1P4WA

Solution structure of the dna-binding domain of the erwinia amylovora rcsb protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
YTPESVAKLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNYLSSVSMTPVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords rcsB
publication title Structural analysis of the DNA-binding domain of the Erwinia amylovora RcsB protein and its interaction with the RcsAB box.
pubmed doi rcsb
source organism Erwinia amylovora
molecule tags Dna binding protein
total genus 22
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4wA00
3C7JA 1YFHA 3SHFA 1B9MA 4DNCA 3QP5A 1U6GA 1LEBA 5LLQA 1OYWA 3MZYA 5H20A 2DPDA 1G3WA 3REOA 1LDJA 3GFJA 1ZG3A 2VBZA 2GQQA 2DQRA 2P7CB 4U0WA 1BBYA 2YX7A 3F8FA 2NNNA 1OKRA 2FF4A 1HKQA 2EFOA 2OAZA 1J9IA 4PGGA 1XD7A 3KP5A 2QENA 1Z6TA 3FX3A 3NQOA 4WXHA 1S3JA 3TKYA 5HLHA 1ZRFA 2ZNYA 2RKHA 4G7ZF 5TRDA 3V8KA 4HAMA 4EJUA 1IN7A 4GO1A 3ML6A 3KLOA 3TGNA 1YYVA 4ZYDA 5DCMB 3G73A 4CGZA 2FSWA 3P9KA 4U0YA 2DQLA 4AVPA 1LQ1A 2A61A 4YIIA 3RKWA 1KU7A 3OOPA 2LF7A 1C0WA 2UXNA 2RN7A 2BE5F 2H6BA 2OZ6A 4QWQA 2J5OA 1RUNA 4M73A 1FNNA 5HS9A 2YPRA 3SFZA 4IHSA 3K2ZA 1ZH5A 2W57A 3LFKA 5J6XA 5LRSA 1PP8F 3IWZA 4AIJA 3EYIA 2B0LA 4XRFA 2DW4A 2ELHA 2L4MA 5FB2A 3BROA 1Z1DA 2HZTA 3KZZA 1T2KA 2ADUA 4L18B 2EWNA 3KLNA 2XROA 1S29A 2YX4A 1FC3A 4MEYF 1XGMA 1B9NA 1Z9CA 2EK5A 1G3TA 2L4AA 1XGOA 2UXXA 5AIPA 3I53A 3RPQA 2XAGA 4I02A 4ZYHA 1SAXA 1R36A 1R5HA 2JT1A 4S04A 4HYEA 3M8EA 2G7HA 2HDCA 2RVCA 1MJAA 3WTUC 1LEAA 1Z91A 2FE3A 2XAQA 4OIOF 3GFLA 2ISYA 2FOKA 5AIQA 1ONVA 2H27A 4I09A 4MGRA 3Q9VA 2JSCA 3F3XA 3KP6A 5CLSA 4RB0A 2A68F 1LDDA 2STTA 1A04A 3T1BA 2STWA 4O3MA 1G4DA 2Z33A 1XMAA 4HDUA 4HF0A 3QAHA 4KT5C 3ZMSA 4ASNA 4XBFA 4RB2C 5A2QK 3FM5A 1FYLA 2Y48A 2P7VB 2K4BA 1Z7UA 3J7AO 3I54A 1K7AA 1R58A 4G6QA 3R4KA 2LDUA 2NRAC 2RQPA 1BC8C 2EFQA 3V7CA 3QRFF 3ZP5A 2V79A 4CYDA 4KMFA 5JHUA 4UVBA 1J0RA 5E8GA 1SD4A 1ZYRF 2O6GE 1GHCA 4KIBA 2ZJ2A 1EH7A 4YFXF 5DCFA 1YS7A 3U9GA 4KN4X 5LEKA 2XRNA 1JHFA 1Y0UA 4NB5A 3LQRA 4A5NA 1IN8A 2PQ8A 3RDIA 4U7BA 3ZN0A 1FT9A 4WF2A 5K1YA 1F9NA 1XB4A 1XSXA 3F72A 2GA2A 3TO9A 1IN6A 4M74A 4PDKA 3CO6C 2E7WA 4ZZDA 1ZN2A 2H09A 4P9FA 4LMYA 5FLXZ 4BHBA 3ZQ7A 5IT3A 2XGXA 2BBYA 4ETSA 5FFXA 5D4RA 1TQIA 2M45A 3KP2A 3MWMA 2WC2A 1XMKA 1TTYA 2DI3A 2EV5A 2PMUA 4UUVA 3K9TA 2VOPA 3VODA 1MKMA 3HUGA 1GXPA 2CGPA 1QGPA 1TQMA 3GUDA 2ISZA 5CVVA 3F23A 2HEOA 2FBKA 4HX7A 2PMHA 3ZMTA 4HX8A 2QM3A 1ULYA 1IN4A 5L3DA 3WE2A 3ZMUA 4UV8A 1OYIA 5CVJA 2M30A 4HZFA 2QYOA 5BQTA 2VN2A 3K1PA 4N9IA 4OOIA 2F5EA 4KDPA 1XN7A 5L3BA 1QNTA 1VTNC 2JPCA 4OIRF 3IL2A 1V4RA 1YLFA 2XAJA 2X4HA 1F4KA 1BIAA 4ESJA 1FOKA 5LHHA 3ZN1A 4JBAA 4ZZLA 2NS0A 2HKXA 1KQ9A 1L3LA 2ZO4A 1ZG1A 4FT8A 3HRTA 3FF5A 2G7UA 5ICGA 1Z05A 3I64A 4EGYA 3RI4A 3IHUA 1G3YA 1I27A 4FX0A 2D1HA 4MEXF 6PAXA 4ENMA 3RTRA 3I71A 5D5XB 2PFBA 3E5QA 1T6SA 1XGNA 2DK5A 3KE2A 5E1WA 1YIOA 2GXGA 4A12A 4IRGA 1FP2A 5ERIA 4PZJA 1T39A 1SFEA 3BOQA 2P4WA 3SXYA 4L9JA 3J80Z 1SD7A 2W25A 5TJJA 2QLZA 4EJWA 2FMYA 1G3SA 2Z99A 1QQIA 2RV8A 1IZ1A 4MNUA 3U1DA 2ESNA 1P6RA 1MDMA 3RKXA 4LLNA 2ZBKA 1L0OC 2OD5A 4MQ9F 2KKOA 1G6NA 1H9TA 3HYIA 3CUQA 1HW1A 2IT0A 5DV5A 1HKTA 2IA1A 4KA4A 4IJAA 3QPTA 3WU0A 4O6JA 3Q5FA 2FXAA 3L09A 1XCBA 1GXQA 3KETA 4M9SA 3N4MA 3H92A 2E1CA 1P4WA 3SQNA 5CVIA 4LLLA 2IP2A 3MFKA 1KYZA 4RAYA 5L3GA 2K4JA 2CG4A 4BAYA 4HLXA 2R7FA 3EUHA 4LK0F 2NAZA 4B09A 4HV5A 3GW2A 2VOOA 2VE9A 2QVOA 3FWEA 3BJAA 1BI0A 4IVNA 2O8XA 3WE3A 1T98A 1SD6A 5BOXA 3GLXA 3COAC 5BPDA 3B73A 4WX9A 2L01A 5D5UB 2DPUA 1I6XA 1DPUA 4UV9A 3CUQC 1NHAA 4RGUA 1KYWA 2H94A 3E97A 5DDGA 2YR2A 5CYVA 3FXUA 1W5SA 1B59A 2RNJA 1LVAA 1W5TA 5L3FA 3SZPA 3G3ZA 2OU2A 1I1SA 1MDMB 3F8MA 4G8XA 4IRIA 3ERED 5DD4A 5DUKA 5F6FA 1MZBA 1YW8A 3CUQB 1XSVA 3WTTC 5D8KB 4LD5A 4YG2F 2XKOA 2HR3A 3DFGA 4WWCA 4HQEA 2DU9A 1U5TA 5JI6A 3QU3A 4LB6B 3E5UA 2G9WA 4LGWA 2HQNA 4OMYA 4JQFA 3MQ0A 4OMZA 4P96A 2XAFA 3W6JB 2E1NA 3ULQB 3KP3A 5E17F 3QPHA 4KN7X 1D5VA 1D3YA 1B6AA 2EB7A 2L3DA 1U3EM 2IRFG 2VXZA 3HTUA 5D6FA 4KIFA 1XCVA 1FWZA 4AIKA 3NRVA 3S2WA 4L0ZB 3O2PE 4Z2YA 3WGIA 2HTSA 1R1VA 4FHTA 4AD9A 1ZRCA 4E70A 4CZZA 2CW0F 3IC7A 1TLHB 1U5TC 2EV0A 3R0AA 1OPCA 3GO5A 5D8LB 1R5GA 3E6BA 3FMQA 1I1GA 4WXCA 5EEHA 1O3RA 1RI7A 2KJCA 2MH9A 3TDUC 1IN5A 3J81K 1E2XA 3CDHA 3RPUA 1O3QA 4AWXB 4N0BA 1U5TB 3I59A 5HDGA 1R7JA 1R22A 3QOPA 3C3WA 1BI3A 2YSRA 2R7DA 2TDXA 4MHGA 4ESBA 3DEUA 4CDGA 1IF1A 1XGSA 3CO7C 3DPTA 2Q2EA 5EEGA 3JAMZ 4G7HF 2C6YA 2DBBA 2A6HF 1FYKA 3K69A 3F6VA 1TW2A 1TQPA 4HX4A 4KFCA 1S7AA 4UXNA 3PQKA 2V1DA 1DP7P 2HFHA 1IXRC 2GWRA 4KNYA 3R61A 1HBXG 2IPQX 2COMA 2M5WA 1O57A 2OZUA 1BOAA 1FBSA 1AWCA 1J75A 4MTDA 3LQQA 2BEOA 1EV7A 4NHJA 4L5IA 1EH6A 3LA2A 4Y17A 3I59B 5E1XA 4QLCU 2CSOA 4FX4A 4F7ZA 2M1BA 1RZ4A 4HDVA 5CVUA 2MH2A 2VODA 3T8RA 2NNYA 3VOEA 3VEPA 2YU3A 1ZREA 3P7NA 3WU1B 3MZHA 1IAWA 1CGPA 2LKPA 2IJLA 1TW3A 4GCVA 1QZYA 1W4MA 2RDPA 4KMUX 3H3UA 4I0AA 3ABUA 2RC4A 3AAFA 4IF4A 3LAJA 3HSFA 5FGMA 5LGTA 3BPVA 4M6XA 3SZTA 4K2EA 5E20A 1KU2A 4A0XA 4P9UA 1BJAA 3ECOA 2KRFA 3HOTA 1LJ9A 5CVRA 3E6CC 3F22A 4B8XA 3E3VA 4L9TA 2ZCWA 4HW0A 3B02A 3LSTA 3MAJA 1X3UA 5ILUA 3GX4X 5K5RA 4A0YA 1Z6RA 3GYHX 4G94A 2PI0A 3DP7A 4OU0A 1O7FA 2HS5A 2Y0MA 1ZAOA 4U88A 2EV6A 3RJPA 4BXUA 2Z9OA 3IWFA 4EJVA 4OIQF 2XIGA 3NEUA 1WSUA 2A69F 1ZGJA 1MJ9A 3JSOA 4CICA 5HOOA 4ON0A 4CHUA 2JRTA 2PBIA 1MGTA 4M6YA 1HKSA 1QBJA 2W85A 4Y15A 1TNTA 2A07F 3DKWA 4U7DA 4U0VA 1MD0A 4A0ZA 5BS6A 3R60A 2DFIA 5E1ZB 3F8NA 4I98B 4RS8A 1LB2A 3I58A 3TQNA 4P5OA 3RKYA 2VE8A 4S05A 2DT5A 3GEZA 2HOEA 5LHIA 2CO5A 1ZHFA 1USSA 4RAZA 1RIOH 4PGHA 2V1UA 1BN5A 3FZVA 4BH9A 4MTEA 2QQBA 3KZYA 1S6LA 3V7SA 5HS7A 5FD6A 2LF8A 1HSJA 5FO5A 5DD8A 2XVCA 2VC1A 3HHGA 1JXSA 2PEXA 3GF2A 3E6MA 4KYWA 3CJNA 4D0PA 4UVAA 4NQWA 5FD5A 2KIMA 2F5DA 3F8CA 4EJTA 3PFIA 5KVRA 4ESFA 1YS6A 4A6DA 4IHTA 5HVQC 3FMSA 2JTVA 1K78A 2VT2A 3IKVA 2P5KA 3I4PA 1BIBA 5HS8A 4LG0A 2XUBA 2A5YB 3F8BA 4YFNF 3I0TA 3MEXA 5BMZA 4Q5SF 4G7OF 4XSZF 2HQRA 5DYMA 2O0YA 2W24A 3ABTA 2D1VA 1O3SA 4KIGA 4HBLA 2WWYA 1LNWA 4YFKF 1IRGA 3P9IA 1FBUA 1F5TA 4HQMA 5F1RA 3K0LA 2DO7A 2HYFA 5H6RA 2XKPA 4UVCA 3HRUA 5FLXK 1R1TA 2FNAA 1MJBA 2FBIA 2FEZA 3WG9A 1IW7F 2P5LC 3M1EA 2BV6A 4IPAA 3RYRA 1ZG5A 2EJRA 3GFMA 4L5JA 1WI9A 2PJPA 3JTGA 2BGCA 1FPQA 5JFRA 1U2WA 3HIFA 3TO7A 4A2UA 5KK1A 4BNCA 1K79A 3F21A 1XSDA 4CXFA 5D5VB 3LA3A 3F6OA 3WTSC 3CUOA 4PCQA 4XLNF 2QBYA 4HV6A 2LSOA 2V9VA 4P55A 3MCZA 1K78B 1STZA 2P6SA 1H9GA 3DPLC 4LG0B 2FQ3A 2IW5A 4AIHA 1KQ0A 3T5XA 4DQ2A 2M87A 4EM1A 2ACJA 3T8TA 1SMTA 3CTAA 2QZ8A 1ZLKA 1F1ZA 1RNLA 3WTZA 4GGGA 2VBXA 2ETHA 2D45A 2UWMA 3TO6A 1W7PA 3D0SA 4RB1A 1YW9A 1TBXA 5HLIA 3KEOA 2EFWA 2M8EA 2BYVE 5LEJA 3O3KA 1WQ2A 2HTJA 3EQLF 1KQ8A 3M9AA 1YW7A 1H0MA 3IKTA 2K7LA 3BJ6A 2O3FA 1WWXA 2DLLA 5DEQA 3EYYA 3KP7A 1USTA 1YQAA 2FA5A 5FFZA 3KCCA 5E18F 4O5VA 2OQGA 3L00A 1D8JA 3WTYC 2O61A 3JTHA 1SD5A 5ILVA 2AXLA 5D6EA 3J80K 1B1BA 5IT9K 4ENNA 2HWVA 4TV7A 2K86A 2EA4A 2F2EA 3WTXC 3LAPA 2Z5UA 2FBHA 4M9XA 2CYYA 2QBYB 1UFMA 1R00A 5A2QZ 2E7XA 3PQJA 3GFIA 4RGXA 3O6BB 1ZGAA 1LDKB 4EJOA 5K5QA 3ZMZA 3L9FA 2VC0A 3TOBA 5HDNA 4EGZA 2PG4A 3RIRA 1WKMA 1W7PD 1FLIA 2IA0A 1WRJA 3T0YA 3WGHA 5LBQA 4BYYA 4LK1F 1HW5A 1DDNA 2QQAA 1TNSA 2ESHA 1W7PB 1KU3A 2MLGA 4L9VA 1ON1A 4I7HA 4R8HA 2HKOA 2LNBA 2DK8A 4ENJA 4RGRA 5LGNA 1FYMA 3ROUA 1YTYA 3HRSA 2QUFA 2J5PA 1V3FA 4IXAA 3BP8A 1XDUA 4LFUA 1FX7A 2D2WA 2MLKA 2IA2A 1UHMA 2VBWA 2DAOA 2JZYA 1UHWA 3DV8A 4WK8F 2ZXJA 2X0LA 2ZKZA 2ZMEA 3V4GA 4Q4ZF 2QQ9A 5JR3A 1BC7C 3OV8A 1AOYA 4R1HA 4Q47A 4JK1X 3JW4A 4KUMA 2V1XA 3WTVC 2PN6A 4GXOA 1RUOA 4BQAA 5DUIA 1UB9A 1SMYF 3WTWC 4HF1A 3DXJF 1OR7A 1JHHA 1IRFA 3D5LA 1IUYA 1P4XA 3K1NA 5LGUA 2KIUA 3GZ5A 3C18A 1PP7U 2WTEA 5H6QA 2GZWA 3C1DA 4G9YA 2UZKA 2OQRA 3P9CA 1PUEE 4ZH4F 2GXBA 3Q9SA 1FY7A 3L2CA 1KGSA 5D5WB 2P6TA 2DTRA 3HTSB 4EM0B 1DPRA 2WV0A 1FBQA 1OYYA 2ZMEB 2RGVA 4WXDA 1IXSB 4I0BA 4R79A 1GVJA 1R23A 2KIFA 1HSTA 1HW2A 1PDNC 2EFNA 2L02A 3R0JA 4I2OA 2XASA 5K5OA 4HOBA 5ICCA 2MA3A 1J7KA 3FXQA 2CWEA 4WCGA 3JSPA 5J8CA 2NYXA 2VT3A 1YO5C 1ON2A 4LJZF 2JPBA 1JGSA 2OBPA 3K1MA 2VBYA 2A3SA 4UNOA 1U78A 5JVTA 3EDPA 4BHPA 1REPC 1ODDA 1QPMA 3ZMVA 2XHKA 1EH8A 3LWFA 2Y75A 3GZ6A 5HLGA 1T0FA 1ZLJA 2L54A 2KJBA 5CJ9A 3ECHA 4HF2A 1SFUA 3M7GA 2EFPA 3TOAA 4LB5A 1B4AA 4ZYEA 2GIVA 4G6DA 1OMIA 5ICFA 5F64A 1FSEA 3V8LA 4YIFA 2ZNZA 2A6EF 4HLYA 3JAMK 1ZRDA 5LRRA 2GA1A 3ZMDA 5D4SA 3V7RA 2MBFA 2R3SA 4A6EA 1FP1D 2FNPA 5BPIA 3DQVC 4IRHA 4CO8A 3M8FA 4RB3C 4M9ZA 3ZPLA 2Z3YA 3VFZA 5J8FA 3HOSA 2PLYA 3IRRA 3U2RA 2CQKA 3E6DA 2Q0OA 3HHHA 1P2FA 3R6SA 1O7LA 4M71A 1IXCA 2XV4S 4XSXF 2FMLA 4GYIA 1E17A 3LA7A 3GXOA 2O03A 2P8TA 1P4AA 4BHCA 3GWZA 4EVIA 3HSEA 3FHZA 4XLPF 2QWWA 2MC3A 3FXRA 3WGGA 4L0YB 2FU4A 3FMRA 1J59A 3H3ZA 3BY6A 1J5YA 1U8RA 2H6CA 1FSHA 5ICEA 3QU6A 2F5CA 4EM2A 5LHGA 5HDKA 2CFXA 1O3TA 2K27A 3HRMA 3L7WA 1CF7A 1QZZA 1QO0D 3BWGA 3EETA 4I01A 4Y13A 3V8JA 1UCRA 1KA8A 3IRQA 4ENKA 4GYGA 3W6KB 5ILSA 4M72A 2F5FA 4EMSA 1I5ZA 3ISPA 3TDZC 1S7OA 1P92A 4LLGF 5ED4A 4A5MA 4KICA 3VB2A 2AS5F 5E8IA 3N97A 1HQCA 1T38A 3I5UA 1BI1A 5IT9Z 4Q48A 1SFXA 1BI2A 3HSRA 4OINF 5AONA 4OIPF 5L3CA 4H0EA 2V6CA 4L9NA 3BZ6A 2HYGD 3KEQA 1S8NA 5L3EA 3DF8A 2FRHA 4N9HA 2P5VA 1R1UA 4HA8A 1Q1HA 3CLOA 4EQQA 2K02A 1D8KA 4UHTA 3KP4A 3BPXA 3BJOA 1YG2A 3KFWX 2ZFWA 2GAUA 2Q8KA 2MD5A 3E5XA 2EA2A 1J2XA 4RGSA 1CF7B 1HXDA 3FM3A 5DCMA 2HGCA 3WODF 3J81Z 4MQVA 2VONA 1K6OA 2XAHA 3RYPA 1JE8A 1BM9A 1XDSA 3QP6A 2W84A 2IVMA 2OA4A 3GVAA 4EV0A 3BDDA 1ZARA 4ZYGA 3ELKA 1KU9A 1DUXC 1FZPB
chains in the Genus database with same CATH superfamily
2XSDC 2CW8A 2L0KA 1GVDA 3C7JA 1YFHA 1MBGA 3SHFA 4MLOA 1B9MA 4DNCA 3QP5A 1U6GA 1LEBA 1XTAA 5LLQA 1TWCJ 1OYWA 1Z3XA 5J1RA 2R5ZB 3MZYA 5H20A 2DPDA 4BXXJ 2HVQA 1G3WA 3REOA 1LDJA 4LG3A 1IRZA 3GFJA 4XR6A 1ZG3A 2VBZA 2GQQA 2DQRA 2P7CB 1IRXA 4U0WA 3S14J 1BBYA 2I5UA 2YX7A 1OCPA 3F8FA 5K7FA 2NNNA 1OKRA 4XKVA 2ELKA 2DA2A 3BLYA 2FF4A 1HKQA 2MG4A 2E5NA 2EFOA 2OAZA 1J9IA 3M8JA 4PGGA 2KT0A 2V7FA 3X2QH 1XD7A 3H3VK 2WV1A 3KP5A 5B1AH 2P81A 2QENA 1Z6TA 3AKZA 2Y0SA 4XLEA 2YUSA 3QPSA 2D5VA 2CFOA 4BGDA 3I4MJ 3FX3A 3NQOA 4WXHA 1S3JA 2CQNA 3TKYA 5HLHA 1ZRFA 2H1KA 3NWTA 4ANJA 2ZNYA 2RKHA 3BTIA 4G7ZF 5TRDA 3V8KA 4HAMA 4EJUA 3DBLB 1IN7A 4GO1A 3W2VA 4DZJA 1UELB 2H1LA 3OYLA 1U8BA 2ZC2A 2VJJA 1WI3A 2LC2A 1LKXA 2E1MB 3HKZN 3ML6A 3CJRB 4PK4A 3KLOA 4LITA 1W0UA 3I55I 2NOJB 4NDLA 1XG1A 3TGNA 4A3BJ 4X0GA 1YYVA 4ZYDA 2Z1DA 3S17J 5DCMB 3SEQA 3TL4X 3G73A 4CGZA 4CCNA 2AO9A 4XL9A 2CS3A 3GTKJ 1VQKI 1SFOJ 3PUFA 3CF2A 2FSWA 3P9KA 4FISA 3MZ8A 3CCEI 4G6TB 4U0YA 2DQLA 4AVPA 2DJIA 1PUFB 3PIPF 1LQ1A 4JYKA 2A61A 2YS9A 4YIIA 4G12A 3RKWA 3OOPA 2LP0A 4CSWA 1YITI 3TMOA 1KU7A 5KNLA 4ITVA 2LF7A 5FKNA 2LH9A 1R9TJ 4XRMA 1C0WA 1MMNA 4U87A 4CCJA 1YX5A 3DLLF 2UXNA 5FKLA 2QF7A 2RN7A 2BE5F 2VIXA 2H6BA 4FETA 3KEYA 3LSPA 3W6VA 2OZ6A 4QWQA 2J5OA 1TL8A 2ZJQF 4HNVA 2FQ4A 1RUNA 3MKLA 4M73A 3M07A 1ERDA 4LIVA 1FNNA 5HS9A 2DA3A 2YPRA 3SFZA 1E0EA 4IHSA 2JN6A 1XS9A 3K2ZA 5M5YJ 3OYHA 4BXFA 2W57A 4J19A 1ZH5A 4NC8A 4C2UA 3LFKA 2VUMJ 5KHDA 5J6XA 2DDBA 5LRSA 1K4SA 1PP8F 3IWZA 4AIJA 4XRSG 2JUCA 4ZYAA 4FASD 1IGNA 2LY1A 1LUJB 1XX5A 3EYIA 2B0LA 4XRFA 2DA7A 2ZXIA 4HG2A 3ABLH 2CUZA 1OFCX 2K9NA 4E7SA 1TT0A 2DW4A 2OF7A 2CMPA 2ELHA 5IP7J 2L4MA 2KDOA 2DA5A 5F08A 5FB2A 3BROA 3J7AY 1Z1DA 2HZTA 3KZZA 1T2KA 2ADUA 2X48A 4L18B 2XGEA 2HYJA 1YOVB 2EWNA 3KLNA 3ZXSA 2XROA 2R7QA 2X6OA 4EEFG 5EGOA 1S29A 1MBJA 2XPUA 2YX4A 1FC3A 2XPWA 4E7ZA 2GLOA 4MEYF 3HBLA 1XGMA 2CJJA 5B1BH 1B9NA 4RLQA 1Z9CA 1XPXA 2EK5A 1G3TA 2L4AA 1XGOA 2UXXA 5AIPA 3I53A 1PVEA 3RPQA 3OYIA 2XAGA 1IG7A 4I02A 4ZYHA 1I3AA 3Q3SA 5KAIC 1SAXA 2MD0A 4BJ6C 1R36A 1R5HA 2JT1A 3LSMA 4S04A 1EJ9A 2LG4A 1FIPA 4A3LJ 4HYEA 3M8EA 2G7HA 4MIMA 2HDCA 2QCOA 2RVCA 4X6AJ 2LY9A 1MJAA 4V2FA 3OYAA 3WTUC 1LEAA 1Z91A 5M5WJ 2LBFA 1YE9A 3D5RC 3OIPA 2FE3A 4ZJZA 2NVYJ 3CCSI 4CCOA 2CV2A 2XAQA 3NWSA 4OIOF 5J3LA 3CC4I 3GFLA 4M3BA 2ISYA 1TWHJ 2FOKA 3BR6A 5AIQA 2WBMA 4IOCF 1ONVA 2H27A 3K4KA 1X3WB 4I09A 3FIWA 4MGRA 3Q9VA 1A6IA 2DOAA 3VYSB 2JSCA 3HM5A 2OC6A 2B9SA 3OYKA 2F4IA 3F3XA 1GUUA 3KP6A 5CLSA 3TBIA 3S1MJ 3HJEA 4XKBA 3ZCOA 4RB0A 1TT5B 2A68F 2XF7A 1LDDA 2STTA 1A04A 1ETVA 3T1BA 2STWA 4O3MA 1G4DA 2Z33A 1XMAA 4HDUA 2OJED 3GTGJ 4HF0A 1V5FA 5FKOA 3RQ4A 1R5ID 3QAHA 1YX3A 4KT5C 1X2MA 4XKWA 3ZMSA 2VQGA 3K4JA 4ASNA 3OR1C 3ZQFA 4XBFA 4RB2C 5A2QK 3FM5A 1T56A 3MKZA 1FYLA 2P0WA 2Y48A 2P7VB 2VKEA 3F9KA 1G2HA 2K4BA 1Z7UA 3AG4H 3FXKA 3J7AO 3I54A 3DPUA 5EGOB 4DYQA 1K7AA 1R58A 2F48A 2VJ5A 4PJJA 4F92B 3S93A 4G6QA 3R4KA 1UMQA 2LDUA 4F93B 3HGYA 2NRAC 2RQPA 1BC8C 3O8GA 2EFQA 3V7CA 2L7MP 3QRFF 3ZP5A 2V79A 1N25A 4CYDA 4KMFA 5JHUA 2RREA 4C2MJ 4UVBA 1J0RA 1P9QC 5E8GA 3DEEA 1SD4A 1ZYRF 2H8WA 1YHQI 2O6GE 1GHCA 3LSHA 4KIBA 5J4VA 2OTJI 2ZJ2A 2KRCA 1EH7A 4Y7NJ 2BY2A 2LBFB 2FD5A 4IHXA 4YFXF 3GTQJ 4BQQA 5DCFA 2N8GA 4NC6A 1YS7A 3U9GA 3A0HC 4KN4X 5LEKA 2KRHA 1VQ6I 2MW8A 3DBRB 2XRNA 1JHFA 1Y0UA 4NB5A 2L9VA 1ETOA 3LQRA 2ECBA 2Z16A 4Z6YA 1QHGA 5J1YA 2CQQA 4I99C 1NTCA 4XN0A 4A5NA 2KQRA 1IN8A 2PQ8A 3CQZJ 4GRIA 3RDIA 4RA2A 1TZLA 5CKTA 3ZN0A 1FT9A 4U7BA 3BR1A 3CCMI 4WF2A 1LVKA 5K1YA 3RCOA 2M7BA 1F9NA 1XB4A 1XSXA 3F72A 2HXOA 4XRSA 2GA2A 2IS2A 3TO9A 1IN6A 4M74A 4PDKA 3CO6C 2E7WA 1RPWA 1ZN2A 2H09A 4P9FA 4ZZDA 4LMYA 5FLXZ 4BHBA 3ZQ7A 5FKKA 1OQYA 5IT3A 2HXIA 2XGXA 2BBYA 2LREA 4P1WA 4ETSA 5FFXA 5D4RA 4BQOA 1I50J 4PJLA 1ZTRA 1WJCA 1TQIA 2FJ1A 2M45A 5H2FC 1AU7A 4IQJA 4MFDA 3KP2A 3MWMA 2ZXWH 4S0HB 1MSEC 2WC2A 2K3PA 2XF6A 1XMKA 1TTYA 2DI3A 2EV5A 5FLVA 2PMUA 5GTHC 3MD2A 1SFKA 2QA4I 4UUVA 3K9TA 1ZELA 2VOPA 1MIJA 3FK6A 3QYEA 3VODA 1MKMA 3HUGA 1GXPA 1MBEA 2CGPA 1MNDA 1QGPA 1TQMA 3GUDA 2ISZA 3HOYJ 5CVVA 1BL0A 2W1OA 2EZIA 1D1AA 3F23A 4JX5A 2FBKA 1FJLA 2HEOA 4HX7A 4F52A 4RLFA 2PMHA 3K70C 3ZMTA 4HX8A 4BDZA 2QM3A 1YRNA 4RAGA 1ULYA 1IN4A 3S2HJ 5L3DA 3WE2A 3ZMUA 1MW7A 4UV8A 1OYIA 5CVJA 2M30A 3K70D 4HZFA 2QYOA 5BQTA 2VN2A 1JTYA 3K1PA 4ZDLA 2XC7A 4NBQA 3BG7A 4N9IA 1FOYA 3VYUB 2L7ZA 3LMMA 4BEHA 4IQ4A 4OOIA 2F5EA 4KDPA 1XN7A 5L3BA 1QNTA 4KITB 1VTNC 5E79C 3PO2J 2JPCA 3ESWB 2K3FA 4OIRF 3IL2A 1IJWC 1A35A 1V4RA 3OS2A 1DP3A 1YLFA 2XAJA 2OTLI 2X4HA 1F4KA 3ZR8X 1BIAA 3Q0WA 4ESJA 1YJWI 4BY1J 5IOZA 1FOKA 1PYVA 5LHHA 1JUPA 2ZJRF 3CC7I 4AM3A 3ZN1A 4JBAA 4FE7A 4ZZLA 2NS0A 2HKXA 1KQ9A 1L3LA 2ZO4A 1ZG1A 1SVMA 4L5EA 4IHVA 1ACIA 3CDIA 4FT8A 3HRTA 3FF5A 2G7UA 5ICGA 1Z05A 3I64A 3IH2A 1LFPA 4EGYA 3RI4A 3IHUA 1TWFJ 1G3YA 2VQLA 1I27A 3K4LA 4FX0A 2D1HA 4HPQA 4MEXF 6PAXA 1QU3A 4ENMA 3RTRA 3I71A 5D5XB 2WB1A 3J7YJ 2PFBA 3E5QA 1HLVA 2HNHA 1T6SA 1XGNA 2DK5A 3KE2A 3HUGB 3I4NJ 5E1WA 1YIOA 3GTOJ 2GXGA 2VJIA 4A12A 2E2JJ 4IRGA 1FP2A 2GBYA 5ERIA 3SFIA 4PZJA 1RR7A 1SFEA 1T39A 4RM2A 4E7HA 3IH4A 4A3KJ 3BOQA 2P4WA 3SXYA 4L9JA 3J80Z 3IUOA 2CU7A 1SD7A 1K4TA 2W25A 5TJJA 2K9SA 3BR5A 2QLZA 2LTPA 4EJWA 5TGTA 2FMYA 1S72I 1G3SA 2Z99A 1YRNB 4B43A 1QQIA 1VQ8I 1T33A 2RV8A 1I3QJ 1IZ1A 4MNUA 1VZ0A 2XB0X 2LLKA 3U1DA 2ESNA 3EPZA 1P6RA 4ZTFA 1MDMA 4A3CJ 4YELA 3RKXA 2Y69H 1E3OC 2W82A 5F0FA 4LLNA 2VKDA 1L0OC 1WJEA 2ZBKA 3CMYA 2OD5A 4MQ9F 3CP8A 4X1EA 4BEHB 2V9KA 2KKOA 1G6NA 3SYTA 5GPCA 1H9TA 3IH3A 3HYIA 3KX2A 3CUQA 3VPRA 1JUSA 1HW1A 2XF5A 5TISC 2IT0A 5DV5A 1HKTA 2IA1A 4EATA 4KA4A 4IJAA 3FXLA 4DGWB 2CQXA 3QPTA 3WU0A 4O6JA 3Q5FA 2FXAA 3L09A 1W5CC 4M3EA 3BG3A 1XCBA 1GXQA 2ZFUA 5F1JA 4M9SA 3KETA 1VQ7I 4PSWA 3N4MA 3H92A 2E1CA 2FOWA 2X9DA 3QWLA 3BCAA 2EIMH 1P4WA 3SQNA 5CVIA 3L2UA 2LRDA 1I6HJ 4LLLA 1Z77A 2IP2A 3MFKA 1HF0A 1KYZA 4RAYA 5L3GA 5J47A 2K4JA 2CG4A 2VL8A 4BAYA 4HLXA 2R7FA 2OCCH 1ORKA 3EUHA 4AC0A 4LK0F 1WJDA 2NAZA 2JUGA 4ZDOA 4B09A 2BW3A 2L2OA 4HV5A 3GW2A 2VOOA 3AG3H 1QVTA 1VNDA 3MN2A 2VE9A 3ZRGA 2QVOA 1JGGA 3FWEA 3BJAA 1BI0A 4IVNA 2O8XA 3WE3A 3BTCA 1O4XA 1T98A 1BR1A 1SD6A 5BOXA 4IHWA 3GLXA 1D5YA 3COAC 5BPDA 3B73A 1A6QA 4WX9A 2L01A 3UNGC 3G71I 2R7UA 1U9NA 5D5UB 2DPUA 1I6XA 1Y56A 5EF6A 1GT0C 5JLWA 1DPUA 2VB6A 3CD6I 3OYGA 2VXDA 1N75A 4UV9A 3CUQC 3TEDA 3RQIA 1NHAA 4QPQA 3MKWB 4QPOA 3W2WA 4RGUA 4II3A 1TWAJ 2GXAA 1KYWA 2BHYA 2F4OB 2H94A 3E97A 1ITYA 3K4NA 5DDGA 2QEXI 1B8IA 2YR2A 3ASOH 5CYVA 3LSJA 3FXUA 1W5SA 1B59A 2RNJA 1LVAA 1W5TA 2VASA 4NNJA 3B6CA 5L3FA 3SZPA 3G3ZA 2OU2A 3JRGA 1HC8A 1T8IA 1I1SA 3HZJA 3W2AA 1MDMB 3F8MA 2BZTA 4G8XA 2E1MC 3CF5F 2M4GA 4IRIA 2EIKH 3ERED 5DD4A 3HGGA 2HDDA 5DUKA 5F6FA 1MZBA 4QTRA 5F0HA 1WZ2A 3CUQB 1OISA 1YW8A 1XSVA 2MYSA 3BR3A 3EUHC 3A02A 3WTTC 5D8KB 4LD5A 3BTJA 2O9LA 4IOAF 4A3IJ 3EUKL 3IAS2 4YG2F 2HU9A 4A3FJ 2HVSA 2XKOA 2HR3A 3DFGA 4D9JA 2DCEA 4Y3OA 1VI0A 2LK2A 4WWCA 3RKQA 1RRJA 1NG7A 2UV1A 2X85A 4HQEA 2DU9A 1U5TA 1FOWA 5JI6A 3QU3A 4LB6B 1WFXA 3E5UA 2W7NA 2G9WA 1LFUP 4LGWA 5K7ZA 4M3FA 1IV8A 2HQNA 4OMYA 4JQFA 3MQ0A 4OMZA 4P96A 1VQPI 2XAFA 2F5VA 2BW3B 1G8XA 3W6JB 2E1NA 2CUEA 3ULQB 3KP3A 5E17F 2ID3A 3QPHA 1X2NA 4KN7X 5IYBJ 1D5VA 4PSXA 1D3YA 1B6AA 2EB7A 2L3DA 1U3EM 2IRFG 3AG2H 2L7KA 2VXZA 2BY0A 3HTUA 4BACA 2HQAA 5D6FA 4KIFA 1XCVA 3SJMA 3BR2A 1FWZA 1FTTA 5GAEJ 4AIKA 2M4KA 3NRVA 3S2WA 2HI3A 2R7ZJ 3KYCB 4DJAA 2DMTA 2QSFX 4L0ZB 3O2PE 4Z2YA 3WGIA 3E1SA 2CUJA 3H36A 2HTSA 4C3IJ 4C30A 1OJLA 4I6ZA 1R1VA 1B8IB 4FHTA 4AD9A 2KISA 4V19K 1ZRCA 4BS9A 1E3PA 1FMWA 4E70A 4CZZA 2XPVA 2DFEA 4E7KA 2CW0F 3IC7A 1TLHB 3GZNB 3KYDB 1U5TC 2EV0A 3A2KA 3R0AA 1OPCA 2RAEA 3GO5A 5D8LB 5E3OA 2GM4A 1R5GA 3E6BA 2X6YA 1BW6A 3FMQA 1F36A 1I1GA 4WXCA 2KLOA 2NVUB 5EEHA 4A3DJ 1O3RA 1RI7A 2KP6A 2KJCA 4DIQA 2MH9A 3TDUC 1IN5A 3CJTB 2JMWA 1XMXA 3J81K 1E2XA 3CDHA 4F91B 1Y39A 3RPUA 1ZQ3P 2EZHA 1O3QA 4AWXB 5CQGA 4N0BA 1BW5A 5FRNA 2W48A 1U5TB 3L2WA 3ZQQA 1MMSA 2DOEA 3I59A 5HDGA 1X1AA 1R7JA 4IO9F 1R22A 2Y9YA 3QOPA 3C3WA 2QQ8A 1BI3A 2L9RA 2YSRA 2TDXA 2MC4A 2R7DA 2MSYA 4MHGA 3NAUA 1YI2I 1D1CA 2NVTJ 4ESBA 2M0MA 3DEUA 4CDGA 1IF1A 2Y31A 2KL4A 1XGSA 2VQHA 3FBNB 1OLTA 3CO7C 2NXNB 3DPTA 2Q2EA 5EEGA 3JAMZ 4G7HF 3DCFA 3ZQIA 2C6YA 1Y6IA 3SDGA 3G4SI 5M3FJ 2DBBA 2A6HF 1FYKA 2EIJH 2X6WA 3K69A 3CC2I 2M0CA 3F6VA 1TW2A 1TQPA 3NARA 5F27A 4HX4A 3TP3A 4KFCA 2HOAA 1S7AA 1D1BA 3OL3A 4UXNA 2CH0A 5FROA 2MABA 3JREA 4KISA 3HOVJ 1AHDP 2R7SA 5KAFC 3PQKA 2V1DA 3CCUI 5IY5H 3HOXJ 1DP7P 2HFHA 1IXRC 2DTZA 2GWRA 2WAEA 3KPHA 4KNYA 3R61A 3JR9A 1MMDA 1HBXG 3FKJA 2IPQX 4XK4A 1HDPA 1W1WE 3BQYA 3RPUD 2GOXB 2COMA 2M5WA 1O57A 5J1UA 2OZUA 1R49A 4B48A 1BOAA 1FBSA 4CA0A 4AIDA 2A5WA 4CH7A 1AWCA 1J75A 4MTDA 2PJRA 3LQQA 2O7OA 1JUMA 2BEOA 1D0YA 1EV7A 4NHJA 2FX0A 3DBHB 4AVZA 4L5IA 1EH6A 3LA2A 1YIJI 4Y17A 3PO3J 3S8PA 3KYLA 2VI6A 2CRGA 3GMEA 4BDYA 1JKPC 3I59B 5E1XA 3D1NI 4QLCU 1D0XA 1ETKA 2EQRA 5IOYA 2CSOA 2E34A 4NC7A 4XMYA 4FX4A 3F0CA 4F7ZA 2COBA 2M1BA 1RZ4A 4HDVA 1OCZH 1OCCH 5CVUA 1ENHA 2WY8Q 2DN0A 2EINH 2MH2A 4HSRA 2VODA 2E1OA 3T8RA 1IUFA 2E71A 2F6CA 5FJ8J 3OYCA 2NNYA 3ZQCA 3VOEA 3VEPA 1JKQC 2R5YA 2YU3A 1ZREA 5C4XJ 3P7NA 3WU1B 3MZHA 1VFCA 4HNUA 1IAWA 3I9V2 1JKRC 1CGPA 3LSKA 2LKPA 2Q2EB 3CCVI 5FKMA 4PFOA 4CCLA 2IJLA 4C9YA 1TW3A 4DW6A 4GCVA 1QZYA 2IGNA 1W4MA 2IGOA 1POGA 3O8HA 2KFDA 2RDPA 3H3UA 4KMUX 4I0AA 1N78A 2TCTA 1ZR2A 3ABUA 1F43A 2RC4A 3AAFA 1SC7A 2CV1A 1LPQA 4IF4A 2M8GX 3LAJA 3HSFA 1SAUA 5FGMA 5IYCJ 3OMYA 5LGTA 4OWRB 2HPMA 1IV6A 1ETWA 3BPVA 4M6XA 3SZTA 2W4SA 3PIOF 3H35A 4K2EA 5E20A 1KU2A 4A0XA 2KPMA 4YEJA 3BTLA 4P9UA 3OSGA 1BJAA 1RETA 3ECOA 2K85A 4OAYA 2KRFA 2JRMA 3LFUA 3HOTA 1LJ9A 2IXSA 1MBHA 5CVRA 1KONA 3K10A 3TP0A 3F22A 3E6CC 4B8XA 3E3VA 4L9TA 1P7JA 2ZCWA 3B02A 4HW0A 3QYBA 3LSTA 2LKXA 1MBFA 3HKZA 3MAJA 1X3UA 5ILUA 3GX4X 4XOTA 4D5CA 2Z2SB 1NG6A 3FXOA 3BR0A 3H5NA 5K5RA 4A0YA 1Z6RA 3HEFA 4BY7J 3GYHX 3LSIA 4G94A 2PJRB 2PI0A 3DP7A 3IP4B 3ABKH 4OU0A 2OPTA 2Q1ZB 1O7FA 2VPLA 2HS5A 2Y0MA 1ZAOA 4HNTA 4HRIA 4U88A 2VKVA 4UY8I 2JA6J 1VF9A 2EV6A 1N77A 1IC8A 1ZKGA 1V54H 1Y8RB 2MGQA 3RJPA 3LSGA 4BXUA 2Y0SN 3IWFA 4EJVA 2Z9OA 4OIQF 2XIGA 3NEUA 1WSUA 2A69F 5B5EC 1U9OA 4BE0A 1ZGJA 1MJ9A 1FMVA 3B6AA 2K9MA 3JSOA 3VDXA 4E7IA 4CICA 1JTXA 5HOOA 4ON0A 4B3XA 5LFAA 1SEUA 4CHUA 1JKOC 2R5YB 2JRTA 2PBIA 1LE8A 1FIAA 5IP9J 1MGTA 4CCKA 1JT6A 4M6YA 2YU9J 1HKSA 3CZ6A 2W85A 1QBJA 4Y15A 3E7LA 2ZJPF 1TNTA 3Q0UA 4F55A 2A07F 1VQ5I 3DKWA 2CQ7A 3LNQA 4U7DA 4DOZA 4U0VA 3WG7H 1MD0A 3ZQHA 3FXJA 3CCQI 2DJNA 3PL8A 1Z3YA 4A0ZA 2WA0A 5BS6A 3R60A 5EG0B 2HDWA 2DFIA 3PNVA 5B3SH 5E1ZB 1X1BA 3F8NA 4I98B 4RS8A 1S5LC 1LB2A 2V4JC 2BXYA 3I58A 3TQNA 4P5OA 1JT0A 4V2GA 1P7IA 2E2HJ 3RKYA 2VE8A 4S05A 2DT5A 2AXTC 1OCOH 3GEZA 3FISA 2HOEA 5LHIA 2CO5A 1BOBA 1MMGA 1ZHFA 1USSA 4RAZA 5C4JJ 1RIOH 2KIQA 3I56I 4PGHA 2V1UA 2VLAA 2K9LA 1BN5A 4UB6C 4A3MJ 3FZVA 4BBSJ 4BH9A 4MTEA 3ZGKA 2QQBA 5FLMJ 3KZYA 1S6LA 3V7SA 5HS7A 5FD6A 4XKCA 4NUBA 2IBDA 1KZHA 2LF8A 4OAZA 1X4OA 1HSJA 5FO5A 5DD8A 1WVRA 3M4OJ 2NS8A 2XVCA 1W36C 2GIZA 5B66C 2VC1A 3HHGA 1PJRA 2DMNA 1JXSA 2PEXA 1V55H 3GF2A 3ZQGA 4AYBN 2UUZA 3DWLE 3E6MA 4KYWA 2O8KA 1AA7A 3CJNA 5HNHA 3OL4A 4D0PA 4UVAA 4NQWA 5FD5A 2KIMA 3WU2C 1W36D 2F5DA 3F8CA 2Y30A 4EJTA 4C2TA 1A36A 4F3QA 2ELJA 3JRBA 3PFIA 5KVRA 5C44J 4ESFA 1YS6A 4A6DA 4IHTA 5HVQC 3FMSA 1K6YA 2JTVA 1OCTC 4YRVA 1K78A 2EILH 2VT2A 3E0JB 1ETYA 2JA7J 3DKXA 3IKVA 2P5KA 2BVMA 1BIBA 3I4PA 5HS8A 4LG0A 2XUBA 2A5YB 2RNGA 3OOUA 4N4OB 3F8BA 4YFNF 2E5ZA 1LE8B 3I0TA 4KT6A 3OYDA 3MEXA 5BMZA 4Q5SF 4G7OF 3ABMH 3KIOA 1MNEA 4BU2A 4XSZF 1CQTA 2HQRA 3S32A 4HEA2 2DT6A 3H5AA 5DYMA 4QSHA 2O0YA 2W24A 3ABTA 2D1VA 3JRFA 4KIGA 4HBLA 1O3SA 2WWYA 2G0EA 1LNWA 4RMNA 3V42A 4YFKF 2R7OA 5GP9A 4RDUA 3P9IA 1FBUA 1IRGA 3OR2C 1F5TA 2OUMA 4HQMA 5EZGA 2GOMA 5F1RA 3K0LA 1JI8A 2DO7A 2E36A 2HYFA 1SVOA 3S3OA 5H6RA 2XKPA 2DFHA 1MNMC 3S3NA 1VQ9I 4UVCA 3S3MA 3PFYA 2V6EA 3HRUA 5FLXK 1R1TA 5FRMA 3A03A 2FNAA 5CPRB 4AUXA 1MJBA 3QPLA 4E7LA 2FBIA 1WHUA 2FEZA 4ZC3A 3WG9A 5F04A 3FBIB 2VKHA 1IW7F 2P5LC 1H89C 3M1EA 2BV6A 4IPAA 1WJBA 3JRIA 3RYRA 1ZG5A 2EJRA 3GFMA 1GDTA 4L5JA 3JRCA 2QSGX 1WI9A 2HOSA 2PJPA 1BJZA 3JTGA 2BGCA 1FPQA 5JFRA 2L7FP 3S1QJ 2M7AA 2X1EA 1RKTA 1U2WA 3HIFA 3TO7A 2AHQA 4A2UA 4D1QA 3CDLA 5KK1A 4BNCA 4ZTJA 1GV5A 2EH3A 1QPIA 2V9PA 1K79A 3F21A 1XSDA 2AQFA 4XLAA 4CXFA 5D5VB 2LVSA 4MO7A 4DBQA 2NVXJ 1Y1WJ 4NQWB 3LA3A 4FCYA 3F6OA 3WTSC 3CUOA 1ZR4A 4PCQA 3PSFA 4XLNF 3SDBA 2QBYA 4HV6A 2LSOA 5F0CA 2ZSHB 2CUFA 1LFBA 5GAHJ 2V9VA 4P55A 1V5GA 3DTEA 3MCZA 2LD5A 1K78B 1STZA 3OYMA 3U21A 2P6SA 3A1YA 1H9GA 3CCJI 1WPKA 1S7EA 3DPLC 4IL6C 4LG0B 3HPGA 2FQ3A 4D7NA 2IW5A 2KMUA 4AIHA 4FQGA 1W0TA 1AKHB 1KQ0A 3T5XA 2WY7Q 2M87A 4DQ2A 4EM1A 2ACJA 2HPIA 4UB8C 1SMTA 3T8TA 2R0QC 3CTAA 2QZ8A 1ZLKA 4B44A 1F1ZA 1RNLA 3WHCA 3PSIA 3WTZA 3TW6A 2IGMA 2B63J 4GGGA 2VBXA 2A6TA 2LYCA 2ETHA 4BKXA 2X6XA 2D45A 4DBRA 2UWMA 4UUSA 3IV5A 1QHHD 3TO6A 5M3MJ 3JRHA 1W7PA 3HPHA 1A31A 1FOXA 3D0SA 1NH3A 3CLQA 4RB1A 1RC9A 1YW9A 4QIWN 4YIRX 1TBXA 1DGWY 5HLIA 3KEOA 3MKYB 2EFWA 4D7MA 2M8EA 2BYVE 1UG2A 5IYDJ 4JOMA 4PJMA 5LEJA 4JX6A 3O3KA 3J7ZI 4RBOA 4BE2A 1WQ2A 2HTJA 3EQLF 3W3CA 1VQOI 1KQ8A 3M9AA 1V5EA 1YW7A 1H0MA 4XQFA 3HC7A 3IKTA 2K7LA 3S1RJ 2K9QA 3BJ6A 2O3FA 1UZCA 1WWXA 2DLLA 5DEQA 3EYYA 3KP7A 1USTA 1YQAA 2FA5A 2NS7A 4Y4RA 2V1NA 1J09A 5FFZA 3KCCA 5E18F 2XDVA 2ME6A 4O5VA 3VYRB 2OQGA 3L00A 4CYCB 1D8JA 1G59A 3WTYC 4C3JJ 2O61A 1Z0XA 3JTHA 1SD5A 5ILVA 2AXLA 3DKYA 3P5JA 3DU6A 5LD2C 5D6EA 3VYTB 1X1DA 1QA6A 3J80K 1E3HA 1B1BA 5IT9K 2R7WA 2Y2ZA 2HWVA 4ENNA 2DXIA 2ECCA 4TV7A 2JVHA 2K86A 5KCMA 2EA4A 3QOEA 4XORA 2F2EA 3WTXC 3LAPA 2Z5UA 2FBHA 4M9XA 3TW7A 2CYYA 3FHNA 3GCMA 2QBYB 1UFMA 2XRLA 1R00A 1U0JA 2BXZA 3QQAA 5A2QZ 2E7XA 1WCMJ 3PQJA 3GFIA 4RGXA 3O6BB 1Y0NA 2H8RA 1ZGAA 1EF4A 1LDKB 3BG5A 4EJOA 3WHBA 5K5QA 3ZMZA 3L9FA 2VC0A 3TOBA 5HDNA 4EGZA 2PG4A 4A3EJ 3RIRA 1VQNI 1B72A 3OS0A 2QSHX 4CUGA 2IEKA 3PNYA 1WKMA 1W7PD 2OV7A 1FLIA 1Q1VA 2IA0A 1WRJA 3T0YA 5IPAA 1Z67A 3WGHA 5LBQA 3OYEA 1APLC 1X4PA 4BYYA 2EPFA 4XICA 4LK1F 1K61A 1HW5A 3HG9A 2E19A 4IX7A 1DDNA 3H9JA 2QQAA 4UUSB 4BUPA 1TNSA 2ESHA 3OIQA 1W7PB 1KU3A 4XN3A 1BR4A 2MLGA 4L9VA 4XONA 3H5RA 1R6RA 3HOZJ 1ON1A 2EZLA 4PJ0C 3N05A 3HB9A 3H9QA 2A05A 2WAQN 4I7HA 2HKOA 4R8HA 2LNBA 2DK8A 4ENJA 4RGRA 5LGNA 1R71A 1H88C 3CJQB 3S16J 1FYMA 3ROUA 4BQNA 3OYNA 1YTYA 3HRSA 1HA8A 2PMZN 2QUFA 2J5PA 1V3FA 1VQLI 2WAFA 4IXAA 3BP8A 1XDUA 4LFUA 1FX7A 2D2WA 4AYBA 2MLKA 3G1LA 2IA2A 2BOLA 2DODA 1UHMA 4XLCA 2ME0A 2VBWA 2DAOA 2JZYA 1TP4A 1UHWA 3DV8A 4WK8F 2ZXJA 2DA4A 2X0LA 2ZKZA 2ZMEA 3V4GA 4Q4ZF 4M3GA 2IS6A 2L5QA 2QQ9A 3AG1H 2XGCA 4M6VA 5JR3A 1X1PA 3OV8A 1BC7C 1AOYA 4R1HA 2ID6A 4Q47A 4JK1X 3A01A 1JJ8C 2VJ4A 2LOOA 4II2A 3CCRI 2WADA 3G2BA 3JW4A 4KUMA 5IP6A 2V1XA 2JVGA 3WTVC 2DA1A 2PN6A 1Y8QB 4AU7A 4B4CA 3OYFA 4GXOA 4PJNA 5J40A 3MMYB 2IS1A 1RUOA 4BQAA 5DUIA 4DYCA 1UB9A 1UHSA 2E35A 1SMYF 2B7EA 3WTWC 2L9NA 4Y33A 4A69C 4HF1A 3DXJF 5HLTA 5EYRA 1OR7A 1T95A 2JK3A 4B1RA 1JHHA 2E2IJ 4KJZA 1IRFA 1IO2A 3D5LA 1NK3P 4Y52J 1B72B 4C3HJ 1IUYA 2WB1N 3S1NJ 4I76A 1XC5A 1P4XA 3K1NA 5HNFA 3HXLA 5LGUA 2KIUA 1X19A 2X51A 3GZ5A 3C18A 1MH4A 2DFFA 1PP7U 2LR8A 3S2DJ 1DU6A 2WTEA 3PM1A 1WJFA 5H6QA 2GZWA 3BC8A 3C1DA 4G9YA 2UZKA 2OQRA 3P9CA 2ZMEC 1MMAA 4RM3A 1PUEE 4ZH4F 2R7RA 2I10A 2DMQA 3L2VA 2GXBA 3Q9SA 1EA3A 1FY7A 1NK2P 5DS9A 1IDZA 2KZGA 1KGSA 3L2CA 3GTPJ 3DU5A 5D5WB 2P6TA 2DTRA 3HTSB 2LY2A 4EM0B 1DPRA 2WV0A 3OIOA 4N4NB 1FBQA 2ICWG 2LMDA 3L2QA 2K40A 4J01A 3C2BA 3HOUJ 1WJAA 2LFBA 1OYYA 1D0ZA 1R4MB 4RAFA 5CQEA 2ZMEB 3C2GA 4BJ5C 1FEXA 2RGVA 4WXDA 1IXSB 4I0BA 4R79A 1GVJA 1R23A 2R92J 2M9HA 1OR7C 2KIFA 1MBKA 1RR8C 2PX9A 3A01B 2CW7A 1UAAA 3ERMA 3L1PA 1HSTA 3SEZA 1HW2A 5GTIC 3JRDA 1PDNC 3D5SC 2EFNA 2L02A 3R0JA 4I2OA 2XASA 4LIUA 2L9SA 3JCUC 4E7JA 5K5OA 4HOBA 4E6KG 2DOFA 5ICCA 2MA3A 4A93J 4DYRA 5EG0A 1J7KA 3FXQA 2CWEA 4WCGA 4MFEA 4CZCA 3JSPA 5J8CA 1RESA 2NYXA 2VT3A 2ZXHA 1YO5C 1ON2A 4LJZF 2JPBA 4GFBA 5DTDA 1ZGWA 2E60A 1HOMA 1JGSA 4E4HA 2OBPA 3VSKA 5J4YA 3K1MA 3CMAI 3G1OA 4HSTA 2VBYA 2A3SA 2JA8J 4UNOA 1DU0A 1U78A 1MSFC 4XLFA 3H9GA 5JVTA 3EDPA 1SANA 4B3AA 4BHPA 5GPAA 2ZB9A 3C2HA 1REPC 1ODDA 2R7VA 1QPMA 2TRTA 4XLHA 3KZIC 4JP0A 3A4CA 2R93J 4B47A 3ZMVA 2XHKA 2DYRH 2Y9ZA 3K6GA 1EH8A 1OCRH 2JA2A 2QGUA 2X1DA 2HOTA 3LWFA 2Y75A 2K5CA 3GZ6A 5HLGA 2CV0A 1T0FA 1ZLJA 2L54A 2KJBA 5CJ9A 1QVUA 4A3GJ 3ECHA 3DTIA 1UJ8A 4HF2A 1SFUA 3M7GA 1M1EB 1I39A 2EFPA 3I3LA 5EDNA 4FTHA 3TOAA 4LB5A 4IKFA 1B4AA 4ZYEA 1YJNI 2GIVA 3K7AJ 1OMIA 4G6DA 1TC3C 3DLAA 5ICFA 2DMPA 4W1UA 3L2RA 5F64A 1FSEA 4LOCA 2EZKA 2IGKA 2ZNZA 3V8LA 4YIFA 4XM3A 3LL7A 2A6EF 4HLYA 1EKEA 3JAMK 4IHYA 1UG0A 3A0BC 1ZRDA 1R4NB 3VSLA 1ETXA 3ASNH 5LRRA 2GA1A 3MVPA 3ZMDA 4DZPA 5D4SA 4XOPA 3V7RA 2JSPA 2MBFA 2R3SA 3RZDJ 4A6EA 1FP1D 3BQZA 3OS1A 2DT7B 2DA6A 1WJ5A 2FNPA 2ZSIB 5BPIA 4BE1A 3DQVC 3BZKA 4IRHA 4CO8A 3GLLA 3M8FA 3BT9A 2O5RA 1VQMI 2HVRA 3CMMA 2M3AA 4RB3C 4M9ZA 3ZPLA 4BL0B 2NVQJ 4PFPA 2EBIA 2Z3YA 3VFZA 2DYSH 5J8FA 3HOSA 2PLYA 3K4MA 3IRRA 3HOWJ 2JQ7A 2VQCA 1FTZA 3U2RA 4M3DA 2CQKA 3E6DA 4XIDA 2Q0OA 3FK7A 5EZHA 4BJTA 3HHHA 1P2FA 5BNGA 3BZCA 3R6SA 5JVGF 1JJ6C 5GADJ 2R7XA 4BBRJ 1O7LA 4M71A 1IXCA 1T0FC 2WAQA 2IS4A 2XV4S 2QKLB 2FMLA 4XSXF 3ZOBA 5EJCA 4GYIA 4IZZA 1E17A 3QYFA 3LA7A 3GXOA 3Q0VA 2O03A 2P8TA 3SZGA 2PMZA 1P4AA 4BHCA 3GWZA 3AL0C 4EVIA 1H8AC 1ZK8A 3HSEA 3FHZA 1DGRM 4XLPF 5HODA 2QWWA 2MC3A 1HCRA 5M5XJ 1IDYA 4D5FA 4FE4A 3FXRA 4PUSA 3WGGA 4L0YB 3BG9A 3CP2A 2FU4A 3FMRA 2XGDA 1J59A 2HQ5A 3H3ZA 2X1CA 1WH7A 3BY6A 1J5YA 5E3LA 5JLXA 3UKGA 1U8RA 2H6CA 1FSHA 5ICEA 3LSRA 2M34A 2OCEA 1Y1VJ 2KHMA 1BR2A 2F5CA 2XSJC 3QU6A 4IEJA 4EM2A 5HDKA 5LHGA 2R7TA 3ONQA 2CFXA 3RZOJ 9ANTA 1O3TA 3AL0B 2K27A 3VWBA 3H0DA 3HRMA 3FXMA 3L7WA 4XNFA 1CF7A 1DQUA 1QZZA 1QO0D 3BWGA 3EETA 4JX4A 3OSFA 3HDDA 4GDFA 2DMUA 1SVLA 4I01A 4Y13A 3FDYA 3DEWA 3V8JA 1UCRA 2FUG2 3RSNA 2R4GA 1WGXA 5DM7F 3EUAA 1A5JA 1KA8A 3IRQA 3GBGA 4ENKA 4CCMA 4J00A 5E3MA 4UUTA 2RQQA 2BY3A 4GYGA 3W6KB 5ILSA 3QODA 4M72A 2F5FA 1AKHA 4EMSA 1I5ZA 3FKIJ 3ISPA 3TDZC 1S7OA 1P92A 4LLGF 5ED4A 4A5MA 4KICA 3K4CA 2JJ7A 2DDAA 1X58A 3VB2A 5GAGJ 3OYJA 3K4BA 2AS5F 5E8IA 3BG6A 3IAM2 3CESA 3U1KA 5K7HA 2LKSA 3N97A 3CCLI 1HQCA 1T38A 4H4KC 3OY9A 3I5UA 1BI1A 3JRAA 3BCBA 1QRYA 2KDZA 5IT9Z 3DTKA 4Q48A 1SFXA 2R5ZA 3OWTA 5C3EJ 1BI2A 3HSRA 2QKMB 4OINF 1QZEA 5AONA 5EEAA 4OIPF 5L3CA 3OYBA 4H0EA 1T08B 2V6CA 4L9NA 2VPRA 3BZ6A 3HL2A 2HYGD 1BA5A 3M3YJ 3KEQA 1MH3A 1S8NA 3PUBA 2HZDA 5E3NA 5L3EA 3LOCA 1Z7LA 2MFZA 3CMEI 3DF8A 2BHZA 5JHFA 2M2EA 2FRHA 4N9HA 2P5VA 3K2AA 1R1UA 2IAIA 1VQ4I 4HA8A 1Q1HA 4ABZA 3CLOA 4EQQA 2K02A 1WH5A 2XB5A 3ZQLA 4W97A 4CYCA 1D8KA 1HDDC 4UHTA 1GV2A 3KP4A 3GTLJ 1S9HA 3BPXA 3BJOA 1YG2A 3KFWX 1Z21A 3UR3C 1RKWA 2NOGA 2BY1A 2ZFWA 2GAUA 2Q8KA 2MD5A 3E5XA 2EA2A 1J2XA 2W00A 4RGSA 1CF7B 3CCYA 1TWGJ 1HXDA 1ETQA 3FM3A 3H0GJ 5DCMA 2HGCA 3M1CA 3GTJJ 2KZVA 3WODF 3J81Z 2V26A 4MQVA 5DM6F 3PJRA 1K6OA 2VONA 2XAHA 3RYPA 1JE8A 1BM9A 3G6EI 3H1CA 1XDSA 3QP6A 2W84A 2IVMA 2AQEA 1PUFA 2OA4A 2JA5J 3GVAA 2F4MB 4EV0A 3BDDA 1ZARA 4ZDPA 2I8DA 2BVLA 4ZYGA 4A3JJ 3AFHA 3PNTA 3ELKA 1X1CA 1YJ9I 1KU9A 3G1MA 1DUXC 3S15J 3GTMJ 2JWTA 1K83J 2XAUA 1FZPB 1GLNA 1X3ZB
chains in the Genus database with same CATH topology
3C7JA 1YFHA 3SHFA 1B9MA 4DNCA 3QP5A 1U6GA 1LEBA 5LLQA 1OYWA 3MZYA 5H20A 2DPDA 1G3WA 3REOA 1LDJA 3GFJA 1ZG3A 2VBZA 2GQQA 2DQRA 2P7CB 4U0WA 1BBYA 2YX7A 3F8FA 2NNNA 1OKRA 2FF4A 1HKQA 2EFOA 2OAZA 1J9IA 4PGGA 1XD7A 3KP5A 2QENA 1Z6TA 3FX3A 3NQOA 4WXHA 1S3JA 3TKYA 5HLHA 1ZRFA 2ZNYA 2RKHA 4G7ZF 5TRDA 3V8KA 4HAMA 4EJUA 1IN7A 4GO1A 3ML6A 3KLOA 3TGNA 1YYVA 4ZYDA 5DCMB 3G73A 4CGZA 2FSWA 3P9KA 4U0YA 2DQLA 4AVPA 1LQ1A 2A61A 4YIIA 3RKWA 1KU7A 3OOPA 2LF7A 1C0WA 2UXNA 2RN7A 2BE5F 2H6BA 2OZ6A 4QWQA 2J5OA 1RUNA 4M73A 1FNNA 5HS9A 2YPRA 3SFZA 4IHSA 3K2ZA 1ZH5A 2W57A 3LFKA 5J6XA 5LRSA 1PP8F 3IWZA 4AIJA 3EYIA 2B0LA 4XRFA 2DW4A 2ELHA 2L4MA 5FB2A 3BROA 1Z1DA 2HZTA 3KZZA 1T2KA 2ADUA 4L18B 2EWNA 3KLNA 2XROA 1S29A 2YX4A 1FC3A 4MEYF 1XGMA 1B9NA 1Z9CA 2EK5A 1G3TA 2L4AA 1XGOA 2UXXA 5AIPA 3I53A 3RPQA 2XAGA 4I02A 4ZYHA 1SAXA 1R36A 1R5HA 2JT1A 4S04A 4HYEA 3M8EA 2G7HA 2HDCA 2RVCA 1MJAA 3WTUC 1LEAA 1Z91A 2FE3A 2XAQA 4OIOF 3GFLA 2ISYA 2FOKA 5AIQA 1ONVA 2H27A 4I09A 4MGRA 3Q9VA 2JSCA 3F3XA 3KP6A 5CLSA 4RB0A 2A68F 1LDDA 2STTA 1A04A 3T1BA 2STWA 4O3MA 1G4DA 2Z33A 1XMAA 4HDUA 4HF0A 3QAHA 4KT5C 3ZMSA 4ASNA 4XBFA 4RB2C 5A2QK 3FM5A 1FYLA 2Y48A 2P7VB 2K4BA 1Z7UA 3J7AO 3I54A 1K7AA 1R58A 4G6QA 3R4KA 2LDUA 2NRAC 2RQPA 1BC8C 2EFQA 3V7CA 3QRFF 3ZP5A 2V79A 4CYDA 4KMFA 5JHUA 4UVBA 1J0RA 5E8GA 1SD4A 1ZYRF 2O6GE 1GHCA 4KIBA 2ZJ2A 1EH7A 4YFXF 5DCFA 1YS7A 3U9GA 4KN4X 5LEKA 2XRNA 1JHFA 1Y0UA 4NB5A 3LQRA 4A5NA 1IN8A 2PQ8A 3RDIA 4U7BA 3ZN0A 1FT9A 4WF2A 5K1YA 1F9NA 1XB4A 1XSXA 3F72A 2GA2A 3TO9A 1IN6A 4M74A 4PDKA 3CO6C 2E7WA 4ZZDA 1ZN2A 2H09A 4P9FA 4LMYA 5FLXZ 4BHBA 3ZQ7A 5IT3A 2XGXA 2BBYA 4ETSA 5FFXA 5D4RA 1TQIA 2M45A 3KP2A 3MWMA 2WC2A 1XMKA 1TTYA 2DI3A 2EV5A 2PMUA 4UUVA 3K9TA 2VOPA 3VODA 1MKMA 3HUGA 1GXPA 2CGPA 1QGPA 1TQMA 3GUDA 2ISZA 5CVVA 3F23A 2HEOA 2FBKA 4HX7A 2PMHA 3ZMTA 4HX8A 2QM3A 1ULYA 1IN4A 5L3DA 3WE2A 3ZMUA 4UV8A 1OYIA 5CVJA 2M30A 4HZFA 2QYOA 5BQTA 2VN2A 3K1PA 4N9IA 4OOIA 2F5EA 4KDPA 1XN7A 5L3BA 1QNTA 1VTNC 2JPCA 4OIRF 3IL2A 1V4RA 1YLFA 2XAJA 2X4HA 1F4KA 1BIAA 4ESJA 1FOKA 5LHHA 3ZN1A 4JBAA 4ZZLA 2NS0A 2HKXA 1KQ9A 1L3LA 2ZO4A 1ZG1A 4FT8A 3HRTA 3FF5A 2G7UA 5ICGA 1Z05A 3I64A 4EGYA 3RI4A 3IHUA 1G3YA 1I27A 4FX0A 2D1HA 4MEXF 6PAXA 4ENMA 3RTRA 3I71A 5D5XB 2PFBA 3E5QA 1T6SA 1XGNA 2DK5A 3KE2A 5E1WA 1YIOA 2GXGA 4A12A 4IRGA 1FP2A 5ERIA 4PZJA 1T39A 1SFEA 3BOQA 2P4WA 3SXYA 4L9JA 3J80Z 1SD7A 2W25A 5TJJA 2QLZA 4EJWA 2FMYA 1G3SA 2Z99A 1QQIA 2RV8A 1IZ1A 4MNUA 3U1DA 2ESNA 1P6RA 1MDMA 3RKXA 4LLNA 2ZBKA 1L0OC 2OD5A 4MQ9F 2KKOA 1G6NA 1H9TA 3HYIA 3CUQA 1HW1A 2IT0A 5DV5A 1HKTA 2IA1A 4KA4A 4IJAA 3QPTA 3WU0A 4O6JA 3Q5FA 2FXAA 3L09A 1XCBA 1GXQA 3KETA 4M9SA 3N4MA 3H92A 2E1CA 1P4WA 3SQNA 5CVIA 4LLLA 2IP2A 3MFKA 1KYZA 4RAYA 5L3GA 2K4JA 2CG4A 4BAYA 4HLXA 2R7FA 3EUHA 4LK0F 2NAZA 4B09A 4HV5A 3GW2A 2VOOA 2VE9A 2QVOA 3FWEA 3BJAA 1BI0A 4IVNA 2O8XA 3WE3A 1T98A 1SD6A 5BOXA 3GLXA 3COAC 5BPDA 3B73A 4WX9A 2L01A 5D5UB 2DPUA 1I6XA 1DPUA 4UV9A 3CUQC 1NHAA 4RGUA 1KYWA 2H94A 3E97A 5DDGA 2YR2A 5CYVA 3FXUA 1W5SA 1B59A 2RNJA 1LVAA 1W5TA 5L3FA 3SZPA 3G3ZA 2OU2A 1I1SA 1MDMB 3F8MA 4G8XA 4IRIA 3ERED 5DD4A 5DUKA 5F6FA 1MZBA 1YW8A 3CUQB 1XSVA 3WTTC 5D8KB 4LD5A 4YG2F 2XKOA 2HR3A 3DFGA 4WWCA 4HQEA 2DU9A 1U5TA 5JI6A 3QU3A 4LB6B 3E5UA 2G9WA 4LGWA 2HQNA 4OMYA 4JQFA 3MQ0A 4OMZA 4P96A 2XAFA 3W6JB 2E1NA 3ULQB 3KP3A 5E17F 3QPHA 4KN7X 1D5VA 1D3YA 1B6AA 2EB7A 2L3DA 1U3EM 2IRFG 2VXZA 3HTUA 5D6FA 4KIFA 1XCVA 1FWZA 4AIKA 3NRVA 3S2WA 4L0ZB 3O2PE 4Z2YA 3WGIA 2HTSA 1R1VA 4FHTA 4AD9A 1ZRCA 4E70A 4CZZA 2CW0F 3IC7A 1TLHB 1U5TC 2EV0A 3R0AA 1OPCA 3GO5A 5D8LB 1R5GA 3E6BA 3FMQA 1I1GA 4WXCA 5EEHA 1O3RA 1RI7A 2KJCA 2MH9A 3TDUC 1IN5A 3J81K 1E2XA 3CDHA 3RPUA 1O3QA 4AWXB 4N0BA 1U5TB 3I59A 5HDGA 1R7JA 1R22A 3QOPA 3C3WA 1BI3A 2YSRA 2R7DA 2TDXA 4MHGA 4ESBA 3DEUA 4CDGA 1IF1A 1XGSA 3CO7C 3DPTA 2Q2EA 5EEGA 3JAMZ 4G7HF 2C6YA 2DBBA 2A6HF 1FYKA 3K69A 3F6VA 1TW2A 1TQPA 4HX4A 4KFCA 1S7AA 4UXNA 3PQKA 2V1DA 1DP7P 2HFHA 1IXRC 2GWRA 4KNYA 3R61A 1HBXG 2IPQX 2COMA 2M5WA 1O57A 2OZUA 1BOAA 1FBSA 1AWCA 1J75A 4MTDA 3LQQA 2BEOA 1EV7A 4NHJA 4L5IA 1EH6A 3LA2A 4Y17A 3I59B 5E1XA 4QLCU 2CSOA 4FX4A 4F7ZA 2M1BA 1RZ4A 4HDVA 5CVUA 2MH2A 2VODA 3T8RA 2NNYA 3VOEA 3VEPA 2YU3A 1ZREA 3P7NA 3WU1B 3MZHA 1IAWA 1CGPA 2LKPA 2IJLA 1TW3A 4GCVA 1QZYA 1W4MA 2RDPA 4KMUX 3H3UA 4I0AA 3ABUA 2RC4A 3AAFA 4IF4A 3LAJA 3HSFA 5FGMA 5LGTA 3BPVA 4M6XA 3SZTA 4K2EA 5E20A 1KU2A 4A0XA 4P9UA 1BJAA 3ECOA 2KRFA 3HOTA 1LJ9A 5CVRA 3E6CC 3F22A 4B8XA 3E3VA 4L9TA 2ZCWA 4HW0A 3B02A 3LSTA 3MAJA 1X3UA 5ILUA 3GX4X 5K5RA 4A0YA 1Z6RA 3GYHX 4G94A 2PI0A 3DP7A 4OU0A 1O7FA 2HS5A 2Y0MA 1ZAOA 4U88A 2EV6A 3RJPA 4BXUA 2Z9OA 3IWFA 4EJVA 4OIQF 2XIGA 3NEUA 1WSUA 2A69F 1ZGJA 1MJ9A 3JSOA 4CICA 5HOOA 4ON0A 4CHUA 2JRTA 2PBIA 1MGTA 4M6YA 1HKSA 1QBJA 2W85A 4Y15A 1TNTA 2A07F 3DKWA 4U7DA 4U0VA 1MD0A 4A0ZA 5BS6A 3R60A 2DFIA 5E1ZB 3F8NA 4I98B 4RS8A 1LB2A 3I58A 3TQNA 4P5OA 3RKYA 2VE8A 4S05A 2DT5A 3GEZA 2HOEA 5LHIA 2CO5A 1ZHFA 1USSA 4RAZA 1RIOH 4PGHA 2V1UA 1BN5A 3FZVA 4BH9A 4MTEA 2QQBA 3KZYA 1S6LA 3V7SA 5HS7A 5FD6A 2LF8A 1HSJA 5FO5A 5DD8A 2XVCA 2VC1A 3HHGA 1JXSA 2PEXA 3GF2A 3E6MA 4KYWA 3CJNA 4D0PA 4UVAA 4NQWA 5FD5A 2KIMA 2F5DA 3F8CA 4EJTA 3PFIA 5KVRA 4ESFA 1YS6A 4A6DA 4IHTA 5HVQC 3FMSA 2JTVA 1K78A 2VT2A 3IKVA 2P5KA 3I4PA 1BIBA 5HS8A 4LG0A 2XUBA 2A5YB 3F8BA 4YFNF 3I0TA 3MEXA 5BMZA 4Q5SF 4G7OF 4XSZF 2HQRA 5DYMA 2O0YA 2W24A 3ABTA 2D1VA 1O3SA 4KIGA 4HBLA 2WWYA 1LNWA 4YFKF 1IRGA 3P9IA 1FBUA 1F5TA 4HQMA 5F1RA 3K0LA 2DO7A 2HYFA 5H6RA 2XKPA 4UVCA 3HRUA 5FLXK 1R1TA 2FNAA 1MJBA 2FBIA 2FEZA 3WG9A 1IW7F 2P5LC 3M1EA 2BV6A 4IPAA 3RYRA 1ZG5A 2EJRA 3GFMA 4L5JA 1WI9A 2PJPA 3JTGA 2BGCA 1FPQA 5JFRA 1U2WA 3HIFA 3TO7A 4A2UA 5KK1A 4BNCA 1K79A 3F21A 1XSDA 4CXFA 5D5VB 3LA3A 3F6OA 3WTSC 3CUOA 4PCQA 4XLNF 2QBYA 4HV6A 2LSOA 2V9VA 4P55A 3MCZA 1K78B 1STZA 2P6SA 1H9GA 3DPLC 4LG0B 2FQ3A 2IW5A 4AIHA 1KQ0A 3T5XA 4DQ2A 2M87A 4EM1A 2ACJA 3T8TA 1SMTA 3CTAA 2QZ8A 1ZLKA 1F1ZA 1RNLA 3WTZA 4GGGA 2VBXA 2ETHA 2D45A 2UWMA 3TO6A 1W7PA 3D0SA 4RB1A 1YW9A 1TBXA 5HLIA 3KEOA 2EFWA 2M8EA 2BYVE 5LEJA 3O3KA 1WQ2A 2HTJA 3EQLF 1KQ8A 3M9AA 1YW7A 1H0MA 3IKTA 2K7LA 3BJ6A 2O3FA 1WWXA 2DLLA 5DEQA 3EYYA 3KP7A 1USTA 1YQAA 2FA5A 5FFZA 3KCCA 5E18F 4O5VA 2OQGA 3L00A 1D8JA 3WTYC 2O61A 3JTHA 1SD5A 5ILVA 2AXLA 5D6EA 3J80K 1B1BA 5IT9K 4ENNA 2HWVA 4TV7A 2K86A 2EA4A 2F2EA 3WTXC 3LAPA 2Z5UA 2FBHA 4M9XA 2CYYA 2QBYB 1UFMA 1R00A 5A2QZ 2E7XA 3PQJA 3GFIA 4RGXA 3O6BB 1ZGAA 1LDKB 4EJOA 5K5QA 3ZMZA 3L9FA 2VC0A 3TOBA 5HDNA 4EGZA 2PG4A 3RIRA 1WKMA 1W7PD 1FLIA 2IA0A 1WRJA 3T0YA 3WGHA 5LBQA 4BYYA 4LK1F 1HW5A 1DDNA 2QQAA 1TNSA 2ESHA 1W7PB 1KU3A 2MLGA 4L9VA 1ON1A 4I7HA 4R8HA 2HKOA 2LNBA 2DK8A 4ENJA 4RGRA 5LGNA 1FYMA 3ROUA 1YTYA 3HRSA 2QUFA 2J5PA 1V3FA 4IXAA 3BP8A 1XDUA 4LFUA 1FX7A 2D2WA 2MLKA 2IA2A 1UHMA 2VBWA 2DAOA 2JZYA 1UHWA 3DV8A 4WK8F 2ZXJA 2X0LA 2ZKZA 2ZMEA 3V4GA 4Q4ZF 2QQ9A 5JR3A 1BC7C 3OV8A 1AOYA 4R1HA 4Q47A 4JK1X 3JW4A 4KUMA 2V1XA 3WTVC 2PN6A 4GXOA 1RUOA 4BQAA 5DUIA 1UB9A 1SMYF 3WTWC 4HF1A 3DXJF 1OR7A 1JHHA 1IRFA 3D5LA 1IUYA 1P4XA 3K1NA 5LGUA 2KIUA 3GZ5A 3C18A 1PP7U 2WTEA 5H6QA 2GZWA 3C1DA 4G9YA 2UZKA 2OQRA 3P9CA 1PUEE 4ZH4F 2GXBA 3Q9SA 1FY7A 3L2CA 1KGSA 5D5WB 2P6TA 2DTRA 3HTSB 4EM0B 1DPRA 2WV0A 1FBQA 1OYYA 2ZMEB 2RGVA 4WXDA 1IXSB 4I0BA 4R79A 1GVJA 1R23A 2KIFA 1HSTA 1HW2A 1PDNC 2EFNA 2L02A 3R0JA 4I2OA 2XASA 5K5OA 4HOBA 5ICCA 2MA3A 1J7KA 3FXQA 2CWEA 4WCGA 3JSPA 5J8CA 2NYXA 2VT3A 1YO5C 1ON2A 4LJZF 2JPBA 1JGSA 2OBPA 3K1MA 2VBYA 2A3SA 4UNOA 1U78A 5JVTA 3EDPA 4BHPA 1REPC 1ODDA 1QPMA 3ZMVA 2XHKA 1EH8A 3LWFA 2Y75A 3GZ6A 5HLGA 1T0FA 1ZLJA 2L54A 2KJBA 5CJ9A 3ECHA 4HF2A 1SFUA 3M7GA 2EFPA 3TOAA 4LB5A 1B4AA 4ZYEA 2GIVA 4G6DA 1OMIA 5ICFA 5F64A 1FSEA 3V8LA 4YIFA 2ZNZA 2A6EF 4HLYA 3JAMK 1ZRDA 5LRRA 2GA1A 3ZMDA 5D4SA 3V7RA 2MBFA 2R3SA 4A6EA 1FP1D 2FNPA 5BPIA 3DQVC 4IRHA 4CO8A 3M8FA 4RB3C 4M9ZA 3ZPLA 2Z3YA 3VFZA 5J8FA 3HOSA 2PLYA 3IRRA 3U2RA 2CQKA 3E6DA 2Q0OA 3HHHA 1P2FA 3R6SA 1O7LA 4M71A 1IXCA 2XV4S 4XSXF 2FMLA 4GYIA 1E17A 3LA7A 3GXOA 2O03A 2P8TA 1P4AA 4BHCA 3GWZA 4EVIA 3HSEA 3FHZA 4XLPF 2QWWA 2MC3A 3FXRA 3WGGA 4L0YB 2FU4A 3FMRA 1J59A 3H3ZA 3BY6A 1J5YA 1U8RA 2H6CA 1FSHA 5ICEA 3QU6A 2F5CA 4EM2A 5LHGA 5HDKA 2CFXA 1O3TA 2K27A 3HRMA 3L7WA 1CF7A 1QZZA 1QO0D 3BWGA 3EETA 4I01A 4Y13A 3V8JA 1UCRA 1KA8A 3IRQA 4ENKA 4GYGA 3W6KB 5ILSA 4M72A 2F5FA 4EMSA 1I5ZA 3ISPA 3TDZC 1S7OA 1P92A 4LLGF 5ED4A 4A5MA 4KICA 3VB2A 2AS5F 5E8IA 3N97A 1HQCA 1T38A 3I5UA 1BI1A 5IT9Z 4Q48A 1SFXA 1BI2A 3HSRA 4OINF 5AONA 4OIPF 5L3CA 4H0EA 2V6CA 4L9NA 3BZ6A 2HYGD 3KEQA 1S8NA 5L3EA 3DF8A 2FRHA 4N9HA 2P5VA 1R1UA 4HA8A 1Q1HA 3CLOA 4EQQA 2K02A 1D8KA 4UHTA 3KP4A 3BPXA 3BJOA 1YG2A 3KFWX 2ZFWA 2GAUA 2Q8KA 2MD5A 3E5XA 2EA2A 1J2XA 4RGSA 1CF7B 1HXDA 3FM3A 5DCMA 2HGCA 3WODF 3J81Z 4MQVA 2VONA 1K6OA 2XAHA 3RYPA 1JE8A 1BM9A 1XDSA 3QP6A 2W84A 2IVMA 2OA4A 3GVAA 4EV0A 3BDDA 1ZARA 4ZYGA 3ELKA 1KU9A 1DUXC 1FZPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7J A;  1YFH A;  3SHF A;  1B9M A;  4DNC A;  3QP5 A;  1U6G A;  1LEB A;  5LLQ A;  1OYW A;  3MZY A;  5H20 A;  2DPD A;  1G3W A;  3REO A;  1LDJ A;  3GFJ A;  1ZG3 A;  2VBZ A;  2GQQ A;  2DQR A;  2P7C B;  4U0W A;  1BBY A;  2YX7 A;  3F8F A;  2NNN A;  1OKR A;  2FF4 A;  1HKQ A;  2EFO A;  2OAZ A;  1J9I A;  4PGG A;  1XD7 A;  3KP5 A;  2QEN A;  1Z6T A;  3FX3 A;  3NQO A;  4WXH A;  1S3J A;  3TKY A;  5HLH A;  1ZRF A;  2ZNY A;  2RKH A;  4G7Z F;  5TRD A;  3V8K A;  4HAM A;  4EJU A;  1IN7 A;  4GO1 A;  3ML6 A;  3KLO A;  3TGN A;  1YYV A;  4ZYD A;  5DCM B;  3G73 A;  4CGZ A;  2FSW A;  3P9K A;  4U0Y A;  2DQL A;  4AVP A;  1LQ1 A;  2A61 A;  4YII A;  3RKW A;  1KU7 A;  3OOP A;  2LF7 A;  1C0W A;  2UXN A;  2RN7 A;  2BE5 F;  2H6B A;  2OZ6 A;  4QWQ A;  2J5O A;  1RUN A;  4M73 A;  1FNN A;  5HS9 A;  2YPR A;  3SFZ A;  4IHS A;  3K2Z A;  1ZH5 A;  2W57 A;  3LFK A;  5J6X A;  5LRS A;  1PP8 F;  3IWZ A;  4AIJ A;  3EYI A;  2B0L A;  4XRF A;  2DW4 A;  2ELH A;  2L4M A;  5FB2 A;  3BRO A;  1Z1D A;  2HZT A;  3KZZ A;  1T2K A;  2ADU A;  4L18 B;  2EWN A;  3KLN A;  2XRO A;  1S29 A;  2YX4 A;  1FC3 A;  4MEY F;  1XGM A;  1B9N A;  1Z9C A;  2EK5 A;  1G3T A;  2L4A A;  1XGO A;  2UXX A;  5AIP A;  3I53 A;  3RPQ A;  2XAG A;  4I02 A;  4ZYH A;  1SAX A;  1R36 A;  1R5H A;  2JT1 A;  4S04 A;  4HYE A;  3M8E A;  2G7H A;  2HDC A;  2RVC A;  1MJA A;  3WTU C;  1LEA A;  1Z91 A;  2FE3 A;  2XAQ A;  4OIO F;  3GFL A;  2ISY A;  2FOK A;  5AIQ A;  1ONV A;  2H27 A;  4I09 A;  4MGR A;  3Q9V A;  2JSC A;  3F3X A;  3KP6 A;  5CLS A;  4RB0 A;  2A68 F;  1LDD A;  2STT A;  1A04 A;  3T1B A;  2STW A;  4O3M A;  1G4D A;  2Z33 A;  1XMA A;  4HDU A;  4HF0 A;  3QAH A;  4KT5 C;  3ZMS A;  4ASN A;  4XBF A;  4RB2 C;  5A2Q K;  3FM5 A;  1FYL A;  2Y48 A;  2P7V B;  2K4B A;  1Z7U A;  3J7A O;  3I54 A;  1K7A A;  1R58 A;  4G6Q A;  3R4K A;  2LDU A;  2NRA C;  2RQP A;  1BC8 C;  2EFQ A;  3V7C A;  3QRF F;  3ZP5 A;  2V79 A;  4CYD A;  4KMF A;  5JHU A;  4UVB A;  1J0R A;  5E8G A;  1SD4 A;  1ZYR F;  2O6G E;  1GHC A;  4KIB A;  2ZJ2 A;  1EH7 A;  4YFX F;  5DCF A;  1YS7 A;  3U9G A;  4KN4 X;  5LEK A;  2XRN A;  1JHF A;  1Y0U A;  4NB5 A;  3LQR A;  4A5N A;  1IN8 A;  2PQ8 A;  3RDI A;  4U7B A;  3ZN0 A;  1FT9 A;  4WF2 A;  5K1Y A;  1F9N A;  1XB4 A;  1XSX A;  3F72 A;  2GA2 A;  3TO9 A;  1IN6 A;  4M74 A;  4PDK A;  3CO6 C;  2E7W A;  4ZZD A;  1ZN2 A;  2H09 A;  4P9F A;  4LMY A;  5FLX Z;  4BHB A;  3ZQ7 A;  5IT3 A;  2XGX A;  2BBY A;  4ETS A;  5FFX A;  5D4R A;  1TQI A;  2M45 A;  3KP2 A;  3MWM A;  2WC2 A;  1XMK A;  1TTY A;  2DI3 A;  2EV5 A;  2PMU A;  4UUV A;  3K9T A;  2VOP A;  3VOD A;  1MKM A;  3HUG A;  1GXP A;  2CGP A;  1QGP A;  1TQM A;  3GUD A;  2ISZ A;  5CVV A;  3F23 A;  2HEO A;  2FBK A;  4HX7 A;  2PMH A;  3ZMT A;  4HX8 A;  2QM3 A;  1ULY A;  1IN4 A;  5L3D A;  3WE2 A;  3ZMU A;  4UV8 A;  1OYI A;  5CVJ A;  2M30 A;  4HZF A;  2QYO A;  5BQT A;  2VN2 A;  3K1P A;  4N9I A;  4OOI A;  2F5E A;  4KDP A;  1XN7 A;  5L3B A;  1QNT A;  1VTN C;  2JPC A;  4OIR F;  3IL2 A;  1V4R A;  1YLF A;  2XAJ A;  2X4H A;  1F4K A;  1BIA A;  4ESJ A;  1FOK A;  5LHH A;  3ZN1 A;  4JBA A;  4ZZL A;  2NS0 A;  2HKX A;  1KQ9 A;  1L3L A;  2ZO4 A;  1ZG1 A;  4FT8 A;  3HRT A;  3FF5 A;  2G7U A;  5ICG A;  1Z05 A;  3I64 A;  4EGY A;  3RI4 A;  3IHU A;  1G3Y A;  1I27 A;  4FX0 A;  2D1H A;  4MEX F;  6PAX A;  4ENM A;  3RTR A;  3I71 A;  5D5X B;  2PFB A;  3E5Q A;  1T6S A;  1XGN A;  2DK5 A;  3KE2 A;  5E1W A;  1YIO A;  2GXG A;  4A12 A;  4IRG A;  1FP2 A;  5ERI A;  4PZJ A;  1T39 A;  1SFE A;  3BOQ A;  2P4W A;  3SXY A;  4L9J A;  3J80 Z;  1SD7 A;  2W25 A;  5TJJ A;  2QLZ A;  4EJW A;  2FMY A;  1G3S A;  2Z99 A;  1QQI A;  2RV8 A;  1IZ1 A;  4MNU A;  3U1D A;  2ESN A;  1P6R A;  1MDM A;  3RKX A;  4LLN A;  2ZBK A;  1L0O C;  2OD5 A;  4MQ9 F;  2KKO A;  1G6N A;  1H9T A;  3HYI A;  3CUQ A;  1HW1 A;  2IT0 A;  5DV5 A;  1HKT A;  2IA1 A;  4KA4 A;  4IJA A;  3QPT A;  3WU0 A;  4O6J A;  3Q5F A;  2FXA A;  3L09 A;  1XCB A;  1GXQ A;  3KET A;  4M9S A;  3N4M A;  3H92 A;  2E1C A;  1P4W A;  3SQN A;  5CVI A;  4LLL A;  2IP2 A;  3MFK A;  1KYZ A;  4RAY A;  5L3G A;  2K4J A;  2CG4 A;  4BAY A;  4HLX A;  2R7F A;  3EUH A;  4LK0 F;  2NAZ A;  4B09 A;  4HV5 A;  3GW2 A;  2VOO A;  2VE9 A;  2QVO A;  3FWE A;  3BJA A;  1BI0 A;  4IVN A;  2O8X A;  3WE3 A;  1T98 A;  1SD6 A;  5BOX A;  3GLX A;  3COA C;  5BPD A;  3B73 A;  4WX9 A;  2L01 A;  5D5U B;  2DPU A;  1I6X A;  1DPU A;  4UV9 A;  3CUQ C;  1NHA A;  4RGU A;  1KYW A;  2H94 A;  3E97 A;  5DDG A;  2YR2 A;  5CYV A;  3FXU A;  1W5S A;  1B59 A;  2RNJ A;  1LVA A;  1W5T A;  5L3F A;  3SZP A;  3G3Z A;  2OU2 A;  1I1S A;  1MDM B;  3F8M A;  4G8X A;  4IRI A;  3ERE D;  5DD4 A;  5DUK A;  5F6F A;  1MZB A;  1YW8 A;  3CUQ B;  1XSV A;  3WTT C;  5D8K B;  4LD5 A;  4YG2 F;  2XKO A;  2HR3 A;  3DFG A;  4WWC A;  4HQE A;  2DU9 A;  1U5T A;  5JI6 A;  3QU3 A;  4LB6 B;  3E5U A;  2G9W A;  4LGW A;  2HQN A;  4OMY A;  4JQF A;  3MQ0 A;  4OMZ A;  4P96 A;  2XAF A;  3W6J B;  2E1N A;  3ULQ B;  3KP3 A;  5E17 F;  3QPH A;  4KN7 X;  1D5V A;  1D3Y A;  1B6A A;  2EB7 A;  2L3D A;  1U3E M;  2IRF G;  2VXZ A;  3HTU A;  5D6F A;  4KIF A;  1XCV A;  1FWZ A;  4AIK A;  3NRV A;  3S2W A;  4L0Z B;  3O2P E;  4Z2Y A;  3WGI A;  2HTS A;  1R1V A;  4FHT A;  4AD9 A;  1ZRC A;  4E70 A;  4CZZ A;  2CW0 F;  3IC7 A;  1TLH B;  1U5T C;  2EV0 A;  3R0A A;  1OPC A;  3GO5 A;  5D8L B;  1R5G A;  3E6B A;  3FMQ A;  1I1G A;  4WXC A;  5EEH A;  1O3R A;  1RI7 A;  2KJC A;  2MH9 A;  3TDU C;  1IN5 A;  3J81 K;  1E2X A;  3CDH A;  3RPU A;  1O3Q A;  4AWX B;  4N0B A;  1U5T B;  3I59 A;  5HDG A;  1R7J A;  1R22 A;  3QOP A;  3C3W A;  1BI3 A;  2YSR A;  2R7D A;  2TDX A;  4MHG A;  4ESB A;  3DEU A;  4CDG A;  1IF1 A;  1XGS A;  3CO7 C;  3DPT A;  2Q2E A;  5EEG A;  3JAM Z;  4G7H F;  2C6Y A;  2DBB A;  2A6H F;  1FYK A;  3K69 A;  3F6V A;  1TW2 A;  1TQP A;  4HX4 A;  4KFC A;  1S7A A;  4UXN A;  3PQK A;  2V1D A;  1DP7 P;  2HFH A;  1IXR C;  2GWR A;  4KNY A;  3R61 A;  1HBX G;  2IPQ X;  2COM A;  2M5W A;  1O57 A;  2OZU A;  1BOA A;  1FBS A;  1AWC A;  1J75 A;  4MTD A;  3LQQ A;  2BEO A;  1EV7 A;  4NHJ A;  4L5I A;  1EH6 A;  3LA2 A;  4Y17 A;  3I59 B;  5E1X A;  4QLC U;  2CSO A;  4FX4 A;  4F7Z A;  2M1B A;  1RZ4 A;  4HDV A;  5CVU A;  2MH2 A;  2VOD A;  3T8R A;  2NNY A;  3VOE A;  3VEP A;  2YU3 A;  1ZRE A;  3P7N A;  3WU1 B;  3MZH A;  1IAW A;  1CGP A;  2LKP A;  2IJL A;  1TW3 A;  4GCV A;  1QZY A;  1W4M A;  2RDP A;  4KMU X;  3H3U A;  4I0A A;  3ABU A;  2RC4 A;  3AAF A;  4IF4 A;  3LAJ A;  3HSF A;  5FGM A;  5LGT A;  3BPV A;  4M6X A;  3SZT A;  4K2E A;  5E20 A;  1KU2 A;  4A0X A;  4P9U A;  1BJA A;  3ECO A;  2KRF A;  3HOT A;  1LJ9 A;  5CVR A;  3E6C C;  3F22 A;  4B8X A;  3E3V A;  4L9T A;  2ZCW A;  4HW0 A;  3B02 A;  3LST A;  3MAJ A;  1X3U A;  5ILU A;  3GX4 X;  5K5R A;  4A0Y A;  1Z6R A;  3GYH X;  4G94 A;  2PI0 A;  3DP7 A;  4OU0 A;  1O7F A;  2HS5 A;  2Y0M A;  1ZAO A;  4U88 A;  2EV6 A;  3RJP A;  4BXU A;  2Z9O A;  3IWF A;  4EJV A;  4OIQ F;  2XIG A;  3NEU A;  1WSU A;  2A69 F;  1ZGJ A;  1MJ9 A;  3JSO A;  4CIC A;  5HOO A;  4ON0 A;  4CHU A;  2JRT A;  2PBI A;  1MGT A;  4M6Y A;  1HKS A;  1QBJ A;  2W85 A;  4Y15 A;  1TNT A;  2A07 F;  3DKW A;  4U7D A;  4U0V A;  1MD0 A;  4A0Z A;  5BS6 A;  3R60 A;  2DFI A;  5E1Z B;  3F8N A;  4I98 B;  4RS8 A;  1LB2 A;  3I58 A;  3TQN A;  4P5O A;  3RKY A;  2VE8 A;  4S05 A;  2DT5 A;  3GEZ A;  2HOE A;  5LHI A;  2CO5 A;  1ZHF A;  1USS A;  4RAZ A;  1RIO H;  4PGH A;  2V1U A;  1BN5 A;  3FZV A;  4BH9 A;  4MTE A;  2QQB A;  3KZY A;  1S6L A;  3V7S A;  5HS7 A;  5FD6 A;  2LF8 A;  1HSJ A;  5FO5 A;  5DD8 A;  2XVC A;  2VC1 A;  3HHG A;  1JXS A;  2PEX A;  3GF2 A;  3E6M A;  4KYW A;  3CJN A;  4D0P A;  4UVA A;  4NQW A;  5FD5 A;  2KIM A;  2F5D A;  3F8C A;  4EJT A;  3PFI A;  5KVR A;  4ESF A;  1YS6 A;  4A6D A;  4IHT A;  5HVQ C;  3FMS A;  2JTV A;  1K78 A;  2VT2 A;  3IKV A;  2P5K A;  3I4P A;  1BIB A;  5HS8 A;  4LG0 A;  2XUB A;  2A5Y B;  3F8B A;  4YFN F;  3I0T A;  3MEX A;  5BMZ A;  4Q5S F;  4G7O F;  4XSZ F;  2HQR A;  5DYM A;  2O0Y A;  2W24 A;  3ABT A;  2D1V A;  1O3S A;  4KIG A;  4HBL A;  2WWY A;  1LNW A;  4YFK F;  1IRG A;  3P9I A;  1FBU A;  1F5T A;  4HQM A;  5F1R A;  3K0L A;  2DO7 A;  2HYF A;  5H6R A;  2XKP A;  4UVC A;  3HRU A;  5FLX K;  1R1T A;  2FNA A;  1MJB A;  2FBI A;  2FEZ A;  3WG9 A;  1IW7 F;  2P5L C;  3M1E A;  2BV6 A;  4IPA A;  3RYR A;  1ZG5 A;  2EJR A;  3GFM A;  4L5J A;  1WI9 A;  2PJP A;  3JTG A;  2BGC A;  1FPQ A;  5JFR A;  1U2W A;  3HIF A;  3TO7 A;  4A2U A;  5KK1 A;  4BNC A;  1K79 A;  3F21 A;  1XSD A;  4CXF A;  5D5V B;  3LA3 A;  3F6O A;  3WTS C;  3CUO A;  4PCQ A;  4XLN F;  2QBY A;  4HV6 A;  2LSO A;  2V9V A;  4P55 A;  3MCZ A;  1K78 B;  1STZ A;  2P6S A;  1H9G A;  3DPL C;  4LG0 B;  2FQ3 A;  2IW5 A;  4AIH A;  1KQ0 A;  3T5X A;  4DQ2 A;  2M87 A;  4EM1 A;  2ACJ A;  3T8T A;  1SMT A;  3CTA A;  2QZ8 A;  1ZLK A;  1F1Z A;  1RNL A;  3WTZ A;  4GGG A;  2VBX A;  2ETH A;  2D45 A;  2UWM A;  3TO6 A;  1W7P A;  3D0S A;  4RB1 A;  1YW9 A;  1TBX A;  5HLI A;  3KEO A;  2EFW A;  2M8E A;  2BYV E;  5LEJ A;  3O3K A;  1WQ2 A;  2HTJ A;  3EQL F;  1KQ8 A;  3M9A A;  1YW7 A;  1H0M A;  3IKT A;  2K7L A;  3BJ6 A;  2O3F A;  1WWX A;  2DLL A;  5DEQ A;  3EYY A;  3KP7 A;  1UST A;  1YQA A;  2FA5 A;  5FFZ A;  3KCC A;  5E18 F;  4O5V A;  2OQG A;  3L00 A;  1D8J A;  3WTY C;  2O61 A;  3JTH A;  1SD5 A;  5ILV A;  2AXL A;  5D6E A;  3J80 K;  1B1B A;  5IT9 K;  4ENN A;  2HWV A;  4TV7 A;  2K86 A;  2EA4 A;  2F2E A;  3WTX C;  3LAP A;  2Z5U A;  2FBH A;  4M9X A;  2CYY A;  2QBY B;  1UFM A;  1R00 A;  5A2Q Z;  2E7X A;  3PQJ A;  3GFI A;  4RGX A;  3O6B B;  1ZGA A;  1LDK B;  4EJO A;  5K5Q A;  3ZMZ A;  3L9F A;  2VC0 A;  3TOB A;  5HDN A;  4EGZ A;  2PG4 A;  3RIR A;  1WKM A;  1W7P D;  1FLI A;  2IA0 A;  1WRJ A;  3T0Y A;  3WGH A;  5LBQ A;  4BYY A;  4LK1 F;  1HW5 A;  1DDN A;  2QQA A;  1TNS A;  2ESH A;  1W7P B;  1KU3 A;  2MLG A;  4L9V A;  1ON1 A;  4I7H A;  4R8H A;  2HKO A;  2LNB A;  2DK8 A;  4ENJ A;  4RGR A;  5LGN A;  1FYM A;  3ROU A;  1YTY A;  3HRS A;  2QUF A;  2J5P A;  1V3F A;  4IXA A;  3BP8 A;  1XDU A;  4LFU A;  1FX7 A;  2D2W A;  2MLK A;  2IA2 A;  1UHM A;  2VBW A;  2DAO A;  2JZY A;  1UHW A;  3DV8 A;  4WK8 F;  2ZXJ A;  2X0L A;  2ZKZ A;  2ZME A;  3V4G A;  4Q4Z F;  2QQ9 A;  5JR3 A;  1BC7 C;  3OV8 A;  1AOY A;  4R1H A;  4Q47 A;  4JK1 X;  3JW4 A;  4KUM A;  2V1X A;  3WTV C;  2PN6 A;  4GXO A;  1RUO A;  4BQA A;  5DUI A;  1UB9 A;  1SMY F;  3WTW C;  4HF1 A;  3DXJ F;  1OR7 A;  1JHH A;  1IRF A;  3D5L A;  1IUY A;  1P4X A;  3K1N A;  5LGU A;  2KIU A;  3GZ5 A;  3C18 A;  1PP7 U;  2WTE A;  5H6Q A;  2GZW A;  3C1D A;  4G9Y A;  2UZK A;  2OQR A;  3P9C A;  1PUE E;  4ZH4 F;  2GXB A;  3Q9S A;  1FY7 A;  3L2C A;  1KGS A;  5D5W B;  2P6T A;  2DTR A;  3HTS B;  4EM0 B;  1DPR A;  2WV0 A;  1FBQ A;  1OYY A;  2ZME B;  2RGV A;  4WXD A;  1IXS B;  4I0B A;  4R79 A;  1GVJ A;  1R23 A;  2KIF A;  1HST A;  1HW2 A;  1PDN C;  2EFN A;  2L02 A;  3R0J A;  4I2O A;  2XAS A;  5K5O A;  4HOB A;  5ICC A;  2MA3 A;  1J7K A;  3FXQ A;  2CWE A;  4WCG A;  3JSP A;  5J8C A;  2NYX A;  2VT3 A;  1YO5 C;  1ON2 A;  4LJZ F;  2JPB A;  1JGS A;  2OBP A;  3K1M A;  2VBY A;  2A3S A;  4UNO A;  1U78 A;  5JVT A;  3EDP A;  4BHP A;  1REP C;  1ODD A;  1QPM A;  3ZMV A;  2XHK A;  1EH8 A;  3LWF A;  2Y75 A;  3GZ6 A;  5HLG A;  1T0F A;  1ZLJ A;  2L54 A;  2KJB A;  5CJ9 A;  3ECH A;  4HF2 A;  1SFU A;  3M7G A;  2EFP A;  3TOA A;  4LB5 A;  1B4A A;  4ZYE A;  2GIV A;  4G6D A;  1OMI A;  5ICF A;  5F64 A;  1FSE A;  3V8L A;  4YIF A;  2ZNZ A;  2A6E F;  4HLY A;  3JAM K;  1ZRD A;  5LRR A;  2GA1 A;  3ZMD A;  5D4S A;  3V7R A;  2MBF A;  2R3S A;  4A6E A;  1FP1 D;  2FNP A;  5BPI A;  3DQV C;  4IRH A;  4CO8 A;  3M8F A;  4RB3 C;  4M9Z A;  3ZPL A;  2Z3Y A;  3VFZ A;  5J8F A;  3HOS A;  2PLY A;  3IRR A;  3U2R A;  2CQK A;  3E6D A;  2Q0O A;  3HHH A;  1P2F A;  3R6S A;  1O7L A;  4M71 A;  1IXC A;  2XV4 S;  4XSX F;  2FML A;  4GYI A;  1E17 A;  3LA7 A;  3GXO A;  2O03 A;  2P8T A;  1P4A A;  4BHC A;  3GWZ A;  4EVI A;  3HSE A;  3FHZ A;  4XLP F;  2QWW A;  2MC3 A;  3FXR A;  3WGG A;  4L0Y B;  2FU4 A;  3FMR A;  1J59 A;  3H3Z A;  3BY6 A;  1J5Y A;  1U8R A;  2H6C A;  1FSH A;  5ICE A;  3QU6 A;  2F5C A;  4EM2 A;  5LHG A;  5HDK A;  2CFX A;  1O3T A;  2K27 A;  3HRM A;  3L7W A;  1CF7 A;  1QZZ A;  1QO0 D;  3BWG A;  3EET A;  4I01 A;  4Y13 A;  3V8J A;  1UCR A;  1KA8 A;  3IRQ A;  4ENK A;  4GYG A;  3W6K B;  5ILS A;  4M72 A;  2F5F A;  4EMS A;  1I5Z A;  3ISP A;  3TDZ C;  1S7O A;  1P92 A;  4LLG F;  5ED4 A;  4A5M A;  4KIC A;  3VB2 A;  2AS5 F;  5E8I A;  3N97 A;  1HQC A;  1T38 A;  3I5U A;  1BI1 A;  5IT9 Z;  4Q48 A;  1SFX A;  1BI2 A;  3HSR A;  4OIN F;  5AON A;  4OIP F;  5L3C A;  4H0E A;  2V6C A;  4L9N A;  3BZ6 A;  2HYG D;  3KEQ A;  1S8N A;  5L3E A;  3DF8 A;  2FRH A;  4N9H A;  2P5V A;  1R1U A;  4HA8 A;  1Q1H A;  3CLO A;  4EQQ A;  2K02 A;  1D8K A;  4UHT A;  3KP4 A;  3BPX A;  3BJO A;  1YG2 A;  3KFW X;  2ZFW A;  2GAU A;  2Q8K A;  2MD5 A;  3E5X A;  2EA2 A;  1J2X A;  4RGS A;  1CF7 B;  1HXD A;  3FM3 A;  5DCM A;  2HGC A;  3WOD F;  3J81 Z;  4MQV A;  2VON A;  1K6O A;  2XAH A;  3RYP A;  1JE8 A;  1BM9 A;  1XDS A;  3QP6 A;  2W84 A;  2IVM A;  2OA4 A;  3GVA A;  4EV0 A;  3BDD A;  1ZAR A;  4ZYG A;  3ELK A;  1KU9 A;  1DUX C;  1FZP B; 
#chains in the Genus database with same CATH topology
 2XSD C;  2CW8 A;  2L0K A;  1GVD A;  3C7J A;  1YFH A;  1MBG A;  3SHF A;  4MLO A;  1B9M A;  4DNC A;  3QP5 A;  1U6G A;  1LEB A;  1XTA A;  5LLQ A;  1TWC J;  1OYW A;  1Z3X A;  5J1R A;  2R5Z B;  3MZY A;  5H20 A;  2DPD A;  4BXX J;  2HVQ A;  1G3W A;  3REO A;  1LDJ A;  4LG3 A;  1IRZ A;  3GFJ A;  4XR6 A;  1ZG3 A;  2VBZ A;  2GQQ A;  2DQR A;  2P7C B;  1IRX A;  4U0W A;  3S14 J;  1BBY A;  2I5U A;  2YX7 A;  1OCP A;  3F8F A;  5K7F A;  2NNN A;  1OKR A;  4XKV A;  2ELK A;  2DA2 A;  3BLY A;  2FF4 A;  1HKQ A;  2MG4 A;  2E5N A;  2EFO A;  2OAZ A;  1J9I A;  3M8J A;  4PGG A;  2KT0 A;  2V7F A;  3X2Q H;  1XD7 A;  3H3V K;  2WV1 A;  3KP5 A;  5B1A H;  2P81 A;  2QEN A;  1Z6T A;  3AKZ A;  2Y0S A;  4XLE A;  2YUS A;  3QPS A;  2D5V A;  2CFO A;  4BGD A;  3I4M J;  3FX3 A;  3NQO A;  4WXH A;  1S3J A;  2CQN A;  3TKY A;  5HLH A;  1ZRF A;  2H1K A;  3NWT A;  4ANJ A;  2ZNY A;  2RKH A;  3BTI A;  4G7Z F;  5TRD A;  3V8K A;  4HAM A;  4EJU A;  3DBL B;  1IN7 A;  4GO1 A;  3W2V A;  4DZJ A;  1UEL B;  2H1L A;  3OYL A;  1U8B A;  2ZC2 A;  2VJJ A;  1WI3 A;  2LC2 A;  1LKX A;  2E1M B;  3HKZ N;  3ML6 A;  3CJR B;  4PK4 A;  3KLO A;  4LIT A;  1W0U A;  3I55 I;  2NOJ B;  4NDL A;  1XG1 A;  3TGN A;  4A3B J;  4X0G A;  1YYV A;  4ZYD A;  2Z1D A;  3S17 J;  5DCM B;  3SEQ A;  3TL4 X;  3G73 A;  4CGZ A;  4CCN A;  2AO9 A;  4XL9 A;  2CS3 A;  3GTK J;  1VQK I;  1SFO J;  3PUF A;  3CF2 A;  2FSW A;  3P9K A;  4FIS A;  3MZ8 A;  3CCE I;  4G6T B;  4U0Y A;  2DQL A;  4AVP A;  2DJI A;  1PUF B;  3PIP F;  1LQ1 A;  4JYK A;  2A61 A;  2YS9 A;  4YII A;  4G12 A;  3RKW A;  3OOP A;  2LP0 A;  4CSW A;  1YIT I;  3TMO A;  1KU7 A;  5KNL A;  4ITV A;  2LF7 A;  5FKN A;  2LH9 A;  1R9T J;  4XRM A;  1C0W A;  1MMN A;  4U87 A;  4CCJ A;  1YX5 A;  3DLL F;  2UXN A;  5FKL A;  2QF7 A;  2RN7 A;  2BE5 F;  2VIX A;  2H6B A;  4FET A;  3KEY A;  3LSP A;  3W6V A;  2OZ6 A;  4QWQ A;  2J5O A;  1TL8 A;  2ZJQ F;  4HNV A;  2FQ4 A;  1RUN A;  3MKL A;  4M73 A;  3M07 A;  1ERD A;  4LIV A;  1FNN A;  5HS9 A;  2DA3 A;  2YPR A;  3SFZ A;  1E0E A;  4IHS A;  2JN6 A;  1XS9 A;  3K2Z A;  5M5Y J;  3OYH A;  4BXF A;  2W57 A;  4J19 A;  1ZH5 A;  4NC8 A;  4C2U A;  3LFK A;  2VUM J;  5KHD A;  5J6X A;  2DDB A;  5LRS A;  1K4S A;  1PP8 F;  3IWZ A;  4AIJ A;  4XRS G;  2JUC A;  4ZYA A;  4FAS D;  1IGN A;  2LY1 A;  1LUJ B;  1XX5 A;  3EYI A;  2B0L A;  4XRF A;  2DA7 A;  2ZXI A;  4HG2 A;  3ABL H;  2CUZ A;  1OFC X;  2K9N A;  4E7S A;  1TT0 A;  2DW4 A;  2OF7 A;  2CMP A;  2ELH A;  5IP7 J;  2L4M A;  2KDO A;  2DA5 A;  5F08 A;  5FB2 A;  3BRO A;  3J7A Y;  1Z1D A;  2HZT A;  3KZZ A;  1T2K A;  2ADU A;  2X48 A;  4L18 B;  2XGE A;  2HYJ A;  1YOV B;  2EWN A;  3KLN A;  3ZXS A;  2XRO A;  2R7Q A;  2X6O A;  4EEF G;  5EGO A;  1S29 A;  1MBJ A;  2XPU A;  2YX4 A;  1FC3 A;  2XPW A;  4E7Z A;  2GLO A;  4MEY F;  3HBL A;  1XGM A;  2CJJ A;  5B1B H;  1B9N A;  4RLQ A;  1Z9C A;  1XPX A;  2EK5 A;  1G3T A;  2L4A A;  1XGO A;  2UXX A;  5AIP A;  3I53 A;  1PVE A;  3RPQ A;  3OYI A;  2XAG A;  1IG7 A;  4I02 A;  4ZYH A;  1I3A A;  3Q3S A;  5KAI C;  1SAX A;  2MD0 A;  4BJ6 C;  1R36 A;  1R5H A;  2JT1 A;  3LSM A;  4S04 A;  1EJ9 A;  2LG4 A;  1FIP A;  4A3L J;  4HYE A;  3M8E A;  2G7H A;  4MIM A;  2HDC A;  2QCO A;  2RVC A;  4X6A J;  2LY9 A;  1MJA A;  4V2F A;  3OYA A;  3WTU C;  1LEA A;  1Z91 A;  5M5W J;  2LBF A;  1YE9 A;  3D5R C;  3OIP A;  2FE3 A;  4ZJZ A;  2NVY J;  3CCS I;  4CCO A;  2CV2 A;  2XAQ A;  3NWS A;  4OIO F;  5J3L A;  3CC4 I;  3GFL A;  4M3B A;  2ISY A;  1TWH J;  2FOK A;  3BR6 A;  5AIQ A;  2WBM A;  4IOC F;  1ONV A;  2H27 A;  3K4K A;  1X3W B;  4I09 A;  3FIW A;  4MGR A;  3Q9V A;  1A6I A;  2DOA A;  3VYS B;  2JSC A;  3HM5 A;  2OC6 A;  2B9S A;  3OYK A;  2F4I A;  3F3X A;  1GUU A;  3KP6 A;  5CLS A;  3TBI A;  3S1M J;  3HJE A;  4XKB A;  3ZCO A;  4RB0 A;  1TT5 B;  2A68 F;  2XF7 A;  1LDD A;  2STT A;  1A04 A;  1ETV A;  3T1B A;  2STW A;  4O3M A;  1G4D A;  2Z33 A;  1XMA A;  4HDU A;  2OJE D;  3GTG J;  4HF0 A;  1V5F A;  5FKO A;  3RQ4 A;  1R5I D;  3QAH A;  1YX3 A;  4KT5 C;  1X2M A;  4XKW A;  3ZMS A;  2VQG A;  3K4J A;  4ASN A;  3OR1 C;  3ZQF A;  4XBF A;  4RB2 C;  5A2Q K;  3FM5 A;  1T56 A;  3MKZ A;  1FYL A;  2P0W A;  2Y48 A;  2P7V B;  2VKE A;  3F9K A;  1G2H A;  2K4B A;  1Z7U A;  3AG4 H;  3FXK A;  3J7A O;  3I54 A;  3DPU A;  5EGO B;  4DYQ A;  1K7A A;  1R58 A;  2F48 A;  2VJ5 A;  4PJJ A;  4F92 B;  3S93 A;  4G6Q A;  3R4K A;  1UMQ A;  2LDU A;  4F93 B;  3HGY A;  2NRA C;  2RQP A;  1BC8 C;  3O8G A;  2EFQ A;  3V7C A;  2L7M P;  3QRF F;  3ZP5 A;  2V79 A;  1N25 A;  4CYD A;  4KMF A;  5JHU A;  2RRE A;  4C2M J;  4UVB A;  1J0R A;  1P9Q C;  5E8G A;  3DEE A;  1SD4 A;  1ZYR F;  2H8W A;  1YHQ I;  2O6G E;  1GHC A;  3LSH A;  4KIB A;  5J4V A;  2OTJ I;  2ZJ2 A;  2KRC A;  1EH7 A;  4Y7N J;  2BY2 A;  2LBF B;  2FD5 A;  4IHX A;  4YFX F;  3GTQ J;  4BQQ A;  5DCF A;  2N8G A;  4NC6 A;  1YS7 A;  3U9G A;  3A0H C;  4KN4 X;  5LEK A;  2KRH A;  1VQ6 I;  2MW8 A;  3DBR B;  2XRN A;  1JHF A;  1Y0U A;  4NB5 A;  2L9V A;  1ETO A;  3LQR A;  2ECB A;  2Z16 A;  4Z6Y A;  1QHG A;  5J1Y A;  2CQQ A;  4I99 C;  1NTC A;  4XN0 A;  4A5N A;  2KQR A;  1IN8 A;  2PQ8 A;  3CQZ J;  4GRI A;  3RDI A;  4RA2 A;  1TZL A;  5CKT A;  3ZN0 A;  1FT9 A;  4U7B A;  3BR1 A;  3CCM I;  4WF2 A;  1LVK A;  5K1Y A;  3RCO A;  2M7B A;  1F9N A;  1XB4 A;  1XSX A;  3F72 A;  2HXO A;  4XRS A;  2GA2 A;  2IS2 A;  3TO9 A;  1IN6 A;  4M74 A;  4PDK A;  3CO6 C;  2E7W A;  1RPW A;  1ZN2 A;  2H09 A;  4P9F A;  4ZZD A;  4LMY A;  5FLX Z;  4BHB A;  3ZQ7 A;  5FKK A;  1OQY A;  5IT3 A;  2HXI A;  2XGX A;  2BBY A;  2LRE A;  4P1W A;  4ETS A;  5FFX A;  5D4R A;  4BQO A;  1I50 J;  4PJL A;  1ZTR A;  1WJC A;  1TQI A;  2FJ1 A;  2M45 A;  5H2F C;  1AU7 A;  4IQJ A;  4MFD A;  3KP2 A;  3MWM A;  2ZXW H;  4S0H B;  1MSE C;  2WC2 A;  2K3P A;  2XF6 A;  1XMK A;  1TTY A;  2DI3 A;  2EV5 A;  5FLV A;  2PMU A;  5GTH C;  3MD2 A;  1SFK A;  2QA4 I;  4UUV A;  3K9T A;  1ZEL A;  2VOP A;  1MIJ A;  3FK6 A;  3QYE A;  3VOD A;  1MKM A;  3HUG A;  1GXP A;  1MBE A;  2CGP A;  1MND A;  1QGP A;  1TQM A;  3GUD A;  2ISZ A;  3HOY J;  5CVV A;  1BL0 A;  2W1O A;  2EZI A;  1D1A A;  3F23 A;  4JX5 A;  2FBK A;  1FJL A;  2HEO A;  4HX7 A;  4F52 A;  4RLF A;  2PMH A;  3K70 C;  3ZMT A;  4HX8 A;  4BDZ A;  2QM3 A;  1YRN A;  4RAG A;  1ULY A;  1IN4 A;  3S2H J;  5L3D A;  3WE2 A;  3ZMU A;  1MW7 A;  4UV8 A;  1OYI A;  5CVJ A;  2M30 A;  3K70 D;  4HZF A;  2QYO A;  5BQT A;  2VN2 A;  1JTY A;  3K1P A;  4ZDL A;  2XC7 A;  4NBQ A;  3BG7 A;  4N9I A;  1FOY A;  3VYU B;  2L7Z A;  3LMM A;  4BEH A;  4IQ4 A;  4OOI A;  2F5E A;  4KDP A;  1XN7 A;  5L3B A;  1QNT A;  4KIT B;  1VTN C;  5E79 C;  3PO2 J;  2JPC A;  3ESW B;  2K3F A;  4OIR F;  3IL2 A;  1IJW C;  1A35 A;  1V4R A;  3OS2 A;  1DP3 A;  1YLF A;  2XAJ A;  2OTL I;  2X4H A;  1F4K A;  3ZR8 X;  1BIA A;  3Q0W A;  4ESJ A;  1YJW I;  4BY1 J;  5IOZ A;  1FOK A;  1PYV A;  5LHH A;  1JUP A;  2ZJR F;  3CC7 I;  4AM3 A;  3ZN1 A;  4JBA A;  4FE7 A;  4ZZL A;  2NS0 A;  2HKX A;  1KQ9 A;  1L3L A;  2ZO4 A;  1ZG1 A;  1SVM A;  4L5E A;  4IHV A;  1ACI A;  3CDI A;  4FT8 A;  3HRT A;  3FF5 A;  2G7U A;  5ICG A;  1Z05 A;  3I64 A;  3IH2 A;  1LFP A;  4EGY A;  3RI4 A;  3IHU A;  1TWF J;  1G3Y A;  2VQL A;  1I27 A;  3K4L A;  4FX0 A;  2D1H A;  4HPQ A;  4MEX F;  6PAX A;  1QU3 A;  4ENM A;  3RTR A;  3I71 A;  5D5X B;  2WB1 A;  3J7Y J;  2PFB A;  3E5Q A;  1HLV A;  2HNH A;  1T6S A;  1XGN A;  2DK5 A;  3KE2 A;  3HUG B;  3I4N J;  5E1W A;  1YIO A;  3GTO J;  2GXG A;  2VJI A;  4A12 A;  2E2J J;  4IRG A;  1FP2 A;  2GBY A;  5ERI A;  3SFI A;  4PZJ A;  1RR7 A;  1SFE A;  1T39 A;  4RM2 A;  4E7H A;  3IH4 A;  4A3K J;  3BOQ A;  2P4W A;  3SXY A;  4L9J A;  3J80 Z;  3IUO A;  2CU7 A;  1SD7 A;  1K4T A;  2W25 A;  5TJJ A;  2K9S A;  3BR5 A;  2QLZ A;  2LTP A;  4EJW A;  5TGT A;  2FMY A;  1S72 I;  1G3S A;  2Z99 A;  1YRN B;  4B43 A;  1QQI A;  1VQ8 I;  1T33 A;  2RV8 A;  1I3Q J;  1IZ1 A;  4MNU A;  1VZ0 A;  2XB0 X;  2LLK A;  3U1D A;  2ESN A;  3EPZ A;  1P6R A;  4ZTF A;  1MDM A;  4A3C J;  4YEL A;  3RKX A;  2Y69 H;  1E3O C;  2W82 A;  5F0F A;  4LLN A;  2VKD A;  1L0O C;  1WJE A;  2ZBK A;  3CMY A;  2OD5 A;  4MQ9 F;  3CP8 A;  4X1E A;  4BEH B;  2V9K A;  2KKO A;  1G6N A;  3SYT A;  5GPC A;  1H9T A;  3IH3 A;  3HYI A;  3KX2 A;  3CUQ A;  3VPR A;  1JUS A;  1HW1 A;  2XF5 A;  5TIS C;  2IT0 A;  5DV5 A;  1HKT A;  2IA1 A;  4EAT A;  4KA4 A;  4IJA A;  3FXL A;  4DGW B;  2CQX A;  3QPT A;  3WU0 A;  4O6J A;  3Q5F A;  2FXA A;  3L09 A;  1W5C C;  4M3E A;  3BG3 A;  1XCB A;  1GXQ A;  2ZFU A;  5F1J A;  4M9S A;  3KET A;  1VQ7 I;  4PSW A;  3N4M A;  3H92 A;  2E1C A;  2FOW A;  2X9D A;  3QWL A;  3BCA A;  2EIM H;  1P4W A;  3SQN A;  5CVI A;  3L2U A;  2LRD A;  1I6H J;  4LLL A;  1Z77 A;  2IP2 A;  3MFK A;  1HF0 A;  1KYZ A;  4RAY A;  5L3G A;  5J47 A;  2K4J A;  2CG4 A;  2VL8 A;  4BAY A;  4HLX A;  2R7F A;  2OCC H;  1ORK A;  3EUH A;  4AC0 A;  4LK0 F;  1WJD A;  2NAZ A;  2JUG A;  4ZDO A;  4B09 A;  2BW3 A;  2L2O A;  4HV5 A;  3GW2 A;  2VOO A;  3AG3 H;  1QVT A;  1VND A;  3MN2 A;  2VE9 A;  3ZRG A;  2QVO A;  1JGG A;  3FWE A;  3BJA A;  1BI0 A;  4IVN A;  2O8X A;  3WE3 A;  3BTC A;  1O4X A;  1T98 A;  1BR1 A;  1SD6 A;  5BOX A;  4IHW A;  3GLX A;  1D5Y A;  3COA C;  5BPD A;  3B73 A;  1A6Q A;  4WX9 A;  2L01 A;  3UNG C;  3G71 I;  2R7U A;  1U9N A;  5D5U B;  2DPU A;  1I6X A;  1Y56 A;  5EF6 A;  1GT0 C;  5JLW A;  1DPU A;  2VB6 A;  3CD6 I;  3OYG A;  2VXD A;  1N75 A;  4UV9 A;  3CUQ C;  3TED A;  3RQI A;  1NHA A;  4QPQ A;  3MKW B;  4QPO A;  3W2W A;  4RGU A;  4II3 A;  1TWA J;  2GXA A;  1KYW A;  2BHY A;  2F4O B;  2H94 A;  3E97 A;  1ITY A;  3K4N A;  5DDG A;  2QEX I;  1B8I A;  2YR2 A;  3ASO H;  5CYV A;  3LSJ A;  3FXU A;  1W5S A;  1B59 A;  2RNJ A;  1LVA A;  1W5T A;  2VAS A;  4NNJ A;  3B6C A;  5L3F A;  3SZP A;  3G3Z A;  2OU2 A;  3JRG A;  1HC8 A;  1T8I A;  1I1S A;  3HZJ A;  3W2A A;  1MDM B;  3F8M A;  2BZT A;  4G8X A;  2E1M C;  3CF5 F;  2M4G A;  4IRI A;  2EIK H;  3ERE D;  5DD4 A;  3HGG A;  2HDD A;  5DUK A;  5F6F A;  1MZB A;  4QTR A;  5F0H A;  1WZ2 A;  3CUQ B;  1OIS A;  1YW8 A;  1XSV A;  2MYS A;  3BR3 A;  3EUH C;  3A02 A;  3WTT C;  5D8K B;  4LD5 A;  3BTJ A;  2O9L A;  4IOA F;  4A3I J;  3EUK L;  3IAS 2;  4YG2 F;  2HU9 A;  4A3F J;  2HVS A;  2XKO A;  2HR3 A;  3DFG A;  4D9J A;  2DCE A;  4Y3O A;  1VI0 A;  2LK2 A;  4WWC A;  3RKQ A;  1RRJ A;  1NG7 A;  2UV1 A;  2X85 A;  4HQE A;  2DU9 A;  1U5T A;  1FOW A;  5JI6 A;  3QU3 A;  4LB6 B;  1WFX A;  3E5U A;  2W7N A;  2G9W A;  1LFU P;  4LGW A;  5K7Z A;  4M3F A;  1IV8 A;  2HQN A;  4OMY A;  4JQF A;  3MQ0 A;  4OMZ A;  4P96 A;  1VQP I;  2XAF A;  2F5V A;  2BW3 B;  1G8X A;  3W6J B;  2E1N A;  2CUE A;  3ULQ B;  3KP3 A;  5E17 F;  2ID3 A;  3QPH A;  1X2N A;  4KN7 X;  5IYB J;  1D5V A;  4PSX A;  1D3Y A;  1B6A A;  2EB7 A;  2L3D A;  1U3E M;  2IRF G;  3AG2 H;  2L7K A;  2VXZ A;  2BY0 A;  3HTU A;  4BAC A;  2HQA A;  5D6F A;  4KIF A;  1XCV A;  3SJM A;  3BR2 A;  1FWZ A;  1FTT A;  5GAE J;  4AIK A;  2M4K A;  3NRV A;  3S2W A;  2HI3 A;  2R7Z J;  3KYC B;  4DJA A;  2DMT A;  2QSF X;  4L0Z B;  3O2P E;  4Z2Y A;  3WGI A;  3E1S A;  2CUJ A;  3H36 A;  2HTS A;  4C3I J;  4C30 A;  1OJL A;  4I6Z A;  1R1V A;  1B8I B;  4FHT A;  4AD9 A;  2KIS A;  4V19 K;  1ZRC A;  4BS9 A;  1E3P A;  1FMW A;  4E70 A;  4CZZ A;  2XPV A;  2DFE A;  4E7K A;  2CW0 F;  3IC7 A;  1TLH B;  3GZN B;  3KYD B;  1U5T C;  2EV0 A;  3A2K A;  3R0A A;  1OPC A;  2RAE A;  3GO5 A;  5D8L B;  5E3O A;  2GM4 A;  1R5G A;  3E6B A;  2X6Y A;  1BW6 A;  3FMQ A;  1F36 A;  1I1G A;  4WXC A;  2KLO A;  2NVU B;  5EEH A;  4A3D J;  1O3R A;  1RI7 A;  2KP6 A;  2KJC A;  4DIQ A;  2MH9 A;  3TDU C;  1IN5 A;  3CJT B;  2JMW A;  1XMX A;  3J81 K;  1E2X A;  3CDH A;  4F91 B;  1Y39 A;  3RPU A;  1ZQ3 P;  2EZH A;  1O3Q A;  4AWX B;  5CQG A;  4N0B A;  1BW5 A;  5FRN A;  2W48 A;  1U5T B;  3L2W A;  3ZQQ A;  1MMS A;  2DOE A;  3I59 A;  5HDG A;  1X1A A;  1R7J A;  4IO9 F;  1R22 A;  2Y9Y A;  3QOP A;  3C3W A;  2QQ8 A;  1BI3 A;  2L9R A;  2YSR A;  2TDX A;  2MC4 A;  2R7D A;  2MSY A;  4MHG A;  3NAU A;  1YI2 I;  1D1C A;  2NVT J;  4ESB A;  2M0M A;  3DEU A;  4CDG A;  1IF1 A;  2Y31 A;  2KL4 A;  1XGS A;  2VQH A;  3FBN B;  1OLT A;  3CO7 C;  2NXN B;  3DPT A;  2Q2E A;  5EEG A;  3JAM Z;  4G7H F;  3DCF A;  3ZQI A;  2C6Y A;  1Y6I A;  3SDG A;  3G4S I;  5M3F J;  2DBB A;  2A6H F;  1FYK A;  2EIJ H;  2X6W A;  3K69 A;  3CC2 I;  2M0C A;  3F6V A;  1TW2 A;  1TQP A;  3NAR A;  5F27 A;  4HX4 A;  3TP3 A;  4KFC A;  2HOA A;  1S7A A;  1D1B A;  3OL3 A;  4UXN A;  2CH0 A;  5FRO A;  2MAB A;  3JRE A;  4KIS A;  3HOV J;  1AHD P;  2R7S A;  5KAF C;  3PQK A;  2V1D A;  3CCU I;  5IY5 H;  3HOX J;  1DP7 P;  2HFH A;  1IXR C;  2DTZ A;  2GWR A;  2WAE A;  3KPH A;  4KNY A;  3R61 A;  3JR9 A;  1MMD A;  1HBX G;  3FKJ A;  2IPQ X;  4XK4 A;  1HDP A;  1W1W E;  3BQY A;  3RPU D;  2GOX B;  2COM A;  2M5W A;  1O57 A;  5J1U A;  2OZU A;  1R49 A;  4B48 A;  1BOA A;  1FBS A;  4CA0 A;  4AID A;  2A5W A;  4CH7 A;  1AWC A;  1J75 A;  4MTD A;  2PJR A;  3LQQ A;  2O7O A;  1JUM A;  2BEO A;  1D0Y A;  1EV7 A;  4NHJ A;  2FX0 A;  3DBH B;  4AVZ A;  4L5I A;  1EH6 A;  3LA2 A;  1YIJ I;  4Y17 A;  3PO3 J;  3S8P A;  3KYL A;  2VI6 A;  2CRG A;  3GME A;  4BDY A;  1JKP C;  3I59 B;  5E1X A;  3D1N I;  4QLC U;  1D0X A;  1ETK A;  2EQR A;  5IOY A;  2CSO A;  2E34 A;  4NC7 A;  4XMY A;  4FX4 A;  3F0C A;  4F7Z A;  2COB A;  2M1B A;  1RZ4 A;  4HDV A;  1OCZ H;  1OCC H;  5CVU A;  1ENH A;  2WY8 Q;  2DN0 A;  2EIN H;  2MH2 A;  4HSR A;  2VOD A;  2E1O A;  3T8R A;  1IUF A;  2E71 A;  2F6C A;  5FJ8 J;  3OYC A;  2NNY A;  3ZQC A;  3VOE A;  3VEP A;  1JKQ C;  2R5Y A;  2YU3 A;  1ZRE A;  5C4X J;  3P7N A;  3WU1 B;  3MZH A;  1VFC A;  4HNU A;  1IAW A;  3I9V 2;  1JKR C;  1CGP A;  3LSK A;  2LKP A;  2Q2E B;  3CCV I;  5FKM A;  4PFO A;  4CCL A;  2IJL A;  4C9Y A;  1TW3 A;  4DW6 A;  4GCV A;  1QZY A;  2IGN A;  1W4M A;  2IGO A;  1POG A;  3O8H A;  2KFD A;  2RDP A;  3H3U A;  4KMU X;  4I0A A;  1N78 A;  2TCT A;  1ZR2 A;  3ABU A;  1F43 A;  2RC4 A;  3AAF A;  1SC7 A;  2CV1 A;  1LPQ A;  4IF4 A;  2M8G X;  3LAJ A;  3HSF A;  1SAU A;  5FGM A;  5IYC J;  3OMY A;  5LGT A;  4OWR B;  2HPM A;  1IV6 A;  1ETW A;  3BPV A;  4M6X A;  3SZT A;  2W4S A;  3PIO F;  3H35 A;  4K2E A;  5E20 A;  1KU2 A;  4A0X A;  2KPM A;  4YEJ A;  3BTL A;  4P9U A;  3OSG A;  1BJA A;  1RET A;  3ECO A;  2K85 A;  4OAY A;  2KRF A;  2JRM A;  3LFU A;  3HOT A;  1LJ9 A;  2IXS A;  1MBH A;  5CVR A;  1KON A;  3K10 A;  3TP0 A;  3F22 A;  3E6C C;  4B8X A;  3E3V A;  4L9T A;  1P7J A;  2ZCW A;  3B02 A;  4HW0 A;  3QYB A;  3LST A;  2LKX A;  1MBF A;  3HKZ A;  3MAJ A;  1X3U A;  5ILU A;  3GX4 X;  4XOT A;  4D5C A;  2Z2S B;  1NG6 A;  3FXO A;  3BR0 A;  3H5N A;  5K5R A;  4A0Y A;  1Z6R A;  3HEF A;  4BY7 J;  3GYH X;  3LSI A;  4G94 A;  2PJR B;  2PI0 A;  3DP7 A;  3IP4 B;  3ABK H;  4OU0 A;  2OPT A;  2Q1Z B;  1O7F A;  2VPL A;  2HS5 A;  2Y0M A;  1ZAO A;  4HNT A;  4HRI A;  4U88 A;  2VKV A;  4UY8 I;  2JA6 J;  1VF9 A;  2EV6 A;  1N77 A;  1IC8 A;  1ZKG A;  1V54 H;  1Y8R B;  2MGQ A;  3RJP A;  3LSG A;  4BXU A;  2Y0S N;  3IWF A;  4EJV A;  2Z9O A;  4OIQ F;  2XIG A;  3NEU A;  1WSU A;  2A69 F;  5B5E C;  1U9O A;  4BE0 A;  1ZGJ A;  1MJ9 A;  1FMV A;  3B6A A;  2K9M A;  3JSO A;  3VDX A;  4E7I A;  4CIC A;  1JTX A;  5HOO A;  4ON0 A;  4B3X A;  5LFA A;  1SEU A;  4CHU A;  1JKO C;  2R5Y B;  2JRT A;  2PBI A;  1LE8 A;  1FIA A;  5IP9 J;  1MGT A;  4CCK A;  1JT6 A;  4M6Y A;  2YU9 J;  1HKS A;  3CZ6 A;  2W85 A;  1QBJ A;  4Y15 A;  3E7L A;  2ZJP F;  1TNT A;  3Q0U A;  4F55 A;  2A07 F;  1VQ5 I;  3DKW A;  2CQ7 A;  3LNQ A;  4U7D A;  4DOZ A;  4U0V A;  3WG7 H;  1MD0 A;  3ZQH A;  3FXJ A;  3CCQ I;  2DJN A;  3PL8 A;  1Z3Y A;  4A0Z A;  2WA0 A;  5BS6 A;  3R60 A;  5EG0 B;  2HDW A;  2DFI A;  3PNV A;  5B3S H;  5E1Z B;  1X1B A;  3F8N A;  4I98 B;  4RS8 A;  1S5L C;  1LB2 A;  2V4J C;  2BXY A;  3I58 A;  3TQN A;  4P5O A;  1JT0 A;  4V2G A;  1P7I A;  2E2H J;  3RKY A;  2VE8 A;  4S05 A;  2DT5 A;  2AXT C;  1OCO H;  3GEZ A;  3FIS A;  2HOE A;  5LHI A;  2CO5 A;  1BOB A;  1MMG A;  1ZHF A;  1USS A;  4RAZ A;  5C4J J;  1RIO H;  2KIQ A;  3I56 I;  4PGH A;  2V1U A;  2VLA A;  2K9L A;  1BN5 A;  4UB6 C;  4A3M J;  3FZV A;  4BBS J;  4BH9 A;  4MTE A;  3ZGK A;  2QQB A;  5FLM J;  3KZY A;  1S6L A;  3V7S A;  5HS7 A;  5FD6 A;  4XKC A;  4NUB A;  2IBD A;  1KZH A;  2LF8 A;  4OAZ A;  1X4O A;  1HSJ A;  5FO5 A;  5DD8 A;  1WVR A;  3M4O J;  2NS8 A;  2XVC A;  1W36 C;  2GIZ A;  5B66 C;  2VC1 A;  3HHG A;  1PJR A;  2DMN A;  1JXS A;  2PEX A;  1V55 H;  3GF2 A;  3ZQG A;  4AYB N;  2UUZ A;  3DWL E;  3E6M A;  4KYW A;  2O8K A;  1AA7 A;  3CJN A;  5HNH A;  3OL4 A;  4D0P A;  4UVA A;  4NQW A;  5FD5 A;  2KIM A;  3WU2 C;  1W36 D;  2F5D A;  3F8C A;  2Y30 A;  4EJT A;  4C2T A;  1A36 A;  4F3Q A;  2ELJ A;  3JRB A;  3PFI A;  5KVR A;  5C44 J;  4ESF A;  1YS6 A;  4A6D A;  4IHT A;  5HVQ C;  3FMS A;  1K6Y A;  2JTV A;  1OCT C;  4YRV A;  1K78 A;  2EIL H;  2VT2 A;  3E0J B;  1ETY A;  2JA7 J;  3DKX A;  3IKV A;  2P5K A;  2BVM A;  1BIB A;  3I4P A;  5HS8 A;  4LG0 A;  2XUB A;  2A5Y B;  2RNG A;  3OOU A;  4N4O B;  3F8B A;  4YFN F;  2E5Z A;  1LE8 B;  3I0T A;  4KT6 A;  3OYD A;  3MEX A;  5BMZ A;  4Q5S F;  4G7O F;  3ABM H;  3KIO A;  1MNE A;  4BU2 A;  4XSZ F;  1CQT A;  2HQR A;  3S32 A;  4HEA 2;  2DT6 A;  3H5A A;  5DYM A;  4QSH A;  2O0Y A;  2W24 A;  3ABT A;  2D1V A;  3JRF A;  4KIG A;  4HBL A;  1O3S A;  2WWY A;  2G0E A;  1LNW A;  4RMN A;  3V42 A;  4YFK F;  2R7O A;  5GP9 A;  4RDU A;  3P9I A;  1FBU A;  1IRG A;  3OR2 C;  1F5T A;  2OUM A;  4HQM A;  5EZG A;  2GOM A;  5F1R A;  3K0L A;  1JI8 A;  2DO7 A;  2E36 A;  2HYF A;  1SVO A;  3S3O A;  5H6R A;  2XKP A;  2DFH A;  1MNM C;  3S3N A;  1VQ9 I;  4UVC A;  3S3M A;  3PFY A;  2V6E A;  3HRU A;  5FLX K;  1R1T A;  5FRM A;  3A03 A;  2FNA A;  5CPR B;  4AUX A;  1MJB A;  3QPL A;  4E7L A;  2FBI A;  1WHU A;  2FEZ A;  4ZC3 A;  3WG9 A;  5F04 A;  3FBI B;  2VKH A;  1IW7 F;  2P5L C;  1H89 C;  3M1E A;  2BV6 A;  4IPA A;  1WJB A;  3JRI A;  3RYR A;  1ZG5 A;  2EJR A;  3GFM A;  1GDT A;  4L5J A;  3JRC A;  2QSG X;  1WI9 A;  2HOS A;  2PJP A;  1BJZ A;  3JTG A;  2BGC A;  1FPQ A;  5JFR A;  2L7F P;  3S1Q J;  2M7A A;  2X1E A;  1RKT A;  1U2W A;  3HIF A;  3TO7 A;  2AHQ A;  4A2U A;  4D1Q A;  3CDL A;  5KK1 A;  4BNC A;  4ZTJ A;  1GV5 A;  2EH3 A;  1QPI A;  2V9P A;  1K79 A;  3F21 A;  1XSD A;  2AQF A;  4XLA A;  4CXF A;  5D5V B;  2LVS A;  4MO7 A;  4DBQ A;  2NVX J;  1Y1W J;  4NQW B;  3LA3 A;  4FCY A;  3F6O A;  3WTS C;  3CUO A;  1ZR4 A;  4PCQ A;  3PSF A;  4XLN F;  3SDB A;  2QBY A;  4HV6 A;  2LSO A;  5F0C A;  2ZSH B;  2CUF A;  1LFB A;  5GAH J;  2V9V A;  4P55 A;  1V5G A;  3DTE A;  3MCZ A;  2LD5 A;  1K78 B;  1STZ A;  3OYM A;  3U21 A;  2P6S A;  3A1Y A;  1H9G A;  3CCJ I;  1WPK A;  1S7E A;  3DPL C;  4IL6 C;  4LG0 B;  3HPG A;  2FQ3 A;  4D7N A;  2IW5 A;  2KMU A;  4AIH A;  4FQG A;  1W0T A;  1AKH B;  1KQ0 A;  3T5X A;  2WY7 Q;  2M87 A;  4DQ2 A;  4EM1 A;  2ACJ A;  2HPI A;  4UB8 C;  1SMT A;  3T8T A;  2R0Q C;  3CTA A;  2QZ8 A;  1ZLK A;  4B44 A;  1F1Z A;  1RNL A;  3WHC A;  3PSI A;  3WTZ A;  3TW6 A;  2IGM A;  2B63 J;  4GGG A;  2VBX A;  2A6T A;  2LYC A;  2ETH A;  4BKX A;  2X6X A;  2D45 A;  4DBR A;  2UWM A;  4UUS A;  3IV5 A;  1QHH D;  3TO6 A;  5M3M J;  3JRH A;  1W7P A;  3HPH A;  1A31 A;  1FOX A;  3D0S A;  1NH3 A;  3CLQ A;  4RB1 A;  1RC9 A;  1YW9 A;  4QIW N;  4YIR X;  1TBX A;  1DGW Y;  5HLI A;  3KEO A;  3MKY B;  2EFW A;  4D7M A;  2M8E A;  2BYV E;  1UG2 A;  5IYD J;  4JOM A;  4PJM A;  5LEJ A;  4JX6 A;  3O3K A;  3J7Z I;  4RBO A;  4BE2 A;  1WQ2 A;  2HTJ A;  3EQL F;  3W3C A;  1VQO I;  1KQ8 A;  3M9A A;  1V5E A;  1YW7 A;  1H0M A;  4XQF A;  3HC7 A;  3IKT A;  2K7L A;  3S1R J;  2K9Q A;  3BJ6 A;  2O3F A;  1UZC A;  1WWX A;  2DLL A;  5DEQ A;  3EYY A;  3KP7 A;  1UST A;  1YQA A;  2FA5 A;  2NS7 A;  4Y4R A;  2V1N A;  1J09 A;  5FFZ A;  3KCC A;  5E18 F;  2XDV A;  2ME6 A;  4O5V A;  3VYR B;  2OQG A;  3L00 A;  4CYC B;  1D8J A;  1G59 A;  3WTY C;  4C3J J;  2O61 A;  1Z0X A;  3JTH A;  1SD5 A;  5ILV A;  2AXL A;  3DKY A;  3P5J A;  3DU6 A;  5LD2 C;  5D6E A;  3VYT B;  1X1D A;  1QA6 A;  3J80 K;  1E3H A;  1B1B A;  5IT9 K;  2R7W A;  2Y2Z A;  2HWV A;  4ENN A;  2DXI A;  2ECC A;  4TV7 A;  2JVH A;  2K86 A;  5KCM A;  2EA4 A;  3QOE A;  4XOR A;  2F2E A;  3WTX C;  3LAP A;  2Z5U A;  2FBH A;  4M9X A;  3TW7 A;  2CYY A;  3FHN A;  3GCM A;  2QBY B;  1UFM A;  2XRL A;  1R00 A;  1U0J A;  2BXZ A;  3QQA A;  5A2Q Z;  2E7X A;  1WCM J;  3PQJ A;  3GFI A;  4RGX A;  3O6B B;  1Y0N A;  2H8R A;  1ZGA A;  1EF4 A;  1LDK B;  3BG5 A;  4EJO A;  3WHB A;  5K5Q A;  3ZMZ A;  3L9F A;  2VC0 A;  3TOB A;  5HDN A;  4EGZ A;  2PG4 A;  4A3E J;  3RIR A;  1VQN I;  1B72 A;  3OS0 A;  2QSH X;  4CUG A;  2IEK A;  3PNY A;  1WKM A;  1W7P D;  2OV7 A;  1FLI A;  1Q1V A;  2IA0 A;  1WRJ A;  3T0Y A;  5IPA A;  1Z67 A;  3WGH A;  5LBQ A;  3OYE A;  1APL C;  1X4P A;  4BYY A;  2EPF A;  4XIC A;  4LK1 F;  1K61 A;  1HW5 A;  3HG9 A;  2E19 A;  4IX7 A;  1DDN A;  3H9J A;  2QQA A;  4UUS B;  4BUP A;  1TNS A;  2ESH A;  3OIQ A;  1W7P B;  1KU3 A;  4XN3 A;  1BR4 A;  2MLG A;  4L9V A;  4XON A;  3H5R A;  1R6R A;  3HOZ J;  1ON1 A;  2EZL A;  4PJ0 C;  3N05 A;  3HB9 A;  3H9Q A;  2A05 A;  2WAQ N;  4I7H A;  2HKO A;  4R8H A;  2LNB A;  2DK8 A;  4ENJ A;  4RGR A;  5LGN A;  1R71 A;  1H88 C;  3CJQ B;  3S16 J;  1FYM A;  3ROU A;  4BQN A;  3OYN A;  1YTY A;  3HRS A;  1HA8 A;  2PMZ N;  2QUF A;  2J5P A;  1V3F A;  1VQL I;  2WAF A;  4IXA A;  3BP8 A;  1XDU A;  4LFU A;  1FX7 A;  2D2W A;  4AYB A;  2MLK A;  3G1L A;  2IA2 A;  2BOL A;  2DOD A;  1UHM A;  4XLC A;  2ME0 A;  2VBW A;  2DAO A;  2JZY A;  1TP4 A;  1UHW A;  3DV8 A;  4WK8 F;  2ZXJ A;  2DA4 A;  2X0L A;  2ZKZ A;  2ZME A;  3V4G A;  4Q4Z F;  4M3G A;  2IS6 A;  2L5Q A;  2QQ9 A;  3AG1 H;  2XGC A;  4M6V A;  5JR3 A;  1X1P A;  3OV8 A;  1BC7 C;  1AOY A;  4R1H A;  2ID6 A;  4Q47 A;  4JK1 X;  3A01 A;  1JJ8 C;  2VJ4 A;  2LOO A;  4II2 A;  3CCR I;  2WAD A;  3G2B A;  3JW4 A;  4KUM A;  5IP6 A;  2V1X A;  2JVG A;  3WTV C;  2DA1 A;  2PN6 A;  1Y8Q B;  4AU7 A;  4B4C A;  3OYF A;  4GXO A;  4PJN A;  5J40 A;  3MMY B;  2IS1 A;  1RUO A;  4BQA A;  5DUI A;  4DYC A;  1UB9 A;  1UHS A;  2E35 A;  1SMY F;  2B7E A;  3WTW C;  2L9N A;  4Y33 A;  4A69 C;  4HF1 A;  3DXJ F;  5HLT A;  5EYR A;  1OR7 A;  1T95 A;  2JK3 A;  4B1R A;  1JHH A;  2E2I J;  4KJZ A;  1IRF A;  1IO2 A;  3D5L A;  1NK3 P;  4Y52 J;  1B72 B;  4C3H J;  1IUY A;  2WB1 N;  3S1N J;  4I76 A;  1XC5 A;  1P4X A;  3K1N A;  5HNF A;  3HXL A;  5LGU A;  2KIU A;  1X19 A;  2X51 A;  3GZ5 A;  3C18 A;  1MH4 A;  2DFF A;  1PP7 U;  2LR8 A;  3S2D J;  1DU6 A;  2WTE A;  3PM1 A;  1WJF A;  5H6Q A;  2GZW A;  3BC8 A;  3C1D A;  4G9Y A;  2UZK A;  2OQR A;  3P9C A;  2ZME C;  1MMA A;  4RM3 A;  1PUE E;  4ZH4 F;  2R7R A;  2I10 A;  2DMQ A;  3L2V A;  2GXB A;  3Q9S A;  1EA3 A;  1FY7 A;  1NK2 P;  5DS9 A;  1IDZ A;  2KZG A;  1KGS A;  3L2C A;  3GTP J;  3DU5 A;  5D5W B;  2P6T A;  2DTR A;  3HTS B;  2LY2 A;  4EM0 B;  1DPR A;  2WV0 A;  3OIO A;  4N4N B;  1FBQ A;  2ICW G;  2LMD A;  3L2Q A;  2K40 A;  4J01 A;  3C2B A;  3HOU J;  1WJA A;  2LFB A;  1OYY A;  1D0Z A;  1R4M B;  4RAF A;  5CQE A;  2ZME B;  3C2G A;  4BJ5 C;  1FEX A;  2RGV A;  4WXD A;  1IXS B;  4I0B A;  4R79 A;  1GVJ A;  1R23 A;  2R92 J;  2M9H A;  1OR7 C;  2KIF A;  1MBK A;  1RR8 C;  2PX9 A;  3A01 B;  2CW7 A;  1UAA A;  3ERM A;  3L1P A;  1HST A;  3SEZ A;  1HW2 A;  5GTI C;  3JRD A;  1PDN C;  3D5S C;  2EFN A;  2L02 A;  3R0J A;  4I2O A;  2XAS A;  4LIU A;  2L9S A;  3JCU C;  4E7J A;  5K5O A;  4HOB A;  4E6K G;  2DOF A;  5ICC A;  2MA3 A;  4A93 J;  4DYR A;  5EG0 A;  1J7K A;  3FXQ A;  2CWE A;  4WCG A;  4MFE A;  4CZC A;  3JSP A;  5J8C A;  1RES A;  2NYX A;  2VT3 A;  2ZXH A;  1YO5 C;  1ON2 A;  4LJZ F;  2JPB A;  4GFB A;  5DTD A;  1ZGW A;  2E60 A;  1HOM A;  1JGS A;  4E4H A;  2OBP A;  3VSK A;  5J4Y A;  3K1M A;  3CMA I;  3G1O A;  4HST A;  2VBY A;  2A3S A;  2JA8 J;  4UNO A;  1DU0 A;  1U78 A;  1MSF C;  4XLF A;  3H9G A;  5JVT A;  3EDP A;  1SAN A;  4B3A A;  4BHP A;  5GPA A;  2ZB9 A;  3C2H A;  1REP C;  1ODD A;  2R7V A;  1QPM A;  2TRT A;  4XLH A;  3KZI C;  4JP0 A;  3A4C A;  2R93 J;  4B47 A;  3ZMV A;  2XHK A;  2DYR H;  2Y9Z A;  3K6G A;  1EH8 A;  1OCR H;  2JA2 A;  2QGU A;  2X1D A;  2HOT A;  3LWF A;  2Y75 A;  2K5C A;  3GZ6 A;  5HLG A;  2CV0 A;  1T0F A;  1ZLJ A;  2L54 A;  2KJB A;  5CJ9 A;  1QVU A;  4A3G J;  3ECH A;  3DTI A;  1UJ8 A;  4HF2 A;  1SFU A;  3M7G A;  1M1E B;  1I39 A;  2EFP A;  3I3L A;  5EDN A;  4FTH A;  3TOA A;  4LB5 A;  4IKF A;  1B4A A;  4ZYE A;  1YJN I;  2GIV A;  3K7A J;  1OMI A;  4G6D A;  1TC3 C;  3DLA A;  5ICF A;  2DMP A;  4W1U A;  3L2R A;  5F64 A;  1FSE A;  4LOC A;  2EZK A;  2IGK A;  2ZNZ A;  3V8L A;  4YIF A;  4XM3 A;  3LL7 A;  2A6E F;  4HLY A;  1EKE A;  3JAM K;  4IHY A;  1UG0 A;  3A0B C;  1ZRD A;  1R4N B;  3VSL A;  1ETX A;  3ASN H;  5LRR A;  2GA1 A;  3MVP A;  3ZMD A;  4DZP A;  5D4S A;  4XOP A;  3V7R A;  2JSP A;  2MBF A;  2R3S A;  3RZD J;  4A6E A;  1FP1 D;  3BQZ A;  3OS1 A;  2DT7 B;  2DA6 A;  1WJ5 A;  2FNP A;  2ZSI B;  5BPI A;  4BE1 A;  3DQV C;  3BZK A;  4IRH A;  4CO8 A;  3GLL A;  3M8F A;  3BT9 A;  2O5R A;  1VQM I;  2HVR A;  3CMM A;  2M3A A;  4RB3 C;  4M9Z A;  3ZPL A;  4BL0 B;  2NVQ J;  4PFP A;  2EBI A;  2Z3Y A;  3VFZ A;  2DYS H;  5J8F A;  3HOS A;  2PLY A;  3K4M A;  3IRR A;  3HOW J;  2JQ7 A;  2VQC A;  1FTZ A;  3U2R A;  4M3D A;  2CQK A;  3E6D A;  4XID A;  2Q0O A;  3FK7 A;  5EZH A;  4BJT A;  3HHH A;  1P2F A;  5BNG A;  3BZC A;  3R6S A;  5JVG F;  1JJ6 C;  5GAD J;  2R7X A;  4BBR J;  1O7L A;  4M71 A;  1IXC A;  1T0F C;  2WAQ A;  2IS4 A;  2XV4 S;  2QKL B;  2FML A;  4XSX F;  3ZOB A;  5EJC A;  4GYI A;  4IZZ A;  1E17 A;  3QYF A;  3LA7 A;  3GXO A;  3Q0V A;  2O03 A;  2P8T A;  3SZG A;  2PMZ A;  1P4A A;  4BHC A;  3GWZ A;  3AL0 C;  4EVI A;  1H8A C;  1ZK8 A;  3HSE A;  3FHZ A;  1DGR M;  4XLP F;  5HOD A;  2QWW A;  2MC3 A;  1HCR A;  5M5X J;  1IDY A;  4D5F A;  4FE4 A;  3FXR A;  4PUS A;  3WGG A;  4L0Y B;  3BG9 A;  3CP2 A;  2FU4 A;  3FMR A;  2XGD A;  1J59 A;  2HQ5 A;  3H3Z A;  2X1C A;  1WH7 A;  3BY6 A;  1J5Y A;  5E3L A;  5JLX A;  3UKG A;  1U8R A;  2H6C A;  1FSH A;  5ICE A;  3LSR A;  2M34 A;  2OCE A;  1Y1V J;  2KHM A;  1BR2 A;  2F5C A;  2XSJ C;  3QU6 A;  4IEJ A;  4EM2 A;  5HDK A;  5LHG A;  2R7T A;  3ONQ A;  2CFX A;  3RZO J;  9ANT A;  1O3T A;  3AL0 B;  2K27 A;  3VWB A;  3H0D A;  3HRM A;  3FXM A;  3L7W A;  4XNF A;  1CF7 A;  1DQU A;  1QZZ A;  1QO0 D;  3BWG A;  3EET A;  4JX4 A;  3OSF A;  3HDD A;  4GDF A;  2DMU A;  1SVL A;  4I01 A;  4Y13 A;  3FDY A;  3DEW A;  3V8J A;  1UCR A;  2FUG 2;  3RSN A;  2R4G A;  1WGX A;  5DM7 F;  3EUA A;  1A5J A;  1KA8 A;  3IRQ A;  3GBG A;  4ENK A;  4CCM A;  4J00 A;  5E3M A;  4UUT A;  2RQQ A;  2BY3 A;  4GYG A;  3W6K B;  5ILS A;  3QOD A;  4M72 A;  2F5F A;  1AKH A;  4EMS A;  1I5Z A;  3FKI J;  3ISP A;  3TDZ C;  1S7O A;  1P92 A;  4LLG F;  5ED4 A;  4A5M A;  4KIC A;  3K4C A;  2JJ7 A;  2DDA A;  1X58 A;  3VB2 A;  5GAG J;  3OYJ A;  3K4B A;  2AS5 F;  5E8I A;  3BG6 A;  3IAM 2;  3CES A;  3U1K A;  5K7H A;  2LKS A;  3N97 A;  3CCL I;  1HQC A;  1T38 A;  4H4K C;  3OY9 A;  3I5U A;  1BI1 A;  3JRA A;  3BCB A;  1QRY A;  2KDZ A;  5IT9 Z;  3DTK A;  4Q48 A;  1SFX A;  2R5Z A;  3OWT A;  5C3E J;  1BI2 A;  3HSR A;  2QKM B;  4OIN F;  1QZE A;  5AON A;  5EEA A;  4OIP F;  5L3C A;  3OYB A;  4H0E A;  1T08 B;  2V6C A;  4L9N A;  2VPR A;  3BZ6 A;  3HL2 A;  2HYG D;  1BA5 A;  3M3Y J;  3KEQ A;  1MH3 A;  1S8N A;  3PUB A;  2HZD A;  5E3N A;  5L3E A;  3LOC A;  1Z7L A;  2MFZ A;  3CME I;  3DF8 A;  2BHZ A;  5JHF A;  2M2E A;  2FRH A;  4N9H A;  2P5V A;  3K2A A;  1R1U A;  2IAI A;  1VQ4 I;  4HA8 A;  1Q1H A;  4ABZ A;  3CLO A;  4EQQ A;  2K02 A;  1WH5 A;  2XB5 A;  3ZQL A;  4W97 A;  4CYC A;  1D8K A;  1HDD C;  4UHT A;  1GV2 A;  3KP4 A;  3GTL J;  1S9H A;  3BPX A;  3BJO A;  1YG2 A;  3KFW X;  1Z21 A;  3UR3 C;  1RKW A;  2NOG A;  2BY1 A;  2ZFW A;  2GAU A;  2Q8K A;  2MD5 A;  3E5X A;  2EA2 A;  1J2X A;  2W00 A;  4RGS A;  1CF7 B;  3CCY A;  1TWG J;  1HXD A;  1ETQ A;  3FM3 A;  3H0G J;  5DCM A;  2HGC A;  3M1C A;  3GTJ J;  2KZV A;  3WOD F;  3J81 Z;  2V26 A;  4MQV A;  5DM6 F;  3PJR A;  1K6O A;  2VON A;  2XAH A;  3RYP A;  1JE8 A;  1BM9 A;  3G6E I;  3H1C A;  1XDS A;  3QP6 A;  2W84 A;  2IVM A;  2AQE A;  1PUF A;  2OA4 A;  2JA5 J;  3GVA A;  2F4M B;  4EV0 A;  3BDD A;  1ZAR A;  4ZDP A;  2I8D A;  2BVL A;  4ZYG A;  4A3J J;  3AFH A;  3PNT A;  3ELK A;  1X1C A;  1YJ9 I;  1KU9 A;  3G1M A;  1DUX C;  3S15 J;  3GTM J;  2JWT A;  1K83 J;  2XAU A;  1FZP B;  1GLN A;  1X3Z B; 
#chains in the Genus database with same CATH homology
 3C7J A;  1YFH A;  3SHF A;  1B9M A;  4DNC A;  3QP5 A;  1U6G A;  1LEB A;  5LLQ A;  1OYW A;  3MZY A;  5H20 A;  2DPD A;  1G3W A;  3REO A;  1LDJ A;  3GFJ A;  1ZG3 A;  2VBZ A;  2GQQ A;  2DQR A;  2P7C B;  4U0W A;  1BBY A;  2YX7 A;  3F8F A;  2NNN A;  1OKR A;  2FF4 A;  1HKQ A;  2EFO A;  2OAZ A;  1J9I A;  4PGG A;  1XD7 A;  3KP5 A;  2QEN A;  1Z6T A;  3FX3 A;  3NQO A;  4WXH A;  1S3J A;  3TKY A;  5HLH A;  1ZRF A;  2ZNY A;  2RKH A;  4G7Z F;  5TRD A;  3V8K A;  4HAM A;  4EJU A;  1IN7 A;  4GO1 A;  3ML6 A;  3KLO A;  3TGN A;  1YYV A;  4ZYD A;  5DCM B;  3G73 A;  4CGZ A;  2FSW A;  3P9K A;  4U0Y A;  2DQL A;  4AVP A;  1LQ1 A;  2A61 A;  4YII A;  3RKW A;  1KU7 A;  3OOP A;  2LF7 A;  1C0W A;  2UXN A;  2RN7 A;  2BE5 F;  2H6B A;  2OZ6 A;  4QWQ A;  2J5O A;  1RUN A;  4M73 A;  1FNN A;  5HS9 A;  2YPR A;  3SFZ A;  4IHS A;  3K2Z A;  1ZH5 A;  2W57 A;  3LFK A;  5J6X A;  5LRS A;  1PP8 F;  3IWZ A;  4AIJ A;  3EYI A;  2B0L A;  4XRF A;  2DW4 A;  2ELH A;  2L4M A;  5FB2 A;  3BRO A;  1Z1D A;  2HZT A;  3KZZ A;  1T2K A;  2ADU A;  4L18 B;  2EWN A;  3KLN A;  2XRO A;  1S29 A;  2YX4 A;  1FC3 A;  4MEY F;  1XGM A;  1B9N A;  1Z9C A;  2EK5 A;  1G3T A;  2L4A A;  1XGO A;  2UXX A;  5AIP A;  3I53 A;  3RPQ A;  2XAG A;  4I02 A;  4ZYH A;  1SAX A;  1R36 A;  1R5H A;  2JT1 A;  4S04 A;  4HYE A;  3M8E A;  2G7H A;  2HDC A;  2RVC A;  1MJA A;  3WTU C;  1LEA A;  1Z91 A;  2FE3 A;  2XAQ A;  4OIO F;  3GFL A;  2ISY A;  2FOK A;  5AIQ A;  1ONV A;  2H27 A;  4I09 A;  4MGR A;  3Q9V A;  2JSC A;  3F3X A;  3KP6 A;  5CLS A;  4RB0 A;  2A68 F;  1LDD A;  2STT A;  1A04 A;  3T1B A;  2STW A;  4O3M A;  1G4D A;  2Z33 A;  1XMA A;  4HDU A;  4HF0 A;  3QAH A;  4KT5 C;  3ZMS A;  4ASN A;  4XBF A;  4RB2 C;  5A2Q K;  3FM5 A;  1FYL A;  2Y48 A;  2P7V B;  2K4B A;  1Z7U A;  3J7A O;  3I54 A;  1K7A A;  1R58 A;  4G6Q A;  3R4K A;  2LDU A;  2NRA C;  2RQP A;  1BC8 C;  2EFQ A;  3V7C A;  3QRF F;  3ZP5 A;  2V79 A;  4CYD A;  4KMF A;  5JHU A;  4UVB A;  1J0R A;  5E8G A;  1SD4 A;  1ZYR F;  2O6G E;  1GHC A;  4KIB A;  2ZJ2 A;  1EH7 A;  4YFX F;  5DCF A;  1YS7 A;  3U9G A;  4KN4 X;  5LEK A;  2XRN A;  1JHF A;  1Y0U A;  4NB5 A;  3LQR A;  4A5N A;  1IN8 A;  2PQ8 A;  3RDI A;  4U7B A;  3ZN0 A;  1FT9 A;  4WF2 A;  5K1Y A;  1F9N A;  1XB4 A;  1XSX A;  3F72 A;  2GA2 A;  3TO9 A;  1IN6 A;  4M74 A;  4PDK A;  3CO6 C;  2E7W A;  4ZZD A;  1ZN2 A;  2H09 A;  4P9F A;  4LMY A;  5FLX Z;  4BHB A;  3ZQ7 A;  5IT3 A;  2XGX A;  2BBY A;  4ETS A;  5FFX A;  5D4R A;  1TQI A;  2M45 A;  3KP2 A;  3MWM A;  2WC2 A;  1XMK A;  1TTY A;  2DI3 A;  2EV5 A;  2PMU A;  4UUV A;  3K9T A;  2VOP A;  3VOD A;  1MKM A;  3HUG A;  1GXP A;  2CGP A;  1QGP A;  1TQM A;  3GUD A;  2ISZ A;  5CVV A;  3F23 A;  2HEO A;  2FBK A;  4HX7 A;  2PMH A;  3ZMT A;  4HX8 A;  2QM3 A;  1ULY A;  1IN4 A;  5L3D A;  3WE2 A;  3ZMU A;  4UV8 A;  1OYI A;  5CVJ A;  2M30 A;  4HZF A;  2QYO A;  5BQT A;  2VN2 A;  3K1P A;  4N9I A;  4OOI A;  2F5E A;  4KDP A;  1XN7 A;  5L3B A;  1QNT A;  1VTN C;  2JPC A;  4OIR F;  3IL2 A;  1V4R A;  1YLF A;  2XAJ A;  2X4H A;  1F4K A;  1BIA A;  4ESJ A;  1FOK A;  5LHH A;  3ZN1 A;  4JBA A;  4ZZL A;  2NS0 A;  2HKX A;  1KQ9 A;  1L3L A;  2ZO4 A;  1ZG1 A;  4FT8 A;  3HRT A;  3FF5 A;  2G7U A;  5ICG A;  1Z05 A;  3I64 A;  4EGY A;  3RI4 A;  3IHU A;  1G3Y A;  1I27 A;  4FX0 A;  2D1H A;  4MEX F;  6PAX A;  4ENM A;  3RTR A;  3I71 A;  5D5X B;  2PFB A;  3E5Q A;  1T6S A;  1XGN A;  2DK5 A;  3KE2 A;  5E1W A;  1YIO A;  2GXG A;  4A12 A;  4IRG A;  1FP2 A;  5ERI A;  4PZJ A;  1T39 A;  1SFE A;  3BOQ A;  2P4W A;  3SXY A;  4L9J A;  3J80 Z;  1SD7 A;  2W25 A;  5TJJ A;  2QLZ A;  4EJW A;  2FMY A;  1G3S A;  2Z99 A;  1QQI A;  2RV8 A;  1IZ1 A;  4MNU A;  3U1D A;  2ESN A;  1P6R A;  1MDM A;  3RKX A;  4LLN A;  2ZBK A;  1L0O C;  2OD5 A;  4MQ9 F;  2KKO A;  1G6N A;  1H9T A;  3HYI A;  3CUQ A;  1HW1 A;  2IT0 A;  5DV5 A;  1HKT A;  2IA1 A;  4KA4 A;  4IJA A;  3QPT A;  3WU0 A;  4O6J A;  3Q5F A;  2FXA A;  3L09 A;  1XCB A;  1GXQ A;  3KET A;  4M9S A;  3N4M A;  3H92 A;  2E1C A;  1P4W A;  3SQN A;  5CVI A;  4LLL A;  2IP2 A;  3MFK A;  1KYZ A;  4RAY A;  5L3G A;  2K4J A;  2CG4 A;  4BAY A;  4HLX A;  2R7F A;  3EUH A;  4LK0 F;  2NAZ A;  4B09 A;  4HV5 A;  3GW2 A;  2VOO A;  2VE9 A;  2QVO A;  3FWE A;  3BJA A;  1BI0 A;  4IVN A;  2O8X A;  3WE3 A;  1T98 A;  1SD6 A;  5BOX A;  3GLX A;  3COA C;  5BPD A;  3B73 A;  4WX9 A;  2L01 A;  5D5U B;  2DPU A;  1I6X A;  1DPU A;  4UV9 A;  3CUQ C;  1NHA A;  4RGU A;  1KYW A;  2H94 A;  3E97 A;  5DDG A;  2YR2 A;  5CYV A;  3FXU A;  1W5S A;  1B59 A;  2RNJ A;  1LVA A;  1W5T A;  5L3F A;  3SZP A;  3G3Z A;  2OU2 A;  1I1S A;  1MDM B;  3F8M A;  4G8X A;  4IRI A;  3ERE D;  5DD4 A;  5DUK A;  5F6F A;  1MZB A;  1YW8 A;  3CUQ B;  1XSV A;  3WTT C;  5D8K B;  4LD5 A;  4YG2 F;  2XKO A;  2HR3 A;  3DFG A;  4WWC A;  4HQE A;  2DU9 A;  1U5T A;  5JI6 A;  3QU3 A;  4LB6 B;  3E5U A;  2G9W A;  4LGW A;  2HQN A;  4OMY A;  4JQF A;  3MQ0 A;  4OMZ A;  4P96 A;  2XAF A;  3W6J B;  2E1N A;  3ULQ B;  3KP3 A;  5E17 F;  3QPH A;  4KN7 X;  1D5V A;  1D3Y A;  1B6A A;  2EB7 A;  2L3D A;  1U3E M;  2IRF G;  2VXZ A;  3HTU A;  5D6F A;  4KIF A;  1XCV A;  1FWZ A;  4AIK A;  3NRV A;  3S2W A;  4L0Z B;  3O2P E;  4Z2Y A;  3WGI A;  2HTS A;  1R1V A;  4FHT A;  4AD9 A;  1ZRC A;  4E70 A;  4CZZ A;  2CW0 F;  3IC7 A;  1TLH B;  1U5T C;  2EV0 A;  3R0A A;  1OPC A;  3GO5 A;  5D8L B;  1R5G A;  3E6B A;  3FMQ A;  1I1G A;  4WXC A;  5EEH A;  1O3R A;  1RI7 A;  2KJC A;  2MH9 A;  3TDU C;  1IN5 A;  3J81 K;  1E2X A;  3CDH A;  3RPU A;  1O3Q A;  4AWX B;  4N0B A;  1U5T B;  3I59 A;  5HDG A;  1R7J A;  1R22 A;  3QOP A;  3C3W A;  1BI3 A;  2YSR A;  2R7D A;  2TDX A;  4MHG A;  4ESB A;  3DEU A;  4CDG A;  1IF1 A;  1XGS A;  3CO7 C;  3DPT A;  2Q2E A;  5EEG A;  3JAM Z;  4G7H F;  2C6Y A;  2DBB A;  2A6H F;  1FYK A;  3K69 A;  3F6V A;  1TW2 A;  1TQP A;  4HX4 A;  4KFC A;  1S7A A;  4UXN A;  3PQK A;  2V1D A;  1DP7 P;  2HFH A;  1IXR C;  2GWR A;  4KNY A;  3R61 A;  1HBX G;  2IPQ X;  2COM A;  2M5W A;  1O57 A;  2OZU A;  1BOA A;  1FBS A;  1AWC A;  1J75 A;  4MTD A;  3LQQ A;  2BEO A;  1EV7 A;  4NHJ A;  4L5I A;  1EH6 A;  3LA2 A;  4Y17 A;  3I59 B;  5E1X A;  4QLC U;  2CSO A;  4FX4 A;  4F7Z A;  2M1B A;  1RZ4 A;  4HDV A;  5CVU A;  2MH2 A;  2VOD A;  3T8R A;  2NNY A;  3VOE A;  3VEP A;  2YU3 A;  1ZRE A;  3P7N A;  3WU1 B;  3MZH A;  1IAW A;  1CGP A;  2LKP A;  2IJL A;  1TW3 A;  4GCV A;  1QZY A;  1W4M A;  2RDP A;  4KMU X;  3H3U A;  4I0A A;  3ABU A;  2RC4 A;  3AAF A;  4IF4 A;  3LAJ A;  3HSF A;  5FGM A;  5LGT A;  3BPV A;  4M6X A;  3SZT A;  4K2E A;  5E20 A;  1KU2 A;  4A0X A;  4P9U A;  1BJA A;  3ECO A;  2KRF A;  3HOT A;  1LJ9 A;  5CVR A;  3E6C C;  3F22 A;  4B8X A;  3E3V A;  4L9T A;  2ZCW A;  4HW0 A;  3B02 A;  3LST A;  3MAJ A;  1X3U A;  5ILU A;  3GX4 X;  5K5R A;  4A0Y A;  1Z6R A;  3GYH X;  4G94 A;  2PI0 A;  3DP7 A;  4OU0 A;  1O7F A;  2HS5 A;  2Y0M A;  1ZAO A;  4U88 A;  2EV6 A;  3RJP A;  4BXU A;  2Z9O A;  3IWF A;  4EJV A;  4OIQ F;  2XIG A;  3NEU A;  1WSU A;  2A69 F;  1ZGJ A;  1MJ9 A;  3JSO A;  4CIC A;  5HOO A;  4ON0 A;  4CHU A;  2JRT A;  2PBI A;  1MGT A;  4M6Y A;  1HKS A;  1QBJ A;  2W85 A;  4Y15 A;  1TNT A;  2A07 F;  3DKW A;  4U7D A;  4U0V A;  1MD0 A;  4A0Z A;  5BS6 A;  3R60 A;  2DFI A;  5E1Z B;  3F8N A;  4I98 B;  4RS8 A;  1LB2 A;  3I58 A;  3TQN A;  4P5O A;  3RKY A;  2VE8 A;  4S05 A;  2DT5 A;  3GEZ A;  2HOE A;  5LHI A;  2CO5 A;  1ZHF A;  1USS A;  4RAZ A;  1RIO H;  4PGH A;  2V1U A;  1BN5 A;  3FZV A;  4BH9 A;  4MTE A;  2QQB A;  3KZY A;  1S6L A;  3V7S A;  5HS7 A;  5FD6 A;  2LF8 A;  1HSJ A;  5FO5 A;  5DD8 A;  2XVC A;  2VC1 A;  3HHG A;  1JXS A;  2PEX A;  3GF2 A;  3E6M A;  4KYW A;  3CJN A;  4D0P A;  4UVA A;  4NQW A;  5FD5 A;  2KIM A;  2F5D A;  3F8C A;  4EJT A;  3PFI A;  5KVR A;  4ESF A;  1YS6 A;  4A6D A;  4IHT A;  5HVQ C;  3FMS A;  2JTV A;  1K78 A;  2VT2 A;  3IKV A;  2P5K A;  3I4P A;  1BIB A;  5HS8 A;  4LG0 A;  2XUB A;  2A5Y B;  3F8B A;  4YFN F;  3I0T A;  3MEX A;  5BMZ A;  4Q5S F;  4G7O F;  4XSZ F;  2HQR A;  5DYM A;  2O0Y A;  2W24 A;  3ABT A;  2D1V A;  1O3S A;  4KIG A;  4HBL A;  2WWY A;  1LNW A;  4YFK F;  1IRG A;  3P9I A;  1FBU A;  1F5T A;  4HQM A;  5F1R A;  3K0L A;  2DO7 A;  2HYF A;  5H6R A;  2XKP A;  4UVC A;  3HRU A;  5FLX K;  1R1T A;  2FNA A;  1MJB A;  2FBI A;  2FEZ A;  3WG9 A;  1IW7 F;  2P5L C;  3M1E A;  2BV6 A;  4IPA A;  3RYR A;  1ZG5 A;  2EJR A;  3GFM A;  4L5J A;  1WI9 A;  2PJP A;  3JTG A;  2BGC A;  1FPQ A;  5JFR A;  1U2W A;  3HIF A;  3TO7 A;  4A2U A;  5KK1 A;  4BNC A;  1K79 A;  3F21 A;  1XSD A;  4CXF A;  5D5V B;  3LA3 A;  3F6O A;  3WTS C;  3CUO A;  4PCQ A;  4XLN F;  2QBY A;  4HV6 A;  2LSO A;  2V9V A;  4P55 A;  3MCZ A;  1K78 B;  1STZ A;  2P6S A;  1H9G A;  3DPL C;  4LG0 B;  2FQ3 A;  2IW5 A;  4AIH A;  1KQ0 A;  3T5X A;  4DQ2 A;  2M87 A;  4EM1 A;  2ACJ A;  3T8T A;  1SMT A;  3CTA A;  2QZ8 A;  1ZLK A;  1F1Z A;  1RNL A;  3WTZ A;  4GGG A;  2VBX A;  2ETH A;  2D45 A;  2UWM A;  3TO6 A;  1W7P A;  3D0S A;  4RB1 A;  1YW9 A;  1TBX A;  5HLI A;  3KEO A;  2EFW A;  2M8E A;  2BYV E;  5LEJ A;  3O3K A;  1WQ2 A;  2HTJ A;  3EQL F;  1KQ8 A;  3M9A A;  1YW7 A;  1H0M A;  3IKT A;  2K7L A;  3BJ6 A;  2O3F A;  1WWX A;  2DLL A;  5DEQ A;  3EYY A;  3KP7 A;  1UST A;  1YQA A;  2FA5 A;  5FFZ A;  3KCC A;  5E18 F;  4O5V A;  2OQG A;  3L00 A;  1D8J A;  3WTY C;  2O61 A;  3JTH A;  1SD5 A;  5ILV A;  2AXL A;  5D6E A;  3J80 K;  1B1B A;  5IT9 K;  4ENN A;  2HWV A;  4TV7 A;  2K86 A;  2EA4 A;  2F2E A;  3WTX C;  3LAP A;  2Z5U A;  2FBH A;  4M9X A;  2CYY A;  2QBY B;  1UFM A;  1R00 A;  5A2Q Z;  2E7X A;  3PQJ A;  3GFI A;  4RGX A;  3O6B B;  1ZGA A;  1LDK B;  4EJO A;  5K5Q A;  3ZMZ A;  3L9F A;  2VC0 A;  3TOB A;  5HDN A;  4EGZ A;  2PG4 A;  3RIR A;  1WKM A;  1W7P D;  1FLI A;  2IA0 A;  1WRJ A;  3T0Y A;  3WGH A;  5LBQ A;  4BYY A;  4LK1 F;  1HW5 A;  1DDN A;  2QQA A;  1TNS A;  2ESH A;  1W7P B;  1KU3 A;  2MLG A;  4L9V A;  1ON1 A;  4I7H A;  4R8H A;  2HKO A;  2LNB A;  2DK8 A;  4ENJ A;  4RGR A;  5LGN A;  1FYM A;  3ROU A;  1YTY A;  3HRS A;  2QUF A;  2J5P A;  1V3F A;  4IXA A;  3BP8 A;  1XDU A;  4LFU A;  1FX7 A;  2D2W A;  2MLK A;  2IA2 A;  1UHM A;  2VBW A;  2DAO A;  2JZY A;  1UHW A;  3DV8 A;  4WK8 F;  2ZXJ A;  2X0L A;  2ZKZ A;  2ZME A;  3V4G A;  4Q4Z F;  2QQ9 A;  5JR3 A;  1BC7 C;  3OV8 A;  1AOY A;  4R1H A;  4Q47 A;  4JK1 X;  3JW4 A;  4KUM A;  2V1X A;  3WTV C;  2PN6 A;  4GXO A;  1RUO A;  4BQA A;  5DUI A;  1UB9 A;  1SMY F;  3WTW C;  4HF1 A;  3DXJ F;  1OR7 A;  1JHH A;  1IRF A;  3D5L A;  1IUY A;  1P4X A;  3K1N A;  5LGU A;  2KIU A;  3GZ5 A;  3C18 A;  1PP7 U;  2WTE A;  5H6Q A;  2GZW A;  3C1D A;  4G9Y A;  2UZK A;  2OQR A;  3P9C A;  1PUE E;  4ZH4 F;  2GXB A;  3Q9S A;  1FY7 A;  3L2C A;  1KGS A;  5D5W B;  2P6T A;  2DTR A;  3HTS B;  4EM0 B;  1DPR A;  2WV0 A;  1FBQ A;  1OYY A;  2ZME B;  2RGV A;  4WXD A;  1IXS B;  4I0B A;  4R79 A;  1GVJ A;  1R23 A;  2KIF A;  1HST A;  1HW2 A;  1PDN C;  2EFN A;  2L02 A;  3R0J A;  4I2O A;  2XAS A;  5K5O A;  4HOB A;  5ICC A;  2MA3 A;  1J7K A;  3FXQ A;  2CWE A;  4WCG A;  3JSP A;  5J8C A;  2NYX A;  2VT3 A;  1YO5 C;  1ON2 A;  4LJZ F;  2JPB A;  1JGS A;  2OBP A;  3K1M A;  2VBY A;  2A3S A;  4UNO A;  1U78 A;  5JVT A;  3EDP A;  4BHP A;  1REP C;  1ODD A;  1QPM A;  3ZMV A;  2XHK A;  1EH8 A;  3LWF A;  2Y75 A;  3GZ6 A;  5HLG A;  1T0F A;  1ZLJ A;  2L54 A;  2KJB A;  5CJ9 A;  3ECH A;  4HF2 A;  1SFU A;  3M7G A;  2EFP A;  3TOA A;  4LB5 A;  1B4A A;  4ZYE A;  2GIV A;  4G6D A;  1OMI A;  5ICF A;  5F64 A;  1FSE A;  3V8L A;  4YIF A;  2ZNZ A;  2A6E F;  4HLY A;  3JAM K;  1ZRD A;  5LRR A;  2GA1 A;  3ZMD A;  5D4S A;  3V7R A;  2MBF A;  2R3S A;  4A6E A;  1FP1 D;  2FNP A;  5BPI A;  3DQV C;  4IRH A;  4CO8 A;  3M8F A;  4RB3 C;  4M9Z A;  3ZPL A;  2Z3Y A;  3VFZ A;  5J8F A;  3HOS A;  2PLY A;  3IRR A;  3U2R A;  2CQK A;  3E6D A;  2Q0O A;  3HHH A;  1P2F A;  3R6S A;  1O7L A;  4M71 A;  1IXC A;  2XV4 S;  4XSX F;  2FML A;  4GYI A;  1E17 A;  3LA7 A;  3GXO A;  2O03 A;  2P8T A;  1P4A A;  4BHC A;  3GWZ A;  4EVI A;  3HSE A;  3FHZ A;  4XLP F;  2QWW A;  2MC3 A;  3FXR A;  3WGG A;  4L0Y B;  2FU4 A;  3FMR A;  1J59 A;  3H3Z A;  3BY6 A;  1J5Y A;  1U8R A;  2H6C A;  1FSH A;  5ICE A;  3QU6 A;  2F5C A;  4EM2 A;  5LHG A;  5HDK A;  2CFX A;  1O3T A;  2K27 A;  3HRM A;  3L7W A;  1CF7 A;  1QZZ A;  1QO0 D;  3BWG A;  3EET A;  4I01 A;  4Y13 A;  3V8J A;  1UCR A;  1KA8 A;  3IRQ A;  4ENK A;  4GYG A;  3W6K B;  5ILS A;  4M72 A;  2F5F A;  4EMS A;  1I5Z A;  3ISP A;  3TDZ C;  1S7O A;  1P92 A;  4LLG F;  5ED4 A;  4A5M A;  4KIC A;  3VB2 A;  2AS5 F;  5E8I A;  3N97 A;  1HQC A;  1T38 A;  3I5U A;  1BI1 A;  5IT9 Z;  4Q48 A;  1SFX A;  1BI2 A;  3HSR A;  4OIN F;  5AON A;  4OIP F;  5L3C A;  4H0E A;  2V6C A;  4L9N A;  3BZ6 A;  2HYG D;  3KEQ A;  1S8N A;  5L3E A;  3DF8 A;  2FRH A;  4N9H A;  2P5V A;  1R1U A;  4HA8 A;  1Q1H A;  3CLO A;  4EQQ A;  2K02 A;  1D8K A;  4UHT A;  3KP4 A;  3BPX A;  3BJO A;  1YG2 A;  3KFW X;  2ZFW A;  2GAU A;  2Q8K A;  2MD5 A;  3E5X A;  2EA2 A;  1J2X A;  4RGS A;  1CF7 B;  1HXD A;  3FM3 A;  5DCM A;  2HGC A;  3WOD F;  3J81 Z;  4MQV A;  2VON A;  1K6O A;  2XAH A;  3RYP A;  1JE8 A;  1BM9 A;  1XDS A;  3QP6 A;  2W84 A;  2IVM A;  2OA4 A;  3GVA A;  4EV0 A;  3BDD A;  1ZAR A;  4ZYG A;  3ELK A;  1KU9 A;  1DUX C;  1FZP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...