1P4WA

Solution structure of the dna-binding domain of the erwinia amylovora rcsb protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
b'YTPESVAKLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNYLSSVSMTPVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords rcsB
publication title Structural analysis of the DNA-binding domain of the Erwinia amylovora RcsB protein and its interaction with the RcsAB box.
pubmed doi rcsb
source organism Erwinia amylovora
molecule tags Dna binding protein
total genus 22
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4wA00
2H6BA 3ZMTA 2EFNA 3BWGA 4PDKA 1SFUA 1JXSA 1XD7A 3LFKA 2Z3YA 2VOPA 4M9SA 2CWEA 4GO1A 4MEXF 2IT0A 2H27A 2VC1A 2MA3A 4IVNA 2QWWA 3K1PA 1U2WA 2Z99A 3L7WA 2OQGA 2JSCA 3DV8A 2VOOA 4WXCA 1XGOA 1IXCA 1FNNA 2BYVE 1R1TA 3DPLC 1FBSA 4IF4A 1AWCA 5L3EA 5LGTA 1O3RA 5H6QA 1ZRCA 4YG2F 4U0WA 1K78B 5HDKA 1OYWA 1R58A 4A12A 4CDGA 4HX7A 4RAZA 1V3FA 3I4PA 3TDZC 2MLGA 2V1UA 2EA4A 3KP6A 4L5IA 1PUEE 1J2XA 3CO7C 3Q5FA 2KIFA 2Y0MA 1G6NA 4UVBA 3FMQA 3O6BB 1W4MA 1BJAA 1YO5C 4WXDA 4ENKA 4IHTA 1G3YA 3DF8A 2PBIA 4ESFA 4ZZLA 2QVOA 1TNSA 4RS8A 1XSVA 4KIGA 3ZP5A 5AONA 1YW8A 1FYKA 5HS9A 1SAXA 2LDUA 2WTEA 4G7ZF 4LD5A 5DYMA 2KRFA 2D2WA 2QENA 4WX9A 2NS0A 4EJUA 1F5TA 1EH6A 4HBLA 1EH7A 4UVAA 4WWCA 1R23A 2MH2A 1ZH5A 3P7NA 4U0YA 1MJAA 5K5QA 3SHFA 3WGGA 4BYYA 4EJVA 2QUFA 2HQRA 2L01A 2RNJA 3HRMA 4ZYGA 2QBYB 3GXOA 3GUDA 5DV5A 1ZRFA 1XGMA 2KJBA 1IRGA 5L3GA 5IT3A 3KLOA 2YX4A 1Z91A 1BI3A 1WWXA 3JAMZ 1U5TA 2OQRA 4OU0A 3PQJA 1S29A 2RV8A 2M45A 5FLXZ 4KMFA 2FOKA 1HQCA 2DQLA 3OV8A 1G3SA 5EEGA 2FBHA 5AIQA 2O61A 5D6EA 2A68F 3WTZA 5CVIA 3ERED 4UHTA 1BI1A 1X3UA 2ZJ2A 1FZPB 1AOYA 2BE5F 3M9AA 2GWRA 1J59A 2A07F 2OAZA 1R22A 1QBJA 2Y75A 2VBYA 3CLOA 4KNYA 3LAJA 4F7ZA 3I71A 5TRDA 4M9ZA 1O7LA 4HV6A 2A5YB 4U88A 1YS6A 3WE3A 1H0MA 4EM1A 4EQQA 3DFGA 2R7DA 4IRGA 4EV0A 1YG2A 3F8NA 2RKHA 3J81K 2FF4A 1YW9A 4L0ZB 1RI7A 2OD5A 2GQQA 1K78A 4BHPA 2MC3A 1TQMA 5E8GA 5D8LB 2Q0OA 3FHZA 5ED4A 2V1DA 3QU3A 5F64A 1KA8A 4AIHA 3VFZA 3SQNA 1O3QA 1ON2A 2DTRA 2IVMA 4KFCA 1FSEA 4GYGA 1HBXG 3T1BA 5LRSA 1ZYRF 1MDMB 5EEHA 2UWMA 2X4HA 1S3JA 2P5VA 3R0AA 2DU9A 4ZZDA 1Z05A 3E6MA 2DBBA 2GXBA 2FNPA 3E5UA 3DEUA 2OBPA 1XCVA 1A04A 1JHHA 4MNUA 2F5EA 3MQ0A 3KP5A 4I98B 5TJJA 3ZMDA 1L3LA 2IA2A 3ABUA 4FT8A 3BDDA 1GHCA 2DAOA 5H20A 3IRQA 4GGGA 5F1RA 3KE2A 3KZZA 4G8XA 2CYYA 5DEQA 5FFXA 2QBYA 2FRHA 4MEYF 3LSTA 1HXDA 5HLHA 4WF2A 1DUXC 2W85A 5CVVA 5ERIA 1FPQA 2VN2A 2M30A 3TO6A 3GLXA 4Z2YA 4ENMA 3W6JB 1P4AA 1FP1D 5E1WA 4A6DA 2EWNA 4GYIA 3C7JA 1TQPA 4I02A 2RVCA 1FX7A 1R1VA 4HF2A 4RGXA 1QGPA 3F8FA 4LB5A 5BPDA 2CSOA 4IHSA 2B0LA 4FX4A 2DK8A 4ON0A 3TO9A 2D45A 3CTAA 2JT1A 4A0XA 1B4AA 3GFJA 3E3VA 4HLXA 4N9IA 5HS8A 3IC7A 1JHFA 3GWZA 2ETHA 4DQ2A 1I6XA 3E97A 4U0VA 1IN4A 4Q5SF 3QRFF 3BOQA 1I1GA 1FT9A 2J5PA 2DPUA 2W25A 1WSUA 3K69A 3EUHA 5CJ9A 1ZHFA 1BC7C 1ZAOA 1UB9A 3ZMZA 1O57A 2PMUA 1TTYA 3DQVC 1LDJA 2VONA 4G94A 3D5LA 4BHCA 4G7OF 2W84A 2XRNA 3GEZA 2BGCA 4KIFA 4UV8A 1SFXA 4LLLA 3J80K 3GFIA 1HW5A 3WU0A 1MDMA 1USTA 1J5YA 1HSTA 1G4DA 5BQTA 4JBAA 3WGHA 1FYMA 1MZBA 2G7HA 5HS7A 3DP7A 1R5GA 1TW3A 2VXZA 2DI3A 1Z6RA 4L9NA 4P55A 2O6GE 2L02A 4HOBA 1P2FA 3KEOA 2VBZA 4A6EA 3BJ6A 4A2UA 3E5QA 4HYEA 3FMRA 4HW0A 4CGZA 3V7RA 2CQKA 2FSWA 5L3DA 2P6SA 4JQFA 4EM2A 2XAQA 1LQ1A 1F4KA 1XSDA 3B02A 2WC2A 5LBQA 1ZG3A 4UVCA 2GA2A 1P6RA 2JTVA 4RGRA 3V7SA 3S2WA 1J9IA 3BPVA 3RKYA 1K7AA 2COMA 4Y13A 3IWFA 5D8KB 2YSRA 4OOIA 3U9GA 2ESHA 2EFOA 3QOPA 3R0JA 2VE8A 2GA1A 1U8RA 3RDIA 3ZQ7A 3AAFA 2D1VA 2HKXA 3WODF 3ECHA 3GFMA 2HTSA 2OU2A 1T0FA 4ASNA 2O3FA 2Y48A 5LRRA 3RYRA 4KICA 3G73A 3H92A 5E1XA 4N9HA 3D0SA 3KP2A 3QP6A 2AS5F 5BMZA 1TLHB 2MLKA 1C0WA 2K27A 5D5XB 2W24A 2PN6A 3JTGA 4R8HA 1K79A 4P9FA 2NNYA 4IRIA 3WTSC 3O3KA 3BZ6A 1B1BA 3ML6A 3BPXA 5L3CA 1FC3A 3I53A 1ZARA 3HOSA 4K2EA 2DT5A 2E1CA 3VODA 4CYDA 4BHBA 1OYYA 5D4RA 1W7PD 3SZTA 4G7HF 2EV0A 4U7BA 2BV6A 2GAUA 5FGMA 3BJOA 4YIFA 2Z9OA 1GXQA 3PFIA 1UFMA 1K6OA 2Q8KA 3WE2A 1SFEA 1P4XA 3KETA 2VT2A 4HA8A 4M71A 2FBIA 5HOOA 3CUQC 3GW2A 4LB6B 4LGWA 4GXOA 2GIVA 1IXRC 3ZPLA 3TDUC 4PGHA 3REOA 1XSXA 4XLPF 1DPUA 1XDUA 2ZMEB 4M6XA 4RB0A 5D5WB 4OIRF 1FOKA 2RGVA 1HKTA 2XGXA 1J0RA 2A3SA 2XKPA 5DCFA 5CVRA 1R7JA 2EK5A 2F5CA 3TOBA 2P8TA 3WTWC 1YFHA 3HHGA 3H3UA 1T2KA 3LQQA 1BBYA 3KZYA 3WU1B 1B59A 2ZCWA 2H94A 2FMYA 2DPDA 2FE3A 1SMTA 3RYPA 4O6JA 2O8XA 2EA2A 4CO8A 3N97A 1T6SA 1TW2A 1Y0UA 5LHHA 5FB2A 4I2OA 5J8CA 2ZNZA 1SD7A 4KN7X 3IWZA 3V8JA 4MTDA 2K7LA 2CO5A 3E6BA 3ZMSA 2H6CA 2BBYA 3QPTA 4Q4ZF 3EQLF 2LSOA 1BN5A 4B8XA 2W57A 5CLSA 4HDUA 1QQIA 3FX3A 1XCBA 1YLFA 1ODDA 1WI9A 1HW1A 2O0YA 1D8JA 3RKWA 3GZ6A 2QQAA 4LG0A 2X0LA 2HYFA 3T8TA 2F5FA 2UXNA 5BS6A 3QPHA 3DXJF 5LHIA 1R1UA 1PDNC 2IW5A 3SZPA 2XAHA 3QU6A 4HQMA 4YFXF 3JAMK 5K5OA 4ENJA 5FLXK 1MJBA 1W7PA 2KIMA 3L2CA 5BOXA 2DK5A 2L54A 4M73A 3BROA 1D3YA 2YPRA 2P7VB 3FF5A 3TKYA 2HYGD 4N0BA 5HVQC 4L18B 2P6TA 3F8CA 1XB4A 3JTHA 3JW4A 5E17F 2HWVA 1Z6TA 2F5DA 5J6XA 3FM5A 1IRFA 2QQBA 2JRTA 1FYLA 2FU4A 3L9FA 4I7HA 2HDCA 3P9KA 2PMHA 4BXUA 3F23A 1GVJA 2FA5A 1BM9A 3FXRA 4MQVA 3EETA 1YS7A 2CGPA 1STZA 3U1DA 1OMIA 4HZFA 1RIOH 1BIBA 4U7DA 1P92A 3MAJA 4I09A 2M5WA 2ZMEA 3VOEA 2MD5A 3F6VA 5D5UB 4YFNF 5JHUA 1HSJA 1FBUA 1KU7A 1BI0A 1F1ZA 3M8FA 3NEUA 1P4WA 3V7CA 2UXXA 4RGSA 2HQNA 3I54A 2IJLA 3KP4A 4I0AA 1U6GA 3MZHA 3RIRA 3WTVC 1T98A 4PGGA 4H0EA 2M1BA 1PP8F 3K9TA 1RZ4A 4LLGF 1KU2A 3LA7A 2P7CB 4MGRA 4P5OA 3W6KB 2FNAA 2QLZA 1E17A 2NRAC 5IT9Z 2HGCA 3I59B 1YIOA 1G3WA 3Q9VA 1IN5A 2ZXJA 4EGZA 2XASA 4BAYA 1T39A 3GVAA 5F6FA 2HFHA 1KGSA 1F9NA 3I64A 5K5RA 2QM3A 1S7AA 2FXAA 3P9CA 4AIJA 2HZTA 2M8EA 2V9VA 1S6LA 4WXHA 3FM3A 3HSFA 4HAMA 4L9JA 1G3TA 2VE9A 1QZZA 4LFUA 5DD8A 3G3ZA 4I01A 4E70A 5DCMB 2ESNA 4A5MA 4HX8A 3GYHX 4HDVA 4KT5C 5IT9K 2BEOA 2P4WA 1IF1A 3F21A 5ILSA 1SD4A 4FHTA 5H6RA 3M7GA 3QAHA 3R6SA 2YU3A 3CDHA 2JPCA 1KU9A 2MBFA 5ILUA 2Z33A 4MQ9F 3WGIA 2VBWA 1LEAA 1W5TA 2XAGA 4S05A 4OIOF 2JPBA 4EJTA 1ULYA 4KN4X 1ZRDA 1WKMA 1QZYA 1R36A 4P9UA 4Q48A 2HS5A 3NQOA 5A2QZ 3BJAA 3HRSA 4NHJA 3LQRA 5D4SA 3J7AO 1U5TC 1KU3A 4PCQA 3C3WA 1MD0A 1DP7P 2GZWA 3HRUA 3O2PE 3JSPA 4R1HA 1WRJA 3RKXA 3FXQA 3K2ZA 3RPQA 5DUIA 1OYIA 4A0ZA 2EV5A 2PFBA 3RJPA 3HTSB 4LK1F 1EH8A 3V8LA 1RUOA 2VT3A 3U2RA 5CYVA 4R79A 1U78A 4XRFA 3BP8A 5E20A 3FZVA 4IPAA 4WK8F 1BC8C 1FWZA 2STTA 3Q9SA 3FXUA 4MTEA 1SD6A 3WTTC 2NYXA 3F8BA 4CZZA 3VEPA 2Q2EA 3I59A 4BH9A 3TOAA 4NQWA 1D8KA 2CFXA 4DNCA 2WWYA 1ZLKA 2A6EF 4CICA 3HHHA 5ICCA 1CF7A 3LA2A 1ZN2A 3RPUA 5FFZA 3HRTA 2KJCA 1IW7F 2LF8A 1JGSA 2K86A 3R4KA 4HF0A 2FQ3A 1ZG5A 1J75A 4HF1A 1Z7UA 2QZ8A 1ZREA 4LG0B 1IN8A 2HKOA 1PP7U 5CVJA 3I0TA 4Y15A 1IN6A 1TQIA 4KIBA 1IZ1A 2VC0A 2IPQX 2D1HA 3TQNA 1OR7A 3K0LA 5HDGA 3F72A 5DCMA 4AWXB 1W7PB 3MEXA 3BY6A 4ESBA 1MJ9A 4D0PA 4LJZF 2ZO4A 4NB5A 3H3ZA 4EM0B 2P5KA 2ADUA 2PQ8A 2K02A 5L3FA 4L5JA 5LEKA 4IJAA 4ESJA 1ON1A 3IKTA 2OZ6A 5ICGA 2M87A 4PZJA 3ZMVA 2A69F 1IN7A 1XMAA 4AIKA 3KLNA 2RC4A 3ZN1A 4P96A 5DDGA 2FEZA 2E1NA 1DPRA 3KFWX 5D6FA 3ECOA 5LEJA 1YYVA 4G6DA 1XGSA 4Q47A 1ZGAA 2EB7A 4RGUA 4HX4A 4KA4A 2E7XA 4RAYA 1FLIA 1SD5A 5FD6A 1O3TA 5JVTA 1T38A 4YIIA 4OIPF 5KK1A 2A6HF 2RN7A 3E6DA 4IRHA 3GF2A 3IKVA 3IRRA 1NHAA 1LDKB 1XMKA 2STWA 4ZYDA 1IUYA 4OINF 5ICFA 3GFLA 5CVUA 1R00A 1MKMA 2TDXA 3NRVA 3DPTA 1BI2A 1VTNC 3KP3A 1KQ9A 1B6AA 1ZLJA 2PLYA 1UHWA 4ZYEA 3P9IA 2FBKA 1LB2A 1R5HA 2IA1A 3SXYA 2YR2A 2DFIA 2EFQA 3F3XA 2V79A 3R61A 2NNNA 3GZ5A 3MCZA 3E6CC 4EGYA 3RTRA 3CUQB 1D5VA 2XIGA 2O03A 3FWEA 2Z5UA 1QPMA 3MZYA 1O7FA 4L0YB 4EJWA 2MH9A 2J5OA 4XLNF 4S04A 3J81Z 3OOPA 1WQ2A 2XVCA 3MWMA 2EFPA 1O3SA 3WTUC 2F2EA 2P5LC 5E8IA 4LK0F 2H09A 2PJPA 1Q1HA 1KQ0A 2ZBKA 2IP2A 2ELHA 3COAC 4EVIA 2ISYA 3HIFA 4KUMA 2VODA 5BPIA 2DO7A 4FX0A 5E1ZB 3TGNA 3EYYA 2CW0F 2QQ9A 2LNBA 4LMYA 1REPC 2GXGA 2ZFWA 3I58A 2G7UA 2XUBA 3F8MA 2R3SA 4BQAA 3ISPA 1E2XA 4ZH4F 1UCRA 4TV7A 5DD4A 4RB3C 1HKQA 1I1SA 3T0YA 1B9MA 4GCVA 1U3EM 3RI4A 5JFRA 2HR3A 2NAZA 2HOEA 4I0BA 4M6YA 2L3DA 3TO7A 2DLLA 4QWQA 4G9YA 2DW4A 1LVAA 3C18A 1H9GA 2HEOA 1CGPA 4OMYA 1OPCA 2FMLA 1XN7A 4HLYA 3T5XA 2VBXA 4O3MA 3MFKA 4KDPA 2ZNYA 4L9VA 5LGUA 2UZKA 1S8NA 2K4JA 2PG4A 2EJRA 3DKWA 3F22A 2DQRA 2E7WA 4MHGA 1DDNA 1TBXA 2ZKZA 3C1DA 3JSOA 3VB2A 1Z1DA 1H9TA 3ULQB 3GO5A 2WV0A 4IXAA 3HTUA 3HOTA 4CXFA 2A61A 4L9TA 4CHUA 1BIAA 3GX4X 1MGTA 1V4RA 5HLGA 1GXPA 4HV5A 5LLQA 2RQPA 2HTJA 2LF7A 1OKRA 2OZUA 5HLIA 1HW2A 1RUNA 3L09A 2PEXA 4AD9A 5KVRA 2XKOA 4OIQF 3FMSA 3IL2A 2KIUA 3SFZA 1YW7A 3KEQA 3K1MA 3HUGA 3V4GA 3ELKA 3IHUA 2RDPA 4UV9A 1CF7B 4YFKF 4BNCA 2JZYA 3WTXC 1Z9CA 3CUQA 4XSXF 2R7FA 4XSZF 4EJOA 3CO6C 2YX7A 5ILVA 1YTYA 3LAPA 4M74A 2G9WA 3WG9A 2V6CA 4G6QA 3B73A 1JE8A 3ZN0A 2OA4A 2IRFG 1USSA 4UNOA 2EFWA 1W5SA 4JK1X 1S7OA 4ZYHA 4AVPA 1FSHA 2PI0A 3J80Z 1FP2A 4KMUX 4UXNA 3N4MA 2V1XA 3HSEA 4KYWA 4QLCU 3M8EA 1HKSA 1FY7A 4WCGA 1ONVA 2K4BA 2C6YA 5ICEA 3F6OA 3LWFA 3E5XA 5FO5A 1I5ZA 4M72A 2XAFA 4LLNA 5J8FA 2AXLA 3KP7A 2IA0A 4HQEA 3LA3A 3ROUA 1QNTA 4RB1A 4B09A 2CG4A 1XDSA 3I5UA 3K1NA 3ABTA 3HSRA 3L00A 5L3BA 1B9NA 1KYZA 5HDNA 1TNTA 3CUOA 4OMZA 3M1EA 4A0YA 1SMYF 5LHGA 5D5VB 4ENNA 5JI6A 2XV4S 2KKOA 3EYIA 1FBQA 3WTYC 3KCCA 2L4AA 1IAWA 1UHMA 5A2QK 3V8KA 1J7KA 5K1YA 4XBFA 5LGNA 1BOAA 4UUVA 1L0OC 2XAJA 5E18F 1LJ9A 5AIPA 3ZMUA 4EMSA 1KQ8A 1EV7A 5JR3A 2QYOA 4A5NA 1I27A 1LDDA 4Y17A 4ETSA 4RB2C 2ISZA 4O5VA 3R60A 5FD5A 3QP5A 5DUKA 2EV6A 1LNWA 1IXSB 3PQKA 1RNLA 1ZGJA 3T8RA 2ACJA 3CJNA 4M9XA 1LEBA 1KYWA 1U5TB 3HYIA 2L4MA 1QO0D 1XGNA 2XHKA 6PAXA 1YQAA 1ZG1A 3EDPA 2LKPA 2XROA
chains in the Genus database with same CATH superfamily
2H6BA 4M3FA 1FOYA 3BQYA 3ZMTA 1RR8C 1MMSA 2DJNA 2EFNA 3OYMA 2JVHA 3BWGA 2W48A 4LG3A 3B6AA 1MBKA 2DT6A 4PDKA 3L1PA 1SFUA 1JXSA 1R9TJ 1XD7A 5F0CA 3LFKA 2Z3YA 5TGTA 2VOPA 4M9SA 1IC8A 2FX0A 3E7LA 1WH5A 2DA5A 5M3FJ 9ANTA 4Y3OA 2CWEA 2DA6A 4GO1A 1MMDA 3LSJA 2VJJA 2BHYA 4MEXF 2IT0A 2H27A 2VC1A 3DLLF 4DBQA 2MA3A 4IVNA 3GTQJ 2QWWA 2DCEA 3K1PA 1U2WA 1UG0A 2Z99A 3H0GJ 3L7WA 5GPCA 2OQGA 2PJRB 2JSCA 4LOCA 3IV5A 2HOAA 3DV8A 2VOOA 5CPRB 3HPHA 4WXCA 2E2HJ 4W1UA 4BQQA 1XGOA 3S93A 2XSJC 3HBLA 3OL3A 4F52A 1E3OC 1F43A 1IXCA 3RSNA 1FNNA 5FROA 2BYVE 3W2VA 1R1TA 3DPLC 1FBSA 3RCOA 4IF4A 5IYCJ 3CP2A 4FASD 4XR6A 5GAEJ 3G4SI 3BT9A 1AWCA 5L3EA 5LGTA 1O3RA 2JSPA 2WA0A 2O5RA 5H6QA 1KONA 2R7OA 1ZRCA 2LG4A 4U0WA 4YG2F 1K78B 5HDKA 5IP6A 4YELA 2ZSHB 1OYWA 1R58A 4A12A 1K83J 3M4OJ 2B9SA 4CDGA 4HX7A 1G2HA 4RAZA 1V3FA 2QEXI 3I4PA 2E60A 3TDZC 3AG3H 2MLGA 4YRVA 1B8IA 2V1UA 2EA4A 3KP6A 4L5IA 4B1RA 3CZ6A 2ICWG 1PUEE 3JR9A 3A03A 2RAEA 2DOAA 2LMDA 2OV7A 1J2XA 3CO7C 3Q5FA 2KIFA 2Y0MA 2XRLA 1JKQC 1G6NA 3FK7A 2AQFA 3PJRA 2LK2A 2ZSIB 4UVBA 4ZYAA 3FMQA 3O6BB 4M3EA 1W4MA 3BC8A 3OYNA 1BJAA 2ZJRF 1YO5C 4HSTA 4WXDA 4C30A 2IGKA 3PM1A 1OCCH 3BR6A 3C2BA 4U87A 2HNHA 4ENKA 3D1NI 5KHDA 4IHTA 3V42A 1G3YA 3DF8A 2CV0A 2PBIA 3ABLH 4ESFA 4G6TB 4ZC3A 4ZZLA 3K4MA 1UAAA 2HQAA 3DU5A 2QVOA 1TNSA 4RS8A 2P81A 4PSXA 4KITB 1XS9A 1XSVA 4PJ0C 4KIGA 3ZP5A 4A3BJ 5AONA 3TL4X 3S14J 1YW8A 2E5ZA 1FYKA 2EIJH 3G1LA 5HS9A 1SAXA 1QZEA 2LDUA 2DMPA 2Y9ZA 2WTEA 3H5AA 5LD2C 3U1KA 3DBLB 4G7ZF 4I6ZA 4LD5A 5DYMA 2KRFA 2D2WA 2QENA 5F27A 3I3LA 4WX9A 2NS0A 2DT7B 3S3NA 3DLAA 3ZR8X 1NG6A 4EJUA 1F5TA 4IHWA 3IH2A 4V19K 3CDLA 1EH6A 2EH3A 3PSIA 4HBLA 1EH7A 2QKMB 4UVAA 4WWCA 4YEJA 1R23A 2Y31A 2MH2A 1ZH5A 3BTLA 3P7NA 3FHNA 1WJFA 2V9PA 4U0YA 1MJAA 2VKDA 3SHFA 3WGGA 4BYYA 3HEFA 5K5QA 1HDPA 2O9LA 4RAGA 4EJVA 2QUFA 1NH3A 1IO2A 2HQRA 2L01A 2RNJA 3HRMA 4ZYGA 1U9OA 1XTAA 1ERDA 2QBYB 3GXOA 3GUDA 5DV5A 2W7NA 3ASOH 1ZRFA 1XGMA 2KJBA 4MFDA 1IRGA 5L3GA 4BKXA 1EJ9A 1LPQA 5IT3A 3KLOA 2YX4A 1Z91A 5JLWA 1WZ2A 1BI3A 4Y7NJ 4KJZA 1WWXA 3JAMZ 1U5TA 1YJNI 2OQRA 4V2FA 4OU0A 1FIAA 2F48A 1S29A 2RV8A 3PQJA 2LY9A 3W2WA 1W5CC 2M45A 5FLXZ 3WG7H 4KMFA 1UELB 2FOKA 1HQCA 2A05A 2DQLA 3OV8A 1G3SA 2E36A 2VXDA 5EEGA 2FBHA 5AIQA 5E3LA 2O61A 2X6YA 3G71I 2MGQA 2NVYJ 3IAS2 5D6EA 5C44J 1OFCX 2A68F 3DCFA 3S8PA 3WTZA 5CVIA 3ERED 5FLVA 1S7EA 2V7FA 4UHTA 1RKTA 5M5YJ 1BI1A 2BHZA 2NVXJ 2JA8J 1X3UA 2ZJ2A 1FZPB 1AOYA 2BE5F 2L9RA 3M9AA 2OTLI 2GWRA 3VYRB 1J59A 2A07F 2TRTA 2K5CA 1IG7A 3DBHB 2OAZA 4Y33A 1GDTA 2M2EA 3VPRA 1R22A 2DMNA 2EIKH 2Y75A 1QBJA 3S2DJ 2BXYA 1POGA 1UJ8A 2JUCA 1IJWC 2VBYA 3CLOA 4I99C 2WY7Q 1R4NB 4KNYA 2DMQA 2AQEA 2E5NA 4E7HA 3LAJA 4F7ZA 2PJRA 3I71A 1WCMJ 3DPUA 1IDYA 5TRDA 4M9ZA 1O7LA 2DXIA 3TBIA 4HV6A 2A5YB 4CCMA 3H3VK 4U88A 1YS6A 3WE3A 3Q0WA 1H0MA 1RKWA 4XLEA 4EM1A 1MNEA 4EQQA 3DFGA 2R7DA 5E3MA 4IRGA 4EV0A 1YG2A 3F8NA 2RKHA 3J81K 2FF4A 1YW9A 4L0ZB 1RI7A 1P7JA 2OD5A 2GQQA 4A3LJ 3TW7A 1K78A 3PUFA 4BHPA 2M3AA 2MC3A 2VKEA 3VSLA 2HPIA 1TQMA 3AG1H 3QPLA 2K9QA 5E8GA 2WY8Q 5D8LB 2KPMA 2QA4I 2Q0OA 1ZK8A 3TP0A 1D0YA 3FHZA 5ED4A 5FJ8J 2KFDA 5FKMA 2V1DA 3BG9A 3QU3A 5F64A 3H5RA 1KA8A 1GLNA 2IGMA 4AIHA 2GOXB 3VFZA 3SQNA 1O3QA 3M3YJ 1ON2A 2DTRA 2IVMA 4KFCA 4BDYA 5J47A 1FSEA 4GYGA 1VI0A 4XOTA 3JRBA 1HBXG 1XG1A 3T1BA 5LRSA 1ZYRF 2AO9A 5JHFA 1MDMB 5EEHA 1QVUA 3S3MA 2UWMA 2CQXA 3X2QH 1T8IA 2X4HA 1VQKI 1S3JA 2P5VA 3R0AA 2R93J 2E2JJ 2DU9A 1W0UA 5IOZA 4ZZDA 3K10A 1D5YA 3BTCA 2H8WA 2COBA 1V54H 1Z05A 3O8HA 3BG6A 4IZZA 3E6MA 3J7AY 2DBBA 4CCJA 2GLOA 2GXBA 1H89C 4CCOA 2FNPA 2NVTJ 1S5LC 4IOCF 3DWLE 3E5UA 3DEUA 3MKWB 1FTZA 5EJCA 4BE2A 2R7SA 3U21A 2OBPA 3VWBA 1X1PA 1XCVA 3FXMA 1A04A 3KIOA 1JHHA 4MNUA 2F5EA 3IH4A 5K7HA 1OR7C 1OCPA 2M0MA 3MQ0A 3RZDJ 2XGEA 2GM4A 2V4JC 3KP5A 3AL0B 3FBNB 2VI6A 2Y0SN 4I98B 2KL4A 1D1CA 5TJJA 2DFEA 2R7QA 1APLC 3ZMDA 3H5NA 1SFKA 3IUOA 1L3LA 5M5WJ 3ZRGA 2IA2A 3ABUA 4FT8A 3BDDA 4B43A 3ZQLA 2HVSA 4NDLA 1MNDA 1GHCA 2DAOA 4NC8A 4HSRA 5H20A 3IRQA 4C2UA 4GGGA 3ZOBA 2JA7J 5F1RA 3KE2A 3KZZA 4G8XA 2R7RA 1LUJB 5KCMA 2CYYA 5DEQA 2M4KA 1FMWA 5FFXA 2QBYA 2FRHA 2BY0A 5KAFC 4MEYF 3LSTA 1HXDA 2X1CA 5HLHA 3M1CA 4WF2A 2IGOA 1DUXC 2W85A 5CVVA 5ERIA 1FPQA 3RQIA 1AKHB 2VN2A 2M30A 1D0ZA 3TO6A 3CCVI 3EUAA 3GLXA 4Z2YA 4ENMA 1EF4A 3W6JB 2X51A 1P4AA 4D9JA 1FP1D 5E1WA 4A6DA 2HXIA 1Y0NA 2EWNA 4GYIA 3H9QA 3CLQA 4XONA 3C7JA 1TQPA 4JP0A 4I02A 2RVCA 3KPHA 1FX7A 3S1NJ 1R1VA 4PJNA 2VKVA 3BR0A 1SAUA 3HKZN 4HF2A 4RGXA 1QGPA 2IBDA 4B4CA 1FOXA 3F8FA 4LB5A 4QPQA 5F0HA 5BPDA 2CSOA 1ETVA 4IHSA 3RPUD 2B0LA 1ETQA 3JRDA 2DK8A 3CF2A 4FX4A 1BA5A 4ON0A 3TO9A 2D45A 2EZLA 3DEEA 3CTAA 3A01B 2JT1A 4A0XA 1B4AA 1I3QJ 3GFJA 2R92J 2WB1N 3E3VA 4HLXA 4N9IA 4BEHA 5HS8A 3IC7A 1JHFA 3JCUC 3OY9A 1DU0A 1QU3A 1SC7A 3GWZA 2ETHA 2BY3A 2LRDA 3SDBA 3LNQA 4BQOA 3CF5F 4J01A 3MZ8A 4DQ2A 2PMZN 1I6XA 3E97A 3QYBA 4U0VA 4NUBA 3OYGA 2L7FP 1IN4A 4Q5SF 4PJLA 3QRFF 5DTDA 3BOQA 1A6QA 1I1GA 4JX5A 5F0FA 2NVQJ 1FT9A 2X6XA 4I76A 2J5PA 2E34A 2DPUA 4E7IA 5B1AH 2W25A 3PIOF 1WSUA 3K69A 1TL8A 2LOOA 3EUHA 3ABMH 5CJ9A 1ZHFA 1BC7C 3I4NJ 5GTHC 1UHSA 3CCJI 1QHHD 1ZAOA 1UB9A 3ZMZA 1MBHA 3NAUA 1O57A 2L0KA 4D5FA 2PMUA 3ESWB 1TTYA 3DQVC 1MW7A 4IO9F 1LDJA 2VONA 1QRYA 2AXTC 4G94A 4PFPA 3D5LA 4HPQA 4BHCA 1VQ5I 1A6IA 2Y2ZA 4G7OF 1SVLA 3D5RC 3W6VA 1BW5A 2W84A 2XRNA 3GEZA 2BGCA 4KIFA 2VJ4A 4UV8A 3RZOJ 4RAFA 1SFXA 4LLLA 3J80K 3GFIA 3GTOJ 1HW5A 5E79C 1OCOH 1OQYA 3LOCA 2K9NA 2LKXA 3WU0A 1MDMA 3SEQA 1USTA 1J5YA 3OYCA 1HSTA 2JMWA 5F04A 1G59A 3SYTA 1X4PA 3H9GA 1G4DA 5BQTA 3OYEA 5FLMJ 4JBAA 3WGHA 1FYMA 1MZBA 2G7HA 3FDYA 5J1UA 4HNUA 2MYSA 1T95A 3S32A 1VF9A 5HS7A 4AYBA 1W0TA 2XC7A 4XM3A 1MBJA 2OTJI 3DP7A 1R5GA 2DFHA 1TW3A 3RQ4A 3G1MA 3HJEA 3HC7A 2VXZA 2DI3A 1FTTA 1Z6RA 2JA2A 2F4OB 4L9NA 4P55A 2O6GE 2L02A 4HOBA 1P2FA 3KEOA 1OCRH 3ONQA 2VBZA 4OWRB 1EKEA 4A6EA 1FOWA 3BJ6A 4A2UA 2E1MB 2HVQA 1AA7A 3E5QA 2CH0A 4XLFA 2FOWA 4E7SA 1X3WB 4HYEA 3FMRA 4CCKA 4HW0A 1WJ5A 3B6CA 2BOLA 4CGZA 3V7RA 2CQKA 2XGDA 2FSWA 5L3DA 2IGNA 1YIJI 3PNYA 1K6YA 2P6SA 1HOMA 4JQFA 4EM2A 2XAQA 5GTIC 1SVMA 1LQ1A 4BACA 1F4KA 1JUPA 2WAEA 5KNLA 1XSDA 3B02A 2WC2A 1V5EA 3ERMA 3GZNB 1JJ8C 1LFPA 5LBQA 1ZG3A 3OL4A 1JT0A 5EZGA 4UVCA 2GA2A 1P6RA 2JTVA 4RGRA 3V7SA 3S2WA 1J9IA 3BPVA 3RKYA 4IHYA 1K7AA 1TT0A 1HDDC 3FK6A 2COMA 1VQ6I 4Y13A 3OYBA 2HDDA 1LFUP 3IWFA 5D8KB 2XDVA 2YSRA 4OOIA 1ORKA 1BL0A 1B72B 1AKHA 2L2OA 1Z77A 3U9GA 4A3GJ 2R0QC 2ESHA 2EFOA 3QOPA 2R7UA 5HNHA 3R0JA 2VE8A 2GA1A 2R7XA 1U8RA 3RDIA 3ZQ7A 4CUGA 2KRCA 3AAFA 4M3BA 1X2NA 2D1VA 1ZELA 2ZC2A 4DJAA 4DBRA 4E7KA 2HKXA 3WODF 1W36C 1TWGJ 3ECHA 4DYRA 3GFMA 4DYCA 2HTSA 2OU2A 1NG7A 1T0FA 3PNTA 4AVZA 4ASNA 2O3FA 2Y48A 5LRRA 3RYRA 2K3FA 3NARA 4KICA 3G73A 3H92A 3CC2I 5E1XA 4PUSA 4N9HA 1JKOC 4B48A 2W00A 3D0SA 3A01A 2ZMEC 1YJ9I 3BTIA 5J1YA 2LD5A 3KP2A 5EDNA 2CUZA 3LSGA 3QP6A 2Z2SB 3CCMI 2AS5F 4C2TA 5BMZA 1TLHB 2MLKA 4AM3A 2VLAA 1C0WA 2K27A 5D5XB 1X2MA 3OYHA 2W24A 2PN6A 3JTGA 2CQQA 4R8HA 3ZXSA 1WFXA 3Q0VA 1K79A 1PUFB 4IQJA 4P9FA 5DM6F 1J09A 2NNYA 4IRIA 3WTSC 1IRZA 3O3KA 3BZ6A 4BJTA 4BJ6C 2LFBA 3HM5A 1B1BA 3ML6A 3BPXA 5L3CA 1FC3A 3I53A 1ZARA 1TZLA 3HOSA 4K2EA 2DT5A 2GBYA 4CYCB 2E1CA 3I4MJ 2KLOA 3VODA 2R7TA 4CYDA 2CMPA 1ETXA 4BHBA 1OYYA 2K40A 1W7PD 5D4RA 1UMQA 2V9KA 2DA3A 1WVRA 3SZTA 4G7HF 2HVRA 2EV0A 4U7BA 4NNJA 4UUSA 1ENHA 4XLHA 2BV6A 2GAUA 5K7ZA 1JKRC 5FGMA 4BY7J 3BJOA 4YIFA 3CCUI 3VYSB 4RLQA 2Z9OA 4IX7A 1GXQA 2WV1A 1IRXA 4A3FJ 3PFIA 1UFMA 1K6OA 2Q8KA 3WE2A 3MN2A 2QSGX 1SFEA 3S3OA 2GOMA 1P4XA 3KETA 5FKKA 4QSHA 2CRGA 2VT2A 4HA8A 4M71A 2FBIA 5HOOA 3CUQC 4MFEA 4A3MJ 2BVMA 5CQGA 3GW2A 3G6EI 4LB6B 2DN0A 4HNVA 4LGWA 2P0WA 3MKLA 2GIVA 1ZTRA 4GXOA 5F1JA 2VJ5A 4LIVA 1IXRC 2K9SA 3ZPLA 2E1OA 3TDUC 1OLTA 1S9HA 4PGHA 5KAIC 3REOA 2LY2A 1XSXA 2GIZA 2VQGA 3BCBA 1W36D 1BJZA 3UKGA 3GTPJ 4XLPF 1DPUA 3HOUJ 2WAQN 1G8XA 1XDUA 2DTZA 2JVGA 4RLFA 2ZMEB 3JRGA 1WGXA 4M6XA 4RB0A 5D5WB 2WBMA 4OIRF 1FOKA 1IV8A 1W1WE 2PX9A 2RGVA 1HKTA 2M7AA 4EATA 2XGXA 3BR1A 2IXSA 4BQNA 1V5GA 3HOXJ 1J0RA 4D1QA 5EGOB 1XX5A 2A3SA 2RNGA 1CQTA 4N4OB 2JWTA 2XKPA 2ME6A 3FXOA 2NS7A 5DCFA 1VQNI 2VPLA 2IS2A 5CVRA 1R7JA 2EK5A 2F5CA 3TOBA 1OCTC 2P8TA 3WTWC 4AU7A 1LE8B 1YFHA 3HHGA 1Z3YA 2Y69H 3H3UA 1T2KA 3HKZA 2I10A 3LQQA 1BBYA 3KZYA 3MVPA 3WU1B 1B59A 2ZCWA 2H94A 2FMYA 1H88C 1X1CA 2DPDA 2FE3A 1SMTA 1FIPA 3RYPA 4O6JA 2O8XA 2EA2A 2YS9A 3OS2A 1I39A 3A1YA 4CO8A 3N97A 1T6SA 1TW2A 4E7ZA 2ZXWH 1Y0UA 3LSKA 5LHHA 3L2VA 3SDGA 1K4SA 4DZJA 5FB2A 1B72A 5J8CA 2DOEA 4I2OA 4XORA 2ZNZA 1SD7A 2QCOA 4E6KG 4UB6C 2ZJQF 3ABKH 2R4GA 4KN7X 3IWZA 1ETKA 3V8JA 2OUMA 4MTDA 4B3AA 2K7LA 2CO5A 3E6BA 1HCRA 1Y8QB 3ZMSA 2H6CA 1OCZH 2BBYA 3QPTA 4Q4ZF 3EQLF 3ZQHA 2LSOA 2ZXIA 1BN5A 1I50J 4B8XA 1A35A 4XRSG 2W57A 5CLSA 5IY5H 4HDUA 1QQIA 3FX3A 1XCBA 3QYEA 2X9DA 4PK4A 4CCNA 1YLFA 1ODDA 1WI9A 1HW1A 2O0YA 1D8JA 2QSFX 1TWFJ 1DP3A 3RKWA 4BEHB 3GZ6A 3CCYA 1SVOA 2QQAA 4LG0A 2KIQA 2X0LA 2HYFA 3T8TA 2F5FA 2UXNA 3C2GA 3I56I 5BS6A 3PFYA 3QPHA 3DXJF 5LHIA 1R1UA 1PDNC 2IW5A 4NC6A 3SZPA 1E3PA 2XAHA 3QU6A 4A93J 4HQMA 4YFXF 3JAMK 1PUFA 5K5OA 2TCTA 2FUG2 4ENJA 2YU9J 3BR2A 5FLXK 1MJBA 3OSFA 2DYRH 1W7PA 2KIMA 3L2CA 5BOXA 2DK5A 2L54A 4M73A 1MSEC 3BROA 1D3YA 2YPRA 3CJRB 3OR1C 2MC4A 5M5XJ 4ZTJA 2P7VB 3FF5A 4CYCA 2L9VA 3TKYA 5B66C 4Y4RA 1YHQI 4RBOA 1IUFA 3HZJA 2EZKA 2DMTA 2HYGD 4N0BA 5HVQC 4L18B 2P6TA 1YITI 3F8CA 1XB4A 3JTHA 3JW4A 3NWSA 4MLOA 2HWVA 3FIWA 5E17F 3CJTB 1Z6TA 2F5DA 3W2AA 5J6XA 2IS4A 3FM5A 1IRFA 4XKWA 5EG0B 2QGUA 2X6WA 4BL0B 2QQBA 4LITA 2QQ8A 4F93B 3DKYA 2JRTA 1FYLA 2H1KA 4XK4A 4Y52J 3SZGA 2FU4A 4NC7A 3L9FA 2ECCA 4I7HA 4KT6A 2EIMH 3BCAA 1LVKA 2IS1A 2HDCA 1QA6A 2DA7A 3P9KA 2PMHA 4BXUA 3DTEA 3F23A 1GVJA 2FA5A 4F55A 1BM9A 3FXRA 1QPIA 4MQVA 3EETA 2VQCA 4B44A 4RDUA 3GTMJ 1YS7A 2LREA 3I9V2 3MKZA 2CGPA 2V1NA 1VQ8I 1STZA 1R4MB 2LKSA 3U1DA 1OMIA 1RESA 2QKLB 2HDWA 4HZFA 4F92B 1RIOH 4BE0A 1BIBA 2KMUA 4U7DA 2NOGA 5GAGJ 1P92A 3MAJA 4EEFG 4I09A 2M5WA 2ZMEA 3VOEA 2MD5A 2DFFA 3OYJA 3F6VA 5D5UB 2UV1A 4YFNF 1O4XA 2LBFA 1MIJA 1YX3A 5JHUA 2CFOA 1FBUA 1HSJA 1ETYA 5EGOA 1KU7A 1BI0A 3OYFA 2L9NA 1F1ZA 2KZVA 1LFBA 3M8FA 3NEUA 1P4WA 4D5CA 3V7CA 2UXXA 4RGSA 4UUTA 3LL7A 2HQNA 3I54A 4IOAF 2IJLA 3EUKL 2VKHA 3KP4A 1LE8A 4I0AA 1U6GA 2B7EA 3MZHA 3S2HJ 3RIRA 4C2MJ 3WTVC 1T98A 2KHMA 2HYJA 4PGGA 4YIRX 4H0EA 3UR3C 2M1BA 5J40A 3G2BA 1PP8F 2CV1A 3K9TA 2EBIA 1RZ4A 4LLGF 3ZQGA 1KU2A 1RR7A 3LA7A 2P7CB 4MGRA 1DU6A 4P5OA 3W6KB 2FNAA 2QLZA 1E17A 1DGRM 1OJLA 5FKOA 2NRAC 2KISA 3LSHA 5IT9Z 2Q2EB 2HGCA 3I59B 2BZTA 4NQWB 4BGDA 3A0HC 3BG3A 1WPKA 3FBIB 3O8GA 1YIOA 2XAUA 2OJED 1G3WA 3Q9VA 1IN5A 2ZXJA 4EGZA 1FMVA 2XASA 4BAYA 1T39A 2X1DA 4ZJZA 3GVAA 5J3LA 5C4JJ 5F6FA 2HFHA 1AHDP 3HOZJ 1KGSA 1F9NA 3LSIA 4A3IJ 3Q3SA 5JVGF 3I64A 1K4TA 3L2QA 1NTCA 4XMYA 5K5RA 2QM3A 2GXAA 1S7AA 2ID6A 2FXAA 4A3KJ 2CS3A 1WJBA 3AG2H 3P9CA 4AIJA 2HZTA 2M8EA 2V9VA 3BLYA 3W3CA 3SJMA 1S6LA 3PUBA 4WXHA 2ELJA 3FM3A 3HSFA 4HAMA 2ECBA 2OPTA 1GV2A 4L9JA 2DA1A 5E3OA 1G3TA 4JOMA 3E1SA 2VE9A 1QZZA 4LFUA 5DD8A 3G3ZA 4A3EJ 1SANA 3MD2A 3IH3A 1VQOI 4I01A 4E70A 1SFOJ 5DCMB 2ESNA 4A5MA 4HX8A 3TW6A 3GYHX 1EA3A 4HDVA 4JYKA 4KT5C 4CA0A 2BEOA 5IT9K 3EPZA 2P4WA 1IF1A 3OIOA 1R5ID 2K9MA 3F21A 2ZB9A 4BS9A 3OWTA 5ILSA 1SD4A 1JGGA 5J1RA 5HODA 4FHTA 5H6RA 1RRJA 3M7GA 3QAHA 4V2GA 4FTHA 3CDIA 3R6SA 2N8GA 2YU3A 3S1QJ 3CDHA 4XN3A 2JPCA 4ANJA 1KU9A 1ZQ3P 3HOYJ 1WI3A 4PJJA 2MBFA 1JKPC 5ILUA 4UUSB 1PYVA 3P5JA 2Z33A 2V6EA 2W4SA 4MQ9F 2LYCA 3WGIA 3CCEI 4GFBA 1WJDA 2VBWA 4GDFA 3KZIC 1LEAA 3IP4B 5GP9A 1FJLA 2O8KA 1W5TA 2VL8A 1TWHJ 2XAGA 4S05A 2JPBA 5EG0A 4EJTA 4OIOF 1ULYA 4KN4X 1ZRDA 1WKMA 1QZYA 1R36A 4P9UA 4BE1A 1ETWA 4Q48A 2HS5A 3HGYA 3NQOA 5A2QZ 3BJAA 3HRSA 3K6GA 3LQRA 3N05A 4NHJA 5D4SA 1R49A 3J7AO 1X19A 1U5TC 1T56A 1Z3XA 2VIXA 4RA2A 3J7YJ 4XLAA 3FXJA 1KU3A 4PCQA 3A4CA 5IYBJ 3HB9A 4JX6A 3C3WA 1JT6A 1MD0A 1RETA 2Q1ZB 3PO3J 1DP7P 3JRHA 2VQLA 2HZDA 2GZWA 3HRUA 1N25A 3O2PE 3JSPA 4XIDA 5IP7J 1MSFC 2LLKA 3RKQA 1Z0XA 4AUXA 4A3DJ 4R1HA 1WRJA 3RKXA 1MBEA 1RC9A 1X1DA 3FXQA 3K2ZA 3RPQA 5DUIA 5DM7F 1OYIA 3OS1A 4A0ZA 2EV5A 2PFBA 3D5SC 3RJPA 2JN6A 3LSRA 4LK1F 3HTSB 1EH8A 3V8LA 2DODA 2F4IA 4BU2A 2KP6A 3ZQQA 4F3QA 1RUOA 2VT3A 3A2KA 3U2RA 4CSWA 5CYVA 3BR5A 2KRHA 4R79A 1U78A 2XPVA 4XRFA 2KDOA 3BP8A 5E20A 1A31A 3FZVA 4X1EA 1A5JA 4IPAA 3PL8A 1T33A 2E2IJ 4WK8F 2OCEA 1BC8C 3PIPF 2L5QA 3CCQI 1FWZA 4DYQA 3HDDA 2M4GA 2STTA 4GRIA 3Q9SA 4P1WA 1JUMA 2CJJA 2XF6A 3FXUA 3VYUB 5E3NA 2M9HA 2RREA 4MTEA 1SD6A 1VNDA 2V26A 1WJCA 2CUJA 4E7JA 3WTTC 4CH7A 2FJ1A 3CESA 2NYXA 3F8BA 4CZZA 3ZGKA 5IYDJ 1P7IA 3VEPA 4BXFA 1GVDA 2HU9A 3HPGA 2HQ5A 2Q2EA 3I59A 4PJMA 3TOAA 2EINH 4NQWA 4BH9A 2DA4A 3CMAI 1D8KA 2CFXA 4DNCA 1Y39A 3H35A 1VQLI 2WWYA 1QVTA 5EF6A 2A6EF 1ZLKA 4CICA 3K7AJ 3OYAA 1TWAJ 3HHHA 5ICCA 1CF7A 3LA2A 1ZN2A 5DS9A 4ZDLA 3RPUA 5FFZA 1WJEA 3HRTA 2KJCA 1IV6A 1IW7F 3OYKA 2DOFA 2LF8A 1JGSA 4FE7A 2K86A 3JREA 2B63J 3R4KA 4HF0A 1TP4A 2FQ3A 4DIQA 1ZG5A 3VDXA 1J75A 1GUUA 2H1LA 3ZCOA 4HF1A 1Z7UA 1SEUA 2L9SA 3PSFA 2QZ8A 5FKNA 2RQQA 3QQAA 4ITVA 1ZREA 4LG0B 1IN8A 2F5VA 3DBRB 2HKOA 1PP7U 5CVJA 3FKJA 3MKYB 3A0BC 2L7KA 3I0TA 4Y15A 1IN6A 1TQIA 4KIBA 1IGNA 2X85A 2VPRA 1IZ1A 2VC0A 1VQMI 2IPQX 2D1HA 3TQNA 1OR7A 3K0LA 4HG2A 5HDGA 3F72A 5DCMA 4AWXB 1Y6IA 3HOVJ 3K4CA 4AC0A 1W7PB 3MEXA 3BY6A 5GAHJ 4J00A 1YE9A 4ESBA 5EEAA 1MJ9A 4XOPA 1YI2I 4D0PA 4XN0A 2KZGA 4LJZF 3OYDA 2ZO4A 4NB5A 3H3ZA 4XKVA 1WJAA 1X1BA 4EM0B 2P5KA 2ADUA 2PQ8A 5CQEA 2K02A 1R6RA 2VQHA 5L3FA 5F08A 2JUGA 2CV2A 1X3ZB 2EILH 4L5JA 4AIDA 4M3DA 4B47A 2E19A 5LEKA 4IJAA 3H9JA 2HXOA 3J7ZI 1MBFA 3JRIA 2LY1A 4ESJA 1BR1A 1ON1A 1S72I 1TWCJ 4A69C 3IKTA 2CW8A 2OZ6A 5ICGA 1VQ7I 1MH4A 2M87A 2JA5J 4PZJA 2R5ZB 3ZMVA 2A69F 1IN7A 3UNGC 2DYSH 4C9YA 1XMAA 2ZFUA 4AIKA 3KLNA 2RC4A 3H0DA 2OCCH 2M7BA 3BQZA 3ZN1A 1ZKGA 4F91B 4P96A 5DDGA 2FEZA 2K85A 2E1NA 2EZHA 1DPRA 3KFWX 2Y0SA 1VZ0A 5D6FA 3ECOA 5LEJA 1YYVA 4G6DA 4ZDPA 4KISA 1XGSA 2OF7A 4Q47A 3QWLA 1R71A 4PFOA 3GTLJ 5IPAA 4NBQA 1ZGAA 3OS0A 4RM2A 1ZR4A 2JK3A 3GCMA 3S16J 2EB7A 4RGUA 4HX4A 4IL6C 2W1OA 4KA4A 2E7XA 1MMGA 4RAYA 1FLIA 1SD5A 5FD6A 3DKXA 5JVTA 1O3TA 1T38A 3HL2A 4YIIA 4C3HJ 1ZGWA 4OIPF 4DW6A 1H8AC 5KK1A 2A6HF 2RN7A 2VJIA 4FQGA 2LBFB 2CUFA 2OC6A 2QSHX 4W97A 3LMMA 3E6DA 4IRHA 3GF2A 4PSWA 3IKVA 3IRRA 3CJQB 4QIWN 1HLVA 1NHAA 4XLCA 5LFAA 1LDKB 1XMKA 2E71A 2STWA 4JX4A 1VFCA 4C3IJ 3BTJA 3ZQCA 4ZYDA 1IUYA 4OINF 3GTKJ 5ICFA 3GFLA 3K4KA 2CQNA 5CVUA 3QYFA 3C2HA 1R00A 4S0HB 2HPMA 1Y1VJ 1MKMA 2TDXA 2I8DA 3S1MJ 3NRVA 3DPTA 1BI2A 1VTNC 3KP3A 3DU6A 3LSMA 3PNVA 4A3CJ 1KQ9A 1B6AA 3S1RJ 4M6VA 5B3SH 1ZLJA 4IEJA 2R7WA 2PLYA 1UHWA 4E4HA 4ZYEA 3P9IA 2FBKA 4II3A 3EUHC 2F4MB 5IP9J 3JRCA 1LB2A 1D1BA 1R5HA 2Y30A 1Y56A 4AYBN 1DGWY 1Z21A 2IA1A 2M0CA 2WB1A 2NS8A 2HOTA 3SXYA 2WADA 3CMMA 2YR2A 2DFIA 2LC2A 3HUGB 2EFQA 2MABA 4QTRA 3F3XA 2V79A 2Z16A 3R61A 4ZDOA 3NWTA 2Y9YA 2NNNA 3GZ5A 3MCZA 2PMZA 1U9NA 3E6CC 4EGYA 2JA6J 3S15J 3RTRA 2IEKA 3CUQB 2BXZA 3PO2J 2DDAA 1D5VA 2XIGA 2O03A 3HXLA 3FWEA 2DMUA 2Z5UA 3WHCA 2R5YB 3GTGJ 1QPMA 4XQFA 3MZYA 1O7FA 2G0EA 4L0YB 4EJWA 5FRMA 5CKTA 4HNTA 1WHUA 3DTKA 2MH9A 2J5OA 4XLNF 3F0CA 1PJRA 1V55H 4S04A 3OOPA 4DOZA 3J81Z 1WQ2A 2EPFA 2MG4A 4UB8C 3ZQFA 2XVCA 1VQPI 3BG5A 3MWMA 2EFPA 3E0JB 1O3SA 3WTUC 1NK2P 3OYLA 2F2EA 2P5LC 2I5UA 4BY1J 5EYRA 5E8IA 2XF7A 4LK0F 2H09A 2KT0A 1Q1HA 2PJPA 1KQ0A 2ZBKA 2IP2A 3CC4I 4OAYA 2ELHA 1ETOA 4XRSA 3COAC 4EVIA 2ISYA 3HGGA 3HIFA 4KUMA 2VODA 5BPIA 2DO7A 2MW8A 4FX0A 5E1ZB 3TGNA 3EYYA 2M34A 2CW0F 2K3PA 3H1CA 4IKFA 3OIPA 2QQ9A 2LNBA 4LMYA 1REPC 2GXGA 1X4OA 2X1EA 2ZFWA 2WAFA 4G12A 2MD0A 2BVLA 3I58A 2G7UA 2XGCA 2XPUA 2L7ZA 2XUBA 3F8MA 4BXXJ 1HC8A 2R3SA 4BQAA 1BR4A 3AL0C 3ISPA 1E2XA 3KYCB 4ZH4F 1UCRA 3K2AA 4TV7A 1A36A 5DD4A 4RB3C 5HLTA 1JTYA 1HKQA 1I1SA 1JTXA 1UG2A 2ZXHA 3T0YA 3S17J 3KX2A 1XMXA 1B9MA 2HOSA 1MNMC 4GCVA 1U3EM 3FISA 3K4JA 3RI4A 3CD6I 1Z7LA 5JFRA 4RM3A 2HR3A 1BR2A 2HI3A 2NAZA 2W82A 2HOEA 4FCYA 1NK3P 4I0BA 4IQ4A 4M6YA 2L3DA 2LP0A 3TO7A 3TP3A 4ZTFA 2X6OA 2DLLA 4QWQA 2R5ZA 4G9YA 1HF0A 2VASA 2XB5A 1E3HA 2DW4A 5EZHA 4FISA 3TMOA 1ZR2A 1LVAA 3C18A 1H9GA 2YUSA 2IAIA 1N77A 1WH7A 3M07A 2HEOA 5M3MJ 1CGPA 4XNFA 4OMYA 3K4NA 1OPCA 1X58A 1XN7A 2FMLA 3DEWA 4HLYA 3T5XA 1YX5A 1TC3C 4FETA 2VBXA 4O3MA 3MFKA 4KDPA 2VUMJ 2CUEA 2ZNYA 4L9VA 3JRAA 5LGUA 3H36A 2UZKA 1S8NA 2K4JA 2PG4A 3BR3A 4XICA 2EJRA 1MMAA 2A6TA 3QODA 1IDZA 3DKWA 2LVSA 3F22A 2DQRA 3GLLA 2E7WA 4FE4A 4MHGA 1DDNA 1TBXA 2BY2A 2IS6A 2F6CA 1T0FC 2ZKZA 3C1DA 3JSOA 5C4XJ 3VB2A 1Z1DA 1H9TA 2FQ4A 1Y1WJ 2UUZA 3ULQB 3GO5A 2WV0A 4OAZA 1HA8A 4IXAA 4L5EA 3HTUA 4DZPA 3HOTA 4CXFA 2A61A 4L9TA 1K61A 3FXKA 4CHUA 3QPSA 3HOWJ 1BIAA 3GX4X 1JJ6C 2AHQA 2DDBA 5BNGA 2O7OA 4M3GA 1MGTA 3F9KA 1V4RA 5HLGA 1GXPA 4HV5A 4MO7A 4CZCA 4QPOA 1M1EB 5GADJ 3FKIJ 1BW6A 5LLQA 2RQPA 1MBGA 5IOYA 4HRIA 2HTJA 2LF7A 1OKRA 2OZUA 5HLIA 3GMEA 1HW2A 3L09A 1RUNA 3WHBA 2CW7A 2PEXA 3OSGA 1YRNB 1T08B 2H8RA 4AD9A 4E7LA 5KVRA 2XKOA 4OIQF 1V5FA 3FMSA 3IL2A 2KIUA 3L2RA 3SFZA 2JQ7A 1YW7A 3KEQA 3K1MA 4H4KC 2CU7A 3HUGA 2BW3B 3V4GA 3ELKA 2EZIA 3IHUA 4DGWB 4XL9A 1GT0C 2RDPA 3GBGA 1BOBA 2XF5A 4UV9A 1CF7B 4YFKF 4BNCA 2JZYA 3WTXC 1Z9CA 1AU7A 2CQ7A 3CUQA 4D7MA 3K4BA 1MMNA 3L2UA 4XSXF 2R7FA 4X0GA 1OISA 1LKXA 2KDZA 3FXLA 4XSZF 2XPWA 4A3JJ 4EJOA 3CO6C 2R5YA 3ZQIA 3LSPA 2YX7A 5B1BH 2XB0X 1D0XA 5ILVA 1YTYA 2KQRA 1Y8RB 3GTJJ 3LAPA 4M74A 2G9WA 3WG9A 2V6CA 4G6QA 3B73A 1JE8A 1I3AA 2ZJPF 3Q0UA 3ZN0A 1RPWA 3ASNH 1YOVB 2OA4A 4ABZA 2IRFG 1USSA 3VYTB 4UNOA 2EFWA 1W5SA 1MH3A 3TEDA 3HG9A 4JK1X 4XKCA 2ID3A 1ITYA 1S7OA 4XRMA 3CCLI 4ZYHA 4AVPA 5TISC 1X1AA 1FSHA 1U8BA 2PI0A 4BDZA 1Q1VA 4Z6YA 3AG4H 1XC5A 3J80Z 2E1MC 1Z67A 1D1AA 4LIUA 1FP2A 4KMUX 4BJ5C 4UXNA 3N4MA 2V1XA 3HSEA 4KYWA 4QLCU 1TT5B 4RMNA 3M8EA 1HKSA 3I55I 2A5WA 1FY7A 4WCGA 4J19A 4CCLA 1YJWI 1ONVA 2K4BA 1VQ4I 2JJ7A 2C6YA 5ICEA 4II2A 2E35A 3F6OA 3CCRI 1DQUA 3LWFA 3E5XA 5FO5A 2NXNB 5FKLA 2WAQA 3DTIA 2NVUB 1I5ZA 4M72A 2XAFA 3AKZA 4LLNA 2LTPA 3BZCA 3OOUA 3QOEA 5J8FA 2AXLA 3CP8A 3KP7A 5H2FC 2Z1DA 2IA0A 3K70C 4HQEA 3LA3A 2R7ZJ 4B3XA 1B8IB 3G1OA 3ROUA 5K7FA 1QNTA 2FD5A 4RB1A 4BBSJ 4D7NA 4B09A 2CG4A 1XDSA 3I5UA 2D5VA 2L7MP 3MMYB 3K1NA 1VQ9I 3ABTA 4BUPA 1ACIA 3HSRA 3L00A 5L3BA 1B9NA 1KYZA 5HDNA 2BY1A 1JI8A 1TNTA 4BBRJ 3CUOA 4OMZA 2EQRA 3M1EA 4A0YA 5JLXA 1SMYF 5LHGA 2JRMA 4IHXA 3CMYA 1F36A 5D5VB 4ENNA 3CQZJ 1U0JA 5JI6A 2XV4S 4HEA2 3IAM2 3OIQA 1UZCA 2KKOA 4UY8I 2R7VA 3JRFA 5FRNA 3EYIA 3WU2C 1FBQA 2DA2A 2ELKA 3WTYC 1E0EA 3KCCA 2L4AA 2M8GX 2LH9A 1IAWA 5HNFA 1KZHA 1UHMA 5A2QK 3V8KA 1J7KA 3OMYA 3CCSI 2VB6A 5K1YA 4XBFA 5LGNA 1BOAA 3BZKA 4UUVA 3KYDB 3M8JA 1L0OC 1N75A 5C3EJ 1PVEA 4XKBA 2XAJA 5E18F 1LJ9A 5AIPA 1FEXA 3ZMUA 4EMSA 1KQ8A 1EV7A 5JR3A 3LFUA 4X6AJ 4IHVA 5J4YA 2QYOA 1JUSA 1XPXA 4MIMA 4A5NA 1YRNA 3KEYA 1I27A 1LDDA 2DJIA 2LR8A 4Y17A 4ETSA 5J4VA 4N4NB 4RB2C 3KYLA 2MSYA 2ISZA 4O5VA 3K4LA 3R60A 5GPAA 2QF7A 1N78A 3AFHA 5FD5A 2XSDC 3CMEI 3A02A 3BG7A 2BW3A 3QP5A 1QHGA 5DUKA 2EV6A 1LNWA 1IXSB 3PQKA 1RNLA 1ZGJA 3T8RA 4C3JJ 2ME0A 3L2WA 2ACJA 3SFIA 3CJNA 3CC7I 4M9XA 3OR2C 3SEZA 1LEBA 1I6HJ 1KYWA 1U5TB 2MFZA 3HYIA 3OYIA 2K9LA 2NOJB 2L4MA 1QO0D 3K70D 1XGNA 2XHKA 5B5EC 6PAXA 1P9QC 1YQAA 1ZG1A 2X48A 3EDPA 1GV5A 2LKPA 3VSKA 2XROA
chains in the Genus database with same CATH topology
2H6BA 3ZMTA 2EFNA 3BWGA 4PDKA 1SFUA 1JXSA 1XD7A 3LFKA 2Z3YA 2VOPA 4M9SA 2CWEA 4GO1A 4MEXF 2IT0A 2H27A 2VC1A 2MA3A 4IVNA 2QWWA 3K1PA 1U2WA 2Z99A 3L7WA 2OQGA 2JSCA 3DV8A 2VOOA 4WXCA 1XGOA 1IXCA 1FNNA 2BYVE 1R1TA 3DPLC 1FBSA 4IF4A 1AWCA 5L3EA 5LGTA 1O3RA 5H6QA 1ZRCA 4YG2F 4U0WA 1K78B 5HDKA 1OYWA 1R58A 4A12A 4CDGA 4HX7A 4RAZA 1V3FA 3I4PA 3TDZC 2MLGA 2V1UA 2EA4A 3KP6A 4L5IA 1PUEE 1J2XA 3CO7C 3Q5FA 2KIFA 2Y0MA 1G6NA 4UVBA 3FMQA 3O6BB 1W4MA 1BJAA 1YO5C 4WXDA 4ENKA 4IHTA 1G3YA 3DF8A 2PBIA 4ESFA 4ZZLA 2QVOA 1TNSA 4RS8A 1XSVA 4KIGA 3ZP5A 5AONA 1YW8A 1FYKA 5HS9A 1SAXA 2LDUA 2WTEA 4G7ZF 4LD5A 5DYMA 2KRFA 2D2WA 2QENA 4WX9A 2NS0A 4EJUA 1F5TA 1EH6A 4HBLA 1EH7A 4UVAA 4WWCA 1R23A 2MH2A 1ZH5A 3P7NA 4U0YA 1MJAA 5K5QA 3SHFA 3WGGA 4BYYA 4EJVA 2QUFA 2HQRA 2L01A 2RNJA 3HRMA 4ZYGA 2QBYB 3GXOA 3GUDA 5DV5A 1ZRFA 1XGMA 2KJBA 1IRGA 5L3GA 5IT3A 3KLOA 2YX4A 1Z91A 1BI3A 1WWXA 3JAMZ 1U5TA 2OQRA 4OU0A 3PQJA 1S29A 2RV8A 2M45A 5FLXZ 4KMFA 2FOKA 1HQCA 2DQLA 3OV8A 1G3SA 5EEGA 2FBHA 5AIQA 2O61A 5D6EA 2A68F 3WTZA 5CVIA 3ERED 4UHTA 1BI1A 1X3UA 2ZJ2A 1FZPB 1AOYA 2BE5F 3M9AA 2GWRA 1J59A 2A07F 2OAZA 1R22A 1QBJA 2Y75A 2VBYA 3CLOA 4KNYA 3LAJA 4F7ZA 3I71A 5TRDA 4M9ZA 1O7LA 4HV6A 2A5YB 4U88A 1YS6A 3WE3A 1H0MA 4EM1A 4EQQA 3DFGA 2R7DA 4IRGA 4EV0A 1YG2A 3F8NA 2RKHA 3J81K 2FF4A 1YW9A 4L0ZB 1RI7A 2OD5A 2GQQA 1K78A 4BHPA 2MC3A 1TQMA 5E8GA 5D8LB 2Q0OA 3FHZA 5ED4A 2V1DA 3QU3A 5F64A 1KA8A 4AIHA 3VFZA 3SQNA 1O3QA 1ON2A 2DTRA 2IVMA 4KFCA 1FSEA 4GYGA 1HBXG 3T1BA 5LRSA 1ZYRF 1MDMB 5EEHA 2UWMA 2X4HA 1S3JA 2P5VA 3R0AA 2DU9A 4ZZDA 1Z05A 3E6MA 2DBBA 2GXBA 2FNPA 3E5UA 3DEUA 2OBPA 1XCVA 1A04A 1JHHA 4MNUA 2F5EA 3MQ0A 3KP5A 4I98B 5TJJA 3ZMDA 1L3LA 2IA2A 3ABUA 4FT8A 3BDDA 1GHCA 2DAOA 5H20A 3IRQA 4GGGA 5F1RA 3KE2A 3KZZA 4G8XA 2CYYA 5DEQA 5FFXA 2QBYA 2FRHA 4MEYF 3LSTA 1HXDA 5HLHA 4WF2A 1DUXC 2W85A 5CVVA 5ERIA 1FPQA 2VN2A 2M30A 3TO6A 3GLXA 4Z2YA 4ENMA 3W6JB 1P4AA 1FP1D 5E1WA 4A6DA 2EWNA 4GYIA 3C7JA 1TQPA 4I02A 2RVCA 1FX7A 1R1VA 4HF2A 4RGXA 1QGPA 3F8FA 4LB5A 5BPDA 2CSOA 4IHSA 2B0LA 4FX4A 2DK8A 4ON0A 3TO9A 2D45A 3CTAA 2JT1A 4A0XA 1B4AA 3GFJA 3E3VA 4HLXA 4N9IA 5HS8A 3IC7A 1JHFA 3GWZA 2ETHA 4DQ2A 1I6XA 3E97A 4U0VA 1IN4A 4Q5SF 3QRFF 3BOQA 1I1GA 1FT9A 2J5PA 2DPUA 2W25A 1WSUA 3K69A 3EUHA 5CJ9A 1ZHFA 1BC7C 1ZAOA 1UB9A 3ZMZA 1O57A 2PMUA 1TTYA 3DQVC 1LDJA 2VONA 4G94A 3D5LA 4BHCA 4G7OF 2W84A 2XRNA 3GEZA 2BGCA 4KIFA 4UV8A 1SFXA 4LLLA 3J80K 3GFIA 1HW5A 3WU0A 1MDMA 1USTA 1J5YA 1HSTA 1G4DA 5BQTA 4JBAA 3WGHA 1FYMA 1MZBA 2G7HA 5HS7A 3DP7A 1R5GA 1TW3A 2VXZA 2DI3A 1Z6RA 4L9NA 4P55A 2O6GE 2L02A 4HOBA 1P2FA 3KEOA 2VBZA 4A6EA 3BJ6A 4A2UA 3E5QA 4HYEA 3FMRA 4HW0A 4CGZA 3V7RA 2CQKA 2FSWA 5L3DA 2P6SA 4JQFA 4EM2A 2XAQA 1LQ1A 1F4KA 1XSDA 3B02A 2WC2A 5LBQA 1ZG3A 4UVCA 2GA2A 1P6RA 2JTVA 4RGRA 3V7SA 3S2WA 1J9IA 3BPVA 3RKYA 1K7AA 2COMA 4Y13A 3IWFA 5D8KB 2YSRA 4OOIA 3U9GA 2ESHA 2EFOA 3QOPA 3R0JA 2VE8A 2GA1A 1U8RA 3RDIA 3ZQ7A 3AAFA 2D1VA 2HKXA 3WODF 3ECHA 3GFMA 2HTSA 2OU2A 1T0FA 4ASNA 2O3FA 2Y48A 5LRRA 3RYRA 4KICA 3G73A 3H92A 5E1XA 4N9HA 3D0SA 3KP2A 3QP6A 2AS5F 5BMZA 1TLHB 2MLKA 1C0WA 2K27A 5D5XB 2W24A 2PN6A 3JTGA 4R8HA 1K79A 4P9FA 2NNYA 4IRIA 3WTSC 3O3KA 3BZ6A 1B1BA 3ML6A 3BPXA 5L3CA 1FC3A 3I53A 1ZARA 3HOSA 4K2EA 2DT5A 2E1CA 3VODA 4CYDA 4BHBA 1OYYA 5D4RA 1W7PD 3SZTA 4G7HF 2EV0A 4U7BA 2BV6A 2GAUA 5FGMA 3BJOA 4YIFA 2Z9OA 1GXQA 3PFIA 1UFMA 1K6OA 2Q8KA 3WE2A 1SFEA 1P4XA 3KETA 2VT2A 4HA8A 4M71A 2FBIA 5HOOA 3CUQC 3GW2A 4LB6B 4LGWA 4GXOA 2GIVA 1IXRC 3ZPLA 3TDUC 4PGHA 3REOA 1XSXA 4XLPF 1DPUA 1XDUA 2ZMEB 4M6XA 4RB0A 5D5WB 4OIRF 1FOKA 2RGVA 1HKTA 2XGXA 1J0RA 2A3SA 2XKPA 5DCFA 5CVRA 1R7JA 2EK5A 2F5CA 3TOBA 2P8TA 3WTWC 1YFHA 3HHGA 3H3UA 1T2KA 3LQQA 1BBYA 3KZYA 3WU1B 1B59A 2ZCWA 2H94A 2FMYA 2DPDA 2FE3A 1SMTA 3RYPA 4O6JA 2O8XA 2EA2A 4CO8A 3N97A 1T6SA 1TW2A 1Y0UA 5LHHA 5FB2A 4I2OA 5J8CA 2ZNZA 1SD7A 4KN7X 3IWZA 3V8JA 4MTDA 2K7LA 2CO5A 3E6BA 3ZMSA 2H6CA 2BBYA 3QPTA 4Q4ZF 3EQLF 2LSOA 1BN5A 4B8XA 2W57A 5CLSA 4HDUA 1QQIA 3FX3A 1XCBA 1YLFA 1ODDA 1WI9A 1HW1A 2O0YA 1D8JA 3RKWA 3GZ6A 2QQAA 4LG0A 2X0LA 2HYFA 3T8TA 2F5FA 2UXNA 5BS6A 3QPHA 3DXJF 5LHIA 1R1UA 1PDNC 2IW5A 3SZPA 2XAHA 3QU6A 4HQMA 4YFXF 3JAMK 5K5OA 4ENJA 5FLXK 1MJBA 1W7PA 2KIMA 3L2CA 5BOXA 2DK5A 2L54A 4M73A 3BROA 1D3YA 2YPRA 2P7VB 3FF5A 3TKYA 2HYGD 4N0BA 5HVQC 4L18B 2P6TA 3F8CA 1XB4A 3JTHA 3JW4A 5E17F 2HWVA 1Z6TA 2F5DA 5J6XA 3FM5A 1IRFA 2QQBA 2JRTA 1FYLA 2FU4A 3L9FA 4I7HA 2HDCA 3P9KA 2PMHA 4BXUA 3F23A 1GVJA 2FA5A 1BM9A 3FXRA 4MQVA 3EETA 1YS7A 2CGPA 1STZA 3U1DA 1OMIA 4HZFA 1RIOH 1BIBA 4U7DA 1P92A 3MAJA 4I09A 2M5WA 2ZMEA 3VOEA 2MD5A 3F6VA 5D5UB 4YFNF 5JHUA 1HSJA 1FBUA 1KU7A 1BI0A 1F1ZA 3M8FA 3NEUA 1P4WA 3V7CA 2UXXA 4RGSA 2HQNA 3I54A 2IJLA 3KP4A 4I0AA 1U6GA 3MZHA 3RIRA 3WTVC 1T98A 4PGGA 4H0EA 2M1BA 1PP8F 3K9TA 1RZ4A 4LLGF 1KU2A 3LA7A 2P7CB 4MGRA 4P5OA 3W6KB 2FNAA 2QLZA 1E17A 2NRAC 5IT9Z 2HGCA 3I59B 1YIOA 1G3WA 3Q9VA 1IN5A 2ZXJA 4EGZA 2XASA 4BAYA 1T39A 3GVAA 5F6FA 2HFHA 1KGSA 1F9NA 3I64A 5K5RA 2QM3A 1S7AA 2FXAA 3P9CA 4AIJA 2HZTA 2M8EA 2V9VA 1S6LA 4WXHA 3FM3A 3HSFA 4HAMA 4L9JA 1G3TA 2VE9A 1QZZA 4LFUA 5DD8A 3G3ZA 4I01A 4E70A 5DCMB 2ESNA 4A5MA 4HX8A 3GYHX 4HDVA 4KT5C 5IT9K 2BEOA 2P4WA 1IF1A 3F21A 5ILSA 1SD4A 4FHTA 5H6RA 3M7GA 3QAHA 3R6SA 2YU3A 3CDHA 2JPCA 1KU9A 2MBFA 5ILUA 2Z33A 4MQ9F 3WGIA 2VBWA 1LEAA 1W5TA 2XAGA 4S05A 4OIOF 2JPBA 4EJTA 1ULYA 4KN4X 1ZRDA 1WKMA 1QZYA 1R36A 4P9UA 4Q48A 2HS5A 3NQOA 5A2QZ 3BJAA 3HRSA 4NHJA 3LQRA 5D4SA 3J7AO 1U5TC 1KU3A 4PCQA 3C3WA 1MD0A 1DP7P 2GZWA 3HRUA 3O2PE 3JSPA 4R1HA 1WRJA 3RKXA 3FXQA 3K2ZA 3RPQA 5DUIA 1OYIA 4A0ZA 2EV5A 2PFBA 3RJPA 3HTSB 4LK1F 1EH8A 3V8LA 1RUOA 2VT3A 3U2RA 5CYVA 4R79A 1U78A 4XRFA 3BP8A 5E20A 3FZVA 4IPAA 4WK8F 1BC8C 1FWZA 2STTA 3Q9SA 3FXUA 4MTEA 1SD6A 3WTTC 2NYXA 3F8BA 4CZZA 3VEPA 2Q2EA 3I59A 4BH9A 3TOAA 4NQWA 1D8KA 2CFXA 4DNCA 2WWYA 1ZLKA 2A6EF 4CICA 3HHHA 5ICCA 1CF7A 3LA2A 1ZN2A 3RPUA 5FFZA 3HRTA 2KJCA 1IW7F 2LF8A 1JGSA 2K86A 3R4KA 4HF0A 2FQ3A 1ZG5A 1J75A 4HF1A 1Z7UA 2QZ8A 1ZREA 4LG0B 1IN8A 2HKOA 1PP7U 5CVJA 3I0TA 4Y15A 1IN6A 1TQIA 4KIBA 1IZ1A 2VC0A 2IPQX 2D1HA 3TQNA 1OR7A 3K0LA 5HDGA 3F72A 5DCMA 4AWXB 1W7PB 3MEXA 3BY6A 4ESBA 1MJ9A 4D0PA 4LJZF 2ZO4A 4NB5A 3H3ZA 4EM0B 2P5KA 2ADUA 2PQ8A 2K02A 5L3FA 4L5JA 5LEKA 4IJAA 4ESJA 1ON1A 3IKTA 2OZ6A 5ICGA 2M87A 4PZJA 3ZMVA 2A69F 1IN7A 1XMAA 4AIKA 3KLNA 2RC4A 3ZN1A 4P96A 5DDGA 2FEZA 2E1NA 1DPRA 3KFWX 5D6FA 3ECOA 5LEJA 1YYVA 4G6DA 1XGSA 4Q47A 1ZGAA 2EB7A 4RGUA 4HX4A 4KA4A 2E7XA 4RAYA 1FLIA 1SD5A 5FD6A 1O3TA 5JVTA 1T38A 4YIIA 4OIPF 5KK1A 2A6HF 2RN7A 3E6DA 4IRHA 3GF2A 3IKVA 3IRRA 1NHAA 1LDKB 1XMKA 2STWA 4ZYDA 1IUYA 4OINF 5ICFA 3GFLA 5CVUA 1R00A 1MKMA 2TDXA 3NRVA 3DPTA 1BI2A 1VTNC 3KP3A 1KQ9A 1B6AA 1ZLJA 2PLYA 1UHWA 4ZYEA 3P9IA 2FBKA 1LB2A 1R5HA 2IA1A 3SXYA 2YR2A 2DFIA 2EFQA 3F3XA 2V79A 3R61A 2NNNA 3GZ5A 3MCZA 3E6CC 4EGYA 3RTRA 3CUQB 1D5VA 2XIGA 2O03A 3FWEA 2Z5UA 1QPMA 3MZYA 1O7FA 4L0YB 4EJWA 2MH9A 2J5OA 4XLNF 4S04A 3J81Z 3OOPA 1WQ2A 2XVCA 3MWMA 2EFPA 1O3SA 3WTUC 2F2EA 2P5LC 5E8IA 4LK0F 2H09A 2PJPA 1Q1HA 1KQ0A 2ZBKA 2IP2A 2ELHA 3COAC 4EVIA 2ISYA 3HIFA 4KUMA 2VODA 5BPIA 2DO7A 4FX0A 5E1ZB 3TGNA 3EYYA 2CW0F 2QQ9A 2LNBA 4LMYA 1REPC 2GXGA 2ZFWA 3I58A 2G7UA 2XUBA 3F8MA 2R3SA 4BQAA 3ISPA 1E2XA 4ZH4F 1UCRA 4TV7A 5DD4A 4RB3C 1HKQA 1I1SA 3T0YA 1B9MA 4GCVA 1U3EM 3RI4A 5JFRA 2HR3A 2NAZA 2HOEA 4I0BA 4M6YA 2L3DA 3TO7A 2DLLA 4QWQA 4G9YA 2DW4A 1LVAA 3C18A 1H9GA 2HEOA 1CGPA 4OMYA 1OPCA 2FMLA 1XN7A 4HLYA 3T5XA 2VBXA 4O3MA 3MFKA 4KDPA 2ZNYA 4L9VA 5LGUA 2UZKA 1S8NA 2K4JA 2PG4A 2EJRA 3DKWA 3F22A 2DQRA 2E7WA 4MHGA 1DDNA 1TBXA 2ZKZA 3C1DA 3JSOA 3VB2A 1Z1DA 1H9TA 3ULQB 3GO5A 2WV0A 4IXAA 3HTUA 3HOTA 4CXFA 2A61A 4L9TA 4CHUA 1BIAA 3GX4X 1MGTA 1V4RA 5HLGA 1GXPA 4HV5A 5LLQA 2RQPA 2HTJA 2LF7A 1OKRA 2OZUA 5HLIA 1HW2A 1RUNA 3L09A 2PEXA 4AD9A 5KVRA 2XKOA 4OIQF 3FMSA 3IL2A 2KIUA 3SFZA 1YW7A 3KEQA 3K1MA 3HUGA 3V4GA 3ELKA 3IHUA 2RDPA 4UV9A 1CF7B 4YFKF 4BNCA 2JZYA 3WTXC 1Z9CA 3CUQA 4XSXF 2R7FA 4XSZF 4EJOA 3CO6C 2YX7A 5ILVA 1YTYA 3LAPA 4M74A 2G9WA 3WG9A 2V6CA 4G6QA 3B73A 1JE8A 3ZN0A 2OA4A 2IRFG 1USSA 4UNOA 2EFWA 1W5SA 4JK1X 1S7OA 4ZYHA 4AVPA 1FSHA 2PI0A 3J80Z 1FP2A 4KMUX 4UXNA 3N4MA 2V1XA 3HSEA 4KYWA 4QLCU 3M8EA 1HKSA 1FY7A 4WCGA 1ONVA 2K4BA 2C6YA 5ICEA 3F6OA 3LWFA 3E5XA 5FO5A 1I5ZA 4M72A 2XAFA 4LLNA 5J8FA 2AXLA 3KP7A 2IA0A 4HQEA 3LA3A 3ROUA 1QNTA 4RB1A 4B09A 2CG4A 1XDSA 3I5UA 3K1NA 3ABTA 3HSRA 3L00A 5L3BA 1B9NA 1KYZA 5HDNA 1TNTA 3CUOA 4OMZA 3M1EA 4A0YA 1SMYF 5LHGA 5D5VB 4ENNA 5JI6A 2XV4S 2KKOA 3EYIA 1FBQA 3WTYC 3KCCA 2L4AA 1IAWA 1UHMA 5A2QK 3V8KA 1J7KA 5K1YA 4XBFA 5LGNA 1BOAA 4UUVA 1L0OC 2XAJA 5E18F 1LJ9A 5AIPA 3ZMUA 4EMSA 1KQ8A 1EV7A 5JR3A 2QYOA 4A5NA 1I27A 1LDDA 4Y17A 4ETSA 4RB2C 2ISZA 4O5VA 3R60A 5FD5A 3QP5A 5DUKA 2EV6A 1LNWA 1IXSB 3PQKA 1RNLA 1ZGJA 3T8RA 2ACJA 3CJNA 4M9XA 1LEBA 1KYWA 1U5TB 3HYIA 2L4MA 1QO0D 1XGNA 2XHKA 6PAXA 1YQAA 1ZG1A 3EDPA 2LKPA 2XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6B A;  3ZMT A;  2EFN A;  3BWG A;  4PDK A;  1SFU A;  1JXS A;  1XD7 A;  3LFK A;  2Z3Y A;  2VOP A;  4M9S A;  2CWE A;  4GO1 A;  4MEX F;  2IT0 A;  2H27 A;  2VC1 A;  2MA3 A;  4IVN A;  2QWW A;  3K1P A;  1U2W A;  2Z99 A;  3L7W A;  2OQG A;  2JSC A;  3DV8 A;  2VOO A;  4WXC A;  1XGO A;  1IXC A;  1FNN A;  2BYV E;  1R1T A;  3DPL C;  1FBS A;  4IF4 A;  1AWC A;  5L3E A;  5LGT A;  1O3R A;  5H6Q A;  1ZRC A;  4YG2 F;  4U0W A;  1K78 B;  5HDK A;  1OYW A;  1R58 A;  4A12 A;  4CDG A;  4HX7 A;  4RAZ A;  1V3F A;  3I4P A;  3TDZ C;  2MLG A;  2V1U A;  2EA4 A;  3KP6 A;  4L5I A;  1PUE E;  1J2X A;  3CO7 C;  3Q5F A;  2KIF A;  2Y0M A;  1G6N A;  4UVB A;  3FMQ A;  3O6B B;  1W4M A;  1BJA A;  1YO5 C;  4WXD A;  4ENK A;  4IHT A;  1G3Y A;  3DF8 A;  2PBI A;  4ESF A;  4ZZL A;  2QVO A;  1TNS A;  4RS8 A;  1XSV A;  4KIG A;  3ZP5 A;  5AON A;  1YW8 A;  1FYK A;  5HS9 A;  1SAX A;  2LDU A;  2WTE A;  4G7Z F;  4LD5 A;  5DYM A;  2KRF A;  2D2W A;  2QEN A;  4WX9 A;  2NS0 A;  4EJU A;  1F5T A;  1EH6 A;  4HBL A;  1EH7 A;  4UVA A;  4WWC A;  1R23 A;  2MH2 A;  1ZH5 A;  3P7N A;  4U0Y A;  1MJA A;  5K5Q A;  3SHF A;  3WGG A;  4BYY A;  4EJV A;  2QUF A;  2HQR A;  2L01 A;  2RNJ A;  3HRM A;  4ZYG A;  2QBY B;  3GXO A;  3GUD A;  5DV5 A;  1ZRF A;  1XGM A;  2KJB A;  1IRG A;  5L3G A;  5IT3 A;  3KLO A;  2YX4 A;  1Z91 A;  1BI3 A;  1WWX A;  3JAM Z;  1U5T A;  2OQR A;  4OU0 A;  3PQJ A;  1S29 A;  2RV8 A;  2M45 A;  5FLX Z;  4KMF A;  2FOK A;  1HQC A;  2DQL A;  3OV8 A;  1G3S A;  5EEG A;  2FBH A;  5AIQ A;  2O61 A;  5D6E A;  2A68 F;  3WTZ A;  5CVI A;  3ERE D;  4UHT A;  1BI1 A;  1X3U A;  2ZJ2 A;  1FZP B;  1AOY A;  2BE5 F;  3M9A A;  2GWR A;  1J59 A;  2A07 F;  2OAZ A;  1R22 A;  1QBJ A;  2Y75 A;  2VBY A;  3CLO A;  4KNY A;  3LAJ A;  4F7Z A;  3I71 A;  5TRD A;  4M9Z A;  1O7L A;  4HV6 A;  2A5Y B;  4U88 A;  1YS6 A;  3WE3 A;  1H0M A;  4EM1 A;  4EQQ A;  3DFG A;  2R7D A;  4IRG A;  4EV0 A;  1YG2 A;  3F8N A;  2RKH A;  3J81 K;  2FF4 A;  1YW9 A;  4L0Z B;  1RI7 A;  2OD5 A;  2GQQ A;  1K78 A;  4BHP A;  2MC3 A;  1TQM A;  5E8G A;  5D8L B;  2Q0O A;  3FHZ A;  5ED4 A;  2V1D A;  3QU3 A;  5F64 A;  1KA8 A;  4AIH A;  3VFZ A;  3SQN A;  1O3Q A;  1ON2 A;  2DTR A;  2IVM A;  4KFC A;  1FSE A;  4GYG A;  1HBX G;  3T1B A;  5LRS A;  1ZYR F;  1MDM B;  5EEH A;  2UWM A;  2X4H A;  1S3J A;  2P5V A;  3R0A A;  2DU9 A;  4ZZD A;  1Z05 A;  3E6M A;  2DBB A;  2GXB A;  2FNP A;  3E5U A;  3DEU A;  2OBP A;  1XCV A;  1A04 A;  1JHH A;  4MNU A;  2F5E A;  3MQ0 A;  3KP5 A;  4I98 B;  5TJJ A;  3ZMD A;  1L3L A;  2IA2 A;  3ABU A;  4FT8 A;  3BDD A;  1GHC A;  2DAO A;  5H20 A;  3IRQ A;  4GGG A;  5F1R A;  3KE2 A;  3KZZ A;  4G8X A;  2CYY A;  5DEQ A;  5FFX A;  2QBY A;  2FRH A;  4MEY F;  3LST A;  1HXD A;  5HLH A;  4WF2 A;  1DUX C;  2W85 A;  5CVV A;  5ERI A;  1FPQ A;  2VN2 A;  2M30 A;  3TO6 A;  3GLX A;  4Z2Y A;  4ENM A;  3W6J B;  1P4A A;  1FP1 D;  5E1W A;  4A6D A;  2EWN A;  4GYI A;  3C7J A;  1TQP A;  4I02 A;  2RVC A;  1FX7 A;  1R1V A;  4HF2 A;  4RGX A;  1QGP A;  3F8F A;  4LB5 A;  5BPD A;  2CSO A;  4IHS A;  2B0L A;  4FX4 A;  2DK8 A;  4ON0 A;  3TO9 A;  2D45 A;  3CTA A;  2JT1 A;  4A0X A;  1B4A A;  3GFJ A;  3E3V A;  4HLX A;  4N9I A;  5HS8 A;  3IC7 A;  1JHF A;  3GWZ A;  2ETH A;  4DQ2 A;  1I6X A;  3E97 A;  4U0V A;  1IN4 A;  4Q5S F;  3QRF F;  3BOQ A;  1I1G A;  1FT9 A;  2J5P A;  2DPU A;  2W25 A;  1WSU A;  3K69 A;  3EUH A;  5CJ9 A;  1ZHF A;  1BC7 C;  1ZAO A;  1UB9 A;  3ZMZ A;  1O57 A;  2PMU A;  1TTY A;  3DQV C;  1LDJ A;  2VON A;  4G94 A;  3D5L A;  4BHC A;  4G7O F;  2W84 A;  2XRN A;  3GEZ A;  2BGC A;  4KIF A;  4UV8 A;  1SFX A;  4LLL A;  3J80 K;  3GFI A;  1HW5 A;  3WU0 A;  1MDM A;  1UST A;  1J5Y A;  1HST A;  1G4D A;  5BQT A;  4JBA A;  3WGH A;  1FYM A;  1MZB A;  2G7H A;  5HS7 A;  3DP7 A;  1R5G A;  1TW3 A;  2VXZ A;  2DI3 A;  1Z6R A;  4L9N A;  4P55 A;  2O6G E;  2L02 A;  4HOB A;  1P2F A;  3KEO A;  2VBZ A;  4A6E A;  3BJ6 A;  4A2U A;  3E5Q A;  4HYE A;  3FMR A;  4HW0 A;  4CGZ A;  3V7R A;  2CQK A;  2FSW A;  5L3D A;  2P6S A;  4JQF A;  4EM2 A;  2XAQ A;  1LQ1 A;  1F4K A;  1XSD A;  3B02 A;  2WC2 A;  5LBQ A;  1ZG3 A;  4UVC A;  2GA2 A;  1P6R A;  2JTV A;  4RGR A;  3V7S A;  3S2W A;  1J9I A;  3BPV A;  3RKY A;  1K7A A;  2COM A;  4Y13 A;  3IWF A;  5D8K B;  2YSR A;  4OOI A;  3U9G A;  2ESH A;  2EFO A;  3QOP A;  3R0J A;  2VE8 A;  2GA1 A;  1U8R A;  3RDI A;  3ZQ7 A;  3AAF A;  2D1V A;  2HKX A;  3WOD F;  3ECH A;  3GFM A;  2HTS A;  2OU2 A;  1T0F A;  4ASN A;  2O3F A;  2Y48 A;  5LRR A;  3RYR A;  4KIC A;  3G73 A;  3H92 A;  5E1X A;  4N9H A;  3D0S A;  3KP2 A;  3QP6 A;  2AS5 F;  5BMZ A;  1TLH B;  2MLK A;  1C0W A;  2K27 A;  5D5X B;  2W24 A;  2PN6 A;  3JTG A;  4R8H A;  1K79 A;  4P9F A;  2NNY A;  4IRI A;  3WTS C;  3O3K A;  3BZ6 A;  1B1B A;  3ML6 A;  3BPX A;  5L3C A;  1FC3 A;  3I53 A;  1ZAR A;  3HOS A;  4K2E A;  2DT5 A;  2E1C A;  3VOD A;  4CYD A;  4BHB A;  1OYY A;  5D4R A;  1W7P D;  3SZT A;  4G7H F;  2EV0 A;  4U7B A;  2BV6 A;  2GAU A;  5FGM A;  3BJO A;  4YIF A;  2Z9O A;  1GXQ A;  3PFI A;  1UFM A;  1K6O A;  2Q8K A;  3WE2 A;  1SFE A;  1P4X A;  3KET A;  2VT2 A;  4HA8 A;  4M71 A;  2FBI A;  5HOO A;  3CUQ C;  3GW2 A;  4LB6 B;  4LGW A;  4GXO A;  2GIV A;  1IXR C;  3ZPL A;  3TDU C;  4PGH A;  3REO A;  1XSX A;  4XLP F;  1DPU A;  1XDU A;  2ZME B;  4M6X A;  4RB0 A;  5D5W B;  4OIR F;  1FOK A;  2RGV A;  1HKT A;  2XGX A;  1J0R A;  2A3S A;  2XKP A;  5DCF A;  5CVR A;  1R7J A;  2EK5 A;  2F5C A;  3TOB A;  2P8T A;  3WTW C;  1YFH A;  3HHG A;  3H3U A;  1T2K A;  3LQQ A;  1BBY A;  3KZY A;  3WU1 B;  1B59 A;  2ZCW A;  2H94 A;  2FMY A;  2DPD A;  2FE3 A;  1SMT A;  3RYP A;  4O6J A;  2O8X A;  2EA2 A;  4CO8 A;  3N97 A;  1T6S A;  1TW2 A;  1Y0U A;  5LHH A;  5FB2 A;  4I2O A;  5J8C A;  2ZNZ A;  1SD7 A;  4KN7 X;  3IWZ A;  3V8J A;  4MTD A;  2K7L A;  2CO5 A;  3E6B A;  3ZMS A;  2H6C A;  2BBY A;  3QPT A;  4Q4Z F;  3EQL F;  2LSO A;  1BN5 A;  4B8X A;  2W57 A;  5CLS A;  4HDU A;  1QQI A;  3FX3 A;  1XCB A;  1YLF A;  1ODD A;  1WI9 A;  1HW1 A;  2O0Y A;  1D8J A;  3RKW A;  3GZ6 A;  2QQA A;  4LG0 A;  2X0L A;  2HYF A;  3T8T A;  2F5F A;  2UXN A;  5BS6 A;  3QPH A;  3DXJ F;  5LHI A;  1R1U A;  1PDN C;  2IW5 A;  3SZP A;  2XAH A;  3QU6 A;  4HQM A;  4YFX F;  3JAM K;  5K5O A;  4ENJ A;  5FLX K;  1MJB A;  1W7P A;  2KIM A;  3L2C A;  5BOX A;  2DK5 A;  2L54 A;  4M73 A;  3BRO A;  1D3Y A;  2YPR A;  2P7V B;  3FF5 A;  3TKY A;  2HYG D;  4N0B A;  5HVQ C;  4L18 B;  2P6T A;  3F8C A;  1XB4 A;  3JTH A;  3JW4 A;  5E17 F;  2HWV A;  1Z6T A;  2F5D A;  5J6X A;  3FM5 A;  1IRF A;  2QQB A;  2JRT A;  1FYL A;  2FU4 A;  3L9F A;  4I7H A;  2HDC A;  3P9K A;  2PMH A;  4BXU A;  3F23 A;  1GVJ A;  2FA5 A;  1BM9 A;  3FXR A;  4MQV A;  3EET A;  1YS7 A;  2CGP A;  1STZ A;  3U1D A;  1OMI A;  4HZF A;  1RIO H;  1BIB A;  4U7D A;  1P92 A;  3MAJ A;  4I09 A;  2M5W A;  2ZME A;  3VOE A;  2MD5 A;  3F6V A;  5D5U B;  4YFN F;  5JHU A;  1HSJ A;  1FBU A;  1KU7 A;  1BI0 A;  1F1Z A;  3M8F A;  3NEU A;  1P4W A;  3V7C A;  2UXX A;  4RGS A;  2HQN A;  3I54 A;  2IJL A;  3KP4 A;  4I0A A;  1U6G A;  3MZH A;  3RIR A;  3WTV C;  1T98 A;  4PGG A;  4H0E A;  2M1B A;  1PP8 F;  3K9T A;  1RZ4 A;  4LLG F;  1KU2 A;  3LA7 A;  2P7C B;  4MGR A;  4P5O A;  3W6K B;  2FNA A;  2QLZ A;  1E17 A;  2NRA C;  5IT9 Z;  2HGC A;  3I59 B;  1YIO A;  1G3W A;  3Q9V A;  1IN5 A;  2ZXJ A;  4EGZ A;  2XAS A;  4BAY A;  1T39 A;  3GVA A;  5F6F A;  2HFH A;  1KGS A;  1F9N A;  3I64 A;  5K5R A;  2QM3 A;  1S7A A;  2FXA A;  3P9C A;  4AIJ A;  2HZT A;  2M8E A;  2V9V A;  1S6L A;  4WXH A;  3FM3 A;  3HSF A;  4HAM A;  4L9J A;  1G3T A;  2VE9 A;  1QZZ A;  4LFU A;  5DD8 A;  3G3Z A;  4I01 A;  4E70 A;  5DCM B;  2ESN A;  4A5M A;  4HX8 A;  3GYH X;  4HDV A;  4KT5 C;  5IT9 K;  2BEO A;  2P4W A;  1IF1 A;  3F21 A;  5ILS A;  1SD4 A;  4FHT A;  5H6R A;  3M7G A;  3QAH A;  3R6S A;  2YU3 A;  3CDH A;  2JPC A;  1KU9 A;  2MBF A;  5ILU A;  2Z33 A;  4MQ9 F;  3WGI A;  2VBW A;  1LEA A;  1W5T A;  2XAG A;  4S05 A;  4OIO F;  2JPB A;  4EJT A;  1ULY A;  4KN4 X;  1ZRD A;  1WKM A;  1QZY A;  1R36 A;  4P9U A;  4Q48 A;  2HS5 A;  3NQO A;  5A2Q Z;  3BJA A;  3HRS A;  4NHJ A;  3LQR A;  5D4S A;  3J7A O;  1U5T C;  1KU3 A;  4PCQ A;  3C3W A;  1MD0 A;  1DP7 P;  2GZW A;  3HRU A;  3O2P E;  3JSP A;  4R1H A;  1WRJ A;  3RKX A;  3FXQ A;  3K2Z A;  3RPQ A;  5DUI A;  1OYI A;  4A0Z A;  2EV5 A;  2PFB A;  3RJP A;  3HTS B;  4LK1 F;  1EH8 A;  3V8L A;  1RUO A;  2VT3 A;  3U2R A;  5CYV A;  4R79 A;  1U78 A;  4XRF A;  3BP8 A;  5E20 A;  3FZV A;  4IPA A;  4WK8 F;  1BC8 C;  1FWZ A;  2STT A;  3Q9S A;  3FXU A;  4MTE A;  1SD6 A;  3WTT C;  2NYX A;  3F8B A;  4CZZ A;  3VEP A;  2Q2E A;  3I59 A;  4BH9 A;  3TOA A;  4NQW A;  1D8K A;  2CFX A;  4DNC A;  2WWY A;  1ZLK A;  2A6E F;  4CIC A;  3HHH A;  5ICC A;  1CF7 A;  3LA2 A;  1ZN2 A;  3RPU A;  5FFZ A;  3HRT A;  2KJC A;  1IW7 F;  2LF8 A;  1JGS A;  2K86 A;  3R4K A;  4HF0 A;  2FQ3 A;  1ZG5 A;  1J75 A;  4HF1 A;  1Z7U A;  2QZ8 A;  1ZRE A;  4LG0 B;  1IN8 A;  2HKO A;  1PP7 U;  5CVJ A;  3I0T A;  4Y15 A;  1IN6 A;  1TQI A;  4KIB A;  1IZ1 A;  2VC0 A;  2IPQ X;  2D1H A;  3TQN A;  1OR7 A;  3K0L A;  5HDG A;  3F72 A;  5DCM A;  4AWX B;  1W7P B;  3MEX A;  3BY6 A;  4ESB A;  1MJ9 A;  4D0P A;  4LJZ F;  2ZO4 A;  4NB5 A;  3H3Z A;  4EM0 B;  2P5K A;  2ADU A;  2PQ8 A;  2K02 A;  5L3F A;  4L5J A;  5LEK A;  4IJA A;  4ESJ A;  1ON1 A;  3IKT A;  2OZ6 A;  5ICG A;  2M87 A;  4PZJ A;  3ZMV A;  2A69 F;  1IN7 A;  1XMA A;  4AIK A;  3KLN A;  2RC4 A;  3ZN1 A;  4P96 A;  5DDG A;  2FEZ A;  2E1N A;  1DPR A;  3KFW X;  5D6F A;  3ECO A;  5LEJ A;  1YYV A;  4G6D A;  1XGS A;  4Q47 A;  1ZGA A;  2EB7 A;  4RGU A;  4HX4 A;  4KA4 A;  2E7X A;  4RAY A;  1FLI A;  1SD5 A;  5FD6 A;  1O3T A;  5JVT A;  1T38 A;  4YII A;  4OIP F;  5KK1 A;  2A6H F;  2RN7 A;  3E6D A;  4IRH A;  3GF2 A;  3IKV A;  3IRR A;  1NHA A;  1LDK B;  1XMK A;  2STW A;  4ZYD A;  1IUY A;  4OIN F;  5ICF A;  3GFL A;  5CVU A;  1R00 A;  1MKM A;  2TDX A;  3NRV A;  3DPT A;  1BI2 A;  1VTN C;  3KP3 A;  1KQ9 A;  1B6A A;  1ZLJ A;  2PLY A;  1UHW A;  4ZYE A;  3P9I A;  2FBK A;  1LB2 A;  1R5H A;  2IA1 A;  3SXY A;  2YR2 A;  2DFI A;  2EFQ A;  3F3X A;  2V79 A;  3R61 A;  2NNN A;  3GZ5 A;  3MCZ A;  3E6C C;  4EGY A;  3RTR A;  3CUQ B;  1D5V A;  2XIG A;  2O03 A;  3FWE A;  2Z5U A;  1QPM A;  3MZY A;  1O7F A;  4L0Y B;  4EJW A;  2MH9 A;  2J5O A;  4XLN F;  4S04 A;  3J81 Z;  3OOP A;  1WQ2 A;  2XVC A;  3MWM A;  2EFP A;  1O3S A;  3WTU C;  2F2E A;  2P5L C;  5E8I A;  4LK0 F;  2H09 A;  2PJP A;  1Q1H A;  1KQ0 A;  2ZBK A;  2IP2 A;  2ELH A;  3COA C;  4EVI A;  2ISY A;  3HIF A;  4KUM A;  2VOD A;  5BPI A;  2DO7 A;  4FX0 A;  5E1Z B;  3TGN A;  3EYY A;  2CW0 F;  2QQ9 A;  2LNB A;  4LMY A;  1REP C;  2GXG A;  2ZFW A;  3I58 A;  2G7U A;  2XUB A;  3F8M A;  2R3S A;  4BQA A;  3ISP A;  1E2X A;  4ZH4 F;  1UCR A;  4TV7 A;  5DD4 A;  4RB3 C;  1HKQ A;  1I1S A;  3T0Y A;  1B9M A;  4GCV A;  1U3E M;  3RI4 A;  5JFR A;  2HR3 A;  2NAZ A;  2HOE A;  4I0B A;  4M6Y A;  2L3D A;  3TO7 A;  2DLL A;  4QWQ A;  4G9Y A;  2DW4 A;  1LVA A;  3C18 A;  1H9G A;  2HEO A;  1CGP A;  4OMY A;  1OPC A;  2FML A;  1XN7 A;  4HLY A;  3T5X A;  2VBX A;  4O3M A;  3MFK A;  4KDP A;  2ZNY A;  4L9V A;  5LGU A;  2UZK A;  1S8N A;  2K4J A;  2PG4 A;  2EJR A;  3DKW A;  3F22 A;  2DQR A;  2E7W A;  4MHG A;  1DDN A;  1TBX A;  2ZKZ A;  3C1D A;  3JSO A;  3VB2 A;  1Z1D A;  1H9T A;  3ULQ B;  3GO5 A;  2WV0 A;  4IXA A;  3HTU A;  3HOT A;  4CXF A;  2A61 A;  4L9T A;  4CHU A;  1BIA A;  3GX4 X;  1MGT A;  1V4R A;  5HLG A;  1GXP A;  4HV5 A;  5LLQ A;  2RQP A;  2HTJ A;  2LF7 A;  1OKR A;  2OZU A;  5HLI A;  1HW2 A;  1RUN A;  3L09 A;  2PEX A;  4AD9 A;  5KVR A;  2XKO A;  4OIQ F;  3FMS A;  3IL2 A;  2KIU A;  3SFZ A;  1YW7 A;  3KEQ A;  3K1M A;  3HUG A;  3V4G A;  3ELK A;  3IHU A;  2RDP A;  4UV9 A;  1CF7 B;  4YFK F;  4BNC A;  2JZY A;  3WTX C;  1Z9C A;  3CUQ A;  4XSX F;  2R7F A;  4XSZ F;  4EJO A;  3CO6 C;  2YX7 A;  5ILV A;  1YTY A;  3LAP A;  4M74 A;  2G9W A;  3WG9 A;  2V6C A;  4G6Q A;  3B73 A;  1JE8 A;  3ZN0 A;  2OA4 A;  2IRF G;  1USS A;  4UNO A;  2EFW A;  1W5S A;  4JK1 X;  1S7O A;  4ZYH A;  4AVP A;  1FSH A;  2PI0 A;  3J80 Z;  1FP2 A;  4KMU X;  4UXN A;  3N4M A;  2V1X A;  3HSE A;  4KYW A;  4QLC U;  3M8E A;  1HKS A;  1FY7 A;  4WCG A;  1ONV A;  2K4B A;  2C6Y A;  5ICE A;  3F6O A;  3LWF A;  3E5X A;  5FO5 A;  1I5Z A;  4M72 A;  2XAF A;  4LLN A;  5J8F A;  2AXL A;  3KP7 A;  2IA0 A;  4HQE A;  3LA3 A;  3ROU A;  1QNT A;  4RB1 A;  4B09 A;  2CG4 A;  1XDS A;  3I5U A;  3K1N A;  3ABT A;  3HSR A;  3L00 A;  5L3B A;  1B9N A;  1KYZ A;  5HDN A;  1TNT A;  3CUO A;  4OMZ A;  3M1E A;  4A0Y A;  1SMY F;  5LHG A;  5D5V B;  4ENN A;  5JI6 A;  2XV4 S;  2KKO A;  3EYI A;  1FBQ A;  3WTY C;  3KCC A;  2L4A A;  1IAW A;  1UHM A;  5A2Q K;  3V8K A;  1J7K A;  5K1Y A;  4XBF A;  5LGN A;  1BOA A;  4UUV A;  1L0O C;  2XAJ A;  5E18 F;  1LJ9 A;  5AIP A;  3ZMU A;  4EMS A;  1KQ8 A;  1EV7 A;  5JR3 A;  2QYO A;  4A5N A;  1I27 A;  1LDD A;  4Y17 A;  4ETS A;  4RB2 C;  2ISZ A;  4O5V A;  3R60 A;  5FD5 A;  3QP5 A;  5DUK A;  2EV6 A;  1LNW A;  1IXS B;  3PQK A;  1RNL A;  1ZGJ A;  3T8R A;  2ACJ A;  3CJN A;  4M9X A;  1LEB A;  1KYW A;  1U5T B;  3HYI A;  2L4M A;  1QO0 D;  1XGN A;  2XHK A;  6PAX A;  1YQA A;  1ZG1 A;  3EDP A;  2LKP A;  2XRO A; 
#chains in the Genus database with same CATH topology
 2H6B A;  4M3F A;  1FOY A;  3BQY A;  3ZMT A;  1RR8 C;  1MMS A;  2DJN A;  2EFN A;  3OYM A;  2JVH A;  3BWG A;  2W48 A;  4LG3 A;  3B6A A;  1MBK A;  2DT6 A;  4PDK A;  3L1P A;  1SFU A;  1JXS A;  1R9T J;  1XD7 A;  5F0C A;  3LFK A;  2Z3Y A;  5TGT A;  2VOP A;  4M9S A;  1IC8 A;  2FX0 A;  3E7L A;  1WH5 A;  2DA5 A;  5M3F J;  9ANT A;  4Y3O A;  2CWE A;  2DA6 A;  4GO1 A;  1MMD A;  3LSJ A;  2VJJ A;  2BHY A;  4MEX F;  2IT0 A;  2H27 A;  2VC1 A;  3DLL F;  4DBQ A;  2MA3 A;  4IVN A;  3GTQ J;  2QWW A;  2DCE A;  3K1P A;  1U2W A;  1UG0 A;  2Z99 A;  3H0G J;  3L7W A;  5GPC A;  2OQG A;  2PJR B;  2JSC A;  4LOC A;  3IV5 A;  2HOA A;  3DV8 A;  2VOO A;  5CPR B;  3HPH A;  4WXC A;  2E2H J;  4W1U A;  4BQQ A;  1XGO A;  3S93 A;  2XSJ C;  3HBL A;  3OL3 A;  4F52 A;  1E3O C;  1F43 A;  1IXC A;  3RSN A;  1FNN A;  5FRO A;  2BYV E;  3W2V A;  1R1T A;  3DPL C;  1FBS A;  3RCO A;  4IF4 A;  5IYC J;  3CP2 A;  4FAS D;  4XR6 A;  5GAE J;  3G4S I;  3BT9 A;  1AWC A;  5L3E A;  5LGT A;  1O3R A;  2JSP A;  2WA0 A;  2O5R A;  5H6Q A;  1KON A;  2R7O A;  1ZRC A;  2LG4 A;  4U0W A;  4YG2 F;  1K78 B;  5HDK A;  5IP6 A;  4YEL A;  2ZSH B;  1OYW A;  1R58 A;  4A12 A;  1K83 J;  3M4O J;  2B9S A;  4CDG A;  4HX7 A;  1G2H A;  4RAZ A;  1V3F A;  2QEX I;  3I4P A;  2E60 A;  3TDZ C;  3AG3 H;  2MLG A;  4YRV A;  1B8I A;  2V1U A;  2EA4 A;  3KP6 A;  4L5I A;  4B1R A;  3CZ6 A;  2ICW G;  1PUE E;  3JR9 A;  3A03 A;  2RAE A;  2DOA A;  2LMD A;  2OV7 A;  1J2X A;  3CO7 C;  3Q5F A;  2KIF A;  2Y0M A;  2XRL A;  1JKQ C;  1G6N A;  3FK7 A;  2AQF A;  3PJR A;  2LK2 A;  2ZSI B;  4UVB A;  4ZYA A;  3FMQ A;  3O6B B;  4M3E A;  1W4M A;  3BC8 A;  3OYN A;  1BJA A;  2ZJR F;  1YO5 C;  4HST A;  4WXD A;  4C30 A;  2IGK A;  3PM1 A;  1OCC H;  3BR6 A;  3C2B A;  4U87 A;  2HNH A;  4ENK A;  3D1N I;  5KHD A;  4IHT A;  3V42 A;  1G3Y A;  3DF8 A;  2CV0 A;  2PBI A;  3ABL H;  4ESF A;  4G6T B;  4ZC3 A;  4ZZL A;  3K4M A;  1UAA A;  2HQA A;  3DU5 A;  2QVO A;  1TNS A;  4RS8 A;  2P81 A;  4PSX A;  4KIT B;  1XS9 A;  1XSV A;  4PJ0 C;  4KIG A;  3ZP5 A;  4A3B J;  5AON A;  3TL4 X;  3S14 J;  1YW8 A;  2E5Z A;  1FYK A;  2EIJ H;  3G1L A;  5HS9 A;  1SAX A;  1QZE A;  2LDU A;  2DMP A;  2Y9Z A;  2WTE A;  3H5A A;  5LD2 C;  3U1K A;  3DBL B;  4G7Z F;  4I6Z A;  4LD5 A;  5DYM A;  2KRF A;  2D2W A;  2QEN A;  5F27 A;  3I3L A;  4WX9 A;  2NS0 A;  2DT7 B;  3S3N A;  3DLA A;  3ZR8 X;  1NG6 A;  4EJU A;  1F5T A;  4IHW A;  3IH2 A;  4V19 K;  3CDL A;  1EH6 A;  2EH3 A;  3PSI A;  4HBL A;  1EH7 A;  2QKM B;  4UVA A;  4WWC A;  4YEJ A;  1R23 A;  2Y31 A;  2MH2 A;  1ZH5 A;  3BTL A;  3P7N A;  3FHN A;  1WJF A;  2V9P A;  4U0Y A;  1MJA A;  2VKD A;  3SHF A;  3WGG A;  4BYY A;  3HEF A;  5K5Q A;  1HDP A;  2O9L A;  4RAG A;  4EJV A;  2QUF A;  1NH3 A;  1IO2 A;  2HQR A;  2L01 A;  2RNJ A;  3HRM A;  4ZYG A;  1U9O A;  1XTA A;  1ERD A;  2QBY B;  3GXO A;  3GUD A;  5DV5 A;  2W7N A;  3ASO H;  1ZRF A;  1XGM A;  2KJB A;  4MFD A;  1IRG A;  5L3G A;  4BKX A;  1EJ9 A;  1LPQ A;  5IT3 A;  3KLO A;  2YX4 A;  1Z91 A;  5JLW A;  1WZ2 A;  1BI3 A;  4Y7N J;  4KJZ A;  1WWX A;  3JAM Z;  1U5T A;  1YJN I;  2OQR A;  4V2F A;  4OU0 A;  1FIA A;  2F48 A;  1S29 A;  2RV8 A;  3PQJ A;  2LY9 A;  3W2W A;  1W5C C;  2M45 A;  5FLX Z;  3WG7 H;  4KMF A;  1UEL B;  2FOK A;  1HQC A;  2A05 A;  2DQL A;  3OV8 A;  1G3S A;  2E36 A;  2VXD A;  5EEG A;  2FBH A;  5AIQ A;  5E3L A;  2O61 A;  2X6Y A;  3G71 I;  2MGQ A;  2NVY J;  3IAS 2;  5D6E A;  5C44 J;  1OFC X;  2A68 F;  3DCF A;  3S8P A;  3WTZ A;  5CVI A;  3ERE D;  5FLV A;  1S7E A;  2V7F A;  4UHT A;  1RKT A;  5M5Y J;  1BI1 A;  2BHZ A;  2NVX J;  2JA8 J;  1X3U A;  2ZJ2 A;  1FZP B;  1AOY A;  2BE5 F;  2L9R A;  3M9A A;  2OTL I;  2GWR A;  3VYR B;  1J59 A;  2A07 F;  2TRT A;  2K5C A;  1IG7 A;  3DBH B;  2OAZ A;  4Y33 A;  1GDT A;  2M2E A;  3VPR A;  1R22 A;  2DMN A;  2EIK H;  2Y75 A;  1QBJ A;  3S2D J;  2BXY A;  1POG A;  1UJ8 A;  2JUC A;  1IJW C;  2VBY A;  3CLO A;  4I99 C;  2WY7 Q;  1R4N B;  4KNY A;  2DMQ A;  2AQE A;  2E5N A;  4E7H A;  3LAJ A;  4F7Z A;  2PJR A;  3I71 A;  1WCM J;  3DPU A;  1IDY A;  5TRD A;  4M9Z A;  1O7L A;  2DXI A;  3TBI A;  4HV6 A;  2A5Y B;  4CCM A;  3H3V K;  4U88 A;  1YS6 A;  3WE3 A;  3Q0W A;  1H0M A;  1RKW A;  4XLE A;  4EM1 A;  1MNE A;  4EQQ A;  3DFG A;  2R7D A;  5E3M A;  4IRG A;  4EV0 A;  1YG2 A;  3F8N A;  2RKH A;  3J81 K;  2FF4 A;  1YW9 A;  4L0Z B;  1RI7 A;  1P7J A;  2OD5 A;  2GQQ A;  4A3L J;  3TW7 A;  1K78 A;  3PUF A;  4BHP A;  2M3A A;  2MC3 A;  2VKE A;  3VSL A;  2HPI A;  1TQM A;  3AG1 H;  3QPL A;  2K9Q A;  5E8G A;  2WY8 Q;  5D8L B;  2KPM A;  2QA4 I;  2Q0O A;  1ZK8 A;  3TP0 A;  1D0Y A;  3FHZ A;  5ED4 A;  5FJ8 J;  2KFD A;  5FKM A;  2V1D A;  3BG9 A;  3QU3 A;  5F64 A;  3H5R A;  1KA8 A;  1GLN A;  2IGM A;  4AIH A;  2GOX B;  3VFZ A;  3SQN A;  1O3Q A;  3M3Y J;  1ON2 A;  2DTR A;  2IVM A;  4KFC A;  4BDY A;  5J47 A;  1FSE A;  4GYG A;  1VI0 A;  4XOT A;  3JRB A;  1HBX G;  1XG1 A;  3T1B A;  5LRS A;  1ZYR F;  2AO9 A;  5JHF A;  1MDM B;  5EEH A;  1QVU A;  3S3M A;  2UWM A;  2CQX A;  3X2Q H;  1T8I A;  2X4H A;  1VQK I;  1S3J A;  2P5V A;  3R0A A;  2R93 J;  2E2J J;  2DU9 A;  1W0U A;  5IOZ A;  4ZZD A;  3K10 A;  1D5Y A;  3BTC A;  2H8W A;  2COB A;  1V54 H;  1Z05 A;  3O8H A;  3BG6 A;  4IZZ A;  3E6M A;  3J7A Y;  2DBB A;  4CCJ A;  2GLO A;  2GXB A;  1H89 C;  4CCO A;  2FNP A;  2NVT J;  1S5L C;  4IOC F;  3DWL E;  3E5U A;  3DEU A;  3MKW B;  1FTZ A;  5EJC A;  4BE2 A;  2R7S A;  3U21 A;  2OBP A;  3VWB A;  1X1P A;  1XCV A;  3FXM A;  1A04 A;  3KIO A;  1JHH A;  4MNU A;  2F5E A;  3IH4 A;  5K7H A;  1OR7 C;  1OCP A;  2M0M A;  3MQ0 A;  3RZD J;  2XGE A;  2GM4 A;  2V4J C;  3KP5 A;  3AL0 B;  3FBN B;  2VI6 A;  2Y0S N;  4I98 B;  2KL4 A;  1D1C A;  5TJJ A;  2DFE A;  2R7Q A;  1APL C;  3ZMD A;  3H5N A;  1SFK A;  3IUO A;  1L3L A;  5M5W J;  3ZRG A;  2IA2 A;  3ABU A;  4FT8 A;  3BDD A;  4B43 A;  3ZQL A;  2HVS A;  4NDL A;  1MND A;  1GHC A;  2DAO A;  4NC8 A;  4HSR A;  5H20 A;  3IRQ A;  4C2U A;  4GGG A;  3ZOB A;  2JA7 J;  5F1R A;  3KE2 A;  3KZZ A;  4G8X A;  2R7R A;  1LUJ B;  5KCM A;  2CYY A;  5DEQ A;  2M4K A;  1FMW A;  5FFX A;  2QBY A;  2FRH A;  2BY0 A;  5KAF C;  4MEY F;  3LST A;  1HXD A;  2X1C A;  5HLH A;  3M1C A;  4WF2 A;  2IGO A;  1DUX C;  2W85 A;  5CVV A;  5ERI A;  1FPQ A;  3RQI A;  1AKH B;  2VN2 A;  2M30 A;  1D0Z A;  3TO6 A;  3CCV I;  3EUA A;  3GLX A;  4Z2Y A;  4ENM A;  1EF4 A;  3W6J B;  2X51 A;  1P4A A;  4D9J A;  1FP1 D;  5E1W A;  4A6D A;  2HXI A;  1Y0N A;  2EWN A;  4GYI A;  3H9Q A;  3CLQ A;  4XON A;  3C7J A;  1TQP A;  4JP0 A;  4I02 A;  2RVC A;  3KPH A;  1FX7 A;  3S1N J;  1R1V A;  4PJN A;  2VKV A;  3BR0 A;  1SAU A;  3HKZ N;  4HF2 A;  4RGX A;  1QGP A;  2IBD A;  4B4C A;  1FOX A;  3F8F A;  4LB5 A;  4QPQ A;  5F0H A;  5BPD A;  2CSO A;  1ETV A;  4IHS A;  3RPU D;  2B0L A;  1ETQ A;  3JRD A;  2DK8 A;  3CF2 A;  4FX4 A;  1BA5 A;  4ON0 A;  3TO9 A;  2D45 A;  2EZL A;  3DEE A;  3CTA A;  3A01 B;  2JT1 A;  4A0X A;  1B4A A;  1I3Q J;  3GFJ A;  2R92 J;  2WB1 N;  3E3V A;  4HLX A;  4N9I A;  4BEH A;  5HS8 A;  3IC7 A;  1JHF A;  3JCU C;  3OY9 A;  1DU0 A;  1QU3 A;  1SC7 A;  3GWZ A;  2ETH A;  2BY3 A;  2LRD A;  3SDB A;  3LNQ A;  4BQO A;  3CF5 F;  4J01 A;  3MZ8 A;  4DQ2 A;  2PMZ N;  1I6X A;  3E97 A;  3QYB A;  4U0V A;  4NUB A;  3OYG A;  2L7F P;  1IN4 A;  4Q5S F;  4PJL A;  3QRF F;  5DTD A;  3BOQ A;  1A6Q A;  1I1G A;  4JX5 A;  5F0F A;  2NVQ J;  1FT9 A;  2X6X A;  4I76 A;  2J5P A;  2E34 A;  2DPU A;  4E7I A;  5B1A H;  2W25 A;  3PIO F;  1WSU A;  3K69 A;  1TL8 A;  2LOO A;  3EUH A;  3ABM H;  5CJ9 A;  1ZHF A;  1BC7 C;  3I4N J;  5GTH C;  1UHS A;  3CCJ I;  1QHH D;  1ZAO A;  1UB9 A;  3ZMZ A;  1MBH A;  3NAU A;  1O57 A;  2L0K A;  4D5F A;  2PMU A;  3ESW B;  1TTY A;  3DQV C;  1MW7 A;  4IO9 F;  1LDJ A;  2VON A;  1QRY A;  2AXT C;  4G94 A;  4PFP A;  3D5L A;  4HPQ A;  4BHC A;  1VQ5 I;  1A6I A;  2Y2Z A;  4G7O F;  1SVL A;  3D5R C;  3W6V A;  1BW5 A;  2W84 A;  2XRN A;  3GEZ A;  2BGC A;  4KIF A;  2VJ4 A;  4UV8 A;  3RZO J;  4RAF A;  1SFX A;  4LLL A;  3J80 K;  3GFI A;  3GTO J;  1HW5 A;  5E79 C;  1OCO H;  1OQY A;  3LOC A;  2K9N A;  2LKX A;  3WU0 A;  1MDM A;  3SEQ A;  1UST A;  1J5Y A;  3OYC A;  1HST A;  2JMW A;  5F04 A;  1G59 A;  3SYT A;  1X4P A;  3H9G A;  1G4D A;  5BQT A;  3OYE A;  5FLM J;  4JBA A;  3WGH A;  1FYM A;  1MZB A;  2G7H A;  3FDY A;  5J1U A;  4HNU A;  2MYS A;  1T95 A;  3S32 A;  1VF9 A;  5HS7 A;  4AYB A;  1W0T A;  2XC7 A;  4XM3 A;  1MBJ A;  2OTJ I;  3DP7 A;  1R5G A;  2DFH A;  1TW3 A;  3RQ4 A;  3G1M A;  3HJE A;  3HC7 A;  2VXZ A;  2DI3 A;  1FTT A;  1Z6R A;  2JA2 A;  2F4O B;  4L9N A;  4P55 A;  2O6G E;  2L02 A;  4HOB A;  1P2F A;  3KEO A;  1OCR H;  3ONQ A;  2VBZ A;  4OWR B;  1EKE A;  4A6E A;  1FOW A;  3BJ6 A;  4A2U A;  2E1M B;  2HVQ A;  1AA7 A;  3E5Q A;  2CH0 A;  4XLF A;  2FOW A;  4E7S A;  1X3W B;  4HYE A;  3FMR A;  4CCK A;  4HW0 A;  1WJ5 A;  3B6C A;  2BOL A;  4CGZ A;  3V7R A;  2CQK A;  2XGD A;  2FSW A;  5L3D A;  2IGN A;  1YIJ I;  3PNY A;  1K6Y A;  2P6S A;  1HOM A;  4JQF A;  4EM2 A;  2XAQ A;  5GTI C;  1SVM A;  1LQ1 A;  4BAC A;  1F4K A;  1JUP A;  2WAE A;  5KNL A;  1XSD A;  3B02 A;  2WC2 A;  1V5E A;  3ERM A;  3GZN B;  1JJ8 C;  1LFP A;  5LBQ A;  1ZG3 A;  3OL4 A;  1JT0 A;  5EZG A;  4UVC A;  2GA2 A;  1P6R A;  2JTV A;  4RGR A;  3V7S A;  3S2W A;  1J9I A;  3BPV A;  3RKY A;  4IHY A;  1K7A A;  1TT0 A;  1HDD C;  3FK6 A;  2COM A;  1VQ6 I;  4Y13 A;  3OYB A;  2HDD A;  1LFU P;  3IWF A;  5D8K B;  2XDV A;  2YSR A;  4OOI A;  1ORK A;  1BL0 A;  1B72 B;  1AKH A;  2L2O A;  1Z77 A;  3U9G A;  4A3G J;  2R0Q C;  2ESH A;  2EFO A;  3QOP A;  2R7U A;  5HNH A;  3R0J A;  2VE8 A;  2GA1 A;  2R7X A;  1U8R A;  3RDI A;  3ZQ7 A;  4CUG A;  2KRC A;  3AAF A;  4M3B A;  1X2N A;  2D1V A;  1ZEL A;  2ZC2 A;  4DJA A;  4DBR A;  4E7K A;  2HKX A;  3WOD F;  1W36 C;  1TWG J;  3ECH A;  4DYR A;  3GFM A;  4DYC A;  2HTS A;  2OU2 A;  1NG7 A;  1T0F A;  3PNT A;  4AVZ A;  4ASN A;  2O3F A;  2Y48 A;  5LRR A;  3RYR A;  2K3F A;  3NAR A;  4KIC A;  3G73 A;  3H92 A;  3CC2 I;  5E1X A;  4PUS A;  4N9H A;  1JKO C;  4B48 A;  2W00 A;  3D0S A;  3A01 A;  2ZME C;  1YJ9 I;  3BTI A;  5J1Y A;  2LD5 A;  3KP2 A;  5EDN A;  2CUZ A;  3LSG A;  3QP6 A;  2Z2S B;  3CCM I;  2AS5 F;  4C2T A;  5BMZ A;  1TLH B;  2MLK A;  4AM3 A;  2VLA A;  1C0W A;  2K27 A;  5D5X B;  1X2M A;  3OYH A;  2W24 A;  2PN6 A;  3JTG A;  2CQQ A;  4R8H A;  3ZXS A;  1WFX A;  3Q0V A;  1K79 A;  1PUF B;  4IQJ A;  4P9F A;  5DM6 F;  1J09 A;  2NNY A;  4IRI A;  3WTS C;  1IRZ A;  3O3K A;  3BZ6 A;  4BJT A;  4BJ6 C;  2LFB A;  3HM5 A;  1B1B A;  3ML6 A;  3BPX A;  5L3C A;  1FC3 A;  3I53 A;  1ZAR A;  1TZL A;  3HOS A;  4K2E A;  2DT5 A;  2GBY A;  4CYC B;  2E1C A;  3I4M J;  2KLO A;  3VOD A;  2R7T A;  4CYD A;  2CMP A;  1ETX A;  4BHB A;  1OYY A;  2K40 A;  1W7P D;  5D4R A;  1UMQ A;  2V9K A;  2DA3 A;  1WVR A;  3SZT A;  4G7H F;  2HVR A;  2EV0 A;  4U7B A;  4NNJ A;  4UUS A;  1ENH A;  4XLH A;  2BV6 A;  2GAU A;  5K7Z A;  1JKR C;  5FGM A;  4BY7 J;  3BJO A;  4YIF A;  3CCU I;  3VYS B;  4RLQ A;  2Z9O A;  4IX7 A;  1GXQ A;  2WV1 A;  1IRX A;  4A3F J;  3PFI A;  1UFM A;  1K6O A;  2Q8K A;  3WE2 A;  3MN2 A;  2QSG X;  1SFE A;  3S3O A;  2GOM A;  1P4X A;  3KET A;  5FKK A;  4QSH A;  2CRG A;  2VT2 A;  4HA8 A;  4M71 A;  2FBI A;  5HOO A;  3CUQ C;  4MFE A;  4A3M J;  2BVM A;  5CQG A;  3GW2 A;  3G6E I;  4LB6 B;  2DN0 A;  4HNV A;  4LGW A;  2P0W A;  3MKL A;  2GIV A;  1ZTR A;  4GXO A;  5F1J A;  2VJ5 A;  4LIV A;  1IXR C;  2K9S A;  3ZPL A;  2E1O A;  3TDU C;  1OLT A;  1S9H A;  4PGH A;  5KAI C;  3REO A;  2LY2 A;  1XSX A;  2GIZ A;  2VQG A;  3BCB A;  1W36 D;  1BJZ A;  3UKG A;  3GTP J;  4XLP F;  1DPU A;  3HOU J;  2WAQ N;  1G8X A;  1XDU A;  2DTZ A;  2JVG A;  4RLF A;  2ZME B;  3JRG A;  1WGX A;  4M6X A;  4RB0 A;  5D5W B;  2WBM A;  4OIR F;  1FOK A;  1IV8 A;  1W1W E;  2PX9 A;  2RGV A;  1HKT A;  2M7A A;  4EAT A;  2XGX A;  3BR1 A;  2IXS A;  4BQN A;  1V5G A;  3HOX J;  1J0R A;  4D1Q A;  5EGO B;  1XX5 A;  2A3S A;  2RNG A;  1CQT A;  4N4O B;  2JWT A;  2XKP A;  2ME6 A;  3FXO A;  2NS7 A;  5DCF A;  1VQN I;  2VPL A;  2IS2 A;  5CVR A;  1R7J A;  2EK5 A;  2F5C A;  3TOB A;  1OCT C;  2P8T A;  3WTW C;  4AU7 A;  1LE8 B;  1YFH A;  3HHG A;  1Z3Y A;  2Y69 H;  3H3U A;  1T2K A;  3HKZ A;  2I10 A;  3LQQ A;  1BBY A;  3KZY A;  3MVP A;  3WU1 B;  1B59 A;  2ZCW A;  2H94 A;  2FMY A;  1H88 C;  1X1C A;  2DPD A;  2FE3 A;  1SMT A;  1FIP A;  3RYP A;  4O6J A;  2O8X A;  2EA2 A;  2YS9 A;  3OS2 A;  1I39 A;  3A1Y A;  4CO8 A;  3N97 A;  1T6S A;  1TW2 A;  4E7Z A;  2ZXW H;  1Y0U A;  3LSK A;  5LHH A;  3L2V A;  3SDG A;  1K4S A;  4DZJ A;  5FB2 A;  1B72 A;  5J8C A;  2DOE A;  4I2O A;  4XOR A;  2ZNZ A;  1SD7 A;  2QCO A;  4E6K G;  4UB6 C;  2ZJQ F;  3ABK H;  2R4G A;  4KN7 X;  3IWZ A;  1ETK A;  3V8J A;  2OUM A;  4MTD A;  4B3A A;  2K7L A;  2CO5 A;  3E6B A;  1HCR A;  1Y8Q B;  3ZMS A;  2H6C A;  1OCZ H;  2BBY A;  3QPT A;  4Q4Z F;  3EQL F;  3ZQH A;  2LSO A;  2ZXI A;  1BN5 A;  1I50 J;  4B8X A;  1A35 A;  4XRS G;  2W57 A;  5CLS A;  5IY5 H;  4HDU A;  1QQI A;  3FX3 A;  1XCB A;  3QYE A;  2X9D A;  4PK4 A;  4CCN A;  1YLF A;  1ODD A;  1WI9 A;  1HW1 A;  2O0Y A;  1D8J A;  2QSF X;  1TWF J;  1DP3 A;  3RKW A;  4BEH B;  3GZ6 A;  3CCY A;  1SVO A;  2QQA A;  4LG0 A;  2KIQ A;  2X0L A;  2HYF A;  3T8T A;  2F5F A;  2UXN A;  3C2G A;  3I56 I;  5BS6 A;  3PFY A;  3QPH A;  3DXJ F;  5LHI A;  1R1U A;  1PDN C;  2IW5 A;  4NC6 A;  3SZP A;  1E3P A;  2XAH A;  3QU6 A;  4A93 J;  4HQM A;  4YFX F;  3JAM K;  1PUF A;  5K5O A;  2TCT A;  2FUG 2;  4ENJ A;  2YU9 J;  3BR2 A;  5FLX K;  1MJB A;  3OSF A;  2DYR H;  1W7P A;  2KIM A;  3L2C A;  5BOX A;  2DK5 A;  2L54 A;  4M73 A;  1MSE C;  3BRO A;  1D3Y A;  2YPR A;  3CJR B;  3OR1 C;  2MC4 A;  5M5X J;  4ZTJ A;  2P7V B;  3FF5 A;  4CYC A;  2L9V A;  3TKY A;  5B66 C;  4Y4R A;  1YHQ I;  4RBO A;  1IUF A;  3HZJ A;  2EZK A;  2DMT A;  2HYG D;  4N0B A;  5HVQ C;  4L18 B;  2P6T A;  1YIT I;  3F8C A;  1XB4 A;  3JTH A;  3JW4 A;  3NWS A;  4MLO A;  2HWV A;  3FIW A;  5E17 F;  3CJT B;  1Z6T A;  2F5D A;  3W2A A;  5J6X A;  2IS4 A;  3FM5 A;  1IRF A;  4XKW A;  5EG0 B;  2QGU A;  2X6W A;  4BL0 B;  2QQB A;  4LIT A;  2QQ8 A;  4F93 B;  3DKY A;  2JRT A;  1FYL A;  2H1K A;  4XK4 A;  4Y52 J;  3SZG A;  2FU4 A;  4NC7 A;  3L9F A;  2ECC A;  4I7H A;  4KT6 A;  2EIM H;  3BCA A;  1LVK A;  2IS1 A;  2HDC A;  1QA6 A;  2DA7 A;  3P9K A;  2PMH A;  4BXU A;  3DTE A;  3F23 A;  1GVJ A;  2FA5 A;  4F55 A;  1BM9 A;  3FXR A;  1QPI A;  4MQV A;  3EET A;  2VQC A;  4B44 A;  4RDU A;  3GTM J;  1YS7 A;  2LRE A;  3I9V 2;  3MKZ A;  2CGP A;  2V1N A;  1VQ8 I;  1STZ A;  1R4M B;  2LKS A;  3U1D A;  1OMI A;  1RES A;  2QKL B;  2HDW A;  4HZF A;  4F92 B;  1RIO H;  4BE0 A;  1BIB A;  2KMU A;  4U7D A;  2NOG A;  5GAG J;  1P92 A;  3MAJ A;  4EEF G;  4I09 A;  2M5W A;  2ZME A;  3VOE A;  2MD5 A;  2DFF A;  3OYJ A;  3F6V A;  5D5U B;  2UV1 A;  4YFN F;  1O4X A;  2LBF A;  1MIJ A;  1YX3 A;  5JHU A;  2CFO A;  1FBU A;  1HSJ A;  1ETY A;  5EGO A;  1KU7 A;  1BI0 A;  3OYF A;  2L9N A;  1F1Z A;  2KZV A;  1LFB A;  3M8F A;  3NEU A;  1P4W A;  4D5C A;  3V7C A;  2UXX A;  4RGS A;  4UUT A;  3LL7 A;  2HQN A;  3I54 A;  4IOA F;  2IJL A;  3EUK L;  2VKH A;  3KP4 A;  1LE8 A;  4I0A A;  1U6G A;  2B7E A;  3MZH A;  3S2H J;  3RIR A;  4C2M J;  3WTV C;  1T98 A;  2KHM A;  2HYJ A;  4PGG A;  4YIR X;  4H0E A;  3UR3 C;  2M1B A;  5J40 A;  3G2B A;  1PP8 F;  2CV1 A;  3K9T A;  2EBI A;  1RZ4 A;  4LLG F;  3ZQG A;  1KU2 A;  1RR7 A;  3LA7 A;  2P7C B;  4MGR A;  1DU6 A;  4P5O A;  3W6K B;  2FNA A;  2QLZ A;  1E17 A;  1DGR M;  1OJL A;  5FKO A;  2NRA C;  2KIS A;  3LSH A;  5IT9 Z;  2Q2E B;  2HGC A;  3I59 B;  2BZT A;  4NQW B;  4BGD A;  3A0H C;  3BG3 A;  1WPK A;  3FBI B;  3O8G A;  1YIO A;  2XAU A;  2OJE D;  1G3W A;  3Q9V A;  1IN5 A;  2ZXJ A;  4EGZ A;  1FMV A;  2XAS A;  4BAY A;  1T39 A;  2X1D A;  4ZJZ A;  3GVA A;  5J3L A;  5C4J J;  5F6F A;  2HFH A;  1AHD P;  3HOZ J;  1KGS A;  1F9N A;  3LSI A;  4A3I J;  3Q3S A;  5JVG F;  3I64 A;  1K4T A;  3L2Q A;  1NTC A;  4XMY A;  5K5R A;  2QM3 A;  2GXA A;  1S7A A;  2ID6 A;  2FXA A;  4A3K J;  2CS3 A;  1WJB A;  3AG2 H;  3P9C A;  4AIJ A;  2HZT A;  2M8E A;  2V9V A;  3BLY A;  3W3C A;  3SJM A;  1S6L A;  3PUB A;  4WXH A;  2ELJ A;  3FM3 A;  3HSF A;  4HAM A;  2ECB A;  2OPT A;  1GV2 A;  4L9J A;  2DA1 A;  5E3O A;  1G3T A;  4JOM A;  3E1S A;  2VE9 A;  1QZZ A;  4LFU A;  5DD8 A;  3G3Z A;  4A3E J;  1SAN A;  3MD2 A;  3IH3 A;  1VQO I;  4I01 A;  4E70 A;  1SFO J;  5DCM B;  2ESN A;  4A5M A;  4HX8 A;  3TW6 A;  3GYH X;  1EA3 A;  4HDV A;  4JYK A;  4KT5 C;  4CA0 A;  2BEO A;  5IT9 K;  3EPZ A;  2P4W A;  1IF1 A;  3OIO A;  1R5I D;  2K9M A;  3F21 A;  2ZB9 A;  4BS9 A;  3OWT A;  5ILS A;  1SD4 A;  1JGG A;  5J1R A;  5HOD A;  4FHT A;  5H6R A;  1RRJ A;  3M7G A;  3QAH A;  4V2G A;  4FTH A;  3CDI A;  3R6S A;  2N8G A;  2YU3 A;  3S1Q J;  3CDH A;  4XN3 A;  2JPC A;  4ANJ A;  1KU9 A;  1ZQ3 P;  3HOY J;  1WI3 A;  4PJJ A;  2MBF A;  1JKP C;  5ILU A;  4UUS B;  1PYV A;  3P5J A;  2Z33 A;  2V6E A;  2W4S A;  4MQ9 F;  2LYC A;  3WGI A;  3CCE I;  4GFB A;  1WJD A;  2VBW A;  4GDF A;  3KZI C;  1LEA A;  3IP4 B;  5GP9 A;  1FJL A;  2O8K A;  1W5T A;  2VL8 A;  1TWH J;  2XAG A;  4S05 A;  2JPB A;  5EG0 A;  4EJT A;  4OIO F;  1ULY A;  4KN4 X;  1ZRD A;  1WKM A;  1QZY A;  1R36 A;  4P9U A;  4BE1 A;  1ETW A;  4Q48 A;  2HS5 A;  3HGY A;  3NQO A;  5A2Q Z;  3BJA A;  3HRS A;  3K6G A;  3LQR A;  3N05 A;  4NHJ A;  5D4S A;  1R49 A;  3J7A O;  1X19 A;  1U5T C;  1T56 A;  1Z3X A;  2VIX A;  4RA2 A;  3J7Y J;  4XLA A;  3FXJ A;  1KU3 A;  4PCQ A;  3A4C A;  5IYB J;  3HB9 A;  4JX6 A;  3C3W A;  1JT6 A;  1MD0 A;  1RET A;  2Q1Z B;  3PO3 J;  1DP7 P;  3JRH A;  2VQL A;  2HZD A;  2GZW A;  3HRU A;  1N25 A;  3O2P E;  3JSP A;  4XID A;  5IP7 J;  1MSF C;  2LLK A;  3RKQ A;  1Z0X A;  4AUX A;  4A3D J;  4R1H A;  1WRJ A;  3RKX A;  1MBE A;  1RC9 A;  1X1D A;  3FXQ A;  3K2Z A;  3RPQ A;  5DUI A;  5DM7 F;  1OYI A;  3OS1 A;  4A0Z A;  2EV5 A;  2PFB A;  3D5S C;  3RJP A;  2JN6 A;  3LSR A;  4LK1 F;  3HTS B;  1EH8 A;  3V8L A;  2DOD A;  2F4I A;  4BU2 A;  2KP6 A;  3ZQQ A;  4F3Q A;  1RUO A;  2VT3 A;  3A2K A;  3U2R A;  4CSW A;  5CYV A;  3BR5 A;  2KRH A;  4R79 A;  1U78 A;  2XPV A;  4XRF A;  2KDO A;  3BP8 A;  5E20 A;  1A31 A;  3FZV A;  4X1E A;  1A5J A;  4IPA A;  3PL8 A;  1T33 A;  2E2I J;  4WK8 F;  2OCE A;  1BC8 C;  3PIP F;  2L5Q A;  3CCQ I;  1FWZ A;  4DYQ A;  3HDD A;  2M4G A;  2STT A;  4GRI A;  3Q9S A;  4P1W A;  1JUM A;  2CJJ A;  2XF6 A;  3FXU A;  3VYU B;  5E3N A;  2M9H A;  2RRE A;  4MTE A;  1SD6 A;  1VND A;  2V26 A;  1WJC A;  2CUJ A;  4E7J A;  3WTT C;  4CH7 A;  2FJ1 A;  3CES A;  2NYX A;  3F8B A;  4CZZ A;  3ZGK A;  5IYD J;  1P7I A;  3VEP A;  4BXF A;  1GVD A;  2HU9 A;  3HPG A;  2HQ5 A;  2Q2E A;  3I59 A;  4PJM A;  3TOA A;  2EIN H;  4NQW A;  4BH9 A;  2DA4 A;  3CMA I;  1D8K A;  2CFX A;  4DNC A;  1Y39 A;  3H35 A;  1VQL I;  2WWY A;  1QVT A;  5EF6 A;  2A6E F;  1ZLK A;  4CIC A;  3K7A J;  3OYA A;  1TWA J;  3HHH A;  5ICC A;  1CF7 A;  3LA2 A;  1ZN2 A;  5DS9 A;  4ZDL A;  3RPU A;  5FFZ A;  1WJE A;  3HRT A;  2KJC A;  1IV6 A;  1IW7 F;  3OYK A;  2DOF A;  2LF8 A;  1JGS A;  4FE7 A;  2K86 A;  3JRE A;  2B63 J;  3R4K A;  4HF0 A;  1TP4 A;  2FQ3 A;  4DIQ A;  1ZG5 A;  3VDX A;  1J75 A;  1GUU A;  2H1L A;  3ZCO A;  4HF1 A;  1Z7U A;  1SEU A;  2L9S A;  3PSF A;  2QZ8 A;  5FKN A;  2RQQ A;  3QQA A;  4ITV A;  1ZRE A;  4LG0 B;  1IN8 A;  2F5V A;  3DBR B;  2HKO A;  1PP7 U;  5CVJ A;  3FKJ A;  3MKY B;  3A0B C;  2L7K A;  3I0T A;  4Y15 A;  1IN6 A;  1TQI A;  4KIB A;  1IGN A;  2X85 A;  2VPR A;  1IZ1 A;  2VC0 A;  1VQM I;  2IPQ X;  2D1H A;  3TQN A;  1OR7 A;  3K0L A;  4HG2 A;  5HDG A;  3F72 A;  5DCM A;  4AWX B;  1Y6I A;  3HOV J;  3K4C A;  4AC0 A;  1W7P B;  3MEX A;  3BY6 A;  5GAH J;  4J00 A;  1YE9 A;  4ESB A;  5EEA A;  1MJ9 A;  4XOP A;  1YI2 I;  4D0P A;  4XN0 A;  2KZG A;  4LJZ F;  3OYD A;  2ZO4 A;  4NB5 A;  3H3Z A;  4XKV A;  1WJA A;  1X1B A;  4EM0 B;  2P5K A;  2ADU A;  2PQ8 A;  5CQE A;  2K02 A;  1R6R A;  2VQH A;  5L3F A;  5F08 A;  2JUG A;  2CV2 A;  1X3Z B;  2EIL H;  4L5J A;  4AID A;  4M3D A;  4B47 A;  2E19 A;  5LEK A;  4IJA A;  3H9J A;  2HXO A;  3J7Z I;  1MBF A;  3JRI A;  2LY1 A;  4ESJ A;  1BR1 A;  1ON1 A;  1S72 I;  1TWC J;  4A69 C;  3IKT A;  2CW8 A;  2OZ6 A;  5ICG A;  1VQ7 I;  1MH4 A;  2M87 A;  2JA5 J;  4PZJ A;  2R5Z B;  3ZMV A;  2A69 F;  1IN7 A;  3UNG C;  2DYS H;  4C9Y A;  1XMA A;  2ZFU A;  4AIK A;  3KLN A;  2RC4 A;  3H0D A;  2OCC H;  2M7B A;  3BQZ A;  3ZN1 A;  1ZKG A;  4F91 B;  4P96 A;  5DDG A;  2FEZ A;  2K85 A;  2E1N A;  2EZH A;  1DPR A;  3KFW X;  2Y0S A;  1VZ0 A;  5D6F A;  3ECO A;  5LEJ A;  1YYV A;  4G6D A;  4ZDP A;  4KIS A;  1XGS A;  2OF7 A;  4Q47 A;  3QWL A;  1R71 A;  4PFO A;  3GTL J;  5IPA A;  4NBQ A;  1ZGA A;  3OS0 A;  4RM2 A;  1ZR4 A;  2JK3 A;  3GCM A;  3S16 J;  2EB7 A;  4RGU A;  4HX4 A;  4IL6 C;  2W1O A;  4KA4 A;  2E7X A;  1MMG A;  4RAY A;  1FLI A;  1SD5 A;  5FD6 A;  3DKX A;  5JVT A;  1O3T A;  1T38 A;  3HL2 A;  4YII A;  4C3H J;  1ZGW A;  4OIP F;  4DW6 A;  1H8A C;  5KK1 A;  2A6H F;  2RN7 A;  2VJI A;  4FQG A;  2LBF B;  2CUF A;  2OC6 A;  2QSH X;  4W97 A;  3LMM A;  3E6D A;  4IRH A;  3GF2 A;  4PSW A;  3IKV A;  3IRR A;  3CJQ B;  4QIW N;  1HLV A;  1NHA A;  4XLC A;  5LFA A;  1LDK B;  1XMK A;  2E71 A;  2STW A;  4JX4 A;  1VFC A;  4C3I J;  3BTJ A;  3ZQC A;  4ZYD A;  1IUY A;  4OIN F;  3GTK J;  5ICF A;  3GFL A;  3K4K A;  2CQN A;  5CVU A;  3QYF A;  3C2H A;  1R00 A;  4S0H B;  2HPM A;  1Y1V J;  1MKM A;  2TDX A;  2I8D A;  3S1M J;  3NRV A;  3DPT A;  1BI2 A;  1VTN C;  3KP3 A;  3DU6 A;  3LSM A;  3PNV A;  4A3C J;  1KQ9 A;  1B6A A;  3S1R J;  4M6V A;  5B3S H;  1ZLJ A;  4IEJ A;  2R7W A;  2PLY A;  1UHW A;  4E4H A;  4ZYE A;  3P9I A;  2FBK A;  4II3 A;  3EUH C;  2F4M B;  5IP9 J;  3JRC A;  1LB2 A;  1D1B A;  1R5H A;  2Y30 A;  1Y56 A;  4AYB N;  1DGW Y;  1Z21 A;  2IA1 A;  2M0C A;  2WB1 A;  2NS8 A;  2HOT A;  3SXY A;  2WAD A;  3CMM A;  2YR2 A;  2DFI A;  2LC2 A;  3HUG B;  2EFQ A;  2MAB A;  4QTR A;  3F3X A;  2V79 A;  2Z16 A;  3R61 A;  4ZDO A;  3NWT A;  2Y9Y A;  2NNN A;  3GZ5 A;  3MCZ A;  2PMZ A;  1U9N A;  3E6C C;  4EGY A;  2JA6 J;  3S15 J;  3RTR A;  2IEK A;  3CUQ B;  2BXZ A;  3PO2 J;  2DDA A;  1D5V A;  2XIG A;  2O03 A;  3HXL A;  3FWE A;  2DMU A;  2Z5U A;  3WHC A;  2R5Y B;  3GTG J;  1QPM A;  4XQF A;  3MZY A;  1O7F A;  2G0E A;  4L0Y B;  4EJW A;  5FRM A;  5CKT A;  4HNT A;  1WHU A;  3DTK A;  2MH9 A;  2J5O A;  4XLN F;  3F0C A;  1PJR A;  1V55 H;  4S04 A;  3OOP A;  4DOZ A;  3J81 Z;  1WQ2 A;  2EPF A;  2MG4 A;  4UB8 C;  3ZQF A;  2XVC A;  1VQP I;  3BG5 A;  3MWM A;  2EFP A;  3E0J B;  1O3S A;  3WTU C;  1NK2 P;  3OYL A;  2F2E A;  2P5L C;  2I5U A;  4BY1 J;  5EYR A;  5E8I A;  2XF7 A;  4LK0 F;  2H09 A;  2KT0 A;  1Q1H A;  2PJP A;  1KQ0 A;  2ZBK A;  2IP2 A;  3CC4 I;  4OAY A;  2ELH A;  1ETO A;  4XRS A;  3COA C;  4EVI A;  2ISY A;  3HGG A;  3HIF A;  4KUM A;  2VOD A;  5BPI A;  2DO7 A;  2MW8 A;  4FX0 A;  5E1Z B;  3TGN A;  3EYY A;  2M34 A;  2CW0 F;  2K3P A;  3H1C A;  4IKF A;  3OIP A;  2QQ9 A;  2LNB A;  4LMY A;  1REP C;  2GXG A;  1X4O A;  2X1E A;  2ZFW A;  2WAF A;  4G12 A;  2MD0 A;  2BVL A;  3I58 A;  2G7U A;  2XGC A;  2XPU A;  2L7Z A;  2XUB A;  3F8M A;  4BXX J;  1HC8 A;  2R3S A;  4BQA A;  1BR4 A;  3AL0 C;  3ISP A;  1E2X A;  3KYC B;  4ZH4 F;  1UCR A;  3K2A A;  4TV7 A;  1A36 A;  5DD4 A;  4RB3 C;  5HLT A;  1JTY A;  1HKQ A;  1I1S A;  1JTX A;  1UG2 A;  2ZXH A;  3T0Y A;  3S17 J;  3KX2 A;  1XMX A;  1B9M A;  2HOS A;  1MNM C;  4GCV A;  1U3E M;  3FIS A;  3K4J A;  3RI4 A;  3CD6 I;  1Z7L A;  5JFR A;  4RM3 A;  2HR3 A;  1BR2 A;  2HI3 A;  2NAZ A;  2W82 A;  2HOE A;  4FCY A;  1NK3 P;  4I0B A;  4IQ4 A;  4M6Y A;  2L3D A;  2LP0 A;  3TO7 A;  3TP3 A;  4ZTF A;  2X6O A;  2DLL A;  4QWQ A;  2R5Z A;  4G9Y A;  1HF0 A;  2VAS A;  2XB5 A;  1E3H A;  2DW4 A;  5EZH A;  4FIS A;  3TMO A;  1ZR2 A;  1LVA A;  3C18 A;  1H9G A;  2YUS A;  2IAI A;  1N77 A;  1WH7 A;  3M07 A;  2HEO A;  5M3M J;  1CGP A;  4XNF A;  4OMY A;  3K4N A;  1OPC A;  1X58 A;  1XN7 A;  2FML A;  3DEW A;  4HLY A;  3T5X A;  1YX5 A;  1TC3 C;  4FET A;  2VBX A;  4O3M A;  3MFK A;  4KDP A;  2VUM J;  2CUE A;  2ZNY A;  4L9V A;  3JRA A;  5LGU A;  3H36 A;  2UZK A;  1S8N A;  2K4J A;  2PG4 A;  3BR3 A;  4XIC A;  2EJR A;  1MMA A;  2A6T A;  3QOD A;  1IDZ A;  3DKW A;  2LVS A;  3F22 A;  2DQR A;  3GLL A;  2E7W A;  4FE4 A;  4MHG A;  1DDN A;  1TBX A;  2BY2 A;  2IS6 A;  2F6C A;  1T0F C;  2ZKZ A;  3C1D A;  3JSO A;  5C4X J;  3VB2 A;  1Z1D A;  1H9T A;  2FQ4 A;  1Y1W J;  2UUZ A;  3ULQ B;  3GO5 A;  2WV0 A;  4OAZ A;  1HA8 A;  4IXA A;  4L5E A;  3HTU A;  4DZP A;  3HOT A;  4CXF A;  2A61 A;  4L9T A;  1K61 A;  3FXK A;  4CHU A;  3QPS A;  3HOW J;  1BIA A;  3GX4 X;  1JJ6 C;  2AHQ A;  2DDB A;  5BNG A;  2O7O A;  4M3G A;  1MGT A;  3F9K A;  1V4R A;  5HLG A;  1GXP A;  4HV5 A;  4MO7 A;  4CZC A;  4QPO A;  1M1E B;  5GAD J;  3FKI J;  1BW6 A;  5LLQ A;  2RQP A;  1MBG A;  5IOY A;  4HRI A;  2HTJ A;  2LF7 A;  1OKR A;  2OZU A;  5HLI A;  3GME A;  1HW2 A;  3L09 A;  1RUN A;  3WHB A;  2CW7 A;  2PEX A;  3OSG A;  1YRN B;  1T08 B;  2H8R A;  4AD9 A;  4E7L A;  5KVR A;  2XKO A;  4OIQ F;  1V5F A;  3FMS A;  3IL2 A;  2KIU A;  3L2R A;  3SFZ A;  2JQ7 A;  1YW7 A;  3KEQ A;  3K1M A;  4H4K C;  2CU7 A;  3HUG A;  2BW3 B;  3V4G A;  3ELK A;  2EZI A;  3IHU A;  4DGW B;  4XL9 A;  1GT0 C;  2RDP A;  3GBG A;  1BOB A;  2XF5 A;  4UV9 A;  1CF7 B;  4YFK F;  4BNC A;  2JZY A;  3WTX C;  1Z9C A;  1AU7 A;  2CQ7 A;  3CUQ A;  4D7M A;  3K4B A;  1MMN A;  3L2U A;  4XSX F;  2R7F A;  4X0G A;  1OIS A;  1LKX A;  2KDZ A;  3FXL A;  4XSZ F;  2XPW A;  4A3J J;  4EJO A;  3CO6 C;  2R5Y A;  3ZQI A;  3LSP A;  2YX7 A;  5B1B H;  2XB0 X;  1D0X A;  5ILV A;  1YTY A;  2KQR A;  1Y8R B;  3GTJ J;  3LAP A;  4M74 A;  2G9W A;  3WG9 A;  2V6C A;  4G6Q A;  3B73 A;  1JE8 A;  1I3A A;  2ZJP F;  3Q0U A;  3ZN0 A;  1RPW A;  3ASN H;  1YOV B;  2OA4 A;  4ABZ A;  2IRF G;  1USS A;  3VYT B;  4UNO A;  2EFW A;  1W5S A;  1MH3 A;  3TED A;  3HG9 A;  4JK1 X;  4XKC A;  2ID3 A;  1ITY A;  1S7O A;  4XRM A;  3CCL I;  4ZYH A;  4AVP A;  5TIS C;  1X1A A;  1FSH A;  1U8B A;  2PI0 A;  4BDZ A;  1Q1V A;  4Z6Y A;  3AG4 H;  1XC5 A;  3J80 Z;  2E1M C;  1Z67 A;  1D1A A;  4LIU A;  1FP2 A;  4KMU X;  4BJ5 C;  4UXN A;  3N4M A;  2V1X A;  3HSE A;  4KYW A;  4QLC U;  1TT5 B;  4RMN A;  3M8E A;  1HKS A;  3I55 I;  2A5W A;  1FY7 A;  4WCG A;  4J19 A;  4CCL A;  1YJW I;  1ONV A;  2K4B A;  1VQ4 I;  2JJ7 A;  2C6Y A;  5ICE A;  4II2 A;  2E35 A;  3F6O A;  3CCR I;  1DQU A;  3LWF A;  3E5X A;  5FO5 A;  2NXN B;  5FKL A;  2WAQ A;  3DTI A;  2NVU B;  1I5Z A;  4M72 A;  2XAF A;  3AKZ A;  4LLN A;  2LTP A;  3BZC A;  3OOU A;  3QOE A;  5J8F A;  2AXL A;  3CP8 A;  3KP7 A;  5H2F C;  2Z1D A;  2IA0 A;  3K70 C;  4HQE A;  3LA3 A;  2R7Z J;  4B3X A;  1B8I B;  3G1O A;  3ROU A;  5K7F A;  1QNT A;  2FD5 A;  4RB1 A;  4BBS J;  4D7N A;  4B09 A;  2CG4 A;  1XDS A;  3I5U A;  2D5V A;  2L7M P;  3MMY B;  3K1N A;  1VQ9 I;  3ABT A;  4BUP A;  1ACI A;  3HSR A;  3L00 A;  5L3B A;  1B9N A;  1KYZ A;  5HDN A;  2BY1 A;  1JI8 A;  1TNT A;  4BBR J;  3CUO A;  4OMZ A;  2EQR A;  3M1E A;  4A0Y A;  5JLX A;  1SMY F;  5LHG A;  2JRM A;  4IHX A;  3CMY A;  1F36 A;  5D5V B;  4ENN A;  3CQZ J;  1U0J A;  5JI6 A;  2XV4 S;  4HEA 2;  3IAM 2;  3OIQ A;  1UZC A;  2KKO A;  4UY8 I;  2R7V A;  3JRF A;  5FRN A;  3EYI A;  3WU2 C;  1FBQ A;  2DA2 A;  2ELK A;  3WTY C;  1E0E A;  3KCC A;  2L4A A;  2M8G X;  2LH9 A;  1IAW A;  5HNF A;  1KZH A;  1UHM A;  5A2Q K;  3V8K A;  1J7K A;  3OMY A;  3CCS I;  2VB6 A;  5K1Y A;  4XBF A;  5LGN A;  1BOA A;  3BZK A;  4UUV A;  3KYD B;  3M8J A;  1L0O C;  1N75 A;  5C3E J;  1PVE A;  4XKB A;  2XAJ A;  5E18 F;  1LJ9 A;  5AIP A;  1FEX A;  3ZMU A;  4EMS A;  1KQ8 A;  1EV7 A;  5JR3 A;  3LFU A;  4X6A J;  4IHV A;  5J4Y A;  2QYO A;  1JUS A;  1XPX A;  4MIM A;  4A5N A;  1YRN A;  3KEY A;  1I27 A;  1LDD A;  2DJI A;  2LR8 A;  4Y17 A;  4ETS A;  5J4V A;  4N4N B;  4RB2 C;  3KYL A;  2MSY A;  2ISZ A;  4O5V A;  3K4L A;  3R60 A;  5GPA A;  2QF7 A;  1N78 A;  3AFH A;  5FD5 A;  2XSD C;  3CME I;  3A02 A;  3BG7 A;  2BW3 A;  3QP5 A;  1QHG A;  5DUK A;  2EV6 A;  1LNW A;  1IXS B;  3PQK A;  1RNL A;  1ZGJ A;  3T8R A;  4C3J J;  2ME0 A;  3L2W A;  2ACJ A;  3SFI A;  3CJN A;  3CC7 I;  4M9X A;  3OR2 C;  3SEZ A;  1LEB A;  1I6H J;  1KYW A;  1U5T B;  2MFZ A;  3HYI A;  3OYI A;  2K9L A;  2NOJ B;  2L4M A;  1QO0 D;  3K70 D;  1XGN A;  2XHK A;  5B5E C;  6PAX A;  1P9Q C;  1YQA A;  1ZG1 A;  2X48 A;  3EDP A;  1GV5 A;  2LKP A;  3VSK A;  2XRO A; 
#chains in the Genus database with same CATH homology
 2H6B A;  3ZMT A;  2EFN A;  3BWG A;  4PDK A;  1SFU A;  1JXS A;  1XD7 A;  3LFK A;  2Z3Y A;  2VOP A;  4M9S A;  2CWE A;  4GO1 A;  4MEX F;  2IT0 A;  2H27 A;  2VC1 A;  2MA3 A;  4IVN A;  2QWW A;  3K1P A;  1U2W A;  2Z99 A;  3L7W A;  2OQG A;  2JSC A;  3DV8 A;  2VOO A;  4WXC A;  1XGO A;  1IXC A;  1FNN A;  2BYV E;  1R1T A;  3DPL C;  1FBS A;  4IF4 A;  1AWC A;  5L3E A;  5LGT A;  1O3R A;  5H6Q A;  1ZRC A;  4YG2 F;  4U0W A;  1K78 B;  5HDK A;  1OYW A;  1R58 A;  4A12 A;  4CDG A;  4HX7 A;  4RAZ A;  1V3F A;  3I4P A;  3TDZ C;  2MLG A;  2V1U A;  2EA4 A;  3KP6 A;  4L5I A;  1PUE E;  1J2X A;  3CO7 C;  3Q5F A;  2KIF A;  2Y0M A;  1G6N A;  4UVB A;  3FMQ A;  3O6B B;  1W4M A;  1BJA A;  1YO5 C;  4WXD A;  4ENK A;  4IHT A;  1G3Y A;  3DF8 A;  2PBI A;  4ESF A;  4ZZL A;  2QVO A;  1TNS A;  4RS8 A;  1XSV A;  4KIG A;  3ZP5 A;  5AON A;  1YW8 A;  1FYK A;  5HS9 A;  1SAX A;  2LDU A;  2WTE A;  4G7Z F;  4LD5 A;  5DYM A;  2KRF A;  2D2W A;  2QEN A;  4WX9 A;  2NS0 A;  4EJU A;  1F5T A;  1EH6 A;  4HBL A;  1EH7 A;  4UVA A;  4WWC A;  1R23 A;  2MH2 A;  1ZH5 A;  3P7N A;  4U0Y A;  1MJA A;  5K5Q A;  3SHF A;  3WGG A;  4BYY A;  4EJV A;  2QUF A;  2HQR A;  2L01 A;  2RNJ A;  3HRM A;  4ZYG A;  2QBY B;  3GXO A;  3GUD A;  5DV5 A;  1ZRF A;  1XGM A;  2KJB A;  1IRG A;  5L3G A;  5IT3 A;  3KLO A;  2YX4 A;  1Z91 A;  1BI3 A;  1WWX A;  3JAM Z;  1U5T A;  2OQR A;  4OU0 A;  3PQJ A;  1S29 A;  2RV8 A;  2M45 A;  5FLX Z;  4KMF A;  2FOK A;  1HQC A;  2DQL A;  3OV8 A;  1G3S A;  5EEG A;  2FBH A;  5AIQ A;  2O61 A;  5D6E A;  2A68 F;  3WTZ A;  5CVI A;  3ERE D;  4UHT A;  1BI1 A;  1X3U A;  2ZJ2 A;  1FZP B;  1AOY A;  2BE5 F;  3M9A A;  2GWR A;  1J59 A;  2A07 F;  2OAZ A;  1R22 A;  1QBJ A;  2Y75 A;  2VBY A;  3CLO A;  4KNY A;  3LAJ A;  4F7Z A;  3I71 A;  5TRD A;  4M9Z A;  1O7L A;  4HV6 A;  2A5Y B;  4U88 A;  1YS6 A;  3WE3 A;  1H0M A;  4EM1 A;  4EQQ A;  3DFG A;  2R7D A;  4IRG A;  4EV0 A;  1YG2 A;  3F8N A;  2RKH A;  3J81 K;  2FF4 A;  1YW9 A;  4L0Z B;  1RI7 A;  2OD5 A;  2GQQ A;  1K78 A;  4BHP A;  2MC3 A;  1TQM A;  5E8G A;  5D8L B;  2Q0O A;  3FHZ A;  5ED4 A;  2V1D A;  3QU3 A;  5F64 A;  1KA8 A;  4AIH A;  3VFZ A;  3SQN A;  1O3Q A;  1ON2 A;  2DTR A;  2IVM A;  4KFC A;  1FSE A;  4GYG A;  1HBX G;  3T1B A;  5LRS A;  1ZYR F;  1MDM B;  5EEH A;  2UWM A;  2X4H A;  1S3J A;  2P5V A;  3R0A A;  2DU9 A;  4ZZD A;  1Z05 A;  3E6M A;  2DBB A;  2GXB A;  2FNP A;  3E5U A;  3DEU A;  2OBP A;  1XCV A;  1A04 A;  1JHH A;  4MNU A;  2F5E A;  3MQ0 A;  3KP5 A;  4I98 B;  5TJJ A;  3ZMD A;  1L3L A;  2IA2 A;  3ABU A;  4FT8 A;  3BDD A;  1GHC A;  2DAO A;  5H20 A;  3IRQ A;  4GGG A;  5F1R A;  3KE2 A;  3KZZ A;  4G8X A;  2CYY A;  5DEQ A;  5FFX A;  2QBY A;  2FRH A;  4MEY F;  3LST A;  1HXD A;  5HLH A;  4WF2 A;  1DUX C;  2W85 A;  5CVV A;  5ERI A;  1FPQ A;  2VN2 A;  2M30 A;  3TO6 A;  3GLX A;  4Z2Y A;  4ENM A;  3W6J B;  1P4A A;  1FP1 D;  5E1W A;  4A6D A;  2EWN A;  4GYI A;  3C7J A;  1TQP A;  4I02 A;  2RVC A;  1FX7 A;  1R1V A;  4HF2 A;  4RGX A;  1QGP A;  3F8F A;  4LB5 A;  5BPD A;  2CSO A;  4IHS A;  2B0L A;  4FX4 A;  2DK8 A;  4ON0 A;  3TO9 A;  2D45 A;  3CTA A;  2JT1 A;  4A0X A;  1B4A A;  3GFJ A;  3E3V A;  4HLX A;  4N9I A;  5HS8 A;  3IC7 A;  1JHF A;  3GWZ A;  2ETH A;  4DQ2 A;  1I6X A;  3E97 A;  4U0V A;  1IN4 A;  4Q5S F;  3QRF F;  3BOQ A;  1I1G A;  1FT9 A;  2J5P A;  2DPU A;  2W25 A;  1WSU A;  3K69 A;  3EUH A;  5CJ9 A;  1ZHF A;  1BC7 C;  1ZAO A;  1UB9 A;  3ZMZ A;  1O57 A;  2PMU A;  1TTY A;  3DQV C;  1LDJ A;  2VON A;  4G94 A;  3D5L A;  4BHC A;  4G7O F;  2W84 A;  2XRN A;  3GEZ A;  2BGC A;  4KIF A;  4UV8 A;  1SFX A;  4LLL A;  3J80 K;  3GFI A;  1HW5 A;  3WU0 A;  1MDM A;  1UST A;  1J5Y A;  1HST A;  1G4D A;  5BQT A;  4JBA A;  3WGH A;  1FYM A;  1MZB A;  2G7H A;  5HS7 A;  3DP7 A;  1R5G A;  1TW3 A;  2VXZ A;  2DI3 A;  1Z6R A;  4L9N A;  4P55 A;  2O6G E;  2L02 A;  4HOB A;  1P2F A;  3KEO A;  2VBZ A;  4A6E A;  3BJ6 A;  4A2U A;  3E5Q A;  4HYE A;  3FMR A;  4HW0 A;  4CGZ A;  3V7R A;  2CQK A;  2FSW A;  5L3D A;  2P6S A;  4JQF A;  4EM2 A;  2XAQ A;  1LQ1 A;  1F4K A;  1XSD A;  3B02 A;  2WC2 A;  5LBQ A;  1ZG3 A;  4UVC A;  2GA2 A;  1P6R A;  2JTV A;  4RGR A;  3V7S A;  3S2W A;  1J9I A;  3BPV A;  3RKY A;  1K7A A;  2COM A;  4Y13 A;  3IWF A;  5D8K B;  2YSR A;  4OOI A;  3U9G A;  2ESH A;  2EFO A;  3QOP A;  3R0J A;  2VE8 A;  2GA1 A;  1U8R A;  3RDI A;  3ZQ7 A;  3AAF A;  2D1V A;  2HKX A;  3WOD F;  3ECH A;  3GFM A;  2HTS A;  2OU2 A;  1T0F A;  4ASN A;  2O3F A;  2Y48 A;  5LRR A;  3RYR A;  4KIC A;  3G73 A;  3H92 A;  5E1X A;  4N9H A;  3D0S A;  3KP2 A;  3QP6 A;  2AS5 F;  5BMZ A;  1TLH B;  2MLK A;  1C0W A;  2K27 A;  5D5X B;  2W24 A;  2PN6 A;  3JTG A;  4R8H A;  1K79 A;  4P9F A;  2NNY A;  4IRI A;  3WTS C;  3O3K A;  3BZ6 A;  1B1B A;  3ML6 A;  3BPX A;  5L3C A;  1FC3 A;  3I53 A;  1ZAR A;  3HOS A;  4K2E A;  2DT5 A;  2E1C A;  3VOD A;  4CYD A;  4BHB A;  1OYY A;  5D4R A;  1W7P D;  3SZT A;  4G7H F;  2EV0 A;  4U7B A;  2BV6 A;  2GAU A;  5FGM A;  3BJO A;  4YIF A;  2Z9O A;  1GXQ A;  3PFI A;  1UFM A;  1K6O A;  2Q8K A;  3WE2 A;  1SFE A;  1P4X A;  3KET A;  2VT2 A;  4HA8 A;  4M71 A;  2FBI A;  5HOO A;  3CUQ C;  3GW2 A;  4LB6 B;  4LGW A;  4GXO A;  2GIV A;  1IXR C;  3ZPL A;  3TDU C;  4PGH A;  3REO A;  1XSX A;  4XLP F;  1DPU A;  1XDU A;  2ZME B;  4M6X A;  4RB0 A;  5D5W B;  4OIR F;  1FOK A;  2RGV A;  1HKT A;  2XGX A;  1J0R A;  2A3S A;  2XKP A;  5DCF A;  5CVR A;  1R7J A;  2EK5 A;  2F5C A;  3TOB A;  2P8T A;  3WTW C;  1YFH A;  3HHG A;  3H3U A;  1T2K A;  3LQQ A;  1BBY A;  3KZY A;  3WU1 B;  1B59 A;  2ZCW A;  2H94 A;  2FMY A;  2DPD A;  2FE3 A;  1SMT A;  3RYP A;  4O6J A;  2O8X A;  2EA2 A;  4CO8 A;  3N97 A;  1T6S A;  1TW2 A;  1Y0U A;  5LHH A;  5FB2 A;  4I2O A;  5J8C A;  2ZNZ A;  1SD7 A;  4KN7 X;  3IWZ A;  3V8J A;  4MTD A;  2K7L A;  2CO5 A;  3E6B A;  3ZMS A;  2H6C A;  2BBY A;  3QPT A;  4Q4Z F;  3EQL F;  2LSO A;  1BN5 A;  4B8X A;  2W57 A;  5CLS A;  4HDU A;  1QQI A;  3FX3 A;  1XCB A;  1YLF A;  1ODD A;  1WI9 A;  1HW1 A;  2O0Y A;  1D8J A;  3RKW A;  3GZ6 A;  2QQA A;  4LG0 A;  2X0L A;  2HYF A;  3T8T A;  2F5F A;  2UXN A;  5BS6 A;  3QPH A;  3DXJ F;  5LHI A;  1R1U A;  1PDN C;  2IW5 A;  3SZP A;  2XAH A;  3QU6 A;  4HQM A;  4YFX F;  3JAM K;  5K5O A;  4ENJ A;  5FLX K;  1MJB A;  1W7P A;  2KIM A;  3L2C A;  5BOX A;  2DK5 A;  2L54 A;  4M73 A;  3BRO A;  1D3Y A;  2YPR A;  2P7V B;  3FF5 A;  3TKY A;  2HYG D;  4N0B A;  5HVQ C;  4L18 B;  2P6T A;  3F8C A;  1XB4 A;  3JTH A;  3JW4 A;  5E17 F;  2HWV A;  1Z6T A;  2F5D A;  5J6X A;  3FM5 A;  1IRF A;  2QQB A;  2JRT A;  1FYL A;  2FU4 A;  3L9F A;  4I7H A;  2HDC A;  3P9K A;  2PMH A;  4BXU A;  3F23 A;  1GVJ A;  2FA5 A;  1BM9 A;  3FXR A;  4MQV A;  3EET A;  1YS7 A;  2CGP A;  1STZ A;  3U1D A;  1OMI A;  4HZF A;  1RIO H;  1BIB A;  4U7D A;  1P92 A;  3MAJ A;  4I09 A;  2M5W A;  2ZME A;  3VOE A;  2MD5 A;  3F6V A;  5D5U B;  4YFN F;  5JHU A;  1HSJ A;  1FBU A;  1KU7 A;  1BI0 A;  1F1Z A;  3M8F A;  3NEU A;  1P4W A;  3V7C A;  2UXX A;  4RGS A;  2HQN A;  3I54 A;  2IJL A;  3KP4 A;  4I0A A;  1U6G A;  3MZH A;  3RIR A;  3WTV C;  1T98 A;  4PGG A;  4H0E A;  2M1B A;  1PP8 F;  3K9T A;  1RZ4 A;  4LLG F;  1KU2 A;  3LA7 A;  2P7C B;  4MGR A;  4P5O A;  3W6K B;  2FNA A;  2QLZ A;  1E17 A;  2NRA C;  5IT9 Z;  2HGC A;  3I59 B;  1YIO A;  1G3W A;  3Q9V A;  1IN5 A;  2ZXJ A;  4EGZ A;  2XAS A;  4BAY A;  1T39 A;  3GVA A;  5F6F A;  2HFH A;  1KGS A;  1F9N A;  3I64 A;  5K5R A;  2QM3 A;  1S7A A;  2FXA A;  3P9C A;  4AIJ A;  2HZT A;  2M8E A;  2V9V A;  1S6L A;  4WXH A;  3FM3 A;  3HSF A;  4HAM A;  4L9J A;  1G3T A;  2VE9 A;  1QZZ A;  4LFU A;  5DD8 A;  3G3Z A;  4I01 A;  4E70 A;  5DCM B;  2ESN A;  4A5M A;  4HX8 A;  3GYH X;  4HDV A;  4KT5 C;  5IT9 K;  2BEO A;  2P4W A;  1IF1 A;  3F21 A;  5ILS A;  1SD4 A;  4FHT A;  5H6R A;  3M7G A;  3QAH A;  3R6S A;  2YU3 A;  3CDH A;  2JPC A;  1KU9 A;  2MBF A;  5ILU A;  2Z33 A;  4MQ9 F;  3WGI A;  2VBW A;  1LEA A;  1W5T A;  2XAG A;  4S05 A;  4OIO F;  2JPB A;  4EJT A;  1ULY A;  4KN4 X;  1ZRD A;  1WKM A;  1QZY A;  1R36 A;  4P9U A;  4Q48 A;  2HS5 A;  3NQO A;  5A2Q Z;  3BJA A;  3HRS A;  4NHJ A;  3LQR A;  5D4S A;  3J7A O;  1U5T C;  1KU3 A;  4PCQ A;  3C3W A;  1MD0 A;  1DP7 P;  2GZW A;  3HRU A;  3O2P E;  3JSP A;  4R1H A;  1WRJ A;  3RKX A;  3FXQ A;  3K2Z A;  3RPQ A;  5DUI A;  1OYI A;  4A0Z A;  2EV5 A;  2PFB A;  3RJP A;  3HTS B;  4LK1 F;  1EH8 A;  3V8L A;  1RUO A;  2VT3 A;  3U2R A;  5CYV A;  4R79 A;  1U78 A;  4XRF A;  3BP8 A;  5E20 A;  3FZV A;  4IPA A;  4WK8 F;  1BC8 C;  1FWZ A;  2STT A;  3Q9S A;  3FXU A;  4MTE A;  1SD6 A;  3WTT C;  2NYX A;  3F8B A;  4CZZ A;  3VEP A;  2Q2E A;  3I59 A;  4BH9 A;  3TOA A;  4NQW A;  1D8K A;  2CFX A;  4DNC A;  2WWY A;  1ZLK A;  2A6E F;  4CIC A;  3HHH A;  5ICC A;  1CF7 A;  3LA2 A;  1ZN2 A;  3RPU A;  5FFZ A;  3HRT A;  2KJC A;  1IW7 F;  2LF8 A;  1JGS A;  2K86 A;  3R4K A;  4HF0 A;  2FQ3 A;  1ZG5 A;  1J75 A;  4HF1 A;  1Z7U A;  2QZ8 A;  1ZRE A;  4LG0 B;  1IN8 A;  2HKO A;  1PP7 U;  5CVJ A;  3I0T A;  4Y15 A;  1IN6 A;  1TQI A;  4KIB A;  1IZ1 A;  2VC0 A;  2IPQ X;  2D1H A;  3TQN A;  1OR7 A;  3K0L A;  5HDG A;  3F72 A;  5DCM A;  4AWX B;  1W7P B;  3MEX A;  3BY6 A;  4ESB A;  1MJ9 A;  4D0P A;  4LJZ F;  2ZO4 A;  4NB5 A;  3H3Z A;  4EM0 B;  2P5K A;  2ADU A;  2PQ8 A;  2K02 A;  5L3F A;  4L5J A;  5LEK A;  4IJA A;  4ESJ A;  1ON1 A;  3IKT A;  2OZ6 A;  5ICG A;  2M87 A;  4PZJ A;  3ZMV A;  2A69 F;  1IN7 A;  1XMA A;  4AIK A;  3KLN A;  2RC4 A;  3ZN1 A;  4P96 A;  5DDG A;  2FEZ A;  2E1N A;  1DPR A;  3KFW X;  5D6F A;  3ECO A;  5LEJ A;  1YYV A;  4G6D A;  1XGS A;  4Q47 A;  1ZGA A;  2EB7 A;  4RGU A;  4HX4 A;  4KA4 A;  2E7X A;  4RAY A;  1FLI A;  1SD5 A;  5FD6 A;  1O3T A;  5JVT A;  1T38 A;  4YII A;  4OIP F;  5KK1 A;  2A6H F;  2RN7 A;  3E6D A;  4IRH A;  3GF2 A;  3IKV A;  3IRR A;  1NHA A;  1LDK B;  1XMK A;  2STW A;  4ZYD A;  1IUY A;  4OIN F;  5ICF A;  3GFL A;  5CVU A;  1R00 A;  1MKM A;  2TDX A;  3NRV A;  3DPT A;  1BI2 A;  1VTN C;  3KP3 A;  1KQ9 A;  1B6A A;  1ZLJ A;  2PLY A;  1UHW A;  4ZYE A;  3P9I A;  2FBK A;  1LB2 A;  1R5H A;  2IA1 A;  3SXY A;  2YR2 A;  2DFI A;  2EFQ A;  3F3X A;  2V79 A;  3R61 A;  2NNN A;  3GZ5 A;  3MCZ A;  3E6C C;  4EGY A;  3RTR A;  3CUQ B;  1D5V A;  2XIG A;  2O03 A;  3FWE A;  2Z5U A;  1QPM A;  3MZY A;  1O7F A;  4L0Y B;  4EJW A;  2MH9 A;  2J5O A;  4XLN F;  4S04 A;  3J81 Z;  3OOP A;  1WQ2 A;  2XVC A;  3MWM A;  2EFP A;  1O3S A;  3WTU C;  2F2E A;  2P5L C;  5E8I A;  4LK0 F;  2H09 A;  2PJP A;  1Q1H A;  1KQ0 A;  2ZBK A;  2IP2 A;  2ELH A;  3COA C;  4EVI A;  2ISY A;  3HIF A;  4KUM A;  2VOD A;  5BPI A;  2DO7 A;  4FX0 A;  5E1Z B;  3TGN A;  3EYY A;  2CW0 F;  2QQ9 A;  2LNB A;  4LMY A;  1REP C;  2GXG A;  2ZFW A;  3I58 A;  2G7U A;  2XUB A;  3F8M A;  2R3S A;  4BQA A;  3ISP A;  1E2X A;  4ZH4 F;  1UCR A;  4TV7 A;  5DD4 A;  4RB3 C;  1HKQ A;  1I1S A;  3T0Y A;  1B9M A;  4GCV A;  1U3E M;  3RI4 A;  5JFR A;  2HR3 A;  2NAZ A;  2HOE A;  4I0B A;  4M6Y A;  2L3D A;  3TO7 A;  2DLL A;  4QWQ A;  4G9Y A;  2DW4 A;  1LVA A;  3C18 A;  1H9G A;  2HEO A;  1CGP A;  4OMY A;  1OPC A;  2FML A;  1XN7 A;  4HLY A;  3T5X A;  2VBX A;  4O3M A;  3MFK A;  4KDP A;  2ZNY A;  4L9V A;  5LGU A;  2UZK A;  1S8N A;  2K4J A;  2PG4 A;  2EJR A;  3DKW A;  3F22 A;  2DQR A;  2E7W A;  4MHG A;  1DDN A;  1TBX A;  2ZKZ A;  3C1D A;  3JSO A;  3VB2 A;  1Z1D A;  1H9T A;  3ULQ B;  3GO5 A;  2WV0 A;  4IXA A;  3HTU A;  3HOT A;  4CXF A;  2A61 A;  4L9T A;  4CHU A;  1BIA A;  3GX4 X;  1MGT A;  1V4R A;  5HLG A;  1GXP A;  4HV5 A;  5LLQ A;  2RQP A;  2HTJ A;  2LF7 A;  1OKR A;  2OZU A;  5HLI A;  1HW2 A;  1RUN A;  3L09 A;  2PEX A;  4AD9 A;  5KVR A;  2XKO A;  4OIQ F;  3FMS A;  3IL2 A;  2KIU A;  3SFZ A;  1YW7 A;  3KEQ A;  3K1M A;  3HUG A;  3V4G A;  3ELK A;  3IHU A;  2RDP A;  4UV9 A;  1CF7 B;  4YFK F;  4BNC A;  2JZY A;  3WTX C;  1Z9C A;  3CUQ A;  4XSX F;  2R7F A;  4XSZ F;  4EJO A;  3CO6 C;  2YX7 A;  5ILV A;  1YTY A;  3LAP A;  4M74 A;  2G9W A;  3WG9 A;  2V6C A;  4G6Q A;  3B73 A;  1JE8 A;  3ZN0 A;  2OA4 A;  2IRF G;  1USS A;  4UNO A;  2EFW A;  1W5S A;  4JK1 X;  1S7O A;  4ZYH A;  4AVP A;  1FSH A;  2PI0 A;  3J80 Z;  1FP2 A;  4KMU X;  4UXN A;  3N4M A;  2V1X A;  3HSE A;  4KYW A;  4QLC U;  3M8E A;  1HKS A;  1FY7 A;  4WCG A;  1ONV A;  2K4B A;  2C6Y A;  5ICE A;  3F6O A;  3LWF A;  3E5X A;  5FO5 A;  1I5Z A;  4M72 A;  2XAF A;  4LLN A;  5J8F A;  2AXL A;  3KP7 A;  2IA0 A;  4HQE A;  3LA3 A;  3ROU A;  1QNT A;  4RB1 A;  4B09 A;  2CG4 A;  1XDS A;  3I5U A;  3K1N A;  3ABT A;  3HSR A;  3L00 A;  5L3B A;  1B9N A;  1KYZ A;  5HDN A;  1TNT A;  3CUO A;  4OMZ A;  3M1E A;  4A0Y A;  1SMY F;  5LHG A;  5D5V B;  4ENN A;  5JI6 A;  2XV4 S;  2KKO A;  3EYI A;  1FBQ A;  3WTY C;  3KCC A;  2L4A A;  1IAW A;  1UHM A;  5A2Q K;  3V8K A;  1J7K A;  5K1Y A;  4XBF A;  5LGN A;  1BOA A;  4UUV A;  1L0O C;  2XAJ A;  5E18 F;  1LJ9 A;  5AIP A;  3ZMU A;  4EMS A;  1KQ8 A;  1EV7 A;  5JR3 A;  2QYO A;  4A5N A;  1I27 A;  1LDD A;  4Y17 A;  4ETS A;  4RB2 C;  2ISZ A;  4O5V A;  3R60 A;  5FD5 A;  3QP5 A;  5DUK A;  2EV6 A;  1LNW A;  1IXS B;  3PQK A;  1RNL A;  1ZGJ A;  3T8R A;  2ACJ A;  3CJN A;  4M9X A;  1LEB A;  1KYW A;  1U5T B;  3HYI A;  2L4M A;  1QO0 D;  1XGN A;  2XHK A;  6PAX A;  1YQA A;  1ZG1 A;  3EDP A;  2LKP A;  2XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...