2L2OA

Solution structure of human hspc280 protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKSANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQDLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords UPF0727 protein C6orf115
publication title Solution structure of the human HSPC280 protein
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14705 Costars Costars
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l2oA00
2KRHA 2L2OA
chains in the Genus database with same CATH superfamily
1X1CA 3R6SA 4CO8A 4QPOA 5BNGA 2M7BA 1UHMA 2STTA 2F5CA 4EVIA 2GA2A 4E7SA 1XGOA 3Q9VA 2HPMA 2XGCA 4L0YB 3D0SA 4QPQA 4C30A 1U8RA 1ITYA 4ZDPA 2ELKA 4IX7A 1G3TA 4RAZA 2EA2A 5J1UA 2BXYA 5EZGA 4BE2A 4UUSB 5LD2C 3G6EI 4MFDA 2A6HF 5EDNA 1ZR2A 2JA5J 2BXZA 3H3ZA 3U1DA 2HVQA 1SFOJ 2ISYA 2ZJPF 1LVAA 1RKWA 3G1MA 5GAGJ 2E1NA 3A01A 1YRNA 2CS3A 2GOMA 2HOTA 4AVPA 1ERDA 1BBYA 5LGTA 1GDTA 5AIQA 3C2HA 3VWBA 1DQUA 1WHUA 2QM3A 4X6AJ 4NDLA 2M0MA 3ZMSA 4I2OA 1Z1DA 1SAXA 1LDDA 3KEQA 2HKXA 4BDZA 3KP5A 2PBIA 3GO5A 1B59A 1WSUA 2EINH 2KL4A 3WTWC 1YOVB 1H9TA 1DP3A 2IS1A 3H5AA 2FEZA 2IPQX 3GZ5A 4B48A 2CG4A 3ULQB 3VDXA 1XGSA 5J1YA 1JTYA 4XKBA 1T0FA 3QP6A 1B8IA 3SFIA 4LB5A 1TT0A 1ZQ3P 1R1TA 2EQRA 2EJRA 2BZTA 2Y69H 4DQ2A 3KP2A 3AG1H 5F04A 3ESWB 2MBFA 3BY6A 1IN8A 3BCBA 2O8KA 1J9IA 4MGRA 3Q5FA 2FQ4A 2IXSA 2BEOA 2QSHX 4WXHA 2MD5A 3FXMA 2P7VB 2WAFA 1EH6A 3DEWA 3EYYA 2DFIA 4OWRB 2Y9ZA 3T0YA 1RUNA 4Y33A 2W00A 1MMNA 3I71A 3CCJI 2Y9YA 3FISA 2K4BA 3RQIA 1D0YA 3JRFA 3KYLA 3CUQB 4FQGA 4CZZA 3HOWJ 1ETKA 3PSIA 2OA4A 5HLTA 2XPVA 4ZYHA 1R9TJ 2B9SA 3N05A 2H1KA 1WJDA 2ZSIB 1U5TB 4RS8A 4DZJA 5D4RA 5B66C 1X4PA 3PUBA 2IS6A 5J1RA 2RQQA 5DUKA 5CVUA 3V8KA 2GZWA 1F9NA 2CQKA 2DODA 1O3RA 4A0XA 4HV6A 4QTRA 4ANJA 2K9QA 1ZLJA 3DBLB 4DBQA 3MWMA 3RKXA 2CRGA 3CO6C 3L2WA 4DYCA 2K4JA 4ITVA 4ZH4F 1LEAA 3CQZJ 2E1MC 4J19A 1MJAA 2LC2A 1K6OA 3PIOF 2VLAA 4KT5C 2JUCA 1DU0A 1HKQA 1JUPA 2R3SA 2M4KA 2FF4A 2KHMA 2RC4A 2JA2A 3OIOA 3TMOA 5LFAA 2WBMA 1K61A 3PO2J 2DO7A 1FSEA 3BZ6A 5E3LA 2ZBKA 1VI0A 1G3YA 3GW2A 3SDBA 5JHUA 2VPLA 2A6TA 4I99C 2YX7A 1BI0A 1A31A 2K5CA 4HSRA 3C7JA 1P2FA 4BH9A 3CDIA 1TZLA 5K7HA 4ASNA 3OYLA 1SMTA 2LMDA 2E2JJ 4M3GA 4HSTA 1PVEA 2HZTA 1IN7A 3O6BB 1VQMI 1POGA 4UVCA 4A5MA 2V6EA 2UUZA 1R7JA 1EV7A 3MAJA 3HYIA 2LY9A 4PJLA 4C3JJ 5ILVA 3CCRI 3LMMA 2VL8A 3SEZA 3MD2A 3HOZJ 4II3A 4M71A 3HOYJ 2L7ZA 2CO5A 1N78A 2IEKA 2DXIA 2RDPA 2XDVA 3I9V2 1AU7A 3BG7A 4HPQA 1K83J 1S7EA 1ZGJA 1BJAA 4PUSA 1YFHA 3HRMA 1ZR4A 2VT2A 1MJ9A 1Z7LA 1O3TA 1BL0A 2V1XA 2WAEA 3TO6A 1V4RA 4A3FJ 5F1JA 3IH3A 1KZHA 3RDIA 1BA5A 4UVBA 1VQ6I 2HXOA 1Z21A 2XHKA 5F0FA 4A5NA 4UUSA 2LR8A 1TNTA 4L5JA 4O5VA 3HOXJ 2E19A 5C44J 4BE1A 3DLLF 1VFCA 1TT5B 1FYMA 1LFBA 2L4MA 4PJJA 2TDXA 3VYSB 2L3DA 4G7OF 3UNGC 1U5TC 4ENMA 2PJRB 2OQRA 3ZQLA 3IL2A 4FT8A 2L02A 1TW3A 4AM3A 2HYGD 4YIFA 3HOVJ 4CH7A 4CYCB 5EGOB 1H89C 2JWTA 2Z3YA 4FHTA 4V2FA 1S8NA 2EIKH 3BPXA 4Y7NJ 3BG6A 2PX9A 5E1ZB 2ELJA 2EV6A 3PO3J 3WTYC 2AQFA 2H8WA 2NVUB 1RI7A 1UZCA 1ETQA 4ZJZA 1F4KA 4TV7A 2VB6A 4G8XA 3W2AA 5D6EA 3QYBA 3LA3A 4S0HB 1IF1A 4IVNA 1RETA 1IXSB 1SVMA 4L9NA 2MA3A 4D7MA 3HC7A 2EZKA 2CV2A 3KZYA 1AHDP 4RMNA 5EG0B 2YSRA 4MQ9F 2JA7J 4GDFA 1BR1A 2IT0A 1OCZH 3OV8A 1QU3A 2LH9A 3HM5A 2HZDA 2K02A 1YW9A 3VB2A 2VC0A 4U7BA 4KN4X 3NQOA 3M07A 4ZZDA 1X4OA 3ZMTA 3CUQA 3OYBA 2XAQA 3H36A 1Z05A 2M34A 2DBBA 5F0HA 5KAIC 3PQJA 4YIIA 3KE2A 5D5XB 2OF7A 1KQ0A 2A69F 1XN7A 2MLGA 2L5QA 3O8HA 1OYYA 3IH4A 4C3IJ 3M4OJ 1Y8RB 3RKQA 1MNEA 1WGXA 2QGUA 3K1MA 1U5TA 2VKEA 3FIWA 4KICA 4Y3OA 4CXFA 1L3LA 4LIVA 1QPIA 3X2QH 2CU7A 5LBQA 5HOOA 3F8CA 1ONVA 4A3GJ 4XLAA 2A07F 4HV5A 2X6WA 2AS5F 2JRTA 4M9ZA 2K9MA 3LSHA 3TEDA 1AKHA 5FKNA 4BS9A 1OYIA 5L3DA 2W82A 1FT9A 2UV1A 3GXOA 4GYGA 2VKDA 3S2DJ 2W84A 5D5WB 2PMHA 3TOAA 1G8XA 3I4MJ 2CW0F 2O0YA 2NRAC 1T08B 3B02A 3SHFA 5ILUA 5JVTA 1HOMA 3QODA 1BN5A 5LGUA 3BDDA 1XGNA 3S15J 1BI1A 3CJQB 2YS9A 5L3CA 4WXCA 5FKKA 4BQNA 1FOWA 3IWZA 1E3OC 1C0WA 4GGGA 4ZDLA 4E6KG 4K2EA 3V7SA 2OAZA 5B1BH 4JBAA 2DMPA 4A3JJ 4LG0B 4D0PA 2M0CA 3SFZA 1FNNA 2Y30A 3BTCA 3QPLA 2PQ8A 2COMA 4RGRA 5HODA 5FJ8J 2X1EA 3RTRA 4D7NA 3ABTA 1K4SA 2HVSA 2DA3A 2FNAA 3AL0B 4F3QA 5L3GA 5FLMJ 3FM3A 3GTPJ 1Z6RA 3M8EA 4H0EA 4IHYA 1U6GA 5H6RA 3H0GJ 2RVCA 3TOBA 2XIGA 1WCMJ 1ZRCA 5CVVA 2KIUA 3Q0VA 1N75A 2KKOA 3WU2C 1YTYA 3DEUA 2HDDA 4GFBA 3LSTA 1R6RA 5ICFA 1P9QC 1XGMA 3VOEA 4EGZA 2DA5A 2RNJA 3WU0A 3IAM2 3WTZA 2W1OA 4BY7J 5M5XJ 3BJ6A 2H27A 2JSPA 2LLKA 4KMUX 1ZG5A 4A3DJ 2Z1DA 3ZP5A 4N4NB 1QHHD 3QYFA 3DFGA 3BP8A 3PJRA 1V5GA 2NOJB 3K69A 1RRJA 3QOPA 4RB1A 3CCVI 4FETA 4ENJA 2X1DA 4YRVA 3D1NI 5E3OA 2DA2A 2FXAA 1P4AA 4AC0A 4BXFA 1V5EA 4MHGA 3W2VA 4AYBA 4MQVA 3CUOA 3FBNB 1T8IA 4OIRF 2PJRA 1BOBA 4AIKA 1PUEE 1G2HA 2R7VA 1VQKI 3BJAA 3OYKA 2RNGA 2AQEA 3GZ6A 3E6CC 4BE0A 2IAIA 2ECCA 2LVSA 3S93A 2BOLA 2PI0A 3BG9A 3BTIA 3FMQA 4KJZA 4CYCA 2R4GA 5EGOA 3W3CA 1JUSA 3FDYA 2G0EA 5FFZA 5KCMA 4BXXJ 4BACA 3BG3A 4BHPA 2ECBA 5CQEA 3GWZA 2MG4A 1FIAA 2JVGA 4YIRX 2WADA 2IA2A 4P1WA 3GTMJ 2WAQA 1X1PA 5E1XA 1ZK8A 3V42A 1JKRC 3WG7H 3ZQQA 3JTGA 2HGCA 1U8BA 1KA8A 2VC1A 1P7IA 4F7ZA 2A3SA 3S2HJ 1HDPA 4NC7A 1J2XA 2XF5A 4DBRA 3IC7A 3IRQA 4YFXF 2R7OA 2NS7A 1Y8QB 3I55I 2Y0MA 1JXSA 1O7FA 1ZHFA 3I3LA 3ECHA 3QRFF 4I0AA 4ZYDA 3RI4A 1UB9A 2R93J 3AL0C 4XSXF 3COAC 3JW4A 1HA8A 2ZXJA 3ERED 4R8HA 1R58A 4ZC3A 1F36A 4FASD 1XDUA 1HXDA 2KT0A 2VBXA 2DMUA 3RCOA 4F92B 1BIBA 3K4CA 1FBQA 1KYZA 5CYVA 3ASNH 2ADUA 4HDVA 4KISA 1KU9A 3J81Z 4NHJA 3HJEA 5EJCA 4HNVA 3K4NA 3MKYB 1R49A 2Q1ZB 1FOXA 3DKWA 1UMQA 2BY1A 2TRTA 4XOTA 4LK1F 2PG4A 3GZNB 3HG9A 2L4AA 4OOIA 2CV0A 2XGXA 3ZPLA 3M7GA 2ZXHA 1IN4A 1IDYA 2XGEA 1BR2A 1R23A 1JJ6C 4EJTA 1TC3C 3KIOA 4C2TA 1S7OA 2FMYA 1Y1WJ 5HS9A 4HQEA 3R61A 1TWHJ 1A36A 4U7DA 2KJCA 3HUGB 2L9SA 5DV5A 3MKLA 3A2KA 3ML6A 4HW0A 3SJMA 4A3EJ 4KDPA 2AXTC 2E5ZA 4XLFA 3OYMA 3G1LA 4F52A 2CW7A 3FXUA 2K9NA 4KA4A 2GLOA 2L54A 3LSMA 4FX4A 2M8EA 1XSDA 2Z99A 2M87A 2I10A 4LG0A 3CMMA 1MIJA 5E8GA 1IO2A 2M30A 3O2PE 2EZHA 2AO9A 1V5FA 4PFPA 5AIPA 1X1DA 4YG2F 2HTJA 3V8LA 1USTA 5DM6F 2HQAA 1JT6A 3PNVA 2P0WA 1Z91A 1IXCA 2EIMH 3L09A 3WU1B 2IS2A 2X0LA 2FBKA 3FHZA 3E7LA 3F8MA 2Z33A 2ELHA 1J59A 2QSGX 1LNWA 4PJNA 4OIPF 3Q0WA 2IS4A 2MC3A 3QAHA 2CJJA 4QIWN 4KMFA 4G6TB 3I59B 2FSWA 4DYRA 5F1RA 5CVJA 1WI9A 3CDLA 3DBHB 2M1BA 2KP6A 4R79A 1VQOI 2GIVA 2HFHA 3M3YJ 1IN5A 2M5WA 1D3YA 2RGVA 1X2MA 5E20A 2PMUA 4C9YA 4HNTA 3CMYA 4AIDA 2VXZA 1VQ7I 2CGPA 1TQPA 4M3FA 2XB0X 1W5SA 3K6GA 4KITB 4OMZA 5F0CA 2XUBA 2LY1A 4RAFA 4LB6B 1VQNI 2O9LA 1W5TA 2D5VA 2VI6A 2W57A 2HQ5A 3GYHX 1QBJA 1J09A 1BW6A 1F1ZA 1YYVA 1OJLA 1BJZA 2CH0A 5HLGA 4WK8F 3OYFA 4M72A 2AHQA 2V9PA 3IP4B 2CW8A 1SAUA 3FK6A 2DTRA 3SZPA 2K86A 3M1CA 2KZGA 4KIBA 5F08A 2HOEA 1CF7A 2VE8A 2FUG2 2E36A 1SD6A 2WY7Q 1BC7C 4PGGA 1HDDC 3G2BA 1IN6A 2XVCA 1HCRA 3GX4X 3T5XA 1S72I 2MLKA 4IJAA 3DBRB 3A02A 3WGHA 1IJWC 4HF2A 5CVIA 2BBYA 2K40A 5K7FA 1JUMA 4Z2YA 3QPHA 4EM1A 3HKZA 5IOZA 1D1AA 2IRFG 3FXQA 5J40A 1UAAA 4LIUA 1SD5A 1Y6IA 3J80K 4ZZLA 4E7LA 3CF5F 4II2A 3VYRB 4EJVA 3E5XA 2CFXA 3L9FA 3IRRA 1E17A 1U9NA 1S5LC 2MGQA 4A0YA 3F8BA 4E4HA 2ZMEB 2BHYA 1FP2A 4KN7X 1IRGA 3LSRA 5GTHC 2EFOA 2OU2A 3GFIA 1I6HJ 3ZQIA 2W85A 3HPHA 2NVQJ 2FA5A 4CCOA 1K6YA 4I98B 3OSFA 2HTSA 3CJTB 1TW2A 3OYNA 3LAJA 3D5SC 3P5JA 1FWZA 3ELKA 3WE3A 2F5VA 1M1EB 3OYAA 3EETA 1ZTRA 2F2EA 2E7XA 5F64A 5ED4A 3ECOA 4U0YA 5FRNA 4J00A 1RR7A 4CUGA 2VPRA 1MSFC 4BU2A 5HDKA 2XV4S 2O61A 2HKOA 1ZELA 2GAUA 3OYDA 5E1WA 3CCLI 5M5WJ 2Y0SN 1Y56A 2NNYA 2HOAA 5LLQA 2PJPA 2BY3A 5JHFA 3JRCA 2E1CA 4W97A 2Y31A 2R0QC 3CCYA 4IHWA 3SQNA 1D8JA 5AONA 4U0WA 5FD5A 3RJPA 1TWAJ 1G3SA 2MH2A 2PLYA 1Z7UA 3L1PA 2ZFWA 4Q48A 3BROA 2PN6A 3DTEA 2Y2ZA 3LSKA 4XMYA 2OTLI 1EF4A 3RZDJ 4UHTA 2QSFX 4UY8I 3S2WA 3L2VA 1XMXA 1KU2A 3S3OA 3OYJA 1O3SA 4F93B 2OZUA 5GTIC 1RC9A 2K9LA 4P96A 3OS1A 1XB4A 2OPTA 2P5LC 1YIJI 3FBIB 1JTXA 3F22A 1TNSA 3GMEA 1SFEA 4Y4RA 3J80Z 1FOKA 4JX5A 5KK1A 3AAFA 2MYSA 4B1RA 2UZKA 4Y15A 4HRIA 3DPTA 3AKZA 4XKWA 5TGTA 4EMSA 4BHCA 2VBWA 1OCCH 3U9GA 5E3MA 1DDNA 2BV6A 1ODDA 3T8RA 1IDZA 3HPGA 3OS2A 5FRMA 3Q9SA 3R0JA 4RB0A 5H20A 4BBRJ 2E60A 5HNFA 4FCYA 2KDOA 1EKEA 5GAEJ 4NNJA 4IHSA 2Z9OA 2QF7A 3OS0A 1WJEA 2VN2A 1W0UA 4UXNA 3FZVA 4U87A 1KGSA 3WE2A 4B3AA 5BPIA 2QBYB 2R7XA 2Y48A 4OMYA 2ZMEC 4LLNA 5C3EJ 5HLHA 2KMUA 5B1AH 3L2RA 1I39A 4Z6YA 4EGYA 4NC8A 3SDGA 4V2GA 1HLVA 1X2NA 5F27A 4UVAA 1VQ8I 1S6LA 3K4LA 4BXUA 3JAMZ 2W4SA 1MBHA 4CCLA 1FTZA 3CCEI 1B72B 5CVRA 5JLXA 4PZJA 5ICCA 2ACJA 2HQRA 4MO7A 3J7ZI 3UKGA 1GVDA 4M3DA 2DAOA 5EYRA 5FGMA 3MZ8A 3BOQA 2R5YA 4EJUA 4BAYA 3O8GA 2C6YA 2VBZA 3V7CA 3OOPA 1PJRA 3ZQHA 1OCOH 2EV5A 3AG4H 5IT9Z 1UJ8A 2GWRA 4HBLA 4A2UA 1S7AA 1WJAA 2HPIA 3M9AA 4HF1A 2X1CA 1YJNI 1KONA 1O7LA 2P81A 4MLOA 1O4XA 3B6CA 3J7AO 3K1PA 4XLPF 1BI3A 1MGTA 3CF2A 4F55A 2ZJRF 4X1EA 2JN6A 2LOOA 3FXRA 5FKOA 4B4CA 1G4DA 4WWCA 4G6DA 1QVTA 4BGDA 5FROA 3E97A 2NAZA 1VNDA 2VODA 2WV0A 3OR2C 1EH8A 3CUQC 4HLXA 1MBGA 2NOGA 3RKYA 2ZMEA 3I54A 1K4TA 1TL8A 2JQ7A 2ZCWA 3I56I 4N9HA 2B7EA 2QQBA 2D2WA 5FD6A 3C2GA 1ULYA 2KLOA 4GCVA 1MBFA 3JRAA 3LAPA 1AOYA 2JUGA 3DWLE 1HQCA 2VOOA 3BWGA 1PP8F 4OIOF 2OD5A 2KPMA 3V7RA 4A3MJ 2JRMA 2VUMJ 2BGCA 4JOMA 3Q0UA 4Y17A 4B3XA 4E7JA 3E5UA 2L9RA 5DCFA 1QQIA 3LQRA 4BQQA 2R7RA 1LDKB 4E7HA 1YE9A 1SEUA 3QYEA 1W1WE 2H6BA 4HZFA 2W25A 4XR6A 2DW4A 3GTGJ 2GIZA 1WWXA 1XPXA 4BEHB 5FLVA 2ZO4A 1GV2A 3TL4X 1FBSA 1OISA 2H8RA 5FLXZ 1XD7A 3TBIA 5EF6A 1NH3A 2W24A 2F6CA 4BNCA 3BPVA 2GOXB 4L18B 3K4KA 1SVOA 5HDGA 5J4YA 3LNQA 3ZGKA 3K70C 3CCUI 1R00A 5KVRA 3KCCA 2H1LA 1I3QJ 1WH5A 5L3FA 4ZTJA 2B0LA 2ESHA 1IW7F 1Y0UA 1K78B 1RIOH 1R4NB 1OMIA 2X6YA 2QQ9A 5LRRA 3WODF 3GCMA 2DCEA 3TGNA 4HEA2 2ETHA 4CCNA 2DQLA 3HGYA 3ONQA 3BTJA 1JT0A 1UCRA 5FFXA 4C2UA 3G73A 2M2EA 3BZKA 4BDYA 2LG4A 2NVXJ 2H09A 4DJAA 2E34A 5TRDA 3BZCA 3E6MA 2E71A 1ZLKA 3OL4A 3QPSA 1FX7A 5KHDA 1HSJA 4RAGA 1ON2A 2JVHA 1Y0NA 2HYJA 1LVKA 3GVAA 4I7HA 4JK1X 1TBXA 5J47A 2ZXIA 4A93J 1T2KA 4XLHA 3MZHA 1APLC 4LITA 5HLIA 4D5CA 1STZA 2XSDC 2QENA 3EPZA 2FBHA 1MW7A 4O3MA 3KLNA 2H6CA 4I09A 3WTUC 2MABA 4IQ4A 5IYDJ 5IP9J 3PSFA 5DD4A 2WB1A 2VIXA 5FKLA 5LHHA 2LF7A 4D5FA 3FF5A 1UFMA 3OYEA 5H6QA 2HYFA 1LFUP 2J5PA 1ZRFA 2KFDA 4WCGA 2EBIA 1B72A 5IYBJ 1YS7A 2EA4A 4BHBA 2K85A 3G4SI 1IV8A 3K7AJ 1O3QA 1T95A 1JJ8C 2R92J 1W7PB 1MKMA 4PJ0C 4UUVA 3CCMI 1PYVA 3HSRA 5D5VB 3W6KB 3HOTA 1X3WB 2VBYA 4B43A 2DTZA 2XKOA 3G71I 5DEQA 1GUUA 3IKTA 2QEXI 4L5EA 4E7KA 2O7OA 2VONA 3RYRA 4D1QA 2VQHA 5EZHA 3CJNA 4W1UA 3E5QA 2JMWA 3BR5A 5DD8A 1K7AA 3S14J 3U1KA 1JHHA 1GV5A 4EM2A 4XORA 2E35A 1FZPB 5IY5H 1ETOA 3ZMVA 2W7NA 3ZMZA 4XN0A 2GQQA 2KIFA 1RR8C 2VJ5A 3S1RJ 4OIQF 1WKMA 4A3BJ 4MTDA 4M9XA 2DK5A 1P4XA 2DI3A 3J81K 4IZZA 2LNBA 2EV0A 4MEYF 2P5VA 4MFEA 3VODA 2HOSA 1MSEC 1XDSA 3I4NJ 3MKZA 1A6QA 4M6XA 3LSIA 4ESBA 3SZGA 3RPUA 3CC7I 3ABMH 3BR6A 4ON0A 2P8TA 2KIMA 1O57A 2BE5F 1P6RA 1HW1A 4L0ZB 2PMZA 4R1HA 1SC7A 4RM2A 1ENHA 2DT7B 3RYPA 3V8JA 3FKIJ 3S1MJ 5DTDA 4HAMA 3HHGA 5J8CA 1SFKA 5ERIA 3K4JA 1PUFB 2BVMA 3K70D 4BBSJ 2LYCA 2O6GE 1ZGAA 4BEHA 3KP4A 3TDZC 2V1UA 1QHGA 1RESA 5E8IA 5M3FJ 3G1OA 4HDUA 3HDDA 4O6JA 1TWFJ 3AG2H 1QO0D 3JRGA 2X85A 1V54H 2DQRA 3DTIA 1IXRC 1DP7P 2J5OA 3ZQCA 4Q47A 2FX0A 2O3FA 5EG0A 2YU3A 2L7KA 2R7UA 1TQIA 4A12A 5M3MJ 5CLSA 4A3KJ 3EQLF 1YG2A 2R7DA 2KQRA 4LK0F 3CESA 3TW7A 3ROUA 3PFYA 3ZR8X 1GXQA 5J6XA 4U88A 4XICA 1IG7A 1K78A 2CQQA 2G9WA 5CPRB 4XBFA 5F6FA 1Z67A 1CQTA 3HIFA 5BMZA 3HBLA 2K3FA 3JRHA 9ANTA 2DDAA 3F72A 5FB2A 4KFCA 2EH3A 3Q3SA 3HTUA 4PSXA 3HEFA 1LE8B 2L0KA 3I64A 3OMYA 1FOYA 4BJ5C 3S16J 1JI8A 3OYCA 2YU9J 1U78A 2EZLA 2M4GA 3CMEI 3RQ4A 4EJOA 1FP1D 3ZRGA 3CP8A 3HHHA 1R5GA 4L5IA 5LGNA 2X51A 3S17J 2WWYA 1AA7A 3LWFA 2IJLA 4KYWA 2FOWA 3IAS2 3KP6A 3RPUD 2XC7A 3SXYA 3H3UA 1YI2I 2VQCA 4PSWA 1MBKA 1U3EM 2F5FA 3H9GA 4PGHA 2QA4I 3CZ6A 3BR0A 4HYEA 1P7JA 3ZOBA 1KQ8A 2E7WA 3BCAA 4P9UA 4AYBN 4CHUA 3B6AA 3GTQJ 4B47A 3FXOA 1YW7A 4AD9A 5C4XJ 4RB3C 4FX0A 4NQWB 1YQAA 1X1BA 3OSGA 2V4JC 3MVPA 1MH3A 2ZC2A 5L3BA 1WFXA 5A2QZ 5GPCA 3OR1C 2JPCA 3CLQA 3WGIA 3IV5A 4QSHA 2XPUA 2FQ3A 4I76A 1V55H 3NRVA 4RLQA 2V1NA 3DU6A 2CUJA 4DZPA 3OIQA 1W7PA 1EH7A 4IHXA 1FLIA 2QUFA 3DXJF 2RN7A 2DFHA 3GF2A 3WHBA 2NXNB 4ZYAA 4XL9A 1YO5C 4C2MJ 1FC3A 2WAQN 4RGSA 4FE7A 3N97A 1QGPA 2OCEA 1W36D 1R5HA 2EK5A 3TDUC 1SD4A 4UV9A 1B4AA 3FWEA 3ZQ7A 1NK2P 5HS8A 3CC2I 2ZXWH 5IOYA 4Q5SF 2HQNA 2QVOA 3MFKA 3BR2A 5J4VA 1IC8A 3D5RC 2R7QA 5IPAA 1GLNA 2Z5UA 3KEYA 3B73A 1ZYRF 3OIPA 3VFZA 4PJMA 1T33A 3KP7A 1IUFA 2HS5A 3MZYA 4I01A 2EILH 1WQ2A 5IP7J 4Y52J 4JYKA 4BYYA 2R7FA 2BYVE 2ID3A 4G9YA 5GADJ 5EEGA 3LSGA 2JK3A 2VE9A 2G7HA 1Y39A 2HEOA 3E1SA 5DS9A 2WA0A 2BY2A 1HW2A 4L9VA 2LKSA 2GXBA 1XC5A 3U21A 3A03A 1I1SA 3F0CA 1KU3A 3DCFA 3F6VA 4LLGF 2NVYJ 2L9VA 3DLAA 1YS6A 3C2BA 3HB9A 3M8JA 1OLTA 1GT0C 2V9KA 1B1BA 1R1UA 3E0JB 2ZSHB 3E6BA 2VJJA 1RKTA 3FXKA 3CO7C 1XMAA 2IW5A 3OYGA 1JE8A 3OYHA 2EFNA 1QZZA 2CYYA 4XLCA 3LSJA 1ZN2A 2R7TA 2IGOA 2FBIA 5DCMB 2AXLA 2LD5A 3OWTA 2UXNA 3L2CA 2K3PA 2I8DA 1I27A 4IPAA 2DT6A 3RKWA 4IRIA 1PUFA 5E79C 2UXXA 4HG2A 5LHGA 3RZOJ 1XX5A 3HRUA 3QP5A 4S04A 5GPAA 3FX3A 3ZQGA 2Q2EB 2CUZA 2DMTA 3K2AA 2P6SA 2VXDA 4ETSA 3N4MA 2XF7A 1MZBA 2M8GX 3GTJJ 2OC6A 1D1BA 1W7PD 1BM9A 2A05A 2F5EA 4N9IA 3LA7A 4LG3A 1EA3A 2LF8A 3D5LA 1B6AA 3OY9A 3H3VK 4AIJA 3VPRA 3NARA 3MEXA 2ZNYA 2IA1A 2JJ7A 1YLFA 1XSXA 5ICGA 1IV6A 3C18A 3CJRB 3KZZA 2OUMA 3PNYA 5IP6A 5B5EC 2X6XA 3BR1A 2X9DA 1ZG1A 4I6ZA 2M9HA 4EV0A 4XIDA 3PNTA 2P5KA 2DFFA 4ESFA 5JFRA 4UV8A 4WX9A 4M73A 1R4MB 4CA0A 1BR4A 4V19K 3TO9A 4DYQA 2GM4A 4MIMA 5BPDA 4E7IA 1G59A 1LE8A 3J7AY 2IGKA 4CGZA 4CZCA 4ZDOA 2L9NA 2CV1A 5ILSA 2STWA 1Z9CA 4S05A 2LSOA 2IBDA 1IRFA 1USSA 4YEJA 3FXLA 5K5RA 3HGGA 3KZIC 1MNDA 2E1MB 2BY0A 4XN3A 1FTTA 2A6EF 1W5CC 2YX4A 3E3VA 4RM3A 4AIHA 1LFPA 4NB5A 1JHFA 1HBXG 3JAMK 1T38A 4KIGA 1JGGA 4KUMA 1A6IA 3H1CA 3UR3C 4A0ZA 4L9JA 1MMSA 1J5YA 2LKXA 2DA7A 4I0BA 2VJ4A 3ISPA 3M8FA 3W6VA 5DDGA 2D45A 2VOPA 2LFBA 4RLFA 1UHWA 1X19A 2E1OA 5IT9K 1NTCA 3HUGA 3OYIA 2Y75A 4XRSA 1MH4A 5K5QA 3FXJA 4I02A 4NQWA 4E7ZA 5J3LA 3ZQFA 2DOEA 2LBFB 5CJ9A 1H9GA 2DN0A 3K4MA 3FMSA 1Z3YA 3I53A 1PP7U 4M74A 1KQ9A 1IGNA 2ZB9A 3S1QJ 5FO5A 4G7ZF 3MCZA 4DGWB 2ME0A 2FNPA 3NEUA 3ZN1A 1V3FA 1OR7C 5E17F 2X4HA 1YITI 3HKZN 1MBEA 4RGUA 3GTOJ 5IT3A 4LLLA 1R22A 3FHNA 1QPMA 4BL0B 1JGSA 1RNLA 3C1DA 2QWWA 5ICEA 1T98A 2IVMA 2EIJH 4M3BA 4XRMA 1NK3P 4L9TA 2IGNA 1Z77A 2YPRA 2XF6A 1LDJA 1VQ5I 4CCKA 4GYIA 2R7ZJ 3L2UA 2JZYA 1IRZA 1Q1HA 2HI3A 4HNUA 1NHAA 3K10A 1MD0A 3DP7A 4Y13A 4LD5A 1H0MA 3I59A 3SYTA 2YUSA 2ZNZA 2ME6A 4KT6A 1Z3XA 2MW8A 1J7KA 2I5UA 4C3HJ 4RDUA 4DNCA 4A3CJ 4A3IJ 4XQFA 3F3XA 1I6XA 3S3MA 1BIAA 4UNOA 4EJWA 3ZMDA 4IRGA 2WTEA 2A5YB 3I4PA 2Z2SB 2HVRA 2JTVA 3IWFA 3TP3A 3ZN0A 3QU3A 4CSWA 2DMQA 3K4BA 3CC4I 3MKWB 3J7YJ 1AKHB 2FOKA 2BVLA 2XPWA 3HL2A 3VEPA 5FLXK 1J0RA 4GO1A 2HDWA 4QLCU 4HX4A 3JSPA 1MMGA 2GXAA 2LY2A 3BQZA 1KYWA 4JP0A 2VKVA 2DPDA 2V79A 2FRHA 3IHUA 2LP0A 1I1GA 4EM0B 5B3SH 3CCQI 2A61A 3DEEA 3K1NA 4GXOA 3QU6A 3S32A 2XGDA 5DCMA 3DF8A 4M9SA 1QA6A 2LDUA 3QOEA 1MBJA 1GXPA 3KPHA 1IUYA 3CMAI 1OR7A 4AUXA 1IRXA 2XAUA 4RAYA 2CUFA 1LB2A 1FYKA 4B8XA 2Q2EA 3VYUB 2R7SA 3QWLA 1OYWA 5D5UB 3DTKA 2QZ8A 2Z16A 3DU5A 5HNHA 2DYRH 4XKVA 3WTSC 4CYDA 1A35A 4XRSG 4KNYA 1OPCA 1FPQA 3T8TA 3HRTA 3A0BC 5D6FA 2QKLB 4XRFA 1ZREA 1VQLI 2RQPA 5E3NA 1ZAOA 3SZTA 4MNUA 2EZIA 3ABLH 2NNNA 3W6JB 4M6VA 2JA8J 1KU7A 1UHSA 3H5RA 1I3AA 4LJZF 1YW8A 4XNFA 1DPRA 2F4IA 2CSOA 1F5TA 1PDNC 4NC6A 4YELA 1I50J 2DK8A 4IEJA 2EWNA 3R0AA 4HOBA 1A04A 1RZ4A 2VKHA 6PAXA 3CDHA 3KFWX 4CCJA 3V4GA 5LHIA 2L01A 1WPKA 3HSFA 3LSPA 1D5YA 2DLLA 3F21A 1XCVA 2KIQA 1D8KA 4CICA 5J8FA 4MEXF 2EFPA 3GFMA 5EEHA 1G3WA 4N4OB 3TQNA 1MMDA 3GEZA 3KEOA 4BQOA 1XS9A 1ZKGA 2RV8A 2EFWA 1LPQA 2OTJI 1ACIA 4B44A 1OKRA 5DM7F 1EJ9A 4IF4A 3PUFA 1FMVA 2E2HJ 1RUOA 4JX4A 2NS0A 1FEXA 2QCOA 2IP2A 1WJFA 3MN2A 1DU6A 4ZYGA 2JA6J 2VASA 3PQKA 1TQMA 2W48A 1X3ZB 3WHCA 2X48A 4JQFA 3WG9A 1X3UA 2TCTA 2Q8KA 1JKQC 1HKSA 1Y1VJ 3WGGA 4A3LJ 3ASOH 4XLNF 3HTSB 4QWQA 4N0BA 4E70A 2LBFA 5K5OA 5TJJA 4XONA 3BC8A 3LQQA 4UUTA 1ZGWA 3LL7A 3BR3A 1REPC 3DQVC 4HX8A 4P9FA 3VSLA 1F43A 3FKJA 4HLYA 2DU9A 4G7HF 2L2OA 1HF0A 3WTTC 1H88C 2FJ1A 2ESNA 2LREA 4RGXA 1ORKA 3BT9A 4EATA 3JRDA 2H94A 3BG5A 4LOCA 3BJOA 1ZG3A 3R60A 3F23A 2HNHA 3BQYA 1W4MA 3C3WA 4X0GA 1WJBA 2A5WA 1HKTA 2K7LA 2FMLA 1BC8C 2XB5A 2VT3A 3DPUA 4IQJA 2CWEA 3PM1A 3LA2A 4BJTA 1DUXC 4IXAA 1WZ2A 2HU9A 5E18F 4OU0A 3HRSA 4IOCF 1MJBA 3ZCOA 3JRBA 1S29A 4ENNA 4IO9F 1OFCX 2QYOA 4CCMA 1U0JA 3S3NA 1OCTC 2KJBA 3NWSA 1ZRDA 4ESJA 1YJWI 2Q0OA 2QBYA 2DYSH 1XTAA 1YIOA 2L7MP 3EDPA 2IA0A 5HVQC 3GBGA 5LEKA 1CGPA 4UB6C 2QQAA 5KAFC 2OBPA 1FSHA 2PEXA 3F8NA 2V9VA 2VQLA 2XSJC 4XOPA 2DFEA 4GRIA 3SEQA 1JKPC 4G12A 4AWXB 4BY1J 1QZYA 1MDMB 2RKHA 4A6EA 3O3KA 1VQ4I 2ID6A 4IHTA 3JCUC 2OV7A 4M6YA 5LEJA 4DIQA 1QVUA 1R1VA 1UG0A 5FKMA 1IZ1A 1P4WA 2O03A 4IL6C 3W2WA 3RPQA 3TW6A 1U2WA 3S8PA 1IAWA 1BI2A 2UWMA 2VJIA 3ZXSA 3HSEA 4HA8A 3KP3A 3WTXC 5EEAA 1VTNC 1B9NA 3JR9A 2KZVA 2KDZA 1E2XA 1X1AA 3LOCA 2V7FA 2GXGA 1OQYA 4ZTFA 1R36A 1HW5A 4HF0A 3JTHA 1P92A 2F4OB 4AU7A 2HDCA 1D0ZA 3KX2A 4IKFA 1D0XA 2FU4A 2F5DA 2KRHA 1U9OA 3RSNA 1BOAA 3A1YA 3KYDB 1FBUA 5D8KB 1OCPA 3IH2A 4WF2A 3EUAA 1ETXA 5IYCJ 2P4WA 1W36C 2E5NA 2OCCH 2EFQA 1R5ID 4D9JA 1FYLA 2KISA 1DPUA 5GAHJ 2COBA 2XROA 2DA6A 2MC4A 2NS8A 5DYMA 1UG2A 1YX3A 1OCRH 1XMKA 5HS7A 1ETYA 1WH7A 2MD0A 3QPTA 3HZJA 4U0VA 3BTLA 1R71A 1LJ9A 5L3EA 3HOSA 2RAEA 3ABUA 3PIPF 3ABKH 1LUJB 3JRIA 4J01A 4FISA 3K0LA 2R5ZB 2EB7A 2XAGA 1TWCJ 2OQGA 5LRSA 3KETA 4PDKA 5K1YA 1XG1A 2R7WA 2XAJA 5D4SA 4BKXA 1ETVA 2CQXA 2DJIA 2M3AA 2DOAA 4F91B 4EEFG 4YFKF 5A2QK 2BW3B 1VQ9I 2A68F 3GFJA 4DW6A 1SFUA 2D1HA 1TTYA 4P5OA 1TWGJ 1MNMC 2WB1N 3GUDA 4OINF 4YFNF 3F6OA 3CD6I 4BUPA 2YR2A 4OAYA 3DPLC 4IRHA 3HXLA 1E3PA 4FTHA 3P9KA 3L7WA 4A69C 2E2IJ 3AG3H 3DKYA 2LTPA 2M45A 3GLLA 1CF7B 3H5NA 4P55A 5K7ZA 1XCBA 4XSZF 5KNLA 4G94A 1TP4A 5BS6A 4B09A 2XKPA 1UELB 4XLEA 4MTEA 3K9TA 4LMYA 1QZEA 3I5UA 2CMPA 1HSTA 4OAZA 3ERMA 2GBYA 2P7CB 2QKMB 3KYCB 3CCSI 2DA1A 3OOUA 1ZARA 2DT5A 3PFIA 2NYXA 4ENKA 4BJ6C 4M3EA 1XSVA 4NBQA 5BQTA 3F9KA 4JX6A 1H8AC 4FE4A 2LK2A 3TP0A 3DV8A 2F4MB 3P9IA 2L7FP 2BHZA 1RPWA 3I58A 3TO7A 1E0EA 3VSKA 4G6QA 2F48A 2JT1A 2QQ8A 3P7NA 4A6DA 1TLHB 3LFKA 1D1CA 3U2RA 3A01B 1YRNB 1SMYF 2ZKZA 3T1BA 2FD5A 4PFOA 1AWCA 2HWVA 2X6OA 4NUBA 1N25A 2DJNA 3JREA 3GTKJ 2XAFA 1K79A 3OL3A 5CKTA 1FIPA 3RIRA 3A0HC 1WJCA 1DGRM 2K9SA 1WI3A 3VYTB 2XASA 2ZFUA 3KLOA 1GHCA 4IOAF 1NG7A 1VZ0A 2O5RA 1J75A 3GTLJ 2PMZN 1W0TA 3GFLA 4IHVA 1X58A 1MDMA 1T56A 4LFUA 4EQQA 2IGMA 3H35A 1B8IB 3NWTA 2M7AA 3H9JA 1SFXA 1E3HA 1SANA 1FMWA 2V1DA 2JPBA 1YJ9I 3E6DA 1GVJA 5JLWA 4RB2C 3BLYA 3QQAA 4CDGA 3IUOA 5DUIA 3L00A 3IKVA 1L0OC 2DPUA 2WV1A 4RBOA 3HOUJ 3FM5A 1I5ZA 2KRCA 2MH9A 3F8FA 3CLOA 4HX7A 4WXDA 3NAUA 2HXIA 2WY8Q 1VQPI 2XRLA 3H9QA 2EPFA 4PK4A 2FE3A 1WJ5A 3EUHC 1T39A 4BQAA 1Q1VA 1Z0XA 2OJED 5JVGF 3EUKL 1Z6TA 2D1VA 4RA2A 1N77A 4XK4A 4Q4ZF 3H92A 1LQ1A 3A4CA 3GLXA 4HQMA 2ICWG 2P6TA 1T6SA 1WRJA 1G6NA 1QRYA 3P9CA 3EYIA 2O8XA 3AFHA 3WTVC 2MFZA 1WVRA 1A5JA 2N8GA 5CQGA 2G7UA 1JKOC 2RREA 1LEBA 1FJLA 2V6CA 3TKYA 1BW5A 2DDBA 3CTAA 1MMAA 3G3ZA 5TISC 1YX5A 1NG6A 2DOFA 2LKPA 1QNTA 5JR3A 2VQGA 4XM3A 5HDNA 1S3JA 2R5ZA 1DGWY 2CUEA 3R4KA 4H4KC 1D5VA 2Y0SA 2V26A 1HC8A 2KRFA 3I0TA 2JSCA 2CQ7A 3CP2A 2DMNA 2ISZA 1ZH5A 2CQNA 4DOZA 2ZJQF 3MQ0A 2GA1A 4AVZA 5JI6A 2XAHA 5H2FC 2WC2A 2BW3A 4ZYEA 2MSYA 1VF9A 2DA4A 1ETWA 2HR3A 5C4JJ 3ZMUA 3JSOA 3L2QA 2R5YB 1SVLA 1YHQI 3DKXA 1SD7A 1FY7A 5GP9A 3FMRA 5M5YJ 3H0DA 4KIFA 2XRNA 2LRDA 4XKCA 2CFOA 1S9HA 1B9MA 5D8LB 3PL8A 2OZ6A 3EUHA 3MMYB 3LFUA 4UB8C 5BOXA 2PFBA 3FK7A 3S1NJ 2K27A 3M1EA 2ZJ2A 1T0FC 4LGWA 1LKXA 2NVTJ 4ABZA 4PCQA 2QLZA 3K2ZA 3REOA 1ON1A 2B63J
chains in the Genus database with same CATH topology
1X1CA 3EPZA 1HA8A 1MW7A 4QPOA 2M7BA 2MABA 1IRXA 2XAUA 4IQ4A 4ZC3A 3PSFA 4FASD 2WB1A 2VIXA 3VYUB 2R7SA 4E7SA 3RCOA 4F92B 3DTKA 2HPMA 2Z16A 3K4CA 3OYEA 3DU5A 5HNHA 4KISA 4XKVA 4QPQA 4C30A 4ZDPA 4IX7A 3K4NA 3MKYB 2Q1ZB 4XOTA 4BE2A 5LD2C 3HG9A 2CV0A 1T95A 2ZXHA 2QKLB 2HVQA 1BR2A 1PYVA 3HOTA 4C2TA 4B43A 3H5RA 4XNFA 2CS3A 2GOMA 4E7KA 1ERDA 2F4IA 4D1QA 2VQHA 2L9SA 3HUGB 3C2HA 3VWBA 1DQUA 4YELA 3A2KA 2E5ZA 4XLFA 2M0MA 3OYMA 2VKHA 4CCJA 4F52A 2CW7A 4BDZA 4XORA 2KL4A 3LSMA 2W7NA 4XN0A 1DP3A 3CMMA 2VJ5A 2IS1A 3H5AA 4B48A 4N4OB 3VDXA 1V5FA 4PFPA 4XKBA 1MMDA 1X1DA 4BQOA 1TT0A 4IZZA 2HQAA 3PNVA 2P0WA 4B44A 3BCBA 2IS2A 1FMVA 1WJFA 2IXSA 3MKZA 2VASA 2WAFA 3LSIA 3SZGA 4OWRB 4PJNA 4JQFA 4Y33A 2W00A 1MMNA 2IS4A 2PMZA 1D0YA 4RM2A 3KYLA 4G6TB 2DT7B 2LBFA 2KP6A 1SFKA 4XONA 4R79A 3BC8A 3K4JA 3PSIA 2BVMA 3LL7A 3K70D 5HLTA 2LYCA 3DQVC 3VSLA 4C9YA 3N05A 3FKJA 4HNTA 4BEHA 1WJDA 2VXZA 2L2OA 2ZSIB 1QHGA 1X4PA 2LREA 3PUBA 4EATA 2IS6A 2RQQA 3K6GA 4KITB 2LY1A 2X85A 2HNHA 3DTIA 4X0GA 1WJBA 2A5WA 1J09A 4ANJA 4DBQA 2CH0A 3OYFA 2L7KA 3DPUA 3L2WA 4IQJA 2R7UA 3IP4B 2CW8A 1SAUA 4ITVA 4BJTA 2KQRA 3CESA 2HU9A 2E1MC 3M1CA 3PFYA 2LC2A 3ZR8X 3ZCOA 2FUG2 2VLAA 4CCMA 2WY7Q 5CPRB 1U0JA 3S3NA 2M4KA 3NWSA 2KHMA 3G2BA 2JA2A 3TMOA 5LFAA 2WBMA 5HVQC 3GBGA 4PSXA 3HKZA 1D1AA 3OMYA 3SDBA 4BJ5C 1JI8A 3OYCA 2VPLA 2A6TA 1UAAA 2VQLA 4LIUA 2XSJC 4XOPA 2M4GA 4GRIA 3RQ4A 2K5CA 4HSRA 3SEQA 1Y6IA 3ZRGA 3CP8A 4E7LA 4II2A 1TZLA 2X51A 3VYRB 3OYLA 1AA7A 2OV7A 4HSTA 3IAS2 4DIQA 4E4HA 3RPUD 1UG0A 2XC7A 2V6EA 2UUZA 2VQCA 4PSWA 3W2WA 3H9GA 3CZ6A 3S8PA 4PJLA 3HPHA 2VL8A 3LMMA 3SEZA 3MD2A 4CCOA 1K6YA 4II3A 2UWMA 3BCAA 2VJIA 3ZXSA 1N78A 4B47A 2DXIA 3OYNA 2XDVA 3I9V2 3D5SC 3BG7A 4HPQA 4NQWB 4PUSA 2KZVA 1X1BA 2V4JC 3OYAA 1X1AA 2F5VA 2V7FA 1Z7LA 4ZTFA 2WAEA 1WFXA 4AU7A 3OR1C 1D0ZA 3KX2A 4IKFA 5FRNA 4J00A 4CUGA 1D0XA 2KRHA 4BU2A 3RSNA 3A1YA 1Z21A 1ZELA 3OYDA 3EUAA 4RLQA 4BE1A 2V1NA 1Y56A 3DU6A 2E5NA 2CUJA 1W36C 3OIQA 5JHFA 4D9JA 4PJJA 3VYSB 4ZYAA 4XL9A 3UNGC 2MC4A 2PJRB 1YX3A 2MD0A 1W36D 3HOSA 3D5RC 2R7QA 1GLNA 3DTEA 3KEYA 3LSKA 4XMYA 4CH7A 3OIPA 4PJMA 4J01A 3L2VA 3S3OA 3OYJA 4F93B 2R7WA 3BG6A 2ELJA 2K9LA 3OS1A 2AQFA 3LSGA 2DJIA 3W2AA 4ZJZA 3FBIB 2VB6A 2M3AA 2DOAA 3QYBA 4F91B 3E1SA 2WA0A 4Y4RA 3HC7A 2CV2A 2BW3B 2MYSA 3U21A 4HRIA 3DPTA 4P5OA 4RMNA 3AKZA 4XKWA 5TGTA 3DLAA 3M8JA 1BR1A 1OLTA 4BUPA 2V9KA 4OAYA 3HPGA 3OS2A 3DPLC 3E0JB 5FRMA 2ZSHB 3HXLA 1QU3A 2LH9A 5HNFA 2VJJA 2E60A 2HZDA 2KDOA 3DKYA 4NNJA 3OYGA 3OYHA 3H5NA 3OS0A 1WJEA 4U7BA 4XLCA 1X4OA 2R7TA 2IGOA 4U87A 3OYBA 5KNLA 2R7XA 3OWTA 2K3PA 2I8DA 2DT6A 1UELB 2KMUA 3L2RA 4XLEA 4HG2A 4NC8A 2CMPA 4OAZA 2L5QA 1MNEA 2QKMB 2Q2EB 2CUZA 2VXDA 3OOUA 4Y3OA 3K4LA 4LIVA 2XF7A 2W4SA 2OC6A 1D1BA 4BJ6C 4CCLA 5HOOA 3F9KA 4XLAA 4LG3A 1EA3A 2X6WA 3D5LA 3OY9A 2K9MA 3LSHA 1E0EA 4BS9A 3VSKA 2W82A 2UV1A 2VKDA 3CJRB 1PJRA 1D1CA 2OUMA 3PNYA 1G8XA 2X6XA 4PFOA 1WJAA 2HPIA 4NUBA 3PNTA 2X1CA 3QODA 4CA0A 1KONA 3OL3A 5CKTA 4MLOA 1BR4A 3CJQB 1WJCA 1DGRM 4E7IA 3VYTB 1G59A 4BQNA 2ZFUA 2IGKA 3CF2A 4F55A 4CZCA 3J7AY 4ZDOA 2L9NA 2CV1A 1NG7A 1VZ0A 2LOOA 4ZDLA 4E6KG 2O5RA 4YEJA 1MNDA 2E1MB 4XN3A 4BGDA 4RM3A 5FROA 2IGMA 3H35A 3NWTA 1LFPA 2M7AA 3OR2C 2X1EA 3H9JA 3RTRA 2HVSA 1FMWA 3AL0B 4F3QA 3UR3C 2VJ4A 3BLYA 3C2GA 3IUOA 2KLOA 1N75A 2JUGA 3DWLE 1R6RA 4RLFA 2KPMA 1P9QC 2KRCA 4JOMA 1X19A 4B3XA 4E7JA 3IAM2 3OYIA 2WY8Q 4E7ZA 2W1OA 3H9QA 2LBFB 4BQQA 2R7RA 1LDKB 4E7HA 2JSPA 3K4MA 1YE9A 4PK4A 3QYEA 2Z1DA 1WJ5A 3EUHC 4N4NB 1Z3YA 4XR6A 1QHHD 3EUKL 3QYFA 1N77A 3PJRA 4BEHB 1V5GA 2NOJB 3TL4X 3A4CA 4DGWB 3TBIA 4FETA 2X1DA 4YRVA 1OR7C 2F6CA 3AFHA 2GOXB 4BXFA 2MFZA 3K4KA 1V5EA 3W2VA 4AYBA 3FBNB 3FHNA 2PJRA 5CQGA 1BOBA 4BL0B 2RREA 2R7VA 3ZGKA 3OYKA 3K70C 2RNGA 2AQEA 1MMAA 4BE0A 2IGNA 1YX5A 1NG6A 3S93A 2BOLA 2XF6A 4CCKA 4ZTJA 2VQGA 4XM3A 4KJZA 3L2UA 2R4GA 3W3CA 4HNUA 3FDYA 1DGWY 3K10A 2X6YA 4H4KC 2Y0SA 2V26A 5KCMA 2DCEA 4BACA 4HEA2 3SYTA 4CCNA 3CP2A 4KT6A 5CQEA 1Z3XA 3ONQA 4DOZA 2JVGA 2WADA 4P1WA 4C2UA 4AVZA 4XQFA 2WAQA 4BDYA 3S3MA 2LG4A 2BW3A 3V42A 4DJAA 3ZQQA 2HVRA 2Z2SB 3L2QA 4CSWA 3OL4A 3DKXA 3K4BA 3MKWB 4NC7A 2XF5A 2BVLA 3H0DA 3HL2A 4DBRA 5KHDA 2HDWA 2JVHA 2LRDA 4XKCA 1LVKA 1MMGA 2CFOA 2LY2A 1S9HA 2R7OA 3PL8A 3MMYB 3LFUA 2ZXIA 3I3LA 3DEEA 1T0FC 4XLHA 1LKXA 3S32A 4LITA 3AL0C 3QOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRH A;  2L2O A; 
#chains in the Genus database with same CATH topology
 1X1C A;  3R6S A;  4CO8 A;  4QPO A;  5BNG A;  2M7B A;  1UHM A;  2STT A;  2F5C A;  4EVI A;  2GA2 A;  4E7S A;  1XGO A;  3Q9V A;  2HPM A;  2XGC A;  4L0Y B;  3D0S A;  4QPQ A;  4C30 A;  1U8R A;  1ITY A;  4ZDP A;  2ELK A;  4IX7 A;  1G3T A;  4RAZ A;  2EA2 A;  5J1U A;  2BXY A;  5EZG A;  4BE2 A;  4UUS B;  5LD2 C;  3G6E I;  4MFD A;  2A6H F;  5EDN A;  1ZR2 A;  2JA5 J;  2BXZ A;  3H3Z A;  3U1D A;  2HVQ A;  1SFO J;  2ISY A;  2ZJP F;  1LVA A;  1RKW A;  3G1M A;  5GAG J;  2E1N A;  3A01 A;  1YRN A;  2CS3 A;  2GOM A;  2HOT A;  4AVP A;  1ERD A;  1BBY A;  5LGT A;  1GDT A;  5AIQ A;  3C2H A;  3VWB A;  1DQU A;  1WHU A;  2QM3 A;  4X6A J;  4NDL A;  2M0M A;  3ZMS A;  4I2O A;  1Z1D A;  1SAX A;  1LDD A;  3KEQ A;  2HKX A;  4BDZ A;  3KP5 A;  2PBI A;  3GO5 A;  1B59 A;  1WSU A;  2EIN H;  2KL4 A;  3WTW C;  1YOV B;  1H9T A;  1DP3 A;  2IS1 A;  3H5A A;  2FEZ A;  2IPQ X;  3GZ5 A;  4B48 A;  2CG4 A;  3ULQ B;  3VDX A;  1XGS A;  5J1Y A;  1JTY A;  4XKB A;  1T0F A;  3QP6 A;  1B8I A;  3SFI A;  4LB5 A;  1TT0 A;  1ZQ3 P;  1R1T A;  2EQR A;  2EJR A;  2BZT A;  2Y69 H;  4DQ2 A;  3KP2 A;  3AG1 H;  5F04 A;  3ESW B;  2MBF A;  3BY6 A;  1IN8 A;  3BCB A;  2O8K A;  1J9I A;  4MGR A;  3Q5F A;  2FQ4 A;  2IXS A;  2BEO A;  2QSH X;  4WXH A;  2MD5 A;  3FXM A;  2P7V B;  2WAF A;  1EH6 A;  3DEW A;  3EYY A;  2DFI A;  4OWR B;  2Y9Z A;  3T0Y A;  1RUN A;  4Y33 A;  2W00 A;  1MMN A;  3I71 A;  3CCJ I;  2Y9Y A;  3FIS A;  2K4B A;  3RQI A;  1D0Y A;  3JRF A;  3KYL A;  3CUQ B;  4FQG A;  4CZZ A;  3HOW J;  1ETK A;  3PSI A;  2OA4 A;  5HLT A;  2XPV A;  4ZYH A;  1R9T J;  2B9S A;  3N05 A;  2H1K A;  1WJD A;  2ZSI B;  1U5T B;  4RS8 A;  4DZJ A;  5D4R A;  5B66 C;  1X4P A;  3PUB A;  2IS6 A;  5J1R A;  2RQQ A;  5DUK A;  5CVU A;  3V8K A;  2GZW A;  1F9N A;  2CQK A;  2DOD A;  1O3R A;  4A0X A;  4HV6 A;  4QTR A;  4ANJ A;  2K9Q A;  1ZLJ A;  3DBL B;  4DBQ A;  3MWM A;  3RKX A;  2CRG A;  3CO6 C;  3L2W A;  4DYC A;  2K4J A;  4ITV A;  4ZH4 F;  1LEA A;  3CQZ J;  2E1M C;  4J19 A;  1MJA A;  2LC2 A;  1K6O A;  3PIO F;  2VLA A;  4KT5 C;  2JUC A;  1DU0 A;  1HKQ A;  1JUP A;  2R3S A;  2M4K A;  2FF4 A;  2KHM A;  2RC4 A;  2JA2 A;  3OIO A;  3TMO A;  5LFA A;  2WBM A;  1K61 A;  3PO2 J;  2DO7 A;  1FSE A;  3BZ6 A;  5E3L A;  2ZBK A;  1VI0 A;  1G3Y A;  3GW2 A;  3SDB A;  5JHU A;  2VPL A;  2A6T A;  4I99 C;  2YX7 A;  1BI0 A;  1A31 A;  2K5C A;  4HSR A;  3C7J A;  1P2F A;  4BH9 A;  3CDI A;  1TZL A;  5K7H A;  4ASN A;  3OYL A;  1SMT A;  2LMD A;  2E2J J;  4M3G A;  4HST A;  1PVE A;  2HZT A;  1IN7 A;  3O6B B;  1VQM I;  1POG A;  4UVC A;  4A5M A;  2V6E A;  2UUZ A;  1R7J A;  1EV7 A;  3MAJ A;  3HYI A;  2LY9 A;  4PJL A;  4C3J J;  5ILV A;  3CCR I;  3LMM A;  2VL8 A;  3SEZ A;  3MD2 A;  3HOZ J;  4II3 A;  4M71 A;  3HOY J;  2L7Z A;  2CO5 A;  1N78 A;  2IEK A;  2DXI A;  2RDP A;  2XDV A;  3I9V 2;  1AU7 A;  3BG7 A;  4HPQ A;  1K83 J;  1S7E A;  1ZGJ A;  1BJA A;  4PUS A;  1YFH A;  3HRM A;  1ZR4 A;  2VT2 A;  1MJ9 A;  1Z7L A;  1O3T A;  1BL0 A;  2V1X A;  2WAE A;  3TO6 A;  1V4R A;  4A3F J;  5F1J A;  3IH3 A;  1KZH A;  3RDI A;  1BA5 A;  4UVB A;  1VQ6 I;  2HXO A;  1Z21 A;  2XHK A;  5F0F A;  4A5N A;  4UUS A;  2LR8 A;  1TNT A;  4L5J A;  4O5V A;  3HOX J;  2E19 A;  5C44 J;  4BE1 A;  3DLL F;  1VFC A;  1TT5 B;  1FYM A;  1LFB A;  2L4M A;  4PJJ A;  2TDX A;  3VYS B;  2L3D A;  4G7O F;  3UNG C;  1U5T C;  4ENM A;  2PJR B;  2OQR A;  3ZQL A;  3IL2 A;  4FT8 A;  2L02 A;  1TW3 A;  4AM3 A;  2HYG D;  4YIF A;  3HOV J;  4CH7 A;  4CYC B;  5EGO B;  1H89 C;  2JWT A;  2Z3Y A;  4FHT A;  4V2F A;  1S8N A;  2EIK H;  3BPX A;  4Y7N J;  3BG6 A;  2PX9 A;  5E1Z B;  2ELJ A;  2EV6 A;  3PO3 J;  3WTY C;  2AQF A;  2H8W A;  2NVU B;  1RI7 A;  1UZC A;  1ETQ A;  4ZJZ A;  1F4K A;  4TV7 A;  2VB6 A;  4G8X A;  3W2A A;  5D6E A;  3QYB A;  3LA3 A;  4S0H B;  1IF1 A;  4IVN A;  1RET A;  1IXS B;  1SVM A;  4L9N A;  2MA3 A;  4D7M A;  3HC7 A;  2EZK A;  2CV2 A;  3KZY A;  1AHD P;  4RMN A;  5EG0 B;  2YSR A;  4MQ9 F;  2JA7 J;  4GDF A;  1BR1 A;  2IT0 A;  1OCZ H;  3OV8 A;  1QU3 A;  2LH9 A;  3HM5 A;  2HZD A;  2K02 A;  1YW9 A;  3VB2 A;  2VC0 A;  4U7B A;  4KN4 X;  3NQO A;  3M07 A;  4ZZD A;  1X4O A;  3ZMT A;  3CUQ A;  3OYB A;  2XAQ A;  3H36 A;  1Z05 A;  2M34 A;  2DBB A;  5F0H A;  5KAI C;  3PQJ A;  4YII A;  3KE2 A;  5D5X B;  2OF7 A;  1KQ0 A;  2A69 F;  1XN7 A;  2MLG A;  2L5Q A;  3O8H A;  1OYY A;  3IH4 A;  4C3I J;  3M4O J;  1Y8R B;  3RKQ A;  1MNE A;  1WGX A;  2QGU A;  3K1M A;  1U5T A;  2VKE A;  3FIW A;  4KIC A;  4Y3O A;  4CXF A;  1L3L A;  4LIV A;  1QPI A;  3X2Q H;  2CU7 A;  5LBQ A;  5HOO A;  3F8C A;  1ONV A;  4A3G J;  4XLA A;  2A07 F;  4HV5 A;  2X6W A;  2AS5 F;  2JRT A;  4M9Z A;  2K9M A;  3LSH A;  3TED A;  1AKH A;  5FKN A;  4BS9 A;  1OYI A;  5L3D A;  2W82 A;  1FT9 A;  2UV1 A;  3GXO A;  4GYG A;  2VKD A;  3S2D J;  2W84 A;  5D5W B;  2PMH A;  3TOA A;  1G8X A;  3I4M J;  2CW0 F;  2O0Y A;  2NRA C;  1T08 B;  3B02 A;  3SHF A;  5ILU A;  5JVT A;  1HOM A;  3QOD A;  1BN5 A;  5LGU A;  3BDD A;  1XGN A;  3S15 J;  1BI1 A;  3CJQ B;  2YS9 A;  5L3C A;  4WXC A;  5FKK A;  4BQN A;  1FOW A;  3IWZ A;  1E3O C;  1C0W A;  4GGG A;  4ZDL A;  4E6K G;  4K2E A;  3V7S A;  2OAZ A;  5B1B H;  4JBA A;  2DMP A;  4A3J J;  4LG0 B;  4D0P A;  2M0C A;  3SFZ A;  1FNN A;  2Y30 A;  3BTC A;  3QPL A;  2PQ8 A;  2COM A;  4RGR A;  5HOD A;  5FJ8 J;  2X1E A;  3RTR A;  4D7N A;  3ABT A;  1K4S A;  2HVS A;  2DA3 A;  2FNA A;  3AL0 B;  4F3Q A;  5L3G A;  5FLM J;  3FM3 A;  3GTP J;  1Z6R A;  3M8E A;  4H0E A;  4IHY A;  1U6G A;  5H6R A;  3H0G J;  2RVC A;  3TOB A;  2XIG A;  1WCM J;  1ZRC A;  5CVV A;  2KIU A;  3Q0V A;  1N75 A;  2KKO A;  3WU2 C;  1YTY A;  3DEU A;  2HDD A;  4GFB A;  3LST A;  1R6R A;  5ICF A;  1P9Q C;  1XGM A;  3VOE A;  4EGZ A;  2DA5 A;  2RNJ A;  3WU0 A;  3IAM 2;  3WTZ A;  2W1O A;  4BY7 J;  5M5X J;  3BJ6 A;  2H27 A;  2JSP A;  2LLK A;  4KMU X;  1ZG5 A;  4A3D J;  2Z1D A;  3ZP5 A;  4N4N B;  1QHH D;  3QYF A;  3DFG A;  3BP8 A;  3PJR A;  1V5G A;  2NOJ B;  3K69 A;  1RRJ A;  3QOP A;  4RB1 A;  3CCV I;  4FET A;  4ENJ A;  2X1D A;  4YRV A;  3D1N I;  5E3O A;  2DA2 A;  2FXA A;  1P4A A;  4AC0 A;  4BXF A;  1V5E A;  4MHG A;  3W2V A;  4AYB A;  4MQV A;  3CUO A;  3FBN B;  1T8I A;  4OIR F;  2PJR A;  1BOB A;  4AIK A;  1PUE E;  1G2H A;  2R7V A;  1VQK I;  3BJA A;  3OYK A;  2RNG A;  2AQE A;  3GZ6 A;  3E6C C;  4BE0 A;  2IAI A;  2ECC A;  2LVS A;  3S93 A;  2BOL A;  2PI0 A;  3BG9 A;  3BTI A;  3FMQ A;  4KJZ A;  4CYC A;  2R4G A;  5EGO A;  3W3C A;  1JUS A;  3FDY A;  2G0E A;  5FFZ A;  5KCM A;  4BXX J;  4BAC A;  3BG3 A;  4BHP A;  2ECB A;  5CQE A;  3GWZ A;  2MG4 A;  1FIA A;  2JVG A;  4YIR X;  2WAD A;  2IA2 A;  4P1W A;  3GTM J;  2WAQ A;  1X1P A;  5E1X A;  1ZK8 A;  3V42 A;  1JKR C;  3WG7 H;  3ZQQ A;  3JTG A;  2HGC A;  1U8B A;  1KA8 A;  2VC1 A;  1P7I A;  4F7Z A;  2A3S A;  3S2H J;  1HDP A;  4NC7 A;  1J2X A;  2XF5 A;  4DBR A;  3IC7 A;  3IRQ A;  4YFX F;  2R7O A;  2NS7 A;  1Y8Q B;  3I55 I;  2Y0M A;  1JXS A;  1O7F A;  1ZHF A;  3I3L A;  3ECH A;  3QRF F;  4I0A A;  4ZYD A;  3RI4 A;  1UB9 A;  2R93 J;  3AL0 C;  4XSX F;  3COA C;  3JW4 A;  1HA8 A;  2ZXJ A;  3ERE D;  4R8H A;  1R58 A;  4ZC3 A;  1F36 A;  4FAS D;  1XDU A;  1HXD A;  2KT0 A;  2VBX A;  2DMU A;  3RCO A;  4F92 B;  1BIB A;  3K4C A;  1FBQ A;  1KYZ A;  5CYV A;  3ASN H;  2ADU A;  4HDV A;  4KIS A;  1KU9 A;  3J81 Z;  4NHJ A;  3HJE A;  5EJC A;  4HNV A;  3K4N A;  3MKY B;  1R49 A;  2Q1Z B;  1FOX A;  3DKW A;  1UMQ A;  2BY1 A;  2TRT A;  4XOT A;  4LK1 F;  2PG4 A;  3GZN B;  3HG9 A;  2L4A A;  4OOI A;  2CV0 A;  2XGX A;  3ZPL A;  3M7G A;  2ZXH A;  1IN4 A;  1IDY A;  2XGE A;  1BR2 A;  1R23 A;  1JJ6 C;  4EJT A;  1TC3 C;  3KIO A;  4C2T A;  1S7O A;  2FMY A;  1Y1W J;  5HS9 A;  4HQE A;  3R61 A;  1TWH J;  1A36 A;  4U7D A;  2KJC A;  3HUG B;  2L9S A;  5DV5 A;  3MKL A;  3A2K A;  3ML6 A;  4HW0 A;  3SJM A;  4A3E J;  4KDP A;  2AXT C;  2E5Z A;  4XLF A;  3OYM A;  3G1L A;  4F52 A;  2CW7 A;  3FXU A;  2K9N A;  4KA4 A;  2GLO A;  2L54 A;  3LSM A;  4FX4 A;  2M8E A;  1XSD A;  2Z99 A;  2M87 A;  2I10 A;  4LG0 A;  3CMM A;  1MIJ A;  5E8G A;  1IO2 A;  2M30 A;  3O2P E;  2EZH A;  2AO9 A;  1V5F A;  4PFP A;  5AIP A;  1X1D A;  4YG2 F;  2HTJ A;  3V8L A;  1UST A;  5DM6 F;  2HQA A;  1JT6 A;  3PNV A;  2P0W A;  1Z91 A;  1IXC A;  2EIM H;  3L09 A;  3WU1 B;  2IS2 A;  2X0L A;  2FBK A;  3FHZ A;  3E7L A;  3F8M A;  2Z33 A;  2ELH A;  1J59 A;  2QSG X;  1LNW A;  4PJN A;  4OIP F;  3Q0W A;  2IS4 A;  2MC3 A;  3QAH A;  2CJJ A;  4QIW N;  4KMF A;  4G6T B;  3I59 B;  2FSW A;  4DYR A;  5F1R A;  5CVJ A;  1WI9 A;  3CDL A;  3DBH B;  2M1B A;  2KP6 A;  4R79 A;  1VQO I;  2GIV A;  2HFH A;  3M3Y J;  1IN5 A;  2M5W A;  1D3Y A;  2RGV A;  1X2M A;  5E20 A;  2PMU A;  4C9Y A;  4HNT A;  3CMY A;  4AID A;  2VXZ A;  1VQ7 I;  2CGP A;  1TQP A;  4M3F A;  2XB0 X;  1W5S A;  3K6G A;  4KIT B;  4OMZ A;  5F0C A;  2XUB A;  2LY1 A;  4RAF A;  4LB6 B;  1VQN I;  2O9L A;  1W5T A;  2D5V A;  2VI6 A;  2W57 A;  2HQ5 A;  3GYH X;  1QBJ A;  1J09 A;  1BW6 A;  1F1Z A;  1YYV A;  1OJL A;  1BJZ A;  2CH0 A;  5HLG A;  4WK8 F;  3OYF A;  4M72 A;  2AHQ A;  2V9P A;  3IP4 B;  2CW8 A;  1SAU A;  3FK6 A;  2DTR A;  3SZP A;  2K86 A;  3M1C A;  2KZG A;  4KIB A;  5F08 A;  2HOE A;  1CF7 A;  2VE8 A;  2FUG 2;  2E36 A;  1SD6 A;  2WY7 Q;  1BC7 C;  4PGG A;  1HDD C;  3G2B A;  1IN6 A;  2XVC A;  1HCR A;  3GX4 X;  3T5X A;  1S72 I;  2MLK A;  4IJA A;  3DBR B;  3A02 A;  3WGH A;  1IJW C;  4HF2 A;  5CVI A;  2BBY A;  2K40 A;  5K7F A;  1JUM A;  4Z2Y A;  3QPH A;  4EM1 A;  3HKZ A;  5IOZ A;  1D1A A;  2IRF G;  3FXQ A;  5J40 A;  1UAA A;  4LIU A;  1SD5 A;  1Y6I A;  3J80 K;  4ZZL A;  4E7L A;  3CF5 F;  4II2 A;  3VYR B;  4EJV A;  3E5X A;  2CFX A;  3L9F A;  3IRR A;  1E17 A;  1U9N A;  1S5L C;  2MGQ A;  4A0Y A;  3F8B A;  4E4H A;  2ZME B;  2BHY A;  1FP2 A;  4KN7 X;  1IRG A;  3LSR A;  5GTH C;  2EFO A;  2OU2 A;  3GFI A;  1I6H J;  3ZQI A;  2W85 A;  3HPH A;  2NVQ J;  2FA5 A;  4CCO A;  1K6Y A;  4I98 B;  3OSF A;  2HTS A;  3CJT B;  1TW2 A;  3OYN A;  3LAJ A;  3D5S C;  3P5J A;  1FWZ A;  3ELK A;  3WE3 A;  2F5V A;  1M1E B;  3OYA A;  3EET A;  1ZTR A;  2F2E A;  2E7X A;  5F64 A;  5ED4 A;  3ECO A;  4U0Y A;  5FRN A;  4J00 A;  1RR7 A;  4CUG A;  2VPR A;  1MSF C;  4BU2 A;  5HDK A;  2XV4 S;  2O61 A;  2HKO A;  1ZEL A;  2GAU A;  3OYD A;  5E1W A;  3CCL I;  5M5W J;  2Y0S N;  1Y56 A;  2NNY A;  2HOA A;  5LLQ A;  2PJP A;  2BY3 A;  5JHF A;  3JRC A;  2E1C A;  4W97 A;  2Y31 A;  2R0Q C;  3CCY A;  4IHW A;  3SQN A;  1D8J A;  5AON A;  4U0W A;  5FD5 A;  3RJP A;  1TWA J;  1G3S A;  2MH2 A;  2PLY A;  1Z7U A;  3L1P A;  2ZFW A;  4Q48 A;  3BRO A;  2PN6 A;  3DTE A;  2Y2Z A;  3LSK A;  4XMY A;  2OTL I;  1EF4 A;  3RZD J;  4UHT A;  2QSF X;  4UY8 I;  3S2W A;  3L2V A;  1XMX A;  1KU2 A;  3S3O A;  3OYJ A;  1O3S A;  4F93 B;  2OZU A;  5GTI C;  1RC9 A;  2K9L A;  4P96 A;  3OS1 A;  1XB4 A;  2OPT A;  2P5L C;  1YIJ I;  3FBI B;  1JTX A;  3F22 A;  1TNS A;  3GME A;  1SFE A;  4Y4R A;  3J80 Z;  1FOK A;  4JX5 A;  5KK1 A;  3AAF A;  2MYS A;  4B1R A;  2UZK A;  4Y15 A;  4HRI A;  3DPT A;  3AKZ A;  4XKW A;  5TGT A;  4EMS A;  4BHC A;  2VBW A;  1OCC H;  3U9G A;  5E3M A;  1DDN A;  2BV6 A;  1ODD A;  3T8R A;  1IDZ A;  3HPG A;  3OS2 A;  5FRM A;  3Q9S A;  3R0J A;  4RB0 A;  5H20 A;  4BBR J;  2E60 A;  5HNF A;  4FCY A;  2KDO A;  1EKE A;  5GAE J;  4NNJ A;  4IHS A;  2Z9O A;  2QF7 A;  3OS0 A;  1WJE A;  2VN2 A;  1W0U A;  4UXN A;  3FZV A;  4U87 A;  1KGS A;  3WE2 A;  4B3A A;  5BPI A;  2QBY B;  2R7X A;  2Y48 A;  4OMY A;  2ZME C;  4LLN A;  5C3E J;  5HLH A;  2KMU A;  5B1A H;  3L2R A;  1I39 A;  4Z6Y A;  4EGY A;  4NC8 A;  3SDG A;  4V2G A;  1HLV A;  1X2N A;  5F27 A;  4UVA A;  1VQ8 I;  1S6L A;  3K4L A;  4BXU A;  3JAM Z;  2W4S A;  1MBH A;  4CCL A;  1FTZ A;  3CCE I;  1B72 B;  5CVR A;  5JLX A;  4PZJ A;  5ICC A;  2ACJ A;  2HQR A;  4MO7 A;  3J7Z I;  3UKG A;  1GVD A;  4M3D A;  2DAO A;  5EYR A;  5FGM A;  3MZ8 A;  3BOQ A;  2R5Y A;  4EJU A;  4BAY A;  3O8G A;  2C6Y A;  2VBZ A;  3V7C A;  3OOP A;  1PJR A;  3ZQH A;  1OCO H;  2EV5 A;  3AG4 H;  5IT9 Z;  1UJ8 A;  2GWR A;  4HBL A;  4A2U A;  1S7A A;  1WJA A;  2HPI A;  3M9A A;  4HF1 A;  2X1C A;  1YJN I;  1KON A;  1O7L A;  2P81 A;  4MLO A;  1O4X A;  3B6C A;  3J7A O;  3K1P A;  4XLP F;  1BI3 A;  1MGT A;  3CF2 A;  4F55 A;  2ZJR F;  4X1E A;  2JN6 A;  2LOO A;  3FXR A;  5FKO A;  4B4C A;  1G4D A;  4WWC A;  4G6D A;  1QVT A;  4BGD A;  5FRO A;  3E97 A;  2NAZ A;  1VND A;  2VOD A;  2WV0 A;  3OR2 C;  1EH8 A;  3CUQ C;  4HLX A;  1MBG A;  2NOG A;  3RKY A;  2ZME A;  3I54 A;  1K4T A;  1TL8 A;  2JQ7 A;  2ZCW A;  3I56 I;  4N9H A;  2B7E A;  2QQB A;  2D2W A;  5FD6 A;  3C2G A;  1ULY A;  2KLO A;  4GCV A;  1MBF A;  3JRA A;  3LAP A;  1AOY A;  2JUG A;  3DWL E;  1HQC A;  2VOO A;  3BWG A;  1PP8 F;  4OIO F;  2OD5 A;  2KPM A;  3V7R A;  4A3M J;  2JRM A;  2VUM J;  2BGC A;  4JOM A;  3Q0U A;  4Y17 A;  4B3X A;  4E7J A;  3E5U A;  2L9R A;  5DCF A;  1QQI A;  3LQR A;  4BQQ A;  2R7R A;  1LDK B;  4E7H A;  1YE9 A;  1SEU A;  3QYE A;  1W1W E;  2H6B A;  4HZF A;  2W25 A;  4XR6 A;  2DW4 A;  3GTG J;  2GIZ A;  1WWX A;  1XPX A;  4BEH B;  5FLV A;  2ZO4 A;  1GV2 A;  3TL4 X;  1FBS A;  1OIS A;  2H8R A;  5FLX Z;  1XD7 A;  3TBI A;  5EF6 A;  1NH3 A;  2W24 A;  2F6C A;  4BNC A;  3BPV A;  2GOX B;  4L18 B;  3K4K A;  1SVO A;  5HDG A;  5J4Y A;  3LNQ A;  3ZGK A;  3K70 C;  3CCU I;  1R00 A;  5KVR A;  3KCC A;  2H1L A;  1I3Q J;  1WH5 A;  5L3F A;  4ZTJ A;  2B0L A;  2ESH A;  1IW7 F;  1Y0U A;  1K78 B;  1RIO H;  1R4N B;  1OMI A;  2X6Y A;  2QQ9 A;  5LRR A;  3WOD F;  3GCM A;  2DCE A;  3TGN A;  4HEA 2;  2ETH A;  4CCN A;  2DQL A;  3HGY A;  3ONQ A;  3BTJ A;  1JT0 A;  1UCR A;  5FFX A;  4C2U A;  3G73 A;  2M2E A;  3BZK A;  4BDY A;  2LG4 A;  2NVX J;  2H09 A;  4DJA A;  2E34 A;  5TRD A;  3BZC A;  3E6M A;  2E71 A;  1ZLK A;  3OL4 A;  3QPS A;  1FX7 A;  5KHD A;  1HSJ A;  4RAG A;  1ON2 A;  2JVH A;  1Y0N A;  2HYJ A;  1LVK A;  3GVA A;  4I7H A;  4JK1 X;  1TBX A;  5J47 A;  2ZXI A;  4A93 J;  1T2K A;  4XLH A;  3MZH A;  1APL C;  4LIT A;  5HLI A;  4D5C A;  1STZ A;  2XSD C;  2QEN A;  3EPZ A;  2FBH A;  1MW7 A;  4O3M A;  3KLN A;  2H6C A;  4I09 A;  3WTU C;  2MAB A;  4IQ4 A;  5IYD J;  5IP9 J;  3PSF A;  5DD4 A;  2WB1 A;  2VIX A;  5FKL A;  5LHH A;  2LF7 A;  4D5F A;  3FF5 A;  1UFM A;  3OYE A;  5H6Q A;  2HYF A;  1LFU P;  2J5P A;  1ZRF A;  2KFD A;  4WCG A;  2EBI A;  1B72 A;  5IYB J;  1YS7 A;  2EA4 A;  4BHB A;  2K85 A;  3G4S I;  1IV8 A;  3K7A J;  1O3Q A;  1T95 A;  1JJ8 C;  2R92 J;  1W7P B;  1MKM A;  4PJ0 C;  4UUV A;  3CCM I;  1PYV A;  3HSR A;  5D5V B;  3W6K B;  3HOT A;  1X3W B;  2VBY A;  4B43 A;  2DTZ A;  2XKO A;  3G71 I;  5DEQ A;  1GUU A;  3IKT A;  2QEX I;  4L5E A;  4E7K A;  2O7O A;  2VON A;  3RYR A;  4D1Q A;  2VQH A;  5EZH A;  3CJN A;  4W1U A;  3E5Q A;  2JMW A;  3BR5 A;  5DD8 A;  1K7A A;  3S14 J;  3U1K A;  1JHH A;  1GV5 A;  4EM2 A;  4XOR A;  2E35 A;  1FZP B;  5IY5 H;  1ETO A;  3ZMV A;  2W7N A;  3ZMZ A;  4XN0 A;  2GQQ A;  2KIF A;  1RR8 C;  2VJ5 A;  3S1R J;  4OIQ F;  1WKM A;  4A3B J;  4MTD A;  4M9X A;  2DK5 A;  1P4X A;  2DI3 A;  3J81 K;  4IZZ A;  2LNB A;  2EV0 A;  4MEY F;  2P5V A;  4MFE A;  3VOD A;  2HOS A;  1MSE C;  1XDS A;  3I4N J;  3MKZ A;  1A6Q A;  4M6X A;  3LSI A;  4ESB A;  3SZG A;  3RPU A;  3CC7 I;  3ABM H;  3BR6 A;  4ON0 A;  2P8T A;  2KIM A;  1O57 A;  2BE5 F;  1P6R A;  1HW1 A;  4L0Z B;  2PMZ A;  4R1H A;  1SC7 A;  4RM2 A;  1ENH A;  2DT7 B;  3RYP A;  3V8J A;  3FKI J;  3S1M J;  5DTD A;  4HAM A;  3HHG A;  5J8C A;  1SFK A;  5ERI A;  3K4J A;  1PUF B;  2BVM A;  3K70 D;  4BBS J;  2LYC A;  2O6G E;  1ZGA A;  4BEH A;  3KP4 A;  3TDZ C;  2V1U A;  1QHG A;  1RES A;  5E8I A;  5M3F J;  3G1O A;  4HDU A;  3HDD A;  4O6J A;  1TWF J;  3AG2 H;  1QO0 D;  3JRG A;  2X85 A;  1V54 H;  2DQR A;  3DTI A;  1IXR C;  1DP7 P;  2J5O A;  3ZQC A;  4Q47 A;  2FX0 A;  2O3F A;  5EG0 A;  2YU3 A;  2L7K A;  2R7U A;  1TQI A;  4A12 A;  5M3M J;  5CLS A;  4A3K J;  3EQL F;  1YG2 A;  2R7D A;  2KQR A;  4LK0 F;  3CES A;  3TW7 A;  3ROU A;  3PFY A;  3ZR8 X;  1GXQ A;  5J6X A;  4U88 A;  4XIC A;  1IG7 A;  1K78 A;  2CQQ A;  2G9W A;  5CPR B;  4XBF A;  5F6F A;  1Z67 A;  1CQT A;  3HIF A;  5BMZ A;  3HBL A;  2K3F A;  3JRH A;  9ANT A;  2DDA A;  3F72 A;  5FB2 A;  4KFC A;  2EH3 A;  3Q3S A;  3HTU A;  4PSX A;  3HEF A;  1LE8 B;  2L0K A;  3I64 A;  3OMY A;  1FOY A;  4BJ5 C;  3S16 J;  1JI8 A;  3OYC A;  2YU9 J;  1U78 A;  2EZL A;  2M4G A;  3CME I;  3RQ4 A;  4EJO A;  1FP1 D;  3ZRG A;  3CP8 A;  3HHH A;  1R5G A;  4L5I A;  5LGN A;  2X51 A;  3S17 J;  2WWY A;  1AA7 A;  3LWF A;  2IJL A;  4KYW A;  2FOW A;  3IAS 2;  3KP6 A;  3RPU D;  2XC7 A;  3SXY A;  3H3U A;  1YI2 I;  2VQC A;  4PSW A;  1MBK A;  1U3E M;  2F5F A;  3H9G A;  4PGH A;  2QA4 I;  3CZ6 A;  3BR0 A;  4HYE A;  1P7J A;  3ZOB A;  1KQ8 A;  2E7W A;  3BCA A;  4P9U A;  4AYB N;  4CHU A;  3B6A A;  3GTQ J;  4B47 A;  3FXO A;  1YW7 A;  4AD9 A;  5C4X J;  4RB3 C;  4FX0 A;  4NQW B;  1YQA A;  1X1B A;  3OSG A;  2V4J C;  3MVP A;  1MH3 A;  2ZC2 A;  5L3B A;  1WFX A;  5A2Q Z;  5GPC A;  3OR1 C;  2JPC A;  3CLQ A;  3WGI A;  3IV5 A;  4QSH A;  2XPU A;  2FQ3 A;  4I76 A;  1V55 H;  3NRV A;  4RLQ A;  2V1N A;  3DU6 A;  2CUJ A;  4DZP A;  3OIQ A;  1W7P A;  1EH7 A;  4IHX A;  1FLI A;  2QUF A;  3DXJ F;  2RN7 A;  2DFH A;  3GF2 A;  3WHB A;  2NXN B;  4ZYA A;  4XL9 A;  1YO5 C;  4C2M J;  1FC3 A;  2WAQ N;  4RGS A;  4FE7 A;  3N97 A;  1QGP A;  2OCE A;  1W36 D;  1R5H A;  2EK5 A;  3TDU C;  1SD4 A;  4UV9 A;  1B4A A;  3FWE A;  3ZQ7 A;  1NK2 P;  5HS8 A;  3CC2 I;  2ZXW H;  5IOY A;  4Q5S F;  2HQN A;  2QVO A;  3MFK A;  3BR2 A;  5J4V A;  1IC8 A;  3D5R C;  2R7Q A;  5IPA A;  1GLN A;  2Z5U A;  3KEY A;  3B73 A;  1ZYR F;  3OIP A;  3VFZ A;  4PJM A;  1T33 A;  3KP7 A;  1IUF A;  2HS5 A;  3MZY A;  4I01 A;  2EIL H;  1WQ2 A;  5IP7 J;  4Y52 J;  4JYK A;  4BYY A;  2R7F A;  2BYV E;  2ID3 A;  4G9Y A;  5GAD J;  5EEG A;  3LSG A;  2JK3 A;  2VE9 A;  2G7H A;  1Y39 A;  2HEO A;  3E1S A;  5DS9 A;  2WA0 A;  2BY2 A;  1HW2 A;  4L9V A;  2LKS A;  2GXB A;  1XC5 A;  3U21 A;  3A03 A;  1I1S A;  3F0C A;  1KU3 A;  3DCF A;  3F6V A;  4LLG F;  2NVY J;  2L9V A;  3DLA A;  1YS6 A;  3C2B A;  3HB9 A;  3M8J A;  1OLT A;  1GT0 C;  2V9K A;  1B1B A;  1R1U A;  3E0J B;  2ZSH B;  3E6B A;  2VJJ A;  1RKT A;  3FXK A;  3CO7 C;  1XMA A;  2IW5 A;  3OYG A;  1JE8 A;  3OYH A;  2EFN A;  1QZZ A;  2CYY A;  4XLC A;  3LSJ A;  1ZN2 A;  2R7T A;  2IGO A;  2FBI A;  5DCM B;  2AXL A;  2LD5 A;  3OWT A;  2UXN A;  3L2C A;  2K3P A;  2I8D A;  1I27 A;  4IPA A;  2DT6 A;  3RKW A;  4IRI A;  1PUF A;  5E79 C;  2UXX A;  4HG2 A;  5LHG A;  3RZO J;  1XX5 A;  3HRU A;  3QP5 A;  4S04 A;  5GPA A;  3FX3 A;  3ZQG A;  2Q2E B;  2CUZ A;  2DMT A;  3K2A A;  2P6S A;  2VXD A;  4ETS A;  3N4M A;  2XF7 A;  1MZB A;  2M8G X;  3GTJ J;  2OC6 A;  1D1B A;  1W7P D;  1BM9 A;  2A05 A;  2F5E A;  4N9I A;  3LA7 A;  4LG3 A;  1EA3 A;  2LF8 A;  3D5L A;  1B6A A;  3OY9 A;  3H3V K;  4AIJ A;  3VPR A;  3NAR A;  3MEX A;  2ZNY A;  2IA1 A;  2JJ7 A;  1YLF A;  1XSX A;  5ICG A;  1IV6 A;  3C18 A;  3CJR B;  3KZZ A;  2OUM A;  3PNY A;  5IP6 A;  5B5E C;  2X6X A;  3BR1 A;  2X9D A;  1ZG1 A;  4I6Z A;  2M9H A;  4EV0 A;  4XID A;  3PNT A;  2P5K A;  2DFF A;  4ESF A;  5JFR A;  4UV8 A;  4WX9 A;  4M73 A;  1R4M B;  4CA0 A;  1BR4 A;  4V19 K;  3TO9 A;  4DYQ A;  2GM4 A;  4MIM A;  5BPD A;  4E7I A;  1G59 A;  1LE8 A;  3J7A Y;  2IGK A;  4CGZ A;  4CZC A;  4ZDO A;  2L9N A;  2CV1 A;  5ILS A;  2STW A;  1Z9C A;  4S05 A;  2LSO A;  2IBD A;  1IRF A;  1USS A;  4YEJ A;  3FXL A;  5K5R A;  3HGG A;  3KZI C;  1MND A;  2E1M B;  2BY0 A;  4XN3 A;  1FTT A;  2A6E F;  1W5C C;  2YX4 A;  3E3V A;  4RM3 A;  4AIH A;  1LFP A;  4NB5 A;  1JHF A;  1HBX G;  3JAM K;  1T38 A;  4KIG A;  1JGG A;  4KUM A;  1A6I A;  3H1C A;  3UR3 C;  4A0Z A;  4L9J A;  1MMS A;  1J5Y A;  2LKX A;  2DA7 A;  4I0B A;  2VJ4 A;  3ISP A;  3M8F A;  3W6V A;  5DDG A;  2D45 A;  2VOP A;  2LFB A;  4RLF A;  1UHW A;  1X19 A;  2E1O A;  5IT9 K;  1NTC A;  3HUG A;  3OYI A;  2Y75 A;  4XRS A;  1MH4 A;  5K5Q A;  3FXJ A;  4I02 A;  4NQW A;  4E7Z A;  5J3L A;  3ZQF A;  2DOE A;  2LBF B;  5CJ9 A;  1H9G A;  2DN0 A;  3K4M A;  3FMS A;  1Z3Y A;  3I53 A;  1PP7 U;  4M74 A;  1KQ9 A;  1IGN A;  2ZB9 A;  3S1Q J;  5FO5 A;  4G7Z F;  3MCZ A;  4DGW B;  2ME0 A;  2FNP A;  3NEU A;  3ZN1 A;  1V3F A;  1OR7 C;  5E17 F;  2X4H A;  1YIT I;  3HKZ N;  1MBE A;  4RGU A;  3GTO J;  5IT3 A;  4LLL A;  1R22 A;  3FHN A;  1QPM A;  4BL0 B;  1JGS A;  1RNL A;  3C1D A;  2QWW A;  5ICE A;  1T98 A;  2IVM A;  2EIJ H;  4M3B A;  4XRM A;  1NK3 P;  4L9T A;  2IGN A;  1Z77 A;  2YPR A;  2XF6 A;  1LDJ A;  1VQ5 I;  4CCK A;  4GYI A;  2R7Z J;  3L2U A;  2JZY A;  1IRZ A;  1Q1H A;  2HI3 A;  4HNU A;  1NHA A;  3K10 A;  1MD0 A;  3DP7 A;  4Y13 A;  4LD5 A;  1H0M A;  3I59 A;  3SYT A;  2YUS A;  2ZNZ A;  2ME6 A;  4KT6 A;  1Z3X A;  2MW8 A;  1J7K A;  2I5U A;  4C3H J;  4RDU A;  4DNC A;  4A3C J;  4A3I J;  4XQF A;  3F3X A;  1I6X A;  3S3M A;  1BIA A;  4UNO A;  4EJW A;  3ZMD A;  4IRG A;  2WTE A;  2A5Y B;  3I4P A;  2Z2S B;  2HVR A;  2JTV A;  3IWF A;  3TP3 A;  3ZN0 A;  3QU3 A;  4CSW A;  2DMQ A;  3K4B A;  3CC4 I;  3MKW B;  3J7Y J;  1AKH B;  2FOK A;  2BVL A;  2XPW A;  3HL2 A;  3VEP A;  5FLX K;  1J0R A;  4GO1 A;  2HDW A;  4QLC U;  4HX4 A;  3JSP A;  1MMG A;  2GXA A;  2LY2 A;  3BQZ A;  1KYW A;  4JP0 A;  2VKV A;  2DPD A;  2V79 A;  2FRH A;  3IHU A;  2LP0 A;  1I1G A;  4EM0 B;  5B3S H;  3CCQ I;  2A61 A;  3DEE A;  3K1N A;  4GXO A;  3QU6 A;  3S32 A;  2XGD A;  5DCM A;  3DF8 A;  4M9S A;  1QA6 A;  2LDU A;  3QOE A;  1MBJ A;  1GXP A;  3KPH A;  1IUY A;  3CMA I;  1OR7 A;  4AUX A;  1IRX A;  2XAU A;  4RAY A;  2CUF A;  1LB2 A;  1FYK A;  4B8X A;  2Q2E A;  3VYU B;  2R7S A;  3QWL A;  1OYW A;  5D5U B;  3DTK A;  2QZ8 A;  2Z16 A;  3DU5 A;  5HNH A;  2DYR H;  4XKV A;  3WTS C;  4CYD A;  1A35 A;  4XRS G;  4KNY A;  1OPC A;  1FPQ A;  3T8T A;  3HRT A;  3A0B C;  5D6F A;  2QKL B;  4XRF A;  1ZRE A;  1VQL I;  2RQP A;  5E3N A;  1ZAO A;  3SZT A;  4MNU A;  2EZI A;  3ABL H;  2NNN A;  3W6J B;  4M6V A;  2JA8 J;  1KU7 A;  1UHS A;  3H5R A;  1I3A A;  4LJZ F;  1YW8 A;  4XNF A;  1DPR A;  2F4I A;  2CSO A;  1F5T A;  1PDN C;  4NC6 A;  4YEL A;  1I50 J;  2DK8 A;  4IEJ A;  2EWN A;  3R0A A;  4HOB A;  1A04 A;  1RZ4 A;  2VKH A;  6PAX A;  3CDH A;  3KFW X;  4CCJ A;  3V4G A;  5LHI A;  2L01 A;  1WPK A;  3HSF A;  3LSP A;  1D5Y A;  2DLL A;  3F21 A;  1XCV A;  2KIQ A;  1D8K A;  4CIC A;  5J8F A;  4MEX F;  2EFP A;  3GFM A;  5EEH A;  1G3W A;  4N4O B;  3TQN A;  1MMD A;  3GEZ A;  3KEO A;  4BQO A;  1XS9 A;  1ZKG A;  2RV8 A;  2EFW A;  1LPQ A;  2OTJ I;  1ACI A;  4B44 A;  1OKR A;  5DM7 F;  1EJ9 A;  4IF4 A;  3PUF A;  1FMV A;  2E2H J;  1RUO A;  4JX4 A;  2NS0 A;  1FEX A;  2QCO A;  2IP2 A;  1WJF A;  3MN2 A;  1DU6 A;  4ZYG A;  2JA6 J;  2VAS A;  3PQK A;  1TQM A;  2W48 A;  1X3Z B;  3WHC A;  2X48 A;  4JQF A;  3WG9 A;  1X3U A;  2TCT A;  2Q8K A;  1JKQ C;  1HKS A;  1Y1V J;  3WGG A;  4A3L J;  3ASO H;  4XLN F;  3HTS B;  4QWQ A;  4N0B A;  4E70 A;  2LBF A;  5K5O A;  5TJJ A;  4XON A;  3BC8 A;  3LQQ A;  4UUT A;  1ZGW A;  3LL7 A;  3BR3 A;  1REP C;  3DQV C;  4HX8 A;  4P9F A;  3VSL A;  1F43 A;  3FKJ A;  4HLY A;  2DU9 A;  4G7H F;  2L2O A;  1HF0 A;  3WTT C;  1H88 C;  2FJ1 A;  2ESN A;  2LRE A;  4RGX A;  1ORK A;  3BT9 A;  4EAT A;  3JRD A;  2H94 A;  3BG5 A;  4LOC A;  3BJO A;  1ZG3 A;  3R60 A;  3F23 A;  2HNH A;  3BQY A;  1W4M A;  3C3W A;  4X0G A;  1WJB A;  2A5W A;  1HKT A;  2K7L A;  2FML A;  1BC8 C;  2XB5 A;  2VT3 A;  3DPU A;  4IQJ A;  2CWE A;  3PM1 A;  3LA2 A;  4BJT A;  1DUX C;  4IXA A;  1WZ2 A;  2HU9 A;  5E18 F;  4OU0 A;  3HRS A;  4IOC F;  1MJB A;  3ZCO A;  3JRB A;  1S29 A;  4ENN A;  4IO9 F;  1OFC X;  2QYO A;  4CCM A;  1U0J A;  3S3N A;  1OCT C;  2KJB A;  3NWS A;  1ZRD A;  4ESJ A;  1YJW I;  2Q0O A;  2QBY A;  2DYS H;  1XTA A;  1YIO A;  2L7M P;  3EDP A;  2IA0 A;  5HVQ C;  3GBG A;  5LEK A;  1CGP A;  4UB6 C;  2QQA A;  5KAF C;  2OBP A;  1FSH A;  2PEX A;  3F8N A;  2V9V A;  2VQL A;  2XSJ C;  4XOP A;  2DFE A;  4GRI A;  3SEQ A;  1JKP C;  4G12 A;  4AWX B;  4BY1 J;  1QZY A;  1MDM B;  2RKH A;  4A6E A;  3O3K A;  1VQ4 I;  2ID6 A;  4IHT A;  3JCU C;  2OV7 A;  4M6Y A;  5LEJ A;  4DIQ A;  1QVU A;  1R1V A;  1UG0 A;  5FKM A;  1IZ1 A;  1P4W A;  2O03 A;  4IL6 C;  3W2W A;  3RPQ A;  3TW6 A;  1U2W A;  3S8P A;  1IAW A;  1BI2 A;  2UWM A;  2VJI A;  3ZXS A;  3HSE A;  4HA8 A;  3KP3 A;  3WTX C;  5EEA A;  1VTN C;  1B9N A;  3JR9 A;  2KZV A;  2KDZ A;  1E2X A;  1X1A A;  3LOC A;  2V7F A;  2GXG A;  1OQY A;  4ZTF A;  1R36 A;  1HW5 A;  4HF0 A;  3JTH A;  1P92 A;  2F4O B;  4AU7 A;  2HDC A;  1D0Z A;  3KX2 A;  4IKF A;  1D0X A;  2FU4 A;  2F5D A;  2KRH A;  1U9O A;  3RSN A;  1BOA A;  3A1Y A;  3KYD B;  1FBU A;  5D8K B;  1OCP A;  3IH2 A;  4WF2 A;  3EUA A;  1ETX A;  5IYC J;  2P4W A;  1W36 C;  2E5N A;  2OCC H;  2EFQ A;  1R5I D;  4D9J A;  1FYL A;  2KIS A;  1DPU A;  5GAH J;  2COB A;  2XRO A;  2DA6 A;  2MC4 A;  2NS8 A;  5DYM A;  1UG2 A;  1YX3 A;  1OCR H;  1XMK A;  5HS7 A;  1ETY A;  1WH7 A;  2MD0 A;  3QPT A;  3HZJ A;  4U0V A;  3BTL A;  1R71 A;  1LJ9 A;  5L3E A;  3HOS A;  2RAE A;  3ABU A;  3PIP F;  3ABK H;  1LUJ B;  3JRI A;  4J01 A;  4FIS A;  3K0L A;  2R5Z B;  2EB7 A;  2XAG A;  1TWC J;  2OQG A;  5LRS A;  3KET A;  4PDK A;  5K1Y A;  1XG1 A;  2R7W A;  2XAJ A;  5D4S A;  4BKX A;  1ETV A;  2CQX A;  2DJI A;  2M3A A;  2DOA A;  4F91 B;  4EEF G;  4YFK F;  5A2Q K;  2BW3 B;  1VQ9 I;  2A68 F;  3GFJ A;  4DW6 A;  1SFU A;  2D1H A;  1TTY A;  4P5O A;  1TWG J;  1MNM C;  2WB1 N;  3GUD A;  4OIN F;  4YFN F;  3F6O A;  3CD6 I;  4BUP A;  2YR2 A;  4OAY A;  3DPL C;  4IRH A;  3HXL A;  1E3P A;  4FTH A;  3P9K A;  3L7W A;  4A69 C;  2E2I J;  3AG3 H;  3DKY A;  2LTP A;  2M45 A;  3GLL A;  1CF7 B;  3H5N A;  4P55 A;  5K7Z A;  1XCB A;  4XSZ F;  5KNL A;  4G94 A;  1TP4 A;  5BS6 A;  4B09 A;  2XKP A;  1UEL B;  4XLE A;  4MTE A;  3K9T A;  4LMY A;  1QZE A;  3I5U A;  2CMP A;  1HST A;  4OAZ A;  3ERM A;  2GBY A;  2P7C B;  2QKM B;  3KYC B;  3CCS I;  2DA1 A;  3OOU A;  1ZAR A;  2DT5 A;  3PFI A;  2NYX A;  4ENK A;  4BJ6 C;  4M3E A;  1XSV A;  4NBQ A;  5BQT A;  3F9K A;  4JX6 A;  1H8A C;  4FE4 A;  2LK2 A;  3TP0 A;  3DV8 A;  2F4M B;  3P9I A;  2L7F P;  2BHZ A;  1RPW A;  3I58 A;  3TO7 A;  1E0E A;  3VSK A;  4G6Q A;  2F48 A;  2JT1 A;  2QQ8 A;  3P7N A;  4A6D A;  1TLH B;  3LFK A;  1D1C A;  3U2R A;  3A01 B;  1YRN B;  1SMY F;  2ZKZ A;  3T1B A;  2FD5 A;  4PFO A;  1AWC A;  2HWV A;  2X6O A;  4NUB A;  1N25 A;  2DJN A;  3JRE A;  3GTK J;  2XAF A;  1K79 A;  3OL3 A;  5CKT A;  1FIP A;  3RIR A;  3A0H C;  1WJC A;  1DGR M;  2K9S A;  1WI3 A;  3VYT B;  2XAS A;  2ZFU A;  3KLO A;  1GHC A;  4IOA F;  1NG7 A;  1VZ0 A;  2O5R A;  1J75 A;  3GTL J;  2PMZ N;  1W0T A;  3GFL A;  4IHV A;  1X58 A;  1MDM A;  1T56 A;  4LFU A;  4EQQ A;  2IGM A;  3H35 A;  1B8I B;  3NWT A;  2M7A A;  3H9J A;  1SFX A;  1E3H A;  1SAN A;  1FMW A;  2V1D A;  2JPB A;  1YJ9 I;  3E6D A;  1GVJ A;  5JLW A;  4RB2 C;  3BLY A;  3QQA A;  4CDG A;  3IUO A;  5DUI A;  3L00 A;  3IKV A;  1L0O C;  2DPU A;  2WV1 A;  4RBO A;  3HOU J;  3FM5 A;  1I5Z A;  2KRC A;  2MH9 A;  3F8F A;  3CLO A;  4HX7 A;  4WXD A;  3NAU A;  2HXI A;  2WY8 Q;  1VQP I;  2XRL A;  3H9Q A;  2EPF A;  4PK4 A;  2FE3 A;  1WJ5 A;  3EUH C;  1T39 A;  4BQA A;  1Q1V A;  1Z0X A;  2OJE D;  5JVG F;  3EUK L;  1Z6T A;  2D1V A;  4RA2 A;  1N77 A;  4XK4 A;  4Q4Z F;  3H92 A;  1LQ1 A;  3A4C A;  3GLX A;  4HQM A;  2ICW G;  2P6T A;  1T6S A;  1WRJ A;  1G6N A;  1QRY A;  3P9C A;  3EYI A;  2O8X A;  3AFH A;  3WTV C;  2MFZ A;  1WVR A;  1A5J A;  2N8G A;  5CQG A;  2G7U A;  1JKO C;  2RRE A;  1LEB A;  1FJL A;  2V6C A;  3TKY A;  1BW5 A;  2DDB A;  3CTA A;  1MMA A;  3G3Z A;  5TIS C;  1YX5 A;  1NG6 A;  2DOF A;  2LKP A;  1QNT A;  5JR3 A;  2VQG A;  4XM3 A;  5HDN A;  1S3J A;  2R5Z A;  1DGW Y;  2CUE A;  3R4K A;  4H4K C;  1D5V A;  2Y0S A;  2V26 A;  1HC8 A;  2KRF A;  3I0T A;  2JSC A;  2CQ7 A;  3CP2 A;  2DMN A;  2ISZ A;  1ZH5 A;  2CQN A;  4DOZ A;  2ZJQ F;  3MQ0 A;  2GA1 A;  4AVZ A;  5JI6 A;  2XAH A;  5H2F C;  2WC2 A;  2BW3 A;  4ZYE A;  2MSY A;  1VF9 A;  2DA4 A;  1ETW A;  2HR3 A;  5C4J J;  3ZMU A;  3JSO A;  3L2Q A;  2R5Y B;  1SVL A;  1YHQ I;  3DKX A;  1SD7 A;  1FY7 A;  5GP9 A;  3FMR A;  5M5Y J;  3H0D A;  4KIF A;  2XRN A;  2LRD A;  4XKC A;  2CFO A;  1S9H A;  1B9M A;  5D8L B;  3PL8 A;  2OZ6 A;  3EUH A;  3MMY B;  3LFU A;  4UB8 C;  5BOX A;  2PFB A;  3FK7 A;  3S1N J;  2K27 A;  3M1E A;  2ZJ2 A;  1T0F C;  4LGW A;  1LKX A;  2NVT J;  4ABZ A;  4PCQ A;  2QLZ A;  3K2Z A;  3REO A;  1ON1 A;  2B63 J; 
#chains in the Genus database with same CATH homology
 1X1C A;  3EPZ A;  1HA8 A;  1MW7 A;  4QPO A;  2M7B A;  2MAB A;  1IRX A;  2XAU A;  4IQ4 A;  4ZC3 A;  3PSF A;  4FAS D;  2WB1 A;  2VIX A;  3VYU B;  2R7S A;  4E7S A;  3RCO A;  4F92 B;  3DTK A;  2HPM A;  2Z16 A;  3K4C A;  3OYE A;  3DU5 A;  5HNH A;  4KIS A;  4XKV A;  4QPQ A;  4C30 A;  4ZDP A;  4IX7 A;  3K4N A;  3MKY B;  2Q1Z B;  4XOT A;  4BE2 A;  5LD2 C;  3HG9 A;  2CV0 A;  1T95 A;  2ZXH A;  2QKL B;  2HVQ A;  1BR2 A;  1PYV A;  3HOT A;  4C2T A;  4B43 A;  3H5R A;  4XNF A;  2CS3 A;  2GOM A;  4E7K A;  1ERD A;  2F4I A;  4D1Q A;  2VQH A;  2L9S A;  3HUG B;  3C2H A;  3VWB A;  1DQU A;  4YEL A;  3A2K A;  2E5Z A;  4XLF A;  2M0M A;  3OYM A;  2VKH A;  4CCJ A;  4F52 A;  2CW7 A;  4BDZ A;  4XOR A;  2KL4 A;  3LSM A;  2W7N A;  4XN0 A;  1DP3 A;  3CMM A;  2VJ5 A;  2IS1 A;  3H5A A;  4B48 A;  4N4O B;  3VDX A;  1V5F A;  4PFP A;  4XKB A;  1MMD A;  1X1D A;  4BQO A;  1TT0 A;  4IZZ A;  2HQA A;  3PNV A;  2P0W A;  4B44 A;  3BCB A;  2IS2 A;  1FMV A;  1WJF A;  2IXS A;  3MKZ A;  2VAS A;  2WAF A;  3LSI A;  3SZG A;  4OWR B;  4PJN A;  4JQF A;  4Y33 A;  2W00 A;  1MMN A;  2IS4 A;  2PMZ A;  1D0Y A;  4RM2 A;  3KYL A;  4G6T B;  2DT7 B;  2LBF A;  2KP6 A;  1SFK A;  4XON A;  4R79 A;  3BC8 A;  3K4J A;  3PSI A;  2BVM A;  3LL7 A;  3K70 D;  5HLT A;  2LYC A;  3DQV C;  3VSL A;  4C9Y A;  3N05 A;  3FKJ A;  4HNT A;  4BEH A;  1WJD A;  2VXZ A;  2L2O A;  2ZSI B;  1QHG A;  1X4P A;  2LRE A;  3PUB A;  4EAT A;  2IS6 A;  2RQQ A;  3K6G A;  4KIT B;  2LY1 A;  2X85 A;  2HNH A;  3DTI A;  4X0G A;  1WJB A;  2A5W A;  1J09 A;  4ANJ A;  4DBQ A;  2CH0 A;  3OYF A;  2L7K A;  3DPU A;  3L2W A;  4IQJ A;  2R7U A;  3IP4 B;  2CW8 A;  1SAU A;  4ITV A;  4BJT A;  2KQR A;  3CES A;  2HU9 A;  2E1M C;  3M1C A;  3PFY A;  2LC2 A;  3ZR8 X;  3ZCO A;  2FUG 2;  2VLA A;  4CCM A;  2WY7 Q;  5CPR B;  1U0J A;  3S3N A;  2M4K A;  3NWS A;  2KHM A;  3G2B A;  2JA2 A;  3TMO A;  5LFA A;  2WBM A;  5HVQ C;  3GBG A;  4PSX A;  3HKZ A;  1D1A A;  3OMY A;  3SDB A;  4BJ5 C;  1JI8 A;  3OYC A;  2VPL A;  2A6T A;  1UAA A;  2VQL A;  4LIU A;  2XSJ C;  4XOP A;  2M4G A;  4GRI A;  3RQ4 A;  2K5C A;  4HSR A;  3SEQ A;  1Y6I A;  3ZRG A;  3CP8 A;  4E7L A;  4II2 A;  1TZL A;  2X51 A;  3VYR B;  3OYL A;  1AA7 A;  2OV7 A;  4HST A;  3IAS 2;  4DIQ A;  4E4H A;  3RPU D;  1UG0 A;  2XC7 A;  2V6E A;  2UUZ A;  2VQC A;  4PSW A;  3W2W A;  3H9G A;  3CZ6 A;  3S8P A;  4PJL A;  3HPH A;  2VL8 A;  3LMM A;  3SEZ A;  3MD2 A;  4CCO A;  1K6Y A;  4II3 A;  2UWM A;  3BCA A;  2VJI A;  3ZXS A;  1N78 A;  4B47 A;  2DXI A;  3OYN A;  2XDV A;  3I9V 2;  3D5S C;  3BG7 A;  4HPQ A;  4NQW B;  4PUS A;  2KZV A;  1X1B A;  2V4J C;  3OYA A;  1X1A A;  2F5V A;  2V7F A;  1Z7L A;  4ZTF A;  2WAE A;  1WFX A;  4AU7 A;  3OR1 C;  1D0Z A;  3KX2 A;  4IKF A;  5FRN A;  4J00 A;  4CUG A;  1D0X A;  2KRH A;  4BU2 A;  3RSN A;  3A1Y A;  1Z21 A;  1ZEL A;  3OYD A;  3EUA A;  4RLQ A;  4BE1 A;  2V1N A;  1Y56 A;  3DU6 A;  2E5N A;  2CUJ A;  1W36 C;  3OIQ A;  5JHF A;  4D9J A;  4PJJ A;  3VYS B;  4ZYA A;  4XL9 A;  3UNG C;  2MC4 A;  2PJR B;  1YX3 A;  2MD0 A;  1W36 D;  3HOS A;  3D5R C;  2R7Q A;  1GLN A;  3DTE A;  3KEY A;  3LSK A;  4XMY A;  4CH7 A;  3OIP A;  4PJM A;  4J01 A;  3L2V A;  3S3O A;  3OYJ A;  4F93 B;  2R7W A;  3BG6 A;  2ELJ A;  2K9L A;  3OS1 A;  2AQF A;  3LSG A;  2DJI A;  3W2A A;  4ZJZ A;  3FBI B;  2VB6 A;  2M3A A;  2DOA A;  3QYB A;  4F91 B;  3E1S A;  2WA0 A;  4Y4R A;  3HC7 A;  2CV2 A;  2BW3 B;  2MYS A;  3U21 A;  4HRI A;  3DPT A;  4P5O A;  4RMN A;  3AKZ A;  4XKW A;  5TGT A;  3DLA A;  3M8J A;  1BR1 A;  1OLT A;  4BUP A;  2V9K A;  4OAY A;  3HPG A;  3OS2 A;  3DPL C;  3E0J B;  5FRM A;  2ZSH B;  3HXL A;  1QU3 A;  2LH9 A;  5HNF A;  2VJJ A;  2E60 A;  2HZD A;  2KDO A;  3DKY A;  4NNJ A;  3OYG A;  3OYH A;  3H5N A;  3OS0 A;  1WJE A;  4U7B A;  4XLC A;  1X4O A;  2R7T A;  2IGO A;  4U87 A;  3OYB A;  5KNL A;  2R7X A;  3OWT A;  2K3P A;  2I8D A;  2DT6 A;  1UEL B;  2KMU A;  3L2R A;  4XLE A;  4HG2 A;  4NC8 A;  2CMP A;  4OAZ A;  2L5Q A;  1MNE A;  2QKM B;  2Q2E B;  2CUZ A;  2VXD A;  3OOU A;  4Y3O A;  3K4L A;  4LIV A;  2XF7 A;  2W4S A;  2OC6 A;  1D1B A;  4BJ6 C;  4CCL A;  5HOO A;  3F9K A;  4XLA A;  4LG3 A;  1EA3 A;  2X6W A;  3D5L A;  3OY9 A;  2K9M A;  3LSH A;  1E0E A;  4BS9 A;  3VSK A;  2W82 A;  2UV1 A;  2VKD A;  3CJR B;  1PJR A;  1D1C A;  2OUM A;  3PNY A;  1G8X A;  2X6X A;  4PFO A;  1WJA A;  2HPI A;  4NUB A;  3PNT A;  2X1C A;  3QOD A;  4CA0 A;  1KON A;  3OL3 A;  5CKT A;  4MLO A;  1BR4 A;  3CJQ B;  1WJC A;  1DGR M;  4E7I A;  3VYT B;  1G59 A;  4BQN A;  2ZFU A;  2IGK A;  3CF2 A;  4F55 A;  4CZC A;  3J7A Y;  4ZDO A;  2L9N A;  2CV1 A;  1NG7 A;  1VZ0 A;  2LOO A;  4ZDL A;  4E6K G;  2O5R A;  4YEJ A;  1MND A;  2E1M B;  4XN3 A;  4BGD A;  4RM3 A;  5FRO A;  2IGM A;  3H35 A;  3NWT A;  1LFP A;  2M7A A;  3OR2 C;  2X1E A;  3H9J A;  3RTR A;  2HVS A;  1FMW A;  3AL0 B;  4F3Q A;  3UR3 C;  2VJ4 A;  3BLY A;  3C2G A;  3IUO A;  2KLO A;  1N75 A;  2JUG A;  3DWL E;  1R6R A;  4RLF A;  2KPM A;  1P9Q C;  2KRC A;  4JOM A;  1X19 A;  4B3X A;  4E7J A;  3IAM 2;  3OYI A;  2WY8 Q;  4E7Z A;  2W1O A;  3H9Q A;  2LBF B;  4BQQ A;  2R7R A;  1LDK B;  4E7H A;  2JSP A;  3K4M A;  1YE9 A;  4PK4 A;  3QYE A;  2Z1D A;  1WJ5 A;  3EUH C;  4N4N B;  1Z3Y A;  4XR6 A;  1QHH D;  3EUK L;  3QYF A;  1N77 A;  3PJR A;  4BEH B;  1V5G A;  2NOJ B;  3TL4 X;  3A4C A;  4DGW B;  3TBI A;  4FET A;  2X1D A;  4YRV A;  1OR7 C;  2F6C A;  3AFH A;  2GOX B;  4BXF A;  2MFZ A;  3K4K A;  1V5E A;  3W2V A;  4AYB A;  3FBN B;  3FHN A;  2PJR A;  5CQG A;  1BOB A;  4BL0 B;  2RRE A;  2R7V A;  3ZGK A;  3OYK A;  3K70 C;  2RNG A;  2AQE A;  1MMA A;  4BE0 A;  2IGN A;  1YX5 A;  1NG6 A;  3S93 A;  2BOL A;  2XF6 A;  4CCK A;  4ZTJ A;  2VQG A;  4XM3 A;  4KJZ A;  3L2U A;  2R4G A;  3W3C A;  4HNU A;  3FDY A;  1DGW Y;  3K10 A;  2X6Y A;  4H4K C;  2Y0S A;  2V26 A;  5KCM A;  2DCE A;  4BAC A;  4HEA 2;  3SYT A;  4CCN A;  3CP2 A;  4KT6 A;  5CQE A;  1Z3X A;  3ONQ A;  4DOZ A;  2JVG A;  2WAD A;  4P1W A;  4C2U A;  4AVZ A;  4XQF A;  2WAQ A;  4BDY A;  3S3M A;  2LG4 A;  2BW3 A;  3V42 A;  4DJA A;  3ZQQ A;  2HVR A;  2Z2S B;  3L2Q A;  4CSW A;  3OL4 A;  3DKX A;  3K4B A;  3MKW B;  4NC7 A;  2XF5 A;  2BVL A;  3H0D A;  3HL2 A;  4DBR A;  5KHD A;  2HDW A;  2JVH A;  2LRD A;  4XKC A;  1LVK A;  1MMG A;  2CFO A;  2LY2 A;  1S9H A;  2R7O A;  3PL8 A;  3MMY B;  3LFU A;  2ZXI A;  3I3L A;  3DEE A;  1T0F C;  4XLH A;  1LKX A;  3S32 A;  4LIT A;  3AL0 C;  3QOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...