1YITI

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yitI00
3CCSI 2H8WA 3J7YJ 2E34A 1YITI 1VQ7I 1YJ9I 1VQ6I 5JVGF 1VQ4I 2E36A 1VQLI 2OTLI 3CD6I 4IO9F 1YIJI 2ZJQF 3CF5F 1VQOI 3I56I 3CCEI 2ZJPF 1S72I 3CMAI 2NXNB 1VQ5I 1MMSA 3DLLF 5DM7F 3CJTB 5GAHJ 2OTJI 1YI2I 4IOCF 3CC4I 2E35A 3J7ZI 3PIOF 2K3FA 1FOYA 5DM6F 3CCUI 1FOWA 4UY8I 3CC7I 1VQNI 3CCRI 1VQPI 3CCVI 1VQ9I 3CC2I 2ZJRF 1ACIA 5GAGJ 5GADJ 4V19K 3G6EI 1FOXA 1YJNI 2QA4I 3CCQI 1VQMI 1YJWI 3PIPF 2QEXI 3CCLI 3CCJI 3I55I 1VQKI 3CMEI 3G4SI 1Y39A 2FOWA 1YHQI 1VQ8I 1HC8A 1QA6A 5GAEJ 4IOAF 3CCMI 2JQ7A 3G71I
chains in the Genus database with same CATH superfamily
2VOOA 3A4CA 3TMOA 4M6XA 2ME0A 5EJCA 3H9QA 2O0YA 2NOJB 3C2GA 4E70A 2OV7A 1WJ5A 2L7FP 4RGUA 3RKWA 1HKQA 3QPTA 5LEJA 3PQJA 3GTGJ 2HYFA 2CU7A 1WJDA 1X58A 2Y48A 2JN6A 2FE3A 3DKWA 5IT3A 3I59A 2HI3A 3K4BA 5DS9A 1X4PA 2GZWA 1Y8QB 3T1BA 2LREA 2JA7J 4BJ5C 2O3FA 3BG7A 1LDJA 2A6HF 4P5OA 3E6MA 2EZHA 2HGCA 2LDUA 2JA8J 2A6TA 4MO7A 3FK6A 2LKSA 3DBHB 5E20A 3QPHA 3J7AY 2OJED 2YSRA 4E7IA 1U6GA 2QQ9A 3W6KB 2LRDA 4I6ZA 3FIWA 3E5QA 3JCUC 1VF9A 3MZ8A 2O03A 2H09A 4M71A 3QOPA 2RGVA 4XLHA 4A2UA 2UZKA 2OTJI 1TWCJ 4MQ9F 4XONA 3RKXA 1IV8A 1QQIA 4O3MA 1K6OA 3PUBA 3ZQCA 3H1CA 4EM0B 1WCMJ 3HKZN 1E17A 3VYSB 4LB5A 3WE3A 1ODDA 1P7JA 4MFDA 2NVQJ 5EF6A 1DP7P 2ID3A 1WZ2A 2KIUA 2MBFA 1IAWA 2HR3A 3I4PA 3HUGB 4Q47A 4UY8I 1W7PB 2CUZA 2ID6A 3VB2A 3GTOJ 2A05A 1X3ZB 4AYBN 3FHNA 3I5UA 2LYCA 5EGOA 1MDMB 4BKXA 3EYIA 1ZGAA 4UUTA 3G3ZA 3K4LA 2VQLA 3WG9A 1AOYA 3QWLA 4UV8A 2K9NA 1HDPA 3LSHA 2IVMA 3KCCA 1NG6A 2L7ZA 4ZYAA 1KU7A 2ZXWH 3CMMA 2ME6A 5J6XA 3DEWA 3IRQA 4M74A 1ETQA 2XSJC 2LH9A 2KQRA 3KYLA 2ZNYA 1BA5A 3OV8A 3OYHA 3BCBA 1FZPB 3W2VA 3ECOA 5C3EJ 3TEDA 2QBYB 3IC7A 4UUSA 1YE9A 5KHDA 1USSA 3W3CA 4II2A 2DOEA 3L00A 4JX6A 4ABZA 1AWCA 4CCLA 3KP6A 4G6TB 2KFDA 2ZXHA 2W7NA 3D5RC 3DPTA 1G3WA 2YUSA 3GW2A 1T0FC 1JKQC 2LFBA 3L2CA 4JQFA 2EQRA 5FKMA 3DQVC 5KK1A 1BI2A 2LY2A 3O8HA 1MJ9A 2VE9A 4AWXB 2N8GA 1MBJA 4BXXJ 3LAJA 1IN6A 2A3SA 2EPFA 3CD6I 3L2WA 4U87A 3W2AA 1ZH5A 4PGGA 3AL0B 2ZXJA 4EJTA 2L02A 1BJAA 1RI7A 3KETA 3Q5FA 1Y0NA 3KYCB 4PGHA 9ANTA 5EG0A 1GV5A 1R5ID 3ABTA 2ZJPF 4PFOA 1V5FA 1WJAA 3Q0VA 5DUIA 1FMWA 3HG9A 4Y52J 1MGTA 4PJJA 3L2QA 3M7GA 3FISA 4HLXA 3RPQA 1TNSA 3VSKA 5H2FC 4EGZA 1U5TA 4JOMA 3OMYA 2BY1A 2FSWA 5LRRA 2HXOA 4LD5A 1OCZH 5E1XA 1HDDC 1I27A 2F4MB 1I1SA 3FHZA 3S2WA 1BR1A 4G6DA 1UHWA 2O7OA 2HYJA 4HNUA 2O6GE 4B3AA 1YX5A 3ELKA 4Y33A 4IF4A 2H6CA 1I3QJ 1E0EA 2V6CA 2NYXA 2K9LA 4XKBA 5ILVA 2KIQA 3TKYA 5D5VB 1JXSA 5B66C 3K4CA 1T95A 2VI6A 3DLAA 4LG0B 3G73A 5HLHA 2EA2A 1JKPC 3SZPA 3IH4A 1VQ9I 2DFFA 2LK2A 3BY6A 4YRVA 3OSGA 1QO0D 4L0ZB 2G7UA 2HYGD 2OCEA 1OPCA 2K9MA 4FE4A 2VKDA 5H20A 1K79A 4XRMA 5CYVA 2FMYA 1UFMA 2NS0A 4RAGA 3WGGA 4O6JA 2X6YA 3BTJA 1KYWA 1BM9A 3IV5A 2E7WA 2G7HA 5CQEA 5L3BA 3ZQIA 3PIPF 3TW6A 2X9DA 3FKIJ 5ICGA 5EYRA 1LPQA 1ZLKA 1PUFB 2VL8A 3CLQA 2PEXA 3JRFA 2X4HA 4DGWB 4XRSG 4EMSA 4BHCA 2JQ7A 2PQ8A 3SQNA 1TL8A 1ETKA 4IHTA 5BPIA 5CLSA 4HBLA 4ZTJA 4L9NA 1T56A 5A2QZ 2CRGA 3FXKA 3U9GA 3D0SA 3TQNA 3JSPA 3CO7C 3FM5A 2Q1ZB 4KYWA 2RREA 3K2ZA 4ZDLA 4N9IA 5M5YJ 2IGKA 2WAEA 3QU6A 4KICA 4DJAA 2FUG2 3HRUA 4NC6A 4UV9A 2V9PA 4IPAA 5AIPA 5TISC 3K1NA 4XIDA 2XAFA 1OCOH 1R5HA 2X1EA 3AFHA 2DXIA 1RESA 4G7OF 3JRHA 4M3DA 5J3LA 1YFHA 3ZQFA 5FJ8J 2W82A 3SZGA 3ROUA 5F0HA 1MNEA 4I0AA 4KFCA 4MTEA 2NS8A 1LEAA 2COBA 2LOOA 3WU2C 5ILUA 3HHGA 3OYJA 2KMUA 3M1CA 2WBMA 1WI3A 2K7LA 1A6IA 2AXTC 3EDPA 4NNJA 1Q1HA 1BR2A 2VQGA 3AG3H 3PUFA 5GAHJ 4NC8A 4XKCA 4M3FA 3J81K 2HKXA 5M3FJ 4H0EA 1BC8C 2E35A 3GBGA 2CUFA 3RQIA 2OF7A 4E7JA 3L2RA 1EKEA 2CH0A 2KT0A 2M8EA 2RAEA 2IS6A 2HOTA 1R5GA 5DD8A 1FEXA 1WH5A 1T33A 1FBUA 2EFQA 5EZGA 4D1QA 3G2BA 3F6VA 1LKXA 2CW0F 3LSMA 4M9SA 3G1LA 5JLXA 1BI0A 3FF5A 2VQCA 4LLLA 3JSOA 2R5ZB 1MH4A 2HDWA 1S9HA 5LEKA 1K78B 2AHQA 2XAHA 3OIOA 4PSWA 3IKTA 4D5CA 1Y6IA 4OIOF 2DFEA 1QU3A 2EIJH 3WU0A 3FX3A 3KZYA 1SAXA 3WTSC 2ZKZA 4X0GA 2FBKA 4Y7NJ 2R3SA 5GP9A 1R58A 1XDSA 1Z6TA 2ELHA 3LA7A 4LMYA 2MC3A 3DKXA 1LEBA 5HDKA 5EEAA 2MLGA 4CGZA 2KHMA 3H0GJ 2QEXI 3ESWB 2DTRA 2X51A 2XDVA 3ZCOA 1T8IA 1WHUA 2DOFA 2HZTA 1B9NA 4DZPA 4CICA 2D2WA 3E6BA 1QA6A 4BXUA 3CZ6A 2CWEA 1RR8C 3L9FA 1HLVA 4PZJA 3P9KA 4IRHA 1S29A 3DFGA 5FD5A 2HPMA 4RM2A 3DU6A 3U2RA 4D9JA 2YU9J 3K4MA 1HCRA 2VC0A 3FXOA 1Z21A 4D0PA 1D5VA 2CQKA 2K02A 2E60A 1UJ8A 2GOXB 2CO5A 4U88A 2PJRB 3QU3A 4OIPF 3PSFA 1YRNB 3H35A 4RGRA 1IXSB 2DI3A 2E1MC 3MMYB 3E3VA 5DCMA 1I3AA 2A68F 1WRJA 3WU1B 2R0QC 2L54A 1HBXG 4I09A 3M9AA 5HLTA 3QPLA 3EQLF 2K3PA 1UG2A 3CLOA 1DUXC 4UB6C 4Q4ZF 1XSDA 5HS7A 5ICFA 2ACJA 3QP6A 4AIDA 4ZZDA 4XRFA 1R7JA 4NHJA 5BOXA 3M8FA 2E5NA 2BY2A 2NXNB 5C4JJ 3O2PE 1P6RA 1ZKGA 2L3DA 2L4MA 3J80K 3DBLB 4EJUA 3BT9A 4EM2A 5FB2A 2Z5UA 4CA0A 2DMUA 4IOCF 4HV6A 2JT1A 1HW1A 1TT5B 1AA7A 2KPMA 4I99C 2DMQA 2L7KA 3JR9A 1WSUA 1KQ0A 2Y2ZA 4Y15A 1G59A 4B3XA 2A61A 1EJ9A 4KDPA 4ZYEA 1MMAA 1R23A 3CUQC 4HEA2 1ZTRA 1WJFA 2V1DA 4XNFA 2JMWA 1TWFJ 4DQ2A 3L7WA 2AS5F 2IRFG 3QYBA 3C2BA 2FQ3A 5K7HA 3S1NJ 1J2XA 2K9QA 3AG2H 3WODF 4KT5C 4GRIA 1MMNA 4GXOA 3ZN1A 3WTZA 4CO8A 5FGMA 3RCOA 1P92A 2V6EA 2DT6A 3RJPA 4P96A 1Z1DA 2W57A 4I98B 4C2UA 1FOKA 1A6QA 2B7EA 2EH3A 2HOAA 3WTXC 4ENJA 1Y0UA 4V19K 4XLPF 1S7EA 2ZFUA 4B09A 2ZMEA 1OJLA 4NB5A 2FA5A 1NK2P 3I58A 4UVAA 3HOWJ 2B63J 4ESFA 1O3QA 5J4YA 1X19A 2HEOA 3ZQLA 5JI6A 4RB3C 2DDAA 2L7MP 2Y30A 1RRJA 3KEOA 1QZEA 3BTLA 3G4SI 3M3YJ 2IAIA 2OAZA 5BS6A 1LJ9A 3H5NA 2DA1A 2BY0A 1OMIA 1SD6A 2A5WA 2KISA 1EA3A 1LE8A 4Y4RA 4BE2A 2WY8Q 1RUNA 4DW6A 3GZ6A 1KQ9A 1OR7C 1VNDA 1YW7A 1HXDA 3DEUA 5IOYA 2ZJ2A 4Y13A 3VFZA 3PFYA 2XPVA 2F5CA 2ZB9A 2W1OA 4HG2A 5E3NA 4IZZA 1KZHA 5FKLA 1W36D 2JSCA 1I39A 4RAFA 1BI1A 4QPQA 1QZZA 4A3LJ 2R7QA 4EGYA 3RKQA 1ETYA 2Y9YA 2RKHA 3A02A 4IO9F 2FBIA 3MKYB 2VPLA 1SD5A 2IS1A 2BGCA 2RC4A 2Q8KA 4EJOA 2W85A 3COAC 2W00A 2IT0A 3VDXA 3FKJA 2M45A 3PNYA 4BNCA 3ZQHA 2P8TA 3W6JB 3CCEI 1IRGA 4HZFA 4CYCB 5E3MA 2OC6A 4UHTA 4DNCA 4OAYA 1S6LA 2CV1A 2VBXA 3F9KA 1HF0A 2W48A 1QZYA 4XN3A 2DT5A 2GAUA 3VYUB 1YI2I 3S1QJ 2EBIA 3R4KA 3M8EA 2I10A 4BE1A 4XM3A 3I9V2 4OWRB 1ETWA 3BZKA 1WI9A 3F72A 3IAS2 3CQZJ 3BJ6A 2VODA 3Q0UA 1JUSA 2BEOA 1TNTA 2F5FA 2HOEA 3FM3A 4PJ0C 4AIHA 3DWLE 3OYCA 3RZDJ 3MCZA 4XSZF 2P7CB 3EETA 5E8GA 1DGWY 2M30A 3BG3A 4F91B 5E1WA 4S04A 4YIRX 3CDLA 1V5GA 4BJTA 3H5AA 3GWZA 4PJNA 1JKOC 1MW7A 1W36C 1CGPA 4QLCU 3HSEA 5GADJ 3MQ0A 4ZTFA 1FSHA 3ONQA 4ANJA 2BW3A 5GTIC 3KPHA 2UXXA 3FBNB 3WTTC 1DQUA 1YLFA 2MC4A 4EJVA 3OR2C 4L9JA 2XIGA 4M6YA 4M3BA 4C3HJ 2YU3A 4OMYA 3SXYA 1QVTA 4CUGA 2BOLA 2EIMH 1USTA 4B4CA 3PQKA 2VLAA 5IT9Z 1Y39A 1FP2A 5D4RA 2IP2A 4XKWA 4PUSA 1QPIA 3F8MA 4YFKF 1HC8A 4A3BJ 1D1CA 2FJ1A 2W24A 3CP2A 4C9YA 1BR4A 2LNBA 3E97A 1J7KA 3EUAA 1U8BA 3S2HJ 4A3CJ 1UG0A 4JX5A 1O4XA 1BW5A 5B1BH 1SFUA 3KEYA 4AUXA 4A3KJ 5DEQA 3K4JA 3TO7A 4CZZA 2COMA 1HKSA 1G6NA 1VQ7I 3ECHA 3S16J 4FCYA 3RYRA 5J4VA 1GUUA 2VXZA 3R0AA 4LK0F 4A6DA 4ON0A 4LG3A 3ZMDA 3RPUD 5E8IA 1RPWA 2M9HA 3GFMA 3NAUA 3NRVA 4A69C 2L9VA 5FLMJ 1MNMC 4IQJA 2E1CA 2CQXA 1H8AC 5EDNA 2LY1A 3S3NA 1FX7A 2VBZA 2LP0A 4BUPA 4HLYA 3HYIA 5JR3A 2OZ6A 2V4JC 3L2UA 2RV8A 1Z7LA 2MD5A 4IHXA 5KAFC 1JJ8C 1R1UA 1QPMA 1POGA 4BY7J 4B1RA 4NBQA 4HDUA 3M1EA 3IWFA 1N75A 3I59B 3DLLF 4LJZF 2NRAC 4GFBA 1H88C 1W0TA 4HSRA 5J40A 1JE8A 2LVSA 2FOKA 2I8DA 3DV8A 1DDNA 4HF1A 3CDHA 5C44J 3DCFA 3TBIA 4ENNA 3FMQA 3IHUA 2BBYA 2RQPA 2NVUB 1GVDA 4LK1F 4QTRA 3D5SC 2XF7A 2TCTA 3TDZC 1FOYA 4BBRJ 3OYKA 4FETA 1APLC 1CF7A 4KN4X 2EFOA 4MFEA 5K5RA 3CCUI 4XN0A 2IA1A 1UB9A 3OS2A 3N4MA 1FOWA 3OYAA 4GO1A 1W7PD 3CCYA 2VJJA 2MLKA 3ASNH 3JRGA 2AQFA 4XICA 2JVHA 3VEPA 1ENHA 3A01A 4G7ZF 5H6QA 1TW2A 2EWNA 2J5OA 2VJIA 3H3UA 4I76A 3EPZA 3A2KA 4QWQA 1GT0C 2HQ5A 2IGOA 4IEJA 2JRTA 1VQMI 3GCMA 4MGRA 2XAUA 2CV2A 2CQ7A 2R7ZJ 5D6FA 3PL8A 2JJ7A 3GEZA 4CDGA 1G3YA 3CCJI 1FP1D 3QYEA 5IPAA 1W0UA 2KZGA 3FMRA 5IOZA 1XSVA 1YHQI 2CUEA 2XRNA 4YEJA 4WF2A 1ZLJA 3PO2J 4UVCA 1BN5A 2ESHA 5FFXA 3FXQA 3JRIA 1DGRM 2IW5A 4FX4A 3DKYA 1JJ6C 4A3GJ 2JA5J 4E4HA 3V7CA 4BGDA 2EJRA 5DV5A 1KU2A 4RAYA 2AQEA 1FBQA 2YX7A 5GPAA 2L0KA 1MJBA 4G9YA 3HEFA 4WK8F 3BDDA 3QP5A 3GO5A 3K0LA 1Z7UA 3F3XA 1UHSA 4JP0A 3U1DA 1TQMA 1XX5A 3K9TA 4LB6B 3AKZA 2E2JJ 2OTLI 4JX4A 3TDUC 1W4MA 4WXHA 2A5YB 5BMZA 2WC2A 1TBXA 3LFKA 3VYRB 4RAZA 1F4KA 2Z33A 1E2XA 3ZN0A 3OYGA 1T0FA 4ITVA 3S8PA 4XLNF 1ON1A 1GVJA 2JA2A 2P5VA 2ZXIA 3GXOA 4EM1A 5IP6A 5K7ZA 3BPVA 2PJPA 2DA7A 3DBRB 2HOSA 1IW7F 2VJ4A 4J00A 1U9NA 1ETVA 1YW8A 4XLFA 3ZMUA 2QSGX 1YG2A 1XDUA 3BZ6A 4HW0A 4BDZA 4I02A 2HNHA 1AU7A 2V1UA 1G2HA 2DMNA 1R6RA 4KMFA 1RKTA 2YX4A 4A3JJ 2UUZA 3I54A 2HQAA 2EV5A 2OZUA 5EG0B 2BVLA 1PJRA 4OMZA 3FK7A 3KP5A 3K7AJ 1QBJA 2YS9A 4OAZA 2WB1A 3BZCA 3SEZA 4EV0A 4TV7A 2K85A 4JBAA 4B47A 1U5TB 3ULQB 4BY1J 3H92A 5BPDA 3BTCA 4RGXA 3NWTA 1DPRA 1FT9A 3C18A 1U8RA 1GXPA 1FJLA 1V55H 2JSPA 1MSFC 4DBRA 1J59A 2VIXA 3HOSA 4CCOA 2XPWA 3K4KA 3FZVA 4Z2YA 2DA4A 1VQPI 2FQ4A 2ADUA 2ECBA 2EZKA 3LSTA 4YELA 2P5LC 3HTUA 2PLYA 1ACIA 3DPLC 2EK5A 1PP7U 2HDDA 3GYHX 4Q5SF 1SANA 1X4OA 3HRTA 1IRXA 2DPUA 1Z9CA 2P6SA 3HRSA 3HXLA 3FMSA 4RMNA 2A07F 2ZFWA 3AL0C 1FIPA 2BY3A 2KIMA 4XR6A 3LSRA 3U1KA 1QHHD 3CCLI 1SMTA 4IHYA 2ELKA 3H3ZA 4HYEA 1ITYA 2B9SA 1WPKA 2BYVE 1G3TA 2IS2A 4M9XA 1W1WE 3SFIA 3C7JA 3F21A 4N4OB 4IX7A 2KRHA 5F08A 2KRCA 3PJRA 3HM5A 3M4OJ 1Q1VA 4UNOA 1K83J 3E5XA 3HJEA 4F92B 2GLOA 3GZNB 2RNJA 2Z3YA 4QSHA 5F1JA 2H8WA 5KVRA 4G6QA 4AM3A 2VOPA 1ZR4A 3ZP5A 2Z99A 2CFXA 1YITI 2UV1A 1YJ9I 4FISA 3GTKJ 1VQ6I 4NQWA 1JTYA 2CW8A 1JTXA 5ERIA 3WE2A 3K1PA 5FRNA 3EUHA 1XTAA 2VKHA 4L5IA 4AVPA 4DIQA 3EUHC 2BE5F 1V4RA 1OLTA 1D8KA 3KP4A 3ZRGA 2P0WA 3KYDB 2JUCA 4KT6A 4Q48A 4P9UA 3JTHA 3CMAI 3FXJA 1LFBA 3EYYA 1MIJA 1MMGA 1LFPA 4I01A 2QYOA 2DPDA 2VB6A 2ZSIB 2MH2A 5DM7F 1TLHB 4BBSJ 5F04A 2VT3A 1OCCH 2HTJA 3QODA 5HDGA 3SZTA 3MKWB 2DOAA 2M0CA 3HOYJ 1S8NA 3HBLA 4A3FJ 2BV6A 2NVTJ 3RI4A 2VT2A 1X1DA 1PUFA 3E0JB 2IEKA 2M4GA 3WG7H 5LGTA 1HSJA 1SVLA 4FHTA 2GIZA 3S17J 3OL4A 2ECCA 5CVJA 2L9NA 4BYYA 3H5RA 1HKTA 5F6FA 4BQQA 2B0LA 2DAOA 3N97A 2QZ8A 5CVRA 3ERED 3RSNA 4C3JJ 1ZQ3P 1A04A 2K86A 3TP0A 5B3SH 2DJIA 1WQ2A 3KFWX 1LVAA 5HNHA 3GTMJ 3DTEA 3R0JA 3S1MJ 3T8RA 1WKMA 1D0ZA 1FY7A 4RGSA 2DBBA 1XN7A 1LFUP 3IH2A 4HPQA 5D8KB 1VQKI 2PBIA 3BJOA 1P2FA 5IY5H 4IHSA 3LSJA 3OWTA 4E7SA 2LKPA 1FBSA 4BAYA 2PI0A 5JHFA 1IN4A 1ZG5A 2XB5A 2IXSA 2H27A 2GBYA 3HPGA 2QSFX 2QQAA 4YIFA 4CYDA 1KU3A 3V42A 2Q2EA 2WY7Q 3DTIA 1FYMA 1B8IB 3BC8A 1TT0A 3TO6A 3TOBA 1V3FA 1TC3C 1E3HA 3UNGC 3FBIB 4U0YA 2FX0A 1JT0A 3GTLJ 4RLQA 3D1NI 3F6OA 1R00A 2HDCA 1KA8A 2UXNA 2DODA 2Y9ZA 1XD7A 2K9SA 3TGNA 2EIKH 4HX8A 3OYMA 4MLOA 1JKRC 5LGUA 3H9GA 1SFKA 4J01A 3B02A 5CVVA 2ZJQF 4RA2A 2IGNA 4IRGA 4LITA 2XB0X 1ETXA 4LOCA 1K61A 1K78A 3UKGA 1SD4A 1B59A 4LLGF 5FKNA 5FO5A 4F7ZA 4AIKA 2E2HJ 1NG7A 3TO9A 4EQQA 2F4OB 4XBFA 1P4XA 3WGIA 5DCMB 1B9MA 2JUGA 1J5YA 3I71A 1K4SA 1VQ5I 3S15J 3TOAA 1X1AA 4DYCA 1DPUA 2DTZA 2BVMA 4XMYA 3S2DJ 4C30A 2LTPA 4IKFA 2QUFA 1VI0A 1ZAOA 2HFHA 2Y75A 5J1RA 3N05A 3ZMVA 1X1CA 2JTVA 3HOTA 3OIQA 1ZRDA 3E1SA 5F64A 1WH7A 5AIQA 2DA5A 1IO2A 2XSDC 1O3SA 2D1VA 3TW7A 2Y0SA 1TWGJ 1Z3YA 2LC2A 1RIOH 4N9HA 3IUOA 3BR2A 3AG4H 3P5JA 2Z9OA 3H36A 1BW6A 2EV0A 5J1UA 1VZ0A 1T08B 3BPXA 4XRSA 2F2EA 2ZCWA 1SAUA 4X6AJ 2X6XA 1IV6A 2HQRA 2PJRA 4II3A 5B5EC 3BR0A 1XSXA 1YW9A 2QVOA 2RNGA 1YRNA 5J8FA 4KMUX 3CCVI 3IKVA 2MG4A 3CUQA 3VPRA 5HODA 3K10A 1DU6A 3CC2I 1BJZA 4HNVA 1B1BA 4BACA 2X48A 2ZO4A 5BNGA 3W6VA 3C1DA 1IRZA 3CJNA 1XCVA 2CFOA 1EF4A 3J81Z 1MBEA 1Y8RB 3R60A 2ESNA 4CXFA 3JTGA 3C3WA 4E6KG 2DA3A 2NVYJ 2DYSH 2WADA 4IJAA 2VE8A 4FQGA 5HNFA 4GYGA 3JRBA 1R49A 2EZIA 1OCTC 3RZOJ 4M72A 4IHVA 3HOUJ 2L9RA 3LMMA 1TQIA 5GAEJ 4A93J 4RLFA 1ZRCA 2XRLA 1SMYF 1BOBA 1MJAA 5TRDA 5FKKA 4XLAA 3MZYA 1U2WA 3CCSI 5LRSA 1X3UA 3NARA 2LMDA 3OYDA 3T0YA 2EA4A 1J0RA 1IG7A 3LA2A 1RETA 5JVTA 1FIAA 3RTRA 2P7VB 1D3YA 3JAMZ 2E36A 2KL4A 1P9QC 3I0TA 2V7FA 3UR3C 2DK5A 5AONA 2PN6A 1B4AA 4KIGA 5LFAA 1OR7A 5ILSA 1XGMA 2UWMA 4NC7A 2QCOA 2L01A 3F22A 1JT6A 3LSPA 4DOZA 1R4NB 5LLQA 3ISPA 2HQNA 4HSTA 3TP3A 5E1ZB 5E3LA 3HOVJ 2MGQA 4C3IJ 3JRDA 4LLNA 2IGMA 1IN5A 5KCMA 4E7HA 4PFPA 2IPQX 1LDDA 1RKWA 2M8GX 3S3MA 5E18F 1HW2A 2KLOA 2KDZA 2PFBA 1F9NA 2NOGA 2JK3A 4W97A 1YO5C 4YIIA 4HV5A 3J7ZI 3LNQA 2DO7A 3B6CA 3LL7A 2EB7A 4J19A 3HHHA 1ORKA 3OYBA 2JWTA 3BR5A 4B44A 2BZTA 2D5VA 5F0CA 5FLXK 2MABA 4BQOA 3P9IA 3K6GA 4R79A 2STWA 3BG9A 2HXIA 1RNLA 2Y31A 5J8CA 5L3GA 4IVNA 1Y1WJ 2LBFB 1ZRFA 4FX0A 2QSHX 2E1NA 2JVGA 2M87A 2H1KA 4P9FA 1BBYA 2GOMA 2BXYA 2IA0A 3MEXA 4XLCA 2GM4A 3CJRB 4A0ZA 3J80Z 4QIWN 1MKMA 3K69A 1EV7A 3DPUA 5JFRA 3VWBA 4Z6YA 1B72A 2QQBA 3S1RJ 4CCKA 3AAFA 1IF1A 2R7OA 2X1DA 3NWSA 2Y0MA 3I55I 3DP7A 4BU2A 1LVKA 4ZYHA 5E3OA 4AU7A 4P55A 3DU5A 2CYYA 2R5YB 3NEUA 3V8KA 2R7TA 3CCMI 3MZHA 1T2KA 2VKVA 4U0VA 2NAZA 1R1TA 3ZPLA 2IJLA 4AD9A 2L4AA 2WA0A 2KZVA 3BG6A 3BOQA 3KLNA 1NHAA 2ISYA 3ABUA 4HX4A 4RB2C 1H9TA 1F5TA 1HOMA 3S32A 5LHHA 1IGNA 1VQLI 1G8XA 1D0YA 2V1NA 4MTDA 1WWXA 2M1BA 1HQCA 4BJ6C 3FDYA 4CCJA 1OYYA 4LFUA 5FD6A 3HGYA 2XV4S 1AKHA 1UMQA 2QLZA 2LLKA 1KONA 1IZ1A 4BEHB 4LIVA 2HVRA 5CJ9A 2K40A 5D5XB 3LOCA 5ICCA 2O8KA 5F0FA 3SDBA 1QNTA 4D7MA 5D8LB 3M8JA 3OOPA 4I0BA 4RB0A 3HSRA 1WVRA 1HSTA 4GCVA 1LUJB 1ZG3A 1MZBA 4LGWA 2XHKA 3FXRA 3TL4X 2R7VA 3D5LA 3HOXJ 2Z1DA 4CCNA 4CCMA 3PM1A 4NDLA 5LD2C 4HA8A 4ESJA 2A6EF 2KDOA 3RQ4A 3L09A 2ZBKA 1FWZA 2ZC2A 4HAMA 2FNPA 1T98A 1RZ4A 2WV1A 2M34A 3NQOA 1IDYA 5D4SA 1IN7A 1MD0A 2F5VA 3O3KA 3OY9A 2D45A 2O9LA 3PNTA 1XGNA 5L3DA 4F93B 4QPOA 4XLEA 2OQGA 3LSKA 3W2WA 1ZK8A 1FNNA 2C6YA 1GHCA 1SVOA 3F8NA 1B6AA 3G1OA 3I64A 3O8GA 2VPRA 4LIUA 1FPQA 1YTYA 3I3LA 2HVQA 2KRFA 4PDKA 1JGGA 3VSLA 2XC7A 1MH3A 3LWFA 4OIQF 3BR3A 3WGHA 1ZREA 3HL2A 1FOXA 1CF7B 1MBFA 2F5EA 4HQEA 2QA4I 5J47A 2NNNA 3B73A 3V7RA 3J7AO 4OU0A 3JREA 2CJJA 4A3MJ 2EINH 1YX3A 2R4GA 2Y69H 3IAM2 1EH7A 2MW8A 4OINF 3WTUC 4WCGA 4B43A 1TW3A 4ESBA 3A01B 1SFOJ 3I53A 1IC8A 1EH8A 4FT8A 1XB4A 2OPTA 5CPRB 1VQ8I 4KISA 1OYIA 1YS6A 2JA6J 2CGPA 4IOAF 4M6VA 3EUKL 3RPUA 3BG5A 3HRMA 1J9IA 1GDTA 1UCRA 1NH3A 1FC3A 3K2AA 4PSXA 1A31A 4IXAA 5KNLA 4PCQA 3PO3J 2X6OA 1VTNC 3L1PA 3LSGA 3QRFF 5GTHC 1PDNC 1MMDA 3HC7A 1D1AA 5DTDA 2RVCA 3E6CC 4PJLA 5JVGF 1R4MB 1VQ4I 2XROA 3OL3A 5EGOB 5F1RA 1FMVA 2NNYA 1TZLA 2GXAA 2VBYA 3DEEA 2BXZA 4AVZA 3K1MA 5FKOA 2FNAA 1Z77A 3BR6A 4A5NA 3CF5F 1YYVA 1VQOI 3SJMA 3QAHA 3HTSB 2LF8A 2CMPA 2VXDA 2JZYA 4UUVA 4F52A 2M4KA 2R7RA 1R36A 1MMSA 1J09A 1O57A 1ON2A 2O61A 4AC0A 4UUSB 2H1LA 1TQPA 1T39A 1M1EB 4JYKA 1JUPA 2MD0A 2A69F 2KP6A 5HLGA 3CJQB 4JK1X 3HUGA 3WHCA 1W7PA 4U7BA 4KIFA 3E7LA 5L3EA 3RYPA 2VKEA 2WB1N 3HKZA 3LFUA 4A0XA 1X1PA 1MDMA 1S7AA 1WJCA 4A0YA 1Z3XA 3U21A 3O6BB 1IXCA 1MBKA 5EEGA 3QYFA 2JPBA 1DU0A 4RB1A 4I2OA 4I7HA 3Q9SA 4ZDOA 3GTJJ 2F5DA 1LNWA 2DU9A 5A2QK 1WFXA 2FU4A 4G8XA 4RS8A 3FXMA 2OQRA 4AYBA 5IP7J 2LF7A 3CCRI 3BR1A 5E79C 1L0OC 2DMPA 2OU2A 2RDPA 5M5XJ 2P6TA 1Z05A 4HF0A 4Y3OA 4V2GA 2QBYA 1IRFA 3PFIA 2H8RA 1FTTA 4ZJZA 4MHGA 2DFHA 3KZIC 4HF2A 4A3IJ 1MSEC 2EZLA 4XK4A 3ZXSA 2TRTA 1NK3P 2LR8A 2LD5A 2VN2A 3CCQI 2G9WA 4L5JA 3JW4A 1D5YA 1GXQA 4EATA 4IHWA 2IS4A 1SD7A 1N77A 2KIFA 5ICEA 3HOZJ 4L18B 4B8XA 3GLLA 2F6CA 3VOEA 4XORA 2DFIA 3LAPA 1C0WA 1L3LA 5FRMA 2W84A 3K70D 2FMLA 3QQAA 2E5ZA 1TTYA 1H0MA 2L9SA 2LY9A 1D0XA 1R22A 2XF6A 5LHIA 5GPCA 2FEZA 1RR7A 4N4NB 3HGGA 2DW4A 2WTEA 1XGOA 2HU9A 5L3FA 1WJBA 5LBQA 3A03A 3GFIA 4H4KC 5M5WJ 3OR1C 3RIRA 3SYTA 1X2MA 2CSOA 4Y17A 3ABLH 3ABMH 1KYZA 4U0WA 2WAFA 1U5TC 1HA8A 2ELJA 4BE0A 2PX9A 2DT7B 4ZZLA 1Z0XA 3HZJA 3OYNA 1PYVA 1FYKA 5DD4A 4C2TA 2OD5A 4NUBA 3V8LA 2FXAA 4NQWB 2XGEA 4DYRA 1R71A 1K7AA 2M2EA 3PNVA 2WV0A 1Y56A 3MKZA 3CDIA 5IYCJ 1S5LC 4U7DA 3LQRA 2O5RA 2LKXA 1G4DA 2XKOA 4KA4A 2X85A 1XMXA 2CUJA 2OBPA 1SFEA 4BHBA 3I4NJ 3H0DA 5K1YA 2Z2SB 4IL6C 1IUFA 4CHUA 3PSIA 1IDZA 2RQQA 1ETOA 1KU9A 5HS9A 4LG0A 3WTYC 3KP2A 4F3QA 1DP3A 3KP3A 1I5ZA 4BL0B 3G1MA 2EV6A 5CVUA 2Q0OA 3GTPJ 2EILH 1ZARA 3MN2A 4L9VA 1Z6RA 1Y1VJ 2M0MA 1LQ1A 5DDGA 4M3EA 3MWMA 2K3FA 5DYMA 3K70C 5L3CA 4E7LA 2YPRA 1LB2A 3OSFA 1ZYRF 2DYRH 4EVIA 4D7NA 5IYBJ 3RKYA 1O3TA 2XAQA 5TGTA 4FTHA 2LG4A 2XPUA 4S05A 1WGXA 1P4AA 1XS9A 3V4GA 5LGNA 2CQNA 2XGXA 2AO9A 2GA1A 2M7AA 1YIOA 1K4TA 3MFKA 1IN8A 2V26A 2XASA 5GAGJ 3S14J 2X1CA 3R61A 1ZG1A 2VASA 5D5UB 1YJNI 3BROA 5D5WB 2JRMA 1OCRH 3ML6A 3T5XA 1ZGWA 3GFJA 1LDKB 3HPHA 3DF8A 3WHBA 3CMEI 4KUMA 4XQFA 1BOAA 2CS3A 2DLLA 2FOWA 3OS1A 1MNDA 3HIFA 4PK4A 2H94A 2HZDA 3CO6C 4FASD 2XGDA 1CQTA 3IP4B 1D1BA 4ENMA 3G71I 2K27A 3CP8A 2R7WA 2CV0A 3AG1H 1OQYA 2OCCH 1VFCA 2DCEA 1E3OC 1JGSA 1BC7C 5K7FA 5F27A 2QGUA 3Q9VA 1AHDP 1U78A 2JPCA 3HSFA 3E5UA 4W1UA 2R7UA 3ZMSA 3T8TA 1XC5A 2R7SA 1MBHA 2DMTA 3K4NA 1O7LA 2QM3A 2Q2EB 3H9JA 3MVPA 3Q0WA 2PG4A 4UXNA 5HOOA 5M3MJ 1PP8F 2VQHA 3F8CA 1NTCA 1Z67A 3BP8A 2CG4A 5FFZA 2DQRA 4CSWA 1QVUA 3GF2A 4BHPA 1ZR2A 2H6BA 3ASOH 1F43A 1ZHFA 2P81A 1W5TA 3F8FA 4IQ4A 3OYLA 2R7DA 1KQ8A 3A0HC 4RM3A 1P7IA 2KJBA 3HDDA 4ZYDA 1QRYA 4HOBA 1ZN2A 4MQVA 3P9CA 4GGGA 4IRIA 2GWRA 3JAMK 2EFPA 1ZGJA 3GFLA 4D5FA 2R5ZA 1U9OA 2E1MB 1EH6A 2V79A 5FLVA 5B1AH 2Y0SN 2V1XA 1XMAA 1S3JA 3PIOF 1V5EA 3SFZA 4E7ZA 1U0JA 5DM6F 4BQAA 1B8IA 2KKOA 4L0YB 2F4IA 3ZMTA 1F36A 1S7OA 1IXRC 3A1YA 4G94A 5J1YA 4KJZA 1K6YA 2BHYA 2TDXA 1ZELA 1ONVA 2AXLA 6PAXA 2J5PA 3OYIA 1A35A 2R92J 4OOIA 1VQNI 4F55A 2PMZN 5HLIA 1STZA 4X1EA 2GA2A 1R1VA 5DCFA 2M5WA 3JRAA 4G7HF 2MA3A 1ERDA 5BQTA 1XCBA 4BQNA 4PJMA 4HDVA 3GTQJ 1YJWI 1WJEA 5LHGA 2K4BA 3IL2A 2XUBA 2VC1A 1R9TJ 3GZ5A 2MH9A 4YFNF 3CUQB 2E19A 1RUOA 5H6RA 3CF2A 1H89C 5EEHA 2DQLA 3ZQQA 1SEUA 3WTVC 2PMUA 3FXUA 3DTKA 3BTIA 2PMZA 3OIPA 2F48A 3KE2A 3ZQ7A 1YQAA 1OISA 4C2MJ 4FE7A 5K5OA 5C4XJ 1BIAA 1IJWC 2R7XA 4BH9A 3QPSA 1OFCX 4GDFA 5IYDJ 3IWZA 1YS7A 3IRRA 4E7KA 1G3SA 2M7BA 4S0HB 4ZDPA 5HVQC 2QKLB 5DUKA 1H9GA 3BJAA 2ZNZA 2P5KA 5FROA 3MD2A 3M07A 1HW5A 1GV2A 1SC7A 2DDBA 3R6SA 4YG2F 2GXBA 2XVCA 2XKPA 2ZMEB 2O8XA 4ZC3A 4BS9A 1F1ZA 2ZSHB 1PVEA 1FTZA 1X1BA 3REOA 3I56I 5CQGA 4EJWA 4HRIA 3CMYA 1N25A 3LA3A 2X6WA 4A5MA 3KEQA 2XGCA 1A36A 4KIBA 2MFZA 1RC9A 4HX7A 4XL9A 2I5UA 2HKOA 3SHFA 3GMEA 3BLYA 3KX2A 4MIMA 4YFXF 2R7FA 1I50J 1O3RA 2W25A 1O7FA 3X2QH 3F23A 4M9ZA 5E17F 3SEQA 3LQQA 2ETHA 2HWVA 1LE8B 2VUMJ 4B48A 3ZQGA 3FXLA 3WTWC 1GLNA 1SFXA 5IT9K 4WXDA 4RDUA 2QKMB 1X3WB 1E3PA 2DJNA 1FLIA 1QGPA 4N0BA 1UHMA 4WX9A 5K5QA 4KITB 3VYTB 2ZMEC 4O5VA 2R93J 3C2HA 2X0LA 3F8BA 2XAGA 4MEYF 4ZYGA 3ZOBA 4XSXF 3FWEA 4M73A 1I1GA 3OOUA 2EFWA 4DYQA 2E71A 4CZCA 3OYFA 2XAJA 2WAQN 1YOVB 1X2NA 1OYWA 1P4WA 2E1OA 2WWYA 1N78A 2GXGA 1T6SA 4M3GA 1Z91A 3G6EI 4XKVA 3OYEA 1XPXA 1TP4A 2IBDA 5HDNA 1XMKA 4P1WA 4UB8C 2VJ5A 3A0BC 2FBHA 3GVAA 2XF5A 2STTA 1J75A 5CVIA 2WAQA 4HQMA 3L2VA 2DN0A 4KNYA 2FD5A 2OA4A 3BQZA 1TWHJ 3H3VK 1B72B 2MSYA 4L5EA 3LSIA 1ULYA 2V9KA 1JUMA 5D6EA 3F0CA 3KLOA 4ASNA 4UVBA 3OS0A 4GYIA 4R8HA 1OKRA 1I6HJ 3J7YJ 2E34A 2QENA 1MBGA 1W5CC 2M3AA 3HB9A 1A5JA 3GLXA 1XGSA 4A6EA 1KGSA 4CYCA 4KN7X 2CQQA 4DBQA 1UZCA 3KZZA 2W4SA 3CESA 5JLWA 1QHGA 1YIJI 2PMHA 1I6XA 2L2OA 2BW3B 4V2FA 2LBFA 3B6AA 3BQYA 5CKTA 1BI3A 2NS7A 2IA2A 2FF4A 2HS5A 1BL0A 4RBOA 2HPIA 1XG1A 1S72I 3RDIA 3S3OA 3ZR8X 1JHFA 4A3EJ 2LSOA 2NVXJ 1UELB 3BCAA 4WXCA 3DXJF 4XOPA 2DA6A 3ABKH 3CJTB 3Q3SA 1BIBA 2FRHA 3MKLA 3S93A 1AKHB 1FYLA 4K2EA 4BXFA 4CH7A 4L9TA 3MAJA 3GX4X 2KJCA 3CC4I 2K4JA 5TJJA 2GQQA 4ZH4F 2G0EA 3ERMA 3KP7A 1UAAA 5JHUA 2R5YA 3IH3A 2DK8A 2ICWG 2Z16A 4EEFG 1V54H 3GUDA 2VBWA 2P4WA 1PUEE 2QWWA 3CUOA 2EFNA 2ISZA 2QF7A 1FSEA 4XOTA 3V7SA 4G12A 4HNTA 2VONA 1IUYA 1JI8A 2K5CA 3CC7I 3VODA 5HS8A 2E2IJ 4MNUA 2L5QA 1OCPA 4A12A 3CTAA 3QOEA 3E6DA 3V8JA 4DZJA 3I4MJ 2ZJRF 1REPC 1W5SA 2D1HA 2DA2A 3JRCA 4R1HA 4AIJA 4BEHA 4ENKA 5EZHA 1TWAJ 2OUMA 2V9VA 4OIRF 2GIVA 5IP9J 4BDYA 3ZMZA 4ETSA 2HVSA 3BWGA 4A3DJ 1T38A 5KAIC 3SDGA 3KIOA 3ZGKA 1JHHA 2E7XA 4WWCA 4MEXF 1U3EM 2BHZA 2MYSA 2HTSA 1D8JA 1SVMA 2RN7A 5ED4A 2QQ8A 2YR2A 5FLXZ 2CW7A 3P7NA
chains in the Genus database with same CATH topology
3CCSI 2H8WA 3J7YJ 2E34A 1YITI 1VQ7I 1YJ9I 1VQ6I 5JVGF 1VQ4I 2E36A 1VQLI 2OTLI 3CD6I 4IO9F 1YIJI 2ZJQF 3CF5F 1VQOI 3I56I 3CCEI 2ZJPF 1S72I 3CMAI 2NXNB 1VQ5I 1MMSA 3DLLF 5DM7F 3CJTB 5GAHJ 2OTJI 1YI2I 4IOCF 3CC4I 2E35A 3J7ZI 3PIOF 2K3FA 1FOYA 5DM6F 3CCUI 1FOWA 4UY8I 3CC7I 1VQNI 3CCRI 1VQPI 3CCVI 1VQ9I 3CC2I 2ZJRF 1ACIA 5GAGJ 5GADJ 4V19K 3G6EI 1FOXA 1YJNI 2QA4I 3CCQI 1VQMI 1YJWI 3PIPF 2QEXI 3CCLI 3CCJI 3I55I 1VQKI 3CMEI 3G4SI 1Y39A 2FOWA 1YHQI 1VQ8I 1HC8A 1QA6A 5GAEJ 4IOAF 3CCMI 2JQ7A 3G71I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS I;  2H8W A;  3J7Y J;  2E34 A;  1YIT I;  1VQ7 I;  1YJ9 I;  1VQ6 I;  5JVG F;  1VQ4 I;  2E36 A;  1VQL I;  2OTL I;  3CD6 I;  4IO9 F;  1YIJ I;  2ZJQ F;  3CF5 F;  1VQO I;  3I56 I;  3CCE I;  2ZJP F;  1S72 I;  3CMA I;  2NXN B;  1VQ5 I;  1MMS A;  3DLL F;  5DM7 F;  3CJT B;  5GAH J;  2OTJ I;  1YI2 I;  4IOC F;  3CC4 I;  2E35 A;  3J7Z I;  3PIO F;  2K3F A;  1FOY A;  5DM6 F;  3CCU I;  1FOW A;  4UY8 I;  3CC7 I;  1VQN I;  3CCR I;  1VQP I;  3CCV I;  1VQ9 I;  3CC2 I;  2ZJR F;  1ACI A;  5GAG J;  5GAD J;  4V19 K;  3G6E I;  1FOX A;  1YJN I;  2QA4 I;  3CCQ I;  1VQM I;  1YJW I;  3PIP F;  2QEX I;  3CCL I;  3CCJ I;  3I55 I;  1VQK I;  3CME I;  3G4S I;  1Y39 A;  2FOW A;  1YHQ I;  1VQ8 I;  1HC8 A;  1QA6 A;  5GAE J;  4IOA F;  3CCM I;  2JQ7 A;  3G71 I; 
#chains in the Genus database with same CATH topology
 2VOO A;  3A4C A;  3TMO A;  4M6X A;  2ME0 A;  5EJC A;  3H9Q A;  2O0Y A;  2NOJ B;  3C2G A;  4E70 A;  2OV7 A;  1WJ5 A;  2L7F P;  4RGU A;  3RKW A;  1HKQ A;  3QPT A;  5LEJ A;  3PQJ A;  3GTG J;  2HYF A;  2CU7 A;  1WJD A;  1X58 A;  2Y48 A;  2JN6 A;  2FE3 A;  3DKW A;  5IT3 A;  3I59 A;  2HI3 A;  3K4B A;  5DS9 A;  1X4P A;  2GZW A;  1Y8Q B;  3T1B A;  2LRE A;  2JA7 J;  4BJ5 C;  2O3F A;  3BG7 A;  1LDJ A;  2A6H F;  4P5O A;  3E6M A;  2EZH A;  2HGC A;  2LDU A;  2JA8 J;  2A6T A;  4MO7 A;  3FK6 A;  2LKS A;  3DBH B;  5E20 A;  3QPH A;  3J7A Y;  2OJE D;  2YSR A;  4E7I A;  1U6G A;  2QQ9 A;  3W6K B;  2LRD A;  4I6Z A;  3FIW A;  3E5Q A;  3JCU C;  1VF9 A;  3MZ8 A;  2O03 A;  2H09 A;  4M71 A;  3QOP A;  2RGV A;  4XLH A;  4A2U A;  2UZK A;  2OTJ I;  1TWC J;  4MQ9 F;  4XON A;  3RKX A;  1IV8 A;  1QQI A;  4O3M A;  1K6O A;  3PUB A;  3ZQC A;  3H1C A;  4EM0 B;  1WCM J;  3HKZ N;  1E17 A;  3VYS B;  4LB5 A;  3WE3 A;  1ODD A;  1P7J A;  4MFD A;  2NVQ J;  5EF6 A;  1DP7 P;  2ID3 A;  1WZ2 A;  2KIU A;  2MBF A;  1IAW A;  2HR3 A;  3I4P A;  3HUG B;  4Q47 A;  4UY8 I;  1W7P B;  2CUZ A;  2ID6 A;  3VB2 A;  3GTO J;  2A05 A;  1X3Z B;  4AYB N;  3FHN A;  3I5U A;  2LYC A;  5EGO A;  1MDM B;  4BKX A;  3EYI A;  1ZGA A;  4UUT A;  3G3Z A;  3K4L A;  2VQL A;  3WG9 A;  1AOY A;  3QWL A;  4UV8 A;  2K9N A;  1HDP A;  3LSH A;  2IVM A;  3KCC A;  1NG6 A;  2L7Z A;  4ZYA A;  1KU7 A;  2ZXW H;  3CMM A;  2ME6 A;  5J6X A;  3DEW A;  3IRQ A;  4M74 A;  1ETQ A;  2XSJ C;  2LH9 A;  2KQR A;  3KYL A;  2ZNY A;  1BA5 A;  3OV8 A;  3OYH A;  3BCB A;  1FZP B;  3W2V A;  3ECO A;  5C3E J;  3TED A;  2QBY B;  3IC7 A;  4UUS A;  1YE9 A;  5KHD A;  1USS A;  3W3C A;  4II2 A;  2DOE A;  3L00 A;  4JX6 A;  4ABZ A;  1AWC A;  4CCL A;  3KP6 A;  4G6T B;  2KFD A;  2ZXH A;  2W7N A;  3D5R C;  3DPT A;  1G3W A;  2YUS A;  3GW2 A;  1T0F C;  1JKQ C;  2LFB A;  3L2C A;  4JQF A;  2EQR A;  5FKM A;  3DQV C;  5KK1 A;  1BI2 A;  2LY2 A;  3O8H A;  1MJ9 A;  2VE9 A;  4AWX B;  2N8G A;  1MBJ A;  4BXX J;  3LAJ A;  1IN6 A;  2A3S A;  2EPF A;  3CD6 I;  3L2W A;  4U87 A;  3W2A A;  1ZH5 A;  4PGG A;  3AL0 B;  2ZXJ A;  4EJT A;  2L02 A;  1BJA A;  1RI7 A;  3KET A;  3Q5F A;  1Y0N A;  3KYC B;  4PGH A;  9ANT A;  5EG0 A;  1GV5 A;  1R5I D;  3ABT A;  2ZJP F;  4PFO A;  1V5F A;  1WJA A;  3Q0V A;  5DUI A;  1FMW A;  3HG9 A;  4Y52 J;  1MGT A;  4PJJ A;  3L2Q A;  3M7G A;  3FIS A;  4HLX A;  3RPQ A;  1TNS A;  3VSK A;  5H2F C;  4EGZ A;  1U5T A;  4JOM A;  3OMY A;  2BY1 A;  2FSW A;  5LRR A;  2HXO A;  4LD5 A;  1OCZ H;  5E1X A;  1HDD C;  1I27 A;  2F4M B;  1I1S A;  3FHZ A;  3S2W A;  1BR1 A;  4G6D A;  1UHW A;  2O7O A;  2HYJ A;  4HNU A;  2O6G E;  4B3A A;  1YX5 A;  3ELK A;  4Y33 A;  4IF4 A;  2H6C A;  1I3Q J;  1E0E A;  2V6C A;  2NYX A;  2K9L A;  4XKB A;  5ILV A;  2KIQ A;  3TKY A;  5D5V B;  1JXS A;  5B66 C;  3K4C A;  1T95 A;  2VI6 A;  3DLA A;  4LG0 B;  3G73 A;  5HLH A;  2EA2 A;  1JKP C;  3SZP A;  3IH4 A;  1VQ9 I;  2DFF A;  2LK2 A;  3BY6 A;  4YRV A;  3OSG A;  1QO0 D;  4L0Z B;  2G7U A;  2HYG D;  2OCE A;  1OPC A;  2K9M A;  4FE4 A;  2VKD A;  5H20 A;  1K79 A;  4XRM A;  5CYV A;  2FMY A;  1UFM A;  2NS0 A;  4RAG A;  3WGG A;  4O6J A;  2X6Y A;  3BTJ A;  1KYW A;  1BM9 A;  3IV5 A;  2E7W A;  2G7H A;  5CQE A;  5L3B A;  3ZQI A;  3PIP F;  3TW6 A;  2X9D A;  3FKI J;  5ICG A;  5EYR A;  1LPQ A;  1ZLK A;  1PUF B;  2VL8 A;  3CLQ A;  2PEX A;  3JRF A;  2X4H A;  4DGW B;  4XRS G;  4EMS A;  4BHC A;  2JQ7 A;  2PQ8 A;  3SQN A;  1TL8 A;  1ETK A;  4IHT A;  5BPI A;  5CLS A;  4HBL A;  4ZTJ A;  4L9N A;  1T56 A;  5A2Q Z;  2CRG A;  3FXK A;  3U9G A;  3D0S A;  3TQN A;  3JSP A;  3CO7 C;  3FM5 A;  2Q1Z B;  4KYW A;  2RRE A;  3K2Z A;  4ZDL A;  4N9I A;  5M5Y J;  2IGK A;  2WAE A;  3QU6 A;  4KIC A;  4DJA A;  2FUG 2;  3HRU A;  4NC6 A;  4UV9 A;  2V9P A;  4IPA A;  5AIP A;  5TIS C;  3K1N A;  4XID A;  2XAF A;  1OCO H;  1R5H A;  2X1E A;  3AFH A;  2DXI A;  1RES A;  4G7O F;  3JRH A;  4M3D A;  5J3L A;  1YFH A;  3ZQF A;  5FJ8 J;  2W82 A;  3SZG A;  3ROU A;  5F0H A;  1MNE A;  4I0A A;  4KFC A;  4MTE A;  2NS8 A;  1LEA A;  2COB A;  2LOO A;  3WU2 C;  5ILU A;  3HHG A;  3OYJ A;  2KMU A;  3M1C A;  2WBM A;  1WI3 A;  2K7L A;  1A6I A;  2AXT C;  3EDP A;  4NNJ A;  1Q1H A;  1BR2 A;  2VQG A;  3AG3 H;  3PUF A;  5GAH J;  4NC8 A;  4XKC A;  4M3F A;  3J81 K;  2HKX A;  5M3F J;  4H0E A;  1BC8 C;  2E35 A;  3GBG A;  2CUF A;  3RQI A;  2OF7 A;  4E7J A;  3L2R A;  1EKE A;  2CH0 A;  2KT0 A;  2M8E A;  2RAE A;  2IS6 A;  2HOT A;  1R5G A;  5DD8 A;  1FEX A;  1WH5 A;  1T33 A;  1FBU A;  2EFQ A;  5EZG A;  4D1Q A;  3G2B A;  3F6V A;  1LKX A;  2CW0 F;  3LSM A;  4M9S A;  3G1L A;  5JLX A;  1BI0 A;  3FF5 A;  2VQC A;  4LLL A;  3JSO A;  2R5Z B;  1MH4 A;  2HDW A;  1S9H A;  5LEK A;  1K78 B;  2AHQ A;  2XAH A;  3OIO A;  4PSW A;  3IKT A;  4D5C A;  1Y6I A;  4OIO F;  2DFE A;  1QU3 A;  2EIJ H;  3WU0 A;  3FX3 A;  3KZY A;  1SAX A;  3WTS C;  2ZKZ A;  4X0G A;  2FBK A;  4Y7N J;  2R3S A;  5GP9 A;  1R58 A;  1XDS A;  1Z6T A;  2ELH A;  3LA7 A;  4LMY A;  2MC3 A;  3DKX A;  1LEB A;  5HDK A;  5EEA A;  2MLG A;  4CGZ A;  2KHM A;  3H0G J;  2QEX I;  3ESW B;  2DTR A;  2X51 A;  2XDV A;  3ZCO A;  1T8I A;  1WHU A;  2DOF A;  2HZT A;  1B9N A;  4DZP A;  4CIC A;  2D2W A;  3E6B A;  1QA6 A;  4BXU A;  3CZ6 A;  2CWE A;  1RR8 C;  3L9F A;  1HLV A;  4PZJ A;  3P9K A;  4IRH A;  1S29 A;  3DFG A;  5FD5 A;  2HPM A;  4RM2 A;  3DU6 A;  3U2R A;  4D9J A;  2YU9 J;  3K4M A;  1HCR A;  2VC0 A;  3FXO A;  1Z21 A;  4D0P A;  1D5V A;  2CQK A;  2K02 A;  2E60 A;  1UJ8 A;  2GOX B;  2CO5 A;  4U88 A;  2PJR B;  3QU3 A;  4OIP F;  3PSF A;  1YRN B;  3H35 A;  4RGR A;  1IXS B;  2DI3 A;  2E1M C;  3MMY B;  3E3V A;  5DCM A;  1I3A A;  2A68 F;  1WRJ A;  3WU1 B;  2R0Q C;  2L54 A;  1HBX G;  4I09 A;  3M9A A;  5HLT A;  3QPL A;  3EQL F;  2K3P A;  1UG2 A;  3CLO A;  1DUX C;  4UB6 C;  4Q4Z F;  1XSD A;  5HS7 A;  5ICF A;  2ACJ A;  3QP6 A;  4AID A;  4ZZD A;  4XRF A;  1R7J A;  4NHJ A;  5BOX A;  3M8F A;  2E5N A;  2BY2 A;  2NXN B;  5C4J J;  3O2P E;  1P6R A;  1ZKG A;  2L3D A;  2L4M A;  3J80 K;  3DBL B;  4EJU A;  3BT9 A;  4EM2 A;  5FB2 A;  2Z5U A;  4CA0 A;  2DMU A;  4IOC F;  4HV6 A;  2JT1 A;  1HW1 A;  1TT5 B;  1AA7 A;  2KPM A;  4I99 C;  2DMQ A;  2L7K A;  3JR9 A;  1WSU A;  1KQ0 A;  2Y2Z A;  4Y15 A;  1G59 A;  4B3X A;  2A61 A;  1EJ9 A;  4KDP A;  4ZYE A;  1MMA A;  1R23 A;  3CUQ C;  4HEA 2;  1ZTR A;  1WJF A;  2V1D A;  4XNF A;  2JMW A;  1TWF J;  4DQ2 A;  3L7W A;  2AS5 F;  2IRF G;  3QYB A;  3C2B A;  2FQ3 A;  5K7H A;  3S1N J;  1J2X A;  2K9Q A;  3AG2 H;  3WOD F;  4KT5 C;  4GRI A;  1MMN A;  4GXO A;  3ZN1 A;  3WTZ A;  4CO8 A;  5FGM A;  3RCO A;  1P92 A;  2V6E A;  2DT6 A;  3RJP A;  4P96 A;  1Z1D A;  2W57 A;  4I98 B;  4C2U A;  1FOK A;  1A6Q A;  2B7E A;  2EH3 A;  2HOA A;  3WTX C;  4ENJ A;  1Y0U A;  4V19 K;  4XLP F;  1S7E A;  2ZFU A;  4B09 A;  2ZME A;  1OJL A;  4NB5 A;  2FA5 A;  1NK2 P;  3I58 A;  4UVA A;  3HOW J;  2B63 J;  4ESF A;  1O3Q A;  5J4Y A;  1X19 A;  2HEO A;  3ZQL A;  5JI6 A;  4RB3 C;  2DDA A;  2L7M P;  2Y30 A;  1RRJ A;  3KEO A;  1QZE A;  3BTL A;  3G4S I;  3M3Y J;  2IAI A;  2OAZ A;  5BS6 A;  1LJ9 A;  3H5N A;  2DA1 A;  2BY0 A;  1OMI A;  1SD6 A;  2A5W A;  2KIS A;  1EA3 A;  1LE8 A;  4Y4R A;  4BE2 A;  2WY8 Q;  1RUN A;  4DW6 A;  3GZ6 A;  1KQ9 A;  1OR7 C;  1VND A;  1YW7 A;  1HXD A;  3DEU A;  5IOY A;  2ZJ2 A;  4Y13 A;  3VFZ A;  3PFY A;  2XPV A;  2F5C A;  2ZB9 A;  2W1O A;  4HG2 A;  5E3N A;  4IZZ A;  1KZH A;  5FKL A;  1W36 D;  2JSC A;  1I39 A;  4RAF A;  1BI1 A;  4QPQ A;  1QZZ A;  4A3L J;  2R7Q A;  4EGY A;  3RKQ A;  1ETY A;  2Y9Y A;  2RKH A;  3A02 A;  4IO9 F;  2FBI A;  3MKY B;  2VPL A;  1SD5 A;  2IS1 A;  2BGC A;  2RC4 A;  2Q8K A;  4EJO A;  2W85 A;  3COA C;  2W00 A;  2IT0 A;  3VDX A;  3FKJ A;  2M45 A;  3PNY A;  4BNC A;  3ZQH A;  2P8T A;  3W6J B;  3CCE I;  1IRG A;  4HZF A;  4CYC B;  5E3M A;  2OC6 A;  4UHT A;  4DNC A;  4OAY A;  1S6L A;  2CV1 A;  2VBX A;  3F9K A;  1HF0 A;  2W48 A;  1QZY A;  4XN3 A;  2DT5 A;  2GAU A;  3VYU B;  1YI2 I;  3S1Q J;  2EBI A;  3R4K A;  3M8E A;  2I10 A;  4BE1 A;  4XM3 A;  3I9V 2;  4OWR B;  1ETW A;  3BZK A;  1WI9 A;  3F72 A;  3IAS 2;  3CQZ J;  3BJ6 A;  2VOD A;  3Q0U A;  1JUS A;  2BEO A;  1TNT A;  2F5F A;  2HOE A;  3FM3 A;  4PJ0 C;  4AIH A;  3DWL E;  3OYC A;  3RZD J;  3MCZ A;  4XSZ F;  2P7C B;  3EET A;  5E8G A;  1DGW Y;  2M30 A;  3BG3 A;  4F91 B;  5E1W A;  4S04 A;  4YIR X;  3CDL A;  1V5G A;  4BJT A;  3H5A A;  3GWZ A;  4PJN A;  1JKO C;  1MW7 A;  1W36 C;  1CGP A;  4QLC U;  3HSE A;  5GAD J;  3MQ0 A;  4ZTF A;  1FSH A;  3ONQ A;  4ANJ A;  2BW3 A;  5GTI C;  3KPH A;  2UXX A;  3FBN B;  3WTT C;  1DQU A;  1YLF A;  2MC4 A;  4EJV A;  3OR2 C;  4L9J A;  2XIG A;  4M6Y A;  4M3B A;  4C3H J;  2YU3 A;  4OMY A;  3SXY A;  1QVT A;  4CUG A;  2BOL A;  2EIM H;  1UST A;  4B4C A;  3PQK A;  2VLA A;  5IT9 Z;  1Y39 A;  1FP2 A;  5D4R A;  2IP2 A;  4XKW A;  4PUS A;  1QPI A;  3F8M A;  4YFK F;  1HC8 A;  4A3B J;  1D1C A;  2FJ1 A;  2W24 A;  3CP2 A;  4C9Y A;  1BR4 A;  2LNB A;  3E97 A;  1J7K A;  3EUA A;  1U8B A;  3S2H J;  4A3C J;  1UG0 A;  4JX5 A;  1O4X A;  1BW5 A;  5B1B H;  1SFU A;  3KEY A;  4AUX A;  4A3K J;  5DEQ A;  3K4J A;  3TO7 A;  4CZZ A;  2COM A;  1HKS A;  1G6N A;  1VQ7 I;  3ECH A;  3S16 J;  4FCY A;  3RYR A;  5J4V A;  1GUU A;  2VXZ A;  3R0A A;  4LK0 F;  4A6D A;  4ON0 A;  4LG3 A;  3ZMD A;  3RPU D;  5E8I A;  1RPW A;  2M9H A;  3GFM A;  3NAU A;  3NRV A;  4A69 C;  2L9V A;  5FLM J;  1MNM C;  4IQJ A;  2E1C A;  2CQX A;  1H8A C;  5EDN A;  2LY1 A;  3S3N A;  1FX7 A;  2VBZ A;  2LP0 A;  4BUP A;  4HLY A;  3HYI A;  5JR3 A;  2OZ6 A;  2V4J C;  3L2U A;  2RV8 A;  1Z7L A;  2MD5 A;  4IHX A;  5KAF C;  1JJ8 C;  1R1U A;  1QPM A;  1POG A;  4BY7 J;  4B1R A;  4NBQ A;  4HDU A;  3M1E A;  3IWF A;  1N75 A;  3I59 B;  3DLL F;  4LJZ F;  2NRA C;  4GFB A;  1H88 C;  1W0T A;  4HSR A;  5J40 A;  1JE8 A;  2LVS A;  2FOK A;  2I8D A;  3DV8 A;  1DDN A;  4HF1 A;  3CDH A;  5C44 J;  3DCF A;  3TBI A;  4ENN A;  3FMQ A;  3IHU A;  2BBY A;  2RQP A;  2NVU B;  1GVD A;  4LK1 F;  4QTR A;  3D5S C;  2XF7 A;  2TCT A;  3TDZ C;  1FOY A;  4BBR J;  3OYK A;  4FET A;  1APL C;  1CF7 A;  4KN4 X;  2EFO A;  4MFE A;  5K5R A;  3CCU I;  4XN0 A;  2IA1 A;  1UB9 A;  3OS2 A;  3N4M A;  1FOW A;  3OYA A;  4GO1 A;  1W7P D;  3CCY A;  2VJJ A;  2MLK A;  3ASN H;  3JRG A;  2AQF A;  4XIC A;  2JVH A;  3VEP A;  1ENH A;  3A01 A;  4G7Z F;  5H6Q A;  1TW2 A;  2EWN A;  2J5O A;  2VJI A;  3H3U A;  4I76 A;  3EPZ A;  3A2K A;  4QWQ A;  1GT0 C;  2HQ5 A;  2IGO A;  4IEJ A;  2JRT A;  1VQM I;  3GCM A;  4MGR A;  2XAU A;  2CV2 A;  2CQ7 A;  2R7Z J;  5D6F A;  3PL8 A;  2JJ7 A;  3GEZ A;  4CDG A;  1G3Y A;  3CCJ I;  1FP1 D;  3QYE A;  5IPA A;  1W0U A;  2KZG A;  3FMR A;  5IOZ A;  1XSV A;  1YHQ I;  2CUE A;  2XRN A;  4YEJ A;  4WF2 A;  1ZLJ A;  3PO2 J;  4UVC A;  1BN5 A;  2ESH A;  5FFX A;  3FXQ A;  3JRI A;  1DGR M;  2IW5 A;  4FX4 A;  3DKY A;  1JJ6 C;  4A3G J;  2JA5 J;  4E4H A;  3V7C A;  4BGD A;  2EJR A;  5DV5 A;  1KU2 A;  4RAY A;  2AQE A;  1FBQ A;  2YX7 A;  5GPA A;  2L0K A;  1MJB A;  4G9Y A;  3HEF A;  4WK8 F;  3BDD A;  3QP5 A;  3GO5 A;  3K0L A;  1Z7U A;  3F3X A;  1UHS A;  4JP0 A;  3U1D A;  1TQM A;  1XX5 A;  3K9T A;  4LB6 B;  3AKZ A;  2E2J J;  2OTL I;  4JX4 A;  3TDU C;  1W4M A;  4WXH A;  2A5Y B;  5BMZ A;  2WC2 A;  1TBX A;  3LFK A;  3VYR B;  4RAZ A;  1F4K A;  2Z33 A;  1E2X A;  3ZN0 A;  3OYG A;  1T0F A;  4ITV A;  3S8P A;  4XLN F;  1ON1 A;  1GVJ A;  2JA2 A;  2P5V A;  2ZXI A;  3GXO A;  4EM1 A;  5IP6 A;  5K7Z A;  3BPV A;  2PJP A;  2DA7 A;  3DBR B;  2HOS A;  1IW7 F;  2VJ4 A;  4J00 A;  1U9N A;  1ETV A;  1YW8 A;  4XLF A;  3ZMU A;  2QSG X;  1YG2 A;  1XDU A;  3BZ6 A;  4HW0 A;  4BDZ A;  4I02 A;  2HNH A;  1AU7 A;  2V1U A;  1G2H A;  2DMN A;  1R6R A;  4KMF A;  1RKT A;  2YX4 A;  4A3J J;  2UUZ A;  3I54 A;  2HQA A;  2EV5 A;  2OZU A;  5EG0 B;  2BVL A;  1PJR A;  4OMZ A;  3FK7 A;  3KP5 A;  3K7A J;  1QBJ A;  2YS9 A;  4OAZ A;  2WB1 A;  3BZC A;  3SEZ A;  4EV0 A;  4TV7 A;  2K85 A;  4JBA A;  4B47 A;  1U5T B;  3ULQ B;  4BY1 J;  3H92 A;  5BPD A;  3BTC A;  4RGX A;  3NWT A;  1DPR A;  1FT9 A;  3C18 A;  1U8R A;  1GXP A;  1FJL A;  1V55 H;  2JSP A;  1MSF C;  4DBR A;  1J59 A;  2VIX A;  3HOS A;  4CCO A;  2XPW A;  3K4K A;  3FZV A;  4Z2Y A;  2DA4 A;  1VQP I;  2FQ4 A;  2ADU A;  2ECB A;  2EZK A;  3LST A;  4YEL A;  2P5L C;  3HTU A;  2PLY A;  1ACI A;  3DPL C;  2EK5 A;  1PP7 U;  2HDD A;  3GYH X;  4Q5S F;  1SAN A;  1X4O A;  3HRT A;  1IRX A;  2DPU A;  1Z9C A;  2P6S A;  3HRS A;  3HXL A;  3FMS A;  4RMN A;  2A07 F;  2ZFW A;  3AL0 C;  1FIP A;  2BY3 A;  2KIM A;  4XR6 A;  3LSR A;  3U1K A;  1QHH D;  3CCL I;  1SMT A;  4IHY A;  2ELK A;  3H3Z A;  4HYE A;  1ITY A;  2B9S A;  1WPK A;  2BYV E;  1G3T A;  2IS2 A;  4M9X A;  1W1W E;  3SFI A;  3C7J A;  3F21 A;  4N4O B;  4IX7 A;  2KRH A;  5F08 A;  2KRC A;  3PJR A;  3HM5 A;  3M4O J;  1Q1V A;  4UNO A;  1K83 J;  3E5X A;  3HJE A;  4F92 B;  2GLO A;  3GZN B;  2RNJ A;  2Z3Y A;  4QSH A;  5F1J A;  2H8W A;  5KVR A;  4G6Q A;  4AM3 A;  2VOP A;  1ZR4 A;  3ZP5 A;  2Z99 A;  2CFX A;  1YIT I;  2UV1 A;  1YJ9 I;  4FIS A;  3GTK J;  1VQ6 I;  4NQW A;  1JTY A;  2CW8 A;  1JTX A;  5ERI A;  3WE2 A;  3K1P A;  5FRN A;  3EUH A;  1XTA A;  2VKH A;  4L5I A;  4AVP A;  4DIQ A;  3EUH C;  2BE5 F;  1V4R A;  1OLT A;  1D8K A;  3KP4 A;  3ZRG A;  2P0W A;  3KYD B;  2JUC A;  4KT6 A;  4Q48 A;  4P9U A;  3JTH A;  3CMA I;  3FXJ A;  1LFB A;  3EYY A;  1MIJ A;  1MMG A;  1LFP A;  4I01 A;  2QYO A;  2DPD A;  2VB6 A;  2ZSI B;  2MH2 A;  5DM7 F;  1TLH B;  4BBS J;  5F04 A;  2VT3 A;  1OCC H;  2HTJ A;  3QOD A;  5HDG A;  3SZT A;  3MKW B;  2DOA A;  2M0C A;  3HOY J;  1S8N A;  3HBL A;  4A3F J;  2BV6 A;  2NVT J;  3RI4 A;  2VT2 A;  1X1D A;  1PUF A;  3E0J B;  2IEK A;  2M4G A;  3WG7 H;  5LGT A;  1HSJ A;  1SVL A;  4FHT A;  2GIZ A;  3S17 J;  3OL4 A;  2ECC A;  5CVJ A;  2L9N A;  4BYY A;  3H5R A;  1HKT A;  5F6F A;  4BQQ A;  2B0L A;  2DAO A;  3N97 A;  2QZ8 A;  5CVR A;  3ERE D;  3RSN A;  4C3J J;  1ZQ3 P;  1A04 A;  2K86 A;  3TP0 A;  5B3S H;  2DJI A;  1WQ2 A;  3KFW X;  1LVA A;  5HNH A;  3GTM J;  3DTE A;  3R0J A;  3S1M J;  3T8R A;  1WKM A;  1D0Z A;  1FY7 A;  4RGS A;  2DBB A;  1XN7 A;  1LFU P;  3IH2 A;  4HPQ A;  5D8K B;  1VQK I;  2PBI A;  3BJO A;  1P2F A;  5IY5 H;  4IHS A;  3LSJ A;  3OWT A;  4E7S A;  2LKP A;  1FBS A;  4BAY A;  2PI0 A;  5JHF A;  1IN4 A;  1ZG5 A;  2XB5 A;  2IXS A;  2H27 A;  2GBY A;  3HPG A;  2QSF X;  2QQA A;  4YIF A;  4CYD A;  1KU3 A;  3V42 A;  2Q2E A;  2WY7 Q;  3DTI A;  1FYM A;  1B8I B;  3BC8 A;  1TT0 A;  3TO6 A;  3TOB A;  1V3F A;  1TC3 C;  1E3H A;  3UNG C;  3FBI B;  4U0Y A;  2FX0 A;  1JT0 A;  3GTL J;  4RLQ A;  3D1N I;  3F6O A;  1R00 A;  2HDC A;  1KA8 A;  2UXN A;  2DOD A;  2Y9Z A;  1XD7 A;  2K9S A;  3TGN A;  2EIK H;  4HX8 A;  3OYM A;  4MLO A;  1JKR C;  5LGU A;  3H9G A;  1SFK A;  4J01 A;  3B02 A;  5CVV A;  2ZJQ F;  4RA2 A;  2IGN A;  4IRG A;  4LIT A;  2XB0 X;  1ETX A;  4LOC A;  1K61 A;  1K78 A;  3UKG A;  1SD4 A;  1B59 A;  4LLG F;  5FKN A;  5FO5 A;  4F7Z A;  4AIK A;  2E2H J;  1NG7 A;  3TO9 A;  4EQQ A;  2F4O B;  4XBF A;  1P4X A;  3WGI A;  5DCM B;  1B9M A;  2JUG A;  1J5Y A;  3I71 A;  1K4S A;  1VQ5 I;  3S15 J;  3TOA A;  1X1A A;  4DYC A;  1DPU A;  2DTZ A;  2BVM A;  4XMY A;  3S2D J;  4C30 A;  2LTP A;  4IKF A;  2QUF A;  1VI0 A;  1ZAO A;  2HFH A;  2Y75 A;  5J1R A;  3N05 A;  3ZMV A;  1X1C A;  2JTV A;  3HOT A;  3OIQ A;  1ZRD A;  3E1S A;  5F64 A;  1WH7 A;  5AIQ A;  2DA5 A;  1IO2 A;  2XSD C;  1O3S A;  2D1V A;  3TW7 A;  2Y0S A;  1TWG J;  1Z3Y A;  2LC2 A;  1RIO H;  4N9H A;  3IUO A;  3BR2 A;  3AG4 H;  3P5J A;  2Z9O A;  3H36 A;  1BW6 A;  2EV0 A;  5J1U A;  1VZ0 A;  1T08 B;  3BPX A;  4XRS A;  2F2E A;  2ZCW A;  1SAU A;  4X6A J;  2X6X A;  1IV6 A;  2HQR A;  2PJR A;  4II3 A;  5B5E C;  3BR0 A;  1XSX A;  1YW9 A;  2QVO A;  2RNG A;  1YRN A;  5J8F A;  4KMU X;  3CCV I;  3IKV A;  2MG4 A;  3CUQ A;  3VPR A;  5HOD A;  3K10 A;  1DU6 A;  3CC2 I;  1BJZ A;  4HNV A;  1B1B A;  4BAC A;  2X48 A;  2ZO4 A;  5BNG A;  3W6V A;  3C1D A;  1IRZ A;  3CJN A;  1XCV A;  2CFO A;  1EF4 A;  3J81 Z;  1MBE A;  1Y8R B;  3R60 A;  2ESN A;  4CXF A;  3JTG A;  3C3W A;  4E6K G;  2DA3 A;  2NVY J;  2DYS H;  2WAD A;  4IJA A;  2VE8 A;  4FQG A;  5HNF A;  4GYG A;  3JRB A;  1R49 A;  2EZI A;  1OCT C;  3RZO J;  4M72 A;  4IHV A;  3HOU J;  2L9R A;  3LMM A;  1TQI A;  5GAE J;  4A93 J;  4RLF A;  1ZRC A;  2XRL A;  1SMY F;  1BOB A;  1MJA A;  5TRD A;  5FKK A;  4XLA A;  3MZY A;  1U2W A;  3CCS I;  5LRS A;  1X3U A;  3NAR A;  2LMD A;  3OYD A;  3T0Y A;  2EA4 A;  1J0R A;  1IG7 A;  3LA2 A;  1RET A;  5JVT A;  1FIA A;  3RTR A;  2P7V B;  1D3Y A;  3JAM Z;  2E36 A;  2KL4 A;  1P9Q C;  3I0T A;  2V7F A;  3UR3 C;  2DK5 A;  5AON A;  2PN6 A;  1B4A A;  4KIG A;  5LFA A;  1OR7 A;  5ILS A;  1XGM A;  2UWM A;  4NC7 A;  2QCO A;  2L01 A;  3F22 A;  1JT6 A;  3LSP A;  4DOZ A;  1R4N B;  5LLQ A;  3ISP A;  2HQN A;  4HST A;  3TP3 A;  5E1Z B;  5E3L A;  3HOV J;  2MGQ A;  4C3I J;  3JRD A;  4LLN A;  2IGM A;  1IN5 A;  5KCM A;  4E7H A;  4PFP A;  2IPQ X;  1LDD A;  1RKW A;  2M8G X;  3S3M A;  5E18 F;  1HW2 A;  2KLO A;  2KDZ A;  2PFB A;  1F9N A;  2NOG A;  2JK3 A;  4W97 A;  1YO5 C;  4YII A;  4HV5 A;  3J7Z I;  3LNQ A;  2DO7 A;  3B6C A;  3LL7 A;  2EB7 A;  4J19 A;  3HHH A;  1ORK A;  3OYB A;  2JWT A;  3BR5 A;  4B44 A;  2BZT A;  2D5V A;  5F0C A;  5FLX K;  2MAB A;  4BQO A;  3P9I A;  3K6G A;  4R79 A;  2STW A;  3BG9 A;  2HXI A;  1RNL A;  2Y31 A;  5J8C A;  5L3G A;  4IVN A;  1Y1W J;  2LBF B;  1ZRF A;  4FX0 A;  2QSH X;  2E1N A;  2JVG A;  2M87 A;  2H1K A;  4P9F A;  1BBY A;  2GOM A;  2BXY A;  2IA0 A;  3MEX A;  4XLC A;  2GM4 A;  3CJR B;  4A0Z A;  3J80 Z;  4QIW N;  1MKM A;  3K69 A;  1EV7 A;  3DPU A;  5JFR A;  3VWB A;  4Z6Y A;  1B72 A;  2QQB A;  3S1R J;  4CCK A;  3AAF A;  1IF1 A;  2R7O A;  2X1D A;  3NWS A;  2Y0M A;  3I55 I;  3DP7 A;  4BU2 A;  1LVK A;  4ZYH A;  5E3O A;  4AU7 A;  4P55 A;  3DU5 A;  2CYY A;  2R5Y B;  3NEU A;  3V8K A;  2R7T A;  3CCM I;  3MZH A;  1T2K A;  2VKV A;  4U0V A;  2NAZ A;  1R1T A;  3ZPL A;  2IJL A;  4AD9 A;  2L4A A;  2WA0 A;  2KZV A;  3BG6 A;  3BOQ A;  3KLN A;  1NHA A;  2ISY A;  3ABU A;  4HX4 A;  4RB2 C;  1H9T A;  1F5T A;  1HOM A;  3S32 A;  5LHH A;  1IGN A;  1VQL I;  1G8X A;  1D0Y A;  2V1N A;  4MTD A;  1WWX A;  2M1B A;  1HQC A;  4BJ6 C;  3FDY A;  4CCJ A;  1OYY A;  4LFU A;  5FD6 A;  3HGY A;  2XV4 S;  1AKH A;  1UMQ A;  2QLZ A;  2LLK A;  1KON A;  1IZ1 A;  4BEH B;  4LIV A;  2HVR A;  5CJ9 A;  2K40 A;  5D5X B;  3LOC A;  5ICC A;  2O8K A;  5F0F A;  3SDB A;  1QNT A;  4D7M A;  5D8L B;  3M8J A;  3OOP A;  4I0B A;  4RB0 A;  3HSR A;  1WVR A;  1HST A;  4GCV A;  1LUJ B;  1ZG3 A;  1MZB A;  4LGW A;  2XHK A;  3FXR A;  3TL4 X;  2R7V A;  3D5L A;  3HOX J;  2Z1D A;  4CCN A;  4CCM A;  3PM1 A;  4NDL A;  5LD2 C;  4HA8 A;  4ESJ A;  2A6E F;  2KDO A;  3RQ4 A;  3L09 A;  2ZBK A;  1FWZ A;  2ZC2 A;  4HAM A;  2FNP A;  1T98 A;  1RZ4 A;  2WV1 A;  2M34 A;  3NQO A;  1IDY A;  5D4S A;  1IN7 A;  1MD0 A;  2F5V A;  3O3K A;  3OY9 A;  2D45 A;  2O9L A;  3PNT A;  1XGN A;  5L3D A;  4F93 B;  4QPO A;  4XLE A;  2OQG A;  3LSK A;  3W2W A;  1ZK8 A;  1FNN A;  2C6Y A;  1GHC A;  1SVO A;  3F8N A;  1B6A A;  3G1O A;  3I64 A;  3O8G A;  2VPR A;  4LIU A;  1FPQ A;  1YTY A;  3I3L A;  2HVQ A;  2KRF A;  4PDK A;  1JGG A;  3VSL A;  2XC7 A;  1MH3 A;  3LWF A;  4OIQ F;  3BR3 A;  3WGH A;  1ZRE A;  3HL2 A;  1FOX A;  1CF7 B;  1MBF A;  2F5E A;  4HQE A;  2QA4 I;  5J47 A;  2NNN A;  3B73 A;  3V7R A;  3J7A O;  4OU0 A;  3JRE A;  2CJJ A;  4A3M J;  2EIN H;  1YX3 A;  2R4G A;  2Y69 H;  3IAM 2;  1EH7 A;  2MW8 A;  4OIN F;  3WTU C;  4WCG A;  4B43 A;  1TW3 A;  4ESB A;  3A01 B;  1SFO J;  3I53 A;  1IC8 A;  1EH8 A;  4FT8 A;  1XB4 A;  2OPT A;  5CPR B;  1VQ8 I;  4KIS A;  1OYI A;  1YS6 A;  2JA6 J;  2CGP A;  4IOA F;  4M6V A;  3EUK L;  3RPU A;  3BG5 A;  3HRM A;  1J9I A;  1GDT A;  1UCR A;  1NH3 A;  1FC3 A;  3K2A A;  4PSX A;  1A31 A;  4IXA A;  5KNL A;  4PCQ A;  3PO3 J;  2X6O A;  1VTN C;  3L1P A;  3LSG A;  3QRF F;  5GTH C;  1PDN C;  1MMD A;  3HC7 A;  1D1A A;  5DTD A;  2RVC A;  3E6C C;  4PJL A;  5JVG F;  1R4M B;  1VQ4 I;  2XRO A;  3OL3 A;  5EGO B;  5F1R A;  1FMV A;  2NNY A;  1TZL A;  2GXA A;  2VBY A;  3DEE A;  2BXZ A;  4AVZ A;  3K1M A;  5FKO A;  2FNA A;  1Z77 A;  3BR6 A;  4A5N A;  3CF5 F;  1YYV A;  1VQO I;  3SJM A;  3QAH A;  3HTS B;  2LF8 A;  2CMP A;  2VXD A;  2JZY A;  4UUV A;  4F52 A;  2M4K A;  2R7R A;  1R36 A;  1MMS A;  1J09 A;  1O57 A;  1ON2 A;  2O61 A;  4AC0 A;  4UUS B;  2H1L A;  1TQP A;  1T39 A;  1M1E B;  4JYK A;  1JUP A;  2MD0 A;  2A69 F;  2KP6 A;  5HLG A;  3CJQ B;  4JK1 X;  3HUG A;  3WHC A;  1W7P A;  4U7B A;  4KIF A;  3E7L A;  5L3E A;  3RYP A;  2VKE A;  2WB1 N;  3HKZ A;  3LFU A;  4A0X A;  1X1P A;  1MDM A;  1S7A A;  1WJC A;  4A0Y A;  1Z3X A;  3U21 A;  3O6B B;  1IXC A;  1MBK A;  5EEG A;  3QYF A;  2JPB A;  1DU0 A;  4RB1 A;  4I2O A;  4I7H A;  3Q9S A;  4ZDO A;  3GTJ J;  2F5D A;  1LNW A;  2DU9 A;  5A2Q K;  1WFX A;  2FU4 A;  4G8X A;  4RS8 A;  3FXM A;  2OQR A;  4AYB A;  5IP7 J;  2LF7 A;  3CCR I;  3BR1 A;  5E79 C;  1L0O C;  2DMP A;  2OU2 A;  2RDP A;  5M5X J;  2P6T A;  1Z05 A;  4HF0 A;  4Y3O A;  4V2G A;  2QBY A;  1IRF A;  3PFI A;  2H8R A;  1FTT A;  4ZJZ A;  4MHG A;  2DFH A;  3KZI C;  4HF2 A;  4A3I J;  1MSE C;  2EZL A;  4XK4 A;  3ZXS A;  2TRT A;  1NK3 P;  2LR8 A;  2LD5 A;  2VN2 A;  3CCQ I;  2G9W A;  4L5J A;  3JW4 A;  1D5Y A;  1GXQ A;  4EAT A;  4IHW A;  2IS4 A;  1SD7 A;  1N77 A;  2KIF A;  5ICE A;  3HOZ J;  4L18 B;  4B8X A;  3GLL A;  2F6C A;  3VOE A;  4XOR A;  2DFI A;  3LAP A;  1C0W A;  1L3L A;  5FRM A;  2W84 A;  3K70 D;  2FML A;  3QQA A;  2E5Z A;  1TTY A;  1H0M A;  2L9S A;  2LY9 A;  1D0X A;  1R22 A;  2XF6 A;  5LHI A;  5GPC A;  2FEZ A;  1RR7 A;  4N4N B;  3HGG A;  2DW4 A;  2WTE A;  1XGO A;  2HU9 A;  5L3F A;  1WJB A;  5LBQ A;  3A03 A;  3GFI A;  4H4K C;  5M5W J;  3OR1 C;  3RIR A;  3SYT A;  1X2M A;  2CSO A;  4Y17 A;  3ABL H;  3ABM H;  1KYZ A;  4U0W A;  2WAF A;  1U5T C;  1HA8 A;  2ELJ A;  4BE0 A;  2PX9 A;  2DT7 B;  4ZZL A;  1Z0X A;  3HZJ A;  3OYN A;  1PYV A;  1FYK A;  5DD4 A;  4C2T A;  2OD5 A;  4NUB A;  3V8L A;  2FXA A;  4NQW B;  2XGE A;  4DYR A;  1R71 A;  1K7A A;  2M2E A;  3PNV A;  2WV0 A;  1Y56 A;  3MKZ A;  3CDI A;  5IYC J;  1S5L C;  4U7D A;  3LQR A;  2O5R A;  2LKX A;  1G4D A;  2XKO A;  4KA4 A;  2X85 A;  1XMX A;  2CUJ A;  2OBP A;  1SFE A;  4BHB A;  3I4N J;  3H0D A;  5K1Y A;  2Z2S B;  4IL6 C;  1IUF A;  4CHU A;  3PSI A;  1IDZ A;  2RQQ A;  1ETO A;  1KU9 A;  5HS9 A;  4LG0 A;  3WTY C;  3KP2 A;  4F3Q A;  1DP3 A;  3KP3 A;  1I5Z A;  4BL0 B;  3G1M A;  2EV6 A;  5CVU A;  2Q0O A;  3GTP J;  2EIL H;  1ZAR A;  3MN2 A;  4L9V A;  1Z6R A;  1Y1V J;  2M0M A;  1LQ1 A;  5DDG A;  4M3E A;  3MWM A;  2K3F A;  5DYM A;  3K70 C;  5L3C A;  4E7L A;  2YPR A;  1LB2 A;  3OSF A;  1ZYR F;  2DYR H;  4EVI A;  4D7N A;  5IYB J;  3RKY A;  1O3T A;  2XAQ A;  5TGT A;  4FTH A;  2LG4 A;  2XPU A;  4S05 A;  1WGX A;  1P4A A;  1XS9 A;  3V4G A;  5LGN A;  2CQN A;  2XGX A;  2AO9 A;  2GA1 A;  2M7A A;  1YIO A;  1K4T A;  3MFK A;  1IN8 A;  2V26 A;  2XAS A;  5GAG J;  3S14 J;  2X1C A;  3R61 A;  1ZG1 A;  2VAS A;  5D5U B;  1YJN I;  3BRO A;  5D5W B;  2JRM A;  1OCR H;  3ML6 A;  3T5X A;  1ZGW A;  3GFJ A;  1LDK B;  3HPH A;  3DF8 A;  3WHB A;  3CME I;  4KUM A;  4XQF A;  1BOA A;  2CS3 A;  2DLL A;  2FOW A;  3OS1 A;  1MND A;  3HIF A;  4PK4 A;  2H94 A;  2HZD A;  3CO6 C;  4FAS D;  2XGD A;  1CQT A;  3IP4 B;  1D1B A;  4ENM A;  3G71 I;  2K27 A;  3CP8 A;  2R7W A;  2CV0 A;  3AG1 H;  1OQY A;  2OCC H;  1VFC A;  2DCE A;  1E3O C;  1JGS A;  1BC7 C;  5K7F A;  5F27 A;  2QGU A;  3Q9V A;  1AHD P;  1U78 A;  2JPC A;  3HSF A;  3E5U A;  4W1U A;  2R7U A;  3ZMS A;  3T8T A;  1XC5 A;  2R7S A;  1MBH A;  2DMT A;  3K4N A;  1O7L A;  2QM3 A;  2Q2E B;  3H9J A;  3MVP A;  3Q0W A;  2PG4 A;  4UXN A;  5HOO A;  5M3M J;  1PP8 F;  2VQH A;  3F8C A;  1NTC A;  1Z67 A;  3BP8 A;  2CG4 A;  5FFZ A;  2DQR A;  4CSW A;  1QVU A;  3GF2 A;  4BHP A;  1ZR2 A;  2H6B A;  3ASO H;  1F43 A;  1ZHF A;  2P81 A;  1W5T A;  3F8F A;  4IQ4 A;  3OYL A;  2R7D A;  1KQ8 A;  3A0H C;  4RM3 A;  1P7I A;  2KJB A;  3HDD A;  4ZYD A;  1QRY A;  4HOB A;  1ZN2 A;  4MQV A;  3P9C A;  4GGG A;  4IRI A;  2GWR A;  3JAM K;  2EFP A;  1ZGJ A;  3GFL A;  4D5F A;  2R5Z A;  1U9O A;  2E1M B;  1EH6 A;  2V79 A;  5FLV A;  5B1A H;  2Y0S N;  2V1X A;  1XMA A;  1S3J A;  3PIO F;  1V5E A;  3SFZ A;  4E7Z A;  1U0J A;  5DM6 F;  4BQA A;  1B8I A;  2KKO A;  4L0Y B;  2F4I A;  3ZMT A;  1F36 A;  1S7O A;  1IXR C;  3A1Y A;  4G94 A;  5J1Y A;  4KJZ A;  1K6Y A;  2BHY A;  2TDX A;  1ZEL A;  1ONV A;  2AXL A;  6PAX A;  2J5P A;  3OYI A;  1A35 A;  2R92 J;  4OOI A;  1VQN I;  4F55 A;  2PMZ N;  5HLI A;  1STZ A;  4X1E A;  2GA2 A;  1R1V A;  5DCF A;  2M5W A;  3JRA A;  4G7H F;  2MA3 A;  1ERD A;  5BQT A;  1XCB A;  4BQN A;  4PJM A;  4HDV A;  3GTQ J;  1YJW I;  1WJE A;  5LHG A;  2K4B A;  3IL2 A;  2XUB A;  2VC1 A;  1R9T J;  3GZ5 A;  2MH9 A;  4YFN F;  3CUQ B;  2E19 A;  1RUO A;  5H6R A;  3CF2 A;  1H89 C;  5EEH A;  2DQL A;  3ZQQ A;  1SEU A;  3WTV C;  2PMU A;  3FXU A;  3DTK A;  3BTI A;  2PMZ A;  3OIP A;  2F48 A;  3KE2 A;  3ZQ7 A;  1YQA A;  1OIS A;  4C2M J;  4FE7 A;  5K5O A;  5C4X J;  1BIA A;  1IJW C;  2R7X A;  4BH9 A;  3QPS A;  1OFC X;  4GDF A;  5IYD J;  3IWZ A;  1YS7 A;  3IRR A;  4E7K A;  1G3S A;  2M7B A;  4S0H B;  4ZDP A;  5HVQ C;  2QKL B;  5DUK A;  1H9G A;  3BJA A;  2ZNZ A;  2P5K A;  5FRO A;  3MD2 A;  3M07 A;  1HW5 A;  1GV2 A;  1SC7 A;  2DDB A;  3R6S A;  4YG2 F;  2GXB A;  2XVC A;  2XKP A;  2ZME B;  2O8X A;  4ZC3 A;  4BS9 A;  1F1Z A;  2ZSH B;  1PVE A;  1FTZ A;  1X1B A;  3REO A;  3I56 I;  5CQG A;  4EJW A;  4HRI A;  3CMY A;  1N25 A;  3LA3 A;  2X6W A;  4A5M A;  3KEQ A;  2XGC A;  1A36 A;  4KIB A;  2MFZ A;  1RC9 A;  4HX7 A;  4XL9 A;  2I5U A;  2HKO A;  3SHF A;  3GME A;  3BLY A;  3KX2 A;  4MIM A;  4YFX F;  2R7F A;  1I50 J;  1O3R A;  2W25 A;  1O7F A;  3X2Q H;  3F23 A;  4M9Z A;  5E17 F;  3SEQ A;  3LQQ A;  2ETH A;  2HWV A;  1LE8 B;  2VUM J;  4B48 A;  3ZQG A;  3FXL A;  3WTW C;  1GLN A;  1SFX A;  5IT9 K;  4WXD A;  4RDU A;  2QKM B;  1X3W B;  1E3P A;  2DJN A;  1FLI A;  1QGP A;  4N0B A;  1UHM A;  4WX9 A;  5K5Q A;  4KIT B;  3VYT B;  2ZME C;  4O5V A;  2R93 J;  3C2H A;  2X0L A;  3F8B A;  2XAG A;  4MEY F;  4ZYG A;  3ZOB A;  4XSX F;  3FWE A;  4M73 A;  1I1G A;  3OOU A;  2EFW A;  4DYQ A;  2E71 A;  4CZC A;  3OYF A;  2XAJ A;  2WAQ N;  1YOV B;  1X2N A;  1OYW A;  1P4W A;  2E1O A;  2WWY A;  1N78 A;  2GXG A;  1T6S A;  4M3G A;  1Z91 A;  3G6E I;  4XKV A;  3OYE A;  1XPX A;  1TP4 A;  2IBD A;  5HDN A;  1XMK A;  4P1W A;  4UB8 C;  2VJ5 A;  3A0B C;  2FBH A;  3GVA A;  2XF5 A;  2STT A;  1J75 A;  5CVI A;  2WAQ A;  4HQM A;  3L2V A;  2DN0 A;  4KNY A;  2FD5 A;  2OA4 A;  3BQZ A;  1TWH J;  3H3V K;  1B72 B;  2MSY A;  4L5E A;  3LSI A;  1ULY A;  2V9K A;  1JUM A;  5D6E A;  3F0C A;  3KLO A;  4ASN A;  4UVB A;  3OS0 A;  4GYI A;  4R8H A;  1OKR A;  1I6H J;  3J7Y J;  2E34 A;  2QEN A;  1MBG A;  1W5C C;  2M3A A;  3HB9 A;  1A5J A;  3GLX A;  1XGS A;  4A6E A;  1KGS A;  4CYC A;  4KN7 X;  2CQQ A;  4DBQ A;  1UZC A;  3KZZ A;  2W4S A;  3CES A;  5JLW A;  1QHG A;  1YIJ I;  2PMH A;  1I6X A;  2L2O A;  2BW3 B;  4V2F A;  2LBF A;  3B6A A;  3BQY A;  5CKT A;  1BI3 A;  2NS7 A;  2IA2 A;  2FF4 A;  2HS5 A;  1BL0 A;  4RBO A;  2HPI A;  1XG1 A;  1S72 I;  3RDI A;  3S3O A;  3ZR8 X;  1JHF A;  4A3E J;  2LSO A;  2NVX J;  1UEL B;  3BCA A;  4WXC A;  3DXJ F;  4XOP A;  2DA6 A;  3ABK H;  3CJT B;  3Q3S A;  1BIB A;  2FRH A;  3MKL A;  3S93 A;  1AKH B;  1FYL A;  4K2E A;  4BXF A;  4CH7 A;  4L9T A;  3MAJ A;  3GX4 X;  2KJC A;  3CC4 I;  2K4J A;  5TJJ A;  2GQQ A;  4ZH4 F;  2G0E A;  3ERM A;  3KP7 A;  1UAA A;  5JHU A;  2R5Y A;  3IH3 A;  2DK8 A;  2ICW G;  2Z16 A;  4EEF G;  1V54 H;  3GUD A;  2VBW A;  2P4W A;  1PUE E;  2QWW A;  3CUO A;  2EFN A;  2ISZ A;  2QF7 A;  1FSE A;  4XOT A;  3V7S A;  4G12 A;  4HNT A;  2VON A;  1IUY A;  1JI8 A;  2K5C A;  3CC7 I;  3VOD A;  5HS8 A;  2E2I J;  4MNU A;  2L5Q A;  1OCP A;  4A12 A;  3CTA A;  3QOE A;  3E6D A;  3V8J A;  4DZJ A;  3I4M J;  2ZJR F;  1REP C;  1W5S A;  2D1H A;  2DA2 A;  3JRC A;  4R1H A;  4AIJ A;  4BEH A;  4ENK A;  5EZH A;  1TWA J;  2OUM A;  2V9V A;  4OIR F;  2GIV A;  5IP9 J;  4BDY A;  3ZMZ A;  4ETS A;  2HVS A;  3BWG A;  4A3D J;  1T38 A;  5KAI C;  3SDG A;  3KIO A;  3ZGK A;  1JHH A;  2E7X A;  4WWC A;  4MEX F;  1U3E M;  2BHZ A;  2MYS A;  2HTS A;  1D8J A;  1SVM A;  2RN7 A;  5ED4 A;  2QQ8 A;  2YR2 A;  5FLX Z;  2CW7 A;  3P7N A; 
#chains in the Genus database with same CATH homology
 3CCS I;  2H8W A;  3J7Y J;  2E34 A;  1YIT I;  1VQ7 I;  1YJ9 I;  1VQ6 I;  5JVG F;  1VQ4 I;  2E36 A;  1VQL I;  2OTL I;  3CD6 I;  4IO9 F;  1YIJ I;  2ZJQ F;  3CF5 F;  1VQO I;  3I56 I;  3CCE I;  2ZJP F;  1S72 I;  3CMA I;  2NXN B;  1VQ5 I;  1MMS A;  3DLL F;  5DM7 F;  3CJT B;  5GAH J;  2OTJ I;  1YI2 I;  4IOC F;  3CC4 I;  2E35 A;  3J7Z I;  3PIO F;  2K3F A;  1FOY A;  5DM6 F;  3CCU I;  1FOW A;  4UY8 I;  3CC7 I;  1VQN I;  3CCR I;  1VQP I;  3CCV I;  1VQ9 I;  3CC2 I;  2ZJR F;  1ACI A;  5GAG J;  5GAD J;  4V19 K;  3G6E I;  1FOX A;  1YJN I;  2QA4 I;  3CCQ I;  1VQM I;  1YJW I;  3PIP F;  2QEX I;  3CCL I;  3CCJ I;  3I55 I;  1VQK I;  3CME I;  3G4S I;  1Y39 A;  2FOW A;  1YHQ I;  1VQ8 I;  1HC8 A;  1QA6 A;  5GAE J;  4IOA F;  3CCM I;  2JQ7 A;  3G71 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...