1YITI

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yitI00
5GAGJ 5GADJ 5GAHJ 3J7YJ 2ZJQF 3CCSI 2K3FA 3CMAI 4UY8I 3CMEI 1VQOI 3I56I 1VQ5I 3CCEI 4V19K 3I55I 4IOAF 1VQ7I 1VQLI 1FOYA 2E34A 5DM6F 1YI2I 5JVGF 2H8WA 3PIPF 3CC7I 2QA4I 2E35A 3CJTB 4IO9F 1VQKI 3G6EI 3CCJI 1YJNI 1YHQI 3CC4I 1VQ4I 3CCVI 1HC8A 3DLLF 1YJ9I 5GAEJ 2E36A 1VQPI 2NXNB 1QA6A 1FOXA 3CF5F 1MMSA 2ZJPF 4IOCF 1Y39A 3CD6I 3CCMI 1VQ8I 3PIOF 1ACIA 1YIJI 1VQ9I 3J7ZI 3G4SI 2JQ7A 1VQNI 2OTLI 2FOWA 3CCLI 3G71I 2OTJI 3CCUI 1VQ6I 3CCRI 1YJWI 3CC2I 2QEXI 1YITI 1S72I 3CCQI 5DM7F 1VQMI 2ZJRF 1FOWA
chains in the Genus database with same CATH superfamily
2ADUA 1E2XA 2VJ5A 2EJRA 4ZYGA 3J7YJ 3G1OA 1LE8A 4A3IJ 2HQAA 1R49A 2FE3A 1IV8A 4RAFA 4RMNA 2AO9A 3IL2A 1IN6A 1K6OA 2RDPA 2ZMEA 2VUMJ 4HSRA 2R7SA 1Z77A 4BGDA 4IOAF 1XS9A 5J1UA 1HSTA 3L2UA 3DEWA 3VB2A 2COMA 3Q0UA 2KIMA 5LRRA 1J59A 2LF7A 2WV0A 3ZP5A 2DT7B 2FNAA 4O3MA 5IP7J 3WU0A 1EH7A 2FA5A 1GVJA 4EJUA 4ENMA 2KMUA 1G2HA 1VFCA 5TRDA 4EEFG 2L5QA 3GTPJ 1SFXA 2DT5A 5K5QA 3BWGA 4AVPA 4FCYA 1ZRDA 4CHUA 3JAMK 3KP3A 1RR7A 3OSFA 2VODA 3W6KB 1BM9A 1F5TA 3F8MA 3OSGA 2KRCA 1R1VA 2QYOA 3GXOA 2HNHA 1T39A 2A68F 2TRTA 2QSGX 1JUMA 3JREA 4C3IJ 4F92B 5HLGA 2X9DA 4G8XA 1QBJA 4PGHA 3BTJA 4BE1A 1XSVA 3M8FA 5JHFA 5FKKA 3S1MJ 1ETYA 3ASOH 2V9KA 3GFLA 5LGNA 1SD6A 2IA0A 1YS7A 3HPHA 1S7OA 1VZ0A 2IGOA 2BY2A 2F6CA 1HF0A 2VXZA 1F1ZA 1JJ6C 2HOTA 2VBZA 4M3GA 2OQRA 2HXOA 4A93J 2G7UA 1G3TA 4KUMA 4BE0A 4CDGA 4LK0F 3WGGA 3I54A 4BKXA 1X1BA 1Z6RA 2ZMEC 3LAPA 3CC2I 3ZMTA 2YR2A 1YITI 1HA8A 2WC2A 1LEAA 1FMWA 5LFAA 2R93J 1BI2A 2K4BA 4RB0A 2VBWA 5IT9Z 4NBQA 2ZC2A 3BTLA 1BJZA 3F9KA 2VJJA 2CRGA 2CU7A 3IWFA 3K9TA 2D1VA 2FQ4A 2BW3B 4KICA 2XPUA 4A3CJ 4B44A 2CQQA 3CUQB 2PMZN 4FE4A 1K4TA 2Z33A 4HDUA 3COAC 2DT6A 4CGZA 4Q47A 2MYSA 2RC4A 5E1ZB 3H9JA 4A2UA 4BE2A 4ANJA 1IXRC 2HU9A 1H8AC 1YG2A 2FD5A 5EYRA 1EA3A 2CGPA 3HPGA 3S3OA 1Y0UA 2HR3A 4UVCA 2P6SA 1WGXA 2DMTA 1GV5A 1AOYA 1OCZH 2HWVA 3H0DA 2EK5A 1WHUA 1LNWA 2GQQA 4DYRA 2ZFUA 5B66C 2EIMH 4E4HA 2K86A 1ETKA 2DQLA 3DBRB 1ZH5A 1SVMA 3K10A 4RGSA 2M4GA 3DBHB 5FD5A 2MW8A 4A3BJ 3FXLA 4HNUA 4A12A 3S8PA 5D6FA 2A3SA 2NRAC 4MNUA 3OL3A 3WGIA 2GM4A 2QQ9A 2F2EA 2X85A 2WWYA 2DOFA 4W1UA 5CQGA 2H27A 1P4XA 3BQYA 4TV7A 3K0LA 1SC7A 4BACA 2WV1A 2XUBA 1HQCA 3KP6A 3ZMZA 1WJ5A 4FX0A 3NEUA 2PLYA 2BY0A 3A03A 4GYIA 1E17A 3AL0B 1ON1A 3RPQA 3JRCA 1QVTA 2CW0F 3GCMA 2DDBA 3DKXA 3OOUA 5E3NA 1VTNC 5J6XA 2VBYA 3ERED 1JT6A 3S3NA 2L4AA 3EYYA 5FRMA 2BVLA 4QSHA 2XAGA 3CF5F 4NHJA 3CQZJ 3L2RA 2ZJPF 2E1CA 5EGOB 1HW5A 4B3XA 3ABMH 4E7LA 4LOCA 3FHNA 3TGNA 1RR8C 2MC3A 2L7ZA 4YG2F 5FLXK 4E7ZA 4J01A 3C2BA 2Q8KA 1QHGA 5K7ZA 1KQ8A 2CV1A 2QQBA 2XRNA 4HSTA 5D5XB 2EZKA 3U9GA 2ZXJA 5EJCA 2HVRA 2V6EA 3BOQA 3K70C 1Z91A 3BTIA 2BXYA 2GAUA 4L5IA 5HOOA 2DLLA 3CJQB 1R36A 3F8NA 4G7ZF 2VC1A 1FYLA 3HZJA 2UXNA 5EGOA 2Y0SA 2M2EA 5BNGA 4HA8A 2STTA 1Y0NA 1W5TA 3RYPA 2B0LA 2V1UA 2P81A 1YW7A 4ZZDA 3BJAA 1R4MB 2VKDA 3H3VK 3AG2H 5E3MA 3CZ6A 3L7WA 2NOGA 1JGGA 5B1BH 3BR5A 3MWMA 1VF9A 3CDLA 2L9VA 3DEUA 2KIFA 2A6TA 3GFJA 5L3CA 1MD0A 4UY8I 3FF5A 4BDZA 5E1XA 2IXSA 4BYYA 3GFIA 4PSWA 5LHIA 4RS8A 2FJ1A 4V19K 3HKZN 1RIOH 4HBLA 2E5NA 3HIFA 4U0YA 1BL0A 3I4MJ 4HNTA 4EGYA 2VPRA 2E34A 4BJTA 1UZCA 1R1TA 3ABKH 1L3LA 3JAMZ 1FEXA 4IRIA 1J7KA 2NS0A 2X1CA 1RZ4A 3BR0A 4L0YB 4MLOA 4KMUX 3A4CA 3AKZA 1FJLA 2OU2A 2DA7A 4HF2A 3ZOBA 5F27A 1J9IA 1PP7U 1IG7A 1Z21A 1T33A 4WXDA 3AG1H 3E6CC 3CCJI 1YJNI 1NH3A 4A5MA 3FK6A 2O03A 3PO3J 4OOIA 2DFEA 2DJNA 2WB1N 3ZQHA 2E2JJ 3JTGA 3DTKA 1IO2A 4XKCA 3IKVA 5FGMA 4D7MA 1QHHD 1AHDP 1D0YA 2FXAA 4YIIA 3BTCA 5F64A 1QZEA 1XGNA 1QA6A 4NQWB 2ZO4A 1PUEE 3K1MA 3SZGA 4AM3A 1SFOJ 2VC0A 1ETQA 3JRGA 3MKYB 4B09A 5GPAA 4LGWA 1KYWA 1PVEA 1SVOA 4FX4A 1QPIA 4BNCA 2VQLA 4XM3A 5FLVA 3HOZJ 4HG2A 2JQ7A 1TQPA 2XB0X 3DEEA 3HL2A 1UAAA 3ABUA 1I6XA 3IH4A 1O57A 1ODDA 1R1UA 1SVLA 1U5TB 1BR1A 3DP7A 2L01A 3LSMA 4A0ZA 5IT3A 2OCEA 4BDYA 4AC0A 4CZZA 2E1OA 2GA1A 3TL4X 2A61A 2BZTA 4NQWA 2XF5A 2E19A 3KP4A 2XVCA 4A3JJ 1IDYA 4I7HA 4YELA 3I5UA 4IZZA 1G8XA 4N4NB 2ZFWA 3SFZA 3QODA 1KYZA 3VYUB 1HLVA 3MEXA 5HVQC 1FSHA 2IA2A 1APLC 3JRDA 5EDNA 1T95A 3GBGA 4FISA 4HNVA 1N75A 1U9OA 3V7CA 2WA0A 1AKHB 4M6YA 2HOEA 2Y30A 3E6MA 2STWA 1MH4A 1YQAA 3RKXA 1VQ5I 1Z7UA 1ZG3A 3S16J 4DJAA 3HRTA 5FROA 2GZWA 1FYMA 2E60A 2IGMA 1T38A 2A5YB 2CQXA 2JTVA 3DPLC 5J47A 2FBHA 3WU2C 3BG7A 4JOMA 4LK1F 4U0VA 4NC7A 4BUPA 1LDDA 2UZKA 4L9NA 1YRNA 3RCOA 4IEJA 1FOYA 1BI1A 1B8IB 1XN7A 1R5ID 3LSHA 1RKTA 2E5ZA 1S8NA 1BI0A 2EQRA 3WHBA 3MFKA 1BA5A 5DCMB 2GIVA 3WTYC 4BHCA 4MQVA 4PDKA 1WJBA 2ME0A 3S3MA 3AG4H 5IP6A 3MQ0A 2D45A 1WCMJ 2LFBA 4IQJA 1FIPA 1BN5A 2WBMA 2DCEA 1FBUA 1F4KA 1DU6A 1AWCA 1WJEA 2DA6A 4KT5C 5CPRB 1XGSA 1R7JA 1ITYA 3HGYA 4YIRX 1B8IA 3OR1C 4JX6A 3MZYA 3FXJA 1Y8RB 3D5LA 2W48A 4RGXA 2AXTC 5FLXZ 5DCMA 5LGTA 2ZXWH 1ZREA 2DBBA 2W25A 1RNLA 3GMEA 3OIPA 5KVRA 1JGSA 2Z3YA 3Q9VA 3K69A 1BJAA 5J4VA 2VB6A 2HXIA 4AIDA 3PIOF 3BZKA 4BY7J 2V6CA 2D2WA 1YIJI 4X1EA 2ZNZA 2V9VA 2X0LA 3GLLA 3OIQA 3EUHA 1ETWA 2BOLA 2X6YA 4C30A 4KJZA 3MKWB 3LQRA 2OA4A 3HEFA 2FOWA 1O3SA 1HKQA 3E1SA 2KHMA 3F6VA 2KQRA 3QPTA 3HM5A 3KFWX 5CJ9A 1LJ9A 2VI6A 3K4CA 3S93A 1FY7A 2WY8Q 4XR6A 4M3FA 4EV0A 1T6SA 1W0UA 4QWQA 4XLCA 3K4KA 4HPQA 4OAZA 4A0XA 1I27A 5F6FA 3MMYB 2KDZA 1VQMI 2KLOA 4CCMA 4BBRJ 4XSZF 3LA3A 4BHBA 3CO7C 2OC6A 5DUKA 3FXKA 1MGTA 3WTTC 2B7EA 2HTJA 2ISYA 3RZDJ 3GTMJ 4W97A 4DYQA 4L5JA 1Z6TA 3H35A 1GVDA 2LDUA 2DFHA 4EJVA 3LA7A 2O7OA 2FF4A 1SFKA 3GTOJ 4D9JA 3FMQA 1VQ7I 3K6GA 3O6BB 4OMZA 1J0RA 1WJDA 2LRDA 2R0QC 2JJ7A 2D1HA 2JK3A 5ED4A 1RPWA 3EDPA 2JA5J 1OCRH 4F52A 2R7DA 2XC7A 2QA4I 3FXRA 3KX2A 2NS8A 1UELB 1P7JA 1V54H 2I8DA 4I0AA 3ZN0A 3I53A 1JTXA 2IA1A 2MC4A 3IH3A 1NHAA 1ZGJA 3D5RC 2LNBA 5DCFA 3SEZA 2CO5A 3J80K 1HC8A 3OS2A 3KYCB 4E7SA 5HODA 1ZG1A 1MNMC 2DXIA 5M3MJ 1GXQA 3PNYA 2I5UA 3NWSA 3PM1A 4MIMA 3OYFA 4G6TB 4IRGA 5D8LB 4FQGA 1R5GA 1LB2A 2H1KA 1GLNA 2OJED 3ECHA 4R79A 4J00A 2Y0MA 4PJ0C 1SANA 1X4PA 2CUZA 1I5ZA 5H20A 4BJ5C 1FYKA 1AU7A 2M87A 4U7BA 1P7IA 1MIJA 1USSA 1K61A 2ZXHA 4HX8A 3R0JA 4M6VA 3WE2A 3DCFA 1H89C 2XAQA 2XGEA 3G1MA 2DA5A 1B6AA 2DYRH 3M8EA 4M72A 3FMRA 4FHTA 2V7FA 3OIOA 2ID6A 2MBFA 2VL8A 4FETA 4PZJA 3BZCA 4EGZA 1QPMA 3M07A 1XPXA 2FNPA 2JA7J 2JA8J 1MBKA 2DI3A 2KP6A 1QRYA 5H6RA 5C4JJ 2BY1A 4KITB 1ERDA 3KEQA 5K7FA 2CUJA 5K5OA 3LSGA 1L0OC 3KEYA 3I59B 4LIVA 2DMUA 3BJOA 3F72A 3QPHA 4ZDOA 3K4MA 2LG4A 2JSCA 3LA2A 1KA8A 2CQKA 2K85A 3JTHA 3ZR8X 2VBXA 2M9HA 3TP3A 4CO8A 4O6JA 4QPQA 1X1AA 2QBYB 1YIOA 4NNJA 4BHPA 2V1DA 2X4HA 2IW5A 2KJBA 1WJCA 3PSFA 1JKRC 4HEA2 3CMEI 1IAWA 4I76A 3I56I 1YS6A 4PFOA 4BBSJ 2B63J 1QO0D 1V3FA 3KEOA 1DP3A 2EFQA 3LSJA 3I59A 3OYIA 3LFUA 1X3WB 4CCKA 2L0KA 1Q1VA 3JW4A 4M9ZA 1MBEA 3FX3A 1X58A 1TNTA 3GUDA 4EM0B 3G73A 1U8BA 4AD9A 2QBYA 1V55H 1Z3XA 4FT8A 2VXDA 1W7PD 1KONA 2A05A 1RUNA 5F1JA 3SZPA 1F36A 1GUUA 2L3DA 3EETA 2F5FA 3OOPA 1ETVA 1ZELA 2TDXA 3CJTB 3BCAA 1TBXA 1FIAA 2JN6A 3QP5A 1M1EB 3A1YA 2NVXJ 3EPZA 2D5VA 3PJRA 2DW4A 2Y9YA 1TW3A 2LP0A 2XAFA 1V5FA 1KZHA 1FBSA 2EV6A 2YPRA 5FFXA 1V4RA 4XLAA 2JPBA 5HNHA 4AUXA 1KU2A 2NNNA 1U2WA 4B48A 1W1WE 4LLNA 2KRHA 2R7OA 2CH0A 1ULYA 3ZPLA 1P4WA 2LTPA 2HZTA 2KZVA 2LF8A 2X1EA 5M3FJ 2H94A 3OYNA 3IRQA 3HOWJ 3ABLH 2EIJH 2AQFA 2JRTA 2DPDA 2ZNYA 3CP2A 1EKEA 5GTHC 4IX7A 1O3RA 1EH8A 3RTRA 4M73A 3NQOA 2LH9A 2A6EF 1QNTA 1MH3A 3G71I 3GZ6A 3MZHA 4L9JA 3E5XA 4A6DA 2Y0SN 1SD5A 3PUBA 1QGPA 2ZXIA 3WTVC 2EIKH 4XQFA 2IEKA 3RPUD 1GHCA 3DU5A 2IS1A 4P5OA 3U1DA 2FU4A 1SMYF 1SD4A 3V7RA 1LVKA 4ENNA 3A01B 2BEOA 4Y4RA 2AQEA 2F4OB 4RM3A 4KN4X 2KIUA 5KAIC 1VNDA 4HF0A 1OJLA 1UG0A 2CQNA 2X51A 1Y1WJ 2P0WA 4BL0B 4IRHA 3CMAI 4G9YA 3BR1A 3IAM2 3R60A 1XG1A 1D5YA 4LIUA 3N4MA 2ISZA 5DTDA 3WE3A 3EUAA 2M3AA 3FDYA 4GO1A 1OCOH 5D8KB 2JWTA 2HDCA 3BPVA 1KGSA 3OYEA 5F04A 2AS5F 2IP2A 1I3AA 3KIOA 4G6DA 1ON2A 3HGGA 1DQUA 2W85A 1BR2A 4NUBA 5J3LA 5DM6F 3CMMA 3A01A 2XSJC 3BR3A 1HSJA 4R8HA 4I2OA 2M5WA 2O3FA 3QYEA 1OYIA 3F8BA 2EZLA 3J80Z 4HX7A 1EH6A 1WJAA 3BT9A 3VDXA 4Z2YA 1W36C 2CYYA 1ZRCA 4XLPF 3W2VA 1HKTA 4ESFA 1IRGA 2P5KA 4HAMA 5EEHA 4ESBA 2QUFA 4IO9F 4XL9A 5J8CA 1JKQC 4KISA 1W5SA 4I6ZA 3CC4I 1R6RA 4DW6A 4BXFA 2FQ3A 4OIOF 3VSLA 3SQNA 1BC8C 2IGKA 4GCVA 4HLYA 3IH2A 3ZMVA 2NNYA 2K02A 1UG2A 2N8GA 1LFBA 3BCBA 5HS7A 4CSWA 2LMDA 4N0BA 2BW3A 1OKRA 2VOPA 1YOVB 3L2VA 3CUQA 4AYBA 3RZOJ 4A3DJ 1ZAOA 2XROA 2HEOA 1SD7A 4GRIA 2ZJ2A 1K6YA 4Y52J 3GZNB 3M8JA 2EILH 5BPIA 2V9PA 2PFBA 4RB1A 4ENKA 2O61A 3H5AA 1DGRM 2COBA 1XDSA 2JSPA 4JX4A 4NC6A 2M34A 2Y69H 3BG9A 3KCCA 1E3PA 1STZA 3HYIA 5FFZA 5DUIA 2XB5A 2K9MA 3K4LA 3FZVA 1JXSA 5J8FA 2DK5A 4KA4A 5H6QA 4ESJA 1R5HA 4I09A 1IW7F 1KU3A 2FRHA 2OAZA 2G0EA 3AAFA 1REPC 2VT2A 4CCNA 3PFYA 2W1OA 2IS2A 3BY6A 3E6DA 1WZ2A 3V8LA 2KISA 2DQRA 4S04A 5EF6A 2XDVA 1T2KA 1A31A 3ROUA 4MTDA 5IPAA 5F08A 4Q48A 2XPWA 1OR7A 1IUFA 3TQNA 2W7NA 1O7FA 3I3LA 3MN2A 1PYVA 3MKLA 1D0ZA 2R7XA 5E1WA 3A0BC 2R7FA 2Q1ZB 3ZQFA 2RVCA 4I99C 4EATA 3KYLA 2R7RA 1SAXA 2QSHX 2ESNA 5D6EA 2CMPA 4OIRF 2X1DA 3LSRA 1ORKA 1RRJA 4ZC3A 5GAHJ 1UB9A 1IN7A 3Q9SA 5DS9A 4E7KA 2K3FA 9ANTA 5HLIA 3K2ZA 4KIBA 3VSKA 3C7JA 1YW9A 3HRMA 4XN3A 3T8TA 2HTSA 2GWRA 3RJPA 5K7HA 4KDPA 2EV5A 2CFOA 3K4NA 2KJCA 3S17J 2R7VA 3VWBA 4UV8A 3I55I 2MLKA 2WAEA 3TW7A 3OWTA 1IZ1A 2E7XA 4OAYA 4MTEA 1A6IA 1WQ2A 2EFOA 1UCRA 2DJIA 3N97A 1JHFA 3JSPA 1ONVA 3CTAA 2CG4A 3CUQC 4LG3A 1ZLJA 1FNNA 2ESHA 2DFFA 4IPAA 5KK1A 4F55A 2Z5UA 1A5JA 5LEJA 2JMWA 4S05A 3ZQ7A 5M5XJ 3E3VA 4HF1A 2H1LA 3JR9A 1IRXA 1KQ0A 1VQ4I 2Z99A 3OS1A 3LWFA 3CO6C 2WAQA 4C2MJ 3CCVI 2A07F 2JA2A 2M4KA 1Z9CA 4NC8A 4XLHA 1XX5A 1DPUA 3QYFA 4C2TA 2LYCA 1FBQA 3BG6A 3K4JA 1GXPA 3BR2A 2XPVA 4IJAA 3E0JB 1HXDA 1C0WA 5D5UB 3FISA 4M3EA 2DODA 2E71A 3EQLF 1OR7C 3TMOA 3WTUC 3KLNA 3U21A 4C3JJ 3H36A 1JI8A 2E2HJ 3PNVA 4QIWN 2O5RA 1ACIA 1D1CA 4YFKF 3HOYJ 3PO2J 3C3WA 4JQFA 2MG4A 1EF4A 3AL0C 4UV9A 3QQAA 5LHGA 1IF1A 2IVMA 3WGHA 3J7AO 1QZZA 3NAUA 4UUTA 5KHDA 3ZQQA 1WI3A 3GF2A 3PUFA 1XDUA 1YE9A 3ZCOA 1TW2A 3F21A 1Z1DA 1CGPA 1WSUA 1DUXC 4U87A 1K7AA 4CYCB 1H88C 1JKPC 4XK4A 3OL4A 4CXFA 1BW6A 1IRFA 1PJRA 1HKSA 1S7EA 3LOCA 4LB5A 1TQMA 5DD8A 1WI9A 5JVTA 4C2UA 2DDAA 1N77A 2DPUA 2JVGA 4MGRA 3FIWA 4F3QA 3K70D 2KFDA 1T08B 4CH7A 4HLXA 4XOTA 3JSOA 5HDKA 2XKPA 3OYCA 2X48A 5EZGA 3IRRA 2DA3A 3GTLJ 3M9AA 2UXXA 2Q2EB 5BS6A 2VLAA 2W57A 1E0EA 3OYMA 1X1PA 1XGOA 2Q0OA 2Z2SB 4IVNA 3LSTA 2F5EA 1EJ9A 3F22A 1JUPA 4IKFA 4XKWA 1J5YA 4HQMA 4LG0B 1FP1D 3CJRB 3GX4X 2CJJA 3G3ZA 4E7HA 3HC7A 1HW2A 3J7AY 2CS3A 2K9SA 3OYDA 3OV8A 2HFHA 4A3FJ 1JHHA 2CW8A 2EB7A 1J09A 2RAEA 2F4IA 2O6GE 2HPIA 1MJAA 4E6KG 5LGUA 2VIXA 3D1NI 1U5TA 2Q2EA 2FBKA 3T0YA 2HGCA 2A6HF 4BXUA 2HDWA 5J1RA 3DV8A 3DTIA 4HV6A 3IP4B 1X1CA 2VQGA 4B1RA 3Q0VA 5D4SA 2IS6A 5FO5A 3TEDA 4I02A 2LC2A 4LG0A 5JHUA 2RQPA 3FMSA 2P5VA 5HS8A 1LEBA 3MKZA 1ZGWA 2ZSHB 3K7AJ 2MA3A 2L7MP 1MNEA 2G9WA 3ZN1A 1TWHJ 3MD2A 2LY9A 3R61A 3PL8A 1MDMB 3MAJA 4M3BA 3VFZA 3VYRB 4FASD 3HG9A 3HUGB 2QCOA 4F91B 5KNLA 1AKHA 4UVAA 3L2QA 4Y15A 4LB6B 3SDGA 3ERMA 3TW6A 3M3YJ 4KYWA 4LJZF 2DK8A 1S29A 1LDKB 2RV8A 2CSOA 4XOPA 3QU3A 4CUGA 2W4SA 4F93B 3BPXA 2NVQJ 5FKMA 1HBXG 1IXCA 4Y7NJ 3I64A 3QOPA 3GTGJ 2P4WA 4G6QA 3JRIA 1VQNI 1SFEA 1XMXA 2EBIA 2QF7A 5E20A 1MDMA 1IV6A 2K27A 4AU7A 2V1NA 4P96A 3AFHA 3HUGA 3L00A 1ZN2A 4A6EA 2HYJA 2LSOA 1GDTA 1NK2P 2DOEA 2JUGA 2OD5A 1G6NA 1W7PB 1V5EA 4A69C 5H2FC 2R7TA 4UHTA 3F6OA 1TP4A 2R5ZB 1HCRA 5FKLA 3HBLA 5DV5A 5F0CA 4XKBA 4QLCU 4KNYA 3J81K 3OYJA 4PSXA 2O9LA 2KPMA 2PMUA 4XRFA 4YIFA 1R58A 3UNGC 3IV5A 2QVOA 3DLAA 2HDDA 1U5TC 2NOJB 3BJ6A 1Y8QB 4NB5A 4WXCA 3TO7A 2DAOA 2E1MB 3BDDA 3M7GA 5CLSA 4OIQF 5HLHA 2X6OA 4EJOA 2HQNA 2BY3A 1DPRA 2Y9ZA 1FZPB 3N05A 1Y56A 1KQ9A 3SZTA 1JUSA 1SMTA 2Y75A 4XLFA 1RI7A 2R5ZA 1BW5A 4G7HF 3PNTA 4ZYAA 5L3BA 5ICEA 4IHWA 3TOBA 5IYDJ 4GGGA 4DYCA 3JRHA 4BQQA 4FE7A 1R22A 3W6JB 2EFPA 2H6CA 3HTUA 3EUKL 3RKWA 2VPLA 2DA1A 4ZTJA 4A5NA 2IAIA 3SXYA 1HDDC 3OYGA 2AHQA 5K5RA 2RGVA 3FM5A 3S2DJ 2PX9A 5JFRA 1ZQ3P 2LBFB 2PEXA 3T8RA 5TJJA 4ZH4F 4OIPF 3WU1B 3CMYA 3R4KA 2E36A 1QU3A 3OYBA 2PQ8A 4J19A 4B47A 1YX3A 2JVHA 2MD5A 3ZQLA 2OZ6A 3V8KA 2XV4S 5IYCJ 3VODA 1MMSA 4A3MJ 1S7AA 2F5DA 1JKOC 5CVRA 4XORA 1IDZA 1JTYA 3HJEA 5AONA 1B59A 1OYWA 1O4XA 4IL6C 2P7VB 4YRVA 3FXOA 4BU2A 3V4GA 4ZDPA 3EUHC 2LBFA 3P9KA 2HVQA 1YO5C 2M8EA 3H1CA 5D5WB 1TWFJ 3P7NA 4P9UA 4GYGA 2NVYJ 1MKMA 3V42A 1P2FA 4LD5A 3LL7A 3C2GA 1LQ1A 3I58A 4I01A 2MABA 2OTJI 1XB4A 1R71A 2V4JC 5L3FA 5FKNA 3P9CA 4GFBA 4EJTA 5AIQA 4XKVA 3UR3C 1K83J 1ZK8A 3VEPA 1S72I 4RA2A 1E3OC 3ZXSA 3RIRA 2M8GX 3PQJA 1UHMA 5B1AH 1HDPA 5HDGA 3ZMDA 4ZZLA 3DKYA 2JUCA 2DMQA 3TDUC 3PQKA 2GXBA 2LY1A 1AA7A 3KP2A 2CV0A 2VKHA 1P9QC 2L7FP 1GV2A 3A02A 4U0WA 3ELKA 5ILSA 2JA6J 3CCEI 3OYAA 1DGWY 2QENA 1D5VA 5AIPA 1FMVA 1S3JA 3H3ZA 4G12A 1QQIA 1SEUA 3FKJA 4D0PA 3ASNH 2H8WA 3PIPF 3I9V2 2DMPA 1WRJA 3W2WA 4BS9A 4AIHA 2YUSA 4WX9A 3FHZA 1Z0XA 4JP0A 2E35A 4DZPA 1TWCJ 1NK3P 4F7ZA 1FC3A 4PK4A 1A36A 3DU6A 4ZYHA 1WPKA 4LLGF 4UB6C 3FBIB 4LITA 1FOKA 1U9NA 2M30A 4V2GA 2VKEA 1G3YA 4KMFA 5HDNA 1XMAA 4P9FA 3B6AA 3GTQJ 2GOMA 4AYBN 1YTYA 3GZ5A 1ZARA 1DU0A 1ZHFA 2ZSIB 4I98B 2L4MA 1D0XA 1TT5B 1VQPI 3W6VA 1K79A 5CYVA 1I6HJ 4RAGA 2MH2A 3DPTA 4PCQA 2RQQA 3H9QA 1N78A 1H9TA 4L0ZB 5C4XJ 4AIKA 1F9NA 1Z3YA 4PJLA 5A2QK 2LK2A 5ICGA 3ML6A 2XHKA 1X1DA 4U88A 5LLQA 2IJLA 3FXMA 1HOMA 1G4DA 1S6LA 5IP9J 3DPUA 3RKYA 4X6AJ 4IHTA 2RNJA 3O8HA 3CCUI 3LNQA 3J81Z 3Q5FA 4E7JA 4KT6A 1YYVA 3RYRA 1G59A 3HDDA 3CDHA 1X3ZB 1O7LA 2VKVA 4UXNA 3RQ4A 4RM2A 5E3OA 2PI0A 3S32A 3ZQIA 4UUSB 3C18A 1J75A 4OU0A 5F1RA 3WODF 2K9NA 3ISPA 2VT3A 3HHHA 1ZR2A 1X3UA 3K2AA 2MLGA 3SJMA 2BHYA 4Z6YA 2QQAA 2UWMA 4ENJA 1WVRA 2DMNA 2O0YA 4Y13A 4CZCA 3IC7A 2Y2ZA 3G1LA 1UHWA 3WG7H 3GYHX 1IGNA 2JRMA 4Y3OA 2WADA 5JLXA 2M7BA 1R23A 3D5SC 1NG6A 2XGDA 1B72B 5F0HA 5E8IA 3HOVJ 1OLTA 2DYSH 4BQAA 1ETOA 4UUSA 1I1SA 2M1BA 1Z67A 2FMLA 3MZ8A 3O2PE 4C9YA 2DFIA 4RB2C 5LHHA 2BYVE 2QZ8A 5D5VB 2F4MB 1ZG5A 1XSXA 2QLZA 5EG0B 3HOXJ 3E6BA 3JRFA 2IGNA 1OCPA 2ELHA 2EZIA 2GA2A 3GTJJ 1MMAA 2BBYA 2JT1A 2ME6A 2ELJA 2OZUA 1N25A 4I0BA 1D1AA 2K3PA 1PDNC 3S1RJ 1B1BA 2HOAA 3O8GA 1B72A 2WAQN 5J4YA 2KIQA 4ASNA 5ILVA 3EYIA 3PSIA 1BOAA 2OPTA 3IKTA 1G3WA 2M0MA 4EJWA 2R4GA 3JCUC 4YEJA 2KL4A 2O8XA 4FTHA 3SYTA 4Y17A 3L2CA 1R9TJ 5BPDA 1IN5A 2VQCA 5EG0A 2FBIA 1SFUA 2NXNB 3R6SA 1FOXA 2CFXA 2GXGA 2YS9A 3HOUJ 4B43A 3E7LA 3QP6A 4L9TA 3CCMI 4V2FA 4WK8F 3KZYA 4RDUA 2WAFA 1VQ8I 4MFDA 3FBNB 3TBIA 3OR2C 4ETSA 2EINH 4C3HJ 3B02A 2QM3A 5FJ8J 2K5CA 1B9NA 4R1HA 2F48A 1MMGA 3ZRGA 4WXHA 4E7IA 1P6RA 2L9RA 3TP0A 5FKOA 2MD0A 5FRNA 2HQ5A 2L2OA 4B3AA 3V8JA 3F3XA 4PFPA 2QWWA 2DA2A 1YJWI 4HQEA 5ILUA 4ABZA 1A35A 4PGGA 1OQYA 1FT9A 3BC8A 4CYDA 3KPHA 5L3EA 1BIBA 2RREA 5FB2A 1XSDA 1BIAA 1RETA 2DTZA 2A69F 3VOEA 5K1YA 3TKYA 1FPQA 3HXLA 2M7AA 3MVPA 4PJNA 5GAGJ 4CCLA 5EEAA 4A3KJ 4HDVA 2VN2A 2DOAA 2P5LC 2CV2A 1P4AA 1XCVA 4IHYA 2YX4A 4ZJZA 3LAJA 1Z7LA 3C2HA 5HS9A 2V26A 2XRLA 5ERIA 1D8JA 2NYXA 4EVIA 4UUVA 1VQLI 2W00A 2LR8A 2IBDA 2QQ8A 1MBJA 4DZJA 4MHGA 3F0CA 1B9MA 2FOKA 3CC7I 2R7ZJ 3HSFA 2VOOA 2NVUB 3BQZA 4RGUA 2XSDC 1RUOA 2LLKA 4D1QA 5KAFC 3RI4A 1I50J 4EM2A 3LMMA 4H4KC 1X2MA 2EFNA 4G7OF 2RN7A 5B5EC 4DNCA 2YX7A 4RAYA 1FP2A 3ABTA 2C6YA 1E3HA 1X4OA 3RQIA 3HSEA 5C44J 3BZ6A 1OPCA 1OFCX 4MEXF 2HKOA 1OMIA 1FTZA 2MGQA 5M5WJ 4EMSA 2XGCA 4YFNF 3B6CA 3HSRA 3DLLF 2K4JA 2HZDA 3QPSA 1U78A 2VE8A 3ESWB 4P55A 2LKPA 3FXUA 1MBHA 2ICWG 5A2QZ 3KETA 3TDZC 1W36D 2HYGD 1MZBA 4DBQA 5CKTA 2FX0A 4GDFA 4QPOA 3DF8A 3CP8A 4L9VA 3S2WA 4HX4A 3TOAA 2YSRA 4ZTFA 2H8RA 2ACJA 3KZIC 1FSEA 3RSNA 4Q5SF 4U7DA 1SAUA 3WTSC 2Z9OA 4H0EA 2AXLA 3ONQA 3VPRA 3S2HJ 3J7ZI 2L7KA 2E7WA 1JJ8C 5LBQA 5C3EJ 2NAZA 5E79C 2FMYA 3OS0A 3HB9A 5CQEA 2LKSA 5E8GA 3HRUA 1ZYRF 3H5NA 4IF4A 2QSFX 4M74A 4RGRA 3FKIJ 3HOTA 3I4PA 1VQ6I 4RAZA 1WJFA 3BG5A 2PMHA 4B4CA 2VQHA 1UHSA 2XKOA 1VI0A 2ETHA 1USTA 2PN6A 4XSXF 3CCQI 1U8RA 1K78B 3QAHA 5IYBJ 4JK1X 1J2XA 3ULQB 3P5JA 3F23A 2X6WA 2XIGA 2MSYA 1TT0A 1H9GA 2HVSA 3F8CA 4IXAA 5CVJA 3IUOA 3CCSI 3IAS2 5IY5H 2JZYA 2PMZA 2F5VA 4JBAA 3QU6A 1FWZA 1POGA 5BMZA 1Q1HA 1JE8A 3NRVA 4YFXF 5DDGA 1XC5A 2OQGA 3SHFA 3U1KA 4BEHB 4L18B 1TWAJ 3GTKJ 1OISA 4O5VA 2GBYA 4OWRB 4M3DA 2PJRB 1ETXA 1T8IA 3DKWA 2BXZA 1K78A 1T98A 4AVZA 2EFWA 4P1WA 2ELKA 3SDBA 1WFXA 3GVAA 4MQ9F 2DN0A 5GTIC 1QVUA 1BR4A 1U6GA 4LLLA 4QTRA 3M4OJ 3GWZA 3O3KA 3DQVC 2XAJA 5B3SH 1T0FA 1OCCH 1PUFB 3SEQA 2V79A 4CYCA 2EWNA 2L9SA 3S15J 3GEZA 3K1NA 3W3CA 3A2KA 4HV5A 1BI3A 3LQQA 3FXQA 4PUSA 3G6EI 4BEHA 1H0MA 1YHQI 2NS7A 1OCTC 2PJRA 2CUEA 1IC8A 2BV6A 4LFUA 3FWEA 4XIDA 4ZYDA 2F5CA 2VE9A 2RKHA 1MMDA 2CQ7A 2I10A 1MSEC 3QRFF 3SFIA 4JX5A 2RNGA 4DOZA 5ICFA 5LD2C 1Y1VJ 2KKOA 3E5UA 1MSFC 5ICCA 3NWTA 1PUFA 2HQRA 4M9SA 4N4OB 2Y48A 1IN4A 2DA4A 1KU9A 2V1XA 2P8TA 3T5XA 4BXXJ 3L9FA 5F0FA 4S0HB 1O3QA 1V5GA 1JT0A 3DBLB 2Y31A 3CCYA 5CVVA 1YRNB 2GLOA 1TZLA 2KT0A 3GFMA 2LVSA 2YU9J 4JYKA 1Y6IA 3M1CA 2GIZA 4XRSG 2WTEA 4BQNA 3IHUA 4OMYA 2L02A 2FUG2 1CF7B 1D8KA 4II3A 2HPMA 2L9NA 3MCZA 3KZZA 3OYLA 3CESA 1BC7C 1A04A 3DFGA 3CCRI 1P92A 3E97A 2R3SA 4ON0A 5J40A 3BR6A 3CLQA 5GP9A 1LUJB 3HTSB 1CQTA 2CW7A 2OV7A 4D7NA 2J5OA 2HI3A 1PP8F 4XLNF 2LKXA 1ENHA 2ZB9A 5E3LA 2PBIA 5JI6A 1K4SA 2XGXA 2VJ4A 4MO7A 1DDNA 2KRFA 1TC3C 1FOWA 1YX5A 4LMYA 2P7CB 3DXJF 2O8KA 1T0FC 2K9QA 2ZCWA 5GADJ 1CF7A 1TL8A 1ZKGA 2IS4A 4D5CA 1FLIA 1XGMA 2CUFA 2YU3A 5FD6A 2XAHA 1XCBA 4KIGA 4N9HA 1WWXA 2K7LA 4XRSA 1MJ9A 2Z16A 2XF7A 4UVBA 3KP7A 2FEZA 2W82A 2MFZA 4EM1A 2ECCA 1WH5A 3HKZA 4A3EJ 1O3TA 4IQ4A 4PJJA 3H9GA 2JPCA 1B4AA 4M71A 2OCCH 1MNDA 3B73A 2WY7Q 4DBRA 2IT0A 1D1BA 5DD4A 2VONA 3WTZA 2QKMB 5LEKA 3IWZA 4CICA 3ZGKA 2NVTJ 2LY2A 4XMYA 3BROA 4RB3C 5M5YJ 1W0TA 4A3GJ 2IRFG 1S5LC 1ZRFA 6PAXA 3HRSA 1W5CC 3BG3A 5CVUA 1VQKI 1KU7A 1W7PA 5D4RA 3CDIA 1HW1A 3QPLA 3I71A 5EEGA 3ECOA 5BQTA 4DGWB 1IUYA 4KIFA 4WCGA 2R7QA 2WB1A 5EZHA 5GAEJ 3E5QA 3X2QH 4EQQA 1LPQA 4D5FA 3OYHA 4BH9A 4A3LJ 2PG4A 2HS5A 3UKGA 2UUZA 3Q0WA 4WF2A 5GPCA 2M0CA 3G2BA 3KP5A 3WHCA 4XRMA 4IOCF 3GW2A 1MJBA 1IN8A 1TNSA 4L5EA 3WTXC 4A0YA 2R5YB 1QZYA 4BQOA 3RKQA 1R4NB 3LSIA 2MH9A 3CD6I 4CA0A 3H0GJ 3HHGA 2BE5F 5JLWA 1VQ9I 2J5PA 2DO7A 2K9LA 3G4SI 2VJIA 1ZLKA 3Q3SA 1UFMA 1RESA 2IPQX 1ZR4A 1RC9A 2K40A 4HW0A 3OYKA 2HOSA 2TCTA 4ITVA 3CUOA 3V7SA 3K4BA 4MEYF 3WG9A 3S1NJ 4MFEA 5TISC 3M1EA 5KCMA 1I1GA 1UMQA 1ZGAA 1ZTRA 1LDJA 3VYSB 2UV1A 1XMKA 4DQ2A 2R5YA 3S1QJ 4M9XA 2EZHA 4AWXB 3H3UA 2ECBA 3K1PA 3BLYA 4CCOA 1GT0C 2BGCA 1NTCA 1U0JA 2KDOA 2A5WA 5J1YA 2W24A 2Z1DA 3CF2A 3RDIA 4XN0A 1TLHB 2EA4A 1EV7A 2ZKZA 4IHXA 4NDLA 4BY1J 3RPUA 2CWEA 1IJWC 3T1BA 1DP7P 3LFKA 3W2AA 1YW8A 2ZJQF 4XONA 2LREA 4Q4ZF 4UB8C 3OMYA 1MBFA 5IT9K 5L3GA 1VQOI 1G3SA 1T56A 1UJ8A 5JR3A 1TQIA 2EPFA 1I39A 1X2NA 3QYBA 4GXOA 4HOBA 1R00A 4N9IA 2ID3A 1U3EM 2EA2A 3ZMSA 5IOYA 1BOBA 3GLXA 1LFPA 3F8FA 2P6TA 4XLEA 1NG7A 5JVGF 1YI2I 4ZYEA 4ZDLA 5BOXA 2LD5A 5IOZA 2VASA 2XAUA 2GXAA 1XD7A 3A0HC 3L2WA 1TWGJ 2EH3A 3AG3H 4PJMA 2E1MC 4UNOA 1BBYA 1WKMA 4II2A 2R7UA 5E17F 2OUMA 4M6XA 4XNFA 2XASA 4IHSA 2GOXB 4DIQA 4WWCA 4KFCA 3GO5A 2DU9A 3L1PA 4G94A 1RKWA 4B8XA 1XTAA 3REOA 2KZGA 5LRSA 3JRBA 4XBFA 3CJNA 2R92J 3OY9A 3H92A 2H09A 3I0TA 1F43A 4RLFA 4CCJA 1MW7A 3LSKA 1YJ9I 1X19A 3TO9A 4BJ6C 4RBOA 3CLOA 1LVAA 2OBPA 1WH7A 1IRZA 3D0SA 1FX7A 3C1DA 2EV0A 3KLOA 5FLMJ 2PJPA 3HOSA 5L3DA 1MBGA 3TO6A 3I4NJ 2XF6A 1TTYA 3KYDB 3L09A 1Y39A 2BVMA 2G7HA 2E2IJ 3U2RA 3JRAA 3DTEA 2M45A 4OINF 4HYEA 5DYMA 2X6XA 5HNFA 1IXSB 3WTWC 1S9HA 1YLFA 4Y33A 5E18F 1D3YA 2E1NA 3H5RA 3VYTB 2HKXA 1LFUP 5DEQA 2ZBKA 2R7WA 2BHZA 2HYFA 1W4MA 2OTLI 2QGUA 3CCLI 1YFHA 1LE8B 1OYYA 3P9IA 3S14J 1Z05A 2W84A 3QWLA 2L54A 3ZQGA 2OF7A 3QOEA 5TGTA 3BP8A 1I3QJ 3R0AA 3NARA 2ZMEB 2DTRA 4HZFA 4X0GA 4AIJA 1FTTA 2QEXI 4HRIA 4IHVA 3LSPA 1MMNA 2B9SA 1A6QA 4E70A 2H6BA 5CVIA 3FK7A 1LKXA 2FSWA 4K2EA 4BAYA 5DM7F 2LOOA 4XICA 4RLQA 2QKLB 3FM3A 3PFIA 3KE2A 4KN7X 3ZQCA 5HLTA 3ZMUA 2ZJRF 3DWLE
chains in the Genus database with same CATH topology
5GAGJ 5GADJ 5GAHJ 3J7YJ 2ZJQF 3CCSI 2K3FA 3CMAI 4UY8I 3CMEI 1VQOI 3I56I 1VQ5I 3CCEI 4V19K 3I55I 4IOAF 1VQ7I 1VQLI 1FOYA 2E34A 5DM6F 1YI2I 5JVGF 2H8WA 3PIPF 3CC7I 2QA4I 2E35A 3CJTB 4IO9F 1VQKI 3G6EI 3CCJI 1YJNI 1YHQI 3CC4I 1VQ4I 3CCVI 1HC8A 3DLLF 1YJ9I 5GAEJ 2E36A 1VQPI 2NXNB 1QA6A 1FOXA 3CF5F 1MMSA 2ZJPF 4IOCF 1Y39A 3CD6I 3CCMI 1VQ8I 3PIOF 1ACIA 1YIJI 1VQ9I 3J7ZI 3G4SI 2JQ7A 1VQNI 2OTLI 2FOWA 3CCLI 3G71I 2OTJI 3CCUI 1VQ6I 3CCRI 1YJWI 3CC2I 2QEXI 1YITI 1S72I 3CCQI 5DM7F 1VQMI 2ZJRF 1FOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAG J;  5GAD J;  5GAH J;  3J7Y J;  2ZJQ F;  3CCS I;  2K3F A;  3CMA I;  4UY8 I;  3CME I;  1VQO I;  3I56 I;  1VQ5 I;  3CCE I;  4V19 K;  3I55 I;  4IOA F;  1VQ7 I;  1VQL I;  1FOY A;  2E34 A;  5DM6 F;  1YI2 I;  5JVG F;  2H8W A;  3PIP F;  3CC7 I;  2QA4 I;  2E35 A;  3CJT B;  4IO9 F;  1VQK I;  3G6E I;  3CCJ I;  1YJN I;  1YHQ I;  3CC4 I;  1VQ4 I;  3CCV I;  1HC8 A;  3DLL F;  1YJ9 I;  5GAE J;  2E36 A;  1VQP I;  2NXN B;  1QA6 A;  1FOX A;  3CF5 F;  1MMS A;  2ZJP F;  4IOC F;  1Y39 A;  3CD6 I;  3CCM I;  1VQ8 I;  3PIO F;  1ACI A;  1YIJ I;  1VQ9 I;  3J7Z I;  3G4S I;  2JQ7 A;  1VQN I;  2OTL I;  2FOW A;  3CCL I;  3G71 I;  2OTJ I;  3CCU I;  1VQ6 I;  3CCR I;  1YJW I;  3CC2 I;  2QEX I;  1YIT I;  1S72 I;  3CCQ I;  5DM7 F;  1VQM I;  2ZJR F;  1FOW A; 
#chains in the Genus database with same CATH topology
 2ADU A;  1E2X A;  2VJ5 A;  2EJR A;  4ZYG A;  3J7Y J;  3G1O A;  1LE8 A;  4A3I J;  2HQA A;  1R49 A;  2FE3 A;  1IV8 A;  4RAF A;  4RMN A;  2AO9 A;  3IL2 A;  1IN6 A;  1K6O A;  2RDP A;  2ZME A;  2VUM J;  4HSR A;  2R7S A;  1Z77 A;  4BGD A;  4IOA F;  1XS9 A;  5J1U A;  1HST A;  3L2U A;  3DEW A;  3VB2 A;  2COM A;  3Q0U A;  2KIM A;  5LRR A;  1J59 A;  2LF7 A;  2WV0 A;  3ZP5 A;  2DT7 B;  2FNA A;  4O3M A;  5IP7 J;  3WU0 A;  1EH7 A;  2FA5 A;  1GVJ A;  4EJU A;  4ENM A;  2KMU A;  1G2H A;  1VFC A;  5TRD A;  4EEF G;  2L5Q A;  3GTP J;  1SFX A;  2DT5 A;  5K5Q A;  3BWG A;  4AVP A;  4FCY A;  1ZRD A;  4CHU A;  3JAM K;  3KP3 A;  1RR7 A;  3OSF A;  2VOD A;  3W6K B;  1BM9 A;  1F5T A;  3F8M A;  3OSG A;  2KRC A;  1R1V A;  2QYO A;  3GXO A;  2HNH A;  1T39 A;  2A68 F;  2TRT A;  2QSG X;  1JUM A;  3JRE A;  4C3I J;  4F92 B;  5HLG A;  2X9D A;  4G8X A;  1QBJ A;  4PGH A;  3BTJ A;  4BE1 A;  1XSV A;  3M8F A;  5JHF A;  5FKK A;  3S1M J;  1ETY A;  3ASO H;  2V9K A;  3GFL A;  5LGN A;  1SD6 A;  2IA0 A;  1YS7 A;  3HPH A;  1S7O A;  1VZ0 A;  2IGO A;  2BY2 A;  2F6C A;  1HF0 A;  2VXZ A;  1F1Z A;  1JJ6 C;  2HOT A;  2VBZ A;  4M3G A;  2OQR A;  2HXO A;  4A93 J;  2G7U A;  1G3T A;  4KUM A;  4BE0 A;  4CDG A;  4LK0 F;  3WGG A;  3I54 A;  4BKX A;  1X1B A;  1Z6R A;  2ZME C;  3LAP A;  3CC2 I;  3ZMT A;  2YR2 A;  1YIT I;  1HA8 A;  2WC2 A;  1LEA A;  1FMW A;  5LFA A;  2R93 J;  1BI2 A;  2K4B A;  4RB0 A;  2VBW A;  5IT9 Z;  4NBQ A;  2ZC2 A;  3BTL A;  1BJZ A;  3F9K A;  2VJJ A;  2CRG A;  2CU7 A;  3IWF A;  3K9T A;  2D1V A;  2FQ4 A;  2BW3 B;  4KIC A;  2XPU A;  4A3C J;  4B44 A;  2CQQ A;  3CUQ B;  2PMZ N;  4FE4 A;  1K4T A;  2Z33 A;  4HDU A;  3COA C;  2DT6 A;  4CGZ A;  4Q47 A;  2MYS A;  2RC4 A;  5E1Z B;  3H9J A;  4A2U A;  4BE2 A;  4ANJ A;  1IXR C;  2HU9 A;  1H8A C;  1YG2 A;  2FD5 A;  5EYR A;  1EA3 A;  2CGP A;  3HPG A;  3S3O A;  1Y0U A;  2HR3 A;  4UVC A;  2P6S A;  1WGX A;  2DMT A;  1GV5 A;  1AOY A;  1OCZ H;  2HWV A;  3H0D A;  2EK5 A;  1WHU A;  1LNW A;  2GQQ A;  4DYR A;  2ZFU A;  5B66 C;  2EIM H;  4E4H A;  2K86 A;  1ETK A;  2DQL A;  3DBR B;  1ZH5 A;  1SVM A;  3K10 A;  4RGS A;  2M4G A;  3DBH B;  5FD5 A;  2MW8 A;  4A3B J;  3FXL A;  4HNU A;  4A12 A;  3S8P A;  5D6F A;  2A3S A;  2NRA C;  4MNU A;  3OL3 A;  3WGI A;  2GM4 A;  2QQ9 A;  2F2E A;  2X85 A;  2WWY A;  2DOF A;  4W1U A;  5CQG A;  2H27 A;  1P4X A;  3BQY A;  4TV7 A;  3K0L A;  1SC7 A;  4BAC A;  2WV1 A;  2XUB A;  1HQC A;  3KP6 A;  3ZMZ A;  1WJ5 A;  4FX0 A;  3NEU A;  2PLY A;  2BY0 A;  3A03 A;  4GYI A;  1E17 A;  3AL0 B;  1ON1 A;  3RPQ A;  3JRC A;  1QVT A;  2CW0 F;  3GCM A;  2DDB A;  3DKX A;  3OOU A;  5E3N A;  1VTN C;  5J6X A;  2VBY A;  3ERE D;  1JT6 A;  3S3N A;  2L4A A;  3EYY A;  5FRM A;  2BVL A;  4QSH A;  2XAG A;  3CF5 F;  4NHJ A;  3CQZ J;  3L2R A;  2ZJP F;  2E1C A;  5EGO B;  1HW5 A;  4B3X A;  3ABM H;  4E7L A;  4LOC A;  3FHN A;  3TGN A;  1RR8 C;  2MC3 A;  2L7Z A;  4YG2 F;  5FLX K;  4E7Z A;  4J01 A;  3C2B A;  2Q8K A;  1QHG A;  5K7Z A;  1KQ8 A;  2CV1 A;  2QQB A;  2XRN A;  4HST A;  5D5X B;  2EZK A;  3U9G A;  2ZXJ A;  5EJC A;  2HVR A;  2V6E A;  3BOQ A;  3K70 C;  1Z91 A;  3BTI A;  2BXY A;  2GAU A;  4L5I A;  5HOO A;  2DLL A;  3CJQ B;  1R36 A;  3F8N A;  4G7Z F;  2VC1 A;  1FYL A;  3HZJ A;  2UXN A;  5EGO A;  2Y0S A;  2M2E A;  5BNG A;  4HA8 A;  2STT A;  1Y0N A;  1W5T A;  3RYP A;  2B0L A;  2V1U A;  2P81 A;  1YW7 A;  4ZZD A;  3BJA A;  1R4M B;  2VKD A;  3H3V K;  3AG2 H;  5E3M A;  3CZ6 A;  3L7W A;  2NOG A;  1JGG A;  5B1B H;  3BR5 A;  3MWM A;  1VF9 A;  3CDL A;  2L9V A;  3DEU A;  2KIF A;  2A6T A;  3GFJ A;  5L3C A;  1MD0 A;  4UY8 I;  3FF5 A;  4BDZ A;  5E1X A;  2IXS A;  4BYY A;  3GFI A;  4PSW A;  5LHI A;  4RS8 A;  2FJ1 A;  4V19 K;  3HKZ N;  1RIO H;  4HBL A;  2E5N A;  3HIF A;  4U0Y A;  1BL0 A;  3I4M J;  4HNT A;  4EGY A;  2VPR A;  2E34 A;  4BJT A;  1UZC A;  1R1T A;  3ABK H;  1L3L A;  3JAM Z;  1FEX A;  4IRI A;  1J7K A;  2NS0 A;  2X1C A;  1RZ4 A;  3BR0 A;  4L0Y B;  4MLO A;  4KMU X;  3A4C A;  3AKZ A;  1FJL A;  2OU2 A;  2DA7 A;  4HF2 A;  3ZOB A;  5F27 A;  1J9I A;  1PP7 U;  1IG7 A;  1Z21 A;  1T33 A;  4WXD A;  3AG1 H;  3E6C C;  3CCJ I;  1YJN I;  1NH3 A;  4A5M A;  3FK6 A;  2O03 A;  3PO3 J;  4OOI A;  2DFE A;  2DJN A;  2WB1 N;  3ZQH A;  2E2J J;  3JTG A;  3DTK A;  1IO2 A;  4XKC A;  3IKV A;  5FGM A;  4D7M A;  1QHH D;  1AHD P;  1D0Y A;  2FXA A;  4YII A;  3BTC A;  5F64 A;  1QZE A;  1XGN A;  1QA6 A;  4NQW B;  2ZO4 A;  1PUE E;  3K1M A;  3SZG A;  4AM3 A;  1SFO J;  2VC0 A;  1ETQ A;  3JRG A;  3MKY B;  4B09 A;  5GPA A;  4LGW A;  1KYW A;  1PVE A;  1SVO A;  4FX4 A;  1QPI A;  4BNC A;  2VQL A;  4XM3 A;  5FLV A;  3HOZ J;  4HG2 A;  2JQ7 A;  1TQP A;  2XB0 X;  3DEE A;  3HL2 A;  1UAA A;  3ABU A;  1I6X A;  3IH4 A;  1O57 A;  1ODD A;  1R1U A;  1SVL A;  1U5T B;  1BR1 A;  3DP7 A;  2L01 A;  3LSM A;  4A0Z A;  5IT3 A;  2OCE A;  4BDY A;  4AC0 A;  4CZZ A;  2E1O A;  2GA1 A;  3TL4 X;  2A61 A;  2BZT A;  4NQW A;  2XF5 A;  2E19 A;  3KP4 A;  2XVC A;  4A3J J;  1IDY A;  4I7H A;  4YEL A;  3I5U A;  4IZZ A;  1G8X A;  4N4N B;  2ZFW A;  3SFZ A;  3QOD A;  1KYZ A;  3VYU B;  1HLV A;  3MEX A;  5HVQ C;  1FSH A;  2IA2 A;  1APL C;  3JRD A;  5EDN A;  1T95 A;  3GBG A;  4FIS A;  4HNV A;  1N75 A;  1U9O A;  3V7C A;  2WA0 A;  1AKH B;  4M6Y A;  2HOE A;  2Y30 A;  3E6M A;  2STW A;  1MH4 A;  1YQA A;  3RKX A;  1VQ5 I;  1Z7U A;  1ZG3 A;  3S16 J;  4DJA A;  3HRT A;  5FRO A;  2GZW A;  1FYM A;  2E60 A;  2IGM A;  1T38 A;  2A5Y B;  2CQX A;  2JTV A;  3DPL C;  5J47 A;  2FBH A;  3WU2 C;  3BG7 A;  4JOM A;  4LK1 F;  4U0V A;  4NC7 A;  4BUP A;  1LDD A;  2UZK A;  4L9N A;  1YRN A;  3RCO A;  4IEJ A;  1FOY A;  1BI1 A;  1B8I B;  1XN7 A;  1R5I D;  3LSH A;  1RKT A;  2E5Z A;  1S8N A;  1BI0 A;  2EQR A;  3WHB A;  3MFK A;  1BA5 A;  5DCM B;  2GIV A;  3WTY C;  4BHC A;  4MQV A;  4PDK A;  1WJB A;  2ME0 A;  3S3M A;  3AG4 H;  5IP6 A;  3MQ0 A;  2D45 A;  1WCM J;  2LFB A;  4IQJ A;  1FIP A;  1BN5 A;  2WBM A;  2DCE A;  1FBU A;  1F4K A;  1DU6 A;  1AWC A;  1WJE A;  2DA6 A;  4KT5 C;  5CPR B;  1XGS A;  1R7J A;  1ITY A;  3HGY A;  4YIR X;  1B8I A;  3OR1 C;  4JX6 A;  3MZY A;  3FXJ A;  1Y8R B;  3D5L A;  2W48 A;  4RGX A;  2AXT C;  5FLX Z;  5DCM A;  5LGT A;  2ZXW H;  1ZRE A;  2DBB A;  2W25 A;  1RNL A;  3GME A;  3OIP A;  5KVR A;  1JGS A;  2Z3Y A;  3Q9V A;  3K69 A;  1BJA A;  5J4V A;  2VB6 A;  2HXI A;  4AID A;  3PIO F;  3BZK A;  4BY7 J;  2V6C A;  2D2W A;  1YIJ I;  4X1E A;  2ZNZ A;  2V9V A;  2X0L A;  3GLL A;  3OIQ A;  3EUH A;  1ETW A;  2BOL A;  2X6Y A;  4C30 A;  4KJZ A;  3MKW B;  3LQR A;  2OA4 A;  3HEF A;  2FOW A;  1O3S A;  1HKQ A;  3E1S A;  2KHM A;  3F6V A;  2KQR A;  3QPT A;  3HM5 A;  3KFW X;  5CJ9 A;  1LJ9 A;  2VI6 A;  3K4C A;  3S93 A;  1FY7 A;  2WY8 Q;  4XR6 A;  4M3F A;  4EV0 A;  1T6S A;  1W0U A;  4QWQ A;  4XLC A;  3K4K A;  4HPQ A;  4OAZ A;  4A0X A;  1I27 A;  5F6F A;  3MMY B;  2KDZ A;  1VQM I;  2KLO A;  4CCM A;  4BBR J;  4XSZ F;  3LA3 A;  4BHB A;  3CO7 C;  2OC6 A;  5DUK A;  3FXK A;  1MGT A;  3WTT C;  2B7E A;  2HTJ A;  2ISY A;  3RZD J;  3GTM J;  4W97 A;  4DYQ A;  4L5J A;  1Z6T A;  3H35 A;  1GVD A;  2LDU A;  2DFH A;  4EJV A;  3LA7 A;  2O7O A;  2FF4 A;  1SFK A;  3GTO J;  4D9J A;  3FMQ A;  1VQ7 I;  3K6G A;  3O6B B;  4OMZ A;  1J0R A;  1WJD A;  2LRD A;  2R0Q C;  2JJ7 A;  2D1H A;  2JK3 A;  5ED4 A;  1RPW A;  3EDP A;  2JA5 J;  1OCR H;  4F52 A;  2R7D A;  2XC7 A;  2QA4 I;  3FXR A;  3KX2 A;  2NS8 A;  1UEL B;  1P7J A;  1V54 H;  2I8D A;  4I0A A;  3ZN0 A;  3I53 A;  1JTX A;  2IA1 A;  2MC4 A;  3IH3 A;  1NHA A;  1ZGJ A;  3D5R C;  2LNB A;  5DCF A;  3SEZ A;  2CO5 A;  3J80 K;  1HC8 A;  3OS2 A;  3KYC B;  4E7S A;  5HOD A;  1ZG1 A;  1MNM C;  2DXI A;  5M3M J;  1GXQ A;  3PNY A;  2I5U A;  3NWS A;  3PM1 A;  4MIM A;  3OYF A;  4G6T B;  4IRG A;  5D8L B;  4FQG A;  1R5G A;  1LB2 A;  2H1K A;  1GLN A;  2OJE D;  3ECH A;  4R79 A;  4J00 A;  2Y0M A;  4PJ0 C;  1SAN A;  1X4P A;  2CUZ A;  1I5Z A;  5H20 A;  4BJ5 C;  1FYK A;  1AU7 A;  2M87 A;  4U7B A;  1P7I A;  1MIJ A;  1USS A;  1K61 A;  2ZXH A;  4HX8 A;  3R0J A;  4M6V A;  3WE2 A;  3DCF A;  1H89 C;  2XAQ A;  2XGE A;  3G1M A;  2DA5 A;  1B6A A;  2DYR H;  3M8E A;  4M72 A;  3FMR A;  4FHT A;  2V7F A;  3OIO A;  2ID6 A;  2MBF A;  2VL8 A;  4FET A;  4PZJ A;  3BZC A;  4EGZ A;  1QPM A;  3M07 A;  1XPX A;  2FNP A;  2JA7 J;  2JA8 J;  1MBK A;  2DI3 A;  2KP6 A;  1QRY A;  5H6R A;  5C4J J;  2BY1 A;  4KIT B;  1ERD A;  3KEQ A;  5K7F A;  2CUJ A;  5K5O A;  3LSG A;  1L0O C;  3KEY A;  3I59 B;  4LIV A;  2DMU A;  3BJO A;  3F72 A;  3QPH A;  4ZDO A;  3K4M A;  2LG4 A;  2JSC A;  3LA2 A;  1KA8 A;  2CQK A;  2K85 A;  3JTH A;  3ZR8 X;  2VBX A;  2M9H A;  3TP3 A;  4CO8 A;  4O6J A;  4QPQ A;  1X1A A;  2QBY B;  1YIO A;  4NNJ A;  4BHP A;  2V1D A;  2X4H A;  2IW5 A;  2KJB A;  1WJC A;  3PSF A;  1JKR C;  4HEA 2;  3CME I;  1IAW A;  4I76 A;  3I56 I;  1YS6 A;  4PFO A;  4BBS J;  2B63 J;  1QO0 D;  1V3F A;  3KEO A;  1DP3 A;  2EFQ A;  3LSJ A;  3I59 A;  3OYI A;  3LFU A;  1X3W B;  4CCK A;  2L0K A;  1Q1V A;  3JW4 A;  4M9Z A;  1MBE A;  3FX3 A;  1X58 A;  1TNT A;  3GUD A;  4EM0 B;  3G73 A;  1U8B A;  4AD9 A;  2QBY A;  1V55 H;  1Z3X A;  4FT8 A;  2VXD A;  1W7P D;  1KON A;  2A05 A;  1RUN A;  5F1J A;  3SZP A;  1F36 A;  1GUU A;  2L3D A;  3EET A;  2F5F A;  3OOP A;  1ETV A;  1ZEL A;  2TDX A;  3CJT B;  3BCA A;  1TBX A;  1FIA A;  2JN6 A;  3QP5 A;  1M1E B;  3A1Y A;  2NVX J;  3EPZ A;  2D5V A;  3PJR A;  2DW4 A;  2Y9Y A;  1TW3 A;  2LP0 A;  2XAF A;  1V5F A;  1KZH A;  1FBS A;  2EV6 A;  2YPR A;  5FFX A;  1V4R A;  4XLA A;  2JPB A;  5HNH A;  4AUX A;  1KU2 A;  2NNN A;  1U2W A;  4B48 A;  1W1W E;  4LLN A;  2KRH A;  2R7O A;  2CH0 A;  1ULY A;  3ZPL A;  1P4W A;  2LTP A;  2HZT A;  2KZV A;  2LF8 A;  2X1E A;  5M3F J;  2H94 A;  3OYN A;  3IRQ A;  3HOW J;  3ABL H;  2EIJ H;  2AQF A;  2JRT A;  2DPD A;  2ZNY A;  3CP2 A;  1EKE A;  5GTH C;  4IX7 A;  1O3R A;  1EH8 A;  3RTR A;  4M73 A;  3NQO A;  2LH9 A;  2A6E F;  1QNT A;  1MH3 A;  3G71 I;  3GZ6 A;  3MZH A;  4L9J A;  3E5X A;  4A6D A;  2Y0S N;  1SD5 A;  3PUB A;  1QGP A;  2ZXI A;  3WTV C;  2EIK H;  4XQF A;  2IEK A;  3RPU D;  1GHC A;  3DU5 A;  2IS1 A;  4P5O A;  3U1D A;  2FU4 A;  1SMY F;  1SD4 A;  3V7R A;  1LVK A;  4ENN A;  3A01 B;  2BEO A;  4Y4R A;  2AQE A;  2F4O B;  4RM3 A;  4KN4 X;  2KIU A;  5KAI C;  1VND A;  4HF0 A;  1OJL A;  1UG0 A;  2CQN A;  2X51 A;  1Y1W J;  2P0W A;  4BL0 B;  4IRH A;  3CMA I;  4G9Y A;  3BR1 A;  3IAM 2;  3R60 A;  1XG1 A;  1D5Y A;  4LIU A;  3N4M A;  2ISZ A;  5DTD A;  3WE3 A;  3EUA A;  2M3A A;  3FDY A;  4GO1 A;  1OCO H;  5D8K B;  2JWT A;  2HDC A;  3BPV A;  1KGS A;  3OYE A;  5F04 A;  2AS5 F;  2IP2 A;  1I3A A;  3KIO A;  4G6D A;  1ON2 A;  3HGG A;  1DQU A;  2W85 A;  1BR2 A;  4NUB A;  5J3L A;  5DM6 F;  3CMM A;  3A01 A;  2XSJ C;  3BR3 A;  1HSJ A;  4R8H A;  4I2O A;  2M5W A;  2O3F A;  3QYE A;  1OYI A;  3F8B A;  2EZL A;  3J80 Z;  4HX7 A;  1EH6 A;  1WJA A;  3BT9 A;  3VDX A;  4Z2Y A;  1W36 C;  2CYY A;  1ZRC A;  4XLP F;  3W2V A;  1HKT A;  4ESF A;  1IRG A;  2P5K A;  4HAM A;  5EEH A;  4ESB A;  2QUF A;  4IO9 F;  4XL9 A;  5J8C A;  1JKQ C;  4KIS A;  1W5S A;  4I6Z A;  3CC4 I;  1R6R A;  4DW6 A;  4BXF A;  2FQ3 A;  4OIO F;  3VSL A;  3SQN A;  1BC8 C;  2IGK A;  4GCV A;  4HLY A;  3IH2 A;  3ZMV A;  2NNY A;  2K02 A;  1UG2 A;  2N8G A;  1LFB A;  3BCB A;  5HS7 A;  4CSW A;  2LMD A;  4N0B A;  2BW3 A;  1OKR A;  2VOP A;  1YOV B;  3L2V A;  3CUQ A;  4AYB A;  3RZO J;  4A3D J;  1ZAO A;  2XRO A;  2HEO A;  1SD7 A;  4GRI A;  2ZJ2 A;  1K6Y A;  4Y52 J;  3GZN B;  3M8J A;  2EIL H;  5BPI A;  2V9P A;  2PFB A;  4RB1 A;  4ENK A;  2O61 A;  3H5A A;  1DGR M;  2COB A;  1XDS A;  2JSP A;  4JX4 A;  4NC6 A;  2M34 A;  2Y69 H;  3BG9 A;  3KCC A;  1E3P A;  1STZ A;  3HYI A;  5FFZ A;  5DUI A;  2XB5 A;  2K9M A;  3K4L A;  3FZV A;  1JXS A;  5J8F A;  2DK5 A;  4KA4 A;  5H6Q A;  4ESJ A;  1R5H A;  4I09 A;  1IW7 F;  1KU3 A;  2FRH A;  2OAZ A;  2G0E A;  3AAF A;  1REP C;  2VT2 A;  4CCN A;  3PFY A;  2W1O A;  2IS2 A;  3BY6 A;  3E6D A;  1WZ2 A;  3V8L A;  2KIS A;  2DQR A;  4S04 A;  5EF6 A;  2XDV A;  1T2K A;  1A31 A;  3ROU A;  4MTD A;  5IPA A;  5F08 A;  4Q48 A;  2XPW A;  1OR7 A;  1IUF A;  3TQN A;  2W7N A;  1O7F A;  3I3L A;  3MN2 A;  1PYV A;  3MKL A;  1D0Z A;  2R7X A;  5E1W A;  3A0B C;  2R7F A;  2Q1Z B;  3ZQF A;  2RVC A;  4I99 C;  4EAT A;  3KYL A;  2R7R A;  1SAX A;  2QSH X;  2ESN A;  5D6E A;  2CMP A;  4OIR F;  2X1D A;  3LSR A;  1ORK A;  1RRJ A;  4ZC3 A;  5GAH J;  1UB9 A;  1IN7 A;  3Q9S A;  5DS9 A;  4E7K A;  2K3F A;  9ANT A;  5HLI A;  3K2Z A;  4KIB A;  3VSK A;  3C7J A;  1YW9 A;  3HRM A;  4XN3 A;  3T8T A;  2HTS A;  2GWR A;  3RJP A;  5K7H A;  4KDP A;  2EV5 A;  2CFO A;  3K4N A;  2KJC A;  3S17 J;  2R7V A;  3VWB A;  4UV8 A;  3I55 I;  2MLK A;  2WAE A;  3TW7 A;  3OWT A;  1IZ1 A;  2E7X A;  4OAY A;  4MTE A;  1A6I A;  1WQ2 A;  2EFO A;  1UCR A;  2DJI A;  3N97 A;  1JHF A;  3JSP A;  1ONV A;  3CTA A;  2CG4 A;  3CUQ C;  4LG3 A;  1ZLJ A;  1FNN A;  2ESH A;  2DFF A;  4IPA A;  5KK1 A;  4F55 A;  2Z5U A;  1A5J A;  5LEJ A;  2JMW A;  4S05 A;  3ZQ7 A;  5M5X J;  3E3V A;  4HF1 A;  2H1L A;  3JR9 A;  1IRX A;  1KQ0 A;  1VQ4 I;  2Z99 A;  3OS1 A;  3LWF A;  3CO6 C;  2WAQ A;  4C2M J;  3CCV I;  2A07 F;  2JA2 A;  2M4K A;  1Z9C A;  4NC8 A;  4XLH A;  1XX5 A;  1DPU A;  3QYF A;  4C2T A;  2LYC A;  1FBQ A;  3BG6 A;  3K4J A;  1GXP A;  3BR2 A;  2XPV A;  4IJA A;  3E0J B;  1HXD A;  1C0W A;  5D5U B;  3FIS A;  4M3E A;  2DOD A;  2E71 A;  3EQL F;  1OR7 C;  3TMO A;  3WTU C;  3KLN A;  3U21 A;  4C3J J;  3H36 A;  1JI8 A;  2E2H J;  3PNV A;  4QIW N;  2O5R A;  1ACI A;  1D1C A;  4YFK F;  3HOY J;  3PO2 J;  3C3W A;  4JQF A;  2MG4 A;  1EF4 A;  3AL0 C;  4UV9 A;  3QQA A;  5LHG A;  1IF1 A;  2IVM A;  3WGH A;  3J7A O;  1QZZ A;  3NAU A;  4UUT A;  5KHD A;  3ZQQ A;  1WI3 A;  3GF2 A;  3PUF A;  1XDU A;  1YE9 A;  3ZCO A;  1TW2 A;  3F21 A;  1Z1D A;  1CGP A;  1WSU A;  1DUX C;  4U87 A;  1K7A A;  4CYC B;  1H88 C;  1JKP C;  4XK4 A;  3OL4 A;  4CXF A;  1BW6 A;  1IRF A;  1PJR A;  1HKS A;  1S7E A;  3LOC A;  4LB5 A;  1TQM A;  5DD8 A;  1WI9 A;  5JVT A;  4C2U A;  2DDA A;  1N77 A;  2DPU A;  2JVG A;  4MGR A;  3FIW A;  4F3Q A;  3K70 D;  2KFD A;  1T08 B;  4CH7 A;  4HLX A;  4XOT A;  3JSO A;  5HDK A;  2XKP A;  3OYC A;  2X48 A;  5EZG A;  3IRR A;  2DA3 A;  3GTL J;  3M9A A;  2UXX A;  2Q2E B;  5BS6 A;  2VLA A;  2W57 A;  1E0E A;  3OYM A;  1X1P A;  1XGO A;  2Q0O A;  2Z2S B;  4IVN A;  3LST A;  2F5E A;  1EJ9 A;  3F22 A;  1JUP A;  4IKF A;  4XKW A;  1J5Y A;  4HQM A;  4LG0 B;  1FP1 D;  3CJR B;  3GX4 X;  2CJJ A;  3G3Z A;  4E7H A;  3HC7 A;  1HW2 A;  3J7A Y;  2CS3 A;  2K9S A;  3OYD A;  3OV8 A;  2HFH A;  4A3F J;  1JHH A;  2CW8 A;  2EB7 A;  1J09 A;  2RAE A;  2F4I A;  2O6G E;  2HPI A;  1MJA A;  4E6K G;  5LGU A;  2VIX A;  3D1N I;  1U5T A;  2Q2E A;  2FBK A;  3T0Y A;  2HGC A;  2A6H F;  4BXU A;  2HDW A;  5J1R A;  3DV8 A;  3DTI A;  4HV6 A;  3IP4 B;  1X1C A;  2VQG A;  4B1R A;  3Q0V A;  5D4S A;  2IS6 A;  5FO5 A;  3TED A;  4I02 A;  2LC2 A;  4LG0 A;  5JHU A;  2RQP A;  3FMS A;  2P5V A;  5HS8 A;  1LEB A;  3MKZ A;  1ZGW A;  2ZSH B;  3K7A J;  2MA3 A;  2L7M P;  1MNE A;  2G9W A;  3ZN1 A;  1TWH J;  3MD2 A;  2LY9 A;  3R61 A;  3PL8 A;  1MDM B;  3MAJ A;  4M3B A;  3VFZ A;  3VYR B;  4FAS D;  3HG9 A;  3HUG B;  2QCO A;  4F91 B;  5KNL A;  1AKH A;  4UVA A;  3L2Q A;  4Y15 A;  4LB6 B;  3SDG A;  3ERM A;  3TW6 A;  3M3Y J;  4KYW A;  4LJZ F;  2DK8 A;  1S29 A;  1LDK B;  2RV8 A;  2CSO A;  4XOP A;  3QU3 A;  4CUG A;  2W4S A;  4F93 B;  3BPX A;  2NVQ J;  5FKM A;  1HBX G;  1IXC A;  4Y7N J;  3I64 A;  3QOP A;  3GTG J;  2P4W A;  4G6Q A;  3JRI A;  1VQN I;  1SFE A;  1XMX A;  2EBI A;  2QF7 A;  5E20 A;  1MDM A;  1IV6 A;  2K27 A;  4AU7 A;  2V1N A;  4P96 A;  3AFH A;  3HUG A;  3L00 A;  1ZN2 A;  4A6E A;  2HYJ A;  2LSO A;  1GDT A;  1NK2 P;  2DOE A;  2JUG A;  2OD5 A;  1G6N A;  1W7P B;  1V5E A;  4A69 C;  5H2F C;  2R7T A;  4UHT A;  3F6O A;  1TP4 A;  2R5Z B;  1HCR A;  5FKL A;  3HBL A;  5DV5 A;  5F0C A;  4XKB A;  4QLC U;  4KNY A;  3J81 K;  3OYJ A;  4PSX A;  2O9L A;  2KPM A;  2PMU A;  4XRF A;  4YIF A;  1R58 A;  3UNG C;  3IV5 A;  2QVO A;  3DLA A;  2HDD A;  1U5T C;  2NOJ B;  3BJ6 A;  1Y8Q B;  4NB5 A;  4WXC A;  3TO7 A;  2DAO A;  2E1M B;  3BDD A;  3M7G A;  5CLS A;  4OIQ F;  5HLH A;  2X6O A;  4EJO A;  2HQN A;  2BY3 A;  1DPR A;  2Y9Z A;  1FZP B;  3N05 A;  1Y56 A;  1KQ9 A;  3SZT A;  1JUS A;  1SMT A;  2Y75 A;  4XLF A;  1RI7 A;  2R5Z A;  1BW5 A;  4G7H F;  3PNT A;  4ZYA A;  5L3B A;  5ICE A;  4IHW A;  3TOB A;  5IYD J;  4GGG A;  4DYC A;  3JRH A;  4BQQ A;  4FE7 A;  1R22 A;  3W6J B;  2EFP A;  2H6C A;  3HTU A;  3EUK L;  3RKW A;  2VPL A;  2DA1 A;  4ZTJ A;  4A5N A;  2IAI A;  3SXY A;  1HDD C;  3OYG A;  2AHQ A;  5K5R A;  2RGV A;  3FM5 A;  3S2D J;  2PX9 A;  5JFR A;  1ZQ3 P;  2LBF B;  2PEX A;  3T8R A;  5TJJ A;  4ZH4 F;  4OIP F;  3WU1 B;  3CMY A;  3R4K A;  2E36 A;  1QU3 A;  3OYB A;  2PQ8 A;  4J19 A;  4B47 A;  1YX3 A;  2JVH A;  2MD5 A;  3ZQL A;  2OZ6 A;  3V8K A;  2XV4 S;  5IYC J;  3VOD A;  1MMS A;  4A3M J;  1S7A A;  2F5D A;  1JKO C;  5CVR A;  4XOR A;  1IDZ A;  1JTY A;  3HJE A;  5AON A;  1B59 A;  1OYW A;  1O4X A;  4IL6 C;  2P7V B;  4YRV A;  3FXO A;  4BU2 A;  3V4G A;  4ZDP A;  3EUH C;  2LBF A;  3P9K A;  2HVQ A;  1YO5 C;  2M8E A;  3H1C A;  5D5W B;  1TWF J;  3P7N A;  4P9U A;  4GYG A;  2NVY J;  1MKM A;  3V42 A;  1P2F A;  4LD5 A;  3LL7 A;  3C2G A;  1LQ1 A;  3I58 A;  4I01 A;  2MAB A;  2OTJ I;  1XB4 A;  1R71 A;  2V4J C;  5L3F A;  5FKN A;  3P9C A;  4GFB A;  4EJT A;  5AIQ A;  4XKV A;  3UR3 C;  1K83 J;  1ZK8 A;  3VEP A;  1S72 I;  4RA2 A;  1E3O C;  3ZXS A;  3RIR A;  2M8G X;  3PQJ A;  1UHM A;  5B1A H;  1HDP A;  5HDG A;  3ZMD A;  4ZZL A;  3DKY A;  2JUC A;  2DMQ A;  3TDU C;  3PQK A;  2GXB A;  2LY1 A;  1AA7 A;  3KP2 A;  2CV0 A;  2VKH A;  1P9Q C;  2L7F P;  1GV2 A;  3A02 A;  4U0W A;  3ELK A;  5ILS A;  2JA6 J;  3CCE I;  3OYA A;  1DGW Y;  2QEN A;  1D5V A;  5AIP A;  1FMV A;  1S3J A;  3H3Z A;  4G12 A;  1QQI A;  1SEU A;  3FKJ A;  4D0P A;  3ASN H;  2H8W A;  3PIP F;  3I9V 2;  2DMP A;  1WRJ A;  3W2W A;  4BS9 A;  4AIH A;  2YUS A;  4WX9 A;  3FHZ A;  1Z0X A;  4JP0 A;  2E35 A;  4DZP A;  1TWC J;  1NK3 P;  4F7Z A;  1FC3 A;  4PK4 A;  1A36 A;  3DU6 A;  4ZYH A;  1WPK A;  4LLG F;  4UB6 C;  3FBI B;  4LIT A;  1FOK A;  1U9N A;  2M30 A;  4V2G A;  2VKE A;  1G3Y A;  4KMF A;  5HDN A;  1XMA A;  4P9F A;  3B6A A;  3GTQ J;  2GOM A;  4AYB N;  1YTY A;  3GZ5 A;  1ZAR A;  1DU0 A;  1ZHF A;  2ZSI B;  4I98 B;  2L4M A;  1D0X A;  1TT5 B;  1VQP I;  3W6V A;  1K79 A;  5CYV A;  1I6H J;  4RAG A;  2MH2 A;  3DPT A;  4PCQ A;  2RQQ A;  3H9Q A;  1N78 A;  1H9T A;  4L0Z B;  5C4X J;  4AIK A;  1F9N A;  1Z3Y A;  4PJL A;  5A2Q K;  2LK2 A;  5ICG A;  3ML6 A;  2XHK A;  1X1D A;  4U88 A;  5LLQ A;  2IJL A;  3FXM A;  1HOM A;  1G4D A;  1S6L A;  5IP9 J;  3DPU A;  3RKY A;  4X6A J;  4IHT A;  2RNJ A;  3O8H A;  3CCU I;  3LNQ A;  3J81 Z;  3Q5F A;  4E7J A;  4KT6 A;  1YYV A;  3RYR A;  1G59 A;  3HDD A;  3CDH A;  1X3Z B;  1O7L A;  2VKV A;  4UXN A;  3RQ4 A;  4RM2 A;  5E3O A;  2PI0 A;  3S32 A;  3ZQI A;  4UUS B;  3C18 A;  1J75 A;  4OU0 A;  5F1R A;  3WOD F;  2K9N A;  3ISP A;  2VT3 A;  3HHH A;  1ZR2 A;  1X3U A;  3K2A A;  2MLG A;  3SJM A;  2BHY A;  4Z6Y A;  2QQA A;  2UWM A;  4ENJ A;  1WVR A;  2DMN A;  2O0Y A;  4Y13 A;  4CZC A;  3IC7 A;  2Y2Z A;  3G1L A;  1UHW A;  3WG7 H;  3GYH X;  1IGN A;  2JRM A;  4Y3O A;  2WAD A;  5JLX A;  2M7B A;  1R23 A;  3D5S C;  1NG6 A;  2XGD A;  1B72 B;  5F0H A;  5E8I A;  3HOV J;  1OLT A;  2DYS H;  4BQA A;  1ETO A;  4UUS A;  1I1S A;  2M1B A;  1Z67 A;  2FML A;  3MZ8 A;  3O2P E;  4C9Y A;  2DFI A;  4RB2 C;  5LHH A;  2BYV E;  2QZ8 A;  5D5V B;  2F4M B;  1ZG5 A;  1XSX A;  2QLZ A;  5EG0 B;  3HOX J;  3E6B A;  3JRF A;  2IGN A;  1OCP A;  2ELH A;  2EZI A;  2GA2 A;  3GTJ J;  1MMA A;  2BBY A;  2JT1 A;  2ME6 A;  2ELJ A;  2OZU A;  1N25 A;  4I0B A;  1D1A A;  2K3P A;  1PDN C;  3S1R J;  1B1B A;  2HOA A;  3O8G A;  1B72 A;  2WAQ N;  5J4Y A;  2KIQ A;  4ASN A;  5ILV A;  3EYI A;  3PSI A;  1BOA A;  2OPT A;  3IKT A;  1G3W A;  2M0M A;  4EJW A;  2R4G A;  3JCU C;  4YEJ A;  2KL4 A;  2O8X A;  4FTH A;  3SYT A;  4Y17 A;  3L2C A;  1R9T J;  5BPD A;  1IN5 A;  2VQC A;  5EG0 A;  2FBI A;  1SFU A;  2NXN B;  3R6S A;  1FOX A;  2CFX A;  2GXG A;  2YS9 A;  3HOU J;  4B43 A;  3E7L A;  3QP6 A;  4L9T A;  3CCM I;  4V2F A;  4WK8 F;  3KZY A;  4RDU A;  2WAF A;  1VQ8 I;  4MFD A;  3FBN B;  3TBI A;  3OR2 C;  4ETS A;  2EIN H;  4C3H J;  3B02 A;  2QM3 A;  5FJ8 J;  2K5C A;  1B9N A;  4R1H A;  2F48 A;  1MMG A;  3ZRG A;  4WXH A;  4E7I A;  1P6R A;  2L9R A;  3TP0 A;  5FKO A;  2MD0 A;  5FRN A;  2HQ5 A;  2L2O A;  4B3A A;  3V8J A;  3F3X A;  4PFP A;  2QWW A;  2DA2 A;  1YJW I;  4HQE A;  5ILU A;  4ABZ A;  1A35 A;  4PGG A;  1OQY A;  1FT9 A;  3BC8 A;  4CYD A;  3KPH A;  5L3E A;  1BIB A;  2RRE A;  5FB2 A;  1XSD A;  1BIA A;  1RET A;  2DTZ A;  2A69 F;  3VOE A;  5K1Y A;  3TKY A;  1FPQ A;  3HXL A;  2M7A A;  3MVP A;  4PJN A;  5GAG J;  4CCL A;  5EEA A;  4A3K J;  4HDV A;  2VN2 A;  2DOA A;  2P5L C;  2CV2 A;  1P4A A;  1XCV A;  4IHY A;  2YX4 A;  4ZJZ A;  3LAJ A;  1Z7L A;  3C2H A;  5HS9 A;  2V26 A;  2XRL A;  5ERI A;  1D8J A;  2NYX A;  4EVI A;  4UUV A;  1VQL I;  2W00 A;  2LR8 A;  2IBD A;  2QQ8 A;  1MBJ A;  4DZJ A;  4MHG A;  3F0C A;  1B9M A;  2FOK A;  3CC7 I;  2R7Z J;  3HSF A;  2VOO A;  2NVU B;  3BQZ A;  4RGU A;  2XSD C;  1RUO A;  2LLK A;  4D1Q A;  5KAF C;  3RI4 A;  1I50 J;  4EM2 A;  3LMM A;  4H4K C;  1X2M A;  2EFN A;  4G7O F;  2RN7 A;  5B5E C;  4DNC A;  2YX7 A;  4RAY A;  1FP2 A;  3ABT A;  2C6Y A;  1E3H A;  1X4O A;  3RQI A;  3HSE A;  5C44 J;  3BZ6 A;  1OPC A;  1OFC X;  4MEX F;  2HKO A;  1OMI A;  1FTZ A;  2MGQ A;  5M5W J;  4EMS A;  2XGC A;  4YFN F;  3B6C A;  3HSR A;  3DLL F;  2K4J A;  2HZD A;  3QPS A;  1U78 A;  2VE8 A;  3ESW B;  4P55 A;  2LKP A;  3FXU A;  1MBH A;  2ICW G;  5A2Q Z;  3KET A;  3TDZ C;  1W36 D;  2HYG D;  1MZB A;  4DBQ A;  5CKT A;  2FX0 A;  4GDF A;  4QPO A;  3DF8 A;  3CP8 A;  4L9V A;  3S2W A;  4HX4 A;  3TOA A;  2YSR A;  4ZTF A;  2H8R A;  2ACJ A;  3KZI C;  1FSE A;  3RSN A;  4Q5S F;  4U7D A;  1SAU A;  3WTS C;  2Z9O A;  4H0E A;  2AXL A;  3ONQ A;  3VPR A;  3S2H J;  3J7Z I;  2L7K A;  2E7W A;  1JJ8 C;  5LBQ A;  5C3E J;  2NAZ A;  5E79 C;  2FMY A;  3OS0 A;  3HB9 A;  5CQE A;  2LKS A;  5E8G A;  3HRU A;  1ZYR F;  3H5N A;  4IF4 A;  2QSF X;  4M74 A;  4RGR A;  3FKI J;  3HOT A;  3I4P A;  1VQ6 I;  4RAZ A;  1WJF A;  3BG5 A;  2PMH A;  4B4C A;  2VQH A;  1UHS A;  2XKO A;  1VI0 A;  2ETH A;  1UST A;  2PN6 A;  4XSX F;  3CCQ I;  1U8R A;  1K78 B;  3QAH A;  5IYB J;  4JK1 X;  1J2X A;  3ULQ B;  3P5J A;  3F23 A;  2X6W A;  2XIG A;  2MSY A;  1TT0 A;  1H9G A;  2HVS A;  3F8C A;  4IXA A;  5CVJ A;  3IUO A;  3CCS I;  3IAS 2;  5IY5 H;  2JZY A;  2PMZ A;  2F5V A;  4JBA A;  3QU6 A;  1FWZ A;  1POG A;  5BMZ A;  1Q1H A;  1JE8 A;  3NRV A;  4YFX F;  5DDG A;  1XC5 A;  2OQG A;  3SHF A;  3U1K A;  4BEH B;  4L18 B;  1TWA J;  3GTK J;  1OIS A;  4O5V A;  2GBY A;  4OWR B;  4M3D A;  2PJR B;  1ETX A;  1T8I A;  3DKW A;  2BXZ A;  1K78 A;  1T98 A;  4AVZ A;  2EFW A;  4P1W A;  2ELK A;  3SDB A;  1WFX A;  3GVA A;  4MQ9 F;  2DN0 A;  5GTI C;  1QVU A;  1BR4 A;  1U6G A;  4LLL A;  4QTR A;  3M4O J;  3GWZ A;  3O3K A;  3DQV C;  2XAJ A;  5B3S H;  1T0F A;  1OCC H;  1PUF B;  3SEQ A;  2V79 A;  4CYC A;  2EWN A;  2L9S A;  3S15 J;  3GEZ A;  3K1N A;  3W3C A;  3A2K A;  4HV5 A;  1BI3 A;  3LQQ A;  3FXQ A;  4PUS A;  3G6E I;  4BEH A;  1H0M A;  1YHQ I;  2NS7 A;  1OCT C;  2PJR A;  2CUE A;  1IC8 A;  2BV6 A;  4LFU A;  3FWE A;  4XID A;  4ZYD A;  2F5C A;  2VE9 A;  2RKH A;  1MMD A;  2CQ7 A;  2I10 A;  1MSE C;  3QRF F;  3SFI A;  4JX5 A;  2RNG A;  4DOZ A;  5ICF A;  5LD2 C;  1Y1V J;  2KKO A;  3E5U A;  1MSF C;  5ICC A;  3NWT A;  1PUF A;  2HQR A;  4M9S A;  4N4O B;  2Y48 A;  1IN4 A;  2DA4 A;  1KU9 A;  2V1X A;  2P8T A;  3T5X A;  4BXX J;  3L9F A;  5F0F A;  4S0H B;  1O3Q A;  1V5G A;  1JT0 A;  3DBL B;  2Y31 A;  3CCY A;  5CVV A;  1YRN B;  2GLO A;  1TZL A;  2KT0 A;  3GFM A;  2LVS A;  2YU9 J;  4JYK A;  1Y6I A;  3M1C A;  2GIZ A;  4XRS G;  2WTE A;  4BQN A;  3IHU A;  4OMY A;  2L02 A;  2FUG 2;  1CF7 B;  1D8K A;  4II3 A;  2HPM A;  2L9N A;  3MCZ A;  3KZZ A;  3OYL A;  3CES A;  1BC7 C;  1A04 A;  3DFG A;  3CCR I;  1P92 A;  3E97 A;  2R3S A;  4ON0 A;  5J40 A;  3BR6 A;  3CLQ A;  5GP9 A;  1LUJ B;  3HTS B;  1CQT A;  2CW7 A;  2OV7 A;  4D7N A;  2J5O A;  2HI3 A;  1PP8 F;  4XLN F;  2LKX A;  1ENH A;  2ZB9 A;  5E3L A;  2PBI A;  5JI6 A;  1K4S A;  2XGX A;  2VJ4 A;  4MO7 A;  1DDN A;  2KRF A;  1TC3 C;  1FOW A;  1YX5 A;  4LMY A;  2P7C B;  3DXJ F;  2O8K A;  1T0F C;  2K9Q A;  2ZCW A;  5GAD J;  1CF7 A;  1TL8 A;  1ZKG A;  2IS4 A;  4D5C A;  1FLI A;  1XGM A;  2CUF A;  2YU3 A;  5FD6 A;  2XAH A;  1XCB A;  4KIG A;  4N9H A;  1WWX A;  2K7L A;  4XRS A;  1MJ9 A;  2Z16 A;  2XF7 A;  4UVB A;  3KP7 A;  2FEZ A;  2W82 A;  2MFZ A;  4EM1 A;  2ECC A;  1WH5 A;  3HKZ A;  4A3E J;  1O3T A;  4IQ4 A;  4PJJ A;  3H9G A;  2JPC A;  1B4A A;  4M71 A;  2OCC H;  1MND A;  3B73 A;  2WY7 Q;  4DBR A;  2IT0 A;  1D1B A;  5DD4 A;  2VON A;  3WTZ A;  2QKM B;  5LEK A;  3IWZ A;  4CIC A;  3ZGK A;  2NVT J;  2LY2 A;  4XMY A;  3BRO A;  4RB3 C;  5M5Y J;  1W0T A;  4A3G J;  2IRF G;  1S5L C;  1ZRF A;  6PAX A;  3HRS A;  1W5C C;  3BG3 A;  5CVU A;  1VQK I;  1KU7 A;  1W7P A;  5D4R A;  3CDI A;  1HW1 A;  3QPL A;  3I71 A;  5EEG A;  3ECO A;  5BQT A;  4DGW B;  1IUY A;  4KIF A;  4WCG A;  2R7Q A;  2WB1 A;  5EZH A;  5GAE J;  3E5Q A;  3X2Q H;  4EQQ A;  1LPQ A;  4D5F A;  3OYH A;  4BH9 A;  4A3L J;  2PG4 A;  2HS5 A;  3UKG A;  2UUZ A;  3Q0W A;  4WF2 A;  5GPC A;  2M0C A;  3G2B A;  3KP5 A;  3WHC A;  4XRM A;  4IOC F;  3GW2 A;  1MJB A;  1IN8 A;  1TNS A;  4L5E A;  3WTX C;  4A0Y A;  2R5Y B;  1QZY A;  4BQO A;  3RKQ A;  1R4N B;  3LSI A;  2MH9 A;  3CD6 I;  4CA0 A;  3H0G J;  3HHG A;  2BE5 F;  5JLW A;  1VQ9 I;  2J5P A;  2DO7 A;  2K9L A;  3G4S I;  2VJI A;  1ZLK A;  3Q3S A;  1UFM A;  1RES A;  2IPQ X;  1ZR4 A;  1RC9 A;  2K40 A;  4HW0 A;  3OYK A;  2HOS A;  2TCT A;  4ITV A;  3CUO A;  3V7S A;  3K4B A;  4MEY F;  3WG9 A;  3S1N J;  4MFE A;  5TIS C;  3M1E A;  5KCM A;  1I1G A;  1UMQ A;  1ZGA A;  1ZTR A;  1LDJ A;  3VYS B;  2UV1 A;  1XMK A;  4DQ2 A;  2R5Y A;  3S1Q J;  4M9X A;  2EZH A;  4AWX B;  3H3U A;  2ECB A;  3K1P A;  3BLY A;  4CCO A;  1GT0 C;  2BGC A;  1NTC A;  1U0J A;  2KDO A;  2A5W A;  5J1Y A;  2W24 A;  2Z1D A;  3CF2 A;  3RDI A;  4XN0 A;  1TLH B;  2EA4 A;  1EV7 A;  2ZKZ A;  4IHX A;  4NDL A;  4BY1 J;  3RPU A;  2CWE A;  1IJW C;  3T1B A;  1DP7 P;  3LFK A;  3W2A A;  1YW8 A;  2ZJQ F;  4XON A;  2LRE A;  4Q4Z F;  4UB8 C;  3OMY A;  1MBF A;  5IT9 K;  5L3G A;  1VQO I;  1G3S A;  1T56 A;  1UJ8 A;  5JR3 A;  1TQI A;  2EPF A;  1I39 A;  1X2N A;  3QYB A;  4GXO A;  4HOB A;  1R00 A;  4N9I A;  2ID3 A;  1U3E M;  2EA2 A;  3ZMS A;  5IOY A;  1BOB A;  3GLX A;  1LFP A;  3F8F A;  2P6T A;  4XLE A;  1NG7 A;  5JVG F;  1YI2 I;  4ZYE A;  4ZDL A;  5BOX A;  2LD5 A;  5IOZ A;  2VAS A;  2XAU A;  2GXA A;  1XD7 A;  3A0H C;  3L2W A;  1TWG J;  2EH3 A;  3AG3 H;  4PJM A;  2E1M C;  4UNO A;  1BBY A;  1WKM A;  4II2 A;  2R7U A;  5E17 F;  2OUM A;  4M6X A;  4XNF A;  2XAS A;  4IHS A;  2GOX B;  4DIQ A;  4WWC A;  4KFC A;  3GO5 A;  2DU9 A;  3L1P A;  4G94 A;  1RKW A;  4B8X A;  1XTA A;  3REO A;  2KZG A;  5LRS A;  3JRB A;  4XBF A;  3CJN A;  2R92 J;  3OY9 A;  3H92 A;  2H09 A;  3I0T A;  1F43 A;  4RLF A;  4CCJ A;  1MW7 A;  3LSK A;  1YJ9 I;  1X19 A;  3TO9 A;  4BJ6 C;  4RBO A;  3CLO A;  1LVA A;  2OBP A;  1WH7 A;  1IRZ A;  3D0S A;  1FX7 A;  3C1D A;  2EV0 A;  3KLO A;  5FLM J;  2PJP A;  3HOS A;  5L3D A;  1MBG A;  3TO6 A;  3I4N J;  2XF6 A;  1TTY A;  3KYD B;  3L09 A;  1Y39 A;  2BVM A;  2G7H A;  2E2I J;  3U2R A;  3JRA A;  3DTE A;  2M45 A;  4OIN F;  4HYE A;  5DYM A;  2X6X A;  5HNF A;  1IXS B;  3WTW C;  1S9H A;  1YLF A;  4Y33 A;  5E18 F;  1D3Y A;  2E1N A;  3H5R A;  3VYT B;  2HKX A;  1LFU P;  5DEQ A;  2ZBK A;  2R7W A;  2BHZ A;  2HYF A;  1W4M A;  2OTL I;  2QGU A;  3CCL I;  1YFH A;  1LE8 B;  1OYY A;  3P9I A;  3S14 J;  1Z05 A;  2W84 A;  3QWL A;  2L54 A;  3ZQG A;  2OF7 A;  3QOE A;  5TGT A;  3BP8 A;  1I3Q J;  3R0A A;  3NAR A;  2ZME B;  2DTR A;  4HZF A;  4X0G A;  4AIJ A;  1FTT A;  2QEX I;  4HRI A;  4IHV A;  3LSP A;  1MMN A;  2B9S A;  1A6Q A;  4E70 A;  2H6B A;  5CVI A;  3FK7 A;  1LKX A;  2FSW A;  4K2E A;  4BAY A;  5DM7 F;  2LOO A;  4XIC A;  4RLQ A;  2QKL B;  3FM3 A;  3PFI A;  3KE2 A;  4KN7 X;  3ZQC A;  5HLT A;  3ZMU A;  2ZJR F;  3DWL E; 
#chains in the Genus database with same CATH homology
 5GAG J;  5GAD J;  5GAH J;  3J7Y J;  2ZJQ F;  3CCS I;  2K3F A;  3CMA I;  4UY8 I;  3CME I;  1VQO I;  3I56 I;  1VQ5 I;  3CCE I;  4V19 K;  3I55 I;  4IOA F;  1VQ7 I;  1VQL I;  1FOY A;  2E34 A;  5DM6 F;  1YI2 I;  5JVG F;  2H8W A;  3PIP F;  3CC7 I;  2QA4 I;  2E35 A;  3CJT B;  4IO9 F;  1VQK I;  3G6E I;  3CCJ I;  1YJN I;  1YHQ I;  3CC4 I;  1VQ4 I;  3CCV I;  1HC8 A;  3DLL F;  1YJ9 I;  5GAE J;  2E36 A;  1VQP I;  2NXN B;  1QA6 A;  1FOX A;  3CF5 F;  1MMS A;  2ZJP F;  4IOC F;  1Y39 A;  3CD6 I;  3CCM I;  1VQ8 I;  3PIO F;  1ACI A;  1YIJ I;  1VQ9 I;  3J7Z I;  3G4S I;  2JQ7 A;  1VQN I;  2OTL I;  2FOW A;  3CCL I;  3G71 I;  2OTJ I;  3CCU I;  1VQ6 I;  3CCR I;  1YJW I;  3CC2 I;  2QEX I;  1YIT I;  1S72 I;  3CCQ I;  5DM7 F;  1VQM I;  2ZJR F;  1FOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...