1TLHB

T4 asia bound to sigma70 region 4
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 10 kDa anti-sigma factor
publication title T4 AsiA blocks DNA recognition by remodeling sigma(70) region 4
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
total genus 17
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tlhB01
3LSTA 2VONA 3LA3A 1DP7P 2FBKA 3Q9VA 4S04A 4EMSA 3FXUA 3WU0A 3NRVA 1BIAA 4IRIA 4U88A 2W24A 4PZJA 3SZTA 3BWGA 1H9GA 3KLNA 3G73A 3BJAA 4IXAA 1YQAA 1O3RA 2P5VA 3HSRA 5H6RA 5DEQA 2KIMA 5E8GA 3I5UA 2K86A 3BJ6A 3Q9SA 5L3FA 1K79A 1XSXA 2HYFA 2V79A 2QQBA 3FM5A 3SFZA 3KZYA 4HDUA 2EV5A 3LQQA 3I71A 1QQIA 4IRHA 5IT3A 2FSWA 2HQNA 2H09A 1MDMB 3VEPA 3CUQB 5D8LB 5E17F 4U0YA 1LEAA 4M71A 1O3QA 2XGXA 2PMUA 2XV4S 2UWMA 2WV0A 1SMYF 1S7AA 1DUXC 2HZTA 4KDPA 4GYIA 4HLYA 3M8FA 2VBWA 3I0TA 1IN7A 4MGRA 2A3SA 4KICA 1U3EM 4R79A 2VE9A 2FXAA 3W6KB 2P5KA 2CFXA 4L0YB 4EQQA 1U5TC 3O2PE 1W5SA 4ZYDA 1QPMA 2GA2A 1FT9A 1GXPA 1R22A 5JR3A 2HGCA 4M9XA 5DUIA 3DF8A 1X3UA 2XIGA 2MC3A 2WWYA 4P9UA 3COAC 1ZREA 1LNWA 3CDHA 1RIOH 2VC0A 1TQIA 2XHKA 2ESNA 4Y15A 2VXZA 2GWRA 1W7PA 2EFNA 1D8KA 1P4WA 2E1CA 3M1EA 4OIQF 4RGRA 2QWWA 2KRFA 4RGUA 1IN8A 1MZBA 4AIKA 1W7PD 4LLNA 1IXRC 4L9NA 1HSJA 1HQCA 5FD5A 1BM9A 2EFPA 2ISYA 4G94A 2ZBKA 3RPQA 4MNUA 3F8FA 1IZ1A 3RIRA 5ILVA 1G3YA 3F23A 2LNBA 2RC4A 1FYMA 2KIUA 4OOIA 2P6SA 2ACJA 1MD0A 1YW8A 5LGNA 4FHTA 3R6SA 3IKVA 1QBJA 3GW2A 1IRFA 1TW3A 5HS9A 2RQPA 3WTXC 3WG9A 1ZRCA 1QO0D 4IJAA 3QU3A 3I4PA 1IAWA 2BV6A 4EM2A 1LB2A 4LB6B 2FRHA 2XAJA 1RUOA 4KT5C 5AIQA 5DCMA 2DBBA 3P7NA 1FNNA 4MTEA 3V8KA 2Q8KA 2QYOA 2QQ9A 1REPC 3C18A 1TQMA 4Q47A 2BEOA 2X0LA 2XUBA 3TOBA 5ICCA 2F5FA 3T5XA 5J6XA 3ERED 5E20A 1LDKB 3BOQA 4MEXF 3RYRA 1YW7A 5TJJA 4CZZA 1SFEA 3RYPA 4KIBA 1A04A 2JSCA 2QQAA 5ICGA 2GXBA 2XAFA 1BN5A 2MA3A 1O3TA 3CO7C 4OIOF 3LAJA 1WRJA 4UV8A 3FZVA 3ROUA 1F5TA 1FWZA 1EH8A 2P7CB 1F4KA 4M73A 2DT5A 3ZN0A 1SD4A 3M7GA 1H9TA 5BQTA 4U0WA 4PCQA 5DV5A 4KYWA 4XRFA 1B4AA 4ZYHA 3F3XA 3J81Z 4HLXA 5JVTA 2G7HA 5K1YA 4AIJA 4HDVA 1YO5C 2RVCA 4ZYGA 1SFUA 3VOEA 4U7BA 2QBYB 1B9MA 1ULYA 1FBUA 4EV0A 4KMUX 1S8NA 2O8XA 1IW7F 1KU9A 3WGGA 4G6QA 4BNCA 1BIBA 3QOPA 1LDJA 3BJOA 1SMTA 2M1BA 5E1ZB 5D6EA 4EJVA 2FOKA 1B1BA 2JZYA 3U2RA 1XB4A 1SD6A 3PQKA 1K7AA 3F6OA 3BZ6A 5DYMA 2FF4A 4KA4A 5ILSA 2QENA 1B59A 1Z7UA 2HDCA 1XMAA 3IL2A 1ZYRF 4KN4X 2PEXA 3PQJA 5AONA 5CVRA 1FY7A 4G6DA 3F72A 4A2UA 1T6SA 3RJPA 5H6QA 2A07F 4IPAA 1I1GA 5LRSA 1ONVA 2EJRA 3V8LA 4DQ2A 5F1RA 3J81K 2Z33A 3GYHX 2ZMEB 2DI3A 3GLXA 2OAZA 1TBXA 4L9VA 1BC7C 2NS0A 3D0SA 3U1DA 2PBIA 4EJTA 2P6TA 3CUOA 3Q5FA 1DDNA 3LQRA 1ZLJA 4MTDA 4XLNF 3M9AA 4XSZF 2QZ8A 2XKPA 1U5TA 2KJCA 3I59B 2A68F 1IF1A 2A69F 1S6LA 4LG0B 1O7LA 4RB1A 5AIPA 4KFCA 1FYKA 3TGNA 4BHCA 2EFOA 4GCVA 2IW5A 2W25A 4UNOA 4UUVA 3HOSA 3FF5A 1EV7A 2DO7A 1P4AA 4JBAA 5FLXZ 5ICFA 2O3FA 3KFWX 5CLSA 4HA8A 4CXFA 1D3YA 3LWFA 4JK1X 4P9FA 4XLPF 2CGPA 4GYGA 2O61A 3B02A 1ZGAA 3HRTA 2CG4A 2XROA 2IT0A 3EYYA 1RZ4A 5IT9Z 2YSRA 2XAQA 2EWNA 3BY6A 1TW2A 3W6JB 2V6CA 2HOEA 3T8TA 4ON0A 2DW4A 5E1WA 4G9YA 2PFBA 3MAJA 3R0AA 5CYVA 4EVIA 1FC3A 2V1UA 4O5VA 1V4RA 1FOKA 3GO5A 1U78A 1U2WA 5E18F 2IVMA 3EUHA 2FMLA 1CGPA 4RB3C 2DLLA 3WU1B 3ZMDA 3MQ0A 3QU6A 2ZNZA 3R60A 4YIIA 1J0RA 2ELHA 2GXGA 2CW0F 4HOBA 4OINF 4AWXB 1PUEE 3KP6A 4HYEA 1Y0UA 2NNYA 2Y48A 1G4DA 2FBHA 2DTRA 4TV7A 1HBXG 2HS5A 1Z1DA 2MLGA 1RUNA 2IRFG 1F9NA 1WWXA 2DQRA 3QP5A 2EFWA 2HTJA 4G8XA 5FLXK 5E8IA 4HW0A 3ABTA 4KMFA 4HQEA 3FMQA 5LBQA 2F5CA 1O57A 1K78B 2RNJA 3K1MA 4I98B 4G7OF 5IT9K 3GFIA 2D2WA 4RAZA 1J59A 2C6YA 1ZG5A 3KP7A 2KJBA 2EA4A 1USSA 2R7FA 3VFZA 1G3WA 1R5HA 4LB5A 2HQRA 1XMKA 2VODA 1J7KA 2EFQA 3K0LA 1IN5A 1VTNC 1IUYA 1EH7A 2V1XA 1KA8A 1W7PB 2NNNA 1XD7A 1QNTA 1RI7A 5LRRA 5LEKA 5DD4A 1PP7U 2O0YA 5HDKA 3L00A 3LFKA 1LEBA 1ZG1A 2OQGA 3ML6A 2VOOA 4EJWA 4MQ9F 4UXNA 2GA1A 1R36A 1FP1D 4DNCA 3DKWA 2MH2A 1SFXA 2O03A 2K4JA 4BYYA 1T2KA 3DPLC 1I5ZA 4FX4A 2YPRA 2A6HF 2CYYA 3E3VA 4BQAA 4P5OA 3FXRA 2HEOA 3MZYA 4UV9A 3L09A 1SD7A 2K4BA 3GZ5A 1LQ1A 3DP7A 4JQFA 3SXYA 1CF7B 3E6CC 1MDMA 2ZJ2A 2VE8A 2DAOA 3K2ZA 2HFHA 2F5EA 3T0YA 1HW5A 2HWVA 5H20A 3GX4X 3HHGA 1KYWA 1KYZA 1J9IA 5CVUA 5DUKA 3IWFA 1SD5A 2DU9A 1FP2A 2QUFA 1ZH5A 5BS6A 5HLIA 4HX4A 1UFMA 4LD5A 3CLOA 3MFKA 1QZZA 3KE2A 1XGSA 3H92A 2K02A 5K5OA 3FM3A 3EDPA 1XSVA 1FZPB 4EJOA 1XDSA 3HRMA 3E6DA 1T38A 2Y75A 5LHGA 1E17A 1IN6A 1UHWA 3KETA 2MBFA 4LMYA 3R0JA 4PDKA 2MH9A 4KNYA 1USTA 3AAFA 5CJ9A 4YG2F 3HSFA 1KU2A 1TQPA 3BPVA 4HX7A 5DCFA 2W85A 3GVAA 2EV0A 1KQ9A 4HBLA 1S7OA 2K27A 1ZLKA 4AD9A 2P5LC 2M5WA 3RI4A 4PGGA 1Z9CA 4G7ZF 3ZP5A 3V7RA 1XGNA 1XSDA 3BP8A 3WTSC 4PGHA 4A12A 1KQ8A 4YIFA 3V7SA 3MEXA 3IRRA 2PJPA 2JTVA 2YX4A 3WTYC 2VT3A 4RAYA 3I58A 2F2EA 4ENJA 2RV8A 3JSOA 1YG2A 2IP2A 3DQVC 3VB2A 2COMA 4BH9A 2CWEA 4YFNF 5A2QZ 1OPCA 5LHIA 3KP5A 4ZZDA 2B0LA 2UXXA 2EK5A 2EV6A 4NHJA 1T0FA 1R1TA 2M45A 5F6FA 3ZMVA 3ULQB 5J8FA 1ODDA 3TDUC 1PP8F 4M9ZA 3WTTC 4IVNA 2TDXA 3TO7A 2D1VA 2JRTA 3FXQA 3GZ6A 2UZKA 4GXOA 3NQOA 5D4RA 4ENKA 1ON1A 4M74A 3RKYA 5TRDA 3BDDA 2RN7A 3WTUC 3K1PA 1P6RA 3TQNA 4ENMA 4S05A 1L0OC 3VODA 1WSUA 2IJLA 5HVQC 4ETSA 3JTGA 1XGMA 2ZCWA 1BI1A 4M6XA 4YFKF 4BHPA 6PAXA 2HTSA 1GVJA 5HDGA 3CUQC 1R5GA 4ZH4F 2PMHA 5CVVA 3GFLA 3C1DA 4KIGA 1OR7A 4I7HA 2W84A 5DDGA 1T39A 2OD5A 1FLIA 3REOA 5D4SA 2RGVA 3TOAA 4R1HA 5JHUA 3K9TA 4L9JA 4I02A 3FMSA 4YFXF 4GGGA 3IHUA 4WXDA 2DFIA 3RKWA 5A2QK 1R00A 3IKTA 2RDPA 2ZO4A 1FBQA 1U5TB 2CQKA 1Q1HA 5LEJA 1LJ9A 2J5OA 3WTVC 4CICA 3ZPLA 4B8XA 3GF2A 4HV6A 5KK1A 5J8CA 2OQRA 2E1NA 4KIFA 4Q5SF 2OZUA 5HS7A 2H6CA 2VN2A 5ED4A 2GQQA 1XN7A 4WXCA 1QGPA 2M87A 3F8CA 2HKXA 2E7WA 2ISZA 2MLKA 1R1UA 1S3JA 1BI0A 3CO6C 2IPQX 3G3ZA 2A6EF 4RS8A 3DEUA 1FX7A 2QLZA 3HHHA 3F8BA 5HOOA 4EGYA 3ZMZA 1UCRA 2HYGD 2YR2A 4AIHA 1F1ZA 3IC7A 4O6JA 3FX3A 2FMYA 3QRFF 5ILUA 4UVBA 4Q4ZF 3QP6A 4OIPF 1P4XA 3SQNA 5HDNA 3F21A 3M8EA 2IA1A 1ON2A 3KP2A 2KIFA 3HYIA 5BPIA 1XCBA 1YYVA 3WE3A 2ZMEA 5JI6A 3FHZA 4F7ZA 1UB9A 4Q48A 1G3TA 1YW9A 4MQVA 3SHFA 2ZXJA 1HW1A 2A5YB 1KQ0A 5K5RA 1YTYA 2EB7A 3E6MA 4ZYEA 1D8JA 3I59A 3FWEA 3LA2A 3KEOA 4LG0A 1GXQA 4HAMA 3S2WA 5BPDA 1SAXA 3E5QA 3P9KA 1JE8A 1HSTA 3KP4A 2FNPA 1MKMA 2NYXA 2FU4A 1ZN2A 4U0VA 4LLLA 2XAGA 1TTYA 3D5LA 4RB2C 3L9FA 3ZN1A 4ESBA 2DPUA 3E6BA 2NAZA 2DQLA 1IN4A 5LLQA 3TDZC 5L3BA 1TNTA 2Z5UA 4OMYA 4RGXA 1HW2A 1I6XA 2L3DA 3HTSB 3BROA 3DXJF 3N97A 3LAPA 4ESJA 1DPUA 1ZGJA 2Q0OA 4QWQA 1BJAA 2ZKZA 1JXSA 3H3ZA 3H3UA 4WK8F 1EH6A 3OV8A 2GZWA 2H6BA 1HKQA 4HF0A 2G7UA 1R23A 3GFMA 1FSEA 3RKXA 3QPHA 2JPCA 4CYDA 1FBSA 2OA4A 2JPBA 2X4HA 1MJAA 3DPTA 2IA2A 4LJZF 2R7DA 2STWA 5LHHA 1OYYA 4A5MA 5EEHA 2AS5F 3KZZA 1FYLA 1Z91A 1WI9A 3F8NA 1OKRA 4I0AA 1R7JA 3ZQ7A 5L3CA 4N9HA 2VOPA 3WODF 2V9VA 2OBPA 2V1DA 3GWZA 4WX9A 4D0PA 1ZRFA 3GEZA 5FFXA 3HRUA 1K78A 1LVAA 2UXNA 1H0MA 4CHUA 1BOAA 3JTHA 3DFGA 3RPUA 4A0YA 1U8RA 4GO1A 3WTWC 3BPXA 4KUMA 3ECOA 4Y13A 4A6DA 1TNSA 3CUQA 5FD6A 4UVAA 1W4MA 3FMRA 2XVCA 3F8MA 3ZMUA 4IHTA 2OZ6A 1Z05A 1NHAA 2E7XA 2H94A 1O7FA 4I2OA 2CSOA 2FA5A 1BC8C 3WE2A 4EM0B 1Z6RA 3CTAA 5DCMB 5FB2A 1MGTA 4N0BA 5L3DA 4A6EA 4BAYA 5HLGA 1YFHA 1YS6A 3KLOA 2QVOA 3GXOA 3R4KA 1G3SA 2IA0A 2HR3A 1OYWA 1MJBA 1YIOA 2P7VB 2JT1A 3J80Z 3ABUA 4G7HF 2VBYA 4H0EA 4L0ZB 4I01A 4M6YA 1UHMA 1IXCA 1YS7A 1FPQA 1T98A 2MD5A 3V7CA 3SZPA 1JGSA 4CGZA 2M30A 3EYIA 3RTRA 5FGMA 1QZYA 3WGIA 1YLFA 1CF7A 1C0WA 1B9NA 1ZRDA 1J2XA 5D6FA 4K2EA 3ISPA 4L9TA 1HXDA 3V4GA 2YX7A 3L7WA 3ZMTA 1DPRA 4I0BA 3TO9A 4E70A 1P92A 2FQ3A 3GFJA 3T8RA 4EM1A 4LK0F 4IHSA 4HV5A 4CDGA 2DPDA 3E97A 2K7LA 2D1HA 2OU2A 4HF2A 3QPTA 4M72A 1WQ2A 2L4AA 2XASA 3RDIA 3JSPA 3IRQA 2FNAA 3ECHA 2BYVE 4Y17A 1KGSA 3F22A 3J80K 4OU0A 4UHTA 4N9IA 1TLHB 2P4WA 2VC1A 4EJUA 3O6BB 1W5TA 4MEYF 5BMZA 1FSHA 3DV8A 5D5VB 2ADUA 3HTUA 3T1BA 5ERIA 3WTZA 5D5XB 4LK1F 1KU7A 1G6NA 2M8EA 2BBYA 2VBZA 2DK8A 2LF7A 2FE3A 2Z9OA 3F6VA 2VBXA 3QAHA 3K1NA 4L18B 2Y0MA 2G9WA 1D5VA 2KKOA 3U9GA 4B09A 3MCZA 4ESFA 4L5IA 4BXUA 4U7DA 3C3WA 5FFZA 4ENNA 1I1SA 4HF1A 2O6GE 4A0ZA 2PI0A 2Z3YA 5L3EA 1S29A 4OIRF 1XGOA 2GIVA 1V3FA 2PN6A 3C7JA 2STTA 5JFRA 2XKOA 2GAUA 5HLHA 1IXSB 4A0XA 3TO6A 4IRGA 1PDNC 4KN7X 1BI2A 3I54A 3R61A 1ZAOA 3ELKA 3K69A 3MWMA 2DK5A 2LSOA 5LGTA 3JAMZ 1JHHA 5BOXA 2XAHA 1BI3A 3ZMSA 3PFIA 4EGZA 1AWCA 1JHFA 3V8JA 4WXHA 3B73A 5CVIA 4ASNA 2PLYA 4QLCU 4OMZA 4WWCA 1IRGA 1OMIA 5EEGA 1R58A 4BHBA 2QM3A 4L5JA 2ZNYA 2BE5F 2FEZA 2LDUA 4P96A 4CO8A 2VT2A 5F64A 2QBYA 3O3KA 1P2FA 4FX0A 1U6GA 3KP3A 1J5YA 5D8KB 2L54A 2F5DA 1OYIA 3LA7A 5FO5A 2ETHA 4HZFA 1XDUA 4WF2A 3KCCA 5E1XA 1R1VA 4XSXF 3N4MA 4M9SA 5HS8A 1K6OA 4NQWA 1ZARA 4Z2YA 2EA2A 1J75A 1LDDA 3GUDA 5DD8A 4I09A 3HIFA 4A5NA 3CJNA 5KVRA 3NEUA 4IF4A 2L4MA 5D5UB 3MZHA 4UVCA 3IWZA 2NRAC 2R3SA 2XRNA 2L01A 3I64A 3HSEA 2WTEA 1O3SA 1AOYA 3JAMK 3E5XA 2PG4A 2ZFWA 3E5UA 3J7AO 4FT8A 2AXLA 1ZG3A 3HOTA 4WCGA 1WKMA 3EETA 2WC2A 2D45A 1Z6TA 5K5QA 2LF8A 4R8HA 2BGCA 3WGHA 2A61A 4HQMA 4O3MA 4AVPA 5L3GA 4RGSA 4MHGA 4ZZLA 2Q2EA 3EQLF 1B6AA 5LGUA 1BBYA 2W57A 2ESHA 1MJ9A 1STZA 4NB5A 1HKSA 2HKOA 2H27A 2Z99A 3I53A 3P9CA 2LKPA 1E2XA 3HRSA 5D5WB 1GHCA 3HUGA 3KEQA 4LLGF 2J5PA 4LGWA 5ICEA 1HKTA 2PQ8A 3TKYA 4LFUA 4XBFA 3P9IA 4HX8A 2YU3A 1RNLA 5CVJA 1L3LA 2L02A 1I27A 1ZHFA 3OOPA 4RB0A 2CO5A 3L2CA 2P8TA 2FBIA 3JW4A 2RKHA 4P55A 1XCVA 1KU3A
chains in the Genus database with same CATH superfamily
5GP9A 3LSTA 2ID3A 2VONA 3LA3A 2R0QC 1DP7P 2FBKA 4BDZA 3BG9A 3Q9VA 4S04A 5LD2C 3VYRB 2VQHA 3GTPJ 3C2HA 4EMSA 2XF7A 3FXUA 3WU0A 3NRVA 2E2HJ 1BIAA 4IRIA 1ZTRA 2DODA 4U88A 2W24A 4PZJA 3SZTA 5EG0B 5GADJ 2JA5J 4CA0A 3BWGA 1H9GA 3KLNA 3G73A 4NDLA 3BJAA 1MMNA 1DU0A 2DJIA 2LG4A 4IXAA 1YQAA 1O3RA 2P5VA 3BTIA 2HDWA 3H1CA 3C2BA 3HSRA 5H6RA 1SAUA 1RETA 5DEQA 2KIMA 2Z1DA 5E8GA 3I5UA 2K86A 4M3GA 2CUEA 1BW6A 2DMUA 3BJ6A 3Q9SA 5L3FA 1Z3YA 2JUGA 1K79A 2ME0A 1XSXA 2HYFA 2Y2ZA 2V79A 2QQBA 3FM5A 3SFZA 3KZYA 5K7FA 3H35A 4HDUA 2EV5A 2CW8A 3LQQA 1ERDA 3I71A 1WJDA 1NK2P 4OAZA 1QQIA 4IRHA 2VQCA 2FSWA 2HQNA 3DKXA 5IP7J 5IT3A 2H09A 3ZQIA 1X1DA 1MDMB 1TWHJ 4C3HJ 1X1AA 3VEPA 1QHGA 3CUQB 4LG3A 5D8LB 1ETYA 3A0HC 4FQGA 5E17F 3L2VA 4U0YA 1SVLA 1LEAA 4M71A 3CF5F 1O3QA 2KISA 2WB1N 2XGXA 1Y1VJ 2XB0X 2PMUA 2XV4S 4II3A 5J4YA 4BDYA 1R4NB 2UWMA 2WV0A 1SMYF 1S7AA 2YUSA 1DUXC 2HZTA 4KDPA 4MLOA 4GYIA 4HLYA 3M8FA 2VBWA 4N4NB 3I0TA 2CUZA 5KHDA 1IN7A 4XKVA 4MGRA 2GOXB 2A3SA 4DW6A 4CYCA 2DA2A 4KICA 3S32A 4R79A 1U3EM 2R7SA 2VE9A 3PJRA 2FXAA 3W6KB 2COBA 2P5KA 2CFXA 1YJWI 3G2BA 1D1BA 4L0YB 4EQQA 1U5TC 3LSHA 3O2PE 3OL4A 2PJRB 2WY8Q 1W5SA 4ZYDA 1QPMA 2GA2A 3BG7A 3DU5A 1FT9A 2GBYA 1GXPA 3DTEA 4C30A 2DDAA 1R22A 5JR3A 2HGCA 2WAFA 4M9XA 4BEHA 3K10A 5DUIA 3ZOBA 3DF8A 1KONA 1X3UA 2XIGA 3QPSA 1W5CC 2MC3A 2WWYA 4P9UA 2DMQA 4NC7A 2QGUA 3COAC 1ZREA 2DOAA 1Z7LA 2QKMB 1H8AC 1LNWA 4PJ0C 5JVGF 4E7LA 3CZ6A 3CDHA 1UELB 1RIOH 3X2QH 2VC0A 4J01A 1TQIA 2XHKA 4I6ZA 2ESNA 1MBJA 2VXZA 4Y15A 4DBQA 2GWRA 2HPMA 1W7PA 3FBNB 3HL2A 3S1MJ 5FKKA 1FOWA 2EFNA 3ZCOA 1I3AA 1D8KA 1P4WA 3DKYA 3BR5A 2EZKA 2E1CA 3M1EA 1K4TA 2I10A 4E7ZA 4OIQF 4RGRA 2QWWA 3ZGKA 5J1YA 4DOZA 2NVXJ 4YELA 4E7JA 3PUBA 2KRFA 4BKXA 3MN2A 3DBHB 4RGUA 1IN8A 1MH4A 1MZBA 5KNLA 1W36C 4M3EA 4AIKA 1W7PD 3IP4B 1YI2I 4LLNA 5M5WJ 1IXRC 2R93J 4L9NA 1HSJA 2DMTA 5J1UA 1HQCA 4BQOA 5GAGJ 4IHYA 2YU9J 3ZQFA 3KYDB 4XMYA 2LTPA 3C2GA 5FD5A 3QWLA 1BM9A 2EFPA 2ISYA 3HKZA 4G94A 2ZBKA 1B8IB 1YITI 3RPQA 4MNUA 2RREA 3F8FA 1IZ1A 3RIRA 2DYSH 5ILVA 1G3YA 3F23A 2LNBA 2Y0SA 1IJWC 2RC4A 1FYMA 2KIUA 4OOIA 1FIPA 2P6SA 3ABKH 2AQEA 5F0CA 2WA0A 1B72B 4CSWA 2ACJA 1MD0A 1YW8A 3BR6A 5LGNA 1TZLA 2TRTA 4FHTA 3WG7H 3WHCA 1TWCJ 4HRIA 1TC3C 2QF7A 1X4OA 4E7SA 3R6SA 5F0FA 3OWTA 3IKVA 1QBJA 4I99C 2X1DA 2CS3A 3GW2A 1IRFA 1TW3A 1TT0A 4HPQA 3SJMA 5HS9A 2RQPA 2LP0A 3WTXC 1TWFJ 2X6XA 1EA3A 3DU6A 2W1OA 4MIMA 3WG9A 4CCMA 4XN3A 4BS9A 1ZRCA 1QO0D 4IJAA 2VPRA 2BY0A 3ZQCA 3QU3A 4CH7A 3I4PA 3TBIA 1YJ9I 1W1WE 2BV6A 1IAWA 3DBRB 4EM2A 4BL0B 4LB6B 1LB2A 2FRHA 2XAJA 1RUOA 4KT5C 5AIQA 3OYBA 2EZIA 5DCMA 2D5VA 2DBBA 1X1PA 4Z6YA 4UUSB 3BG3A 1W0TA 3G1LA 1M1EB 2P81A 3P7NA 1FNNA 4C2MJ 4MTEA 3CQZJ 3V8KA 2Q8KA 4QIWN 2QYOA 2QQ9A 3IH3A 2NOJB 1REPC 3C18A 1TQMA 4Q47A 3AL0C 5IPAA 2BEOA 2X0LA 2XUBA 3TOBA 5ICCA 4NC6A 2F5FA 2VLAA 3FIWA 3T5XA 3DTIA 5J6XA 3HGYA 3ERED 1AKHA 1I6HJ 5E3OA 3DWLE 2CQ7A 5E20A 2IBDA 1WCMJ 1LDKB 3HDDA 3CMEI 4A3CJ 1U0JA 3QYEA 3BOQA 4XKCA 4JX5A 4MEXF 4CCNA 2E19A 1WJEA 2BOLA 2OCEA 3RYRA 3SFIA 1YW7A 5TJJA 4CZZA 1SFEA 3RYPA 5B5EC 4KIBA 5DM6F 1A04A 2VQGA 3G1OA 2JSCA 2QQAA 5ICGA 2GXBA 2XAFA 2X6OA 4XONA 1KZHA 3H5AA 1RR7A 1BN5A 1CQTA 2ZC2A 3O8GA 1WVRA 2MA3A 3OYKA 3KIOA 1O3TA 3CO7C 4OIOF 3LAJA 3JRFA 1WRJA 4UV8A 1YJNI 3FZVA 2QA4I 2XPWA 3ROUA 3J7ZI 1FWZA 1F5TA 1EH8A 3Q0VA 2V4JC 2K5CA 1WH7A 3OOUA 1F4KA 4M73A 2P7CB 2XAUA 2R7WA 2DT5A 2FX0A 3ZN0A 3QYBA 1SD4A 3M7GA 3H0GJ 2DA5A 2FD5A 1H9TA 5BQTA 2M7BA 1JI8A 4U0WA 4XRSA 1PJRA 3CDIA 4PCQA 5DV5A 2CJJA 4PFOA 4KYWA 2V9PA 2Y9YA 4XRFA 1B4AA 3OS1A 4KJZA 1PYVA 2F48A 2BZTA 2NVYJ 1ETQA 4ZYHA 2BW3B 2DN0A 3F3XA 3J81Z 2K85A 5FLVA 1YX5A 3FDYA 2A6TA 4HLXA 1MBFA 5JVTA 3LSJA 2G7HA 5KAFC 5K1YA 4AIJA 4HDVA 5EZGA 4HNVA 2R4GA 1DU6A 3KYLA 1YO5C 2RVCA 4ZYGA 1SFUA 3VOEA 4U7BA 3H3VK 5IOZA 2QSHX 2QBYB 1B9MA 1ULYA 1FBUA 4FTHA 5E3LA 1X3WB 4EV0A 4KMUX 4XLHA 1D1CA 1S8NA 2QSGX 3CJQB 5JLXA 5DTDA 4AM3A 2O8XA 1F43A 1IW7F 1O4XA 1KU9A 2DCEA 3WGGA 4G6QA 4BNCA 1BIBA 3QOPA 1SVMA 1LDJA 3BJOA 1Y39A 1SMTA 2M1BA 5E1ZB 1IO2A 5D6EA 4EJVA 2FOKA 1B1BA 2JZYA 2WADA 3U2RA 1XB4A 1BR2A 1SD6A 3PQKA 4LIVA 1IGNA 5CPRB 3WHBA 2G0EA 1K7AA 1ACIA 3F6OA 3BZ6A 5DYMA 2K9MA 3L2WA 3KYCB 3L2QA 2FF4A 2L9NA 3ERMA 3A0BC 5ILSA 4KA4A 1LKXA 1OCPA 2W48A 2KQRA 2QENA 3GCMA 2KDOA 3HEFA 5KAIC 5J4VA 1B59A 2HVRA 4AYBN 4IEJA 1Z7UA 2HDCA 1XMAA 3S3MA 3IL2A 1ZYRF 2HXOA 2CFOA 3K4CA 4KN4X 2PEXA 3PQJA 5AONA 5CVRA 1I50J 3GTKJ 1NG7A 1FY7A 3AG3H 1IC8A 3EPZA 4G6DA 3F72A 3VSKA 3OYCA 4A2UA 1T6SA 3J7YJ 3RJPA 5B66C 5H6QA 1VQPI 2A07F 4IPAA 3OIOA 1S9HA 1OCOH 4CCOA 1I1GA 2KPMA 3JRAA 1LFBA 4CZCA 3HXLA 3MKLA 3K70D 5EJCA 3UR3C 3JRGA 2XSJC 5LRSA 1ONVA 2EJRA 3V8LA 3HGGA 3FXJA 4DQ2A 5F27A 1E3HA 5F1RA 3J81K 1X3ZB 3GYHX 2ZMEB 3KPHA 3HPHA 2DI3A 4NUBA 2Z33A 2E36A 3GLXA 2F4MB 2OAZA 1AHDP 2DA3A 1TBXA 4L9VA 2MC4A 2NS0A 4FE7A 2L7MP 3D0SA 4F3QA 1JKPC 2VQLA 4F92B 3HBLA 3U1DA 2PBIA 1HDPA 4EJTA 2P6TA 3BR2A 5CQGA 2ZJQF 2R5ZB 2OTLI 3M1CA 3ABLH 3PIPF 3CUOA 3Q5FA 1DDNA 3LQRA 2MW8A 4W1UA 4B3AA 4XKBA 1ZLJA 4MTDA 4XLNF 4BY1J 3M9AA 4XSZF 2QZ8A 2XKPA 1X2NA 3JREA 3HOXJ 1U5TA 2KJCA 3I59B 2A68F 1IF1A 1JT6A 2A69F 3DLLF 1Y8QB 2BHZA 2ICWG 1S6LA 4LG0B 2HQAA 1O7LA 3K2AA 4RB1A 5AIPA 4HSTA 4KFCA 4B48A 1FYKA 3TGNA 4XN0A 1T33A 4BHCA 3S3NA 2EFOA 4GCVA 2IW5A 2W25A 4UNOA 4UUVA 3HOSA 3FF5A 1EV7A 2DO7A 1P4AA 4JBAA 2X6YA 2N8GA 3RZOJ 5FLXZ 5ICFA 2O3FA 3KFWX 5CLSA 2NS7A 5J3LA 4HA8A 4CXFA 1D3YA 3OYLA 3BG5A 3LWFA 1OCCH 2B63J 4JK1X 4MFDA 4P9FA 4XLPF 2CGPA 4PJMA 4GYGA 2F5VA 2O61A 3B02A 4DIQA 4BU2A 4G12A 1ZGAA 3D1NI 3HOVJ 3HRTA 4DYRA 2CG4A 4NBQA 2XROA 2IT0A 1T0FC 3EYYA 1RZ4A 5IT9Z 2GOMA 2VASA 3Q3SA 2YSRA 3TW7A 2XAQA 2WAQN 1QPIA 4GRIA 1K61A 2EWNA 3BY6A 1TW2A 3W6JB 4PSXA 4B47A 3S17J 2V6CA 5IY5H 2HOEA 3T8TA 4ON0A 3J7AY 2DW4A 1WJFA 5E1WA 4G9YA 2MD0A 3M4OJ 3RCOA 4S0HB 2PFBA 1LVKA 3A03A 3MAJA 4D5FA 3R0AA 4RAGA 5CYVA 2WAEA 4EVIA 1FC3A 2V1UA 4O5VA 1BW5A 3MKWB 1MSFC 3LSRA 2ELKA 1V4RA 3CCJI 1FOKA 3GO5A 1U78A 1U2WA 5E18F 2H1LA 3WU2C 2XSDC 2L2OA 2IVMA 3EUHA 4M3BA 1VQMI 2FMLA 1CGPA 1UMQA 4IX7A 3Q0WA 4RB3C 2I5UA 2DLLA 3WU1B 3ZMDA 3MQ0A 3QU6A 1SVOA 2QEXI 4IHXA 2ZNZA 5FKNA 1ZR2A 3W2AA 1UZCA 3PSIA 3R60A 4YIIA 5J1RA 4BQQA 1J0RA 2ELHA 2E34A 4OWRB 4A3GJ 3O8HA 3TMOA 2GXGA 1VQLI 2CW0F 2V1NA 4HOBA 4OINF 2VKDA 4AWXB 1VQ9I 4A3KJ 4DYCA 3H9QA 1PUEE 4LOCA 4ZDPA 1N77A 2VUMJ 5FKLA 3KP6A 4HYEA 1Y0UA 2NNYA 2Y48A 1G4DA 3A2KA 2FBHA 2DTRA 4TV7A 1HBXG 2HS5A 3VYUB 1Z1DA 2MLGA 1RUNA 2IRFG 1H89C 1F9NA 1WWXA 2DQRA 3QP5A 2EFWA 2HTJA 4G8XA 4RLQA 5FLXK 4BE0A 4PJJA 2HQ5A 5E8IA 4HW0A 3ABTA 4BE1A 4KMFA 3K4BA 4HQEA 4P1WA 2W82A 3S15J 1YHQI 4CYCB 2OV7A 3FMQA 5FLMJ 1GDTA 2IGMA 1JTYA 2F5CA 4XM3A 5LBQA 1O57A 3FXOA 1BOBA 1K78B 2XC7A 1EF4A 4V19K 2RNJA 3K1MA 2E1MC 4I98B 2KL4A 4N4OB 5M3FJ 2IS6A 2AQFA 3W3CA 1WHUA 3K70C 4G7OF 2OUMA 5IT9K 4B43A 4ABZA 3GFIA 3CDLA 5HLTA 2D2WA 4RAZA 1XC5A 4DZJA 4XRMA 1ZKGA 2WV1A 1J59A 2C6YA 2LY1A 1ZG5A 3OYMA 3KP7A 1ZQ3P 5GAEJ 3ESWB 1WPKA 2R7UA 1QZEA 2KJBA 1FOXA 1R5ID 1USSA 2EA4A 2R7FA 3VFZA 3S16J 1G3WA 2XPVA 1R5HA 4LB5A 4EEFG 5C3EJ 2HQRA 1MBHA 1XMKA 4U87A 2VODA 1FMWA 1J7KA 3PM1A 3B6AA 2EFQA 3K0LA 1MMGA 2EIMH 2M4GA 1IN5A 1VTNC 2FUG2 1JT0A 5DM7F 1IUYA 3OR1C 1EH7A 2V1XA 1KA8A 1W7PB 2NNNA 1XD7A 1QNTA 3CMAI 1RI7A 4RMNA 5LRRA 3SYTA 3NAUA 5LEKA 5DD4A 1PP7U 2JA7J 2O0YA 5HDKA 4IZZA 3L00A 3LFKA 3LMMA 1LEBA 4RM2A 2EIKH 3AFHA 1ZG1A 4X1EA 4XOPA 2OQGA 1K83J 5F1JA 1U9NA 1Z77A 1FIAA 3ML6A 2VOOA 3CCUI 4EJWA 4MQ9F 3SDBA 2DA1A 2GA1A 4UXNA 2YS9A 2QCOA 2Y31A 2K3FA 1R36A 3AG1H 3W2WA 4BJ5C 1FP1D 2R7XA 1T08B 4DNCA 3DKWA 2MH2A 1SFXA 5B1BH 2O03A 2K4JA 3VYSB 4RLFA 1GT0C 4BYYA 5IOYA 1T2KA 1SFKA 2XGCA 1I5ZA 3DPLC 4FX4A 2YPRA 2A6HF 2CYYA 3IAM2 3E3VA 1APLC 2VB6A 4AC0A 1G8XA 2XPUA 3SEQA 4P5OA 3FXRA 2HEOA 4BQAA 3MZYA 4II2A 4UV9A 3L09A 1SD7A 2K4BA 4ZYAA 2EQRA 3GZ5A 1LPQA 4HEA2 1IUFA 4C3IJ 1LQ1A 3DP7A 4JQFA 3SXYA 5EGOB 1CF7B 2EH3A 1XMXA 3E6CC 3BR1A 1MDMA 2ZJ2A 2VE8A 2DAOA 3ZQLA 3K2ZA 2ZJRF 2HFHA 2F5EA 3QOEA 3T0YA 1HW5A 1IDZA 2HWVA 3H9JA 5H20A 2L7ZA 2JVHA 3EUAA 2L9SA 3GX4X 3HHGA 2WBMA 1Z0XA 1BL0A 1KYWA 3I9V2 1KYZA 4BJ6C 1Z3XA 1J9IA 1T56A 2VJIA 5CVUA 4A3EJ 2IGNA 5DUKA 3IWFA 2E2JJ 1SD5A 2DU9A 1FP2A 2QUFA 1MMDA 1FOYA 4RAFA 1ZH5A 5BS6A 5HLIA 1LFUP 4HX4A 1UFMA 3BTCA 4LD5A 4XLFA 2HOSA 3GTMJ 3CLOA 5GAHJ 2KT0A 3MFKA 1QZZA 3IH4A 3KE2A 1RR8C 1XGSA 2KIQA 1YRNA 4D5CA 3H92A 3U21A 4DZPA 1JJ8C 2K02A 4MFEA 1JUSA 2FJ1A 5K5OA 3FM3A 4F55A 3EDPA 1XSVA 3EUKL 5TGTA 1FZPB 3P5JA 4EJOA 1XDSA 3HRMA 3OYDA 2PJRA 3DTKA 3OL3A 3IV5A 3EUHC 4CCKA 2LC2A 2HOAA 3BG6A 3A1YA 3E6DA 1T38A 1AKHB 3S14J 2DOFA 2Y75A 1JKRC 2CQQA 5LHGA 4GFBA 2R7OA 4RM3A 4XR6A 1E17A 2XF5A 3JCUC 1IN6A 1UHWA 2OJED 3KETA 2JJ7A 2BVLA 2MBFA 3LOCA 2A5WA 4LMYA 3R0JA 4PDKA 2LKXA 1Y8RB 4IOCF 2MH9A 4YEJA 2JQ7A 4KNYA 5C44J 1USTA 2IGKA 3I56I 3AAFA 5CJ9A 4YG2F 3HSFA 1TT5B 1WZ2A 1KU2A 2KRHA 3TP0A 3BTJA 3OS0A 3OSGA 1TQPA 4D9JA 3BPVA 4I76A 4HX7A 5FKMA 5DCFA 4IL6C 2W85A 3GVAA 2EV0A 1KQ9A 4XQFA 2KDZA 3K4JA 4HBLA 1S7OA 2K27A 1ZLKA 1GV5A 4AD9A 1SEUA 4HNUA 2P5LC 2M5WA 3RI4A 1P7JA 2LK2A 4PGGA 1Z9CA 3JRBA 2MGQA 3ZP5A 5IP9J 4G7ZF 4BXFA 1GUUA 2KLOA 3V7RA 1XGNA 1XSDA 2E2IJ 3BP8A 3WTSC 4PGHA 4A12A 1KQ8A 1N25A 4YIFA 5C4XJ 3CCEI 2DMNA 1PVEA 4ZTJA 3V7SA 3MEXA 3IRRA 1VQ6I 2PJPA 2JTVA 2YX4A 3HOUJ 3KX2A 3WTYC 5GPCA 2VT3A 2PMZN 1B72A 1OISA 4RAYA 3I58A 4HSRA 5BNGA 2F2EA 4BGDA 4ENJA 2RV8A 4D7MA 3PIOF 1YG2A 2IP2A 3JSOA 3G6EI 4A3IJ 4QPOA 3DQVC 3VB2A 2COMA 2LKSA 2CWEA 4BH9A 2WY7Q 2M4KA 4YFNF 3HM5A 5A2QZ 1OPCA 1QU3A 5LHIA 3KP5A 3TW6A 4ZZDA 2B0LA 2UXXA 4E7IA 2EK5A 2EV6A 2CUFA 4NHJA 5EDNA 2GIZA 1T0FA 1R1TA 3HJEA 2M45A 2DFHA 1MW7A 5F6FA 3ZMVA 2R92J 3ULQB 1X2MA 2ZJPF 5J8FA 1ODDA 1HA8A 3TDUC 1PP8F 3L2RA 4M9ZA 5EZHA 3WTTC 4IVNA 5M3MJ 2TDXA 2DMPA 3HG9A 3TO7A 2D1VA 2JUCA 2JRTA 1F36A 4IO9F 1I3QJ 2CUJA 2JRMA 3FXQA 3S1NJ 1P7IA 3GZ6A 3JRHA 2UZKA 4GXOA 2F4IA 3NQOA 5D4RA 4ENKA 1ON1A 4M74A 5GPAA 4FETA 3RKYA 2L9RA 2DA7A 3BDDA 5TRDA 2RN7A 3WTUC 3K1PA 1P6RA 3TQNA 4ENMA 2E35A 2H8WA 4S05A 1L0OC 3VODA 4F91B 1WSUA 2IJLA 5HVQC 4Y3OA 4ETSA 3JTGA 1TWAJ 1Y1WJ 2K40A 3MKZA 3CC4I 1XGMA 2ZCWA 1VQNI 1BI1A 2KP6A 4M6XA 3H0DA 3AG2H 4DGWB 2E71A 1QRYA 4YFKF 2LRDA 4BHPA 4IOAF 6PAXA 4W97A 3FXKA 1HLVA 3BCBA 1RKTA 2A05A 2HTSA 1MMAA 4A3DJ 4F93B 1OCTC 1ETXA 5H2FC 1GVJA 3FKJA 2RAEA 5HDGA 5JHFA 1G59A 3CUQC 1R5GA 2M34A 4ZH4F 1VQ5I 3K4LA 4BBSJ 5F04A 4UUTA 2PMHA 5CVVA 3GFLA 3C1DA 4KIGA 1OR7A 4I7HA 2W84A 1V5FA 5DDGA 2ZXWH 4KISA 2UV1A 3E0JB 2OD5A 4B3XA 1T39A 4BBRJ 4ZJZA 1FLIA 3REOA 5D4SA 2RGVA 4NQWB 3TOAA 1LE8B 4R1HA 5JHUA 2BY1A 3AG4H 1ETVA 3LSIA 3K9TA 2AHQA 3HZJA 2WB1A 3LSGA 2EZLA 4L9JA 1WI3A 4XLEA 1JGGA 4I02A 2HYJA 3FMSA 4YFXF 2R5YB 5F08A 1JKQC 3LL7A 4GGGA 3IHUA 4WXDA 3HB9A 2DFIA 3RKWA 5A2QK 1R00A 5IYBJ 4AUXA 3IKTA 1GV2A 2RDPA 4FISA 1YE9A 2ZO4A 5J47A 4XK4A 1FBQA 1WJ5A 3PL8A 1U5TB 2CQKA 1Q1HA 5LEJA 1LJ9A 2J5OA 2LFBA 2VXDA 2EBIA 1IG7A 3WTVC 2V7FA 4CCLA 4CICA 4C2TA 5HODA 3S3OA 1X19A 3ZPLA 4B8XA 3GF2A 4HV6A 5KK1A 4Y7NJ 5J8CA 2OQRA 1OQYA 3GTOJ 2E1NA 4KIFA 4Q5SF 2OZUA 1HC8A 5HS7A 2H6CA 2Y9ZA 3BTLA 2LREA 2JK3A 2VN2A 1D0XA 3OYJA 5TISC 2VKEA 2CV2A 1YIJI 3ZQGA 2UUZA 2O8KA 5ED4A 2Q2EB 2B9SA 2GQQA 1XN7A 4WXCA 1QGPA 2M87A 4J00A 3S1QJ 3F8CA 2HKXA 2JN6A 4JYKA 2E7WA 2ISZA 3A01A 2MLKA 4F52A 1R1UA 1HOMA 1OCRH 2LYCA 3QODA 1S3JA 1BI0A 1ZGWA 3CO6C 2IPQX 2HPIA 1SANA 3G3ZA 1XS9A 1Y0NA 5E3MA 2A6EF 4RS8A 1MBKA 3F9KA 4XLAA 1FTTA 2XB5A 3DEUA 1FX7A 3MZ8A 3OMYA 3QPLA 3I4NJ 2LY2A 2QLZA 5LFAA 3HHHA 3HKZN 3F8BA 2X9DA 3VPRA 3U1KA 3GMEA 2IS4A 5HOOA 4EGYA 3S8PA 1E3PA 4A69C 3HUGB 1VF9A 2HVQA 2OF7A 1QVTA 3ZMZA 1R6RA 2NVUB 3OYFA 1UCRA 2Y0SN 2HYGD 2YR2A 4AIHA 1F1ZA 2ZSIB 3IC7A 3ASOH 4PFPA 4O6JA 4IHWA 4RBOA 4B1RA 3FX3A 2FMYA 3QRFF 1I39A 5ILUA 2Y30A 1MBEA 3N05A 4UVBA 2H8RA 1VFCA 3H5NA 4Q4ZF 3QP6A 3LFUA 4OIPF 4M3DA 1P4XA 2EILH 1D0YA 3SQNA 3PNVA 5HDNA 3F21A 3M8EA 2IA1A 4B4CA 3BT9A 4A3JJ 3H36A 3HPGA 4E6KG 4A3LJ 2JA2A 1ON2A 2W00A 3KP2A 3UKGA 3RZDJ 2KIFA 3HYIA 1UG0A 5BPIA 3HOYJ 1XCBA 1YYVA 2JWTA 3PO2J 1WJBA 3WE3A 2ZB9A 2ZMEA 2XGEA 1MH3A 1XX5A 3PNYA 1UB9A 4F7ZA 5JI6A 3FHZA 4Q48A 1G3TA 2FOWA 1YW9A 2E60A 1U8BA 4A3BJ 1ORKA 4MQVA 5K7HA 4D7NA 2HNHA 3SHFA 2ZXJA 2NVQJ 2GM4A 2LBFA 3NARA 1R49A 1X1CA 2JSPA 1AA7A 3DEEA 5CQEA 1HW1A 1JJ6C 4JX6A 2A5YB 1KQ0A 4MO7A 5EEAA 3D5SC 1R71A 5K5RA 1Y6IA 3HOZJ 1YTYA 3VDXA 2EB7A 3E6MA 2W7NA 3ZQQA 3AL0B 4UB8C 4ZYEA 2TCTA 1D8JA 1K4SA 4OAYA 3I59A 3FWEA 4QPQA 3LA2A 4ANJA 1OCZH 3CCMI 3BQYA 3FK6A 3KEOA 4LG0A 4XLCA 1ZR4A 1GXQA 4HAMA 3S2WA 3OYIA 3K4KA 5BPDA 3E5QA 1SAXA 2EPFA 3P9KA 1JE8A 1MBGA 1BR4A 3JRDA 1EJ9A 1WJAA 1HSTA 3OYAA 3CCYA 3CC2I 3KP4A 2FNPA 1MKMA 2NYXA 2FU4A 1ZN2A 2W4SA 4U0VA 1BA5A 1VQ8I 4E7KA 2IAIA 1OR7C 1R4MB 4LLLA 3S1RJ 1TL8A 2NXNB 2XAGA 1TTYA 3D5LA 4RB2C 3L9FA 1YX3A 4UB6C 3ZN1A 4EATA 4AU7A 4ESBA 4G6TB 1T95A 3E6BA 1UG2A 2DPUA 2NAZA 2IS1A 4XORA 2DQLA 1IV8A 1IN4A 2V6EA 5LLQA 4BY7J 2ZXIA 5K7ZA 2JVGA 3QQAA 3TDZC 2LH9A 3G1MA 5L3BA 1TNTA 3GTJJ 2Z5UA 4OMYA 2RQQA 3DLAA 3OYEA 2OTJI 2L5QA 4DYQA 5GTIC 4RGXA 1HW2A 2B7EA 2DJNA 3FK7A 1I6XA 2BHYA 2L3DA 3HTSB 3BROA 5GTHC 3S2DJ 3DXJF 4ZDLA 5HNHA 3N97A 3LAPA 1A31A 3LNQA 9ANTA 4ESJA 2VIXA 1DPUA 3GZNB 3BLYA 1ZGJA 5IYDJ 2FQ4A 2Q0OA 4QWQA 1BJAA 2ZKZA 2LR8A 3PSFA 1JXSA 3H3ZA 3H3UA 3BCAA 4WK8F 1EH6A 3PNTA 2ZSHB 3FXLA 2DT7B 4IQJA 3OV8A 3DPUA 2GZWA 2H6BA 4PK4A 3NWSA 3OY9A 2ECCA 1HKQA 3CCLI 3H9GA 4BEHB 1MMSA 4HF0A 1D1AA 1TWGJ 2G7UA 1VZ0A 3M8JA 1R23A 3I4MJ 3GFMA 3JRCA 1FSEA 5EF6A 3A4CA 3QPHA 3RKXA 2JPCA 1PUFA 4BJTA 1VNDA 4CYDA 1FBSA 2NS8A 2OA4A 2JPBA 2HOTA 2X4HA 1MJAA 1ETWA 2L7FP 3DPTA 3OYHA 3S2HJ 3M07A 2IA2A 4LJZF 2R7DA 4NC8A 2M0MA 4M6VA 4GDFA 2STWA 2DT6A 1GVDA 3CCVI 1IDYA 3SDGA 1DQUA 4FE4A 2OC6A 1OYYA 3K7AJ 4A5MA 5LHHA 2H1KA 5EEHA 2AS5F 1RRJA 3KZZA 2R7VA 5EG0A 2MSYA 1FYLA 1Z91A 1WI9A 3F8NA 1OKRA 4I0AA 1R7JA 4NNJA 3ZQ7A 1MNDA 5L3CA 4N9HA 1DGWY 2CMPA 2Q1ZB 3CJTB 2VOPA 1OJLA 1J09A 4CUGA 3KZIC 3CLQA 3WODF 2V9VA 2OBPA 1BJZA 2V1DA 3GWZA 4WX9A 4D0PA 2QKLB 1RESA 1X58A 1WFXA 5FRMA 2QQ8A 1ZRFA 1V55H 1JKOC 3GEZA 5FFXA 2O9LA 1YRNB 3HRUA 2ME6A 1R9TJ 1HF0A 4YRVA 1K78A 1LVAA 2KMUA 3DCFA 2UXNA 1H0MA 4YIRX 4CHUA 1GLNA 1VQOI 1BOAA 3JTHA 4AYBA 1SC7A 3DFGA 3ZXSA 3RPUA 2R7QA 4A0YA 3ZRGA 1V5GA 1U8RA 4GO1A 3MMYB 3WTWC 3BPXA 4KUMA 4KITB 3QYFA 3ECOA 4Y13A 4A6DA 1TNSA 1A6IA 3CUQA 3RQ4A 5FD6A 4UVAA 2MG4A 4JOMA 1W4MA 3FMRA 2XVCA 3F8MA 3ZMUA 4IHTA 2OZ6A 4A93J 1Z05A 1NHAA 3RPUD 2HDDA 2MYSA 3TEDA 1FJLA 2ZMEC 5M5XJ 2E7XA 2H94A 2L7KA 3BR3A 2O7OA 4L5EA 1O7FA 2F4OB 4I2OA 2CSOA 2FA5A 4XKWA 4CCJA 1HCRA 1BC8C 3WE2A 4EM0B 1Z6RA 3CTAA 5DCMB 5FB2A 1MGTA 4N0BA 1N75A 5L3DA 2HI3A 4A6EA 4BAYA 1ZK8A 5HLGA 2I8DA 1YFHA 1YS6A 2O5RA 3KLOA 2QVOA 1UJ8A 3GXOA 3R4KA 1N78A 1G3SA 2DFEA 2IA0A 2DTZA 2HR3A 2K3PA 4C9YA 3LSMA 2ZFUA 1XTAA 1OYWA 1MJBA 2V9KA 1YIOA 3RSNA 2P7VB 1P9QC 2JT1A 3J80Z 2X1EA 3ABUA 4RDUA 3OR2C 4G7HF 2VBYA 3A02A 3OIQA 5M5YJ 4H0EA 4L0ZB 4C2UA 4JX4A 1XG1A 2QSFX 2CQXA 4I01A 4M6YA 1UHMA 1IXCA 3VSLA 1YS7A 1FPQA 1T98A 1RC9A 2MD5A 3NWTA 4QTRA 2JA8J 2ECBA 3V7CA 3OIPA 3SZPA 1JGSA 4CGZA 2M30A 3EYIA 3K4MA 3RTRA 5FGMA 1D0ZA 1QZYA 5EGOA 3F0CA 3D5RC 1YLFA 3WGIA 4PSWA 1CF7A 1C0WA 1B9NA 1A35A 1ZRDA 1MSEC 3LSKA 1J2XA 5D6FA 3HC7A 2MFZA 4K2EA 3ISPA 4L9TA 3LSPA 1HXDA 1RPWA 3V4GA 2M2EA 2YX7A 2BXZA 3SZGA 3L7WA 2HXIA 3ZMTA 3H5RA 2ZXHA 1DPRA 2OPTA 4FCYA 4I0BA 4J19A 2DFFA 3TO9A 4E70A 5JLWA 1P92A 2FQ3A 2WAQA 4IKFA 1S5LC 3GFJA 3T8RA 1VQ4I 4EM1A 4LK0F 4IHSA 4HV5A 2X85A 1E0EA 2XGDA 3L2UA 2EINH 4CDGA 3CP2A 5FROA 1DP3A 1B8IA 4ZTFA 5EYRA 3RKQA 2DPDA 2CV1A 4HNTA 2ELJA 3E97A 4X0GA 2PX9A 2K7LA 3B6CA 2D1HA 2OU2A 3G71I 1UHSA 4HF2A 1WGXA 3QPTA 2K9SA 2M3AA 4M72A 4X6AJ 1WQ2A 3IUOA 4BACA 1NTCA 2L4AA 2XASA 3RDIA 3JSPA 5IP6A 1WH5A 2KZVA 4A3MJ 3IRQA 5IYCJ 1Z21A 2FNAA 2HVSA 3ECHA 2BYVE 4Y17A 1MNMC 4XIDA 2K9NA 3TP3A 2DOEA 3DBLB 1JTXA 1KGSA 4AIDA 4H4KC 3F22A 3J80K 1A5JA 2CW7A 4OU0A 2KFDA 4UHTA 2E1OA 4N9IA 1TLHB 3JRIA 2P4WA 2VC1A 4EJUA 3MKYB 3GBGA 2M7AA 2ID6A 1NK3P 3O6BB 2VPLA 1W5TA 3FISA 4MEYF 5BMZA 1FSHA 3DV8A 5B1AH 5D5VB 2ADUA 3HTUA 3T1BA 1FMVA 4UUSA 1S72I 5ERIA 5FJ8J 3IAS2 2KZGA 3WTZA 2AO9A 4LK1F 5D5XB 1SFOJ 3CCRI 1KU7A 4Y52J 4A3FJ 1G6NA 2M8EA 2BBYA 2VBZA 2DK8A 1VI0A 2LF7A 2VJ4A 2XF6A 3E7LA 4XNFA 1OLTA 5HNFA 3CMYA 2FE3A 2LD5A 2Z9OA 4BUPA 3Q0UA 1NG6A 3F6VA 2VBXA 3QAHA 3K1NA 2VJ5A 3M3YJ 3ASNH 4XL9A 3DEWA 4L18B 2JMWA 2Y0MA 4QSHA 4C3JJ 2G9WA 2MABA 1D5VA 2CQNA 2BVMA 2KKOA 3U9GA 4B09A 3MCZA 4XOTA 2E1MB 1JUPA 3MVPA 3ZQHA 5FRNA 5CKTA 4ESFA 2NVTJ 4L5IA 3ABMH 4BXUA 4U7DA 3BZKA 3C3WA 5FFZA 2IEKA 4ENNA 1I1SA 2P0WA 4XICA 3G4SI 3S93A 3BZCA 2O6GE 4HF1A 4A0ZA 2PI0A 2Z3YA 5FKOA 5L3EA 1XPXA 1S29A 4V2FA 4OIRF 1XGOA 4Y4RA 3FBIB 3K4NA 1S7EA 2GIVA 1V3FA 2IS2A 2PN6A 4LIUA 3C7JA 2STTA 3CC7I 5JFRA 2XKOA 3OYNA 2M0CA 2GAUA 5HLHA 1IXSB 4A0XA 1BC7C 3GLLA 3E1SA 5E79C 4IRGA 3TO6A 1PDNC 2R7TA 1IRZA 3FHNA 3CJRB 5B3SH 2DA6A 1T8IA 4KN7X 1U9OA 1NH3A 3CCSI 1BI2A 3I54A 3R61A 3A01B 1ZAOA 3ELKA 3K69A 3MWMA 2DK5A 2CRGA 2GXAA 1X1BA 2LSOA 5LGTA 3JAMZ 1HDDC 3GTQJ 2X1CA 1JHHA 4ITVA 5BOXA 2XAHA 2KRCA 1BI3A 3CD6I 3ZMSA 4M3FA 3PFIA 4EGZA 2M9HA 3I3LA 1AWCA 1JHFA 2HU9A 1V54H 3V8JA 4WXHA 2K9QA 2KHMA 3B73A 1TP4A 5CVIA 2HZDA 4ASNA 2PLYA 4QLCU 4DJAA 4OMZA 4UY8I 4WWCA 4IQ4A 1QVUA 1IRGA 3FKIJ 1OMIA 3ZR8X 4ZDOA 1FTZA 2BW3A 5EEGA 1R58A 4BHBA 2QM3A 2Y69H 2LMDA 3K6GA 4XRSG 1A36A 2VL8A 1ZELA 4L5JA 3V42A 2ZNYA 4E4HA 4ZC3A 2BE5F 5J40A 2FEZA 2LDUA 4P96A 4CO8A 1VQKI 4PJNA 2VT2A 2Z16A 5F64A 2OCCH 5F0HA 2QBYA 1QA6A 3O3KA 1P2FA 2XRLA 3RQIA 4FX0A 1G2HA 1U6GA 3BR0A 3KP3A 4FASD 1J5YA 4LITA 2L54A 5D8KB 1EKEA 1OYIA 2F5DA 3LA7A 5FO5A 2CU7A 2ETHA 4HZFA 1XDUA 2Z2SB 4WF2A 3KCCA 5E1XA 2VKHA 3ONQA 2K9LA 1R1VA 1X4PA 4XSXF 4PUSA 2EIJH 3JR9A 3N4MA 4M9SA 5HS8A 3CCQI 1IV6A 1RKWA 1K6OA 2NOGA 4KT6A 3BQZA 4NQWA 1LUJB 2DA4A 1LE8A 1YOVB 3TL4X 3OS2A 1ZARA 2IGOA 2LOOA 4Z2YA 2EA2A 1J75A 2JA6J 1Z67A 2F6CA 5KCMA 1LDDA 3GUDA 5DD8A 1QHHD 4I09A 3PUFA 3HIFA 4A5NA 2LBFB 2R5YA 2X6WA 3CJNA 3IH2A 5KVRA 2DYRH 3NEUA 1BR1A 1LFPA 4JP0A 4IF4A 2L4MA 4B44A 3GTLJ 2LVSA 5D5UB 2VKVA 3MZHA 1Q1VA 4UVCA 3IWZA 1W0UA 2NRAC 2R3SA 2EZHA 2XRNA 5DS9A 1JUMA 2L01A 2IXSA 3I64A 3UNGC 3L1PA 3HOWJ 2VI6A 2BY3A 3HSEA 2WTEA 4BQNA 1O3SA 1AOYA 3JAMK 3PO3J 3E5XA 1A6QA 2GLOA 2PG4A 5C4JJ 2ZFWA 3E5UA 3J7AO 1DGRM 1MNEA 1UAAA 1V5EA 2AXLA 2BY2A 2LY9A 4FT8A 1ZG3A 3HOTA 4WCGA 1WKMA 3EETA 2WC2A 2D45A 1Z6TA 4E7HA 3BC8A 5K5QA 2LF8A 4R8HA 4V2GA 2BGCA 2M8GX 2X48A 3WGHA 2A61A 4HQMA 1WJCA 4O3MA 1FEXA 4AVPA 1AU7A 3I55I 2DDBA 3OYGA 5L3GA 3KEYA 4RGSA 4MHGA 1ITYA 4PJLA 5E3NA 2R7ZJ 2E5ZA 2CH0A 4ZZLA 3SEZA 2Q2EA 1E3OC 3EQLF 3CESA 4RA2A 1POGA 1D5YA 1MIJA 2L0KA 3VYTB 1B6AA 5LGUA 2XDVA 1BBYA 2W57A 2R5ZA 3PFYA 2ESHA 3VWBA 1MJ9A 1STZA 2V26A 4NB5A 1HKSA 3MD2A 3OSFA 1ENHA 2HKOA 2H27A 2E5NA 2Z99A 3FXMA 3I53A 4BXXJ 1VQ7I 3P9CA 2BXYA 2LLKA 2LKPA 3CMMA 4AVZA 1ETOA 4Y33A 2CV0A 1E2XA 3GTGJ 3HRSA 5D5WB 1GHCA 1H88C 3CF2A 3HUGA 3KEQA 1OFCX 2X51A 4LLGF 3W6VA 2J5PA 4LGWA 5ICEA 1HKTA 2AXTC 1Y56A 2PQ8A 1IRXA 2RNGA 3CP8A 3TKYA 3W2VA 4LFUA 4XBFA 3P9IA 4DBRA 3AKZA 4HX8A 2YU3A 4D1QA 1RNLA 1K6YA 5CVJA 4IHVA 2R7RA 4BE2A 1W36D 4HG2A 2VJJA 1L3LA 2L02A 1I27A 1ZHFA 3OOPA 4RB0A 2CO5A 2PMZA 1ETKA 3L2CA 2P8TA 1PUFB 2FBIA 3JW4A 2RKHA 4P55A 1XCVA 2L9VA 2DXIA 1KU3A
chains in the Genus database with same CATH topology
3LSTA 2VONA 3LA3A 1DP7P 2FBKA 3Q9VA 4S04A 4EMSA 3FXUA 3WU0A 3NRVA 1BIAA 4IRIA 4U88A 2W24A 4PZJA 3SZTA 3BWGA 1H9GA 3KLNA 3G73A 3BJAA 4IXAA 1YQAA 1O3RA 2P5VA 3HSRA 5H6RA 5DEQA 2KIMA 5E8GA 3I5UA 2K86A 3BJ6A 3Q9SA 5L3FA 1K79A 1XSXA 2HYFA 2V79A 2QQBA 3FM5A 3SFZA 3KZYA 4HDUA 2EV5A 3LQQA 3I71A 1QQIA 4IRHA 5IT3A 2FSWA 2HQNA 2H09A 1MDMB 3VEPA 3CUQB 5D8LB 5E17F 4U0YA 1LEAA 4M71A 1O3QA 2XGXA 2PMUA 2XV4S 2UWMA 2WV0A 1SMYF 1S7AA 1DUXC 2HZTA 4KDPA 4GYIA 4HLYA 3M8FA 2VBWA 3I0TA 1IN7A 4MGRA 2A3SA 4KICA 1U3EM 4R79A 2VE9A 2FXAA 3W6KB 2P5KA 2CFXA 4L0YB 4EQQA 1U5TC 3O2PE 1W5SA 4ZYDA 1QPMA 2GA2A 1FT9A 1GXPA 1R22A 5JR3A 2HGCA 4M9XA 5DUIA 3DF8A 1X3UA 2XIGA 2MC3A 2WWYA 4P9UA 3COAC 1ZREA 1LNWA 3CDHA 1RIOH 2VC0A 1TQIA 2XHKA 2ESNA 4Y15A 2VXZA 2GWRA 1W7PA 2EFNA 1D8KA 1P4WA 2E1CA 3M1EA 4OIQF 4RGRA 2QWWA 2KRFA 4RGUA 1IN8A 1MZBA 4AIKA 1W7PD 4LLNA 1IXRC 4L9NA 1HSJA 1HQCA 5FD5A 1BM9A 2EFPA 2ISYA 4G94A 2ZBKA 3RPQA 4MNUA 3F8FA 1IZ1A 3RIRA 5ILVA 1G3YA 3F23A 2LNBA 2RC4A 1FYMA 2KIUA 4OOIA 2P6SA 2ACJA 1MD0A 1YW8A 5LGNA 4FHTA 3R6SA 3IKVA 1QBJA 3GW2A 1IRFA 1TW3A 5HS9A 2RQPA 3WTXC 3WG9A 1ZRCA 1QO0D 4IJAA 3QU3A 3I4PA 1IAWA 2BV6A 4EM2A 1LB2A 4LB6B 2FRHA 2XAJA 1RUOA 4KT5C 5AIQA 5DCMA 2DBBA 3P7NA 1FNNA 4MTEA 3V8KA 2Q8KA 2QYOA 2QQ9A 1REPC 3C18A 1TQMA 4Q47A 2BEOA 2X0LA 2XUBA 3TOBA 5ICCA 2F5FA 3T5XA 5J6XA 3ERED 5E20A 1LDKB 3BOQA 4MEXF 3RYRA 1YW7A 5TJJA 4CZZA 1SFEA 3RYPA 4KIBA 1A04A 2JSCA 2QQAA 5ICGA 2GXBA 2XAFA 1BN5A 2MA3A 1O3TA 3CO7C 4OIOF 3LAJA 1WRJA 4UV8A 3FZVA 3ROUA 1F5TA 1FWZA 1EH8A 2P7CB 1F4KA 4M73A 2DT5A 3ZN0A 1SD4A 3M7GA 1H9TA 5BQTA 4U0WA 4PCQA 5DV5A 4KYWA 4XRFA 1B4AA 4ZYHA 3F3XA 3J81Z 4HLXA 5JVTA 2G7HA 5K1YA 4AIJA 4HDVA 1YO5C 2RVCA 4ZYGA 1SFUA 3VOEA 4U7BA 2QBYB 1B9MA 1ULYA 1FBUA 4EV0A 4KMUX 1S8NA 2O8XA 1IW7F 1KU9A 3WGGA 4G6QA 4BNCA 1BIBA 3QOPA 1LDJA 3BJOA 1SMTA 2M1BA 5E1ZB 5D6EA 4EJVA 2FOKA 1B1BA 2JZYA 3U2RA 1XB4A 1SD6A 3PQKA 1K7AA 3F6OA 3BZ6A 5DYMA 2FF4A 4KA4A 5ILSA 2QENA 1B59A 1Z7UA 2HDCA 1XMAA 3IL2A 1ZYRF 4KN4X 2PEXA 3PQJA 5AONA 5CVRA 1FY7A 4G6DA 3F72A 4A2UA 1T6SA 3RJPA 5H6QA 2A07F 4IPAA 1I1GA 5LRSA 1ONVA 2EJRA 3V8LA 4DQ2A 5F1RA 3J81K 2Z33A 3GYHX 2ZMEB 2DI3A 3GLXA 2OAZA 1TBXA 4L9VA 1BC7C 2NS0A 3D0SA 3U1DA 2PBIA 4EJTA 2P6TA 3CUOA 3Q5FA 1DDNA 3LQRA 1ZLJA 4MTDA 4XLNF 3M9AA 4XSZF 2QZ8A 2XKPA 1U5TA 2KJCA 3I59B 2A68F 1IF1A 2A69F 1S6LA 4LG0B 1O7LA 4RB1A 5AIPA 4KFCA 1FYKA 3TGNA 4BHCA 2EFOA 4GCVA 2IW5A 2W25A 4UNOA 4UUVA 3HOSA 3FF5A 1EV7A 2DO7A 1P4AA 4JBAA 5FLXZ 5ICFA 2O3FA 3KFWX 5CLSA 4HA8A 4CXFA 1D3YA 3LWFA 4JK1X 4P9FA 4XLPF 2CGPA 4GYGA 2O61A 3B02A 1ZGAA 3HRTA 2CG4A 2XROA 2IT0A 3EYYA 1RZ4A 5IT9Z 2YSRA 2XAQA 2EWNA 3BY6A 1TW2A 3W6JB 2V6CA 2HOEA 3T8TA 4ON0A 2DW4A 5E1WA 4G9YA 2PFBA 3MAJA 3R0AA 5CYVA 4EVIA 1FC3A 2V1UA 4O5VA 1V4RA 1FOKA 3GO5A 1U78A 1U2WA 5E18F 2IVMA 3EUHA 2FMLA 1CGPA 4RB3C 2DLLA 3WU1B 3ZMDA 3MQ0A 3QU6A 2ZNZA 3R60A 4YIIA 1J0RA 2ELHA 2GXGA 2CW0F 4HOBA 4OINF 4AWXB 1PUEE 3KP6A 4HYEA 1Y0UA 2NNYA 2Y48A 1G4DA 2FBHA 2DTRA 4TV7A 1HBXG 2HS5A 1Z1DA 2MLGA 1RUNA 2IRFG 1F9NA 1WWXA 2DQRA 3QP5A 2EFWA 2HTJA 4G8XA 5FLXK 5E8IA 4HW0A 3ABTA 4KMFA 4HQEA 3FMQA 5LBQA 2F5CA 1O57A 1K78B 2RNJA 3K1MA 4I98B 4G7OF 5IT9K 3GFIA 2D2WA 4RAZA 1J59A 2C6YA 1ZG5A 3KP7A 2KJBA 2EA4A 1USSA 2R7FA 3VFZA 1G3WA 1R5HA 4LB5A 2HQRA 1XMKA 2VODA 1J7KA 2EFQA 3K0LA 1IN5A 1VTNC 1IUYA 1EH7A 2V1XA 1KA8A 1W7PB 2NNNA 1XD7A 1QNTA 1RI7A 5LRRA 5LEKA 5DD4A 1PP7U 2O0YA 5HDKA 3L00A 3LFKA 1LEBA 1ZG1A 2OQGA 3ML6A 2VOOA 4EJWA 4MQ9F 4UXNA 2GA1A 1R36A 1FP1D 4DNCA 3DKWA 2MH2A 1SFXA 2O03A 2K4JA 4BYYA 1T2KA 3DPLC 1I5ZA 4FX4A 2YPRA 2A6HF 2CYYA 3E3VA 4BQAA 4P5OA 3FXRA 2HEOA 3MZYA 4UV9A 3L09A 1SD7A 2K4BA 3GZ5A 1LQ1A 3DP7A 4JQFA 3SXYA 1CF7B 3E6CC 1MDMA 2ZJ2A 2VE8A 2DAOA 3K2ZA 2HFHA 2F5EA 3T0YA 1HW5A 2HWVA 5H20A 3GX4X 3HHGA 1KYWA 1KYZA 1J9IA 5CVUA 5DUKA 3IWFA 1SD5A 2DU9A 1FP2A 2QUFA 1ZH5A 5BS6A 5HLIA 4HX4A 1UFMA 4LD5A 3CLOA 3MFKA 1QZZA 3KE2A 1XGSA 3H92A 2K02A 5K5OA 3FM3A 3EDPA 1XSVA 1FZPB 4EJOA 1XDSA 3HRMA 3E6DA 1T38A 2Y75A 5LHGA 1E17A 1IN6A 1UHWA 3KETA 2MBFA 4LMYA 3R0JA 4PDKA 2MH9A 4KNYA 1USTA 3AAFA 5CJ9A 4YG2F 3HSFA 1KU2A 1TQPA 3BPVA 4HX7A 5DCFA 2W85A 3GVAA 2EV0A 1KQ9A 4HBLA 1S7OA 2K27A 1ZLKA 4AD9A 2P5LC 2M5WA 3RI4A 4PGGA 1Z9CA 4G7ZF 3ZP5A 3V7RA 1XGNA 1XSDA 3BP8A 3WTSC 4PGHA 4A12A 1KQ8A 4YIFA 3V7SA 3MEXA 3IRRA 2PJPA 2JTVA 2YX4A 3WTYC 2VT3A 4RAYA 3I58A 2F2EA 4ENJA 2RV8A 3JSOA 1YG2A 2IP2A 3DQVC 3VB2A 2COMA 4BH9A 2CWEA 4YFNF 5A2QZ 1OPCA 5LHIA 3KP5A 4ZZDA 2B0LA 2UXXA 2EK5A 2EV6A 4NHJA 1T0FA 1R1TA 2M45A 5F6FA 3ZMVA 3ULQB 5J8FA 1ODDA 3TDUC 1PP8F 4M9ZA 3WTTC 4IVNA 2TDXA 3TO7A 2D1VA 2JRTA 3FXQA 3GZ6A 2UZKA 4GXOA 3NQOA 5D4RA 4ENKA 1ON1A 4M74A 3RKYA 5TRDA 3BDDA 2RN7A 3WTUC 3K1PA 1P6RA 3TQNA 4ENMA 4S05A 1L0OC 3VODA 1WSUA 2IJLA 5HVQC 4ETSA 3JTGA 1XGMA 2ZCWA 1BI1A 4M6XA 4YFKF 4BHPA 6PAXA 2HTSA 1GVJA 5HDGA 3CUQC 1R5GA 4ZH4F 2PMHA 5CVVA 3GFLA 3C1DA 4KIGA 1OR7A 4I7HA 2W84A 5DDGA 1T39A 2OD5A 1FLIA 3REOA 5D4SA 2RGVA 3TOAA 4R1HA 5JHUA 3K9TA 4L9JA 4I02A 3FMSA 4YFXF 4GGGA 3IHUA 4WXDA 2DFIA 3RKWA 5A2QK 1R00A 3IKTA 2RDPA 2ZO4A 1FBQA 1U5TB 2CQKA 1Q1HA 5LEJA 1LJ9A 2J5OA 3WTVC 4CICA 3ZPLA 4B8XA 3GF2A 4HV6A 5KK1A 5J8CA 2OQRA 2E1NA 4KIFA 4Q5SF 2OZUA 5HS7A 2H6CA 2VN2A 5ED4A 2GQQA 1XN7A 4WXCA 1QGPA 2M87A 3F8CA 2HKXA 2E7WA 2ISZA 2MLKA 1R1UA 1S3JA 1BI0A 3CO6C 2IPQX 3G3ZA 2A6EF 4RS8A 3DEUA 1FX7A 2QLZA 3HHHA 3F8BA 5HOOA 4EGYA 3ZMZA 1UCRA 2HYGD 2YR2A 4AIHA 1F1ZA 3IC7A 4O6JA 3FX3A 2FMYA 3QRFF 5ILUA 4UVBA 4Q4ZF 3QP6A 4OIPF 1P4XA 3SQNA 5HDNA 3F21A 3M8EA 2IA1A 1ON2A 3KP2A 2KIFA 3HYIA 5BPIA 1XCBA 1YYVA 3WE3A 2ZMEA 5JI6A 3FHZA 4F7ZA 1UB9A 4Q48A 1G3TA 1YW9A 4MQVA 3SHFA 2ZXJA 1HW1A 2A5YB 1KQ0A 5K5RA 1YTYA 2EB7A 3E6MA 4ZYEA 1D8JA 3I59A 3FWEA 3LA2A 3KEOA 4LG0A 1GXQA 4HAMA 3S2WA 5BPDA 1SAXA 3E5QA 3P9KA 1JE8A 1HSTA 3KP4A 2FNPA 1MKMA 2NYXA 2FU4A 1ZN2A 4U0VA 4LLLA 2XAGA 1TTYA 3D5LA 4RB2C 3L9FA 3ZN1A 4ESBA 2DPUA 3E6BA 2NAZA 2DQLA 1IN4A 5LLQA 3TDZC 5L3BA 1TNTA 2Z5UA 4OMYA 4RGXA 1HW2A 1I6XA 2L3DA 3HTSB 3BROA 3DXJF 3N97A 3LAPA 4ESJA 1DPUA 1ZGJA 2Q0OA 4QWQA 1BJAA 2ZKZA 1JXSA 3H3ZA 3H3UA 4WK8F 1EH6A 3OV8A 2GZWA 2H6BA 1HKQA 4HF0A 2G7UA 1R23A 3GFMA 1FSEA 3RKXA 3QPHA 2JPCA 4CYDA 1FBSA 2OA4A 2JPBA 2X4HA 1MJAA 3DPTA 2IA2A 4LJZF 2R7DA 2STWA 5LHHA 1OYYA 4A5MA 5EEHA 2AS5F 3KZZA 1FYLA 1Z91A 1WI9A 3F8NA 1OKRA 4I0AA 1R7JA 3ZQ7A 5L3CA 4N9HA 2VOPA 3WODF 2V9VA 2OBPA 2V1DA 3GWZA 4WX9A 4D0PA 1ZRFA 3GEZA 5FFXA 3HRUA 1K78A 1LVAA 2UXNA 1H0MA 4CHUA 1BOAA 3JTHA 3DFGA 3RPUA 4A0YA 1U8RA 4GO1A 3WTWC 3BPXA 4KUMA 3ECOA 4Y13A 4A6DA 1TNSA 3CUQA 5FD6A 4UVAA 1W4MA 3FMRA 2XVCA 3F8MA 3ZMUA 4IHTA 2OZ6A 1Z05A 1NHAA 2E7XA 2H94A 1O7FA 4I2OA 2CSOA 2FA5A 1BC8C 3WE2A 4EM0B 1Z6RA 3CTAA 5DCMB 5FB2A 1MGTA 4N0BA 5L3DA 4A6EA 4BAYA 5HLGA 1YFHA 1YS6A 3KLOA 2QVOA 3GXOA 3R4KA 1G3SA 2IA0A 2HR3A 1OYWA 1MJBA 1YIOA 2P7VB 2JT1A 3J80Z 3ABUA 4G7HF 2VBYA 4H0EA 4L0ZB 4I01A 4M6YA 1UHMA 1IXCA 1YS7A 1FPQA 1T98A 2MD5A 3V7CA 3SZPA 1JGSA 4CGZA 2M30A 3EYIA 3RTRA 5FGMA 1QZYA 3WGIA 1YLFA 1CF7A 1C0WA 1B9NA 1ZRDA 1J2XA 5D6FA 4K2EA 3ISPA 4L9TA 1HXDA 3V4GA 2YX7A 3L7WA 3ZMTA 1DPRA 4I0BA 3TO9A 4E70A 1P92A 2FQ3A 3GFJA 3T8RA 4EM1A 4LK0F 4IHSA 4HV5A 4CDGA 2DPDA 3E97A 2K7LA 2D1HA 2OU2A 4HF2A 3QPTA 4M72A 1WQ2A 2L4AA 2XASA 3RDIA 3JSPA 3IRQA 2FNAA 3ECHA 2BYVE 4Y17A 1KGSA 3F22A 3J80K 4OU0A 4UHTA 4N9IA 1TLHB 2P4WA 2VC1A 4EJUA 3O6BB 1W5TA 4MEYF 5BMZA 1FSHA 3DV8A 5D5VB 2ADUA 3HTUA 3T1BA 5ERIA 3WTZA 5D5XB 4LK1F 1KU7A 1G6NA 2M8EA 2BBYA 2VBZA 2DK8A 2LF7A 2FE3A 2Z9OA 3F6VA 2VBXA 3QAHA 3K1NA 4L18B 2Y0MA 2G9WA 1D5VA 2KKOA 3U9GA 4B09A 3MCZA 4ESFA 4L5IA 4BXUA 4U7DA 3C3WA 5FFZA 4ENNA 1I1SA 4HF1A 2O6GE 4A0ZA 2PI0A 2Z3YA 5L3EA 1S29A 4OIRF 1XGOA 2GIVA 1V3FA 2PN6A 3C7JA 2STTA 5JFRA 2XKOA 2GAUA 5HLHA 1IXSB 4A0XA 3TO6A 4IRGA 1PDNC 4KN7X 1BI2A 3I54A 3R61A 1ZAOA 3ELKA 3K69A 3MWMA 2DK5A 2LSOA 5LGTA 3JAMZ 1JHHA 5BOXA 2XAHA 1BI3A 3ZMSA 3PFIA 4EGZA 1AWCA 1JHFA 3V8JA 4WXHA 3B73A 5CVIA 4ASNA 2PLYA 4QLCU 4OMZA 4WWCA 1IRGA 1OMIA 5EEGA 1R58A 4BHBA 2QM3A 4L5JA 2ZNYA 2BE5F 2FEZA 2LDUA 4P96A 4CO8A 2VT2A 5F64A 2QBYA 3O3KA 1P2FA 4FX0A 1U6GA 3KP3A 1J5YA 5D8KB 2L54A 2F5DA 1OYIA 3LA7A 5FO5A 2ETHA 4HZFA 1XDUA 4WF2A 3KCCA 5E1XA 1R1VA 4XSXF 3N4MA 4M9SA 5HS8A 1K6OA 4NQWA 1ZARA 4Z2YA 2EA2A 1J75A 1LDDA 3GUDA 5DD8A 4I09A 3HIFA 4A5NA 3CJNA 5KVRA 3NEUA 4IF4A 2L4MA 5D5UB 3MZHA 4UVCA 3IWZA 2NRAC 2R3SA 2XRNA 2L01A 3I64A 3HSEA 2WTEA 1O3SA 1AOYA 3JAMK 3E5XA 2PG4A 2ZFWA 3E5UA 3J7AO 4FT8A 2AXLA 1ZG3A 3HOTA 4WCGA 1WKMA 3EETA 2WC2A 2D45A 1Z6TA 5K5QA 2LF8A 4R8HA 2BGCA 3WGHA 2A61A 4HQMA 4O3MA 4AVPA 5L3GA 4RGSA 4MHGA 4ZZLA 2Q2EA 3EQLF 1B6AA 5LGUA 1BBYA 2W57A 2ESHA 1MJ9A 1STZA 4NB5A 1HKSA 2HKOA 2H27A 2Z99A 3I53A 3P9CA 2LKPA 1E2XA 3HRSA 5D5WB 1GHCA 3HUGA 3KEQA 4LLGF 2J5PA 4LGWA 5ICEA 1HKTA 2PQ8A 3TKYA 4LFUA 4XBFA 3P9IA 4HX8A 2YU3A 1RNLA 5CVJA 1L3LA 2L02A 1I27A 1ZHFA 3OOPA 4RB0A 2CO5A 3L2CA 2P8TA 2FBIA 3JW4A 2RKHA 4P55A 1XCVA 1KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LST A;  2VON A;  3LA3 A;  1DP7 P;  2FBK A;  3Q9V A;  4S04 A;  4EMS A;  3FXU A;  3WU0 A;  3NRV A;  1BIA A;  4IRI A;  4U88 A;  2W24 A;  4PZJ A;  3SZT A;  3BWG A;  1H9G A;  3KLN A;  3G73 A;  3BJA A;  4IXA A;  1YQA A;  1O3R A;  2P5V A;  3HSR A;  5H6R A;  5DEQ A;  2KIM A;  5E8G A;  3I5U A;  2K86 A;  3BJ6 A;  3Q9S A;  5L3F A;  1K79 A;  1XSX A;  2HYF A;  2V79 A;  2QQB A;  3FM5 A;  3SFZ A;  3KZY A;  4HDU A;  2EV5 A;  3LQQ A;  3I71 A;  1QQI A;  4IRH A;  5IT3 A;  2FSW A;  2HQN A;  2H09 A;  1MDM B;  3VEP A;  3CUQ B;  5D8L B;  5E17 F;  4U0Y A;  1LEA A;  4M71 A;  1O3Q A;  2XGX A;  2PMU A;  2XV4 S;  2UWM A;  2WV0 A;  1SMY F;  1S7A A;  1DUX C;  2HZT A;  4KDP A;  4GYI A;  4HLY A;  3M8F A;  2VBW A;  3I0T A;  1IN7 A;  4MGR A;  2A3S A;  4KIC A;  1U3E M;  4R79 A;  2VE9 A;  2FXA A;  3W6K B;  2P5K A;  2CFX A;  4L0Y B;  4EQQ A;  1U5T C;  3O2P E;  1W5S A;  4ZYD A;  1QPM A;  2GA2 A;  1FT9 A;  1GXP A;  1R22 A;  5JR3 A;  2HGC A;  4M9X A;  5DUI A;  3DF8 A;  1X3U A;  2XIG A;  2MC3 A;  2WWY A;  4P9U A;  3COA C;  1ZRE A;  1LNW A;  3CDH A;  1RIO H;  2VC0 A;  1TQI A;  2XHK A;  2ESN A;  4Y15 A;  2VXZ A;  2GWR A;  1W7P A;  2EFN A;  1D8K A;  1P4W A;  2E1C A;  3M1E A;  4OIQ F;  4RGR A;  2QWW A;  2KRF A;  4RGU A;  1IN8 A;  1MZB A;  4AIK A;  1W7P D;  4LLN A;  1IXR C;  4L9N A;  1HSJ A;  1HQC A;  5FD5 A;  1BM9 A;  2EFP A;  2ISY A;  4G94 A;  2ZBK A;  3RPQ A;  4MNU A;  3F8F A;  1IZ1 A;  3RIR A;  5ILV A;  1G3Y A;  3F23 A;  2LNB A;  2RC4 A;  1FYM A;  2KIU A;  4OOI A;  2P6S A;  2ACJ A;  1MD0 A;  1YW8 A;  5LGN A;  4FHT A;  3R6S A;  3IKV A;  1QBJ A;  3GW2 A;  1IRF A;  1TW3 A;  5HS9 A;  2RQP A;  3WTX C;  3WG9 A;  1ZRC A;  1QO0 D;  4IJA A;  3QU3 A;  3I4P A;  1IAW A;  2BV6 A;  4EM2 A;  1LB2 A;  4LB6 B;  2FRH A;  2XAJ A;  1RUO A;  4KT5 C;  5AIQ A;  5DCM A;  2DBB A;  3P7N A;  1FNN A;  4MTE A;  3V8K A;  2Q8K A;  2QYO A;  2QQ9 A;  1REP C;  3C18 A;  1TQM A;  4Q47 A;  2BEO A;  2X0L A;  2XUB A;  3TOB A;  5ICC A;  2F5F A;  3T5X A;  5J6X A;  3ERE D;  5E20 A;  1LDK B;  3BOQ A;  4MEX F;  3RYR A;  1YW7 A;  5TJJ A;  4CZZ A;  1SFE A;  3RYP A;  4KIB A;  1A04 A;  2JSC A;  2QQA A;  5ICG A;  2GXB A;  2XAF A;  1BN5 A;  2MA3 A;  1O3T A;  3CO7 C;  4OIO F;  3LAJ A;  1WRJ A;  4UV8 A;  3FZV A;  3ROU A;  1F5T A;  1FWZ A;  1EH8 A;  2P7C B;  1F4K A;  4M73 A;  2DT5 A;  3ZN0 A;  1SD4 A;  3M7G A;  1H9T A;  5BQT A;  4U0W A;  4PCQ A;  5DV5 A;  4KYW A;  4XRF A;  1B4A A;  4ZYH A;  3F3X A;  3J81 Z;  4HLX A;  5JVT A;  2G7H A;  5K1Y A;  4AIJ A;  4HDV A;  1YO5 C;  2RVC A;  4ZYG A;  1SFU A;  3VOE A;  4U7B A;  2QBY B;  1B9M A;  1ULY A;  1FBU A;  4EV0 A;  4KMU X;  1S8N A;  2O8X A;  1IW7 F;  1KU9 A;  3WGG A;  4G6Q A;  4BNC A;  1BIB A;  3QOP A;  1LDJ A;  3BJO A;  1SMT A;  2M1B A;  5E1Z B;  5D6E A;  4EJV A;  2FOK A;  1B1B A;  2JZY A;  3U2R A;  1XB4 A;  1SD6 A;  3PQK A;  1K7A A;  3F6O A;  3BZ6 A;  5DYM A;  2FF4 A;  4KA4 A;  5ILS A;  2QEN A;  1B59 A;  1Z7U A;  2HDC A;  1XMA A;  3IL2 A;  1ZYR F;  4KN4 X;  2PEX A;  3PQJ A;  5AON A;  5CVR A;  1FY7 A;  4G6D A;  3F72 A;  4A2U A;  1T6S A;  3RJP A;  5H6Q A;  2A07 F;  4IPA A;  1I1G A;  5LRS A;  1ONV A;  2EJR A;  3V8L A;  4DQ2 A;  5F1R A;  3J81 K;  2Z33 A;  3GYH X;  2ZME B;  2DI3 A;  3GLX A;  2OAZ A;  1TBX A;  4L9V A;  1BC7 C;  2NS0 A;  3D0S A;  3U1D A;  2PBI A;  4EJT A;  2P6T A;  3CUO A;  3Q5F A;  1DDN A;  3LQR A;  1ZLJ A;  4MTD A;  4XLN F;  3M9A A;  4XSZ F;  2QZ8 A;  2XKP A;  1U5T A;  2KJC A;  3I59 B;  2A68 F;  1IF1 A;  2A69 F;  1S6L A;  4LG0 B;  1O7L A;  4RB1 A;  5AIP A;  4KFC A;  1FYK A;  3TGN A;  4BHC A;  2EFO A;  4GCV A;  2IW5 A;  2W25 A;  4UNO A;  4UUV A;  3HOS A;  3FF5 A;  1EV7 A;  2DO7 A;  1P4A A;  4JBA A;  5FLX Z;  5ICF A;  2O3F A;  3KFW X;  5CLS A;  4HA8 A;  4CXF A;  1D3Y A;  3LWF A;  4JK1 X;  4P9F A;  4XLP F;  2CGP A;  4GYG A;  2O61 A;  3B02 A;  1ZGA A;  3HRT A;  2CG4 A;  2XRO A;  2IT0 A;  3EYY A;  1RZ4 A;  5IT9 Z;  2YSR A;  2XAQ A;  2EWN A;  3BY6 A;  1TW2 A;  3W6J B;  2V6C A;  2HOE A;  3T8T A;  4ON0 A;  2DW4 A;  5E1W A;  4G9Y A;  2PFB A;  3MAJ A;  3R0A A;  5CYV A;  4EVI A;  1FC3 A;  2V1U A;  4O5V A;  1V4R A;  1FOK A;  3GO5 A;  1U78 A;  1U2W A;  5E18 F;  2IVM A;  3EUH A;  2FML A;  1CGP A;  4RB3 C;  2DLL A;  3WU1 B;  3ZMD A;  3MQ0 A;  3QU6 A;  2ZNZ A;  3R60 A;  4YII A;  1J0R A;  2ELH A;  2GXG A;  2CW0 F;  4HOB A;  4OIN F;  4AWX B;  1PUE E;  3KP6 A;  4HYE A;  1Y0U A;  2NNY A;  2Y48 A;  1G4D A;  2FBH A;  2DTR A;  4TV7 A;  1HBX G;  2HS5 A;  1Z1D A;  2MLG A;  1RUN A;  2IRF G;  1F9N A;  1WWX A;  2DQR A;  3QP5 A;  2EFW A;  2HTJ A;  4G8X A;  5FLX K;  5E8I A;  4HW0 A;  3ABT A;  4KMF A;  4HQE A;  3FMQ A;  5LBQ A;  2F5C A;  1O57 A;  1K78 B;  2RNJ A;  3K1M A;  4I98 B;  4G7O F;  5IT9 K;  3GFI A;  2D2W A;  4RAZ A;  1J59 A;  2C6Y A;  1ZG5 A;  3KP7 A;  2KJB A;  2EA4 A;  1USS A;  2R7F A;  3VFZ A;  1G3W A;  1R5H A;  4LB5 A;  2HQR A;  1XMK A;  2VOD A;  1J7K A;  2EFQ A;  3K0L A;  1IN5 A;  1VTN C;  1IUY A;  1EH7 A;  2V1X A;  1KA8 A;  1W7P B;  2NNN A;  1XD7 A;  1QNT A;  1RI7 A;  5LRR A;  5LEK A;  5DD4 A;  1PP7 U;  2O0Y A;  5HDK A;  3L00 A;  3LFK A;  1LEB A;  1ZG1 A;  2OQG A;  3ML6 A;  2VOO A;  4EJW A;  4MQ9 F;  4UXN A;  2GA1 A;  1R36 A;  1FP1 D;  4DNC A;  3DKW A;  2MH2 A;  1SFX A;  2O03 A;  2K4J A;  4BYY A;  1T2K A;  3DPL C;  1I5Z A;  4FX4 A;  2YPR A;  2A6H F;  2CYY A;  3E3V A;  4BQA A;  4P5O A;  3FXR A;  2HEO A;  3MZY A;  4UV9 A;  3L09 A;  1SD7 A;  2K4B A;  3GZ5 A;  1LQ1 A;  3DP7 A;  4JQF A;  3SXY A;  1CF7 B;  3E6C C;  1MDM A;  2ZJ2 A;  2VE8 A;  2DAO A;  3K2Z A;  2HFH A;  2F5E A;  3T0Y A;  1HW5 A;  2HWV A;  5H20 A;  3GX4 X;  3HHG A;  1KYW A;  1KYZ A;  1J9I A;  5CVU A;  5DUK A;  3IWF A;  1SD5 A;  2DU9 A;  1FP2 A;  2QUF A;  1ZH5 A;  5BS6 A;  5HLI A;  4HX4 A;  1UFM A;  4LD5 A;  3CLO A;  3MFK A;  1QZZ A;  3KE2 A;  1XGS A;  3H92 A;  2K02 A;  5K5O A;  3FM3 A;  3EDP A;  1XSV A;  1FZP B;  4EJO A;  1XDS A;  3HRM A;  3E6D A;  1T38 A;  2Y75 A;  5LHG A;  1E17 A;  1IN6 A;  1UHW A;  3KET A;  2MBF A;  4LMY A;  3R0J A;  4PDK A;  2MH9 A;  4KNY A;  1UST A;  3AAF A;  5CJ9 A;  4YG2 F;  3HSF A;  1KU2 A;  1TQP A;  3BPV A;  4HX7 A;  5DCF A;  2W85 A;  3GVA A;  2EV0 A;  1KQ9 A;  4HBL A;  1S7O A;  2K27 A;  1ZLK A;  4AD9 A;  2P5L C;  2M5W A;  3RI4 A;  4PGG A;  1Z9C A;  4G7Z F;  3ZP5 A;  3V7R A;  1XGN A;  1XSD A;  3BP8 A;  3WTS C;  4PGH A;  4A12 A;  1KQ8 A;  4YIF A;  3V7S A;  3MEX A;  3IRR A;  2PJP A;  2JTV A;  2YX4 A;  3WTY C;  2VT3 A;  4RAY A;  3I58 A;  2F2E A;  4ENJ A;  2RV8 A;  3JSO A;  1YG2 A;  2IP2 A;  3DQV C;  3VB2 A;  2COM A;  4BH9 A;  2CWE A;  4YFN F;  5A2Q Z;  1OPC A;  5LHI A;  3KP5 A;  4ZZD A;  2B0L A;  2UXX A;  2EK5 A;  2EV6 A;  4NHJ A;  1T0F A;  1R1T A;  2M45 A;  5F6F A;  3ZMV A;  3ULQ B;  5J8F A;  1ODD A;  3TDU C;  1PP8 F;  4M9Z A;  3WTT C;  4IVN A;  2TDX A;  3TO7 A;  2D1V A;  2JRT A;  3FXQ A;  3GZ6 A;  2UZK A;  4GXO A;  3NQO A;  5D4R A;  4ENK A;  1ON1 A;  4M74 A;  3RKY A;  5TRD A;  3BDD A;  2RN7 A;  3WTU C;  3K1P A;  1P6R A;  3TQN A;  4ENM A;  4S05 A;  1L0O C;  3VOD A;  1WSU A;  2IJL A;  5HVQ C;  4ETS A;  3JTG A;  1XGM A;  2ZCW A;  1BI1 A;  4M6X A;  4YFK F;  4BHP A;  6PAX A;  2HTS A;  1GVJ A;  5HDG A;  3CUQ C;  1R5G A;  4ZH4 F;  2PMH A;  5CVV A;  3GFL A;  3C1D A;  4KIG A;  1OR7 A;  4I7H A;  2W84 A;  5DDG A;  1T39 A;  2OD5 A;  1FLI A;  3REO A;  5D4S A;  2RGV A;  3TOA A;  4R1H A;  5JHU A;  3K9T A;  4L9J A;  4I02 A;  3FMS A;  4YFX F;  4GGG A;  3IHU A;  4WXD A;  2DFI A;  3RKW A;  5A2Q K;  1R00 A;  3IKT A;  2RDP A;  2ZO4 A;  1FBQ A;  1U5T B;  2CQK A;  1Q1H A;  5LEJ A;  1LJ9 A;  2J5O A;  3WTV C;  4CIC A;  3ZPL A;  4B8X A;  3GF2 A;  4HV6 A;  5KK1 A;  5J8C A;  2OQR A;  2E1N A;  4KIF A;  4Q5S F;  2OZU A;  5HS7 A;  2H6C A;  2VN2 A;  5ED4 A;  2GQQ A;  1XN7 A;  4WXC A;  1QGP A;  2M87 A;  3F8C A;  2HKX A;  2E7W A;  2ISZ A;  2MLK A;  1R1U A;  1S3J A;  1BI0 A;  3CO6 C;  2IPQ X;  3G3Z A;  2A6E F;  4RS8 A;  3DEU A;  1FX7 A;  2QLZ A;  3HHH A;  3F8B A;  5HOO A;  4EGY A;  3ZMZ A;  1UCR A;  2HYG D;  2YR2 A;  4AIH A;  1F1Z A;  3IC7 A;  4O6J A;  3FX3 A;  2FMY A;  3QRF F;  5ILU A;  4UVB A;  4Q4Z F;  3QP6 A;  4OIP F;  1P4X A;  3SQN A;  5HDN A;  3F21 A;  3M8E A;  2IA1 A;  1ON2 A;  3KP2 A;  2KIF A;  3HYI A;  5BPI A;  1XCB A;  1YYV A;  3WE3 A;  2ZME A;  5JI6 A;  3FHZ A;  4F7Z A;  1UB9 A;  4Q48 A;  1G3T A;  1YW9 A;  4MQV A;  3SHF A;  2ZXJ A;  1HW1 A;  2A5Y B;  1KQ0 A;  5K5R A;  1YTY A;  2EB7 A;  3E6M A;  4ZYE A;  1D8J A;  3I59 A;  3FWE A;  3LA2 A;  3KEO A;  4LG0 A;  1GXQ A;  4HAM A;  3S2W A;  5BPD A;  1SAX A;  3E5Q A;  3P9K A;  1JE8 A;  1HST A;  3KP4 A;  2FNP A;  1MKM A;  2NYX A;  2FU4 A;  1ZN2 A;  4U0V A;  4LLL A;  2XAG A;  1TTY A;  3D5L A;  4RB2 C;  3L9F A;  3ZN1 A;  4ESB A;  2DPU A;  3E6B A;  2NAZ A;  2DQL A;  1IN4 A;  5LLQ A;  3TDZ C;  5L3B A;  1TNT A;  2Z5U A;  4OMY A;  4RGX A;  1HW2 A;  1I6X A;  2L3D A;  3HTS B;  3BRO A;  3DXJ F;  3N97 A;  3LAP A;  4ESJ A;  1DPU A;  1ZGJ A;  2Q0O A;  4QWQ A;  1BJA A;  2ZKZ A;  1JXS A;  3H3Z A;  3H3U A;  4WK8 F;  1EH6 A;  3OV8 A;  2GZW A;  2H6B A;  1HKQ A;  4HF0 A;  2G7U A;  1R23 A;  3GFM A;  1FSE A;  3RKX A;  3QPH A;  2JPC A;  4CYD A;  1FBS A;  2OA4 A;  2JPB A;  2X4H A;  1MJA A;  3DPT A;  2IA2 A;  4LJZ F;  2R7D A;  2STW A;  5LHH A;  1OYY A;  4A5M A;  5EEH A;  2AS5 F;  3KZZ A;  1FYL A;  1Z91 A;  1WI9 A;  3F8N A;  1OKR A;  4I0A A;  1R7J A;  3ZQ7 A;  5L3C A;  4N9H A;  2VOP A;  3WOD F;  2V9V A;  2OBP A;  2V1D A;  3GWZ A;  4WX9 A;  4D0P A;  1ZRF A;  3GEZ A;  5FFX A;  3HRU A;  1K78 A;  1LVA A;  2UXN A;  1H0M A;  4CHU A;  1BOA A;  3JTH A;  3DFG A;  3RPU A;  4A0Y A;  1U8R A;  4GO1 A;  3WTW C;  3BPX A;  4KUM A;  3ECO A;  4Y13 A;  4A6D A;  1TNS A;  3CUQ A;  5FD6 A;  4UVA A;  1W4M A;  3FMR A;  2XVC A;  3F8M A;  3ZMU A;  4IHT A;  2OZ6 A;  1Z05 A;  1NHA A;  2E7X A;  2H94 A;  1O7F A;  4I2O A;  2CSO A;  2FA5 A;  1BC8 C;  3WE2 A;  4EM0 B;  1Z6R A;  3CTA A;  5DCM B;  5FB2 A;  1MGT A;  4N0B A;  5L3D A;  4A6E A;  4BAY A;  5HLG A;  1YFH A;  1YS6 A;  3KLO A;  2QVO A;  3GXO A;  3R4K A;  1G3S A;  2IA0 A;  2HR3 A;  1OYW A;  1MJB A;  1YIO A;  2P7V B;  2JT1 A;  3J80 Z;  3ABU A;  4G7H F;  2VBY A;  4H0E A;  4L0Z B;  4I01 A;  4M6Y A;  1UHM A;  1IXC A;  1YS7 A;  1FPQ A;  1T98 A;  2MD5 A;  3V7C A;  3SZP A;  1JGS A;  4CGZ A;  2M30 A;  3EYI A;  3RTR A;  5FGM A;  1QZY A;  3WGI A;  1YLF A;  1CF7 A;  1C0W A;  1B9N A;  1ZRD A;  1J2X A;  5D6F A;  4K2E A;  3ISP A;  4L9T A;  1HXD A;  3V4G A;  2YX7 A;  3L7W A;  3ZMT A;  1DPR A;  4I0B A;  3TO9 A;  4E70 A;  1P92 A;  2FQ3 A;  3GFJ A;  3T8R A;  4EM1 A;  4LK0 F;  4IHS A;  4HV5 A;  4CDG A;  2DPD A;  3E97 A;  2K7L A;  2D1H A;  2OU2 A;  4HF2 A;  3QPT A;  4M72 A;  1WQ2 A;  2L4A A;  2XAS A;  3RDI A;  3JSP A;  3IRQ A;  2FNA A;  3ECH A;  2BYV E;  4Y17 A;  1KGS A;  3F22 A;  3J80 K;  4OU0 A;  4UHT A;  4N9I A;  1TLH B;  2P4W A;  2VC1 A;  4EJU A;  3O6B B;  1W5T A;  4MEY F;  5BMZ A;  1FSH A;  3DV8 A;  5D5V B;  2ADU A;  3HTU A;  3T1B A;  5ERI A;  3WTZ A;  5D5X B;  4LK1 F;  1KU7 A;  1G6N A;  2M8E A;  2BBY A;  2VBZ A;  2DK8 A;  2LF7 A;  2FE3 A;  2Z9O A;  3F6V A;  2VBX A;  3QAH A;  3K1N A;  4L18 B;  2Y0M A;  2G9W A;  1D5V A;  2KKO A;  3U9G A;  4B09 A;  3MCZ A;  4ESF A;  4L5I A;  4BXU A;  4U7D A;  3C3W A;  5FFZ A;  4ENN A;  1I1S A;  4HF1 A;  2O6G E;  4A0Z A;  2PI0 A;  2Z3Y A;  5L3E A;  1S29 A;  4OIR F;  1XGO A;  2GIV A;  1V3F A;  2PN6 A;  3C7J A;  2STT A;  5JFR A;  2XKO A;  2GAU A;  5HLH A;  1IXS B;  4A0X A;  3TO6 A;  4IRG A;  1PDN C;  4KN7 X;  1BI2 A;  3I54 A;  3R61 A;  1ZAO A;  3ELK A;  3K69 A;  3MWM A;  2DK5 A;  2LSO A;  5LGT A;  3JAM Z;  1JHH A;  5BOX A;  2XAH A;  1BI3 A;  3ZMS A;  3PFI A;  4EGZ A;  1AWC A;  1JHF A;  3V8J A;  4WXH A;  3B73 A;  5CVI A;  4ASN A;  2PLY A;  4QLC U;  4OMZ A;  4WWC A;  1IRG A;  1OMI A;  5EEG A;  1R58 A;  4BHB A;  2QM3 A;  4L5J A;  2ZNY A;  2BE5 F;  2FEZ A;  2LDU A;  4P96 A;  4CO8 A;  2VT2 A;  5F64 A;  2QBY A;  3O3K A;  1P2F A;  4FX0 A;  1U6G A;  3KP3 A;  1J5Y A;  5D8K B;  2L54 A;  2F5D A;  1OYI A;  3LA7 A;  5FO5 A;  2ETH A;  4HZF A;  1XDU A;  4WF2 A;  3KCC A;  5E1X A;  1R1V A;  4XSX F;  3N4M A;  4M9S A;  5HS8 A;  1K6O A;  4NQW A;  1ZAR A;  4Z2Y A;  2EA2 A;  1J75 A;  1LDD A;  3GUD A;  5DD8 A;  4I09 A;  3HIF A;  4A5N A;  3CJN A;  5KVR A;  3NEU A;  4IF4 A;  2L4M A;  5D5U B;  3MZH A;  4UVC A;  3IWZ A;  2NRA C;  2R3S A;  2XRN A;  2L01 A;  3I64 A;  3HSE A;  2WTE A;  1O3S A;  1AOY A;  3JAM K;  3E5X A;  2PG4 A;  2ZFW A;  3E5U A;  3J7A O;  4FT8 A;  2AXL A;  1ZG3 A;  3HOT A;  4WCG A;  1WKM A;  3EET A;  2WC2 A;  2D45 A;  1Z6T A;  5K5Q A;  2LF8 A;  4R8H A;  2BGC A;  3WGH A;  2A61 A;  4HQM A;  4O3M A;  4AVP A;  5L3G A;  4RGS A;  4MHG A;  4ZZL A;  2Q2E A;  3EQL F;  1B6A A;  5LGU A;  1BBY A;  2W57 A;  2ESH A;  1MJ9 A;  1STZ A;  4NB5 A;  1HKS A;  2HKO A;  2H27 A;  2Z99 A;  3I53 A;  3P9C A;  2LKP A;  1E2X A;  3HRS A;  5D5W B;  1GHC A;  3HUG A;  3KEQ A;  4LLG F;  2J5P A;  4LGW A;  5ICE A;  1HKT A;  2PQ8 A;  3TKY A;  4LFU A;  4XBF A;  3P9I A;  4HX8 A;  2YU3 A;  1RNL A;  5CVJ A;  1L3L A;  2L02 A;  1I27 A;  1ZHF A;  3OOP A;  4RB0 A;  2CO5 A;  3L2C A;  2P8T A;  2FBI A;  3JW4 A;  2RKH A;  4P55 A;  1XCV A;  1KU3 A; 
#chains in the Genus database with same CATH topology
 5GP9 A;  3LST A;  2ID3 A;  2VON A;  3LA3 A;  2R0Q C;  1DP7 P;  2FBK A;  4BDZ A;  3BG9 A;  3Q9V A;  4S04 A;  5LD2 C;  3VYR B;  2VQH A;  3GTP J;  3C2H A;  4EMS A;  2XF7 A;  3FXU A;  3WU0 A;  3NRV A;  2E2H J;  1BIA A;  4IRI A;  1ZTR A;  2DOD A;  4U88 A;  2W24 A;  4PZJ A;  3SZT A;  5EG0 B;  5GAD J;  2JA5 J;  4CA0 A;  3BWG A;  1H9G A;  3KLN A;  3G73 A;  4NDL A;  3BJA A;  1MMN A;  1DU0 A;  2DJI A;  2LG4 A;  4IXA A;  1YQA A;  1O3R A;  2P5V A;  3BTI A;  2HDW A;  3H1C A;  3C2B A;  3HSR A;  5H6R A;  1SAU A;  1RET A;  5DEQ A;  2KIM A;  2Z1D A;  5E8G A;  3I5U A;  2K86 A;  4M3G A;  2CUE A;  1BW6 A;  2DMU A;  3BJ6 A;  3Q9S A;  5L3F A;  1Z3Y A;  2JUG A;  1K79 A;  2ME0 A;  1XSX A;  2HYF A;  2Y2Z A;  2V79 A;  2QQB A;  3FM5 A;  3SFZ A;  3KZY A;  5K7F A;  3H35 A;  4HDU A;  2EV5 A;  2CW8 A;  3LQQ A;  1ERD A;  3I71 A;  1WJD A;  1NK2 P;  4OAZ A;  1QQI A;  4IRH A;  2VQC A;  2FSW A;  2HQN A;  3DKX A;  5IP7 J;  5IT3 A;  2H09 A;  3ZQI A;  1X1D A;  1MDM B;  1TWH J;  4C3H J;  1X1A A;  3VEP A;  1QHG A;  3CUQ B;  4LG3 A;  5D8L B;  1ETY A;  3A0H C;  4FQG A;  5E17 F;  3L2V A;  4U0Y A;  1SVL A;  1LEA A;  4M71 A;  3CF5 F;  1O3Q A;  2KIS A;  2WB1 N;  2XGX A;  1Y1V J;  2XB0 X;  2PMU A;  2XV4 S;  4II3 A;  5J4Y A;  4BDY A;  1R4N B;  2UWM A;  2WV0 A;  1SMY F;  1S7A A;  2YUS A;  1DUX C;  2HZT A;  4KDP A;  4MLO A;  4GYI A;  4HLY A;  3M8F A;  2VBW A;  4N4N B;  3I0T A;  2CUZ A;  5KHD A;  1IN7 A;  4XKV A;  4MGR A;  2GOX B;  2A3S A;  4DW6 A;  4CYC A;  2DA2 A;  4KIC A;  3S32 A;  4R79 A;  1U3E M;  2R7S A;  2VE9 A;  3PJR A;  2FXA A;  3W6K B;  2COB A;  2P5K A;  2CFX A;  1YJW I;  3G2B A;  1D1B A;  4L0Y B;  4EQQ A;  1U5T C;  3LSH A;  3O2P E;  3OL4 A;  2PJR B;  2WY8 Q;  1W5S A;  4ZYD A;  1QPM A;  2GA2 A;  3BG7 A;  3DU5 A;  1FT9 A;  2GBY A;  1GXP A;  3DTE A;  4C30 A;  2DDA A;  1R22 A;  5JR3 A;  2HGC A;  2WAF A;  4M9X A;  4BEH A;  3K10 A;  5DUI A;  3ZOB A;  3DF8 A;  1KON A;  1X3U A;  2XIG A;  3QPS A;  1W5C C;  2MC3 A;  2WWY A;  4P9U A;  2DMQ A;  4NC7 A;  2QGU A;  3COA C;  1ZRE A;  2DOA A;  1Z7L A;  2QKM B;  1H8A C;  1LNW A;  4PJ0 C;  5JVG F;  4E7L A;  3CZ6 A;  3CDH A;  1UEL B;  1RIO H;  3X2Q H;  2VC0 A;  4J01 A;  1TQI A;  2XHK A;  4I6Z A;  2ESN A;  1MBJ A;  2VXZ A;  4Y15 A;  4DBQ A;  2GWR A;  2HPM A;  1W7P A;  3FBN B;  3HL2 A;  3S1M J;  5FKK A;  1FOW A;  2EFN A;  3ZCO A;  1I3A A;  1D8K A;  1P4W A;  3DKY A;  3BR5 A;  2EZK A;  2E1C A;  3M1E A;  1K4T A;  2I10 A;  4E7Z A;  4OIQ F;  4RGR A;  2QWW A;  3ZGK A;  5J1Y A;  4DOZ A;  2NVX J;  4YEL A;  4E7J A;  3PUB A;  2KRF A;  4BKX A;  3MN2 A;  3DBH B;  4RGU A;  1IN8 A;  1MH4 A;  1MZB A;  5KNL A;  1W36 C;  4M3E A;  4AIK A;  1W7P D;  3IP4 B;  1YI2 I;  4LLN A;  5M5W J;  1IXR C;  2R93 J;  4L9N A;  1HSJ A;  2DMT A;  5J1U A;  1HQC A;  4BQO A;  5GAG J;  4IHY A;  2YU9 J;  3ZQF A;  3KYD B;  4XMY A;  2LTP A;  3C2G A;  5FD5 A;  3QWL A;  1BM9 A;  2EFP A;  2ISY A;  3HKZ A;  4G94 A;  2ZBK A;  1B8I B;  1YIT I;  3RPQ A;  4MNU A;  2RRE A;  3F8F A;  1IZ1 A;  3RIR A;  2DYS H;  5ILV A;  1G3Y A;  3F23 A;  2LNB A;  2Y0S A;  1IJW C;  2RC4 A;  1FYM A;  2KIU A;  4OOI A;  1FIP A;  2P6S A;  3ABK H;  2AQE A;  5F0C A;  2WA0 A;  1B72 B;  4CSW A;  2ACJ A;  1MD0 A;  1YW8 A;  3BR6 A;  5LGN A;  1TZL A;  2TRT A;  4FHT A;  3WG7 H;  3WHC A;  1TWC J;  4HRI A;  1TC3 C;  2QF7 A;  1X4O A;  4E7S A;  3R6S A;  5F0F A;  3OWT A;  3IKV A;  1QBJ A;  4I99 C;  2X1D A;  2CS3 A;  3GW2 A;  1IRF A;  1TW3 A;  1TT0 A;  4HPQ A;  3SJM A;  5HS9 A;  2RQP A;  2LP0 A;  3WTX C;  1TWF J;  2X6X A;  1EA3 A;  3DU6 A;  2W1O A;  4MIM A;  3WG9 A;  4CCM A;  4XN3 A;  4BS9 A;  1ZRC A;  1QO0 D;  4IJA A;  2VPR A;  2BY0 A;  3ZQC A;  3QU3 A;  4CH7 A;  3I4P A;  3TBI A;  1YJ9 I;  1W1W E;  2BV6 A;  1IAW A;  3DBR B;  4EM2 A;  4BL0 B;  4LB6 B;  1LB2 A;  2FRH A;  2XAJ A;  1RUO A;  4KT5 C;  5AIQ A;  3OYB A;  2EZI A;  5DCM A;  2D5V A;  2DBB A;  1X1P A;  4Z6Y A;  4UUS B;  3BG3 A;  1W0T A;  3G1L A;  1M1E B;  2P81 A;  3P7N A;  1FNN A;  4C2M J;  4MTE A;  3CQZ J;  3V8K A;  2Q8K A;  4QIW N;  2QYO A;  2QQ9 A;  3IH3 A;  2NOJ B;  1REP C;  3C18 A;  1TQM A;  4Q47 A;  3AL0 C;  5IPA A;  2BEO A;  2X0L A;  2XUB A;  3TOB A;  5ICC A;  4NC6 A;  2F5F A;  2VLA A;  3FIW A;  3T5X A;  3DTI A;  5J6X A;  3HGY A;  3ERE D;  1AKH A;  1I6H J;  5E3O A;  3DWL E;  2CQ7 A;  5E20 A;  2IBD A;  1WCM J;  1LDK B;  3HDD A;  3CME I;  4A3C J;  1U0J A;  3QYE A;  3BOQ A;  4XKC A;  4JX5 A;  4MEX F;  4CCN A;  2E19 A;  1WJE A;  2BOL A;  2OCE A;  3RYR A;  3SFI A;  1YW7 A;  5TJJ A;  4CZZ A;  1SFE A;  3RYP A;  5B5E C;  4KIB A;  5DM6 F;  1A04 A;  2VQG A;  3G1O A;  2JSC A;  2QQA A;  5ICG A;  2GXB A;  2XAF A;  2X6O A;  4XON A;  1KZH A;  3H5A A;  1RR7 A;  1BN5 A;  1CQT A;  2ZC2 A;  3O8G A;  1WVR A;  2MA3 A;  3OYK A;  3KIO A;  1O3T A;  3CO7 C;  4OIO F;  3LAJ A;  3JRF A;  1WRJ A;  4UV8 A;  1YJN I;  3FZV A;  2QA4 I;  2XPW A;  3ROU A;  3J7Z I;  1FWZ A;  1F5T A;  1EH8 A;  3Q0V A;  2V4J C;  2K5C A;  1WH7 A;  3OOU A;  1F4K A;  4M73 A;  2P7C B;  2XAU A;  2R7W A;  2DT5 A;  2FX0 A;  3ZN0 A;  3QYB A;  1SD4 A;  3M7G A;  3H0G J;  2DA5 A;  2FD5 A;  1H9T A;  5BQT A;  2M7B A;  1JI8 A;  4U0W A;  4XRS A;  1PJR A;  3CDI A;  4PCQ A;  5DV5 A;  2CJJ A;  4PFO A;  4KYW A;  2V9P A;  2Y9Y A;  4XRF A;  1B4A A;  3OS1 A;  4KJZ A;  1PYV A;  2F48 A;  2BZT A;  2NVY J;  1ETQ A;  4ZYH A;  2BW3 B;  2DN0 A;  3F3X A;  3J81 Z;  2K85 A;  5FLV A;  1YX5 A;  3FDY A;  2A6T A;  4HLX A;  1MBF A;  5JVT A;  3LSJ A;  2G7H A;  5KAF C;  5K1Y A;  4AIJ A;  4HDV A;  5EZG A;  4HNV A;  2R4G A;  1DU6 A;  3KYL A;  1YO5 C;  2RVC A;  4ZYG A;  1SFU A;  3VOE A;  4U7B A;  3H3V K;  5IOZ A;  2QSH X;  2QBY B;  1B9M A;  1ULY A;  1FBU A;  4FTH A;  5E3L A;  1X3W B;  4EV0 A;  4KMU X;  4XLH A;  1D1C A;  1S8N A;  2QSG X;  3CJQ B;  5JLX A;  5DTD A;  4AM3 A;  2O8X A;  1F43 A;  1IW7 F;  1O4X A;  1KU9 A;  2DCE A;  3WGG A;  4G6Q A;  4BNC A;  1BIB A;  3QOP A;  1SVM A;  1LDJ A;  3BJO A;  1Y39 A;  1SMT A;  2M1B A;  5E1Z B;  1IO2 A;  5D6E A;  4EJV A;  2FOK A;  1B1B A;  2JZY A;  2WAD A;  3U2R A;  1XB4 A;  1BR2 A;  1SD6 A;  3PQK A;  4LIV A;  1IGN A;  5CPR B;  3WHB A;  2G0E A;  1K7A A;  1ACI A;  3F6O A;  3BZ6 A;  5DYM A;  2K9M A;  3L2W A;  3KYC B;  3L2Q A;  2FF4 A;  2L9N A;  3ERM A;  3A0B C;  5ILS A;  4KA4 A;  1LKX A;  1OCP A;  2W48 A;  2KQR A;  2QEN A;  3GCM A;  2KDO A;  3HEF A;  5KAI C;  5J4V A;  1B59 A;  2HVR A;  4AYB N;  4IEJ A;  1Z7U A;  2HDC A;  1XMA A;  3S3M A;  3IL2 A;  1ZYR F;  2HXO A;  2CFO A;  3K4C A;  4KN4 X;  2PEX A;  3PQJ A;  5AON A;  5CVR A;  1I50 J;  3GTK J;  1NG7 A;  1FY7 A;  3AG3 H;  1IC8 A;  3EPZ A;  4G6D A;  3F72 A;  3VSK A;  3OYC A;  4A2U A;  1T6S A;  3J7Y J;  3RJP A;  5B66 C;  5H6Q A;  1VQP I;  2A07 F;  4IPA A;  3OIO A;  1S9H A;  1OCO H;  4CCO A;  1I1G A;  2KPM A;  3JRA A;  1LFB A;  4CZC A;  3HXL A;  3MKL A;  3K70 D;  5EJC A;  3UR3 C;  3JRG A;  2XSJ C;  5LRS A;  1ONV A;  2EJR A;  3V8L A;  3HGG A;  3FXJ A;  4DQ2 A;  5F27 A;  1E3H A;  5F1R A;  3J81 K;  1X3Z B;  3GYH X;  2ZME B;  3KPH A;  3HPH A;  2DI3 A;  4NUB A;  2Z33 A;  2E36 A;  3GLX A;  2F4M B;  2OAZ A;  1AHD P;  2DA3 A;  1TBX A;  4L9V A;  2MC4 A;  2NS0 A;  4FE7 A;  2L7M P;  3D0S A;  4F3Q A;  1JKP C;  2VQL A;  4F92 B;  3HBL A;  3U1D A;  2PBI A;  1HDP A;  4EJT A;  2P6T A;  3BR2 A;  5CQG A;  2ZJQ F;  2R5Z B;  2OTL I;  3M1C A;  3ABL H;  3PIP F;  3CUO A;  3Q5F A;  1DDN A;  3LQR A;  2MW8 A;  4W1U A;  4B3A A;  4XKB A;  1ZLJ A;  4MTD A;  4XLN F;  4BY1 J;  3M9A A;  4XSZ F;  2QZ8 A;  2XKP A;  1X2N A;  3JRE A;  3HOX J;  1U5T A;  2KJC A;  3I59 B;  2A68 F;  1IF1 A;  1JT6 A;  2A69 F;  3DLL F;  1Y8Q B;  2BHZ A;  2ICW G;  1S6L A;  4LG0 B;  2HQA A;  1O7L A;  3K2A A;  4RB1 A;  5AIP A;  4HST A;  4KFC A;  4B48 A;  1FYK A;  3TGN A;  4XN0 A;  1T33 A;  4BHC A;  3S3N A;  2EFO A;  4GCV A;  2IW5 A;  2W25 A;  4UNO A;  4UUV A;  3HOS A;  3FF5 A;  1EV7 A;  2DO7 A;  1P4A A;  4JBA A;  2X6Y A;  2N8G A;  3RZO J;  5FLX Z;  5ICF A;  2O3F A;  3KFW X;  5CLS A;  2NS7 A;  5J3L A;  4HA8 A;  4CXF A;  1D3Y A;  3OYL A;  3BG5 A;  3LWF A;  1OCC H;  2B63 J;  4JK1 X;  4MFD A;  4P9F A;  4XLP F;  2CGP A;  4PJM A;  4GYG A;  2F5V A;  2O61 A;  3B02 A;  4DIQ A;  4BU2 A;  4G12 A;  1ZGA A;  3D1N I;  3HOV J;  3HRT A;  4DYR A;  2CG4 A;  4NBQ A;  2XRO A;  2IT0 A;  1T0F C;  3EYY A;  1RZ4 A;  5IT9 Z;  2GOM A;  2VAS A;  3Q3S A;  2YSR A;  3TW7 A;  2XAQ A;  2WAQ N;  1QPI A;  4GRI A;  1K61 A;  2EWN A;  3BY6 A;  1TW2 A;  3W6J B;  4PSX A;  4B47 A;  3S17 J;  2V6C A;  5IY5 H;  2HOE A;  3T8T A;  4ON0 A;  3J7A Y;  2DW4 A;  1WJF A;  5E1W A;  4G9Y A;  2MD0 A;  3M4O J;  3RCO A;  4S0H B;  2PFB A;  1LVK A;  3A03 A;  3MAJ A;  4D5F A;  3R0A A;  4RAG A;  5CYV A;  2WAE A;  4EVI A;  1FC3 A;  2V1U A;  4O5V A;  1BW5 A;  3MKW B;  1MSF C;  3LSR A;  2ELK A;  1V4R A;  3CCJ I;  1FOK A;  3GO5 A;  1U78 A;  1U2W A;  5E18 F;  2H1L A;  3WU2 C;  2XSD C;  2L2O A;  2IVM A;  3EUH A;  4M3B A;  1VQM I;  2FML A;  1CGP A;  1UMQ A;  4IX7 A;  3Q0W A;  4RB3 C;  2I5U A;  2DLL A;  3WU1 B;  3ZMD A;  3MQ0 A;  3QU6 A;  1SVO A;  2QEX I;  4IHX A;  2ZNZ A;  5FKN A;  1ZR2 A;  3W2A A;  1UZC A;  3PSI A;  3R60 A;  4YII A;  5J1R A;  4BQQ A;  1J0R A;  2ELH A;  2E34 A;  4OWR B;  4A3G J;  3O8H A;  3TMO A;  2GXG A;  1VQL I;  2CW0 F;  2V1N A;  4HOB A;  4OIN F;  2VKD A;  4AWX B;  1VQ9 I;  4A3K J;  4DYC A;  3H9Q A;  1PUE E;  4LOC A;  4ZDP A;  1N77 A;  2VUM J;  5FKL A;  3KP6 A;  4HYE A;  1Y0U A;  2NNY A;  2Y48 A;  1G4D A;  3A2K A;  2FBH A;  2DTR A;  4TV7 A;  1HBX G;  2HS5 A;  3VYU B;  1Z1D A;  2MLG A;  1RUN A;  2IRF G;  1H89 C;  1F9N A;  1WWX A;  2DQR A;  3QP5 A;  2EFW A;  2HTJ A;  4G8X A;  4RLQ A;  5FLX K;  4BE0 A;  4PJJ A;  2HQ5 A;  5E8I A;  4HW0 A;  3ABT A;  4BE1 A;  4KMF A;  3K4B A;  4HQE A;  4P1W A;  2W82 A;  3S15 J;  1YHQ I;  4CYC B;  2OV7 A;  3FMQ A;  5FLM J;  1GDT A;  2IGM A;  1JTY A;  2F5C A;  4XM3 A;  5LBQ A;  1O57 A;  3FXO A;  1BOB A;  1K78 B;  2XC7 A;  1EF4 A;  4V19 K;  2RNJ A;  3K1M A;  2E1M C;  4I98 B;  2KL4 A;  4N4O B;  5M3F J;  2IS6 A;  2AQF A;  3W3C A;  1WHU A;  3K70 C;  4G7O F;  2OUM A;  5IT9 K;  4B43 A;  4ABZ A;  3GFI A;  3CDL A;  5HLT A;  2D2W A;  4RAZ A;  1XC5 A;  4DZJ A;  4XRM A;  1ZKG A;  2WV1 A;  1J59 A;  2C6Y A;  2LY1 A;  1ZG5 A;  3OYM A;  3KP7 A;  1ZQ3 P;  5GAE J;  3ESW B;  1WPK A;  2R7U A;  1QZE A;  2KJB A;  1FOX A;  1R5I D;  1USS A;  2EA4 A;  2R7F A;  3VFZ A;  3S16 J;  1G3W A;  2XPV A;  1R5H A;  4LB5 A;  4EEF G;  5C3E J;  2HQR A;  1MBH A;  1XMK A;  4U87 A;  2VOD A;  1FMW A;  1J7K A;  3PM1 A;  3B6A A;  2EFQ A;  3K0L A;  1MMG A;  2EIM H;  2M4G A;  1IN5 A;  1VTN C;  2FUG 2;  1JT0 A;  5DM7 F;  1IUY A;  3OR1 C;  1EH7 A;  2V1X A;  1KA8 A;  1W7P B;  2NNN A;  1XD7 A;  1QNT A;  3CMA I;  1RI7 A;  4RMN A;  5LRR A;  3SYT A;  3NAU A;  5LEK A;  5DD4 A;  1PP7 U;  2JA7 J;  2O0Y A;  5HDK A;  4IZZ A;  3L00 A;  3LFK A;  3LMM A;  1LEB A;  4RM2 A;  2EIK H;  3AFH A;  1ZG1 A;  4X1E A;  4XOP A;  2OQG A;  1K83 J;  5F1J A;  1U9N A;  1Z77 A;  1FIA A;  3ML6 A;  2VOO A;  3CCU I;  4EJW A;  4MQ9 F;  3SDB A;  2DA1 A;  2GA1 A;  4UXN A;  2YS9 A;  2QCO A;  2Y31 A;  2K3F A;  1R36 A;  3AG1 H;  3W2W A;  4BJ5 C;  1FP1 D;  2R7X A;  1T08 B;  4DNC A;  3DKW A;  2MH2 A;  1SFX A;  5B1B H;  2O03 A;  2K4J A;  3VYS B;  4RLF A;  1GT0 C;  4BYY A;  5IOY A;  1T2K A;  1SFK A;  2XGC A;  1I5Z A;  3DPL C;  4FX4 A;  2YPR A;  2A6H F;  2CYY A;  3IAM 2;  3E3V A;  1APL C;  2VB6 A;  4AC0 A;  1G8X A;  2XPU A;  3SEQ A;  4P5O A;  3FXR A;  2HEO A;  4BQA A;  3MZY A;  4II2 A;  4UV9 A;  3L09 A;  1SD7 A;  2K4B A;  4ZYA A;  2EQR A;  3GZ5 A;  1LPQ A;  4HEA 2;  1IUF A;  4C3I J;  1LQ1 A;  3DP7 A;  4JQF A;  3SXY A;  5EGO B;  1CF7 B;  2EH3 A;  1XMX A;  3E6C C;  3BR1 A;  1MDM A;  2ZJ2 A;  2VE8 A;  2DAO A;  3ZQL A;  3K2Z A;  2ZJR F;  2HFH A;  2F5E A;  3QOE A;  3T0Y A;  1HW5 A;  1IDZ A;  2HWV A;  3H9J A;  5H20 A;  2L7Z A;  2JVH A;  3EUA A;  2L9S A;  3GX4 X;  3HHG A;  2WBM A;  1Z0X A;  1BL0 A;  1KYW A;  3I9V 2;  1KYZ A;  4BJ6 C;  1Z3X A;  1J9I A;  1T56 A;  2VJI A;  5CVU A;  4A3E J;  2IGN A;  5DUK A;  3IWF A;  2E2J J;  1SD5 A;  2DU9 A;  1FP2 A;  2QUF A;  1MMD A;  1FOY A;  4RAF A;  1ZH5 A;  5BS6 A;  5HLI A;  1LFU P;  4HX4 A;  1UFM A;  3BTC A;  4LD5 A;  4XLF A;  2HOS A;  3GTM J;  3CLO A;  5GAH J;  2KT0 A;  3MFK A;  1QZZ A;  3IH4 A;  3KE2 A;  1RR8 C;  1XGS A;  2KIQ A;  1YRN A;  4D5C A;  3H92 A;  3U21 A;  4DZP A;  1JJ8 C;  2K02 A;  4MFE A;  1JUS A;  2FJ1 A;  5K5O A;  3FM3 A;  4F55 A;  3EDP A;  1XSV A;  3EUK L;  5TGT A;  1FZP B;  3P5J A;  4EJO A;  1XDS A;  3HRM A;  3OYD A;  2PJR A;  3DTK A;  3OL3 A;  3IV5 A;  3EUH C;  4CCK A;  2LC2 A;  2HOA A;  3BG6 A;  3A1Y A;  3E6D A;  1T38 A;  1AKH B;  3S14 J;  2DOF A;  2Y75 A;  1JKR C;  2CQQ A;  5LHG A;  4GFB A;  2R7O A;  4RM3 A;  4XR6 A;  1E17 A;  2XF5 A;  3JCU C;  1IN6 A;  1UHW A;  2OJE D;  3KET A;  2JJ7 A;  2BVL A;  2MBF A;  3LOC A;  2A5W A;  4LMY A;  3R0J A;  4PDK A;  2LKX A;  1Y8R B;  4IOC F;  2MH9 A;  4YEJ A;  2JQ7 A;  4KNY A;  5C44 J;  1UST A;  2IGK A;  3I56 I;  3AAF A;  5CJ9 A;  4YG2 F;  3HSF A;  1TT5 B;  1WZ2 A;  1KU2 A;  2KRH A;  3TP0 A;  3BTJ A;  3OS0 A;  3OSG A;  1TQP A;  4D9J A;  3BPV A;  4I76 A;  4HX7 A;  5FKM A;  5DCF A;  4IL6 C;  2W85 A;  3GVA A;  2EV0 A;  1KQ9 A;  4XQF A;  2KDZ A;  3K4J A;  4HBL A;  1S7O A;  2K27 A;  1ZLK A;  1GV5 A;  4AD9 A;  1SEU A;  4HNU A;  2P5L C;  2M5W A;  3RI4 A;  1P7J A;  2LK2 A;  4PGG A;  1Z9C A;  3JRB A;  2MGQ A;  3ZP5 A;  5IP9 J;  4G7Z F;  4BXF A;  1GUU A;  2KLO A;  3V7R A;  1XGN A;  1XSD A;  2E2I J;  3BP8 A;  3WTS C;  4PGH A;  4A12 A;  1KQ8 A;  1N25 A;  4YIF A;  5C4X J;  3CCE I;  2DMN A;  1PVE A;  4ZTJ A;  3V7S A;  3MEX A;  3IRR A;  1VQ6 I;  2PJP A;  2JTV A;  2YX4 A;  3HOU J;  3KX2 A;  3WTY C;  5GPC A;  2VT3 A;  2PMZ N;  1B72 A;  1OIS A;  4RAY A;  3I58 A;  4HSR A;  5BNG A;  2F2E A;  4BGD A;  4ENJ A;  2RV8 A;  4D7M A;  3PIO F;  1YG2 A;  2IP2 A;  3JSO A;  3G6E I;  4A3I J;  4QPO A;  3DQV C;  3VB2 A;  2COM A;  2LKS A;  2CWE A;  4BH9 A;  2WY7 Q;  2M4K A;  4YFN F;  3HM5 A;  5A2Q Z;  1OPC A;  1QU3 A;  5LHI A;  3KP5 A;  3TW6 A;  4ZZD A;  2B0L A;  2UXX A;  4E7I A;  2EK5 A;  2EV6 A;  2CUF A;  4NHJ A;  5EDN A;  2GIZ A;  1T0F A;  1R1T A;  3HJE A;  2M45 A;  2DFH A;  1MW7 A;  5F6F A;  3ZMV A;  2R92 J;  3ULQ B;  1X2M A;  2ZJP F;  5J8F A;  1ODD A;  1HA8 A;  3TDU C;  1PP8 F;  3L2R A;  4M9Z A;  5EZH A;  3WTT C;  4IVN A;  5M3M J;  2TDX A;  2DMP A;  3HG9 A;  3TO7 A;  2D1V A;  2JUC A;  2JRT A;  1F36 A;  4IO9 F;  1I3Q J;  2CUJ A;  2JRM A;  3FXQ A;  3S1N J;  1P7I A;  3GZ6 A;  3JRH A;  2UZK A;  4GXO A;  2F4I A;  3NQO A;  5D4R A;  4ENK A;  1ON1 A;  4M74 A;  5GPA A;  4FET A;  3RKY A;  2L9R A;  2DA7 A;  3BDD A;  5TRD A;  2RN7 A;  3WTU C;  3K1P A;  1P6R A;  3TQN A;  4ENM A;  2E35 A;  2H8W A;  4S05 A;  1L0O C;  3VOD A;  4F91 B;  1WSU A;  2IJL A;  5HVQ C;  4Y3O A;  4ETS A;  3JTG A;  1TWA J;  1Y1W J;  2K40 A;  3MKZ A;  3CC4 I;  1XGM A;  2ZCW A;  1VQN I;  1BI1 A;  2KP6 A;  4M6X A;  3H0D A;  3AG2 H;  4DGW B;  2E71 A;  1QRY A;  4YFK F;  2LRD A;  4BHP A;  4IOA F;  6PAX A;  4W97 A;  3FXK A;  1HLV A;  3BCB A;  1RKT A;  2A05 A;  2HTS A;  1MMA A;  4A3D J;  4F93 B;  1OCT C;  1ETX A;  5H2F C;  1GVJ A;  3FKJ A;  2RAE A;  5HDG A;  5JHF A;  1G59 A;  3CUQ C;  1R5G A;  2M34 A;  4ZH4 F;  1VQ5 I;  3K4L A;  4BBS J;  5F04 A;  4UUT A;  2PMH A;  5CVV A;  3GFL A;  3C1D A;  4KIG A;  1OR7 A;  4I7H A;  2W84 A;  1V5F A;  5DDG A;  2ZXW H;  4KIS A;  2UV1 A;  3E0J B;  2OD5 A;  4B3X A;  1T39 A;  4BBR J;  4ZJZ A;  1FLI A;  3REO A;  5D4S A;  2RGV A;  4NQW B;  3TOA A;  1LE8 B;  4R1H A;  5JHU A;  2BY1 A;  3AG4 H;  1ETV A;  3LSI A;  3K9T A;  2AHQ A;  3HZJ A;  2WB1 A;  3LSG A;  2EZL A;  4L9J A;  1WI3 A;  4XLE A;  1JGG A;  4I02 A;  2HYJ A;  3FMS A;  4YFX F;  2R5Y B;  5F08 A;  1JKQ C;  3LL7 A;  4GGG A;  3IHU A;  4WXD A;  3HB9 A;  2DFI A;  3RKW A;  5A2Q K;  1R00 A;  5IYB J;  4AUX A;  3IKT A;  1GV2 A;  2RDP A;  4FIS A;  1YE9 A;  2ZO4 A;  5J47 A;  4XK4 A;  1FBQ A;  1WJ5 A;  3PL8 A;  1U5T B;  2CQK A;  1Q1H A;  5LEJ A;  1LJ9 A;  2J5O A;  2LFB A;  2VXD A;  2EBI A;  1IG7 A;  3WTV C;  2V7F A;  4CCL A;  4CIC A;  4C2T A;  5HOD A;  3S3O A;  1X19 A;  3ZPL A;  4B8X A;  3GF2 A;  4HV6 A;  5KK1 A;  4Y7N J;  5J8C A;  2OQR A;  1OQY A;  3GTO J;  2E1N A;  4KIF A;  4Q5S F;  2OZU A;  1HC8 A;  5HS7 A;  2H6C A;  2Y9Z A;  3BTL A;  2LRE A;  2JK3 A;  2VN2 A;  1D0X A;  3OYJ A;  5TIS C;  2VKE A;  2CV2 A;  1YIJ I;  3ZQG A;  2UUZ A;  2O8K A;  5ED4 A;  2Q2E B;  2B9S A;  2GQQ A;  1XN7 A;  4WXC A;  1QGP A;  2M87 A;  4J00 A;  3S1Q J;  3F8C A;  2HKX A;  2JN6 A;  4JYK A;  2E7W A;  2ISZ A;  3A01 A;  2MLK A;  4F52 A;  1R1U A;  1HOM A;  1OCR H;  2LYC A;  3QOD A;  1S3J A;  1BI0 A;  1ZGW A;  3CO6 C;  2IPQ X;  2HPI A;  1SAN A;  3G3Z A;  1XS9 A;  1Y0N A;  5E3M A;  2A6E F;  4RS8 A;  1MBK A;  3F9K A;  4XLA A;  1FTT A;  2XB5 A;  3DEU A;  1FX7 A;  3MZ8 A;  3OMY A;  3QPL A;  3I4N J;  2LY2 A;  2QLZ A;  5LFA A;  3HHH A;  3HKZ N;  3F8B A;  2X9D A;  3VPR A;  3U1K A;  3GME A;  2IS4 A;  5HOO A;  4EGY A;  3S8P A;  1E3P A;  4A69 C;  3HUG B;  1VF9 A;  2HVQ A;  2OF7 A;  1QVT A;  3ZMZ A;  1R6R A;  2NVU B;  3OYF A;  1UCR A;  2Y0S N;  2HYG D;  2YR2 A;  4AIH A;  1F1Z A;  2ZSI B;  3IC7 A;  3ASO H;  4PFP A;  4O6J A;  4IHW A;  4RBO A;  4B1R A;  3FX3 A;  2FMY A;  3QRF F;  1I39 A;  5ILU A;  2Y30 A;  1MBE A;  3N05 A;  4UVB A;  2H8R A;  1VFC A;  3H5N A;  4Q4Z F;  3QP6 A;  3LFU A;  4OIP F;  4M3D A;  1P4X A;  2EIL H;  1D0Y A;  3SQN A;  3PNV A;  5HDN A;  3F21 A;  3M8E A;  2IA1 A;  4B4C A;  3BT9 A;  4A3J J;  3H36 A;  3HPG A;  4E6K G;  4A3L J;  2JA2 A;  1ON2 A;  2W00 A;  3KP2 A;  3UKG A;  3RZD J;  2KIF A;  3HYI A;  1UG0 A;  5BPI A;  3HOY J;  1XCB A;  1YYV A;  2JWT A;  3PO2 J;  1WJB A;  3WE3 A;  2ZB9 A;  2ZME A;  2XGE A;  1MH3 A;  1XX5 A;  3PNY A;  1UB9 A;  4F7Z A;  5JI6 A;  3FHZ A;  4Q48 A;  1G3T A;  2FOW A;  1YW9 A;  2E60 A;  1U8B A;  4A3B J;  1ORK A;  4MQV A;  5K7H A;  4D7N A;  2HNH A;  3SHF A;  2ZXJ A;  2NVQ J;  2GM4 A;  2LBF A;  3NAR A;  1R49 A;  1X1C A;  2JSP A;  1AA7 A;  3DEE A;  5CQE A;  1HW1 A;  1JJ6 C;  4JX6 A;  2A5Y B;  1KQ0 A;  4MO7 A;  5EEA A;  3D5S C;  1R71 A;  5K5R A;  1Y6I A;  3HOZ J;  1YTY A;  3VDX A;  2EB7 A;  3E6M A;  2W7N A;  3ZQQ A;  3AL0 B;  4UB8 C;  4ZYE A;  2TCT A;  1D8J A;  1K4S A;  4OAY A;  3I59 A;  3FWE A;  4QPQ A;  3LA2 A;  4ANJ A;  1OCZ H;  3CCM I;  3BQY A;  3FK6 A;  3KEO A;  4LG0 A;  4XLC A;  1ZR4 A;  1GXQ A;  4HAM A;  3S2W A;  3OYI A;  3K4K A;  5BPD A;  3E5Q A;  1SAX A;  2EPF A;  3P9K A;  1JE8 A;  1MBG A;  1BR4 A;  3JRD A;  1EJ9 A;  1WJA A;  1HST A;  3OYA A;  3CCY A;  3CC2 I;  3KP4 A;  2FNP A;  1MKM A;  2NYX A;  2FU4 A;  1ZN2 A;  2W4S A;  4U0V A;  1BA5 A;  1VQ8 I;  4E7K A;  2IAI A;  1OR7 C;  1R4M B;  4LLL A;  3S1R J;  1TL8 A;  2NXN B;  2XAG A;  1TTY A;  3D5L A;  4RB2 C;  3L9F A;  1YX3 A;  4UB6 C;  3ZN1 A;  4EAT A;  4AU7 A;  4ESB A;  4G6T B;  1T95 A;  3E6B A;  1UG2 A;  2DPU A;  2NAZ A;  2IS1 A;  4XOR A;  2DQL A;  1IV8 A;  1IN4 A;  2V6E A;  5LLQ A;  4BY7 J;  2ZXI A;  5K7Z A;  2JVG A;  3QQA A;  3TDZ C;  2LH9 A;  3G1M A;  5L3B A;  1TNT A;  3GTJ J;  2Z5U A;  4OMY A;  2RQQ A;  3DLA A;  3OYE A;  2OTJ I;  2L5Q A;  4DYQ A;  5GTI C;  4RGX A;  1HW2 A;  2B7E A;  2DJN A;  3FK7 A;  1I6X A;  2BHY A;  2L3D A;  3HTS B;  3BRO A;  5GTH C;  3S2D J;  3DXJ F;  4ZDL A;  5HNH A;  3N97 A;  3LAP A;  1A31 A;  3LNQ A;  9ANT A;  4ESJ A;  2VIX A;  1DPU A;  3GZN B;  3BLY A;  1ZGJ A;  5IYD J;  2FQ4 A;  2Q0O A;  4QWQ A;  1BJA A;  2ZKZ A;  2LR8 A;  3PSF A;  1JXS A;  3H3Z A;  3H3U A;  3BCA A;  4WK8 F;  1EH6 A;  3PNT A;  2ZSH B;  3FXL A;  2DT7 B;  4IQJ A;  3OV8 A;  3DPU A;  2GZW A;  2H6B A;  4PK4 A;  3NWS A;  3OY9 A;  2ECC A;  1HKQ A;  3CCL I;  3H9G A;  4BEH B;  1MMS A;  4HF0 A;  1D1A A;  1TWG J;  2G7U A;  1VZ0 A;  3M8J A;  1R23 A;  3I4M J;  3GFM A;  3JRC A;  1FSE A;  5EF6 A;  3A4C A;  3QPH A;  3RKX A;  2JPC A;  1PUF A;  4BJT A;  1VND A;  4CYD A;  1FBS A;  2NS8 A;  2OA4 A;  2JPB A;  2HOT A;  2X4H A;  1MJA A;  1ETW A;  2L7F P;  3DPT A;  3OYH A;  3S2H J;  3M07 A;  2IA2 A;  4LJZ F;  2R7D A;  4NC8 A;  2M0M A;  4M6V A;  4GDF A;  2STW A;  2DT6 A;  1GVD A;  3CCV I;  1IDY A;  3SDG A;  1DQU A;  4FE4 A;  2OC6 A;  1OYY A;  3K7A J;  4A5M A;  5LHH A;  2H1K A;  5EEH A;  2AS5 F;  1RRJ A;  3KZZ A;  2R7V A;  5EG0 A;  2MSY A;  1FYL A;  1Z91 A;  1WI9 A;  3F8N A;  1OKR A;  4I0A A;  1R7J A;  4NNJ A;  3ZQ7 A;  1MND A;  5L3C A;  4N9H A;  1DGW Y;  2CMP A;  2Q1Z B;  3CJT B;  2VOP A;  1OJL A;  1J09 A;  4CUG A;  3KZI C;  3CLQ A;  3WOD F;  2V9V A;  2OBP A;  1BJZ A;  2V1D A;  3GWZ A;  4WX9 A;  4D0P A;  2QKL B;  1RES A;  1X58 A;  1WFX A;  5FRM A;  2QQ8 A;  1ZRF A;  1V55 H;  1JKO C;  3GEZ A;  5FFX A;  2O9L A;  1YRN B;  3HRU A;  2ME6 A;  1R9T J;  1HF0 A;  4YRV A;  1K78 A;  1LVA A;  2KMU A;  3DCF A;  2UXN A;  1H0M A;  4YIR X;  4CHU A;  1GLN A;  1VQO I;  1BOA A;  3JTH A;  4AYB A;  1SC7 A;  3DFG A;  3ZXS A;  3RPU A;  2R7Q A;  4A0Y A;  3ZRG A;  1V5G A;  1U8R A;  4GO1 A;  3MMY B;  3WTW C;  3BPX A;  4KUM A;  4KIT B;  3QYF A;  3ECO A;  4Y13 A;  4A6D A;  1TNS A;  1A6I A;  3CUQ A;  3RQ4 A;  5FD6 A;  4UVA A;  2MG4 A;  4JOM A;  1W4M A;  3FMR A;  2XVC A;  3F8M A;  3ZMU A;  4IHT A;  2OZ6 A;  4A93 J;  1Z05 A;  1NHA A;  3RPU D;  2HDD A;  2MYS A;  3TED A;  1FJL A;  2ZME C;  5M5X J;  2E7X A;  2H94 A;  2L7K A;  3BR3 A;  2O7O A;  4L5E A;  1O7F A;  2F4O B;  4I2O A;  2CSO A;  2FA5 A;  4XKW A;  4CCJ A;  1HCR A;  1BC8 C;  3WE2 A;  4EM0 B;  1Z6R A;  3CTA A;  5DCM B;  5FB2 A;  1MGT A;  4N0B A;  1N75 A;  5L3D A;  2HI3 A;  4A6E A;  4BAY A;  1ZK8 A;  5HLG A;  2I8D A;  1YFH A;  1YS6 A;  2O5R A;  3KLO A;  2QVO A;  1UJ8 A;  3GXO A;  3R4K A;  1N78 A;  1G3S A;  2DFE A;  2IA0 A;  2DTZ A;  2HR3 A;  2K3P A;  4C9Y A;  3LSM A;  2ZFU A;  1XTA A;  1OYW A;  1MJB A;  2V9K A;  1YIO A;  3RSN A;  2P7V B;  1P9Q C;  2JT1 A;  3J80 Z;  2X1E A;  3ABU A;  4RDU A;  3OR2 C;  4G7H F;  2VBY A;  3A02 A;  3OIQ A;  5M5Y J;  4H0E A;  4L0Z B;  4C2U A;  4JX4 A;  1XG1 A;  2QSF X;  2CQX A;  4I01 A;  4M6Y A;  1UHM A;  1IXC A;  3VSL A;  1YS7 A;  1FPQ A;  1T98 A;  1RC9 A;  2MD5 A;  3NWT A;  4QTR A;  2JA8 J;  2ECB A;  3V7C A;  3OIP A;  3SZP A;  1JGS A;  4CGZ A;  2M30 A;  3EYI A;  3K4M A;  3RTR A;  5FGM A;  1D0Z A;  1QZY A;  5EGO A;  3F0C A;  3D5R C;  1YLF A;  3WGI A;  4PSW A;  1CF7 A;  1C0W A;  1B9N A;  1A35 A;  1ZRD A;  1MSE C;  3LSK A;  1J2X A;  5D6F A;  3HC7 A;  2MFZ A;  4K2E A;  3ISP A;  4L9T A;  3LSP A;  1HXD A;  1RPW A;  3V4G A;  2M2E A;  2YX7 A;  2BXZ A;  3SZG A;  3L7W A;  2HXI A;  3ZMT A;  3H5R A;  2ZXH A;  1DPR A;  2OPT A;  4FCY A;  4I0B A;  4J19 A;  2DFF A;  3TO9 A;  4E70 A;  5JLW A;  1P92 A;  2FQ3 A;  2WAQ A;  4IKF A;  1S5L C;  3GFJ A;  3T8R A;  1VQ4 I;  4EM1 A;  4LK0 F;  4IHS A;  4HV5 A;  2X85 A;  1E0E A;  2XGD A;  3L2U A;  2EIN H;  4CDG A;  3CP2 A;  5FRO A;  1DP3 A;  1B8I A;  4ZTF A;  5EYR A;  3RKQ A;  2DPD A;  2CV1 A;  4HNT A;  2ELJ A;  3E97 A;  4X0G A;  2PX9 A;  2K7L A;  3B6C A;  2D1H A;  2OU2 A;  3G71 I;  1UHS A;  4HF2 A;  1WGX A;  3QPT A;  2K9S A;  2M3A A;  4M72 A;  4X6A J;  1WQ2 A;  3IUO A;  4BAC A;  1NTC A;  2L4A A;  2XAS A;  3RDI A;  3JSP A;  5IP6 A;  1WH5 A;  2KZV A;  4A3M J;  3IRQ A;  5IYC J;  1Z21 A;  2FNA A;  2HVS A;  3ECH A;  2BYV E;  4Y17 A;  1MNM C;  4XID A;  2K9N A;  3TP3 A;  2DOE A;  3DBL B;  1JTX A;  1KGS A;  4AID A;  4H4K C;  3F22 A;  3J80 K;  1A5J A;  2CW7 A;  4OU0 A;  2KFD A;  4UHT A;  2E1O A;  4N9I A;  1TLH B;  3JRI A;  2P4W A;  2VC1 A;  4EJU A;  3MKY B;  3GBG A;  2M7A A;  2ID6 A;  1NK3 P;  3O6B B;  2VPL A;  1W5T A;  3FIS A;  4MEY F;  5BMZ A;  1FSH A;  3DV8 A;  5B1A H;  5D5V B;  2ADU A;  3HTU A;  3T1B A;  1FMV A;  4UUS A;  1S72 I;  5ERI A;  5FJ8 J;  3IAS 2;  2KZG A;  3WTZ A;  2AO9 A;  4LK1 F;  5D5X B;  1SFO J;  3CCR I;  1KU7 A;  4Y52 J;  4A3F J;  1G6N A;  2M8E A;  2BBY A;  2VBZ A;  2DK8 A;  1VI0 A;  2LF7 A;  2VJ4 A;  2XF6 A;  3E7L A;  4XNF A;  1OLT A;  5HNF A;  3CMY A;  2FE3 A;  2LD5 A;  2Z9O A;  4BUP A;  3Q0U A;  1NG6 A;  3F6V A;  2VBX A;  3QAH A;  3K1N A;  2VJ5 A;  3M3Y J;  3ASN H;  4XL9 A;  3DEW A;  4L18 B;  2JMW A;  2Y0M A;  4QSH A;  4C3J J;  2G9W A;  2MAB A;  1D5V A;  2CQN A;  2BVM A;  2KKO A;  3U9G A;  4B09 A;  3MCZ A;  4XOT A;  2E1M B;  1JUP A;  3MVP A;  3ZQH A;  5FRN A;  5CKT A;  4ESF A;  2NVT J;  4L5I A;  3ABM H;  4BXU A;  4U7D A;  3BZK A;  3C3W A;  5FFZ A;  2IEK A;  4ENN A;  1I1S A;  2P0W A;  4XIC A;  3G4S I;  3S93 A;  3BZC A;  2O6G E;  4HF1 A;  4A0Z A;  2PI0 A;  2Z3Y A;  5FKO A;  5L3E A;  1XPX A;  1S29 A;  4V2F A;  4OIR F;  1XGO A;  4Y4R A;  3FBI B;  3K4N A;  1S7E A;  2GIV A;  1V3F A;  2IS2 A;  2PN6 A;  4LIU A;  3C7J A;  2STT A;  3CC7 I;  5JFR A;  2XKO A;  3OYN A;  2M0C A;  2GAU A;  5HLH A;  1IXS B;  4A0X A;  1BC7 C;  3GLL A;  3E1S A;  5E79 C;  4IRG A;  3TO6 A;  1PDN C;  2R7T A;  1IRZ A;  3FHN A;  3CJR B;  5B3S H;  2DA6 A;  1T8I A;  4KN7 X;  1U9O A;  1NH3 A;  3CCS I;  1BI2 A;  3I54 A;  3R61 A;  3A01 B;  1ZAO A;  3ELK A;  3K69 A;  3MWM A;  2DK5 A;  2CRG A;  2GXA A;  1X1B A;  2LSO A;  5LGT A;  3JAM Z;  1HDD C;  3GTQ J;  2X1C A;  1JHH A;  4ITV A;  5BOX A;  2XAH A;  2KRC A;  1BI3 A;  3CD6 I;  3ZMS A;  4M3F A;  3PFI A;  4EGZ A;  2M9H A;  3I3L A;  1AWC A;  1JHF A;  2HU9 A;  1V54 H;  3V8J A;  4WXH A;  2K9Q A;  2KHM A;  3B73 A;  1TP4 A;  5CVI A;  2HZD A;  4ASN A;  2PLY A;  4QLC U;  4DJA A;  4OMZ A;  4UY8 I;  4WWC A;  4IQ4 A;  1QVU A;  1IRG A;  3FKI J;  1OMI A;  3ZR8 X;  4ZDO A;  1FTZ A;  2BW3 A;  5EEG A;  1R58 A;  4BHB A;  2QM3 A;  2Y69 H;  2LMD A;  3K6G A;  4XRS G;  1A36 A;  2VL8 A;  1ZEL A;  4L5J A;  3V42 A;  2ZNY A;  4E4H A;  4ZC3 A;  2BE5 F;  5J40 A;  2FEZ A;  2LDU A;  4P96 A;  4CO8 A;  1VQK I;  4PJN A;  2VT2 A;  2Z16 A;  5F64 A;  2OCC H;  5F0H A;  2QBY A;  1QA6 A;  3O3K A;  1P2F A;  2XRL A;  3RQI A;  4FX0 A;  1G2H A;  1U6G A;  3BR0 A;  3KP3 A;  4FAS D;  1J5Y A;  4LIT A;  2L54 A;  5D8K B;  1EKE A;  1OYI A;  2F5D A;  3LA7 A;  5FO5 A;  2CU7 A;  2ETH A;  4HZF A;  1XDU A;  2Z2S B;  4WF2 A;  3KCC A;  5E1X A;  2VKH A;  3ONQ A;  2K9L A;  1R1V A;  1X4P A;  4XSX F;  4PUS A;  2EIJ H;  3JR9 A;  3N4M A;  4M9S A;  5HS8 A;  3CCQ I;  1IV6 A;  1RKW A;  1K6O A;  2NOG A;  4KT6 A;  3BQZ A;  4NQW A;  1LUJ B;  2DA4 A;  1LE8 A;  1YOV B;  3TL4 X;  3OS2 A;  1ZAR A;  2IGO A;  2LOO A;  4Z2Y A;  2EA2 A;  1J75 A;  2JA6 J;  1Z67 A;  2F6C A;  5KCM A;  1LDD A;  3GUD A;  5DD8 A;  1QHH D;  4I09 A;  3PUF A;  3HIF A;  4A5N A;  2LBF B;  2R5Y A;  2X6W A;  3CJN A;  3IH2 A;  5KVR A;  2DYR H;  3NEU A;  1BR1 A;  1LFP A;  4JP0 A;  4IF4 A;  2L4M A;  4B44 A;  3GTL J;  2LVS A;  5D5U B;  2VKV A;  3MZH A;  1Q1V A;  4UVC A;  3IWZ A;  1W0U A;  2NRA C;  2R3S A;  2EZH A;  2XRN A;  5DS9 A;  1JUM A;  2L01 A;  2IXS A;  3I64 A;  3UNG C;  3L1P A;  3HOW J;  2VI6 A;  2BY3 A;  3HSE A;  2WTE A;  4BQN A;  1O3S A;  1AOY A;  3JAM K;  3PO3 J;  3E5X A;  1A6Q A;  2GLO A;  2PG4 A;  5C4J J;  2ZFW A;  3E5U A;  3J7A O;  1DGR M;  1MNE A;  1UAA A;  1V5E A;  2AXL A;  2BY2 A;  2LY9 A;  4FT8 A;  1ZG3 A;  3HOT A;  4WCG A;  1WKM A;  3EET A;  2WC2 A;  2D45 A;  1Z6T A;  4E7H A;  3BC8 A;  5K5Q A;  2LF8 A;  4R8H A;  4V2G A;  2BGC A;  2M8G X;  2X48 A;  3WGH A;  2A61 A;  4HQM A;  1WJC A;  4O3M A;  1FEX A;  4AVP A;  1AU7 A;  3I55 I;  2DDB A;  3OYG A;  5L3G A;  3KEY A;  4RGS A;  4MHG A;  1ITY A;  4PJL A;  5E3N A;  2R7Z J;  2E5Z A;  2CH0 A;  4ZZL A;  3SEZ A;  2Q2E A;  1E3O C;  3EQL F;  3CES A;  4RA2 A;  1POG A;  1D5Y A;  1MIJ A;  2L0K A;  3VYT B;  1B6A A;  5LGU A;  2XDV A;  1BBY A;  2W57 A;  2R5Z A;  3PFY A;  2ESH A;  3VWB A;  1MJ9 A;  1STZ A;  2V26 A;  4NB5 A;  1HKS A;  3MD2 A;  3OSF A;  1ENH A;  2HKO A;  2H27 A;  2E5N A;  2Z99 A;  3FXM A;  3I53 A;  4BXX J;  1VQ7 I;  3P9C A;  2BXY A;  2LLK A;  2LKP A;  3CMM A;  4AVZ A;  1ETO A;  4Y33 A;  2CV0 A;  1E2X A;  3GTG J;  3HRS A;  5D5W B;  1GHC A;  1H88 C;  3CF2 A;  3HUG A;  3KEQ A;  1OFC X;  2X51 A;  4LLG F;  3W6V A;  2J5P A;  4LGW A;  5ICE A;  1HKT A;  2AXT C;  1Y56 A;  2PQ8 A;  1IRX A;  2RNG A;  3CP8 A;  3TKY A;  3W2V A;  4LFU A;  4XBF A;  3P9I A;  4DBR A;  3AKZ A;  4HX8 A;  2YU3 A;  4D1Q A;  1RNL A;  1K6Y A;  5CVJ A;  4IHV A;  2R7R A;  4BE2 A;  1W36 D;  4HG2 A;  2VJJ A;  1L3L A;  2L02 A;  1I27 A;  1ZHF A;  3OOP A;  4RB0 A;  2CO5 A;  2PMZ A;  1ETK A;  3L2C A;  2P8T A;  1PUF B;  2FBI A;  3JW4 A;  2RKH A;  4P55 A;  1XCV A;  2L9V A;  2DXI A;  1KU3 A; 
#chains in the Genus database with same CATH homology
 3LST A;  2VON A;  3LA3 A;  1DP7 P;  2FBK A;  3Q9V A;  4S04 A;  4EMS A;  3FXU A;  3WU0 A;  3NRV A;  1BIA A;  4IRI A;  4U88 A;  2W24 A;  4PZJ A;  3SZT A;  3BWG A;  1H9G A;  3KLN A;  3G73 A;  3BJA A;  4IXA A;  1YQA A;  1O3R A;  2P5V A;  3HSR A;  5H6R A;  5DEQ A;  2KIM A;  5E8G A;  3I5U A;  2K86 A;  3BJ6 A;  3Q9S A;  5L3F A;  1K79 A;  1XSX A;  2HYF A;  2V79 A;  2QQB A;  3FM5 A;  3SFZ A;  3KZY A;  4HDU A;  2EV5 A;  3LQQ A;  3I71 A;  1QQI A;  4IRH A;  5IT3 A;  2FSW A;  2HQN A;  2H09 A;  1MDM B;  3VEP A;  3CUQ B;  5D8L B;  5E17 F;  4U0Y A;  1LEA A;  4M71 A;  1O3Q A;  2XGX A;  2PMU A;  2XV4 S;  2UWM A;  2WV0 A;  1SMY F;  1S7A A;  1DUX C;  2HZT A;  4KDP A;  4GYI A;  4HLY A;  3M8F A;  2VBW A;  3I0T A;  1IN7 A;  4MGR A;  2A3S A;  4KIC A;  1U3E M;  4R79 A;  2VE9 A;  2FXA A;  3W6K B;  2P5K A;  2CFX A;  4L0Y B;  4EQQ A;  1U5T C;  3O2P E;  1W5S A;  4ZYD A;  1QPM A;  2GA2 A;  1FT9 A;  1GXP A;  1R22 A;  5JR3 A;  2HGC A;  4M9X A;  5DUI A;  3DF8 A;  1X3U A;  2XIG A;  2MC3 A;  2WWY A;  4P9U A;  3COA C;  1ZRE A;  1LNW A;  3CDH A;  1RIO H;  2VC0 A;  1TQI A;  2XHK A;  2ESN A;  4Y15 A;  2VXZ A;  2GWR A;  1W7P A;  2EFN A;  1D8K A;  1P4W A;  2E1C A;  3M1E A;  4OIQ F;  4RGR A;  2QWW A;  2KRF A;  4RGU A;  1IN8 A;  1MZB A;  4AIK A;  1W7P D;  4LLN A;  1IXR C;  4L9N A;  1HSJ A;  1HQC A;  5FD5 A;  1BM9 A;  2EFP A;  2ISY A;  4G94 A;  2ZBK A;  3RPQ A;  4MNU A;  3F8F A;  1IZ1 A;  3RIR A;  5ILV A;  1G3Y A;  3F23 A;  2LNB A;  2RC4 A;  1FYM A;  2KIU A;  4OOI A;  2P6S A;  2ACJ A;  1MD0 A;  1YW8 A;  5LGN A;  4FHT A;  3R6S A;  3IKV A;  1QBJ A;  3GW2 A;  1IRF A;  1TW3 A;  5HS9 A;  2RQP A;  3WTX C;  3WG9 A;  1ZRC A;  1QO0 D;  4IJA A;  3QU3 A;  3I4P A;  1IAW A;  2BV6 A;  4EM2 A;  1LB2 A;  4LB6 B;  2FRH A;  2XAJ A;  1RUO A;  4KT5 C;  5AIQ A;  5DCM A;  2DBB A;  3P7N A;  1FNN A;  4MTE A;  3V8K A;  2Q8K A;  2QYO A;  2QQ9 A;  1REP C;  3C18 A;  1TQM A;  4Q47 A;  2BEO A;  2X0L A;  2XUB A;  3TOB A;  5ICC A;  2F5F A;  3T5X A;  5J6X A;  3ERE D;  5E20 A;  1LDK B;  3BOQ A;  4MEX F;  3RYR A;  1YW7 A;  5TJJ A;  4CZZ A;  1SFE A;  3RYP A;  4KIB A;  1A04 A;  2JSC A;  2QQA A;  5ICG A;  2GXB A;  2XAF A;  1BN5 A;  2MA3 A;  1O3T A;  3CO7 C;  4OIO F;  3LAJ A;  1WRJ A;  4UV8 A;  3FZV A;  3ROU A;  1F5T A;  1FWZ A;  1EH8 A;  2P7C B;  1F4K A;  4M73 A;  2DT5 A;  3ZN0 A;  1SD4 A;  3M7G A;  1H9T A;  5BQT A;  4U0W A;  4PCQ A;  5DV5 A;  4KYW A;  4XRF A;  1B4A A;  4ZYH A;  3F3X A;  3J81 Z;  4HLX A;  5JVT A;  2G7H A;  5K1Y A;  4AIJ A;  4HDV A;  1YO5 C;  2RVC A;  4ZYG A;  1SFU A;  3VOE A;  4U7B A;  2QBY B;  1B9M A;  1ULY A;  1FBU A;  4EV0 A;  4KMU X;  1S8N A;  2O8X A;  1IW7 F;  1KU9 A;  3WGG A;  4G6Q A;  4BNC A;  1BIB A;  3QOP A;  1LDJ A;  3BJO A;  1SMT A;  2M1B A;  5E1Z B;  5D6E A;  4EJV A;  2FOK A;  1B1B A;  2JZY A;  3U2R A;  1XB4 A;  1SD6 A;  3PQK A;  1K7A A;  3F6O A;  3BZ6 A;  5DYM A;  2FF4 A;  4KA4 A;  5ILS A;  2QEN A;  1B59 A;  1Z7U A;  2HDC A;  1XMA A;  3IL2 A;  1ZYR F;  4KN4 X;  2PEX A;  3PQJ A;  5AON A;  5CVR A;  1FY7 A;  4G6D A;  3F72 A;  4A2U A;  1T6S A;  3RJP A;  5H6Q A;  2A07 F;  4IPA A;  1I1G A;  5LRS A;  1ONV A;  2EJR A;  3V8L A;  4DQ2 A;  5F1R A;  3J81 K;  2Z33 A;  3GYH X;  2ZME B;  2DI3 A;  3GLX A;  2OAZ A;  1TBX A;  4L9V A;  1BC7 C;  2NS0 A;  3D0S A;  3U1D A;  2PBI A;  4EJT A;  2P6T A;  3CUO A;  3Q5F A;  1DDN A;  3LQR A;  1ZLJ A;  4MTD A;  4XLN F;  3M9A A;  4XSZ F;  2QZ8 A;  2XKP A;  1U5T A;  2KJC A;  3I59 B;  2A68 F;  1IF1 A;  2A69 F;  1S6L A;  4LG0 B;  1O7L A;  4RB1 A;  5AIP A;  4KFC A;  1FYK A;  3TGN A;  4BHC A;  2EFO A;  4GCV A;  2IW5 A;  2W25 A;  4UNO A;  4UUV A;  3HOS A;  3FF5 A;  1EV7 A;  2DO7 A;  1P4A A;  4JBA A;  5FLX Z;  5ICF A;  2O3F A;  3KFW X;  5CLS A;  4HA8 A;  4CXF A;  1D3Y A;  3LWF A;  4JK1 X;  4P9F A;  4XLP F;  2CGP A;  4GYG A;  2O61 A;  3B02 A;  1ZGA A;  3HRT A;  2CG4 A;  2XRO A;  2IT0 A;  3EYY A;  1RZ4 A;  5IT9 Z;  2YSR A;  2XAQ A;  2EWN A;  3BY6 A;  1TW2 A;  3W6J B;  2V6C A;  2HOE A;  3T8T A;  4ON0 A;  2DW4 A;  5E1W A;  4G9Y A;  2PFB A;  3MAJ A;  3R0A A;  5CYV A;  4EVI A;  1FC3 A;  2V1U A;  4O5V A;  1V4R A;  1FOK A;  3GO5 A;  1U78 A;  1U2W A;  5E18 F;  2IVM A;  3EUH A;  2FML A;  1CGP A;  4RB3 C;  2DLL A;  3WU1 B;  3ZMD A;  3MQ0 A;  3QU6 A;  2ZNZ A;  3R60 A;  4YII A;  1J0R A;  2ELH A;  2GXG A;  2CW0 F;  4HOB A;  4OIN F;  4AWX B;  1PUE E;  3KP6 A;  4HYE A;  1Y0U A;  2NNY A;  2Y48 A;  1G4D A;  2FBH A;  2DTR A;  4TV7 A;  1HBX G;  2HS5 A;  1Z1D A;  2MLG A;  1RUN A;  2IRF G;  1F9N A;  1WWX A;  2DQR A;  3QP5 A;  2EFW A;  2HTJ A;  4G8X A;  5FLX K;  5E8I A;  4HW0 A;  3ABT A;  4KMF A;  4HQE A;  3FMQ A;  5LBQ A;  2F5C A;  1O57 A;  1K78 B;  2RNJ A;  3K1M A;  4I98 B;  4G7O F;  5IT9 K;  3GFI A;  2D2W A;  4RAZ A;  1J59 A;  2C6Y A;  1ZG5 A;  3KP7 A;  2KJB A;  2EA4 A;  1USS A;  2R7F A;  3VFZ A;  1G3W A;  1R5H A;  4LB5 A;  2HQR A;  1XMK A;  2VOD A;  1J7K A;  2EFQ A;  3K0L A;  1IN5 A;  1VTN C;  1IUY A;  1EH7 A;  2V1X A;  1KA8 A;  1W7P B;  2NNN A;  1XD7 A;  1QNT A;  1RI7 A;  5LRR A;  5LEK A;  5DD4 A;  1PP7 U;  2O0Y A;  5HDK A;  3L00 A;  3LFK A;  1LEB A;  1ZG1 A;  2OQG A;  3ML6 A;  2VOO A;  4EJW A;  4MQ9 F;  4UXN A;  2GA1 A;  1R36 A;  1FP1 D;  4DNC A;  3DKW A;  2MH2 A;  1SFX A;  2O03 A;  2K4J A;  4BYY A;  1T2K A;  3DPL C;  1I5Z A;  4FX4 A;  2YPR A;  2A6H F;  2CYY A;  3E3V A;  4BQA A;  4P5O A;  3FXR A;  2HEO A;  3MZY A;  4UV9 A;  3L09 A;  1SD7 A;  2K4B A;  3GZ5 A;  1LQ1 A;  3DP7 A;  4JQF A;  3SXY A;  1CF7 B;  3E6C C;  1MDM A;  2ZJ2 A;  2VE8 A;  2DAO A;  3K2Z A;  2HFH A;  2F5E A;  3T0Y A;  1HW5 A;  2HWV A;  5H20 A;  3GX4 X;  3HHG A;  1KYW A;  1KYZ A;  1J9I A;  5CVU A;  5DUK A;  3IWF A;  1SD5 A;  2DU9 A;  1FP2 A;  2QUF A;  1ZH5 A;  5BS6 A;  5HLI A;  4HX4 A;  1UFM A;  4LD5 A;  3CLO A;  3MFK A;  1QZZ A;  3KE2 A;  1XGS A;  3H92 A;  2K02 A;  5K5O A;  3FM3 A;  3EDP A;  1XSV A;  1FZP B;  4EJO A;  1XDS A;  3HRM A;  3E6D A;  1T38 A;  2Y75 A;  5LHG A;  1E17 A;  1IN6 A;  1UHW A;  3KET A;  2MBF A;  4LMY A;  3R0J A;  4PDK A;  2MH9 A;  4KNY A;  1UST A;  3AAF A;  5CJ9 A;  4YG2 F;  3HSF A;  1KU2 A;  1TQP A;  3BPV A;  4HX7 A;  5DCF A;  2W85 A;  3GVA A;  2EV0 A;  1KQ9 A;  4HBL A;  1S7O A;  2K27 A;  1ZLK A;  4AD9 A;  2P5L C;  2M5W A;  3RI4 A;  4PGG A;  1Z9C A;  4G7Z F;  3ZP5 A;  3V7R A;  1XGN A;  1XSD A;  3BP8 A;  3WTS C;  4PGH A;  4A12 A;  1KQ8 A;  4YIF A;  3V7S A;  3MEX A;  3IRR A;  2PJP A;  2JTV A;  2YX4 A;  3WTY C;  2VT3 A;  4RAY A;  3I58 A;  2F2E A;  4ENJ A;  2RV8 A;  3JSO A;  1YG2 A;  2IP2 A;  3DQV C;  3VB2 A;  2COM A;  4BH9 A;  2CWE A;  4YFN F;  5A2Q Z;  1OPC A;  5LHI A;  3KP5 A;  4ZZD A;  2B0L A;  2UXX A;  2EK5 A;  2EV6 A;  4NHJ A;  1T0F A;  1R1T A;  2M45 A;  5F6F A;  3ZMV A;  3ULQ B;  5J8F A;  1ODD A;  3TDU C;  1PP8 F;  4M9Z A;  3WTT C;  4IVN A;  2TDX A;  3TO7 A;  2D1V A;  2JRT A;  3FXQ A;  3GZ6 A;  2UZK A;  4GXO A;  3NQO A;  5D4R A;  4ENK A;  1ON1 A;  4M74 A;  3RKY A;  5TRD A;  3BDD A;  2RN7 A;  3WTU C;  3K1P A;  1P6R A;  3TQN A;  4ENM A;  4S05 A;  1L0O C;  3VOD A;  1WSU A;  2IJL A;  5HVQ C;  4ETS A;  3JTG A;  1XGM A;  2ZCW A;  1BI1 A;  4M6X A;  4YFK F;  4BHP A;  6PAX A;  2HTS A;  1GVJ A;  5HDG A;  3CUQ C;  1R5G A;  4ZH4 F;  2PMH A;  5CVV A;  3GFL A;  3C1D A;  4KIG A;  1OR7 A;  4I7H A;  2W84 A;  5DDG A;  1T39 A;  2OD5 A;  1FLI A;  3REO A;  5D4S A;  2RGV A;  3TOA A;  4R1H A;  5JHU A;  3K9T A;  4L9J A;  4I02 A;  3FMS A;  4YFX F;  4GGG A;  3IHU A;  4WXD A;  2DFI A;  3RKW A;  5A2Q K;  1R00 A;  3IKT A;  2RDP A;  2ZO4 A;  1FBQ A;  1U5T B;  2CQK A;  1Q1H A;  5LEJ A;  1LJ9 A;  2J5O A;  3WTV C;  4CIC A;  3ZPL A;  4B8X A;  3GF2 A;  4HV6 A;  5KK1 A;  5J8C A;  2OQR A;  2E1N A;  4KIF A;  4Q5S F;  2OZU A;  5HS7 A;  2H6C A;  2VN2 A;  5ED4 A;  2GQQ A;  1XN7 A;  4WXC A;  1QGP A;  2M87 A;  3F8C A;  2HKX A;  2E7W A;  2ISZ A;  2MLK A;  1R1U A;  1S3J A;  1BI0 A;  3CO6 C;  2IPQ X;  3G3Z A;  2A6E F;  4RS8 A;  3DEU A;  1FX7 A;  2QLZ A;  3HHH A;  3F8B A;  5HOO A;  4EGY A;  3ZMZ A;  1UCR A;  2HYG D;  2YR2 A;  4AIH A;  1F1Z A;  3IC7 A;  4O6J A;  3FX3 A;  2FMY A;  3QRF F;  5ILU A;  4UVB A;  4Q4Z F;  3QP6 A;  4OIP F;  1P4X A;  3SQN A;  5HDN A;  3F21 A;  3M8E A;  2IA1 A;  1ON2 A;  3KP2 A;  2KIF A;  3HYI A;  5BPI A;  1XCB A;  1YYV A;  3WE3 A;  2ZME A;  5JI6 A;  3FHZ A;  4F7Z A;  1UB9 A;  4Q48 A;  1G3T A;  1YW9 A;  4MQV A;  3SHF A;  2ZXJ A;  1HW1 A;  2A5Y B;  1KQ0 A;  5K5R A;  1YTY A;  2EB7 A;  3E6M A;  4ZYE A;  1D8J A;  3I59 A;  3FWE A;  3LA2 A;  3KEO A;  4LG0 A;  1GXQ A;  4HAM A;  3S2W A;  5BPD A;  1SAX A;  3E5Q A;  3P9K A;  1JE8 A;  1HST A;  3KP4 A;  2FNP A;  1MKM A;  2NYX A;  2FU4 A;  1ZN2 A;  4U0V A;  4LLL A;  2XAG A;  1TTY A;  3D5L A;  4RB2 C;  3L9F A;  3ZN1 A;  4ESB A;  2DPU A;  3E6B A;  2NAZ A;  2DQL A;  1IN4 A;  5LLQ A;  3TDZ C;  5L3B A;  1TNT A;  2Z5U A;  4OMY A;  4RGX A;  1HW2 A;  1I6X A;  2L3D A;  3HTS B;  3BRO A;  3DXJ F;  3N97 A;  3LAP A;  4ESJ A;  1DPU A;  1ZGJ A;  2Q0O A;  4QWQ A;  1BJA A;  2ZKZ A;  1JXS A;  3H3Z A;  3H3U A;  4WK8 F;  1EH6 A;  3OV8 A;  2GZW A;  2H6B A;  1HKQ A;  4HF0 A;  2G7U A;  1R23 A;  3GFM A;  1FSE A;  3RKX A;  3QPH A;  2JPC A;  4CYD A;  1FBS A;  2OA4 A;  2JPB A;  2X4H A;  1MJA A;  3DPT A;  2IA2 A;  4LJZ F;  2R7D A;  2STW A;  5LHH A;  1OYY A;  4A5M A;  5EEH A;  2AS5 F;  3KZZ A;  1FYL A;  1Z91 A;  1WI9 A;  3F8N A;  1OKR A;  4I0A A;  1R7J A;  3ZQ7 A;  5L3C A;  4N9H A;  2VOP A;  3WOD F;  2V9V A;  2OBP A;  2V1D A;  3GWZ A;  4WX9 A;  4D0P A;  1ZRF A;  3GEZ A;  5FFX A;  3HRU A;  1K78 A;  1LVA A;  2UXN A;  1H0M A;  4CHU A;  1BOA A;  3JTH A;  3DFG A;  3RPU A;  4A0Y A;  1U8R A;  4GO1 A;  3WTW C;  3BPX A;  4KUM A;  3ECO A;  4Y13 A;  4A6D A;  1TNS A;  3CUQ A;  5FD6 A;  4UVA A;  1W4M A;  3FMR A;  2XVC A;  3F8M A;  3ZMU A;  4IHT A;  2OZ6 A;  1Z05 A;  1NHA A;  2E7X A;  2H94 A;  1O7F A;  4I2O A;  2CSO A;  2FA5 A;  1BC8 C;  3WE2 A;  4EM0 B;  1Z6R A;  3CTA A;  5DCM B;  5FB2 A;  1MGT A;  4N0B A;  5L3D A;  4A6E A;  4BAY A;  5HLG A;  1YFH A;  1YS6 A;  3KLO A;  2QVO A;  3GXO A;  3R4K A;  1G3S A;  2IA0 A;  2HR3 A;  1OYW A;  1MJB A;  1YIO A;  2P7V B;  2JT1 A;  3J80 Z;  3ABU A;  4G7H F;  2VBY A;  4H0E A;  4L0Z B;  4I01 A;  4M6Y A;  1UHM A;  1IXC A;  1YS7 A;  1FPQ A;  1T98 A;  2MD5 A;  3V7C A;  3SZP A;  1JGS A;  4CGZ A;  2M30 A;  3EYI A;  3RTR A;  5FGM A;  1QZY A;  3WGI A;  1YLF A;  1CF7 A;  1C0W A;  1B9N A;  1ZRD A;  1J2X A;  5D6F A;  4K2E A;  3ISP A;  4L9T A;  1HXD A;  3V4G A;  2YX7 A;  3L7W A;  3ZMT A;  1DPR A;  4I0B A;  3TO9 A;  4E70 A;  1P92 A;  2FQ3 A;  3GFJ A;  3T8R A;  4EM1 A;  4LK0 F;  4IHS A;  4HV5 A;  4CDG A;  2DPD A;  3E97 A;  2K7L A;  2D1H A;  2OU2 A;  4HF2 A;  3QPT A;  4M72 A;  1WQ2 A;  2L4A A;  2XAS A;  3RDI A;  3JSP A;  3IRQ A;  2FNA A;  3ECH A;  2BYV E;  4Y17 A;  1KGS A;  3F22 A;  3J80 K;  4OU0 A;  4UHT A;  4N9I A;  1TLH B;  2P4W A;  2VC1 A;  4EJU A;  3O6B B;  1W5T A;  4MEY F;  5BMZ A;  1FSH A;  3DV8 A;  5D5V B;  2ADU A;  3HTU A;  3T1B A;  5ERI A;  3WTZ A;  5D5X B;  4LK1 F;  1KU7 A;  1G6N A;  2M8E A;  2BBY A;  2VBZ A;  2DK8 A;  2LF7 A;  2FE3 A;  2Z9O A;  3F6V A;  2VBX A;  3QAH A;  3K1N A;  4L18 B;  2Y0M A;  2G9W A;  1D5V A;  2KKO A;  3U9G A;  4B09 A;  3MCZ A;  4ESF A;  4L5I A;  4BXU A;  4U7D A;  3C3W A;  5FFZ A;  4ENN A;  1I1S A;  4HF1 A;  2O6G E;  4A0Z A;  2PI0 A;  2Z3Y A;  5L3E A;  1S29 A;  4OIR F;  1XGO A;  2GIV A;  1V3F A;  2PN6 A;  3C7J A;  2STT A;  5JFR A;  2XKO A;  2GAU A;  5HLH A;  1IXS B;  4A0X A;  3TO6 A;  4IRG A;  1PDN C;  4KN7 X;  1BI2 A;  3I54 A;  3R61 A;  1ZAO A;  3ELK A;  3K69 A;  3MWM A;  2DK5 A;  2LSO A;  5LGT A;  3JAM Z;  1JHH A;  5BOX A;  2XAH A;  1BI3 A;  3ZMS A;  3PFI A;  4EGZ A;  1AWC A;  1JHF A;  3V8J A;  4WXH A;  3B73 A;  5CVI A;  4ASN A;  2PLY A;  4QLC U;  4OMZ A;  4WWC A;  1IRG A;  1OMI A;  5EEG A;  1R58 A;  4BHB A;  2QM3 A;  4L5J A;  2ZNY A;  2BE5 F;  2FEZ A;  2LDU A;  4P96 A;  4CO8 A;  2VT2 A;  5F64 A;  2QBY A;  3O3K A;  1P2F A;  4FX0 A;  1U6G A;  3KP3 A;  1J5Y A;  5D8K B;  2L54 A;  2F5D A;  1OYI A;  3LA7 A;  5FO5 A;  2ETH A;  4HZF A;  1XDU A;  4WF2 A;  3KCC A;  5E1X A;  1R1V A;  4XSX F;  3N4M A;  4M9S A;  5HS8 A;  1K6O A;  4NQW A;  1ZAR A;  4Z2Y A;  2EA2 A;  1J75 A;  1LDD A;  3GUD A;  5DD8 A;  4I09 A;  3HIF A;  4A5N A;  3CJN A;  5KVR A;  3NEU A;  4IF4 A;  2L4M A;  5D5U B;  3MZH A;  4UVC A;  3IWZ A;  2NRA C;  2R3S A;  2XRN A;  2L01 A;  3I64 A;  3HSE A;  2WTE A;  1O3S A;  1AOY A;  3JAM K;  3E5X A;  2PG4 A;  2ZFW A;  3E5U A;  3J7A O;  4FT8 A;  2AXL A;  1ZG3 A;  3HOT A;  4WCG A;  1WKM A;  3EET A;  2WC2 A;  2D45 A;  1Z6T A;  5K5Q A;  2LF8 A;  4R8H A;  2BGC A;  3WGH A;  2A61 A;  4HQM A;  4O3M A;  4AVP A;  5L3G A;  4RGS A;  4MHG A;  4ZZL A;  2Q2E A;  3EQL F;  1B6A A;  5LGU A;  1BBY A;  2W57 A;  2ESH A;  1MJ9 A;  1STZ A;  4NB5 A;  1HKS A;  2HKO A;  2H27 A;  2Z99 A;  3I53 A;  3P9C A;  2LKP A;  1E2X A;  3HRS A;  5D5W B;  1GHC A;  3HUG A;  3KEQ A;  4LLG F;  2J5P A;  4LGW A;  5ICE A;  1HKT A;  2PQ8 A;  3TKY A;  4LFU A;  4XBF A;  3P9I A;  4HX8 A;  2YU3 A;  1RNL A;  5CVJ A;  1L3L A;  2L02 A;  1I27 A;  1ZHF A;  3OOP A;  4RB0 A;  2CO5 A;  3L2C A;  2P8T A;  2FBI A;  3JW4 A;  2RKH A;  4P55 A;  1XCV A;  1KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...