1YITI

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1yitI00
3CMAI 3G6EI 1YJNI 1FOYA 3CCEI 4IOCF 1YIJI 1Y39A 3CCRI 3CCSI 4UY8I 2OTLI 2K3FA 3CCVI 3I55I 1MMSA 4IOAF 3CCQI 4V19K 1FOWA 1VQ8I 1VQNI 2OTJI 3DLLF 3PIOF 3CF5F 2ZJQF 1QA6A 3J7ZI 1VQ9I 3CC4I 3I56I 1VQ7I 1VQ6I 3CCMI 1VQMI 1FOXA 1YJ9I 3CCLI 5JVGF 5GAGJ 1HC8A 2E35A 3CCJI 1VQKI 1ACIA 1VQ4I 2ZJPF 2H8WA 2QEXI 2QA4I 1VQPI 1YI2I 1VQ5I 1VQLI 2ZJRF 3CC7I 5GADJ 1YHQI 3PIPF 3G4SI 3G71I 1S72I 3CD6I 2JQ7A 5GAHJ 2FOWA 3CJTB 3J7YJ 5DM7F 2E36A 2E34A 4IO9F 3CMEI 5GAEJ 1YJWI 3CCUI 5DM6F 3CC2I 1YITI 2NXNB 1VQOI
chains in the Genus database with same CATH superfamily
5DYMA 2IXSA 1A36A 1S29A 2K7LA 1X3UA 5L3CA 2F4IA 2FNAA 4L5IA 2G9WA 3ZMSA 1D5YA 2M7AA 3PUBA 4E6KG 4UXNA 5CVVA 4ETSA 1G3SA 3H3ZA 1DDNA 3W6KB 4CCMA 3QOPA 5F1RA 4QIWN 1ZR4A 4A3BJ 3WHBA 4KNYA 1I39A 4MNUA 3CUQA 3B6CA 3QYFA 2YU9J 5LBQA 3M3YJ 1LUJB 1XC5A 2CYYA 1U78A 2CO5A 2E34A 5F0CA 1FYLA 1U9NA 4BE2A 4II3A 2DA5A 3LA7A 5DEQA 1LFUP 5E3MA 1TLHB 2VQHA 4NUBA 3SZTA 3TMOA 2IA2A 3D1NI 2VQCA 4LLLA 1RR8C 2X48A 2DOEA 2X9DA 5C4JJ 3RYRA 2QUFA 4DGWB 2Y9YA 4LK1F 5HDGA 4DBQA 3WG7H 3HSEA 2NVXJ 2QEXI 4XRSG 1UHMA 3DBLB 2B63J 4BY1J 4HNTA 2V26A 1FLIA 4G6QA 4RAYA 1W7PA 5M5WJ 2AQFA 5FFXA 2TDXA 4BAYA 4KN4X 1OR7A 2LDUA 3OWTA 2DK8A 3ZQ7A 4IKFA 3OMYA 1IZ1A 1X58A 2HPIA 1ETKA 1SAUA 2LNBA 2HKOA 3BTJA 3I58A 4BQNA 2EFWA 1O4XA 3IH4A 2ZO4A 2W85A 1S7AA 4ABZA 2BEOA 2VBYA 3K4JA 2K02A 1FEXA 1DPRA 4A5NA 3F8FA 1P92A 3VSKA 3JSPA 3F0CA 1IUFA 3PNYA 2X85A 2ZCWA 3NQOA 2ELHA 3CP2A 3OOPA 5CYVA 4A0YA 2AXLA 1K79A 1ZYRF 2OA4A 4XSZF 1O3SA 3HTUA 5J1RA 2HXIA 4FTHA 3H0GJ 3BJ6A 3S15J 2F5VA 1AKHA 2IGOA 1C0WA 1MBKA 3LAJA 2DQLA 1SMYF 3LFKA 2DFEA 1LDJA 2XV4S 3BP8A 4M6YA 4FX4A 3OOUA 3HYIA 4B4CA 1Y8QB 5F0HA 1EV7A 4Q5SF 3NWSA 3GFIA 4KT6A 2WA0A 2LBFB 4A3MJ 1P4XA 2JRTA 2OD5A 5JI6A 1LEBA 2WY8Q 2DN0A 3DEEA 2P6SA 2A6HF 2CH0A 3BJAA 3U2RA 4BBSJ 3FZVA 2O0YA 3OYAA 4ENKA 4HEA2 1D1BA 3P7NA 5JLWA 2V79A 3F6VA 1MMGA 4O5VA 2MW8A 2P6TA 3QWLA 3KP6A 1SFXA 2BHYA 5GAEJ 4HRIA 4OOIA 3HIFA 1BM9A 5E1XA 5CQEA 1OKRA 4C30A 2PLYA 2ME0A 2XRLA 2XVCA 2Y0MA 5LEJA 4OAZA 1I5ZA 4GGGA 5E79C 3KZIC 4IHSA 4IHVA 1J2XA 5HS7A 2XDVA 3BR6A 2VBWA 3MZ8A 4GXOA 2FEZA 4BNCA 3F72A 2K9SA 1ZQ3P 4YIFA 3DEUA 4C3JJ 1TC3C 1I27A 3TQNA 3CJRB 3S3OA 1O57A 2Y75A 2QWWA 2BVMA 3QP5A 3E6DA 4DNCA 3GTKJ 3ZQHA 2PMUA 2Q0OA 2NS7A 3DF8A 3L09A 1WGXA 4OINF 2HPMA 2E71A 2PBIA 1Y1WJ 3RQ4A 2KPMA 3JAMZ 1IXRC 2R7UA 3L2VA 4E7ZA 3CCSI 4GDFA 5HLTA 3UR3C 1WSUA 5CVIA 4JOMA 1ZRFA 1FYMA 4EJTA 3K7AJ 2GA1A 4I99C 4CCKA 5F27A 2VJIA 2QVOA 2WY7Q 4KT5C 3HHHA 4ANJA 1RC9A 3IHUA 5IP9J 1X1AA 3BR3A 3IV5A 4OAYA 4J00A 1H89C 3TO6A 3G3ZA 1A6QA 2OAZA 4U88A 3T5XA 1OPCA 2K5CA 3HOXJ 3G6EI 2ZXJA 3FXKA 2M8EA 2I10A 3Q0VA 4BUPA 3DBHB 1HW2A 3GXOA 4IHXA 2WADA 3G1MA 3IRRA 2X0LA 3IKVA 2ZXIA 3HOZJ 3TO7A 1D8KA 2CUFA 2HR3A 5AIQA 2NVTJ 2HZDA 2IT0A 5FROA 1S8NA 2IPQX 2XF5A 1TQIA 4C2TA 5HLIA 4KFCA 2VXZA 2RV8A 4KIFA 1UB9A 3FWEA 4JX4A 2DYSH 2BY2A 1QVTA 2EV0A 2KL4A 2YUSA 4A5MA 5E1ZB 4RB2C 1YJWI 4PDKA 3H3VK 5H20A 1USTA 2BGCA 4IOAF 3KZYA 5EG0A 3VDXA 2L7ZA 1RI7A 3FDYA 5HDKA 2KIQA 2ID3A 3BOQA 4ZYHA 2E1CA 2IBDA 1VQNI 4LD5A 1Z67A 3R6SA 3CMYA 2BY1A 4UUSB 3MKYB 4CA0A 1DU0A 3E5QA 2ZNYA 2M3AA 2MH9A 3Q3SA 3OIPA 2R7VA 3FK6A 3CC7I 4HYEA 5K5OA 1V4RA 3BZKA 2ZKZA 1YYVA 3EETA 2L7MP 2EINH 4NC6A 3I59A 4OU0A 4XLNF 4XBFA 2AQEA 1L3LA 5E1WA 4ZTFA 1YS7A 1FNNA 3BR2A 3ULQB 4ZZLA 1GV5A 1E3PA 5HS8A 2Z33A 2H09A 1R4MB 4M9ZA 3KPHA 4JX5A 2MH2A 1P7IA 3FF5A 3I4NJ 1FWZA 2QSFX 3K1NA 4WXCA 1IDYA 2H8WA 3U9GA 2LBFA 5EZGA 4CXFA 1BOAA 5FKNA 5HODA 1B8IB 1NTCA 4AVPA 4I2OA 3DPTA 4M9SA 3LSPA 2O3FA 3N97A 4A0ZA 3SJMA 3DKXA 1RR7A 4YFKF 1YJNI 4XLPF 1JGSA 3WTSC 3S3NA 1OCOH 2ZNZA 4QPQA 1WH5A 2FBHA 3P9KA 1G3WA 1V5GA 1MJ9A 2BXZA 2KJCA 4YFNF 2TCTA 1YOVB 2A6TA 5F04A 1BL0A 3CO7C 4XN3A 5TISC 1OCZH 4IRIA 1J75A 5JVGF 4CICA 1PUFB 3I9V2 3TKYA 4J19A 1Z91A 4A2UA 2BY0A 3F8BA 2Z1DA 2KRCA 2ZXHA 3NRVA 1D1CA 4L9TA 2W1OA 2MC3A 2YS9A 2BV6A 4YRVA 2KISA 1HDPA 3DTIA 4UVCA 1AWCA 4D7MA 4D5FA 1UG2A 4GCVA 2DA4A 2HOAA 1LB2A 1Z9CA 4KN7X 2R5YA 2H27A 1HSJA 5LGTA 1K4SA 1FOKA 2DMQA 3VB2A 3PM1A 2QQ9A 1X2NA 3WU1B 1NG6A 4GYGA 2ELJA 4XKVA 1YHQI 3CUQC 1W1WE 4KIBA 1BC8C 2E36A 3ZQQA 1VZ0A 3RKXA 3EUHC 2EBIA 4HX8A 5D5VB 5DUIA 4LJZF 1X4OA 1VFCA 2JTVA 4KUMA 4R1HA 3L7WA 2DK5A 2F2EA 2GA2A 1MSEC 3OYFA 4GRIA 2LREA 1F4KA 3JRAA 1QZZA 3GO5A 4BYYA 2RN7A 2MFZA 4PJNA 4XLFA 5EEGA 3ZMZA 3HHGA 2H1LA 3GEZA 1LEAA 3E6MA 1AKHB 1B1BA 3S2WA 4Y52J 1JKQC 3VODA 1QZEA 1BI3A 1UAAA 4PSXA 3A01B 3ML6A 4CYCA 2JA6J 3PFIA 2Z9OA 3LSHA 2CW8A 3N05A 3RCOA 1YW9A 2BY3A 2DMNA 3J81Z 2GIVA 3Q0UA 3TDUC 4EM2A 3GYHX 2AS5F 4UNOA 2F4MB 3MZHA 1NG7A 1V5FA 3I53A 4XLHA 4OIRF 1GT0C 4E7LA 3J7ZI 1KZHA 3L2CA 1KQ9A 1YJ9I 3BTIA 1MH4A 3PJRA 2L5QA 3E1SA 5KAFC 1R5ID 3ZN0A 3QPTA 1ETQA 3CTAA 2FU4A 3CF2A 1T2KA 2FRHA 3J81K 1X1CA 4CDGA 1Y8RB 4ZYEA 3I5UA 1P2FA 1GDTA 2IVMA 2PJPA 3CMAI 4RAFA 4RM3A 4JX6A 1BI0A 5FB2A 1XPXA 3DTKA 2LH9A 5D8KB 2D45A 1IN7A 3W2VA 1R1UA 2X6YA 3DKWA 2JA2A 4HV6A 4RLFA 4BL0B 3DFGA 5AONA 2V1XA 5D6FA 1TW3A 2ZJPF 2WBMA 1WJAA 3IRQA 5IYCJ 3OYCA 3RPUA 2F5FA 1FSEA 4Y4RA 1HQCA 1MH3A 2CUZA 3W2AA 1ETYA 4PGHA 4AD9A 2V9PA 4EMSA 5IPAA 2E60A 1IXCA 4I09A 4IRGA 4C2MJ 2STWA 2OZ6A 3JR9A 3LSRA 1FMWA 1GVDA 4B3AA 3S14J 1FOWA 2DYRH 2HYGD 5L3GA 1OJLA 5CJ9A 1W36C 4U7BA 4XKBA 1MBEA 1T56A 1H0MA 1NK2P 2JN6A 1B9NA 2L7FP 3W6JB 1X2MA 1X1DA 3QAHA 4CZZA 2VOPA 2V1NA 2UXNA 5D5XB 1FIAA 3FHNA 2HKXA 4XRMA 4HV5A 4M71A 1D5VA 4RGXA 3RTRA 2LSOA 4XIDA 2MD5A 1P9QC 3AG3H 3JRDA 3OYHA 3K0LA 3LSIA 4BGDA 4A3LJ 4HZFA 1ON1A 2DA7A 1S7OA 5F1JA 5H6RA 4P9FA 5GPAA 2RQPA 4G12A 3FM3A 3WTZA 4PJLA 1N78A 2A5WA 1TT5B 2PJRA 3KP3A 2QZ8A 3FMSA 4BQAA 4KJZA 3HC7A 5DUKA 4F93B 4U0YA 2HEOA 5HS9A 4DJAA 2W48A 2EZLA 3ONQA 3LSJA 2RNJA 1IJWC 4FCYA 1TWAJ 1W0TA 1PJRA 2DT5A 5FD5A 4EEFG 4Q4ZF 1ZN2A 3LNQA 3BG7A 1IUYA 2Y31A 4OMYA 2R7OA 2DMPA 2JT1A 1ORKA 2A61A 2L3DA 2GLOA 5FKOA 2NVQJ 2EFQA 2IGKA 1VQPI 1W4MA 3DEWA 2ECBA 1LVAA 2FOWA 4K2EA 3ZMTA 4LIUA 1QU3A 4RA2A 1RUOA 2ISYA 1ZLKA 1HA8A 3OS2A 2CQNA 5J6XA 4A3CJ 3BZ6A 2HU9A 2PMHA 4HNVA 1U3EM 3GCMA 4LG0A 3I0TA 2E7XA 1FTTA 5K5RA 2QBYA 3G73A 2G7UA 4I76A 4BBRJ 2FX0A 4EVIA 2Z16A 1GUUA 3CCJI 1K78B 3BCAA 4IHYA 1QNTA 1U8RA 4RGSA 2BZTA 3TL4X 3UNGC 4FT8A 1WHUA 4S05A 2GZWA 2JA5J 3CDHA 4BJTA 3IKTA 2UZKA 5H2FC 5K7ZA 2LF7A 4BJ6C 1MMDA 2FF4A 3JW4A 3K2ZA 4MEXF 3VEPA 2Z5UA 2IEKA 3AAFA 1LQ1A 2P8TA 1SFOJ 3FXMA 4OWRB 1Z6RA 3OSGA 1IRGA 4ZH4F 3PSFA 3KCCA 4UV9A 1R1TA 1Z05A 2BHZA 2KDOA 4HNUA 2KMUA 1HXDA 2ACJA 2Y69H 2DQRA 2JA7J 1USSA 3LL7A 1JUSA 5KHDA 1FTZA 5J3LA 2YSRA 5LLQA 2XUBA 1SD4A 2YU3A 3MZYA 5M3MJ 2LOOA 3I55I 2XAFA 3WTTC 1EH6A 2VODA 1UJ8A 3IAM2 3A4CA 3E6CC 1MIJA 4DZJA 2V1UA 4N0BA 2NVUB 3BQZA 5GTIC 1X1BA 1E3OC 2XSJC 4ENMA 4KICA 3PQJA 4IRHA 2QQAA 3G1OA 1MBGA 1WJ5A 2VL8A 1DGWY 3RKYA 3KX2A 2OUMA 1WFXA 3OL3A 4ZZDA 4FQGA 2P4WA 1J59A 1AU7A 4DYRA 3SYTA 1Z77A 4MLOA 3S1QJ 3KLNA 1ZG1A 3FMRA 3GW2A 3H5RA 3TP0A 2JWTA 3K6GA 2ESNA 1AA7A 1ODDA 2K4BA 2K3FA 4O3MA 1I3QJ 2X6WA 3E97A 3ZQIA 4IZZA 4HDUA 1WJCA 4B44A 2K3PA 1I1GA 2WAEA 3Q9SA 1U5TA 4KITB 1TQMA 1UMQA 3SQNA 4AU7A 1SFEA 4L0YB 3HZJA 4MFEA 1BR1A 1FT9A 3OYBA 1SEUA 1K6YA 4RLQA 1U6GA 3ZR8X 3PNTA 1L0OC 2JMWA 3I71A 5IT3A 1YRNA 3PO3J 4NQWA 3CQZJ 3R60A 1QHHD 2E1NA 2KJBA 1SVLA 4A3FJ 2LF8A 5J4VA 2QENA 4BJ5C 5E8GA 1T38A 4D0PA 2CMPA 2QYOA 3HSFA 2H6CA 4M72A 5D5UB 1ZELA 3CF5F 3S1RJ 4QSHA 1J7KA 1VQ7I 1R36A 2VONA 4XOTA 4LITA 2DA2A 2VKHA 3PIPF 1O3TA 1V3FA 1HBXG 2CRGA 5JR3A 2WC2A 2CSOA 2NXNB 2LD5A 2WV1A 2EQRA 1UELB 1MDMB 4M3BA 4M3GA 1IRXA 2EFOA 1R4NB 3I64A 1ZREA 4G94A 4RGRA 3LOCA 4D7NA 1PUFA 2XPUA 1R00A 1WJDA 3AL0C 3I54A 3QYBA 4HX4A 5BQTA 3GTMJ 1ETVA 2LY1A 2STTA 4DOZA 2JA8J 1T39A 4XORA 3S93A 1JXSA 3BR5A 3CDLA 3KLOA 2P5LC 3QOEA 1H88C 2VPLA 5E3NA 2Y2ZA 1JKPC 4L9JA 5KCMA 4G7HF 5EEHA 5FLXK 5ICFA 3HXLA 1FX7A 3S8PA 1FOYA 5J4YA 2CGPA 2OC6A 4EATA 3K4BA 4ZDOA 2O7OA 2BW3B 2GAUA 2E1MC 2L0KA 2JSPA 5K7HA 4XQFA 2RVCA 4E4HA 5DCFA 3V42A 1JE8A 1UFMA 2NS8A 3HUGB 4PK4A 1S9HA 1O3RA 3PO2J 2WTEA 4II2A 3GMEA 1BIAA 1IW7F 1XX5A 1XGMA 2HI3A 2F5CA 4XMYA 1T08B 4XLEA 3T8TA 5LHIA 4WCGA 1RNLA 3IWZA 2PEXA 2HS5A 3CESA 3CCUI 1Z6TA 4C2UA 2R4GA 5JHUA 1U0JA 1RKWA 1ZG5A 3BC8A 3H5NA 4PCQA 3CCRI 2QBYB 3ABKH 4IF4A 1QVUA 1E3HA 3GZNB 3VWBA 5BNGA 2K86A 3FXLA 1JI8A 2IA0A 1MBJA 5IYBJ 2HDCA 1KU7A 3I4PA 2EZIA 4PZJA 5FD6A 4RDUA 3F22A 2DT7B 4BE1A 2ID6A 4ZYAA 2K4JA 2L02A 3JRBA 4PJJA 4KMUX 3O8GA 1ZGWA 2R7FA 3AFHA 2H1KA 1V54H 1XGNA 1ZLJA 3HPGA 4G9YA 4P5OA 3DLLF 2D1VA 2QSHX 2OJED 3E0JB 4I0BA 2R7XA 4GYIA 4WXDA 2Q2EB 3O6BB 1QZYA 2P5KA 4G6DA 2EV5A 2FNPA 4HDVA 4E7JA 2XKOA 3FM5A 4I98B 5LGUA 2QM3A 1WI3A 5BOXA 2UUZA 2F48A 2RREA 3DPUA 3OYNA 3AG2H 4Y33A 3JTGA 2KRFA 1IDZA 3K1PA 4LMYA 4RM2A 3G1LA 1ZTRA 4BHPA 1OYYA 5C44J 1FY7A 2EJRA 1IG7A 3CCQI 4HQEA 4A69C 3W3CA 4GO1A 5TGTA 1Z21A 5GPCA 2GOMA 3F23A 1VQ6I 1IAWA 3BG3A 3NAUA 5L3BA 1WI9A 2P7CB 3PUFA 5LRSA 3H3UA 5F64A 4E7IA 3NEUA 1SD6A 1YX5A 4B47A 4QTRA 2ME6A 2X1DA 2UV1A 3K70D 1XGOA 2M30A 1D3YA 4PSWA 2V6CA 5ICGA 2DFHA 5L3EA 5H6QA 1T0FC 2HXOA 2LR8A 3JTHA 5D8LB 5IOYA 1QQIA 3HKZN 2D2WA 5EJCA 1A35A 3ECOA 1NH3A 2R7QA 1G6NA 1XSVA 1VQ8I 2L4MA 4BE0A 5FLVA 2HGCA 3WTUC 2WB1N 1U8BA 1MBHA 2IP2A 3Q5FA 1V55H 1Z3YA 4HF1A 4WWCA 1FBSA 2CG4A 3ZRGA 3HOUJ 1DU6A 4AIKA 1FBQA 4EM1A 3HSRA 4M3FA 1BIBA 2G7HA 3DCFA 3HB9A 1TW2A 2XAJA 2L9RA 2M4GA 1VQOI 1IN6A 5DTDA 3GZ5A 2V4JC 4UUVA 1S6LA 4R8HA 2O61A 4EJWA 4CZCA 2HQ5A 1Q1HA 4N4NB 4U0VA 4IHWA 2JPBA 2L01A 1OQYA 5CPRB 2GXBA 2FQ3A 2EILH 2FUG2 3M8EA 3JSOA 1NHAA 1FBUA 2VPRA 2DLLA 1YG2A 4IL6C 4H4KC 1IRFA 3U21A 1G4DA 3DU6A 2DA1A 3F6OA 2VE9A 4W97A 1ZK8A 3BT9A 1T98A 2O03A 1MDMA 3JRFA 2M8GX 3E5XA 1OCRH 3KP7A 4A3IJ 2F6CA 3KP2A 4EGYA 3CZ6A 2DJNA 1IN5A 3EUKL 1XD7A 3GFLA 2O8XA 1NK3P 2KQRA 2L9SA 1Y0NA 2EFNA 1TBXA 2QCOA 1RETA 2IS1A 1TZLA 2CFXA 3BJOA 2DXIA 3FIWA 4Q47A 5J47A 4KIGA 2XGEA 4QLCU 3HOYJ 3V7RA 4IVNA 3H92A 3W2WA 5BMZA 3EQLF 4L5JA 2P0WA 1R22A 1WQ2A 3A0BC 4AYBN 4D5CA 4N9HA 5K1YA 1XMKA 3PNVA 4BH9A 1CGPA 2HOTA 3PFYA 2DBBA 4PJ0C 5LRRA 3S1MJ 4KDPA 2VKVA 2QKMB 2VUMJ 3H9JA 2R7TA 2K85A 2WAQN 3LMMA 5FFZA 2LKXA 2L9VA 4BEHB 2DFIA 1JKOC 5L3FA 2LYCA 3IH3A 1YE9A 4L9NA 1OFCX 3OSFA 2E2JJ 5FRMA 2RKHA 3DLAA 5DCMA 1HW5A 2XC7A 1IC8A 3RKQA 4HOBA 3GVAA 2M4KA 4XRFA 5C4XJ 3K9TA 4MHGA 2DTZA 4HBLA 2DT6A 1D8JA 4Z2YA 2GBYA 5B1AH 4CCLA 1XB4A 2PQ8A 3FMQA 2EIJH 2HOEA 5FKKA 5ICEA 3DV8A 3EYIA 1G2HA 4IEJA 1YTYA 2M2EA 4PJMA 3OS0A 2ZJQF 2KRHA 2VQLA 4W1UA 1JHHA 2Z3YA 2XSDC 4BKXA 1MZBA 1VTNC 1IV6A 2COMA 4S0HB 1T8IA 5GTHC 4ESFA 3U1KA 1GVJA 2KFDA 1XDSA 2OV7A 3HBLA 4E7HA 2R93J 3C1DA 1RZ4A 1I3AA 2W84A 2NOGA 3UKGA 1ZRDA 1GXQA 3DPLC 2M1BA 4OIQF 4CYCB 1I6HJ 2BXYA 2Z2SB 2PMZN 1T95A 4G7ZF 1R5GA 2P7VB 2GOXB 2HDWA 2AO9A 3A0HC 3C7JA 4HSRA 2OCEA 1H9GA 1KQ8A 5TJJA 1HW1A 2A3SA 3O3KA 4I6ZA 1VQKI 4KISA 1TT0A 4QPOA 2DJIA 2KDZA 1S72I 4ZDPA 3MMYB 4LB6B 2FJ1A 1K61A 5D6EA 2R5ZA 3WGIA 4A3DJ 3EUHA 3C18A 2MC4A 4Q48A 4D9JA 4HF0A 3LQRA 2JUGA 1YIJI 2GWRA 3BLYA 3GFMA 1SMTA 3GX4X 2FBKA 3ASNH 2EPFA 2B7EA 2VBXA 4V2GA 4A3GJ 2CUJA 2OF7A 2ZFWA 3MKWB 4LK0F 3CC4I 1HKTA 2CJJA 2KP6A 1MNEA 4NC7A 2OPTA 1ACIA 3ZXSA 2BW3A 1BW5A 1MNMC 2IAIA 4LG3A 2CQKA 4CCJA 3C2GA 5EEAA 2ETHA 3K4LA 1KYWA 2L2OA 3R0JA 4M6VA 3OIQA 3VFZA 4A93J 2NOJB 3GFJA 3CC2I 1WRJA 1TP4A 2QLZA 1W5SA 3BZCA 3SZGA 5FLXZ 1O3QA 3KYDB 2E2HJ 4BY7J 3SEQA 3WODF 2OCCH 2OBPA 3J7AO 4M9XA 2XPWA 3HRSA 3MVPA 1JGGA 1OYIA 3L2RA 1WVRA 1LDDA 1Q1VA 4N9IA 2DA6A 5F6FA 4U7DA 1HF0A 1HDDC 1P4WA 1B4AA 1K6OA 1X4PA 1UHWA 4YELA 1XDUA 3IH2A 3A01A 1BI2A 4E70A 4BU2A 4A6DA 2E5ZA 2X1EA 3PQKA 2EV6A 4C3IJ 2LTPA 2QGUA 2GM4A 1ETXA 1P6RA 4EQQA 4YIIA 1X19A 1E17A 3B73A 2RGVA 2LKPA 2XF7A 5CVUA 4NQWB 4IQJA 3P9IA 2M45A 3MFKA 1BBYA 4RBOA 3RPUD 1DPUA 2DODA 2IS2A 3D0SA 1QA6A 3WU0A 4F55A 1WCMJ 4TV7A 1KGSA 3W6VA 4M6XA 1I6XA 3C2BA 2QQ8A 4B48A 5GADJ 2L54A 2K27A 3OY9A 3OYLA 2JQ7A 4RMNA 2F5DA 1ZARA 3HM5A 2PJRB 1TWFJ 3BG5A 2RAEA 2M7BA 5DS9A 4ZJZA 2IRFG 2O8KA 2GXGA 5IT9Z 1ETWA 5DCMB 3FXQA 1UHSA 4UB8C 5K5QA 2IA1A 3WU2C 3KEOA 1VQ9I 1D0ZA 4XLCA 4CUGA 2VQGA 4MQVA 3KZZA 3T1BA 2D5VA 4LB5A 2VE8A 3KE2A 2MSYA 5KAIC 1MKMA 5BPIA 3I59B 1G59A 2VC0A 1MBFA 3X2QH 4FISA 4NDLA 1VNDA 3V4GA 4CH7A 1Y39A 2NRAC 1K83J 3VSLA 3BPXA 3SZPA 1AOYA 2W00A 1LE8A 3ZOBA 3B02A 2HQNA 2O5RA 2XAUA 1OCPA 3Q0WA 1ERDA 4UHTA 1FOXA 1OISA 3H1CA 1D0YA 3H9QA 1QGPA 4XICA 2MYSA 3FXUA 1LKXA 5EZHA 2DCEA 3S2HJ 2D1HA 3FX3A 5HVQC 5EF6A 2LRDA 2XB5A 3ZQCA 2XF6A 5HLHA 2XHKA 2MG4A 3JRIA 3BDDA 3H35A 2DMTA 4DBRA 4XSXF 3OYDA 4MO7A 5FRNA 2LG4A 2X1CA 2OZUA 3PIOF 1QPMA 4G6TB 3BY6A 1B9MA 2DPDA 2R5ZB 3I56I 1W36D 1UG0A 3FXJA 4M3EA 5M5YJ 1YI2I 1KONA 2E5NA 3RQIA 3QODA 4AUXA 1R5HA 3RDIA 1KU9A 3O8HA 1JT6A 5ERIA 1YQAA 2B0LA 2KIMA 1GV2A 2V7FA 2ZMEB 4L18B 1LE8B 2GIZA 3H9GA 3M7GA 3FBNB 2G0EA 2HYFA 2I5UA 1G3TA 3RPQA 3IL2A 1J9IA 5KNLA 4U0WA 2QQBA 4LIVA 3ZN1A 3TEDA 4MEYF 3H36A 1U9OA 3BTLA 2X4HA 3ISPA 1TL8A 3CCYA 3TW7A 3LQQA 3SFIA 4F3QA 1ON2A 2EFPA 4FX0A 5L3DA 5EGOA 3HRMA 4WX9A 2DOFA 3GWZA 3V8KA 2HNHA 2R7ZJ 2W7NA 1GXPA 1JUMA 4AWXB 1Z3XA 3HDDA 2K40A 2PFBA 5BPDA 4P9UA 5DD8A 1Y56A 3KP4A 1VI0A 1EKEA 2W24A 3JRCA 3S2DJ 3SEZA 2V9KA 1FSHA 1PUEE 3M1EA 3KYLA 3JRGA 5DDGA 3L2QA 2BBYA 5D4SA 4XKCA 5LGNA 3SDGA 2FXAA 3HGGA 3HOTA 1REPC 2XIGA 1W7PD 3BQYA 3QU6A 4X0GA 3WTXC 3H0DA 1HKSA 1EF4A 4BDZA 2VIXA 5D4RA 3I4MJ 5AIPA 5K7FA 2JVGA 4UY8I 2R92J 1FP1D 1ZR2A 2HTSA 1BA5A 5J8CA 1ZAOA 3KYCB 1ZG3A 2A6EF 2ISZA 1SC7A 3NARA 4WXHA 1DQUA 3G2BA 3QQAA 4F52A 2HOSA 3HRTA 5CLSA 2LP0A 2DTRA 1CQTA 3HEFA 4S04A 6PAXA 1W5CC 3WGHA 3CUQB 5B3SH 1X1PA 3WE3A 3GTOJ 5ICCA 2HFHA 2A07F 3KEQA 2EK5A 3PL8A 2UWMA 3LA3A 1E2XA 4DZPA 5IT9K 5LFAA 3LA2A 5D5WB 4JQFA 4PFOA 2JVHA 5IY5H 1LVKA 1OYWA 4RAGA 4XONA 2K9NA 2EH3A 3VOEA 3QP6A 2RDPA 1RPWA 3F9KA 3KEYA 3MCZA 1XN7A 4L5EA 3MEXA 4BHCA 3FK7A 1PVEA 3OS1A 4LLNA 2FSWA 3AL0B 2LKSA 4C9YA 1T6SA 2VJJA 4XM3A 3MAJA 4P96A 2N8GA 4NHJA 2YX4A 3ZQGA 2BVLA 1POGA 3L9FA 4HLYA 1AHDP 1SVMA 3RSNA 3D5LA 3CCVI 1QO0D 5EYRA 2JZYA 3OYMA 4ZC3A 2NAZA 3K4CA 2X6OA 4C3HJ 2HWVA 1FPQA 4A0XA 1YS6A 1B59A 3GLXA 2PG4A 1YRNB 1X3WB 1J5YA 4JBAA 1HOMA 3NWTA 1S5LC 3G71I 5IP6A 4A12A 1F36A 3Q9VA 2BYVE 3OR1C 5BS6A 2HVRA 2Y30A 4NC8A 1XTAA 1IN4A 1MGTA 4F7ZA 4MGRA 3TGNA 2CU7A 1DGRM 2VT3A 2R7DA 2OTLI 5FGMA 1R6RA 2XB0X 4H0EA 1P4AA 3VYRB 4AVZA 4RB3C 1T33A 3ABUA 1K7AA 1BOBA 4RB1A 2KIFA 3K70C 5HNHA 2NNNA 1HC8A 1U2WA 5TRDA 2VBZA 4LFUA 2VC1A 3KFWX 3FXRA 2CW0F 1RRJA 1WJBA 3SXYA 3VYUB 1IN8A 1XSDA 3ESWB 4FETA 4A3EJ 3CP8A 1B6AA 4QWQA 3CMEI 1YW8A 3BCBA 2VT2A 1ETOA 1HSTA 1ZGJA 2YR2A 2L4AA 2M9HA 2CS3A 1HCRA 3K10A 4EM0B 5FKLA 1SFKA 2HTJA 2E7WA 1EH8A 3J80K 4XLAA 3QU3A 1YX3A 4OIPF 2FBIA 3I3LA 3CCLI 1VF9A 2IS6A 4CYDA 1E0EA 2DFFA 2YPRA 2R7WA 4KYWA 2HQRA 1W7PB 2W4SA 3S17J 2XROA 3LFUA 3GTJJ 1U5TB 5ED4A 1TNTA 2Q2EA 3V7CA 4X6AJ 2A5YB 5B1BH 4IOCF 4HX7A 2Z99A 3P5JA 4A3JJ 4XNFA 1JUPA 4BQOA 4ZYGA 2VASA 5HDNA 3GLLA 4F92B 4LGWA 3GZ6A 2KLOA 3GTLJ 1IGNA 1ZGAA 2LFBA 1RUNA 4N4OB 2ZC2A 2R5YB 4ESBA 3HG9A 4RAZA 4M73A 1D0XA 3A2KA 3ERED 1OLTA 2FOKA 3C2HA 3V8JA 4HA8A 2DDAA 3WG9A 5IYDJ 1I50J 2J5PA 1IO2A 1JTYA 4HQMA 3RIRA 4B09A 1G8XA 3WTWC 1OMIA 3CCEI 5ILSA 1PP8F 3HOSA 3CMMA 5ILVA 3OV8A 1TTYA 3BTCA 1BN5A 1O7FA 1T0FA 3DU5A 4LLGF 1TWHJ 2H94A 1HKQA 2VI6A 2ZFUA 2OTJI 2HZTA 3DWLE 2GXAA 4AIJA 4MFDA 2E1OA 3SHFA 1HLVA 4B3XA 1XSXA 3CCMI 4DYQA 1F5TA 4FE7A 2KZVA 3GTQJ 3RJPA 3MWMA 3OIOA 3FBIB 3LWFA 2A69F 2XAHA 3AG4H 3ZGKA 5J1YA 1LPQA 5E8IA 5LEKA 3SFZA 3J80Z 2KT0A 5J8FA 2WWYA 1RKTA 1TQPA 4Z6YA 4RGUA 1Y0UA 2V1DA 1ITYA 3GBGA 2MLKA 4JK1X 3HRUA 2VJ5A 2W82A 3K2AA 3MQ0A 4Y15A 2MLGA 2WAQA 3HKZA 2ZSHB 3CO6C 3E5UA 2AHQA 3BPVA 3C3WA 3M1CA 5E3LA 5FO5A 2LK2A 3R0AA 3LSTA 4XL9A 3TOAA 4I7HA 5E3OA 1PDNC 3G4SI 3K4NA 3QPSA 2CFOA 4G8XA 3IP4B 3U1DA 2CQQA 2KIUA 5M3FJ 4NB5A 1W0UA 3AG1H 2EA2A 2B9SA 4XOPA 1EH7A 4FHTA 5GP9A 4YG2F 3RZOJ 5J1UA 2MD0A 1WH7A 3KP5A 4UVBA 2W25A 3ERMA 4UUTA 4XK4A 4A3KJ 2MA3A 4XN0A 4V19K 3D5RC 2EZKA 2ZB9A 1SD7A 3FXOA 1J09A 3F8NA 3EDPA 4PFPA 4JP0A 2DA3A 1X3ZB 1R7JA 2ZMEC 3FKIJ 2VXDA 5HOOA 3R61A 4EV0A 4M3DA 3CJTB 1LFPA 2PX9A 2ADUA 2JUCA 4ESJA 4MIMA 2W57A 4CGZA 3LAPA 4B8XA 1KA8A 2ZJ2A 2Y0SN 1CF7B 1MSFC 1STZA 4Y17A 3HL2A 1BI1A 1FIPA 1U5TC 1IV8A 1LFBA 4UVAA 1VQMI 2K9LA 5C3EJ 1A04A 1WJEA 2QA4I 3S32A 1TWGJ 2R0QC 3CLQA 1KQ0A 2CQ7A 3J7YJ 1BJAA 1Y1VJ 1QHGA 2Y48A 5KVRA 5IOZA 2X51A 1GLNA 2LLKA 3A1YA 2FA5A 4V2FA 4X1EA 2JK3A 2RNGA 3SDBA 3K4KA 4UUSA 2X6XA 1V5EA 3FKJA 2XPVA 2PN6A 2BE5F 2P81A 4HW0A 3L1PA 3E3VA 1RIOH 3ASOH 4PUSA 5DD4A 1B72B 4L9VA 3VYTB 3O2PE 1Y6IA 3GF2A 3QPHA 3S3MA 1VQLI 2DPUA 1WZ2A 3REOA 3EYYA 2VOOA 3DKYA 3ROUA 1EJ9A 2ZMEA 1XCVA 3LSKA 3KIOA 1IXSB 3HPHA 2KKOA 5E18F 3D5SC 4IQ4A 4AIHA 1TWCJ 1N25A 1R23A 1H8AC 1FMVA 2EB7A 1QRYA 2KHMA 1A6IA 3ZMDA 2XRNA 3BR1A 3K4MA 4EJOA 3B6AA 3ZMUA 1DUXC 4NBQA 3ECHA 4XKWA 1FC3A 2H6BA 1SAXA 4O6JA 4L0ZB 1F9NA 5JFRA 4Y3OA 5HNFA 4IO9F 4ZYDA 2V9VA 1QPIA 1S3JA 3OYIA 5B5EC 3CJQB 1XG1A 3JRHA 3RYPA 1YW7A 2R3SA 1FYKA 1MW7A 4CSWA 2RC4A 5FJ8J 3MKZA 2FMYA 4CCNA 3HTSB 4I02A 2LY9A 5CVJA 1CF7A 4EJVA 3A02A 4YEJA 4MQ9F 5J40A 1P7JA 4JYKA 2JJ7A 4U87A 2DI3A 1PYVA 3CDIA 1BC7C 1DP7P 2ZJRF 2Y9ZA 3CD6I 4EGZA 4WF2A 3BG9A 2LVSA 4ENNA 1BR2A 2ZSIB 3CLOA 3TOBA 4BHBA 5DM6F 1BW6A 2FMLA 2NS0A 2VB6A 3TO9A 3ABLH 2BOLA 2XAQA 3IUOA 2M0CA 2VKEA 1MD0A 3WTVC 3HGYA 2ICWG 4E7SA 2IS4A 2LMDA 3CUOA 2XKPA 2RQQA 4Y7NJ 2JSCA 1UZCA 2TRTA 1JT0A 1MJAA 2FQ4A 1J0RA 1R1VA 4DYCA 3GTPJ 3HUGA 2HVQA 1ZRCA 3MN2A 3JCUC 3QYEA 2DO7A 1ENHA 3OYKA 2ECCA 1O7LA 4XR6A 3M9AA 2E2IJ 3HJEA 5CKTA 3F8MA 2H8RA 1Z7UA 2R7SA 1RESA 4HSTA 4MTDA 4D1QA 1ONVA 4BEHA 3KETA 1R49A 4BXFA 3S1NJ 2IGNA 1YLFA 2Q1ZB 3EUAA 4IXAA 2A68F 2CWEA 4FE4A 1YO5C 1VQ5I 4KMFA 1MJBA 1ZHFA 2J5OA 2XGDA 3K1MA 1UCRA 1ULYA 1XMAA 5JLXA 2WV0A 1D1AA 5A2QK 2XGXA 1A31A 4XRSA 4BDYA 4UV8A 1FJLA 3BG6A 4OMZA 1SD5A 4BXXJ 3JAMK 2ZXWH 4YFXF 3RKWA 2NYXA 3OYJA 2L7KA 3WE2A 1MNDA 4IX7A 1BJZA 2OQRA 2O9LA 1YIOA 5LHHA 2YX7A 1KYZA 2DAOA 3OYEA 5KK1A 2I8DA 2R7RA 3HOVJ 4DW6A 3M4OJ 2VJ4A 1EA3A 3WTYC 4ASNA 2VLAA 1JJ8C 2HYJA 5E20A 1XMXA 3OL4A 4NNJA 5IP7J 4M74A 3N4MA 2M0MA 2VKDA 2QSGX 3DXJF 3EPZA 1ZKGA 2FE3A 2NNYA 3BROA 2ZBKA 4MTEA 3F3XA 1B72A 4E7KA 2DU9A 2XAGA 4HLXA 2ELKA 2L9NA 1LJ9A 3PSIA 1B8IA 3DBRB 2A05A 1IRZA 1OCTC 3H5AA 3TW6A 5GAGJ 4AC0A 3M07A 4CHUA 3QPLA 4B43A 4BQQA 2CUEA 2EZHA 2E1MB 4A6EA 2Y0SA 4ZDLA 3WHCA 2GQQA 4UB6C 2CV1A 1WKMA 2XGCA 1Z0XA 2QF7A 5CVRA 3R4KA 4FASD 5FKMA 3TP3A 2IW5A 4DIQA 4F91B 4ON0A 3IWFA 2PI0A 4HF2A 2P5VA 2IGMA 3ZQFA 3K69A 1GHCA 2XASA 2CV0A 3ABMH 4LG0B 4KA4A 1R71A 1JJ6C 2O6GE 1F1ZA 1M1EB 1QBJA 2K9MA 4BS9A 1N77A 2E35A 2LY2A 2JRMA 3J7AY 3DTEA 3LSGA 2CQXA 2JPCA 2HVSA 2MABA 4HG2A 5JHFA 3OR2C 5FLMJ 5GAHJ 1OR7C 5DM7F 4R79A 3DP7A 3WGGA 2COBA 1K78A 1YITI 1SVOA 1KU2A 2EWNA 2LC2A 1A5JA 1JKRC 2ESHA 4Y13A 2CW7A 2E19A 2MGQA 3MD2A 4CO8A 1OCCH 2WB1A 3ZP5A 3COAC 1R9TJ 2DDBA 4HPQA 3L00A 3V7SA 1ZH5A 5EG0B 4EJUA 1MMNA 1WJFA 2AXTC 3L2WA 5M5XJ 3ZPLA 4AIDA 4G7OF 4I01A 4DQ2A 5HLGA 1N75A 5JVTA 1XCBA 3ELKA 2OU2A 3M8FA 2UXXA 2PMZA 1FP2A 3AKZA 3F21A 4RS8A 2K9QA 3V8LA 3JREA 1IF1A 4AM3A 4P1WA 2QKLB 4J01A 1G3YA 2EA4A 1DP3A 4HAMA 3FISA 3HOWJ 3QRFF 1JHFA 4AYBA 1H9TA 2WAFA 1TNSA 4OIOF 1KU3A 3GTGJ 9ANTA 2M87A 2HQAA 1FZPB 3BR0A 3A03A 1R58A 4LOCA 3F8CA 3T8RA 1LDKB 3GUDA 1BR4A 3TDZC 1MMAA 1VQ4I 2V6EA 5F08A 3LSMA 4B1RA 1APLC 3RZDJ 5LHGA 1YFHA 3RI4A 3ZQLA 1F43A 2M5WA 1SANA 5CQGA 5EDNA 2EIMH 3ZCOA 4BXUA 5E17F 2M34A 2DMUA 2C6YA 1MMSA 5ILUA 3S16J 3P9CA 2HDDA 3BWGA 3E6BA 5EGOB 1SFUA 2DOAA 4IHTA 2Q8KA 3M8JA 4YIRX 4ENJA 2OQGA 3FHZA 4I0AA 2DW4A 3CJNA 5A2QZ 1LNWA 1WPKA 1JTXA 3IAS2 4IPAA 1Z1DA 4IJAA 5B66C 5LD2C 1I1SA 5DV5A 1S7EA 2IJLA 2NVYJ 3ABTA 3MKLA 1W5TA 4ITVA 3T0YA 4ZTJA 1Z7LA 3VPRA 3L2UA 2CV2A 4CCOA 3OYGA 1K4TA 2MBFA 1XGSA 3IC7A 1XS9A 5F0FA 4WK8F 2F4OB 2EIKH 2VN2A 3DQVC 1WWXA 3TBIA 4RB0A 4PGGA 2FD5A 3VYSB 3ZMVA 4GFBA 2F5EA 4BACA 2KZGA 3E7LA 4P55A 1PP7U
chains in the Genus database with same CATH topology
3CMAI 3G6EI 1YJNI 1FOYA 3CCEI 4IOCF 1YIJI 1Y39A 3CCRI 3CCSI 4UY8I 2OTLI 2K3FA 3CCVI 3I55I 1MMSA 4IOAF 3CCQI 4V19K 1FOWA 1VQ8I 1VQNI 2OTJI 3DLLF 3PIOF 3CF5F 2ZJQF 1QA6A 3J7ZI 1VQ9I 3CC4I 3I56I 1VQ7I 1VQ6I 3CCMI 1VQMI 1FOXA 1YJ9I 3CCLI 5JVGF 5GAGJ 1HC8A 2E35A 3CCJI 1VQKI 1ACIA 1VQ4I 2ZJPF 2H8WA 2QEXI 2QA4I 1VQPI 1YI2I 1VQ5I 1VQLI 2ZJRF 3CC7I 5GADJ 1YHQI 3PIPF 3G4SI 3G71I 1S72I 3CD6I 2JQ7A 5GAHJ 2FOWA 3CJTB 3J7YJ 5DM7F 2E36A 2E34A 4IO9F 3CMEI 5GAEJ 1YJWI 3CCUI 5DM6F 3CC2I 1YITI 2NXNB 1VQOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA I;  3G6E I;  1YJN I;  1FOY A;  3CCE I;  4IOC F;  1YIJ I;  1Y39 A;  3CCR I;  3CCS I;  4UY8 I;  2OTL I;  2K3F A;  3CCV I;  3I55 I;  1MMS A;  4IOA F;  3CCQ I;  4V19 K;  1FOW A;  1VQ8 I;  1VQN I;  2OTJ I;  3DLL F;  3PIO F;  3CF5 F;  2ZJQ F;  1QA6 A;  3J7Z I;  1VQ9 I;  3CC4 I;  3I56 I;  1VQ7 I;  1VQ6 I;  3CCM I;  1VQM I;  1FOX A;  1YJ9 I;  3CCL I;  5JVG F;  5GAG J;  1HC8 A;  2E35 A;  3CCJ I;  1VQK I;  1ACI A;  1VQ4 I;  2ZJP F;  2H8W A;  2QEX I;  2QA4 I;  1VQP I;  1YI2 I;  1VQ5 I;  1VQL I;  2ZJR F;  3CC7 I;  5GAD J;  1YHQ I;  3PIP F;  3G4S I;  3G71 I;  1S72 I;  3CD6 I;  2JQ7 A;  5GAH J;  2FOW A;  3CJT B;  3J7Y J;  5DM7 F;  2E36 A;  2E34 A;  4IO9 F;  3CME I;  5GAE J;  1YJW I;  3CCU I;  5DM6 F;  3CC2 I;  1YIT I;  2NXN B;  1VQO I; 
#chains in the Genus database with same CATH topology
 5DYM A;  2IXS A;  1A36 A;  1S29 A;  2K7L A;  1X3U A;  5L3C A;  2F4I A;  2FNA A;  4L5I A;  2G9W A;  3ZMS A;  1D5Y A;  2M7A A;  3PUB A;  4E6K G;  4UXN A;  5CVV A;  4ETS A;  1G3S A;  3H3Z A;  1DDN A;  3W6K B;  4CCM A;  3QOP A;  5F1R A;  4QIW N;  1ZR4 A;  4A3B J;  3WHB A;  4KNY A;  1I39 A;  4MNU A;  3CUQ A;  3B6C A;  3QYF A;  2YU9 J;  5LBQ A;  3M3Y J;  1LUJ B;  1XC5 A;  2CYY A;  1U78 A;  2CO5 A;  2E34 A;  5F0C A;  1FYL A;  1U9N A;  4BE2 A;  4II3 A;  2DA5 A;  3LA7 A;  5DEQ A;  1LFU P;  5E3M A;  1TLH B;  2VQH A;  4NUB A;  3SZT A;  3TMO A;  2IA2 A;  3D1N I;  2VQC A;  4LLL A;  1RR8 C;  2X48 A;  2DOE A;  2X9D A;  5C4J J;  3RYR A;  2QUF A;  4DGW B;  2Y9Y A;  4LK1 F;  5HDG A;  4DBQ A;  3WG7 H;  3HSE A;  2NVX J;  2QEX I;  4XRS G;  1UHM A;  3DBL B;  2B63 J;  4BY1 J;  4HNT A;  2V26 A;  1FLI A;  4G6Q A;  4RAY A;  1W7P A;  5M5W J;  2AQF A;  5FFX A;  2TDX A;  4BAY A;  4KN4 X;  1OR7 A;  2LDU A;  3OWT A;  2DK8 A;  3ZQ7 A;  4IKF A;  3OMY A;  1IZ1 A;  1X58 A;  2HPI A;  1ETK A;  1SAU A;  2LNB A;  2HKO A;  3BTJ A;  3I58 A;  4BQN A;  2EFW A;  1O4X A;  3IH4 A;  2ZO4 A;  2W85 A;  1S7A A;  4ABZ A;  2BEO A;  2VBY A;  3K4J A;  2K02 A;  1FEX A;  1DPR A;  4A5N A;  3F8F A;  1P92 A;  3VSK A;  3JSP A;  3F0C A;  1IUF A;  3PNY A;  2X85 A;  2ZCW A;  3NQO A;  2ELH A;  3CP2 A;  3OOP A;  5CYV A;  4A0Y A;  2AXL A;  1K79 A;  1ZYR F;  2OA4 A;  4XSZ F;  1O3S A;  3HTU A;  5J1R A;  2HXI A;  4FTH A;  3H0G J;  3BJ6 A;  3S15 J;  2F5V A;  1AKH A;  2IGO A;  1C0W A;  1MBK A;  3LAJ A;  2DQL A;  1SMY F;  3LFK A;  2DFE A;  1LDJ A;  2XV4 S;  3BP8 A;  4M6Y A;  4FX4 A;  3OOU A;  3HYI A;  4B4C A;  1Y8Q B;  5F0H A;  1EV7 A;  4Q5S F;  3NWS A;  3GFI A;  4KT6 A;  2WA0 A;  2LBF B;  4A3M J;  1P4X A;  2JRT A;  2OD5 A;  5JI6 A;  1LEB A;  2WY8 Q;  2DN0 A;  3DEE A;  2P6S A;  2A6H F;  2CH0 A;  3BJA A;  3U2R A;  4BBS J;  3FZV A;  2O0Y A;  3OYA A;  4ENK A;  4HEA 2;  1D1B A;  3P7N A;  5JLW A;  2V79 A;  3F6V A;  1MMG A;  4O5V A;  2MW8 A;  2P6T A;  3QWL A;  3KP6 A;  1SFX A;  2BHY A;  5GAE J;  4HRI A;  4OOI A;  3HIF A;  1BM9 A;  5E1X A;  5CQE A;  1OKR A;  4C30 A;  2PLY A;  2ME0 A;  2XRL A;  2XVC A;  2Y0M A;  5LEJ A;  4OAZ A;  1I5Z A;  4GGG A;  5E79 C;  3KZI C;  4IHS A;  4IHV A;  1J2X A;  5HS7 A;  2XDV A;  3BR6 A;  2VBW A;  3MZ8 A;  4GXO A;  2FEZ A;  4BNC A;  3F72 A;  2K9S A;  1ZQ3 P;  4YIF A;  3DEU A;  4C3J J;  1TC3 C;  1I27 A;  3TQN A;  3CJR B;  3S3O A;  1O57 A;  2Y75 A;  2QWW A;  2BVM A;  3QP5 A;  3E6D A;  4DNC A;  3GTK J;  3ZQH A;  2PMU A;  2Q0O A;  2NS7 A;  3DF8 A;  3L09 A;  1WGX A;  4OIN F;  2HPM A;  2E71 A;  2PBI A;  1Y1W J;  3RQ4 A;  2KPM A;  3JAM Z;  1IXR C;  2R7U A;  3L2V A;  4E7Z A;  3CCS I;  4GDF A;  5HLT A;  3UR3 C;  1WSU A;  5CVI A;  4JOM A;  1ZRF A;  1FYM A;  4EJT A;  3K7A J;  2GA1 A;  4I99 C;  4CCK A;  5F27 A;  2VJI A;  2QVO A;  2WY7 Q;  4KT5 C;  3HHH A;  4ANJ A;  1RC9 A;  3IHU A;  5IP9 J;  1X1A A;  3BR3 A;  3IV5 A;  4OAY A;  4J00 A;  1H89 C;  3TO6 A;  3G3Z A;  1A6Q A;  2OAZ A;  4U88 A;  3T5X A;  1OPC A;  2K5C A;  3HOX J;  3G6E I;  2ZXJ A;  3FXK A;  2M8E A;  2I10 A;  3Q0V A;  4BUP A;  3DBH B;  1HW2 A;  3GXO A;  4IHX A;  2WAD A;  3G1M A;  3IRR A;  2X0L A;  3IKV A;  2ZXI A;  3HOZ J;  3TO7 A;  1D8K A;  2CUF A;  2HR3 A;  5AIQ A;  2NVT J;  2HZD A;  2IT0 A;  5FRO A;  1S8N A;  2IPQ X;  2XF5 A;  1TQI A;  4C2T A;  5HLI A;  4KFC A;  2VXZ A;  2RV8 A;  4KIF A;  1UB9 A;  3FWE A;  4JX4 A;  2DYS H;  2BY2 A;  1QVT A;  2EV0 A;  2KL4 A;  2YUS A;  4A5M A;  5E1Z B;  4RB2 C;  1YJW I;  4PDK A;  3H3V K;  5H20 A;  1UST A;  2BGC A;  4IOA F;  3KZY A;  5EG0 A;  3VDX A;  2L7Z A;  1RI7 A;  3FDY A;  5HDK A;  2KIQ A;  2ID3 A;  3BOQ A;  4ZYH A;  2E1C A;  2IBD A;  1VQN I;  4LD5 A;  1Z67 A;  3R6S A;  3CMY A;  2BY1 A;  4UUS B;  3MKY B;  4CA0 A;  1DU0 A;  3E5Q A;  2ZNY A;  2M3A A;  2MH9 A;  3Q3S A;  3OIP A;  2R7V A;  3FK6 A;  3CC7 I;  4HYE A;  5K5O A;  1V4R A;  3BZK A;  2ZKZ A;  1YYV A;  3EET A;  2L7M P;  2EIN H;  4NC6 A;  3I59 A;  4OU0 A;  4XLN F;  4XBF A;  2AQE A;  1L3L A;  5E1W A;  4ZTF A;  1YS7 A;  1FNN A;  3BR2 A;  3ULQ B;  4ZZL A;  1GV5 A;  1E3P A;  5HS8 A;  2Z33 A;  2H09 A;  1R4M B;  4M9Z A;  3KPH A;  4JX5 A;  2MH2 A;  1P7I A;  3FF5 A;  3I4N J;  1FWZ A;  2QSF X;  3K1N A;  4WXC A;  1IDY A;  2H8W A;  3U9G A;  2LBF A;  5EZG A;  4CXF A;  1BOA A;  5FKN A;  5HOD A;  1B8I B;  1NTC A;  4AVP A;  4I2O A;  3DPT A;  4M9S A;  3LSP A;  2O3F A;  3N97 A;  4A0Z A;  3SJM A;  3DKX A;  1RR7 A;  4YFK F;  1YJN I;  4XLP F;  1JGS A;  3WTS C;  3S3N A;  1OCO H;  2ZNZ A;  4QPQ A;  1WH5 A;  2FBH A;  3P9K A;  1G3W A;  1V5G A;  1MJ9 A;  2BXZ A;  2KJC A;  4YFN F;  2TCT A;  1YOV B;  2A6T A;  5F04 A;  1BL0 A;  3CO7 C;  4XN3 A;  5TIS C;  1OCZ H;  4IRI A;  1J75 A;  5JVG F;  4CIC A;  1PUF B;  3I9V 2;  3TKY A;  4J19 A;  1Z91 A;  4A2U A;  2BY0 A;  3F8B A;  2Z1D A;  2KRC A;  2ZXH A;  3NRV A;  1D1C A;  4L9T A;  2W1O A;  2MC3 A;  2YS9 A;  2BV6 A;  4YRV A;  2KIS A;  1HDP A;  3DTI A;  4UVC A;  1AWC A;  4D7M A;  4D5F A;  1UG2 A;  4GCV A;  2DA4 A;  2HOA A;  1LB2 A;  1Z9C A;  4KN7 X;  2R5Y A;  2H27 A;  1HSJ A;  5LGT A;  1K4S A;  1FOK A;  2DMQ A;  3VB2 A;  3PM1 A;  2QQ9 A;  1X2N A;  3WU1 B;  1NG6 A;  4GYG A;  2ELJ A;  4XKV A;  1YHQ I;  3CUQ C;  1W1W E;  4KIB A;  1BC8 C;  2E36 A;  3ZQQ A;  1VZ0 A;  3RKX A;  3EUH C;  2EBI A;  4HX8 A;  5D5V B;  5DUI A;  4LJZ F;  1X4O A;  1VFC A;  2JTV A;  4KUM A;  4R1H A;  3L7W A;  2DK5 A;  2F2E A;  2GA2 A;  1MSE C;  3OYF A;  4GRI A;  2LRE A;  1F4K A;  3JRA A;  1QZZ A;  3GO5 A;  4BYY A;  2RN7 A;  2MFZ A;  4PJN A;  4XLF A;  5EEG A;  3ZMZ A;  3HHG A;  2H1L A;  3GEZ A;  1LEA A;  3E6M A;  1AKH B;  1B1B A;  3S2W A;  4Y52 J;  1JKQ C;  3VOD A;  1QZE A;  1BI3 A;  1UAA A;  4PSX A;  3A01 B;  3ML6 A;  4CYC A;  2JA6 J;  3PFI A;  2Z9O A;  3LSH A;  2CW8 A;  3N05 A;  3RCO A;  1YW9 A;  2BY3 A;  2DMN A;  3J81 Z;  2GIV A;  3Q0U A;  3TDU C;  4EM2 A;  3GYH X;  2AS5 F;  4UNO A;  2F4M B;  3MZH A;  1NG7 A;  1V5F A;  3I53 A;  4XLH A;  4OIR F;  1GT0 C;  4E7L A;  3J7Z I;  1KZH A;  3L2C A;  1KQ9 A;  1YJ9 I;  3BTI A;  1MH4 A;  3PJR A;  2L5Q A;  3E1S A;  5KAF C;  1R5I D;  3ZN0 A;  3QPT A;  1ETQ A;  3CTA A;  2FU4 A;  3CF2 A;  1T2K A;  2FRH A;  3J81 K;  1X1C A;  4CDG A;  1Y8R B;  4ZYE A;  3I5U A;  1P2F A;  1GDT A;  2IVM A;  2PJP A;  3CMA I;  4RAF A;  4RM3 A;  4JX6 A;  1BI0 A;  5FB2 A;  1XPX A;  3DTK A;  2LH9 A;  5D8K B;  2D45 A;  1IN7 A;  3W2V A;  1R1U A;  2X6Y A;  3DKW A;  2JA2 A;  4HV6 A;  4RLF A;  4BL0 B;  3DFG A;  5AON A;  2V1X A;  5D6F A;  1TW3 A;  2ZJP F;  2WBM A;  1WJA A;  3IRQ A;  5IYC J;  3OYC A;  3RPU A;  2F5F A;  1FSE A;  4Y4R A;  1HQC A;  1MH3 A;  2CUZ A;  3W2A A;  1ETY A;  4PGH A;  4AD9 A;  2V9P A;  4EMS A;  5IPA A;  2E60 A;  1IXC A;  4I09 A;  4IRG A;  4C2M J;  2STW A;  2OZ6 A;  3JR9 A;  3LSR A;  1FMW A;  1GVD A;  4B3A A;  3S14 J;  1FOW A;  2DYR H;  2HYG D;  5L3G A;  1OJL A;  5CJ9 A;  1W36 C;  4U7B A;  4XKB A;  1MBE A;  1T56 A;  1H0M A;  1NK2 P;  2JN6 A;  1B9N A;  2L7F P;  3W6J B;  1X2M A;  1X1D A;  3QAH A;  4CZZ A;  2VOP A;  2V1N A;  2UXN A;  5D5X B;  1FIA A;  3FHN A;  2HKX A;  4XRM A;  4HV5 A;  4M71 A;  1D5V A;  4RGX A;  3RTR A;  2LSO A;  4XID A;  2MD5 A;  1P9Q C;  3AG3 H;  3JRD A;  3OYH A;  3K0L A;  3LSI A;  4BGD A;  4A3L J;  4HZF A;  1ON1 A;  2DA7 A;  1S7O A;  5F1J A;  5H6R A;  4P9F A;  5GPA A;  2RQP A;  4G12 A;  3FM3 A;  3WTZ A;  4PJL A;  1N78 A;  2A5W A;  1TT5 B;  2PJR A;  3KP3 A;  2QZ8 A;  3FMS A;  4BQA A;  4KJZ A;  3HC7 A;  5DUK A;  4F93 B;  4U0Y A;  2HEO A;  5HS9 A;  4DJA A;  2W48 A;  2EZL A;  3ONQ A;  3LSJ A;  2RNJ A;  1IJW C;  4FCY A;  1TWA J;  1W0T A;  1PJR A;  2DT5 A;  5FD5 A;  4EEF G;  4Q4Z F;  1ZN2 A;  3LNQ A;  3BG7 A;  1IUY A;  2Y31 A;  4OMY A;  2R7O A;  2DMP A;  2JT1 A;  1ORK A;  2A61 A;  2L3D A;  2GLO A;  5FKO A;  2NVQ J;  2EFQ A;  2IGK A;  1VQP I;  1W4M A;  3DEW A;  2ECB A;  1LVA A;  2FOW A;  4K2E A;  3ZMT A;  4LIU A;  1QU3 A;  4RA2 A;  1RUO A;  2ISY A;  1ZLK A;  1HA8 A;  3OS2 A;  2CQN A;  5J6X A;  4A3C J;  3BZ6 A;  2HU9 A;  2PMH A;  4HNV A;  1U3E M;  3GCM A;  4LG0 A;  3I0T A;  2E7X A;  1FTT A;  5K5R A;  2QBY A;  3G73 A;  2G7U A;  4I76 A;  4BBR J;  2FX0 A;  4EVI A;  2Z16 A;  1GUU A;  3CCJ I;  1K78 B;  3BCA A;  4IHY A;  1QNT A;  1U8R A;  4RGS A;  2BZT A;  3TL4 X;  3UNG C;  4FT8 A;  1WHU A;  4S05 A;  2GZW A;  2JA5 J;  3CDH A;  4BJT A;  3IKT A;  2UZK A;  5H2F C;  5K7Z A;  2LF7 A;  4BJ6 C;  1MMD A;  2FF4 A;  3JW4 A;  3K2Z A;  4MEX F;  3VEP A;  2Z5U A;  2IEK A;  3AAF A;  1LQ1 A;  2P8T A;  1SFO J;  3FXM A;  4OWR B;  1Z6R A;  3OSG A;  1IRG A;  4ZH4 F;  3PSF A;  3KCC A;  4UV9 A;  1R1T A;  1Z05 A;  2BHZ A;  2KDO A;  4HNU A;  2KMU A;  1HXD A;  2ACJ A;  2Y69 H;  2DQR A;  2JA7 J;  1USS A;  3LL7 A;  1JUS A;  5KHD A;  1FTZ A;  5J3L A;  2YSR A;  5LLQ A;  2XUB A;  1SD4 A;  2YU3 A;  3MZY A;  5M3M J;  2LOO A;  3I55 I;  2XAF A;  3WTT C;  1EH6 A;  2VOD A;  1UJ8 A;  3IAM 2;  3A4C A;  3E6C C;  1MIJ A;  4DZJ A;  2V1U A;  4N0B A;  2NVU B;  3BQZ A;  5GTI C;  1X1B A;  1E3O C;  2XSJ C;  4ENM A;  4KIC A;  3PQJ A;  4IRH A;  2QQA A;  3G1O A;  1MBG A;  1WJ5 A;  2VL8 A;  1DGW Y;  3RKY A;  3KX2 A;  2OUM A;  1WFX A;  3OL3 A;  4ZZD A;  4FQG A;  2P4W A;  1J59 A;  1AU7 A;  4DYR A;  3SYT A;  1Z77 A;  4MLO A;  3S1Q J;  3KLN A;  1ZG1 A;  3FMR A;  3GW2 A;  3H5R A;  3TP0 A;  2JWT A;  3K6G A;  2ESN A;  1AA7 A;  1ODD A;  2K4B A;  2K3F A;  4O3M A;  1I3Q J;  2X6W A;  3E97 A;  3ZQI A;  4IZZ A;  4HDU A;  1WJC A;  4B44 A;  2K3P A;  1I1G A;  2WAE A;  3Q9S A;  1U5T A;  4KIT B;  1TQM A;  1UMQ A;  3SQN A;  4AU7 A;  1SFE A;  4L0Y B;  3HZJ A;  4MFE A;  1BR1 A;  1FT9 A;  3OYB A;  1SEU A;  1K6Y A;  4RLQ A;  1U6G A;  3ZR8 X;  3PNT A;  1L0O C;  2JMW A;  3I71 A;  5IT3 A;  1YRN A;  3PO3 J;  4NQW A;  3CQZ J;  3R60 A;  1QHH D;  2E1N A;  2KJB A;  1SVL A;  4A3F J;  2LF8 A;  5J4V A;  2QEN A;  4BJ5 C;  5E8G A;  1T38 A;  4D0P A;  2CMP A;  2QYO A;  3HSF A;  2H6C A;  4M72 A;  5D5U B;  1ZEL A;  3CF5 F;  3S1R J;  4QSH A;  1J7K A;  1VQ7 I;  1R36 A;  2VON A;  4XOT A;  4LIT A;  2DA2 A;  2VKH A;  3PIP F;  1O3T A;  1V3F A;  1HBX G;  2CRG A;  5JR3 A;  2WC2 A;  2CSO A;  2NXN B;  2LD5 A;  2WV1 A;  2EQR A;  1UEL B;  1MDM B;  4M3B A;  4M3G A;  1IRX A;  2EFO A;  1R4N B;  3I64 A;  1ZRE A;  4G94 A;  4RGR A;  3LOC A;  4D7N A;  1PUF A;  2XPU A;  1R00 A;  1WJD A;  3AL0 C;  3I54 A;  3QYB A;  4HX4 A;  5BQT A;  3GTM J;  1ETV A;  2LY1 A;  2STT A;  4DOZ A;  2JA8 J;  1T39 A;  4XOR A;  3S93 A;  1JXS A;  3BR5 A;  3CDL A;  3KLO A;  2P5L C;  3QOE A;  1H88 C;  2VPL A;  5E3N A;  2Y2Z A;  1JKP C;  4L9J A;  5KCM A;  4G7H F;  5EEH A;  5FLX K;  5ICF A;  3HXL A;  1FX7 A;  3S8P A;  1FOY A;  5J4Y A;  2CGP A;  2OC6 A;  4EAT A;  3K4B A;  4ZDO A;  2O7O A;  2BW3 B;  2GAU A;  2E1M C;  2L0K A;  2JSP A;  5K7H A;  4XQF A;  2RVC A;  4E4H A;  5DCF A;  3V42 A;  1JE8 A;  1UFM A;  2NS8 A;  3HUG B;  4PK4 A;  1S9H A;  1O3R A;  3PO2 J;  2WTE A;  4II2 A;  3GME A;  1BIA A;  1IW7 F;  1XX5 A;  1XGM A;  2HI3 A;  2F5C A;  4XMY A;  1T08 B;  4XLE A;  3T8T A;  5LHI A;  4WCG A;  1RNL A;  3IWZ A;  2PEX A;  2HS5 A;  3CES A;  3CCU I;  1Z6T A;  4C2U A;  2R4G A;  5JHU A;  1U0J A;  1RKW A;  1ZG5 A;  3BC8 A;  3H5N A;  4PCQ A;  3CCR I;  2QBY B;  3ABK H;  4IF4 A;  1QVU A;  1E3H A;  3GZN B;  3VWB A;  5BNG A;  2K86 A;  3FXL A;  1JI8 A;  2IA0 A;  1MBJ A;  5IYB J;  2HDC A;  1KU7 A;  3I4P A;  2EZI A;  4PZJ A;  5FD6 A;  4RDU A;  3F22 A;  2DT7 B;  4BE1 A;  2ID6 A;  4ZYA A;  2K4J A;  2L02 A;  3JRB A;  4PJJ A;  4KMU X;  3O8G A;  1ZGW A;  2R7F A;  3AFH A;  2H1K A;  1V54 H;  1XGN A;  1ZLJ A;  3HPG A;  4G9Y A;  4P5O A;  3DLL F;  2D1V A;  2QSH X;  2OJE D;  3E0J B;  4I0B A;  2R7X A;  4GYI A;  4WXD A;  2Q2E B;  3O6B B;  1QZY A;  2P5K A;  4G6D A;  2EV5 A;  2FNP A;  4HDV A;  4E7J A;  2XKO A;  3FM5 A;  4I98 B;  5LGU A;  2QM3 A;  1WI3 A;  5BOX A;  2UUZ A;  2F48 A;  2RRE A;  3DPU A;  3OYN A;  3AG2 H;  4Y33 A;  3JTG A;  2KRF A;  1IDZ A;  3K1P A;  4LMY A;  4RM2 A;  3G1L A;  1ZTR A;  4BHP A;  1OYY A;  5C44 J;  1FY7 A;  2EJR A;  1IG7 A;  3CCQ I;  4HQE A;  4A69 C;  3W3C A;  4GO1 A;  5TGT A;  1Z21 A;  5GPC A;  2GOM A;  3F23 A;  1VQ6 I;  1IAW A;  3BG3 A;  3NAU A;  5L3B A;  1WI9 A;  2P7C B;  3PUF A;  5LRS A;  3H3U A;  5F64 A;  4E7I A;  3NEU A;  1SD6 A;  1YX5 A;  4B47 A;  4QTR A;  2ME6 A;  2X1D A;  2UV1 A;  3K70 D;  1XGO A;  2M30 A;  1D3Y A;  4PSW A;  2V6C A;  5ICG A;  2DFH A;  5L3E A;  5H6Q A;  1T0F C;  2HXO A;  2LR8 A;  3JTH A;  5D8L B;  5IOY A;  1QQI A;  3HKZ N;  2D2W A;  5EJC A;  1A35 A;  3ECO A;  1NH3 A;  2R7Q A;  1G6N A;  1XSV A;  1VQ8 I;  2L4M A;  4BE0 A;  5FLV A;  2HGC A;  3WTU C;  2WB1 N;  1U8B A;  1MBH A;  2IP2 A;  3Q5F A;  1V55 H;  1Z3Y A;  4HF1 A;  4WWC A;  1FBS A;  2CG4 A;  3ZRG A;  3HOU J;  1DU6 A;  4AIK A;  1FBQ A;  4EM1 A;  3HSR A;  4M3F A;  1BIB A;  2G7H A;  3DCF A;  3HB9 A;  1TW2 A;  2XAJ A;  2L9R A;  2M4G A;  1VQO I;  1IN6 A;  5DTD A;  3GZ5 A;  2V4J C;  4UUV A;  1S6L A;  4R8H A;  2O61 A;  4EJW A;  4CZC A;  2HQ5 A;  1Q1H A;  4N4N B;  4U0V A;  4IHW A;  2JPB A;  2L01 A;  1OQY A;  5CPR B;  2GXB A;  2FQ3 A;  2EIL H;  2FUG 2;  3M8E A;  3JSO A;  1NHA A;  1FBU A;  2VPR A;  2DLL A;  1YG2 A;  4IL6 C;  4H4K C;  1IRF A;  3U21 A;  1G4D A;  3DU6 A;  2DA1 A;  3F6O A;  2VE9 A;  4W97 A;  1ZK8 A;  3BT9 A;  1T98 A;  2O03 A;  1MDM A;  3JRF A;  2M8G X;  3E5X A;  1OCR H;  3KP7 A;  4A3I J;  2F6C A;  3KP2 A;  4EGY A;  3CZ6 A;  2DJN A;  1IN5 A;  3EUK L;  1XD7 A;  3GFL A;  2O8X A;  1NK3 P;  2KQR A;  2L9S A;  1Y0N A;  2EFN A;  1TBX A;  2QCO A;  1RET A;  2IS1 A;  1TZL A;  2CFX A;  3BJO A;  2DXI A;  3FIW A;  4Q47 A;  5J47 A;  4KIG A;  2XGE A;  4QLC U;  3HOY J;  3V7R A;  4IVN A;  3H92 A;  3W2W A;  5BMZ A;  3EQL F;  4L5J A;  2P0W A;  1R22 A;  1WQ2 A;  3A0B C;  4AYB N;  4D5C A;  4N9H A;  5K1Y A;  1XMK A;  3PNV A;  4BH9 A;  1CGP A;  2HOT A;  3PFY A;  2DBB A;  4PJ0 C;  5LRR A;  3S1M J;  4KDP A;  2VKV A;  2QKM B;  2VUM J;  3H9J A;  2R7T A;  2K85 A;  2WAQ N;  3LMM A;  5FFZ A;  2LKX A;  2L9V A;  4BEH B;  2DFI A;  1JKO C;  5L3F A;  2LYC A;  3IH3 A;  1YE9 A;  4L9N A;  1OFC X;  3OSF A;  2E2J J;  5FRM A;  2RKH A;  3DLA A;  5DCM A;  1HW5 A;  2XC7 A;  1IC8 A;  3RKQ A;  4HOB A;  3GVA A;  2M4K A;  4XRF A;  5C4X J;  3K9T A;  4MHG A;  2DTZ A;  4HBL A;  2DT6 A;  1D8J A;  4Z2Y A;  2GBY A;  5B1A H;  4CCL A;  1XB4 A;  2PQ8 A;  3FMQ A;  2EIJ H;  2HOE A;  5FKK A;  5ICE A;  3DV8 A;  3EYI A;  1G2H A;  4IEJ A;  1YTY A;  2M2E A;  4PJM A;  3OS0 A;  2ZJQ F;  2KRH A;  2VQL A;  4W1U A;  1JHH A;  2Z3Y A;  2XSD C;  4BKX A;  1MZB A;  1VTN C;  1IV6 A;  2COM A;  4S0H B;  1T8I A;  5GTH C;  4ESF A;  3U1K A;  1GVJ A;  2KFD A;  1XDS A;  2OV7 A;  3HBL A;  4E7H A;  2R93 J;  3C1D A;  1RZ4 A;  1I3A A;  2W84 A;  2NOG A;  3UKG A;  1ZRD A;  1GXQ A;  3DPL C;  2M1B A;  4OIQ F;  4CYC B;  1I6H J;  2BXY A;  2Z2S B;  2PMZ N;  1T95 A;  4G7Z F;  1R5G A;  2P7V B;  2GOX B;  2HDW A;  2AO9 A;  3A0H C;  3C7J A;  4HSR A;  2OCE A;  1H9G A;  1KQ8 A;  5TJJ A;  1HW1 A;  2A3S A;  3O3K A;  4I6Z A;  1VQK I;  4KIS A;  1TT0 A;  4QPO A;  2DJI A;  2KDZ A;  1S72 I;  4ZDP A;  3MMY B;  4LB6 B;  2FJ1 A;  1K61 A;  5D6E A;  2R5Z A;  3WGI A;  4A3D J;  3EUH A;  3C18 A;  2MC4 A;  4Q48 A;  4D9J A;  4HF0 A;  3LQR A;  2JUG A;  1YIJ I;  2GWR A;  3BLY A;  3GFM A;  1SMT A;  3GX4 X;  2FBK A;  3ASN H;  2EPF A;  2B7E A;  2VBX A;  4V2G A;  4A3G J;  2CUJ A;  2OF7 A;  2ZFW A;  3MKW B;  4LK0 F;  3CC4 I;  1HKT A;  2CJJ A;  2KP6 A;  1MNE A;  4NC7 A;  2OPT A;  1ACI A;  3ZXS A;  2BW3 A;  1BW5 A;  1MNM C;  2IAI A;  4LG3 A;  2CQK A;  4CCJ A;  3C2G A;  5EEA A;  2ETH A;  3K4L A;  1KYW A;  2L2O A;  3R0J A;  4M6V A;  3OIQ A;  3VFZ A;  4A93 J;  2NOJ B;  3GFJ A;  3CC2 I;  1WRJ A;  1TP4 A;  2QLZ A;  1W5S A;  3BZC A;  3SZG A;  5FLX Z;  1O3Q A;  3KYD B;  2E2H J;  4BY7 J;  3SEQ A;  3WOD F;  2OCC H;  2OBP A;  3J7A O;  4M9X A;  2XPW A;  3HRS A;  3MVP A;  1JGG A;  1OYI A;  3L2R A;  1WVR A;  1LDD A;  1Q1V A;  4N9I A;  2DA6 A;  5F6F A;  4U7D A;  1HF0 A;  1HDD C;  1P4W A;  1B4A A;  1K6O A;  1X4P A;  1UHW A;  4YEL A;  1XDU A;  3IH2 A;  3A01 A;  1BI2 A;  4E70 A;  4BU2 A;  4A6D A;  2E5Z A;  2X1E A;  3PQK A;  2EV6 A;  4C3I J;  2LTP A;  2QGU A;  2GM4 A;  1ETX A;  1P6R A;  4EQQ A;  4YII A;  1X19 A;  1E17 A;  3B73 A;  2RGV A;  2LKP A;  2XF7 A;  5CVU A;  4NQW B;  4IQJ A;  3P9I A;  2M45 A;  3MFK A;  1BBY A;  4RBO A;  3RPU D;  1DPU A;  2DOD A;  2IS2 A;  3D0S A;  1QA6 A;  3WU0 A;  4F55 A;  1WCM J;  4TV7 A;  1KGS A;  3W6V A;  4M6X A;  1I6X A;  3C2B A;  2QQ8 A;  4B48 A;  5GAD J;  2L54 A;  2K27 A;  3OY9 A;  3OYL A;  2JQ7 A;  4RMN A;  2F5D A;  1ZAR A;  3HM5 A;  2PJR B;  1TWF J;  3BG5 A;  2RAE A;  2M7B A;  5DS9 A;  4ZJZ A;  2IRF G;  2O8K A;  2GXG A;  5IT9 Z;  1ETW A;  5DCM B;  3FXQ A;  1UHS A;  4UB8 C;  5K5Q A;  2IA1 A;  3WU2 C;  3KEO A;  1VQ9 I;  1D0Z A;  4XLC A;  4CUG A;  2VQG A;  4MQV A;  3KZZ A;  3T1B A;  2D5V A;  4LB5 A;  2VE8 A;  3KE2 A;  2MSY A;  5KAI C;  1MKM A;  5BPI A;  3I59 B;  1G59 A;  2VC0 A;  1MBF A;  3X2Q H;  4FIS A;  4NDL A;  1VND A;  3V4G A;  4CH7 A;  1Y39 A;  2NRA C;  1K83 J;  3VSL A;  3BPX A;  3SZP A;  1AOY A;  2W00 A;  1LE8 A;  3ZOB A;  3B02 A;  2HQN A;  2O5R A;  2XAU A;  1OCP A;  3Q0W A;  1ERD A;  4UHT A;  1FOX A;  1OIS A;  3H1C A;  1D0Y A;  3H9Q A;  1QGP A;  4XIC A;  2MYS A;  3FXU A;  1LKX A;  5EZH A;  2DCE A;  3S2H J;  2D1H A;  3FX3 A;  5HVQ C;  5EF6 A;  2LRD A;  2XB5 A;  3ZQC A;  2XF6 A;  5HLH A;  2XHK A;  2MG4 A;  3JRI A;  3BDD A;  3H35 A;  2DMT A;  4DBR A;  4XSX F;  3OYD A;  4MO7 A;  5FRN A;  2LG4 A;  2X1C A;  2OZU A;  3PIO F;  1QPM A;  4G6T B;  3BY6 A;  1B9M A;  2DPD A;  2R5Z B;  3I56 I;  1W36 D;  1UG0 A;  3FXJ A;  4M3E A;  5M5Y J;  1YI2 I;  1KON A;  2E5N A;  3RQI A;  3QOD A;  4AUX A;  1R5H A;  3RDI A;  1KU9 A;  3O8H A;  1JT6 A;  5ERI A;  1YQA A;  2B0L A;  2KIM A;  1GV2 A;  2V7F A;  2ZME B;  4L18 B;  1LE8 B;  2GIZ A;  3H9G A;  3M7G A;  3FBN B;  2G0E A;  2HYF A;  2I5U A;  1G3T A;  3RPQ A;  3IL2 A;  1J9I A;  5KNL A;  4U0W A;  2QQB A;  4LIV A;  3ZN1 A;  3TED A;  4MEY F;  3H36 A;  1U9O A;  3BTL A;  2X4H A;  3ISP A;  1TL8 A;  3CCY A;  3TW7 A;  3LQQ A;  3SFI A;  4F3Q A;  1ON2 A;  2EFP A;  4FX0 A;  5L3D A;  5EGO A;  3HRM A;  4WX9 A;  2DOF A;  3GWZ A;  3V8K A;  2HNH A;  2R7Z J;  2W7N A;  1GXP A;  1JUM A;  4AWX B;  1Z3X A;  3HDD A;  2K40 A;  2PFB A;  5BPD A;  4P9U A;  5DD8 A;  1Y56 A;  3KP4 A;  1VI0 A;  1EKE A;  2W24 A;  3JRC A;  3S2D J;  3SEZ A;  2V9K A;  1FSH A;  1PUE E;  3M1E A;  3KYL A;  3JRG A;  5DDG A;  3L2Q A;  2BBY A;  5D4S A;  4XKC A;  5LGN A;  3SDG A;  2FXA A;  3HGG A;  3HOT A;  1REP C;  2XIG A;  1W7P D;  3BQY A;  3QU6 A;  4X0G A;  3WTX C;  3H0D A;  1HKS A;  1EF4 A;  4BDZ A;  2VIX A;  5D4R A;  3I4M J;  5AIP A;  5K7F A;  2JVG A;  4UY8 I;  2R92 J;  1FP1 D;  1ZR2 A;  2HTS A;  1BA5 A;  5J8C A;  1ZAO A;  3KYC B;  1ZG3 A;  2A6E F;  2ISZ A;  1SC7 A;  3NAR A;  4WXH A;  1DQU A;  3G2B A;  3QQA A;  4F52 A;  2HOS A;  3HRT A;  5CLS A;  2LP0 A;  2DTR A;  1CQT A;  3HEF A;  4S04 A;  6PAX A;  1W5C C;  3WGH A;  3CUQ B;  5B3S H;  1X1P A;  3WE3 A;  3GTO J;  5ICC A;  2HFH A;  2A07 F;  3KEQ A;  2EK5 A;  3PL8 A;  2UWM A;  3LA3 A;  1E2X A;  4DZP A;  5IT9 K;  5LFA A;  3LA2 A;  5D5W B;  4JQF A;  4PFO A;  2JVH A;  5IY5 H;  1LVK A;  1OYW A;  4RAG A;  4XON A;  2K9N A;  2EH3 A;  3VOE A;  3QP6 A;  2RDP A;  1RPW A;  3F9K A;  3KEY A;  3MCZ A;  1XN7 A;  4L5E A;  3MEX A;  4BHC A;  3FK7 A;  1PVE A;  3OS1 A;  4LLN A;  2FSW A;  3AL0 B;  2LKS A;  4C9Y A;  1T6S A;  2VJJ A;  4XM3 A;  3MAJ A;  4P96 A;  2N8G A;  4NHJ A;  2YX4 A;  3ZQG A;  2BVL A;  1POG A;  3L9F A;  4HLY A;  1AHD P;  1SVM A;  3RSN A;  3D5L A;  3CCV I;  1QO0 D;  5EYR A;  2JZY A;  3OYM A;  4ZC3 A;  2NAZ A;  3K4C A;  2X6O A;  4C3H J;  2HWV A;  1FPQ A;  4A0X A;  1YS6 A;  1B59 A;  3GLX A;  2PG4 A;  1YRN B;  1X3W B;  1J5Y A;  4JBA A;  1HOM A;  3NWT A;  1S5L C;  3G71 I;  5IP6 A;  4A12 A;  1F36 A;  3Q9V A;  2BYV E;  3OR1 C;  5BS6 A;  2HVR A;  2Y30 A;  4NC8 A;  1XTA A;  1IN4 A;  1MGT A;  4F7Z A;  4MGR A;  3TGN A;  2CU7 A;  1DGR M;  2VT3 A;  2R7D A;  2OTL I;  5FGM A;  1R6R A;  2XB0 X;  4H0E A;  1P4A A;  3VYR B;  4AVZ A;  4RB3 C;  1T33 A;  3ABU A;  1K7A A;  1BOB A;  4RB1 A;  2KIF A;  3K70 C;  5HNH A;  2NNN A;  1HC8 A;  1U2W A;  5TRD A;  2VBZ A;  4LFU A;  2VC1 A;  3KFW X;  3FXR A;  2CW0 F;  1RRJ A;  1WJB A;  3SXY A;  3VYU B;  1IN8 A;  1XSD A;  3ESW B;  4FET A;  4A3E J;  3CP8 A;  1B6A A;  4QWQ A;  3CME I;  1YW8 A;  3BCB A;  2VT2 A;  1ETO A;  1HST A;  1ZGJ A;  2YR2 A;  2L4A A;  2M9H A;  2CS3 A;  1HCR A;  3K10 A;  4EM0 B;  5FKL A;  1SFK A;  2HTJ A;  2E7W A;  1EH8 A;  3J80 K;  4XLA A;  3QU3 A;  1YX3 A;  4OIP F;  2FBI A;  3I3L A;  3CCL I;  1VF9 A;  2IS6 A;  4CYD A;  1E0E A;  2DFF A;  2YPR A;  2R7W A;  4KYW A;  2HQR A;  1W7P B;  2W4S A;  3S17 J;  2XRO A;  3LFU A;  3GTJ J;  1U5T B;  5ED4 A;  1TNT A;  2Q2E A;  3V7C A;  4X6A J;  2A5Y B;  5B1B H;  4IOC F;  4HX7 A;  2Z99 A;  3P5J A;  4A3J J;  4XNF A;  1JUP A;  4BQO A;  4ZYG A;  2VAS A;  5HDN A;  3GLL A;  4F92 B;  4LGW A;  3GZ6 A;  2KLO A;  3GTL J;  1IGN A;  1ZGA A;  2LFB A;  1RUN A;  4N4O B;  2ZC2 A;  2R5Y B;  4ESB A;  3HG9 A;  4RAZ A;  4M73 A;  1D0X A;  3A2K A;  3ERE D;  1OLT A;  2FOK A;  3C2H A;  3V8J A;  4HA8 A;  2DDA A;  3WG9 A;  5IYD J;  1I50 J;  2J5P A;  1IO2 A;  1JTY A;  4HQM A;  3RIR A;  4B09 A;  1G8X A;  3WTW C;  1OMI A;  3CCE I;  5ILS A;  1PP8 F;  3HOS A;  3CMM A;  5ILV A;  3OV8 A;  1TTY A;  3BTC A;  1BN5 A;  1O7F A;  1T0F A;  3DU5 A;  4LLG F;  1TWH J;  2H94 A;  1HKQ A;  2VI6 A;  2ZFU A;  2OTJ I;  2HZT A;  3DWL E;  2GXA A;  4AIJ A;  4MFD A;  2E1O A;  3SHF A;  1HLV A;  4B3X A;  1XSX A;  3CCM I;  4DYQ A;  1F5T A;  4FE7 A;  2KZV A;  3GTQ J;  3RJP A;  3MWM A;  3OIO A;  3FBI B;  3LWF A;  2A69 F;  2XAH A;  3AG4 H;  3ZGK A;  5J1Y A;  1LPQ A;  5E8I A;  5LEK A;  3SFZ A;  3J80 Z;  2KT0 A;  5J8F A;  2WWY A;  1RKT A;  1TQP A;  4Z6Y A;  4RGU A;  1Y0U A;  2V1D A;  1ITY A;  3GBG A;  2MLK A;  4JK1 X;  3HRU A;  2VJ5 A;  2W82 A;  3K2A A;  3MQ0 A;  4Y15 A;  2MLG A;  2WAQ A;  3HKZ A;  2ZSH B;  3CO6 C;  3E5U A;  2AHQ A;  3BPV A;  3C3W A;  3M1C A;  5E3L A;  5FO5 A;  2LK2 A;  3R0A A;  3LST A;  4XL9 A;  3TOA A;  4I7H A;  5E3O A;  1PDN C;  3G4S I;  3K4N A;  3QPS A;  2CFO A;  4G8X A;  3IP4 B;  3U1D A;  2CQQ A;  2KIU A;  5M3F J;  4NB5 A;  1W0U A;  3AG1 H;  2EA2 A;  2B9S A;  4XOP A;  1EH7 A;  4FHT A;  5GP9 A;  4YG2 F;  3RZO J;  5J1U A;  2MD0 A;  1WH7 A;  3KP5 A;  4UVB A;  2W25 A;  3ERM A;  4UUT A;  4XK4 A;  4A3K J;  2MA3 A;  4XN0 A;  4V19 K;  3D5R C;  2EZK A;  2ZB9 A;  1SD7 A;  3FXO A;  1J09 A;  3F8N A;  3EDP A;  4PFP A;  4JP0 A;  2DA3 A;  1X3Z B;  1R7J A;  2ZME C;  3FKI J;  2VXD A;  5HOO A;  3R61 A;  4EV0 A;  4M3D A;  3CJT B;  1LFP A;  2PX9 A;  2ADU A;  2JUC A;  4ESJ A;  4MIM A;  2W57 A;  4CGZ A;  3LAP A;  4B8X A;  1KA8 A;  2ZJ2 A;  2Y0S N;  1CF7 B;  1MSF C;  1STZ A;  4Y17 A;  3HL2 A;  1BI1 A;  1FIP A;  1U5T C;  1IV8 A;  1LFB A;  4UVA A;  1VQM I;  2K9L A;  5C3E J;  1A04 A;  1WJE A;  2QA4 I;  3S32 A;  1TWG J;  2R0Q C;  3CLQ A;  1KQ0 A;  2CQ7 A;  3J7Y J;  1BJA A;  1Y1V J;  1QHG A;  2Y48 A;  5KVR A;  5IOZ A;  2X51 A;  1GLN A;  2LLK A;  3A1Y A;  2FA5 A;  4V2F A;  4X1E A;  2JK3 A;  2RNG A;  3SDB A;  3K4K A;  4UUS A;  2X6X A;  1V5E A;  3FKJ A;  2XPV A;  2PN6 A;  2BE5 F;  2P81 A;  4HW0 A;  3L1P A;  3E3V A;  1RIO H;  3ASO H;  4PUS A;  5DD4 A;  1B72 B;  4L9V A;  3VYT B;  3O2P E;  1Y6I A;  3GF2 A;  3QPH A;  3S3M A;  1VQL I;  2DPU A;  1WZ2 A;  3REO A;  3EYY A;  2VOO A;  3DKY A;  3ROU A;  1EJ9 A;  2ZME A;  1XCV A;  3LSK A;  3KIO A;  1IXS B;  3HPH A;  2KKO A;  5E18 F;  3D5S C;  4IQ4 A;  4AIH A;  1TWC J;  1N25 A;  1R23 A;  1H8A C;  1FMV A;  2EB7 A;  1QRY A;  2KHM A;  1A6I A;  3ZMD A;  2XRN A;  3BR1 A;  3K4M A;  4EJO A;  3B6A A;  3ZMU A;  1DUX C;  4NBQ A;  3ECH A;  4XKW A;  1FC3 A;  2H6B A;  1SAX A;  4O6J A;  4L0Z B;  1F9N A;  5JFR A;  4Y3O A;  5HNF A;  4IO9 F;  4ZYD A;  2V9V A;  1QPI A;  1S3J A;  3OYI A;  5B5E C;  3CJQ B;  1XG1 A;  3JRH A;  3RYP A;  1YW7 A;  2R3S A;  1FYK A;  1MW7 A;  4CSW A;  2RC4 A;  5FJ8 J;  3MKZ A;  2FMY A;  4CCN A;  3HTS B;  4I02 A;  2LY9 A;  5CVJ A;  1CF7 A;  4EJV A;  3A02 A;  4YEJ A;  4MQ9 F;  5J40 A;  1P7J A;  4JYK A;  2JJ7 A;  4U87 A;  2DI3 A;  1PYV A;  3CDI A;  1BC7 C;  1DP7 P;  2ZJR F;  2Y9Z A;  3CD6 I;  4EGZ A;  4WF2 A;  3BG9 A;  2LVS A;  4ENN A;  1BR2 A;  2ZSI B;  3CLO A;  3TOB A;  4BHB A;  5DM6 F;  1BW6 A;  2FML A;  2NS0 A;  2VB6 A;  3TO9 A;  3ABL H;  2BOL A;  2XAQ A;  3IUO A;  2M0C A;  2VKE A;  1MD0 A;  3WTV C;  3HGY A;  2ICW G;  4E7S A;  2IS4 A;  2LMD A;  3CUO A;  2XKP A;  2RQQ A;  4Y7N J;  2JSC A;  1UZC A;  2TRT A;  1JT0 A;  1MJA A;  2FQ4 A;  1J0R A;  1R1V A;  4DYC A;  3GTP J;  3HUG A;  2HVQ A;  1ZRC A;  3MN2 A;  3JCU C;  3QYE A;  2DO7 A;  1ENH A;  3OYK A;  2ECC A;  1O7L A;  4XR6 A;  3M9A A;  2E2I J;  3HJE A;  5CKT A;  3F8M A;  2H8R A;  1Z7U A;  2R7S A;  1RES A;  4HST A;  4MTD A;  4D1Q A;  1ONV A;  4BEH A;  3KET A;  1R49 A;  4BXF A;  3S1N J;  2IGN A;  1YLF A;  2Q1Z B;  3EUA A;  4IXA A;  2A68 F;  2CWE A;  4FE4 A;  1YO5 C;  1VQ5 I;  4KMF A;  1MJB A;  1ZHF A;  2J5O A;  2XGD A;  3K1M A;  1UCR A;  1ULY A;  1XMA A;  5JLX A;  2WV0 A;  1D1A A;  5A2Q K;  2XGX A;  1A31 A;  4XRS A;  4BDY A;  4UV8 A;  1FJL A;  3BG6 A;  4OMZ A;  1SD5 A;  4BXX J;  3JAM K;  2ZXW H;  4YFX F;  3RKW A;  2NYX A;  3OYJ A;  2L7K A;  3WE2 A;  1MND A;  4IX7 A;  1BJZ A;  2OQR A;  2O9L A;  1YIO A;  5LHH A;  2YX7 A;  1KYZ A;  2DAO A;  3OYE A;  5KK1 A;  2I8D A;  2R7R A;  3HOV J;  4DW6 A;  3M4O J;  2VJ4 A;  1EA3 A;  3WTY C;  4ASN A;  2VLA A;  1JJ8 C;  2HYJ A;  5E20 A;  1XMX A;  3OL4 A;  4NNJ A;  5IP7 J;  4M74 A;  3N4M A;  2M0M A;  2VKD A;  2QSG X;  3DXJ F;  3EPZ A;  1ZKG A;  2FE3 A;  2NNY A;  3BRO A;  2ZBK A;  4MTE A;  3F3X A;  1B72 A;  4E7K A;  2DU9 A;  2XAG A;  4HLX A;  2ELK A;  2L9N A;  1LJ9 A;  3PSI A;  1B8I A;  3DBR B;  2A05 A;  1IRZ A;  1OCT C;  3H5A A;  3TW6 A;  5GAG J;  4AC0 A;  3M07 A;  4CHU A;  3QPL A;  4B43 A;  4BQQ A;  2CUE A;  2EZH A;  2E1M B;  4A6E A;  2Y0S A;  4ZDL A;  3WHC A;  2GQQ A;  4UB6 C;  2CV1 A;  1WKM A;  2XGC A;  1Z0X A;  2QF7 A;  5CVR A;  3R4K A;  4FAS D;  5FKM A;  3TP3 A;  2IW5 A;  4DIQ A;  4F91 B;  4ON0 A;  3IWF A;  2PI0 A;  4HF2 A;  2P5V A;  2IGM A;  3ZQF A;  3K69 A;  1GHC A;  2XAS A;  2CV0 A;  3ABM H;  4LG0 B;  4KA4 A;  1R71 A;  1JJ6 C;  2O6G E;  1F1Z A;  1M1E B;  1QBJ A;  2K9M A;  4BS9 A;  1N77 A;  2E35 A;  2LY2 A;  2JRM A;  3J7A Y;  3DTE A;  3LSG A;  2CQX A;  2JPC A;  2HVS A;  2MAB A;  4HG2 A;  5JHF A;  3OR2 C;  5FLM J;  5GAH J;  1OR7 C;  5DM7 F;  4R79 A;  3DP7 A;  3WGG A;  2COB A;  1K78 A;  1YIT I;  1SVO A;  1KU2 A;  2EWN A;  2LC2 A;  1A5J A;  1JKR C;  2ESH A;  4Y13 A;  2CW7 A;  2E19 A;  2MGQ A;  3MD2 A;  4CO8 A;  1OCC H;  2WB1 A;  3ZP5 A;  3COA C;  1R9T J;  2DDB A;  4HPQ A;  3L00 A;  3V7S A;  1ZH5 A;  5EG0 B;  4EJU A;  1MMN A;  1WJF A;  2AXT C;  3L2W A;  5M5X J;  3ZPL A;  4AID A;  4G7O F;  4I01 A;  4DQ2 A;  5HLG A;  1N75 A;  5JVT A;  1XCB A;  3ELK A;  2OU2 A;  3M8F A;  2UXX A;  2PMZ A;  1FP2 A;  3AKZ A;  3F21 A;  4RS8 A;  2K9Q A;  3V8L A;  3JRE A;  1IF1 A;  4AM3 A;  4P1W A;  2QKL B;  4J01 A;  1G3Y A;  2EA4 A;  1DP3 A;  4HAM A;  3FIS A;  3HOW J;  3QRF F;  1JHF A;  4AYB A;  1H9T A;  2WAF A;  1TNS A;  4OIO F;  1KU3 A;  3GTG J;  9ANT A;  2M87 A;  2HQA A;  1FZP B;  3BR0 A;  3A03 A;  1R58 A;  4LOC A;  3F8C A;  3T8R A;  1LDK B;  3GUD A;  1BR4 A;  3TDZ C;  1MMA A;  1VQ4 I;  2V6E A;  5F08 A;  3LSM A;  4B1R A;  1APL C;  3RZD J;  5LHG A;  1YFH A;  3RI4 A;  3ZQL A;  1F43 A;  2M5W A;  1SAN A;  5CQG A;  5EDN A;  2EIM H;  3ZCO A;  4BXU A;  5E17 F;  2M34 A;  2DMU A;  2C6Y A;  1MMS A;  5ILU A;  3S16 J;  3P9C A;  2HDD A;  3BWG A;  3E6B A;  5EGO B;  1SFU A;  2DOA A;  4IHT A;  2Q8K A;  3M8J A;  4YIR X;  4ENJ A;  2OQG A;  3FHZ A;  4I0A A;  2DW4 A;  3CJN A;  5A2Q Z;  1LNW A;  1WPK A;  1JTX A;  3IAS 2;  4IPA A;  1Z1D A;  4IJA A;  5B66 C;  5LD2 C;  1I1S A;  5DV5 A;  1S7E A;  2IJL A;  2NVY J;  3ABT A;  3MKL A;  1W5T A;  4ITV A;  3T0Y A;  4ZTJ A;  1Z7L A;  3VPR A;  3L2U A;  2CV2 A;  4CCO A;  3OYG A;  1K4T A;  2MBF A;  1XGS A;  3IC7 A;  1XS9 A;  5F0F A;  4WK8 F;  2F4O B;  2EIK H;  2VN2 A;  3DQV C;  1WWX A;  3TBI A;  4RB0 A;  4PGG A;  2FD5 A;  3VYS B;  3ZMV A;  4GFB A;  2F5E A;  4BAC A;  2KZG A;  3E7L A;  4P55 A;  1PP7 U; 
#chains in the Genus database with same CATH homology
 3CMA I;  3G6E I;  1YJN I;  1FOY A;  3CCE I;  4IOC F;  1YIJ I;  1Y39 A;  3CCR I;  3CCS I;  4UY8 I;  2OTL I;  2K3F A;  3CCV I;  3I55 I;  1MMS A;  4IOA F;  3CCQ I;  4V19 K;  1FOW A;  1VQ8 I;  1VQN I;  2OTJ I;  3DLL F;  3PIO F;  3CF5 F;  2ZJQ F;  1QA6 A;  3J7Z I;  1VQ9 I;  3CC4 I;  3I56 I;  1VQ7 I;  1VQ6 I;  3CCM I;  1VQM I;  1FOX A;  1YJ9 I;  3CCL I;  5JVG F;  5GAG J;  1HC8 A;  2E35 A;  3CCJ I;  1VQK I;  1ACI A;  1VQ4 I;  2ZJP F;  2H8W A;  2QEX I;  2QA4 I;  1VQP I;  1YI2 I;  1VQ5 I;  1VQL I;  2ZJR F;  3CC7 I;  5GAD J;  1YHQ I;  3PIP F;  3G4S I;  3G71 I;  1S72 I;  3CD6 I;  2JQ7 A;  5GAH J;  2FOW A;  3CJT B;  3J7Y J;  5DM7 F;  2E36 A;  2E34 A;  4IO9 F;  3CME I;  5GAE J;  1YJW I;  3CCU I;  5DM6 F;  3CC2 I;  1YIT I;  2NXN B;  1VQO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...