1X3UA

Solution structure of the c-terminal transcriptional activator domain of fixj from sinorhizobium melilot
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
b'GSHMDDANDIRARLQTLSERERQVLSAVVAGLPNKSIAYDLDISPRTVEVHRANVMAKMKAKSLPHLVRMALAGGFGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein fixJ
publication title Solution structure of the C-terminal transcriptional activator domain of FixJ from Sinorhizobium meliloti and its recognition of the fixK promoter
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1x3uA01
1TW3A 3WG9A 3WTUC 1FYMA 4LFUA 3SZPA 5HVQC 3IRQA 4CO8A 2UXXA 3C3WA 1G4DA 1E2XA 2V6CA 2C6YA 2H27A 3LSTA 3QRFF 3GFLA 3RDIA 4HAMA 3KP6A 1YW8A 4BNCA 3I0TA 4M6XA 3MWMA 4HBLA 3M8EA 2FF4A 2FNAA 3LA2A 1P2FA 3HIFA 4UVCA 2YX7A 2QYOA 5FD6A 2Y48A 5HS9A 4U88A 2YU3A 4LLGF 3ZMUA 1U5TB 1SFUA 5J8CA 4ESJA 4MTEA 2QM3A 2RVCA 2E1CA 4EGZA 4XRFA 1YW7A 2CFXA 1I27A 5D5WB 4KYWA 3C7JA 5CLSA 1K78B 3LAPA 1IN6A 1TW2A 3DEUA 4GYIA 2R7FA 3WTWC 1KQ8A 3FM5A 4OMZA 1JE8A 5DCMB 2FXAA 3BPVA 1W7PD 2IA1A 1VTNC 1SD6A 2DTRA 4PCQA 1AWCA 4ENMA 2JSCA 1G3WA 4KN4X 2QVOA 3JAMK 2W24A 4FHTA 3WGIA 1CF7A 3KP3A 3MCZA 4AIHA 1Z9CA 4KMUX 4RB2C 4GCVA 1FWZA 5FFZA 2VE8A 1FBUA 1QGPA 3GFMA 3GXOA 2MBFA 1ZRDA 2CWEA 5DCFA 1ZG3A 1UHMA 2XAFA 1BC7C 2W25A 1KQ0A 2TDXA 4RB0A 3KLNA 4HLXA 1IZ1A 4UXNA 1FY7A 2FA5A 2ZMEB 4HQEA 2KIMA 2K4JA 4G94A 1XGOA 2EA4A 2ESNA 1ON2A 3TOBA 3F21A 3RKYA 1ZG5A 1FYLA 3F8MA 3ZMZA 3L00A 2VOOA 1KQ9A 4HW0A 5LBQA 4G6QA 3W6JB 1S7OA 2XAJA 2HKXA 4MEXF 5H20A 4U7DA 4BYYA 2NNNA 1R1UA 3GVAA 1Z1DA 5ILUA 2DPUA 2ELHA 3F6VA 2XKPA 4PDKA 4AD9A 2GWRA 1W4MA 1W7PA 4WK8F 4LK0F 2KIUA 3BPXA 3I59B 3KZYA 3JSOA 2QUFA 5ICEA 4AIKA 1BOAA 4N0BA 2GXBA 5IT3A 2ZNYA 2GQQA 2EWNA 3KFWX 4EQQA 3QPHA 5IT9Z 3P9IA 4F7ZA 3VB2A 4CHUA 2RN7A 1ONVA 1U6GA 1XB4A 4XBFA 2X0LA 3GFIA 3S2WA 1IRGA 2P8TA 2OA4A 3ZP5A 1PDNC 4D0PA 3BZ6A 3K69A 5ICGA 2AS5F 4BHCA 3K9TA 5EEGA 3MAJA 5HLHA 4BXUA 1ZAOA 5CJ9A 3ECOA 3OOPA 3HUGA 1KGSA 1HQCA 2EFNA 3WGHA 4WXCA 2QQAA 3F72A 4I02A 5CVRA 3KLOA 1HKSA 2EV5A 2LDUA 4XSXF 4LG0B 3M7GA 1FLIA 4HF0A 4ZYEA 3BOQA 2ACJA 2BV6A 5AIQA 5AONA 3DFGA 2ESHA 1BI2A 4UVAA 1LVAA 2Q8KA 2UZKA 3CLOA 4O3MA 3V8KA 1BJAA 3ZPLA 4OIPF 2M5WA 3RTRA 1EV7A 3HSRA 2XUBA 2OZ6A 5DD4A 4A12A 4I2OA 4RB1A 5D6EA 2P6SA 2W84A 2DO7A 2YR2A 3O2PE 2RV8A 4KNYA 1STZA 1MDMB 1BBYA 1Z6TA 1RIOH 2DAOA 2RKHA 3E5UA 4A5MA 5E1WA 1HBXG 2V1UA 4HQMA 1T6SA 1SD4A 1WSUA 4RGXA 1UFMA 2O3FA 1XGMA 5FFXA 4RAZA 1HKTA 4RGRA 2IJLA 2D1HA 2PG4A 3DPTA 3GLXA 1P4AA 4IF4A 4AVPA 4NHJA 1J5YA 4LD5A 2DK5A 1W5SA 2A6HF 3SZTA 3ABTA 5CVIA 5ILSA 1D5VA 4L18B 3CUOA 3BY6A 4CYDA 2NYXA 4N9HA 1YIOA 1ZLKA 5ILVA 2EV0A 3R4KA 5L3BA 4ENJA 5DDGA 1U8RA 4ZZDA 5H6RA 1I5ZA 1F9NA 3EQLF 3I4PA 4EJVA 4U0WA 3E6CC 1LQ1A 2Y0MA 3IKVA 4G7HF 5BPIA 4MQVA 5DD8A 4AWXB 5BQTA 4MNUA 2MC3A 3ERED 1I1SA 4OU0A 1P4WA 1EH6A 4HF2A 2CW0F 1H0MA 5DYMA 3N97A 5LGUA 3EYIA 4HZFA 2NNYA 2HFHA 5AIPA 4ASNA 3F23A 2O61A 3F6OA 2ADUA 2CYYA 1SMTA 3K1NA 4GO1A 1SD5A 4ENKA 1PP8F 4KMFA 1B6AA 3V7RA 3HTSB 3I5UA 5ICCA 1IF1A 1ZN2A 1TBXA 4A0YA 3GO5A 2P7VB 2ZJ2A 2LSOA 3KP2A 3WTZA 1LDJA 2ZXJA 3I71A 2ETHA 1T39A 1SMYF 1ZG1A 1H9TA 1HKQA 2FSWA 1MZBA 5JFRA 2HYFA 3HRSA 3WU0A 1CGPA 4PGHA 4G7ZF 1S29A 3WE3A 3GF2A 1WI9A 3LAJA 3TO6A 4KIFA 5CVVA 2UXNA 2O6GE 2XV4S 5HDNA 5L3EA 3DF8A 4CXFA 1XCBA 3HOSA 1FYKA 4UVBA 4Y15A 4L5IA 2BEOA 4ZZLA 2GIVA 3TGNA 2Y75A 2HEOA 1IXRC 4LJZF 1TTYA 1QZYA 4PZJA 2RDPA 2V1DA 1TLHB 4KN7X 1O3RA 1XMKA 5DUIA 2X4HA 1F1ZA 1SAXA 3M1EA 1FOKA 1F4KA 3HHGA 1J75A 4G7OF 4HYEA 1GHCA 5ICFA 5BOXA 3CUQC 5JHUA 2FNPA 2VBYA 4CDGA 4AIJA 3E5QA 2BE5F 3HHHA 4MGRA 2YSRA 4EM0B 4QWQA 2E7WA 3DPLC 3TO7A 4L9NA 3WE2A 3T5XA 4R8HA 1EH7A 1MJ9A 4JK1X 3IKTA 2FBIA 4Z2YA 4L0ZB 5F6FA 1OYIA 1O7LA 2FU4A 3R60A 4UV8A 1YG2A 1OR7A 2ZO4A 1U78A 4XLNF 2A61A 1IXSB 3FWEA 4B8XA 3J7AO 2LF7A 3FXQA 1XSDA 1OYYA 2OQGA 5E20A 1CF7B 3GZ6A 1A04A 2HYGD 1LEAA 2HS5A 2ZNZA 4HV6A 4LB5A 1BI0A 3TKYA 3R6SA 1R22A 2P6TA 3O6BB 2STTA 1XGSA 1O57A 3WTXC 2G7HA 3P7NA 1RZ4A 3ECHA 4BHPA 2IA2A 1OMIA 4BH9A 4YFXF 4FT8A 4I0AA 1TNTA 2E1NA 1ZGJA 3HOTA 2VONA 3J80K 1FBQA 5JI6A 3T0YA 4UNOA 1ZREA 5F1RA 3VFZA 3CJNA 4HDUA 2DPDA 3U2RA 5D5XB 4E70A 1KU2A 3ML6A 4DNCA 5FLXK 4N9IA 2HQRA 4L0YB 2J5PA 4I01A 1B9NA 2HQNA 4LK1F 4EJUA 2OBPA 4P9UA 2L3DA 1RUNA 5HLGA 2EA2A 3T8TA 2FQ3A 5FB2A 1RNLA 4XSZF 4DQ2A 4OIOF 2VC1A 4YFKF 4G6DA 2Z3YA 4M71A 3ZN0A 1YW9A 3K1PA 3G73A 3F8NA 2DFIA 4CZZA 3D0SA 1FP2A 1W7PB 1U5TC 3K0LA 2QLZA 2ZFWA 5A2QZ 1S8NA 4UHTA 3SFZA 3FMRA 3QP5A 5TJJA 3ISPA 2D45A 1MGTA 1KYWA 3OV8A 4IXAA 4RB3C 1FX7A 1H9GA 2EFWA 1XSXA 2L02A 2QQ9A 5E1ZB 2DBBA 3VOEA 1KU7A 3ZQ7A 4WXHA 1ZRCA 3TDUC 1SD7A 4LLLA 1K79A 4O5VA 2DI3A 3BJ6A 3JW4A 2PI0A 3Q5FA 2VBZA 2P5KA 1ODDA 4IJAA 1O3SA 2M8EA 3FXUA 4EV0A 4KIBA 2F2EA 3H3ZA 1UHWA 4M9SA 2BYVE 4G9YA 2L54A 5D6FA 3JSPA 1FSEA 2ZBKA 4UV9A 3GW2A 2FEZA 3CDHA 3KETA 1QPMA 2HKOA 5H6QA 3VODA 3P9KA 5JR3A 3EUHA 5CVJA 3O3KA 2A69F 2CO5A 3E6DA 1HW2A 5CYVA 1UCRA 1HW5A 4BAYA 4YFNF 2K7LA 3FF5A 5E8IA 1LDKB 4LLNA 1DPRA 1JHHA 2O8XA 2HZTA 4P96A 4HX8A 4U0YA 1L3LA 1ULYA 2M45A 2H94A 1FT9A 3ROUA 1YYVA 4ESBA 2IRFG 2XVCA 4NB5A 2PMHA 2JPCA 4A0ZA 3V7CA 3J81Z 2VBWA 4MTDA 3I54A 1B4AA 1BIBA 2UWMA 2WV0A 2EFOA 5D8KB 3RPUA 2XAQA 4IHTA 2V1XA 2Z9OA 3P9CA 5E8GA 1C0WA 2JZYA 3FM3A 3PQKA 4WWCA 3IWZA 1LNWA 1PP7U 5LHIA 3ULQB 1BIAA 2E7XA 1TQMA 4G8XA 4HX7A 4HA8A 5LEJA 4OIRF 5FD5A 4WX9A 2FE3A 3KEOA 4I0BA 1R36A 1V3FA 3T1BA 5LRSA 3F8FA 2DLLA 3MFKA 1XMAA 4L9VA 4IPAA 5D8LB 4ZH4F 2P7CB 4Q47A 1S6LA 4IRHA 2VT2A 2G9WA 3DKWA 2QQBA 3FMQA 1R23A 1RI7A 4M9ZA 2QBYA 5K5RA 4L5JA 4EM2A 4L9JA 5LRRA 1FBSA 3ELKA 4OIQF 4EJTA 2IA0A 4IRIA 2LKPA 4HX4A 5LHGA 3COAC 1SFXA 2L4AA 4M6YA 4HF1A 1YFHA 1GXQA 1KU9A 4Q5SF 2B0LA 1GVJA 1BC8C 1D3YA 3JAMZ 3FX3A 2F5FA 3VEPA 1HSJA 3ZMTA 3QOPA 3V4GA 5ED4A 3LFKA 5HDGA 3D5LA 4R1HA 3I58A 2K4BA 3CUQA 1ZLJA 2XASA 1KU3A 2GAUA 4L9TA 5FGMA 2KJCA 4BHBA 5IT9K 2O0YA 5K1YA 5DEQA 5JVTA 3E3VA 1PUEE 4M72A 4Q4ZF 5BPDA 3E6MA 1RUOA 3HTUA 2J5OA 2EFQA 3E97A 3FHZA 3E6BA 3IC7A 3CO7C 2DT5A 4ESFA 3Q9VA 3GEZA 1I1GA 3DXJF 3GWZA 2CG4A 4WXDA 1R5HA 1BN5A 1LDDA 2H6BA 2R7DA 3V8LA 4HOBA 1ZH5A 4P55A 1J2XA 1IW7F 3WODF 2V9VA 2VBXA 3HSFA 1BI1A 2IPQX 4KA4A 3R0JA 2FOKA 4WCGA 1FZPB 2HTSA 2MLKA 2XRNA 3RKXA 2A07F 2H09A 1REPC 3G3ZA 5DUKA 2VXZA 1I6XA 1ON1A 2Z33A 3H3UA 3JTGA 4LGWA 5J8FA 4MQ9F 5K5OA 1B9MA 5CVUA 1R1VA 1SFEA 2EFPA 1XDUA 4OINF 2JRTA 4A5NA 3MQ0A 3GUDA 2ISZA 3CTAA 2P4WA 1FP1D 3C1DA 3V7SA 3HRUA 4IRGA 1XDSA 4I98B 4LMYA 2H6CA 3KE2A 4GXOA 3ZMSA 4YIIA 2DU9A 2MLGA 2HR3A 3IL2A 2LNBA 5D4RA 3C18A 4Y17A 4EM1A 1QO0D 2A5YB 4HLYA 5L3CA 2DK8A 1R7JA 4M73A 2Z5UA 2F5EA 4QLCU 2HOEA 3H92A 2RQPA 3BWGA 4XLPF 1NHAA 1YS7A 2XKOA 4KICA 2CQKA 1U5TA 2Q2EA 2QENA 1HXDA 1O3QA 2W85A 2QWWA 3RPQA 3RKWA 4P9FA 3F8CA 1OPCA 1YTYA 3KP5A 1K78A 2MH9A 5LHHA 4Q48A 3FMSA 2A3SA 3WTSC 6PAXA 1OYWA 3SQNA 4O6JA 3RJPA 4EVIA 2MA3A 3RYRA 5TRDA 2PLYA 2HTJA 2PEXA 5DCMA 2PQ8A 4MHGA 2JT1A 1MKMA 1V4RA 4R79A 1MD0A 3DP7A 1X3UA 4GYGA 1S7AA 3IWFA 3K1MA 2OQRA 1MJAA 4JQFA 2LF8A 5L3DA 3L2CA 2JPBA 2EB7A 1IN8A 4IHSA 2V79A 4GGGA 3IHUA 1XGNA 3FXRA 2FRHA 4FX4A 2EV6A 1YS6A 4LB6B 3REOA 1J59A 2KKOA 1O3TA 1IUYA 1Q1HA 2M1BA 3F8BA 3LQRA 5E18F 4ZYHA 1WRJA 2PN6A 2VOPA 1GXPA 4ON0A 4ENNA 2YX4A 2ZMEA 1J9IA 2COMA 1JXSA 1FPQA 3ZMDA 2HDCA 5D5VB 1K7AA 2G7UA 3MEXA 2K27A 2STWA 1D8KA 4KDPA 2XIGA 2F5CA 3AAFA 2OAZA 2VC0A 2OU2A 1TNSA 4KT5C 1LJ9A 1EH8A 1ZGAA 1UB9A 2GA1A 3NEUA 1Y0UA 2XROA 4M9XA 4I7HA 3TQNA 4YG2F 3L7WA 2Q0OA 4CICA 5LGNA 3E5XA 5KVRA 2A68F 4EMSA 2RC4A 1D8JA 1R5GA 1WKMA 3QAHA 2O03A 2IT0A 2R3SA 1T2KA 4TV7A 1IRFA 4A6DA 4RGUA 1Z7UA 3I59A 3I64A 2VE9A 1DDNA 4HDVA 2ZCWA 2XGXA 1QQIA 1U2WA 3GYHX 2M30A 2WWYA 5LLQA 1K6OA 3WTYC 1USTA 1Z05A 2XHKA 1LEBA 3BJOA 1U3EM 1IXCA 4MEYF 3BP8A 2L01A 5L3FA 3MZHA 3Q9SA 3BROA 1TQPA 2RNJA 4KUMA 2NAZA 2CGPA 2GA2A 2YPRA 4U7BA 3NQOA 2DQLA 4A6EA 3FZVA 2P5VA 1KYZA 4ZYDA 1HW1A 2L4MA 2FMYA 2PFBA 3M8FA 2EK5A 3ZMVA 1XSVA 3IRRA 1YQAA 3N4MA 3QPTA 4RGSA 4BQAA 2D1VA 2ISYA 4M74A 4CGZA 2VODA 1P92A 1XCVA 4KIGA 3U1DA 1QBJA 5HDKA 1W5TA 2CSOA 1T38A 5EEHA 5K5QA 1MJBA 5E1XA 4EJWA 5ERIA 4Y13A 2IP2A 1QZZA 4EGYA 1WWXA 3V8JA 3TDZC 1ZYRF 3SHFA 4EJOA 2OD5A 5FO5A 1B59A 2MH2A 3EYYA 4RS8A 3CO6C 2VT3A 1R58A 1S3JA 3HYIA 3MZYA 4OMYA 4LG0A 3LQQA 3QU3A 4JBAA 5HS7A 5HS8A 2K86A 4P5OA 2K02A 5J6XA 2HGCA 2JTVA 2NRAC 5HLIA 3WGGA 2PBIA 2VN2A 3WU1B 3L09A 3PQJA 2QZ8A 2DW4A 4A2UA 2D2WA 1E17A 1P6RA 2M87A 3EETA 1T98A 4FX0A 3M9AA 3DQVC 3U9GA 3K2ZA 3RIRA 1ZHFA 3JTHA 1USSA 1BM9A 1AOYA 1KA8A 1FSHA 4WF2A 3ABUA 1J7KA 1FNNA 5KK1A 1DP7P 4IVNA 4NQWA 1IAWA 1MDMA 3HRMA 2IVMA 3NRVA 2QBYB 4PGGA 3F3XA 5D4SA 2HWVA 1B1BA 3ZN1A 2W57A 3HSEA 3R61A 1XN7A 3TOAA 4ETSA 3KEQA 3QU6A 5D5UB 1Z91A 4YIFA 1WQ2A 4S04A 2BBYA 3RI4A 4U0VA 3W6KB 4B09A 1IN5A 1DUXC 5A2QK 1L0OC 4ZYGA 3GZ5A 4K2EA 1YO5C 3CUQB 1Z6RA 3KZZA 3PFIA 2IW5A 5BS6A 5HOOA 1O7FA 4S05A 1G3YA 2XAHA 3WTTC 3DV8A 5LGTA 5E17F 3BJAA 1ZRFA 4KFCA 1JGSA 4A0XA 3LA7A 2WTEA 1F5TA 1OKRA 4HV5A 2PJPA 1HSTA 4UUVA 3RYPA 3BDDA 1YLFA 2PMUA 2EJRA 3SXYA 3T8RA 1J0RA 2DQRA 2P5LC 1LB2A 2FMLA 1IN4A 3LA3A 1QNTA 2OZUA 2FBHA 2NS0A 3QP6A 3LWFA 3J80Z 2Z99A 4I09A 4RAYA 1R1TA 5LEKA 1BI3A 3L9FA 5L3GA 1P4XA 2ZKZA 1G3SA 5FLXZ 3I53A 3R0AA 1G6NA 2KIFA 3TO9A 5F64A 2BGCA 2GZWA 3KP7A 3KCCA 1R00A 3HRTA 1XD7A 2RGVA 3B02A 5DV5A 3KP4A 2F5DA 1FC3A 2AXLA 4H0EA 1TQIA 3WTVC 1T0FA 1IN7A 2A6EF 2XAGA 3B73A 3GX4X 2WC2A 2KJBA 5BMZA 1ZARA 3EDPA 2FBKA 1JHFA 1G3TA 1DPUA 2KRFA 4OOIA 3F22A 2MD5A 2GXGA 3J81K 3GFJA
chains in the Genus database with same CATH superfamily
3VWBA 1TW3A 3WG9A 3TP3A 3WTUC 1FYMA 4LFUA 3SZPA 3BZCA 3LSIA 4BQOA 3K70D 3S1NJ 5HVQC 3IRQA 1SVOA 4CO8A 3G1MA 4KT6A 2M4GA 2UXXA 4ZYAA 5EG0B 3C3WA 2KHMA 1G4DA 4BDZA 1Y8QB 4CA0A 1E2XA 2V6CA 3SEQA 2C6YA 3LSTA 2H27A 1OCPA 4HNVA 3QRFF 2H8RA 4JYKA 4MFDA 1OQYA 1V5EA 2XGDA 3GFLA 3KP6A 1YW8A 4HAMA 3RDIA 4BNCA 2I5UA 2M3AA 3I0TA 4QIWN 4M6XA 1ORKA 3MWMA 2HPMA 2BXYA 5GAGJ 4HBLA 1W36D 3M8EA 3PIOF 1RRJA 2FF4A 2FNAA 3LA2A 1P2FA 3HIFA 4UVCA 2YX7A 1TWFJ 2QYOA 2DJIA 4M3BA 2Y48A 5HS9A 5FD6A 4A3IJ 4U88A 2YU3A 2DA6A 4LLGF 3LSKA 3ZMUA 3PFYA 1U5TB 1WH7A 1JKOC 2Q2EB 1VFCA 1SFUA 3DPUA 5J8CA 4ESJA 4MTEA 4PJNA 1BR1A 2QM3A 2RVCA 2E1CA 3I4MJ 4EGZA 4XRFA 3JRIA 1YW7A 2CFXA 1I27A 5J1RA 5D5WB 4KYWA 3C7JA 3OIQA 2VIXA 5CLSA 4NDLA 1K78B 3LAPA 1S72I 3QOEA 1IN6A 1TW2A 1ZKGA 4IX7A 3DEUA 4GYIA 2R7FA 3WTWC 2UUZA 1KQ8A 3FM5A 1Z21A 1VF9A 4OMZA 2BVMA 1JE8A 2KMUA 2ZJPF 5DCMB 2DMPA 1D0XA 3WHCA 2R7RA 4DOZA 2E19A 2FXAA 3BPVA 1W7PD 2XDVA 2IS2A 2IA1A 4N4NB 1VTNC 1SD6A 1EF4A 1V55H 1FIAA 3TL4X 2DTRA 1MNMC 4PCQA 1AWCA 1X1BA 2YUSA 2CW7A 4ITVA 4ENMA 2Y31A 4IQJA 2JSCA 1G3WA 4KN4X 4Y3OA 2QVOA 3JAMK 1V54H 1Y39A 3CCVI 2ID6A 1Y1VJ 2MFZA 2W24A 3FHNA 1DQUA 1JI8A 3KZIC 4HSTA 3MKWB 4FHTA 1PUFB 3FBIB 3WGIA 1CF7A 3KP3A 4X6AJ 4XKCA 1W0UA 3MCZA 3VSLA 4AIHA 1Z9CA 1PYVA 4KMUX 2WV1A 5FLMJ 4C3HJ 3SJMA 4XNFA 5FKOA 4RB2C 1W5CC 2ZXHA 4GCVA 1FWZA 5FFZA 3S16J 1YHQI 4IQ4A 9ANTA 3OWTA 2VE8A 4OWRB 1FBUA 1QGPA 2AXTC 3OYBA 4A3DJ 3GFMA 3GXOA 3KPHA 1UJ8A 2MBFA 4AYBA 2F4IA 4MLOA 1ZRDA 2E2JJ 2CWEA 4UUTA 2DMTA 1ZG3A 3K4NA 5DCFA 1UHMA 5IPAA 3L2VA 2XAFA 2CQXA 1BC7C 2W25A 1D5YA 1KQ0A 2TDXA 2CUEA 4XICA 4RB0A 3KLNA 2VUMJ 2H1KA 2LBFB 2B63J 4HLXA 1IZ1A 1XTAA 3BG9A 3CC4I 3HOZJ 4UXNA 1FY7A 2FA5A 2ZMEB 1WJCA 1WPKA 4HQEA 2KIMA 2K4JA 4G94A 3BT9A 1QPIA 1XGOA 2Z16A 3AG1H 1Y8RB 3ZQFA 3CCJI 2EA4A 5EGOB 1FOXA 2XF7A 3JREA 2ESNA 1ON2A 3GTPJ 4ZJZA 1F36A 3OY9A 3TOBA 2JVGA 2LY2A 3F21A 3RKYA 1ZG5A 3IH4A 1FYLA 1N78A 3F8MA 3ZMZA 2AQEA 3JRBA 4BACA 2Z1DA 3L00A 2VOOA 5IP9J 4B48A 1UZCA 1YJNI 1KQ9A 2WAFA 1YRNA 1H8AC 2ME0A 1T08B 4HW0A 1T56A 5LBQA 4G6QA 3W6JB 1VQ6I 1S7OA 3OYFA 2XAJA 1SANA 2HKXA 2KZVA 4MEXF 5H20A 2D5VA 1G8XA 4GFBA 3CMYA 3A0BC 4U7DA 4BYYA 4QTRA 4V19K 2NNNA 2OJED 1R1UA 2E1MB 4E4HA 3A4CA 1TWGJ 3ABMH 3GVAA 1Z1DA 5ILUA 1SFOJ 1OCTC 2DPUA 2CV1A 2ELHA 2R7VA 3F6VA 3E1SA 2OUMA 1A36A 2XKPA 4PDKA 4AD9A 4A3GJ 3B6AA 3TP0A 4IHVA 2GWRA 1W4MA 1W7PA 2KL4A 4WK8F 4BQNA 4LK0F 2KIUA 2OCCH 3ZCOA 4BE0A 3BPXA 1XG1A 1OR7C 2BHZA 3I59B 3KZYA 3BG6A 3JSOA 2QUFA 5ICEA 2DA1A 4AIKA 1BOAA 4N0BA 2GXBA 1FOWA 3S32A 3EUAA 1LE8B 4ZDLA 1OCCH 5IT3A 3BQZA 5TISC 2ZNYA 2GQQA 3E0JB 4RMNA 2EWNA 3KFWX 2LH9A 4EQQA 1GDTA 3QPHA 5IT9Z 2CW8A 2GM4A 1WZ2A 3P9IA 4F7ZA 3WG7H 3VB2A 4CHUA 2RN7A 1ONVA 2JA8J 4XLCA 2G0EA 1U6GA 2CMPA 5CQEA 1XB4A 4XBFA 2X0LA 2V4JC 2E60A 1SAUA 3QPLA 3GFIA 2WADA 3GLLA 1K4TA 3A01B 3LL7A 3NWTA 3S2WA 1IRGA 2P8TA 2OA4A 2PJRB 5GTIC 3ZP5A 1MMNA 4LOCA 1PDNC 3FKIJ 2EQRA 2IGKA 4D0PA 5IYCJ 3BZ6A 3K69A 2DCEA 2KPMA 3AL0B 2HQ5A 5ICGA 1BL0A 2AS5F 4BHCA 3K9TA 5EEGA 3MAJA 1NG6A 5HLHA 1XC5A 4BXUA 3FXOA 2E5NA 2O5RA 1ZAOA 5CJ9A 5JVGF 3ECOA 3ZQIA 3OOPA 3HUGA 1KGSA 1X3WB 3ERMA 2OC6A 1RKTA 4HSRA 3CDIA 2X9DA 1VQ5I 1HQCA 1PVEA 4ZDPA 2EFNA 3WGHA 4WXCA 2QQAA 3F72A 4I02A 5CVRA 5FJ8J 1IRZA 3KLOA 2L7ZA 1HKSA 1W36C 1Q1VA 2HYJA 2WAQN 2EV5A 1R49A 2LDUA 4XSXF 4LG0B 3M7GA 1ERDA 1FLIA 4HF0A 4ZYEA 3BOQA 2ACJA 2R7OA 2BV6A 4PJLA 5AIQA 5AONA 3DFGA 2ESHA 1VQPI 1S7EA 1GT0C 1AKHA 5EYRA 1BI2A 3OL4A 1RESA 2XPVA 4UVAA 5FROA 3DEWA 1LVAA 2Q8KA 2KISA 2UZKA 3CLOA 1J09A 5KAIC 4Y52J 4O3MA 4BDYA 1V5GA 3V8KA 1BJAA 4B3XA 1OISA 1Y56A 3ZPLA 4OIPF 2M5WA 2NOJB 3RTRA 2Q1ZB 1EV7A 3HSRA 5GADJ 2XUBA 2DTZA 3S2HJ 2VQLA 3DTKA 1N25A 1OCOH 1P7JA 3GCMA 1MIJA 2E2HJ 2OZ6A 5DD4A 4A12A 2Y9YA 3IH3A 4I2OA 4BU2A 3BCBA 4RB1A 5D6EA 2P6SA 3BTJA 3H5RA 5E3LA 2OTLI 2W84A 3DEEA 4J01A 2DO7A 2YR2A 3O2PE 3OYCA 4A3CJ 4ZDOA 1SFKA 2R7QA 2RV8A 4NQWB 4KNYA 1STZA 1MDMB 3HB9A 2RAEA 1BBYA 1Z6TA 5B3SH 3ZQLA 2VQCA 3BQYA 4QPOA 1RIOH 2DAOA 2RKHA 3BR3A 1N77A 4DJAA 3E5UA 5E1WA 4A5MA 3H0DA 1XX5A 4HQMA 1HBXG 2AHQA 1T6SA 3LSMA 1SD4A 1WSUA 2V1UA 4RGXA 1UFMA 4BJ6C 2DFFA 2O3FA 1XGMA 4A69C 5FFXA 4RAZA 4F93B 1HKTA 4RGRA 2IJLA 2XPUA 1VQ9I 2D1HA 2PG4A 2X6WA 2ZB9A 1ZQ3P 1XPXA 3DPTA 2W4SA 3GLXA 3ZR8X 1P4AA 2QSFX 3ONQA 4IF4A 4AVPA 5F04A 1YITI 3PNTA 4NHJA 3GTQJ 1BA5A 2E71A 5EDNA 1JKRC 1HA8A 1J5YA 4LD5A 4E6KG 2VASA 2DK5A 4DW6A 3KEYA 1W5SA 2A6HF 5J3LA 2EIMH 3TMOA 3SZTA 3ABTA 5CVIA 5ILSA 1D5VA 3RCOA 4L18B 3CUOA 3BY6A 4FISA 4CYDA 2NYXA 3SFIA 4XONA 5C4JJ 2Z2SB 3DWLE 4C9YA 4N9HA 1YIOA 1JGGA 4I99C 1ZLKA 5ILVA 2EV0A 3R4KA 2KFDA 5L3BA 4ENJA 5DDGA 2L0KA 1MMAA 2L7FP 4BGDA 1U8RA 1LUJB 4ZZDA 1NG7A 3K4CA 5H6RA 1I5ZA 1F9NA 1K4SA 3K4MA 2NOGA 2DYRH 1YOVB 3EQLF 3I4PA 4EJVA 2LMDA 1P7IA 4U0WA 1MNDA 1HC8A 3OOUA 3H5AA 2DJNA 3BR5A 3ZXSA 2LKSA 3E6CC 2Y0MA 1LQ1A 1WHUA 3IKVA 4J19A 3EUHC 4G7HF 3AG2H 2EILH 5BPIA 1JJ6C 1IO2A 4MQVA 5DD8A 4AWXB 4RLQA 5BQTA 4MNUA 2MC3A 1HDPA 4X1EA 3ERED 4F91B 1ZR2A 1I1SA 1K6YA 5FKMA 4XQFA 3M1CA 4OU0A 1P4WA 1EH6A 3G2BA 4HF2A 2CW0F 1H0MA 1R4MB 5DYMA 3N97A 2VJIA 3JRCA 5LGUA 4UUSA 5GTHC 5TGTA 1CQTA 3EYIA 1E3HA 2WB1N 2RREA 4HZFA 2NNYA 2HFHA 4BJ5C 3BC8A 4PK4A 5AIPA 4IOAF 1Z7LA 4ASNA 3F23A 3MD2A 1B8IB 4FE4A 2VKDA 1R5ID 3CP2A 2CRGA 2O61A 3CLQA 5H2FC 3F6OA 1MH4A 1RR8C 2ADUA 3EUKL 2CYYA 1SMTA 1TT5B 3K1NA 4GO1A 1SD5A 2R0QC 2L5QA 4BEHA 4ENKA 1PP8F 1H89C 1A35A 4KMFA 1B6AA 2VLAA 3V7RA 3HTSB 2H1LA 3I5UA 1TWHJ 5ICCA 4IEJA 1IF1A 1ZN2A 3FXLA 2FQ4A 2OCEA 2K40A 1TBXA 4A0YA 3GO5A 5FRMA 1R6RA 2P7VB 2ZJ2A 1GVDA 4UB6C 2LSOA 3CDLA 4BKXA 3KP2A 4XKVA 2I8DA 5KHDA 3WTZA 1LDJA 2CH0A 2KZGA 2ZXJA 3I71A 3HKZA 2ETHA 2JUCA 1T39A 1SMYF 3F9KA 1ZG1A 1H9TA 1HKQA 2FSWA 1MZBA 2HPIA 3Q0VA 2LR8A 2JA6J 2BZTA 1ZK8A 2F4OB 2MYSA 3HOYJ 5JFRA 4OAYA 3HJEA 2HYFA 3HRSA 4JX4A 3WU0A 4PGHA 1CGPA 1ZELA 4G7ZF 1S29A 1MNEA 3WE3A 2B9SA 5LFAA 2DOAA 3GF2A 1WI9A 3LAJA 2XB5A 2LYCA 3TO6A 4YELA 1F43A 4KIFA 2DMQA 4JX5A 4U87A 5CVVA 4HPQA 3VYSB 5K7HA 3W3CA 4E7JA 2UXNA 3BCAA 2XV4S 5HDNA 2O6GE 2K9LA 2M4KA 5L3EA 1U8BA 4D1QA 4XLHA 3DF8A 4CXFA 1MBKA 2R7TA 1XCBA 2NS7A 3HOSA 1FYKA 1JUSA 2A5WA 1K83J 1POGA 4UVBA 4Y15A 4L5IA 1BR4A 2BEOA 4ZZLA 2GIVA 3TGNA 1NK3P 1BOBA 2Y75A 2A05A 5HODA 2HEOA 1IXRC 4GRIA 4LJZF 1TTYA 1QZYA 3K4BA 3PL8A 4PZJA 5GP9A 3WU2C 1FTTA 2CQQA 3H35A 2RDPA 3J81K 4E7LA 2V1DA 1XS9A 4NUBA 3H9JA 3RSNA 1TLHB 4KN7X 1O3RA 1XMKA 4MFEA 2XC7A 4F3QA 2X4HA 5DUIA 4I6ZA 1F1ZA 1MBEA 3SDGA 3J7YJ 3N05A 1SAXA 3M1EA 1FOKA 2HOTA 1T33A 2M34A 1Z67A 1F4KA 3HHGA 3S15J 3D5SC 2K5CA 1J75A 4FCYA 4RBOA 4G7OF 2LTPA 1VQOI 4HYEA 3BR1A 1GHCA 2LG4A 2K3FA 2X85A 5ICFA 1KZHA 5BOXA 3MZ8A 3CUQC 5JHUA 1QU3A 3Q3SA 2FNPA 2VBYA 4CDGA 4AIJA 3E5QA 2BE5F 3HHHA 4MGRA 2YSRA 4EM0B 4QWQA 4CZCA 2E7WA 2OF7A 3DPLC 3TO7A 2X48A 2CU7A 1ETYA 3G1OA 4HNTA 3CCRI 4L9NA 3WE2A 4JP0A 2VQGA 3CQZJ 3T5XA 1SEUA 2F6CA 4R8HA 2KQRA 1EH7A 4LITA 4BY1J 2FOWA 4UY8I 2R4GA 3G4SI 5DM6F 1W0TA 1VQ4I 1MJ9A 4JK1X 3IKTA 2E5ZA 2FBIA 1G59A 4Z2YA 4Y7NJ 4L0ZB 5F6FA 1OYIA 4XKWA 3JCUC 1O7LA 1WGXA 5FKNA 3UR3C 2FU4A 3R60A 2Y0SA 4UV8A 3RQ4A 1YG2A 2ZSIB 1OR7A 2ZO4A 1U78A 4XLNF 4UB8C 2A61A 1LVKA 3GTJJ 1D0ZA 3AKZA 1IXSB 3FWEA 4B8XA 3J7AO 2ZFUA 3RZDJ 2NVTJ 1NH3A 1SC7A 2LF7A 4C2UA 3FXQA 1XSDA 2LRDA 1OYYA 2OQGA 4II3A 5E20A 1CF7B 2HNHA 2VI6A 3GZ6A 1A04A 4V2GA 2HYGD 5FKLA 4HG2A 1T8IA 1LEAA 2HS5A 1DU0A 1UELB 2ZNZA 4HV6A 4QPQA 4ZTJA 4XMYA 3W2AA 2E34A 4LB5A 1BI0A 3TKYA 2DODA 3R6SA 1R22A 5IY5H 2P6TA 4Y33A 2NVYJ 5IYDJ 3O6BB 2BXZA 2STTA 3O8HA 4A3LJ 4JOMA 1AA7A 1O57A 1XGSA 3HDDA 4A3FJ 3WTXC 1IDZA 2G7HA 5EZHA 3PSIA 3IH2A 3IAM2 3P7NA 1IG7A 4Y4RA 1RZ4A 2V9KA 2VPRA 4BXFA 2ZXWH 1MMSA 3L2WA 3ECHA 4IHWA 3BR2A 3HC7A 4BHPA 2IA2A 1H88C 1OMIA 4KJZA 4BH9A 4YFXF 4BXXJ 4FT8A 4I0AA 1TNTA 2IGOA 2A6TA 2E1NA 2WB1A 2R5ZA 1ZGJA 3L1PA 3HOTA 2VONA 3J80K 3I9V2 2R7UA 5M3FJ 2YU9J 1FBQA 2W00A 4CH7A 5JI6A 3T0YA 1V5FA 4UNOA 4EATA 1ZREA 2V7FA 2QKLB 5F1RA 3VFZA 2JSPA 3CJNA 1WJBA 3LSHA 2XSJC 4RA2A 4HDUA 2DPDA 3U2RA 5D5XB 4E70A 1KU2A 2K85A 3ML6A 2NVQJ 4DNCA 2LY1A 5FLXK 4N9IA 2MSYA 2HQRA 2V26A 4L0YB 2J5PA 3M3YJ 4I01A 3H9GA 1B9NA 2HQNA 3OMYA 4LK1F 4EJUA 1FIPA 2OBPA 1N75A 4P9UA 2L3DA 1LFBA 1YJ9I 1RUNA 4ABZA 3G71I 5HLGA 3RZOJ 2CJJA 2EA2A 3T8TA 2FQ3A 1YRNB 3VYTB 5FB2A 1RNLA 4ZC3A 2R5YA 4XSZF 2PMZN 4DQ2A 2CS3A 4OIOF 2VC1A 4YFKF 1EJ9A 2BY1A 4D7NA 4BJTA 3QYEA 4G6DA 5HNHA 2Z3YA 4M71A 2M2EA 3ZN0A 2UV1A 2XB0X 4FTHA 1X2MA 1YW9A 3J7AY 2XGCA 2X6YA 3K1PA 3G73A 3F8NA 1FJLA 2DFIA 3HPGA 4CZZA 1ZGWA 3D0SA 2EIJH 1FP2A 4A3BJ 1W7PB 3OYIA 2F5VA 2EH3A 5KCMA 1U5TC 3K0LA 2QLZA 2ZFWA 5A2QZ 1S8NA 2VJ5A 2BY2A 3OIPA 4UHTA 2LLKA 1P9QC 3RPUD 3SFZA 3FMRA 4M3GA 2Y2ZA 3L2UA 3QP5A 2K9NA 5TJJA 3ISPA 2D45A 1MGTA 1KYWA 3OV8A 4IXAA 3QWLA 4BQQA 4G12A 1U0JA 1UG0A 4RAFA 1LFUP 4XK4A 4DZPA 4RB3C 1FX7A 1JJ8C 1QRYA 1H9GA 4NBQA 4PSXA 2EFWA 1XSXA 2L02A 2QQ9A 5E1ZB 3JRHA 3A0HC 1MBGA 2M9HA 2DBBA 3GZNB 3VOEA 2XAUA 1KU7A 3ZQ7A 3S3MA 4HNUA 4WXHA 1ZRCA 3TDUC 4BE1A 1SD7A 1TL8A 4NNJA 2DA4A 4LLLA 1K79A 1YX3A 3G1LA 4D9JA 2V6EA 2IGNA 3BG5A 4O5VA 2DI3A 3BJ6A 3JW4A 2PI0A 3FK7A 3Q5FA 1GUUA 2VBZA 2P5KA 3DBHB 1ODDA 1D0YA 1QHGA 2M8GX 4IJAA 1O3SA 1X4PA 2F48A 2M8EA 2QGUA 1TWCJ 3DKYA 4Z6YA 3FXUA 2DT7B 2KT0A 4A3JJ 2CFOA 3U21A 3DKXA 4EV0A 4KIBA 2F2EA 2HVSA 2K9MA 3H3ZA 1UHWA 3P5JA 4M9SA 2BYVE 2BW3A 2R7WA 2IS4A 2ELJA 4G9YA 4HEA2 2L54A 5D6FA 2X6OA 1QZEA 2W48A 1FSEA 3JSPA 1D1AA 1HCRA 3HUGB 1QA6A 1IGNA 3BTCA 2EIKH 2ZBKA 4UV9A 3HPHA 3LOCA 5GPCA 2FEZA 3GW2A 3CDHA 3KETA 1QPMA 2HKOA 5H6QA 4XR6A 3VODA 2GXAA 3P9KA 2O9LA 5JR3A 2OTJI 1DGWY 3EUHA 3PM1A 3A02A 3OYAA 2KDOA 1X2NA 4NC6A 1TT0A 5CVJA 3O3KA 2A69F 2CO5A 3E6DA 3PO2J 2HXOA 3DTEA 1WJFA 1HW2A 3OSFA 2CQ7A 2CUFA 2P0WA 3TEDA 5CYVA 1UCRA 2VB6A 1HW5A 4C2MJ 2QEXI 4HRIA 4BAYA 4YFNF 1AKHB 2K7LA 2HVQA 2MW8A 1LDKB 3FF5A 5E8IA 1DPRA 3OYEA 1JHHA 3K4KA 3A1YA 3OSGA 4LLNA 2O8XA 3BZKA 5B1AH 2HZTA 4P96A 2ZMEC 4HX8A 1R4NB 5GAHJ 1FMVA 4U0YA 3OYHA 1L3LA 1ULYA 4IO9F 3FISA 2M45A 2I10A 2H94A 1FT9A 3DLAA 3ROUA 1YYVA 4XIDA 4E7HA 2W82A 4ESBA 1R71A 2IRFG 2XVCA 1IJWC 2F4MB 3BG3A 3UKGA 4F52A 1VNDA 4NB5A 2PMHA 2JPCA 3LSPA 4S0HB 4A0ZA 3V7CA 3J81Z 2VBWA 2DN0A 4MTDA 3I54A 1B4AA 1BIBA 3OYDA 2WV0A 2UWMA 4ZTFA 2EFOA 1X4OA 3K4JA 5D8KB 3RPUA 4IKFA 1D1CA 2XAQA 4IHTA 2V1XA 5E3NA 2Z9OA 2VPLA 3ABLH 2Y30A 3P9CA 5E8GA 5B1BH 1C0WA 4C2TA 2JZYA 3FM3A 2L7MP 5KAFC 4M6VA 3PQKA 3PUFA 4WWCA 3VDXA 3IWZA 1LNWA 1X19A 2QKMB 1PP7U 1UHSA 5LHIA 3ULQB 1HOMA 1BIAA 2E7XA 1TQMA 4G8XA 4HX7A 2DMUA 4HA8A 3MKLA 5DM7F 4ANJA 2E1MC 1X3ZB 2NXNB 4BUPA 5LEJA 3DTIA 5FD5A 4OIRF 1Y1WJ 2CV0A 4CUGA 1Z77A 1EKEA 4WX9A 2FE3A 2DA3A 3M4OJ 3KEOA 4I0BA 1B72A 1R36A 1V3FA 3T1BA 3Q0WA 5LRSA 3F8FA 1A6IA 2DLLA 3MFKA 1XMAA 4L9VA 4IPAA 3SEZA 2EZLA 4GDFA 5D8LB 4ZH4F 2DT6A 2DMNA 2P7CB 4Q47A 3CD6I 1S6LA 3S17J 3VYUB 1D1BA 2JA2A 3AG4H 4IRHA 2VT2A 2G9WA 3DKWA 5F0HA 2QQBA 1DU6A 3FMQA 1R23A 1RI7A 3FXKA 2IEKA 4M9ZA 4FE7A 5LD2C 3NWSA 2QBYA 5K5RA 3JRAA 1ITYA 3MKYB 4L5JA 4EM2A 4L9JA 5LRRA 2JQ7A 2HZDA 1FBSA 3ELKA 4DYRA 2WY8Q 4OIQF 4FQGA 4EJTA 2IA0A 4IRIA 2LKPA 4YEJA 4XN0A 4HX4A 1SVLA 5LHGA 3A2KA 3COAC 1SFXA 2L4AA 5J4VA 5FRNA 4M6YA 5M5YJ 2XPWA 2N8GA 2X1EA 3FK6A 4HF1A 1YFHA 1GXQA 5F0CA 1KU9A 2H8WA 2O8KA 2B0LA 4Q5SF 3QYBA 3CCUI 1GVJA 2X6XA 1BC8C 3F0CA 3AL0C 1MSFC 3HXLA 1ZR4A 3MVPA 4F55A 3TBIA 1D3YA 3JAMZ 3FX3A 2W7NA 2F5FA 3VEPA 1HSJA 2EPFA 3BG7A 3ZMTA 2JA7J 1FTZA 3QOPA 3V4GA 5ED4A 5BNGA 2HI3A 4UUSB 3LFKA 5HDGA 3D5LA 1WJAA 4R1HA 3I58A 2K4BA 3CUQA 1ZLJA 4CCMA 2XASA 4DGWB 2DYSH 3AFHA 1ETVA 1JUMA 2JN6A 3GBGA 3ZRGA 2K3PA 1KU3A 2DOEA 2GAUA 5J1UA 4LIVA 5GAEJ 4L9TA 2JUGA 5FGMA 4E7ZA 5IOYA 1TC3C 3HOUJ 2HDDA 2KJCA 3CJTB 4BHBA 5C44J 5IT9K 3WHBA 2O0YA 3K10A 3IAS2 5K1YA 5DEQA 4BEHB 5JVTA 3E3VA 1PUEE 1I6HJ 4M72A 4Q4ZF 5BPDA 3OS2A 3E6MA 1RUOA 1DGRM 3HTUA 2J5OA 2EFQA 3E97A 3FHZA 1RR7A 2DFHA 3E6BA 3IC7A 4C30A 3CO7C 2DT5A 3HOVJ 4AC0A 4ESFA 3OYMA 3MN2A 5M5WJ 5EEAA 4D7MA 3G6EI 3UNGC 4XN3A 3CCLI 3DCFA 3Q9VA 5JLWA 1PJRA 3GEZA 1I1GA 5M5XJ 1Y0NA 3BR6A 3DXJF 4LG3A 3GWZA 2CG4A 1WJDA 4WXDA 4MO7A 1HDDC 3LFUA 1AHDP 3A03A 1R5HA 1BN5A 4KISA 2JWTA 3JRDA 1LDDA 4XLFA 2H6BA 4PUSA 5EJCA 3CF2A 3PSFA 2R7DA 3SYTA 1ENHA 4HOBA 3V8LA 4BY7J 1ZH5A 4P55A 1J2XA 1IW7F 3CCEI 2GOMA 3WODF 3DBLB 2V9VA 3GMEA 2VBXA 2WAQA 2BY0A 3HSFA 1BI1A 2IPQX 3LMMA 1JUPA 4KA4A 2JA5J 3R0JA 2FOKA 4WCGA 1FZPB 2HTSA 2MLKA 2XRNA 3E7LA 3RKXA 4P1WA 2A07F 2IGMA 3LNQA 2H09A 1REPC 2GBYA 3G3ZA 5DUKA 5J1YA 4CYCA 2VXZA 4E7KA 1T95A 1I6XA 2KRCA 5F0FA 1ON1A 2Z33A 1JT0A 3H3UA 3W2WA 3JTGA 4LGWA 5J8FA 1E3OC 4MQ9F 4PJJA 3D1NI 3HM5A 4B44A 3C2HA 5K5OA 2IBDA 1B9MA 5CVUA 2HU9A 5E3MA 1R1VA 1SFEA 2W1OA 2EFPA 1XDUA 4OINF 4J00A 2JRTA 4A5NA 1ETXA 2GIZA 3MQ0A 3GUDA 4RM3A 2ISZA 1ETWA 1YI2I 3CTAA 2CUZA 2KLOA 2P4WA 5F27A 1FP1D 1JKPC 3C1DA 3V7SA 4B1RA 3RKQA 3HRUA 1BR2A 4IRGA 4JX6A 1XDSA 4MIMA 4I98B 4LMYA 2H6CA 3BTLA 3KE2A 4AUXA 3I4NJ 4GXOA 1OLTA 3MMYB 3ZMSA 3KYCB 4YIIA 5EG0A 4XOTA 2X51A 2DU9A 2MLGA 2JJ7A 2HR3A 3IL2A 4E7IA 2LNBA 2VJ4A 5D4RA 3C18A 1LFPA 4Y17A 4EM1A 1VI0A 2HDWA 3O8GA 1QO0D 2LC2A 2A5YB 4HLYA 3HOWJ 1VQLI 5GPAA 5L3CA 2DK8A 2YS9A 1IC8A 2HXIA 2IXSA 1R7JA 3K2AA 4M73A 4BS9A 2Z5UA 3SDBA 2F5EA 4QLCU 5C4XJ 4PFOA 4FETA 2E2IJ 4X0GA 4A3KJ 2LVSA 2HOEA 2CQNA 2AO9A 2TRTA 2E35A 3MKZA 3GTKJ 2DDBA 2RQPA 3BWGA 3H92A 4XLPF 1VZ0A 2R7ZJ 1NHAA 1YS7A 2VKEA 2XKOA 4KICA 1MH3A 2CQKA 4A93J 1U5TA 4A3MJ 2Q2EA 2QENA 1HXDA 2TCTA 1O3QA 5B66C 2W85A 1QVTA 2QWWA 5IP7J 3KYDB 3RPQA 3I56I 1BJZA 1RETA 3RKWA 3DBRB 3JR9A 4P9FA 3F8CA 1OPCA 1YTYA 3KP5A 3S93A 4PJMA 1Z3XA 2XGEA 3ZQGA 1K78A 1ETOA 2MH9A 5LHHA 4Q48A 1GLNA 4CCKA 3FMSA 2EBIA 2A3SA 4M3FA 3WTSC 6PAXA 3H3VK 1OYWA 3SQNA 4O6JA 1YIJI 3RJPA 3CP8A 2ECBA 2L9NA 2MA3A 4D5CA 4EVIA 3CMMA 3RYRA 2LK2A 4RAGA 5TRDA 2PLYA 2HTJA 5K7FA 2PEXA 2E36A 5DCMA 2MG4A 2PQ8A 4MHGA 2JT1A 1MKMA 1V4RA 4R79A 4DIQA 1MD0A 4XLAA 3FKJA 2EZHA 3CC2I 3DP7A 4KITB 1MMDA 3S3NA 1YJWI 1A31A 1X3UA 5J40A 3OYNA 2JK3A 4GYGA 2BY3A 1S7AA 2EZIA 2X1CA 3CCYA 3IWFA 1MSEC 4IHXA 3K1MA 3S1RJ 1MBHA 2OQRA 1MJAA 2R93J 2P81A 4JQFA 4IHYA 2LF8A 1SVMA 1WCMJ 5L3DA 3L2CA 2R5ZB 2FUG2 3L2RA 4BL0B 2VL8A 2O7OA 4RDUA 2JPBA 3OL3A 2EB7A 5CPRB 1T0FC 1PUFA 1IN8A 4IHSA 2FJ1A 2KIQA 1XMXA 5CQGA 3PJRA 4L5EA 2LD5A 2OPTA 1Z3YA 2WBMA 3W2VA 4YRVA 1M1EB 2V79A 4GGGA 3IHUA 1XGNA 2XRLA 2ZJQF 3FXRA 4M3DA 3HOXJ 2FRHA 1OCZH 4FX4A 1MMGA 2MC4A 2EV6A 1YS6A 4LB6B 3BTIA 2DA5A 1VQMI 1A6QA 5FKKA 1FOYA 1G2HA 4OAZA 2M7AA 5EF6A 4B3AA 3REOA 2V9PA 3OYJA 2WA0A 2VXDA 1J59A 2HOAA 2K9QA 2KKOA 1O3TA 3BR0A 1IUYA 1Q1HA 2M1BA 3F8BA 3LQRA 1JTXA 5E18F 2LBFA 4ZYHA 1WRJA 2PN6A 2Y9ZA 3NAUA 3IP4B 2VOPA 2ZSHB 3ESWB 1VQ7I 4XORA 3TW7A 2R5YB 1GV2A 1GXPA 4ON0A 2VQHA 2YX4A 4ENNA 2ZMEA 1J9IA 1OCRH 2COMA 2CV2A 1JXSA 5IYBJ 1FPQA 3ZMDA 2HDCA 4DZJA 1YX5A 3H36A 4NC7A 5EGOA 4FASD 4II2A 4W1UA 5D5VB 1K7AA 1OJLA 2G7UA 3MEXA 3PNVA 2K27A 2STWA 1D8KA 2ME6A 4AIDA 4KDPA 2XIGA 2F5CA 3HZJA 3AAFA 2OAZA 2VC0A 2BVLA 2OU2A 3S14J 1TNSA 3ZQHA 4KT5C 4CCOA 3ASOH 1LJ9A 2LFBA 3Q0UA 3HL2A 1EH8A 1ZGAA 1UB9A 3KYLA 2GA1A 3NEUA 1Y0UA 1APLC 3M8JA 4XRSA 4RM2A 4M9XA 2XROA 4I7HA 3HBLA 3RQIA 3C2GA 3TQNA 2Y69H 1JKQC 2L7KA 4YG2F 3AG3H 3L7WA 3CC7I 1KONA 2COBA 2Q0OA 4PSWA 2R7XA 4CICA 5LGNA 3E5XA 5KVRA 2A68F 1A5JA 4EMSA 2RC4A 5J4YA 1D8JA 5E3OA 1R5GA 1WKMA 3QAHA 4IZZA 2O03A 2IT0A 1TWAJ 4E7SA 1X58A 2DA2A 4PJ0C 2R3SA 3VYRB 1T2KA 3QQAA 4TV7A 1IRFA 2CUJA 2L9SA 3FIWA 1X1CA 5HLTA 4A6DA 4RGUA 4A3EJ 1Z7UA 3I59A 3I64A 2LKXA 1TP4A 2VE9A 2ICWG 3IUOA 1I3QJ 1DDNA 4HDVA 2L2OA 4DBRA 2ZCWA 2XGXA 2VKVA 1QQIA 1U2WA 1LE8A 4XRSG 2RQQA 2BW3B 4I76A 3GYHX 2M30A 2OV7A 4XRMA 2WWYA 1BW5A 5LLQA 1K6OA 3WTYC 5JHFA 1USTA 2VJJA 1Z05A 2XHKA 4CCNA 5EZGA 1LEBA 3GTGJ 3BJOA 5F08A 1U3EM 1IXCA 3S8PA 4MEYF 3BP8A 3W6VA 2L01A 5L3FA 3MZHA 3Q9SA 3BROA 3VSKA 1TQPA 2BHYA 2RNJA 4M3EA 4XL9A 3J7ZI 4V2FA 4KUMA 3OS1A 2X1DA 2NAZA 2CGPA 2GA2A 2YPRA 4U7BA 3NQOA 2DQLA 1UAAA 1E3PA 4A6EA 3PNYA 3FZVA 2HQAA 2P5VA 3A01A 1KYZA 1E0EA 4ZYDA 3HEFA 5F1JA 3OR1C 4CCJA 4XLEA 1HW1A 2PJRA 4F92B 2MGQA 2L4MA 2QQ8A 2FMYA 2PFBA 3ZGKA 3QODA 5HNFA 1Y6IA 3FXJA 5KNLA 3CCMI 2DDAA 1DP3A 3M8FA 4N4OB 4PFPA 2EK5A 3ZMVA 1XSVA 3IRRA 2QA4I 1YQAA 2EINH 3CESA 3K70C 3LSRA 3N4MA 1IRXA 3QPTA 4RGSA 4BQAA 2D1VA 2E1OA 5DTDA 2ISYA 3C2BA 4M74A 4CGZA 1JT6A 2VODA 1LKXA 3HKZN 1P92A 1XCVA 4KIGA 3U1DA 1QBJA 5HDKA 1W5TA 2CSOA 1T38A 3LSGA 1IV8A 5EEHA 5K5QA 1MJBA 2ZXIA 3S1MJ 5E1XA 1WI3A 4EJWA 5ERIA 3K4LA 4Y13A 4DYCA 3X2QH 3PO3J 3FDYA 4DBQA 3S1QJ 4D5FA 2IP2A 1QZZA 1VQ8I 1I39A 3K7AJ 4EGYA 3V42A 1W1WE 4BBRJ 4C3IJ 5C3EJ 1WWXA 1Z0XA 4XKBA 2QSGX 3BLYA 2BOLA 3EPZA 5E79C 2AQFA 3ABKH 1ZYRF 3SHFA 3TDZC 3V8JA 2OD5A 3H1CA 5FO5A 1B59A 2MH2A 4EJOA 3L2QA 4BBSJ 3EYYA 4RS8A 4QSHA 2QCOA 3CO6C 2VT3A 1R58A 1S3JA 3HYIA 3MZYA 4OMYA 2JRMA 4LG0A 2XSDC 3LQQA 5CKTA 1ETQA 3QU3A 4JBAA 1WJ5A 5HS7A 2K9SA 1MW7A 5HS8A 2IAIA 1BW6A 1MBJA 2K86A 4P5OA 2XF6A 3S3OA 2K02A 2PX9A 5J6XA 2HGCA 2JTVA 2NRAC 5HLIA 4CCLA 2FX0A 3WGGA 2PBIA 2WY7Q 2VN2A 3CJQB 3KIOA 4B4CA 3WU1B 3L09A 3PQJA 5B5EC 2QZ8A 4IL6C 2DW4A 4A2UA 1ETKA 2D2WA 1E17A 1P6RA 2M87A 3EETA 3HG9A 1T98A 2IS6A 1ACIA 4FX0A 3I3LA 3M9AA 3DQVC 3QYFA 1B72B 2ID3A 2LREA 3U9GA 2V1NA 5IOZA 3K2ZA 1U9NA 1ZHFA 3RIRA 3JTHA 1FEXA 1USSA 1BM9A 3ZOBA 1AOYA 1KA8A 1FSHA 4WF2A 3ABUA 1J7KA 1VQNI 1FNNA 3H0GJ 1RC9A 1GV5A 5KK1A 1DP7P 4IVNA 3HGYA 4NQWA 1HLVA 1IAWA 3GTOJ 1MDMA 1FMWA 3HGGA 3OYLA 3HRMA 2L9RA 2ZC2A 2FD5A 2IVMA 3K6GA 1WVRA 2DOFA 2JMWA 3NRVA 2VKHA 2QBYB 4XM3A 1R9TJ 1IV6A 4PGGA 3F3XA 5D4SA 3JRGA 2LOOA 1JTYA 2HWVA 3FXMA 4DYQA 1B1BA 3VPRA 3ZN1A 4H4KC 4C3JJ 2W57A 2NVXJ 5DS9A 2PMZA 3HSEA 4G6TB 2KP6A 2QF7A 3U1KA 3R61A 3OR2C 1XN7A 2L9VA 3TOAA 3TW6A 4LIUA 3CCQI 3DU6A 4ETSA 2RNGA 5K7ZA 3DLLF 2ELKA 3KEQA 4EEFG 3QU6A 5D5UB 1UMQA 1ZTRA 4IOCF 3ZQCA 1Z91A 3CMEI 3KX2A 2DA7A 4BE2A 2DXIA 2Y0SN 4YIFA 4AVZA 1WQ2A 4S04A 1NK2P 2BBYA 2DFEA 1UG2A 3RI4A 3H9QA 4U0VA 1LPQA 3CZ6A 3W6KB 4B09A 1RPWA 1IN5A 1DUXC 5A2QK 1L0OC 4ZYGA 1MBFA 3GZ5A 4K2EA 1YO5C 1WFXA 2HOSA 3GTLJ 3DU5A 2R7SA 3CUQB 1Z6RA 3KZZA 5FLVA 3PFIA 1U9OA 2IW5A 5JLXA 5BS6A 1O7FA 5HOOA 1K61A 2QSHX 3CCSI 1G3YA 2MD0A 2XAHA 4S05A 3WTTC 3DV8A 5LGTA 5E17F 2NVUB 3BJAA 1ZRFA 4KFCA 1JGSA 4A0XA 2ZJRF 3LA7A 3NARA 1OFCX 1X1AA 2WTEA 3M07A 1F5TA 1OKRA 4HV5A 2PJPA 4YIRX 1HSTA 3SZGA 4UUVA 3RYPA 3BDDA 1YLFA 2PMUA 1O4XA 3OYGA 1AU7A 2EJRA 3SXYA 2LY9A 3T8RA 1J0RA 4AYBN 5M3MJ 2HVRA 2M7BA 2DQRA 3OIOA 5IP6A 2P5LC 1VQKI 1S5LC 2FMLA 1LB2A 1IN4A 3LA3A 1QNTA 2OZUA 4RLFA 2FBHA 2NS0A 3QP6A 3LWFA 3J80Z 3PIPF 2MABA 2Z99A 1WH5A 4I09A 4RAYA 3B6CA 1R1TA 5LEKA 2NS8A 1WJEA 3CMAI 2IS1A 1BI3A 3L9FA 4XOPA 5L3GA 1P4XA 2ZKZA 1S9HA 3PUBA 1B8IA 1G3SA 3I55I 5FLXZ 3I53A 2LP0A 1G6NA 3R0AA 3OS0A 2KIFA 4CSWA 3FBNB 3TO9A 3ASNH 3QPSA 3D5RC 1NTCA 1RKWA 1I3AA 2JVHA 2WAEA 5F64A 4B43A 3GTMJ 2BGCA 5J47A 2GZWA 3KP7A 2B7EA 3KCCA 1R00A 3HRTA 4AU7A 1XD7A 2ECCA 2KDZA 2RGVA 3B02A 5DV5A 3KP4A 2R92J 2F5DA 4AM3A 3LSJA 1FC3A 2AXLA 1IDYA 2XF5A 1QVUA 1IUFA 2EZKA 3S2DJ 3ZQQA 4CYCB 1I50J 4H0EA 1TQIA 2GLOA 3WTVC 1T0FA 1IN7A 2A6EF 4W97A 1YE9A 3OYKA 2XAGA 3CJRB 1TZLA 4B47A 3B73A 3GX4X 2WC2A 2KJBA 5BMZA 2GOXB 1X1DA 1ZARA 3EDPA 2FBKA 1JHFA 1G3TA 3H5NA 1DPUA 2KRFA 3CF5F 1QHHD 4OOIA 3F22A 1EA3A 2M0MA 3JRFA 2KRHA 2MD5A 1HF0A 2M0CA 2GXGA 3IV5A 1X1PA 3GFJA 4NC8A
chains in the Genus database with same CATH topology
1TW3A 3WG9A 3WTUC 1FYMA 4LFUA 3SZPA 5HVQC 3IRQA 4CO8A 2UXXA 3C3WA 1G4DA 1E2XA 2V6CA 2C6YA 2H27A 3LSTA 3QRFF 3GFLA 3RDIA 4HAMA 3KP6A 1YW8A 4BNCA 3I0TA 4M6XA 3MWMA 4HBLA 3M8EA 2FF4A 2FNAA 3LA2A 1P2FA 3HIFA 4UVCA 2YX7A 2QYOA 5FD6A 2Y48A 5HS9A 4U88A 2YU3A 4LLGF 3ZMUA 1U5TB 1SFUA 5J8CA 4ESJA 4MTEA 2QM3A 2RVCA 2E1CA 4EGZA 4XRFA 1YW7A 2CFXA 1I27A 5D5WB 4KYWA 3C7JA 5CLSA 1K78B 3LAPA 1IN6A 1TW2A 3DEUA 4GYIA 2R7FA 3WTWC 1KQ8A 3FM5A 4OMZA 1JE8A 5DCMB 2FXAA 3BPVA 1W7PD 2IA1A 1VTNC 1SD6A 2DTRA 4PCQA 1AWCA 4ENMA 2JSCA 1G3WA 4KN4X 2QVOA 3JAMK 2W24A 4FHTA 3WGIA 1CF7A 3KP3A 3MCZA 4AIHA 1Z9CA 4KMUX 4RB2C 4GCVA 1FWZA 5FFZA 2VE8A 1FBUA 1QGPA 3GFMA 3GXOA 2MBFA 1ZRDA 2CWEA 5DCFA 1ZG3A 1UHMA 2XAFA 1BC7C 2W25A 1KQ0A 2TDXA 4RB0A 3KLNA 4HLXA 1IZ1A 4UXNA 1FY7A 2FA5A 2ZMEB 4HQEA 2KIMA 2K4JA 4G94A 1XGOA 2EA4A 2ESNA 1ON2A 3TOBA 3F21A 3RKYA 1ZG5A 1FYLA 3F8MA 3ZMZA 3L00A 2VOOA 1KQ9A 4HW0A 5LBQA 4G6QA 3W6JB 1S7OA 2XAJA 2HKXA 4MEXF 5H20A 4U7DA 4BYYA 2NNNA 1R1UA 3GVAA 1Z1DA 5ILUA 2DPUA 2ELHA 3F6VA 2XKPA 4PDKA 4AD9A 2GWRA 1W4MA 1W7PA 4WK8F 4LK0F 2KIUA 3BPXA 3I59B 3KZYA 3JSOA 2QUFA 5ICEA 4AIKA 1BOAA 4N0BA 2GXBA 5IT3A 2ZNYA 2GQQA 2EWNA 3KFWX 4EQQA 3QPHA 5IT9Z 3P9IA 4F7ZA 3VB2A 4CHUA 2RN7A 1ONVA 1U6GA 1XB4A 4XBFA 2X0LA 3GFIA 3S2WA 1IRGA 2P8TA 2OA4A 3ZP5A 1PDNC 4D0PA 3BZ6A 3K69A 5ICGA 2AS5F 4BHCA 3K9TA 5EEGA 3MAJA 5HLHA 4BXUA 1ZAOA 5CJ9A 3ECOA 3OOPA 3HUGA 1KGSA 1HQCA 2EFNA 3WGHA 4WXCA 2QQAA 3F72A 4I02A 5CVRA 3KLOA 1HKSA 2EV5A 2LDUA 4XSXF 4LG0B 3M7GA 1FLIA 4HF0A 4ZYEA 3BOQA 2ACJA 2BV6A 5AIQA 5AONA 3DFGA 2ESHA 1BI2A 4UVAA 1LVAA 2Q8KA 2UZKA 3CLOA 4O3MA 3V8KA 1BJAA 3ZPLA 4OIPF 2M5WA 3RTRA 1EV7A 3HSRA 2XUBA 2OZ6A 5DD4A 4A12A 4I2OA 4RB1A 5D6EA 2P6SA 2W84A 2DO7A 2YR2A 3O2PE 2RV8A 4KNYA 1STZA 1MDMB 1BBYA 1Z6TA 1RIOH 2DAOA 2RKHA 3E5UA 4A5MA 5E1WA 1HBXG 2V1UA 4HQMA 1T6SA 1SD4A 1WSUA 4RGXA 1UFMA 2O3FA 1XGMA 5FFXA 4RAZA 1HKTA 4RGRA 2IJLA 2D1HA 2PG4A 3DPTA 3GLXA 1P4AA 4IF4A 4AVPA 4NHJA 1J5YA 4LD5A 2DK5A 1W5SA 2A6HF 3SZTA 3ABTA 5CVIA 5ILSA 1D5VA 4L18B 3CUOA 3BY6A 4CYDA 2NYXA 4N9HA 1YIOA 1ZLKA 5ILVA 2EV0A 3R4KA 5L3BA 4ENJA 5DDGA 1U8RA 4ZZDA 5H6RA 1I5ZA 1F9NA 3EQLF 3I4PA 4EJVA 4U0WA 3E6CC 1LQ1A 2Y0MA 3IKVA 4G7HF 5BPIA 4MQVA 5DD8A 4AWXB 5BQTA 4MNUA 2MC3A 3ERED 1I1SA 4OU0A 1P4WA 1EH6A 4HF2A 2CW0F 1H0MA 5DYMA 3N97A 5LGUA 3EYIA 4HZFA 2NNYA 2HFHA 5AIPA 4ASNA 3F23A 2O61A 3F6OA 2ADUA 2CYYA 1SMTA 3K1NA 4GO1A 1SD5A 4ENKA 1PP8F 4KMFA 1B6AA 3V7RA 3HTSB 3I5UA 5ICCA 1IF1A 1ZN2A 1TBXA 4A0YA 3GO5A 2P7VB 2ZJ2A 2LSOA 3KP2A 3WTZA 1LDJA 2ZXJA 3I71A 2ETHA 1T39A 1SMYF 1ZG1A 1H9TA 1HKQA 2FSWA 1MZBA 5JFRA 2HYFA 3HRSA 3WU0A 1CGPA 4PGHA 4G7ZF 1S29A 3WE3A 3GF2A 1WI9A 3LAJA 3TO6A 4KIFA 5CVVA 2UXNA 2O6GE 2XV4S 5HDNA 5L3EA 3DF8A 4CXFA 1XCBA 3HOSA 1FYKA 4UVBA 4Y15A 4L5IA 2BEOA 4ZZLA 2GIVA 3TGNA 2Y75A 2HEOA 1IXRC 4LJZF 1TTYA 1QZYA 4PZJA 2RDPA 2V1DA 1TLHB 4KN7X 1O3RA 1XMKA 5DUIA 2X4HA 1F1ZA 1SAXA 3M1EA 1FOKA 1F4KA 3HHGA 1J75A 4G7OF 4HYEA 1GHCA 5ICFA 5BOXA 3CUQC 5JHUA 2FNPA 2VBYA 4CDGA 4AIJA 3E5QA 2BE5F 3HHHA 4MGRA 2YSRA 4EM0B 4QWQA 2E7WA 3DPLC 3TO7A 4L9NA 3WE2A 3T5XA 4R8HA 1EH7A 1MJ9A 4JK1X 3IKTA 2FBIA 4Z2YA 4L0ZB 5F6FA 1OYIA 1O7LA 2FU4A 3R60A 4UV8A 1YG2A 1OR7A 2ZO4A 1U78A 4XLNF 2A61A 1IXSB 3FWEA 4B8XA 3J7AO 2LF7A 3FXQA 1XSDA 1OYYA 2OQGA 5E20A 1CF7B 3GZ6A 1A04A 2HYGD 1LEAA 2HS5A 2ZNZA 4HV6A 4LB5A 1BI0A 3TKYA 3R6SA 1R22A 2P6TA 3O6BB 2STTA 1XGSA 1O57A 3WTXC 2G7HA 3P7NA 1RZ4A 3ECHA 4BHPA 2IA2A 1OMIA 4BH9A 4YFXF 4FT8A 4I0AA 1TNTA 2E1NA 1ZGJA 3HOTA 2VONA 3J80K 1FBQA 5JI6A 3T0YA 4UNOA 1ZREA 5F1RA 3VFZA 3CJNA 4HDUA 2DPDA 3U2RA 5D5XB 4E70A 1KU2A 3ML6A 4DNCA 5FLXK 4N9IA 2HQRA 4L0YB 2J5PA 4I01A 1B9NA 2HQNA 4LK1F 4EJUA 2OBPA 4P9UA 2L3DA 1RUNA 5HLGA 2EA2A 3T8TA 2FQ3A 5FB2A 1RNLA 4XSZF 4DQ2A 4OIOF 2VC1A 4YFKF 4G6DA 2Z3YA 4M71A 3ZN0A 1YW9A 3K1PA 3G73A 3F8NA 2DFIA 4CZZA 3D0SA 1FP2A 1W7PB 1U5TC 3K0LA 2QLZA 2ZFWA 5A2QZ 1S8NA 4UHTA 3SFZA 3FMRA 3QP5A 5TJJA 3ISPA 2D45A 1MGTA 1KYWA 3OV8A 4IXAA 4RB3C 1FX7A 1H9GA 2EFWA 1XSXA 2L02A 2QQ9A 5E1ZB 2DBBA 3VOEA 1KU7A 3ZQ7A 4WXHA 1ZRCA 3TDUC 1SD7A 4LLLA 1K79A 4O5VA 2DI3A 3BJ6A 3JW4A 2PI0A 3Q5FA 2VBZA 2P5KA 1ODDA 4IJAA 1O3SA 2M8EA 3FXUA 4EV0A 4KIBA 2F2EA 3H3ZA 1UHWA 4M9SA 2BYVE 4G9YA 2L54A 5D6FA 3JSPA 1FSEA 2ZBKA 4UV9A 3GW2A 2FEZA 3CDHA 3KETA 1QPMA 2HKOA 5H6QA 3VODA 3P9KA 5JR3A 3EUHA 5CVJA 3O3KA 2A69F 2CO5A 3E6DA 1HW2A 5CYVA 1UCRA 1HW5A 4BAYA 4YFNF 2K7LA 3FF5A 5E8IA 1LDKB 4LLNA 1DPRA 1JHHA 2O8XA 2HZTA 4P96A 4HX8A 4U0YA 1L3LA 1ULYA 2M45A 2H94A 1FT9A 3ROUA 1YYVA 4ESBA 2IRFG 2XVCA 4NB5A 2PMHA 2JPCA 4A0ZA 3V7CA 3J81Z 2VBWA 4MTDA 3I54A 1B4AA 1BIBA 2UWMA 2WV0A 2EFOA 5D8KB 3RPUA 2XAQA 4IHTA 2V1XA 2Z9OA 3P9CA 5E8GA 1C0WA 2JZYA 3FM3A 3PQKA 4WWCA 3IWZA 1LNWA 1PP7U 5LHIA 3ULQB 1BIAA 2E7XA 1TQMA 4G8XA 4HX7A 4HA8A 5LEJA 4OIRF 5FD5A 4WX9A 2FE3A 3KEOA 4I0BA 1R36A 1V3FA 3T1BA 5LRSA 3F8FA 2DLLA 3MFKA 1XMAA 4L9VA 4IPAA 5D8LB 4ZH4F 2P7CB 4Q47A 1S6LA 4IRHA 2VT2A 2G9WA 3DKWA 2QQBA 3FMQA 1R23A 1RI7A 4M9ZA 2QBYA 5K5RA 4L5JA 4EM2A 4L9JA 5LRRA 1FBSA 3ELKA 4OIQF 4EJTA 2IA0A 4IRIA 2LKPA 4HX4A 5LHGA 3COAC 1SFXA 2L4AA 4M6YA 4HF1A 1YFHA 1GXQA 1KU9A 4Q5SF 2B0LA 1GVJA 1BC8C 1D3YA 3JAMZ 3FX3A 2F5FA 3VEPA 1HSJA 3ZMTA 3QOPA 3V4GA 5ED4A 3LFKA 5HDGA 3D5LA 4R1HA 3I58A 2K4BA 3CUQA 1ZLJA 2XASA 1KU3A 2GAUA 4L9TA 5FGMA 2KJCA 4BHBA 5IT9K 2O0YA 5K1YA 5DEQA 5JVTA 3E3VA 1PUEE 4M72A 4Q4ZF 5BPDA 3E6MA 1RUOA 3HTUA 2J5OA 2EFQA 3E97A 3FHZA 3E6BA 3IC7A 3CO7C 2DT5A 4ESFA 3Q9VA 3GEZA 1I1GA 3DXJF 3GWZA 2CG4A 4WXDA 1R5HA 1BN5A 1LDDA 2H6BA 2R7DA 3V8LA 4HOBA 1ZH5A 4P55A 1J2XA 1IW7F 3WODF 2V9VA 2VBXA 3HSFA 1BI1A 2IPQX 4KA4A 3R0JA 2FOKA 4WCGA 1FZPB 2HTSA 2MLKA 2XRNA 3RKXA 2A07F 2H09A 1REPC 3G3ZA 5DUKA 2VXZA 1I6XA 1ON1A 2Z33A 3H3UA 3JTGA 4LGWA 5J8FA 4MQ9F 5K5OA 1B9MA 5CVUA 1R1VA 1SFEA 2EFPA 1XDUA 4OINF 2JRTA 4A5NA 3MQ0A 3GUDA 2ISZA 3CTAA 2P4WA 1FP1D 3C1DA 3V7SA 3HRUA 4IRGA 1XDSA 4I98B 4LMYA 2H6CA 3KE2A 4GXOA 3ZMSA 4YIIA 2DU9A 2MLGA 2HR3A 3IL2A 2LNBA 5D4RA 3C18A 4Y17A 4EM1A 1QO0D 2A5YB 4HLYA 5L3CA 2DK8A 1R7JA 4M73A 2Z5UA 2F5EA 4QLCU 2HOEA 3H92A 2RQPA 3BWGA 4XLPF 1NHAA 1YS7A 2XKOA 4KICA 2CQKA 1U5TA 2Q2EA 2QENA 1HXDA 1O3QA 2W85A 2QWWA 3RPQA 3RKWA 4P9FA 3F8CA 1OPCA 1YTYA 3KP5A 1K78A 2MH9A 5LHHA 4Q48A 3FMSA 2A3SA 3WTSC 6PAXA 1OYWA 3SQNA 4O6JA 3RJPA 4EVIA 2MA3A 3RYRA 5TRDA 2PLYA 2HTJA 2PEXA 5DCMA 2PQ8A 4MHGA 2JT1A 1MKMA 1V4RA 4R79A 1MD0A 3DP7A 1X3UA 4GYGA 1S7AA 3IWFA 3K1MA 2OQRA 1MJAA 4JQFA 2LF8A 5L3DA 3L2CA 2JPBA 2EB7A 1IN8A 4IHSA 2V79A 4GGGA 3IHUA 1XGNA 3FXRA 2FRHA 4FX4A 2EV6A 1YS6A 4LB6B 3REOA 1J59A 2KKOA 1O3TA 1IUYA 1Q1HA 2M1BA 3F8BA 3LQRA 5E18F 4ZYHA 1WRJA 2PN6A 2VOPA 1GXPA 4ON0A 4ENNA 2YX4A 2ZMEA 1J9IA 2COMA 1JXSA 1FPQA 3ZMDA 2HDCA 5D5VB 1K7AA 2G7UA 3MEXA 2K27A 2STWA 1D8KA 4KDPA 2XIGA 2F5CA 3AAFA 2OAZA 2VC0A 2OU2A 1TNSA 4KT5C 1LJ9A 1EH8A 1ZGAA 1UB9A 2GA1A 3NEUA 1Y0UA 2XROA 4M9XA 4I7HA 3TQNA 4YG2F 3L7WA 2Q0OA 4CICA 5LGNA 3E5XA 5KVRA 2A68F 4EMSA 2RC4A 1D8JA 1R5GA 1WKMA 3QAHA 2O03A 2IT0A 2R3SA 1T2KA 4TV7A 1IRFA 4A6DA 4RGUA 1Z7UA 3I59A 3I64A 2VE9A 1DDNA 4HDVA 2ZCWA 2XGXA 1QQIA 1U2WA 3GYHX 2M30A 2WWYA 5LLQA 1K6OA 3WTYC 1USTA 1Z05A 2XHKA 1LEBA 3BJOA 1U3EM 1IXCA 4MEYF 3BP8A 2L01A 5L3FA 3MZHA 3Q9SA 3BROA 1TQPA 2RNJA 4KUMA 2NAZA 2CGPA 2GA2A 2YPRA 4U7BA 3NQOA 2DQLA 4A6EA 3FZVA 2P5VA 1KYZA 4ZYDA 1HW1A 2L4MA 2FMYA 2PFBA 3M8FA 2EK5A 3ZMVA 1XSVA 3IRRA 1YQAA 3N4MA 3QPTA 4RGSA 4BQAA 2D1VA 2ISYA 4M74A 4CGZA 2VODA 1P92A 1XCVA 4KIGA 3U1DA 1QBJA 5HDKA 1W5TA 2CSOA 1T38A 5EEHA 5K5QA 1MJBA 5E1XA 4EJWA 5ERIA 4Y13A 2IP2A 1QZZA 4EGYA 1WWXA 3V8JA 3TDZC 1ZYRF 3SHFA 4EJOA 2OD5A 5FO5A 1B59A 2MH2A 3EYYA 4RS8A 3CO6C 2VT3A 1R58A 1S3JA 3HYIA 3MZYA 4OMYA 4LG0A 3LQQA 3QU3A 4JBAA 5HS7A 5HS8A 2K86A 4P5OA 2K02A 5J6XA 2HGCA 2JTVA 2NRAC 5HLIA 3WGGA 2PBIA 2VN2A 3WU1B 3L09A 3PQJA 2QZ8A 2DW4A 4A2UA 2D2WA 1E17A 1P6RA 2M87A 3EETA 1T98A 4FX0A 3M9AA 3DQVC 3U9GA 3K2ZA 3RIRA 1ZHFA 3JTHA 1USSA 1BM9A 1AOYA 1KA8A 1FSHA 4WF2A 3ABUA 1J7KA 1FNNA 5KK1A 1DP7P 4IVNA 4NQWA 1IAWA 1MDMA 3HRMA 2IVMA 3NRVA 2QBYB 4PGGA 3F3XA 5D4SA 2HWVA 1B1BA 3ZN1A 2W57A 3HSEA 3R61A 1XN7A 3TOAA 4ETSA 3KEQA 3QU6A 5D5UB 1Z91A 4YIFA 1WQ2A 4S04A 2BBYA 3RI4A 4U0VA 3W6KB 4B09A 1IN5A 1DUXC 5A2QK 1L0OC 4ZYGA 3GZ5A 4K2EA 1YO5C 3CUQB 1Z6RA 3KZZA 3PFIA 2IW5A 5BS6A 5HOOA 1O7FA 4S05A 1G3YA 2XAHA 3WTTC 3DV8A 5LGTA 5E17F 3BJAA 1ZRFA 4KFCA 1JGSA 4A0XA 3LA7A 2WTEA 1F5TA 1OKRA 4HV5A 2PJPA 1HSTA 4UUVA 3RYPA 3BDDA 1YLFA 2PMUA 2EJRA 3SXYA 3T8RA 1J0RA 2DQRA 2P5LC 1LB2A 2FMLA 1IN4A 3LA3A 1QNTA 2OZUA 2FBHA 2NS0A 3QP6A 3LWFA 3J80Z 2Z99A 4I09A 4RAYA 1R1TA 5LEKA 1BI3A 3L9FA 5L3GA 1P4XA 2ZKZA 1G3SA 5FLXZ 3I53A 3R0AA 1G6NA 2KIFA 3TO9A 5F64A 2BGCA 2GZWA 3KP7A 3KCCA 1R00A 3HRTA 1XD7A 2RGVA 3B02A 5DV5A 3KP4A 2F5DA 1FC3A 2AXLA 4H0EA 1TQIA 3WTVC 1T0FA 1IN7A 2A6EF 2XAGA 3B73A 3GX4X 2WC2A 2KJBA 5BMZA 1ZARA 3EDPA 2FBKA 1JHFA 1G3TA 1DPUA 2KRFA 4OOIA 3F22A 2MD5A 2GXGA 3J81K 3GFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW3 A;  3WG9 A;  3WTU C;  1FYM A;  4LFU A;  3SZP A;  5HVQ C;  3IRQ A;  4CO8 A;  2UXX A;  3C3W A;  1G4D A;  1E2X A;  2V6C A;  2C6Y A;  2H27 A;  3LST A;  3QRF F;  3GFL A;  3RDI A;  4HAM A;  3KP6 A;  1YW8 A;  4BNC A;  3I0T A;  4M6X A;  3MWM A;  4HBL A;  3M8E A;  2FF4 A;  2FNA A;  3LA2 A;  1P2F A;  3HIF A;  4UVC A;  2YX7 A;  2QYO A;  5FD6 A;  2Y48 A;  5HS9 A;  4U88 A;  2YU3 A;  4LLG F;  3ZMU A;  1U5T B;  1SFU A;  5J8C A;  4ESJ A;  4MTE A;  2QM3 A;  2RVC A;  2E1C A;  4EGZ A;  4XRF A;  1YW7 A;  2CFX A;  1I27 A;  5D5W B;  4KYW A;  3C7J A;  5CLS A;  1K78 B;  3LAP A;  1IN6 A;  1TW2 A;  3DEU A;  4GYI A;  2R7F A;  3WTW C;  1KQ8 A;  3FM5 A;  4OMZ A;  1JE8 A;  5DCM B;  2FXA A;  3BPV A;  1W7P D;  2IA1 A;  1VTN C;  1SD6 A;  2DTR A;  4PCQ A;  1AWC A;  4ENM A;  2JSC A;  1G3W A;  4KN4 X;  2QVO A;  3JAM K;  2W24 A;  4FHT A;  3WGI A;  1CF7 A;  3KP3 A;  3MCZ A;  4AIH A;  1Z9C A;  4KMU X;  4RB2 C;  4GCV A;  1FWZ A;  5FFZ A;  2VE8 A;  1FBU A;  1QGP A;  3GFM A;  3GXO A;  2MBF A;  1ZRD A;  2CWE A;  5DCF A;  1ZG3 A;  1UHM A;  2XAF A;  1BC7 C;  2W25 A;  1KQ0 A;  2TDX A;  4RB0 A;  3KLN A;  4HLX A;  1IZ1 A;  4UXN A;  1FY7 A;  2FA5 A;  2ZME B;  4HQE A;  2KIM A;  2K4J A;  4G94 A;  1XGO A;  2EA4 A;  2ESN A;  1ON2 A;  3TOB A;  3F21 A;  3RKY A;  1ZG5 A;  1FYL A;  3F8M A;  3ZMZ A;  3L00 A;  2VOO A;  1KQ9 A;  4HW0 A;  5LBQ A;  4G6Q A;  3W6J B;  1S7O A;  2XAJ A;  2HKX A;  4MEX F;  5H20 A;  4U7D A;  4BYY A;  2NNN A;  1R1U A;  3GVA A;  1Z1D A;  5ILU A;  2DPU A;  2ELH A;  3F6V A;  2XKP A;  4PDK A;  4AD9 A;  2GWR A;  1W4M A;  1W7P A;  4WK8 F;  4LK0 F;  2KIU A;  3BPX A;  3I59 B;  3KZY A;  3JSO A;  2QUF A;  5ICE A;  4AIK A;  1BOA A;  4N0B A;  2GXB A;  5IT3 A;  2ZNY A;  2GQQ A;  2EWN A;  3KFW X;  4EQQ A;  3QPH A;  5IT9 Z;  3P9I A;  4F7Z A;  3VB2 A;  4CHU A;  2RN7 A;  1ONV A;  1U6G A;  1XB4 A;  4XBF A;  2X0L A;  3GFI A;  3S2W A;  1IRG A;  2P8T A;  2OA4 A;  3ZP5 A;  1PDN C;  4D0P A;  3BZ6 A;  3K69 A;  5ICG A;  2AS5 F;  4BHC A;  3K9T A;  5EEG A;  3MAJ A;  5HLH A;  4BXU A;  1ZAO A;  5CJ9 A;  3ECO A;  3OOP A;  3HUG A;  1KGS A;  1HQC A;  2EFN A;  3WGH A;  4WXC A;  2QQA A;  3F72 A;  4I02 A;  5CVR A;  3KLO A;  1HKS A;  2EV5 A;  2LDU A;  4XSX F;  4LG0 B;  3M7G A;  1FLI A;  4HF0 A;  4ZYE A;  3BOQ A;  2ACJ A;  2BV6 A;  5AIQ A;  5AON A;  3DFG A;  2ESH A;  1BI2 A;  4UVA A;  1LVA A;  2Q8K A;  2UZK A;  3CLO A;  4O3M A;  3V8K A;  1BJA A;  3ZPL A;  4OIP F;  2M5W A;  3RTR A;  1EV7 A;  3HSR A;  2XUB A;  2OZ6 A;  5DD4 A;  4A12 A;  4I2O A;  4RB1 A;  5D6E A;  2P6S A;  2W84 A;  2DO7 A;  2YR2 A;  3O2P E;  2RV8 A;  4KNY A;  1STZ A;  1MDM B;  1BBY A;  1Z6T A;  1RIO H;  2DAO A;  2RKH A;  3E5U A;  4A5M A;  5E1W A;  1HBX G;  2V1U A;  4HQM A;  1T6S A;  1SD4 A;  1WSU A;  4RGX A;  1UFM A;  2O3F A;  1XGM A;  5FFX A;  4RAZ A;  1HKT A;  4RGR A;  2IJL A;  2D1H A;  2PG4 A;  3DPT A;  3GLX A;  1P4A A;  4IF4 A;  4AVP A;  4NHJ A;  1J5Y A;  4LD5 A;  2DK5 A;  1W5S A;  2A6H F;  3SZT A;  3ABT A;  5CVI A;  5ILS A;  1D5V A;  4L18 B;  3CUO A;  3BY6 A;  4CYD A;  2NYX A;  4N9H A;  1YIO A;  1ZLK A;  5ILV A;  2EV0 A;  3R4K A;  5L3B A;  4ENJ A;  5DDG A;  1U8R A;  4ZZD A;  5H6R A;  1I5Z A;  1F9N A;  3EQL F;  3I4P A;  4EJV A;  4U0W A;  3E6C C;  1LQ1 A;  2Y0M A;  3IKV A;  4G7H F;  5BPI A;  4MQV A;  5DD8 A;  4AWX B;  5BQT A;  4MNU A;  2MC3 A;  3ERE D;  1I1S A;  4OU0 A;  1P4W A;  1EH6 A;  4HF2 A;  2CW0 F;  1H0M A;  5DYM A;  3N97 A;  5LGU A;  3EYI A;  4HZF A;  2NNY A;  2HFH A;  5AIP A;  4ASN A;  3F23 A;  2O61 A;  3F6O A;  2ADU A;  2CYY A;  1SMT A;  3K1N A;  4GO1 A;  1SD5 A;  4ENK A;  1PP8 F;  4KMF A;  1B6A A;  3V7R A;  3HTS B;  3I5U A;  5ICC A;  1IF1 A;  1ZN2 A;  1TBX A;  4A0Y A;  3GO5 A;  2P7V B;  2ZJ2 A;  2LSO A;  3KP2 A;  3WTZ A;  1LDJ A;  2ZXJ A;  3I71 A;  2ETH A;  1T39 A;  1SMY F;  1ZG1 A;  1H9T A;  1HKQ A;  2FSW A;  1MZB A;  5JFR A;  2HYF A;  3HRS A;  3WU0 A;  1CGP A;  4PGH A;  4G7Z F;  1S29 A;  3WE3 A;  3GF2 A;  1WI9 A;  3LAJ A;  3TO6 A;  4KIF A;  5CVV A;  2UXN A;  2O6G E;  2XV4 S;  5HDN A;  5L3E A;  3DF8 A;  4CXF A;  1XCB A;  3HOS A;  1FYK A;  4UVB A;  4Y15 A;  4L5I A;  2BEO A;  4ZZL A;  2GIV A;  3TGN A;  2Y75 A;  2HEO A;  1IXR C;  4LJZ F;  1TTY A;  1QZY A;  4PZJ A;  2RDP A;  2V1D A;  1TLH B;  4KN7 X;  1O3R A;  1XMK A;  5DUI A;  2X4H A;  1F1Z A;  1SAX A;  3M1E A;  1FOK A;  1F4K A;  3HHG A;  1J75 A;  4G7O F;  4HYE A;  1GHC A;  5ICF A;  5BOX A;  3CUQ C;  5JHU A;  2FNP A;  2VBY A;  4CDG A;  4AIJ A;  3E5Q A;  2BE5 F;  3HHH A;  4MGR A;  2YSR A;  4EM0 B;  4QWQ A;  2E7W A;  3DPL C;  3TO7 A;  4L9N A;  3WE2 A;  3T5X A;  4R8H A;  1EH7 A;  1MJ9 A;  4JK1 X;  3IKT A;  2FBI A;  4Z2Y A;  4L0Z B;  5F6F A;  1OYI A;  1O7L A;  2FU4 A;  3R60 A;  4UV8 A;  1YG2 A;  1OR7 A;  2ZO4 A;  1U78 A;  4XLN F;  2A61 A;  1IXS B;  3FWE A;  4B8X A;  3J7A O;  2LF7 A;  3FXQ A;  1XSD A;  1OYY A;  2OQG A;  5E20 A;  1CF7 B;  3GZ6 A;  1A04 A;  2HYG D;  1LEA A;  2HS5 A;  2ZNZ A;  4HV6 A;  4LB5 A;  1BI0 A;  3TKY A;  3R6S A;  1R22 A;  2P6T A;  3O6B B;  2STT A;  1XGS A;  1O57 A;  3WTX C;  2G7H A;  3P7N A;  1RZ4 A;  3ECH A;  4BHP A;  2IA2 A;  1OMI A;  4BH9 A;  4YFX F;  4FT8 A;  4I0A A;  1TNT A;  2E1N A;  1ZGJ A;  3HOT A;  2VON A;  3J80 K;  1FBQ A;  5JI6 A;  3T0Y A;  4UNO A;  1ZRE A;  5F1R A;  3VFZ A;  3CJN A;  4HDU A;  2DPD A;  3U2R A;  5D5X B;  4E70 A;  1KU2 A;  3ML6 A;  4DNC A;  5FLX K;  4N9I A;  2HQR A;  4L0Y B;  2J5P A;  4I01 A;  1B9N A;  2HQN A;  4LK1 F;  4EJU A;  2OBP A;  4P9U A;  2L3D A;  1RUN A;  5HLG A;  2EA2 A;  3T8T A;  2FQ3 A;  5FB2 A;  1RNL A;  4XSZ F;  4DQ2 A;  4OIO F;  2VC1 A;  4YFK F;  4G6D A;  2Z3Y A;  4M71 A;  3ZN0 A;  1YW9 A;  3K1P A;  3G73 A;  3F8N A;  2DFI A;  4CZZ A;  3D0S A;  1FP2 A;  1W7P B;  1U5T C;  3K0L A;  2QLZ A;  2ZFW A;  5A2Q Z;  1S8N A;  4UHT A;  3SFZ A;  3FMR A;  3QP5 A;  5TJJ A;  3ISP A;  2D45 A;  1MGT A;  1KYW A;  3OV8 A;  4IXA A;  4RB3 C;  1FX7 A;  1H9G A;  2EFW A;  1XSX A;  2L02 A;  2QQ9 A;  5E1Z B;  2DBB A;  3VOE A;  1KU7 A;  3ZQ7 A;  4WXH A;  1ZRC A;  3TDU C;  1SD7 A;  4LLL A;  1K79 A;  4O5V A;  2DI3 A;  3BJ6 A;  3JW4 A;  2PI0 A;  3Q5F A;  2VBZ A;  2P5K A;  1ODD A;  4IJA A;  1O3S A;  2M8E A;  3FXU A;  4EV0 A;  4KIB A;  2F2E A;  3H3Z A;  1UHW A;  4M9S A;  2BYV E;  4G9Y A;  2L54 A;  5D6F A;  3JSP A;  1FSE A;  2ZBK A;  4UV9 A;  3GW2 A;  2FEZ A;  3CDH A;  3KET A;  1QPM A;  2HKO A;  5H6Q A;  3VOD A;  3P9K A;  5JR3 A;  3EUH A;  5CVJ A;  3O3K A;  2A69 F;  2CO5 A;  3E6D A;  1HW2 A;  5CYV A;  1UCR A;  1HW5 A;  4BAY A;  4YFN F;  2K7L A;  3FF5 A;  5E8I A;  1LDK B;  4LLN A;  1DPR A;  1JHH A;  2O8X A;  2HZT A;  4P96 A;  4HX8 A;  4U0Y A;  1L3L A;  1ULY A;  2M45 A;  2H94 A;  1FT9 A;  3ROU A;  1YYV A;  4ESB A;  2IRF G;  2XVC A;  4NB5 A;  2PMH A;  2JPC A;  4A0Z A;  3V7C A;  3J81 Z;  2VBW A;  4MTD A;  3I54 A;  1B4A A;  1BIB A;  2UWM A;  2WV0 A;  2EFO A;  5D8K B;  3RPU A;  2XAQ A;  4IHT A;  2V1X A;  2Z9O A;  3P9C A;  5E8G A;  1C0W A;  2JZY A;  3FM3 A;  3PQK A;  4WWC A;  3IWZ A;  1LNW A;  1PP7 U;  5LHI A;  3ULQ B;  1BIA A;  2E7X A;  1TQM A;  4G8X A;  4HX7 A;  4HA8 A;  5LEJ A;  4OIR F;  5FD5 A;  4WX9 A;  2FE3 A;  3KEO A;  4I0B A;  1R36 A;  1V3F A;  3T1B A;  5LRS A;  3F8F A;  2DLL A;  3MFK A;  1XMA A;  4L9V A;  4IPA A;  5D8L B;  4ZH4 F;  2P7C B;  4Q47 A;  1S6L A;  4IRH A;  2VT2 A;  2G9W A;  3DKW A;  2QQB A;  3FMQ A;  1R23 A;  1RI7 A;  4M9Z A;  2QBY A;  5K5R A;  4L5J A;  4EM2 A;  4L9J A;  5LRR A;  1FBS A;  3ELK A;  4OIQ F;  4EJT A;  2IA0 A;  4IRI A;  2LKP A;  4HX4 A;  5LHG A;  3COA C;  1SFX A;  2L4A A;  4M6Y A;  4HF1 A;  1YFH A;  1GXQ A;  1KU9 A;  4Q5S F;  2B0L A;  1GVJ A;  1BC8 C;  1D3Y A;  3JAM Z;  3FX3 A;  2F5F A;  3VEP A;  1HSJ A;  3ZMT A;  3QOP A;  3V4G A;  5ED4 A;  3LFK A;  5HDG A;  3D5L A;  4R1H A;  3I58 A;  2K4B A;  3CUQ A;  1ZLJ A;  2XAS A;  1KU3 A;  2GAU A;  4L9T A;  5FGM A;  2KJC A;  4BHB A;  5IT9 K;  2O0Y A;  5K1Y A;  5DEQ A;  5JVT A;  3E3V A;  1PUE E;  4M72 A;  4Q4Z F;  5BPD A;  3E6M A;  1RUO A;  3HTU A;  2J5O A;  2EFQ A;  3E97 A;  3FHZ A;  3E6B A;  3IC7 A;  3CO7 C;  2DT5 A;  4ESF A;  3Q9V A;  3GEZ A;  1I1G A;  3DXJ F;  3GWZ A;  2CG4 A;  4WXD A;  1R5H A;  1BN5 A;  1LDD A;  2H6B A;  2R7D A;  3V8L A;  4HOB A;  1ZH5 A;  4P55 A;  1J2X A;  1IW7 F;  3WOD F;  2V9V A;  2VBX A;  3HSF A;  1BI1 A;  2IPQ X;  4KA4 A;  3R0J A;  2FOK A;  4WCG A;  1FZP B;  2HTS A;  2MLK A;  2XRN A;  3RKX A;  2A07 F;  2H09 A;  1REP C;  3G3Z A;  5DUK A;  2VXZ A;  1I6X A;  1ON1 A;  2Z33 A;  3H3U A;  3JTG A;  4LGW A;  5J8F A;  4MQ9 F;  5K5O A;  1B9M A;  5CVU A;  1R1V A;  1SFE A;  2EFP A;  1XDU A;  4OIN F;  2JRT A;  4A5N A;  3MQ0 A;  3GUD A;  2ISZ A;  3CTA A;  2P4W A;  1FP1 D;  3C1D A;  3V7S A;  3HRU A;  4IRG A;  1XDS A;  4I98 B;  4LMY A;  2H6C A;  3KE2 A;  4GXO A;  3ZMS A;  4YII A;  2DU9 A;  2MLG A;  2HR3 A;  3IL2 A;  2LNB A;  5D4R A;  3C18 A;  4Y17 A;  4EM1 A;  1QO0 D;  2A5Y B;  4HLY A;  5L3C A;  2DK8 A;  1R7J A;  4M73 A;  2Z5U A;  2F5E A;  4QLC U;  2HOE A;  3H92 A;  2RQP A;  3BWG A;  4XLP F;  1NHA A;  1YS7 A;  2XKO A;  4KIC A;  2CQK A;  1U5T A;  2Q2E A;  2QEN A;  1HXD A;  1O3Q A;  2W85 A;  2QWW A;  3RPQ A;  3RKW A;  4P9F A;  3F8C A;  1OPC A;  1YTY A;  3KP5 A;  1K78 A;  2MH9 A;  5LHH A;  4Q48 A;  3FMS A;  2A3S A;  3WTS C;  6PAX A;  1OYW A;  3SQN A;  4O6J A;  3RJP A;  4EVI A;  2MA3 A;  3RYR A;  5TRD A;  2PLY A;  2HTJ A;  2PEX A;  5DCM A;  2PQ8 A;  4MHG A;  2JT1 A;  1MKM A;  1V4R A;  4R79 A;  1MD0 A;  3DP7 A;  1X3U A;  4GYG A;  1S7A A;  3IWF A;  3K1M A;  2OQR A;  1MJA A;  4JQF A;  2LF8 A;  5L3D A;  3L2C A;  2JPB A;  2EB7 A;  1IN8 A;  4IHS A;  2V79 A;  4GGG A;  3IHU A;  1XGN A;  3FXR A;  2FRH A;  4FX4 A;  2EV6 A;  1YS6 A;  4LB6 B;  3REO A;  1J59 A;  2KKO A;  1O3T A;  1IUY A;  1Q1H A;  2M1B A;  3F8B A;  3LQR A;  5E18 F;  4ZYH A;  1WRJ A;  2PN6 A;  2VOP A;  1GXP A;  4ON0 A;  4ENN A;  2YX4 A;  2ZME A;  1J9I A;  2COM A;  1JXS A;  1FPQ A;  3ZMD A;  2HDC A;  5D5V B;  1K7A A;  2G7U A;  3MEX A;  2K27 A;  2STW A;  1D8K A;  4KDP A;  2XIG A;  2F5C A;  3AAF A;  2OAZ A;  2VC0 A;  2OU2 A;  1TNS A;  4KT5 C;  1LJ9 A;  1EH8 A;  1ZGA A;  1UB9 A;  2GA1 A;  3NEU A;  1Y0U A;  2XRO A;  4M9X A;  4I7H A;  3TQN A;  4YG2 F;  3L7W A;  2Q0O A;  4CIC A;  5LGN A;  3E5X A;  5KVR A;  2A68 F;  4EMS A;  2RC4 A;  1D8J A;  1R5G A;  1WKM A;  3QAH A;  2O03 A;  2IT0 A;  2R3S A;  1T2K A;  4TV7 A;  1IRF A;  4A6D A;  4RGU A;  1Z7U A;  3I59 A;  3I64 A;  2VE9 A;  1DDN A;  4HDV A;  2ZCW A;  2XGX A;  1QQI A;  1U2W A;  3GYH X;  2M30 A;  2WWY A;  5LLQ A;  1K6O A;  3WTY C;  1UST A;  1Z05 A;  2XHK A;  1LEB A;  3BJO A;  1U3E M;  1IXC A;  4MEY F;  3BP8 A;  2L01 A;  5L3F A;  3MZH A;  3Q9S A;  3BRO A;  1TQP A;  2RNJ A;  4KUM A;  2NAZ A;  2CGP A;  2GA2 A;  2YPR A;  4U7B A;  3NQO A;  2DQL A;  4A6E A;  3FZV A;  2P5V A;  1KYZ A;  4ZYD A;  1HW1 A;  2L4M A;  2FMY A;  2PFB A;  3M8F A;  2EK5 A;  3ZMV A;  1XSV A;  3IRR A;  1YQA A;  3N4M A;  3QPT A;  4RGS A;  4BQA A;  2D1V A;  2ISY A;  4M74 A;  4CGZ A;  2VOD A;  1P92 A;  1XCV A;  4KIG A;  3U1D A;  1QBJ A;  5HDK A;  1W5T A;  2CSO A;  1T38 A;  5EEH A;  5K5Q A;  1MJB A;  5E1X A;  4EJW A;  5ERI A;  4Y13 A;  2IP2 A;  1QZZ A;  4EGY A;  1WWX A;  3V8J A;  3TDZ C;  1ZYR F;  3SHF A;  4EJO A;  2OD5 A;  5FO5 A;  1B59 A;  2MH2 A;  3EYY A;  4RS8 A;  3CO6 C;  2VT3 A;  1R58 A;  1S3J A;  3HYI A;  3MZY A;  4OMY A;  4LG0 A;  3LQQ A;  3QU3 A;  4JBA A;  5HS7 A;  5HS8 A;  2K86 A;  4P5O A;  2K02 A;  5J6X A;  2HGC A;  2JTV A;  2NRA C;  5HLI A;  3WGG A;  2PBI A;  2VN2 A;  3WU1 B;  3L09 A;  3PQJ A;  2QZ8 A;  2DW4 A;  4A2U A;  2D2W A;  1E17 A;  1P6R A;  2M87 A;  3EET A;  1T98 A;  4FX0 A;  3M9A A;  3DQV C;  3U9G A;  3K2Z A;  3RIR A;  1ZHF A;  3JTH A;  1USS A;  1BM9 A;  1AOY A;  1KA8 A;  1FSH A;  4WF2 A;  3ABU A;  1J7K A;  1FNN A;  5KK1 A;  1DP7 P;  4IVN A;  4NQW A;  1IAW A;  1MDM A;  3HRM A;  2IVM A;  3NRV A;  2QBY B;  4PGG A;  3F3X A;  5D4S A;  2HWV A;  1B1B A;  3ZN1 A;  2W57 A;  3HSE A;  3R61 A;  1XN7 A;  3TOA A;  4ETS A;  3KEQ A;  3QU6 A;  5D5U B;  1Z91 A;  4YIF A;  1WQ2 A;  4S04 A;  2BBY A;  3RI4 A;  4U0V A;  3W6K B;  4B09 A;  1IN5 A;  1DUX C;  5A2Q K;  1L0O C;  4ZYG A;  3GZ5 A;  4K2E A;  1YO5 C;  3CUQ B;  1Z6R A;  3KZZ A;  3PFI A;  2IW5 A;  5BS6 A;  5HOO A;  1O7F A;  4S05 A;  1G3Y A;  2XAH A;  3WTT C;  3DV8 A;  5LGT A;  5E17 F;  3BJA A;  1ZRF A;  4KFC A;  1JGS A;  4A0X A;  3LA7 A;  2WTE A;  1F5T A;  1OKR A;  4HV5 A;  2PJP A;  1HST A;  4UUV A;  3RYP A;  3BDD A;  1YLF A;  2PMU A;  2EJR A;  3SXY A;  3T8R A;  1J0R A;  2DQR A;  2P5L C;  1LB2 A;  2FML A;  1IN4 A;  3LA3 A;  1QNT A;  2OZU A;  2FBH A;  2NS0 A;  3QP6 A;  3LWF A;  3J80 Z;  2Z99 A;  4I09 A;  4RAY A;  1R1T A;  5LEK A;  1BI3 A;  3L9F A;  5L3G A;  1P4X A;  2ZKZ A;  1G3S A;  5FLX Z;  3I53 A;  3R0A A;  1G6N A;  2KIF A;  3TO9 A;  5F64 A;  2BGC A;  2GZW A;  3KP7 A;  3KCC A;  1R00 A;  3HRT A;  1XD7 A;  2RGV A;  3B02 A;  5DV5 A;  3KP4 A;  2F5D A;  1FC3 A;  2AXL A;  4H0E A;  1TQI A;  3WTV C;  1T0F A;  1IN7 A;  2A6E F;  2XAG A;  3B73 A;  3GX4 X;  2WC2 A;  2KJB A;  5BMZ A;  1ZAR A;  3EDP A;  2FBK A;  1JHF A;  1G3T A;  1DPU A;  2KRF A;  4OOI A;  3F22 A;  2MD5 A;  2GXG A;  3J81 K;  3GFJ A; 
#chains in the Genus database with same CATH topology
 3VWB A;  1TW3 A;  3WG9 A;  3TP3 A;  3WTU C;  1FYM A;  4LFU A;  3SZP A;  3BZC A;  3LSI A;  4BQO A;  3K70 D;  3S1N J;  5HVQ C;  3IRQ A;  1SVO A;  4CO8 A;  3G1M A;  4KT6 A;  2M4G A;  2UXX A;  4ZYA A;  5EG0 B;  3C3W A;  2KHM A;  1G4D A;  4BDZ A;  1Y8Q B;  4CA0 A;  1E2X A;  2V6C A;  3SEQ A;  2C6Y A;  3LST A;  2H27 A;  1OCP A;  4HNV A;  3QRF F;  2H8R A;  4JYK A;  4MFD A;  1OQY A;  1V5E A;  2XGD A;  3GFL A;  3KP6 A;  1YW8 A;  4HAM A;  3RDI A;  4BNC A;  2I5U A;  2M3A A;  3I0T A;  4QIW N;  4M6X A;  1ORK A;  3MWM A;  2HPM A;  2BXY A;  5GAG J;  4HBL A;  1W36 D;  3M8E A;  3PIO F;  1RRJ A;  2FF4 A;  2FNA A;  3LA2 A;  1P2F A;  3HIF A;  4UVC A;  2YX7 A;  1TWF J;  2QYO A;  2DJI A;  4M3B A;  2Y48 A;  5HS9 A;  5FD6 A;  4A3I J;  4U88 A;  2YU3 A;  2DA6 A;  4LLG F;  3LSK A;  3ZMU A;  3PFY A;  1U5T B;  1WH7 A;  1JKO C;  2Q2E B;  1VFC A;  1SFU A;  3DPU A;  5J8C A;  4ESJ A;  4MTE A;  4PJN A;  1BR1 A;  2QM3 A;  2RVC A;  2E1C A;  3I4M J;  4EGZ A;  4XRF A;  3JRI A;  1YW7 A;  2CFX A;  1I27 A;  5J1R A;  5D5W B;  4KYW A;  3C7J A;  3OIQ A;  2VIX A;  5CLS A;  4NDL A;  1K78 B;  3LAP A;  1S72 I;  3QOE A;  1IN6 A;  1TW2 A;  1ZKG A;  4IX7 A;  3DEU A;  4GYI A;  2R7F A;  3WTW C;  2UUZ A;  1KQ8 A;  3FM5 A;  1Z21 A;  1VF9 A;  4OMZ A;  2BVM A;  1JE8 A;  2KMU A;  2ZJP F;  5DCM B;  2DMP A;  1D0X A;  3WHC A;  2R7R A;  4DOZ A;  2E19 A;  2FXA A;  3BPV A;  1W7P D;  2XDV A;  2IS2 A;  2IA1 A;  4N4N B;  1VTN C;  1SD6 A;  1EF4 A;  1V55 H;  1FIA A;  3TL4 X;  2DTR A;  1MNM C;  4PCQ A;  1AWC A;  1X1B A;  2YUS A;  2CW7 A;  4ITV A;  4ENM A;  2Y31 A;  4IQJ A;  2JSC A;  1G3W A;  4KN4 X;  4Y3O A;  2QVO A;  3JAM K;  1V54 H;  1Y39 A;  3CCV I;  2ID6 A;  1Y1V J;  2MFZ A;  2W24 A;  3FHN A;  1DQU A;  1JI8 A;  3KZI C;  4HST A;  3MKW B;  4FHT A;  1PUF B;  3FBI B;  3WGI A;  1CF7 A;  3KP3 A;  4X6A J;  4XKC A;  1W0U A;  3MCZ A;  3VSL A;  4AIH A;  1Z9C A;  1PYV A;  4KMU X;  2WV1 A;  5FLM J;  4C3H J;  3SJM A;  4XNF A;  5FKO A;  4RB2 C;  1W5C C;  2ZXH A;  4GCV A;  1FWZ A;  5FFZ A;  3S16 J;  1YHQ I;  4IQ4 A;  9ANT A;  3OWT A;  2VE8 A;  4OWR B;  1FBU A;  1QGP A;  2AXT C;  3OYB A;  4A3D J;  3GFM A;  3GXO A;  3KPH A;  1UJ8 A;  2MBF A;  4AYB A;  2F4I A;  4MLO A;  1ZRD A;  2E2J J;  2CWE A;  4UUT A;  2DMT A;  1ZG3 A;  3K4N A;  5DCF A;  1UHM A;  5IPA A;  3L2V A;  2XAF A;  2CQX A;  1BC7 C;  2W25 A;  1D5Y A;  1KQ0 A;  2TDX A;  2CUE A;  4XIC A;  4RB0 A;  3KLN A;  2VUM J;  2H1K A;  2LBF B;  2B63 J;  4HLX A;  1IZ1 A;  1XTA A;  3BG9 A;  3CC4 I;  3HOZ J;  4UXN A;  1FY7 A;  2FA5 A;  2ZME B;  1WJC A;  1WPK A;  4HQE A;  2KIM A;  2K4J A;  4G94 A;  3BT9 A;  1QPI A;  1XGO A;  2Z16 A;  3AG1 H;  1Y8R B;  3ZQF A;  3CCJ I;  2EA4 A;  5EGO B;  1FOX A;  2XF7 A;  3JRE A;  2ESN A;  1ON2 A;  3GTP J;  4ZJZ A;  1F36 A;  3OY9 A;  3TOB A;  2JVG A;  2LY2 A;  3F21 A;  3RKY A;  1ZG5 A;  3IH4 A;  1FYL A;  1N78 A;  3F8M A;  3ZMZ A;  2AQE A;  3JRB A;  4BAC A;  2Z1D A;  3L00 A;  2VOO A;  5IP9 J;  4B48 A;  1UZC A;  1YJN I;  1KQ9 A;  2WAF A;  1YRN A;  1H8A C;  2ME0 A;  1T08 B;  4HW0 A;  1T56 A;  5LBQ A;  4G6Q A;  3W6J B;  1VQ6 I;  1S7O A;  3OYF A;  2XAJ A;  1SAN A;  2HKX A;  2KZV A;  4MEX F;  5H20 A;  2D5V A;  1G8X A;  4GFB A;  3CMY A;  3A0B C;  4U7D A;  4BYY A;  4QTR A;  4V19 K;  2NNN A;  2OJE D;  1R1U A;  2E1M B;  4E4H A;  3A4C A;  1TWG J;  3ABM H;  3GVA A;  1Z1D A;  5ILU A;  1SFO J;  1OCT C;  2DPU A;  2CV1 A;  2ELH A;  2R7V A;  3F6V A;  3E1S A;  2OUM A;  1A36 A;  2XKP A;  4PDK A;  4AD9 A;  4A3G J;  3B6A A;  3TP0 A;  4IHV A;  2GWR A;  1W4M A;  1W7P A;  2KL4 A;  4WK8 F;  4BQN A;  4LK0 F;  2KIU A;  2OCC H;  3ZCO A;  4BE0 A;  3BPX A;  1XG1 A;  1OR7 C;  2BHZ A;  3I59 B;  3KZY A;  3BG6 A;  3JSO A;  2QUF A;  5ICE A;  2DA1 A;  4AIK A;  1BOA A;  4N0B A;  2GXB A;  1FOW A;  3S32 A;  3EUA A;  1LE8 B;  4ZDL A;  1OCC H;  5IT3 A;  3BQZ A;  5TIS C;  2ZNY A;  2GQQ A;  3E0J B;  4RMN A;  2EWN A;  3KFW X;  2LH9 A;  4EQQ A;  1GDT A;  3QPH A;  5IT9 Z;  2CW8 A;  2GM4 A;  1WZ2 A;  3P9I A;  4F7Z A;  3WG7 H;  3VB2 A;  4CHU A;  2RN7 A;  1ONV A;  2JA8 J;  4XLC A;  2G0E A;  1U6G A;  2CMP A;  5CQE A;  1XB4 A;  4XBF A;  2X0L A;  2V4J C;  2E60 A;  1SAU A;  3QPL A;  3GFI A;  2WAD A;  3GLL A;  1K4T A;  3A01 B;  3LL7 A;  3NWT A;  3S2W A;  1IRG A;  2P8T A;  2OA4 A;  2PJR B;  5GTI C;  3ZP5 A;  1MMN A;  4LOC A;  1PDN C;  3FKI J;  2EQR A;  2IGK A;  4D0P A;  5IYC J;  3BZ6 A;  3K69 A;  2DCE A;  2KPM A;  3AL0 B;  2HQ5 A;  5ICG A;  1BL0 A;  2AS5 F;  4BHC A;  3K9T A;  5EEG A;  3MAJ A;  1NG6 A;  5HLH A;  1XC5 A;  4BXU A;  3FXO A;  2E5N A;  2O5R A;  1ZAO A;  5CJ9 A;  5JVG F;  3ECO A;  3ZQI A;  3OOP A;  3HUG A;  1KGS A;  1X3W B;  3ERM A;  2OC6 A;  1RKT A;  4HSR A;  3CDI A;  2X9D A;  1VQ5 I;  1HQC A;  1PVE A;  4ZDP A;  2EFN A;  3WGH A;  4WXC A;  2QQA A;  3F72 A;  4I02 A;  5CVR A;  5FJ8 J;  1IRZ A;  3KLO A;  2L7Z A;  1HKS A;  1W36 C;  1Q1V A;  2HYJ A;  2WAQ N;  2EV5 A;  1R49 A;  2LDU A;  4XSX F;  4LG0 B;  3M7G A;  1ERD A;  1FLI A;  4HF0 A;  4ZYE A;  3BOQ A;  2ACJ A;  2R7O A;  2BV6 A;  4PJL A;  5AIQ A;  5AON A;  3DFG A;  2ESH A;  1VQP I;  1S7E A;  1GT0 C;  1AKH A;  5EYR A;  1BI2 A;  3OL4 A;  1RES A;  2XPV A;  4UVA A;  5FRO A;  3DEW A;  1LVA A;  2Q8K A;  2KIS A;  2UZK A;  3CLO A;  1J09 A;  5KAI C;  4Y52 J;  4O3M A;  4BDY A;  1V5G A;  3V8K A;  1BJA A;  4B3X A;  1OIS A;  1Y56 A;  3ZPL A;  4OIP F;  2M5W A;  2NOJ B;  3RTR A;  2Q1Z B;  1EV7 A;  3HSR A;  5GAD J;  2XUB A;  2DTZ A;  3S2H J;  2VQL A;  3DTK A;  1N25 A;  1OCO H;  1P7J A;  3GCM A;  1MIJ A;  2E2H J;  2OZ6 A;  5DD4 A;  4A12 A;  2Y9Y A;  3IH3 A;  4I2O A;  4BU2 A;  3BCB A;  4RB1 A;  5D6E A;  2P6S A;  3BTJ A;  3H5R A;  5E3L A;  2OTL I;  2W84 A;  3DEE A;  4J01 A;  2DO7 A;  2YR2 A;  3O2P E;  3OYC A;  4A3C J;  4ZDO A;  1SFK A;  2R7Q A;  2RV8 A;  4NQW B;  4KNY A;  1STZ A;  1MDM B;  3HB9 A;  2RAE A;  1BBY A;  1Z6T A;  5B3S H;  3ZQL A;  2VQC A;  3BQY A;  4QPO A;  1RIO H;  2DAO A;  2RKH A;  3BR3 A;  1N77 A;  4DJA A;  3E5U A;  5E1W A;  4A5M A;  3H0D A;  1XX5 A;  4HQM A;  1HBX G;  2AHQ A;  1T6S A;  3LSM A;  1SD4 A;  1WSU A;  2V1U A;  4RGX A;  1UFM A;  4BJ6 C;  2DFF A;  2O3F A;  1XGM A;  4A69 C;  5FFX A;  4RAZ A;  4F93 B;  1HKT A;  4RGR A;  2IJL A;  2XPU A;  1VQ9 I;  2D1H A;  2PG4 A;  2X6W A;  2ZB9 A;  1ZQ3 P;  1XPX A;  3DPT A;  2W4S A;  3GLX A;  3ZR8 X;  1P4A A;  2QSF X;  3ONQ A;  4IF4 A;  4AVP A;  5F04 A;  1YIT I;  3PNT A;  4NHJ A;  3GTQ J;  1BA5 A;  2E71 A;  5EDN A;  1JKR C;  1HA8 A;  1J5Y A;  4LD5 A;  4E6K G;  2VAS A;  2DK5 A;  4DW6 A;  3KEY A;  1W5S A;  2A6H F;  5J3L A;  2EIM H;  3TMO A;  3SZT A;  3ABT A;  5CVI A;  5ILS A;  1D5V A;  3RCO A;  4L18 B;  3CUO A;  3BY6 A;  4FIS A;  4CYD A;  2NYX A;  3SFI A;  4XON A;  5C4J J;  2Z2S B;  3DWL E;  4C9Y A;  4N9H A;  1YIO A;  1JGG A;  4I99 C;  1ZLK A;  5ILV A;  2EV0 A;  3R4K A;  2KFD A;  5L3B A;  4ENJ A;  5DDG A;  2L0K A;  1MMA A;  2L7F P;  4BGD A;  1U8R A;  1LUJ B;  4ZZD A;  1NG7 A;  3K4C A;  5H6R A;  1I5Z A;  1F9N A;  1K4S A;  3K4M A;  2NOG A;  2DYR H;  1YOV B;  3EQL F;  3I4P A;  4EJV A;  2LMD A;  1P7I A;  4U0W A;  1MND A;  1HC8 A;  3OOU A;  3H5A A;  2DJN A;  3BR5 A;  3ZXS A;  2LKS A;  3E6C C;  2Y0M A;  1LQ1 A;  1WHU A;  3IKV A;  4J19 A;  3EUH C;  4G7H F;  3AG2 H;  2EIL H;  5BPI A;  1JJ6 C;  1IO2 A;  4MQV A;  5DD8 A;  4AWX B;  4RLQ A;  5BQT A;  4MNU A;  2MC3 A;  1HDP A;  4X1E A;  3ERE D;  4F91 B;  1ZR2 A;  1I1S A;  1K6Y A;  5FKM A;  4XQF A;  3M1C A;  4OU0 A;  1P4W A;  1EH6 A;  3G2B A;  4HF2 A;  2CW0 F;  1H0M A;  1R4M B;  5DYM A;  3N97 A;  2VJI A;  3JRC A;  5LGU A;  4UUS A;  5GTH C;  5TGT A;  1CQT A;  3EYI A;  1E3H A;  2WB1 N;  2RRE A;  4HZF A;  2NNY A;  2HFH A;  4BJ5 C;  3BC8 A;  4PK4 A;  5AIP A;  4IOA F;  1Z7L A;  4ASN A;  3F23 A;  3MD2 A;  1B8I B;  4FE4 A;  2VKD A;  1R5I D;  3CP2 A;  2CRG A;  2O61 A;  3CLQ A;  5H2F C;  3F6O A;  1MH4 A;  1RR8 C;  2ADU A;  3EUK L;  2CYY A;  1SMT A;  1TT5 B;  3K1N A;  4GO1 A;  1SD5 A;  2R0Q C;  2L5Q A;  4BEH A;  4ENK A;  1PP8 F;  1H89 C;  1A35 A;  4KMF A;  1B6A A;  2VLA A;  3V7R A;  3HTS B;  2H1L A;  3I5U A;  1TWH J;  5ICC A;  4IEJ A;  1IF1 A;  1ZN2 A;  3FXL A;  2FQ4 A;  2OCE A;  2K40 A;  1TBX A;  4A0Y A;  3GO5 A;  5FRM A;  1R6R A;  2P7V B;  2ZJ2 A;  1GVD A;  4UB6 C;  2LSO A;  3CDL A;  4BKX A;  3KP2 A;  4XKV A;  2I8D A;  5KHD A;  3WTZ A;  1LDJ A;  2CH0 A;  2KZG A;  2ZXJ A;  3I71 A;  3HKZ A;  2ETH A;  2JUC A;  1T39 A;  1SMY F;  3F9K A;  1ZG1 A;  1H9T A;  1HKQ A;  2FSW A;  1MZB A;  2HPI A;  3Q0V A;  2LR8 A;  2JA6 J;  2BZT A;  1ZK8 A;  2F4O B;  2MYS A;  3HOY J;  5JFR A;  4OAY A;  3HJE A;  2HYF A;  3HRS A;  4JX4 A;  3WU0 A;  4PGH A;  1CGP A;  1ZEL A;  4G7Z F;  1S29 A;  1MNE A;  3WE3 A;  2B9S A;  5LFA A;  2DOA A;  3GF2 A;  1WI9 A;  3LAJ A;  2XB5 A;  2LYC A;  3TO6 A;  4YEL A;  1F43 A;  4KIF A;  2DMQ A;  4JX5 A;  4U87 A;  5CVV A;  4HPQ A;  3VYS B;  5K7H A;  3W3C A;  4E7J A;  2UXN A;  3BCA A;  2XV4 S;  5HDN A;  2O6G E;  2K9L A;  2M4K A;  5L3E A;  1U8B A;  4D1Q A;  4XLH A;  3DF8 A;  4CXF A;  1MBK A;  2R7T A;  1XCB A;  2NS7 A;  3HOS A;  1FYK A;  1JUS A;  2A5W A;  1K83 J;  1POG A;  4UVB A;  4Y15 A;  4L5I A;  1BR4 A;  2BEO A;  4ZZL A;  2GIV A;  3TGN A;  1NK3 P;  1BOB A;  2Y75 A;  2A05 A;  5HOD A;  2HEO A;  1IXR C;  4GRI A;  4LJZ F;  1TTY A;  1QZY A;  3K4B A;  3PL8 A;  4PZJ A;  5GP9 A;  3WU2 C;  1FTT A;  2CQQ A;  3H35 A;  2RDP A;  3J81 K;  4E7L A;  2V1D A;  1XS9 A;  4NUB A;  3H9J A;  3RSN A;  1TLH B;  4KN7 X;  1O3R A;  1XMK A;  4MFE A;  2XC7 A;  4F3Q A;  2X4H A;  5DUI A;  4I6Z A;  1F1Z A;  1MBE A;  3SDG A;  3J7Y J;  3N05 A;  1SAX A;  3M1E A;  1FOK A;  2HOT A;  1T33 A;  2M34 A;  1Z67 A;  1F4K A;  3HHG A;  3S15 J;  3D5S C;  2K5C A;  1J75 A;  4FCY A;  4RBO A;  4G7O F;  2LTP A;  1VQO I;  4HYE A;  3BR1 A;  1GHC A;  2LG4 A;  2K3F A;  2X85 A;  5ICF A;  1KZH A;  5BOX A;  3MZ8 A;  3CUQ C;  5JHU A;  1QU3 A;  3Q3S A;  2FNP A;  2VBY A;  4CDG A;  4AIJ A;  3E5Q A;  2BE5 F;  3HHH A;  4MGR A;  2YSR A;  4EM0 B;  4QWQ A;  4CZC A;  2E7W A;  2OF7 A;  3DPL C;  3TO7 A;  2X48 A;  2CU7 A;  1ETY A;  3G1O A;  4HNT A;  3CCR I;  4L9N A;  3WE2 A;  4JP0 A;  2VQG A;  3CQZ J;  3T5X A;  1SEU A;  2F6C A;  4R8H A;  2KQR A;  1EH7 A;  4LIT A;  4BY1 J;  2FOW A;  4UY8 I;  2R4G A;  3G4S I;  5DM6 F;  1W0T A;  1VQ4 I;  1MJ9 A;  4JK1 X;  3IKT A;  2E5Z A;  2FBI A;  1G59 A;  4Z2Y A;  4Y7N J;  4L0Z B;  5F6F A;  1OYI A;  4XKW A;  3JCU C;  1O7L A;  1WGX A;  5FKN A;  3UR3 C;  2FU4 A;  3R60 A;  2Y0S A;  4UV8 A;  3RQ4 A;  1YG2 A;  2ZSI B;  1OR7 A;  2ZO4 A;  1U78 A;  4XLN F;  4UB8 C;  2A61 A;  1LVK A;  3GTJ J;  1D0Z A;  3AKZ A;  1IXS B;  3FWE A;  4B8X A;  3J7A O;  2ZFU A;  3RZD J;  2NVT J;  1NH3 A;  1SC7 A;  2LF7 A;  4C2U A;  3FXQ A;  1XSD A;  2LRD A;  1OYY A;  2OQG A;  4II3 A;  5E20 A;  1CF7 B;  2HNH A;  2VI6 A;  3GZ6 A;  1A04 A;  4V2G A;  2HYG D;  5FKL A;  4HG2 A;  1T8I A;  1LEA A;  2HS5 A;  1DU0 A;  1UEL B;  2ZNZ A;  4HV6 A;  4QPQ A;  4ZTJ A;  4XMY A;  3W2A A;  2E34 A;  4LB5 A;  1BI0 A;  3TKY A;  2DOD A;  3R6S A;  1R22 A;  5IY5 H;  2P6T A;  4Y33 A;  2NVY J;  5IYD J;  3O6B B;  2BXZ A;  2STT A;  3O8H A;  4A3L J;  4JOM A;  1AA7 A;  1O57 A;  1XGS A;  3HDD A;  4A3F J;  3WTX C;  1IDZ A;  2G7H A;  5EZH A;  3PSI A;  3IH2 A;  3IAM 2;  3P7N A;  1IG7 A;  4Y4R A;  1RZ4 A;  2V9K A;  2VPR A;  4BXF A;  2ZXW H;  1MMS A;  3L2W A;  3ECH A;  4IHW A;  3BR2 A;  3HC7 A;  4BHP A;  2IA2 A;  1H88 C;  1OMI A;  4KJZ A;  4BH9 A;  4YFX F;  4BXX J;  4FT8 A;  4I0A A;  1TNT A;  2IGO A;  2A6T A;  2E1N A;  2WB1 A;  2R5Z A;  1ZGJ A;  3L1P A;  3HOT A;  2VON A;  3J80 K;  3I9V 2;  2R7U A;  5M3F J;  2YU9 J;  1FBQ A;  2W00 A;  4CH7 A;  5JI6 A;  3T0Y A;  1V5F A;  4UNO A;  4EAT A;  1ZRE A;  2V7F A;  2QKL B;  5F1R A;  3VFZ A;  2JSP A;  3CJN A;  1WJB A;  3LSH A;  2XSJ C;  4RA2 A;  4HDU A;  2DPD A;  3U2R A;  5D5X B;  4E70 A;  1KU2 A;  2K85 A;  3ML6 A;  2NVQ J;  4DNC A;  2LY1 A;  5FLX K;  4N9I A;  2MSY A;  2HQR A;  2V26 A;  4L0Y B;  2J5P A;  3M3Y J;  4I01 A;  3H9G A;  1B9N A;  2HQN A;  3OMY A;  4LK1 F;  4EJU A;  1FIP A;  2OBP A;  1N75 A;  4P9U A;  2L3D A;  1LFB A;  1YJ9 I;  1RUN A;  4ABZ A;  3G71 I;  5HLG A;  3RZO J;  2CJJ A;  2EA2 A;  3T8T A;  2FQ3 A;  1YRN B;  3VYT B;  5FB2 A;  1RNL A;  4ZC3 A;  2R5Y A;  4XSZ F;  2PMZ N;  4DQ2 A;  2CS3 A;  4OIO F;  2VC1 A;  4YFK F;  1EJ9 A;  2BY1 A;  4D7N A;  4BJT A;  3QYE A;  4G6D A;  5HNH A;  2Z3Y A;  4M71 A;  2M2E A;  3ZN0 A;  2UV1 A;  2XB0 X;  4FTH A;  1X2M A;  1YW9 A;  3J7A Y;  2XGC A;  2X6Y A;  3K1P A;  3G73 A;  3F8N A;  1FJL A;  2DFI A;  3HPG A;  4CZZ A;  1ZGW A;  3D0S A;  2EIJ H;  1FP2 A;  4A3B J;  1W7P B;  3OYI A;  2F5V A;  2EH3 A;  5KCM A;  1U5T C;  3K0L A;  2QLZ A;  2ZFW A;  5A2Q Z;  1S8N A;  2VJ5 A;  2BY2 A;  3OIP A;  4UHT A;  2LLK A;  1P9Q C;  3RPU D;  3SFZ A;  3FMR A;  4M3G A;  2Y2Z A;  3L2U A;  3QP5 A;  2K9N A;  5TJJ A;  3ISP A;  2D45 A;  1MGT A;  1KYW A;  3OV8 A;  4IXA A;  3QWL A;  4BQQ A;  4G12 A;  1U0J A;  1UG0 A;  4RAF A;  1LFU P;  4XK4 A;  4DZP A;  4RB3 C;  1FX7 A;  1JJ8 C;  1QRY A;  1H9G A;  4NBQ A;  4PSX A;  2EFW A;  1XSX A;  2L02 A;  2QQ9 A;  5E1Z B;  3JRH A;  3A0H C;  1MBG A;  2M9H A;  2DBB A;  3GZN B;  3VOE A;  2XAU A;  1KU7 A;  3ZQ7 A;  3S3M A;  4HNU A;  4WXH A;  1ZRC A;  3TDU C;  4BE1 A;  1SD7 A;  1TL8 A;  4NNJ A;  2DA4 A;  4LLL A;  1K79 A;  1YX3 A;  3G1L A;  4D9J A;  2V6E A;  2IGN A;  3BG5 A;  4O5V A;  2DI3 A;  3BJ6 A;  3JW4 A;  2PI0 A;  3FK7 A;  3Q5F A;  1GUU A;  2VBZ A;  2P5K A;  3DBH B;  1ODD A;  1D0Y A;  1QHG A;  2M8G X;  4IJA A;  1O3S A;  1X4P A;  2F48 A;  2M8E A;  2QGU A;  1TWC J;  3DKY A;  4Z6Y A;  3FXU A;  2DT7 B;  2KT0 A;  4A3J J;  2CFO A;  3U21 A;  3DKX A;  4EV0 A;  4KIB A;  2F2E A;  2HVS A;  2K9M A;  3H3Z A;  1UHW A;  3P5J A;  4M9S A;  2BYV E;  2BW3 A;  2R7W A;  2IS4 A;  2ELJ A;  4G9Y A;  4HEA 2;  2L54 A;  5D6F A;  2X6O A;  1QZE A;  2W48 A;  1FSE A;  3JSP A;  1D1A A;  1HCR A;  3HUG B;  1QA6 A;  1IGN A;  3BTC A;  2EIK H;  2ZBK A;  4UV9 A;  3HPH A;  3LOC A;  5GPC A;  2FEZ A;  3GW2 A;  3CDH A;  3KET A;  1QPM A;  2HKO A;  5H6Q A;  4XR6 A;  3VOD A;  2GXA A;  3P9K A;  2O9L A;  5JR3 A;  2OTJ I;  1DGW Y;  3EUH A;  3PM1 A;  3A02 A;  3OYA A;  2KDO A;  1X2N A;  4NC6 A;  1TT0 A;  5CVJ A;  3O3K A;  2A69 F;  2CO5 A;  3E6D A;  3PO2 J;  2HXO A;  3DTE A;  1WJF A;  1HW2 A;  3OSF A;  2CQ7 A;  2CUF A;  2P0W A;  3TED A;  5CYV A;  1UCR A;  2VB6 A;  1HW5 A;  4C2M J;  2QEX I;  4HRI A;  4BAY A;  4YFN F;  1AKH B;  2K7L A;  2HVQ A;  2MW8 A;  1LDK B;  3FF5 A;  5E8I A;  1DPR A;  3OYE A;  1JHH A;  3K4K A;  3A1Y A;  3OSG A;  4LLN A;  2O8X A;  3BZK A;  5B1A H;  2HZT A;  4P96 A;  2ZME C;  4HX8 A;  1R4N B;  5GAH J;  1FMV A;  4U0Y A;  3OYH A;  1L3L A;  1ULY A;  4IO9 F;  3FIS A;  2M45 A;  2I10 A;  2H94 A;  1FT9 A;  3DLA A;  3ROU A;  1YYV A;  4XID A;  4E7H A;  2W82 A;  4ESB A;  1R71 A;  2IRF G;  2XVC A;  1IJW C;  2F4M B;  3BG3 A;  3UKG A;  4F52 A;  1VND A;  4NB5 A;  2PMH A;  2JPC A;  3LSP A;  4S0H B;  4A0Z A;  3V7C A;  3J81 Z;  2VBW A;  2DN0 A;  4MTD A;  3I54 A;  1B4A A;  1BIB A;  3OYD A;  2WV0 A;  2UWM A;  4ZTF A;  2EFO A;  1X4O A;  3K4J A;  5D8K B;  3RPU A;  4IKF A;  1D1C A;  2XAQ A;  4IHT A;  2V1X A;  5E3N A;  2Z9O A;  2VPL A;  3ABL H;  2Y30 A;  3P9C A;  5E8G A;  5B1B H;  1C0W A;  4C2T A;  2JZY A;  3FM3 A;  2L7M P;  5KAF C;  4M6V A;  3PQK A;  3PUF A;  4WWC A;  3VDX A;  3IWZ A;  1LNW A;  1X19 A;  2QKM B;  1PP7 U;  1UHS A;  5LHI A;  3ULQ B;  1HOM A;  1BIA A;  2E7X A;  1TQM A;  4G8X A;  4HX7 A;  2DMU A;  4HA8 A;  3MKL A;  5DM7 F;  4ANJ A;  2E1M C;  1X3Z B;  2NXN B;  4BUP A;  5LEJ A;  3DTI A;  5FD5 A;  4OIR F;  1Y1W J;  2CV0 A;  4CUG A;  1Z77 A;  1EKE A;  4WX9 A;  2FE3 A;  2DA3 A;  3M4O J;  3KEO A;  4I0B A;  1B72 A;  1R36 A;  1V3F A;  3T1B A;  3Q0W A;  5LRS A;  3F8F A;  1A6I A;  2DLL A;  3MFK A;  1XMA A;  4L9V A;  4IPA A;  3SEZ A;  2EZL A;  4GDF A;  5D8L B;  4ZH4 F;  2DT6 A;  2DMN A;  2P7C B;  4Q47 A;  3CD6 I;  1S6L A;  3S17 J;  3VYU B;  1D1B A;  2JA2 A;  3AG4 H;  4IRH A;  2VT2 A;  2G9W A;  3DKW A;  5F0H A;  2QQB A;  1DU6 A;  3FMQ A;  1R23 A;  1RI7 A;  3FXK A;  2IEK A;  4M9Z A;  4FE7 A;  5LD2 C;  3NWS A;  2QBY A;  5K5R A;  3JRA A;  1ITY A;  3MKY B;  4L5J A;  4EM2 A;  4L9J A;  5LRR A;  2JQ7 A;  2HZD A;  1FBS A;  3ELK A;  4DYR A;  2WY8 Q;  4OIQ F;  4FQG A;  4EJT A;  2IA0 A;  4IRI A;  2LKP A;  4YEJ A;  4XN0 A;  4HX4 A;  1SVL A;  5LHG A;  3A2K A;  3COA C;  1SFX A;  2L4A A;  5J4V A;  5FRN A;  4M6Y A;  5M5Y J;  2XPW A;  2N8G A;  2X1E A;  3FK6 A;  4HF1 A;  1YFH A;  1GXQ A;  5F0C A;  1KU9 A;  2H8W A;  2O8K A;  2B0L A;  4Q5S F;  3QYB A;  3CCU I;  1GVJ A;  2X6X A;  1BC8 C;  3F0C A;  3AL0 C;  1MSF C;  3HXL A;  1ZR4 A;  3MVP A;  4F55 A;  3TBI A;  1D3Y A;  3JAM Z;  3FX3 A;  2W7N A;  2F5F A;  3VEP A;  1HSJ A;  2EPF A;  3BG7 A;  3ZMT A;  2JA7 J;  1FTZ A;  3QOP A;  3V4G A;  5ED4 A;  5BNG A;  2HI3 A;  4UUS B;  3LFK A;  5HDG A;  3D5L A;  1WJA A;  4R1H A;  3I58 A;  2K4B A;  3CUQ A;  1ZLJ A;  4CCM A;  2XAS A;  4DGW B;  2DYS H;  3AFH A;  1ETV A;  1JUM A;  2JN6 A;  3GBG A;  3ZRG A;  2K3P A;  1KU3 A;  2DOE A;  2GAU A;  5J1U A;  4LIV A;  5GAE J;  4L9T A;  2JUG A;  5FGM A;  4E7Z A;  5IOY A;  1TC3 C;  3HOU J;  2HDD A;  2KJC A;  3CJT B;  4BHB A;  5C44 J;  5IT9 K;  3WHB A;  2O0Y A;  3K10 A;  3IAS 2;  5K1Y A;  5DEQ A;  4BEH B;  5JVT A;  3E3V A;  1PUE E;  1I6H J;  4M72 A;  4Q4Z F;  5BPD A;  3OS2 A;  3E6M A;  1RUO A;  1DGR M;  3HTU A;  2J5O A;  2EFQ A;  3E97 A;  3FHZ A;  1RR7 A;  2DFH A;  3E6B A;  3IC7 A;  4C30 A;  3CO7 C;  2DT5 A;  3HOV J;  4AC0 A;  4ESF A;  3OYM A;  3MN2 A;  5M5W J;  5EEA A;  4D7M A;  3G6E I;  3UNG C;  4XN3 A;  3CCL I;  3DCF A;  3Q9V A;  5JLW A;  1PJR A;  3GEZ A;  1I1G A;  5M5X J;  1Y0N A;  3BR6 A;  3DXJ F;  4LG3 A;  3GWZ A;  2CG4 A;  1WJD A;  4WXD A;  4MO7 A;  1HDD C;  3LFU A;  1AHD P;  3A03 A;  1R5H A;  1BN5 A;  4KIS A;  2JWT A;  3JRD A;  1LDD A;  4XLF A;  2H6B A;  4PUS A;  5EJC A;  3CF2 A;  3PSF A;  2R7D A;  3SYT A;  1ENH A;  4HOB A;  3V8L A;  4BY7 J;  1ZH5 A;  4P55 A;  1J2X A;  1IW7 F;  3CCE I;  2GOM A;  3WOD F;  3DBL B;  2V9V A;  3GME A;  2VBX A;  2WAQ A;  2BY0 A;  3HSF A;  1BI1 A;  2IPQ X;  3LMM A;  1JUP A;  4KA4 A;  2JA5 J;  3R0J A;  2FOK A;  4WCG A;  1FZP B;  2HTS A;  2MLK A;  2XRN A;  3E7L A;  3RKX A;  4P1W A;  2A07 F;  2IGM A;  3LNQ A;  2H09 A;  1REP C;  2GBY A;  3G3Z A;  5DUK A;  5J1Y A;  4CYC A;  2VXZ A;  4E7K A;  1T95 A;  1I6X A;  2KRC A;  5F0F A;  1ON1 A;  2Z33 A;  1JT0 A;  3H3U A;  3W2W A;  3JTG A;  4LGW A;  5J8F A;  1E3O C;  4MQ9 F;  4PJJ A;  3D1N I;  3HM5 A;  4B44 A;  3C2H A;  5K5O A;  2IBD A;  1B9M A;  5CVU A;  2HU9 A;  5E3M A;  1R1V A;  1SFE A;  2W1O A;  2EFP A;  1XDU A;  4OIN F;  4J00 A;  2JRT A;  4A5N A;  1ETX A;  2GIZ A;  3MQ0 A;  3GUD A;  4RM3 A;  2ISZ A;  1ETW A;  1YI2 I;  3CTA A;  2CUZ A;  2KLO A;  2P4W A;  5F27 A;  1FP1 D;  1JKP C;  3C1D A;  3V7S A;  4B1R A;  3RKQ A;  3HRU A;  1BR2 A;  4IRG A;  4JX6 A;  1XDS A;  4MIM A;  4I98 B;  4LMY A;  2H6C A;  3BTL A;  3KE2 A;  4AUX A;  3I4N J;  4GXO A;  1OLT A;  3MMY B;  3ZMS A;  3KYC B;  4YII A;  5EG0 A;  4XOT A;  2X51 A;  2DU9 A;  2MLG A;  2JJ7 A;  2HR3 A;  3IL2 A;  4E7I A;  2LNB A;  2VJ4 A;  5D4R A;  3C18 A;  1LFP A;  4Y17 A;  4EM1 A;  1VI0 A;  2HDW A;  3O8G A;  1QO0 D;  2LC2 A;  2A5Y B;  4HLY A;  3HOW J;  1VQL I;  5GPA A;  5L3C A;  2DK8 A;  2YS9 A;  1IC8 A;  2HXI A;  2IXS A;  1R7J A;  3K2A A;  4M73 A;  4BS9 A;  2Z5U A;  3SDB A;  2F5E A;  4QLC U;  5C4X J;  4PFO A;  4FET A;  2E2I J;  4X0G A;  4A3K J;  2LVS A;  2HOE A;  2CQN A;  2AO9 A;  2TRT A;  2E35 A;  3MKZ A;  3GTK J;  2DDB A;  2RQP A;  3BWG A;  3H92 A;  4XLP F;  1VZ0 A;  2R7Z J;  1NHA A;  1YS7 A;  2VKE A;  2XKO A;  4KIC A;  1MH3 A;  2CQK A;  4A93 J;  1U5T A;  4A3M J;  2Q2E A;  2QEN A;  1HXD A;  2TCT A;  1O3Q A;  5B66 C;  2W85 A;  1QVT A;  2QWW A;  5IP7 J;  3KYD B;  3RPQ A;  3I56 I;  1BJZ A;  1RET A;  3RKW A;  3DBR B;  3JR9 A;  4P9F A;  3F8C A;  1OPC A;  1YTY A;  3KP5 A;  3S93 A;  4PJM A;  1Z3X A;  2XGE A;  3ZQG A;  1K78 A;  1ETO A;  2MH9 A;  5LHH A;  4Q48 A;  1GLN A;  4CCK A;  3FMS A;  2EBI A;  2A3S A;  4M3F A;  3WTS C;  6PAX A;  3H3V K;  1OYW A;  3SQN A;  4O6J A;  1YIJ I;  3RJP A;  3CP8 A;  2ECB A;  2L9N A;  2MA3 A;  4D5C A;  4EVI A;  3CMM A;  3RYR A;  2LK2 A;  4RAG A;  5TRD A;  2PLY A;  2HTJ A;  5K7F A;  2PEX A;  2E36 A;  5DCM A;  2MG4 A;  2PQ8 A;  4MHG A;  2JT1 A;  1MKM A;  1V4R A;  4R79 A;  4DIQ A;  1MD0 A;  4XLA A;  3FKJ A;  2EZH A;  3CC2 I;  3DP7 A;  4KIT B;  1MMD A;  3S3N A;  1YJW I;  1A31 A;  1X3U A;  5J40 A;  3OYN A;  2JK3 A;  4GYG A;  2BY3 A;  1S7A A;  2EZI A;  2X1C A;  3CCY A;  3IWF A;  1MSE C;  4IHX A;  3K1M A;  3S1R J;  1MBH A;  2OQR A;  1MJA A;  2R93 J;  2P81 A;  4JQF A;  4IHY A;  2LF8 A;  1SVM A;  1WCM J;  5L3D A;  3L2C A;  2R5Z B;  2FUG 2;  3L2R A;  4BL0 B;  2VL8 A;  2O7O A;  4RDU A;  2JPB A;  3OL3 A;  2EB7 A;  5CPR B;  1T0F C;  1PUF A;  1IN8 A;  4IHS A;  2FJ1 A;  2KIQ A;  1XMX A;  5CQG A;  3PJR A;  4L5E A;  2LD5 A;  2OPT A;  1Z3Y A;  2WBM A;  3W2V A;  4YRV A;  1M1E B;  2V79 A;  4GGG A;  3IHU A;  1XGN A;  2XRL A;  2ZJQ F;  3FXR A;  4M3D A;  3HOX J;  2FRH A;  1OCZ H;  4FX4 A;  1MMG A;  2MC4 A;  2EV6 A;  1YS6 A;  4LB6 B;  3BTI A;  2DA5 A;  1VQM I;  1A6Q A;  5FKK A;  1FOY A;  1G2H A;  4OAZ A;  2M7A A;  5EF6 A;  4B3A A;  3REO A;  2V9P A;  3OYJ A;  2WA0 A;  2VXD A;  1J59 A;  2HOA A;  2K9Q A;  2KKO A;  1O3T A;  3BR0 A;  1IUY A;  1Q1H A;  2M1B A;  3F8B A;  3LQR A;  1JTX A;  5E18 F;  2LBF A;  4ZYH A;  1WRJ A;  2PN6 A;  2Y9Z A;  3NAU A;  3IP4 B;  2VOP A;  2ZSH B;  3ESW B;  1VQ7 I;  4XOR A;  3TW7 A;  2R5Y B;  1GV2 A;  1GXP A;  4ON0 A;  2VQH A;  2YX4 A;  4ENN A;  2ZME A;  1J9I A;  1OCR H;  2COM A;  2CV2 A;  1JXS A;  5IYB J;  1FPQ A;  3ZMD A;  2HDC A;  4DZJ A;  1YX5 A;  3H36 A;  4NC7 A;  5EGO A;  4FAS D;  4II2 A;  4W1U A;  5D5V B;  1K7A A;  1OJL A;  2G7U A;  3MEX A;  3PNV A;  2K27 A;  2STW A;  1D8K A;  2ME6 A;  4AID A;  4KDP A;  2XIG A;  2F5C A;  3HZJ A;  3AAF A;  2OAZ A;  2VC0 A;  2BVL A;  2OU2 A;  3S14 J;  1TNS A;  3ZQH A;  4KT5 C;  4CCO A;  3ASO H;  1LJ9 A;  2LFB A;  3Q0U A;  3HL2 A;  1EH8 A;  1ZGA A;  1UB9 A;  3KYL A;  2GA1 A;  3NEU A;  1Y0U A;  1APL C;  3M8J A;  4XRS A;  4RM2 A;  4M9X A;  2XRO A;  4I7H A;  3HBL A;  3RQI A;  3C2G A;  3TQN A;  2Y69 H;  1JKQ C;  2L7K A;  4YG2 F;  3AG3 H;  3L7W A;  3CC7 I;  1KON A;  2COB A;  2Q0O A;  4PSW A;  2R7X A;  4CIC A;  5LGN A;  3E5X A;  5KVR A;  2A68 F;  1A5J A;  4EMS A;  2RC4 A;  5J4Y A;  1D8J A;  5E3O A;  1R5G A;  1WKM A;  3QAH A;  4IZZ A;  2O03 A;  2IT0 A;  1TWA J;  4E7S A;  1X58 A;  2DA2 A;  4PJ0 C;  2R3S A;  3VYR B;  1T2K A;  3QQA A;  4TV7 A;  1IRF A;  2CUJ A;  2L9S A;  3FIW A;  1X1C A;  5HLT A;  4A6D A;  4RGU A;  4A3E J;  1Z7U A;  3I59 A;  3I64 A;  2LKX A;  1TP4 A;  2VE9 A;  2ICW G;  3IUO A;  1I3Q J;  1DDN A;  4HDV A;  2L2O A;  4DBR A;  2ZCW A;  2XGX A;  2VKV A;  1QQI A;  1U2W A;  1LE8 A;  4XRS G;  2RQQ A;  2BW3 B;  4I76 A;  3GYH X;  2M30 A;  2OV7 A;  4XRM A;  2WWY A;  1BW5 A;  5LLQ A;  1K6O A;  3WTY C;  5JHF A;  1UST A;  2VJJ A;  1Z05 A;  2XHK A;  4CCN A;  5EZG A;  1LEB A;  3GTG J;  3BJO A;  5F08 A;  1U3E M;  1IXC A;  3S8P A;  4MEY F;  3BP8 A;  3W6V A;  2L01 A;  5L3F A;  3MZH A;  3Q9S A;  3BRO A;  3VSK A;  1TQP A;  2BHY A;  2RNJ A;  4M3E A;  4XL9 A;  3J7Z I;  4V2F A;  4KUM A;  3OS1 A;  2X1D A;  2NAZ A;  2CGP A;  2GA2 A;  2YPR A;  4U7B A;  3NQO A;  2DQL A;  1UAA A;  1E3P A;  4A6E A;  3PNY A;  3FZV A;  2HQA A;  2P5V A;  3A01 A;  1KYZ A;  1E0E A;  4ZYD A;  3HEF A;  5F1J A;  3OR1 C;  4CCJ A;  4XLE A;  1HW1 A;  2PJR A;  4F92 B;  2MGQ A;  2L4M A;  2QQ8 A;  2FMY A;  2PFB A;  3ZGK A;  3QOD A;  5HNF A;  1Y6I A;  3FXJ A;  5KNL A;  3CCM I;  2DDA A;  1DP3 A;  3M8F A;  4N4O B;  4PFP A;  2EK5 A;  3ZMV A;  1XSV A;  3IRR A;  2QA4 I;  1YQA A;  2EIN H;  3CES A;  3K70 C;  3LSR A;  3N4M A;  1IRX A;  3QPT A;  4RGS A;  4BQA A;  2D1V A;  2E1O A;  5DTD A;  2ISY A;  3C2B A;  4M74 A;  4CGZ A;  1JT6 A;  2VOD A;  1LKX A;  3HKZ N;  1P92 A;  1XCV A;  4KIG A;  3U1D A;  1QBJ A;  5HDK A;  1W5T A;  2CSO A;  1T38 A;  3LSG A;  1IV8 A;  5EEH A;  5K5Q A;  1MJB A;  2ZXI A;  3S1M J;  5E1X A;  1WI3 A;  4EJW A;  5ERI A;  3K4L A;  4Y13 A;  4DYC A;  3X2Q H;  3PO3 J;  3FDY A;  4DBQ A;  3S1Q J;  4D5F A;  2IP2 A;  1QZZ A;  1VQ8 I;  1I39 A;  3K7A J;  4EGY A;  3V42 A;  1W1W E;  4BBR J;  4C3I J;  5C3E J;  1WWX A;  1Z0X A;  4XKB A;  2QSG X;  3BLY A;  2BOL A;  3EPZ A;  5E79 C;  2AQF A;  3ABK H;  1ZYR F;  3SHF A;  3TDZ C;  3V8J A;  2OD5 A;  3H1C A;  5FO5 A;  1B59 A;  2MH2 A;  4EJO A;  3L2Q A;  4BBS J;  3EYY A;  4RS8 A;  4QSH A;  2QCO A;  3CO6 C;  2VT3 A;  1R58 A;  1S3J A;  3HYI A;  3MZY A;  4OMY A;  2JRM A;  4LG0 A;  2XSD C;  3LQQ A;  5CKT A;  1ETQ A;  3QU3 A;  4JBA A;  1WJ5 A;  5HS7 A;  2K9S A;  1MW7 A;  5HS8 A;  2IAI A;  1BW6 A;  1MBJ A;  2K86 A;  4P5O A;  2XF6 A;  3S3O A;  2K02 A;  2PX9 A;  5J6X A;  2HGC A;  2JTV A;  2NRA C;  5HLI A;  4CCL A;  2FX0 A;  3WGG A;  2PBI A;  2WY7 Q;  2VN2 A;  3CJQ B;  3KIO A;  4B4C A;  3WU1 B;  3L09 A;  3PQJ A;  5B5E C;  2QZ8 A;  4IL6 C;  2DW4 A;  4A2U A;  1ETK A;  2D2W A;  1E17 A;  1P6R A;  2M87 A;  3EET A;  3HG9 A;  1T98 A;  2IS6 A;  1ACI A;  4FX0 A;  3I3L A;  3M9A A;  3DQV C;  3QYF A;  1B72 B;  2ID3 A;  2LRE A;  3U9G A;  2V1N A;  5IOZ A;  3K2Z A;  1U9N A;  1ZHF A;  3RIR A;  3JTH A;  1FEX A;  1USS A;  1BM9 A;  3ZOB A;  1AOY A;  1KA8 A;  1FSH A;  4WF2 A;  3ABU A;  1J7K A;  1VQN I;  1FNN A;  3H0G J;  1RC9 A;  1GV5 A;  5KK1 A;  1DP7 P;  4IVN A;  3HGY A;  4NQW A;  1HLV A;  1IAW A;  3GTO J;  1MDM A;  1FMW A;  3HGG A;  3OYL A;  3HRM A;  2L9R A;  2ZC2 A;  2FD5 A;  2IVM A;  3K6G A;  1WVR A;  2DOF A;  2JMW A;  3NRV A;  2VKH A;  2QBY B;  4XM3 A;  1R9T J;  1IV6 A;  4PGG A;  3F3X A;  5D4S A;  3JRG A;  2LOO A;  1JTY A;  2HWV A;  3FXM A;  4DYQ A;  1B1B A;  3VPR A;  3ZN1 A;  4H4K C;  4C3J J;  2W57 A;  2NVX J;  5DS9 A;  2PMZ A;  3HSE A;  4G6T B;  2KP6 A;  2QF7 A;  3U1K A;  3R61 A;  3OR2 C;  1XN7 A;  2L9V A;  3TOA A;  3TW6 A;  4LIU A;  3CCQ I;  3DU6 A;  4ETS A;  2RNG A;  5K7Z A;  3DLL F;  2ELK A;  3KEQ A;  4EEF G;  3QU6 A;  5D5U B;  1UMQ A;  1ZTR A;  4IOC F;  3ZQC A;  1Z91 A;  3CME I;  3KX2 A;  2DA7 A;  4BE2 A;  2DXI A;  2Y0S N;  4YIF A;  4AVZ A;  1WQ2 A;  4S04 A;  1NK2 P;  2BBY A;  2DFE A;  1UG2 A;  3RI4 A;  3H9Q A;  4U0V A;  1LPQ A;  3CZ6 A;  3W6K B;  4B09 A;  1RPW A;  1IN5 A;  1DUX C;  5A2Q K;  1L0O C;  4ZYG A;  1MBF A;  3GZ5 A;  4K2E A;  1YO5 C;  1WFX A;  2HOS A;  3GTL J;  3DU5 A;  2R7S A;  3CUQ B;  1Z6R A;  3KZZ A;  5FLV A;  3PFI A;  1U9O A;  2IW5 A;  5JLX A;  5BS6 A;  1O7F A;  5HOO A;  1K61 A;  2QSH X;  3CCS I;  1G3Y A;  2MD0 A;  2XAH A;  4S05 A;  3WTT C;  3DV8 A;  5LGT A;  5E17 F;  2NVU B;  3BJA A;  1ZRF A;  4KFC A;  1JGS A;  4A0X A;  2ZJR F;  3LA7 A;  3NAR A;  1OFC X;  1X1A A;  2WTE A;  3M07 A;  1F5T A;  1OKR A;  4HV5 A;  2PJP A;  4YIR X;  1HST A;  3SZG A;  4UUV A;  3RYP A;  3BDD A;  1YLF A;  2PMU A;  1O4X A;  3OYG A;  1AU7 A;  2EJR A;  3SXY A;  2LY9 A;  3T8R A;  1J0R A;  4AYB N;  5M3M J;  2HVR A;  2M7B A;  2DQR A;  3OIO A;  5IP6 A;  2P5L C;  1VQK I;  1S5L C;  2FML A;  1LB2 A;  1IN4 A;  3LA3 A;  1QNT A;  2OZU A;  4RLF A;  2FBH A;  2NS0 A;  3QP6 A;  3LWF A;  3J80 Z;  3PIP F;  2MAB A;  2Z99 A;  1WH5 A;  4I09 A;  4RAY A;  3B6C A;  1R1T A;  5LEK A;  2NS8 A;  1WJE A;  3CMA I;  2IS1 A;  1BI3 A;  3L9F A;  4XOP A;  5L3G A;  1P4X A;  2ZKZ A;  1S9H A;  3PUB A;  1B8I A;  1G3S A;  3I55 I;  5FLX Z;  3I53 A;  2LP0 A;  1G6N A;  3R0A A;  3OS0 A;  2KIF A;  4CSW A;  3FBN B;  3TO9 A;  3ASN H;  3QPS A;  3D5R C;  1NTC A;  1RKW A;  1I3A A;  2JVH A;  2WAE A;  5F64 A;  4B43 A;  3GTM J;  2BGC A;  5J47 A;  2GZW A;  3KP7 A;  2B7E A;  3KCC A;  1R00 A;  3HRT A;  4AU7 A;  1XD7 A;  2ECC A;  2KDZ A;  2RGV A;  3B02 A;  5DV5 A;  3KP4 A;  2R92 J;  2F5D A;  4AM3 A;  3LSJ A;  1FC3 A;  2AXL A;  1IDY A;  2XF5 A;  1QVU A;  1IUF A;  2EZK A;  3S2D J;  3ZQQ A;  4CYC B;  1I50 J;  4H0E A;  1TQI A;  2GLO A;  3WTV C;  1T0F A;  1IN7 A;  2A6E F;  4W97 A;  1YE9 A;  3OYK A;  2XAG A;  3CJR B;  1TZL A;  4B47 A;  3B73 A;  3GX4 X;  2WC2 A;  2KJB A;  5BMZ A;  2GOX B;  1X1D A;  1ZAR A;  3EDP A;  2FBK A;  1JHF A;  1G3T A;  3H5N A;  1DPU A;  2KRF A;  3CF5 F;  1QHH D;  4OOI A;  3F22 A;  1EA3 A;  2M0M A;  3JRF A;  2KRH A;  2MD5 A;  1HF0 A;  2M0C A;  2GXG A;  3IV5 A;  1X1P A;  3GFJ A;  4NC8 A; 
#chains in the Genus database with same CATH homology
 1TW3 A;  3WG9 A;  3WTU C;  1FYM A;  4LFU A;  3SZP A;  5HVQ C;  3IRQ A;  4CO8 A;  2UXX A;  3C3W A;  1G4D A;  1E2X A;  2V6C A;  2C6Y A;  2H27 A;  3LST A;  3QRF F;  3GFL A;  3RDI A;  4HAM A;  3KP6 A;  1YW8 A;  4BNC A;  3I0T A;  4M6X A;  3MWM A;  4HBL A;  3M8E A;  2FF4 A;  2FNA A;  3LA2 A;  1P2F A;  3HIF A;  4UVC A;  2YX7 A;  2QYO A;  5FD6 A;  2Y48 A;  5HS9 A;  4U88 A;  2YU3 A;  4LLG F;  3ZMU A;  1U5T B;  1SFU A;  5J8C A;  4ESJ A;  4MTE A;  2QM3 A;  2RVC A;  2E1C A;  4EGZ A;  4XRF A;  1YW7 A;  2CFX A;  1I27 A;  5D5W B;  4KYW A;  3C7J A;  5CLS A;  1K78 B;  3LAP A;  1IN6 A;  1TW2 A;  3DEU A;  4GYI A;  2R7F A;  3WTW C;  1KQ8 A;  3FM5 A;  4OMZ A;  1JE8 A;  5DCM B;  2FXA A;  3BPV A;  1W7P D;  2IA1 A;  1VTN C;  1SD6 A;  2DTR A;  4PCQ A;  1AWC A;  4ENM A;  2JSC A;  1G3W A;  4KN4 X;  2QVO A;  3JAM K;  2W24 A;  4FHT A;  3WGI A;  1CF7 A;  3KP3 A;  3MCZ A;  4AIH A;  1Z9C A;  4KMU X;  4RB2 C;  4GCV A;  1FWZ A;  5FFZ A;  2VE8 A;  1FBU A;  1QGP A;  3GFM A;  3GXO A;  2MBF A;  1ZRD A;  2CWE A;  5DCF A;  1ZG3 A;  1UHM A;  2XAF A;  1BC7 C;  2W25 A;  1KQ0 A;  2TDX A;  4RB0 A;  3KLN A;  4HLX A;  1IZ1 A;  4UXN A;  1FY7 A;  2FA5 A;  2ZME B;  4HQE A;  2KIM A;  2K4J A;  4G94 A;  1XGO A;  2EA4 A;  2ESN A;  1ON2 A;  3TOB A;  3F21 A;  3RKY A;  1ZG5 A;  1FYL A;  3F8M A;  3ZMZ A;  3L00 A;  2VOO A;  1KQ9 A;  4HW0 A;  5LBQ A;  4G6Q A;  3W6J B;  1S7O A;  2XAJ A;  2HKX A;  4MEX F;  5H20 A;  4U7D A;  4BYY A;  2NNN A;  1R1U A;  3GVA A;  1Z1D A;  5ILU A;  2DPU A;  2ELH A;  3F6V A;  2XKP A;  4PDK A;  4AD9 A;  2GWR A;  1W4M A;  1W7P A;  4WK8 F;  4LK0 F;  2KIU A;  3BPX A;  3I59 B;  3KZY A;  3JSO A;  2QUF A;  5ICE A;  4AIK A;  1BOA A;  4N0B A;  2GXB A;  5IT3 A;  2ZNY A;  2GQQ A;  2EWN A;  3KFW X;  4EQQ A;  3QPH A;  5IT9 Z;  3P9I A;  4F7Z A;  3VB2 A;  4CHU A;  2RN7 A;  1ONV A;  1U6G A;  1XB4 A;  4XBF A;  2X0L A;  3GFI A;  3S2W A;  1IRG A;  2P8T A;  2OA4 A;  3ZP5 A;  1PDN C;  4D0P A;  3BZ6 A;  3K69 A;  5ICG A;  2AS5 F;  4BHC A;  3K9T A;  5EEG A;  3MAJ A;  5HLH A;  4BXU A;  1ZAO A;  5CJ9 A;  3ECO A;  3OOP A;  3HUG A;  1KGS A;  1HQC A;  2EFN A;  3WGH A;  4WXC A;  2QQA A;  3F72 A;  4I02 A;  5CVR A;  3KLO A;  1HKS A;  2EV5 A;  2LDU A;  4XSX F;  4LG0 B;  3M7G A;  1FLI A;  4HF0 A;  4ZYE A;  3BOQ A;  2ACJ A;  2BV6 A;  5AIQ A;  5AON A;  3DFG A;  2ESH A;  1BI2 A;  4UVA A;  1LVA A;  2Q8K A;  2UZK A;  3CLO A;  4O3M A;  3V8K A;  1BJA A;  3ZPL A;  4OIP F;  2M5W A;  3RTR A;  1EV7 A;  3HSR A;  2XUB A;  2OZ6 A;  5DD4 A;  4A12 A;  4I2O A;  4RB1 A;  5D6E A;  2P6S A;  2W84 A;  2DO7 A;  2YR2 A;  3O2P E;  2RV8 A;  4KNY A;  1STZ A;  1MDM B;  1BBY A;  1Z6T A;  1RIO H;  2DAO A;  2RKH A;  3E5U A;  4A5M A;  5E1W A;  1HBX G;  2V1U A;  4HQM A;  1T6S A;  1SD4 A;  1WSU A;  4RGX A;  1UFM A;  2O3F A;  1XGM A;  5FFX A;  4RAZ A;  1HKT A;  4RGR A;  2IJL A;  2D1H A;  2PG4 A;  3DPT A;  3GLX A;  1P4A A;  4IF4 A;  4AVP A;  4NHJ A;  1J5Y A;  4LD5 A;  2DK5 A;  1W5S A;  2A6H F;  3SZT A;  3ABT A;  5CVI A;  5ILS A;  1D5V A;  4L18 B;  3CUO A;  3BY6 A;  4CYD A;  2NYX A;  4N9H A;  1YIO A;  1ZLK A;  5ILV A;  2EV0 A;  3R4K A;  5L3B A;  4ENJ A;  5DDG A;  1U8R A;  4ZZD A;  5H6R A;  1I5Z A;  1F9N A;  3EQL F;  3I4P A;  4EJV A;  4U0W A;  3E6C C;  1LQ1 A;  2Y0M A;  3IKV A;  4G7H F;  5BPI A;  4MQV A;  5DD8 A;  4AWX B;  5BQT A;  4MNU A;  2MC3 A;  3ERE D;  1I1S A;  4OU0 A;  1P4W A;  1EH6 A;  4HF2 A;  2CW0 F;  1H0M A;  5DYM A;  3N97 A;  5LGU A;  3EYI A;  4HZF A;  2NNY A;  2HFH A;  5AIP A;  4ASN A;  3F23 A;  2O61 A;  3F6O A;  2ADU A;  2CYY A;  1SMT A;  3K1N A;  4GO1 A;  1SD5 A;  4ENK A;  1PP8 F;  4KMF A;  1B6A A;  3V7R A;  3HTS B;  3I5U A;  5ICC A;  1IF1 A;  1ZN2 A;  1TBX A;  4A0Y A;  3GO5 A;  2P7V B;  2ZJ2 A;  2LSO A;  3KP2 A;  3WTZ A;  1LDJ A;  2ZXJ A;  3I71 A;  2ETH A;  1T39 A;  1SMY F;  1ZG1 A;  1H9T A;  1HKQ A;  2FSW A;  1MZB A;  5JFR A;  2HYF A;  3HRS A;  3WU0 A;  1CGP A;  4PGH A;  4G7Z F;  1S29 A;  3WE3 A;  3GF2 A;  1WI9 A;  3LAJ A;  3TO6 A;  4KIF A;  5CVV A;  2UXN A;  2O6G E;  2XV4 S;  5HDN A;  5L3E A;  3DF8 A;  4CXF A;  1XCB A;  3HOS A;  1FYK A;  4UVB A;  4Y15 A;  4L5I A;  2BEO A;  4ZZL A;  2GIV A;  3TGN A;  2Y75 A;  2HEO A;  1IXR C;  4LJZ F;  1TTY A;  1QZY A;  4PZJ A;  2RDP A;  2V1D A;  1TLH B;  4KN7 X;  1O3R A;  1XMK A;  5DUI A;  2X4H A;  1F1Z A;  1SAX A;  3M1E A;  1FOK A;  1F4K A;  3HHG A;  1J75 A;  4G7O F;  4HYE A;  1GHC A;  5ICF A;  5BOX A;  3CUQ C;  5JHU A;  2FNP A;  2VBY A;  4CDG A;  4AIJ A;  3E5Q A;  2BE5 F;  3HHH A;  4MGR A;  2YSR A;  4EM0 B;  4QWQ A;  2E7W A;  3DPL C;  3TO7 A;  4L9N A;  3WE2 A;  3T5X A;  4R8H A;  1EH7 A;  1MJ9 A;  4JK1 X;  3IKT A;  2FBI A;  4Z2Y A;  4L0Z B;  5F6F A;  1OYI A;  1O7L A;  2FU4 A;  3R60 A;  4UV8 A;  1YG2 A;  1OR7 A;  2ZO4 A;  1U78 A;  4XLN F;  2A61 A;  1IXS B;  3FWE A;  4B8X A;  3J7A O;  2LF7 A;  3FXQ A;  1XSD A;  1OYY A;  2OQG A;  5E20 A;  1CF7 B;  3GZ6 A;  1A04 A;  2HYG D;  1LEA A;  2HS5 A;  2ZNZ A;  4HV6 A;  4LB5 A;  1BI0 A;  3TKY A;  3R6S A;  1R22 A;  2P6T A;  3O6B B;  2STT A;  1XGS A;  1O57 A;  3WTX C;  2G7H A;  3P7N A;  1RZ4 A;  3ECH A;  4BHP A;  2IA2 A;  1OMI A;  4BH9 A;  4YFX F;  4FT8 A;  4I0A A;  1TNT A;  2E1N A;  1ZGJ A;  3HOT A;  2VON A;  3J80 K;  1FBQ A;  5JI6 A;  3T0Y A;  4UNO A;  1ZRE A;  5F1R A;  3VFZ A;  3CJN A;  4HDU A;  2DPD A;  3U2R A;  5D5X B;  4E70 A;  1KU2 A;  3ML6 A;  4DNC A;  5FLX K;  4N9I A;  2HQR A;  4L0Y B;  2J5P A;  4I01 A;  1B9N A;  2HQN A;  4LK1 F;  4EJU A;  2OBP A;  4P9U A;  2L3D A;  1RUN A;  5HLG A;  2EA2 A;  3T8T A;  2FQ3 A;  5FB2 A;  1RNL A;  4XSZ F;  4DQ2 A;  4OIO F;  2VC1 A;  4YFK F;  4G6D A;  2Z3Y A;  4M71 A;  3ZN0 A;  1YW9 A;  3K1P A;  3G73 A;  3F8N A;  2DFI A;  4CZZ A;  3D0S A;  1FP2 A;  1W7P B;  1U5T C;  3K0L A;  2QLZ A;  2ZFW A;  5A2Q Z;  1S8N A;  4UHT A;  3SFZ A;  3FMR A;  3QP5 A;  5TJJ A;  3ISP A;  2D45 A;  1MGT A;  1KYW A;  3OV8 A;  4IXA A;  4RB3 C;  1FX7 A;  1H9G A;  2EFW A;  1XSX A;  2L02 A;  2QQ9 A;  5E1Z B;  2DBB A;  3VOE A;  1KU7 A;  3ZQ7 A;  4WXH A;  1ZRC A;  3TDU C;  1SD7 A;  4LLL A;  1K79 A;  4O5V A;  2DI3 A;  3BJ6 A;  3JW4 A;  2PI0 A;  3Q5F A;  2VBZ A;  2P5K A;  1ODD A;  4IJA A;  1O3S A;  2M8E A;  3FXU A;  4EV0 A;  4KIB A;  2F2E A;  3H3Z A;  1UHW A;  4M9S A;  2BYV E;  4G9Y A;  2L54 A;  5D6F A;  3JSP A;  1FSE A;  2ZBK A;  4UV9 A;  3GW2 A;  2FEZ A;  3CDH A;  3KET A;  1QPM A;  2HKO A;  5H6Q A;  3VOD A;  3P9K A;  5JR3 A;  3EUH A;  5CVJ A;  3O3K A;  2A69 F;  2CO5 A;  3E6D A;  1HW2 A;  5CYV A;  1UCR A;  1HW5 A;  4BAY A;  4YFN F;  2K7L A;  3FF5 A;  5E8I A;  1LDK B;  4LLN A;  1DPR A;  1JHH A;  2O8X A;  2HZT A;  4P96 A;  4HX8 A;  4U0Y A;  1L3L A;  1ULY A;  2M45 A;  2H94 A;  1FT9 A;  3ROU A;  1YYV A;  4ESB A;  2IRF G;  2XVC A;  4NB5 A;  2PMH A;  2JPC A;  4A0Z A;  3V7C A;  3J81 Z;  2VBW A;  4MTD A;  3I54 A;  1B4A A;  1BIB A;  2UWM A;  2WV0 A;  2EFO A;  5D8K B;  3RPU A;  2XAQ A;  4IHT A;  2V1X A;  2Z9O A;  3P9C A;  5E8G A;  1C0W A;  2JZY A;  3FM3 A;  3PQK A;  4WWC A;  3IWZ A;  1LNW A;  1PP7 U;  5LHI A;  3ULQ B;  1BIA A;  2E7X A;  1TQM A;  4G8X A;  4HX7 A;  4HA8 A;  5LEJ A;  4OIR F;  5FD5 A;  4WX9 A;  2FE3 A;  3KEO A;  4I0B A;  1R36 A;  1V3F A;  3T1B A;  5LRS A;  3F8F A;  2DLL A;  3MFK A;  1XMA A;  4L9V A;  4IPA A;  5D8L B;  4ZH4 F;  2P7C B;  4Q47 A;  1S6L A;  4IRH A;  2VT2 A;  2G9W A;  3DKW A;  2QQB A;  3FMQ A;  1R23 A;  1RI7 A;  4M9Z A;  2QBY A;  5K5R A;  4L5J A;  4EM2 A;  4L9J A;  5LRR A;  1FBS A;  3ELK A;  4OIQ F;  4EJT A;  2IA0 A;  4IRI A;  2LKP A;  4HX4 A;  5LHG A;  3COA C;  1SFX A;  2L4A A;  4M6Y A;  4HF1 A;  1YFH A;  1GXQ A;  1KU9 A;  4Q5S F;  2B0L A;  1GVJ A;  1BC8 C;  1D3Y A;  3JAM Z;  3FX3 A;  2F5F A;  3VEP A;  1HSJ A;  3ZMT A;  3QOP A;  3V4G A;  5ED4 A;  3LFK A;  5HDG A;  3D5L A;  4R1H A;  3I58 A;  2K4B A;  3CUQ A;  1ZLJ A;  2XAS A;  1KU3 A;  2GAU A;  4L9T A;  5FGM A;  2KJC A;  4BHB A;  5IT9 K;  2O0Y A;  5K1Y A;  5DEQ A;  5JVT A;  3E3V A;  1PUE E;  4M72 A;  4Q4Z F;  5BPD A;  3E6M A;  1RUO A;  3HTU A;  2J5O A;  2EFQ A;  3E97 A;  3FHZ A;  3E6B A;  3IC7 A;  3CO7 C;  2DT5 A;  4ESF A;  3Q9V A;  3GEZ A;  1I1G A;  3DXJ F;  3GWZ A;  2CG4 A;  4WXD A;  1R5H A;  1BN5 A;  1LDD A;  2H6B A;  2R7D A;  3V8L A;  4HOB A;  1ZH5 A;  4P55 A;  1J2X A;  1IW7 F;  3WOD F;  2V9V A;  2VBX A;  3HSF A;  1BI1 A;  2IPQ X;  4KA4 A;  3R0J A;  2FOK A;  4WCG A;  1FZP B;  2HTS A;  2MLK A;  2XRN A;  3RKX A;  2A07 F;  2H09 A;  1REP C;  3G3Z A;  5DUK A;  2VXZ A;  1I6X A;  1ON1 A;  2Z33 A;  3H3U A;  3JTG A;  4LGW A;  5J8F A;  4MQ9 F;  5K5O A;  1B9M A;  5CVU A;  1R1V A;  1SFE A;  2EFP A;  1XDU A;  4OIN F;  2JRT A;  4A5N A;  3MQ0 A;  3GUD A;  2ISZ A;  3CTA A;  2P4W A;  1FP1 D;  3C1D A;  3V7S A;  3HRU A;  4IRG A;  1XDS A;  4I98 B;  4LMY A;  2H6C A;  3KE2 A;  4GXO A;  3ZMS A;  4YII A;  2DU9 A;  2MLG A;  2HR3 A;  3IL2 A;  2LNB A;  5D4R A;  3C18 A;  4Y17 A;  4EM1 A;  1QO0 D;  2A5Y B;  4HLY A;  5L3C A;  2DK8 A;  1R7J A;  4M73 A;  2Z5U A;  2F5E A;  4QLC U;  2HOE A;  3H92 A;  2RQP A;  3BWG A;  4XLP F;  1NHA A;  1YS7 A;  2XKO A;  4KIC A;  2CQK A;  1U5T A;  2Q2E A;  2QEN A;  1HXD A;  1O3Q A;  2W85 A;  2QWW A;  3RPQ A;  3RKW A;  4P9F A;  3F8C A;  1OPC A;  1YTY A;  3KP5 A;  1K78 A;  2MH9 A;  5LHH A;  4Q48 A;  3FMS A;  2A3S A;  3WTS C;  6PAX A;  1OYW A;  3SQN A;  4O6J A;  3RJP A;  4EVI A;  2MA3 A;  3RYR A;  5TRD A;  2PLY A;  2HTJ A;  2PEX A;  5DCM A;  2PQ8 A;  4MHG A;  2JT1 A;  1MKM A;  1V4R A;  4R79 A;  1MD0 A;  3DP7 A;  1X3U A;  4GYG A;  1S7A A;  3IWF A;  3K1M A;  2OQR A;  1MJA A;  4JQF A;  2LF8 A;  5L3D A;  3L2C A;  2JPB A;  2EB7 A;  1IN8 A;  4IHS A;  2V79 A;  4GGG A;  3IHU A;  1XGN A;  3FXR A;  2FRH A;  4FX4 A;  2EV6 A;  1YS6 A;  4LB6 B;  3REO A;  1J59 A;  2KKO A;  1O3T A;  1IUY A;  1Q1H A;  2M1B A;  3F8B A;  3LQR A;  5E18 F;  4ZYH A;  1WRJ A;  2PN6 A;  2VOP A;  1GXP A;  4ON0 A;  4ENN A;  2YX4 A;  2ZME A;  1J9I A;  2COM A;  1JXS A;  1FPQ A;  3ZMD A;  2HDC A;  5D5V B;  1K7A A;  2G7U A;  3MEX A;  2K27 A;  2STW A;  1D8K A;  4KDP A;  2XIG A;  2F5C A;  3AAF A;  2OAZ A;  2VC0 A;  2OU2 A;  1TNS A;  4KT5 C;  1LJ9 A;  1EH8 A;  1ZGA A;  1UB9 A;  2GA1 A;  3NEU A;  1Y0U A;  2XRO A;  4M9X A;  4I7H A;  3TQN A;  4YG2 F;  3L7W A;  2Q0O A;  4CIC A;  5LGN A;  3E5X A;  5KVR A;  2A68 F;  4EMS A;  2RC4 A;  1D8J A;  1R5G A;  1WKM A;  3QAH A;  2O03 A;  2IT0 A;  2R3S A;  1T2K A;  4TV7 A;  1IRF A;  4A6D A;  4RGU A;  1Z7U A;  3I59 A;  3I64 A;  2VE9 A;  1DDN A;  4HDV A;  2ZCW A;  2XGX A;  1QQI A;  1U2W A;  3GYH X;  2M30 A;  2WWY A;  5LLQ A;  1K6O A;  3WTY C;  1UST A;  1Z05 A;  2XHK A;  1LEB A;  3BJO A;  1U3E M;  1IXC A;  4MEY F;  3BP8 A;  2L01 A;  5L3F A;  3MZH A;  3Q9S A;  3BRO A;  1TQP A;  2RNJ A;  4KUM A;  2NAZ A;  2CGP A;  2GA2 A;  2YPR A;  4U7B A;  3NQO A;  2DQL A;  4A6E A;  3FZV A;  2P5V A;  1KYZ A;  4ZYD A;  1HW1 A;  2L4M A;  2FMY A;  2PFB A;  3M8F A;  2EK5 A;  3ZMV A;  1XSV A;  3IRR A;  1YQA A;  3N4M A;  3QPT A;  4RGS A;  4BQA A;  2D1V A;  2ISY A;  4M74 A;  4CGZ A;  2VOD A;  1P92 A;  1XCV A;  4KIG A;  3U1D A;  1QBJ A;  5HDK A;  1W5T A;  2CSO A;  1T38 A;  5EEH A;  5K5Q A;  1MJB A;  5E1X A;  4EJW A;  5ERI A;  4Y13 A;  2IP2 A;  1QZZ A;  4EGY A;  1WWX A;  3V8J A;  3TDZ C;  1ZYR F;  3SHF A;  4EJO A;  2OD5 A;  5FO5 A;  1B59 A;  2MH2 A;  3EYY A;  4RS8 A;  3CO6 C;  2VT3 A;  1R58 A;  1S3J A;  3HYI A;  3MZY A;  4OMY A;  4LG0 A;  3LQQ A;  3QU3 A;  4JBA A;  5HS7 A;  5HS8 A;  2K86 A;  4P5O A;  2K02 A;  5J6X A;  2HGC A;  2JTV A;  2NRA C;  5HLI A;  3WGG A;  2PBI A;  2VN2 A;  3WU1 B;  3L09 A;  3PQJ A;  2QZ8 A;  2DW4 A;  4A2U A;  2D2W A;  1E17 A;  1P6R A;  2M87 A;  3EET A;  1T98 A;  4FX0 A;  3M9A A;  3DQV C;  3U9G A;  3K2Z A;  3RIR A;  1ZHF A;  3JTH A;  1USS A;  1BM9 A;  1AOY A;  1KA8 A;  1FSH A;  4WF2 A;  3ABU A;  1J7K A;  1FNN A;  5KK1 A;  1DP7 P;  4IVN A;  4NQW A;  1IAW A;  1MDM A;  3HRM A;  2IVM A;  3NRV A;  2QBY B;  4PGG A;  3F3X A;  5D4S A;  2HWV A;  1B1B A;  3ZN1 A;  2W57 A;  3HSE A;  3R61 A;  1XN7 A;  3TOA A;  4ETS A;  3KEQ A;  3QU6 A;  5D5U B;  1Z91 A;  4YIF A;  1WQ2 A;  4S04 A;  2BBY A;  3RI4 A;  4U0V A;  3W6K B;  4B09 A;  1IN5 A;  1DUX C;  5A2Q K;  1L0O C;  4ZYG A;  3GZ5 A;  4K2E A;  1YO5 C;  3CUQ B;  1Z6R A;  3KZZ A;  3PFI A;  2IW5 A;  5BS6 A;  5HOO A;  1O7F A;  4S05 A;  1G3Y A;  2XAH A;  3WTT C;  3DV8 A;  5LGT A;  5E17 F;  3BJA A;  1ZRF A;  4KFC A;  1JGS A;  4A0X A;  3LA7 A;  2WTE A;  1F5T A;  1OKR A;  4HV5 A;  2PJP A;  1HST A;  4UUV A;  3RYP A;  3BDD A;  1YLF A;  2PMU A;  2EJR A;  3SXY A;  3T8R A;  1J0R A;  2DQR A;  2P5L C;  1LB2 A;  2FML A;  1IN4 A;  3LA3 A;  1QNT A;  2OZU A;  2FBH A;  2NS0 A;  3QP6 A;  3LWF A;  3J80 Z;  2Z99 A;  4I09 A;  4RAY A;  1R1T A;  5LEK A;  1BI3 A;  3L9F A;  5L3G A;  1P4X A;  2ZKZ A;  1G3S A;  5FLX Z;  3I53 A;  3R0A A;  1G6N A;  2KIF A;  3TO9 A;  5F64 A;  2BGC A;  2GZW A;  3KP7 A;  3KCC A;  1R00 A;  3HRT A;  1XD7 A;  2RGV A;  3B02 A;  5DV5 A;  3KP4 A;  2F5D A;  1FC3 A;  2AXL A;  4H0E A;  1TQI A;  3WTV C;  1T0F A;  1IN7 A;  2A6E F;  2XAG A;  3B73 A;  3GX4 X;  2WC2 A;  2KJB A;  5BMZ A;  1ZAR A;  3EDP A;  2FBK A;  1JHF A;  1G3T A;  1DPU A;  2KRF A;  4OOI A;  3F22 A;  2MD5 A;  2GXG A;  3J81 K;  3GFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...