2L2OA

Solution structure of human hspc280 protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
b'MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKSANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQDLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0727 protein C6orf115
publication title Solution structure of the human HSPC280 protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14705 Costars Costars
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l2oA00
2KRHA 2L2OA
chains in the Genus database with same CATH superfamily
1O3QA 2HOTA 2ZO4A 5GAHJ 2FBHA 3BG6A 3P9IA 1PP8F 5E1XA 4II3A 1A6QA 1OCZH 3REOA 2KPMA 3KP7A 3E5UA 4S04A 3BR5A 3MN2A 1RR7A 2F5VA 1WGXA 3PSFA 4JX5A 4EJTA 1F36A 3FHZA 3KLNA 2HYGD 3GCMA 4MFDA 2DA1A 3SFIA 3K1NA 4FHTA 2X85A 3HL2A 1LB2A 1DPRA 3T8TA 1AA7A 1FIAA 4RM2A 5DUIA 3QRFF 1G3YA 3NEUA 3A1YA 3DBHB 3AG2H 2VLAA 2X4HA 4YFNF 1U5TA 1RKWA 5K5QA 3H1CA 4NC6A 1KZHA 4XLPF 3PFYA 3F21A 3BROA 2QZ8A 3LAJA 3WTVC 1XSXA 4G7OF 5FGMA 1MKMA 2VODA 2ECCA 1EH8A 5FFXA 4QSHA 1SVMA 3F6VA 1JJ8C 3DEEA 1VQLI 4IJAA 3F8NA 3AG4H 4X0GA 3RDIA 3BR0A 2E7XA 4ITVA 1MMNA 2IRFG 3GTGJ 3L09A 1PYVA 4MO7A 4FE7A 3I53A 4XR6A 2BXZA 5L3FA 3R0JA 2KDZA 2ECBA 1Y1WJ 3DPTA 4CZCA 2FMLA 5A2QK 4MFEA 1OMIA 1KQ9A 2BHYA 1MW7A 5J8FA 5D8LB 3RZDJ 3A01A 4CCJA 3BR1A 2EINH 3HJEA 3DPUA 5D5VB 2GA1A 1E3PA 3LSKA 1SEUA 1MMSA 2P7VB 3OY9A 4I09A 1I27A 4KFCA 2R0QC 1EH7A 5IOYA 4BHCA 3JRAA 3S3MA 2WAEA 1BOAA 3LNQA 1MNMC 4BH9A 1BOBA 4XLFA 2VBZA 4IHVA 2CO5A 1X2MA 1HW2A 4N9HA 1SD4A 1R4NB 3GBGA 2DLLA 2FF4A 5IYBJ 2MD0A 1JT0A 3RIRA 3FBNB 4B3XA 4EJOA 4H4KC 3KP4A 3FXLA 1O3SA 1TBXA 2GOMA 1FEXA 2K9LA 3FDYA 4JX4A 3B73A 3WGHA 4UY8I 2FBKA 3EDPA 4CCMA 2V9PA 1YJ9I 2K27A 1MBFA 4MQVA 4XLNF 3CZ6A 5DV5A 2FXAA 3K2ZA 4D9JA 3K2AA 2RKHA 4XN3A 4ZTFA 4B47A 5HLHA 1RIOH 2DJNA 3GTOJ 1JJ6C 2GIZA 1XDSA 3HM5A 1LEAA 1R23A 1P7IA 2K9MA 4U87A 2QM3A 2BOLA 1G4DA 2LKPA 3MZHA 4BXXJ 3NWSA 1TNSA 2ZKZA 4OWRB 3RYRA 2OA4A 4DIQA 1YJNI 3FZVA 4CA0A 3VWBA 3I9V2 2QKLB 1WZ2A 4H0EA 2BGCA 2CMPA 2L7MP 3GTLJ 1MH4A 3LSRA 3KLOA 4NC7A 3NAUA 1X1AA 4AIHA 1XDUA 2K3PA 1VQ9I 2M87A 2QENA 1CGPA 4FX4A 3E6CC 3BTLA 3G73A 3H5RA 1IXCA 2E5NA 4L9VA 1YW8A 2DT6A 1Y39A 1ZGWA 4LITA 5D5WB 2K4JA 3W3CA 5L3DA 1UHMA 2KZVA 3OV8A 2WY8Q 1S72I 1IRGA 4I2OA 2DA7A 5ERIA 2XC7A 1LFPA 1KU7A 1ZH5A 2XUBA 3DU5A 4E6KG 1X3ZB 3WTYC 3BCAA 5IT3A 4AWXB 3HSFA 3R4KA 3JRGA 1GVDA 4DYCA 1Y8QB 2Z3YA 3KEQA 5TRDA 1I1GA 2DA2A 3DEWA 2YUSA 2HEOA 1ORKA 2K40A 2MA3A 3MKYB 3KCCA 4LG0B 2PG4A 5GAGJ 4ETSA 3VODA 3RPUD 1EA3A 1D5YA 1H9GA 5BPDA 4HSTA 3P9KA 2MGQA 2VJJA 4C2TA 2Y2ZA 1E3HA 2CW8A 1JHHA 2IGMA 2L5QA 5DCFA 3CUOA 2EFQA 4HF0A 2IA1A 4J00A 2IP2A 5H20A 3FBIB 2ELKA 3HUGB 4A3LJ 3K4MA 2HNHA 2V26A 2PMZN 3G3ZA 1KU2A 2HXOA 2DT7B 3DWLE 3MEXA 1HOMA 2KHMA 1W5CC 2WTEA 4MHGA 3CJRB 3RJPA 5J1YA 2DI3A 4WX9A 4JBAA 4M3BA 4HNVA 4YIRX 1K78B 3WE2A 4RMNA 1IO2A 1ZARA 5EDNA 1FMWA 3LQRA 3F8CA 5D6FA 2GIVA 2K7LA 1I1SA 1FY7A 1QVUA 2QBYA 4N4OB 1ZTRA 4PUSA 3DP7A 4L9TA 5JHUA 3RZOJ 3GW2A 4LB5A 2HPIA 1VQ7I 1LQ1A 4FE4A 2FNPA 5K1YA 4IEJA 3O3KA 1B9MA 2R7DA 3EETA 2R7UA 3V42A 5BPIA 1R36A 5B1BH 1OCOH 1JUMA 1LDKB 1MH3A 2UWMA 1XPXA 1FTZA 2XAQA 2KT0A 3K4BA 4PK4A 2VT2A 2EV5A 1C0WA 5L3GA 4HLYA 2V9VA 1STZA 5E3MA 3J81Z 1TQMA 3G71I 5E3OA 1U6GA 1BR1A 4RAZA 4RGSA 2X0LA 1YX3A 4HDUA 3BZCA 5BOXA 1OPCA 3ZQCA 1B8IA 4UVBA 1B72B 3ABMH 1SFEA 3AG1H 4M73A 2LK2A 5B66C 4D1QA 3I5UA 2VBWA 3EQLF 3RPQA 2DOFA 2FQ3A 2X48A 4OIPF 1KQ8A 4F91B 4UUVA 3HGGA 4RLQA 1FMVA 4EJWA 3ELKA 5CVRA 2VT3A 1SFUA 1MJBA 1VQMI 1R5HA 1XGOA 3ML6A 3LSIA 3DFGA 5DUKA 3VPRA 3MQ0A 1F1ZA 5EYRA 2E1CA 9ANTA 2KZGA 1HDDC 3CCVI 3N97A 2TRTA 1UAAA 1NTCA 4PSXA 1DP7P 2BVLA 2RC4A 3HXLA 3SFZA 5K5RA 1HW1A 3BLYA 3FK6A 4NNJA 3CUQB 5IT9K 2DFFA 4IO9F 4QLCU 2VPRA 4AC0A 1SD6A 3LA3A 3FHNA 1Y0UA 4OAZA 2XGCA 1HSTA 1OQYA 2UXNA 3FXMA 1ZN2A 1B4AA 2X51A 3LA7A 3ZRGA 3CC2I 4NBQA 4ZTJA 2XGDA 2I5UA 2EB7A 2HTJA 2ZNZA 3K9TA 1R5ID 4BXUA 3LFUA 1ZQ3P 3BTJA 2DPUA 4IVNA 3LWFA 2IT0A 1BR2A 1W7PB 3ROUA 3EYYA 1H0MA 6PAXA 2NNNA 4HQMA 3CCJI 2W1OA 3BZ6A 2L02A 1IRZA 3M8FA 4U7DA 4HX4A 3MZ8A 1USSA 1IGNA 3PSIA 1U5TC 2HZTA 1VQKI 3BTIA 2ID6A 3WODF 1VQ6I 3QPSA 3M1CA 3F8MA 4BY1J 3CESA 4RS8A 2BE5F 3IWZA 2QLZA 4A5NA 3LFKA 2CU7A 3T1BA 3BQZA 3F3XA 4S0HB 3CF5F 2ELHA 3HKZN 4HBLA 4I0AA 4O5VA 4BDZA 1HKSA 2BW3B 2YR2A 3HBLA 1TWGJ 4OIRF 2E1MC 3UR3C 4XRSA 2ZXHA 4LGWA 3OS0A 2Y30A 2JZYA 2WAQA 3ZMVA 2MH9A 2OC6A 2HZDA 5LRRA 3MZYA 3J80K 3AAFA 4HF2A 4E7LA 5DTDA 1TWCJ 1U5TB 2NS8A 1DGRM 4UHTA 1AOYA 2FSWA 3LSPA 3CCYA 3OOPA 3ZGKA 2HFHA 2DQRA 2MABA 4M72A 1CF7A 1JUSA 4O3MA 1QQIA 5BS6A 3OYIA 1P4AA 3GUDA 1ON1A 2P5VA 2HR3A 4HW0A 2EIMH 1W5SA 4A0ZA 2K9QA 4ENKA 4U7BA 2E1MB 2VKDA 1TTYA 1FZPB 4A3CJ 3A02A 4M6YA 2A68F 3H3ZA 2L54A 3JW4A 1S7AA 1ZREA 4LJZF 2G0EA 1GT0C 2VONA 1Z3XA 1QNTA 2LRDA 4CCKA 3DBLB 1K7AA 4EM2A 4U0YA 1I6HJ 2X6WA 2K02A 3A01B 2OTLI 4N9IA 2JA6J 4G12A 3C1DA 3H36A 3FMQA 3AG3H 3QU3A 4B44A 1MJ9A 4ESBA 5FLXZ 3G2BA 1O7FA 4BE2A 3T8RA 1K6YA 2F4MB 1JT6A 1RI7A 5FKKA 4C3IJ 1TWHJ 1X3WB 4QPOA 4XOTA 1K6OA 2LTPA 3GTQJ 1MJAA 4C3HJ 4PJNA 3TO6A 1BM9A 4AUXA 3CF2A 2L7KA 4OIQF 2M7BA 4XIDA 5FD6A 4N4NB 3C2HA 2DOEA 3FKIJ 4KIBA 4BJ5C 5M5YJ 3IH3A 3EUKL 3GWZA 3BP8A 4PJMA 3KP3A 5J4VA 3JSOA 3P9CA 2F5EA 4BDYA 2WA0A 5HDGA 2EFPA 5EZHA 2W85A 1APLC 2Z1DA 5D4SA 3QOPA 5DM6F 1OJLA 2JMWA 2YU9J 2DCEA 4ENMA 3QPHA 5CVUA 2Y0SN 1FSHA 3CCQI 1IG7A 2EIKH 2GXAA 2QEXI 4B48A 3S3NA 3WTZA 5LGTA 3S17J 4WK8F 3DKYA 3ZPLA 1F9NA 2RVCA 1ON2A 3OR2C 4RM3A 2PBIA 3PL8A 3SDBA 4CXFA 3D0SA 2LKXA 2KLOA 2FQ4A 4BL0B 2K9SA 1E2XA 2CQXA 2LH9A 3GXOA 3LMMA 4LLLA 1P6RA 2P8TA 2P81A 2H27A 4V19K 3JR9A 5HDKA 4V2GA 1DDNA 4ESFA 5CQGA 1H88C 1D8JA 4GCVA 3CCLI 1WJ5A 1IN8A 2K86A 4A0XA 2CG4A 2HOSA 2ZB9A 2E7WA 2W25A 2X1DA 5F27A 4HDVA 2TCTA 4P5OA 2DXIA 1UELB 1IDZA 1MBHA 4MTDA 3KP6A 4JYKA 2MSYA 4ZDPA 5IPAA 2V79A 4EGZA 1V55H 4U88A 3S1NJ 3ZQHA 2NAZA 1LPQA 3TOAA 3P5JA 4ZJZA 4L0YB 3B6AA 1KYZA 4GYIA 2DTZA 2PFBA 3V7CA 3MFKA 1EKEA 3M8EA 3HOVJ 4P9UA 2G9WA 3OYEA 2IA2A 4DGWB 4XBFA 2GOXB 3TL4X 2ZNYA 1O4XA 5E8GA 1GVJA 4CSWA 2G7UA 2XF7A 4BACA 1OLTA 4ABZA 2LY2A 4FTHA 4XL9A 1UB9A 2A05A 1N77A 1OCCH 4RB0A 2WV1A 3HSRA 2KRHA 2HQ5A 2OAZA 5DM7F 4HAMA 4A69C 4EM1A 4AM3A 3R6SA 2QWWA 1X1PA 4UB8C 5E1ZB 2ID3A 2Y9YA 2ME6A 1Q1HA 4F52A 5L3BA 1ERDA 1WH5A 3CDHA 1IDYA 4Y13A 4G6QA 2FRHA 2ZXIA 1JUPA 1YS7A 3M8JA 3ZR8X 1S3JA 4I98B 2ICWG 4HA8A 5J1RA 2IJLA 3GYHX 2DMUA 1TW3A 2IBDA 3ABKH 1ETVA 3GLXA 2CW7A 2GA2A 2LREA 5M5WJ 4IQJA 3S15J 1T08B 2KMUA 1K79A 1IJWC 4A3BJ 3RCOA 2QBYB 4M3GA 1Y8RB 2OQGA 1HKQA 3TDZC 4XLHA 1QPMA 3G6EI 3CDLA 3PNTA 1ETWA 1F43A 4MQ9F 4D5FA 4CCLA 3L2QA 4AVZA 1MZBA 3FMSA 4Y15A 1XGMA 3CTAA 5HNFA 1FBQA 1G59A 4UVAA 1IC8A 1PJRA 1MBGA 3S16J 4OMYA 4D7MA 1QZZA 2VASA 1FIPA 3I59A 1FSEA 3CCEI 5E3LA 3GFIA 3VYUB 1JGGA 1E17A 3W2WA 2M4KA 4C3JJ 1FYMA 3S2WA 2L3DA 1FNNA 3A03A 3DTEA 5ED4A 1ZR4A 1TWAJ 1B8IB 1WCMJ 5J1UA 4DBRA 1YJWI 2A69F 4IHTA 3C3WA 4QPQA 4DZPA 4Z6YA 4RGXA 2R92J 3ZMSA 3COAC 2LBFA 2BY1A 5DEQA 1J09A 1ENHA 4EQQA 1U0JA 4S05A 5FRNA 2FU4A 3WE3A 4JP0A 1R58A 2W24A 5J3LA 3CO6C 1YI2I 3VDXA 1Z21A 4ZZLA 1U3EM 5EF6A 1OYWA 1FYKA 4RB2C 4CZZA 1ZLKA 3GEZA 2CRGA 4ZYDA 5HS8A 1R22A 1UMQA 2HYFA 1QVTA 2XASA 3IP4B 3K4NA 1WQ2A 2VXZA 4XSZF 2V1UA 4UUSA 3KEYA 4G94A 1QO0D 3CLQA 2GM4A 2XF6A 3JRDA 3U9GA 5ICCA 4EEFG 3K10A 5FROA 1HW5A 3FXJA 1TZLA 3H5AA 4ZH4F 1AWCA 3VSLA 2Z99A 2WY7Q 4R8HA 1U9OA 5FO5A 4XORA 3H35A 2B9SA 3KZIC 2NOJB 3O6BB 1VNDA 4LG3A 1ULYA 4XLAA 3LSMA 5D8KB 4DYQA 3NARA 3AFHA 5KAIC 3QP6A 4OU0A 2E36A 4RLFA 2YSRA 1PUFA 1Z05A 1KGSA 1BN5A 2KISA 1W0TA 2OCEA 4IOCF 2E5ZA 3I0TA 4QWQA 4LIUA 2H6BA 5GPAA 3OYNA 4BUPA 1WJCA 2D2WA 4UXNA 1MBEA 4KT6A 4KUMA 2EV0A 4QTRA 2Y0MA 2CV2A 2L9RA 4Q5SF 3OS1A 5EZGA 4NC8A 2EWNA 2QVOA 4LOCA 4BQOA 4JX6A 4WWCA 2M0MA 3IH2A 1OCPA 5HS9A 4RBOA 3A0HC 1EV7A 3R61A 3ZP5A 2HGCA 3IKVA 3AKZA 2WBMA 2P4WA 2AXTC 4D5CA 1RUOA 1Z6RA 1BI2A 2JT1A 1MDMA 4L5IA 2X9DA 2IAIA 5DD8A 1Z1DA 4XNFA 3KFWX 3E1SA 1OCTC 1PVEA 1R5GA 4XKBA 5GTIC 5M3MJ 2IS2A 2EJRA 2LLKA 2FOKA 1T2KA 1L0OC 4AIJA 2EPFA 3ECOA 2DMPA 2FX0A 3ABLH 3HIFA 1OR7C 2XPWA 2UXXA 3ZMDA 2JA2A 4XLEA 2JN6A 4YRVA 1SFKA 2M3AA 2FNAA 2VOOA 3ZMZA 4IZZA 2M8GX 2J5PA 1LNWA 1P2FA 1GDTA 2L4AA 5LGUA 2Z16A 3IKTA 1LFBA 2XGEA 3WG7H 3BR6A 1BC7C 2NVXJ 2VI6A 4IF4A 2RN7A 3Q0VA 2JPCA 4HX8A 3NRVA 4Y33A 4YFXF 2IS1A 2DDAA 4HLXA 4A5MA 5BQTA 2BEOA 1DQUA 1I50J 1TP4A 2ZMEA 4BEHB 1EF4A 2EZKA 3R60A 2GWRA 4ZC3A 3L2WA 4PJLA 4A3MJ 3OYFA 3JREA 2CSOA 1UG2A 2JA5J 4F92B 3VYSB 2A61A 1QHHD 3HG9A 3IV5A 2DYRH 4FASD 1LDJA 3CJQB 2ZJPF 2K5CA 4FQGA 1BI3A 5H2FC 2HPMA 2XROA 5IOZA 1HA8A 2BY3A 2VC1A 4N0BA 4CH7A 4G6DA 2GXGA 4X1EA 4KA4A 2F5DA 4ZDLA 4HF1A 2CV0A 1I6XA 3KYDB 1FJLA 2H8WA 3F8BA 3DLLF 3Q9SA 2RNJA 2EZHA 1HDPA 3KPHA 1KA8A 1BBYA 3M7GA 3H3VK 3PQKA 1IXRC 1DPUA 3RQIA 4DQ2A 5JR3A 1MMAA 5KAFC 3B6CA 3M4OJ 1Z0XA 3C7JA 3ZXSA 1CQTA 2OQRA 2PN6A 4XSXF 3JRFA 2I10A 3FXUA 1KYWA 2DO7A 2B7EA 3DF8A 3JRHA 5E3NA 3GFJA 3HOSA 2H94A 2KP6A 3OYAA 2MC4A 4CHUA 4U0VA 3HOWJ 5EEGA 5ILSA 2V1DA 4WF2A 1E0EA 4BNCA 4RGUA 3ZQQA 4D0PA 2H8RA 1UG0A 2LYCA 2H6CA 1D3YA 1QZEA 4XKCA 3JSPA 2R5YA 3SEQA 2RV8A 4D7NA 3JRCA 2LVSA 4HQEA 3OL4A 4M3EA 2D5VA 3GLLA 3WHBA 1V3FA 1Z6TA 3ERED 5CYVA 2ESHA 3BR3A 3BG7A 1XD7A 2JVHA 2L01A 2WWYA 1HKTA 3BQYA 1ZG5A 3OYHA 2W4SA 3LSTA 3CMAI 4M3DA 1QZYA 2M34A 1XMKA 3S14J 4CYDA 1T0FA 3GTJJ 3J81K 1HQCA 3TQNA 5HVQC 2HVQA 3PM1A 2BXYA 3HYIA 1N75A 3RKXA 2WAQN 4GGGA 2XSDC 1NK2P 1RZ4A 1TT5B 5H6QA 1SMYF 3QU6A 1KONA 3EUAA 4Y17A 2F6CA 4KYWA 3VYTB 2NYXA 5BNGA 1R6RA 4IX7A 2UV1A 3Q9VA 5JLWA 2WADA 1ETQA 2V6CA 2DODA 1S6LA 2ELJA 5F1JA 3SZTA 2VKVA 4G7HF 4NDLA 2HDCA 1IV8A 2B63J 4KDPA 1SVOA 4BGDA 2YS9A 1ZHFA 3CMYA 1TT0A 1Y1VJ 3BJOA 3DLAA 2D1VA 2E19A 1K4SA 2L7ZA 3S1RJ 3ZN1A 2DPDA 4GDFA 1JKPC 3I3LA 3TO7A 4AYBA 1TW2A 5IYDJ 3CC7I 4AIDA 3MKZA 1XGNA 2H09A 5EEAA 2K4BA 4RAYA 3LL7A 1G3WA 3HRSA 4RA2A 1JHFA 5GPCA 3E5QA 2PJRA 5EGOA 2HYJA 1GXPA 3TOBA 4E4HA 2EV6A 3N4MA 2R4GA 2EZLA 2JVGA 2CFOA 1VQ4I 1REPC 2M5WA 1UHSA 3W2AA 4M9SA 3OWTA 3ZQLA 4EM0B 3JRBA 3DBRB 2CW0F 4G6TB 4W97A 2NNYA 1D1BA 3I59B 3IWFA 4NB5A 1T95A 3HHHA 1YRNA 3CJNA 5LRSA 3L00A 2GXBA 2C6YA 2IGOA 2IEKA 5L3CA 3DKXA 2E71A 1WJDA 3M9AA 5EJCA 2XPVA 2Z9OA 1W0UA 3FM3A 1AKHA 4IPAA 4PJ0C 1ZELA 2Y9ZA 1K61A 3DTIA 1GUUA 3SYTA 2WB1A 4XRMA 4YIFA 3ESWB 2AS5F 1WSUA 5IT9Z 2LBFB 2L4MA 4M74A 1FOWA 1RUNA 1V5FA 3MD2A 3LAPA 2KL4A 2XKPA 2BZTA 3K4LA 4J01A 1J0RA 3H9QA 3GX4X 4W1UA 4I76A 4IOAF 3OYBA 3MCZA 1BC8C 1J59A 2KRFA 2M1BA 5TISC 3QQAA 2P5KA 1SAUA 1ZR2A 3HOYJ 2AQFA 1QRYA 2STTA 4UUSB 2DA3A 1BL0A 5D5XB 5E1WA 4Y4RA 2ESNA 5CLSA 4XMYA 2O6GE 2DU9A 1JI8A 1X4PA 3JRIA 4Y52J 3PFIA 4BS9A 4RDUA 1MSFC 4XK4A 3JAMZ 3WG9A 1DU6A 4Z2YA 5EG0A 3TP3A 2ME0A 2BV6A 1Z77A 3HDDA 1BI1A 1GV2A 5ICFA 2J5OA 2A3SA 1K4TA 2ZSHB 3BG3A 1SFXA 2XAGA 2OTJI 2CS3A 1TNTA 3BPVA 5L3EA 3F22A 2HXIA 4A2UA 3JTHA 1PUFB 2GLOA 1BW6A 1UJ8A 4F7ZA 3ZN0A 2XDVA 2IS6A 4BY7J 4C30A 3PUFA 1XN7A 1D0YA 1R00A 1XC5A 3BY6A 2ZCWA 2HS5A 2ZJRF 5FLMJ 3J80Z 2VC0A 3MAJA 1XB4A 4XKWA 2QQ9A 1P4XA 4B4CA 3ZQ7A 3SXYA 3QAHA 4GYGA 3T5XA 1FC3A 3H5NA 2V9KA 3CO7C 3BG5A 5FLXK 3ASNH 3I58A 2DK5A 3HB9A 4E70A 4UB6C 4HEA2 5ILUA 3SZGA 2R7SA 1B1BA 1OR7A 2XF5A 3CQZJ 4M9ZA 2RNGA 2VBYA 3PIOF 3DKWA 2HTSA 1E3OC 1VQOI 1MD0A 1MDMB 3GZ5A 1MNEA 2YX7A 1YOVB 3V7RA 4L9JA 1IZ1A 5E79C 4EATA 3V8JA 5HDNA 1VFCA 2Z2SB 4EV0A 2O5RA 5H6RA 2VQHA 2ZC2A 5DYMA 2RDPA 2E35A 3E6BA 2IS4A 1D0ZA 4ZYEA 2W57A 5LGNA 1ODDA 4WXHA 2LR8A 3ZOBA 1FPQA 1S7EA 2MLKA 3CMEI 4A3EJ 2HWVA 5FKOA 4KIGA 1O3TA 4MIMA 2CQ7A 4ZYGA 1YO5C 2KRCA 4KN4X 5JLXA 3GTMJ 2PI0A 4Q4ZF 5DD4A 2JRMA 3PO2J 2ZMEC 2EK5A 1YHQI 2DFHA 1ZAOA 3Q0WA 1MNDA 4MLOA 5ICEA 3HSEA 4HSRA 4GO1A 4HV5A 1WVRA 1RNLA 2CUJA 2QKMB 2P0WA 3PUBA 1R49A 3BJ6A 2P6SA 1S29A 1UZCA 3K1MA 5K5OA 3TW6A 2M0CA 3ECHA 1ZG1A 4DBQA 3K70D 3D5SC 2WV0A 2EILH 2FA5A 1FOKA 2FBIA 2CGPA 2VUMJ 2MC3A 2RGVA 2VOPA 2N8GA 2ZMEB 4I7HA 1YLFA 3MVPA 3AL0C 3F9KA 3A4CA 1U9NA 2JSPA 3I71A 5JFRA 5IP9J 4A3FJ 1R71A 5F0FA 3J7YJ 4OIOF 1P92A 1ZGAA 4RAGA 1LFUP 5AONA 5K7FA 5IP7J 3TP0A 3SJMA 1PDNC 4PSWA 4IHWA 5B5EC 2O8KA 5LHIA 2EBIA 1WKMA 2O61A 1DU0A 2L9VA 2QA4I 1DGWY 4B8XA 1UCRA 3J7AY 1T56A 1YW9A 1AU7A 5E8IA 3LQQA 1G8XA 4AU7A 4L5EA 3CLOA 3AL0B 3RKQA 2DFEA 2HVSA 1G3TA 4LMYA 2R7TA 5FFZA 2X6YA 5GTHC 1OCRH 2BY0A 5LHGA 3OR1C 2PX9A 1O7LA 3FK7A 4FCYA 1LKXA 2BYVE 4U0WA 1F5TA 1BJZA 2XGXA 3K1PA 5DS9A 1ITYA 5GAEJ 3WU1B 3L9FA 1Z91A 2VQLA 1MSEC 4GXOA 4XRSG 2NVQJ 3KEOA 3LA2A 4A6DA 4IXAA 3QYFA 5DCMA 2FE3A 3S2HJ 1GLNA 1XX5A 4NQWA 2M30A 3F72A 3OOUA 2RREA 2UUZA 5CVVA 1RETA 4JK1X 1QU3A 2QUFA 4IQ4A 1YIJI 2NS7A 3S3OA 2NOGA 3ERMA 2R5YB 2IPQX 4KMUX 1T0FC 2VB6A 1WI9A 1YITI 4WXDA 3C18A 3QYEA 4QIWN 1YX5A 4G9YA 5HNHA 5LFAA 3RTRA 1IF1A 1VZ0A 3CCSI 2HQAA 3BZKA 1DP3A 2ZJ2A 5TGTA 1IN5A 3CP2A 3CCRI 5E20A 3I55I 2JTVA 5C4XJ 4MTEA 2VE9A 4AIKA 4BXFA 2ZFWA 2ISYA 4C2UA 1QBJA 2HOAA 1XS9A 1JE8A 3HZJA 5CVIA 2VPLA 5EEHA 4PGHA 2KQRA 2STWA 5F0CA 3GTPJ 2UZKA 2O3FA 4HYEA 3DXJF 5KVRA 5AIPA 2NVYJ 1LE8A 3F0CA 3U2RA 2ZSIB 2XAHA 2MLGA 3S1QJ 2HKOA 2E60A 2OJED 4LB6B 2HKXA 3ASOH 5HOOA 2DA5A 3HRUA 2LD5A 1A6IA 1OFCX 4I01A 1IUYA 3BG9A 2QGUA 1XG1A 1V54H 4KT5C 2ZXWH 1D5VA 2R7RA 2LY9A 5HS7A 1JKOC 3S8PA 3GZNB 2EFNA 2FMYA 1JTYA 1WJEA 3H0GJ 4M6XA 5LEJA 5ICGA 1TC3C 4I99C 3NWTA 2PJRB 1Y0NA 4X6AJ 2DT5A 2Y75A 5EGOB 1X1DA 2L0KA 3C2GA 3CP8A 5D4RA 1HCRA 3PJRA 3SZPA 3S2DJ 3CMMA 3IH4A 2F2EA 1RR8C 1ONVA 2ZBKA 4P1WA 3KETA 1D1CA 1TLHB 4NUBA 2CWEA 2XSJC 3K4JA 2NRAC 3K0LA 4RB1A 2IGNA 3O8GA 1YRNB 1SD7A 2K3FA 2Q2EA 3K69A 2CUFA 2Q8KA 2R7XA 1W4MA 4CGZA 1BW5A 2R5ZA 2JQ7A 1GXQA 2HI3A 4DZJA 3HOXJ 5F08A 2L7FP 1FLIA 2BW3A 3OIOA 3L2UA 1L3LA 2EZIA 4HNTA 2VL8A 1AKHB 2W48A 4EJUA 1ETXA 4BE1A 1YQAA 2DFIA 4ENNA 4P96A 2HDWA 2QQAA 1T39A 1O3RA 1QA6A 4GRIA 2VQCA 1MIJA 1M1EB 1H89C 2OV7A 1X2NA 5HLIA 5JVTA 1XCBA 1WI3A 1YS6A 4A3JJ 1IV6A 3A0BC 5KHDA 4ZYHA 1EJ9A 5FD5A 4PGGA 5FJ8J 3TDUC 1R1VA 3VFZA 3BOQA 2X1EA 3DQVC 3KYCB 4BYYA 1P7JA 1SFOJ 4A3KJ 1W5TA 4PCQA 5EG0B 1Z7LA 3TKYA 2QSFX 2BY2A 1A04A 2JK3A 2LG4A 2A6TA 5A2QZ 3PQJA 2LSOA 2ADUA 2Y69H 4HOBA 3LSHA 2DDBA 3OYCA 1CF7B 5K7HA 4RAFA 4BU2A 3J7ZI 5CQEA 1PP7U 2IXSA 2R7VA 2MBFA 2QQ8A 4IRIA 2XAJA 1QGPA 4R79A 2P5LC 4E7KA 4XRFA 3I56I 2VJ5A 2R7QA 2O7OA 3SHFA 3ABUA 1A31A 1NG6A 1HSJA 2M7AA 2DA6A 3RKWA 1U8BA 2L2OA 4DYRA 2OUMA 3DPLC 3G4SI 1KU3A 2JSCA 3FISA 4IKFA 2XB5A 5C3EJ 3MKWB 3LSGA 2KIMA 2F5CA 3RSNA 1P9QC 2EFWA 4M71A 2M2EA 1O57A 2KKOA 4AD9A 4KISA 2L9SA 4IHXA 1R9TJ 1D8KA 2XHKA 3F6OA 4KITB 1ACIA 1X4OA 2NXNB 4G7ZF 1Y56A 2FD5A 2KDOA 3KE2A 1D1AA 1ZKGA 3B02A 1FP1D 4UUTA 3TGNA 4A6EA 3PIPF 3E6MA 5J4YA 4Q48A 1Z67A 3IHUA 1VQNI 4A0YA 4XICA 2CUZA 1FX7A 1V5EA 1A36A 2X6OA 2E1OA 2DQLA 2EH3A 3BC8A 4LK0F 4E7IA 3K6GA 3SEZA 2EFOA 1ZK8A 2BVMA 2XPUA 5C4JJ 4Y3OA 4IHYA 2L9NA 3NQOA 3ONQA 1AHDP 4HG2A 2JUGA 4MGRA 2A5WA 4AYBN 1RRJA 2F4IA 4CICA 1RC9A 3WU2C 2VJ4A 1NK3P 1BIBA 4B3AA 3KIOA 1T8IA 3X2QH 2DYSH 4A3GJ 4FT8A 1NH3A 3FM5A 1QHGA 1RPWA 1I3AA 3IRQA 2QCOA 2YU3A 4A12A 2QSHX 3HTSB 1YYVA 1W36C 4KICA 1OKRA 2Y48A 2XVCA 1ZRFA 2VKEA 4DOZA 2R7ZJ 3OYMA 2XB0X 3LOCA 3S1MJ 1NG7A 3GTKJ 1IRFA 4I0BA 3WTUC 2OF7A 4L0ZB 1YG2A 4ZYAA 4ANJA 1VTNC 3E3VA 1G2HA 3QODA 2BHZA 3E0JB 1HC8A 2CQKA 3HRMA 3KX2A 1WJBA 1ETKA 1XSDA 2VE8A 1W36D 1SD5A 4XOPA 2K85A 4B43A 4Y7NJ 3VSKA 4BBRJ 2MFZA 3BR2A 1XMXA 2CQNA 2VQGA 4HPQA 2D45A 3OYDA 2O9LA 1OYIA 4CCOA 1OISA 1Z3YA 1IRXA 1A35A 1J5YA 2GZWA 2WB1N 3DEUA 3TBIA 1I39A 2F48A 1ZG3A 5F1RA 3WGGA 4F55A 4L9NA 5FKNA 2VJIA 4DNCA 1VI0A 1XSVA 3IL2A 3E6DA 3W6VA 2OBPA 1R4MB 5K7ZA 4L18B 3BT9A 1P4WA 3QYBA 4HX7A 2W7NA 4XM3A 3H92A 1K83J 2EA2A 3R0AA 2HOEA 4KNYA 5KK1A 3KZZA 5IP6A 1WHUA 2JPBA 2MYSA 3IRRA 5B3SH 3CD6I 5CVJA 5D6EA 2Y31A 4RGRA 1V5GA 1XTAA 4IRGA 2F5FA 2DAOA 5CPRB 3ABTA 4I02A 3BTCA 2F4OB 2X1CA 4J19A 3EUHA 3L1PA 1B9NA 2COBA 2VBXA 2W84A 3J7AO 3FXQA 4BKXA 1A5JA 4CYCA 3DCFA 3H9JA 2H1KA 3IUOA 2A6EF 4CUGA 5DCMB 2ISZA 3PNYA 2VN2A 3BJAA 4NQWB 3I4PA 5FB2A 2JA7J 3S93A 1X3UA 5LBQA 2IGKA 1HBXG 4GFBA 1R1UA 3T0YA 3V7SA 4DW6A 3CDIA 3S32A 5BMZA 2YX4A 2XRLA 4V2FA 3D5LA 2OU2A 3WTSC 3OIQA 1WRJA 3JTGA 2XAFA 1JKRC 1BR4A 5CKTA 2QSGX 4IL6C 2DW4A 4P9FA 2R7FA 2R3SA 3KP5A 3M1EA 3QWLA 4XQFA 2NVTJ 3CJTB 2TDXA 3BDDA 4E7ZA 3H3UA 3GVAA 3KZYA 1H8AC 1U8RA 1MGTA 5J8CA 2OZUA 3HOUJ 5CJ9A 3KP2A 2IA0A 4PFOA 2JJ7A 2K9NA 1D0XA 3CUQC 1Z9CA 3OL3A 4XLCA 5LHHA 2D1HA 2Q1ZB 1B6AA 3ZMUA 4MNUA 4Q47A 3H9GA 3BWGA 1Y6IA 2GQQA 2ZFUA 2LF7A 3CC4I 3HOZJ 1MBKA 3FF5A 1RESA 1XCVA 2KJBA 2FUG2 2Z5UA 3L7WA 1LE8B 2PMHA 1I5ZA 2QYOA 2DTRA 1JTXA 2FOWA 2JUCA 1ETYA 2KIQA 1SC7A 3VYRB 1KQ0A 1R1TA 3VEPA 1XGSA 1BIAA 3PNVA 3U1KA 2E1NA 2KIUA 1EH6A 2V7FA 4HNUA 1GHCA 3O8HA 1ETOA 1FBSA 1WFXA 3RQ4A 4BHBA 1UHWA 2DK8A 2P6TA 2WAFA 2E2JJ 1U78A 1JXSA 3LSJA 3ZMTA 4F93B 4BQAA 2PMZA 2PLYA 2HQRA 3PO3J 1JGSA 3OIPA 3K7AJ 4M9XA 4OINF 3G1LA 2HU9A 2AQEA 3V8LA 4CCNA 4BBSJ 1VQ8I 2LF8A 3HPGA 3HHGA 3FXKA 1N78A 1QPIA 5FLVA 1W7PD 4EMSA 5J40A 1Q1VA 4MEXF 4UV8A 3I4MJ 4LLNA 4RB3C 5GP9A 2PJPA 3IC7A 5C44J 2E34A 2XV4S 3N05A 1LJ9A 1ZRDA 2COMA 3JAMK 1LUJB 2DOAA 1POGA 2MH2A 5F6FA 3ZCOA 1FT9A 4AVPA 4BAYA 3OYJA 1TWFJ 3U1DA 4LLGF 3DV8A 5FRMA 2Q2EB 4L5JA 1X19A 3OYLA 1T38A 2V6EA 1X1BA 3TO9A 4K2EA 5E18F 4II2A 2R5ZB 2P7CB 1MMGA 3H0DA 2G7HA 3MKLA 2V1NA 4BQNA 4C9YA 2KFDA 3GMEA 1FTTA 1RKTA 2LDUA 5F0HA 4NHJA 5IY5H 3FKJA 2EA4A 4FISA 3TW7A 1LEBA 1IN4A 1SMTA 5FKLA 2QF7A 1HXDA 1S8NA 2W00A 1H9TA 3CCUI 4UNOA 2Q0OA 4DJAA 3K4KA 5DDGA 2EIJH 3TEDA 1I3QJ 3VOEA 2LY1A 3CCMI 3HGYA 3P7NA 3WGIA 4KIFA 5B1AH 3OYKA 4A3IJ 4I6ZA 3WTTC 3FXOA 2CQQA 2AO9A 4KMFA 3V4GA 1USTA 1KU9A 4BQQA 1BA5A 2CJJA 1U2WA 3V8KA 5JI6A 1SANA 4WXCA 2DMNA 1YIOA 4F3QA 3Q3SA 2KJCA 2LNBA 2WC2A 3QPTA 1PUEE 2FEZA 1J2XA 3OSFA 2DMTA 2HQNA 3OYGA 5TJJA 2RAEA 3ZQGA 2M9HA 5KNLA 1WPKA 1VQPI 1R7JA 3UKGA 5D5UB 2AXLA 4JQFA 2PQ8A 1G6NA 4M6VA 3E5XA 3SDGA 2R7WA 3F8FA 1VQ5I 2E2IJ 1TQPA 2CV1A 1IUFA 3DU6A 2GAUA 5F64A 5LLQA 5IYCJ 2R93J 3K4CA 4BEHA 3GO5A 3K70C 4HRIA 2A07F 2NS0A 2NVUB 4EGYA 3Q0UA 4A3DJ 2BBYA 4BHPA 4CDGA 3EPZA 1YW7A 1S9HA 3I54A 3W2VA 3FX3A 1IN6A 2DA4A 3D5RC 3WU0A 4PZJA 1IW7F 1SVLA 2CUEA 3FXRA 3GFMA 3WTXC 2PEXA 1F4KA 2MG4A 4BE0A 4E7SA 1FP2A 2HDDA 5KCMA 1ZYRF 1FOYA 1W1WE 1SAXA 3I4NJ 1MMDA 3IAS2 3MMYB 5LD2C 5HLTA 3L2CA 3ISPA 5GADJ 4EVIA 2LOOA 4LG0A 3U21A 3HKZA 4B1RA 2Z33A 3E97A 3IAM2 3M3YJ 3QOEA 2LFBA 1UFMA 5JHFA 3ULQB 4YIIA 2B0LA 4LK1F 4R1HA 3L2VA 3KYLA 2DJIA 3RPUA 4E7JA 2E2HJ 1IAWA 2ETHA 3GFLA 2V4JC 4JOMA 4TV7A 5J6XA 1ZRCA 3GF2A 1WJAA 5HLGA 5LEKA 3ZQIA 1V4RA 1X1CA 4WCGA 1S5LC 2XRNA 1NHAA 4YFKF 1TL8A 3HUGA 4ZDOA 3HC7A 4ON0A 3HPHA 1IXSB 2O03A 5ILVA 3JCUC 1WH7A 2OCCH 2R7OA 2XAUA 3DTKA 2O8XA 2V1XA 2LMDA 3OS2A 1N25A 1XMAA 3I64A 2M4GA 1S7OA 4C2MJ 1J75A 1K78A 2RQQA 3A2KA 3VB2A 2ZXJA 1J7KA 2DMQA 1DUXC 4YELA 1OYYA 3WHCA 1T98A 2AHQA 3OMYA 2X6XA 1T6SA 2FJ1A 1HF0A 2CFXA 2OZ6A 5JVGF 3FIWA 4OMZA 2ZJQF 3RKYA 3SQNA 3UNGC 4B09A 3L2RA 2A6HF 3EYIA 4A93J 3OSGA 5M5XJ 1FYLA 4LIVA 2VXDA 1WWXA 1Z7UA 2ACJA 4ASNA 4LD5A 1BI0A 1FBUA 4HV6A 3W6JB 2JA8J 4UV9A 2DN0A 2RQPA 2M45A 4XONA 1WJFA 4KN7X 4EJVA 2CYYA 1IN7A 2IW5A 1X58A 1VF9A 2PMUA 1BJAA 3EUHC 2HVRA 4FX0A 4M3FA 3QPLA 2H1LA 3FWEA 1B72A 4PFPA 2A5YB 4OAYA 4P55A 4HZFA 4IRHA 3C2BA 5M3FJ 5HODA 2Y0SA 4ENJA 2VKHA 4XN0A 2QQBA 2M8EA 3E7LA 4OOIA 2KIFA 4ZZDA 4IHSA 2LP0A 4E7HA 3GZ6A 4YG2F 1J9IA 2EQRA 3G1OA 3HOTA 4FETA 3FMRA 3W6KB 1B59A 4MEYF 2YPRA 1TQIA 1YE9A 4LFUA 4CO8A 3O2PE 1FOXA 4O6JA 1GV5A 3BPXA 2CH0A 1LVAA 1T33A 4UVCA 4ESJA 3RI4A 4CYCB 1G3SA 4KJZA 2I8DA 2JRTA 3D1NI 2LKSA 2LC2A 2XKOA 3CUQA 1ZLJA 2IVMA 2MD5A 2XIGA 2DBBA 5J47A 4PDKA 5E17F 3G1MA 2OD5A 3QP5A 1LDDA 1HLVA 2GBYA 4G8XA 4YEJA 3BCBA 3Q5FA 2VIXA 2OPTA 2O0YA 1YFHA 1FWZA 3M07A 2JWTA 3HEFA 4PJJA 4XKVA 5FKMA 3MWMA 2MW8A 3WTWC 3HRTA 1ZGJA 1LVKA 1JKQC 3TMOA 3HTUA 3RYPA 4BJTA 1YTYA 3ZQFA 1MBJA 3F23A 1W7PA 2W82A 4BJ6C 5AIQA 5F04A
chains in the Genus database with same CATH topology
2JUGA 3DKXA 1WJDA 2A5WA 3BG6A 4II3A 2F4IA 2VJ4A 2KPMA 1ZELA 3DTIA 5CQGA 3SYTA 2WB1A 2F5VA 1WJ5A 1QHGA 3PSFA 2LBFB 1V5FA 1W36C 2X1DA 3MD2A 2KL4A 4P5OA 4DOZA 3K4LA 4J01A 2DXIA 3H9QA 1UELB 3OYMA 2X85A 3HL2A 3OYBA 1NG7A 1AA7A 4RM2A 4ZDPA 3A1YA 4ZYAA 4ANJA 2VLAA 1SAUA 4ZJZA 3QODA 2AQFA 3E0JB 3KX2A 1WJBA 3PFYA 1W36D 4XOPA 4Y4RA 4XMYA 4B43A 3VSKA 1JI8A 1X4PA 2MFZA 3OYEA 4BS9A 4DGWB 2GOXB 3TL4X 2VQGA 4HPQA 4CSWA 3DEEA 3OYDA 2XF7A 4CCOA 1OLTA 4BACA 1Z3YA 1IRXA 2LY2A 4X0GA 2ZSHB 4XL9A 4ITVA 1MMNA 3TBIA 1N77A 1PYVA 2CS3A 2KRHA 4XR6A 4F55A 2VJIA 3DPTA 4CZCA 3QYBA 2W7NA 4XM3A 2XDVA 2IS6A 1MW7A 4C30A 1D0YA 4CCJA 3DPUA 4F52A 3LSKA 1ERDA 3OY9A 4XKWA 2MYSA 1V5GA 3M8JA 2ZXIA 3ZR8X 3S3MA 2WAEA 5CPRB 3H5NA 1BOBA 2V9KA 4XLFA 2X1CA 2CW7A 2LREA 3GBGA 4IQJA 2KMUA 3H9JA 3IUOA 4HEA2 2MD0A 4CUGA 3SZGA 3ONQA 3PNYA 2R7SA 3RCOA 2XF5A 4NQWB 3S93A 3FBNB 2RNGA 4B3XA 4XLHA 2IGKA 4H4KC 2GOMA 3S32A 3PNTA 1MNEA 2K9LA 3FDYA 3D5LA 3OIQA 4CCMA 1BR4A 5CKTA 4CCLA 3L2QA 4AVZA 4EATA 3CZ6A 2Z2SB 2O5RA 2VQHA 5HNFA 4D9JA 4XQFA 1G59A 4E7ZA 4XN3A 1PJRA 4B47A 4ZTFA 2IS4A 1D0ZA 2VASA 4PFOA 2K9MA 4U87A 3VYUB 2BOLA 3W2WA 2M4KA 3NWSA 4OWRB 4DIQA 1D0XA 3VWBA 4CA0A 3OL3A 4XLCA 2KRCA 2Q1ZB 3DTEA 3I9V2 2QKLB 2CMPA 1MNDA 4DBRA 4MLOA 4NC7A 3H9GA 4HSRA 1Y6IA 1X1AA 2ZFUA 2K3PA 4QPQA 2CUJA 2QKMB 2P0WA 3PUBA 2FUG2 3H5RA 2E5NA 2LBFA 2DT6A 1J09A 4LITA 4DBQA 3K70D 3D5SC 3VYRB 3W3CA 1U0JA 5FRNA 3PNVA 2KZVA 2WY8Q 3VDXA 1Z21A 2V7FA 4HNUA 2XC7A 1LFPA 1WFXA 3RQ4A 3DU5A 4E6KG 2WAFA 3AL0C 3F9KA 3A4CA 2JSPA 4F93B 2PMZA 3BCAA 3IP4B 3K4NA 2VXZA 3OIPA 2HU9A 2AQEA 4CCNA 3KEYA 2XF6A 3HPGA 1N78A 3K10A 4PSWA 5FROA 3MKYB 1TZLA 3H5AA 3VSLA 2WY7Q 1DGWY 3RPUD 1EA3A 4XORA 3J7AY 3H35A 4HSTA 2NOJB 4LG3A 3N05A 3LSMA 4XLAA 1G8XA 3AFHA 4AU7A 2VJJA 4RLFA 2DOAA 4C2TA 3AL0B 3ZCOA 2CW8A 2HVSA 3OYJA 2IGMA 2L5QA 2R7TA 5FRMA 2X6YA 2E5ZA 2Q2EB 4J00A 1X19A 3OYLA 3OR1C 2V6EA 1X1BA 4LIUA 3OYNA 4II2A 4BUPA 1MMGA 3H0DA 1WJCA 3FBIB 3HUGB 1LKXA 3K4MA 2V1NA 2HNHA 2V26A 4BQNA 4KT6A 2DT7B 4C9YA 2CV2A 3DWLE 3OS1A 2VQLA 4NC8A 2KHMA 3CJRB 4BQOA 2M0MA 3FKJA 4RMNA 1FMWA 3QYFA 2W00A 1GLNA 3OOUA 4N4OB 3K4KA 2RREA 4PUSA 2UUZA 4DJAA 3AKZA 2WBMA 2LY1A 1QU3A 2HPIA 4IQ4A 3S3OA 3OYKA 1T0FC 2VB6A 2R7UA 3V42A 4XNFA 3QYEA 1LDKB 1YX5A 3E1SA 4BQQA 2UWMA 5HNHA 4XKBA 5LFAA 2IS2A 3RTRA 3K4BA 4PK4A 1VZ0A 2HQAA 4F3QA 1DP3A 5TGTA 3CP2A 3OYGA 1BR1A 1OR7C 1YX3A 4BXFA 5KNLA 2JA2A 4XLEA 4YRVA 4C2UA 1SFKA 2M3AA 4JQFA 2VPLA 4IZZA 2KQRA 2R7WA 2CV1A 3DU6A 2Z16A 4D1QA 3K4CA 4BEHA 2ZSIB 3K70C 4HRIA 2E60A 5HOOA 4F91B 4Y33A 4RLQA 3EPZA 1FMVA 1S9HA 3W2VA 2IS1A 3D5RC 1DQUA 3LSIA 4BEHB 4BE0A 4E7SA 2R7RA 3S8PA 5KCMA 4ZC3A 3L2WA 4PJLA 3OYFA 1UAAA 4PSXA 1WJEA 2BVLA 3HXLA 4F92B 3VYSB 1QHHD 3HG9A 3BLYA 4NNJA 3NWTA 4FASD 3CJQB 1MMDA 2PJRB 3IAS2 2K5CA 2HPMA 1HA8A 1X1DA 3MMYB 5LD2C 3C2GA 3CP8A 5HLTA 4CH7A 2LOOA 3U21A 3HKZA 3FHNA 3PJRA 4OAZA 4ZDLA 3IAM2 3CMMA 3QOEA 3ZRGA 2X51A 5JHFA 4P1WA 2CV0A 1D1CA 4NUBA 4ZTJA 3L2VA 2XSJC 3KYLA 2DJIA 4E7JA 3K4JA 2V4JC 4JOMA 2IGNA 3LFUA 1WJAA 2R7XA 1X1CA 1BR2A 1MMAA 2W1OA 4ZDOA 3HC7A 3ZXSA 3HPHA 2BW3A 3L2UA 3PSIA 2R7OA 2VL8A 2XAUA 4HNTA 3DTKA 3OS2A 3M1CA 2M4GA 3CESA 3HOSA 4BE1A 2RQQA 2KP6A 3A2KA 3OYAA 2MC4A 2HDWA 4BDZA 2BW3B 4YELA 2E1MC 3UR3C 4GRIA 2VQCA 1E0EA 2ZXHA 3OS0A 3OMYA 2WAQA 3ZQQA 2OV7A 2OC6A 2HZDA 2X6XA 1UG0A 2LYCA 4E7LA 4XKCA 3SEQA 5KHDA 3UNGC 1DGRM 3OL4A 3L2RA 3ZGKA 2MABA 2X1EA 3OYIA 3BG7A 3DQVC 4LIVA 2VXDA 2JVHA 1Z7LA 2LG4A 3OYHA 2A6TA 2W4SA 2E1MB 2VKDA 4U7BA 4XONA 3LSHA 1WJFA 3OYCA 4BU2A 5CQEA 2IXSA 2R7VA 3EUHC 1Z3XA 2HVRA 4R79A 2HVQA 2LRDA 4CCKA 5HVQC 4E7KA 4PFPA 4OAYA 1N75A 2VJ5A 2R7QA 2X6WA 2Y0SA 1NG6A 2VKHA 4XN0A 4B44A 3G2BA 2M7AA 4BE2A 1KONA 2L2OA 3EUAA 1K6YA 2F6CA 4QPOA 4XOTA 3VYTB 2OUMA 3DPLC 4E7HA 1R6RA 4IX7A 2UV1A 3HOTA 4FETA 2WADA 4PJNA 4IKFA 3MKWB 3LSGA 1YE9A 3CF2A 2ELJA 3RSNA 1P9QC 2L7KA 2CH0A 2M7BA 4BGDA 4N4NB 1TT0A 3C2HA 3DLAA 4KISA 2L9SA 4KITB 1X4OA 4BJ5C 4KJZA 3I3LA 1Y56A 4AYBA 3EUKL 2KDOA 2I8DA 3MKZA 1D1AA 4PJMA 2LC2A 3LL7A 4BDYA 2PJRA 2WA0A 4E4HA 2Z1DA 2CUZA 2DCEA 2R4GA 2JVGA 2CFOA 4YEJA 3BCBA 1V5EA 2VIXA 4B48A 3S3NA 3W2AA 3OWTA 3DKYA 4G6TB 4PJJA 4XKVA 1D1BA 3OR2C 3BC8A 4E7IA 4RM3A 3K6GA 1T95A 3PL8A 3SDBA 1LVKA 3SEZA 2KLOA 3TMOA 4BJTA 4BL0B 2BVMA 2W82A 4Y3OA 4BJ6C 2L9NA 2LH9A 2IGOA 3LMMA 4HG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRH A;  2L2O A; 
#chains in the Genus database with same CATH topology
 1O3Q A;  2HOT A;  2ZO4 A;  5GAH J;  2FBH A;  3BG6 A;  3P9I A;  1PP8 F;  5E1X A;  4II3 A;  1A6Q A;  1OCZ H;  3REO A;  2KPM A;  3KP7 A;  3E5U A;  4S04 A;  3BR5 A;  3MN2 A;  1RR7 A;  2F5V A;  1WGX A;  3PSF A;  4JX5 A;  4EJT A;  1F36 A;  3FHZ A;  3KLN A;  2HYG D;  3GCM A;  4MFD A;  2DA1 A;  3SFI A;  3K1N A;  4FHT A;  2X85 A;  3HL2 A;  1LB2 A;  1DPR A;  3T8T A;  1AA7 A;  1FIA A;  4RM2 A;  5DUI A;  3QRF F;  1G3Y A;  3NEU A;  3A1Y A;  3DBH B;  3AG2 H;  2VLA A;  2X4H A;  4YFN F;  1U5T A;  1RKW A;  5K5Q A;  3H1C A;  4NC6 A;  1KZH A;  4XLP F;  3PFY A;  3F21 A;  3BRO A;  2QZ8 A;  3LAJ A;  3WTV C;  1XSX A;  4G7O F;  5FGM A;  1MKM A;  2VOD A;  2ECC A;  1EH8 A;  5FFX A;  4QSH A;  1SVM A;  3F6V A;  1JJ8 C;  3DEE A;  1VQL I;  4IJA A;  3F8N A;  3AG4 H;  4X0G A;  3RDI A;  3BR0 A;  2E7X A;  4ITV A;  1MMN A;  2IRF G;  3GTG J;  3L09 A;  1PYV A;  4MO7 A;  4FE7 A;  3I53 A;  4XR6 A;  2BXZ A;  5L3F A;  3R0J A;  2KDZ A;  2ECB A;  1Y1W J;  3DPT A;  4CZC A;  2FML A;  5A2Q K;  4MFE A;  1OMI A;  1KQ9 A;  2BHY A;  1MW7 A;  5J8F A;  5D8L B;  3RZD J;  3A01 A;  4CCJ A;  3BR1 A;  2EIN H;  3HJE A;  3DPU A;  5D5V B;  2GA1 A;  1E3P A;  3LSK A;  1SEU A;  1MMS A;  2P7V B;  3OY9 A;  4I09 A;  1I27 A;  4KFC A;  2R0Q C;  1EH7 A;  5IOY A;  4BHC A;  3JRA A;  3S3M A;  2WAE A;  1BOA A;  3LNQ A;  1MNM C;  4BH9 A;  1BOB A;  4XLF A;  2VBZ A;  4IHV A;  2CO5 A;  1X2M A;  1HW2 A;  4N9H A;  1SD4 A;  1R4N B;  3GBG A;  2DLL A;  2FF4 A;  5IYB J;  2MD0 A;  1JT0 A;  3RIR A;  3FBN B;  4B3X A;  4EJO A;  4H4K C;  3KP4 A;  3FXL A;  1O3S A;  1TBX A;  2GOM A;  1FEX A;  2K9L A;  3FDY A;  4JX4 A;  3B73 A;  3WGH A;  4UY8 I;  2FBK A;  3EDP A;  4CCM A;  2V9P A;  1YJ9 I;  2K27 A;  1MBF A;  4MQV A;  4XLN F;  3CZ6 A;  5DV5 A;  2FXA A;  3K2Z A;  4D9J A;  3K2A A;  2RKH A;  4XN3 A;  4ZTF A;  4B47 A;  5HLH A;  1RIO H;  2DJN A;  3GTO J;  1JJ6 C;  2GIZ A;  1XDS A;  3HM5 A;  1LEA A;  1R23 A;  1P7I A;  2K9M A;  4U87 A;  2QM3 A;  2BOL A;  1G4D A;  2LKP A;  3MZH A;  4BXX J;  3NWS A;  1TNS A;  2ZKZ A;  4OWR B;  3RYR A;  2OA4 A;  4DIQ A;  1YJN I;  3FZV A;  4CA0 A;  3VWB A;  3I9V 2;  2QKL B;  1WZ2 A;  4H0E A;  2BGC A;  2CMP A;  2L7M P;  3GTL J;  1MH4 A;  3LSR A;  3KLO A;  4NC7 A;  3NAU A;  1X1A A;  4AIH A;  1XDU A;  2K3P A;  1VQ9 I;  2M87 A;  2QEN A;  1CGP A;  4FX4 A;  3E6C C;  3BTL A;  3G73 A;  3H5R A;  1IXC A;  2E5N A;  4L9V A;  1YW8 A;  2DT6 A;  1Y39 A;  1ZGW A;  4LIT A;  5D5W B;  2K4J A;  3W3C A;  5L3D A;  1UHM A;  2KZV A;  3OV8 A;  2WY8 Q;  1S72 I;  1IRG A;  4I2O A;  2DA7 A;  5ERI A;  2XC7 A;  1LFP A;  1KU7 A;  1ZH5 A;  2XUB A;  3DU5 A;  4E6K G;  1X3Z B;  3WTY C;  3BCA A;  5IT3 A;  4AWX B;  3HSF A;  3R4K A;  3JRG A;  1GVD A;  4DYC A;  1Y8Q B;  2Z3Y A;  3KEQ A;  5TRD A;  1I1G A;  2DA2 A;  3DEW A;  2YUS A;  2HEO A;  1ORK A;  2K40 A;  2MA3 A;  3MKY B;  3KCC A;  4LG0 B;  2PG4 A;  5GAG J;  4ETS A;  3VOD A;  3RPU D;  1EA3 A;  1D5Y A;  1H9G A;  5BPD A;  4HST A;  3P9K A;  2MGQ A;  2VJJ A;  4C2T A;  2Y2Z A;  1E3H A;  2CW8 A;  1JHH A;  2IGM A;  2L5Q A;  5DCF A;  3CUO A;  2EFQ A;  4HF0 A;  2IA1 A;  4J00 A;  2IP2 A;  5H20 A;  3FBI B;  2ELK A;  3HUG B;  4A3L J;  3K4M A;  2HNH A;  2V26 A;  2PMZ N;  3G3Z A;  1KU2 A;  2HXO A;  2DT7 B;  3DWL E;  3MEX A;  1HOM A;  2KHM A;  1W5C C;  2WTE A;  4MHG A;  3CJR B;  3RJP A;  5J1Y A;  2DI3 A;  4WX9 A;  4JBA A;  4M3B A;  4HNV A;  4YIR X;  1K78 B;  3WE2 A;  4RMN A;  1IO2 A;  1ZAR A;  5EDN A;  1FMW A;  3LQR A;  3F8C A;  5D6F A;  2GIV A;  2K7L A;  1I1S A;  1FY7 A;  1QVU A;  2QBY A;  4N4O B;  1ZTR A;  4PUS A;  3DP7 A;  4L9T A;  5JHU A;  3RZO J;  3GW2 A;  4LB5 A;  2HPI A;  1VQ7 I;  1LQ1 A;  4FE4 A;  2FNP A;  5K1Y A;  4IEJ A;  3O3K A;  1B9M A;  2R7D A;  3EET A;  2R7U A;  3V42 A;  5BPI A;  1R36 A;  5B1B H;  1OCO H;  1JUM A;  1LDK B;  1MH3 A;  2UWM A;  1XPX A;  1FTZ A;  2XAQ A;  2KT0 A;  3K4B A;  4PK4 A;  2VT2 A;  2EV5 A;  1C0W A;  5L3G A;  4HLY A;  2V9V A;  1STZ A;  5E3M A;  3J81 Z;  1TQM A;  3G71 I;  5E3O A;  1U6G A;  1BR1 A;  4RAZ A;  4RGS A;  2X0L A;  1YX3 A;  4HDU A;  3BZC A;  5BOX A;  1OPC A;  3ZQC A;  1B8I A;  4UVB A;  1B72 B;  3ABM H;  1SFE A;  3AG1 H;  4M73 A;  2LK2 A;  5B66 C;  4D1Q A;  3I5U A;  2VBW A;  3EQL F;  3RPQ A;  2DOF A;  2FQ3 A;  2X48 A;  4OIP F;  1KQ8 A;  4F91 B;  4UUV A;  3HGG A;  4RLQ A;  1FMV A;  4EJW A;  3ELK A;  5CVR A;  2VT3 A;  1SFU A;  1MJB A;  1VQM I;  1R5H A;  1XGO A;  3ML6 A;  3LSI A;  3DFG A;  5DUK A;  3VPR A;  3MQ0 A;  1F1Z A;  5EYR A;  2E1C A;  9ANT A;  2KZG A;  1HDD C;  3CCV I;  3N97 A;  2TRT A;  1UAA A;  1NTC A;  4PSX A;  1DP7 P;  2BVL A;  2RC4 A;  3HXL A;  3SFZ A;  5K5R A;  1HW1 A;  3BLY A;  3FK6 A;  4NNJ A;  3CUQ B;  5IT9 K;  2DFF A;  4IO9 F;  4QLC U;  2VPR A;  4AC0 A;  1SD6 A;  3LA3 A;  3FHN A;  1Y0U A;  4OAZ A;  2XGC A;  1HST A;  1OQY A;  2UXN A;  3FXM A;  1ZN2 A;  1B4A A;  2X51 A;  3LA7 A;  3ZRG A;  3CC2 I;  4NBQ A;  4ZTJ A;  2XGD A;  2I5U A;  2EB7 A;  2HTJ A;  2ZNZ A;  3K9T A;  1R5I D;  4BXU A;  3LFU A;  1ZQ3 P;  3BTJ A;  2DPU A;  4IVN A;  3LWF A;  2IT0 A;  1BR2 A;  1W7P B;  3ROU A;  3EYY A;  1H0M A;  6PAX A;  2NNN A;  4HQM A;  3CCJ I;  2W1O A;  3BZ6 A;  2L02 A;  1IRZ A;  3M8F A;  4U7D A;  4HX4 A;  3MZ8 A;  1USS A;  1IGN A;  3PSI A;  1U5T C;  2HZT A;  1VQK I;  3BTI A;  2ID6 A;  3WOD F;  1VQ6 I;  3QPS A;  3M1C A;  3F8M A;  4BY1 J;  3CES A;  4RS8 A;  2BE5 F;  3IWZ A;  2QLZ A;  4A5N A;  3LFK A;  2CU7 A;  3T1B A;  3BQZ A;  3F3X A;  4S0H B;  3CF5 F;  2ELH A;  3HKZ N;  4HBL A;  4I0A A;  4O5V A;  4BDZ A;  1HKS A;  2BW3 B;  2YR2 A;  3HBL A;  1TWG J;  4OIR F;  2E1M C;  3UR3 C;  4XRS A;  2ZXH A;  4LGW A;  3OS0 A;  2Y30 A;  2JZY A;  2WAQ A;  3ZMV A;  2MH9 A;  2OC6 A;  2HZD A;  5LRR A;  3MZY A;  3J80 K;  3AAF A;  4HF2 A;  4E7L A;  5DTD A;  1TWC J;  1U5T B;  2NS8 A;  1DGR M;  4UHT A;  1AOY A;  2FSW A;  3LSP A;  3CCY A;  3OOP A;  3ZGK A;  2HFH A;  2DQR A;  2MAB A;  4M72 A;  1CF7 A;  1JUS A;  4O3M A;  1QQI A;  5BS6 A;  3OYI A;  1P4A A;  3GUD A;  1ON1 A;  2P5V A;  2HR3 A;  4HW0 A;  2EIM H;  1W5S A;  4A0Z A;  2K9Q A;  4ENK A;  4U7B A;  2E1M B;  2VKD A;  1TTY A;  1FZP B;  4A3C J;  3A02 A;  4M6Y A;  2A68 F;  3H3Z A;  2L54 A;  3JW4 A;  1S7A A;  1ZRE A;  4LJZ F;  2G0E A;  1GT0 C;  2VON A;  1Z3X A;  1QNT A;  2LRD A;  4CCK A;  3DBL B;  1K7A A;  4EM2 A;  4U0Y A;  1I6H J;  2X6W A;  2K02 A;  3A01 B;  2OTL I;  4N9I A;  2JA6 J;  4G12 A;  3C1D A;  3H36 A;  3FMQ A;  3AG3 H;  3QU3 A;  4B44 A;  1MJ9 A;  4ESB A;  5FLX Z;  3G2B A;  1O7F A;  4BE2 A;  3T8R A;  1K6Y A;  2F4M B;  1JT6 A;  1RI7 A;  5FKK A;  4C3I J;  1TWH J;  1X3W B;  4QPO A;  4XOT A;  1K6O A;  2LTP A;  3GTQ J;  1MJA A;  4C3H J;  4PJN A;  3TO6 A;  1BM9 A;  4AUX A;  3CF2 A;  2L7K A;  4OIQ F;  2M7B A;  4XID A;  5FD6 A;  4N4N B;  3C2H A;  2DOE A;  3FKI J;  4KIB A;  4BJ5 C;  5M5Y J;  3IH3 A;  3EUK L;  3GWZ A;  3BP8 A;  4PJM A;  3KP3 A;  5J4V A;  3JSO A;  3P9C A;  2F5E A;  4BDY A;  2WA0 A;  5HDG A;  2EFP A;  5EZH A;  2W85 A;  1APL C;  2Z1D A;  5D4S A;  3QOP A;  5DM6 F;  1OJL A;  2JMW A;  2YU9 J;  2DCE A;  4ENM A;  3QPH A;  5CVU A;  2Y0S N;  1FSH A;  3CCQ I;  1IG7 A;  2EIK H;  2GXA A;  2QEX I;  4B48 A;  3S3N A;  3WTZ A;  5LGT A;  3S17 J;  4WK8 F;  3DKY A;  3ZPL A;  1F9N A;  2RVC A;  1ON2 A;  3OR2 C;  4RM3 A;  2PBI A;  3PL8 A;  3SDB A;  4CXF A;  3D0S A;  2LKX A;  2KLO A;  2FQ4 A;  4BL0 B;  2K9S A;  1E2X A;  2CQX A;  2LH9 A;  3GXO A;  3LMM A;  4LLL A;  1P6R A;  2P8T A;  2P81 A;  2H27 A;  4V19 K;  3JR9 A;  5HDK A;  4V2G A;  1DDN A;  4ESF A;  5CQG A;  1H88 C;  1D8J A;  4GCV A;  3CCL I;  1WJ5 A;  1IN8 A;  2K86 A;  4A0X A;  2CG4 A;  2HOS A;  2ZB9 A;  2E7W A;  2W25 A;  2X1D A;  5F27 A;  4HDV A;  2TCT A;  4P5O A;  2DXI A;  1UEL B;  1IDZ A;  1MBH A;  4MTD A;  3KP6 A;  4JYK A;  2MSY A;  4ZDP A;  5IPA A;  2V79 A;  4EGZ A;  1V55 H;  4U88 A;  3S1N J;  3ZQH A;  2NAZ A;  1LPQ A;  3TOA A;  3P5J A;  4ZJZ A;  4L0Y B;  3B6A A;  1KYZ A;  4GYI A;  2DTZ A;  2PFB A;  3V7C A;  3MFK A;  1EKE A;  3M8E A;  3HOV J;  4P9U A;  2G9W A;  3OYE A;  2IA2 A;  4DGW B;  4XBF A;  2GOX B;  3TL4 X;  2ZNY A;  1O4X A;  5E8G A;  1GVJ A;  4CSW A;  2G7U A;  2XF7 A;  4BAC A;  1OLT A;  4ABZ A;  2LY2 A;  4FTH A;  4XL9 A;  1UB9 A;  2A05 A;  1N77 A;  1OCC H;  4RB0 A;  2WV1 A;  3HSR A;  2KRH A;  2HQ5 A;  2OAZ A;  5DM7 F;  4HAM A;  4A69 C;  4EM1 A;  4AM3 A;  3R6S A;  2QWW A;  1X1P A;  4UB8 C;  5E1Z B;  2ID3 A;  2Y9Y A;  2ME6 A;  1Q1H A;  4F52 A;  5L3B A;  1ERD A;  1WH5 A;  3CDH A;  1IDY A;  4Y13 A;  4G6Q A;  2FRH A;  2ZXI A;  1JUP A;  1YS7 A;  3M8J A;  3ZR8 X;  1S3J A;  4I98 B;  2ICW G;  4HA8 A;  5J1R A;  2IJL A;  3GYH X;  2DMU A;  1TW3 A;  2IBD A;  3ABK H;  1ETV A;  3GLX A;  2CW7 A;  2GA2 A;  2LRE A;  5M5W J;  4IQJ A;  3S15 J;  1T08 B;  2KMU A;  1K79 A;  1IJW C;  4A3B J;  3RCO A;  2QBY B;  4M3G A;  1Y8R B;  2OQG A;  1HKQ A;  3TDZ C;  4XLH A;  1QPM A;  3G6E I;  3CDL A;  3PNT A;  1ETW A;  1F43 A;  4MQ9 F;  4D5F A;  4CCL A;  3L2Q A;  4AVZ A;  1MZB A;  3FMS A;  4Y15 A;  1XGM A;  3CTA A;  5HNF A;  1FBQ A;  1G59 A;  4UVA A;  1IC8 A;  1PJR A;  1MBG A;  3S16 J;  4OMY A;  4D7M A;  1QZZ A;  2VAS A;  1FIP A;  3I59 A;  1FSE A;  3CCE I;  5E3L A;  3GFI A;  3VYU B;  1JGG A;  1E17 A;  3W2W A;  2M4K A;  4C3J J;  1FYM A;  3S2W A;  2L3D A;  1FNN A;  3A03 A;  3DTE A;  5ED4 A;  1ZR4 A;  1TWA J;  1B8I B;  1WCM J;  5J1U A;  4DBR A;  1YJW I;  2A69 F;  4IHT A;  3C3W A;  4QPQ A;  4DZP A;  4Z6Y A;  4RGX A;  2R92 J;  3ZMS A;  3COA C;  2LBF A;  2BY1 A;  5DEQ A;  1J09 A;  1ENH A;  4EQQ A;  1U0J A;  4S05 A;  5FRN A;  2FU4 A;  3WE3 A;  4JP0 A;  1R58 A;  2W24 A;  5J3L A;  3CO6 C;  1YI2 I;  3VDX A;  1Z21 A;  4ZZL A;  1U3E M;  5EF6 A;  1OYW A;  1FYK A;  4RB2 C;  4CZZ A;  1ZLK A;  3GEZ A;  2CRG A;  4ZYD A;  5HS8 A;  1R22 A;  1UMQ A;  2HYF A;  1QVT A;  2XAS A;  3IP4 B;  3K4N A;  1WQ2 A;  2VXZ A;  4XSZ F;  2V1U A;  4UUS A;  3KEY A;  4G94 A;  1QO0 D;  3CLQ A;  2GM4 A;  2XF6 A;  3JRD A;  3U9G A;  5ICC A;  4EEF G;  3K10 A;  5FRO A;  1HW5 A;  3FXJ A;  1TZL A;  3H5A A;  4ZH4 F;  1AWC A;  3VSL A;  2Z99 A;  2WY7 Q;  4R8H A;  1U9O A;  5FO5 A;  4XOR A;  3H35 A;  2B9S A;  3KZI C;  2NOJ B;  3O6B B;  1VND A;  4LG3 A;  1ULY A;  4XLA A;  3LSM A;  5D8K B;  4DYQ A;  3NAR A;  3AFH A;  5KAI C;  3QP6 A;  4OU0 A;  2E36 A;  4RLF A;  2YSR A;  1PUF A;  1Z05 A;  1KGS A;  1BN5 A;  2KIS A;  1W0T A;  2OCE A;  4IOC F;  2E5Z A;  3I0T A;  4QWQ A;  4LIU A;  2H6B A;  5GPA A;  3OYN A;  4BUP A;  1WJC A;  2D2W A;  4UXN A;  1MBE A;  4KT6 A;  4KUM A;  2EV0 A;  4QTR A;  2Y0M A;  2CV2 A;  2L9R A;  4Q5S F;  3OS1 A;  5EZG A;  4NC8 A;  2EWN A;  2QVO A;  4LOC A;  4BQO A;  4JX6 A;  4WWC A;  2M0M A;  3IH2 A;  1OCP A;  5HS9 A;  4RBO A;  3A0H C;  1EV7 A;  3R61 A;  3ZP5 A;  2HGC A;  3IKV A;  3AKZ A;  2WBM A;  2P4W A;  2AXT C;  4D5C A;  1RUO A;  1Z6R A;  1BI2 A;  2JT1 A;  1MDM A;  4L5I A;  2X9D A;  2IAI A;  5DD8 A;  1Z1D A;  4XNF A;  3KFW X;  3E1S A;  1OCT C;  1PVE A;  1R5G A;  4XKB A;  5GTI C;  5M3M J;  2IS2 A;  2EJR A;  2LLK A;  2FOK A;  1T2K A;  1L0O C;  4AIJ A;  2EPF A;  3ECO A;  2DMP A;  2FX0 A;  3ABL H;  3HIF A;  1OR7 C;  2XPW A;  2UXX A;  3ZMD A;  2JA2 A;  4XLE A;  2JN6 A;  4YRV A;  1SFK A;  2M3A A;  2FNA A;  2VOO A;  3ZMZ A;  4IZZ A;  2M8G X;  2J5P A;  1LNW A;  1P2F A;  1GDT A;  2L4A A;  5LGU A;  2Z16 A;  3IKT A;  1LFB A;  2XGE A;  3WG7 H;  3BR6 A;  1BC7 C;  2NVX J;  2VI6 A;  4IF4 A;  2RN7 A;  3Q0V A;  2JPC A;  4HX8 A;  3NRV A;  4Y33 A;  4YFX F;  2IS1 A;  2DDA A;  4HLX A;  4A5M A;  5BQT A;  2BEO A;  1DQU A;  1I50 J;  1TP4 A;  2ZME A;  4BEH B;  1EF4 A;  2EZK A;  3R60 A;  2GWR A;  4ZC3 A;  3L2W A;  4PJL A;  4A3M J;  3OYF A;  3JRE A;  2CSO A;  1UG2 A;  2JA5 J;  4F92 B;  3VYS B;  2A61 A;  1QHH D;  3HG9 A;  3IV5 A;  2DYR H;  4FAS D;  1LDJ A;  3CJQ B;  2ZJP F;  2K5C A;  4FQG A;  1BI3 A;  5H2F C;  2HPM A;  2XRO A;  5IOZ A;  1HA8 A;  2BY3 A;  2VC1 A;  4N0B A;  4CH7 A;  4G6D A;  2GXG A;  4X1E A;  4KA4 A;  2F5D A;  4ZDL A;  4HF1 A;  2CV0 A;  1I6X A;  3KYD B;  1FJL A;  2H8W A;  3F8B A;  3DLL F;  3Q9S A;  2RNJ A;  2EZH A;  1HDP A;  3KPH A;  1KA8 A;  1BBY A;  3M7G A;  3H3V K;  3PQK A;  1IXR C;  1DPU A;  3RQI A;  4DQ2 A;  5JR3 A;  1MMA A;  5KAF C;  3B6C A;  3M4O J;  1Z0X A;  3C7J A;  3ZXS A;  1CQT A;  2OQR A;  2PN6 A;  4XSX F;  3JRF A;  2I10 A;  3FXU A;  1KYW A;  2DO7 A;  2B7E A;  3DF8 A;  3JRH A;  5E3N A;  3GFJ A;  3HOS A;  2H94 A;  2KP6 A;  3OYA A;  2MC4 A;  4CHU A;  4U0V A;  3HOW J;  5EEG A;  5ILS A;  2V1D A;  4WF2 A;  1E0E A;  4BNC A;  4RGU A;  3ZQQ A;  4D0P A;  2H8R A;  1UG0 A;  2LYC A;  2H6C A;  1D3Y A;  1QZE A;  4XKC A;  3JSP A;  2R5Y A;  3SEQ A;  2RV8 A;  4D7N A;  3JRC A;  2LVS A;  4HQE A;  3OL4 A;  4M3E A;  2D5V A;  3GLL A;  3WHB A;  1V3F A;  1Z6T A;  3ERE D;  5CYV A;  2ESH A;  3BR3 A;  3BG7 A;  1XD7 A;  2JVH A;  2L01 A;  2WWY A;  1HKT A;  3BQY A;  1ZG5 A;  3OYH A;  2W4S A;  3LST A;  3CMA I;  4M3D A;  1QZY A;  2M34 A;  1XMK A;  3S14 J;  4CYD A;  1T0F A;  3GTJ J;  3J81 K;  1HQC A;  3TQN A;  5HVQ C;  2HVQ A;  3PM1 A;  2BXY A;  3HYI A;  1N75 A;  3RKX A;  2WAQ N;  4GGG A;  2XSD C;  1NK2 P;  1RZ4 A;  1TT5 B;  5H6Q A;  1SMY F;  3QU6 A;  1KON A;  3EUA A;  4Y17 A;  2F6C A;  4KYW A;  3VYT B;  2NYX A;  5BNG A;  1R6R A;  4IX7 A;  2UV1 A;  3Q9V A;  5JLW A;  2WAD A;  1ETQ A;  2V6C A;  2DOD A;  1S6L A;  2ELJ A;  5F1J A;  3SZT A;  2VKV A;  4G7H F;  4NDL A;  2HDC A;  1IV8 A;  2B63 J;  4KDP A;  1SVO A;  4BGD A;  2YS9 A;  1ZHF A;  3CMY A;  1TT0 A;  1Y1V J;  3BJO A;  3DLA A;  2D1V A;  2E19 A;  1K4S A;  2L7Z A;  3S1R J;  3ZN1 A;  2DPD A;  4GDF A;  1JKP C;  3I3L A;  3TO7 A;  4AYB A;  1TW2 A;  5IYD J;  3CC7 I;  4AID A;  3MKZ A;  1XGN A;  2H09 A;  5EEA A;  2K4B A;  4RAY A;  3LL7 A;  1G3W A;  3HRS A;  4RA2 A;  1JHF A;  5GPC A;  3E5Q A;  2PJR A;  5EGO A;  2HYJ A;  1GXP A;  3TOB A;  4E4H A;  2EV6 A;  3N4M A;  2R4G A;  2EZL A;  2JVG A;  2CFO A;  1VQ4 I;  1REP C;  2M5W A;  1UHS A;  3W2A A;  4M9S A;  3OWT A;  3ZQL A;  4EM0 B;  3JRB A;  3DBR B;  2CW0 F;  4G6T B;  4W97 A;  2NNY A;  1D1B A;  3I59 B;  3IWF A;  4NB5 A;  1T95 A;  3HHH A;  1YRN A;  3CJN A;  5LRS A;  3L00 A;  2GXB A;  2C6Y A;  2IGO A;  2IEK A;  5L3C A;  3DKX A;  2E71 A;  1WJD A;  3M9A A;  5EJC A;  2XPV A;  2Z9O A;  1W0U A;  3FM3 A;  1AKH A;  4IPA A;  4PJ0 C;  1ZEL A;  2Y9Z A;  1K61 A;  3DTI A;  1GUU A;  3SYT A;  2WB1 A;  4XRM A;  4YIF A;  3ESW B;  2AS5 F;  1WSU A;  5IT9 Z;  2LBF B;  2L4M A;  4M74 A;  1FOW A;  1RUN A;  1V5F A;  3MD2 A;  3LAP A;  2KL4 A;  2XKP A;  2BZT A;  3K4L A;  4J01 A;  1J0R A;  3H9Q A;  3GX4 X;  4W1U A;  4I76 A;  4IOA F;  3OYB A;  3MCZ A;  1BC8 C;  1J59 A;  2KRF A;  2M1B A;  5TIS C;  3QQA A;  2P5K A;  1SAU A;  1ZR2 A;  3HOY J;  2AQF A;  1QRY A;  2STT A;  4UUS B;  2DA3 A;  1BL0 A;  5D5X B;  5E1W A;  4Y4R A;  2ESN A;  5CLS A;  4XMY A;  2O6G E;  2DU9 A;  1JI8 A;  1X4P A;  3JRI A;  4Y52 J;  3PFI A;  4BS9 A;  4RDU A;  1MSF C;  4XK4 A;  3JAM Z;  3WG9 A;  1DU6 A;  4Z2Y A;  5EG0 A;  3TP3 A;  2ME0 A;  2BV6 A;  1Z77 A;  3HDD A;  1BI1 A;  1GV2 A;  5ICF A;  2J5O A;  2A3S A;  1K4T A;  2ZSH B;  3BG3 A;  1SFX A;  2XAG A;  2OTJ I;  2CS3 A;  1TNT A;  3BPV A;  5L3E A;  3F22 A;  2HXI A;  4A2U A;  3JTH A;  1PUF B;  2GLO A;  1BW6 A;  1UJ8 A;  4F7Z A;  3ZN0 A;  2XDV A;  2IS6 A;  4BY7 J;  4C30 A;  3PUF A;  1XN7 A;  1D0Y A;  1R00 A;  1XC5 A;  3BY6 A;  2ZCW A;  2HS5 A;  2ZJR F;  5FLM J;  3J80 Z;  2VC0 A;  3MAJ A;  1XB4 A;  4XKW A;  2QQ9 A;  1P4X A;  4B4C A;  3ZQ7 A;  3SXY A;  3QAH A;  4GYG A;  3T5X A;  1FC3 A;  3H5N A;  2V9K A;  3CO7 C;  3BG5 A;  5FLX K;  3ASN H;  3I58 A;  2DK5 A;  3HB9 A;  4E70 A;  4UB6 C;  4HEA 2;  5ILU A;  3SZG A;  2R7S A;  1B1B A;  1OR7 A;  2XF5 A;  3CQZ J;  4M9Z A;  2RNG A;  2VBY A;  3PIO F;  3DKW A;  2HTS A;  1E3O C;  1VQO I;  1MD0 A;  1MDM B;  3GZ5 A;  1MNE A;  2YX7 A;  1YOV B;  3V7R A;  4L9J A;  1IZ1 A;  5E79 C;  4EAT A;  3V8J A;  5HDN A;  1VFC A;  2Z2S B;  4EV0 A;  2O5R A;  5H6R A;  2VQH A;  2ZC2 A;  5DYM A;  2RDP A;  2E35 A;  3E6B A;  2IS4 A;  1D0Z A;  4ZYE A;  2W57 A;  5LGN A;  1ODD A;  4WXH A;  2LR8 A;  3ZOB A;  1FPQ A;  1S7E A;  2MLK A;  3CME I;  4A3E J;  2HWV A;  5FKO A;  4KIG A;  1O3T A;  4MIM A;  2CQ7 A;  4ZYG A;  1YO5 C;  2KRC A;  4KN4 X;  5JLX A;  3GTM J;  2PI0 A;  4Q4Z F;  5DD4 A;  2JRM A;  3PO2 J;  2ZME C;  2EK5 A;  1YHQ I;  2DFH A;  1ZAO A;  3Q0W A;  1MND A;  4MLO A;  5ICE A;  3HSE A;  4HSR A;  4GO1 A;  4HV5 A;  1WVR A;  1RNL A;  2CUJ A;  2QKM B;  2P0W A;  3PUB A;  1R49 A;  3BJ6 A;  2P6S A;  1S29 A;  1UZC A;  3K1M A;  5K5O A;  3TW6 A;  2M0C A;  3ECH A;  1ZG1 A;  4DBQ A;  3K70 D;  3D5S C;  2WV0 A;  2EIL H;  2FA5 A;  1FOK A;  2FBI A;  2CGP A;  2VUM J;  2MC3 A;  2RGV A;  2VOP A;  2N8G A;  2ZME B;  4I7H A;  1YLF A;  3MVP A;  3AL0 C;  3F9K A;  3A4C A;  1U9N A;  2JSP A;  3I71 A;  5JFR A;  5IP9 J;  4A3F J;  1R71 A;  5F0F A;  3J7Y J;  4OIO F;  1P92 A;  1ZGA A;  4RAG A;  1LFU P;  5AON A;  5K7F A;  5IP7 J;  3TP0 A;  3SJM A;  1PDN C;  4PSW A;  4IHW A;  5B5E C;  2O8K A;  5LHI A;  2EBI A;  1WKM A;  2O61 A;  1DU0 A;  2L9V A;  2QA4 I;  1DGW Y;  4B8X A;  1UCR A;  3J7A Y;  1T56 A;  1YW9 A;  1AU7 A;  5E8I A;  3LQQ A;  1G8X A;  4AU7 A;  4L5E A;  3CLO A;  3AL0 B;  3RKQ A;  2DFE A;  2HVS A;  1G3T A;  4LMY A;  2R7T A;  5FFZ A;  2X6Y A;  5GTH C;  1OCR H;  2BY0 A;  5LHG A;  3OR1 C;  2PX9 A;  1O7L A;  3FK7 A;  4FCY A;  1LKX A;  2BYV E;  4U0W A;  1F5T A;  1BJZ A;  2XGX A;  3K1P A;  5DS9 A;  1ITY A;  5GAE J;  3WU1 B;  3L9F A;  1Z91 A;  2VQL A;  1MSE C;  4GXO A;  4XRS G;  2NVQ J;  3KEO A;  3LA2 A;  4A6D A;  4IXA A;  3QYF A;  5DCM A;  2FE3 A;  3S2H J;  1GLN A;  1XX5 A;  4NQW A;  2M30 A;  3F72 A;  3OOU A;  2RRE A;  2UUZ A;  5CVV A;  1RET A;  4JK1 X;  1QU3 A;  2QUF A;  4IQ4 A;  1YIJ I;  2NS7 A;  3S3O A;  2NOG A;  3ERM A;  2R5Y B;  2IPQ X;  4KMU X;  1T0F C;  2VB6 A;  1WI9 A;  1YIT I;  4WXD A;  3C18 A;  3QYE A;  4QIW N;  1YX5 A;  4G9Y A;  5HNH A;  5LFA A;  3RTR A;  1IF1 A;  1VZ0 A;  3CCS I;  2HQA A;  3BZK A;  1DP3 A;  2ZJ2 A;  5TGT A;  1IN5 A;  3CP2 A;  3CCR I;  5E20 A;  3I55 I;  2JTV A;  5C4X J;  4MTE A;  2VE9 A;  4AIK A;  4BXF A;  2ZFW A;  2ISY A;  4C2U A;  1QBJ A;  2HOA A;  1XS9 A;  1JE8 A;  3HZJ A;  5CVI A;  2VPL A;  5EEH A;  4PGH A;  2KQR A;  2STW A;  5F0C A;  3GTP J;  2UZK A;  2O3F A;  4HYE A;  3DXJ F;  5KVR A;  5AIP A;  2NVY J;  1LE8 A;  3F0C A;  3U2R A;  2ZSI B;  2XAH A;  2MLG A;  3S1Q J;  2HKO A;  2E60 A;  2OJE D;  4LB6 B;  2HKX A;  3ASO H;  5HOO A;  2DA5 A;  3HRU A;  2LD5 A;  1A6I A;  1OFC X;  4I01 A;  1IUY A;  3BG9 A;  2QGU A;  1XG1 A;  1V54 H;  4KT5 C;  2ZXW H;  1D5V A;  2R7R A;  2LY9 A;  5HS7 A;  1JKO C;  3S8P A;  3GZN B;  2EFN A;  2FMY A;  1JTY A;  1WJE A;  3H0G J;  4M6X A;  5LEJ A;  5ICG A;  1TC3 C;  4I99 C;  3NWT A;  2PJR B;  1Y0N A;  4X6A J;  2DT5 A;  2Y75 A;  5EGO B;  1X1D A;  2L0K A;  3C2G A;  3CP8 A;  5D4R A;  1HCR A;  3PJR A;  3SZP A;  3S2D J;  3CMM A;  3IH4 A;  2F2E A;  1RR8 C;  1ONV A;  2ZBK A;  4P1W A;  3KET A;  1D1C A;  1TLH B;  4NUB A;  2CWE A;  2XSJ C;  3K4J A;  2NRA C;  3K0L A;  4RB1 A;  2IGN A;  3O8G A;  1YRN B;  1SD7 A;  2K3F A;  2Q2E A;  3K69 A;  2CUF A;  2Q8K A;  2R7X A;  1W4M A;  4CGZ A;  1BW5 A;  2R5Z A;  2JQ7 A;  1GXQ A;  2HI3 A;  4DZJ A;  3HOX J;  5F08 A;  2L7F P;  1FLI A;  2BW3 A;  3OIO A;  3L2U A;  1L3L A;  2EZI A;  4HNT A;  2VL8 A;  1AKH B;  2W48 A;  4EJU A;  1ETX A;  4BE1 A;  1YQA A;  2DFI A;  4ENN A;  4P96 A;  2HDW A;  2QQA A;  1T39 A;  1O3R A;  1QA6 A;  4GRI A;  2VQC A;  1MIJ A;  1M1E B;  1H89 C;  2OV7 A;  1X2N A;  5HLI A;  5JVT A;  1XCB A;  1WI3 A;  1YS6 A;  4A3J J;  1IV6 A;  3A0B C;  5KHD A;  4ZYH A;  1EJ9 A;  5FD5 A;  4PGG A;  5FJ8 J;  3TDU C;  1R1V A;  3VFZ A;  3BOQ A;  2X1E A;  3DQV C;  3KYC B;  4BYY A;  1P7J A;  1SFO J;  4A3K J;  1W5T A;  4PCQ A;  5EG0 B;  1Z7L A;  3TKY A;  2QSF X;  2BY2 A;  1A04 A;  2JK3 A;  2LG4 A;  2A6T A;  5A2Q Z;  3PQJ A;  2LSO A;  2ADU A;  2Y69 H;  4HOB A;  3LSH A;  2DDB A;  3OYC A;  1CF7 B;  5K7H A;  4RAF A;  4BU2 A;  3J7Z I;  5CQE A;  1PP7 U;  2IXS A;  2R7V A;  2MBF A;  2QQ8 A;  4IRI A;  2XAJ A;  1QGP A;  4R79 A;  2P5L C;  4E7K A;  4XRF A;  3I56 I;  2VJ5 A;  2R7Q A;  2O7O A;  3SHF A;  3ABU A;  1A31 A;  1NG6 A;  1HSJ A;  2M7A A;  2DA6 A;  3RKW A;  1U8B A;  2L2O A;  4DYR A;  2OUM A;  3DPL C;  3G4S I;  1KU3 A;  2JSC A;  3FIS A;  4IKF A;  2XB5 A;  5C3E J;  3MKW B;  3LSG A;  2KIM A;  2F5C A;  3RSN A;  1P9Q C;  2EFW A;  4M71 A;  2M2E A;  1O57 A;  2KKO A;  4AD9 A;  4KIS A;  2L9S A;  4IHX A;  1R9T J;  1D8K A;  2XHK A;  3F6O A;  4KIT B;  1ACI A;  1X4O A;  2NXN B;  4G7Z F;  1Y56 A;  2FD5 A;  2KDO A;  3KE2 A;  1D1A A;  1ZKG A;  3B02 A;  1FP1 D;  4UUT A;  3TGN A;  4A6E A;  3PIP F;  3E6M A;  5J4Y A;  4Q48 A;  1Z67 A;  3IHU A;  1VQN I;  4A0Y A;  4XIC A;  2CUZ A;  1FX7 A;  1V5E A;  1A36 A;  2X6O A;  2E1O A;  2DQL A;  2EH3 A;  3BC8 A;  4LK0 F;  4E7I A;  3K6G A;  3SEZ A;  2EFO A;  1ZK8 A;  2BVM A;  2XPU A;  5C4J J;  4Y3O A;  4IHY A;  2L9N A;  3NQO A;  3ONQ A;  1AHD P;  4HG2 A;  2JUG A;  4MGR A;  2A5W A;  4AYB N;  1RRJ A;  2F4I A;  4CIC A;  1RC9 A;  3WU2 C;  2VJ4 A;  1NK3 P;  1BIB A;  4B3A A;  3KIO A;  1T8I A;  3X2Q H;  2DYS H;  4A3G J;  4FT8 A;  1NH3 A;  3FM5 A;  1QHG A;  1RPW A;  1I3A A;  3IRQ A;  2QCO A;  2YU3 A;  4A12 A;  2QSH X;  3HTS B;  1YYV A;  1W36 C;  4KIC A;  1OKR A;  2Y48 A;  2XVC A;  1ZRF A;  2VKE A;  4DOZ A;  2R7Z J;  3OYM A;  2XB0 X;  3LOC A;  3S1M J;  1NG7 A;  3GTK J;  1IRF A;  4I0B A;  3WTU C;  2OF7 A;  4L0Z B;  1YG2 A;  4ZYA A;  4ANJ A;  1VTN C;  3E3V A;  1G2H A;  3QOD A;  2BHZ A;  3E0J B;  1HC8 A;  2CQK A;  3HRM A;  3KX2 A;  1WJB A;  1ETK A;  1XSD A;  2VE8 A;  1W36 D;  1SD5 A;  4XOP A;  2K85 A;  4B43 A;  4Y7N J;  3VSK A;  4BBR J;  2MFZ A;  3BR2 A;  1XMX A;  2CQN A;  2VQG A;  4HPQ A;  2D45 A;  3OYD A;  2O9L A;  1OYI A;  4CCO A;  1OIS A;  1Z3Y A;  1IRX A;  1A35 A;  1J5Y A;  2GZW A;  2WB1 N;  3DEU A;  3TBI A;  1I39 A;  2F48 A;  1ZG3 A;  5F1R A;  3WGG A;  4F55 A;  4L9N A;  5FKN A;  2VJI A;  4DNC A;  1VI0 A;  1XSV A;  3IL2 A;  3E6D A;  3W6V A;  2OBP A;  1R4M B;  5K7Z A;  4L18 B;  3BT9 A;  1P4W A;  3QYB A;  4HX7 A;  2W7N A;  4XM3 A;  3H92 A;  1K83 J;  2EA2 A;  3R0A A;  2HOE A;  4KNY A;  5KK1 A;  3KZZ A;  5IP6 A;  1WHU A;  2JPB A;  2MYS A;  3IRR A;  5B3S H;  3CD6 I;  5CVJ A;  5D6E A;  2Y31 A;  4RGR A;  1V5G A;  1XTA A;  4IRG A;  2F5F A;  2DAO A;  5CPR B;  3ABT A;  4I02 A;  3BTC A;  2F4O B;  2X1C A;  4J19 A;  3EUH A;  3L1P A;  1B9N A;  2COB A;  2VBX A;  2W84 A;  3J7A O;  3FXQ A;  4BKX A;  1A5J A;  4CYC A;  3DCF A;  3H9J A;  2H1K A;  3IUO A;  2A6E F;  4CUG A;  5DCM B;  2ISZ A;  3PNY A;  2VN2 A;  3BJA A;  4NQW B;  3I4P A;  5FB2 A;  2JA7 J;  3S93 A;  1X3U A;  5LBQ A;  2IGK A;  1HBX G;  4GFB A;  1R1U A;  3T0Y A;  3V7S A;  4DW6 A;  3CDI A;  3S32 A;  5BMZ A;  2YX4 A;  2XRL A;  4V2F A;  3D5L A;  2OU2 A;  3WTS C;  3OIQ A;  1WRJ A;  3JTG A;  2XAF A;  1JKR C;  1BR4 A;  5CKT A;  2QSG X;  4IL6 C;  2DW4 A;  4P9F A;  2R7F A;  2R3S A;  3KP5 A;  3M1E A;  3QWL A;  4XQF A;  2NVT J;  3CJT B;  2TDX A;  3BDD A;  4E7Z A;  3H3U A;  3GVA A;  3KZY A;  1H8A C;  1U8R A;  1MGT A;  5J8C A;  2OZU A;  3HOU J;  5CJ9 A;  3KP2 A;  2IA0 A;  4PFO A;  2JJ7 A;  2K9N A;  1D0X A;  3CUQ C;  1Z9C A;  3OL3 A;  4XLC A;  5LHH A;  2D1H A;  2Q1Z B;  1B6A A;  3ZMU A;  4MNU A;  4Q47 A;  3H9G A;  3BWG A;  1Y6I A;  2GQQ A;  2ZFU A;  2LF7 A;  3CC4 I;  3HOZ J;  1MBK A;  3FF5 A;  1RES A;  1XCV A;  2KJB A;  2FUG 2;  2Z5U A;  3L7W A;  1LE8 B;  2PMH A;  1I5Z A;  2QYO A;  2DTR A;  1JTX A;  2FOW A;  2JUC A;  1ETY A;  2KIQ A;  1SC7 A;  3VYR B;  1KQ0 A;  1R1T A;  3VEP A;  1XGS A;  1BIA A;  3PNV A;  3U1K A;  2E1N A;  2KIU A;  1EH6 A;  2V7F A;  4HNU A;  1GHC A;  3O8H A;  1ETO A;  1FBS A;  1WFX A;  3RQ4 A;  4BHB A;  1UHW A;  2DK8 A;  2P6T A;  2WAF A;  2E2J J;  1U78 A;  1JXS A;  3LSJ A;  3ZMT A;  4F93 B;  4BQA A;  2PMZ A;  2PLY A;  2HQR A;  3PO3 J;  1JGS A;  3OIP A;  3K7A J;  4M9X A;  4OIN F;  3G1L A;  2HU9 A;  2AQE A;  3V8L A;  4CCN A;  4BBS J;  1VQ8 I;  2LF8 A;  3HPG A;  3HHG A;  3FXK A;  1N78 A;  1QPI A;  5FLV A;  1W7P D;  4EMS A;  5J40 A;  1Q1V A;  4MEX F;  4UV8 A;  3I4M J;  4LLN A;  4RB3 C;  5GP9 A;  2PJP A;  3IC7 A;  5C44 J;  2E34 A;  2XV4 S;  3N05 A;  1LJ9 A;  1ZRD A;  2COM A;  3JAM K;  1LUJ B;  2DOA A;  1POG A;  2MH2 A;  5F6F A;  3ZCO A;  1FT9 A;  4AVP A;  4BAY A;  3OYJ A;  1TWF J;  3U1D A;  4LLG F;  3DV8 A;  5FRM A;  2Q2E B;  4L5J A;  1X19 A;  3OYL A;  1T38 A;  2V6E A;  1X1B A;  3TO9 A;  4K2E A;  5E18 F;  4II2 A;  2R5Z B;  2P7C B;  1MMG A;  3H0D A;  2G7H A;  3MKL A;  2V1N A;  4BQN A;  4C9Y A;  2KFD A;  3GME A;  1FTT A;  1RKT A;  2LDU A;  5F0H A;  4NHJ A;  5IY5 H;  3FKJ A;  2EA4 A;  4FIS A;  3TW7 A;  1LEB A;  1IN4 A;  1SMT A;  5FKL A;  2QF7 A;  1HXD A;  1S8N A;  2W00 A;  1H9T A;  3CCU I;  4UNO A;  2Q0O A;  4DJA A;  3K4K A;  5DDG A;  2EIJ H;  3TED A;  1I3Q J;  3VOE A;  2LY1 A;  3CCM I;  3HGY A;  3P7N A;  3WGI A;  4KIF A;  5B1A H;  3OYK A;  4A3I J;  4I6Z A;  3WTT C;  3FXO A;  2CQQ A;  2AO9 A;  4KMF A;  3V4G A;  1UST A;  1KU9 A;  4BQQ A;  1BA5 A;  2CJJ A;  1U2W A;  3V8K A;  5JI6 A;  1SAN A;  4WXC A;  2DMN A;  1YIO A;  4F3Q A;  3Q3S A;  2KJC A;  2LNB A;  2WC2 A;  3QPT A;  1PUE E;  2FEZ A;  1J2X A;  3OSF A;  2DMT A;  2HQN A;  3OYG A;  5TJJ A;  2RAE A;  3ZQG A;  2M9H A;  5KNL A;  1WPK A;  1VQP I;  1R7J A;  3UKG A;  5D5U B;  2AXL A;  4JQF A;  2PQ8 A;  1G6N A;  4M6V A;  3E5X A;  3SDG A;  2R7W A;  3F8F A;  1VQ5 I;  2E2I J;  1TQP A;  2CV1 A;  1IUF A;  3DU6 A;  2GAU A;  5F64 A;  5LLQ A;  5IYC J;  2R93 J;  3K4C A;  4BEH A;  3GO5 A;  3K70 C;  4HRI A;  2A07 F;  2NS0 A;  2NVU B;  4EGY A;  3Q0U A;  4A3D J;  2BBY A;  4BHP A;  4CDG A;  3EPZ A;  1YW7 A;  1S9H A;  3I54 A;  3W2V A;  3FX3 A;  1IN6 A;  2DA4 A;  3D5R C;  3WU0 A;  4PZJ A;  1IW7 F;  1SVL A;  2CUE A;  3FXR A;  3GFM A;  3WTX C;  2PEX A;  1F4K A;  2MG4 A;  4BE0 A;  4E7S A;  1FP2 A;  2HDD A;  5KCM A;  1ZYR F;  1FOY A;  1W1W E;  1SAX A;  3I4N J;  1MMD A;  3IAS 2;  3MMY B;  5LD2 C;  5HLT A;  3L2C A;  3ISP A;  5GAD J;  4EVI A;  2LOO A;  4LG0 A;  3U21 A;  3HKZ A;  4B1R A;  2Z33 A;  3E97 A;  3IAM 2;  3M3Y J;  3QOE A;  2LFB A;  1UFM A;  5JHF A;  3ULQ B;  4YII A;  2B0L A;  4LK1 F;  4R1H A;  3L2V A;  3KYL A;  2DJI A;  3RPU A;  4E7J A;  2E2H J;  1IAW A;  2ETH A;  3GFL A;  2V4J C;  4JOM A;  4TV7 A;  5J6X A;  1ZRC A;  3GF2 A;  1WJA A;  5HLG A;  5LEK A;  3ZQI A;  1V4R A;  1X1C A;  4WCG A;  1S5L C;  2XRN A;  1NHA A;  4YFK F;  1TL8 A;  3HUG A;  4ZDO A;  3HC7 A;  4ON0 A;  3HPH A;  1IXS B;  2O03 A;  5ILV A;  3JCU C;  1WH7 A;  2OCC H;  2R7O A;  2XAU A;  3DTK A;  2O8X A;  2V1X A;  2LMD A;  3OS2 A;  1N25 A;  1XMA A;  3I64 A;  2M4G A;  1S7O A;  4C2M J;  1J75 A;  1K78 A;  2RQQ A;  3A2K A;  3VB2 A;  2ZXJ A;  1J7K A;  2DMQ A;  1DUX C;  4YEL A;  1OYY A;  3WHC A;  1T98 A;  2AHQ A;  3OMY A;  2X6X A;  1T6S A;  2FJ1 A;  1HF0 A;  2CFX A;  2OZ6 A;  5JVG F;  3FIW A;  4OMZ A;  2ZJQ F;  3RKY A;  3SQN A;  3UNG C;  4B09 A;  3L2R A;  2A6H F;  3EYI A;  4A93 J;  3OSG A;  5M5X J;  1FYL A;  4LIV A;  2VXD A;  1WWX A;  1Z7U A;  2ACJ A;  4ASN A;  4LD5 A;  1BI0 A;  1FBU A;  4HV6 A;  3W6J B;  2JA8 J;  4UV9 A;  2DN0 A;  2RQP A;  2M45 A;  4XON A;  1WJF A;  4KN7 X;  4EJV A;  2CYY A;  1IN7 A;  2IW5 A;  1X58 A;  1VF9 A;  2PMU A;  1BJA A;  3EUH C;  2HVR A;  4FX0 A;  4M3F A;  3QPL A;  2H1L A;  3FWE A;  1B72 A;  4PFP A;  2A5Y B;  4OAY A;  4P55 A;  4HZF A;  4IRH A;  3C2B A;  5M3F J;  5HOD A;  2Y0S A;  4ENJ A;  2VKH A;  4XN0 A;  2QQB A;  2M8E A;  3E7L A;  4OOI A;  2KIF A;  4ZZD A;  4IHS A;  2LP0 A;  4E7H A;  3GZ6 A;  4YG2 F;  1J9I A;  2EQR A;  3G1O A;  3HOT A;  4FET A;  3FMR A;  3W6K B;  1B59 A;  4MEY F;  2YPR A;  1TQI A;  1YE9 A;  4LFU A;  4CO8 A;  3O2P E;  1FOX A;  4O6J A;  1GV5 A;  3BPX A;  2CH0 A;  1LVA A;  1T33 A;  4UVC A;  4ESJ A;  3RI4 A;  4CYC B;  1G3S A;  4KJZ A;  2I8D A;  2JRT A;  3D1N I;  2LKS A;  2LC2 A;  2XKO A;  3CUQ A;  1ZLJ A;  2IVM A;  2MD5 A;  2XIG A;  2DBB A;  5J47 A;  4PDK A;  5E17 F;  3G1M A;  2OD5 A;  3QP5 A;  1LDD A;  1HLV A;  2GBY A;  4G8X A;  4YEJ A;  3BCB A;  3Q5F A;  2VIX A;  2OPT A;  2O0Y A;  1YFH A;  1FWZ A;  3M07 A;  2JWT A;  3HEF A;  4PJJ A;  4XKV A;  5FKM A;  3MWM A;  2MW8 A;  3WTW C;  3HRT A;  1ZGJ A;  1LVK A;  1JKQ C;  3TMO A;  3HTU A;  3RYP A;  4BJT A;  1YTY A;  3ZQF A;  1MBJ A;  3F23 A;  1W7P A;  2W82 A;  4BJ6 C;  5AIQ A;  5F04 A; 
#chains in the Genus database with same CATH homology
 2JUG A;  3DKX A;  1WJD A;  2A5W A;  3BG6 A;  4II3 A;  2F4I A;  2VJ4 A;  2KPM A;  1ZEL A;  3DTI A;  5CQG A;  3SYT A;  2WB1 A;  2F5V A;  1WJ5 A;  1QHG A;  3PSF A;  2LBF B;  1V5F A;  1W36 C;  2X1D A;  3MD2 A;  2KL4 A;  4P5O A;  4DOZ A;  3K4L A;  4J01 A;  2DXI A;  3H9Q A;  1UEL B;  3OYM A;  2X85 A;  3HL2 A;  3OYB A;  1NG7 A;  1AA7 A;  4RM2 A;  4ZDP A;  3A1Y A;  4ZYA A;  4ANJ A;  2VLA A;  1SAU A;  4ZJZ A;  3QOD A;  2AQF A;  3E0J B;  3KX2 A;  1WJB A;  3PFY A;  1W36 D;  4XOP A;  4Y4R A;  4XMY A;  4B43 A;  3VSK A;  1JI8 A;  1X4P A;  2MFZ A;  3OYE A;  4BS9 A;  4DGW B;  2GOX B;  3TL4 X;  2VQG A;  4HPQ A;  4CSW A;  3DEE A;  3OYD A;  2XF7 A;  4CCO A;  1OLT A;  4BAC A;  1Z3Y A;  1IRX A;  2LY2 A;  4X0G A;  2ZSH B;  4XL9 A;  4ITV A;  1MMN A;  3TBI A;  1N77 A;  1PYV A;  2CS3 A;  2KRH A;  4XR6 A;  4F55 A;  2VJI A;  3DPT A;  4CZC A;  3QYB A;  2W7N A;  4XM3 A;  2XDV A;  2IS6 A;  1MW7 A;  4C30 A;  1D0Y A;  4CCJ A;  3DPU A;  4F52 A;  3LSK A;  1ERD A;  3OY9 A;  4XKW A;  2MYS A;  1V5G A;  3M8J A;  2ZXI A;  3ZR8 X;  3S3M A;  2WAE A;  5CPR B;  3H5N A;  1BOB A;  2V9K A;  4XLF A;  2X1C A;  2CW7 A;  2LRE A;  3GBG A;  4IQJ A;  2KMU A;  3H9J A;  3IUO A;  4HEA 2;  2MD0 A;  4CUG A;  3SZG A;  3ONQ A;  3PNY A;  2R7S A;  3RCO A;  2XF5 A;  4NQW B;  3S93 A;  3FBN B;  2RNG A;  4B3X A;  4XLH A;  2IGK A;  4H4K C;  2GOM A;  3S32 A;  3PNT A;  1MNE A;  2K9L A;  3FDY A;  3D5L A;  3OIQ A;  4CCM A;  1BR4 A;  5CKT A;  4CCL A;  3L2Q A;  4AVZ A;  4EAT A;  3CZ6 A;  2Z2S B;  2O5R A;  2VQH A;  5HNF A;  4D9J A;  4XQF A;  1G59 A;  4E7Z A;  4XN3 A;  1PJR A;  4B47 A;  4ZTF A;  2IS4 A;  1D0Z A;  2VAS A;  4PFO A;  2K9M A;  4U87 A;  3VYU B;  2BOL A;  3W2W A;  2M4K A;  3NWS A;  4OWR B;  4DIQ A;  1D0X A;  3VWB A;  4CA0 A;  3OL3 A;  4XLC A;  2KRC A;  2Q1Z B;  3DTE A;  3I9V 2;  2QKL B;  2CMP A;  1MND A;  4DBR A;  4MLO A;  4NC7 A;  3H9G A;  4HSR A;  1Y6I A;  1X1A A;  2ZFU A;  2K3P A;  4QPQ A;  2CUJ A;  2QKM B;  2P0W A;  3PUB A;  2FUG 2;  3H5R A;  2E5N A;  2LBF A;  2DT6 A;  1J09 A;  4LIT A;  4DBQ A;  3K70 D;  3D5S C;  3VYR B;  3W3C A;  1U0J A;  5FRN A;  3PNV A;  2KZV A;  2WY8 Q;  3VDX A;  1Z21 A;  2V7F A;  4HNU A;  2XC7 A;  1LFP A;  1WFX A;  3RQ4 A;  3DU5 A;  4E6K G;  2WAF A;  3AL0 C;  3F9K A;  3A4C A;  2JSP A;  4F93 B;  2PMZ A;  3BCA A;  3IP4 B;  3K4N A;  2VXZ A;  3OIP A;  2HU9 A;  2AQE A;  4CCN A;  3KEY A;  2XF6 A;  3HPG A;  1N78 A;  3K10 A;  4PSW A;  5FRO A;  3MKY B;  1TZL A;  3H5A A;  3VSL A;  2WY7 Q;  1DGW Y;  3RPU D;  1EA3 A;  4XOR A;  3J7A Y;  3H35 A;  4HST A;  2NOJ B;  4LG3 A;  3N05 A;  3LSM A;  4XLA A;  1G8X A;  3AFH A;  4AU7 A;  2VJJ A;  4RLF A;  2DOA A;  4C2T A;  3AL0 B;  3ZCO A;  2CW8 A;  2HVS A;  3OYJ A;  2IGM A;  2L5Q A;  2R7T A;  5FRM A;  2X6Y A;  2E5Z A;  2Q2E B;  4J00 A;  1X19 A;  3OYL A;  3OR1 C;  2V6E A;  1X1B A;  4LIU A;  3OYN A;  4II2 A;  4BUP A;  1MMG A;  3H0D A;  1WJC A;  3FBI B;  3HUG B;  1LKX A;  3K4M A;  2V1N A;  2HNH A;  2V26 A;  4BQN A;  4KT6 A;  2DT7 B;  4C9Y A;  2CV2 A;  3DWL E;  3OS1 A;  2VQL A;  4NC8 A;  2KHM A;  3CJR B;  4BQO A;  2M0M A;  3FKJ A;  4RMN A;  1FMW A;  3QYF A;  2W00 A;  1GLN A;  3OOU A;  4N4O B;  3K4K A;  2RRE A;  4PUS A;  2UUZ A;  4DJA A;  3AKZ A;  2WBM A;  2LY1 A;  1QU3 A;  2HPI A;  4IQ4 A;  3S3O A;  3OYK A;  1T0F C;  2VB6 A;  2R7U A;  3V42 A;  4XNF A;  3QYE A;  1LDK B;  1YX5 A;  3E1S A;  4BQQ A;  2UWM A;  5HNH A;  4XKB A;  5LFA A;  2IS2 A;  3RTR A;  3K4B A;  4PK4 A;  1VZ0 A;  2HQA A;  4F3Q A;  1DP3 A;  5TGT A;  3CP2 A;  3OYG A;  1BR1 A;  1OR7 C;  1YX3 A;  4BXF A;  5KNL A;  2JA2 A;  4XLE A;  4YRV A;  4C2U A;  1SFK A;  2M3A A;  4JQF A;  2VPL A;  4IZZ A;  2KQR A;  2R7W A;  2CV1 A;  3DU6 A;  2Z16 A;  4D1Q A;  3K4C A;  4BEH A;  2ZSI B;  3K70 C;  4HRI A;  2E60 A;  5HOO A;  4F91 B;  4Y33 A;  4RLQ A;  3EPZ A;  1FMV A;  1S9H A;  3W2V A;  2IS1 A;  3D5R C;  1DQU A;  3LSI A;  4BEH B;  4BE0 A;  4E7S A;  2R7R A;  3S8P A;  5KCM A;  4ZC3 A;  3L2W A;  4PJL A;  3OYF A;  1UAA A;  4PSX A;  1WJE A;  2BVL A;  3HXL A;  4F92 B;  3VYS B;  1QHH D;  3HG9 A;  3BLY A;  4NNJ A;  3NWT A;  4FAS D;  3CJQ B;  1MMD A;  2PJR B;  3IAS 2;  2K5C A;  2HPM A;  1HA8 A;  1X1D A;  3MMY B;  5LD2 C;  3C2G A;  3CP8 A;  5HLT A;  4CH7 A;  2LOO A;  3U21 A;  3HKZ A;  3FHN A;  3PJR A;  4OAZ A;  4ZDL A;  3IAM 2;  3CMM A;  3QOE A;  3ZRG A;  2X51 A;  5JHF A;  4P1W A;  2CV0 A;  1D1C A;  4NUB A;  4ZTJ A;  3L2V A;  2XSJ C;  3KYL A;  2DJI A;  4E7J A;  3K4J A;  2V4J C;  4JOM A;  2IGN A;  3LFU A;  1WJA A;  2R7X A;  1X1C A;  1BR2 A;  1MMA A;  2W1O A;  4ZDO A;  3HC7 A;  3ZXS A;  3HPH A;  2BW3 A;  3L2U A;  3PSI A;  2R7O A;  2VL8 A;  2XAU A;  4HNT A;  3DTK A;  3OS2 A;  3M1C A;  2M4G A;  3CES A;  3HOS A;  4BE1 A;  2RQQ A;  2KP6 A;  3A2K A;  3OYA A;  2MC4 A;  2HDW A;  4BDZ A;  2BW3 B;  4YEL A;  2E1M C;  3UR3 C;  4GRI A;  2VQC A;  1E0E A;  2ZXH A;  3OS0 A;  3OMY A;  2WAQ A;  3ZQQ A;  2OV7 A;  2OC6 A;  2HZD A;  2X6X A;  1UG0 A;  2LYC A;  4E7L A;  4XKC A;  3SEQ A;  5KHD A;  3UNG C;  1DGR M;  3OL4 A;  3L2R A;  3ZGK A;  2MAB A;  2X1E A;  3OYI A;  3BG7 A;  3DQV C;  4LIV A;  2VXD A;  2JVH A;  1Z7L A;  2LG4 A;  3OYH A;  2A6T A;  2W4S A;  2E1M B;  2VKD A;  4U7B A;  4XON A;  3LSH A;  1WJF A;  3OYC A;  4BU2 A;  5CQE A;  2IXS A;  2R7V A;  3EUH C;  1Z3X A;  2HVR A;  4R79 A;  2HVQ A;  2LRD A;  4CCK A;  5HVQ C;  4E7K A;  4PFP A;  4OAY A;  1N75 A;  2VJ5 A;  2R7Q A;  2X6W A;  2Y0S A;  1NG6 A;  2VKH A;  4XN0 A;  4B44 A;  3G2B A;  2M7A A;  4BE2 A;  1KON A;  2L2O A;  3EUA A;  1K6Y A;  2F6C A;  4QPO A;  4XOT A;  3VYT B;  2OUM A;  3DPL C;  4E7H A;  1R6R A;  4IX7 A;  2UV1 A;  3HOT A;  4FET A;  2WAD A;  4PJN A;  4IKF A;  3MKW B;  3LSG A;  1YE9 A;  3CF2 A;  2ELJ A;  3RSN A;  1P9Q C;  2L7K A;  2CH0 A;  2M7B A;  4BGD A;  4N4N B;  1TT0 A;  3C2H A;  3DLA A;  4KIS A;  2L9S A;  4KIT B;  1X4O A;  4BJ5 C;  4KJZ A;  3I3L A;  1Y56 A;  4AYB A;  3EUK L;  2KDO A;  2I8D A;  3MKZ A;  1D1A A;  4PJM A;  2LC2 A;  3LL7 A;  4BDY A;  2PJR A;  2WA0 A;  4E4H A;  2Z1D A;  2CUZ A;  2DCE A;  2R4G A;  2JVG A;  2CFO A;  4YEJ A;  3BCB A;  1V5E A;  2VIX A;  4B48 A;  3S3N A;  3W2A A;  3OWT A;  3DKY A;  4G6T B;  4PJJ A;  4XKV A;  1D1B A;  3OR2 C;  3BC8 A;  4E7I A;  4RM3 A;  3K6G A;  1T95 A;  3PL8 A;  3SDB A;  1LVK A;  3SEZ A;  2KLO A;  3TMO A;  4BJT A;  4BL0 B;  2BVM A;  2W82 A;  4Y3O A;  4BJ6 C;  2L9N A;  2LH9 A;  2IGO A;  3LMM A;  4HG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...