1P4WA

Solution structure of the dna-binding domain of the erwinia amylovora rcsb protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
YTPESVAKLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNYLSSVSMTPVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords rcsB
publication title Structural analysis of the DNA-binding domain of the Erwinia amylovora RcsB protein and its interaction with the RcsAB box.
pubmed doi rcsb
source organism Erwinia amylovora
total genus 22
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4wA00
1USSA 3V8KA 4HQEA 3RJPA 2QQAA 1PP7U 3TOAA 3MZHA 2LF8A 1FZPB 3Q9VA 3NEUA 5JR3A 2PEXA 3F21A 4HLXA 2Z5UA 1BC8C 3N4MA 2DBBA 1L0OC 1BC7C 1IZ1A 2A68F 2JPCA 3M8EA 1R1TA 1BI0A 4BYYA 3P9IA 3KCCA 2FU4A 1LDJA 5L3EA 1RUNA 1BI3A 1WI9A 2K4JA 1XMKA 2RC4A 1STZA 4WF2A 4M6XA 5CLSA 3P9KA 1JGSA 4KN4X 1R00A 2OAZA 4Z2YA 1R5GA 3ZMSA 5L3BA 1SD7A 5LHHA 5CYVA 3MQ0A 4G94A 5LEKA 1D3YA 4ASNA 2QQ9A 2GZWA 2R3SA 3BJOA 2P8TA 4RGXA 3IRRA 4AIHA 1TW2A 2GXBA 3MZYA 2ZFWA 1K7AA 3U9GA 3BWGA 4S04A 2QZ8A 4ZYGA 3HRMA 2D1HA 2OZ6A 1KU9A 2EFQA 2G9WA 2K7LA 4ESFA 1SMTA 1Z6RA 4B09A 4IRIA 2J5OA 3WU0A 2FBKA 2NNNA 1E17A 2DT5A 4AIJA 3FWEA 2HYFA 4LLNA 1YS6A 1BN5A 3FZVA 3KP4A 4NB5A 5L3GA 3ABTA 4ZYDA 1U3EM 3VOEA 5E18F 1UHWA 2HQRA 1ZGAA 1OKRA 3QRFF 2IP2A 1IUYA 2PBIA 1FX7A 1ZRFA 2FBHA 5ILSA 4DNCA 2PN6A 2VT2A 1G6NA 3ZMTA 3T8RA 5AIQA 1OMIA 1YW7A 2ESNA 3IL2A 4EJWA 5DDGA 4P96A 1IXRC 5K5OA 4WXDA 1HKSA 4HV6A 1JHHA 3IWZA 3EYIA 4RS8A 1FBQA 1XGNA 2L3DA 2EV5A 4KIBA 2MLGA 3WU1B 3IWFA 1QBJA 1G3SA 4IF4A 1I1GA 3HOTA 3F23A 3ML6A 2KIFA 5ED4A 2P7VB 3CJNA 1R23A 4ZYHA 3WTYC 4AVPA 4U7DA 3VB2A 2F5EA 2X0LA 2DQRA 3FF5A 3BZ6A 2R7DA 4RAZA 5BQTA 2XAJA 4I0BA 3HRTA 1PDNC 1R5HA 4L9TA 5CVIA 1O7FA 4G6QA 3DPLC 5D5VB 1SD5A 1J0RA 2P5VA 4EV0A 4XRFA 1R58A 4I98B 4HA8A 2D1VA 4EM2A 1J2XA 5BMZA 4YFKF 4MQVA 5LBQA 1XDUA 4K2EA 1USTA 4EGYA 1GHCA 5DEQA 4A0ZA 1ZGJA 2XGXA 3C3WA 3ZMUA 3FXQA 4L18B 1OYIA 1MJBA 2BEOA 2JRTA 1ZRCA 3OOPA 4XBFA 4Y17A 2DTRA 4OOIA 1PP8F 4M9XA 5HDGA 4RGUA 3E6CC 3ELKA 5E8GA 1K78B 4I09A 4OMYA 3QOPA 3F8BA 3CUQA 1LDKB 5D4RA 2QBYA 1XGSA 2IJLA 1F4KA 1LEAA 4M71A 2ZNZA 2VBZA 4N9IA 2FOKA 3BOQA 2QENA 3KFWX 1ODDA 2DLLA 3JAMZ 5TJJA 1FYLA 3HTUA 1F9NA 2ZXJA 4I02A 3LQQA 2ZMEA 3MAJA 1IRGA 1BOAA 3JAMK 2BV6A 3GO5A 5BOXA 3T8TA 1LB2A 4RB3C 3QU3A 3ABUA 2M45A 4I01A 2HGCA 4Y15A 3TDUC 2Y48A 3Q9SA 1FYKA 3PQKA 1T39A 2NS0A 2XAQA 4KDPA 5BS6A 3B02A 4I7HA 2QM3A 2P5KA 3I53A 4BNCA 1Z7UA 1RIOH 2A3SA 4GO1A 4RGRA 1FSEA 1QZZA 1ZHFA 1XCBA 3Q5FA 2L54A 4WXHA 4Q5SF 2AXLA 4ON0A 2LF7A 2EB7A 3GZ5A 4KIGA 4CZZA 1G3WA 3GEZA 2ISZA 2W85A 5KK1A 4LG0A 4HOBA 4EJTA 2O03A 1SFUA 4Y13A 1ZARA 2FSWA 3LA2A 4QLCU 3WTVC 5ICFA 4GCVA 5E20A 2GQQA 1TLHB 1IXSB 2BE5F 4O5VA 3WTUC 2FMLA 5J8FA 1KU2A 3G73A 1JXSA 1UHMA 3LQRA 3T0YA 2EV0A 1ZRDA 3DEUA 4O3MA 3VFZA 5LGNA 4ESBA 2DU9A 3K9TA 1ZN2A 3GFIA 2IW5A 5E8IA 1XGOA 3J80Z 2A07F 3K0LA 3J80K 2L01A 1AWCA 2XASA 2DK8A 1S7AA 2VOOA 3TQNA 1KGSA 4L5IA 1IW7F 3F8MA 3M8FA 4OIQF 1LEBA 1KU3A 4G9YA 2E1CA 2XRNA 4CHUA 1W5TA 1OR7A 1B9MA 2O0YA 2P7CB 4MHGA 2VN2A 1D5VA 5E1XA 3WODF 4XLNF 1FOKA 5BPIA 3KETA 2ZKZA 5E17F 4ENJA 1XGMA 1TTYA 3VEPA 2YR2A 1O3SA 1W7PA 4O6JA 2TDXA 4ZZDA 2FRHA 4GYIA 4LD5A 1YO5C 3F72A 2XIGA 3GFLA 2E7WA 4G8XA 3CUOA 1S6LA 4XSXF 3HUGA 4GXOA 4L5JA 4A6EA 1S7OA 4ETSA 1A04A 3F6OA 3FHZA 1EH7A 2Y0MA 1R36A 3PFIA 3QPTA 1XD7A 1SFXA 4HDUA 1FY7A 1P6RA 1T98A 2ETHA 2V79A 1GVJA 4Q4ZF 5AONA 4KMFA 4ENMA 2QWWA 3QU6A 2UWMA 4EJUA 1ZG5A 1CF7A 3I71A 2O8XA 2KJCA 1EH6A 3G3ZA 4HF0A 1WWXA 3WTWC 3NQOA 4HAMA 4EGZA 1MKMA 4KA4A 1J7KA 4HZFA 1BIAA 2MA3A 5HVQC 4LLLA 1FBSA 1FT9A 3I64A 5FD6A 4FX4A 2P6SA 3KP5A 1P4XA 2XROA 2CGPA 4MEYF 4PGGA 1IN4A 3COAC 3FM3A 1Y0UA 2OZUA 1SMYF 1U78A 1XMAA 3RDIA 4AIKA 2QBYB 4OINF 3E5QA 2RNJA 4LGWA 3RKWA 3LAJA 3KE2A 5J6XA 5ICEA 2VE9A 1LJ9A 1Q1HA 2VBWA 2HDCA 4MNUA 5CVVA 1EH8A 2QYOA 3L2CA 4IRGA 6PAXA 5H6QA 2UZKA 4EVIA 4TV7A 2L02A 4OIRF 3WGHA 4A5MA 2Z9OA 3HTSB 1YS7A 4LK0F 3EDPA 4M6YA 4D0PA 3VODA 3QP5A 2F2EA 3QP6A 2E1NA 2F5DA 2CG4A 3CO7C 1OPCA 5DCFA 4EQQA 2EFWA 1IN6A 1ZYRF 1FNNA 2A5YB 2XHKA 4U0WA 2CWEA 3ZN1A 1TNSA 2W25A 1SD4A 1SFEA 4OU0A 5CJ9A 2STTA 2RVCA 3W6JB 2M30A 3IKTA 3M7GA 5HS7A 2PQ8A 2VE8A 4Q47A 4HX4A 3R61A 3C18A 3RKXA 4RB2C 2IVMA 4FX0A 1O57A 2HFHA 3F8CA 5JFRA 5CVJA 4DQ2A 4QWQA 5LLQA 1XCVA 3GFMA 3SZTA 3GXOA 3ZPLA 2FQ3A 2XKPA 3HHHA 3WTXC 2YX4A 3RYPA 1B9NA 3JW4A 5DUKA 1U5TA 4HYEA 1U8RA 4U0VA 3GLXA 2LKPA 5KVRA 2MLKA 3KP6A 2VT3A 3E97A 3EETA 4CYDA 2ESHA 2RQPA 3F8NA 3V4GA 1LVAA 1ONVA 3WGGA 5AIPA 2HOEA 1FSHA 4HLYA 2MH9A 3GYHX 5FD5A 1BJAA 3V7CA 1K6OA 2FEZA 3CTAA 4WK8F 4AWXB 4WXCA 3P9CA 1UFMA 1YW9A 4LLGF 3MEXA 2Q8KA 1TQPA 5F6FA 2VC1A 1F1ZA 4EMSA 4OIPF 4N9HA 2V1DA 2A6HF 1BI1A 4FHTA 1XDSA 1FLIA 4HV5A 3SFZA 2UXXA 2OBPA 2Z3YA 3U2RA 3K1MA 4M74A 4LJZF 3TOBA 1G3TA 2CO5A 2NNYA 2GAUA 5H6RA 1ZREA 1F5TA 1MJAA 5FO5A 1C0WA 1YFHA 2OQGA 1SD6A 1WKMA 3O3KA 4P9UA 1MDMA 1BM9A 1T2KA 1U6GA 4IXAA 1JE8A 3BP8A 1XSXA 2BGCA 3F8FA 2MBFA 3SQNA 2QUFA 3BJ6A 3L9FA 3FMSA 3R6SA 5HLIA 4YIFA 2Z33A 3L09A 3JTHA 5DV5A 5IT3A 1DPRA 1OYWA 4LB6B 1WQ2A 5ICGA 1I6XA 3HSEA 1D8KA 3KEQA 5F64A 2VODA 5K5QA 2JZYA 2K27A 3K1NA 3RI4A 2KKOA 5J8CA 4UNOA 3GW2A 1RUOA 1YIOA 3O6BB 3ZMDA 2WWYA 3OV8A 4UHTA 4LK1F 2KRFA 4CDGA 1Z9CA 2V6CA 2EA2A 4ENNA 1NHAA 1R1UA 5HDKA 3HSRA 3W6KB 4H0EA 4WX9A 5FLXZ 1IN5A 4BXUA 4KT5C 5LRSA 3E6DA 4NQWA 3RPUA 4L0YB 3MFKA 5FLXK 3WE2A 5ICCA 4AD9A 1IAWA 4BAYA 3M9AA 1B4AA 4R8HA 1TQMA 1YLFA 5DD8A 1XB4A 1UCRA 4KYWA 3AAFA 4S05A 3GX4X 1RNLA 1W5SA 3SHFA 3M1EA 1R22A 1ON1A 2E7XA 3IKVA 5LGTA 4KN7X 5FGMA 4N0BA 1REPC 1KQ0A 2XUBA 2EK5A 2RN7A 5LHGA 3DPTA 2XAGA 1FYMA 3C1DA 3GFJA 4KICA 2FA5A 1J59A 2ZNYA 5E1WA 5LRRA 2YX7A 1ZLJA 2Q2EA 5HLGA 4PZJA 3ZN0A 4RB0A 4RB1A 1J5YA 3GWZA 4HQMA 5TRDA 4A0XA 2EWNA 3R0JA 2D2WA 1TBXA 4E70A 2A61A 4EJVA 1QO0D 3L7WA 3KEOA 3GUDA 3HRUA 1HW1A 1QQIA 2PLYA 2A6EF 1B6AA 4F7ZA 3BPVA 2ACJA 1MJ9A 4IHSA 2FF4A 5BPDA 2YPRA 3LFKA 4UVBA 2CYYA 3BY6A 4UUVA 4MTEA 1RZ4A 5EEGA 1AOYA 2GXGA 2ZBKA 1U5TB 1O3TA 1TQIA 2QVOA 2VC0A 2CFXA 4BHCA 4B8XA 1R7JA 5DCMA 2OA4A 4U7BA 2DO7A 1P4AA 5EEHA 3ZQ7A 2PJPA 1KQ9A 1IF1A 4L9NA 1G3YA 3WTZA 3CDHA 2EA4A 5L3DA 2V1UA 5HDNA 1OYYA 4A6DA 1H9TA 2JPBA 3ULQB 2ZJ2A 1HKQA 4CICA 4CO8A 1K79A 2EV6A 1T0FA 2DI3A 4PDKA 4R1HA 1QGPA 1PUEE 4YIIA 2G7HA 4HBLA 5D8LB 1ZAOA 4MQ9F 1V3FA 3QPHA 4A2UA 3ECOA 2YSRA 2HWVA 3N97A 1L3LA 3H3UA 4I2OA 1ZG3A 1VTNC 1HW5A 2HR3A 4M9SA 5D4SA 1K78A 3GZ6A 2KJBA 3E3VA 3DXJF 1ZG1A 3O2PE 3LAPA 2PG4A 2VOPA 4BHBA 2QLZA 1V4RA 1MDMB 2CQKA 2K4BA 2IT0A 2Z99A 3TO9A 2MD5A 2MH2A 3WE3A 5JVTA 2M8EA 1WRJA 1I5ZA 3DF8A 5HS9A 2IA1A 1HQCA 1Z91A 5D8KB 3CUQB 2VBXA 3D5LA 2PMUA 4BHPA 3HOSA 3V8JA 2FBIA 1U2WA 2IRFG 2VBYA 2V9VA 3ZMZA 1YG2A 2FMYA 2O3FA 3I58A 4G7HF 1HKTA 1IRFA 2FE3A 2H6CA 1UB9A 2ZMEB 3FXRA 3DP7A 1YQAA 2RGVA 1KU7A 4LB5A 5DUIA 3TGNA 1J75A 3BPXA 2AS5F 1EV7A 3RPQA 1Z6TA 1KYWA 1P4WA 1LQ1A 3ECHA 2RV8A 3HRSA 4M9ZA 5L3CA 3SZPA 3EYYA 2KIUA 2GA2A 2HTJA 4UVCA 2M1BA 2NRAC 3F6VA 2R7FA 4HX8A 2KIMA 3FMRA 2QQBA 4R79A 3T5XA 1S29A 3WTSC 2V1XA 1ZLKA 1FBUA 4I0AA 5ILVA 3D0SA 3LWFA 3NRVA 2P6TA 3K2ZA 5A2QZ 1TNTA 3I59A 4LG0B 3EQLF 3I4PA 3LA7A 2PFBA 1FC3A 3ZMVA 2OU2A 3T1BA 2F5FA 2VXZA 2COMA 2EJRA 1QPMA 3B73A 5A2QK 2H09A 2HTSA 4A5NA 4YFXF 1MD0A 4HW0A 3L00A 3J7AO 4BQAA 3ROUA 4EJOA 2NYXA 4PCQA 1YTYA 4ENKA 4ZYEA 2A69F 1B1BA 3ERED 3H92A 4NHJA 2MC3A 2WTEA 1S8NA 3KLOA 1MZBA 3E6BA 4M73A 1I27A 4JBAA 2DAOA 2B0LA 1DPUA 4ZH4F 4MEXF 2VONA 3WG9A 3FXUA 3FM5A 3TO6A 3LA3A 3FMQA 1O3QA 1HXDA 5HLHA 5FFZA 3J81Z 1BBYA 3E5XA 3V7RA 4G7ZF 5D6EA 5E1ZB 1QZYA 3J81K 3BJAA 3K1PA 2LNBA 2FNPA 1KQ8A 3GF2A 3HYIA 1I1SA 1Z1DA 3P7NA 1W7PB 3E6MA 2Q0OA 2GA1A 3JSOA 4LMYA 3DFGA 5LHIA 4GGGA 4IPAA 2HS5A 2L4AA 4A0YA 5DCMB 5DYMA 3MWMA 3RYRA 2F5CA 2IA2A 5CVRA 3I5UA 3DKWA 1MGTA 4BH9A 4OMZA 1BI2A 2H27A 3QAHA 4YG2F 2K86A 3F22A 2M5WA 4G6DA 2C6YA 4WWCA 1HSTA 4LFUA 3DV8A 2IPQX 1XN7A 2OD5A 3H3ZA 4P9FA 1CF7B 4YFNF 3KZZA 1Z05A 2L4MA 1LDDA 2CSOA 1H0MA 1DDNA 2O61A 1P2FA 4EM1A 3HIFA 3KZYA 2G7UA 3S2WA 3TDZC 2BBYA 2GWRA 4U0YA 3HSFA 4RAYA 1ON2A 4HF2A 1IXCA 4OIOF 4IHTA 3LSTA 1KYZA 1YW8A 2BYVE 5LGUA 2DW4A 4JQFA 2DQLA 3REOA 3ISPA 1HW2A 4UV8A 2XV4S 4HX7A 1JHFA 2D45A 4HF1A 1W4MA 4KUMA 1ULYA 2LDUA 2NAZA 3RKYA 3IRQA 4L9JA 1O7LA 5L3FA 2CW0F 1DP7P 2HEOA 1FWZA 1U5TC 2K02A 3U1DA 1YYVA 1QNTA 2YU3A 4UXNA 5F1RA 3R0AA 3IHUA 4HDVA 3WTTC 5D5XB 1G4DA 4EM0B 1DUXC 2XVCA 2H6BA 4PGHA 1R1VA 2P5LC 4P5OA 3R4KA 4UVAA 3C7JA 3V8LA 1WSUA 3KP2A 1GXQA 3CLOA 2RDPA 2P4WA 3MCZA 1X3UA 3HHGA 4KIFA 2HZTA 4L9VA 4M72A 1T38A 2EFPA 2RKHA 1IN7A 5JHUA 5LEJA 1E2XA 4A12A 1XSVA 2FNAA 3SXYA 5D5UB 3RTRA 2H94A 2W24A 2Y75A 1IN8A 3IC7A 2LSOA 2WV0A 2ZO4A 1LNWA 5FFXA 4IVNA 4IRHA 5H20A 2XKOA 3E5UA 3ZP5A 2HKXA 3KLNA 1D8JA 5D6FA 4P55A 3I0TA 1O3RA 1FP1D 3EUHA 4CGZA 3RIRA 5HS8A 3I59B 1ZH5A 3K69A 2XAFA 1TW3A 1RI7A 4WCGA 3JSPA 2X4HA 4ESJA 2PI0A 4IJAA 4G7OF 4KFCA 1BIBA 2DPUA 2M87A 5HOOA 2JTVA 3CUQC 2HQNA 2ADUA 1T6SA 2ISYA 1SAXA 5K5RA 4FT8A 2ELHA 5IT9Z 1W7PD 2DK5A 5ILUA 3BROA 5K1YA 2DFIA 2DPDA 3PQJA 1XSDA 3DQVC 5JI6A 5IT9K 4U88A 4XSZF 3I54A 1FPQA 3KP3A 1J9IA 4XLPF 2HYGD 2JSCA 4CXFA 2EFOA 3V7SA 1GXPA 1HBXG 2OQRA 4MTDA 4JK1X 3F3XA 5D5WB 4KMUX 1S3JA 2STWA 3GVAA 5ERIA 2J5PA 4ZZLA 1HSJA 4RGSA 2GIVA 1KA8A 2FXAA 3BDDA 2PMHA 1B59A 4UV9A 2ZCWA 4GYGA 2IA0A 3TKYA 2W57A 5CVUA 3KP7A 3WGIA 4MGRA 4KNYA 3R60A 4L0ZB 2WC2A 2W84A 2XAHA 1P92A 1H9GA 3TO7A 3FX3A 1FP2A 5DD4A 4Q48A 2JT1A 2O6GE 3CO6C 5FB2A 1CGPA 2EFNA 3JTGA 2UXNA 2HKOA
chains in the Genus database with same CATH superfamily
1USSA 3IAS2 3WU2C 5HNFA 3V8KA 3E7LA 3DBLB 1TP4A 4HQEA 3RJPA 2LD5A 3BR6A 4CCLA 2QQAA 1PP7U 3TOAA 3MZHA 2LF8A 1FZPB 2LC2A 1B72B 3Q9VA 3NEUA 4LOCA 3DBHB 5JR3A 1PUFA 2PEXA 3F21A 4HLXA 2R5YA 4RLQA 2Z5UA 1BC8C 3N4MA 2I10A 2DBBA 1L0OC 1BC7C 1IZ1A 4E6KG 2A68F 3BQZA 3ERMA 2JPCA 1E3PA 2CUEA 3M8EA 4BL0B 1R1TA 1BI0A 3QYEA 2XPVA 1T08B 4BYYA 3P9IA 3DEWA 1M1EB 3KCCA 2FU4A 1LDJA 5L3EA 1RUNA 1BI3A 2DOFA 4C9YA 1WI9A 5J40A 2K4JA 1XMKA 2RC4A 2EPFA 3I56I 1ETKA 1STZA 4I99C 4WF2A 4M6XA 5CLSA 3P9KA 1JGSA 1X4OA 3HOXJ 1Z7LA 1R00A 4KN4X 2OAZA 4Z2YA 1OR7C 1R5GA 1DQUA 3ZMSA 5L3BA 1SD7A 5LHHA 2M8GX 5CYVA 3MQ0A 4G94A 5LEKA 1D3YA 4KJZA 4ASNA 2QQ9A 1AU7A 2GZWA 2R3SA 3BJOA 4DYRA 5F27A 2P8TA 4RGXA 3IRRA 2AO9A 3DCFA 4OAZA 4AIHA 4EEFG 3AG1H 2E1OA 4CCJA 1TW2A 2GXBA 3MZYA 2L9NA 2ZFWA 5GPAA 2BY0A 1K7AA 2VASA 1IRZA 3U9GA 1ETWA 3D5RC 3BWGA 4S04A 2JRMA 2QZ8A 2EIMH 4ZYGA 3N05A 3HRMA 2VKEA 5LD2C 3W2AA 2D1HA 2JJ7A 2OZ6A 1KU9A 2A5WA 2EFQA 2G9WA 2K7LA 4ESFA 1SMTA 1Z6RA 4B09A 4IRIA 2NOGA 3LSKA 2J5OA 5FRNA 3WU0A 2FBKA 2NNNA 1E17A 1J09A 2QCOA 5J1YA 3O8HA 2DT5A 1GV5A 4AIJA 3FWEA 2HYFA 4PJNA 4LLNA 1YS6A 1BN5A 4QTRA 3FZVA 1X3ZB 2X6WA 5J1UA 3OYLA 3KP4A 3A4CA 4NB5A 5L3GA 4XONA 2NS7A 2WADA 3ABTA 3MMYB 3HL2A 4ZYDA 4A3KJ 1K4TA 1U3EM 3VOEA 1RRJA 1OFCX 5E18F 1UHWA 2HQRA 4XLFA 2KRCA 1ZGAA 1OKRA 3QRFF 2H8WA 2IP2A 2HPIA 1IUYA 3ZOBA 2PBIA 1FX7A 1X2NA 1ZRFA 2FBHA 2DODA 4RAGA 5ILSA 2HOSA 5B1BH 3A02A 4DNCA 2PN6A 2VT2A 1G6NA 3ZMTA 3T8RA 5AIQA 2BZTA 4E7KA 1OMIA 4M6VA 1YW7A 2ESNA 3IL2A 2Q2EB 1DP3A 1QRYA 4XL9A 3S2HJ 4EJWA 2KLOA 1X1AA 1IDYA 3D1NI 5DDGA 4P96A 2CQNA 1IXRC 2X1DA 5K5OA 1BW6A 4WXDA 1ZQ3P 1HKSA 4HV6A 2BVMA 1JHHA 3IWZA 3EYIA 4RS8A 5KHDA 3AG4H 2NVXJ 1FBQA 4B43A 1XGNA 2L3DA 1D1AA 4E7ZA 2EV5A 4KIBA 3K70C 2MLGA 3WU1B 3DEEA 3IWFA 2BW3A 2GM4A 2N8GA 1QBJA 1G3SA 2KRHA 2DFEA 3OYKA 1OCTC 3CLQA 3CZ6A 4DJAA 2JWTA 4IF4A 1I1GA 3A0BC 3PSIA 5FKNA 4DZPA 3HOTA 3S1NJ 3F23A 3ML6A 2KIFA 2LG4A 1Y0NA 3QOEA 4XLHA 5ED4A 4BE2A 1UHSA 2P7VB 4IQJA 3CJNA 3TW6A 1YJWI 5EZGA 1R23A 4ZYHA 4PJMA 4XOPA 4A3IJ 2XF7A 3WTYC 4AVPA 4U7DA 3RQIA 3VB2A 2F5EA 1VQKI 2X0LA 2DQRA 1W36D 3FF5A 3BZ6A 9ANTA 4M3BA 1MMGA 2R7DA 2CV1A 4RAZA 2VKDA 3H9GA 5BQTA 2XAJA 1R4NB 1Y56A 4XM3A 4I0BA 3I4NJ 3Q3SA 1SFOJ 3HRTA 2IS2A 3OR2C 1PDNC 1R5HA 4L9TA 3G1MA 1O7FA 5CVIA 4C3JJ 2M7AA 1ETQA 1WJAA 3H5AA 4G6QA 5K7HA 1RETA 3DPLC 3PO2J 3IH3A 2YUSA 5D5VB 1SD5A 1J0RA 3IUOA 2P5VA 4EV0A 2Z16A 2JVGA 4HRIA 1T56A 1TWCJ 3FXOA 3QWLA 1Y1VJ 1HDPA 3PUBA 3CCMI 3BC8A 4XRFA 2XPUA 1R58A 4JOMA 4I98B 2L0KA 3DTEA 4HA8A 3OYBA 2VJ5A 2D1VA 4EM2A 1J2XA 1HDDC 1A6IA 3DKYA 4FISA 5BMZA 4AYBA 3F0CA 4YFKF 4MQVA 5LBQA 2DA5A 4HNVA 3H3VK 1XDUA 2JMWA 4KITB 4K2EA 3CCUI 3KIOA 1USTA 2DOAA 2A05A 4EGYA 4CUGA 3GTGJ 2ID3A 5DEQA 1GHCA 3OWTA 4A0ZA 1ZGJA 2ZFUA 2XGXA 3C3WA 1NG6A 3ZMUA 3Q0VA 2R7WA 3OMYA 2X85A 3FXQA 1XPXA 4L18B 1OYIA 1GUUA 1MJBA 2BEOA 3DTIA 2JRTA 4MLOA 2KZGA 4A3JJ 4AM3A 1ZRCA 1JTXA 3BLYA 3OOPA 3P5JA 3CCRI 1RR7A 4XKWA 1UMQA 4XBFA 3L2VA 5J4VA 3A01B 4Y17A 5F04A 1TWGJ 2DTRA 5GP9A 1VQ5I 4OOIA 3CC7I 4BXXJ 1ENHA 3RKQA 2K9QA 1PP8F 2HZDA 3PIOF 1ZR2A 1QZEA 1I3QJ 3HG9A 3H5RA 4M9XA 5HDGA 4RGUA 3OYEA 3E6CC 3ELKA 1IV8A 1R5ID 3GTJJ 5E8GA 1K78B 3C2BA 4I09A 2W48A 3BQYA 3QOPA 5CQGA 4OMYA 3F8BA 3CUQA 3H0GJ 2ZXWH 1LDKB 5D4RA 1ETYA 1P7JA 2AQEA 1YJNI 2QBYA 1XGSA 2IJLA 1E3HA 3K4MA 1F4KA 1LEAA 4M71A 4M3FA 2ZNZA 4CZCA 2VBZA 4N9IA 2FOKA 2DA3A 1P7IA 3M1CA 1MSFC 4KT6A 2QEXI 3BOQA 2QENA 3SEQA 4F92B 2KFDA 2YS9A 2LMDA 1YX5A 3KFWX 1IUFA 1ODDA 2DLLA 1SVOA 2OJED 1R49A 2V4JC 4PSWA 3JAMZ 1OCOH 5TJJA 1FYLA 3HTUA 1Y1WJ 5IP6A 1F9NA 2ZXJA 4I02A 3LQQA 2ZMEA 3H0DA 2BY2A 3MAJA 2KISA 1IRGA 1FOXA 1BOAA 5CKTA 3RPUD 3OYMA 4ZYAA 3JAMK 1MBEA 4FASD 1WI3A 2BV6A 3GO5A 5BOXA 3T8TA 1LB2A 4RB3C 2EZLA 3QU3A 2FJ1A 3ABUA 2M45A 2JVHA 4I01A 2HGCA 4Y15A 3TDUC 1E3OC 2Y48A 2ELKA 4BXFA 3Q9SA 3E0JB 1FYKA 3M8JA 3PQKA 1T39A 2NS0A 4X1EA 5F08A 2XAQA 4KDPA 5BS6A 3FHNA 1GVDA 3CCEI 3B02A 3A0HC 3QYBA 1AKHA 3HOZJ 2E5NA 4Y3OA 1G2HA 4UB8C 3FK7A 4I7HA 2QM3A 2P5KA 3I53A 4BNCA 1Z7UA 5EG0A 1Z21A 2LKXA 2JUCA 1RIOH 3E1SA 2O7OA 2A3SA 4GO1A 1HOMA 2EILH 2M3AA 4RGRA 1FSEA 1QZZA 1ZHFA 1XCBA 3K4BA 3Q5FA 2L54A 4YEJA 4WXHA 4Q5SF 3LSGA 3JRAA 2AXLA 4ON0A 2E5ZA 2LF7A 5BNGA 2EB7A 1EF4A 3GZ5A 4KIGA 2LBFB 4CZZA 3TP3A 1G3WA 3GEZA 2ISZA 2R7TA 5GTHC 3L2QA 2W85A 1YI2I 5KK1A 1JJ6C 4LG0A 4HOBA 2JA8J 4EJTA 2O03A 2H1LA 2XGEA 1SFUA 2BVLA 4Y13A 2P0WA 1ZARA 1LFPA 2FSWA 3LA2A 4QLCU 5ICFA 3WTVC 4GCVA 5E20A 2GQQA 1TLHB 1IXSB 3QPLA 1EJ9A 2BE5F 5KAIC 4O5VA 3WTUC 2QKLB 2FMLA 5J8FA 1KU2A 3CCQI 1QHGA 1U9OA 4DGWB 2JN6A 3G73A 1JXSA 4M3GA 3NWTA 1UHMA 3LQRA 3T0YA 2EV0A 1ZRDA 3DEUA 3MKYB 1Y8QB 4JYKA 4J00A 1PJRA 4O3MA 3VFZA 2EZIA 5LGNA 2QGUA 4ESBA 1WJDA 2OTJI 2DU9A 3K9TA 1ZN2A 2DJIA 2HOTA 3GFIA 2LY2A 2LY9A 2IW5A 5E8IA 1XGOA 3J80Z 1LFBA 1FOWA 2HNHA 1BOBA 2LYCA 2A07F 2HXIA 3K0LA 2EZKA 2ZXHA 1QA6A 1MW7A 4LIVA 3PUFA 2JSPA 3HKZA 3J80K 1CQTA 1O4XA 3LNQA 2L01A 1VQLI 5GAHJ 1AWCA 2XASA 2DK8A 1S7AA 2VOOA 1QU3A 3TQNA 4ITVA 1JT0A 1KGSA 4L5IA 1IW7F 3F8MA 3M8FA 4D9JA 5B66C 4OIQF 2O9LA 1LEBA 4DBRA 1KU3A 1WVRA 2PJRB 4V2GA 4G9YA 2E1CA 2XRNA 3AL0B 4I6ZA 4CHUA 1W5TA 1OR7A 1B9MA 2O0YA 2P7CB 3HOWJ 4MHGA 2VN2A 2DXIA 1D5VA 2GLOA 5E1XA 2X51A 3WODF 5J4YA 4XLNF 1FOKA 5C3EJ 5BPIA 1JUSA 3KETA 4YIRX 2CW8A 1QVUA 2E2JJ 2ZKZA 3OS1A 2V1NA 5E17F 4ENJA 1XGMA 1TTYA 2HOAA 4XK4A 2YR2A 3VEPA 4BEHB 2MABA 3OYFA 1O3SA 4C2UA 1W7PA 4BBSJ 1RC9A 3JRHA 3KEYA 2M2EA 4O6JA 3ZXSA 2TDXA 1VNDA 4ZZDA 2FRHA 1ACIA 4BQOA 3DU6A 4GYIA 4LD5A 2WY7Q 2Y2ZA 1YO5C 1X19A 3F72A 2XIGA 3GFLA 1GV2A 3K4CA 2E7WA 5F1JA 4G8XA 3CUOA 1S6LA 4XSXF 3HUGA 2EH3A 4GXOA 4L5JA 2VUMJ 4A6EA 1S7OA 4ETSA 3S3MA 2DDAA 1A04A 2F6CA 2V26A 3CP2A 3F6OA 1MIJA 3JRGA 4A69C 3FHZA 1ITYA 1WJ5A 2Z1DA 5IP9J 1QVTA 1EH7A 2E35A 2Y0MA 4HNUA 1R36A 3PFIA 2Y9YA 3QPTA 4ZDPA 3D5SC 4F52A 2Y30A 1XD7A 1SFXA 4HDUA 1FY7A 1P6RA 2DTZA 1T98A 1SVLA 2ETHA 2W7NA 2V79A 1D5YA 1GVJA 2R7SA 2KDZA 2MGQA 5IPAA 5AONA 4Q4ZF 4KMFA 1YITI 3MKWB 2K85A 4PFOA 4ENMA 2QWWA 3QU6A 2VB6A 2UWMA 4EJUA 3QPSA 3G1LA 3EUAA 1ZG5A 3CF5F 4CA0A 4NBQA 5M3MJ 1CF7A 3HBLA 3GTLJ 1HLVA 3K70D 1BR1A 1BR2A 2EIKH 3I71A 2O8XA 2PX9A 2KJCA 3DKXA 3PFYA 4IHYA 1KZHA 4QIWN 1YRNA 1BA5A 1EH6A 2IGNA 1RPWA 2IEKA 2Q1ZB 3G4SI 4IZZA 3OYIA 3G3ZA 4HF0A 1WWXA 3WTWC 1XG1A 3NQOA 4HAMA 1MKMA 4EGZA 3W2VA 2DDBA 4XICA 4KA4A 1J7KA 2Y0SN 1VQOI 2EQRA 1WJEA 4HZFA 3GTPJ 3ZQGA 5H2FC 3CJTB 2VPLA 1BIAA 2MA3A 5HVQC 4LLLA 1FBSA 1FT9A 3I64A 2L7KA 5JVGF 4XRMA 3H36A 1LE8A 4A3LJ 5FD6A 1K6YA 4ZJZA 5TISC 3K7AJ 4IHWA 2X6YA 4FX4A 3HPHA 3K10A 2P6SA 3KP5A 3JRIA 1T8IA 5FKOA 3S15J 4DYCA 1P4XA 5IOZA 2XROA 2E1MC 2CGPA 4MEYF 4PGGA 1IN4A 2XPWA 3COAC 3FM3A 1Y0UA 3EUHC 4A3CJ 2NVTJ 3PIPF 3GMEA 3JREA 1V5EA 2OZUA 4FCYA 1SMYF 1U78A 4XRSG 3CMMA 1XMAA 4NUBA 3I55I 3RDIA 4AIKA 2R7ZJ 3VYSB 4BU2A 2QBYB 4OINF 3E5QA 1N77A 2BHYA 3BCAA 2RNJA 4LGWA 4PSXA 3RKWA 1ZGWA 1AHDP 3LAJA 1X1DA 3KE2A 3FXKA 5J6XA 5ICEA 2R7QA 2VE9A 1LJ9A 5KAFC 1TWFJ 1Q1HA 2VBWA 2HDCA 3L2UA 4FETA 4MNUA 5CVVA 3S93A 1EH8A 1IJWC 2XB0X 4IOCF 2QYOA 4BBRJ 3L2CA 3MVPA 4IRGA 2DA7A 6PAXA 1HF0A 1SEUA 2WB1A 4CH7A 5H6QA 2UZKA 4EVIA 4KISA 4TV7A 4AUXA 3MKZA 3PJRA 2L02A 2XDVA 4OIRF 3OOUA 3WGHA 4A5MA 2HVSA 1VQPI 3FIWA 4GRIA 4H4KC 3S1RJ 2Z9OA 1YS7A 3HTSB 4LK0F 4JP0A 4BACA 2D5VA 2DT6A 3EDPA 4M6YA 1FOYA 4BS9A 4PUSA 2I5UA 1QPIA 4D0PA 3VODA 3TP0A 3SZGA 3QP5A 2F2EA 2L9SA 1OISA 3QP6A 2VKHA 2E1NA 2WAQN 2F5DA 2CG4A 2OCEA 3CO7C 1OPCA 5DCFA 1D0ZA 4EQQA 2JA6J 2EFWA 3KYCB 3DTKA 1IN6A 2COBA 1ZYRF 1FNNA 2A5YB 2V9PA 3ZQQA 1HCRA 2VI6A 5DTDA 2XHKA 4U0WA 3CJRB 4FTHA 2LR8A 2CWEA 3ZN1A 1TNSA 2W25A 5LFAA 4IHVA 2R7OA 1SD4A 2XC7A 1SFEA 4OU0A 2ECBA 5CJ9A 3GTQJ 2STTA 2RVCA 3W6JB 2MYSA 4XNFA 1FIPA 1T0FC 1TL8A 2XGDA 1X2MA 2CUFA 2VJJA 4BUPA 2CQ7A 2M30A 3IKTA 3M7GA 5HS7A 2PQ8A 2YU9J 1D0YA 2VE8A 3ZQHA 1P9QC 4Q47A 4HX4A 2M34A 3R61A 1LKXA 3OYJA 3C18A 3RKXA 4RB2C 2OTLI 4A3GJ 1I39A 2IVMA 3CJQB 4FX0A 4XLEA 4F91B 4XRSA 1YE9A 2X48A 1O57A 5KNLA 3JRDA 3BG7A 1VQ9I 2HFHA 3F8CA 5JFRA 1S72I 5CVJA 4BY7J 3G1OA 4DQ2A 4QWQA 5LLQA 1XCVA 5IYCJ 4PJLA 5FKKA 4BGDA 1OCPA 2DFFA 1MNDA 3GFMA 1VQ6I 4II2A 3LSIA 3PNVA 1UAAA 3SZTA 2E1MB 3S16J 3S32A 2A6TA 2M4KA 3GXOA 1MH3A 3ZPLA 4HSTA 2LFBA 3KYDB 2FQ3A 2XKPA 3HHHA 2DA4A 4FQGA 4B3AA 5E3NA 3WTXC 1IO2A 2YX4A 3LL7A 3OIOA 3RYPA 5E3MA 3IV5A 1B9NA 1SFKA 3JW4A 5DUKA 1U5TA 3L2RA 4HYEA 1U8RA 4U0VA 4BJ5C 4UUSB 3GLXA 1JUMA 1IG7A 3GZNB 4IL6C 2LKPA 5KVRA 4BQNA 2MLKA 4F93B 3KP6A 2VT3A 3E97A 3EETA 5M5XJ 3VSLA 4CYDA 2ESHA 2RQPA 5B5EC 1NH3A 3F8NA 3V4GA 1LVAA 1ONVA 3WGGA 5AIPA 2DA6A 2HOEA 2UUZA 3GBGA 5B1AH 1FSHA 4ANJA 2KHMA 4HLYA 2MH9A 3GYHX 1VQ7I 2R7XA 5FD5A 1BJAA 4CYCA 3LSRA 3V7CA 3KZIC 1K6OA 3S17J 2FEZA 3CTAA 2QSFX 4WK8F 4AWXB 4WXCA 3P9CA 2CW7A 2DA1A 1UFMA 1YW9A 4LLGF 1DU0A 3AG2H 3MEXA 2Q8KA 1TQPA 5F6FA 5K7ZA 5IYDJ 1WPKA 2VC1A 3CC4I 1F1ZA 4EMSA 4OIPF 2E71A 4N9HA 5FLVA 1JKPC 2HPMA 2V1DA 2A6HF 3HPGA 2IGMA 3G2BA 1BI1A 3JCUC 5F0HA 4FHTA 1XDSA 1FLIA 4HV5A 3PSFA 3SFZA 2UXXA 3M3YJ 1YX3A 4A93J 2OBPA 2Z3YA 3U2RA 3K1MA 2KPMA 4M74A 4LJZF 5J47A 3TOBA 3B6CA 1G3TA 1LVKA 2CO5A 2NNYA 3ZQCA 2GAUA 2W82A 4YRVA 1V5GA 2XB5A 3W2WA 5H6RA 2KL4A 1F5TA 2IXSA 1ZREA 2ME6A 4DZJA 1MJAA 3FXMA 2MW8A 5FO5A 1Y6IA 1C0WA 1POGA 1YFHA 3S1QJ 2OQGA 2OUMA 2IAIA 2KT0A 2VQCA 1SD6A 1R9TJ 4DYQA 2DFHA 1V54H 1WKMA 3BG9A 2K9SA 3O3KA 3FBIB 4P9UA 2X6OA 1IGNA 1MDMA 1BM9A 2CMPA 3GLLA 1T2KA 3QODA 1RKWA 1U6GA 1W1WE 2BXYA 4IXAA 4E7JA 3S3NA 1JE8A 1JGGA 3BP8A 4YELA 1XSXA 2BGCA 3F8FA 3C2HA 2ME0A 2MBFA 3HJEA 3SQNA 2QUFA 3BJ6A 1JKOC 1UJ8A 3JRFA 3L9FA 3FMSA 2MD0A 2NVUB 2RAEA 3R6SA 5HLIA 1B72A 4YIFA 2Z33A 3L09A 3JTHA 5M5YJ 5DV5A 3OIQA 4AC0A 5IT3A 1DPRA 1OYWA 3BTCA 2NVYJ 4LB6B 3LSPA 1WQ2A 3GCMA 2EINH 5ICGA 3AKZA 3CCSI 1I6XA 3HSEA 3FDYA 5GTIC 4X0GA 4CCOA 1D8KA 3L1PA 1YRNB 3KEQA 2R7VA 3UKGA 5F64A 2VODA 2OC6A 2F48A 5K5QA 1MSEC 4BE0A 2JZYA 2K27A 2V7FA 3K1NA 1X3WB 3FISA 4C30A 3RI4A 2KKOA 5J8CA 1WJCA 3S8PA 3FK6A 3GW2A 1RUOA 3BR3A 4UNOA 1YIOA 4HG2A 2GBYA 3OYGA 3O6BB 3ZMDA 2M9HA 2WWYA 3OV8A 4UHTA 3AL0C 4LK1F 2KRFA 4CDGA 3BG6A 3KYLA 5M5WJ 4RMNA 2M4GA 1Z9CA 1RESA 2V6CA 1VFCA 1PUFB 2IS1A 2EA2A 3FBNB 4ENNA 4RLFA 2HXOA 2X1EA 1NHAA 5E3LA 1I3AA 1R1UA 2R5YB 5HDKA 3HSRA 3J7ZI 2CV2A 3W6KB 4H0EA 4WX9A 5FLXZ 2LK2A 1FIAA 1IN5A 1JI8A 4BXUA 1FMVA 3CQZJ 4KT5C 5C4XJ 1NK2P 5LRSA 3E6DA 4NQWA 3RPUA 4L0YB 2M0CA 3MFKA 2AXTC 5FLXK 4D7MA 3WE2A 1MMDA 5ICCA 5JLWA 4BDYA 3BTLA 4AD9A 1IAWA 4BAYA 3CCYA 3M9AA 1T95A 4MO7A 1B4AA 5EGOA 3CMYA 2AHQA 1PVEA 1JTYA 4R8HA 2NS8A 5EYRA 1TWAJ 1TQMA 1YLFA 4ZTJA 5DD8A 1XB4A 1UCRA 2DYSH 4KYWA 5CQEA 3AAFA 4S05A 2EZHA 4LIUA 3GX4X 1RNLA 1W5SA 1WH5A 2PMZN 3M1EA 5JLXA 2CQQA 1R22A 1ON1A 3SHFA 3OIPA 1GDTA 4D1QA 2E7XA 2R7RA 5GAGJ 1TZLA 2M0MA 3IKVA 4C3IJ 4BDZA 2H1KA 5LGTA 3PM1A 1Z3XA 4KN7X 5FGMA 2FQ4A 2X6XA 4GDFA 4N0BA 5FKLA 1REPC 1KQ0A 2XUBA 2FOWA 1XX5A 3TL4X 2EK5A 2RN7A 2RQQA 1VQNI 5LHGA 3DPTA 2OPTA 1Q1VA 1YIJI 3K4NA 2JUGA 2XAGA 1FYMA 3C1DA 1V5FA 3GFJA 1A5JA 1TC3C 1Z67A 4KICA 4RBOA 2VLAA 3NARA 3DLAA 2FA5A 1X58A 1J59A 3JRBA 2ZNYA 2QQ8A 5E1WA 5LRRA 4ABZA 2YX7A 4XN0A 1ZLJA 2Q2EA 3DWLE 5HLGA 4NC6A 4PZJA 2K40A 3ZN0A 4RB0A 4RB1A 1GT0C 2ZSIB 1J5YA 3GWZA 4HQMA 4B3XA 4J01A 5TRDA 4A0XA 1EKEA 2EWNA 3R0JA 1OLTA 4F3QA 3X2QH 4ZZLA 2D2WA 5EF6A 1TBXA 4E70A 2A61A 4EJVA 1QO0D 3L7WA 1MBGA 3KEOA 2V6EA 3S1MJ 3WHCA 3GUDA 3HRUA 1BR4A 1HW1A 3CCVI 3CMAI 2IS4A 1QQIA 1TWHJ 2GXAA 3ESWB 2PLYA 1YHQI 1X1PA 2FX0A 4E7IA 2AQFA 2A6EF 2E60A 1IDZA 4A3MJ 1FEXA 4AIDA 1B6AA 4F7ZA 3BPVA 2ACJA 1MJ9A 3BZKA 2Y69H 4IHSA 2Y9ZA 2CJJA 4Y4RA 2M7BA 3PNYA 2FF4A 5BPDA 1T33A 2GOXB 4I76A 2YPRA 3LFKA 2G0EA 4UVBA 3CDIA 3ZGKA 2CYYA 3BY6A 4JX5A 4J19A 3Q0UA 4HPQA 2LREA 4UUVA 1SANA 2PMZA 4P1WA 4MTEA 2IGKA 1IC8A 2NVQJ 1TT5B 1RZ4A 5EEGA 2X9DA 3JRCA 1WJFA 2BW3B 3BTIA 2XF6A 4C2MJ 4PJJA 1AOYA 2DJNA 2WY8Q 1XC5A 3OY9A 3U21A 2GXGA 2ZBKA 1U5TB 4HEA2 1O3TA 3ABMH 1TQIA 2QVOA 1D1BA 1Y8RB 2VC0A 5K7FA 1W0TA 3GTKJ 2CFXA 4BHCA 1JT6A 1YJ9I 4B8XA 1R7JA 4A3FJ 1MBJA 5DCMA 2OA4A 3FKIJ 5J3LA 4A3BJ 3J7YJ 4XKCA 4U7BA 2DO7A 1P4AA 3M07A 5EEHA 3ZQ7A 1AA7A 4NNJA 5GAEJ 3HZJA 5M3FJ 2PJPA 4EATA 1KQ9A 1IV6A 1IF1A 4L9NA 1G3YA 3WTZA 3CDHA 2EA4A 5L3DA 2V1UA 5HDNA 1OYYA 4A6DA 4HSRA 1H9TA 4MIMA 1ETOA 2JPBA 4ZDOA 3ULQB 3TW7A 2E2IJ 1FTTA 2ZJ2A 2L7MP 3LMMA 5JHFA 2LTPA 1HKQA 4CICA 4CO8A 4A3DJ 4A3EJ 1K79A 2WA0A 2EV6A 1T0FA 2DI3A 2CFOA 4PDKA 4R1HA 4OAYA 1QGPA 1W0UA 1PUEE 2WV1A 1MBFA 4YIIA 4E7HA 2G7HA 4HBLA 2CUZA 5D8LB 4Z6YA 1NG7A 2R92J 2EIJH 4RA2A 1ZAOA 4MQ9F 1K61A 1V3FA 3QPHA 3CC2I 2F4MB 4A2UA 3ECOA 4UUTA 2YSRA 3NWSA 2DCEA 2HWVA 4BY1J 3A01A 3N97A 1L3LA 2ZJQF 3H3UA 5F0FA 4I2OA 1VQ8I 2QF7A 4Y33A 3K4KA 4QPOA 3IAM2 3K2AA 3PL8A 1ZG3A 3BZCA 1VTNC 3I4MJ 1HW5A 2HR3A 2TRTA 4M9SA 5CPRB 5D4SA 1KONA 3S3OA 2O5RA 1K78A 3GZ6A 4RM3A 3LFUA 3ZCOA 2KJBA 3E3VA 2CUJA 2GOMA 3DXJF 1MMAA 3OL4A 3O2PE 1ZG1A 1A31A 3LAPA 2PG4A 1WFXA 2EBIA 2VOPA 4BHBA 2QLZA 4DIQA 1XTAA 1V4RA 5DS9A 4M3DA 3VWBA 1MDMB 2CQKA 2K4BA 2IT0A 4BQQA 3G71I 2Z99A 2L9RA 3ASOH 3TO9A 1DGRM 4RAFA 2QKMB 3BCBA 2MD5A 5C4JJ 5E79C 1IRXA 2MH2A 3WE3A 2K9MA 5JVTA 2R5ZA 2M8EA 1WRJA 1I5ZA 3DF8A 1OCZH 1ZKGA 5HS9A 2IA1A 1HQCA 3FXJA 1G8XA 1Z91A 3ZQIA 1WGXA 3CF2A 5D8KB 2JA7J 3CUQB 2W1OA 2VBXA 3D5LA 1GLNA 2PMUA 4BHPA 3BTJA 4XR6A 3PO3J 3O8GA 3SYTA 3HOSA 2VQHA 3V8JA 2FBIA 2ZSHB 4E7LA 3VSKA 1U2WA 2IRFG 2VBYA 3RZDJ 4HNTA 2V9VA 3ZMZA 1U0JA 4L5EA 4XKBA 1YG2A 2FMYA 4DW6A 2O3FA 3I58A 3QYFA 4G7HF 1HKTA 1IRFA 4D5CA 4IO9F 2FE3A 2H6CA 3SDGA 2DOEA 1UB9A 2JA5J 2ZMEB 3FXRA 3RQ4A 3HXLA 1UG2A 1YQAA 3DP7A 2IBDA 2RGVA 2OV7A 1KU7A 2LH9A 4LB5A 1S5LC 5DUIA 3TGNA 5HLTA 1J75A 3BPXA 2AS5F 1EV7A 3RPQA 1Z6TA 1KYWA 4F55A 1P4WA 1NTCA 5HNHA 3HOVJ 1YOVB 2LBFA 2WBMA 3BG5A 1LQ1A 4PFPA 4AVZA 3ECHA 2RV8A 4PJ0C 3HRSA 3DLLF 1LPQA 4M9ZA 2DA2A 4NQWB 5L3CA 1V55H 2MC4A 3U1KA 2Y0SA 5EZHA 3SZPA 1AKHB 3EYYA 2KIUA 2GA2A 2HTJA 3I3LA 4UVCA 2M1BA 3HEFA 3B6AA 2NRAC 3F6VA 4XIDA 5EG0B 3CCJI 1TT0A 3MD2A 5EGOB 3G6EI 2R7FA 2VXDA 4XOTA 4HX8A 2KIMA 4DOZA 1OJLA 1SAUA 2QQBA 3FMRA 4R79A 4C3HJ 3SJMA 1PYVA 2ZXIA 3T5XA 1S29A 4NC7A 3WTSC 2VQGA 4N4OB 1ZELA 1JJ8C 2V1XA 4XLCA 1ZLKA 1FBUA 1BJZA 4I0AA 5ILVA 3D0SA 2RNGA 3LWFA 2NXNB 3NRVA 1WZ2A 1ERDA 2P6TA 2XSJC 3C2GA 3VYRB 4D5FA 1UELB 2K9NA 1X1CA 2E34A 3K2ZA 1TNTA 3I59A 5A2QZ 1LFUP 3EQLF 4LG0B 3I4PA 1VQ4I 3LA7A 1X1BA 1A36A 2DMTA 2PFBA 2W4SA 3V42A 1FC3A 2OU2A 3WHBA 3ZMVA 1ZTRA 2HQ5A 4QPQA 3T1BA 2F5FA 2VXZA 1R6RA 2COMA 2EJRA 1A35A 1QPMA 3B73A 5A2QK 2H09A 2HTSA 4A5NA 2E2HJ 4YFXF 1MD0A 4HW0A 3SFIA 4Y7NJ 3L00A 3J7AO 1FTZA 3HOYJ 1WJBA 2V9KA 3EUKL 4BQAA 2LLKA 4D7NA 2F4OB 4NDLA 4XQFA 3ROUA 4EJOA 4B1RA 2UV1A 2NYXA 4BJTA 1HA8A 4XN3A 4PCQA 1YTYA 2LKSA 3S14J 3NAUA 3CDLA 4ENKA 2PJRA 2CU7A 4BKXA 4ZYEA 1ETVA 5GADJ 3BR2A 4IX7A 2NOJB 3WG7H 2X1CA 2ZJPF 3OS0A 2A69F 2B63J 2KDOA 2KMUA 4AYBN 4LG3A 3VDXA 1B1BA 2H8RA 3ERED 3H92A 5EEAA 4NHJA 4IKFA 2MC3A 3ABLH 2WTEA 1S8NA 3HGGA 1QHHD 2VKVA 4DBQA 3KLOA 1MZBA 3E6BA 4M73A 1I27A 4JBAA 4BEHA 2W00A 2DAOA 2B0LA 2ZC2A 2JA2A 1DPUA 4ZH4F 4MEXF 2VONA 3WG9A 3FXUA 1F43A 2WAQA 3FM5A 3TO6A 1JUPA 2E19A 1HC8A 3LA3A 3FMQA 1O3QA 1HXDA 2B9SA 5HLHA 4PK4A 1EA3A 5FFZA 5DM6F 3J81Z 1BBYA 3E5XA 3V7RA 3DPUA 2DT7B 2KIQA 3ZQFA 4G7ZF 1B8IA 2KP6A 3BR5A 5D6EA 5E1ZB 2VL8A 4Y52J 2QSHX 2HDDA 1QZYA 1A6QA 1Z77A 2DMPA 2MFZA 3J81K 3BJAA 3K1PA 2LNBA 2FNPA 1KQ8A 3GF2A 3HYIA 1I1SA 3Q0WA 1Z1DA 3LSJA 4IEJA 3P7NA 3GTMJ 1W7PB 3MKLA 4RDUA 3E6MA 4JX4A 3JR9A 1OCCH 2Q0OA 3K4LA 2GA1A 3JSOA 4LMYA 5IP7J 3DFGA 3LSMA 5LHIA 3K4JA 2XF5A 4GGGA 1OQYA 1MNMC 4IPAA 2F5VA 4U87A 3OSFA 1H88C 3HUGB 2HS5A 1U8BA 4BJ6C 2L4AA 4A0YA 5DCMB 4XLAA 5DYMA 3MWMA 1MH4A 2R93J 3LOCA 3W6VA 5B3SH 1RR8C 3RYRA 2BOLA 2F5CA 2IA2A 3OYNA 5CVRA 1I50J 3I5UA 4JX6A 2MG4A 3DKWA 3BG3A 1MGTA 3VPRA 4BH9A 4OMZA 4BE1A 4IHXA 2ZB9A 1BI2A 2H27A 3QAHA 4YG2F 4N4NB 3ABKH 2K86A 3CP8A 2DN0A 3F22A 1VI0A 2CRGA 1MMNA 2M5WA 3HB9A 4G6DA 2C6YA 4WWCA 1HSTA 2JK3A 2P81A 3RCOA 2HVQA 3DV8A 4LFUA 2MSYA 1WCMJ 2IPQX 3CCLI 2HVRA 1WHUA 4CCKA 1Z3YA 1XN7A 2OD5A 3H3ZA 4P9FA 2XGCA 4XORA 2CV0A 3HDDA 4GFBA 3UNGC 1CF7B 4XMYA 3A03A 4V19K 4YFNF 3KZZA 1Z05A 1MBHA 2VQLA 2L4MA 1LDDA 2CSOA 4X6AJ 1N25A 3M4OJ 3HOUJ 1H0MA 4ZDLA 1DDNA 1VZ0A 2O61A 1P2FA 5KCMA 4EM1A 3HIFA 3KZYA 2G7UA 3S2WA 3TDZC 2QSGX 2XAUA 3IH2A 2BBYA 2GWRA 4U0YA 3EPZA 1UZCA 3HSFA 1R71A 4B47A 4RAYA 1ON2A 3BR0A 4HF2A 1IXCA 4OIOF 2GIZA 4IHTA 5IY5H 3LSTA 1KYZA 4IQ4A 1YW8A 1LE8B 2BYVE 2K9LA 5LGUA 2DW4A 4JQFA 4UB6C 2BXZA 2DQLA 2K5CA 5EDNA 3OYDA 5TGTA 3ISPA 3REOA 1HW2A 4UV8A 2FD5A 2XV4S 3QQAA 4HX7A 1JHFA 5FJ8J 2D45A 4G12A 4XKVA 2R5ZB 4HF1A 2FUG2 3CMEI 3OSGA 1W4MA 4KUMA 1F36A 1ULYA 2LDUA 2NAZA 3RKYA 2KQRA 3IRQA 4L9JA 2Y31A 2IGOA 4B44A 4CCMA 1O7LA 3VYTB 5L3FA 2CW0F 3CESA 3ONQA 1DP7P 2HEOA 1FWZA 1U5TC 2ECCA 2K02A 2ICWG 3U1DA 3J7AY 1YYVA 1BL0A 1QNTA 2YU3A 4UXNA 3AFHA 2LOOA 3BR1A 5F1RA 3R0AA 3HKZN 1VQMI 2ELJA 4B4CA 3DU5A 5EJCA 3IHUA 4HDVA 3LSHA 3WTTC 5D5XB 2ID6A 4ZC3A 1SC7A 3IH4A 1G4DA 4EM0B 3OYCA 1DUXC 2XVCA 2CH0A 2H6BA 1R1VA 4PGHA 2P5LC 4IOAF 1ZK8A 2DMQA 4P5OA 3H35A 3R4KA 4UVAA 2LRDA 3C7JA 3V8LA 4E7SA 1WSUA 3HGYA 3KP2A 1S9HA 4MFEA 3BT9A 1GXQA 2WAEA 3H9JA 3CLOA 4W1UA 2JQ7A 2RDPA 2R0QC 1MMSA 3MZ8A 2L7FP 2P4WA 4QSHA 5F0CA 3MCZA 5J1RA 1X3UA 4NC8A 3HHGA 2DMNA 2HZTA 4KIFA 4L9VA 4M72A 2DMUA 4CCNA 1T38A 2EFPA 2RKHA 1IN7A 5JHUA 4FE4A 1I6HJ 5LEJA 1E2XA 4A12A 3L2WA 2I8DA 5DM7F 4CSWA 1ETXA 5HODA 1W36C 4UY8I 1XSVA 2FNAA 3SXYA 3A1YA 1SVMA 5D5UB 1U9NA 1X4PA 5GPCA 5IOYA 3HM5A 3RTRA 2OF7A 2IS6A 2LVSA 2H94A 2W24A 2Y75A 1N78A 2RREA 1IN8A 2LY1A 3IC7A 2LSOA 1UG0A 2WV0A 4II3A 3RZOJ 2ZO4A 1LNWA 1MBKA 3PNTA 3OL3A 5FFXA 5E3OA 3TEDA 2QA4I 3OYAA 2TCTA 4IVNA 4IRHA 5H20A 1DGWY 1MNEA 2XKOA 3E5UA 3ZP5A 2CS3A 2HKXA 3KLNA 1D8JA 3OR1C 3W3CA 2XRLA 2CQXA 5D6FA 4P55A 3I0TA 1O3RA 1FP1D 3EUHA 2VJ4A 4CGZA 3RIRA 5HS8A 3I59B 2K3PA 3KPHA 4FE7A 4W97A 3F9KA 3IP4B 1ZH5A 3K69A 1D0XA 2XAFA 4UUSA 1W5CC 2K3FA 1FMWA 1Z0XA 1TW3A 1RI7A 4WCGA 2OCCH 3JSPA 2X4HA 3FKJA 1E0EA 4ESJA 1ZR4A 2PI0A 4RM2A 4IJAA 1N75A 2HYJA 3H1CA 4G7OF 4G6TB 4KFCA 1BIBA 2DPUA 2L9VA 2BY3A 2M87A 1JKRC 5HOOA 1APLC 2JTVA 3CUQC 2HQNA 2ADUA 1T6SA 2ISYA 1SAXA 1R4MB 3FXLA 5K5RA 4FT8A 2ELHA 1FJLA 5IT9Z 5IYBJ 1W7PD 1XMXA 2DK5A 5ILUA 3BROA 5K1YA 1WH7A 2DFIA 3K6GA 2DPDA 3PQJA 3I9V2 3TMOA 1XSDA 2WAFA 2L2OA 3DQVC 5JI6A 5IT9K 5FROA 4U88A 3TBIA 4XSZF 3I54A 4V2FA 2ZJRF 2E36A 4OWRB 3H9QA 1FPQA 3KP3A 2HU9A 1J9IA 4XLPF 2DYRH 2R7UA 2ZMEC 2HYGD 2JSCA 1OCRH 3DBRB 4CXFA 2EFOA 2HDWA 2L7ZA 3V7SA 3MN2A 2LP0A 3OS2A 3S2DJ 2O8KA 4CYCB 4C2TA 1K4SA 1VF9A 1GXPA 4LITA 3RSNA 2OQRA 1HBXG 1B8IB 3A2KA 4MTDA 4JK1X 5FLMJ 1XS9A 3F3XA 2VJIA 2BY1A 2XSDC 5D5WB 4KMUX 1S3JA 2STWA 3SEZA 2VIXA 3ASNH 1LUJB 3GVAA 5ERIA 1S7EA 2J5PA 2F4IA 2KZVA 1Y39A 1ORKA 1HSJA 2GIVA 1KA8A 2FXAA 2L5QA 2PMHA 3BDDA 4RGSA 1B59A 4UV9A 2ZCWA 3VYUB 5FRMA 4MFDA 1BW5A 4GYGA 5C44J 2IA0A 3TKYA 1DU6A 2W57A 5CVUA 4ZTFA 3KP7A 1H89C 4S0HB 3WGIA 4E4HA 4MGRA 3CD6I 3ZR8X 4KNYA 1H8AC 3R60A 4L0ZB 2HQAA 4AU7A 2WC2A 1NK3P 2WB1N 1RKTA 2W84A 2XAHA 1P92A 1H9GA 3TO7A 3FX3A 1FP2A 3KX2A 2Z2SB 3HC7A 3ZRGA 3GTOJ 1D1CA 2VPRA 3SDBA 1G59A 5DD4A 3OYHA 4Q48A 3ZQLA 2B7EA 3UR3C 1JKQC 2JT1A 2O6GE 3CO6C 1K83J 2HI3A 2BHZA 5FB2A 1CGPA 2R4GA 4B48A 2EFNA 3JTGA 2UXNA 5FKMA 3H5NA 3AG3H 4M3EA 2HKOA
chains in the Genus database with same CATH topology
1USSA 3V8KA 4HQEA 3RJPA 2QQAA 1PP7U 3TOAA 3MZHA 2LF8A 1FZPB 3Q9VA 3NEUA 5JR3A 2PEXA 3F21A 4HLXA 2Z5UA 1BC8C 3N4MA 2DBBA 1L0OC 1BC7C 1IZ1A 2A68F 2JPCA 3M8EA 1R1TA 1BI0A 4BYYA 3P9IA 3KCCA 2FU4A 1LDJA 5L3EA 1RUNA 1BI3A 1WI9A 2K4JA 1XMKA 2RC4A 1STZA 4WF2A 4M6XA 5CLSA 3P9KA 1JGSA 4KN4X 1R00A 2OAZA 4Z2YA 1R5GA 3ZMSA 5L3BA 1SD7A 5LHHA 5CYVA 3MQ0A 4G94A 5LEKA 1D3YA 4ASNA 2QQ9A 2GZWA 2R3SA 3BJOA 2P8TA 4RGXA 3IRRA 4AIHA 1TW2A 2GXBA 3MZYA 2ZFWA 1K7AA 3U9GA 3BWGA 4S04A 2QZ8A 4ZYGA 3HRMA 2D1HA 2OZ6A 1KU9A 2EFQA 2G9WA 2K7LA 4ESFA 1SMTA 1Z6RA 4B09A 4IRIA 2J5OA 3WU0A 2FBKA 2NNNA 1E17A 2DT5A 4AIJA 3FWEA 2HYFA 4LLNA 1YS6A 1BN5A 3FZVA 3KP4A 4NB5A 5L3GA 3ABTA 4ZYDA 1U3EM 3VOEA 5E18F 1UHWA 2HQRA 1ZGAA 1OKRA 3QRFF 2IP2A 1IUYA 2PBIA 1FX7A 1ZRFA 2FBHA 5ILSA 4DNCA 2PN6A 2VT2A 1G6NA 3ZMTA 3T8RA 5AIQA 1OMIA 1YW7A 2ESNA 3IL2A 4EJWA 5DDGA 4P96A 1IXRC 5K5OA 4WXDA 1HKSA 4HV6A 1JHHA 3IWZA 3EYIA 4RS8A 1FBQA 1XGNA 2L3DA 2EV5A 4KIBA 2MLGA 3WU1B 3IWFA 1QBJA 1G3SA 4IF4A 1I1GA 3HOTA 3F23A 3ML6A 2KIFA 5ED4A 2P7VB 3CJNA 1R23A 4ZYHA 3WTYC 4AVPA 4U7DA 3VB2A 2F5EA 2X0LA 2DQRA 3FF5A 3BZ6A 2R7DA 4RAZA 5BQTA 2XAJA 4I0BA 3HRTA 1PDNC 1R5HA 4L9TA 5CVIA 1O7FA 4G6QA 3DPLC 5D5VB 1SD5A 1J0RA 2P5VA 4EV0A 4XRFA 1R58A 4I98B 4HA8A 2D1VA 4EM2A 1J2XA 5BMZA 4YFKF 4MQVA 5LBQA 1XDUA 4K2EA 1USTA 4EGYA 1GHCA 5DEQA 4A0ZA 1ZGJA 2XGXA 3C3WA 3ZMUA 3FXQA 4L18B 1OYIA 1MJBA 2BEOA 2JRTA 1ZRCA 3OOPA 4XBFA 4Y17A 2DTRA 4OOIA 1PP8F 4M9XA 5HDGA 4RGUA 3E6CC 3ELKA 5E8GA 1K78B 4I09A 4OMYA 3QOPA 3F8BA 3CUQA 1LDKB 5D4RA 2QBYA 1XGSA 2IJLA 1F4KA 1LEAA 4M71A 2ZNZA 2VBZA 4N9IA 2FOKA 3BOQA 2QENA 3KFWX 1ODDA 2DLLA 3JAMZ 5TJJA 1FYLA 3HTUA 1F9NA 2ZXJA 4I02A 3LQQA 2ZMEA 3MAJA 1IRGA 1BOAA 3JAMK 2BV6A 3GO5A 5BOXA 3T8TA 1LB2A 4RB3C 3QU3A 3ABUA 2M45A 4I01A 2HGCA 4Y15A 3TDUC 2Y48A 3Q9SA 1FYKA 3PQKA 1T39A 2NS0A 2XAQA 4KDPA 5BS6A 3B02A 4I7HA 2QM3A 2P5KA 3I53A 4BNCA 1Z7UA 1RIOH 2A3SA 4GO1A 4RGRA 1FSEA 1QZZA 1ZHFA 1XCBA 3Q5FA 2L54A 4WXHA 4Q5SF 2AXLA 4ON0A 2LF7A 2EB7A 3GZ5A 4KIGA 4CZZA 1G3WA 3GEZA 2ISZA 2W85A 5KK1A 4LG0A 4HOBA 4EJTA 2O03A 1SFUA 4Y13A 1ZARA 2FSWA 3LA2A 4QLCU 3WTVC 5ICFA 4GCVA 5E20A 2GQQA 1TLHB 1IXSB 2BE5F 4O5VA 3WTUC 2FMLA 5J8FA 1KU2A 3G73A 1JXSA 1UHMA 3LQRA 3T0YA 2EV0A 1ZRDA 3DEUA 4O3MA 3VFZA 5LGNA 4ESBA 2DU9A 3K9TA 1ZN2A 3GFIA 2IW5A 5E8IA 1XGOA 3J80Z 2A07F 3K0LA 3J80K 2L01A 1AWCA 2XASA 2DK8A 1S7AA 2VOOA 3TQNA 1KGSA 4L5IA 1IW7F 3F8MA 3M8FA 4OIQF 1LEBA 1KU3A 4G9YA 2E1CA 2XRNA 4CHUA 1W5TA 1OR7A 1B9MA 2O0YA 2P7CB 4MHGA 2VN2A 1D5VA 5E1XA 3WODF 4XLNF 1FOKA 5BPIA 3KETA 2ZKZA 5E17F 4ENJA 1XGMA 1TTYA 3VEPA 2YR2A 1O3SA 1W7PA 4O6JA 2TDXA 4ZZDA 2FRHA 4GYIA 4LD5A 1YO5C 3F72A 2XIGA 3GFLA 2E7WA 4G8XA 3CUOA 1S6LA 4XSXF 3HUGA 4GXOA 4L5JA 4A6EA 1S7OA 4ETSA 1A04A 3F6OA 3FHZA 1EH7A 2Y0MA 1R36A 3PFIA 3QPTA 1XD7A 1SFXA 4HDUA 1FY7A 1P6RA 1T98A 2ETHA 2V79A 1GVJA 4Q4ZF 5AONA 4KMFA 4ENMA 2QWWA 3QU6A 2UWMA 4EJUA 1ZG5A 1CF7A 3I71A 2O8XA 2KJCA 1EH6A 3G3ZA 4HF0A 1WWXA 3WTWC 3NQOA 4HAMA 4EGZA 1MKMA 4KA4A 1J7KA 4HZFA 1BIAA 2MA3A 5HVQC 4LLLA 1FBSA 1FT9A 3I64A 5FD6A 4FX4A 2P6SA 3KP5A 1P4XA 2XROA 2CGPA 4MEYF 4PGGA 1IN4A 3COAC 3FM3A 1Y0UA 2OZUA 1SMYF 1U78A 1XMAA 3RDIA 4AIKA 2QBYB 4OINF 3E5QA 2RNJA 4LGWA 3RKWA 3LAJA 3KE2A 5J6XA 5ICEA 2VE9A 1LJ9A 1Q1HA 2VBWA 2HDCA 4MNUA 5CVVA 1EH8A 2QYOA 3L2CA 4IRGA 6PAXA 5H6QA 2UZKA 4EVIA 4TV7A 2L02A 4OIRF 3WGHA 4A5MA 2Z9OA 3HTSB 1YS7A 4LK0F 3EDPA 4M6YA 4D0PA 3VODA 3QP5A 2F2EA 3QP6A 2E1NA 2F5DA 2CG4A 3CO7C 1OPCA 5DCFA 4EQQA 2EFWA 1IN6A 1ZYRF 1FNNA 2A5YB 2XHKA 4U0WA 2CWEA 3ZN1A 1TNSA 2W25A 1SD4A 1SFEA 4OU0A 5CJ9A 2STTA 2RVCA 3W6JB 2M30A 3IKTA 3M7GA 5HS7A 2PQ8A 2VE8A 4Q47A 4HX4A 3R61A 3C18A 3RKXA 4RB2C 2IVMA 4FX0A 1O57A 2HFHA 3F8CA 5JFRA 5CVJA 4DQ2A 4QWQA 5LLQA 1XCVA 3GFMA 3SZTA 3GXOA 3ZPLA 2FQ3A 2XKPA 3HHHA 3WTXC 2YX4A 3RYPA 1B9NA 3JW4A 5DUKA 1U5TA 4HYEA 1U8RA 4U0VA 3GLXA 2LKPA 5KVRA 2MLKA 3KP6A 2VT3A 3E97A 3EETA 4CYDA 2ESHA 2RQPA 3F8NA 3V4GA 1LVAA 1ONVA 3WGGA 5AIPA 2HOEA 1FSHA 4HLYA 2MH9A 3GYHX 5FD5A 1BJAA 3V7CA 1K6OA 2FEZA 3CTAA 4WK8F 4AWXB 4WXCA 3P9CA 1UFMA 1YW9A 4LLGF 3MEXA 2Q8KA 1TQPA 5F6FA 2VC1A 1F1ZA 4EMSA 4OIPF 4N9HA 2V1DA 2A6HF 1BI1A 4FHTA 1XDSA 1FLIA 4HV5A 3SFZA 2UXXA 2OBPA 2Z3YA 3U2RA 3K1MA 4M74A 4LJZF 3TOBA 1G3TA 2CO5A 2NNYA 2GAUA 5H6RA 1ZREA 1F5TA 1MJAA 5FO5A 1C0WA 1YFHA 2OQGA 1SD6A 1WKMA 3O3KA 4P9UA 1MDMA 1BM9A 1T2KA 1U6GA 4IXAA 1JE8A 3BP8A 1XSXA 2BGCA 3F8FA 2MBFA 3SQNA 2QUFA 3BJ6A 3L9FA 3FMSA 3R6SA 5HLIA 4YIFA 2Z33A 3L09A 3JTHA 5DV5A 5IT3A 1DPRA 1OYWA 4LB6B 1WQ2A 5ICGA 1I6XA 3HSEA 1D8KA 3KEQA 5F64A 2VODA 5K5QA 2JZYA 2K27A 3K1NA 3RI4A 2KKOA 5J8CA 4UNOA 3GW2A 1RUOA 1YIOA 3O6BB 3ZMDA 2WWYA 3OV8A 4UHTA 4LK1F 2KRFA 4CDGA 1Z9CA 2V6CA 2EA2A 4ENNA 1NHAA 1R1UA 5HDKA 3HSRA 3W6KB 4H0EA 4WX9A 5FLXZ 1IN5A 4BXUA 4KT5C 5LRSA 3E6DA 4NQWA 3RPUA 4L0YB 3MFKA 5FLXK 3WE2A 5ICCA 4AD9A 1IAWA 4BAYA 3M9AA 1B4AA 4R8HA 1TQMA 1YLFA 5DD8A 1XB4A 1UCRA 4KYWA 3AAFA 4S05A 3GX4X 1RNLA 1W5SA 3SHFA 3M1EA 1R22A 1ON1A 2E7XA 3IKVA 5LGTA 4KN7X 5FGMA 4N0BA 1REPC 1KQ0A 2XUBA 2EK5A 2RN7A 5LHGA 3DPTA 2XAGA 1FYMA 3C1DA 3GFJA 4KICA 2FA5A 1J59A 2ZNYA 5E1WA 5LRRA 2YX7A 1ZLJA 2Q2EA 5HLGA 4PZJA 3ZN0A 4RB0A 4RB1A 1J5YA 3GWZA 4HQMA 5TRDA 4A0XA 2EWNA 3R0JA 2D2WA 1TBXA 4E70A 2A61A 4EJVA 1QO0D 3L7WA 3KEOA 3GUDA 3HRUA 1HW1A 1QQIA 2PLYA 2A6EF 1B6AA 4F7ZA 3BPVA 2ACJA 1MJ9A 4IHSA 2FF4A 5BPDA 2YPRA 3LFKA 4UVBA 2CYYA 3BY6A 4UUVA 4MTEA 1RZ4A 5EEGA 1AOYA 2GXGA 2ZBKA 1U5TB 1O3TA 1TQIA 2QVOA 2VC0A 2CFXA 4BHCA 4B8XA 1R7JA 5DCMA 2OA4A 4U7BA 2DO7A 1P4AA 5EEHA 3ZQ7A 2PJPA 1KQ9A 1IF1A 4L9NA 1G3YA 3WTZA 3CDHA 2EA4A 5L3DA 2V1UA 5HDNA 1OYYA 4A6DA 1H9TA 2JPBA 3ULQB 2ZJ2A 1HKQA 4CICA 4CO8A 1K79A 2EV6A 1T0FA 2DI3A 4PDKA 4R1HA 1QGPA 1PUEE 4YIIA 2G7HA 4HBLA 5D8LB 1ZAOA 4MQ9F 1V3FA 3QPHA 4A2UA 3ECOA 2YSRA 2HWVA 3N97A 1L3LA 3H3UA 4I2OA 1ZG3A 1VTNC 1HW5A 2HR3A 4M9SA 5D4SA 1K78A 3GZ6A 2KJBA 3E3VA 3DXJF 1ZG1A 3O2PE 3LAPA 2PG4A 2VOPA 4BHBA 2QLZA 1V4RA 1MDMB 2CQKA 2K4BA 2IT0A 2Z99A 3TO9A 2MD5A 2MH2A 3WE3A 5JVTA 2M8EA 1WRJA 1I5ZA 3DF8A 5HS9A 2IA1A 1HQCA 1Z91A 5D8KB 3CUQB 2VBXA 3D5LA 2PMUA 4BHPA 3HOSA 3V8JA 2FBIA 1U2WA 2IRFG 2VBYA 2V9VA 3ZMZA 1YG2A 2FMYA 2O3FA 3I58A 4G7HF 1HKTA 1IRFA 2FE3A 2H6CA 1UB9A 2ZMEB 3FXRA 3DP7A 1YQAA 2RGVA 1KU7A 4LB5A 5DUIA 3TGNA 1J75A 3BPXA 2AS5F 1EV7A 3RPQA 1Z6TA 1KYWA 1P4WA 1LQ1A 3ECHA 2RV8A 3HRSA 4M9ZA 5L3CA 3SZPA 3EYYA 2KIUA 2GA2A 2HTJA 4UVCA 2M1BA 2NRAC 3F6VA 2R7FA 4HX8A 2KIMA 3FMRA 2QQBA 4R79A 3T5XA 1S29A 3WTSC 2V1XA 1ZLKA 1FBUA 4I0AA 5ILVA 3D0SA 3LWFA 3NRVA 2P6TA 3K2ZA 5A2QZ 1TNTA 3I59A 4LG0B 3EQLF 3I4PA 3LA7A 2PFBA 1FC3A 3ZMVA 2OU2A 3T1BA 2F5FA 2VXZA 2COMA 2EJRA 1QPMA 3B73A 5A2QK 2H09A 2HTSA 4A5NA 4YFXF 1MD0A 4HW0A 3L00A 3J7AO 4BQAA 3ROUA 4EJOA 2NYXA 4PCQA 1YTYA 4ENKA 4ZYEA 2A69F 1B1BA 3ERED 3H92A 4NHJA 2MC3A 2WTEA 1S8NA 3KLOA 1MZBA 3E6BA 4M73A 1I27A 4JBAA 2DAOA 2B0LA 1DPUA 4ZH4F 4MEXF 2VONA 3WG9A 3FXUA 3FM5A 3TO6A 3LA3A 3FMQA 1O3QA 1HXDA 5HLHA 5FFZA 3J81Z 1BBYA 3E5XA 3V7RA 4G7ZF 5D6EA 5E1ZB 1QZYA 3J81K 3BJAA 3K1PA 2LNBA 2FNPA 1KQ8A 3GF2A 3HYIA 1I1SA 1Z1DA 3P7NA 1W7PB 3E6MA 2Q0OA 2GA1A 3JSOA 4LMYA 3DFGA 5LHIA 4GGGA 4IPAA 2HS5A 2L4AA 4A0YA 5DCMB 5DYMA 3MWMA 3RYRA 2F5CA 2IA2A 5CVRA 3I5UA 3DKWA 1MGTA 4BH9A 4OMZA 1BI2A 2H27A 3QAHA 4YG2F 2K86A 3F22A 2M5WA 4G6DA 2C6YA 4WWCA 1HSTA 4LFUA 3DV8A 2IPQX 1XN7A 2OD5A 3H3ZA 4P9FA 1CF7B 4YFNF 3KZZA 1Z05A 2L4MA 1LDDA 2CSOA 1H0MA 1DDNA 2O61A 1P2FA 4EM1A 3HIFA 3KZYA 2G7UA 3S2WA 3TDZC 2BBYA 2GWRA 4U0YA 3HSFA 4RAYA 1ON2A 4HF2A 1IXCA 4OIOF 4IHTA 3LSTA 1KYZA 1YW8A 2BYVE 5LGUA 2DW4A 4JQFA 2DQLA 3REOA 3ISPA 1HW2A 4UV8A 2XV4S 4HX7A 1JHFA 2D45A 4HF1A 1W4MA 4KUMA 1ULYA 2LDUA 2NAZA 3RKYA 3IRQA 4L9JA 1O7LA 5L3FA 2CW0F 1DP7P 2HEOA 1FWZA 1U5TC 2K02A 3U1DA 1YYVA 1QNTA 2YU3A 4UXNA 5F1RA 3R0AA 3IHUA 4HDVA 3WTTC 5D5XB 1G4DA 4EM0B 1DUXC 2XVCA 2H6BA 4PGHA 1R1VA 2P5LC 4P5OA 3R4KA 4UVAA 3C7JA 3V8LA 1WSUA 3KP2A 1GXQA 3CLOA 2RDPA 2P4WA 3MCZA 1X3UA 3HHGA 4KIFA 2HZTA 4L9VA 4M72A 1T38A 2EFPA 2RKHA 1IN7A 5JHUA 5LEJA 1E2XA 4A12A 1XSVA 2FNAA 3SXYA 5D5UB 3RTRA 2H94A 2W24A 2Y75A 1IN8A 3IC7A 2LSOA 2WV0A 2ZO4A 1LNWA 5FFXA 4IVNA 4IRHA 5H20A 2XKOA 3E5UA 3ZP5A 2HKXA 3KLNA 1D8JA 5D6FA 4P55A 3I0TA 1O3RA 1FP1D 3EUHA 4CGZA 3RIRA 5HS8A 3I59B 1ZH5A 3K69A 2XAFA 1TW3A 1RI7A 4WCGA 3JSPA 2X4HA 4ESJA 2PI0A 4IJAA 4G7OF 4KFCA 1BIBA 2DPUA 2M87A 5HOOA 2JTVA 3CUQC 2HQNA 2ADUA 1T6SA 2ISYA 1SAXA 5K5RA 4FT8A 2ELHA 5IT9Z 1W7PD 2DK5A 5ILUA 3BROA 5K1YA 2DFIA 2DPDA 3PQJA 1XSDA 3DQVC 5JI6A 5IT9K 4U88A 4XSZF 3I54A 1FPQA 3KP3A 1J9IA 4XLPF 2HYGD 2JSCA 4CXFA 2EFOA 3V7SA 1GXPA 1HBXG 2OQRA 4MTDA 4JK1X 3F3XA 5D5WB 4KMUX 1S3JA 2STWA 3GVAA 5ERIA 2J5PA 4ZZLA 1HSJA 4RGSA 2GIVA 1KA8A 2FXAA 3BDDA 2PMHA 1B59A 4UV9A 2ZCWA 4GYGA 2IA0A 3TKYA 2W57A 5CVUA 3KP7A 3WGIA 4MGRA 4KNYA 3R60A 4L0ZB 2WC2A 2W84A 2XAHA 1P92A 1H9GA 3TO7A 3FX3A 1FP2A 5DD4A 4Q48A 2JT1A 2O6GE 3CO6C 5FB2A 1CGPA 2EFNA 3JTGA 2UXNA 2HKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USS A;  3V8K A;  4HQE A;  3RJP A;  2QQA A;  1PP7 U;  3TOA A;  3MZH A;  2LF8 A;  1FZP B;  3Q9V A;  3NEU A;  5JR3 A;  2PEX A;  3F21 A;  4HLX A;  2Z5U A;  1BC8 C;  3N4M A;  2DBB A;  1L0O C;  1BC7 C;  1IZ1 A;  2A68 F;  2JPC A;  3M8E A;  1R1T A;  1BI0 A;  4BYY A;  3P9I A;  3KCC A;  2FU4 A;  1LDJ A;  5L3E A;  1RUN A;  1BI3 A;  1WI9 A;  2K4J A;  1XMK A;  2RC4 A;  1STZ A;  4WF2 A;  4M6X A;  5CLS A;  3P9K A;  1JGS A;  4KN4 X;  1R00 A;  2OAZ A;  4Z2Y A;  1R5G A;  3ZMS A;  5L3B A;  1SD7 A;  5LHH A;  5CYV A;  3MQ0 A;  4G94 A;  5LEK A;  1D3Y A;  4ASN A;  2QQ9 A;  2GZW A;  2R3S A;  3BJO A;  2P8T A;  4RGX A;  3IRR A;  4AIH A;  1TW2 A;  2GXB A;  3MZY A;  2ZFW A;  1K7A A;  3U9G A;  3BWG A;  4S04 A;  2QZ8 A;  4ZYG A;  3HRM A;  2D1H A;  2OZ6 A;  1KU9 A;  2EFQ A;  2G9W A;  2K7L A;  4ESF A;  1SMT A;  1Z6R A;  4B09 A;  4IRI A;  2J5O A;  3WU0 A;  2FBK A;  2NNN A;  1E17 A;  2DT5 A;  4AIJ A;  3FWE A;  2HYF A;  4LLN A;  1YS6 A;  1BN5 A;  3FZV A;  3KP4 A;  4NB5 A;  5L3G A;  3ABT A;  4ZYD A;  1U3E M;  3VOE A;  5E18 F;  1UHW A;  2HQR A;  1ZGA A;  1OKR A;  3QRF F;  2IP2 A;  1IUY A;  2PBI A;  1FX7 A;  1ZRF A;  2FBH A;  5ILS A;  4DNC A;  2PN6 A;  2VT2 A;  1G6N A;  3ZMT A;  3T8R A;  5AIQ A;  1OMI A;  1YW7 A;  2ESN A;  3IL2 A;  4EJW A;  5DDG A;  4P96 A;  1IXR C;  5K5O A;  4WXD A;  1HKS A;  4HV6 A;  1JHH A;  3IWZ A;  3EYI A;  4RS8 A;  1FBQ A;  1XGN A;  2L3D A;  2EV5 A;  4KIB A;  2MLG A;  3WU1 B;  3IWF A;  1QBJ A;  1G3S A;  4IF4 A;  1I1G A;  3HOT A;  3F23 A;  3ML6 A;  2KIF A;  5ED4 A;  2P7V B;  3CJN A;  1R23 A;  4ZYH A;  3WTY C;  4AVP A;  4U7D A;  3VB2 A;  2F5E A;  2X0L A;  2DQR A;  3FF5 A;  3BZ6 A;  2R7D A;  4RAZ A;  5BQT A;  2XAJ A;  4I0B A;  3HRT A;  1PDN C;  1R5H A;  4L9T A;  5CVI A;  1O7F A;  4G6Q A;  3DPL C;  5D5V B;  1SD5 A;  1J0R A;  2P5V A;  4EV0 A;  4XRF A;  1R58 A;  4I98 B;  4HA8 A;  2D1V A;  4EM2 A;  1J2X A;  5BMZ A;  4YFK F;  4MQV A;  5LBQ A;  1XDU A;  4K2E A;  1UST A;  4EGY A;  1GHC A;  5DEQ A;  4A0Z A;  1ZGJ A;  2XGX A;  3C3W A;  3ZMU A;  3FXQ A;  4L18 B;  1OYI A;  1MJB A;  2BEO A;  2JRT A;  1ZRC A;  3OOP A;  4XBF A;  4Y17 A;  2DTR A;  4OOI A;  1PP8 F;  4M9X A;  5HDG A;  4RGU A;  3E6C C;  3ELK A;  5E8G A;  1K78 B;  4I09 A;  4OMY A;  3QOP A;  3F8B A;  3CUQ A;  1LDK B;  5D4R A;  2QBY A;  1XGS A;  2IJL A;  1F4K A;  1LEA A;  4M71 A;  2ZNZ A;  2VBZ A;  4N9I A;  2FOK A;  3BOQ A;  2QEN A;  3KFW X;  1ODD A;  2DLL A;  3JAM Z;  5TJJ A;  1FYL A;  3HTU A;  1F9N A;  2ZXJ A;  4I02 A;  3LQQ A;  2ZME A;  3MAJ A;  1IRG A;  1BOA A;  3JAM K;  2BV6 A;  3GO5 A;  5BOX A;  3T8T A;  1LB2 A;  4RB3 C;  3QU3 A;  3ABU A;  2M45 A;  4I01 A;  2HGC A;  4Y15 A;  3TDU C;  2Y48 A;  3Q9S A;  1FYK A;  3PQK A;  1T39 A;  2NS0 A;  2XAQ A;  4KDP A;  5BS6 A;  3B02 A;  4I7H A;  2QM3 A;  2P5K A;  3I53 A;  4BNC A;  1Z7U A;  1RIO H;  2A3S A;  4GO1 A;  4RGR A;  1FSE A;  1QZZ A;  1ZHF A;  1XCB A;  3Q5F A;  2L54 A;  4WXH A;  4Q5S F;  2AXL A;  4ON0 A;  2LF7 A;  2EB7 A;  3GZ5 A;  4KIG A;  4CZZ A;  1G3W A;  3GEZ A;  2ISZ A;  2W85 A;  5KK1 A;  4LG0 A;  4HOB A;  4EJT A;  2O03 A;  1SFU A;  4Y13 A;  1ZAR A;  2FSW A;  3LA2 A;  4QLC U;  3WTV C;  5ICF A;  4GCV A;  5E20 A;  2GQQ A;  1TLH B;  1IXS B;  2BE5 F;  4O5V A;  3WTU C;  2FML A;  5J8F A;  1KU2 A;  3G73 A;  1JXS A;  1UHM A;  3LQR A;  3T0Y A;  2EV0 A;  1ZRD A;  3DEU A;  4O3M A;  3VFZ A;  5LGN A;  4ESB A;  2DU9 A;  3K9T A;  1ZN2 A;  3GFI A;  2IW5 A;  5E8I A;  1XGO A;  3J80 Z;  2A07 F;  3K0L A;  3J80 K;  2L01 A;  1AWC A;  2XAS A;  2DK8 A;  1S7A A;  2VOO A;  3TQN A;  1KGS A;  4L5I A;  1IW7 F;  3F8M A;  3M8F A;  4OIQ F;  1LEB A;  1KU3 A;  4G9Y A;  2E1C A;  2XRN A;  4CHU A;  1W5T A;  1OR7 A;  1B9M A;  2O0Y A;  2P7C B;  4MHG A;  2VN2 A;  1D5V A;  5E1X A;  3WOD F;  4XLN F;  1FOK A;  5BPI A;  3KET A;  2ZKZ A;  5E17 F;  4ENJ A;  1XGM A;  1TTY A;  3VEP A;  2YR2 A;  1O3S A;  1W7P A;  4O6J A;  2TDX A;  4ZZD A;  2FRH A;  4GYI A;  4LD5 A;  1YO5 C;  3F72 A;  2XIG A;  3GFL A;  2E7W A;  4G8X A;  3CUO A;  1S6L A;  4XSX F;  3HUG A;  4GXO A;  4L5J A;  4A6E A;  1S7O A;  4ETS A;  1A04 A;  3F6O A;  3FHZ A;  1EH7 A;  2Y0M A;  1R36 A;  3PFI A;  3QPT A;  1XD7 A;  1SFX A;  4HDU A;  1FY7 A;  1P6R A;  1T98 A;  2ETH A;  2V79 A;  1GVJ A;  4Q4Z F;  5AON A;  4KMF A;  4ENM A;  2QWW A;  3QU6 A;  2UWM A;  4EJU A;  1ZG5 A;  1CF7 A;  3I71 A;  2O8X A;  2KJC A;  1EH6 A;  3G3Z A;  4HF0 A;  1WWX A;  3WTW C;  3NQO A;  4HAM A;  4EGZ A;  1MKM A;  4KA4 A;  1J7K A;  4HZF A;  1BIA A;  2MA3 A;  5HVQ C;  4LLL A;  1FBS A;  1FT9 A;  3I64 A;  5FD6 A;  4FX4 A;  2P6S A;  3KP5 A;  1P4X A;  2XRO A;  2CGP A;  4MEY F;  4PGG A;  1IN4 A;  3COA C;  3FM3 A;  1Y0U A;  2OZU A;  1SMY F;  1U78 A;  1XMA A;  3RDI A;  4AIK A;  2QBY B;  4OIN F;  3E5Q A;  2RNJ A;  4LGW A;  3RKW A;  3LAJ A;  3KE2 A;  5J6X A;  5ICE A;  2VE9 A;  1LJ9 A;  1Q1H A;  2VBW A;  2HDC A;  4MNU A;  5CVV A;  1EH8 A;  2QYO A;  3L2C A;  4IRG A;  6PAX A;  5H6Q A;  2UZK A;  4EVI A;  4TV7 A;  2L02 A;  4OIR F;  3WGH A;  4A5M A;  2Z9O A;  3HTS B;  1YS7 A;  4LK0 F;  3EDP A;  4M6Y A;  4D0P A;  3VOD A;  3QP5 A;  2F2E A;  3QP6 A;  2E1N A;  2F5D A;  2CG4 A;  3CO7 C;  1OPC A;  5DCF A;  4EQQ A;  2EFW A;  1IN6 A;  1ZYR F;  1FNN A;  2A5Y B;  2XHK A;  4U0W A;  2CWE A;  3ZN1 A;  1TNS A;  2W25 A;  1SD4 A;  1SFE A;  4OU0 A;  5CJ9 A;  2STT A;  2RVC A;  3W6J B;  2M30 A;  3IKT A;  3M7G A;  5HS7 A;  2PQ8 A;  2VE8 A;  4Q47 A;  4HX4 A;  3R61 A;  3C18 A;  3RKX A;  4RB2 C;  2IVM A;  4FX0 A;  1O57 A;  2HFH A;  3F8C A;  5JFR A;  5CVJ A;  4DQ2 A;  4QWQ A;  5LLQ A;  1XCV A;  3GFM A;  3SZT A;  3GXO A;  3ZPL A;  2FQ3 A;  2XKP A;  3HHH A;  3WTX C;  2YX4 A;  3RYP A;  1B9N A;  3JW4 A;  5DUK A;  1U5T A;  4HYE A;  1U8R A;  4U0V A;  3GLX A;  2LKP A;  5KVR A;  2MLK A;  3KP6 A;  2VT3 A;  3E97 A;  3EET A;  4CYD A;  2ESH A;  2RQP A;  3F8N A;  3V4G A;  1LVA A;  1ONV A;  3WGG A;  5AIP A;  2HOE A;  1FSH A;  4HLY A;  2MH9 A;  3GYH X;  5FD5 A;  1BJA A;  3V7C A;  1K6O A;  2FEZ A;  3CTA A;  4WK8 F;  4AWX B;  4WXC A;  3P9C A;  1UFM A;  1YW9 A;  4LLG F;  3MEX A;  2Q8K A;  1TQP A;  5F6F A;  2VC1 A;  1F1Z A;  4EMS A;  4OIP F;  4N9H A;  2V1D A;  2A6H F;  1BI1 A;  4FHT A;  1XDS A;  1FLI A;  4HV5 A;  3SFZ A;  2UXX A;  2OBP A;  2Z3Y A;  3U2R A;  3K1M A;  4M74 A;  4LJZ F;  3TOB A;  1G3T A;  2CO5 A;  2NNY A;  2GAU A;  5H6R A;  1ZRE A;  1F5T A;  1MJA A;  5FO5 A;  1C0W A;  1YFH A;  2OQG A;  1SD6 A;  1WKM A;  3O3K A;  4P9U A;  1MDM A;  1BM9 A;  1T2K A;  1U6G A;  4IXA A;  1JE8 A;  3BP8 A;  1XSX A;  2BGC A;  3F8F A;  2MBF A;  3SQN A;  2QUF A;  3BJ6 A;  3L9F A;  3FMS A;  3R6S A;  5HLI A;  4YIF A;  2Z33 A;  3L09 A;  3JTH A;  5DV5 A;  5IT3 A;  1DPR A;  1OYW A;  4LB6 B;  1WQ2 A;  5ICG A;  1I6X A;  3HSE A;  1D8K A;  3KEQ A;  5F64 A;  2VOD A;  5K5Q A;  2JZY A;  2K27 A;  3K1N A;  3RI4 A;  2KKO A;  5J8C A;  4UNO A;  3GW2 A;  1RUO A;  1YIO A;  3O6B B;  3ZMD A;  2WWY A;  3OV8 A;  4UHT A;  4LK1 F;  2KRF A;  4CDG A;  1Z9C A;  2V6C A;  2EA2 A;  4ENN A;  1NHA A;  1R1U A;  5HDK A;  3HSR A;  3W6K B;  4H0E A;  4WX9 A;  5FLX Z;  1IN5 A;  4BXU A;  4KT5 C;  5LRS A;  3E6D A;  4NQW A;  3RPU A;  4L0Y B;  3MFK A;  5FLX K;  3WE2 A;  5ICC A;  4AD9 A;  1IAW A;  4BAY A;  3M9A A;  1B4A A;  4R8H A;  1TQM A;  1YLF A;  5DD8 A;  1XB4 A;  1UCR A;  4KYW A;  3AAF A;  4S05 A;  3GX4 X;  1RNL A;  1W5S A;  3SHF A;  3M1E A;  1R22 A;  1ON1 A;  2E7X A;  3IKV A;  5LGT A;  4KN7 X;  5FGM A;  4N0B A;  1REP C;  1KQ0 A;  2XUB A;  2EK5 A;  2RN7 A;  5LHG A;  3DPT A;  2XAG A;  1FYM A;  3C1D A;  3GFJ A;  4KIC A;  2FA5 A;  1J59 A;  2ZNY A;  5E1W A;  5LRR A;  2YX7 A;  1ZLJ A;  2Q2E A;  5HLG A;  4PZJ A;  3ZN0 A;  4RB0 A;  4RB1 A;  1J5Y A;  3GWZ A;  4HQM A;  5TRD A;  4A0X A;  2EWN A;  3R0J A;  2D2W A;  1TBX A;  4E70 A;  2A61 A;  4EJV A;  1QO0 D;  3L7W A;  3KEO A;  3GUD A;  3HRU A;  1HW1 A;  1QQI A;  2PLY A;  2A6E F;  1B6A A;  4F7Z A;  3BPV A;  2ACJ A;  1MJ9 A;  4IHS A;  2FF4 A;  5BPD A;  2YPR A;  3LFK A;  4UVB A;  2CYY A;  3BY6 A;  4UUV A;  4MTE A;  1RZ4 A;  5EEG A;  1AOY A;  2GXG A;  2ZBK A;  1U5T B;  1O3T A;  1TQI A;  2QVO A;  2VC0 A;  2CFX A;  4BHC A;  4B8X A;  1R7J A;  5DCM A;  2OA4 A;  4U7B A;  2DO7 A;  1P4A A;  5EEH A;  3ZQ7 A;  2PJP A;  1KQ9 A;  1IF1 A;  4L9N A;  1G3Y A;  3WTZ A;  3CDH A;  2EA4 A;  5L3D A;  2V1U A;  5HDN A;  1OYY A;  4A6D A;  1H9T A;  2JPB A;  3ULQ B;  2ZJ2 A;  1HKQ A;  4CIC A;  4CO8 A;  1K79 A;  2EV6 A;  1T0F A;  2DI3 A;  4PDK A;  4R1H A;  1QGP A;  1PUE E;  4YII A;  2G7H A;  4HBL A;  5D8L B;  1ZAO A;  4MQ9 F;  1V3F A;  3QPH A;  4A2U A;  3ECO A;  2YSR A;  2HWV A;  3N97 A;  1L3L A;  3H3U A;  4I2O A;  1ZG3 A;  1VTN C;  1HW5 A;  2HR3 A;  4M9S A;  5D4S A;  1K78 A;  3GZ6 A;  2KJB A;  3E3V A;  3DXJ F;  1ZG1 A;  3O2P E;  3LAP A;  2PG4 A;  2VOP A;  4BHB A;  2QLZ A;  1V4R A;  1MDM B;  2CQK A;  2K4B A;  2IT0 A;  2Z99 A;  3TO9 A;  2MD5 A;  2MH2 A;  3WE3 A;  5JVT A;  2M8E A;  1WRJ A;  1I5Z A;  3DF8 A;  5HS9 A;  2IA1 A;  1HQC A;  1Z91 A;  5D8K B;  3CUQ B;  2VBX A;  3D5L A;  2PMU A;  4BHP A;  3HOS A;  3V8J A;  2FBI A;  1U2W A;  2IRF G;  2VBY A;  2V9V A;  3ZMZ A;  1YG2 A;  2FMY A;  2O3F A;  3I58 A;  4G7H F;  1HKT A;  1IRF A;  2FE3 A;  2H6C A;  1UB9 A;  2ZME B;  3FXR A;  3DP7 A;  1YQA A;  2RGV A;  1KU7 A;  4LB5 A;  5DUI A;  3TGN A;  1J75 A;  3BPX A;  2AS5 F;  1EV7 A;  3RPQ A;  1Z6T A;  1KYW A;  1P4W A;  1LQ1 A;  3ECH A;  2RV8 A;  3HRS A;  4M9Z A;  5L3C A;  3SZP A;  3EYY A;  2KIU A;  2GA2 A;  2HTJ A;  4UVC A;  2M1B A;  2NRA C;  3F6V A;  2R7F A;  4HX8 A;  2KIM A;  3FMR A;  2QQB A;  4R79 A;  3T5X A;  1S29 A;  3WTS C;  2V1X A;  1ZLK A;  1FBU A;  4I0A A;  5ILV A;  3D0S A;  3LWF A;  3NRV A;  2P6T A;  3K2Z A;  5A2Q Z;  1TNT A;  3I59 A;  4LG0 B;  3EQL F;  3I4P A;  3LA7 A;  2PFB A;  1FC3 A;  3ZMV A;  2OU2 A;  3T1B A;  2F5F A;  2VXZ A;  2COM A;  2EJR A;  1QPM A;  3B73 A;  5A2Q K;  2H09 A;  2HTS A;  4A5N A;  4YFX F;  1MD0 A;  4HW0 A;  3L00 A;  3J7A O;  4BQA A;  3ROU A;  4EJO A;  2NYX A;  4PCQ A;  1YTY A;  4ENK A;  4ZYE A;  2A69 F;  1B1B A;  3ERE D;  3H92 A;  4NHJ A;  2MC3 A;  2WTE A;  1S8N A;  3KLO A;  1MZB A;  3E6B A;  4M73 A;  1I27 A;  4JBA A;  2DAO A;  2B0L A;  1DPU A;  4ZH4 F;  4MEX F;  2VON A;  3WG9 A;  3FXU A;  3FM5 A;  3TO6 A;  3LA3 A;  3FMQ A;  1O3Q A;  1HXD A;  5HLH A;  5FFZ A;  3J81 Z;  1BBY A;  3E5X A;  3V7R A;  4G7Z F;  5D6E A;  5E1Z B;  1QZY A;  3J81 K;  3BJA A;  3K1P A;  2LNB A;  2FNP A;  1KQ8 A;  3GF2 A;  3HYI A;  1I1S A;  1Z1D A;  3P7N A;  1W7P B;  3E6M A;  2Q0O A;  2GA1 A;  3JSO A;  4LMY A;  3DFG A;  5LHI A;  4GGG A;  4IPA A;  2HS5 A;  2L4A A;  4A0Y A;  5DCM B;  5DYM A;  3MWM A;  3RYR A;  2F5C A;  2IA2 A;  5CVR A;  3I5U A;  3DKW A;  1MGT A;  4BH9 A;  4OMZ A;  1BI2 A;  2H27 A;  3QAH A;  4YG2 F;  2K86 A;  3F22 A;  2M5W A;  4G6D A;  2C6Y A;  4WWC A;  1HST A;  4LFU A;  3DV8 A;  2IPQ X;  1XN7 A;  2OD5 A;  3H3Z A;  4P9F A;  1CF7 B;  4YFN F;  3KZZ A;  1Z05 A;  2L4M A;  1LDD A;  2CSO A;  1H0M A;  1DDN A;  2O61 A;  1P2F A;  4EM1 A;  3HIF A;  3KZY A;  2G7U A;  3S2W A;  3TDZ C;  2BBY A;  2GWR A;  4U0Y A;  3HSF A;  4RAY A;  1ON2 A;  4HF2 A;  1IXC A;  4OIO F;  4IHT A;  3LST A;  1KYZ A;  1YW8 A;  2BYV E;  5LGU A;  2DW4 A;  4JQF A;  2DQL A;  3REO A;  3ISP A;  1HW2 A;  4UV8 A;  2XV4 S;  4HX7 A;  1JHF A;  2D45 A;  4HF1 A;  1W4M A;  4KUM A;  1ULY A;  2LDU A;  2NAZ A;  3RKY A;  3IRQ A;  4L9J A;  1O7L A;  5L3F A;  2CW0 F;  1DP7 P;  2HEO A;  1FWZ A;  1U5T C;  2K02 A;  3U1D A;  1YYV A;  1QNT A;  2YU3 A;  4UXN A;  5F1R A;  3R0A A;  3IHU A;  4HDV A;  3WTT C;  5D5X B;  1G4D A;  4EM0 B;  1DUX C;  2XVC A;  2H6B A;  4PGH A;  1R1V A;  2P5L C;  4P5O A;  3R4K A;  4UVA A;  3C7J A;  3V8L A;  1WSU A;  3KP2 A;  1GXQ A;  3CLO A;  2RDP A;  2P4W A;  3MCZ A;  1X3U A;  3HHG A;  4KIF A;  2HZT A;  4L9V A;  4M72 A;  1T38 A;  2EFP A;  2RKH A;  1IN7 A;  5JHU A;  5LEJ A;  1E2X A;  4A12 A;  1XSV A;  2FNA A;  3SXY A;  5D5U B;  3RTR A;  2H94 A;  2W24 A;  2Y75 A;  1IN8 A;  3IC7 A;  2LSO A;  2WV0 A;  2ZO4 A;  1LNW A;  5FFX A;  4IVN A;  4IRH A;  5H20 A;  2XKO A;  3E5U A;  3ZP5 A;  2HKX A;  3KLN A;  1D8J A;  5D6F A;  4P55 A;  3I0T A;  1O3R A;  1FP1 D;  3EUH A;  4CGZ A;  3RIR A;  5HS8 A;  3I59 B;  1ZH5 A;  3K69 A;  2XAF A;  1TW3 A;  1RI7 A;  4WCG A;  3JSP A;  2X4H A;  4ESJ A;  2PI0 A;  4IJA A;  4G7O F;  4KFC A;  1BIB A;  2DPU A;  2M87 A;  5HOO A;  2JTV A;  3CUQ C;  2HQN A;  2ADU A;  1T6S A;  2ISY A;  1SAX A;  5K5R A;  4FT8 A;  2ELH A;  5IT9 Z;  1W7P D;  2DK5 A;  5ILU A;  3BRO A;  5K1Y A;  2DFI A;  2DPD A;  3PQJ A;  1XSD A;  3DQV C;  5JI6 A;  5IT9 K;  4U88 A;  4XSZ F;  3I54 A;  1FPQ A;  3KP3 A;  1J9I A;  4XLP F;  2HYG D;  2JSC A;  4CXF A;  2EFO A;  3V7S A;  1GXP A;  1HBX G;  2OQR A;  4MTD A;  4JK1 X;  3F3X A;  5D5W B;  4KMU X;  1S3J A;  2STW A;  3GVA A;  5ERI A;  2J5P A;  4ZZL A;  1HSJ A;  4RGS A;  2GIV A;  1KA8 A;  2FXA A;  3BDD A;  2PMH A;  1B59 A;  4UV9 A;  2ZCW A;  4GYG A;  2IA0 A;  3TKY A;  2W57 A;  5CVU A;  3KP7 A;  3WGI A;  4MGR A;  4KNY A;  3R60 A;  4L0Z B;  2WC2 A;  2W84 A;  2XAH A;  1P92 A;  1H9G A;  3TO7 A;  3FX3 A;  1FP2 A;  5DD4 A;  4Q48 A;  2JT1 A;  2O6G E;  3CO6 C;  5FB2 A;  1CGP A;  2EFN A;  3JTG A;  2UXN A;  2HKO A; 
#chains in the Genus database with same CATH topology
 1USS A;  3IAS 2;  3WU2 C;  5HNF A;  3V8K A;  3E7L A;  3DBL B;  1TP4 A;  4HQE A;  3RJP A;  2LD5 A;  3BR6 A;  4CCL A;  2QQA A;  1PP7 U;  3TOA A;  3MZH A;  2LF8 A;  1FZP B;  2LC2 A;  1B72 B;  3Q9V A;  3NEU A;  4LOC A;  3DBH B;  5JR3 A;  1PUF A;  2PEX A;  3F21 A;  4HLX A;  2R5Y A;  4RLQ A;  2Z5U A;  1BC8 C;  3N4M A;  2I10 A;  2DBB A;  1L0O C;  1BC7 C;  1IZ1 A;  4E6K G;  2A68 F;  3BQZ A;  3ERM A;  2JPC A;  1E3P A;  2CUE A;  3M8E A;  4BL0 B;  1R1T A;  1BI0 A;  3QYE A;  2XPV A;  1T08 B;  4BYY A;  3P9I A;  3DEW A;  1M1E B;  3KCC A;  2FU4 A;  1LDJ A;  5L3E A;  1RUN A;  1BI3 A;  2DOF A;  4C9Y A;  1WI9 A;  5J40 A;  2K4J A;  1XMK A;  2RC4 A;  2EPF A;  3I56 I;  1ETK A;  1STZ A;  4I99 C;  4WF2 A;  4M6X A;  5CLS A;  3P9K A;  1JGS A;  1X4O A;  3HOX J;  1Z7L A;  1R00 A;  4KN4 X;  2OAZ A;  4Z2Y A;  1OR7 C;  1R5G A;  1DQU A;  3ZMS A;  5L3B A;  1SD7 A;  5LHH A;  2M8G X;  5CYV A;  3MQ0 A;  4G94 A;  5LEK A;  1D3Y A;  4KJZ A;  4ASN A;  2QQ9 A;  1AU7 A;  2GZW A;  2R3S A;  3BJO A;  4DYR A;  5F27 A;  2P8T A;  4RGX A;  3IRR A;  2AO9 A;  3DCF A;  4OAZ A;  4AIH A;  4EEF G;  3AG1 H;  2E1O A;  4CCJ A;  1TW2 A;  2GXB A;  3MZY A;  2L9N A;  2ZFW A;  5GPA A;  2BY0 A;  1K7A A;  2VAS A;  1IRZ A;  3U9G A;  1ETW A;  3D5R C;  3BWG A;  4S04 A;  2JRM A;  2QZ8 A;  2EIM H;  4ZYG A;  3N05 A;  3HRM A;  2VKE A;  5LD2 C;  3W2A A;  2D1H A;  2JJ7 A;  2OZ6 A;  1KU9 A;  2A5W A;  2EFQ A;  2G9W A;  2K7L A;  4ESF A;  1SMT A;  1Z6R A;  4B09 A;  4IRI A;  2NOG A;  3LSK A;  2J5O A;  5FRN A;  3WU0 A;  2FBK A;  2NNN A;  1E17 A;  1J09 A;  2QCO A;  5J1Y A;  3O8H A;  2DT5 A;  1GV5 A;  4AIJ A;  3FWE A;  2HYF A;  4PJN A;  4LLN A;  1YS6 A;  1BN5 A;  4QTR A;  3FZV A;  1X3Z B;  2X6W A;  5J1U A;  3OYL A;  3KP4 A;  3A4C A;  4NB5 A;  5L3G A;  4XON A;  2NS7 A;  2WAD A;  3ABT A;  3MMY B;  3HL2 A;  4ZYD A;  4A3K J;  1K4T A;  1U3E M;  3VOE A;  1RRJ A;  1OFC X;  5E18 F;  1UHW A;  2HQR A;  4XLF A;  2KRC A;  1ZGA A;  1OKR A;  3QRF F;  2H8W A;  2IP2 A;  2HPI A;  1IUY A;  3ZOB A;  2PBI A;  1FX7 A;  1X2N A;  1ZRF A;  2FBH A;  2DOD A;  4RAG A;  5ILS A;  2HOS A;  5B1B H;  3A02 A;  4DNC A;  2PN6 A;  2VT2 A;  1G6N A;  3ZMT A;  3T8R A;  5AIQ A;  2BZT A;  4E7K A;  1OMI A;  4M6V A;  1YW7 A;  2ESN A;  3IL2 A;  2Q2E B;  1DP3 A;  1QRY A;  4XL9 A;  3S2H J;  4EJW A;  2KLO A;  1X1A A;  1IDY A;  3D1N I;  5DDG A;  4P96 A;  2CQN A;  1IXR C;  2X1D A;  5K5O A;  1BW6 A;  4WXD A;  1ZQ3 P;  1HKS A;  4HV6 A;  2BVM A;  1JHH A;  3IWZ A;  3EYI A;  4RS8 A;  5KHD A;  3AG4 H;  2NVX J;  1FBQ A;  4B43 A;  1XGN A;  2L3D A;  1D1A A;  4E7Z A;  2EV5 A;  4KIB A;  3K70 C;  2MLG A;  3WU1 B;  3DEE A;  3IWF A;  2BW3 A;  2GM4 A;  2N8G A;  1QBJ A;  1G3S A;  2KRH A;  2DFE A;  3OYK A;  1OCT C;  3CLQ A;  3CZ6 A;  4DJA A;  2JWT A;  4IF4 A;  1I1G A;  3A0B C;  3PSI A;  5FKN A;  4DZP A;  3HOT A;  3S1N J;  3F23 A;  3ML6 A;  2KIF A;  2LG4 A;  1Y0N A;  3QOE A;  4XLH A;  5ED4 A;  4BE2 A;  1UHS A;  2P7V B;  4IQJ A;  3CJN A;  3TW6 A;  1YJW I;  5EZG A;  1R23 A;  4ZYH A;  4PJM A;  4XOP A;  4A3I J;  2XF7 A;  3WTY C;  4AVP A;  4U7D A;  3RQI A;  3VB2 A;  2F5E A;  1VQK I;  2X0L A;  2DQR A;  1W36 D;  3FF5 A;  3BZ6 A;  9ANT A;  4M3B A;  1MMG A;  2R7D A;  2CV1 A;  4RAZ A;  2VKD A;  3H9G A;  5BQT A;  2XAJ A;  1R4N B;  1Y56 A;  4XM3 A;  4I0B A;  3I4N J;  3Q3S A;  1SFO J;  3HRT A;  2IS2 A;  3OR2 C;  1PDN C;  1R5H A;  4L9T A;  3G1M A;  1O7F A;  5CVI A;  4C3J J;  2M7A A;  1ETQ A;  1WJA A;  3H5A A;  4G6Q A;  5K7H A;  1RET A;  3DPL C;  3PO2 J;  3IH3 A;  2YUS A;  5D5V B;  1SD5 A;  1J0R A;  3IUO A;  2P5V A;  4EV0 A;  2Z16 A;  2JVG A;  4HRI A;  1T56 A;  1TWC J;  3FXO A;  3QWL A;  1Y1V J;  1HDP A;  3PUB A;  3CCM I;  3BC8 A;  4XRF A;  2XPU A;  1R58 A;  4JOM A;  4I98 B;  2L0K A;  3DTE A;  4HA8 A;  3OYB A;  2VJ5 A;  2D1V A;  4EM2 A;  1J2X A;  1HDD C;  1A6I A;  3DKY A;  4FIS A;  5BMZ A;  4AYB A;  3F0C A;  4YFK F;  4MQV A;  5LBQ A;  2DA5 A;  4HNV A;  3H3V K;  1XDU A;  2JMW A;  4KIT B;  4K2E A;  3CCU I;  3KIO A;  1UST A;  2DOA A;  2A05 A;  4EGY A;  4CUG A;  3GTG J;  2ID3 A;  5DEQ A;  1GHC A;  3OWT A;  4A0Z A;  1ZGJ A;  2ZFU A;  2XGX A;  3C3W A;  1NG6 A;  3ZMU A;  3Q0V A;  2R7W A;  3OMY A;  2X85 A;  3FXQ A;  1XPX A;  4L18 B;  1OYI A;  1GUU A;  1MJB A;  2BEO A;  3DTI A;  2JRT A;  4MLO A;  2KZG A;  4A3J J;  4AM3 A;  1ZRC A;  1JTX A;  3BLY A;  3OOP A;  3P5J A;  3CCR I;  1RR7 A;  4XKW A;  1UMQ A;  4XBF A;  3L2V A;  5J4V A;  3A01 B;  4Y17 A;  5F04 A;  1TWG J;  2DTR A;  5GP9 A;  1VQ5 I;  4OOI A;  3CC7 I;  4BXX J;  1ENH A;  3RKQ A;  2K9Q A;  1PP8 F;  2HZD A;  3PIO F;  1ZR2 A;  1QZE A;  1I3Q J;  3HG9 A;  3H5R A;  4M9X A;  5HDG A;  4RGU A;  3OYE A;  3E6C C;  3ELK A;  1IV8 A;  1R5I D;  3GTJ J;  5E8G A;  1K78 B;  3C2B A;  4I09 A;  2W48 A;  3BQY A;  3QOP A;  5CQG A;  4OMY A;  3F8B A;  3CUQ A;  3H0G J;  2ZXW H;  1LDK B;  5D4R A;  1ETY A;  1P7J A;  2AQE A;  1YJN I;  2QBY A;  1XGS A;  2IJL A;  1E3H A;  3K4M A;  1F4K A;  1LEA A;  4M71 A;  4M3F A;  2ZNZ A;  4CZC A;  2VBZ A;  4N9I A;  2FOK A;  2DA3 A;  1P7I A;  3M1C A;  1MSF C;  4KT6 A;  2QEX I;  3BOQ A;  2QEN A;  3SEQ A;  4F92 B;  2KFD A;  2YS9 A;  2LMD A;  1YX5 A;  3KFW X;  1IUF A;  1ODD A;  2DLL A;  1SVO A;  2OJE D;  1R49 A;  2V4J C;  4PSW A;  3JAM Z;  1OCO H;  5TJJ A;  1FYL A;  3HTU A;  1Y1W J;  5IP6 A;  1F9N A;  2ZXJ A;  4I02 A;  3LQQ A;  2ZME A;  3H0D A;  2BY2 A;  3MAJ A;  2KIS A;  1IRG A;  1FOX A;  1BOA A;  5CKT A;  3RPU D;  3OYM A;  4ZYA A;  3JAM K;  1MBE A;  4FAS D;  1WI3 A;  2BV6 A;  3GO5 A;  5BOX A;  3T8T A;  1LB2 A;  4RB3 C;  2EZL A;  3QU3 A;  2FJ1 A;  3ABU A;  2M45 A;  2JVH A;  4I01 A;  2HGC A;  4Y15 A;  3TDU C;  1E3O C;  2Y48 A;  2ELK A;  4BXF A;  3Q9S A;  3E0J B;  1FYK A;  3M8J A;  3PQK A;  1T39 A;  2NS0 A;  4X1E A;  5F08 A;  2XAQ A;  4KDP A;  5BS6 A;  3FHN A;  1GVD A;  3CCE I;  3B02 A;  3A0H C;  3QYB A;  1AKH A;  3HOZ J;  2E5N A;  4Y3O A;  1G2H A;  4UB8 C;  3FK7 A;  4I7H A;  2QM3 A;  2P5K A;  3I53 A;  4BNC A;  1Z7U A;  5EG0 A;  1Z21 A;  2LKX A;  2JUC A;  1RIO H;  3E1S A;  2O7O A;  2A3S A;  4GO1 A;  1HOM A;  2EIL H;  2M3A A;  4RGR A;  1FSE A;  1QZZ A;  1ZHF A;  1XCB A;  3K4B A;  3Q5F A;  2L54 A;  4YEJ A;  4WXH A;  4Q5S F;  3LSG A;  3JRA A;  2AXL A;  4ON0 A;  2E5Z A;  2LF7 A;  5BNG A;  2EB7 A;  1EF4 A;  3GZ5 A;  4KIG A;  2LBF B;  4CZZ A;  3TP3 A;  1G3W A;  3GEZ A;  2ISZ A;  2R7T A;  5GTH C;  3L2Q A;  2W85 A;  1YI2 I;  5KK1 A;  1JJ6 C;  4LG0 A;  4HOB A;  2JA8 J;  4EJT A;  2O03 A;  2H1L A;  2XGE A;  1SFU A;  2BVL A;  4Y13 A;  2P0W A;  1ZAR A;  1LFP A;  2FSW A;  3LA2 A;  4QLC U;  5ICF A;  3WTV C;  4GCV A;  5E20 A;  2GQQ A;  1TLH B;  1IXS B;  3QPL A;  1EJ9 A;  2BE5 F;  5KAI C;  4O5V A;  3WTU C;  2QKL B;  2FML A;  5J8F A;  1KU2 A;  3CCQ I;  1QHG A;  1U9O A;  4DGW B;  2JN6 A;  3G73 A;  1JXS A;  4M3G A;  3NWT A;  1UHM A;  3LQR A;  3T0Y A;  2EV0 A;  1ZRD A;  3DEU A;  3MKY B;  1Y8Q B;  4JYK A;  4J00 A;  1PJR A;  4O3M A;  3VFZ A;  2EZI A;  5LGN A;  2QGU A;  4ESB A;  1WJD A;  2OTJ I;  2DU9 A;  3K9T A;  1ZN2 A;  2DJI A;  2HOT A;  3GFI A;  2LY2 A;  2LY9 A;  2IW5 A;  5E8I A;  1XGO A;  3J80 Z;  1LFB A;  1FOW A;  2HNH A;  1BOB A;  2LYC A;  2A07 F;  2HXI A;  3K0L A;  2EZK A;  2ZXH A;  1QA6 A;  1MW7 A;  4LIV A;  3PUF A;  2JSP A;  3HKZ A;  3J80 K;  1CQT A;  1O4X A;  3LNQ A;  2L01 A;  1VQL I;  5GAH J;  1AWC A;  2XAS A;  2DK8 A;  1S7A A;  2VOO A;  1QU3 A;  3TQN A;  4ITV A;  1JT0 A;  1KGS A;  4L5I A;  1IW7 F;  3F8M A;  3M8F A;  4D9J A;  5B66 C;  4OIQ F;  2O9L A;  1LEB A;  4DBR A;  1KU3 A;  1WVR A;  2PJR B;  4V2G A;  4G9Y A;  2E1C A;  2XRN A;  3AL0 B;  4I6Z A;  4CHU A;  1W5T A;  1OR7 A;  1B9M A;  2O0Y A;  2P7C B;  3HOW J;  4MHG A;  2VN2 A;  2DXI A;  1D5V A;  2GLO A;  5E1X A;  2X51 A;  3WOD F;  5J4Y A;  4XLN F;  1FOK A;  5C3E J;  5BPI A;  1JUS A;  3KET A;  4YIR X;  2CW8 A;  1QVU A;  2E2J J;  2ZKZ A;  3OS1 A;  2V1N A;  5E17 F;  4ENJ A;  1XGM A;  1TTY A;  2HOA A;  4XK4 A;  2YR2 A;  3VEP A;  4BEH B;  2MAB A;  3OYF A;  1O3S A;  4C2U A;  1W7P A;  4BBS J;  1RC9 A;  3JRH A;  3KEY A;  2M2E A;  4O6J A;  3ZXS A;  2TDX A;  1VND A;  4ZZD A;  2FRH A;  1ACI A;  4BQO A;  3DU6 A;  4GYI A;  4LD5 A;  2WY7 Q;  2Y2Z A;  1YO5 C;  1X19 A;  3F72 A;  2XIG A;  3GFL A;  1GV2 A;  3K4C A;  2E7W A;  5F1J A;  4G8X A;  3CUO A;  1S6L A;  4XSX F;  3HUG A;  2EH3 A;  4GXO A;  4L5J A;  2VUM J;  4A6E A;  1S7O A;  4ETS A;  3S3M A;  2DDA A;  1A04 A;  2F6C A;  2V26 A;  3CP2 A;  3F6O A;  1MIJ A;  3JRG A;  4A69 C;  3FHZ A;  1ITY A;  1WJ5 A;  2Z1D A;  5IP9 J;  1QVT A;  1EH7 A;  2E35 A;  2Y0M A;  4HNU A;  1R36 A;  3PFI A;  2Y9Y A;  3QPT A;  4ZDP A;  3D5S C;  4F52 A;  2Y30 A;  1XD7 A;  1SFX A;  4HDU A;  1FY7 A;  1P6R A;  2DTZ A;  1T98 A;  1SVL A;  2ETH A;  2W7N A;  2V79 A;  1D5Y A;  1GVJ A;  2R7S A;  2KDZ A;  2MGQ A;  5IPA A;  5AON A;  4Q4Z F;  4KMF A;  1YIT I;  3MKW B;  2K85 A;  4PFO A;  4ENM A;  2QWW A;  3QU6 A;  2VB6 A;  2UWM A;  4EJU A;  3QPS A;  3G1L A;  3EUA A;  1ZG5 A;  3CF5 F;  4CA0 A;  4NBQ A;  5M3M J;  1CF7 A;  3HBL A;  3GTL J;  1HLV A;  3K70 D;  1BR1 A;  1BR2 A;  2EIK H;  3I71 A;  2O8X A;  2PX9 A;  2KJC A;  3DKX A;  3PFY A;  4IHY A;  1KZH A;  4QIW N;  1YRN A;  1BA5 A;  1EH6 A;  2IGN A;  1RPW A;  2IEK A;  2Q1Z B;  3G4S I;  4IZZ A;  3OYI A;  3G3Z A;  4HF0 A;  1WWX A;  3WTW C;  1XG1 A;  3NQO A;  4HAM A;  1MKM A;  4EGZ A;  3W2V A;  2DDB A;  4XIC A;  4KA4 A;  1J7K A;  2Y0S N;  1VQO I;  2EQR A;  1WJE A;  4HZF A;  3GTP J;  3ZQG A;  5H2F C;  3CJT B;  2VPL A;  1BIA A;  2MA3 A;  5HVQ C;  4LLL A;  1FBS A;  1FT9 A;  3I64 A;  2L7K A;  5JVG F;  4XRM A;  3H36 A;  1LE8 A;  4A3L J;  5FD6 A;  1K6Y A;  4ZJZ A;  5TIS C;  3K7A J;  4IHW A;  2X6Y A;  4FX4 A;  3HPH A;  3K10 A;  2P6S A;  3KP5 A;  3JRI A;  1T8I A;  5FKO A;  3S15 J;  4DYC A;  1P4X A;  5IOZ A;  2XRO A;  2E1M C;  2CGP A;  4MEY F;  4PGG A;  1IN4 A;  2XPW A;  3COA C;  3FM3 A;  1Y0U A;  3EUH C;  4A3C J;  2NVT J;  3PIP F;  3GME A;  3JRE A;  1V5E A;  2OZU A;  4FCY A;  1SMY F;  1U78 A;  4XRS G;  3CMM A;  1XMA A;  4NUB A;  3I55 I;  3RDI A;  4AIK A;  2R7Z J;  3VYS B;  4BU2 A;  2QBY B;  4OIN F;  3E5Q A;  1N77 A;  2BHY A;  3BCA A;  2RNJ A;  4LGW A;  4PSX A;  3RKW A;  1ZGW A;  1AHD P;  3LAJ A;  1X1D A;  3KE2 A;  3FXK A;  5J6X A;  5ICE A;  2R7Q A;  2VE9 A;  1LJ9 A;  5KAF C;  1TWF J;  1Q1H A;  2VBW A;  2HDC A;  3L2U A;  4FET A;  4MNU A;  5CVV A;  3S93 A;  1EH8 A;  1IJW C;  2XB0 X;  4IOC F;  2QYO A;  4BBR J;  3L2C A;  3MVP A;  4IRG A;  2DA7 A;  6PAX A;  1HF0 A;  1SEU A;  2WB1 A;  4CH7 A;  5H6Q A;  2UZK A;  4EVI A;  4KIS A;  4TV7 A;  4AUX A;  3MKZ A;  3PJR A;  2L02 A;  2XDV A;  4OIR F;  3OOU A;  3WGH A;  4A5M A;  2HVS A;  1VQP I;  3FIW A;  4GRI A;  4H4K C;  3S1R J;  2Z9O A;  1YS7 A;  3HTS B;  4LK0 F;  4JP0 A;  4BAC A;  2D5V A;  2DT6 A;  3EDP A;  4M6Y A;  1FOY A;  4BS9 A;  4PUS A;  2I5U A;  1QPI A;  4D0P A;  3VOD A;  3TP0 A;  3SZG A;  3QP5 A;  2F2E A;  2L9S A;  1OIS A;  3QP6 A;  2VKH A;  2E1N A;  2WAQ N;  2F5D A;  2CG4 A;  2OCE A;  3CO7 C;  1OPC A;  5DCF A;  1D0Z A;  4EQQ A;  2JA6 J;  2EFW A;  3KYC B;  3DTK A;  1IN6 A;  2COB A;  1ZYR F;  1FNN A;  2A5Y B;  2V9P A;  3ZQQ A;  1HCR A;  2VI6 A;  5DTD A;  2XHK A;  4U0W A;  3CJR B;  4FTH A;  2LR8 A;  2CWE A;  3ZN1 A;  1TNS A;  2W25 A;  5LFA A;  4IHV A;  2R7O A;  1SD4 A;  2XC7 A;  1SFE A;  4OU0 A;  2ECB A;  5CJ9 A;  3GTQ J;  2STT A;  2RVC A;  3W6J B;  2MYS A;  4XNF A;  1FIP A;  1T0F C;  1TL8 A;  2XGD A;  1X2M A;  2CUF A;  2VJJ A;  4BUP A;  2CQ7 A;  2M30 A;  3IKT A;  3M7G A;  5HS7 A;  2PQ8 A;  2YU9 J;  1D0Y A;  2VE8 A;  3ZQH A;  1P9Q C;  4Q47 A;  4HX4 A;  2M34 A;  3R61 A;  1LKX A;  3OYJ A;  3C18 A;  3RKX A;  4RB2 C;  2OTL I;  4A3G J;  1I39 A;  2IVM A;  3CJQ B;  4FX0 A;  4XLE A;  4F91 B;  4XRS A;  1YE9 A;  2X48 A;  1O57 A;  5KNL A;  3JRD A;  3BG7 A;  1VQ9 I;  2HFH A;  3F8C A;  5JFR A;  1S72 I;  5CVJ A;  4BY7 J;  3G1O A;  4DQ2 A;  4QWQ A;  5LLQ A;  1XCV A;  5IYC J;  4PJL A;  5FKK A;  4BGD A;  1OCP A;  2DFF A;  1MND A;  3GFM A;  1VQ6 I;  4II2 A;  3LSI A;  3PNV A;  1UAA A;  3SZT A;  2E1M B;  3S16 J;  3S32 A;  2A6T A;  2M4K A;  3GXO A;  1MH3 A;  3ZPL A;  4HST A;  2LFB A;  3KYD B;  2FQ3 A;  2XKP A;  3HHH A;  2DA4 A;  4FQG A;  4B3A A;  5E3N A;  3WTX C;  1IO2 A;  2YX4 A;  3LL7 A;  3OIO A;  3RYP A;  5E3M A;  3IV5 A;  1B9N A;  1SFK A;  3JW4 A;  5DUK A;  1U5T A;  3L2R A;  4HYE A;  1U8R A;  4U0V A;  4BJ5 C;  4UUS B;  3GLX A;  1JUM A;  1IG7 A;  3GZN B;  4IL6 C;  2LKP A;  5KVR A;  4BQN A;  2MLK A;  4F93 B;  3KP6 A;  2VT3 A;  3E97 A;  3EET A;  5M5X J;  3VSL A;  4CYD A;  2ESH A;  2RQP A;  5B5E C;  1NH3 A;  3F8N A;  3V4G A;  1LVA A;  1ONV A;  3WGG A;  5AIP A;  2DA6 A;  2HOE A;  2UUZ A;  3GBG A;  5B1A H;  1FSH A;  4ANJ A;  2KHM A;  4HLY A;  2MH9 A;  3GYH X;  1VQ7 I;  2R7X A;  5FD5 A;  1BJA A;  4CYC A;  3LSR A;  3V7C A;  3KZI C;  1K6O A;  3S17 J;  2FEZ A;  3CTA A;  2QSF X;  4WK8 F;  4AWX B;  4WXC A;  3P9C A;  2CW7 A;  2DA1 A;  1UFM A;  1YW9 A;  4LLG F;  1DU0 A;  3AG2 H;  3MEX A;  2Q8K A;  1TQP A;  5F6F A;  5K7Z A;  5IYD J;  1WPK A;  2VC1 A;  3CC4 I;  1F1Z A;  4EMS A;  4OIP F;  2E71 A;  4N9H A;  5FLV A;  1JKP C;  2HPM A;  2V1D A;  2A6H F;  3HPG A;  2IGM A;  3G2B A;  1BI1 A;  3JCU C;  5F0H A;  4FHT A;  1XDS A;  1FLI A;  4HV5 A;  3PSF A;  3SFZ A;  2UXX A;  3M3Y J;  1YX3 A;  4A93 J;  2OBP A;  2Z3Y A;  3U2R A;  3K1M A;  2KPM A;  4M74 A;  4LJZ F;  5J47 A;  3TOB A;  3B6C A;  1G3T A;  1LVK A;  2CO5 A;  2NNY A;  3ZQC A;  2GAU A;  2W82 A;  4YRV A;  1V5G A;  2XB5 A;  3W2W A;  5H6R A;  2KL4 A;  1F5T A;  2IXS A;  1ZRE A;  2ME6 A;  4DZJ A;  1MJA A;  3FXM A;  2MW8 A;  5FO5 A;  1Y6I A;  1C0W A;  1POG A;  1YFH A;  3S1Q J;  2OQG A;  2OUM A;  2IAI A;  2KT0 A;  2VQC A;  1SD6 A;  1R9T J;  4DYQ A;  2DFH A;  1V54 H;  1WKM A;  3BG9 A;  2K9S A;  3O3K A;  3FBI B;  4P9U A;  2X6O A;  1IGN A;  1MDM A;  1BM9 A;  2CMP A;  3GLL A;  1T2K A;  3QOD A;  1RKW A;  1U6G A;  1W1W E;  2BXY A;  4IXA A;  4E7J A;  3S3N A;  1JE8 A;  1JGG A;  3BP8 A;  4YEL A;  1XSX A;  2BGC A;  3F8F A;  3C2H A;  2ME0 A;  2MBF A;  3HJE A;  3SQN A;  2QUF A;  3BJ6 A;  1JKO C;  1UJ8 A;  3JRF A;  3L9F A;  3FMS A;  2MD0 A;  2NVU B;  2RAE A;  3R6S A;  5HLI A;  1B72 A;  4YIF A;  2Z33 A;  3L09 A;  3JTH A;  5M5Y J;  5DV5 A;  3OIQ A;  4AC0 A;  5IT3 A;  1DPR A;  1OYW A;  3BTC A;  2NVY J;  4LB6 B;  3LSP A;  1WQ2 A;  3GCM A;  2EIN H;  5ICG A;  3AKZ A;  3CCS I;  1I6X A;  3HSE A;  3FDY A;  5GTI C;  4X0G A;  4CCO A;  1D8K A;  3L1P A;  1YRN B;  3KEQ A;  2R7V A;  3UKG A;  5F64 A;  2VOD A;  2OC6 A;  2F48 A;  5K5Q A;  1MSE C;  4BE0 A;  2JZY A;  2K27 A;  2V7F A;  3K1N A;  1X3W B;  3FIS A;  4C30 A;  3RI4 A;  2KKO A;  5J8C A;  1WJC A;  3S8P A;  3FK6 A;  3GW2 A;  1RUO A;  3BR3 A;  4UNO A;  1YIO A;  4HG2 A;  2GBY A;  3OYG A;  3O6B B;  3ZMD A;  2M9H A;  2WWY A;  3OV8 A;  4UHT A;  3AL0 C;  4LK1 F;  2KRF A;  4CDG A;  3BG6 A;  3KYL A;  5M5W J;  4RMN A;  2M4G A;  1Z9C A;  1RES A;  2V6C A;  1VFC A;  1PUF B;  2IS1 A;  2EA2 A;  3FBN B;  4ENN A;  4RLF A;  2HXO A;  2X1E A;  1NHA A;  5E3L A;  1I3A A;  1R1U A;  2R5Y B;  5HDK A;  3HSR A;  3J7Z I;  2CV2 A;  3W6K B;  4H0E A;  4WX9 A;  5FLX Z;  2LK2 A;  1FIA A;  1IN5 A;  1JI8 A;  4BXU A;  1FMV A;  3CQZ J;  4KT5 C;  5C4X J;  1NK2 P;  5LRS A;  3E6D A;  4NQW A;  3RPU A;  4L0Y B;  2M0C A;  3MFK A;  2AXT C;  5FLX K;  4D7M A;  3WE2 A;  1MMD A;  5ICC A;  5JLW A;  4BDY A;  3BTL A;  4AD9 A;  1IAW A;  4BAY A;  3CCY A;  3M9A A;  1T95 A;  4MO7 A;  1B4A A;  5EGO A;  3CMY A;  2AHQ A;  1PVE A;  1JTY A;  4R8H A;  2NS8 A;  5EYR A;  1TWA J;  1TQM A;  1YLF A;  4ZTJ A;  5DD8 A;  1XB4 A;  1UCR A;  2DYS H;  4KYW A;  5CQE A;  3AAF A;  4S05 A;  2EZH A;  4LIU A;  3GX4 X;  1RNL A;  1W5S A;  1WH5 A;  2PMZ N;  3M1E A;  5JLX A;  2CQQ A;  1R22 A;  1ON1 A;  3SHF A;  3OIP A;  1GDT A;  4D1Q A;  2E7X A;  2R7R A;  5GAG J;  1TZL A;  2M0M A;  3IKV A;  4C3I J;  4BDZ A;  2H1K A;  5LGT A;  3PM1 A;  1Z3X A;  4KN7 X;  5FGM A;  2FQ4 A;  2X6X A;  4GDF A;  4N0B A;  5FKL A;  1REP C;  1KQ0 A;  2XUB A;  2FOW A;  1XX5 A;  3TL4 X;  2EK5 A;  2RN7 A;  2RQQ A;  1VQN I;  5LHG A;  3DPT A;  2OPT A;  1Q1V A;  1YIJ I;  3K4N A;  2JUG A;  2XAG A;  1FYM A;  3C1D A;  1V5F A;  3GFJ A;  1A5J A;  1TC3 C;  1Z67 A;  4KIC A;  4RBO A;  2VLA A;  3NAR A;  3DLA A;  2FA5 A;  1X58 A;  1J59 A;  3JRB A;  2ZNY A;  2QQ8 A;  5E1W A;  5LRR A;  4ABZ A;  2YX7 A;  4XN0 A;  1ZLJ A;  2Q2E A;  3DWL E;  5HLG A;  4NC6 A;  4PZJ A;  2K40 A;  3ZN0 A;  4RB0 A;  4RB1 A;  1GT0 C;  2ZSI B;  1J5Y A;  3GWZ A;  4HQM A;  4B3X A;  4J01 A;  5TRD A;  4A0X A;  1EKE A;  2EWN A;  3R0J A;  1OLT A;  4F3Q A;  3X2Q H;  4ZZL A;  2D2W A;  5EF6 A;  1TBX A;  4E70 A;  2A61 A;  4EJV A;  1QO0 D;  3L7W A;  1MBG A;  3KEO A;  2V6E A;  3S1M J;  3WHC A;  3GUD A;  3HRU A;  1BR4 A;  1HW1 A;  3CCV I;  3CMA I;  2IS4 A;  1QQI A;  1TWH J;  2GXA A;  3ESW B;  2PLY A;  1YHQ I;  1X1P A;  2FX0 A;  4E7I A;  2AQF A;  2A6E F;  2E60 A;  1IDZ A;  4A3M J;  1FEX A;  4AID A;  1B6A A;  4F7Z A;  3BPV A;  2ACJ A;  1MJ9 A;  3BZK A;  2Y69 H;  4IHS A;  2Y9Z A;  2CJJ A;  4Y4R A;  2M7B A;  3PNY A;  2FF4 A;  5BPD A;  1T33 A;  2GOX B;  4I76 A;  2YPR A;  3LFK A;  2G0E A;  4UVB A;  3CDI A;  3ZGK A;  2CYY A;  3BY6 A;  4JX5 A;  4J19 A;  3Q0U A;  4HPQ A;  2LRE A;  4UUV A;  1SAN A;  2PMZ A;  4P1W A;  4MTE A;  2IGK A;  1IC8 A;  2NVQ J;  1TT5 B;  1RZ4 A;  5EEG A;  2X9D A;  3JRC A;  1WJF A;  2BW3 B;  3BTI A;  2XF6 A;  4C2M J;  4PJJ A;  1AOY A;  2DJN A;  2WY8 Q;  1XC5 A;  3OY9 A;  3U21 A;  2GXG A;  2ZBK A;  1U5T B;  4HEA 2;  1O3T A;  3ABM H;  1TQI A;  2QVO A;  1D1B A;  1Y8R B;  2VC0 A;  5K7F A;  1W0T A;  3GTK J;  2CFX A;  4BHC A;  1JT6 A;  1YJ9 I;  4B8X A;  1R7J A;  4A3F J;  1MBJ A;  5DCM A;  2OA4 A;  3FKI J;  5J3L A;  4A3B J;  3J7Y J;  4XKC A;  4U7B A;  2DO7 A;  1P4A A;  3M07 A;  5EEH A;  3ZQ7 A;  1AA7 A;  4NNJ A;  5GAE J;  3HZJ A;  5M3F J;  2PJP A;  4EAT A;  1KQ9 A;  1IV6 A;  1IF1 A;  4L9N A;  1G3Y A;  3WTZ A;  3CDH A;  2EA4 A;  5L3D A;  2V1U A;  5HDN A;  1OYY A;  4A6D A;  4HSR A;  1H9T A;  4MIM A;  1ETO A;  2JPB A;  4ZDO A;  3ULQ B;  3TW7 A;  2E2I J;  1FTT A;  2ZJ2 A;  2L7M P;  3LMM A;  5JHF A;  2LTP A;  1HKQ A;  4CIC A;  4CO8 A;  4A3D J;  4A3E J;  1K79 A;  2WA0 A;  2EV6 A;  1T0F A;  2DI3 A;  2CFO A;  4PDK A;  4R1H A;  4OAY A;  1QGP A;  1W0U A;  1PUE E;  2WV1 A;  1MBF A;  4YII A;  4E7H A;  2G7H A;  4HBL A;  2CUZ A;  5D8L B;  4Z6Y A;  1NG7 A;  2R92 J;  2EIJ H;  4RA2 A;  1ZAO A;  4MQ9 F;  1K61 A;  1V3F A;  3QPH A;  3CC2 I;  2F4M B;  4A2U A;  3ECO A;  4UUT A;  2YSR A;  3NWS A;  2DCE A;  2HWV A;  4BY1 J;  3A01 A;  3N97 A;  1L3L A;  2ZJQ F;  3H3U A;  5F0F A;  4I2O A;  1VQ8 I;  2QF7 A;  4Y33 A;  3K4K A;  4QPO A;  3IAM 2;  3K2A A;  3PL8 A;  1ZG3 A;  3BZC A;  1VTN C;  3I4M J;  1HW5 A;  2HR3 A;  2TRT A;  4M9S A;  5CPR B;  5D4S A;  1KON A;  3S3O A;  2O5R A;  1K78 A;  3GZ6 A;  4RM3 A;  3LFU A;  3ZCO A;  2KJB A;  3E3V A;  2CUJ A;  2GOM A;  3DXJ F;  1MMA A;  3OL4 A;  3O2P E;  1ZG1 A;  1A31 A;  3LAP A;  2PG4 A;  1WFX A;  2EBI A;  2VOP A;  4BHB A;  2QLZ A;  4DIQ A;  1XTA A;  1V4R A;  5DS9 A;  4M3D A;  3VWB A;  1MDM B;  2CQK A;  2K4B A;  2IT0 A;  4BQQ A;  3G71 I;  2Z99 A;  2L9R A;  3ASO H;  3TO9 A;  1DGR M;  4RAF A;  2QKM B;  3BCB A;  2MD5 A;  5C4J J;  5E79 C;  1IRX A;  2MH2 A;  3WE3 A;  2K9M A;  5JVT A;  2R5Z A;  2M8E A;  1WRJ A;  1I5Z A;  3DF8 A;  1OCZ H;  1ZKG A;  5HS9 A;  2IA1 A;  1HQC A;  3FXJ A;  1G8X A;  1Z91 A;  3ZQI A;  1WGX A;  3CF2 A;  5D8K B;  2JA7 J;  3CUQ B;  2W1O A;  2VBX A;  3D5L A;  1GLN A;  2PMU A;  4BHP A;  3BTJ A;  4XR6 A;  3PO3 J;  3O8G A;  3SYT A;  3HOS A;  2VQH A;  3V8J A;  2FBI A;  2ZSH B;  4E7L A;  3VSK A;  1U2W A;  2IRF G;  2VBY A;  3RZD J;  4HNT A;  2V9V A;  3ZMZ A;  1U0J A;  4L5E A;  4XKB A;  1YG2 A;  2FMY A;  4DW6 A;  2O3F A;  3I58 A;  3QYF A;  4G7H F;  1HKT A;  1IRF A;  4D5C A;  4IO9 F;  2FE3 A;  2H6C A;  3SDG A;  2DOE A;  1UB9 A;  2JA5 J;  2ZME B;  3FXR A;  3RQ4 A;  3HXL A;  1UG2 A;  1YQA A;  3DP7 A;  2IBD A;  2RGV A;  2OV7 A;  1KU7 A;  2LH9 A;  4LB5 A;  1S5L C;  5DUI A;  3TGN A;  5HLT A;  1J75 A;  3BPX A;  2AS5 F;  1EV7 A;  3RPQ A;  1Z6T A;  1KYW A;  4F55 A;  1P4W A;  1NTC A;  5HNH A;  3HOV J;  1YOV B;  2LBF A;  2WBM A;  3BG5 A;  1LQ1 A;  4PFP A;  4AVZ A;  3ECH A;  2RV8 A;  4PJ0 C;  3HRS A;  3DLL F;  1LPQ A;  4M9Z A;  2DA2 A;  4NQW B;  5L3C A;  1V55 H;  2MC4 A;  3U1K A;  2Y0S A;  5EZH A;  3SZP A;  1AKH B;  3EYY A;  2KIU A;  2GA2 A;  2HTJ A;  3I3L A;  4UVC A;  2M1B A;  3HEF A;  3B6A A;  2NRA C;  3F6V A;  4XID A;  5EG0 B;  3CCJ I;  1TT0 A;  3MD2 A;  5EGO B;  3G6E I;  2R7F A;  2VXD A;  4XOT A;  4HX8 A;  2KIM A;  4DOZ A;  1OJL A;  1SAU A;  2QQB A;  3FMR A;  4R79 A;  4C3H J;  3SJM A;  1PYV A;  2ZXI A;  3T5X A;  1S29 A;  4NC7 A;  3WTS C;  2VQG A;  4N4O B;  1ZEL A;  1JJ8 C;  2V1X A;  4XLC A;  1ZLK A;  1FBU A;  1BJZ A;  4I0A A;  5ILV A;  3D0S A;  2RNG A;  3LWF A;  2NXN B;  3NRV A;  1WZ2 A;  1ERD A;  2P6T A;  2XSJ C;  3C2G A;  3VYR B;  4D5F A;  1UEL B;  2K9N A;  1X1C A;  2E34 A;  3K2Z A;  1TNT A;  3I59 A;  5A2Q Z;  1LFU P;  3EQL F;  4LG0 B;  3I4P A;  1VQ4 I;  3LA7 A;  1X1B A;  1A36 A;  2DMT A;  2PFB A;  2W4S A;  3V42 A;  1FC3 A;  2OU2 A;  3WHB A;  3ZMV A;  1ZTR A;  2HQ5 A;  4QPQ A;  3T1B A;  2F5F A;  2VXZ A;  1R6R A;  2COM A;  2EJR A;  1A35 A;  1QPM A;  3B73 A;  5A2Q K;  2H09 A;  2HTS A;  4A5N A;  2E2H J;  4YFX F;  1MD0 A;  4HW0 A;  3SFI A;  4Y7N J;  3L00 A;  3J7A O;  1FTZ A;  3HOY J;  1WJB A;  2V9K A;  3EUK L;  4BQA A;  2LLK A;  4D7N A;  2F4O B;  4NDL A;  4XQF A;  3ROU A;  4EJO A;  4B1R A;  2UV1 A;  2NYX A;  4BJT A;  1HA8 A;  4XN3 A;  4PCQ A;  1YTY A;  2LKS A;  3S14 J;  3NAU A;  3CDL A;  4ENK A;  2PJR A;  2CU7 A;  4BKX A;  4ZYE A;  1ETV A;  5GAD J;  3BR2 A;  4IX7 A;  2NOJ B;  3WG7 H;  2X1C A;  2ZJP F;  3OS0 A;  2A69 F;  2B63 J;  2KDO A;  2KMU A;  4AYB N;  4LG3 A;  3VDX A;  1B1B A;  2H8R A;  3ERE D;  3H92 A;  5EEA A;  4NHJ A;  4IKF A;  2MC3 A;  3ABL H;  2WTE A;  1S8N A;  3HGG A;  1QHH D;  2VKV A;  4DBQ A;  3KLO A;  1MZB A;  3E6B A;  4M73 A;  1I27 A;  4JBA A;  4BEH A;  2W00 A;  2DAO A;  2B0L A;  2ZC2 A;  2JA2 A;  1DPU A;  4ZH4 F;  4MEX F;  2VON A;  3WG9 A;  3FXU A;  1F43 A;  2WAQ A;  3FM5 A;  3TO6 A;  1JUP A;  2E19 A;  1HC8 A;  3LA3 A;  3FMQ A;  1O3Q A;  1HXD A;  2B9S A;  5HLH A;  4PK4 A;  1EA3 A;  5FFZ A;  5DM6 F;  3J81 Z;  1BBY A;  3E5X A;  3V7R A;  3DPU A;  2DT7 B;  2KIQ A;  3ZQF A;  4G7Z F;  1B8I A;  2KP6 A;  3BR5 A;  5D6E A;  5E1Z B;  2VL8 A;  4Y52 J;  2QSH X;  2HDD A;  1QZY A;  1A6Q A;  1Z77 A;  2DMP A;  2MFZ A;  3J81 K;  3BJA A;  3K1P A;  2LNB A;  2FNP A;  1KQ8 A;  3GF2 A;  3HYI A;  1I1S A;  3Q0W A;  1Z1D A;  3LSJ A;  4IEJ A;  3P7N A;  3GTM J;  1W7P B;  3MKL A;  4RDU A;  3E6M A;  4JX4 A;  3JR9 A;  1OCC H;  2Q0O A;  3K4L A;  2GA1 A;  3JSO A;  4LMY A;  5IP7 J;  3DFG A;  3LSM A;  5LHI A;  3K4J A;  2XF5 A;  4GGG A;  1OQY A;  1MNM C;  4IPA A;  2F5V A;  4U87 A;  3OSF A;  1H88 C;  3HUG B;  2HS5 A;  1U8B A;  4BJ6 C;  2L4A A;  4A0Y A;  5DCM B;  4XLA A;  5DYM A;  3MWM A;  1MH4 A;  2R93 J;  3LOC A;  3W6V A;  5B3S H;  1RR8 C;  3RYR A;  2BOL A;  2F5C A;  2IA2 A;  3OYN A;  5CVR A;  1I50 J;  3I5U A;  4JX6 A;  2MG4 A;  3DKW A;  3BG3 A;  1MGT A;  3VPR A;  4BH9 A;  4OMZ A;  4BE1 A;  4IHX A;  2ZB9 A;  1BI2 A;  2H27 A;  3QAH A;  4YG2 F;  4N4N B;  3ABK H;  2K86 A;  3CP8 A;  2DN0 A;  3F22 A;  1VI0 A;  2CRG A;  1MMN A;  2M5W A;  3HB9 A;  4G6D A;  2C6Y A;  4WWC A;  1HST A;  2JK3 A;  2P81 A;  3RCO A;  2HVQ A;  3DV8 A;  4LFU A;  2MSY A;  1WCM J;  2IPQ X;  3CCL I;  2HVR A;  1WHU A;  4CCK A;  1Z3Y A;  1XN7 A;  2OD5 A;  3H3Z A;  4P9F A;  2XGC A;  4XOR A;  2CV0 A;  3HDD A;  4GFB A;  3UNG C;  1CF7 B;  4XMY A;  3A03 A;  4V19 K;  4YFN F;  3KZZ A;  1Z05 A;  1MBH A;  2VQL A;  2L4M A;  1LDD A;  2CSO A;  4X6A J;  1N25 A;  3M4O J;  3HOU J;  1H0M A;  4ZDL A;  1DDN A;  1VZ0 A;  2O61 A;  1P2F A;  5KCM A;  4EM1 A;  3HIF A;  3KZY A;  2G7U A;  3S2W A;  3TDZ C;  2QSG X;  2XAU A;  3IH2 A;  2BBY A;  2GWR A;  4U0Y A;  3EPZ A;  1UZC A;  3HSF A;  1R71 A;  4B47 A;  4RAY A;  1ON2 A;  3BR0 A;  4HF2 A;  1IXC A;  4OIO F;  2GIZ A;  4IHT A;  5IY5 H;  3LST A;  1KYZ A;  4IQ4 A;  1YW8 A;  1LE8 B;  2BYV E;  2K9L A;  5LGU A;  2DW4 A;  4JQF A;  4UB6 C;  2BXZ A;  2DQL A;  2K5C A;  5EDN A;  3OYD A;  5TGT A;  3ISP A;  3REO A;  1HW2 A;  4UV8 A;  2FD5 A;  2XV4 S;  3QQA A;  4HX7 A;  1JHF A;  5FJ8 J;  2D45 A;  4G12 A;  4XKV A;  2R5Z B;  4HF1 A;  2FUG 2;  3CME I;  3OSG A;  1W4M A;  4KUM A;  1F36 A;  1ULY A;  2LDU A;  2NAZ A;  3RKY A;  2KQR A;  3IRQ A;  4L9J A;  2Y31 A;  2IGO A;  4B44 A;  4CCM A;  1O7L A;  3VYT B;  5L3F A;  2CW0 F;  3CES A;  3ONQ A;  1DP7 P;  2HEO A;  1FWZ A;  1U5T C;  2ECC A;  2K02 A;  2ICW G;  3U1D A;  3J7A Y;  1YYV A;  1BL0 A;  1QNT A;  2YU3 A;  4UXN A;  3AFH A;  2LOO A;  3BR1 A;  5F1R A;  3R0A A;  3HKZ N;  1VQM I;  2ELJ A;  4B4C A;  3DU5 A;  5EJC A;  3IHU A;  4HDV A;  3LSH A;  3WTT C;  5D5X B;  2ID6 A;  4ZC3 A;  1SC7 A;  3IH4 A;  1G4D A;  4EM0 B;  3OYC A;  1DUX C;  2XVC A;  2CH0 A;  2H6B A;  1R1V A;  4PGH A;  2P5L C;  4IOA F;  1ZK8 A;  2DMQ A;  4P5O A;  3H35 A;  3R4K A;  4UVA A;  2LRD A;  3C7J A;  3V8L A;  4E7S A;  1WSU A;  3HGY A;  3KP2 A;  1S9H A;  4MFE A;  3BT9 A;  1GXQ A;  2WAE A;  3H9J A;  3CLO A;  4W1U A;  2JQ7 A;  2RDP A;  2R0Q C;  1MMS A;  3MZ8 A;  2L7F P;  2P4W A;  4QSH A;  5F0C A;  3MCZ A;  5J1R A;  1X3U A;  4NC8 A;  3HHG A;  2DMN A;  2HZT A;  4KIF A;  4L9V A;  4M72 A;  2DMU A;  4CCN A;  1T38 A;  2EFP A;  2RKH A;  1IN7 A;  5JHU A;  4FE4 A;  1I6H J;  5LEJ A;  1E2X A;  4A12 A;  3L2W A;  2I8D A;  5DM7 F;  4CSW A;  1ETX A;  5HOD A;  1W36 C;  4UY8 I;  1XSV A;  2FNA A;  3SXY A;  3A1Y A;  1SVM A;  5D5U B;  1U9N A;  1X4P A;  5GPC A;  5IOY A;  3HM5 A;  3RTR A;  2OF7 A;  2IS6 A;  2LVS A;  2H94 A;  2W24 A;  2Y75 A;  1N78 A;  2RRE A;  1IN8 A;  2LY1 A;  3IC7 A;  2LSO A;  1UG0 A;  2WV0 A;  4II3 A;  3RZO J;  2ZO4 A;  1LNW A;  1MBK A;  3PNT A;  3OL3 A;  5FFX A;  5E3O A;  3TED A;  2QA4 I;  3OYA A;  2TCT A;  4IVN A;  4IRH A;  5H20 A;  1DGW Y;  1MNE A;  2XKO A;  3E5U A;  3ZP5 A;  2CS3 A;  2HKX A;  3KLN A;  1D8J A;  3OR1 C;  3W3C A;  2XRL A;  2CQX A;  5D6F A;  4P55 A;  3I0T A;  1O3R A;  1FP1 D;  3EUH A;  2VJ4 A;  4CGZ A;  3RIR A;  5HS8 A;  3I59 B;  2K3P A;  3KPH A;  4FE7 A;  4W97 A;  3F9K A;  3IP4 B;  1ZH5 A;  3K69 A;  1D0X A;  2XAF A;  4UUS A;  1W5C C;  2K3F A;  1FMW A;  1Z0X A;  1TW3 A;  1RI7 A;  4WCG A;  2OCC H;  3JSP A;  2X4H A;  3FKJ A;  1E0E A;  4ESJ A;  1ZR4 A;  2PI0 A;  4RM2 A;  4IJA A;  1N75 A;  2HYJ A;  3H1C A;  4G7O F;  4G6T B;  4KFC A;  1BIB A;  2DPU A;  2L9V A;  2BY3 A;  2M87 A;  1JKR C;  5HOO A;  1APL C;  2JTV A;  3CUQ C;  2HQN A;  2ADU A;  1T6S A;  2ISY A;  1SAX A;  1R4M B;  3FXL A;  5K5R A;  4FT8 A;  2ELH A;  1FJL A;  5IT9 Z;  5IYB J;  1W7P D;  1XMX A;  2DK5 A;  5ILU A;  3BRO A;  5K1Y A;  1WH7 A;  2DFI A;  3K6G A;  2DPD A;  3PQJ A;  3I9V 2;  3TMO A;  1XSD A;  2WAF A;  2L2O A;  3DQV C;  5JI6 A;  5IT9 K;  5FRO A;  4U88 A;  3TBI A;  4XSZ F;  3I54 A;  4V2F A;  2ZJR F;  2E36 A;  4OWR B;  3H9Q A;  1FPQ A;  3KP3 A;  2HU9 A;  1J9I A;  4XLP F;  2DYR H;  2R7U A;  2ZME C;  2HYG D;  2JSC A;  1OCR H;  3DBR B;  4CXF A;  2EFO A;  2HDW A;  2L7Z A;  3V7S A;  3MN2 A;  2LP0 A;  3OS2 A;  3S2D J;  2O8K A;  4CYC B;  4C2T A;  1K4S A;  1VF9 A;  1GXP A;  4LIT A;  3RSN A;  2OQR A;  1HBX G;  1B8I B;  3A2K A;  4MTD A;  4JK1 X;  5FLM J;  1XS9 A;  3F3X A;  2VJI A;  2BY1 A;  2XSD C;  5D5W B;  4KMU X;  1S3J A;  2STW A;  3SEZ A;  2VIX A;  3ASN H;  1LUJ B;  3GVA A;  5ERI A;  1S7E A;  2J5P A;  2F4I A;  2KZV A;  1Y39 A;  1ORK A;  1HSJ A;  2GIV A;  1KA8 A;  2FXA A;  2L5Q A;  2PMH A;  3BDD A;  4RGS A;  1B59 A;  4UV9 A;  2ZCW A;  3VYU B;  5FRM A;  4MFD A;  1BW5 A;  4GYG A;  5C44 J;  2IA0 A;  3TKY A;  1DU6 A;  2W57 A;  5CVU A;  4ZTF A;  3KP7 A;  1H89 C;  4S0H B;  3WGI A;  4E4H A;  4MGR A;  3CD6 I;  3ZR8 X;  4KNY A;  1H8A C;  3R60 A;  4L0Z B;  2HQA A;  4AU7 A;  2WC2 A;  1NK3 P;  2WB1 N;  1RKT A;  2W84 A;  2XAH A;  1P92 A;  1H9G A;  3TO7 A;  3FX3 A;  1FP2 A;  3KX2 A;  2Z2S B;  3HC7 A;  3ZRG A;  3GTO J;  1D1C A;  2VPR A;  3SDB A;  1G59 A;  5DD4 A;  3OYH A;  4Q48 A;  3ZQL A;  2B7E A;  3UR3 C;  1JKQ C;  2JT1 A;  2O6G E;  3CO6 C;  1K83 J;  2HI3 A;  2BHZ A;  5FB2 A;  1CGP A;  2R4G A;  4B48 A;  2EFN A;  3JTG A;  2UXN A;  5FKM A;  3H5N A;  3AG3 H;  4M3E A;  2HKO A; 
#chains in the Genus database with same CATH homology
 1USS A;  3V8K A;  4HQE A;  3RJP A;  2QQA A;  1PP7 U;  3TOA A;  3MZH A;  2LF8 A;  1FZP B;  3Q9V A;  3NEU A;  5JR3 A;  2PEX A;  3F21 A;  4HLX A;  2Z5U A;  1BC8 C;  3N4M A;  2DBB A;  1L0O C;  1BC7 C;  1IZ1 A;  2A68 F;  2JPC A;  3M8E A;  1R1T A;  1BI0 A;  4BYY A;  3P9I A;  3KCC A;  2FU4 A;  1LDJ A;  5L3E A;  1RUN A;  1BI3 A;  1WI9 A;  2K4J A;  1XMK A;  2RC4 A;  1STZ A;  4WF2 A;  4M6X A;  5CLS A;  3P9K A;  1JGS A;  4KN4 X;  1R00 A;  2OAZ A;  4Z2Y A;  1R5G A;  3ZMS A;  5L3B A;  1SD7 A;  5LHH A;  5CYV A;  3MQ0 A;  4G94 A;  5LEK A;  1D3Y A;  4ASN A;  2QQ9 A;  2GZW A;  2R3S A;  3BJO A;  2P8T A;  4RGX A;  3IRR A;  4AIH A;  1TW2 A;  2GXB A;  3MZY A;  2ZFW A;  1K7A A;  3U9G A;  3BWG A;  4S04 A;  2QZ8 A;  4ZYG A;  3HRM A;  2D1H A;  2OZ6 A;  1KU9 A;  2EFQ A;  2G9W A;  2K7L A;  4ESF A;  1SMT A;  1Z6R A;  4B09 A;  4IRI A;  2J5O A;  3WU0 A;  2FBK A;  2NNN A;  1E17 A;  2DT5 A;  4AIJ A;  3FWE A;  2HYF A;  4LLN A;  1YS6 A;  1BN5 A;  3FZV A;  3KP4 A;  4NB5 A;  5L3G A;  3ABT A;  4ZYD A;  1U3E M;  3VOE A;  5E18 F;  1UHW A;  2HQR A;  1ZGA A;  1OKR A;  3QRF F;  2IP2 A;  1IUY A;  2PBI A;  1FX7 A;  1ZRF A;  2FBH A;  5ILS A;  4DNC A;  2PN6 A;  2VT2 A;  1G6N A;  3ZMT A;  3T8R A;  5AIQ A;  1OMI A;  1YW7 A;  2ESN A;  3IL2 A;  4EJW A;  5DDG A;  4P96 A;  1IXR C;  5K5O A;  4WXD A;  1HKS A;  4HV6 A;  1JHH A;  3IWZ A;  3EYI A;  4RS8 A;  1FBQ A;  1XGN A;  2L3D A;  2EV5 A;  4KIB A;  2MLG A;  3WU1 B;  3IWF A;  1QBJ A;  1G3S A;  4IF4 A;  1I1G A;  3HOT A;  3F23 A;  3ML6 A;  2KIF A;  5ED4 A;  2P7V B;  3CJN A;  1R23 A;  4ZYH A;  3WTY C;  4AVP A;  4U7D A;  3VB2 A;  2F5E A;  2X0L A;  2DQR A;  3FF5 A;  3BZ6 A;  2R7D A;  4RAZ A;  5BQT A;  2XAJ A;  4I0B A;  3HRT A;  1PDN C;  1R5H A;  4L9T A;  5CVI A;  1O7F A;  4G6Q A;  3DPL C;  5D5V B;  1SD5 A;  1J0R A;  2P5V A;  4EV0 A;  4XRF A;  1R58 A;  4I98 B;  4HA8 A;  2D1V A;  4EM2 A;  1J2X A;  5BMZ A;  4YFK F;  4MQV A;  5LBQ A;  1XDU A;  4K2E A;  1UST A;  4EGY A;  1GHC A;  5DEQ A;  4A0Z A;  1ZGJ A;  2XGX A;  3C3W A;  3ZMU A;  3FXQ A;  4L18 B;  1OYI A;  1MJB A;  2BEO A;  2JRT A;  1ZRC A;  3OOP A;  4XBF A;  4Y17 A;  2DTR A;  4OOI A;  1PP8 F;  4M9X A;  5HDG A;  4RGU A;  3E6C C;  3ELK A;  5E8G A;  1K78 B;  4I09 A;  4OMY A;  3QOP A;  3F8B A;  3CUQ A;  1LDK B;  5D4R A;  2QBY A;  1XGS A;  2IJL A;  1F4K A;  1LEA A;  4M71 A;  2ZNZ A;  2VBZ A;  4N9I A;  2FOK A;  3BOQ A;  2QEN A;  3KFW X;  1ODD A;  2DLL A;  3JAM Z;  5TJJ A;  1FYL A;  3HTU A;  1F9N A;  2ZXJ A;  4I02 A;  3LQQ A;  2ZME A;  3MAJ A;  1IRG A;  1BOA A;  3JAM K;  2BV6 A;  3GO5 A;  5BOX A;  3T8T A;  1LB2 A;  4RB3 C;  3QU3 A;  3ABU A;  2M45 A;  4I01 A;  2HGC A;  4Y15 A;  3TDU C;  2Y48 A;  3Q9S A;  1FYK A;  3PQK A;  1T39 A;  2NS0 A;  2XAQ A;  4KDP A;  5BS6 A;  3B02 A;  4I7H A;  2QM3 A;  2P5K A;  3I53 A;  4BNC A;  1Z7U A;  1RIO H;  2A3S A;  4GO1 A;  4RGR A;  1FSE A;  1QZZ A;  1ZHF A;  1XCB A;  3Q5F A;  2L54 A;  4WXH A;  4Q5S F;  2AXL A;  4ON0 A;  2LF7 A;  2EB7 A;  3GZ5 A;  4KIG A;  4CZZ A;  1G3W A;  3GEZ A;  2ISZ A;  2W85 A;  5KK1 A;  4LG0 A;  4HOB A;  4EJT A;  2O03 A;  1SFU A;  4Y13 A;  1ZAR A;  2FSW A;  3LA2 A;  4QLC U;  3WTV C;  5ICF A;  4GCV A;  5E20 A;  2GQQ A;  1TLH B;  1IXS B;  2BE5 F;  4O5V A;  3WTU C;  2FML A;  5J8F A;  1KU2 A;  3G73 A;  1JXS A;  1UHM A;  3LQR A;  3T0Y A;  2EV0 A;  1ZRD A;  3DEU A;  4O3M A;  3VFZ A;  5LGN A;  4ESB A;  2DU9 A;  3K9T A;  1ZN2 A;  3GFI A;  2IW5 A;  5E8I A;  1XGO A;  3J80 Z;  2A07 F;  3K0L A;  3J80 K;  2L01 A;  1AWC A;  2XAS A;  2DK8 A;  1S7A A;  2VOO A;  3TQN A;  1KGS A;  4L5I A;  1IW7 F;  3F8M A;  3M8F A;  4OIQ F;  1LEB A;  1KU3 A;  4G9Y A;  2E1C A;  2XRN A;  4CHU A;  1W5T A;  1OR7 A;  1B9M A;  2O0Y A;  2P7C B;  4MHG A;  2VN2 A;  1D5V A;  5E1X A;  3WOD F;  4XLN F;  1FOK A;  5BPI A;  3KET A;  2ZKZ A;  5E17 F;  4ENJ A;  1XGM A;  1TTY A;  3VEP A;  2YR2 A;  1O3S A;  1W7P A;  4O6J A;  2TDX A;  4ZZD A;  2FRH A;  4GYI A;  4LD5 A;  1YO5 C;  3F72 A;  2XIG A;  3GFL A;  2E7W A;  4G8X A;  3CUO A;  1S6L A;  4XSX F;  3HUG A;  4GXO A;  4L5J A;  4A6E A;  1S7O A;  4ETS A;  1A04 A;  3F6O A;  3FHZ A;  1EH7 A;  2Y0M A;  1R36 A;  3PFI A;  3QPT A;  1XD7 A;  1SFX A;  4HDU A;  1FY7 A;  1P6R A;  1T98 A;  2ETH A;  2V79 A;  1GVJ A;  4Q4Z F;  5AON A;  4KMF A;  4ENM A;  2QWW A;  3QU6 A;  2UWM A;  4EJU A;  1ZG5 A;  1CF7 A;  3I71 A;  2O8X A;  2KJC A;  1EH6 A;  3G3Z A;  4HF0 A;  1WWX A;  3WTW C;  3NQO A;  4HAM A;  4EGZ A;  1MKM A;  4KA4 A;  1J7K A;  4HZF A;  1BIA A;  2MA3 A;  5HVQ C;  4LLL A;  1FBS A;  1FT9 A;  3I64 A;  5FD6 A;  4FX4 A;  2P6S A;  3KP5 A;  1P4X A;  2XRO A;  2CGP A;  4MEY F;  4PGG A;  1IN4 A;  3COA C;  3FM3 A;  1Y0U A;  2OZU A;  1SMY F;  1U78 A;  1XMA A;  3RDI A;  4AIK A;  2QBY B;  4OIN F;  3E5Q A;  2RNJ A;  4LGW A;  3RKW A;  3LAJ A;  3KE2 A;  5J6X A;  5ICE A;  2VE9 A;  1LJ9 A;  1Q1H A;  2VBW A;  2HDC A;  4MNU A;  5CVV A;  1EH8 A;  2QYO A;  3L2C A;  4IRG A;  6PAX A;  5H6Q A;  2UZK A;  4EVI A;  4TV7 A;  2L02 A;  4OIR F;  3WGH A;  4A5M A;  2Z9O A;  3HTS B;  1YS7 A;  4LK0 F;  3EDP A;  4M6Y A;  4D0P A;  3VOD A;  3QP5 A;  2F2E A;  3QP6 A;  2E1N A;  2F5D A;  2CG4 A;  3CO7 C;  1OPC A;  5DCF A;  4EQQ A;  2EFW A;  1IN6 A;  1ZYR F;  1FNN A;  2A5Y B;  2XHK A;  4U0W A;  2CWE A;  3ZN1 A;  1TNS A;  2W25 A;  1SD4 A;  1SFE A;  4OU0 A;  5CJ9 A;  2STT A;  2RVC A;  3W6J B;  2M30 A;  3IKT A;  3M7G A;  5HS7 A;  2PQ8 A;  2VE8 A;  4Q47 A;  4HX4 A;  3R61 A;  3C18 A;  3RKX A;  4RB2 C;  2IVM A;  4FX0 A;  1O57 A;  2HFH A;  3F8C A;  5JFR A;  5CVJ A;  4DQ2 A;  4QWQ A;  5LLQ A;  1XCV A;  3GFM A;  3SZT A;  3GXO A;  3ZPL A;  2FQ3 A;  2XKP A;  3HHH A;  3WTX C;  2YX4 A;  3RYP A;  1B9N A;  3JW4 A;  5DUK A;  1U5T A;  4HYE A;  1U8R A;  4U0V A;  3GLX A;  2LKP A;  5KVR A;  2MLK A;  3KP6 A;  2VT3 A;  3E97 A;  3EET A;  4CYD A;  2ESH A;  2RQP A;  3F8N A;  3V4G A;  1LVA A;  1ONV A;  3WGG A;  5AIP A;  2HOE A;  1FSH A;  4HLY A;  2MH9 A;  3GYH X;  5FD5 A;  1BJA A;  3V7C A;  1K6O A;  2FEZ A;  3CTA A;  4WK8 F;  4AWX B;  4WXC A;  3P9C A;  1UFM A;  1YW9 A;  4LLG F;  3MEX A;  2Q8K A;  1TQP A;  5F6F A;  2VC1 A;  1F1Z A;  4EMS A;  4OIP F;  4N9H A;  2V1D A;  2A6H F;  1BI1 A;  4FHT A;  1XDS A;  1FLI A;  4HV5 A;  3SFZ A;  2UXX A;  2OBP A;  2Z3Y A;  3U2R A;  3K1M A;  4M74 A;  4LJZ F;  3TOB A;  1G3T A;  2CO5 A;  2NNY A;  2GAU A;  5H6R A;  1ZRE A;  1F5T A;  1MJA A;  5FO5 A;  1C0W A;  1YFH A;  2OQG A;  1SD6 A;  1WKM A;  3O3K A;  4P9U A;  1MDM A;  1BM9 A;  1T2K A;  1U6G A;  4IXA A;  1JE8 A;  3BP8 A;  1XSX A;  2BGC A;  3F8F A;  2MBF A;  3SQN A;  2QUF A;  3BJ6 A;  3L9F A;  3FMS A;  3R6S A;  5HLI A;  4YIF A;  2Z33 A;  3L09 A;  3JTH A;  5DV5 A;  5IT3 A;  1DPR A;  1OYW A;  4LB6 B;  1WQ2 A;  5ICG A;  1I6X A;  3HSE A;  1D8K A;  3KEQ A;  5F64 A;  2VOD A;  5K5Q A;  2JZY A;  2K27 A;  3K1N A;  3RI4 A;  2KKO A;  5J8C A;  4UNO A;  3GW2 A;  1RUO A;  1YIO A;  3O6B B;  3ZMD A;  2WWY A;  3OV8 A;  4UHT A;  4LK1 F;  2KRF A;  4CDG A;  1Z9C A;  2V6C A;  2EA2 A;  4ENN A;  1NHA A;  1R1U A;  5HDK A;  3HSR A;  3W6K B;  4H0E A;  4WX9 A;  5FLX Z;  1IN5 A;  4BXU A;  4KT5 C;  5LRS A;  3E6D A;  4NQW A;  3RPU A;  4L0Y B;  3MFK A;  5FLX K;  3WE2 A;  5ICC A;  4AD9 A;  1IAW A;  4BAY A;  3M9A A;  1B4A A;  4R8H A;  1TQM A;  1YLF A;  5DD8 A;  1XB4 A;  1UCR A;  4KYW A;  3AAF A;  4S05 A;  3GX4 X;  1RNL A;  1W5S A;  3SHF A;  3M1E A;  1R22 A;  1ON1 A;  2E7X A;  3IKV A;  5LGT A;  4KN7 X;  5FGM A;  4N0B A;  1REP C;  1KQ0 A;  2XUB A;  2EK5 A;  2RN7 A;  5LHG A;  3DPT A;  2XAG A;  1FYM A;  3C1D A;  3GFJ A;  4KIC A;  2FA5 A;  1J59 A;  2ZNY A;  5E1W A;  5LRR A;  2YX7 A;  1ZLJ A;  2Q2E A;  5HLG A;  4PZJ A;  3ZN0 A;  4RB0 A;  4RB1 A;  1J5Y A;  3GWZ A;  4HQM A;  5TRD A;  4A0X A;  2EWN A;  3R0J A;  2D2W A;  1TBX A;  4E70 A;  2A61 A;  4EJV A;  1QO0 D;  3L7W A;  3KEO A;  3GUD A;  3HRU A;  1HW1 A;  1QQI A;  2PLY A;  2A6E F;  1B6A A;  4F7Z A;  3BPV A;  2ACJ A;  1MJ9 A;  4IHS A;  2FF4 A;  5BPD A;  2YPR A;  3LFK A;  4UVB A;  2CYY A;  3BY6 A;  4UUV A;  4MTE A;  1RZ4 A;  5EEG A;  1AOY A;  2GXG A;  2ZBK A;  1U5T B;  1O3T A;  1TQI A;  2QVO A;  2VC0 A;  2CFX A;  4BHC A;  4B8X A;  1R7J A;  5DCM A;  2OA4 A;  4U7B A;  2DO7 A;  1P4A A;  5EEH A;  3ZQ7 A;  2PJP A;  1KQ9 A;  1IF1 A;  4L9N A;  1G3Y A;  3WTZ A;  3CDH A;  2EA4 A;  5L3D A;  2V1U A;  5HDN A;  1OYY A;  4A6D A;  1H9T A;  2JPB A;  3ULQ B;  2ZJ2 A;  1HKQ A;  4CIC A;  4CO8 A;  1K79 A;  2EV6 A;  1T0F A;  2DI3 A;  4PDK A;  4R1H A;  1QGP A;  1PUE E;  4YII A;  2G7H A;  4HBL A;  5D8L B;  1ZAO A;  4MQ9 F;  1V3F A;  3QPH A;  4A2U A;  3ECO A;  2YSR A;  2HWV A;  3N97 A;  1L3L A;  3H3U A;  4I2O A;  1ZG3 A;  1VTN C;  1HW5 A;  2HR3 A;  4M9S A;  5D4S A;  1K78 A;  3GZ6 A;  2KJB A;  3E3V A;  3DXJ F;  1ZG1 A;  3O2P E;  3LAP A;  2PG4 A;  2VOP A;  4BHB A;  2QLZ A;  1V4R A;  1MDM B;  2CQK A;  2K4B A;  2IT0 A;  2Z99 A;  3TO9 A;  2MD5 A;  2MH2 A;  3WE3 A;  5JVT A;  2M8E A;  1WRJ A;  1I5Z A;  3DF8 A;  5HS9 A;  2IA1 A;  1HQC A;  1Z91 A;  5D8K B;  3CUQ B;  2VBX A;  3D5L A;  2PMU A;  4BHP A;  3HOS A;  3V8J A;  2FBI A;  1U2W A;  2IRF G;  2VBY A;  2V9V A;  3ZMZ A;  1YG2 A;  2FMY A;  2O3F A;  3I58 A;  4G7H F;  1HKT A;  1IRF A;  2FE3 A;  2H6C A;  1UB9 A;  2ZME B;  3FXR A;  3DP7 A;  1YQA A;  2RGV A;  1KU7 A;  4LB5 A;  5DUI A;  3TGN A;  1J75 A;  3BPX A;  2AS5 F;  1EV7 A;  3RPQ A;  1Z6T A;  1KYW A;  1P4W A;  1LQ1 A;  3ECH A;  2RV8 A;  3HRS A;  4M9Z A;  5L3C A;  3SZP A;  3EYY A;  2KIU A;  2GA2 A;  2HTJ A;  4UVC A;  2M1B A;  2NRA C;  3F6V A;  2R7F A;  4HX8 A;  2KIM A;  3FMR A;  2QQB A;  4R79 A;  3T5X A;  1S29 A;  3WTS C;  2V1X A;  1ZLK A;  1FBU A;  4I0A A;  5ILV A;  3D0S A;  3LWF A;  3NRV A;  2P6T A;  3K2Z A;  5A2Q Z;  1TNT A;  3I59 A;  4LG0 B;  3EQL F;  3I4P A;  3LA7 A;  2PFB A;  1FC3 A;  3ZMV A;  2OU2 A;  3T1B A;  2F5F A;  2VXZ A;  2COM A;  2EJR A;  1QPM A;  3B73 A;  5A2Q K;  2H09 A;  2HTS A;  4A5N A;  4YFX F;  1MD0 A;  4HW0 A;  3L00 A;  3J7A O;  4BQA A;  3ROU A;  4EJO A;  2NYX A;  4PCQ A;  1YTY A;  4ENK A;  4ZYE A;  2A69 F;  1B1B A;  3ERE D;  3H92 A;  4NHJ A;  2MC3 A;  2WTE A;  1S8N A;  3KLO A;  1MZB A;  3E6B A;  4M73 A;  1I27 A;  4JBA A;  2DAO A;  2B0L A;  1DPU A;  4ZH4 F;  4MEX F;  2VON A;  3WG9 A;  3FXU A;  3FM5 A;  3TO6 A;  3LA3 A;  3FMQ A;  1O3Q A;  1HXD A;  5HLH A;  5FFZ A;  3J81 Z;  1BBY A;  3E5X A;  3V7R A;  4G7Z F;  5D6E A;  5E1Z B;  1QZY A;  3J81 K;  3BJA A;  3K1P A;  2LNB A;  2FNP A;  1KQ8 A;  3GF2 A;  3HYI A;  1I1S A;  1Z1D A;  3P7N A;  1W7P B;  3E6M A;  2Q0O A;  2GA1 A;  3JSO A;  4LMY A;  3DFG A;  5LHI A;  4GGG A;  4IPA A;  2HS5 A;  2L4A A;  4A0Y A;  5DCM B;  5DYM A;  3MWM A;  3RYR A;  2F5C A;  2IA2 A;  5CVR A;  3I5U A;  3DKW A;  1MGT A;  4BH9 A;  4OMZ A;  1BI2 A;  2H27 A;  3QAH A;  4YG2 F;  2K86 A;  3F22 A;  2M5W A;  4G6D A;  2C6Y A;  4WWC A;  1HST A;  4LFU A;  3DV8 A;  2IPQ X;  1XN7 A;  2OD5 A;  3H3Z A;  4P9F A;  1CF7 B;  4YFN F;  3KZZ A;  1Z05 A;  2L4M A;  1LDD A;  2CSO A;  1H0M A;  1DDN A;  2O61 A;  1P2F A;  4EM1 A;  3HIF A;  3KZY A;  2G7U A;  3S2W A;  3TDZ C;  2BBY A;  2GWR A;  4U0Y A;  3HSF A;  4RAY A;  1ON2 A;  4HF2 A;  1IXC A;  4OIO F;  4IHT A;  3LST A;  1KYZ A;  1YW8 A;  2BYV E;  5LGU A;  2DW4 A;  4JQF A;  2DQL A;  3REO A;  3ISP A;  1HW2 A;  4UV8 A;  2XV4 S;  4HX7 A;  1JHF A;  2D45 A;  4HF1 A;  1W4M A;  4KUM A;  1ULY A;  2LDU A;  2NAZ A;  3RKY A;  3IRQ A;  4L9J A;  1O7L A;  5L3F A;  2CW0 F;  1DP7 P;  2HEO A;  1FWZ A;  1U5T C;  2K02 A;  3U1D A;  1YYV A;  1QNT A;  2YU3 A;  4UXN A;  5F1R A;  3R0A A;  3IHU A;  4HDV A;  3WTT C;  5D5X B;  1G4D A;  4EM0 B;  1DUX C;  2XVC A;  2H6B A;  4PGH A;  1R1V A;  2P5L C;  4P5O A;  3R4K A;  4UVA A;  3C7J A;  3V8L A;  1WSU A;  3KP2 A;  1GXQ A;  3CLO A;  2RDP A;  2P4W A;  3MCZ A;  1X3U A;  3HHG A;  4KIF A;  2HZT A;  4L9V A;  4M72 A;  1T38 A;  2EFP A;  2RKH A;  1IN7 A;  5JHU A;  5LEJ A;  1E2X A;  4A12 A;  1XSV A;  2FNA A;  3SXY A;  5D5U B;  3RTR A;  2H94 A;  2W24 A;  2Y75 A;  1IN8 A;  3IC7 A;  2LSO A;  2WV0 A;  2ZO4 A;  1LNW A;  5FFX A;  4IVN A;  4IRH A;  5H20 A;  2XKO A;  3E5U A;  3ZP5 A;  2HKX A;  3KLN A;  1D8J A;  5D6F A;  4P55 A;  3I0T A;  1O3R A;  1FP1 D;  3EUH A;  4CGZ A;  3RIR A;  5HS8 A;  3I59 B;  1ZH5 A;  3K69 A;  2XAF A;  1TW3 A;  1RI7 A;  4WCG A;  3JSP A;  2X4H A;  4ESJ A;  2PI0 A;  4IJA A;  4G7O F;  4KFC A;  1BIB A;  2DPU A;  2M87 A;  5HOO A;  2JTV A;  3CUQ C;  2HQN A;  2ADU A;  1T6S A;  2ISY A;  1SAX A;  5K5R A;  4FT8 A;  2ELH A;  5IT9 Z;  1W7P D;  2DK5 A;  5ILU A;  3BRO A;  5K1Y A;  2DFI A;  2DPD A;  3PQJ A;  1XSD A;  3DQV C;  5JI6 A;  5IT9 K;  4U88 A;  4XSZ F;  3I54 A;  1FPQ A;  3KP3 A;  1J9I A;  4XLP F;  2HYG D;  2JSC A;  4CXF A;  2EFO A;  3V7S A;  1GXP A;  1HBX G;  2OQR A;  4MTD A;  4JK1 X;  3F3X A;  5D5W B;  4KMU X;  1S3J A;  2STW A;  3GVA A;  5ERI A;  2J5P A;  4ZZL A;  1HSJ A;  4RGS A;  2GIV A;  1KA8 A;  2FXA A;  3BDD A;  2PMH A;  1B59 A;  4UV9 A;  2ZCW A;  4GYG A;  2IA0 A;  3TKY A;  2W57 A;  5CVU A;  3KP7 A;  3WGI A;  4MGR A;  4KNY A;  3R60 A;  4L0Z B;  2WC2 A;  2W84 A;  2XAH A;  1P92 A;  1H9G A;  3TO7 A;  3FX3 A;  1FP2 A;  5DD4 A;  4Q48 A;  2JT1 A;  2O6G E;  3CO6 C;  5FB2 A;  1CGP A;  2EFN A;  3JTG A;  2UXN A;  2HKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...