM9A 1I1GA 3E6DA 3AAFA 1O3SA 1JUMA 4U88A 4E4HA 5BPDA 3HG9A 1TT5B 1WJDA 3GVAA 3BR6A 2HS5A 3I4MJ 2E7XA 2KZGA 5BQTA 3HSEA 2DA3A 3U21A 5M5WJ 2MGQA 2ZB9A 1PVEA 3J7AO 4LFUA 3IAM2 2DFIA 2LFBA 2DQRA 4S05A 5E3LA 1D5VA 1MJBA 3K2AA 3KP2A 3LQRA 2YS9A 5EZHA 1FBSA 4GRIA 5FKNA 2P0WA 4A3IJ 4EJVA 2VOPA 3BG7A 3I54A 2IGOA 1G59A 1P92A 1Z6TA 1SAXA 3HOSA 4BJ5C 3KP3A 4PGGA 4CA0A 2KISA 1BOBA 1S5LC 2VKEA 1JGGA 1U8RA 2EFPA 3ZOBA 3FBIB 4BE1A 1HCRA 3M3YJ 3QU6A 5DTDA 2L9NA 3GEZA 4J01A 4IOAF 4E7JA 3K4JA 3WGGA 3WTVC 1EH8A 2ETHA 2GXGA 3GF2A 1R7JA 1VQOI 4XL9A 2M0CA 4CO8A 2WAQA 2HOAA 3F8NA 4UUTA 1B1BA 2BYVE 3GZ5A 4Q4ZF 4IO9F 1BN5A 1B8IA 5A2QZ 3M4OJ 4D5FA 5CVRA 5CQEA 5FB2A 4M9ZA 3OR1C 2E35A 4M9XA 5JHUA 5B1AH 1WVRA 2N8GA 1JKPC 2VJIA 3ABTA 2GOXB 1F36A 1MD0A 2KRHA 3KX2A 3MEXA 1BA5A 3ABUA 3LOCA 4FETA 3HGGA 2F48A 3CF2A 4PZJA 3GO5A 1MBFA 3X2QH 3L2QA 2ELHA 1WJAA 2KDZA 2VQGA 1MNDA 4J19A 3HHGA 3WTSC 1W1WE 2KRCA 4Q48A 3S32A 1GXQA 3S3NA 2JA8J 2NVUB 3I4NJ 5GAEJ 1QHHD 6PAXA 2A05A 3AL0B 1VZ0A 2VQLA 3ZQQA 4E7LA 3PFIA 2XPUA 5IP6A 2DK5A 4A3KJ 1TWCJ 3PM1A 2K3FA 4MQVA 1VQPI 1HW5A 1RC9A 2H6BA 3GLLA 3RCOA 1X2NA 3DLAA 3CTAA 1XX5A 5D6FA 3K6GA 1RKWA 1U8BA 2VT2A 3O6BB 4GO1A 4UVCA 3A02A 1FOXA 5L3EA 1ZTRA 2VPRA 4UHTA 3W6JB 3GX4X 4IHTA 4A3CJ 4IOCF 1LDJA 2F5CA 3UR3C 4E7ZA 4TV7A 3MZHA 2R5ZB 1HKTA 4FHTA 4NC8A 2O0YA 1ORKA 1T0FC 2DLLA 2MYSA 2EB7A 1FLIA 1R00A 2F5FA 4WX9A 3OYMA 5IYDJ 2VN2A 4U87A 4R1HA 2OJED 2GIVA 3DTEA 5IP9J 2FX0A 3FIWA 3F23A 1Z21A 1SMYF 2FEZA 5DDGA 1ZK8A 1YJNI 2GA1A 3GBGA 4UUVA 2WWYA 2OA4A 5DCMB 1OMIA 2DXIA 4BDZA 2OF7A 5D4SA 3VYSB 2FA5A 4C30A 1DDNA 1TW3A 2MG4A 2ESNA 2PLYA 2B63J 1OFCX 3HTUA 1OCOH 1JT6A 3CJQB 2MLKA 3C3WA 2KZVA 1KQ0A 1BR2A 1NTCA 4Y3OA 1DUXC 2XRLA 2MFZA 2FJ1A 2QCOA 3BPXA 1P7JA 3C7JA 3R0JA 4XLFA 5ICEA 3DPUA 3OYEA 5IOYA 2OZUA 4BL0B 3DWLE 2O7OA 3QOEA 3K4MA 1RZ4A 3C1DA 3K9TA 3WGHA 2COMA 4KN4X 2E2JJ 2CWEA 4PFOA 3HSFA 2XIGA 3TQNA 3FMQA 5DEQA 2DMUA 3SFZA 1U78A 2DI3A 3AL0C 3HOYJ 4EJWA 1U9OA 1TNTA 4PUSA 4V2FA 3WTTC 3OYHA 3NEUA 1BJAA 1B8IB 1MBGA 1VQ5I 5L3DA 4G6QA 3E5QA 4AU7A 3ZN0A 1TQIA 2VKHA 4MGRA 1AU7A 5HNFA 4MNUA 5FLMJ 2NNYA 2OUMA 4ESBA 2V7FA 3S1RJ 3F8MA 1SVOA 2F4MB 1XGMA 3GCMA 1JUSA 3AG2H 3GFLA 1GDTA 1P4AA 4NDLA 3OL4A 4HNUA 3EUKL 2IEKA 4RBOA 3HBLA 4ON0A 4MTEA 3T0YA 1UMQA 5C4XJ 1QQIA 3D5LA 1I6HJ 4A6EA 4MEYF 3BTJA 1ODDA 4L9JA 3VPRA 1XCVA 1VNDA 1WH5A 3QWLA 1N25A 2VLAA 2IAIA 3I64A 2ZXIA 2CW0F 4EGYA 1OYYA 3F6OA 3WGIA 2KFDA 2ELKA 4G7ZF 2LD5A 2EFNA 5EG0A 1KONA 3HL2A 5CLSA 2HI3A 3RYPA 2OC6A 1UG0A 4CYCB 5IP7J 3KEQA 2MW8A 2ID3A 1SVMA 5F6FA 2CQQA 4E6KG 1SFKA 3G6EI 1U5TC 1Z3YA 2A61A 3MKWB 2UZKA 1UFMA 1B4AA 3OSFA 5D8KB 3I59B 3V42A 3PO2J 3S16J 3H0GJ 4NQWA 2HVRA 2O8XA 5BS6A 2D45A 3HXLA 4BY7J 1IXCA 3IH2A 1V5GA 2JSPA 1LE8A 5DV5A 1FOKA 5JVTA 3GUDA 2P7CB 1MH4A 3FXMA 5FKMA 1MMDA 4A69C 5J4VA 3BR1A 4XNFA 4ZZDA 2HEOA 3S1NJ 4U7DA 2VBXA 2ZXJA 2V6EA 4V19K 4QPOA 2JVGA 3KFWX 5KK1A 3A0BC 3OIOA 1MZBA 2HWVA 3HKZN 1Y8QB 5C4JJ 1L3LA 2H94A 4OU0A 3LQQA 1W5SA 1EH7A 4F55A 2CQNA 1QVUA 2LR8A 2O3FA 2XSJC 2ECBA 3C2GA 5J8FA 4HQMA 4AYBA 4XRFA 4EM1A 1PP8F 2OQRA 2ICWG 1R23A 3M8EA 1BI3A 1QPIA 4M72A 3MKYB 1CF7B 4M74A 2GIZA 5AIQA 4F91B 1UJ8A 1SVLA 3JW4A 4YIRX 3AG4H 3CDHA 1HC8A 2QUFA 1FZPB 2ZSHB 3BZKA 3ZMZA 5IYCJ 2XGEA 4ENJA 2IT0A 3CCUI 3I53A 2ZSIB 2ZJPF 4JP0A 1AKHB 2LK2A 1IN5A 3HRTA 2EV0A 2VODA 3WG9A 3CCYA 2G7HA 2Z3YA 1S7EA 2R5ZA 3PSIA 1FOYA 3VYUB 1RNLA 3ISPA 2AO9A 1BI1A 1W7PB 3QU3A 2VXZA 3U9GA 2PN6A 1E0EA 1OCCH 2AQFA 2F4OB 2QENA 3O2PE 1LB2A 3HDDA 1LE8B 2BY0A 3EETA 1KQ8A 2W82A 3IP4B 2OTLI 3MKZA 2QQBA 1MNEA 1U2WA 4CH7A 3OYCA 4LGWA 1Y39A 1ETXA 1K83J 2P5VA 3M07A 3JRGA 5HDGA 4XOTA 1TP4A 2CW8A 2GA2A 2K9LA 3FXOA 4WWCA 4I7HA 4BNCA 3RIRA 1FTZA 3EUHC 1ETKA 2A3SA 2C6YA 1XB4A 3E6BA 2VASA 3CDIA 2DJIA 3AG1H 3VYTB 2P7VB 3KEYA 3DKYA 4D7NA 2R7QA 3ZXSA 2LF8A 4HF0A 2R92J 3IV5A 4XMYA 3CUOA 4YG2F 3JAMZ 3PQKA 2H1KA 2TRTA 5M5YJ 1G2HA 1YS6A 4DYRA 4ZYGA 1OCPA 4QWQA 4WCGA 2QQ8A 2LBFB 4HNTA 1ERDA 3GYHX 4ZYDA 2ZMEA 2FD5A 2XVCA 3LA7A 2WY8Q 1YFHA 5HOOA 5E1ZB 2HVSA 4W97A 4ZH4F 4R79A 1D5YA 2F4IA 2ZO4A 5C3EJ 3ABMH 3TO9A 1OCZH 1U9NA 3N05A 3PQJA 1U3EM 2Y0SA 2HZTA 4YIIA 1IO2A 1KU3A 1YLFA 3A1YA 3CJNA 2WADA 1K6YA 1WWXA 2DFFA 1IRZA 4HA8A 3M9AA 2EWNA 3PL8A 4CCOA 5E18F 1G3YA 4LD5A 5E8GA 1BW6A 3BY6A 1N75A 3EYYA 4L5EA 3G1MA 3J7YJ 3FM3A 3WU2C 2BOLA 1NH3A 1PUEE 2CV1A 3HOVJ 4HSTA 3E3VA 3IL2A 4I99C 1DP7P 5FRNA 4HYEA 4LB5A 4KUMA 2VKDA 3RKXA 2OCEA 3TO6A 4X1EA 1MW7A 2P5KA 4LMYA 2R0QC 1R5GA 4U0YA 2BV6A 3CMMA 2OU2A 2L02A 3SZGA 3GFMA 1KYWA 3CD6I 5K7ZA 5FKKA 3I59A 4GYGA 2ZXWH 3VOEA 4OMZA 1HOMA 3F22A 2ISZA 3I71A 3HGYA 3MWMA 3RQIA 1LVAA 2WAFA 1ZREA 3MKLA 1Z3XA 3ZQLA 4CSWA 3BZ6A 1WFXA 3WTZA 3UKGA 3HPHA 1ZR2A 1W7PA 2HXOA 2YU9J 4HX8A 1R1UA 3P9KA 3TEDA 5F0HA 3CMAI 1GV2A 4BAYA 4OMYA 2M34A 3SFIA 3MFKA 1W5CC 3F0CA 1I1SA 4ZYEA 4DZPA 4LLGF 4C2TA 3GMEA 2V9VA 2KRFA 1FJLA 1MSEC 1D1AA 3L9FA 4KIGA 4WK8F 1IN8A 3CCRI 3WODF 1LFUP 3CMYA 1CF7A 2CRGA 4D7MA 3DV8A 4A3LJ 1IW7F 3MCZA 1T8IA 1A6QA 2PMZN 2FUG2 3BR2A 4ETSA 2HQNA 1XGSA 1OPCA 3J80K 2KIMA 3BLYA 3S2WA 4B48A 1AA7A 1MBHA 2I10A 2PX9A 1Y1VJ 4XLEA 5K5QA 3GW2A 2L3DA 3JSOA 2EIJH 2WAQN 1I6XA 2Q8KA 1WSUA 2STWA 1T08B 1XMAA 1NG6A 3KP5A 4KMFA 1Z67A 5J47A 2E5NA 3HM5A 3HHHA 2DODA 5DUIA 2LY1A 2CUEA 4XLPF 3DLLF 1FYLA 2DA6A 2K9MA 1OJLA 1V55H 2BXZA 1ZGJA 4KICA 1P7IA 2IVMA 3GTJJ 2PI0A 2PG4A 1R9TJ 3LNQA 4FE4A 2JUGA 4IL6C 1RESA 1S6LA 4PSXA 4LK1F 3Q5FA 2DYSH 4XM3A 1X3ZB 3DU5A 1XSDA 1RKTA 4HLXA 2PEXA 5FGMA 3GTQJ 4RDUA 2KLOA 5KCMA 3HRSA 4RMNA 1USTA 3TP0A 3CLOA 1QVTA 2HKXA 4XONA 3L2VA 4PJNA 4HRIA 1WKMA 5HS9A 1VQ9I 3BG3A 2LDUA 3OL3A 1W36D 2A69F 2RC4A 3FXJA 1IUFA 1Y56A 4HX4A 5EF6A 2HOTA 2O5RA 2VPLA 3RYRA 4KIBA 3OYKA 3WTWC 3LA2A 2ACJA 3I4PA 1ITYA 3F8BA 1KA8A 2PJRB 3T8TA 4HW0A 4CCKA 3CUQA 4BBSJ 1ONVA 4HV5A 4UV8A 2WAEA 1IDZA 2PMHA 3ASNH 3QPLA 3D5RC 5D5WB 2RDPA 4KJZA 2IXSA 2XAUA 2K9QA 2K85A 1MMNA 2DAOA 5TISC 2ZCWA 5CYVA 2BGCA 2QKMB 4HDUA 1MMAA 3TOAA 4BQQA 4KNYA 1TC3C 2P6TA 5ERIA 4ENMA 2IP2A 2J5OA 2HGCA 4ZTFA 2V1UA 1V3FA 3BTCA 2QGUA 3D0SA
chains in the Genus database with same CATH topology
2E36A 2OTJI 1ACIA 1YJNI 5GAHJ 1VQKI 3CCVI 1YJWI 3CC7I 3CJTB 3CC2I 1VQMI 1VQOI 5GADJ 1YI2I 2ZJQF 3CCJI 1YITI 1S72I 1VQ9I 1YIJI 4UY8I 3CCSI 1VQ8I 5GAEJ 4V19K 2H8WA 4IOCF 3CCMI 2E34A 3CMAI 3CF5F 5JVGF 3CC4I 4IO9F 3I56I 1FOXA 3PIPF 3PIOF 2JQ7A 3CCEI 3G6EI 2OTLI 1VQ6I 5DM6F 1HC8A 3G4SI 1YHQI 1VQ5I 3CD6I 2E35A 1Y39A 1FOWA 2K3FA 1QA6A 2QEXI 3G71I 3CCUI 1VQPI 3I55I 2ZJRF 3CCLI 1VQ7I 5GAGJ 2ZJPF 3CCRI 3CCQI 2NXNB 1VQ4I 3J7YJ 2QA4I 3CMEI 3J7ZI 5DM7F 1VQLI 1MMSA 4IOAF 2FOWA 1VQNI 3DLLF 1FOYA 1YJ9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E36 A;  2OTJ I;  1ACI A;  1YJN I;  5GAH J;  1VQK I;  3CCV I;  1YJW I;  3CC7 I;  3CJT B;  3CC2 I;  1VQM I;  1VQO I;  5GAD J;  1YI2 I;  2ZJQ F;  3CCJ I;  1YIT I;  1S72 I;  1VQ9 I;  1YIJ I;  4UY8 I;  3CCS I;  1VQ8 I;  5GAE J;  4V19 K;  2H8W A;  4IOC F;  3CCM I;  2E34 A;  3CMA I;  3CF5 F;  5JVG F;  3CC4 I;  4IO9 F;  3I56 I;  1FOX A;  3PIP F;  3PIO F;  2JQ7 A;  3CCE I;  3G6E I;  2OTL I;  1VQ6 I;  5DM6 F;  1HC8 A;  3G4S I;  1YHQ I;  1VQ5 I;  3CD6 I;  2E35 A;  1Y39 A;  1FOW A;  2K3F A;  1QA6 A;  2QEX I;  3G71 I;  3CCU I;  1VQP I;  3I55 I;  2ZJR F;  3CCL I;  1VQ7 I;  5GAG J;  2ZJP F;  3CCR I;  3CCQ I;  2NXN B;  1VQ4 I;  3J7Y J;  2QA4 I;  3CME I;  3J7Z I;  5DM7 F;  1VQL I;  1MMS A;  4IOA F;  2FOW A;  1VQN I;  3DLL F;  1FOY A;  1YJ9 I; 
#chains in the Genus database with same CATH topology
 3S1M J;  2DDA A;  4HBL A;  4OAY A;  5D4R A;  4B8X A;  2CGP A;  4NUB A;  4HLY A;  4RB3 C;  1X1D A;  3R4K A;  3GTG J;  1A31 A;  5TGT A;  3HOZ J;  1FC3 A;  3K2Z A;  3K69 A;  4KN7 X;  4AM3 A;  1PJR A;  1S9H A;  4LIU A;  2CFO A;  3WE3 A;  1IRG A;  5EEH A;  5H20 A;  5GP9 A;  1YW9 A;  3F72 A;  3U1K A;  4C3J J;  1LFB A;  1WI3 A;  3ZQH A;  3ZMU A;  2EA2 A;  2IBD A;  1MMS A;  3LMM A;  1LFP A;  3OOP A;  2RN7 A;  1M1E B;  3Q0V A;  3I3L A;  2IS6 A;  5EG0 B;  4BUP A;  4BHP A;  1SFU A;  1FIP A;  4FT8 A;  1MDM B;  2L4M A;  5HLG A;  3GFJ A;  2JA7 J;  2DYR H;  3L7W A;  3S2D J;  2JA5 J;  4KFC A;  2R4G A;  3EPZ A;  4MEX F;  2NXN B;  4HEA 2;  4OIO F;  4AWX B;  4KYW A;  2JT1 A;  3CME I;  4XOP A;  4R8H A;  5IY5 H;  5IT9 K;  2CV2 A;  5GTI C;  5J8C A;  1GVJ A;  3J81 K;  4BJT A;  2I5U A;  2A6T A;  2VIX A;  2CQ7 A;  2L7M P;  2L7F P;  4HDV A;  2PQ8 A;  1ZRF A;  5FKL A;  3V8J A;  2LKS A;  1Y1W J;  3F21 A;  1OCR H;  3C18 A;  3LSP A;  3ESW B;  3ONQ A;  2M3A A;  1GV5 A;  4CIC A;  2XSD C;  1JKO C;  3FZV A;  3VFZ A;  2QQA A;  3OMY A;  2KHM A;  3ZRG A;  5JFR A;  1ULY A;  2WTE A;  3OYF A;  1VTN C;  2EIK H;  3H3Z A;  2DA2 A;  4CCJ A;  4A3D J;  3HSR A;  3SQN A;  2L4A A;  4DOZ A;  1IC8 A;  4CGZ A;  2P81 A;  2E5Z A;  2CS3 A;  2EV5 A;  1KGS A;  2DT7 B;  1FWZ A;  4F7Z A;  2LTP A;  2M7A A;  3M7G A;  3BR3 A;  4NC6 A;  3ZQI A;  2KP6 A;  2EFQ A;  2H8W A;  4RM3 A;  4XLC A;  3OY9 A;  1ZRD A;  2BBY A;  4L18 B;  1XDS A;  3IWF A;  4QIW N;  1VFC A;  2H27 A;  4ASN A;  3OYJ A;  2WB1 A;  1FBU A;  3GWZ A;  3IKT A;  4LG0 B;  1X3U A;  3FXQ A;  4OIR F;  2AS5 F;  4BEH A;  3M8F A;  5CVJ A;  1P2F A;  1VF9 A;  1S29 A;  1J7K A;  2Z2S B;  2VXD A;  4JQF A;  5HS7 A;  3WG7 H;  2ECC A;  1D3Y A;  5K7H A;  2K4J A;  2DTZ A;  2R7D A;  2M30 A;  5KHD A;  3ZMV A;  3B73 A;  2NAZ A;  4EVI A;  4G6D A;  3JR9 A;  2X48 A;  5EYR A;  5H6Q A;  1BOA A;  2NYX A;  1O7L A;  2E2H J;  2L5Q A;  1TNS A;  3QPH A;  2HYF A;  4RAF A;  1UHM A;  3PNT A;  3QYE A;  4RGX A;  2XB5 A;  3DBL B;  2PBI A;  2LC2 A;  3Q3S A;  2YSR A;  5AON A;  1ZAR A;  1IV6 A;  3PO3 J;  3OIQ A;  2L2O A;  2EPF A;  5L3F A;  1VQN I;  3O8H A;  4G7H F;  2O8K A;  1F5T A;  3B6C A;  3KLN A;  2JPC A;  3LAJ A;  2XB0 X;  2I8D A;  1X3W B;  4KA4 A;  4HF1 A;  2LRD A;  4I76 A;  1YW8 A;  4A12 A;  2XF5 A;  4U0V A;  2CFX A;  3HIF A;  4DBR A;  1BL0 A;  3FF5 A;  3NWT A;  1R71 A;  2UV1 A;  4JYK A;  1DGW Y;  4XOR A;  1UB9 A;  3I9V 2;  3REO A;  3C2H A;  3KYC B;  3MQ0 A;  1WJB A;  1X19 A;  4EM2 A;  4AVZ A;  4II2 A;  4XKC A;  5LHG A;  4IRI A;  1E3O C;  4Y4R A;  3LSM A;  3CES A;  1Z1D A;  1R6R A;  3KPH A;  4NC7 A;  2Q2E B;  2JA2 A;  3A0H C;  5J4Y A;  3GTO J;  3RZO J;  3JRH A;  1GXP A;  3K4C A;  5E17 F;  4A5M A;  1FT9 A;  4M71 A;  1ZEL A;  2XRN A;  4AYB N;  3AG3 H;  2EIN H;  3DEW A;  3HYI A;  3F8C A;  2JWT A;  3LFU A;  5B1B H;  4B4C A;  3W3C A;  4ESJ A;  3F6V A;  4Y15 A;  2CU7 A;  4RA2 A;  1ON1 A;  2WV1 A;  2P5L C;  4QLC U;  5BMZ A;  2HXI A;  1KU9 A;  1SFO J;  2LMD A;  2R5Y A;  2QBY B;  1Y0U A;  1PUF A;  2K40 A;  4DGW B;  1IN7 A;  5FD6 A;  3L2C A;  1T56 A;  2KDO A;  4I09 A;  5FKO A;  1PUF B;  3H5N A;  5F27 A;  5F1R A;  2WA0 A;  2K27 A;  1XD7 A;  1F1Z A;  4C2M J;  1V54 H;  2HYJ A;  2YPR A;  2KIU A;  4ZYA A;  2VQH A;  5F1J A;  4UUS B;  3BJO A;  3ZN1 A;  1QU3 A;  1DU6 A;  3MAJ A;  2IGM A;  2WB1 N;  2HYG D;  1ON2 A;  5GPC A;  4JBA A;  4D5C A;  3V4G A;  3FK6 A;  4F3Q A;  3QQA A;  2DT6 A;  5DM6 F;  5KNL A;  3MMY B;  4B43 A;  2JA6 J;  3S8P A;  1R4N B;  3VEP A;  2ZNY A;  4O5V A;  4RM2 A;  2HU9 A;  4PDK A;  1STZ A;  2DOA A;  3J7Z I;  4ANJ A;  1VQL I;  1UZC A;  1P9Q C;  1YOV B;  3RPU A;  1JJ6 C;  1SAU A;  1BC8 C;  1IRX A;  3S3M A;  4RB0 A;  2DA4 A;  3RQ4 A;  1U6G A;  1MKM A;  4L0Y B;  4IEJ A;  2R7T A;  5J1Y A;  2XAQ A;  3SDB A;  4YEJ A;  3TP3 A;  3W6K B;  3HUG B;  3RZD J;  1FPQ A;  4BAC A;  5D8L B;  2DPD A;  3HOX J;  1J5Y A;  1EKE A;  4FX0 A;  3N97 A;  4HF2 A;  2HZD A;  2Q1Z B;  3BPV A;  2ZJR F;  5CVI A;  3IRR A;  3CP8 A;  3E6C C;  3KZI C;  3OSG A;  4FTH A;  1X58 A;  1MBK A;  4OOI A;  4N9H A;  2XAS A;  5K7F A;  1R1T A;  2OD5 A;  2OTJ I;  1T2K A;  2XDV A;  4OIP F;  4C3I J;  5LGN A;  2OAZ A;  4CCN A;  3S15 J;  1UHW A;  4EV0 A;  2GXB A;  4X0G A;  3E0J B;  4XLH A;  4JK1 X;  1L0O C;  2TCT A;  4IKF A;  4XRM A;  3D1N I;  5F64 A;  1QRY A;  5HDN A;  1WPK A;  4IHY A;  2XGC A;  1V5F A;  5C44 J;  3DBH B;  2JSC A;  4LG3 A;  3WHC A;  2PJP A;  3H9G A;  4BQO A;  1RUN A;  1B72 A;  3DEE A;  5JR3 A;  2XAG A;  2DN0 A;  1YI2 I;  3OYB A;  1D1B A;  4XK4 A;  5M5X J;  3G1L A;  4B44 A;  1T39 A;  4I6Z A;  3M1C A;  4RGR A;  2GLO A;  4M6X A;  1MJA A;  1TT0 A;  4NNJ A;  3DP7 A;  5FRM A;  2NS8 A;  1LEB A;  1BR4 A;  4L0Z B;  2V1X A;  1JHF A;  3BR5 A;  3JRB A;  3FK7 A;  3DTK A;  3CCL I;  2Z99 A;  4XIC A;  1WRJ A;  1VQ4 I;  1DPR A;  3LSH A;  2E60 A;  2FOW A;  2ELJ A;  2R7O A;  2PMU A;  2O61 A;  2E1O A;  4HV6 A;  5GAD J;  2DK8 A;  5TJJ A;  1ZLJ A;  4QTR A;  3V7R A;  4A3F J;  2JRT A;  1OCT C;  2KKO A;  4GGG A;  2DU9 A;  3OYL A;  1T98 A;  1SFE A;  3E1S A;  4M3F A;  3RKQ A;  3HKZ A;  1OKR A;  2DTR A;  2ID6 A;  2YUS A;  2HKO A;  4CYC A;  2VBW A;  5CVU A;  4IHS A;  1WZ2 A;  4PGH A;  1WH7 A;  3ZQF A;  5DM7 F;  2Z33 A;  1JHH A;  5K5O A;  3ZGK A;  2BY1 A;  2DO7 A;  2X6O A;  3OYG A;  1D0Z A;  3KET A;  1ENH A;  3ECO A;  3K4K A;  3JRC A;  3COA C;  1HKS A;  4NQW B;  4E7K A;  2L0K A;  4E7I A;  1BC7 C;  2X85 A;  1REP C;  3F8F A;  3BCB A;  2Q2E A;  4LOC A;  3JSP A;  2G9W A;  2G0E A;  4WXC A;  1MNM C;  1UHS A;  3FXL A;  5LRS A;  2JK3 A;  2E19 A;  1F43 A;  1F9N A;  2F6C A;  3BCA A;  3FMS A;  3EYI A;  2LG4 A;  4XBF A;  2V26 A;  2K9N A;  5H6R A;  2M7B A;  2B0L A;  3ASO H;  4ESF A;  2V9K A;  3JRF A;  1JXS A;  4XID A;  4M9S A;  4UVB A;  2LVS A;  5AIP A;  4MQ9 F;  3NAU A;  1MSF C;  3TDU C;  4B3A A;  1ZYR F;  1YRN B;  1YIT I;  3QPT A;  2L7Z A;  2VQC A;  3HEF A;  2FU4 A;  4GFB A;  2QSG X;  2A6E F;  4G8X A;  2DA5 A;  1ZG3 A;  3OOU A;  2E1C A;  3R60 A;  1POG A;  3O3K A;  5FO5 A;  3RSN A;  2LF7 A;  2WY7 Q;  3JRE A;  5L3C A;  1K61 A;  4NB5 A;  4CZZ A;  2XF6 A;  1YX3 A;  2RNG A;  1HF0 A;  4N0B A;  2RAE A;  1I3A A;  3KLO A;  4IRH A;  1WQ2 A;  1SMT A;  3NAR A;  5J6X A;  3H5A A;  3FX3 A;  1QO0 D;  1XN7 A;  3WTY C;  1R5H A;  2P4W A;  3KP7 A;  4G9Y A;  5DCF A;  1PP7 U;  2LP0 A;  3LA3 A;  4P96 A;  1E2X A;  3LAP A;  2JQ7 A;  1OYI A;  2X1D A;  2VJJ A;  4LJZ F;  2PJR A;  1Q1H A;  3DQV C;  4AC0 A;  3LST A;  4IZZ A;  2YX4 A;  4HSR A;  2R7Z J;  2FNA A;  3PUB A;  3R61 A;  4MFE A;  1RET A;  1FSE A;  3ZMD A;  2HPI A;  1NK2 P;  2Y48 A;  3OR2 C;  5GAH J;  5HOD A;  3BQY A;  3HRU A;  2ADU A;  2KL4 A;  1Z77 A;  4RAG A;  3TKY A;  4XQF A;  3H35 A;  3Q0W A;  1WJC A;  2HQ5 A;  4IHX A;  3S17 J;  2DBB A;  1FIA A;  2FF4 A;  1P4X A;  2R7V A;  2M1B A;  2RVC A;  2ZNZ A;  3E7L A;  3QP6 A;  4XSX F;  1KU2 A;  1XTA A;  4XR6 A;  1NG7 A;  4EJO A;  1QGP A;  1ETV A;  1RR8 C;  2ZFW A;  1LJ9 A;  3BT9 A;  2IA1 A;  5HLH A;  4AIJ A;  3LSI A;  4YEL A;  3S2H J;  5F08 A;  1ZG1 A;  2HNH A;  2MA3 A;  1TQM A;  4RAY A;  2W25 A;  5GPA A;  5LFA A;  5EEA A;  2W57 A;  1R49 A;  1VI0 A;  2FBI A;  4P55 A;  1YO5 C;  3ZP5 A;  1BW5 A;  3G3Z A;  4W1U A;  1JUP A;  1IDY A;  2CW7 A;  3P9I A;  4N4O B;  2OQG A;  2IPQ X;  3UNG C;  5GTH C;  3SZP A;  1P4W A;  4ZYH A;  4Y7N J;  2Y9Z A;  3BP8 A;  4Y17 A;  3DEU A;  1R36 A;  4KMU X;  3JRD A;  1FTT A;  2O03 A;  4EJU A;  2CH0 A;  4YFK F;  3MZ8 A;  3BZC A;  2ZFU A;  4DJA A;  2EIL H;  3I0T A;  4H4K C;  3RKY A;  3GFI A;  1AHD P;  2DMN A;  1X1B A;  1H89 C;  1A6I A;  3K4B A;  3C2B A;  3K4L A;  4B47 A;  3DF8 A;  5EZG A;  3H0D A;  2EIM H;  4ENK A;  3H3U A;  4HAM A;  2DMQ A;  2VI6 A;  4Q5S F;  1V5E A;  1YG2 A;  4JX5 A;  1HST A;  2K4B A;  1GLN A;  1TZL A;  2COB A;  1DP3 A;  4BXU A;  3H1C A;  3MVP A;  3M8J A;  4Z2Y A;  3G71 I;  3Q0U A;  2M9H A;  2MH2 A;  1BBY A;  3CCQ I;  1G3T A;  1ZAO A;  2L7K A;  1ETW A;  1MBE A;  2H8R A;  2CQX A;  1S72 I;  3H36 A;  1FX7 A;  3TDZ C;  4EGZ A;  1SD6 A;  3J81 Z;  3FHZ A;  1GUU A;  2EZK A;  1W36 C;  5F0C A;  3FHN A;  2M87 A;  1T0F A;  4P5O A;  4CCM A;  1KU7 A;  2UWM A;  3CDL A;  2Z1D A;  2CMP A;  1K78 B;  4Y33 A;  3IRQ A;  2IA0 A;  4FX4 A;  3K7A J;  3JAM K;  2QEX I;  1I27 A;  3W2A A;  4M6V A;  3HC7 A;  1FMV A;  2ME0 A;  5A2Q K;  4A3M J;  2FXA A;  3KZY A;  1YIJ I;  4HQE A;  4XLN F;  1I3Q J;  5EJC A;  1ZN2 A;  2GOM A;  2HQR A;  1MH3 A;  2QSH X;  2QM3 A;  3P5J A;  4O6J A;  5CPR B;  3S1Q J;  3ZQC A;  1Z05 A;  3O8G A;  3PSF A;  1XDU A;  1C0W A;  5ILS A;  2D1H A;  2VON A;  1LDD A;  2YU3 A;  2QWW A;  2R7F A;  3E6M A;  4M3D A;  2UUZ A;  2LY9 A;  1FOW A;  2L54 A;  2JTV A;  1Y8R B;  3IUO A;  2W24 A;  3Q9V A;  3KP6 A;  2FOK A;  3W6V A;  4V2G A;  5IOZ A;  3CJR B;  4A0Z A;  3T1B A;  4BE2 A;  2FRH A;  1HW2 A;  5LD2 C;  3DXJ F;  1SD5 A;  4Y13 A;  2FSW A;  1HKQ A;  1Q1V A;  2K86 A;  2L9S A;  3H9J A;  1VQM I;  5EDN A;  5IT3 A;  2GXA A;  2Y0M A;  4JOM A;  4AVP A;  4M3G A;  3I58 A;  3Q9S A;  4I98 B;  1FNN A;  3IWZ A;  3S3O A;  5F04 A;  1QBJ A;  2NS7 A;  4PJ0 C;  1KZH A;  2QF7 A;  4BXF A;  1FSH A;  2R7R A;  2NVT J;  1TWH J;  1YHQ I;  4L5I A;  5TRD A;  3IH3 A;  3RPQ A;  3K70 D;  4DYQ A;  3JTG A;  2JZY A;  2RV8 A;  1W0T A;  1XGN A;  2A6H F;  3QOP A;  1XSV A;  4II3 A;  1JKQ C;  1MBJ A;  4C3H J;  1IGN A;  1X1C A;  2M4G A;  4EMS A;  2NOJ B;  1BI2 A;  1ZKG A;  5D5U B;  5LEK A;  2V4J C;  3F3X A;  4S04 A;  2V6C A;  3EQL F;  1SAN A;  3OS0 A;  2EQR A;  2CG4 A;  2NVX J;  4XLA A;  3PIP F;  4X6A J;  3U2R A;  4D0P A;  5E8I A;  3CP2 A;  4N4N B;  4LLL A;  1BIA A;  2VC1 A;  2WC2 A;  1ZLK A;  4L9V A;  1FY7 A;  2UXX A;  2XAJ A;  2QSF X;  3JRA A;  2JN6 A;  2DJN A;  1J59 A;  4UVA A;  3LFK A;  2DCE A;  3BTL A;  1OYW A;  1U0J A;  1SC7 A;  1W0U A;  2VE8 A;  2XAH A;  1YJW I;  4IVN A;  5LEJ A;  3K10 A;  1DQU A;  3ZR8 X;  5DS9 A;  2X1C A;  5DCM A;  4LB6 B;  1YYV A;  1U5T B;  3FDY A;  4I01 A;  4ZDO A;  2HDW A;  2L01 A;  3KZZ A;  2K02 A;  2VBZ A;  2HDC A;  2OBP A;  1WJF A;  2P8T A;  1XMX A;  1R22 A;  2FBK A;  3DBR B;  1TQP A;  4MHG A;  2EA4 A;  4BH9 A;  2BHZ A;  3FXU A;  4A0X A;  1NHA A;  1O3Q A;  3MD2 A;  5B66 C;  3CC2 I;  2M0M A;  2QYO A;  4YFX F;  1XG1 A;  1ZGA A;  5ICF A;  3DU6 A;  4FIS A;  3HPG A;  3ELK A;  2XV4 S;  4F93 B;  4KIF A;  3KCC A;  3FXK A;  3VWB A;  3ULQ B;  2VT3 A;  3KP4 A;  1J75 A;  5JHF A;  3VSK A;  3OYD A;  3SXY A;  2K3P A;  4G12 A;  1D1C A;  3WE2 A;  3K1M A;  4JX6 A;  3ECH A;  4YRV A;  1O3R A;  3PJR A;  2IA2 A;  3J80 Z;  2KJB A;  2GWR A;  1IV8 A;  4RB2 C;  2PMZ A;  2LSO A;  4ABZ A;  1HW1 A;  3BG9 A;  3TOB A;  1G4D A;  5K5R A;  3OWT A;  3FBN B;  1W4M A;  2RGV A;  2H09 A;  4I0A A;  4WXH A;  3V8L A;  1MJ9 A;  1D8J A;  2M4K A;  4OAZ A;  2DDB A;  5LBQ A;  1D0Y A;  4MLO A;  5J1U A;  1XPX A;  4M6Y A;  2R3S A;  3OYN A;  1FYK A;  2XRO A;  4OIQ F;  1NK3 P;  5ILV A;  1N77 A;  1QZZ A;  4GCV A;  2NVY J;  2YR2 A;  3GTL J;  2R7W A;  3JRI A;  1F4K A;  1CQT A;  4EQQ A;  3ERM A;  2HQA A;  2MSY A;  2M2E A;  3B02 A;  2IW5 A;  2D5V A;  3HZJ A;  3VOD A;  2XKP A;  4BS9 A;  2KQR A;  3BQZ A;  4LIV A;  3R6S A;  3I56 I;  1ZQ3 P;  2EH3 A;  1EH6 A;  1WJ5 A;  2VB6 A;  1RIO H;  3ROU A;  5EEG A;  2CO5 A;  2XUB A;  5FJ8 J;  3G4S I;  4RLQ A;  2EK5 A;  1K7A A;  4L5J A;  5FFZ A;  3RPU D;  1UEL B;  2ZME C;  3CQZ J;  3I5U A;  4A5N A;  4L9T A;  4BKX A;  4RAZ A;  1EV7 A;  4G7O F;  1QNT A;  3V7C A;  2WV0 A;  3ZMT A;  3KIO A;  4HX7 A;  1WI9 A;  3J7A Y;  2RQQ A;  3FXR A;  4DIQ A;  2BXY A;  4P1W A;  4XN3 A;  1I39 A;  2IGK A;  2VBY A;  1Z7U A;  2NNN A;  1R58 A;  3CZ6 A;  3SDG A;  3QPS A;  4XRS G;  4BY1 J;  2LLK A;  1IUY A;  1H9T A;  1Y0N A;  2E1M B;  1QPM A;  2G7U A;  1ZG5 A;  2GBY A;  1T38 A;  4UXN A;  2QKL B;  4PFP A;  3K70 C;  1G3S A;  3MZY A;  4UB8 C;  5D6E A;  3LSR A;  3BJA A;  4ZJZ A;  1TWA J;  2E36 A;  4XN0 A;  3LSK A;  3V8K A;  3FWE A;  3K4N A;  2X1E A;  3CCV I;  4CCL A;  4DZJ A;  1HLV A;  1JJ8 C;  1IG7 A;  1FBQ A;  2FBH A;  2EBI A;  3BG6 A;  3K1N A;  2O9L A;  2W85 A;  3VB2 A;  3CF5 F;  4JX4 A;  1AWC A;  2XPW A;  2VJ5 A;  1K4T A;  4ENN A;  2M8E A;  4P9U A;  2GAU A;  2BY3 A;  2ZME B;  5LGU A;  1LPQ A;  5DD4 A;  1YX5 A;  2GZW A;  5B3S H;  2CUZ A;  4YIF A;  5E20 A;  3A01 A;  2EZH A;  2AXT C;  4IHV A;  1J9I A;  2LOO A;  1HA8 A;  2KIQ A;  1USS A;  4NHJ A;  1XC5 A;  2X0L A;  2HOS A;  2LYC A;  3CUQ B;  5DUK A;  2E2I J;  2ZKZ A;  1A5J A;  5L3B A;  4H0E A;  4BEH B;  3VDX A;  5HLT A;  1RPW A;  4DYC A;  1VQ8 I;  1B59 A;  1G6N A;  5JVG F;  2X9D A;  1UCR A;  2IS1 A;  4DBQ A;  1TWF J;  3HOW J;  1WGX A;  2W00 A;  4GYI A;  2E1M C;  1D8K A;  5KVR A;  1VQ6 I;  4OIN F;  4QPQ A;  1E3H A;  4A2U A;  4BYY A;  9ANT A;  1J2X A;  1XGO A;  3DFG A;  1N78 A;  1IZ1 A;  1X4P A;  2HOE A;  2X6W A;  2R7X A;  1IN6 A;  1LQ1 A;  2CJJ A;  4UNO A;  2VJ4 A;  2F5D A;  3HOU J;  1Z6R A;  2XPV A;  1ACI A;  2XC7 A;  3ERE D;  3GTK J;  5EGO A;  2K7L A;  5L3G A;  1DGR M;  2A68 F;  2MAB A;  1RUO A;  2OCC H;  2V1D A;  3N4M A;  4PSW A;  3G1O A;  2H1L A;  1OLT A;  2MD0 A;  4ITV A;  4M73 A;  5E3N A;  1YQA A;  3TW6 A;  4LK0 F;  3HUG A;  1ZRC A;  1AOY A;  3ZMS A;  4Z6Y A;  2OZ6 A;  3V7S A;  2NRA C;  3U1D A;  4A6D A;  3ML6 A;  1U5T A;  3KYL A;  4FCY A;  2L9R A;  2QQ9 A;  1WJE A;  2MD5 A;  4AID A;  3VYR B;  3FM5 A;  3CCJ I;  1UAA A;  2E1N A;  4RS8 A;  4ZDL A;  2LRE A;  3CCS I;  2Y0S N;  4CDG A;  3L1P A;  1A36 A;  1DU0 A;  3SJM A;  3A01 B;  1ZR4 A;  1H9G A;  1J09 A;  1QZY A;  4IRG A;  4IHW A;  3AKZ A;  2JJ7 A;  3OIP A;  1S3J A;  2CUF A;  5JLX A;  3CLQ A;  3L00 A;  3G2B A;  4AUX A;  3GZN B;  4HNV A;  5HDK A;  3SEZ A;  2YX7 A;  5B5E C;  5K1Y A;  5D5V B;  1EJ9 A;  3H5R A;  1FMW A;  1K79 A;  4XKB A;  2OV7 A;  4RGS A;  3NQO A;  1D0X A;  2X51 A;  4GDF A;  2EJR A;  3ZQ7 A;  2W84 A;  2EFO A;  4XRS A;  1E17 A;  3WU1 B;  2VOO A;  3GXO A;  3GTM J;  2WBM A;  3PIO F;  3BDD A;  4DQ2 A;  1MMG A;  3EDP A;  2DW4 A;  2X4H A;  3BOQ A;  3ZPL A;  1K6O A;  2R93 J;  2HVQ A;  1BR1 A;  1K78 A;  4PJM A;  2B9S A;  1TBX A;  3M1E A;  2BY2 A;  2QLZ A;  4DNC A;  5BOX A;  3CJT B;  2VL8 A;  1TLH B;  1KYZ A;  1T95 A;  2RNJ A;  5CKT A;  2DOF A;  4IQJ A;  5H2F C;  3PNY A;  3EUH A;  5FLV A;  3E97 A;  2J5P A;  5FFX A;  3QYB A;  4IF4 A;  3E5U A;  4AD9 A;  1X1P A;  1UG2 A;  4BHC A;  2CYY A;  2BHY A;  1CGP A;  4E7H A;  3P9C A;  1PDN C;  4IQ4 A;  4MTD A;  1HSJ A;  2JPB A;  2FMY A;  4UV9 A;  4J00 A;  5LHH A;  1BJZ A;  4E70 A;  1JGS A;  2E71 A;  1FYM A;  4I02 A;  4A3J J;  3WHB A;  1TWG J;  1YE9 A;  2HTJ A;  2FML A;  1YS7 A;  2D1V A;  4A0Y A;  1SEU A;  1EF4 A;  4CYD A;  1JKR C;  3JCU C;  3BRO A;  1LNW A;  4KIT B;  1IJW C;  1XS9 A;  3L2W A;  2RQP A;  1G3W A;  2E34 A;  3L2U A;  2DT5 A;  3ZCO A;  2LKX A;  3H9Q A;  3CCE I;  5E79 C;  4F52 A;  5LLQ A;  3KEO A;  4B09 A;  1X1A A;  2Q0O A;  1XMK A;  4Y52 J;  5ED4 A;  2P6S A;  1OQY A;  4EEF G;  5M3F J;  5FLX K;  4I0B A;  5FD5 A;  1B9M A;  1WHU A;  2MC3 A;  4D1Q A;  5DD8 A;  1R1V A;  1RR7 A;  3MN2 A;  3CC7 I;  4A3G J;  3PFY A;  5E3O A;  5HNH A;  2AHQ A;  2HFH A;  3GLX A;  5J40 A;  3G73 A;  2VE9 A;  2ME6 A;  3K0L A;  2HTS A;  4KT5 C;  2EZI A;  4N9I A;  1H88 C;  4CZC A;  2K5C A;  2Z16 A;  4ZZL A;  2JMW A;  3L09 A;  2K9S A;  3ABK H;  2L9V A;  2EZL A;  2ZJ2 A;  2TDX A;  3QOD A;  2BEO A;  1LDK B;  2XAF A;  3PNV A;  2KJC A;  2A07 F;  1OIS A;  4BE0 A;  1BIB A;  4GXO A;  1KQ9 A;  3DKX A;  2JUC A;  3CCM I;  1R4M B;  2NOG A;  1O4X A;  2PFB A;  2HDD A;  1Z9C A;  2NS0 A;  1SFX A;  1ETO A;  3A03 A;  4HOB A;  3OYA A;  2DQL A;  4YFN F;  2F5E A;  2UXN A;  1HDP A;  1QA6 A;  4BDY A;  2DMT A;  3F9K A;  3I55 I;  5F0F A;  1Z91 A;  3DTI A;  1XSX A;  5CVV A;  3EUA A;  4B3X A;  3HRM A;  4E7S A;  3R0A A;  4U0W A;  1V4R A;  2B7E A;  2R7U A;  2ESH A;  1JT0 A;  3P7N A;  3TGN A;  1W5T A;  4B1R A;  1HBX G;  4XKW A;  3A4C A;  2E7W A;  4BHB A;  1Y6I A;  4MIM A;  2X6X A;  5LGT A;  2GQQ A;  1A04 A;  4UY8 I;  1LKX A;  1MGT A;  5HVQ C;  1S7A A;  2MC4 A;  2HR3 A;  1RI7 A;  4PJJ A;  5E1W A;  1O57 A;  3T5X A;  3RDI A;  2Y69 H;  2KPM A;  2FNP A;  2EFW A;  3HB9 A;  3FIS A;  3TMO A;  2F2E A;  2JRM A;  2H6C A;  4IXA A;  5IPA A;  4RLF A;  2BE5 F;  3PUF A;  4G94 A;  5ICC A;  3GTP J;  2QZ8 A;  2VC0 A;  3QRF F;  1IAW A;  2Y9Y A;  3S93 A;  1TL8 A;  2OPT A;  1I5Z A;  3TO7 A;  3TBI A;  3LWF A;  1TW2 A;  2ZJQ F;  1MIJ A;  2FQ4 A;  4CHU A;  2QVO A;  1R5I D;  1S8N A;  2STT A;  4I2O A;  4LG0 A;  3WTU C;  2ZXH A;  4A3E J;  2FQ3 A;  4IPA A;  3KYD B;  4PCQ A;  1K4S A;  2IS2 A;  5CJ9 A;  4CXF A;  5HS8 A;  4NBQ A;  4O3M A;  2LNB A;  2XGX A;  3DPT A;  5D5X B;  2V79 A;  4KIS A;  3SEQ A;  4AIH A;  4HG2 A;  2BZT A;  4PK4 A;  2W7N A;  2A5W A;  1IXR C;  2XKO A;  1GVD A;  1VQK I;  4ZC3 A;  3ABL H;  3W2W A;  4OWR B;  1FP1 D;  4EJT A;  5E3M A;  4LLN A;  1ETQ A;  1W7P D;  1WCM J;  3NWS A;  4CUG A;  3SZT A;  3WTX C;  2A5Y B;  4BQA A;  2D2W A;  3RTR A;  2CQK A;  3CO7 C;  1IN4 A;  1HDD C;  4PJL A;  1Z7L A;  2MLG A;  3B6A A;  5KAI C;  1B9N A;  1QHG A;  2KT0 A;  4UUS A;  2QA4 I;  1FP2 A;  1LVK A;  3WU0 A;  3OS1 A;  2FE3 A;  1RRJ A;  5IYB J;  2ZC2 A;  1X2M A;  3FKI J;  3H92 A;  4ZDP A;  4HZF A;  1X4O A;  3OS2 A;  1YJ9 I;  2F5V A;  1T6S A;  4BJ6 C;  4M3B A;  3BTI A;  4L9N A;  4MFD A;  1IXS B;  2CSO A;  1QZE A;  3K1P A;  3QYF A;  3IC7 A;  1EA3 A;  3DKW A;  4MO7 A;  1O3T A;  3LSJ A;  2XHK A;  2IRF G;  2W1O A;  4G6T B;  3KE2 A;  2DA7 A;  4KT6 A;  1VQ7 I;  5ICG A;  3IH4 A;  3BG5 A;  2BW3 B;  3NRV A;  4A3B J;  2XF7 A;  4F92 B;  5HLI A;  4QSH A;  4XKV A;  2LY2 A;  2MH9 A;  1TTY A;  3D5S C;  3BWG A;  3LSG A;  1ETY A;  2LKP A;  4BXX J;  1P6R A;  1YRN A;  3QAH A;  4S0H B;  2CUJ A;  1B72 B;  1YW7 A;  2LBF A;  2ZBK A;  4C2U A;  3HJE A;  2BVL A;  3OYI A;  2HPM A;  2IJL A;  4C9Y A;  2W48 A;  4UB6 C;  3HOT A;  2M45 A;  3ZQG A;  3L2R A;  1OR7 A;  2NVQ J;  5JI6 A;  4FQG A;  3JTH A;  1LUJ B;  3A2K A;  3BR0 A;  5BPI A;  2IGN A;  3LL7 A;  5CQG A;  1HXD A;  2VKV A;  3S14 J;  5FLX Z;  1JTY A;  4RB1 A;  1SD4 A;  2DA1 A;  1O7F A;  4ZTJ A;  1APL C;  1E3P A;  1I50 J;  2IS4 A;  1ZGW A;  2CV0 A;  1OR7 C;  1GT0 C;  2Y75 A;  1PYV A;  1B6A A;  4BU2 A;  2DOE A;  2RKH A;  2EV6 A;  2DFH A;  4D9J A;  2M8G X;  4EAT A;  3RI4 A;  2KIF A;  4EM0 B;  2KMU A;  4A93 J;  1HQC A;  1JE8 A;  1H8A C;  3IKV A;  4LIT A;  3QP5 A;  5LHI A;  2DPU A;  4DW6 A;  4BGD A;  2Y30 A;  2Z9O A;  5M3M J;  3CO6 C;  1Z0X A;  2AXL A;  1FEX A;  1S7O A;  4HPQ A;  2Z5U A;  1SD7 A;  2ISY A;  2BW3 A;  5J3L A;  2LH9 A;  3TW7 A;  4IX7 A;  3RJP A;  1ZHF A;  5KAF C;  1YTY A;  4M3E A;  4XSZ F;  2X6Y A;  2JVH A;  3OV8 A;  4AIK A;  4IJA A;  1IRF A;  2GM4 A;  4Q47 A;  4KDP A;  2V1N A;  1DPU A;  2V9P A;  3E5X A;  4U7B A;  2Y31 A;  1IF1 A;  5E1X A;  3HTS B;  3GZ6 A;  2AQE A;  3FMR A;  5IT9 Z;  2BVM A;  3AFH A;  5FRO A;  2MBF A;  3CC4 I;  3W2V A;  3CUQ C;  4FE7 A;  1G8X A;  1H0M A;  2XGD A;  5ILU A;  4WXD A;  1YIO A;  3IHU A;  3FKJ A;  4BQN A;  5GAG J;  1A35 A;  3T8R A;  2R5Y B;  2M5W A;  2QBY A;  3VSL A;  2DFE A;  4WF2 A;  5EGO B;  2W4S A;  2O6G E;  3DPL C;  1BI0 A;  5JLW A;  1XCB A;  2DMP A;  3H3V K;  3RKW A;  2RRE A;  3IAS 2;  3DCF A;  3BC8 A;  4BBR J;  3BJ6 A;  2VUM J;  1GHC A;  5BNG A;  4FAS D;  4P9F A;  2Y2Z A;  3SYT A;  3TL4 X;  5LRR A;  5DYM A;  3SHF A;  1ZH5 A;  5J1R A;  1AKH A;  4RGU A;  4K2E A;  1LEA A;  1T33 A;  1JI8 A;  1JTX A;  1MDM A;  2R7S A;  1J0R A;  1BM9 A;  1I1G A;  3E6D A;  3AAF A;  1O3S A;  1JUM A;  4U88 A;  4E4H A;  5BPD A;  3HG9 A;  1TT5 B;  1WJD A;  3GVA A;  3BR6 A;  2HS5 A;  3I4M J;  2E7X A;  2KZG A;  5BQT A;  3HSE A;  2DA3 A;  3U21 A;  5M5W J;  2MGQ A;  2ZB9 A;  1PVE A;  3J7A O;  4LFU A;  3IAM 2;  2DFI A;  2LFB A;  2DQR A;  4S05 A;  5E3L A;  1D5V A;  1MJB A;  3K2A A;  3KP2 A;  3LQR A;  2YS9 A;  5EZH A;  1FBS A;  4GRI A;  5FKN A;  2P0W A;  4A3I J;  4EJV A;  2VOP A;  3BG7 A;  3I54 A;  2IGO A;  1G59 A;  1P92 A;  1Z6T A;  1SAX A;  3HOS A;  4BJ5 C;  3KP3 A;  4PGG A;  4CA0 A;  2KIS A;  1BOB A;  1S5L C;  2VKE A;  1JGG A;  1U8R A;  2EFP A;  3ZOB A;  3FBI B;  4BE1 A;  1HCR A;  3M3Y J;  3QU6 A;  5DTD A;  2L9N A;  3GEZ A;  4J01 A;  4IOA F;  4E7J A;  3K4J A;  3WGG A;  3WTV C;  1EH8 A;  2ETH A;  2GXG A;  3GF2 A;  1R7J A;  1VQO I;  4XL9 A;  2M0C A;  4CO8 A;  2WAQ A;  2HOA A;  3F8N A;  4UUT A;  1B1B A;  2BYV E;  3GZ5 A;  4Q4Z F;  4IO9 F;  1BN5 A;  1B8I A;  5A2Q Z;  3M4O J;  4D5F A;  5CVR A;  5CQE A;  5FB2 A;  4M9Z A;  3OR1 C;  2E35 A;  4M9X A;  5JHU A;  5B1A H;  1WVR A;  2N8G A;  1JKP C;  2VJI A;  3ABT A;  2GOX B;  1F36 A;  1MD0 A;  2KRH A;  3KX2 A;  3MEX A;  1BA5 A;  3ABU A;  3LOC A;  4FET A;  3HGG A;  2F48 A;  3CF2 A;  4PZJ A;  3GO5 A;  1MBF A;  3X2Q H;  3L2Q A;  2ELH A;  1WJA A;  2KDZ A;  2VQG A;  1MND A;  4J19 A;  3HHG A;  3WTS C;  1W1W E;  2KRC A;  4Q48 A;  3S32 A;  1GXQ A;  3S3N A;  2JA8 J;  2NVU B;  3I4N J;  5GAE J;  1QHH D;  6PAX A;  2A05 A;  3AL0 B;  1VZ0 A;  2VQL A;  3ZQQ A;  4E7L A;  3PFI A;  2XPU A;  5IP6 A;  2DK5 A;  4A3K J;  1TWC J;  3PM1 A;  2K3F A;  4MQV A;  1VQP I;  1HW5 A;  1RC9 A;  2H6B A;  3GLL A;  3RCO A;  1X2N A;  3DLA A;  3CTA A;  1XX5 A;  5D6F A;  3K6G A;  1RKW A;  1U8B A;  2VT2 A;  3O6B B;  4GO1 A;  4UVC A;  3A02 A;  1FOX A;  5L3E A;  1ZTR A;  2VPR A;  4UHT A;  3W6J B;  3GX4 X;  4IHT A;  4A3C J;  4IOC F;  1LDJ A;  2F5C A;  3UR3 C;  4E7Z A;  4TV7 A;  3MZH A;  2R5Z B;  1HKT A;  4FHT A;  4NC8 A;  2O0Y A;  1ORK A;  1T0F C;  2DLL A;  2MYS A;  2EB7 A;  1FLI A;  1R00 A;  2F5F A;  4WX9 A;  3OYM A;  5IYD J;  2VN2 A;  4U87 A;  4R1H A;  2OJE D;  2GIV A;  3DTE A;  5IP9 J;  2FX0 A;  3FIW A;  3F23 A;  1Z21 A;  1SMY F;  2FEZ A;  5DDG A;  1ZK8 A;  1YJN I;  2GA1 A;  3GBG A;  4UUV A;  2WWY A;  2OA4 A;  5DCM B;  1OMI A;  2DXI A;  4BDZ A;  2OF7 A;  5D4S A;  3VYS B;  2FA5 A;  4C30 A;  1DDN A;  1TW3 A;  2MG4 A;  2ESN A;  2PLY A;  2B63 J;  1OFC X;  3HTU A;  1OCO H;  1JT6 A;  3CJQ B;  2MLK A;  3C3W A;  2KZV A;  1KQ0 A;  1BR2 A;  1NTC A;  4Y3O A;  1DUX C;  2XRL A;  2MFZ A;  2FJ1 A;  2QCO A;  3BPX A;  1P7J A;  3C7J A;  3R0J A;  4XLF A;  5ICE A;  3DPU A;  3OYE A;  5IOY A;  2OZU A;  4BL0 B;  3DWL E;  2O7O A;  3QOE A;  3K4M A;  1RZ4 A;  3C1D A;  3K9T A;  3WGH A;  2COM A;  4KN4 X;  2E2J J;  2CWE A;  4PFO A;  3HSF A;  2XIG A;  3TQN A;  3FMQ A;  5DEQ A;  2DMU A;  3SFZ A;  1U78 A;  2DI3 A;  3AL0 C;  3HOY J;  4EJW A;  1U9O A;  1TNT A;  4PUS A;  4V2F A;  3WTT C;  3OYH A;  3NEU A;  1BJA A;  1B8I B;  1MBG A;  1VQ5 I;  5L3D A;  4G6Q A;  3E5Q A;  4AU7 A;  3ZN0 A;  1TQI A;  2VKH A;  4MGR A;  1AU7 A;  5HNF A;  4MNU A;  5FLM J;  2NNY A;  2OUM A;  4ESB A;  2V7F A;  3S1R J;  3F8M A;  1SVO A;  2F4M B;  1XGM A;  3GCM A;  1JUS A;  3AG2 H;  3GFL A;  1GDT A;  1P4A A;  4NDL A;  3OL4 A;  4HNU A;  3EUK L;  2IEK A;  4RBO A;  3HBL A;  4ON0 A;  4MTE A;  3T0Y A;  1UMQ A;  5C4X J;  1QQI A;  3D5L A;  1I6H J;  4A6E A;  4MEY F;  3BTJ A;  1ODD A;  4L9J A;  3VPR A;  1XCV A;  1VND A;  1WH5 A;  3QWL A;  1N25 A;  2VLA A;  2IAI A;  3I64 A;  2ZXI A;  2CW0 F;  4EGY A;  1OYY A;  3F6O A;  3WGI A;  2KFD A;  2ELK A;  4G7Z F;  2LD5 A;  2EFN A;  5EG0 A;  1KON A;  3HL2 A;  5CLS A;  2HI3 A;  3RYP A;  2OC6 A;  1UG0 A;  4CYC B;  5IP7 J;  3KEQ A;  2MW8 A;  2ID3 A;  1SVM A;  5F6F A;  2CQQ A;  4E6K G;  1SFK A;  3G6E I;  1U5T C;  1Z3Y A;  2A61 A;  3MKW B;  2UZK A;  1UFM A;  1B4A A;  3OSF A;  5D8K B;  3I59 B;  3V42 A;  3PO2 J;  3S16 J;  3H0G J;  4NQW A;  2HVR A;  2O8X A;  5BS6 A;  2D45 A;  3HXL A;  4BY7 J;  1IXC A;  3IH2 A;  1V5G A;  2JSP A;  1LE8 A;  5DV5 A;  1FOK A;  5JVT A;  3GUD A;  2P7C B;  1MH4 A;  3FXM A;  5FKM A;  1MMD A;  4A69 C;  5J4V A;  3BR1 A;  4XNF A;  4ZZD A;  2HEO A;  3S1N J;  4U7D A;  2VBX A;  2ZXJ A;  2V6E A;  4V19 K;  4QPO A;  2JVG A;  3KFW X;  5KK1 A;  3A0B C;  3OIO A;  1MZB A;  2HWV A;  3HKZ N;  1Y8Q B;  5C4J J;  1L3L A;  2H94 A;  4OU0 A;  3LQQ A;  1W5S A;  1EH7 A;  4F55 A;  2CQN A;  1QVU A;  2LR8 A;  2O3F A;  2XSJ C;  2ECB A;  3C2G A;  5J8F A;  4HQM A;  4AYB A;  4XRF A;  4EM1 A;  1PP8 F;  2OQR A;  2ICW G;  1R23 A;  3M8E A;  1BI3 A;  1QPI A;  4M72 A;  3MKY B;  1CF7 B;  4M74 A;  2GIZ A;  5AIQ A;  4F91 B;  1UJ8 A;  1SVL A;  3JW4 A;  4YIR X;  3AG4 H;  3CDH A;  1HC8 A;  2QUF A;  1FZP B;  2ZSH B;  3BZK A;  3ZMZ A;  5IYC J;  2XGE A;  4ENJ A;  2IT0 A;  3CCU I;  3I53 A;  2ZSI B;  2ZJP F;  4JP0 A;  1AKH B;  2LK2 A;  1IN5 A;  3HRT A;  2EV0 A;  2VOD A;  3WG9 A;  3CCY A;  2G7H A;  2Z3Y A;  1S7E A;  2R5Z A;  3PSI A;  1FOY A;  3VYU B;  1RNL A;  3ISP A;  2AO9 A;  1BI1 A;  1W7P B;  3QU3 A;  2VXZ A;  3U9G A;  2PN6 A;  1E0E A;  1OCC H;  2AQF A;  2F4O B;  2QEN A;  3O2P E;  1LB2 A;  3HDD A;  1LE8 B;  2BY0 A;  3EET A;  1KQ8 A;  2W82 A;  3IP4 B;  2OTL I;  3MKZ A;  2QQB A;  1MNE A;  1U2W A;  4CH7 A;  3OYC A;  4LGW A;  1Y39 A;  1ETX A;  1K83 J;  2P5V A;  3M07 A;  3JRG A;  5HDG A;  4XOT A;  1TP4 A;  2CW8 A;  2GA2 A;  2K9L A;  3FXO A;  4WWC A;  4I7H A;  4BNC A;  3RIR A;  1FTZ A;  3EUH C;  1ETK A;  2A3S A;  2C6Y A;  1XB4 A;  3E6B A;  2VAS A;  3CDI A;  2DJI A;  3AG1 H;  3VYT B;  2P7V B;  3KEY A;  3DKY A;  4D7N A;  2R7Q A;  3ZXS A;  2LF8 A;  4HF0 A;  2R92 J;  3IV5 A;  4XMY A;  3CUO A;  4YG2 F;  3JAM Z;  3PQK A;  2H1K A;  2TRT A;  5M5Y J;  1G2H A;  1YS6 A;  4DYR A;  4ZYG A;  1OCP A;  4QWQ A;  4WCG A;  2QQ8 A;  2LBF B;  4HNT A;  1ERD A;  3GYH X;  4ZYD A;  2ZME A;  2FD5 A;  2XVC A;  3LA7 A;  2WY8 Q;  1YFH A;  5HOO A;  5E1Z B;  2HVS A;  4W97 A;  4ZH4 F;  4R79 A;  1D5Y A;  2F4I A;  2ZO4 A;  5C3E J;  3ABM H;  3TO9 A;  1OCZ H;  1U9N A;  3N05 A;  3PQJ A;  1U3E M;  2Y0S A;  2HZT A;  4YII A;  1IO2 A;  1KU3 A;  1YLF A;  3A1Y A;  3CJN A;  2WAD A;  1K6Y A;  1WWX A;  2DFF A;  1IRZ A;  4HA8 A;  3M9A A;  2EWN A;  3PL8 A;  4CCO A;  5E18 F;  1G3Y A;  4LD5 A;  5E8G A;  1BW6 A;  3BY6 A;  1N75 A;  3EYY A;  4L5E A;  3G1M A;  3J7Y J;  3FM3 A;  3WU2 C;  2BOL A;  1NH3 A;  1PUE E;  2CV1 A;  3HOV J;  4HST A;  3E3V A;  3IL2 A;  4I99 C;  1DP7 P;  5FRN A;  4HYE A;  4LB5 A;  4KUM A;  2VKD A;  3RKX A;  2OCE A;  3TO6 A;  4X1E A;  1MW7 A;  2P5K A;  4LMY A;  2R0Q C;  1R5G A;  4U0Y A;  2BV6 A;  3CMM A;  2OU2 A;  2L02 A;  3SZG A;  3GFM A;  1KYW A;  3CD6 I;  5K7Z A;  5FKK A;  3I59 A;  4GYG A;  2ZXW H;  3VOE A;  4OMZ A;  1HOM A;  3F22 A;  2ISZ A;  3I71 A;  3HGY A;  3MWM A;  3RQI A;  1LVA A;  2WAF A;  1ZRE A;  3MKL A;  1Z3X A;  3ZQL A;  4CSW A;  3BZ6 A;  1WFX A;  3WTZ A;  3UKG A;  3HPH A;  1ZR2 A;  1W7P A;  2HXO A;  2YU9 J;  4HX8 A;  1R1U A;  3P9K A;  3TED A;  5F0H A;  3CMA I;  1GV2 A;  4BAY A;  4OMY A;  2M34 A;  3SFI A;  3MFK A;  1W5C C;  3F0C A;  1I1S A;  4ZYE A;  4DZP A;  4LLG F;  4C2T A;  3GME A;  2V9V A;  2KRF A;  1FJL A;  1MSE C;  1D1A A;  3L9F A;  4KIG A;  4WK8 F;  1IN8 A;  3CCR I;  3WOD F;  1LFU P;  3CMY A;  1CF7 A;  2CRG A;  4D7M A;  3DV8 A;  4A3L J;  1IW7 F;  3MCZ A;  1T8I A;  1A6Q A;  2PMZ N;  2FUG 2;  3BR2 A;  4ETS A;  2HQN A;  1XGS A;  1OPC A;  3J80 K;  2KIM A;  3BLY A;  3S2W A;  4B48 A;  1AA7 A;  1MBH A;  2I10 A;  2PX9 A;  1Y1V J;  4XLE A;  5K5Q A;  3GW2 A;  2L3D A;  3JSO A;  2EIJ H;  2WAQ N;  1I6X A;  2Q8K A;  1WSU A;  2STW A;  1T08 B;  1XMA A;  1NG6 A;  3KP5 A;  4KMF A;  1Z67 A;  5J47 A;  2E5N A;  3HM5 A;  3HHH A;  2DOD A;  5DUI A;  2LY1 A;  2CUE A;  4XLP F;  3DLL F;  1FYL A;  2DA6 A;  2K9M A;  1OJL A;  1V55 H;  2BXZ A;  1ZGJ A;  4KIC A;  1P7I A;  2IVM A;  3GTJ J;  2PI0 A;  2PG4 A;  1R9T J;  3LNQ A;  4FE4 A;  2JUG A;  4IL6 C;  1RES A;  1S6L A;  4PSX A;  4LK1 F;  3Q5F A;  2DYS H;  4XM3 A;  1X3Z B;  3DU5 A;  1XSD A;  1RKT A;  4HLX A;  2PEX A;  5FGM A;  3GTQ J;  4RDU A;  2KLO A;  5KCM A;  3HRS A;  4RMN A;  1UST A;  3TP0 A;  3CLO A;  1QVT A;  2HKX A;  4XON A;  3L2V A;  4PJN A;  4HRI A;  1WKM A;  5HS9 A;  1VQ9 I;  3BG3 A;  2LDU A;  3OL3 A;  1W36 D;  2A69 F;  2RC4 A;  3FXJ A;  1IUF A;  1Y56 A;  4HX4 A;  5EF6 A;  2HOT A;  2O5R A;  2VPL A;  3RYR A;  4KIB A;  3OYK A;  3WTW C;  3LA2 A;  2ACJ A;  3I4P A;  1ITY A;  3F8B A;  1KA8 A;  2PJR B;  3T8T A;  4HW0 A;  4CCK A;  3CUQ A;  4BBS J;  1ONV A;  4HV5 A;  4UV8 A;  2WAE A;  1IDZ A;  2PMH A;  3ASN H;  3QPL A;  3D5R C;  5D5W B;  2RDP A;  4KJZ A;  2IXS A;  2XAU A;  2K9Q A;  2K85 A;  1MMN A;  2DAO A;  5TIS C;  2ZCW A;  5CYV A;  2BGC A;  2QKM B;  4HDU A;  1MMA A;  3TOA A;  4BQQ A;  4KNY A;  1TC3 C;  2P6T A;  5ERI A;  4ENM A;  2IP2 A;  2J5O A;  2HGC A;  4ZTF A;  2V1U A;  1V3F A;  3BTC A;  2QGU A;  3D0S A; 
#chains in the Genus database with same CATH homology
 2E36 A;  2OTJ I;  1ACI A;  1YJN I;  5GAH J;  1VQK I;  3CCV I;  1YJW I;  3CC7 I;  3CJT B;  3CC2 I;  1VQM I;  1VQO I;  5GAD J;  1YI2 I;  2ZJQ F;  3CCJ I;  1YIT I;  1S72 I;  1VQ9 I;  1YIJ I;  4UY8 I;  3CCS I;  1VQ8 I;  5GAE J;  4V19 K;  2H8W A;  4IOC F;  3CCM I;  2E34 A;  3CMA I;  3CF5 F;  5JVG F;  3CC4 I;  4IO9 F;  3I56 I;  1FOX A;  3PIP F;  3PIO F;  2JQ7 A;  3CCE I;  3G6E I;  2OTL I;  1VQ6 I;  5DM6 F;  1HC8 A;  3G4S I;  1YHQ I;  1VQ5 I;  3CD6 I;  2E35 A;  1Y39 A;  1FOW A;  2K3F A;  1QA6 A;  2QEX I;  3G71 I;  3CCU I;  1VQP I;  3I55 I;  2ZJR F;  3CCL I;  1VQ7 I;  5GAG J;  2ZJP F;  3CCR I;  3CCQ I;  2NXN B;  1VQ4 I;  3J7Y J;  2QA4 I;  3CME I;  3J7Z I;  5DM7 F;  1VQL I;  1MMS A;  4IOA F;  2FOW A;  1VQN I;  3DLL F;  1FOY A;  1YJ9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...