1X3UA

Solution structure of the c-terminal transcriptional activator domain of fixj from sinorhizobium melilot
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
GSHMDDANDIRARLQTLSERERQVLSAVVAGLPNKSIAYDLDISPRTVEVHRANVMAKMKAKSLPHLVRMALAGGFGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein fixJ
publication title Solution structure of the C-terminal transcriptional activator domain of FixJ from Sinorhizobium meliloti and its recognition of the fixK promoter
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1x3uA01
3L09A 2IA2A 3S2WA 3IL2A 3DQVC 2HGCA 5K5RA 2K4JA 1L3LA 2Y48A 2C6YA 2W24A 3DPLC 4GYIA 4M73A 3LQRA 3BDDA 2EV6A 2VE9A 3R61A 1O57A 3FXQA 3GF2A 3J80K 2YX7A 1PP8F 2RGVA 3HHHA 1HW5A 1REPC 5KK1A 1KU3A 1MJ9A 4HX7A 1KYWA 4XLPF 3MWMA 4LLNA 1QPMA 3ZN1A 1C0WA 5DV5A 2E1CA 2R7FA 2F5FA 1OYIA 3JSOA 2RV8A 3DPTA 4AD9A 3K2ZA 1P4WA 2DPUA 4HDVA 4UVCA 4P9FA 3F3XA 6PAXA 3K0LA 2D1VA 1O7FA 4I01A 5D4RA 5AONA 1HW1A 1LJ9A 5E8GA 3U1DA 3WGIA 5BS6A 1TQIA 2RNJA 5E20A 3FMQA 2K86A 2DQRA 5E1WA 2VT2A 4AVPA 3EQLF 1ONVA 3RYPA 3WE3A 1G3YA 2FRHA 2UXXA 1U6GA 1W5TA 4RB0A 4HQEA 3KP6A 1GHCA 5CVUA 2O8XA 4HDUA 1F9NA 2Z3YA 4D0PA 1J7KA 5ERIA 4MTEA 1WQ2A 2FF4A 3FM5A 5E17F 3M7GA 2FNPA 1HKQA 1XDSA 1LVAA 3DFGA 1RIOH 4A6DA 4KMFA 3RTRA 3LA2A 3NRVA 2P5KA 2P7VB 1SMTA 5KVRA 2IP2A 4LJZF 1R1TA 1O7LA 3MEXA 4HV6A 4WXDA 3KZZA 2P5VA 2EV0A 2FEZA 1Z6TA 4Y17A 3EYIA 5L3GA 3SHFA 4RGXA 3TO7A 2NNYA 5DUKA 1SFXA 4N9HA 2YU3A 4CZZA 1G3TA 2Z99A 4Y15A 4I98B 2VBXA 2MC3A 4HF2A 4G7OF 2G7UA 4EM0B 2HYGD 2HR3A 2K02A 1LB2A 4G8XA 2PQ8A 3G73A 4RS8A 2QM3A 3IHUA 4HF0A 4PGHA 5CLSA 2MBFA 2GAUA 4ENNA 1YQAA 3J80Z 2BGCA 3HHGA 2JTVA 5DCMB 4ZH4F 2QENA 5LRSA 4IHTA 3VEPA 4U0WA 4IVNA 5EEHA 4S05A 2HZTA 2EA2A 2H6CA 4L9VA 1R7JA 2ZJ2A 3RJPA 2HQRA 1T0FA 2P6SA 4RB2C 3T8RA 2RN7A 5H20A 3SZPA 4HF1A 2FSWA 2ZCWA 3EUHA 2XKPA 1TW2A 3GFMA 3WTVC 2QBYA 1X3UA 3QPHA 3H92A 3F72A 5K1YA 1DP7P 3SZTA 2O6GE 1F4KA 4GXOA 2EFOA 1SFEA 2ESHA 2ELHA 4HLYA 2EFQA 1EH8A 3I59B 3G3ZA 4L18B 2QVOA 2UXNA 2A61A 3DF8A 3F8BA 2CWEA 4K2EA 4EJTA 1ZN2A 3ZN0A 4O5VA 1WKMA 4WWCA 2Q0OA 1J9IA 1FP1D 3KEQA 1ON1A 3FX3A 1EH6A 4Q4ZF 3GYHX 3RI4A 5D4SA 5L3CA 4CXFA 3VB2A 3BOQA 3HOTA 2PI0A 3C3WA 1R23A 2PN6A 2CSOA 2QYOA 4UNOA 3I64A 4OIOF 1IN8A 3IWZA 3BY6A 1B9NA 4UVAA 3DKWA 3QAHA 4G7HF 3MZYA 4EJVA 1T2KA 2LNBA 5D5UB 3V8LA 4YFKF 4LG0A 4PZJA 2P8TA 4XSZF 4LMYA 2Z9OA 4ENKA 1KU2A 4O6JA 1D5VA 3GXOA 4BNCA 2GWRA 5ICGA 2QUFA 4MNUA 4NB5A 2XASA 1B6AA 4XRFA 4IRHA 5FFZA 3HSRA 1BI1A 2X0LA 2MLKA 3E6CC 1IZ1A 3K9TA 3V8JA 3HIFA 2JPBA 1S29A 1EV7A 4KT5C 4B09A 3F21A 2OBPA 4RAYA 3K1MA 5FO5A 3CUQB 3JSPA 3R0JA 4N0BA 5D8LB 1E17A 2Q2EA 3QPTA 1R5HA 2EFNA 3F23A 4GCVA 3C7JA 2V1UA 4A5NA 4MEYF 4CDGA 2JZYA 1QNTA 4UV8A 1XCVA 3F8MA 2OQRA 2QWWA 1OKRA 1KYZA 5L3FA 4YFXF 2PBIA 2VE8A 3TDUC 1OPCA 4R79A 3GWZA 1G3SA 3LA7A 3E5QA 4XBFA 4G6DA 4EGZA 4ESBA 1R5GA 4MQVA 1FP2A 4Q48A 1JHFA 1V4RA 2UWMA 4UV9A 4EJUA 1R1VA 3GO5A 3ROUA 2BYVE 2V1XA 1JGSA 2ZFWA 1IN4A 4EQQA 4AWXB 3JW4A 1P4AA 4YG2F 2Z5UA 5TJJA 4HX8A 4F7ZA 4QLCU 1NHAA 1RUNA 1ZARA 2R3SA 3HOSA 1DPRA 4R8HA 2D2WA 4M71A 1BIBA 1KU7A 5LGNA 5DD8A 4IRGA 1XGOA 3GFJA 3I54A 1ZH5A 1USTA 2FU4A 5LHIA 1CF7B 2ZNZA 1P2FA 4XLNF 3KLOA 4LK0F 3DV8A 2XRNA 2J5OA 2XVCA 3GUDA 3N97A 4CHUA 5D8KB 2ISZA 3KE2A 1WSUA 2GIVA 2GA1A 1XMAA 4M9SA 3ZPLA 3E6DA 4RGSA 2ZKZA 4OIQF 2HOEA 3Q9VA 1W5SA 2PJPA 2LKPA 1LDKB 1SAXA 2VBZA 2D1HA 4P9UA 3ECHA 2A5YB 3L2CA 3KCCA 2XV4S 2DFIA 1KA8A 3ZMDA 3CTAA 4KN7X 1F5TA 2XROA 5LEKA 3K69A 2YX4A 2VBYA 3MQ0A 2R7DA 2STWA 3M8EA 1SD5A 1ZHFA 3GW2A 4IF4A 2V1DA 2B0LA 3BPVA 2RDPA 3KP5A 4KA4A 3Q5FA 4M9ZA 4GYGA 3TQNA 3E5XA 3IKVA 1SD7A 4I0BA 1MDMA 2O0YA 4XSXF 2PLYA 3ZMZA 2ZMEA 1ZLKA 1HKTA 2L02A 2HYFA 1UCRA 3TOAA 2XKOA 1IN7A 4H0EA 2P7CB 4L5IA 1GXPA 1AOYA 3BWGA 1QO0D 4U0VA 3L9FA 3MZHA 4LD5A 1GVJA 2ZO4A 3P9KA 1S6LA 4I2OA 3FXRA 3HRUA 3R6SA 3FHZA 3LFKA 2DPDA 1ZGAA 2EFWA 1PUEE 1J75A 2HKXA 4DQ2A 4KNYA 1K78B 2KJBA 1T98A 2YPRA 3R60A 3ML6A 2FE3A 3WTYC 3HSEA 2EA4A 1OMIA 3BJ6A 3BP8A 3ABUA 4NHJA 3O3KA 5ILUA 4WF2A 1YS6A 4RGRA 2L4AA 4MTDA 2QLZA 2O03A 2LF7A 3ZP5A 3BZ6A 5LRRA 3KEOA 4ESFA 1VTNC 3P7NA 3KP7A 1WRJA 3L00A 5FD5A 1O3TA 1SD4A 1YO5C 1TNSA 2ETHA 5LLQA 4IHSA 2XUBA 1ZRFA 3RKXA 3I4PA 4A12A 1W7PB 3HSFA 2FBHA 5BPIA 1LQ1A 1ULYA 3RPQA 2JPCA 3CDHA 4JK1X 2QZ8A 3D5LA 2Y0MA 5AIPA 5D5XB 5F1RA 5A2QK 5DEQA 5K5OA 1FYMA 3ABTA 3T5XA 2A3SA 1XSDA 3CUOA 5HDGA 2HS5A 1FT9A 2DW4A 2Y75A 5FD6A 1FOKA 3KP2A 5ICEA 4BXUA 4AIJA 2P5LC 1DUXC 2H09A 1CGPA 2JT1A 2K4BA 4WX9A 1SD6A 2V6CA 3ERED 4PGGA 4WCGA 1K7AA 1YW7A 3Q9SA 1ZLJA 4ZYHA 1S8NA 1B9MA 4GGGA 3LQQA 4KMUX 2KRFA 3KFWX 3K1PA 1AWCA 2CGPA 1J2XA 2G7HA 3NQOA 2VC0A 1KQ0A 1FY7A 3V7CA 4A0ZA 2F5DA 2DAOA 4FX4A 3C18A 4UUVA 1IF1A 1R00A 2MLGA 3ZMTA 4EVIA 2EB7A 1JE8A 2DTRA 3BROA 5AIQA 2E7WA 4ZYEA 1ZRDA 1P92A 5CJ9A 1IXCA 2OZ6A 4AIHA 3WE2A 1P4XA 1U2WA 1LEBA 1H9TA 1XD7A 3ZQ7A 3HUGA 4LLGF 5CVRA 1HSJA 4L9JA 1KGSA 1WWXA 1U5TA 4Q5SF 5LHHA 1FWZA 5DDGA 1ZGJA 5JHUA 2NRAC 1FSHA 3RYRA 2F5CA 2W25A 1MGTA 4HBLA 3HRTA 3L7WA 1I1SA 3KETA 3E5UA 1TBXA 4BHPA 5ICFA 5DCFA 3T8TA 5E8IA 2XAGA 1HXDA 1TLHB 4HQMA 2VOPA 1I5ZA 3HRSA 3IRQA 3IWFA 1R1UA 1S7OA 5A2QZ 3TO6A 3M1EA 4G7ZF 1UB9A 3I0TA 3M9AA 3EDPA 4HZFA 4A2UA 4WXHA 2AXLA 1O3QA 1BN5A 5HS7A 4BHCA 2BE5F 3NEUA 2MH2A 3QP6A 2FOKA 1BOAA 2ESNA 4KIBA 4L0YB 1BBYA 1XB4A 5L3EA 2KIFA 1BI3A 3FF5A 4ASNA 2H94A 3U2RA 4BHBA 3DEUA 1JHHA 3F6VA 4OIPF 1ZG1A 4CICA 3WU1B 3RDIA 5DCMA 5JFRA 5F6FA 1DPUA 3LAPA 3E97A 3RPUA 3H3ZA 2V79A 1I27A 1Z7UA 2X4HA 2CFXA 5JVTA 3PQJA 4ZYGA 3GEZA 4OOIA 2VXZA 4HAMA 3FWEA 1OYYA 2M1BA 3GLXA 2YR2A 2CW0F 5LBQA 4ENJA 4G6QA 3V4GA 3IC7A 1STZA 1XMKA 1ODDA 4Y13A 2E1NA 2W84A 1KQ9A 3VODA 3KP4A 1KU9A 1XN7A 2OQGA 4M6YA 1UHWA 1R36A 2F5EA 3K1NA 1J5YA 4HW0A 2VONA 1XSVA 4M72A 5ED4A 1SFUA 3GVAA 3I59A 2GXGA 1S7AA 5D5VB 3QU6A 4A0XA 2FQ3A 1F1ZA 3WTXC 2HKOA 3ECOA 1MJAA 1QGPA 2BBYA 2WV0A 2O61A 4OIRF 5J8CA 4ZZLA 4MQ9F 3SQNA 1XSXA 2XAFA 5FLXK 4R1HA 1XGNA 1EH7A 2XIGA 3EETA 5FB2A 4FX0A 4L0ZB 1BM9A 1LNWA 1IRFA 4RAZA 3BPXA 1FLIA 1HKSA 1FZPB 1QZYA 2YSRA 1O3SA 3FM3A 4OINF 2LF8A 5ILSA 2FMYA 3WTUC 1O3RA 4KYWA 5CVVA 2IJLA 2COMA 1L0OC 3WTZA 1MZBA 3GZ5A 3ELKA 3F8CA 1JXSA 1B4AA 3BJOA 4TV7A 2HQNA 4KICA 3J81K 2DO7A 3C1DA 1S3JA 2L3DA 2M5WA 1QZZA 3TKYA 4EM2A 1QBJA 1XDUA 3FMRA 4UVBA 4EGYA 3PQKA 3W6JB 4OMYA 4M6XA 2A07F 2OZUA 2L4MA 2GQQA 2ADUA 3ZMUA 2VC1A 5IT3A 3TGNA 3ZMVA 3B02A 4L9NA 1R58A 3JAMK 1H0MA 4P5OA 1V3FA 1YW9A 1FSEA 1TNTA 1ZG3A 4U0YA 1HW2A 1SMYF 4EJOA 1LDDA 2KKOA 2WWYA 3MFKA 4YIFA 1TQMA 1YFHA 1FBQA 1PP7U 3CUQA 3REOA 1YIOA 4EV0A 3V7SA 3JTGA 3RKWA 2D45A 3COAC 1H9GA 2MA3A 1T6SA 4NQWA 2L01A 3KP3A 5HLHA 5IT9K 1J0RA 3F22A 1J59A 1OR7A 4I09A 1E2XA 2QBYB 4ESJA 2IT0A 1RI7A 2VN2A 2HWVA 4HX4A 1TQPA 4WXCA 2OAZA 3U9GA 2DK8A 4YIIA 4BQAA 1FPQA 1YW8A 2CQKA 1T38A 4MHGA 5FLXZ 5DUIA 3V7RA 4A5MA 5D6FA 1T39A 1Z91A 4KUMA 2MH9A 1ZREA 4IRIA 2E7XA 5CVIA 5HVQC 2PG4A 3WG9A 4EMSA 2PFBA 4HV5A 2GZWA 1BC8C 5BQTA 4FHTA 2P6TA 2RC4A 4I02A 2DU9A 2XGXA 4OU0A 4P55A 2FBKA 3ULQB 4HLXA 3WTSC 1I1GA 4UHTA 1P6RA 2IW5A 4CGZA 3J7AO 2HEOA 5DD4A 3J81Z 5BMZA 2WTEA 1U5TB 2NAZA 5H6RA 2PMUA 2QQ9A 4YFNF 2FNAA 3F8FA 1Y0UA 2GA2A 4G94A 2FBIA 1U5TC 2ZXJA 3JAMZ 1G4DA 1K6OA 2RVCA 4LG0B 2L54A 1IUYA 1CF7A 2W57A 5DYMA 2DQLA 5CVJA 2M45A 3LA3A 2DBBA 2FA5A 4M9XA 2PMHA 4QWQA 2M87A 1DDNA 1G6NA 4M74A 5HS9A 3OOPA 5ICCA 1Z6RA 3GFLA 3B73A 1FYKA 2WC2A 4CYDA 4B8XA 4WK8F 5JI6A 4UXNA 2M30A 1FX7A 3E3VA 2RKHA 2NS0A 1B59A 5LGTA 4I0AA 3HRMA 5IT9Z 5FFXA 1MJBA 2OD5A 3QU3A 2P4WA 4CO8A 4LGWA 2OU2A 2JRTA 2KIUA 4LB5A 1ZG5A 4KFCA 1Q1HA 5HDNA 3E6MA 3GX4X 1LEAA 2MD5A 3DXJF 4KN4X 3RKYA 3I53A 2RQPA 3F6OA 1UFMA 4MGRA 2NNNA 3CO7C 3ZMSA 1FNNA 2VOOA 2DK5A 1I6XA 3E6BA 1QQIA 4P96A 4MEXF 5J8FA 1IXSB 4HOBA 2QQBA 4RB1A 3PFIA 2ACJA 2EV5A 2HFHA 5HOOA 3D0SA 4BH9A 1BI2A 4G9YA 4FT8A 4LK1F 4GO1A 4I7HA 5E1XA 1KQ8A 5CYVA 3QRFF 3H3UA 2Q8KA 4OMZA 2H27A 3M8FA 2XAJA 1K78A 5LGUA 1Z1DA 2UZKA 3O6BB 1ON2A 3T0YA 5ILVA 1YLFA 1HBXG 4KDPA 4E70A 1IW7F 5K5QA 3WU0A 2VBWA 1YTYA 3WTTC 1BC7C 2A6HF 3P9IA 3V8KA 2ZBKA 3WODF 2XAHA 3R0AA 4RB3C 5FGMA 4BAYA 3WGGA 4KIGA 4O3MA 1FYLA 1A04A 5HS8A 4LB6B 4ON0A 4Q47A 4U7DA 3DP7A 4KIFA 4U7BA 4PCQA 4N9IA 1TW3A 2HDCA 1YS7A 5F64A 2QQAA 5LHGA 1W7PA 1D8JA 4S04A 1IN6A 3JTHA 2A6EF 4IXAA 4IPAA 2HTJA 5BOXA 2KIMA 1Z05A 3ISPA 5JR3A 2F2EA 3IKTA 2O3FA 3CO6C 2IRFG 3MAJA 2IPQX 1MKMA 2BEOA 2OA4A 1IN5A 5E18F 1BI0A 5E1ZB 4EJWA 3CJNA 5D6EA 2M8EA 4ZZDA 5HDKA 4L5JA 5H6QA 3GZ6A 3SXYA 2EK5A 5HLIA 3QOPA 2A68F 5LEJA 3VFZA 1RZ4A 2EFPA 1BIAA 2LDUA 1U78A 3VOEA 1K79A 4L9TA 3CUQC 2FMLA 3I71A 4EM1A 1IXRC 1MDMB 4JQFA 2H6BA 3O2PE 2Z33A 2EWNA 4BYYA 2ZMEB 5HLGA 1MD0A 2DI3A 2LSOA 3KZYA 1LDJA 5EEGA 1IRGA 1UHMA 3EYYA 2NYXA 3CLOA 2AS5F 3WGHA 4PDKA 2JSCA 1ZAOA 3AAFA 2XHKA 1Z9CA 4A0YA 5L3BA 2XAQA 5BPDA 2A69F 2HTSA 3QP5A 3LWFA 1ZRCA 1G3WA 1GXQA 4DNCA 2DT5A 1FBSA 5L3DA 4AIKA 2ZNYA 2IVMA 4IJAA 2VODA 2CG4A 3RIRA 1IAWA 3HTSB 1U8RA 5J6XA 2W85A 2J5PA 1XCBA 3F8NA 1W7PD 2CYYA 1U3EM 1FBUA 2IA1A 1D3YA 3W6KB 2PEXA 3IRRA 1YG2A 4A6EA 1RNLA 1XGSA 2TDXA 3HTUA 4LFUA 3LSTA 1TTYA 4HA8A 4LLLA 4Z2YA 1USSA 1PDNC 1BJAA 3SFZA 1YYVA 3P9CA 4ETSA 2K27A 2ISYA 2IA0A 2GXBA 3GFIA 2G9WA 4JBAA 1D8KA 2V9VA 1R22A 5D5WB 1XGMA 2DLLA 3FZVA 3T1BA 1W4MA 3I5UA 2BV6A 1ZYRF 3TDZC 4ENMA 5TRDA 3TO9A 3FMSA 3BJAA 3OV8A 2EJRA 3KLNA 4HYEA 1FC3A 3R4KA 1WI9A 3TOBA 2CO5A 1HSTA 2FXAA 1HQCA 3WTWC 1B1BA 2K7LA 3LAJA 3FXUA 3I58A 3MCZA 3HYIA 4U88A 2VT3A 2STTA 4RGUA 3N4MA 1RUOA 1OYWA 2KJCA 4ZYDA
chains in the Genus database with same CATH superfamily
3A4CA 1GDTA 1TL8A 3L09A 2IA2A 4ITVA 2VKEA 3S2WA 1E3OC 1N78A 3IL2A 2QKLB 2HDWA 2WAFA 1PVEA 3DQVC 4A3IJ 1WCMJ 2MSYA 1IRZA 2HGCA 5K5RA 5B5EC 2K4JA 1L3LA 2Y48A 2K5CA 1VQPI 3FBIB 2W24A 2C6YA 1T8IA 3DPLC 4GYIA 4XOTA 3CCRI 2K3PA 4M73A 3LQRA 3BDDA 3TW6A 2EV6A 5GAEJ 2VE9A 3R61A 1O57A 1VI0A 3FXQA 4JX4A 3I4MJ 3GF2A 2X1EA 4QIWN 3J80K 2YX7A 1QA6A 3BG6A 1PP8F 2RGVA 3HHHA 1HW5A 3K70C 1REPC 5KK1A 3MKYB 1KU3A 3OYGA 1MJ9A 4HX7A 1KYWA 4XLPF 1JKOC 1VNDA 3MWMA 4LLNA 1QPMA 3ZN1A 3CLQA 3PNVA 2KRHA 1JJ6C 4GRIA 5DV5A 1C0WA 2E1CA 2R7FA 1RETA 2F5FA 1Y8QB 2R5YB 4V19K 1OYIA 2L9SA 4DZJA 1YJ9I 3BTLA 3OYMA 4C30A 3JSOA 1PUFB 3BG5A 2ZFUA 4I99C 2I5UA 2RV8A 3DPTA 2X6XA 3CD6I 3S15J 4AD9A 3K2ZA 3SJMA 1APLC 1LE8B 1P4WA 2DPUA 1UJ8A 4XM3A 4OAYA 1A6QA 4HDVA 1MBHA 1IUFA 4UVCA 4P9FA 3UNGC 3F3XA 3JRBA 6PAXA 1B72B 2KZVA 2R7SA 1Y56A 2QF7A 3K0LA 2D1VA 5H2FC 1TWAJ 2LR8A 3J7ZI 1OISA 1O7FA 1X1DA 2VQGA 4CUGA 4I01A 5D4RA 3OWTA 3MKZA 5M3FJ 5AONA 1HW1A 4LITA 2BY3A 1LJ9A 5E8GA 3U1DA 3FHNA 3W2AA 3WGIA 3H5AA 3CJQB 5BS6A 3KYCB 1TQIA 2RNJA 4E7LA 3CDIA 2OJED 5E20A 4YRVA 2DCEA 3FMQA 2K86A 2DQRA 5E1WA 5GTHC 2HXIA 3HUGB 2VT2A 3CCYA 1FMVA 3EQLF 4AVPA 5HLTA 1ONVA 4RM2A 1P9QC 3RYPA 3WE3A 1G3YA 2FRHA 3SEQA 4HRIA 2UXXA 1FTTA 1U6GA 1Q1VA 4E7SA 5LFAA 1W5TA 4RB0A 4HQEA 2XPWA 3I3LA 2ECBA 3KP6A 4BE2A 1GHCA 5CVUA 2ICWG 2O8XA 4HDUA 4XNFA 2X85A 4D5CA 2F5VA 1F9NA 2Z3YA 4D0PA 1J7KA 2E2IJ 2LREA 5ERIA 4KJZA 1M1EB 4MTEA 1WQ2A 2XGEA 4HEA2 2FF4A 1BJZA 1V5EA 1I3AA 3FM5A 2DTZA 3PUFA 5E17F 2F4IA 3M7GA 2FNPA 2FQ4A 1HKQA 3FK6A 4IKFA 1XDSA 2BZTA 1YITI 1LVAA 3TMOA 2ZSIB 3DFGA 1RIOH 4A6DA 4KMFA 3RTRA 3LA2A 3NRVA 3G6EI 2DA6A 2DA1A 2P5KA 4C3HJ 3OYEA 2P7VB 1SMTA 5KVRA 1OLTA 2IP2A 4LJZF 1R1TA 1O7LA 3MEXA 4HV6A 4WXDA 3LSJA 4NC6A 2EPFA 3KZZA 3ZQCA 1S72I 2CMPA 2P5VA 1ETXA 2IGMA 3QWLA 3HPHA 2EV0A 2FEZA 1Z6TA 2MC4A 4Y17A 3EYIA 1OCCH 2HI3A 3CMEI 5L3GA 3SHFA 2VL8A 1Z67A 4RGXA 3TO7A 3AG2H 4D1QA 2NNYA 5DUKA 1SFXA 4N9HA 2YU3A 4CZZA 4A3GJ 1G3TA 2Z99A 4UUTA 4Y15A 4I98B 2VBXA 2PMZA 2MC3A 4HF2A 3ERMA 5F0CA 3HL2A 4G7OF 2LVSA 2G7UA 4EM0B 1X3WB 3I56I 1YI2I 1OQYA 5B1AH 4IQ4A 5KHDA 3DBRB 1BR1A 2HYGD 2HR3A 5K7HA 2K02A 1FOYA 1LB2A 3E0JB 4G8XA 2PQ8A 3HGGA 3G73A 4RS8A 2QM3A 3IHUA 2DOFA 4HF0A 1XC5A 4BBSJ 1YE9A 2NVYJ 4PGHA 1JT6A 5CLSA 3G1OA 4F93B 2MBFA 2GAUA 4ENNA 4DBQA 1YQAA 5B3SH 3ZOBA 4F92B 2CV1A 3J80Z 2BGCA 3OYAA 3HHGA 2JTVA 5DCMB 4ZH4F 4B43A 1RRJA 4PJLA 2QENA 5LRSA 4IHTA 1NG7A 1WJCA 3VEPA 5GAGJ 4PFOA 4U0WA 1D1AA 2HQ5A 4IVNA 5EEHA 4S05A 4B4CA 2HZTA 2EA2A 2H6CA 4L9VA 1R7JA 2ZJ2A 2F4OB 1OJLA 2HQRA 1T0FA 4JYKA 3RJPA 3LSRA 2P6SA 3F0CA 4RB2C 4NBQA 3T8RA 4ZTJA 2RN7A 5H20A 2JMWA 3SZPA 1MBGA 4HF1A 4A3CJ 3C2HA 2FSWA 2ZCWA 3EUHA 1NK3P 4NDLA 2XKPA 1TW2A 1IO2A 3GFMA 3WTVC 2QBYA 1D0XA 1X3UA 2IS1A 2GIZA 3UR3C 1TC3C 3QPHA 4CCMA 4BQNA 3H92A 3F72A 1W0UA 1MNDA 1QPIA 3FXJA 1RR8C 2K9LA 5K1YA 2VKDA 5F27A 1DP7P 1IJWC 4Y4RA 3K4MA 4OAZA 4DYRA 4RM3A 4XRSA 3SZTA 2O6GE 2M34A 1F4KA 3SDBA 2EIJH 3HZJA 4GXOA 2EFOA 3PNTA 1SFEA 2MABA 2ESHA 2ELHA 4Y3OA 2EFQA 4HLYA 4A3EJ 1EH8A 3I59B 4II2A 2OCCH 3G3ZA 4IQJA 4RMNA 4L18B 2QVOA 2UXNA 2A61A 3DF8A 3F8BA 2L0KA 2CWEA 4K2EA 4XLEA 2Y0SN 4FE7A 2NVTJ 4EJTA 5F04A 1V55H 2L5QA 1ZN2A 3ZN0A 3W3CA 4O5VA 2DFHA 1WKMA 4F55A 2R7UA 4WWCA 2Q0OA 3K4BA 1J9IA 1FP1D 4UUSA 3KEQA 4IL6C 1ON1A 3FX3A 2RREA 1EH6A 4Q4ZF 3GYHX 3RI4A 1SC7A 5D4SA 5L3CA 3EPZA 4S0HB 4CXFA 3VB2A 3KYDB 3BOQA 2EZKA 3HOTA 3S1NJ 1JUMA 4M6VA 2PMZN 4C3JJ 2PI0A 4CCOA 3C3WA 2AHQA 2O5RA 2BY2A 1J09A 1ORKA 4I76A 1R23A 3SEZA 2PN6A 2CSOA 2QYOA 1X4PA 3LSKA 4UNOA 2K9QA 3I64A 1JT0A 2VB6A 4OIOF 1IN8A 3IWZA 3BY6A 1W36D 1B9NA 2R93J 4UVAA 3DKWA 3QAHA 1RKTA 3C2GA 4G7HF 3MZYA 4EJVA 5LD2C 1T2KA 4B3AA 1F43A 3PUBA 4BY1J 4BKXA 2LNBA 2EQRA 5D5UB 3V8LA 1LUJB 1D1CA 3CESA 4RA2A 4YFKF 2NXNB 3OS0A 4LG0A 5FLVA 1IV8A 1H88C 3BR2A 2H1LA 4PZJA 2P8TA 4XSZF 4LMYA 2LD5A 2Z9OA 4ENKA 1KU2A 4O6JA 1D5VA 4A93J 2QSHX 3GXOA 1FOWA 4BNCA 2GWRA 5ICGA 3PJRA 2VJ4A 2YUSA 2QUFA 4MNUA 3K4KA 4NB5A 2XASA 1P7IA 1UG0A 2DMPA 1B6AA 5FJ8J 4XRFA 1P7JA 4V2GA 4IRHA 2JN6A 1Z3YA 1BW6A 3HSRA 4PJMA 2XGCA 5FFZA 3H35A 1R49A 3VPRA 1BI1A 2X0LA 2MLKA 2ZJRF 3FDYA 3JRGA 1DGWY 3E6CC 4B3XA 1IZ1A 3CCVI 3K9TA 1ZGWA 2DDAA 3V8JA 3KPHA 4XIDA 1ACIA 3HIFA 2L9RA 2JPBA 1S29A 3O8HA 1EV7A 3PNYA 2NS8A 1SANA 4KT5C 3MD2A 4B09A 1PYVA 2CUJA 3F21A 1V5FA 3EUAA 3WHCA 2OBPA 4RAYA 3K1MA 5FO5A 3CUQB 3BTJA 3JSPA 1WGXA 5DTDA 3R0JA 4N0BA 1YHQI 5D8LB 3LSHA 2CJJA 1E17A 2Q2EA 2DMQA 2BVMA 3QPTA 2X1DA 2M7AA 1R5HA 2EFNA 3F23A 4GCVA 3S32A 2DJNA 3CCUI 1X2NA 2CS3A 2XAUA 4ABZA 4IHVA 4HNVA 3C7JA 2QQ8A 2GOXB 3J7YJ 2V1UA 4A5NA 4MEYF 4CYCA 1UMQA 1Y1WJ 4CDGA 2KIQA 2EZLA 2BW3B 2EINH 4CH7A 2JZYA 1QNTA 4UV8A 1VQMI 1H8AC 1XCVA 2ZB9A 3F8MA 2FD5A 1Y39A 5F0HA 2E35A 3H9QA 2OQRA 2QWWA 1OKRA 2KL4A 1KYZA 5L3FA 5CPRB 3BR6A 4YFXF 2PBIA 1XX5A 1I6HJ 4PFPA 2ZXHA 1ZTRA 2VE8A 3TDUC 3ZQIA 1OPCA 2BXYA 3ASOH 3HB9A 4R79A 3GWZA 1G3SA 3LA7A 3E5QA 4XBFA 2L7MP 4G6DA 3IH4A 4IZZA 2R7RA 2R7OA 3PO3J 3LOCA 4RDUA 2R5ZA 4EGZA 2IAIA 1IG7A 3S17J 4ESBA 4Y7NJ 4NC8A 1R5GA 1WJEA 1FP2A 4MQVA 4QSHA 4Q48A 1WPKA 2HOTA 1WH7A 2XGDA 1JHFA 2M8GX 5B1BH 1V4RA 2E60A 5IP9J 2UWMA 4UV9A 2JVGA 4EJUA 1R1VA 2ZSHB 2CW8A 3GO5A 3ROUA 1UAAA 4F52A 3FXOA 2BYVE 3JRHA 2V1XA 3J7AY 1JGSA 2ZXWH 2ZFWA 1IN4A 3DEEA 4EQQA 4AWXB 2K9NA 3D1NI 2M9HA 4CCKA 2HXOA 3JW4A 2R92J 4XKVA 3CP2A 1P4AA 4YG2F 2UUZA 2Z5UA 3VDXA 2ZJQF 4CCNA 4IO9F 5TJJA 4HX8A 4F7ZA 1X1BA 1WJAA 5E3OA 1QVUA 2A5WA 4QLCU 1NHAA 3H5RA 5EZGA 1RUNA 1DP3A 1ZARA 3FK7A 2HU9A 4BEHB 3HOYJ 2R3SA 3LFUA 4Y33A 3HOSA 1DPRA 2IS6A 4R8HA 3L2RA 3LMMA 2D2WA 4M71A 1VQNI 2RNGA 1BIBA 2CW7A 1KU7A 1TT5B 3CCEI 5LGNA 5DD8A 4B1RA 2OUMA 2HOSA 4IRGA 2E36A 4ZDLA 1XGOA 4HSRA 3GFJA 3I54A 3OMYA 2EBIA 2KLOA 4PJJA 2LG4A 2Y69H 1ZH5A 1USTA 2V1NA 2FU4A 3AFHA 1SFKA 2IGKA 5LHIA 1CF7B 2ZNZA 2HZDA 5JLXA 1IV6A 4XRMA 2E2HJ 1P2FA 3H9GA 4EATA 4XLNF 3KLOA 4LK0F 3DV8A 2XRNA 3JRDA 2J5OA 2XVCA 2CUFA 3GUDA 3N97A 4CHUA 5D8KB 5IY5H 5J40A 3MKLA 2ISZA 3IAM2 3KE2A 4AIDA 3S3NA 2GIVA 1WSUA 1YJNI 2GA1A 1XMAA 5TISC 2E1MC 1WJDA 4M9SA 4AUXA 3ZPLA 5FRNA 3E6DA 4RGSA 2ZKZA 2LC2A 4OIQF 2BOLA 2HOEA 2ME0A 4NC7A 3Q9VA 5EYRA 1W5SA 2LLKA 2Q1ZB 3TEDA 2PJPA 2LKPA 1LDKB 1SAXA 5F08A 2VBZA 2D1HA 1ETWA 4P9UA 3ASNH 2KP6A 2A5YB 3ECHA 3L2CA 3KCCA 2XV4S 2DFIA 3L1PA 1ZELA 1X1AA 2XF7A 3MZ8A 1KA8A 3ZMDA 4BE1A 2A6TA 3CTAA 2CFOA 4DYQA 4KN7X 1F5TA 2XROA 4XLAA 2LY9A 5LEKA 3K69A 4XLCA 2YX4A 2VBYA 3MQ0A 3RZOJ 2R7DA 2STWA 1W36C 3G2BA 2V7FA 4XN0A 4CCJA 3M8EA 1SD5A 1ZHFA 3GW2A 2M0CA 2IEKA 4IF4A 4UB6C 3AG1H 2V1DA 3L2QA 2LP0A 2B0LA 2ID3A 3BPVA 1LFUP 4XORA 4DGWB 2RDPA 3KP5A 4KA4A 3Q5FA 4QTRA 2KT0A 3BR5A 3JRFA 4M9ZA 4GYGA 3TQNA 1W0TA 3IV5A 2M4GA 3E5XA 2DDBA 1OFCX 2KHMA 2CUZA 3M07A 3IKVA 4X1EA 1SD7A 4I0BA 2E5NA 3K2AA 1MDMA 2O0YA 4BGDA 4XSXF 5M5XJ 2K85A 3ZMZA 2PLYA 4PJNA 2ZMEA 1ZR4A 1ZLKA 1HKTA 2L02A 2HYFA 2R7ZJ 1T0FC 1F36A 1UCRA 3TOAA 2XKOA 3BG3A 1MBJA 1IN7A 4H0EA 2P7CB 1EJ9A 2LMDA 4L5IA 1GXPA 4J00A 2F6CA 3CZ6A 1AOYA 1MMSA 4F3QA 2V26A 3BWGA 4Y52J 1S7EA 3EUHC 3GTMJ 1QO0D 1OCOH 3H36A 4U0VA 5EZHA 2BVLA 3L9FA 2ELKA 3MZHA 4EEFG 3U1KA 4LD5A 2CQXA 1GVJA 2COBA 2ZO4A 3P9KA 1S6LA 3ZQLA 4I2OA 2ELJA 3FXRA 3KYLA 3HRUA 3QODA 3R6SA 2B7EA 3FHZA 3LFKA 2FUG2 3S16J 3E7LA 2DPDA 1ZGAA 2NOGA 3KIOA 4FISA 2EFWA 2R7TA 2KRCA 2N8GA 1PUEE 1J75A 2HKXA 2W4SA 4DQ2A 4KNYA 1K78B 4X6AJ 4A3DJ 2KJBA 1T98A 2VXDA 2YPRA 3R60A 3ML6A 2FE3A 4OWRB 2X6WA 4KITB 1BA5A 5FROA 1OCZH 3A02A 3K6GA 4D5FA 2E5ZA 2JA8J 3NAUA 3WTYC 3HSEA 5J4VA 1UELB 1D5YA 2EA4A 2DOEA 3H1CA 1YOVB 1OMIA 1RESA 2E2JJ 4PUSA 3DLLF 3BJ6A 3PSFA 3BP8A 2LTPA 3ABUA 2LY1A 2KPMA 4NHJA 4HSTA 2MW8A 1YRNB 1OCTC 3O3KA 1ZR2A 5ILUA 4WF2A 1YS6A 2VUMJ 5IPAA 2HVRA 3GTLJ 2YU9J 4RGRA 2CQNA 2OTLI 2AO9A 2L4AA 4YELA 3CJRB 4MTDA 3OYJA 2QLZA 4DOZA 2O03A 1SEUA 4ZC3A 2HOAA 2F48A 2LF7A 3ZP5A 5GADJ 1TWCJ 3BZ6A 2WBMA 5LRRA 3KEOA 4ESFA 1VTNC 3P7NA 3PO2J 2X1CA 1WRJA 3KP7A 2Y0SA 3L00A 5FD5A 2NVQJ 1O3TA 1SD4A 1YO5C 1K4TA 1TNSA 3QYFA 2LK2A 2ETHA 5LLQA 4II3A 4IHSA 2Y30A 1MSFC 2XUBA 3CC2I 1ZRFA 3RKXA 3I4PA 4A12A 1W7PB 1HLVA 3HSFA 5GPAA 3PSIA 2EIMH 1U9NA 2FBHA 4IHWA 3O8GA 5BPIA 3AG3H 3FBNB 2PJRB 2QGUA 1LQ1A 1ULYA 3RPQA 1AKHB 1N25A 2HVSA 2JPCA 2MGQA 3CDHA 1KZHA 4JK1X 2QZ8A 3D5LA 2Y0MA 4E7IA 2LOOA 5M5YJ 3N05A 3BZKA 2K9MA 5AIPA 5D5XB 5F1RA 5A2QK 4YIRX 5DEQA 5K5OA 2LKXA 1NH3A 4E6KG 1FYMA 3ABTA 3T5XA 2OPTA 2JUGA 4M3FA 2A3SA 4BJ5C 1XSDA 2LBFB 4MIMA 4AYBA 3CUOA 5HDGA 1VQLI 2R0QC 2HS5A 1S9HA 2Z2SB 3CF2A 1FT9A 3GTKJ 4XOPA 2DW4A 2OV7A 2Y75A 5FD6A 1MBEA 1FOKA 3KP2A 5ICEA 4BXUA 4PSXA 2VQCA 4AIJA 4LOCA 2P5LC 3IAS2 1DUXC 5JLWA 1BOBA 2H09A 1YIJI 2ME6A 1CGPA 2JT1A 3OYFA 2K4BA 2JWTA 4WX9A 1SD6A 1XMXA 1WI3A 1BR2A 2V6CA 4BDZA 3ERED 5GP9A 2JA6J 1DGRM 2H8RA 4PGGA 4WCGA 3NWTA 1K7AA 4XK4A 1YW7A 3Q9SA 4DIQA 1K83J 1ZLJA 4ZYHA 1RPWA 2CQ7A 5F0FA 1S8NA 4I6ZA 1B9MA 4GGGA 3LQQA 5EGOB 2R5YA 1B8IB 2JK3A 4KMUX 2KRFA 3KFWX 3K1PA 1AWCA 1PUFA 2R4GA 3G4SI 3DTEA 2CGPA 1J2XA 3M3YJ 2G7HA 3DU5A 2I10A 1JTYA 3NQOA 2VC0A 1KQ0A 2KMUA 1FY7A 3JR9A 1DU6A 3V7CA 4A0ZA 1LE8A 3H0DA 2F5DA 2DAOA 4FX4A 3C18A 4UUVA 1XG1A 1IF1A 1R00A 3A0BC 2MLGA 3GZNB 2LY2A 3ZMTA 2R5ZB 4EVIA 3OS2A 2EB7A 1JE8A 2DTRA 1TWHJ 3GMEA 1B72A 3QQAA 3BROA 5AIQA 1IDYA 2L9NA 2E7WA 5FKKA 3DKXA 4ZYEA 1ZRDA 4XL9A 1P92A 5CJ9A 1IXCA 2OZ6A 4V2FA 2W48A 2H1KA 1UZCA 4L5EA 4NUBA 2AXTC 4AIHA 3WHBA 4BBRJ 5M5WJ 3WE2A 3OYLA 1P4XA 1R4NB 3JRCA 1U2WA 1LEBA 1H9TA 1XD7A 3ZQ7A 3HUGA 1VQ6I 1EA3A 4LLGF 5CVRA 2IGOA 1HSJA 3RCOA 5E3LA 4L9JA 5E79C 3OL3A 5FKNA 1KGSA 1WWXA 2QCOA 1U5TA 2LYCA 4Q5SF 1GV5A 4G12A 1T33A 5LHHA 1FWZA 1SVMA 1Z77A 1HA8A 3BR3A 1D0YA 5DDGA 1ZGJA 1AHDP 2MG4A 5JHUA 1E0EA 2GOMA 2NRAC 2DMTA 4ZDOA 2DA3A 3BCAA 3S14J 1FSHA 3DTIA 5J1YA 3RYRA 2G0EA 2F5CA 2W25A 1ENHA 1MGTA 4HBLA 2YS9A 3HRTA 3L7WA 2XF5A 4AYBN 4UY8I 3S1RJ 4FE4A 1FOXA 4B48A 1I1SA 2RQQA 3CQZJ 3KETA 1LKXA 3A1YA 3E5UA 1TBXA 3VSKA 4G6TB 2XSJC 4BHPA 5ICFA 3W2VA 5DCFA 3T8TA 5E8IA 3H3VK 2XAGA 1HXDA 2DA5A 1TLHB 3OIPA 4HQMA 2VOPA 4JX6A 1I5ZA 1UG2A 3HRSA 3IRQA 4IHYA 2VKVA 1R1UA 3IWFA 1S7OA 5A2QZ 1VQ9I 3TO6A 3DTKA 3M1EA 4G7ZF 1UB9A 3I0TA 2NVUB 3M9AA 3EDPA 4HZFA 4A2UA 1Z0XA 2Y2ZA 4WXHA 3VYTB 4YEJA 1HC8A 2AXLA 1O3QA 1BN5A 5HS7A 3VYUB 4MO7A 4A3MJ 4BHCA 2BE5F 4BJTA 2L2OA 3NEUA 3HM5A 1XS9A 2MH2A 3QP6A 2FOKA 1MMAA 1BOAA 2ESNA 4KIBA 5IOZA 4L0YB 1WZ2A 2E1OA 1BBYA 1XB4A 3S1MJ 5L3EA 2KIFA 1WJBA 1BI3A 3FF5A 3ZQHA 4ASNA 1W1WE 1WVRA 1JKQC 1QHGA 2H94A 3U2RA 4BHBA 3HOXJ 3DEUA 3K4JA 1JHHA 2VQLA 3F6VA 4OIPF 3BR0A 5J1UA 2B9SA 1ZG1A 3OS1A 1QRYA 2VI6A 2R7WA 4CICA 5FRMA 3WU1B 3RDIA 3CF5F 5DCMA 3ZR8X 5JFRA 4ZYAA 3W6VA 5F6FA 1DPUA 3LAPA 2DMUA 3E97A 2OTJI 2CU7A 3GLLA 3LSGA 3H3ZA 2TRTA 3RPUA 2V79A 1T56A 1I27A 1Z7UA 2X4HA 2CFXA 5JVTA 3PQJA 4ZYGA 3HOVJ 3GEZA 3DBLB 1YX5A 4OOIA 1CQTA 2VXZA 4HAMA 3FWEA 3Q0UA 3F9KA 1AA7A 5KCMA 4BE0A 3JRAA 1JTXA 4NNJA 5FKOA 1OYYA 1MBFA 1MMGA 2M1BA 3LSMA 3GLXA 4A3KJ 4IEJA 4ANJA 2YR2A 2CW0F 5LBQA 4ENJA 2XRLA 4G6QA 4PJ0C 3CMYA 3V4GA 4IOCF 3IC7A 1STZA 1XMKA 1ODDA 1PJRA 2P0WA 3BT9A 2E1NA 4Y13A 2L9VA 2W84A 2MYSA 1KQ9A 3VODA 2KDZA 3HKZA 3KP4A 5FKMA 1MH4A 1H89C 1KU9A 1XN7A 2OQGA 4M6YA 2WV1A 1UHWA 1R36A 2F5EA 2DJIA 1J5YA 2ZMEC 3K1NA 2F4MB 4HW0A 2VONA 3IUOA 5J3LA 1XSVA 4M72A 5BNGA 3K4NA 5ED4A 4JX5A 1SFUA 3QPLA 3H0GJ 3GVAA 3I59A 4BU2A 2GXGA 3KEYA 3HPGA 1S7AA 5D5VB 2W7NA 3QU6A 4A0XA 2FQ3A 1QZEA 1F1ZA 3HJEA 3IP4B 3WTXC 2HKOA 3ECOA 1MJAA 3L2VA 1QGPA 1SVOA 3DU6A 2BBYA 2WV0A 2O61A 3FKJA 4ZTFA 3OYBA 2V4JC 4CSWA 4OIRF 5J8CA 4ZZLA 2JA5J 4M3DA 4MQ9F 1XSXA 3SQNA 3AL0C 2M0MA 2XAFA 4BJ6C 4A3BJ 5FLXK 4R1HA 1XGNA 4JOMA 3LSIA 1EH7A 2XIGA 3EETA 5FB2A 1OCPA 4FX0A 4L0ZB 4AC0A 1BM9A 1LNWA 1IRFA 2BXZA 4RAZA 3BPXA 4E7ZA 1FLIA 3Q0VA 1QHHD 3HOWJ 3CC4I 2JUCA 3FXLA 1HKSA 3HOUJ 1FZPB 1QZYA 2YSRA 1O3SA 3OYHA 3FM3A 4OINF 2LF8A 2LH9A 5ILSA 3K10A 5J47A 2FMYA 3WTUC 5HNHA 1O3RA 2JVHA 1RC9A 4KYWA 5CVVA 2GM4A 2IJLA 1E3PA 2B63J 2COMA 5EG0A 2A05A 1L0OC 3WTZA 1MZBA 3GZ5A 4F91B 2VPRA 3ELKA 3F8CA 1JXSA 3GTJJ 1B4AA 3BJOA 4PSWA 5EJCA 3BR1A 4X0GA 1Z21A 3G1LA 4TV7A 3RSNA 1R9TJ 2HQNA 4BQQA 3A03A 5IYDJ 1JUSA 2ECCA 5J4YA 4KICA 3J81K 2DO7A 3C1DA 5KAFC 1AU7A 1S3JA 3BG7A 2L3DA 2M5WA 1E3HA 1QZZA 3RQIA 2E1MB 3TKYA 1UHSA 2ID6A 4EM2A 1XDUA 3H5NA 1QBJA 3FMRA 2FOWA 4UVBA 3PQKA 4EGYA 3U21A 1ETQA 2JRMA 1NG6A 3W6JB 4OMYA 4MFEA 4M6XA 1A36A 1GT0C 2A07F 2OZUA 2L4MA 3AKZA 2GQQA 2ADUA 3ZMUA 1SFOJ 4E7KA 3I4NJ 2E34A 2VC1A 5IT3A 3CC7I 3TGNA 3ZMVA 3B02A 4L9NA 1R58A 5IP7J 3JAMK 1X1PA 3HBLA 4P5OA 1H0MA 2V9KA 3S3MA 1I39A 1V3FA 3IH2A 5DM6F 4W1UA 4RAFA 1YW9A 2DXIA 4RLFA 1FSEA 3D5SC 1TNTA 1ZG3A 2KISA 3JRIA 3DEWA 1VQ8I 4U0YA 2RAEA 5GAHJ 3BCBA 1HW2A 1SMYF 1RKWA 4DYCA 3HKZN 4EJOA 1WJFA 3ABKH 3OSGA 1LDDA 2M3AA 3Q3SA 2KKOA 2FX0A 1R71A 2WWYA 3M1CA 3FKIJ 3QOEA 1XTAA 3MFKA 4YIFA 1TQMA 4LG3A 2IS4A 1YFHA 3IH3A 1FBQA 2CUEA 2ZC2A 1R6RA 1PP7U 3CUQA 3W2WA 3G71I 3RKQA 2DN0A 3REOA 1YIOA 2IGNA 4C2TA 2O9LA 2LFBA 4EV0A 2CH0A 3V7SA 5IP6A 3JTGA 3A0HC 3H9JA 4XICA 3RKWA 2D45A 3LNQA 3COAC 1G59A 1JI8A 1H9GA 2MA3A 1T6SA 2WB1A 5IYCJ 2CV0A 4NQWA 2L01A 3S2HJ 3KP3A 3B6AA 5HLHA 5IT9K 1J0RA 3DBHB 3QPSA 3F22A 2QSGX 2NOJB 1VZ0A 1J59A 2BW3A 2OF7A 2TCTA 1OR7A 4I09A 4W97A 1HDDC 5M3MJ 1E2XA 2GBYA 2QBYB 4ESJA 2IT0A 1RI7A 2VN2A 2IS2A 2HWVA 4HX4A 3A01A 1TQPA 4WXCA 2OAZA 1EF4A 4A69C 3U9GA 4A3LJ 2DK8A 4BY7J 2QA4I 1GV2A 1A5JA 4YIIA 3ZXSA 2CV2A 2VLAA 4BQAA 3RQ4A 1NK2P 1FPQA 1YW8A 1FJLA 2CQKA 1ETVA 4BUPA 4H4KC 1T38A 4MHGA 5FLXZ 5DUIA 3V7RA 3VYSB 2V9PA 4A5MA 3PIOF 5D6FA 1T39A 2R7XA 1Z91A 4KUMA 2Y9ZA 2MH9A 3V42A 3TW7A 1ZREA 4IRIA 2E7XA 5CVIA 5HVQC 3CCJI 3BQZA 4JP0A 2PG4A 3S8PA 3WG9A 4EMSA 2PFBA 2XDVA 4HV5A 2GZWA 4P1WA 5BQTA 4FHTA 1BC8C 2P6TA 2RC4A 4I02A 1N75A 2ZXIA 3E1SA 2DU9A 2HPIA 3TBIA 1TP4A 1WJ5A 2XGXA 4OU0A 1SAUA 3OIQA 4P55A 2FBKA 3ULQB 4UUSB 4HLXA 3WTSC 1I1GA 2E71A 5IOYA 4B44A 1MNMC 4UHTA 3OYCA 1P6RA 2IW5A 4CGZA 3J7AO 1MW7A 2HEOA 1HOMA 4XRSG 2MD0A 5DD4A 1RR7A 3C2BA 3J81Z 1TWFJ 3MKWB 3EUKL 4QPQA 3OYNA 4BEHA 5BMZA 3S1QJ 2WTEA 1U5TB 1TWGJ 1Y8RB 2DA2A 2NAZA 5EF6A 2E19A 5H6RA 2PMUA 1XPXA 2QQ9A 4YFNF 2O8KA 4XMYA 2FNAA 5DS9A 4BXFA 3F8FA 1Y0UA 4XONA 2GA2A 2DOAA 4G94A 2FBIA 1U5TC 5CQGA 5GTIC 4D7NA 2ZXJA 3DLAA 2EILH 3JAMZ 3OYKA 4XN3A 1G4DA 2M2EA 3L2WA 1ITYA 1K6OA 5HODA 1A6IA 1FIAA 2RVCA 4LG0B 3NWSA 2GLOA 2V6EA 1S5LC 4XR6A 2L54A 1IUYA 1BR4A 1CF7A 2IBDA 2DT7B 2W57A 5DYMA 1JKRC 1DQUA 2DQLA 1X58A 2WB1N 3DWLE 5CVJA 2CQQA 1JUPA 2M45A 3LA3A 2DBBA 2FA5A 1X1CA 4M9XA 2PMHA 4BACA 4XKBA 3FXMA 3CDLA 1IRXA 3P5JA 4QWQA 2M87A 3ONQA 1DDNA 1NTCA 1G6NA 2Y9YA 3I9V2 1MBKA 4M74A 5HS9A 3OOPA 3OL4A 2DA7A 1K6YA 1Z3XA 5ICCA 2KDOA 1Z6RA 3GFLA 2HVQA 4LIUA 3B73A 2KZGA 3PL8A 1FYKA 1LVKA 2WC2A 4CYDA 4B8XA 4WK8F 4A3JJ 2DFFA 1IC8A 5JI6A 4U87A 4UXNA 4AU7A 2M30A 4J01A 1HDPA 9ANTA 4E7HA 1FX7A 3E3VA 2RKHA 2OCEA 5JVGF 1MSEC 2NS0A 1B59A 1FIPA 3K4CA 2BY1A 4UB8C 3S93A 3DCFA 4I0AA 3HRMA 5LGTA 5E3MA 5IT9Z 1GVDA 2L7ZA 2GXAA 5FLMJ 3Q0WA 1VF9A 5FFXA 5DM7F 1MJBA 2OD5A 3VSLA 4D7MA 3QU3A 4XKWA 2JA7J 2P4WA 5CQEA 4LGWA 4CO8A 4A3FJ 1ZKGA 3HEFA 2W1OA 2OU2A 2Q2EB 3GBGA 2JRTA 2KIUA 4QPOA 4LB5A 4XKCA 1JGGA 1FTZA 1ZG5A 4KFCA 1Q1HA 3MMYB 3LSPA 5HDNA 2BHYA 1TZLA 4BXXJ 3E6MA 4MLOA 4MFDA 4N4NB 5K7FA 3BQYA 4BDYA 3GX4X 3CCSI 3CCLI 1LEAA 2MD5A 4FETA 3D5RC 5C4XJ 3OSFA 3ZQQA 4CYCB 3L2UA 2VKHA 3S3OA 4KT6A 2XF6A 3DXJF 4KN4X 3OYIA 1BL0A 3RKYA 2W00A 4XLFA 5C44J 3I53A 2RQPA 3WU2C 3JREA 4E7JA 3F6OA 1UFMA 2XC7A 4MGRA 1YX3A 2NNNA 3CP8A 3CO7C 3ZMSA 1FNNA 2VOOA 2DK5A 1I6XA 3E6BA 1G2HA 1QQIA 4P96A 4MEXF 5J8FA 1IXSB 3ZQGA 4RAGA 4HOBA 4FTHA 2QQBA 4RB1A 3PFIA 2ACJA 1EKEA 2EV5A 2HFHA 5HOOA 3HGYA 3D0SA 4BH9A 1BI2A 4G9YA 4FT8A 1HCRA 1MMDA 4BL0B 2X9DA 4LK1F 1ETYA 4GO1A 4I7HA 1YJWI 1WH5A 5E1XA 3KZIC 1KQ8A 5CYVA 5FKLA 3QRFF 4HG2A 3H3UA 2Q8KA 2AQFA 2X6YA 2VQHA 4OMZA 2WY7Q 4AM3A 2H27A 3M8FA 3QYBA 2XAJA 2QKMB 3CCQI 1K78A 5LGUA 1U9OA 1Z1DA 2QSFX 1T95A 2UZKA 4E4HA 3O6BB 1HF0A 1ON2A 3T0YA 2WY8Q 1V5GA 1YLFA 5ILVA 1HBXG 2K3FA 1JKPC 4HNUA 2DFEA 3DPUA 2LRDA 4KDPA 4E70A 4C3IJ 3OIOA 3I55I 1IW7F 4Z6YA 5K5QA 3WU0A 4CZCA 2JSPA 2VBWA 3RZDJ 2M7BA 2DMNA 2JQ7A 1YTYA 3WTTC 1LFPA 1BC7C 3PIPF 2R7QA 3GTOJ 4FQGA 2A6HF 2XSDC 3GTQJ 1YRNA 3P9IA 3CMAI 3SDGA 3V8KA 1R5ID 2ZBKA 1Y0NA 5KNLA 3WODF 2PX9A 5EG0B 1D0ZA 2XAHA 3R0AA 3CCMI 1ETOA 3GTGJ 4RB3C 5FGMA 4BAYA 3A2KA 3WGGA 5E3NA 3HXLA 4KIGA 4O3MA 1FYLA 1Z7LA 4IHXA 1A04A 5HS8A 4LB6B 4ON0A 2VJJA 5JHFA 4Q47A 4U7DA 2DYSH 2EZHA 3DP7A 4KIFA 4GFBA 4U7BA 4PCQA 4N9IA 3S2DJ 4C2UA 1TW3A 2HDCA 1YS7A 5F64A 2QQAA 5LHGA 3K70D 3ABMH 1W7PA 1X19A 4CCLA 4LIVA 1D8JA 4S04A 1IN6A 4B47A 3JTHA 3ESWB 5EEAA 2A6EF 2WAEA 4IXAA 4IPAA 3NARA 2HTJA 2BHZA 2NS7A 1SVLA 1KONA 2HYJA 4XQFA 2CRGA 2PJRA 5BOXA 1MH3A 3CJTB 2KIMA 2HNHA 1MNEA 1Z05A 3ISPA 5JR3A 2F2EA 1AKHA 3IKTA 2I8DA 2O3FA 4CA0A 4HPQA 3CO6C 1K4SA 2P81A 2WAQA 1GLNA 1IGNA 3MAJA 2IPQX 2IRFG 3G1MA 1FMWA 1MKMA 2BEOA 2OA4A 4FCYA 1IN5A 1N77A 4FASD 5C3EJ 5F1JA 3ZCOA 5E18F 1BI0A 1T08B 5E1ZB 3SZGA 1FEXA 4EJWA 3CJNA 3CMMA 5D6EA 3UKGA 2M8EA 4ZZDA 1D1BA 1TT0A 2LBFA 2DT6A 1BW5A 4XLHA 1Y1VJ 2KFDA 5HDKA 5C4JJ 5IYBJ 2DODA 4L5JA 5H6QA 3GZ6A 4N4OB 2K9SA 3SXYA 2UV1A 2EK5A 5HLIA 3QOPA 1VQ7I 4AVZA 2A68F 2X48A 5LEJA 3OR1C 3VFZA 4D9JA 1K61A 3MN2A 2VASA 3OY9A 1RZ4A 2EFPA 2K40A 1BIAA 3HOZJ 2VPLA 3BTIA 3K4LA 4BS9A 2LDUA 3BLYA 1U78A 1O4XA 2L7KA 3VOEA 1K79A 1R4MB 4L9TA 1QU3A 3CUQC 2FMLA 2BY0A 3SFIA 3FIWA 4M3GA 2QEXI 3I71A 4EM1A 3MVPA 1ZQ3P 4NQWB 1IXRC 2EZIA 1MDMB 4JQFA 2H6BA 5J1RA 3O2PE 2Z33A 2EWNA 4BYYA 2W82A 1U8BA 2LKSA 2ZMEB 3ZQFA 5HLGA 1MD0A 2DI3A 4M3EA 2LSOA 2D5VA 3KZYA 1LDJA 3K7AJ 3TL4X 5EEGA 1IRGA 3VYRB 1ERDA 5EGOA 1B8IA 1V54H 1UHMA 3EYYA 1VQ5I 2XPVA 2NYXA 3CLOA 2WADA 4DW6A 3A01B 5KAIC 3QYEA 4C9YA 2AS5F 1I50J 3OOUA 3WGHA 3AG4H 4PDKA 4KISA 3GTPJ 1OR7C 2JSCA 1ZAOA 2XPUA 5TGTA 5K7ZA 4IX7A 3AAFA 2XB0X 2XHKA 3ABLH 4C2MJ 4A0YA 5L3BA 1Z9CA 3FISA 2XAQA 5BPDA 2A69F 2HTSA 3QP5A 2HQAA 4ZDPA 4RBOA 3LWFA 3BTCA 3AL0B 1ZRCA 1G3WA 2Z1DA 2EIKH 3HC7A 1A35A 4RLQA 2VJ5A 1IDZA 1GXQA 1VQ4I 1X4OA 1JJ8C 2IXSA 4DNCA 2DT5A 1FBSA 5EDNA 5L3DA 3LL7A 2ZNYA 4AIKA 2IVMA 4IJAA 3BZCA 1VFCA 2VODA 2CG4A 3RIRA 1LPQA 1OCRH 3PFYA 1IAWA 3HTSB 2AQEA 3HG9A 1U8RA 1ZK8A 2O7OA 5J6XA 2W85A 2J5PA 1MMNA 3X2QH 3B6CA 1XCBA 3F8NA 2XB5A 1W7PD 2CYYA 3M8JA 1U3EM 2HPMA 1FBUA 2IA1A 1D3YA 3W6KB 1ETKA 2PEXA 3WG7H 3IRRA 4HNTA 1YG2A 2Z16A 4A6EA 2WAQN 1RNLA 1WFXA 1XGSA 1WHUA 5B66C 2R7VA 3OYDA 2TDXA 4ZJZA 5GPCA 3HTUA 4LFUA 2EH3A 2FJ1A 1X3ZB 4BQOA 3OR2C 3LSTA 1TTYA 3TP3A 2Y31A 4HA8A 4LLLA 4Z2YA 1USSA 1PDNC 1BJAA 2VJIA 2ZJPF 2VIXA 1QVTA 3SFZA 1I3QJ 1YYVA 3P9CA 1MIJA 4ETSA 2K27A 2ISYA 2M4KA 1W5CC 2IA0A 2GXBA 3GFIA 2G9WA 3FXKA 4JBAA 1D8KA 2WA0A 2V9VA 3JCUC 3M4OJ 1R22A 5D5WB 4M3BA 1XGMA 2DLLA 3ZRGA 3FZVA 3T1BA 3DKYA 3RPUD 1W4MA 1VQOI 3I5UA 1Y6IA 2BV6A 1A31A 1POGA 1ZYRF 3TDZC 1G8XA 2HDDA 2MFZA 4ENMA 5TRDA 3TP0A 3TO9A 1GUUA 3FMSA 3BJAA 3OV8A 1VQKI 5HNFA 3ZGKA 2EJRA 3KLNA 4HYEA 1FC3A 3R4KA 1WI9A 3TOBA 2CO5A 1HSTA 2JA2A 2FXAA 2H8WA 1HQCA 3HDDA 1U0JA 3WTWC 2NVXJ 2KQRA 1B1BA 2K7LA 1LFBA 4DBRA 3LAJA 4IOAF 3GCMA 3FXUA 4GDFA 2DYRH 4J19A 2X51A 3I58A 2X6OA 1DU0A 2OC6A 2L7FP 3BC8A 3MCZA 5CKTA 3SYTA 3HYIA 1X2MA 4U88A 2JJ7A 2VT3A 2STTA 3VWBA 4RGUA 2DA4A 3BG9A 3KX2A 4DZPA 3N4MA 1RUOA 4DJAA 1OYWA 2KJCA 3PM1A 4ZYDA 4PK4A
chains in the Genus database with same CATH topology
3L09A 2IA2A 3S2WA 3IL2A 3DQVC 2HGCA 5K5RA 2K4JA 1L3LA 2Y48A 2C6YA 2W24A 3DPLC 4GYIA 4M73A 3LQRA 3BDDA 2EV6A 2VE9A 3R61A 1O57A 3FXQA 3GF2A 3J80K 2YX7A 1PP8F 2RGVA 3HHHA 1HW5A 1REPC 5KK1A 1KU3A 1MJ9A 4HX7A 1KYWA 4XLPF 3MWMA 4LLNA 1QPMA 3ZN1A 1C0WA 5DV5A 2E1CA 2R7FA 2F5FA 1OYIA 3JSOA 2RV8A 3DPTA 4AD9A 3K2ZA 1P4WA 2DPUA 4HDVA 4UVCA 4P9FA 3F3XA 6PAXA 3K0LA 2D1VA 1O7FA 4I01A 5D4RA 5AONA 1HW1A 1LJ9A 5E8GA 3U1DA 3WGIA 5BS6A 1TQIA 2RNJA 5E20A 3FMQA 2K86A 2DQRA 5E1WA 2VT2A 4AVPA 3EQLF 1ONVA 3RYPA 3WE3A 1G3YA 2FRHA 2UXXA 1U6GA 1W5TA 4RB0A 4HQEA 3KP6A 1GHCA 5CVUA 2O8XA 4HDUA 1F9NA 2Z3YA 4D0PA 1J7KA 5ERIA 4MTEA 1WQ2A 2FF4A 3FM5A 5E17F 3M7GA 2FNPA 1HKQA 1XDSA 1LVAA 3DFGA 1RIOH 4A6DA 4KMFA 3RTRA 3LA2A 3NRVA 2P5KA 2P7VB 1SMTA 5KVRA 2IP2A 4LJZF 1R1TA 1O7LA 3MEXA 4HV6A 4WXDA 3KZZA 2P5VA 2EV0A 2FEZA 1Z6TA 4Y17A 3EYIA 5L3GA 3SHFA 4RGXA 3TO7A 2NNYA 5DUKA 1SFXA 4N9HA 2YU3A 4CZZA 1G3TA 2Z99A 4Y15A 4I98B 2VBXA 2MC3A 4HF2A 4G7OF 2G7UA 4EM0B 2HYGD 2HR3A 2K02A 1LB2A 4G8XA 2PQ8A 3G73A 4RS8A 2QM3A 3IHUA 4HF0A 4PGHA 5CLSA 2MBFA 2GAUA 4ENNA 1YQAA 3J80Z 2BGCA 3HHGA 2JTVA 5DCMB 4ZH4F 2QENA 5LRSA 4IHTA 3VEPA 4U0WA 4IVNA 5EEHA 4S05A 2HZTA 2EA2A 2H6CA 4L9VA 1R7JA 2ZJ2A 3RJPA 2HQRA 1T0FA 2P6SA 4RB2C 3T8RA 2RN7A 5H20A 3SZPA 4HF1A 2FSWA 2ZCWA 3EUHA 2XKPA 1TW2A 3GFMA 3WTVC 2QBYA 1X3UA 3QPHA 3H92A 3F72A 5K1YA 1DP7P 3SZTA 2O6GE 1F4KA 4GXOA 2EFOA 1SFEA 2ESHA 2ELHA 4HLYA 2EFQA 1EH8A 3I59B 3G3ZA 4L18B 2QVOA 2UXNA 2A61A 3DF8A 3F8BA 2CWEA 4K2EA 4EJTA 1ZN2A 3ZN0A 4O5VA 1WKMA 4WWCA 2Q0OA 1J9IA 1FP1D 3KEQA 1ON1A 3FX3A 1EH6A 4Q4ZF 3GYHX 3RI4A 5D4SA 5L3CA 4CXFA 3VB2A 3BOQA 3HOTA 2PI0A 3C3WA 1R23A 2PN6A 2CSOA 2QYOA 4UNOA 3I64A 4OIOF 1IN8A 3IWZA 3BY6A 1B9NA 4UVAA 3DKWA 3QAHA 4G7HF 3MZYA 4EJVA 1T2KA 2LNBA 5D5UB 3V8LA 4YFKF 4LG0A 4PZJA 2P8TA 4XSZF 4LMYA 2Z9OA 4ENKA 1KU2A 4O6JA 1D5VA 3GXOA 4BNCA 2GWRA 5ICGA 2QUFA 4MNUA 4NB5A 2XASA 1B6AA 4XRFA 4IRHA 5FFZA 3HSRA 1BI1A 2X0LA 2MLKA 3E6CC 1IZ1A 3K9TA 3V8JA 3HIFA 2JPBA 1S29A 1EV7A 4KT5C 4B09A 3F21A 2OBPA 4RAYA 3K1MA 5FO5A 3CUQB 3JSPA 3R0JA 4N0BA 5D8LB 1E17A 2Q2EA 3QPTA 1R5HA 2EFNA 3F23A 4GCVA 3C7JA 2V1UA 4A5NA 4MEYF 4CDGA 2JZYA 1QNTA 4UV8A 1XCVA 3F8MA 2OQRA 2QWWA 1OKRA 1KYZA 5L3FA 4YFXF 2PBIA 2VE8A 3TDUC 1OPCA 4R79A 3GWZA 1G3SA 3LA7A 3E5QA 4XBFA 4G6DA 4EGZA 4ESBA 1R5GA 4MQVA 1FP2A 4Q48A 1JHFA 1V4RA 2UWMA 4UV9A 4EJUA 1R1VA 3GO5A 3ROUA 2BYVE 2V1XA 1JGSA 2ZFWA 1IN4A 4EQQA 4AWXB 3JW4A 1P4AA 4YG2F 2Z5UA 5TJJA 4HX8A 4F7ZA 4QLCU 1NHAA 1RUNA 1ZARA 2R3SA 3HOSA 1DPRA 4R8HA 2D2WA 4M71A 1BIBA 1KU7A 5LGNA 5DD8A 4IRGA 1XGOA 3GFJA 3I54A 1ZH5A 1USTA 2FU4A 5LHIA 1CF7B 2ZNZA 1P2FA 4XLNF 3KLOA 4LK0F 3DV8A 2XRNA 2J5OA 2XVCA 3GUDA 3N97A 4CHUA 5D8KB 2ISZA 3KE2A 1WSUA 2GIVA 2GA1A 1XMAA 4M9SA 3ZPLA 3E6DA 4RGSA 2ZKZA 4OIQF 2HOEA 3Q9VA 1W5SA 2PJPA 2LKPA 1LDKB 1SAXA 2VBZA 2D1HA 4P9UA 3ECHA 2A5YB 3L2CA 3KCCA 2XV4S 2DFIA 1KA8A 3ZMDA 3CTAA 4KN7X 1F5TA 2XROA 5LEKA 3K69A 2YX4A 2VBYA 3MQ0A 2R7DA 2STWA 3M8EA 1SD5A 1ZHFA 3GW2A 4IF4A 2V1DA 2B0LA 3BPVA 2RDPA 3KP5A 4KA4A 3Q5FA 4M9ZA 4GYGA 3TQNA 3E5XA 3IKVA 1SD7A 4I0BA 1MDMA 2O0YA 4XSXF 2PLYA 3ZMZA 2ZMEA 1ZLKA 1HKTA 2L02A 2HYFA 1UCRA 3TOAA 2XKOA 1IN7A 4H0EA 2P7CB 4L5IA 1GXPA 1AOYA 3BWGA 1QO0D 4U0VA 3L9FA 3MZHA 4LD5A 1GVJA 2ZO4A 3P9KA 1S6LA 4I2OA 3FXRA 3HRUA 3R6SA 3FHZA 3LFKA 2DPDA 1ZGAA 2EFWA 1PUEE 1J75A 2HKXA 4DQ2A 4KNYA 1K78B 2KJBA 1T98A 2YPRA 3R60A 3ML6A 2FE3A 3WTYC 3HSEA 2EA4A 1OMIA 3BJ6A 3BP8A 3ABUA 4NHJA 3O3KA 5ILUA 4WF2A 1YS6A 4RGRA 2L4AA 4MTDA 2QLZA 2O03A 2LF7A 3ZP5A 3BZ6A 5LRRA 3KEOA 4ESFA 1VTNC 3P7NA 3KP7A 1WRJA 3L00A 5FD5A 1O3TA 1SD4A 1YO5C 1TNSA 2ETHA 5LLQA 4IHSA 2XUBA 1ZRFA 3RKXA 3I4PA 4A12A 1W7PB 3HSFA 2FBHA 5BPIA 1LQ1A 1ULYA 3RPQA 2JPCA 3CDHA 4JK1X 2QZ8A 3D5LA 2Y0MA 5AIPA 5D5XB 5F1RA 5A2QK 5DEQA 5K5OA 1FYMA 3ABTA 3T5XA 2A3SA 1XSDA 3CUOA 5HDGA 2HS5A 1FT9A 2DW4A 2Y75A 5FD6A 1FOKA 3KP2A 5ICEA 4BXUA 4AIJA 2P5LC 1DUXC 2H09A 1CGPA 2JT1A 2K4BA 4WX9A 1SD6A 2V6CA 3ERED 4PGGA 4WCGA 1K7AA 1YW7A 3Q9SA 1ZLJA 4ZYHA 1S8NA 1B9MA 4GGGA 3LQQA 4KMUX 2KRFA 3KFWX 3K1PA 1AWCA 2CGPA 1J2XA 2G7HA 3NQOA 2VC0A 1KQ0A 1FY7A 3V7CA 4A0ZA 2F5DA 2DAOA 4FX4A 3C18A 4UUVA 1IF1A 1R00A 2MLGA 3ZMTA 4EVIA 2EB7A 1JE8A 2DTRA 3BROA 5AIQA 2E7WA 4ZYEA 1ZRDA 1P92A 5CJ9A 1IXCA 2OZ6A 4AIHA 3WE2A 1P4XA 1U2WA 1LEBA 1H9TA 1XD7A 3ZQ7A 3HUGA 4LLGF 5CVRA 1HSJA 4L9JA 1KGSA 1WWXA 1U5TA 4Q5SF 5LHHA 1FWZA 5DDGA 1ZGJA 5JHUA 2NRAC 1FSHA 3RYRA 2F5CA 2W25A 1MGTA 4HBLA 3HRTA 3L7WA 1I1SA 3KETA 3E5UA 1TBXA 4BHPA 5ICFA 5DCFA 3T8TA 5E8IA 2XAGA 1HXDA 1TLHB 4HQMA 2VOPA 1I5ZA 3HRSA 3IRQA 3IWFA 1R1UA 1S7OA 5A2QZ 3TO6A 3M1EA 4G7ZF 1UB9A 3I0TA 3M9AA 3EDPA 4HZFA 4A2UA 4WXHA 2AXLA 1O3QA 1BN5A 5HS7A 4BHCA 2BE5F 3NEUA 2MH2A 3QP6A 2FOKA 1BOAA 2ESNA 4KIBA 4L0YB 1BBYA 1XB4A 5L3EA 2KIFA 1BI3A 3FF5A 4ASNA 2H94A 3U2RA 4BHBA 3DEUA 1JHHA 3F6VA 4OIPF 1ZG1A 4CICA 3WU1B 3RDIA 5DCMA 5JFRA 5F6FA 1DPUA 3LAPA 3E97A 3RPUA 3H3ZA 2V79A 1I27A 1Z7UA 2X4HA 2CFXA 5JVTA 3PQJA 4ZYGA 3GEZA 4OOIA 2VXZA 4HAMA 3FWEA 1OYYA 2M1BA 3GLXA 2YR2A 2CW0F 5LBQA 4ENJA 4G6QA 3V4GA 3IC7A 1STZA 1XMKA 1ODDA 4Y13A 2E1NA 2W84A 1KQ9A 3VODA 3KP4A 1KU9A 1XN7A 2OQGA 4M6YA 1UHWA 1R36A 2F5EA 3K1NA 1J5YA 4HW0A 2VONA 1XSVA 4M72A 5ED4A 1SFUA 3GVAA 3I59A 2GXGA 1S7AA 5D5VB 3QU6A 4A0XA 2FQ3A 1F1ZA 3WTXC 2HKOA 3ECOA 1MJAA 1QGPA 2BBYA 2WV0A 2O61A 4OIRF 5J8CA 4ZZLA 4MQ9F 3SQNA 1XSXA 2XAFA 5FLXK 4R1HA 1XGNA 1EH7A 2XIGA 3EETA 5FB2A 4FX0A 4L0ZB 1BM9A 1LNWA 1IRFA 4RAZA 3BPXA 1FLIA 1HKSA 1FZPB 1QZYA 2YSRA 1O3SA 3FM3A 4OINF 2LF8A 5ILSA 2FMYA 3WTUC 1O3RA 4KYWA 5CVVA 2IJLA 2COMA 1L0OC 3WTZA 1MZBA 3GZ5A 3ELKA 3F8CA 1JXSA 1B4AA 3BJOA 4TV7A 2HQNA 4KICA 3J81K 2DO7A 3C1DA 1S3JA 2L3DA 2M5WA 1QZZA 3TKYA 4EM2A 1QBJA 1XDUA 3FMRA 4UVBA 4EGYA 3PQKA 3W6JB 4OMYA 4M6XA 2A07F 2OZUA 2L4MA 2GQQA 2ADUA 3ZMUA 2VC1A 5IT3A 3TGNA 3ZMVA 3B02A 4L9NA 1R58A 3JAMK 1H0MA 4P5OA 1V3FA 1YW9A 1FSEA 1TNTA 1ZG3A 4U0YA 1HW2A 1SMYF 4EJOA 1LDDA 2KKOA 2WWYA 3MFKA 4YIFA 1TQMA 1YFHA 1FBQA 1PP7U 3CUQA 3REOA 1YIOA 4EV0A 3V7SA 3JTGA 3RKWA 2D45A 3COAC 1H9GA 2MA3A 1T6SA 4NQWA 2L01A 3KP3A 5HLHA 5IT9K 1J0RA 3F22A 1J59A 1OR7A 4I09A 1E2XA 2QBYB 4ESJA 2IT0A 1RI7A 2VN2A 2HWVA 4HX4A 1TQPA 4WXCA 2OAZA 3U9GA 2DK8A 4YIIA 4BQAA 1FPQA 1YW8A 2CQKA 1T38A 4MHGA 5FLXZ 5DUIA 3V7RA 4A5MA 5D6FA 1T39A 1Z91A 4KUMA 2MH9A 1ZREA 4IRIA 2E7XA 5CVIA 5HVQC 2PG4A 3WG9A 4EMSA 2PFBA 4HV5A 2GZWA 1BC8C 5BQTA 4FHTA 2P6TA 2RC4A 4I02A 2DU9A 2XGXA 4OU0A 4P55A 2FBKA 3ULQB 4HLXA 3WTSC 1I1GA 4UHTA 1P6RA 2IW5A 4CGZA 3J7AO 2HEOA 5DD4A 3J81Z 5BMZA 2WTEA 1U5TB 2NAZA 5H6RA 2PMUA 2QQ9A 4YFNF 2FNAA 3F8FA 1Y0UA 2GA2A 4G94A 2FBIA 1U5TC 2ZXJA 3JAMZ 1G4DA 1K6OA 2RVCA 4LG0B 2L54A 1IUYA 1CF7A 2W57A 5DYMA 2DQLA 5CVJA 2M45A 3LA3A 2DBBA 2FA5A 4M9XA 2PMHA 4QWQA 2M87A 1DDNA 1G6NA 4M74A 5HS9A 3OOPA 5ICCA 1Z6RA 3GFLA 3B73A 1FYKA 2WC2A 4CYDA 4B8XA 4WK8F 5JI6A 4UXNA 2M30A 1FX7A 3E3VA 2RKHA 2NS0A 1B59A 5LGTA 4I0AA 3HRMA 5IT9Z 5FFXA 1MJBA 2OD5A 3QU3A 2P4WA 4CO8A 4LGWA 2OU2A 2JRTA 2KIUA 4LB5A 1ZG5A 4KFCA 1Q1HA 5HDNA 3E6MA 3GX4X 1LEAA 2MD5A 3DXJF 4KN4X 3RKYA 3I53A 2RQPA 3F6OA 1UFMA 4MGRA 2NNNA 3CO7C 3ZMSA 1FNNA 2VOOA 2DK5A 1I6XA 3E6BA 1QQIA 4P96A 4MEXF 5J8FA 1IXSB 4HOBA 2QQBA 4RB1A 3PFIA 2ACJA 2EV5A 2HFHA 5HOOA 3D0SA 4BH9A 1BI2A 4G9YA 4FT8A 4LK1F 4GO1A 4I7HA 5E1XA 1KQ8A 5CYVA 3QRFF 3H3UA 2Q8KA 4OMZA 2H27A 3M8FA 2XAJA 1K78A 5LGUA 1Z1DA 2UZKA 3O6BB 1ON2A 3T0YA 5ILVA 1YLFA 1HBXG 4KDPA 4E70A 1IW7F 5K5QA 3WU0A 2VBWA 1YTYA 3WTTC 1BC7C 2A6HF 3P9IA 3V8KA 2ZBKA 3WODF 2XAHA 3R0AA 4RB3C 5FGMA 4BAYA 3WGGA 4KIGA 4O3MA 1FYLA 1A04A 5HS8A 4LB6B 4ON0A 4Q47A 4U7DA 3DP7A 4KIFA 4U7BA 4PCQA 4N9IA 1TW3A 2HDCA 1YS7A 5F64A 2QQAA 5LHGA 1W7PA 1D8JA 4S04A 1IN6A 3JTHA 2A6EF 4IXAA 4IPAA 2HTJA 5BOXA 2KIMA 1Z05A 3ISPA 5JR3A 2F2EA 3IKTA 2O3FA 3CO6C 2IRFG 3MAJA 2IPQX 1MKMA 2BEOA 2OA4A 1IN5A 5E18F 1BI0A 5E1ZB 4EJWA 3CJNA 5D6EA 2M8EA 4ZZDA 5HDKA 4L5JA 5H6QA 3GZ6A 3SXYA 2EK5A 5HLIA 3QOPA 2A68F 5LEJA 3VFZA 1RZ4A 2EFPA 1BIAA 2LDUA 1U78A 3VOEA 1K79A 4L9TA 3CUQC 2FMLA 3I71A 4EM1A 1IXRC 1MDMB 4JQFA 2H6BA 3O2PE 2Z33A 2EWNA 4BYYA 2ZMEB 5HLGA 1MD0A 2DI3A 2LSOA 3KZYA 1LDJA 5EEGA 1IRGA 1UHMA 3EYYA 2NYXA 3CLOA 2AS5F 3WGHA 4PDKA 2JSCA 1ZAOA 3AAFA 2XHKA 1Z9CA 4A0YA 5L3BA 2XAQA 5BPDA 2A69F 2HTSA 3QP5A 3LWFA 1ZRCA 1G3WA 1GXQA 4DNCA 2DT5A 1FBSA 5L3DA 4AIKA 2ZNYA 2IVMA 4IJAA 2VODA 2CG4A 3RIRA 1IAWA 3HTSB 1U8RA 5J6XA 2W85A 2J5PA 1XCBA 3F8NA 1W7PD 2CYYA 1U3EM 1FBUA 2IA1A 1D3YA 3W6KB 2PEXA 3IRRA 1YG2A 4A6EA 1RNLA 1XGSA 2TDXA 3HTUA 4LFUA 3LSTA 1TTYA 4HA8A 4LLLA 4Z2YA 1USSA 1PDNC 1BJAA 3SFZA 1YYVA 3P9CA 4ETSA 2K27A 2ISYA 2IA0A 2GXBA 3GFIA 2G9WA 4JBAA 1D8KA 2V9VA 1R22A 5D5WB 1XGMA 2DLLA 3FZVA 3T1BA 1W4MA 3I5UA 2BV6A 1ZYRF 3TDZC 4ENMA 5TRDA 3TO9A 3FMSA 3BJAA 3OV8A 2EJRA 3KLNA 4HYEA 1FC3A 3R4KA 1WI9A 3TOBA 2CO5A 1HSTA 2FXAA 1HQCA 3WTWC 1B1BA 2K7LA 3LAJA 3FXUA 3I58A 3MCZA 3HYIA 4U88A 2VT3A 2STTA 4RGUA 3N4MA 1RUOA 1OYWA 2KJCA 4ZYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L09 A;  2IA2 A;  3S2W A;  3IL2 A;  3DQV C;  2HGC A;  5K5R A;  2K4J A;  1L3L A;  2Y48 A;  2C6Y A;  2W24 A;  3DPL C;  4GYI A;  4M73 A;  3LQR A;  3BDD A;  2EV6 A;  2VE9 A;  3R61 A;  1O57 A;  3FXQ A;  3GF2 A;  3J80 K;  2YX7 A;  1PP8 F;  2RGV A;  3HHH A;  1HW5 A;  1REP C;  5KK1 A;  1KU3 A;  1MJ9 A;  4HX7 A;  1KYW A;  4XLP F;  3MWM A;  4LLN A;  1QPM A;  3ZN1 A;  1C0W A;  5DV5 A;  2E1C A;  2R7F A;  2F5F A;  1OYI A;  3JSO A;  2RV8 A;  3DPT A;  4AD9 A;  3K2Z A;  1P4W A;  2DPU A;  4HDV A;  4UVC A;  4P9F A;  3F3X A;  6PAX A;  3K0L A;  2D1V A;  1O7F A;  4I01 A;  5D4R A;  5AON A;  1HW1 A;  1LJ9 A;  5E8G A;  3U1D A;  3WGI A;  5BS6 A;  1TQI A;  2RNJ A;  5E20 A;  3FMQ A;  2K86 A;  2DQR A;  5E1W A;  2VT2 A;  4AVP A;  3EQL F;  1ONV A;  3RYP A;  3WE3 A;  1G3Y A;  2FRH A;  2UXX A;  1U6G A;  1W5T A;  4RB0 A;  4HQE A;  3KP6 A;  1GHC A;  5CVU A;  2O8X A;  4HDU A;  1F9N A;  2Z3Y A;  4D0P A;  1J7K A;  5ERI A;  4MTE A;  1WQ2 A;  2FF4 A;  3FM5 A;  5E17 F;  3M7G A;  2FNP A;  1HKQ A;  1XDS A;  1LVA A;  3DFG A;  1RIO H;  4A6D A;  4KMF A;  3RTR A;  3LA2 A;  3NRV A;  2P5K A;  2P7V B;  1SMT A;  5KVR A;  2IP2 A;  4LJZ F;  1R1T A;  1O7L A;  3MEX A;  4HV6 A;  4WXD A;  3KZZ A;  2P5V A;  2EV0 A;  2FEZ A;  1Z6T A;  4Y17 A;  3EYI A;  5L3G A;  3SHF A;  4RGX A;  3TO7 A;  2NNY A;  5DUK A;  1SFX A;  4N9H A;  2YU3 A;  4CZZ A;  1G3T A;  2Z99 A;  4Y15 A;  4I98 B;  2VBX A;  2MC3 A;  4HF2 A;  4G7O F;  2G7U A;  4EM0 B;  2HYG D;  2HR3 A;  2K02 A;  1LB2 A;  4G8X A;  2PQ8 A;  3G73 A;  4RS8 A;  2QM3 A;  3IHU A;  4HF0 A;  4PGH A;  5CLS A;  2MBF A;  2GAU A;  4ENN A;  1YQA A;  3J80 Z;  2BGC A;  3HHG A;  2JTV A;  5DCM B;  4ZH4 F;  2QEN A;  5LRS A;  4IHT A;  3VEP A;  4U0W A;  4IVN A;  5EEH A;  4S05 A;  2HZT A;  2EA2 A;  2H6C A;  4L9V A;  1R7J A;  2ZJ2 A;  3RJP A;  2HQR A;  1T0F A;  2P6S A;  4RB2 C;  3T8R A;  2RN7 A;  5H20 A;  3SZP A;  4HF1 A;  2FSW A;  2ZCW A;  3EUH A;  2XKP A;  1TW2 A;  3GFM A;  3WTV C;  2QBY A;  1X3U A;  3QPH A;  3H92 A;  3F72 A;  5K1Y A;  1DP7 P;  3SZT A;  2O6G E;  1F4K A;  4GXO A;  2EFO A;  1SFE A;  2ESH A;  2ELH A;  4HLY A;  2EFQ A;  1EH8 A;  3I59 B;  3G3Z A;  4L18 B;  2QVO A;  2UXN A;  2A61 A;  3DF8 A;  3F8B A;  2CWE A;  4K2E A;  4EJT A;  1ZN2 A;  3ZN0 A;  4O5V A;  1WKM A;  4WWC A;  2Q0O A;  1J9I A;  1FP1 D;  3KEQ A;  1ON1 A;  3FX3 A;  1EH6 A;  4Q4Z F;  3GYH X;  3RI4 A;  5D4S A;  5L3C A;  4CXF A;  3VB2 A;  3BOQ A;  3HOT A;  2PI0 A;  3C3W A;  1R23 A;  2PN6 A;  2CSO A;  2QYO A;  4UNO A;  3I64 A;  4OIO F;  1IN8 A;  3IWZ A;  3BY6 A;  1B9N A;  4UVA A;  3DKW A;  3QAH A;  4G7H F;  3MZY A;  4EJV A;  1T2K A;  2LNB A;  5D5U B;  3V8L A;  4YFK F;  4LG0 A;  4PZJ A;  2P8T A;  4XSZ F;  4LMY A;  2Z9O A;  4ENK A;  1KU2 A;  4O6J A;  1D5V A;  3GXO A;  4BNC A;  2GWR A;  5ICG A;  2QUF A;  4MNU A;  4NB5 A;  2XAS A;  1B6A A;  4XRF A;  4IRH A;  5FFZ A;  3HSR A;  1BI1 A;  2X0L A;  2MLK A;  3E6C C;  1IZ1 A;  3K9T A;  3V8J A;  3HIF A;  2JPB A;  1S29 A;  1EV7 A;  4KT5 C;  4B09 A;  3F21 A;  2OBP A;  4RAY A;  3K1M A;  5FO5 A;  3CUQ B;  3JSP A;  3R0J A;  4N0B A;  5D8L B;  1E17 A;  2Q2E A;  3QPT A;  1R5H A;  2EFN A;  3F23 A;  4GCV A;  3C7J A;  2V1U A;  4A5N A;  4MEY F;  4CDG A;  2JZY A;  1QNT A;  4UV8 A;  1XCV A;  3F8M A;  2OQR A;  2QWW A;  1OKR A;  1KYZ A;  5L3F A;  4YFX F;  2PBI A;  2VE8 A;  3TDU C;  1OPC A;  4R79 A;  3GWZ A;  1G3S A;  3LA7 A;  3E5Q A;  4XBF A;  4G6D A;  4EGZ A;  4ESB A;  1R5G A;  4MQV A;  1FP2 A;  4Q48 A;  1JHF A;  1V4R A;  2UWM A;  4UV9 A;  4EJU A;  1R1V A;  3GO5 A;  3ROU A;  2BYV E;  2V1X A;  1JGS A;  2ZFW A;  1IN4 A;  4EQQ A;  4AWX B;  3JW4 A;  1P4A A;  4YG2 F;  2Z5U A;  5TJJ A;  4HX8 A;  4F7Z A;  4QLC U;  1NHA A;  1RUN A;  1ZAR A;  2R3S A;  3HOS A;  1DPR A;  4R8H A;  2D2W A;  4M71 A;  1BIB A;  1KU7 A;  5LGN A;  5DD8 A;  4IRG A;  1XGO A;  3GFJ A;  3I54 A;  1ZH5 A;  1UST A;  2FU4 A;  5LHI A;  1CF7 B;  2ZNZ A;  1P2F A;  4XLN F;  3KLO A;  4LK0 F;  3DV8 A;  2XRN A;  2J5O A;  2XVC A;  3GUD A;  3N97 A;  4CHU A;  5D8K B;  2ISZ A;  3KE2 A;  1WSU A;  2GIV A;  2GA1 A;  1XMA A;  4M9S A;  3ZPL A;  3E6D A;  4RGS A;  2ZKZ A;  4OIQ F;  2HOE A;  3Q9V A;  1W5S A;  2PJP A;  2LKP A;  1LDK B;  1SAX A;  2VBZ A;  2D1H A;  4P9U A;  3ECH A;  2A5Y B;  3L2C A;  3KCC A;  2XV4 S;  2DFI A;  1KA8 A;  3ZMD A;  3CTA A;  4KN7 X;  1F5T A;  2XRO A;  5LEK A;  3K69 A;  2YX4 A;  2VBY A;  3MQ0 A;  2R7D A;  2STW A;  3M8E A;  1SD5 A;  1ZHF A;  3GW2 A;  4IF4 A;  2V1D A;  2B0L A;  3BPV A;  2RDP A;  3KP5 A;  4KA4 A;  3Q5F A;  4M9Z A;  4GYG A;  3TQN A;  3E5X A;  3IKV A;  1SD7 A;  4I0B A;  1MDM A;  2O0Y A;  4XSX F;  2PLY A;  3ZMZ A;  2ZME A;  1ZLK A;  1HKT A;  2L02 A;  2HYF A;  1UCR A;  3TOA A;  2XKO A;  1IN7 A;  4H0E A;  2P7C B;  4L5I A;  1GXP A;  1AOY A;  3BWG A;  1QO0 D;  4U0V A;  3L9F A;  3MZH A;  4LD5 A;  1GVJ A;  2ZO4 A;  3P9K A;  1S6L A;  4I2O A;  3FXR A;  3HRU A;  3R6S A;  3FHZ A;  3LFK A;  2DPD A;  1ZGA A;  2EFW A;  1PUE E;  1J75 A;  2HKX A;  4DQ2 A;  4KNY A;  1K78 B;  2KJB A;  1T98 A;  2YPR A;  3R60 A;  3ML6 A;  2FE3 A;  3WTY C;  3HSE A;  2EA4 A;  1OMI A;  3BJ6 A;  3BP8 A;  3ABU A;  4NHJ A;  3O3K A;  5ILU A;  4WF2 A;  1YS6 A;  4RGR A;  2L4A A;  4MTD A;  2QLZ A;  2O03 A;  2LF7 A;  3ZP5 A;  3BZ6 A;  5LRR A;  3KEO A;  4ESF A;  1VTN C;  3P7N A;  3KP7 A;  1WRJ A;  3L00 A;  5FD5 A;  1O3T A;  1SD4 A;  1YO5 C;  1TNS A;  2ETH A;  5LLQ A;  4IHS A;  2XUB A;  1ZRF A;  3RKX A;  3I4P A;  4A12 A;  1W7P B;  3HSF A;  2FBH A;  5BPI A;  1LQ1 A;  1ULY A;  3RPQ A;  2JPC A;  3CDH A;  4JK1 X;  2QZ8 A;  3D5L A;  2Y0M A;  5AIP A;  5D5X B;  5F1R A;  5A2Q K;  5DEQ A;  5K5O A;  1FYM A;  3ABT A;  3T5X A;  2A3S A;  1XSD A;  3CUO A;  5HDG A;  2HS5 A;  1FT9 A;  2DW4 A;  2Y75 A;  5FD6 A;  1FOK A;  3KP2 A;  5ICE A;  4BXU A;  4AIJ A;  2P5L C;  1DUX C;  2H09 A;  1CGP A;  2JT1 A;  2K4B A;  4WX9 A;  1SD6 A;  2V6C A;  3ERE D;  4PGG A;  4WCG A;  1K7A A;  1YW7 A;  3Q9S A;  1ZLJ A;  4ZYH A;  1S8N A;  1B9M A;  4GGG A;  3LQQ A;  4KMU X;  2KRF A;  3KFW X;  3K1P A;  1AWC A;  2CGP A;  1J2X A;  2G7H A;  3NQO A;  2VC0 A;  1KQ0 A;  1FY7 A;  3V7C A;  4A0Z A;  2F5D A;  2DAO A;  4FX4 A;  3C18 A;  4UUV A;  1IF1 A;  1R00 A;  2MLG A;  3ZMT A;  4EVI A;  2EB7 A;  1JE8 A;  2DTR A;  3BRO A;  5AIQ A;  2E7W A;  4ZYE A;  1ZRD A;  1P92 A;  5CJ9 A;  1IXC A;  2OZ6 A;  4AIH A;  3WE2 A;  1P4X A;  1U2W A;  1LEB A;  1H9T A;  1XD7 A;  3ZQ7 A;  3HUG A;  4LLG F;  5CVR A;  1HSJ A;  4L9J A;  1KGS A;  1WWX A;  1U5T A;  4Q5S F;  5LHH A;  1FWZ A;  5DDG A;  1ZGJ A;  5JHU A;  2NRA C;  1FSH A;  3RYR A;  2F5C A;  2W25 A;  1MGT A;  4HBL A;  3HRT A;  3L7W A;  1I1S A;  3KET A;  3E5U A;  1TBX A;  4BHP A;  5ICF A;  5DCF A;  3T8T A;  5E8I A;  2XAG A;  1HXD A;  1TLH B;  4HQM A;  2VOP A;  1I5Z A;  3HRS A;  3IRQ A;  3IWF A;  1R1U A;  1S7O A;  5A2Q Z;  3TO6 A;  3M1E A;  4G7Z F;  1UB9 A;  3I0T A;  3M9A A;  3EDP A;  4HZF A;  4A2U A;  4WXH A;  2AXL A;  1O3Q A;  1BN5 A;  5HS7 A;  4BHC A;  2BE5 F;  3NEU A;  2MH2 A;  3QP6 A;  2FOK A;  1BOA A;  2ESN A;  4KIB A;  4L0Y B;  1BBY A;  1XB4 A;  5L3E A;  2KIF A;  1BI3 A;  3FF5 A;  4ASN A;  2H94 A;  3U2R A;  4BHB A;  3DEU A;  1JHH A;  3F6V A;  4OIP F;  1ZG1 A;  4CIC A;  3WU1 B;  3RDI A;  5DCM A;  5JFR A;  5F6F A;  1DPU A;  3LAP A;  3E97 A;  3RPU A;  3H3Z A;  2V79 A;  1I27 A;  1Z7U A;  2X4H A;  2CFX A;  5JVT A;  3PQJ A;  4ZYG A;  3GEZ A;  4OOI A;  2VXZ A;  4HAM A;  3FWE A;  1OYY A;  2M1B A;  3GLX A;  2YR2 A;  2CW0 F;  5LBQ A;  4ENJ A;  4G6Q A;  3V4G A;  3IC7 A;  1STZ A;  1XMK A;  1ODD A;  4Y13 A;  2E1N A;  2W84 A;  1KQ9 A;  3VOD A;  3KP4 A;  1KU9 A;  1XN7 A;  2OQG A;  4M6Y A;  1UHW A;  1R36 A;  2F5E A;  3K1N A;  1J5Y A;  4HW0 A;  2VON A;  1XSV A;  4M72 A;  5ED4 A;  1SFU A;  3GVA A;  3I59 A;  2GXG A;  1S7A A;  5D5V B;  3QU6 A;  4A0X A;  2FQ3 A;  1F1Z A;  3WTX C;  2HKO A;  3ECO A;  1MJA A;  1QGP A;  2BBY A;  2WV0 A;  2O61 A;  4OIR F;  5J8C A;  4ZZL A;  4MQ9 F;  3SQN A;  1XSX A;  2XAF A;  5FLX K;  4R1H A;  1XGN A;  1EH7 A;  2XIG A;  3EET A;  5FB2 A;  4FX0 A;  4L0Z B;  1BM9 A;  1LNW A;  1IRF A;  4RAZ A;  3BPX A;  1FLI A;  1HKS A;  1FZP B;  1QZY A;  2YSR A;  1O3S A;  3FM3 A;  4OIN F;  2LF8 A;  5ILS A;  2FMY A;  3WTU C;  1O3R A;  4KYW A;  5CVV A;  2IJL A;  2COM A;  1L0O C;  3WTZ A;  1MZB A;  3GZ5 A;  3ELK A;  3F8C A;  1JXS A;  1B4A A;  3BJO A;  4TV7 A;  2HQN A;  4KIC A;  3J81 K;  2DO7 A;  3C1D A;  1S3J A;  2L3D A;  2M5W A;  1QZZ A;  3TKY A;  4EM2 A;  1QBJ A;  1XDU A;  3FMR A;  4UVB A;  4EGY A;  3PQK A;  3W6J B;  4OMY A;  4M6X A;  2A07 F;  2OZU A;  2L4M A;  2GQQ A;  2ADU A;  3ZMU A;  2VC1 A;  5IT3 A;  3TGN A;  3ZMV A;  3B02 A;  4L9N A;  1R58 A;  3JAM K;  1H0M A;  4P5O A;  1V3F A;  1YW9 A;  1FSE A;  1TNT A;  1ZG3 A;  4U0Y A;  1HW2 A;  1SMY F;  4EJO A;  1LDD A;  2KKO A;  2WWY A;  3MFK A;  4YIF A;  1TQM A;  1YFH A;  1FBQ A;  1PP7 U;  3CUQ A;  3REO A;  1YIO A;  4EV0 A;  3V7S A;  3JTG A;  3RKW A;  2D45 A;  3COA C;  1H9G A;  2MA3 A;  1T6S A;  4NQW A;  2L01 A;  3KP3 A;  5HLH A;  5IT9 K;  1J0R A;  3F22 A;  1J59 A;  1OR7 A;  4I09 A;  1E2X A;  2QBY B;  4ESJ A;  2IT0 A;  1RI7 A;  2VN2 A;  2HWV A;  4HX4 A;  1TQP A;  4WXC A;  2OAZ A;  3U9G A;  2DK8 A;  4YII A;  4BQA A;  1FPQ A;  1YW8 A;  2CQK A;  1T38 A;  4MHG A;  5FLX Z;  5DUI A;  3V7R A;  4A5M A;  5D6F A;  1T39 A;  1Z91 A;  4KUM A;  2MH9 A;  1ZRE A;  4IRI A;  2E7X A;  5CVI A;  5HVQ C;  2PG4 A;  3WG9 A;  4EMS A;  2PFB A;  4HV5 A;  2GZW A;  1BC8 C;  5BQT A;  4FHT A;  2P6T A;  2RC4 A;  4I02 A;  2DU9 A;  2XGX A;  4OU0 A;  4P55 A;  2FBK A;  3ULQ B;  4HLX A;  3WTS C;  1I1G A;  4UHT A;  1P6R A;  2IW5 A;  4CGZ A;  3J7A O;  2HEO A;  5DD4 A;  3J81 Z;  5BMZ A;  2WTE A;  1U5T B;  2NAZ A;  5H6R A;  2PMU A;  2QQ9 A;  4YFN F;  2FNA A;  3F8F A;  1Y0U A;  2GA2 A;  4G94 A;  2FBI A;  1U5T C;  2ZXJ A;  3JAM Z;  1G4D A;  1K6O A;  2RVC A;  4LG0 B;  2L54 A;  1IUY A;  1CF7 A;  2W57 A;  5DYM A;  2DQL A;  5CVJ A;  2M45 A;  3LA3 A;  2DBB A;  2FA5 A;  4M9X A;  2PMH A;  4QWQ A;  2M87 A;  1DDN A;  1G6N A;  4M74 A;  5HS9 A;  3OOP A;  5ICC A;  1Z6R A;  3GFL A;  3B73 A;  1FYK A;  2WC2 A;  4CYD A;  4B8X A;  4WK8 F;  5JI6 A;  4UXN A;  2M30 A;  1FX7 A;  3E3V A;  2RKH A;  2NS0 A;  1B59 A;  5LGT A;  4I0A A;  3HRM A;  5IT9 Z;  5FFX A;  1MJB A;  2OD5 A;  3QU3 A;  2P4W A;  4CO8 A;  4LGW A;  2OU2 A;  2JRT A;  2KIU A;  4LB5 A;  1ZG5 A;  4KFC A;  1Q1H A;  5HDN A;  3E6M A;  3GX4 X;  1LEA A;  2MD5 A;  3DXJ F;  4KN4 X;  3RKY A;  3I53 A;  2RQP A;  3F6O A;  1UFM A;  4MGR A;  2NNN A;  3CO7 C;  3ZMS A;  1FNN A;  2VOO A;  2DK5 A;  1I6X A;  3E6B A;  1QQI A;  4P96 A;  4MEX F;  5J8F A;  1IXS B;  4HOB A;  2QQB A;  4RB1 A;  3PFI A;  2ACJ A;  2EV5 A;  2HFH A;  5HOO A;  3D0S A;  4BH9 A;  1BI2 A;  4G9Y A;  4FT8 A;  4LK1 F;  4GO1 A;  4I7H A;  5E1X A;  1KQ8 A;  5CYV A;  3QRF F;  3H3U A;  2Q8K A;  4OMZ A;  2H27 A;  3M8F A;  2XAJ A;  1K78 A;  5LGU A;  1Z1D A;  2UZK A;  3O6B B;  1ON2 A;  3T0Y A;  5ILV A;  1YLF A;  1HBX G;  4KDP A;  4E70 A;  1IW7 F;  5K5Q A;  3WU0 A;  2VBW A;  1YTY A;  3WTT C;  1BC7 C;  2A6H F;  3P9I A;  3V8K A;  2ZBK A;  3WOD F;  2XAH A;  3R0A A;  4RB3 C;  5FGM A;  4BAY A;  3WGG A;  4KIG A;  4O3M A;  1FYL A;  1A04 A;  5HS8 A;  4LB6 B;  4ON0 A;  4Q47 A;  4U7D A;  3DP7 A;  4KIF A;  4U7B A;  4PCQ A;  4N9I A;  1TW3 A;  2HDC A;  1YS7 A;  5F64 A;  2QQA A;  5LHG A;  1W7P A;  1D8J A;  4S04 A;  1IN6 A;  3JTH A;  2A6E F;  4IXA A;  4IPA A;  2HTJ A;  5BOX A;  2KIM A;  1Z05 A;  3ISP A;  5JR3 A;  2F2E A;  3IKT A;  2O3F A;  3CO6 C;  2IRF G;  3MAJ A;  2IPQ X;  1MKM A;  2BEO A;  2OA4 A;  1IN5 A;  5E18 F;  1BI0 A;  5E1Z B;  4EJW A;  3CJN A;  5D6E A;  2M8E A;  4ZZD A;  5HDK A;  4L5J A;  5H6Q A;  3GZ6 A;  3SXY A;  2EK5 A;  5HLI A;  3QOP A;  2A68 F;  5LEJ A;  3VFZ A;  1RZ4 A;  2EFP A;  1BIA A;  2LDU A;  1U78 A;  3VOE A;  1K79 A;  4L9T A;  3CUQ C;  2FML A;  3I71 A;  4EM1 A;  1IXR C;  1MDM B;  4JQF A;  2H6B A;  3O2P E;  2Z33 A;  2EWN A;  4BYY A;  2ZME B;  5HLG A;  1MD0 A;  2DI3 A;  2LSO A;  3KZY A;  1LDJ A;  5EEG A;  1IRG A;  1UHM A;  3EYY A;  2NYX A;  3CLO A;  2AS5 F;  3WGH A;  4PDK A;  2JSC A;  1ZAO A;  3AAF A;  2XHK A;  1Z9C A;  4A0Y A;  5L3B A;  2XAQ A;  5BPD A;  2A69 F;  2HTS A;  3QP5 A;  3LWF A;  1ZRC A;  1G3W A;  1GXQ A;  4DNC A;  2DT5 A;  1FBS A;  5L3D A;  4AIK A;  2ZNY A;  2IVM A;  4IJA A;  2VOD A;  2CG4 A;  3RIR A;  1IAW A;  3HTS B;  1U8R A;  5J6X A;  2W85 A;  2J5P A;  1XCB A;  3F8N A;  1W7P D;  2CYY A;  1U3E M;  1FBU A;  2IA1 A;  1D3Y A;  3W6K B;  2PEX A;  3IRR A;  1YG2 A;  4A6E A;  1RNL A;  1XGS A;  2TDX A;  3HTU A;  4LFU A;  3LST A;  1TTY A;  4HA8 A;  4LLL A;  4Z2Y A;  1USS A;  1PDN C;  1BJA A;  3SFZ A;  1YYV A;  3P9C A;  4ETS A;  2K27 A;  2ISY A;  2IA0 A;  2GXB A;  3GFI A;  2G9W A;  4JBA A;  1D8K A;  2V9V A;  1R22 A;  5D5W B;  1XGM A;  2DLL A;  3FZV A;  3T1B A;  1W4M A;  3I5U A;  2BV6 A;  1ZYR F;  3TDZ C;  4ENM A;  5TRD A;  3TO9 A;  3FMS A;  3BJA A;  3OV8 A;  2EJR A;  3KLN A;  4HYE A;  1FC3 A;  3R4K A;  1WI9 A;  3TOB A;  2CO5 A;  1HST A;  2FXA A;  1HQC A;  3WTW C;  1B1B A;  2K7L A;  3LAJ A;  3FXU A;  3I58 A;  3MCZ A;  3HYI A;  4U88 A;  2VT3 A;  2STT A;  4RGU A;  3N4M A;  1RUO A;  1OYW A;  2KJC A;  4ZYD A; 
#chains in the Genus database with same CATH topology
 3A4C A;  1GDT A;  1TL8 A;  3L09 A;  2IA2 A;  4ITV A;  2VKE A;  3S2W A;  1E3O C;  1N78 A;  3IL2 A;  2QKL B;  2HDW A;  2WAF A;  1PVE A;  3DQV C;  4A3I J;  1WCM J;  2MSY A;  1IRZ A;  2HGC A;  5K5R A;  5B5E C;  2K4J A;  1L3L A;  2Y48 A;  2K5C A;  1VQP I;  3FBI B;  2W24 A;  2C6Y A;  1T8I A;  3DPL C;  4GYI A;  4XOT A;  3CCR I;  2K3P A;  4M73 A;  3LQR A;  3BDD A;  3TW6 A;  2EV6 A;  5GAE J;  2VE9 A;  3R61 A;  1O57 A;  1VI0 A;  3FXQ A;  4JX4 A;  3I4M J;  3GF2 A;  2X1E A;  4QIW N;  3J80 K;  2YX7 A;  1QA6 A;  3BG6 A;  1PP8 F;  2RGV A;  3HHH A;  1HW5 A;  3K70 C;  1REP C;  5KK1 A;  3MKY B;  1KU3 A;  3OYG A;  1MJ9 A;  4HX7 A;  1KYW A;  4XLP F;  1JKO C;  1VND A;  3MWM A;  4LLN A;  1QPM A;  3ZN1 A;  3CLQ A;  3PNV A;  2KRH A;  1JJ6 C;  4GRI A;  5DV5 A;  1C0W A;  2E1C A;  2R7F A;  1RET A;  2F5F A;  1Y8Q B;  2R5Y B;  4V19 K;  1OYI A;  2L9S A;  4DZJ A;  1YJ9 I;  3BTL A;  3OYM A;  4C30 A;  3JSO A;  1PUF B;  3BG5 A;  2ZFU A;  4I99 C;  2I5U A;  2RV8 A;  3DPT A;  2X6X A;  3CD6 I;  3S15 J;  4AD9 A;  3K2Z A;  3SJM A;  1APL C;  1LE8 B;  1P4W A;  2DPU A;  1UJ8 A;  4XM3 A;  4OAY A;  1A6Q A;  4HDV A;  1MBH A;  1IUF A;  4UVC A;  4P9F A;  3UNG C;  3F3X A;  3JRB A;  6PAX A;  1B72 B;  2KZV A;  2R7S A;  1Y56 A;  2QF7 A;  3K0L A;  2D1V A;  5H2F C;  1TWA J;  2LR8 A;  3J7Z I;  1OIS A;  1O7F A;  1X1D A;  2VQG A;  4CUG A;  4I01 A;  5D4R A;  3OWT A;  3MKZ A;  5M3F J;  5AON A;  1HW1 A;  4LIT A;  2BY3 A;  1LJ9 A;  5E8G A;  3U1D A;  3FHN A;  3W2A A;  3WGI A;  3H5A A;  3CJQ B;  5BS6 A;  3KYC B;  1TQI A;  2RNJ A;  4E7L A;  3CDI A;  2OJE D;  5E20 A;  4YRV A;  2DCE A;  3FMQ A;  2K86 A;  2DQR A;  5E1W A;  5GTH C;  2HXI A;  3HUG B;  2VT2 A;  3CCY A;  1FMV A;  3EQL F;  4AVP A;  5HLT A;  1ONV A;  4RM2 A;  1P9Q C;  3RYP A;  3WE3 A;  1G3Y A;  2FRH A;  3SEQ A;  4HRI A;  2UXX A;  1FTT A;  1U6G A;  1Q1V A;  4E7S A;  5LFA A;  1W5T A;  4RB0 A;  4HQE A;  2XPW A;  3I3L A;  2ECB A;  3KP6 A;  4BE2 A;  1GHC A;  5CVU A;  2ICW G;  2O8X A;  4HDU A;  4XNF A;  2X85 A;  4D5C A;  2F5V A;  1F9N A;  2Z3Y A;  4D0P A;  1J7K A;  2E2I J;  2LRE A;  5ERI A;  4KJZ A;  1M1E B;  4MTE A;  1WQ2 A;  2XGE A;  4HEA 2;  2FF4 A;  1BJZ A;  1V5E A;  1I3A A;  3FM5 A;  2DTZ A;  3PUF A;  5E17 F;  2F4I A;  3M7G A;  2FNP A;  2FQ4 A;  1HKQ A;  3FK6 A;  4IKF A;  1XDS A;  2BZT A;  1YIT I;  1LVA A;  3TMO A;  2ZSI B;  3DFG A;  1RIO H;  4A6D A;  4KMF A;  3RTR A;  3LA2 A;  3NRV A;  3G6E I;  2DA6 A;  2DA1 A;  2P5K A;  4C3H J;  3OYE A;  2P7V B;  1SMT A;  5KVR A;  1OLT A;  2IP2 A;  4LJZ F;  1R1T A;  1O7L A;  3MEX A;  4HV6 A;  4WXD A;  3LSJ A;  4NC6 A;  2EPF A;  3KZZ A;  3ZQC A;  1S72 I;  2CMP A;  2P5V A;  1ETX A;  2IGM A;  3QWL A;  3HPH A;  2EV0 A;  2FEZ A;  1Z6T A;  2MC4 A;  4Y17 A;  3EYI A;  1OCC H;  2HI3 A;  3CME I;  5L3G A;  3SHF A;  2VL8 A;  1Z67 A;  4RGX A;  3TO7 A;  3AG2 H;  4D1Q A;  2NNY A;  5DUK A;  1SFX A;  4N9H A;  2YU3 A;  4CZZ A;  4A3G J;  1G3T A;  2Z99 A;  4UUT A;  4Y15 A;  4I98 B;  2VBX A;  2PMZ A;  2MC3 A;  4HF2 A;  3ERM A;  5F0C A;  3HL2 A;  4G7O F;  2LVS A;  2G7U A;  4EM0 B;  1X3W B;  3I56 I;  1YI2 I;  1OQY A;  5B1A H;  4IQ4 A;  5KHD A;  3DBR B;  1BR1 A;  2HYG D;  2HR3 A;  5K7H A;  2K02 A;  1FOY A;  1LB2 A;  3E0J B;  4G8X A;  2PQ8 A;  3HGG A;  3G73 A;  4RS8 A;  2QM3 A;  3IHU A;  2DOF A;  4HF0 A;  1XC5 A;  4BBS J;  1YE9 A;  2NVY J;  4PGH A;  1JT6 A;  5CLS A;  3G1O A;  4F93 B;  2MBF A;  2GAU A;  4ENN A;  4DBQ A;  1YQA A;  5B3S H;  3ZOB A;  4F92 B;  2CV1 A;  3J80 Z;  2BGC A;  3OYA A;  3HHG A;  2JTV A;  5DCM B;  4ZH4 F;  4B43 A;  1RRJ A;  4PJL A;  2QEN A;  5LRS A;  4IHT A;  1NG7 A;  1WJC A;  3VEP A;  5GAG J;  4PFO A;  4U0W A;  1D1A A;  2HQ5 A;  4IVN A;  5EEH A;  4S05 A;  4B4C A;  2HZT A;  2EA2 A;  2H6C A;  4L9V A;  1R7J A;  2ZJ2 A;  2F4O B;  1OJL A;  2HQR A;  1T0F A;  4JYK A;  3RJP A;  3LSR A;  2P6S A;  3F0C A;  4RB2 C;  4NBQ A;  3T8R A;  4ZTJ A;  2RN7 A;  5H20 A;  2JMW A;  3SZP A;  1MBG A;  4HF1 A;  4A3C J;  3C2H A;  2FSW A;  2ZCW A;  3EUH A;  1NK3 P;  4NDL A;  2XKP A;  1TW2 A;  1IO2 A;  3GFM A;  3WTV C;  2QBY A;  1D0X A;  1X3U A;  2IS1 A;  2GIZ A;  3UR3 C;  1TC3 C;  3QPH A;  4CCM A;  4BQN A;  3H92 A;  3F72 A;  1W0U A;  1MND A;  1QPI A;  3FXJ A;  1RR8 C;  2K9L A;  5K1Y A;  2VKD A;  5F27 A;  1DP7 P;  1IJW C;  4Y4R A;  3K4M A;  4OAZ A;  4DYR A;  4RM3 A;  4XRS A;  3SZT A;  2O6G E;  2M34 A;  1F4K A;  3SDB A;  2EIJ H;  3HZJ A;  4GXO A;  2EFO A;  3PNT A;  1SFE A;  2MAB A;  2ESH A;  2ELH A;  4Y3O A;  2EFQ A;  4HLY A;  4A3E J;  1EH8 A;  3I59 B;  4II2 A;  2OCC H;  3G3Z A;  4IQJ A;  4RMN A;  4L18 B;  2QVO A;  2UXN A;  2A61 A;  3DF8 A;  3F8B A;  2L0K A;  2CWE A;  4K2E A;  4XLE A;  2Y0S N;  4FE7 A;  2NVT J;  4EJT A;  5F04 A;  1V55 H;  2L5Q A;  1ZN2 A;  3ZN0 A;  3W3C A;  4O5V A;  2DFH A;  1WKM A;  4F55 A;  2R7U A;  4WWC A;  2Q0O A;  3K4B A;  1J9I A;  1FP1 D;  4UUS A;  3KEQ A;  4IL6 C;  1ON1 A;  3FX3 A;  2RRE A;  1EH6 A;  4Q4Z F;  3GYH X;  3RI4 A;  1SC7 A;  5D4S A;  5L3C A;  3EPZ A;  4S0H B;  4CXF A;  3VB2 A;  3KYD B;  3BOQ A;  2EZK A;  3HOT A;  3S1N J;  1JUM A;  4M6V A;  2PMZ N;  4C3J J;  2PI0 A;  4CCO A;  3C3W A;  2AHQ A;  2O5R A;  2BY2 A;  1J09 A;  1ORK A;  4I76 A;  1R23 A;  3SEZ A;  2PN6 A;  2CSO A;  2QYO A;  1X4P A;  3LSK A;  4UNO A;  2K9Q A;  3I64 A;  1JT0 A;  2VB6 A;  4OIO F;  1IN8 A;  3IWZ A;  3BY6 A;  1W36 D;  1B9N A;  2R93 J;  4UVA A;  3DKW A;  3QAH A;  1RKT A;  3C2G A;  4G7H F;  3MZY A;  4EJV A;  5LD2 C;  1T2K A;  4B3A A;  1F43 A;  3PUB A;  4BY1 J;  4BKX A;  2LNB A;  2EQR A;  5D5U B;  3V8L A;  1LUJ B;  1D1C A;  3CES A;  4RA2 A;  4YFK F;  2NXN B;  3OS0 A;  4LG0 A;  5FLV A;  1IV8 A;  1H88 C;  3BR2 A;  2H1L A;  4PZJ A;  2P8T A;  4XSZ F;  4LMY A;  2LD5 A;  2Z9O A;  4ENK A;  1KU2 A;  4O6J A;  1D5V A;  4A93 J;  2QSH X;  3GXO A;  1FOW A;  4BNC A;  2GWR A;  5ICG A;  3PJR A;  2VJ4 A;  2YUS A;  2QUF A;  4MNU A;  3K4K A;  4NB5 A;  2XAS A;  1P7I A;  1UG0 A;  2DMP A;  1B6A A;  5FJ8 J;  4XRF A;  1P7J A;  4V2G A;  4IRH A;  2JN6 A;  1Z3Y A;  1BW6 A;  3HSR A;  4PJM A;  2XGC A;  5FFZ A;  3H35 A;  1R49 A;  3VPR A;  1BI1 A;  2X0L A;  2MLK A;  2ZJR F;  3FDY A;  3JRG A;  1DGW Y;  3E6C C;  4B3X A;  1IZ1 A;  3CCV I;  3K9T A;  1ZGW A;  2DDA A;  3V8J A;  3KPH A;  4XID A;  1ACI A;  3HIF A;  2L9R A;  2JPB A;  1S29 A;  3O8H A;  1EV7 A;  3PNY A;  2NS8 A;  1SAN A;  4KT5 C;  3MD2 A;  4B09 A;  1PYV A;  2CUJ A;  3F21 A;  1V5F A;  3EUA A;  3WHC A;  2OBP A;  4RAY A;  3K1M A;  5FO5 A;  3CUQ B;  3BTJ A;  3JSP A;  1WGX A;  5DTD A;  3R0J A;  4N0B A;  1YHQ I;  5D8L B;  3LSH A;  2CJJ A;  1E17 A;  2Q2E A;  2DMQ A;  2BVM A;  3QPT A;  2X1D A;  2M7A A;  1R5H A;  2EFN A;  3F23 A;  4GCV A;  3S32 A;  2DJN A;  3CCU I;  1X2N A;  2CS3 A;  2XAU A;  4ABZ A;  4IHV A;  4HNV A;  3C7J A;  2QQ8 A;  2GOX B;  3J7Y J;  2V1U A;  4A5N A;  4MEY F;  4CYC A;  1UMQ A;  1Y1W J;  4CDG A;  2KIQ A;  2EZL A;  2BW3 B;  2EIN H;  4CH7 A;  2JZY A;  1QNT A;  4UV8 A;  1VQM I;  1H8A C;  1XCV A;  2ZB9 A;  3F8M A;  2FD5 A;  1Y39 A;  5F0H A;  2E35 A;  3H9Q A;  2OQR A;  2QWW A;  1OKR A;  2KL4 A;  1KYZ A;  5L3F A;  5CPR B;  3BR6 A;  4YFX F;  2PBI A;  1XX5 A;  1I6H J;  4PFP A;  2ZXH A;  1ZTR A;  2VE8 A;  3TDU C;  3ZQI A;  1OPC A;  2BXY A;  3ASO H;  3HB9 A;  4R79 A;  3GWZ A;  1G3S A;  3LA7 A;  3E5Q A;  4XBF A;  2L7M P;  4G6D A;  3IH4 A;  4IZZ A;  2R7R A;  2R7O A;  3PO3 J;  3LOC A;  4RDU A;  2R5Z A;  4EGZ A;  2IAI A;  1IG7 A;  3S17 J;  4ESB A;  4Y7N J;  4NC8 A;  1R5G A;  1WJE A;  1FP2 A;  4MQV A;  4QSH A;  4Q48 A;  1WPK A;  2HOT A;  1WH7 A;  2XGD A;  1JHF A;  2M8G X;  5B1B H;  1V4R A;  2E60 A;  5IP9 J;  2UWM A;  4UV9 A;  2JVG A;  4EJU A;  1R1V A;  2ZSH B;  2CW8 A;  3GO5 A;  3ROU A;  1UAA A;  4F52 A;  3FXO A;  2BYV E;  3JRH A;  2V1X A;  3J7A Y;  1JGS A;  2ZXW H;  2ZFW A;  1IN4 A;  3DEE A;  4EQQ A;  4AWX B;  2K9N A;  3D1N I;  2M9H A;  4CCK A;  2HXO A;  3JW4 A;  2R92 J;  4XKV A;  3CP2 A;  1P4A A;  4YG2 F;  2UUZ A;  2Z5U A;  3VDX A;  2ZJQ F;  4CCN A;  4IO9 F;  5TJJ A;  4HX8 A;  4F7Z A;  1X1B A;  1WJA A;  5E3O A;  1QVU A;  2A5W A;  4QLC U;  1NHA A;  3H5R A;  5EZG A;  1RUN A;  1DP3 A;  1ZAR A;  3FK7 A;  2HU9 A;  4BEH B;  3HOY J;  2R3S A;  3LFU A;  4Y33 A;  3HOS A;  1DPR A;  2IS6 A;  4R8H A;  3L2R A;  3LMM A;  2D2W A;  4M71 A;  1VQN I;  2RNG A;  1BIB A;  2CW7 A;  1KU7 A;  1TT5 B;  3CCE I;  5LGN A;  5DD8 A;  4B1R A;  2OUM A;  2HOS A;  4IRG A;  2E36 A;  4ZDL A;  1XGO A;  4HSR A;  3GFJ A;  3I54 A;  3OMY A;  2EBI A;  2KLO A;  4PJJ A;  2LG4 A;  2Y69 H;  1ZH5 A;  1UST A;  2V1N A;  2FU4 A;  3AFH A;  1SFK A;  2IGK A;  5LHI A;  1CF7 B;  2ZNZ A;  2HZD A;  5JLX A;  1IV6 A;  4XRM A;  2E2H J;  1P2F A;  3H9G A;  4EAT A;  4XLN F;  3KLO A;  4LK0 F;  3DV8 A;  2XRN A;  3JRD A;  2J5O A;  2XVC A;  2CUF A;  3GUD A;  3N97 A;  4CHU A;  5D8K B;  5IY5 H;  5J40 A;  3MKL A;  2ISZ A;  3IAM 2;  3KE2 A;  4AID A;  3S3N A;  2GIV A;  1WSU A;  1YJN I;  2GA1 A;  1XMA A;  5TIS C;  2E1M C;  1WJD A;  4M9S A;  4AUX A;  3ZPL A;  5FRN A;  3E6D A;  4RGS A;  2ZKZ A;  2LC2 A;  4OIQ F;  2BOL A;  2HOE A;  2ME0 A;  4NC7 A;  3Q9V A;  5EYR A;  1W5S A;  2LLK A;  2Q1Z B;  3TED A;  2PJP A;  2LKP A;  1LDK B;  1SAX A;  5F08 A;  2VBZ A;  2D1H A;  1ETW A;  4P9U A;  3ASN H;  2KP6 A;  2A5Y B;  3ECH A;  3L2C A;  3KCC A;  2XV4 S;  2DFI A;  3L1P A;  1ZEL A;  1X1A A;  2XF7 A;  3MZ8 A;  1KA8 A;  3ZMD A;  4BE1 A;  2A6T A;  3CTA A;  2CFO A;  4DYQ A;  4KN7 X;  1F5T A;  2XRO A;  4XLA A;  2LY9 A;  5LEK A;  3K69 A;  4XLC A;  2YX4 A;  2VBY A;  3MQ0 A;  3RZO J;  2R7D A;  2STW A;  1W36 C;  3G2B A;  2V7F A;  4XN0 A;  4CCJ A;  3M8E A;  1SD5 A;  1ZHF A;  3GW2 A;  2M0C A;  2IEK A;  4IF4 A;  4UB6 C;  3AG1 H;  2V1D A;  3L2Q A;  2LP0 A;  2B0L A;  2ID3 A;  3BPV A;  1LFU P;  4XOR A;  4DGW B;  2RDP A;  3KP5 A;  4KA4 A;  3Q5F A;  4QTR A;  2KT0 A;  3BR5 A;  3JRF A;  4M9Z A;  4GYG A;  3TQN A;  1W0T A;  3IV5 A;  2M4G A;  3E5X A;  2DDB A;  1OFC X;  2KHM A;  2CUZ A;  3M07 A;  3IKV A;  4X1E A;  1SD7 A;  4I0B A;  2E5N A;  3K2A A;  1MDM A;  2O0Y A;  4BGD A;  4XSX F;  5M5X J;  2K85 A;  3ZMZ A;  2PLY A;  4PJN A;  2ZME A;  1ZR4 A;  1ZLK A;  1HKT A;  2L02 A;  2HYF A;  2R7Z J;  1T0F C;  1F36 A;  1UCR A;  3TOA A;  2XKO A;  3BG3 A;  1MBJ A;  1IN7 A;  4H0E A;  2P7C B;  1EJ9 A;  2LMD A;  4L5I A;  1GXP A;  4J00 A;  2F6C A;  3CZ6 A;  1AOY A;  1MMS A;  4F3Q A;  2V26 A;  3BWG A;  4Y52 J;  1S7E A;  3EUH C;  3GTM J;  1QO0 D;  1OCO H;  3H36 A;  4U0V A;  5EZH A;  2BVL A;  3L9F A;  2ELK A;  3MZH A;  4EEF G;  3U1K A;  4LD5 A;  2CQX A;  1GVJ A;  2COB A;  2ZO4 A;  3P9K A;  1S6L A;  3ZQL A;  4I2O A;  2ELJ A;  3FXR A;  3KYL A;  3HRU A;  3QOD A;  3R6S A;  2B7E A;  3FHZ A;  3LFK A;  2FUG 2;  3S16 J;  3E7L A;  2DPD A;  1ZGA A;  2NOG A;  3KIO A;  4FIS A;  2EFW A;  2R7T A;  2KRC A;  2N8G A;  1PUE E;  1J75 A;  2HKX A;  2W4S A;  4DQ2 A;  4KNY A;  1K78 B;  4X6A J;  4A3D J;  2KJB A;  1T98 A;  2VXD A;  2YPR A;  3R60 A;  3ML6 A;  2FE3 A;  4OWR B;  2X6W A;  4KIT B;  1BA5 A;  5FRO A;  1OCZ H;  3A02 A;  3K6G A;  4D5F A;  2E5Z A;  2JA8 J;  3NAU A;  3WTY C;  3HSE A;  5J4V A;  1UEL B;  1D5Y A;  2EA4 A;  2DOE A;  3H1C A;  1YOV B;  1OMI A;  1RES A;  2E2J J;  4PUS A;  3DLL F;  3BJ6 A;  3PSF A;  3BP8 A;  2LTP A;  3ABU A;  2LY1 A;  2KPM A;  4NHJ A;  4HST A;  2MW8 A;  1YRN B;  1OCT C;  3O3K A;  1ZR2 A;  5ILU A;  4WF2 A;  1YS6 A;  2VUM J;  5IPA A;  2HVR A;  3GTL J;  2YU9 J;  4RGR A;  2CQN A;  2OTL I;  2AO9 A;  2L4A A;  4YEL A;  3CJR B;  4MTD A;  3OYJ A;  2QLZ A;  4DOZ A;  2O03 A;  1SEU A;  4ZC3 A;  2HOA A;  2F48 A;  2LF7 A;  3ZP5 A;  5GAD J;  1TWC J;  3BZ6 A;  2WBM A;  5LRR A;  3KEO A;  4ESF A;  1VTN C;  3P7N A;  3PO2 J;  2X1C A;  1WRJ A;  3KP7 A;  2Y0S A;  3L00 A;  5FD5 A;  2NVQ J;  1O3T A;  1SD4 A;  1YO5 C;  1K4T A;  1TNS A;  3QYF A;  2LK2 A;  2ETH A;  5LLQ A;  4II3 A;  4IHS A;  2Y30 A;  1MSF C;  2XUB A;  3CC2 I;  1ZRF A;  3RKX A;  3I4P A;  4A12 A;  1W7P B;  1HLV A;  3HSF A;  5GPA A;  3PSI A;  2EIM H;  1U9N A;  2FBH A;  4IHW A;  3O8G A;  5BPI A;  3AG3 H;  3FBN B;  2PJR B;  2QGU A;  1LQ1 A;  1ULY A;  3RPQ A;  1AKH B;  1N25 A;  2HVS A;  2JPC A;  2MGQ A;  3CDH A;  1KZH A;  4JK1 X;  2QZ8 A;  3D5L A;  2Y0M A;  4E7I A;  2LOO A;  5M5Y J;  3N05 A;  3BZK A;  2K9M A;  5AIP A;  5D5X B;  5F1R A;  5A2Q K;  4YIR X;  5DEQ A;  5K5O A;  2LKX A;  1NH3 A;  4E6K G;  1FYM A;  3ABT A;  3T5X A;  2OPT A;  2JUG A;  4M3F A;  2A3S A;  4BJ5 C;  1XSD A;  2LBF B;  4MIM A;  4AYB A;  3CUO A;  5HDG A;  1VQL I;  2R0Q C;  2HS5 A;  1S9H A;  2Z2S B;  3CF2 A;  1FT9 A;  3GTK J;  4XOP A;  2DW4 A;  2OV7 A;  2Y75 A;  5FD6 A;  1MBE A;  1FOK A;  3KP2 A;  5ICE A;  4BXU A;  4PSX A;  2VQC A;  4AIJ A;  4LOC A;  2P5L C;  3IAS 2;  1DUX C;  5JLW A;  1BOB A;  2H09 A;  1YIJ I;  2ME6 A;  1CGP A;  2JT1 A;  3OYF A;  2K4B A;  2JWT A;  4WX9 A;  1SD6 A;  1XMX A;  1WI3 A;  1BR2 A;  2V6C A;  4BDZ A;  3ERE D;  5GP9 A;  2JA6 J;  1DGR M;  2H8R A;  4PGG A;  4WCG A;  3NWT A;  1K7A A;  4XK4 A;  1YW7 A;  3Q9S A;  4DIQ A;  1K83 J;  1ZLJ A;  4ZYH A;  1RPW A;  2CQ7 A;  5F0F A;  1S8N A;  4I6Z A;  1B9M A;  4GGG A;  3LQQ A;  5EGO B;  2R5Y A;  1B8I B;  2JK3 A;  4KMU X;  2KRF A;  3KFW X;  3K1P A;  1AWC A;  1PUF A;  2R4G A;  3G4S I;  3DTE A;  2CGP A;  1J2X A;  3M3Y J;  2G7H A;  3DU5 A;  2I10 A;  1JTY A;  3NQO A;  2VC0 A;  1KQ0 A;  2KMU A;  1FY7 A;  3JR9 A;  1DU6 A;  3V7C A;  4A0Z A;  1LE8 A;  3H0D A;  2F5D A;  2DAO A;  4FX4 A;  3C18 A;  4UUV A;  1XG1 A;  1IF1 A;  1R00 A;  3A0B C;  2MLG A;  3GZN B;  2LY2 A;  3ZMT A;  2R5Z B;  4EVI A;  3OS2 A;  2EB7 A;  1JE8 A;  2DTR A;  1TWH J;  3GME A;  1B72 A;  3QQA A;  3BRO A;  5AIQ A;  1IDY A;  2L9N A;  2E7W A;  5FKK A;  3DKX A;  4ZYE A;  1ZRD A;  4XL9 A;  1P92 A;  5CJ9 A;  1IXC A;  2OZ6 A;  4V2F A;  2W48 A;  2H1K A;  1UZC A;  4L5E A;  4NUB A;  2AXT C;  4AIH A;  3WHB A;  4BBR J;  5M5W J;  3WE2 A;  3OYL A;  1P4X A;  1R4N B;  3JRC A;  1U2W A;  1LEB A;  1H9T A;  1XD7 A;  3ZQ7 A;  3HUG A;  1VQ6 I;  1EA3 A;  4LLG F;  5CVR A;  2IGO A;  1HSJ A;  3RCO A;  5E3L A;  4L9J A;  5E79 C;  3OL3 A;  5FKN A;  1KGS A;  1WWX A;  2QCO A;  1U5T A;  2LYC A;  4Q5S F;  1GV5 A;  4G12 A;  1T33 A;  5LHH A;  1FWZ A;  1SVM A;  1Z77 A;  1HA8 A;  3BR3 A;  1D0Y A;  5DDG A;  1ZGJ A;  1AHD P;  2MG4 A;  5JHU A;  1E0E A;  2GOM A;  2NRA C;  2DMT A;  4ZDO A;  2DA3 A;  3BCA A;  3S14 J;  1FSH A;  3DTI A;  5J1Y A;  3RYR A;  2G0E A;  2F5C A;  2W25 A;  1ENH A;  1MGT A;  4HBL A;  2YS9 A;  3HRT A;  3L7W A;  2XF5 A;  4AYB N;  4UY8 I;  3S1R J;  4FE4 A;  1FOX A;  4B48 A;  1I1S A;  2RQQ A;  3CQZ J;  3KET A;  1LKX A;  3A1Y A;  3E5U A;  1TBX A;  3VSK A;  4G6T B;  2XSJ C;  4BHP A;  5ICF A;  3W2V A;  5DCF A;  3T8T A;  5E8I A;  3H3V K;  2XAG A;  1HXD A;  2DA5 A;  1TLH B;  3OIP A;  4HQM A;  2VOP A;  4JX6 A;  1I5Z A;  1UG2 A;  3HRS A;  3IRQ A;  4IHY A;  2VKV A;  1R1U A;  3IWF A;  1S7O A;  5A2Q Z;  1VQ9 I;  3TO6 A;  3DTK A;  3M1E A;  4G7Z F;  1UB9 A;  3I0T A;  2NVU B;  3M9A A;  3EDP A;  4HZF A;  4A2U A;  1Z0X A;  2Y2Z A;  4WXH A;  3VYT B;  4YEJ A;  1HC8 A;  2AXL A;  1O3Q A;  1BN5 A;  5HS7 A;  3VYU B;  4MO7 A;  4A3M J;  4BHC A;  2BE5 F;  4BJT A;  2L2O A;  3NEU A;  3HM5 A;  1XS9 A;  2MH2 A;  3QP6 A;  2FOK A;  1MMA A;  1BOA A;  2ESN A;  4KIB A;  5IOZ A;  4L0Y B;  1WZ2 A;  2E1O A;  1BBY A;  1XB4 A;  3S1M J;  5L3E A;  2KIF A;  1WJB A;  1BI3 A;  3FF5 A;  3ZQH A;  4ASN A;  1W1W E;  1WVR A;  1JKQ C;  1QHG A;  2H94 A;  3U2R A;  4BHB A;  3HOX J;  3DEU A;  3K4J A;  1JHH A;  2VQL A;  3F6V A;  4OIP F;  3BR0 A;  5J1U A;  2B9S A;  1ZG1 A;  3OS1 A;  1QRY A;  2VI6 A;  2R7W A;  4CIC A;  5FRM A;  3WU1 B;  3RDI A;  3CF5 F;  5DCM A;  3ZR8 X;  5JFR A;  4ZYA A;  3W6V A;  5F6F A;  1DPU A;  3LAP A;  2DMU A;  3E97 A;  2OTJ I;  2CU7 A;  3GLL A;  3LSG A;  3H3Z A;  2TRT A;  3RPU A;  2V79 A;  1T56 A;  1I27 A;  1Z7U A;  2X4H A;  2CFX A;  5JVT A;  3PQJ A;  4ZYG A;  3HOV J;  3GEZ A;  3DBL B;  1YX5 A;  4OOI A;  1CQT A;  2VXZ A;  4HAM A;  3FWE A;  3Q0U A;  3F9K A;  1AA7 A;  5KCM A;  4BE0 A;  3JRA A;  1JTX A;  4NNJ A;  5FKO A;  1OYY A;  1MBF A;  1MMG A;  2M1B A;  3LSM A;  3GLX A;  4A3K J;  4IEJ A;  4ANJ A;  2YR2 A;  2CW0 F;  5LBQ A;  4ENJ A;  2XRL A;  4G6Q A;  4PJ0 C;  3CMY A;  3V4G A;  4IOC F;  3IC7 A;  1STZ A;  1XMK A;  1ODD A;  1PJR A;  2P0W A;  3BT9 A;  2E1N A;  4Y13 A;  2L9V A;  2W84 A;  2MYS A;  1KQ9 A;  3VOD A;  2KDZ A;  3HKZ A;  3KP4 A;  5FKM A;  1MH4 A;  1H89 C;  1KU9 A;  1XN7 A;  2OQG A;  4M6Y A;  2WV1 A;  1UHW A;  1R36 A;  2F5E A;  2DJI A;  1J5Y A;  2ZME C;  3K1N A;  2F4M B;  4HW0 A;  2VON A;  3IUO A;  5J3L A;  1XSV A;  4M72 A;  5BNG A;  3K4N A;  5ED4 A;  4JX5 A;  1SFU A;  3QPL A;  3H0G J;  3GVA A;  3I59 A;  4BU2 A;  2GXG A;  3KEY A;  3HPG A;  1S7A A;  5D5V B;  2W7N A;  3QU6 A;  4A0X A;  2FQ3 A;  1QZE A;  1F1Z A;  3HJE A;  3IP4 B;  3WTX C;  2HKO A;  3ECO A;  1MJA A;  3L2V A;  1QGP A;  1SVO A;  3DU6 A;  2BBY A;  2WV0 A;  2O61 A;  3FKJ A;  4ZTF A;  3OYB A;  2V4J C;  4CSW A;  4OIR F;  5J8C A;  4ZZL A;  2JA5 J;  4M3D A;  4MQ9 F;  1XSX A;  3SQN A;  3AL0 C;  2M0M A;  2XAF A;  4BJ6 C;  4A3B J;  5FLX K;  4R1H A;  1XGN A;  4JOM A;  3LSI A;  1EH7 A;  2XIG A;  3EET A;  5FB2 A;  1OCP A;  4FX0 A;  4L0Z B;  4AC0 A;  1BM9 A;  1LNW A;  1IRF A;  2BXZ A;  4RAZ A;  3BPX A;  4E7Z A;  1FLI A;  3Q0V A;  1QHH D;  3HOW J;  3CC4 I;  2JUC A;  3FXL A;  1HKS A;  3HOU J;  1FZP B;  1QZY A;  2YSR A;  1O3S A;  3OYH A;  3FM3 A;  4OIN F;  2LF8 A;  2LH9 A;  5ILS A;  3K10 A;  5J47 A;  2FMY A;  3WTU C;  5HNH A;  1O3R A;  2JVH A;  1RC9 A;  4KYW A;  5CVV A;  2GM4 A;  2IJL A;  1E3P A;  2B63 J;  2COM A;  5EG0 A;  2A05 A;  1L0O C;  3WTZ A;  1MZB A;  3GZ5 A;  4F91 B;  2VPR A;  3ELK A;  3F8C A;  1JXS A;  3GTJ J;  1B4A A;  3BJO A;  4PSW A;  5EJC A;  3BR1 A;  4X0G A;  1Z21 A;  3G1L A;  4TV7 A;  3RSN A;  1R9T J;  2HQN A;  4BQQ A;  3A03 A;  5IYD J;  1JUS A;  2ECC A;  5J4Y A;  4KIC A;  3J81 K;  2DO7 A;  3C1D A;  5KAF C;  1AU7 A;  1S3J A;  3BG7 A;  2L3D A;  2M5W A;  1E3H A;  1QZZ A;  3RQI A;  2E1M B;  3TKY A;  1UHS A;  2ID6 A;  4EM2 A;  1XDU A;  3H5N A;  1QBJ A;  3FMR A;  2FOW A;  4UVB A;  3PQK A;  4EGY A;  3U21 A;  1ETQ A;  2JRM A;  1NG6 A;  3W6J B;  4OMY A;  4MFE A;  4M6X A;  1A36 A;  1GT0 C;  2A07 F;  2OZU A;  2L4M A;  3AKZ A;  2GQQ A;  2ADU A;  3ZMU A;  1SFO J;  4E7K A;  3I4N J;  2E34 A;  2VC1 A;  5IT3 A;  3CC7 I;  3TGN A;  3ZMV A;  3B02 A;  4L9N A;  1R58 A;  5IP7 J;  3JAM K;  1X1P A;  3HBL A;  4P5O A;  1H0M A;  2V9K A;  3S3M A;  1I39 A;  1V3F A;  3IH2 A;  5DM6 F;  4W1U A;  4RAF A;  1YW9 A;  2DXI A;  4RLF A;  1FSE A;  3D5S C;  1TNT A;  1ZG3 A;  2KIS A;  3JRI A;  3DEW A;  1VQ8 I;  4U0Y A;  2RAE A;  5GAH J;  3BCB A;  1HW2 A;  1SMY F;  1RKW A;  4DYC A;  3HKZ N;  4EJO A;  1WJF A;  3ABK H;  3OSG A;  1LDD A;  2M3A A;  3Q3S A;  2KKO A;  2FX0 A;  1R71 A;  2WWY A;  3M1C A;  3FKI J;  3QOE A;  1XTA A;  3MFK A;  4YIF A;  1TQM A;  4LG3 A;  2IS4 A;  1YFH A;  3IH3 A;  1FBQ A;  2CUE A;  2ZC2 A;  1R6R A;  1PP7 U;  3CUQ A;  3W2W A;  3G71 I;  3RKQ A;  2DN0 A;  3REO A;  1YIO A;  2IGN A;  4C2T A;  2O9L A;  2LFB A;  4EV0 A;  2CH0 A;  3V7S A;  5IP6 A;  3JTG A;  3A0H C;  3H9J A;  4XIC A;  3RKW A;  2D45 A;  3LNQ A;  3COA C;  1G59 A;  1JI8 A;  1H9G A;  2MA3 A;  1T6S A;  2WB1 A;  5IYC J;  2CV0 A;  4NQW A;  2L01 A;  3S2H J;  3KP3 A;  3B6A A;  5HLH A;  5IT9 K;  1J0R A;  3DBH B;  3QPS A;  3F22 A;  2QSG X;  2NOJ B;  1VZ0 A;  1J59 A;  2BW3 A;  2OF7 A;  2TCT A;  1OR7 A;  4I09 A;  4W97 A;  1HDD C;  5M3M J;  1E2X A;  2GBY A;  2QBY B;  4ESJ A;  2IT0 A;  1RI7 A;  2VN2 A;  2IS2 A;  2HWV A;  4HX4 A;  3A01 A;  1TQP A;  4WXC A;  2OAZ A;  1EF4 A;  4A69 C;  3U9G A;  4A3L J;  2DK8 A;  4BY7 J;  2QA4 I;  1GV2 A;  1A5J A;  4YII A;  3ZXS A;  2CV2 A;  2VLA A;  4BQA A;  3RQ4 A;  1NK2 P;  1FPQ A;  1YW8 A;  1FJL A;  2CQK A;  1ETV A;  4BUP A;  4H4K C;  1T38 A;  4MHG A;  5FLX Z;  5DUI A;  3V7R A;  3VYS B;  2V9P A;  4A5M A;  3PIO F;  5D6F A;  1T39 A;  2R7X A;  1Z91 A;  4KUM A;  2Y9Z A;  2MH9 A;  3V42 A;  3TW7 A;  1ZRE A;  4IRI A;  2E7X A;  5CVI A;  5HVQ C;  3CCJ I;  3BQZ A;  4JP0 A;  2PG4 A;  3S8P A;  3WG9 A;  4EMS A;  2PFB A;  2XDV A;  4HV5 A;  2GZW A;  4P1W A;  5BQT A;  4FHT A;  1BC8 C;  2P6T A;  2RC4 A;  4I02 A;  1N75 A;  2ZXI A;  3E1S A;  2DU9 A;  2HPI A;  3TBI A;  1TP4 A;  1WJ5 A;  2XGX A;  4OU0 A;  1SAU A;  3OIQ A;  4P55 A;  2FBK A;  3ULQ B;  4UUS B;  4HLX A;  3WTS C;  1I1G A;  2E71 A;  5IOY A;  4B44 A;  1MNM C;  4UHT A;  3OYC A;  1P6R A;  2IW5 A;  4CGZ A;  3J7A O;  1MW7 A;  2HEO A;  1HOM A;  4XRS G;  2MD0 A;  5DD4 A;  1RR7 A;  3C2B A;  3J81 Z;  1TWF J;  3MKW B;  3EUK L;  4QPQ A;  3OYN A;  4BEH A;  5BMZ A;  3S1Q J;  2WTE A;  1U5T B;  1TWG J;  1Y8R B;  2DA2 A;  2NAZ A;  5EF6 A;  2E19 A;  5H6R A;  2PMU A;  1XPX A;  2QQ9 A;  4YFN F;  2O8K A;  4XMY A;  2FNA A;  5DS9 A;  4BXF A;  3F8F A;  1Y0U A;  4XON A;  2GA2 A;  2DOA A;  4G94 A;  2FBI A;  1U5T C;  5CQG A;  5GTI C;  4D7N A;  2ZXJ A;  3DLA A;  2EIL H;  3JAM Z;  3OYK A;  4XN3 A;  1G4D A;  2M2E A;  3L2W A;  1ITY A;  1K6O A;  5HOD A;  1A6I A;  1FIA A;  2RVC A;  4LG0 B;  3NWS A;  2GLO A;  2V6E A;  1S5L C;  4XR6 A;  2L54 A;  1IUY A;  1BR4 A;  1CF7 A;  2IBD A;  2DT7 B;  2W57 A;  5DYM A;  1JKR C;  1DQU A;  2DQL A;  1X58 A;  2WB1 N;  3DWL E;  5CVJ A;  2CQQ A;  1JUP A;  2M45 A;  3LA3 A;  2DBB A;  2FA5 A;  1X1C A;  4M9X A;  2PMH A;  4BAC A;  4XKB A;  3FXM A;  3CDL A;  1IRX A;  3P5J A;  4QWQ A;  2M87 A;  3ONQ A;  1DDN A;  1NTC A;  1G6N A;  2Y9Y A;  3I9V 2;  1MBK A;  4M74 A;  5HS9 A;  3OOP A;  3OL4 A;  2DA7 A;  1K6Y A;  1Z3X A;  5ICC A;  2KDO A;  1Z6R A;  3GFL A;  2HVQ A;  4LIU A;  3B73 A;  2KZG A;  3PL8 A;  1FYK A;  1LVK A;  2WC2 A;  4CYD A;  4B8X A;  4WK8 F;  4A3J J;  2DFF A;  1IC8 A;  5JI6 A;  4U87 A;  4UXN A;  4AU7 A;  2M30 A;  4J01 A;  1HDP A;  9ANT A;  4E7H A;  1FX7 A;  3E3V A;  2RKH A;  2OCE A;  5JVG F;  1MSE C;  2NS0 A;  1B59 A;  1FIP A;  3K4C A;  2BY1 A;  4UB8 C;  3S93 A;  3DCF A;  4I0A A;  3HRM A;  5LGT A;  5E3M A;  5IT9 Z;  1GVD A;  2L7Z A;  2GXA A;  5FLM J;  3Q0W A;  1VF9 A;  5FFX A;  5DM7 F;  1MJB A;  2OD5 A;  3VSL A;  4D7M A;  3QU3 A;  4XKW A;  2JA7 J;  2P4W A;  5CQE A;  4LGW A;  4CO8 A;  4A3F J;  1ZKG A;  3HEF A;  2W1O A;  2OU2 A;  2Q2E B;  3GBG A;  2JRT A;  2KIU A;  4QPO A;  4LB5 A;  4XKC A;  1JGG A;  1FTZ A;  1ZG5 A;  4KFC A;  1Q1H A;  3MMY B;  3LSP A;  5HDN A;  2BHY A;  1TZL A;  4BXX J;  3E6M A;  4MLO A;  4MFD A;  4N4N B;  5K7F A;  3BQY A;  4BDY A;  3GX4 X;  3CCS I;  3CCL I;  1LEA A;  2MD5 A;  4FET A;  3D5R C;  5C4X J;  3OSF A;  3ZQQ A;  4CYC B;  3L2U A;  2VKH A;  3S3O A;  4KT6 A;  2XF6 A;  3DXJ F;  4KN4 X;  3OYI A;  1BL0 A;  3RKY A;  2W00 A;  4XLF A;  5C44 J;  3I53 A;  2RQP A;  3WU2 C;  3JRE A;  4E7J A;  3F6O A;  1UFM A;  2XC7 A;  4MGR A;  1YX3 A;  2NNN A;  3CP8 A;  3CO7 C;  3ZMS A;  1FNN A;  2VOO A;  2DK5 A;  1I6X A;  3E6B A;  1G2H A;  1QQI A;  4P96 A;  4MEX F;  5J8F A;  1IXS B;  3ZQG A;  4RAG A;  4HOB A;  4FTH A;  2QQB A;  4RB1 A;  3PFI A;  2ACJ A;  1EKE A;  2EV5 A;  2HFH A;  5HOO A;  3HGY A;  3D0S A;  4BH9 A;  1BI2 A;  4G9Y A;  4FT8 A;  1HCR A;  1MMD A;  4BL0 B;  2X9D A;  4LK1 F;  1ETY A;  4GO1 A;  4I7H A;  1YJW I;  1WH5 A;  5E1X A;  3KZI C;  1KQ8 A;  5CYV A;  5FKL A;  3QRF F;  4HG2 A;  3H3U A;  2Q8K A;  2AQF A;  2X6Y A;  2VQH A;  4OMZ A;  2WY7 Q;  4AM3 A;  2H27 A;  3M8F A;  3QYB A;  2XAJ A;  2QKM B;  3CCQ I;  1K78 A;  5LGU A;  1U9O A;  1Z1D A;  2QSF X;  1T95 A;  2UZK A;  4E4H A;  3O6B B;  1HF0 A;  1ON2 A;  3T0Y A;  2WY8 Q;  1V5G A;  1YLF A;  5ILV A;  1HBX G;  2K3F A;  1JKP C;  4HNU A;  2DFE A;  3DPU A;  2LRD A;  4KDP A;  4E70 A;  4C3I J;  3OIO A;  3I55 I;  1IW7 F;  4Z6Y A;  5K5Q A;  3WU0 A;  4CZC A;  2JSP A;  2VBW A;  3RZD J;  2M7B A;  2DMN A;  2JQ7 A;  1YTY A;  3WTT C;  1LFP A;  1BC7 C;  3PIP F;  2R7Q A;  3GTO J;  4FQG A;  2A6H F;  2XSD C;  3GTQ J;  1YRN A;  3P9I A;  3CMA I;  3SDG A;  3V8K A;  1R5I D;  2ZBK A;  1Y0N A;  5KNL A;  3WOD F;  2PX9 A;  5EG0 B;  1D0Z A;  2XAH A;  3R0A A;  3CCM I;  1ETO A;  3GTG J;  4RB3 C;  5FGM A;  4BAY A;  3A2K A;  3WGG A;  5E3N A;  3HXL A;  4KIG A;  4O3M A;  1FYL A;  1Z7L A;  4IHX A;  1A04 A;  5HS8 A;  4LB6 B;  4ON0 A;  2VJJ A;  5JHF A;  4Q47 A;  4U7D A;  2DYS H;  2EZH A;  3DP7 A;  4KIF A;  4GFB A;  4U7B A;  4PCQ A;  4N9I A;  3S2D J;  4C2U A;  1TW3 A;  2HDC A;  1YS7 A;  5F64 A;  2QQA A;  5LHG A;  3K70 D;  3ABM H;  1W7P A;  1X19 A;  4CCL A;  4LIV A;  1D8J A;  4S04 A;  1IN6 A;  4B47 A;  3JTH A;  3ESW B;  5EEA A;  2A6E F;  2WAE A;  4IXA A;  4IPA A;  3NAR A;  2HTJ A;  2BHZ A;  2NS7 A;  1SVL A;  1KON A;  2HYJ A;  4XQF A;  2CRG A;  2PJR A;  5BOX A;  1MH3 A;  3CJT B;  2KIM A;  2HNH A;  1MNE A;  1Z05 A;  3ISP A;  5JR3 A;  2F2E A;  1AKH A;  3IKT A;  2I8D A;  2O3F A;  4CA0 A;  4HPQ A;  3CO6 C;  1K4S A;  2P81 A;  2WAQ A;  1GLN A;  1IGN A;  3MAJ A;  2IPQ X;  2IRF G;  3G1M A;  1FMW A;  1MKM A;  2BEO A;  2OA4 A;  4FCY A;  1IN5 A;  1N77 A;  4FAS D;  5C3E J;  5F1J A;  3ZCO A;  5E18 F;  1BI0 A;  1T08 B;  5E1Z B;  3SZG A;  1FEX A;  4EJW A;  3CJN A;  3CMM A;  5D6E A;  3UKG A;  2M8E A;  4ZZD A;  1D1B A;  1TT0 A;  2LBF A;  2DT6 A;  1BW5 A;  4XLH A;  1Y1V J;  2KFD A;  5HDK A;  5C4J J;  5IYB J;  2DOD A;  4L5J A;  5H6Q A;  3GZ6 A;  4N4O B;  2K9S A;  3SXY A;  2UV1 A;  2EK5 A;  5HLI A;  3QOP A;  1VQ7 I;  4AVZ A;  2A68 F;  2X48 A;  5LEJ A;  3OR1 C;  3VFZ A;  4D9J A;  1K61 A;  3MN2 A;  2VAS A;  3OY9 A;  1RZ4 A;  2EFP A;  2K40 A;  1BIA A;  3HOZ J;  2VPL A;  3BTI A;  3K4L A;  4BS9 A;  2LDU A;  3BLY A;  1U78 A;  1O4X A;  2L7K A;  3VOE A;  1K79 A;  1R4M B;  4L9T A;  1QU3 A;  3CUQ C;  2FML A;  2BY0 A;  3SFI A;  3FIW A;  4M3G A;  2QEX I;  3I71 A;  4EM1 A;  3MVP A;  1ZQ3 P;  4NQW B;  1IXR C;  2EZI A;  1MDM B;  4JQF A;  2H6B A;  5J1R A;  3O2P E;  2Z33 A;  2EWN A;  4BYY A;  2W82 A;  1U8B A;  2LKS A;  2ZME B;  3ZQF A;  5HLG A;  1MD0 A;  2DI3 A;  4M3E A;  2LSO A;  2D5V A;  3KZY A;  1LDJ A;  3K7A J;  3TL4 X;  5EEG A;  1IRG A;  3VYR B;  1ERD A;  5EGO A;  1B8I A;  1V54 H;  1UHM A;  3EYY A;  1VQ5 I;  2XPV A;  2NYX A;  3CLO A;  2WAD A;  4DW6 A;  3A01 B;  5KAI C;  3QYE A;  4C9Y A;  2AS5 F;  1I50 J;  3OOU A;  3WGH A;  3AG4 H;  4PDK A;  4KIS A;  3GTP J;  1OR7 C;  2JSC A;  1ZAO A;  2XPU A;  5TGT A;  5K7Z A;  4IX7 A;  3AAF A;  2XB0 X;  2XHK A;  3ABL H;  4C2M J;  4A0Y A;  5L3B A;  1Z9C A;  3FIS A;  2XAQ A;  5BPD A;  2A69 F;  2HTS A;  3QP5 A;  2HQA A;  4ZDP A;  4RBO A;  3LWF A;  3BTC A;  3AL0 B;  1ZRC A;  1G3W A;  2Z1D A;  2EIK H;  3HC7 A;  1A35 A;  4RLQ A;  2VJ5 A;  1IDZ A;  1GXQ A;  1VQ4 I;  1X4O A;  1JJ8 C;  2IXS A;  4DNC A;  2DT5 A;  1FBS A;  5EDN A;  5L3D A;  3LL7 A;  2ZNY A;  4AIK A;  2IVM A;  4IJA A;  3BZC A;  1VFC A;  2VOD A;  2CG4 A;  3RIR A;  1LPQ A;  1OCR H;  3PFY A;  1IAW A;  3HTS B;  2AQE A;  3HG9 A;  1U8R A;  1ZK8 A;  2O7O A;  5J6X A;  2W85 A;  2J5P A;  1MMN A;  3X2Q H;  3B6C A;  1XCB A;  3F8N A;  2XB5 A;  1W7P D;  2CYY A;  3M8J A;  1U3E M;  2HPM A;  1FBU A;  2IA1 A;  1D3Y A;  3W6K B;  1ETK A;  2PEX A;  3WG7 H;  3IRR A;  4HNT A;  1YG2 A;  2Z16 A;  4A6E A;  2WAQ N;  1RNL A;  1WFX A;  1XGS A;  1WHU A;  5B66 C;  2R7V A;  3OYD A;  2TDX A;  4ZJZ A;  5GPC A;  3HTU A;  4LFU A;  2EH3 A;  2FJ1 A;  1X3Z B;  4BQO A;  3OR2 C;  3LST A;  1TTY A;  3TP3 A;  2Y31 A;  4HA8 A;  4LLL A;  4Z2Y A;  1USS A;  1PDN C;  1BJA A;  2VJI A;  2ZJP F;  2VIX A;  1QVT A;  3SFZ A;  1I3Q J;  1YYV A;  3P9C A;  1MIJ A;  4ETS A;  2K27 A;  2ISY A;  2M4K A;  1W5C C;  2IA0 A;  2GXB A;  3GFI A;  2G9W A;  3FXK A;  4JBA A;  1D8K A;  2WA0 A;  2V9V A;  3JCU C;  3M4O J;  1R22 A;  5D5W B;  4M3B A;  1XGM A;  2DLL A;  3ZRG A;  3FZV A;  3T1B A;  3DKY A;  3RPU D;  1W4M A;  1VQO I;  3I5U A;  1Y6I A;  2BV6 A;  1A31 A;  1POG A;  1ZYR F;  3TDZ C;  1G8X A;  2HDD A;  2MFZ A;  4ENM A;  5TRD A;  3TP0 A;  3TO9 A;  1GUU A;  3FMS A;  3BJA A;  3OV8 A;  1VQK I;  5HNF A;  3ZGK A;  2EJR A;  3KLN A;  4HYE A;  1FC3 A;  3R4K A;  1WI9 A;  3TOB A;  2CO5 A;  1HST A;  2JA2 A;  2FXA A;  2H8W A;  1HQC A;  3HDD A;  1U0J A;  3WTW C;  2NVX J;  2KQR A;  1B1B A;  2K7L A;  1LFB A;  4DBR A;  3LAJ A;  4IOA F;  3GCM A;  3FXU A;  4GDF A;  2DYR H;  4J19 A;  2X51 A;  3I58 A;  2X6O A;  1DU0 A;  2OC6 A;  2L7F P;  3BC8 A;  3MCZ A;  5CKT A;  3SYT A;  3HYI A;  1X2M A;  4U88 A;  2JJ7 A;  2VT3 A;  2STT A;  3VWB A;  4RGU A;  2DA4 A;  3BG9 A;  3KX2 A;  4DZP A;  3N4M A;  1RUO A;  4DJA A;  1OYW A;  2KJC A;  3PM1 A;  4ZYD A;  4PK4 A; 
#chains in the Genus database with same CATH homology
 3L09 A;  2IA2 A;  3S2W A;  3IL2 A;  3DQV C;  2HGC A;  5K5R A;  2K4J A;  1L3L A;  2Y48 A;  2C6Y A;  2W24 A;  3DPL C;  4GYI A;  4M73 A;  3LQR A;  3BDD A;  2EV6 A;  2VE9 A;  3R61 A;  1O57 A;  3FXQ A;  3GF2 A;  3J80 K;  2YX7 A;  1PP8 F;  2RGV A;  3HHH A;  1HW5 A;  1REP C;  5KK1 A;  1KU3 A;  1MJ9 A;  4HX7 A;  1KYW A;  4XLP F;  3MWM A;  4LLN A;  1QPM A;  3ZN1 A;  1C0W A;  5DV5 A;  2E1C A;  2R7F A;  2F5F A;  1OYI A;  3JSO A;  2RV8 A;  3DPT A;  4AD9 A;  3K2Z A;  1P4W A;  2DPU A;  4HDV A;  4UVC A;  4P9F A;  3F3X A;  6PAX A;  3K0L A;  2D1V A;  1O7F A;  4I01 A;  5D4R A;  5AON A;  1HW1 A;  1LJ9 A;  5E8G A;  3U1D A;  3WGI A;  5BS6 A;  1TQI A;  2RNJ A;  5E20 A;  3FMQ A;  2K86 A;  2DQR A;  5E1W A;  2VT2 A;  4AVP A;  3EQL F;  1ONV A;  3RYP A;  3WE3 A;  1G3Y A;  2FRH A;  2UXX A;  1U6G A;  1W5T A;  4RB0 A;  4HQE A;  3KP6 A;  1GHC A;  5CVU A;  2O8X A;  4HDU A;  1F9N A;  2Z3Y A;  4D0P A;  1J7K A;  5ERI A;  4MTE A;  1WQ2 A;  2FF4 A;  3FM5 A;  5E17 F;  3M7G A;  2FNP A;  1HKQ A;  1XDS A;  1LVA A;  3DFG A;  1RIO H;  4A6D A;  4KMF A;  3RTR A;  3LA2 A;  3NRV A;  2P5K A;  2P7V B;  1SMT A;  5KVR A;  2IP2 A;  4LJZ F;  1R1T A;  1O7L A;  3MEX A;  4HV6 A;  4WXD A;  3KZZ A;  2P5V A;  2EV0 A;  2FEZ A;  1Z6T A;  4Y17 A;  3EYI A;  5L3G A;  3SHF A;  4RGX A;  3TO7 A;  2NNY A;  5DUK A;  1SFX A;  4N9H A;  2YU3 A;  4CZZ A;  1G3T A;  2Z99 A;  4Y15 A;  4I98 B;  2VBX A;  2MC3 A;  4HF2 A;  4G7O F;  2G7U A;  4EM0 B;  2HYG D;  2HR3 A;  2K02 A;  1LB2 A;  4G8X A;  2PQ8 A;  3G73 A;  4RS8 A;  2QM3 A;  3IHU A;  4HF0 A;  4PGH A;  5CLS A;  2MBF A;  2GAU A;  4ENN A;  1YQA A;  3J80 Z;  2BGC A;  3HHG A;  2JTV A;  5DCM B;  4ZH4 F;  2QEN A;  5LRS A;  4IHT A;  3VEP A;  4U0W A;  4IVN A;  5EEH A;  4S05 A;  2HZT A;  2EA2 A;  2H6C A;  4L9V A;  1R7J A;  2ZJ2 A;  3RJP A;  2HQR A;  1T0F A;  2P6S A;  4RB2 C;  3T8R A;  2RN7 A;  5H20 A;  3SZP A;  4HF1 A;  2FSW A;  2ZCW A;  3EUH A;  2XKP A;  1TW2 A;  3GFM A;  3WTV C;  2QBY A;  1X3U A;  3QPH A;  3H92 A;  3F72 A;  5K1Y A;  1DP7 P;  3SZT A;  2O6G E;  1F4K A;  4GXO A;  2EFO A;  1SFE A;  2ESH A;  2ELH A;  4HLY A;  2EFQ A;  1EH8 A;  3I59 B;  3G3Z A;  4L18 B;  2QVO A;  2UXN A;  2A61 A;  3DF8 A;  3F8B A;  2CWE A;  4K2E A;  4EJT A;  1ZN2 A;  3ZN0 A;  4O5V A;  1WKM A;  4WWC A;  2Q0O A;  1J9I A;  1FP1 D;  3KEQ A;  1ON1 A;  3FX3 A;  1EH6 A;  4Q4Z F;  3GYH X;  3RI4 A;  5D4S A;  5L3C A;  4CXF A;  3VB2 A;  3BOQ A;  3HOT A;  2PI0 A;  3C3W A;  1R23 A;  2PN6 A;  2CSO A;  2QYO A;  4UNO A;  3I64 A;  4OIO F;  1IN8 A;  3IWZ A;  3BY6 A;  1B9N A;  4UVA A;  3DKW A;  3QAH A;  4G7H F;  3MZY A;  4EJV A;  1T2K A;  2LNB A;  5D5U B;  3V8L A;  4YFK F;  4LG0 A;  4PZJ A;  2P8T A;  4XSZ F;  4LMY A;  2Z9O A;  4ENK A;  1KU2 A;  4O6J A;  1D5V A;  3GXO A;  4BNC A;  2GWR A;  5ICG A;  2QUF A;  4MNU A;  4NB5 A;  2XAS A;  1B6A A;  4XRF A;  4IRH A;  5FFZ A;  3HSR A;  1BI1 A;  2X0L A;  2MLK A;  3E6C C;  1IZ1 A;  3K9T A;  3V8J A;  3HIF A;  2JPB A;  1S29 A;  1EV7 A;  4KT5 C;  4B09 A;  3F21 A;  2OBP A;  4RAY A;  3K1M A;  5FO5 A;  3CUQ B;  3JSP A;  3R0J A;  4N0B A;  5D8L B;  1E17 A;  2Q2E A;  3QPT A;  1R5H A;  2EFN A;  3F23 A;  4GCV A;  3C7J A;  2V1U A;  4A5N A;  4MEY F;  4CDG A;  2JZY A;  1QNT A;  4UV8 A;  1XCV A;  3F8M A;  2OQR A;  2QWW A;  1OKR A;  1KYZ A;  5L3F A;  4YFX F;  2PBI A;  2VE8 A;  3TDU C;  1OPC A;  4R79 A;  3GWZ A;  1G3S A;  3LA7 A;  3E5Q A;  4XBF A;  4G6D A;  4EGZ A;  4ESB A;  1R5G A;  4MQV A;  1FP2 A;  4Q48 A;  1JHF A;  1V4R A;  2UWM A;  4UV9 A;  4EJU A;  1R1V A;  3GO5 A;  3ROU A;  2BYV E;  2V1X A;  1JGS A;  2ZFW A;  1IN4 A;  4EQQ A;  4AWX B;  3JW4 A;  1P4A A;  4YG2 F;  2Z5U A;  5TJJ A;  4HX8 A;  4F7Z A;  4QLC U;  1NHA A;  1RUN A;  1ZAR A;  2R3S A;  3HOS A;  1DPR A;  4R8H A;  2D2W A;  4M71 A;  1BIB A;  1KU7 A;  5LGN A;  5DD8 A;  4IRG A;  1XGO A;  3GFJ A;  3I54 A;  1ZH5 A;  1UST A;  2FU4 A;  5LHI A;  1CF7 B;  2ZNZ A;  1P2F A;  4XLN F;  3KLO A;  4LK0 F;  3DV8 A;  2XRN A;  2J5O A;  2XVC A;  3GUD A;  3N97 A;  4CHU A;  5D8K B;  2ISZ A;  3KE2 A;  1WSU A;  2GIV A;  2GA1 A;  1XMA A;  4M9S A;  3ZPL A;  3E6D A;  4RGS A;  2ZKZ A;  4OIQ F;  2HOE A;  3Q9V A;  1W5S A;  2PJP A;  2LKP A;  1LDK B;  1SAX A;  2VBZ A;  2D1H A;  4P9U A;  3ECH A;  2A5Y B;  3L2C A;  3KCC A;  2XV4 S;  2DFI A;  1KA8 A;  3ZMD A;  3CTA A;  4KN7 X;  1F5T A;  2XRO A;  5LEK A;  3K69 A;  2YX4 A;  2VBY A;  3MQ0 A;  2R7D A;  2STW A;  3M8E A;  1SD5 A;  1ZHF A;  3GW2 A;  4IF4 A;  2V1D A;  2B0L A;  3BPV A;  2RDP A;  3KP5 A;  4KA4 A;  3Q5F A;  4M9Z A;  4GYG A;  3TQN A;  3E5X A;  3IKV A;  1SD7 A;  4I0B A;  1MDM A;  2O0Y A;  4XSX F;  2PLY A;  3ZMZ A;  2ZME A;  1ZLK A;  1HKT A;  2L02 A;  2HYF A;  1UCR A;  3TOA A;  2XKO A;  1IN7 A;  4H0E A;  2P7C B;  4L5I A;  1GXP A;  1AOY A;  3BWG A;  1QO0 D;  4U0V A;  3L9F A;  3MZH A;  4LD5 A;  1GVJ A;  2ZO4 A;  3P9K A;  1S6L A;  4I2O A;  3FXR A;  3HRU A;  3R6S A;  3FHZ A;  3LFK A;  2DPD A;  1ZGA A;  2EFW A;  1PUE E;  1J75 A;  2HKX A;  4DQ2 A;  4KNY A;  1K78 B;  2KJB A;  1T98 A;  2YPR A;  3R60 A;  3ML6 A;  2FE3 A;  3WTY C;  3HSE A;  2EA4 A;  1OMI A;  3BJ6 A;  3BP8 A;  3ABU A;  4NHJ A;  3O3K A;  5ILU A;  4WF2 A;  1YS6 A;  4RGR A;  2L4A A;  4MTD A;  2QLZ A;  2O03 A;  2LF7 A;  3ZP5 A;  3BZ6 A;  5LRR A;  3KEO A;  4ESF A;  1VTN C;  3P7N A;  3KP7 A;  1WRJ A;  3L00 A;  5FD5 A;  1O3T A;  1SD4 A;  1YO5 C;  1TNS A;  2ETH A;  5LLQ A;  4IHS A;  2XUB A;  1ZRF A;  3RKX A;  3I4P A;  4A12 A;  1W7P B;  3HSF A;  2FBH A;  5BPI A;  1LQ1 A;  1ULY A;  3RPQ A;  2JPC A;  3CDH A;  4JK1 X;  2QZ8 A;  3D5L A;  2Y0M A;  5AIP A;  5D5X B;  5F1R A;  5A2Q K;  5DEQ A;  5K5O A;  1FYM A;  3ABT A;  3T5X A;  2A3S A;  1XSD A;  3CUO A;  5HDG A;  2HS5 A;  1FT9 A;  2DW4 A;  2Y75 A;  5FD6 A;  1FOK A;  3KP2 A;  5ICE A;  4BXU A;  4AIJ A;  2P5L C;  1DUX C;  2H09 A;  1CGP A;  2JT1 A;  2K4B A;  4WX9 A;  1SD6 A;  2V6C A;  3ERE D;  4PGG A;  4WCG A;  1K7A A;  1YW7 A;  3Q9S A;  1ZLJ A;  4ZYH A;  1S8N A;  1B9M A;  4GGG A;  3LQQ A;  4KMU X;  2KRF A;  3KFW X;  3K1P A;  1AWC A;  2CGP A;  1J2X A;  2G7H A;  3NQO A;  2VC0 A;  1KQ0 A;  1FY7 A;  3V7C A;  4A0Z A;  2F5D A;  2DAO A;  4FX4 A;  3C18 A;  4UUV A;  1IF1 A;  1R00 A;  2MLG A;  3ZMT A;  4EVI A;  2EB7 A;  1JE8 A;  2DTR A;  3BRO A;  5AIQ A;  2E7W A;  4ZYE A;  1ZRD A;  1P92 A;  5CJ9 A;  1IXC A;  2OZ6 A;  4AIH A;  3WE2 A;  1P4X A;  1U2W A;  1LEB A;  1H9T A;  1XD7 A;  3ZQ7 A;  3HUG A;  4LLG F;  5CVR A;  1HSJ A;  4L9J A;  1KGS A;  1WWX A;  1U5T A;  4Q5S F;  5LHH A;  1FWZ A;  5DDG A;  1ZGJ A;  5JHU A;  2NRA C;  1FSH A;  3RYR A;  2F5C A;  2W25 A;  1MGT A;  4HBL A;  3HRT A;  3L7W A;  1I1S A;  3KET A;  3E5U A;  1TBX A;  4BHP A;  5ICF A;  5DCF A;  3T8T A;  5E8I A;  2XAG A;  1HXD A;  1TLH B;  4HQM A;  2VOP A;  1I5Z A;  3HRS A;  3IRQ A;  3IWF A;  1R1U A;  1S7O A;  5A2Q Z;  3TO6 A;  3M1E A;  4G7Z F;  1UB9 A;  3I0T A;  3M9A A;  3EDP A;  4HZF A;  4A2U A;  4WXH A;  2AXL A;  1O3Q A;  1BN5 A;  5HS7 A;  4BHC A;  2BE5 F;  3NEU A;  2MH2 A;  3QP6 A;  2FOK A;  1BOA A;  2ESN A;  4KIB A;  4L0Y B;  1BBY A;  1XB4 A;  5L3E A;  2KIF A;  1BI3 A;  3FF5 A;  4ASN A;  2H94 A;  3U2R A;  4BHB A;  3DEU A;  1JHH A;  3F6V A;  4OIP F;  1ZG1 A;  4CIC A;  3WU1 B;  3RDI A;  5DCM A;  5JFR A;  5F6F A;  1DPU A;  3LAP A;  3E97 A;  3RPU A;  3H3Z A;  2V79 A;  1I27 A;  1Z7U A;  2X4H A;  2CFX A;  5JVT A;  3PQJ A;  4ZYG A;  3GEZ A;  4OOI A;  2VXZ A;  4HAM A;  3FWE A;  1OYY A;  2M1B A;  3GLX A;  2YR2 A;  2CW0 F;  5LBQ A;  4ENJ A;  4G6Q A;  3V4G A;  3IC7 A;  1STZ A;  1XMK A;  1ODD A;  4Y13 A;  2E1N A;  2W84 A;  1KQ9 A;  3VOD A;  3KP4 A;  1KU9 A;  1XN7 A;  2OQG A;  4M6Y A;  1UHW A;  1R36 A;  2F5E A;  3K1N A;  1J5Y A;  4HW0 A;  2VON A;  1XSV A;  4M72 A;  5ED4 A;  1SFU A;  3GVA A;  3I59 A;  2GXG A;  1S7A A;  5D5V B;  3QU6 A;  4A0X A;  2FQ3 A;  1F1Z A;  3WTX C;  2HKO A;  3ECO A;  1MJA A;  1QGP A;  2BBY A;  2WV0 A;  2O61 A;  4OIR F;  5J8C A;  4ZZL A;  4MQ9 F;  3SQN A;  1XSX A;  2XAF A;  5FLX K;  4R1H A;  1XGN A;  1EH7 A;  2XIG A;  3EET A;  5FB2 A;  4FX0 A;  4L0Z B;  1BM9 A;  1LNW A;  1IRF A;  4RAZ A;  3BPX A;  1FLI A;  1HKS A;  1FZP B;  1QZY A;  2YSR A;  1O3S A;  3FM3 A;  4OIN F;  2LF8 A;  5ILS A;  2FMY A;  3WTU C;  1O3R A;  4KYW A;  5CVV A;  2IJL A;  2COM A;  1L0O C;  3WTZ A;  1MZB A;  3GZ5 A;  3ELK A;  3F8C A;  1JXS A;  1B4A A;  3BJO A;  4TV7 A;  2HQN A;  4KIC A;  3J81 K;  2DO7 A;  3C1D A;  1S3J A;  2L3D A;  2M5W A;  1QZZ A;  3TKY A;  4EM2 A;  1QBJ A;  1XDU A;  3FMR A;  4UVB A;  4EGY A;  3PQK A;  3W6J B;  4OMY A;  4M6X A;  2A07 F;  2OZU A;  2L4M A;  2GQQ A;  2ADU A;  3ZMU A;  2VC1 A;  5IT3 A;  3TGN A;  3ZMV A;  3B02 A;  4L9N A;  1R58 A;  3JAM K;  1H0M A;  4P5O A;  1V3F A;  1YW9 A;  1FSE A;  1TNT A;  1ZG3 A;  4U0Y A;  1HW2 A;  1SMY F;  4EJO A;  1LDD A;  2KKO A;  2WWY A;  3MFK A;  4YIF A;  1TQM A;  1YFH A;  1FBQ A;  1PP7 U;  3CUQ A;  3REO A;  1YIO A;  4EV0 A;  3V7S A;  3JTG A;  3RKW A;  2D45 A;  3COA C;  1H9G A;  2MA3 A;  1T6S A;  4NQW A;  2L01 A;  3KP3 A;  5HLH A;  5IT9 K;  1J0R A;  3F22 A;  1J59 A;  1OR7 A;  4I09 A;  1E2X A;  2QBY B;  4ESJ A;  2IT0 A;  1RI7 A;  2VN2 A;  2HWV A;  4HX4 A;  1TQP A;  4WXC A;  2OAZ A;  3U9G A;  2DK8 A;  4YII A;  4BQA A;  1FPQ A;  1YW8 A;  2CQK A;  1T38 A;  4MHG A;  5FLX Z;  5DUI A;  3V7R A;  4A5M A;  5D6F A;  1T39 A;  1Z91 A;  4KUM A;  2MH9 A;  1ZRE A;  4IRI A;  2E7X A;  5CVI A;  5HVQ C;  2PG4 A;  3WG9 A;  4EMS A;  2PFB A;  4HV5 A;  2GZW A;  1BC8 C;  5BQT A;  4FHT A;  2P6T A;  2RC4 A;  4I02 A;  2DU9 A;  2XGX A;  4OU0 A;  4P55 A;  2FBK A;  3ULQ B;  4HLX A;  3WTS C;  1I1G A;  4UHT A;  1P6R A;  2IW5 A;  4CGZ A;  3J7A O;  2HEO A;  5DD4 A;  3J81 Z;  5BMZ A;  2WTE A;  1U5T B;  2NAZ A;  5H6R A;  2PMU A;  2QQ9 A;  4YFN F;  2FNA A;  3F8F A;  1Y0U A;  2GA2 A;  4G94 A;  2FBI A;  1U5T C;  2ZXJ A;  3JAM Z;  1G4D A;  1K6O A;  2RVC A;  4LG0 B;  2L54 A;  1IUY A;  1CF7 A;  2W57 A;  5DYM A;  2DQL A;  5CVJ A;  2M45 A;  3LA3 A;  2DBB A;  2FA5 A;  4M9X A;  2PMH A;  4QWQ A;  2M87 A;  1DDN A;  1G6N A;  4M74 A;  5HS9 A;  3OOP A;  5ICC A;  1Z6R A;  3GFL A;  3B73 A;  1FYK A;  2WC2 A;  4CYD A;  4B8X A;  4WK8 F;  5JI6 A;  4UXN A;  2M30 A;  1FX7 A;  3E3V A;  2RKH A;  2NS0 A;  1B59 A;  5LGT A;  4I0A A;  3HRM A;  5IT9 Z;  5FFX A;  1MJB A;  2OD5 A;  3QU3 A;  2P4W A;  4CO8 A;  4LGW A;  2OU2 A;  2JRT A;  2KIU A;  4LB5 A;  1ZG5 A;  4KFC A;  1Q1H A;  5HDN A;  3E6M A;  3GX4 X;  1LEA A;  2MD5 A;  3DXJ F;  4KN4 X;  3RKY A;  3I53 A;  2RQP A;  3F6O A;  1UFM A;  4MGR A;  2NNN A;  3CO7 C;  3ZMS A;  1FNN A;  2VOO A;  2DK5 A;  1I6X A;  3E6B A;  1QQI A;  4P96 A;  4MEX F;  5J8F A;  1IXS B;  4HOB A;  2QQB A;  4RB1 A;  3PFI A;  2ACJ A;  2EV5 A;  2HFH A;  5HOO A;  3D0S A;  4BH9 A;  1BI2 A;  4G9Y A;  4FT8 A;  4LK1 F;  4GO1 A;  4I7H A;  5E1X A;  1KQ8 A;  5CYV A;  3QRF F;  3H3U A;  2Q8K A;  4OMZ A;  2H27 A;  3M8F A;  2XAJ A;  1K78 A;  5LGU A;  1Z1D A;  2UZK A;  3O6B B;  1ON2 A;  3T0Y A;  5ILV A;  1YLF A;  1HBX G;  4KDP A;  4E70 A;  1IW7 F;  5K5Q A;  3WU0 A;  2VBW A;  1YTY A;  3WTT C;  1BC7 C;  2A6H F;  3P9I A;  3V8K A;  2ZBK A;  3WOD F;  2XAH A;  3R0A A;  4RB3 C;  5FGM A;  4BAY A;  3WGG A;  4KIG A;  4O3M A;  1FYL A;  1A04 A;  5HS8 A;  4LB6 B;  4ON0 A;  4Q47 A;  4U7D A;  3DP7 A;  4KIF A;  4U7B A;  4PCQ A;  4N9I A;  1TW3 A;  2HDC A;  1YS7 A;  5F64 A;  2QQA A;  5LHG A;  1W7P A;  1D8J A;  4S04 A;  1IN6 A;  3JTH A;  2A6E F;  4IXA A;  4IPA A;  2HTJ A;  5BOX A;  2KIM A;  1Z05 A;  3ISP A;  5JR3 A;  2F2E A;  3IKT A;  2O3F A;  3CO6 C;  2IRF G;  3MAJ A;  2IPQ X;  1MKM A;  2BEO A;  2OA4 A;  1IN5 A;  5E18 F;  1BI0 A;  5E1Z B;  4EJW A;  3CJN A;  5D6E A;  2M8E A;  4ZZD A;  5HDK A;  4L5J A;  5H6Q A;  3GZ6 A;  3SXY A;  2EK5 A;  5HLI A;  3QOP A;  2A68 F;  5LEJ A;  3VFZ A;  1RZ4 A;  2EFP A;  1BIA A;  2LDU A;  1U78 A;  3VOE A;  1K79 A;  4L9T A;  3CUQ C;  2FML A;  3I71 A;  4EM1 A;  1IXR C;  1MDM B;  4JQF A;  2H6B A;  3O2P E;  2Z33 A;  2EWN A;  4BYY A;  2ZME B;  5HLG A;  1MD0 A;  2DI3 A;  2LSO A;  3KZY A;  1LDJ A;  5EEG A;  1IRG A;  1UHM A;  3EYY A;  2NYX A;  3CLO A;  2AS5 F;  3WGH A;  4PDK A;  2JSC A;  1ZAO A;  3AAF A;  2XHK A;  1Z9C A;  4A0Y A;  5L3B A;  2XAQ A;  5BPD A;  2A69 F;  2HTS A;  3QP5 A;  3LWF A;  1ZRC A;  1G3W A;  1GXQ A;  4DNC A;  2DT5 A;  1FBS A;  5L3D A;  4AIK A;  2ZNY A;  2IVM A;  4IJA A;  2VOD A;  2CG4 A;  3RIR A;  1IAW A;  3HTS B;  1U8R A;  5J6X A;  2W85 A;  2J5P A;  1XCB A;  3F8N A;  1W7P D;  2CYY A;  1U3E M;  1FBU A;  2IA1 A;  1D3Y A;  3W6K B;  2PEX A;  3IRR A;  1YG2 A;  4A6E A;  1RNL A;  1XGS A;  2TDX A;  3HTU A;  4LFU A;  3LST A;  1TTY A;  4HA8 A;  4LLL A;  4Z2Y A;  1USS A;  1PDN C;  1BJA A;  3SFZ A;  1YYV A;  3P9C A;  4ETS A;  2K27 A;  2ISY A;  2IA0 A;  2GXB A;  3GFI A;  2G9W A;  4JBA A;  1D8K A;  2V9V A;  1R22 A;  5D5W B;  1XGM A;  2DLL A;  3FZV A;  3T1B A;  1W4M A;  3I5U A;  2BV6 A;  1ZYR F;  3TDZ C;  4ENM A;  5TRD A;  3TO9 A;  3FMS A;  3BJA A;  3OV8 A;  2EJR A;  3KLN A;  4HYE A;  1FC3 A;  3R4K A;  1WI9 A;  3TOB A;  2CO5 A;  1HST A;  2FXA A;  1HQC A;  3WTW C;  1B1B A;  2K7L A;  3LAJ A;  3FXU A;  3I58 A;  3MCZ A;  3HYI A;  4U88 A;  2VT3 A;  2STT A;  4RGU A;  3N4M A;  1RUO A;  1OYW A;  2KJC A;  4ZYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...