1X3UA

Solution structure of the c-terminal transcriptional activator domain of fixj from sinorhizobium melilot
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
GSHMDDANDIRARLQTLSERERQVLSAVVAGLPNKSIAYDLDISPRTVEVHRANVMAKMKAKSLPHLVRMALAGGFGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the C-terminal transcriptional activator domain of FixJ from Sinorhizobium meliloti and its recognition of the fixK promoter
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
molecule keywords Transcriptional regulatory protein fixJ
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1x3uA01
4UUVA 3I59B 2EFNA 5HDKA 3T0YA 4O6JA 4KICA 4ASNA 1TTYA 3F72A 4OU0A 2HQRA 3RIRA 2FEZA 5TJJA 4L5JA 2W24A 5IT3A 3FF5A 1GXQA 4L9TA 3T8RA 3K0LA 2JSCA 4F7ZA 3V7SA 3GFMA 4BHBA 3ABTA 2PG4A 1TW3A 3Q9VA 3REOA 1Z6TA 2G7HA 4TV7A 3PQKA 3FM5A 1ULYA 4M9ZA 4HX4A 4IRGA 2ZCWA 3FM3A 1SMYF 1OYWA 4M71A 2EV5A 3H3UA 5F6FA 1U2WA 2A6EF 2UWMA 1UHWA 1LDJA 3LA7A 3ZMSA 3E5QA 2A69F 1K78B 2CFXA 2H27A 5EEHA 1IN8A 1R23A 1TQMA 4N0BA 3EUHA 1W7PA 4NQWA 5HLGA 5LHIA 3DXJF 2L01A 4HF1A 1XDSA 2STWA 2NRAC 3OOPA 2IP2A 2J5PA 3AAFA 2VBZA 4DNCA 1OR7A 2FOKA 3FXRA 3V8LA 1E17A 1MKMA 2D2WA 5E1WA 1KA8A 2BE5F 3VEPA 3V4GA 4PZJA 1MGTA 4ZZLA 1G3SA 1G3WA 3DFGA 4A6DA 2A07F 2ESNA 4LLGF 2NS0A 1R00A 4YIFA 3LAJA 2J5OA 2FSWA 5TRDA 2IPQX 3BJAA 2ZNZA 1YW8A 3GO5A 2ZFWA 3WTZA 2B0LA 4WF2A 2KIFA 1XCVA 4HBLA 1L3LA 1J75A 4UNOA 3W6KB 1JHHA 5HS7A 2PMUA 4HX7A 1DDNA 1BC7C 3GZ6A 1FZPB 3SHFA 2OQGA 2L54A 2BEOA 4P9UA 2GXGA 2OU2A 5L3BA 4ESFA 2DO7A 2OAZA 5JFRA 5E17F 3F23A 3IHUA 3C1DA 3J81Z 4Z2YA 1ZGJA 1P92A 5K5QA 3M8FA 1D8KA 4I01A 2GQQA 1Z1DA 3RYRA 1XSXA 3JAMZ 3LA3A 1B9NA 3V7RA 5CJ9A 1ODDA 2QQBA 1LEBA 2RDPA 3FZVA 4EJTA 2K4BA 4OINF 2G9WA 1TQIA 3V7CA 4XRFA 1SFEA 4Q4ZF 1ZLJA 1IXSB 1HXDA 3F8MA 4HF0A 4P96A 2ETHA 3K1NA 2KJCA 1YLFA 2QBYA 1Q1HA 2DBBA 2NNYA 1MDMA 2M45A 1HQCA 4UV8A 3P9KA 3T5XA 1PP7U 2XROA 3TO9A 2VXZA 5IT9K 3EYIA 1WRJA 5LHHA 5D8KB 3F6OA 4YFNF 4LK1F 3R4KA 5CLSA 1OYYA 2F5EA 1XD7A 4HLXA 3WODF 4QWQA 1K6OA 3EDPA 5AONA 3ZP5A 5LGTA 2XKOA 4UVCA 3F3XA 2OQRA 2XASA 3SZTA 4CYDA 4EVIA 3I53A 4EJUA 4U88A 1CF7A 3QPTA 4B8XA 3WTSC 4U0YA 2CGPA 4GO1A 1T38A 1BI2A 5DCMA 1SD4A 4KMFA 1B4AA 3MEXA 3SXYA 4A0ZA 1YIOA 1Z91A 4FHTA 1H0MA 4KMUX 1IUYA 2V1XA 4MNUA 1XB4A 3WE3A 2XUBA 2QVOA 1W5TA 4H0EA 2UZKA 1LDDA 4PGHA 1RUOA 2RN7A 3HTUA 3TKYA 1X3UA 3O6BB 3I54A 3GW2A 1UCRA 1ZRFA 2BGCA 3ZMZA 2VC0A 2QLZA 1S6LA 2QZ8A 2ADUA 5E20A 1ZLKA 1W7PB 5DD8A 2F2EA 4RGSA 2VE8A 2UXNA 1IW7F 4BXUA 1TNTA 2P4WA 4CDGA 1HSJA 5FD6A 2P6TA 1G3YA 2H6BA 4G8XA 4EV0A 4CXFA 4BAYA 1PDNC 2Z99A 2HTJA 1UHMA 4KN4X 4L5IA 5ICGA 3IL2A 2XGXA 1U78A 3KLNA 1EH6A 1R7JA 3M1EA 3JW4A 2MD5A 4YFXF 4WXDA 4ETSA 5L3EA 3DEUA 2L02A 2CYYA 4I09A 4AD9A 2O6GE 2VN2A 2ZJ2A 5EEGA 1KYZA 3LAPA 1FY7A 2RVCA 4G6DA 2EV0A 5DUKA 5HLHA 3KFWX 4FX4A 2MA3A 2EFQA 1KU3A 4MEXF 3WGIA 3WTTC 1BC8C 1K7AA 1D3YA 4B09A 3JAMK 2HFHA 1Z05A 1CF7B 1P6RA 4AIJA 1LEAA 3HSFA 4P9FA 4LB6B 5E8GA 1KU2A 2Q8KA 2XAGA 1HKQA 1FYKA 1QPMA 3WTYC 1W4MA 1KYWA 1S8NA 3LQRA 3MAJA 3LQQA 5AIPA 2ISYA 1HSTA 3H3ZA 4M9XA 1XSDA 5HOOA 1FBUA 3HRUA 2RKHA 1UB9A 5K5OA 4HV5A 1FBQA 2EB7A 1P2FA 4MQVA 4Q5SF 2YPRA 3NRVA 2IA1A 3T1BA 3SQNA 1ZARA 3S2WA 4CZZA 2FA5A 5LRSA 1XGSA 2CQKA 3E3VA 3T8TA 1IN4A 5JR3A 3ZN1A 1DUXC 4G7ZF 1VTNC 3WG9A 3I58A 4A0XA 4UVBA 1MDMB 1S3JA 4G7HF 5KK1A 4ZYGA 1QQIA 5E1ZB 3FWEA 3JTGA 1O3RA 3HOTA 2K86A 4M6YA 2P7VB 1JHFA 4KT5C 5ICFA 3J7AO 2FE3A 1WI9A 4EM2A 3BP8A 1GHCA 1MJAA 1Z9CA 4OIRF 5DCMB 5D5UB 1V4RA 2JZYA 3KP6A 2A6HF 2GZWA 2H94A 2PFBA 3OV8A 4A12A 1AOYA 3BY6A 2F5DA 2KIUA 4ENMA 3ISPA 1YS6A 2VBYA 3ULQB 3WU1B 2O0YA 4E70A 1ZG3A 3K9TA 3F21A 3U9GA 3O3KA 4A5NA 4LB5A 2Q2EA 2MLGA 6PAXA 1DPUA 1EH7A 2FXAA 2W25A 3IKVA 3BROA 3H92A 3K69A 3HSRA 1RIOH 3QAHA 3BPVA 4EJWA 1IRGA 2O03A 3L09A 2IW5A 1PUEE 2WWYA 5H6RA 2LKPA 3ECHA 3RKYA 1TW2A 2R7FA 3SFZA 1FT9A 2P5LC 1GXPA 3KEOA 1C0WA 1YO5C 4GYGA 1TNSA 1WWXA 2AXLA 3I0TA 5CVVA 4AWXB 1MJ9A 2YSRA 2PBIA 2R3SA 3FXQA 5LRRA 3N97A 4UXNA 3DPTA 3I71A 2W85A 3ML6A 5J8FA 3U2RA 3IRQA 4PCQA 2D45A 1RUNA 2KJBA 1YYVA 4KDPA 4XBFA 1QNTA 3FMQA 1USTA 3P9CA 3N4MA 4IPAA 4HDUA 1P4WA 4HW0A 1I27A 1KU9A 4MTEA 5LHGA 3KP2A 3NEUA 2BV6A 3KP7A 2IVMA 3WU0A 3L9FA 2V1UA 4Q48A 4RAZA 2ZXJA 3SZPA 2GWRA 1FP1D 1KGSA 1F1ZA 3NQOA 2E1NA 4OIQF 2XV4S 3F8FA 3M9AA 4KYWA 3L7WA 2M5WA 3ECOA 4ZYEA 1T98A 1K78A 2QWWA 3HUGA 4ON0A 2YX4A 5ILUA 1BIAA 1T2KA 2IA0A 5A2QZ 2HOEA 3HTSB 1U6GA 2XHKA 1DPRA 1TBXA 2DW4A 2X0LA 4I7HA 1U5TC 2LNBA 5BPIA 4GYIA 1XMAA 5LEJA 1IZ1A 2ZMEB 1UFMA 4LGWA 4RB3C 1Z7UA 2YR2A 3R0AA 2DPDA 1RZ4A 2HYGD 3GF2A 3EYYA 5E18F 1ZGAA 3QP5A 3VFZA 2GA2A 4HA8A 3CTAA 3TDZC 4EQQA 4S05A 5LEKA 2HTSA 2NNNA 4I02A 1K79A 2FBIA 3BPXA 2M1BA 3CDHA 4HLYA 2L4MA 1P4AA 1E2XA 3KCCA 2VOPA 3ELKA 4MTDA 3RI4A 1FOKA 2XKPA 1S7AA 4A2UA 3I4PA 4YIIA 1BI3A 1IN7A 1EH8A 1A04A 2OD5A 2P6SA 1FX7A 3C3WA 2LDUA 3VODA 4M72A 3TO7A 4G7OF 1NHAA 4HYEA 1ZAOA 1XGNA 2A3SA 4CICA 3RYPA 4MQ9F 2F5CA 4L0ZB 2XAJA 1G3TA 4P5OA 2AS5F 1ZRCA 2QENA 2V6CA 2GIVA 4LD5A 1BM9A 4WXHA 1OPCA 1G4DA 3J80Z 2P8TA 1IXCA 1XMKA 2VBWA 3TO6A 1FYMA 1I6XA 3WGGA 4I0BA 4GXOA 2WV0A 2HKXA 1XCBA 4R8HA 1FSHA 1XGMA 2DT5A 2XIGA 2FNAA 1PP8F 4L18B 2EA2A 3DQVC 5D4RA 5ERIA 3RJPA 2FF4A 2CSOA 2HZTA 5J6XA 4CHUA 1XN7A 1FWZA 1HKTA 3F8CA 1YFHA 4D0PA 3WE2A 3ERED 1FPQA 2JPCA 3FMSA 2V79A 3BZ6A 1HW1A 1J5YA 4EMSA 4RGRA 2FBKA 5CVUA 4U0VA 3E5UA 3GVAA 4XLPF 2HEOA 4G94A 2DU9A 2O61A 3O2PE 4EGZA 4M73A 1FNNA 3IKTA 3MZYA 2R7DA 2EFPA 2Y48A 3R61A 1J0RA 4LG0A 3TGNA 2RGVA 3QU6A 2DPUA 4ENJA 2ACJA 2STTA 1ZYRF 3R60A 5LGNA 4O5VA 2EK5A 2IA2A 1LVAA 4FT8A 1J9IA 3HHHA 5FO5A 2HQNA 3FHZA 4GCVA 1USSA 1YW9A 3CUOA 3I59A 1J2XA 1O7FA 2A68F 1T6SA 1QGPA 1LNWA 4RS8A 3CLOA 5D5VB 3KE2A 4ESJA 4ZYHA 3F22A 3IRRA 3E6CC 3CUQC 2JRTA 5HS8A 2M30A 1GVJA 3WTWC 3K1MA 2A5YB 3WTVC 3C7JA 4A6EA 4AIKA 2ZMEA 2DFIA 4I98B 4ENKA 4BQAA 5FLXK 4JQFA 2QBYB 3P7NA 4XSXF 4QLCU 1V3FA 4KNYA 4OIPF 3D0SA 3TDUC 2YX7A 1T39A 2M8EA 3HIFA 3ZMUA 1JE8A 3GFIA 4Y17A 4JBAA 4BH9A 2L3DA 4L9NA 3IWFA 3D5LA 5A2QK 2W57A 5BMZA 2E7WA 3COAC 5IT9Z 3DKWA 4M74A 2QUFA 4S04A 4XLNF 4WXCA 5D8LB 4LFUA 1STZA 4HF2A 3CUQA 2NAZA 4LK0F 2VONA 4RAYA 2LF8A 4L9VA 2MH9A 3LWFA 3ROUA 2XRNA 3BOQA 1B9MA 1O3SA 5L3FA 2DK5A 3K2ZA 5FD5A 2M87A 2QQ9A 4IF4A 1AWCA 4EJOA 2EV6A 2LF7A 1REPC 1YW7A 2GA1A 2IRFG 2RV8A 4A0YA 1R36A 2ZBKA 1YG2A 2WC2A 4EM0B 2P5KA 4KIGA 2OBPA 5ILSA 4KIFA 1WKMA 2V1DA 2WTEA 1Y0UA 2VODA 2V9VA 3G73A 5H6QA 1QBJA 2JPBA 3ZMVA 5K5RA 1O3QA 5L3GA 4KUMA 2C6YA 4MHGA 3VB2A 3QRFF 2KIMA 1I5ZA 3GEZA 2MC3A 2G7UA 3BDDA 2FMLA 2XAQA 3ZPLA 2HWVA 2JTVA 5DV5A 2XAFA 2L4AA 1P4XA 1SD7A 3DPLC 4LMYA 4Q47A 1B59A 4BHCA 2VOOA 3P9IA 5DYMA 4LG0B 2PLYA 2DAOA 4CO8A 3GLXA 4OIOF 4WK8F 1LQ1A 1HW5A 3V8KA 3LA2A 4OOIA 2Y0MA 2MBFA 1ZRDA 1XDUA 4DQ2A 1R1TA 3GFLA 3E5XA 1F4KA 5HVQC 1ON2A 4YFKF 3CJNA 2LSOA 3JTHA 3WGHA 4BHPA 1IRFA 4AVPA 3HRTA 4WX9A 4HQEA 3GWZA 5D6EA 3Q5FA 5HS9A 2FRHA 4U7BA 5KVRA 1D8JA 1G6NA 4UV9A 4EGYA 4HDVA 2XAHA 1IAWA 2TDXA 4U0WA 5DCFA 3WTUC 4IJAA 2FQ3A 4O3MA 3QU3A 3QOPA 1FSEA 1R58A 2ISZA 1BOAA 2Z5UA 4HV6A 1LDKB 1HBXG 3HYIA 1KQ8A 1BBYA 4WCGA 2ZKZA 5D5WB 3TOBA 2DK8A 4ZYDA 1TLHB 2O3FA 3E6MA 4AIHA 3PQJA 1XSVA 2IT0A 2XVCA 3TOAA 1QZZA 1R1VA 1HW2A 2MH2A 3QP6A 4LJZF 3HSEA 1WQ2A 2VC1A 2HKOA 3KP3A 2QYOA 3E6DA 5E1XA 4RGXA 3ABUA 4G9YA 4NHJA 1RNLA 3F6VA 3DP7A 4L0YB 2Z3YA 5LGUA 1ZN2A 1S29A 4R1HA 3BJOA 3EETA 1YQAA 3BWGA 2Z9OA 2FNPA 2DQRA 2QQAA 3CUQB 3RKWA 1BI1A 3V8JA 3RPUA 1FYLA 1IXRC 4IHSA 3HRSA 1F9NA 1WSUA 1J7KA 3F8NA 2HS5A 2K4JA 4ENNA 4IRIA 2O8XA 1H9GA 1QO0D 2NYXA 2CG4A 2H09A 3M8EA 1O3TA 2ZNYA 2CO5A 5DUIA 2ELHA 3DF8A 4HAMA 5F64A 3GYHX 2PJPA 5JI6A 5D5XB 1W5SA 4UHTA 5CVIA 3ZMTA 3I5UA 4I2OA 1T0FA 2D1VA 2FBHA 1R1UA 4UVAA 2K27A 5ILVA 4RB1A 2HR3A 3VOEA 1O7LA 1F5TA 1U3EM 5DEQA 3KLOA 3ZMDA 2VBXA 1U8RA 1MZBA 1ON1A 2HYFA 1D5VA 5CVJA 3WTXC 2PEXA 3L00A 2EWNA 2VT2A 2HGCA 4CGZA 5L3CA 4R79A 2H6CA 1OYIA 3C18A 2HDCA 2ESHA 2PI0A 3GZ5A 2GAUA 1SMTA 1JXSA 5FB2A 5JVTA 3E97A 2UXXA 3MFKA 3MWMA 3IC7A 5FGMA 1LB2A 4U7DA 4FX0A 2BBYA 4K2EA 1KQ0A 2K7LA 2KKOA 5K1YA 2CWEA 2GXBA 5JHUA 1MJBA 2RQPA 1S7OA 3CO6C 5J8CA 5ICEA 3MQ0A 3RTRA 3PFIA 3HOSA 1OKRA 3I64A 3LFKA 1OMIA 2K02A 1RI7A 1SD6A 3K1PA 2RNJA 2D1HA 1TQPA 1SD5A 2OZ6A 1H9TA 3FMRA 2Y75A 2DQLA 1ZH5A 3KP5A 2OA4A 3B73A 2VE9A 1L0OC 4A5MA 5LBQA 1FLIA 4KA4A 5ICCA 4KN7X 5DDGA 3F8BA 3KEQA 4EM1A 2MLKA 4YG2F 5D4SA 2Z33A 1SFXA 4ZH4F 1QZYA 4P55A 5DD4A 3KETA 4NB5A 2A61A 1YTYA 3ZQ7A 3KP4A 4HQMA 3TQNA 3MCZA 1R5GA 1KU7A 5F1RA 3HRMA 4IXAA 3GUDA 1HKSA 4G6QA 2JT1A 2EFWA 2DI3A 2OZUA 2BYVE 2X4HA 4HOBA 1ZHFA 1KQ9A 2ZO4A 3J81K 1W7PD 1FC3A 4IVNA 2PMHA 3R0JA 4LLLA 1DP7P 3MZHA 2F5FA 3JSPA 1I1GA 4M6XA 1J59A 3CO7C 3DV8A 2IJLA 1U5TB 4Y15A 5BPDA 1ZG5A 4ESBA 5D6FA 4RGUA 5L3DA 1BN5A 2PQ8A 2EJRA 1BJAA 3E6BA 3GXOA 1O57A 2FU4A 5H20A 2W84A 2QM3A 2COMA 3QPHA 3LSTA 4RB0A 1XGOA 4ZZDA 4LLNA 5BS6A 1IN6A 4OMYA 1FP2A 4IRHA 5CYVA 3R6SA 1ONVA 4RB2C 3BJ6A 1CGPA 1U5TA 1I1SA 3ZN0A 1Z6RA 4N9IA 4BNCA 3RDIA 4IHTA 3J80K 4EJVA 3EQLF 3L2CA 4PGGA 2VT3A 2P5VA 2RC4A 4MEYF 3RKXA 2P7CB 5ED4A 1BIBA 5HDGA 5FFXA 1R22A 5HDNA 2E7XA 4KFCA 3RPQA 3M7GA 4MGRA 3G3ZA 4Y13A 3Q9SA 5E8IA 4HZFA 5FLXZ 1BI0A 1SFUA 3IWZA 2FMYA 5BOXA 1MD0A 1IN5A 2DTRA 3B02A 2EA4A 4PDKA 4HX8A 2KRFA 2YU3A 3KZZA 1JGSA 4I0AA 4M9SA 3KZYA 2CW0F 4WWCA 3GX4X 3GFJA 1YS7A 1IF1A 5FFZA 1ZG1A 1SAXA 4GGGA 3U1DA 4N9HA 1B1BA 4BYYA 4KIBA 2EFOA 3HHGA 2DLLA 1FBSA 1LJ9A 1EV7A 1B6AA 2Q0OA 3W6JB 5LLQA 1R5HA 5BQTA 2E1CA 4L9JA 4OMZA 4JK1X 1ZREA 4XSZF 5HLIA 3JSOA 2PN6A 5AIQA 3FX3A 5CVRA 3FXUA
chains in the Genus database with same CATH superfamily
3RCOA 4UUVA 3I59B 2EFNA 5HDKA 2PMZA 2XC7A 2QSFX 4KISA 3T0YA 2QSGX 4O6JA 3FXKA 2DTZA 3CCVI 4I76A 4KICA 4ASNA 1TTYA 3F72A 4OU0A 2HQRA 1Z77A 4XQFA 1LVKA 3OMYA 3RIRA 4XIDA 2FEZA 5TJJA 4L5JA 2L9NA 2W24A 5IT3A 3FF5A 1QHGA 1GXQA 4L9TA 3BR6A 3T8RA 2V4JC 3K0LA 2JSCA 3X2QH 4XLCA 4F7ZA 3S1MJ 1OFCX 3V7SA 3GFMA 4II3A 4BHBA 3ABTA 2PG4A 5B1BH 4DYCA 1TW3A 3Q9VA 3REOA 1Z6TA 2G7HA 4TV7A 3PQKA 3FM5A 3ZQFA 2IXSA 4Y7NJ 1B72A 1ULYA 4M9ZA 4BEHA 1Z21A 4HX4A 4PUSA 2MABA 4IRGA 4AYBN 2ZCWA 1MBJA 3FM3A 4XN0A 4DW6A 5J1YA 4XONA 5K7FA 1BOBA 3C2BA 3C2HA 1SMYF 1OYWA 4M71A 4UUTA 1QVTA 5DM7F 3DTKA 3H36A 2EV5A 1BL0A 3H3UA 5F6FA 3BLYA 1U2WA 2A6EF 2UWMA 1UHWA 1LDJA 5CKTA 3LA7A 2Q1ZB 2L7MP 3ZMSA 3E5QA 2A69F 1K78B 2CFXA 2H27A 2R93J 5EEHA 3DU5A 1IN8A 1R23A 2DMNA 3A0HC 1TQMA 1FMWA 4N0BA 4BY7J 3EUHA 1CQTA 1W7PA 4NQWA 1SFOJ 2TRTA 5HLGA 2ELJA 2CJJA 3DXJF 5LHIA 2L01A 4M3GA 3HGGA 4HF1A 1XDSA 2QKLB 3FDYA 3KYDB 2STWA 5KCMA 5EZGA 2NRAC 3OOPA 2IP2A 2J5PA 3H5AA 2A05A 2BHZA 1X4OA 5F0HA 2VBZA 2ICWG 1OJLA 1OR7A 4DNCA 3AAFA 2FOKA 2NXNB 3FXRA 3V8LA 1E17A 1MKMA 3Q3SA 4XR6A 3S14J 1QHHD 1RETA 2D2WA 5IOYA 3FXJA 3DTIA 5E1WA 1KA8A 2BE5F 4G12A 2HNHA 1YX5A 5EZHA 3VEPA 3V4GA 4PZJA 1MGTA 4ZZLA 1G3SA 3IUOA 2B9SA 1G3WA 2EIMH 3DFGA 2NVQJ 4A6DA 1WVRA 1Y6IA 1OCOH 2A07F 3S17J 4HSTA 1WJFA 2ESNA 4MIMA 4LLGF 2E1MC 2K85A 2VJ4A 3S16J 4A3MJ 2NS0A 1FJLA 1R00A 2XB5A 3SZGA 4YIFA 3LAJA 2J5OA 2FSWA 5TRDA 1UG2A 2EILH 2CU7A 4FETA 4XL9A 2IPQX 3BJAA 1AHDP 2ZNZA 4C3IJ 1YW8A 3GO5A 2ZFWA 3WTZA 1VF9A 2E2IJ 2B0LA 4WF2A 2KIFA 3AL0C 1W1WE 4BS9A 3S32A 3RPUD 1XCVA 4HBLA 4XRSG 4AUXA 1L3LA 1J75A 4UNOA 4A3CJ 1MIJA 2E71A 4DZPA 2LMDA 1JHHA 1U9OA 3DEEA 3W6KB 4ZJZA 2DOEA 2R7TA 2NVXJ 3S15J 5HS7A 2PMUA 4HX7A 1HDPA 3RQIA 1JUSA 3KZIC 1DDNA 1BC7C 2DDAA 3GZ6A 1UJ8A 1IV6A 4RLFA 1VQPI 1FZPB 3SHFA 2OQGA 2CQNA 2L54A 3K70D 1X19A 2BEOA 3OSGA 4P9UA 1WH7A 2GXGA 3ABKH 3PNYA 2OU2A 5L3BA 3DU6A 4ESFA 1R4NB 1GV5A 2K5CA 3HXLA 2L9SA 2DO7A 4ZDPA 5GAGJ 2OAZA 5JFRA 5DM6F 3UR3C 4X1EA 3PO3J 2OTLI 5E17F 2TCTA 1QA6A 3F23A 5C44J 4E7JA 3IHUA 4BKXA 3CCLI 3C1DA 3J81Z 4Z2YA 1ZGJA 1HCRA 4PFPA 1P92A 5K5QA 1DP3A 3OYNA 4RM2A 3M8FA 3VYRB 5J47A 2R7SA 2WB1N 1D8KA 4I01A 2NS8A 2GQQA 1Z1DA 4BJ5C 1Z0XA 1XC5A 4QTRA 3RYRA 1XSXA 3JAMZ 3LA3A 1B9NA 5F27A 3GTPJ 2I5UA 3V7RA 5CJ9A 1ODDA 5FKLA 2QQBA 1LEBA 2RDPA 1U0JA 2W82A 3FZVA 2K4BA 4OINF 4EJTA 2G9WA 2WBMA 1UAAA 2L7ZA 1TQIA 2M7BA 3V7CA 4XRFA 3DLAA 1SFEA 2X51A 4Q4ZF 3ESWB 1ZLJA 2ID3A 1IXSB 1T33A 1HXDA 2R5ZA 3HJEA 3F8MA 1DU6A 4HF0A 4P96A 2ETHA 3VPRA 1R9TJ 3K1NA 2R0QC 2H1LA 2KJCA 1YLFA 4PK4A 2H1KA 2QBYA 1Q1HA 2LY1A 3CDIA 4IL6C 2ZXHA 2DBBA 1MNMC 3FK7A 3QQAA 5J1RA 2NNYA 1MDMA 2LYCA 5LD2C 2M45A 2K9MA 2JA5J 1HQCA 3V42A 5JLWA 3UKGA 1H89C 3J7AY 4UV8A 3P9KA 3T5XA 1PP7U 1XPXA 2IS1A 2XROA 3TO9A 1BR4A 2BW3B 2VXZA 1YE9A 5IT9K 3EYIA 1YOVB 3ABMH 1WRJA 4YELA 5LHHA 5D8KB 3JR9A 3F6OA 4YFNF 4J19A 2FOWA 4LK1F 3R4KA 5CLSA 1OYYA 2F5EA 1D1AA 4IZZA 1W36C 2PMZN 4S0HB 1XD7A 4XKVA 4NUBA 4HLXA 3WODF 4QWQA 2LY9A 1K6OA 3TP0A 1RRJA 4BXFA 3EDPA 2KMUA 4XM3A 5K7HA 2FX0A 5AONA 2H8WA 3K4CA 4W1UA 2JN6A 3ZP5A 5LGTA 2XKOA 4UVCA 4DIQA 3F3XA 2OQRA 5C3EJ 2XASA 3SZTA 4BE1A 1Z7LA 4CYDA 4EVIA 1ENHA 2EH3A 3I53A 2DYSH 2F48A 4EJUA 4U88A 1CF7A 3QPTA 2LG4A 5EGOA 4B8XA 3WTSC 1I39A 4U0YA 3RZOJ 2CGPA 4GO1A 4PSXA 1T38A 4BBSJ 1BI2A 5DCMA 3M1CA 1SD4A 4KMFA 1B4AA 3MEXA 3SXYA 3LSIA 4A0ZA 1R4MB 1YIOA 5F04A 1Z91A 4FHTA 5M3FJ 2HI3A 1H0MA 4KMUX 1IUYA 2V1XA 4MNUA 1XB4A 3WE3A 2XUBA 2QVOA 1W5TA 4V2GA 4H0EA 3WG7H 2UZKA 1LDDA 4PGHA 3IP4B 1RUOA 5CQEA 2RN7A 3HTUA 4PFOA 3L2RA 3SEQA 3TKYA 1X3UA 2LOOA 2V7FA 3O6BB 3I54A 3GW2A 4A3DJ 1UCRA 1ZRFA 3BR1A 2BGCA 3ZMZA 3JRDA 2VC0A 2QLZA 1S6LA 2MFZA 2IS4A 3HC7A 2QZ8A 3W6VA 2WAEA 2ADUA 2COBA 2X9DA 3OOUA 3PNVA 5E20A 1VQ9I 1ZLKA 1W7PB 5DD8A 2F2EA 5TISC 4RGSA 2VE8A 3GTKJ 2UXNA 4UY8I 1IW7F 3K4NA 4BXUA 4KITB 2XAUA 1W0TA 2IEKA 1TNTA 2P4WA 2X6XA 4CDGA 3KYCB 1HSJA 5FD6A 2P6TA 1G3YA 4UUSA 2VB6A 3JRFA 2H6BA 3GTOJ 2BXYA 2F5VA 3I3LA 4G8XA 1AU7A 5HODA 4EV0A 4CXFA 4A93J 1SVMA 1B8IA 4BAYA 1PDNC 1MBHA 2DOAA 2Z99A 1S5LC 2HTJA 1UHMA 4KN4X 4L5IA 5ICGA 3IL2A 2XGXA 2Y2ZA 3HG9A 1U78A 3KLNA 1EH6A 2CRGA 1R7JA 3M1EA 3CCUI 3JW4A 2MD5A 4NNJA 3ZQHA 4YFXF 4II2A 2JWTA 1AKHB 4XNFA 4WXDA 4ETSA 5L3EA 3D5SC 1JKOC 2HXIA 3AG1H 3CZ6A 1Y8RB 2L02A 3DEUA 5FROA 2CYYA 2LREA 3LOCA 4I09A 4AD9A 2O6GE 4F93B 4E7KA 2VN2A 2ZJ2A 5EEGA 1KYZA 3LAPA 2O5RA 3CMYA 1Z3XA 1FY7A 2RVCA 5E3MA 1X58A 2EV0A 4G6DA 5DUKA 2WAQA 2O8KA 4A69C 1FOYA 5HLHA 3KFWX 4AIDA 1A35A 3DPUA 4FX4A 5GTIC 2MA3A 2EFQA 2EIKH 3TMOA 1KU3A 4IO9F 3WGIA 4MEXF 3GTQJ 3WTTC 1BC8C 1K7AA 2CUJA 5EF6A 1I3AA 2E60A 1D3YA 1K6YA 4IX7A 5KAIC 4B09A 3JAMK 2HFHA 1OCTC 1ZR2A 3OS0A 1Z05A 3HGYA 1CF7B 3QYEA 4H4KC 1P6RA 1IJWC 4AIJA 1D1BA 1LEAA 3HSFA 4P9FA 4LB6B 5E8GA 1KU2A 3A2KA 2KZVA 3I55I 2LBFA 2CQQA 1XX5A 2Q8KA 2XAGA 5FKKA 2VJJA 1HKQA 1FYKA 1QPMA 1AKHA 3WTYC 1W4MA 3BG9A 1RC9A 1KYWA 2JQ7A 1P9QC 1S8NA 1PUFA 3LQRA 3MAJA 3LQQA 4AU7A 4CA0A 5AIPA 1SFKA 3W3CA 4F91B 2IBDA 5J3LA 2ISYA 1HSTA 2ZJQF 2M3AA 3CCSI 3H3ZA 4PJJA 1JI8A 3BZKA 4M9XA 4JOMA 2HOAA 1OQYA 1XSDA 1N25A 2M2EA 5HOOA 1FBUA 3HRUA 3GBGA 2Z16A 1EF4A 2RKHA 3DTEA 1UB9A 1QRYA 1TWFJ 4HV5A 5K5OA 3K4JA 1MMSA 2ZC2A 2HQ5A 1FBQA 5E3OA 3CF5F 1YRNB 2Y9YA 3MKLA 2EB7A 1P2FA 4MQVA 4Q5SF 3LFUA 2YPRA 3NRVA 2IA1A 3T1BA 3SQNA 1ZARA 3S2WA 4CZZA 2JMWA 2FA5A 5LRSA 1XGSA 3VYTB 5FLMJ 1YJ9I 2CQKA 3E3VA 3T8TA 1IN4A 4A3KJ 3J7YJ 5JR3A 3OYKA 3ZN1A 4BL0B 1DUXC 2HZDA 4G7ZF 3K4KA 2ZXIA 2LKXA 1VTNC 3WG9A 4F55A 3I58A 3OIOA 1V54H 2OJED 4A0XA 4UVBA 1MDMB 3H0GJ 1S3JA 4G7HF 2XF5A 5KK1A 1E3HA 1QQIA 5E1ZB 4ZYGA 2VI6A 2DT7B 3FWEA 4UB6C 3JTGA 4EATA 3S93A 1O3RA 2KFDA 2L7KA 5B66C 3Q0UA 4E6KG 3QYFA 3HOTA 2K86A 4M6YA 1YIJI 4B43A 2P7VB 4Y3OA 3G6EI 4ZDLA 1HOMA 1JHFA 1XS9A 2CW7A 4PJLA 4KT5C 5ICFA 2VXDA 3LNQA 1OCPA 4YRVA 3J7AO 3LSKA 2X6YA 2FE3A 3O8GA 1WI9A 2K9QA 4EM2A 3BP8A 1ZELA 4BJ6C 1MJAA 4BE2A 1Z9CA 1GHCA 1D5YA 3K4MA 4OIRF 3GCMA 3A01B 2N8GA 2K3PA 1ETYA 5DCMB 4AYBA 5D5UB 3EUKL 1V4RA 2JZYA 3KP6A 2A6HF 2GZWA 5IYCJ 2H94A 4M3EA 2PFBA 3OV8A 4A12A 1AOYA 1SANA 1MH3A 2E34A 3BY6A 2F5DA 2KIUA 5FRNA 3PL8A 4Y33A 3Q0WA 2M8GX 4ENMA 1WHUA 3CCMI 3ISPA 1YS6A 2VBYA 3ULQB 4MFEA 2XGDA 1K83J 1QZEA 3WU1B 1ZKGA 2O0YA 4E70A 1ZG3A 4FASD 3K9TA 3F21A 1UMQA 2E36A 1WCMJ 3O8HA 3VSKA 3U9GA 1H88C 2VQHA 4JYKA 1EA3A 3OYFA 3O3KA 2E2JJ 4A5NA 1HLVA 4LB5A 2JA6J 2Q2EA 2MLGA 6PAXA 1DPUA 1WPKA 5C4JJ 1EH7A 2ZFUA 3G4SI 2FXAA 2W25A 5J4YA 4W97A 2M4KA 4CCLA 2DOFA 2O9LA 2DMUA 3IKVA 3BROA 3H92A 2KQRA 3K69A 3HSRA 1HDDC 4MO7A 3HKZN 1JKRC 4IOAF 2EZLA 3QAHA 1RIOH 3BPVA 2G0EA 4EJWA 1IRGA 2EQRA 3LL7A 1OCZH 2O03A 3L09A 3OR1C 2IW5A 3OIQA 1PUEE 2WWYA 5H6RA 3JRAA 3CC7I 2VL8A 2LKPA 3CJQB 2MSYA 5GP9A 3ECHA 1LFUP 3RKYA 2K9SA 1TW2A 2R7FA 3SFZA 1FT9A 2HU9A 5J40A 4IOCF 4DYRA 2P5LC 1GXPA 3KEOA 1C0WA 1YO5C 1IG7A 2CQXA 2EZKA 2WV1A 4GYGA 1TNSA 2NVUB 3VYSB 1WWXA 4BDZA 2AXLA 4XOTA 3IAM2 2DFHA 2ECCA 3I0TA 1MJ9A 2X85A 2YSRA 5CVVA 3A03A 3S8PA 2R4GA 4AWXB 4CYCB 3OS2A 2PBIA 2DA3A 2L9RA 2EIJH 2DXIA 4NC6A 2LC2A 2R3SA 3FXQA 5LRRA 3N97A 4UXNA 3DPTA 3OYAA 4A3IJ 3I71A 1YITI 3ZCOA 3OYIA 2DJNA 2W85A 3ML6A 5J8FA 3U2RA 1G2HA 3IRQA 2CUFA 4PCQA 2D45A 1RUNA 2KJBA 1YYVA 3JRHA 4C3JJ 4KDPA 4XBFA 1QNTA 3FMQA 2NVTJ 3K7AJ 2L7FP 2LR8A 1USTA 3P9CA 3N4MA 3IH3A 1XMXA 1RESA 4IPAA 2ZSIB 3TW7A 3ERMA 2A6TA 4HDUA 1P4WA 1WH5A 1LKXA 4HW0A 1I27A 1KU9A 3IH2A 4MTEA 5LHGA 2VKVA 2AQEA 2IGKA 2NOJB 3KP2A 4PJMA 3DKXA 4RDUA 3NEUA 3L2VA 2DFEA 3SEZA 2BV6A 3KP7A 2IVMA 3WU0A 1IRXA 2VASA 3L9FA 4CCOA 2V1UA 4Q48A 1T56A 4RAZA 4BUPA 2ZXJA 3SZPA 2F4MB 3W2WA 3HOWJ 2GWRA 1FP1D 4BEHB 3CCYA 5EG0A 3KEYA 1KGSA 3DEWA 1F1ZA 3NQOA 2E1NA 4OIQF 2XV4S 3F8FA 3M9AA 1BR2A 4KYWA 2W48A 3L7WA 4ZYAA 1VQLI 1SC7A 1XTAA 2M5WA 3ECOA 2GXAA 4ZYEA 1T98A 1JKQC 1K78A 2LRDA 2QWWA 3HUGA 3OL4A 1ZGWA 4ON0A 2YX4A 2QKMB 3G1LA 5ILUA 1BIAA 3H0DA 1T2KA 2IA0A 5A2QZ 2MGQA 2HOEA 1K4TA 2K3FA 4IEJA 1ORKA 3HTSB 2DMQA 3H1CA 1XG1A 1U6GA 2XHKA 1JT6A 1DPRA 1TBXA 4J00A 2DW4A 2X0LA 3HBLA 4I7HA 1U5TC 2JVGA 2LNBA 2YS9A 3S3NA 5BPIA 3BT9A 1VI0A 1X3WB 1LPQA 2LD5A 4GYIA 1XMAA 5LEJA 5EEAA 1IZ1A 2MC4A 3LSGA 2ZMEB 3BTIA 2DCEA 2RREA 3EUAA 1UFMA 4LGWA 2E5ZA 3M8JA 1FMVA 4RB3C 4A3GJ 4X0GA 2B63J 1Z7UA 1FTTA 2YR2A 2BXZA 1F43A 1VQ7I 3R0AA 2DPDA 1RZ4A 2HYGD 1MSEC 1JTXA 3GF2A 3EYYA 2R5YA 2HYJA 5E18F 1P7JA 1ZGAA 3QP5A 3VFZA 2GA2A 1IUFA 4HA8A 5GPCA 5M5YJ 3CTAA 1NG7A 3TDZC 4EQQA 2Y69H 4S05A 1BA5A 2DFFA 3GTJJ 2CH0A 5B1AH 5LEKA 2HTSA 2NNNA 4I02A 4Y4RA 1K79A 1ERDA 2VKDA 2FBIA 1TT5B 4AC0A 3CJRB 3RKQA 2R92J 1ETQA 3PIPF 3CLQA 4P1WA 3BPXA 1WJ5A 2M1BA 4IQ4A 3CDHA 4HLYA 2DYRH 1WJBA 2L4MA 2I8DA 1P4AA 5B3SH 1E2XA 3KCCA 4PJ0C 2VOPA 3LSHA 2A5WA 2VJIA 3ELKA 1A5JA 1S7EA 3G2BA 4MTDA 3RI4A 1FOKA 3BQZA 2XKPA 1S7AA 4CCMA 3CMAI 2QCOA 3I4PA 4A2UA 4YIIA 1BI3A 1IN7A 1EH8A 1A04A 3PFYA 2X1EA 3AFHA 2OD5A 5F0CA 2P6SA 1FX7A 3C3WA 2LDUA 3VODA 4M72A 3TO7A 2CV2A 4G7OF 3VSLA 3HUGB 1LE8A 1NHAA 3VDXA 4HYEA 1ZAOA 1XGNA 2A3SA 4XRMA 4CICA 3RYPA 2LVSA 4IHXA 4MQ9F 4XMYA 1OISA 2JA2A 2F5CA 4L0ZB 2XAJA 3S1NJ 2JJ7A 1IRZA 1G3TA 1MMDA 4P5OA 4XRSA 3BQYA 2CW8A 2AS5F 2E5NA 5CPRB 1ZRCA 3LSJA 2QENA 3CC4I 2GLOA 2L9VA 2V6CA 3ABLH 3S3MA 2LY2A 2GIVA 1JGGA 4E7SA 4LD5A 1BM9A 4WXHA 1OPCA 1G4DA 1Y8QB 1Z67A 3J80Z 2P8TA 1IXCA 3BTLA 2XGEA 1SEUA 1XMKA 2VBWA 3OYCA 1GV2A 5JHFA 2LK2A 3LSPA 3JCUC 3TO6A 1ETKA 1I6XA 3WGGA 1FYMA 3ZQQA 3MN2A 5J4VA 4I0BA 4GXOA 2WV0A 2HKXA 1XCBA 2K9NA 4R8HA 5M5XJ 1FSHA 1XGMA 2DT5A 3F9KA 4DBQA 4F52A 4LIUA 2XIGA 3FK6A 2ZB9A 2X1DA 2FNAA 1PP8F 4L18B 2EA2A 3DQVC 2KLOA 4I99C 5D4RA 4FE4A 1D0YA 5ERIA 2QEXI 4DZJA 1DGWY 1WJEA 3RJPA 3MZ8A 1ITYA 2R7VA 2FF4A 4ZTFA 1W36D 2XB0X 3H9GA 3OY9A 4BGDA 1VQMI 2CSOA 2F4IA 2HZTA 4ANJA 2NVYJ 3CCJI 2DT6A 5J6XA 2IGNA 1XN7A 3ASNH 4CHUA 3HDDA 1FWZA 1HKTA 4CYCA 3F8CA 5M5WJ 4E7LA 5DTDA 3H35A 4J01A 1YFHA 5IY5H 1R49A 4D0PA 4RLQA 3WE2A 1BR1A 1FPQA 3ERED 1FOXA 2JPCA 4IHYA 2L5QA 1JUPA 2BY1A 3FMSA 3BG3A 3I4MJ 3NWTA 2V79A 4NC7A 1Y39A 3BZ6A 2V6EA 5GPAA 2AHQA 4ZTJA 3BCAA 4OAZA 1HW1A 2JUCA 2MD0A 1J5YA 5EYRA 4EMSA 4RGRA 2FBKA 5CVUA 2M34A 4U0VA 2WAQN 3E5UA 4B47A 4IQJA 3GVAA 3PUFA 3CCQI 2OCEA 3G1OA 4XLPF 2HEOA 2HXOA 1FIAA 4G94A 2DU9A 4C30A 4AVZA 1TC3C 1K61A 2O61A 5GADJ 4C2MJ 1IC8A 3O2PE 4V2FA 4CCNA 3BG6A 4EGZA 3FXLA 4M73A 5EJCA 2RAEA 1FNNA 1ZQ3P 2QQ8A 4NBQA 3IKTA 3MZYA 2R7DA 2EFPA 3HPGA 3EUHC 1BW5A 1MSFC 4AM3A 3E1SA 2Y48A 3R61A 2XDVA 1J0RA 4LG0A 2X6WA 2R7XA 1RKWA 3HM5A 3TGNA 2W00A 4HG2A 4B48A 4NDLA 2RGVA 3QU6A 2DPUA 1FIPA 4BACA 3ZQIA 4ENJA 4ZC3A 3I4NJ 1UG0A 2ACJA 2STTA 4RMNA 1ZYRF 3R60A 5LGNA 4O5VA 1SVOA 2EK5A 2VLAA 5CQGA 2IA2A 2R7WA 5F08A 5DS9A 1G59A 5IOZA 3LSRA 1LVAA 3H9JA 4FT8A 1J9IA 3HHHA 5FO5A 2CUEA 2HQNA 3FHZA 2DJIA 4GCVA 3P5JA 1USSA 3CD6I 3IH4A 1YW9A 5JLXA 5FKOA 3CUOA 1QU3A 3I59A 4G6TB 1J2XA 1O7FA 2A68F 2KHMA 1T6SA 1X1CA 1T08B 1QGPA 2WADA 5E79C 1LNWA 4RAGA 4RS8A 3CLOA 3W2AA 1SVLA 2GBYA 5IP9J 5D5VB 5EG0B 3KE2A 3MVPA 5HNHA 3MKYB 4ESJA 1A6IA 4ZYHA 3F22A 2RNGA 3IRRA 3E6CC 1MBFA 3CUQC 2JRTA 1GLNA 3OYLA 2JA7J 4N4NB 5HS8A 2AXTC 2LKSA 2M30A 1VQKI 3HOZJ 1GVJA 3U1KA 3K4LA 3WTWC 3ZXSA 3K1MA 3GTLJ 3G1MA 2A5YB 2DMPA 3WTVC 1GDTA 3C7JA 3CMMA 2V9PA 4A6EA 1S72I 2VQLA 4FQGA 4AIKA 1TWCJ 2ZMEA 2DFIA 4I98B 4ENKA 1X1AA 4BQAA 5FLXK 4NQWB 5F0FA 4JQFA 2QBYB 3M4OJ 2KDOA 3JREA 4QIWN 3P7NA 2JSPA 4XSXF 2GOXB 4ABZA 9ANTA 1OCCH 3TL4X 4QLCU 2VJ5A 1V3FA 2FUG2 4KNYA 4OIPF 3D0SA 3TDUC 2YX7A 1T39A 2JRMA 3CC2I 2M8EA 3HIFA 3ZMUA 2LP0A 1JE8A 3GFIA 4JX6A 4XN3A 4Y17A 4FTHA 1GT0C 1WI3A 4CZCA 4JBAA 1POGA 3A1YA 4BH9A 2L3DA 4L9NA 2IAIA 3D5LA 3IWFA 4JX4A 5A2QK 2W57A 5BMZA 4XLFA 2E7WA 3COAC 4XOPA 5IT9Z 3DKWA 4M74A 2QUFA 4S04A 4XLNF 4BU2A 4WXCA 5D8LB 3ZR8X 5F1JA 2XF6A 3IAS2 4LFUA 1STZA 1PJRA 4HF2A 2FQ4A 3CUQA 2NAZA 2EZIA 4LK0F 2VONA 3A4CA 4RAYA 3D1NI 2X6OA 4CUGA 2LF8A 3QYBA 2XGCA 1ACIA 3DWLE 2KPMA 4L9VA 2MH9A 4FCYA 3CP2A 1OLTA 3PSFA 3LWFA 3KIOA 3ROUA 2R5YB 2VQGA 2X1CA 1J09A 2XRNA 4LITA 3ZQLA 4C3HJ 3BOQA 1B9MA 1O3SA 3OYBA 2IS6A 5L3FA 2DK5A 4B4CA 2OV7A 4BDYA 3E7LA 3K2ZA 2L2OA 2DA1A 5FD5A 3LMMA 2HPIA 1X4PA 2M87A 2WA0A 4XKBA 2QQ9A 3E0JB 4IF4A 1X1DA 2XPWA 4NC8A 1AWCA 4E7IA 3SDBA 1MMAA 4EJOA 3OYJA 1YRNA 2EV6A 1LE8B 2LF7A 2OCCH 5IYBJ 1REPC 1YW7A 2GA1A 2IRFG 2RV8A 4A0YA 5TGTA 1R36A 2ZBKA 1YG2A 2WC2A 4EM0B 2F4OB 3NAUA 2P5KA 4D5FA 3BG7A 4KIGA 2KRCA 2OBPA 3BR2A 3BG5A 5ILSA 3GTMJ 4KIFA 4HRIA 2JA8J 3ZQCA 1WKMA 3IV5A 3QOEA 2V1DA 2WTEA 1Y0UA 2VODA 3DLLF 3FXOA 3ONQA 3SYTA 2Y0SN 2V9VA 3G73A 4LIVA 5H6QA 1QBJA 1FTZA 2JPBA 3ZMVA 5K5RA 1O3QA 5L3GA 4KUMA 2HQAA 2C6YA 2EBIA 1X3ZB 4MHGA 3VB2A 2VKHA 2WB1A 3QRFF 2KIMA 1AA7A 2H8RA 1I5ZA 1NH3A 3GEZA 1VQ5I 4XLHA 1R5ID 2OUMA 2MC3A 2DDBA 2R5ZB 2G7UA 2HVSA 3BDDA 4CCJA 2FMLA 5KNLA 2XAQA 4B3XA 3ZPLA 2HWVA 2BVMA 2JTVA 5FKMA 3PUBA 5DV5A 2XAFA 3NARA 1X1PA 2L4AA 3M3YJ 1P4XA 4XKCA 1SD7A 1NG6A 3DPLC 4LMYA 4Q47A 4RBOA 1B59A 2M7AA 4HSRA 2AQFA 2ZSHB 1BW6A 4BHCA 2DA7A 3N05A 2VOOA 3P9IA 2M4GA 5DYMA 3W2VA 4LG0B 2PLYA 2DAOA 4CO8A 4XK4A 3GLXA 4D9JA 3AG3H 1TWGJ 3BR5A 4BQNA 4OIOF 4WK8F 1LQ1A 1HW5A 3V8KA 1V55H 3LA2A 4D7NA 2KP6A 1PUFB 2KT0A 1JTYA 4XICA 4OOIA 5BNGA 1APLC 5FKNA 2DA6A 2GOMA 2Y0MA 2MBFA 2OPTA 1ZRDA 3BTJA 3DKYA 1VQNI 1XDUA 4DQ2A 5C4XJ 1W5CC 1R1TA 3B6CA 1F36A 3GFLA 3E5XA 1F4KA 5HVQC 1EKEA 3CMEI 1ON2A 4YFKF 1P7IA 5IPAA 3EPZA 4XLAA 5EDNA 3FBIB 3FKIJ 3CJNA 1X2MA 2LSOA 2FD5A 1MBGA 3JTHA 3WGHA 4BHPA 4F92B 1IRFA 4AVPA 3HRTA 5FLVA 2CQ7A 4WX9A 4HQEA 3ZQGA 2ME0A 3PM1A 4HNTA 1ETOA 3GWZA 2L0KA 5D6EA 3Q5FA 5HS9A 1U8BA 1A31A 2FRHA 4U7BA 3CQZJ 1N78A 5KVRA 2R7OA 4IHWA 4BQOA 2F6CA 2LTPA 3A02A 3ZGKA 2I10A 1D8JA 2UV1A 1LUJB 1G6NA 2ZXWH 1UHSA 4UV9A 4EGYA 4HDVA 2XAHA 2Y9ZA 2OC6A 3HOUJ 1V5FA 3HL2A 5J1UA 1IAWA 2TDXA 4U0WA 3DBHB 1KZHA 2BY0A 5DCFA 2QGUA 1WGXA 3WTUC 4V19K 2DMTA 1YHQI 2XRLA 4IJAA 3CJTB 2KDZA 3K4BA 2E1MB 2Y30A 1IDYA 1YI2I 2FQ3A 4MFDA 5KHDA 4O3MA 3QU3A 1ETVA 3QOPA 4C2TA 3RQ4A 1FSEA 1R58A 2E19A 4LOCA 2ISZA 3HPHA 3JRGA 1BOAA 2K40A 2Z5UA 5GTHC 4HNUA 4HV6A 1LDKB 5FJ8J 3CP8A 1HBXG 1UELB 3WHBA 3HYIA 2CUZA 1KQ8A 1BBYA 2WY8Q 3OYHA 1I6HJ 4WCGA 2EINH 3FISA 2Y0SA 2ZKZA 5D5WB 1MNEA 3TOBA 2DN0A 2DK8A 3S1QJ 4ZYDA 1TLHB 2O3FA 3K6GA 3E6MA 3PQJA 4AIHA 1XSVA 3H5NA 2IT0A 2XVCA 3TOAA 4BY1J 3LSMA 4DOZA 2DA4A 5GAEJ 1VQ8I 4YEJA 3NWSA 1VQ6I 1QZZA 1R1VA 1HF0A 1HW2A 2MH2A 1JKPC 3QP6A 2HVQA 4LJZF 3HSEA 1WQ2A 3HOYJ 2VC1A 3TP3A 2HKOA 4BE0A 3KP3A 2R7ZJ 2QYOA 3E6DA 5E1XA 2XF7A 4RGXA 1RR7A 5EGOB 3ABUA 3JRIA 4G9YA 4U87A 4NHJA 3VYUB 3PIOF 3FXMA 4M3DA 1RNLA 3F6VA 3DP7A 4L0YB 1TZLA 2Z3YA 5LGUA 4C9YA 1ZN2A 2ZJPF 1S29A 4R1HA 3BJOA 3EETA 1YQAA 2DA5A 3BWGA 3ZOBA 3ZRGA 1ZTRA 2Z9OA 3BR0A 1W0UA 4PSWA 2FNPA 2DQRA 1ETWA 2R7QA 2QQAA 3WU2C 3L2WA 3CUQB 3RKWA 2HDWA 4FISA 5IYDJ 1BI1A 1FOWA 3V8JA 3SJMA 3RPUA 2HOSA 1FYLA 4BQQA 2HOTA 1IXRC 3U21A 4GDFA 4IHSA 3HRSA 1F9NA 3OWTA 4B1RA 1WSUA 1J7KA 3F8NA 2BVLA 2HS5A 2K4JA 3GLLA 4ENNA 3OYDA 3QPSA 1JUMA 2BHYA 1NK2P 4IRIA 1T8IA 2O8XA 1H9GA 4DBRA 1I50J 1QO0D 2NYXA 2CG4A 2H09A 3M8EA 2X48A 1O3TA 2ZMEC 2ZNYA 2CO5A 5DUIA 2OTJI 1MNDA 2ELHA 3AL0B 3DF8A 4HAMA 5F64A 3GYHX 2Y31A 4M3FA 2PJPA 5JI6A 1TT0A 5D5XB 1W5SA 4UHTA 2VKEA 5CVIA 3ZMTA 4M3BA 1WJDA 3I5UA 1Y1VJ 4I2OA 1T0FA 5K7ZA 1T0FC 4M6VA 2D1VA 2FBHA 1R1UA 1MW7A 4UVAA 1GUUA 2K27A 3GTGJ 5ILVA 4A3FJ 4E7HA 1Q1VA 4RB1A 2HR3A 3VOEA 4PJNA 1O7LA 1F5TA 4KT6A 1ZR4A 5DEQA 1U3EM 3KLOA 3ZMDA 2IGMA 2VBXA 5IP7J 2P81A 1U8RA 4E4HA 2Q2EB 3HZJA 1QVUA 1MZBA 3H5RA 1ON1A 2HYFA 1DGRM 1MH4A 3GZNB 3BCBA 3SFIA 1HC8A 1WFXA 1D5VA 2LH9A 4RA2A 2WAFA 5CVJA 3WTXC 2IS2A 2PEXA 3L00A 2XPVA 2EWNA 1YJWI 2VT2A 3SDGA 3OR2C 3G71I 2HGCA 4CGZA 2VPRA 4R79A 5L3CA 2H6CA 1OR7C 1OYIA 1WJAA 2NOGA 4X6AJ 3C18A 3GMEA 3L2QA 2HDCA 3FBNB 1NK3P 2O7OA 2ESHA 2PI0A 3GZ5A 3MKWB 2HVRA 2GAUA 3H9QA 3AG2H 1GVDA 3QODA 1SMTA 3H3VK 4QSHA 1JXSA 5FB2A 2DODA 5JVTA 4HEA2 1E3PA 3E97A 2UXXA 3MFKA 4A3BJ 5HLTA 1RPWA 4D7MA 3MWMA 3IC7A 5FGMA 3CCEI 2ID6A 3CDLA 3MD2A 4Z6YA 1HA8A 2XSDC 2LLKA 4U7DA 1LB2A 1WZ2A 2BY3A 3AG4H 4FX0A 4ZDOA 2BBYA 3KYLA 4K2EA 1KQ0A 2QF7A 2LBFB 3A0BC 1U9NA 1B8IB 2K7LA 4QPQA 3OYGA 2KKOA 5K1YA 1N75A 2CWEA 2ME6A 2GXBA 3A01A 2QSHX 4UUSB 5JHUA 1MJBA 1IV8A 4XORA 2RQPA 1S7OA 3CO6C 5J8CA 5ICEA 2CMPA 3MQ0A 3RTRA 3CESA 3PFIA 4UB8C 5GAHJ 3HOSA 1OKRA 3DBRB 2M0CA 3I64A 3LFKA 1OMIA 3S3OA 2YU9J 2K02A 1RI7A 1SD6A 2UUZA 2KL4A 3K1PA 2BOLA 2XSJC 2RNJA 1S9HA 2D1HA 4GRIA 1TQPA 1SD5A 5IP6A 3AKZA 2OZ6A 1H9TA 5KAFC 3FMRA 1IDZA 2Y75A 4BJTA 2DQLA 2Z2SB 1ZH5A 3OYEA 2OF7A 1MBEA 3KP5A 1MMGA 2OA4A 1SAUA 3B73A 2GIZA 2VE9A 3DBLB 4IHVA 1LFBA 3S2DJ 4YIRX 2GM4A 1PVEA 2ELKA 1L0OC 2E2HJ 4A5MA 1VFCA 5LBQA 2P0WA 1V5EA 1FLIA 1Z3YA 3OL3A 4KA4A 4QPOA 5ICCA 1YX3A 1PYVA 4KN7X 3L1PA 5DDGA 3F0CA 3F8BA 2M0MA 2K9LA 3S1RJ 3KEQA 3BTCA 2MYSA 2MLKA 4DYQA 1OCRH 2E35A 4EM1A 3JRCA 4YG2F 3CF2A 5D4SA 2Z33A 3HB9A 1SFXA 4ZH4F 1QZYA 1Y56A 4P55A 2V26A 5DD4A 1FEXA 3KETA 4NB5A 1DU0A 4RM3A 2A61A 1YTYA 1KONA 4B44A 3ZQ7A 2ECBA 3KP4A 4JX5A 4HQMA 3TQNA 1D1CA 5FRMA 3MCZA 1R5GA 3Q0VA 4B3AA 1KU7A 2HDDA 5F1RA 3HRMA 4IXAA 4BBRJ 3GUDA 1HKSA 4G6QA 4FE7A 1D0ZA 4BXXJ 1A36A 2V9KA 2VUMJ 2EPFA 3PJRA 2JT1A 2EFWA 2DI3A 2OZUA 2VIXA 1VQOI 2BYVE 1TWAJ 3L2UA 2FJ1A 2X4HA 3D5RC 2EZHA 3QWLA 4JP0A 4HOBA 1ZHFA 3FHNA 1KQ9A 2ZO4A 4HNVA 2W1OA 3J81K 3CCRI 1W7PD 1FC3A 4IVNA 2PMHA 3R0JA 4LLLA 3J7ZI 3HKZA 1DP7P 4N4OB 3K70C 3MZHA 2F5FA 2W7NA 3JSPA 1I1GA 1K4SA 4M6XA 1J59A 1NTCA 1LFPA 4D5CA 3CO7C 3DV8A 3TBIA 4A3LJ 2IJLA 2D5VA 1U5TB 4Y15A 5BPDA 2RQQA 3HEFA 3I9V2 1ZG5A 4ESBA 3RSNA 2CFOA 5D6FA 4CH7A 4RGUA 5L3DA 3QPLA 1TL8A 1V5GA 1BN5A 2PQ8A 1D0XA 1G8XA 2EJRA 4A3EJ 1A6QA 1BJAA 1Y0NA 2ZJRF 3E6BA 2MW8A 3GXOA 1O57A 1JJ8C 2BZTA 3WHCA 2FU4A 5H20A 2W84A 2B7EA 2QM3A 2COMA 3QPHA 1B72B 2DA2A 4IKFA 3LSTA 3OIPA 4RB0A 1RR8C 1MMNA 3BC8A 1ETXA 2CS3A 2HPMA 1XGOA 4E7ZA 4ZZDA 4LLNA 5BS6A 2KZGA 2MG4A 1IN6A 4OMYA 4EEFG 1FP2A 5E3NA 4IRHA 5CYVA 3R6SA 3RZDJ 2WY7Q 4XLEA 2M9HA 1UZCA 1ONVA 4RB2C 1H8AC 3KPHA 2AO9A 3BJ6A 3ASOH 4ITVA 1ZK8A 1CGPA 1N77A 1MBKA 1U5TA 3HOXJ 1I1SA 3PSIA 3S2HJ 3ZN0A 4OWRB 4HPQA 1Z6RA 2CV1A 5M3MJ 2JUGA 4N9IA 1M1EB 5B5EC 4BNCA 3RDIA 4IHTA 2R7UA 1VNDA 3OSFA 3J80K 3BZCA 4EJVA 4I6ZA 1WJCA 3EQLF 2PJRA 3L2CA 1VZ0A 3OYMA 5E3LA 4PGGA 2VT3A 2IGOA 2PJRB 3PO2J 1DQUA 2P5VA 2RC4A 4MEYF 3RKXA 4DGWB 2P7CB 1R6RA 2Z1DA 5ED4A 4MLOA 1BIBA 3K10A 1IO2A 1X1BA 4DJAA 5HDGA 2KRHA 5FFXA 2E1OA 3FKJA 1R22A 5HDNA 5HNFA 4C2UA 2E7XA 4KFCA 3RPQA 3KX2A 2VPLA 1RKTA 3M07A 4RAFA 4OAYA 3DCFA 3M7GA 4MGRA 3G3ZA 3K2AA 1BJZA 1YJNI 4A3JJ 4Y13A 3Q9SA 5E8IA 1O4XA 2CV0A 4GFBA 4D1QA 4HZFA 3OS1A 5FLXZ 1BI0A 4Y52J 1SFUA 3JRBA 2JK3A 4XKWA 2NS7A 1E3OC 3IWZA 1JT0A 5H2FC 2FMYA 5BOXA 1MD0A 4CSWA 1IN5A 5JVGF 3MMYB 4LG3A 2DTRA 4CCKA 3B02A 2EA4A 1IGNA 4PDKA 3TEDA 4HX8A 2KRFA 2YU3A 3KZZA 1R71A 2KIQA 2LFBA 1JGSA 1TP4A 4I0AA 2R7RA 4M9SA 1I3QJ 3KZYA 2JVHA 2CW0F 4F3QA 4WWCA 3GX4X 1TWHJ 3GFJA 5LFAA 1YS7A 1VQ4I 5FFZA 1IF1A 2KISA 1ZG1A 1SAXA 3PNTA 2YUSA 4KJZA 4GGGA 3U1DA 3BR3A 4N9HA 1B1BA 4BYYA 4KIBA 2EFOA 3HHGA 3I56I 4L5EA 2XPUA 2DLLA 1FBSA 1LJ9A 1EV7A 3B6AA 3TW6A 1B6AA 2Q0OA 3W6JB 5LLQA 1R5HA 5BQTA 1T95A 2W4SA 2E1CA 4L9JA 4OMZA 4JK1X 2V1NA 1Y1WJ 1ZREA 2PX9A 2QA4I 3MKZA 1JJ6C 3HOVJ 1E0EA 3VWBA 1X2NA 2BW3A 3FIWA 4XSZF 1EJ9A 2BY2A 2VQCA 2PN6A 3C2GA 5AIQA 5HLIA 3UNGC 3FX3A 5CVRA 3JSOA 1QPIA 3FXUA
chains in the Genus database with same CATH topology
4UUVA 3I59B 2EFNA 5HDKA 3T0YA 4O6JA 4KICA 4ASNA 1TTYA 3F72A 4OU0A 2HQRA 3RIRA 2FEZA 5TJJA 4L5JA 2W24A 5IT3A 3FF5A 1GXQA 4L9TA 3T8RA 3K0LA 2JSCA 4F7ZA 3V7SA 3GFMA 4BHBA 3ABTA 2PG4A 1TW3A 3Q9VA 3REOA 1Z6TA 2G7HA 4TV7A 3PQKA 3FM5A 1ULYA 4M9ZA 4HX4A 4IRGA 2ZCWA 3FM3A 1SMYF 1OYWA 4M71A 2EV5A 3H3UA 5F6FA 1U2WA 2A6EF 2UWMA 1UHWA 1LDJA 3LA7A 3ZMSA 3E5QA 2A69F 1K78B 2CFXA 2H27A 5EEHA 1IN8A 1R23A 1TQMA 4N0BA 3EUHA 1W7PA 4NQWA 5HLGA 5LHIA 3DXJF 2L01A 4HF1A 1XDSA 2STWA 2NRAC 3OOPA 2IP2A 2J5PA 3AAFA 2VBZA 4DNCA 1OR7A 2FOKA 3FXRA 3V8LA 1E17A 1MKMA 2D2WA 5E1WA 1KA8A 2BE5F 3VEPA 3V4GA 4PZJA 1MGTA 4ZZLA 1G3SA 1G3WA 3DFGA 4A6DA 2A07F 2ESNA 4LLGF 2NS0A 1R00A 4YIFA 3LAJA 2J5OA 2FSWA 5TRDA 2IPQX 3BJAA 2ZNZA 1YW8A 3GO5A 2ZFWA 3WTZA 2B0LA 4WF2A 2KIFA 1XCVA 4HBLA 1L3LA 1J75A 4UNOA 3W6KB 1JHHA 5HS7A 2PMUA 4HX7A 1DDNA 1BC7C 3GZ6A 1FZPB 3SHFA 2OQGA 2L54A 2BEOA 4P9UA 2GXGA 2OU2A 5L3BA 4ESFA 2DO7A 2OAZA 5JFRA 5E17F 3F23A 3IHUA 3C1DA 3J81Z 4Z2YA 1ZGJA 1P92A 5K5QA 3M8FA 1D8KA 4I01A 2GQQA 1Z1DA 3RYRA 1XSXA 3JAMZ 3LA3A 1B9NA 3V7RA 5CJ9A 1ODDA 2QQBA 1LEBA 2RDPA 3FZVA 4EJTA 2K4BA 4OINF 2G9WA 1TQIA 3V7CA 4XRFA 1SFEA 4Q4ZF 1ZLJA 1IXSB 1HXDA 3F8MA 4HF0A 4P96A 2ETHA 3K1NA 2KJCA 1YLFA 2QBYA 1Q1HA 2DBBA 2NNYA 1MDMA 2M45A 1HQCA 4UV8A 3P9KA 3T5XA 1PP7U 2XROA 3TO9A 2VXZA 5IT9K 3EYIA 1WRJA 5LHHA 5D8KB 3F6OA 4YFNF 4LK1F 3R4KA 5CLSA 1OYYA 2F5EA 1XD7A 4HLXA 3WODF 4QWQA 1K6OA 3EDPA 5AONA 3ZP5A 5LGTA 2XKOA 4UVCA 3F3XA 2OQRA 2XASA 3SZTA 4CYDA 4EVIA 3I53A 4EJUA 4U88A 1CF7A 3QPTA 4B8XA 3WTSC 4U0YA 2CGPA 4GO1A 1T38A 1BI2A 5DCMA 1SD4A 4KMFA 1B4AA 3MEXA 3SXYA 4A0ZA 1YIOA 1Z91A 4FHTA 1H0MA 4KMUX 1IUYA 2V1XA 4MNUA 1XB4A 3WE3A 2XUBA 2QVOA 1W5TA 4H0EA 2UZKA 1LDDA 4PGHA 1RUOA 2RN7A 3HTUA 3TKYA 1X3UA 3O6BB 3I54A 3GW2A 1UCRA 1ZRFA 2BGCA 3ZMZA 2VC0A 2QLZA 1S6LA 2QZ8A 2ADUA 5E20A 1ZLKA 1W7PB 5DD8A 2F2EA 4RGSA 2VE8A 2UXNA 1IW7F 4BXUA 1TNTA 2P4WA 4CDGA 1HSJA 5FD6A 2P6TA 1G3YA 2H6BA 4G8XA 4EV0A 4CXFA 4BAYA 1PDNC 2Z99A 2HTJA 1UHMA 4KN4X 4L5IA 5ICGA 3IL2A 2XGXA 1U78A 3KLNA 1EH6A 1R7JA 3M1EA 3JW4A 2MD5A 4YFXF 4WXDA 4ETSA 5L3EA 3DEUA 2L02A 2CYYA 4I09A 4AD9A 2O6GE 2VN2A 2ZJ2A 5EEGA 1KYZA 3LAPA 1FY7A 2RVCA 4G6DA 2EV0A 5DUKA 5HLHA 3KFWX 4FX4A 2MA3A 2EFQA 1KU3A 4MEXF 3WGIA 3WTTC 1BC8C 1K7AA 1D3YA 4B09A 3JAMK 2HFHA 1Z05A 1CF7B 1P6RA 4AIJA 1LEAA 3HSFA 4P9FA 4LB6B 5E8GA 1KU2A 2Q8KA 2XAGA 1HKQA 1FYKA 1QPMA 3WTYC 1W4MA 1KYWA 1S8NA 3LQRA 3MAJA 3LQQA 5AIPA 2ISYA 1HSTA 3H3ZA 4M9XA 1XSDA 5HOOA 1FBUA 3HRUA 2RKHA 1UB9A 5K5OA 4HV5A 1FBQA 2EB7A 1P2FA 4MQVA 4Q5SF 2YPRA 3NRVA 2IA1A 3T1BA 3SQNA 1ZARA 3S2WA 4CZZA 2FA5A 5LRSA 1XGSA 2CQKA 3E3VA 3T8TA 1IN4A 5JR3A 3ZN1A 1DUXC 4G7ZF 1VTNC 3WG9A 3I58A 4A0XA 4UVBA 1MDMB 1S3JA 4G7HF 5KK1A 4ZYGA 1QQIA 5E1ZB 3FWEA 3JTGA 1O3RA 3HOTA 2K86A 4M6YA 2P7VB 1JHFA 4KT5C 5ICFA 3J7AO 2FE3A 1WI9A 4EM2A 3BP8A 1GHCA 1MJAA 1Z9CA 4OIRF 5DCMB 5D5UB 1V4RA 2JZYA 3KP6A 2A6HF 2GZWA 2H94A 2PFBA 3OV8A 4A12A 1AOYA 3BY6A 2F5DA 2KIUA 4ENMA 3ISPA 1YS6A 2VBYA 3ULQB 3WU1B 2O0YA 4E70A 1ZG3A 3K9TA 3F21A 3U9GA 3O3KA 4A5NA 4LB5A 2Q2EA 2MLGA 6PAXA 1DPUA 1EH7A 2FXAA 2W25A 3IKVA 3BROA 3H92A 3K69A 3HSRA 1RIOH 3QAHA 3BPVA 4EJWA 1IRGA 2O03A 3L09A 2IW5A 1PUEE 2WWYA 5H6RA 2LKPA 3ECHA 3RKYA 1TW2A 2R7FA 3SFZA 1FT9A 2P5LC 1GXPA 3KEOA 1C0WA 1YO5C 4GYGA 1TNSA 1WWXA 2AXLA 3I0TA 5CVVA 4AWXB 1MJ9A 2YSRA 2PBIA 2R3SA 3FXQA 5LRRA 3N97A 4UXNA 3DPTA 3I71A 2W85A 3ML6A 5J8FA 3U2RA 3IRQA 4PCQA 2D45A 1RUNA 2KJBA 1YYVA 4KDPA 4XBFA 1QNTA 3FMQA 1USTA 3P9CA 3N4MA 4IPAA 4HDUA 1P4WA 4HW0A 1I27A 1KU9A 4MTEA 5LHGA 3KP2A 3NEUA 2BV6A 3KP7A 2IVMA 3WU0A 3L9FA 2V1UA 4Q48A 4RAZA 2ZXJA 3SZPA 2GWRA 1FP1D 1KGSA 1F1ZA 3NQOA 2E1NA 4OIQF 2XV4S 3F8FA 3M9AA 4KYWA 3L7WA 2M5WA 3ECOA 4ZYEA 1T98A 1K78A 2QWWA 3HUGA 4ON0A 2YX4A 5ILUA 1BIAA 1T2KA 2IA0A 5A2QZ 2HOEA 3HTSB 1U6GA 2XHKA 1DPRA 1TBXA 2DW4A 2X0LA 4I7HA 1U5TC 2LNBA 5BPIA 4GYIA 1XMAA 5LEJA 1IZ1A 2ZMEB 1UFMA 4LGWA 4RB3C 1Z7UA 2YR2A 3R0AA 2DPDA 1RZ4A 2HYGD 3GF2A 3EYYA 5E18F 1ZGAA 3QP5A 3VFZA 2GA2A 4HA8A 3CTAA 3TDZC 4EQQA 4S05A 5LEKA 2HTSA 2NNNA 4I02A 1K79A 2FBIA 3BPXA 2M1BA 3CDHA 4HLYA 2L4MA 1P4AA 1E2XA 3KCCA 2VOPA 3ELKA 4MTDA 3RI4A 1FOKA 2XKPA 1S7AA 4A2UA 3I4PA 4YIIA 1BI3A 1IN7A 1EH8A 1A04A 2OD5A 2P6SA 1FX7A 3C3WA 2LDUA 3VODA 4M72A 3TO7A 4G7OF 1NHAA 4HYEA 1ZAOA 1XGNA 2A3SA 4CICA 3RYPA 4MQ9F 2F5CA 4L0ZB 2XAJA 1G3TA 4P5OA 2AS5F 1ZRCA 2QENA 2V6CA 2GIVA 4LD5A 1BM9A 4WXHA 1OPCA 1G4DA 3J80Z 2P8TA 1IXCA 1XMKA 2VBWA 3TO6A 1FYMA 1I6XA 3WGGA 4I0BA 4GXOA 2WV0A 2HKXA 1XCBA 4R8HA 1FSHA 1XGMA 2DT5A 2XIGA 2FNAA 1PP8F 4L18B 2EA2A 3DQVC 5D4RA 5ERIA 3RJPA 2FF4A 2CSOA 2HZTA 5J6XA 4CHUA 1XN7A 1FWZA 1HKTA 3F8CA 1YFHA 4D0PA 3WE2A 3ERED 1FPQA 2JPCA 3FMSA 2V79A 3BZ6A 1HW1A 1J5YA 4EMSA 4RGRA 2FBKA 5CVUA 4U0VA 3E5UA 3GVAA 4XLPF 2HEOA 4G94A 2DU9A 2O61A 3O2PE 4EGZA 4M73A 1FNNA 3IKTA 3MZYA 2R7DA 2EFPA 2Y48A 3R61A 1J0RA 4LG0A 3TGNA 2RGVA 3QU6A 2DPUA 4ENJA 2ACJA 2STTA 1ZYRF 3R60A 5LGNA 4O5VA 2EK5A 2IA2A 1LVAA 4FT8A 1J9IA 3HHHA 5FO5A 2HQNA 3FHZA 4GCVA 1USSA 1YW9A 3CUOA 3I59A 1J2XA 1O7FA 2A68F 1T6SA 1QGPA 1LNWA 4RS8A 3CLOA 5D5VB 3KE2A 4ESJA 4ZYHA 3F22A 3IRRA 3E6CC 3CUQC 2JRTA 5HS8A 2M30A 1GVJA 3WTWC 3K1MA 2A5YB 3WTVC 3C7JA 4A6EA 4AIKA 2ZMEA 2DFIA 4I98B 4ENKA 4BQAA 5FLXK 4JQFA 2QBYB 3P7NA 4XSXF 4QLCU 1V3FA 4KNYA 4OIPF 3D0SA 3TDUC 2YX7A 1T39A 2M8EA 3HIFA 3ZMUA 1JE8A 3GFIA 4Y17A 4JBAA 4BH9A 2L3DA 4L9NA 3IWFA 3D5LA 5A2QK 2W57A 5BMZA 2E7WA 3COAC 5IT9Z 3DKWA 4M74A 2QUFA 4S04A 4XLNF 4WXCA 5D8LB 4LFUA 1STZA 4HF2A 3CUQA 2NAZA 4LK0F 2VONA 4RAYA 2LF8A 4L9VA 2MH9A 3LWFA 3ROUA 2XRNA 3BOQA 1B9MA 1O3SA 5L3FA 2DK5A 3K2ZA 5FD5A 2M87A 2QQ9A 4IF4A 1AWCA 4EJOA 2EV6A 2LF7A 1REPC 1YW7A 2GA1A 2IRFG 2RV8A 4A0YA 1R36A 2ZBKA 1YG2A 2WC2A 4EM0B 2P5KA 4KIGA 2OBPA 5ILSA 4KIFA 1WKMA 2V1DA 2WTEA 1Y0UA 2VODA 2V9VA 3G73A 5H6QA 1QBJA 2JPBA 3ZMVA 5K5RA 1O3QA 5L3GA 4KUMA 2C6YA 4MHGA 3VB2A 3QRFF 2KIMA 1I5ZA 3GEZA 2MC3A 2G7UA 3BDDA 2FMLA 2XAQA 3ZPLA 2HWVA 2JTVA 5DV5A 2XAFA 2L4AA 1P4XA 1SD7A 3DPLC 4LMYA 4Q47A 1B59A 4BHCA 2VOOA 3P9IA 5DYMA 4LG0B 2PLYA 2DAOA 4CO8A 3GLXA 4OIOF 4WK8F 1LQ1A 1HW5A 3V8KA 3LA2A 4OOIA 2Y0MA 2MBFA 1ZRDA 1XDUA 4DQ2A 1R1TA 3GFLA 3E5XA 1F4KA 5HVQC 1ON2A 4YFKF 3CJNA 2LSOA 3JTHA 3WGHA 4BHPA 1IRFA 4AVPA 3HRTA 4WX9A 4HQEA 3GWZA 5D6EA 3Q5FA 5HS9A 2FRHA 4U7BA 5KVRA 1D8JA 1G6NA 4UV9A 4EGYA 4HDVA 2XAHA 1IAWA 2TDXA 4U0WA 5DCFA 3WTUC 4IJAA 2FQ3A 4O3MA 3QU3A 3QOPA 1FSEA 1R58A 2ISZA 1BOAA 2Z5UA 4HV6A 1LDKB 1HBXG 3HYIA 1KQ8A 1BBYA 4WCGA 2ZKZA 5D5WB 3TOBA 2DK8A 4ZYDA 1TLHB 2O3FA 3E6MA 4AIHA 3PQJA 1XSVA 2IT0A 2XVCA 3TOAA 1QZZA 1R1VA 1HW2A 2MH2A 3QP6A 4LJZF 3HSEA 1WQ2A 2VC1A 2HKOA 3KP3A 2QYOA 3E6DA 5E1XA 4RGXA 3ABUA 4G9YA 4NHJA 1RNLA 3F6VA 3DP7A 4L0YB 2Z3YA 5LGUA 1ZN2A 1S29A 4R1HA 3BJOA 3EETA 1YQAA 3BWGA 2Z9OA 2FNPA 2DQRA 2QQAA 3CUQB 3RKWA 1BI1A 3V8JA 3RPUA 1FYLA 1IXRC 4IHSA 3HRSA 1F9NA 1WSUA 1J7KA 3F8NA 2HS5A 2K4JA 4ENNA 4IRIA 2O8XA 1H9GA 1QO0D 2NYXA 2CG4A 2H09A 3M8EA 1O3TA 2ZNYA 2CO5A 5DUIA 2ELHA 3DF8A 4HAMA 5F64A 3GYHX 2PJPA 5JI6A 5D5XB 1W5SA 4UHTA 5CVIA 3ZMTA 3I5UA 4I2OA 1T0FA 2D1VA 2FBHA 1R1UA 4UVAA 2K27A 5ILVA 4RB1A 2HR3A 3VOEA 1O7LA 1F5TA 1U3EM 5DEQA 3KLOA 3ZMDA 2VBXA 1U8RA 1MZBA 1ON1A 2HYFA 1D5VA 5CVJA 3WTXC 2PEXA 3L00A 2EWNA 2VT2A 2HGCA 4CGZA 5L3CA 4R79A 2H6CA 1OYIA 3C18A 2HDCA 2ESHA 2PI0A 3GZ5A 2GAUA 1SMTA 1JXSA 5FB2A 5JVTA 3E97A 2UXXA 3MFKA 3MWMA 3IC7A 5FGMA 1LB2A 4U7DA 4FX0A 2BBYA 4K2EA 1KQ0A 2K7LA 2KKOA 5K1YA 2CWEA 2GXBA 5JHUA 1MJBA 2RQPA 1S7OA 3CO6C 5J8CA 5ICEA 3MQ0A 3RTRA 3PFIA 3HOSA 1OKRA 3I64A 3LFKA 1OMIA 2K02A 1RI7A 1SD6A 3K1PA 2RNJA 2D1HA 1TQPA 1SD5A 2OZ6A 1H9TA 3FMRA 2Y75A 2DQLA 1ZH5A 3KP5A 2OA4A 3B73A 2VE9A 1L0OC 4A5MA 5LBQA 1FLIA 4KA4A 5ICCA 4KN7X 5DDGA 3F8BA 3KEQA 4EM1A 2MLKA 4YG2F 5D4SA 2Z33A 1SFXA 4ZH4F 1QZYA 4P55A 5DD4A 3KETA 4NB5A 2A61A 1YTYA 3ZQ7A 3KP4A 4HQMA 3TQNA 3MCZA 1R5GA 1KU7A 5F1RA 3HRMA 4IXAA 3GUDA 1HKSA 4G6QA 2JT1A 2EFWA 2DI3A 2OZUA 2BYVE 2X4HA 4HOBA 1ZHFA 1KQ9A 2ZO4A 3J81K 1W7PD 1FC3A 4IVNA 2PMHA 3R0JA 4LLLA 1DP7P 3MZHA 2F5FA 3JSPA 1I1GA 4M6XA 1J59A 3CO7C 3DV8A 2IJLA 1U5TB 4Y15A 5BPDA 1ZG5A 4ESBA 5D6FA 4RGUA 5L3DA 1BN5A 2PQ8A 2EJRA 1BJAA 3E6BA 3GXOA 1O57A 2FU4A 5H20A 2W84A 2QM3A 2COMA 3QPHA 3LSTA 4RB0A 1XGOA 4ZZDA 4LLNA 5BS6A 1IN6A 4OMYA 1FP2A 4IRHA 5CYVA 3R6SA 1ONVA 4RB2C 3BJ6A 1CGPA 1U5TA 1I1SA 3ZN0A 1Z6RA 4N9IA 4BNCA 3RDIA 4IHTA 3J80K 4EJVA 3EQLF 3L2CA 4PGGA 2VT3A 2P5VA 2RC4A 4MEYF 3RKXA 2P7CB 5ED4A 1BIBA 5HDGA 5FFXA 1R22A 5HDNA 2E7XA 4KFCA 3RPQA 3M7GA 4MGRA 3G3ZA 4Y13A 3Q9SA 5E8IA 4HZFA 5FLXZ 1BI0A 1SFUA 3IWZA 2FMYA 5BOXA 1MD0A 1IN5A 2DTRA 3B02A 2EA4A 4PDKA 4HX8A 2KRFA 2YU3A 3KZZA 1JGSA 4I0AA 4M9SA 3KZYA 2CW0F 4WWCA 3GX4X 3GFJA 1YS7A 1IF1A 5FFZA 1ZG1A 1SAXA 4GGGA 3U1DA 4N9HA 1B1BA 4BYYA 4KIBA 2EFOA 3HHGA 2DLLA 1FBSA 1LJ9A 1EV7A 1B6AA 2Q0OA 3W6JB 5LLQA 1R5HA 5BQTA 2E1CA 4L9JA 4OMZA 4JK1X 1ZREA 4XSZF 5HLIA 3JSOA 2PN6A 5AIQA 3FX3A 5CVRA 3FXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUV A;  3I59 B;  2EFN A;  5HDK A;  3T0Y A;  4O6J A;  4KIC A;  4ASN A;  1TTY A;  3F72 A;  4OU0 A;  2HQR A;  3RIR A;  2FEZ A;  5TJJ A;  4L5J A;  2W24 A;  5IT3 A;  3FF5 A;  1GXQ A;  4L9T A;  3T8R A;  3K0L A;  2JSC A;  4F7Z A;  3V7S A;  3GFM A;  4BHB A;  3ABT A;  2PG4 A;  1TW3 A;  3Q9V A;  3REO A;  1Z6T A;  2G7H A;  4TV7 A;  3PQK A;  3FM5 A;  1ULY A;  4M9Z A;  4HX4 A;  4IRG A;  2ZCW A;  3FM3 A;  1SMY F;  1OYW A;  4M71 A;  2EV5 A;  3H3U A;  5F6F A;  1U2W A;  2A6E F;  2UWM A;  1UHW A;  1LDJ A;  3LA7 A;  3ZMS A;  3E5Q A;  2A69 F;  1K78 B;  2CFX A;  2H27 A;  5EEH A;  1IN8 A;  1R23 A;  1TQM A;  4N0B A;  3EUH A;  1W7P A;  4NQW A;  5HLG A;  5LHI A;  3DXJ F;  2L01 A;  4HF1 A;  1XDS A;  2STW A;  2NRA C;  3OOP A;  2IP2 A;  2J5P A;  3AAF A;  2VBZ A;  4DNC A;  1OR7 A;  2FOK A;  3FXR A;  3V8L A;  1E17 A;  1MKM A;  2D2W A;  5E1W A;  1KA8 A;  2BE5 F;  3VEP A;  3V4G A;  4PZJ A;  1MGT A;  4ZZL A;  1G3S A;  1G3W A;  3DFG A;  4A6D A;  2A07 F;  2ESN A;  4LLG F;  2NS0 A;  1R00 A;  4YIF A;  3LAJ A;  2J5O A;  2FSW A;  5TRD A;  2IPQ X;  3BJA A;  2ZNZ A;  1YW8 A;  3GO5 A;  2ZFW A;  3WTZ A;  2B0L A;  4WF2 A;  2KIF A;  1XCV A;  4HBL A;  1L3L A;  1J75 A;  4UNO A;  3W6K B;  1JHH A;  5HS7 A;  2PMU A;  4HX7 A;  1DDN A;  1BC7 C;  3GZ6 A;  1FZP B;  3SHF A;  2OQG A;  2L54 A;  2BEO A;  4P9U A;  2GXG A;  2OU2 A;  5L3B A;  4ESF A;  2DO7 A;  2OAZ A;  5JFR A;  5E17 F;  3F23 A;  3IHU A;  3C1D A;  3J81 Z;  4Z2Y A;  1ZGJ A;  1P92 A;  5K5Q A;  3M8F A;  1D8K A;  4I01 A;  2GQQ A;  1Z1D A;  3RYR A;  1XSX A;  3JAM Z;  3LA3 A;  1B9N A;  3V7R A;  5CJ9 A;  1ODD A;  2QQB A;  1LEB A;  2RDP A;  3FZV A;  4EJT A;  2K4B A;  4OIN F;  2G9W A;  1TQI A;  3V7C A;  4XRF A;  1SFE A;  4Q4Z F;  1ZLJ A;  1IXS B;  1HXD A;  3F8M A;  4HF0 A;  4P96 A;  2ETH A;  3K1N A;  2KJC A;  1YLF A;  2QBY A;  1Q1H A;  2DBB A;  2NNY A;  1MDM A;  2M45 A;  1HQC A;  4UV8 A;  3P9K A;  3T5X A;  1PP7 U;  2XRO A;  3TO9 A;  2VXZ A;  5IT9 K;  3EYI A;  1WRJ A;  5LHH A;  5D8K B;  3F6O A;  4YFN F;  4LK1 F;  3R4K A;  5CLS A;  1OYY A;  2F5E A;  1XD7 A;  4HLX A;  3WOD F;  4QWQ A;  1K6O A;  3EDP A;  5AON A;  3ZP5 A;  5LGT A;  2XKO A;  4UVC A;  3F3X A;  2OQR A;  2XAS A;  3SZT A;  4CYD A;  4EVI A;  3I53 A;  4EJU A;  4U88 A;  1CF7 A;  3QPT A;  4B8X A;  3WTS C;  4U0Y A;  2CGP A;  4GO1 A;  1T38 A;  1BI2 A;  5DCM A;  1SD4 A;  4KMF A;  1B4A A;  3MEX A;  3SXY A;  4A0Z A;  1YIO A;  1Z91 A;  4FHT A;  1H0M A;  4KMU X;  1IUY A;  2V1X A;  4MNU A;  1XB4 A;  3WE3 A;  2XUB A;  2QVO A;  1W5T A;  4H0E A;  2UZK A;  1LDD A;  4PGH A;  1RUO A;  2RN7 A;  3HTU A;  3TKY A;  1X3U A;  3O6B B;  3I54 A;  3GW2 A;  1UCR A;  1ZRF A;  2BGC A;  3ZMZ A;  2VC0 A;  2QLZ A;  1S6L A;  2QZ8 A;  2ADU A;  5E20 A;  1ZLK A;  1W7P B;  5DD8 A;  2F2E A;  4RGS A;  2VE8 A;  2UXN A;  1IW7 F;  4BXU A;  1TNT A;  2P4W A;  4CDG A;  1HSJ A;  5FD6 A;  2P6T A;  1G3Y A;  2H6B A;  4G8X A;  4EV0 A;  4CXF A;  4BAY A;  1PDN C;  2Z99 A;  2HTJ A;  1UHM A;  4KN4 X;  4L5I A;  5ICG A;  3IL2 A;  2XGX A;  1U78 A;  3KLN A;  1EH6 A;  1R7J A;  3M1E A;  3JW4 A;  2MD5 A;  4YFX F;  4WXD A;  4ETS A;  5L3E A;  3DEU A;  2L02 A;  2CYY A;  4I09 A;  4AD9 A;  2O6G E;  2VN2 A;  2ZJ2 A;  5EEG A;  1KYZ A;  3LAP A;  1FY7 A;  2RVC A;  4G6D A;  2EV0 A;  5DUK A;  5HLH A;  3KFW X;  4FX4 A;  2MA3 A;  2EFQ A;  1KU3 A;  4MEX F;  3WGI A;  3WTT C;  1BC8 C;  1K7A A;  1D3Y A;  4B09 A;  3JAM K;  2HFH A;  1Z05 A;  1CF7 B;  1P6R A;  4AIJ A;  1LEA A;  3HSF A;  4P9F A;  4LB6 B;  5E8G A;  1KU2 A;  2Q8K A;  2XAG A;  1HKQ A;  1FYK A;  1QPM A;  3WTY C;  1W4M A;  1KYW A;  1S8N A;  3LQR A;  3MAJ A;  3LQQ A;  5AIP A;  2ISY A;  1HST A;  3H3Z A;  4M9X A;  1XSD A;  5HOO A;  1FBU A;  3HRU A;  2RKH A;  1UB9 A;  5K5O A;  4HV5 A;  1FBQ A;  2EB7 A;  1P2F A;  4MQV A;  4Q5S F;  2YPR A;  3NRV A;  2IA1 A;  3T1B A;  3SQN A;  1ZAR A;  3S2W A;  4CZZ A;  2FA5 A;  5LRS A;  1XGS A;  2CQK A;  3E3V A;  3T8T A;  1IN4 A;  5JR3 A;  3ZN1 A;  1DUX C;  4G7Z F;  1VTN C;  3WG9 A;  3I58 A;  4A0X A;  4UVB A;  1MDM B;  1S3J A;  4G7H F;  5KK1 A;  4ZYG A;  1QQI A;  5E1Z B;  3FWE A;  3JTG A;  1O3R A;  3HOT A;  2K86 A;  4M6Y A;  2P7V B;  1JHF A;  4KT5 C;  5ICF A;  3J7A O;  2FE3 A;  1WI9 A;  4EM2 A;  3BP8 A;  1GHC A;  1MJA A;  1Z9C A;  4OIR F;  5DCM B;  5D5U B;  1V4R A;  2JZY A;  3KP6 A;  2A6H F;  2GZW A;  2H94 A;  2PFB A;  3OV8 A;  4A12 A;  1AOY A;  3BY6 A;  2F5D A;  2KIU A;  4ENM A;  3ISP A;  1YS6 A;  2VBY A;  3ULQ B;  3WU1 B;  2O0Y A;  4E70 A;  1ZG3 A;  3K9T A;  3F21 A;  3U9G A;  3O3K A;  4A5N A;  4LB5 A;  2Q2E A;  2MLG A;  6PAX A;  1DPU A;  1EH7 A;  2FXA A;  2W25 A;  3IKV A;  3BRO A;  3H92 A;  3K69 A;  3HSR A;  1RIO H;  3QAH A;  3BPV A;  4EJW A;  1IRG A;  2O03 A;  3L09 A;  2IW5 A;  1PUE E;  2WWY A;  5H6R A;  2LKP A;  3ECH A;  3RKY A;  1TW2 A;  2R7F A;  3SFZ A;  1FT9 A;  2P5L C;  1GXP A;  3KEO A;  1C0W A;  1YO5 C;  4GYG A;  1TNS A;  1WWX A;  2AXL A;  3I0T A;  5CVV A;  4AWX B;  1MJ9 A;  2YSR A;  2PBI A;  2R3S A;  3FXQ A;  5LRR A;  3N97 A;  4UXN A;  3DPT A;  3I71 A;  2W85 A;  3ML6 A;  5J8F A;  3U2R A;  3IRQ A;  4PCQ A;  2D45 A;  1RUN A;  2KJB A;  1YYV A;  4KDP A;  4XBF A;  1QNT A;  3FMQ A;  1UST A;  3P9C A;  3N4M A;  4IPA A;  4HDU A;  1P4W A;  4HW0 A;  1I27 A;  1KU9 A;  4MTE A;  5LHG A;  3KP2 A;  3NEU A;  2BV6 A;  3KP7 A;  2IVM A;  3WU0 A;  3L9F A;  2V1U A;  4Q48 A;  4RAZ A;  2ZXJ A;  3SZP A;  2GWR A;  1FP1 D;  1KGS A;  1F1Z A;  3NQO A;  2E1N A;  4OIQ F;  2XV4 S;  3F8F A;  3M9A A;  4KYW A;  3L7W A;  2M5W A;  3ECO A;  4ZYE A;  1T98 A;  1K78 A;  2QWW A;  3HUG A;  4ON0 A;  2YX4 A;  5ILU A;  1BIA A;  1T2K A;  2IA0 A;  5A2Q Z;  2HOE A;  3HTS B;  1U6G A;  2XHK A;  1DPR A;  1TBX A;  2DW4 A;  2X0L A;  4I7H A;  1U5T C;  2LNB A;  5BPI A;  4GYI A;  1XMA A;  5LEJ A;  1IZ1 A;  2ZME B;  1UFM A;  4LGW A;  4RB3 C;  1Z7U A;  2YR2 A;  3R0A A;  2DPD A;  1RZ4 A;  2HYG D;  3GF2 A;  3EYY A;  5E18 F;  1ZGA A;  3QP5 A;  3VFZ A;  2GA2 A;  4HA8 A;  3CTA A;  3TDZ C;  4EQQ A;  4S05 A;  5LEK A;  2HTS A;  2NNN A;  4I02 A;  1K79 A;  2FBI A;  3BPX A;  2M1B A;  3CDH A;  4HLY A;  2L4M A;  1P4A A;  1E2X A;  3KCC A;  2VOP A;  3ELK A;  4MTD A;  3RI4 A;  1FOK A;  2XKP A;  1S7A A;  4A2U A;  3I4P A;  4YII A;  1BI3 A;  1IN7 A;  1EH8 A;  1A04 A;  2OD5 A;  2P6S A;  1FX7 A;  3C3W A;  2LDU A;  3VOD A;  4M72 A;  3TO7 A;  4G7O F;  1NHA A;  4HYE A;  1ZAO A;  1XGN A;  2A3S A;  4CIC A;  3RYP A;  4MQ9 F;  2F5C A;  4L0Z B;  2XAJ A;  1G3T A;  4P5O A;  2AS5 F;  1ZRC A;  2QEN A;  2V6C A;  2GIV A;  4LD5 A;  1BM9 A;  4WXH A;  1OPC A;  1G4D A;  3J80 Z;  2P8T A;  1IXC A;  1XMK A;  2VBW A;  3TO6 A;  1FYM A;  1I6X A;  3WGG A;  4I0B A;  4GXO A;  2WV0 A;  2HKX A;  1XCB A;  4R8H A;  1FSH A;  1XGM A;  2DT5 A;  2XIG A;  2FNA A;  1PP8 F;  4L18 B;  2EA2 A;  3DQV C;  5D4R A;  5ERI A;  3RJP A;  2FF4 A;  2CSO A;  2HZT A;  5J6X A;  4CHU A;  1XN7 A;  1FWZ A;  1HKT A;  3F8C A;  1YFH A;  4D0P A;  3WE2 A;  3ERE D;  1FPQ A;  2JPC A;  3FMS A;  2V79 A;  3BZ6 A;  1HW1 A;  1J5Y A;  4EMS A;  4RGR A;  2FBK A;  5CVU A;  4U0V A;  3E5U A;  3GVA A;  4XLP F;  2HEO A;  4G94 A;  2DU9 A;  2O61 A;  3O2P E;  4EGZ A;  4M73 A;  1FNN A;  3IKT A;  3MZY A;  2R7D A;  2EFP A;  2Y48 A;  3R61 A;  1J0R A;  4LG0 A;  3TGN A;  2RGV A;  3QU6 A;  2DPU A;  4ENJ A;  2ACJ A;  2STT A;  1ZYR F;  3R60 A;  5LGN A;  4O5V A;  2EK5 A;  2IA2 A;  1LVA A;  4FT8 A;  1J9I A;  3HHH A;  5FO5 A;  2HQN A;  3FHZ A;  4GCV A;  1USS A;  1YW9 A;  3CUO A;  3I59 A;  1J2X A;  1O7F A;  2A68 F;  1T6S A;  1QGP A;  1LNW A;  4RS8 A;  3CLO A;  5D5V B;  3KE2 A;  4ESJ A;  4ZYH A;  3F22 A;  3IRR A;  3E6C C;  3CUQ C;  2JRT A;  5HS8 A;  2M30 A;  1GVJ A;  3WTW C;  3K1M A;  2A5Y B;  3WTV C;  3C7J A;  4A6E A;  4AIK A;  2ZME A;  2DFI A;  4I98 B;  4ENK A;  4BQA A;  5FLX K;  4JQF A;  2QBY B;  3P7N A;  4XSX F;  4QLC U;  1V3F A;  4KNY A;  4OIP F;  3D0S A;  3TDU C;  2YX7 A;  1T39 A;  2M8E A;  3HIF A;  3ZMU A;  1JE8 A;  3GFI A;  4Y17 A;  4JBA A;  4BH9 A;  2L3D A;  4L9N A;  3IWF A;  3D5L A;  5A2Q K;  2W57 A;  5BMZ A;  2E7W A;  3COA C;  5IT9 Z;  3DKW A;  4M74 A;  2QUF A;  4S04 A;  4XLN F;  4WXC A;  5D8L B;  4LFU A;  1STZ A;  4HF2 A;  3CUQ A;  2NAZ A;  4LK0 F;  2VON A;  4RAY A;  2LF8 A;  4L9V A;  2MH9 A;  3LWF A;  3ROU A;  2XRN A;  3BOQ A;  1B9M A;  1O3S A;  5L3F A;  2DK5 A;  3K2Z A;  5FD5 A;  2M87 A;  2QQ9 A;  4IF4 A;  1AWC A;  4EJO A;  2EV6 A;  2LF7 A;  1REP C;  1YW7 A;  2GA1 A;  2IRF G;  2RV8 A;  4A0Y A;  1R36 A;  2ZBK A;  1YG2 A;  2WC2 A;  4EM0 B;  2P5K A;  4KIG A;  2OBP A;  5ILS A;  4KIF A;  1WKM A;  2V1D A;  2WTE A;  1Y0U A;  2VOD A;  2V9V A;  3G73 A;  5H6Q A;  1QBJ A;  2JPB A;  3ZMV A;  5K5R A;  1O3Q A;  5L3G A;  4KUM A;  2C6Y A;  4MHG A;  3VB2 A;  3QRF F;  2KIM A;  1I5Z A;  3GEZ A;  2MC3 A;  2G7U A;  3BDD A;  2FML A;  2XAQ A;  3ZPL A;  2HWV A;  2JTV A;  5DV5 A;  2XAF A;  2L4A A;  1P4X A;  1SD7 A;  3DPL C;  4LMY A;  4Q47 A;  1B59 A;  4BHC A;  2VOO A;  3P9I A;  5DYM A;  4LG0 B;  2PLY A;  2DAO A;  4CO8 A;  3GLX A;  4OIO F;  4WK8 F;  1LQ1 A;  1HW5 A;  3V8K A;  3LA2 A;  4OOI A;  2Y0M A;  2MBF A;  1ZRD A;  1XDU A;  4DQ2 A;  1R1T A;  3GFL A;  3E5X A;  1F4K A;  5HVQ C;  1ON2 A;  4YFK F;  3CJN A;  2LSO A;  3JTH A;  3WGH A;  4BHP A;  1IRF A;  4AVP A;  3HRT A;  4WX9 A;  4HQE A;  3GWZ A;  5D6E A;  3Q5F A;  5HS9 A;  2FRH A;  4U7B A;  5KVR A;  1D8J A;  1G6N A;  4UV9 A;  4EGY A;  4HDV A;  2XAH A;  1IAW A;  2TDX A;  4U0W A;  5DCF A;  3WTU C;  4IJA A;  2FQ3 A;  4O3M A;  3QU3 A;  3QOP A;  1FSE A;  1R58 A;  2ISZ A;  1BOA A;  2Z5U A;  4HV6 A;  1LDK B;  1HBX G;  3HYI A;  1KQ8 A;  1BBY A;  4WCG A;  2ZKZ A;  5D5W B;  3TOB A;  2DK8 A;  4ZYD A;  1TLH B;  2O3F A;  3E6M A;  4AIH A;  3PQJ A;  1XSV A;  2IT0 A;  2XVC A;  3TOA A;  1QZZ A;  1R1V A;  1HW2 A;  2MH2 A;  3QP6 A;  4LJZ F;  3HSE A;  1WQ2 A;  2VC1 A;  2HKO A;  3KP3 A;  2QYO A;  3E6D A;  5E1X A;  4RGX A;  3ABU A;  4G9Y A;  4NHJ A;  1RNL A;  3F6V A;  3DP7 A;  4L0Y B;  2Z3Y A;  5LGU A;  1ZN2 A;  1S29 A;  4R1H A;  3BJO A;  3EET A;  1YQA A;  3BWG A;  2Z9O A;  2FNP A;  2DQR A;  2QQA A;  3CUQ B;  3RKW A;  1BI1 A;  3V8J A;  3RPU A;  1FYL A;  1IXR C;  4IHS A;  3HRS A;  1F9N A;  1WSU A;  1J7K A;  3F8N A;  2HS5 A;  2K4J A;  4ENN A;  4IRI A;  2O8X A;  1H9G A;  1QO0 D;  2NYX A;  2CG4 A;  2H09 A;  3M8E A;  1O3T A;  2ZNY A;  2CO5 A;  5DUI A;  2ELH A;  3DF8 A;  4HAM A;  5F64 A;  3GYH X;  2PJP A;  5JI6 A;  5D5X B;  1W5S A;  4UHT A;  5CVI A;  3ZMT A;  3I5U A;  4I2O A;  1T0F A;  2D1V A;  2FBH A;  1R1U A;  4UVA A;  2K27 A;  5ILV A;  4RB1 A;  2HR3 A;  3VOE A;  1O7L A;  1F5T A;  1U3E M;  5DEQ A;  3KLO A;  3ZMD A;  2VBX A;  1U8R A;  1MZB A;  1ON1 A;  2HYF A;  1D5V A;  5CVJ A;  3WTX C;  2PEX A;  3L00 A;  2EWN A;  2VT2 A;  2HGC A;  4CGZ A;  5L3C A;  4R79 A;  2H6C A;  1OYI A;  3C18 A;  2HDC A;  2ESH A;  2PI0 A;  3GZ5 A;  2GAU A;  1SMT A;  1JXS A;  5FB2 A;  5JVT A;  3E97 A;  2UXX A;  3MFK A;  3MWM A;  3IC7 A;  5FGM A;  1LB2 A;  4U7D A;  4FX0 A;  2BBY A;  4K2E A;  1KQ0 A;  2K7L A;  2KKO A;  5K1Y A;  2CWE A;  2GXB A;  5JHU A;  1MJB A;  2RQP A;  1S7O A;  3CO6 C;  5J8C A;  5ICE A;  3MQ0 A;  3RTR A;  3PFI A;  3HOS A;  1OKR A;  3I64 A;  3LFK A;  1OMI A;  2K02 A;  1RI7 A;  1SD6 A;  3K1P A;  2RNJ A;  2D1H A;  1TQP A;  1SD5 A;  2OZ6 A;  1H9T A;  3FMR A;  2Y75 A;  2DQL A;  1ZH5 A;  3KP5 A;  2OA4 A;  3B73 A;  2VE9 A;  1L0O C;  4A5M A;  5LBQ A;  1FLI A;  4KA4 A;  5ICC A;  4KN7 X;  5DDG A;  3F8B A;  3KEQ A;  4EM1 A;  2MLK A;  4YG2 F;  5D4S A;  2Z33 A;  1SFX A;  4ZH4 F;  1QZY A;  4P55 A;  5DD4 A;  3KET A;  4NB5 A;  2A61 A;  1YTY A;  3ZQ7 A;  3KP4 A;  4HQM A;  3TQN A;  3MCZ A;  1R5G A;  1KU7 A;  5F1R A;  3HRM A;  4IXA A;  3GUD A;  1HKS A;  4G6Q A;  2JT1 A;  2EFW A;  2DI3 A;  2OZU A;  2BYV E;  2X4H A;  4HOB A;  1ZHF A;  1KQ9 A;  2ZO4 A;  3J81 K;  1W7P D;  1FC3 A;  4IVN A;  2PMH A;  3R0J A;  4LLL A;  1DP7 P;  3MZH A;  2F5F A;  3JSP A;  1I1G A;  4M6X A;  1J59 A;  3CO7 C;  3DV8 A;  2IJL A;  1U5T B;  4Y15 A;  5BPD A;  1ZG5 A;  4ESB A;  5D6F A;  4RGU A;  5L3D A;  1BN5 A;  2PQ8 A;  2EJR A;  1BJA A;  3E6B A;  3GXO A;  1O57 A;  2FU4 A;  5H20 A;  2W84 A;  2QM3 A;  2COM A;  3QPH A;  3LST A;  4RB0 A;  1XGO A;  4ZZD A;  4LLN A;  5BS6 A;  1IN6 A;  4OMY A;  1FP2 A;  4IRH A;  5CYV A;  3R6S A;  1ONV A;  4RB2 C;  3BJ6 A;  1CGP A;  1U5T A;  1I1S A;  3ZN0 A;  1Z6R A;  4N9I A;  4BNC A;  3RDI A;  4IHT A;  3J80 K;  4EJV A;  3EQL F;  3L2C A;  4PGG A;  2VT3 A;  2P5V A;  2RC4 A;  4MEY F;  3RKX A;  2P7C B;  5ED4 A;  1BIB A;  5HDG A;  5FFX A;  1R22 A;  5HDN A;  2E7X A;  4KFC A;  3RPQ A;  3M7G A;  4MGR A;  3G3Z A;  4Y13 A;  3Q9S A;  5E8I A;  4HZF A;  5FLX Z;  1BI0 A;  1SFU A;  3IWZ A;  2FMY A;  5BOX A;  1MD0 A;  1IN5 A;  2DTR A;  3B02 A;  2EA4 A;  4PDK A;  4HX8 A;  2KRF A;  2YU3 A;  3KZZ A;  1JGS A;  4I0A A;  4M9S A;  3KZY A;  2CW0 F;  4WWC A;  3GX4 X;  3GFJ A;  1YS7 A;  1IF1 A;  5FFZ A;  1ZG1 A;  1SAX A;  4GGG A;  3U1D A;  4N9H A;  1B1B A;  4BYY A;  4KIB A;  2EFO A;  3HHG A;  2DLL A;  1FBS A;  1LJ9 A;  1EV7 A;  1B6A A;  2Q0O A;  3W6J B;  5LLQ A;  1R5H A;  5BQT A;  2E1C A;  4L9J A;  4OMZ A;  4JK1 X;  1ZRE A;  4XSZ F;  5HLI A;  3JSO A;  2PN6 A;  5AIQ A;  3FX3 A;  5CVR A;  3FXU A; 
#chains in the Genus database with same CATH topology
 3RCO A;  4UUV A;  3I59 B;  2EFN A;  5HDK A;  2PMZ A;  2XC7 A;  2QSF X;  4KIS A;  3T0Y A;  2QSG X;  4O6J A;  3FXK A;  2DTZ A;  3CCV I;  4I76 A;  4KIC A;  4ASN A;  1TTY A;  3F72 A;  4OU0 A;  2HQR A;  1Z77 A;  4XQF A;  1LVK A;  3OMY A;  3RIR A;  4XID A;  2FEZ A;  5TJJ A;  4L5J A;  2L9N A;  2W24 A;  5IT3 A;  3FF5 A;  1QHG A;  1GXQ A;  4L9T A;  3BR6 A;  3T8R A;  2V4J C;  3K0L A;  2JSC A;  3X2Q H;  4XLC A;  4F7Z A;  3S1M J;  1OFC X;  3V7S A;  3GFM A;  4II3 A;  4BHB A;  3ABT A;  2PG4 A;  5B1B H;  4DYC A;  1TW3 A;  3Q9V A;  3REO A;  1Z6T A;  2G7H A;  4TV7 A;  3PQK A;  3FM5 A;  3ZQF A;  2IXS A;  4Y7N J;  1B72 A;  1ULY A;  4M9Z A;  4BEH A;  1Z21 A;  4HX4 A;  4PUS A;  2MAB A;  4IRG A;  4AYB N;  2ZCW A;  1MBJ A;  3FM3 A;  4XN0 A;  4DW6 A;  5J1Y A;  4XON A;  5K7F A;  1BOB A;  3C2B A;  3C2H A;  1SMY F;  1OYW A;  4M71 A;  4UUT A;  1QVT A;  5DM7 F;  3DTK A;  3H36 A;  2EV5 A;  1BL0 A;  3H3U A;  5F6F A;  3BLY A;  1U2W A;  2A6E F;  2UWM A;  1UHW A;  1LDJ A;  5CKT A;  3LA7 A;  2Q1Z B;  2L7M P;  3ZMS A;  3E5Q A;  2A69 F;  1K78 B;  2CFX A;  2H27 A;  2R93 J;  5EEH A;  3DU5 A;  1IN8 A;  1R23 A;  2DMN A;  3A0H C;  1TQM A;  1FMW A;  4N0B A;  4BY7 J;  3EUH A;  1CQT A;  1W7P A;  4NQW A;  1SFO J;  2TRT A;  5HLG A;  2ELJ A;  2CJJ A;  3DXJ F;  5LHI A;  2L01 A;  4M3G A;  3HGG A;  4HF1 A;  1XDS A;  2QKL B;  3FDY A;  3KYD B;  2STW A;  5KCM A;  5EZG A;  2NRA C;  3OOP A;  2IP2 A;  2J5P A;  3H5A A;  2A05 A;  2BHZ A;  1X4O A;  5F0H A;  2VBZ A;  2ICW G;  1OJL A;  1OR7 A;  4DNC A;  3AAF A;  2FOK A;  2NXN B;  3FXR A;  3V8L A;  1E17 A;  1MKM A;  3Q3S A;  4XR6 A;  3S14 J;  1QHH D;  1RET A;  2D2W A;  5IOY A;  3FXJ A;  3DTI A;  5E1W A;  1KA8 A;  2BE5 F;  4G12 A;  2HNH A;  1YX5 A;  5EZH A;  3VEP A;  3V4G A;  4PZJ A;  1MGT A;  4ZZL A;  1G3S A;  3IUO A;  2B9S A;  1G3W A;  2EIM H;  3DFG A;  2NVQ J;  4A6D A;  1WVR A;  1Y6I A;  1OCO H;  2A07 F;  3S17 J;  4HST A;  1WJF A;  2ESN A;  4MIM A;  4LLG F;  2E1M C;  2K85 A;  2VJ4 A;  3S16 J;  4A3M J;  2NS0 A;  1FJL A;  1R00 A;  2XB5 A;  3SZG A;  4YIF A;  3LAJ A;  2J5O A;  2FSW A;  5TRD A;  1UG2 A;  2EIL H;  2CU7 A;  4FET A;  4XL9 A;  2IPQ X;  3BJA A;  1AHD P;  2ZNZ A;  4C3I J;  1YW8 A;  3GO5 A;  2ZFW A;  3WTZ A;  1VF9 A;  2E2I J;  2B0L A;  4WF2 A;  2KIF A;  3AL0 C;  1W1W E;  4BS9 A;  3S32 A;  3RPU D;  1XCV A;  4HBL A;  4XRS G;  4AUX A;  1L3L A;  1J75 A;  4UNO A;  4A3C J;  1MIJ A;  2E71 A;  4DZP A;  2LMD A;  1JHH A;  1U9O A;  3DEE A;  3W6K B;  4ZJZ A;  2DOE A;  2R7T A;  2NVX J;  3S15 J;  5HS7 A;  2PMU A;  4HX7 A;  1HDP A;  3RQI A;  1JUS A;  3KZI C;  1DDN A;  1BC7 C;  2DDA A;  3GZ6 A;  1UJ8 A;  1IV6 A;  4RLF A;  1VQP I;  1FZP B;  3SHF A;  2OQG A;  2CQN A;  2L54 A;  3K70 D;  1X19 A;  2BEO A;  3OSG A;  4P9U A;  1WH7 A;  2GXG A;  3ABK H;  3PNY A;  2OU2 A;  5L3B A;  3DU6 A;  4ESF A;  1R4N B;  1GV5 A;  2K5C A;  3HXL A;  2L9S A;  2DO7 A;  4ZDP A;  5GAG J;  2OAZ A;  5JFR A;  5DM6 F;  3UR3 C;  4X1E A;  3PO3 J;  2OTL I;  5E17 F;  2TCT A;  1QA6 A;  3F23 A;  5C44 J;  4E7J A;  3IHU A;  4BKX A;  3CCL I;  3C1D A;  3J81 Z;  4Z2Y A;  1ZGJ A;  1HCR A;  4PFP A;  1P92 A;  5K5Q A;  1DP3 A;  3OYN A;  4RM2 A;  3M8F A;  3VYR B;  5J47 A;  2R7S A;  2WB1 N;  1D8K A;  4I01 A;  2NS8 A;  2GQQ A;  1Z1D A;  4BJ5 C;  1Z0X A;  1XC5 A;  4QTR A;  3RYR A;  1XSX A;  3JAM Z;  3LA3 A;  1B9N A;  5F27 A;  3GTP J;  2I5U A;  3V7R A;  5CJ9 A;  1ODD A;  5FKL A;  2QQB A;  1LEB A;  2RDP A;  1U0J A;  2W82 A;  3FZV A;  2K4B A;  4OIN F;  4EJT A;  2G9W A;  2WBM A;  1UAA A;  2L7Z A;  1TQI A;  2M7B A;  3V7C A;  4XRF A;  3DLA A;  1SFE A;  2X51 A;  4Q4Z F;  3ESW B;  1ZLJ A;  2ID3 A;  1IXS B;  1T33 A;  1HXD A;  2R5Z A;  3HJE A;  3F8M A;  1DU6 A;  4HF0 A;  4P96 A;  2ETH A;  3VPR A;  1R9T J;  3K1N A;  2R0Q C;  2H1L A;  2KJC A;  1YLF A;  4PK4 A;  2H1K A;  2QBY A;  1Q1H A;  2LY1 A;  3CDI A;  4IL6 C;  2ZXH A;  2DBB A;  1MNM C;  3FK7 A;  3QQA A;  5J1R A;  2NNY A;  1MDM A;  2LYC A;  5LD2 C;  2M45 A;  2K9M A;  2JA5 J;  1HQC A;  3V42 A;  5JLW A;  3UKG A;  1H89 C;  3J7A Y;  4UV8 A;  3P9K A;  3T5X A;  1PP7 U;  1XPX A;  2IS1 A;  2XRO A;  3TO9 A;  1BR4 A;  2BW3 B;  2VXZ A;  1YE9 A;  5IT9 K;  3EYI A;  1YOV B;  3ABM H;  1WRJ A;  4YEL A;  5LHH A;  5D8K B;  3JR9 A;  3F6O A;  4YFN F;  4J19 A;  2FOW A;  4LK1 F;  3R4K A;  5CLS A;  1OYY A;  2F5E A;  1D1A A;  4IZZ A;  1W36 C;  2PMZ N;  4S0H B;  1XD7 A;  4XKV A;  4NUB A;  4HLX A;  3WOD F;  4QWQ A;  2LY9 A;  1K6O A;  3TP0 A;  1RRJ A;  4BXF A;  3EDP A;  2KMU A;  4XM3 A;  5K7H A;  2FX0 A;  5AON A;  2H8W A;  3K4C A;  4W1U A;  2JN6 A;  3ZP5 A;  5LGT A;  2XKO A;  4UVC A;  4DIQ A;  3F3X A;  2OQR A;  5C3E J;  2XAS A;  3SZT A;  4BE1 A;  1Z7L A;  4CYD A;  4EVI A;  1ENH A;  2EH3 A;  3I53 A;  2DYS H;  2F48 A;  4EJU A;  4U88 A;  1CF7 A;  3QPT A;  2LG4 A;  5EGO A;  4B8X A;  3WTS C;  1I39 A;  4U0Y A;  3RZO J;  2CGP A;  4GO1 A;  4PSX A;  1T38 A;  4BBS J;  1BI2 A;  5DCM A;  3M1C A;  1SD4 A;  4KMF A;  1B4A A;  3MEX A;  3SXY A;  3LSI A;  4A0Z A;  1R4M B;  1YIO A;  5F04 A;  1Z91 A;  4FHT A;  5M3F J;  2HI3 A;  1H0M A;  4KMU X;  1IUY A;  2V1X A;  4MNU A;  1XB4 A;  3WE3 A;  2XUB A;  2QVO A;  1W5T A;  4V2G A;  4H0E A;  3WG7 H;  2UZK A;  1LDD A;  4PGH A;  3IP4 B;  1RUO A;  5CQE A;  2RN7 A;  3HTU A;  4PFO A;  3L2R A;  3SEQ A;  3TKY A;  1X3U A;  2LOO A;  2V7F A;  3O6B B;  3I54 A;  3GW2 A;  4A3D J;  1UCR A;  1ZRF A;  3BR1 A;  2BGC A;  3ZMZ A;  3JRD A;  2VC0 A;  2QLZ A;  1S6L A;  2MFZ A;  2IS4 A;  3HC7 A;  2QZ8 A;  3W6V A;  2WAE A;  2ADU A;  2COB A;  2X9D A;  3OOU A;  3PNV A;  5E20 A;  1VQ9 I;  1ZLK A;  1W7P B;  5DD8 A;  2F2E A;  5TIS C;  4RGS A;  2VE8 A;  3GTK J;  2UXN A;  4UY8 I;  1IW7 F;  3K4N A;  4BXU A;  4KIT B;  2XAU A;  1W0T A;  2IEK A;  1TNT A;  2P4W A;  2X6X A;  4CDG A;  3KYC B;  1HSJ A;  5FD6 A;  2P6T A;  1G3Y A;  4UUS A;  2VB6 A;  3JRF A;  2H6B A;  3GTO J;  2BXY A;  2F5V A;  3I3L A;  4G8X A;  1AU7 A;  5HOD A;  4EV0 A;  4CXF A;  4A93 J;  1SVM A;  1B8I A;  4BAY A;  1PDN C;  1MBH A;  2DOA A;  2Z99 A;  1S5L C;  2HTJ A;  1UHM A;  4KN4 X;  4L5I A;  5ICG A;  3IL2 A;  2XGX A;  2Y2Z A;  3HG9 A;  1U78 A;  3KLN A;  1EH6 A;  2CRG A;  1R7J A;  3M1E A;  3CCU I;  3JW4 A;  2MD5 A;  4NNJ A;  3ZQH A;  4YFX F;  4II2 A;  2JWT A;  1AKH B;  4XNF A;  4WXD A;  4ETS A;  5L3E A;  3D5S C;  1JKO C;  2HXI A;  3AG1 H;  3CZ6 A;  1Y8R B;  2L02 A;  3DEU A;  5FRO A;  2CYY A;  2LRE A;  3LOC A;  4I09 A;  4AD9 A;  2O6G E;  4F93 B;  4E7K A;  2VN2 A;  2ZJ2 A;  5EEG A;  1KYZ A;  3LAP A;  2O5R A;  3CMY A;  1Z3X A;  1FY7 A;  2RVC A;  5E3M A;  1X58 A;  2EV0 A;  4G6D A;  5DUK A;  2WAQ A;  2O8K A;  4A69 C;  1FOY A;  5HLH A;  3KFW X;  4AID A;  1A35 A;  3DPU A;  4FX4 A;  5GTI C;  2MA3 A;  2EFQ A;  2EIK H;  3TMO A;  1KU3 A;  4IO9 F;  3WGI A;  4MEX F;  3GTQ J;  3WTT C;  1BC8 C;  1K7A A;  2CUJ A;  5EF6 A;  1I3A A;  2E60 A;  1D3Y A;  1K6Y A;  4IX7 A;  5KAI C;  4B09 A;  3JAM K;  2HFH A;  1OCT C;  1ZR2 A;  3OS0 A;  1Z05 A;  3HGY A;  1CF7 B;  3QYE A;  4H4K C;  1P6R A;  1IJW C;  4AIJ A;  1D1B A;  1LEA A;  3HSF A;  4P9F A;  4LB6 B;  5E8G A;  1KU2 A;  3A2K A;  2KZV A;  3I55 I;  2LBF A;  2CQQ A;  1XX5 A;  2Q8K A;  2XAG A;  5FKK A;  2VJJ A;  1HKQ A;  1FYK A;  1QPM A;  1AKH A;  3WTY C;  1W4M A;  3BG9 A;  1RC9 A;  1KYW A;  2JQ7 A;  1P9Q C;  1S8N A;  1PUF A;  3LQR A;  3MAJ A;  3LQQ A;  4AU7 A;  4CA0 A;  5AIP A;  1SFK A;  3W3C A;  4F91 B;  2IBD A;  5J3L A;  2ISY A;  1HST A;  2ZJQ F;  2M3A A;  3CCS I;  3H3Z A;  4PJJ A;  1JI8 A;  3BZK A;  4M9X A;  4JOM A;  2HOA A;  1OQY A;  1XSD A;  1N25 A;  2M2E A;  5HOO A;  1FBU A;  3HRU A;  3GBG A;  2Z16 A;  1EF4 A;  2RKH A;  3DTE A;  1UB9 A;  1QRY A;  1TWF J;  4HV5 A;  5K5O A;  3K4J A;  1MMS A;  2ZC2 A;  2HQ5 A;  1FBQ A;  5E3O A;  3CF5 F;  1YRN B;  2Y9Y A;  3MKL A;  2EB7 A;  1P2F A;  4MQV A;  4Q5S F;  3LFU A;  2YPR A;  3NRV A;  2IA1 A;  3T1B A;  3SQN A;  1ZAR A;  3S2W A;  4CZZ A;  2JMW A;  2FA5 A;  5LRS A;  1XGS A;  3VYT B;  5FLM J;  1YJ9 I;  2CQK A;  3E3V A;  3T8T A;  1IN4 A;  4A3K J;  3J7Y J;  5JR3 A;  3OYK A;  3ZN1 A;  4BL0 B;  1DUX C;  2HZD A;  4G7Z F;  3K4K A;  2ZXI A;  2LKX A;  1VTN C;  3WG9 A;  4F55 A;  3I58 A;  3OIO A;  1V54 H;  2OJE D;  4A0X A;  4UVB A;  1MDM B;  3H0G J;  1S3J A;  4G7H F;  2XF5 A;  5KK1 A;  1E3H A;  1QQI A;  5E1Z B;  4ZYG A;  2VI6 A;  2DT7 B;  3FWE A;  4UB6 C;  3JTG A;  4EAT A;  3S93 A;  1O3R A;  2KFD A;  2L7K A;  5B66 C;  3Q0U A;  4E6K G;  3QYF A;  3HOT A;  2K86 A;  4M6Y A;  1YIJ I;  4B43 A;  2P7V B;  4Y3O A;  3G6E I;  4ZDL A;  1HOM A;  1JHF A;  1XS9 A;  2CW7 A;  4PJL A;  4KT5 C;  5ICF A;  2VXD A;  3LNQ A;  1OCP A;  4YRV A;  3J7A O;  3LSK A;  2X6Y A;  2FE3 A;  3O8G A;  1WI9 A;  2K9Q A;  4EM2 A;  3BP8 A;  1ZEL A;  4BJ6 C;  1MJA A;  4BE2 A;  1Z9C A;  1GHC A;  1D5Y A;  3K4M A;  4OIR F;  3GCM A;  3A01 B;  2N8G A;  2K3P A;  1ETY A;  5DCM B;  4AYB A;  5D5U B;  3EUK L;  1V4R A;  2JZY A;  3KP6 A;  2A6H F;  2GZW A;  5IYC J;  2H94 A;  4M3E A;  2PFB A;  3OV8 A;  4A12 A;  1AOY A;  1SAN A;  1MH3 A;  2E34 A;  3BY6 A;  2F5D A;  2KIU A;  5FRN A;  3PL8 A;  4Y33 A;  3Q0W A;  2M8G X;  4ENM A;  1WHU A;  3CCM I;  3ISP A;  1YS6 A;  2VBY A;  3ULQ B;  4MFE A;  2XGD A;  1K83 J;  1QZE A;  3WU1 B;  1ZKG A;  2O0Y A;  4E70 A;  1ZG3 A;  4FAS D;  3K9T A;  3F21 A;  1UMQ A;  2E36 A;  1WCM J;  3O8H A;  3VSK A;  3U9G A;  1H88 C;  2VQH A;  4JYK A;  1EA3 A;  3OYF A;  3O3K A;  2E2J J;  4A5N A;  1HLV A;  4LB5 A;  2JA6 J;  2Q2E A;  2MLG A;  6PAX A;  1DPU A;  1WPK A;  5C4J J;  1EH7 A;  2ZFU A;  3G4S I;  2FXA A;  2W25 A;  5J4Y A;  4W97 A;  2M4K A;  4CCL A;  2DOF A;  2O9L A;  2DMU A;  3IKV A;  3BRO A;  3H92 A;  2KQR A;  3K69 A;  3HSR A;  1HDD C;  4MO7 A;  3HKZ N;  1JKR C;  4IOA F;  2EZL A;  3QAH A;  1RIO H;  3BPV A;  2G0E A;  4EJW A;  1IRG A;  2EQR A;  3LL7 A;  1OCZ H;  2O03 A;  3L09 A;  3OR1 C;  2IW5 A;  3OIQ A;  1PUE E;  2WWY A;  5H6R A;  3JRA A;  3CC7 I;  2VL8 A;  2LKP A;  3CJQ B;  2MSY A;  5GP9 A;  3ECH A;  1LFU P;  3RKY A;  2K9S A;  1TW2 A;  2R7F A;  3SFZ A;  1FT9 A;  2HU9 A;  5J40 A;  4IOC F;  4DYR A;  2P5L C;  1GXP A;  3KEO A;  1C0W A;  1YO5 C;  1IG7 A;  2CQX A;  2EZK A;  2WV1 A;  4GYG A;  1TNS A;  2NVU B;  3VYS B;  1WWX A;  4BDZ A;  2AXL A;  4XOT A;  3IAM 2;  2DFH A;  2ECC A;  3I0T A;  1MJ9 A;  2X85 A;  2YSR A;  5CVV A;  3A03 A;  3S8P A;  2R4G A;  4AWX B;  4CYC B;  3OS2 A;  2PBI A;  2DA3 A;  2L9R A;  2EIJ H;  2DXI A;  4NC6 A;  2LC2 A;  2R3S A;  3FXQ A;  5LRR A;  3N97 A;  4UXN A;  3DPT A;  3OYA A;  4A3I J;  3I71 A;  1YIT I;  3ZCO A;  3OYI A;  2DJN A;  2W85 A;  3ML6 A;  5J8F A;  3U2R A;  1G2H A;  3IRQ A;  2CUF A;  4PCQ A;  2D45 A;  1RUN A;  2KJB A;  1YYV A;  3JRH A;  4C3J J;  4KDP A;  4XBF A;  1QNT A;  3FMQ A;  2NVT J;  3K7A J;  2L7F P;  2LR8 A;  1UST A;  3P9C A;  3N4M A;  3IH3 A;  1XMX A;  1RES A;  4IPA A;  2ZSI B;  3TW7 A;  3ERM A;  2A6T A;  4HDU A;  1P4W A;  1WH5 A;  1LKX A;  4HW0 A;  1I27 A;  1KU9 A;  3IH2 A;  4MTE A;  5LHG A;  2VKV A;  2AQE A;  2IGK A;  2NOJ B;  3KP2 A;  4PJM A;  3DKX A;  4RDU A;  3NEU A;  3L2V A;  2DFE A;  3SEZ A;  2BV6 A;  3KP7 A;  2IVM A;  3WU0 A;  1IRX A;  2VAS A;  3L9F A;  4CCO A;  2V1U A;  4Q48 A;  1T56 A;  4RAZ A;  4BUP A;  2ZXJ A;  3SZP A;  2F4M B;  3W2W A;  3HOW J;  2GWR A;  1FP1 D;  4BEH B;  3CCY A;  5EG0 A;  3KEY A;  1KGS A;  3DEW A;  1F1Z A;  3NQO A;  2E1N A;  4OIQ F;  2XV4 S;  3F8F A;  3M9A A;  1BR2 A;  4KYW A;  2W48 A;  3L7W A;  4ZYA A;  1VQL I;  1SC7 A;  1XTA A;  2M5W A;  3ECO A;  2GXA A;  4ZYE A;  1T98 A;  1JKQ C;  1K78 A;  2LRD A;  2QWW A;  3HUG A;  3OL4 A;  1ZGW A;  4ON0 A;  2YX4 A;  2QKM B;  3G1L A;  5ILU A;  1BIA A;  3H0D A;  1T2K A;  2IA0 A;  5A2Q Z;  2MGQ A;  2HOE A;  1K4T A;  2K3F A;  4IEJ A;  1ORK A;  3HTS B;  2DMQ A;  3H1C A;  1XG1 A;  1U6G A;  2XHK A;  1JT6 A;  1DPR A;  1TBX A;  4J00 A;  2DW4 A;  2X0L A;  3HBL A;  4I7H A;  1U5T C;  2JVG A;  2LNB A;  2YS9 A;  3S3N A;  5BPI A;  3BT9 A;  1VI0 A;  1X3W B;  1LPQ A;  2LD5 A;  4GYI A;  1XMA A;  5LEJ A;  5EEA A;  1IZ1 A;  2MC4 A;  3LSG A;  2ZME B;  3BTI A;  2DCE A;  2RRE A;  3EUA A;  1UFM A;  4LGW A;  2E5Z A;  3M8J A;  1FMV A;  4RB3 C;  4A3G J;  4X0G A;  2B63 J;  1Z7U A;  1FTT A;  2YR2 A;  2BXZ A;  1F43 A;  1VQ7 I;  3R0A A;  2DPD A;  1RZ4 A;  2HYG D;  1MSE C;  1JTX A;  3GF2 A;  3EYY A;  2R5Y A;  2HYJ A;  5E18 F;  1P7J A;  1ZGA A;  3QP5 A;  3VFZ A;  2GA2 A;  1IUF A;  4HA8 A;  5GPC A;  5M5Y J;  3CTA A;  1NG7 A;  3TDZ C;  4EQQ A;  2Y69 H;  4S05 A;  1BA5 A;  2DFF A;  3GTJ J;  2CH0 A;  5B1A H;  5LEK A;  2HTS A;  2NNN A;  4I02 A;  4Y4R A;  1K79 A;  1ERD A;  2VKD A;  2FBI A;  1TT5 B;  4AC0 A;  3CJR B;  3RKQ A;  2R92 J;  1ETQ A;  3PIP F;  3CLQ A;  4P1W A;  3BPX A;  1WJ5 A;  2M1B A;  4IQ4 A;  3CDH A;  4HLY A;  2DYR H;  1WJB A;  2L4M A;  2I8D A;  1P4A A;  5B3S H;  1E2X A;  3KCC A;  4PJ0 C;  2VOP A;  3LSH A;  2A5W A;  2VJI A;  3ELK A;  1A5J A;  1S7E A;  3G2B A;  4MTD A;  3RI4 A;  1FOK A;  3BQZ A;  2XKP A;  1S7A A;  4CCM A;  3CMA I;  2QCO A;  3I4P A;  4A2U A;  4YII A;  1BI3 A;  1IN7 A;  1EH8 A;  1A04 A;  3PFY A;  2X1E A;  3AFH A;  2OD5 A;  5F0C A;  2P6S A;  1FX7 A;  3C3W A;  2LDU A;  3VOD A;  4M72 A;  3TO7 A;  2CV2 A;  4G7O F;  3VSL A;  3HUG B;  1LE8 A;  1NHA A;  3VDX A;  4HYE A;  1ZAO A;  1XGN A;  2A3S A;  4XRM A;  4CIC A;  3RYP A;  2LVS A;  4IHX A;  4MQ9 F;  4XMY A;  1OIS A;  2JA2 A;  2F5C A;  4L0Z B;  2XAJ A;  3S1N J;  2JJ7 A;  1IRZ A;  1G3T A;  1MMD A;  4P5O A;  4XRS A;  3BQY A;  2CW8 A;  2AS5 F;  2E5N A;  5CPR B;  1ZRC A;  3LSJ A;  2QEN A;  3CC4 I;  2GLO A;  2L9V A;  2V6C A;  3ABL H;  3S3M A;  2LY2 A;  2GIV A;  1JGG A;  4E7S A;  4LD5 A;  1BM9 A;  4WXH A;  1OPC A;  1G4D A;  1Y8Q B;  1Z67 A;  3J80 Z;  2P8T A;  1IXC A;  3BTL A;  2XGE A;  1SEU A;  1XMK A;  2VBW A;  3OYC A;  1GV2 A;  5JHF A;  2LK2 A;  3LSP A;  3JCU C;  3TO6 A;  1ETK A;  1I6X A;  3WGG A;  1FYM A;  3ZQQ A;  3MN2 A;  5J4V A;  4I0B A;  4GXO A;  2WV0 A;  2HKX A;  1XCB A;  2K9N A;  4R8H A;  5M5X J;  1FSH A;  1XGM A;  2DT5 A;  3F9K A;  4DBQ A;  4F52 A;  4LIU A;  2XIG A;  3FK6 A;  2ZB9 A;  2X1D A;  2FNA A;  1PP8 F;  4L18 B;  2EA2 A;  3DQV C;  2KLO A;  4I99 C;  5D4R A;  4FE4 A;  1D0Y A;  5ERI A;  2QEX I;  4DZJ A;  1DGW Y;  1WJE A;  3RJP A;  3MZ8 A;  1ITY A;  2R7V A;  2FF4 A;  4ZTF A;  1W36 D;  2XB0 X;  3H9G A;  3OY9 A;  4BGD A;  1VQM I;  2CSO A;  2F4I A;  2HZT A;  4ANJ A;  2NVY J;  3CCJ I;  2DT6 A;  5J6X A;  2IGN A;  1XN7 A;  3ASN H;  4CHU A;  3HDD A;  1FWZ A;  1HKT A;  4CYC A;  3F8C A;  5M5W J;  4E7L A;  5DTD A;  3H35 A;  4J01 A;  1YFH A;  5IY5 H;  1R49 A;  4D0P A;  4RLQ A;  3WE2 A;  1BR1 A;  1FPQ A;  3ERE D;  1FOX A;  2JPC A;  4IHY A;  2L5Q A;  1JUP A;  2BY1 A;  3FMS A;  3BG3 A;  3I4M J;  3NWT A;  2V79 A;  4NC7 A;  1Y39 A;  3BZ6 A;  2V6E A;  5GPA A;  2AHQ A;  4ZTJ A;  3BCA A;  4OAZ A;  1HW1 A;  2JUC A;  2MD0 A;  1J5Y A;  5EYR A;  4EMS A;  4RGR A;  2FBK A;  5CVU A;  2M34 A;  4U0V A;  2WAQ N;  3E5U A;  4B47 A;  4IQJ A;  3GVA A;  3PUF A;  3CCQ I;  2OCE A;  3G1O A;  4XLP F;  2HEO A;  2HXO A;  1FIA A;  4G94 A;  2DU9 A;  4C30 A;  4AVZ A;  1TC3 C;  1K61 A;  2O61 A;  5GAD J;  4C2M J;  1IC8 A;  3O2P E;  4V2F A;  4CCN A;  3BG6 A;  4EGZ A;  3FXL A;  4M73 A;  5EJC A;  2RAE A;  1FNN A;  1ZQ3 P;  2QQ8 A;  4NBQ A;  3IKT A;  3MZY A;  2R7D A;  2EFP A;  3HPG A;  3EUH C;  1BW5 A;  1MSF C;  4AM3 A;  3E1S A;  2Y48 A;  3R61 A;  2XDV A;  1J0R A;  4LG0 A;  2X6W A;  2R7X A;  1RKW A;  3HM5 A;  3TGN A;  2W00 A;  4HG2 A;  4B48 A;  4NDL A;  2RGV A;  3QU6 A;  2DPU A;  1FIP A;  4BAC A;  3ZQI A;  4ENJ A;  4ZC3 A;  3I4N J;  1UG0 A;  2ACJ A;  2STT A;  4RMN A;  1ZYR F;  3R60 A;  5LGN A;  4O5V A;  1SVO A;  2EK5 A;  2VLA A;  5CQG A;  2IA2 A;  2R7W A;  5F08 A;  5DS9 A;  1G59 A;  5IOZ A;  3LSR A;  1LVA A;  3H9J A;  4FT8 A;  1J9I A;  3HHH A;  5FO5 A;  2CUE A;  2HQN A;  3FHZ A;  2DJI A;  4GCV A;  3P5J A;  1USS A;  3CD6 I;  3IH4 A;  1YW9 A;  5JLX A;  5FKO A;  3CUO A;  1QU3 A;  3I59 A;  4G6T B;  1J2X A;  1O7F A;  2A68 F;  2KHM A;  1T6S A;  1X1C A;  1T08 B;  1QGP A;  2WAD A;  5E79 C;  1LNW A;  4RAG A;  4RS8 A;  3CLO A;  3W2A A;  1SVL A;  2GBY A;  5IP9 J;  5D5V B;  5EG0 B;  3KE2 A;  3MVP A;  5HNH A;  3MKY B;  4ESJ A;  1A6I A;  4ZYH A;  3F22 A;  2RNG A;  3IRR A;  3E6C C;  1MBF A;  3CUQ C;  2JRT A;  1GLN A;  3OYL A;  2JA7 J;  4N4N B;  5HS8 A;  2AXT C;  2LKS A;  2M30 A;  1VQK I;  3HOZ J;  1GVJ A;  3U1K A;  3K4L A;  3WTW C;  3ZXS A;  3K1M A;  3GTL J;  3G1M A;  2A5Y B;  2DMP A;  3WTV C;  1GDT A;  3C7J A;  3CMM A;  2V9P A;  4A6E A;  1S72 I;  2VQL A;  4FQG A;  4AIK A;  1TWC J;  2ZME A;  2DFI A;  4I98 B;  4ENK A;  1X1A A;  4BQA A;  5FLX K;  4NQW B;  5F0F A;  4JQF A;  2QBY B;  3M4O J;  2KDO A;  3JRE A;  4QIW N;  3P7N A;  2JSP A;  4XSX F;  2GOX B;  4ABZ A;  9ANT A;  1OCC H;  3TL4 X;  4QLC U;  2VJ5 A;  1V3F A;  2FUG 2;  4KNY A;  4OIP F;  3D0S A;  3TDU C;  2YX7 A;  1T39 A;  2JRM A;  3CC2 I;  2M8E A;  3HIF A;  3ZMU A;  2LP0 A;  1JE8 A;  3GFI A;  4JX6 A;  4XN3 A;  4Y17 A;  4FTH A;  1GT0 C;  1WI3 A;  4CZC A;  4JBA A;  1POG A;  3A1Y A;  4BH9 A;  2L3D A;  4L9N A;  2IAI A;  3D5L A;  3IWF A;  4JX4 A;  5A2Q K;  2W57 A;  5BMZ A;  4XLF A;  2E7W A;  3COA C;  4XOP A;  5IT9 Z;  3DKW A;  4M74 A;  2QUF A;  4S04 A;  4XLN F;  4BU2 A;  4WXC A;  5D8L B;  3ZR8 X;  5F1J A;  2XF6 A;  3IAS 2;  4LFU A;  1STZ A;  1PJR A;  4HF2 A;  2FQ4 A;  3CUQ A;  2NAZ A;  2EZI A;  4LK0 F;  2VON A;  3A4C A;  4RAY A;  3D1N I;  2X6O A;  4CUG A;  2LF8 A;  3QYB A;  2XGC A;  1ACI A;  3DWL E;  2KPM A;  4L9V A;  2MH9 A;  4FCY A;  3CP2 A;  1OLT A;  3PSF A;  3LWF A;  3KIO A;  3ROU A;  2R5Y B;  2VQG A;  2X1C A;  1J09 A;  2XRN A;  4LIT A;  3ZQL A;  4C3H J;  3BOQ A;  1B9M A;  1O3S A;  3OYB A;  2IS6 A;  5L3F A;  2DK5 A;  4B4C A;  2OV7 A;  4BDY A;  3E7L A;  3K2Z A;  2L2O A;  2DA1 A;  5FD5 A;  3LMM A;  2HPI A;  1X4P A;  2M87 A;  2WA0 A;  4XKB A;  2QQ9 A;  3E0J B;  4IF4 A;  1X1D A;  2XPW A;  4NC8 A;  1AWC A;  4E7I A;  3SDB A;  1MMA A;  4EJO A;  3OYJ A;  1YRN A;  2EV6 A;  1LE8 B;  2LF7 A;  2OCC H;  5IYB J;  1REP C;  1YW7 A;  2GA1 A;  2IRF G;  2RV8 A;  4A0Y A;  5TGT A;  1R36 A;  2ZBK A;  1YG2 A;  2WC2 A;  4EM0 B;  2F4O B;  3NAU A;  2P5K A;  4D5F A;  3BG7 A;  4KIG A;  2KRC A;  2OBP A;  3BR2 A;  3BG5 A;  5ILS A;  3GTM J;  4KIF A;  4HRI A;  2JA8 J;  3ZQC A;  1WKM A;  3IV5 A;  3QOE A;  2V1D A;  2WTE A;  1Y0U A;  2VOD A;  3DLL F;  3FXO A;  3ONQ A;  3SYT A;  2Y0S N;  2V9V A;  3G73 A;  4LIV A;  5H6Q A;  1QBJ A;  1FTZ A;  2JPB A;  3ZMV A;  5K5R A;  1O3Q A;  5L3G A;  4KUM A;  2HQA A;  2C6Y A;  2EBI A;  1X3Z B;  4MHG A;  3VB2 A;  2VKH A;  2WB1 A;  3QRF F;  2KIM A;  1AA7 A;  2H8R A;  1I5Z A;  1NH3 A;  3GEZ A;  1VQ5 I;  4XLH A;  1R5I D;  2OUM A;  2MC3 A;  2DDB A;  2R5Z B;  2G7U A;  2HVS A;  3BDD A;  4CCJ A;  2FML A;  5KNL A;  2XAQ A;  4B3X A;  3ZPL A;  2HWV A;  2BVM A;  2JTV A;  5FKM A;  3PUB A;  5DV5 A;  2XAF A;  3NAR A;  1X1P A;  2L4A A;  3M3Y J;  1P4X A;  4XKC A;  1SD7 A;  1NG6 A;  3DPL C;  4LMY A;  4Q47 A;  4RBO A;  1B59 A;  2M7A A;  4HSR A;  2AQF A;  2ZSH B;  1BW6 A;  4BHC A;  2DA7 A;  3N05 A;  2VOO A;  3P9I A;  2M4G A;  5DYM A;  3W2V A;  4LG0 B;  2PLY A;  2DAO A;  4CO8 A;  4XK4 A;  3GLX A;  4D9J A;  3AG3 H;  1TWG J;  3BR5 A;  4BQN A;  4OIO F;  4WK8 F;  1LQ1 A;  1HW5 A;  3V8K A;  1V55 H;  3LA2 A;  4D7N A;  2KP6 A;  1PUF B;  2KT0 A;  1JTY A;  4XIC A;  4OOI A;  5BNG A;  1APL C;  5FKN A;  2DA6 A;  2GOM A;  2Y0M A;  2MBF A;  2OPT A;  1ZRD A;  3BTJ A;  3DKY A;  1VQN I;  1XDU A;  4DQ2 A;  5C4X J;  1W5C C;  1R1T A;  3B6C A;  1F36 A;  3GFL A;  3E5X A;  1F4K A;  5HVQ C;  1EKE A;  3CME I;  1ON2 A;  4YFK F;  1P7I A;  5IPA A;  3EPZ A;  4XLA A;  5EDN A;  3FBI B;  3FKI J;  3CJN A;  1X2M A;  2LSO A;  2FD5 A;  1MBG A;  3JTH A;  3WGH A;  4BHP A;  4F92 B;  1IRF A;  4AVP A;  3HRT A;  5FLV A;  2CQ7 A;  4WX9 A;  4HQE A;  3ZQG A;  2ME0 A;  3PM1 A;  4HNT A;  1ETO A;  3GWZ A;  2L0K A;  5D6E A;  3Q5F A;  5HS9 A;  1U8B A;  1A31 A;  2FRH A;  4U7B A;  3CQZ J;  1N78 A;  5KVR A;  2R7O A;  4IHW A;  4BQO A;  2F6C A;  2LTP A;  3A02 A;  3ZGK A;  2I10 A;  1D8J A;  2UV1 A;  1LUJ B;  1G6N A;  2ZXW H;  1UHS A;  4UV9 A;  4EGY A;  4HDV A;  2XAH A;  2Y9Z A;  2OC6 A;  3HOU J;  1V5F A;  3HL2 A;  5J1U A;  1IAW A;  2TDX A;  4U0W A;  3DBH B;  1KZH A;  2BY0 A;  5DCF A;  2QGU A;  1WGX A;  3WTU C;  4V19 K;  2DMT A;  1YHQ I;  2XRL A;  4IJA A;  3CJT B;  2KDZ A;  3K4B A;  2E1M B;  2Y30 A;  1IDY A;  1YI2 I;  2FQ3 A;  4MFD A;  5KHD A;  4O3M A;  3QU3 A;  1ETV A;  3QOP A;  4C2T A;  3RQ4 A;  1FSE A;  1R58 A;  2E19 A;  4LOC A;  2ISZ A;  3HPH A;  3JRG A;  1BOA A;  2K40 A;  2Z5U A;  5GTH C;  4HNU A;  4HV6 A;  1LDK B;  5FJ8 J;  3CP8 A;  1HBX G;  1UEL B;  3WHB A;  3HYI A;  2CUZ A;  1KQ8 A;  1BBY A;  2WY8 Q;  3OYH A;  1I6H J;  4WCG A;  2EIN H;  3FIS A;  2Y0S A;  2ZKZ A;  5D5W B;  1MNE A;  3TOB A;  2DN0 A;  2DK8 A;  3S1Q J;  4ZYD A;  1TLH B;  2O3F A;  3K6G A;  3E6M A;  3PQJ A;  4AIH A;  1XSV A;  3H5N A;  2IT0 A;  2XVC A;  3TOA A;  4BY1 J;  3LSM A;  4DOZ A;  2DA4 A;  5GAE J;  1VQ8 I;  4YEJ A;  3NWS A;  1VQ6 I;  1QZZ A;  1R1V A;  1HF0 A;  1HW2 A;  2MH2 A;  1JKP C;  3QP6 A;  2HVQ A;  4LJZ F;  3HSE A;  1WQ2 A;  3HOY J;  2VC1 A;  3TP3 A;  2HKO A;  4BE0 A;  3KP3 A;  2R7Z J;  2QYO A;  3E6D A;  5E1X A;  2XF7 A;  4RGX A;  1RR7 A;  5EGO B;  3ABU A;  3JRI A;  4G9Y A;  4U87 A;  4NHJ A;  3VYU B;  3PIO F;  3FXM A;  4M3D A;  1RNL A;  3F6V A;  3DP7 A;  4L0Y B;  1TZL A;  2Z3Y A;  5LGU A;  4C9Y A;  1ZN2 A;  2ZJP F;  1S29 A;  4R1H A;  3BJO A;  3EET A;  1YQA A;  2DA5 A;  3BWG A;  3ZOB A;  3ZRG A;  1ZTR A;  2Z9O A;  3BR0 A;  1W0U A;  4PSW A;  2FNP A;  2DQR A;  1ETW A;  2R7Q A;  2QQA A;  3WU2 C;  3L2W A;  3CUQ B;  3RKW A;  2HDW A;  4FIS A;  5IYD J;  1BI1 A;  1FOW A;  3V8J A;  3SJM A;  3RPU A;  2HOS A;  1FYL A;  4BQQ A;  2HOT A;  1IXR C;  3U21 A;  4GDF A;  4IHS A;  3HRS A;  1F9N A;  3OWT A;  4B1R A;  1WSU A;  1J7K A;  3F8N A;  2BVL A;  2HS5 A;  2K4J A;  3GLL A;  4ENN A;  3OYD A;  3QPS A;  1JUM A;  2BHY A;  1NK2 P;  4IRI A;  1T8I A;  2O8X A;  1H9G A;  4DBR A;  1I50 J;  1QO0 D;  2NYX A;  2CG4 A;  2H09 A;  3M8E A;  2X48 A;  1O3T A;  2ZME C;  2ZNY A;  2CO5 A;  5DUI A;  2OTJ I;  1MND A;  2ELH A;  3AL0 B;  3DF8 A;  4HAM A;  5F64 A;  3GYH X;  2Y31 A;  4M3F A;  2PJP A;  5JI6 A;  1TT0 A;  5D5X B;  1W5S A;  4UHT A;  2VKE A;  5CVI A;  3ZMT A;  4M3B A;  1WJD A;  3I5U A;  1Y1V J;  4I2O A;  1T0F A;  5K7Z A;  1T0F C;  4M6V A;  2D1V A;  2FBH A;  1R1U A;  1MW7 A;  4UVA A;  1GUU A;  2K27 A;  3GTG J;  5ILV A;  4A3F J;  4E7H A;  1Q1V A;  4RB1 A;  2HR3 A;  3VOE A;  4PJN A;  1O7L A;  1F5T A;  4KT6 A;  1ZR4 A;  5DEQ A;  1U3E M;  3KLO A;  3ZMD A;  2IGM A;  2VBX A;  5IP7 J;  2P81 A;  1U8R A;  4E4H A;  2Q2E B;  3HZJ A;  1QVU A;  1MZB A;  3H5R A;  1ON1 A;  2HYF A;  1DGR M;  1MH4 A;  3GZN B;  3BCB A;  3SFI A;  1HC8 A;  1WFX A;  1D5V A;  2LH9 A;  4RA2 A;  2WAF A;  5CVJ A;  3WTX C;  2IS2 A;  2PEX A;  3L00 A;  2XPV A;  2EWN A;  1YJW I;  2VT2 A;  3SDG A;  3OR2 C;  3G71 I;  2HGC A;  4CGZ A;  2VPR A;  4R79 A;  5L3C A;  2H6C A;  1OR7 C;  1OYI A;  1WJA A;  2NOG A;  4X6A J;  3C18 A;  3GME A;  3L2Q A;  2HDC A;  3FBN B;  1NK3 P;  2O7O A;  2ESH A;  2PI0 A;  3GZ5 A;  3MKW B;  2HVR A;  2GAU A;  3H9Q A;  3AG2 H;  1GVD A;  3QOD A;  1SMT A;  3H3V K;  4QSH A;  1JXS A;  5FB2 A;  2DOD A;  5JVT A;  4HEA 2;  1E3P A;  3E97 A;  2UXX A;  3MFK A;  4A3B J;  5HLT A;  1RPW A;  4D7M A;  3MWM A;  3IC7 A;  5FGM A;  3CCE I;  2ID6 A;  3CDL A;  3MD2 A;  4Z6Y A;  1HA8 A;  2XSD C;  2LLK A;  4U7D A;  1LB2 A;  1WZ2 A;  2BY3 A;  3AG4 H;  4FX0 A;  4ZDO A;  2BBY A;  3KYL A;  4K2E A;  1KQ0 A;  2QF7 A;  2LBF B;  3A0B C;  1U9N A;  1B8I B;  2K7L A;  4QPQ A;  3OYG A;  2KKO A;  5K1Y A;  1N75 A;  2CWE A;  2ME6 A;  2GXB A;  3A01 A;  2QSH X;  4UUS B;  5JHU A;  1MJB A;  1IV8 A;  4XOR A;  2RQP A;  1S7O A;  3CO6 C;  5J8C A;  5ICE A;  2CMP A;  3MQ0 A;  3RTR A;  3CES A;  3PFI A;  4UB8 C;  5GAH J;  3HOS A;  1OKR A;  3DBR B;  2M0C A;  3I64 A;  3LFK A;  1OMI A;  3S3O A;  2YU9 J;  2K02 A;  1RI7 A;  1SD6 A;  2UUZ A;  2KL4 A;  3K1P A;  2BOL A;  2XSJ C;  2RNJ A;  1S9H A;  2D1H A;  4GRI A;  1TQP A;  1SD5 A;  5IP6 A;  3AKZ A;  2OZ6 A;  1H9T A;  5KAF C;  3FMR A;  1IDZ A;  2Y75 A;  4BJT A;  2DQL A;  2Z2S B;  1ZH5 A;  3OYE A;  2OF7 A;  1MBE A;  3KP5 A;  1MMG A;  2OA4 A;  1SAU A;  3B73 A;  2GIZ A;  2VE9 A;  3DBL B;  4IHV A;  1LFB A;  3S2D J;  4YIR X;  2GM4 A;  1PVE A;  2ELK A;  1L0O C;  2E2H J;  4A5M A;  1VFC A;  5LBQ A;  2P0W A;  1V5E A;  1FLI A;  1Z3Y A;  3OL3 A;  4KA4 A;  4QPO A;  5ICC A;  1YX3 A;  1PYV A;  4KN7 X;  3L1P A;  5DDG A;  3F0C A;  3F8B A;  2M0M A;  2K9L A;  3S1R J;  3KEQ A;  3BTC A;  2MYS A;  2MLK A;  4DYQ A;  1OCR H;  2E35 A;  4EM1 A;  3JRC A;  4YG2 F;  3CF2 A;  5D4S A;  2Z33 A;  3HB9 A;  1SFX A;  4ZH4 F;  1QZY A;  1Y56 A;  4P55 A;  2V26 A;  5DD4 A;  1FEX A;  3KET A;  4NB5 A;  1DU0 A;  4RM3 A;  2A61 A;  1YTY A;  1KON A;  4B44 A;  3ZQ7 A;  2ECB A;  3KP4 A;  4JX5 A;  4HQM A;  3TQN A;  1D1C A;  5FRM A;  3MCZ A;  1R5G A;  3Q0V A;  4B3A A;  1KU7 A;  2HDD A;  5F1R A;  3HRM A;  4IXA A;  4BBR J;  3GUD A;  1HKS A;  4G6Q A;  4FE7 A;  1D0Z A;  4BXX J;  1A36 A;  2V9K A;  2VUM J;  2EPF A;  3PJR A;  2JT1 A;  2EFW A;  2DI3 A;  2OZU A;  2VIX A;  1VQO I;  2BYV E;  1TWA J;  3L2U A;  2FJ1 A;  2X4H A;  3D5R C;  2EZH A;  3QWL A;  4JP0 A;  4HOB A;  1ZHF A;  3FHN A;  1KQ9 A;  2ZO4 A;  4HNV A;  2W1O A;  3J81 K;  3CCR I;  1W7P D;  1FC3 A;  4IVN A;  2PMH A;  3R0J A;  4LLL A;  3J7Z I;  3HKZ A;  1DP7 P;  4N4O B;  3K70 C;  3MZH A;  2F5F A;  2W7N A;  3JSP A;  1I1G A;  1K4S A;  4M6X A;  1J59 A;  1NTC A;  1LFP A;  4D5C A;  3CO7 C;  3DV8 A;  3TBI A;  4A3L J;  2IJL A;  2D5V A;  1U5T B;  4Y15 A;  5BPD A;  2RQQ A;  3HEF A;  3I9V 2;  1ZG5 A;  4ESB A;  3RSN A;  2CFO A;  5D6F A;  4CH7 A;  4RGU A;  5L3D A;  3QPL A;  1TL8 A;  1V5G A;  1BN5 A;  2PQ8 A;  1D0X A;  1G8X A;  2EJR A;  4A3E J;  1A6Q A;  1BJA A;  1Y0N A;  2ZJR F;  3E6B A;  2MW8 A;  3GXO A;  1O57 A;  1JJ8 C;  2BZT A;  3WHC A;  2FU4 A;  5H20 A;  2W84 A;  2B7E A;  2QM3 A;  2COM A;  3QPH A;  1B72 B;  2DA2 A;  4IKF A;  3LST A;  3OIP A;  4RB0 A;  1RR8 C;  1MMN A;  3BC8 A;  1ETX A;  2CS3 A;  2HPM A;  1XGO A;  4E7Z A;  4ZZD A;  4LLN A;  5BS6 A;  2KZG A;  2MG4 A;  1IN6 A;  4OMY A;  4EEF G;  1FP2 A;  5E3N A;  4IRH A;  5CYV A;  3R6S A;  3RZD J;  2WY7 Q;  4XLE A;  2M9H A;  1UZC A;  1ONV A;  4RB2 C;  1H8A C;  3KPH A;  2AO9 A;  3BJ6 A;  3ASO H;  4ITV A;  1ZK8 A;  1CGP A;  1N77 A;  1MBK A;  1U5T A;  3HOX J;  1I1S A;  3PSI A;  3S2H J;  3ZN0 A;  4OWR B;  4HPQ A;  1Z6R A;  2CV1 A;  5M3M J;  2JUG A;  4N9I A;  1M1E B;  5B5E C;  4BNC A;  3RDI A;  4IHT A;  2R7U A;  1VND A;  3OSF A;  3J80 K;  3BZC A;  4EJV A;  4I6Z A;  1WJC A;  3EQL F;  2PJR A;  3L2C A;  1VZ0 A;  3OYM A;  5E3L A;  4PGG A;  2VT3 A;  2IGO A;  2PJR B;  3PO2 J;  1DQU A;  2P5V A;  2RC4 A;  4MEY F;  3RKX A;  4DGW B;  2P7C B;  1R6R A;  2Z1D A;  5ED4 A;  4MLO A;  1BIB A;  3K10 A;  1IO2 A;  1X1B A;  4DJA A;  5HDG A;  2KRH A;  5FFX A;  2E1O A;  3FKJ A;  1R22 A;  5HDN A;  5HNF A;  4C2U A;  2E7X A;  4KFC A;  3RPQ A;  3KX2 A;  2VPL A;  1RKT A;  3M07 A;  4RAF A;  4OAY A;  3DCF A;  3M7G A;  4MGR A;  3G3Z A;  3K2A A;  1BJZ A;  1YJN I;  4A3J J;  4Y13 A;  3Q9S A;  5E8I A;  1O4X A;  2CV0 A;  4GFB A;  4D1Q A;  4HZF A;  3OS1 A;  5FLX Z;  1BI0 A;  4Y52 J;  1SFU A;  3JRB A;  2JK3 A;  4XKW A;  2NS7 A;  1E3O C;  3IWZ A;  1JT0 A;  5H2F C;  2FMY A;  5BOX A;  1MD0 A;  4CSW A;  1IN5 A;  5JVG F;  3MMY B;  4LG3 A;  2DTR A;  4CCK A;  3B02 A;  2EA4 A;  1IGN A;  4PDK A;  3TED A;  4HX8 A;  2KRF A;  2YU3 A;  3KZZ A;  1R71 A;  2KIQ A;  2LFB A;  1JGS A;  1TP4 A;  4I0A A;  2R7R A;  4M9S A;  1I3Q J;  3KZY A;  2JVH A;  2CW0 F;  4F3Q A;  4WWC A;  3GX4 X;  1TWH J;  3GFJ A;  5LFA A;  1YS7 A;  1VQ4 I;  5FFZ A;  1IF1 A;  2KIS A;  1ZG1 A;  1SAX A;  3PNT A;  2YUS A;  4KJZ A;  4GGG A;  3U1D A;  3BR3 A;  4N9H A;  1B1B A;  4BYY A;  4KIB A;  2EFO A;  3HHG A;  3I56 I;  4L5E A;  2XPU A;  2DLL A;  1FBS A;  1LJ9 A;  1EV7 A;  3B6A A;  3TW6 A;  1B6A A;  2Q0O A;  3W6J B;  5LLQ A;  1R5H A;  5BQT A;  1T95 A;  2W4S A;  2E1C A;  4L9J A;  4OMZ A;  4JK1 X;  2V1N A;  1Y1W J;  1ZRE A;  2PX9 A;  2QA4 I;  3MKZ A;  1JJ6 C;  3HOV J;  1E0E A;  3VWB A;  1X2N A;  2BW3 A;  3FIW A;  4XSZ F;  1EJ9 A;  2BY2 A;  2VQC A;  2PN6 A;  3C2G A;  5AIQ A;  5HLI A;  3UNG C;  3FX3 A;  5CVR A;  3JSO A;  1QPI A;  3FXU A; 
#chains in the Genus database with same CATH homology
 4UUV A;  3I59 B;  2EFN A;  5HDK A;  3T0Y A;  4O6J A;  4KIC A;  4ASN A;  1TTY A;  3F72 A;  4OU0 A;  2HQR A;  3RIR A;  2FEZ A;  5TJJ A;  4L5J A;  2W24 A;  5IT3 A;  3FF5 A;  1GXQ A;  4L9T A;  3T8R A;  3K0L A;  2JSC A;  4F7Z A;  3V7S A;  3GFM A;  4BHB A;  3ABT A;  2PG4 A;  1TW3 A;  3Q9V A;  3REO A;  1Z6T A;  2G7H A;  4TV7 A;  3PQK A;  3FM5 A;  1ULY A;  4M9Z A;  4HX4 A;  4IRG A;  2ZCW A;  3FM3 A;  1SMY F;  1OYW A;  4M71 A;  2EV5 A;  3H3U A;  5F6F A;  1U2W A;  2A6E F;  2UWM A;  1UHW A;  1LDJ A;  3LA7 A;  3ZMS A;  3E5Q A;  2A69 F;  1K78 B;  2CFX A;  2H27 A;  5EEH A;  1IN8 A;  1R23 A;  1TQM A;  4N0B A;  3EUH A;  1W7P A;  4NQW A;  5HLG A;  5LHI A;  3DXJ F;  2L01 A;  4HF1 A;  1XDS A;  2STW A;  2NRA C;  3OOP A;  2IP2 A;  2J5P A;  3AAF A;  2VBZ A;  4DNC A;  1OR7 A;  2FOK A;  3FXR A;  3V8L A;  1E17 A;  1MKM A;  2D2W A;  5E1W A;  1KA8 A;  2BE5 F;  3VEP A;  3V4G A;  4PZJ A;  1MGT A;  4ZZL A;  1G3S A;  1G3W A;  3DFG A;  4A6D A;  2A07 F;  2ESN A;  4LLG F;  2NS0 A;  1R00 A;  4YIF A;  3LAJ A;  2J5O A;  2FSW A;  5TRD A;  2IPQ X;  3BJA A;  2ZNZ A;  1YW8 A;  3GO5 A;  2ZFW A;  3WTZ A;  2B0L A;  4WF2 A;  2KIF A;  1XCV A;  4HBL A;  1L3L A;  1J75 A;  4UNO A;  3W6K B;  1JHH A;  5HS7 A;  2PMU A;  4HX7 A;  1DDN A;  1BC7 C;  3GZ6 A;  1FZP B;  3SHF A;  2OQG A;  2L54 A;  2BEO A;  4P9U A;  2GXG A;  2OU2 A;  5L3B A;  4ESF A;  2DO7 A;  2OAZ A;  5JFR A;  5E17 F;  3F23 A;  3IHU A;  3C1D A;  3J81 Z;  4Z2Y A;  1ZGJ A;  1P92 A;  5K5Q A;  3M8F A;  1D8K A;  4I01 A;  2GQQ A;  1Z1D A;  3RYR A;  1XSX A;  3JAM Z;  3LA3 A;  1B9N A;  3V7R A;  5CJ9 A;  1ODD A;  2QQB A;  1LEB A;  2RDP A;  3FZV A;  4EJT A;  2K4B A;  4OIN F;  2G9W A;  1TQI A;  3V7C A;  4XRF A;  1SFE A;  4Q4Z F;  1ZLJ A;  1IXS B;  1HXD A;  3F8M A;  4HF0 A;  4P96 A;  2ETH A;  3K1N A;  2KJC A;  1YLF A;  2QBY A;  1Q1H A;  2DBB A;  2NNY A;  1MDM A;  2M45 A;  1HQC A;  4UV8 A;  3P9K A;  3T5X A;  1PP7 U;  2XRO A;  3TO9 A;  2VXZ A;  5IT9 K;  3EYI A;  1WRJ A;  5LHH A;  5D8K B;  3F6O A;  4YFN F;  4LK1 F;  3R4K A;  5CLS A;  1OYY A;  2F5E A;  1XD7 A;  4HLX A;  3WOD F;  4QWQ A;  1K6O A;  3EDP A;  5AON A;  3ZP5 A;  5LGT A;  2XKO A;  4UVC A;  3F3X A;  2OQR A;  2XAS A;  3SZT A;  4CYD A;  4EVI A;  3I53 A;  4EJU A;  4U88 A;  1CF7 A;  3QPT A;  4B8X A;  3WTS C;  4U0Y A;  2CGP A;  4GO1 A;  1T38 A;  1BI2 A;  5DCM A;  1SD4 A;  4KMF A;  1B4A A;  3MEX A;  3SXY A;  4A0Z A;  1YIO A;  1Z91 A;  4FHT A;  1H0M A;  4KMU X;  1IUY A;  2V1X A;  4MNU A;  1XB4 A;  3WE3 A;  2XUB A;  2QVO A;  1W5T A;  4H0E A;  2UZK A;  1LDD A;  4PGH A;  1RUO A;  2RN7 A;  3HTU A;  3TKY A;  1X3U A;  3O6B B;  3I54 A;  3GW2 A;  1UCR A;  1ZRF A;  2BGC A;  3ZMZ A;  2VC0 A;  2QLZ A;  1S6L A;  2QZ8 A;  2ADU A;  5E20 A;  1ZLK A;  1W7P B;  5DD8 A;  2F2E A;  4RGS A;  2VE8 A;  2UXN A;  1IW7 F;  4BXU A;  1TNT A;  2P4W A;  4CDG A;  1HSJ A;  5FD6 A;  2P6T A;  1G3Y A;  2H6B A;  4G8X A;  4EV0 A;  4CXF A;  4BAY A;  1PDN C;  2Z99 A;  2HTJ A;  1UHM A;  4KN4 X;  4L5I A;  5ICG A;  3IL2 A;  2XGX A;  1U78 A;  3KLN A;  1EH6 A;  1R7J A;  3M1E A;  3JW4 A;  2MD5 A;  4YFX F;  4WXD A;  4ETS A;  5L3E A;  3DEU A;  2L02 A;  2CYY A;  4I09 A;  4AD9 A;  2O6G E;  2VN2 A;  2ZJ2 A;  5EEG A;  1KYZ A;  3LAP A;  1FY7 A;  2RVC A;  4G6D A;  2EV0 A;  5DUK A;  5HLH A;  3KFW X;  4FX4 A;  2MA3 A;  2EFQ A;  1KU3 A;  4MEX F;  3WGI A;  3WTT C;  1BC8 C;  1K7A A;  1D3Y A;  4B09 A;  3JAM K;  2HFH A;  1Z05 A;  1CF7 B;  1P6R A;  4AIJ A;  1LEA A;  3HSF A;  4P9F A;  4LB6 B;  5E8G A;  1KU2 A;  2Q8K A;  2XAG A;  1HKQ A;  1FYK A;  1QPM A;  3WTY C;  1W4M A;  1KYW A;  1S8N A;  3LQR A;  3MAJ A;  3LQQ A;  5AIP A;  2ISY A;  1HST A;  3H3Z A;  4M9X A;  1XSD A;  5HOO A;  1FBU A;  3HRU A;  2RKH A;  1UB9 A;  5K5O A;  4HV5 A;  1FBQ A;  2EB7 A;  1P2F A;  4MQV A;  4Q5S F;  2YPR A;  3NRV A;  2IA1 A;  3T1B A;  3SQN A;  1ZAR A;  3S2W A;  4CZZ A;  2FA5 A;  5LRS A;  1XGS A;  2CQK A;  3E3V A;  3T8T A;  1IN4 A;  5JR3 A;  3ZN1 A;  1DUX C;  4G7Z F;  1VTN C;  3WG9 A;  3I58 A;  4A0X A;  4UVB A;  1MDM B;  1S3J A;  4G7H F;  5KK1 A;  4ZYG A;  1QQI A;  5E1Z B;  3FWE A;  3JTG A;  1O3R A;  3HOT A;  2K86 A;  4M6Y A;  2P7V B;  1JHF A;  4KT5 C;  5ICF A;  3J7A O;  2FE3 A;  1WI9 A;  4EM2 A;  3BP8 A;  1GHC A;  1MJA A;  1Z9C A;  4OIR F;  5DCM B;  5D5U B;  1V4R A;  2JZY A;  3KP6 A;  2A6H F;  2GZW A;  2H94 A;  2PFB A;  3OV8 A;  4A12 A;  1AOY A;  3BY6 A;  2F5D A;  2KIU A;  4ENM A;  3ISP A;  1YS6 A;  2VBY A;  3ULQ B;  3WU1 B;  2O0Y A;  4E70 A;  1ZG3 A;  3K9T A;  3F21 A;  3U9G A;  3O3K A;  4A5N A;  4LB5 A;  2Q2E A;  2MLG A;  6PAX A;  1DPU A;  1EH7 A;  2FXA A;  2W25 A;  3IKV A;  3BRO A;  3H92 A;  3K69 A;  3HSR A;  1RIO H;  3QAH A;  3BPV A;  4EJW A;  1IRG A;  2O03 A;  3L09 A;  2IW5 A;  1PUE E;  2WWY A;  5H6R A;  2LKP A;  3ECH A;  3RKY A;  1TW2 A;  2R7F A;  3SFZ A;  1FT9 A;  2P5L C;  1GXP A;  3KEO A;  1C0W A;  1YO5 C;  4GYG A;  1TNS A;  1WWX A;  2AXL A;  3I0T A;  5CVV A;  4AWX B;  1MJ9 A;  2YSR A;  2PBI A;  2R3S A;  3FXQ A;  5LRR A;  3N97 A;  4UXN A;  3DPT A;  3I71 A;  2W85 A;  3ML6 A;  5J8F A;  3U2R A;  3IRQ A;  4PCQ A;  2D45 A;  1RUN A;  2KJB A;  1YYV A;  4KDP A;  4XBF A;  1QNT A;  3FMQ A;  1UST A;  3P9C A;  3N4M A;  4IPA A;  4HDU A;  1P4W A;  4HW0 A;  1I27 A;  1KU9 A;  4MTE A;  5LHG A;  3KP2 A;  3NEU A;  2BV6 A;  3KP7 A;  2IVM A;  3WU0 A;  3L9F A;  2V1U A;  4Q48 A;  4RAZ A;  2ZXJ A;  3SZP A;  2GWR A;  1FP1 D;  1KGS A;  1F1Z A;  3NQO A;  2E1N A;  4OIQ F;  2XV4 S;  3F8F A;  3M9A A;  4KYW A;  3L7W A;  2M5W A;  3ECO A;  4ZYE A;  1T98 A;  1K78 A;  2QWW A;  3HUG A;  4ON0 A;  2YX4 A;  5ILU A;  1BIA A;  1T2K A;  2IA0 A;  5A2Q Z;  2HOE A;  3HTS B;  1U6G A;  2XHK A;  1DPR A;  1TBX A;  2DW4 A;  2X0L A;  4I7H A;  1U5T C;  2LNB A;  5BPI A;  4GYI A;  1XMA A;  5LEJ A;  1IZ1 A;  2ZME B;  1UFM A;  4LGW A;  4RB3 C;  1Z7U A;  2YR2 A;  3R0A A;  2DPD A;  1RZ4 A;  2HYG D;  3GF2 A;  3EYY A;  5E18 F;  1ZGA A;  3QP5 A;  3VFZ A;  2GA2 A;  4HA8 A;  3CTA A;  3TDZ C;  4EQQ A;  4S05 A;  5LEK A;  2HTS A;  2NNN A;  4I02 A;  1K79 A;  2FBI A;  3BPX A;  2M1B A;  3CDH A;  4HLY A;  2L4M A;  1P4A A;  1E2X A;  3KCC A;  2VOP A;  3ELK A;  4MTD A;  3RI4 A;  1FOK A;  2XKP A;  1S7A A;  4A2U A;  3I4P A;  4YII A;  1BI3 A;  1IN7 A;  1EH8 A;  1A04 A;  2OD5 A;  2P6S A;  1FX7 A;  3C3W A;  2LDU A;  3VOD A;  4M72 A;  3TO7 A;  4G7O F;  1NHA A;  4HYE A;  1ZAO A;  1XGN A;  2A3S A;  4CIC A;  3RYP A;  4MQ9 F;  2F5C A;  4L0Z B;  2XAJ A;  1G3T A;  4P5O A;  2AS5 F;  1ZRC A;  2QEN A;  2V6C A;  2GIV A;  4LD5 A;  1BM9 A;  4WXH A;  1OPC A;  1G4D A;  3J80 Z;  2P8T A;  1IXC A;  1XMK A;  2VBW A;  3TO6 A;  1FYM A;  1I6X A;  3WGG A;  4I0B A;  4GXO A;  2WV0 A;  2HKX A;  1XCB A;  4R8H A;  1FSH A;  1XGM A;  2DT5 A;  2XIG A;  2FNA A;  1PP8 F;  4L18 B;  2EA2 A;  3DQV C;  5D4R A;  5ERI A;  3RJP A;  2FF4 A;  2CSO A;  2HZT A;  5J6X A;  4CHU A;  1XN7 A;  1FWZ A;  1HKT A;  3F8C A;  1YFH A;  4D0P A;  3WE2 A;  3ERE D;  1FPQ A;  2JPC A;  3FMS A;  2V79 A;  3BZ6 A;  1HW1 A;  1J5Y A;  4EMS A;  4RGR A;  2FBK A;  5CVU A;  4U0V A;  3E5U A;  3GVA A;  4XLP F;  2HEO A;  4G94 A;  2DU9 A;  2O61 A;  3O2P E;  4EGZ A;  4M73 A;  1FNN A;  3IKT A;  3MZY A;  2R7D A;  2EFP A;  2Y48 A;  3R61 A;  1J0R A;  4LG0 A;  3TGN A;  2RGV A;  3QU6 A;  2DPU A;  4ENJ A;  2ACJ A;  2STT A;  1ZYR F;  3R60 A;  5LGN A;  4O5V A;  2EK5 A;  2IA2 A;  1LVA A;  4FT8 A;  1J9I A;  3HHH A;  5FO5 A;  2HQN A;  3FHZ A;  4GCV A;  1USS A;  1YW9 A;  3CUO A;  3I59 A;  1J2X A;  1O7F A;  2A68 F;  1T6S A;  1QGP A;  1LNW A;  4RS8 A;  3CLO A;  5D5V B;  3KE2 A;  4ESJ A;  4ZYH A;  3F22 A;  3IRR A;  3E6C C;  3CUQ C;  2JRT A;  5HS8 A;  2M30 A;  1GVJ A;  3WTW C;  3K1M A;  2A5Y B;  3WTV C;  3C7J A;  4A6E A;  4AIK A;  2ZME A;  2DFI A;  4I98 B;  4ENK A;  4BQA A;  5FLX K;  4JQF A;  2QBY B;  3P7N A;  4XSX F;  4QLC U;  1V3F A;  4KNY A;  4OIP F;  3D0S A;  3TDU C;  2YX7 A;  1T39 A;  2M8E A;  3HIF A;  3ZMU A;  1JE8 A;  3GFI A;  4Y17 A;  4JBA A;  4BH9 A;  2L3D A;  4L9N A;  3IWF A;  3D5L A;  5A2Q K;  2W57 A;  5BMZ A;  2E7W A;  3COA C;  5IT9 Z;  3DKW A;  4M74 A;  2QUF A;  4S04 A;  4XLN F;  4WXC A;  5D8L B;  4LFU A;  1STZ A;  4HF2 A;  3CUQ A;  2NAZ A;  4LK0 F;  2VON A;  4RAY A;  2LF8 A;  4L9V A;  2MH9 A;  3LWF A;  3ROU A;  2XRN A;  3BOQ A;  1B9M A;  1O3S A;  5L3F A;  2DK5 A;  3K2Z A;  5FD5 A;  2M87 A;  2QQ9 A;  4IF4 A;  1AWC A;  4EJO A;  2EV6 A;  2LF7 A;  1REP C;  1YW7 A;  2GA1 A;  2IRF G;  2RV8 A;  4A0Y A;  1R36 A;  2ZBK A;  1YG2 A;  2WC2 A;  4EM0 B;  2P5K A;  4KIG A;  2OBP A;  5ILS A;  4KIF A;  1WKM A;  2V1D A;  2WTE A;  1Y0U A;  2VOD A;  2V9V A;  3G73 A;  5H6Q A;  1QBJ A;  2JPB A;  3ZMV A;  5K5R A;  1O3Q A;  5L3G A;  4KUM A;  2C6Y A;  4MHG A;  3VB2 A;  3QRF F;  2KIM A;  1I5Z A;  3GEZ A;  2MC3 A;  2G7U A;  3BDD A;  2FML A;  2XAQ A;  3ZPL A;  2HWV A;  2JTV A;  5DV5 A;  2XAF A;  2L4A A;  1P4X A;  1SD7 A;  3DPL C;  4LMY A;  4Q47 A;  1B59 A;  4BHC A;  2VOO A;  3P9I A;  5DYM A;  4LG0 B;  2PLY A;  2DAO A;  4CO8 A;  3GLX A;  4OIO F;  4WK8 F;  1LQ1 A;  1HW5 A;  3V8K A;  3LA2 A;  4OOI A;  2Y0M A;  2MBF A;  1ZRD A;  1XDU A;  4DQ2 A;  1R1T A;  3GFL A;  3E5X A;  1F4K A;  5HVQ C;  1ON2 A;  4YFK F;  3CJN A;  2LSO A;  3JTH A;  3WGH A;  4BHP A;  1IRF A;  4AVP A;  3HRT A;  4WX9 A;  4HQE A;  3GWZ A;  5D6E A;  3Q5F A;  5HS9 A;  2FRH A;  4U7B A;  5KVR A;  1D8J A;  1G6N A;  4UV9 A;  4EGY A;  4HDV A;  2XAH A;  1IAW A;  2TDX A;  4U0W A;  5DCF A;  3WTU C;  4IJA A;  2FQ3 A;  4O3M A;  3QU3 A;  3QOP A;  1FSE A;  1R58 A;  2ISZ A;  1BOA A;  2Z5U A;  4HV6 A;  1LDK B;  1HBX G;  3HYI A;  1KQ8 A;  1BBY A;  4WCG A;  2ZKZ A;  5D5W B;  3TOB A;  2DK8 A;  4ZYD A;  1TLH B;  2O3F A;  3E6M A;  4AIH A;  3PQJ A;  1XSV A;  2IT0 A;  2XVC A;  3TOA A;  1QZZ A;  1R1V A;  1HW2 A;  2MH2 A;  3QP6 A;  4LJZ F;  3HSE A;  1WQ2 A;  2VC1 A;  2HKO A;  3KP3 A;  2QYO A;  3E6D A;  5E1X A;  4RGX A;  3ABU A;  4G9Y A;  4NHJ A;  1RNL A;  3F6V A;  3DP7 A;  4L0Y B;  2Z3Y A;  5LGU A;  1ZN2 A;  1S29 A;  4R1H A;  3BJO A;  3EET A;  1YQA A;  3BWG A;  2Z9O A;  2FNP A;  2DQR A;  2QQA A;  3CUQ B;  3RKW A;  1BI1 A;  3V8J A;  3RPU A;  1FYL A;  1IXR C;  4IHS A;  3HRS A;  1F9N A;  1WSU A;  1J7K A;  3F8N A;  2HS5 A;  2K4J A;  4ENN A;  4IRI A;  2O8X A;  1H9G A;  1QO0 D;  2NYX A;  2CG4 A;  2H09 A;  3M8E A;  1O3T A;  2ZNY A;  2CO5 A;  5DUI A;  2ELH A;  3DF8 A;  4HAM A;  5F64 A;  3GYH X;  2PJP A;  5JI6 A;  5D5X B;  1W5S A;  4UHT A;  5CVI A;  3ZMT A;  3I5U A;  4I2O A;  1T0F A;  2D1V A;  2FBH A;  1R1U A;  4UVA A;  2K27 A;  5ILV A;  4RB1 A;  2HR3 A;  3VOE A;  1O7L A;  1F5T A;  1U3E M;  5DEQ A;  3KLO A;  3ZMD A;  2VBX A;  1U8R A;  1MZB A;  1ON1 A;  2HYF A;  1D5V A;  5CVJ A;  3WTX C;  2PEX A;  3L00 A;  2EWN A;  2VT2 A;  2HGC A;  4CGZ A;  5L3C A;  4R79 A;  2H6C A;  1OYI A;  3C18 A;  2HDC A;  2ESH A;  2PI0 A;  3GZ5 A;  2GAU A;  1SMT A;  1JXS A;  5FB2 A;  5JVT A;  3E97 A;  2UXX A;  3MFK A;  3MWM A;  3IC7 A;  5FGM A;  1LB2 A;  4U7D A;  4FX0 A;  2BBY A;  4K2E A;  1KQ0 A;  2K7L A;  2KKO A;  5K1Y A;  2CWE A;  2GXB A;  5JHU A;  1MJB A;  2RQP A;  1S7O A;  3CO6 C;  5J8C A;  5ICE A;  3MQ0 A;  3RTR A;  3PFI A;  3HOS A;  1OKR A;  3I64 A;  3LFK A;  1OMI A;  2K02 A;  1RI7 A;  1SD6 A;  3K1P A;  2RNJ A;  2D1H A;  1TQP A;  1SD5 A;  2OZ6 A;  1H9T A;  3FMR A;  2Y75 A;  2DQL A;  1ZH5 A;  3KP5 A;  2OA4 A;  3B73 A;  2VE9 A;  1L0O C;  4A5M A;  5LBQ A;  1FLI A;  4KA4 A;  5ICC A;  4KN7 X;  5DDG A;  3F8B A;  3KEQ A;  4EM1 A;  2MLK A;  4YG2 F;  5D4S A;  2Z33 A;  1SFX A;  4ZH4 F;  1QZY A;  4P55 A;  5DD4 A;  3KET A;  4NB5 A;  2A61 A;  1YTY A;  3ZQ7 A;  3KP4 A;  4HQM A;  3TQN A;  3MCZ A;  1R5G A;  1KU7 A;  5F1R A;  3HRM A;  4IXA A;  3GUD A;  1HKS A;  4G6Q A;  2JT1 A;  2EFW A;  2DI3 A;  2OZU A;  2BYV E;  2X4H A;  4HOB A;  1ZHF A;  1KQ9 A;  2ZO4 A;  3J81 K;  1W7P D;  1FC3 A;  4IVN A;  2PMH A;  3R0J A;  4LLL A;  1DP7 P;  3MZH A;  2F5F A;  3JSP A;  1I1G A;  4M6X A;  1J59 A;  3CO7 C;  3DV8 A;  2IJL A;  1U5T B;  4Y15 A;  5BPD A;  1ZG5 A;  4ESB A;  5D6F A;  4RGU A;  5L3D A;  1BN5 A;  2PQ8 A;  2EJR A;  1BJA A;  3E6B A;  3GXO A;  1O57 A;  2FU4 A;  5H20 A;  2W84 A;  2QM3 A;  2COM A;  3QPH A;  3LST A;  4RB0 A;  1XGO A;  4ZZD A;  4LLN A;  5BS6 A;  1IN6 A;  4OMY A;  1FP2 A;  4IRH A;  5CYV A;  3R6S A;  1ONV A;  4RB2 C;  3BJ6 A;  1CGP A;  1U5T A;  1I1S A;  3ZN0 A;  1Z6R A;  4N9I A;  4BNC A;  3RDI A;  4IHT A;  3J80 K;  4EJV A;  3EQL F;  3L2C A;  4PGG A;  2VT3 A;  2P5V A;  2RC4 A;  4MEY F;  3RKX A;  2P7C B;  5ED4 A;  1BIB A;  5HDG A;  5FFX A;  1R22 A;  5HDN A;  2E7X A;  4KFC A;  3RPQ A;  3M7G A;  4MGR A;  3G3Z A;  4Y13 A;  3Q9S A;  5E8I A;  4HZF A;  5FLX Z;  1BI0 A;  1SFU A;  3IWZ A;  2FMY A;  5BOX A;  1MD0 A;  1IN5 A;  2DTR A;  3B02 A;  2EA4 A;  4PDK A;  4HX8 A;  2KRF A;  2YU3 A;  3KZZ A;  1JGS A;  4I0A A;  4M9S A;  3KZY A;  2CW0 F;  4WWC A;  3GX4 X;  3GFJ A;  1YS7 A;  1IF1 A;  5FFZ A;  1ZG1 A;  1SAX A;  4GGG A;  3U1D A;  4N9H A;  1B1B A;  4BYY A;  4KIB A;  2EFO A;  3HHG A;  2DLL A;  1FBS A;  1LJ9 A;  1EV7 A;  1B6A A;  2Q0O A;  3W6J B;  5LLQ A;  1R5H A;  5BQT A;  2E1C A;  4L9J A;  4OMZ A;  4JK1 X;  1ZRE A;  4XSZ F;  5HLI A;  3JSO A;  2PN6 A;  5AIQ A;  3FX3 A;  5CVR A;  3FXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...