1TLHB

T4 asia bound to sigma70 region 4
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords 10 kDa anti-sigma factor
publication title T4 AsiA blocks DNA recognition by remodeling sigma(70) region 4
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 17
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04545 Sigma70_r4 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tlhB01
3RJPA 2ZKZA 2W84A 4M73A 1O7FA 3I0TA 2QBYB 4YG2F 1UB9A 3WGGA 1HKSA 5BOXA 2JPCA 2PMUA 2CSOA 1LDDA 4ZZLA 1S29A 2V1XA 3WTSC 1FC3A 3KP3A 2EB7A 5BQTA 2OZ6A 5LBQA 3M7GA 2QWWA 3QU3A 3WTYC 4KIFA 1KQ9A 5CVUA 4G7HF 2BBYA 2IP2A 1FBQA 4DQ2A 4O3MA 4HOBA 1NHAA 4TV7A 1W5SA 4AD9A 1U5TA 2RGVA 4KIBA 2XHKA 2HKXA 3HSRA 3K1MA 4Y17A 1F5TA 4R1HA 4G7OF 4OIRF 1BI0A 2YPRA 3FZVA 1OYYA 4LJZF 4EV0A 3KEOA 4HF1A 2BV6A 4M6XA 3R61A 1EH7A 4EMSA 3DXJF 2GQQA 3EUHA 3CUQC 2EA4A 1FBUA 1XD7A 2A5YB 2FMLA 1U78A 1RUNA 5CVVA 1P4XA 1FWZA 2EV0A 3GXOA 1XMKA 3V8LA 1T2KA 3V8KA 2WC2A 5A2QZ 3F8FA 4ENJA 5J8FA 2PBIA 2DU9A 2HGCA 5ICCA 4KFCA 3R0AA 1YS7A 2KIMA 1J2XA 1BOAA 4A5NA 3GEZA 2A69F 4ASNA 1T0FA 1DDNA 1TLHB 2F5DA 3TGNA 4KMFA 5H6RA 3DQVC 3GLXA 4YIFA 2HTJA 1TNSA 1XGNA 3MEXA 1R1VA 1SD7A 1QQIA 1SD6A 2QQ9A 5D5WB 2ISZA 1ZH5A 4WK8F 4YFXF 2CWEA 4MHGA 1R1UA 3GFLA 3I54A 3HRSA 2ZNYA 4P9UA 2CW0F 1YFHA 3TKYA 1MZBA 3U2RA 2ACJA 5JVTA 3FM5A 1FBSA 2CGPA 2VBXA 1TW2A 1UHWA 5K5QA 5D5UB 4OIQF 1LDJA 1FP2A 1TBXA 5FD5A 4UUVA 3F22A 1R00A 3DV8A 1L0OC 2L4AA 4P5OA 5LRSA 1IN7A 2FA5A 3FMQA 2P6TA 4HZFA 3RYRA 4GCVA 2QZ8A 1SMYF 2WWYA 1WRJA 2AS5F 2VBZA 5IT9K 1HSTA 2IW5A 1X3UA 3I5UA 2W85A 3LQQA 4P9FA 5BMZA 1LJ9A 4HX7A 5FLXK 2J5PA 3MQ0A 1ZG5A 5HDNA 3N4MA 3I53A 3WTTC 1L3LA 5DUKA 4HX8A 3DKWA 3HOSA 3BDDA 4HV6A 2MLGA 4KICA 1OR7A 3D0SA 3MAJA 4M9ZA 2VXZA 1FSHA 4MQ9F 4JQFA 3ERED 3KLOA 3ML6A 5LLQA 1R23A 4UVCA 3HYIA 2DLLA 3J7AO 3VEPA 4BQAA 1YS6A 2QM3A 2NYXA 3IWZA 4KIGA 1USTA 1CGPA 1YG2A 1O7LA 3C3WA 3R6SA 5DCMB 1ON1A 3HSFA 2DK5A 4PGHA 2L01A 3KEQA 4L9JA 5LRRA 4OINF 3Q5FA 2FEZA 1QNTA 2OU2A 3KE2A 3IKTA 1T98A 1G3WA 1SD5A 1LEBA 1GXQA 3WGHA 3G73A 2TDXA 3GZ6A 2EFWA 2DBBA 3LA2A 1XSXA 4P55A 3G3ZA 1UCRA 1KYWA 4JBAA 5FD6A 1FOKA 1JGSA 1V3FA 3DPTA 2VOOA 5CVJA 1EH8A 1WQ2A 1QPMA 3GO5A 4MEYF 5LHGA 5DCMA 2XAFA 1JXSA 3FWEA 3MCZA 5K1YA 3F8BA 2O61A 2GAUA 1U3EM 5DD8A 2RNJA 3RKXA 2HYGD 5D5XB 1B1BA 2UWMA 3I59B 5CVIA 4ESFA 1K78B 4HDUA 4S05A 1EH6A 1R58A 1KQ0A 5AONA 1SFXA 1P4WA 4K2EA 2HOEA 2NAZA 4ZYGA 3JTHA 3FHZA 3CLOA 1MKMA 2MA3A 1DUXC 2QQAA 2ZXJA 2GA2A 3EQLF 4A12A 1I6XA 4WCGA 1Y0UA 2D45A 3I59A 1S3JA 5L3DA 4RGSA 1FX7A 4EVIA 1ONVA 1K78A 2E7WA 4UV9A 1BI2A 3MWMA 2M8EA 2BE5F 2GXGA 4N9HA 3TOBA 1SD4A 3TOAA 1R1TA 1WWXA 3EYYA 4I02A 3SXYA 5HS8A 2VT2A 3RPQA 2LF7A 1GXPA 2P5KA 3TO9A 2K7LA 1BI3A 3H92A 1XCBA 1UFMA 1R7JA 1Z05A 2CFXA 4ETSA 2V6CA 1SAXA 3W6JB 1Z1DA 5LHHA 5F64A 1Z7UA 3GF2A 3RKYA 4WXHA 1OKRA 1I5ZA 3KP4A 5CVRA 5HLIA 5LGUA 2HS5A 4B09A 2GZWA 4L9VA 1STZA 2YU3A 2L3DA 4IVNA 3SHFA 3T5XA 4Q48A 3COAC 1OPCA 2OAZA 2JZYA 4BNCA 4HDVA 5EEHA 3BWGA 1WKMA 5TJJA 2O0YA 1KU7A 4A6EA 3KFWX 4L0ZB 1IZ1A 3E6BA 1B9MA 2K02A 1P2FA 4L5IA 2UXXA 2WV0A 2VT3A 2XV4S 2QLZA 4N0BA 1FZPB 5ILSA 4M74A 3VFZA 4L5JA 5E1XA 4CYDA 1W7PB 1XB4A 3ABTA 2FBIA 2M5WA 3F6VA 4HV5A 5ILVA 4O5VA 3GZ5A 2Z33A 5FO5A 2HZTA 1VTNC 5AIPA 2HQNA 1DP7P 4RGRA 3E3VA 1BC7C 1MJAA 4I98B 4D0PA 5L3EA 1S8NA 3HTSB 5KVRA 5D4SA 5L3BA 2E1NA 3ZN1A 2O6GE 2STWA 3CUOA 5E1ZB 1G3YA 2Z9OA 5DDGA 1XSVA 1YIOA 1U5TC 3V7SA 3ABUA 1Z91A 1W7PA 3FF5A 3ZQ7A 4NB5A 2V1UA 3FM3A 3F23A 2EFNA 3GFJA 1IN8A 5HDGA 3ISPA 1GVJA 2IA2A 4U0YA 1PP7U 1XDSA 1O3RA 2DFIA 2VODA 3KP6A 1RUOA 4YFNF 4UVAA 4RAZA 2IPQX 4ZYHA 5JHUA 4HLYA 1D8JA 1QZYA 1QGPA 3HHGA 3LFKA 3T8RA 3ZMTA 3WGIA 2X0LA 4JK1X 1XGMA 2G7HA 4NHJA 1J5YA 4MGRA 2JPBA 2IJLA 4EQQA 5LGNA 4A2UA 1YQAA 4KN4X 1ZRDA 1F1ZA 4PDKA 3K2ZA 5TRDA 1DPUA 5K5OA 3B73A 3E6DA 2XGXA 2DW4A 1AOYA 5CLSA 2IRFG 4IRIA 4IF4A 4WXCA 3GFIA 3L09A 1PP8F 1IN4A 1V4RA 3O3KA 4Y13A 1IW7F 3REOA 2ZO4A 3MZHA 2FF4A 2ZFWA 2R3SA 2DAOA 1U2WA 2VC1A 3WE2A 4CO8A 2MBFA 3BJAA 1LB2A 2Q2EA 3QAHA 3F6OA 3BZ6A 1ODDA 4EM0B 3CUQA 2D1HA 2ZCWA 3E6CC 2HWVA 4EJTA 1ZARA 1FY7A 2GXBA 2PG4A 1IXCA 4KNYA 1S7OA 1HBXG 2XAQA 3I4PA 2LNBA 4CICA 1IF1A 3WTVC 2K4JA 2OA4A 1TQPA 4AIKA 3P9KA 3PQJA 2ISYA 4LLNA 2ESHA 5E8IA 2A07F 3SFZA 1OMIA 3S2WA 4WWCA 1A04A 4ZH4F 1R5GA 2MD5A 3EETA 3BOQA 2FSWA 1YW7A 2F2EA 3NEUA 2W24A 3GUDA 3R60A 1IAWA 1XCVA 5L3CA 1LNWA 1ZREA 2P4WA 4IJAA 2PN6A 1BI1A 1HW1A 1B6AA 2FNAA 1P4AA 2EV5A 4RAYA 1USSA 3V7CA 3V7RA 3J80K 3GVAA 1OYIA 2KJCA 3DPLC 5HVQC 4LD5A 2G9WA 1ZAOA 2H6CA 4G6QA 3F72A 1U8RA 4IHTA 1KU2A 1FYKA 2EA2A 3FX3A 2K4BA 2RN7A 2DK8A 4G6DA 1FSEA 5FB2A 4OIOF 2NS0A 2DT5A 4BHCA 2MLKA 5AIQA 1JHFA 2XASA 3SZTA 4A0YA 4RS8A 2M87A 1BIBA 4G9YA 3E5XA 3ZMDA 1RIOH 4UV8A 5IT9Z 3GYHX 3LQRA 3CO6C 3ULQB 3F8MA 5ED4A 5EEGA 3MFKA 1FNNA 2LDUA 5FLXZ 4MTDA 5JI6A 2A61A 3WU0A 4PCQA 2F5FA 2O3FA 4P96A 5HS9A 4BXUA 1IXSB 1J0RA 3V4GA 4RB1A 4FHTA 2FRHA 3DP7A 5IT3A 2A6HF 3K1NA 1ZLKA 3QPHA 3FXRA 4Y15A 1ZG1A 1Z9CA 4GYIA 1B59A 3P7NA 2DTRA 2P7CB 3ZPLA 5DYMA 1YLFA 1REPC 2MH2A 3C18A 4XLNF 4ZYDA 1T6SA 1BBYA 1DPRA 3NRVA 3NQOA 3TO7A 1MDMA 4KYWA 4HX4A 5JR3A 3HTUA 1RZ4A 5FFXA 2XROA 2IA0A 3IC7A 5D8KB 2JSCA 4M9XA 2XVCA 4U7DA 3BJ6A 2VOPA 4ZZDA 4RGXA 4HLXA 4H0EA 3ZMUA 3T0YA 3J81Z 1HKQA 1XDUA 2H27A 1G3TA 4AIHA 2Q0OA 5BPIA 1BJAA 2QQBA 2X4HA 1H9TA 5ERIA 1QO0D 2M30A 4HW0A 3PQKA 2VN2A 4I09A 2QENA 4EJVA 2EFQA 4LFUA 5FGMA 1YO5C 2GWRA 2F5CA 1IXRC 1Q1HA 2KKOA 2XAJA 2H09A 1J7KA 1UHMA 3RI4A 4KN7X 2HDCA 4HF0A 1ZHFA 2CYYA 3B02A 1HSJA 4OOIA 1HKTA 4CGZA 3TDUC 2K86A 3QPTA 3F8CA 3IL2A 4I7HA 1F9NA 2MC3A 3RIRA 4EJOA 4M72A 5E20A 3RYPA 4A5MA 1MJBA 1IUYA 3CO7C 3KETA 4WX9A 5JFRA 1GHCA 1I27A 4LB5A 3FXQA 3C1DA 4R8HA 5H20A 2EK5A 3E6MA 3CTAA 2AXLA 1I1SA 2LKPA 1K79A 2RVCA 2DQRA 1TNTA 2FMYA 3OV8A 2J5OA 1ZN2A 1AWCA 3OOPA 5D5VB 2K27A 2ZMEB 1FPQA 4HA8A 2YR2A 2ELHA 4WXDA 3JAMZ 3ZMSA 1XN7A 2HKOA 5D8LB 1IN6A 4UHTA 3KZYA 2NNNA 1G4DA 3BPVA 2YX4A 3HHHA 2EJRA 2XAHA 3I64A 2VONA 4CXFA 1K6OA 3LA3A 2PQ8A 2DI3A 1IRFA 2STTA 2IT0A 1E17A 4LLLA 5DUIA 5LEKA 4O6JA 3ROUA 2ZMEA 1B4AA 4YFKF 3KCCA 5HDKA 3VB2A 1HQCA 3TQNA 4XLPF 1D5VA 1Z6RA 1J59A 3HIFA 2O8XA 4L18B 4KT5C 3JTGA 2KIFA 2QUFA 4L0YB 3K9TA 2L02A 4G8XA 2XAGA 2D1VA 5FFZA 4ESJA 4OMZA 1ZLJA 2FNPA 3WODF 2Y75A 3RKWA 2HR3A 2P5VA 4EM1A 3QP5A 4U88A 4HQMA 1TQIA 3F21A 2CO5A 1G3SA 4IRGA 3GWZA 1O3SA 1XMAA 2Y0MA 2JT1A 3E5QA 2OZUA 2XRNA 4L9TA 4FX4A 1O57A 3V8JA 5A2QK 2LSOA 3KP5A 3H3UA 1FYLA 4HYEA 2B0LA 5DEQA 1H0MA 1KYZA 2DO7A 2VE9A 4Q47A 5E8GA 3ZMVA 1BIAA 2P5LC 3D5LA 3IRQA 3SZPA 3M9AA 3HRTA 2QBYA 4NQWA 5ICGA 2PEXA 1S6LA 4LB6B 3L2CA 3CUQB 4Q4ZF 3VODA 4U0VA 1MD0A 5BPDA 1JE8A 1LDKB 2PFBA 4MNUA 3ECHA 3DF8A 1HW2A 1U6GA 3SQNA 4S04A 1PUEE 4LGWA 1ZGAA 4BAYA 3ZP5A 3MZYA 4B8XA 2FBHA 2PMHA 2XKOA 2HTSA 4I0AA 1YW9A 5D4RA 1W5TA 1KU3A 1KU9A 3W6KB 3I58A 2Q8KA 2ZNZA 3KP2A 4FT8A 4GXOA 5D6EA 1MJ9A 1S7AA 1PDNC 2O03A 4Q5SF 5L3GA 4EGYA 5LEJA 4L9NA 2E1CA 2RC4A 2DPDA 3WG9A 3VOEA 2JTVA 3L00A 4M9SA 2VBWA 2HYFA 2RV8A 2CG4A 2ZJ2A 2P8TA 2V1DA 1LVAA 1YYVA 3M1EA 4RB3C 3GX4X 4I2OA 1ULYA 4ZYEA 4XBFA 2RKHA 1LQ1A 3IRRA 1BM9A 3WTXC 3LAJA 2NRAC 1SFEA 4XSXF 2OQRA 2BEOA 4UVBA 5J8CA 5L3FA 3RTRA 1MGTA 3KLNA 3E5UA 3GW2A 4FX0A 3L9FA 2EV6A 3DFGA 4E70A 5CJ9A 3AAFA 3WTUC 2JRTA 1TQMA 2VBYA 4BHBA 1BC8C 3N97A 2W25A 2P7VB 4AVPA 2XKPA 5HLHA 4I01A 5E17F 1T38A 3P9IA 2PLYA 1YTYA 2P6SA 2V79A 4LMYA 3TO6A 4QLCU 4MEXF 3ZN0A 4LK0F 4N9IA 3R4KA 4CZZA 3HSEA 2OBPA 2UXNA 3JSOA 4LG0B 4EJUA 1EV7A 1SMTA 3M8FA 1ZYRF 2A3SA 3FMSA 5J6XA 4ENKA 1J75A 1G6NA 3JW4A 1FYMA 2V9VA 3WE3A 4IRHA 4BYYA 4AIJA 2VE8A 3WTWC 2A68F 2HEOA 2OQGA 4CHUA 4A6DA 5LHIA 1JHHA 2R7DA 2A6EF 1FP1D 3JSPA 5DV5A 5E1WA 1BN5A 4M6YA 3J80Z 1RNLA 3GFMA 4GGGA 1MDMB 1TW3A 4KUMA 1I1GA 5ICEA 2PI0A 4LG0A 5ILUA 4PZJA 2YSRA 4XSZF 5HOOA 1E2XA 2H6BA 3TDZC 3HOTA 3M8EA 4ENNA 2ESNA 4XRFA 3IHUA 2NNYA 4OMYA 3J81K 4Z2YA 2XIGA 3LWFA 2FOKA 4GO1A 4U7BA 3LSTA 1O3QA 3QOPA 4HAMA 2L54A 2D2WA 5F6FA 1XGOA 2GIVA 3ZMZA 2FE3A 3Q9SA 2BYVE 5HS7A 4KDPA 3BROA 3LAPA 4KA4A 2W57A 4ON0A 2XUBA 2EFPA 3HUGA 2R7FA 2EWNA 4LK1F 1D3YA 2Z3YA 2L4MA 3L7WA 3ECOA 4RB2C 4G7ZF 3U9GA 1P6RA 4EM2A 3BPXA 4QWQA 4WF2A 2OD5A 2Y48A 4AWXB 3BP8A 1WI9A 3HRMA 4GYGA 3RPUA 3RDIA 3FMRA 3BJOA 3U1DA 1QBJA 2HFHA 2KJBA 1W4MA 3DEUA 3IWFA 4U0WA 4IPAA 3PFIA 1K7AA 1WSUA 3F8NA 3FXUA 3WU1B 4RGUA 2E7XA 2FQ3A 1F4KA 3KP7A 3BY6A 3CJNA 1ZG3A 4MQVA 4I0BA 3K69A 2ZBKA 6PAXA 2KRFA 2IVMA 2BGCA 4A0XA 4ENMA 1XGSA 1KGSA 5D6FA 4HF2A 3E97A 2GA1A 1HW5A 1FT9A 3WTZA 2YX7A 4KMUX 3I71A 1C0WA 4M71A 1R36A 4A0ZA 1ZRCA 2F5EA 3T8TA 2C6YA 3QRFF 1IN5A 2ADUA 4UNOA 1XSDA 4BH9A 3ELKA 1TTYA 4R79A 3K1PA 2RDPA 2M1BA 5DD4A 3JAMK 2WTEA 5K5RA 1KA8A 4OIPF 3O2PE 1FLIA 1W7PD 5ICFA 2KIUA 3CDHA 1RI7A 4IXAA 4PGGA 5E18F 4UXNA 5KK1A 5BS6A 4IHSA 2CQKA 4HQEA 1T39A 3R0JA 2H94A 1HXDA 1B9NA 2PJPA 4LLGF 4DNCA 1J9IA 1LEAA 3T1BA 5HLGA 3K0LA 1Z6TA 4ESBA 2FBKA 1R22A 2G7UA 1IRGA 2DQLA 1CF7B 2LF8A 3F3XA 2COMA 1SFUA 1H9GA 3Q9VA 2FU4A 5CYVA 3KZZA 1ON2A 4CDGA 1R5HA 3P9CA 1KQ8A 2QVOA 3IKVA 4MTEA 5DCFA 3EYIA 4F7ZA 3C7JA 1ZGJA 2MH9A 3QP6A 4RB0A 3HRUA 1OYWA 4EGZA 2QYOA 1D8KA 4HBLA 4G94A 2UZKA 4EJWA 3O6BB 2VC0A 3LA7A 4BHPA 5LGTA 2M45A 2IA1A 5H6QA 1QZZA 2Z5UA 2Z99A 1YW8A 2HQRA 1CF7A 2DPUA 1P92A 3EDPA 5F1RA 2EFOA 2ETHA 1U5TB 1O3TA 1ZRFA 4YIIA 3QU6A 4OU0A 2FXAA 3H3ZA 2RQPA
chains in the Genus database with same CATH superfamily
3RJPA 2CJJA 2ZKZA 2W84A 4E7SA 4EEFG 4M73A 1O7FA 3I0TA 2QBYB 4YG2F 3I4MJ 1UB9A 2LFBA 3WGGA 1HKSA 5BOXA 2JPCA 2PMUA 2CSOA 5EJCA 1LDDA 2NVUB 4ZZLA 1CQTA 3AL0B 3E0JB 4RM2A 4W1UA 2NVQJ 1S29A 2LH9A 2V1XA 3WTSC 3S1QJ 3RQ4A 1FC3A 3KP3A 3OS1A 1BW6A 2EB7A 5BQTA 2OZ6A 4IX7A 5LBQA 3M7GA 1TT0A 1A5JA 2QWWA 3QU3A 3WTYC 4KIFA 1FIPA 1WJBA 1KQ9A 2TRTA 5CVUA 3L2QA 4G7HF 2BBYA 2IP2A 1HOMA 2HPMA 1FBQA 4DQ2A 3QYFA 4O3MA 4HOBA 1NHAA 4TV7A 1W5SA 4AD9A 1U5TA 1RPWA 2E71A 2RGVA 4A3FJ 2AO9A 4KIBA 3QOEA 2XHKA 3FIWA 3OYNA 2QQ8A 2HKXA 1V5EA 1JUMA 2KDOA 4BE2A 3HSRA 3VYSB 2CH0A 1IDZA 5C4XJ 3K1MA 3K2AA 4Y17A 1F5TA 4HSTA 2QSGX 3G6EI 3QYEA 4R1HA 3RKQA 4G7OF 2KDZA 4OIRF 3QPLA 1BI0A 2YPRA 3D5RC 1OYYA 3FZVA 4LJZF 4EV0A 3KEOA 4HF1A 4LIVA 4X0GA 2BV6A 3BG7A 4M6XA 3R61A 3JRBA 4F3QA 1EH7A 2WV1A 3JR9A 1ERDA 1HCRA 2KLOA 2UUZA 1Z0XA 1ZELA 4NDLA 1IV8A 4EMSA 3DXJF 4E7KA 2GQQA 3HOUJ 3EUHA 4AIDA 3CUQC 2EA4A 4PSWA 1FBUA 2M7BA 2ZC2A 1TC3C 1XD7A 2A5YB 3M07A 5M5WJ 3OS0A 1IG7A 1F43A 2FMLA 1U78A 1I3QJ 1RUNA 4PJLA 5CVVA 1G2HA 2K5CA 3ZQGA 3HBLA 1P4XA 1FWZA 2EV0A 3GXOA 5IPAA 1Y1WJ 3QPSA 1XMKA 3V8LA 4BQNA 3K4NA 2M2EA 1FMVA 3HOYJ 1T2KA 3V8KA 1PJRA 2WC2A 2VJIA 3F8FA 5A2QZ 1K4SA 4B3XA 3GBGA 4ENJA 5J8FA 2PBIA 1QPIA 2DU9A 2HGCA 5ICCA 3TBIA 4F55A 4KFCA 3R0AA 1YS7A 2KIMA 1J2XA 1BOAA 1MMGA 4A5NA 3GEZA 2A69F 4ASNA 1FTTA 4BL0B 1T0FA 3TP0A 4E6KG 2L9NA 1DDNA 2FUG2 2CV2A 2L7FP 2H8WA 3IAM2 4XLAA 2GIZA 5J1RA 3MKWB 3CC2I 2JSPA 2E2IJ 3HGYA 1TLHB 2F5DA 3TGNA 4KMFA 1DU6A 5EYRA 5H6RA 3DQVC 3GLXA 2Y9YA 4QPOA 4YIFA 2HTJA 2DA4A 4DZJA 2V4JC 1DP3A 4RBOA 1TNSA 1Y6IA 1ITYA 4JP0A 1XGNA 3MEXA 1R1VA 1SD7A 1QQIA 4BACA 1SD6A 4XMYA 4RAFA 2QQ9A 5D5WB 2ISZA 3DU6A 1ZH5A 2R7UA 4BQQA 2HOAA 4WK8F 3PIPF 4XM3A 4YFXF 5C44J 3DKXA 1DU0A 2CWEA 4MHGA 1R1UA 5J47A 3GFLA 3I54A 1XG1A 4PK4A 3HRSA 2ZNYA 3Q0UA 3BZCA 4AVZA 4P9UA 2CW0F 3GTMJ 3AG4H 1YFHA 3TKYA 1MZBA 3CC7I 3U2RA 2ACJA 3RZOJ 2PMZN 3RCOA 3PUBA 5JVTA 3FM5A 1FBSA 2CGPA 2O8KA 1VQ6I 2VBXA 3FHNA 5M3FJ 3GTKJ 1TW2A 3G1OA 1UHWA 5K5QA 5D5UB 1Q1VA 4OIQF 2DA2A 1LDJA 1FP2A 1BJZA 4A3DJ 1TBXA 5FD5A 4UUVA 3F22A 1R00A 1D1AA 3DV8A 1O4XA 4IQJA 3FBNB 4OWRB 2X6WA 4I76A 1L0OC 1WJAA 2L4AA 4P5OA 3ASOH 5LRSA 1IN7A 2FA5A 1SAUA 1ETVA 4YEJA 2V9KA 4IHXA 3FMQA 4QSHA 1MBFA 2P6TA 4HZFA 3RYRA 4GCVA 1MBGA 2QZ8A 1MSEC 1X4PA 2DN0A 4A3MJ 1SMYF 2FD5A 1K6YA 1R4MB 2WWYA 1WRJA 2AS5F 2VBZA 5IT9K 1HSTA 2IW5A 1X3UA 2YS9A 3I5UA 1NK2P 2VJ4A 1D1CA 2W85A 2K9NA 3LQQA 3OL4A 1UZCA 3HGGA 2PJRB 4P9FA 1ACIA 5BMZA 3TW6A 1LJ9A 2VKVA 4GRIA 4HX7A 4V2FA 4Y4RA 1NH3A 1S7EA 2AHQA 3MMYB 4D7MA 5FLXK 3OIQA 2J5PA 1LFUP 4XRSG 5EZHA 3CJRB 3MQ0A 1WJ5A 1ZG5A 5HDNA 1YJ9I 3N4MA 3I53A 2CFOA 2K3FA 3WTTC 1L3LA 1GV2A 2ZB9A 1MNMC 5DUKA 4HX8A 3DKWA 2LP0A 4BJ6C 3HOSA 3BDDA 4HV6A 2MLGA 4KICA 1OR7A 3D0SA 3MAJA 4M9ZA 2VXZA 2DA1A 4Z6YA 1FSHA 4MQ9F 4JQFA 3ERED 3M3YJ 3KLOA 3ML6A 5LLQA 4A3KJ 1R23A 4UVCA 1JJ6C 2LG4A 1JI8A 4Y33A 2RREA 3HYIA 2DLLA 3J7AO 3VEPA 4BQAA 3W2AA 1YS6A 2QM3A 2NYXA 3IWZA 4KIGA 1ZGWA 2CU7A 1USTA 2HDWA 1CGPA 1YG2A 1O7LA 3Q3SA 3C3WA 3R6SA 2O9LA 5DCMB 2ECCA 1ON1A 3HSFA 2NXNB 3FK7A 3OIOA 2DK5A 4MO7A 4XKWA 2EQRA 2PJRA 4PGHA 2L01A 3K4KA 3KEQA 2DA3A 4L9JA 5FKNA 3GTGJ 1S72I 3WHBA 3OYLA 5LRRA 4OINF 3Q5FA 2FEZA 2KZGA 1QNTA 5KAIC 2QA4I 2OU2A 3BQZA 3KE2A 3IKTA 1T98A 1G3WA 4MIMA 4Y7NJ 1SD5A 2QSHX 1LEBA 3G4SI 1GXQA 1MMSA 3WGHA 2KL4A 3G73A 2D5VA 2TDXA 4ZDOA 1EKEA 3MN2A 3GZ6A 2EFWA 3GTQJ 2DBBA 2HU9A 4ZDLA 1TWFJ 3LA2A 3OMYA 2HVRA 1XSXA 1IRXA 3OYAA 2DFFA 2EZHA 1ETKA 4P55A 4DIQA 3G3ZA 1UCRA 1A35A 1KYWA 3CCMI 4JBAA 5FD6A 1HLVA 2L9VA 1FOKA 3IP4B 1JGSA 1V3FA 3DPTA 2DJNA 2VOOA 2E1MB 5CVJA 1AU7A 1EH8A 1WQ2A 1QPMA 3GO5A 4MEYF 5LHGA 5DCMA 2XAFA 1JXSA 3FWEA 3FDYA 3MCZA 5K1YA 3OYGA 3CP8A 1K83J 2BY2A 3F8BA 2B63J 2VLAA 2O61A 2VKEA 2DFEA 2GAUA 1U3EM 3UKGA 1WJDA 3DLLF 5DD8A 2RNJA 3RKXA 4XLCA 4IOCF 2HYGD 5FLMJ 1GV5A 2OC6A 3SEZA 5D5XB 1B1BA 2BW3B 2UWMA 3S3MA 3BG5A 2EZKA 3I59B 4C3HJ 5CVIA 4DBQA 1D0ZA 2X6XA 2E5NA 2VQHA 3CCJI 2ZXWH 2BY1A 4ESFA 5J1YA 1K78B 1E3HA 3OR2C 1RESA 2LREA 4HDUA 4S05A 1EH6A 2RAEA 2KMUA 1R58A 4CYCB 1KQ0A 5AONA 3OR1C 3DEEA 3F9KA 1SFXA 1P4WA 4K2EA 3PNVA 2HOEA 3S15J 3K4JA 1MIJA 2NAZA 4ZYGA 3JTHA 3CMAI 3FHZA 5IYDJ 3ZCOA 3CLOA 1MKMA 1JT6A 2MA3A 1EA3A 3PNYA 1V55H 1DUXC 4GFBA 2BY0A 2ELKA 1VQPI 2QQAA 2ZXJA 2GA2A 2MYSA 5IYCJ 3SDBA 5E3MA 3EQLF 4A12A 1B8IA 5M5YJ 2ZSHB 1I6XA 3H5RA 3KX2A 4F52A 2M3AA 4WCGA 1Y0UA 4AUXA 1IC8A 1VQ7I 4E4HA 5F08A 2BW3A 2D45A 3I59A 3ERMA 2X1CA 3G1LA 5GPCA 4ZC3A 1S3JA 2Y69H 5L3DA 3TP3A 4RGSA 1FX7A 1ONVA 2E34A 4EVIA 1K78A 2E7WA 2BHZA 4UV9A 1P9QC 1BI2A 3MWMA 5F1JA 2E36A 2M8EA 1W36C 1FJLA 2BE5F 4CYCA 2GXGA 4MLOA 2V26A 4HPQA 4N9HA 3TOBA 1SD4A 5KNLA 3TOAA 1R1TA 1WWXA 4HEA2 1OLTA 3EYYA 4I02A 3GTPJ 2LKSA 3SXYA 5HS8A 3C2BA 5IY5H 1HF0A 2VT2A 3NWSA 3RPQA 1W0TA 1IGNA 2LF7A 3RZDJ 1MBEA 1QHGA 3HXLA 2P5KA 1GXPA 3TO9A 2K7LA 2F6CA 1BI3A 4DJAA 3H92A 1XCBA 1UFMA 1R71A 1R7JA 1Z05A 4XLEA 2CFXA 3J7AY 1VNDA 4ETSA 2ZJQF 2V6CA 5DTDA 1SAXA 3W6JB 1VQ5I 1SVOA 3L2UA 1Z1DA 2R4GA 5LHHA 1UAAA 1FEXA 5F64A 3PL8A 4D1QA 1Z7UA 1I50J 1JGGA 2XC7A 3AG2H 3KZIC 2DA6A 2CV0A 2F4IA 1M1EB 3GF2A 2QKLB 5CKTA 3RKYA 4WXHA 2DMTA 1OKRA 1I5ZA 2OPTA 5GTHC 2Y30A 3KP4A 5CVRA 2Z16A 5HLIA 4C3IJ 5LGUA 5EGOB 3BR1A 1OCOH 1QHHD 2HS5A 4B09A 3O8GA 2Y0SN 4G6TB 3SDGA 4ZJZA 2GZWA 4L9VA 1Y8RB 4FTHA 4CH7A 2X48A 1STZA 2YU3A 1J09A 5JLXA 2L3DA 5GAEJ 5HNFA 4IVNA 1ZKGA 5K7ZA 2H1LA 3GLLA 4DBRA 1N77A 3SHFA 3T5XA 2LYCA 3KYCB 1SFKA 4P1WA 4Q48A 3COAC 2EPFA 2OTLI 1WFXA 1OPCA 3CF5F 1A31A 1ZK8A 2OAZA 2LD5A 2JZYA 4BNCA 1FTZA 4HDVA 5EEHA 3BWGA 3WG7H 3OYMA 1WKMA 3ZXSA 3CD6I 5TJJA 2O0YA 3GTLJ 2M34A 2IBDA 1KU7A 2LK2A 3L2WA 4MFEA 4A6EA 2W00A 3KFWX 4L0ZB 3BR0A 1IZ1A 3BLYA 1T8IA 3E6BA 2EH3A 1B9MA 3J7ZI 3OYKA 2R7RA 2K02A 3HZJA 2XPUA 3E7LA 5J4VA 1P2FA 4L5IA 4PJNA 2UXXA 2WV0A 2VT3A 2XV4S 5FKMA 3S17J 3S1MJ 2QLZA 4N0BA 2EZLA 1FZPB 5ILSA 3A2KA 3U1KA 4JX5A 4M74A 3ZRGA 2MC4A 4QIWN 2LY9A 3VFZA 4L5JA 4W97A 5E1XA 4CYDA 3NAUA 1W7PB 1XB4A 3ABTA 5LD2C 2FBIA 1UJ8A 2H1KA 2M5WA 2JA2A 2GLOA 5FRMA 3F6VA 4HV5A 4GDFA 5J40A 3H9GA 2QSFX 2VPLA 5ILVA 2ID6A 4O5VA 1FMWA 3GZ5A 2Z33A 4BJ5C 5FO5A 2DMUA 4A3LJ 2HZTA 1VTNC 5AIPA 3OIPA 4ZDPA 2HQNA 1DP7P 4OAYA 4RGRA 1TWHJ 1R5ID 1AKHB 2KQRA 3E3VA 3S2DJ 1X3ZB 3CCSI 1BC7C 2X6YA 1MJAA 3LSRA 3FXJA 2RNGA 4I98B 4FQGA 2DOFA 3PSFA 4D0PA 5L3EA 1S8NA 3HTSB 5KVRA 1Y0NA 4M6VA 2HI3A 5D4SA 1VQMI 5L3BA 2E1NA 3ZN1A 2JA7J 4XICA 2F4MB 5KCMA 4B4CA 1AA7A 4XRMA 2DMNA 2IGKA 2O6GE 1X1BA 2STWA 3CUOA 3OYCA 5E1ZB 1G3YA 2VB6A 2Z9OA 5DDGA 1XSVA 4DZPA 1X3WB 1YIOA 1TZLA 1U5TC 3V7SA 3ABUA 4D5CA 1Z91A 1W7PA 3FF5A 2BZTA 3ZQ7A 4AC0A 4NB5A 2CV1A 2V1UA 2IXSA 3FM3A 3F23A 2EFNA 1JT0A 3GFJA 2MABA 2E19A 4M3GA 1IN8A 3SEQA 5HDGA 1Y1VJ 2CS3A 2IS2A 3ISPA 5HODA 1XPXA 1SANA 1GVJA 2IA2A 4U0YA 1PP7U 1XTAA 1XDSA 2A5WA 3IAS2 3LSHA 1O3RA 2DFIA 1AKHA 4G12A 3KP6A 2VODA 5JHFA 1RUOA 5EDNA 3AL0C 4YFNF 1JTXA 4UVAA 4B1RA 2BVMA 4RAZA 2IPQX 2LC2A 1X4OA 2EBIA 3DTKA 1UELB 4ZYHA 5JHUA 4HLYA 2R93J 1WGXA 1D8JA 4YRVA 1QZYA 1QGPA 1HDPA 3BG3A 3HHGA 3HKZN 3LFKA 3T8RA 4BU2A 3ZMTA 2HNHA 1RKWA 3W2VA 3WGIA 1GT0C 3GCMA 2X0LA 2QCOA 3JRHA 3VYTB 4JK1X 2Y9ZA 2HDDA 1XGMA 2DMPA 2G7HA 2XGDA 4NHJA 3GMEA 2NOGA 3H9JA 5E3OA 3SYTA 3BCBA 1YITI 2Y2ZA 1J5YA 4MGRA 4HSRA 2E2JJ 1W0UA 3CCYA 2JPBA 4BY7J 3IH3A 4JX4A 4M3FA 2Z2SB 3CMEI 2IJLA 1OQYA 2EIKH 2FX0A 4AYBN 1MSFC 3OYFA 2KIQA 2XGEA 3HB9A 1I39A 1XX5A 4EQQA 5LGNA 1IUFA 4A2UA 2DOEA 5IOYA 1YQAA 4PFPA 3RSNA 4KN4X 1ZRDA 1T0FC 1F1ZA 3B6AA 3VYUB 3HDDA 3LFUA 2Q2EB 3S3OA 1OCCH 4PDKA 1APLC 3K2ZA 5TRDA 4CCKA 1U9NA 3I56I 1DPUA 3CF2A 5K5OA 1R4NB 1WJEA 3B73A 3E6DA 2XGXA 1JKRC 2DW4A 2JA6J 1AOYA 5CLSA 3FKJA 4XLHA 5B1BH 1VFCA 2IRFG 3HEFA 4IRIA 4IF4A 3PM1A 3K6GA 4WXCA 3GFIA 5KAFC 3OYIA 3G2BA 3BTCA 3L09A 1PP8F 4RA2A 3AFHA 1IN4A 4LG3A 1V4RA 4YELA 3O3KA 4Y13A 1IW7F 3REOA 4IZZA 2ZO4A 4HG2A 4KITB 3MZHA 1MMAA 2FF4A 2ZFWA 2R3SA 2DAOA 2DT6A 1U2WA 2VC1A 1H89C 4U87A 3WE2A 3Q0WA 4CO8A 1RR8C 3FXMA 1VQ9I 2MBFA 4C30A 2Z1DA 3BJAA 1LB2A 3RQIA 2Q2EA 3QAHA 2O7OA 3F6OA 3BZ6A 4B47A 3C2GA 1ODDA 4XKBA 1MH3A 4EM0B 3CUQA 2KZVA 2D1HA 2ZCWA 3H5NA 3OOUA 3JRFA 3E6CC 1YIJI 1WJFA 2HWVA 2DDAA 4EJTA 2ID3A 1ZARA 1FY7A 5C4JJ 2GXBA 2PG4A 1AHDP 1IXCA 4KNYA 1S7OA 1HBXG 2XAQA 4CCOA 3I4PA 2LNBA 1ZQ3P 3S16J 3L2RA 1PVEA 2XF5A 4CICA 3WTVC 1IF1A 1H88C 2L5QA 2K4JA 4C2TA 2OA4A 1TQPA 3PFYA 4AIKA 1VQLI 3P9KA 2XB5A 5HNHA 5JLWA 3PQJA 2L7ZA 1XC5A 2ISYA 1Y56A 3J7YJ 3TEDA 4LLNA 5LFAA 2I10A 2ESHA 2ECBA 5E8IA 3SFZA 1X1CA 3JRGA 2A07F 1MMDA 1LVKA 1OMIA 3M8JA 3S2WA 4WWCA 1A04A 4ZH4F 1YRNB 4Y52J 1VZ0A 1R5GA 2MD5A 3OYBA 1P7JA 3FK6A 3EETA 3BOQA 2LY1A 2EZIA 2FSWA 2WB1A 4J01A 4BJTA 1YW7A 2F2EA 3NEUA 2W24A 3CESA 3GUDA 3R60A 1IAWA 1XCVA 4HNVA 1RC9A 5L3CA 1LNWA 2EINH 2LBFB 4PJ0C 1G59A 1ZREA 2P4WA 4IJAA 1OR7C 3MVPA 5GTIC 2PN6A 3SZGA 2VKDA 4S0HB 1BI1A 1HW1A 5C3EJ 5KHDA 3CC4I 1B6AA 2FNAA 1P4AA 3H9QA 2EV5A 4RAYA 1LE8B 1USSA 3V7CA 3V7RA 3J80K 3FXOA 3GVAA 1OYIA 2P0WA 1R9TJ 1OCRH 2KJCA 3DPLC 5HVQC 4LD5A 2G9WA 3W6VA 3H3VK 4CCMA 5FRNA 1ZAOA 2H6CA 1JKOC 4RMNA 1MBJA 1RR7A 4G6QA 3VPRA 3MKYB 1YRNA 2B7EA 3F72A 1SVMA 1U8RA 4IHTA 1KU2A 1FYKA 2EA2A 2V6EA 3FX3A 5GAGJ 2K4BA 2AXTC 2RN7A 2DK8A 2W4SA 3PUFA 3SFIA 2VPRA 2DXIA 1LFPA 4G6DA 3A02A 3G1MA 4RLQA 1FSEA 5FB2A 4OIOF 2LBFA 4XNFA 2NS0A 4C3JJ 2DT5A 4BHCA 3RPUD 5GP9A 3I3LA 2MLKA 1UHSA 5AIQA 3DKYA 2JA8J 1JHFA 2XF6A 2XASA 2WAQA 3SZTA 3ZGKA 1KONA 3W2WA 4RS8A 4A0YA 3CJQB 2M87A 2MSYA 2NOJB 1BIBA 4G9YA 1NG6A 1LE8A 3E5XA 3ZMDA 1A6IA 2XPWA 4AU7A 4DOZA 1RIOH 4UV8A 2OTJI 5IT9Z 3GYHX 1JUSA 1BOBA 1TWAJ 3V42A 4PSXA 3LQRA 2FQ4A 3CO6C 2WBMA 3ULQB 3F8MA 5ED4A 5EEGA 3MFKA 1MBHA 2IEKA 1FNNA 2LDUA 1A36A 5FLXZ 4MTDA 2Y31A 5JI6A 2A61A 1HA8A 3ZQIA 3WU0A 4PCQA 3CCQI 2F48A 2F5FA 2HYJA 2RQQA 2O3FA 1SFOJ 3DU5A 4P96A 2K9LA 4NNJA 2CW8A 5HS9A 4BXUA 3S2HJ 3CMYA 1IXSB 2GM4A 3H0DA 2HOTA 1J0RA 3K4LA 3H1CA 1ETXA 1X58A 3V4GA 4RB1A 1JJ8C 4FHTA 2FRHA 1BA5A 2LR8A 1T08B 3DP7A 4DYRA 5IT3A 2A6HF 3K1NA 2GOXB 1ZLKA 4UB8C 3IV5A 3QPHA 3FXRA 4Y15A 1ZG1A 2DFHA 2HXOA 1Z9CA 2CUZA 3BQYA 2CUEA 4GYIA 2L7MP 3WU2C 1B59A 3S93A 1GLNA 4XKVA 4BE0A 3K10A 1BL0A 2DMQA 3P7NA 4KT6A 2DTRA 2P7CB 3ZPLA 5DYMA 3TMOA 2LY2A 3JREA 2E1MC 1B8IB 1YLFA 5B5EC 1REPC 2MH2A 4BDYA 3C18A 4XLNF 2FOWA 4OAZA 3BTIA 2X9DA 3CCRI 3HG9A 4ZYDA 1T6SA 1BBYA 1RKTA 1DPRA 3EUAA 3NRVA 2XB0X 3NQOA 2K9QA 3TO7A 1W36D 1MDMA 4KYWA 4ITVA 3I55I 4HX4A 5B1AH 3KYLA 4UUSB 5B66C 1DQUA 1PUFA 5J3LA 1TP4A 5JR3A 4NC7A 1IV6A 3HTUA 3NWTA 1RZ4A 2KP6A 5FFXA 2XROA 2IA0A 4HRIA 3IC7A 2JMWA 3ZR8X 5D8KB 2JSCA 2K9MA 1Z67A 2GXAA 4M9XA 2XVCA 4U7DA 3BJ6A 2VOPA 4ZZDA 4RGXA 4UY8I 2WAEA 4A3JJ 4HLXA 4H0EA 3EPZA 1YX3A 3ZMUA 3OYDA 3T0YA 3J81Z 2DJIA 1HKQA 1XDUA 3P5JA 2H27A 1G3TA 4AIHA 4XOTA 1SVLA 2Q0OA 5BPIA 1BJAA 4NC8A 4CSWA 3JRCA 1W1WE 2QQBA 2Q1ZB 2X4HA 1Z7LA 5FKLA 1H9TA 3Q0VA 4E7LA 3GTJJ 2MD0A 4FISA 1R49A 5ERIA 1QO0D 1IRZA 4II2A 3PSIA 1BW5A 2M30A 4HW0A 3PQKA 2VN2A 4I09A 4Y3OA 2QENA 4EJVA 2EFQA 1BR1A 2QF7A 4A3GJ 3CQZJ 4D5FA 4LFUA 5CQGA 5FGMA 2GWRA 2F5CA 5IP9J 1YO5C 4C9YA 1IXRC 3KIOA 4UUSA 1JKPC 1N25A 1Q1HA 2KKOA 2XAJA 2H09A 2IGMA 1J7KA 1UHMA 2QEXI 3RI4A 2DCEA 4KN7X 1E3OC 1D5YA 2HDCA 2CRGA 3WHCA 2M8GX 3L2VA 2BHYA 5CPRB 4HF0A 3I4NJ 1ZHFA 3OSFA 1X19A 2CYYA 3B02A 3M1CA 2LTPA 1HSJA 4OOIA 1S5LC 1SC7A 1HKTA 2WB1N 4XL9A 3DBHB 4CGZA 3TDUC 2K86A 2JN6A 2LOOA 2DTZA 3QPTA 4ZTJA 3F8CA 3K7AJ 3IL2A 4I7HA 1F9NA 2K3PA 2MC3A 3RIRA 3VDXA 4EJOA 3BR3A 4M72A 1S9HA 5E20A 3RYPA 3ABLH 2CUFA 2X85A 3K70C 4A5MA 1MJBA 3KEYA 1IUYA 3CO7C 2DOAA 2XSJC 4IHWA 3HOWJ 4KJZA 3KETA 2ZJRF 5M5XJ 2V7FA 4WX9A 1OCPA 5JFRA 5J1UA 3DEWA 1GHCA 3OWTA 1I27A 3FXLA 4ZYAA 3CCVI 4BDZA 4LB5A 3E1SA 1DGRM 1N75A 3C1DA 3FXQA 3HM5A 4E7IA 4R8HA 5H20A 2EK5A 2F4OB 1KZHA 3E6MA 1QZEA 2L9SA 2R5ZB 2AQFA 3HPHA 3CTAA 2AXLA 3MZ8A 2CW7A 3C2HA 5EG0B 1I1SA 4XKCA 1IJWC 2LKPA 4J19A 2VQCA 1K79A 2RVCA 3GZNB 4XK4A 3S1NJ 2MGQA 1WH7A 2DQRA 1TNTA 1YE9A 2ZXIA 1B72B 2FMYA 3OV8A 4X1EA 1V54H 1V5FA 2X1DA 3S14J 2B9SA 3DLAA 2WADA 2J5OA 5IP6A 1ZN2A 2L7KA 1AWCA 2VKHA 3OOPA 5D5VB 3DBRB 1PYVA 2K27A 2ZMEB 1D0XA 4LITA 1ETQA 1FPQA 4JX6A 4HA8A 4KISA 2YR2A 2ELHA 4WXDA 2FJ1A 3JAMZ 3ZMSA 1XN7A 5DM6F 2HKOA 4L5EA 1FOXA 5D8LB 1IN6A 2R7SA 4UHTA 5E3NA 3KZYA 3HOXJ 1Y8QB 2NNNA 2R5ZA 5EF6A 4RAGA 1G4DA 5EEAA 3BPVA 2YX4A 3HHHA 3OL3A 5F27A 2EJRA 5FKOA 2XAHA 2PMZA 3I64A 1U0JA 2VONA 4CXFA 4FASD 4LIUA 5EG0A 2LVSA 3BTJA 3H0GJ 1K6OA 1VQ4I 2DYRH 2R7WA 5E79C 2IAIA 3LA3A 2PQ8A 3ABMH 1MNDA 2DI3A 3DPUA 3LNQA 1FOYA 1B72A 1IRFA 2STTA 2V1NA 2E2HJ 2O5RA 2IT0A 1E17A 4LLLA 5DUIA 5LEKA 4O6JA 1WVRA 1WHUA 2JVHA 1I3AA 3QYBA 2ZXHA 4DGWB 3ROUA 2ZMEA 3VSKA 1TT5B 4X6AJ 1B4AA 4YFKF 3KCCA 3VWBA 3LSIA 2P81A 5HDKA 3VB2A 1QRYA 1MH4A 2KRHA 3BZKA 4V2GA 3S32A 1HQCA 3TQNA 3LOCA 4XLPF 1D5VA 1Z6RA 2VIXA 2X6OA 1J59A 5DS9A 2R7XA 2DT7B 3HIFA 4CCJA 2O8XA 4L18B 4KT5C 2VI6A 3NARA 2OCEA 4XORA 3LSMA 5FKKA 3JTGA 2KIFA 4BEHA 1W5CC 1RETA 2QUFA 4CCNA 4JOMA 4L0YB 3K9TA 5M3MJ 2L02A 4G8XA 5FJ8J 2XAGA 2H8RA 4E7JA 2D1VA 2L9RA 2L0KA 3JRAA 1K61A 5FFZA 1LUJB 4ESJA 4DYCA 4OMZA 5GAHJ 1ZLJA 5GPAA 3PJRA 2FNPA 3WODF 2HZDA 4NQWB 2Y75A 2NS7A 3RKWA 2HR3A 2VQGA 2ZSIB 2P5VA 4EM1A 2ME6A 3QP5A 3CDLA 4BBSJ 5K7HA 4U88A 4HQMA 3EUHC 1TQIA 3F21A 2CO5A 1G3SA 4IRGA 3GWZA 4ABZA 2M9HA 1O3SA 2TCTA 1XMAA 2Y0MA 2KPMA 2JT1A 3H36A 3E5QA 2OZUA 2XRNA 4L9TA 2EIJH 4FX4A 1O57A 3QODA 3V8JA 3K4MA 1TL8A 5A2QK 3N05A 2LSOA 3KP5A 3H3UA 1FYLA 4HYEA 3OYHA 2X51A 1E3PA 2B0LA 5DEQA 1H0MA 2OJED 3FXKA 4NC6A 1KYZA 2DO7A 2VE9A 4Q47A 1X2MA 5E8GA 3ZMVA 1BIAA 1I6HJ 2P5LC 1ETOA 3D5LA 3IRQA 2DA5A 3HPGA 3SZPA 2I8DA 2R7ZJ 3M9AA 3OYJA 3HRTA 2QBYA 5JVGF 4NQWA 5ICGA 2VQLA 2PEXA 1S6LA 1ZR2A 4LB6B 1FOWA 3L2CA 3CUQB 4IEJA 4Q4ZF 3VODA 4U0VA 1MD0A 4DW6A 4XIDA 5BPDA 1JE8A 1LDKB 2PFBA 2YUSA 5H2FC 4MNUA 3ECHA 3DF8A 1HW2A 1MMNA 2LRDA 2XF7A 4XN0A 1U6GA 1NK3P 3BG6A 2GBYA 3CJTB 3SQNA 4S04A 1IDYA 2R7OA 2MG4A 1PUEE 4LGWA 1ZGAA 4BAYA 3ZP5A 2BOLA 3DTEA 3MZYA 4B8XA 2WAFA 2FBHA 3AKZA 2PMHA 3MD2A 3ASNH 2XAUA 2XKOA 3LMMA 2HPIA 3OYEA 2HTSA 2HOSA 1Z77A 3VYRB 4I0AA 1YW9A 5D4RA 1W5TA 2MFZA 2BY3A 1KU3A 1KU9A 1JKQC 5F0CA 4I99C 3W6KB 3A4CA 3I58A 4M3EA 4BXFA 2Q8KA 2R7VA 2ZNZA 2CQQA 3A01B 2CQNA 3PO3J 3KP2A 4FT8A 4GXOA 3FBIB 3CDIA 3DWLE 5D6EA 2X1EA 1JTYA 1MJ9A 1OCZH 1S7AA 4AM3A 1PDNC 1D0YA 2O03A 2DDBA 4Q5SF 4BGDA 1H8AC 5L3GA 5LEJA 4EGYA 4L9NA 4F91B 3KPHA 2OCCH 3AG1H 2E1CA 2RC4A 4XLFA 2WY7Q 3U21A 2KISA 1WPKA 3FKIJ 2QGUA 2DPDA 3WG9A 3VOEA 2A05A 2JA5J 5CQEA 1LPQA 2VJ5A 2XSDC 3MKZA 2JTVA 3L00A 1P7IA 1WCMJ 4M9SA 1ETWA 1N78A 2VBWA 2HYFA 1UG0A 2RV8A 1F36A 3ZOBA 2CG4A 2ZJ2A 5F04A 5F0FA 2P8TA 2V1DA 2JVGA 1LVAA 1YYVA 3BCAA 3M1EA 3CCUI 1ZR4A 3L1PA 4A93J 4RB3C 4NBQA 2WA0A 3VSLA 3GX4X 4I2OA 1T95A 1ULYA 3FISA 3A01A 4A3BJ 4ZYEA 4XBFA 2RKHA 3MKLA 1LQ1A 3LL7A 3IRRA 1BM9A 3WTXC 3LAJA 3ZQHA 3OY9A 2NRAC 1SFEA 2W82A 4XSXF 2OQRA 2BEOA 4DYQA 3HJEA 4UVBA 5J8CA 4PJMA 5L3FA 4LOCA 4J00A 1VF9A 4F92B 2ME0A 4XR6A 3RTRA 1QVUA 1MGTA 1VQKI 2LKXA 1YX5A 3KLNA 3E5UA 3GW2A 4FX0A 4FE7A 1UG2A 3L9FA 2EV6A 3DFGA 1QU3A 4E70A 2UV1A 1G8XA 4NUBA 5CJ9A 3AAFA 4IHYA 3CZ6A 3WTUC 2JRTA 1TQMA 2XPVA 5HLTA 2VBYA 3PIOF 2QKMB 4BHBA 1BC8C 3N97A 9ANTA 2R7TA 2W25A 2P7VB 4AVPA 2XKPA 1YOVB 1E0EA 3LSJA 5HLHA 4I01A 5E17F 1T38A 2DA7A 2R7QA 3P9IA 3O8HA 2PLYA 2IS4A 1WJCA 1YTYA 2ZFUA 1TWCJ 3HC7A 4RLFA 1FIAA 2P6SA 3IUOA 2V79A 4LMYA 4V19K 1QA6A 3TO6A 4QLCU 2OUMA 4XN3A 1VI0A 4MEXF 3PNTA 3ZN0A 4LK0F 4N9IA 3R4KA 4CZZA 2VJJA 3HSEA 4IHVA 1BR2A 2OBPA 2N8GA 2UXNA 3JSOA 4LG0B 4EJUA 1EV7A 1SMTA 3ZQQA 3M8FA 1ZYRF 2A3SA 3FMSA 5J6XA 4ENKA 1J75A 4D7NA 1X1DA 3A1YA 1G6NA 2CMPA 2I5UA 3BG9A 3JW4A 2Y0SA 1FYMA 2V9VA 4F93B 1ZTRA 3WE3A 3S1RJ 2HVSA 4IRHA 2IGNA 4BYYA 2KRCA 4AIJA 3GTOJ 3OS2A 3IH2A 4RM3A 1XMXA 1HDDC 2VE8A 1Y39A 3WTWC 2GOMA 2A68F 1DGWY 2HEOA 1X2NA 2OQGA 4CHUA 4A6DA 5LHIA 1JHHA 2R7DA 3JCUC 2A6EF 1FP1D 2VL8A 2HQAA 5GADJ 4PJJA 3JSPA 5DV5A 5E1WA 2NVTJ 4FCYA 1VQ8I 1BN5A 4M6YA 1TWGJ 2G0EA 3J80Z 3OSGA 1RNLA 2IGOA 3HOVJ 3GFMA 5EZGA 1ETYA 4C2UA 3BR2A 4GGGA 3A0HC 1MDMB 1TW3A 4KUMA 2VUMJ 1I1GA 3K4CA 5ICEA 2PI0A 1PUFB 4LG0A 3HUGB 4H4KC 2R0QC 4BXXJ 2DODA 5ILUA 2K85A 4B48A 4PZJA 3CCLI 2LLKA 2JK3A 2YSRA 1VQOI 4B3AA 4XSZF 5HOOA 3TL4X 1E2XA 2YU9J 2M0CA 2E5ZA 3DCFA 2H6BA 3TDZC 4BS9A 4II3A 3HOTA 3KYDB 3IH4A 1Z3YA 3M8EA 4IL6C 2VXDA 4ENNA 2ESNA 4XRFA 2JQ7A 3IHUA 2NNYA 3A0BC 2HXIA 3SJMA 4OMYA 3J81K 4Z2YA 2XIGA 3LWFA 2FOKA 4GO1A 4U7BA 2JUCA 3LSTA 4E7ZA 4QTRA 2ICWG 1O3QA 4FETA 2PX9A 3QOPA 4HAMA 2LMDA 2L54A 2D2WA 4M3BA 4UUTA 5E3LA 1K4TA 5F6FA 1XGOA 2GIVA 3ZMZA 2FE3A 3Q9SA 3CLQA 2BYVE 5HS7A 2IS1A 4KDPA 3BROA 3LAPA 4KA4A 2W57A 2K40A 4ON0A 2NVXJ 2XUBA 2EFPA 3H5AA 3HUGA 1MNEA 4CUGA 4FE4A 2R7FA 2OV7A 2EWNA 2M0MA 4LK1F 3JRIA 1D3YA 1NTCA 3LSKA 1GDTA 4A3EJ 2Z3YA 2L4MA 3L7WA 5IP7J 3ECOA 2JUGA 4RB2C 4G7ZF 3F0CA 3H35A 5FLVA 3U9GA 1P6RA 4EM2A 5J4YA 1EF4A 1XS9A 4BY1J 3BPXA 2ELJA 3ZQLA 4XRSA 4QWQA 4WF2A 2AQEA 5B3SH 2OD5A 2Y48A 3K70D 1ENHA 2IS6A 4AWXB 3BP8A 4N4OB 1WI9A 3HRMA 4GYGA 3PO2J 2WY8Q 1POGA 3RPUA 2DYSH 3RDIA 3FMRA 3BJOA 3U1DA 4BQOA 1MW7A 4QPQA 1X1PA 2HFHA 4XONA 4BBRJ 2KJBA 5DM7F 4YIRX 1QBJA 1OISA 2M7AA 1W4MA 3DEUA 3IWFA 4U0WA 4IPAA 3PFIA 1K7AA 1WZ2A 2NVYJ 1WSUA 3F8NA 3FXUA 3HKZA 4UB6C 3WU1B 4RGUA 1Z3XA 4IO9F 4A3CJ 2E7XA 2FQ3A 1F4KA 3KP7A 1YHQI 3S8PA 1QVTA 3BY6A 3CJNA 3ZQCA 1ZG3A 4JYKA 4MQVA 4B44A 3W3CA 4I0BA 5BNGA 2F5VA 3K69A 4PFOA 3D1NI 1Z21A 2ZBKA 6PAXA 2EILH 2BXYA 1SEUA 2KRFA 5IYBJ 1U9OA 4XQFA 2NS8A 2IVMA 2BGCA 1U8BA 4A0XA 4ENMA 1XGSA 1KGSA 5D6FA 4HF2A 3ZQFA 3E97A 2W7NA 4AYBA 2GA1A 1HW5A 1FT9A 3WTZA 2HVQA 2YX7A 1YJNI 1V5GA 2XGCA 4KMUX 1ORKA 3I71A 1C0WA 4M71A 1R36A 4A0ZA 1ZRCA 1GVDA 2F5EA 3T8TA 2C6YA 3QRFF 1JUPA 1BR4A 2M4GA 3AG3H 1IN5A 2ADUA 4UNOA 1XSDA 1EJ9A 4BH9A 3UNGC 1OCTC 1MBKA 4EATA 3ELKA 3CMMA 1TTYA 4R79A 3BT9A 2E60A 3K1PA 2RDPA 2XRLA 4BKXA 4MFDA 2CQ7A 2M1BA 5DD4A 3JAMK 2WTEA 4N4NB 1HC8A 5K5RA 4A69C 1KA8A 2CQXA 4I6ZA 4B43A 1GUUA 3QQAA 3ESWB 3O2PE 4OIPF 2HQ5A 1W7PD 2K9SA 4PUSA 1FLIA 5ICFA 2KIUA 4XOPA 4D9JA 1YI2I 3CDHA 1RI7A 4IXAA 4PGGA 2E35A 5E18F 3HL2A 4UXNA 5KK1A 5BS6A 5IOZA 4IHSA 2COBA 3B6CA 1R6RA 2CQKA 3QWLA 4HQEA 3ABKH 3DTIA 1T39A 3R0JA 3LSGA 1UMQA 3CP2A 2H94A 3DBLB 2WAQN 1HXDA 1B9NA 2PJPA 3BR6A 2KHMA 4LLGF 1T33A 4DNCA 3CCEI 1A6QA 3EUKL 1J9IA 1LEAA 3T1BA 1WI3A 4E7HA 1IO2A 3D5SC 5HLGA 3K0LA 2ZMEC 2R5YB 2VASA 2ZJPF 1Z6TA 2OF7A 4ESBA 2FBKA 1R22A 2BVLA 3I9V2 2G7UA 1IRGA 2DQLA 1CF7B 4BEHB 2JRMA 2L2OA 2LF8A 3F3XA 1NG7A 2COMA 1SFUA 1H9GA 3Q9VA 2R92J 2FU4A 5CYVA 5FROA 3KZZA 1ON2A 2KT0A 4CDGA 3ONQA 1YJWI 1LFBA 1R5HA 3P9CA 2KFDA 1KQ8A 2MW8A 2QVOA 3IKVA 4MTEA 4C2MJ 5EGOA 3TW7A 5DCFA 3EYIA 4F7ZA 1LKXA 4M3DA 4ANJA 2XDVA 3BC8A 3C7JA 1ZGJA 2MH9A 4ZTFA 3QP6A 4CCLA 2BXZA 3HRUA 4RB0A 3BR5A 3M4OJ 1OYWA 4EGZA 2QYOA 2M4KA 1D8KA 1T56A 4HBLA 4G94A 2V9PA 4IQ4A 3S3NA 2UZKA 4A3IJ 1RRJA 2W1OA 4IOAF 4EJWA 1D1BA 2JWTA 3O6BB 2VC0A 3LA7A 4BHPA 5LGTA 2M45A 5F0HA 4CZCA 3HOZJ 2R5YA 3G71I 2W48A 1WH5A 4BUPA 2IA1A 4BE1A 5H6QA 3LSPA 4IKFA 5TISC 1QZZA 2Z5UA 2Z99A 5TGTA 1YW8A 4CA0A 2HQRA 1CF7A 2DPUA 1P92A 2EIMH 3BTLA 3EDPA 4RDUA 3X2QH 5F1RA 1OFCX 2EFOA 1OJLA 2ETHA 5K7FA 1VQNI 2E1OA 2JJ7A 3K4BA 4HNUA 2A6TA 1U5TB 1O3TA 1X1AA 4YIIA 4HNTA 1ZRFA 3QU6A 2CUJA 4OU0A 3UR3C 3JRDA 2FXAA 3H3ZA 2RQPA 3A03A
chains in the Genus database with same CATH topology
3RJPA 2ZKZA 2W84A 4M73A 1O7FA 3I0TA 2QBYB 4YG2F 1UB9A 3WGGA 1HKSA 5BOXA 2JPCA 2PMUA 2CSOA 1LDDA 4ZZLA 1S29A 2V1XA 3WTSC 1FC3A 3KP3A 2EB7A 5BQTA 2OZ6A 5LBQA 3M7GA 2QWWA 3QU3A 3WTYC 4KIFA 1KQ9A 5CVUA 4G7HF 2BBYA 2IP2A 1FBQA 4DQ2A 4O3MA 4HOBA 1NHAA 4TV7A 1W5SA 4AD9A 1U5TA 2RGVA 4KIBA 2XHKA 2HKXA 3HSRA 3K1MA 4Y17A 1F5TA 4R1HA 4G7OF 4OIRF 1BI0A 2YPRA 3FZVA 1OYYA 4LJZF 4EV0A 3KEOA 4HF1A 2BV6A 4M6XA 3R61A 1EH7A 4EMSA 3DXJF 2GQQA 3EUHA 3CUQC 2EA4A 1FBUA 1XD7A 2A5YB 2FMLA 1U78A 1RUNA 5CVVA 1P4XA 1FWZA 2EV0A 3GXOA 1XMKA 3V8LA 1T2KA 3V8KA 2WC2A 5A2QZ 3F8FA 4ENJA 5J8FA 2PBIA 2DU9A 2HGCA 5ICCA 4KFCA 3R0AA 1YS7A 2KIMA 1J2XA 1BOAA 4A5NA 3GEZA 2A69F 4ASNA 1T0FA 1DDNA 1TLHB 2F5DA 3TGNA 4KMFA 5H6RA 3DQVC 3GLXA 4YIFA 2HTJA 1TNSA 1XGNA 3MEXA 1R1VA 1SD7A 1QQIA 1SD6A 2QQ9A 5D5WB 2ISZA 1ZH5A 4WK8F 4YFXF 2CWEA 4MHGA 1R1UA 3GFLA 3I54A 3HRSA 2ZNYA 4P9UA 2CW0F 1YFHA 3TKYA 1MZBA 3U2RA 2ACJA 5JVTA 3FM5A 1FBSA 2CGPA 2VBXA 1TW2A 1UHWA 5K5QA 5D5UB 4OIQF 1LDJA 1FP2A 1TBXA 5FD5A 4UUVA 3F22A 1R00A 3DV8A 1L0OC 2L4AA 4P5OA 5LRSA 1IN7A 2FA5A 3FMQA 2P6TA 4HZFA 3RYRA 4GCVA 2QZ8A 1SMYF 2WWYA 1WRJA 2AS5F 2VBZA 5IT9K 1HSTA 2IW5A 1X3UA 3I5UA 2W85A 3LQQA 4P9FA 5BMZA 1LJ9A 4HX7A 5FLXK 2J5PA 3MQ0A 1ZG5A 5HDNA 3N4MA 3I53A 3WTTC 1L3LA 5DUKA 4HX8A 3DKWA 3HOSA 3BDDA 4HV6A 2MLGA 4KICA 1OR7A 3D0SA 3MAJA 4M9ZA 2VXZA 1FSHA 4MQ9F 4JQFA 3ERED 3KLOA 3ML6A 5LLQA 1R23A 4UVCA 3HYIA 2DLLA 3J7AO 3VEPA 4BQAA 1YS6A 2QM3A 2NYXA 3IWZA 4KIGA 1USTA 1CGPA 1YG2A 1O7LA 3C3WA 3R6SA 5DCMB 1ON1A 3HSFA 2DK5A 4PGHA 2L01A 3KEQA 4L9JA 5LRRA 4OINF 3Q5FA 2FEZA 1QNTA 2OU2A 3KE2A 3IKTA 1T98A 1G3WA 1SD5A 1LEBA 1GXQA 3WGHA 3G73A 2TDXA 3GZ6A 2EFWA 2DBBA 3LA2A 1XSXA 4P55A 3G3ZA 1UCRA 1KYWA 4JBAA 5FD6A 1FOKA 1JGSA 1V3FA 3DPTA 2VOOA 5CVJA 1EH8A 1WQ2A 1QPMA 3GO5A 4MEYF 5LHGA 5DCMA 2XAFA 1JXSA 3FWEA 3MCZA 5K1YA 3F8BA 2O61A 2GAUA 1U3EM 5DD8A 2RNJA 3RKXA 2HYGD 5D5XB 1B1BA 2UWMA 3I59B 5CVIA 4ESFA 1K78B 4HDUA 4S05A 1EH6A 1R58A 1KQ0A 5AONA 1SFXA 1P4WA 4K2EA 2HOEA 2NAZA 4ZYGA 3JTHA 3FHZA 3CLOA 1MKMA 2MA3A 1DUXC 2QQAA 2ZXJA 2GA2A 3EQLF 4A12A 1I6XA 4WCGA 1Y0UA 2D45A 3I59A 1S3JA 5L3DA 4RGSA 1FX7A 4EVIA 1ONVA 1K78A 2E7WA 4UV9A 1BI2A 3MWMA 2M8EA 2BE5F 2GXGA 4N9HA 3TOBA 1SD4A 3TOAA 1R1TA 1WWXA 3EYYA 4I02A 3SXYA 5HS8A 2VT2A 3RPQA 2LF7A 1GXPA 2P5KA 3TO9A 2K7LA 1BI3A 3H92A 1XCBA 1UFMA 1R7JA 1Z05A 2CFXA 4ETSA 2V6CA 1SAXA 3W6JB 1Z1DA 5LHHA 5F64A 1Z7UA 3GF2A 3RKYA 4WXHA 1OKRA 1I5ZA 3KP4A 5CVRA 5HLIA 5LGUA 2HS5A 4B09A 2GZWA 4L9VA 1STZA 2YU3A 2L3DA 4IVNA 3SHFA 3T5XA 4Q48A 3COAC 1OPCA 2OAZA 2JZYA 4BNCA 4HDVA 5EEHA 3BWGA 1WKMA 5TJJA 2O0YA 1KU7A 4A6EA 3KFWX 4L0ZB 1IZ1A 3E6BA 1B9MA 2K02A 1P2FA 4L5IA 2UXXA 2WV0A 2VT3A 2XV4S 2QLZA 4N0BA 1FZPB 5ILSA 4M74A 3VFZA 4L5JA 5E1XA 4CYDA 1W7PB 1XB4A 3ABTA 2FBIA 2M5WA 3F6VA 4HV5A 5ILVA 4O5VA 3GZ5A 2Z33A 5FO5A 2HZTA 1VTNC 5AIPA 2HQNA 1DP7P 4RGRA 3E3VA 1BC7C 1MJAA 4I98B 4D0PA 5L3EA 1S8NA 3HTSB 5KVRA 5D4SA 5L3BA 2E1NA 3ZN1A 2O6GE 2STWA 3CUOA 5E1ZB 1G3YA 2Z9OA 5DDGA 1XSVA 1YIOA 1U5TC 3V7SA 3ABUA 1Z91A 1W7PA 3FF5A 3ZQ7A 4NB5A 2V1UA 3FM3A 3F23A 2EFNA 3GFJA 1IN8A 5HDGA 3ISPA 1GVJA 2IA2A 4U0YA 1PP7U 1XDSA 1O3RA 2DFIA 2VODA 3KP6A 1RUOA 4YFNF 4UVAA 4RAZA 2IPQX 4ZYHA 5JHUA 4HLYA 1D8JA 1QZYA 1QGPA 3HHGA 3LFKA 3T8RA 3ZMTA 3WGIA 2X0LA 4JK1X 1XGMA 2G7HA 4NHJA 1J5YA 4MGRA 2JPBA 2IJLA 4EQQA 5LGNA 4A2UA 1YQAA 4KN4X 1ZRDA 1F1ZA 4PDKA 3K2ZA 5TRDA 1DPUA 5K5OA 3B73A 3E6DA 2XGXA 2DW4A 1AOYA 5CLSA 2IRFG 4IRIA 4IF4A 4WXCA 3GFIA 3L09A 1PP8F 1IN4A 1V4RA 3O3KA 4Y13A 1IW7F 3REOA 2ZO4A 3MZHA 2FF4A 2ZFWA 2R3SA 2DAOA 1U2WA 2VC1A 3WE2A 4CO8A 2MBFA 3BJAA 1LB2A 2Q2EA 3QAHA 3F6OA 3BZ6A 1ODDA 4EM0B 3CUQA 2D1HA 2ZCWA 3E6CC 2HWVA 4EJTA 1ZARA 1FY7A 2GXBA 2PG4A 1IXCA 4KNYA 1S7OA 1HBXG 2XAQA 3I4PA 2LNBA 4CICA 1IF1A 3WTVC 2K4JA 2OA4A 1TQPA 4AIKA 3P9KA 3PQJA 2ISYA 4LLNA 2ESHA 5E8IA 2A07F 3SFZA 1OMIA 3S2WA 4WWCA 1A04A 4ZH4F 1R5GA 2MD5A 3EETA 3BOQA 2FSWA 1YW7A 2F2EA 3NEUA 2W24A 3GUDA 3R60A 1IAWA 1XCVA 5L3CA 1LNWA 1ZREA 2P4WA 4IJAA 2PN6A 1BI1A 1HW1A 1B6AA 2FNAA 1P4AA 2EV5A 4RAYA 1USSA 3V7CA 3V7RA 3J80K 3GVAA 1OYIA 2KJCA 3DPLC 5HVQC 4LD5A 2G9WA 1ZAOA 2H6CA 4G6QA 3F72A 1U8RA 4IHTA 1KU2A 1FYKA 2EA2A 3FX3A 2K4BA 2RN7A 2DK8A 4G6DA 1FSEA 5FB2A 4OIOF 2NS0A 2DT5A 4BHCA 2MLKA 5AIQA 1JHFA 2XASA 3SZTA 4A0YA 4RS8A 2M87A 1BIBA 4G9YA 3E5XA 3ZMDA 1RIOH 4UV8A 5IT9Z 3GYHX 3LQRA 3CO6C 3ULQB 3F8MA 5ED4A 5EEGA 3MFKA 1FNNA 2LDUA 5FLXZ 4MTDA 5JI6A 2A61A 3WU0A 4PCQA 2F5FA 2O3FA 4P96A 5HS9A 4BXUA 1IXSB 1J0RA 3V4GA 4RB1A 4FHTA 2FRHA 3DP7A 5IT3A 2A6HF 3K1NA 1ZLKA 3QPHA 3FXRA 4Y15A 1ZG1A 1Z9CA 4GYIA 1B59A 3P7NA 2DTRA 2P7CB 3ZPLA 5DYMA 1YLFA 1REPC 2MH2A 3C18A 4XLNF 4ZYDA 1T6SA 1BBYA 1DPRA 3NRVA 3NQOA 3TO7A 1MDMA 4KYWA 4HX4A 5JR3A 3HTUA 1RZ4A 5FFXA 2XROA 2IA0A 3IC7A 5D8KB 2JSCA 4M9XA 2XVCA 4U7DA 3BJ6A 2VOPA 4ZZDA 4RGXA 4HLXA 4H0EA 3ZMUA 3T0YA 3J81Z 1HKQA 1XDUA 2H27A 1G3TA 4AIHA 2Q0OA 5BPIA 1BJAA 2QQBA 2X4HA 1H9TA 5ERIA 1QO0D 2M30A 4HW0A 3PQKA 2VN2A 4I09A 2QENA 4EJVA 2EFQA 4LFUA 5FGMA 1YO5C 2GWRA 2F5CA 1IXRC 1Q1HA 2KKOA 2XAJA 2H09A 1J7KA 1UHMA 3RI4A 4KN7X 2HDCA 4HF0A 1ZHFA 2CYYA 3B02A 1HSJA 4OOIA 1HKTA 4CGZA 3TDUC 2K86A 3QPTA 3F8CA 3IL2A 4I7HA 1F9NA 2MC3A 3RIRA 4EJOA 4M72A 5E20A 3RYPA 4A5MA 1MJBA 1IUYA 3CO7C 3KETA 4WX9A 5JFRA 1GHCA 1I27A 4LB5A 3FXQA 3C1DA 4R8HA 5H20A 2EK5A 3E6MA 3CTAA 2AXLA 1I1SA 2LKPA 1K79A 2RVCA 2DQRA 1TNTA 2FMYA 3OV8A 2J5OA 1ZN2A 1AWCA 3OOPA 5D5VB 2K27A 2ZMEB 1FPQA 4HA8A 2YR2A 2ELHA 4WXDA 3JAMZ 3ZMSA 1XN7A 2HKOA 5D8LB 1IN6A 4UHTA 3KZYA 2NNNA 1G4DA 3BPVA 2YX4A 3HHHA 2EJRA 2XAHA 3I64A 2VONA 4CXFA 1K6OA 3LA3A 2PQ8A 2DI3A 1IRFA 2STTA 2IT0A 1E17A 4LLLA 5DUIA 5LEKA 4O6JA 3ROUA 2ZMEA 1B4AA 4YFKF 3KCCA 5HDKA 3VB2A 1HQCA 3TQNA 4XLPF 1D5VA 1Z6RA 1J59A 3HIFA 2O8XA 4L18B 4KT5C 3JTGA 2KIFA 2QUFA 4L0YB 3K9TA 2L02A 4G8XA 2XAGA 2D1VA 5FFZA 4ESJA 4OMZA 1ZLJA 2FNPA 3WODF 2Y75A 3RKWA 2HR3A 2P5VA 4EM1A 3QP5A 4U88A 4HQMA 1TQIA 3F21A 2CO5A 1G3SA 4IRGA 3GWZA 1O3SA 1XMAA 2Y0MA 2JT1A 3E5QA 2OZUA 2XRNA 4L9TA 4FX4A 1O57A 3V8JA 5A2QK 2LSOA 3KP5A 3H3UA 1FYLA 4HYEA 2B0LA 5DEQA 1H0MA 1KYZA 2DO7A 2VE9A 4Q47A 5E8GA 3ZMVA 1BIAA 2P5LC 3D5LA 3IRQA 3SZPA 3M9AA 3HRTA 2QBYA 4NQWA 5ICGA 2PEXA 1S6LA 4LB6B 3L2CA 3CUQB 4Q4ZF 3VODA 4U0VA 1MD0A 5BPDA 1JE8A 1LDKB 2PFBA 4MNUA 3ECHA 3DF8A 1HW2A 1U6GA 3SQNA 4S04A 1PUEE 4LGWA 1ZGAA 4BAYA 3ZP5A 3MZYA 4B8XA 2FBHA 2PMHA 2XKOA 2HTSA 4I0AA 1YW9A 5D4RA 1W5TA 1KU3A 1KU9A 3W6KB 3I58A 2Q8KA 2ZNZA 3KP2A 4FT8A 4GXOA 5D6EA 1MJ9A 1S7AA 1PDNC 2O03A 4Q5SF 5L3GA 4EGYA 5LEJA 4L9NA 2E1CA 2RC4A 2DPDA 3WG9A 3VOEA 2JTVA 3L00A 4M9SA 2VBWA 2HYFA 2RV8A 2CG4A 2ZJ2A 2P8TA 2V1DA 1LVAA 1YYVA 3M1EA 4RB3C 3GX4X 4I2OA 1ULYA 4ZYEA 4XBFA 2RKHA 1LQ1A 3IRRA 1BM9A 3WTXC 3LAJA 2NRAC 1SFEA 4XSXF 2OQRA 2BEOA 4UVBA 5J8CA 5L3FA 3RTRA 1MGTA 3KLNA 3E5UA 3GW2A 4FX0A 3L9FA 2EV6A 3DFGA 4E70A 5CJ9A 3AAFA 3WTUC 2JRTA 1TQMA 2VBYA 4BHBA 1BC8C 3N97A 2W25A 2P7VB 4AVPA 2XKPA 5HLHA 4I01A 5E17F 1T38A 3P9IA 2PLYA 1YTYA 2P6SA 2V79A 4LMYA 3TO6A 4QLCU 4MEXF 3ZN0A 4LK0F 4N9IA 3R4KA 4CZZA 3HSEA 2OBPA 2UXNA 3JSOA 4LG0B 4EJUA 1EV7A 1SMTA 3M8FA 1ZYRF 2A3SA 3FMSA 5J6XA 4ENKA 1J75A 1G6NA 3JW4A 1FYMA 2V9VA 3WE3A 4IRHA 4BYYA 4AIJA 2VE8A 3WTWC 2A68F 2HEOA 2OQGA 4CHUA 4A6DA 5LHIA 1JHHA 2R7DA 2A6EF 1FP1D 3JSPA 5DV5A 5E1WA 1BN5A 4M6YA 3J80Z 1RNLA 3GFMA 4GGGA 1MDMB 1TW3A 4KUMA 1I1GA 5ICEA 2PI0A 4LG0A 5ILUA 4PZJA 2YSRA 4XSZF 5HOOA 1E2XA 2H6BA 3TDZC 3HOTA 3M8EA 4ENNA 2ESNA 4XRFA 3IHUA 2NNYA 4OMYA 3J81K 4Z2YA 2XIGA 3LWFA 2FOKA 4GO1A 4U7BA 3LSTA 1O3QA 3QOPA 4HAMA 2L54A 2D2WA 5F6FA 1XGOA 2GIVA 3ZMZA 2FE3A 3Q9SA 2BYVE 5HS7A 4KDPA 3BROA 3LAPA 4KA4A 2W57A 4ON0A 2XUBA 2EFPA 3HUGA 2R7FA 2EWNA 4LK1F 1D3YA 2Z3YA 2L4MA 3L7WA 3ECOA 4RB2C 4G7ZF 3U9GA 1P6RA 4EM2A 3BPXA 4QWQA 4WF2A 2OD5A 2Y48A 4AWXB 3BP8A 1WI9A 3HRMA 4GYGA 3RPUA 3RDIA 3FMRA 3BJOA 3U1DA 1QBJA 2HFHA 2KJBA 1W4MA 3DEUA 3IWFA 4U0WA 4IPAA 3PFIA 1K7AA 1WSUA 3F8NA 3FXUA 3WU1B 4RGUA 2E7XA 2FQ3A 1F4KA 3KP7A 3BY6A 3CJNA 1ZG3A 4MQVA 4I0BA 3K69A 2ZBKA 6PAXA 2KRFA 2IVMA 2BGCA 4A0XA 4ENMA 1XGSA 1KGSA 5D6FA 4HF2A 3E97A 2GA1A 1HW5A 1FT9A 3WTZA 2YX7A 4KMUX 3I71A 1C0WA 4M71A 1R36A 4A0ZA 1ZRCA 2F5EA 3T8TA 2C6YA 3QRFF 1IN5A 2ADUA 4UNOA 1XSDA 4BH9A 3ELKA 1TTYA 4R79A 3K1PA 2RDPA 2M1BA 5DD4A 3JAMK 2WTEA 5K5RA 1KA8A 4OIPF 3O2PE 1FLIA 1W7PD 5ICFA 2KIUA 3CDHA 1RI7A 4IXAA 4PGGA 5E18F 4UXNA 5KK1A 5BS6A 4IHSA 2CQKA 4HQEA 1T39A 3R0JA 2H94A 1HXDA 1B9NA 2PJPA 4LLGF 4DNCA 1J9IA 1LEAA 3T1BA 5HLGA 3K0LA 1Z6TA 4ESBA 2FBKA 1R22A 2G7UA 1IRGA 2DQLA 1CF7B 2LF8A 3F3XA 2COMA 1SFUA 1H9GA 3Q9VA 2FU4A 5CYVA 3KZZA 1ON2A 4CDGA 1R5HA 3P9CA 1KQ8A 2QVOA 3IKVA 4MTEA 5DCFA 3EYIA 4F7ZA 3C7JA 1ZGJA 2MH9A 3QP6A 4RB0A 3HRUA 1OYWA 4EGZA 2QYOA 1D8KA 4HBLA 4G94A 2UZKA 4EJWA 3O6BB 2VC0A 3LA7A 4BHPA 5LGTA 2M45A 2IA1A 5H6QA 1QZZA 2Z5UA 2Z99A 1YW8A 2HQRA 1CF7A 2DPUA 1P92A 3EDPA 5F1RA 2EFOA 2ETHA 1U5TB 1O3TA 1ZRFA 4YIIA 3QU6A 4OU0A 2FXAA 3H3ZA 2RQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJP A;  2ZKZ A;  2W84 A;  4M73 A;  1O7F A;  3I0T A;  2QBY B;  4YG2 F;  1UB9 A;  3WGG A;  1HKS A;  5BOX A;  2JPC A;  2PMU A;  2CSO A;  1LDD A;  4ZZL A;  1S29 A;  2V1X A;  3WTS C;  1FC3 A;  3KP3 A;  2EB7 A;  5BQT A;  2OZ6 A;  5LBQ A;  3M7G A;  2QWW A;  3QU3 A;  3WTY C;  4KIF A;  1KQ9 A;  5CVU A;  4G7H F;  2BBY A;  2IP2 A;  1FBQ A;  4DQ2 A;  4O3M A;  4HOB A;  1NHA A;  4TV7 A;  1W5S A;  4AD9 A;  1U5T A;  2RGV A;  4KIB A;  2XHK A;  2HKX A;  3HSR A;  3K1M A;  4Y17 A;  1F5T A;  4R1H A;  4G7O F;  4OIR F;  1BI0 A;  2YPR A;  3FZV A;  1OYY A;  4LJZ F;  4EV0 A;  3KEO A;  4HF1 A;  2BV6 A;  4M6X A;  3R61 A;  1EH7 A;  4EMS A;  3DXJ F;  2GQQ A;  3EUH A;  3CUQ C;  2EA4 A;  1FBU A;  1XD7 A;  2A5Y B;  2FML A;  1U78 A;  1RUN A;  5CVV A;  1P4X A;  1FWZ A;  2EV0 A;  3GXO A;  1XMK A;  3V8L A;  1T2K A;  3V8K A;  2WC2 A;  5A2Q Z;  3F8F A;  4ENJ A;  5J8F A;  2PBI A;  2DU9 A;  2HGC A;  5ICC A;  4KFC A;  3R0A A;  1YS7 A;  2KIM A;  1J2X A;  1BOA A;  4A5N A;  3GEZ A;  2A69 F;  4ASN A;  1T0F A;  1DDN A;  1TLH B;  2F5D A;  3TGN A;  4KMF A;  5H6R A;  3DQV C;  3GLX A;  4YIF A;  2HTJ A;  1TNS A;  1XGN A;  3MEX A;  1R1V A;  1SD7 A;  1QQI A;  1SD6 A;  2QQ9 A;  5D5W B;  2ISZ A;  1ZH5 A;  4WK8 F;  4YFX F;  2CWE A;  4MHG A;  1R1U A;  3GFL A;  3I54 A;  3HRS A;  2ZNY A;  4P9U A;  2CW0 F;  1YFH A;  3TKY A;  1MZB A;  3U2R A;  2ACJ A;  5JVT A;  3FM5 A;  1FBS A;  2CGP A;  2VBX A;  1TW2 A;  1UHW A;  5K5Q A;  5D5U B;  4OIQ F;  1LDJ A;  1FP2 A;  1TBX A;  5FD5 A;  4UUV A;  3F22 A;  1R00 A;  3DV8 A;  1L0O C;  2L4A A;  4P5O A;  5LRS A;  1IN7 A;  2FA5 A;  3FMQ A;  2P6T A;  4HZF A;  3RYR A;  4GCV A;  2QZ8 A;  1SMY F;  2WWY A;  1WRJ A;  2AS5 F;  2VBZ A;  5IT9 K;  1HST A;  2IW5 A;  1X3U A;  3I5U A;  2W85 A;  3LQQ A;  4P9F A;  5BMZ A;  1LJ9 A;  4HX7 A;  5FLX K;  2J5P A;  3MQ0 A;  1ZG5 A;  5HDN A;  3N4M A;  3I53 A;  3WTT C;  1L3L A;  5DUK A;  4HX8 A;  3DKW A;  3HOS A;  3BDD A;  4HV6 A;  2MLG A;  4KIC A;  1OR7 A;  3D0S A;  3MAJ A;  4M9Z A;  2VXZ A;  1FSH A;  4MQ9 F;  4JQF A;  3ERE D;  3KLO A;  3ML6 A;  5LLQ A;  1R23 A;  4UVC A;  3HYI A;  2DLL A;  3J7A O;  3VEP A;  4BQA A;  1YS6 A;  2QM3 A;  2NYX A;  3IWZ A;  4KIG A;  1UST A;  1CGP A;  1YG2 A;  1O7L A;  3C3W A;  3R6S A;  5DCM B;  1ON1 A;  3HSF A;  2DK5 A;  4PGH A;  2L01 A;  3KEQ A;  4L9J A;  5LRR A;  4OIN F;  3Q5F A;  2FEZ A;  1QNT A;  2OU2 A;  3KE2 A;  3IKT A;  1T98 A;  1G3W A;  1SD5 A;  1LEB A;  1GXQ A;  3WGH A;  3G73 A;  2TDX A;  3GZ6 A;  2EFW A;  2DBB A;  3LA2 A;  1XSX A;  4P55 A;  3G3Z A;  1UCR A;  1KYW A;  4JBA A;  5FD6 A;  1FOK A;  1JGS A;  1V3F A;  3DPT A;  2VOO A;  5CVJ A;  1EH8 A;  1WQ2 A;  1QPM A;  3GO5 A;  4MEY F;  5LHG A;  5DCM A;  2XAF A;  1JXS A;  3FWE A;  3MCZ A;  5K1Y A;  3F8B A;  2O61 A;  2GAU A;  1U3E M;  5DD8 A;  2RNJ A;  3RKX A;  2HYG D;  5D5X B;  1B1B A;  2UWM A;  3I59 B;  5CVI A;  4ESF A;  1K78 B;  4HDU A;  4S05 A;  1EH6 A;  1R58 A;  1KQ0 A;  5AON A;  1SFX A;  1P4W A;  4K2E A;  2HOE A;  2NAZ A;  4ZYG A;  3JTH A;  3FHZ A;  3CLO A;  1MKM A;  2MA3 A;  1DUX C;  2QQA A;  2ZXJ A;  2GA2 A;  3EQL F;  4A12 A;  1I6X A;  4WCG A;  1Y0U A;  2D45 A;  3I59 A;  1S3J A;  5L3D A;  4RGS A;  1FX7 A;  4EVI A;  1ONV A;  1K78 A;  2E7W A;  4UV9 A;  1BI2 A;  3MWM A;  2M8E A;  2BE5 F;  2GXG A;  4N9H A;  3TOB A;  1SD4 A;  3TOA A;  1R1T A;  1WWX A;  3EYY A;  4I02 A;  3SXY A;  5HS8 A;  2VT2 A;  3RPQ A;  2LF7 A;  1GXP A;  2P5K A;  3TO9 A;  2K7L A;  1BI3 A;  3H92 A;  1XCB A;  1UFM A;  1R7J A;  1Z05 A;  2CFX A;  4ETS A;  2V6C A;  1SAX A;  3W6J B;  1Z1D A;  5LHH A;  5F64 A;  1Z7U A;  3GF2 A;  3RKY A;  4WXH A;  1OKR A;  1I5Z A;  3KP4 A;  5CVR A;  5HLI A;  5LGU A;  2HS5 A;  4B09 A;  2GZW A;  4L9V A;  1STZ A;  2YU3 A;  2L3D A;  4IVN A;  3SHF A;  3T5X A;  4Q48 A;  3COA C;  1OPC A;  2OAZ A;  2JZY A;  4BNC A;  4HDV A;  5EEH A;  3BWG A;  1WKM A;  5TJJ A;  2O0Y A;  1KU7 A;  4A6E A;  3KFW X;  4L0Z B;  1IZ1 A;  3E6B A;  1B9M A;  2K02 A;  1P2F A;  4L5I A;  2UXX A;  2WV0 A;  2VT3 A;  2XV4 S;  2QLZ A;  4N0B A;  1FZP B;  5ILS A;  4M74 A;  3VFZ A;  4L5J A;  5E1X A;  4CYD A;  1W7P B;  1XB4 A;  3ABT A;  2FBI A;  2M5W A;  3F6V A;  4HV5 A;  5ILV A;  4O5V A;  3GZ5 A;  2Z33 A;  5FO5 A;  2HZT A;  1VTN C;  5AIP A;  2HQN A;  1DP7 P;  4RGR A;  3E3V A;  1BC7 C;  1MJA A;  4I98 B;  4D0P A;  5L3E A;  1S8N A;  3HTS B;  5KVR A;  5D4S A;  5L3B A;  2E1N A;  3ZN1 A;  2O6G E;  2STW A;  3CUO A;  5E1Z B;  1G3Y A;  2Z9O A;  5DDG A;  1XSV A;  1YIO A;  1U5T C;  3V7S A;  3ABU A;  1Z91 A;  1W7P A;  3FF5 A;  3ZQ7 A;  4NB5 A;  2V1U A;  3FM3 A;  3F23 A;  2EFN A;  3GFJ A;  1IN8 A;  5HDG A;  3ISP A;  1GVJ A;  2IA2 A;  4U0Y A;  1PP7 U;  1XDS A;  1O3R A;  2DFI A;  2VOD A;  3KP6 A;  1RUO A;  4YFN F;  4UVA A;  4RAZ A;  2IPQ X;  4ZYH A;  5JHU A;  4HLY A;  1D8J A;  1QZY A;  1QGP A;  3HHG A;  3LFK A;  3T8R A;  3ZMT A;  3WGI A;  2X0L A;  4JK1 X;  1XGM A;  2G7H A;  4NHJ A;  1J5Y A;  4MGR A;  2JPB A;  2IJL A;  4EQQ A;  5LGN A;  4A2U A;  1YQA A;  4KN4 X;  1ZRD A;  1F1Z A;  4PDK A;  3K2Z A;  5TRD A;  1DPU A;  5K5O A;  3B73 A;  3E6D A;  2XGX A;  2DW4 A;  1AOY A;  5CLS A;  2IRF G;  4IRI A;  4IF4 A;  4WXC A;  3GFI A;  3L09 A;  1PP8 F;  1IN4 A;  1V4R A;  3O3K A;  4Y13 A;  1IW7 F;  3REO A;  2ZO4 A;  3MZH A;  2FF4 A;  2ZFW A;  2R3S A;  2DAO A;  1U2W A;  2VC1 A;  3WE2 A;  4CO8 A;  2MBF A;  3BJA A;  1LB2 A;  2Q2E A;  3QAH A;  3F6O A;  3BZ6 A;  1ODD A;  4EM0 B;  3CUQ A;  2D1H A;  2ZCW A;  3E6C C;  2HWV A;  4EJT A;  1ZAR A;  1FY7 A;  2GXB A;  2PG4 A;  1IXC A;  4KNY A;  1S7O A;  1HBX G;  2XAQ A;  3I4P A;  2LNB A;  4CIC A;  1IF1 A;  3WTV C;  2K4J A;  2OA4 A;  1TQP A;  4AIK A;  3P9K A;  3PQJ A;  2ISY A;  4LLN A;  2ESH A;  5E8I A;  2A07 F;  3SFZ A;  1OMI A;  3S2W A;  4WWC A;  1A04 A;  4ZH4 F;  1R5G A;  2MD5 A;  3EET A;  3BOQ A;  2FSW A;  1YW7 A;  2F2E A;  3NEU A;  2W24 A;  3GUD A;  3R60 A;  1IAW A;  1XCV A;  5L3C A;  1LNW A;  1ZRE A;  2P4W A;  4IJA A;  2PN6 A;  1BI1 A;  1HW1 A;  1B6A A;  2FNA A;  1P4A A;  2EV5 A;  4RAY A;  1USS A;  3V7C A;  3V7R A;  3J80 K;  3GVA A;  1OYI A;  2KJC A;  3DPL C;  5HVQ C;  4LD5 A;  2G9W A;  1ZAO A;  2H6C A;  4G6Q A;  3F72 A;  1U8R A;  4IHT A;  1KU2 A;  1FYK A;  2EA2 A;  3FX3 A;  2K4B A;  2RN7 A;  2DK8 A;  4G6D A;  1FSE A;  5FB2 A;  4OIO F;  2NS0 A;  2DT5 A;  4BHC A;  2MLK A;  5AIQ A;  1JHF A;  2XAS A;  3SZT A;  4A0Y A;  4RS8 A;  2M87 A;  1BIB A;  4G9Y A;  3E5X A;  3ZMD A;  1RIO H;  4UV8 A;  5IT9 Z;  3GYH X;  3LQR A;  3CO6 C;  3ULQ B;  3F8M A;  5ED4 A;  5EEG A;  3MFK A;  1FNN A;  2LDU A;  5FLX Z;  4MTD A;  5JI6 A;  2A61 A;  3WU0 A;  4PCQ A;  2F5F A;  2O3F A;  4P96 A;  5HS9 A;  4BXU A;  1IXS B;  1J0R A;  3V4G A;  4RB1 A;  4FHT A;  2FRH A;  3DP7 A;  5IT3 A;  2A6H F;  3K1N A;  1ZLK A;  3QPH A;  3FXR A;  4Y15 A;  1ZG1 A;  1Z9C A;  4GYI A;  1B59 A;  3P7N A;  2DTR A;  2P7C B;  3ZPL A;  5DYM A;  1YLF A;  1REP C;  2MH2 A;  3C18 A;  4XLN F;  4ZYD A;  1T6S A;  1BBY A;  1DPR A;  3NRV A;  3NQO A;  3TO7 A;  1MDM A;  4KYW A;  4HX4 A;  5JR3 A;  3HTU A;  1RZ4 A;  5FFX A;  2XRO A;  2IA0 A;  3IC7 A;  5D8K B;  2JSC A;  4M9X A;  2XVC A;  4U7D A;  3BJ6 A;  2VOP A;  4ZZD A;  4RGX A;  4HLX A;  4H0E A;  3ZMU A;  3T0Y A;  3J81 Z;  1HKQ A;  1XDU A;  2H27 A;  1G3T A;  4AIH A;  2Q0O A;  5BPI A;  1BJA A;  2QQB A;  2X4H A;  1H9T A;  5ERI A;  1QO0 D;  2M30 A;  4HW0 A;  3PQK A;  2VN2 A;  4I09 A;  2QEN A;  4EJV A;  2EFQ A;  4LFU A;  5FGM A;  1YO5 C;  2GWR A;  2F5C A;  1IXR C;  1Q1H A;  2KKO A;  2XAJ A;  2H09 A;  1J7K A;  1UHM A;  3RI4 A;  4KN7 X;  2HDC A;  4HF0 A;  1ZHF A;  2CYY A;  3B02 A;  1HSJ A;  4OOI A;  1HKT A;  4CGZ A;  3TDU C;  2K86 A;  3QPT A;  3F8C A;  3IL2 A;  4I7H A;  1F9N A;  2MC3 A;  3RIR A;  4EJO A;  4M72 A;  5E20 A;  3RYP A;  4A5M A;  1MJB A;  1IUY A;  3CO7 C;  3KET A;  4WX9 A;  5JFR A;  1GHC A;  1I27 A;  4LB5 A;  3FXQ A;  3C1D A;  4R8H A;  5H20 A;  2EK5 A;  3E6M A;  3CTA A;  2AXL A;  1I1S A;  2LKP A;  1K79 A;  2RVC A;  2DQR A;  1TNT A;  2FMY A;  3OV8 A;  2J5O A;  1ZN2 A;  1AWC A;  3OOP A;  5D5V B;  2K27 A;  2ZME B;  1FPQ A;  4HA8 A;  2YR2 A;  2ELH A;  4WXD A;  3JAM Z;  3ZMS A;  1XN7 A;  2HKO A;  5D8L B;  1IN6 A;  4UHT A;  3KZY A;  2NNN A;  1G4D A;  3BPV A;  2YX4 A;  3HHH A;  2EJR A;  2XAH A;  3I64 A;  2VON A;  4CXF A;  1K6O A;  3LA3 A;  2PQ8 A;  2DI3 A;  1IRF A;  2STT A;  2IT0 A;  1E17 A;  4LLL A;  5DUI A;  5LEK A;  4O6J A;  3ROU A;  2ZME A;  1B4A A;  4YFK F;  3KCC A;  5HDK A;  3VB2 A;  1HQC A;  3TQN A;  4XLP F;  1D5V A;  1Z6R A;  1J59 A;  3HIF A;  2O8X A;  4L18 B;  4KT5 C;  3JTG A;  2KIF A;  2QUF A;  4L0Y B;  3K9T A;  2L02 A;  4G8X A;  2XAG A;  2D1V A;  5FFZ A;  4ESJ A;  4OMZ A;  1ZLJ A;  2FNP A;  3WOD F;  2Y75 A;  3RKW A;  2HR3 A;  2P5V A;  4EM1 A;  3QP5 A;  4U88 A;  4HQM A;  1TQI A;  3F21 A;  2CO5 A;  1G3S A;  4IRG A;  3GWZ A;  1O3S A;  1XMA A;  2Y0M A;  2JT1 A;  3E5Q A;  2OZU A;  2XRN A;  4L9T A;  4FX4 A;  1O57 A;  3V8J A;  5A2Q K;  2LSO A;  3KP5 A;  3H3U A;  1FYL A;  4HYE A;  2B0L A;  5DEQ A;  1H0M A;  1KYZ A;  2DO7 A;  2VE9 A;  4Q47 A;  5E8G A;  3ZMV A;  1BIA A;  2P5L C;  3D5L A;  3IRQ A;  3SZP A;  3M9A A;  3HRT A;  2QBY A;  4NQW A;  5ICG A;  2PEX A;  1S6L A;  4LB6 B;  3L2C A;  3CUQ B;  4Q4Z F;  3VOD A;  4U0V A;  1MD0 A;  5BPD A;  1JE8 A;  1LDK B;  2PFB A;  4MNU A;  3ECH A;  3DF8 A;  1HW2 A;  1U6G A;  3SQN A;  4S04 A;  1PUE E;  4LGW A;  1ZGA A;  4BAY A;  3ZP5 A;  3MZY A;  4B8X A;  2FBH A;  2PMH A;  2XKO A;  2HTS A;  4I0A A;  1YW9 A;  5D4R A;  1W5T A;  1KU3 A;  1KU9 A;  3W6K B;  3I58 A;  2Q8K A;  2ZNZ A;  3KP2 A;  4FT8 A;  4GXO A;  5D6E A;  1MJ9 A;  1S7A A;  1PDN C;  2O03 A;  4Q5S F;  5L3G A;  4EGY A;  5LEJ A;  4L9N A;  2E1C A;  2RC4 A;  2DPD A;  3WG9 A;  3VOE A;  2JTV A;  3L00 A;  4M9S A;  2VBW A;  2HYF A;  2RV8 A;  2CG4 A;  2ZJ2 A;  2P8T A;  2V1D A;  1LVA A;  1YYV A;  3M1E A;  4RB3 C;  3GX4 X;  4I2O A;  1ULY A;  4ZYE A;  4XBF A;  2RKH A;  1LQ1 A;  3IRR A;  1BM9 A;  3WTX C;  3LAJ A;  2NRA C;  1SFE A;  4XSX F;  2OQR A;  2BEO A;  4UVB A;  5J8C A;  5L3F A;  3RTR A;  1MGT A;  3KLN A;  3E5U A;  3GW2 A;  4FX0 A;  3L9F A;  2EV6 A;  3DFG A;  4E70 A;  5CJ9 A;  3AAF A;  3WTU C;  2JRT A;  1TQM A;  2VBY A;  4BHB A;  1BC8 C;  3N97 A;  2W25 A;  2P7V B;  4AVP A;  2XKP A;  5HLH A;  4I01 A;  5E17 F;  1T38 A;  3P9I A;  2PLY A;  1YTY A;  2P6S A;  2V79 A;  4LMY A;  3TO6 A;  4QLC U;  4MEX F;  3ZN0 A;  4LK0 F;  4N9I A;  3R4K A;  4CZZ A;  3HSE A;  2OBP A;  2UXN A;  3JSO A;  4LG0 B;  4EJU A;  1EV7 A;  1SMT A;  3M8F A;  1ZYR F;  2A3S A;  3FMS A;  5J6X A;  4ENK A;  1J75 A;  1G6N A;  3JW4 A;  1FYM A;  2V9V A;  3WE3 A;  4IRH A;  4BYY A;  4AIJ A;  2VE8 A;  3WTW C;  2A68 F;  2HEO A;  2OQG A;  4CHU A;  4A6D A;  5LHI A;  1JHH A;  2R7D A;  2A6E F;  1FP1 D;  3JSP A;  5DV5 A;  5E1W A;  1BN5 A;  4M6Y A;  3J80 Z;  1RNL A;  3GFM A;  4GGG A;  1MDM B;  1TW3 A;  4KUM A;  1I1G A;  5ICE A;  2PI0 A;  4LG0 A;  5ILU A;  4PZJ A;  2YSR A;  4XSZ F;  5HOO A;  1E2X A;  2H6B A;  3TDZ C;  3HOT A;  3M8E A;  4ENN A;  2ESN A;  4XRF A;  3IHU A;  2NNY A;  4OMY A;  3J81 K;  4Z2Y A;  2XIG A;  3LWF A;  2FOK A;  4GO1 A;  4U7B A;  3LST A;  1O3Q A;  3QOP A;  4HAM A;  2L54 A;  2D2W A;  5F6F A;  1XGO A;  2GIV A;  3ZMZ A;  2FE3 A;  3Q9S A;  2BYV E;  5HS7 A;  4KDP A;  3BRO A;  3LAP A;  4KA4 A;  2W57 A;  4ON0 A;  2XUB A;  2EFP A;  3HUG A;  2R7F A;  2EWN A;  4LK1 F;  1D3Y A;  2Z3Y A;  2L4M A;  3L7W A;  3ECO A;  4RB2 C;  4G7Z F;  3U9G A;  1P6R A;  4EM2 A;  3BPX A;  4QWQ A;  4WF2 A;  2OD5 A;  2Y48 A;  4AWX B;  3BP8 A;  1WI9 A;  3HRM A;  4GYG A;  3RPU A;  3RDI A;  3FMR A;  3BJO A;  3U1D A;  1QBJ A;  2HFH A;  2KJB A;  1W4M A;  3DEU A;  3IWF A;  4U0W A;  4IPA A;  3PFI A;  1K7A A;  1WSU A;  3F8N A;  3FXU A;  3WU1 B;  4RGU A;  2E7X A;  2FQ3 A;  1F4K A;  3KP7 A;  3BY6 A;  3CJN A;  1ZG3 A;  4MQV A;  4I0B A;  3K69 A;  2ZBK A;  6PAX A;  2KRF A;  2IVM A;  2BGC A;  4A0X A;  4ENM A;  1XGS A;  1KGS A;  5D6F A;  4HF2 A;  3E97 A;  2GA1 A;  1HW5 A;  1FT9 A;  3WTZ A;  2YX7 A;  4KMU X;  3I71 A;  1C0W A;  4M71 A;  1R36 A;  4A0Z A;  1ZRC A;  2F5E A;  3T8T A;  2C6Y A;  3QRF F;  1IN5 A;  2ADU A;  4UNO A;  1XSD A;  4BH9 A;  3ELK A;  1TTY A;  4R79 A;  3K1P A;  2RDP A;  2M1B A;  5DD4 A;  3JAM K;  2WTE A;  5K5R A;  1KA8 A;  4OIP F;  3O2P E;  1FLI A;  1W7P D;  5ICF A;  2KIU A;  3CDH A;  1RI7 A;  4IXA A;  4PGG A;  5E18 F;  4UXN A;  5KK1 A;  5BS6 A;  4IHS A;  2CQK A;  4HQE A;  1T39 A;  3R0J A;  2H94 A;  1HXD A;  1B9N A;  2PJP A;  4LLG F;  4DNC A;  1J9I A;  1LEA A;  3T1B A;  5HLG A;  3K0L A;  1Z6T A;  4ESB A;  2FBK A;  1R22 A;  2G7U A;  1IRG A;  2DQL A;  1CF7 B;  2LF8 A;  3F3X A;  2COM A;  1SFU A;  1H9G A;  3Q9V A;  2FU4 A;  5CYV A;  3KZZ A;  1ON2 A;  4CDG A;  1R5H A;  3P9C A;  1KQ8 A;  2QVO A;  3IKV A;  4MTE A;  5DCF A;  3EYI A;  4F7Z A;  3C7J A;  1ZGJ A;  2MH9 A;  3QP6 A;  4RB0 A;  3HRU A;  1OYW A;  4EGZ A;  2QYO A;  1D8K A;  4HBL A;  4G94 A;  2UZK A;  4EJW A;  3O6B B;  2VC0 A;  3LA7 A;  4BHP A;  5LGT A;  2M45 A;  2IA1 A;  5H6Q A;  1QZZ A;  2Z5U A;  2Z99 A;  1YW8 A;  2HQR A;  1CF7 A;  2DPU A;  1P92 A;  3EDP A;  5F1R A;  2EFO A;  2ETH A;  1U5T B;  1O3T A;  1ZRF A;  4YII A;  3QU6 A;  4OU0 A;  2FXA A;  3H3Z A;  2RQP A; 
#chains in the Genus database with same CATH topology
 3RJP A;  2CJJ A;  2ZKZ A;  2W84 A;  4E7S A;  4EEF G;  4M73 A;  1O7F A;  3I0T A;  2QBY B;  4YG2 F;  3I4M J;  1UB9 A;  2LFB A;  3WGG A;  1HKS A;  5BOX A;  2JPC A;  2PMU A;  2CSO A;  5EJC A;  1LDD A;  2NVU B;  4ZZL A;  1CQT A;  3AL0 B;  3E0J B;  4RM2 A;  4W1U A;  2NVQ J;  1S29 A;  2LH9 A;  2V1X A;  3WTS C;  3S1Q J;  3RQ4 A;  1FC3 A;  3KP3 A;  3OS1 A;  1BW6 A;  2EB7 A;  5BQT A;  2OZ6 A;  4IX7 A;  5LBQ A;  3M7G A;  1TT0 A;  1A5J A;  2QWW A;  3QU3 A;  3WTY C;  4KIF A;  1FIP A;  1WJB A;  1KQ9 A;  2TRT A;  5CVU A;  3L2Q A;  4G7H F;  2BBY A;  2IP2 A;  1HOM A;  2HPM A;  1FBQ A;  4DQ2 A;  3QYF A;  4O3M A;  4HOB A;  1NHA A;  4TV7 A;  1W5S A;  4AD9 A;  1U5T A;  1RPW A;  2E71 A;  2RGV A;  4A3F J;  2AO9 A;  4KIB A;  3QOE A;  2XHK A;  3FIW A;  3OYN A;  2QQ8 A;  2HKX A;  1V5E A;  1JUM A;  2KDO A;  4BE2 A;  3HSR A;  3VYS B;  2CH0 A;  1IDZ A;  5C4X J;  3K1M A;  3K2A A;  4Y17 A;  1F5T A;  4HST A;  2QSG X;  3G6E I;  3QYE A;  4R1H A;  3RKQ A;  4G7O F;  2KDZ A;  4OIR F;  3QPL A;  1BI0 A;  2YPR A;  3D5R C;  1OYY A;  3FZV A;  4LJZ F;  4EV0 A;  3KEO A;  4HF1 A;  4LIV A;  4X0G A;  2BV6 A;  3BG7 A;  4M6X A;  3R61 A;  3JRB A;  4F3Q A;  1EH7 A;  2WV1 A;  3JR9 A;  1ERD A;  1HCR A;  2KLO A;  2UUZ A;  1Z0X A;  1ZEL A;  4NDL A;  1IV8 A;  4EMS A;  3DXJ F;  4E7K A;  2GQQ A;  3HOU J;  3EUH A;  4AID A;  3CUQ C;  2EA4 A;  4PSW A;  1FBU A;  2M7B A;  2ZC2 A;  1TC3 C;  1XD7 A;  2A5Y B;  3M07 A;  5M5W J;  3OS0 A;  1IG7 A;  1F43 A;  2FML A;  1U78 A;  1I3Q J;  1RUN A;  4PJL A;  5CVV A;  1G2H A;  2K5C A;  3ZQG A;  3HBL A;  1P4X A;  1FWZ A;  2EV0 A;  3GXO A;  5IPA A;  1Y1W J;  3QPS A;  1XMK A;  3V8L A;  4BQN A;  3K4N A;  2M2E A;  1FMV A;  3HOY J;  1T2K A;  3V8K A;  1PJR A;  2WC2 A;  2VJI A;  3F8F A;  5A2Q Z;  1K4S A;  4B3X A;  3GBG A;  4ENJ A;  5J8F A;  2PBI A;  1QPI A;  2DU9 A;  2HGC A;  5ICC A;  3TBI A;  4F55 A;  4KFC A;  3R0A A;  1YS7 A;  2KIM A;  1J2X A;  1BOA A;  1MMG A;  4A5N A;  3GEZ A;  2A69 F;  4ASN A;  1FTT A;  4BL0 B;  1T0F A;  3TP0 A;  4E6K G;  2L9N A;  1DDN A;  2FUG 2;  2CV2 A;  2L7F P;  2H8W A;  3IAM 2;  4XLA A;  2GIZ A;  5J1R A;  3MKW B;  3CC2 I;  2JSP A;  2E2I J;  3HGY A;  1TLH B;  2F5D A;  3TGN A;  4KMF A;  1DU6 A;  5EYR A;  5H6R A;  3DQV C;  3GLX A;  2Y9Y A;  4QPO A;  4YIF A;  2HTJ A;  2DA4 A;  4DZJ A;  2V4J C;  1DP3 A;  4RBO A;  1TNS A;  1Y6I A;  1ITY A;  4JP0 A;  1XGN A;  3MEX A;  1R1V A;  1SD7 A;  1QQI A;  4BAC A;  1SD6 A;  4XMY A;  4RAF A;  2QQ9 A;  5D5W B;  2ISZ A;  3DU6 A;  1ZH5 A;  2R7U A;  4BQQ A;  2HOA A;  4WK8 F;  3PIP F;  4XM3 A;  4YFX F;  5C44 J;  3DKX A;  1DU0 A;  2CWE A;  4MHG A;  1R1U A;  5J47 A;  3GFL A;  3I54 A;  1XG1 A;  4PK4 A;  3HRS A;  2ZNY A;  3Q0U A;  3BZC A;  4AVZ A;  4P9U A;  2CW0 F;  3GTM J;  3AG4 H;  1YFH A;  3TKY A;  1MZB A;  3CC7 I;  3U2R A;  2ACJ A;  3RZO J;  2PMZ N;  3RCO A;  3PUB A;  5JVT A;  3FM5 A;  1FBS A;  2CGP A;  2O8K A;  1VQ6 I;  2VBX A;  3FHN A;  5M3F J;  3GTK J;  1TW2 A;  3G1O A;  1UHW A;  5K5Q A;  5D5U B;  1Q1V A;  4OIQ F;  2DA2 A;  1LDJ A;  1FP2 A;  1BJZ A;  4A3D J;  1TBX A;  5FD5 A;  4UUV A;  3F22 A;  1R00 A;  1D1A A;  3DV8 A;  1O4X A;  4IQJ A;  3FBN B;  4OWR B;  2X6W A;  4I76 A;  1L0O C;  1WJA A;  2L4A A;  4P5O A;  3ASO H;  5LRS A;  1IN7 A;  2FA5 A;  1SAU A;  1ETV A;  4YEJ A;  2V9K A;  4IHX A;  3FMQ A;  4QSH A;  1MBF A;  2P6T A;  4HZF A;  3RYR A;  4GCV A;  1MBG A;  2QZ8 A;  1MSE C;  1X4P A;  2DN0 A;  4A3M J;  1SMY F;  2FD5 A;  1K6Y A;  1R4M B;  2WWY A;  1WRJ A;  2AS5 F;  2VBZ A;  5IT9 K;  1HST A;  2IW5 A;  1X3U A;  2YS9 A;  3I5U A;  1NK2 P;  2VJ4 A;  1D1C A;  2W85 A;  2K9N A;  3LQQ A;  3OL4 A;  1UZC A;  3HGG A;  2PJR B;  4P9F A;  1ACI A;  5BMZ A;  3TW6 A;  1LJ9 A;  2VKV A;  4GRI A;  4HX7 A;  4V2F A;  4Y4R A;  1NH3 A;  1S7E A;  2AHQ A;  3MMY B;  4D7M A;  5FLX K;  3OIQ A;  2J5P A;  1LFU P;  4XRS G;  5EZH A;  3CJR B;  3MQ0 A;  1WJ5 A;  1ZG5 A;  5HDN A;  1YJ9 I;  3N4M A;  3I53 A;  2CFO A;  2K3F A;  3WTT C;  1L3L A;  1GV2 A;  2ZB9 A;  1MNM C;  5DUK A;  4HX8 A;  3DKW A;  2LP0 A;  4BJ6 C;  3HOS A;  3BDD A;  4HV6 A;  2MLG A;  4KIC A;  1OR7 A;  3D0S A;  3MAJ A;  4M9Z A;  2VXZ A;  2DA1 A;  4Z6Y A;  1FSH A;  4MQ9 F;  4JQF A;  3ERE D;  3M3Y J;  3KLO A;  3ML6 A;  5LLQ A;  4A3K J;  1R23 A;  4UVC A;  1JJ6 C;  2LG4 A;  1JI8 A;  4Y33 A;  2RRE A;  3HYI A;  2DLL A;  3J7A O;  3VEP A;  4BQA A;  3W2A A;  1YS6 A;  2QM3 A;  2NYX A;  3IWZ A;  4KIG A;  1ZGW A;  2CU7 A;  1UST A;  2HDW A;  1CGP A;  1YG2 A;  1O7L A;  3Q3S A;  3C3W A;  3R6S A;  2O9L A;  5DCM B;  2ECC A;  1ON1 A;  3HSF A;  2NXN B;  3FK7 A;  3OIO A;  2DK5 A;  4MO7 A;  4XKW A;  2EQR A;  2PJR A;  4PGH A;  2L01 A;  3K4K A;  3KEQ A;  2DA3 A;  4L9J A;  5FKN A;  3GTG J;  1S72 I;  3WHB A;  3OYL A;  5LRR A;  4OIN F;  3Q5F A;  2FEZ A;  2KZG A;  1QNT A;  5KAI C;  2QA4 I;  2OU2 A;  3BQZ A;  3KE2 A;  3IKT A;  1T98 A;  1G3W A;  4MIM A;  4Y7N J;  1SD5 A;  2QSH X;  1LEB A;  3G4S I;  1GXQ A;  1MMS A;  3WGH A;  2KL4 A;  3G73 A;  2D5V A;  2TDX A;  4ZDO A;  1EKE A;  3MN2 A;  3GZ6 A;  2EFW A;  3GTQ J;  2DBB A;  2HU9 A;  4ZDL A;  1TWF J;  3LA2 A;  3OMY A;  2HVR A;  1XSX A;  1IRX A;  3OYA A;  2DFF A;  2EZH A;  1ETK A;  4P55 A;  4DIQ A;  3G3Z A;  1UCR A;  1A35 A;  1KYW A;  3CCM I;  4JBA A;  5FD6 A;  1HLV A;  2L9V A;  1FOK A;  3IP4 B;  1JGS A;  1V3F A;  3DPT A;  2DJN A;  2VOO A;  2E1M B;  5CVJ A;  1AU7 A;  1EH8 A;  1WQ2 A;  1QPM A;  3GO5 A;  4MEY F;  5LHG A;  5DCM A;  2XAF A;  1JXS A;  3FWE A;  3FDY A;  3MCZ A;  5K1Y A;  3OYG A;  3CP8 A;  1K83 J;  2BY2 A;  3F8B A;  2B63 J;  2VLA A;  2O61 A;  2VKE A;  2DFE A;  2GAU A;  1U3E M;  3UKG A;  1WJD A;  3DLL F;  5DD8 A;  2RNJ A;  3RKX A;  4XLC A;  4IOC F;  2HYG D;  5FLM J;  1GV5 A;  2OC6 A;  3SEZ A;  5D5X B;  1B1B A;  2BW3 B;  2UWM A;  3S3M A;  3BG5 A;  2EZK A;  3I59 B;  4C3H J;  5CVI A;  4DBQ A;  1D0Z A;  2X6X A;  2E5N A;  2VQH A;  3CCJ I;  2ZXW H;  2BY1 A;  4ESF A;  5J1Y A;  1K78 B;  1E3H A;  3OR2 C;  1RES A;  2LRE A;  4HDU A;  4S05 A;  1EH6 A;  2RAE A;  2KMU A;  1R58 A;  4CYC B;  1KQ0 A;  5AON A;  3OR1 C;  3DEE A;  3F9K A;  1SFX A;  1P4W A;  4K2E A;  3PNV A;  2HOE A;  3S15 J;  3K4J A;  1MIJ A;  2NAZ A;  4ZYG A;  3JTH A;  3CMA I;  3FHZ A;  5IYD J;  3ZCO A;  3CLO A;  1MKM A;  1JT6 A;  2MA3 A;  1EA3 A;  3PNY A;  1V55 H;  1DUX C;  4GFB A;  2BY0 A;  2ELK A;  1VQP I;  2QQA A;  2ZXJ A;  2GA2 A;  2MYS A;  5IYC J;  3SDB A;  5E3M A;  3EQL F;  4A12 A;  1B8I A;  5M5Y J;  2ZSH B;  1I6X A;  3H5R A;  3KX2 A;  4F52 A;  2M3A A;  4WCG A;  1Y0U A;  4AUX A;  1IC8 A;  1VQ7 I;  4E4H A;  5F08 A;  2BW3 A;  2D45 A;  3I59 A;  3ERM A;  2X1C A;  3G1L A;  5GPC A;  4ZC3 A;  1S3J A;  2Y69 H;  5L3D A;  3TP3 A;  4RGS A;  1FX7 A;  1ONV A;  2E34 A;  4EVI A;  1K78 A;  2E7W A;  2BHZ A;  4UV9 A;  1P9Q C;  1BI2 A;  3MWM A;  5F1J A;  2E36 A;  2M8E A;  1W36 C;  1FJL A;  2BE5 F;  4CYC A;  2GXG A;  4MLO A;  2V26 A;  4HPQ A;  4N9H A;  3TOB A;  1SD4 A;  5KNL A;  3TOA A;  1R1T A;  1WWX A;  4HEA 2;  1OLT A;  3EYY A;  4I02 A;  3GTP J;  2LKS A;  3SXY A;  5HS8 A;  3C2B A;  5IY5 H;  1HF0 A;  2VT2 A;  3NWS A;  3RPQ A;  1W0T A;  1IGN A;  2LF7 A;  3RZD J;  1MBE A;  1QHG A;  3HXL A;  2P5K A;  1GXP A;  3TO9 A;  2K7L A;  2F6C A;  1BI3 A;  4DJA A;  3H92 A;  1XCB A;  1UFM A;  1R71 A;  1R7J A;  1Z05 A;  4XLE A;  2CFX A;  3J7A Y;  1VND A;  4ETS A;  2ZJQ F;  2V6C A;  5DTD A;  1SAX A;  3W6J B;  1VQ5 I;  1SVO A;  3L2U A;  1Z1D A;  2R4G A;  5LHH A;  1UAA A;  1FEX A;  5F64 A;  3PL8 A;  4D1Q A;  1Z7U A;  1I50 J;  1JGG A;  2XC7 A;  3AG2 H;  3KZI C;  2DA6 A;  2CV0 A;  2F4I A;  1M1E B;  3GF2 A;  2QKL B;  5CKT A;  3RKY A;  4WXH A;  2DMT A;  1OKR A;  1I5Z A;  2OPT A;  5GTH C;  2Y30 A;  3KP4 A;  5CVR A;  2Z16 A;  5HLI A;  4C3I J;  5LGU A;  5EGO B;  3BR1 A;  1OCO H;  1QHH D;  2HS5 A;  4B09 A;  3O8G A;  2Y0S N;  4G6T B;  3SDG A;  4ZJZ A;  2GZW A;  4L9V A;  1Y8R B;  4FTH A;  4CH7 A;  2X48 A;  1STZ A;  2YU3 A;  1J09 A;  5JLX A;  2L3D A;  5GAE J;  5HNF A;  4IVN A;  1ZKG A;  5K7Z A;  2H1L A;  3GLL A;  4DBR A;  1N77 A;  3SHF A;  3T5X A;  2LYC A;  3KYC B;  1SFK A;  4P1W A;  4Q48 A;  3COA C;  2EPF A;  2OTL I;  1WFX A;  1OPC A;  3CF5 F;  1A31 A;  1ZK8 A;  2OAZ A;  2LD5 A;  2JZY A;  4BNC A;  1FTZ A;  4HDV A;  5EEH A;  3BWG A;  3WG7 H;  3OYM A;  1WKM A;  3ZXS A;  3CD6 I;  5TJJ A;  2O0Y A;  3GTL J;  2M34 A;  2IBD A;  1KU7 A;  2LK2 A;  3L2W A;  4MFE A;  4A6E A;  2W00 A;  3KFW X;  4L0Z B;  3BR0 A;  1IZ1 A;  3BLY A;  1T8I A;  3E6B A;  2EH3 A;  1B9M A;  3J7Z I;  3OYK A;  2R7R A;  2K02 A;  3HZJ A;  2XPU A;  3E7L A;  5J4V A;  1P2F A;  4L5I A;  4PJN A;  2UXX A;  2WV0 A;  2VT3 A;  2XV4 S;  5FKM A;  3S17 J;  3S1M J;  2QLZ A;  4N0B A;  2EZL A;  1FZP B;  5ILS A;  3A2K A;  3U1K A;  4JX5 A;  4M74 A;  3ZRG A;  2MC4 A;  4QIW N;  2LY9 A;  3VFZ A;  4L5J A;  4W97 A;  5E1X A;  4CYD A;  3NAU A;  1W7P B;  1XB4 A;  3ABT A;  5LD2 C;  2FBI A;  1UJ8 A;  2H1K A;  2M5W A;  2JA2 A;  2GLO A;  5FRM A;  3F6V A;  4HV5 A;  4GDF A;  5J40 A;  3H9G A;  2QSF X;  2VPL A;  5ILV A;  2ID6 A;  4O5V A;  1FMW A;  3GZ5 A;  2Z33 A;  4BJ5 C;  5FO5 A;  2DMU A;  4A3L J;  2HZT A;  1VTN C;  5AIP A;  3OIP A;  4ZDP A;  2HQN A;  1DP7 P;  4OAY A;  4RGR A;  1TWH J;  1R5I D;  1AKH B;  2KQR A;  3E3V A;  3S2D J;  1X3Z B;  3CCS I;  1BC7 C;  2X6Y A;  1MJA A;  3LSR A;  3FXJ A;  2RNG A;  4I98 B;  4FQG A;  2DOF A;  3PSF A;  4D0P A;  5L3E A;  1S8N A;  3HTS B;  5KVR A;  1Y0N A;  4M6V A;  2HI3 A;  5D4S A;  1VQM I;  5L3B A;  2E1N A;  3ZN1 A;  2JA7 J;  4XIC A;  2F4M B;  5KCM A;  4B4C A;  1AA7 A;  4XRM A;  2DMN A;  2IGK A;  2O6G E;  1X1B A;  2STW A;  3CUO A;  3OYC A;  5E1Z B;  1G3Y A;  2VB6 A;  2Z9O A;  5DDG A;  1XSV A;  4DZP A;  1X3W B;  1YIO A;  1TZL A;  1U5T C;  3V7S A;  3ABU A;  4D5C A;  1Z91 A;  1W7P A;  3FF5 A;  2BZT A;  3ZQ7 A;  4AC0 A;  4NB5 A;  2CV1 A;  2V1U A;  2IXS A;  3FM3 A;  3F23 A;  2EFN A;  1JT0 A;  3GFJ A;  2MAB A;  2E19 A;  4M3G A;  1IN8 A;  3SEQ A;  5HDG A;  1Y1V J;  2CS3 A;  2IS2 A;  3ISP A;  5HOD A;  1XPX A;  1SAN A;  1GVJ A;  2IA2 A;  4U0Y A;  1PP7 U;  1XTA A;  1XDS A;  2A5W A;  3IAS 2;  3LSH A;  1O3R A;  2DFI A;  1AKH A;  4G12 A;  3KP6 A;  2VOD A;  5JHF A;  1RUO A;  5EDN A;  3AL0 C;  4YFN F;  1JTX A;  4UVA A;  4B1R A;  2BVM A;  4RAZ A;  2IPQ X;  2LC2 A;  1X4O A;  2EBI A;  3DTK A;  1UEL B;  4ZYH A;  5JHU A;  4HLY A;  2R93 J;  1WGX A;  1D8J A;  4YRV A;  1QZY A;  1QGP A;  1HDP A;  3BG3 A;  3HHG A;  3HKZ N;  3LFK A;  3T8R A;  4BU2 A;  3ZMT A;  2HNH A;  1RKW A;  3W2V A;  3WGI A;  1GT0 C;  3GCM A;  2X0L A;  2QCO A;  3JRH A;  3VYT B;  4JK1 X;  2Y9Z A;  2HDD A;  1XGM A;  2DMP A;  2G7H A;  2XGD A;  4NHJ A;  3GME A;  2NOG A;  3H9J A;  5E3O A;  3SYT A;  3BCB A;  1YIT I;  2Y2Z A;  1J5Y A;  4MGR A;  4HSR A;  2E2J J;  1W0U A;  3CCY A;  2JPB A;  4BY7 J;  3IH3 A;  4JX4 A;  4M3F A;  2Z2S B;  3CME I;  2IJL A;  1OQY A;  2EIK H;  2FX0 A;  4AYB N;  1MSF C;  3OYF A;  2KIQ A;  2XGE A;  3HB9 A;  1I39 A;  1XX5 A;  4EQQ A;  5LGN A;  1IUF A;  4A2U A;  2DOE A;  5IOY A;  1YQA A;  4PFP A;  3RSN A;  4KN4 X;  1ZRD A;  1T0F C;  1F1Z A;  3B6A A;  3VYU B;  3HDD A;  3LFU A;  2Q2E B;  3S3O A;  1OCC H;  4PDK A;  1APL C;  3K2Z A;  5TRD A;  4CCK A;  1U9N A;  3I56 I;  1DPU A;  3CF2 A;  5K5O A;  1R4N B;  1WJE A;  3B73 A;  3E6D A;  2XGX A;  1JKR C;  2DW4 A;  2JA6 J;  1AOY A;  5CLS A;  3FKJ A;  4XLH A;  5B1B H;  1VFC A;  2IRF G;  3HEF A;  4IRI A;  4IF4 A;  3PM1 A;  3K6G A;  4WXC A;  3GFI A;  5KAF C;  3OYI A;  3G2B A;  3BTC A;  3L09 A;  1PP8 F;  4RA2 A;  3AFH A;  1IN4 A;  4LG3 A;  1V4R A;  4YEL A;  3O3K A;  4Y13 A;  1IW7 F;  3REO A;  4IZZ A;  2ZO4 A;  4HG2 A;  4KIT B;  3MZH A;  1MMA A;  2FF4 A;  2ZFW A;  2R3S A;  2DAO A;  2DT6 A;  1U2W A;  2VC1 A;  1H89 C;  4U87 A;  3WE2 A;  3Q0W A;  4CO8 A;  1RR8 C;  3FXM A;  1VQ9 I;  2MBF A;  4C30 A;  2Z1D A;  3BJA A;  1LB2 A;  3RQI A;  2Q2E A;  3QAH A;  2O7O A;  3F6O A;  3BZ6 A;  4B47 A;  3C2G A;  1ODD A;  4XKB A;  1MH3 A;  4EM0 B;  3CUQ A;  2KZV A;  2D1H A;  2ZCW A;  3H5N A;  3OOU A;  3JRF A;  3E6C C;  1YIJ I;  1WJF A;  2HWV A;  2DDA A;  4EJT A;  2ID3 A;  1ZAR A;  1FY7 A;  5C4J J;  2GXB A;  2PG4 A;  1AHD P;  1IXC A;  4KNY A;  1S7O A;  1HBX G;  2XAQ A;  4CCO A;  3I4P A;  2LNB A;  1ZQ3 P;  3S16 J;  3L2R A;  1PVE A;  2XF5 A;  4CIC A;  3WTV C;  1IF1 A;  1H88 C;  2L5Q A;  2K4J A;  4C2T A;  2OA4 A;  1TQP A;  3PFY A;  4AIK A;  1VQL I;  3P9K A;  2XB5 A;  5HNH A;  5JLW A;  3PQJ A;  2L7Z A;  1XC5 A;  2ISY A;  1Y56 A;  3J7Y J;  3TED A;  4LLN A;  5LFA A;  2I10 A;  2ESH A;  2ECB A;  5E8I A;  3SFZ A;  1X1C A;  3JRG A;  2A07 F;  1MMD A;  1LVK A;  1OMI A;  3M8J A;  3S2W A;  4WWC A;  1A04 A;  4ZH4 F;  1YRN B;  4Y52 J;  1VZ0 A;  1R5G A;  2MD5 A;  3OYB A;  1P7J A;  3FK6 A;  3EET A;  3BOQ A;  2LY1 A;  2EZI A;  2FSW A;  2WB1 A;  4J01 A;  4BJT A;  1YW7 A;  2F2E A;  3NEU A;  2W24 A;  3CES A;  3GUD A;  3R60 A;  1IAW A;  1XCV A;  4HNV A;  1RC9 A;  5L3C A;  1LNW A;  2EIN H;  2LBF B;  4PJ0 C;  1G59 A;  1ZRE A;  2P4W A;  4IJA A;  1OR7 C;  3MVP A;  5GTI C;  2PN6 A;  3SZG A;  2VKD A;  4S0H B;  1BI1 A;  1HW1 A;  5C3E J;  5KHD A;  3CC4 I;  1B6A A;  2FNA A;  1P4A A;  3H9Q A;  2EV5 A;  4RAY A;  1LE8 B;  1USS A;  3V7C A;  3V7R A;  3J80 K;  3FXO A;  3GVA A;  1OYI A;  2P0W A;  1R9T J;  1OCR H;  2KJC A;  3DPL C;  5HVQ C;  4LD5 A;  2G9W A;  3W6V A;  3H3V K;  4CCM A;  5FRN A;  1ZAO A;  2H6C A;  1JKO C;  4RMN A;  1MBJ A;  1RR7 A;  4G6Q A;  3VPR A;  3MKY B;  1YRN A;  2B7E A;  3F72 A;  1SVM A;  1U8R A;  4IHT A;  1KU2 A;  1FYK A;  2EA2 A;  2V6E A;  3FX3 A;  5GAG J;  2K4B A;  2AXT C;  2RN7 A;  2DK8 A;  2W4S A;  3PUF A;  3SFI A;  2VPR A;  2DXI A;  1LFP A;  4G6D A;  3A02 A;  3G1M A;  4RLQ A;  1FSE A;  5FB2 A;  4OIO F;  2LBF A;  4XNF A;  2NS0 A;  4C3J J;  2DT5 A;  4BHC A;  3RPU D;  5GP9 A;  3I3L A;  2MLK A;  1UHS A;  5AIQ A;  3DKY A;  2JA8 J;  1JHF A;  2XF6 A;  2XAS A;  2WAQ A;  3SZT A;  3ZGK A;  1KON A;  3W2W A;  4RS8 A;  4A0Y A;  3CJQ B;  2M87 A;  2MSY A;  2NOJ B;  1BIB A;  4G9Y A;  1NG6 A;  1LE8 A;  3E5X A;  3ZMD A;  1A6I A;  2XPW A;  4AU7 A;  4DOZ A;  1RIO H;  4UV8 A;  2OTJ I;  5IT9 Z;  3GYH X;  1JUS A;  1BOB A;  1TWA J;  3V42 A;  4PSX A;  3LQR A;  2FQ4 A;  3CO6 C;  2WBM A;  3ULQ B;  3F8M A;  5ED4 A;  5EEG A;  3MFK A;  1MBH A;  2IEK A;  1FNN A;  2LDU A;  1A36 A;  5FLX Z;  4MTD A;  2Y31 A;  5JI6 A;  2A61 A;  1HA8 A;  3ZQI A;  3WU0 A;  4PCQ A;  3CCQ I;  2F48 A;  2F5F A;  2HYJ A;  2RQQ A;  2O3F A;  1SFO J;  3DU5 A;  4P96 A;  2K9L A;  4NNJ A;  2CW8 A;  5HS9 A;  4BXU A;  3S2H J;  3CMY A;  1IXS B;  2GM4 A;  3H0D A;  2HOT A;  1J0R A;  3K4L A;  3H1C A;  1ETX A;  1X58 A;  3V4G A;  4RB1 A;  1JJ8 C;  4FHT A;  2FRH A;  1BA5 A;  2LR8 A;  1T08 B;  3DP7 A;  4DYR A;  5IT3 A;  2A6H F;  3K1N A;  2GOX B;  1ZLK A;  4UB8 C;  3IV5 A;  3QPH A;  3FXR A;  4Y15 A;  1ZG1 A;  2DFH A;  2HXO A;  1Z9C A;  2CUZ A;  3BQY A;  2CUE A;  4GYI A;  2L7M P;  3WU2 C;  1B59 A;  3S93 A;  1GLN A;  4XKV A;  4BE0 A;  3K10 A;  1BL0 A;  2DMQ A;  3P7N A;  4KT6 A;  2DTR A;  2P7C B;  3ZPL A;  5DYM A;  3TMO A;  2LY2 A;  3JRE A;  2E1M C;  1B8I B;  1YLF A;  5B5E C;  1REP C;  2MH2 A;  4BDY A;  3C18 A;  4XLN F;  2FOW A;  4OAZ A;  3BTI A;  2X9D A;  3CCR I;  3HG9 A;  4ZYD A;  1T6S A;  1BBY A;  1RKT A;  1DPR A;  3EUA A;  3NRV A;  2XB0 X;  3NQO A;  2K9Q A;  3TO7 A;  1W36 D;  1MDM A;  4KYW A;  4ITV A;  3I55 I;  4HX4 A;  5B1A H;  3KYL A;  4UUS B;  5B66 C;  1DQU A;  1PUF A;  5J3L A;  1TP4 A;  5JR3 A;  4NC7 A;  1IV6 A;  3HTU A;  3NWT A;  1RZ4 A;  2KP6 A;  5FFX A;  2XRO A;  2IA0 A;  4HRI A;  3IC7 A;  2JMW A;  3ZR8 X;  5D8K B;  2JSC A;  2K9M A;  1Z67 A;  2GXA A;  4M9X A;  2XVC A;  4U7D A;  3BJ6 A;  2VOP A;  4ZZD A;  4RGX A;  4UY8 I;  2WAE A;  4A3J J;  4HLX A;  4H0E A;  3EPZ A;  1YX3 A;  3ZMU A;  3OYD A;  3T0Y A;  3J81 Z;  2DJI A;  1HKQ A;  1XDU A;  3P5J A;  2H27 A;  1G3T A;  4AIH A;  4XOT A;  1SVL A;  2Q0O A;  5BPI A;  1BJA A;  4NC8 A;  4CSW A;  3JRC A;  1W1W E;  2QQB A;  2Q1Z B;  2X4H A;  1Z7L A;  5FKL A;  1H9T A;  3Q0V A;  4E7L A;  3GTJ J;  2MD0 A;  4FIS A;  1R49 A;  5ERI A;  1QO0 D;  1IRZ A;  4II2 A;  3PSI A;  1BW5 A;  2M30 A;  4HW0 A;  3PQK A;  2VN2 A;  4I09 A;  4Y3O A;  2QEN A;  4EJV A;  2EFQ A;  1BR1 A;  2QF7 A;  4A3G J;  3CQZ J;  4D5F A;  4LFU A;  5CQG A;  5FGM A;  2GWR A;  2F5C A;  5IP9 J;  1YO5 C;  4C9Y A;  1IXR C;  3KIO A;  4UUS A;  1JKP C;  1N25 A;  1Q1H A;  2KKO A;  2XAJ A;  2H09 A;  2IGM A;  1J7K A;  1UHM A;  2QEX I;  3RI4 A;  2DCE A;  4KN7 X;  1E3O C;  1D5Y A;  2HDC A;  2CRG A;  3WHC A;  2M8G X;  3L2V A;  2BHY A;  5CPR B;  4HF0 A;  3I4N J;  1ZHF A;  3OSF A;  1X19 A;  2CYY A;  3B02 A;  3M1C A;  2LTP A;  1HSJ A;  4OOI A;  1S5L C;  1SC7 A;  1HKT A;  2WB1 N;  4XL9 A;  3DBH B;  4CGZ A;  3TDU C;  2K86 A;  2JN6 A;  2LOO A;  2DTZ A;  3QPT A;  4ZTJ A;  3F8C A;  3K7A J;  3IL2 A;  4I7H A;  1F9N A;  2K3P A;  2MC3 A;  3RIR A;  3VDX A;  4EJO A;  3BR3 A;  4M72 A;  1S9H A;  5E20 A;  3RYP A;  3ABL H;  2CUF A;  2X85 A;  3K70 C;  4A5M A;  1MJB A;  3KEY A;  1IUY A;  3CO7 C;  2DOA A;  2XSJ C;  4IHW A;  3HOW J;  4KJZ A;  3KET A;  2ZJR F;  5M5X J;  2V7F A;  4WX9 A;  1OCP A;  5JFR A;  5J1U A;  3DEW A;  1GHC A;  3OWT A;  1I27 A;  3FXL A;  4ZYA A;  3CCV I;  4BDZ A;  4LB5 A;  3E1S A;  1DGR M;  1N75 A;  3C1D A;  3FXQ A;  3HM5 A;  4E7I A;  4R8H A;  5H20 A;  2EK5 A;  2F4O B;  1KZH A;  3E6M A;  1QZE A;  2L9S A;  2R5Z B;  2AQF A;  3HPH A;  3CTA A;  2AXL A;  3MZ8 A;  2CW7 A;  3C2H A;  5EG0 B;  1I1S A;  4XKC A;  1IJW C;  2LKP A;  4J19 A;  2VQC A;  1K79 A;  2RVC A;  3GZN B;  4XK4 A;  3S1N J;  2MGQ A;  1WH7 A;  2DQR A;  1TNT A;  1YE9 A;  2ZXI A;  1B72 B;  2FMY A;  3OV8 A;  4X1E A;  1V54 H;  1V5F A;  2X1D A;  3S14 J;  2B9S A;  3DLA A;  2WAD A;  2J5O A;  5IP6 A;  1ZN2 A;  2L7K A;  1AWC A;  2VKH A;  3OOP A;  5D5V B;  3DBR B;  1PYV A;  2K27 A;  2ZME B;  1D0X A;  4LIT A;  1ETQ A;  1FPQ A;  4JX6 A;  4HA8 A;  4KIS A;  2YR2 A;  2ELH A;  4WXD A;  2FJ1 A;  3JAM Z;  3ZMS A;  1XN7 A;  5DM6 F;  2HKO A;  4L5E A;  1FOX A;  5D8L B;  1IN6 A;  2R7S A;  4UHT A;  5E3N A;  3KZY A;  3HOX J;  1Y8Q B;  2NNN A;  2R5Z A;  5EF6 A;  4RAG A;  1G4D A;  5EEA A;  3BPV A;  2YX4 A;  3HHH A;  3OL3 A;  5F27 A;  2EJR A;  5FKO A;  2XAH A;  2PMZ A;  3I64 A;  1U0J A;  2VON A;  4CXF A;  4FAS D;  4LIU A;  5EG0 A;  2LVS A;  3BTJ A;  3H0G J;  1K6O A;  1VQ4 I;  2DYR H;  2R7W A;  5E79 C;  2IAI A;  3LA3 A;  2PQ8 A;  3ABM H;  1MND A;  2DI3 A;  3DPU A;  3LNQ A;  1FOY A;  1B72 A;  1IRF A;  2STT A;  2V1N A;  2E2H J;  2O5R A;  2IT0 A;  1E17 A;  4LLL A;  5DUI A;  5LEK A;  4O6J A;  1WVR A;  1WHU A;  2JVH A;  1I3A A;  3QYB A;  2ZXH A;  4DGW B;  3ROU A;  2ZME A;  3VSK A;  1TT5 B;  4X6A J;  1B4A A;  4YFK F;  3KCC A;  3VWB A;  3LSI A;  2P81 A;  5HDK A;  3VB2 A;  1QRY A;  1MH4 A;  2KRH A;  3BZK A;  4V2G A;  3S32 A;  1HQC A;  3TQN A;  3LOC A;  4XLP F;  1D5V A;  1Z6R A;  2VIX A;  2X6O A;  1J59 A;  5DS9 A;  2R7X A;  2DT7 B;  3HIF A;  4CCJ A;  2O8X A;  4L18 B;  4KT5 C;  2VI6 A;  3NAR A;  2OCE A;  4XOR A;  3LSM A;  5FKK A;  3JTG A;  2KIF A;  4BEH A;  1W5C C;  1RET A;  2QUF A;  4CCN A;  4JOM A;  4L0Y B;  3K9T A;  5M3M J;  2L02 A;  4G8X A;  5FJ8 J;  2XAG A;  2H8R A;  4E7J A;  2D1V A;  2L9R A;  2L0K A;  3JRA A;  1K61 A;  5FFZ A;  1LUJ B;  4ESJ A;  4DYC A;  4OMZ A;  5GAH J;  1ZLJ A;  5GPA A;  3PJR A;  2FNP A;  3WOD F;  2HZD A;  4NQW B;  2Y75 A;  2NS7 A;  3RKW A;  2HR3 A;  2VQG A;  2ZSI B;  2P5V A;  4EM1 A;  2ME6 A;  3QP5 A;  3CDL A;  4BBS J;  5K7H A;  4U88 A;  4HQM A;  3EUH C;  1TQI A;  3F21 A;  2CO5 A;  1G3S A;  4IRG A;  3GWZ A;  4ABZ A;  2M9H A;  1O3S A;  2TCT A;  1XMA A;  2Y0M A;  2KPM A;  2JT1 A;  3H36 A;  3E5Q A;  2OZU A;  2XRN A;  4L9T A;  2EIJ H;  4FX4 A;  1O57 A;  3QOD A;  3V8J A;  3K4M A;  1TL8 A;  5A2Q K;  3N05 A;  2LSO A;  3KP5 A;  3H3U A;  1FYL A;  4HYE A;  3OYH A;  2X51 A;  1E3P A;  2B0L A;  5DEQ A;  1H0M A;  2OJE D;  3FXK A;  4NC6 A;  1KYZ A;  2DO7 A;  2VE9 A;  4Q47 A;  1X2M A;  5E8G A;  3ZMV A;  1BIA A;  1I6H J;  2P5L C;  1ETO A;  3D5L A;  3IRQ A;  2DA5 A;  3HPG A;  3SZP A;  2I8D A;  2R7Z J;  3M9A A;  3OYJ A;  3HRT A;  2QBY A;  5JVG F;  4NQW A;  5ICG A;  2VQL A;  2PEX A;  1S6L A;  1ZR2 A;  4LB6 B;  1FOW A;  3L2C A;  3CUQ B;  4IEJ A;  4Q4Z F;  3VOD A;  4U0V A;  1MD0 A;  4DW6 A;  4XID A;  5BPD A;  1JE8 A;  1LDK B;  2PFB A;  2YUS A;  5H2F C;  4MNU A;  3ECH A;  3DF8 A;  1HW2 A;  1MMN A;  2LRD A;  2XF7 A;  4XN0 A;  1U6G A;  1NK3 P;  3BG6 A;  2GBY A;  3CJT B;  3SQN A;  4S04 A;  1IDY A;  2R7O A;  2MG4 A;  1PUE E;  4LGW A;  1ZGA A;  4BAY A;  3ZP5 A;  2BOL A;  3DTE A;  3MZY A;  4B8X A;  2WAF A;  2FBH A;  3AKZ A;  2PMH A;  3MD2 A;  3ASN H;  2XAU A;  2XKO A;  3LMM A;  2HPI A;  3OYE A;  2HTS A;  2HOS A;  1Z77 A;  3VYR B;  4I0A A;  1YW9 A;  5D4R A;  1W5T A;  2MFZ A;  2BY3 A;  1KU3 A;  1KU9 A;  1JKQ C;  5F0C A;  4I99 C;  3W6K B;  3A4C A;  3I58 A;  4M3E A;  4BXF A;  2Q8K A;  2R7V A;  2ZNZ A;  2CQQ A;  3A01 B;  2CQN A;  3PO3 J;  3KP2 A;  4FT8 A;  4GXO A;  3FBI B;  3CDI A;  3DWL E;  5D6E A;  2X1E A;  1JTY A;  1MJ9 A;  1OCZ H;  1S7A A;  4AM3 A;  1PDN C;  1D0Y A;  2O03 A;  2DDB A;  4Q5S F;  4BGD A;  1H8A C;  5L3G A;  5LEJ A;  4EGY A;  4L9N A;  4F91 B;  3KPH A;  2OCC H;  3AG1 H;  2E1C A;  2RC4 A;  4XLF A;  2WY7 Q;  3U21 A;  2KIS A;  1WPK A;  3FKI J;  2QGU A;  2DPD A;  3WG9 A;  3VOE A;  2A05 A;  2JA5 J;  5CQE A;  1LPQ A;  2VJ5 A;  2XSD C;  3MKZ A;  2JTV A;  3L00 A;  1P7I A;  1WCM J;  4M9S A;  1ETW A;  1N78 A;  2VBW A;  2HYF A;  1UG0 A;  2RV8 A;  1F36 A;  3ZOB A;  2CG4 A;  2ZJ2 A;  5F04 A;  5F0F A;  2P8T A;  2V1D A;  2JVG A;  1LVA A;  1YYV A;  3BCA A;  3M1E A;  3CCU I;  1ZR4 A;  3L1P A;  4A93 J;  4RB3 C;  4NBQ A;  2WA0 A;  3VSL A;  3GX4 X;  4I2O A;  1T95 A;  1ULY A;  3FIS A;  3A01 A;  4A3B J;  4ZYE A;  4XBF A;  2RKH A;  3MKL A;  1LQ1 A;  3LL7 A;  3IRR A;  1BM9 A;  3WTX C;  3LAJ A;  3ZQH A;  3OY9 A;  2NRA C;  1SFE A;  2W82 A;  4XSX F;  2OQR A;  2BEO A;  4DYQ A;  3HJE A;  4UVB A;  5J8C A;  4PJM A;  5L3F A;  4LOC A;  4J00 A;  1VF9 A;  4F92 B;  2ME0 A;  4XR6 A;  3RTR A;  1QVU A;  1MGT A;  1VQK I;  2LKX A;  1YX5 A;  3KLN A;  3E5U A;  3GW2 A;  4FX0 A;  4FE7 A;  1UG2 A;  3L9F A;  2EV6 A;  3DFG A;  1QU3 A;  4E70 A;  2UV1 A;  1G8X A;  4NUB A;  5CJ9 A;  3AAF A;  4IHY A;  3CZ6 A;  3WTU C;  2JRT A;  1TQM A;  2XPV A;  5HLT A;  2VBY A;  3PIO F;  2QKM B;  4BHB A;  1BC8 C;  3N97 A;  9ANT A;  2R7T A;  2W25 A;  2P7V B;  4AVP A;  2XKP A;  1YOV B;  1E0E A;  3LSJ A;  5HLH A;  4I01 A;  5E17 F;  1T38 A;  2DA7 A;  2R7Q A;  3P9I A;  3O8H A;  2PLY A;  2IS4 A;  1WJC A;  1YTY A;  2ZFU A;  1TWC J;  3HC7 A;  4RLF A;  1FIA A;  2P6S A;  3IUO A;  2V79 A;  4LMY A;  4V19 K;  1QA6 A;  3TO6 A;  4QLC U;  2OUM A;  4XN3 A;  1VI0 A;  4MEX F;  3PNT A;  3ZN0 A;  4LK0 F;  4N9I A;  3R4K A;  4CZZ A;  2VJJ A;  3HSE A;  4IHV A;  1BR2 A;  2OBP A;  2N8G A;  2UXN A;  3JSO A;  4LG0 B;  4EJU A;  1EV7 A;  1SMT A;  3ZQQ A;  3M8F A;  1ZYR F;  2A3S A;  3FMS A;  5J6X A;  4ENK A;  1J75 A;  4D7N A;  1X1D A;  3A1Y A;  1G6N A;  2CMP A;  2I5U A;  3BG9 A;  3JW4 A;  2Y0S A;  1FYM A;  2V9V A;  4F93 B;  1ZTR A;  3WE3 A;  3S1R J;  2HVS A;  4IRH A;  2IGN A;  4BYY A;  2KRC A;  4AIJ A;  3GTO J;  3OS2 A;  3IH2 A;  4RM3 A;  1XMX A;  1HDD C;  2VE8 A;  1Y39 A;  3WTW C;  2GOM A;  2A68 F;  1DGW Y;  2HEO A;  1X2N A;  2OQG A;  4CHU A;  4A6D A;  5LHI A;  1JHH A;  2R7D A;  3JCU C;  2A6E F;  1FP1 D;  2VL8 A;  2HQA A;  5GAD J;  4PJJ A;  3JSP A;  5DV5 A;  5E1W A;  2NVT J;  4FCY A;  1VQ8 I;  1BN5 A;  4M6Y A;  1TWG J;  2G0E A;  3J80 Z;  3OSG A;  1RNL A;  2IGO A;  3HOV J;  3GFM A;  5EZG A;  1ETY A;  4C2U A;  3BR2 A;  4GGG A;  3A0H C;  1MDM B;  1TW3 A;  4KUM A;  2VUM J;  1I1G A;  3K4C A;  5ICE A;  2PI0 A;  1PUF B;  4LG0 A;  3HUG B;  4H4K C;  2R0Q C;  4BXX J;  2DOD A;  5ILU A;  2K85 A;  4B48 A;  4PZJ A;  3CCL I;  2LLK A;  2JK3 A;  2YSR A;  1VQO I;  4B3A A;  4XSZ F;  5HOO A;  3TL4 X;  1E2X A;  2YU9 J;  2M0C A;  2E5Z A;  3DCF A;  2H6B A;  3TDZ C;  4BS9 A;  4II3 A;  3HOT A;  3KYD B;  3IH4 A;  1Z3Y A;  3M8E A;  4IL6 C;  2VXD A;  4ENN A;  2ESN A;  4XRF A;  2JQ7 A;  3IHU A;  2NNY A;  3A0B C;  2HXI A;  3SJM A;  4OMY A;  3J81 K;  4Z2Y A;  2XIG A;  3LWF A;  2FOK A;  4GO1 A;  4U7B A;  2JUC A;  3LST A;  4E7Z A;  4QTR A;  2ICW G;  1O3Q A;  4FET A;  2PX9 A;  3QOP A;  4HAM A;  2LMD A;  2L54 A;  2D2W A;  4M3B A;  4UUT A;  5E3L A;  1K4T A;  5F6F A;  1XGO A;  2GIV A;  3ZMZ A;  2FE3 A;  3Q9S A;  3CLQ A;  2BYV E;  5HS7 A;  2IS1 A;  4KDP A;  3BRO A;  3LAP A;  4KA4 A;  2W57 A;  2K40 A;  4ON0 A;  2NVX J;  2XUB A;  2EFP A;  3H5A A;  3HUG A;  1MNE A;  4CUG A;  4FE4 A;  2R7F A;  2OV7 A;  2EWN A;  2M0M A;  4LK1 F;  3JRI A;  1D3Y A;  1NTC A;  3LSK A;  1GDT A;  4A3E J;  2Z3Y A;  2L4M A;  3L7W A;  5IP7 J;  3ECO A;  2JUG A;  4RB2 C;  4G7Z F;  3F0C A;  3H35 A;  5FLV A;  3U9G A;  1P6R A;  4EM2 A;  5J4Y A;  1EF4 A;  1XS9 A;  4BY1 J;  3BPX A;  2ELJ A;  3ZQL A;  4XRS A;  4QWQ A;  4WF2 A;  2AQE A;  5B3S H;  2OD5 A;  2Y48 A;  3K70 D;  1ENH A;  2IS6 A;  4AWX B;  3BP8 A;  4N4O B;  1WI9 A;  3HRM A;  4GYG A;  3PO2 J;  2WY8 Q;  1POG A;  3RPU A;  2DYS H;  3RDI A;  3FMR A;  3BJO A;  3U1D A;  4BQO A;  1MW7 A;  4QPQ A;  1X1P A;  2HFH A;  4XON A;  4BBR J;  2KJB A;  5DM7 F;  4YIR X;  1QBJ A;  1OIS A;  2M7A A;  1W4M A;  3DEU A;  3IWF A;  4U0W A;  4IPA A;  3PFI A;  1K7A A;  1WZ2 A;  2NVY J;  1WSU A;  3F8N A;  3FXU A;  3HKZ A;  4UB6 C;  3WU1 B;  4RGU A;  1Z3X A;  4IO9 F;  4A3C J;  2E7X A;  2FQ3 A;  1F4K A;  3KP7 A;  1YHQ I;  3S8P A;  1QVT A;  3BY6 A;  3CJN A;  3ZQC A;  1ZG3 A;  4JYK A;  4MQV A;  4B44 A;  3W3C A;  4I0B A;  5BNG A;  2F5V A;  3K69 A;  4PFO A;  3D1N I;  1Z21 A;  2ZBK A;  6PAX A;  2EIL H;  2BXY A;  1SEU A;  2KRF A;  5IYB J;  1U9O A;  4XQF A;  2NS8 A;  2IVM A;  2BGC A;  1U8B A;  4A0X A;  4ENM A;  1XGS A;  1KGS A;  5D6F A;  4HF2 A;  3ZQF A;  3E97 A;  2W7N A;  4AYB A;  2GA1 A;  1HW5 A;  1FT9 A;  3WTZ A;  2HVQ A;  2YX7 A;  1YJN I;  1V5G A;  2XGC A;  4KMU X;  1ORK A;  3I71 A;  1C0W A;  4M71 A;  1R36 A;  4A0Z A;  1ZRC A;  1GVD A;  2F5E A;  3T8T A;  2C6Y A;  3QRF F;  1JUP A;  1BR4 A;  2M4G A;  3AG3 H;  1IN5 A;  2ADU A;  4UNO A;  1XSD A;  1EJ9 A;  4BH9 A;  3UNG C;  1OCT C;  1MBK A;  4EAT A;  3ELK A;  3CMM A;  1TTY A;  4R79 A;  3BT9 A;  2E60 A;  3K1P A;  2RDP A;  2XRL A;  4BKX A;  4MFD A;  2CQ7 A;  2M1B A;  5DD4 A;  3JAM K;  2WTE A;  4N4N B;  1HC8 A;  5K5R A;  4A69 C;  1KA8 A;  2CQX A;  4I6Z A;  4B43 A;  1GUU A;  3QQA A;  3ESW B;  3O2P E;  4OIP F;  2HQ5 A;  1W7P D;  2K9S A;  4PUS A;  1FLI A;  5ICF A;  2KIU A;  4XOP A;  4D9J A;  1YI2 I;  3CDH A;  1RI7 A;  4IXA A;  4PGG A;  2E35 A;  5E18 F;  3HL2 A;  4UXN A;  5KK1 A;  5BS6 A;  5IOZ A;  4IHS A;  2COB A;  3B6C A;  1R6R A;  2CQK A;  3QWL A;  4HQE A;  3ABK H;  3DTI A;  1T39 A;  3R0J A;  3LSG A;  1UMQ A;  3CP2 A;  2H94 A;  3DBL B;  2WAQ N;  1HXD A;  1B9N A;  2PJP A;  3BR6 A;  2KHM A;  4LLG F;  1T33 A;  4DNC A;  3CCE I;  1A6Q A;  3EUK L;  1J9I A;  1LEA A;  3T1B A;  1WI3 A;  4E7H A;  1IO2 A;  3D5S C;  5HLG A;  3K0L A;  2ZME C;  2R5Y B;  2VAS A;  2ZJP F;  1Z6T A;  2OF7 A;  4ESB A;  2FBK A;  1R22 A;  2BVL A;  3I9V 2;  2G7U A;  1IRG A;  2DQL A;  1CF7 B;  4BEH B;  2JRM A;  2L2O A;  2LF8 A;  3F3X A;  1NG7 A;  2COM A;  1SFU A;  1H9G A;  3Q9V A;  2R92 J;  2FU4 A;  5CYV A;  5FRO A;  3KZZ A;  1ON2 A;  2KT0 A;  4CDG A;  3ONQ A;  1YJW I;  1LFB A;  1R5H A;  3P9C A;  2KFD A;  1KQ8 A;  2MW8 A;  2QVO A;  3IKV A;  4MTE A;  4C2M J;  5EGO A;  3TW7 A;  5DCF A;  3EYI A;  4F7Z A;  1LKX A;  4M3D A;  4ANJ A;  2XDV A;  3BC8 A;  3C7J A;  1ZGJ A;  2MH9 A;  4ZTF A;  3QP6 A;  4CCL A;  2BXZ A;  3HRU A;  4RB0 A;  3BR5 A;  3M4O J;  1OYW A;  4EGZ A;  2QYO A;  2M4K A;  1D8K A;  1T56 A;  4HBL A;  4G94 A;  2V9P A;  4IQ4 A;  3S3N A;  2UZK A;  4A3I J;  1RRJ A;  2W1O A;  4IOA F;  4EJW A;  1D1B A;  2JWT A;  3O6B B;  2VC0 A;  3LA7 A;  4BHP A;  5LGT A;  2M45 A;  5F0H A;  4CZC A;  3HOZ J;  2R5Y A;  3G71 I;  2W48 A;  1WH5 A;  4BUP A;  2IA1 A;  4BE1 A;  5H6Q A;  3LSP A;  4IKF A;  5TIS C;  1QZZ A;  2Z5U A;  2Z99 A;  5TGT A;  1YW8 A;  4CA0 A;  2HQR A;  1CF7 A;  2DPU A;  1P92 A;  2EIM H;  3BTL A;  3EDP A;  4RDU A;  3X2Q H;  5F1R A;  1OFC X;  2EFO A;  1OJL A;  2ETH A;  5K7F A;  1VQN I;  2E1O A;  2JJ7 A;  3K4B A;  4HNU A;  2A6T A;  1U5T B;  1O3T A;  1X1A A;  4YII A;  4HNT A;  1ZRF A;  3QU6 A;  2CUJ A;  4OU0 A;  3UR3 C;  3JRD A;  2FXA A;  3H3Z A;  2RQP A;  3A03 A; 
#chains in the Genus database with same CATH homology
 3RJP A;  2ZKZ A;  2W84 A;  4M73 A;  1O7F A;  3I0T A;  2QBY B;  4YG2 F;  1UB9 A;  3WGG A;  1HKS A;  5BOX A;  2JPC A;  2PMU A;  2CSO A;  1LDD A;  4ZZL A;  1S29 A;  2V1X A;  3WTS C;  1FC3 A;  3KP3 A;  2EB7 A;  5BQT A;  2OZ6 A;  5LBQ A;  3M7G A;  2QWW A;  3QU3 A;  3WTY C;  4KIF A;  1KQ9 A;  5CVU A;  4G7H F;  2BBY A;  2IP2 A;  1FBQ A;  4DQ2 A;  4O3M A;  4HOB A;  1NHA A;  4TV7 A;  1W5S A;  4AD9 A;  1U5T A;  2RGV A;  4KIB A;  2XHK A;  2HKX A;  3HSR A;  3K1M A;  4Y17 A;  1F5T A;  4R1H A;  4G7O F;  4OIR F;  1BI0 A;  2YPR A;  3FZV A;  1OYY A;  4LJZ F;  4EV0 A;  3KEO A;  4HF1 A;  2BV6 A;  4M6X A;  3R61 A;  1EH7 A;  4EMS A;  3DXJ F;  2GQQ A;  3EUH A;  3CUQ C;  2EA4 A;  1FBU A;  1XD7 A;  2A5Y B;  2FML A;  1U78 A;  1RUN A;  5CVV A;  1P4X A;  1FWZ A;  2EV0 A;  3GXO A;  1XMK A;  3V8L A;  1T2K A;  3V8K A;  2WC2 A;  5A2Q Z;  3F8F A;  4ENJ A;  5J8F A;  2PBI A;  2DU9 A;  2HGC A;  5ICC A;  4KFC A;  3R0A A;  1YS7 A;  2KIM A;  1J2X A;  1BOA A;  4A5N A;  3GEZ A;  2A69 F;  4ASN A;  1T0F A;  1DDN A;  1TLH B;  2F5D A;  3TGN A;  4KMF A;  5H6R A;  3DQV C;  3GLX A;  4YIF A;  2HTJ A;  1TNS A;  1XGN A;  3MEX A;  1R1V A;  1SD7 A;  1QQI A;  1SD6 A;  2QQ9 A;  5D5W B;  2ISZ A;  1ZH5 A;  4WK8 F;  4YFX F;  2CWE A;  4MHG A;  1R1U A;  3GFL A;  3I54 A;  3HRS A;  2ZNY A;  4P9U A;  2CW0 F;  1YFH A;  3TKY A;  1MZB A;  3U2R A;  2ACJ A;  5JVT A;  3FM5 A;  1FBS A;  2CGP A;  2VBX A;  1TW2 A;  1UHW A;  5K5Q A;  5D5U B;  4OIQ F;  1LDJ A;  1FP2 A;  1TBX A;  5FD5 A;  4UUV A;  3F22 A;  1R00 A;  3DV8 A;  1L0O C;  2L4A A;  4P5O A;  5LRS A;  1IN7 A;  2FA5 A;  3FMQ A;  2P6T A;  4HZF A;  3RYR A;  4GCV A;  2QZ8 A;  1SMY F;  2WWY A;  1WRJ A;  2AS5 F;  2VBZ A;  5IT9 K;  1HST A;  2IW5 A;  1X3U A;  3I5U A;  2W85 A;  3LQQ A;  4P9F A;  5BMZ A;  1LJ9 A;  4HX7 A;  5FLX K;  2J5P A;  3MQ0 A;  1ZG5 A;  5HDN A;  3N4M A;  3I53 A;  3WTT C;  1L3L A;  5DUK A;  4HX8 A;  3DKW A;  3HOS A;  3BDD A;  4HV6 A;  2MLG A;  4KIC A;  1OR7 A;  3D0S A;  3MAJ A;  4M9Z A;  2VXZ A;  1FSH A;  4MQ9 F;  4JQF A;  3ERE D;  3KLO A;  3ML6 A;  5LLQ A;  1R23 A;  4UVC A;  3HYI A;  2DLL A;  3J7A O;  3VEP A;  4BQA A;  1YS6 A;  2QM3 A;  2NYX A;  3IWZ A;  4KIG A;  1UST A;  1CGP A;  1YG2 A;  1O7L A;  3C3W A;  3R6S A;  5DCM B;  1ON1 A;  3HSF A;  2DK5 A;  4PGH A;  2L01 A;  3KEQ A;  4L9J A;  5LRR A;  4OIN F;  3Q5F A;  2FEZ A;  1QNT A;  2OU2 A;  3KE2 A;  3IKT A;  1T98 A;  1G3W A;  1SD5 A;  1LEB A;  1GXQ A;  3WGH A;  3G73 A;  2TDX A;  3GZ6 A;  2EFW A;  2DBB A;  3LA2 A;  1XSX A;  4P55 A;  3G3Z A;  1UCR A;  1KYW A;  4JBA A;  5FD6 A;  1FOK A;  1JGS A;  1V3F A;  3DPT A;  2VOO A;  5CVJ A;  1EH8 A;  1WQ2 A;  1QPM A;  3GO5 A;  4MEY F;  5LHG A;  5DCM A;  2XAF A;  1JXS A;  3FWE A;  3MCZ A;  5K1Y A;  3F8B A;  2O61 A;  2GAU A;  1U3E M;  5DD8 A;  2RNJ A;  3RKX A;  2HYG D;  5D5X B;  1B1B A;  2UWM A;  3I59 B;  5CVI A;  4ESF A;  1K78 B;  4HDU A;  4S05 A;  1EH6 A;  1R58 A;  1KQ0 A;  5AON A;  1SFX A;  1P4W A;  4K2E A;  2HOE A;  2NAZ A;  4ZYG A;  3JTH A;  3FHZ A;  3CLO A;  1MKM A;  2MA3 A;  1DUX C;  2QQA A;  2ZXJ A;  2GA2 A;  3EQL F;  4A12 A;  1I6X A;  4WCG A;  1Y0U A;  2D45 A;  3I59 A;  1S3J A;  5L3D A;  4RGS A;  1FX7 A;  4EVI A;  1ONV A;  1K78 A;  2E7W A;  4UV9 A;  1BI2 A;  3MWM A;  2M8E A;  2BE5 F;  2GXG A;  4N9H A;  3TOB A;  1SD4 A;  3TOA A;  1R1T A;  1WWX A;  3EYY A;  4I02 A;  3SXY A;  5HS8 A;  2VT2 A;  3RPQ A;  2LF7 A;  1GXP A;  2P5K A;  3TO9 A;  2K7L A;  1BI3 A;  3H92 A;  1XCB A;  1UFM A;  1R7J A;  1Z05 A;  2CFX A;  4ETS A;  2V6C A;  1SAX A;  3W6J B;  1Z1D A;  5LHH A;  5F64 A;  1Z7U A;  3GF2 A;  3RKY A;  4WXH A;  1OKR A;  1I5Z A;  3KP4 A;  5CVR A;  5HLI A;  5LGU A;  2HS5 A;  4B09 A;  2GZW A;  4L9V A;  1STZ A;  2YU3 A;  2L3D A;  4IVN A;  3SHF A;  3T5X A;  4Q48 A;  3COA C;  1OPC A;  2OAZ A;  2JZY A;  4BNC A;  4HDV A;  5EEH A;  3BWG A;  1WKM A;  5TJJ A;  2O0Y A;  1KU7 A;  4A6E A;  3KFW X;  4L0Z B;  1IZ1 A;  3E6B A;  1B9M A;  2K02 A;  1P2F A;  4L5I A;  2UXX A;  2WV0 A;  2VT3 A;  2XV4 S;  2QLZ A;  4N0B A;  1FZP B;  5ILS A;  4M74 A;  3VFZ A;  4L5J A;  5E1X A;  4CYD A;  1W7P B;  1XB4 A;  3ABT A;  2FBI A;  2M5W A;  3F6V A;  4HV5 A;  5ILV A;  4O5V A;  3GZ5 A;  2Z33 A;  5FO5 A;  2HZT A;  1VTN C;  5AIP A;  2HQN A;  1DP7 P;  4RGR A;  3E3V A;  1BC7 C;  1MJA A;  4I98 B;  4D0P A;  5L3E A;  1S8N A;  3HTS B;  5KVR A;  5D4S A;  5L3B A;  2E1N A;  3ZN1 A;  2O6G E;  2STW A;  3CUO A;  5E1Z B;  1G3Y A;  2Z9O A;  5DDG A;  1XSV A;  1YIO A;  1U5T C;  3V7S A;  3ABU A;  1Z91 A;  1W7P A;  3FF5 A;  3ZQ7 A;  4NB5 A;  2V1U A;  3FM3 A;  3F23 A;  2EFN A;  3GFJ A;  1IN8 A;  5HDG A;  3ISP A;  1GVJ A;  2IA2 A;  4U0Y A;  1PP7 U;  1XDS A;  1O3R A;  2DFI A;  2VOD A;  3KP6 A;  1RUO A;  4YFN F;  4UVA A;  4RAZ A;  2IPQ X;  4ZYH A;  5JHU A;  4HLY A;  1D8J A;  1QZY A;  1QGP A;  3HHG A;  3LFK A;  3T8R A;  3ZMT A;  3WGI A;  2X0L A;  4JK1 X;  1XGM A;  2G7H A;  4NHJ A;  1J5Y A;  4MGR A;  2JPB A;  2IJL A;  4EQQ A;  5LGN A;  4A2U A;  1YQA A;  4KN4 X;  1ZRD A;  1F1Z A;  4PDK A;  3K2Z A;  5TRD A;  1DPU A;  5K5O A;  3B73 A;  3E6D A;  2XGX A;  2DW4 A;  1AOY A;  5CLS A;  2IRF G;  4IRI A;  4IF4 A;  4WXC A;  3GFI A;  3L09 A;  1PP8 F;  1IN4 A;  1V4R A;  3O3K A;  4Y13 A;  1IW7 F;  3REO A;  2ZO4 A;  3MZH A;  2FF4 A;  2ZFW A;  2R3S A;  2DAO A;  1U2W A;  2VC1 A;  3WE2 A;  4CO8 A;  2MBF A;  3BJA A;  1LB2 A;  2Q2E A;  3QAH A;  3F6O A;  3BZ6 A;  1ODD A;  4EM0 B;  3CUQ A;  2D1H A;  2ZCW A;  3E6C C;  2HWV A;  4EJT A;  1ZAR A;  1FY7 A;  2GXB A;  2PG4 A;  1IXC A;  4KNY A;  1S7O A;  1HBX G;  2XAQ A;  3I4P A;  2LNB A;  4CIC A;  1IF1 A;  3WTV C;  2K4J A;  2OA4 A;  1TQP A;  4AIK A;  3P9K A;  3PQJ A;  2ISY A;  4LLN A;  2ESH A;  5E8I A;  2A07 F;  3SFZ A;  1OMI A;  3S2W A;  4WWC A;  1A04 A;  4ZH4 F;  1R5G A;  2MD5 A;  3EET A;  3BOQ A;  2FSW A;  1YW7 A;  2F2E A;  3NEU A;  2W24 A;  3GUD A;  3R60 A;  1IAW A;  1XCV A;  5L3C A;  1LNW A;  1ZRE A;  2P4W A;  4IJA A;  2PN6 A;  1BI1 A;  1HW1 A;  1B6A A;  2FNA A;  1P4A A;  2EV5 A;  4RAY A;  1USS A;  3V7C A;  3V7R A;  3J80 K;  3GVA A;  1OYI A;  2KJC A;  3DPL C;  5HVQ C;  4LD5 A;  2G9W A;  1ZAO A;  2H6C A;  4G6Q A;  3F72 A;  1U8R A;  4IHT A;  1KU2 A;  1FYK A;  2EA2 A;  3FX3 A;  2K4B A;  2RN7 A;  2DK8 A;  4G6D A;  1FSE A;  5FB2 A;  4OIO F;  2NS0 A;  2DT5 A;  4BHC A;  2MLK A;  5AIQ A;  1JHF A;  2XAS A;  3SZT A;  4A0Y A;  4RS8 A;  2M87 A;  1BIB A;  4G9Y A;  3E5X A;  3ZMD A;  1RIO H;  4UV8 A;  5IT9 Z;  3GYH X;  3LQR A;  3CO6 C;  3ULQ B;  3F8M A;  5ED4 A;  5EEG A;  3MFK A;  1FNN A;  2LDU A;  5FLX Z;  4MTD A;  5JI6 A;  2A61 A;  3WU0 A;  4PCQ A;  2F5F A;  2O3F A;  4P96 A;  5HS9 A;  4BXU A;  1IXS B;  1J0R A;  3V4G A;  4RB1 A;  4FHT A;  2FRH A;  3DP7 A;  5IT3 A;  2A6H F;  3K1N A;  1ZLK A;  3QPH A;  3FXR A;  4Y15 A;  1ZG1 A;  1Z9C A;  4GYI A;  1B59 A;  3P7N A;  2DTR A;  2P7C B;  3ZPL A;  5DYM A;  1YLF A;  1REP C;  2MH2 A;  3C18 A;  4XLN F;  4ZYD A;  1T6S A;  1BBY A;  1DPR A;  3NRV A;  3NQO A;  3TO7 A;  1MDM A;  4KYW A;  4HX4 A;  5JR3 A;  3HTU A;  1RZ4 A;  5FFX A;  2XRO A;  2IA0 A;  3IC7 A;  5D8K B;  2JSC A;  4M9X A;  2XVC A;  4U7D A;  3BJ6 A;  2VOP A;  4ZZD A;  4RGX A;  4HLX A;  4H0E A;  3ZMU A;  3T0Y A;  3J81 Z;  1HKQ A;  1XDU A;  2H27 A;  1G3T A;  4AIH A;  2Q0O A;  5BPI A;  1BJA A;  2QQB A;  2X4H A;  1H9T A;  5ERI A;  1QO0 D;  2M30 A;  4HW0 A;  3PQK A;  2VN2 A;  4I09 A;  2QEN A;  4EJV A;  2EFQ A;  4LFU A;  5FGM A;  1YO5 C;  2GWR A;  2F5C A;  1IXR C;  1Q1H A;  2KKO A;  2XAJ A;  2H09 A;  1J7K A;  1UHM A;  3RI4 A;  4KN7 X;  2HDC A;  4HF0 A;  1ZHF A;  2CYY A;  3B02 A;  1HSJ A;  4OOI A;  1HKT A;  4CGZ A;  3TDU C;  2K86 A;  3QPT A;  3F8C A;  3IL2 A;  4I7H A;  1F9N A;  2MC3 A;  3RIR A;  4EJO A;  4M72 A;  5E20 A;  3RYP A;  4A5M A;  1MJB A;  1IUY A;  3CO7 C;  3KET A;  4WX9 A;  5JFR A;  1GHC A;  1I27 A;  4LB5 A;  3FXQ A;  3C1D A;  4R8H A;  5H20 A;  2EK5 A;  3E6M A;  3CTA A;  2AXL A;  1I1S A;  2LKP A;  1K79 A;  2RVC A;  2DQR A;  1TNT A;  2FMY A;  3OV8 A;  2J5O A;  1ZN2 A;  1AWC A;  3OOP A;  5D5V B;  2K27 A;  2ZME B;  1FPQ A;  4HA8 A;  2YR2 A;  2ELH A;  4WXD A;  3JAM Z;  3ZMS A;  1XN7 A;  2HKO A;  5D8L B;  1IN6 A;  4UHT A;  3KZY A;  2NNN A;  1G4D A;  3BPV A;  2YX4 A;  3HHH A;  2EJR A;  2XAH A;  3I64 A;  2VON A;  4CXF A;  1K6O A;  3LA3 A;  2PQ8 A;  2DI3 A;  1IRF A;  2STT A;  2IT0 A;  1E17 A;  4LLL A;  5DUI A;  5LEK A;  4O6J A;  3ROU A;  2ZME A;  1B4A A;  4YFK F;  3KCC A;  5HDK A;  3VB2 A;  1HQC A;  3TQN A;  4XLP F;  1D5V A;  1Z6R A;  1J59 A;  3HIF A;  2O8X A;  4L18 B;  4KT5 C;  3JTG A;  2KIF A;  2QUF A;  4L0Y B;  3K9T A;  2L02 A;  4G8X A;  2XAG A;  2D1V A;  5FFZ A;  4ESJ A;  4OMZ A;  1ZLJ A;  2FNP A;  3WOD F;  2Y75 A;  3RKW A;  2HR3 A;  2P5V A;  4EM1 A;  3QP5 A;  4U88 A;  4HQM A;  1TQI A;  3F21 A;  2CO5 A;  1G3S A;  4IRG A;  3GWZ A;  1O3S A;  1XMA A;  2Y0M A;  2JT1 A;  3E5Q A;  2OZU A;  2XRN A;  4L9T A;  4FX4 A;  1O57 A;  3V8J A;  5A2Q K;  2LSO A;  3KP5 A;  3H3U A;  1FYL A;  4HYE A;  2B0L A;  5DEQ A;  1H0M A;  1KYZ A;  2DO7 A;  2VE9 A;  4Q47 A;  5E8G A;  3ZMV A;  1BIA A;  2P5L C;  3D5L A;  3IRQ A;  3SZP A;  3M9A A;  3HRT A;  2QBY A;  4NQW A;  5ICG A;  2PEX A;  1S6L A;  4LB6 B;  3L2C A;  3CUQ B;  4Q4Z F;  3VOD A;  4U0V A;  1MD0 A;  5BPD A;  1JE8 A;  1LDK B;  2PFB A;  4MNU A;  3ECH A;  3DF8 A;  1HW2 A;  1U6G A;  3SQN A;  4S04 A;  1PUE E;  4LGW A;  1ZGA A;  4BAY A;  3ZP5 A;  3MZY A;  4B8X A;  2FBH A;  2PMH A;  2XKO A;  2HTS A;  4I0A A;  1YW9 A;  5D4R A;  1W5T A;  1KU3 A;  1KU9 A;  3W6K B;  3I58 A;  2Q8K A;  2ZNZ A;  3KP2 A;  4FT8 A;  4GXO A;  5D6E A;  1MJ9 A;  1S7A A;  1PDN C;  2O03 A;  4Q5S F;  5L3G A;  4EGY A;  5LEJ A;  4L9N A;  2E1C A;  2RC4 A;  2DPD A;  3WG9 A;  3VOE A;  2JTV A;  3L00 A;  4M9S A;  2VBW A;  2HYF A;  2RV8 A;  2CG4 A;  2ZJ2 A;  2P8T A;  2V1D A;  1LVA A;  1YYV A;  3M1E A;  4RB3 C;  3GX4 X;  4I2O A;  1ULY A;  4ZYE A;  4XBF A;  2RKH A;  1LQ1 A;  3IRR A;  1BM9 A;  3WTX C;  3LAJ A;  2NRA C;  1SFE A;  4XSX F;  2OQR A;  2BEO A;  4UVB A;  5J8C A;  5L3F A;  3RTR A;  1MGT A;  3KLN A;  3E5U A;  3GW2 A;  4FX0 A;  3L9F A;  2EV6 A;  3DFG A;  4E70 A;  5CJ9 A;  3AAF A;  3WTU C;  2JRT A;  1TQM A;  2VBY A;  4BHB A;  1BC8 C;  3N97 A;  2W25 A;  2P7V B;  4AVP A;  2XKP A;  5HLH A;  4I01 A;  5E17 F;  1T38 A;  3P9I A;  2PLY A;  1YTY A;  2P6S A;  2V79 A;  4LMY A;  3TO6 A;  4QLC U;  4MEX F;  3ZN0 A;  4LK0 F;  4N9I A;  3R4K A;  4CZZ A;  3HSE A;  2OBP A;  2UXN A;  3JSO A;  4LG0 B;  4EJU A;  1EV7 A;  1SMT A;  3M8F A;  1ZYR F;  2A3S A;  3FMS A;  5J6X A;  4ENK A;  1J75 A;  1G6N A;  3JW4 A;  1FYM A;  2V9V A;  3WE3 A;  4IRH A;  4BYY A;  4AIJ A;  2VE8 A;  3WTW C;  2A68 F;  2HEO A;  2OQG A;  4CHU A;  4A6D A;  5LHI A;  1JHH A;  2R7D A;  2A6E F;  1FP1 D;  3JSP A;  5DV5 A;  5E1W A;  1BN5 A;  4M6Y A;  3J80 Z;  1RNL A;  3GFM A;  4GGG A;  1MDM B;  1TW3 A;  4KUM A;  1I1G A;  5ICE A;  2PI0 A;  4LG0 A;  5ILU A;  4PZJ A;  2YSR A;  4XSZ F;  5HOO A;  1E2X A;  2H6B A;  3TDZ C;  3HOT A;  3M8E A;  4ENN A;  2ESN A;  4XRF A;  3IHU A;  2NNY A;  4OMY A;  3J81 K;  4Z2Y A;  2XIG A;  3LWF A;  2FOK A;  4GO1 A;  4U7B A;  3LST A;  1O3Q A;  3QOP A;  4HAM A;  2L54 A;  2D2W A;  5F6F A;  1XGO A;  2GIV A;  3ZMZ A;  2FE3 A;  3Q9S A;  2BYV E;  5HS7 A;  4KDP A;  3BRO A;  3LAP A;  4KA4 A;  2W57 A;  4ON0 A;  2XUB A;  2EFP A;  3HUG A;  2R7F A;  2EWN A;  4LK1 F;  1D3Y A;  2Z3Y A;  2L4M A;  3L7W A;  3ECO A;  4RB2 C;  4G7Z F;  3U9G A;  1P6R A;  4EM2 A;  3BPX A;  4QWQ A;  4WF2 A;  2OD5 A;  2Y48 A;  4AWX B;  3BP8 A;  1WI9 A;  3HRM A;  4GYG A;  3RPU A;  3RDI A;  3FMR A;  3BJO A;  3U1D A;  1QBJ A;  2HFH A;  2KJB A;  1W4M A;  3DEU A;  3IWF A;  4U0W A;  4IPA A;  3PFI A;  1K7A A;  1WSU A;  3F8N A;  3FXU A;  3WU1 B;  4RGU A;  2E7X A;  2FQ3 A;  1F4K A;  3KP7 A;  3BY6 A;  3CJN A;  1ZG3 A;  4MQV A;  4I0B A;  3K69 A;  2ZBK A;  6PAX A;  2KRF A;  2IVM A;  2BGC A;  4A0X A;  4ENM A;  1XGS A;  1KGS A;  5D6F A;  4HF2 A;  3E97 A;  2GA1 A;  1HW5 A;  1FT9 A;  3WTZ A;  2YX7 A;  4KMU X;  3I71 A;  1C0W A;  4M71 A;  1R36 A;  4A0Z A;  1ZRC A;  2F5E A;  3T8T A;  2C6Y A;  3QRF F;  1IN5 A;  2ADU A;  4UNO A;  1XSD A;  4BH9 A;  3ELK A;  1TTY A;  4R79 A;  3K1P A;  2RDP A;  2M1B A;  5DD4 A;  3JAM K;  2WTE A;  5K5R A;  1KA8 A;  4OIP F;  3O2P E;  1FLI A;  1W7P D;  5ICF A;  2KIU A;  3CDH A;  1RI7 A;  4IXA A;  4PGG A;  5E18 F;  4UXN A;  5KK1 A;  5BS6 A;  4IHS A;  2CQK A;  4HQE A;  1T39 A;  3R0J A;  2H94 A;  1HXD A;  1B9N A;  2PJP A;  4LLG F;  4DNC A;  1J9I A;  1LEA A;  3T1B A;  5HLG A;  3K0L A;  1Z6T A;  4ESB A;  2FBK A;  1R22 A;  2G7U A;  1IRG A;  2DQL A;  1CF7 B;  2LF8 A;  3F3X A;  2COM A;  1SFU A;  1H9G A;  3Q9V A;  2FU4 A;  5CYV A;  3KZZ A;  1ON2 A;  4CDG A;  1R5H A;  3P9C A;  1KQ8 A;  2QVO A;  3IKV A;  4MTE A;  5DCF A;  3EYI A;  4F7Z A;  3C7J A;  1ZGJ A;  2MH9 A;  3QP6 A;  4RB0 A;  3HRU A;  1OYW A;  4EGZ A;  2QYO A;  1D8K A;  4HBL A;  4G94 A;  2UZK A;  4EJW A;  3O6B B;  2VC0 A;  3LA7 A;  4BHP A;  5LGT A;  2M45 A;  2IA1 A;  5H6Q A;  1QZZ A;  2Z5U A;  2Z99 A;  1YW8 A;  2HQR A;  1CF7 A;  2DPU A;  1P92 A;  3EDP A;  5F1R A;  2EFO A;  2ETH A;  1U5T B;  1O3T A;  1ZRF A;  4YII A;  3QU6 A;  4OU0 A;  2FXA A;  3H3Z A;  2RQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...