1YITI

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yitI00
5GADJ 1S72I 2H8WA 2OTJI 3CD6I 1VQKI 4V19K 1VQ6I 3CMEI 4IOAF 1VQ7I 3G6EI 2ZJPF 1VQNI 1VQ8I 1ACIA 3CCMI 5DM7F 3G71I 4UY8I 1Y39A 3CCRI 1YJ9I 1QA6A 2E34A 3CJTB 3CMAI 1YITI 5GAHJ 3CC2I 1VQ5I 3CC4I 2ZJRF 1MMSA 3CCUI 1FOYA 3CCVI 1FOWA 3CCQI 2E35A 1HC8A 1YI2I 2FOWA 5DM6F 4IOCF 1YJNI 3CF5F 1YJWI 1YIJI 3CCJI 5GAGJ 2ZJQF 3J7ZI 3CCSI 5GAEJ 1VQOI 1VQPI 2K3FA 2QEXI 3PIPF 2OTLI 2NXNB 3I56I 3CCEI 2QA4I 1VQ4I 3CC7I 2E36A 1VQLI 2JQ7A 1VQMI 1FOXA 3CCLI 3I55I 3J7YJ 5JVGF 4IO9F 1VQ9I 3PIOF 3DLLF 1YHQI 3G4SI
chains in the Genus database with same CATH superfamily
3OWTA 2KDZA 2K27A 3LFKA 1BJZA 1TNTA 4UV8A 2KKOA 3REOA 3GFJA 4L9VA 4E70A 1EH6A 3VYSB 2KFDA 4QIWN 2P4WA 3G1OA 3KX2A 2Q1ZB 3AG1H 3MD2A 2HZTA 2HGCA 3IP4B 4ZYGA 3G6EI 5BOXA 2FUG2 4JX4A 4LG3A 4FE4A 3GTLJ 4EMSA 4LIVA 5H20A 5K1YA 1I39A 2BZTA 3WU0A 4XMYA 1Y39A 3FXJA 2RC4A 3HHGA 4XR6A 5JI6A 1T2KA 1W0TA 5HLIA 1MBKA 5D5WB 1DU0A 3K1NA 1KA8A 1YRNA 2E2HJ 2ZXWH 2CUFA 2HZDA 3BOQA 3P5JA 3OYKA 1ZREA 4Y13A 1JXSA 4IX7A 2VASA 1H9GA 3V4GA 4XKCA 1YW8A 3CCYA 3OYNA 4RB1A 3K1MA 1REPC 2AXTC 5DD4A 1OKRA 3NARA 4NDLA 3TKYA 1FZPB 3OYGA 5B1AH 1J75A 3TW6A 3GFMA 5DEQA 1LNWA 3JREA 3FXUA 1IDZA 1TWHJ 4C30A 4R79A 4XM3A 1U78A 5E79C 2CRGA 1D5VA 2ZJQF 2XRNA 3WTVC 4I7HA 2EIJH 3QYEA 2DMTA 3VDXA 3KP6A 1H9TA 3AG2H 3GEZA 3L9FA 4II3A 4W1UA 4CCKA 2CUJA 1MNMC 3A02A 3PUFA 3H9GA 3CJRB 3IAS2 4NC6A 2FBKA 5DS9A 4NB5A 2HR3A 1A6IA 2O0YA 4CYCB 3WE2A 4IHSA 3QOPA 3RIRA 2R7TA 5C4JJ 4XLPF 2HS5A 1XC5A 3HYIA 5J47A 3RJPA 2L7FP 3E5XA 2MC3A 3WTTC 1SFXA 2E1OA 2VKVA 4BEHA 5M5XJ 1U5TC 2E19A 4DW6A 2IW5A 4HDVA 2MGQA 2VQLA 1HA8A 2BVMA 4MFEA 1R58A 3HOTA 2DW4A 4XLNF 3J7AO 2XGDA 5KK1A 3A03A 3HG9A 3J80K 2EFPA 1R36A 1K78A 2A69F 3LL7A 3RDIA 1FYKA 4FISA 1E3OC 2K9NA 3ZR8X 4IZZA 1ETVA 2XB0X 5GADJ 1K6OA 3LQRA 3ABTA 3R4KA 3ZQGA 4ZZLA 2K7LA 1X1DA 3S1MJ 1K78B 1W1WE 1Z3XA 4LG0A 4IOAF 3R0JA 2V9VA 2L7ZA 3N05A 2GXAA 5D8KB 3OS0A 5FFZA 2IJLA 3ZMTA 4YG2F 1BW5A 5EJCA 2ADUA 1XDUA 4I99C 1LDKB 5C44J 3IKTA 3OSGA 1QA6A 2F2EA 4PSWA 2P5VA 1JI8A 2QF7A 5H6QA 2DA6A 5LEKA 4E4HA 3BTCA 1W36D 4ABZA 4BBSJ 2J5PA 4OAYA 2GOXB 4UUTA 2QKLB 4ENKA 2JUCA 2R7ZJ 2QWWA 2WV1A 5IP9J 1ON1A 4YFKF 2M8GX 1BJAA 2LMDA 4Q47A 1FSHA 1YE9A 2B9SA 5KCMA 5FD6A 1R71A 3RZDJ 3CMMA 2EA4A 2I10A 3TBIA 1D1AA 3QPSA 1YIJI 1K7AA 5DDGA 2M2EA 1WJCA 1Z67A 2F5DA 5L3DA 3VOEA 1FPQA 2HVRA 2ECCA 2XAUA 2F5VA 5E17F 4D9JA 1CGPA 1FX7A 2OQGA 4HA8A 2DK8A 4DJAA 4LLLA 2GA1A 3E6CC 3V7CA 4WXCA 4F91B 1MSFC 1MBEA 2F48A 5ICFA 2FBIA 2AO9A 3UKGA 2UXXA 1FOKA 3K70C 2KZVA 3WU2C 2ELKA 2TDXA 3FBNB 2E71A 1UB9A 2D1HA 2RGVA 3BT9A 3S14J 4NHJA 5EG0B 2P81A 1HKQA 3CLQA 2OU2A 3DP7A 2JSCA 2IEKA 2HDCA 1ZR4A 3WTZA 4S05A 1SFUA 1FTZA 1T98A 4BXUA 1FOXA 4DGWB 5DD8A 4DBRA 3BROA 1W5SA 3KP7A 4DBQA 1XD7A 1T39A 4KICA 1XSDA 1RR7A 3PIOF 5DYMA 1SC7A 2B63J 4PFOA 2F4IA 2MD0A 1C0WA 1I5ZA 2L9VA 3M1EA 2JTVA 2EIKH 3DTEA 5ICEA 4E7HA 2VBXA 1JE8A 2LDUA 3FIWA 4AUXA 1TW3A 1HQCA 3FMRA 1IXSB 4M6VA 2QYOA 3DQVC 4HZFA 4IKFA 2D45A 4Y17A 2H6BA 2L9NA 3CF2A 2NRAC 1SVMA 2LTPA 2JWTA 4A3LJ 2XB5A 4Y33A 3SEQA 2BY2A 3R61A 1MD0A 2JZYA 4XRFA 5HS8A 5AIQA 3HL2A 3KFWX 1LVAA 1U8BA 2Z3YA 3O8GA 1G8XA 1OCCH 5ED4A 3G71I 2RREA 3GTOJ 2XASA 3KP4A 2PMZA 3RKQA 3S15J 1RI7A 2RNGA 4MIMA 3EUHA 4UVBA 2DT6A 5IT9Z 2MW8A 3PSFA 4CXFA 4AIKA 2L9RA 5CYVA 4LMYA 1OR7A 1X1BA 1YITI 1O3TA 2WB1N 2XGEA 3IHUA 3JRDA 5IT3A 4RGUA 2QENA 4YEJA 3HHHA 3CCUI 3HKZA 1LDDA 3T0YA 2VXZA 2F6CA 2LY1A 4GYIA 1R23A 3DTKA 3I53A 2RVCA 3BDDA 1ITYA 2CU7A 2YUSA 4Q4ZF 4A3MJ 2H8RA 3AFHA 3OYJA 5GPAA 3JR9A 3CF5F 5KVRA 2PEXA 4LITA 1AWCA 3SDBA 2O6GE 9ANTA 4N9HA 2COBA 3LFUA 3S32A 3PM1A 3LWFA 2ZJ2A 1NG7A 3FISA 3ROUA 2WAQN 2X1CA 4ENNA 3PO2J 4XKBA 3P9CA 3BG9A 1QGPA 2EZKA 4L0YB 3LSIA 3WGIA 3KYDB 4UVCA 1ETXA 2P6SA 3ECOA 3SQNA 4V2FA 2DO7A 2BOLA 5J8CA 3JRFA 3KYCB 4G6TB 2JT1A 3MVPA 4HAMA 5E1ZB 1U0JA 3NWTA 1WJBA 3QPLA 3BY6A 2E36A 4BE0A 3ZN1A 4KYWA 4B3XA 3ZQFA 2DA4A 4A6EA 3OL3A 1XSVA 1BIAA 1R22A 3ULQB 1JJ8C 4FETA 3F23A 3DV8A 1FNNA 3VPRA 5EGOA 2KL4A 3W6VA 2CJJA 1V54H 2M34A 2PX9A 1TWCJ 3GZNB 3HGYA 1O7FA 3OYEA 3T8RA 3HGGA 1FIPA 5JHFA 4MO7A 4FTHA 3IH3A 4D0PA 5EGOB 1E2XA 5FLXZ 1DP3A 3W6KB 4AU7A 1ZGJA 2LR8A 2OPTA 3LQQA 2P5KA 2DODA 1VQKI 5EYRA 3CMEI 1MBFA 3GTQJ 4RAFA 1Y8QB 5A2QZ 2M3AA 2VPRA 1SVOA 3VWBA 1TT5B 2QBYA 3HC7A 4F3QA 1X19A 3BLYA 1BR4A 1WPKA 1T8IA 1QQIA 5ILUA 3PFYA 5F6FA 4EQQA 1TWFJ 5HLTA 1MKMA 1ZKGA 3S1QJ 1RNLA 1HDDC 1WCMJ 2NYXA 1A04A 3IH2A 3ASOH 1LE8A 4PZJA 3L2WA 4GCVA 3SEZA 3ZMZA 3RYPA 5GTIC 3CC2I 1VTNC 2OF7A 3HOXJ 1XMXA 3KEQA 1NG6A 1E3PA 2VT3A 2DFIA 3ABKH 3D5RC 3CCQI 4ENMA 4HF2A 2FOWA 5J6XA 3RI4A 2K86A 4BH9A 5DM6F 3WODF 3RPQA 4MHGA 3WE3A 2VJ5A 4E7ZA 1RETA 4PJJA 3TW7A 2NVQJ 2YPRA 4MQ9F 2ZBKA 1LEBA 1UHSA 4X0GA 1BC8C 5GAEJ 1Z0XA 1GV2A 3ZGKA 3T5XA 1J7KA 2KISA 1X2MA 2DMNA 3BQZA 2KT0A 1PYVA 1G3YA 3BR3A 3R60A 1ZRDA 2OTLI 2R92J 4GGGA 2K4BA 5FKNA 4LJZF 3GW2A 4OAZA 1A5JA 2NXNB 1WVRA 2DU9A 3A01A 1Y6IA 4YRVA 2EV6A 5LGNA 1IN7A 1BN5A 5B5EC 4XLFA 2WTEA 2K85A 4D5CA 4QPOA 1LFUP 2XKOA 3LSKA 2J5OA 1MIJA 2DFFA 2ZXHA 3S3NA 3W2WA 3HRUA 3K4NA 4B1RA 2IA2A 3H5RA 4NC8A 3B73A 2GZWA 5E1WA 3DCFA 1ZG5A 3FDYA 3DBRB 4ZYAA 2LG4A 5C3EJ 2FJ1A 2MH9A 1XCVA 4E7KA 4ESFA 1X1AA 2XVCA 1P92A 5FGMA 4N4OB 4DYCA 3TQNA 1VQ9I 3N4MA 1BW6A 3PL8A 2D2WA 4EGZA 2PLYA 1S8NA 4XOPA 2HQ5A 3FHNA 4HW0A 1S72I 4ZZDA 3QODA 1UZCA 1F5TA 3LA3A 3QPHA 2HWVA 1X3UA 2ISZA 1DGWY 3OOPA 1MNEA 2H6CA 1X58A 2P6TA 3HPHA 4DZJA 2IT0A 2IS2A 3PUBA 3TOBA 3MZYA 3S93A 2NS8A 1F9NA 2L4MA 1V55H 3ECHA 3O3KA 2CV2A 1YW9A 5CQGA 2FX0A 3SZTA 2VONA 3W6JB 4I09A 2EFOA 4UVAA 5LHIA 1I3AA 2EWNA 2QUFA 4I0BA 1WI3A 4ON0A 3KETA 2KIUA 1J0RA 2JPBA 4R8HA 5GP9A 4A5MA 4AD9A 2X0LA 3FF5A 2E60A 2M30A 3HRMA 2R7VA 2OUMA 5FROA 3LA2A 5M3MJ 3G1MA 1FYMA 2AXLA 2CQKA 2IAIA 2JPCA 2VT2A 1ORKA 2CQNA 4HOBA 4G7OF 2CS3A 1D0XA 3S2WA 2F4MB 3ZRGA 1MMDA 4MTDA 1A31A 1S29A 4I6ZA 2VOOA 3MFKA 2NVUB 2A07F 3F72A 4BNCA 3DKYA 4U88A 3JCUC 2W24A 1YTYA 2BE5F 1QHGA 3BR1A 2OZUA 2Y9ZA 3BPXA 1GXPA 1MMAA 4C3IJ 1E17A 4ESBA 4HNUA 1WWXA 1QZZA 1YYVA 3OIPA 5EEGA 1PP8F 1MH4A 1MMNA 1SD5A 5HS7A 3RYRA 1UAAA 2Z5UA 2XF6A 3K2ZA 1VQ4I 5B66C 1K83J 4J00A 2ZMEA 1LEAA 1P4AA 2E7WA 2XAFA 2EZLA 2HQNA 4IL6C 4P1WA 2R4GA 4I76A 2XPWA 4B4CA 1IN6A 1WJEA 4DYQA 2KHMA 3AL0B 4KN4X 3BZ6A 5E20A 5HNHA 1BI0A 3U1KA 3JTGA 2Q2EA 3WTSC 1V5FA 1Z91A 2ZMEB 2H27A 2VPLA 4MNUA 3I4MJ 4XBFA 2M0CA 3I55I 4RGXA 1XMAA 1Z21A 4NQWB 4D7NA 3CJQB 2A6EF 3GXOA 4KT6A 2PJRB 2L2OA 3QU6A 4ITVA 4GDFA 4HNTA 4P9UA 1ZG1A 3DLLF 3E3VA 4JQFA 2VBYA 4AYBA 4ZDLA 2VL8A 2LKPA 2Z2SB 4HX4A 1S6LA 4RBOA 2LREA 2E2IJ 3I59A 3CDIA 2V1XA 1B9NA 2KZGA 2OTJI 4E6KG 4CHUA 2O61A 4U7DA 2X1EA 3JRAA 3GWZA 1UJ8A 1P4WA 1DU6A 1UFMA 2Y75A 4IHXA 2HNHA 4YIRX 2RDPA 2HQAA 3HSFA 5FKOA 5E18F 4II2A 1IGNA 2R93J 5IOZA 1WJFA 1HLVA 3CQZJ 4ZYEA 4UY8I 1P7JA 4PDKA 1MZBA 2WAEA 3KE2A 2GA2A 3OL4A 4LOCA 3BZKA 2HKOA 5FJ8J 3OYIA 1G6NA 3E6MA 4HG2A 1SFKA 1ZLKA 1MH3A 2W84A 4LFUA 2M8EA 3T1BA 3K0LA 2JA5J 3EUHC 1R5HA 1QBJA 2MLGA 4A3BJ 1MMSA 3WU1B 2GOMA 2FRHA 2EJRA 1YX5A 1WJDA 3GLLA 2CFXA 1GUUA 1OR7C 1DPRA 1O3SA 2H09A 3RKXA 4PUSA 1OISA 3BQYA 3FXOA 3EUKL 2EPFA 4MEXF 1BBYA 2WA0A 1JHHA 5LRSA 2FSWA 1Y8RB 2QSGX 3M3YJ 2VC1A 1WJ5A 3DEUA 1Y1WJ 2VE8A 3I58A 1MJBA 1V4RA 4D1QA 2IRFG 5C4XJ 3CCJI 4XRSG 5GAGJ 1IXRC 2VQGA 1FT9A 1ETKA 4IHWA 5ERIA 3D0SA 3LAJA 1ZLJA 2X51A 4BL0B 4IJAA 1SAUA 3LSMA 4MEYF 3PIPF 3RPUD 5BS6A 2EFNA 3ZQIA 2RN7A 1OFCX 5GTHC 3CO6C 3F0CA 1RUNA 1L3LA 2FMYA 5IOYA 3RKYA 4EM1A 4WCGA 2XAGA 3NEUA 2FNAA 5IYBJ 2JA8J 2EA2A 2ESHA 3X2QH 1D3YA 3V8LA 3IAM2 2OCEA 2HOSA 1FLIA 2BGCA 5KNLA 2XUBA 3PFIA 2CWEA 5DUKA 1GT0C 4CYCA 3CCLI 2ID3A 3BG5A 3LSRA 2VQCA 1L0OC 2UV1A 5IT9K 2JA6J 1YG2A 2L0KA 5FB2A 4ZTFA 2IA0A 1QO0D 2BVLA 1UG2A 1YHQI 2K9SA 4ASNA 3HOVJ 4NUBA 1IC8A 2XPUA 2V4JC 3ZXSA 3GTGJ 5J40A 5LGTA 4BDYA 1HXDA 3LOCA 2CYYA 1T95A 4LK0F 3GO5A 3GX4X 4XKWA 4LIUA 3CD6I 3HTSB 1VNDA 5DCMB 6PAXA 4L5JA 2IS1A 4MGRA 4J19A 2EFWA 1MMGA 4OMZA 4EM2A 2VLAA 5E8GA 4UB6C 1Z7UA 2K3PA 4EJVA 1T0FA 3MMYB 1Z05A 5HDKA 2XF7A 3ML6A 4YELA 4EATA 4B3AA 2DDBA 2H1KA 3DLAA 2HVQA 1ZHFA 3ZN0A 4I01A 5K5RA 2TCTA 2VBZA 1HW1A 1ODDA 2E34A 4YIFA 3PNTA 1HKTA 2V9PA 3CJTB 1FEXA 3F8NA 1LVKA 3DEWA 1I27A 4M74A 2WY8Q 1TLHB 1D0YA 1G3WA 4JYKA 2ELHA 1IV6A 5F0CA 2VUMJ 1X1PA 2O7OA 4EGYA 3OYBA 2LBFB 4HLXA 1RRJA 2VKHA 2LF8A 4Q48A 2COMA 2R5YA 4IQJA 3O2PE 2UXNA 4M3FA 4PK4A 4LB6B 3S2DJ 2BY0A 1J2XA 5DV5A 3EDPA 2JK3A 2M45A 1KYWA 2OC6A 3S1NJ 1NH3A 3VSLA 2OAZA 2R5YB 3MWMA 1F36A 1K79A 3KP3A 4XN3A 4U87A 3BTLA 3Q9VA 4IXAA 2K40A 3CLOA 1ON2A 2EV5A 1SVLA 2ZC2A 3K9TA 3BJAA 2WV0A 2E1MB 2DQLA 1WI9A 2X1DA 2KRCA 1SMTA 1B59A 2JVGA 5FLXK 4XK4A 5EF6A 5CKTA 3ZOBA 1TL8A 3U21A 3BG6A 5CQEA 3GYHX 1R1TA 5CJ9A 1STZA 5B3SH 2CW0F 3IV5A 1A6QA 3H1CA 5LHGA 2STTA 5A2QK 5AIPA 2FD5A 1F4KA 1ZAOA 5HLGA 2ZSHB 2ICWG 2H1LA 1AA7A 1GLNA 2MABA 4QPQA 4AIDA 2ZKZA 1SAXA 3R6SA 2E5NA 4I2OA 5EG0A 4DNCA 5IYDJ 2HPMA 5E3MA 2VKEA 1W5TA 4A3JJ 3EYYA 3F8MA 4AIJA 3JRHA 1ETOA 1WH7A 2K9QA 2VIXA 3BCAA 5CVJA 2MYSA 4F92B 2VODA 2O8XA 3K1PA 2LH9A 2UUZA 3IRRA 4BUPA 3FMQA 2Q8KA 2ZB9A 2XDVA 4FE7A 4R1HA 2L4AA 1VQNI 3C2HA 1TQIA 2W25A 3A0HC 3DPLC 3E7LA 4BHPA 4P5OA 5CVIA 1I6XA 3EUAA 2HOEA 3TP3A 4BAYA 1XGSA 4BHCA 4A12A 3DPUA 1LFPA 2HDDA 3TO7A 2R7XA 1VQ5I 3F6VA 2XHKA 1XGNA 4RMNA 1YOVB 1IZ1A 2L01A 2PI0A 2NAZA 3MKZA 2QQ9A 1JGGA 3L2CA 1ZQ3P 3K10A 5CVRA 2L02A 1R6RA 4K2EA 3SFZA 4PJ0C 4XN0A 2PMHA 3I4PA 4Y3OA 4HV6A 3I54A 2GXGA 1JJ6C 1APLC 3J7AY 2L9SA 2M9HA 4S0HB 2DFEA 1IUFA 4KISA 1LJ9A 4JK1X 4PCQA 3DF8A 1ZR2A 2HTJA 3HRSA 2X6XA 5HDGA 3JRBA 4BXXJ 1YJWI 5DCFA 3F6OA 3KLOA 4V2GA 2M5WA 5HVQC 3GF2A 2B0LA 3WHCA 3CCSI 1VQPI 2V26A 3FX3A 1R5ID 4JBAA 4G94A 4KIFA 1IUYA 3H35A 4CA0A 2QEXI 3DWLE 2W48A 3QU3A 5F27A 4F55A 1IRFA 3I71A 2F5EA 4E7SA 3RQIA 1BI3A 4EJUA 1HBXG 4KT5C 3VYRB 2FQ3A 2QA4I 3I56I 3QOEA 3IWZA 4HEA2 3BG3A 3F8BA 4XNFA 3F8FA 4NC7A 1LQ1A 3BR6A 4B44A 3AL0C 2YU9J 2XF5A 1WRJA 3FKJA 2ME0A 5JHUA 2IXSA 1NHAA 2DOFA 4DYRA 2YSRA 2VJ4A 1KU7A 2ZMEC 1YS6A 5BQTA 2DPDA 3RCOA 3K7AJ 2R7RA 3BR0A 1B1BA 5J1UA 4FASD 4H4KC 1FWZA 2EFQA 1S3JA 2OBPA 3EETA 4YFNF 1OPCA 2FMLA 1XN7A 2DJNA 4KFCA 4ETSA 2KP6A 1YLFA 4BGDA 2LVSA 1KQ8A 2MSYA 4M3DA 5JR3A 2DYSH 1MBGA 3PNYA 1KYZA 2R5ZA 4MLOA 1OCZH 2W7NA 1IG7A 2QSFX 2GBYA 2M87A 3A0BC 3CESA 4A0YA 3MKWB 1ULYA 3ONQA 1MJAA 1V3FA 4BDZA 4A3EJ 5H6RA 3ZP5A 2R5ZB 1W36C 2JVHA 1AKHA 2Z9OA 1MDMB 2NNNA 2O3FA 3M1CA 5CVUA 1JKPC 2ZJPF 2R7DA 4OIPF 1Y0NA 3ASNH 3MEXA 3RZOJ 5ILVA 4CZCA 5K7FA 1RIOH 2DTRA 3KEYA 5BNGA 1AKHB 1SMYF 3H3UA 5IP6A 3JW4A 4A5NA 1OCOH 3E97A 1R7JA 2Y0SA 2ETHA 1MBHA 2DAOA 4RAYA 2BV6A 2QQAA 1B9MA 2NNYA 1PVEA 2CW7A 1BC7C 2M0MA 2RNJA 2Z99A 2UWMA 1Z9CA 4JP0A 5AONA 4KA4A 1FOWA 2KDOA 4MTEA 2ID6A 1LUJB 1YI2I 1I6HJ 4P9FA 4A0ZA 4KDPA 3U9GA 5FFXA 5LFAA 2NVYJ 3ELKA 3C2GA 4C2TA 4G8XA 3FXMA 3HTUA 1JTYA 1S7OA 3DBHB 2XIGA 5HLHA 1JT0A 1TC3C 1FIAA 2DYRH 1I3QJ 3ABLH 3QAHA 4DQ2A 2HQRA 2ACJA 3HDDA 3S16J 3I4NJ 4RAGA 3TDUC 2ESNA 4CUGA 3KZZA 1UHWA 2FA5A 1O4XA 1ETYA 1ERDA 1ZG3A 4Z6YA 2L7KA 2CG4A 4L5EA 2EK5A 2LY9A 2IS4A 5TGTA 1PDNC 3WTXC 4C2UA 3G2BA 3F22A 3V8KA 2P8TA 2E2JJ 3M8FA 3D1NI 2VI6A 2RV8A 1N78A 3H92A 3F3XA 2MG4A 3I3LA 4CYDA 2BBYA 3QRFF 3QWLA 1TQMA 1ZTRA 1POGA 2A68F 1TW2A 2EV0A 3P7NA 3A1YA 3IUOA 3ESWB 3LSJA 4AYBN 4GRIA 1MW7A 2Y9YA 1USTA 5TISC 4FCYA 1VQMI 2O9LA 4BJ5C 4CSWA 2DBBA 1RZ4A 4D7MA 4EJTA 4HX7A 5D5VB 4BY7J 2YU3A 2XAJA 4IO9F 1ZGWA 3K4JA 5J4VA 4O5VA 2XGXA 3S3MA 3V8JA 4AVZA 3TGNA 5K5OA 4O3MA 2ZXIA 3HUGB 4YIIA 4P55A 2HFHA 1BIBA 5KAFC 2BXYA 2HYJA 2EILH 3GTMJ 2GIZA 4JX5A 4EVIA 2CUZA 3S3OA 5E3OA 1J09A 3PSIA 4BQOA 1R1VA 2ME6A 5LD2C 3E5UA 1FBUA 2NOJB 5B1BH 2IVMA 1VQ8I 1XMKA 4CDGA 3CCMI 1FP1D 4OINF 1JKQC 3FHZA 3QQAA 3C18A 4XSXF 1QRYA 3D5SC 1IW7F 4IRIA 3GFLA 1YJ9I 3PQJA 1T0FC 2KJCA 1FMVA 1OYYA 2JUGA 2XAQA 5E1XA 4A3DJ 2HYGD 3LSHA 1PUEE 2OCCH 4KUMA 1H89C 3CC4I 2HOAA 3B6AA 2ZJRF 3ZQLA 3RPUA 4UUSA 2O5RA 4CCMA 4A3IJ 2ZCWA 3VYUB 1HF0A 1ZARA 2M4KA 3SHFA 2RKHA 1P6RA 2WY7Q 1B4AA 3SXYA 3OR2C 4IOCF 2VJIA 2CH0A 3SZGA 2JA7J 2HDWA 2WAQA 2DCEA 4HYEA 3JSOA 1IF1A 4IHYA 3S2HJ 2DLLA 3K4BA 3HEFA 5KAIC 4UUSB 2XGCA 2KIMA 4ESJA 2G0EA 4BQAA 4KMFA 2HYFA 2I5UA 3C7JA 3VFZA 3PJRA 1EKEA 2V9KA 4F52A 1H88C 4G6DA 2HXOA 2E1MC 4LK1F 3MCZA 3L1PA 3DBLB 1Z3YA 2DXIA 2XROA 2A6HF 1U6GA 5CLSA 3CCEI 4E7LA 3ZMSA 2V79A 1MSEC 1XDSA 1E0EA 3MN2A 2JSPA 5HS9A 2KPMA 3HM5A 3HB9A 3G3ZA 3PQKA 3CO7C 2KQRA 4RB3C 5L3FA 2DJIA 2UZKA 1QNTA 3HPGA 2P7VB 3KZYA 3HBLA 3OMYA 4CO8A 3GLXA 3GBGA 1O57A 2R7WA 3B6CA 1X4OA 2WAFA 3OYCA 5F1JA 4F7ZA 2PG4A 2X9DA 2A5WA 4UNOA 1KONA 4LGWA 1OLTA 2PMUA 1DDNA 5BPIA 1JTXA 2KIQA 1U9NA 3QYBA 5FLMJ 4OIRF 1OYIA 1R4MB 1FBSA 4NQWA 2VN2A 5LRRA 4BXFA 2JRMA 1OCPA 3FXRA 3ZMDA 1K4SA 2PJRA 2ECBA 3OR1C 3CUQB 1BM9A 2R7FA 3M8EA 3GTJJ 1TP4A 2CGPA 2WADA 3KYLA 3QP5A 4FT8A 1K6YA 4KMUX 2XSDC 3IL2A 2R3SA 4GFBA 5GPCA 3AG4H 3WG9A 3GVAA 4BQNA 3M7GA 4X6AJ 3M8JA 3BG7A 1XCBA 2B7EA 3PO3J 1SD4A 3QYFA 2EB7A 1UHMA 3C3WA 4H0EA 3DFGA 3OIQA 3OYFA 1HW2A 3LSPA 3J81Z 3CCRI 3MZ8A 3FZVA 2V1UA 4QTRA 3BP8A 1YIOA 4NBQA 2HOTA 1R1UA 2FXAA 3HJEA 3H3ZA 3S8PA 5FRNA 1RKWA 1BR1A 1Y0UA 5GAHJ 3CDHA 2CQQA 1J59A 2P7CB 3H0GJ 4QLCU 2Y2ZA 4IHVA 5E3LA 3M9AA 2XKPA 3MKYB 3FXLA 3CP8A 2MA3A 1G4DA 1YJNI 1Z6TA 2FBHA 3BCBA 4JX6A 1TBXA 2HI3A 4JOMA 4WWCA 1IN8A 2LYCA 1JT6A 1J5YA 2L54A 4QWQA 3L00A 1I1GA 3WGGA 2PJPA 5EZGA 5FKLA 1OCTC 4RGSA 1VQOI 3E6BA 1U8RA 4A0XA 4RB0A 1T08B 2MLKA 3MKLA 1T6SA 2VC0A 3R0AA 1CF7B 1BR2A 3O8HA 1GXQA 2NOGA 3ZQCA 4XIDA 2D1VA 2QKMB 2QQBA 5HOOA 4GXOA 4ZH4F 4ENJA 3TMOA 4OMYA 2JMWA 1QVUA 2L3DA 2LK2A 4IQ4A 2QCOA 5M5WJ 2NVXJ 1VQLI 3LSGA 1NK2P 4I98B 5EEAA 2H94A 3EQLF 3SYTA 5F1RA 1P9QC 2DI3A 3A4CA 3JTHA 1DUXC 3DPTA 2CO5A 3J7YJ 1KQ9A 1UG0A 4BACA 2RQQA 4M73A 1OCRH 3K70D 3BTIA 1KU9A 4KJZA 2VE9A 3K2AA 2LF7A 4HQEA 4RDUA 2XAHA 4XOTA 4RLFA 2XPVA 3CP2A 1BA5A 4HNVA 1ENHA 1LPQA 4B47A 5HNFA 3MAJA 3KP5A 4PJLA 1LDJA 1IRZA 1YX3A 3CJNA 4Y15A 1J9IA 5IP7J 2QZ8A 4U0YA 2DA2A 3I0TA 3SZPA 1VQ6I 4XL9A 5DTDA 3L09A 2R0QC 2CW8A 4PGGA 4KN7X 4B09A 2RAEA 2ZNYA 5LLQA 4RB2C 1ACIA 5DM7F 4ZTJA 1WKMA 2CFOA 2EZHA 1YRNB 4WXDA 2Z1DA 2DA3A 4O6JA 2C6YA 2CSOA 5DCMA 3C2BA 3ABUA 1D1BA 2DFHA 2IPQX 3C1DA 5K7HA 3CMAI 4IVNA 4BE1A 2OV7A 1Z77A 4U0VA 3ISPA 4L9TA 4CICA 2IP2A 2PMZN 4HBLA 4M72A 3DTIA 4IHTA 4EM0B 4TV7A 2CV0A 4XLHA 4XLCA 4LLGF 1TQPA 4RGRA 1ETWA 4EEFG 1FOYA 4G7ZF 5BPDA 3HRTA 4BKXA 5J4YA 3DKXA 3EYIA 4D5FA 1KQ0A 3HOWJ 3V7RA 2IA1A 2BHYA 4RA2A 2BHZA 3I64A 3W3CA 3G73A 2DQRA 3HKZN 3SJMA 3GZ6A 4XKVA 2LBFA 3MZHA 1D0ZA 3B02A 3WTYC 4A69C 4OIQF 2L5QA 3W2VA 4DOZA 3HOSA 2LD5A 1DGRM 3F9KA 2K02A 2EIMH 1U3EM 3TOAA 2V7FA 2Y48A 3BJOA 4Z2YA 4FX4A 3OV8A 1GHCA 2XRLA 2DA5A 3L2UA 1RESA 5LGUA 3E6DA 3KIOA 1XB4A 2DMQA 3OYAA 1SANA 1MBJA 2BYVE 4BEHB 5K7ZA 2Z33A 3NAUA 5DUIA 4LB5A 1P7IA 3GTPJ 1FP2A 1V5EA 1HW5A 4M3BA 1ZGAA 3H36A 1X2NA 3L2VA 3GFIA 4N0BA 4XLEA 1XSXA 3U1DA 1KGSA 1RR8C 2FNPA 2N8GA 2JQ7A 5D6FA 2A6TA 1EH7A 4ZJZA 1XS9A 1IN5A 3OIOA 5ILSA 1F1ZA 2K9MA 1W7PD 4A93J 1IRXA 2DT7B 1U9OA 2GWRA 1SEUA 4L5IA 2QVOA 1WHUA 4FQGA 1PJRA 2X6OA 5F0HA 1R00A 3OYLA 2YR2A 2WBMA 4LG0B 2R7QA 4L0ZB 2EINH 2LLKA 3KCCA 2LKSA 1UMQA 3DXJF 3K4LA 3OY9A 3H5NA 1G3SA 4HX8A 1YS7A 1OMIA 1ZRFA 2PN6A 2HTSA 1N25A 4HSRA 3JRIA 4V19K 3TEDA 4L9JA 4A3GJ 1MGTA 1SD7A 1IO2A 1D5YA 2Y0SN 4A2UA 4AIHA 3P9KA 1QPIA 5D4SA 3WTUC 3BJ6A 4U7BA 2O03A 2L7MP 2VBWA 3U2RA 3L2QA 2F5FA 5L3BA 4IEJA 3KZIC 2DA1A 4HPQA 4N9IA 3T8TA 5F04A 4C9YA 3ABMH 1Y1VJ 3P9IA 4RAZA 1G59A 4EV0A 4BBRJ 2DTZA 1WH5A 1I50J 3RKWA 1WJAA 2X6WA 3VYTB 4OU0A 2LP0A 3VB2A 2LC2A 3COAC 1CQTA 2V6CA 1GVDA 3LSTA 3CCVI 4UV9A 1O7LA 1PUFA 4B48A 4UUVA 2X48A 4M6YA 2TRTA 2M7AA 3V7SA 4HV5A 1I1SA 3HSEA 2PBIA 2QGUA 3M07A 4EJOA 1D1CA 4L9NA 4GYGA 5LEJA 5M5YJ 1PUFB 1R5GA 3WTWC 4FX0A 1D8JA 2OQRA 3OYDA 2XC7A 4U0WA 3H0DA 3FKIJ 2KMUA 1E3HA 3HOYJ 1UCRA 2K4JA 1RUOA 2K3FA 1G2HA 2M7BA 1FC3A 3DU5A 1YFHA 3OSFA 2VXDA 3M4OJ 1O3RA 3AG3H 5D6EA 2JRTA 2Y0MA 4RM3A 3ERED 1DQUA 3E5QA 3PNVA 2V1NA 1JUPA 4M71A 4OOIA 2GLOA 1BOBA 2OJED 4CCJA 1EF4A 1WFXA 2V6EA 5EDNA 1YO5C 5EZHA 1AU7A 4WX9A 3ZPLA 1VZ0A 2V1DA 1GDTA 3DKWA 2BXZA 2BW3A 1VI0A 4DZPA 5D5XB 5CPRB 5FKKA 2VB6A 2KIFA 1ZH5A 3F21A 1N75A 2DA7A 4XRMA 2ZO4A 2QLZA 1W0UA 1JHFA 3VEPA 4PSXA 3L7WA 2YX4A 4M3GA 4I0AA 3TL4X 3BPVA 3ERMA 4PJNA 1GVJA 2BW3B 3HZJA 1D8KA 4AWXB 3OOUA 4ZDOA 2VKDA 3LMMA 3Q9SA 3GUDA 2H8WA 2ISYA 1JGSA 3CUQC 5F08A 2STWA 1YQAA 3WG7H 5M3FJ 3H9QA 4A6DA 2ZNZA 2AHQA 4I02A 1K61A 3H5AA 5HDNA 5L3CA 3MQ0A 1VQ7I 3IC7A 3HOUJ 2NS7A 4C2MJ 1HSTA 1XPXA 1IXCA 2F5CA 3ZQHA 1KU2A 1LFBA 2VQHA 2MD5A 1ZN2A 1HCRA 2Y69H 4G12A 1MDMA 5CVVA 1AOYA 3ZQQA 3IH4A 4ANJA 3I9V2 4Y52J 2MBFA 1BI1A 1ETQA 2DOAA 4C3HJ 3J80Z 3OYHA 3BTJA 1R49A 4XLAA 3NRVA 2MC4A 1Q1HA 4ZYHA 3BR5A 1FY7A 2W1OA 1FSEA 1KZHA 2AQFA 3JAMK 3JSPA 2BY1A 4W97A 5D5UB 1ZYRF 2VOPA 2OZ6A 1VFCA 2DN0A 3TO9A 3GCMA 1HC8A 2M4GA 3FMSA 2GQQA 2CV1A 3VODA 3RTRA 1JKRC 2GM4A 1OQYA 1FTTA 3K4MA 4IPAA 1QU3A 2XSJC 3FXKA 5LHHA 3A2KA 1Y56A 2NVTJ 1SD6A 1EH8A 3J7ZI 3ZMVA 2LY2A 1T33A 4AC0A 3K4CA 1OYWA 1SFEA 4GO1A 4WF2A 5HODA 1AHDP 2OD5A 2G7HA 5J3LA 1ONVA 1QPMA 2E1NA 1T38A 1EJ9A 1Z6RA 1FYLA 2GIVA 3LNQA 4QSHA 3S1RJ 2R7OA 4OIOF 2BY3A 1IAWA 5TJJA 3FM3A 1LB2A 2WWYA 3DU6A 2LSOA 3D5LA 1PP7U 2R7SA 1U5TA 2I8DA 5IPAA 1QHHD 2HXIA 1A36A 2WC2A 2AQEA 2IGOA 1RKTA 4XICA 4AVPA 4C3JJ 2KLOA 2LRDA 2KRHA 5FO5A 1U5TB 3J81K 3UNGC 3WHBA 1S5LC 2MFZA 4WXHA 4MFDA 5TRDA 1TTYA 4UB8C 1B72A 1B8IA 2DDAA 2FE3A 4HLYA 1HDPA 4BQQA 2HPIA 2QBYB 1F43A 1FMWA 1V5GA 2Q0OA 4IRGA 1Q1VA 2NS0A 2GAUA 1W4MA 2M1BA 2FEZA 4MQVA 4CZZA 4A3FJ 5ICCA 1B72B 3FM5A 1X3WB 3TP0A 5IY5H 3HUGA 1B8IB 3KEOA 2X85A 3K4KA 4A3KJ 4A3CJ 3WGHA 1LE8B 4BJ6C 2F4OB 2O8KA 2DOEA 1HKSA 2D5VA 5J8FA 3BR2A 3VSKA 2HVSA 3N97A 2BEOA 2YS9A 2K5CA 1JUSA 1W5CC 3IWFA 4KIGA 4BJTA 1IDYA 4CCLA 2Y31A 4IRHA 2EH3A 4BY1J 4CGZA 1S7AA 4B8XA 2LNBA 1S7EA 4BYYA 4E7IA 1ZRCA 1JKOC 2JN6A 3KP2A 3ZMUA 1ZK8A 1TZLA 4RLQA 4UHTA 3GZ5A 4RM2A 3RSNA 1G3TA 2KJBA 4S04A 2RQPA 2W82A 3HSRA 3FBIB 4IF4A 3OS2A 1X1CA 2Y30A 2E35A 2MH2A 4P96A 3OS1A 2R7UA 3EPZA 5J1RA 3RQ4A 1GV5A 4Q5SF 5KHDA 2WB1A 1TWGJ 2ZXJA 4G6QA 1Z1DA 2LKXA 3JRGA 2CMPA 2EZIA 2A05A 3QP6A 1FBQA 2OA4A 4RS8A 4ZDPA 4NNJA 3HIFA 3OYMA 4G9YA 1NTCA 2X4HA 3SFIA 2K9LA 4XORA 3A01B 3BZCA 3FK7A 3FWEA 3LA7A 4XQFA 4HF0A 1RPWA 3V42A 2FOKA 5L3EA 4CCNA 2CQXA 2DK5A 4BS9A 1BI2A 4ZC3A 1WQ2A 3AKZA 3CDLA 1P4XA 4LD5A 2P5LC 2IGKA 2ZFWA 5BMZA 4Y4RA 4XSZF 1H8AC 3ZQ7A 3H3VK 2KRFA 2X6YA 2W85A 1KU3A 1H0MA 3SDGA 1A35A 2IS6A 2FU4A 3W2AA 1DPUA 3CC7I 5D4RA 2ELJA 1U2WA 3H9JA 4KNYA 3FXQA 4LLNA 1DP7P 3F8CA 5EEHA 1X3ZB 2IGNA 1HOMA 4PGHA 2W57A 2ZFUA 1JUMA 4M9SA 1TNSA 3HOZJ 1MJ9A 1XG1A 2CQ7A 2Z16A 3JAMZ 3G4SI 1QZEA 1BL0A 1EV7A 1Z7LA 1HSJA 3IRQA 1IRGA 3Q0VA 1BOAA 1QVTA 2YX7A 1O3QA 4PJMA 3AAFA 2AS5F 1T56A 1X4PA 5JFRA 1M1EB 4L18B 1LKXA 1QZYA 1RC9A 1YW7A 3CTAA 1MNDA 5K5QA 1XGMA 1VF9A 4UXNA 4CCOA 2HEOA 4E7JA 1TWAJ 4CH7A 3L2RA 3CUQA 1NK3P 1WZ2A 2DPUA 1B6AA 2G9WA 4DIQA 1WGXA 1UELB 2G7UA 3Q3SA 4X1EA 1XGOA 5IYCJ 5FKMA 4PFPA 1K4TA 2EQRA 4B43A 2GXBA 3HXLA 4FHTA 3NQOA 1IJWC 2HU9A 2A3SA 1IV8A 5E3NA 4BE2A 4ZYDA 4KITB 2P0WA 3GMEA 1N77A 4HQMA 5LBQA 2A5YB 3QPTA 3Q0UA 5L3GA 1R4NB 1FJLA 1SFOJ 3O6BB 4HRIA 3CZ6A 1EA3A 3LAPA 3ZCOA 2DMPA 2W4SA 1IN4A 4J01A 2DMUA 2FF4A 2LFBA 5FD5A 4BU2A 3JRCA 2E5ZA 4M6XA 3TDZC 1W7PA 4YFXF 5ICGA 4N4NB 3G1LA 5H2FC 2DT5A 4XRSA 2PQ8A 4BHBA 4M9ZA 4Y7NJ 3BC8A 5F64A 3UR3C 3GTKJ 2LOOA 3IKVA 2E7XA 5D8LB 5JVTA 3KLNA 5F0FA 5FLVA 3KPHA 4M9XA 2Q2EB 4M3EA 4XONA 4EJWA 2HKXA 5JLXA 1W7PB 5JLWA 4F93B 4HSTA 4KIBA 2E1CA 1XTAA 1R9TJ 1CF7A 1TT0A 2EBIA 3Q5FA 5FRMA 3I5UA 3DEEA 2PFBA 4OWRB 3TO6A 1USSA 1S9HA 2XV4S 2A61A 2QM3A 3Q0WA 1XX5A 3FK6A 4HDUA 3CUOA 1OJLA 3I59B 2JJ7A 3CMYA 2W00A 2FQ4A 5JVGF 5E8IA 2JA2A 1WSUA 2QSHX 2VJJA 1ZELA 3K6GA 2IGMA 3E0JB 4WK8F 4AM3A 3NWSA 3BWGA 4G7HF 4HF1A 2QQ8A 5J1YA 2CUEA 3E1SA 2IBDA 2ZSIB 3K69A 3S17J 1P2FA
chains in the Genus database with same CATH topology
5GADJ 1S72I 2H8WA 2OTJI 3CD6I 1VQKI 4V19K 1VQ6I 3CMEI 4IOAF 1VQ7I 3G6EI 2ZJPF 1VQNI 1VQ8I 1ACIA 3CCMI 5DM7F 3G71I 4UY8I 1Y39A 3CCRI 1YJ9I 1QA6A 2E34A 3CJTB 3CMAI 1YITI 5GAHJ 3CC2I 1VQ5I 3CC4I 2ZJRF 1MMSA 3CCUI 1FOYA 3CCVI 1FOWA 3CCQI 2E35A 1HC8A 1YI2I 2FOWA 5DM6F 4IOCF 1YJNI 3CF5F 1YJWI 1YIJI 3CCJI 5GAGJ 2ZJQF 3J7ZI 3CCSI 5GAEJ 1VQOI 1VQPI 2K3FA 2QEXI 3PIPF 2OTLI 2NXNB 3I56I 3CCEI 2QA4I 1VQ4I 3CC7I 2E36A 1VQLI 2JQ7A 1VQMI 1FOXA 3CCLI 3I55I 3J7YJ 5JVGF 4IO9F 1VQ9I 3PIOF 3DLLF 1YHQI 3G4SI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD J;  1S72 I;  2H8W A;  2OTJ I;  3CD6 I;  1VQK I;  4V19 K;  1VQ6 I;  3CME I;  4IOA F;  1VQ7 I;  3G6E I;  2ZJP F;  1VQN I;  1VQ8 I;  1ACI A;  3CCM I;  5DM7 F;  3G71 I;  4UY8 I;  1Y39 A;  3CCR I;  1YJ9 I;  1QA6 A;  2E34 A;  3CJT B;  3CMA I;  1YIT I;  5GAH J;  3CC2 I;  1VQ5 I;  3CC4 I;  2ZJR F;  1MMS A;  3CCU I;  1FOY A;  3CCV I;  1FOW A;  3CCQ I;  2E35 A;  1HC8 A;  1YI2 I;  2FOW A;  5DM6 F;  4IOC F;  1YJN I;  3CF5 F;  1YJW I;  1YIJ I;  3CCJ I;  5GAG J;  2ZJQ F;  3J7Z I;  3CCS I;  5GAE J;  1VQO I;  1VQP I;  2K3F A;  2QEX I;  3PIP F;  2OTL I;  2NXN B;  3I56 I;  3CCE I;  2QA4 I;  1VQ4 I;  3CC7 I;  2E36 A;  1VQL I;  2JQ7 A;  1VQM I;  1FOX A;  3CCL I;  3I55 I;  3J7Y J;  5JVG F;  4IO9 F;  1VQ9 I;  3PIO F;  3DLL F;  1YHQ I;  3G4S I; 
#chains in the Genus database with same CATH topology
 3OWT A;  2KDZ A;  2K27 A;  3LFK A;  1BJZ A;  1TNT A;  4UV8 A;  2KKO A;  3REO A;  3GFJ A;  4L9V A;  4E70 A;  1EH6 A;  3VYS B;  2KFD A;  4QIW N;  2P4W A;  3G1O A;  3KX2 A;  2Q1Z B;  3AG1 H;  3MD2 A;  2HZT A;  2HGC A;  3IP4 B;  4ZYG A;  3G6E I;  5BOX A;  2FUG 2;  4JX4 A;  4LG3 A;  4FE4 A;  3GTL J;  4EMS A;  4LIV A;  5H20 A;  5K1Y A;  1I39 A;  2BZT A;  3WU0 A;  4XMY A;  1Y39 A;  3FXJ A;  2RC4 A;  3HHG A;  4XR6 A;  5JI6 A;  1T2K A;  1W0T A;  5HLI A;  1MBK A;  5D5W B;  1DU0 A;  3K1N A;  1KA8 A;  1YRN A;  2E2H J;  2ZXW H;  2CUF A;  2HZD A;  3BOQ A;  3P5J A;  3OYK A;  1ZRE A;  4Y13 A;  1JXS A;  4IX7 A;  2VAS A;  1H9G A;  3V4G A;  4XKC A;  1YW8 A;  3CCY A;  3OYN A;  4RB1 A;  3K1M A;  1REP C;  2AXT C;  5DD4 A;  1OKR A;  3NAR A;  4NDL A;  3TKY A;  1FZP B;  3OYG A;  5B1A H;  1J75 A;  3TW6 A;  3GFM A;  5DEQ A;  1LNW A;  3JRE A;  3FXU A;  1IDZ A;  1TWH J;  4C30 A;  4R79 A;  4XM3 A;  1U78 A;  5E79 C;  2CRG A;  1D5V A;  2ZJQ F;  2XRN A;  3WTV C;  4I7H A;  2EIJ H;  3QYE A;  2DMT A;  3VDX A;  3KP6 A;  1H9T A;  3AG2 H;  3GEZ A;  3L9F A;  4II3 A;  4W1U A;  4CCK A;  2CUJ A;  1MNM C;  3A02 A;  3PUF A;  3H9G A;  3CJR B;  3IAS 2;  4NC6 A;  2FBK A;  5DS9 A;  4NB5 A;  2HR3 A;  1A6I A;  2O0Y A;  4CYC B;  3WE2 A;  4IHS A;  3QOP A;  3RIR A;  2R7T A;  5C4J J;  4XLP F;  2HS5 A;  1XC5 A;  3HYI A;  5J47 A;  3RJP A;  2L7F P;  3E5X A;  2MC3 A;  3WTT C;  1SFX A;  2E1O A;  2VKV A;  4BEH A;  5M5X J;  1U5T C;  2E19 A;  4DW6 A;  2IW5 A;  4HDV A;  2MGQ A;  2VQL A;  1HA8 A;  2BVM A;  4MFE A;  1R58 A;  3HOT A;  2DW4 A;  4XLN F;  3J7A O;  2XGD A;  5KK1 A;  3A03 A;  3HG9 A;  3J80 K;  2EFP A;  1R36 A;  1K78 A;  2A69 F;  3LL7 A;  3RDI A;  1FYK A;  4FIS A;  1E3O C;  2K9N A;  3ZR8 X;  4IZZ A;  1ETV A;  2XB0 X;  5GAD J;  1K6O A;  3LQR A;  3ABT A;  3R4K A;  3ZQG A;  4ZZL A;  2K7L A;  1X1D A;  3S1M J;  1K78 B;  1W1W E;  1Z3X A;  4LG0 A;  4IOA F;  3R0J A;  2V9V A;  2L7Z A;  3N05 A;  2GXA A;  5D8K B;  3OS0 A;  5FFZ A;  2IJL A;  3ZMT A;  4YG2 F;  1BW5 A;  5EJC A;  2ADU A;  1XDU A;  4I99 C;  1LDK B;  5C44 J;  3IKT A;  3OSG A;  1QA6 A;  2F2E A;  4PSW A;  2P5V A;  1JI8 A;  2QF7 A;  5H6Q A;  2DA6 A;  5LEK A;  4E4H A;  3BTC A;  1W36 D;  4ABZ A;  4BBS J;  2J5P A;  4OAY A;  2GOX B;  4UUT A;  2QKL B;  4ENK A;  2JUC A;  2R7Z J;  2QWW A;  2WV1 A;  5IP9 J;  1ON1 A;  4YFK F;  2M8G X;  1BJA A;  2LMD A;  4Q47 A;  1FSH A;  1YE9 A;  2B9S A;  5KCM A;  5FD6 A;  1R71 A;  3RZD J;  3CMM A;  2EA4 A;  2I10 A;  3TBI A;  1D1A A;  3QPS A;  1YIJ I;  1K7A A;  5DDG A;  2M2E A;  1WJC A;  1Z67 A;  2F5D A;  5L3D A;  3VOE A;  1FPQ A;  2HVR A;  2ECC A;  2XAU A;  2F5V A;  5E17 F;  4D9J A;  1CGP A;  1FX7 A;  2OQG A;  4HA8 A;  2DK8 A;  4DJA A;  4LLL A;  2GA1 A;  3E6C C;  3V7C A;  4WXC A;  4F91 B;  1MSF C;  1MBE A;  2F48 A;  5ICF A;  2FBI A;  2AO9 A;  3UKG A;  2UXX A;  1FOK A;  3K70 C;  2KZV A;  3WU2 C;  2ELK A;  2TDX A;  3FBN B;  2E71 A;  1UB9 A;  2D1H A;  2RGV A;  3BT9 A;  3S14 J;  4NHJ A;  5EG0 B;  2P81 A;  1HKQ A;  3CLQ A;  2OU2 A;  3DP7 A;  2JSC A;  2IEK A;  2HDC A;  1ZR4 A;  3WTZ A;  4S05 A;  1SFU A;  1FTZ A;  1T98 A;  4BXU A;  1FOX A;  4DGW B;  5DD8 A;  4DBR A;  3BRO A;  1W5S A;  3KP7 A;  4DBQ A;  1XD7 A;  1T39 A;  4KIC A;  1XSD A;  1RR7 A;  3PIO F;  5DYM A;  1SC7 A;  2B63 J;  4PFO A;  2F4I A;  2MD0 A;  1C0W A;  1I5Z A;  2L9V A;  3M1E A;  2JTV A;  2EIK H;  3DTE A;  5ICE A;  4E7H A;  2VBX A;  1JE8 A;  2LDU A;  3FIW A;  4AUX A;  1TW3 A;  1HQC A;  3FMR A;  1IXS B;  4M6V A;  2QYO A;  3DQV C;  4HZF A;  4IKF A;  2D45 A;  4Y17 A;  2H6B A;  2L9N A;  3CF2 A;  2NRA C;  1SVM A;  2LTP A;  2JWT A;  4A3L J;  2XB5 A;  4Y33 A;  3SEQ A;  2BY2 A;  3R61 A;  1MD0 A;  2JZY A;  4XRF A;  5HS8 A;  5AIQ A;  3HL2 A;  3KFW X;  1LVA A;  1U8B A;  2Z3Y A;  3O8G A;  1G8X A;  1OCC H;  5ED4 A;  3G71 I;  2RRE A;  3GTO J;  2XAS A;  3KP4 A;  2PMZ A;  3RKQ A;  3S15 J;  1RI7 A;  2RNG A;  4MIM A;  3EUH A;  4UVB A;  2DT6 A;  5IT9 Z;  2MW8 A;  3PSF A;  4CXF A;  4AIK A;  2L9R A;  5CYV A;  4LMY A;  1OR7 A;  1X1B A;  1YIT I;  1O3T A;  2WB1 N;  2XGE A;  3IHU A;  3JRD A;  5IT3 A;  4RGU A;  2QEN A;  4YEJ A;  3HHH A;  3CCU I;  3HKZ A;  1LDD A;  3T0Y A;  2VXZ A;  2F6C A;  2LY1 A;  4GYI A;  1R23 A;  3DTK A;  3I53 A;  2RVC A;  3BDD A;  1ITY A;  2CU7 A;  2YUS A;  4Q4Z F;  4A3M J;  2H8R A;  3AFH A;  3OYJ A;  5GPA A;  3JR9 A;  3CF5 F;  5KVR A;  2PEX A;  4LIT A;  1AWC A;  3SDB A;  2O6G E;  9ANT A;  4N9H A;  2COB A;  3LFU A;  3S32 A;  3PM1 A;  3LWF A;  2ZJ2 A;  1NG7 A;  3FIS A;  3ROU A;  2WAQ N;  2X1C A;  4ENN A;  3PO2 J;  4XKB A;  3P9C A;  3BG9 A;  1QGP A;  2EZK A;  4L0Y B;  3LSI A;  3WGI A;  3KYD B;  4UVC A;  1ETX A;  2P6S A;  3ECO A;  3SQN A;  4V2F A;  2DO7 A;  2BOL A;  5J8C A;  3JRF A;  3KYC B;  4G6T B;  2JT1 A;  3MVP A;  4HAM A;  5E1Z B;  1U0J A;  3NWT A;  1WJB A;  3QPL A;  3BY6 A;  2E36 A;  4BE0 A;  3ZN1 A;  4KYW A;  4B3X A;  3ZQF A;  2DA4 A;  4A6E A;  3OL3 A;  1XSV A;  1BIA A;  1R22 A;  3ULQ B;  1JJ8 C;  4FET A;  3F23 A;  3DV8 A;  1FNN A;  3VPR A;  5EGO A;  2KL4 A;  3W6V A;  2CJJ A;  1V54 H;  2M34 A;  2PX9 A;  1TWC J;  3GZN B;  3HGY A;  1O7F A;  3OYE A;  3T8R A;  3HGG A;  1FIP A;  5JHF A;  4MO7 A;  4FTH A;  3IH3 A;  4D0P A;  5EGO B;  1E2X A;  5FLX Z;  1DP3 A;  3W6K B;  4AU7 A;  1ZGJ A;  2LR8 A;  2OPT A;  3LQQ A;  2P5K A;  2DOD A;  1VQK I;  5EYR A;  3CME I;  1MBF A;  3GTQ J;  4RAF A;  1Y8Q B;  5A2Q Z;  2M3A A;  2VPR A;  1SVO A;  3VWB A;  1TT5 B;  2QBY A;  3HC7 A;  4F3Q A;  1X19 A;  3BLY A;  1BR4 A;  1WPK A;  1T8I A;  1QQI A;  5ILU A;  3PFY A;  5F6F A;  4EQQ A;  1TWF J;  5HLT A;  1MKM A;  1ZKG A;  3S1Q J;  1RNL A;  1HDD C;  1WCM J;  2NYX A;  1A04 A;  3IH2 A;  3ASO H;  1LE8 A;  4PZJ A;  3L2W A;  4GCV A;  3SEZ A;  3ZMZ A;  3RYP A;  5GTI C;  3CC2 I;  1VTN C;  2OF7 A;  3HOX J;  1XMX A;  3KEQ A;  1NG6 A;  1E3P A;  2VT3 A;  2DFI A;  3ABK H;  3D5R C;  3CCQ I;  4ENM A;  4HF2 A;  2FOW A;  5J6X A;  3RI4 A;  2K86 A;  4BH9 A;  5DM6 F;  3WOD F;  3RPQ A;  4MHG A;  3WE3 A;  2VJ5 A;  4E7Z A;  1RET A;  4PJJ A;  3TW7 A;  2NVQ J;  2YPR A;  4MQ9 F;  2ZBK A;  1LEB A;  1UHS A;  4X0G A;  1BC8 C;  5GAE J;  1Z0X A;  1GV2 A;  3ZGK A;  3T5X A;  1J7K A;  2KIS A;  1X2M A;  2DMN A;  3BQZ A;  2KT0 A;  1PYV A;  1G3Y A;  3BR3 A;  3R60 A;  1ZRD A;  2OTL I;  2R92 J;  4GGG A;  2K4B A;  5FKN A;  4LJZ F;  3GW2 A;  4OAZ A;  1A5J A;  2NXN B;  1WVR A;  2DU9 A;  3A01 A;  1Y6I A;  4YRV A;  2EV6 A;  5LGN A;  1IN7 A;  1BN5 A;  5B5E C;  4XLF A;  2WTE A;  2K85 A;  4D5C A;  4QPO A;  1LFU P;  2XKO A;  3LSK A;  2J5O A;  1MIJ A;  2DFF A;  2ZXH A;  3S3N A;  3W2W A;  3HRU A;  3K4N A;  4B1R A;  2IA2 A;  3H5R A;  4NC8 A;  3B73 A;  2GZW A;  5E1W A;  3DCF A;  1ZG5 A;  3FDY A;  3DBR B;  4ZYA A;  2LG4 A;  5C3E J;  2FJ1 A;  2MH9 A;  1XCV A;  4E7K A;  4ESF A;  1X1A A;  2XVC A;  1P92 A;  5FGM A;  4N4O B;  4DYC A;  3TQN A;  1VQ9 I;  3N4M A;  1BW6 A;  3PL8 A;  2D2W A;  4EGZ A;  2PLY A;  1S8N A;  4XOP A;  2HQ5 A;  3FHN A;  4HW0 A;  1S72 I;  4ZZD A;  3QOD A;  1UZC A;  1F5T A;  3LA3 A;  3QPH A;  2HWV A;  1X3U A;  2ISZ A;  1DGW Y;  3OOP A;  1MNE A;  2H6C A;  1X58 A;  2P6T A;  3HPH A;  4DZJ A;  2IT0 A;  2IS2 A;  3PUB A;  3TOB A;  3MZY A;  3S93 A;  2NS8 A;  1F9N A;  2L4M A;  1V55 H;  3ECH A;  3O3K A;  2CV2 A;  1YW9 A;  5CQG A;  2FX0 A;  3SZT A;  2VON A;  3W6J B;  4I09 A;  2EFO A;  4UVA A;  5LHI A;  1I3A A;  2EWN A;  2QUF A;  4I0B A;  1WI3 A;  4ON0 A;  3KET A;  2KIU A;  1J0R A;  2JPB A;  4R8H A;  5GP9 A;  4A5M A;  4AD9 A;  2X0L A;  3FF5 A;  2E60 A;  2M30 A;  3HRM A;  2R7V A;  2OUM A;  5FRO A;  3LA2 A;  5M3M J;  3G1M A;  1FYM A;  2AXL A;  2CQK A;  2IAI A;  2JPC A;  2VT2 A;  1ORK A;  2CQN A;  4HOB A;  4G7O F;  2CS3 A;  1D0X A;  3S2W A;  2F4M B;  3ZRG A;  1MMD A;  4MTD A;  1A31 A;  1S29 A;  4I6Z A;  2VOO A;  3MFK A;  2NVU B;  2A07 F;  3F72 A;  4BNC A;  3DKY A;  4U88 A;  3JCU C;  2W24 A;  1YTY A;  2BE5 F;  1QHG A;  3BR1 A;  2OZU A;  2Y9Z A;  3BPX A;  1GXP A;  1MMA A;  4C3I J;  1E17 A;  4ESB A;  4HNU A;  1WWX A;  1QZZ A;  1YYV A;  3OIP A;  5EEG A;  1PP8 F;  1MH4 A;  1MMN A;  1SD5 A;  5HS7 A;  3RYR A;  1UAA A;  2Z5U A;  2XF6 A;  3K2Z A;  1VQ4 I;  5B66 C;  1K83 J;  4J00 A;  2ZME A;  1LEA A;  1P4A A;  2E7W A;  2XAF A;  2EZL A;  2HQN A;  4IL6 C;  4P1W A;  2R4G A;  4I76 A;  2XPW A;  4B4C A;  1IN6 A;  1WJE A;  4DYQ A;  2KHM A;  3AL0 B;  4KN4 X;  3BZ6 A;  5E20 A;  5HNH A;  1BI0 A;  3U1K A;  3JTG A;  2Q2E A;  3WTS C;  1V5F A;  1Z91 A;  2ZME B;  2H27 A;  2VPL A;  4MNU A;  3I4M J;  4XBF A;  2M0C A;  3I55 I;  4RGX A;  1XMA A;  1Z21 A;  4NQW B;  4D7N A;  3CJQ B;  2A6E F;  3GXO A;  4KT6 A;  2PJR B;  2L2O A;  3QU6 A;  4ITV A;  4GDF A;  4HNT A;  4P9U A;  1ZG1 A;  3DLL F;  3E3V A;  4JQF A;  2VBY A;  4AYB A;  4ZDL A;  2VL8 A;  2LKP A;  2Z2S B;  4HX4 A;  1S6L A;  4RBO A;  2LRE A;  2E2I J;  3I59 A;  3CDI A;  2V1X A;  1B9N A;  2KZG A;  2OTJ I;  4E6K G;  4CHU A;  2O61 A;  4U7D A;  2X1E A;  3JRA A;  3GWZ A;  1UJ8 A;  1P4W A;  1DU6 A;  1UFM A;  2Y75 A;  4IHX A;  2HNH A;  4YIR X;  2RDP A;  2HQA A;  3HSF A;  5FKO A;  5E18 F;  4II2 A;  1IGN A;  2R93 J;  5IOZ A;  1WJF A;  1HLV A;  3CQZ J;  4ZYE A;  4UY8 I;  1P7J A;  4PDK A;  1MZB A;  2WAE A;  3KE2 A;  2GA2 A;  3OL4 A;  4LOC A;  3BZK A;  2HKO A;  5FJ8 J;  3OYI A;  1G6N A;  3E6M A;  4HG2 A;  1SFK A;  1ZLK A;  1MH3 A;  2W84 A;  4LFU A;  2M8E A;  3T1B A;  3K0L A;  2JA5 J;  3EUH C;  1R5H A;  1QBJ A;  2MLG A;  4A3B J;  1MMS A;  3WU1 B;  2GOM A;  2FRH A;  2EJR A;  1YX5 A;  1WJD A;  3GLL A;  2CFX A;  1GUU A;  1OR7 C;  1DPR A;  1O3S A;  2H09 A;  3RKX A;  4PUS A;  1OIS A;  3BQY A;  3FXO A;  3EUK L;  2EPF A;  4MEX F;  1BBY A;  2WA0 A;  1JHH A;  5LRS A;  2FSW A;  1Y8R B;  2QSG X;  3M3Y J;  2VC1 A;  1WJ5 A;  3DEU A;  1Y1W J;  2VE8 A;  3I58 A;  1MJB A;  1V4R A;  4D1Q A;  2IRF G;  5C4X J;  3CCJ I;  4XRS G;  5GAG J;  1IXR C;  2VQG A;  1FT9 A;  1ETK A;  4IHW A;  5ERI A;  3D0S A;  3LAJ A;  1ZLJ A;  2X51 A;  4BL0 B;  4IJA A;  1SAU A;  3LSM A;  4MEY F;  3PIP F;  3RPU D;  5BS6 A;  2EFN A;  3ZQI A;  2RN7 A;  1OFC X;  5GTH C;  3CO6 C;  3F0C A;  1RUN A;  1L3L A;  2FMY A;  5IOY A;  3RKY A;  4EM1 A;  4WCG A;  2XAG A;  3NEU A;  2FNA A;  5IYB J;  2JA8 J;  2EA2 A;  2ESH A;  3X2Q H;  1D3Y A;  3V8L A;  3IAM 2;  2OCE A;  2HOS A;  1FLI A;  2BGC A;  5KNL A;  2XUB A;  3PFI A;  2CWE A;  5DUK A;  1GT0 C;  4CYC A;  3CCL I;  2ID3 A;  3BG5 A;  3LSR A;  2VQC A;  1L0O C;  2UV1 A;  5IT9 K;  2JA6 J;  1YG2 A;  2L0K A;  5FB2 A;  4ZTF A;  2IA0 A;  1QO0 D;  2BVL A;  1UG2 A;  1YHQ I;  2K9S A;  4ASN A;  3HOV J;  4NUB A;  1IC8 A;  2XPU A;  2V4J C;  3ZXS A;  3GTG J;  5J40 A;  5LGT A;  4BDY A;  1HXD A;  3LOC A;  2CYY A;  1T95 A;  4LK0 F;  3GO5 A;  3GX4 X;  4XKW A;  4LIU A;  3CD6 I;  3HTS B;  1VND A;  5DCM B;  6PAX A;  4L5J A;  2IS1 A;  4MGR A;  4J19 A;  2EFW A;  1MMG A;  4OMZ A;  4EM2 A;  2VLA A;  5E8G A;  4UB6 C;  1Z7U A;  2K3P A;  4EJV A;  1T0F A;  3MMY B;  1Z05 A;  5HDK A;  2XF7 A;  3ML6 A;  4YEL A;  4EAT A;  4B3A A;  2DDB A;  2H1K A;  3DLA A;  2HVQ A;  1ZHF A;  3ZN0 A;  4I01 A;  5K5R A;  2TCT A;  2VBZ A;  1HW1 A;  1ODD A;  2E34 A;  4YIF A;  3PNT A;  1HKT A;  2V9P A;  3CJT B;  1FEX A;  3F8N A;  1LVK A;  3DEW A;  1I27 A;  4M74 A;  2WY8 Q;  1TLH B;  1D0Y A;  1G3W A;  4JYK A;  2ELH A;  1IV6 A;  5F0C A;  2VUM J;  1X1P A;  2O7O A;  4EGY A;  3OYB A;  2LBF B;  4HLX A;  1RRJ A;  2VKH A;  2LF8 A;  4Q48 A;  2COM A;  2R5Y A;  4IQJ A;  3O2P E;  2UXN A;  4M3F A;  4PK4 A;  4LB6 B;  3S2D J;  2BY0 A;  1J2X A;  5DV5 A;  3EDP A;  2JK3 A;  2M45 A;  1KYW A;  2OC6 A;  3S1N J;  1NH3 A;  3VSL A;  2OAZ A;  2R5Y B;  3MWM A;  1F36 A;  1K79 A;  3KP3 A;  4XN3 A;  4U87 A;  3BTL A;  3Q9V A;  4IXA A;  2K40 A;  3CLO A;  1ON2 A;  2EV5 A;  1SVL A;  2ZC2 A;  3K9T A;  3BJA A;  2WV0 A;  2E1M B;  2DQL A;  1WI9 A;  2X1D A;  2KRC A;  1SMT A;  1B59 A;  2JVG A;  5FLX K;  4XK4 A;  5EF6 A;  5CKT A;  3ZOB A;  1TL8 A;  3U21 A;  3BG6 A;  5CQE A;  3GYH X;  1R1T A;  5CJ9 A;  1STZ A;  5B3S H;  2CW0 F;  3IV5 A;  1A6Q A;  3H1C A;  5LHG A;  2STT A;  5A2Q K;  5AIP A;  2FD5 A;  1F4K A;  1ZAO A;  5HLG A;  2ZSH B;  2ICW G;  2H1L A;  1AA7 A;  1GLN A;  2MAB A;  4QPQ A;  4AID A;  2ZKZ A;  1SAX A;  3R6S A;  2E5N A;  4I2O A;  5EG0 A;  4DNC A;  5IYD J;  2HPM A;  5E3M A;  2VKE A;  1W5T A;  4A3J J;  3EYY A;  3F8M A;  4AIJ A;  3JRH A;  1ETO A;  1WH7 A;  2K9Q A;  2VIX A;  3BCA A;  5CVJ A;  2MYS A;  4F92 B;  2VOD A;  2O8X A;  3K1P A;  2LH9 A;  2UUZ A;  3IRR A;  4BUP A;  3FMQ A;  2Q8K A;  2ZB9 A;  2XDV A;  4FE7 A;  4R1H A;  2L4A A;  1VQN I;  3C2H A;  1TQI A;  2W25 A;  3A0H C;  3DPL C;  3E7L A;  4BHP A;  4P5O A;  5CVI A;  1I6X A;  3EUA A;  2HOE A;  3TP3 A;  4BAY A;  1XGS A;  4BHC A;  4A12 A;  3DPU A;  1LFP A;  2HDD A;  3TO7 A;  2R7X A;  1VQ5 I;  3F6V A;  2XHK A;  1XGN A;  4RMN A;  1YOV B;  1IZ1 A;  2L01 A;  2PI0 A;  2NAZ A;  3MKZ A;  2QQ9 A;  1JGG A;  3L2C A;  1ZQ3 P;  3K10 A;  5CVR A;  2L02 A;  1R6R A;  4K2E A;  3SFZ A;  4PJ0 C;  4XN0 A;  2PMH A;  3I4P A;  4Y3O A;  4HV6 A;  3I54 A;  2GXG A;  1JJ6 C;  1APL C;  3J7A Y;  2L9S A;  2M9H A;  4S0H B;  2DFE A;  1IUF A;  4KIS A;  1LJ9 A;  4JK1 X;  4PCQ A;  3DF8 A;  1ZR2 A;  2HTJ A;  3HRS A;  2X6X A;  5HDG A;  3JRB A;  4BXX J;  1YJW I;  5DCF A;  3F6O A;  3KLO A;  4V2G A;  2M5W A;  5HVQ C;  3GF2 A;  2B0L A;  3WHC A;  3CCS I;  1VQP I;  2V26 A;  3FX3 A;  1R5I D;  4JBA A;  4G94 A;  4KIF A;  1IUY A;  3H35 A;  4CA0 A;  2QEX I;  3DWL E;  2W48 A;  3QU3 A;  5F27 A;  4F55 A;  1IRF A;  3I71 A;  2F5E A;  4E7S A;  3RQI A;  1BI3 A;  4EJU A;  1HBX G;  4KT5 C;  3VYR B;  2FQ3 A;  2QA4 I;  3I56 I;  3QOE A;  3IWZ A;  4HEA 2;  3BG3 A;  3F8B A;  4XNF A;  3F8F A;  4NC7 A;  1LQ1 A;  3BR6 A;  4B44 A;  3AL0 C;  2YU9 J;  2XF5 A;  1WRJ A;  3FKJ A;  2ME0 A;  5JHU A;  2IXS A;  1NHA A;  2DOF A;  4DYR A;  2YSR A;  2VJ4 A;  1KU7 A;  2ZME C;  1YS6 A;  5BQT A;  2DPD A;  3RCO A;  3K7A J;  2R7R A;  3BR0 A;  1B1B A;  5J1U A;  4FAS D;  4H4K C;  1FWZ A;  2EFQ A;  1S3J A;  2OBP A;  3EET A;  4YFN F;  1OPC A;  2FML A;  1XN7 A;  2DJN A;  4KFC A;  4ETS A;  2KP6 A;  1YLF A;  4BGD A;  2LVS A;  1KQ8 A;  2MSY A;  4M3D A;  5JR3 A;  2DYS H;  1MBG A;  3PNY A;  1KYZ A;  2R5Z A;  4MLO A;  1OCZ H;  2W7N A;  1IG7 A;  2QSF X;  2GBY A;  2M87 A;  3A0B C;  3CES A;  4A0Y A;  3MKW B;  1ULY A;  3ONQ A;  1MJA A;  1V3F A;  4BDZ A;  4A3E J;  5H6R A;  3ZP5 A;  2R5Z B;  1W36 C;  2JVH A;  1AKH A;  2Z9O A;  1MDM B;  2NNN A;  2O3F A;  3M1C A;  5CVU A;  1JKP C;  2ZJP F;  2R7D A;  4OIP F;  1Y0N A;  3ASN H;  3MEX A;  3RZO J;  5ILV A;  4CZC A;  5K7F A;  1RIO H;  2DTR A;  3KEY A;  5BNG A;  1AKH B;  1SMY F;  3H3U A;  5IP6 A;  3JW4 A;  4A5N A;  1OCO H;  3E97 A;  1R7J A;  2Y0S A;  2ETH A;  1MBH A;  2DAO A;  4RAY A;  2BV6 A;  2QQA A;  1B9M A;  2NNY A;  1PVE A;  2CW7 A;  1BC7 C;  2M0M A;  2RNJ A;  2Z99 A;  2UWM A;  1Z9C A;  4JP0 A;  5AON A;  4KA4 A;  1FOW A;  2KDO A;  4MTE A;  2ID6 A;  1LUJ B;  1YI2 I;  1I6H J;  4P9F A;  4A0Z A;  4KDP A;  3U9G A;  5FFX A;  5LFA A;  2NVY J;  3ELK A;  3C2G A;  4C2T A;  4G8X A;  3FXM A;  3HTU A;  1JTY A;  1S7O A;  3DBH B;  2XIG A;  5HLH A;  1JT0 A;  1TC3 C;  1FIA A;  2DYR H;  1I3Q J;  3ABL H;  3QAH A;  4DQ2 A;  2HQR A;  2ACJ A;  3HDD A;  3S16 J;  3I4N J;  4RAG A;  3TDU C;  2ESN A;  4CUG A;  3KZZ A;  1UHW A;  2FA5 A;  1O4X A;  1ETY A;  1ERD A;  1ZG3 A;  4Z6Y A;  2L7K A;  2CG4 A;  4L5E A;  2EK5 A;  2LY9 A;  2IS4 A;  5TGT A;  1PDN C;  3WTX C;  4C2U A;  3G2B A;  3F22 A;  3V8K A;  2P8T A;  2E2J J;  3M8F A;  3D1N I;  2VI6 A;  2RV8 A;  1N78 A;  3H92 A;  3F3X A;  2MG4 A;  3I3L A;  4CYD A;  2BBY A;  3QRF F;  3QWL A;  1TQM A;  1ZTR A;  1POG A;  2A68 F;  1TW2 A;  2EV0 A;  3P7N A;  3A1Y A;  3IUO A;  3ESW B;  3LSJ A;  4AYB N;  4GRI A;  1MW7 A;  2Y9Y A;  1UST A;  5TIS C;  4FCY A;  1VQM I;  2O9L A;  4BJ5 C;  4CSW A;  2DBB A;  1RZ4 A;  4D7M A;  4EJT A;  4HX7 A;  5D5V B;  4BY7 J;  2YU3 A;  2XAJ A;  4IO9 F;  1ZGW A;  3K4J A;  5J4V A;  4O5V A;  2XGX A;  3S3M A;  3V8J A;  4AVZ A;  3TGN A;  5K5O A;  4O3M A;  2ZXI A;  3HUG B;  4YII A;  4P55 A;  2HFH A;  1BIB A;  5KAF C;  2BXY A;  2HYJ A;  2EIL H;  3GTM J;  2GIZ A;  4JX5 A;  4EVI A;  2CUZ A;  3S3O A;  5E3O A;  1J09 A;  3PSI A;  4BQO A;  1R1V A;  2ME6 A;  5LD2 C;  3E5U A;  1FBU A;  2NOJ B;  5B1B H;  2IVM A;  1VQ8 I;  1XMK A;  4CDG A;  3CCM I;  1FP1 D;  4OIN F;  1JKQ C;  3FHZ A;  3QQA A;  3C18 A;  4XSX F;  1QRY A;  3D5S C;  1IW7 F;  4IRI A;  3GFL A;  1YJ9 I;  3PQJ A;  1T0F C;  2KJC A;  1FMV A;  1OYY A;  2JUG A;  2XAQ A;  5E1X A;  4A3D J;  2HYG D;  3LSH A;  1PUE E;  2OCC H;  4KUM A;  1H89 C;  3CC4 I;  2HOA A;  3B6A A;  2ZJR F;  3ZQL A;  3RPU A;  4UUS A;  2O5R A;  4CCM A;  4A3I J;  2ZCW A;  3VYU B;  1HF0 A;  1ZAR A;  2M4K A;  3SHF A;  2RKH A;  1P6R A;  2WY7 Q;  1B4A A;  3SXY A;  3OR2 C;  4IOC F;  2VJI A;  2CH0 A;  3SZG A;  2JA7 J;  2HDW A;  2WAQ A;  2DCE A;  4HYE A;  3JSO A;  1IF1 A;  4IHY A;  3S2H J;  2DLL A;  3K4B A;  3HEF A;  5KAI C;  4UUS B;  2XGC A;  2KIM A;  4ESJ A;  2G0E A;  4BQA A;  4KMF A;  2HYF A;  2I5U A;  3C7J A;  3VFZ A;  3PJR A;  1EKE A;  2V9K A;  4F52 A;  1H88 C;  4G6D A;  2HXO A;  2E1M C;  4LK1 F;  3MCZ A;  3L1P A;  3DBL B;  1Z3Y A;  2DXI A;  2XRO A;  2A6H F;  1U6G A;  5CLS A;  3CCE I;  4E7L A;  3ZMS A;  2V79 A;  1MSE C;  1XDS A;  1E0E A;  3MN2 A;  2JSP A;  5HS9 A;  2KPM A;  3HM5 A;  3HB9 A;  3G3Z A;  3PQK A;  3CO7 C;  2KQR A;  4RB3 C;  5L3F A;  2DJI A;  2UZK A;  1QNT A;  3HPG A;  2P7V B;  3KZY A;  3HBL A;  3OMY A;  4CO8 A;  3GLX A;  3GBG A;  1O57 A;  2R7W A;  3B6C A;  1X4O A;  2WAF A;  3OYC A;  5F1J A;  4F7Z A;  2PG4 A;  2X9D A;  2A5W A;  4UNO A;  1KON A;  4LGW A;  1OLT A;  2PMU A;  1DDN A;  5BPI A;  1JTX A;  2KIQ A;  1U9N A;  3QYB A;  5FLM J;  4OIR F;  1OYI A;  1R4M B;  1FBS A;  4NQW A;  2VN2 A;  5LRR A;  4BXF A;  2JRM A;  1OCP A;  3FXR A;  3ZMD A;  1K4S A;  2PJR A;  2ECB A;  3OR1 C;  3CUQ B;  1BM9 A;  2R7F A;  3M8E A;  3GTJ J;  1TP4 A;  2CGP A;  2WAD A;  3KYL A;  3QP5 A;  4FT8 A;  1K6Y A;  4KMU X;  2XSD C;  3IL2 A;  2R3S A;  4GFB A;  5GPC A;  3AG4 H;  3WG9 A;  3GVA A;  4BQN A;  3M7G A;  4X6A J;  3M8J A;  3BG7 A;  1XCB A;  2B7E A;  3PO3 J;  1SD4 A;  3QYF A;  2EB7 A;  1UHM A;  3C3W A;  4H0E A;  3DFG A;  3OIQ A;  3OYF A;  1HW2 A;  3LSP A;  3J81 Z;  3CCR I;  3MZ8 A;  3FZV A;  2V1U A;  4QTR A;  3BP8 A;  1YIO A;  4NBQ A;  2HOT A;  1R1U A;  2FXA A;  3HJE A;  3H3Z A;  3S8P A;  5FRN A;  1RKW A;  1BR1 A;  1Y0U A;  5GAH J;  3CDH A;  2CQQ A;  1J59 A;  2P7C B;  3H0G J;  4QLC U;  2Y2Z A;  4IHV A;  5E3L A;  3M9A A;  2XKP A;  3MKY B;  3FXL A;  3CP8 A;  2MA3 A;  1G4D A;  1YJN I;  1Z6T A;  2FBH A;  3BCB A;  4JX6 A;  1TBX A;  2HI3 A;  4JOM A;  4WWC A;  1IN8 A;  2LYC A;  1JT6 A;  1J5Y A;  2L54 A;  4QWQ A;  3L00 A;  1I1G A;  3WGG A;  2PJP A;  5EZG A;  5FKL A;  1OCT C;  4RGS A;  1VQO I;  3E6B A;  1U8R A;  4A0X A;  4RB0 A;  1T08 B;  2MLK A;  3MKL A;  1T6S A;  2VC0 A;  3R0A A;  1CF7 B;  1BR2 A;  3O8H A;  1GXQ A;  2NOG A;  3ZQC A;  4XID A;  2D1V A;  2QKM B;  2QQB A;  5HOO A;  4GXO A;  4ZH4 F;  4ENJ A;  3TMO A;  4OMY A;  2JMW A;  1QVU A;  2L3D A;  2LK2 A;  4IQ4 A;  2QCO A;  5M5W J;  2NVX J;  1VQL I;  3LSG A;  1NK2 P;  4I98 B;  5EEA A;  2H94 A;  3EQL F;  3SYT A;  5F1R A;  1P9Q C;  2DI3 A;  3A4C A;  3JTH A;  1DUX C;  3DPT A;  2CO5 A;  3J7Y J;  1KQ9 A;  1UG0 A;  4BAC A;  2RQQ A;  4M73 A;  1OCR H;  3K70 D;  3BTI A;  1KU9 A;  4KJZ A;  2VE9 A;  3K2A A;  2LF7 A;  4HQE A;  4RDU A;  2XAH A;  4XOT A;  4RLF A;  2XPV A;  3CP2 A;  1BA5 A;  4HNV A;  1ENH A;  1LPQ A;  4B47 A;  5HNF A;  3MAJ A;  3KP5 A;  4PJL A;  1LDJ A;  1IRZ A;  1YX3 A;  3CJN A;  4Y15 A;  1J9I A;  5IP7 J;  2QZ8 A;  4U0Y A;  2DA2 A;  3I0T A;  3SZP A;  1VQ6 I;  4XL9 A;  5DTD A;  3L09 A;  2R0Q C;  2CW8 A;  4PGG A;  4KN7 X;  4B09 A;  2RAE A;  2ZNY A;  5LLQ A;  4RB2 C;  1ACI A;  5DM7 F;  4ZTJ A;  1WKM A;  2CFO A;  2EZH A;  1YRN B;  4WXD A;  2Z1D A;  2DA3 A;  4O6J A;  2C6Y A;  2CSO A;  5DCM A;  3C2B A;  3ABU A;  1D1B A;  2DFH A;  2IPQ X;  3C1D A;  5K7H A;  3CMA I;  4IVN A;  4BE1 A;  2OV7 A;  1Z77 A;  4U0V A;  3ISP A;  4L9T A;  4CIC A;  2IP2 A;  2PMZ N;  4HBL A;  4M72 A;  3DTI A;  4IHT A;  4EM0 B;  4TV7 A;  2CV0 A;  4XLH A;  4XLC A;  4LLG F;  1TQP A;  4RGR A;  1ETW A;  4EEF G;  1FOY A;  4G7Z F;  5BPD A;  3HRT A;  4BKX A;  5J4Y A;  3DKX A;  3EYI A;  4D5F A;  1KQ0 A;  3HOW J;  3V7R A;  2IA1 A;  2BHY A;  4RA2 A;  2BHZ A;  3I64 A;  3W3C A;  3G73 A;  2DQR A;  3HKZ N;  3SJM A;  3GZ6 A;  4XKV A;  2LBF A;  3MZH A;  1D0Z A;  3B02 A;  3WTY C;  4A69 C;  4OIQ F;  2L5Q A;  3W2V A;  4DOZ A;  3HOS A;  2LD5 A;  1DGR M;  3F9K A;  2K02 A;  2EIM H;  1U3E M;  3TOA A;  2V7F A;  2Y48 A;  3BJO A;  4Z2Y A;  4FX4 A;  3OV8 A;  1GHC A;  2XRL A;  2DA5 A;  3L2U A;  1RES A;  5LGU A;  3E6D A;  3KIO A;  1XB4 A;  2DMQ A;  3OYA A;  1SAN A;  1MBJ A;  2BYV E;  4BEH B;  5K7Z A;  2Z33 A;  3NAU A;  5DUI A;  4LB5 A;  1P7I A;  3GTP J;  1FP2 A;  1V5E A;  1HW5 A;  4M3B A;  1ZGA A;  3H36 A;  1X2N A;  3L2V A;  3GFI A;  4N0B A;  4XLE A;  1XSX A;  3U1D A;  1KGS A;  1RR8 C;  2FNP A;  2N8G A;  2JQ7 A;  5D6F A;  2A6T A;  1EH7 A;  4ZJZ A;  1XS9 A;  1IN5 A;  3OIO A;  5ILS A;  1F1Z A;  2K9M A;  1W7P D;  4A93 J;  1IRX A;  2DT7 B;  1U9O A;  2GWR A;  1SEU A;  4L5I A;  2QVO A;  1WHU A;  4FQG A;  1PJR A;  2X6O A;  5F0H A;  1R00 A;  3OYL A;  2YR2 A;  2WBM A;  4LG0 B;  2R7Q A;  4L0Z B;  2EIN H;  2LLK A;  3KCC A;  2LKS A;  1UMQ A;  3DXJ F;  3K4L A;  3OY9 A;  3H5N A;  1G3S A;  4HX8 A;  1YS7 A;  1OMI A;  1ZRF A;  2PN6 A;  2HTS A;  1N25 A;  4HSR A;  3JRI A;  4V19 K;  3TED A;  4L9J A;  4A3G J;  1MGT A;  1SD7 A;  1IO2 A;  1D5Y A;  2Y0S N;  4A2U A;  4AIH A;  3P9K A;  1QPI A;  5D4S A;  3WTU C;  3BJ6 A;  4U7B A;  2O03 A;  2L7M P;  2VBW A;  3U2R A;  3L2Q A;  2F5F A;  5L3B A;  4IEJ A;  3KZI C;  2DA1 A;  4HPQ A;  4N9I A;  3T8T A;  5F04 A;  4C9Y A;  3ABM H;  1Y1V J;  3P9I A;  4RAZ A;  1G59 A;  4EV0 A;  4BBR J;  2DTZ A;  1WH5 A;  1I50 J;  3RKW A;  1WJA A;  2X6W A;  3VYT B;  4OU0 A;  2LP0 A;  3VB2 A;  2LC2 A;  3COA C;  1CQT A;  2V6C A;  1GVD A;  3LST A;  3CCV I;  4UV9 A;  1O7L A;  1PUF A;  4B48 A;  4UUV A;  2X48 A;  4M6Y A;  2TRT A;  2M7A A;  3V7S A;  4HV5 A;  1I1S A;  3HSE A;  2PBI A;  2QGU A;  3M07 A;  4EJO A;  1D1C A;  4L9N A;  4GYG A;  5LEJ A;  5M5Y J;  1PUF B;  1R5G A;  3WTW C;  4FX0 A;  1D8J A;  2OQR A;  3OYD A;  2XC7 A;  4U0W A;  3H0D A;  3FKI J;  2KMU A;  1E3H A;  3HOY J;  1UCR A;  2K4J A;  1RUO A;  2K3F A;  1G2H A;  2M7B A;  1FC3 A;  3DU5 A;  1YFH A;  3OSF A;  2VXD A;  3M4O J;  1O3R A;  3AG3 H;  5D6E A;  2JRT A;  2Y0M A;  4RM3 A;  3ERE D;  1DQU A;  3E5Q A;  3PNV A;  2V1N A;  1JUP A;  4M71 A;  4OOI A;  2GLO A;  1BOB A;  2OJE D;  4CCJ A;  1EF4 A;  1WFX A;  2V6E A;  5EDN A;  1YO5 C;  5EZH A;  1AU7 A;  4WX9 A;  3ZPL A;  1VZ0 A;  2V1D A;  1GDT A;  3DKW A;  2BXZ A;  2BW3 A;  1VI0 A;  4DZP A;  5D5X B;  5CPR B;  5FKK A;  2VB6 A;  2KIF A;  1ZH5 A;  3F21 A;  1N75 A;  2DA7 A;  4XRM A;  2ZO4 A;  2QLZ A;  1W0U A;  1JHF A;  3VEP A;  4PSX A;  3L7W A;  2YX4 A;  4M3G A;  4I0A A;  3TL4 X;  3BPV A;  3ERM A;  4PJN A;  1GVJ A;  2BW3 B;  3HZJ A;  1D8K A;  4AWX B;  3OOU A;  4ZDO A;  2VKD A;  3LMM A;  3Q9S A;  3GUD A;  2H8W A;  2ISY A;  1JGS A;  3CUQ C;  5F08 A;  2STW A;  1YQA A;  3WG7 H;  5M3F J;  3H9Q A;  4A6D A;  2ZNZ A;  2AHQ A;  4I02 A;  1K61 A;  3H5A A;  5HDN A;  5L3C A;  3MQ0 A;  1VQ7 I;  3IC7 A;  3HOU J;  2NS7 A;  4C2M J;  1HST A;  1XPX A;  1IXC A;  2F5C A;  3ZQH A;  1KU2 A;  1LFB A;  2VQH A;  2MD5 A;  1ZN2 A;  1HCR A;  2Y69 H;  4G12 A;  1MDM A;  5CVV A;  1AOY A;  3ZQQ A;  3IH4 A;  4ANJ A;  3I9V 2;  4Y52 J;  2MBF A;  1BI1 A;  1ETQ A;  2DOA A;  4C3H J;  3J80 Z;  3OYH A;  3BTJ A;  1R49 A;  4XLA A;  3NRV A;  2MC4 A;  1Q1H A;  4ZYH A;  3BR5 A;  1FY7 A;  2W1O A;  1FSE A;  1KZH A;  2AQF A;  3JAM K;  3JSP A;  2BY1 A;  4W97 A;  5D5U B;  1ZYR F;  2VOP A;  2OZ6 A;  1VFC A;  2DN0 A;  3TO9 A;  3GCM A;  1HC8 A;  2M4G A;  3FMS A;  2GQQ A;  2CV1 A;  3VOD A;  3RTR A;  1JKR C;  2GM4 A;  1OQY A;  1FTT A;  3K4M A;  4IPA A;  1QU3 A;  2XSJ C;  3FXK A;  5LHH A;  3A2K A;  1Y56 A;  2NVT J;  1SD6 A;  1EH8 A;  3J7Z I;  3ZMV A;  2LY2 A;  1T33 A;  4AC0 A;  3K4C A;  1OYW A;  1SFE A;  4GO1 A;  4WF2 A;  5HOD A;  1AHD P;  2OD5 A;  2G7H A;  5J3L A;  1ONV A;  1QPM A;  2E1N A;  1T38 A;  1EJ9 A;  1Z6R A;  1FYL A;  2GIV A;  3LNQ A;  4QSH A;  3S1R J;  2R7O A;  4OIO F;  2BY3 A;  1IAW A;  5TJJ A;  3FM3 A;  1LB2 A;  2WWY A;  3DU6 A;  2LSO A;  3D5L A;  1PP7 U;  2R7S A;  1U5T A;  2I8D A;  5IPA A;  1QHH D;  2HXI A;  1A36 A;  2WC2 A;  2AQE A;  2IGO A;  1RKT A;  4XIC A;  4AVP A;  4C3J J;  2KLO A;  2LRD A;  2KRH A;  5FO5 A;  1U5T B;  3J81 K;  3UNG C;  3WHB A;  1S5L C;  2MFZ A;  4WXH A;  4MFD A;  5TRD A;  1TTY A;  4UB8 C;  1B72 A;  1B8I A;  2DDA A;  2FE3 A;  4HLY A;  1HDP A;  4BQQ A;  2HPI A;  2QBY B;  1F43 A;  1FMW A;  1V5G A;  2Q0O A;  4IRG A;  1Q1V A;  2NS0 A;  2GAU A;  1W4M A;  2M1B A;  2FEZ A;  4MQV A;  4CZZ A;  4A3F J;  5ICC A;  1B72 B;  3FM5 A;  1X3W B;  3TP0 A;  5IY5 H;  3HUG A;  1B8I B;  3KEO A;  2X85 A;  3K4K A;  4A3K J;  4A3C J;  3WGH A;  1LE8 B;  4BJ6 C;  2F4O B;  2O8K A;  2DOE A;  1HKS A;  2D5V A;  5J8F A;  3BR2 A;  3VSK A;  2HVS A;  3N97 A;  2BEO A;  2YS9 A;  2K5C A;  1JUS A;  1W5C C;  3IWF A;  4KIG A;  4BJT A;  1IDY A;  4CCL A;  2Y31 A;  4IRH A;  2EH3 A;  4BY1 J;  4CGZ A;  1S7A A;  4B8X A;  2LNB A;  1S7E A;  4BYY A;  4E7I A;  1ZRC A;  1JKO C;  2JN6 A;  3KP2 A;  3ZMU A;  1ZK8 A;  1TZL A;  4RLQ A;  4UHT A;  3GZ5 A;  4RM2 A;  3RSN A;  1G3T A;  2KJB A;  4S04 A;  2RQP A;  2W82 A;  3HSR A;  3FBI B;  4IF4 A;  3OS2 A;  1X1C A;  2Y30 A;  2E35 A;  2MH2 A;  4P96 A;  3OS1 A;  2R7U A;  3EPZ A;  5J1R A;  3RQ4 A;  1GV5 A;  4Q5S F;  5KHD A;  2WB1 A;  1TWG J;  2ZXJ A;  4G6Q A;  1Z1D A;  2LKX A;  3JRG A;  2CMP A;  2EZI A;  2A05 A;  3QP6 A;  1FBQ A;  2OA4 A;  4RS8 A;  4ZDP A;  4NNJ A;  3HIF A;  3OYM A;  4G9Y A;  1NTC A;  2X4H A;  3SFI A;  2K9L A;  4XOR A;  3A01 B;  3BZC A;  3FK7 A;  3FWE A;  3LA7 A;  4XQF A;  4HF0 A;  1RPW A;  3V42 A;  2FOK A;  5L3E A;  4CCN A;  2CQX A;  2DK5 A;  4BS9 A;  1BI2 A;  4ZC3 A;  1WQ2 A;  3AKZ A;  3CDL A;  1P4X A;  4LD5 A;  2P5L C;  2IGK A;  2ZFW A;  5BMZ A;  4Y4R A;  4XSZ F;  1H8A C;  3ZQ7 A;  3H3V K;  2KRF A;  2X6Y A;  2W85 A;  1KU3 A;  1H0M A;  3SDG A;  1A35 A;  2IS6 A;  2FU4 A;  3W2A A;  1DPU A;  3CC7 I;  5D4R A;  2ELJ A;  1U2W A;  3H9J A;  4KNY A;  3FXQ A;  4LLN A;  1DP7 P;  3F8C A;  5EEH A;  1X3Z B;  2IGN A;  1HOM A;  4PGH A;  2W57 A;  2ZFU A;  1JUM A;  4M9S A;  1TNS A;  3HOZ J;  1MJ9 A;  1XG1 A;  2CQ7 A;  2Z16 A;  3JAM Z;  3G4S I;  1QZE A;  1BL0 A;  1EV7 A;  1Z7L A;  1HSJ A;  3IRQ A;  1IRG A;  3Q0V A;  1BOA A;  1QVT A;  2YX7 A;  1O3Q A;  4PJM A;  3AAF A;  2AS5 F;  1T56 A;  1X4P A;  5JFR A;  1M1E B;  4L18 B;  1LKX A;  1QZY A;  1RC9 A;  1YW7 A;  3CTA A;  1MND A;  5K5Q A;  1XGM A;  1VF9 A;  4UXN A;  4CCO A;  2HEO A;  4E7J A;  1TWA J;  4CH7 A;  3L2R A;  3CUQ A;  1NK3 P;  1WZ2 A;  2DPU A;  1B6A A;  2G9W A;  4DIQ A;  1WGX A;  1UEL B;  2G7U A;  3Q3S A;  4X1E A;  1XGO A;  5IYC J;  5FKM A;  4PFP A;  1K4T A;  2EQR A;  4B43 A;  2GXB A;  3HXL A;  4FHT A;  3NQO A;  1IJW C;  2HU9 A;  2A3S A;  1IV8 A;  5E3N A;  4BE2 A;  4ZYD A;  4KIT B;  2P0W A;  3GME A;  1N77 A;  4HQM A;  5LBQ A;  2A5Y B;  3QPT A;  3Q0U A;  5L3G A;  1R4N B;  1FJL A;  1SFO J;  3O6B B;  4HRI A;  3CZ6 A;  1EA3 A;  3LAP A;  3ZCO A;  2DMP A;  2W4S A;  1IN4 A;  4J01 A;  2DMU A;  2FF4 A;  2LFB A;  5FD5 A;  4BU2 A;  3JRC A;  2E5Z A;  4M6X A;  3TDZ C;  1W7P A;  4YFX F;  5ICG A;  4N4N B;  3G1L A;  5H2F C;  2DT5 A;  4XRS A;  2PQ8 A;  4BHB A;  4M9Z A;  4Y7N J;  3BC8 A;  5F64 A;  3UR3 C;  3GTK J;  2LOO A;  3IKV A;  2E7X A;  5D8L B;  5JVT A;  3KLN A;  5F0F A;  5FLV A;  3KPH A;  4M9X A;  2Q2E B;  4M3E A;  4XON A;  4EJW A;  2HKX A;  5JLX A;  1W7P B;  5JLW A;  4F93 B;  4HST A;  4KIB A;  2E1C A;  1XTA A;  1R9T J;  1CF7 A;  1TT0 A;  2EBI A;  3Q5F A;  5FRM A;  3I5U A;  3DEE A;  2PFB A;  4OWR B;  3TO6 A;  1USS A;  1S9H A;  2XV4 S;  2A61 A;  2QM3 A;  3Q0W A;  1XX5 A;  3FK6 A;  4HDU A;  3CUO A;  1OJL A;  3I59 B;  2JJ7 A;  3CMY A;  2W00 A;  2FQ4 A;  5JVG F;  5E8I A;  2JA2 A;  1WSU A;  2QSH X;  2VJJ A;  1ZEL A;  3K6G A;  2IGM A;  3E0J B;  4WK8 F;  4AM3 A;  3NWS A;  3BWG A;  4G7H F;  4HF1 A;  2QQ8 A;  5J1Y A;  2CUE A;  3E1S A;  2IBD A;  2ZSI B;  3K69 A;  3S17 J;  1P2F A; 
#chains in the Genus database with same CATH homology
 5GAD J;  1S72 I;  2H8W A;  2OTJ I;  3CD6 I;  1VQK I;  4V19 K;  1VQ6 I;  3CME I;  4IOA F;  1VQ7 I;  3G6E I;  2ZJP F;  1VQN I;  1VQ8 I;  1ACI A;  3CCM I;  5DM7 F;  3G71 I;  4UY8 I;  1Y39 A;  3CCR I;  1YJ9 I;  1QA6 A;  2E34 A;  3CJT B;  3CMA I;  1YIT I;  5GAH J;  3CC2 I;  1VQ5 I;  3CC4 I;  2ZJR F;  1MMS A;  3CCU I;  1FOY A;  3CCV I;  1FOW A;  3CCQ I;  2E35 A;  1HC8 A;  1YI2 I;  2FOW A;  5DM6 F;  4IOC F;  1YJN I;  3CF5 F;  1YJW I;  1YIJ I;  3CCJ I;  5GAG J;  2ZJQ F;  3J7Z I;  3CCS I;  5GAE J;  1VQO I;  1VQP I;  2K3F A;  2QEX I;  3PIP F;  2OTL I;  2NXN B;  3I56 I;  3CCE I;  2QA4 I;  1VQ4 I;  3CC7 I;  2E36 A;  1VQL I;  2JQ7 A;  1VQM I;  1FOX A;  3CCL I;  3I55 I;  3J7Y J;  5JVG F;  4IO9 F;  1VQ9 I;  3PIO F;  3DLL F;  1YHQ I;  3G4S I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...