2L2OA

Solution structure of human hspc280 protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKSANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQDLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0727 protein C6orf115
publication title Solution structure of the human HSPC280 protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14705 Costars Costars
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l2oA00
2KRHA 2L2OA
chains in the Genus database with same CATH superfamily
5CQEA 1XGOA 1MW7A 3G6EI 4O3MA 1U5TA 5L3DA 3PIOF 2KP6A 2MH2A 4S0HB 3PSFA 2VL8A 2YUSA 2CFOA 4NQWA 3H9QA 4X6AJ 2OBPA 2ETHA 5CVUA 2X1EA 2R5ZA 1P4WA 3LSMA 4XM3A 1LVKA 1FSEA 3A4CA 5J40A 3MD2A 5IT3A 5C3EJ 1RC9A 2Y31A 3IHUA 3PSIA 3KFWX 2ZJRF 1RKWA 4FE7A 1LQ1A 4GRIA 5CVIA 4B44A 3R60A 4PK4A 1EH8A 2CUEA 3CJTB 1XC5A 4C3JJ 3BG3A 4DGWB 2ZFUA 2HTJA 3J81Z 3ERMA 5LHIA 2TDXA 1TZLA 2ZFWA 2UXXA 3V7CA 1UHWA 2MG4A 2CH0A 3ASNH 3FX3A 2R92J 3QP5A 2V6CA 2NYXA 1H9GA 4LLGF 1OCCH 1D1CA 2KQRA 1X3WB 2WV0A 4A3BJ 2EV6A 4UY8I 1QZYA 1XGNA 2YX7A 5EF6A 5J8CA 2RVCA 3SFZA 3KZIC 2M2EA 3I54A 1IDYA 1GV2A 4GFBA 3M8FA 4PDKA 3QYBA 2VPLA 3QP6A 1E3HA 5LHGA 3WTWC 3OYGA 3VYTB 3ECHA 5B3SH 1WH7A 4CCMA 3GTLJ 1FPQA 3L2VA 4ZDOA 2HEOA 2FQ3A 4IJAA 1ETVA 2RV8A 2XPUA 2H1KA 2BV6A 3OMYA 1D5VA 1S29A 1ZGWA 2UXNA 5H6RA 3GYHX 4BU2A 2A5YB 2EV0A 1MBKA 4M9SA 5FJ8J 2VE8A 3GTQJ 5IP7J 1A04A 1ORKA 2W1OA 4IQ4A 5IT9Z 2QYOA 4ZYDA 4HLXA 3RQIA 2VIXA 2JK3A 5HNFA 1J7KA 2JPCA 2XB5A 3MZHA 4FQGA 1HDPA 4MFEA 1UMQA 2AO9A 2JUGA 3MMYB 4BE1A 1YJNI 2NRAC 2DYRH 2LMDA 4N9IA 4L9VA 2X51A 2GBYA 4S04A 4XR6A 3CCSI 4UV9A 5J4VA 5IYBJ 3TL4X 3A1YA 5HDNA 1HKQA 1Z05A 4XONA 4KIBA 3I71A 3CLOA 4HYEA 4HDVA 2X85A 3W2AA 1IW7F 4F55A 4RS8A 2QENA 4JK1X 3GWZA 1IXCA 2M30A 1FYKA 2L54A 5E8GA 1Y0UA 2G7HA 4IRHA 1ETWA 4ZYAA 1XCBA 5ICFA 4IO9F 4UNOA 1DGWY 1MGTA 2EH3A 2KJBA 1IN8A 3BTCA 1ZG1A 2WAFA 2TRTA 1ONVA 3RPUA 4DBQA 5A2QK 1T0FC 3J80Z 3TEDA 3G1MA 3FM3A 3WGHA 2I5UA 2M1BA 2IJLA 3CD6I 2X6WA 2ESNA 2RC4A 3HSFA 5EZGA 1GLNA 2AXTC 1P2FA 3OYKA 3FXJA 4ZH4F 3TOBA 4IRIA 2CGPA 2EPFA 1YRNB 1H89C 2G0EA 3EUKL 3K4BA 1FIAA 1JHFA 1I3AA 4G8XA 3GFMA 4MQ9F 4J01A 2GAUA 4F3QA 5ERIA 2J5OA 2DT7B 4IHVA 1BL0A 1F9NA 3H92A 3AFHA 1S5LC 3KE2A 3Q9VA 3LSIA 3GTKJ 1NTCA 1YS7A 4A0YA 5E3NA 2IT0A 1ETXA 3N05A 3Q3SA 2QSGX 2V9KA 2X6OA 4A3KJ 4BQQA 3LSRA 2BZTA 4G9YA 3CUQB 2DQRA 4D1QA 5HNHA 1FT9A 4A0ZA 3GTMJ 2E5NA 4ITVA 1Z3XA 1YHQI 5JHUA 3CJNA 3U9GA 3LSGA 4XMYA 3RKYA 3O8GA 1ETOA 2W00A 1X2MA 3HSRA 2E2JJ 3I55I 3KP2A 1YRNA 2IGOA 1PP7U 3RTRA 3HGYA 2P7CB 1ZG5A 4LMYA 3R0AA 3C2GA 2CV0A 4B47A 1HLVA 1APLC 1JGSA 1CQTA 1EF4A 5DCMB 3ZQGA 2VOOA 2ZJ2A 4BE0A 2KZVA 4Y4RA 1SFOJ 3S14J 3ZMVA 2M7BA 1TWCJ 4U88A 3ONQA 2IVMA 4L9TA 3F23A 2V79A 5JHFA 2MD0A 3KYDB 1K78B 1S7AA 2VBXA 5DM7F 2L2OA 3FDYA 3HKZA 3WU1B 2XAHA 3WTUC 3CUQA 2CV1A 3ZQHA 1D0ZA 1A31A 3SDGA 4LG0B 5KAFC 4F7ZA 2CW7A 3ZQIA 2VQHA 3MCZA 1HCRA 4XRSG 2IGKA 2D1VA 2NOJB 4E7JA 4LGWA 2COMA 2UV1A 1MMSA 1EH7A 4QPOA 1QQIA 2QWWA 5E1ZB 1OKRA 5DCMA 3ZOBA 1VZ0A 3G4SI 3S1NJ 2ZBKA 3ZPLA 3PNYA 3LSTA 4YEJA 3JRDA 1V5GA 1JT6A 1MMGA 2O6GE 3K4KA 1X1AA 2K3FA 2IA0A 2QBYB 2FQ4A 1K78A 2WTEA 5HVQC 3WODF 2Y2ZA 3HXLA 3H5AA 1G4DA 1S7EA 1KQ9A 4EGYA 2HWVA 4LG0A 1D8JA 3CC7I 4HA8A 3BCAA 2A6HF 2R7RA 3DEWA 3G1OA 4U0WA 3GZNB 2BE5F 3O2PE 5JFRA 4RBOA 3DLAA 2IA1A 3VWBA 1ZKGA 1VTNC 1W5SA 2GWRA 4LLLA 2V9PA 2XAQA 1XX5A 1U0JA 2WAQA 1ZRFA 5EEHA 2D45A 4HNTA 2AQEA 3DKXA 3DTIA 1X1PA 2CYYA 1EJ9A 1HOMA 4IOCF 3GFIA 4ENMA 3OR2C 4IHTA 4DZJA 2E5ZA 3HOXJ 1I1SA 3S93A 3E5QA 2CJJA 4KN4X 2F5FA 2UZKA 3IKVA 2DCEA 2LTPA 4UVCA 4XQFA 2QBYA 1N77A 2M3AA 2LFBA 1NG6A 3I4PA 3WTXC 1RUOA 3G2BA 2FX0A 1O3SA 3OSFA 1QBJA 4M3GA 2KDZA 3ULQB 4XN3A 4XLNF 3WE3A 3SZTA 3FK6A 3ZQFA 1D0YA 3K4LA 4EM0B 3QPHA 2HQAA 3V4GA 2XB0X 3ZMSA 3E6DA 5L3FA 3RKQA 1IV6A 2QSHX 1FTZA 5E3MA 1BI1A 4O6JA 4U0YA 1XSVA 1Z7LA 3MZ8A 2FU4A 2DPUA 1VQ6I 2RQQA 1R1TA 1TWAJ 3F8FA 2Q1ZB 4RMNA 2P81A 1F1ZA 4UVBA 3QPTA 1ZR2A 4V19K 1OQYA 1LEBA 1XG1A 3AG1H 4XSXF 2JMWA 3L2WA 3DFGA 3T0YA 3X2QH 1P7JA 5F04A 4ZJZA 4OAZA 2E1OA 2R4GA 5EZHA 2JA5J 1MBGA 2E71A 5FD6A 3K70C 3TO9A 2Z33A 3E97A 2OAZA 1LEAA 5GAEJ 5JLWA 2P0WA 4XOPA 1IDZA 4UUSB 4UB6C 1Y1WJ 2A05A 2QF7A 5M5WJ 2P7VB 4RDUA 2ZMEB 2HXOA 3DEEA 1O57A 3H0GJ 5FRNA 5K5RA 2L7KA 3PNTA 1IN7A 1R49A 5LD2C 3WTZA 2E60A 2K86A 3Q5FA 3HRTA 2EA2A 4GGGA 3BY6A 3HJEA 5LLQA 3JRGA 3ERED 1J9IA 5HS7A 2CW8A 4KUMA 2N8GA 3VB2A 2EBIA 4BXXJ 2FRHA 4RAFA 3V8JA 4KN7X 2E1MB 4IKFA 3FM5A 3S16J 4FASD 1R58A 5IYDJ 4RGSA 5CLSA 1G2HA 1YX5A 2MYSA 2F5EA 4Q5SF 2KIFA 5E1WA 2JSPA 4UUSA 5GTIC 4UHTA 1SD5A 1FBUA 2ZMEA 2F6CA 2EFPA 4BEHB 2LOOA 3TGNA 2OUMA 1ODDA 1FTTA 4XNFA 4AVPA 3JRIA 5GPAA 4HSTA 2QCOA 5CVVA 3T1BA 1RR8C 3OYFA 3COAC 4P9UA 4AVZA 1NHAA 2P8TA 3RPUD 4K2EA 4HLYA 3DPTA 2CRGA 3W3CA 5IY5H 3ABLH 3IAS2 1T6SA 4M9ZA 1PVEA 2HYFA 1I39A 2X1DA 1D3YA 4Z6YA 1KGSA 2WV1A 4BBSJ 3FXMA 2A6EF 2FD5A 2PMZA 3V42A 1YS6A 2WWYA 1YW7A 5TISC 4A3CJ 4I02A 2YU9J 1JE8A 2DPDA 1TQIA 3EPZA 4NC7A 3PQJA 3GF2A 4YIIA 1JJ6C 4R79A 5ICGA 4G7OF 4BEHA 3KCCA 2LR8A 3FKJA 3QWLA 1DPRA 4IHYA 3SQNA 3RZDJ 4DOZA 4D0PA 3NWTA 2V7FA 4A2UA 2L4AA 1O3QA 2UWMA 1HA8A 2JUCA 2OTLI 1T39A 1R36A 2M34A 3BC8A 1USSA 3CJRB 2HDCA 4ENJA 2Z3YA 4BAYA 3KP3A 5FKOA 4C2TA 3HDDA 5LGUA 1P92A 1PP8F 4EM2A 4HF2A 3FF5A 3QYFA 1A6IA 3AL0C 2A3SA 2DT6A 3F72A 4I09A 1JUPA 2RKHA 4YIFA 3F21A 1BJAA 2R7TA 3M7GA 2JWTA 3ASOH 3LAJA 3NARA 2MC3A 2VOPA 5J1RA 3JR9A 2PLYA 3D0SA 5C4JJ 2EWNA 1O7FA 1OMIA 3JRFA 2XGXA 1T33A 3VYRB 5LBQA 1Z6RA 2V26A 3LA2A 3EUHC 3OS2A 3S17J 1R5ID 2AXLA 4II3A 3IH4A 1XMAA 2DW4A 3E0JB 2F5CA 1QA6A 4LITA 3BJ6A 4P5OA 2FNPA 2PBIA 2DFFA 2CMPA 2P4WA 1MIJA 1W7PB 2HFHA 2KMUA 2ZSHB 1ZELA 5LRSA 2QA4I 1QVTA 4A93J 4M74A 2DK8A 2LDUA 3HSEA 3FXOA 2F5DA 1AKHA 1U9OA 4HW0A 1B4AA 3S15J 3GLXA 3QAHA 3BG5A 4KISA 5D8LB 4B09A 1RKTA 1BI0A 3A0BC 4QTRA 4D7NA 2LY1A 4BJ6C 2LKSA 4BS9A 2ECCA 5KHDA 4L5IA 2X1CA 2E1CA 4E7HA 3K9TA 4HX8A 3T8RA 2PJRB 2HKXA 3HTUA 2IS6A 1F5TA 4QWQA 4AU7A 3O8HA 4M6YA 3BWGA 1JTXA 1W7PA 1P7IA 3FXQA 3E6CC 4EV0A 3OY9A 5FGMA 2V4JC 1XDSA 4YRVA 4CYCB 1AU7A 1UJ8A 3BR0A 1J0RA 3ABTA 1IGNA 5H20A 1WGXA 3M8EA 3QOEA 4G94A 3OYNA 3S2DJ 3DV8A 3FZVA 5EEAA 4BJ5C 4CCLA 3G1LA 2XIGA 2MD5A 2X9DA 2JN6A 3ABMH 1W5CC 2OTJI 2GLOA 2Y9ZA 2CSOA 2JJ7A 1MBEA 3V7SA 4BY1J 3HIFA 2DA7A 3CMYA 3O6BB 2PJRA 2KZGA 3B6AA 2HPIA 4XICA 1XCVA 1JKPC 1TW3A 3LL7A 1Y6IA 3JSOA 1BN5A 2K85A 2VKVA 3C2HA 5D5UB 5EDNA 2EILH 3J7YJ 2LK2A 1B8IB 5E18F 2F4MB 3LSKA 4CYCA 5F0CA 1KU9A 3BDDA 5GADJ 3IWFA 2KJCA 4OIQF 1WPKA 4RLFA 1KYZA 3HRMA 1B72B 3BR1A 2HXIA 3LWFA 3H5RA 4BHPA 4XRSA 3BR5A 2C6YA 1RPWA 3HEFA 4TV7A 2OV7A 2A68F 2LF8A 1KU7A 5EJCA 1YJWI 4XLCA 2OJED 3CO6C 3OYAA 2H6CA 2EFWA 2XC7A 3H0DA 1MD0A 2IP2A 4PCQA 3BR6A 4L5EA 5K5OA 4G6TB 2FJ1A 4FX4A 1MDMB 3D5SC 2WY8Q 1P4AA 1B8IA 3OYDA 2RREA 1HQCA 2QM3A 2IGNA 1YE9A 2DI3A 3K4CA 5HS8A 2P5KA 2XAFA 3TO7A 1E0EA 2AS5F 2OU2A 3CTAA 4OWRB 1T0FA 4DQ2A 3S1MJ 2W57A 3C18A 3KPHA 2NS8A 5DD4A 2K27A 1YO5C 1B72A 2DMTA 2DMUA 3H3UA 4AC0A 4KA4A 2E36A 1J2XA 4M6VA 4RGXA 1LKXA 1Y39A 5M3FJ 2CW0F 2ELJA 4D7MA 2M8EA 4QPQA 3PIPF 2O0YA 1Z77A 4C2MJ 1HSJA 2DAOA 1U9NA 1MNDA 2EFNA 4XLAA 5F08A 2Z9OA 1E17A 3ELKA 4BQOA 2VJJA 3BQYA 3E5XA 3SEZA 4AIDA 2ZSIB 4DJAA 4RB3C 3FMQA 5M5YJ 1R5HA 2R5YB 1MDMA 2F2EA 1WJAA 4JQFA 1V5EA 2ZXHA 2LKPA 2MH9A 3FXLA 3VDXA 3CJQB 4IXAA 1Y0NA 4CGZA 1UZCA 2KIUA 2GM4A 1ON2A 4L18B 1XB4A 1Z1DA 2W82A 1VI0A 1I3QJ 5LHHA 4DYCA 2M4KA 4B8XA 1JXSA 2JT1A 2VN2A 2L9SA 2L7ZA 1ZR4A 4LJZF 1KQ8A 2RGVA 5D5VB 1KU3A 2RQPA 3F8MA 4EJOA 1J75A 2H94A 4CH7A 1FWZA 2VT2A 3KP7A 2FXAA 2JVGA 2NNNA 3G3ZA 2KFDA 2OPTA 2A61A 4CUGA 5GAGJ 3DKYA 3S32A 1TP4A 4U87A 2CU7A 4G7HF 2R5YA 4MIMA 4D5FA 3MEXA 1KYWA 4HSRA 2W85A 1FSHA 3E6BA 3DTKA 1RETA 2E2HJ 4CO8A 3R0JA 2BY0A 3OIQA 1FIPA 1HW2A 5CQGA 2DYSH 1IUYA 5CYVA 1DGRM 1YW8A 1ZHFA 3BZCA 1DQUA 2KRHA 3M8JA 3KEYA 4YELA 3U2RA 3ZP5A 4C2UA 1DUXC 4YIRX 1RIOH 3PQKA 1G3YA 3F6VA 4HV6A 4XBFA 2IS1A 2JZYA 4AIKA 1WQ2A 2Z99A 5DUIA 3ZGKA 4M3EA 3F8NA 1MBHA 1R71A 3T5XA 3WTYC 4ESJA 1HSTA 2NS7A 4AWXB 2FUG2 3JREA 3MVPA 1BIAA 1ZARA 4A3DJ 2ZCWA 1IXRC 1YW9A 1IRFA 1USTA 4NC8A 1ZREA 2XDVA 2DDAA 4A3IJ 2GOMA 2L9VA 1B1BA 1HKSA 3KEQA 1UELB 3TP3A 1SMYF 1BJZA 1FOWA 2K4BA 2WBMA 1IJWC 4EATA 1YG2A 4BL0B 4CYDA 2M5WA 3I5UA 2GIVA 3G73A 4ZTFA 5CVRA 5F0HA 3K2ZA 1W36C 3U21A 1DU0A 2GXAA 3BG9A 3TDZC 2VODA 2ISYA 3Q0VA 1MJBA 4RAZA 2P6TA 1ETYA 3HPGA 1ZLKA 3K6GA 4UXNA 2ZB9A 2QLZA 3UNGC 3D5RC 3IP4B 4C3HJ 1U5TC 3A01B 2DK5A 3L2UA 1Z67A 2X4HA 2O9LA 3HC7A 2STTA 2IGMA 2KKOA 1K79A 5B66C 3BLYA 3HM5A 2PJPA 1M1EB 2NOGA 2BY2A 2IS2A 3GZ5A 2DFEA 3QPLA 3A2KA 4KNYA 4M3FA 1IN4A 1MJ9A 5E79C 1U78A 4GYGA 2EZIA 1UG0A 2QKLB 4EM1A 1TWHJ 1SEUA 3MWMA 1UFMA 5EG0B 3P9KA 4G7ZF 3WG9A 1ZAOA 2ME6A 1QO0D 4UV8A 3KIOA 4LFUA 2W48A 1GXPA 1E2XA 2PG4A 3KP6A 1ZGAA 1LJ9A 3FISA 2OD5A 3H5NA 2DLLA 4W97A 1YJ9I 5ILSA 2CQQA 4DNCA 1VQMI 1S6LA 2KISA 3CDLA 3W2WA 4Q48A 1WZ2A 4RM2A 4Y13A 1W7PD 3I0TA 1R7JA 3Q0UA 3GXOA 4XK4A 3FMRA 4OINF 3LFKA 3TDUC 3BG7A 4BXUA 3A03A 3RCOA 4RA2A 2VI6A 2K9MA 1HKTA 1R23A 3K1MA 3JSPA 2M0MA 1VQ4I 2AQFA 1PDNC 1WJBA 2FEZA 4I6ZA 1VFCA 2D2WA 3TQNA 2JRTA 3RYPA 4J00A 4KMUX 1SC7A 4E6KG 1SAUA 4HV5A 5FB2A 2VLAA 3OYMA 5EG0A 1ITYA 2HZTA 5LGTA 3V7RA 2DTRA 4HDUA 1EKEA 3LA3A 5CVJA 1XD7A 4IQJA 3DU5A 2HVSA 2Y0MA 4ZTJA 1ZN2A 3UR3C 2BGCA 3CF2A 3KP4A 4V2GA 1OYYA 1SD7A 2E7WA 2ELKA 2QQBA 5E8IA 4A3LJ 1SD6A 2KIMA 5ILVA 3CP8A 3BJOA 3GCMA 1X3UA 3CCVI 2GXBA 4H4KC 5ICEA 2O8XA 2DA1A 2IS4A 1XPXA 1P6RA 4XN0A 2XGEA 2VB6A 5FKNA 2JRMA 4UVAA 5BQTA 1LDDA 1NK2P 3WHCA 2OZ6A 5LEKA 4EJTA 2XF6A 4I98B 1PUFB 2BYVE 4MLOA 4FTHA 1HW5A 1BM9A 1T95A 5AIQA 3LQQA 1BW5A 1TL8A 1TW2A 1YX3A 3BOQA 1SFEA 3RDIA 3BP8A 1WJ5A 4UUVA 1OISA 3MKLA 3I4MJ 3ZQCA 1GHCA 2K4JA 4E7ZA 1WJDA 3K4MA 4M73A 3K1NA 3GUDA 4G6DA 2KL4A 4B3XA 4ZYEA 2EV5A 3M4OJ 5DDGA 3J7AY 1LDJA 1ETKA 5GP9A 4BACA 2FNAA 4U0VA 5ILUA 3GX4X 1H8AC 1TWFJ 3ABUA 3HL2A 2EIJH 1MBFA 4IPAA 1E3OC 2XAJA 2XGDA 2DN0A 2Y48A 4HAMA 4KT5C 1PJRA 1L0OC 1B9NA 3VPRA 1PUFA 4LK1F 1MBJA 1MMNA 1TNSA 2MLKA 2V1XA 3AKZA 1DDNA 2DFHA 1BI3A 1SANA 1NK3P 2GIZA 3NWSA 3MKYB 2XSJC 5HLGA 2J5PA 3OWTA 3S1QJ 3HRSA 2DXIA 2Z5UA 3HOVJ 5J1UA 1U6GA 2ZJPF 2VBZA 2HQNA 1EH6A 1HBXG 5FLXK 3CMEI 5IYCJ 1UHMA 1ZGJA 5TGTA 4IHXA 5F1RA 5B1AH 3F3XA 3OS0A 1WJFA 3L2RA 1FX7A 1YFHA 3DKWA 1F43A 3QQAA 4E7KA 2XF7A 3MKWB 1QHHD 1D1BA 2O7OA 2L4MA 2YX4A 4IX7A 2I10A 1A6QA 3BZKA 3IL2A 4I2OA 2KT0A 2M45A 3OSGA 1S3JA 1YIJI 3BPVA 2Z2SB 4XKCA 5DCFA 1CGPA 3KZZA 3NQOA 1FBQA 4BYYA 2CS3A 3RZOJ 2Y9YA 3KYCB 2DJIA 2BVMA 2XF5A 2CQ7A 1J59A 2DBBA 1UCRA 2OA4A 3HG9A 2HOSA 2MGQA 5BPIA 2M87A 4DBRA 2PFBA 1JGGA 2VBWA 1V5FA 4LB5A 1X1CA 2XKPA 3FBIB 2P6SA 1ZRDA 3MKZA 2L01A 5J47A 4HF1A 3OYIA 4MEXF 1U2WA 3JRBA 2HQRA 4UUTA 3GTGJ 1Q1VA 3LSPA 1LFPA 1YQAA 4GYIA 5D8KB 5J1YA 2Y75A 4AIHA 2DA2A 2ZC2A 3WHBA 3OIOA 3E1SA 1R9TJ 1V4RA 2QGUA 4BNCA 3L2QA 3BT9A 2E2IJ 3WTVC 3J81K 3L2CA 2XPWA 5AONA 2EINH 1QRYA 5AIPA 4JX5A 4OMYA 3SZPA 1XN7A 1XGSA 4MTEA 2O8KA 1ZH5A 4BHBA 5J8FA 3FMSA 4RLQA 2R7SA 3O3KA 3BZ6A 2ZXIA 1QHGA 4F52A 4YFXF 2EFQA 2BBYA 4PJNA 3DTEA 3OOUA 1Z21A 2VASA 4MQVA 1IAWA 1GXQA 3JRCA 2VKDA 2W84A 1DP3A 2LD5A 3S3OA 4EJWA 2VUMJ 3C2BA 3ZMTA 2L9NA 3HHHA 5KCMA 2WC2A 1U8RA 4F91B 2LSOA 1IO2A 2KRCA 4HX4A 3TMOA 1X19A 2Q2EB 3N4MA 3H3ZA 4KICA 3DQVC 4I7HA 1SAXA 2HQ5A 2Q0OA 3I53A 1BR4A 1JTYA 1ZYRF 2EZHA 3QYEA 2YU3A 3TKYA 3TO6A 1EA3A 2KLOA 2OQRA 1WRJA 1SFXA 1QNTA 2LNBA 1EV7A 4YG2F 2DMQA 3S8PA 5GPCA 3S3NA 2JA7J 2LVSA 2XV4S 2R0QC 5IT9K 1TWGJ 4Y3OA 5L3BA 5LFAA 1JUSA 3IRQA 4PFOA 1YIOA 3JRHA 1V55H 1YTYA 4AM3A 1OCRH 5A2QZ 2MA3A 2LKXA 2JA8J 2LH9A 3PM1A 2Q2EA 2OC6A 4LK0F 1VNDA 3K0LA 3FHNA 3B02A 3ZMUA 5KVRA 2M9HA 5HOOA 4BY7J 1SFKA 3BTIA 4W1UA 4XKVA 1I5ZA 4QLCU 5FLVA 1BI2A 3OYBA 3BJAA 1MKMA 2VXZA 4IHSA 4NBQA 3P7NA 5DUKA 4KFCA 3VSLA 4FT8A 4AYBN 1IF1A 3HOYJ 5JVTA 1LDKB 2LC2A 2FBKA 2NAZA 3KZYA 3OYJA 5JVGF 1JKRC 2E7XA 1Z3YA 2H8WA 2QZ8A 4KDPA 4N4NB 2ECBA 3FIWA 4C3IJ 1A35A 3U1DA 2MBFA 1ZK8A 3LSHA 2HDWA 1IRXA 4LOCA 1NH3A 2Y69H 1XSDA 3LNQA 3K70D 4CCJA 1K6YA 5EGOB 3WE2A 1SVMA 2XUBA 3V8KA 2HOEA 2BXYA 1WI9A 1JKOC 1B6AA 4BQAA 3GTOJ 1Y8QB 2NVYJ 4I01A 4E7IA 3JRAA 2IEKA 2W25A 4B48A 2R7QA 3DP7A 3ROUA 3G71I 4PJMA 2K9QA 1PYVA 3L7WA 2YR2A 3MN2A 3LMMA 2VJ5A 4HF0A 3DBHB 1ULYA 2QVOA 4B4CA 2XPVA 2ESHA 5LRRA 5J4YA 4MHGA 3IWZA 1FBSA 2M0CA 3AG4H 3I56I 5D4SA 4EGZA 1RNLA 2NVUB 5HDKA 3RI4A 2PQ8A 4RB2C 1BA5A 1S8NA 2AHQA 3K4NA 5EGOA 2ZJQF 3ZR8X 3S2WA 5JI6A 3FBNB 4XOTA 3ESWB 4A12A 3KEOA 1E3PA 2H27A 1Z7UA 2O03A 4JBAA 3FHZA 1IUFA 4OIOF 2MABA 1G3TA 1VQKI 3JTHA 1G59A 4BH9A 2KRFA 4GXOA 2O61A 1OYWA 3JAMK 5DV5A 5CJ9A 2HU9A 4KMFA 3N97A 1TT0A 3PNVA 1GVJA 1BW6A 3OL4A 2O5RA 5TJJA 3VYSB 3CC4I 3NRVA 3CESA 3PUBA 3GVAA 2QUFA 4ASNA 3PO3J 1SD4A 1WJCA 1X2NA 2V9VA 3KLNA 4HQMA 4LLNA 1OCPA 1R1VA 5IP6A 4RGUA 2EZLA 1HW1A 2EFOA 3NEUA 2R3SA 2BHZA 4HRIA 4OAYA 3HOWJ 4CCNA 1IN5A 5E3OA 1ZLJA 4D9JA 1YOVB 2R7OA 3HGGA 1HDDC 2UUZA 3CO7C 3I58A 1XMXA 1W0UA 4ZYHA 3ECOA 4BXFA 1BOAA 5E20A 2BY3A 3IC7A 2VE9A 2XRLA 3GEZA 1H9TA 4OMZA 4WXCA 4ZDPA 1H0MA 2L3DA 4ZDLA 5F0FA 3OYCA 2ZXJA 2K3PA 1MZBA 3QPSA 2XGCA 3AG2H 4QSHA 1VQNI 2ISZA 5ICCA 2XROA 2HOAA 4MO7A 1KZHA 3VSKA 3QU3A 9ANTA 3LA7A 3OOPA 1D5YA 5K5QA 4CZZA 3IRRA 4Q47A 4WK8F 1RZ4A 2RNGA 3A0HC 3JTGA 2R7UA 2R7VA 5FLXZ 4AYBA 3KX2A 5C4XJ 2JA2A 1J5YA 4XLHA 4J19A 1LFUP 5HLHA 3CLQA 4BGDA 4CA0A 2BEOA 1C0WA 2KDOA 1XGMA 5HDGA 2NVQJ 5FD5A 4LB6B 5M5XJ 2WB1N 3GBGA 1OLTA 2KIQA 3AG3H 5F64A 4KIFA 1RI7A 1HC8A 2MFZA 4A3EJ 4IEJA 3GFJA 2DOEA 1JI8A 3F0CA 3L9FA 3J7ZI 5DYMA 1TQMA 1VQPI 1GT0C 2L02A 4OIPF 3ZQLA 1FOYA 1S72I 4ON0A 5KNLA 2VKEA 2CUJA 3ZMDA 2OF7A 4Y33A 1BC7C 2ID6A 3OV8A 4M3BA 3OYLA 1WH5A 1IRZA 2R93J 2IA2A 3E7LA 4IF4A 1HF0A 4L0YB 1O3TA 5D6FA 2HS5A 3HRUA 3H9JA 3VEPA 1IXSB 1V54H 2LY9A 1TQPA 3JW4A 2EZKA 2MW8A 5DS9A 2F5VA 3SHFA 3CMMA 4DZPA 2NVXJ 2H8RA 1W0TA 4BUPA 5HS9A 3BROA 5BS6A 3CCEI 4JYKA 3RYRA 3ISPA 4XRFA 5CKTA 3LAPA 5TRDA 2IRFG 2HZDA 2FA5A 1FEXA 2PX9A 2F4IA 3CCJI 1R4MB 2VQGA 5JLXA 5L3CA 1XSXA 1IZ1A 2K5CA 1LB2A 5FROA 4IZZA 3I3LA 3K10A 2K7LA 5BOXA 1IRGA 4HQEA 1T56A 3DXJF 3OYEA 2CWEA 3DEUA 3RIRA 1NG7A 2NS0A 2M8GX 4AUXA 1UG2A 5E1XA 2LRDA 1QVUA 4RAYA 1OPCA 3FKIJ 4KT6A 1TT5B 3RKXA 4A0XA 2M4GA 4E4HA 2FBIA 2BHYA 2R7WA 1AHDP 2KHMA 3K2AA 3K7AJ 1N78A 1J09A 3L00A 3GTPJ 4PSWA 2L7FP 3CZ6A 3ZN0A 2A69F 3U1KA 1KU2A 4ZYGA 5H2FC 1VF9A 3PFIA 4JP0A 1FOKA 4ETSA 4RB0A 1FMVA 1OJLA 3JCUC 3MFKA 1VQ9I 1MH3A 5FLMJ 2LREA 3BTJA 4WX9A 3LFUA 4ESBA 3HKZN 5FRMA 3WTSC 4B3AA 3CF5F 4WF2A 3ZCOA 4BDZA 4ESFA 3FXKA 4F92B 3CUOA 4AIJA 5LGNA 2DA5A 2WA0A 3E3VA 3RKWA 1FYLA 4YFNF 1SVOA 1WWXA 4OU0A 1OR7C 2XHKA 1O3RA 2M7AA 3W6KB 2LYCA 4O5VA 2FOWA 2CQXA 2LY2A 4N4OB 4II2A 4XLPF 4WXHA 3HOTA 1WHUA 3D5LA 4HG2A 5FO5A 2JPBA 3H9GA 4Y7NJ 1FP1D 3L1PA 3ZRGA 1R1UA 4HNVA 2L5QA 3MAJA 1QZZA 4FX0A 4DYQA 4EQQA 1F36A 3CP2A 4Z2YA 1OFCX 4CDGA 2V1UA 1PUEE 2L9RA 4EVIA 3HOZJ 2W7NA 1W4MA 4HNUA 4L5JA 2VQCA 5BMZA 2Q8KA 4CICA 4B43A 4IHWA 2WB1A 2STWA 2IAIA 2QEXI 2HNHA 1WJEA 1K7AA 4BDYA 3HOSA 4BE2A 1WCMJ 2V1DA 1Z0XA 2GQQA 1W5TA 4XLEA 4GO1A 4MTDA 4MEYF 4G12A 3R6SA 3B6CA 5IOZA 3MQ0A 1UHSA 3J7AO 2HYJA 4WWCA 2WAQN 3CQZJ 5B5EC 1QPMA 3K69A 1I50J 1O7LA 1FYMA 3FK7A 2A5WA 4NDLA 2Z16A 1HXDA 1UB9A 4ABZA 1G8XA 2XSDC 2DTZA 4BJTA 3GTJJ 4Q4ZF 2O3FA 2DOAA 4A5NA 1I1GA 3HB9A 1RR7A 4F93B 3A01A 2GA2A 2DMNA 2MSYA 1JUMA 1LPQA 1KA8A 1Z91A 2PI0A 1D1AA 1VQ7I 2DOFA 4LG3A 4A3MJ 4CCOA 4NUBA 4FISA 5K7FA 2BY1A 3IUOA 4U7DA 4A3FJ 3GW2A 1K4TA 2I8DA 4FCYA 1TTYA 1K4SA 3I4NJ 1KQ0A 2V1NA 2RDPA 1AA7A 1BIBA 1YI2I 2VBYA 3CCYA 5IOYA 2OZUA 3SEQA 3JAMZ 1U3EM 1T2KA 3WGIA 3M3YJ 2HDDA 1XS9A 3OR1C 3M1EA 5K7ZA 4E7SA 3BR2A 1WFXA 1FNNA 3SZGA 4XLFA 1Y56A 4Y15A 1ON1A 3RSNA 4Y52J 1I27A 4PUSA 2DO7A 2DU9A 3ABKH 2F4OB 2LG4A 3UKGA 2NNYA 4CZCA 1B59A 1DU6A 5L3EA 4CCKA 4A3JJ 1GV5A 2RN7A 1MMDA 1I6HJ 3W6JB 3CCRI 3GLLA 3DBLB 2WAEA 3H35A 5IPAA 2XASA 4KYWA 1X1BA 4EJVA 4LD5A 2K9LA 3HPHA 5DD8A 2BOLA 5GTHC 2ZNYA 3I64A 4NB5A 1MNMC 5B1BH 2ME0A 3DF8A 4BBRJ 4GCVA 2YPRA 3SYTA 5FFXA 1G3WA 4XSZF 1G6NA 3F8CA 1VQ8I 2HVQA 4LIUA 1YYVA 3MZYA 3OL3A 2BW3B 4NC6A 4M3DA 2FMYA 2GOXB 4YFKF 2IBDA 2VPRA 3R61A 3ZN1A 3QOPA 1GUUA 3QRFF 4E7LA 4M72A 1A36A 1W1WE 1W36D 3ZQ7A 2RNJA 2RAEA 2DA4A 4P55A 4PFPA 2DQLA 3KP5A 3P9IA 1FMWA 2PEXA 4L9NA 2P5LC 3AL0B 3CCQI 4PJLA 2IPQX 1FC3A 1POGA 1X4PA 4FETA 1Y1VJ 5D5XB 2MC4A 1QU3A 2DDBA 3TP0A 5K7HA 1FZPB 1LNWA 2CFXA 3VODA 3PFYA 4L0ZB 1YLFA 1VQ5I 1D8KA 3HOUJ 5HODA 4HBLA 2ADUA 2BW3A 5E3LA 1SMTA 4I0BA 3BQZA 1O4XA 3F22A 3EDPA 2V6EA 3C7JA 2PMZN 3C1DA 2NXNB 3QODA 3LOCA 5GAHJ 4M6XA 2GA1A 1T98A 3QU6A 1JKQC 3DCFA 3FXUA 2JQ7A 4L9JA 1MH4A 1MNEA 2FF4A 2CUFA 2DA3A 2EIKH 4HZFA 4R1HA 4A5MA 2HYGD 2FE3A 3DU6A 1QPIA 2Y0SN 5F6FA 3VYUB 2VONA 3K4JA 1MJAA 4E70A 5JR3A 1U8BA 5BPDA 2GXGA 1P4XA 4P9FA 1WKMA 2B63J 3GMEA 2YS9A 4BHCA 3IH3A 2R7DA 1X4OA 3FWEA 1X1DA 3HZJA 4RM3A 4D5CA 2H09A 1T08B 1FJLA 1MSEC 3WU2C 3EUHA 1KONA 4PGHA 3M07A 5EYRA 3S1RJ 1QGPA 5FKMA 4HOBA 5C44J 5J3LA 2K40A 1OCZH 4BKXA 1BR1A 1G3SA 3D1NI 2CO5A 4LIVA 1AOYA 4XKBA 1QZEA 2OCCH 5D6EA 1IN6A 2VC1A 5EEGA 2L0KA 3PUFA 2PMUA 1K61A 2FBHA 1JHHA 1LFBA 3RQ4A 2E1NA 4NNJA 1D0XA 1VQLI 3TW6A 1RESA 4Y17A 4CSWA 2X0LA 3E5UA 4WXDA 1ETQA 2EIMH 3VOEA 1LE8B 3CUQC 2VC0A 4JX4A 1H88C 4A3GJ 4MNUA 2X6XA 2QQAA 1TNTA 2LP0A 1SFUA 4A6EA 4H0EA 1FOXA 4I0AA 2COBA 4I76A 3GO5A 3CCMI 3RPQA 3F9KA 2QSFX 4FE4A 4KITB 1AWCA 5DEQA 1T8IA 2ZXWH 1WVRA 4HEA2 2ZO4A 2CQNA 5D4RA 1YITI 1R6RA 4PJJA 2LLKA 4XORA 2ELHA 3S2HJ 4XKWA 2E19A 3EETA 2QKMB 1IG7A 3HHGA 5D5WB 2H6BA 4BQNA 3VFZA 2R7XA 2VXDA 3I59B 4X0GA 4JOMA 2FMLA 3PJRA 3OIPA 1N25A 2VJ4A 3DWLE 4DW6A 3EYIA 4ENNA 2ZKZA 4XRMA 3CDIA 1ENHA 2CUZA 1LE8A 2X48A 3L09A 2L7MP 5F27A 2BVLA 4IOAF 3GZ6A 2EJRA 4A6DA 3P9CA 3R4KA 3CCLI 2BXZA 3OS1A 5M3MJ 3BR3A 1FY7A 1TBXA 2EQRA 1BBYA 2X6YA 3HTSB 4RGRA 1SVLA 1LUJB 1Y8RB 2F48A 2HKOA 1L3LA 3P5JA 1RUNA 2YSRA 1Z9CA 4EEFG 1R4NB 2HR3A 2VT3A 2K9NA 3KYLA 1R00A 1BC8C 2W4SA 3E6MA 3M1CA 3I59A 2HVRA 3BCBA 4A69C 2OCEA 2KPMA 3W6VA 3WGGA 2GZWA 4HX7A 1X3ZB 3SDBA 3EQLF 4WCGA 5FFZA 1STZA 1BR2A 1XTAA 2VJIA 3H1CA 2HGCA 4JX6A 1ZQ3P 2XVCA 2JTVA 5HLIA 3EYYA 4V2FA 2B7EA 2Y0SA 4X1EA 5E17F 5BNGA 5HLTA 1N75A 1K83J 3REOA 2FOKA 1K6OA 2P5VA 4MFDA 4CHUA 3T8TA 2R7ZJ 4OOIA 4PSXA 4RB1A 3J80K 3IV5A 4OIRF 3CCUI 1CF7B 2LBFB 1GDTA 4IRGA 3BG6A 2DMPA 4XIDA 1AKHB 3KETA 1ZG3A 1Z6TA 2ICWG 2E35A 4C9YA 4DYRA 3W2VA 1RRJA 1BOBA 3A02A 5LEJA 5FKKA 3HYIA 2VQLA 4N9HA 2JA6J 1R5GA 4M9XA 2TCTA 2DT5A 3AAFA 3LQRA 4EMSA 4ZC3A 4S05A 1GVDA 2H1LA 2E34A 3NAUA 4PZJA 2CQKA 3IAM2 3RJPA 5H6QA 4ENKA 3DPLC 1OCOH 3BPXA 1V3FA 4ANJA 2K02A 2G7UA 5F1JA 4XL9A 3TW7A 1S9HA 3K1PA 2HI3A 1ZRCA 3EUAA 3V8LA 1CF7A 4HPQA 2LBFA 3SFIA 3LSJA 1P9QC 3C3WA 1OCTC 2ID3A 4FHTA 1UAAA 2K9SA 3CMAI 5ED4A 2EB7A 2FSWA 3IH2A 3HBLA 2B9SA 1MMAA 2MLGA 3H3VK 2B0LA 2WY7Q 4AD9A 1LVAA 4RAGA 1MSFC 3ML6A 2CG4A 4U7BA 1DPUA 3KLOA 4M71A 4G6QA 2VKHA 1DP7P 1ERDA 4IL6C 4IVNA 3WG7H 1FP2A 2R7FA 2XRNA 2XAUA 2JSCA 5FKLA 2ZMEC 3PL8A 1T38A 3IKTA 3HUGB 2DODA 2ZNZA 2OQGA 1IV8A 3ZMZA 1IC8A 4DIQA 4QIWN 1OYIA 4PJ0C 4KJZA 5KK1A 5K1YA 4GDFA 3B73A 3S3MA 5DM6F 1JJ8C 3DLLF 1I6XA 1Q1HA 3M9AA 3WTTC 3Q9SA 2D5VA 4CXFA 2XKOA 3ZQQA 5CPRB 2DA6A 2CV2A 2A07F 2LF7A 2QQ9A 4P1WA 3DBRB 4P96A 1ACIA 1TC3C 4PGGA 5KAIC 2JVHA 4UB8C 2HTSA 3I9V2 1B9MA 1R22A 5L3GA 2E1MC 1VQOI 3F6OA 2HPMA 4NHJA 2HOTA 2PMHA 2Y30A 1F4KA 1TLHB 4B1RA 2XAGA 4ZZDA 2PN6A 5J6XA 4MGRA 1U5TB 2WADA 1REPC 3TBIA 2NVTJ 2QQ8A 4R8HA 4NQWB 3DPUA 1OR7A 2IW5A 3HUGA 3ZXSA 2ACJA 3H36A 4EJUA 2DJNA 2EA4A 1JT0A 3CC2I 1XDUA 2R5ZB 2DFIA 1A5JA 2W24A 2G9WA 5IP9J 1X58A 4KIGA 4C30A 3FXRA 4N0BA 5DTDA 6PAXA 2EK5A 1WI3A 3PO2J 2IXSA 4I99C 3TOAA 3WU0A 3SJMA 1ZTRA 1WSUA 1FLIA 3BTLA 2D1HA 3SXYA 1S7OA 4ZZLA 3Q0WA 3GFLA 2A6TA 2Z1DA 3OYHA 3CDHA 1XMKA 3F8BA
chains in the Genus database with same CATH topology
1WJFA 5CQEA 3QYFA 1MW7A 3AL0C 4E7KA 2XF7A 2DT6A 3MKWB 2KP6A 1QHHD 1D1BA 3PSFA 2VL8A 2R7TA 2CFOA 4IX7A 3H9QA 2A5WA 2Z16A 2Z2SB 2X1EA 4XKCA 1G8XA 3LSMA 4XM3A 4BJTA 1LVKA 2CS3A 3A4CA 2DOAA 2DJIA 3MD2A 3PSIA 2BVMA 2XF5A 3VYRB 4GRIA 4F93B 2V26A 3EUHC 3OS2A 3HG9A 4II3A 4B44A 4PK4A 1D1AA 3E0JB 4DBRA 4LITA 4LG3A 4P5OA 4CCOA 4DGWB 2ZFUA 1V5FA 2CMPA 1X1CA 2KMUA 3FBIB 1TZLA 4NUBA 2ZSHB 1ZELA 3MKZA 2CH0A 3IUOA 3OYIA 2I8DA 1LFPA 1D1CA 2KQRA 2V1NA 4KISA 1AA7A 3E1SA 3SEQA 3L2QA 2LY1A 4BJ6C 4BS9A 3OR1C 5KHDA 3QYBA 4E7SA 1WFXA 2VPLA 2X1CA 3SZGA 4E7HA 4RLQA 4XLFA 2PJRB 1Y56A 3VYTB 3OYGA 2R7SA 4CCMA 2IS6A 3RSNA 2ZXIA 4AU7A 1QHGA 4PUSA 4F52A 3L2VA 4ZDOA 2LG4A 4PJNA 3DTEA 4CZCA 3OOUA 3OY9A 4CCKA 1Z21A 2VASA 1MMDA 2V4JC 2VKDA 1DP3A 4YRVA 3OMYA 3S3OA 2WAEA 3H35A 2L9NA 1X1BA 5KCMA 2K9LA 3HPHA 3QOEA 4BU2A 3OYNA 2BOLA 4F91B 2KRCA 4BJ5C 4CCLA 3TMOA 1X19A 2Q2EB 3SYTA 2W1OA 4IQ4A 3DQVC 2HVQA 4LIUA 2VIXA 1BR4A 3OL3A 2BW3B 3QYEA 5HNFA 1EA3A 2KLOA 2GOXB 2PJRA 2HPIA 2JUGA 3LL7A 3MMYB 4BE1A 1Y6IA 3S8PA 4E7LA 3C2HA 1W36D 3S3NA 2X51A 4PFPA 3LSKA 4XR6A 4Y3OA 1FMWA 5LFAA 3TL4X 3A1YA 4PFOA 3AL0B 4PJLA 4XONA 1X4PA 4FETA 2LH9A 2MC4A 2X85A 4RLFA 4F55A 3W2AA 1QU3A 2OC6A 3PFYA 3FHNA 3H5RA 5HOOA 1SFKA 4XKVA 2OV7A 4ZYAA 2BW3A 4XLCA 3OYAA 1DGWY 3OYBA 2VXZA 2V6EA 2XC7A 3H0DA 2WAFA 3VSLA 4DBQA 3QODA 1T0FC 4G6TB 1LDKB 2LC2A 3D5SC 2WY8Q 3OYDA 1MNEA 2RREA 2X6WA 2IGNA 1YE9A 3OYJA 3K4CA 1GLNA 1Z3YA 1E0EA 3OYKA 4N4NB 3DU6A 4OWRB 3VYUB 3K4JA 3LSHA 3EUKL 2HDWA 1IRXA 3K4BA 4J01A 1LKXA 3K70D 4CCJA 1K6YA 4F3QA 2ELJA 4QPQA 2DT7B 1MNDA 3AFHA 4XLAA 4BQOA 3LSIA 1X4OA 2VJJA 4E7IA 1X1DA 4RM3A 3SEZA 2ZSIB 4DJAA 3N05A 1KONA 2V9KA 4B48A 2R7QA 4PJMA 4BQQA 1PYVA 4D1QA 1WJAA 4JQFA 1V5EA 1BR1A 2ZXHA 4LIVA 3LMMA 4XKBA 3VDXA 2VJ5A 2E5NA 3CJQB 1Z3XA 4ITVA 3LSGA 4XMYA 2W00A 2W82A 2M4KA 2IGOA 3RTRA 3RQ4A 4NNJA 1D0XA 4CSWA 2L9SA 3C2GA 2CV0A 3K4NA 4B47A 3ZR8X 3FBNB 4XOTA 4CH7A 4BE0A 2JVGA 2KZVA 4Y4RA 2MABA 2X6XA 2M7BA 1G59A 4CUGA 3ONQA 3DKYA 3S32A 2HU9A 2MD0A 5JHFA 4U87A 2L2OA 1TT0A 3F9KA 3FDYA 3HKZA 3PNVA 4KITB 3OL4A 2O5RA 2CV1A 4HEA2 1D0ZA 4HSRA 3VYSB 3CESA 3DTKA 3PUBA 5HNHA 2CW7A 1R6RA 4PJJA 4XORA 1WJCA 3OIQA 2VQHA 5CQGA 4XKWA 2IGKA 2NOJB 2QKMB 4E7JA 1DGRM 4BQNA 1DQUA 2KRHA 3M8JA 3KEYA 4YELA 2R7XA 4C2UA 2VXDA 4X0GA 4HRIA 4JOMA 4OAYA 3OIPA 3PJRA 4CCNA 2UV1A 2VJ4A 3DWLE 4D9JA 4QPOA 2R7OA 2IS1A 1VZ0A 2CUZA 2UUZA 3PNYA 2BVLA 4YEJA 3ZGKA 1V5GA 1MMGA 4BXFA 3K4KA 1X1AA 4ZDPA 5HVQC 4ZDLA 3OS1A 3HXLA 3OYCA 2FUG2 3H5AA 2K3PA 2X6YA 4NC8A 3BCAA 2R7RA 3VSKA 2XDVA 2GOMA 3DLAA 3KYLA 3VWBA 1UELB 2W4SA 3M1CA 2HVRA 2RNGA 3BCBA 2WBMA 1U0JA 2KPMA 2WAQA 4EATA 2R7UA 2R7VA 4BL0B 2AQEA 3DKXA 4HNTA 3DTIA 4AYBA 3KX2A 4ZTFA 2JA2A 3SDBA 3OR2C 4XLHA 2E5ZA 1W36C 1BR2A 3S93A 3U21A 4BGDA 2VJIA 4CA0A 2KDOA 2DCEA 3HPGA 4XQFA 1N77A 3K6GA 2M3AA 3UNGC 3D5RC 1NG6A 3IP4B 2Y0SA 3GBGA 3L2UA 3G2BA 1OLTA 3HC7A 2IGMA 5HLTA 1N75A 3BLYA 2MFZA 4XN3A 2IS2A 1JI8A 1D0YA 3A2KA 3K4LA 2HQAA 4PSXA 1UG0A 2QKLB 2LBFB 3BG6A 5KNLA 2CUJA 1Z7LA 4Y33A 4C9YA 2RQQA 3W2VA 2Q1ZB 4RMNA 1BOBA 3OYLA 2VQLA 3H5NA 3L2WA 4ZC3A 3H9JA 3W2WA 3IAM2 4RM2A 3DPLC 2F5VA 3BG7A 3CMMA 3RCOA 4ZJZA 4OAZA 2K9MA 4ANJA 4BUPA 2R4GA 3K70C 2M0MA 4XL9A 5CKTA 1S9HA 2AQFA 2HZDA 1WJBA 4J00A 2F4IA 3EUAA 4E6KG 2VQGA 4HPQA 2LBFA 1SAUA 2K5CA 2P0WA 4XOPA 5FROA 2VLAA 3OYMA 4IZZA 3I3LA 3K10A 1P9QC 3OYEA 1UAAA 1NG7A 3DEEA 4IQJA 3DU5A 2HVSA 4ZTJA 1MMAA 5FRNA 2LRDA 2L7KA 3PNTA 2WY7Q 3UR3C 4KT6A 3CF2A 2M4GA 5LD2C 4E4HA 2E60A 4U7BA 2R7WA 2KHMA 2VKHA 1N78A 1ERDA 1J09A 4PSWA 3CP8A 3CZ6A 2CW8A 2XAUA 4H4KC 2IS4A 3PL8A 2E1MB 4IKFA 4XN0A 4FASD 2VB6A 3HUGB 1FMVA 1YX5A 2MYSA 4DIQA 4KJZA 2XF6A 2LREA 3S3MA 2JSPA 3LFUA 4MLOA 5FRMA 1T95A 2F6CA 3ZCOA 4BEHB 2LOOA 3ZQQA 2OUMA 5CPRB 4BDZA 2CV2A 4P1WA 1YX3A 4XNFA 4F92B 4HSTA 1WJ5A 2JVHA 3I9V2 2WA0A 3OYFA 4AVZA 2E1MC 2HPMA 3RPUD 4E7ZA 1OR7C 1WJDA 3DPTA 3K4MA 4B3XA 2KL4A 2M7AA 3W3CA 2LYCA 3IAS2 3J7AY 4N4OB 2LY2A 4II2A 3HOTA 2WADA 2X1DA 4BACA 3D5LA 4HG2A 3TBIA 3H9GA 3HL2A 3ZRGA 2L5QA 4NQWB 3DPUA 3ZXSA 2PMZA 3V42A 3CP2A 1PJRA 2W7NA 4NC7A 3EPZA 4HNUA 2VQCA 1MMNA 4R79A 4B43A 4C30A 4BEHA 3AKZA 2WB1A 2HNHA 1WJEA 3FKJA 2IXSA 4BDYA 3NWSA 4DOZA 3HOSA 3MKYB 4BE2A 2XSJC 3NWTA 3OWTA 2V7FA 2DXIA 2UWMA 1HA8A 4XLEA 3BC8A 2A6TA 2Z1DA 3CJRB 3OYHA 5TGTA 4C2TA 3OS0A 3L2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRH A;  2L2O A; 
#chains in the Genus database with same CATH topology
 5CQE A;  1XGO A;  1MW7 A;  3G6E I;  4O3M A;  1U5T A;  5L3D A;  3PIO F;  2KP6 A;  2MH2 A;  4S0H B;  3PSF A;  2VL8 A;  2YUS A;  2CFO A;  4NQW A;  3H9Q A;  4X6A J;  2OBP A;  2ETH A;  5CVU A;  2X1E A;  2R5Z A;  1P4W A;  3LSM A;  4XM3 A;  1LVK A;  1FSE A;  3A4C A;  5J40 A;  3MD2 A;  5IT3 A;  5C3E J;  1RC9 A;  2Y31 A;  3IHU A;  3PSI A;  3KFW X;  2ZJR F;  1RKW A;  4FE7 A;  1LQ1 A;  4GRI A;  5CVI A;  4B44 A;  3R60 A;  4PK4 A;  1EH8 A;  2CUE A;  3CJT B;  1XC5 A;  4C3J J;  3BG3 A;  4DGW B;  2ZFU A;  2HTJ A;  3J81 Z;  3ERM A;  5LHI A;  2TDX A;  1TZL A;  2ZFW A;  2UXX A;  3V7C A;  1UHW A;  2MG4 A;  2CH0 A;  3ASN H;  3FX3 A;  2R92 J;  3QP5 A;  2V6C A;  2NYX A;  1H9G A;  4LLG F;  1OCC H;  1D1C A;  2KQR A;  1X3W B;  2WV0 A;  4A3B J;  2EV6 A;  4UY8 I;  1QZY A;  1XGN A;  2YX7 A;  5EF6 A;  5J8C A;  2RVC A;  3SFZ A;  3KZI C;  2M2E A;  3I54 A;  1IDY A;  1GV2 A;  4GFB A;  3M8F A;  4PDK A;  3QYB A;  2VPL A;  3QP6 A;  1E3H A;  5LHG A;  3WTW C;  3OYG A;  3VYT B;  3ECH A;  5B3S H;  1WH7 A;  4CCM A;  3GTL J;  1FPQ A;  3L2V A;  4ZDO A;  2HEO A;  2FQ3 A;  4IJA A;  1ETV A;  2RV8 A;  2XPU A;  2H1K A;  2BV6 A;  3OMY A;  1D5V A;  1S29 A;  1ZGW A;  2UXN A;  5H6R A;  3GYH X;  4BU2 A;  2A5Y B;  2EV0 A;  1MBK A;  4M9S A;  5FJ8 J;  2VE8 A;  3GTQ J;  5IP7 J;  1A04 A;  1ORK A;  2W1O A;  4IQ4 A;  5IT9 Z;  2QYO A;  4ZYD A;  4HLX A;  3RQI A;  2VIX A;  2JK3 A;  5HNF A;  1J7K A;  2JPC A;  2XB5 A;  3MZH A;  4FQG A;  1HDP A;  4MFE A;  1UMQ A;  2AO9 A;  2JUG A;  3MMY B;  4BE1 A;  1YJN I;  2NRA C;  2DYR H;  2LMD A;  4N9I A;  4L9V A;  2X51 A;  2GBY A;  4S04 A;  4XR6 A;  3CCS I;  4UV9 A;  5J4V A;  5IYB J;  3TL4 X;  3A1Y A;  5HDN A;  1HKQ A;  1Z05 A;  4XON A;  4KIB A;  3I71 A;  3CLO A;  4HYE A;  4HDV A;  2X85 A;  3W2A A;  1IW7 F;  4F55 A;  4RS8 A;  2QEN A;  4JK1 X;  3GWZ A;  1IXC A;  2M30 A;  1FYK A;  2L54 A;  5E8G A;  1Y0U A;  2G7H A;  4IRH A;  1ETW A;  4ZYA A;  1XCB A;  5ICF A;  4IO9 F;  4UNO A;  1DGW Y;  1MGT A;  2EH3 A;  2KJB A;  1IN8 A;  3BTC A;  1ZG1 A;  2WAF A;  2TRT A;  1ONV A;  3RPU A;  4DBQ A;  5A2Q K;  1T0F C;  3J80 Z;  3TED A;  3G1M A;  3FM3 A;  3WGH A;  2I5U A;  2M1B A;  2IJL A;  3CD6 I;  2X6W A;  2ESN A;  2RC4 A;  3HSF A;  5EZG A;  1GLN A;  2AXT C;  1P2F A;  3OYK A;  3FXJ A;  4ZH4 F;  3TOB A;  4IRI A;  2CGP A;  2EPF A;  1YRN B;  1H89 C;  2G0E A;  3EUK L;  3K4B A;  1FIA A;  1JHF A;  1I3A A;  4G8X A;  3GFM A;  4MQ9 F;  4J01 A;  2GAU A;  4F3Q A;  5ERI A;  2J5O A;  2DT7 B;  4IHV A;  1BL0 A;  1F9N A;  3H92 A;  3AFH A;  1S5L C;  3KE2 A;  3Q9V A;  3LSI A;  3GTK J;  1NTC A;  1YS7 A;  4A0Y A;  5E3N A;  2IT0 A;  1ETX A;  3N05 A;  3Q3S A;  2QSG X;  2V9K A;  2X6O A;  4A3K J;  4BQQ A;  3LSR A;  2BZT A;  4G9Y A;  3CUQ B;  2DQR A;  4D1Q A;  5HNH A;  1FT9 A;  4A0Z A;  3GTM J;  2E5N A;  4ITV A;  1Z3X A;  1YHQ I;  5JHU A;  3CJN A;  3U9G A;  3LSG A;  4XMY A;  3RKY A;  3O8G A;  1ETO A;  2W00 A;  1X2M A;  3HSR A;  2E2J J;  3I55 I;  3KP2 A;  1YRN A;  2IGO A;  1PP7 U;  3RTR A;  3HGY A;  2P7C B;  1ZG5 A;  4LMY A;  3R0A A;  3C2G A;  2CV0 A;  4B47 A;  1HLV A;  1APL C;  1JGS A;  1CQT A;  1EF4 A;  5DCM B;  3ZQG A;  2VOO A;  2ZJ2 A;  4BE0 A;  2KZV A;  4Y4R A;  1SFO J;  3S14 J;  3ZMV A;  2M7B A;  1TWC J;  4U88 A;  3ONQ A;  2IVM A;  4L9T A;  3F23 A;  2V79 A;  5JHF A;  2MD0 A;  3KYD B;  1K78 B;  1S7A A;  2VBX A;  5DM7 F;  2L2O A;  3FDY A;  3HKZ A;  3WU1 B;  2XAH A;  3WTU C;  3CUQ A;  2CV1 A;  3ZQH A;  1D0Z A;  1A31 A;  3SDG A;  4LG0 B;  5KAF C;  4F7Z A;  2CW7 A;  3ZQI A;  2VQH A;  3MCZ A;  1HCR A;  4XRS G;  2IGK A;  2D1V A;  2NOJ B;  4E7J A;  4LGW A;  2COM A;  2UV1 A;  1MMS A;  1EH7 A;  4QPO A;  1QQI A;  2QWW A;  5E1Z B;  1OKR A;  5DCM A;  3ZOB A;  1VZ0 A;  3G4S I;  3S1N J;  2ZBK A;  3ZPL A;  3PNY A;  3LST A;  4YEJ A;  3JRD A;  1V5G A;  1JT6 A;  1MMG A;  2O6G E;  3K4K A;  1X1A A;  2K3F A;  2IA0 A;  2QBY B;  2FQ4 A;  1K78 A;  2WTE A;  5HVQ C;  3WOD F;  2Y2Z A;  3HXL A;  3H5A A;  1G4D A;  1S7E A;  1KQ9 A;  4EGY A;  2HWV A;  4LG0 A;  1D8J A;  3CC7 I;  4HA8 A;  3BCA A;  2A6H F;  2R7R A;  3DEW A;  3G1O A;  4U0W A;  3GZN B;  2BE5 F;  3O2P E;  5JFR A;  4RBO A;  3DLA A;  2IA1 A;  3VWB A;  1ZKG A;  1VTN C;  1W5S A;  2GWR A;  4LLL A;  2V9P A;  2XAQ A;  1XX5 A;  1U0J A;  2WAQ A;  1ZRF A;  5EEH A;  2D45 A;  4HNT A;  2AQE A;  3DKX A;  3DTI A;  1X1P A;  2CYY A;  1EJ9 A;  1HOM A;  4IOC F;  3GFI A;  4ENM A;  3OR2 C;  4IHT A;  4DZJ A;  2E5Z A;  3HOX J;  1I1S A;  3S93 A;  3E5Q A;  2CJJ A;  4KN4 X;  2F5F A;  2UZK A;  3IKV A;  2DCE A;  2LTP A;  4UVC A;  4XQF A;  2QBY A;  1N77 A;  2M3A A;  2LFB A;  1NG6 A;  3I4P A;  3WTX C;  1RUO A;  3G2B A;  2FX0 A;  1O3S A;  3OSF A;  1QBJ A;  4M3G A;  2KDZ A;  3ULQ B;  4XN3 A;  4XLN F;  3WE3 A;  3SZT A;  3FK6 A;  3ZQF A;  1D0Y A;  3K4L A;  4EM0 B;  3QPH A;  2HQA A;  3V4G A;  2XB0 X;  3ZMS A;  3E6D A;  5L3F A;  3RKQ A;  1IV6 A;  2QSH X;  1FTZ A;  5E3M A;  1BI1 A;  4O6J A;  4U0Y A;  1XSV A;  1Z7L A;  3MZ8 A;  2FU4 A;  2DPU A;  1VQ6 I;  2RQQ A;  1R1T A;  1TWA J;  3F8F A;  2Q1Z B;  4RMN A;  2P81 A;  1F1Z A;  4UVB A;  3QPT A;  1ZR2 A;  4V19 K;  1OQY A;  1LEB A;  1XG1 A;  3AG1 H;  4XSX F;  2JMW A;  3L2W A;  3DFG A;  3T0Y A;  3X2Q H;  1P7J A;  5F04 A;  4ZJZ A;  4OAZ A;  2E1O A;  2R4G A;  5EZH A;  2JA5 J;  1MBG A;  2E71 A;  5FD6 A;  3K70 C;  3TO9 A;  2Z33 A;  3E97 A;  2OAZ A;  1LEA A;  5GAE J;  5JLW A;  2P0W A;  4XOP A;  1IDZ A;  4UUS B;  4UB6 C;  1Y1W J;  2A05 A;  2QF7 A;  5M5W J;  2P7V B;  4RDU A;  2ZME B;  2HXO A;  3DEE A;  1O57 A;  3H0G J;  5FRN A;  5K5R A;  2L7K A;  3PNT A;  1IN7 A;  1R49 A;  5LD2 C;  3WTZ A;  2E60 A;  2K86 A;  3Q5F A;  3HRT A;  2EA2 A;  4GGG A;  3BY6 A;  3HJE A;  5LLQ A;  3JRG A;  3ERE D;  1J9I A;  5HS7 A;  2CW8 A;  4KUM A;  2N8G A;  3VB2 A;  2EBI A;  4BXX J;  2FRH A;  4RAF A;  3V8J A;  4KN7 X;  2E1M B;  4IKF A;  3FM5 A;  3S16 J;  4FAS D;  1R58 A;  5IYD J;  4RGS A;  5CLS A;  1G2H A;  1YX5 A;  2MYS A;  2F5E A;  4Q5S F;  2KIF A;  5E1W A;  2JSP A;  4UUS A;  5GTI C;  4UHT A;  1SD5 A;  1FBU A;  2ZME A;  2F6C A;  2EFP A;  4BEH B;  2LOO A;  3TGN A;  2OUM A;  1ODD A;  1FTT A;  4XNF A;  4AVP A;  3JRI A;  5GPA A;  4HST A;  2QCO A;  5CVV A;  3T1B A;  1RR8 C;  3OYF A;  3COA C;  4P9U A;  4AVZ A;  1NHA A;  2P8T A;  3RPU D;  4K2E A;  4HLY A;  3DPT A;  2CRG A;  3W3C A;  5IY5 H;  3ABL H;  3IAS 2;  1T6S A;  4M9Z A;  1PVE A;  2HYF A;  1I39 A;  2X1D A;  1D3Y A;  4Z6Y A;  1KGS A;  2WV1 A;  4BBS J;  3FXM A;  2A6E F;  2FD5 A;  2PMZ A;  3V42 A;  1YS6 A;  2WWY A;  1YW7 A;  5TIS C;  4A3C J;  4I02 A;  2YU9 J;  1JE8 A;  2DPD A;  1TQI A;  3EPZ A;  4NC7 A;  3PQJ A;  3GF2 A;  4YII A;  1JJ6 C;  4R79 A;  5ICG A;  4G7O F;  4BEH A;  3KCC A;  2LR8 A;  3FKJ A;  3QWL A;  1DPR A;  4IHY A;  3SQN A;  3RZD J;  4DOZ A;  4D0P A;  3NWT A;  2V7F A;  4A2U A;  2L4A A;  1O3Q A;  2UWM A;  1HA8 A;  2JUC A;  2OTL I;  1T39 A;  1R36 A;  2M34 A;  3BC8 A;  1USS A;  3CJR B;  2HDC A;  4ENJ A;  2Z3Y A;  4BAY A;  3KP3 A;  5FKO A;  4C2T A;  3HDD A;  5LGU A;  1P92 A;  1PP8 F;  4EM2 A;  4HF2 A;  3FF5 A;  3QYF A;  1A6I A;  3AL0 C;  2A3S A;  2DT6 A;  3F72 A;  4I09 A;  1JUP A;  2RKH A;  4YIF A;  3F21 A;  1BJA A;  2R7T A;  3M7G A;  2JWT A;  3ASO H;  3LAJ A;  3NAR A;  2MC3 A;  2VOP A;  5J1R A;  3JR9 A;  2PLY A;  3D0S A;  5C4J J;  2EWN A;  1O7F A;  1OMI A;  3JRF A;  2XGX A;  1T33 A;  3VYR B;  5LBQ A;  1Z6R A;  2V26 A;  3LA2 A;  3EUH C;  3OS2 A;  3S17 J;  1R5I D;  2AXL A;  4II3 A;  3IH4 A;  1XMA A;  2DW4 A;  3E0J B;  2F5C A;  1QA6 A;  4LIT A;  3BJ6 A;  4P5O A;  2FNP A;  2PBI A;  2DFF A;  2CMP A;  2P4W A;  1MIJ A;  1W7P B;  2HFH A;  2KMU A;  2ZSH B;  1ZEL A;  5LRS A;  2QA4 I;  1QVT A;  4A93 J;  4M74 A;  2DK8 A;  2LDU A;  3HSE A;  3FXO A;  2F5D A;  1AKH A;  1U9O A;  4HW0 A;  1B4A A;  3S15 J;  3GLX A;  3QAH A;  3BG5 A;  4KIS A;  5D8L B;  4B09 A;  1RKT A;  1BI0 A;  3A0B C;  4QTR A;  4D7N A;  2LY1 A;  4BJ6 C;  2LKS A;  4BS9 A;  2ECC A;  5KHD A;  4L5I A;  2X1C A;  2E1C A;  4E7H A;  3K9T A;  4HX8 A;  3T8R A;  2PJR B;  2HKX A;  3HTU A;  2IS6 A;  1F5T A;  4QWQ A;  4AU7 A;  3O8H A;  4M6Y A;  3BWG A;  1JTX A;  1W7P A;  1P7I A;  3FXQ A;  3E6C C;  4EV0 A;  3OY9 A;  5FGM A;  2V4J C;  1XDS A;  4YRV A;  4CYC B;  1AU7 A;  1UJ8 A;  3BR0 A;  1J0R A;  3ABT A;  1IGN A;  5H20 A;  1WGX A;  3M8E A;  3QOE A;  4G94 A;  3OYN A;  3S2D J;  3DV8 A;  3FZV A;  5EEA A;  4BJ5 C;  4CCL A;  3G1L A;  2XIG A;  2MD5 A;  2X9D A;  2JN6 A;  3ABM H;  1W5C C;  2OTJ I;  2GLO A;  2Y9Z A;  2CSO A;  2JJ7 A;  1MBE A;  3V7S A;  4BY1 J;  3HIF A;  2DA7 A;  3CMY A;  3O6B B;  2PJR A;  2KZG A;  3B6A A;  2HPI A;  4XIC A;  1XCV A;  1JKP C;  1TW3 A;  3LL7 A;  1Y6I A;  3JSO A;  1BN5 A;  2K85 A;  2VKV A;  3C2H A;  5D5U B;  5EDN A;  2EIL H;  3J7Y J;  2LK2 A;  1B8I B;  5E18 F;  2F4M B;  3LSK A;  4CYC A;  5F0C A;  1KU9 A;  3BDD A;  5GAD J;  3IWF A;  2KJC A;  4OIQ F;  1WPK A;  4RLF A;  1KYZ A;  3HRM A;  1B72 B;  3BR1 A;  2HXI A;  3LWF A;  3H5R A;  4BHP A;  4XRS A;  3BR5 A;  2C6Y A;  1RPW A;  3HEF A;  4TV7 A;  2OV7 A;  2A68 F;  2LF8 A;  1KU7 A;  5EJC A;  1YJW I;  4XLC A;  2OJE D;  3CO6 C;  3OYA A;  2H6C A;  2EFW A;  2XC7 A;  3H0D A;  1MD0 A;  2IP2 A;  4PCQ A;  3BR6 A;  4L5E A;  5K5O A;  4G6T B;  2FJ1 A;  4FX4 A;  1MDM B;  3D5S C;  2WY8 Q;  1P4A A;  1B8I A;  3OYD A;  2RRE A;  1HQC A;  2QM3 A;  2IGN A;  1YE9 A;  2DI3 A;  3K4C A;  5HS8 A;  2P5K A;  2XAF A;  3TO7 A;  1E0E A;  2AS5 F;  2OU2 A;  3CTA A;  4OWR B;  1T0F A;  4DQ2 A;  3S1M J;  2W57 A;  3C18 A;  3KPH A;  2NS8 A;  5DD4 A;  2K27 A;  1YO5 C;  1B72 A;  2DMT A;  2DMU A;  3H3U A;  4AC0 A;  4KA4 A;  2E36 A;  1J2X A;  4M6V A;  4RGX A;  1LKX A;  1Y39 A;  5M3F J;  2CW0 F;  2ELJ A;  4D7M A;  2M8E A;  4QPQ A;  3PIP F;  2O0Y A;  1Z77 A;  4C2M J;  1HSJ A;  2DAO A;  1U9N A;  1MND A;  2EFN A;  4XLA A;  5F08 A;  2Z9O A;  1E17 A;  3ELK A;  4BQO A;  2VJJ A;  3BQY A;  3E5X A;  3SEZ A;  4AID A;  2ZSI B;  4DJA A;  4RB3 C;  3FMQ A;  5M5Y J;  1R5H A;  2R5Y B;  1MDM A;  2F2E A;  1WJA A;  4JQF A;  1V5E A;  2ZXH A;  2LKP A;  2MH9 A;  3FXL A;  3VDX A;  3CJQ B;  4IXA A;  1Y0N A;  4CGZ A;  1UZC A;  2KIU A;  2GM4 A;  1ON2 A;  4L18 B;  1XB4 A;  1Z1D A;  2W82 A;  1VI0 A;  1I3Q J;  5LHH A;  4DYC A;  2M4K A;  4B8X A;  1JXS A;  2JT1 A;  2VN2 A;  2L9S A;  2L7Z A;  1ZR4 A;  4LJZ F;  1KQ8 A;  2RGV A;  5D5V B;  1KU3 A;  2RQP A;  3F8M A;  4EJO A;  1J75 A;  2H94 A;  4CH7 A;  1FWZ A;  2VT2 A;  3KP7 A;  2FXA A;  2JVG A;  2NNN A;  3G3Z A;  2KFD A;  2OPT A;  2A61 A;  4CUG A;  5GAG J;  3DKY A;  3S32 A;  1TP4 A;  4U87 A;  2CU7 A;  4G7H F;  2R5Y A;  4MIM A;  4D5F A;  3MEX A;  1KYW A;  4HSR A;  2W85 A;  1FSH A;  3E6B A;  3DTK A;  1RET A;  2E2H J;  4CO8 A;  3R0J A;  2BY0 A;  3OIQ A;  1FIP A;  1HW2 A;  5CQG A;  2DYS H;  1IUY A;  5CYV A;  1DGR M;  1YW8 A;  1ZHF A;  3BZC A;  1DQU A;  2KRH A;  3M8J A;  3KEY A;  4YEL A;  3U2R A;  3ZP5 A;  4C2U A;  1DUX C;  4YIR X;  1RIO H;  3PQK A;  1G3Y A;  3F6V A;  4HV6 A;  4XBF A;  2IS1 A;  2JZY A;  4AIK A;  1WQ2 A;  2Z99 A;  5DUI A;  3ZGK A;  4M3E A;  3F8N A;  1MBH A;  1R71 A;  3T5X A;  3WTY C;  4ESJ A;  1HST A;  2NS7 A;  4AWX B;  2FUG 2;  3JRE A;  3MVP A;  1BIA A;  1ZAR A;  4A3D J;  2ZCW A;  1IXR C;  1YW9 A;  1IRF A;  1UST A;  4NC8 A;  1ZRE A;  2XDV A;  2DDA A;  4A3I J;  2GOM A;  2L9V A;  1B1B A;  1HKS A;  3KEQ A;  1UEL B;  3TP3 A;  1SMY F;  1BJZ A;  1FOW A;  2K4B A;  2WBM A;  1IJW C;  4EAT A;  1YG2 A;  4BL0 B;  4CYD A;  2M5W A;  3I5U A;  2GIV A;  3G73 A;  4ZTF A;  5CVR A;  5F0H A;  3K2Z A;  1W36 C;  3U21 A;  1DU0 A;  2GXA A;  3BG9 A;  3TDZ C;  2VOD A;  2ISY A;  3Q0V A;  1MJB A;  4RAZ A;  2P6T A;  1ETY A;  3HPG A;  1ZLK A;  3K6G A;  4UXN A;  2ZB9 A;  2QLZ A;  3UNG C;  3D5R C;  3IP4 B;  4C3H J;  1U5T C;  3A01 B;  2DK5 A;  3L2U A;  1Z67 A;  2X4H A;  2O9L A;  3HC7 A;  2STT A;  2IGM A;  2KKO A;  1K79 A;  5B66 C;  3BLY A;  3HM5 A;  2PJP A;  1M1E B;  2NOG A;  2BY2 A;  2IS2 A;  3GZ5 A;  2DFE A;  3QPL A;  3A2K A;  4KNY A;  4M3F A;  1IN4 A;  1MJ9 A;  5E79 C;  1U78 A;  4GYG A;  2EZI A;  1UG0 A;  2QKL B;  4EM1 A;  1TWH J;  1SEU A;  3MWM A;  1UFM A;  5EG0 B;  3P9K A;  4G7Z F;  3WG9 A;  1ZAO A;  2ME6 A;  1QO0 D;  4UV8 A;  3KIO A;  4LFU A;  2W48 A;  1GXP A;  1E2X A;  2PG4 A;  3KP6 A;  1ZGA A;  1LJ9 A;  3FIS A;  2OD5 A;  3H5N A;  2DLL A;  4W97 A;  1YJ9 I;  5ILS A;  2CQQ A;  4DNC A;  1VQM I;  1S6L A;  2KIS A;  3CDL A;  3W2W A;  4Q48 A;  1WZ2 A;  4RM2 A;  4Y13 A;  1W7P D;  3I0T A;  1R7J A;  3Q0U A;  3GXO A;  4XK4 A;  3FMR A;  4OIN F;  3LFK A;  3TDU C;  3BG7 A;  4BXU A;  3A03 A;  3RCO A;  4RA2 A;  2VI6 A;  2K9M A;  1HKT A;  1R23 A;  3K1M A;  3JSP A;  2M0M A;  1VQ4 I;  2AQF A;  1PDN C;  1WJB A;  2FEZ A;  4I6Z A;  1VFC A;  2D2W A;  3TQN A;  2JRT A;  3RYP A;  4J00 A;  4KMU X;  1SC7 A;  4E6K G;  1SAU A;  4HV5 A;  5FB2 A;  2VLA A;  3OYM A;  5EG0 A;  1ITY A;  2HZT A;  5LGT A;  3V7R A;  2DTR A;  4HDU A;  1EKE A;  3LA3 A;  5CVJ A;  1XD7 A;  4IQJ A;  3DU5 A;  2HVS A;  2Y0M A;  4ZTJ A;  1ZN2 A;  3UR3 C;  2BGC A;  3CF2 A;  3KP4 A;  4V2G A;  1OYY A;  1SD7 A;  2E7W A;  2ELK A;  2QQB A;  5E8I A;  4A3L J;  1SD6 A;  2KIM A;  5ILV A;  3CP8 A;  3BJO A;  3GCM A;  1X3U A;  3CCV I;  2GXB A;  4H4K C;  5ICE A;  2O8X A;  2DA1 A;  2IS4 A;  1XPX A;  1P6R A;  4XN0 A;  2XGE A;  2VB6 A;  5FKN A;  2JRM A;  4UVA A;  5BQT A;  1LDD A;  1NK2 P;  3WHC A;  2OZ6 A;  5LEK A;  4EJT A;  2XF6 A;  4I98 B;  1PUF B;  2BYV E;  4MLO A;  4FTH A;  1HW5 A;  1BM9 A;  1T95 A;  5AIQ A;  3LQQ A;  1BW5 A;  1TL8 A;  1TW2 A;  1YX3 A;  3BOQ A;  1SFE A;  3RDI A;  3BP8 A;  1WJ5 A;  4UUV A;  1OIS A;  3MKL A;  3I4M J;  3ZQC A;  1GHC A;  2K4J A;  4E7Z A;  1WJD A;  3K4M A;  4M73 A;  3K1N A;  3GUD A;  4G6D A;  2KL4 A;  4B3X A;  4ZYE A;  2EV5 A;  3M4O J;  5DDG A;  3J7A Y;  1LDJ A;  1ETK A;  5GP9 A;  4BAC A;  2FNA A;  4U0V A;  5ILU A;  3GX4 X;  1H8A C;  1TWF J;  3ABU A;  3HL2 A;  2EIJ H;  1MBF A;  4IPA A;  1E3O C;  2XAJ A;  2XGD A;  2DN0 A;  2Y48 A;  4HAM A;  4KT5 C;  1PJR A;  1L0O C;  1B9N A;  3VPR A;  1PUF A;  4LK1 F;  1MBJ A;  1MMN A;  1TNS A;  2MLK A;  2V1X A;  3AKZ A;  1DDN A;  2DFH A;  1BI3 A;  1SAN A;  1NK3 P;  2GIZ A;  3NWS A;  3MKY B;  2XSJ C;  5HLG A;  2J5P A;  3OWT A;  3S1Q J;  3HRS A;  2DXI A;  2Z5U A;  3HOV J;  5J1U A;  1U6G A;  2ZJP F;  2VBZ A;  2HQN A;  1EH6 A;  1HBX G;  5FLX K;  3CME I;  5IYC J;  1UHM A;  1ZGJ A;  5TGT A;  4IHX A;  5F1R A;  5B1A H;  3F3X A;  3OS0 A;  1WJF A;  3L2R A;  1FX7 A;  1YFH A;  3DKW A;  1F43 A;  3QQA A;  4E7K A;  2XF7 A;  3MKW B;  1QHH D;  1D1B A;  2O7O A;  2L4M A;  2YX4 A;  4IX7 A;  2I10 A;  1A6Q A;  3BZK A;  3IL2 A;  4I2O A;  2KT0 A;  2M45 A;  3OSG A;  1S3J A;  1YIJ I;  3BPV A;  2Z2S B;  4XKC A;  5DCF A;  1CGP A;  3KZZ A;  3NQO A;  1FBQ A;  4BYY A;  2CS3 A;  3RZO J;  2Y9Y A;  3KYC B;  2DJI A;  2BVM A;  2XF5 A;  2CQ7 A;  1J59 A;  2DBB A;  1UCR A;  2OA4 A;  3HG9 A;  2HOS A;  2MGQ A;  5BPI A;  2M87 A;  4DBR A;  2PFB A;  1JGG A;  2VBW A;  1V5F A;  4LB5 A;  1X1C A;  2XKP A;  3FBI B;  2P6S A;  1ZRD A;  3MKZ A;  2L01 A;  5J47 A;  4HF1 A;  3OYI A;  4MEX F;  1U2W A;  3JRB A;  2HQR A;  4UUT A;  3GTG J;  1Q1V A;  3LSP A;  1LFP A;  1YQA A;  4GYI A;  5D8K B;  5J1Y A;  2Y75 A;  4AIH A;  2DA2 A;  2ZC2 A;  3WHB A;  3OIO A;  3E1S A;  1R9T J;  1V4R A;  2QGU A;  4BNC A;  3L2Q A;  3BT9 A;  2E2I J;  3WTV C;  3J81 K;  3L2C A;  2XPW A;  5AON A;  2EIN H;  1QRY A;  5AIP A;  4JX5 A;  4OMY A;  3SZP A;  1XN7 A;  1XGS A;  4MTE A;  2O8K A;  1ZH5 A;  4BHB A;  5J8F A;  3FMS A;  4RLQ A;  2R7S A;  3O3K A;  3BZ6 A;  2ZXI A;  1QHG A;  4F52 A;  4YFX F;  2EFQ A;  2BBY A;  4PJN A;  3DTE A;  3OOU A;  1Z21 A;  2VAS A;  4MQV A;  1IAW A;  1GXQ A;  3JRC A;  2VKD A;  2W84 A;  1DP3 A;  2LD5 A;  3S3O A;  4EJW A;  2VUM J;  3C2B A;  3ZMT A;  2L9N A;  3HHH A;  5KCM A;  2WC2 A;  1U8R A;  4F91 B;  2LSO A;  1IO2 A;  2KRC A;  4HX4 A;  3TMO A;  1X19 A;  2Q2E B;  3N4M A;  3H3Z A;  4KIC A;  3DQV C;  4I7H A;  1SAX A;  2HQ5 A;  2Q0O A;  3I53 A;  1BR4 A;  1JTY A;  1ZYR F;  2EZH A;  3QYE A;  2YU3 A;  3TKY A;  3TO6 A;  1EA3 A;  2KLO A;  2OQR A;  1WRJ A;  1SFX A;  1QNT A;  2LNB A;  1EV7 A;  4YG2 F;  2DMQ A;  3S8P A;  5GPC A;  3S3N A;  2JA7 J;  2LVS A;  2XV4 S;  2R0Q C;  5IT9 K;  1TWG J;  4Y3O A;  5L3B A;  5LFA A;  1JUS A;  3IRQ A;  4PFO A;  1YIO A;  3JRH A;  1V55 H;  1YTY A;  4AM3 A;  1OCR H;  5A2Q Z;  2MA3 A;  2LKX A;  2JA8 J;  2LH9 A;  3PM1 A;  2Q2E A;  2OC6 A;  4LK0 F;  1VND A;  3K0L A;  3FHN A;  3B02 A;  3ZMU A;  5KVR A;  2M9H A;  5HOO A;  4BY7 J;  1SFK A;  3BTI A;  4W1U A;  4XKV A;  1I5Z A;  4QLC U;  5FLV A;  1BI2 A;  3OYB A;  3BJA A;  1MKM A;  2VXZ A;  4IHS A;  4NBQ A;  3P7N A;  5DUK A;  4KFC A;  3VSL A;  4FT8 A;  4AYB N;  1IF1 A;  3HOY J;  5JVT A;  1LDK B;  2LC2 A;  2FBK A;  2NAZ A;  3KZY A;  3OYJ A;  5JVG F;  1JKR C;  2E7X A;  1Z3Y A;  2H8W A;  2QZ8 A;  4KDP A;  4N4N B;  2ECB A;  3FIW A;  4C3I J;  1A35 A;  3U1D A;  2MBF A;  1ZK8 A;  3LSH A;  2HDW A;  1IRX A;  4LOC A;  1NH3 A;  2Y69 H;  1XSD A;  3LNQ A;  3K70 D;  4CCJ A;  1K6Y A;  5EGO B;  3WE2 A;  1SVM A;  2XUB A;  3V8K A;  2HOE A;  2BXY A;  1WI9 A;  1JKO C;  1B6A A;  4BQA A;  3GTO J;  1Y8Q B;  2NVY J;  4I01 A;  4E7I A;  3JRA A;  2IEK A;  2W25 A;  4B48 A;  2R7Q A;  3DP7 A;  3ROU A;  3G71 I;  4PJM A;  2K9Q A;  1PYV A;  3L7W A;  2YR2 A;  3MN2 A;  3LMM A;  2VJ5 A;  4HF0 A;  3DBH B;  1ULY A;  2QVO A;  4B4C A;  2XPV A;  2ESH A;  5LRR A;  5J4Y A;  4MHG A;  3IWZ A;  1FBS A;  2M0C A;  3AG4 H;  3I56 I;  5D4S A;  4EGZ A;  1RNL A;  2NVU B;  5HDK A;  3RI4 A;  2PQ8 A;  4RB2 C;  1BA5 A;  1S8N A;  2AHQ A;  3K4N A;  5EGO A;  2ZJQ F;  3ZR8 X;  3S2W A;  5JI6 A;  3FBN B;  4XOT A;  3ESW B;  4A12 A;  3KEO A;  1E3P A;  2H27 A;  1Z7U A;  2O03 A;  4JBA A;  3FHZ A;  1IUF A;  4OIO F;  2MAB A;  1G3T A;  1VQK I;  3JTH A;  1G59 A;  4BH9 A;  2KRF A;  4GXO A;  2O61 A;  1OYW A;  3JAM K;  5DV5 A;  5CJ9 A;  2HU9 A;  4KMF A;  3N97 A;  1TT0 A;  3PNV A;  1GVJ A;  1BW6 A;  3OL4 A;  2O5R A;  5TJJ A;  3VYS B;  3CC4 I;  3NRV A;  3CES A;  3PUB A;  3GVA A;  2QUF A;  4ASN A;  3PO3 J;  1SD4 A;  1WJC A;  1X2N A;  2V9V A;  3KLN A;  4HQM A;  4LLN A;  1OCP A;  1R1V A;  5IP6 A;  4RGU A;  2EZL A;  1HW1 A;  2EFO A;  3NEU A;  2R3S A;  2BHZ A;  4HRI A;  4OAY A;  3HOW J;  4CCN A;  1IN5 A;  5E3O A;  1ZLJ A;  4D9J A;  1YOV B;  2R7O A;  3HGG A;  1HDD C;  2UUZ A;  3CO7 C;  3I58 A;  1XMX A;  1W0U A;  4ZYH A;  3ECO A;  4BXF A;  1BOA A;  5E20 A;  2BY3 A;  3IC7 A;  2VE9 A;  2XRL A;  3GEZ A;  1H9T A;  4OMZ A;  4WXC A;  4ZDP A;  1H0M A;  2L3D A;  4ZDL A;  5F0F A;  3OYC A;  2ZXJ A;  2K3P A;  1MZB A;  3QPS A;  2XGC A;  3AG2 H;  4QSH A;  1VQN I;  2ISZ A;  5ICC A;  2XRO A;  2HOA A;  4MO7 A;  1KZH A;  3VSK A;  3QU3 A;  9ANT A;  3LA7 A;  3OOP A;  1D5Y A;  5K5Q A;  4CZZ A;  3IRR A;  4Q47 A;  4WK8 F;  1RZ4 A;  2RNG A;  3A0H C;  3JTG A;  2R7U A;  2R7V A;  5FLX Z;  4AYB A;  3KX2 A;  5C4X J;  2JA2 A;  1J5Y A;  4XLH A;  4J19 A;  1LFU P;  5HLH A;  3CLQ A;  4BGD A;  4CA0 A;  2BEO A;  1C0W A;  2KDO A;  1XGM A;  5HDG A;  2NVQ J;  5FD5 A;  4LB6 B;  5M5X J;  2WB1 N;  3GBG A;  1OLT A;  2KIQ A;  3AG3 H;  5F64 A;  4KIF A;  1RI7 A;  1HC8 A;  2MFZ A;  4A3E J;  4IEJ A;  3GFJ A;  2DOE A;  1JI8 A;  3F0C A;  3L9F A;  3J7Z I;  5DYM A;  1TQM A;  1VQP I;  1GT0 C;  2L02 A;  4OIP F;  3ZQL A;  1FOY A;  1S72 I;  4ON0 A;  5KNL A;  2VKE A;  2CUJ A;  3ZMD A;  2OF7 A;  4Y33 A;  1BC7 C;  2ID6 A;  3OV8 A;  4M3B A;  3OYL A;  1WH5 A;  1IRZ A;  2R93 J;  2IA2 A;  3E7L A;  4IF4 A;  1HF0 A;  4L0Y B;  1O3T A;  5D6F A;  2HS5 A;  3HRU A;  3H9J A;  3VEP A;  1IXS B;  1V54 H;  2LY9 A;  1TQP A;  3JW4 A;  2EZK A;  2MW8 A;  5DS9 A;  2F5V A;  3SHF A;  3CMM A;  4DZP A;  2NVX J;  2H8R A;  1W0T A;  4BUP A;  5HS9 A;  3BRO A;  5BS6 A;  3CCE I;  4JYK A;  3RYR A;  3ISP A;  4XRF A;  5CKT A;  3LAP A;  5TRD A;  2IRF G;  2HZD A;  2FA5 A;  1FEX A;  2PX9 A;  2F4I A;  3CCJ I;  1R4M B;  2VQG A;  5JLX A;  5L3C A;  1XSX A;  1IZ1 A;  2K5C A;  1LB2 A;  5FRO A;  4IZZ A;  3I3L A;  3K10 A;  2K7L A;  5BOX A;  1IRG A;  4HQE A;  1T56 A;  3DXJ F;  3OYE A;  2CWE A;  3DEU A;  3RIR A;  1NG7 A;  2NS0 A;  2M8G X;  4AUX A;  1UG2 A;  5E1X A;  2LRD A;  1QVU A;  4RAY A;  1OPC A;  3FKI J;  4KT6 A;  1TT5 B;  3RKX A;  4A0X A;  2M4G A;  4E4H A;  2FBI A;  2BHY A;  2R7W A;  1AHD P;  2KHM A;  3K2A A;  3K7A J;  1N78 A;  1J09 A;  3L00 A;  3GTP J;  4PSW A;  2L7F P;  3CZ6 A;  3ZN0 A;  2A69 F;  3U1K A;  1KU2 A;  4ZYG A;  5H2F C;  1VF9 A;  3PFI A;  4JP0 A;  1FOK A;  4ETS A;  4RB0 A;  1FMV A;  1OJL A;  3JCU C;  3MFK A;  1VQ9 I;  1MH3 A;  5FLM J;  2LRE A;  3BTJ A;  4WX9 A;  3LFU A;  4ESB A;  3HKZ N;  5FRM A;  3WTS C;  4B3A A;  3CF5 F;  4WF2 A;  3ZCO A;  4BDZ A;  4ESF A;  3FXK A;  4F92 B;  3CUO A;  4AIJ A;  5LGN A;  2DA5 A;  2WA0 A;  3E3V A;  3RKW A;  1FYL A;  4YFN F;  1SVO A;  1WWX A;  4OU0 A;  1OR7 C;  2XHK A;  1O3R A;  2M7A A;  3W6K B;  2LYC A;  4O5V A;  2FOW A;  2CQX A;  2LY2 A;  4N4O B;  4II2 A;  4XLP F;  4WXH A;  3HOT A;  1WHU A;  3D5L A;  4HG2 A;  5FO5 A;  2JPB A;  3H9G A;  4Y7N J;  1FP1 D;  3L1P A;  3ZRG A;  1R1U A;  4HNV A;  2L5Q A;  3MAJ A;  1QZZ A;  4FX0 A;  4DYQ A;  4EQQ A;  1F36 A;  3CP2 A;  4Z2Y A;  1OFC X;  4CDG A;  2V1U A;  1PUE E;  2L9R A;  4EVI A;  3HOZ J;  2W7N A;  1W4M A;  4HNU A;  4L5J A;  2VQC A;  5BMZ A;  2Q8K A;  4CIC A;  4B43 A;  4IHW A;  2WB1 A;  2STW A;  2IAI A;  2QEX I;  2HNH A;  1WJE A;  1K7A A;  4BDY A;  3HOS A;  4BE2 A;  1WCM J;  2V1D A;  1Z0X A;  2GQQ A;  1W5T A;  4XLE A;  4GO1 A;  4MTD A;  4MEY F;  4G12 A;  3R6S A;  3B6C A;  5IOZ A;  3MQ0 A;  1UHS A;  3J7A O;  2HYJ A;  4WWC A;  2WAQ N;  3CQZ J;  5B5E C;  1QPM A;  3K69 A;  1I50 J;  1O7L A;  1FYM A;  3FK7 A;  2A5W A;  4NDL A;  2Z16 A;  1HXD A;  1UB9 A;  4ABZ A;  1G8X A;  2XSD C;  2DTZ A;  4BJT A;  3GTJ J;  4Q4Z F;  2O3F A;  2DOA A;  4A5N A;  1I1G A;  3HB9 A;  1RR7 A;  4F93 B;  3A01 A;  2GA2 A;  2DMN A;  2MSY A;  1JUM A;  1LPQ A;  1KA8 A;  1Z91 A;  2PI0 A;  1D1A A;  1VQ7 I;  2DOF A;  4LG3 A;  4A3M J;  4CCO A;  4NUB A;  4FIS A;  5K7F A;  2BY1 A;  3IUO A;  4U7D A;  4A3F J;  3GW2 A;  1K4T A;  2I8D A;  4FCY A;  1TTY A;  1K4S A;  3I4N J;  1KQ0 A;  2V1N A;  2RDP A;  1AA7 A;  1BIB A;  1YI2 I;  2VBY A;  3CCY A;  5IOY A;  2OZU A;  3SEQ A;  3JAM Z;  1U3E M;  1T2K A;  3WGI A;  3M3Y J;  2HDD A;  1XS9 A;  3OR1 C;  3M1E A;  5K7Z A;  4E7S A;  3BR2 A;  1WFX A;  1FNN A;  3SZG A;  4XLF A;  1Y56 A;  4Y15 A;  1ON1 A;  3RSN A;  4Y52 J;  1I27 A;  4PUS A;  2DO7 A;  2DU9 A;  3ABK H;  2F4O B;  2LG4 A;  3UKG A;  2NNY A;  4CZC A;  1B59 A;  1DU6 A;  5L3E A;  4CCK A;  4A3J J;  1GV5 A;  2RN7 A;  1MMD A;  1I6H J;  3W6J B;  3CCR I;  3GLL A;  3DBL B;  2WAE A;  3H35 A;  5IPA A;  2XAS A;  4KYW A;  1X1B A;  4EJV A;  4LD5 A;  2K9L A;  3HPH A;  5DD8 A;  2BOL A;  5GTH C;  2ZNY A;  3I64 A;  4NB5 A;  1MNM C;  5B1B H;  2ME0 A;  3DF8 A;  4BBR J;  4GCV A;  2YPR A;  3SYT A;  5FFX A;  1G3W A;  4XSZ F;  1G6N A;  3F8C A;  1VQ8 I;  2HVQ A;  4LIU A;  1YYV A;  3MZY A;  3OL3 A;  2BW3 B;  4NC6 A;  4M3D A;  2FMY A;  2GOX B;  4YFK F;  2IBD A;  2VPR A;  3R61 A;  3ZN1 A;  3QOP A;  1GUU A;  3QRF F;  4E7L A;  4M72 A;  1A36 A;  1W1W E;  1W36 D;  3ZQ7 A;  2RNJ A;  2RAE A;  2DA4 A;  4P55 A;  4PFP A;  2DQL A;  3KP5 A;  3P9I A;  1FMW A;  2PEX A;  4L9N A;  2P5L C;  3AL0 B;  3CCQ I;  4PJL A;  2IPQ X;  1FC3 A;  1POG A;  1X4P A;  4FET A;  1Y1V J;  5D5X B;  2MC4 A;  1QU3 A;  2DDB A;  3TP0 A;  5K7H A;  1FZP B;  1LNW A;  2CFX A;  3VOD A;  3PFY A;  4L0Z B;  1YLF A;  1VQ5 I;  1D8K A;  3HOU J;  5HOD A;  4HBL A;  2ADU A;  2BW3 A;  5E3L A;  1SMT A;  4I0B A;  3BQZ A;  1O4X A;  3F22 A;  3EDP A;  2V6E A;  3C7J A;  2PMZ N;  3C1D A;  2NXN B;  3QOD A;  3LOC A;  5GAH J;  4M6X A;  2GA1 A;  1T98 A;  3QU6 A;  1JKQ C;  3DCF A;  3FXU A;  2JQ7 A;  4L9J A;  1MH4 A;  1MNE A;  2FF4 A;  2CUF A;  2DA3 A;  2EIK H;  4HZF A;  4R1H A;  4A5M A;  2HYG D;  2FE3 A;  3DU6 A;  1QPI A;  2Y0S N;  5F6F A;  3VYU B;  2VON A;  3K4J A;  1MJA A;  4E70 A;  5JR3 A;  1U8B A;  5BPD A;  2GXG A;  1P4X A;  4P9F A;  1WKM A;  2B63 J;  3GME A;  2YS9 A;  4BHC A;  3IH3 A;  2R7D A;  1X4O A;  3FWE A;  1X1D A;  3HZJ A;  4RM3 A;  4D5C A;  2H09 A;  1T08 B;  1FJL A;  1MSE C;  3WU2 C;  3EUH A;  1KON A;  4PGH A;  3M07 A;  5EYR A;  3S1R J;  1QGP A;  5FKM A;  4HOB A;  5C44 J;  5J3L A;  2K40 A;  1OCZ H;  4BKX A;  1BR1 A;  1G3S A;  3D1N I;  2CO5 A;  4LIV A;  1AOY A;  4XKB A;  1QZE A;  2OCC H;  5D6E A;  1IN6 A;  2VC1 A;  5EEG A;  2L0K A;  3PUF A;  2PMU A;  1K61 A;  2FBH A;  1JHH A;  1LFB A;  3RQ4 A;  2E1N A;  4NNJ A;  1D0X A;  1VQL I;  3TW6 A;  1RES A;  4Y17 A;  4CSW A;  2X0L A;  3E5U A;  4WXD A;  1ETQ A;  2EIM H;  3VOE A;  1LE8 B;  3CUQ C;  2VC0 A;  4JX4 A;  1H88 C;  4A3G J;  4MNU A;  2X6X A;  2QQA A;  1TNT A;  2LP0 A;  1SFU A;  4A6E A;  4H0E A;  1FOX A;  4I0A A;  2COB A;  4I76 A;  3GO5 A;  3CCM I;  3RPQ A;  3F9K A;  2QSF X;  4FE4 A;  4KIT B;  1AWC A;  5DEQ A;  1T8I A;  2ZXW H;  1WVR A;  4HEA 2;  2ZO4 A;  2CQN A;  5D4R A;  1YIT I;  1R6R A;  4PJJ A;  2LLK A;  4XOR A;  2ELH A;  3S2H J;  4XKW A;  2E19 A;  3EET A;  2QKM B;  1IG7 A;  3HHG A;  5D5W B;  2H6B A;  4BQN A;  3VFZ A;  2R7X A;  2VXD A;  3I59 B;  4X0G A;  4JOM A;  2FML A;  3PJR A;  3OIP A;  1N25 A;  2VJ4 A;  3DWL E;  4DW6 A;  3EYI A;  4ENN A;  2ZKZ A;  4XRM A;  3CDI A;  1ENH A;  2CUZ A;  1LE8 A;  2X48 A;  3L09 A;  2L7M P;  5F27 A;  2BVL A;  4IOA F;  3GZ6 A;  2EJR A;  4A6D A;  3P9C A;  3R4K A;  3CCL I;  2BXZ A;  3OS1 A;  5M3M J;  3BR3 A;  1FY7 A;  1TBX A;  2EQR A;  1BBY A;  2X6Y A;  3HTS B;  4RGR A;  1SVL A;  1LUJ B;  1Y8R B;  2F48 A;  2HKO A;  1L3L A;  3P5J A;  1RUN A;  2YSR A;  1Z9C A;  4EEF G;  1R4N B;  2HR3 A;  2VT3 A;  2K9N A;  3KYL A;  1R00 A;  1BC8 C;  2W4S A;  3E6M A;  3M1C A;  3I59 A;  2HVR A;  3BCB A;  4A69 C;  2OCE A;  2KPM A;  3W6V A;  3WGG A;  2GZW A;  4HX7 A;  1X3Z B;  3SDB A;  3EQL F;  4WCG A;  5FFZ A;  1STZ A;  1BR2 A;  1XTA A;  2VJI A;  3H1C A;  2HGC A;  4JX6 A;  1ZQ3 P;  2XVC A;  2JTV A;  5HLI A;  3EYY A;  4V2F A;  2B7E A;  2Y0S A;  4X1E A;  5E17 F;  5BNG A;  5HLT A;  1N75 A;  1K83 J;  3REO A;  2FOK A;  1K6O A;  2P5V A;  4MFD A;  4CHU A;  3T8T A;  2R7Z J;  4OOI A;  4PSX A;  4RB1 A;  3J80 K;  3IV5 A;  4OIR F;  3CCU I;  1CF7 B;  2LBF B;  1GDT A;  4IRG A;  3BG6 A;  2DMP A;  4XID A;  1AKH B;  3KET A;  1ZG3 A;  1Z6T A;  2ICW G;  2E35 A;  4C9Y A;  4DYR A;  3W2V A;  1RRJ A;  1BOB A;  3A02 A;  5LEJ A;  5FKK A;  3HYI A;  2VQL A;  4N9H A;  2JA6 J;  1R5G A;  4M9X A;  2TCT A;  2DT5 A;  3AAF A;  3LQR A;  4EMS A;  4ZC3 A;  4S05 A;  1GVD A;  2H1L A;  2E34 A;  3NAU A;  4PZJ A;  2CQK A;  3IAM 2;  3RJP A;  5H6Q A;  4ENK A;  3DPL C;  1OCO H;  3BPX A;  1V3F A;  4ANJ A;  2K02 A;  2G7U A;  5F1J A;  4XL9 A;  3TW7 A;  1S9H A;  3K1P A;  2HI3 A;  1ZRC A;  3EUA A;  3V8L A;  1CF7 A;  4HPQ A;  2LBF A;  3SFI A;  3LSJ A;  1P9Q C;  3C3W A;  1OCT C;  2ID3 A;  4FHT A;  1UAA A;  2K9S A;  3CMA I;  5ED4 A;  2EB7 A;  2FSW A;  3IH2 A;  3HBL A;  2B9S A;  1MMA A;  2MLG A;  3H3V K;  2B0L A;  2WY7 Q;  4AD9 A;  1LVA A;  4RAG A;  1MSF C;  3ML6 A;  2CG4 A;  4U7B A;  1DPU A;  3KLO A;  4M71 A;  4G6Q A;  2VKH A;  1DP7 P;  1ERD A;  4IL6 C;  4IVN A;  3WG7 H;  1FP2 A;  2R7F A;  2XRN A;  2XAU A;  2JSC A;  5FKL A;  2ZME C;  3PL8 A;  1T38 A;  3IKT A;  3HUG B;  2DOD A;  2ZNZ A;  2OQG A;  1IV8 A;  3ZMZ A;  1IC8 A;  4DIQ A;  4QIW N;  1OYI A;  4PJ0 C;  4KJZ A;  5KK1 A;  5K1Y A;  4GDF A;  3B73 A;  3S3M A;  5DM6 F;  1JJ8 C;  3DLL F;  1I6X A;  1Q1H A;  3M9A A;  3WTT C;  3Q9S A;  2D5V A;  4CXF A;  2XKO A;  3ZQQ A;  5CPR B;  2DA6 A;  2CV2 A;  2A07 F;  2LF7 A;  2QQ9 A;  4P1W A;  3DBR B;  4P96 A;  1ACI A;  1TC3 C;  4PGG A;  5KAI C;  2JVH A;  4UB8 C;  2HTS A;  3I9V 2;  1B9M A;  1R22 A;  5L3G A;  2E1M C;  1VQO I;  3F6O A;  2HPM A;  4NHJ A;  2HOT A;  2PMH A;  2Y30 A;  1F4K A;  1TLH B;  4B1R A;  2XAG A;  4ZZD A;  2PN6 A;  5J6X A;  4MGR A;  1U5T B;  2WAD A;  1REP C;  3TBI A;  2NVT J;  2QQ8 A;  4R8H A;  4NQW B;  3DPU A;  1OR7 A;  2IW5 A;  3HUG A;  3ZXS A;  2ACJ A;  3H36 A;  4EJU A;  2DJN A;  2EA4 A;  1JT0 A;  3CC2 I;  1XDU A;  2R5Z B;  2DFI A;  1A5J A;  2W24 A;  2G9W A;  5IP9 J;  1X58 A;  4KIG A;  4C30 A;  3FXR A;  4N0B A;  5DTD A;  6PAX A;  2EK5 A;  1WI3 A;  3PO2 J;  2IXS A;  4I99 C;  3TOA A;  3WU0 A;  3SJM A;  1ZTR A;  1WSU A;  1FLI A;  3BTL A;  2D1H A;  3SXY A;  1S7O A;  4ZZL A;  3Q0W A;  3GFL A;  2A6T A;  2Z1D A;  3OYH A;  3CDH A;  1XMK A;  3F8B A; 
#chains in the Genus database with same CATH homology
 1WJF A;  5CQE A;  3QYF A;  1MW7 A;  3AL0 C;  4E7K A;  2XF7 A;  2DT6 A;  3MKW B;  2KP6 A;  1QHH D;  1D1B A;  3PSF A;  2VL8 A;  2R7T A;  2CFO A;  4IX7 A;  3H9Q A;  2A5W A;  2Z16 A;  2Z2S B;  2X1E A;  4XKC A;  1G8X A;  3LSM A;  4XM3 A;  4BJT A;  1LVK A;  2CS3 A;  3A4C A;  2DOA A;  2DJI A;  3MD2 A;  3PSI A;  2BVM A;  2XF5 A;  3VYR B;  4GRI A;  4F93 B;  2V26 A;  3EUH C;  3OS2 A;  3HG9 A;  4II3 A;  4B44 A;  4PK4 A;  1D1A A;  3E0J B;  4DBR A;  4LIT A;  4LG3 A;  4P5O A;  4CCO A;  4DGW B;  2ZFU A;  1V5F A;  2CMP A;  1X1C A;  2KMU A;  3FBI B;  1TZL A;  4NUB A;  2ZSH B;  1ZEL A;  3MKZ A;  2CH0 A;  3IUO A;  3OYI A;  2I8D A;  1LFP A;  1D1C A;  2KQR A;  2V1N A;  4KIS A;  1AA7 A;  3E1S A;  3SEQ A;  3L2Q A;  2LY1 A;  4BJ6 C;  4BS9 A;  3OR1 C;  5KHD A;  3QYB A;  4E7S A;  1WFX A;  2VPL A;  2X1C A;  3SZG A;  4E7H A;  4RLQ A;  4XLF A;  2PJR B;  1Y56 A;  3VYT B;  3OYG A;  2R7S A;  4CCM A;  2IS6 A;  3RSN A;  2ZXI A;  4AU7 A;  1QHG A;  4PUS A;  4F52 A;  3L2V A;  4ZDO A;  2LG4 A;  4PJN A;  3DTE A;  4CZC A;  3OOU A;  3OY9 A;  4CCK A;  1Z21 A;  2VAS A;  1MMD A;  2V4J C;  2VKD A;  1DP3 A;  4YRV A;  3OMY A;  3S3O A;  2WAE A;  3H35 A;  2L9N A;  1X1B A;  5KCM A;  2K9L A;  3HPH A;  3QOE A;  4BU2 A;  3OYN A;  2BOL A;  4F91 B;  2KRC A;  4BJ5 C;  4CCL A;  3TMO A;  1X19 A;  2Q2E B;  3SYT A;  2W1O A;  4IQ4 A;  3DQV C;  2HVQ A;  4LIU A;  2VIX A;  1BR4 A;  3OL3 A;  2BW3 B;  3QYE A;  5HNF A;  1EA3 A;  2KLO A;  2GOX B;  2PJR A;  2HPI A;  2JUG A;  3LL7 A;  3MMY B;  4BE1 A;  1Y6I A;  3S8P A;  4E7L A;  3C2H A;  1W36 D;  3S3N A;  2X51 A;  4PFP A;  3LSK A;  4XR6 A;  4Y3O A;  1FMW A;  5LFA A;  3TL4 X;  3A1Y A;  4PFO A;  3AL0 B;  4PJL A;  4XON A;  1X4P A;  4FET A;  2LH9 A;  2MC4 A;  2X85 A;  4RLF A;  4F55 A;  3W2A A;  1QU3 A;  2OC6 A;  3PFY A;  3FHN A;  3H5R A;  5HOO A;  1SFK A;  4XKV A;  2OV7 A;  4ZYA A;  2BW3 A;  4XLC A;  3OYA A;  1DGW Y;  3OYB A;  2VXZ A;  2V6E A;  2XC7 A;  3H0D A;  2WAF A;  3VSL A;  4DBQ A;  3QOD A;  1T0F C;  4G6T B;  1LDK B;  2LC2 A;  3D5S C;  2WY8 Q;  3OYD A;  1MNE A;  2RRE A;  2X6W A;  2IGN A;  1YE9 A;  3OYJ A;  3K4C A;  1GLN A;  1Z3Y A;  1E0E A;  3OYK A;  4N4N B;  3DU6 A;  4OWR B;  3VYU B;  3K4J A;  3LSH A;  3EUK L;  2HDW A;  1IRX A;  3K4B A;  4J01 A;  1LKX A;  3K70 D;  4CCJ A;  1K6Y A;  4F3Q A;  2ELJ A;  4QPQ A;  2DT7 B;  1MND A;  3AFH A;  4XLA A;  4BQO A;  3LSI A;  1X4O A;  2VJJ A;  4E7I A;  1X1D A;  4RM3 A;  3SEZ A;  2ZSI B;  4DJA A;  3N05 A;  1KON A;  2V9K A;  4B48 A;  2R7Q A;  4PJM A;  4BQQ A;  1PYV A;  4D1Q A;  1WJA A;  4JQF A;  1V5E A;  1BR1 A;  2ZXH A;  4LIV A;  3LMM A;  4XKB A;  3VDX A;  2VJ5 A;  2E5N A;  3CJQ B;  1Z3X A;  4ITV A;  3LSG A;  4XMY A;  2W00 A;  2W82 A;  2M4K A;  2IGO A;  3RTR A;  3RQ4 A;  4NNJ A;  1D0X A;  4CSW A;  2L9S A;  3C2G A;  2CV0 A;  3K4N A;  4B47 A;  3ZR8 X;  3FBN B;  4XOT A;  4CH7 A;  4BE0 A;  2JVG A;  2KZV A;  4Y4R A;  2MAB A;  2X6X A;  2M7B A;  1G59 A;  4CUG A;  3ONQ A;  3DKY A;  3S32 A;  2HU9 A;  2MD0 A;  5JHF A;  4U87 A;  2L2O A;  1TT0 A;  3F9K A;  3FDY A;  3HKZ A;  3PNV A;  4KIT B;  3OL4 A;  2O5R A;  2CV1 A;  4HEA 2;  1D0Z A;  4HSR A;  3VYS B;  3CES A;  3DTK A;  3PUB A;  5HNH A;  2CW7 A;  1R6R A;  4PJJ A;  4XOR A;  1WJC A;  3OIQ A;  2VQH A;  5CQG A;  4XKW A;  2IGK A;  2NOJ B;  2QKM B;  4E7J A;  1DGR M;  4BQN A;  1DQU A;  2KRH A;  3M8J A;  3KEY A;  4YEL A;  2R7X A;  4C2U A;  2VXD A;  4X0G A;  4HRI A;  4JOM A;  4OAY A;  3OIP A;  3PJR A;  4CCN A;  2UV1 A;  2VJ4 A;  3DWL E;  4D9J A;  4QPO A;  2R7O A;  2IS1 A;  1VZ0 A;  2CUZ A;  2UUZ A;  3PNY A;  2BVL A;  4YEJ A;  3ZGK A;  1V5G A;  1MMG A;  4BXF A;  3K4K A;  1X1A A;  4ZDP A;  5HVQ C;  4ZDL A;  3OS1 A;  3HXL A;  3OYC A;  2FUG 2;  3H5A A;  2K3P A;  2X6Y A;  4NC8 A;  3BCA A;  2R7R A;  3VSK A;  2XDV A;  2GOM A;  3DLA A;  3KYL A;  3VWB A;  1UEL B;  2W4S A;  3M1C A;  2HVR A;  2RNG A;  3BCB A;  2WBM A;  1U0J A;  2KPM A;  2WAQ A;  4EAT A;  2R7U A;  2R7V A;  4BL0 B;  2AQE A;  3DKX A;  4HNT A;  3DTI A;  4AYB A;  3KX2 A;  4ZTF A;  2JA2 A;  3SDB A;  3OR2 C;  4XLH A;  2E5Z A;  1W36 C;  1BR2 A;  3S93 A;  3U21 A;  4BGD A;  2VJI A;  4CA0 A;  2KDO A;  2DCE A;  3HPG A;  4XQF A;  1N77 A;  3K6G A;  2M3A A;  3UNG C;  3D5R C;  1NG6 A;  3IP4 B;  2Y0S A;  3GBG A;  3L2U A;  3G2B A;  1OLT A;  3HC7 A;  2IGM A;  5HLT A;  1N75 A;  3BLY A;  2MFZ A;  4XN3 A;  2IS2 A;  1JI8 A;  1D0Y A;  3A2K A;  3K4L A;  2HQA A;  4PSX A;  1UG0 A;  2QKL B;  2LBF B;  3BG6 A;  5KNL A;  2CUJ A;  1Z7L A;  4Y33 A;  4C9Y A;  2RQQ A;  3W2V A;  2Q1Z B;  4RMN A;  1BOB A;  3OYL A;  2VQL A;  3H5N A;  3L2W A;  4ZC3 A;  3H9J A;  3W2W A;  3IAM 2;  4RM2 A;  3DPL C;  2F5V A;  3BG7 A;  3CMM A;  3RCO A;  4ZJZ A;  4OAZ A;  2K9M A;  4ANJ A;  4BUP A;  2R4G A;  3K70 C;  2M0M A;  4XL9 A;  5CKT A;  1S9H A;  2AQF A;  2HZD A;  1WJB A;  4J00 A;  2F4I A;  3EUA A;  4E6K G;  2VQG A;  4HPQ A;  2LBF A;  1SAU A;  2K5C A;  2P0W A;  4XOP A;  5FRO A;  2VLA A;  3OYM A;  4IZZ A;  3I3L A;  3K10 A;  1P9Q C;  3OYE A;  1UAA A;  1NG7 A;  3DEE A;  4IQJ A;  3DU5 A;  2HVS A;  4ZTJ A;  1MMA A;  5FRN A;  2LRD A;  2L7K A;  3PNT A;  2WY7 Q;  3UR3 C;  4KT6 A;  3CF2 A;  2M4G A;  5LD2 C;  4E4H A;  2E60 A;  4U7B A;  2R7W A;  2KHM A;  2VKH A;  1N78 A;  1ERD A;  1J09 A;  4PSW A;  3CP8 A;  3CZ6 A;  2CW8 A;  2XAU A;  4H4K C;  2IS4 A;  3PL8 A;  2E1M B;  4IKF A;  4XN0 A;  4FAS D;  2VB6 A;  3HUG B;  1FMV A;  1YX5 A;  2MYS A;  4DIQ A;  4KJZ A;  2XF6 A;  2LRE A;  3S3M A;  2JSP A;  3LFU A;  4MLO A;  5FRM A;  1T95 A;  2F6C A;  3ZCO A;  4BEH B;  2LOO A;  3ZQQ A;  2OUM A;  5CPR B;  4BDZ A;  2CV2 A;  4P1W A;  1YX3 A;  4XNF A;  4F92 B;  4HST A;  1WJ5 A;  2JVH A;  3I9V 2;  2WA0 A;  3OYF A;  4AVZ A;  2E1M C;  2HPM A;  3RPU D;  4E7Z A;  1OR7 C;  1WJD A;  3DPT A;  3K4M A;  4B3X A;  2KL4 A;  2M7A A;  3W3C A;  2LYC A;  3IAS 2;  3J7A Y;  4N4O B;  2LY2 A;  4II2 A;  3HOT A;  2WAD A;  2X1D A;  4BAC A;  3D5L A;  4HG2 A;  3TBI A;  3H9G A;  3HL2 A;  3ZRG A;  2L5Q A;  4NQW B;  3DPU A;  3ZXS A;  2PMZ A;  3V42 A;  3CP2 A;  1PJR A;  2W7N A;  4NC7 A;  3EPZ A;  4HNU A;  2VQC A;  1MMN A;  4R79 A;  4B43 A;  4C30 A;  4BEH A;  3AKZ A;  2WB1 A;  2HNH A;  1WJE A;  3FKJ A;  2IXS A;  4BDY A;  3NWS A;  4DOZ A;  3HOS A;  3MKY B;  4BE2 A;  2XSJ C;  3NWT A;  3OWT A;  2V7F A;  2DXI A;  2UWM A;  1HA8 A;  4XLE A;  3BC8 A;  2A6T A;  2Z1D A;  3CJR B;  3OYH A;  5TGT A;  4C2T A;  3OS0 A;  3L2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...