1X3UA

Solution structure of the c-terminal transcriptional activator domain of fixj from sinorhizobium melilot
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
GSHMDDANDIRARLQTLSERERQVLSAVVAGLPNKSIAYDLDISPRTVEVHRANVMAKMKAKSLPHLVRMALAGGFGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcriptional regulatory protein fixJ
publication title Solution structure of the C-terminal transcriptional activator domain of FixJ from Sinorhizobium meliloti and its recognition of the fixK promoter
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1x3uA01
4WXDA 4MEXF 1I27A 4RS8A 5BQTA 3WTVC 2E1CA 2O03A 5L3GA 3M7GA 1ZRDA 2CYYA 4M6YA 2O8XA 3BROA 5D4SA 4EQQA 1FX7A 3QPHA 1G3YA 1ZHFA 3CTAA 4ZZLA 3F8NA 3HUGA 4OIOF 2STTA 1S3JA 5CYVA 4L18B 3F6OA 2E7WA 4ON0A 2K4JA 2PEXA 3COAC 4KN7X 5AONA 1UB9A 3K1NA 2C6YA 2BV6A 2XV4S 4HX7A 4K2EA 5JHUA 2GXBA 3P9KA 4RAYA 1ZG5A 4IF4A 2BEOA 3QPTA 4QWQA 3V7RA 4KNYA 2OAZA 4TV7A 1B59A 3N4MA 3IRQA 2MBFA 1RUOA 1STZA 3DEUA 4EV0A 3FMRA 3PQJA 4GCVA 5BOXA 2NS0A 1MDMB 2EV0A 1U3EM 4N9HA 5LHIA 2P6TA 2G9WA 3HTSB 1ON2A 4HV6A 4RB0A 5DDGA 3ZQ7A 1RI7A 4YIFA 3GXOA 1S8NA 3LFKA 4HLXA 5DUIA 4P55A 1XMKA 2FEZA 2JSCA 5HLHA 3O6BB 4AVPA 3ZMDA 1PP8F 1IZ1A 2IPQX 5E8IA 4KIFA 1BOAA 4JBAA 1FBUA 3EYYA 1XGSA 4O6JA 3I53A 1IN8A 1HKSA 3BJAA 4BAYA 2W84A 3KCCA 2H27A 3KLNA 5DEQA 4G94A 1HW5A 2FU4A 5LGNA 1YTYA 1FT9A 4Y17A 1V4RA 2QUFA 1MGTA 2QENA 5H20A 2PLYA 2KJBA 1RZ4A 5BS6A 2KIUA 3D0SA 1WWXA 5LBQA 1FSHA 2DLLA 2PJPA 3K69A 1FP1D 4S04A 2P7CB 4FX4A 2W25A 3Q9SA 3GVAA 4ENNA 2X4HA 3LAPA 2V9VA 4CO8A 3TGNA 2K86A 3GLXA 1OMIA 1FSEA 1NHAA 2VOOA 4EM0B 1P4AA 1YW7A 2Z3YA 1W5TA 3LA7A 1BJAA 3SQNA 3R0AA 5LGTA 1G3SA 3ZN1A 2J5OA 2YX4A 3HRUA 5FO5A 2A07F 5L3CA 5D6EA 1W4MA 1FOKA 2VC0A 3R0JA 1BI0A 4ETSA 4NHJA 3SFZA 3JAMK 4H0EA 5FGMA 4L9JA 1Z91A 5JI6A 5HS9A 5F1RA 4EGZA 1YO5C 2ZXJA 1K78B 3TO6A 4LB5A 1UHWA 5ICEA 4L0YB 5K5RA 4KN4X 2Z9OA 3R61A 2Z99A 2ZCWA 4R1HA 3WE2A 2ETHA 1J7KA 4UHTA 2HKXA 3LAJA 3HRSA 2FQ3A 1O7LA 3BPVA 5LLQA 1B4AA 1GXPA 1KGSA 1XGNA 1J75A 1AWCA 5E18F 1P2FA 2UZKA 2XVCA 4KYWA 2MA3A 3SHFA 2LKPA 3GO5A 3F23A 5BMZA 1QO0D 2PMUA 4HYEA 2JTVA 3BDDA 3FMSA 2G7UA 1IXRC 3IRRA 4LLLA 1JHFA 3PFIA 2OQRA 5KVRA 3W6JB 3QU3A 1I1GA 2XKPA 2JRTA 5J8FA 4Q47A 3QAHA 2UXNA 2EJRA 5E17F 1I1SA 4UV9A 4OMZA 1LDJA 4LLNA 2L4AA 4HQMA 3E97A 2D45A 3HRTA 4Q48A 1XCBA 2DK8A 1WSUA 1SAXA 2XHKA 2A6HF 3BJOA 2HWVA 3I59B 3FZVA 1U78A 3CDHA 2Z33A 4WXCA 1TNSA 4IHTA 4E70A 3HOTA 1TQMA 1FY7A 2GAUA 3VFZA 2O3FA 3KETA 4U88A 3GF2A 5DD8A 3WTTC 4M72A 2XRNA 3BJ6A 4M71A 4Q5SF 2MH2A 3ZMVA 1Z05A 2FSWA 1B9MA 2KKOA 5ILVA 3WTWC 2LNBA 2YX7A 2DI3A 3FF5A 1YIOA 2PFBA 4KICA 3GX4X 2VE8A 2HKOA 3J81Z 1R23A 4Y15A 2ZJ2A 1TQIA 2IA1A 4P96A 4I0AA 3JSPA 1YW9A 3EQLF 1R1TA 4KIBA 1KU2A 4I0BA 3WTXC 2LF7A 2KJCA 3GFJA 2JPBA 1QPMA 1XN7A 3AAFA 1J9IA 3T0YA 3E6DA 4HF0A 2VBWA 1F1ZA 3GUDA 3GFMA 4BHPA 3S2WA 2K4BA 1BBYA 2FBIA 1DDNA 3KP3A 4KFCA 2A3SA 1ZLKA 2GA1A 1IXSB 3ELKA 4O3MA 4HZFA 1P4XA 2ELHA 2K7LA 4IHSA 1HW2A 3KP2A 3V4GA 1L3LA 3LSTA 1B6AA 2FBKA 2RV8A 1TBXA 1BC7C 1S7AA 4R8HA 4ZYEA 2RC4A 3MZYA 1CGPA 1S29A 2PI0A 4EJTA 3KEQA 3GEZA 2MH9A 3ISPA 4B09A 2FE3A 4CZZA 4LLGF 5D5VB 1WQ2A 5D5UB 3TO7A 2IP2A 1ZRCA 3KE2A 1MJ9A 4ZYDA 2V6CA 5LRSA 3GW2A 2RN7A 4HX8A 1CF7A 3FWEA 3L7WA 5HLIA 1DP7P 2DPDA 4MTDA 2FF4A 3BY6A 3SZTA 3K0LA 4HDVA 4WCGA 1VTNC 3SXYA 4LG0A 2E1NA 3VODA 1KQ0A 1MZBA 2XASA 1F5TA 5FD6A 4I2OA 1HKQA 1O7FA 2EWNA 1HXDA 2MLKA 3C1DA 4ESBA 1LB2A 2P8TA 2XUBA 2IA2A 5IT9Z 1SFXA 4UV8A 3WGHA 1IF1A 1IN7A 1R5GA 2QM3A 4BHBA 2FNPA 3RKYA 2X0LA 4HF2A 3WG9A 4WWCA 1KA8A 2CQKA 3B02A 3E6MA 5D4RA 3WTZA 1BI3A 4ZH4F 2BYVE 2ZFWA 2E7XA 2L4MA 1XDSA 2D2WA 3K2ZA 2ADUA 3GFIA 2JZYA 3IWFA 4WF2A 3TO9A 2NNNA 3IL2A 2O0YA 5DYMA 3DV8A 4HDUA 1IN5A 3C18A 5FFZA 2ACJA 4CDGA 2V79A 2B0LA 1I6XA 3H3UA 1J0RA 3WGIA 3MCZA 1XMAA 1QNTA 5TRDA 3LWFA 4IPAA 3ZMZA 4HF1A 4I01A 1A04A 4BQAA 4UXNA 3HHHA 3IKVA 3GFLA 4MGRA 2EA4A 2V1XA 1B1BA 5ILSA 2A6EF 5JR3A 5K5QA 3ROUA 3JTGA 1G4DA 3E3VA 4AWXB 4Y13A 2FMYA 3IHUA 2H6BA 1F4KA 3O3KA 3R60A 5EEGA 5DCMA 5HS7A 2LF8A 5E20A 1E17A 4ENJA 5FD5A 2L01A 1KYWA 3R4KA 4RAZA 1B9NA 4LD5A 2ZMEA 5K1YA 3V8JA 1FYKA 3M8FA 1IN4A 1WRJA 1X3UA 4EJWA 4UNOA 2OBPA 3M1EA 3MWMA 2XKOA 1S7OA 1LNWA 2IJLA 1KQ9A 1LQ1A 2WV0A 2STWA 2P7VB 2FMLA 3F22A 2WTEA 3R6SA 3HSEA 2HYFA 4B8XA 3MQ0A 3NQOA 2QYOA 1EH6A 1Z7UA 4M73A 4HX4A 3LA2A 1U5TA 4CICA 3RPUA 4OINF 4DNCA 3EDPA 1PUEE 1SFUA 4BH9A 5CVIA 1J59A 5D8LB 4RB2C 3TOAA 6PAXA 1DPRA 3RI4A 3ULQB 2V1DA 4EMSA 2EFWA 1REPC 2PN6A 3RYRA 2YU3A 5AIQA 2F5FA 3IKTA 1H9GA 2YSRA 3HSRA 3T8TA 1OYYA 1HQCA 5JVTA 2K02A 3HIFA 2L02A 3IC7A 3V7CA 5CJ9A 4OMYA 3QOPA 5HDGA 3FXRA 1RNLA 5DV5A 1V3FA 2VXZA 2OZ6A 3LQQA 2VOPA 3DFGA 2COMA 2MC3A 2ZNYA 5DCFA 1H9TA 1PDNC 1LEAA 4CGZA 3HOSA 1IN6A 3HTUA 3ZMUA 1HW1A 4XLNF 3T8RA 1ULYA 4U0VA 3TQNA 1XD7A 4ESJA 3K9TA 3WU1B 1U8RA 4UUVA 1Z1DA 1RUNA 2JPCA 3B73A 4PGGA 4OOIA 4KA4A 4I09A 3WE3A 5BPDA 1G3WA 1BI2A 3Q9VA 4HV5A 1ZRFA 3J80Z 4YFKF 3WTUC 2XAHA 2ZO4A 1GXQA 4L9TA 4HA8A 1XSXA 4EJVA 2PBIA 3E5XA 3QU6A 3HRMA 3I4PA 1HSJA 2GZWA 1CF7B 1IRFA 2A69F 1IAWA 3F6VA 2YPRA 4KMFA 2KIMA 3EUHA 1R58A 1UFMA 4A0XA 1O3SA 2HQRA 5EEHA 4P9FA 2EB7A 3JW4A 2Q8KA 2BBYA 2DBBA 3T5XA 1LDDA 1W7PD 5ERIA 3ABTA 3GYHX 2NYXA 4LG0B 4MQ9F 4UVAA 2XGXA 1KU3A 4HQEA 3KP4A 1R1UA 2QLZA 3KEOA 2QQAA 1D3YA 1ZYRF 2QBYB 4HW0A 2OU2A 2A61A 2P4WA 2XROA 4HAMA 2LSOA 1Y0UA 2P6SA 1UHMA 1K6OA 4AIHA 3J7AO 3DKWA 2DFIA 1QZYA 5LEJA 1G3TA 2M45A 1BI1A 3KP5A 2W24A 3V7SA 1ZGAA 3O2PE 3JTHA 1TLHB 4N9IA 1ON1A 4MQVA 3J81K 1FBQA 1LJ9A 2NNYA 1T6SA 1XB4A 1DUXC 2K27A 3OOPA 3RIRA 4IRHA 4RGRA 1Z6TA 2M5WA 4Z2YA 2R7FA 3GZ6A 1HBXG 3MZHA 3E5UA 1T39A 1ZH5A 5LEKA 1PP7U 1LEBA 1P92A 5CVVA 3D5LA 3DQVC 5CVRA 3F8CA 1YQAA 1Q1HA 3F8FA 4U7DA 2OA4A 4KMUX 4AD9A 2J5PA 2GIVA 4MTEA 2EFQA 3F8BA 1QBJA 2FXAA 2G7HA 4GXOA 1WKMA 3F3XA 2O61A 5JFRA 3HSFA 4I02A 4A2UA 3CJNA 1K79A 3PQKA 1R22A 3U2RA 5K5OA 3M9AA 4L0ZB 1XGOA 3ECHA 2GQQA 4BYYA 5DCMB 3FHZA 4EM2A 1HSTA 1SMYF 3E6CC 1E2XA 5TJJA 4G7HF 5D5XB 4WXHA 4HOBA 4D0PA 2ZNZA 1XDUA 4U0WA 3RPQA 4R79A 2IA0A 1T2KA 5F64A 4RB3C 1YS6A 2ZMEB 2CSOA 3I0TA 1YW8A 3WU0A 2NAZA 5HDNA 1MJBA 1EV7A 3ZMSA 3CUQA 4OIRF 1XCVA 4ZYHA 1QQIA 3K1MA 1FYLA 2D1VA 2QVOA 4N0BA 2MD5A 4FHTA 5FB2A 2VE9A 3VB2A 4GYIA 2YR2A 1ONVA 3DF8A 1U5TC 1FLIA 3QRFF 2GXGA 5IT9K 1J2XA 1U5TB 3FM5A 3NEUA 3MEXA 4A0YA 3I59A 2BE5F 2VT3A 2Y48A 3BOQA 1D5VA 2DQRA 2MLGA 2Q0OA 3FX3A 1KQ8A 4IXAA 2RKHA 2VN2A 3FM3A 2H6CA 2UXXA 1BC8C 1Z6RA 5ICFA 4HLYA 2FOKA 2HTSA 3L9FA 4M9SA 3REOA 1AOYA 2ZBKA 5A2QK 3CLOA 1QZZA 5ICGA 4CHUA 3H3ZA 4XLPF 5LHHA 4ZYGA 1YS7A 1R5HA 4PGHA 4A0ZA 5A2QZ 3WGGA 2IRFG 2HEOA 2Z5UA 1Z9CA 1FYMA 4GGGA 2QQBA 4Q4ZF 3L2CA 1FWZA 5DD4A 4AIKA 2DW4A 4ESFA 4BNCA 3QP6A 2FA5A 2HQNA 4JK1X 4CXFA 2ISZA 3U9GA 1XGMA 2IT0A 1D8JA 4KIGA 4A6EA 5AIPA 3RKWA 3C7JA 3SZPA 1R36A 3BWGA 1ZARA 2R3SA 2PMHA 2AS5F 2PG4A 1W7PA 2GA2A 2CO5A 2XAJA 3RJPA 5HVQC 4LJZF 5CVUA 4PCQA 1JHHA 3BZ6A 4G9YA 4KT5C 3FXUA 2W85A 2L3DA 2HGCA 2Y75A 4YG2F 1IW7F 4PDKA 3MFKA 1ODDA 4OIPF 1R7JA 3TDUC 1F9NA 1ZG3A 1XSDA 5H6RA 1YLFA 2EV5A 2DT5A 2FNAA 5DUKA 1T38A 1O3QA 1P4WA 3G3ZA 3KZZA 4L9NA 2M30A 2A68F 4MNUA 1SD6A 1KU7A 1OR7A 3WTSC 1SD7A 1FP2A 1ZAOA 2ESNA 4L5JA 1L0OC 1UCRA 1YG2A 1GVJA 4P5OA 2BGCA 4EVIA 4UVCA 2M1BA 1O3RA 4NQWA 4G7OF 2DAOA 3TDZC 1R00A 4RGUA 3KP7A 2QZ8A 1SD5A 2ESHA 3ZPLA 3F72A 2FBHA 2EV6A 2H09A 4A6DA 3CO6C 3L00A 3ERED 4HBLA 1MKMA 1C0WA 2L54A 2O6GE 5J6XA 4LFUA 3DXJF 4JQFA 5HLGA 4M9XA 1KU9A 3FMQA 4RB1A 4L9VA 1QGPA 2HOEA 1U6GA 4WK8F 5HS8A 1XSVA 3P7NA 2RVCA 2D1HA 1TNTA 5BPIA 4LB6B 2H94A 5D6FA 5D5WB 5LRRA 3T1BA 1R1VA 5L3DA 1RIOH 5FFXA 5E8GA 5E1XA 3C3WA 1BM9A 2W57A 1ZGJA 2EFPA 2TDXA 5L3EA 1JGSA 1EH7A 1IUYA 3JAMZ 2HDCA 2XAFA 4GO1A 5L3BA 4XBFA 2CG4A 2UWMA 2XAGA 2QQ9A 2QWWA 2IW5A 2XAQA 2RNJA 4I7HA 3G73A 2F2EA 2XIGA 1TW2A 3J80K 3K1PA 2P5LC 1K7AA 1DPUA 4OIQF 5ED4A 2EK5A 5E1WA 4NB5A 4ZZDA 4ENMA 1YFHA 2OZUA 2ZKZA 2V1UA 4IRGA 3CUQC 3BPXA 3U1DA 4XSZF 1MDMA 3ECOA 4PZJA 4ENKA 3KLOA 2EFOA 2DU9A 5IT3A 1EH8A 2M87A 3F21A 4MHGA 3I5UA 3WODF 3IWZA 3P9IA 1FNNA 1I5ZA 2EFNA 4L5IA 4CYDA 3CUQB 1BIAA 2VT2A 2CW0F 2F5DA 2HFHA 2VBYA 2FRHA 3ZN0A 3EYIA 2GWRA 3L09A 4A5MA 3N97A 4G8XA 1ZG1A 2RGVA 1G6NA 1LDKB 1JXSA 4KUMA 5LHGA 4RGXA 4F7ZA 4QLCU 5HOOA 1O3TA 5CLSA 2VBXA 3ZMTA 4BHCA 2VBZA 4YFXF 4GYGA 4G7ZF 5J8CA 1SD4A 1U2WA 3LQRA 3ABUA 1GHCA 2P5KA 2OQGA 1FC3A 4EJUA 4XSXF 2DQLA 3LA3A 1MJAA 1D8KA 2NRAC 2HS5A 3RKXA 2JT1A 1TW3A 4LK1F 4O5VA 3KFWX 1P6RA 3KP6A 1USSA 1HKTA 3RDIA 4M9ZA 2KIFA 3CUOA 3V8LA 5FLXK 2R7DA 3W6KB 3ZP5A 3VEPA 1J5YA 4S05A 1IRGA 1JE8A 2HYGD 4FT8A 4U0YA 2F5CA 5FLXZ 5ILUA 4M6XA 1TQPA 3GWZA 3I58A 2CGPA 4AIJA 4ASNA 3NRVA 3BP8A 1IXCA 2RQPA 4KDPA 2LDUA 3WTYC 4M74A 3KZYA 1FBSA 1OYWA 1SMTA 2VC1A 3VOEA 2VODA 2DPUA 5CVJA 4IJAA 1FPQA 2Y0MA 3I64A 4UVBA 2DK5A 2OD5A 1H0MA 1ZLJA 3QP5A 3HYIA 3OV8A 3DPTA 3P9CA 1ZN2A 2AXLA 5D8KB 2HTJA 2HZTA 3I71A 1K78A 4LGWA 4DQ2A 4EJOA 3CO7C 5KK1A 1W7PB 4RGSA 2PQ8A 3TOBA 2HR3A 2Q2EA 5ICCA 2EA2A 3EETA 2DO7A 1O57A 3RYPA 2VONA 1LVAA 2IVMA 4MEYF 1T98A 1W5SA 4OU0A 3TKYA 1MD0A 3MAJA 3HHGA 3F8MA 2CWEA 2DTRA 4YFNF 1SFEA 2F5EA 1BIBA 1BN5A 4EM1A 1KYZA 4U7BA 4LK0F 1ZREA 2WWYA 1T0FA 4IRIA 4BXUA 1WI9A 5LGUA 1OPCA 1S6LA 4XRFA 3M8EA 3V8KA 3GZ5A 5E1ZB 4WX9A 3I54A 2CFXA 4IVNA 4LMYA 1TTYA 1OKRA 4I98B 1USTA 4YIIA 2RDPA 3DPLC 4G6QA 2WC2A 3FXQA 1YYVA 4G6DA 3E6BA 4P9UA 5F6FA 2KRFA 4A12A 3ML6A 2P5VA 1OYIA 2M8EA 2ISYA 5H6QA 4EGYA 4FX0A 5L3FA 3JSOA 3E5QA 3H92A 2QBYA 1FZPB 3RTRA 4A5NA 3Q5FA 5HDKA 2A5YB 3DP7A
chains in the Genus database with same CATH superfamily
3JRHA 4WXDA 4MEXF 2DT6A 1I27A 4A3BJ 4RS8A 2KIQA 2Y9YA 2M34A 5BQTA 3M3YJ 4B43A 2JUGA 3WTVC 4XLEA 2E1CA 2HYJA 2O03A 3ZQIA 3IV5A 5L3GA 3M7GA 5E3LA 4F3QA 1ZRDA 2CYYA 3K4MA 4BQQA 3K4BA 4M6YA 2O8XA 1ZTRA 3BR6A 1R71A 2R5YA 3M8JA 3BROA 5D4SA 4EQQA 2DODA 1FX7A 2NS8A 1D0ZA 1D1AA 3QPHA 1G3YA 4PSWA 1ZHFA 3CTAA 3DTIA 2DA4A 4ZZLA 3F8NA 3S15J 3DBHB 1PJRA 3HUGA 1IC8A 4OIOF 1JKRC 2STTA 1S3JA 5CYVA 4L18B 2GLOA 3K6GA 2JJ7A 2E7WA 3F6OA 2K4JA 4ON0A 1S72I 2CV2A 1T56A 2PEXA 1MNMC 3COAC 4KN7X 1QZEA 5AONA 1UB9A 2VJJA 3ABMH 3K1NA 2C6YA 2BV6A 3VYUB 2JK3A 2DJIA 2XV4S 3TEDA 2M2EA 4HX7A 4K2EA 5JHUA 5J47A 2GXBA 1MSFC 3P9KA 2MC4A 5IYBJ 4RAYA 3OYBA 1ZG5A 2WY8Q 4IF4A 3EUKL 3G1MA 2BEOA 2JQ7A 3JRIA 2EZHA 4ZYAA 3BQYA 3QPTA 4QWQA 3V7RA 4CCJA 3CMYA 4A3EJ 4KNYA 2OAZA 4TV7A 2X1CA 1B59A 2L9RA 3DEEA 3N4MA 2HOTA 3IRQA 5EJCA 3HOWJ 2MBFA 2CUEA 1SEUA 2EBIA 3LFUA 3PM1A 1RUOA 1STZA 3DEUA 4EV0A 4B47A 1VQNI 3K4KA 1MSEC 2OCEA 5M5XJ 3FMRA 3ZXSA 3HXLA 2LR8A 3PQJA 3J7YJ 4GCVA 1X4OA 2E5ZA 5BOXA 4AC0A 3GTKJ 1QPIA 1QVTA 1SVOA 2NS0A 1JUPA 2CW7A 2ECCA 3AL0C 1MDMB 2EV0A 1U3EM 4N9HA 5LHIA 2P6TA 2G9WA 4ZDLA 3HTSB 1ON2A 4HV6A 4RB0A 5DDGA 3PNYA 2VXDA 3FXKA 3ZQ7A 3K4NA 1RI7A 4YIFA 3GXOA 4BUPA 1S8NA 3LFKA 1KONA 4HLXA 5GP9A 4CUGA 5DUIA 3OSFA 5M5WJ 4P55A 1XMKA 2FEZA 3AL0B 2LLKA 2JSCA 5HLHA 3JREA 3FISA 1ETQA 5FRMA 4A3DJ 1RETA 3CJTB 2BXYA 3O6BB 4AVPA 1Y8RB 3ZMDA 1PP8F 2B9SA 1IZ1A 2IPQX 5E8IA 2JRMA 4KIFA 1BOAA 4JBAA 1FBUA 3EYYA 1VQMI 1XGSA 4O6JA 3I53A 1IN8A 4LIVA 1HKSA 2DN0A 3BJAA 2GXAA 4BAYA 2W84A 3KCCA 2H27A 4BY7J 2IGOA 3KLNA 5DEQA 1ETVA 4G94A 1HW5A 2FU4A 5JLXA 5LGNA 4UUSA 1YTYA 4C9YA 2KQRA 2TCTA 2E19A 3ZCOA 1FT9A 4Y17A 2B63J 1V4RA 2QUFA 4A3CJ 4XRSA 1I39A 1E3HA 1MGTA 2L9VA 2QENA 4M3EA 5H20A 2PLYA 1XPXA 3M07A 2KJBA 1JGGA 1RZ4A 5BS6A 2KIUA 2R93J 1NH3A 3D0SA 1MMSA 3NWSA 1WWXA 4C3JJ 4XLAA 2DLLA 5LBQA 1FSHA 3FK7A 2PJPA 3K69A 1U9OA 4E7SA 1FP1D 3BR1A 1R4MB 4S04A 3A01A 1ZKGA 2UUZA 2W82A 2P7CB 3L2QA 4FX4A 3GTQJ 3CCUI 2JVHA 2W25A 2XF6A 1VQLI 3Q9SA 3GVAA 3PIPF 3BG3A 5JVGF 4ENNA 2X4HA 2ZJPF 2V9KA 3LAPA 2ZB9A 2B7EA 2F4IA 2V9VA 5FKOA 1BW6A 3TGNA 2K86A 3GLXA 4CO8A 4EEFG 1OMIA 3OWTA 2R7RA 3SYTA 1WHUA 3A2KA 1FSEA 4XKBA 1NHAA 4DBQA 4XONA 3SDBA 3UR3C 2VOOA 3OYJA 2O8KA 5DTDA 5IOYA 4EM0B 1P4AA 1YW7A 5H2FC 3OYNA 1WJCA 2Z3YA 1W5TA 2IAIA 3LA7A 1HA8A 4Y7NJ 1BJAA 3BG6A 1MBEA 3SQNA 3R0AA 5LGTA 2WV1A 1G3SA 3ZN1A 2J5OA 2YX4A 3HRUA 5FO5A 5C3EJ 3OYKA 2A07F 2MG4A 5L3CA 3Q0UA 5D6EA 1W4MA 3DBLB 1WVRA 1FOKA 3S3MA 2Z2SB 2CS3A 2VC0A 4XRSG 3JRAA 3R0JA 3RQIA 1IG7A 2KZGA 2ZFUA 1BI0A 4ETSA 1TT0A 3SFZA 5EGOA 4NHJA 1ERDA 3JAMK 3H5NA 4H0EA 2XF5A 3P5JA 5FGMA 3TP3A 3HEFA 4BBSJ 2NOJB 3I56I 4L9JA 1Z91A 5JI6A 1LFUP 1MMGA 3FHNA 3FXMA 4I99C 5HS9A 2ECBA 5F1RA 4QSHA 4BY1J 1TP4A 4EGZA 4CSWA 1YO5C 2ZXJA 4FASD 2W48A 2MYSA 1K78B 1B8IA 3TO6A 2CUZA 1XS9A 5F0HA 4LB5A 3S14J 3HKZA 2M4KA 1UHWA 5ICEA 4Y52J 4L0YB 5K5RA 4KN4X 2R7VA 2Z9OA 3R61A 3FKIJ 2KISA 2Z99A 2ICWG 2ZCWA 4R1HA 2W00A 2Q2EB 4X1EA 1UG0A 1T0FC 2DCEA 3WE2A 2EPFA 2ETHA 1J7KA 4UHTA 2HKXA 1A31A 3LAJA 3HRSA 2LTPA 2FQ3A 2X9DA 3C2GA 3QWLA 5F0CA 5KAIC 3WHCA 1O7LA 5BNGA 4DW6A 5FRNA 3BPVA 4C2UA 1FIPA 1FOYA 5GPAA 4ZDPA 4JP0A 3U1KA 2VB6A 2HI3A 4XLFA 2OV7A 3VPRA 2CQNA 1B4AA 5LLQA 5J1RA 5DS9A 1GXPA 1KGSA 3SDGA 1XGNA 1APLC 1J75A 1AWCA 5E18F 1P2FA 2UZKA 2XVCA 4KYWA 2MA3A 4E7ZA 3ERMA 2BVMA 2V9PA 2L7KA 2CUFA 3SHFA 2ELJA 2LKPA 2JSPA 3C2HA 3GO5A 3F23A 5BMZA 1QO0D 2PMUA 4HYEA 4A69C 2JTVA 3BDDA 3HL2A 3FMSA 3CCRI 2G7UA 3CCJI 1IXRC 1OLTA 4CCKA 3IRRA 4PK4A 4LLLA 1JHFA 3PFIA 3L2VA 2LKXA 2OQRA 5KVRA 3W6JB 3QU3A 1T95A 4CCNA 1I1GA 2BW3A 2XKPA 2AO9A 2JRTA 5J8FA 4IOAF 4Q47A 1QA6A 3QAHA 2UXNA 2VJ4A 1JKQC 2O9LA 2EJRA 2HXIA 3CCYA 1R6RA 2K5CA 5E17F 1YHQI 2CRGA 2V1NA 2JA7J 1I1SA 1MH3A 4UV9A 1J09A 4OMZA 2OTJI 4KJZA 1S5LC 1F43A 1LDJA 4E7KA 4LLNA 2L4AA 4HQMA 4RA2A 1EA3A 3VYTB 3E97A 2D45A 3FBNB 3HRTA 4Q48A 4V2FA 5DM6F 1OCTC 2XGEA 1XCBA 2DK8A 1WSUA 4F55A 1SAXA 2XHKA 4HNTA 2M0CA 2A6HF 1JI8A 2XSDC 2DMNA 3BJOA 2HWVA 3H5AA 3I59B 3FZVA 2W4SA 1E3OC 1U78A 2ZJQF 3CDHA 2RQQA 4WXCA 2Z33A 1IGNA 1XG1A 1X1PA 3HC7A 1TNSA 3HG9A 4IHTA 4E70A 3HOTA 4J01A 4ZDOA 1TQMA 1FY7A 2GAUA 4Z6YA 1V55H 3QYFA 3VFZA 1HDDC 2O3FA 3TP0A 3KETA 4CYCA 4U88A 1V5FA 2V26A 1U8BA 3GF2A 4DYCA 5DD8A 3WTTC 1MNDA 3QYBA 4M72A 1Y6IA 2XRNA 4GDFA 3BJ6A 1OCZH 4M71A 3PNTA 4BQOA 4Q5SF 1IUFA 2MH2A 4PUSA 3ZMVA 4JYKA 1Z05A 2R5YB 2JA8J 2FSWA 3VYSB 2PMZN 1R49A 1B9MA 5B1AH 2KKOA 5ILVA 2VPLA 4BL0B 1JKOC 2CW8A 3HUGB 2LNBA 2X6OA 2YX7A 3WTWC 3CESA 2R7SA 4GRIA 2DI3A 3FF5A 1JTXA 3KIOA 1Z77A 2BY1A 1YIOA 3B6CA 2Y0SN 2PFBA 5LD2C 4KICA 3GX4X 2VE8A 3E7LA 1VQ4I 4II2A 2HKOA 3J81Z 1UAAA 1R23A 2OPTA 4Y15A 2ZJ2A 1WFXA 3KX2A 1QHHD 4A3GJ 3AKZA 2E35A 1TQIA 2IA1A 4P96A 4I0AA 3JSPA 1YW9A 1MNEA 3EQLF 1Y1WJ 1R1TA 4HG2A 4AU7A 2LBFA 5IP6A 4KIBA 1X2MA 1KU2A 3WU2C 4LG3A 4PSXA 2VKDA 4I0BA 2COBA 3CCQI 3WTXC 2LF7A 3EUAA 2KJCA 2WB1A 3DCFA 3ONQA 3GFJA 4UUTA 3H3VK 2JPBA 1QPMA 1XN7A 5GAEJ 1FEXA 2P0WA 3AAFA 4BXFA 2X48A 2VPRA 2XPVA 1J9IA 5EZGA 3E6DA 4HF0A 3T0YA 2VBWA 4XKWA 1F1ZA 3GUDA 3GFMA 4BHPA 3S2WA 2K4BA 4F92B 1X3WB 1BBYA 2E71A 2FOWA 2FBIA 1DDNA 3HGGA 3BG7A 3KP3A 4KFCA 1K4SA 2A3SA 3LSIA 3GTMJ 3OS0A 1JT0A 2KRHA 2R7XA 1FOXA 1MBHA 1ZLKA 2GA1A 1IXSB 3ELKA 4JOMA 3TL4X 4F93B 4O3MA 4HZFA 1P4XA 2ELHA 2K7LA 4IHSA 1HW2A 1WPKA 4HSTA 3KP2A 4C2MJ 5FKKA 3V4GA 2JUCA 1L3LA 3LSTA 3FIWA 1B6AA 4DZJA 2FBKA 2RV8A 1K61A 3JRBA 1TBXA 1XC5A 1BC7C 1S7AA 1RESA 4R8HA 2RC4A 4ZYEA 1QU3A 3MZYA 4M3GA 2DA5A 1S29A 2NOGA 1CGPA 2PI0A 4EJTA 3KEQA 2CU7A 4XR6A 2IS2A 3GEZA 1MH4A 2MH9A 3ISPA 4B09A 1SVMA 2FE3A 4CZZA 2JMWA 4LLGF 5D5VB 2GIZA 3FKJA 3S1NJ 1WQ2A 5D5UB 3TO7A 1B72A 4BBRJ 5KCMA 2IP2A 1ZRCA 3KE2A 1MJ9A 1ACIA 4ZYDA 2V6CA 4A3IJ 1PVEA 5LRSA 3GW2A 2RN7A 4HX8A 1CF7A 3FWEA 4UUSB 3L7WA 1SAUA 4YELA 3LSJA 5HLIA 1DP7P 2LY1A 4I76A 1I50J 1V5EA 2DPDA 3H0DA 4MTDA 1LFBA 2FF4A 3ZQFA 2QEXI 2QSFX 3ESWB 3L2RA 1OCRH 1WGXA 3I4NJ 3BY6A 3SZTA 2LRDA 3K0LA 4HDVA 3HJEA 5TISC 4WCGA 4KT6A 1VTNC 3PUBA 2DYSH 2TRTA 3SXYA 4LG0A 4BE2A 2E1NA 2KLOA 3VODA 1KQ0A 1MMAA 1MZBA 2XASA 4IKFA 1EKEA 3GMEA 2IS1A 1F5TA 1DGRM 5FD6A 1G2HA 4HRIA 4XKCA 1UELB 2L7FP 4I2OA 3K10A 4F91B 4MLOA 1HKQA 1O7FA 2BHYA 2EWNA 3J7ZI 1HXDA 2MLKA 3C1DA 3IH4A 4ESBA 1LB2A 1AA7A 2MW8A 5GAGJ 3MD2A 2HQ5A 2WAQN 2ELKA 2P8TA 2XUBA 2IA2A 5EZHA 1PUFA 5IT9Z 1SFXA 4IOCF 1JJ6C 4UV8A 3WGHA 1IF1A 1IN7A 1R5GA 2QM3A 4BHBA 2FNPA 3SEZA 3RKYA 2X0LA 5K7ZA 2O7OA 4HF2A 3S1MJ 1EJ9A 4S0HB 3WG9A 4WWCA 1KA8A 4RM2A 1LE8B 2CQKA 3G71I 3WHBA 3B02A 4J00A 3O8HA 3BTCA 3AG3H 3E6MA 5D4RA 3W6VA 3WTZA 1BI3A 4NC6A 4ZH4F 1AKHA 2BYVE 2ZFWA 2E7XA 2L4MA 3S2HJ 1XDSA 2D2WA 3K2ZA 2AQFA 2ADUA 3GFIA 2JZYA 5EGOB 4QPOA 4XOTA 2Y31A 3IWFA 4WF2A 3TO9A 2NNNA 3IL2A 2X1EA 1K6YA 3HPHA 4B4CA 1Z3YA 2O0YA 2VI6A 4KISA 1D1BA 4V2GA 5DYMA 3DV8A 4HDUA 2CJJA 2LMDA 1IN5A 3C18A 1N78A 5FFZA 2ACJA 4CDGA 1B8IB 2IGKA 2V79A 2QSHX 2B0LA 4IX7A 2CV1A 1I6XA 1Y1VJ 5F1JA 3H3UA 1J0RA 3WGIA 3CCEI 1A5JA 1N25A 1ZELA 3N05A 1ETWA 2QGUA 3MCZA 1XMAA 1QNTA 5TRDA 3LWFA 3EPZA 4IPAA 3ZMZA 2QKMB 3HOVJ 3S8PA 3CF5F 4I01A 4NNJA 4HF1A 2X85A 1A04A 1RPWA 4BQAA 4UXNA 2BXZA 3QPSA 3HHHA 3A02A 3BTIA 2QCOA 3IKVA 4BJ6C 3GFLA 4RBOA 4MGRA 2EA4A 2V1XA 2JVGA 2LREA 4G12A 1B1BA 4P1WA 5ILSA 2A6EF 5JR3A 5K5QA 3ROUA 3JTGA 2H8RA 4CCOA 1G4DA 5CQEA 1NK3P 4BS9A 4AYBN 3E3VA 2AXTC 1OQYA 2F48A 4PFOA 4AWXB 2L9NA 4Y13A 2FMYA 1TWCJ 3IHUA 2H6BA 1F4KA 2V6EA 3O3KA 1EF4A 1Y56A 3R60A 1FJLA 5EEGA 2M7BA 5DCMA 5HS7A 3FXLA 3H0GJ 4RAGA 1MMNA 2LF8A 2BW3B 1I3AA 5E20A 3HOUJ 1E17A 4ENJA 5LFAA 5FD5A 1WH5A 2L01A 3CCLI 1KYWA 2KMUA 3ZQQA 3R4KA 4RAZA 1B9NA 4LD5A 2ZMEA 5K1YA 3V8JA 2MABA 1FYKA 5IY5H 3M8FA 4C3HJ 5KNLA 3BZKA 5HNHA 1IN4A 1WRJA 5JHFA 1X3UA 4EJWA 1JKPC 4UNOA 2AQEA 2OBPA 4ZC3A 5IP7J 1LPQA 4FE4A 2R7ZJ 2PX9A 3M1EA 3MWMA 2XKOA 2VL8A 1S7OA 1LNWA 3H1CA 2IJLA 3OIOA 4FETA 1KQ9A 1T8IA 2L9SA 1X2NA 2L7ZA 2LVSA 3DTKA 2VQGA 1OISA 3MMYB 3OY9A 1LQ1A 2WV0A 3VSLA 2LK2A 2STWA 1YI2I 2L5QA 2P7VB 2FMLA 4A3FJ 1RKWA 3S93A 3MZ8A 3F22A 1IDZA 2WTEA 3R6SA 1X3ZB 3CQZJ 2HPIA 3HSEA 3S1RJ 4CYCB 4IHWA 2HYFA 4B8XA 3MQ0A 3NQOA 3CC7I 1WI3A 2QYOA 1EH6A 1Z7UA 4M73A 4HX4A 3LA2A 4HEA2 1U5TA 4CICA 3G6EI 1IRXA 2DOEA 3DKYA 3RPUA 4OINF 4DNCA 3OYMA 3A1YA 3EDPA 2X6XA 1PUEE 1SFUA 4XN0A 4BH9A 5CVIA 1J59A 5D8LB 4RB2C 4BXXJ 4NDLA 3TOAA 1DPRA 2RREA 6PAXA 2EZKA 2IGMA 3E1SA 3PIOF 3RI4A 2W7NA 3ULQB 2YUSA 4HSRA 3W2AA 2V1DA 4EMSA 2EFWA 3VWBA 1REPC 1YRNA 4Y4RA 2PN6A 3RYRA 3F9KA 2F4OB 2YU3A 2ZXHA 3CC2I 5AIQA 3SZGA 3AG1H 2F5FA 5B5EC 2VIXA 3IKTA 1H9GA 2YSRA 3PNVA 2K9LA 4OAZA 2LBFB 3HSRA 3T8TA 1OYYA 1IRZA 1JT6A 1GV5A 4J19A 1HQCA 5JVTA 5FROA 4RM3A 2VKVA 4MFDA 2K02A 3MKZA 3HIFA 2L02A 1FTZA 3IC7A 1X1DA 2DMUA 3V7CA 5CJ9A 4OMYA 2BY2A 4D9JA 1YITI 3QOPA 5HDGA 5KHDA 3FXRA 1V5GA 4GFBA 1D0XA 1RNLA 5DV5A 1V3FA 2VXZA 2OZ6A 3L2UA 3LQQA 2VOPA 3DFGA 2COMA 1IJWC 2MC3A 2BVLA 2ZNYA 5DCFA 5IPAA 1H9TA 1E0EA 1PDNC 3GCMA 4BU2A 1VQPI 2BY3A 1LEAA 4CGZA 3OYLA 3HOSA 2IS6A 1IN6A 3HTUA 1AHDP 3ZMUA 1HW1A 4A3KJ 4XLNF 1D1CA 3IH3A 3T8RA 1BJZA 1ULYA 4U0VA 3TQNA 3NAUA 1XD7A 2HDWA 3K9TA 3WU1B 4ESJA 1U8RA 4UUVA 1Z1DA 4DYQA 1RUNA 5FLVA 2KZVA 1DQUA 3HOXJ 4XLHA 2JPCA 5DM7F 2DJNA 4NBQA 3B73A 4PGGA 2DMTA 2E36A 4OOIA 4KA4A 2WBMA 4I09A 2YU9J 2DFFA 1N75A 3WE3A 5BPDA 3OYCA 3A03A 2R4GA 1G3WA 3JRGA 1BI2A 3Q9VA 2D5VA 4HV5A 1ZRFA 3J80Z 1WH7A 4YFKF 2RNGA 3WTUC 2XAHA 1CQTA 2ZO4A 2W1OA 1GXQA 3LOCA 4L9TA 4HA8A 1VQKI 1XSXA 2XPUA 1B72B 4EJVA 3CLQA 2HDDA 2PBIA 2JA5J 3E5XA 5M5YJ 3QU6A 3DWLE 4FCYA 3JR9A 3KYCB 2QA4I 3HRMA 3I4PA 5TGTA 1HSJA 5E3OA 3VSKA 2GZWA 1CF7B 3F0CA 1IRFA 2A69F 1DP3A 1IAWA 2I8DA 2WAEA 4CZCA 3F6VA 2YPRA 3D5SC 3K4CA 2KIMA 4KMFA 3EUHA 1R58A 1UFMA 4H4KC 4A0XA 1SFKA 3ZQCA 1O3SA 2HQRA 1LKXA 2ID3A 5EEHA 1P7JA 4P9FA 2NVYJ 2EB7A 1KZHA 4DJAA 3JW4A 1GDTA 2Q8KA 2BBYA 2DBBA 2H1LA 4QPQA 1LDDA 3T5XA 3V42A 5F27A 1W7PD 5ERIA 1D0YA 4AVZA 3ABTA 4PJJA 2DOFA 3GYHX 5EG0A 1TC3C 4XMYA 2NYXA 3KEYA 4MQ9F 4LG0B 4UVAA 1ZK8A 2XGXA 1KU3A 4HQEA 3KP4A 1R1UA 1GV2A 2QLZA 3KEOA 4II3A 2QQAA 4Y33A 1D3YA 1MBGA 1ZYRF 1NG6A 2QBYB 4HW0A 2R7TA 2OU2A 3CMMA 2A61A 1GUUA 2P4WA 2XROA 4HAMA 3OYEA 2LSOA 4JX4A 1Y0UA 2P6SA 2DFEA 3DLAA 1PUFB 1UHMA 1K6OA 3KZIC 2FUG2 4AIHA 3J7AO 4D5FA 3DKWA 2DFIA 3LMMA 1ZGWA 4EATA 1QZYA 1RKTA 3HPGA 3MVPA 1IDYA 1GT0C 2OC6A 3GLLA 2XRLA 5LEJA 1G3TA 1Z21A 4XORA 2IS4A 2M0MA 3ABLH 2M45A 1BI1A 1OCOH 1XMXA 3KP5A 2LP0A 2W24A 4HNUA 3V7SA 2LOOA 2DXIA 3S17J 1ZGAA 3O2PE 1ITYA 3JTHA 1NK2P 4IZZA 3H36A 5IYCJ 1IV6A 1TLHB 2P81A 2ZSIB 1AKHB 4N9IA 4XQFA 1ON1A 3HOZJ 1YOVB 5CQGA 2HOSA 4MQVA 3J81K 1FBQA 3G2BA 1LJ9A 2NNYA 1T6SA 1T33A 2X6YA 1SC7A 1XB4A 1DUXC 2IEKA 2K27A 3OOPA 3Q3SA 3RIRA 4YIRX 2CV0A 2EQRA 4IRHA 1OCPA 4RGRA 1Z6TA 2M5WA 3DLLF 2WA0A 2F4MB 4BDYA 4Z2YA 2R7FA 3K4LA 4X0GA 3GZ6A 1W36D 1HBXG 3MZHA 2A05A 3RPUD 3E5UA 1A36A 4DBRA 3QQAA 5HODA 1T39A 1ZH5A 5LEKA 2EZLA 1PP7U 1LEBA 1P92A 1Z67A 5CVVA 3D5LA 3GTOJ 3DQVC 5K7HA 2DT7B 3F8CA 5CVRA 1YQAA 4KITB 1Q1HA 3F8FA 1ETXA 1F36A 1VNDA 1K4TA 2DMQA 3FK6A 5M3FJ 4C3IJ 4HNVA 1VQ8I 2VUMJ 4FE7A 3K2AA 4DGWB 4U7DA 1R4NB 1V54H 4MO7A 4C2TA 2QSGX 2OA4A 3M1CA 5J4VA 4NUBA 4KMUX 1TWFJ 4AD9A 2J5PA 2GIVA 3I3LA 3TW7A 5EF6A 4MTEA 2EFQA 2Z16A 3F8BA 1QBJA 2FXAA 1X4PA 2FJ1A 2G7HA 4XRMA 4GXOA 1WKMA 4XKVA 1VQ7I 3F3XA 1A6QA 1HC8A 3CCMI 3IAM2 2O61A 5JFRA 4AM3A 3HSFA 3DEWA 2XB0X 2MFZA 4B48A 4I02A 4A2UA 3GTGJ 3CJNA 1WJBA 1UJ8A 1YX5A 3PQKA 3ZGKA 1K79A 1R22A 3U2RA 2DTZA 3M9AA 1GVDA 3LSKA 3VYRB 4XM3A 5GAHJ 5K5OA 2R7WA 4L0ZB 4RLFA 2ZMEC 4N4OB 1XGOA 1X1AA 3ECHA 2GQQA 4BYYA 5DCMB 4BE1A 3FHZA 4EM2A 1LUJB 1HSTA 1SMYF 3E6CC 3U21A 2JA6J 3ABKH 4E7HA 1E2XA 2H1KA 5TJJA 4G7HF 1TT5B 5D5XB 4WXHA 3X2QH 4E7JA 3GTPJ 4HOBA 4D0PA 1JTYA 2ZNZA 4NC8A 1TWGJ 3OYIA 1XDUA 4U0WA 3RPQA 4R79A 3QPLA 2HXOA 2IA0A 1T2KA 5F64A 4RB3C 1JJ8C 1YS6A 2ZMEB 1ETOA 2CSOA 3PFYA 2ZC2A 4ZTFA 3I0TA 1ZR2A 2E2JJ 1POGA 1YW8A 3WU0A 2NS7A 2NAZA 5HDNA 2VJ5A 4D5CA 1MJBA 1EV7A 3ASNH 2HPMA 3ZMSA 4W1UA 1FOWA 3CUQA 1XCVA 4OIRF 5C4JJ 3DTEA 1H88C 4DZPA 4ZYHA 4RLQA 2FD5A 3BLYA 1JUMA 2OTLI 1QQIA 3WG7H 3K1MA 2KFDA 1FYLA 2KP6A 2D1VA 2QVOA 4N0BA 2DDBA 2MD5A 3LSGA 4FHTA 5FB2A 2VE9A 1HOMA 3VB2A 4GYIA 2YR2A 5M3MJ 1ONVA 5HNFA 4BJ5C 3DF8A 3HB9A 3A01B 1X1BA 1U5TC 2BOLA 1MMDA 1FLIA 3PO3J 3QRFF 2I5UA 3RSNA 2XPWA 2OCCH 2IXSA 2GXGA 2LYCA 3OIPA 5IT9K 3A4CA 4RDUA 4IHYA 3I9V2 3ZQGA 2X1DA 1J2XA 1U5TB 4LITA 3BQZA 4XNFA 3FM5A 1Y0NA 2KT0A 3NEUA 3MEXA 4A0YA 2E2IJ 3I59A 2BE5F 3OR2C 1HDPA 4X6AJ 2VT3A 2PMZA 4ABZA 5E3NA 2Y48A 3BOQA 1T08B 1D5VA 2DQRA 2MLGA 3BR2A 2Q0OA 3FX3A 2PJRA 3BC8A 3DKXA 1KQ8A 4IXAA 2RKHA 2VN2A 3FM3A 2QQ8A 3UNGC 3ZOBA 2Y0SA 2H6CA 1QHGA 2UXXA 2WAFA 3ZQLA 1Z6RA 1BC8C 1YRNB 1A35A 5ICFA 4HLYA 1WJFA 2FOKA 5J4YA 4PJLA 2HTSA 3HZJA 3L9FA 3GTLJ 4M9SA 3M4OJ 5F0FA 3REOA 1AOYA 2ZBKA 1UG2A 3G1OA 5A2QK 3CLOA 1QZZA 5ICGA 1N77A 4CHUA 3H3ZA 4XLPF 5LHHA 4ZYGA 2Z1DA 4XIDA 1YS7A 1NG7A 3OMYA 1R5HA 3S2DJ 4PGHA 4A0ZA 5A2QZ 3WGGA 4IQJA 5CPRB 1OCCH 2IRFG 5GTHC 5EDNA 2HEOA 2Z5UA 1Z9CA 5B1BH 3BT9A 4GGGA 1FYMA 2QQBA 2GOMA 4Q4ZF 3L2CA 1FWZA 5DD4A 5K7FA 4AIKA 2DW4A 2EIJH 3OOUA 1X19A 2E5NA 3IH2A 4ESFA 3H5RA 2EINH 4BNCA 3DU6A 1VF9A 1I6HJ 3LSPA 3H35A 3QP6A 2FA5A 2HQNA 2M7AA 1LFPA 1VFCA 2CH0A 4JK1X 4CXFA 2ISZA 3U9GA 4L5EA 1FMVA 2CUJA 5HLTA 4ZTJA 2DA2A 2K85A 3CP8A 1XGMA 5C44J 2IT0A 1D8JA 4KIGA 2VASA 1WJEA 2Y30A 3BG5A 9ANTA 5IYDJ 3SEQA 4A6EA 2FQ4A 5AIPA 3DBRB 5FKNA 4W97A 3RKWA 3K7AJ 4MIMA 1WZ2A 1ORKA 3C7JA 3SZPA 1R36A 4QIWN 3BWGA 1ZARA 2R3SA 3HDDA 4BE0A 1Z0XA 3HKZN 2E34A 2LC2A 2PMHA 2AS5F 2A6TA 2DDAA 2PG4A 4M3DA 1W7PA 2GA2A 2ID6A 2CO5A 4BEHA 5F04A 2XAJA 1Z3XA 3RJPA 5HVQC 3EUHC 2CQXA 2KL4A 4LJZF 2O5RA 2M4GA 2OF7A 3PSFA 5CVUA 3I55I 1JHHA 3BZ6A 4G9YA 4KT5C 4PCQA 1OFCX 3FXUA 3H9QA 2W85A 2HU9A 5E79C 2R7OA 5IP9J 2LY2A 3BR3A 2L3DA 2HGCA 1UZCA 3BZCA 2Y75A 3TW6A 1IW7F 4YG2F 1MBFA 2FX0A 4PDKA 3MFKA 4A93J 1ODDA 4OIPF 1R7JA 3TDUC 3ZQHA 1F9NA 3W3CA 1ZG3A 1XSDA 2M8GX 5H6RA 1YLFA 2EV5A 3C2BA 1DU6A 2DT5A 3JCUC 3PJRA 4IHVA 1M1EB 4XLCA 2NXNB 4D1QA 5EG0B 2G0EA 2FNAA 5DUKA 1T38A 1O3QA 1P4WA 3G3ZA 2HOAA 3KZZA 4L9NA 1IV8A 2JWTA 5J3LA 2M30A 2A68F 4MNUA 3L1PA 2LH9A 1SD6A 5JLWA 1KU7A 1BR4A 5KAFC 3MKYB 1OR7A 3WTSC 4AIDA 1SD7A 1UMQA 1FP2A 2XB5A 1ZAOA 2ESNA 4HPQA 2VLAA 4B44A 4L5JA 2WAQA 4BACA 4XICA 1MW7A 1L0OC 2KHMA 2DA3A 3OS1A 2XF7A 1UCRA 4XOPA 3OIQA 1YG2A 1QRYA 1YJ9I 2DYRH 1WJ5A 3ASOH 1GVJA 4P5OA 2K9QA 3TMOA 1RR7A 4CH7A 3ZR8X 2BGCA 4EVIA 4UVCA 1BR2A 2M1BA 1I3QJ 1O3RA 2IBDA 4NQWA 4PFPA 4G7OF 2DAOA 3TDZC 4JX6A 4NC7A 2R5ZA 1R00A 4RGUA 1GLNA 3KP7A 1HF0A 2QZ8A 5E3MA 1SD5A 2ESHA 3Q0WA 5J1UA 3AG4H 3ZPLA 3F72A 2FBHA 1MBJA 2EV6A 2H09A 2VQHA 3CP2A 4IQ4A 3BR0A 4A6DA 3L00A 3CO6C 4CA0A 4A3JJ 3ERED 1RC9A 4HBLA 1MKMA 3GBGA 1C0WA 2RAEA 2L54A 5B66C 1TL8A 2O6GE 4DYRA 2XGDA 1BR1A 4AUXA 2R0QC 2NVTJ 5J6XA 2HZDA 4LFUA 3DXJF 4JQFA 3GZNB 3FDYA 5HLGA 2L2OA 4M9XA 1KU9A 3FMQA 4RB1A 2XAUA 4L9VA 4ZJZA 1LE8A 1QGPA 2HOEA 1VI0A 1U6GA 4WK8F 5HS8A 1XSVA 3GTJJ 4IO9F 3UKGA 5FKLA 2OJED 2RVCA 3P7NA 2D1HA 1BW5A 1TNTA 5BPIA 4LB6B 2H94A 2DOAA 5D6FA 1ZR4A 2KDOA 3CF2A 4YEJA 2IGNA 2L7MP 5D5WB 4BGDA 2K9SA 4FQGA 5LRRA 3A0HC 3T1BA 1JUSA 1R1VA 3OL3A 5L3DA 3S32A 1RIOH 5FFXA 2GOXB 4JX5A 5E8GA 2VQLA 1HLVA 5E1XA 3C3WA 4V19K 1BM9A 2W57A 1ZGJA 3IP4B 2EFPA 2K9NA 2LY9A 2TDXA 5L3EA 1JGSA 2BY0A 1EH7A 1IUYA 3JAMZ 3CDIA 2HDCA 2XAFA 4GO1A 3MKWB 5L3BA 1RRJA 3H9JA 2VQCA 4LOCA 1VQ5I 2LFBA 4XBFA 2CG4A 3RQ4A 1VQOI 2UWMA 1SFOJ 4C30A 2R7UA 2XAGA 2QF7A 2QQ9A 4XN3A 2QWWA 2IW5A 2XAQA 2RNJA 4I7HA 3G73A 2WB1N 3TBIA 1SANA 2VKEA 3PL8A 4AYBA 1W1WE 2DA7A 2F2EA 5EYRA 3HOYJ 2L0KA 2XIGA 1TW2A 1P7IA 1A6IA 3W2VA 3J80K 1QVUA 3VDXA 3CJRB 3HBLA 2X51A 3K1PA 2Y9ZA 2P5LC 1K7AA 1BL0A 2EZIA 1DPUA 4OIQF 2ZXWH 5ED4A 3CCVI 2EK5A 3CMEI 1W0TA 2K3PA 5E1WA 3OSGA 4NB5A 4ZZDA 3KYDB 4BJTA 4ENMA 2XC7A 2OZUA 2ZKZA 1YFHA 3I4MJ 1WJDA 2V1UA 4IRGA 4QTRA 3CUQC 3W2WA 3BPXA 3U1DA 5IOZA 4XSZF 4M6VA 3E0JB 1MDMA 1DGWY 3ECOA 3OS2A 3NARA 1Y8QB 4PZJA 4ENKA 1TZLA 3KLOA 1U9NA 1E3PA 2EFOA 3G4SI 2DU9A 5IT3A 1EH8A 1WCMJ 3BTJA 2M87A 3F21A 4MHGA 3I5UA 3WODF 1MBKA 3IWZA 3P9IA 1FNNA 5GADJ 1FIAA 1I5ZA 2EFNA 4L5IA 2DFHA 3H9GA 3OL4A 4CYDA 3CUQB 1TWAJ 1BIAA 3BTLA 2VT2A 1S9HA 2CW0F 2F5DA 2HFHA 2VBYA 3DPUA 2FRHA 1BOBA 3ZN0A 3S3NA 1DU0A 1O4XA 2HVRA 3EYIA 2GWRA 4A3LJ 3L09A 2Q1ZB 5FJ8J 4F52A 4A5MA 2HVSA 3N97A 4G8XA 2XSJC 4N4NB 1ZG1A 2RGVA 2ZSHB 1G6NA 1LDKB 3HM5A 4E6KG 1JXSA 4KUMA 2F5VA 5LHGA 4PJNA 3Q0VA 2BZTA 4RGXA 4F7ZA 3PUFA 4QLCU 5HOOA 3A0BC 2JN6A 1O3TA 3S1QJ 5CLSA 4XL9A 2VBXA 3ZMTA 3SFIA 1W5CC 2H8WA 2KPMA 5B3SH 3CC4I 3K4JA 4BHCA 3OYAA 1BA5A 3AG2H 2CQQA 2VBZA 3CMAI 4BQNA 2R92J 2ZXIA 3HGYA 2M9HA 4YFXF 4BDZA 4GYGA 4G7ZF 5J8CA 3S3OA 2MD0A 1SD4A 1U2WA 1UHSA 3LQRA 4MFEA 2F6CA 1RR8C 4I6ZA 3ABUA 4UB8C 1VQ6I 4BKXA 1GHCA 2P5KA 2OQGA 2K3FA 4IL6C 1FC3A 2K40A 4EJUA 1ETKA 1Q1VA 4XSXF 2DQLA 3LA3A 4E7LA 1MJAA 2XGCA 1H8AC 2GM4A 1D8KA 2PJRB 1K83J 2NVUB 2NRAC 2HS5A 3IUOA 3RKXA 2JT1A 2KRCA 1R5ID 1ZQ3P 1TW3A 4LK1F 4O5VA 1G59A 3KFWX 1P6RA 4B3AA 3K70D 3LNQA 3KP6A 1USSA 3CDLA 1WJAA 1HKTA 3B6AA 3RDIA 5GPCA 4M9ZA 3SJMA 2KIFA 4UB6C 2QKLB 4LIUA 3CUOA 3V8LA 2E1OA 2R7DA 5FLXK 3W6KB 4DOZA 3ZP5A 3VEPA 5FLMJ 1VZ0A 1J5YA 4S05A 1AU7A 1IRGA 3CJQB 2HYGD 1JE8A 2NVXJ 1P9QC 4FT8A 4U0YA 2F5CA 5FLXZ 5ILUA 4M6XA 1IO2A 2K9MA 3NWTA 1TQPA 3PSIA 2X6WA 3JRDA 3D1NI 3GWZA 3I58A 1FTTA 2CGPA 2E1MC 1U0JA 4AIJA 4YRVA 1XTAA 4OAYA 2V4JC 4ASNA 3RZDJ 3NRVA 3BP8A 1IXCA 2RQPA 2ZJRF 4G6TB 4KDPA 2LDUA 3J7AY 3WTYC 4M74A 4M3FA 3CD6I 3KZYA 2CQ7A 3OR1C 2KDZA 1XX5A 1VQ9I 1FBSA 2CFOA 1OYWA 1SMTA 2VC1A 3VOEA 2VODA 4CCMA 3BCAA 3OYGA 2DPUA 3PO2J 5CVJA 3KYLA 4B1RA 3MN2A 4IJAA 3LL7A 1FPQA 2Y0MA 3I64A 4RAFA 1YIJI 3S16J 2N8GA 4UVBA 2DK5A 2OD5A 2E1MB 1H0MA 2WY7Q 1ZLJA 1HCRA 3QP5A 4FTHA 3HYIA 3OV8A 3DPTA 4PJMA 3P9CA 1ZN2A 2AXLA 5D8KB 2HTJA 2HZTA 3JRCA 2NVQJ 4U87A 5J1YA 2EIKH 3I71A 1K78A 4LGWA 4M3BA 5J40A 3G1LA 4IHXA 3MKLA 4FISA 2Y69H 3CCSI 4DQ2A 2LD5A 4EJOA 1ETYA 4IEJA 3CO7C 5KK1A 2V7FA 2LG4A 1W7PB 4RGSA 3AFHA 4BEHB 2PQ8A 3BG9A 3TOBA 2DA1A 2HR3A 2VKHA 2DMPA 2Y2ZA 2Q2EA 3RKQA 5ICCA 2EA2A 2EH3A 3EETA 3L2WA 2DO7A 1NTCA 4XK4A 1O57A 3RYPA 2VONA 1LVAA 2IVMA 4MEYF 1R9TJ 2UV1A 3FXJA 1T98A 1W5SA 4OU0A 3CZ6A 5F08A 3TKYA 1MD0A 4CCLA 3MAJA 3HHGA 2EILH 2CWEA 3F8MA 2DTRA 4YFNF 1SFEA 1W0UA 2F5EA 1BIBA 1BN5A 4EM1A 1KYZA 3BR5A 2HNHA 2ME0A 2MGQA 4U7BA 4Y3OA 3JRFA 4LK0F 1H89C 1ZREA 2WWYA 1Z7LA 1T0FA 1S7EA 4ANJA 1YJNI 4IRIA 4BXUA 3LSMA 1OR7C 4RMNA 4UY8I 1WI9A 5LGUA 4D7MA 1OPCA 4PJ0C 2HQAA 1S6LA 3D5RC 3M8EA 4XRFA 3V8KA 3K70C 2BHZA 4E4HA 1OJLA 1Y39A 3GZ5A 3QODA 3O8GA 5E1ZB 4B3XA 2I10A 5GTIC 2AHQA 2LKSA 3I54A 2CFXA 4IVNA 4WX9A 4LMYA 1FMWA 1YE9A 5C4XJ 3FXOA 5CKTA 1TTYA 5FKMA 1OKRA 3FBIB 3OYHA 4I98B 1USTA 1W36C 4YIIA 2RDPA 3DPLC 4A3MJ 1YX3A 4G6QA 2WC2A 4OWRB 3OYDA 2HVQA 2GBYA 3QOEA 3RZOJ 4DIQA 3BCBA 3FXQA 1PYVA 1SVLA 1YYVA 2OUMA 1TWHJ 2E2HJ 2WADA 4G6DA 3E6BA 4P9UA 2XDVA 5F6FA 2KRFA 4A12A 3OYFA 4ITVA 3ML6A 2P5VA 1OYIA 2EIMH 3DU5A 2M8EA 2ISYA 5H6QA 2MSYA 2VJIA 4EGYA 4D7NA 3IAS2 1LVKA 4NQWB 2DA6A 4FX0A 5L3FA 3JSOA 3E5QA 2ME6A 3H92A 5EEAA 2R5ZB 1X58A 2CMPA 2R7QA 2M3AA 2JA2A 3ZRGA 2QBYA 3LSHA 1FZPB 3RTRA 4A5NA 3Q5FA 2YS9A 1X1CA 1YJWI 5HDKA 3RCOA 1ENHA 1MIJA 3QYEA 1G8XA 2A5YB 3LSRA 2E60A 2A5WA 3KPHA 4E7IA 1D5YA 3DP7A
chains in the Genus database with same CATH topology
4WXDA 4MEXF 1I27A 4RS8A 5BQTA 3WTVC 2E1CA 2O03A 5L3GA 3M7GA 1ZRDA 2CYYA 4M6YA 2O8XA 3BROA 5D4SA 4EQQA 1FX7A 3QPHA 1G3YA 1ZHFA 3CTAA 4ZZLA 3F8NA 3HUGA 4OIOF 2STTA 1S3JA 5CYVA 4L18B 3F6OA 2E7WA 4ON0A 2K4JA 2PEXA 3COAC 4KN7X 5AONA 1UB9A 3K1NA 2C6YA 2BV6A 2XV4S 4HX7A 4K2EA 5JHUA 2GXBA 3P9KA 4RAYA 1ZG5A 4IF4A 2BEOA 3QPTA 4QWQA 3V7RA 4KNYA 2OAZA 4TV7A 1B59A 3N4MA 3IRQA 2MBFA 1RUOA 1STZA 3DEUA 4EV0A 3FMRA 3PQJA 4GCVA 5BOXA 2NS0A 1MDMB 2EV0A 1U3EM 4N9HA 5LHIA 2P6TA 2G9WA 3HTSB 1ON2A 4HV6A 4RB0A 5DDGA 3ZQ7A 1RI7A 4YIFA 3GXOA 1S8NA 3LFKA 4HLXA 5DUIA 4P55A 1XMKA 2FEZA 2JSCA 5HLHA 3O6BB 4AVPA 3ZMDA 1PP8F 1IZ1A 2IPQX 5E8IA 4KIFA 1BOAA 4JBAA 1FBUA 3EYYA 1XGSA 4O6JA 3I53A 1IN8A 1HKSA 3BJAA 4BAYA 2W84A 3KCCA 2H27A 3KLNA 5DEQA 4G94A 1HW5A 2FU4A 5LGNA 1YTYA 1FT9A 4Y17A 1V4RA 2QUFA 1MGTA 2QENA 5H20A 2PLYA 2KJBA 1RZ4A 5BS6A 2KIUA 3D0SA 1WWXA 5LBQA 1FSHA 2DLLA 2PJPA 3K69A 1FP1D 4S04A 2P7CB 4FX4A 2W25A 3Q9SA 3GVAA 4ENNA 2X4HA 3LAPA 2V9VA 4CO8A 3TGNA 2K86A 3GLXA 1OMIA 1FSEA 1NHAA 2VOOA 4EM0B 1P4AA 1YW7A 2Z3YA 1W5TA 3LA7A 1BJAA 3SQNA 3R0AA 5LGTA 1G3SA 3ZN1A 2J5OA 2YX4A 3HRUA 5FO5A 2A07F 5L3CA 5D6EA 1W4MA 1FOKA 2VC0A 3R0JA 1BI0A 4ETSA 4NHJA 3SFZA 3JAMK 4H0EA 5FGMA 4L9JA 1Z91A 5JI6A 5HS9A 5F1RA 4EGZA 1YO5C 2ZXJA 1K78B 3TO6A 4LB5A 1UHWA 5ICEA 4L0YB 5K5RA 4KN4X 2Z9OA 3R61A 2Z99A 2ZCWA 4R1HA 3WE2A 2ETHA 1J7KA 4UHTA 2HKXA 3LAJA 3HRSA 2FQ3A 1O7LA 3BPVA 5LLQA 1B4AA 1GXPA 1KGSA 1XGNA 1J75A 1AWCA 5E18F 1P2FA 2UZKA 2XVCA 4KYWA 2MA3A 3SHFA 2LKPA 3GO5A 3F23A 5BMZA 1QO0D 2PMUA 4HYEA 2JTVA 3BDDA 3FMSA 2G7UA 1IXRC 3IRRA 4LLLA 1JHFA 3PFIA 2OQRA 5KVRA 3W6JB 3QU3A 1I1GA 2XKPA 2JRTA 5J8FA 4Q47A 3QAHA 2UXNA 2EJRA 5E17F 1I1SA 4UV9A 4OMZA 1LDJA 4LLNA 2L4AA 4HQMA 3E97A 2D45A 3HRTA 4Q48A 1XCBA 2DK8A 1WSUA 1SAXA 2XHKA 2A6HF 3BJOA 2HWVA 3I59B 3FZVA 1U78A 3CDHA 2Z33A 4WXCA 1TNSA 4IHTA 4E70A 3HOTA 1TQMA 1FY7A 2GAUA 3VFZA 2O3FA 3KETA 4U88A 3GF2A 5DD8A 3WTTC 4M72A 2XRNA 3BJ6A 4M71A 4Q5SF 2MH2A 3ZMVA 1Z05A 2FSWA 1B9MA 2KKOA 5ILVA 3WTWC 2LNBA 2YX7A 2DI3A 3FF5A 1YIOA 2PFBA 4KICA 3GX4X 2VE8A 2HKOA 3J81Z 1R23A 4Y15A 2ZJ2A 1TQIA 2IA1A 4P96A 4I0AA 3JSPA 1YW9A 3EQLF 1R1TA 4KIBA 1KU2A 4I0BA 3WTXC 2LF7A 2KJCA 3GFJA 2JPBA 1QPMA 1XN7A 3AAFA 1J9IA 3T0YA 3E6DA 4HF0A 2VBWA 1F1ZA 3GUDA 3GFMA 4BHPA 3S2WA 2K4BA 1BBYA 2FBIA 1DDNA 3KP3A 4KFCA 2A3SA 1ZLKA 2GA1A 1IXSB 3ELKA 4O3MA 4HZFA 1P4XA 2ELHA 2K7LA 4IHSA 1HW2A 3KP2A 3V4GA 1L3LA 3LSTA 1B6AA 2FBKA 2RV8A 1TBXA 1BC7C 1S7AA 4R8HA 4ZYEA 2RC4A 3MZYA 1CGPA 1S29A 2PI0A 4EJTA 3KEQA 3GEZA 2MH9A 3ISPA 4B09A 2FE3A 4CZZA 4LLGF 5D5VB 1WQ2A 5D5UB 3TO7A 2IP2A 1ZRCA 3KE2A 1MJ9A 4ZYDA 2V6CA 5LRSA 3GW2A 2RN7A 4HX8A 1CF7A 3FWEA 3L7WA 5HLIA 1DP7P 2DPDA 4MTDA 2FF4A 3BY6A 3SZTA 3K0LA 4HDVA 4WCGA 1VTNC 3SXYA 4LG0A 2E1NA 3VODA 1KQ0A 1MZBA 2XASA 1F5TA 5FD6A 4I2OA 1HKQA 1O7FA 2EWNA 1HXDA 2MLKA 3C1DA 4ESBA 1LB2A 2P8TA 2XUBA 2IA2A 5IT9Z 1SFXA 4UV8A 3WGHA 1IF1A 1IN7A 1R5GA 2QM3A 4BHBA 2FNPA 3RKYA 2X0LA 4HF2A 3WG9A 4WWCA 1KA8A 2CQKA 3B02A 3E6MA 5D4RA 3WTZA 1BI3A 4ZH4F 2BYVE 2ZFWA 2E7XA 2L4MA 1XDSA 2D2WA 3K2ZA 2ADUA 3GFIA 2JZYA 3IWFA 4WF2A 3TO9A 2NNNA 3IL2A 2O0YA 5DYMA 3DV8A 4HDUA 1IN5A 3C18A 5FFZA 2ACJA 4CDGA 2V79A 2B0LA 1I6XA 3H3UA 1J0RA 3WGIA 3MCZA 1XMAA 1QNTA 5TRDA 3LWFA 4IPAA 3ZMZA 4HF1A 4I01A 1A04A 4BQAA 4UXNA 3HHHA 3IKVA 3GFLA 4MGRA 2EA4A 2V1XA 1B1BA 5ILSA 2A6EF 5JR3A 5K5QA 3ROUA 3JTGA 1G4DA 3E3VA 4AWXB 4Y13A 2FMYA 3IHUA 2H6BA 1F4KA 3O3KA 3R60A 5EEGA 5DCMA 5HS7A 2LF8A 5E20A 1E17A 4ENJA 5FD5A 2L01A 1KYWA 3R4KA 4RAZA 1B9NA 4LD5A 2ZMEA 5K1YA 3V8JA 1FYKA 3M8FA 1IN4A 1WRJA 1X3UA 4EJWA 4UNOA 2OBPA 3M1EA 3MWMA 2XKOA 1S7OA 1LNWA 2IJLA 1KQ9A 1LQ1A 2WV0A 2STWA 2P7VB 2FMLA 3F22A 2WTEA 3R6SA 3HSEA 2HYFA 4B8XA 3MQ0A 3NQOA 2QYOA 1EH6A 1Z7UA 4M73A 4HX4A 3LA2A 1U5TA 4CICA 3RPUA 4OINF 4DNCA 3EDPA 1PUEE 1SFUA 4BH9A 5CVIA 1J59A 5D8LB 4RB2C 3TOAA 6PAXA 1DPRA 3RI4A 3ULQB 2V1DA 4EMSA 2EFWA 1REPC 2PN6A 3RYRA 2YU3A 5AIQA 2F5FA 3IKTA 1H9GA 2YSRA 3HSRA 3T8TA 1OYYA 1HQCA 5JVTA 2K02A 3HIFA 2L02A 3IC7A 3V7CA 5CJ9A 4OMYA 3QOPA 5HDGA 3FXRA 1RNLA 5DV5A 1V3FA 2VXZA 2OZ6A 3LQQA 2VOPA 3DFGA 2COMA 2MC3A 2ZNYA 5DCFA 1H9TA 1PDNC 1LEAA 4CGZA 3HOSA 1IN6A 3HTUA 3ZMUA 1HW1A 4XLNF 3T8RA 1ULYA 4U0VA 3TQNA 1XD7A 4ESJA 3K9TA 3WU1B 1U8RA 4UUVA 1Z1DA 1RUNA 2JPCA 3B73A 4PGGA 4OOIA 4KA4A 4I09A 3WE3A 5BPDA 1G3WA 1BI2A 3Q9VA 4HV5A 1ZRFA 3J80Z 4YFKF 3WTUC 2XAHA 2ZO4A 1GXQA 4L9TA 4HA8A 1XSXA 4EJVA 2PBIA 3E5XA 3QU6A 3HRMA 3I4PA 1HSJA 2GZWA 1CF7B 1IRFA 2A69F 1IAWA 3F6VA 2YPRA 4KMFA 2KIMA 3EUHA 1R58A 1UFMA 4A0XA 1O3SA 2HQRA 5EEHA 4P9FA 2EB7A 3JW4A 2Q8KA 2BBYA 2DBBA 3T5XA 1LDDA 1W7PD 5ERIA 3ABTA 3GYHX 2NYXA 4LG0B 4MQ9F 4UVAA 2XGXA 1KU3A 4HQEA 3KP4A 1R1UA 2QLZA 3KEOA 2QQAA 1D3YA 1ZYRF 2QBYB 4HW0A 2OU2A 2A61A 2P4WA 2XROA 4HAMA 2LSOA 1Y0UA 2P6SA 1UHMA 1K6OA 4AIHA 3J7AO 3DKWA 2DFIA 1QZYA 5LEJA 1G3TA 2M45A 1BI1A 3KP5A 2W24A 3V7SA 1ZGAA 3O2PE 3JTHA 1TLHB 4N9IA 1ON1A 4MQVA 3J81K 1FBQA 1LJ9A 2NNYA 1T6SA 1XB4A 1DUXC 2K27A 3OOPA 3RIRA 4IRHA 4RGRA 1Z6TA 2M5WA 4Z2YA 2R7FA 3GZ6A 1HBXG 3MZHA 3E5UA 1T39A 1ZH5A 5LEKA 1PP7U 1LEBA 1P92A 5CVVA 3D5LA 3DQVC 5CVRA 3F8CA 1YQAA 1Q1HA 3F8FA 4U7DA 2OA4A 4KMUX 4AD9A 2J5PA 2GIVA 4MTEA 2EFQA 3F8BA 1QBJA 2FXAA 2G7HA 4GXOA 1WKMA 3F3XA 2O61A 5JFRA 3HSFA 4I02A 4A2UA 3CJNA 1K79A 3PQKA 1R22A 3U2RA 5K5OA 3M9AA 4L0ZB 1XGOA 3ECHA 2GQQA 4BYYA 5DCMB 3FHZA 4EM2A 1HSTA 1SMYF 3E6CC 1E2XA 5TJJA 4G7HF 5D5XB 4WXHA 4HOBA 4D0PA 2ZNZA 1XDUA 4U0WA 3RPQA 4R79A 2IA0A 1T2KA 5F64A 4RB3C 1YS6A 2ZMEB 2CSOA 3I0TA 1YW8A 3WU0A 2NAZA 5HDNA 1MJBA 1EV7A 3ZMSA 3CUQA 4OIRF 1XCVA 4ZYHA 1QQIA 3K1MA 1FYLA 2D1VA 2QVOA 4N0BA 2MD5A 4FHTA 5FB2A 2VE9A 3VB2A 4GYIA 2YR2A 1ONVA 3DF8A 1U5TC 1FLIA 3QRFF 2GXGA 5IT9K 1J2XA 1U5TB 3FM5A 3NEUA 3MEXA 4A0YA 3I59A 2BE5F 2VT3A 2Y48A 3BOQA 1D5VA 2DQRA 2MLGA 2Q0OA 3FX3A 1KQ8A 4IXAA 2RKHA 2VN2A 3FM3A 2H6CA 2UXXA 1BC8C 1Z6RA 5ICFA 4HLYA 2FOKA 2HTSA 3L9FA 4M9SA 3REOA 1AOYA 2ZBKA 5A2QK 3CLOA 1QZZA 5ICGA 4CHUA 3H3ZA 4XLPF 5LHHA 4ZYGA 1YS7A 1R5HA 4PGHA 4A0ZA 5A2QZ 3WGGA 2IRFG 2HEOA 2Z5UA 1Z9CA 1FYMA 4GGGA 2QQBA 4Q4ZF 3L2CA 1FWZA 5DD4A 4AIKA 2DW4A 4ESFA 4BNCA 3QP6A 2FA5A 2HQNA 4JK1X 4CXFA 2ISZA 3U9GA 1XGMA 2IT0A 1D8JA 4KIGA 4A6EA 5AIPA 3RKWA 3C7JA 3SZPA 1R36A 3BWGA 1ZARA 2R3SA 2PMHA 2AS5F 2PG4A 1W7PA 2GA2A 2CO5A 2XAJA 3RJPA 5HVQC 4LJZF 5CVUA 4PCQA 1JHHA 3BZ6A 4G9YA 4KT5C 3FXUA 2W85A 2L3DA 2HGCA 2Y75A 4YG2F 1IW7F 4PDKA 3MFKA 1ODDA 4OIPF 1R7JA 3TDUC 1F9NA 1ZG3A 1XSDA 5H6RA 1YLFA 2EV5A 2DT5A 2FNAA 5DUKA 1T38A 1O3QA 1P4WA 3G3ZA 3KZZA 4L9NA 2M30A 2A68F 4MNUA 1SD6A 1KU7A 1OR7A 3WTSC 1SD7A 1FP2A 1ZAOA 2ESNA 4L5JA 1L0OC 1UCRA 1YG2A 1GVJA 4P5OA 2BGCA 4EVIA 4UVCA 2M1BA 1O3RA 4NQWA 4G7OF 2DAOA 3TDZC 1R00A 4RGUA 3KP7A 2QZ8A 1SD5A 2ESHA 3ZPLA 3F72A 2FBHA 2EV6A 2H09A 4A6DA 3CO6C 3L00A 3ERED 4HBLA 1MKMA 1C0WA 2L54A 2O6GE 5J6XA 4LFUA 3DXJF 4JQFA 5HLGA 4M9XA 1KU9A 3FMQA 4RB1A 4L9VA 1QGPA 2HOEA 1U6GA 4WK8F 5HS8A 1XSVA 3P7NA 2RVCA 2D1HA 1TNTA 5BPIA 4LB6B 2H94A 5D6FA 5D5WB 5LRRA 3T1BA 1R1VA 5L3DA 1RIOH 5FFXA 5E8GA 5E1XA 3C3WA 1BM9A 2W57A 1ZGJA 2EFPA 2TDXA 5L3EA 1JGSA 1EH7A 1IUYA 3JAMZ 2HDCA 2XAFA 4GO1A 5L3BA 4XBFA 2CG4A 2UWMA 2XAGA 2QQ9A 2QWWA 2IW5A 2XAQA 2RNJA 4I7HA 3G73A 2F2EA 2XIGA 1TW2A 3J80K 3K1PA 2P5LC 1K7AA 1DPUA 4OIQF 5ED4A 2EK5A 5E1WA 4NB5A 4ZZDA 4ENMA 1YFHA 2OZUA 2ZKZA 2V1UA 4IRGA 3CUQC 3BPXA 3U1DA 4XSZF 1MDMA 3ECOA 4PZJA 4ENKA 3KLOA 2EFOA 2DU9A 5IT3A 1EH8A 2M87A 3F21A 4MHGA 3I5UA 3WODF 3IWZA 3P9IA 1FNNA 1I5ZA 2EFNA 4L5IA 4CYDA 3CUQB 1BIAA 2VT2A 2CW0F 2F5DA 2HFHA 2VBYA 2FRHA 3ZN0A 3EYIA 2GWRA 3L09A 4A5MA 3N97A 4G8XA 1ZG1A 2RGVA 1G6NA 1LDKB 1JXSA 4KUMA 5LHGA 4RGXA 4F7ZA 4QLCU 5HOOA 1O3TA 5CLSA 2VBXA 3ZMTA 4BHCA 2VBZA 4YFXF 4GYGA 4G7ZF 5J8CA 1SD4A 1U2WA 3LQRA 3ABUA 1GHCA 2P5KA 2OQGA 1FC3A 4EJUA 4XSXF 2DQLA 3LA3A 1MJAA 1D8KA 2NRAC 2HS5A 3RKXA 2JT1A 1TW3A 4LK1F 4O5VA 3KFWX 1P6RA 3KP6A 1USSA 1HKTA 3RDIA 4M9ZA 2KIFA 3CUOA 3V8LA 5FLXK 2R7DA 3W6KB 3ZP5A 3VEPA 1J5YA 4S05A 1IRGA 1JE8A 2HYGD 4FT8A 4U0YA 2F5CA 5FLXZ 5ILUA 4M6XA 1TQPA 3GWZA 3I58A 2CGPA 4AIJA 4ASNA 3NRVA 3BP8A 1IXCA 2RQPA 4KDPA 2LDUA 3WTYC 4M74A 3KZYA 1FBSA 1OYWA 1SMTA 2VC1A 3VOEA 2VODA 2DPUA 5CVJA 4IJAA 1FPQA 2Y0MA 3I64A 4UVBA 2DK5A 2OD5A 1H0MA 1ZLJA 3QP5A 3HYIA 3OV8A 3DPTA 3P9CA 1ZN2A 2AXLA 5D8KB 2HTJA 2HZTA 3I71A 1K78A 4LGWA 4DQ2A 4EJOA 3CO7C 5KK1A 1W7PB 4RGSA 2PQ8A 3TOBA 2HR3A 2Q2EA 5ICCA 2EA2A 3EETA 2DO7A 1O57A 3RYPA 2VONA 1LVAA 2IVMA 4MEYF 1T98A 1W5SA 4OU0A 3TKYA 1MD0A 3MAJA 3HHGA 3F8MA 2CWEA 2DTRA 4YFNF 1SFEA 2F5EA 1BIBA 1BN5A 4EM1A 1KYZA 4U7BA 4LK0F 1ZREA 2WWYA 1T0FA 4IRIA 4BXUA 1WI9A 5LGUA 1OPCA 1S6LA 4XRFA 3M8EA 3V8KA 3GZ5A 5E1ZB 4WX9A 3I54A 2CFXA 4IVNA 4LMYA 1TTYA 1OKRA 4I98B 1USTA 4YIIA 2RDPA 3DPLC 4G6QA 2WC2A 3FXQA 1YYVA 4G6DA 3E6BA 4P9UA 5F6FA 2KRFA 4A12A 3ML6A 2P5VA 1OYIA 2M8EA 2ISYA 5H6QA 4EGYA 4FX0A 5L3FA 3JSOA 3E5QA 3H92A 2QBYA 1FZPB 3RTRA 4A5NA 3Q5FA 5HDKA 2A5YB 3DP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXD A;  4MEX F;  1I27 A;  4RS8 A;  5BQT A;  3WTV C;  2E1C A;  2O03 A;  5L3G A;  3M7G A;  1ZRD A;  2CYY A;  4M6Y A;  2O8X A;  3BRO A;  5D4S A;  4EQQ A;  1FX7 A;  3QPH A;  1G3Y A;  1ZHF A;  3CTA A;  4ZZL A;  3F8N A;  3HUG A;  4OIO F;  2STT A;  1S3J A;  5CYV A;  4L18 B;  3F6O A;  2E7W A;  4ON0 A;  2K4J A;  2PEX A;  3COA C;  4KN7 X;  5AON A;  1UB9 A;  3K1N A;  2C6Y A;  2BV6 A;  2XV4 S;  4HX7 A;  4K2E A;  5JHU A;  2GXB A;  3P9K A;  4RAY A;  1ZG5 A;  4IF4 A;  2BEO A;  3QPT A;  4QWQ A;  3V7R A;  4KNY A;  2OAZ A;  4TV7 A;  1B59 A;  3N4M A;  3IRQ A;  2MBF A;  1RUO A;  1STZ A;  3DEU A;  4EV0 A;  3FMR A;  3PQJ A;  4GCV A;  5BOX A;  2NS0 A;  1MDM B;  2EV0 A;  1U3E M;  4N9H A;  5LHI A;  2P6T A;  2G9W A;  3HTS B;  1ON2 A;  4HV6 A;  4RB0 A;  5DDG A;  3ZQ7 A;  1RI7 A;  4YIF A;  3GXO A;  1S8N A;  3LFK A;  4HLX A;  5DUI A;  4P55 A;  1XMK A;  2FEZ A;  2JSC A;  5HLH A;  3O6B B;  4AVP A;  3ZMD A;  1PP8 F;  1IZ1 A;  2IPQ X;  5E8I A;  4KIF A;  1BOA A;  4JBA A;  1FBU A;  3EYY A;  1XGS A;  4O6J A;  3I53 A;  1IN8 A;  1HKS A;  3BJA A;  4BAY A;  2W84 A;  3KCC A;  2H27 A;  3KLN A;  5DEQ A;  4G94 A;  1HW5 A;  2FU4 A;  5LGN A;  1YTY A;  1FT9 A;  4Y17 A;  1V4R A;  2QUF A;  1MGT A;  2QEN A;  5H20 A;  2PLY A;  2KJB A;  1RZ4 A;  5BS6 A;  2KIU A;  3D0S A;  1WWX A;  5LBQ A;  1FSH A;  2DLL A;  2PJP A;  3K69 A;  1FP1 D;  4S04 A;  2P7C B;  4FX4 A;  2W25 A;  3Q9S A;  3GVA A;  4ENN A;  2X4H A;  3LAP A;  2V9V A;  4CO8 A;  3TGN A;  2K86 A;  3GLX A;  1OMI A;  1FSE A;  1NHA A;  2VOO A;  4EM0 B;  1P4A A;  1YW7 A;  2Z3Y A;  1W5T A;  3LA7 A;  1BJA A;  3SQN A;  3R0A A;  5LGT A;  1G3S A;  3ZN1 A;  2J5O A;  2YX4 A;  3HRU A;  5FO5 A;  2A07 F;  5L3C A;  5D6E A;  1W4M A;  1FOK A;  2VC0 A;  3R0J A;  1BI0 A;  4ETS A;  4NHJ A;  3SFZ A;  3JAM K;  4H0E A;  5FGM A;  4L9J A;  1Z91 A;  5JI6 A;  5HS9 A;  5F1R A;  4EGZ A;  1YO5 C;  2ZXJ A;  1K78 B;  3TO6 A;  4LB5 A;  1UHW A;  5ICE A;  4L0Y B;  5K5R A;  4KN4 X;  2Z9O A;  3R61 A;  2Z99 A;  2ZCW A;  4R1H A;  3WE2 A;  2ETH A;  1J7K A;  4UHT A;  2HKX A;  3LAJ A;  3HRS A;  2FQ3 A;  1O7L A;  3BPV A;  5LLQ A;  1B4A A;  1GXP A;  1KGS A;  1XGN A;  1J75 A;  1AWC A;  5E18 F;  1P2F A;  2UZK A;  2XVC A;  4KYW A;  2MA3 A;  3SHF A;  2LKP A;  3GO5 A;  3F23 A;  5BMZ A;  1QO0 D;  2PMU A;  4HYE A;  2JTV A;  3BDD A;  3FMS A;  2G7U A;  1IXR C;  3IRR A;  4LLL A;  1JHF A;  3PFI A;  2OQR A;  5KVR A;  3W6J B;  3QU3 A;  1I1G A;  2XKP A;  2JRT A;  5J8F A;  4Q47 A;  3QAH A;  2UXN A;  2EJR A;  5E17 F;  1I1S A;  4UV9 A;  4OMZ A;  1LDJ A;  4LLN A;  2L4A A;  4HQM A;  3E97 A;  2D45 A;  3HRT A;  4Q48 A;  1XCB A;  2DK8 A;  1WSU A;  1SAX A;  2XHK A;  2A6H F;  3BJO A;  2HWV A;  3I59 B;  3FZV A;  1U78 A;  3CDH A;  2Z33 A;  4WXC A;  1TNS A;  4IHT A;  4E70 A;  3HOT A;  1TQM A;  1FY7 A;  2GAU A;  3VFZ A;  2O3F A;  3KET A;  4U88 A;  3GF2 A;  5DD8 A;  3WTT C;  4M72 A;  2XRN A;  3BJ6 A;  4M71 A;  4Q5S F;  2MH2 A;  3ZMV A;  1Z05 A;  2FSW A;  1B9M A;  2KKO A;  5ILV A;  3WTW C;  2LNB A;  2YX7 A;  2DI3 A;  3FF5 A;  1YIO A;  2PFB A;  4KIC A;  3GX4 X;  2VE8 A;  2HKO A;  3J81 Z;  1R23 A;  4Y15 A;  2ZJ2 A;  1TQI A;  2IA1 A;  4P96 A;  4I0A A;  3JSP A;  1YW9 A;  3EQL F;  1R1T A;  4KIB A;  1KU2 A;  4I0B A;  3WTX C;  2LF7 A;  2KJC A;  3GFJ A;  2JPB A;  1QPM A;  1XN7 A;  3AAF A;  1J9I A;  3T0Y A;  3E6D A;  4HF0 A;  2VBW A;  1F1Z A;  3GUD A;  3GFM A;  4BHP A;  3S2W A;  2K4B A;  1BBY A;  2FBI A;  1DDN A;  3KP3 A;  4KFC A;  2A3S A;  1ZLK A;  2GA1 A;  1IXS B;  3ELK A;  4O3M A;  4HZF A;  1P4X A;  2ELH A;  2K7L A;  4IHS A;  1HW2 A;  3KP2 A;  3V4G A;  1L3L A;  3LST A;  1B6A A;  2FBK A;  2RV8 A;  1TBX A;  1BC7 C;  1S7A A;  4R8H A;  4ZYE A;  2RC4 A;  3MZY A;  1CGP A;  1S29 A;  2PI0 A;  4EJT A;  3KEQ A;  3GEZ A;  2MH9 A;  3ISP A;  4B09 A;  2FE3 A;  4CZZ A;  4LLG F;  5D5V B;  1WQ2 A;  5D5U B;  3TO7 A;  2IP2 A;  1ZRC A;  3KE2 A;  1MJ9 A;  4ZYD A;  2V6C A;  5LRS A;  3GW2 A;  2RN7 A;  4HX8 A;  1CF7 A;  3FWE A;  3L7W A;  5HLI A;  1DP7 P;  2DPD A;  4MTD A;  2FF4 A;  3BY6 A;  3SZT A;  3K0L A;  4HDV A;  4WCG A;  1VTN C;  3SXY A;  4LG0 A;  2E1N A;  3VOD A;  1KQ0 A;  1MZB A;  2XAS A;  1F5T A;  5FD6 A;  4I2O A;  1HKQ A;  1O7F A;  2EWN A;  1HXD A;  2MLK A;  3C1D A;  4ESB A;  1LB2 A;  2P8T A;  2XUB A;  2IA2 A;  5IT9 Z;  1SFX A;  4UV8 A;  3WGH A;  1IF1 A;  1IN7 A;  1R5G A;  2QM3 A;  4BHB A;  2FNP A;  3RKY A;  2X0L A;  4HF2 A;  3WG9 A;  4WWC A;  1KA8 A;  2CQK A;  3B02 A;  3E6M A;  5D4R A;  3WTZ A;  1BI3 A;  4ZH4 F;  2BYV E;  2ZFW A;  2E7X A;  2L4M A;  1XDS A;  2D2W A;  3K2Z A;  2ADU A;  3GFI A;  2JZY A;  3IWF A;  4WF2 A;  3TO9 A;  2NNN A;  3IL2 A;  2O0Y A;  5DYM A;  3DV8 A;  4HDU A;  1IN5 A;  3C18 A;  5FFZ A;  2ACJ A;  4CDG A;  2V79 A;  2B0L A;  1I6X A;  3H3U A;  1J0R A;  3WGI A;  3MCZ A;  1XMA A;  1QNT A;  5TRD A;  3LWF A;  4IPA A;  3ZMZ A;  4HF1 A;  4I01 A;  1A04 A;  4BQA A;  4UXN A;  3HHH A;  3IKV A;  3GFL A;  4MGR A;  2EA4 A;  2V1X A;  1B1B A;  5ILS A;  2A6E F;  5JR3 A;  5K5Q A;  3ROU A;  3JTG A;  1G4D A;  3E3V A;  4AWX B;  4Y13 A;  2FMY A;  3IHU A;  2H6B A;  1F4K A;  3O3K A;  3R60 A;  5EEG A;  5DCM A;  5HS7 A;  2LF8 A;  5E20 A;  1E17 A;  4ENJ A;  5FD5 A;  2L01 A;  1KYW A;  3R4K A;  4RAZ A;  1B9N A;  4LD5 A;  2ZME A;  5K1Y A;  3V8J A;  1FYK A;  3M8F A;  1IN4 A;  1WRJ A;  1X3U A;  4EJW A;  4UNO A;  2OBP A;  3M1E A;  3MWM A;  2XKO A;  1S7O A;  1LNW A;  2IJL A;  1KQ9 A;  1LQ1 A;  2WV0 A;  2STW A;  2P7V B;  2FML A;  3F22 A;  2WTE A;  3R6S A;  3HSE A;  2HYF A;  4B8X A;  3MQ0 A;  3NQO A;  2QYO A;  1EH6 A;  1Z7U A;  4M73 A;  4HX4 A;  3LA2 A;  1U5T A;  4CIC A;  3RPU A;  4OIN F;  4DNC A;  3EDP A;  1PUE E;  1SFU A;  4BH9 A;  5CVI A;  1J59 A;  5D8L B;  4RB2 C;  3TOA A;  6PAX A;  1DPR A;  3RI4 A;  3ULQ B;  2V1D A;  4EMS A;  2EFW A;  1REP C;  2PN6 A;  3RYR A;  2YU3 A;  5AIQ A;  2F5F A;  3IKT A;  1H9G A;  2YSR A;  3HSR A;  3T8T A;  1OYY A;  1HQC A;  5JVT A;  2K02 A;  3HIF A;  2L02 A;  3IC7 A;  3V7C A;  5CJ9 A;  4OMY A;  3QOP A;  5HDG A;  3FXR A;  1RNL A;  5DV5 A;  1V3F A;  2VXZ A;  2OZ6 A;  3LQQ A;  2VOP A;  3DFG A;  2COM A;  2MC3 A;  2ZNY A;  5DCF A;  1H9T A;  1PDN C;  1LEA A;  4CGZ A;  3HOS A;  1IN6 A;  3HTU A;  3ZMU A;  1HW1 A;  4XLN F;  3T8R A;  1ULY A;  4U0V A;  3TQN A;  1XD7 A;  4ESJ A;  3K9T A;  3WU1 B;  1U8R A;  4UUV A;  1Z1D A;  1RUN A;  2JPC A;  3B73 A;  4PGG A;  4OOI A;  4KA4 A;  4I09 A;  3WE3 A;  5BPD A;  1G3W A;  1BI2 A;  3Q9V A;  4HV5 A;  1ZRF A;  3J80 Z;  4YFK F;  3WTU C;  2XAH A;  2ZO4 A;  1GXQ A;  4L9T A;  4HA8 A;  1XSX A;  4EJV A;  2PBI A;  3E5X A;  3QU6 A;  3HRM A;  3I4P A;  1HSJ A;  2GZW A;  1CF7 B;  1IRF A;  2A69 F;  1IAW A;  3F6V A;  2YPR A;  4KMF A;  2KIM A;  3EUH A;  1R58 A;  1UFM A;  4A0X A;  1O3S A;  2HQR A;  5EEH A;  4P9F A;  2EB7 A;  3JW4 A;  2Q8K A;  2BBY A;  2DBB A;  3T5X A;  1LDD A;  1W7P D;  5ERI A;  3ABT A;  3GYH X;  2NYX A;  4LG0 B;  4MQ9 F;  4UVA A;  2XGX A;  1KU3 A;  4HQE A;  3KP4 A;  1R1U A;  2QLZ A;  3KEO A;  2QQA A;  1D3Y A;  1ZYR F;  2QBY B;  4HW0 A;  2OU2 A;  2A61 A;  2P4W A;  2XRO A;  4HAM A;  2LSO A;  1Y0U A;  2P6S A;  1UHM A;  1K6O A;  4AIH A;  3J7A O;  3DKW A;  2DFI A;  1QZY A;  5LEJ A;  1G3T A;  2M45 A;  1BI1 A;  3KP5 A;  2W24 A;  3V7S A;  1ZGA A;  3O2P E;  3JTH A;  1TLH B;  4N9I A;  1ON1 A;  4MQV A;  3J81 K;  1FBQ A;  1LJ9 A;  2NNY A;  1T6S A;  1XB4 A;  1DUX C;  2K27 A;  3OOP A;  3RIR A;  4IRH A;  4RGR A;  1Z6T A;  2M5W A;  4Z2Y A;  2R7F A;  3GZ6 A;  1HBX G;  3MZH A;  3E5U A;  1T39 A;  1ZH5 A;  5LEK A;  1PP7 U;  1LEB A;  1P92 A;  5CVV A;  3D5L A;  3DQV C;  5CVR A;  3F8C A;  1YQA A;  1Q1H A;  3F8F A;  4U7D A;  2OA4 A;  4KMU X;  4AD9 A;  2J5P A;  2GIV A;  4MTE A;  2EFQ A;  3F8B A;  1QBJ A;  2FXA A;  2G7H A;  4GXO A;  1WKM A;  3F3X A;  2O61 A;  5JFR A;  3HSF A;  4I02 A;  4A2U A;  3CJN A;  1K79 A;  3PQK A;  1R22 A;  3U2R A;  5K5O A;  3M9A A;  4L0Z B;  1XGO A;  3ECH A;  2GQQ A;  4BYY A;  5DCM B;  3FHZ A;  4EM2 A;  1HST A;  1SMY F;  3E6C C;  1E2X A;  5TJJ A;  4G7H F;  5D5X B;  4WXH A;  4HOB A;  4D0P A;  2ZNZ A;  1XDU A;  4U0W A;  3RPQ A;  4R79 A;  2IA0 A;  1T2K A;  5F64 A;  4RB3 C;  1YS6 A;  2ZME B;  2CSO A;  3I0T A;  1YW8 A;  3WU0 A;  2NAZ A;  5HDN A;  1MJB A;  1EV7 A;  3ZMS A;  3CUQ A;  4OIR F;  1XCV A;  4ZYH A;  1QQI A;  3K1M A;  1FYL A;  2D1V A;  2QVO A;  4N0B A;  2MD5 A;  4FHT A;  5FB2 A;  2VE9 A;  3VB2 A;  4GYI A;  2YR2 A;  1ONV A;  3DF8 A;  1U5T C;  1FLI A;  3QRF F;  2GXG A;  5IT9 K;  1J2X A;  1U5T B;  3FM5 A;  3NEU A;  3MEX A;  4A0Y A;  3I59 A;  2BE5 F;  2VT3 A;  2Y48 A;  3BOQ A;  1D5V A;  2DQR A;  2MLG A;  2Q0O A;  3FX3 A;  1KQ8 A;  4IXA A;  2RKH A;  2VN2 A;  3FM3 A;  2H6C A;  2UXX A;  1BC8 C;  1Z6R A;  5ICF A;  4HLY A;  2FOK A;  2HTS A;  3L9F A;  4M9S A;  3REO A;  1AOY A;  2ZBK A;  5A2Q K;  3CLO A;  1QZZ A;  5ICG A;  4CHU A;  3H3Z A;  4XLP F;  5LHH A;  4ZYG A;  1YS7 A;  1R5H A;  4PGH A;  4A0Z A;  5A2Q Z;  3WGG A;  2IRF G;  2HEO A;  2Z5U A;  1Z9C A;  1FYM A;  4GGG A;  2QQB A;  4Q4Z F;  3L2C A;  1FWZ A;  5DD4 A;  4AIK A;  2DW4 A;  4ESF A;  4BNC A;  3QP6 A;  2FA5 A;  2HQN A;  4JK1 X;  4CXF A;  2ISZ A;  3U9G A;  1XGM A;  2IT0 A;  1D8J A;  4KIG A;  4A6E A;  5AIP A;  3RKW A;  3C7J A;  3SZP A;  1R36 A;  3BWG A;  1ZAR A;  2R3S A;  2PMH A;  2AS5 F;  2PG4 A;  1W7P A;  2GA2 A;  2CO5 A;  2XAJ A;  3RJP A;  5HVQ C;  4LJZ F;  5CVU A;  4PCQ A;  1JHH A;  3BZ6 A;  4G9Y A;  4KT5 C;  3FXU A;  2W85 A;  2L3D A;  2HGC A;  2Y75 A;  4YG2 F;  1IW7 F;  4PDK A;  3MFK A;  1ODD A;  4OIP F;  1R7J A;  3TDU C;  1F9N A;  1ZG3 A;  1XSD A;  5H6R A;  1YLF A;  2EV5 A;  2DT5 A;  2FNA A;  5DUK A;  1T38 A;  1O3Q A;  1P4W A;  3G3Z A;  3KZZ A;  4L9N A;  2M30 A;  2A68 F;  4MNU A;  1SD6 A;  1KU7 A;  1OR7 A;  3WTS C;  1SD7 A;  1FP2 A;  1ZAO A;  2ESN A;  4L5J A;  1L0O C;  1UCR A;  1YG2 A;  1GVJ A;  4P5O A;  2BGC A;  4EVI A;  4UVC A;  2M1B A;  1O3R A;  4NQW A;  4G7O F;  2DAO A;  3TDZ C;  1R00 A;  4RGU A;  3KP7 A;  2QZ8 A;  1SD5 A;  2ESH A;  3ZPL A;  3F72 A;  2FBH A;  2EV6 A;  2H09 A;  4A6D A;  3CO6 C;  3L00 A;  3ERE D;  4HBL A;  1MKM A;  1C0W A;  2L54 A;  2O6G E;  5J6X A;  4LFU A;  3DXJ F;  4JQF A;  5HLG A;  4M9X A;  1KU9 A;  3FMQ A;  4RB1 A;  4L9V A;  1QGP A;  2HOE A;  1U6G A;  4WK8 F;  5HS8 A;  1XSV A;  3P7N A;  2RVC A;  2D1H A;  1TNT A;  5BPI A;  4LB6 B;  2H94 A;  5D6F A;  5D5W B;  5LRR A;  3T1B A;  1R1V A;  5L3D A;  1RIO H;  5FFX A;  5E8G A;  5E1X A;  3C3W A;  1BM9 A;  2W57 A;  1ZGJ A;  2EFP A;  2TDX A;  5L3E A;  1JGS A;  1EH7 A;  1IUY A;  3JAM Z;  2HDC A;  2XAF A;  4GO1 A;  5L3B A;  4XBF A;  2CG4 A;  2UWM A;  2XAG A;  2QQ9 A;  2QWW A;  2IW5 A;  2XAQ A;  2RNJ A;  4I7H A;  3G73 A;  2F2E A;  2XIG A;  1TW2 A;  3J80 K;  3K1P A;  2P5L C;  1K7A A;  1DPU A;  4OIQ F;  5ED4 A;  2EK5 A;  5E1W A;  4NB5 A;  4ZZD A;  4ENM A;  1YFH A;  2OZU A;  2ZKZ A;  2V1U A;  4IRG A;  3CUQ C;  3BPX A;  3U1D A;  4XSZ F;  1MDM A;  3ECO A;  4PZJ A;  4ENK A;  3KLO A;  2EFO A;  2DU9 A;  5IT3 A;  1EH8 A;  2M87 A;  3F21 A;  4MHG A;  3I5U A;  3WOD F;  3IWZ A;  3P9I A;  1FNN A;  1I5Z A;  2EFN A;  4L5I A;  4CYD A;  3CUQ B;  1BIA A;  2VT2 A;  2CW0 F;  2F5D A;  2HFH A;  2VBY A;  2FRH A;  3ZN0 A;  3EYI A;  2GWR A;  3L09 A;  4A5M A;  3N97 A;  4G8X A;  1ZG1 A;  2RGV A;  1G6N A;  1LDK B;  1JXS A;  4KUM A;  5LHG A;  4RGX A;  4F7Z A;  4QLC U;  5HOO A;  1O3T A;  5CLS A;  2VBX A;  3ZMT A;  4BHC A;  2VBZ A;  4YFX F;  4GYG A;  4G7Z F;  5J8C A;  1SD4 A;  1U2W A;  3LQR A;  3ABU A;  1GHC A;  2P5K A;  2OQG A;  1FC3 A;  4EJU A;  4XSX F;  2DQL A;  3LA3 A;  1MJA A;  1D8K A;  2NRA C;  2HS5 A;  3RKX A;  2JT1 A;  1TW3 A;  4LK1 F;  4O5V A;  3KFW X;  1P6R A;  3KP6 A;  1USS A;  1HKT A;  3RDI A;  4M9Z A;  2KIF A;  3CUO A;  3V8L A;  5FLX K;  2R7D A;  3W6K B;  3ZP5 A;  3VEP A;  1J5Y A;  4S05 A;  1IRG A;  1JE8 A;  2HYG D;  4FT8 A;  4U0Y A;  2F5C A;  5FLX Z;  5ILU A;  4M6X A;  1TQP A;  3GWZ A;  3I58 A;  2CGP A;  4AIJ A;  4ASN A;  3NRV A;  3BP8 A;  1IXC A;  2RQP A;  4KDP A;  2LDU A;  3WTY C;  4M74 A;  3KZY A;  1FBS A;  1OYW A;  1SMT A;  2VC1 A;  3VOE A;  2VOD A;  2DPU A;  5CVJ A;  4IJA A;  1FPQ A;  2Y0M A;  3I64 A;  4UVB A;  2DK5 A;  2OD5 A;  1H0M A;  1ZLJ A;  3QP5 A;  3HYI A;  3OV8 A;  3DPT A;  3P9C A;  1ZN2 A;  2AXL A;  5D8K B;  2HTJ A;  2HZT A;  3I71 A;  1K78 A;  4LGW A;  4DQ2 A;  4EJO A;  3CO7 C;  5KK1 A;  1W7P B;  4RGS A;  2PQ8 A;  3TOB A;  2HR3 A;  2Q2E A;  5ICC A;  2EA2 A;  3EET A;  2DO7 A;  1O57 A;  3RYP A;  2VON A;  1LVA A;  2IVM A;  4MEY F;  1T98 A;  1W5S A;  4OU0 A;  3TKY A;  1MD0 A;  3MAJ A;  3HHG A;  3F8M A;  2CWE A;  2DTR A;  4YFN F;  1SFE A;  2F5E A;  1BIB A;  1BN5 A;  4EM1 A;  1KYZ A;  4U7B A;  4LK0 F;  1ZRE A;  2WWY A;  1T0F A;  4IRI A;  4BXU A;  1WI9 A;  5LGU A;  1OPC A;  1S6L A;  4XRF A;  3M8E A;  3V8K A;  3GZ5 A;  5E1Z B;  4WX9 A;  3I54 A;  2CFX A;  4IVN A;  4LMY A;  1TTY A;  1OKR A;  4I98 B;  1UST A;  4YII A;  2RDP A;  3DPL C;  4G6Q A;  2WC2 A;  3FXQ A;  1YYV A;  4G6D A;  3E6B A;  4P9U A;  5F6F A;  2KRF A;  4A12 A;  3ML6 A;  2P5V A;  1OYI A;  2M8E A;  2ISY A;  5H6Q A;  4EGY A;  4FX0 A;  5L3F A;  3JSO A;  3E5Q A;  3H92 A;  2QBY A;  1FZP B;  3RTR A;  4A5N A;  3Q5F A;  5HDK A;  2A5Y B;  3DP7 A; 
#chains in the Genus database with same CATH topology
 3JRH A;  4WXD A;  4MEX F;  2DT6 A;  1I27 A;  4A3B J;  4RS8 A;  2KIQ A;  2Y9Y A;  2M34 A;  5BQT A;  3M3Y J;  4B43 A;  2JUG A;  3WTV C;  4XLE A;  2E1C A;  2HYJ A;  2O03 A;  3ZQI A;  3IV5 A;  5L3G A;  3M7G A;  5E3L A;  4F3Q A;  1ZRD A;  2CYY A;  3K4M A;  4BQQ A;  3K4B A;  4M6Y A;  2O8X A;  1ZTR A;  3BR6 A;  1R71 A;  2R5Y A;  3M8J A;  3BRO A;  5D4S A;  4EQQ A;  2DOD A;  1FX7 A;  2NS8 A;  1D0Z A;  1D1A A;  3QPH A;  1G3Y A;  4PSW A;  1ZHF A;  3CTA A;  3DTI A;  2DA4 A;  4ZZL A;  3F8N A;  3S15 J;  3DBH B;  1PJR A;  3HUG A;  1IC8 A;  4OIO F;  1JKR C;  2STT A;  1S3J A;  5CYV A;  4L18 B;  2GLO A;  3K6G A;  2JJ7 A;  2E7W A;  3F6O A;  2K4J A;  4ON0 A;  1S72 I;  2CV2 A;  1T56 A;  2PEX A;  1MNM C;  3COA C;  4KN7 X;  1QZE A;  5AON A;  1UB9 A;  2VJJ A;  3ABM H;  3K1N A;  2C6Y A;  2BV6 A;  3VYU B;  2JK3 A;  2DJI A;  2XV4 S;  3TED A;  2M2E A;  4HX7 A;  4K2E A;  5JHU A;  5J47 A;  2GXB A;  1MSF C;  3P9K A;  2MC4 A;  5IYB J;  4RAY A;  3OYB A;  1ZG5 A;  2WY8 Q;  4IF4 A;  3EUK L;  3G1M A;  2BEO A;  2JQ7 A;  3JRI A;  2EZH A;  4ZYA A;  3BQY A;  3QPT A;  4QWQ A;  3V7R A;  4CCJ A;  3CMY A;  4A3E J;  4KNY A;  2OAZ A;  4TV7 A;  2X1C A;  1B59 A;  2L9R A;  3DEE A;  3N4M A;  2HOT A;  3IRQ A;  5EJC A;  3HOW J;  2MBF A;  2CUE A;  1SEU A;  2EBI A;  3LFU A;  3PM1 A;  1RUO A;  1STZ A;  3DEU A;  4EV0 A;  4B47 A;  1VQN I;  3K4K A;  1MSE C;  2OCE A;  5M5X J;  3FMR A;  3ZXS A;  3HXL A;  2LR8 A;  3PQJ A;  3J7Y J;  4GCV A;  1X4O A;  2E5Z A;  5BOX A;  4AC0 A;  3GTK J;  1QPI A;  1QVT A;  1SVO A;  2NS0 A;  1JUP A;  2CW7 A;  2ECC A;  3AL0 C;  1MDM B;  2EV0 A;  1U3E M;  4N9H A;  5LHI A;  2P6T A;  2G9W A;  4ZDL A;  3HTS B;  1ON2 A;  4HV6 A;  4RB0 A;  5DDG A;  3PNY A;  2VXD A;  3FXK A;  3ZQ7 A;  3K4N A;  1RI7 A;  4YIF A;  3GXO A;  4BUP A;  1S8N A;  3LFK A;  1KON A;  4HLX A;  5GP9 A;  4CUG A;  5DUI A;  3OSF A;  5M5W J;  4P55 A;  1XMK A;  2FEZ A;  3AL0 B;  2LLK A;  2JSC A;  5HLH A;  3JRE A;  3FIS A;  1ETQ A;  5FRM A;  4A3D J;  1RET A;  3CJT B;  2BXY A;  3O6B B;  4AVP A;  1Y8R B;  3ZMD A;  1PP8 F;  2B9S A;  1IZ1 A;  2IPQ X;  5E8I A;  2JRM A;  4KIF A;  1BOA A;  4JBA A;  1FBU A;  3EYY A;  1VQM I;  1XGS A;  4O6J A;  3I53 A;  1IN8 A;  4LIV A;  1HKS A;  2DN0 A;  3BJA A;  2GXA A;  4BAY A;  2W84 A;  3KCC A;  2H27 A;  4BY7 J;  2IGO A;  3KLN A;  5DEQ A;  1ETV A;  4G94 A;  1HW5 A;  2FU4 A;  5JLX A;  5LGN A;  4UUS A;  1YTY A;  4C9Y A;  2KQR A;  2TCT A;  2E19 A;  3ZCO A;  1FT9 A;  4Y17 A;  2B63 J;  1V4R A;  2QUF A;  4A3C J;  4XRS A;  1I39 A;  1E3H A;  1MGT A;  2L9V A;  2QEN A;  4M3E A;  5H20 A;  2PLY A;  1XPX A;  3M07 A;  2KJB A;  1JGG A;  1RZ4 A;  5BS6 A;  2KIU A;  2R93 J;  1NH3 A;  3D0S A;  1MMS A;  3NWS A;  1WWX A;  4C3J J;  4XLA A;  2DLL A;  5LBQ A;  1FSH A;  3FK7 A;  2PJP A;  3K69 A;  1U9O A;  4E7S A;  1FP1 D;  3BR1 A;  1R4M B;  4S04 A;  3A01 A;  1ZKG A;  2UUZ A;  2W82 A;  2P7C B;  3L2Q A;  4FX4 A;  3GTQ J;  3CCU I;  2JVH A;  2W25 A;  2XF6 A;  1VQL I;  3Q9S A;  3GVA A;  3PIP F;  3BG3 A;  5JVG F;  4ENN A;  2X4H A;  2ZJP F;  2V9K A;  3LAP A;  2ZB9 A;  2B7E A;  2F4I A;  2V9V A;  5FKO A;  1BW6 A;  3TGN A;  2K86 A;  3GLX A;  4CO8 A;  4EEF G;  1OMI A;  3OWT A;  2R7R A;  3SYT A;  1WHU A;  3A2K A;  1FSE A;  4XKB A;  1NHA A;  4DBQ A;  4XON A;  3SDB A;  3UR3 C;  2VOO A;  3OYJ A;  2O8K A;  5DTD A;  5IOY A;  4EM0 B;  1P4A A;  1YW7 A;  5H2F C;  3OYN A;  1WJC A;  2Z3Y A;  1W5T A;  2IAI A;  3LA7 A;  1HA8 A;  4Y7N J;  1BJA A;  3BG6 A;  1MBE A;  3SQN A;  3R0A A;  5LGT A;  2WV1 A;  1G3S A;  3ZN1 A;  2J5O A;  2YX4 A;  3HRU A;  5FO5 A;  5C3E J;  3OYK A;  2A07 F;  2MG4 A;  5L3C A;  3Q0U A;  5D6E A;  1W4M A;  3DBL B;  1WVR A;  1FOK A;  3S3M A;  2Z2S B;  2CS3 A;  2VC0 A;  4XRS G;  3JRA A;  3R0J A;  3RQI A;  1IG7 A;  2KZG A;  2ZFU A;  1BI0 A;  4ETS A;  1TT0 A;  3SFZ A;  5EGO A;  4NHJ A;  1ERD A;  3JAM K;  3H5N A;  4H0E A;  2XF5 A;  3P5J A;  5FGM A;  3TP3 A;  3HEF A;  4BBS J;  2NOJ B;  3I56 I;  4L9J A;  1Z91 A;  5JI6 A;  1LFU P;  1MMG A;  3FHN A;  3FXM A;  4I99 C;  5HS9 A;  2ECB A;  5F1R A;  4QSH A;  4BY1 J;  1TP4 A;  4EGZ A;  4CSW A;  1YO5 C;  2ZXJ A;  4FAS D;  2W48 A;  2MYS A;  1K78 B;  1B8I A;  3TO6 A;  2CUZ A;  1XS9 A;  5F0H A;  4LB5 A;  3S14 J;  3HKZ A;  2M4K A;  1UHW A;  5ICE A;  4Y52 J;  4L0Y B;  5K5R A;  4KN4 X;  2R7V A;  2Z9O A;  3R61 A;  3FKI J;  2KIS A;  2Z99 A;  2ICW G;  2ZCW A;  4R1H A;  2W00 A;  2Q2E B;  4X1E A;  1UG0 A;  1T0F C;  2DCE A;  3WE2 A;  2EPF A;  2ETH A;  1J7K A;  4UHT A;  2HKX A;  1A31 A;  3LAJ A;  3HRS A;  2LTP A;  2FQ3 A;  2X9D A;  3C2G A;  3QWL A;  5F0C A;  5KAI C;  3WHC A;  1O7L A;  5BNG A;  4DW6 A;  5FRN A;  3BPV A;  4C2U A;  1FIP A;  1FOY A;  5GPA A;  4ZDP A;  4JP0 A;  3U1K A;  2VB6 A;  2HI3 A;  4XLF A;  2OV7 A;  3VPR A;  2CQN A;  1B4A A;  5LLQ A;  5J1R A;  5DS9 A;  1GXP A;  1KGS A;  3SDG A;  1XGN A;  1APL C;  1J75 A;  1AWC A;  5E18 F;  1P2F A;  2UZK A;  2XVC A;  4KYW A;  2MA3 A;  4E7Z A;  3ERM A;  2BVM A;  2V9P A;  2L7K A;  2CUF A;  3SHF A;  2ELJ A;  2LKP A;  2JSP A;  3C2H A;  3GO5 A;  3F23 A;  5BMZ A;  1QO0 D;  2PMU A;  4HYE A;  4A69 C;  2JTV A;  3BDD A;  3HL2 A;  3FMS A;  3CCR I;  2G7U A;  3CCJ I;  1IXR C;  1OLT A;  4CCK A;  3IRR A;  4PK4 A;  4LLL A;  1JHF A;  3PFI A;  3L2V A;  2LKX A;  2OQR A;  5KVR A;  3W6J B;  3QU3 A;  1T95 A;  4CCN A;  1I1G A;  2BW3 A;  2XKP A;  2AO9 A;  2JRT A;  5J8F A;  4IOA F;  4Q47 A;  1QA6 A;  3QAH A;  2UXN A;  2VJ4 A;  1JKQ C;  2O9L A;  2EJR A;  2HXI A;  3CCY A;  1R6R A;  2K5C A;  5E17 F;  1YHQ I;  2CRG A;  2V1N A;  2JA7 J;  1I1S A;  1MH3 A;  4UV9 A;  1J09 A;  4OMZ A;  2OTJ I;  4KJZ A;  1S5L C;  1F43 A;  1LDJ A;  4E7K A;  4LLN A;  2L4A A;  4HQM A;  4RA2 A;  1EA3 A;  3VYT B;  3E97 A;  2D45 A;  3FBN B;  3HRT A;  4Q48 A;  4V2F A;  5DM6 F;  1OCT C;  2XGE A;  1XCB A;  2DK8 A;  1WSU A;  4F55 A;  1SAX A;  2XHK A;  4HNT A;  2M0C A;  2A6H F;  1JI8 A;  2XSD C;  2DMN A;  3BJO A;  2HWV A;  3H5A A;  3I59 B;  3FZV A;  2W4S A;  1E3O C;  1U78 A;  2ZJQ F;  3CDH A;  2RQQ A;  4WXC A;  2Z33 A;  1IGN A;  1XG1 A;  1X1P A;  3HC7 A;  1TNS A;  3HG9 A;  4IHT A;  4E70 A;  3HOT A;  4J01 A;  4ZDO A;  1TQM A;  1FY7 A;  2GAU A;  4Z6Y A;  1V55 H;  3QYF A;  3VFZ A;  1HDD C;  2O3F A;  3TP0 A;  3KET A;  4CYC A;  4U88 A;  1V5F A;  2V26 A;  1U8B A;  3GF2 A;  4DYC A;  5DD8 A;  3WTT C;  1MND A;  3QYB A;  4M72 A;  1Y6I A;  2XRN A;  4GDF A;  3BJ6 A;  1OCZ H;  4M71 A;  3PNT A;  4BQO A;  4Q5S F;  1IUF A;  2MH2 A;  4PUS A;  3ZMV A;  4JYK A;  1Z05 A;  2R5Y B;  2JA8 J;  2FSW A;  3VYS B;  2PMZ N;  1R49 A;  1B9M A;  5B1A H;  2KKO A;  5ILV A;  2VPL A;  4BL0 B;  1JKO C;  2CW8 A;  3HUG B;  2LNB A;  2X6O A;  2YX7 A;  3WTW C;  3CES A;  2R7S A;  4GRI A;  2DI3 A;  3FF5 A;  1JTX A;  3KIO A;  1Z77 A;  2BY1 A;  1YIO A;  3B6C A;  2Y0S N;  2PFB A;  5LD2 C;  4KIC A;  3GX4 X;  2VE8 A;  3E7L A;  1VQ4 I;  4II2 A;  2HKO A;  3J81 Z;  1UAA A;  1R23 A;  2OPT A;  4Y15 A;  2ZJ2 A;  1WFX A;  3KX2 A;  1QHH D;  4A3G J;  3AKZ A;  2E35 A;  1TQI A;  2IA1 A;  4P96 A;  4I0A A;  3JSP A;  1YW9 A;  1MNE A;  3EQL F;  1Y1W J;  1R1T A;  4HG2 A;  4AU7 A;  2LBF A;  5IP6 A;  4KIB A;  1X2M A;  1KU2 A;  3WU2 C;  4LG3 A;  4PSX A;  2VKD A;  4I0B A;  2COB A;  3CCQ I;  3WTX C;  2LF7 A;  3EUA A;  2KJC A;  2WB1 A;  3DCF A;  3ONQ A;  3GFJ A;  4UUT A;  3H3V K;  2JPB A;  1QPM A;  1XN7 A;  5GAE J;  1FEX A;  2P0W A;  3AAF A;  4BXF A;  2X48 A;  2VPR A;  2XPV A;  1J9I A;  5EZG A;  3E6D A;  4HF0 A;  3T0Y A;  2VBW A;  4XKW A;  1F1Z A;  3GUD A;  3GFM A;  4BHP A;  3S2W A;  2K4B A;  4F92 B;  1X3W B;  1BBY A;  2E71 A;  2FOW A;  2FBI A;  1DDN A;  3HGG A;  3BG7 A;  3KP3 A;  4KFC A;  1K4S A;  2A3S A;  3LSI A;  3GTM J;  3OS0 A;  1JT0 A;  2KRH A;  2R7X A;  1FOX A;  1MBH A;  1ZLK A;  2GA1 A;  1IXS B;  3ELK A;  4JOM A;  3TL4 X;  4F93 B;  4O3M A;  4HZF A;  1P4X A;  2ELH A;  2K7L A;  4IHS A;  1HW2 A;  1WPK A;  4HST A;  3KP2 A;  4C2M J;  5FKK A;  3V4G A;  2JUC A;  1L3L A;  3LST A;  3FIW A;  1B6A A;  4DZJ A;  2FBK A;  2RV8 A;  1K61 A;  3JRB A;  1TBX A;  1XC5 A;  1BC7 C;  1S7A A;  1RES A;  4R8H A;  2RC4 A;  4ZYE A;  1QU3 A;  3MZY A;  4M3G A;  2DA5 A;  1S29 A;  2NOG A;  1CGP A;  2PI0 A;  4EJT A;  3KEQ A;  2CU7 A;  4XR6 A;  2IS2 A;  3GEZ A;  1MH4 A;  2MH9 A;  3ISP A;  4B09 A;  1SVM A;  2FE3 A;  4CZZ A;  2JMW A;  4LLG F;  5D5V B;  2GIZ A;  3FKJ A;  3S1N J;  1WQ2 A;  5D5U B;  3TO7 A;  1B72 A;  4BBR J;  5KCM A;  2IP2 A;  1ZRC A;  3KE2 A;  1MJ9 A;  1ACI A;  4ZYD A;  2V6C A;  4A3I J;  1PVE A;  5LRS A;  3GW2 A;  2RN7 A;  4HX8 A;  1CF7 A;  3FWE A;  4UUS B;  3L7W A;  1SAU A;  4YEL A;  3LSJ A;  5HLI A;  1DP7 P;  2LY1 A;  4I76 A;  1I50 J;  1V5E A;  2DPD A;  3H0D A;  4MTD A;  1LFB A;  2FF4 A;  3ZQF A;  2QEX I;  2QSF X;  3ESW B;  3L2R A;  1OCR H;  1WGX A;  3I4N J;  3BY6 A;  3SZT A;  2LRD A;  3K0L A;  4HDV A;  3HJE A;  5TIS C;  4WCG A;  4KT6 A;  1VTN C;  3PUB A;  2DYS H;  2TRT A;  3SXY A;  4LG0 A;  4BE2 A;  2E1N A;  2KLO A;  3VOD A;  1KQ0 A;  1MMA A;  1MZB A;  2XAS A;  4IKF A;  1EKE A;  3GME A;  2IS1 A;  1F5T A;  1DGR M;  5FD6 A;  1G2H A;  4HRI A;  4XKC A;  1UEL B;  2L7F P;  4I2O A;  3K10 A;  4F91 B;  4MLO A;  1HKQ A;  1O7F A;  2BHY A;  2EWN A;  3J7Z I;  1HXD A;  2MLK A;  3C1D A;  3IH4 A;  4ESB A;  1LB2 A;  1AA7 A;  2MW8 A;  5GAG J;  3MD2 A;  2HQ5 A;  2WAQ N;  2ELK A;  2P8T A;  2XUB A;  2IA2 A;  5EZH A;  1PUF A;  5IT9 Z;  1SFX A;  4IOC F;  1JJ6 C;  4UV8 A;  3WGH A;  1IF1 A;  1IN7 A;  1R5G A;  2QM3 A;  4BHB A;  2FNP A;  3SEZ A;  3RKY A;  2X0L A;  5K7Z A;  2O7O A;  4HF2 A;  3S1M J;  1EJ9 A;  4S0H B;  3WG9 A;  4WWC A;  1KA8 A;  4RM2 A;  1LE8 B;  2CQK A;  3G71 I;  3WHB A;  3B02 A;  4J00 A;  3O8H A;  3BTC A;  3AG3 H;  3E6M A;  5D4R A;  3W6V A;  3WTZ A;  1BI3 A;  4NC6 A;  4ZH4 F;  1AKH A;  2BYV E;  2ZFW A;  2E7X A;  2L4M A;  3S2H J;  1XDS A;  2D2W A;  3K2Z A;  2AQF A;  2ADU A;  3GFI A;  2JZY A;  5EGO B;  4QPO A;  4XOT A;  2Y31 A;  3IWF A;  4WF2 A;  3TO9 A;  2NNN A;  3IL2 A;  2X1E A;  1K6Y A;  3HPH A;  4B4C A;  1Z3Y A;  2O0Y A;  2VI6 A;  4KIS A;  1D1B A;  4V2G A;  5DYM A;  3DV8 A;  4HDU A;  2CJJ A;  2LMD A;  1IN5 A;  3C18 A;  1N78 A;  5FFZ A;  2ACJ A;  4CDG A;  1B8I B;  2IGK A;  2V79 A;  2QSH X;  2B0L A;  4IX7 A;  2CV1 A;  1I6X A;  1Y1V J;  5F1J A;  3H3U A;  1J0R A;  3WGI A;  3CCE I;  1A5J A;  1N25 A;  1ZEL A;  3N05 A;  1ETW A;  2QGU A;  3MCZ A;  1XMA A;  1QNT A;  5TRD A;  3LWF A;  3EPZ A;  4IPA A;  3ZMZ A;  2QKM B;  3HOV J;  3S8P A;  3CF5 F;  4I01 A;  4NNJ A;  4HF1 A;  2X85 A;  1A04 A;  1RPW A;  4BQA A;  4UXN A;  2BXZ A;  3QPS A;  3HHH A;  3A02 A;  3BTI A;  2QCO A;  3IKV A;  4BJ6 C;  3GFL A;  4RBO A;  4MGR A;  2EA4 A;  2V1X A;  2JVG A;  2LRE A;  4G12 A;  1B1B A;  4P1W A;  5ILS A;  2A6E F;  5JR3 A;  5K5Q A;  3ROU A;  3JTG A;  2H8R A;  4CCO A;  1G4D A;  5CQE A;  1NK3 P;  4BS9 A;  4AYB N;  3E3V A;  2AXT C;  1OQY A;  2F48 A;  4PFO A;  4AWX B;  2L9N A;  4Y13 A;  2FMY A;  1TWC J;  3IHU A;  2H6B A;  1F4K A;  2V6E A;  3O3K A;  1EF4 A;  1Y56 A;  3R60 A;  1FJL A;  5EEG A;  2M7B A;  5DCM A;  5HS7 A;  3FXL A;  3H0G J;  4RAG A;  1MMN A;  2LF8 A;  2BW3 B;  1I3A A;  5E20 A;  3HOU J;  1E17 A;  4ENJ A;  5LFA A;  5FD5 A;  1WH5 A;  2L01 A;  3CCL I;  1KYW A;  2KMU A;  3ZQQ A;  3R4K A;  4RAZ A;  1B9N A;  4LD5 A;  2ZME A;  5K1Y A;  3V8J A;  2MAB A;  1FYK A;  5IY5 H;  3M8F A;  4C3H J;  5KNL A;  3BZK A;  5HNH A;  1IN4 A;  1WRJ A;  5JHF A;  1X3U A;  4EJW A;  1JKP C;  4UNO A;  2AQE A;  2OBP A;  4ZC3 A;  5IP7 J;  1LPQ A;  4FE4 A;  2R7Z J;  2PX9 A;  3M1E A;  3MWM A;  2XKO A;  2VL8 A;  1S7O A;  1LNW A;  3H1C A;  2IJL A;  3OIO A;  4FET A;  1KQ9 A;  1T8I A;  2L9S A;  1X2N A;  2L7Z A;  2LVS A;  3DTK A;  2VQG A;  1OIS A;  3MMY B;  3OY9 A;  1LQ1 A;  2WV0 A;  3VSL A;  2LK2 A;  2STW A;  1YI2 I;  2L5Q A;  2P7V B;  2FML A;  4A3F J;  1RKW A;  3S93 A;  3MZ8 A;  3F22 A;  1IDZ A;  2WTE A;  3R6S A;  1X3Z B;  3CQZ J;  2HPI A;  3HSE A;  3S1R J;  4CYC B;  4IHW A;  2HYF A;  4B8X A;  3MQ0 A;  3NQO A;  3CC7 I;  1WI3 A;  2QYO A;  1EH6 A;  1Z7U A;  4M73 A;  4HX4 A;  3LA2 A;  4HEA 2;  1U5T A;  4CIC A;  3G6E I;  1IRX A;  2DOE A;  3DKY A;  3RPU A;  4OIN F;  4DNC A;  3OYM A;  3A1Y A;  3EDP A;  2X6X A;  1PUE E;  1SFU A;  4XN0 A;  4BH9 A;  5CVI A;  1J59 A;  5D8L B;  4RB2 C;  4BXX J;  4NDL A;  3TOA A;  1DPR A;  2RRE A;  6PAX A;  2EZK A;  2IGM A;  3E1S A;  3PIO F;  3RI4 A;  2W7N A;  3ULQ B;  2YUS A;  4HSR A;  3W2A A;  2V1D A;  4EMS A;  2EFW A;  3VWB A;  1REP C;  1YRN A;  4Y4R A;  2PN6 A;  3RYR A;  3F9K A;  2F4O B;  2YU3 A;  2ZXH A;  3CC2 I;  5AIQ A;  3SZG A;  3AG1 H;  2F5F A;  5B5E C;  2VIX A;  3IKT A;  1H9G A;  2YSR A;  3PNV A;  2K9L A;  4OAZ A;  2LBF B;  3HSR A;  3T8T A;  1OYY A;  1IRZ A;  1JT6 A;  1GV5 A;  4J19 A;  1HQC A;  5JVT A;  5FRO A;  4RM3 A;  2VKV A;  4MFD A;  2K02 A;  3MKZ A;  3HIF A;  2L02 A;  1FTZ A;  3IC7 A;  1X1D A;  2DMU A;  3V7C A;  5CJ9 A;  4OMY A;  2BY2 A;  4D9J A;  1YIT I;  3QOP A;  5HDG A;  5KHD A;  3FXR A;  1V5G A;  4GFB A;  1D0X A;  1RNL A;  5DV5 A;  1V3F A;  2VXZ A;  2OZ6 A;  3L2U A;  3LQQ A;  2VOP A;  3DFG A;  2COM A;  1IJW C;  2MC3 A;  2BVL A;  2ZNY A;  5DCF A;  5IPA A;  1H9T A;  1E0E A;  1PDN C;  3GCM A;  4BU2 A;  1VQP I;  2BY3 A;  1LEA A;  4CGZ A;  3OYL A;  3HOS A;  2IS6 A;  1IN6 A;  3HTU A;  1AHD P;  3ZMU A;  1HW1 A;  4A3K J;  4XLN F;  1D1C A;  3IH3 A;  3T8R A;  1BJZ A;  1ULY A;  4U0V A;  3TQN A;  3NAU A;  1XD7 A;  2HDW A;  3K9T A;  3WU1 B;  4ESJ A;  1U8R A;  4UUV A;  1Z1D A;  4DYQ A;  1RUN A;  5FLV A;  2KZV A;  1DQU A;  3HOX J;  4XLH A;  2JPC A;  5DM7 F;  2DJN A;  4NBQ A;  3B73 A;  4PGG A;  2DMT A;  2E36 A;  4OOI A;  4KA4 A;  2WBM A;  4I09 A;  2YU9 J;  2DFF A;  1N75 A;  3WE3 A;  5BPD A;  3OYC A;  3A03 A;  2R4G A;  1G3W A;  3JRG A;  1BI2 A;  3Q9V A;  2D5V A;  4HV5 A;  1ZRF A;  3J80 Z;  1WH7 A;  4YFK F;  2RNG A;  3WTU C;  2XAH A;  1CQT A;  2ZO4 A;  2W1O A;  1GXQ A;  3LOC A;  4L9T A;  4HA8 A;  1VQK I;  1XSX A;  2XPU A;  1B72 B;  4EJV A;  3CLQ A;  2HDD A;  2PBI A;  2JA5 J;  3E5X A;  5M5Y J;  3QU6 A;  3DWL E;  4FCY A;  3JR9 A;  3KYC B;  2QA4 I;  3HRM A;  3I4P A;  5TGT A;  1HSJ A;  5E3O A;  3VSK A;  2GZW A;  1CF7 B;  3F0C A;  1IRF A;  2A69 F;  1DP3 A;  1IAW A;  2I8D A;  2WAE A;  4CZC A;  3F6V A;  2YPR A;  3D5S C;  3K4C A;  2KIM A;  4KMF A;  3EUH A;  1R58 A;  1UFM A;  4H4K C;  4A0X A;  1SFK A;  3ZQC A;  1O3S A;  2HQR A;  1LKX A;  2ID3 A;  5EEH A;  1P7J A;  4P9F A;  2NVY J;  2EB7 A;  1KZH A;  4DJA A;  3JW4 A;  1GDT A;  2Q8K A;  2BBY A;  2DBB A;  2H1L A;  4QPQ A;  1LDD A;  3T5X A;  3V42 A;  5F27 A;  1W7P D;  5ERI A;  1D0Y A;  4AVZ A;  3ABT A;  4PJJ A;  2DOF A;  3GYH X;  5EG0 A;  1TC3 C;  4XMY A;  2NYX A;  3KEY A;  4MQ9 F;  4LG0 B;  4UVA A;  1ZK8 A;  2XGX A;  1KU3 A;  4HQE A;  3KP4 A;  1R1U A;  1GV2 A;  2QLZ A;  3KEO A;  4II3 A;  2QQA A;  4Y33 A;  1D3Y A;  1MBG A;  1ZYR F;  1NG6 A;  2QBY B;  4HW0 A;  2R7T A;  2OU2 A;  3CMM A;  2A61 A;  1GUU A;  2P4W A;  2XRO A;  4HAM A;  3OYE A;  2LSO A;  4JX4 A;  1Y0U A;  2P6S A;  2DFE A;  3DLA A;  1PUF B;  1UHM A;  1K6O A;  3KZI C;  2FUG 2;  4AIH A;  3J7A O;  4D5F A;  3DKW A;  2DFI A;  3LMM A;  1ZGW A;  4EAT A;  1QZY A;  1RKT A;  3HPG A;  3MVP A;  1IDY A;  1GT0 C;  2OC6 A;  3GLL A;  2XRL A;  5LEJ A;  1G3T A;  1Z21 A;  4XOR A;  2IS4 A;  2M0M A;  3ABL H;  2M45 A;  1BI1 A;  1OCO H;  1XMX A;  3KP5 A;  2LP0 A;  2W24 A;  4HNU A;  3V7S A;  2LOO A;  2DXI A;  3S17 J;  1ZGA A;  3O2P E;  1ITY A;  3JTH A;  1NK2 P;  4IZZ A;  3H36 A;  5IYC J;  1IV6 A;  1TLH B;  2P81 A;  2ZSI B;  1AKH B;  4N9I A;  4XQF A;  1ON1 A;  3HOZ J;  1YOV B;  5CQG A;  2HOS A;  4MQV A;  3J81 K;  1FBQ A;  3G2B A;  1LJ9 A;  2NNY A;  1T6S A;  1T33 A;  2X6Y A;  1SC7 A;  1XB4 A;  1DUX C;  2IEK A;  2K27 A;  3OOP A;  3Q3S A;  3RIR A;  4YIR X;  2CV0 A;  2EQR A;  4IRH A;  1OCP A;  4RGR A;  1Z6T A;  2M5W A;  3DLL F;  2WA0 A;  2F4M B;  4BDY A;  4Z2Y A;  2R7F A;  3K4L A;  4X0G A;  3GZ6 A;  1W36 D;  1HBX G;  3MZH A;  2A05 A;  3RPU D;  3E5U A;  1A36 A;  4DBR A;  3QQA A;  5HOD A;  1T39 A;  1ZH5 A;  5LEK A;  2EZL A;  1PP7 U;  1LEB A;  1P92 A;  1Z67 A;  5CVV A;  3D5L A;  3GTO J;  3DQV C;  5K7H A;  2DT7 B;  3F8C A;  5CVR A;  1YQA A;  4KIT B;  1Q1H A;  3F8F A;  1ETX A;  1F36 A;  1VND A;  1K4T A;  2DMQ A;  3FK6 A;  5M3F J;  4C3I J;  4HNV A;  1VQ8 I;  2VUM J;  4FE7 A;  3K2A A;  4DGW B;  4U7D A;  1R4N B;  1V54 H;  4MO7 A;  4C2T A;  2QSG X;  2OA4 A;  3M1C A;  5J4V A;  4NUB A;  4KMU X;  1TWF J;  4AD9 A;  2J5P A;  2GIV A;  3I3L A;  3TW7 A;  5EF6 A;  4MTE A;  2EFQ A;  2Z16 A;  3F8B A;  1QBJ A;  2FXA A;  1X4P A;  2FJ1 A;  2G7H A;  4XRM A;  4GXO A;  1WKM A;  4XKV A;  1VQ7 I;  3F3X A;  1A6Q A;  1HC8 A;  3CCM I;  3IAM 2;  2O61 A;  5JFR A;  4AM3 A;  3HSF A;  3DEW A;  2XB0 X;  2MFZ A;  4B48 A;  4I02 A;  4A2U A;  3GTG J;  3CJN A;  1WJB A;  1UJ8 A;  1YX5 A;  3PQK A;  3ZGK A;  1K79 A;  1R22 A;  3U2R A;  2DTZ A;  3M9A A;  1GVD A;  3LSK A;  3VYR B;  4XM3 A;  5GAH J;  5K5O A;  2R7W A;  4L0Z B;  4RLF A;  2ZME C;  4N4O B;  1XGO A;  1X1A A;  3ECH A;  2GQQ A;  4BYY A;  5DCM B;  4BE1 A;  3FHZ A;  4EM2 A;  1LUJ B;  1HST A;  1SMY F;  3E6C C;  3U21 A;  2JA6 J;  3ABK H;  4E7H A;  1E2X A;  2H1K A;  5TJJ A;  4G7H F;  1TT5 B;  5D5X B;  4WXH A;  3X2Q H;  4E7J A;  3GTP J;  4HOB A;  4D0P A;  1JTY A;  2ZNZ A;  4NC8 A;  1TWG J;  3OYI A;  1XDU A;  4U0W A;  3RPQ A;  4R79 A;  3QPL A;  2HXO A;  2IA0 A;  1T2K A;  5F64 A;  4RB3 C;  1JJ8 C;  1YS6 A;  2ZME B;  1ETO A;  2CSO A;  3PFY A;  2ZC2 A;  4ZTF A;  3I0T A;  1ZR2 A;  2E2J J;  1POG A;  1YW8 A;  3WU0 A;  2NS7 A;  2NAZ A;  5HDN A;  2VJ5 A;  4D5C A;  1MJB A;  1EV7 A;  3ASN H;  2HPM A;  3ZMS A;  4W1U A;  1FOW A;  3CUQ A;  1XCV A;  4OIR F;  5C4J J;  3DTE A;  1H88 C;  4DZP A;  4ZYH A;  4RLQ A;  2FD5 A;  3BLY A;  1JUM A;  2OTL I;  1QQI A;  3WG7 H;  3K1M A;  2KFD A;  1FYL A;  2KP6 A;  2D1V A;  2QVO A;  4N0B A;  2DDB A;  2MD5 A;  3LSG A;  4FHT A;  5FB2 A;  2VE9 A;  1HOM A;  3VB2 A;  4GYI A;  2YR2 A;  5M3M J;  1ONV A;  5HNF A;  4BJ5 C;  3DF8 A;  3HB9 A;  3A01 B;  1X1B A;  1U5T C;  2BOL A;  1MMD A;  1FLI A;  3PO3 J;  3QRF F;  2I5U A;  3RSN A;  2XPW A;  2OCC H;  2IXS A;  2GXG A;  2LYC A;  3OIP A;  5IT9 K;  3A4C A;  4RDU A;  4IHY A;  3I9V 2;  3ZQG A;  2X1D A;  1J2X A;  1U5T B;  4LIT A;  3BQZ A;  4XNF A;  3FM5 A;  1Y0N A;  2KT0 A;  3NEU A;  3MEX A;  4A0Y A;  2E2I J;  3I59 A;  2BE5 F;  3OR2 C;  1HDP A;  4X6A J;  2VT3 A;  2PMZ A;  4ABZ A;  5E3N A;  2Y48 A;  3BOQ A;  1T08 B;  1D5V A;  2DQR A;  2MLG A;  3BR2 A;  2Q0O A;  3FX3 A;  2PJR A;  3BC8 A;  3DKX A;  1KQ8 A;  4IXA A;  2RKH A;  2VN2 A;  3FM3 A;  2QQ8 A;  3UNG C;  3ZOB A;  2Y0S A;  2H6C A;  1QHG A;  2UXX A;  2WAF A;  3ZQL A;  1Z6R A;  1BC8 C;  1YRN B;  1A35 A;  5ICF A;  4HLY A;  1WJF A;  2FOK A;  5J4Y A;  4PJL A;  2HTS A;  3HZJ A;  3L9F A;  3GTL J;  4M9S A;  3M4O J;  5F0F A;  3REO A;  1AOY A;  2ZBK A;  1UG2 A;  3G1O A;  5A2Q K;  3CLO A;  1QZZ A;  5ICG A;  1N77 A;  4CHU A;  3H3Z A;  4XLP F;  5LHH A;  4ZYG A;  2Z1D A;  4XID A;  1YS7 A;  1NG7 A;  3OMY A;  1R5H A;  3S2D J;  4PGH A;  4A0Z A;  5A2Q Z;  3WGG A;  4IQJ A;  5CPR B;  1OCC H;  2IRF G;  5GTH C;  5EDN A;  2HEO A;  2Z5U A;  1Z9C A;  5B1B H;  3BT9 A;  4GGG A;  1FYM A;  2QQB A;  2GOM A;  4Q4Z F;  3L2C A;  1FWZ A;  5DD4 A;  5K7F A;  4AIK A;  2DW4 A;  2EIJ H;  3OOU A;  1X19 A;  2E5N A;  3IH2 A;  4ESF A;  3H5R A;  2EIN H;  4BNC A;  3DU6 A;  1VF9 A;  1I6H J;  3LSP A;  3H35 A;  3QP6 A;  2FA5 A;  2HQN A;  2M7A A;  1LFP A;  1VFC A;  2CH0 A;  4JK1 X;  4CXF A;  2ISZ A;  3U9G A;  4L5E A;  1FMV A;  2CUJ A;  5HLT A;  4ZTJ A;  2DA2 A;  2K85 A;  3CP8 A;  1XGM A;  5C44 J;  2IT0 A;  1D8J A;  4KIG A;  2VAS A;  1WJE A;  2Y30 A;  3BG5 A;  9ANT A;  5IYD J;  3SEQ A;  4A6E A;  2FQ4 A;  5AIP A;  3DBR B;  5FKN A;  4W97 A;  3RKW A;  3K7A J;  4MIM A;  1WZ2 A;  1ORK A;  3C7J A;  3SZP A;  1R36 A;  4QIW N;  3BWG A;  1ZAR A;  2R3S A;  3HDD A;  4BE0 A;  1Z0X A;  3HKZ N;  2E34 A;  2LC2 A;  2PMH A;  2AS5 F;  2A6T A;  2DDA A;  2PG4 A;  4M3D A;  1W7P A;  2GA2 A;  2ID6 A;  2CO5 A;  4BEH A;  5F04 A;  2XAJ A;  1Z3X A;  3RJP A;  5HVQ C;  3EUH C;  2CQX A;  2KL4 A;  4LJZ F;  2O5R A;  2M4G A;  2OF7 A;  3PSF A;  5CVU A;  3I55 I;  1JHH A;  3BZ6 A;  4G9Y A;  4KT5 C;  4PCQ A;  1OFC X;  3FXU A;  3H9Q A;  2W85 A;  2HU9 A;  5E79 C;  2R7O A;  5IP9 J;  2LY2 A;  3BR3 A;  2L3D A;  2HGC A;  1UZC A;  3BZC A;  2Y75 A;  3TW6 A;  1IW7 F;  4YG2 F;  1MBF A;  2FX0 A;  4PDK A;  3MFK A;  4A93 J;  1ODD A;  4OIP F;  1R7J A;  3TDU C;  3ZQH A;  1F9N A;  3W3C A;  1ZG3 A;  1XSD A;  2M8G X;  5H6R A;  1YLF A;  2EV5 A;  3C2B A;  1DU6 A;  2DT5 A;  3JCU C;  3PJR A;  4IHV A;  1M1E B;  4XLC A;  2NXN B;  4D1Q A;  5EG0 B;  2G0E A;  2FNA A;  5DUK A;  1T38 A;  1O3Q A;  1P4W A;  3G3Z A;  2HOA A;  3KZZ A;  4L9N A;  1IV8 A;  2JWT A;  5J3L A;  2M30 A;  2A68 F;  4MNU A;  3L1P A;  2LH9 A;  1SD6 A;  5JLW A;  1KU7 A;  1BR4 A;  5KAF C;  3MKY B;  1OR7 A;  3WTS C;  4AID A;  1SD7 A;  1UMQ A;  1FP2 A;  2XB5 A;  1ZAO A;  2ESN A;  4HPQ A;  2VLA A;  4B44 A;  4L5J A;  2WAQ A;  4BAC A;  4XIC A;  1MW7 A;  1L0O C;  2KHM A;  2DA3 A;  3OS1 A;  2XF7 A;  1UCR A;  4XOP A;  3OIQ A;  1YG2 A;  1QRY A;  1YJ9 I;  2DYR H;  1WJ5 A;  3ASO H;  1GVJ A;  4P5O A;  2K9Q A;  3TMO A;  1RR7 A;  4CH7 A;  3ZR8 X;  2BGC A;  4EVI A;  4UVC A;  1BR2 A;  2M1B A;  1I3Q J;  1O3R A;  2IBD A;  4NQW A;  4PFP A;  4G7O F;  2DAO A;  3TDZ C;  4JX6 A;  4NC7 A;  2R5Z A;  1R00 A;  4RGU A;  1GLN A;  3KP7 A;  1HF0 A;  2QZ8 A;  5E3M A;  1SD5 A;  2ESH A;  3Q0W A;  5J1U A;  3AG4 H;  3ZPL A;  3F72 A;  2FBH A;  1MBJ A;  2EV6 A;  2H09 A;  2VQH A;  3CP2 A;  4IQ4 A;  3BR0 A;  4A6D A;  3L00 A;  3CO6 C;  4CA0 A;  4A3J J;  3ERE D;  1RC9 A;  4HBL A;  1MKM A;  3GBG A;  1C0W A;  2RAE A;  2L54 A;  5B66 C;  1TL8 A;  2O6G E;  4DYR A;  2XGD A;  1BR1 A;  4AUX A;  2R0Q C;  2NVT J;  5J6X A;  2HZD A;  4LFU A;  3DXJ F;  4JQF A;  3GZN B;  3FDY A;  5HLG A;  2L2O A;  4M9X A;  1KU9 A;  3FMQ A;  4RB1 A;  2XAU A;  4L9V A;  4ZJZ A;  1LE8 A;  1QGP A;  2HOE A;  1VI0 A;  1U6G A;  4WK8 F;  5HS8 A;  1XSV A;  3GTJ J;  4IO9 F;  3UKG A;  5FKL A;  2OJE D;  2RVC A;  3P7N A;  2D1H A;  1BW5 A;  1TNT A;  5BPI A;  4LB6 B;  2H94 A;  2DOA A;  5D6F A;  1ZR4 A;  2KDO A;  3CF2 A;  4YEJ A;  2IGN A;  2L7M P;  5D5W B;  4BGD A;  2K9S A;  4FQG A;  5LRR A;  3A0H C;  3T1B A;  1JUS A;  1R1V A;  3OL3 A;  5L3D A;  3S32 A;  1RIO H;  5FFX A;  2GOX B;  4JX5 A;  5E8G A;  2VQL A;  1HLV A;  5E1X A;  3C3W A;  4V19 K;  1BM9 A;  2W57 A;  1ZGJ A;  3IP4 B;  2EFP A;  2K9N A;  2LY9 A;  2TDX A;  5L3E A;  1JGS A;  2BY0 A;  1EH7 A;  1IUY A;  3JAM Z;  3CDI A;  2HDC A;  2XAF A;  4GO1 A;  3MKW B;  5L3B A;  1RRJ A;  3H9J A;  2VQC A;  4LOC A;  1VQ5 I;  2LFB A;  4XBF A;  2CG4 A;  3RQ4 A;  1VQO I;  2UWM A;  1SFO J;  4C30 A;  2R7U A;  2XAG A;  2QF7 A;  2QQ9 A;  4XN3 A;  2QWW A;  2IW5 A;  2XAQ A;  2RNJ A;  4I7H A;  3G73 A;  2WB1 N;  3TBI A;  1SAN A;  2VKE A;  3PL8 A;  4AYB A;  1W1W E;  2DA7 A;  2F2E A;  5EYR A;  3HOY J;  2L0K A;  2XIG A;  1TW2 A;  1P7I A;  1A6I A;  3W2V A;  3J80 K;  1QVU A;  3VDX A;  3CJR B;  3HBL A;  2X51 A;  3K1P A;  2Y9Z A;  2P5L C;  1K7A A;  1BL0 A;  2EZI A;  1DPU A;  4OIQ F;  2ZXW H;  5ED4 A;  3CCV I;  2EK5 A;  3CME I;  1W0T A;  2K3P A;  5E1W A;  3OSG A;  4NB5 A;  4ZZD A;  3KYD B;  4BJT A;  4ENM A;  2XC7 A;  2OZU A;  2ZKZ A;  1YFH A;  3I4M J;  1WJD A;  2V1U A;  4IRG A;  4QTR A;  3CUQ C;  3W2W A;  3BPX A;  3U1D A;  5IOZ A;  4XSZ F;  4M6V A;  3E0J B;  1MDM A;  1DGW Y;  3ECO A;  3OS2 A;  3NAR A;  1Y8Q B;  4PZJ A;  4ENK A;  1TZL A;  3KLO A;  1U9N A;  1E3P A;  2EFO A;  3G4S I;  2DU9 A;  5IT3 A;  1EH8 A;  1WCM J;  3BTJ A;  2M87 A;  3F21 A;  4MHG A;  3I5U A;  3WOD F;  1MBK A;  3IWZ A;  3P9I A;  1FNN A;  5GAD J;  1FIA A;  1I5Z A;  2EFN A;  4L5I A;  2DFH A;  3H9G A;  3OL4 A;  4CYD A;  3CUQ B;  1TWA J;  1BIA A;  3BTL A;  2VT2 A;  1S9H A;  2CW0 F;  2F5D A;  2HFH A;  2VBY A;  3DPU A;  2FRH A;  1BOB A;  3ZN0 A;  3S3N A;  1DU0 A;  1O4X A;  2HVR A;  3EYI A;  2GWR A;  4A3L J;  3L09 A;  2Q1Z B;  5FJ8 J;  4F52 A;  4A5M A;  2HVS A;  3N97 A;  4G8X A;  2XSJ C;  4N4N B;  1ZG1 A;  2RGV A;  2ZSH B;  1G6N A;  1LDK B;  3HM5 A;  4E6K G;  1JXS A;  4KUM A;  2F5V A;  5LHG A;  4PJN A;  3Q0V A;  2BZT A;  4RGX A;  4F7Z A;  3PUF A;  4QLC U;  5HOO A;  3A0B C;  2JN6 A;  1O3T A;  3S1Q J;  5CLS A;  4XL9 A;  2VBX A;  3ZMT A;  3SFI A;  1W5C C;  2H8W A;  2KPM A;  5B3S H;  3CC4 I;  3K4J A;  4BHC A;  3OYA A;  1BA5 A;  3AG2 H;  2CQQ A;  2VBZ A;  3CMA I;  4BQN A;  2R92 J;  2ZXI A;  3HGY A;  2M9H A;  4YFX F;  4BDZ A;  4GYG A;  4G7Z F;  5J8C A;  3S3O A;  2MD0 A;  1SD4 A;  1U2W A;  1UHS A;  3LQR A;  4MFE A;  2F6C A;  1RR8 C;  4I6Z A;  3ABU A;  4UB8 C;  1VQ6 I;  4BKX A;  1GHC A;  2P5K A;  2OQG A;  2K3F A;  4IL6 C;  1FC3 A;  2K40 A;  4EJU A;  1ETK A;  1Q1V A;  4XSX F;  2DQL A;  3LA3 A;  4E7L A;  1MJA A;  2XGC A;  1H8A C;  2GM4 A;  1D8K A;  2PJR B;  1K83 J;  2NVU B;  2NRA C;  2HS5 A;  3IUO A;  3RKX A;  2JT1 A;  2KRC A;  1R5I D;  1ZQ3 P;  1TW3 A;  4LK1 F;  4O5V A;  1G59 A;  3KFW X;  1P6R A;  4B3A A;  3K70 D;  3LNQ A;  3KP6 A;  1USS A;  3CDL A;  1WJA A;  1HKT A;  3B6A A;  3RDI A;  5GPC A;  4M9Z A;  3SJM A;  2KIF A;  4UB6 C;  2QKL B;  4LIU A;  3CUO A;  3V8L A;  2E1O A;  2R7D A;  5FLX K;  3W6K B;  4DOZ A;  3ZP5 A;  3VEP A;  5FLM J;  1VZ0 A;  1J5Y A;  4S05 A;  1AU7 A;  1IRG A;  3CJQ B;  2HYG D;  1JE8 A;  2NVX J;  1P9Q C;  4FT8 A;  4U0Y A;  2F5C A;  5FLX Z;  5ILU A;  4M6X A;  1IO2 A;  2K9M A;  3NWT A;  1TQP A;  3PSI A;  2X6W A;  3JRD A;  3D1N I;  3GWZ A;  3I58 A;  1FTT A;  2CGP A;  2E1M C;  1U0J A;  4AIJ A;  4YRV A;  1XTA A;  4OAY A;  2V4J C;  4ASN A;  3RZD J;  3NRV A;  3BP8 A;  1IXC A;  2RQP A;  2ZJR F;  4G6T B;  4KDP A;  2LDU A;  3J7A Y;  3WTY C;  4M74 A;  4M3F A;  3CD6 I;  3KZY A;  2CQ7 A;  3OR1 C;  2KDZ A;  1XX5 A;  1VQ9 I;  1FBS A;  2CFO A;  1OYW A;  1SMT A;  2VC1 A;  3VOE A;  2VOD A;  4CCM A;  3BCA A;  3OYG A;  2DPU A;  3PO2 J;  5CVJ A;  3KYL A;  4B1R A;  3MN2 A;  4IJA A;  3LL7 A;  1FPQ A;  2Y0M A;  3I64 A;  4RAF A;  1YIJ I;  3S16 J;  2N8G A;  4UVB A;  2DK5 A;  2OD5 A;  2E1M B;  1H0M A;  2WY7 Q;  1ZLJ A;  1HCR A;  3QP5 A;  4FTH A;  3HYI A;  3OV8 A;  3DPT A;  4PJM A;  3P9C A;  1ZN2 A;  2AXL A;  5D8K B;  2HTJ A;  2HZT A;  3JRC A;  2NVQ J;  4U87 A;  5J1Y A;  2EIK H;  3I71 A;  1K78 A;  4LGW A;  4M3B A;  5J40 A;  3G1L A;  4IHX A;  3MKL A;  4FIS A;  2Y69 H;  3CCS I;  4DQ2 A;  2LD5 A;  4EJO A;  1ETY A;  4IEJ A;  3CO7 C;  5KK1 A;  2V7F A;  2LG4 A;  1W7P B;  4RGS A;  3AFH A;  4BEH B;  2PQ8 A;  3BG9 A;  3TOB A;  2DA1 A;  2HR3 A;  2VKH A;  2DMP A;  2Y2Z A;  2Q2E A;  3RKQ A;  5ICC A;  2EA2 A;  2EH3 A;  3EET A;  3L2W A;  2DO7 A;  1NTC A;  4XK4 A;  1O57 A;  3RYP A;  2VON A;  1LVA A;  2IVM A;  4MEY F;  1R9T J;  2UV1 A;  3FXJ A;  1T98 A;  1W5S A;  4OU0 A;  3CZ6 A;  5F08 A;  3TKY A;  1MD0 A;  4CCL A;  3MAJ A;  3HHG A;  2EIL H;  2CWE A;  3F8M A;  2DTR A;  4YFN F;  1SFE A;  1W0U A;  2F5E A;  1BIB A;  1BN5 A;  4EM1 A;  1KYZ A;  3BR5 A;  2HNH A;  2ME0 A;  2MGQ A;  4U7B A;  4Y3O A;  3JRF A;  4LK0 F;  1H89 C;  1ZRE A;  2WWY A;  1Z7L A;  1T0F A;  1S7E A;  4ANJ A;  1YJN I;  4IRI A;  4BXU A;  3LSM A;  1OR7 C;  4RMN A;  4UY8 I;  1WI9 A;  5LGU A;  4D7M A;  1OPC A;  4PJ0 C;  2HQA A;  1S6L A;  3D5R C;  3M8E A;  4XRF A;  3V8K A;  3K70 C;  2BHZ A;  4E4H A;  1OJL A;  1Y39 A;  3GZ5 A;  3QOD A;  3O8G A;  5E1Z B;  4B3X A;  2I10 A;  5GTI C;  2AHQ A;  2LKS A;  3I54 A;  2CFX A;  4IVN A;  4WX9 A;  4LMY A;  1FMW A;  1YE9 A;  5C4X J;  3FXO A;  5CKT A;  1TTY A;  5FKM A;  1OKR A;  3FBI B;  3OYH A;  4I98 B;  1UST A;  1W36 C;  4YII A;  2RDP A;  3DPL C;  4A3M J;  1YX3 A;  4G6Q A;  2WC2 A;  4OWR B;  3OYD A;  2HVQ A;  2GBY A;  3QOE A;  3RZO J;  4DIQ A;  3BCB A;  3FXQ A;  1PYV A;  1SVL A;  1YYV A;  2OUM A;  1TWH J;  2E2H J;  2WAD A;  4G6D A;  3E6B A;  4P9U A;  2XDV A;  5F6F A;  2KRF A;  4A12 A;  3OYF A;  4ITV A;  3ML6 A;  2P5V A;  1OYI A;  2EIM H;  3DU5 A;  2M8E A;  2ISY A;  5H6Q A;  2MSY A;  2VJI A;  4EGY A;  4D7N A;  3IAS 2;  1LVK A;  4NQW B;  2DA6 A;  4FX0 A;  5L3F A;  3JSO A;  3E5Q A;  2ME6 A;  3H92 A;  5EEA A;  2R5Z B;  1X58 A;  2CMP A;  2R7Q A;  2M3A A;  2JA2 A;  3ZRG A;  2QBY A;  3LSH A;  1FZP B;  3RTR A;  4A5N A;  3Q5F A;  2YS9 A;  1X1C A;  1YJW I;  5HDK A;  3RCO A;  1ENH A;  1MIJ A;  3QYE A;  1G8X A;  2A5Y B;  3LSR A;  2E60 A;  2A5W A;  3KPH A;  4E7I A;  1D5Y A;  3DP7 A; 
#chains in the Genus database with same CATH homology
 4WXD A;  4MEX F;  1I27 A;  4RS8 A;  5BQT A;  3WTV C;  2E1C A;  2O03 A;  5L3G A;  3M7G A;  1ZRD A;  2CYY A;  4M6Y A;  2O8X A;  3BRO A;  5D4S A;  4EQQ A;  1FX7 A;  3QPH A;  1G3Y A;  1ZHF A;  3CTA A;  4ZZL A;  3F8N A;  3HUG A;  4OIO F;  2STT A;  1S3J A;  5CYV A;  4L18 B;  3F6O A;  2E7W A;  4ON0 A;  2K4J A;  2PEX A;  3COA C;  4KN7 X;  5AON A;  1UB9 A;  3K1N A;  2C6Y A;  2BV6 A;  2XV4 S;  4HX7 A;  4K2E A;  5JHU A;  2GXB A;  3P9K A;  4RAY A;  1ZG5 A;  4IF4 A;  2BEO A;  3QPT A;  4QWQ A;  3V7R A;  4KNY A;  2OAZ A;  4TV7 A;  1B59 A;  3N4M A;  3IRQ A;  2MBF A;  1RUO A;  1STZ A;  3DEU A;  4EV0 A;  3FMR A;  3PQJ A;  4GCV A;  5BOX A;  2NS0 A;  1MDM B;  2EV0 A;  1U3E M;  4N9H A;  5LHI A;  2P6T A;  2G9W A;  3HTS B;  1ON2 A;  4HV6 A;  4RB0 A;  5DDG A;  3ZQ7 A;  1RI7 A;  4YIF A;  3GXO A;  1S8N A;  3LFK A;  4HLX A;  5DUI A;  4P55 A;  1XMK A;  2FEZ A;  2JSC A;  5HLH A;  3O6B B;  4AVP A;  3ZMD A;  1PP8 F;  1IZ1 A;  2IPQ X;  5E8I A;  4KIF A;  1BOA A;  4JBA A;  1FBU A;  3EYY A;  1XGS A;  4O6J A;  3I53 A;  1IN8 A;  1HKS A;  3BJA A;  4BAY A;  2W84 A;  3KCC A;  2H27 A;  3KLN A;  5DEQ A;  4G94 A;  1HW5 A;  2FU4 A;  5LGN A;  1YTY A;  1FT9 A;  4Y17 A;  1V4R A;  2QUF A;  1MGT A;  2QEN A;  5H20 A;  2PLY A;  2KJB A;  1RZ4 A;  5BS6 A;  2KIU A;  3D0S A;  1WWX A;  5LBQ A;  1FSH A;  2DLL A;  2PJP A;  3K69 A;  1FP1 D;  4S04 A;  2P7C B;  4FX4 A;  2W25 A;  3Q9S A;  3GVA A;  4ENN A;  2X4H A;  3LAP A;  2V9V A;  4CO8 A;  3TGN A;  2K86 A;  3GLX A;  1OMI A;  1FSE A;  1NHA A;  2VOO A;  4EM0 B;  1P4A A;  1YW7 A;  2Z3Y A;  1W5T A;  3LA7 A;  1BJA A;  3SQN A;  3R0A A;  5LGT A;  1G3S A;  3ZN1 A;  2J5O A;  2YX4 A;  3HRU A;  5FO5 A;  2A07 F;  5L3C A;  5D6E A;  1W4M A;  1FOK A;  2VC0 A;  3R0J A;  1BI0 A;  4ETS A;  4NHJ A;  3SFZ A;  3JAM K;  4H0E A;  5FGM A;  4L9J A;  1Z91 A;  5JI6 A;  5HS9 A;  5F1R A;  4EGZ A;  1YO5 C;  2ZXJ A;  1K78 B;  3TO6 A;  4LB5 A;  1UHW A;  5ICE A;  4L0Y B;  5K5R A;  4KN4 X;  2Z9O A;  3R61 A;  2Z99 A;  2ZCW A;  4R1H A;  3WE2 A;  2ETH A;  1J7K A;  4UHT A;  2HKX A;  3LAJ A;  3HRS A;  2FQ3 A;  1O7L A;  3BPV A;  5LLQ A;  1B4A A;  1GXP A;  1KGS A;  1XGN A;  1J75 A;  1AWC A;  5E18 F;  1P2F A;  2UZK A;  2XVC A;  4KYW A;  2MA3 A;  3SHF A;  2LKP A;  3GO5 A;  3F23 A;  5BMZ A;  1QO0 D;  2PMU A;  4HYE A;  2JTV A;  3BDD A;  3FMS A;  2G7U A;  1IXR C;  3IRR A;  4LLL A;  1JHF A;  3PFI A;  2OQR A;  5KVR A;  3W6J B;  3QU3 A;  1I1G A;  2XKP A;  2JRT A;  5J8F A;  4Q47 A;  3QAH A;  2UXN A;  2EJR A;  5E17 F;  1I1S A;  4UV9 A;  4OMZ A;  1LDJ A;  4LLN A;  2L4A A;  4HQM A;  3E97 A;  2D45 A;  3HRT A;  4Q48 A;  1XCB A;  2DK8 A;  1WSU A;  1SAX A;  2XHK A;  2A6H F;  3BJO A;  2HWV A;  3I59 B;  3FZV A;  1U78 A;  3CDH A;  2Z33 A;  4WXC A;  1TNS A;  4IHT A;  4E70 A;  3HOT A;  1TQM A;  1FY7 A;  2GAU A;  3VFZ A;  2O3F A;  3KET A;  4U88 A;  3GF2 A;  5DD8 A;  3WTT C;  4M72 A;  2XRN A;  3BJ6 A;  4M71 A;  4Q5S F;  2MH2 A;  3ZMV A;  1Z05 A;  2FSW A;  1B9M A;  2KKO A;  5ILV A;  3WTW C;  2LNB A;  2YX7 A;  2DI3 A;  3FF5 A;  1YIO A;  2PFB A;  4KIC A;  3GX4 X;  2VE8 A;  2HKO A;  3J81 Z;  1R23 A;  4Y15 A;  2ZJ2 A;  1TQI A;  2IA1 A;  4P96 A;  4I0A A;  3JSP A;  1YW9 A;  3EQL F;  1R1T A;  4KIB A;  1KU2 A;  4I0B A;  3WTX C;  2LF7 A;  2KJC A;  3GFJ A;  2JPB A;  1QPM A;  1XN7 A;  3AAF A;  1J9I A;  3T0Y A;  3E6D A;  4HF0 A;  2VBW A;  1F1Z A;  3GUD A;  3GFM A;  4BHP A;  3S2W A;  2K4B A;  1BBY A;  2FBI A;  1DDN A;  3KP3 A;  4KFC A;  2A3S A;  1ZLK A;  2GA1 A;  1IXS B;  3ELK A;  4O3M A;  4HZF A;  1P4X A;  2ELH A;  2K7L A;  4IHS A;  1HW2 A;  3KP2 A;  3V4G A;  1L3L A;  3LST A;  1B6A A;  2FBK A;  2RV8 A;  1TBX A;  1BC7 C;  1S7A A;  4R8H A;  4ZYE A;  2RC4 A;  3MZY A;  1CGP A;  1S29 A;  2PI0 A;  4EJT A;  3KEQ A;  3GEZ A;  2MH9 A;  3ISP A;  4B09 A;  2FE3 A;  4CZZ A;  4LLG F;  5D5V B;  1WQ2 A;  5D5U B;  3TO7 A;  2IP2 A;  1ZRC A;  3KE2 A;  1MJ9 A;  4ZYD A;  2V6C A;  5LRS A;  3GW2 A;  2RN7 A;  4HX8 A;  1CF7 A;  3FWE A;  3L7W A;  5HLI A;  1DP7 P;  2DPD A;  4MTD A;  2FF4 A;  3BY6 A;  3SZT A;  3K0L A;  4HDV A;  4WCG A;  1VTN C;  3SXY A;  4LG0 A;  2E1N A;  3VOD A;  1KQ0 A;  1MZB A;  2XAS A;  1F5T A;  5FD6 A;  4I2O A;  1HKQ A;  1O7F A;  2EWN A;  1HXD A;  2MLK A;  3C1D A;  4ESB A;  1LB2 A;  2P8T A;  2XUB A;  2IA2 A;  5IT9 Z;  1SFX A;  4UV8 A;  3WGH A;  1IF1 A;  1IN7 A;  1R5G A;  2QM3 A;  4BHB A;  2FNP A;  3RKY A;  2X0L A;  4HF2 A;  3WG9 A;  4WWC A;  1KA8 A;  2CQK A;  3B02 A;  3E6M A;  5D4R A;  3WTZ A;  1BI3 A;  4ZH4 F;  2BYV E;  2ZFW A;  2E7X A;  2L4M A;  1XDS A;  2D2W A;  3K2Z A;  2ADU A;  3GFI A;  2JZY A;  3IWF A;  4WF2 A;  3TO9 A;  2NNN A;  3IL2 A;  2O0Y A;  5DYM A;  3DV8 A;  4HDU A;  1IN5 A;  3C18 A;  5FFZ A;  2ACJ A;  4CDG A;  2V79 A;  2B0L A;  1I6X A;  3H3U A;  1J0R A;  3WGI A;  3MCZ A;  1XMA A;  1QNT A;  5TRD A;  3LWF A;  4IPA A;  3ZMZ A;  4HF1 A;  4I01 A;  1A04 A;  4BQA A;  4UXN A;  3HHH A;  3IKV A;  3GFL A;  4MGR A;  2EA4 A;  2V1X A;  1B1B A;  5ILS A;  2A6E F;  5JR3 A;  5K5Q A;  3ROU A;  3JTG A;  1G4D A;  3E3V A;  4AWX B;  4Y13 A;  2FMY A;  3IHU A;  2H6B A;  1F4K A;  3O3K A;  3R60 A;  5EEG A;  5DCM A;  5HS7 A;  2LF8 A;  5E20 A;  1E17 A;  4ENJ A;  5FD5 A;  2L01 A;  1KYW A;  3R4K A;  4RAZ A;  1B9N A;  4LD5 A;  2ZME A;  5K1Y A;  3V8J A;  1FYK A;  3M8F A;  1IN4 A;  1WRJ A;  1X3U A;  4EJW A;  4UNO A;  2OBP A;  3M1E A;  3MWM A;  2XKO A;  1S7O A;  1LNW A;  2IJL A;  1KQ9 A;  1LQ1 A;  2WV0 A;  2STW A;  2P7V B;  2FML A;  3F22 A;  2WTE A;  3R6S A;  3HSE A;  2HYF A;  4B8X A;  3MQ0 A;  3NQO A;  2QYO A;  1EH6 A;  1Z7U A;  4M73 A;  4HX4 A;  3LA2 A;  1U5T A;  4CIC A;  3RPU A;  4OIN F;  4DNC A;  3EDP A;  1PUE E;  1SFU A;  4BH9 A;  5CVI A;  1J59 A;  5D8L B;  4RB2 C;  3TOA A;  6PAX A;  1DPR A;  3RI4 A;  3ULQ B;  2V1D A;  4EMS A;  2EFW A;  1REP C;  2PN6 A;  3RYR A;  2YU3 A;  5AIQ A;  2F5F A;  3IKT A;  1H9G A;  2YSR A;  3HSR A;  3T8T A;  1OYY A;  1HQC A;  5JVT A;  2K02 A;  3HIF A;  2L02 A;  3IC7 A;  3V7C A;  5CJ9 A;  4OMY A;  3QOP A;  5HDG A;  3FXR A;  1RNL A;  5DV5 A;  1V3F A;  2VXZ A;  2OZ6 A;  3LQQ A;  2VOP A;  3DFG A;  2COM A;  2MC3 A;  2ZNY A;  5DCF A;  1H9T A;  1PDN C;  1LEA A;  4CGZ A;  3HOS A;  1IN6 A;  3HTU A;  3ZMU A;  1HW1 A;  4XLN F;  3T8R A;  1ULY A;  4U0V A;  3TQN A;  1XD7 A;  4ESJ A;  3K9T A;  3WU1 B;  1U8R A;  4UUV A;  1Z1D A;  1RUN A;  2JPC A;  3B73 A;  4PGG A;  4OOI A;  4KA4 A;  4I09 A;  3WE3 A;  5BPD A;  1G3W A;  1BI2 A;  3Q9V A;  4HV5 A;  1ZRF A;  3J80 Z;  4YFK F;  3WTU C;  2XAH A;  2ZO4 A;  1GXQ A;  4L9T A;  4HA8 A;  1XSX A;  4EJV A;  2PBI A;  3E5X A;  3QU6 A;  3HRM A;  3I4P A;  1HSJ A;  2GZW A;  1CF7 B;  1IRF A;  2A69 F;  1IAW A;  3F6V A;  2YPR A;  4KMF A;  2KIM A;  3EUH A;  1R58 A;  1UFM A;  4A0X A;  1O3S A;  2HQR A;  5EEH A;  4P9F A;  2EB7 A;  3JW4 A;  2Q8K A;  2BBY A;  2DBB A;  3T5X A;  1LDD A;  1W7P D;  5ERI A;  3ABT A;  3GYH X;  2NYX A;  4LG0 B;  4MQ9 F;  4UVA A;  2XGX A;  1KU3 A;  4HQE A;  3KP4 A;  1R1U A;  2QLZ A;  3KEO A;  2QQA A;  1D3Y A;  1ZYR F;  2QBY B;  4HW0 A;  2OU2 A;  2A61 A;  2P4W A;  2XRO A;  4HAM A;  2LSO A;  1Y0U A;  2P6S A;  1UHM A;  1K6O A;  4AIH A;  3J7A O;  3DKW A;  2DFI A;  1QZY A;  5LEJ A;  1G3T A;  2M45 A;  1BI1 A;  3KP5 A;  2W24 A;  3V7S A;  1ZGA A;  3O2P E;  3JTH A;  1TLH B;  4N9I A;  1ON1 A;  4MQV A;  3J81 K;  1FBQ A;  1LJ9 A;  2NNY A;  1T6S A;  1XB4 A;  1DUX C;  2K27 A;  3OOP A;  3RIR A;  4IRH A;  4RGR A;  1Z6T A;  2M5W A;  4Z2Y A;  2R7F A;  3GZ6 A;  1HBX G;  3MZH A;  3E5U A;  1T39 A;  1ZH5 A;  5LEK A;  1PP7 U;  1LEB A;  1P92 A;  5CVV A;  3D5L A;  3DQV C;  5CVR A;  3F8C A;  1YQA A;  1Q1H A;  3F8F A;  4U7D A;  2OA4 A;  4KMU X;  4AD9 A;  2J5P A;  2GIV A;  4MTE A;  2EFQ A;  3F8B A;  1QBJ A;  2FXA A;  2G7H A;  4GXO A;  1WKM A;  3F3X A;  2O61 A;  5JFR A;  3HSF A;  4I02 A;  4A2U A;  3CJN A;  1K79 A;  3PQK A;  1R22 A;  3U2R A;  5K5O A;  3M9A A;  4L0Z B;  1XGO A;  3ECH A;  2GQQ A;  4BYY A;  5DCM B;  3FHZ A;  4EM2 A;  1HST A;  1SMY F;  3E6C C;  1E2X A;  5TJJ A;  4G7H F;  5D5X B;  4WXH A;  4HOB A;  4D0P A;  2ZNZ A;  1XDU A;  4U0W A;  3RPQ A;  4R79 A;  2IA0 A;  1T2K A;  5F64 A;  4RB3 C;  1YS6 A;  2ZME B;  2CSO A;  3I0T A;  1YW8 A;  3WU0 A;  2NAZ A;  5HDN A;  1MJB A;  1EV7 A;  3ZMS A;  3CUQ A;  4OIR F;  1XCV A;  4ZYH A;  1QQI A;  3K1M A;  1FYL A;  2D1V A;  2QVO A;  4N0B A;  2MD5 A;  4FHT A;  5FB2 A;  2VE9 A;  3VB2 A;  4GYI A;  2YR2 A;  1ONV A;  3DF8 A;  1U5T C;  1FLI A;  3QRF F;  2GXG A;  5IT9 K;  1J2X A;  1U5T B;  3FM5 A;  3NEU A;  3MEX A;  4A0Y A;  3I59 A;  2BE5 F;  2VT3 A;  2Y48 A;  3BOQ A;  1D5V A;  2DQR A;  2MLG A;  2Q0O A;  3FX3 A;  1KQ8 A;  4IXA A;  2RKH A;  2VN2 A;  3FM3 A;  2H6C A;  2UXX A;  1BC8 C;  1Z6R A;  5ICF A;  4HLY A;  2FOK A;  2HTS A;  3L9F A;  4M9S A;  3REO A;  1AOY A;  2ZBK A;  5A2Q K;  3CLO A;  1QZZ A;  5ICG A;  4CHU A;  3H3Z A;  4XLP F;  5LHH A;  4ZYG A;  1YS7 A;  1R5H A;  4PGH A;  4A0Z A;  5A2Q Z;  3WGG A;  2IRF G;  2HEO A;  2Z5U A;  1Z9C A;  1FYM A;  4GGG A;  2QQB A;  4Q4Z F;  3L2C A;  1FWZ A;  5DD4 A;  4AIK A;  2DW4 A;  4ESF A;  4BNC A;  3QP6 A;  2FA5 A;  2HQN A;  4JK1 X;  4CXF A;  2ISZ A;  3U9G A;  1XGM A;  2IT0 A;  1D8J A;  4KIG A;  4A6E A;  5AIP A;  3RKW A;  3C7J A;  3SZP A;  1R36 A;  3BWG A;  1ZAR A;  2R3S A;  2PMH A;  2AS5 F;  2PG4 A;  1W7P A;  2GA2 A;  2CO5 A;  2XAJ A;  3RJP A;  5HVQ C;  4LJZ F;  5CVU A;  4PCQ A;  1JHH A;  3BZ6 A;  4G9Y A;  4KT5 C;  3FXU A;  2W85 A;  2L3D A;  2HGC A;  2Y75 A;  4YG2 F;  1IW7 F;  4PDK A;  3MFK A;  1ODD A;  4OIP F;  1R7J A;  3TDU C;  1F9N A;  1ZG3 A;  1XSD A;  5H6R A;  1YLF A;  2EV5 A;  2DT5 A;  2FNA A;  5DUK A;  1T38 A;  1O3Q A;  1P4W A;  3G3Z A;  3KZZ A;  4L9N A;  2M30 A;  2A68 F;  4MNU A;  1SD6 A;  1KU7 A;  1OR7 A;  3WTS C;  1SD7 A;  1FP2 A;  1ZAO A;  2ESN A;  4L5J A;  1L0O C;  1UCR A;  1YG2 A;  1GVJ A;  4P5O A;  2BGC A;  4EVI A;  4UVC A;  2M1B A;  1O3R A;  4NQW A;  4G7O F;  2DAO A;  3TDZ C;  1R00 A;  4RGU A;  3KP7 A;  2QZ8 A;  1SD5 A;  2ESH A;  3ZPL A;  3F72 A;  2FBH A;  2EV6 A;  2H09 A;  4A6D A;  3CO6 C;  3L00 A;  3ERE D;  4HBL A;  1MKM A;  1C0W A;  2L54 A;  2O6G E;  5J6X A;  4LFU A;  3DXJ F;  4JQF A;  5HLG A;  4M9X A;  1KU9 A;  3FMQ A;  4RB1 A;  4L9V A;  1QGP A;  2HOE A;  1U6G A;  4WK8 F;  5HS8 A;  1XSV A;  3P7N A;  2RVC A;  2D1H A;  1TNT A;  5BPI A;  4LB6 B;  2H94 A;  5D6F A;  5D5W B;  5LRR A;  3T1B A;  1R1V A;  5L3D A;  1RIO H;  5FFX A;  5E8G A;  5E1X A;  3C3W A;  1BM9 A;  2W57 A;  1ZGJ A;  2EFP A;  2TDX A;  5L3E A;  1JGS A;  1EH7 A;  1IUY A;  3JAM Z;  2HDC A;  2XAF A;  4GO1 A;  5L3B A;  4XBF A;  2CG4 A;  2UWM A;  2XAG A;  2QQ9 A;  2QWW A;  2IW5 A;  2XAQ A;  2RNJ A;  4I7H A;  3G73 A;  2F2E A;  2XIG A;  1TW2 A;  3J80 K;  3K1P A;  2P5L C;  1K7A A;  1DPU A;  4OIQ F;  5ED4 A;  2EK5 A;  5E1W A;  4NB5 A;  4ZZD A;  4ENM A;  1YFH A;  2OZU A;  2ZKZ A;  2V1U A;  4IRG A;  3CUQ C;  3BPX A;  3U1D A;  4XSZ F;  1MDM A;  3ECO A;  4PZJ A;  4ENK A;  3KLO A;  2EFO A;  2DU9 A;  5IT3 A;  1EH8 A;  2M87 A;  3F21 A;  4MHG A;  3I5U A;  3WOD F;  3IWZ A;  3P9I A;  1FNN A;  1I5Z A;  2EFN A;  4L5I A;  4CYD A;  3CUQ B;  1BIA A;  2VT2 A;  2CW0 F;  2F5D A;  2HFH A;  2VBY A;  2FRH A;  3ZN0 A;  3EYI A;  2GWR A;  3L09 A;  4A5M A;  3N97 A;  4G8X A;  1ZG1 A;  2RGV A;  1G6N A;  1LDK B;  1JXS A;  4KUM A;  5LHG A;  4RGX A;  4F7Z A;  4QLC U;  5HOO A;  1O3T A;  5CLS A;  2VBX A;  3ZMT A;  4BHC A;  2VBZ A;  4YFX F;  4GYG A;  4G7Z F;  5J8C A;  1SD4 A;  1U2W A;  3LQR A;  3ABU A;  1GHC A;  2P5K A;  2OQG A;  1FC3 A;  4EJU A;  4XSX F;  2DQL A;  3LA3 A;  1MJA A;  1D8K A;  2NRA C;  2HS5 A;  3RKX A;  2JT1 A;  1TW3 A;  4LK1 F;  4O5V A;  3KFW X;  1P6R A;  3KP6 A;  1USS A;  1HKT A;  3RDI A;  4M9Z A;  2KIF A;  3CUO A;  3V8L A;  5FLX K;  2R7D A;  3W6K B;  3ZP5 A;  3VEP A;  1J5Y A;  4S05 A;  1IRG A;  1JE8 A;  2HYG D;  4FT8 A;  4U0Y A;  2F5C A;  5FLX Z;  5ILU A;  4M6X A;  1TQP A;  3GWZ A;  3I58 A;  2CGP A;  4AIJ A;  4ASN A;  3NRV A;  3BP8 A;  1IXC A;  2RQP A;  4KDP A;  2LDU A;  3WTY C;  4M74 A;  3KZY A;  1FBS A;  1OYW A;  1SMT A;  2VC1 A;  3VOE A;  2VOD A;  2DPU A;  5CVJ A;  4IJA A;  1FPQ A;  2Y0M A;  3I64 A;  4UVB A;  2DK5 A;  2OD5 A;  1H0M A;  1ZLJ A;  3QP5 A;  3HYI A;  3OV8 A;  3DPT A;  3P9C A;  1ZN2 A;  2AXL A;  5D8K B;  2HTJ A;  2HZT A;  3I71 A;  1K78 A;  4LGW A;  4DQ2 A;  4EJO A;  3CO7 C;  5KK1 A;  1W7P B;  4RGS A;  2PQ8 A;  3TOB A;  2HR3 A;  2Q2E A;  5ICC A;  2EA2 A;  3EET A;  2DO7 A;  1O57 A;  3RYP A;  2VON A;  1LVA A;  2IVM A;  4MEY F;  1T98 A;  1W5S A;  4OU0 A;  3TKY A;  1MD0 A;  3MAJ A;  3HHG A;  3F8M A;  2CWE A;  2DTR A;  4YFN F;  1SFE A;  2F5E A;  1BIB A;  1BN5 A;  4EM1 A;  1KYZ A;  4U7B A;  4LK0 F;  1ZRE A;  2WWY A;  1T0F A;  4IRI A;  4BXU A;  1WI9 A;  5LGU A;  1OPC A;  1S6L A;  4XRF A;  3M8E A;  3V8K A;  3GZ5 A;  5E1Z B;  4WX9 A;  3I54 A;  2CFX A;  4IVN A;  4LMY A;  1TTY A;  1OKR A;  4I98 B;  1UST A;  4YII A;  2RDP A;  3DPL C;  4G6Q A;  2WC2 A;  3FXQ A;  1YYV A;  4G6D A;  3E6B A;  4P9U A;  5F6F A;  2KRF A;  4A12 A;  3ML6 A;  2P5V A;  1OYI A;  2M8E A;  2ISY A;  5H6Q A;  4EGY A;  4FX0 A;  5L3F A;  3JSO A;  3E5Q A;  3H92 A;  2QBY A;  1FZP B;  3RTR A;  4A5N A;  3Q5F A;  5HDK A;  2A5Y B;  3DP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...